2WAQF

The complete structure of the archaeal 13-subunit dna-directed rna polymerase
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
90
structure length
90
Chain Sequence
SVYIVEEHYIPYSVAKKLLSDVIKSGSSSNLLQRTYDYLNSVEKCDAESAQKVVEELSSIISREDVRAVLASICPITPDEVRSILIMDSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Evolution of complex RNA polymerases: the complete archaeal RNA polymerase structure.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE RPO1N SUBUNIT
total genus 13
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2009-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF03874 RNA_pol_Rpb4 RNA polymerase Rpb4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.820 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2waqF02
2WAQF 2WB1F 4AYBF 2PMZF 3HKZF 2Y0SF
chains in the Genus database with same CATH superfamily
1K1SA 2R8KA 4IRDA 5J2JA 3F5EA 5ALTA 5ALDA 2JGAA 4NL9C 4ZOHC 1PK1B 2R8GA 3M6KA 1FFVA 4KX3A 4EBCA 3H0LB 2OWOA 2LYBA 1C7YA 5ALKA 4KLEA 1S10A 3M9OB 2YMLA 4EX7A 3K1ZA 4I2BA 2Y0SC 2B21A 2HHQA 3NS1A 3MGIA 3GV8B 1HEKA 3QUQA 4UATA 3SQIA 2E5SA 5DG8A 4RU9A 1ZQLA 3MABA 3C21A 2NRZA 2VIXA 4QWAA 3UQ0A 1JIHA 4J9PA 2EDUA 3N7RC 5B66U 8ICTA 3PR4A 2ASDA 1L6NA 9ICGA 4DFPA 4U6PA 1HJPA 2RHFA 4CGZA 1QSLA 3RH6A 3GZFA 2EZZA 4KLOA 4JB3A 4QW8A 5KFZA 2YTUA 4RNNA 4GC7A 5JTIA 5DLFA 2K60A 1ZQKA 1Q8KA 4FZMA 2YB1A 8ICQA 4MFAA 5CB1A 3FM9A 5AK3A 2H3QA 4QNLA 3I28A 1RPLA 4Y2XA 3NVWA 8ICIA 1SZHA 1U9LA 1ZD5A 3QUCA 1ZQAA 1RYUA 4E0DA 1XO1A 3D2NA 4C8NA 3BQTA 3NASA 4DS5A 2HOIA 3TANA 2Y9TA 4U7CA 1ZQUA 2WF9A 4ED2A 5KFVA 3V6KA 4RQ0A 3AQEA 4B9LA 3ZDBA 5KT2A 4F8RA 1SL2A 4JV0A 4TUPA 4PGYA 1Z00A 4ED3A 9ICFA 5C5JA 4M9LA 3AUOA 3RB0A 4QZAA 4EZ6A 2W9MA 4ECUA 2VA3A 1EXNA 2IA6A 4QZIA 2KMDA 7ICSA 4QW9A 3E2EA 4O3RA 3GU3A 2MAXA 2W03A 1SWWA 5KFMA 3LVVA 1SWVA 1ZQQA 2AXTU 3RJEA 2IOFK 2P6UA 4KLSA 1DGSA 4CCHA 1TAQA 4NY8A 4KN4A 1SIJA 5AKIA 3B0YA 5ALYA 5A0LA 1DRGA 5J8YA 3TFRA 4O0IA 4P0QB 2K89A 3G6YA 1ZQIA 5KTQA 2I5HA 2CXYA 2WB1F 4G9BA 7ICUA 2FE9A 3GILA 1QQ6A 3N4MB 3HRDD 3TARA 3OHBA 4ELTA 2G5HB 2NRVA 2AGPA 3M9MB 2XICA 3Q8QB 1AQ6A 8ICGA 2BR0A 3C5GA 3LWMA 1N61A 1D9FA 3ETRA 4O3MA 3PX6A 1Z19A 5J0SA 4FBTA 1UT5A 4KLDA 1KFTA 5ALLA 4NLNA 2QB1A 3HW8A 9ICQA 5AK5A 5DLGA 9ICPA 5DB8A 4RQ5A 3IDWA 4M0AA 1F5SA 4MF8A 1ZD4A 1S0MA 3MGHA 2F1JA 2LPEA 2DFLA 3BQ1A 1UCVA 2ZTDA 1JN3A 2KZZA 4J9LA 5HMLA 1VDVA 4KX5A 1Y88A 1BVSA 3C29A 2V4RA 3UQ2A 2W9CA 1X66A 5DB7A 2GLEA 2OXOA 3C28A 3WK4A 2ZTCA 5G5GA 2EZXA 3H8JA 2ZUDA 2A1AA 7ICIA 5JRTA 4KMUA 1HUZA 4B9NA 1XNSA 2ZIUB 1JRPA 3AMZA 4ED0A 2C2EA 2UVUA 4DL2A 2XIDA 4I28A 3UMCA 5ALGA 3ZDDA 1U48A 5D49A 3T5LA 1L7MA 2MSNA 4QZCA 7ICRA 3QZ8A 3C1ZA 2KKVA 4RUCA 7ICGA 9ICOA 4CRXA 2ZTEA 3PNCA 5KG7A 3GDXA 3TI0A 3H8MA 1IXRA 2ISPA 1S76D 1X9XA 5H2FU 1AROP 1PVPA 2V9WA 4Y2YA 3OJUA 3THVA 1OXJA 1NZPA 2KJ9A 4F4WA 2A3VA 4P2HA 4Y2SA 3AM9A 4RUAA 1T94A 2VJ4A 2F1HA 5J2KA 2HBLA 5KFCA 4FS2A 1NKEA 1X2IA 2DKZA 4J9SA 3MGVA 3CYMA 4YR3A 3L3FX 3J81j 3PMLA 4EZ9A 3FC4A 5ALPA 3MBYA 1ZJNA 4DEZA 2NRXA 3GIMA 1SV4A 3GV7B 3TAPA 1D8YA 3D2QA 1YT3A 2K4HA 2W9AA 3KBBA 4RQ2A 1U49A 1Z00B 1KKXA 5KG5A 1ZETA 2EZYA 3BZKA 5K4LA 4DOBA 8ICLA 3TACB 1ED1A 2AHOB 5CRXA 2D3DA 4DSIA 4PGXA 5KG6A 3M6ZA 2KJ5A 1SKSA 3DEEA 4M6WB 5D4BA 3QZ7A 9ICIA 1X40A 4KLFA 5KFKA 2NO5A 4O9MA 8ICJA 5ALXA 1XSNA 4ECWA 2EAOA 3H8SA 4Q45A 5KT5A 3KHLA 2Q4TA 3LYSA 4P4PA 5HNKA 4ACOA 3RBEA 4OJOA 2LM4A 5AM3A 4F4YA 3QYPA 4KLQA 1NKCA 3LK9A 2FI1A 1PVQA 7ICJA 5KG3A 9ICRA 3UXNA 5EE9A 8ICZA 5J2DA 4RPYA 3M9NB 5TZVA 4DL6A 4BXOA 3OSPA 3F53A 5AHXA 4UBBA 4FE3A 1H38A 2Y1IA 3JPQA 3OHAA 1KFSA 1UQVA 4YQWA 4TURA 2J6UA 5ALIA 1ZQBA 5IILA 3AL0B 1X6JA 4X5VA 4JV2A 3UPQA 1SV0C 5KFSA 5ALEA 4Y2PA 3V7JA 1V38A 2JEFA 1NJZA 4M9GA 2OM6A 3KD3A 2ALZA 1RZTA 4TUQA 3QUTA 4OJPA 5KFLA 5KT7A 2WAQF 4R66A 1YZ7A 1MQ3A 4US9A 5IIIA 4YFKA 5ALOA 4UB8U 3IG8A 4GXJA 5HMMA 9ICSA 3HJEA 2W55A 2F77X 3HX0A 2EH9A 2HHVA 5DQGA 3TFSA 3KKAA 5J8YC 5ALSA 5F9LA 2H5XA 2PMZC 2ASJA 3RTVA 3SD7A 2L5YA 2H3ZA 3UXOA 3I76A 4I2AA 2JRZA 2M0NA 3BJYA 2IOFA 2AGOA 5J0TA 2K4PA 1S5LU 1A0PA 1Q3UA 2RP5A 5IIJA 1ZQSA 2IOHA 8ICKA 3SV4A 3L5KA 3V72A 8ICWA 2ZIVB 2UVWA 1BGXT 2HW3A 2IMWP 2MRLA 1CUKA 4P0PB 3ZD9A 3PSIA 4AP9A 2HSZA 4DQRA 4YD2A 4KLUA 