2WAQF

The complete structure of the archaeal 13-subunit dna-directed rna polymerase
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
90
structure length
90
Chain Sequence
SVYIVEEHYIPYSVAKKLLSDVIKSGSSSNLLQRTYDYLNSVEKCDAESAQKVVEELSSIISREDVRAVLASICPITPDEVRSILIMDSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE RPO1N SUBUNIT
publication title Evolution of complex RNA polymerases: the complete archaeal RNA polymerase structure.
pubmed doi rcsb
molecule tags Transcription
total genus 13
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2009-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF03874 RNA_pol_Rpb4 RNA polymerase Rpb4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.820 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2waqF02
2WAQF 2PMZF 2WB1F 3HKZF 2Y0SF 4AYBF
chains in the Genus database with same CATH superfamily
2D3DA 2ZXIA 2A1JB 3QXGA 2B0CA 4F92B 1RXWA 2WF5A 5HMLA 3THVA 3HJEA 4NLGA 4UAVA 3JPPA 3RH5A 8ICAA 3PX6A 2R8KA 2JGAA 4R8UB 5J0XA 3RBDA 2FLPA 5DB7A 3WKDA 2Y0SC 2KSOA 5KG3A 4BXOA 1ZQSA 2KJ9A 1N2XA 4YMMA 5J0TA 3RB3A 5ALPA 1ZRNA 4C0ZA 1VJ5A 4LZDA 4YR2A 4IQTA 5J0YA 3PSTA 1UCVA 7ICPA 4FBTA 3N7PD 4RQ8A 1U47A 1S76D 3GU3A 1EXNA 3AEVA 1RM6C 3NVZA 8ICPA 3D2SA 4QZIA 4CRXA 5AK3A 4QZ8A 2G5IB 5AM2A 2VANA 4IQVA 4PHPA 1Y88A 4Q8FA 2PMZC 2VA3A 2G5HB 4F5RA 4Y2RA 2FLLA 5HR7A 2R8GA 1T3QA 3RJKA 2HHSA 2ISPA 5KG5A 4C8OA 1IM4A 2F1HA 1BPBA 3RR7A 3PNCA 3SV3A 2AXTU 5JU5A 1Z19A 4KLEA 1TK5A 1J2NA 3FC4A 3H40A 1BNPA 1S77D 3D2NA 3UMCA 1NOMA 3QUBA 3N4MB 3FM9A 5KFMA 1T8EA 1ZQPA 4ED7A 1CRXA 4JK1A 4QZGA 2W9BA 5AICA 4I2AA 2FJ6A 3HKZF 4DQQA 2ES6A 2XGPA 4GFJA 2EAMA 3DDHA 4RNOA 1PZNA 1LVHA 1ZQJA 4F50A 2IBKA 5DQGA 4UATA 4LVSA 3M6ZA 5KFRA 2HW3A 2ZIVA 5ALRA 2KNJA 4KITB 1KEJA 1BPYA 3CRXA 1ZQOA 3RH6A 2WAQF 2RHFA 1QSYA 3UQ0A 4F4YA 4YCXA 2GO7A 2JH7A 4CF5A 4RNMA 1IXRA 4R64A 1QQ6A 4AYBF 3H8MA 2DPIA 2LM1A 2RP5A 3RRHA 5KFDA 4IR1A 2CXYA 1TK0A 5KFWA 1IV8A 3H8JA 4EELA 1ZQEA 2KSOB 2KOBA 4M47A 2EAPA 4J9MA 4EYIB 2K8BB 3TQ1A 1V38A 4UASA 2BPFA 3BS7A 2JV3A 1Z00A 4PHAA 5DBAA 4NJ8A 9ICFA 8ICGA 2P6UA 4BWMA 4ED2A 4P0PA 4EBDA 3I1YA 1B0XA 1N5WA 3LWMA 3LK9A 4DL6A 2A19A 2IHNA 7ICEA 2ZIUA 2GOLA 4M0AA 3AM9A 3QX7A 3S6JA 1NK9A 1J97A 3R9KA 2XY5A 7ICRA 1PVRA 9ICRA 4Q44A 1L7NA 3EPGA 5KFHA 4QZCA 4F8RA 1LKYA 5J2EA 2HHQA 5IIJA 5KFSA 9ICIA 2ZIXB 2W9AA 7ICUA 3QEAZ 5KFZA 5ALGA 4BGDA 2B21A 8ICIA 4F3OA 3BS5A 4MF2A 5AKEA 3MABA 1U9LA 1WUDA 2HCFA 1TVAA 4CGZA 1C7YA 4RQ6A 3H8WA 3NVYA 2NRZA 8ICUA 2W9BB 3M6KA 5KFXA 1K1SA 3AL0B 1ED1A 1X9SA 5DGAA 5DLGA 4DS4A 4FO6A 5T14A 1MA7A 5CR0A 4M6WA 4PL2A 4RPXA 5ALYA 3C28A 4DL7A 3RH4A 4DL2A 2I5HA 1J2MA 4DQPA 3JPSA 2MU2A 8ICVA 2QARA 1XSNA 2XY6A 1SL2A 4JWMA 1RQNA 9ICSA 3RB0A 4ECXA 4UAUA 3D6JA 4DLGA 5FP0A 2KFZA 1JI7A 1VLBA 1QQ7A 3GFKB 4KN7A 3AU6A 3BQ7A 3V6KA 4DQRA 4KLTA 4F5OA 1TFRA 3B9JA 2UVUA 1CEZA 4KLQA 2DPJA 5ALOA 1T7PA 1L8OA 4DCCA 4J9PA 2EDUA 5KFPA 1SZPA 5AI5A 5J29A 2I6XA 4DLEA 2BCUA 2W3SA 4EEKA 4OJ6A 3WU2U 5ALNA 1DRGA 3IM1A 1Z00B 3MGHA 3OTQA 2YN4A 2MA1A 2Q0ZX 3ISBA 2KN7A 2AQ0A 4NLCA 3N7RC 1DXSA 4C4SA 2K8CB 2BKEA 2WF6A 4P0PB 1NZPA 3M8SA 2F8KA 3NVVA 4Z6DA 1ZYQA 1XNSA 2ZIUB 4UB3A 4M9HA 3OJUA 3H0MB 2L5YA 5ALWA 3GDXA 4PH5A 2XVTA 5ALSA 1O08A 3BZKA 1LKYB 5AM1A 1NK6A 2XICA 2C2RA 3NRWA 5KFNA 1TAMA 1ZD5A 4OCZA 4I2FA 2JEIA 2KK0A 3SZ2A 4GLXA 1SV4A 2KG5A 3EW9A 5AI4A 2IA6A 3EZ5A 1SXDA 1ZD4A 1ZQRA 4HAIA 5DLFA 1TAUA 2V4RA 3HP6A 5IINA 4RPZA 1MN8A 4AP9A 2JHDA 1KKXA 3ED5A 5F9NA 5DKWA 1BPEA 1ZQLA 2F1IA 1YZ6A 3T79A 2NRWA 2KD1A 3OSNA 2IMWP 1X2IA 4F4KA 3WK4A 1JRPA 1OUQA 1ZXIA 3MR2A 1BGXT 1L7MA 4M6WB 2AH5A 2BQUA 1NK4A 2JR5A 4JWNA 4C4TA 2G08A 4NLKA 4YXMA 8ICNA 1HUOA 2QARB 1K1QA 3GV5B 9ICAA 2PFQA 2LPEA 2ZUBA 4RUCA 4DOAA 4DSIA 3HKZC 1TK8A 7ICIA 3Q8SB 3A0BU 2Y9UA 4ZOHC 4PPXA 4KTQA 3QU9A 3RJIA 3SMVA 4EZ9A 1ZQZA 5EWEA 1MC8A 4P4PA 3OSPA 1ZQFA 5DG9A 3M9OB 3PW0A 3IRUA 1KRPA 2E8OA 3UXNA 2WAQC 1RYSA 4KX5A 2W8LA 4Y2JA 2J6SA 3T5HA 1N48A 5C0YA 1XWLA 5AKYA 9ICKA 2H3QA 8ICQA 2KJ8A 4F72A 5TZVA 4QWCA 3BQ2A 5B66U 1ZQKA 3GV7B 3ZDDA 2HSZA 2NV3A 2EZXA 4ED0A 3KBBA 2K89A 4R8UA 3V7LA 4GXKA 1S8OA 4DQSA 1URJA 4KMOB 3JPTA 3OHAA 4UB1A 3QZ7A 3G6YA 2XC9A 2JEFA 3IV6A 4QNLA 5AKKA 3SEIA 9ICBA 4IR9A 1A77A 1X9MA 3PVXA 2HMXA 