2H3FA

Solution structure of the hiv-1 ma protein
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
131
structure length
131
Chain Sequence
GARASVLSGGELDKWEKIRLRPGGKKQYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNTIAVLYCVHQRIDVKDTKEALDKIEEEQNKSKKKAQQAAADTGNNSQVSQNY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gag polyprotein
publication title Structural basis for targeting HIV-1 Gag proteins to the plasma membrane for virus assembly.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 30
structure length 131
sequence length 131
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2006-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00540 Gag_p17 gag gene protein p17 (matrix protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.90 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2h3fA01
2H3VA 4JMUA 1HEKA 2JMGA 2H3ZA 2K4EA 2LYAA 2K4IA 2H3FA 2K4HA 1TAMA 2HMXA 2N1RA 1HIWA 1UPHA 4ICAA 4IC9A 2H3IA 2H3QA 1A6SA 1ED1A 2LYBA 1L6NA 2GOLA 2NV3A 1ECWA
chains in the Genus database with same CATH superfamily
2I5HA 2XGQA 3T5LA 2P35A 1WUDA 1UA1A 4Z6DA 1ZQCA 1BGXT 3WK8A 3ETRA 2C22A 3LDAA 2E8OA 2H3QA 1WCLA 3MR3A 3SAGA 1NI3A 4BJQA 4UAUA 2G08A 4F5RA 7ICSA 1RYUA 4RUCA 1X9SA 5J2IA 3V7JA 2HBJA 5AIBA 1VJ5A 2K8BB 3FM9A 4PH5A 3AU6A 3G6VA 8ICWA 4Q8FA 2Y0SC 5JRTA 5KFUA 3UXNA 2BKEA 2CPRA 1S0MA 8ICGA 5F3XB 2K89A 2ASJA 3NRWA 4ECUA 4J9PA 2ZIWB 3MGVA 4DL5A 2Q4TA 3ZDEA 3C2KA 1VDVA 2G5IB 2WF7A 3DEEA 2R8KA 3N7RC 1ZQZA 4I2JA 2WF6A 4DFJA 3LVWA 2XVTA 4F5PA 1KFDA 3ETLA 2R18A 1D9DA 2IHNA 4RQ4A 3RJGA 5KG4A 9ICXA 3WKCA 1NK8A 1KBUA 2MUTB 4KLUA 4RQ7A 5KFSA 4NY8A 4KN7A 4GXIA 3Q8MA 2WF5A 4FZMA 3C2LA 4TUPA 4Y2PA 3HJEA 4UB6U 2PMZC 1L6NA 1NK5A 1Q3VA 4USAA 1ZQNA 3TAQA 1TV9A 1WCNA 5AKHA 3RRHA 5ALZA 2R8HA 1S76D 4F5NA 5KT3A 1O03A 1TFRA 4Z6FA 3RJJA 1JI7A 2W9BB 5AI9A 9ICIA 4DSEA 2BCUA 8ICHA 2KKVA 2MU2A 3KD3A 5ALGA 2YX8A 2Y1IA 2HOFA 2JH7A 2QARA 3PSFA 1SV0A 1ZQLA 3A0HU 1K5OA 1JX4A 3KZXA 4BX9C 4KLHA 4RZRA 4OD0A 1XC9A 4F3OA 2FE9A 2FPLA 3HKZC 2E5SA 3NVWA 4M6WA 1YZ6A 2ODGA 3PO5A 4UB2A 1KFSA 3D2NA 3AEVA 2KFZA 4DL2A 1URJA 2WF9A 2ZIUA 2KG5A 3RAQA 4CF3A 2W7PA 2HCFA 8ICCA 1ZD5A 2ZIVB 2QKQA 7ICOA 4IC9A 5IIKA 4O3RA 1ECWA 3EW9A 4GLXA 1WG8A 1NKBA 4PZNA 3TARA 1IM4A 1X6JA 7ICTA 1KEJA 5AK6A 5KFTA 2FMPA 1SKWA 3HW8A 3TADC 3AM9A 4GXJA 3KHHA 7ICFA 5CR0A 1X9WA 3PMLA 1CRXA 3ZI4A 5L1KA 9ICEA 4DF4A 1SL1A 3S6JA 1UT8A 2NRTA 1Z19A 4F71A 4CCHA 3KOOA 4PL2A 3V6JA 