2WAQF

The complete structure of the archaeal 13-subunit dna-directed rna polymerase
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
90
structure length
90
Chain Sequence
b'SVYIVEEHYIPYSVAKKLLSDVIKSGSSSNLLQRTYDYLNSVEKCDAESAQKVVEELSSIISREDVRAVLASICPITPDEVRSILIMDSN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE RPO1N SUBUNIT
molecule tags Transcription
publication title Evolution of complex RNA polymerases: the complete archaeal RNA polymerase structure.
pubmed doi rcsb
total genus 13
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2009-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF03874 RNA_pol_Rpb4 RNA polymerase Rpb4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.820 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2waqF02
2PMZF 2WAQF 3HKZF 2Y0SF 4AYBF 2WB1F
chains in the Genus database with same CATH superfamily
1IV8A 5ALHA 2W8KA 7ICGA 1U45A 4XRHA 5ALMA 3BQTA 1SL0A 1BPDA 3GU3A 5KL1B 4JK1A 2H5XA 2VJ5A 5H2FU 1EXNA 2XIDA 3KHHA 3AN1A 4I2CA 4BJQA 2P6RA 1LV5A 2A1AA 4YD1A 5KTQA 1S0NA 2H3ZA 2KJ5A 2ODGA 3IP4B 3NVVA 1IM4A 2K60A 4UAZA 1X6JA 3PMNA 5DBCA 3DV9A 4DFJA 4NLGA 4DL6A 5KFVA 3AQEA 2MU2A 4GXKA 1D8BA 3TANA 4EBCA 2HHTA 1K5OA 4I28A 5DGAA 5ALPA 3MR2A 1ZQXA 3RB6A 4OJPA 3Q8MA 1SV0C 5AM0A 1QTMA 3FAHA 3E0FA 4NY8A 2F8LA 4Y2PA 3KHLA 4J9NA 4UB6U 3V6HA 3C5GA 2DUYA 4NLNA 4IC9A 4RT3A 2R8HA 3SZ2A 1NK5A 4CRXA 3RF9A 2HVHA 1JRPA 2DL0A 5KFSA 5JU5A 4F4WA 2R8GA 1ZQGA 5KFBA 1NK0A 3R9KA 3RAXA 5IILA 5J8YA 3HKZC 3IM1A 2V4RA 3QXGA 3GIIA 3NGDA 3RJGA 9ICEA 8ICBA 5DB6A 3N28A 3SV3A 3UXPA 1NJZA 1TAMA 4BX9C 5KG6A 2KKPA 4DQSA 4J9MA 2C28A 1P7DA 2YX8A 4PL1A 3QUQA 4AP9A 1N2XA 1OUQA 4KLEA 5G5HA 3J81j 1BPXA 3QU5A 4DL5A 3M9MB 3B0XA 4RQ2A 1ZJMA 4KLIA 2KJ8A 2F77X 4HYKA 4F8RA 4AYBC 3BQ1A 3N7RC 4OD0A 4M0AA 3H40A 4QWEA 4KLGA 1Z3EB 8ICNA 2LPEA 2HSZA 2JZBA 2DF4B 4EZ9A 3PX0A 4MF2A 2OHFA 3Q8QB 1HUZA 3ETRA 5ALJA 3HX0A 3NRWA 2W9BB 2MRLA 4EX7A 7ICLA 2RLTA 2ZXIA 9ICRA 2KD1A 2KKVA 8ICWA 8ICHA 3N4MB 5KFQA 1B4FA 1TAQA 4ZOHC 4F4YA 3D2SA 5HR6A 4DSKA 4M9LA 4I2BA 4YN4A 3UMGA 5J2HA 5CB1A 5DDYA 2Q0ZX 3K4GA 4K4HA 7ICMA 1KSPA 4EBDA 2E1FA 2G0AA 3AUOA 2DBYA 3LWLA 2QKQA 2DQNB 4AYBF 4JMUA 1ZQTA 4C80A 2JZBB 3KBBA 3IDWA 1QH9A 2F44A 3TI0A 5FP0A 4DQPA 1AROP 2ATLA 5C0YA 2DFLA 4M2YA 1ZQZA 1PK1B 4QZHA 3OHAA 5J2JA 3ZDDA 2KNJA 2KEYA 2K8CB 2H3FA 1LB2B 4YQWA 3HILA 2D6FC 4DEZA 2EZZA 5DGBA 3Q8PB 1DK2A 3RJFA 4RQ1A 4ICAA 2W9CB 1ZQQA 4KLUA 2E8NA 2YQEA 1WG8A 2NV3A 1PVPA 2YMQA 1NJXA 4DS5A 2IOHA 1UCVA 3SV4A 2UVUA 5T14A 1F5SA 3F2CA 1JIHA 2JGAA 3MGVA 4ECWA 4DSIA 1ZQRA 3QU7A 1ZQHA 2ZIUB 2PFNA 1VJ5A 1URJA 4ED3A 4J9QA 3TARA 4EEYA 2ZJ5A 5J0UA 4E0DA 3RFAA 2RDJA 3F5EA 2KHQA 1Z00A 4OJ6A 4IRDA 4R65A 3A0HU 3AEVA 2CN1A 9ICTA 1D9DA 3FYHA 3KD3A 2BDPA 3WK5A 5ALQA 1Y88A 2VA8A 3T79A 4O5KA 1X9XA 5EE0A 5J0RA 4MF8A 2WF9A 5KFMA 2F3NA 1BPBA 1KN5A 1KQQA 3D2QA 1ZQLA 4PJ0U 4IS7A 5CRXA 9ICPA 1CUKA 5F9LA 2XCPA 3KHGA 4DSEA 2W11A 3D2NA 2QLTA 5KAIU 2KZ3A 1UQVA 2H3VA 4IR9A 4IQUA 3NASA 5EWGA 1DGSA 3OSNA 4GXIA 1ZQFA 2HW3A 1L7MA 4O5EA 1DK3A 4MEXA 3BS5B 4PH5A 4MHVA 4NJ8A 4TUSA 2G5HB 4M6WA 5DDMA 4RU9A 4YVZA 1UA1A 5J0OA 4O3NA 3M9NB 2WAQC 5KG4A 4NLKA 4RT2A 2GLEA 2HMXA 2KIVA 2HOIA 1RYRA 4YP3A 5AKHA 2OYYA 1RM6C 4DLGA 1T4GA 4QZFA 2WF8A 3RJKA 2LYBA 4QIWF 4QWAA 3RRGA 3H4BA 1KKXA 2Y1JA 1NK4A 4C7ZA 4UAVA 1COOA 3G6XA 2Y0SF 4ZH4A 5KFWA 5J2AA 1RQNA 2R8KA 2BQRA 5L1JA 9ICSA 5AM4A 5DG8A 1XSNA 4JWNA 1C20A 3RH4A 5AKZA 4RQNA 4DL7A 2E8OA 4P0QA 5L9XA 2ZTCA 1KRPA 4C4TA 4C7YA 4QWBA 1IXRA 1XSPA 4I29A 4F3OA 2W9AA 4IQVA 7ICNA 1NZPA 5E79U 2W8LA 2OXOA 4RPXA 1U49A 3QEBZ 4BDPA 4Q45A 1SXDA 2EAOA 2BQUA 1L3SA 4UB8U 5KFLA 1RXVA 5IINA 3IG8A 3TAPA 1Z4OA 5AIBA 2KFNA 3C29A 2PMZF 4UATA 2AH5A 4C8LA 1S0MA 1S5LU 2RQ5A 5AK6A 2NRXA 5DLGA 4B9TA 2XI9A 2NO5A 4Y2QA 4KX5A 3F2DA 1UHUA 2BCVA 4CF5A 4C8NA 4PZNA 2FDRA 5C5JA 2YN4A 2YMLA 1WYGA 8ICMA 1Q3VA 2NYVA 1MA7A 1RYSA 7ICVA 3MR5A 4FZNA 1L7OA 5KFHA 1X9MA 2BCRA 4MEYA 3I28A 4O9MA 1SZPA 3BQ2A 3RJEA 2E8MA 4BWJA 4DOCA 3ALRA 4RQ3A 2HHWA 1X6IA 1SWWA 3BDPA 3RBEA 4F5QA 3NRZA 3PNCA 4I2IA 1LKYB 2MA1A 2G08A 3C2LA 3EZ5A 4J9LA 9ICXA 5KAFU 1NKCA 4YMOA 2GO7A 5ALIA 3QUTA 2W3SA 4UW9A 2BCSA 7ICIA 2ISOA 3GZFA 5J0TA 1ZQYA 4TURA 4GC7A 4ECTA 4DQRA 4Y2RA 3H8JA 