2H3FA

Solution structure of the hiv-1 ma protein
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
131
structure length
131
Chain Sequence
GARASVLSGGELDKWEKIRLRPGGKKQYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNTIAVLYCVHQRIDVKDTKEALDKIEEEQNKSKKKAQQAAADTGNNSQVSQNY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for targeting HIV-1 Gag proteins to the plasma membrane for virus assembly.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
molecule keywords Gag polyprotein
total genus 30
structure length 131
sequence length 131
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2006-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00540 Gag_p17 gag gene protein p17 (matrix protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.90 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2h3fA01
1ECWA 2H3FA 1UPHA 2H3IA 2H3QA 1A6SA 2N1RA 2NV3A 1L6NA 2LYAA 2JMGA 2GOLA 2K4EA 1HIWA 2K4HA 4IC9A 1HEKA 1TAMA 2H3ZA 2H3VA 1ED1A 2HMXA 2LYBA 4ICAA 4JMUA 2K4IA
chains in the Genus database with same CATH superfamily
2G06A 2ZIVA 1S0OA 3PMLA 3PVXA 5ALRA 1HJPA 4JWNA 3ISDA 2W04A 2BKEA 3NVYA 1JI7A 4CF5A 4TUSA 2KZMA 3DEEA 1Z4NA 4E0DA 1NK0A 1TAUA 3OSNA 5ALIA 4MFFA 4GFJA 2W3SA 2A19A 1FIQA 4O3SA 2B6GA 3ETLA 4YFKA 1S0VA 4US8A 3T5KA 2BHNA 5AI6A 1NK7A 5AKZA 1L3VA 4QWAA 3JPOA 2WAQF 2WF7A 9ICIA 1CUKA 5CWRA 2IOFK 1UQVA 5AKLA 1PUZA 5D49A 1BPDA 2W7PA 3E58A 4F5RA 2C2EA 2WF9A 1ZQQA 5AM1A 2BCRA 1DK2A 1RM6C 1URJA 2FI1A 4C8LA 4U6PA 4KX5A 5DQGA 1ZQUA 4NL9C 9ICJA 2ZUDA 5J2KA 4EBDA 5AM2A 1ZQPA 2MRLA 3AU2A 1L3TA 5J2JA 2F3NA 4U7CA 5L1MA 7ICGA 2L5YA 5JRTA 4PHPA 1QTMA 5DQIA 2IHNA 4A8EA 2W8LA 1N5XA 1ZQGA 3ONNA 1Q3UA 9ICNA 1F44A 7ICTA 4Q43A 3H4DA 9ICSA 1TK5A 4XQ8A 3RR8A 2E8OA 1TAMA 4QW8A 2ASDA 4KLFA 2E3TA 4DFJA 4RNOA 5AI8A 5J2BA 2KSOA 1M6YA 3QZ8A 3PSIA 3UXNA 1F5SA 1K1QA 2EAMA 2EH9A 4QJFB 2BR0A 5KG6A 4RQ3A 2E8PA 4TQSA 5T14A 5KFSA 5AI9A 1SL0A 5ALVA 1ZD3A 2IBKA 2JEJA 1LKYA 1XSPA 2KTQA 1RQLA 3PO5A 4F72A 1J2MA 2K8CB 1MA7A 3RB3A 3KFUF 2PI4A 1X6IA 1SZPA 9ICVA 5KFCA 2JZBA 4LZDA 4GXKA 3CYMA 1ZQDA 4UATA 3AQFA 3M9MB 3TARA 1IIPA 2HBMA 5IIJA 1VLBA 5KT2A 4QZDA 1V38A 5KAFU 3ZDCA 1LVHA 1RZTA 4M04A 1KFDA 2KHVA 5JU5A 5J0SA 1ZD2P 1T7PA 3Q8SB 3ZDDA 3PW2A 4M6WB 8ICAA 2YQEA 4UB1A 9ICMA 3I1YA 5KFZA 1JUDA 1NK5A 3MGHA 4KLUA 3WK7A 5KFIA 3SAFA 2KICA 2W54A 1ZQYA 3T5LA 2KKVA 3UPQA 2FPMA 3HWTA 1XO1A 3WK6A 2I9GA 5ALUA 9ICBA 1NKEA 2EAOA 4BWJA 2K4HA 3H7IA 4ECXA 2ZIVB 4QZAA 1N2XA 3O0FA 5KFBA 4KLLA 3F2BA 3VC8A 1XSLA 4O3OA 5AICA 1IV8A 4J9SA 2AGPA 3C23A 5EWGA 3OHAA 4MHVA 4EENA 2KKPA 1N48A 3MR6A 4KLJA 2HOIA 2BCUA 4JV2A 4Q8EA 3ZDBA 5KFPA 3V6HA 4MEYA 3ICXA 1K5OA 3RJKA 5J2HA 2F2AB 2JH7A 2K60A 5F9LA 5J0RA 2KN7A 3OJUA 4ED7A 3B0YA 1JX4A 8ICLA 5AKYA 3CNHA 3MR3A 1NJXA 1D9DA 3N7PD 1T3NA 3ED5A 3M1YA 3D6JA 4ECVA 3U26A 4DS5A 4IRCA 4O3PA 1L7PA 3GDXA 5AM4A 4RUAA 5EOZA 4UB2A 3M8RA 2I6XA 2BQUA 4ELUA 5AM0A 1ZQFA 3OJSA 1IG6A 1X9XA 3RTVA 4KN4A 4OJLA 1TE2A 5KFNA 4FZLA 3RRGA 2C28A 2KJ9A 2CXYA 4DLEA 5DG9A 3RB6A 4F5NA 8ICIA 8ICCA 3EW9A 5KFUA 5J0QA 3IG8A 1QQ7A 2C22A 2DL0A 5HNKA 1TK0A 3VCBA 4F5QA 1TAQA 2G09A 5AKKA 1XS9D 4OCZA 2BCSA 2M9NA 2P6RA 2BQ3A 2LI6A 4BGDA 4RUCA 4G9BA 2G5HB 5DGAA 2KIWA 1N63A 3RH6A 5J0WA 2PXIA 5IIMA 5ALQA 1ZQAA 4ECSA 1XU4A 3PW5A 3PSPA 8ICJA 1NZBA 1N61A 8ICBA 2D3DA 3V6KA 2W9BA 1ZQZA 2KZ3A 1WCLA 2HI0A 4XRHA 1S0NA 1MQ2A 5AM3A 5KG1A 1KL9A 3N97B 4NY8A 2JH1A 2I1QA 4AP9A 1U48A 4ACOA 3Q8RB 4Q45A 7ICKA 2ESEA 4MFCA 4R63A 2Y1JA 5DG7A 3SZ2A 5KG3A 4DL7A 4ECUA 3NGDA 2W3RA 2P35A 2XC9A 1NJWA 2W55A 1O08A 4O3NA 5KT4A 2EQYA 1U49A 3FC4A 4IQUA 4ED1A 4YVZA 4CE6A 2HSZA 8ICHA 1ZQBA 5F3XB 1L6NA 1NKBA 1ZD5A 3IV6A 1QQ5A 3TACB 2HHQA 9ICRA 1O03A 1SV0C 3QXGA 1NKCA 2GLEA 4RQMA 2XY7A 2EAPA 5ALZA 5KAIU 1TVAA 3RH5A 3AL0B 4BWMA 2C2DA 8ICEA 4RU9A 5KT3A 3FAHA 4RQ8A 4DOBA 3K75D 8ICWA 3RFAA 3MC1A 4DF4A 1AROP 4PHEA 1XSNA 7ICOA 1ZQLA 1U4BA 4J03A 2LKYA 4NM2A 4HYKA 3JPQA 2LM4A 3KD3A 2IA6A 5AI5A 4DOCA 3BZKA 3F2CA 4PHDA 1X42A 3SENA 3DDHA 3MR5A 3V6JA 4YD1A 4O5CA 4MEXA 4CGZA 1X9SA 2LM1A 1RQNA 4IRDA 4FO6A 1JMSA 3FDSA 4ECQA 3EZ5A 3ZI4A 5HHIA 3H4BA 1Y88A 3KKAC 4QIWF 3UXPA 2HW3A 3QUBA 4F93B 2DUYA 4JK1A 3FM9A 3OGUA 2Y9UA 3B0XA 2RDJA 1OW5A 4IL6U 1TFRA 3PMNA 2HMXA 2GO7A 4DL3A 5KTQA 3HILA 3GV5B 4JMUA 4DL5A 4GC6A 5CA7A 