2KJ5A 1Q8KA 5ALVA 4DWIA 5ALHA 3AN1A 3ZDAA 1F0MA 1P7DA 1ZJMA 1ZQMA 5AIBA 1QSLA 4USAA 4ECSA 5KL1B 5CEHA 4PGQA 3MDCA 3IP4B 1JALA 4O3NA 3RR8A 1S5LU 3KHLA 4DL4A 1BPXA 5GTIU 2IOFK 3NVWA 4JUZA 2HOFA 4O3QA 5ALDA 1ZD3A 1KTQA 4J9KA 2ESEA 3K1RB 1JXEA 2E5SA 2JEJA 1DOQA 3K1ZA 3ONNA 4DEZA 2BQ3A 2AJQA 1PVQA 4M04A 4BJQA 2LI6A 3KZXA 4EYHB 2UVWA 2HBJA 2NRTA 4G9BA 4I2JA 1NKCA 3OGUA 1ZETA 2F76X 3BZCA 2PI4A 2KVCA 4B9UA 5BOLA 2HHVA 2KE7A 1SL0A 2ASDA 5ALMA 9ICLA 2D8CA 3C2MA 3QUTA 3SR6A 5KFYA 4TQSA 4UB2A 5ALEA 4NL9C 1XSPA 1U48A 2YMPA 2FDRA 1SV0A 5J2BA 2YX8A 1WCLA 7ICLA 4QJFB 4RNNA 5KT7A 3PMNA 1A0PA 1PK1A 2ZG6A 1ZD2P 3KD3A 1B43A 4M9JA 5ALTA 3OJSA 3T3FA 2NO5A 2DF4B 8ICZA 4ECYA 1ZQXA 7ICSA 2QB1A 1SWWA 4GIBA 2F3NA 2H3VA 1BNOA 5AHXA 2I1QA 4DSEA 4YD1A 1RZTA 5D4BA 2BR0A 3ZDBA 5KFBA 1C20A 2BCRA 2WF9A 3TFSA 2C28A 3D2QA 4M2YA 5EE9A 2FMPA 8ICRA 5DBCA 3PW7A 3QUCA 3GV8B 2EQYA 1QQ5A 2EZZA 2Y1JA 4Y2VA 4NLZA 8ICEA 2ZIXA 7ICVA 4I27A 2KIWA 2ISOA 3N28A 1NKBA 1SXEA 8ICFA 2KZ3A 1NZBA 3KHHA 1FO4A 3K4GA 2R8JA 5AM0A 3QZ8A 3PZPA 4UQGA 4FFDA 3WKEA 3MDAA 3SAFA 2NYVA 2NRVA 7ICOA 3M9MB 7ICKA 3ORYA 7ICTA 1WCNA 4O3RA 4PHEA 4O9MA 3EUB2 3H0RB 4MEXA 2JRZA 5EE1A 4OJOA 5CWRA 4O0IA 4ED8A 4GC6A 2XO7A 2PKEA 4IRKA 5KFQA 4QW8A 4B9SA 3BQ0A 4KLIA 1F44A 3FDSA 4A8EA 5DBBA 2PFPA 5IIKA 1N61A 4QW9A 5DG8A 5J0WA 1U4BA 2G06A 3RJHA 3ETRA 2E8NA 4TQRA 1PUZA 4FZNA 3TFRA 3TAPA 1GO3F 3FAHA 3NS1A 4DS5A 1NK7A 1JROA 3RB4A 1NNLA 4B9VA 4DSLA 1WYGA 2JZBA 1PK1B 3DV9A 1TV9A 4RU9A 4RQ1A 3UPQA 4DOCA 1L3SA 3V7KA 3OPXA 2KZMA 1RYRA 1RDFA 2BQRA 2W43A 5BPCA 3C21A 4PL1A 3ISCA 3KZIU 4C8MA 4RQ0A 1TKDA 8ICTA 4ELVA 2DGZA 4MFAA 3WK5A 4NV0A 4UAYA 4J9NA 4EZ6A 1NK0A 8ICMA 2WFAA 1KDHA 9ICNA 3ETLA 5L1LA 3GQCA 4U6PA 1DK3A 2DL0A 1ZQ1C 2RQ5A 1ZQDA 4I2EA 4YR0A 3KKAC 4C8LA 4P4MA 2HHTA 9ICHA 2Z7JA 4BDPA 2HVHA 3VC8A 2YMLA 1OW5A 2A1AA 4Y2QA 1Z4OA 4ELTA 5J2JA 5JUMA 3QU4A 1ZQBA 3PO4A 5KFOA 3E0FA 4O3SA 2V9WA 2E1FA 1TE2A 4F5QA 5J2KA 5HP4A 4RQ4A 4UW9A 1NKEA 2IHMA 5KT6A 2ASJA 5L1JA 5AKXA 4DO9A 4DL5A 3Q8MA 1PK3A 5BOMA 5AK5A 4E0DA 2VIXA 3Q8KA 4QZAA 1B4FA 4UB8U 3GZFA 4EEYA 4ICAA 4DFPA 5KAIU 1YZ7A 4I2CA 1RG6A 4OJLA 1RXVA 4FBUA 1UPHA 3C23A 4BWJA 5CHGA 1COOA 5IILA 4JV0A 2HDOA 2K4HA 4G3IA 4RUAA 3HILA 1X42A 1X66A 3ZI4A 3KHGA 3MR5A 2DBYA 5EOZA 5AKHA 1D9FA 5L1KA 5DDYA 2JZBB 1HEKA 4UBCA 3T5JA 3J81j 5CA7A 3B0YA 2DUYA 2HHWA 9ICXA 1S9FA 4IQWA 3MFIA 2DKXA 4YMNA 1ZQCA 3NASA 2H3IA 1WG8A 4QWAA 3UMGA 3KHRA 1S97A 9ICOA 2B6GA 2BZFA 5JRTA 1XO0A 1D8LA 1AQ6A 5KG4A 4J9SA 2FPMA 1O03A 4PJ0U 1XS9D 2LMRA 5KAFU 5DG7A 4Q45A 4FZLA 5J2HA 4B9MA 3C1ZA 3RJGA 3C5FA 2XGQA 5TISU 1SKWA 3V7JA 4TUQA 2K4EA 4UB4A 1A76A 4O5KA 8ICBA 3SAHA 2DWQA 2OM6A 2W03A 5KG1A 3C1YA 5EE0A 4QWBA 3PW2A 4I2BA 3PO5A 9ICWA 2HBMA 5KT5A 3AMZA 3Q8LA 3RAXA 2RLTA 2BCSA 4C7ZA 4MF8A 2N1RA 5HMMA 1AROP 2CPRA 4RQ5A 1BVSA 5KFFA 4O5EA 3NRZA 3TANA 2P6RA 4KMUA 4QZEA 1UQVA 8ICSA 4UARA 1KL9A 3C2KA 3AUOA 4ED3A 1LV5A 3HWTA 4CCHA 3CP8A 4UAWA 5J0QA 2BDUA 3WKBA 4EX7A 4WJ3B 8ICJA 4F5NA 2JEGA 9ICGA 3AQFA 8ICWA 8ICHA 9ICVA 1KFSA 1N62A 4QWEA 1WWVA 2R18A 3BJYA 3M9NB 4Y2XA 4JB3A 5DDMA 3M1YA 2EANA 1T94A 4GC7A 4YG2A 4YN4A 2K4IA 4F4WA 4ECTA 2KHVA 5J0PA 1X9XA 2CRXA 2VKQA 3PV8A 4K4GA 5DQHA 3IN5A 4NL9A 3PX4A 4RQ2A 2Y1IA 1XU4A 1MSWD 1FFUA 4O3OA 3JPOA 5F3XB 4Y2TA 5KTQA 1UA0A 2LBOA 1COKA 2M0NA 5A0LA 1N60A 4LJXA 5DGBA 1ZQWA 3L4PA 5KFKA 5ALQA 5D46A 2FPLA 1ZQAA 1Q3UA 4P0QB 2J6UA 2GLEA 1UT8A 5G5GA 7ICHA 4LZGA 5ALZA 4F4XA 1XC9A 4PGXA 2MSNA 5L1MA 3LDAA 5CRXA 3UM9A 4P2HA 3NTUA 3GIMA 2ATLA 2AU0A 3F2BA 1SL1A 1U45A 2FLNA 2HOQA 5J0SA 5J2IA 7ICNA 1OXJA 3E2EA 3C2LA 1BPZA 3HT3A 5CB1A 3NUQA 1Z4NA 5KG7A 2YMMA 1DK2A 4IL6U 2OEHA 2AGQA 9ICTA 5ALKA 5J8YC 3SD7A 3LVVA 2H3FA 2W54A 2EAOA 2BCVA 3PY8A 1SIJA 1ZJNA 2G07A 4DL3A 4DQIA 5AK4A 2W9MA 3GIIA 4M9LA 4F93B 2ZTEA 7ICJA 4NLBA 2NO4A 4UB5A 2ZXHA 2HOIA 2ZTCA 4GXIA 4NY8A 5EWGA 5IIOA 3BDPA 5ALJA 1NJXA 4BUGA 4B9TA 2LYBA 4TURA 1KSPA 4YFKA 3PSIA 2R8IA 1T4GA 3U26A 3AQEA 5KFGA 5KFEA 5ALUA 2ZIWA 3TACB 2F2AB 4K4IA 3E58A 4R66A 1SWVA 2G0AA 2E3TA 1V97A 4OJ5A 4RZRA 4IC9A 2JH1A 4KLMA 5HNKA 3F53A 9ICCA 1JN3A 3RJFA 4IQUA 1L3UA 3BQTA 3M7DA 4BX9C 2RDIA 5F9LA 3Q8PB 4RT3A 5DQIA 4RQMA 3IG8A 1NJYA 1JMSA 3A0HU 1RQLA 3RAQA 2IOHA 5AKGA 2MRLA 5L9XA 5CP2A 3GIJA 3RFAA 2FMSA 