2WAQF

The complete structure of the archaeal 13-subunit dna-directed rna polymerase
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
90
structure length
90
Chain Sequence
SVYIVEEHYIPYSVAKKLLSDVIKSGSSSNLLQRTYDYLNSVEKCDAESAQKVVEELSSIISREDVRAVLASICPITPDEVRSILIMDSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE RPO1N SUBUNIT
publication title Evolution of complex RNA polymerases: the complete archaeal RNA polymerase structure.
pubmed doi rcsb
total genus 13
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2009-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF03874 RNA_pol_Rpb4 RNA polymerase Rpb4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.820 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2waqF02
4AYBF 2WAQF 2WB1F 2PMZF 2Y0SF 3HKZF
chains in the Genus database with same CATH superfamily
2RLTA 3D2QA 2H5XA 5KG5A 1TVAA 3RAQA 4EX6A 1JX4A 4I2BA 3JPTA 1D8LA 5ALIA 2KJ8A 2KSOB 4NM1A 3KKAC 4P4MA 2LBOA 4C8LA 2WAQC 2QB0B 1QQ5A 3SAHA 3EPGA 4QZ9A 2E8PA 5DBAA 1SXEA 3GIMA 5J2KA 3LWMA 5EE3A 7ICHA 1ZQZA 8ICZA 2AU0A 4Q44A 2A19A 5DB8A 2BPFA 2OEHA 4E0DA 4I28A 5CHGA 1RG6A 2Y1JA 4DOCA 3PW7A 8ICLA 1X6IA 2W55A 3E0FA 4FZNA 1FIQA 5EE9A 5AM1A 3BZCA 4ZH4A 3KZIU 3WU2U 5HNKA 4FZLA 2AQ0A 3UMGA 4Y2TA 4F2SA 4C8KA 3SAGA 2VA3A 4XA5A 9ICUA 4I2GA 3NUQA 4I2DA 1ZQPA 2H3ZA 2BR0A 1QQ7A 9ICLA 3MR5A 3ZD8A 2G09A 1D9DA 2IHNA 1NK4A 4F4ZA 1XSLA 5L1LA 4OD0A 4BWMA 5AHXA 2ZJ5A 3V6KA 5AK3A 2H3IA 1SKSA 2FDRA 1BPXA 2K60A 1ZQ1C 1QSSA 3ISCA 4EBCA 2Y0SF 5KT2A 3ETRA 4CF3A 2B6GA 8ICYA 3G6VA 2YMLA 1U47A 3GV7B 2W8KA 4DOAA 7ICJA 2JR5A 2CPRA 5HR7A 2IOFK 2YMQA 3HT3A 1K5OA 4NL9C 1TFRA 4PHAA 5C0YA 5A0LA 5AK5A 8ICRA 5KG7A 3F2BA 4ACOA 3V6JA 1TK0A 1F44A 4YQWA 2KHVA 1M6YA 5AI0A 4KLHA 1T8EA 2AXTU 1IG6A 3ED5A 2R8HA 2F1IA 4YMNA 2ZIVA 3WK8A 4B6JA 4ED3A 2KEYA 8ICPA 1MQ2A 4OJOA 5GTIU 3HWTA 4F5PA 3RB3A 2C28A 2CXYA 4RQ4A 1MC8A 5DQHA 2WTFA 4EZ9A 3RH4A 4Y2JA 3ZDCA 3M9MB 2NRZA 4ELVA 4DLEA 1ZETA 4DOBA 1V85A 5DB7A 3WK6A 2F8KA 9ICAA 2H3VA 3PW4A 5AM2A 4RQ3A 2JEIA 1BPBA 4KX3A 4NM2A 2D3DA 2P35A 3RJEA 2PMZC 2E1FA 1QH9A 3KOOA 9ICKA 2UVRA 4M04A 3BDPA 4F4KA 1YZ7A 5AM3A 2ATLA 1L3TA 3WK7A 3TKAA 3RBDA 5J2HA 1X2IA 4DFKA 4TUQA 2Y1IA 3C21A 5J8YA 2NRXA 5KFGA 1S10A 3L5KA 5KFIA 1X9WA 2E1EA 4O5CA 1B22A 1WWVA 5J29A 3QE9Y 3HW8A 4M2YA 3TARA 1BPDA 1UCVA 2KG5A 2KZMA 4IR9A 1XO0A 4J9RA 3FYHA 3PW5A 1N2XA 4PGYA 2R8IA 2FLNA 5IIMA 5KFVA 3PMLA 3OHBA 4RPZA 2YMMA 2XGPA 2XC9A 5J0TA 2IA6A 4JV0A 4R65A 2JRZA 3UQ0A 5HMMA 1SL2A 3MGHA 3U26A 2G07A 5AKXA 4XRHA 3CNHA 5CRXA 4QZDA 3GV8B 2FI1A 2F1HA 3AN1A 3ZD9A 2KMDA 3FAHA 9ICNA 3PW0A 4YG2A 1DGSA 2XCAA 1SZPA 3PSPA 3M1YA 4UB8U 1L6NA 2WFAA 1NKBA 3GILA 3SD7A 5CA7A 2HMXA 4F5OA 1SV0A 4F5NA 1UA0A 4DSLA 5J2IA 3H7IA 9ICXA 5CWRA 1MQ3A 4EYHB 4Y2RA 4ECQA 2DWQA 9ICFA 1ZQLA 5AKGA 2LYBA 2KD1A 1COOA 3R9KA 8ICTA 1UQVA 4ED1A 1U45A 4FE3A 2P6RA 4BGDA 3QX7A 2FMPA 1L8OA 3I1YA 2C2EA 4ECTA 3MFHA 4J9QA 4I2IA 3RFAA 2IOHA 2KIVA 4DS4A 4QZBA 1TAQA 2E3TA 3RJGA 2ZIWA 1T94A 2KICA 9ICJA 5CEHA 4KLQA 2YN4A 5F9NA 4IR1A 4Y2QA 4AYBF 3PO5A 1O03A 4F3OA 5HP4A 3RRHA 5DG7A 2MA1A 5DDMA 1BNPA 5KL1B 3F53A 1AROP 1WYGA 4LJXA 1PK3A 3M9NB 5AM5A 4PPXA 4UB4A 3RH6A 5TZVA 4DSJA 2EQYA 4Y2YA 2QKQA 2ZTDA 4GIBA 3RJJA 4NLKA 3RJHA 5J8YC 1Z3EB 3T5HA 2W3RA 1X9XA 4GXJA 5KFNA 2Y9TA 1ZOLA 2DBYA 3AM9A 1D8BA 3EPIA 3MR3A 5AKEA 1S0OA 2K4EA 5KT6A 2HVHA 2ZTCA 4YXMA 2MU2A 3NVWA 2FMQA 5DKWA 4DO9A 1PVQA 1VLBA 1IM4A 2ZIWB 1ZQKA 2EZZA 4M0AA 4RUAA 1UHUA 3GFKB 5KFXA 1ZD3A 1ZQHA 4IQTA 1JN3A 1N60A 2NRWA 4B9NA 1QLNA 3Q8PB 5J0UA 2DPIA 4F72A 1FO4A 3M9OB 1L3VA 4M6WB 2XVTA 3MABA 5J2JA 1JXEA 4RNNA 2F2AB 1LKYA 3LWLA 1QQ6A 3RAXA 1NJYA 1F5SA 3UQ2A 2XICA 4YVZA 4LZGA 4O3OA 2JEJA 2A1AA 2D8CA 4OJ5A 4XUSA 2K8BB 2HOQA 5KNIA 5HHHA 4F4YA 4F4XA 4MFFA 2PFPA 1OXJA 3JPQA 1SL0A 4RPYA 5J2EA 1SV0C 2Y0SC 3V7JA 1PVRA 4JMUA 2EAPA 1OW5A 2KN7A 1X6JA 1J2MA 1QTMA 5J2GA 2GWSA 3C2KA 5BOLA 3NRWA 1PUZA 2ISPA 1HUOA 1JROA 2I9GA 1RQLA 1S97A 2W7OA 5DQGA 5ALEA 2ODGA 2FLLA 1VDVA 2Q4TA 4QZ8A 3PSIA 2JXJA 1S77D 4R8UA 4CDGA 3QU5A 4IQUA 4UBBA 1L8LA 2ZXIA 4QW9A 3FM9A 2HW3A 2RQ5A 4IC9A 2NO4A 5KFAA 2ZIXA 5F3XB 3RF9A 4DL6A 3PY8A 1LV5A 1ZQYA 1KRPA 2BZFA 4YCXA 1JXLA 4GXKA 2BGWA 5KFOA 5DBBA 2EH9A 7ICMA 3H0LB 2UVWA 4QW8A 