8ICZA 5AK5A 4RPXA 3PX4A 1DXSA 2W9MA 1ZJNA 1HUOA 3IHQB 4Y2TA 3BQTA 5BOLA 5ALOA 4FBTA 5C0YA 5ALGA 2R8JA 8ICNA 5L1IA 2F1HA 2PFOA 2KEYA 3K4GA 4ZOHC 1RYSA 5AKEA 2LBOA 9ICUA 4OJ5A 2A3VA 4O9MA 4RQ6A 5DB7A 1ZJMA 4QZBA 2PFQA 7ICFA 2YN4A 2ZIXA 1SXDA 9ICOA 4GIBA 3AQEA 5CR0A 4QZCA 2AXTU 1PVQA 3LK9A 2YY6A 5H2FU 3EYZA 1KW4A 9ICXA 3H8JA 1UCVA 1BPYA 2BCQA 2NRTA 2FPKA 3C5GA 1B4FA 4UB5A 1QQ6A 2EANA 4Y2UA 4YR3A 4QWCA 3BJYA 2OYYA 4IQVA 1WYGA 1F0MA 5KT5A 3RJHA 2H5XA 1FO4A 1ZQKA 4FZNA 3JPTA 4RT3A 1S76D 2HVHA 3MABA 3D2QA 3TAQA 3FYHA 1BNOA 3PV8A 1Q46A 3HKZC 4P0PB 4C8KA 4NLGA 2OH2A 4KLEA 4NXZA 1SV0A 4FFDA 5GTHU 4I2GA 1V85A 2ZIWA 4DS4A 4I2HA 4MF2A 5ALHA 3Q8LA 3QEBZ 2ZG6A 2EZXA 5KFHA 4ED3A 3H0LB 2Q0ZX 3UQ2A 2M0NA 1ZQXA 1TV9A 2HHVA 5GTIU 4C0ZA 2F1IA 3F5AA 5D4BA 3KKAA 3QZ7A 5AKIA 1DK3A 3MDAA 1QLNA 2F77X 4ECWA 3ISCA 2OEHA 4ECTA 3GIKA 1RXVA 1K1SA 2VJ5A 5DBCA 2ASJA 1CI4A 3EPIA 2DKZA 1ECWA 1Z00B 2ALZA 4YN4A 2XO7A 5L1JA 3CW2C 4ED0A 4FS2A 2R8GA 4RPYA 5IINA 1UA0A 2FMQA 3SAHA 1ZQIA 3PR5B 3L4PA 4YP3A 4GXJA 5J2EA 2DBYA 1SIJA 5KFLA 4K4HA 4O3MA 2CN1A 5KFEA 4Y2QA 3A0BU 4QZ8A 8ICPA 2W9CA 3KHHA 5KFFA 2DKXA 1WG8A 4JB3A 5CEHA 2JZBB 2YMMA 7ICLA 3UQ0A 1S10A 2K8AA 3RR7A 2DGZA 2ZJAA 2AQ0A 2VANA 2A1JB 1JXLA 4QZGA 3QUCA 3MGIA 1IM4A 2PMZC 2R8KA 1Z4OA 4NLCA 2KIVA 4DSFA 1L8OA 3MBYA 3RBDA 4F5OA 3BS5A 1ZOLA 4UB4A 4KLMA 2V9WA 3TQ1A 4B9MA 1MSWD 1KKXA 4DLGA 4O3RA 2AU0A 4F4XA 1KQQA 2YMQA 1SB3C 1H38A 2PFNA 3SYZA 4DFDA 2F44A 4CDGA 3UM9A 3CP8A 1JXEA 2W43A 5KFRA 4M6WA 4F91B 4B9TA 3LYSA 3G6XA 4UB8U 4J9PA 5AI0A 3V7LA 3M9NB 4UAUA 1PK1B 1XO0A 3QX7A 5ALJA 1KSPA 1VJ5A 2HHTA 4OJPA 5KFGA 2NRZA 4DL6A 4MF8A 4KLQA 5TZVA 4DEZA 4Y2JA 4ZH4A 4PZOA 4QZHA 9ICGA 2QB0B 4UB3A 4PGQA 4C8MA 2GWSA 5IILA 1N5WA 2OM6A 5BOMA 4NLBA 5EE0A 3AU6A 8ICQA 3C28A 1T4GA 3SV4A 2P6UA 1OXJA 4ECZA 1LV5A 3T3FA 8ICUA 3WK8A 3GV8B 1NJZA 4UAWA 1DOQA 1U47A 2O6KA 4RQ7A 3GV7B 1FFVA 2F8KA 1LB2B 4F50A 5J0OA 4C4RA 2BPCA 5AM5A 4QWBA 5J0UA 2HHUA 5J0TA 4B9NA 4YMNA 2GOLA 2KV2A 2DWQA 4I2AA 4O5KA 1X40A 3SEIA 4EBEA 1COKA 3QUQA 4EZ6A 1B0XA 5TISU 7ICPA 3SMVA 1SGGA 5IIIA 1ZYQA 3ZDAA 4ECYA 2JV3A 2R18A 2VJ4A 4RT2A 7ICQA 4P0QA 2HOQA 3PNCA 4RNNA 4QZEA 5HR6A 5EWEA 3CRXA 4PL2A 2BDUA 4IQTA 2KJ5A 3OSPA 4BXOB 3WU2U 5DB8A 4DSLA 4DFKA 3QU7A 1PZNA 4DL4A 2ZIWB 1KFSA 5J2IA 2KHQA 3H0MB 5J0XA 2VA2A 5EE9A 2WHEA 2QARA 2FE9A 1XC9A 2KK0A 4KLOA 5CB1A 3LVVA 4NJ8A 3SI8A 4ELVA 1X9MA 4ELTA 3BQ7A 4I2CA 5CHGA 3N28A 3RF9A 3BZCA 4Y2YA 3QEAZ 4DQIA 4F2SA 1SWVA 4NM1A 2JXJA 4XUSA 1ZQTA 2AGQA 1L7OA 3N4MB 1ED1A 2MSNA 1VDVA 2WFAA 5HMMA 4FE3A 4I27A 4BDPA 4OD0A 1ZQRA 4FBUA 3H8MA 1HUZA 3C2LA 5DBAA 2UVUA 5DKWA 5DLFA 2C2RA 5ALLA 4LZGA 2W9BB 2QB1A 4KLDA 2W9CB 1RDFA 5ALNA 4DO9A 2KJ8A 3R9KA 1N60A 5ALEA 8ICMA 3EWAA 1S5LU 2NO5A 2WAQC 1ZQJA 4LJXA 4EEYA 1TK8A 5DGBA 1ZQ1C 2YX8A 2A1JA 5KFJA 2JEIA 1B43A 5HMLA 2RHFA 1ZRNA 5L9XA 2XICA 2B0CA 4KMUA 2UVRA 3I28A 4Z6DA 5IIOA 1UT8A 4M9NA 1DGSA 3BS5B 4XA5A 3ZD8A 5DDYA 5J2GA 3E2EA 4EELA 3IN5A 2OHFA 3KHLA 2YMLA 4J9KA 1OUQA 4JUZA 1KN5A 2H3QA 3N7RC 4RQ1A 4NLZA 3TADC 8ICOA 3PR4A 2ZIUA 2XGQA 5KL8B 4M9JA 2P66A 4J9QA 2H3ZA 4DWIA 4B9VA 1L3UA 3HP6A 1V9PA 1PK1A 2BDPA 2MUTB 4F2RA 3KBBA 3QE9Y 2FLPA 1D9FA 2YMPA 5J2DA 4PL1A 2BPGA 1FEZA 5KL1B 4Z6CA 4IRKA 4FS1A 1DRGA 1XWLA 2F1JA 2G08A 1ZQWA 3Q8KA 1KLNA 8ICYA 4O3QA 3MR2A 2YB1A 4B9UA 2KP7A 3JPRA 4DSEA 4QIWC 2Q4TA 3HX0A 3SQIA 4YXJA 4IR9A 5KFTA 1A0PA 1SWWA 1PVRA 3RBEA 1QSYA 4BJQA 2V4QA 4I2EA 4KLHA 1ZQHA 3Q8PB 2JEFA 3T5HA 3H8SA 7ICHA 3RJGA 4C7ZA 7ICVA 5J2CA 4OJOA 1JALA 1COOA 7ICEA 5ALSA 1UT5A 2LHTA 2R8IA 4Q44A 1D8YA 3ISBA 5KFVA 3C29A 4DFPA 3JPSA 2HVIA 2NYVA 4PGXA 4I2BA 9ICHA 5DB9A 4OO1J 1UHUA 4I2FA 2ATLA 4IQWA 1BGXT 2LPEA 1RYUA 5J0PA 3KOOA 2R8HA 3M7DA 2ZXIA 5AIBA 3PZPA 5DG8A 1SKSA 8ICXA 2HHXA 5AHXA 9ICEA 3H0RB 2F8LA 5EE1A 4YD2A 2E5SA 4PH5A 2FMPA 4P4OA 2WB1F 3TANA 2W7OA 4O0IA 1KRPA 5HHHA 5EWFA 3RB4A 2RRDA 1KDHA 2IHMA 2XGPA 4KMOB 4Z6EA 4F5PA 3LVWA 2WB1C 4QNLA 1D8BA 2IMWP 8ICKA 3UMGA 5KFMA 3UMCA 4PHAA 2QARB 5DLGA 1ZQCA 2AH5A 4EEKA 4DF8A 2B21A 3PSFA 4KLGA 2FDRA 1BPEA 2FPLA 2KZZA 4C80A 2VA8A 4UAVA 4DSKA 1SKRA 2FJ6A 2ZIXB 1L7NA 1SV4A 2AHOB 3Q8MA 4M0AA 2H3IA 4ED2A 1S77D 4NLKA 2PKEA 5BPCA 2LYAA 4ECRA 3T5JA 2K89A 4EBCA 1WWVA 4GXIA 2WF5A 4O5EA 2Y0SC 4F4WA 4M9LA 4ED8A 3K1RB 1L8LA 2V4RA 4EYIB 3D2SA 3QU9A 3C21A 