1Q46A 2LYHA 4QIWF 5HR6A 2ASLA 2YB4A 4RPYA 8ICOA 2DKZA 1HJPA 3CNHA 4XQ8A 2WF7A 2RRDA 5GTHU 3GILA 1Z1VA 1ZQYA 2UVVA 4I28A 1QCKA 4QWDA 1N56A 4PZNA 1ZQGA 3UXPA 1X6JA 3PX0A 4KLHA 2LM4A 4XA5A 3KKAA 4ECWA 2VJ4A 7ICGA 1Q3VA 1L8LA 4NWIA 4DFKA 3V72A 3RB6A 4I29A 1L3VA 5J2FA 3TADC 4CF3A 4IRDA 4KN4A 4O3MA 3T5LA 3L3FX 5AI6A 5EWFA 4M9GA 2W55A 3KTQA 5AKJA 5KG2A 3F5AA 2XI9A 4KLJA 3CW2C 3G6VA 3F2CA 3DEEA 4YMOA 1NI3A 3WKCA 1UHUA 2W11A 2H5XA 2BCQA 5AM5A 2A3VA 3WK8A 1U49A 4B9LA 4RT2A 4RQNA 3GIKA 4J9OA 1D9DA 2KIVA 3WK6A 2ZIWB 3C29A 4GXJA 2AGPA 1D8BA 2WB1F 2J6TA 2KKVA 3ZD8A 2DFLA 4ECVA 1QTMA 3N97B 4PZOA 5E79U 4EBEA 3PW5A 2HBLA 1S0VA 2XCAA 2HVIA 4ACOA 2ODGA 2VA2A 2KV2A 1X40A 3ICXA 2C22A 3MFHA 2HBKA 2FE9A 4IS7A 2YQEA 4MEYA 4YD2A 4U7CA 1K5OA 3PMLA 3QU7A 1JIHA 4CDGA 1NK5A 4NLNA 4YP3A 9ICEA 3TKAA 4O5CA 4KLUA 4KLSA 2JXJA 4UB6U 1CUKA 1SV0C 1YT3A 5KFUA 5ALIA 5HHHA 4UBBA 2FI1A 3MR3A 8ICCA 3N7SC 8ICKA 2KZZA 4I2IA 3PR4A 2P35A 1N63A 1DGSA 5AM3A 4BXOB 9ICMA 3O0FA 4J9LA 1L5UA 4F4ZA 4DFDA 5JTIA 3G6XA 3ALRA 3Q8QB 3RF9A 4XUSA 1ZQQA 2MUTA 2HI0A 3H0LB 5DB6A 4DSJA 4Y2SA 5J2GA 2KMDA 2OHFA 3NGDA 4KLDA 5AI8A 3V6JA 3PSPA 1SKSA 2R8HA 4NM1A 1ZQIA 9ICJA 3PR5B 4ECZA 3IG5A 2D6FC 4OO1J 3QU2A 5ALFA 4M9NA 5KFTA 4Y2PA 4DFJA 2WHEA 5IIMA 3MBYA 3MGIA 3WK9A 1ZQTA 2K4PA 1RYUA 2PFNA 1XO1A 2VJ5A 2OH2A 3RJJA 1D8YA 4US9A 4KLOA 1UA1A 3H4DA 4OD0A 4KX3A 1L7PA 5KFJA 3TI0A 3LVWA 1NK8A 1MQ2A 5KFVA 1SKRA 1VDVA 3L5KA 1S0MA 2WF8A 1QSSA 2BGWA 3MR6A 5G5HA 2NRXA 2QB0A 3SI8A 1ZQNA 2C2EA 2F77X 4Q43A 3RJEA 3H8SA 4MFFA 2DQNB 4F2RA 1Z3EB 4R65A 4K4HA 4QZHA 1ZOLA 5KG6A 2PXIA 4P4OA 1L3TA 4Y2YA 1FEZA 5J2AA 3QU5A 3WKAA 1T3NA 8ICYA 4O3PA 2ZIVB 4F91B 7ICFA 2KICA 1XSLA 1HIWA 1IIPA 2LHTA 3H7IA 5J2CA 4I2HA 3UMBA 4C4RA 4HYKA 1KFDA 3K75D 3Q8RB 2YB1A 3PSFA 4FS1A 1FIQA 4DSKA 2ZUCA 3B0XA 4FS2A 3JPRA 1Z1BA 3ZDCA 1H38A 2ZJ5A 3KOOA 4RQ7A 3RRGA 2AHOB 2EH9A 2W7OA 1X6IA 2Y0SF 1V85A 5AI9A 2KP7A 4P0QA 2K8AA 4Q8EA 4QIWC 2MUTB 5J0OA 4DF4A 2EZYA 3JPQA 4ECRA 5KT2A 5EE3A 4DFMA 2FMQA 3MGVA 4QZBA 8ICLA 4US8A 2H3ZA 3LYSA 2BDPA 1A6SA 4C8KA 1CI4A 3HPOA 2KKPA 4MHVA 9ICPA 5AI0A 4C80A 3QEBZ 4B9NA 2RDJA 5AKZA 2QKQA 4JV2A 4KLLA 3TARA 2UVRA 4EX6A 1ZQUA 4QZDA 1NJZA 4QZ9A 1N5XA 2PMZF 3IHQB 5ALXA 1KBUA 4RQ3A 3FYHA 4YQWA 3QE9Y 4EENA 2BHNA 5B5EU 5HHIA 5J8YA 4R63A 3OHBA 2VA8A 3SAGA 2OCEA 2K60A 8ICXA 3SENA 3BS5B 5AK6A 3I28A 1MQ3A 3QUQA 2W9CA 1JUDA 1KQQA 1HUZA 3SV4A 2PI5A 2QB0B 2HHXA 4YVZA 2F8LA 4B6JA 3PW4A 3CYMA 3HW8A 3H4BA 2M9NA 3HX0A 3ISDA 1QH9A 4CNQA 4J9QA 3VCBA 2KHQA 4F71A 2F44A 2GH1A 5KL8B 1PVPA 4ZH4A 3RBEA 5KFIA 4Y2UA 3F2DA 2WB1C 4FE3A 4TUPA 2LKYA 2XCPA 2JMGA 5CJ7A 1WWUA 7ICMA 3C5GA 5IIIA 1DGJA 1KN5A 5AKLA 4Z6EA 4F2SA 2Q4TA 5D49A 2OWOA 2WTFA 2KFNA 4KLGA 3EWAA 5KT3A 1S10A 9ICUA 2ZTDA 1UT5A 4YR3A 2KVSA 3WK7A 4ED6A 4DF8A 3SYZA 3UQ2A 1QLNA 2HHUA 2XIDA 3LWLA 4PHDA 5AKIA 4ECUA 1RPLA 2E8PA 2ZJAA 5J0RA 2A1JA 5KG0A 3M8RA 3TAQA 2Y9TA 4PGYA 5H2FU 2F1JA 4AYBC 2AQ4A 1S0NA 2W3RA 2C2DA 2OXOA 3T5KA 3JPNA 1TAQA 4FZMA 7ICQA 5L1IA 2KEYA 4I2DA 2PFOA 5KT4A 1SZHA 1B22A 2KTQA 2BPGA 4X5VA 1FFVA 2E8MA 1JXLA 1BPDA 4J03A 2V4QA 2P66A 2QLTA 4TUSA 1ZQHA 2OYYA 4JMUA 4KLFA 9ICQA 1SB3C 4ELUA 3QYPA 5K4LA 3TADA 5DB8A 2ZJ8A 1ECWA 3EPIA 3MC1A 3HRDD 2BPCA 2W7PA 1V9PA 4DSFA 2YTUA 2ALZA 2GWSA 4CF4A 4F5PA 3ZD9A 2AGOA 2MAXA 1JX4A 4OJPA 4C7YA 4QZFA 2FPKA 2W9CB 2E1EA 2YY6A 3V6HA 1X9WA 4MFCA 1IG6A 2YMQA 4Z6CA 4C8NA 3RTVA 2W04A 5DB9A 1KLNA 5AM4A 4CE6A 1F5SA 5J0UA 3IDWA 1S0OA 4NXZA 2W8KA 2I9GA 4NM2A 4IRCA 3AU2A 4XRHA 1KFTA 2LYAA 2CN1A 4ECQA 3BQ1A 4J9RA 1M6YA 3EYZA 2ZUDA 5J2DA 4I2GA 3ZDEA 5C5JA 1ZRMA 1ZQVA 3QNMA 2O6KA 4JV1A 5AIAA 1KW4A 1SGGA 5KFCA 3I76A 5KFAA 3SQIA 1NJWA 5ALLA 4DOBA 4EBCA 1L7OA 4Z6FA 1LB2B 5KNIA 2G09A 1L6NA 3UXOA 4YXJA 3KFUF 2IOFA 2XY7A 5KFLA 3F5EA 4ED1A 4UAZA
chains in the Genus database with same CATH topology