1HIWA 2DGZA 4DS4A 4OD0A 1ZQFA 3NTUA 4BDPA 4PJ0U 4Y2JA 4KN7A 3V7KA 2AQ0A 3RAQA 5KL1B 2I1QA 1C20A 5J0WA 2PXIA 3K1RB 1ZQMA 4PGQA 4YD1A 1SB3C 1O08A 1TV9A 3QXGA 1ZJMA 1BPBA 5JUMA 4QIWC 3SEIA 2YMQA 1UA1A 2MA1A 5J2BA 3WK7A 4FS1A 3PW7A 2W04A 5AM0A 1ZQGA 1ZD3A 2KFZA 3GFKB 4RT2A 2XY7A 3T3FA 5AM1A 3QX7A 3SAHA 2FPMA 2R8HA 2BKEA 2E1FA 2QB0A 5AK4A 3QEAZ 1FIQA 5AM5A 2IBKA 3C2KA 4PL2A 2F8LA 2LKYA 4IQTA 3KHHA 1XSLA 1SL0A 4BWJA 1KDHA 3FDSA 5J29A 2ZIXB 5KFJA 2WF5A 2CPRA 4EBDA 2OCEA 2K8BB 2BQ3A 4ECZA 4ED6A 2BCUA 1QSYA 2AU0A 1L7NA 1NJYA 2JR5A 4DWIA 1U4BA 4QZFA 4YMNA 1BPXA 4YCXA 1D8BA 5TISU 2KFNA 4I2GA 5KFIA 8ICOA 1MC8A 4NL9A 4C8OA 8ICBA 4RQ3A 2QARA 1ZYQA 4ECYA 2B6GA 4C4TA 1KFDA 2PMZF 3H7IA 3IP4B 4XQ8A 3T5JA 4KLJA 4XRHA 8ICSA 5KFUA 1Q46A 4UB6U 3ETLA 5HHHA 2YB4A 5ALJA 4ICAA 1QTMA 4DL3A 3A0HU 1L3VA 2ZJ8A 5J0OA 4RQ4A 3RR7A 4Z6EA 1XS9D 5J0RA 3OJSA 2HOQA 3CW2C 2BPCA 5AI9A 1UA0A 4R63A 3NRWA 2HHWA 3VCBA 9ICHA 2FPLA 3B0XA 3F2CA 3SI8A 5KFYA 2BCRA 3SMVA 9ICNA 3WK6A 2O6KA 1PK3A 4ECRA 3JPNA 5L9XA 3QU5A 1QLNA 4QWDA 7ICLA 2HHTA 5CWRA 1ZQCA 3JPOA 3PW5A 4IQWA 3WK8A 4DSEA 1SKWA 5GTHU 1COKA 2DQNB 2E8MA 2XI9A 3CRXA 2G08A 2WF8A 1QQ7A 5AI8A 4F4XA 1VLBA 1TFRA 1DGJA 5HP4A 3RH4A 4J9RA 3GV5B 8ICEA 1ZQJA 3EPGA 2P66A 4UAWA 3RH5A 4PHDA 1K1QA 1NNLA 4LJXA 4CNQA 1BPZA 3SV3A 2A19A 2ISOA 5J2HA 3NGDA 2K4IA 1NJWA 4NV0A 4I2DA 4QZGA 3DV9A 2EANA 5AI4A 3WKDA 3G6VA 3V6HA 5G5HA 5KG4A 3KOOA 4M04A 3ZD8A 4EEKA 5AKJA 4YVZA 2E8PA 2FLLA 4R8UA 1A76A 4F4ZA 4F2RA 3NUQA 3PX0A 4DL5A 4OJ5A 4BWMA 3KFUF 1CEZA 4QZEA 4B9VA 5AKHA 1ZQXA 2DWQA 2FJ6A 1X9WA 5B5EU 3MC1A 3C1YA 1MQ2A 1URJA 4YG2A 1L3SA 1KW4A 1D8LA 3ED5A 1BNPA 1LB2B 1RYSA 3ORYA 3ISBA 3I1YA 2KSOA 4IQVA 3WKEA 3H0RB 5EWGA 3EWAA 4KITB 4DLGA 1CRXA 2WF7A 3NVZA 5KG1A 4YP3A 2E8OA 1TK5A 2F44A 5ALMA 2F3NA 3BQ7A 1LVHA 4PHPA 1SXEA 2W8KA 2ES6A 4JV1A 1X9SA 2FDRA 4P4MA 3Q8SB 4DLEA 4Q44A 8ICCA 3RAXA 4I2CA 5L1JA 1N5XA 3N97B 4EYIB 5ALWA 4I2HA 1WWVA 3VC8A 4RQ6A 4C7YA 1QH9A 4RNOA 1SGGA 3E0FA 4DSJA 1JALA 2VA2A 3SENA 2JV3A 4IR1A 1J2MA 2XGPA 2KZMA 4I2FA 3BZCA 4O5EA 4EX6A 4KLGA 5IINA 2BHNA 1ZQPA 1TKDA 5J2IA 4Q8EA 3UMGA 4DQPA 5DGAA 2KZ3A 2WB1C 3WK9A 3MDAA 4QZDA 3F5AA 4UAVA 1K5OA 5AM2A 4IS7A 3CNHA 4O3QA 2UVVA 2ZIUA 2KNJA 3WK5A 4B9MA 1WG8A 4PHAA 5C0YA 4TQSA 1ZQTA 1NJXA 4YN4A 2NO4A 4ED7A 3NRZA 1XC9A 3Q8KA 1V9PA 3BDPA 3Q8PB 4K4GA 5IIOA 3HKZF 4DFDA 2ZXIA 4KLTA 4HAIA 4KMOB 3C5FA 5ALVA 5DG9A 4DQIA 2DKXA 4R64A 5L1LA 5AIBA 7ICPA 5DDYA 5KFTA 1ZQ1C 3RBDA 2BGWA 4UB3A 2KTQA 2Y1JA 3GIKA 2NV3A 4WJ3B 2KHVA 4R65A 8ICAA 5EWFA 3H40A 2W7OA 1U45A 9ICTA 3IRUA 1RQNA 4Z6DA 2G5IB 3V7LA 3QEBZ 3K75D 2JH1A 2W8LA 2PFQA 4DL4A 1ECWA 1Z4NA 2PFPA 3MFIA 2I6XA 1F0MA 3TADA 4F92B 3KZXA 4M2YA 2H3IA 2QB0B 2V4QA 4J9MA 4Q8FA 1DK2A 4DSKA 5GTIU 2NYVA 5J0QA 4BJQA 1LKYA 1KN5A 3UXPA 3PW0A 5KNIA 2K4EA 2HHUA 2C2DA 2CRXA 3HPOA 4FZNA 4DQQA 5IIKA 4F5NA 2C28A 3M8RA 4GIBA 2ESEA 5CA7A 4Z6CA 2BPFA 1KRPA 4MHVA 4FZLA 1RQLA 3A0BU 4DSLA 1ZQZA 3QU2A 4RT3A 1QQ5A 2HVHA 2KD1A 2Q0ZX 9ICKA 4DOCA 2GWSA 4RQMA 2ZJ5A 4USAA 2XC9A 1PK1A 3O0FA 2LYHA 3FAHA 3ISCA 4JK1A 5CJ7A 5J2FA 5KT4A 2GOLA 2AGQA 2KVSA 1IV8A 2DBYA 2C22A 5ALZA 4ECSA 3RJJA 1Z4OA 5KFOA 1F44A 5DKWA 1XWLA 1ZQHA 3BQ2A 1ZQRA 2LHTA 4C4SA 4I27A 1JMSA 3Q8MA 2J6TA 8ICPA 2E8NA 3F2DA 2LM1A 7ICQA 3PZPA 2YN4A 9ICEA 4DQSA 4MEYA 1FFUA 3LWLA 1HUOA 3K4GA 1M6YA 5KFAA 3JPPA 4UB5A 2RRDA 3M8SA 2ZUCA 3BS5A 1J97A 2R8IA 1V85A 2NRTA 2KICA 4Y2QA 3N28A 3BS5B 3QE9Y 5J2AA 4UAYA 2ATLA 5CP2A 4QZ8A 3EYZA 3HKZC 4O3PA 3UM9A 5BOMA 4IRCA 4P4OA 2HBKA 1GO3F 3IG5A 4I2IA 5CHGA 4RZRA 4UARA 1SKRA 2HHSA 1JI7A 1OW5A 2QKQA 5KFHA 4YMOA 3HT3A 5KFGA 5EWEA 1Q3VA 4LVSA 5DG7A 9ICMA 4IRKA 1TK8A 2VA8A 3KZIU 1B22A 1KEJA 2XY5A 3PSPA 4UASA 4ELUA 2Y9UA 3MDCA 2RDIA 4KLIA 3C2LA 1NK8A 1Z3EB 4DO9A 4CDGA 3AQFA 3MR2A 2FLNA 4M9NA 3OSNA 5KAIU 3ONNA 4QWBA 2FMPA 3ICXA 3HP6A 2JHDA 2W3SA 4F71A 1XSPA 9ICAA 4NM2A 5KT3A 3SZ2A 5AI6A 1B4FA 5AK6A 4GLXA 1N2XA 1NK0A 1TE2A 1A6SA 3LVWA 2R18A 4F72A 1SV0A 4OCZA 3RJHA 5F9NA 4QWEA 4K4HA 2BDPA 3NVVA 3LDAA 4M6WA 3ZDCA 4F91B 2KJ8A 1VJ5A 5KG0A 2JH7A 3GIJA 1DOQA 2KIWA 4F2SA 4MEXA 4ECVA 1S77D 3PSFA 3TQ1A 3JPSA 2YQEA 2P35A 2F76X 4RPXA 4F5PA 2G07A 7ICMA 3Q8RB 1XO0A 4TUSA 1JXEA 5ALNA 3T5KA 4IQUA 2HDOA 2LI6A 5FP0A 5ALQA 2YY6A 2E3TA 3SAGA 1RYRA 