2WAQF

The complete structure of the archaeal 13-subunit dna-directed rna polymerase
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
90
structure length
90
Chain Sequence
b'SVYIVEEHYIPYSVAKKLLSDVIKSGSSSNLLQRTYDYLNSVEKCDAESAQKVVEELSSIISREDVRAVLASICPITPDEVRSILIMDSN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE RPO1N SUBUNIT
publication title Evolution of complex RNA polymerases: the complete archaeal RNA polymerase structure.
pubmed doi rcsb
molecule tags Transcription
total genus 13
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2009-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF03874 RNA_pol_Rpb4 RNA polymerase Rpb4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.820 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2waqF02
2WAQF 4AYBF 3HKZF 2Y0SF 2PMZF 2WB1F
chains in the Genus database with same CATH superfamily
2PXIA 1OXJA 4YMOA 4UBCA 2QLTA 1XSPA 2XGQA 2RP5A 2KIVA 1ZQZA 5AKKA 5J8YA 5J2DA 2MUTB 3UXNA 5HR7A 4QZBA 4P4PA 4DL3A 2KFNA 5HR6A 2BKEA 4ICAA 4F91B 2I9GA 2BDPA 2FJ6A 3ZD9A 2W9CA 4FE3A 4ECVA 4ECYA 2AGQA 2K8AA 2KJ8A 2E8PA 4DFMA 4YG2A 3SZ2A 5ALQA 5IIMA 4EX7A 3JPTA 1X6JA 4YD1A 3WK6A 3QZ8A 2VIXA 2OYYA 2RQ5A 4TUSA 3FYHA 2KE7A 5J0OA 3OSPA 4M9HA 4OD0A 3RH4A 4ZOHC 4ZH4A 9ICVA 5J8YC 3IP4B 4F8RA 3UM9A 3MGVA 4F5RA 4IQUA 4RPYA 4QW8A 4UAWA 2IA6A 1MQ2A 3GZFA 2WF6A 4J03A 2KVCA 5ALVA 2HBJA 3WK8A 3OJSA 4DWIA 1WCLA 4RQ2A 1KL9A 2ZG6A 3NRWA 5KFGA 5KT4A 3CNHA 2F2AB 5L1JA 3WKCA 1TK8A 1RYRA 2C2EA 2K4IA 3MGHA 3KBBA 4QZIA 5D4BA 2DKXA 1K1QA 3M6KA 8ICGA 1X6IA 4M47A 3OSNA 3J81j 2CN1A 5IINA 4ECTA 4EZ9A 1WYGA 2ZIUB 5KG3A 5J0QA 1B0XA 4KX5A 1A77A 2HVIA 1ZQQA 2CXYA 5KFLA 3C5FA 7ICHA 3GFKB 4LVSA 2MRLA 2G5HB 1TK5A 4M9GA 1L8OA 2EZXA 5KT5A 1DRGA 4RPZA 2IHMA 4BXOB 5L1KA 1PVRA 5DB9A 1SZPA 2VA8A 5EWGA 1RG6A 9ICAA 4UAYA 2IOFK 1KDHA 4YQWA 5DDMA 3EPIA 2ESEA 2H3IA 2FE9A 2LMRA 1TVAA 4RU9A 2ZIXB 1WCNA 5F9NA 4M6WB 3RRHA 2KKVA 2JZBB 5AKIA 1LKYB 2A19A 9ICQA 3M7DA 2P6UA 5AK6A 1L3UA 3MFHA 4AYBC 5J0TA 2ALZA 4QJFB 3F5EA 3FC4A 1SXEA 4B9NA 3EW9A 1EXNA 1PK3A 4GC6A 5EE0A 3OHAA 4RPXA 1N2XA 2ZIVB 3QUBA 4YR3A 1SL0A 4I2DA 3PX4A 4QW9A 5GTHU 1U47A 4B9UA 7ICJA 2NRWA 2ISPA 5KFQA 5ALMA 2RRDA 5DBBA 2ZXIA 2HSZA 1SV0C 4C4SA 2D8CA 1IV8A 3BS5B 5AKGA 1NNLA 3C2LA 1CEZA 1QTMA 9ICFA 5IIOA 2W8LA 3HPOA 5DG9A 3C28A 1F0MA 2LM1A 1BPDA 3PMNA 2KHVA 2V4RA 8ICTA 4C8KA 2ZIWA 4F2RA 4XA5A 1S0NA 3H4DA 2W04A 2B6GA 2L5YA 4ECXA 3HT3A 4A8EA 2JH1A 4C7YA 1BPZA 2ZXHA 3TADA 4EBDA 7ICKA 4JV1A 4YCXA 1UA0A 2KP7A 5DB7A 1C7YA 2VJ5A 5KFXA 1OW5A 2R8GA 5AK3A 2MUTA 4UB5A 4NWIA 3BQ0A 3G6YA 3Q8PB 3I1YA 5ALUA 2WB1C 9ICBA 2NYVA 1ZQTA 3RJFA 1H38A 3U26A 1WWVA 4DQSA 4KLLA 2J6SA 2DPIA 3IN5A 1XWLA 4F71A 4FS1A 1Q8KA 3HX0A 3KD3A 3CYMA 1D8YA 2DL0A 3MABA 4UB6U 5F3XB 3HILA 1L3TA 5DDYA 4BGDA 4UB1A 8ICJA 3PX0A 1CUKA 3KZIU 2D6FC 1QQ7A 8ICMA 4NY8A 5C0YA 4B9SA 3MDCA 5KNIA 3MR6A 1P7DA 1M6YA 2HDOA 4RUAA 5JU5A 3NUQA 2W54A 2P66A 3HW8A 2Y1IA 4DOCA 2LKYA 3QUQA 2HBKA 4Y2QA 1ZD2P 1ZYQA 4US9A 3KZXA 9ICMA 4JV2A 3RJJA 2W7OA 3CP8A 3HWTA 5D49A 2YMQA 9ICGA 4K4IA 2EZYA 3JPNA 2DFLA 4UB4A 4PL1A 2H3QA 5AKLA 5AM3A 3THVA 2ZIUA 4KITB 4Y2XA 5KG0A 2KICA 4UB8U 9ICSA 2WF8A 4JV0A 2K4PA 4IQWA 4M0AA 1ECWA 4OJOA 3MFIA 3K1RB 4RQ1A 1HUOA 2ODGA 2ASJA 2KIWA 1NZBA 1RDFA 4WJ3B 3AMZA 4M2YA 2BCSA 3E2EA 5KFMA 4QNLA 3SENA 2G06A 4ECRA 4DSFA 4NL9A 1L3VA 1V85A 3A0HU 2IOHA 4XRHA 1NOMA 2Y9UA 1PVQA 2Y0SC 5KG2A 2GWSA 3IG8A 4PGQA 1ZOLA 4MHVA 4U7CA 4F4XA 9ICUA 2E8MA 4M6WA 5ALHA 2EANA 1VDVA 3GQCA 1ZQCA 2ZUBA 1LKYA 2MSNA 5HMLA 4EEKA 1C20A 3CRXA 2JRZA 3MDAA 3T5JA 3ZDCA 1X66A 5ALTA 1J97A 3RRGA 3WKDA 3JPQA 5L1IA 4FBUA 2JEJA 4F2SA 5DB8A 1ZJMA 3WK7A 4K4HA 1ZQJA 5B5EU 1BGXT 4FO6A 8ICYA 2LYAA 4E0DA 5BOMA 1Z00B 5KT7A 5AK5A 1L5UA 2NO5A 3AL0B 3BQ1A 8ICWA 3L5KA 2OCEA 2EDUA 4ED2A 1ZQBA 2NRTA 2R18A 1QSLA 2YB1A 5F9LA 4F4KA 4J9RA 3PW4A 4Q45A 3E0FA 4RQ8A 2JV3A 3JPPA 3RR7A 4GIBA 8ICKA 3NTUA 3HKZC 4QZ8A 3ETLA 4R66A 3Q8RB 2E1EA 2UVRA 2PFQA 1ZQSA 4NLNA 9ICEA 3RJHA 1FEZA 1Z19A 4I2FA 3B9JA 2XGPA 5EE1A 3LVWA 3Q8LA 4I28A 4UW9A 3VCBA 2BPCA 3K75D 3ZD8A 5KFDA 4P0PB 2W3SA 2BQUA 4YVZA 5EOZA 3O0FA 2WFAA 4FS2A 2W55A 4Y2TA 2FMQA 4ECQA 4PL2A 4KMOB 2OWOA 4C0ZA 4C8OA 4EX6A 2Q4TA 4GXKA 4FZNA 4YMMA 1MC8A 2XY6A 2YQEA 