2WAQF

The complete structure of the archaeal 13-subunit dna-directed rna polymerase
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
90
structure length
90
Chain Sequence
SVYIVEEHYIPYSVAKKLLSDVIKSGSSSNLLQRTYDYLNSVEKCDAESAQKVVEELSSIISREDVRAVLASICPITPDEVRSILIMDSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Evolution of complex RNA polymerases: the complete archaeal RNA polymerase structure.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE RPO1N SUBUNIT
total genus 13
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2009-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF03874 RNA_pol_Rpb4 RNA polymerase Rpb4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.820 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2waqF02
2Y0SF 4AYBF 2WAQF 2WB1F 2PMZF 3HKZF
chains in the Genus database with same CATH superfamily
2ZG6A 2UVRA 2OCEA 2PFQA 4DLEA 4UB5A 5H2FU 2W8KA 3M1YA 1FFUA 2ZJ8A 1T3NA 3SQIA 4C7ZA 2QLTA 3HP6A 2C2RA 2OM6A 5CR0A 3NVYA 2W9BA 1XNSA 3G6XA 4X5VA 1NJZA 4ECYA 4DQSA 4DL3A 5B66U 4F5QA 3M6ZA 1BPYA 1TFRA 2KFNA 3C5GA 3LDAA 3MR2A 1UHUA 1V85A 2AJQA 2KIWA 5J0PA 4RQ1A 2OHFA 1SZPA 4F5RA 4EZ9A 4ECQA 2HI0A 3BS5B 9ICNA 5ALWA 3IDWA 4RQ5A 4BXOA 3EYZA 4PGQA 1S97A 1PVRA 2EZXA 4US8A 3SI8A 1QQ6A 3N97B 2KICA 1ZJNA 3C23A 5KFMA 1N62A 2MUTA 4DFDA 2IOFK 2OEHA 4GXKA 1D8BA 3PX4A 1DK3A 1UA1A 1QCKA 2BPFA 3M8SA 5ALVA 1SKRA 4IC9A 1ZQKA 1SXDA 2DKZA 1KLNA 2J6TA 4CGZA 3MR3A 1ZQQA 4KLEA 1JXEA 1TAUA 4I2HA 4C8KA 1T94A 3BZKA 8ICZA 2I9GA 9ICQA 1IG6A 4Z6CA 2HBKA 4ED3A 2P6UA 1IV8A 5ALKA 2KK0A 4DFMA 4Q44A 5AIAA 3Q8MA 5ALIA 5ALXA 5ALOA 8ICFA 5CEHA 4NLZA 2YTUA 1SL2A 2HOFA 2QARB 2XY5A 1XO1A 2KJ9A 2FMQA 2YX8A 4K4HA 3WKDA 1FIQA 2NRZA 5DB8A 3HILA 4LJXA 2B0CA 4Y2SA 1UCVA 4KLOA 4QZEA 2E1EA 2KG5A 3B9JA 4ECWA 2ZTEA 1M6YA 3ISDA 4R8UB 4RQ0A 3V7LA 1X9SA 2XI9A 3KHLA 2YN4A 1Q3UA 4J9RA 3RJEA 2NYVA 4PJ0U 1TK0A 2HBJA 4O5CA 3L5KA 5AK5A 4QZBA 3ED5A 4YVZA 2OH2A 3ICXA 1RZTA 3MBYA 4C4RA 5ALUA 3UM9A 3SR6A 5L1KA 3CW2C 4Y2XA 3CRXA 2WF6A 3NUQA 1LKYB 2ZIWB 1WWUA 1NK4A 4KLTA 4M9GA 4C0ZA 5AI8A 3PW4A 3L3FX 5D46A 3QX7A 1B43A 4ACOA 4KMOB 4DSLA 5AM1A 8ICEA 5KG6A 5KFPA 4DL2A 2PMZF 4F2RA 3BQ0A 1KFDA 4C8OA 1RDFA 2BHNA 4PH5A 3JPRA 5JRTA 5DG9A 4KLLA 4YQWA 5CRXA 4DOCA 4F72A 3QUTA 3JPQA 4ECSA 1X9MA 3RBDA 3PW5A 1BNOA 4YR2A 3M9MB 3GIMA 2W9BB 2WB1F 2EZZA 3ZD9A 5J2JA 3DEEA 5J0XA 1IXRA 2ZUCA 4Y2YA 5AK4A 1OW5A 2PMZC 4NLBA 4ELTA 3QUBA 4YMMA 3HJEA 4PL2A 2BCSA 1ZD2P 1Z1BA 4BX9C 7ICMA 4RQ3A 5KT5A 4GXIA 4O5EA 8ICNA 3PSIA 3AQEA 1UA0A 5ALDA 5HR7A 4DS5A 5T14A 5KFDA 4UAYA 7ICOA 1JX4A 3AQFA 1S9FA 4UB2A 7ICLA 2G08A 2MA1A 3MC1A 5KFYA 3ONNA 1B0XA 4K4IA 4I2BA 2F8KA 3RH5A 1T8EA 5AKIA 4DL6A 2GLEA 9ICJA 5IIJA 1BPBA 4A8EA 3EW9A 1SV4A 2XY6A 4ED1A 1KTQA 4O3QA 3HW8A 4RU9A 7ICRA 3JPNA 3KOOA 4TURA 2AGPA 3AU2A 3EUB2 2FPKA 4UATA 2Y1IA 4Z6EA 4FZLA 2W03A 3I76A 1K5OA 3FYHA 7ICVA 5KFFA 4M9NA 7ICUA 3MDAA 4KLFA 4P0PB 2M0NA 1TK5A 1NK0A 3IG8A 2RDIA 1CI4A 5KG4A 3EPIA 2KKPA 4M6WB 1DK2A 1D8LA 2DWQA 5E79U 3OJUA 5DQIA 4MHVA 3E0FA 4M0AA 4E0DA 5AI9A 5J0RA 1QSLA 4ECVA 2FMPA 3HRDD 3M6KA 3WK9A 1S10A 3QEAZ 4DSKA 4DL7A 1C7YA 4FE3A 7ICFA 3E2EA 8ICHA 2ALZA 1ZQIA 2MRLA 1JUDA 5AKXA 1PK1B 3RRHA 5AK6A 1HUZA 5FP0A 1WWVA 1U48A 1TK8A 5KFGA 4DOBA 2JXJA 3QYPA 5KL8B 2D3DA 4JMUA 5AICA 1S0OA 2F2AB 4HAIA 1KFSA 3RJJA 4EEYA 3ZDEA 4O3MA 5L1IA 3PV8A 3RBEA 4QZ9A 9ICCA 2KHVA 2LHTA 4IRDA 3DV9A 2BCVA 3K4GA 4PZOA 3UQ0A 3V6HA 3N7RC 4BWJA 4EBCA 5J2KA 1KRPA 1JI7A 2KP7A 2ZXIA 4O0IA 3SAFA 1SB3C 3QU9A 5KFKA 1Z00A 5HMMA 3D2SA 2R8GA 3I1YA 4EX6A 4CDGA 4QW9A 3PW7A 1YZ6A 5IILA 1J2MA 1Q46A 2GOLA 1L5UA 2H3VA 5AKJA 1D9FA 2VJ5A 4IR9A 3KZIU 4HYKA 3V6KA 8ICTA 5DG8A 5A0LA 4MFCA 4FZMA 4M04A 4MFFA 4DF4A 2NRXA 4JUZA 1XS9D 4USAA 3PO5A 5AM2A 4J9NA 2AH5A 1ZQAA 1TKDA 2VKQA 4F4YA 2QARA 2AQ0A 3KHHA 4MEXA 4KLUA 4YR3A 2R8KA 1ZQSA 5KFOA 1SZHA 3SENA 5J2IA 5ALTA 4CF4A 2JRZA 5KG3A 1U4BA 4YP3A 4TUSA 1X2IA 1K1QA 2KE7A 3E58A 3PR4A 9ICFA 3H4DA 1L3TA 5EWEA 2W9CA 3KBBA 5D49A 1ZD3A 4DFJA 3TAQA 4EYHB 4B9LA 4EBEA 2D6FC 3M9NB 1JMSA 1BGXT 3TACB 2PI5A 4Y2JA 3D2NA 1XU4A 5KFJA 5DLFA 1J97A 1CEZA 8ICKA 3RJIA 4F2SA 1TVAA 3AEVA 3NVWA 4IQVA 2EZYA 3V6JA 1PK3A 5CWRA 4NLCA 2I5HA 1RM6C 1YZ7A 2MUTB 5L9XA 3TFRA 4MF8A 1NK9A 2ZIVA 