4KTQA 3IN5A 4K4IA 5AKEA 5KFBA 5L1KA 1Z1BA 5HR6A 2J6SA 3AU6A 4NLZA 4NJ8A 3ZDEA 2BZFA 5AICA 3WKBA 1MA7A 2PKEA 1QCKA 3U26A 1ZQVA 5ALFA 1IG6A 1WWUA 1L7PA 1S8OA 4B9TA 4IC9A 5J0XA 3KKAC 1S9FA 2BCQA 3DDHA 3PW2A 4ED8A 2ZUBA 4DF8A 5D46A 5AI0A 1PVRA 4DOAA 3JPTA 5AKGA 4DL7A 2OH2A 3QU4A 3G6XA 2UVRA 4Y2UA 3BS7A 4LZDA 2VANA 2HBMA 5KFQA 2W9BB 1NK5A 3PSTA 3KHRA 4FBUA 1A77A 1BNOA 4Z6FA 4DCCA 3RJIA 1UHUA 3V6JA 2G09A 2Y0SF 4NLKA 3M7DA 5J0PA 3RRGA 4DF4A 5EOZA 1TK0A 4AYBC 1L3UA 2PFNA 5AKKA 4B6JA 3OPXA 3MR3A 4CF5A 3OGUA 2PI5A 4YMMA 5DB9A 4PL1A 3F2BA 2KIVA 2JEIA 3WKAA 2XCPA 3PVXA 2DF4B 2F2AB 4P0QA 1WCNA 4JUZA 9ICJA 4UBCA 1ZRMA 4EYHB 4DFJA 1Z1VA 4C0ZA 4JWMA 5AKZA 2FPKA 4CF3A 2K8AA 3ZI4A 5J2EA 1ZQEA 5IIMA 8ICMA 2B0CA 2BQUA 3H0MB 4O3OA 3D2SA 1N56A 2YMPA 1YZ6A 5ALUA 4DFKA 1NZBA 2E1EA 2ODGA 1DK3A 2GH1A 3IV6A 1IIPA 1WCLA 1WYGA 5EE0A 4US8A 1RDFA 2ZIWB 2A1JB 5HHIA 3QUBA 4RQNA 5KFFA 2WAQC 3IM1A 1J2NA 4F5QA 3FYHA 2BCSA 3AEVA 1NK7A 2BQRA 8ICRA 3PV8A 2XGQA 5AI5A 1U47A 3QNMA 2ASLA 4C8KA 3HWTA 2YMMA 1UT8A 4CF4A 4ELVA 3H4DA 2JEGA 3HILA 3C2MA 1L3TA 2ZIXA 4OJ6A 2KEYA 5BPCA 5KAFU 3T5HA 2ZG6A 4NWIA 2HHXA 4QZHA 4EEYA 4QIWF 1NKBA 3MFHA 5KT6A 2DL0A 2WF6A 1NK4A 3RJGA 3TKAA 1ZOLA 3EPIA 4GC6A 4UAUA 1V97A 1ZQDA 4F3OA 5J0UA 1TAMA 1RXVA 3PO4A 1L8OA 1X9MA 4Y2TA 4NLCA 5KFPA 2D6FC 5KFRA 2DUYA 4BUGA 2LMRA 4PPXA 2N1RA 3RJFA 5CR0A 3PW4A 1L5UA 4OO1J 5AM4A 3TADC 2OEHA 4ED1A 3PMNA 2C2RA 4ECXA 2GO7A 2RQ5A 4PHEA 4O3NA 1JXLA 5DBBA 3D6JA 2G0AA 4PH5A 4EENA 1NK9A 1P7DA 5J0YA 4IR9A 5DGBA 1TAUA 2PFOA 4UAZA 2XCAA 1WUDA 2H3VA 5DBCA 2HOFA 9ICXA 9ICCA 1T3NA 1PZNA 2W43A 3RFAA 2W7PA 3ISDA 2BCVA 2JZBB 2F1IA 5DQHA 4UQGA 1PUZA 5L1IA 3IHQB 2CN1A 2XO7A 7ICEA 1N63A 4C8MA 1ZQOA 1KLNA 4PZOA 3H8WA 5F3XB 1T4GA 2HBJA 4BX9C 2KK0A 2ZIVA 3RRHA 3ZDAA 1CI4A 3NVYA 2JZBA 1N5WA 2RDJA 2ZJAA 2BDUA 4KLLA 4NLBA 4ECTA 2M9NA 4YR2A 1S0NA 2ZXHA 1TVAA 2JEJA 4ECQA 7ICFA 1FEZA 2OYYA 1N48A 2LBOA 3AU2A 3JPRA 4J9OA 2YX8A 4FO6A 2I9GA 3ALRA 1COOA 2HCFA 1FO4A 2KOBA 2WFAA 3SYZA 1XU4A 1IM4A 2PI4A 1O03A 3WKCA 5DB6A 4YXJA 2D8CA 2JMGA 1RG6A 2F8KA 3Q8LA 1X6IA 3PR5B 9ICUA 3RJKA 2BPGA 4JWNA 4O5KA 4R8UB 4F93B 1RM6C 1B0XA 4B9UA 1JROA 3PO5A 3CP8A 4C4RA 4F5OA 2LYAA 4QZ9A 5EE1A 1BPEA 2XY6A 4DSFA 4XA5A 7ICVA 2W9BA 2RLTA 2VJ5A 4I2EA 4TQRA 3N7SC 9ICBA 2MU2A 3BQ0A 5DDMA 4CE6A 4RPZA 3EZ5A 1T3QA 1JX4A 3H4BA 7ICNA 4UW9A 2AQ4A 5JU5A 2MUTA 1LV5A 1BPDA 5KFDA 4KLMA 2VKQA 4F50A 2A1JA 4F5RA 3RB6A 5KL8B 1B43A 2Z7JA 3L4PA 2EQYA 1MN8A 1KL9A 2IHNA 4YR0A 3M1YA 7ICOA 1SXDA 3SR6A 4C7ZA 3QU7A 2HVIA 1ZD2P 4KLHA 5KFEA 2R8JA 1MSWD 4O3SA 1NK6A 8ICYA 2FMSA 4HYKA 3GQCA 9ICVA 8ICHA 4RQ8A 5T14A 1NOMA 4UB2A 1X42A 9ICWA 5E79U 3RF9A 4J9KA 1S0OA 1BPYA 1LKYB 1KTQA 1L8LA 4OJLA 2KE7A 4GFJA 2FLPA 4ZH4A 5HR7A 3QU9A 4QZBA 2QARB 2EAPA 3AN1A 2IHMA 5KFWA 4MFFA 4GXIA 3TAQA 4RNMA 3R9KA 4JMUA 1S97A 3E58A 4UB1A 1OUQA 2KVCA 4QWCA 2W11A 2AH5A 2KP7A 3N7PD 1KBUA 5KFNA 2WHEA 1UPHA 1S0VA 4Y2VA 2HI0A 5KFXA 4AYBF 3MR6A 2KKPA 2H3FA 4O5CA 4BGDA 5AKLA 4P0PA 3RB3A 2W54A 1N62A 9ICLA 4Q43A 1RXWA 5KG2A 4J9NA 2W3RA 1ZXIA 2HMXA 3RR8A 8ICNA 4NLGA 7ICKA 5BOLA 1L7OA 4RQ7A 8ICVA 4NXZA 3OTQA 5AKYA 3T79A 2K8CB 5J2CA 2KSOB 5AKXA 4QJFB 2MUTB 7ICHA 2DPJA 2XVTA 5ALRA 5J2GA 1NI3A 1KQQA 5L1MA 5CEHA 7ICTA 1KSPA 3PY8A 4J03A 2KV2A 4YXMA 8ICFA 2OHFA 4M9JA 1ZQWA 1T8EA 4NM1A 5AIAA 2DPIA 4LZGA 1QSSA 1D9DA 1ZRNA 3RB4A 4FFDA 3SAFA 2EAMA 2KG5A 1SZPA 4IL6U 5DBAA 1N60A 2KN7A 3GIIA 8ICUA 4RQ1A 4M47A 4M9HA 2NRWA 4MF2A 2KHQA 4A8EA 3C23A 4GXKA 4G3IA 4J9QA 2QLTA 3B9JA 1T7PA 4EBEA 3S6JA 5DQIA 2WTFA 4BXOB 2ZIWA 4B9SA 3PX4A 3KTQA 1ZQYA 4I2JA 4XUSA 4C80A 4MFCA 1ZQNA 3MR5A 3EW9A 3EUB2 5EE3A 1DXSA 3WU2U 4I29A 2P6RA 3KHGA 2FMQA 5ALHA 2W9CB 4UB4A 4C8LA 4EELA 2AJQA 1JUDA 4DFMA 4F4KA 1SL1A 4Y2RA 4PZNA 2G06A 8ICXA 2JXJA 3UMBA
chains in the Genus database with same CATH topology