2H3FA 1CRXA 3SAGA 1XNSA 2ZIXA 2ZXIA 4U6PA 2ZIUB 1ZQ1C 2R18A 2KIWA 2G07A 3HKZF 4KX5A 4GFJA 2VJ4A 1YT3A 5C0YA 3H0MB 2OYYA 2Z7JA 1Q3VA 2F76X 2H3IA 4NWIA 4NLBA 2XVTA 3VC8A 2H3QA 2KVCA 2KJ8A 4JMUA 1T94A 3N7SC 2ZXHA 1NZBA 1WUDA 3M6ZA 2ZIVB 2HOIA 2F8LA 1XO0A 3CYMA 2K4IA 2ZIVA 2XICA 2JGAA 2KNJA 3PZPA 4CGZA 2KICA 2KHVA 1ECWA 2NV3A 3NRWA 1TAMA 2K89A 2LHTA 1HIWA 1IIPA 3CRXA 3SAFA 1URJA 3E0FA 4KMOB 2VKQA 2KHQA 2WAQF 3VCBA 2W7PA 2CRXA 4O3MA 3L3FX 2Y0SC 3IN5A 2RHFA 3O0FA 2E1FA 3M6KA 4BUGA 2KJ9A 2LYBA 3H0RB 4OJPA 2YB1A 3PSFA 2GH1A 3ALRA 2JH7A 2E1EA 1ED1A 3RF9A 5KL8B 1PVPA 4OJOA 3AL0B 3PSIA 5T14A 1MA7A 2YX8A 4QNLA 4C0ZA 3H0LB 4FZLA 3F5AA 3AQEA 4PL2A 2LBOA 2XI9A 2WB1C 4FE3A 4AYBF 3C28A 3F2DA 1Z1BA 2M0NA 2RP5A 2LKYA 2W04A 2ZIWA 2JMGA 2F2AB 1A0PA 2JHDA 3PSTA 5A0LA 2ZG6A 3F2CA 2K4EA 3N7PD 3PSPA 3DEEA 1F44A 2HMXA 3GU3A 2KJ5A 4A8EA 2VIXA 3SAHA 3IG5A 2OM6A 2W03A 3GZFA 2D6FC 2Q4TA 4QJFB 4OO1J 2W7OA 3T79A 2G0AA 3D2SA 4OJ5A 2KOBA 4CRXA 2KD1A 2G06A 4ICAA 2DF4B 1Q3UA 2Y0SF 4IC9A 2G5IB 2JH1A 2A3VA 4P0QB 2K8BB 4P0QA 2K8AA 1OUQA 2HBMA 3F53A 4FZNA 4QIWC 1P7DA 1GO3F 2PMZC 2G5HB 2CN1A 2H3VA 2LYAA 4OJLA 3C29A 2ZIWB 1UPHA 3M7DA 5KL1B 2WB1F 2G08A 1D8BA 3IP4B 4BX9C 3MGVA 4P0PA 2KKVA 5HR7A 2N1RA 2H3ZA 2VJ5A 2OH2A 2XIDA 3IG8A 3LYSA 1A6SA 2CPRA 5CRXA 2KKPA 3OPXA 2HOFA 3HKZC 4KX3A 2K4HA 2ZIUA 2GOLA 3SQIA 2MRLA 3LVWA 2HBLA 4OJ6A 4PL1A 3F2BA 3RFAA 4AYBC 1DRGA 4ACOA 2E5SA 3SMVA 2HOQA 2KV2A 3D2QA 2OXOA 2MA1A 1Z19A 2DGZA 1PVRA 3ICXA 3K1ZA 4NLCA 3N7RC 3ONNA 4QIWF 5HR6A 3CP8A 2YB4A 4FZMA 2PMZF 2HBKA 2BDUA 1HEKA 3NUQA 1PVQA 2K8CB 2G09A 1KBUA 3D2NA 4NV0A 3KZXA 2F77X 4BJQA 4WJ3B 1L6NA 4P0PB 2KEYA 2HBJA 4U7CA 3KFUF 3AQFA 2DQNB 1SZHA 4CDGA 2WAQC 2RRDA 3LVVA 3F5EA 2ZIXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WAQ F;  2PMZ F;  2WB1 F;  3HKZ F;  2Y0S F;  4AYB F; 
#chains in the Genus database with same CATH topology
 2D3D A;  2ZXI A;  2A1J B;  3QXG A;  2B0C A;  4F92 B;  1RXW A;  2WF5 A;  5HML A;  3THV A;  3HJE A;  4NLG A;  4UAV A;  3JPP A;  3RH5 A;  8ICA A;  3PX6 A;  2R8K A;  2JGA A;  4R8U B;  5J0X A;  3RBD A;  2FLP A;  5DB7 A;  3WKD A;  2Y0S C;  2KSO A;  5KG3 A;  4BXO A;  1ZQS A;  2KJ9 A;  1N2X A;  4YMM A;  5J0T A;  3RB3 A;  5ALP A;  1ZRN A;  4C0Z A;  1VJ5 A;  4LZD A;  4YR2 A;  4IQT A;  5J0Y A;  3PST A;  1UCV A;  7ICP A;  4FBT A;  3N7P D;  4RQ8 A;  1U47 A;  1S76 D;  3GU3 A;  1EXN A;  3AEV A;  1RM6 C;  3NVZ A;  8ICP A;  3D2S A;  4QZI A;  4CRX A;  5AK3 A;  4QZ8 A;  2G5I B;  5AM2 A;  2VAN A;  4IQV A;  4PHP A;  1Y88 A;  4Q8F A;  2PMZ C;  2VA3 A;  2G5H B;  4F5R A;  4Y2R A;  2FLL A;  5HR7 A;  2R8G A;  1T3Q A;  3RJK A;  2HHS A;  2ISP A;  5KG5 A;  4C8O A;  1IM4 A;  2F1H A;  1BPB A;  3RR7 A;  3PNC A;  3SV3 A;  2AXT U;  5JU5 A;  1Z19 A;  4KLE A;  1TK5 A;  1J2N A;  3FC4 A;  3H40 A;  1BNP A;  1S77 D;  3D2N A;  3UMC A;  1NOM A;  3QUB A;  3N4M B;  3FM9 A;  5KFM A;  1T8E A;  1ZQP A;  4ED7 A;  1CRX A;  4JK1 A;  4QZG A;  2W9B A;  5AIC A;  4I2A A;  2FJ6 A;  3HKZ F;  4DQQ A;  2ES6 A;  2XGP A;  4GFJ A;  2EAM A;  3DDH A;  4RNO A;  1PZN A;  1LVH A;  1ZQJ A;  4F50 A;  2IBK A;  5DQG A;  4UAT A;  4LVS A;  3M6Z A;  5KFR A;  2HW3 A;  2ZIV A;  5ALR A;  2KNJ A;  4KIT B;  1KEJ A;  1BPY A;  3CRX A;  1ZQO A;  3RH6 A;  2WAQ F;  2RHF A;  1QSY A;  3UQ0 A;  4F4Y A;  4YCX A;  2GO7 A;  2JH7 A;  4CF5 A;  4RNM A;  1IXR A;  4R64 A;  1QQ6 A;  4AYB F;  3H8M A;  2DPI A;  2LM1 A;  2RP5 A;  3RRH A;  5KFD A;  4IR1 A;  2CXY A;  1TK0 A;  5KFW A;  1IV8 A;  3H8J A;  4EEL A;  1ZQE A;  2KSO B;  2KOB A;  4M47 A;  2EAP A;  4J9M A;  4EYI B;  2K8B B;  3TQ1 A;  1V38 A;  4UAS A;  2BPF A;  3BS7 A;  2JV3 A;  1Z00 A;  4PHA A;  5DBA A;  4NJ8 A;  9ICF A;  8ICG A;  2P6U A;  4BWM A;  4ED2 A;  4P0P A;  4EBD A;  3I1Y A;  1B0X A;  1N5W A;  3LWM A;  3LK9 A;  4DL6 A;  2A19 A;  2IHN A;  7ICE A;  2ZIU A;  2GOL A;  4M0A A;  3AM9 A;  3QX7 A;  3S6J A;  1NK9 A;  1J97 A;  3R9K A;  2XY5 A;  7ICR A;  1PVR A;  9ICR A;  4Q44 A;  1L7N A;  3EPG A;  5KFH A;  4QZC A;  4F8R A;  1LKY A;  5J2E A;  2HHQ A;  5IIJ A;  5KFS A;  9ICI A;  2ZIX B;  2W9A A;  7ICU A;  3QEA Z;  5KFZ A;  5ALG A;  4BGD A;  2B21 A;  8ICI A;  4F3O A;  3BS5 A;  4MF2 A;  5AKE A;  3MAB A;  1U9L A;  1WUD A;  2HCF A;  1TVA A;  4CGZ A;  1C7Y A;  4RQ6 A;  3H8W A;  3NVY A;  2NRZ A;  8ICU A;  2W9B B;  3M6K A;  5KFX A;  1K1S A;  3AL0 B;  1ED1 A;  1X9S A;  5DGA A;  5DLG A;  4DS4 A;  4FO6 A;  5T14 A;  1MA7 A;  5CR0 A;  4M6W A;  4PL2 A;  4RPX A;  5ALY A;  3C28 A;  4DL7 A;  3RH4 A;  4DL2 A;  2I5H A;  1J2M A;  4DQP A;  3JPS A;  2MU2 A;  8ICV A;  2QAR A;  1XSN A;  2XY6 A;  1SL2 A;  4JWM A;  1RQN A;  9ICS A;  3RB0 A;  