3PX6A 2JMGA 4B9VA 5KFUA 3PZPA 2YB1A 2BDUA 2IBKA 3LDAA 1NK9A 4M04A 2HHXA 3C5FA 4PHEA 4M9GA 1SL2A 1J2MA 3WKDA 4F71A 2XY7A 2VIXA 1JI7A 2KHVA 5DB9A 2BR0A 1CRXA 1MQ3A 4PGXA 5IIKA 4F5RA 3KTQA 2W43A 9ICAA 1WCNA 4DQQA 2OEHA 2ZIVB 1T3NA 1N48A 4RUCA 2XO7A 4EBEA 1JX4A 5GTIU 4CNQA 1N62A 3B9JA 3M6KA 5CWRA 3PW5A 1S10A 2BKEA 4NM2A 2BQ3A 5AI9A 2GH1A 1A0PA 1ZD3A 3PO5A 9ICWA 4ED7A 2A1JA 4EX6A 2K4EA 2W9MA 1NK8A 5IIIA 4KLFA 2AXTU 4RNOA 3HRDD 4UB4A 3BS7A 8ICEA 1ZETA 3MABA 3THVA 1ZOLA 2OM6A 3MGIA 3SQIA 1M6YA 1N60A 4DOAA 1BVSA 3QNMA 3KHRA 3TADA 4NXZA 4CDGA 4R63A 8ICSA 4F72A 5DLFA 4DS4A 4MFFA 2WFAA 2OCEA 1NK7A 2HI0A 4Y2SA 4P4MA 4J9OA 5KFDA 2K8BB 2UVWA 2MAXA 3K1RB 4F92B 5AKGA 1KEJA 2M0NA 3MFHA 1SV4A 4ED0A 4YR3A 3T3FA 3V7KA 1Z4NA 7ICQA 7ICFA 3N7PD 5ALVA 4R8UA 4B9UA 4IQWA 3HW8A 2K8AA 3PW4A 5J0SA 4RQ0A 1FO4A 1ZQEA 1XO1A 2J6UA 2AQ0A 2C2DA 5ALEA 3UQ0A 4OJLA 4FO6A 1F44A 3T5KA 1L7PA 4B9SA 4UB1A 4RPZA 4DL3A 3NTUA 2HDOA 1QSLA 2P35A 1SXEA 2BZFA 2PMZC 3G6VA 3QZ8A 4CF3A 4IRCA 4ECZA 1RYUA 1WCLA 2EAMA 5AKLA 1XNSA 1ZQPA 4WJ3B 1HEKA 1UA0A 4B9NA 2IOFK 2KK0A 3OPXA 4KLJA 4F4KA 3V72A 2Y0SC 3TQ1A 2RRDA 4QZCA 1COKA 3OHBA 4QZAA 5CP2A 1B22A 4J03A 9ICFA 3C2MA 8ICRA 3SAHA 1KDHA 4EZ6A 3DEEA 4R8UB 3EYZA 2H3IA 1S9FA 1RG6A 2YMPA 2JEIA 4G3IA 4QZDA 3NVYA 2F8KA 3PMLA 1ZQBA 4BUGA 4YD2A 4O3OA 8ICGA 2E3TA 3LWMA 4RUAA 5HP4A 2LHTA 7ICTA 2CXYA 4GFJA 3PR5B 4M47A 4UB2A 2JEJA 1U9LA 3PR4A 3OJSA 5ALUA 3E58A 7ICSA 1ED1A 4PGYA 4P2HA 3F2BA 2KG5A 4KN4A 1X40A 2IMWP 1HJPA 3FC4A 5AI8A 4US8A 5J2FA 1KFTA 1PUZA 5L1KA 2K4IA 2P6UA 4USAA 3RBDA 1L8OA 5IIOA 3O0FA 5AKXA 4I2HA 1D8YA 2EZXA 2KFZA 4JV2A 3GIJA 2KV2A 4ELUA 4DF4A 5B5EU 2E8PA 2ALZA 1RQLA 2KIWA 2ZIVA 5D4BA 3EPIA 2KJ9A 3QYPA 1Q46A 2A19A 3RJJA 1U48A 1JROA 9ICUA 3RTVA 9ICJA 7ICRA 2PFPA 3CW2C 5J8YC 5KG2A 2HHQA 8ICYA 2W3RA 2BPFA 4RQMA 1QQ6A 4NLBA 1C7YA 1A6SA 4TQSA 4Q8EA 2XY5A 5AKKA 4FS2A 1ZQKA 1ZQCA 1N63A 2FJ6A 3H0LB 1LKYA 3WKCA 4CCHA 5JRTA 4M9JA 2KZZA 1DOQA 2NRVA 1BNPA 3JPQA 2EAPA 5AICA 5KG3A 3ZDAA 1WUDA 5GTHU 1L3TA 2HHUA 5KFXA 2GWSA 1SKSA 5AIAA 1U47A 3RAQA 4RQ7A 1SGGA 5KFTA 3OSPA 1NJWA 2E5SA 2Y9UA 4YFKA 3PX4A 3ISCA 2WHEA 2H3QA 3TFRA 2KOBA 4JWMA 4UB3A 5F9NA 1ZQMA 2AGOA 3WK4A 2ISPA 4UB5A 8ICZA 3WK6A 1PVQA 8ICCA 5ALYA 8ICJA 1PZNA 4F91B 9ICBA 3ZDEA 2IA6A 4IR1A 2GOLA 5ALSA 2CPRA 5J2GA 5EOZA 1FFUA 5G5GA 3LYSA 1NI3A 4NL9C 2FMPA 5BOLA 1QQ5A 3KZXA 1BPEA 3SI8A 5KG7A 1UT5A 1BGXT 2A1JB 2I5HA 3BZKA 1ZQJA 2HVIA 3CYMA 3CRXA 5IIJA 3GIMA 2C22A 3OGUA 2JH1A 5KFRA 1FEZA 3KKAA 3HPOA 3BQ0A 1TV9A 4C8OA 2Q4TA 4KLLA 3PV8A 3AU6A 4I2EA 1MN8A 5J2EA 3BQ7A 1ZQDA 3UQ2A 5KL8B 4P0QB 5KFAA 1AQ6A 3DDHA 1RXWA 5TZVA 8ICIA 5F3XB 2XGPA 4O3MA 3H4DA 9ICQA 5ALTA 3H8WA 3ICXA 3WKBA 3VC8A 2ES6A 5KT6A 3PSTA 3JPNA 4ECQA 4O5CA 4DWIA 4PHAA 9ICNA 4F5PA 2WAQF 2IHNA 3GILA 3M9OB 5HNKA 2MUTB 2RHFA 5JTIA 2HCFA 2ZXHA 4P4OA 5ALGA 2PKEA 9ICMA 3UM9A 3TFSA 4DQIA 3RJIA 5KG1A 4RNNA 3D6JA 4CGZA 5CHGA 4ECXA 1S0VA 8ICUA 2Z7JA 3E2EA 4OO1J 4LZGA 1QLNA 4YCXA 3IRUA 2NO4A 3QU4A 1ZYQA 2KSOA 4PHDA 2HBKA 2ZG6A 1BPZA 4GC6A 4PGQA 5KFNA 1N5XA 4FBUA 2HBJA 5ALRA 3UXOA 3FDSA 2K4HA 2LYHA 5L1LA 5EE3A 5CEHA 4C4RA 5DBAA 2WB1C 4YXJA 1UPHA 2JRZA 1L5UA 1O03A 2F1IA 7ICPA 1XSLA 5AM5A 5ALDA 1KFSA 4O3QA 4K4GA 5ALLA 5J0WA 2RDIA 4QW9A 3LVVA 4MFCA 3L5KA 3IHQB 5DQGA 1ZQOA 2R8IA 4KLSA 4QWDA 2JEFA 3EUB2 3H8MA 2W9CA 1S8OA 4PL2A 5KFKA 5CJ7A 2F1HA 4GIBA 3MDCA 3PO4A 4JV0A 4OCZA 2QB0A 4ED8A 9ICKA 2WTFA 5J29A 1WWVA 2BHNA 4DL2A 2ZIUA 2FLLA 1PK3A 1QSSA 4BGDA 5KFPA 5DG7A 5J2CA 1TK5A 3IV6A 1A77A 3ISBA 4IL6U 4I2AA 3I76A 5KFFA 3JPRA 2W54A 2NRTA 2XY6A 5B66U 3QZ7A 1RPLA 2G09A 3WK9A 3T5HA 4QIWC 3RH5A 2QB1A 2J6SA 5AI5A 5BOMA 5KG5A 5AK4A 4Q43A 4TUPA 4NLCA 1UT8A 2FI1A 5A0LA 2MSNA 3FM9A 2G07A 7ICEA 2W7PA 4KITB 3PSPA 4QJFB 1N56A 4KMUA 3C28A 2KICA 2AQ4A 2V4QA 5AI4A 2YTUA 4RQ8A 4PPXA 4F2SA 2JHDA 1NZBA 2I9GA 3RRHA 3ZI4A 3TAQA 9ICIA 5DKWA 3VCBA 4QZEA 4R64A 3Q8LA 4QNLA 4DFPA 5D46A 3BZCA 1KFDA 2I6XA 3RB3A 4J9KA 4U6PA 3QUCA 3GIKA 4ECVA 1NKEA 8ICPA 3S6JA 3T5LA 1JUDA 3UMCA 1SKRA 2BPCA 3AU2A 3SAFA 4I2DA 4J9PA 3L3FX 2MUTA 2JH7A 3HWTA 1SIJA 1TK0A 4JV1A 2XGQA 2ASDA 5EE1A 2W03A 2LBOA 2G5IB 4XUSA 5DQIA 3V6JA 2B6GA 1TKDA 5KFGA 1NJYA 2DPIA 1ECWA 4UAYA 3M8RA 5ALFA 1J2NA 2ZUBA 1FIQA 2L5YA 3MFIA 4O3SA 3M8SA 4J9RA 2HBLA 