4OJ5A 4QIWC 1Q3VA 3KFUF 4U7CA 4CGZA 2VJ5A 2ZIUA 1NZBA 2KNJA 3N7SC 4FZLA 2E1EA 2HMXA 2MA1A 5C0YA 3AQEA 1WUDA 2H3VA 3F5EA 2GH1A 2HOFA 2WAQF 2JGAA 3SAGA 1IIPA 2W04A 2KD1A 3IN5A 3D2QA 3M6KA 3PSPA 4KX5A 1YT3A 3C29A 4KX3A 2ZIWB 3T79A 3IG8A 2VKQA 3H0LB 2HOQA 2K4HA 2K8CB 3RFAA 2W7PA 1Z1BA 5HR6A 2F77X 2OXOA 3C28A 2WAQC 1URJA 2LYBA 5KL8B 2Z7JA 4CDGA 2CN1A 4QJFB 3NRWA 1MA7A 3O0FA 3VCBA 3SAHA 3AQFA 2XVTA 1ED1A 3F2CA 5CRXA 2E1FA 3K1ZA 2GOLA 3M6ZA 2KJ5A 2Y0SC 3GU3A 3DEEA 3ONNA 2PMZC 3HKZF 1XNSA 2ZIUB 2HBJA 2W03A 3ICXA 4IC9A 4BX9C 1F44A 2ZXIA 2ZIVA 1A6SA 4PL2A 1HEKA 2JHDA 3LVVA 2F8LA 2H3ZA 2LKYA 3H0RB 3SMVA 3SQIA 2E5SA 2LHTA 1CRXA 2ZIXA 4KMOB 4OJ6A 2KV2A 2KEYA 2M0NA 2BDUA 2ZG6A 4NWIA 2XIDA 1PVRA 4NLBA 2Q4TA 2VIXA 3LYSA 4ACOA 2DQNB 5T14A 3F2DA 3PZPA 2OH2A 4OJOA 4QIWF 2XI9A 1A0PA 3CRXA 2G08A 5A0LA 1Q3UA 2ZIXB 3SAFA 2RP5A 3RF9A 3N7RC 2CPRA 1DRGA 2HBMA 1ZQ1C 2ZXHA 4P0QB 2K89A 2ZIVB 4OJLA 2WB1F 3PSTA 2K8BB 1PVQA 2OYYA 4GFJA 1L6NA 2NV3A 4WJ3B 5HR7A 1TAMA 4U6PA 3VC8A 2MRLA 2KKVA 2RHFA 4P0PB 2G5HB 2KHQA 2RRDA 4A8EA 2G09A 3PSIA 2Y0SF 2KHVA 3LVWA 2LBOA 4CRXA 2W7OA 2YX8A 2R18A 3M7DA 4NLCA 3GZFA 2XICA 3ALRA 3E0FA 2G5IB 2D6FC 2KOBA 4AYBC 2JH1A 2KICA 3F53A 4BUGA 1ECWA 3OPXA 2ZIWA 2N1RA 4FE3A 1HIWA 2DGZA 4JMUA 2KJ8A 1D8BA 3KZXA 1OUQA 4PL1A 3F2BA 2JH7A 2K4IA 2H3IA 2KVCA 4FZMA 4OO1J 4O3MA 1PVPA 2KIWA 1Z19A 2YB1A 2PMZF 3HKZC 3N7PD 4NV0A 2JMGA 1KBUA 2KJ9A 3AL0B 2H3QA 4QNLA 2DF4B 3IP4B 2A3VA 1UPHA 2HBKA 2F2AB 4BJQA 1GO3F 4P0QA 3PSFA 1T94A 4AYBF 5KL1B 3IG5A 2KKPA 2H3FA 1SZHA 2K4EA 2VJ4A 2F76X 4C0ZA 2CRXA 2HBLA 4FZNA 2G07A 2WB1C 4P0PA 3CP8A 2G0AA 2K8AA 2HOIA 2OM6A 3D2NA 2LYAA 3F5AA 1XO0A 2YB4A 3H0MB 2G06A 3NUQA 4ICAA 3MGVA 1P7DA 3D2SA 3CYMA 3L3FX 4OJPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WAQ F;  2WB1 F;  4AYB F;  2PMZ F;  3HKZ F;  2Y0S F; 
#chains in the Genus database with same CATH topology
 1K1S A;  2R8K A;  4IRD A;  5J2J A;  3F5E A;  5ALT A;  5ALD A;  2JGA A;  4NL9 C;  4ZOH C;  1PK1 B;  2R8G A;  3M6K A;  1FFV A;  4KX3 A;  4EBC A;  3H0L B;  2OWO A;  2LYB A;  1C7Y A;  5ALK A;  4KLE A;  1S10 A;  3M9O B;  2YML A;  4EX7 A;  3K1Z A;  4I2B A;  2Y0S C;  2B21 A;  2HHQ A;  3NS1 A;  3MGI A;  3GV8 B;  1HEK A;  3QUQ A;  4UAT A;  3SQI A;  2E5S A;  5DG8 A;  4RU9 A;  1ZQL A;  3MAB A;  3C21 A;  2NRZ A;  2VIX A;  4QWA A;  3UQ0 A;  1JIH A;  4J9P A;  2EDU A;  3N7R C;  5B66 U;  8ICT A;  3PR4 A;  2ASD A;  1L6N A;  9ICG A;  4DFP A;  4U6P A;  1HJP A;  2RHF A;  4CGZ A;  1QSL A;  3RH6 A;  3GZF A;  2EZZ A;  4KLO A;  4JB3 A;  4QW8 A;  5KFZ A;  2YTU A;  4RNN A;  4GC7 A;  5JTI A;  5DLF A;  2K60 A;  1ZQK A;  1Q8K A;  4FZM A;  2YB1 A;  8ICQ A;  4MFA A;  5CB1 A;  3FM9 A;  5AK3 A;  2H3Q A;  4QNL A;  3I28 A;  1RPL A;  4Y2X A;  3NVW A;  8ICI A;  1SZH A;  1U9L A;  1ZD5 A;  3QUC A;  1ZQA A;  1RYU A;  4E0D A;  1XO1 A;  3D2N A;  4C8N A;  3BQT A;  3NAS A;  4DS5 A;  2HOI A;  3TAN A;  2Y9T A;  4U7C A;  1ZQU A;  2WF9 A;  4ED2 A;  5KFV A;  3V6K A;  4RQ0 A;  3AQE A;  4B9L A;  3ZDB A;  5KT2 A;  4F8R A;  1SL2 A;  4JV0 A;  4TUP A;  4PGY A;  1Z00 A;  4ED3 A;  9ICF A;  5C5J A;  4M9L A;  3AUO A;  3RB0 A;  4QZA A;  4EZ6 A;  2W9M A;  4ECU A;  2VA3 A;  1EXN A;  2IA6 A;  4QZI A;  2KMD A;  7ICS A;  4QW9 A;  3E2E A;  4O3R A;  3GU3 A;  2MAX A;  2W03 A;  1SWW A;  5KFM A;  3LVV A;  1SWV A;  1ZQQ A;  2AXT U;  3RJE A;  2IOF K;  2P6U A;  4KLS A;  1DGS A;  4CCH A;  1TAQ A;  4NY8 A;  4KN4 A;  1SIJ A;  5AKI A;  3B0Y A;  5ALY A;  5A0L A;  1DRG A;  5J8Y A;  3TFR A;  4O0I A;  4P0Q B;  2K89 A;  3G6Y A;  1ZQI A;  5KTQ A;  2I5H A;  2CXY A;  2WB1 F;  4G9B A;  7ICU A;  2FE9 A;  3GIL A;  1QQ6 A;  3N4M B;  3HRD D;  3TAR A;  3OHB A;  4ELT A;  2G5H B;  2NRV A;  2AGP A;  3M9M B;  2XIC A;  3Q8Q B;  1AQ6 A;  8ICG A;  2BR0 A;  3C5G A;  3LWM A;  1N61 A;  1D9F A;  3ETR A;  4O3M A;  3PX6 A;  1Z19 A;  5J0S A;  4FBT A;  1UT5 A;  4KLD A;  1KFT A;  5ALL A;  4NLN A;  2QB1 A;  3HW8 A;  9ICQ A;  5AK5 A;  5DLG A;  9ICP A;  5DB8 A;  4RQ5 A;  3IDW A;  4M0A A;  1F5S A;  4MF8 A;  1ZD4 A;  1S0M A;  3MGH A;  2F1J A;  2LPE A;  2DFL A;  3BQ1 A;  1UCV A;  2ZTD A;  1JN3 A;  2KZZ A;  4J9L A;  5HML A;  1VDV A;  4KX5 A;  1Y88 A;  1BVS A;  3C29 A;  2V4R A;  3UQ2 A;  2W9C A;  1X66 A;  5DB7 A;  2GLE A;  2OXO A;  3C28 A;  3WK4 A;  2ZTC A;  5G5G A;  2EZX A;  3H8J A;  2ZUD A;  2A1A A;  7ICI A;  5JRT A;  4KMU A;  1HUZ A;  4B9N A;  1XNS A;  2ZIU B;  1JRP A;  3AMZ A;  4ED0 A;  2C2E A;  2UVU A;  4DL2 A;  2XID A;  4I28 A;  3UMC A;  5ALG A;  3ZDD A;  1U48 A;  5D49 A;  3T5L A;  1L7M A;  2MSN A;  4QZC A;  7ICR A;  3QZ8 A;  3C1Z A;  2KKV A;  4RUC A;  7ICG A;  9ICO A;  4CRX A;  2ZTE