4ECX A;  4UAU A;  3D6J A;  4DLG A;  5FP0 A;  2KFZ A;  1JI7 A;  1VLB A;  1QQ7 A;  3GFK B;  4KN7 A;  3AU6 A;  3BQ7 A;  3V6K A;  4DQR A;  4KLT A;  4F5O A;  1TFR A;  3B9J A;  2UVU A;  1CEZ A;  4KLQ A;  2DPJ A;  5ALO A;  1T7P A;  1L8O A;  4DCC A;  4J9P A;  2EDU A;  5KFP A;  1SZP A;  5AI5 A;  5J29 A;  2I6X A;  4DLE A;  2BCU A;  2W3S A;  4EEK A;  4OJ6 A;  3WU2 U;  5ALN A;  1DRG A;  3IM1 A;  1Z00 B;  3MGH A;  3OTQ A;  2YN4 A;  2MA1 A;  2Q0Z X;  3ISB A;  2KN7 A;  2AQ0 A;  4NLC A;  3N7R C;  1DXS A;  4C4S A;  2K8C B;  2BKE A;  2WF6 A;  4P0P B;  1NZP A;  3M8S A;  2F8K A;  3NVV A;  4Z6D A;  1ZYQ A;  1XNS A;  2ZIU B;  4UB3 A;  4M9H A;  3OJU A;  3H0M B;  2L5Y A;  5ALW A;  3GDX A;  4PH5 A;  2XVT A;  5ALS A;  1O08 A;  3BZK A;  1LKY B;  5AM1 A;  1NK6 A;  2XIC A;  2C2R A;  3NRW A;  5KFN A;  1TAM A;  1ZD5 A;  4OCZ A;  4I2F A;  2JEI A;  2KK0 A;  3SZ2 A;  4GLX A;  1SV4 A;  2KG5 A;  3EW9 A;  5AI4 A;  2IA6 A;  3EZ5 A;  1SXD A;  1ZD4 A;  1ZQR A;  4HAI A;  5DLF A;  1TAU A;  2V4R A;  3HP6 A;  5IIN A;  4RPZ A;  1MN8 A;  4AP9 A;  2JHD A;  1KKX A;  3ED5 A;  5F9N A;  5DKW A;  1BPE A;  1ZQL A;  2F1I A;  1YZ6 A;  3T79 A;  2NRW A;  2KD1 A;  3OSN A;  2IMW P;  1X2I A;  4F4K A;  3WK4 A;  1JRP A;  1OUQ A;  1ZXI A;  3MR2 A;  1BGX T;  1L7M A;  4M6W B;  2AH5 A;  2BQU A;  1NK4 A;  2JR5 A;  4JWN A;  4C4T A;  2G08 A;  4NLK A;  4YXM A;  8ICN A;  1HUO A;  2QAR B;  1K1Q A;  3GV5 B;  9ICA A;  2PFQ A;  2LPE A;  2ZUB A;  4RUC A;  4DOA A;  4DSI A;  3HKZ C;  1TK8 A;  7ICI A;  3Q8S B;  3A0B U;  2Y9U A;  4ZOH C;  4PPX A;  4KTQ A;  3QU9 A;  3RJI A;  3SMV A;  4EZ9 A;  1ZQZ A;  5EWE A;  1MC8 A;  4P4P A;  3OSP A;  1ZQF A;  5DG9 A;  3M9O B;  3PW0 A;  3IRU A;  1KRP A;  2E8O A;  3UXN A;  2WAQ C;  1RYS A;  4KX5 A;  2W8L A;  4Y2J A;  2J6S A;  3T5H A;  1N48 A;  5C0Y A;  1XWL A;  5AKY A;  9ICK A;  2H3Q A;  8ICQ A;  2KJ8 A;  4F72 A;  5TZV A;  4QWC A;  3BQ2 A;  5B66 U;  1ZQK A;  3GV7 B;  3ZDD A;  2HSZ A;  2NV3 A;  2EZX A;  4ED0 A;  3KBB A;  2K89 A;  4R8U A;  3V7L A;  4GXK A;  1S8O A;  4DQS A;  1URJ A;  4KMO B;  3JPT A;  3OHA A;  4UB1 A;  3QZ7 A;  3G6Y A;  2XC9 A;  2JEF A;  3IV6 A;  4QNL A;  5AKK A;  3SEI A;  9ICB A;  4IR9 A;  1A77 A;  1X9M A;  3PVX A;  2HMX A;  2KJ5 A;  1Q8K A;  5ALV A;  4DWI A;  5ALH A;  3AN1 A;  3ZDA A;  1F0M A;  1P7D A;  1ZJM A;  1ZQM A;  5AIB A;  1QSL A;  4USA A;  4ECS A;  5KL1 B;  5CEH A;  4PGQ A;  3MDC A;  3IP4 B;  1JAL A;  4O3N A;  3RR8 A;  1S5L U;  3KHL A;  4DL4 A;  1BPX A;  5GTI U;  2IOF K;  3NVW A;  4JUZ A;  2HOF A;  4O3Q A;  5ALD A;  1ZD3 A;  1KTQ A;  4J9K A;  2ESE A;  3K1R B;  1JXE A;  2E5S A;  2JEJ A;  1DOQ A;  3K1Z A;  3ONN A;  4DEZ A;  2BQ3 A;  2AJQ A;  1PVQ A;  4M04 A;  4BJQ A;  2LI6 A;  3KZX A;  4EYH B;  2UVW A;  2HBJ A;  2NRT A;  4G9B A;  4I2J A;  1NKC A;  3OGU A;  1ZET A;  2F76 X;  3BZC A;  2PI4 A;  2KVC A;  4B9U A;  5BOL A;  2HHV A;  2KE7 A;  1SL0 A;  2ASD A;  5ALM A;  9ICL A;  2D8C A;  3C2M A;  3QUT A;  3SR6 A;  5KFY A;  4TQS A;  4UB2 A;  5ALE A;  4NL9 C;  1XSP A;  1U48 A;  2YMP A;  2FDR A;  1SV0 A;  5J2B A;  2YX8 A;  1WCL A;  7ICL A;  4QJF B;  4RNN A;  5KT7 A;  3PMN A;  1A0P A;  1PK1 A;  2ZG6 A;  1ZD2 P;  3KD3 A;  1B43 A;  4M9J A;  5ALT A;  3OJS A;  3T3F A;  2NO5 A;  2DF4 B;  8ICZ A;  4ECY A;  1ZQX A;  7ICS A;  2QB1 A;  1SWW A;  4GIB A;  2F3N A;  2H3V A;  1BNO A;  5AHX A;  2I1Q A;  4DSE A;  4YD1 A;  1RZT A;  5D4B A;  2BR0 A;  3ZDB A;  5KFB A;  1C20 A;  2BCR A;  2WF9 A;  3TFS A;  2C28 A;  3D2Q A;  4M2Y A;  5EE9 A;  2FMP A;  8ICR A;  5DBC A;  3PW7 A;  3QUC A;  3GV8 B;  2EQY A;  1QQ5 A;  2EZZ A;  2Y1J A;  4Y2V A;  4NLZ A;  8ICE A;  2ZIX A;  7ICV A;  4I27 A;  2KIW A;  2ISO A;  3N28 A;  1NKB A;  1SXE A;  8ICF A;  2KZ3 A;  1NZB A;  3KHH A;  1FO4 A;  3K4G A;  2R8J A;  5AM0 A;  3QZ8 A;  3PZP A;  4UQG A;  4FFD A;  3WKE A;  3MDA A;  3SAF A;  2NYV A;  2NRV A;  7ICO A;  3M9M B;  7ICK A;  3ORY A;  7ICT A;  1WCN A;  4O3R A;  4PHE A;  4O9M A;  3EUB 2;  3H0R B;  4MEX A;  2JRZ A;  5EE1 A;  4OJO A;  5CWR A;  4O0I A;  4ED8 A;  4GC6 A;  2XO7 A;  2PKE A;  4IRK A;  5KFQ A;  4QW8 A;  4B9S A;  3BQ0 A;  4KLI A;  1F44 A;  3FDS A;  4A8E A;  5DBB A;  2PFP A;  5IIK A;  1N61 A;  4QW9 A;  5DG8 A;  5J0W A;  1U4B