2JMGA 4P0QA 4BJQA 2JH7A 9ICXA 1RQNA 3GIKA 4BUGA 2JEJA 1BPDA 2E8MA 1SV0A 2DKXA 3OSNA 1WYGA 4C8MA 3BQTA 5DDMA 2Y9TA 5L1MA 1QQ7A 5DBBA 5J2GA 4RT3A 3AUOA 4YXMA 5J2BA 4DFPA 2KNJA 4JV0A 2R8JA 5C0YA 4Q8FA 4I2JA 1PK1A 5J2CA 5F9LA 3PW2A 4UASA 5KNIA 3KZXA 4UB3A 1XC9A 3PR5B 3G6VA 4XQ8A 5KG7A 1TAQA 2E8PA 4UAUA 4UB6U 9ICLA 2ODGA 4J9SA 3GU3A 5ALFA 5AKZA 4B9VA 3KHRA 3SYZA 3HX0A 5EE0A 1SKWA 5KFXA 4KX5A 4RQ4A 3MR6A 2MSNA 3C1ZA 1WG8A 4DLGA 1NJWA 2C2DA 2V4RA 1BPZA 3IV6A 2Y0SF 5IIOA 4LZDA 2F3NA 4F4XA 5HNKA 4RQ8A 3NRWA 1Z3EB 2AXTU 3KD3A 4Y2RA 1ZQMA 1ZQZA 4UB1A 2FLPA 2P35A 9ICIA 3OHBA 3UXNA 3A0HU 3F5EA 3IN5A 5J2AA 4BWMA 5KG0A 2NRVA 5ALEA 5ALSA 5DKWA 3ZDAA 3JPPA 2HOIA 9ICVA 2HSZA 4NWIA 5HR6A 4F50A 3RJFA 4DF8A 1OXJA 3MDCA 2GH1A 3K75D 4QZGA 4Z6FA 3T5HA 4U7CA 1COOA 1XO0A 1COKA 3ETLA 3RRGA 2LMRA 5HMLA 2W55A 1VJ5A 1IM4A 5AM4A 2WTFA 4KLHA 3RH4A 5TISU 4R65A 9ICPA 1NKEA 2ASDA 2W11A 2WB1C 4QZDA 4UAVA 4YR0A 5EWFA 3WK4A 2DPJA 2HHWA 3SV4A 3TAPA 3AL0B 2ZXHA 2A1AA 5HHHA 2FLNA 3BZCA 2V4QA 1L3UA 4F4ZA 1ZQWA 1Y88A 2VA8A 3NS1A 4NLKA 2ZJ5A 8ICRA 2LKYA 4J9OA 2XICA 1ZQJA 4XA5A 5AKHA 4KLJA 3LYSA 5GTHU 2G07A 3HWTA 2LYBA 8ICIA 3SD7A 3PMNA 1KL9A 4ZOHC 2BPGA 4C4TA 9ICTA 4OJ6A 3PW0A 2KTQA 1ZQOA 4MEYA 1JALA 4I2GA 4FS1A 3N7SC 3WKBA 1X9WA 3N28A 4YMOA 3PZPA 1V97A 1PVQA 1SL0A 2LI6A 2ZIUB 8ICAA 2H3QA 5EOZA 2VJ4A 2A1JB 4GC7A 2H3IA 4QWCA 5IIKA 2B21A 1JIHA 1UQVA 4FS2A 5ALZA 2ZIWA 4XUSA 3IG5A 4F5NA 2QB0B 2EH9A 4P2HA 4B6JA 1XWLA 7ICEA 5DB6A 2XGPA 3ISCA 3LWLA 3MFHA 5ALRA 3Q8SB 2JH1A 4EX7A 7ICJA 3D2QA 3UMGA 4DO9A 2EAOA 2E8NA 5J2DA 5L1LA 2BCRA 1JROA 3OGUA 4PHAA 3UPQA 2EAMA 5J0OA 4B9MA 3ZDDA 4UARA 2AGQA 4RQMA 4M2YA 4KMUA 2A19A 2WF9A 2Q4TA 1O08A 2B6GA 1N5WA 1RYSA 1RXVA 1KBUA 2PFNA 4UQGA 5KFIA 5KAFU 1AROP 2ZIXA 5BOMA 2XIDA 4ELUA 5AI6A 2ASLA 4ED0A 2EANA 1FO4A 1ECWA 4I27A 5DGBA 4F91B 1N2XA 1ZQGA 3TKAA 3HT3A 1MA7A 3FC4A 4NV0A 3U26A 2Y9UA 4K4GA 2HBLA 4NXZA 4GXJA 7ICHA 4EBDA 3PSPA 3Q8QB 3ZDBA 5ALPA 2NO4A 2FPMA 4RPYA 3TI0A 5J2EA 2ESEA 4RQ2A 5GTIU 1SV0C 1URJA 2KZMA 4IRCA 3QZ8A 4NL9A 5ALNA 1ZOLA 5CJ7A 3H7IA 4J9MA 2HHVA 2RLTA 3RFAA 3MABA 1Z4OA 4M47A 1QQ5A 3GIIA 8ICLA 4ECXA 1N48A 4DFKA 2UVVA 4NY8A 1JRPA 2F1JA 4M9JA 4UB4A 3F5AA 5KFUA 2DBYA 5ALGA 4EZ6A 3AMZA 1X40A 2ZTDA 1PZNA 4RNNA 2HMXA 2K8AA 2W04A 8ICVA 5AM5A 4EENA 3JPTA 5JUMA 1H38A 1FEZA 2YMQA 3H0RB 4O5KA 5KFCA 2R8IA 3WKEA 2HBMA 1DGJA 4EEKA 4PL1A 5DB9A 9ICEA 3QNMA 3PVXA 4P0QB 3Q8LA 4RZRA 4I2DA 3SMVA 2G09A 3CNHA 2ZIXB 1BPEA 3BQ7A 3ZI4A 3PSFA 4JB3A 4YMNA 2K4HA 5AKGA 5KT4A 2LBOA 5EE1A 4FO6A 4PHPA 2DUYA 2DF4B 4C8LA 2IA6A 4IQUA 4UB8U 2W3SA 4F5PA 3LVWA 2F1IA 2BDUA 3QUQA 4TUPA 4QW8A 3H0MB 2IHMA 2XY7A 2YMLA 1NK7A 1NJYA 2FJ6A 8ICOA 2G5IB 4B9SA 3C2MA 4YFKA 1S5LU 2JR5A 5G5GA 1UPHA 4J03A 5J2HA 1UT8A 4C8NA 1WCNA 2P6RA 3V7JA 5KG5A 3PX0A 3IM1A 5KFNA 4KTQA 4U6PA 3TADC 1RPLA 1N5XA 2BPCA 4F4WA 1S0NA 2DQNB 5KFRA 4PGXA 7ICPA 3M7DA 2HW3A 2J6UA 1L7MA 2HCFA 4Y2VA 1Q3VA 5KFLA 5J0YA 1XSNA 4UBBA 4TQSA 1JN3A 1Z1VA 2F77X 3QU4A 2V9WA 2JHDA 2RHFA 4F3OA 2JZBA 3JPOA 2HOQA 1X6JA 4J9KA 2BQRA 4DS4A 3SZ2A 4OJOA 4KLQA 5DQGA 2YB4A 5K4LA 5KT7A 3PX6A 1DRGA 2K60A 1Z4NA 3VCBA 4US9A 2LYAA 4QIWF 1BPXA 9ICUA 3NVZA 5DGAA 2MU2A 4I29A 3QZ7A 5J0TA 3F2CA 2W8LA 1VLBA 3AU6A 5AKYA 4OJ5A 3H4BA 2AQ4A 1PVPA 5KFHA 2XO7A 2KVCA 4Y2PA 1ZQHA 2PFOA 3MGHA 1QH9A 4B9NA 1KEJA 2FPLA 3PNCA 2J6SA 4JV1A 1F44A 1DOQA 4QIWC 5AI0A 5F9NA 3BS7A 2ZIUA 4TUQA 8ICXA 5EE9A 4YD2A 4F92B 4RPXA 3C2KA 4ED2A 3TARA 5KFBA 1BVSA 4NLGA 2ZUBA 4PGYA 5J0WA 1MQ3A 8ICPA 4UW9A 1MQ2A 2D8CA 5AKEA 2Y0SC 3GZFA 3KHGA 4IL6U 2F44A 1CUKA 5ALJA 3HKZF 2AHOB 4J9QA 4JK1A 4R64A 1OUQA 2K8BB 4KITB 5DQHA 1NZPA 2HHTA 9ICRA 1K1SA 2BCQA 4YN4A 2F8LA 4QWAA 2M9NA 3F2DA 1ZQBA 2RP5A 2W9AA 1KFTA 1RG6A 1X42A 4F5OA 3EZ5A 1LVHA 3HKZC 1EXNA 1SGGA 1BNPA 2ZUDA 7ICQA 5IINA 2E1FA 2JV3A 3IRUA 2W54A 3LVVA 5KFWA 4GC6A 7ICNA 3B0YA 4RT2A 3QU2A 3OJSA 2LPEA 3WK5A 4NM2A 3R9KA 1NI3A 9ICSA 1A0PA 2BR0A 5KTQA 1NK8A 2KSOA 2HVHA 3NVVA 4RNOA 3VC8A 4Q8EA 2DL0A 4DQPA 4DQIA 5L1JA 4B9UA 2WAQF 3SAGA 1V38A 1N56A 3H8SA 2YQEA 1YT3A 3GV5B 4LVSA 3RAQA 2YMPA 1ZXIA 5KG2A 2KVSA 3GQCA 2PXIA 3FM9A 1ZJMA 3CYMA 2P66A 2KV2A 3S6JA 2CXYA 1N63A 4YD1A 3QXGA 2KZ3A 7ICSA 1VDVA 2AGOA 1L6NA 2WAQC 2HDOA 3EWAA 3ALRA 2XCAA 3F2BA 3JPSA 3PSTA 1GO3F 