3F5EA 2HBKA 1T3QA 3NVZA 1NJYA 1C20A 2AJQA 1NK8A 2OCEA 4P0PA 1U9LA 2G07A 1YT3A 2ZJ5A 3TI0A 4QWDA 4F4KA 4C8NA 2FLLA 1Z1VA 4F8RA 1GO3F 4YG2A 2VIXA 2A1AA 3C1YA 1ZXIA 3LWLA 2JEGA 2EZZA 4F4ZA 2XVTA 4F92B 2KG5A 1N62A 3N7SC 1TKDA 4DQPA 2ZJ8A 2K8BB 1XNSA 5E79U 2PFPA 2ZXHA 4EYHB 4RQ5A 4I28A 2D8CA 2LYBA 3BS7A 3IG5A 3QYPA 4Z6FA 1JIHA 1QCKA 2MA1A 1A77A 5ALTA 1ZQMA 3V7KA 2DPIA 2BQRA 3HJEA 5G5GA 3D2NA 4YCXA 2ZUCA 4RNMA 2JMGA 3UMBA 2BGWA 3HKZF 3TFRA 1Z00A 2NO4A 4C4TA 3TKAA 5AKHA 3DV9A 4F71A 2YTUA 8ICRA 3M9OB 1UPHA 2MAXA 1SXEA 5AI4A 4LVSA 3NASA 5EE3A 2NV3A 1IXRA 2ISPA 3BDPA 2DF4B 1D8LA 5ALDA 2KNJA 4Y2VA 5AK6A 1C7YA 5CJ7A 1ZQOA 4JV0A 4HAIA 2ZTDA 9ICCA 4CNQA 1Q8KA 5CRXA 3WKDA 4R8UA 2PMZF 3PO4A 1YZ7A 5HP4A 4NWIA 3WK9A 3RAQA 8ICTA 2KD1A 4UBCA 3WKEA 3K1ZA 4DCCA 2W03A 5KFYA 4F4YA 3HPOA 4G3IA 1NZPA 3WK5A 7ICSA 3QUTA 5C5JA 2ES6A 2ZTEA 1RXWA 1WCNA 7ICUA 3PX6A 4KLIA 5AKJA 1J97A 4KITB 2ZUBA 1S8OA 7ICMA 1KFTA 3C1ZA 5KG7A 5J2FA 7ICIA 5HR7A 2CRXA 1N56A 9ICLA 4ED6A 3RJFA 1AQ6A 3IM1A 3PW0A 9ICFA 5DQHA 1V97A 4B9SA 5G5HA 3L5KA 3V7JA 1LKYB 2W8KA 3H40A 4NLNA 2G0AA 3NRWA 1SL2A 3TFSA 4R65A 4J9RA 5KG4A 2PI5A 2XI9A 3J81j 3MFHA 4F3OA 1PK3A 5KG5A 1CEZA 5KFKA 2JR5A 2IOFA 1A76A 1NK9A 1NNLA 3C2KA 4C8OA 9ICTA 4Y2SA 4TUQA 2QB0A 3I76A 4RQ0A 4OJ6A 1NK4A 2QKQA 4EX6A 1ZRMA 5ALPA 3AUOA 3HW8A 5K4LA 3SR6A 5L1KA 3OHBA 4BUGA 3V72A 7ICJA 4GLXA 4B6JA 3TAPA 4X5VA 2RQ5A 1X9WA 4QWEA 2KE7A 1KTQA 1ZQNA 1BPXA 4UW9A 2MU2A 2KOBA 1MN8A 3SAGA 2HBJA 3G6YA 4YR0A 4PZNA 4QZIA 3F53A 1U45A 1S0MA 4EZ9A 1EXNA 2HHSA 1BVSA 5AK3A 1UA1A 3THVA 7ICRA 3T79A 5DDMA 3WKAA 3IRUA 3G6VA 2BZFA 3ZDEA 1FFUA 2F76X 4FZMA 5ALKA 4DSIA 5B66U 4NL9A 3KHRA 4P2HA 1Z19A 4PPXA 2JGAA 2E1FA 3KZXA 2GH1A 1SL1A 4C4SA 5KNIA 4RPZA 1ZETA 5JUMA 4P0QB 2OXOA 4MFAA 2D6FC 4I29A 5KG2A 2Y1IA 1DGJA 5B5EU 5J29A 8ICFA 3PX0A 4BXOA 1L5UA 3KHGA 3LWMA 1QSLA 2E1EA 1SKWA 1JROA 2J6SA 4IR1A 4UB6U 1T8EA 2DFLA 4PGYA 2KMDA 2AGOA 4KLTA 2HDOA 3GILA 3QU4A 1BPZA 3JPPA 5ALYA 2EDUA 5DB6A 1NK6A 1PVPA 3RRHA 3WKCA 8ICVA 2KVCA 5ALXA 5DBBA 3BQ0A 2OWOA 3OTQA 2WF8A 3F2DA 1T94A 1JRPA 2H3VA 4CF4A 3L3FX 4JWMA 2LMRA 1KEJA 4QZ9A 2XCPA 3A0HU 4WJ3B 3RB0A 4J9MA 2J6UA 5J0YA 4KX3A 1HIWA 3WK4A 2IOHA 1ZQVA 2HHWA 2W9AA 1RG6A 5KFAA 2JRZA 5ALMA 4EX7A 2AQ4A 4Y2PA 1RPLA 1KBUA 3ALRA 2FMSA 3GFKB 4R8UB 4DQRA 4K4GA 1S97A 5IIKA 1QH9A 3HT3A 3OPXA 2BPFA 1MC8A 3QU2A 4CF3A 9ICAA 3GZFA 3C5FA 2ISOA 1WWUA 4YQWA 5J8YC 4NV0A 4DQQA 3BQ2A 9ICKA 4TURA 2NRWA 3BQ1A 4J9LA 1ZQSA 3KTQA 3AEVA 9ICPA 4KN7A 3EPGA 1L7MA 4BX9C 4KLSA 2H3FA 2KVSA 3PSTA 4J9NA 2I5HA 4I2JA 4AYBC 2UVWA 4YMMA 3QNMA 1CRXA 7ICNA 1B22A 2QLTA 2ASLA 4C7YA 2K4PA 4RQ4A 1Z1BA 1MQ3A 3TADA 4K4IA 4AYBF 2XY5A 5AKGA 4QZFA 4ICAA 2ZIUB 4UASA 3ORYA 4US9A 4DL2A 5ALFA 2W11A 5KFWA 1SZHA 3RJEA 9ICWA 4DQSA 4P4PA 1Q3VA 3E0FA 4R64A 2N1RA 4UBBA 1Z3EB 2MUTA 5ALWA 4I2DA 3IP4B 1J2NA 2G5IB 5CP2A 3PY8A 3IDWA 2Y0SF 4J9OA 4UQGA 2CPRA 2XY6A 2DPJA 3NRZA 4GC7A 4DFMA 4JV1A 3QU5A 2WF6A 4PJ0U 1P7DA 4YMOA 3WKBA 2LYHA 4Y2RA 5L1LA 2Y9TA 4M2YA 5FP0A 4B9LA 4USAA 3JPNA 3AMZA 3NS1A 4IC9A 2FLNA 1NOMA 8ICGA 1RYRA 2RDIA 3GIJA 2DQNB 2NRXA 5F9NA 1BPBA 9ICQA 2VA3A 4RQ2A 3MFIA 2HBLA 1L3SA 4P4MA 4KTQA 3AM9A 8ICSA 3GIMA 5KFQA 3NTUA 1QSSA 3MGVA 2KSOB 5KT7A 4IS7A 5KFDA 3C2MA 2HOFA 3NVVA 2JHDA 5A0LA 3NUQA 4M47A 4Y2XA 1X66A 5KG0A 3RAXA 4UAZA 3Q8QB 3RJIA 4UARA 5KFOA 1HEKA 4TUPA 2XCAA 3S6JA 2XIDA 5AKXA 3GIIA 2ZTCA 2BCVA 3RH4A 2K4IA 2EZYA 4M9HA 1BNPA 3AN1A 1A6SA 4QW9A 3KZIU 1ZD4A 4TQRA 3HRDD 2VKQA 2NRVA 2UVVA 3SD7A 5AIAA 3GQCA 4Q8FA 3PW4A 2RP5A 3ETRA 2YB4A 5KT6A 1X2IA 4UAYA 4DSJA 3M8SA 4YR2A 5J8YA 2K4EA 3SV3A 2HCFA 4I2IA 4CRXA 5JTIA 4YXMA 3UXOA 2ODGA 2KFNA 2RLTA 1YZ6A 2E8MA 2Z7JA 3M6KA 5KFXA 5D46A 3MDCA 1X6JA 1S9FA 3NVWA 5AK4A 3PW7A 4M9GA 1NI3A 4RQNA 3M6ZA 4RZRA 2J6TA 3RJJA 3GU3A 3H8WA 3ZD9A 3LDAA 2WTFA 1ZQEA 2E8NA 5J2AA 1WUDA 3EUB2 4DOAA 2KFZA 1JN3A 4R66A 4CCHA 3B9JA
chains in the Genus database with same CATH topology