4MEXA 2KV2A 4YXJA 5CB1A 3C29A 2FLLA 1HIWA 4Y2JA 2HHTA 4QZHA 5L9XA 4UAVA 4YR2A 4OJPA 3JPSA 4NLCA 2W7PA 1DXSA 4CNQA 1T3QA 2JR5A 4FFDA 1SKSA 1SWWA 5J29A 4MFCA 1QCKA 1UCVA 2LI6A 4Z6DA 1NJZA 1Z4NA 5CRXA 1QH9A 4XUSA 4FZLA 4MF8A 9ICRA 4I2GA 7ICNA 3GV7B 5KFWA 2OXOA 5KAFU 4ECWA 3IM1A 3PR4A 1N5WA 5DG7A 4BDPA 4O5EA 4XQ8A 5J2HA 7ICUA 2AQ4A 1ZQNA 7ICSA 1DOQA 4EBCA 4TUPA 4ACOA 1ZD3A 3C23A 4O3PA 3NASA 4NLGA 2H3ZA 2N1RA 2EQYA 4RQMA 4HAIA 1D9FA 2BDUA 1ZQAA 5KFHA 4JMUA 1SKWA 1N5XA 7ICVA 2KG5A 2C2RA 3OJUA 1N61A 4QWAA 5AKJA 1L7PA 4O3QA 2M0NA 2BZFA 5J0SA 2XIDA 5AM0A 3MR2A 4O5KA 1IIPA 3TI0A 1DK3A 5JRTA 3K1ZA 4DOBA 5B66U 1XU4A 4J9QA 2Z7JA 1JX4A 3GV5B 4PGYA 9ICLA 5AI4A 5AM4A 4DEZA 4IRCA 1D8LA 1TKDA 1ZQOA 4KLFA 2KFZA 2XICA 3TACB 3HKZF 4CF5A 4P4MA 3N7RC 1KQQA 1RXWA 2VKQA 5KTQA 4F5NA 4DOAA 5DGBA 5IILA 3LDAA 4RQ4A 1U45A 3FAHA 4QZEA 5CWRA 3V7JA 1PK1A 2ES6A 8ICOA 4RT3A 5ALRA 3UMBA 1JI7A 1QQ5A 1URJA 4GLXA 3SV4A 3L3FX 4QWCA 1Z00A 2PKEA 4B9LA 3UMCA 2MA1A 3GIIA 1L7MA 4PHPA 1K5OA 1JROA 4M9NA 1S8OA 1UPHA 3RBDA 2CPRA 3H0RB 5AKHA 3KOOA 2W8KA 8ICUA 4DS4A 4DSLA 2HHQA 1HJPA 2A1AA 3SI8A 2NV3A 3PSTA 4UB3A 2HI0A 4YD2A 1BPXA 4F4WA 2A1JA 5HNKA 3RJKA 2FLNA 3NS1A 3M6ZA 3AN1A 4DF8A 7ICGA 4I2HA 2WAQC 1ZQIA 4PPXA 4KN4A 5KL1B 4F4ZA 5BPCA 5KFNA 2GOLA 4P0PA 5TZVA 4G9BA 1Q46A 1O03A 3H4BA 2BPFA 1T7PA 3SV3A 3UPQA 2HMXA 1SV4A 1NK5A 4QZDA 5A0LA 3H0MB 9ICWA 4TQRA 3QZ7A 8ICAA 4J9NA 3H7IA 1NK9A 4DSJA 4PZNA 1MSWD 4I27A 3EYZA 4J9PA 3PO5A 4Y2RA 3HJEA 1DK2A 2LYBA 3C21A 3T5HA 4I2IA 1NZPA 2I5HA 1SL2A 1ZQMA 3S6JA 1ZQPA 4RNMA 5J0RA 4Y2YA 4DO9A 1PUZA 3ZDEA 3LWMA 1NJYA 2HW3A 3V72A 4C8MA 3C5GA 2FMSA 5IIIA 3WK4A 2J6UA 2UVVA 2G5IB 4KLIA 5KFOA 2KZMA 2AJQA 1ZQWA 3WKEA 9ICOA 4PH5A 5DQHA 1XO0A 4QZFA 5J0PA 2WF5A 8ICIA 5KFIA 3HP6A 4IL6U 3D2NA 3N7PD 2DBYA 3RAXA 4CF3A 2XI9A 4US8A 7ICQA 1ZQGA 1O08A 4BWJA 2LYHA 4KLDA 5KFZA 1Z3EB 4P4OA 3PNCA 5KL8B 3SAHA 2DGZA 3KFUF 1BNOA 2HHSA 2FPLA 3GU3A 2F1IA 4F92B 4FBTA 5J2BA 1QSSA 3F2BA 3M9NB 3IRUA 3H8SA 4LZDA 3M9OB 5AKZA 3EUB2 2HCFA 4QZ9A 1JUDA 4C7ZA 4PJ0U 5FP0A 1JMSA 1LB2B 5KFPA 4B9MA 2PI5A 1BPBA 1FIQA 1JALA 4J9OA 3VC8A 3KTQA 4RNOA 2ZTCA 5JUMA 1XS9D 1XSNA 2F3NA 1V9PA 4O0IA 2F1HA 2JH7A 5ALDA 5CEHA 2E3TA 3C2KA 3ISCA 1L7NA 4GC7A 2JEGA 1SIJA 1X40A 1TAUA 5DQIA 2WHEA 3RB6A 8ICVA 1TE2A 7ICOA 3V7LA 2KTQA 4RQ0A 3GILA 1OUQA 2LHTA 2G07A 5KT6A 4NLBA 4DL4A 5AM2A 1RYUA 2RLTA 2DF4B 4LZGA 5KG4A 4UAZA 2VA3A 2IBKA 2WAQF 4P0QA 7ICPA 1ZQVA 4YR0A 1J2MA 1L3SA 5DG8A 3TADC 4GXIA 2M9NA 1ZQDA 1JIHA 5J2JA 3R9KA 3BQTA 4PZOA 3ZDAA 5ALIA 1ZXIA 5E79U 4LJXA 5TISU 2EH9A 2AXTU 3QU5A 4Y2UA 1CI4A 2BGWA 5KG1A 3SAGA 1S0OA 3T3FA 2NRVA 4NLKA 4O3SA 1T94A 3RH5A 1XNSA 8ICPA 3AM9A 3HRDD 3UXOA 1COOA 2F76X 4DSEA 1S9FA 2P6RA 4RUCA 2Q0ZX 2GH1A 3GIKA 3GIJA 2GLEA 4QWBA 1ZQRA 7ICMA 1JN3A 4CGZA 2YY6A 5ALEA 2K8BB 5AIAA 3TAQA 2KZZA 2YB4A 4ED7A 3ZDBA 3FDSA 2KVSA 3F53A 5KFKA 5JTIA 2I6XA 2H3VA 2FDRA 5AK4A 2BQ3A 4G3IA 3ISBA 1ZJNA 5KT3A 4DSKA 2W9BB 2ZUCA 5KFYA 3GV8B 1T8EA 5J0WA 2VA2A 4I2AA 2W9AA 3RBEA 3MR5A 4YXMA 1ZQEA 4QZGA 1WG8A 3SQIA 2WF9A 1KFDA 2BHNA 4KN7A 4DQIA 4AP9A 1A0PA 3UMGA 1TV9A 3WKAA 3LYSA 4DL6A 1PK1B 5CR0A 2E8OA 3QUTA 7ICIA 2XC9A 2AU0A 4DL2A 3OTQA 5EWEA 1U49A 5AI6A 1IM4A 1ZQUA 2KK0A 3PSPA 1T4GA 3H8MA 3LK9A 3AQEA 4NL9C 2V4QA 2KZ3A 4O3NA 4QZCA 4PGXA 4ED6A 5J0XA 2YN4A 2QARA 1X9WA 3V6HA 2K4EA 1TAQA 5T14A 3UXPA 3ICXA 1B4FA 4M04A 3PZPA 3ORYA 4I2EA 3E58A 1NKCA 2A1JB 1S10A 3F2DA 2MAXA 3IHQB 2KHQA 2JEFA 2W9MA 4RQ6A 2F1JA 2PMZF 2Y1JA 5KFTA 3GDXA 3NRZA 1KFSA 9ICNA 5HMMA 5CP2A 4UATA 2AGOA 4QZAA 3LVVA 5KG6A 3PO4A 2UVUA 1RZTA 1NJXA 1F5SA 8ICNA 1KSPA 3RH6A 4BX9C 1FO4A 3NGDA 4IR9A 1ZQFA 4YMNA 1S5LU 8ICZA 1X9SA 4KLHA 2W03A 3B0YA 1TFRA 5ALKA 3RB3A 2YMLA 2XCAA 2K8CB 1UA1A 3I28A 3T5KA 2KD1A 1SB3C 3DV9A 4I2JA 2KSOA 3WU2U 3QX7A 4C8NA 2VJ4A 5ALSA 4QWEA 2JHDA 2H5XA 5DGAA 5EE3A 9ICXA 4U6PA 1ZD4A 1ZETA 2DPJA 4NM1A 3M8SA 2KOBA 5BOLA 2QB0A 2ZUDA 1RPLA 2NO4A 1DGJA 1ZQHA 2WF7A 2PFNA 7ICLA 2OH2A 1TAMA 4KLJA 3AUOA 3RB4A 2EAPA 4I2BA 1WWUA 2BQRA 2RDIA 5ALLA 4DQPA 3QXGA 4NJ8A 4DLEA 3SEIA 5G5HA 3SMVA 4DQRA 5ALYA 1Q3VA 2HBLA 2XY5A 3RFAA 2BCRA 4EEYA 3WK9A 3PW0A 4C4RA 2K4HA 2KJ5A 2YX8A 2R8JA 1JXEA 2GO7A 2B21A 4KMUA 4PHAA 1J2NA 3SR6A 4BWMA 4B6JA 5L1MA 4J9SA 2ATLA 1KBUA 4F3OA 2KKPA 3UQ0A 