4C7YA 2JEIA 2HHSA 1U49A 8ICCA 1JXLA 1ZD4A 2YMMA 3AN1A 5EE3A 9ICHA 2BQUA 2I1QA 2KKVA 4DL5A 1A76A 3GILA 2UVUA 5J2FA 4YG2A 2HHQA 4O3SA 2Y1JA 1TE2A 5J0UA 5DB7A 1P7DA 2N1RA 5B5EU 5DLGA 3TFSA 5ALMA 3RTVA 2E3TA 1UT5A 1SL1A 5C5JA 1ZRNA 1IIPA 3WK7A 4KLSA 1S77D 7ICIA 4YXJA 3IHQB 5EWGA 3UMCA 4M9LA 1LKYA 4RUCA 4FBUA 4AYBF 1S8OA 2G06A 2OYYA 3V72A 2XGQA 3UMBA 9ICWA 3THVA 2LM4A 4Z6DA 1ZQDA 1S76D 3QUCA 2HVIA 9ICAA 3ISBA 3LK9A 4ED7A 4P4MA 4NLNA 2JEGA 2ASJA 4BGDA 2W43A 3T79A 2KHQA 2C22A 2F76X 2C28A 2W9MA 3FAHA 2H3FA 4NL9C 4MF2A 5BOLA 2KOBA 5KFSA 4IS7A 4UBCA 4I2AA 2XCPA 4GFJA 3RB4A 2IHNA 1X66A 4F8RA 5KFQA 5BPCA 2ES6A 4RQ6A 3O0FA 4QZAA 1HJPA 1SKSA 2MAXA 4DQQA 3C28A 8ICQA 9ICMA 4RNMA 2RQ5A 1L7NA 3B0XA 5CHGA 1U47A 2NV3A 1HUOA 3T3FA 3L4PA 3C29A 1F0MA 1MN8A 4KN4A 4P4PA 4ZH4A 1B22A 7ICKA 2WF5A 3MR5A 1LV5A 3C21A 3QEBZ 1L7PA 4O3OA 3OSPA 3UQ2A 3H0LB 4OCZA 3MGIA 1SIJA 4I2EA 2LYHA 2GO7A 3T5KA 2K4IA 1MSWD 2WHEA 3PY8A 4UAWA 1Z00B 3GV8B 1S0MA 1Z19A 4I28A 4DCCA 3RJGA 1NK6A 5ALHA 2DGZA 3C1YA 2WF8A 2FLLA 4DSFA 4Q43A 3WK6A 2IMWP 1ZD5A 4FZNA 1L8LA 3TANA 2PI4A 3WU2U 2CN1A 3NASA 4JWMA 4NJ8A 3KFUF 3TQ1A 1A6SA 5KAIU 2A3VA 8ICGA 2C2EA 1S0VA 1WCLA 1NZBA 4BXOB 4ECTA 2NRTA 5AK3A 3K1RB 2BCUA 2JZBB 3RJHA 3H40A 5DBCA 1RYRA 1O03A 4QJFB 8ICBA 2FI1A 3Q8RB 7ICTA 2BDPA 2YB1A 2ISPA 4O3PA 2FMSA 3ZD8A 2ZJAA 2G0AA 4CE6A 2BGWA 2K8CB 2RRDA 5CP2A 1X9XA 1TV9A 4Q45A 2RDJA 1L3SA 2Z7JA 4O3NA 4FFDA 5KL1B 3WKAA 1RQLA 2E8OA 3RJKA 2KD1A 5J8YC 2G5HB 3FDSA 5KT2A 5HHIA 4DSIA 5DBAA 4KLMA 2WFAA 5D4BA 1RXWA 5CB1A 2PFPA 4M6WA 2DPIA 1QTMA 1NK5A 2ATLA 2BQ3A 1ED1A 1X6IA 1HEKA 2L5YA 3GDXA 1T3QA 3QU7A 3KKAA 2PKEA 4P0PA 4KLIA 3SV3A 3GV7B 5AM3A 2ISOA 1ZQUA 4ECUA 4PPXA 4OO1J 1SWWA 5ALQA 1F5SA 8ICMA 2VANA 2ZTCA 2JEFA 1WUDA 5J29A 1QSYA 4P4OA 4FBTA 4M9HA 4XRHA 4DL4A 5KFVA 4IQTA 5IIIA 9ICGA 3UXPA 3V7KA 4OJPA 4TQRA 1ZQRA 4DOAA 3NRZA 4O3RA 5F3XB 5CA7A 4AP9A 3OPXA 3MGVA 4O9MA 5KFEA 1ZQVA 5HP4A 2BKEA 2I6XA 3SEIA 5AHXA 1B4FA 4ED8A 4JV2A 4KN7A 5AI4A 4B9TA 4CRXA 5ALLA 1ZRMA 5J0QA 2K4PA 1D8YA 1DXSA 2UVWA 3RH6A 3F53A 3GIJA 5DDYA 3KTQA 1KSPA 2ZIVB 4I2IA 1CRXA 1N61A 3RB3A 8ICSA 5J8YA 1XSLA 1ZQPA 7ICGA 1PUZA 1ZYQA 5JTIA 2NRWA 4QNLA 3OTQA 4KX3A 2OWOA 2KJ5A 4QZIA 1KKXA 4CF5A 4NM1A 1ZQNA 1U45A 1L3VA 3IP4B 1NNLA 4Y2UA 2F1HA 1ZQCA 4R66A 1Q8KA 8ICWA 2R8HA 4R8UA 5DG7A 4DWIA 2KSOB 4MFAA 4RPZA 5G5HA 3C5FA 4DSEA 4LZGA 3I28A 1RYUA 2BZFA 3PO4A 3ETRA 4QZCA 2IBKA 3RR8A 9ICBA 5AI5A 3C2LA 2K4EA 3BQ1A 3QE9Y 5KFAA 2QB1A 4I2CA 3RAXA 1L7OA 3NGDA 2QKQA 5AM0A 3M9OB 1L8OA 4F93B 2NO5A 2DFLA 2IOHA 2XC9A 2CPRA 1J2NA 5KT6A 2JGAA 1MC8A 5KG1A 2XVTA 4DEZA 2HHUA 2R18A 2CRXA 1ZQ1C 1ZQYA 4DSJA 2FDRA 4YCXA 1ZQEA 3ORYA 1QSSA 1NKCA 2E5SA 4GIBA 4UAZA 1D9DA 3M8RA 2Q0ZX 4RQ7A 2W9CB 3UXOA 3G6YA 3OHAA 5AKKA 1NOMA 4QZHA 4QWDA 3RR7A 3CP8A 1ZQTA 4GLXA 1ZQLA 1ZQXA 3H8WA 5TZVA 1U9LA 4F4KA 2QB0A 1FFVA 4CCHA 1KDHA 3T5JA 3RF9A 9ICKA 5AIBA 2KZZA 1KN5A 1ZETA 3K1ZA 1C20A 3HPOA 2VA2A 4R63A 4IR1A 1T7PA 1QLNA 4CNQA 2EQYA 2OXOA 3H8MA 1NJXA 2KFZA 1KQQA 2WF7A 4WJ3B 1XSPA 1V9PA 4QZ8A 1ZQFA 3MFIA 1SWVA 3BJYA 5JU5A 3A0BU 4RUAA 4AYBC 2EDUA 4CF3A 3QU5A 3PMLA 4IQWA 5KT3A 4C4SA 3TADA 2KN7A 4ED6A 4OD0A 4G3IA 2GWSA 2W7PA 4PHDA 2IOFA 4OJLA 1N60A 2H3ZA 8ICYA 2KMDA 2KEYA 1KW4A 3DDHA 3GFKB 1SXEA 4QWEA 4Y2TA 3ZDCA 2O6KA 3T5LA 1A77A 4PZNA 4I2FA 4J9LA 5AKLA 2W3RA 5IIMA 4JWNA 3BQ2A 2LM1A 4IRKA 4EELA 3N7PD 3WK8A 4QZFA 4KLDA 4EYIB 2A1JA 4BDPA 4RQNA 8ICUA 5KFZA 2YY6A 2W7OA 1T4GA 1TAMA 3D6JA 9ICOA 3BS5A 2KJ8A 2VIXA 4C80A 2H5XA 4ECRA 5ALYA 3WKCA 5KFTA 4QWBA 1DGSA 4G9BA 4J9PA 5J0SA 1LB2B 2HHXA 2K89A 3KKAC 1NKBA 4F71A 3N4MB 1AQ6A 2FE9A 4Y2QA 4ECZA 3LWMA 2AU0A 8ICJA 3Q8KA 3EPGA 2VA3A 2KIVA 4KLGA 3SAHA 4DQRA 4ELVA 3AM9A 4PHEA 3NTUA 3H8JA 3RB0A 3Q8PB 3J81j 4ICAA 3RB6A 3BDPA 1HIWA 2EAPA
chains in the Genus database with same CATH topology