A;  3PNC A;  5KG7 A;  3GDX A;  3TI0 A;  3H8M A;  1IXR A;  2ISP A;  1S76 D;  1X9X A;  5H2F U;  1ARO P;  1PVP A;  2V9W A;  4Y2Y A;  3OJU A;  3THV A;  1OXJ A;  1NZP A;  2KJ9 A;  4F4W A;  2A3V A;  4P2H A;  4Y2S A;  3AM9 A;  4RUA A;  1T94 A;  2VJ4 A;  2F1H A;  5J2K A;  2HBL A;  5KFC A;  4FS2 A;  1NKE A;  1X2I A;  2DKZ A;  4J9S A;  3MGV A;  3CYM A;  4YR3 A;  3L3F X;  3J81 j;  3PML A;  4EZ9 A;  3FC4 A;  5ALP A;  3MBY A;  1ZJN A;  4DEZ A;  2NRX A;  3GIM A;  1SV4 A;  3GV7 B;  3TAP A;  1D8Y A;  3D2Q A;  1YT3 A;  2K4H A;  2W9A A;  3KBB A;  4RQ2 A;  1U49 A;  1Z00 B;  1KKX A;  5KG5 A;  1ZET A;  2EZY A;  3BZK A;  5K4L A;  4DOB A;  8ICL A;  3TAC B;  1ED1 A;  2AHO B;  5CRX A;  2D3D A;  4DSI A;  4PGX A;  5KG6 A;  3M6Z A;  2KJ5 A;  1SKS A;  3DEE A;  4M6W B;  5D4B A;  3QZ7 A;  9ICI A;  1X40 A;  4KLF A;  5KFK A;  2NO5 A;  4O9M A;  8ICJ A;  5ALX A;  1XSN A;  4ECW A;  2EAO A;  3H8S A;  4Q45 A;  5KT5 A;  3KHL A;  2Q4T A;  3LYS A;  4P4P A;  5HNK A;  4ACO A;  3RBE A;  4OJO A;  2LM4 A;  5AM3 A;  4F4Y A;  3QYP A;  4KLQ A;  1NKC A;  3LK9 A;  2FI1 A;  1PVQ A;  7ICJ A;  5KG3 A;  9ICR A;  3UXN A;  5EE9 A;  8ICZ A;  5J2D A;  4RPY A;  3M9N B;  5TZV A;  4DL6 A;  4BXO A;  3OSP A;  3F53 A;  5AHX A;  4UBB A;  4FE3 A;  1H38 A;  2Y1I A;  3JPQ A;  3OHA A;  1KFS A;  1UQV A;  4YQW A;  4TUR A;  2J6U A;  5ALI A;  1ZQB A;  5IIL A;  3AL0 B;  1X6J A;  4X5V A;  4JV2 A;  3UPQ A;  1SV0 C;  5KFS A;  5ALE A;  4Y2P A;  3V7J A;  1V38 A;  2JEF A;  1NJZ A;  4M9G A;  2OM6 A;  3KD3 A;  2ALZ A;  1RZT A;  4TUQ A;  3QUT A;  4OJP A;  5KFL A;  5KT7 A;  2WAQ F;  4R66 A;  1YZ7 A;  1MQ3 A;  4US9 A;  5III A;  4YFK A;  5ALO A;  4UB8 U;  3IG8 A;  4GXJ A;  5HMM A;  9ICS A;  3HJE A;  2W55 A;  2F77 X;  3HX0 A;  2EH9 A;  2HHV A;  5DQG A;  3TFS A;  3KKA A;  5J8Y C;  5ALS A;  5F9L A;  2H5X A;  2PMZ C;  2ASJ A;  3RTV A;  3SD7 A;  2L5Y A;  2H3Z A;  3UXO A;  3I76 A;  4I2A A;  2JRZ A;  2M0N A;  3BJY A;  2IOF A;  2AGO A;  5J0T A;  2K4P A;  1S5L U;  1A0P A;  1Q3U A;  2RP5 A;  5IIJ A;  1ZQS A;  2IOH A;  8ICK A;  3SV4 A;  3L5K A;  3V72 A;  8ICW A;  2ZIV B;  2UVW A;  1BGX T;  2HW3 A;  2IMW P;  2MRL A;  1CUK A;  4P0P B;  3ZD9 A;  3PSI A;  4AP9 A;  2HSZ A;  4DQR A;  4YD2 A;  4KLU A;  1HIW A;  2DGZ A;  4DS4 A;  4OD0 A;  1ZQF A;  3NTU A;  4BDP A;  4PJ0 U;  4Y2J A;  4KN7 A;  3V7K A;  2AQ0 A;  3RAQ A;  5KL1 B;  2I1Q A;  1C20 A;  5J0W A;  2PXI A;  3K1R B;  1ZQM A;  4PGQ A;  4YD1 A;  1SB3 C;  1O08 A;  1TV9 A;  3QXG A;  1ZJM A;  1BPB A;  5JUM A;  4QIW C;  3SEI A;  2YMQ A;  1UA1 A;  2MA1 A;  5J2B A;  3WK7 A;  4FS1 A;  3PW7 A;  2W04 A;  5AM0 A;  1ZQG A;  1ZD3 A;  2KFZ A;  3GFK B;  4RT2 A;  2XY7 A;  3T3F A;  5AM1 A;  3QX7 A;  3SAH A;  2FPM A;  2R8H A;  2BKE A;  2E1F A;  2QB0 A;  5AK4 A;  3QEA Z;  1FIQ A;  5AM5 A;  2IBK A;  3C2K A;  4PL2 A;  2F8L A;  2LKY A;  4IQT A;  3KHH A;  1XSL A;  1SL0 A;  4BWJ A;  1KDH A;  3FDS A;  5J29 A;  2ZIX B;  5KFJ A;  2WF5 A;  2CPR A;  4EBD A;  2OCE A;  2K8B B;  2BQ3 A;  4ECZ A;  4ED6 A;  2BCU A;  1QSY A;  2AU0 A;  1L7N A;  1NJY A;  2JR5 A;  4DWI A;  1U4B A;  4QZF A;  4YMN A;  1BPX A;  4YCX A;  1D8B A;  5TIS U;  2KFN A;  4I2G A;  5KFI A;  8ICO A;  1MC8 A;  4NL9 A;  4C8O A;  8ICB A;  4RQ3 A;  2QAR A;  1ZYQ A;  4ECY A;  2B6G A;  4C4T A;  1KFD A;  2PMZ F;  3H7I A;  3IP4 B;  4XQ8 A;  3T5J A;  4KLJ A;  4XRH A;  8ICS A;  5KFU A;  1Q46 A;  4UB6 U;  3ETL A;  5HHH A;  2YB4 A;  5ALJ A;  4ICA A;  1QTM A;  4DL3 A;  3A0H U;  1L3V A;  2ZJ8 A;  5J0O A;  4RQ4 A;  3RR7 A;  4Z6E A;  1XS9 D;  5J0R A;  3OJS A;  2HOQ A;  3CW2 C;  2BPC A;  5AI9 A;  1UA0 A;  4R63 A;  3NRW A;  2HHW A;  3VCB A;  9ICH A;  2FPL A;  3B0X A;  3F2C A;  3SI8 A;  5KFY A;  2BCR A;  3SMV A;  9ICN A;  3WK6 A;  2O6K A;  1PK3 A;  4ECR A;  3JPN A;  5L9X A;  3QU5 A;  1QLN A;  4QWD A;  7ICL A;  2HHT A;  5CWR A;  1ZQC A;  3JPO A;  3PW5 A;  4IQW A;  3WK8 A;  4DSE A;  1SKW A;  5GTH U;  1COK A;  2DQN B;  2E8M A;  2XI9 A;  3CRX A;  2G08 A;  2WF8 A;  1QQ7 A;  5AI8 A;  4F4X A;  1VLB A;  1TFR A;  1DGJ A;  5HP4 A;  3RH4 A;  4J9R A;  3GV5 B;  8ICE A;  1ZQJ A;  3EPG A;  2P66 A;  4UAW A;  3RH5 A;  4PHD A;  1K1Q A;  1NNL A;  4LJX A;  4CNQ A;  1BPZ A;  3SV3 A;  2A19 A;  2ISO A;  5J2H A;  