1NJWA 4DS5A 4TUQA 2G09A 5ALOA 5J2FA 2JXJA 1JRPA 3ONNA 3JPRA 4F5OA 1U9LA 4K4GA 2HBMA 3Q8QB 1N56A 1GO3F 2NRXA 4ELVA 2FPMA 9ICIA 4TQSA 4QWDA 1S97A 4O9MA 3EZ5A 3H40A 4KLMA 2W9BA 4JUZA 2FMPA 5ALPA 4NV0A 3V7KA 4JB3A 5KFEA 1MA7A 5J2AA 2AGPA 1S0MA 2PFPA 1KN5A 4O3MA 1NK6A 4DFPA 5ALGA 5DB6A 3OHBA 4DL5A 2JGAA 3KHLA 2HHXA 1L7OA 5GTIU 4F5PA 3ISDA 3QE9Y 4X5VA 2FI1A 8ICRA 5KFBA 4TURA 2OM6A 2W3RA 4P0QB 2DKZA 1N63A 4KX3A 3BDPA 4QIWF 3QU7A 3L4PA 4Z6EA 5KFJA 5ALJA 1FFVA 5ALNA 1L8LA 3AEVA 2MU2A 2F77X 4EBEA 5ALFA 4O5CA 3RTVA 2RDJA 4O3RA 5DLFA 1WUDA 3D6JA 4IC9A 4EYHB 1RQLA 4B9VA 5AHXA 3T79A 3SD7A 2YMMA 3QNMA 4NM2A 1BPEA 2C28A 9ICTA 1DGSA 1UT8A 2K89A 3OGUA 4Y2VA 3NVYA 5AI0A 1ZRMA 2DQNB 1IG6A 3PW2A 5AKXA 1RQNA 2ZJ5A 5AI8A 2HOFA 2ASDA 2F44A 5DLGA 3PW7A 4JWMA 1RYSA 5ALXA 1IXRA 3TAPA 1HUZA 2QKQA 2A3VA 5AICA 3D2SA 5HHHA 1ZRNA 9ICPA 3QEAZ 3Q8KA 3WKBA 2R8KA 4RQ5A 2G08A 3BS7A 1BPYA 8ICFA 4ED0A 2ASLA 2LBOA 2F8KA 8ICLA 1XO1A 3MC1A 5J2KA 4EENA 9ICHA 3T5LA 2J6TA 4ED3A 2E8NA 5DQGA 3F2CA 3Q8SB 3PVXA 2OHFA 3OPXA 3KKAA 4KLQA 2HOIA 1N48A 4USAA 3ED5A 5H2FU 4CCHA 1UT5A 3DEEA 1SV0A 3KHHA 3PR5B 1MN8A 3BZKA 5HHIA 2JMGA 1YT3A 4MFFA 5DKWA 1MQ3A 2KNJA 4O3OA 3RAQA 1NK8A 1NK0A 5KFRA 4J9KA 4Z6CA 5IIJA 4KLGA 5J2IA 1X42A 2EAOA 3PSIA 5AM5A 2CRXA 8ICEA 4OCZA 3ZDDA 2BPGA 4RNNA 4HYKA 3BQ7A 2K60A 2QARB 3AU2A 3B0XA 2FPKA 1QQ6A 4UBBA 3BZCA 3PSFA 2FLPA 4OO1J 4RQ7A 2KEYA 2HOQA 4OJLA 1KRPA 4UASA 5KFVA 3G6VA 3KKAC 3C1ZA 8ICHA 2AH5A 2XCPA 4M9LA 2HHWA 1QLNA 3RB0A 3PV8A 5IIKA 2YTUA 2P35A 9ICCA 1JXLA 2OEHA 3IDWA 3RJEA 1KFTA 3TANA 1ZQ1C 5L1LA 2G0AA 7ICRA 4CRXA 1T3NA 3SAFA 4F72A 1Z1BA 1B22A 1RM6C 2AHOB 4ECZA 4YN4A 1D8BA 3MGIA 4R8UA 4ED8A 4RT2A 3K4GA 5HP4A 2JEIA 3QU9A 4JWNA 1KLNA 4ED1A 2PMZC 1KKXA 2KSOB 1NK4A 5J2GA 2B0CA 3M1YA 2R8IA 4RZRA 3N4MB 5KAIU 4JK1A 2BCVA 4Y2PA 2IOFA 2BCUA 5DBCA 4R65A 2QB1A 2QB0B 3M8RA 4ECUA 7ICEA 4KLOA 5AM1A 2NRZA 2Y9TA 8ICBA 5DBAA 3TFRA 4F93B 3TFSA 1LVHA 2W11A 4Z6FA 1FFUA 1Y88A 3QEBZ 7ICFA 1N62A 1VJ5A 4MF2A 1S0VA 3PW5A 4EYIB 2C22A 2H3FA 4IQTA 1ZQXA 2KJ9A 4C4TA 2KMDA 3IG5A 3LWLA 4F5QA 1BVSA 1Z1VA 1UQVA 4NXZA 1X2IA 4F50A 5J2CA 4IRDA 2ZTDA 3C1YA 3D2QA 1KTQA 1CRXA 1U4BA 2F8LA 3TARA 2E5SA 3F5AA 5EE9A 1PZNA 4YP3A 3AQFA 2DUYA 4J9MA 4R64A 2VANA 1L6NA 2HHVA 5AKYA 3I76A 3C2MA 2ISOA 4R63A 4AYBF 4Y2SA 2XY7A 3EPGA 4BXOA 2ZTEA 4IS7A 1D9DA 4M9JA 3N97B 1SWVA 4I2CA 3GIMA 2ZJ8A 3JPOA 2R8HA 7ICTA 1ZQYA 4GFJA 3TQ1A 1PVPA 2I1QA 3N7SC 4Q8EA 1X9XA 1ZD5A 2WTFA 4MFAA 2ZIXA 3QUCA 2W9CB 5KFAA 2JZBA 3PX6A 4ELUA 1V38A 5J0YA 4Q8FA 3NVWA 4GXJA 4Q44A 1Q3UA 3ZI4A 5KFSA 9ICKA 3RJIA 2UVWA 4UQGA 1A6SA 3ETRA 1K1SA 4KTQA 4P2HA 3KHRA 2ZIVA 3EWAA 5KFFA 5CA7A 3SYZA 3G6XA 1UHUA 4DFKA 4DFDA 2XVTA 3IV6A 5D46A 3H0LB 5ALZA 3BS5A 4I29A 5G5GA 4Q43A 4DL7A 4QIWC 3Q8MA 5AI9A 3PY8A 4UB2A 1KW4A 2D3DA 3H8WA 5KG7A 4UAUA 3NVZA 3DDHA 8ICXA 3TKAA 1COKA 5KFUA 5J2EA 3UQ2A 4KLUA 2WB1F 2BR0A 3RJGA 2KN7A 2PFOA 1SZHA 4ECSA 2ZJAA 3QU4A 1TK0A 2O6KA 3NVVA 4PHDA 1N60A 4YFKA 4NLZA 2AQ0A 3N28A 1V97A 5CJ7A 3ALRA 5AKEA 3MBYA 5J0UA 2IHNA 2IMWP 4EZ6A 2E1FA 1KEJA 1BNPA 4IRKA 3H8JA 1U48A 1XC9A 1S76D 3FM9A 3WK5A 5C5JA 2PI4A 5AI5A 4C80A 2EZZA 4FZMA 5CHGA 2DWQA 4DQQA 4BJQA 1ZQLA 4C8LA 8ICQA 3MR3A 3A0BU 3V6JA 3QU2A 4DLGA 1VLBA 1SKRA 3RR8A 2C2DA 5KG5A 5KT2A 1A76A 4IR1A 1NI3A 1RXVA 1QSYA 2EAMA 1HEKA 2LM4A 4F4YA 1SXDA 4DFJA 1SL1A 3V6KA 1F44A 1YZ6A 4B9TA 4EELA 4UARA 8ICSA 5KFCA 4RQ3A 1SGGA 4CDGA 2LPEA 5AIBA 1AROP 2YMPA 3M9MB 3KHGA 2RHFA 1AQ6A 4KLSA 4CF4A 3BJYA 1S77D 1LV5A 1X9MA 4DCCA 1NKEA 2V9WA 3QYPA 4CE6A 4ELTA 4KLEA 8ICCA 2BCQA 1YZ7A 2W43A 1NKBA 2HVHA 4MEYA 1NK7A 1ED1A 3PMLA 1ZQKA 1Z4OA 2XO7A 2Y0SF 9ICJA 2HHUA 4BUGA 4KLTA 5K4LA 3AU6A 4PHEA 4OJ5A 3BQ2A 3RF9A 1B43A 1XSLA 2ZIWB 4DSIA 5EWFA 5ALWA 4DF4A 4J9LA 4OJ6A 3CW2C 4IQVA 4R8UB 4RQNA
chains in the Genus database with same CATH topology