2KKPA 2ZG6A 2PMZF 4OJOA 5C0YA 4P0PA 2KKVA 3H0RB 2RP5A 5A0LA 2YB4A 2K4IA 4FZMA 2Q4TA 1P7DA 2N1RA 2HBMA 1DRGA 2HBKA 2W7PA 3E0FA 4OO1J 3KZXA 3VCBA 1Z19A 3HKZC 4OJLA 2H3ZA 1KBUA 2LYAA 4QIWF 4PL1A 2K4EA 1WUDA 1IIPA 3SQIA 2LKYA 2KEYA 2ZIXA 2XICA 4P0QB 5CRXA 2VKQA 2OM6A 2DGZA 3F2CA 3SMVA 2XIDA 2HOFA 1XNSA 2G09A 2WB1F 2E1FA 4OJ5A 3M6KA 2ZIXB 3LYSA 3DEEA 4FZNA 2G07A 2KJ9A 3LVVA 4AYBF 2YX8A 3M6ZA 3PSFA 4OJPA 1PVPA 2LYBA 2G06A 2K4HA 1SZHA 2OYYA 1ECWA 2KVCA 2PMZC 3GU3A 4FE3A 4NLBA 2LBOA 2CN1A 4PL2A 2MRLA 2CPRA 3KFUF 2DF4B 4OJ6A 4BX9C 2E1EA 1Z1BA 1A6SA 2KIWA 2JGAA 1A0PA 4KX5A 4NV0A 1MA7A 3N7PD 2XVTA 3PSIA 2R18A 3LVWA 2BDUA 3AQEA 3OPXA 3MGVA 1ZQ1C 2A3VA 2CRXA 2HBLA 5HR7A 1F44A 1NZBA 5T14A 3H0MB 3VC8A 4QIWC 5KL8B 3N7SC 2XI9A 2Y0SF 3PSPA 4JMUA 2W7OA 2E5SA 3T79A 2KHQA 2ZIUA 1Q3UA 1TAMA 3AQFA 3PZPA 2F2AB 1PVQA 2ZIUB 2G08A 2MA1A 2F76X 4CRXA 2H3QA 2G5IB 2HBJA 3NRWA 4QJFB 2KJ8A 2H3FA 2VIXA 2WAQF 2KOBA 3ONNA 1URJA 2VJ4A 2D6FC 3SAGA 4O3MA 1UPHA 2OH2A 2H3IA 2YB1A 3ICXA 3CP8A 3F5EA 1YT3A 3D2NA 3IN5A 2VJ5A 3F53A 1PVRA 2HOIA 2G0AA 2KHVA 2KICA 2ZIVB 4A8EA 2LHTA 3RFAA 1CRXA 4GFJA 2K8CB 2RRDA 4NWIA 2K89A 5HR6A 3CRXA 3NUQA 2GH1A 2ZIWB 2ZIWA 3CYMA 4NLCA 4U6PA 1D8BA 2Z7JA 3IG5A 3RF9A 2KV2A 3O0FA 3F5AA 4U7CA 2DQNB 2Y0SC 3K1ZA 3N7RC 1XO0A 3C28A 4QNLA 5KL1B 3M7DA 2ZIVA 3GZFA 2KD1A 2JMGA 2G5HB 4KX3A 2JH7A 4P0QA 2KJ5A 2ZXIA 4BJQA 4C0ZA 3HKZF 2OXOA 4IC9A 4BUGA 2NV3A 3SAFA 4FZLA 2WAQC 1Q3VA 2W03A 3C29A 3SAHA 1L6NA 2JH1A 4WJ3B 3ALRA 3D2QA 3D2SA 1OUQA 2K8BB 3L3FX 2HMXA 2F77X 3IP4B 4CDGA 2JHDA 2K8AA 2RHFA 2WB1C 4KMOB 4ACOA 3F2BA 4CGZA 4P0PB 2M0NA 2W04A 3PSTA 1GO3F 2HOQA 4ICAA 4AYBC 2GOLA 1ED1A 3AL0B 3IG8A 2F8LA 2KNJA 1HEKA 2H3VA 2ZXHA 1HIWA 3H0LB 1T94A 3F2DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y0S F;  4AYB F;  2WAQ F;  2WB1 F;  2PMZ F;  3HKZ F; 
#chains in the Genus database with same CATH topology
 2ZG6 A;  2UVR A;  2OCE A;  2PFQ A;  4DLE A;  4UB5 A;  5H2F U;  2W8K A;  3M1Y A;  1FFU A;  2ZJ8 A;  1T3N A;  3SQI A;  4C7Z A;  2QLT A;  3HP6 A;  2C2R A;  2OM6 A;  5CR0 A;  3NVY A;  2W9B A;  1XNS A;  3G6X A;  4X5V A;  1NJZ A;  4ECY A;  4DQS A;  4DL3 A;  5B66 U;  4F5Q A;  3M6Z A;  1BPY A;  1TFR A;  2KFN A;  3C5G A;  3LDA A;  3MR2 A;  1UHU A;  1V85 A;  2AJQ A;  2KIW A;  5J0P A;  4RQ1 A;  2OHF A;  1SZP A;  4F5R A;  4EZ9 A;  4ECQ A;  2HI0 A;  3BS5 B;  9ICN A;  5ALW A;  3IDW A;  4RQ5 A;  4BXO A;  3EYZ A;  4PGQ A;  1S97 A;  1PVR A;  2EZX A;  4US8 A;  3SI8 A;  1QQ6 A;  3N97 B;  2KIC A;  1ZJN A;  3C23 A;  5KFM A;  1N62 A;  2MUT A;  4DFD A;  2IOF K;  2OEH A;  4GXK A;  1D8B A;  3PX4 A;  1DK3 A;  1UA1 A;  1QCK A;  2BPF A;  3M8S A;  5ALV A;  1SKR A;  4IC9 A;  1ZQK A;  1SXD A;  2DKZ A;  1KLN A;  2J6T A;  4CGZ A;  3MR3 A;  1ZQQ A;  4KLE A;  1JXE A;  1TAU A;  4I2H A;  4C8K A;  1T94 A;  3BZK A;  8ICZ A;  2I9G A;  9ICQ A;  1IG6 A;  4Z6C A;  2HBK A;  4ED3 A;  2P6U A;  1IV8 A;  5ALK A;  2KK0 A;  4DFM A;  4Q44 A;  5AIA A;  3Q8M A;  5ALI A;  5ALX A;  5ALO A;  8ICF A;  5CEH A;  4NLZ A;  2YTU A;  1SL2 A;  2HOF A;  2QAR B;  2XY5 A;  1XO1 A;  2KJ9 A;  2FMQ A;  2YX8 A;  4K4H A;  3WKD A;  1FIQ A;  2NRZ A;  5DB8 A;  3HIL A;  4LJX A;  2B0C A;  4Y2S A;  1UCV A;  4KLO A;  4QZE A;  2E1E A;  2KG5 A;  3B9J A;  4ECW A;  2ZTE A;  1M6Y A;  3ISD A;  4R8U B;  4RQ0 A;  3V7L A;  1X9S A;  2XI9 A;  3KHL A;  2YN4 A;  1Q3U A;  4J9R A;  3RJE A;  2NYV A;  4PJ0 U;  1TK0 A;  2HBJ A;  4O5C A;  3L5K A;  5AK5 A;  4QZB A;  3ED5 A;  4YVZ A;  2OH2 A;  3ICX A;  1RZT A;  3MBY A;  4C4R A;  5ALU A;  3UM9 A;  3SR6 A;  5L1K A;  3CW2 C;  4Y2X A;  3CRX A;  2WF6 A;  3NUQ A;  1LKY B;  2ZIW B;  1WWU A;  1NK4 A;  4KLT A;  4M9G A;  4C0Z A;  5AI8 A;  3PW4 A;  3L3F X;  5D46 A;  3QX7 A;  1B43 A;  4ACO A;  4KMO B;  4DSL A;  5AM1 A;  8ICE A;  5KG6 A;  5KFP A;  4DL2 A;  2PMZ F;  4F2R A;  3BQ0 A;  1KFD A;  4C8O A;  1RDF A;  2BHN A;  4PH5 A;  3JPR A;  5JRT A;  5DG9 A;  4KLL A;  4YQW A;  5CRX A;  4DOC A;  4F72 A;  3QUT A;  3JPQ A;  4ECS A;  1X9M A;  3RBD A;  3PW5 A;  1BNO A;  4YR2 A;  3M9M B;  3GIM A;  2W9B B;  2WB1 F;  2EZZ A;  3ZD9 A;  5J2J A;  3DEE A;  5J0X A;  1IXR A;  2ZUC A;  4Y2Y A;  5AK4 A;  1OW5 A;  2PMZ C;  4NLB A;  4ELT A;  3QUB A;  4YMM A;  3HJE A;  4PL2 A;  2BCS A;  1ZD2 P;  1Z1B A;  4BX9 C;  7ICM A;  4RQ3 A;  5KT5 A;  4GXI A;  4O5E A;  8ICN A;  3PSI A;  3AQE A;  1UA0 A;  5ALD A;  5HR7 A;  4DS5 A;  5T14 A;  5KFD A;  4UAY A;  7ICO A;  1JX4 A;  3AQF A;  1S9F A;  4UB2 A;  7ICL A;  2G08 A;  2MA1 A;  3MC1 A;  5KFY A;  3ONN A;  1B0X A;  4K4I A;  4I2B A;  2F8K A;  3RH5 A;  1T8E A;  5AKI A;  4DL6 A;  2GLE A;  9ICJ A;  5IIJ A;  1BPB A;  4A8E A;  3EW9 