3BQ1A 2V4RA 3WKCA 3IG5A 3C5FA 1XO1A 2ZIUB 4DSEA 5ALMA 1ZYQA 3VCBA 5CJ7A 2KSOA 1U49A 3RR7A 2QB0A 3BZKA 2LYAA 3KTQA 2E8MA 1Z4NA 3UMCA 2JZBB 2M0NA 2I1QA 4YMOA 4C8OA 3H0RB 1ZQSA 9ICPA 4IS7A 2AJQA 3CRXA 5DG8A 4UB5A 4QZGA 1KTQA 4KN7A 5KT4A 4QWDA 5KFQA 3OSPA 4G3IA 4KLFA 3IDWA 4R8UB 5KG2A 3IN5A 1ZQTA 5ALDA 4DSIA 4Z6FA 4KITB 3IRUA 1KSPA 2W9CA 2K4PA 4O5KA 1A77A 3EW9A 4ZOHC 2J6SA 1TKDA 3JPRA 3DV9A 3Q8RB 2W9AA 2AGPA 1BVSA 4EEYA 1ZQVA 2ZUCA 4ELUA 3OSNA 2KVCA 2IOFA 2FLPA 1NJZA 2XY6A 3SI8A 5ALYA 2HHXA 2EDUA 4FO6A 3ICXA 3QZ8A 3NVZA 2CN1A 4J9NA 3T3FA 1WCLA 1TK8A 2Y9UA 3M6ZA 2HCFA 1XU4A 5KG6A 1KKXA 2K4IA 2XY5A 2IBKA 1QSLA 1SZHA 5J0PA 2H3FA 2ESEA 1L7NA 2W7PA 4NLNA 4DS5A 5ALGA 5DB6A 3PNCA 4C0ZA 1Z1VA 3F5AA 1PK1A 1BPZA 8ICCA 5ALKA 4UAWA 1Q8KA 3KHGA 4KLMA 3OPXA 2W9CB 2C2RA 7ICGA 4RUCA 4QZHA 1C7YA 2RRDA 3Q8KA 4RU9A 4RQMA 3JPSA 1C20A 2YY6A 2HBKA 4WJ3B 4YR0A 3Q8QB 3N4MB 1ZQIA 2KP7A 3ISBA 5KFDA 1A0PA 5AKYA 4RQ7A 4HAIA 2KJ5A 1TV9A 3M6KA 4O3RA 2YB4A 3ETLA 2AQ4A 4US8A 4Q45A 3C1YA 3L4PA 2KIWA 2K89A 2BCVA 4YXJA 3PX0A 2ASDA 4AYBC 4P0QB 1T7PA 9ICHA 4QIWC 9ICGA 2MSNA 4TQSA 1A76A 5AIBA 3C23A 2DFLA 2K8AA 2W04A 4UB3A 5AI5A 3NASA 7ICTA 4F93B 2IHMA 2G08A 1WCNA 4UB2A 1NI3A 2VKQA 3WKDA 5B66U 2L5YA 4KTQA 5AI8A 3QU7A 5J0RA 4QZEA 2JV3A 5J0WA 1PK1B 3C29A 4FFDA 1NJWA 5CR0A 2DPJA 4J9MA 1KLNA 1CRXA 1KFTA 3B9JA 7ICEA 4YR2A 1FFUA 2BCQA 4KLEA 4Z6EA 3N97B 5AK4A 3BS5A 2A3VA 2RDIA 5B5EU 3J81j 2PKEA 5DGAA 2RHFA 5KFMA 3M8SA 4P4PA 5KFJA 4XQ8A 1KBUA 3AU6A 4ECXA 1ZRMA 4DFMA 7ICQA 3TFRA 4RQNA 5L1JA 2OHFA 2AGOA 4O9MA 4UAYA 3PW2A 5KFWA 4ED8A 4ICAA 8ICOA 2EZYA 2EZXA 2FE9A 3QU2A 3Q8SB 4J9OA 4CGZA 1L7MA 5ALUA 4I2JA 2EAMA 2ZTEA 2E8OA 5KT5A 4BWJA 2P66A 3WKBA 4QZAA 5G5HA 1IV8A 4M9HA 3JPNA 1SKWA 5DGBA 5KFRA 2ZXHA 4KLTA 4JV2A 1ZD2P 1JIHA 2GLEA 2KZ3A 1RQNA 3QYPA 2HOFA 1RYRA 5DQIA 4O3NA 3KBBA 2R8KA 3BS5B 5ALXA 2LYHA 4NLBA 3TI0A 4MFCA 2OH2A 2AHOB 2W11A 5ALTA 4I2FA 5EOZA 4QJFB 1SWVA 2W9BA 1IXRA 2BHNA 1NZPA 3AQEA 5AI9A 4M9NA 4DCCA 5EE1A 5IIKA 4G9BA 4F91B 3IG8A 3AEVA 4CRXA 8ICQA 3ZI4A 2V9WA 1SKRA 3RR8A 3H8SA 2DQNB 2BQUA 2JEGA 3UXOA 1ZD4A 2G0AA 2HHTA 9ICMA 4C8NA 5J0YA 1YT3A 4JWMA 3OJUA 2JMGA 4RZRA 2KOBA 1XC9A 4ED7A 5ALNA 5D49A 3AL0B 2MAXA 4BUGA 1KFDA 1N48A 4PHDA 5EWFA 3MR2A 5F9LA 4TUSA 4K4GA 3A0HU 2AH5A 3HRDD 5D46A 4FBUA 4CE6A 4M9JA 5BOMA 2PXIA 2BPCA 2OYYA 5DB9A 7ICUA 3GIIA 4JK1A 2YMPA 5KFEA 2PFNA 3GU3A 2AGQA 2W9BB 4JUZA 1TK5A 3G6YA 3OTQA 5ALQA 1ZQBA 9ICRA 8ICIA 1NK6A 1Z1BA 2BCUA 4TUPA 2B21A 2HHQA 1ZQDA 3K1RB 1ZJMA 1IIPA 3C1ZA 4QIWF 3RB6A 1S76D 4EX7A 2FMSA 8ICFA 4TQRA 1UA1A 2HHUA 4LVSA 4M6WA 5KFHA 5J2FA 2BCRA 4RQ2A 2W43A 3HKZF 1N56A 4Q43A 2KHQA 4M47A 2XO7A 4O3MA 4DF8A 4DLGA 4KLSA 1U48A 2ES6A 2WF8A 4J9KA 1BPEA 1X40A 3RJFA 1SXDA 1ZXIA 1ZQAA 5DLGA 4FS1A 2K4HA 3QEBZ 2J6UA 1LVHA 2PI5A 5AKIA 2GO7A 4FS2A 1ZD5A 1D9FA 5AI4A 1SV4A 4DQPA 8ICBA 4IRCA 2HHVA 2HI0A 4PH5A 2BQ3A 3WKEA 9ICVA 2Q0ZX 5J0XA 4FZMA 4F71A 3N28A 2DGZA 2W03A 2ZJAA 4YP3A 3N7PD 4MEXA 4P0PB 2WF6A 1J2NA 2YX8A 1N5WA 2LM1A 1ZQNA 2HDOA 4R66A 4B9SA 4OCZA 1XSPA 1KEJA 5H2FU 9ICSA 4NV0A 1XS9D 3FC4A 8ICHA 2NRTA 3T79A 2D6FC 4MHVA 2M9NA 4DL3A 2N1RA 3EYZA 5KFYA 5EWEA 3KHRA 3RJIA 2XY7A 2JH1A 4EENA 4QWEA 4OJ6A 1L7PA 1SB3C 3MGVA 1S5LU 4NLZA 2LI6A 1A6SA 2ZIUA 5KL8B 3LDAA 5ALWA 2G06A 3PSTA 5TISU 5ALVA 5BPCA 4DSKA 3ORYA 5AKHA 4NY8A 4PZNA 4QWBA 1P7DA 1SIJA 5J0OA 3SQIA 2JZBA 3RB0A 1RXVA 2B0CA 1UT8A 3TAQA 2VA2A 1ZQRA 4MEYA 2VJ5A 8ICXA 3TADA 5ALRA 1B43A 2XGQA 2YQEA 5KG3A 2EAOA 4BX9C 3GDXA 4Z6CA 3EZ5A 1ZQCA 4J9SA 4PJ0U 3CP8A 2XI9A 2NRVA 3PX4A 3V6HA 3MDCA 2K8CB 4K4HA 4ECYA 3BS7A 4GLXA 3M7DA 3PMNA 1NK5A 2LPEA 3UMBA 9ICIA 1PZNA 4PHPA 4C8MA 1DRGA 5AIAA 3HILA 3N7RC 4NWIA 3T5JA 1U4BA 2UVVA 1T4GA 2HOIA 4BXOA 4QZFA 3UXNA 3M8RA 1NZBA 2A1JB 1RYSA 8ICUA 3QUBA 4I2AA 4ECZA 1K1QA 3H40A 1L7OA 3V72A 2ZUBA 2XCPA 1JRPA 8ICSA 5L1MA 4EELA 5JUMA 1EXNA 2KZZA 3WK5A 4JB3A 2FJ6A 4TURA 3ZDBA 5IIIA 2KK0A 4GC6A 1NKCA 4B9VA 4C7YA 4EYIB 1O08A 4YN4A 4PL2A 1U9LA 1N63A 3V7KA 4R63A 1N5XA 1RYUA 1LB2B 3D6JA 4KLIA 4UASA 8ICGA 1PVPA 1N61A 4USAA 1N62A 3GZFA 1T3QA 1ZRNA 4UATA 3BJYA 2RP5A 2NV3A 4DF4A 1KFSA 4O0IA 3K1ZA 2BKEA 2DKZA 8ICJA 7ICSA 2WF9A 4UW9A 4CF5A 4F4WA 3GQCA 4KLJA 3S6JA 1GO3F 3PVXA 4KLLA 3ZDDA 1CEZA 3RJKA 2ASJA 4J03A 