2H3QA 3M6ZA 3AQEA 4KX5A 4QIWF 2ZIUA 3VCBA 4A8EA 2JH1A 5KL8B 3SAHA 2DGZA 1YT3A 2JMGA 3KFUF 2RP5A 2KICA 2ZXHA 3SAGA 4GFJA 2MRLA 2WAQC 4PL1A 2G5HB 3GU3A 1PVPA 4P0PB 2KNJA 5KL1B 3F2BA 1ECWA 2F77X 4FZMA 5HR7A 3N7SC 4OJOA 2K4EA 2VJ5A 3O0FA 3SMVA 3ICXA 4BJQA 5T14A 2GOLA 1DRGA 5HR6A 1T94A 2M0NA 3PZPA 2ZIXA 1XNSA 4ICAA 4P0PA 4PL2A 2XIDA 3PSIA 2KIWA 4KMOB 1NZBA 2CRXA 4NWIA 4WJ3B 1WUDA 3F2DA 2HBLA 1Q3VA 4C0ZA 1PVRA 2HMXA 4QNLA 2F76X 3RFAA 2G06A 1IIPA 2KHQA 4IC9A 5A0LA 3H0MB 2Q4TA 4FE3A 2WB1C 4FZNA 2K4HA 2GH1A 2KJ5A 2YX8A 2PMZF 3K1ZA 3T79A 2H3IA 1HEKA 2K8AA 2KJ8A 3VC8A 2KV2A 2Z7JA 1PVQA 4CGZA 2Y0SC 3PSFA 2ZIXB 2H3FA 2K89A 1Q3UA 3C29A 2K8BB 4OO1J 1F44A 3IG8A 2KEYA 2YB4A 1HIWA 3IN5A 1KBUA 2HOQA 4OJLA 2KKPA 2KJ9A 2KKVA 3LVVA 1A6SA 2DQNB 3F53A 4U7CA 2ZIVA 2VIXA 4CDGA 2LYBA 3M7DA 2OYYA 2G09A 3CYMA 4OJPA 2JH7A 4AYBC 2HOFA 2H3VA 3IG5A 4NLCA 2W7PA 2XICA 2XVTA 3ONNA 3HKZF 3H0LB 3CRXA 4QJFB 3F5EA 3N7RC 4BX9C 2HBMA 1GO3F 2RHFA 3IP4B 3MGVA 2A3VA 2VKQA 4QIWC 2D6FC 3D2SA 2W03A 3GZFA 3D2QA 5CRXA 5C0YA 1ZQ1C 2G0AA 2K8CB 2ZIVB 1OUQA 4NV0A 2LHTA 4CRXA 1CRXA 2KD1A 2G07A 2KVCA 2LYAA 4FZLA 1URJA 2HBJA 3SAFA 1MA7A 4NLBA 1Z1BA 1P7DA 2WB1F 2F8LA 2DF4B 2E5SA 2G5IB 3L3FX 3SQIA 3AL0B 4O3MA 2RRDA 2G08A 2ZG6A 2ZXIA 3F5AA 3NUQA 2OXOA 1SZHA 2VJ4A 3NRWA 2JHDA 2F2AB 1A0PA 2R18A 1ED1A 1D8BA 2WAQF 2YB1A 4P0QA 3AQFA 2JGAA 2Y0SF 3E0FA 2K4IA 2MA1A 2LBOA 1XO0A 2LKYA 1L6NA 3LYSA 4U6PA 3HKZC 4BUGA 3D2NA 2HBKA 3N7PD 2E1EA 1UPHA 2KOBA 2CPRA 3H0RB 3M6KA 2PMZC 3ALRA 3KZXA 4OJ5A 3RF9A 2XI9A 2ZIWB 3C28A 2W7OA 2CN1A 4ACOA 3CP8A 4AYBF 1Z19A 2E1FA 2NV3A 4OJ6A 2H3ZA 2KHVA 2OM6A 3PSTA 2N1RA 2ZIWA 2OH2A 1TAMA 3F2CA 2ZIUB 3OPXA 4P0QB 2BDUA 2W04A 2HOIA 3PSPA 3LVWA 4JMUA 3DEEA 4KX3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WAQ F;  4AYB F;  3HKZ F;  2Y0S F;  2PMZ F;  2WB1 F; 
#chains in the Genus database with same CATH topology
 2PXI A;  1OXJ A;  4YMO A;  4UBC A;  2QLT A;  1XSP A;  2XGQ A;  2RP5 A;  2KIV A;  1ZQZ A;  5AKK A;  5J8Y A;  5J2D A;  2MUT B;  3UXN A;  5HR7 A;  4QZB A;  4P4P A;  4DL3 A;  2KFN A;  5HR6 A;  2BKE A;  4ICA A;  4F91 B;  2I9G A;  2BDP A;  2FJ6 A;  3ZD9 A;  2W9C A;  4FE3 A;  4ECV A;  4ECY A;  2AGQ A;  2K8A A;  2KJ8 A;  2E8P A;  4DFM A;  4YG2 A;  3SZ2 A;  5ALQ A;  5IIM A;  4EX7 A;  3JPT A;  1X6J A;  4YD1 A;  3WK6 A;  3QZ8 A;  2VIX A;  2OYY A;  2RQ5 A;  4TUS A;  3FYH A;  2KE7 A;  5J0O A;  3OSP A;  4M9H A;  4OD0 A;  3RH4 A;  4ZOH C;  4ZH4 A;  9ICV A;  5J8Y C;  3IP4 B;  4F8R A;  3UM9 A;  3MGV A;  4F5R A;  4IQU A;  4RPY A;  4QW8 A;  4UAW A;  2IA6 A;  1MQ2 A;  3GZF A;  2WF6 A;  4J03 A;  2KVC A;  5ALV A;  2HBJ A;  3WK8 A;  3OJS A;  4DWI A;  1WCL A;  4RQ2 A;  1KL9 A;  2ZG6 A;  3NRW A;  5KFG A;  5KT4 A;  3CNH A;  2F2A B;  5L1J A;  3WKC A;  1TK8 A;  1RYR A;  2C2E A;  2K4I A;  3MGH A;  3KBB A;  4QZI A;  5D4B A;  2DKX A;  1K1Q A;  3M6K A;  8ICG A;  1X6I A;  4M47 A;  3OSN A;  3J81 j;  2CN1 A;  5IIN A;  4ECT A;  4EZ9 A;  1WYG A;  2ZIU B;  5KG3 A;  5J0Q A;  1B0X A;  4KX5 A;  1A77 A;  2HVI A;  1ZQQ A;  2CXY A;  5KFL A;  3C5F A;  7ICH A;  3GFK B;  4LVS A;  2MRL A;  2G5H B;  1TK5 A;  4M9G A;  1L8O A;  2EZX A;  5KT5 A;  1DRG A;  4RPZ A;  2IHM A;  4BXO B;  5L1K A;  1PVR A;  5DB9 A;  1SZP A;  2VA8 A;  5EWG A;  1RG6 A;  9ICA A;  4UAY A;  2IOF K;  1KDH A;  4YQW A;  5DDM A;  3EPI A;  2ESE A;  2H3I A;  2FE9 A;  2LMR A;  1TVA A;  4RU9 A;  2ZIX B;  1WCN A;  5F9N A;  4M6W B;  3RRH A;  2KKV A;  2JZB B;  5AKI A;  1LKY B;  2A19 A;  9ICQ A;  3M7D A;  2P6U A;  5AK6 A;  1L3U A;  3MFH A;  4AYB C;  5J0T A;  2ALZ A;  4QJF B;  3F5E A;  3FC4 A;  1SXE A;  4B9N A;  3EW9 A;  1EXN A;  1PK3 A;  4GC6 A;  5EE0 A;  3OHA A;  4RPX A;  1N2X A;  2ZIV B;  3QUB A;  4YR3 A;  1SL0 A;  4I2D A;  3PX4 A;  4QW9 A;  5GTH U;  1U47 A;  4B9U A;  7ICJ A;  2NRW A;  2ISP A;  5KFQ A;  5ALM A;  2RRD A;  5DBB A;  2ZXI A;  2HSZ A;  1SV0 C;  4C4S A;  2D8C A;  1IV8 A;  3BS5 B;  5AKG A;  1NNL A;  3C2L A;  1CEZ A;  1QTM A;  9ICF A;  5IIO A;  2W8L A;  3HPO A;  5DG9 A;  3C28 A;  1F0M A;  2LM1 A;  1BPD A;  3PMN A;  2KHV A;  2V4R A;  8ICT A;  4C8K A;  2ZIW A;  4F2R A;  4XA5 A;  1S0N A;  3H4D A;  2W04 A;  2B6G A;  2L5Y A;  4ECX A;  3HT3 A;  4A8E A;  2JH1 A;  4C7Y A;  1BPZ A;  2ZXH A;  3TAD A;  4EBD A;  7ICK A;  4JV1 A;  4YCX A;  1UA0 A;  2KP7 A;  5DB7 A;  1C7Y A;  2VJ5 A;  5KFX A;  1OW5 A;  2R8G A;  5AK3 A;  2MUT A;  4UB5 A;  4NWI A;  3BQ0 A;  3G6Y A;  3Q8P B;  3I1Y A;  5ALU A;  2WB1 C;  9ICB A;  2NYV A;  1ZQT A;  3RJF A;  1H38 A;  3U26 A;  1WWV A;  4DQS A;  4KLL A;  2J6S A;  2DPI A;  3IN5 A;  1XWL A;  4F71 A;  4FS1 A;  1Q8K A;  3HX0 A;  3KD3 A;  3CYM A;  