A;  1SV4 A;  2XY6 A;  4ED1 A;  1KTQ A;  4O3Q A;  3HW8 A;  4RU9 A;  7ICR A;  3JPN A;  3KOO A;  4TUR A;  2AGP A;  3AU2 A;  3EUB 2;  2FPK A;  4UAT A;  2Y1I A;  4Z6E A;  4FZL A;  2W03 A;  3I76 A;  1K5O A;  3FYH A;  7ICV A;  5KFF A;  4M9N A;  7ICU A;  3MDA A;  4KLF A;  4P0P B;  2M0N A;  1TK5 A;  1NK0 A;  3IG8 A;  2RDI A;  1CI4 A;  5KG4 A;  3EPI A;  2KKP A;  4M6W B;  1DK2 A;  1D8L A;  2DWQ A;  5E79 U;  3OJU A;  5DQI A;  4MHV A;  3E0F A;  4M0A A;  4E0D A;  5AI9 A;  5J0R A;  1QSL A;  4ECV A;  2FMP A;  3HRD D;  3M6K A;  3WK9 A;  1S10 A;  3QEA Z;  4DSK A;  4DL7 A;  1C7Y A;  4FE3 A;  7ICF A;  3E2E A;  8ICH A;  2ALZ A;  1ZQI A;  2MRL A;  1JUD A;  5AKX A;  1PK1 B;  3RRH A;  5AK6 A;  1HUZ A;  5FP0 A;  1WWV A;  1U48 A;  1TK8 A;  5KFG A;  4DOB A;  2JXJ A;  3QYP A;  5KL8 B;  2D3D A;  4JMU A;  5AIC A;  1S0O A;  2F2A B;  4HAI A;  1KFS A;  3RJJ A;  4EEY A;  3ZDE A;  4O3M A;  5L1I A;  3PV8 A;  3RBE A;  4QZ9 A;  9ICC A;  2KHV A;  2LHT A;  4IRD A;  3DV9 A;  2BCV A;  3K4G A;  4PZO A;  3UQ0 A;  3V6H A;  3N7R C;  4BWJ A;  4EBC A;  5J2K A;  1KRP A;  1JI7 A;  2KP7 A;  2ZXI A;  4O0I A;  3SAF A;  1SB3 C;  3QU9 A;  5KFK A;  1Z00 A;  5HMM A;  3D2S A;  2R8G A;  3I1Y A;  4EX6 A;  4CDG A;  4QW9 A;  3PW7 A;  1YZ6 A;  5IIL A;  1J2M A;  1Q46 A;  2GOL A;  1L5U A;  2H3V A;  5AKJ A;  1D9F A;  2VJ5 A;  4IR9 A;  3KZI U;  4HYK A;  3V6K A;  8ICT A;  5DG8 A;  5A0L A;  4MFC A;  4FZM A;  4M04 A;  4MFF A;  4DF4 A;  2NRX A;  4JUZ A;  1XS9 D;  4USA A;  3PO5 A;  5AM2 A;  4J9N A;  2AH5 A;  1ZQA A;  1TKD A;  2VKQ A;  4F4Y A;  2QAR A;  2AQ0 A;  3KHH A;  4MEX A;  4KLU A;  4YR3 A;  2R8K A;  1ZQS A;  5KFO A;  1SZH A;  3SEN A;  5J2I A;  5ALT A;  4CF4 A;  2JRZ A;  5KG3 A;  1U4B A;  4YP3 A;  4TUS A;  1X2I A;  1K1Q A;  2KE7 A;  3E58 A;  3PR4 A;  9ICF A;  3H4D A;  1L3T A;  5EWE A;  2W9C A;  3KBB A;  5D49 A;  1ZD3 A;  4DFJ A;  3TAQ A;  4EYH B;  4B9L A;  4EBE A;  2D6F C;  3M9N B;  1JMS A;  1BGX T;  3TAC B;  2PI5 A;  4Y2J A;  3D2N A;  1XU4 A;  5KFJ A;  5DLF A;  1J97 A;  1CEZ A;  8ICK A;  3RJI A;  4F2S A;  1TVA A;  3AEV A;  3NVW A;  4IQV A;  2EZY A;  3V6J A;  1PK3 A;  5CWR A;  4NLC A;  2I5H A;  1RM6 C;  1YZ7 A;  2MUT B;  5L9X A;  3TFR A;  4MF8 A;  1NK9 A;  2ZIV A;  2JMG A;  4P0Q A;  4BJQ A;  2JH7 A;  9ICX A;  1RQN A;  3GIK A;  4BUG A;  2JEJ A;  1BPD A;  2E8M A;  1SV0 A;  2DKX A;  3OSN A;  1WYG A;  4C8M A;  3BQT A;  5DDM A;  2Y9T A;  5L1M A;  1QQ7 A;  5DBB A;  5J2G A;  4RT3 A;  3AUO A;  4YXM A;  5J2B A;  4DFP A;  2KNJ A;  4JV0 A;  2R8J A;  5C0Y A;  4Q8F A;  4I2J A;  1PK1 A;  5J2C A;  5F9L A;  3PW2 A;  4UAS A;  5KNI A;  3KZX A;  4UB3 A;  1XC9 A;  3PR5 B;  3G6V A;  4XQ8 A;  5KG7 A;  1TAQ A;  2E8P A;  4UAU A;  4UB6 U;  9ICL A;  2ODG A;  4J9S A;  3GU3 A;  5ALF A;  5AKZ A;  4B9V A;  3KHR A;  3SYZ A;  3HX0 A;  5EE0 A;  1SKW A;  5KFX A;  4KX5 A;  4RQ4 A;  3MR6 A;  2MSN A;  3C1Z A;  1WG8 A;  4DLG A;  1NJW A;  2C2D A;  2V4R A;  1BPZ A;  3IV6 A;  2Y0S F;  5IIO A;  4LZD A;  2F3N A;  4F4X A;  5HNK A;  4RQ8 A;  3NRW A;  1Z3E B;  2AXT U;  3KD3 A;  4Y2R A;  1ZQM A;  1ZQZ A;  4UB1 A;  2FLP A;  2P35 A;  9ICI A;  3OHB A;  3UXN A;  3A0H U;  3F5E A;  3IN5 A;  5J2A A;  4BWM A;  5KG0 A;  2NRV A;  5ALE A;  5ALS A;  5DKW A;  3ZDA A;  3JPP A;  2HOI A;  9ICV A;  2HSZ A;  4NWI A;  5HR6 A;  4F50 A;  3RJF A;  4DF8 A;  1OXJ A;  3MDC A;  2GH1 A;  3K75 D;  4QZG A;  4Z6F A;  3T5H A;  4U7C A;  1COO A;  1XO0 A;  1COK A;  3ETL A;  3RRG A;  2LMR A;  5HML A;  2W55 A;  1VJ5 A;  1IM4 A;  5AM4 A;  2WTF A;  4KLH A;  3RH4 A;  5TIS U;  4R65 A;  9ICP A;  1NKE A;  2ASD A;  2W11 A;  2WB1 C;  4QZD A;  4UAV A;  4YR0 A;  5EWF A;  3WK4 A;  2DPJ A;  2HHW A;  3SV4 A;  3TAP A;  3AL0 B;  2ZXH A;  2A1A A;  5HHH A;  2FLN A;  3BZC A;  2V4Q A;  1L3U A;  4F4Z A;  1ZQW A;  1Y88 A;  2VA8 A;  3NS1 A;  4NLK A;  2ZJ5 A;  8ICR A;  2LKY A;  4J9O A;  2XIC A;  1ZQJ A;  4XA5 A;  5AKH A;  4KLJ A;  3LYS A;  5GTH U;  2G07 A;  3HWT A;  2LYB A;  8ICI A;  3SD7 A;  3PMN A;  1KL9 A;  4ZOH C;  2BPG A;  4C4T A;  9ICT A;  4OJ6 A;  3PW0 A;  2KTQ A;  1ZQO A;  4MEY A;  1JAL A;  4I2G A;  4FS1 A;  3N7S C;  3WKB A;  1X9W A;  3N28 A;  4YMO A;  3PZP A;  1V97 A;  1PVQ A;  1SL0 A;  2LI6 A;  2ZIU B;  8ICA A;  