1HUOA 1KW4A 1ZQ1C 1ZD4A 4NM1A 2DKXA 5CA7A 3MDAA 4FZLA 2KSOB 2VKQA 4P4PA 5CR0A 4C0ZA 2HOFA 3EWAA 3MC1A 4NWIA 5J2DA 2ESEA 2QARA 4C4SA 2LI6A 1V97A 3K1ZA 3WKEA 4PZOA 2KZMA 3PW0A 2FPMA 3ZDBA 3JPTA 4Y2VA 1D8LA 3RH6A 7ICKA 3ORYA 4QWCA 3IN5A 3WU2U 2XICA 8ICOA 1YZ7A 4IRKA 1GO3F 4BWMA 3M7DA 3SAGA 1V38A 1MC8A 5KFIA 3T5JA 5KFZA 2LYAA 7ICOA 3WK7A 1CI4A 5L1IA 1WWUA 1S0OA 3SENA 4IQTA 4DFDA 2Y9TA 4Y2JA 4O0IA 4M9NA 5HMLA 3NVZA 3Q8RB 4A8EA 2FMSA 2W7OA 4LVSA 3N7SC 4RQ5A 1NKBA 1NK6A 4KTQA 5J0QA 1SKWA 5KT4A 1L6NA 4DFMA 5J2BA 2VJ4A 4KLHA 3CP8A 2FPLA 4C8KA 2ASLA 4FZMA 3MBYA 1S97A 4F93B 5KT7A 2PFQA 4TUQA 2VA2A 2KVCA 5JUMA 3NS1A 3IG5A 5BPCA 3PY8A 4F5OA 3ISDA 1ZQIA 4DFKA 1OXJA 3HP6A 1BNOA 4F2RA 2B21A 1L3VA 2FMQA 2ZTDA 1XC9A 1Q8KA 2I1QA 3C2KA 4I27A 3MR3A 1O08A 4FBTA 3LK9A 1Z1VA 9ICLA 4UASA 4JUZA 1ZJNA 4YR0A 2ZIWB 3C23A 2CRXA 3GV8B 2EANA 4J9SA 3KFUF 4UARA 4DLEA 2KP7A 3M6ZA 2LM1A 2JEGA 5AI0A 2YMMA 2W04A 3GFKB 1FFVA 2M9NA 1Z00B 2QB0B 1XWLA 5J2KA 5HR7A 4EYHB 4YMMA 1L8LA 3LVWA 5EE9A 4DSFA 4ED6A 3C1YA 3JPPA 3AL0B 8ICKA 4EYIB 2E1EA 3AMZA 1QCKA 2C2EA 2EQYA 3Q8SB 4Y2UA 4I2GA 2ZUCA 2Y1IA 3BS5A 9ICCA 5AI6A 3V6KA 3NUQA 4M6WB 2ZIWA 3RB4A 3KOOA 2D3DA 2K4PA 4TQRA 5L1MA 3SD7A 3PW2A 3KZIU 2IHMA 5AKYA 3TADC 3OJUA 5ALXA 1D9FA 2BCQA 3G6YA 2KVSA 4DCCA 8ICXA 2EDUA 5HHHA 2BPGA 4ECSA 5AK3A 4KLTA 4KN7A 2ASJA 4LJXA 4CF4A 2R18A 4YR2A 3TKAA 4Y2YA 2OWOA 2KMDA 1B43A 3ED5A 1DGJA 4MFAA 1YZ6A 3K75D 5J2IA 3SEIA 1BPYA 3QE9Y 4M9HA 4KMOB 9ICHA 4RQ6A 4US9A 4R66A 3TACB 2XCAA 1KBUA 1H38A 3HT3A 1SZHA 1KTQA 2LKYA 3WK8A 5AM1A 4DL4A 1QSYA 1JN3A 2JXJA 2V9WA 4ECRA 4RNMA 3ZD9A 4X5VA 4P0PA 2HOQA 3UMBA 1PK1A 1T7PA 8ICAA 1ZD5A 1N61A 3ETLA 2W9BA 4B9LA 1X2IA 3RR7A 2ZUDA 3SMVA 4ELVA 4Q44A 5J0XA 2J6TA 5J0YA 1X42A 1T8EA 2DGZA 2FLPA 4QZ9A 5EWEA 4G9BA 1TE2A 4KLQA 3QU2A 1T94A 3GQCA 8ICLA 1VLBA 1ZRMA 1KL9A 2ZIXB 1L3UA 4UAUA 4UBCA 5KT2A 4ECUA 2JV3A 1PVRA 2ZTEA 1F0MA 1X9SA 7ICHA 3H7IA 7ICJA 2AHOB 7ICUA 4PHPA 3C21A 4KLOA 8ICTA 1V85A 2QARB 2AGPA 1KLNA 5J0PA 4XA5A 4K4IA 1JMSA 4KLMA 5AM2A 4Z6EA 8ICFA 5TISU 4O3PA 1TVAA 2ZJAA 1S77D 5AKIA 1LVHA 1YT3A 4DF8A 2HHSA 4UBBA 4NL9A 3F53A 4UQGA 5D49A 2K89A 3PSIA 5AM3A 4ACOA 2HBMA 2NRWA 3RJHA 4I2JA 2A3VA 2AJQA 2AGQA 4EELA 3EPGA 9ICOA 4XQ8A 3HJEA 3KKAC 2B0CA 3JPOA 1SL1A 2KE7A 3GV5B 1S76D 3L4PA 1B0XA 4FS1A 3SR6A 1MSWD 2HHVA 3QU9A 1OW5A 2N1RA 2AU0A 1JXEA 4GXJA 2DPJA 2FPKA 1DXSA 1N5WA 3AQFA 4CE6A 4JB3A 2O6KA 2LMRA 2D8CA 4DOBA 4C8MA 4ED1A 5KFEA 1QQ7A 5DB8A 1CEZA 1IG6A 1Z19A 4QZGA 1ZQAA 5HHIA 4RPYA 1TK8A 3RR8A 3I1YA 5DB7A 2R8JA 5ALKA 3GV7B 5DG9A 2PI4A 3ZD8A 3AM9A 1RZTA 3H8SA 4NLZA 2RP5A 4F50A 3QEAZ 2ZJ8A 4LZDA 8ICQA 2JR5A 4NV0A 5KFJA 1TAUA 1SV0A 2EH9A 2IOFA 3ONNA 1XO0A 4QZBA 3BJYA 1V9PA 2XC9A 4F4ZA 1JALA 4QZ8A 1TFRA 3B0YA 5EWFA 1IIPA 1K1QA 9ICGA 4ELTA 1DRGA 2P66A 2DWQA 4O3RA 3V7JA 4Y2TA 4FE3A 4ED2A 3U26A 1SWVA 4DO9A 3Q8KA 4F5NA 3GDXA 3WKAA 1NOMA 3PVXA 3MGHA 1X9WA 5KT5A 5KFOA 2KN7A 1ZD2P 2F1JA 5DBBA 4Z6FA 4DSJA 2G06A 5KFCA 2BGWA 4P0PB 4QW8A 4GLXA 1T3QA 3C1ZA 8ICVA 1XU4A 4Y2XA 1J97A 2DKZA 4YG2A 4EEKA 2VANA 2WF7A 2YY6A 5KT3A 5ALWA 3M1YA 4KX3A 1L7NA 2PFOA 9ICVA 4YXMA 3UPQA 2FE9A 2PI5A 3UXNA 3RB0A 4Z6CA 3A0BU 1X66A 3QUBA 2F2AB 2EZYA 2F76X 2LM4A 1ZQWA 3H0RB 2ZIXA 1ZRNA 1ZQVA 5ALZA 4YMNA 1XS9D 4HAIA 2WB1F 1ZQSA 5AHXA 1ZXIA 4OJ5A 4B9MA 2KTQA 3CNHA 4UAWA 4F4XA 3H0MB 4Z6DA 4FFDA 4BXOB 1MQ2A 1K1SA 3V7LA 2XVTA 3HKZF 3EW9A 2PXIA 5KFYA 3OTQA 1Z1BA 2NRZA 5KG0A 3F5AA 5DQHA 4B6JA 3QX7A 2BCUA 5AK5A 2UVVA 5KNIA 5IIMA 1VDVA 3PW7A 2VA3A 1ZQUA 4U7CA 4DSLA 5AKEA 5AKJA 2OH2A 4OJOA 2W55A 2YB4A 2UVRA 1Q3UA 4I2FA 3MR6A 4RZRA 2WF5A 4KLDA 3JPSA 4RQ4A 4Q8FA 1HIWA 5HMMA 3ZDCA 5ALNA 1SB3C 2FLNA 2C2RA 1NNLA 3PSFA 4QZIA 1JXLA 1A76A 1U4BA 5ALOA 3N97B 5K4LA 4BXOA 1ZQNA 4EENA 1RDFA 4ECYA 3SYZA 3NVWA 2WF6A
chains in the Genus database with same CATH topology