A;  2G06 A;  3RJH A;  3ETR A;  2E8N A;  4TQR A;  1PUZ A;  4FZN A;  3TFR A;  3TAP A;  1GO3 F;  3FAH A;  3NS1 A;  4DS5 A;  1NK7 A;  1JRO A;  3RB4 A;  1NNL A;  4B9V A;  4DSL A;  1WYG A;  2JZB A;  1PK1 B;  3DV9 A;  1TV9 A;  4RU9 A;  4RQ1 A;  3UPQ A;  4DOC A;  1L3S A;  3V7K A;  3OPX A;  2KZM A;  1RYR A;  1RDF A;  2BQR A;  2W43 A;  5BPC A;  3C21 A;  4PL1 A;  3ISC A;  3KZI U;  4C8M A;  4RQ0 A;  1TKD A;  8ICT A;  4ELV A;  2DGZ A;  4MFA A;  3WK5 A;  4NV0 A;  4UAY A;  4J9N A;  4EZ6 A;  1NK0 A;  8ICM A;  2WFA A;  1KDH A;  9ICN A;  3ETL A;  5L1L A;  3GQC A;  4U6P A;  1DK3 A;  2DL0 A;  1ZQ1 C;  2RQ5 A;  1ZQD A;  4I2E A;  4YR0 A;  3KKA C;  4C8L A;  4P4M A;  2HHT A;  9ICH A;  2Z7J A;  4BDP A;  2HVH A;  3VC8 A;  2YML A;  1OW5 A;  2A1A A;  4Y2Q A;  1Z4O A;  4ELT A;  5J2J A;  5JUM A;  3QU4 A;  1ZQB A;  3PO4 A;  5KFO A;  3E0F A;  4O3S A;  2V9W A;  2E1F A;  1TE2 A;  4F5Q A;  5J2K A;  5HP4 A;  4RQ4 A;  4UW9 A;  1NKE A;  2IHM A;  5KT6 A;  2ASJ A;  5L1J A;  5AKX A;  4DO9 A;  4DL5 A;  3Q8M A;  1PK3 A;  5BOM A;  5AK5 A;  4E0D A;  2VIX A;  3Q8K A;  4QZA A;  1B4F A;  4UB8 U;  3GZF A;  4EEY A;  4ICA A;  4DFP A;  5KAI U;  1YZ7 A;  4I2C A;  1RG6 A;  4OJL A;  1RXV A;  4FBU A;  1UPH A;  3C23 A;  4BWJ A;  5CHG A;  1COO A;  5IIL A;  4JV0 A;  2HDO A;  2K4H A;  4G3I A;  4RUA A;  3HIL A;  1X42 A;  1X66 A;  3ZI4 A;  3KHG A;  3MR5 A;  2DBY A;  5EOZ A;  5AKH A;  1D9F A;  5L1K A;  5DDY A;  2JZB B;  1HEK A;  4UBC A;  3T5J A;  3J81 j;  5CA7 A;  3B0Y A;  2DUY A;  2HHW A;  9ICX A;  1S9F A;  4IQW A;  3MFI A;  2DKX A;  4YMN A;  1ZQC A;  3NAS A;  2H3I A;  1WG8 A;  4QWA A;  3UMG A;  3KHR A;  1S97 A;  9ICO A;  2B6G A;  2BZF A;  5JRT A;  1XO0 A;  1D8L A;  1AQ6 A;  5KG4 A;  4J9S A;  2FPM A;  1O03 A;  4PJ0 U;  1XS9 D;  2LMR A;  5KAF U;  5DG7 A;  4Q45 A;  4FZL A;  5J2H A;  4B9M A;  3C1Z A;  3RJG A;  3C5F A;  2XGQ A;  5TIS U;  1SKW A;  3V7J A;  4TUQ A;  2K4E A;  4UB4 A;  1A76 A;  4O5K A;  8ICB A;  3SAH A;  2DWQ A;  2OM6 A;  2W03 A;  5KG1 A;  3C1Y A;  5EE0 A;  4QWB A;  3PW2 A;  4I2B A;  3PO5 A;  9ICW A;  2HBM A;  5KT5 A;  3AMZ A;  3Q8L A;  3RAX A;  2RLT A;  2BCS A;  4C7Z A;  4MF8 A;  2N1R A;  5HMM A;  1ARO P;  2CPR A;  4RQ5 A;  1BVS A;  5KFF A;  4O5E A;  3NRZ A;  3TAN A;  2P6R A;  4KMU A;  4QZE A;  1UQV A;  8ICS A;  4UAR A;  1KL9 A;  3C2K A;  3AUO A;  4ED3 A;  1LV5 A;  3HWT A;  4CCH A;  3CP8 A;  4UAW A;  5J0Q A;  2BDU A;  3WKB A;  4EX7 A;  4WJ3 B;  8ICJ A;  4F5N A;  2JEG A;  9ICG A;  3AQF A;  8ICW A;  8ICH A;  9ICV A;  1KFS A;  1N62 A;  4QWE A;  1WWV A;  2R18 A;  3BJY A;  3M9N B;  4Y2X A;  4JB3 A;  5DDM A;  3M1Y A;  2EAN A;  1T94 A;  4GC7 A;  4YG2 A;  4YN4 A;  2K4I A;  4F4W A;  4ECT A;  2KHV A;  5J0P A;  1X9X A;  2CRX A;  2VKQ A;  3PV8 A;  4K4G A;  5DQH A;  3IN5 A;  4NL9 A;  3PX4 A;  4RQ2 A;  2Y1I A;  1XU4 A;  1MSW D;  1FFU A;  4O3O A;  3JPO A;  5F3X B;  4Y2T A;  5KTQ A;  1UA0 A;  2LBO A;  1COK A;  2M0N A;  5A0L A;  1N60 A;  4LJX A;  5DGB A;  1ZQW A;  3L4P A;  5KFK A;  5ALQ A;  5D46 A;  2FPL A;  1ZQA A;  1Q3U A;  4P0Q B;  2J6U A;  2GLE A;  1UT8 A;  5G5G A;  7ICH A;  4LZG A;  5ALZ A;  4F4X A;  1XC9 A;  4PGX A;  2MSN A;  5L1M A;  3LDA A;  5CRX A;  3UM9 A;  4P2H A;  3NTU A;  3GIM A;  2ATL A;  2AU0 A;  3F2B A;  1SL1 A;  1U45 A;  2FLN A;  2HOQ A;  5J0S A;  5J2I A;  7ICN A;  1OXJ A;  3E2E A;  3C2L A;  1BPZ A;  3HT3 A;  5CB1 A;  3NUQ A;  1Z4N A;  5KG7 A;  2YMM A;  1DK2 A;  4IL6 U;  2OEH A;  2AGQ A;  9ICT A;  5ALK A;  5J8Y C;  3SD7 A;  3LVV A;  2H3F A;  2W54 A;  2EAO A;  2BCV A;  3PY8 A;  1SIJ A;  1ZJN A;  2G07 A;  4DL3 A;  4DQI A;  5AK4 A;  2W9M A;  3GII A;  4M9L A;  4F93 B;  2ZTE A;  7ICJ A;  4NLB A;  2NO4 A;  4UB5 A;  2ZXH A;  2HOI A;  2ZTC A;  4GXI A;  4NY8 A;  5EWG A;  5IIO A;  3BDP A;  5ALJ A;  1NJX A;  4BUG A;  4B9T A;  2LYB A;  4TUR A;  1KSP A;  4YFK A;  3PSI A;  2R8I A;  1T4G A;  3U26 A;  3AQE A;  5KFG A;  5KFE A;  5ALU A;  2ZIW A;  3TAC B;  2F2A B;  4K4I A;  3E58 A;  4R66 A;  1SWV A;  2G0A A;  2E3T A;  1V97 A;  4OJ5 A;  4RZR A;  4IC9 A;  2JH1 A;  4KLM A;  5HNK A;  3F53 A;  9ICC A;  1JN3 A;  3RJF A;  4IQU A;  1L3U A;  3BQT A;  3M7D A;  4BX9 C;  2RDI A;  5F9L A;  3Q8P B;  4RT3 A;  5DQI A;  4RQM A;  3IG8 A;  