2H3Q A;  5EOZ A;  2VJ4 A;  2A1J B;  4GC7 A;  2H3I A;  4QWC A;  5IIK A;  2B21 A;  1JIH A;  1UQV A;  4FS2 A;  5ALZ A;  2ZIW A;  4XUS A;  3IG5 A;  4F5N A;  2QB0 B;  2EH9 A;  4P2H A;  4B6J A;  1XWL A;  7ICE A;  5DB6 A;  2XGP A;  3ISC A;  3LWL A;  3MFH A;  5ALR A;  3Q8S B;  2JH1 A;  4EX7 A;  7ICJ A;  3D2Q A;  3UMG A;  4DO9 A;  2EAO A;  2E8N A;  5J2D A;  5L1L A;  2BCR A;  1JRO A;  3OGU A;  4PHA A;  3UPQ A;  2EAM A;  5J0O A;  4B9M A;  3ZDD A;  4UAR A;  2AGQ A;  4RQM A;  4M2Y A;  4KMU A;  2A19 A;  2WF9 A;  2Q4T A;  1O08 A;  2B6G A;  1N5W A;  1RYS A;  1RXV A;  1KBU A;  2PFN A;  4UQG A;  5KFI A;  5KAF U;  1ARO P;  2ZIX A;  5BOM A;  2XID A;  4ELU A;  5AI6 A;  2ASL A;  4ED0 A;  2EAN A;  1FO4 A;  1ECW A;  4I27 A;  5DGB A;  4F91 B;  1N2X A;  1ZQG A;  3TKA A;  3HT3 A;  1MA7 A;  3FC4 A;  4NV0 A;  3U26 A;  2Y9U A;  4K4G A;  2HBL A;  4NXZ A;  4GXJ A;  7ICH A;  4EBD A;  3PSP A;  3Q8Q B;  3ZDB A;  5ALP A;  2NO4 A;  2FPM A;  4RPY A;  3TI0 A;  5J2E A;  2ESE A;  4RQ2 A;  5GTI U;  1SV0 C;  1URJ A;  2KZM A;  4IRC A;  3QZ8 A;  4NL9 A;  5ALN A;  1ZOL A;  5CJ7 A;  3H7I A;  4J9M A;  2HHV A;  2RLT A;  3RFA A;  3MAB A;  1Z4O A;  4M47 A;  1QQ5 A;  3GII A;  8ICL A;  4ECX A;  1N48 A;  4DFK A;  2UVV A;  4NY8 A;  1JRP A;  2F1J A;  4M9J A;  4UB4 A;  3F5A A;  5KFU A;  2DBY A;  5ALG A;  4EZ6 A;  3AMZ A;  1X40 A;  2ZTD A;  1PZN A;  4RNN A;  2HMX A;  2K8A A;  2W04 A;  8ICV A;  5AM5 A;  4EEN A;  3JPT A;  5JUM A;  1H38 A;  1FEZ A;  2YMQ A;  3H0R B;  4O5K A;  5KFC A;  2R8I A;  3WKE A;  2HBM A;  1DGJ A;  4EEK A;  4PL1 A;  5DB9 A;  9ICE A;  3QNM A;  3PVX A;  4P0Q B;  3Q8L A;  4RZR A;  4I2D A;  3SMV A;  2G09 A;  3CNH A;  2ZIX B;  1BPE A;  3BQ7 A;  3ZI4 A;  3PSF A;  4JB3 A;  4YMN A;  2K4H A;  5AKG A;  5KT4 A;  2LBO A;  5EE1 A;  4FO6 A;  4PHP A;  2DUY A;  2DF4 B;  4C8L A;  2IA6 A;  4IQU A;  4UB8 U;  2W3S A;  4F5P A;  3LVW A;  2F1I A;  2BDU A;  3QUQ A;  4TUP A;  4QW8 A;  3H0M B;  2IHM A;  2XY7 A;  2YML A;  1NK7 A;  1NJY A;  2FJ6 A;  8ICO A;  2G5I B;  4B9S A;  3C2M A;  4YFK A;  1S5L U;  2JR5 A;  5G5G A;  1UPH A;  4J03 A;  5J2H A;  1UT8 A;  4C8N A;  1WCN A;  2P6R A;  3V7J A;  5KG5 A;  3PX0 A;  3IM1 A;  5KFN A;  4KTQ A;  4U6P A;  3TAD C;  1RPL A;  1N5X A;  2BPC A;  4F4W A;  1S0N A;  2DQN B;  5KFR A;  4PGX A;  7ICP A;  3M7D A;  2HW3 A;  2J6U A;  1L7M A;  2HCF A;  4Y2V A;  1Q3V A;  5KFL A;  5J0Y A;  1XSN A;  4UBB A;  4TQS A;  1JN3 A;  1Z1V A;  2F77 X;  3QU4 A;  2V9W A;  2JHD A;  2RHF A;  4F3O A;  2JZB A;  3JPO A;  2HOQ A;  1X6J A;  4J9K A;  2BQR A;  4DS4 A;  3SZ2 A;  4OJO A;  4KLQ A;  5DQG A;  2YB4 A;  5K4L A;  5KT7 A;  3PX6 A;  1DRG A;  2K60 A;  1Z4N A;  3VCB A;  4US9 A;  2LYA A;  4QIW F;  1BPX A;  9ICU A;  3NVZ A;  5DGA A;  2MU2 A;  4I29 A;  3QZ7 A;  5J0T A;  3F2C A;  2W8L A;  1VLB A;  3AU6 A;  5AKY A;  4OJ5 A;  3H4B A;  2AQ4 A;  1PVP A;  5KFH A;  2XO7 A;  2KVC A;  4Y2P A;  1ZQH A;  2PFO A;  3MGH A;  1QH9 A;  4B9N A;  1KEJ A;  2FPL A;  3PNC A;  2J6S A;  4JV1 A;  1F44 A;  1DOQ A;  4QIW C;  5AI0 A;  5F9N A;  3BS7 A;  2ZIU A;  4TUQ A;  8ICX A;  5EE9 A;  4YD2 A;  4F92 B;  4RPX A;  3C2K A;  4ED2 A;  3TAR A;  5KFB A;  1BVS A;  4NLG A;  2ZUB A;  4PGY A;  5J0W A;  1MQ3 A;  8ICP A;  4UW9 A;  1MQ2 A;  2D8C A;  5AKE A;  2Y0S C;  3GZF A;  3KHG A;  4IL6 U;  2F44 A;  1CUK A;  5ALJ A;  3HKZ F;  2AHO B;  4J9Q A;  4JK1 A;  4R64 A;  1OUQ A;  2K8B B;  4KIT B;  5DQH A;  1NZP A;  2HHT A;  9ICR A;  1K1S A;  2BCQ A;  4YN4 A;  2F8L A;  4QWA A;  2M9N A;  3F2D A;  1ZQB A;  2RP5 A;  2W9A A;  1KFT A;  1RG6 A;  1X42 A;  4F5O A;  3EZ5 A;  1LVH A;  3HKZ C;  1EXN A;  1SGG A;  1BNP A;  2ZUD A;  7ICQ A;  5IIN A;  2E1F A;  2JV3 A;  3IRU A;  2W54 A;  3LVV A;  5KFW A;  4GC6 A;  7ICN A;  3B0Y A;  4RT2 A;  3QU2 A;  3OJS A;  2LPE A;  3WK5 A;  4NM2 A;  3R9K A;  1NI3 A;  9ICS A;  1A0P A;  2BR0 A;  5KTQ A;  1NK8 A;  2KSO A;  2HVH A;  3NVV A;  4RNO A;  3VC8 A;  4Q8E A;  2DL0 A;  4DQP A;  4DQI A;  5L1J A;  4B9U A;  2WAQ F;  3SAG A;  1V38 A;  1N56 A;  3H8S A;  2YQE A;  1YT3 A;  3GV5 B;  4LVS A;  3RAQ A;  2YMP A;  1ZXI A;  5KG2 A;  2KVS A;  3GQC A;  2PXI A;  3FM9 A;  1ZJM A;  3CYM A;  2P66 A;  2KV2 A;  3S6J A;  2CXY A;  1N63 A;  4YD1 A;  3QXG A;  