4M9LA 4QNLA 4IL6U 3IHQB 4ECRA 1WG8A 5DLFA 3GIKA 4BXOB 4IQVA 2C22A 3HP6A 3ONNA 5KG0A 4J9LA 2QB1A 3FDSA 3I76A 5J2BA 3NS1A 5AKZA 1K1SA 3SEIA 4DFJA 1FFVA 2P6UA 1ZQFA 1B4FA 4US9A 5ALHA 3C2MA 2HSZA 4DQQA 1OUQA 9ICOA 4C7ZA 1UPHA 3OGUA 4Y2PA 1X9SA 3RB4A 1SL1A 1ZQXA 3KZXA 4P0QA 3EUB2 4P4OA 3GV5B 2ZG6A 1TAMA 3HJEA 5KFLA 4DL7A 4PL1A 2R8GA 2ALZA 4YD2A 4ED6A 2XIDA 3TQ1A 3WKAA 1XSNA 2ASLA 1KDHA 2R8JA 1ZJNA 5GTHU 3C28A 2G5HB 2VJ4A 1MSWD 2QLTA 4RQ0A 3NVVA 2DF4B 4DL5A 2HHSA 1ZQEA 2QARB 1ZQWA 3TADC 2RDJA 2VANA 3SV3A 4MF8A 4I27A 3H8JA 3T5KA 2JEFA 4F92B 5ALLA 4KLDA 3RTVA 5J0QA 1B0XA 4NLCA 1UT5A 2WB1F 4QWCA 4B9TA 4ECSA 4YMMA 5AKJA 3I28A 1DGJA 4C80A 4OJLA 1RPLA 1L5UA 1KL9A 4KMUA 3NRZA 5J2DA 4F2RA 4X5VA 1S0NA 3JPPA 3HKZC 1JI7A 1JUDA 3PV8A 3V7LA 1TE2A 5KAFU 1QCKA 1Y88A 1JALA 3DEEA 3ISDA 3THVA 2FPLA 4I2EA 2JHDA 5ALZA 3LK9A 4OJPA 4UAZA 5L1KA 4F8RA 2CRXA 1HIWA 4U7CA 4K4IA 1CUKA 3QU4A 5T14A 1ZQOA 4J9PA 3T5LA 2O6KA 2NO5A 3SV4A 5ALPA 3QUQA 4UQGA 4B9MA 5E79U 4CCHA 4YFKA 5AK6A 4GXIA 4B9LA 1S8OA 3F2CA 1Q3UA 7ICVA 1HJPA 2HHWA 3K4GA 4Z6DA 5JRTA 1VJ5A 2ISOA 2KKVA 7ICIA 3QU9A 9ICBA 2LHTA 5DG9A 3D2SA 2E5SA 4DQRA 3AMZA 3AUOA 5J2AA 1NJXA 2F8LA 3H4BA 3VC8A 7ICPA 3ZDEA 5J0SA 3K75D 4C4RA 4KX5A 2W54A 2C2DA 2I6XA 3AU2A 3SZ2A 3JPOA 4Y2UA 1HUZA 5CP2A 4RNOA 4QWAA 5KG4A 3IP4B 1NNLA 1V97A 3KHLA 4O5EA 7ICKA 1DK3A 1ZQUA 3PR5B 5KT7A 5ALOA 5J2CA 2GOLA 3CYMA 1MN8A 2I5HA 3HPOA 3TAPA 8ICAA 1CI4A 1COKA 4BDPA 5KFZA 3L3FX 5IIOA 1S9FA 1F0MA 2KKPA 5KTQA 2MRLA 2KJ9A 2ZIVB 2HVIA 1L3SA 4DFDA 3B0XA 2ZUDA 1DXSA 3C2LA 4DL4A 4CNQA 8ICVA 1Z00A 4EBEA 3UXPA 4EBDA 1V9PA 2BDPA 3MDAA 2KFNA 2DKXA 4I29A 4GFJA 1FEZA 2DUYA 4KLGA 2WAQF 4ED0A 3BQ0A 4F5QA 3KHHA 1V38A 3GIJA 1NKEA 1DOQA 4KN4A 3UPQA 1KN5A 2GH1A 4RPXA 4AP9A 1BGXT 3PSFA 4I2HA 4PHEA 8ICEA 3MBYA 2H3QA 5ALFA 3KFUF 4RQ8A 4KLOA 3A0BU 1BPYA 2F1JA 5HMLA 5DDYA 2E8NA 3QUTA 5K4LA 4Y2SA 4A8EA 2JGAA 2F76X 3MFIA 5DBCA 4B9UA 5KAIU 3H0MB 1KW4A 4UAUA 1WWUA 5ALSA 1KQQA 1T3NA 7ICRA 3Q8LA 4PGQA 5C5JA 1BNOA 2PFQA 5AICA 1NK0A 4P0PA 5KFCA 2VIXA 4I2CA 4RT2A 4HYKA 1Z00B 2MUTA 3IM1A 4QZCA 5KFPA 7ICLA 4F5RA 1ZQMA 7ICNA 1XWLA 2V4QA 4ED2A 2DL0A 5HR6A 4NXZA 1ECWA 4IRDA 3QUCA 1WUDA 4UARA 2W3SA 2WHEA 3F5EA 4EZ6A 5AM0A 1NK9A 3TANA 5HHIA 3H4DA 7ICOA 1NOMA 4IQWA 5EE0A 1J97A 2HBMA 3CW2C 3PZPA 4PZOA 4KLUA 2BPGA 1X42A 4FBTA 3N7SC 1RDFA 5JU5A 2LM4A 3B0YA 3D2NA 5KFUA 9ICEA 4MF2A 2KE7A 2OWOA 4ELTA 5JTIA 4F50A 4LZDA 3MR6A 3RH5A 2UVUA 1NK7A 3KD3A 2OCEA 1Q3VA 3NGDA 1AQ6A 3Q8MA 5AI6A 2HBJA 2JH7A 2MUTB 5EWGA 2IMWP 3SMVA 3TACB 5KFKA 1QSYA 4RQ5A 2PMZF 3AQFA 4O3PA 4CF4A 5KFSA 4UB1A 4M9GA 3LVVA 3RBEA 2NYVA 1ED1A 4UBCA 3BQ2A 3SYZA 2KV2A 3E58A 2A1JA 1Z19A 2VA8A 3KKAA 2W9MA 4NJ8A 3LVWA 8ICNA 2WB1C 5KFBA 2WF7A 1RXWA 3BQ7A 1MA7A 3MC1A 2KVSA 1D8YA 4O3QA 2LKYA 2OM6A 1JMSA 4BJQA 5KFTA 3O0FA 3IV6A 4YR3A 4Q8EA 2EANA 4RQ1A 3PO4A 4UAVA 3QXGA 4DSFA 4DQIA 5L1IA 1RM6C 2YB1A 5G5GA 2G5IB 9ICWA 1Q46A 3BQTA 4C4SA 7ICFA 2KNJA 1NK8A 4C4TA 4RQ6A 1YZ6A 4PGXA 4YD1A 4U6PA 3WK4A 5KFFA 1RZTA 2F44A 4JWNA 1HEKA 4DWIA 4DL2A 5IIJA 1SWWA 1SGGA 2FPKA 2J6TA 3ALRA 2F3NA 3EWAA 3SR6A 4ECUA 3QZ7A 4KMOB 1L3UA 4ECVA 4JV1A 2FPMA 3SENA 4UB6U 9ICQA 4R64A 5IILA 4EEKA 1DK2A 4DQSA 5CB1A 1ZQQA 2R18A 4NLGA 1TAUA 1LKYB 2F77X 1ZQGA 9ICCA 4MFAA 4GC7A 3RRGA 2LMRA 5ALJA 4P2HA 2HBLA 3QNMA 5FP0A 2BCSA 5L9XA 3NVYA 4QZIA 3H8MA 4NL9A 2PI4A 4Y2VA 4DEZA 2W8LA 3LYSA 8ICWA 9ICTA 8ICMA 5KG1A 3HX0A 3C5GA 4IRKA 4O3SA 5AM4A 3UM9A 2Z7JA 5AKKA 3F2DA 3OJSA 4ECWA 2BDUA 5AKLA 1S0VA 4DFPA 1ZQJA 4Q8FA 1Z4OA 5KT3A 1X9MA 3DDHA 1URJA 4RNMA 3H8WA 4RT3A 2WF5A 1S0MA 1H38A 3E2EA 8ICKA 3PX6A 2QARA 2KTQA 5D4BA 3QEAZ 4Y2XA 2OXOA 3MGIA 3WK9A 2PFOA 4OO1J 2BQRA 3ZDAA 1XNSA 2YTUA 2ZJ8A 3SAFA 3OHAA 2KFZA 5IINA 3G6XA 3TFSA 1X66A 3NTUA 3PR4A 2ZIXB
chains in the Genus database with same CATH topology