2E5SA 2H3FA 3SAFA 1OUQA 2G06A 2ZG6A 2KICA 2WB1F 2H3QA 2ZIVA 3LYSA 2OXOA 3N7RC 3IG8A 3PSTA 4P0QB 2XVTA 2W7OA 5HR7A 2CRXA 3H0LB 2KKVA 2M0NA 2ZIWB 4AYBC 2D6FC 2ZIUA 1L6NA 3VCBA 3PSIA 4C0ZA 1XO0A 5KL8B 3N7SC 2RRDA 3F5AA 1CRXA 2W04A 5C0YA 2KHQA 4OJPA 4KMOB 3H0MB 2K4HA 2K8BB 2G09A 1HEKA 2ZIVB 1Z1BA 1XNSA 2KEYA 2F77X 2H3ZA 2ZXHA 3LVWA 3DEEA 3O0FA 2WB1C 2E1EA 4QNLA 2G0AA 2XIDA 3VC8A 4AYBF 4QJFB 3NRWA 3F2BA 3AL0B 2LYBA 2VJ5A 3IG5A 2ZIUB 4ICAA 2LBOA 3LVVA 3IN5A 1D8BA 4GFJA 4OJ5A 5T14A 2A3VA 2K4IA 2XI9A 1SZHA 1ECWA 4PL1A 5KL1B 2MA1A 1DRGA 1Q3VA 2G08A 1A6SA 3E0FA 2G5HB 2OM6A 2N1RA 3RFAA 2KIWA 3D2NA 4NLBA 1PVPA 2YB1A 2ZIXA 3C28A 2JMGA 2VKQA 3HKZF 2K8CB 3IP4B 3AQEA 3RF9A 1MA7A 2G5IB 4QIWC 2KKPA 2WAQF 3PSFA 1PVQA 2KVCA 2Q4TA 3KFUF 3SAHA 2LKYA 4OJ6A 3SQIA 2Y0SF 1A0PA 3F2DA 1T94A 2HOIA 3PSPA 2CPRA 2H3VA 1ED1A 2RP5A 3L3FX 2ZIXB 4BUGA 1PVRA 3F2CA 4BJQA 3ICXA 1NZBA 4O3MA 2YB4A 2CN1A 2W7PA 1UPHA 3CYMA 1P7DA 2H3IA 2F2AB 4CGZA 4WJ3B 2JH7A 4FE3A 2NV3A 3AQFA 4OJOA 2DF4B 2OYYA 2LYAA 2KNJA 1URJA 2GOLA 2K4EA 2K89A 4KX3A 2LHTA 2KV2A 2KOBA 1HIWA 4U6PA 4KX5A 1IIPA 2HBMA 2HBJA 4IC9A 3SAGA 2K8AA 3C29A 4CRXA 2DGZA 3F53A 4FZNA 5CRXA 2JH1A 3N7PD 2KJ8A 2Y0SC 2MRLA 2Z7JA 3M6KA 4OO1J 4ACOA 2PMZF 3D2QA 2PMZC 2WAQC 2DQNB 4QIWF 4U7CA 2VIXA 3HKZC 2KHVA 4NWIA 3T79A 4P0PB 3D2SA 2OH2A 2HBLA 4NLCA 3SMVA 1KBUA 3ALRA 1ZQ1C 2YX8A 4A8EA 2KD1A 3F5EA 2HBKA 2R18A 2F76X 3K1ZA 3ONNA 4FZMA 3M7DA 2ZXIA 3M6ZA 2W03A 2RHFA 3PZPA 1Q3UA 2VJ4A 3OPXA 2XICA 1F44A 4P0PA 3GU3A 2G07A 3GZFA 1YT3A 4P0QA 2HOQA 3MGVA 4NV0A 1TAMA 1Z19A 4CDGA 5HR6A 4OJLA 1WUDA 2ZIWA 3CRXA 2JGAA 3H0RB 4FZLA 2HMXA 2E1FA 3CP8A 3KZXA 2GH1A 4PL2A 2BDUA 2F8LA 2HOFA 2KJ5A 1GO3F 2JHDA 2KJ9A 4BX9C 4JMUA 5A0LA 3NUQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ECW A;  2H3F A;  1UPH A;  2H3I A;  2H3Q A;  1A6S A;  2N1R A;  2NV3 A;  1L6N A;  2LYA A;  2JMG A;  2GOL A;  2K4E A;  1HIW A;  2K4H A;  4IC9 A;  1HEK A;  1TAM A;  2H3Z A;  2H3V A;  1ED1 A;  2HMX A;  2LYB A;  4ICA A;  4JMU A;  2K4I A; 
#chains in the Genus database with same CATH topology
 2G06 A;  2ZIV A;  1S0O A;  3PML A;  3PVX A;  5ALR A;  1HJP A;  4JWN A;  3ISD A;  2W04 A;  2BKE A;  3NVY A;  1JI7 A;  4CF5 A;  4TUS A;  2KZM A;  3DEE A;  1Z4N A;  4E0D A;  1NK0 A;  1TAU A;  3OSN A;  5ALI A;  4MFF A;  4GFJ A;  2W3S A;  2A19 A;  1FIQ A;  4O3S A;  2B6G A;  3ETL A;  4YFK A;  1S0V A;  4US8 A;  3T5K A;  2BHN A;  5AI6 A;  1NK7 A;  5AKZ A;  1L3V A;  4QWA A;  3JPO A;  2WAQ F;  2WF7 A;  9ICI A;  1CUK A;  5CWR A;  2IOF K;  1UQV A;  5AKL A;  1PUZ A;  5D49 A;  1BPD A;  2W7P A;  3E58 A;  4F5R A;  2C2E A;  2WF9 A;  1ZQQ A;  5AM1 A;  2BCR A;  1DK2 A;  1RM6 C;  1URJ A;  2FI1 A;  4C8L A;  4U6P A;  4KX5 A;  5DQG A;  1ZQU A;  4NL9 C;  9ICJ A;  2ZUD A;  5J2K A;  4EBD A;  5AM2 A;  1ZQP A;  2MRL A;  3AU2 A;  1L3T A;  5J2J A;  2F3N A;  4U7C A;  5L1M A;  7ICG A;  2L5Y A;  5JRT A;  4PHP A;  1QTM A;  5DQI A;  2IHN A;  4A8E A;  2W8L A;  1N5X A;  1ZQG A;  3ONN A;  1Q3U A;  9ICN A;  1F44 A;  7ICT A;  4Q43 A;  3H4D A;  9ICS A;  1TK5 A;  4XQ8 A;  3RR8 A;  2E8O A;  1TAM A;  4QW8 A;  2ASD A;  4KLF A;  2E3T A;  4DFJ A;  4RNO A;  5AI8 A;  5J2B A;  2KSO A;  1M6Y A;  3QZ8 A;  3PSI A;  3UXN A;  1F5S A;  1K1Q A;  2EAM A;  2EH9 A;  4QJF B;  2BR0 A;  5KG6 A;  4RQ3 A;  2E8P A;  4TQS A;  5T14 A;  5KFS A;  5AI9 A;  1SL0 A;  5ALV A;  1ZD3 A;  2IBK A;  2JEJ A;  1LKY A;  1XSP A;  2KTQ A;  1RQL A;  3PO5 A;  4F72 A;  1J2M A;  2K8C B;  1MA7 A;  3RB3 A;  3KFU F;  2PI4 A;  1X6I A;  1SZP A;  9ICV A;  5KFC A;  2JZB A;  4LZD A;  4GXK A;  3CYM A;  1ZQD A;  4UAT A;  3AQF A;  3M9M B;  3TAR A;  1IIP A;  2HBM A;  5IIJ A;  1VLB A;  5KT2 A;  4QZD A;  1V38 A;  5KAF U;  3ZDC A;  1LVH A;  1RZT A;  4M04 A;  1KFD A;  2KHV A;  5JU5 A;  5J0S A;  1ZD2 P;  1T7P A;  3Q8S B;  3ZDD A;  3PW2 A;  4M6W B;  8ICA A;  2YQE A;  4UB1 A;  9ICM A;  3I1Y A;  5KFZ A;  1JUD A;  1NK5 A;  3MGH A;  4KLU A;  3WK7 A;  5KFI A;  3SAF A;  2KIC A;  2W54 A;  1ZQY A;  3T5L A;  2KKV A;  3UPQ A;  2FPM A;  3HWT A;  1XO1 A;  3WK6 A;  2I9G A;  5ALU A;  9ICB A;  1NKE A;  2EAO A;  4BWJ A;  2K4H A;  3H7I A;  4ECX A;  2ZIV B;  4QZA A;  1N2X A;  3O0F A;  5KFB A;  4KLL A;  3F2B A;  3VC8 A;  1XSL A;  4O3O A;  5AIC A;  1IV8 A;  4J9S A;  2AGP A;  3C23 A;  5EWG A;  3OHA A;  4MHV A;  4EEN A;  2KKP A;  1N48 A;  3MR6 A;  4KLJ A;  2HOI A;  2BCU A;  4JV2 A;  4Q8E A;  3ZDB A;  5KFP A;  3V6H A;  4MEY A;  3ICX A;  1K5O A;  3RJK A;  5J2H A;  2F2A B;  2JH7 A;  2K60 A;  5F9L A;  5J0R A;  2KN7 A;  3OJU A;  4ED7 A;  3B0Y A;  1JX4 A;  8ICL A;  5AKY A;  3CNH A;  3MR3 A;  1NJX A;  1D9D A;  3N7P D;  1T3N A;  