2KZ3 A;  7ICS A;  1VDV A;  2AGO A;  1L6N A;  2WAQ C;  2HDO A;  3EWA A;  3ALR A;  2XCA A;  3F2B A;  3JPS A;  3PST A;  1GO3 F;  4C7Y A;  2JEI A;  2HHS A;  1U49 A;  8ICC A;  1JXL A;  1ZD4 A;  2YMM A;  3AN1 A;  5EE3 A;  9ICH A;  2BQU A;  2I1Q A;  2KKV A;  4DL5 A;  1A76 A;  3GIL A;  2UVU A;  5J2F A;  4YG2 A;  2HHQ A;  4O3S A;  2Y1J A;  1TE2 A;  5J0U A;  5DB7 A;  1P7D A;  2N1R A;  5B5E U;  5DLG A;  3TFS A;  5ALM A;  3RTV A;  2E3T A;  1UT5 A;  1SL1 A;  5C5J A;  1ZRN A;  1IIP A;  3WK7 A;  4KLS A;  1S77 D;  7ICI A;  4YXJ A;  3IHQ B;  5EWG A;  3UMC A;  4M9L A;  1LKY A;  4RUC A;  4FBU A;  4AYB F;  1S8O A;  2G06 A;  2OYY A;  3V72 A;  2XGQ A;  3UMB A;  9ICW A;  3THV A;  2LM4 A;  4Z6D A;  1ZQD A;  1S76 D;  3QUC A;  2HVI A;  9ICA A;  3ISB A;  3LK9 A;  4ED7 A;  4P4M A;  4NLN A;  2JEG A;  2ASJ A;  4BGD A;  2W43 A;  3T79 A;  2KHQ A;  2C22 A;  2F76 X;  2C28 A;  2W9M A;  3FAH A;  2H3F A;  4NL9 C;  4MF2 A;  5BOL A;  2KOB A;  5KFS A;  4IS7 A;  4UBC A;  4I2A A;  2XCP A;  4GFJ A;  3RB4 A;  2IHN A;  1X66 A;  4F8R A;  5KFQ A;  5BPC A;  2ES6 A;  4RQ6 A;  3O0F A;  4QZA A;  1HJP A;  1SKS A;  2MAX A;  4DQQ A;  3C28 A;  8ICQ A;  9ICM A;  4RNM A;  2RQ5 A;  1L7N A;  3B0X A;  5CHG A;  1U47 A;  2NV3 A;  1HUO A;  3T3F A;  3L4P A;  3C29 A;  1F0M A;  1MN8 A;  4KN4 A;  4P4P A;  4ZH4 A;  1B22 A;  7ICK A;  2WF5 A;  3MR5 A;  1LV5 A;  3C21 A;  3QEB Z;  1L7P A;  4O3O A;  3OSP A;  3UQ2 A;  3H0L B;  4OCZ A;  3MGI A;  1SIJ A;  4I2E A;  2LYH A;  2GO7 A;  3T5K A;  2K4I A;  1MSW D;  2WHE A;  3PY8 A;  4UAW A;  1Z00 B;  3GV8 B;  1S0M A;  1Z19 A;  4I28 A;  4DCC A;  3RJG A;  1NK6 A;  5ALH A;  2DGZ A;  3C1Y A;  2WF8 A;  2FLL A;  4DSF A;  4Q43 A;  3WK6 A;  2IMW P;  1ZD5 A;  4FZN A;  1L8L A;  3TAN A;  2PI4 A;  3WU2 U;  2CN1 A;  3NAS A;  4JWM A;  4NJ8 A;  3KFU F;  3TQ1 A;  1A6S A;  5KAI U;  2A3V A;  8ICG A;  2C2E A;  1S0V A;  1WCL A;  1NZB A;  4BXO B;  4ECT A;  2NRT A;  5AK3 A;  3K1R B;  2BCU A;  2JZB B;  3RJH A;  3H40 A;  5DBC A;  1RYR A;  1O03 A;  4QJF B;  8ICB A;  2FI1 A;  3Q8R B;  7ICT A;  2BDP A;  2YB1 A;  2ISP A;  4O3P A;  2FMS A;  3ZD8 A;  2ZJA A;  2G0A A;  4CE6 A;  2BGW A;  2K8C B;  2RRD A;  5CP2 A;  1X9X A;  1TV9 A;  4Q45 A;  2RDJ A;  1L3S A;  2Z7J A;  4O3N A;  4FFD A;  5KL1 B;  3WKA A;  1RQL A;  2E8O A;  3RJK A;  2KD1 A;  5J8Y C;  2G5H B;  3FDS A;  5KT2 A;  5HHI A;  4DSI A;  5DBA A;  4KLM A;  2WFA A;  5D4B A;  1RXW A;  5CB1 A;  2PFP A;  4M6W A;  2DPI A;  1QTM A;  1NK5 A;  2ATL A;  2BQ3 A;  1ED1 A;  1X6I A;  1HEK A;  2L5Y A;  3GDX A;  1T3Q A;  3QU7 A;  3KKA A;  2PKE A;  4P0P A;  4KLI A;  3SV3 A;  3GV7 B;  5AM3 A;  2ISO A;  1ZQU A;  4ECU A;  4PPX A;  4OO1 J;  1SWW A;  5ALQ A;  1F5S A;  8ICM A;  2VAN A;  2ZTC A;  2JEF A;  1WUD A;  5J29 A;  1QSY A;  4P4O A;  4FBT A;  4M9H A;  4XRH A;  4DL4 A;  5KFV A;  4IQT A;  5III A;  9ICG A;  3UXP A;  3V7K A;  4OJP A;  4TQR A;  1ZQR A;  4DOA A;  3NRZ A;  4O3R A;  5F3X B;  5CA7 A;  4AP9 A;  3OPX A;  3MGV A;  4O9M A;  5KFE A;  1ZQV A;  5HP4 A;  2BKE A;  2I6X A;  3SEI A;  5AHX A;  1B4F A;  4ED8 A;  4JV2 A;  4KN7 A;  5AI4 A;  4B9T A;  4CRX A;  5ALL A;  1ZRM A;  5J0Q A;  2K4P A;  1D8Y A;  1DXS A;  2UVW A;  3RH6 A;  3F53 A;  3GIJ A;  5DDY A;  3KTQ A;  1KSP A;  2ZIV B;  4I2I A;  1CRX A;  1N61 A;  3RB3 A;  8ICS A;  5J8Y A;  1XSL A;  1ZQP A;  7ICG A;  1PUZ A;  1ZYQ A;  5JTI A;  2NRW A;  4QNL A;  3OTQ A;  4KX3 A;  2OWO A;  2KJ5 A;  4QZI A;  1KKX A;  4CF5 A;  4NM1 A;  1ZQN A;  1U45 A;  1L3V A;  3IP4 B;  1NNL A;  4Y2U A;  2F1H A;  1ZQC A;  4R66 A;  1Q8K A;  8ICW A;  2R8H A;  4R8U A;  5DG7 A;  4DWI A;  2KSO B;  4MFA A;  4RPZ A;  5G5H A;  3C5F A;  4DSE A;  4LZG A;  3I28 A;  1RYU A;  2BZF A;  3PO4 A;  3ETR A;  4QZC A;  2IBK A;  3RR8 A;  9ICB A;  5AI5 A;  3C2L A;  2K4E A;  3BQ1 A;  3QE9 Y;  5KFA A;  2QB1 A;  4I2C A;  3RAX A;  1L7O A;  3NGD A;  2QKQ A;  5AM0 A;  3M9O B;  1L8O A;  4F93 B;  2NO5 A;  2DFL A;  2IOH A;  2XC9 A;  2CPR A;  1J2N A;  5KT6 A;  2JGA A;  1MC8 A;  5KG1 A;  2XVT A;  4DEZ A;  2HHU A;  2R18 A;  2CRX A;  1ZQ1 C;  1ZQY A;  4DSJ A;  2FDR A;  4YCX A;  1ZQE A;  3ORY A;  1QSS A;  1NKC A;  2E5S A;  4GIB A;  4UAZ A;  1D9D A;  3M8R A;  2Q0Z X;  4RQ7 A;  2W9C B;  3UXO A;  3G6Y