1D8Y A;  2DL0 A;  3MAB A;  4UB6 U;  5F3X B;  3HIL A;  1L3T A;  5DDY A;  4BGD A;  4UB1 A;  8ICJ A;  3PX0 A;  1CUK A;  3KZI U;  2D6F C;  1QQ7 A;  8ICM A;  4NY8 A;  5C0Y A;  4B9S A;  3MDC A;  5KNI A;  3MR6 A;  1P7D A;  1M6Y A;  2HDO A;  4RUA A;  5JU5 A;  3NUQ A;  2W54 A;  2P66 A;  3HW8 A;  2Y1I A;  4DOC A;  2LKY A;  3QUQ A;  2HBK A;  4Y2Q A;  1ZD2 P;  1ZYQ A;  4US9 A;  3KZX A;  9ICM A;  4JV2 A;  3RJJ A;  2W7O A;  3CP8 A;  3HWT A;  5D49 A;  2YMQ A;  9ICG A;  4K4I A;  2EZY A;  3JPN A;  2DFL A;  4UB4 A;  4PL1 A;  2H3Q A;  5AKL A;  5AM3 A;  3THV A;  2ZIU A;  4KIT B;  4Y2X A;  5KG0 A;  2KIC A;  4UB8 U;  9ICS A;  2WF8 A;  4JV0 A;  2K4P A;  4IQW A;  4M0A A;  1ECW A;  4OJO A;  3MFI A;  3K1R B;  4RQ1 A;  1HUO A;  2ODG A;  2ASJ A;  2KIW A;  1NZB A;  1RDF A;  4WJ3 B;  3AMZ A;  4M2Y A;  2BCS A;  3E2E A;  5KFM A;  4QNL A;  3SEN A;  2G06 A;  4ECR A;  4DSF A;  4NL9 A;  1L3V A;  1V85 A;  3A0H U;  2IOH A;  4XRH A;  1NOM A;  2Y9U A;  1PVQ A;  2Y0S C;  5KG2 A;  2GWS A;  3IG8 A;  4PGQ A;  1ZOL A;  4MHV A;  4U7C A;  4F4X A;  9ICU A;  2E8M A;  4M6W A;  5ALH A;  2EAN A;  1VDV A;  3GQC A;  1ZQC A;  2ZUB A;  1LKY A;  2MSN A;  5HML A;  4EEK A;  1C20 A;  3CRX A;  2JRZ A;  3MDA A;  3T5J A;  3ZDC A;  1X66 A;  5ALT A;  1J97 A;  3RRG A;  3WKD A;  3JPQ A;  5L1I A;  4FBU A;  2JEJ A;  4F2S A;  5DB8 A;  1ZJM A;  3WK7 A;  4K4H A;  1ZQJ A;  5B5E U;  1BGX T;  4FO6 A;  8ICY A;  2LYA A;  4E0D A;  5BOM A;  1Z00 B;  5KT7 A;  5AK5 A;  1L5U A;  2NO5 A;  3AL0 B;  3BQ1 A;  8ICW A;  3L5K A;  2OCE A;  2EDU A;  4ED2 A;  1ZQB A;  2NRT A;  2R18 A;  1QSL A;  2YB1 A;  5F9L A;  4F4K A;  4J9R A;  3PW4 A;  4Q45 A;  3E0F A;  4RQ8 A;  2JV3 A;  3JPP A;  3RR7 A;  4GIB A;  8ICK A;  3NTU A;  3HKZ C;  4QZ8 A;  3ETL A;  4R66 A;  3Q8R B;  2E1E A;  2UVR A;  2PFQ A;  1ZQS A;  4NLN A;  9ICE A;  3RJH A;  1FEZ A;  1Z19 A;  4I2F A;  3B9J A;  2XGP A;  5EE1 A;  3LVW A;  3Q8L A;  4I28 A;  4UW9 A;  3VCB A;  2BPC A;  3K75 D;  3ZD8 A;  5KFD A;  4P0P B;  2W3S A;  2BQU A;  4YVZ A;  5EOZ A;  3O0F A;  2WFA A;  4FS2 A;  2W55 A;  4Y2T A;  2FMQ A;  4ECQ A;  4PL2 A;  4KMO B;  2OWO A;  4C0Z A;  4C8O A;  4EX6 A;  2Q4T A;  4GXK A;  4FZN A;  4YMM A;  1MC8 A;  2XY6 A;  2YQE A;  4MEX A;  2KV2 A;  4YXJ A;  5CB1 A;  3C29 A;  2FLL A;  1HIW A;  4Y2J A;  2HHT A;  4QZH A;  5L9X A;  4UAV A;  4YR2 A;  4OJP A;  3JPS A;  4NLC A;  2W7P A;  1DXS A;  4CNQ A;  1T3Q A;  2JR5 A;  4FFD A;  1SKS A;  1SWW A;  5J29 A;  4MFC A;  1QCK A;  1UCV A;  2LI6 A;  4Z6D A;  1NJZ A;  1Z4N A;  5CRX A;  1QH9 A;  4XUS A;  4FZL A;  4MF8 A;  9ICR A;  4I2G A;  7ICN A;  3GV7 B;  5KFW A;  2OXO A;  5KAF U;  4ECW A;  3IM1 A;  3PR4 A;  1N5W A;  5DG7 A;  4BDP A;  4O5E A;  4XQ8 A;  5J2H A;  7ICU A;  2AQ4 A;  1ZQN A;  7ICS A;  1DOQ A;  4EBC A;  4TUP A;  4ACO A;  1ZD3 A;  3C23 A;  4O3P A;  3NAS A;  4NLG A;  2H3Z A;  2N1R A;  2EQY A;  4RQM A;  4HAI A;  1D9F A;  2BDU A;  1ZQA A;  5KFH A;  4JMU A;  1SKW A;  1N5X A;  7ICV A;  2KG5 A;  2C2R A;  3OJU A;  1N61 A;  4QWA A;  5AKJ A;  1L7P A;  4O3Q A;  2M0N A;  2BZF A;  5J0S A;  2XID A;  5AM0 A;  3MR2 A;  4O5K A;  1IIP A;  3TI0 A;  1DK3 A;  5JRT A;  3K1Z A;  4DOB A;  5B66 U;  1XU4 A;  4J9Q A;  2Z7J A;  1JX4 A;  3GV5 B;  4PGY A;  9ICL A;  5AI4 A;  5AM4 A;  4DEZ A;  4IRC A;  1D8L A;  1TKD A;  1ZQO A;  4KLF A;  2KFZ A;  2XIC A;  3TAC B;  3HKZ F;  4CF5 A;  4P4M A;  3N7R C;  1KQQ A;  1RXW A;  2VKQ A;  5KTQ A;  4F5N A;  4DOA A;  5DGB A;  5IIL A;  3LDA A;  4RQ4 A;  1U45 A;  3FAH A;  4QZE A;  5CWR A;  3V7J A;  1PK1 A;  2ES6 A;  8ICO A;  4RT3 A;  5ALR A;  3UMB A;  1JI7 A;  1QQ5 A;  1URJ A;  4GLX A;  3SV4 A;  3L3F X;  4QWC A;  1Z00 A;  2PKE A;  4B9L A;  3UMC A;  2MA1 A;  3GII A;  1L7M A;  4PHP A;  1K5O A;  1JRO A;  4M9N A;  1S8O A;  1UPH A;  3RBD A;  2CPR A;  3H0R B;  5AKH A;  3KOO A;  2W8K A;  8ICU A;  4DS4 A;  4DSL A;  2HHQ A;  1HJP A;  2A1A A;  3SI8 A;  2NV3 A;  3PST A;  4UB3 A;  2HI0 A;  4YD2 A;  1BPX A;  4F4W A;  2A1J A;  5HNK A;  3RJK A;  2FLN A;  3NS1 A;  3M6Z A;  3AN1 A;  4DF8 A;  7ICG A;  4I2H A;  2WAQ C;  1ZQI A;  4PPX A;  4KN4 A;  5KL1 B;  4F4Z A;  5BPC A;  5KFN A;  2GOL A;  4P0P A;  5TZV A;  4G9B A;  1Q46 A;  1O03 A;  3H4B A;  2BPF A;  1T7P A;  3SV3 