2ZIWA 1T94A 3D2NA 4PL1A 2CPRA 2KICA 3CRXA 2WAQF 1HEKA 2HBKA 4CGZA 4WJ3B 5HR7A 4OJ5A 4NV0A 2K8BB 2HOQA 2XIDA 1A0PA 4AYBF 2OYYA 3ALRA 3D2QA 3F2CA 1Q3UA 3T79A 2D6FC 3C28A 2G5HB 3GU3A 2MA1A 2N1RA 5A0LA 4KMOB 5C0YA 2KJ5A 2VJ4A 2Y0SC 2KKVA 3F53A 5KL1B 3M6KA 4ACOA 2GH1A 3IN5A 2YB4A 4JMUA 1PVRA 1Q3VA 2DF4B 2LHTA 3D2SA 2E5SA 2KJ8A 2KHVA 3PSFA 2ZXHA 2G07A 4PL2A 2JH1A 2HBJA 2JH7A 2LBOA 2H3QA 2WAQC 3NRWA 2F8LA 3KFUF 2KIWA 3VC8A 2K89A 3SAHA 1Z1BA 2HOFA 5CRXA 2R18A 2ZIVA 4OJ6A 3MGVA 3F2BA 2F77X 3SMVA 1PVPA 2KEYA 4AYBC 1A6SA 4P0QB 2ZIUA 4OJOA 2W7OA 4QIWC 4KX5A 5KL8B 3GZFA 1IIPA 2PMZF 3AQFA 2K8AA 2G06A 4QIWF 3PSTA 4NLBA 2HBLA 4A8EA 2OH2A 2Q4TA 4NLCA 3PSPA 2RP5A 2W04A 2NV3A 2WB1F 2JGAA 2F76X 3PSIA 1L6NA 3K1ZA 2G08A 3HKZF 4QJFB 3LVVA 2VKQA 3H0MB 4CDGA 2KHQA 3IP4B 1ED1A 1P7DA 1GO3F 2HMXA 4O3MA 2ZXIA 3LYSA 2H3VA 3SQIA 2KVCA 3E0FA 2KV2A 4KX3A 4FZNA 3C29A 4P0PA 4IC9A 4OJLA 2VIXA 1D8BA 2VJ5A 3AQEA 2K4EA 4QNLA 1XNSA 1CRXA 2ZIXA 2PMZC 3ICXA 3RF9A 2E1FA 1Z19A 2GOLA 2CN1A 3CYMA 4FZLA 3IG8A 3M6ZA 4CRXA 3LVWA 2Z7JA 2WB1C 3F2DA 3ONNA 1PVQA 3L3FX 2A3VA 4BX9C 2BDUA 3HKZC 3SAGA 3H0LB 2K4HA 2KKPA 2RHFA 2ZIWB 3NUQA 2MRLA 2LYBA 2H3ZA 2KD1A 3CP8A 2KJ9A 2ZIVB 1MA7A 3IG5A 2DQNB 2LKYA 2K4IA 2OM6A 4BJQA 2XI9A 2G09A 1SZHA 2ZIUB 2H3FA 2G0AA 1URJA 3O0FA 5HR6A 1ECWA 3VCBA 2W7PA 2K8CB 4FE3A 3DEEA 1OUQA 1F44A 1KBUA 1YT3A 1WUDA 1UPHA 3M7DA 2JMGA 2KOBA 2YB1A 4C0ZA 2G5IB 3F5EA 3F5AA 2XVTA 2JHDA 2E1EA 4OJPA 3AL0B 2LYAA 2F2AB 2H3IA 2OXOA 4OO1J 4BUGA 1DRGA 1ZQ1C 3KZXA 4P0QA 3N7RC 4NWIA 4FZMA 2CRXA 3OPXA 2HBMA 1HIWA 2DGZA 2KNJA 2Y0SF 4U7CA 2M0NA 2W03A 2ZG6A 4ICAA 2HOIA 3N7PD 1TAMA 2XICA 3SAFA 3PZPA 4P0PB 4U6PA 3N7SC 3RFAA 2RRDA 2YX8A 3H0RB 5T14A 1XO0A 1NZBA 4GFJA 2ZIXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AYB F;  2WAQ F;  2WB1 F;  2PMZ F;  2Y0S F;  3HKZ F; 
#chains in the Genus database with same CATH topology
 2RLT A;  3D2Q A;  2H5X A;  5KG5 A;  1TVA A;  3RAQ A;  4EX6 A;  1JX4 A;  4I2B A;  3JPT A;  1D8L A;  5ALI A;  2KJ8 A;  2KSO B;  4NM1 A;  3KKA C;  4P4M A;  2LBO A;  4C8L A;  2WAQ C;  2QB0 B;  1QQ5 A;  3SAH A;  3EPG A;  4QZ9 A;  2E8P A;  5DBA A;  1SXE A;  3GIM A;  5J2K A;  3LWM A;  5EE3 A;  7ICH A;  1ZQZ A;  8ICZ A;  2AU0 A;  4Q44 A;  2A19 A;  5DB8 A;  2BPF A;  2OEH A;  4E0D A;  4I28 A;  5CHG A;  1RG6 A;  2Y1J A;  4DOC A;  3PW7 A;  8ICL A;  1X6I A;  2W55 A;  3E0F A;  4FZN A;  1FIQ A;  5EE9 A;  5AM1 A;  3BZC A;  4ZH4 A;  3KZI U;  3WU2 U;  5HNK A;  4FZL A;  2AQ0 A;  3UMG A;  4Y2T A;  4F2S A;  4C8K A;  3SAG A;  2VA3 A;  4XA5 A;  9ICU A;  4I2G A;  3NUQ A;  4I2D A;  1ZQP A;  2H3Z A;  2BR0 A;  1QQ7 A;  9ICL A;  3MR5 A;  3ZD8 A;  2G09 A;  1D9D A;  2IHN A;  1NK4 A;  4F4Z A;  1XSL A;  5L1L A;  4OD0 A;  4BWM A;  5AHX A;  2ZJ5 A;  3V6K A;  5AK3 A;  2H3I A;  1SKS A;  2FDR A;  1BPX A;  2K60 A;  1ZQ1 C;  1QSS A;  3ISC A;  4EBC A;  2Y0S F;  5KT2 A;  3ETR A;  4CF3 A;  2B6G A;  8ICY A;  3G6V A;  2YML A;  1U47 A;  3GV7 B;  2W8K A;  4DOA A;  7ICJ A;  2JR5 A;  2CPR A;  5HR7 A;  2IOF K;  2YMQ A;  3HT3 A;  1K5O A;  4NL9 C;  1TFR A;  4PHA A;  5C0Y A;  5A0L A;  5AK5 A;  8ICR A;  5KG7 A;  3F2B A;  4ACO A;  3V6J A;  1TK0 A;  1F44 A;  4YQW A;  2KHV A;  1M6Y A;  5AI0 A;  4KLH A;  1T8E A;  2AXT U;  1IG6 A;  3ED5 A;  2R8H A;  2F1I A;  4YMN A;  2ZIV A;  3WK8 A;  4B6J A;  4ED3 A;  2KEY A;  8ICP A;  1MQ2 A;  4OJO A;  5GTI U;  3HWT A;  4F5P A;  3RB3 A;  2C28 A;  2CXY A;  4RQ4 A;  1MC8 A;  5DQH A;  2WTF A;  4EZ9 A;  3RH4 A;  4Y2J A;  3ZDC A;  3M9M B;  2NRZ A;  4ELV A;  4DLE A;  1ZET A;  4DOB A;  1V85 A;  5DB7 A;  3WK6 A;  2F8K A;  9ICA A;  2H3V A;  3PW4 A;  5AM2 A;  4RQ3 A;  2JEI A;  1BPB A;  4KX3 A;  4NM2 A;  2D3D A;  2P35 A;  3RJE A;  2PMZ C;  2E1F A;  1QH9 A;  3KOO A;  9ICK A;  2UVR A;  4M04 A;  3BDP A;  4F4K A;  1YZ7 A;  5AM3 A;  2ATL A;  1L3T A;  3WK7 A;  3TKA A;  3RBD A;  5J2H A;  1X2I A;  4DFK A;  4TUQ A;  2Y1I A;  3C21 A;  5J8Y A;  2NRX A;  5KFG A;  1S10 A;  3L5K A;  5KFI A;  1X9W A;  2E1E A;  4O5C A;  1B22 A;  1WWV A;  5J29 A;  3QE9 Y;  3HW8 A;  4M2Y A;  3TAR A;  1BPD A;  1UCV A;  2KG5 A;  2KZM A;  4IR9 A;  1XO0 A;  4J9R A;  3FYH A;  3PW5 A;  1N2X A;  4PGY A;  2R8I A;  2FLN A;  5IIM A;  5KFV A;  3PML A;  3OHB A;  4RPZ A;  2YMM A;  2XGP A;  2XC9 A;  5J0T A;  2IA6 A;  4JV0 A;  4R65 A;  2JRZ A;  3UQ0 A;  5HMM A;  1SL2 A;  3MGH A;  3U26 A;  2G07 A;  5AKX A;  4XRH A;  3CNH A;  5CRX A;  4QZD A;  3GV8 B;  2FI1 A;  2F1H A;  3AN1 A;  3ZD9 A;  2KMD A;  3FAH A;  9ICN A;  3PW0 A;  4YG2 A;  1DGS A;  2XCA A;  1SZP A;  3PSP A;  3M1Y A;  4UB8 U;  1L6N A;  2WFA A;  1NKB A;  3GIL A;  3SD7 A;  5CA7 A;  2HMX A;  4F5O A;  1SV0 A;  4F5N