1Q3VA 3SMVA 4U6PA 1MA7A 3AL0B 2E1EA 5C0YA 4FZNA 4O3MA 2G5HB 3SAHA 3DEEA 1TAMA 4BX9C 2H3IA 2F2AB 2WAQC 2KKPA 2DGZA 3SAFA 1WUDA 2F76X 2KNJA 3ICXA 4A8EA 2W7OA 3GU3A 2KEYA 2HMXA 2K8CB 3N7SC 4PL2A 3H0RB 2H3FA 3VC8A 3PSTA 5KL1B 2OM6A 2ZIXA 4BUGA 2HOIA 1Z19A 3L3FX 3ALRA 1P7DA 2OYYA 2VJ5A 1T94A 1L6NA 2WB1F 2YX8A 2XIDA 3SQIA 4PL1A 2D6FC 2LYBA 4QIWF 2VJ4A 2JH7A 4OJ5A 3NUQA 2LHTA 1OUQA 2ZIWA 3CP8A 2ZIXB 4BJQA 4GFJA 2MA1A 2G08A 4ICAA 4CDGA 2WAQF 2W03A 4FZMA 2Y0SF 2LBOA 2G5IB 2E5SA 2RHFA 2RP5A 2H3ZA 1PVRA 2KJ8A 2F77X 2KJ5A 2NV3A 2ZIUA 3H0MB 3IP4B 4AYBC 1PVPA 3N7RC 1ED1A 2K8BB 2H3QA 1ECWA 2ZXHA 3F2BA 2XVTA 2KVCA 4P0QA 3HKZF 2DF4B 2KOBA 3IG5A 3GZFA 4NV0A 2M0NA 5T14A 2HBLA 3F2CA 3AQEA 2JGAA 3MGVA 1Z1BA 1D8BA 3ONNA 1XO0A 1ZQ1C 3F5AA 1PVQA 2K4IA 4CGZA 2ZIUB 2JMGA 1URJA 1YT3A 3NRWA 2OXOA 2Z7JA 2YB1A 3PZPA 2BDUA 2R18A 2GOLA 2MRLA 3N7PD 4OJPA 4OO1J 4FZLA 2G09A 2CPRA 3F53A 2ZXIA 4QIWC 3O0FA 1IIPA 2VKQA 3RFAA 2K8AA 2KD1A 2K89A 3PSIA 2KKVA 3F5EA 1DRGA 2KHQA 4ACOA 4C0ZA 2HBMA 2HOFA 3LYSA 3IG8A 2A3VA 4NLCA 4FE3A 4OJLA 2KV2A 1F44A 2VIXA 2KHVA 5A0LA 4U7CA 3E0FA 3C29A 2PMZF 2OH2A 3D2SA 4OJOA 2G07A 4OJ6A 2F8LA 2KIWA 5HR6A 2HBKA 4NWIA 2ZIVA 2YB4A 2ZG6A 3KZXA 1Q3UA 2CN1A 2KJ9A 1CRXA 2W7PA 2ZIWB 3K1ZA 4KMOB 2PMZC 3PSPA 4QJFB 2CRXA 3C28A 2KICA 1HIWA 2ZIVB 3CYMA 3CRXA 4IC9A 3KFUF 3T79A 2HBJA 4CRXA 2G06A 2K4HA 3RF9A 1KBUA 2JH1A 2JHDA 1NZBA 4P0PB 1SZHA 3M6KA 2XI9A 3PSFA 3IN5A 3M6ZA 2WB1C 2XICA 3D2QA 4KX5A 4NLBA 2LKYA 3F2DA 5CRXA 1UPHA 2Q4TA 1A6SA 2E1FA 2G0AA 1XNSA 4WJ3B 1GO3F 2DQNB 2N1RA 2W04A 3D2NA 3VCBA 4AYBF 4P0PA 4JMUA 2HOQA 3M7DA 3SAGA 2H3VA 1HEKA 3HKZC 5KL8B 4P0QB 3H0LB 5HR7A 4KX3A 2GH1A 3AQFA 3OPXA 4QNLA 1A0PA 3LVVA 2Y0SC 2RRDA 3LVWA 2K4EA 2LYAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PMZ F;  2WAQ F;  3HKZ F;  2Y0S F;  4AYB F;  2WB1 F; 
#chains in the Genus database with same CATH topology
 1IV8 A;  5ALH A;  2W8K A;  7ICG A;  1U45 A;  4XRH A;  5ALM A;  3BQT A;  1SL0 A;  1BPD A;  3GU3 A;  5KL1 B;  4JK1 A;  2H5X A;  2VJ5 A;  5H2F U;  1EXN A;  2XID A;  3KHH A;  3AN1 A;  4I2C A;  4BJQ A;  2P6R A;  1LV5 A;  2A1A A;  4YD1 A;  5KTQ A;  1S0N A;  2H3Z A;  2KJ5 A;  2ODG A;  3IP4 B;  3NVV A;  1IM4 A;  2K60 A;  4UAZ A;  1X6J A;  3PMN A;  5DBC A;  3DV9 A;  4DFJ A;  4NLG A;  4DL6 A;  5KFV A;  3AQE A;  2MU2 A;  4GXK A;  1D8B A;  3TAN A;  4EBC A;  2HHT A;  1K5O A;  4I28 A;  5DGA A;  5ALP A;  3MR2 A;  1ZQX A;  3RB6 A;  4OJP A;  3Q8M A;  1SV0 C;  5AM0 A;  1QTM A;  3FAH A;  3E0F A;  4NY8 A;  2F8L A;  4Y2P A;  3KHL A;  4J9N A;  4UB6 U;  3V6H A;  3C5G A;  2DUY A;  4NLN A;  4IC9 A;  4RT3 A;  2R8H A;  3SZ2 A;  1NK5 A;  4CRX A;  3RF9 A;  2HVH A;  1JRP A;  2DL0 A;  5KFS A;  5JU5 A;  4F4W A;  2R8G A;  1ZQG A;  5KFB A;  1NK0 A;  3R9K A;  3RAX A;  5IIL A;  5J8Y A;  3HKZ C;  3IM1 A;  2V4R A;  3QXG A;  3GII A;  3NGD A;  3RJG A;  9ICE A;  8ICB A;  5DB6 A;  3N28 A;  3SV3 A;  3UXP A;  1NJZ A;  1TAM A;  4BX9 C;  5KG6 A;  2KKP A;  4DQS A;  4J9M A;  2C28 A;  1P7D A;  2YX8 A;  4PL1 A;  3QUQ A;  4AP9 A;  1N2X A;  1OUQ A;  4KLE A;  5G5H A;  3J81 j;  1BPX A;  3QU5 A;  4DL5 A;  3M9M B;  3B0X A;  4RQ2 A;  1ZJM A;  4KLI A;  2KJ8 A;  2F77 X;  4HYK A;  4F8R A;  4AYB C;  3BQ1 A;  3N7R C;  4OD0 A;  4M0A A;  3H40 A;  4QWE A;  4KLG A;  1Z3E B;  8ICN A;  2LPE A;  2HSZ A;  2JZB A;  2DF4 B;  4EZ9 A;  3PX0 A;  4MF2 A;  2OHF A;  3Q8Q B;  1HUZ A;  3ETR A;  5ALJ A;  3HX0 A;  3NRW A;  2W9B B;  2MRL A;  4EX7 A;  7ICL A;  2RLT A;  2ZXI A;  9ICR A;  2KD1 A;  2KKV A;  8ICW A;  8ICH A;  3N4M B;  5KFQ A;  1B4F A;  1TAQ A;  4ZOH C;  4F4Y A;  3D2S A;  5HR6 A;  4DSK A;  4M9L A;  4I2B A;  4YN4 A;  3UMG A;  5J2H A;  5CB1 A;  5DDY A;  2Q0Z X;  3K4G A;  4K4H A;  7ICM A;  1KSP A;  4EBD A;  2E1F A;  2G0A A;  3AUO A;  2DBY A;  3LWL A;  2QKQ A;  2DQN B;  4AYB F;  4JMU A;  1ZQT A;  4C80 A;  2JZB B;  3KBB A;  3IDW A;  1QH9 A;  2F44 A;  3TI0 A;  5FP0 A;  4DQP A;  1ARO P;  2ATL A;  5C0Y A;  2DFL A;  4M2Y A;  1ZQZ A;  1PK1 B;  4QZH A;  3OHA A;  5J2J A;  3ZDD A;  2KNJ A;  2KEY A;  2K8C B;  2H3F A;  1LB2 B;  4YQW A;  3HIL A;  2D6F C;  4DEZ A;  2EZZ A;  5DGB A;  3Q8P B;  1DK2 A;  3RJF A;  4RQ1 A;  4ICA A;  2W9C B;  1ZQQ A;  4KLU A;  2E8N A;  2YQE A;  1WG8 A;  2NV3 A;  1PVP A;  2YMQ A;  1NJX A;  4DS5 A;  2IOH A;  1UCV A;  3SV4 A;  2UVU A;  5T14 A;  1F5S A;  3F2C A;  1JIH A;  2JGA A;  3MGV A;  4ECW A;  4DSI A;  1ZQR A;  3QU7 A;  1ZQH A;  2ZIU B;  2PFN A;  1VJ5 A;  1URJ A;  4ED3 A;  4J9Q A;  3TAR A;  4EEY A;  2ZJ5 A;  5J0U A;  4E0D A;  3RFA A;  2RDJ A;  3F5E A;  2KHQ A;  1Z00 A;  4OJ6 A;  4IRD A;  4R65 A;  3A0H U;  3AEV A;  2CN1 A;  9ICT A;  