A;  3UPQ A;  2HMX A;  1SV4 A;  1NK5 A;  4QZD A;  5A0L A;  3H0M B;  9ICW A;  4TQR A;  3QZ7 A;  8ICA A;  4J9N A;  3H7I A;  1NK9 A;  4DSJ A;  4PZN A;  1MSW D;  4I27 A;  3EYZ A;  4J9P A;  3PO5 A;  4Y2R A;  3HJE A;  1DK2 A;  2LYB A;  3C21 A;  3T5H A;  4I2I A;  1NZP A;  2I5H A;  1SL2 A;  1ZQM A;  3S6J A;  1ZQP A;  4RNM A;  5J0R A;  4Y2Y A;  4DO9 A;  1PUZ A;  3ZDE A;  3LWM A;  1NJY A;  2HW3 A;  3V72 A;  4C8M A;  3C5G A;  2FMS A;  5III A;  3WK4 A;  2J6U A;  2UVV A;  2G5I B;  4KLI A;  5KFO A;  2KZM A;  2AJQ A;  1ZQW A;  3WKE A;  9ICO A;  4PH5 A;  5DQH A;  1XO0 A;  4QZF A;  5J0P A;  2WF5 A;  8ICI A;  5KFI A;  3HP6 A;  4IL6 U;  3D2N A;  3N7P D;  2DBY A;  3RAX A;  4CF3 A;  2XI9 A;  4US8 A;  7ICQ A;  1ZQG A;  1O08 A;  4BWJ A;  2LYH A;  4KLD A;  5KFZ A;  1Z3E B;  4P4O A;  3PNC A;  5KL8 B;  3SAH A;  2DGZ A;  3KFU F;  1BNO A;  2HHS A;  2FPL A;  3GU3 A;  2F1I A;  4F92 B;  4FBT A;  5J2B A;  1QSS A;  3F2B A;  3M9N B;  3IRU A;  3H8S A;  4LZD A;  3M9O B;  5AKZ A;  3EUB 2;  2HCF A;  4QZ9 A;  1JUD A;  4C7Z A;  4PJ0 U;  5FP0 A;  1JMS A;  1LB2 B;  5KFP A;  4B9M A;  2PI5 A;  1BPB A;  1FIQ A;  1JAL A;  4J9O A;  3VC8 A;  3KTQ A;  4RNO A;  2ZTC A;  5JUM A;  1XS9 D;  1XSN A;  2F3N A;  1V9P A;  4O0I A;  2F1H A;  2JH7 A;  5ALD A;  5CEH A;  2E3T A;  3C2K A;  3ISC A;  1L7N A;  4GC7 A;  2JEG A;  1SIJ A;  1X40 A;  1TAU A;  5DQI A;  2WHE A;  3RB6 A;  8ICV A;  1TE2 A;  7ICO A;  3V7L A;  2KTQ A;  4RQ0 A;  3GIL A;  1OUQ A;  2LHT A;  2G07 A;  5KT6 A;  4NLB A;  4DL4 A;  5AM2 A;  1RYU A;  2RLT A;  2DF4 B;  4LZG A;  5KG4 A;  4UAZ A;  2VA3 A;  2IBK A;  2WAQ F;  4P0Q A;  7ICP A;  1ZQV A;  4YR0 A;  1J2M A;  1L3S A;  5DG8 A;  3TAD C;  4GXI A;  2M9N A;  1ZQD A;  1JIH A;  5J2J A;  3R9K A;  3BQT A;  4PZO A;  3ZDA A;  5ALI A;  1ZXI A;  5E79 U;  4LJX A;  5TIS U;  2EH9 A;  2AXT U;  3QU5 A;  4Y2U A;  1CI4 A;  2BGW A;  5KG1 A;  3SAG A;  1S0O A;  3T3F A;  2NRV A;  4NLK A;  4O3S A;  1T94 A;  3RH5 A;  1XNS A;  8ICP A;  3AM9 A;  3HRD D;  3UXO A;  1COO A;  2F76 X;  4DSE A;  1S9F A;  2P6R A;  4RUC A;  2Q0Z X;  2GH1 A;  3GIK A;  3GIJ A;  2GLE A;  4QWB A;  1ZQR A;  7ICM A;  1JN3 A;  4CGZ A;  2YY6 A;  5ALE A;  2K8B B;  5AIA A;  3TAQ A;  2KZZ A;  2YB4 A;  4ED7 A;  3ZDB A;  3FDS A;  2KVS A;  3F53 A;  5KFK A;  5JTI A;  2I6X A;  2H3V A;  2FDR A;  5AK4 A;  2BQ3 A;  4G3I A;  3ISB A;  1ZJN A;  5KT3 A;  4DSK A;  2W9B B;  2ZUC A;  5KFY A;  3GV8 B;  1T8E A;  5J0W A;  2VA2 A;  4I2A A;  2W9A A;  3RBE A;  3MR5 A;  4YXM A;  1ZQE A;  4QZG A;  1WG8 A;  3SQI A;  2WF9 A;  1KFD A;  2BHN A;  4KN7 A;  4DQI A;  4AP9 A;  1A0P A;  3UMG A;  1TV9 A;  3WKA A;  3LYS A;  4DL6 A;  1PK1 B;  5CR0 A;  2E8O A;  3QUT A;  7ICI A;  2XC9 A;  2AU0 A;  4DL2 A;  3OTQ A;  5EWE A;  1U49 A;  5AI6 A;  1IM4 A;  1ZQU A;  2KK0 A;  3PSP A;  1T4G A;  3H8M A;  3LK9 A;  3AQE A;  4NL9 C;  2V4Q A;  2KZ3 A;  4O3N A;  4QZC A;  4PGX A;  4ED6 A;  5J0X A;  2YN4 A;  2QAR A;  1X9W A;  3V6H A;  2K4E A;  1TAQ A;  5T14 A;  3UXP A;  3ICX A;  1B4F A;  4M04 A;  3PZP A;  3ORY A;  4I2E A;  3E58 A;  1NKC A;  2A1J B;  1S10 A;  3F2D A;  2MAX A;  3IHQ B;  2KHQ A;  2JEF A;  2W9M A;  4RQ6 A;  2F1J A;  2PMZ F;  2Y1J A;  5KFT A;  3GDX A;  3NRZ A;  1KFS A;  9ICN A;  5HMM A;  5CP2 A;  4UAT A;  2AGO A;  4QZA A;  3LVV A;  5KG6 A;  3PO4 A;  2UVU A;  1RZT A;  1NJX A;  1F5S A;  8ICN A;  1KSP A;  3RH6 A;  4BX9 C;  1FO4 A;  3NGD A;  4IR9 A;  1ZQF A;  4YMN A;  1S5L U;  8ICZ A;  1X9S A;  4KLH A;  2W03 A;  3B0Y A;  1TFR A;  5ALK A;  3RB3 A;  2YML A;  2XCA A;  2K8C B;  1UA1 A;  3I28 A;  3T5K A;  2KD1 A;  1SB3 C;  3DV9 A;  4I2J A;  2KSO A;  3WU2 U;  3QX7 A;  4C8N A;  2VJ4 A;  5ALS A;  4QWE A;  2JHD A;  2H5X A;  5DGA A;  5EE3 A;  9ICX A;  4U6P A;  1ZD4 A;  1ZET A;  2DPJ A;  4NM1 A;  3M8S A;  2KOB A;  5BOL A;  2QB0 A;  2ZUD A;  1RPL A;  2NO4 A;  1DGJ A;  1ZQH A;  2WF7 A;  2PFN A;  7ICL A;  2OH2 A;  1TAM A;  4KLJ A;  3AUO A;  3RB4 A;  2EAP A;  4I2B A;  1WWU A;  2BQR A;  2RDI A;  5ALL A;  4DQP A;  3QXG A;  4NJ8 A;  4DLE A;  3SEI A;  5G5H A;  3SMV A;  4DQR A;  5ALY A;  1Q3V A;  2HBL A;  2XY5 A;  3RFA A;  2BCR A;  4EEY A;  3WK9 A;  3PW0 A;  4C4R A;  2K4H A;  2KJ5 A;  2YX8 A;  2R8J A;  1JXE A;  2GO7 A;  2B21 A;  