3ED5 A;  3M1Y A;  3D6J A;  4ECV A;  3U26 A;  4DS5 A;  4IRC A;  4O3P A;  1L7P A;  3GDX A;  5AM4 A;  4RUA A;  5EOZ A;  4UB2 A;  3M8R A;  2I6X A;  2BQU A;  4ELU A;  5AM0 A;  1ZQF A;  3OJS A;  1IG6 A;  1X9X A;  3RTV A;  4KN4 A;  4OJL A;  1TE2 A;  5KFN A;  4FZL A;  3RRG A;  2C28 A;  2KJ9 A;  2CXY A;  4DLE A;  5DG9 A;  3RB6 A;  4F5N A;  8ICI A;  8ICC A;  3EW9 A;  5KFU A;  5J0Q A;  3IG8 A;  1QQ7 A;  2C22 A;  2DL0 A;  5HNK A;  1TK0 A;  3VCB A;  4F5Q A;  1TAQ A;  2G09 A;  5AKK A;  1XS9 D;  4OCZ A;  2BCS A;  2M9N A;  2P6R A;  2BQ3 A;  2LI6 A;  4BGD A;  4RUC A;  4G9B A;  2G5H B;  5DGA A;  2KIW A;  1N63 A;  3RH6 A;  5J0W A;  2PXI A;  5IIM A;  5ALQ A;  1ZQA A;  4ECS A;  1XU4 A;  3PW5 A;  3PSP A;  8ICJ A;  1NZB A;  1N61 A;  8ICB A;  2D3D A;  3V6K A;  2W9B A;  1ZQZ A;  2KZ3 A;  1WCL A;  2HI0 A;  4XRH A;  1S0N A;  1MQ2 A;  5AM3 A;  5KG1 A;  1KL9 A;  3N97 B;  4NY8 A;  2JH1 A;  2I1Q A;  4AP9 A;  1U48 A;  4ACO A;  3Q8R B;  4Q45 A;  7ICK A;  2ESE A;  4MFC A;  4R63 A;  2Y1J A;  5DG7 A;  3SZ2 A;  5KG3 A;  4DL7 A;  4ECU A;  3NGD A;  2W3R A;  2P35 A;  2XC9 A;  1NJW A;  2W55 A;  1O08 A;  4O3N A;  5KT4 A;  2EQY A;  1U49 A;  3FC4 A;  4IQU A;  4ED1 A;  4YVZ A;  4CE6 A;  2HSZ A;  8ICH A;  1ZQB A;  5F3X B;  1L6N A;  1NKB A;  1ZD5 A;  3IV6 A;  1QQ5 A;  3TAC B;  2HHQ A;  9ICR A;  1O03 A;  1SV0 C;  3QXG A;  1NKC A;  2GLE A;  4RQM A;  2XY7 A;  2EAP A;  5ALZ A;  5KAI U;  1TVA A;  3RH5 A;  3AL0 B;  4BWM A;  2C2D A;  8ICE A;  4RU9 A;  5KT3 A;  3FAH A;  4RQ8 A;  4DOB A;  3K75 D;  8ICW A;  3RFA A;  3MC1 A;  4DF4 A;  1ARO P;  4PHE A;  1XSN A;  7ICO A;  1ZQL A;  1U4B A;  4J03 A;  2LKY A;  4NM2 A;  4HYK A;  3JPQ A;  2LM4 A;  3KD3 A;  2IA6 A;  5AI5 A;  4DOC A;  3BZK A;  3F2C A;  4PHD A;  1X42 A;  3SEN A;  3DDH A;  3MR5 A;  3V6J A;  4YD1 A;  4O5C A;  4MEX A;  4CGZ A;  1X9S A;  2LM1 A;  1RQN A;  4IRD A;  4FO6 A;  1JMS A;  3FDS A;  4ECQ A;  3EZ5 A;  3ZI4 A;  5HHI A;  3H4B A;  1Y88 A;  3KKA C;  4QIW F;  3UXP A;  2HW3 A;  3QUB A;  4F93 B;  2DUY A;  4JK1 A;  3FM9 A;  3OGU A;  2Y9U A;  3B0X A;  2RDJ A;  1OW5 A;  4IL6 U;  1TFR A;  3PMN A;  2HMX A;  2GO7 A;  4DL3 A;  5KTQ A;  3HIL A;  3GV5 B;  4JMU A;  4DL5 A;  4GC6 A;  5CA7 A;  8ICZ A;  5AK5 A;  4RPX A;  3PX4 A;  1DXS A;  2W9M A;  1ZJN A;  1HUO A;  3IHQ B;  4Y2T A;  3BQT A;  5BOL A;  5ALO A;  4FBT A;  5C0Y A;  5ALG A;  2R8J A;  8ICN A;  5L1I A;  2F1H A;  2PFO A;  2KEY A;  3K4G A;  4ZOH C;  1RYS A;  5AKE A;  2LBO A;  9ICU A;  4OJ5 A;  2A3V A;  4O9M A;  4RQ6 A;  5DB7 A;  1ZJM A;  4QZB A;  2PFQ A;  7ICF A;  2YN4 A;  2ZIX A;  1SXD A;  9ICO A;  4GIB A;  3AQE A;  5CR0 A;  4QZC A;  2AXT U;  1PVQ A;  3LK9 A;  2YY6 A;  5H2F U;  3EYZ A;  1KW4 A;  9ICX A;  3H8J A;  1UCV A;  1BPY A;  2BCQ A;  2NRT A;  2FPK A;  3C5G A;  1B4F A;  4UB5 A;  1QQ6 A;  2EAN A;  4Y2U A;  4YR3 A;  4QWC A;  3BJY A;  2OYY A;  4IQV A;  1WYG A;  1F0M A;  5KT5 A;  3RJH A;  2H5X A;  1FO4 A;  1ZQK A;  4FZN A;  3JPT A;  4RT3 A;  1S76 D;  2HVH A;  3MAB A;  3D2Q A;  3TAQ A;  3FYH A;  1BNO A;  3PV8 A;  1Q46 A;  3HKZ C;  4P0P B;  4C8K A;  4NLG A;  2OH2 A;  4KLE A;  4NXZ A;  1SV0 A;  4FFD A;  5GTH U;  4I2G A;  1V85 A;  2ZIW A;  4DS4 A;  4I2H A;  4MF2 A;  5ALH A;  3Q8L A;  3QEB Z;  2ZG6 A;  2EZX A;  5KFH A;  4ED3 A;  3H0L B;  2Q0Z X;  3UQ2 A;  2M0N A;  1ZQX A;  1TV9 A;  2HHV A;  5GTI U;  4C0Z A;  2F1I A;  3F5A A;  5D4B A;  3KKA A;  3QZ7 A;  5AKI A;  1DK3 A;  3MDA A;  1QLN A;  2F77 X;  4ECW A;  3ISC A;  2OEH A;  4ECT A;  3GIK A;  1RXV A;  1K1S A;  2VJ5 A;  5DBC A;  2ASJ A;  1CI4 A;  3EPI A;  2DKZ A;  1ECW A;  1Z00 B;  2ALZ A;  4YN4 A;  2XO7 A;  5L1J A;  3CW2 C;  4ED0 A;  4FS2 A;  2R8G A;  4RPY A;  5IIN A;  1UA0 A;  2FMQ A;  3SAH A;  1ZQI A;  3PR5 B;  3L4P A;  4YP3 A;  4GXJ A;  5J2E A;  2DBY A;  1SIJ A;  5KFL A;  4K4H A;  4O3M A;  2CN1 A;  5KFE A;  4Y2Q A;  3A0B U;  4QZ8 A;  8ICP A;  2W9C A;  3KHH A;  5KFF A;  2DKX A;  1WG8 A;  4JB3 A;  5CEH A;  2JZB B;  2YMM A;  7ICL A;  3UQ0 A;  1S10 A;  2K8A A;  3RR7 A;  2DGZ A;  2ZJA A;  2AQ0 A;  2VAN A;  2A1J B;  1JXL A;  4QZG A;  3QUC A;  3MGI A;  1IM4 A;  2PMZ C;  2R8K A;  1Z4O A;  4NLC A;  2KIV A;  4DSF A;  1L8O A;  3MBY A;  3RBD A;  4F5O A;  3BS5 A;  1ZOL A;  4UB4 A;  4KLM A;  2V9W A;  3TQ1 A;  4B9M A;  1MSW