A;  1UA0 A;  4DSL A;  5J2I A;  3H7I A;  9ICX A;  5CWR A;  1MQ3 A;  4EYH B;  4Y2R A;  4ECQ A;  2DWQ A;  9ICF A;  1ZQL A;  5AKG A;  2LYB A;  2KD1 A;  1COO A;  3R9K A;  8ICT A;  1UQV A;  4ED1 A;  1U45 A;  4FE3 A;  2P6R A;  4BGD A;  3QX7 A;  2FMP A;  1L8O A;  3I1Y A;  2C2E A;  4ECT A;  3MFH A;  4J9Q A;  4I2I A;  3RFA A;  2IOH A;  2KIV A;  4DS4 A;  4QZB A;  1TAQ A;  2E3T A;  3RJG A;  2ZIW A;  1T94 A;  2KIC A;  9ICJ A;  5CEH A;  4KLQ A;  2YN4 A;  5F9N A;  4IR1 A;  4Y2Q A;  4AYB F;  3PO5 A;  1O03 A;  4F3O A;  5HP4 A;  3RRH A;  5DG7 A;  2MA1 A;  5DDM A;  1BNP A;  5KL1 B;  3F53 A;  1ARO P;  1WYG A;  4LJX A;  1PK3 A;  3M9N B;  5AM5 A;  4PPX A;  4UB4 A;  3RH6 A;  5TZV A;  4DSJ A;  2EQY A;  4Y2Y A;  2QKQ A;  2ZTD A;  4GIB A;  3RJJ A;  4NLK A;  3RJH A;  5J8Y C;  1Z3E B;  3T5H A;  2W3R A;  1X9X A;  4GXJ A;  5KFN A;  2Y9T A;  1ZOL A;  2DBY A;  3AM9 A;  1D8B A;  3EPI A;  3MR3 A;  5AKE A;  1S0O A;  2K4E A;  5KT6 A;  2HVH A;  2ZTC A;  4YXM A;  2MU2 A;  3NVW A;  2FMQ A;  5DKW A;  4DO9 A;  1PVQ A;  1VLB A;  1IM4 A;  2ZIW B;  1ZQK A;  2EZZ A;  4M0A A;  4RUA A;  1UHU A;  3GFK B;  5KFX A;  1ZD3 A;  1ZQH A;  4IQT A;  1JN3 A;  1N60 A;  2NRW A;  4B9N A;  1QLN A;  3Q8P B;  5J0U A;  2DPI A;  4F72 A;  1FO4 A;  3M9O B;  1L3V A;  4M6W B;  2XVT A;  3MAB A;  5J2J A;  1JXE A;  4RNN A;  2F2A B;  1LKY A;  3LWL A;  1QQ6 A;  3RAX A;  1NJY A;  1F5S A;  3UQ2 A;  2XIC A;  4YVZ A;  4LZG A;  4O3O A;  2JEJ A;  2A1A A;  2D8C A;  4OJ5 A;  4XUS A;  2K8B B;  2HOQ A;  5KNI A;  5HHH A;  4F4Y A;  4F4X A;  4MFF A;  2PFP A;  1OXJ A;  3JPQ A;  1SL0 A;  4RPY A;  5J2E A;  1SV0 C;  2Y0S C;  3V7J A;  1PVR A;  4JMU A;  2EAP A;  1OW5 A;  2KN7 A;  1X6J A;  1J2M A;  1QTM A;  5J2G A;  2GWS A;  3C2K A;  5BOL A;  3NRW A;  1PUZ A;  2ISP A;  1HUO A;  1JRO A;  2I9G A;  1RQL A;  1S97 A;  2W7O A;  5DQG A;  5ALE A;  2ODG A;  2FLL A;  1VDV A;  2Q4T A;  4QZ8 A;  3PSI A;  2JXJ A;  1S77 D;  4R8U A;  4CDG A;  3QU5 A;  4IQU A;  4UBB A;  1L8L A;  2ZXI A;  4QW9 A;  3FM9 A;  2HW3 A;  2RQ5 A;  4IC9 A;  2NO4 A;  5KFA A;  2ZIX A;  5F3X B;  3RF9 A;  4DL6 A;  3PY8 A;  1LV5 A;  1ZQY A;  1KRP A;  2BZF A;  4YCX A;  1JXL A;  4GXK A;  2BGW A;  5KFO A;  5DBB A;  2EH9 A;  7ICM A;  3H0L B;  2UVW A;  4QW8 A;  3BQ1 A;  2V4R A;  3WKC A;  3IG5 A;  3C5F A;  1XO1 A;  2ZIU B;  4DSE A;  5ALM A;  1ZYQ A;  3VCB A;  5CJ7 A;  2KSO A;  1U49 A;  3RR7 A;  2QB0 A;  3BZK A;  2LYA A;  3KTQ A;  2E8M A;  1Z4N A;  3UMC A;  2JZB B;  2M0N A;  2I1Q A;  4YMO A;  4C8O A;  3H0R B;  1ZQS A;  9ICP A;  4IS7 A;  2AJQ A;  3CRX A;  5DG8 A;  4UB5 A;  4QZG A;  1KTQ A;  4KN7 A;  5KT4 A;  4QWD A;  5KFQ A;  3OSP A;  4G3I A;  4KLF A;  3IDW A;  4R8U B;  5KG2 A;  3IN5 A;  1ZQT A;  5ALD A;  4DSI A;  4Z6F A;  4KIT B;  3IRU A;  1KSP A;  2W9C A;  2K4P A;  4O5K A;  1A77 A;  3EW9 A;  4ZOH C;  2J6S A;  1TKD A;  3JPR A;  3DV9 A;  3Q8R B;  2W9A A;  2AGP A;  1BVS A;  4EEY A;  1ZQV A;  2ZUC A;  4ELU A;  3OSN A;  2KVC A;  2IOF A;  2FLP A;  1NJZ A;  2XY6 A;  3SI8 A;  5ALY A;  2HHX A;  2EDU A;  4FO6 A;  3ICX A;  3QZ8 A;  3NVZ A;  2CN1 A;  4J9N A;  3T3F A;  1WCL A;  1TK8 A;  2Y9U A;  3M6Z A;  2HCF A;  1XU4 A;  5KG6 A;  1KKX A;  2K4I A;  2XY5 A;  2IBK A;  1QSL A;  1SZH A;  5J0P A;  2H3F A;  2ESE A;  1L7N A;  2W7P A;  4NLN A;  4DS5 A;  5ALG A;  5DB6 A;  3PNC A;  4C0Z A;  1Z1V A;  3F5A A;  1PK1 A;  1BPZ A;  8ICC A;  5ALK A;  4UAW A;  1Q8K A;  3KHG A;  4KLM A;  3OPX A;  2W9C B;  2C2R A;  7ICG A;  4RUC A;  4QZH A;  1C7Y A;  2RRD A;  3Q8K A;  4RU9 A;  4RQM A;  3JPS A;  1C20 A;  2YY6 A;  2HBK A;  4WJ3 B;  4YR0 A;  3Q8Q B;  3N4M B;  1ZQI A;  2KP7 A;  3ISB A;  5KFD A;  1A0P A;  5AKY A;  4RQ7 A;  4HAI A;  2KJ5 A;  1TV9 A;  3M6K A;  4O3R A;  2YB4 A;  3ETL A;  2AQ4 A;  4US8 A;  4Q45 A;  3C1Y A;  3L4P A;  2KIW A;  2K89 A;  2BCV A;  4YXJ A;  3PX0 A;  2ASD A;  4AYB C;  4P0Q B;  1T7P A;  9ICH A;  4QIW C;  9ICG A;  2MSN A;  4TQS A;  1A76 A;  5AIB A;  3C23 A;  2DFL A;  2K8A A;  2W04 A;  4UB3 A;  5AI5 A;  3NAS A;  7ICT A;  4F93 B;  2IHM A;  2G08 A;  1WCN A;  4UB2 A;  1NI3 A;  2VKQ A;  3WKD A;  5B66 U;  2L5Y A;  4KTQ A;  5AI8 A;  3QU7 A;  5J0R A;  4QZE A;  2JV3 A;  5J0W A;  1PK1 B;  3C29 A;  4FFD A;  1NJW A;  5CR0 