3NGD A;  2K4I A;  1NJW A;  4NV0 A;  4I2D A;  4QZG A;  3DV9 A;  2EAN A;  5AI4 A;  3WKD A;  3G6V A;  3V6H A;  5G5H A;  5KG4 A;  3KOO A;  4M04 A;  3ZD8 A;  4EEK A;  5AKJ A;  4YVZ A;  2E8P A;  2FLL A;  4R8U A;  1A76 A;  4F4Z A;  4F2R A;  3NUQ A;  3PX0 A;  4DL5 A;  4OJ5 A;  4BWM A;  3KFU F;  1CEZ A;  4QZE A;  4B9V A;  5AKH A;  1ZQX A;  2DWQ A;  2FJ6 A;  1X9W A;  5B5E U;  3MC1 A;  3C1Y A;  1MQ2 A;  1URJ A;  4YG2 A;  1L3S A;  1KW4 A;  1D8L A;  3ED5 A;  1BNP A;  1LB2 B;  1RYS A;  3ORY A;  3ISB A;  3I1Y A;  2KSO A;  4IQV A;  3WKE A;  3H0R B;  5EWG A;  3EWA A;  4KIT B;  4DLG A;  1CRX A;  2WF7 A;  3NVZ A;  5KG1 A;  4YP3 A;  2E8O A;  1TK5 A;  2F44 A;  5ALM A;  2F3N A;  3BQ7 A;  1LVH A;  4PHP A;  1SXE A;  2W8K A;  2ES6 A;  4JV1 A;  1X9S A;  2FDR A;  4P4M A;  3Q8S B;  4DLE A;  4Q44 A;  8ICC A;  3RAX A;  4I2C A;  5L1J A;  1N5X A;  3N97 B;  4EYI B;  5ALW A;  4I2H A;  1WWV A;  3VC8 A;  4RQ6 A;  4C7Y A;  1QH9 A;  4RNO A;  1SGG A;  3E0F A;  4DSJ A;  1JAL A;  2VA2 A;  3SEN A;  2JV3 A;  4IR1 A;  1J2M A;  2XGP A;  2KZM A;  4I2F A;  3BZC A;  4O5E A;  4EX6 A;  4KLG A;  5IIN A;  2BHN A;  1ZQP A;  1TKD A;  5J2I A;  4Q8E A;  3UMG A;  4DQP A;  5DGA A;  2KZ3 A;  2WB1 C;  3WK9 A;  3MDA A;  4QZD A;  3F5A A;  4UAV A;  1K5O A;  5AM2 A;  4IS7 A;  3CNH A;  4O3Q A;  2UVV A;  2ZIU A;  2KNJ A;  3WK5 A;  4B9M A;  1WG8 A;  4PHA A;  5C0Y A;  4TQS A;  1ZQT A;  1NJX A;  4YN4 A;  2NO4 A;  4ED7 A;  3NRZ A;  1XC9 A;  3Q8K A;  1V9P A;  3BDP A;  3Q8P B;  4K4G A;  5IIO A;  3HKZ F;  4DFD A;  2ZXI A;  4KLT A;  4HAI A;  4KMO B;  3C5F A;  5ALV A;  5DG9 A;  4DQI A;  2DKX A;  4R64 A;  5L1L A;  5AIB A;  7ICP A;  5DDY A;  5KFT A;  1ZQ1 C;  3RBD A;  2BGW A;  4UB3 A;  2KTQ A;  2Y1J A;  3GIK A;  2NV3 A;  4WJ3 B;  2KHV A;  4R65 A;  8ICA A;  5EWF A;  3H40 A;  2W7O A;  1U45 A;  9ICT A;  3IRU A;  1RQN A;  4Z6D A;  2G5I B;  3V7L A;  3QEB Z;  3K75 D;  2JH1 A;  2W8L A;  2PFQ A;  4DL4 A;  1ECW A;  1Z4N A;  2PFP A;  3MFI A;  2I6X A;  1F0M A;  3TAD A;  4F92 B;  3KZX A;  4M2Y A;  2H3I A;  2QB0 B;  2V4Q A;  4J9M A;  4Q8F A;  1DK2 A;  4DSK A;  5GTI U;  2NYV A;  5J0Q A;  4BJQ A;  1LKY A;  1KN5 A;  3UXP A;  3PW0 A;  5KNI A;  2K4E A;  2HHU A;  2C2D A;  2CRX A;  3HPO A;  4FZN A;  4DQQ A;  5IIK A;  4F5N A;  2C28 A;  3M8R A;  4GIB A;  2ESE A;  5CA7 A;  4Z6C A;  2BPF A;  1KRP A;  4MHV A;  4FZL A;  1RQL A;  3A0B U;  4DSL A;  1ZQZ A;  3QU2 A;  4RT3 A;  1QQ5 A;  2HVH A;  2KD1 A;  2Q0Z X;  9ICK A;  4DOC A;  2GWS A;  4RQM A;  2ZJ5 A;  4USA A;  2XC9 A;  1PK1 A;  3O0F A;  2LYH A;  3FAH A;  3ISC A;  4JK1 A;  5CJ7 A;  5J2F A;  5KT4 A;  2GOL A;  2AGQ A;  2KVS A;  1IV8 A;  2DBY A;  2C22 A;  5ALZ A;  4ECS A;  3RJJ A;  1Z4O A;  5KFO A;  1F44 A;  5DKW A;  1XWL A;  1ZQH A;  3BQ2 A;  1ZQR A;  2LHT A;  4C4S A;  4I27 A;  1JMS A;  3Q8M A;  2J6T A;  8ICP A;  2E8N A;  3F2D A;  2LM1 A;  7ICQ A;  3PZP A;  2YN4 A;  9ICE A;  4DQS A;  4MEY A;  1FFU A;  3LWL A;  1HUO A;  3K4G A;  1M6Y A;  5KFA A;  3JPP A;  4UB5 A;  2RRD A;  3M8S A;  2ZUC A;  3BS5 A;  1J97 A;  2R8I A;  1V85 A;  2NRT A;  2KIC A;  4Y2Q A;  3N28 A;  3BS5 B;  3QE9 Y;  5J2A A;  4UAY A;  2ATL A;  5CP2 A;  4QZ8 A;  3EYZ A;  3HKZ C;  4O3P A;  3UM9 A;  5BOM A;  4IRC A;  4P4O A;  2HBK A;  1GO3 F;  3IG5 A;  4I2I A;  5CHG A;  4RZR A;  4UAR A;  1SKR A;  2HHS A;  1JI7 A;  1OW5 A;  2QKQ A;  5KFH A;  4YMO A;  3HT3 A;  5KFG A;  5EWE A;  1Q3V A;  4LVS A;  5DG7 A;  9ICM A;  4IRK A;  1TK8 A;  2VA8 A;  3KZI U;  1B22 A;  1KEJ A;  2XY5 A;  3PSP A;  4UAS A;  4ELU A;  2Y9U A;  3MDC A;  2RDI A;  4KLI A;  3C2L A;  1NK8 A;  1Z3E B;  4DO9 A;  4CDG A;  3AQF A;  3MR2 A;  2FLN A;  4M9N A;  3OSN A;  5KAI U;  3ONN A;  4QWB A;  2FMP A;  3ICX A;  3HP6 A;  2JHD A;  2W3S A;  4F71 A;  1XSP A;  9ICA A;  4NM2 A;  5KT3 A;  3SZ2 A;  5AI6 A;  1B4F A;  5AK6 A;  4GLX A;  1N2X A;  1NK0 A;  1TE2 A;  1A6S A;  3LVW A;  2R18 A;  4F72 A;  1SV0 A;  4OCZ A;  3RJH A;  5F9N A;  4QWE A;  4K4H A;  2BDP A;  3NVV A;  3LDA A;  4M6W A;  3ZDC A;  4F91 B;  2KJ8 A;  1VJ5 A;  5KG0 A;  2JH7 A;  3GIJ A;  1DOQ A;  2KIW A;  4F2S A;  4MEX A;  4ECV A;  1S77 D;  3PSF A;  3TQ1 A;  3JPS A;  2YQE A;  2P35 A;  2F76 X;  4RPX A;  4F5P A;  2G07 A;  7ICM A;  3Q8R B;  