A;  3OHA A;  5AKK A;  1NOM A;  4QZH A;  4QWD A;  3RR7 A;  3CP8 A;  1ZQT A;  4GLX A;  1ZQL A;  1ZQX A;  3H8W A;  5TZV A;  1U9L A;  4F4K A;  2QB0 A;  1FFV A;  4CCH A;  1KDH A;  3T5J A;  3RF9 A;  9ICK A;  5AIB A;  2KZZ A;  1KN5 A;  1ZET A;  3K1Z A;  1C20 A;  3HPO A;  2VA2 A;  4R63 A;  4IR1 A;  1T7P A;  1QLN A;  4CNQ A;  2EQY A;  2OXO A;  3H8M A;  1NJX A;  2KFZ A;  1KQQ A;  2WF7 A;  4WJ3 B;  1XSP A;  1V9P A;  4QZ8 A;  1ZQF A;  3MFI A;  1SWV A;  3BJY A;  5JU5 A;  3A0B U;  4RUA A;  4AYB C;  2EDU A;  4CF3 A;  3QU5 A;  3PML A;  4IQW A;  5KT3 A;  4C4S A;  3TAD A;  2KN7 A;  4ED6 A;  4OD0 A;  4G3I A;  2GWS A;  2W7P A;  4PHD A;  2IOF A;  4OJL A;  1N60 A;  2H3Z A;  8ICY A;  2KMD A;  2KEY A;  1KW4 A;  3DDH A;  3GFK B;  1SXE A;  4QWE A;  4Y2T A;  3ZDC A;  2O6K A;  3T5L A;  1A77 A;  4PZN A;  4I2F A;  4J9L A;  5AKL A;  2W3R A;  5IIM A;  4JWN A;  3BQ2 A;  2LM1 A;  4IRK A;  4EEL A;  3N7P D;  3WK8 A;  4QZF A;  4KLD A;  4EYI B;  2A1J A;  4BDP A;  4RQN A;  8ICU A;  5KFZ A;  2YY6 A;  2W7O A;  1T4G A;  1TAM A;  3D6J A;  9ICO A;  3BS5 A;  2KJ8 A;  2VIX A;  4C80 A;  2H5X A;  4ECR A;  5ALY A;  3WKC A;  5KFT A;  4QWB A;  1DGS A;  4G9B A;  4J9P A;  5J0S A;  1LB2 B;  2HHX A;  2K89 A;  3KKA C;  1NKB A;  4F71 A;  3N4M B;  1AQ6 A;  2FE9 A;  4Y2Q A;  4ECZ A;  3LWM A;  2AU0 A;  8ICJ A;  3Q8K A;  3EPG A;  2VA3 A;  2KIV A;  4KLG A;  3SAH A;  4DQR A;  4ELV A;  3AM9 A;  4PHE A;  3NTU A;  3H8J A;  3RB0 A;  3Q8P B;  3J81 j;  4ICA A;  3RB6 A;  3BDP A;  1HIW A;  2EAP A; 
#chains in the Genus database with same CATH homology
 2KKP A;  2ZG6 A;  2PMZ F;  4OJO A;  5C0Y A;  4P0P A;  2KKV A;  3H0R B;  2RP5 A;  5A0L A;  2YB4 A;  2K4I A;  4FZM A;  2Q4T A;  1P7D A;  2N1R A;  2HBM A;  1DRG A;  2HBK A;  2W7P A;  3E0F A;  4OO1 J;  3KZX A;  3VCB A;  1Z19 A;  3HKZ C;  4OJL A;  2H3Z A;  1KBU A;  2LYA A;  4QIW F;  4PL1 A;  2K4E A;  1WUD A;  1IIP A;  3SQI A;  2LKY A;  2KEY A;  2ZIX A;  2XIC A;  4P0Q B;  5CRX A;  2VKQ A;  2OM6 A;  2DGZ A;  3F2C A;  3SMV A;  2XID A;  2HOF A;  1XNS A;  2G09 A;  2WB1 F;  2E1F A;  4OJ5 A;  3M6K A;  2ZIX B;  3LYS A;  3DEE A;  4FZN A;  2G07 A;  2KJ9 A;  3LVV A;  4AYB F;  2YX8 A;  3M6Z A;  3PSF A;  4OJP A;  1PVP A;  2LYB A;  2G06 A;  2K4H A;  1SZH A;  2OYY A;  1ECW A;  2KVC A;  2PMZ C;  3GU3 A;  4FE3 A;  4NLB A;  2LBO A;  2CN1 A;  4PL2 A;  2MRL A;  2CPR A;  3KFU F;  2DF4 B;  4OJ6 A;  4BX9 C;  2E1E A;  1Z1B A;  1A6S A;  2KIW A;  2JGA A;  1A0P A;  4KX5 A;  4NV0 A;  1MA7 A;  3N7P D;  2XVT A;  3PSI A;  2R18 A;  3LVW A;  2BDU A;  3AQE A;  3OPX A;  3MGV A;  1ZQ1 C;  2A3V A;  2CRX A;  2HBL A;  5HR7 A;  1F44 A;  1NZB A;  5T14 A;  3H0M B;  3VC8 A;  4QIW C;  5KL8 B;  3N7S C;  2XI9 A;  2Y0S F;  3PSP A;  4JMU A;  2W7O A;  2E5S A;  3T79 A;  2KHQ A;  2ZIU A;  1Q3U A;  1TAM A;  3AQF A;  3PZP A;  2F2A B;  1PVQ A;  2ZIU B;  2G08 A;  2MA1 A;  2F76 X;  4CRX A;  2H3Q A;  2G5I B;  2HBJ A;  3NRW A;  4QJF B;  2KJ8 A;  2H3F A;  2VIX A;  2WAQ F;  2KOB A;  3ONN A;  1URJ A;  2VJ4 A;  2D6F C;  3SAG A;  4O3M A;  1UPH A;  2OH2 A;  2H3I A;  2YB1 A;  3ICX A;  3CP8 A;  3F5E A;  1YT3 A;  3D2N A;  3IN5 A;  2VJ5 A;  3F53 A;  1PVR A;  2HOI A;  2G0A A;  2KHV A;  2KIC A;  2ZIV B;  4A8E A;  2LHT A;  3RFA A;  1CRX A;  4GFJ A;  2K8C B;  2RRD A;  4NWI A;  2K89 A;  5HR6 A;  3CRX A;  3NUQ A;  2GH1 A;  2ZIW B;  2ZIW A;  3CYM A;  4NLC A;  4U6P A;  1D8B A;  2Z7J A;  3IG5 A;  3RF9 A;  2KV2 A;  3O0F A;  3F5A A;  4U7C A;  2DQN B;  2Y0S C;  3K1Z A;  3N7R C;  1XO0 A;  3C28 A;  4QNL A;  5KL1 B;  3M7D A;  2ZIV A;  3GZF A;  2KD1 A;  2JMG A;  2G5H B;  4KX3 A;  2JH7 A;  4P0Q A;  2KJ5 A;  2ZXI A;  4BJQ A;  4C0Z A;  3HKZ F;  2OXO A;  4IC9 A;  4BUG A;  2NV3 A;  3SAF A;  4FZL A;  2WAQ C;  1Q3V A;  2W03 A;  3C29 A;  3SAH A;  1L6N A;  2JH1 A;  4WJ3 B;  3ALR A;  3D2Q A;  3D2S A;  1OUQ A;  2K8B B;  3L3F X;  2HMX A;  2F77 X;  3IP4 B;  4CDG A;  2JHD A;  2K8A A;  2RHF A;  2WB1 C;  4KMO B;  4ACO A;  3F2B A;  4CGZ A;  4P0P B;  2M0N A;  2W04 A;  3PST A;  1GO3 F;  2HOQ A;  4ICA A;  4AYB C;  2GOL A;  1ED1 A;  3AL0 B;  3IG8 A;  2F8L A;  2KNJ A;  1HEK A;  2H3V A;  2ZXH A;  1HIW A;  3H0L B;  1T94 A;  3F2D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...