1D9D A;  3FYH A;  3KD3 A;  2BDP A;  3WK5 A;  5ALQ A;  1Y88 A;  2VA8 A;  3T79 A;  4O5K A;  1X9X A;  5EE0 A;  5J0R A;  4MF8 A;  2WF9 A;  5KFM A;  2F3N A;  1BPB A;  1KN5 A;  1KQQ A;  3D2Q A;  1ZQL A;  4PJ0 U;  4IS7 A;  5CRX A;  9ICP A;  1CUK A;  5F9L A;  2XCP A;  3KHG A;  4DSE A;  2W11 A;  3D2N A;  2QLT A;  5KAI U;  2KZ3 A;  1UQV A;  2H3V A;  4IR9 A;  4IQU A;  3NAS A;  5EWG A;  1DGS A;  3OSN A;  4GXI A;  1ZQF A;  2HW3 A;  1L7M A;  4O5E A;  1DK3 A;  4MEX A;  3BS5 B;  4PH5 A;  4MHV A;  4NJ8 A;  4TUS A;  2G5H B;  4M6W A;  5DDM A;  4RU9 A;  4YVZ A;  1UA1 A;  5J0O A;  4O3N A;  3M9N B;  2WAQ C;  5KG4 A;  4NLK A;  4RT2 A;  2GLE A;  2HMX A;  2KIV A;  2HOI A;  1RYR A;  4YP3 A;  5AKH A;  2OYY A;  1RM6 C;  4DLG A;  1T4G A;  4QZF A;  2WF8 A;  3RJK A;  2LYB A;  4QIW F;  4QWA A;  3RRG A;  3H4B A;  1KKX A;  2Y1J A;  1NK4 A;  4C7Z A;  4UAV A;  1COO A;  3G6X A;  2Y0S F;  4ZH4 A;  5KFW A;  5J2A A;  1RQN A;  2R8K A;  2BQR A;  5L1J A;  9ICS A;  5AM4 A;  5DG8 A;  1XSN A;  4JWN A;  1C20 A;  3RH4 A;  5AKZ A;  4RQN A;  4DL7 A;  2E8O A;  4P0Q A;  5L9X A;  2ZTC A;  1KRP A;  4C4T A;  4C7Y A;  4QWB A;  1IXR A;  1XSP A;  4I29 A;  4F3O A;  2W9A A;  4IQV A;  7ICN A;  1NZP A;  5E79 U;  2W8L A;  2OXO A;  4RPX A;  1U49 A;  3QEB Z;  4BDP A;  4Q45 A;  1SXD A;  2EAO A;  2BQU A;  1L3S A;  4UB8 U;  5KFL A;  1RXV A;  5IIN A;  3IG8 A;  3TAP A;  1Z4O A;  5AIB A;  2KFN A;  3C29 A;  2PMZ F;  4UAT A;  2AH5 A;  4C8L A;  1S0M A;  1S5L U;  2RQ5 A;  5AK6 A;  2NRX A;  5DLG A;  4B9T A;  2XI9 A;  2NO5 A;  4Y2Q A;  4KX5 A;  3F2D A;  1UHU A;  2BCV A;  4CF5 A;  4C8N A;  4PZN A;  2FDR A;  5C5J A;  2YN4 A;  2YML A;  1WYG A;  8ICM A;  1Q3V A;  2NYV A;  1MA7 A;  1RYS A;  7ICV A;  3MR5 A;  4FZN A;  1L7O A;  5KFH A;  1X9M A;  2BCR A;  4MEY A;  3I28 A;  4O9M A;  1SZP A;  3BQ2 A;  3RJE A;  2E8M A;  4BWJ A;  4DOC A;  3ALR A;  4RQ3 A;  2HHW A;  1X6I A;  1SWW A;  3BDP A;  3RBE A;  4F5Q A;  3NRZ A;  3PNC A;  4I2I A;  1LKY B;  2MA1 A;  2G08 A;  3C2L A;  3EZ5 A;  4J9L A;  9ICX A;  5KAF U;  1NKC A;  4YMO A;  2GO7 A;  5ALI A;  3QUT A;  2W3S A;  4UW9 A;  2BCS A;  7ICI A;  2ISO A;  3GZF A;  5J0T A;  1ZQY A;  4TUR A;  4GC7 A;  4ECT A;  4DQR A;  4Y2R A;  3H8J A;  3PX6 A;  2JMG A;  4B9V A;  5KFU A;  3PZP A;  2YB1 A;  2BDU A;  2IBK A;  3LDA A;  1NK9 A;  4M04 A;  2HHX A;  3C5F A;  4PHE A;  4M9G A;  1SL2 A;  1J2M A;  3WKD A;  4F71 A;  2XY7 A;  2VIX A;  1JI7 A;  2KHV A;  5DB9 A;  2BR0 A;  1CRX A;  1MQ3 A;  4PGX A;  5IIK A;  4F5R A;  3KTQ A;  2W43 A;  9ICA A;  1WCN A;  4DQQ A;  2OEH A;  2ZIV B;  1T3N A;  1N48 A;  4RUC A;  2XO7 A;  4EBE A;  1JX4 A;  5GTI U;  4CNQ A;  1N62 A;  3B9J A;  3M6K A;  5CWR A;  3PW5 A;  1S10 A;  2BKE A;  4NM2 A;  2BQ3 A;  5AI9 A;  2GH1 A;  1A0P A;  1ZD3 A;  3PO5 A;  9ICW A;  4ED7 A;  2A1J A;  4EX6 A;  2K4E A;  2W9M A;  1NK8 A;  5III A;  4KLF A;  2AXT U;  4RNO A;  3HRD D;  4UB4 A;  3BS7 A;  8ICE A;  1ZET A;  3MAB A;  3THV A;  1ZOL A;  2OM6 A;  3MGI A;  3SQI A;  1M6Y A;  1N60 A;  4DOA A;  1BVS A;  3QNM A;  3KHR A;  3TAD A;  4NXZ A;  4CDG A;  4R63 A;  8ICS A;  4F72 A;  5DLF A;  4DS4 A;  4MFF A;  2WFA A;  2OCE A;  1NK7 A;  2HI0 A;  4Y2S A;  4P4M A;  4J9O A;  5KFD A;  2K8B B;  2UVW A;  2MAX A;  3K1R B;  4F92 B;  5AKG A;  1KEJ A;  2M0N A;  3MFH A;  1SV4 A;  4ED0 A;  4YR3 A;  3T3F A;  3V7K A;  1Z4N A;  7ICQ A;  7ICF A;  3N7P D;  5ALV A;  4R8U A;  4B9U A;  4IQW A;  3HW8 A;  2K8A A;  3PW4 A;  5J0S A;  4RQ0 A;  1FO4 A;  1ZQE A;  1XO1 A;  2J6U A;  2AQ0 A;  2C2D A;  5ALE A;  3UQ0 A;  4OJL A;  4FO6 A;  1F44 A;  3T5K A;  1L7P A;  4B9S A;  4UB1 A;  4RPZ A;  4DL3 A;  3NTU A;  2HDO A;  1QSL A;  2P35 A;  1SXE A;  2BZF A;  2PMZ C;  3G6V A;  3QZ8 A;  4CF3 A;  4IRC A;  4ECZ A;  1RYU A;  1WCL A;  2EAM A;  5AKL A;  1XNS A;  1ZQP A;  4WJ3 B;  1HEK A;  1UA0 A;  4B9N A;  2IOF K;  2KK0 A;  3OPX A;  4KLJ A;  4F4K A;  3V72 A;  2Y0S C;  3TQ1 A;  2RRD A;  4QZC A;  1COK A;  3OHB A;  4QZA A;  5CP2 A;  1B22 A;  4J03 A;  9ICF A;  3C2M A;  8ICR A;  3SAH A;  1KDH A;  4EZ6 A;  3DEE A;  4R8U B;  3EYZ A;  2H3I A;  1S9F A;  1RG6 A;  2YMP A;  2JEI A;  4G3I A;  4QZD A;  3NVY A;  2F8K A;  3PML A;  1ZQB A;  4BUG A;  4YD2 A;  4O3O A;  8ICG A;  2E3T A;  3LWM