1NJY A;  1JMS A;  3A0H U;  1RQL A;  3RAQ A;  2IOH A;  5AKG A;  2MRL A;  5L9X A;  5CP2 A;  3GIJ A;  3RFA A;  2FMS A;  1Q46 A;  2LYH A;  4QIW F;  5HR6 A;  2ASL A;  2YB4 A;  4RPY A;  8ICO A;  2DKZ A;  1HJP A;  3CNH A;  4XQ8 A;  2WF7 A;  2RRD A;  5GTH U;  3GIL A;  1Z1V A;  1ZQY A;  2UVV A;  4I28 A;  1QCK A;  4QWD A;  1N56 A;  4PZN A;  1ZQG A;  3UXP A;  1X6J A;  3PX0 A;  4KLH A;  2LM4 A;  4XA5 A;  3KKA A;  4ECW A;  2VJ4 A;  7ICG A;  1Q3V A;  1L8L A;  4NWI A;  4DFK A;  3V72 A;  3RB6 A;  4I29 A;  1L3V A;  5J2F A;  3TAD C;  4CF3 A;  4IRD A;  4KN4 A;  4O3M A;  3T5L A;  3L3F X;  5AI6 A;  5EWF A;  4M9G A;  2W55 A;  3KTQ A;  5AKJ A;  5KG2 A;  3F5A A;  2XI9 A;  4KLJ A;  3CW2 C;  3G6V A;  3F2C A;  3DEE A;  4YMO A;  1NI3 A;  3WKC A;  1UHU A;  2W11 A;  2H5X A;  2BCQ A;  5AM5 A;  2A3V A;  3WK8 A;  1U49 A;  4B9L A;  4RT2 A;  4RQN A;  3GIK A;  4J9O A;  1D9D A;  2KIV A;  3WK6 A;  2ZIW B;  3C29 A;  4GXJ A;  2AGP A;  1D8B A;  2WB1 F;  2J6T A;  2KKV A;  3ZD8 A;  2DFL A;  4ECV A;  1QTM A;  3N97 B;  4PZO A;  5E79 U;  4EBE A;  3PW5 A;  2HBL A;  1S0V A;  2XCA A;  2HVI A;  4ACO A;  2ODG A;  2VA2 A;  2KV2 A;  1X40 A;  3ICX A;  2C22 A;  3MFH A;  2HBK A;  2FE9 A;  4IS7 A;  2YQE A;  4MEY A;  4YD2 A;  4U7C A;  1K5O A;  3PML A;  3QU7 A;  1JIH A;  4CDG A;  1NK5 A;  4NLN A;  4YP3 A;  9ICE A;  3TKA A;  4O5C A;  4KLU A;  4KLS A;  2JXJ A;  4UB6 U;  1CUK A;  1SV0 C;  1YT3 A;  5KFU A;  5ALI A;  5HHH A;  4UBB A;  2FI1 A;  3MR3 A;  8ICC A;  3N7S C;  8ICK A;  2KZZ A;  4I2I A;  3PR4 A;  2P35 A;  1N63 A;  1DGS A;  5AM3 A;  4BXO B;  9ICM A;  3O0F A;  4J9L A;  1L5U A;  4F4Z A;  4DFD A;  5JTI A;  3G6X A;  3ALR A;  3Q8Q B;  3RF9 A;  4XUS A;  1ZQQ A;  2MUT A;  2HI0 A;  3H0L B;  5DB6 A;  4DSJ A;  4Y2S A;  5J2G A;  2KMD A;  2OHF A;  3NGD A;  4KLD A;  5AI8 A;  3V6J A;  3PSP A;  1SKS A;  2R8H A;  4NM1 A;  1ZQI A;  9ICJ A;  3PR5 B;  4ECZ A;  3IG5 A;  2D6F C;  4OO1 J;  3QU2 A;  5ALF A;  4M9N A;  5KFT A;  4Y2P A;  4DFJ A;  2WHE A;  5IIM A;  3MBY A;  3MGI A;  3WK9 A;  1ZQT A;  2K4P A;  1RYU A;  2PFN A;  1XO1 A;  2VJ5 A;  2OH2 A;  3RJJ A;  1D8Y A;  4US9 A;  4KLO A;  1UA1 A;  3H4D A;  4OD0 A;  4KX3 A;  1L7P A;  5KFJ A;  3TI0 A;  3LVW A;  1NK8 A;  1MQ2 A;  5KFV A;  1SKR A;  1VDV A;  3L5K A;  1S0M A;  2WF8 A;  1QSS A;  2BGW A;  3MR6 A;  5G5H A;  2NRX A;  2QB0 A;  3SI8 A;  1ZQN A;  2C2E A;  2F77 X;  4Q43 A;  3RJE A;  3H8S A;  4MFF A;  2DQN B;  4F2R A;  1Z3E B;  4R65 A;  4K4H A;  4QZH A;  1ZOL A;  5KG6 A;  2PXI A;  4P4O A;  1L3T A;  4Y2Y A;  1FEZ A;  5J2A A;  3QU5 A;  3WKA A;  1T3N A;  8ICY A;  4O3P A;  2ZIV B;  4F91 B;  7ICF A;  2KIC A;  1XSL A;  1HIW A;  1IIP A;  2LHT A;  3H7I A;  5J2C A;  4I2H A;  3UMB A;  4C4R A;  4HYK A;  1KFD A;  3K75 D;  3Q8R B;  2YB1 A;  3PSF A;  4FS1 A;  1FIQ A;  4DSK A;  2ZUC A;  3B0X A;  4FS2 A;  3JPR A;  1Z1B A;  3ZDC A;  1H38 A;  2ZJ5 A;  3KOO A;  4RQ7 A;  3RRG A;  2AHO B;  2EH9 A;  2W7O A;  1X6I A;  2Y0S F;  1V85 A;  5AI9 A;  2KP7 A;  4P0Q A;  2K8A A;  4Q8E A;  4QIW C;  2MUT B;  5J0O A;  4DF4 A;  2EZY A;  3JPQ A;  4ECR A;  5KT2 A;  5EE3 A;  4DFM A;  2FMQ A;  3MGV A;  4QZB A;  8ICL A;  4US8 A;  2H3Z A;  3LYS A;  2BDP A;  1A6S A;  4C8K A;  1CI4 A;  3HPO A;  2KKP A;  4MHV A;  9ICP A;  5AI0 A;  4C80 A;  3QEB Z;  4B9N A;  2RDJ A;  5AKZ A;  2QKQ A;  4JV2 A;  4KLL A;  3TAR A;  2UVR A;  4EX6 A;  1ZQU A;  4QZD A;  1NJZ A;  4QZ9 A;  1N5X A;  2PMZ F;  3IHQ B;  5ALX A;  1KBU A;  4RQ3 A;  3FYH A;  4YQW A;  3QE9 Y;  4EEN A;  2BHN A;  5B5E U;  5HHI A;  5J8Y A;  4R63 A;  3OHB A;  2VA8 A;  3SAG A;  2OCE A;  2K60 A;  8ICX A;  3SEN A;  3BS5 B;  5AK6 A;  3I28 A;  1MQ3 A;  3QUQ A;  2W9C A;  1JUD A;  1KQQ A;  1HUZ A;  3SV4 A;  2PI5 A;  2QB0 B;  2HHX A;  4YVZ A;  2F8L A;  4B6J A;  3PW4 A;  3CYM A;  3HW8 A;  3H4B A;  2M9N A;  3HX0 A;  3ISD A;  1QH9 A;  4CNQ A;  4J9Q A;  3VCB A;  2KHQ A;  4F71 A;  2F44 A;  2GH1 A;  5KL8 B;  1PVP A;  4ZH4 A;  3RBE A;  5KFI A;  4Y2U A;  3F2D A;  2WB1 C;  4FE3 A;  4TUP A;  2LKY A;  2XCP A;  2JMG A;  5CJ7 A;  1WWU A;  7ICM A;  3C5G A;  5III A;  1DGJ A;  1KN5 A;  5AKL A;  4Z6E A;  4F2S A;  2Q4T A;  5D49 A;  2OWO A;  2WTF A;  2KFN A;  4KLG A;  3EWA A;  5KT3 A;  1S10 A;  9ICU A;  2ZTD