A;  2DPJ A;  4J9M A;  1KLN A;  1CRX A;  1KFT A;  3B9J A;  7ICE A;  4YR2 A;  1FFU A;  2BCQ A;  4KLE A;  4Z6E A;  3N97 B;  5AK4 A;  3BS5 A;  2A3V A;  2RDI A;  5B5E U;  3J81 j;  2PKE A;  5DGA A;  2RHF A;  5KFM A;  3M8S A;  4P4P A;  5KFJ A;  4XQ8 A;  1KBU A;  3AU6 A;  4ECX A;  1ZRM A;  4DFM A;  7ICQ A;  3TFR A;  4RQN A;  5L1J A;  2OHF A;  2AGO A;  4O9M A;  4UAY A;  3PW2 A;  5KFW A;  4ED8 A;  4ICA A;  8ICO A;  2EZY A;  2EZX A;  2FE9 A;  3QU2 A;  3Q8S B;  4J9O A;  4CGZ A;  1L7M A;  5ALU A;  4I2J A;  2EAM A;  2ZTE A;  2E8O A;  5KT5 A;  4BWJ A;  2P66 A;  3WKB A;  4QZA A;  5G5H A;  1IV8 A;  4M9H A;  3JPN A;  1SKW A;  5DGB A;  5KFR A;  2ZXH A;  4KLT A;  4JV2 A;  1ZD2 P;  1JIH A;  2GLE A;  2KZ3 A;  1RQN A;  3QYP A;  2HOF A;  1RYR A;  5DQI A;  4O3N A;  3KBB A;  2R8K A;  3BS5 B;  5ALX A;  2LYH A;  4NLB A;  3TI0 A;  4MFC A;  2OH2 A;  2AHO B;  2W11 A;  5ALT A;  4I2F A;  5EOZ A;  4QJF B;  1SWV A;  2W9B A;  1IXR A;  2BHN A;  1NZP A;  3AQE A;  5AI9 A;  4M9N A;  4DCC A;  5EE1 A;  5IIK A;  4G9B A;  4F91 B;  3IG8 A;  3AEV A;  4CRX A;  8ICQ A;  3ZI4 A;  2V9W A;  1SKR A;  3RR8 A;  3H8S A;  2DQN B;  2BQU A;  2JEG A;  3UXO A;  1ZD4 A;  2G0A A;  2HHT A;  9ICM A;  4C8N A;  5J0Y A;  1YT3 A;  4JWM A;  3OJU A;  2JMG A;  4RZR A;  2KOB A;  1XC9 A;  4ED7 A;  5ALN A;  5D49 A;  3AL0 B;  2MAX A;  4BUG A;  1KFD A;  1N48 A;  4PHD A;  5EWF A;  3MR2 A;  5F9L A;  4TUS A;  4K4G A;  3A0H U;  2AH5 A;  3HRD D;  5D46 A;  4FBU A;  4CE6 A;  4M9J A;  5BOM A;  2PXI A;  2BPC A;  2OYY A;  5DB9 A;  7ICU A;  3GII A;  4JK1 A;  2YMP A;  5KFE A;  2PFN A;  3GU3 A;  2AGQ A;  2W9B B;  4JUZ A;  1TK5 A;  3G6Y A;  3OTQ A;  5ALQ A;  1ZQB A;  9ICR A;  8ICI A;  1NK6 A;  1Z1B A;  2BCU A;  4TUP A;  2B21 A;  2HHQ A;  1ZQD A;  3K1R B;  1ZJM A;  1IIP A;  3C1Z A;  4QIW F;  3RB6 A;  1S76 D;  4EX7 A;  2FMS A;  8ICF A;  4TQR A;  1UA1 A;  2HHU A;  4LVS A;  4M6W A;  5KFH A;  5J2F A;  2BCR A;  4RQ2 A;  2W43 A;  3HKZ F;  1N56 A;  4Q43 A;  2KHQ A;  4M47 A;  2XO7 A;  4O3M A;  4DF8 A;  4DLG A;  4KLS A;  1U48 A;  2ES6 A;  2WF8 A;  4J9K A;  1BPE A;  1X40 A;  3RJF A;  1SXD A;  1ZXI A;  1ZQA A;  5DLG A;  4FS1 A;  2K4H A;  3QEB Z;  2J6U A;  1LVH A;  2PI5 A;  5AKI A;  2GO7 A;  4FS2 A;  1ZD5 A;  1D9F A;  5AI4 A;  1SV4 A;  4DQP A;  8ICB A;  4IRC A;  2HHV A;  2HI0 A;  4PH5 A;  2BQ3 A;  3WKE A;  9ICV A;  2Q0Z X;  5J0X A;  4FZM A;  4F71 A;  3N28 A;  2DGZ A;  2W03 A;  2ZJA A;  4YP3 A;  3N7P D;  4MEX A;  4P0P B;  2WF6 A;  1J2N A;  2YX8 A;  1N5W A;  2LM1 A;  1ZQN A;  2HDO A;  4R66 A;  4B9S A;  4OCZ A;  1XSP A;  1KEJ A;  5H2F U;  9ICS A;  4NV0 A;  1XS9 D;  3FC4 A;  8ICH A;  2NRT A;  3T79 A;  2D6F C;  4MHV A;  2M9N A;  4DL3 A;  2N1R A;  3EYZ A;  5KFY A;  5EWE A;  3KHR A;  3RJI A;  2XY7 A;  2JH1 A;  4EEN A;  4QWE A;  4OJ6 A;  1L7P A;  1SB3 C;  3MGV A;  1S5L U;  4NLZ A;  2LI6 A;  1A6S A;  2ZIU A;  5KL8 B;  3LDA A;  5ALW A;  2G06 A;  3PST A;  5TIS U;  5ALV A;  5BPC A;  4DSK A;  3ORY A;  5AKH A;  4NY8 A;  4PZN A;  4QWB A;  1P7D A;  1SIJ A;  5J0O A;  3SQI A;  2JZB A;  3RB0 A;  1RXV A;  2B0C A;  1UT8 A;  3TAQ A;  2VA2 A;  1ZQR A;  4MEY A;  2VJ5 A;  8ICX A;  3TAD A;  5ALR A;  1B43 A;  2XGQ A;  2YQE A;  5KG3 A;  2EAO A;  4BX9 C;  3GDX A;  4Z6C A;  3EZ5 A;  1ZQC A;  4J9S A;  4PJ0 U;  3CP8 A;  2XI9 A;  2NRV A;  3PX4 A;  3V6H A;  3MDC A;  2K8C B;  4K4H A;  4ECY A;  3BS7 A;  4GLX A;  3M7D A;  3PMN A;  1NK5 A;  2LPE A;  3UMB A;  9ICI A;  1PZN A;  4PHP A;  4C8M A;  1DRG A;  5AIA A;  3HIL A;  3N7R C;  4NWI A;  3T5J A;  1U4B A;  2UVV A;  1T4G A;  2HOI A;  4BXO A;  4QZF A;  3UXN A;  3M8R A;  1NZB A;  2A1J B;  1RYS A;  8ICU A;  3QUB A;  4I2A A;  4ECZ A;  1K1Q A;  3H40 A;  1L7O A;  3V72 A;  2ZUB A;  2XCP A;  1JRP A;  8ICS A;  5L1M A;  4EEL A;  5JUM A;  1EXN A;  2KZZ A;  3WK5 A;  4JB3 A;  2FJ6 A;  4TUR A;  3ZDB A;  5III A;  2KK0 A;  4GC6 A;  1NKC A;  4B9V A;  4C7Y A;  4EYI B;  1O08 A;  4YN4 A;  4PL2 A;  1U9L A;  1N63 A;  3V7K A;  4R63 A;  1N5X A;  1RYU A;  1LB2 B;  3D6J A;  4KLI A;  4UAS A;  8ICG A;  1PVP A;  1N61 A;  4USA A;  1N62 A;  3GZF A;  1T3Q A;  1ZRN A;  4UAT A;  3BJY A;  2RP5 A;  2NV3 A;  4DF4 A;  1KFS A;  4O0I A;  3K1Z A;  2BKE A;  2DKZ A;  8ICJ A;  7ICS