D;  1KKX A;  4DLG A;  4O3R A;  2AU0 A;  4F4X A;  1KQQ A;  2YMQ A;  1SB3 C;  1H38 A;  2PFN A;  3SYZ A;  4DFD A;  2F44 A;  4CDG A;  3UM9 A;  3CP8 A;  1JXE A;  2W43 A;  5KFR A;  4M6W A;  4F91 B;  4B9T A;  3LYS A;  3G6X A;  4UB8 U;  4J9P A;  5AI0 A;  3V7L A;  3M9N B;  4UAU A;  1PK1 B;  1XO0 A;  3QX7 A;  5ALJ A;  1KSP A;  1VJ5 A;  2HHT A;  4OJP A;  5KFG A;  2NRZ A;  4DL6 A;  4MF8 A;  4KLQ A;  5TZV A;  4DEZ A;  4Y2J A;  4ZH4 A;  4PZO A;  4QZH A;  9ICG A;  2QB0 B;  4UB3 A;  4PGQ A;  4C8M A;  2GWS A;  5IIL A;  1N5W A;  2OM6 A;  5BOM A;  4NLB A;  5EE0 A;  3AU6 A;  8ICQ A;  3C28 A;  1T4G A;  3SV4 A;  2P6U A;  1OXJ A;  4ECZ A;  1LV5 A;  3T3F A;  8ICU A;  3WK8 A;  3GV8 B;  1NJZ A;  4UAW A;  1DOQ A;  1U47 A;  2O6K A;  4RQ7 A;  3GV7 B;  1FFV A;  2F8K A;  1LB2 B;  4F50 A;  5J0O A;  4C4R A;  2BPC A;  5AM5 A;  4QWB A;  5J0U A;  2HHU A;  5J0T A;  4B9N A;  4YMN A;  2GOL A;  2KV2 A;  2DWQ A;  4I2A A;  4O5K A;  1X40 A;  3SEI A;  4EBE A;  1COK A;  3QUQ A;  4EZ6 A;  1B0X A;  5TIS U;  7ICP A;  3SMV A;  1SGG A;  5III A;  1ZYQ A;  3ZDA A;  4ECY A;  2JV3 A;  2R18 A;  2VJ4 A;  4RT2 A;  7ICQ A;  4P0Q A;  2HOQ A;  3PNC A;  4RNN A;  4QZE A;  5HR6 A;  5EWE A;  3CRX A;  4PL2 A;  2BDU A;  4IQT A;  2KJ5 A;  3OSP A;  4BXO B;  3WU2 U;  5DB8 A;  4DSL A;  4DFK A;  3QU7 A;  1PZN A;  4DL4 A;  2ZIW B;  1KFS A;  5J2I A;  2KHQ A;  3H0M B;  5J0X A;  2VA2 A;  5EE9 A;  2WHE A;  2QAR A;  2FE9 A;  1XC9 A;  2KK0 A;  4KLO A;  5CB1 A;  3LVV A;  4NJ8 A;  3SI8 A;  4ELV A;  1X9M A;  4ELT A;  3BQ7 A;  4I2C A;  5CHG A;  3N28 A;  3RF9 A;  3BZC A;  4Y2Y A;  3QEA Z;  4DQI A;  4F2S A;  1SWV A;  4NM1 A;  2JXJ A;  4XUS A;  1ZQT A;  2AGQ A;  1L7O A;  3N4M B;  1ED1 A;  2MSN A;  1VDV A;  2WFA A;  5HMM A;  4FE3 A;  4I27 A;  4BDP A;  4OD0 A;  1ZQR A;  4FBU A;  3H8M A;  1HUZ A;  3C2L A;  5DBA A;  2UVU A;  5DKW A;  5DLF A;  2C2R A;  5ALL A;  4LZG A;  2W9B B;  2QB1 A;  4KLD A;  2W9C B;  1RDF A;  5ALN A;  4DO9 A;  2KJ8 A;  3R9K A;  1N60 A;  5ALE A;  8ICM A;  3EWA A;  1S5L U;  2NO5 A;  2WAQ C;  1ZQJ A;  4LJX A;  4EEY A;  1TK8 A;  5DGB A;  1ZQ1 C;  2YX8 A;  2A1J A;  5KFJ A;  2JEI A;  1B43 A;  5HML A;  2RHF A;  1ZRN A;  5L9X A;  2XIC A;  2B0C A;  4KMU A;  2UVR A;  3I28 A;  4Z6D A;  5IIO A;  1UT8 A;  4M9N A;  1DGS A;  3BS5 B;  4XA5 A;  3ZD8 A;  5DDY A;  5J2G A;  3E2E A;  4EEL A;  3IN5 A;  2OHF A;  3KHL A;  2YML A;  4J9K A;  1OUQ A;  4JUZ A;  1KN5 A;  2H3Q A;  3N7R C;  4RQ1 A;  4NLZ A;  3TAD C;  8ICO A;  3PR4 A;  2ZIU A;  2XGQ A;  5KL8 B;  4M9J A;  2P66 A;  4J9Q A;  2H3Z A;  4DWI A;  4B9V A;  1L3U A;  3HP6 A;  1V9P A;  1PK1 A;  2BDP A;  2MUT B;  4F2R A;  3KBB A;  3QE9 Y;  2FLP A;  1D9F A;  2YMP A;  5J2D A;  4PL1 A;  2BPG A;  1FEZ A;  5KL1 B;  4Z6C A;  4IRK A;  4FS1 A;  1DRG A;  1XWL A;  2F1J A;  2G08 A;  1ZQW A;  3Q8K A;  1KLN A;  8ICY A;  4O3Q A;  3MR2 A;  2YB1 A;  4B9U A;  2KP7 A;  3JPR A;  4DSE A;  4QIW C;  2Q4T A;  3HX0 A;  3SQI A;  4YXJ A;  4IR9 A;  5KFT A;  1A0P A;  1SWW A;  1PVR A;  3RBE A;  1QSY A;  4BJQ A;  2V4Q A;  4I2E A;  4KLH A;  1ZQH A;  3Q8P B;  2JEF A;  3T5H A;  3H8S A;  7ICH A;  3RJG A;  4C7Z A;  7ICV A;  5J2C A;  4OJO A;  1JAL A;  1COO A;  7ICE A;  5ALS A;  1UT5 A;  2LHT A;  2R8I A;  4Q44 A;  1D8Y A;  3ISB A;  5KFV A;  3C29 A;  4DFP A;  3JPS A;  2HVI A;  2NYV A;  4PGX A;  4I2B A;  9ICH A;  5DB9 A;  4OO1 J;  1UHU A;  4I2F A;  2ATL A;  4IQW A;  1BGX T;  2LPE A;  1RYU A;  5J0P A;  3KOO A;  2R8H A;  3M7D A;  2ZXI A;  5AIB A;  3PZP A;  5DG8 A;  1SKS A;  8ICX A;  2HHX A;  5AHX A;  9ICE A;  3H0R B;  2F8L A;  5EE1 A;  4YD2 A;  2E5S A;  4PH5 A;  2FMP A;  4P4O A;  2WB1 F;  3TAN A;  2W7O A;  4O0I A;  1KRP A;  5HHH A;  5EWF A;  3RB4 A;  2RRD A;  1KDH A;  2IHM A;  2XGP A;  4KMO B;  4Z6E A;  4F5P A;  3LVW A;  2WB1 C;  4QNL A;  1D8B A;  2IMW P;  8ICK A;  3UMG A;  5KFM A;  3UMC A;  4PHA A;  2QAR B;  5DLG A;  1ZQC A;  2AH5 A;  4EEK A;  4DF8 A;  2B21 A;  3PSF A;  4KLG A;  2FDR A;  1BPE A;  2FPL A;  2KZZ A;  4C80 A;  2VA8 A;  4UAV A;  4DSK A;  1SKR A;  2FJ6 A;  2ZIX B;  1L7N A;  1SV4 A;  2AHO B;  3Q8M A;  4M0A A;  2H3I A;  4ED2 A;  1S77 D;  4NLK A;  2PKE A;  5BPC A;  2LYA A;  4ECR A;  3T5J A;  2K89 A;  4EBC A;  1WWV A;  4GXI A;  2WF5 A;  4O5E A;  2Y0S C;  4F4W A;  4M9L A;  