1XO0 A;  4TUS A;  1JXE A;  5ALN A;  3T5K A;  4IQU A;  2HDO A;  2LI6 A;  5FP0 A;  5ALQ A;  2YY6 A;  2E3T A;  3SAG A;  1RYR A;  4KTQ A;  3IN5 A;  4K4I A;  5AKE A;  5KFB A;  5L1K A;  1Z1B A;  5HR6 A;  2J6S A;  3AU6 A;  4NLZ A;  4NJ8 A;  3ZDE A;  2BZF A;  5AIC A;  3WKB A;  1MA7 A;  2PKE A;  1QCK A;  3U26 A;  1ZQV A;  5ALF A;  1IG6 A;  1WWU A;  1L7P A;  1S8O A;  4B9T A;  4IC9 A;  5J0X A;  3KKA C;  1S9F A;  2BCQ A;  3DDH A;  3PW2 A;  4ED8 A;  2ZUB A;  4DF8 A;  5D46 A;  5AI0 A;  1PVR A;  4DOA A;  3JPT A;  5AKG A;  4DL7 A;  2OH2 A;  3QU4 A;  3G6X A;  2UVR A;  4Y2U A;  3BS7 A;  4LZD A;  2VAN A;  2HBM A;  5KFQ A;  2W9B B;  1NK5 A;  3PST A;  3KHR A;  4FBU A;  1A77 A;  1BNO A;  4Z6F A;  4DCC A;  3RJI A;  1UHU A;  3V6J A;  2G09 A;  2Y0S F;  4NLK A;  3M7D A;  5J0P A;  3RRG A;  4DF4 A;  5EOZ A;  1TK0 A;  4AYB C;  1L3U A;  2PFN A;  5AKK A;  4B6J A;  3OPX A;  3MR3 A;  4CF5 A;  3OGU A;  2PI5 A;  4YMM A;  5DB9 A;  4PL1 A;  3F2B A;  2KIV A;  2JEI A;  3WKA A;  2XCP A;  3PVX A;  2DF4 B;  2F2A B;  4P0Q A;  1WCN A;  4JUZ A;  9ICJ A;  4UBC A;  1ZRM A;  4EYH B;  4DFJ A;  1Z1V A;  4C0Z A;  4JWM A;  5AKZ A;  2FPK A;  4CF3 A;  2K8A A;  3ZI4 A;  5J2E A;  1ZQE A;  5IIM A;  8ICM A;  2B0C A;  2BQU A;  3H0M B;  4O3O A;  3D2S A;  1N56 A;  2YMP A;  1YZ6 A;  5ALU A;  4DFK A;  1NZB A;  2E1E A;  2ODG A;  1DK3 A;  2GH1 A;  3IV6 A;  1IIP A;  1WCL A;  1WYG A;  5EE0 A;  4US8 A;  1RDF A;  2ZIW B;  2A1J B;  5HHI A;  3QUB A;  4RQN A;  5KFF A;  2WAQ C;  3IM1 A;  1J2N A;  4F5Q A;  3FYH A;  2BCS A;  3AEV A;  1NK7 A;  2BQR A;  8ICR A;  3PV8 A;  2XGQ A;  5AI5 A;  1U47 A;  3QNM A;  2ASL A;  4C8K A;  3HWT A;  2YMM A;  1UT8 A;  4CF4 A;  4ELV A;  3H4D A;  2JEG A;  3HIL A;  3C2M A;  1L3T A;  2ZIX A;  4OJ6 A;  2KEY A;  5BPC A;  5KAF U;  3T5H A;  2ZG6 A;  4NWI A;  2HHX A;  4QZH A;  4EEY A;  4QIW F;  1NKB A;  3MFH A;  5KT6 A;  2DL0 A;  2WF6 A;  1NK4 A;  3RJG A;  3TKA A;  1ZOL A;  3EPI A;  4GC6 A;  4UAU A;  1V97 A;  1ZQD A;  4F3O A;  5J0U A;  1TAM A;  1RXV A;  3PO4 A;  1L8O A;  1X9M A;  4Y2T A;  4NLC A;  5KFP A;  2D6F C;  5KFR A;  2DUY A;  4BUG A;  2LMR A;  4PPX A;  2N1R A;  3RJF A;  5CR0 A;  3PW4 A;  1L5U A;  4OO1 J;  5AM4 A;  3TAD C;  2OEH A;  4ED1 A;  3PMN A;  2C2R A;  4ECX A;  2GO7 A;  2RQ5 A;  4PHE A;  4O3N A;  1JXL A;  5DBB A;  3D6J A;  2G0A A;  4PH5 A;  4EEN A;  1NK9 A;  1P7D A;  5J0Y A;  4IR9 A;  5DGB A;  1TAU A;  2PFO A;  4UAZ A;  2XCA A;  1WUD A;  2H3V A;  5DBC A;  2HOF A;  9ICX A;  9ICC A;  1T3N A;  1PZN A;  2W43 A;  3RFA A;  2W7P A;  3ISD A;  2BCV A;  2JZB B;  2F1I A;  5DQH A;  4UQG A;  1PUZ A;  5L1I A;  3IHQ B;  2CN1 A;  2XO7 A;  7ICE A;  1N63 A;  4C8M A;  1ZQO A;  1KLN A;  4PZO A;  3H8W A;  5F3X B;  1T4G A;  2HBJ A;  4BX9 C;  2KK0 A;  2ZIV A;  3RRH A;  3ZDA A;  1CI4 A;  3NVY A;  2JZB A;  1N5W A;  2RDJ A;  2ZJA A;  2BDU A;  4KLL A;  4NLB A;  4ECT A;  2M9N A;  4YR2 A;  1S0N A;  2ZXH A;  1TVA A;  2JEJ A;  4ECQ A;  7ICF A;  1FEZ A;  2OYY A;  1N48 A;  2LBO A;  3AU2 A;  3JPR A;  4J9O A;  2YX8 A;  4FO6 A;  2I9G A;  3ALR A;  1COO A;  2HCF A;  1FO4 A;  2KOB A;  2WFA A;  3SYZ A;  1XU4 A;  1IM4 A;  2PI4 A;  1O03 A;  3WKC A;  5DB6 A;  4YXJ A;  2D8C A;  2JMG A;  1RG6 A;  2F8K A;  3Q8L A;  1X6I A;  3PR5 B;  9ICU A;  3RJK A;  2BPG A;  4JWN A;  4O5K A;  4R8U B;  4F93 B;  1RM6 C;  1B0X A;  4B9U A;  1JRO A;  3PO5 A;  3CP8 A;  4C4R A;  4F5O A;  2LYA A;  4QZ9 A;  5EE1 A;  1BPE A;  2XY6 A;  4DSF A;  4XA5 A;  7ICV A;  2W9B A;  2RLT A;  2VJ5 A;  4I2E A;  4TQR A;  3N7S C;  9ICB A;  2MU2 A;  3BQ0 A;  5DDM A;  4CE6 A;  4RPZ A;  3EZ5 A;  1T3Q A;  1JX4 A;  3H4B A;  7ICN A;  4UW9 A;  2AQ4 A;  5JU5 A;  2MUT A;  1LV5 A;  1BPD A;  5KFD A;  4KLM A;  2VKQ A;  4F50 A;  2A1J A;  4F5R A;  3RB6 A;  5KL8 B;  1B43 A;  2Z7J A;  3L4P A;  2EQY A;  1MN8 A;  1KL9 A;  2IHN A;  4YR0 A;  3M1Y A;  7ICO A;  1SXD A;  3SR6 A;  4C7Z A;  3QU7 A;  2HVI A;  1ZD2 P;  4KLH A;  5KFE A;  2R8J A;  1MSW D;  4O3S A;  1NK6 A;  8ICY A;  2FMS A;  4HYK A;  3GQC A;  9ICV A;  8ICH A;  4RQ8 A;  5T14 A;  1NOM A;  4UB2 A;  1X42 A;  9ICW A;  5E79 U;  3RF9 A;  4J9K A;  1S0O A;  1BPY A;  1LKY B;  1KTQ A;  1L8L A;  4OJL A;  2KE7 A;  4GFJ A;  2FLP A;  4ZH4 A;  5HR7 A;  3QU9 