A;  2WF9 A;  4UW9 A;  4CF5 A;  4F4W A;  3GQC A;  4KLJ A;  3S6J A;  1GO3 F;  3PVX A;  4KLL A;  3ZDD A;  1CEZ A;  3RJK A;  2ASJ A;  4J03 A;  4M9L A;  4QNL A;  4IL6 U;  3IHQ B;  4ECR A;  1WG8 A;  5DLF A;  3GIK A;  4BXO B;  4IQV A;  2C22 A;  3HP6 A;  3ONN A;  5KG0 A;  4J9L A;  2QB1 A;  3FDS A;  3I76 A;  5J2B A;  3NS1 A;  5AKZ A;  1K1S A;  3SEI A;  4DFJ A;  1FFV A;  2P6U A;  1ZQF A;  1B4F A;  4US9 A;  5ALH A;  3C2M A;  2HSZ A;  4DQQ A;  1OUQ A;  9ICO A;  4C7Z A;  1UPH A;  3OGU A;  4Y2P A;  1X9S A;  3RB4 A;  1SL1 A;  1ZQX A;  3KZX A;  4P0Q A;  3EUB 2;  4P4O A;  3GV5 B;  2ZG6 A;  1TAM A;  3HJE A;  5KFL A;  4DL7 A;  4PL1 A;  2R8G A;  2ALZ A;  4YD2 A;  4ED6 A;  2XID A;  3TQ1 A;  3WKA A;  1XSN A;  2ASL A;  1KDH A;  2R8J A;  1ZJN A;  5GTH U;  3C28 A;  2G5H B;  2VJ4 A;  1MSW D;  2QLT A;  4RQ0 A;  3NVV A;  2DF4 B;  4DL5 A;  2HHS A;  1ZQE A;  2QAR B;  1ZQW A;  3TAD C;  2RDJ A;  2VAN A;  3SV3 A;  4MF8 A;  4I27 A;  3H8J A;  3T5K A;  2JEF A;  4F92 B;  5ALL A;  4KLD A;  3RTV A;  5J0Q A;  1B0X A;  4NLC A;  1UT5 A;  2WB1 F;  4QWC A;  4B9T A;  4ECS A;  4YMM A;  5AKJ A;  3I28 A;  1DGJ A;  4C80 A;  4OJL A;  1RPL A;  1L5U A;  1KL9 A;  4KMU A;  3NRZ A;  5J2D A;  4F2R A;  4X5V A;  1S0N A;  3JPP A;  3HKZ C;  1JI7 A;  1JUD A;  3PV8 A;  3V7L A;  1TE2 A;  5KAF U;  1QCK A;  1Y88 A;  1JAL A;  3DEE A;  3ISD A;  3THV A;  2FPL A;  4I2E A;  2JHD A;  5ALZ A;  3LK9 A;  4OJP A;  4UAZ A;  5L1K A;  4F8R A;  2CRX A;  1HIW A;  4U7C A;  4K4I A;  1CUK A;  3QU4 A;  5T14 A;  1ZQO A;  4J9P A;  3T5L A;  2O6K A;  2NO5 A;  3SV4 A;  5ALP A;  3QUQ A;  4UQG A;  4B9M A;  5E79 U;  4CCH A;  4YFK A;  5AK6 A;  4GXI A;  4B9L A;  1S8O A;  3F2C A;  1Q3U A;  7ICV A;  1HJP A;  2HHW A;  3K4G A;  4Z6D A;  5JRT A;  1VJ5 A;  2ISO A;  2KKV A;  7ICI A;  3QU9 A;  9ICB A;  2LHT A;  5DG9 A;  3D2S A;  2E5S A;  4DQR A;  3AMZ A;  3AUO A;  5J2A A;  1NJX A;  2F8L A;  3H4B A;  3VC8 A;  7ICP A;  3ZDE A;  5J0S A;  3K75 D;  4C4R A;  4KX5 A;  2W54 A;  2C2D A;  2I6X A;  3AU2 A;  3SZ2 A;  3JPO A;  4Y2U A;  1HUZ A;  5CP2 A;  4RNO A;  4QWA A;  5KG4 A;  3IP4 B;  1NNL A;  1V97 A;  3KHL A;  4O5E A;  7ICK A;  1DK3 A;  1ZQU A;  3PR5 B;  5KT7 A;  5ALO A;  5J2C A;  2GOL A;  3CYM A;  1MN8 A;  2I5H A;  3HPO A;  3TAP A;  8ICA A;  1CI4 A;  1COK A;  4BDP A;  5KFZ A;  3L3F X;  5IIO A;  1S9F A;  1F0M A;  2KKP A;  5KTQ A;  2MRL A;  2KJ9 A;  2ZIV B;  2HVI A;  1L3S A;  4DFD A;  3B0X A;  2ZUD A;  1DXS A;  3C2L A;  4DL4 A;  4CNQ A;  8ICV A;  1Z00 A;  4EBE A;  3UXP A;  4EBD A;  1V9P A;  2BDP A;  3MDA A;  2KFN A;  2DKX A;  4I29 A;  4GFJ A;  1FEZ A;  2DUY A;  4KLG A;  2WAQ F;  4ED0 A;  3BQ0 A;  4F5Q A;  3KHH A;  1V38 A;  3GIJ A;  1NKE A;  1DOQ A;  4KN4 A;  3UPQ A;  1KN5 A;  2GH1 A;  4RPX A;  4AP9 A;  1BGX T;  3PSF A;  4I2H A;  4PHE A;  8ICE A;  3MBY A;  2H3Q A;  5ALF A;  3KFU F;  4RQ8 A;  4KLO A;  3A0B U;  1BPY A;  2F1J A;  5HML A;  5DDY A;  2E8N A;  3QUT A;  5K4L A;  4Y2S A;  4A8E A;  2JGA A;  2F76 X;  3MFI A;  5DBC A;  4B9U A;  5KAI U;  3H0M B;  1KW4 A;  4UAU A;  1WWU A;  5ALS A;  1KQQ A;  1T3N A;  7ICR A;  3Q8L A;  4PGQ A;  5C5J A;  1BNO A;  2PFQ A;  5AIC A;  1NK0 A;  4P0P A;  5KFC A;  2VIX A;  4I2C A;  4RT2 A;  4HYK A;  1Z00 B;  2MUT A;  3IM1 A;  4QZC A;  5KFP A;  7ICL A;  4F5R A;  1ZQM A;  7ICN A;  1XWL A;  2V4Q A;  4ED2 A;  2DL0 A;  5HR6 A;  4NXZ A;  1ECW A;  4IRD A;  3QUC A;  1WUD A;  4UAR A;  2W3S A;  2WHE A;  3F5E A;  4EZ6 A;  5AM0 A;  1NK9 A;  3TAN A;  5HHI A;  3H4D A;  7ICO A;  1NOM A;  4IQW A;  5EE0 A;  1J97 A;  2HBM A;  3CW2 C;  3PZP A;  4PZO A;  4KLU A;  2BPG A;  1X42 A;  4FBT A;  3N7S C;  1RDF A;  5JU5 A;  2LM4 A;  3B0Y A;  3D2N A;  5KFU A;  9ICE A;  4MF2 A;  2KE7 A;  2OWO A;  4ELT A;  5JTI A;  4F50 A;  4LZD A;  3MR6 A;  3RH5 A;  2UVU A;  1NK7 A;  3KD3 A;  2OCE A;  1Q3V A;  3NGD A;  1AQ6 A;  3Q8M A;  5AI6 A;  2HBJ A;  2JH7 A;  2MUT B;  5EWG A;  2IMW P;  3SMV A;  3TAC B;  5KFK A;  1QSY A;  4RQ5 A;  2PMZ F;  3AQF A;  4O3P A;  4CF4 A;  5KFS A;  4UB1 A;  4M9G A;  3LVV A;  3RBE A;  2NYV A;  1ED1 A;  4UBC A;  3BQ2 A;  3SYZ A;  2KV2 A;  3E58 A;  2A1J A;  1Z19 A;  2VA8 A;  3KKA A;  2W9M A;  4NJ8 A;  3LVW A;  8ICN A;  2WB1 C;  5KFB A;  2WF7 A;  1RXW