4ED8 A;  3K1R B;  1L8L A;  2V4R A;  4EYI B;  3D2S A;  3QU9 A;  3C21 A;  3F5E A;  2HBK A;  1T3Q A;  3NVZ A;  1NJY A;  1C20 A;  2AJQ A;  1NK8 A;  2OCE A;  4P0P A;  1U9L A;  2G07 A;  1YT3 A;  2ZJ5 A;  3TI0 A;  4QWD A;  4F4K A;  4C8N A;  2FLL A;  1Z1V A;  4F8R A;  1GO3 F;  4YG2 A;  2VIX A;  2A1A A;  3C1Y A;  1ZXI A;  3LWL A;  2JEG A;  2EZZ A;  4F4Z A;  2XVT A;  4F92 B;  2KG5 A;  1N62 A;  3N7S C;  1TKD A;  4DQP A;  2ZJ8 A;  2K8B B;  1XNS A;  5E79 U;  2PFP A;  2ZXH A;  4EYH B;  4RQ5 A;  4I28 A;  2D8C A;  2LYB A;  3BS7 A;  3IG5 A;  3QYP A;  4Z6F A;  1JIH A;  1QCK A;  2MA1 A;  1A77 A;  5ALT A;  1ZQM A;  3V7K A;  2DPI A;  2BQR A;  3HJE A;  5G5G A;  3D2N A;  4YCX A;  2ZUC A;  4RNM A;  2JMG A;  3UMB A;  2BGW A;  3HKZ F;  3TFR A;  1Z00 A;  2NO4 A;  4C4T A;  3TKA A;  5AKH A;  3DV9 A;  4F71 A;  2YTU A;  8ICR A;  3M9O B;  1UPH A;  2MAX A;  1SXE A;  5AI4 A;  4LVS A;  3NAS A;  5EE3 A;  2NV3 A;  1IXR A;  2ISP A;  3BDP A;  2DF4 B;  1D8L A;  5ALD A;  2KNJ A;  4Y2V A;  5AK6 A;  1C7Y A;  5CJ7 A;  1ZQO A;  4JV0 A;  4HAI A;  2ZTD A;  9ICC A;  4CNQ A;  1Q8K A;  5CRX A;  3WKD A;  4R8U A;  2PMZ F;  3PO4 A;  1YZ7 A;  5HP4 A;  4NWI A;  3WK9 A;  3RAQ A;  8ICT A;  2KD1 A;  4UBC A;  3WKE A;  3K1Z A;  4DCC A;  2W03 A;  5KFY A;  4F4Y A;  3HPO A;  4G3I A;  1NZP A;  3WK5 A;  7ICS A;  3QUT A;  5C5J A;  2ES6 A;  2ZTE A;  1RXW A;  1WCN A;  7ICU A;  3PX6 A;  4KLI A;  5AKJ A;  1J97 A;  4KIT B;  2ZUB A;  1S8O A;  7ICM A;  1KFT A;  3C1Z A;  5KG7 A;  5J2F A;  7ICI A;  5HR7 A;  2CRX A;  1N56 A;  9ICL A;  4ED6 A;  3RJF A;  1AQ6 A;  3IM1 A;  3PW0 A;  9ICF A;  5DQH A;  1V97 A;  4B9S A;  5G5H A;  3L5K A;  3V7J A;  1LKY B;  2W8K A;  3H40 A;  4NLN A;  2G0A A;  3NRW A;  1SL2 A;  3TFS A;  4R65 A;  4J9R A;  5KG4 A;  2PI5 A;  2XI9 A;  3J81 j;  3MFH A;  4F3O A;  1PK3 A;  5KG5 A;  1CEZ A;  5KFK A;  2JR5 A;  2IOF A;  1A76 A;  1NK9 A;  1NNL A;  3C2K A;  4C8O A;  9ICT A;  4Y2S A;  4TUQ A;  2QB0 A;  3I76 A;  4RQ0 A;  4OJ6 A;  1NK4 A;  2QKQ A;  4EX6 A;  1ZRM A;  5ALP A;  3AUO A;  3HW8 A;  5K4L A;  3SR6 A;  5L1K A;  3OHB A;  4BUG A;  3V72 A;  7ICJ A;  4GLX A;  4B6J A;  3TAP A;  4X5V A;  2RQ5 A;  1X9W A;  4QWE A;  2KE7 A;  1KTQ A;  1ZQN A;  1BPX A;  4UW9 A;  2MU2 A;  2KOB A;  1MN8 A;  3SAG A;  2HBJ A;  3G6Y A;  4YR0 A;  4PZN A;  4QZI A;  3F53 A;  1U45 A;  1S0M A;  4EZ9 A;  1EXN A;  2HHS A;  1BVS A;  5AK3 A;  1UA1 A;  3THV A;  7ICR A;  3T79 A;  5DDM A;  3WKA A;  3IRU A;  3G6V A;  2BZF A;  3ZDE A;  1FFU A;  2F76 X;  4FZM A;  5ALK A;  4DSI A;  5B66 U;  4NL9 A;  3KHR A;  4P2H A;  1Z19 A;  4PPX A;  2JGA A;  2E1F A;  3KZX A;  2GH1 A;  1SL1 A;  4C4S A;  5KNI A;  4RPZ A;  1ZET A;  5JUM A;  4P0Q B;  2OXO A;  4MFA A;  2D6F C;  4I29 A;  5KG2 A;  2Y1I A;  1DGJ A;  5B5E U;  5J29 A;  8ICF A;  3PX0 A;  4BXO A;  1L5U A;  3KHG A;  3LWM A;  1QSL A;  2E1E A;  1SKW A;  1JRO A;  2J6S A;  4IR1 A;  4UB6 U;  1T8E A;  2DFL A;  4PGY A;  2KMD A;  2AGO A;  4KLT A;  2HDO A;  3GIL A;  3QU4 A;  1BPZ A;  3JPP A;  5ALY A;  2EDU A;  5DB6 A;  1NK6 A;  1PVP A;  3RRH A;  3WKC A;  8ICV A;  2KVC A;  5ALX A;  5DBB A;  3BQ0 A;  2OWO A;  3OTQ A;  2WF8 A;  3F2D A;  1T94 A;  1JRP A;  2H3V A;  4CF4 A;  3L3F X;  4JWM A;  2LMR A;  1KEJ A;  4QZ9 A;  2XCP A;  3A0H U;  4WJ3 B;  3RB0 A;  4J9M A;  2J6U A;  5J0Y A;  4KX3 A;  1HIW A;  3WK4 A;  2IOH A;  1ZQV A;  2HHW A;  2W9A A;  1RG6 A;  5KFA A;  2JRZ A;  5ALM A;  4EX7 A;  2AQ4 A;  4Y2P A;  1RPL A;  1KBU A;  3ALR A;  2FMS A;  3GFK B;  4R8U B;  4DQR A;  4K4G A;  1S97 A;  5IIK A;  1QH9 A;  3HT3 A;  3OPX A;  2BPF A;  1MC8 A;  3QU2 A;  4CF3 A;  9ICA A;  3GZF A;  3C5F A;  2ISO A;  1WWU A;  4YQW A;  5J8Y C;  4NV0 A;  4DQQ A;  3BQ2 A;  9ICK A;  4TUR A;  2NRW A;  3BQ1 A;  4J9L A;  1ZQS A;  3KTQ A;  3AEV A;  9ICP A;  4KN7 A;  3EPG A;  1L7M A;  4BX9 C;  4KLS A;  2H3F A;  2KVS A;  3PST A;  4J9N A;  2I5H A;  4I2J A;  4AYB C;  2UVW A;  4YMM A;  3QNM A;  1CRX A;  7ICN A;  1B22 A;  2QLT A;  2ASL A;  4C7Y A;  2K4P A;  4RQ4 A;  1Z1B A;  1MQ3 A;  3TAD A;  4K4I A;  4AYB F;  2XY5 A;  5AKG A;  4QZF A;  4ICA A;  2ZIU B;  4UAS A;  3ORY A;  4US9 A;  4DL2 A;  5ALF A;  2W11 A;  5KFW A;  1SZH A;  3RJE A;  9ICW A;  4DQS A;  4P4P A;  1Q3V A;  3E0F A;  4R64 A;  2N1R A;  4UBB A;  1Z3E B;  2MUT