A;  1UT5 A;  4YR3 A;  2KVS A;  3WK7 A;  4ED6 A;  4DF8 A;  3SYZ A;  3UQ2 A;  1QLN A;  2HHU A;  2XID A;  3LWL A;  4PHD A;  5AKI A;  4ECU A;  1RPL A;  2E8P A;  2ZJA A;  5J0R A;  2A1J A;  5KG0 A;  3M8R A;  3TAQ A;  2Y9T A;  4PGY A;  5H2F U;  2F1J A;  4AYB C;  2AQ4 A;  1S0N A;  2W3R A;  2C2D A;  2OXO A;  3T5K A;  3JPN A;  1TAQ A;  4FZM A;  7ICQ A;  5L1I A;  2KEY A;  4I2D A;  2PFO A;  5KT4 A;  1SZH A;  1B22 A;  2KTQ A;  2BPG A;  4X5V A;  1FFV A;  2E8M A;  1JXL A;  1BPD A;  4J03 A;  2V4Q A;  2P66 A;  2QLT A;  4TUS A;  1ZQH A;  2OYY A;  4JMU A;  4KLF A;  9ICQ A;  1SB3 C;  4ELU A;  3QYP A;  5K4L A;  3TAD A;  5DB8 A;  2ZJ8 A;  1ECW A;  3EPI A;  3MC1 A;  3HRD D;  2BPC A;  2W7P A;  1V9P A;  4DSF A;  2YTU A;  2ALZ A;  2GWS A;  4CF4 A;  4F5P A;  3ZD9 A;  2AGO A;  2MAX A;  1JX4 A;  4OJP A;  4C7Y A;  4QZF A;  2FPK A;  2W9C B;  2E1E A;  2YY6 A;  3V6H A;  1X9W A;  4MFC A;  1IG6 A;  2YMQ A;  4Z6C A;  4C8N A;  3RTV A;  2W04 A;  5DB9 A;  1KLN A;  5AM4 A;  4CE6 A;  1F5S A;  5J0U A;  3IDW A;  1S0O A;  4NXZ A;  2W8K A;  2I9G A;  4NM2 A;  4IRC A;  3AU2 A;  4XRH A;  1KFT A;  2LYA A;  2CN1 A;  4ECQ A;  3BQ1 A;  4J9R A;  1M6Y A;  3EYZ A;  2ZUD A;  5J2D A;  4I2G A;  3ZDE A;  5C5J A;  1ZRM A;  1ZQV A;  3QNM A;  2O6K A;  4JV1 A;  5AIA A;  1KW4 A;  1SGG A;  5KFC A;  3I76 A;  5KFA A;  3SQI A;  1NJW A;  5ALL A;  4DOB A;  4EBC A;  1L7O A;  4Z6F A;  1LB2 B;  5KNI A;  2G09 A;  1L6N A;  3UXO A;  4YXJ A;  3KFU F;  2IOF A;  2XY7 A;  5KFL A;  3F5E A;  4ED1 A;  4UAZ A; 
#chains in the Genus database with same CATH homology
 2H3F A;  1CRX A;  3SAG A;  1XNS A;  2ZIX A;  2ZXI A;  4U6P A;  2ZIU B;  1ZQ1 C;  2R18 A;  2KIW A;  2G07 A;  3HKZ F;  4KX5 A;  4GFJ A;  2VJ4 A;  1YT3 A;  5C0Y A;  3H0M B;  2OYY A;  2Z7J A;  1Q3V A;  2F76 X;  2H3I A;  4NWI A;  4NLB A;  2XVT A;  3VC8 A;  2H3Q A;  2KVC A;  2KJ8 A;  4JMU A;  1T94 A;  3N7S C;  2ZXH A;  1NZB A;  1WUD A;  3M6Z A;  2ZIV B;  2HOI A;  2F8L A;  1XO0 A;  3CYM A;  2K4I A;  2ZIV A;  2XIC A;  2JGA A;  2KNJ A;  3PZP A;  4CGZ A;  2KIC A;  2KHV A;  1ECW A;  2NV3 A;  3NRW A;  1TAM A;  2K89 A;  2LHT A;  1HIW A;  1IIP A;  3CRX A;  3SAF A;  1URJ A;  3E0F A;  4KMO B;  2VKQ A;  2KHQ A;  2WAQ F;  3VCB A;  2W7P A;  2CRX A;  4O3M A;  3L3F X;  2Y0S C;  3IN5 A;  2RHF A;  3O0F A;  2E1F A;  3M6K A;  4BUG A;  2KJ9 A;  2LYB A;  3H0R B;  4OJP A;  2YB1 A;  3PSF A;  2GH1 A;  3ALR A;  2JH7 A;  2E1E A;  1ED1 A;  3RF9 A;  5KL8 B;  1PVP A;  4OJO A;  3AL0 B;  3PSI A;  5T14 A;  1MA7 A;  2YX8 A;  4QNL A;  4C0Z A;  3H0L B;  4FZL A;  3F5A A;  3AQE A;  4PL2 A;  2LBO A;  2XI9 A;  2WB1 C;  4FE3 A;  4AYB F;  3C28 A;  3F2D A;  1Z1B A;  2M0N A;  2RP5 A;  2LKY A;  2W04 A;  2ZIW A;  2JMG A;  2F2A B;  1A0P A;  2JHD A;  3PST A;  5A0L A;  2ZG6 A;  3F2C A;  2K4E A;  3N7P D;  3PSP A;  3DEE A;  1F44 A;  2HMX A;  3GU3 A;  2KJ5 A;  4A8E A;  2VIX A;  3SAH A;  3IG5 A;  2OM6 A;  2W03 A;  3GZF A;  2D6F C;  2Q4T A;  4QJF B;  4OO1 J;  2W7O A;  3T79 A;  2G0A A;  3D2S A;  4OJ5 A;  2KOB A;  4CRX A;  2KD1 A;  2G06 A;  4ICA A;  2DF4 B;  1Q3U A;  2Y0S F;  4IC9 A;  2G5I B;  2JH1 A;  2A3V A;  4P0Q B;  2K8B B;  4P0Q A;  2K8A A;  1OUQ A;  2HBM A;  3F53 A;  4FZN A;  4QIW C;  1P7D A;  1GO3 F;  2PMZ C;  2G5H B;  2CN1 A;  2H3V A;  2LYA A;  4OJL A;  3C29 A;  2ZIW B;  1UPH A;  3M7D A;  5KL1 B;  2WB1 F;  2G08 A;  1D8B A;  3IP4 B;  4BX9 C;  3MGV A;  4P0P A;  2KKV A;  5HR7 A;  2N1R A;  2H3Z A;  2VJ5 A;  2OH2 A;  2XID A;  3IG8 A;  3LYS A;  1A6S A;  2CPR A;  5CRX A;  2KKP A;  3OPX A;  2HOF A;  3HKZ C;  4KX3 A;  2K4H A;  2ZIU A;  2GOL A;  3SQI A;  2MRL A;  3LVW A;  2HBL A;  4OJ6 A;  4PL1 A;  3F2B A;  3RFA A;  4AYB C;  1DRG A;  4ACO A;  2E5S A;  3SMV A;  2HOQ A;  2KV2 A;  3D2Q A;  2OXO A;  2MA1 A;  1Z19 A;  2DGZ A;  1PVR A;  3ICX A;  3K1Z A;  4NLC A;  3N7R C;  3ONN A;  4QIW F;  5HR6 A;  3CP8 A;  2YB4 A;  4FZM A;  2PMZ F;  2HBK A;  2BDU A;  1HEK A;  3NUQ A;  1PVQ A;  2K8C B;  2G09 A;  1KBU A;  3D2N A;  4NV0 A;  3KZX A;  2F77 X;  4BJQ A;  4WJ3 B;  1L6N A;  4P0P B;  2KEY A;  2HBJ A;  4U7C A;  3KFU F;  3AQF A;  2DQN B;  1SZH A;  4CDG A;  2WAQ C;  2RRD A;  3LVV A;  3F5E A;  2ZIX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...