A;  4RUA A;  5HP4 A;  2LHT A;  7ICT A;  2CXY A;  4GFJ A;  3PR5 B;  4M47 A;  4UB2 A;  2JEJ A;  1U9L A;  3PR4 A;  3OJS A;  5ALU A;  3E58 A;  7ICS A;  1ED1 A;  4PGY A;  4P2H A;  3F2B A;  2KG5 A;  4KN4 A;  1X40 A;  2IMW P;  1HJP A;  3FC4 A;  5AI8 A;  4US8 A;  5J2F A;  1KFT A;  1PUZ A;  5L1K A;  2K4I A;  2P6U A;  4USA A;  3RBD A;  1L8O A;  5IIO A;  3O0F A;  5AKX A;  4I2H A;  1D8Y A;  2EZX A;  2KFZ A;  4JV2 A;  3GIJ A;  2KV2 A;  4ELU A;  4DF4 A;  5B5E U;  2E8P A;  2ALZ A;  1RQL A;  2KIW A;  2ZIV A;  5D4B A;  3EPI A;  2KJ9 A;  3QYP A;  1Q46 A;  2A19 A;  3RJJ A;  1U48 A;  1JRO A;  9ICU A;  3RTV A;  9ICJ A;  7ICR A;  2PFP A;  3CW2 C;  5J8Y C;  5KG2 A;  2HHQ A;  8ICY A;  2W3R A;  2BPF A;  4RQM A;  1QQ6 A;  4NLB A;  1C7Y A;  1A6S A;  4TQS A;  4Q8E A;  2XY5 A;  5AKK A;  4FS2 A;  1ZQK A;  1ZQC A;  1N63 A;  2FJ6 A;  3H0L B;  1LKY A;  3WKC A;  4CCH A;  5JRT A;  4M9J A;  2KZZ A;  1DOQ A;  2NRV A;  1BNP A;  3JPQ A;  2EAP A;  5AIC A;  5KG3 A;  3ZDA A;  1WUD A;  5GTH U;  1L3T A;  2HHU A;  5KFX A;  2GWS A;  1SKS A;  5AIA A;  1U47 A;  3RAQ A;  4RQ7 A;  1SGG A;  5KFT A;  3OSP A;  1NJW A;  2E5S A;  2Y9U A;  4YFK A;  3PX4 A;  3ISC A;  2WHE A;  2H3Q A;  3TFR A;  2KOB A;  4JWM A;  4UB3 A;  5F9N A;  1ZQM A;  2AGO A;  3WK4 A;  2ISP A;  4UB5 A;  8ICZ A;  3WK6 A;  1PVQ A;  8ICC A;  5ALY A;  8ICJ A;  1PZN A;  4F91 B;  9ICB A;  3ZDE A;  2IA6 A;  4IR1 A;  2GOL A;  5ALS A;  2CPR A;  5J2G A;  5EOZ A;  1FFU A;  5G5G A;  3LYS A;  1NI3 A;  4NL9 C;  2FMP A;  5BOL A;  1QQ5 A;  3KZX A;  1BPE A;  3SI8 A;  5KG7 A;  1UT5 A;  1BGX T;  2A1J B;  2I5H A;  3BZK A;  1ZQJ A;  2HVI A;  3CYM A;  3CRX A;  5IIJ A;  3GIM A;  2C22 A;  3OGU A;  2JH1 A;  5KFR A;  1FEZ A;  3KKA A;  3HPO A;  3BQ0 A;  1TV9 A;  4C8O A;  2Q4T A;  4KLL A;  3PV8 A;  3AU6 A;  4I2E A;  1MN8 A;  5J2E A;  3BQ7 A;  1ZQD A;  3UQ2 A;  5KL8 B;  4P0Q B;  5KFA A;  1AQ6 A;  3DDH A;  1RXW A;  5TZV A;  8ICI A;  5F3X B;  2XGP A;  4O3M A;  3H4D A;  9ICQ A;  5ALT A;  3H8W A;  3ICX A;  3WKB A;  3VC8 A;  2ES6 A;  5KT6 A;  3PST A;  3JPN A;  4ECQ A;  4O5C A;  4DWI A;  4PHA A;  9ICN A;  4F5P A;  2WAQ F;  2IHN A;  3GIL A;  3M9O B;  5HNK A;  2MUT B;  2RHF A;  5JTI A;  2HCF A;  2ZXH A;  4P4O A;  5ALG A;  2PKE A;  9ICM A;  3UM9 A;  3TFS A;  4DQI A;  3RJI A;  5KG1 A;  4RNN A;  3D6J A;  4CGZ A;  5CHG A;  4ECX A;  1S0V A;  8ICU A;  2Z7J A;  3E2E A;  4OO1 J;  4LZG A;  1QLN A;  4YCX A;  3IRU A;  2NO4 A;  3QU4 A;  1ZYQ A;  2KSO A;  4PHD A;  2HBK A;  2ZG6 A;  1BPZ A;  4GC6 A;  4PGQ A;  5KFN A;  1N5X A;  4FBU A;  2HBJ A;  5ALR A;  3UXO A;  3FDS A;  2K4H A;  2LYH A;  5L1L A;  5EE3 A;  5CEH A;  4C4R A;  5DBA A;  2WB1 C;  4YXJ A;  1UPH A;  2JRZ A;  1L5U A;  1O03 A;  2F1I A;  7ICP A;  1XSL A;  5AM5 A;  5ALD A;  1KFS A;  4O3Q A;  4K4G A;  5ALL A;  5J0W A;  2RDI A;  4QW9 A;  3LVV A;  4MFC A;  3L5K A;  3IHQ B;  5DQG A;  1ZQO A;  2R8I A;  4KLS A;  4QWD A;  2JEF A;  3EUB 2;  3H8M A;  2W9C A;  1S8O A;  4PL2 A;  5KFK A;  5CJ7 A;  2F1H A;  4GIB A;  3MDC A;  3PO4 A;  4JV0 A;  4OCZ A;  2QB0 A;  4ED8 A;  9ICK A;  2WTF A;  5J29 A;  1WWV A;  2BHN A;  4DL2 A;  2ZIU A;  2FLL A;  1PK3 A;  1QSS A;  4BGD A;  5KFP A;  5DG7 A;  5J2C A;  1TK5 A;  3IV6 A;  1A77 A;  3ISB A;  4IL6 U;  4I2A A;  3I76 A;  5KFF A;  3JPR A;  2W54 A;  2NRT A;  2XY6 A;  5B66 U;  3QZ7 A;  1RPL A;  2G09 A;  3WK9 A;  3T5H A;  4QIW C;  3RH5 A;  2QB1 A;  2J6S A;  5AI5 A;  5BOM A;  5KG5 A;  5AK4 A;  4Q43 A;  4TUP A;  4NLC A;  1UT8 A;  2FI1 A;  5A0L A;  2MSN A;  3FM9 A;  2G07 A;  7ICE A;  2W7P A;  4KIT B;  3PSP A;  4QJF B;  1N56 A;  4KMU A;  3C28 A;  2KIC A;  2AQ4 A;  2V4Q A;  5AI4 A;  2YTU A;  4RQ8 A;  4PPX A;  4F2S A;  2JHD A;  1NZB A;  2I9G A;  3RRH A;  3ZI4 A;  3TAQ A;  9ICI A;  5DKW A;  3VCB A;  4QZE A;  4R64 A;  3Q8L A;  4QNL A;  4DFP A;  5D46 A;  3BZC A;  1KFD A;  2I6X A;  3RB3 A;  4J9K A;  4U6P A;  3QUC A;  3GIK A;  4ECV A;  1NKE A;  8ICP A;  3S6J A;  3T5L A;  1JUD A;  3UMC A;  1SKR A;  2BPC A;  3AU2 A;  3SAF A;  4I2D A;  4J9P A;  3L3F X;  2MUT A;  2JH7 A;  3HWT A;  1SIJ A;  1TK0 A;  4JV1 A;  2XGQ A;  2ASD A;  5EE1 A;  2W03 A;  2LBO A;  2G5I B;  4XUS A;  5DQI A;  3V6J A;  2B6G A;  1TKD A;  5KFG A;  1NJY A;  2DPI A;  