A;  3BQ7 A;  1MA7 A;  3MC1 A;  2KVS A;  1D8Y A;  4O3Q A;  2LKY A;  2OM6 A;  1JMS A;  4BJQ A;  5KFT A;  3O0F A;  3IV6 A;  4YR3 A;  4Q8E A;  2EAN A;  4RQ1 A;  3PO4 A;  4UAV A;  3QXG A;  4DSF A;  4DQI A;  5L1I A;  1RM6 C;  2YB1 A;  5G5G A;  2G5I B;  9ICW A;  1Q46 A;  3BQT A;  4C4S A;  7ICF A;  2KNJ A;  1NK8 A;  4C4T A;  4RQ6 A;  1YZ6 A;  4PGX A;  4YD1 A;  4U6P A;  3WK4 A;  5KFF A;  1RZT A;  2F44 A;  4JWN A;  1HEK A;  4DWI A;  4DL2 A;  5IIJ A;  1SWW A;  1SGG A;  2FPK A;  2J6T A;  3ALR A;  2F3N A;  3EWA A;  3SR6 A;  4ECU A;  3QZ7 A;  4KMO B;  1L3U A;  4ECV A;  4JV1 A;  2FPM A;  3SEN A;  4UB6 U;  9ICQ A;  4R64 A;  5IIL A;  4EEK A;  1DK2 A;  4DQS A;  5CB1 A;  1ZQQ A;  2R18 A;  4NLG A;  1TAU A;  1LKY B;  2F77 X;  1ZQG A;  9ICC A;  4MFA A;  4GC7 A;  3RRG A;  2LMR A;  5ALJ A;  4P2H A;  2HBL A;  3QNM A;  5FP0 A;  2BCS A;  5L9X A;  3NVY A;  4QZI A;  3H8M A;  4NL9 A;  2PI4 A;  4Y2V A;  4DEZ A;  2W8L A;  3LYS A;  8ICW A;  9ICT A;  8ICM A;  5KG1 A;  3HX0 A;  3C5G A;  4IRK A;  4O3S A;  5AM4 A;  3UM9 A;  2Z7J A;  5AKK A;  3F2D A;  3OJS A;  4ECW A;  2BDU A;  5AKL A;  1S0V A;  4DFP A;  1ZQJ A;  4Q8F A;  1Z4O A;  5KT3 A;  1X9M A;  3DDH A;  1URJ A;  4RNM A;  3H8W A;  4RT3 A;  2WF5 A;  1S0M A;  1H38 A;  3E2E A;  8ICK A;  3PX6 A;  2QAR A;  2KTQ A;  5D4B A;  3QEA Z;  4Y2X A;  2OXO A;  3MGI A;  3WK9 A;  2PFO A;  4OO1 J;  2BQR A;  3ZDA A;  1XNS A;  2YTU A;  2ZJ8 A;  3SAF A;  3OHA A;  2KFZ A;  5IIN A;  3G6X A;  3TFS A;  1X66 A;  3NTU A;  3PR4 A;  2ZIX B; 
#chains in the Genus database with same CATH homology
 2ZIW A;  1T94 A;  3D2N A;  4PL1 A;  2CPR A;  2KIC A;  3CRX A;  2WAQ F;  1HEK A;  2HBK A;  4CGZ A;  4WJ3 B;  5HR7 A;  4OJ5 A;  4NV0 A;  2K8B B;  2HOQ A;  2XID A;  1A0P A;  4AYB F;  2OYY A;  3ALR A;  3D2Q A;  3F2C A;  1Q3U A;  3T79 A;  2D6F C;  3C28 A;  2G5H B;  3GU3 A;  2MA1 A;  2N1R A;  5A0L A;  4KMO B;  5C0Y A;  2KJ5 A;  2VJ4 A;  2Y0S C;  2KKV A;  3F53 A;  5KL1 B;  3M6K A;  4ACO A;  2GH1 A;  3IN5 A;  2YB4 A;  4JMU A;  1PVR A;  1Q3V A;  2DF4 B;  2LHT A;  3D2S A;  2E5S A;  2KJ8 A;  2KHV A;  3PSF A;  2ZXH A;  2G07 A;  4PL2 A;  2JH1 A;  2HBJ A;  2JH7 A;  2LBO A;  2H3Q A;  2WAQ C;  3NRW A;  2F8L A;  3KFU F;  2KIW A;  3VC8 A;  2K89 A;  3SAH A;  1Z1B A;  2HOF A;  5CRX A;  2R18 A;  2ZIV A;  4OJ6 A;  3MGV A;  3F2B A;  2F77 X;  3SMV A;  1PVP A;  2KEY A;  4AYB C;  1A6S A;  4P0Q B;  2ZIU A;  4OJO A;  2W7O A;  4QIW C;  4KX5 A;  5KL8 B;  3GZF A;  1IIP A;  2PMZ F;  3AQF A;  2K8A A;  2G06 A;  4QIW F;  3PST A;  4NLB A;  2HBL A;  4A8E A;  2OH2 A;  2Q4T A;  4NLC A;  3PSP A;  2RP5 A;  2W04 A;  2NV3 A;  2WB1 F;  2JGA A;  2F76 X;  3PSI A;  1L6N A;  3K1Z A;  2G08 A;  3HKZ F;  4QJF B;  3LVV A;  2VKQ A;  3H0M B;  4CDG A;  2KHQ A;  3IP4 B;  1ED1 A;  1P7D A;  1GO3 F;  2HMX A;  4O3M A;  2ZXI A;  3LYS A;  2H3V A;  3SQI A;  2KVC A;  3E0F A;  2KV2 A;  4KX3 A;  4FZN A;  3C29 A;  4P0P A;  4IC9 A;  4OJL A;  2VIX A;  1D8B A;  2VJ5 A;  3AQE A;  2K4E A;  4QNL A;  1XNS A;  1CRX A;  2ZIX A;  2PMZ C;  3ICX A;  3RF9 A;  2E1F A;  1Z19 A;  2GOL A;  2CN1 A;  3CYM A;  4FZL A;  3IG8 A;  3M6Z A;  4CRX A;  3LVW A;  2Z7J A;  2WB1 C;  3F2D A;  3ONN A;  1PVQ A;  3L3F X;  2A3V A;  4BX9 C;  2BDU A;  3HKZ C;  3SAG A;  3H0L B;  2K4H A;  2KKP A;  2RHF A;  2ZIW B;  3NUQ A;  2MRL A;  2LYB A;  2H3Z A;  2KD1 A;  3CP8 A;  2KJ9 A;  2ZIV B;  1MA7 A;  3IG5 A;  2DQN B;  2LKY A;  2K4I A;  2OM6 A;  4BJQ A;  2XI9 A;  2G09 A;  1SZH A;  2ZIU B;  2H3F A;  2G0A A;  1URJ A;  3O0F A;  5HR6 A;  1ECW A;  3VCB A;  2W7P A;  2K8C B;  4FE3 A;  3DEE A;  1OUQ A;  1F44 A;  1KBU A;  1YT3 A;  1WUD A;  1UPH A;  3M7D A;  2JMG A;  2KOB A;  2YB1 A;  4C0Z A;  2G5I B;  3F5E A;  3F5A A;  2XVT A;  2JHD A;  2E1E A;  4OJP A;  3AL0 B;  2LYA A;  2F2A B;  2H3I A;  2OXO A;  4OO1 J;  4BUG A;  1DRG A;  1ZQ1 C;  3KZX A;  4P0Q A;  3N7R C;  4NWI A;  4FZM A;  2CRX A;  3OPX A;  2HBM A;  1HIW A;  2DGZ A;  2KNJ A;  2Y0S F;  4U7C A;  2M0N A;  2W03 A;  2ZG6 A;  4ICA A;  2HOI A;  3N7P D;  1TAM A;  2XIC A;  3SAF A;  3PZP A;  4P0P B;  4U6P A;  3N7S C;  3RFA A;  2RRD A;  2YX8 A;  3H0R B;  5T14 A;  1XO0 A;  1NZB A;  4GFJ A;  2ZIX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...