A;  4QZB A;  2QAR B;  2EAP A;  3AN1 A;  2IHM A;  5KFW A;  4MFF A;  4GXI A;  3TAQ A;  4RNM A;  3R9K A;  4JMU A;  1S97 A;  3E58 A;  4UB1 A;  1OUQ A;  2KVC A;  4QWC A;  2W11 A;  2AH5 A;  2KP7 A;  3N7P D;  1KBU A;  5KFN A;  2WHE A;  1UPH A;  1S0V A;  4Y2V A;  2HI0 A;  5KFX A;  4AYB F;  3MR6 A;  2KKP A;  2H3F A;  4O5C A;  4BGD A;  5AKL A;  4P0P A;  3RB3 A;  2W54 A;  1N62 A;  9ICL A;  4Q43 A;  1RXW A;  5KG2 A;  4J9N A;  2W3R A;  1ZXI A;  2HMX A;  3RR8 A;  8ICN A;  4NLG A;  7ICK A;  5BOL A;  1L7O A;  4RQ7 A;  8ICV A;  4NXZ A;  3OTQ A;  5AKY A;  3T79 A;  2K8C B;  5J2C A;  2KSO B;  5AKX A;  4QJF B;  2MUT B;  7ICH A;  2DPJ A;  2XVT A;  5ALR A;  5J2G A;  1NI3 A;  1KQQ A;  5L1M A;  5CEH A;  7ICT A;  1KSP A;  3PY8 A;  4J03 A;  2KV2 A;  4YXM A;  8ICF A;  2OHF A;  4M9J A;  1ZQW A;  1T8E A;  4NM1 A;  5AIA A;  2DPI A;  4LZG A;  1QSS A;  1D9D A;  1ZRN A;  3RB4 A;  4FFD A;  3SAF A;  2EAM A;  2KG5 A;  1SZP A;  4IL6 U;  5DBA A;  1N60 A;  2KN7 A;  3GII A;  8ICU A;  4RQ1 A;  4M47 A;  4M9H A;  2NRW A;  4MF2 A;  2KHQ A;  4A8E A;  3C23 A;  4GXK A;  4G3I A;  4J9Q A;  2QLT A;  3B9J A;  1T7P A;  4EBE A;  3S6J A;  5DQI A;  2WTF A;  4BXO B;  2ZIW A;  4B9S A;  3PX4 A;  3KTQ A;  1ZQY A;  4I2J A;  4XUS A;  4C80 A;  4MFC A;  1ZQN A;  3MR5 A;  3EW9 A;  3EUB 2;  5EE3 A;  1DXS A;  3WU2 U;  4I29 A;  2P6R A;  3KHG A;  2FMQ A;  5ALH A;  2W9C B;  4UB4 A;  4C8L A;  4EEL A;  2AJQ A;  1JUD A;  4DFM A;  4F4K A;  1SL1 A;  4Y2R A;  4PZN A;  2G06 A;  8ICX A;  2JXJ A;  3UMB A; 
#chains in the Genus database with same CATH homology
 4OJ5 A;  4QIW C;  1Q3V A;  3KFU F;  4U7C A;  4CGZ A;  2VJ5 A;  2ZIU A;  1NZB A;  2KNJ A;  3N7S C;  4FZL A;  2E1E A;  2HMX A;  2MA1 A;  5C0Y A;  3AQE A;  1WUD A;  2H3V A;  3F5E A;  2GH1 A;  2HOF A;  2WAQ F;  2JGA A;  3SAG A;  1IIP A;  2W04 A;  2KD1 A;  3IN5 A;  3D2Q A;  3M6K A;  3PSP A;  4KX5 A;  1YT3 A;  3C29 A;  4KX3 A;  2ZIW B;  3T79 A;  3IG8 A;  2VKQ A;  3H0L B;  2HOQ A;  2K4H A;  2K8C B;  3RFA A;  2W7P A;  1Z1B A;  5HR6 A;  2F77 X;  2OXO A;  3C28 A;  2WAQ C;  1URJ A;  2LYB A;  5KL8 B;  2Z7J A;  4CDG A;  2CN1 A;  4QJF B;  3NRW A;  1MA7 A;  3O0F A;  3VCB A;  3SAH A;  3AQF A;  2XVT A;  1ED1 A;  3F2C A;  5CRX A;  2E1F A;  3K1Z A;  2GOL A;  3M6Z A;  2KJ5 A;  2Y0S C;  3GU3 A;  3DEE A;  3ONN A;  2PMZ C;  3HKZ F;  1XNS A;  2ZIU B;  2HBJ A;  2W03 A;  3ICX A;  4IC9 A;  4BX9 C;  1F44 A;  2ZXI A;  2ZIV A;  1A6S A;  4PL2 A;  1HEK A;  2JHD A;  3LVV A;  2F8L A;  2H3Z A;  2LKY A;  3H0R B;  3SMV A;  3SQI A;  2E5S A;  2LHT A;  1CRX A;  2ZIX A;  4KMO B;  4OJ6 A;  2KV2 A;  2KEY A;  2M0N A;  2BDU A;  2ZG6 A;  4NWI A;  2XID A;  1PVR A;  4NLB A;  2Q4T A;  2VIX A;  3LYS A;  4ACO A;  2DQN B;  5T14 A;  3F2D A;  3PZP A;  2OH2 A;  4OJO A;  4QIW F;  2XI9 A;  1A0P A;  3CRX A;  2G08 A;  5A0L A;  1Q3U A;  2ZIX B;  3SAF A;  2RP5 A;  3RF9 A;  3N7R C;  2CPR A;  1DRG A;  2HBM A;  1ZQ1 C;  2ZXH A;  4P0Q B;  2K89 A;  2ZIV B;  4OJL A;  2WB1 F;  3PST A;  2K8B B;  1PVQ A;  2OYY A;  4GFJ A;  1L6N A;  2NV3 A;  4WJ3 B;  5HR7 A;  1TAM A;  4U6P A;  3VC8 A;  2MRL A;  2KKV A;  2RHF A;  4P0P B;  2G5H B;  2KHQ A;  2RRD A;  4A8E A;  2G09 A;  3PSI A;  2Y0S F;  2KHV A;  3LVW A;  2LBO A;  4CRX A;  2W7O A;  2YX8 A;  2R18 A;  3M7D A;  4NLC A;  3GZF A;  2XIC A;  3ALR A;  3E0F A;  2G5I B;  2D6F C;  2KOB A;  4AYB C;  2JH1 A;  2KIC A;  3F53 A;  4BUG A;  1ECW A;  3OPX A;  2ZIW A;  2N1R A;  4FE3 A;  1HIW A;  2DGZ A;  4JMU A;  2KJ8 A;  1D8B A;  3KZX A;  1OUQ A;  4PL1 A;  3F2B A;  2JH7 A;  2K4I A;  2H3I A;  2KVC A;  4FZM A;  4OO1 J;  4O3M A;  1PVP A;  2KIW A;  1Z19 A;  2YB1 A;  2PMZ F;  3HKZ C;  3N7P D;  4NV0 A;  2JMG A;  1KBU A;  2KJ9 A;  3AL0 B;  2H3Q A;  4QNL A;  2DF4 B;  3IP4 B;  2A3V A;  1UPH A;  2HBK A;  2F2A B;  4BJQ A;  1GO3 F;  4P0Q A;  3PSF A;  1T94 A;  4AYB F;  5KL1 B;  3IG5 A;  2KKP A;  2H3F A;  1SZH A;  2K4E A;  2VJ4 A;  2F76 X;  4C0Z A;  2CRX A;  2HBL A;  4FZN A;  2G07 A;  2WB1 C;  4P0P A;  3CP8 A;  2G0A A;  2K8A A;  2HOI A;  2OM6 A;  3D2N A;  2LYA A;  3F5A A;  1XO0 A;  2YB4 A;  3H0M B;  2G06 A;  3NUQ A;  4ICA A;  3MGV A;  1P7D A;  3D2S A;  3CYM A;  3L3F X;  4OJP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...