4KMU A;  4PHA A;  1J2N A;  3SR6 A;  4BWM A;  4B6J A;  5L1M A;  4J9S A;  2ATL A;  1KBU A;  4F3O A;  2KKP A;  3UQ0 A;  1NJW A;  4DS5 A;  4TUQ A;  2G09 A;  5ALO A;  5J2F A;  2JXJ A;  1JRP A;  3ONN A;  3JPR A;  4F5O A;  1U9L A;  4K4G A;  2HBM A;  3Q8Q B;  1N56 A;  1GO3 F;  2NRX A;  4ELV A;  2FPM A;  9ICI A;  4TQS A;  4QWD A;  1S97 A;  4O9M A;  3EZ5 A;  3H40 A;  4KLM A;  2W9B A;  4JUZ A;  2FMP A;  5ALP A;  4NV0 A;  3V7K A;  4JB3 A;  5KFE A;  1MA7 A;  5J2A A;  2AGP A;  1S0M A;  2PFP A;  1KN5 A;  4O3M A;  1NK6 A;  4DFP A;  5ALG A;  5DB6 A;  3OHB A;  4DL5 A;  2JGA A;  3KHL A;  2HHX A;  1L7O A;  5GTI U;  4F5P A;  3ISD A;  3QE9 Y;  4X5V A;  2FI1 A;  8ICR A;  5KFB A;  4TUR A;  2OM6 A;  2W3R A;  4P0Q B;  2DKZ A;  1N63 A;  4KX3 A;  3BDP A;  4QIW F;  3QU7 A;  3L4P A;  4Z6E A;  5KFJ A;  5ALJ A;  1FFV A;  5ALN A;  1L8L A;  3AEV A;  2MU2 A;  2F77 X;  4EBE A;  5ALF A;  4O5C A;  3RTV A;  2RDJ A;  4O3R A;  5DLF A;  1WUD A;  3D6J A;  4IC9 A;  4EYH B;  1RQL A;  4B9V A;  5AHX A;  3T79 A;  3SD7 A;  2YMM A;  3QNM A;  4NM2 A;  1BPE A;  2C28 A;  9ICT A;  1DGS A;  1UT8 A;  2K89 A;  3OGU A;  4Y2V A;  3NVY A;  5AI0 A;  1ZRM A;  2DQN B;  1IG6 A;  3PW2 A;  5AKX A;  1RQN A;  2ZJ5 A;  5AI8 A;  2HOF A;  2ASD A;  2F44 A;  5DLG A;  3PW7 A;  4JWM A;  1RYS A;  5ALX A;  1IXR A;  3TAP A;  1HUZ A;  2QKQ A;  2A3V A;  5AIC A;  3D2S A;  5HHH A;  1ZRN A;  9ICP A;  3QEA Z;  3Q8K A;  3WKB A;  2R8K A;  4RQ5 A;  2G08 A;  3BS7 A;  1BPY A;  8ICF A;  4ED0 A;  2ASL A;  2LBO A;  2F8K A;  8ICL A;  1XO1 A;  3MC1 A;  5J2K A;  4EEN A;  9ICH A;  3T5L A;  2J6T A;  4ED3 A;  2E8N A;  5DQG A;  3F2C A;  3Q8S B;  3PVX A;  2OHF A;  3OPX A;  3KKA A;  4KLQ A;  2HOI A;  1N48 A;  4USA A;  3ED5 A;  5H2F U;  4CCH A;  1UT5 A;  3DEE A;  1SV0 A;  3KHH A;  3PR5 B;  1MN8 A;  3BZK A;  5HHI A;  2JMG A;  1YT3 A;  4MFF A;  5DKW A;  1MQ3 A;  2KNJ A;  4O3O A;  3RAQ A;  1NK8 A;  1NK0 A;  5KFR A;  4J9K A;  4Z6C A;  5IIJ A;  4KLG A;  5J2I A;  1X42 A;  2EAO A;  3PSI A;  5AM5 A;  2CRX A;  8ICE A;  4OCZ A;  3ZDD A;  2BPG A;  4RNN A;  4HYK A;  3BQ7 A;  2K60 A;  2QAR B;  3AU2 A;  3B0X A;  2FPK A;  1QQ6 A;  4UBB A;  3BZC A;  3PSF A;  2FLP A;  4OO1 J;  4RQ7 A;  2KEY A;  2HOQ A;  4OJL A;  1KRP A;  4UAS A;  5KFV A;  3G6V A;  3KKA C;  3C1Z A;  8ICH A;  2AH5 A;  2XCP A;  4M9L A;  2HHW A;  1QLN A;  3RB0 A;  3PV8 A;  5IIK A;  2YTU A;  2P35 A;  9ICC A;  1JXL A;  2OEH A;  3IDW A;  3RJE A;  1KFT A;  3TAN A;  1ZQ1 C;  5L1L A;  2G0A A;  7ICR A;  4CRX A;  1T3N A;  3SAF A;  4F72 A;  1Z1B A;  1B22 A;  1RM6 C;  2AHO B;  4ECZ A;  4YN4 A;  1D8B A;  3MGI A;  4R8U A;  4ED8 A;  4RT2 A;  3K4G A;  5HP4 A;  2JEI A;  3QU9 A;  4JWN A;  1KLN A;  4ED1 A;  2PMZ C;  1KKX A;  2KSO B;  1NK4 A;  5J2G A;  2B0C A;  3M1Y A;  2R8I A;  4RZR A;  3N4M B;  5KAI U;  4JK1 A;  2BCV A;  4Y2P A;  2IOF A;  2BCU A;  5DBC A;  4R65 A;  2QB1 A;  2QB0 B;  3M8R A;  4ECU A;  7ICE A;  4KLO A;  5AM1 A;  2NRZ A;  2Y9T A;  8ICB A;  5DBA A;  3TFR A;  4F93 B;  3TFS A;  1LVH A;  2W11 A;  4Z6F A;  1FFU A;  1Y88 A;  3QEB Z;  7ICF A;  1N62 A;  1VJ5 A;  4MF2 A;  1S0V A;  3PW5 A;  4EYI B;  2C22 A;  2H3F A;  4IQT A;  1ZQX A;  2KJ9 A;  4C4T A;  2KMD A;  3IG5 A;  3LWL A;  4F5Q A;  1BVS A;  1Z1V A;  1UQV A;  4NXZ A;  1X2I A;  4F50 A;  5J2C A;  4IRD A;  2ZTD A;  3C1Y A;  3D2Q A;  1KTQ A;  1CRX A;  1U4B A;  2F8L A;  3TAR A;  2E5S A;  3F5A A;  5EE9 A;  1PZN A;  4YP3 A;  3AQF A;  2DUY A;  4J9M A;  4R64 A;  2VAN A;  1L6N A;  2HHV A;  5AKY A;  3I76 A;  3C2M A;  2ISO A;  4R63 A;  4AYB F;  4Y2S A;  2XY7 A;  3EPG A;  4BXO A;  2ZTE A;  4IS7 A;  1D9D A;  4M9J A;  3N97 B;  1SWV A;  4I2C A;  3GIM A;  2ZJ8 A;  3JPO A;  2R8H A;  7ICT A;  1ZQY A;  4GFJ A;  3TQ1 A;  1PVP A;  2I1Q A;  3N7S C;  4Q8E A;  1X9X A;  1ZD5 A;  2WTF A;  4MFA A;  2ZIX A;  3QUC A;  2W9C B;  5KFA A;  2JZB A;  3PX6 A;  4ELU A;  1V38 A;  5J0Y A;  4Q8F A;  3NVW A;  4GXJ A;  4Q44 A;  1Q3U A;  3ZI4 A;  5KFS A;  9ICK A;  3RJI A;  2UVW A;  4UQG A;  1A6S A;  3ETR A;  1K1S A;  4KTQ A;  4P2H A;  3KHR A;  2ZIV A;  3EWA A;  5KFF A;  5CA7 A;  3SYZ A;  3G6X A;  1UHU A;  4DFK A;  4DFD A;  2XVT A;  3IV6 A;  5D46 A;  3H0L B;  5ALZ A;  3BS5 A;  4I29 A;  5G5G A;  4Q43 A;  4DL7 