1ECW A;  4UAY A;  3M8R A;  5ALF A;  1J2N A;  2ZUB A;  1FIQ A;  2L5Y A;  3MFI A;  4O3S A;  3M8S A;  4J9R A;  2HBL A;  1HUO A;  1KW4 A;  1ZQ1 C;  1ZD4 A;  4NM1 A;  2DKX A;  5CA7 A;  3MDA A;  4FZL A;  2KSO B;  2VKQ A;  4P4P A;  5CR0 A;  4C0Z A;  2HOF A;  3EWA A;  3MC1 A;  4NWI A;  5J2D A;  2ESE A;  2QAR A;  4C4S A;  2LI6 A;  1V97 A;  3K1Z A;  3WKE A;  4PZO A;  2KZM A;  3PW0 A;  2FPM A;  3ZDB A;  3JPT A;  4Y2V A;  1D8L A;  3RH6 A;  7ICK A;  3ORY A;  4QWC A;  3IN5 A;  3WU2 U;  2XIC A;  8ICO A;  1YZ7 A;  4IRK A;  1GO3 F;  4BWM A;  3M7D A;  3SAG A;  1V38 A;  1MC8 A;  5KFI A;  3T5J A;  5KFZ A;  2LYA A;  7ICO A;  3WK7 A;  1CI4 A;  5L1I A;  1WWU A;  1S0O A;  3SEN A;  4IQT A;  4DFD A;  2Y9T A;  4Y2J A;  4O0I A;  4M9N A;  5HML A;  3NVZ A;  3Q8R B;  4A8E A;  2FMS A;  2W7O A;  4LVS A;  3N7S C;  4RQ5 A;  1NKB A;  1NK6 A;  4KTQ A;  5J0Q A;  1SKW A;  5KT4 A;  1L6N A;  4DFM A;  5J2B A;  2VJ4 A;  4KLH A;  3CP8 A;  2FPL A;  4C8K A;  2ASL A;  4FZM A;  3MBY A;  1S97 A;  4F93 B;  5KT7 A;  2PFQ A;  4TUQ A;  2VA2 A;  2KVC A;  5JUM A;  3NS1 A;  3IG5 A;  5BPC A;  3PY8 A;  4F5O A;  3ISD A;  1ZQI A;  4DFK A;  1OXJ A;  3HP6 A;  1BNO A;  4F2R A;  2B21 A;  1L3V A;  2FMQ A;  2ZTD A;  1XC9 A;  1Q8K A;  2I1Q A;  3C2K A;  4I27 A;  3MR3 A;  1O08 A;  4FBT A;  3LK9 A;  1Z1V A;  9ICL A;  4UAS A;  4JUZ A;  1ZJN A;  4YR0 A;  2ZIW B;  3C23 A;  2CRX A;  3GV8 B;  2EAN A;  4J9S A;  3KFU F;  4UAR A;  4DLE A;  2KP7 A;  3M6Z A;  2LM1 A;  2JEG A;  5AI0 A;  2YMM A;  2W04 A;  3GFK B;  1FFV A;  2M9N A;  1Z00 B;  2QB0 B;  1XWL A;  5J2K A;  5HR7 A;  4EYH B;  4YMM A;  1L8L A;  3LVW A;  5EE9 A;  4DSF A;  4ED6 A;  3C1Y A;  3JPP A;  3AL0 B;  8ICK A;  4EYI B;  2E1E A;  3AMZ A;  1QCK A;  2C2E A;  2EQY A;  3Q8S B;  4Y2U A;  4I2G A;  2ZUC A;  2Y1I A;  3BS5 A;  9ICC A;  5AI6 A;  3V6K A;  3NUQ A;  4M6W B;  2ZIW A;  3RB4 A;  3KOO A;  2D3D A;  2K4P A;  4TQR A;  5L1M A;  3SD7 A;  3PW2 A;  3KZI U;  2IHM A;  5AKY A;  3TAD C;  3OJU A;  5ALX A;  1D9F A;  2BCQ A;  3G6Y A;  2KVS A;  4DCC A;  8ICX A;  2EDU A;  5HHH A;  2BPG A;  4ECS A;  5AK3 A;  4KLT A;  4KN7 A;  2ASJ A;  4LJX A;  4CF4 A;  2R18 A;  4YR2 A;  3TKA A;  4Y2Y A;  2OWO A;  2KMD A;  1B43 A;  3ED5 A;  1DGJ A;  4MFA A;  1YZ6 A;  3K75 D;  5J2I A;  3SEI A;  1BPY A;  3QE9 Y;  4M9H A;  4KMO B;  9ICH A;  4RQ6 A;  4US9 A;  4R66 A;  3TAC B;  2XCA A;  1KBU A;  1H38 A;  3HT3 A;  1SZH A;  1KTQ A;  2LKY A;  3WK8 A;  5AM1 A;  4DL4 A;  1QSY A;  1JN3 A;  2JXJ A;  2V9W A;  4ECR A;  4RNM A;  3ZD9 A;  4X5V A;  4P0P A;  2HOQ A;  3UMB A;  1PK1 A;  1T7P A;  8ICA A;  1ZD5 A;  1N61 A;  3ETL A;  2W9B A;  4B9L A;  1X2I A;  3RR7 A;  2ZUD A;  3SMV A;  4ELV A;  4Q44 A;  5J0X A;  2J6T A;  5J0Y A;  1X42 A;  1T8E A;  2DGZ A;  2FLP A;  4QZ9 A;  5EWE A;  4G9B A;  1TE2 A;  4KLQ A;  3QU2 A;  1T94 A;  3GQC A;  8ICL A;  1VLB A;  1ZRM A;  1KL9 A;  2ZIX B;  1L3U A;  4UAU A;  4UBC A;  5KT2 A;  4ECU A;  2JV3 A;  1PVR A;  2ZTE A;  1F0M A;  1X9S A;  7ICH A;  3H7I A;  7ICJ A;  2AHO B;  7ICU A;  4PHP A;  3C21 A;  4KLO A;  8ICT A;  1V85 A;  2QAR B;  2AGP A;  1KLN A;  5J0P A;  4XA5 A;  4K4I A;  1JMS A;  4KLM A;  5AM2 A;  4Z6E A;  8ICF A;  5TIS U;  4O3P A;  1TVA A;  2ZJA A;  1S77 D;  5AKI A;  1LVH A;  1YT3 A;  4DF8 A;  2HHS A;  4UBB A;  4NL9 A;  3F53 A;  4UQG A;  5D49 A;  2K89 A;  3PSI A;  5AM3 A;  4ACO A;  2HBM A;  2NRW A;  3RJH A;  4I2J A;  2A3V A;  2AJQ A;  2AGQ A;  4EEL A;  3EPG A;  9ICO A;  4XQ8 A;  3HJE A;  3KKA C;  2B0C A;  3JPO A;  1SL1 A;  2KE7 A;  3GV5 B;  1S76 D;  3L4P A;  1B0X A;  4FS1 A;  3SR6 A;  1MSW D;  2HHV A;  3QU9 A;  1OW5 A;  2N1R A;  2AU0 A;  1JXE A;  4GXJ A;  2DPJ A;  2FPK A;  1DXS A;  1N5W A;  3AQF A;  4CE6 A;  4JB3 A;  2O6K A;  2LMR A;  2D8C A;  4DOB A;  4C8M A;  4ED1 A;  5KFE A;  1QQ7 A;  5DB8 A;  1CEZ A;  1IG6 A;  1Z19 A;  4QZG A;  1ZQA A;  5HHI A;  4RPY A;  1TK8 A;  3RR8 A;  3I1Y A;  5DB7 A;  2R8J A;  5ALK A;  3GV7 B;  5DG9 A;  2PI4 A;  3ZD8 A;  3AM9 A;  1RZT A;  3H8S A;  4NLZ A;  2RP5 A;  4F50 A;  3QEA Z;  2ZJ8 A;  4LZD A;  8ICQ A;  2JR5 A;  4NV0 A;  5KFJ A;  1TAU A;  1SV0 A;  2EH9 A;  2IOF A;  3ONN A;  1XO0 A;  4QZB A;  3BJY A;  1V9P A;  2XC9 A;  4F4Z A;  1JAL A;  4QZ8 A;  1TFR A;  3B0Y