A;  5ALW A;  4I2D A;  3IP4 B;  1J2N A;  2G5I B;  5CP2 A;  3PY8 A;  3IDW A;  2Y0S F;  4J9O A;  4UQG A;  2CPR A;  2XY6 A;  2DPJ A;  3NRZ A;  4GC7 A;  4DFM A;  4JV1 A;  3QU5 A;  2WF6 A;  4PJ0 U;  1P7D A;  4YMO A;  3WKB A;  2LYH A;  4Y2R A;  5L1L A;  2Y9T A;  4M2Y A;  5FP0 A;  4B9L A;  4USA A;  3JPN A;  3AMZ A;  3NS1 A;  4IC9 A;  2FLN A;  1NOM A;  8ICG A;  1RYR A;  2RDI A;  3GIJ A;  2DQN B;  2NRX A;  5F9N A;  1BPB A;  9ICQ A;  2VA3 A;  4RQ2 A;  3MFI A;  2HBL A;  1L3S A;  4P4M A;  4KTQ A;  3AM9 A;  8ICS A;  3GIM A;  5KFQ A;  3NTU A;  1QSS A;  3MGV A;  2KSO B;  5KT7 A;  4IS7 A;  5KFD A;  3C2M A;  2HOF A;  3NVV A;  2JHD A;  5A0L A;  3NUQ A;  4M47 A;  4Y2X A;  1X66 A;  5KG0 A;  3RAX A;  4UAZ A;  3Q8Q B;  3RJI A;  4UAR A;  5KFO A;  1HEK A;  4TUP A;  2XCA A;  3S6J A;  2XID A;  5AKX A;  3GII A;  2ZTC A;  2BCV A;  3RH4 A;  2K4I A;  2EZY A;  4M9H A;  1BNP A;  3AN1 A;  1A6S A;  4QW9 A;  3KZI U;  1ZD4 A;  4TQR A;  3HRD D;  2VKQ A;  2NRV A;  2UVV A;  3SD7 A;  5AIA A;  3GQC A;  4Q8F A;  3PW4 A;  2RP5 A;  3ETR A;  2YB4 A;  5KT6 A;  1X2I A;  4UAY A;  4DSJ A;  3M8S A;  4YR2 A;  5J8Y A;  2K4E A;  3SV3 A;  2HCF A;  4I2I A;  4CRX A;  5JTI A;  4YXM A;  3UXO A;  2ODG A;  2KFN A;  2RLT A;  1YZ6 A;  2E8M A;  2Z7J A;  3M6K A;  5KFX A;  5D46 A;  3MDC A;  1X6J A;  1S9F A;  3NVW A;  5AK4 A;  3PW7 A;  4M9G A;  1NI3 A;  4RQN A;  3M6Z A;  4RZR A;  2J6T A;  3RJJ A;  3GU3 A;  3H8W A;  3ZD9 A;  3LDA A;  2WTF A;  1ZQE A;  2E8N A;  5J2A A;  1WUD A;  3EUB 2;  4DOA A;  2KFZ A;  1JN3 A;  4R66 A;  4CCH A;  3B9J A; 
#chains in the Genus database with same CATH homology
 2E5S A;  2H3F A;  3SAF A;  1OUQ A;  2G06 A;  2ZG6 A;  2KIC A;  2WB1 F;  2H3Q A;  2ZIV A;  3LYS A;  2OXO A;  3N7R C;  3IG8 A;  3PST A;  4P0Q B;  2XVT A;  2W7O A;  5HR7 A;  2CRX A;  3H0L B;  2KKV A;  2M0N A;  2ZIW B;  4AYB C;  2D6F C;  2ZIU A;  1L6N A;  3VCB A;  3PSI A;  4C0Z A;  1XO0 A;  5KL8 B;  3N7S C;  2RRD A;  3F5A A;  1CRX A;  2W04 A;  5C0Y A;  2KHQ A;  4OJP A;  4KMO B;  3H0M B;  2K4H A;  2K8B B;  2G09 A;  1HEK A;  2ZIV B;  1Z1B A;  1XNS A;  2KEY A;  2F77 X;  2H3Z A;  2ZXH A;  3LVW A;  3DEE A;  3O0F A;  2WB1 C;  2E1E A;  4QNL A;  2G0A A;  2XID A;  3VC8 A;  4AYB F;  4QJF B;  3NRW A;  3F2B A;  3AL0 B;  2LYB A;  2VJ5 A;  3IG5 A;  2ZIU B;  4ICA A;  2LBO A;  3LVV A;  3IN5 A;  1D8B A;  4GFJ A;  4OJ5 A;  5T14 A;  2A3V A;  2K4I A;  2XI9 A;  1SZH A;  1ECW A;  4PL1 A;  5KL1 B;  2MA1 A;  1DRG A;  1Q3V A;  2G08 A;  1A6S A;  3E0F A;  2G5H B;  2OM6 A;  2N1R A;  3RFA A;  2KIW A;  3D2N A;  4NLB A;  1PVP A;  2YB1 A;  2ZIX A;  3C28 A;  2JMG A;  2VKQ A;  3HKZ F;  2K8C B;  3IP4 B;  3AQE A;  3RF9 A;  1MA7 A;  2G5I B;  4QIW C;  2KKP A;  2WAQ F;  3PSF A;  1PVQ A;  2KVC A;  2Q4T A;  3KFU F;  3SAH A;  2LKY A;  4OJ6 A;  3SQI A;  2Y0S F;  1A0P A;  3F2D A;  1T94 A;  2HOI A;  3PSP A;  2CPR A;  2H3V A;  1ED1 A;  2RP5 A;  3L3F X;  2ZIX B;  4BUG A;  1PVR A;  3F2C A;  4BJQ A;  3ICX A;  1NZB A;  4O3M A;  2YB4 A;  2CN1 A;  2W7P A;  1UPH A;  3CYM A;  1P7D A;  2H3I A;  2F2A B;  4CGZ A;  4WJ3 B;  2JH7 A;  4FE3 A;  2NV3 A;  3AQF A;  4OJO A;  2DF4 B;  2OYY A;  2LYA A;  2KNJ A;  1URJ A;  2GOL A;  2K4E A;  2K89 A;  4KX3 A;  2LHT A;  2KV2 A;  2KOB A;  1HIW A;  4U6P A;  4KX5 A;  1IIP A;  2HBM A;  2HBJ A;  4IC9 A;  3SAG A;  2K8A A;  3C29 A;  4CRX A;  2DGZ A;  3F53 A;  4FZN A;  5CRX A;  2JH1 A;  3N7P D;  2KJ8 A;  2Y0S C;  2MRL A;  2Z7J A;  3M6K A;  4OO1 J;  4ACO A;  2PMZ F;  3D2Q A;  2PMZ C;  2WAQ C;  2DQN B;  4QIW F;  4U7C A;  2VIX A;  3HKZ C;  2KHV A;  4NWI A;  3T79 A;  4P0P B;  3D2S A;  2OH2 A;  2HBL A;  4NLC A;  3SMV A;  1KBU A;  3ALR A;  1ZQ1 C;  2YX8 A;  4A8E A;  2KD1 A;  3F5E A;  2HBK A;  2R18 A;  2F76 X;  3K1Z A;  3ONN A;  4FZM A;  3M7D A;  2ZXI A;  3M6Z A;  2W03 A;  2RHF A;  3PZP A;  1Q3U A;  2VJ4 A;  3OPX A;  2XIC A;  1F44 A;  4P0P A;  3GU3 A;  2G07 A;  3GZF A;  1YT3 A;  4P0Q A;  2HOQ A;  3MGV A;  4NV0 A;  1TAM A;  1Z19 A;  4CDG A;  5HR6 A;  4OJL A;  1WUD A;  2ZIW A;  3CRX A;  2JGA A;  3H0R B;  4FZL A;  2HMX A;  2E1F A;  3CP8 A;  3KZX A;  2GH1 A;  4PL2 A;  2BDU A;  2F8L A;  2HOF A;  2KJ5 A;  1GO3 F;  2JHD A;  2KJ9 A;  4BX9 C;  4JMU A;  5A0L A;  3NUQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...