A;  4QIW C;  3Q8M A;  5AI9 A;  3PY8 A;  4UB2 A;  1KW4 A;  2D3D A;  3H8W A;  5KG7 A;  4UAU A;  3NVZ A;  3DDH A;  8ICX A;  3TKA A;  1COK A;  5KFU A;  5J2E A;  3UQ2 A;  4KLU A;  2WB1 F;  2BR0 A;  3RJG A;  2KN7 A;  2PFO A;  1SZH A;  4ECS A;  2ZJA A;  3QU4 A;  1TK0 A;  2O6K A;  3NVV A;  4PHD A;  1N60 A;  4YFK A;  4NLZ A;  2AQ0 A;  3N28 A;  1V97 A;  5CJ7 A;  3ALR A;  5AKE A;  3MBY A;  5J0U A;  2IHN A;  2IMW P;  4EZ6 A;  2E1F A;  1KEJ A;  1BNP A;  4IRK A;  3H8J A;  1U48 A;  1XC9 A;  1S76 D;  3FM9 A;  3WK5 A;  5C5J A;  2PI4 A;  5AI5 A;  4C80 A;  2EZZ A;  4FZM A;  5CHG A;  2DWQ A;  4DQQ A;  4BJQ A;  1ZQL A;  4C8L A;  8ICQ A;  3MR3 A;  3A0B U;  3V6J A;  3QU2 A;  4DLG A;  1VLB A;  1SKR A;  3RR8 A;  2C2D A;  5KG5 A;  5KT2 A;  1A76 A;  4IR1 A;  1NI3 A;  1RXV A;  1QSY A;  2EAM A;  1HEK A;  2LM4 A;  4F4Y A;  1SXD A;  4DFJ A;  1SL1 A;  3V6K A;  1F44 A;  1YZ6 A;  4B9T A;  4EEL A;  4UAR A;  8ICS A;  5KFC A;  4RQ3 A;  1SGG A;  4CDG A;  2LPE A;  5AIB A;  1ARO P;  2YMP A;  3M9M B;  3KHG A;  2RHF A;  1AQ6 A;  4KLS A;  4CF4 A;  3BJY A;  1S77 D;  1LV5 A;  1X9M A;  4DCC A;  1NKE A;  2V9W A;  3QYP A;  4CE6 A;  4ELT A;  4KLE A;  8ICC A;  2BCQ A;  1YZ7 A;  2W43 A;  1NKB A;  2HVH A;  4MEY A;  1NK7 A;  1ED1 A;  3PML A;  1ZQK A;  1Z4O A;  2XO7 A;  2Y0S F;  9ICJ A;  2HHU A;  4BUG A;  4KLT A;  5K4L A;  3AU6 A;  4PHE A;  4OJ5 A;  3BQ2 A;  3RF9 A;  1B43 A;  1XSL A;  2ZIW B;  4DSI A;  5EWF A;  5ALW A;  4DF4 A;  4J9L A;  4OJ6 A;  3CW2 C;  4IQV A;  4R8U B;  4RQN A; 
#chains in the Genus database with same CATH homology
 2H3Q A;  3M6Z A;  3AQE A;  4KX5 A;  4QIW F;  2ZIU A;  3VCB A;  4A8E A;  2JH1 A;  5KL8 B;  3SAH A;  2DGZ A;  1YT3 A;  2JMG A;  3KFU F;  2RP5 A;  2KIC A;  2ZXH A;  3SAG A;  4GFJ A;  2MRL A;  2WAQ C;  4PL1 A;  2G5H B;  3GU3 A;  1PVP A;  4P0P B;  2KNJ A;  5KL1 B;  3F2B A;  1ECW A;  2F77 X;  4FZM A;  5HR7 A;  3N7S C;  4OJO A;  2K4E A;  2VJ5 A;  3O0F A;  3SMV A;  3ICX A;  4BJQ A;  5T14 A;  2GOL A;  1DRG A;  5HR6 A;  1T94 A;  2M0N A;  3PZP A;  2ZIX A;  1XNS A;  4ICA A;  4P0P A;  4PL2 A;  2XID A;  3PSI A;  2KIW A;  4KMO B;  1NZB A;  2CRX A;  4NWI A;  4WJ3 B;  1WUD A;  3F2D A;  2HBL A;  1Q3V A;  4C0Z A;  1PVR A;  2HMX A;  4QNL A;  2F76 X;  3RFA A;  2G06 A;  1IIP A;  2KHQ A;  4IC9 A;  5A0L A;  3H0M B;  2Q4T A;  4FE3 A;  2WB1 C;  4FZN A;  2K4H A;  2GH1 A;  2KJ5 A;  2YX8 A;  2PMZ F;  3K1Z A;  3T79 A;  2H3I A;  1HEK A;  2K8A A;  2KJ8 A;  3VC8 A;  2KV2 A;  2Z7J A;  1PVQ A;  4CGZ A;  2Y0S C;  3PSF A;  2ZIX B;  2H3F A;  2K89 A;  1Q3U A;  3C29 A;  2K8B B;  4OO1 J;  1F44 A;  3IG8 A;  2KEY A;  2YB4 A;  1HIW A;  3IN5 A;  1KBU A;  2HOQ A;  4OJL A;  2KKP A;  2KJ9 A;  2KKV A;  3LVV A;  1A6S A;  2DQN B;  3F53 A;  4U7C A;  2ZIV A;  2VIX A;  4CDG A;  2LYB A;  3M7D A;  2OYY A;  2G09 A;  3CYM A;  4OJP A;  2JH7 A;  4AYB C;  2HOF A;  2H3V A;  3IG5 A;  4NLC A;  2W7P A;  2XIC A;  2XVT A;  3ONN A;  3HKZ F;  3H0L B;  3CRX A;  4QJF B;  3F5E A;  3N7R C;  4BX9 C;  2HBM A;  1GO3 F;  2RHF A;  3IP4 B;  3MGV A;  2A3V A;  2VKQ A;  4QIW C;  2D6F C;  3D2S A;  2W03 A;  3GZF A;  3D2Q A;  5CRX A;  5C0Y A;  1ZQ1 C;  2G0A A;  2K8C B;  2ZIV B;  1OUQ A;  4NV0 A;  2LHT A;  4CRX A;  1CRX A;  2KD1 A;  2G07 A;  2KVC A;  2LYA A;  4FZL A;  1URJ A;  2HBJ A;  3SAF A;  1MA7 A;  4NLB A;  1Z1B A;  1P7D A;  2WB1 F;  2F8L A;  2DF4 B;  2E5S A;  2G5I B;  3L3F X;  3SQI A;  3AL0 B;  4O3M A;  2RRD A;  2G08 A;  2ZG6 A;  2ZXI A;  3F5A A;  3NUQ A;  2OXO A;  1SZH A;  2VJ4 A;  3NRW A;  2JHD A;  2F2A B;  1A0P A;  2R18 A;  1ED1 A;  1D8B A;  2WAQ F;  2YB1 A;  4P0Q A;  3AQF A;  2JGA A;  2Y0S F;  3E0F A;  2K4I A;  2MA1 A;  2LBO A;  1XO0 A;  2LKY A;  1L6N A;  3LYS A;  4U6P A;  3HKZ C;  4BUG A;  3D2N A;  2HBK A;  3N7P D;  2E1E A;  1UPH A;  2KOB A;  2CPR A;  3H0R B;  3M6K A;  2PMZ C;  3ALR A;  3KZX A;  4OJ5 A;  3RF9 A;  2XI9 A;  2ZIW B;  3C28 A;  2W7O A;  2CN1 A;  4ACO A;  3CP8 A;  4AYB F;  1Z19 A;  2E1F A;  2NV3 A;  4OJ6 A;  2H3Z A;  2KHV A;  2OM6 A;  3PST A;  2N1R A;  2ZIW A;  2OH2 A;  1TAM A;  3F2C A;  2ZIU B;  3OPX A;  4P0Q B;  2BDU A;  2W04 A;  2HOI A;  3PSP A;  3LVW A;  4JMU A;  3DEE A;  4KX3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...