A;  5EWF A;  1IIP A;  1K1Q A;  9ICG A;  4ELT A;  1DRG A;  2P66 A;  2DWQ A;  4O3R A;  3V7J A;  4Y2T A;  4FE3 A;  4ED2 A;  3U26 A;  1SWV A;  4DO9 A;  3Q8K A;  4F5N A;  3GDX A;  3WKA A;  1NOM A;  3PVX A;  3MGH A;  1X9W A;  5KT5 A;  5KFO A;  2KN7 A;  1ZD2 P;  2F1J A;  5DBB A;  4Z6F A;  4DSJ A;  2G06 A;  5KFC A;  2BGW A;  4P0P B;  4QW8 A;  4GLX A;  1T3Q A;  3C1Z A;  8ICV A;  1XU4 A;  4Y2X A;  1J97 A;  2DKZ A;  4YG2 A;  4EEK A;  2VAN A;  2WF7 A;  2YY6 A;  5KT3 A;  5ALW A;  3M1Y A;  4KX3 A;  1L7N A;  2PFO A;  9ICV A;  4YXM A;  3UPQ A;  2FE9 A;  2PI5 A;  3UXN A;  3RB0 A;  4Z6C A;  3A0B U;  1X66 A;  3QUB A;  2F2A B;  2EZY A;  2F76 X;  2LM4 A;  1ZQW A;  3H0R B;  2ZIX A;  1ZRN A;  1ZQV A;  5ALZ A;  4YMN A;  1XS9 D;  4HAI A;  2WB1 F;  1ZQS A;  5AHX A;  1ZXI A;  4OJ5 A;  4B9M A;  2KTQ A;  3CNH A;  4UAW A;  4F4X A;  3H0M B;  4Z6D A;  4FFD A;  4BXO B;  1MQ2 A;  1K1S A;  3V7L A;  2XVT A;  3HKZ F;  3EW9 A;  2PXI A;  5KFY A;  3OTQ A;  1Z1B A;  2NRZ A;  5KG0 A;  3F5A A;  5DQH A;  4B6J A;  3QX7 A;  2BCU A;  5AK5 A;  2UVV A;  5KNI A;  5IIM A;  1VDV A;  3PW7 A;  2VA3 A;  1ZQU A;  4U7C A;  4DSL A;  5AKE A;  5AKJ A;  2OH2 A;  4OJO A;  2W55 A;  2YB4 A;  2UVR A;  1Q3U A;  4I2F A;  3MR6 A;  4RZR A;  2WF5 A;  4KLD A;  3JPS A;  4RQ4 A;  4Q8F A;  1HIW A;  5HMM A;  3ZDC A;  5ALN A;  1SB3 C;  2FLN A;  2C2R A;  1NNL A;  3PSF A;  4QZI A;  1JXL A;  1A76 A;  1U4B A;  5ALO A;  3N97 B;  5K4L A;  4BXO A;  1ZQN A;  4EEN A;  1RDF A;  4ECY A;  3SYZ A;  3NVW A;  2WF6 A; 
#chains in the Genus database with same CATH homology
 1Q3V A;  3SMV A;  4U6P A;  1MA7 A;  3AL0 B;  2E1E A;  5C0Y A;  4FZN A;  4O3M A;  2G5H B;  3SAH A;  3DEE A;  1TAM A;  4BX9 C;  2H3I A;  2F2A B;  2WAQ C;  2KKP A;  2DGZ A;  3SAF A;  1WUD A;  2F76 X;  2KNJ A;  3ICX A;  4A8E A;  2W7O A;  3GU3 A;  2KEY A;  2HMX A;  2K8C B;  3N7S C;  4PL2 A;  3H0R B;  2H3F A;  3VC8 A;  3PST A;  5KL1 B;  2OM6 A;  2ZIX A;  4BUG A;  2HOI A;  1Z19 A;  3L3F X;  3ALR A;  1P7D A;  2OYY A;  2VJ5 A;  1T94 A;  1L6N A;  2WB1 F;  2YX8 A;  2XID A;  3SQI A;  4PL1 A;  2D6F C;  2LYB A;  4QIW F;  2VJ4 A;  2JH7 A;  4OJ5 A;  3NUQ A;  2LHT A;  1OUQ A;  2ZIW A;  3CP8 A;  2ZIX B;  4BJQ A;  4GFJ A;  2MA1 A;  2G08 A;  4ICA A;  4CDG A;  2WAQ F;  2W03 A;  4FZM A;  2Y0S F;  2LBO A;  2G5I B;  2E5S A;  2RHF A;  2RP5 A;  2H3Z A;  1PVR A;  2KJ8 A;  2F77 X;  2KJ5 A;  2NV3 A;  2ZIU A;  3H0M B;  3IP4 B;  4AYB C;  1PVP A;  3N7R C;  1ED1 A;  2K8B B;  2H3Q A;  1ECW A;  2ZXH A;  3F2B A;  2XVT A;  2KVC A;  4P0Q A;  3HKZ F;  2DF4 B;  2KOB A;  3IG5 A;  3GZF A;  4NV0 A;  2M0N A;  5T14 A;  2HBL A;  3F2C A;  3AQE A;  2JGA A;  3MGV A;  1Z1B A;  1D8B A;  3ONN A;  1XO0 A;  1ZQ1 C;  3F5A A;  1PVQ A;  2K4I A;  4CGZ A;  2ZIU B;  2JMG A;  1URJ A;  1YT3 A;  3NRW A;  2OXO A;  2Z7J A;  2YB1 A;  3PZP A;  2BDU A;  2R18 A;  2GOL A;  2MRL A;  3N7P D;  4OJP A;  4OO1 J;  4FZL A;  2G09 A;  2CPR A;  3F53 A;  2ZXI A;  4QIW C;  3O0F A;  1IIP A;  2VKQ A;  3RFA A;  2K8A A;  2KD1 A;  2K89 A;  3PSI A;  2KKV A;  3F5E A;  1DRG A;  2KHQ A;  4ACO A;  4C0Z A;  2HBM A;  2HOF A;  3LYS A;  3IG8 A;  2A3V A;  4NLC A;  4FE3 A;  4OJL A;  2KV2 A;  1F44 A;  2VIX A;  2KHV A;  5A0L A;  4U7C A;  3E0F A;  3C29 A;  2PMZ F;  2OH2 A;  3D2S A;  4OJO A;  2G07 A;  4OJ6 A;  2F8L A;  2KIW A;  5HR6 A;  2HBK A;  4NWI A;  2ZIV A;  2YB4 A;  2ZG6 A;  3KZX A;  1Q3U A;  2CN1 A;  2KJ9 A;  1CRX A;  2W7P A;  2ZIW B;  3K1Z A;  4KMO B;  2PMZ C;  3PSP A;  4QJF B;  2CRX A;  3C28 A;  2KIC A;  1HIW A;  2ZIV B;  3CYM A;  3CRX A;  4IC9 A;  3KFU F;  3T79 A;  2HBJ A;  4CRX A;  2G06 A;  2K4H A;  3RF9 A;  1KBU A;  2JH1 A;  2JHD A;  1NZB A;  4P0P B;  1SZH A;  3M6K A;  2XI9 A;  3PSF A;  3IN5 A;  3M6Z A;  2WB1 C;  2XIC A;  3D2Q A;  4KX5 A;  4NLB A;  2LKY A;  3F2D A;  5CRX A;  1UPH A;  2Q4T A;  1A6S A;  2E1F A;  2G0A A;  1XNS A;  4WJ3 B;  1GO3 F;  2DQN B;  2N1R A;  2W04 A;  3D2N A;  3VCB A;  4AYB F;  4P0P A;  4JMU A;  2HOQ A;  3M7D A;  3SAG A;  2H3V A;  1HEK A;  3HKZ C;  5KL8 B;  4P0Q B;  3H0L B;  5HR7 A;  4KX3 A;  2GH1 A;  3AQF A;  3OPX A;  4QNL A;  1A0P A;  3LVV A;  2Y0S C;  2RRD A;  3LVW A;  2K4E A;  2LYA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...