3PW0A 1Z3EB 2HHTA 2W55A 4C7ZA 4Y2JA 2HHQA 2KP7A 1ZQTA 2ZXIA 9ICUA 5DG8A 4R66A 1U47A 1KTQA 3PMNA 5AKYA 3H8WA 1FFUA 4YCXA 3BS5B 2KJ5A 1JXEA 2K4PA 4GIBA 1XSPA 2EAMA 4QZAA 4C8KA 2FPMA 2K8AA 3WKEA 4C8NA 5J8YA 2DBYA 2JXJA 3NS1A 2DKXA 2K4HA 2JEJA 2GH1A 2IHMA 2W9MA 1ZQQA 5FP0A 4M9NA 1WWVA 9ICLA 4R64A 2B21A 4Y2QA 4M9GA 1VLBA 4Z6EA 5DGBA 1XO1A 1YT3A 2F3NA 2BCQA 4F72A 3FAHA 2OHFA 1X9XA 1L3UA 2D8CA 5D4BA 4DSFA 1J2MA 1ZQJA 1AQ6A 2O6KA 2E3TA 3R9KA 3QXGA 4EYHB 5DG7A 4JMUA 4CNQA 3N28A 2PXIA 3MDAA 4DOCA 4YMMA 4R65A 3OGUA 3GFKB 1RQLA 3BS7A 3QUTA 5AIAA 2BZFA 4KLQA 3B0YA 1SWVA 2UVVA 1EXNA 4ED2A 3SMVA 4P4PA 2ZIXB 4OJ5A 4Y2XA 3EYZA 3UMCA 8ICSA 9ICBA 5AI6A 4DSIA 4QWCA 4F50A 5DB9A 4RUAA 1SV4A 2F44A 2DL0A 2HSZA 4RQMA 1Z1VA 2IBKA 1KFTA 4F91B 4UW9A 1L8OA 3ZDAA 1ZQKA 7ICVA 4QZFA 1ZQSA 1QQ6A 5HR7A 4O3OA 2YMPA 2XY5A 1Z00B 2B0CA 4A8EA 4J9KA 2M9NA 4NLZA 4R8UB 4RNOA 5KFBA 2LPEA 2XCPA 4PGYA 2IOFA 2BDUA 4F92B 1S9FA 1SWWA 2J6TA 3BQ2A 3GILA 2C2DA 5AI8A 1ZQIA 1ZD3A 3PSTA 4IR1A 2I1QA 5AI4A 4PZOA 2YQEA 5ALJA 4ECXA 5EWFA 2RP5A 4RU9A 5D46A 5KT4A 1KQQA 3I1YA 1CEZA 4MF2A 2GO7A 4RNMA 4EBEA 5CHGA 3LWLA 4DQPA 2RDIA 5ALEA 5HNKA 2WFAA 5JU5A 7ICHA 1GO3F 4NM2A 3MFIA 1WWUA 4YD2A 3MGHA 2FI1A 1CI4A 3F2BA 4PHPA 5DB6A 4LZDA 1L7MA 3BZKA 5KT2A 3T5KA 2HOQA 5KFAA 1TAQA 4OJLA 4DSLA 2E8MA 1L7OA 2N1RA 1SKRA 2DUYA 2KVSA 2BCSA 5DG9A 3Q8SB 2DPIA 9ICNA 1ZQGA 2UVUA 2QB1A 4XUSA 4ED7A 3AUOA 3E2EA 1PVQA 4EX6A 5KFXA 1LVHA 5CJ7A 3SZ2A 4ECRA 5IILA 5J2BA 3SYZA 1L7PA 1OXJA 5L9XA 1X6IA 2AXTU 3ISCA 5EE3A 4B6JA 3RJHA 5IINA 1JRPA 1UPHA 4P0QB 1S0VA 3EZ5A 2H3IA 3PSIA 3PY8A 1DGSA 3NTUA 4DL6A 4YMNA 2DWQA 3KKAC 5AI0A 1MSWD 1DK3A 4RT3A 2DGZA 1SKSA 5DBCA 4DSJA 5KG0A 1NKEA 2BGWA 4RNNA 5KFIA 1QSSA 4IS7A 2RRDA 5KFYA 2IA6A 2W3SA 4QZ9A 1RZTA 2HBMA 3OJUA 3JPSA 3ISBA 5HMLA 1NK4A 1ZQVA 1NK9A 2WTFA 3LWMA 5DGAA 3MR5A 2WAQC 4C80A 4OO1J 3V7KA 4J9OA 4RQ6A 3N97B 4HAIA 1RDFA 1H38A 3C5GA 2E1FA 2OH2A 1XS9D 1N2XA 2DFLA 5KL8B 5KFCA 3AMZA 3IN5A 2PMZF 3G6YA 3C1ZA 5ALUA 4BXOB 5ALDA 4F4YA 3H8MA 2FLNA 1J97A 1RM6C 4F4WA 5KFDA 3SD7A 2KD1A 1BPYA 2KHVA 3NVZA 1ZQMA 2ZUCA 3N7SC 4I2BA 3UPQA 5KFMA 4DFMA 2F2AB 3RH4A 4KLDA 4UB3A 2YMMA 5KFRA 3IM1A 5HP4A 1Y88A 3MDCA 3QYPA 2IOHA 3WK9A 2FLLA 3HILA 7ICGA 5D49A 1SXDA 1TKDA 8ICNA 3SI8A 8ICTA 4EEYA 4MF8A 1TAMA 2KIVA 2V4RA 4OCZA 1L3SA 5IIOA 1N62A 2AGOA 4DOBA 3M7DA 4O3QA 1Z4NA 3BQ7A 2HI0A 3TKAA 5J2DA 3AL0B 1XWLA 5KFHA 3UQ0A 4ECYA 3RJIA 3ZD9A 4JV0A 1LB2B 5HR6A 1U9LA 2W9BA 3RR8A 1L7NA 2DKZA 4GC7A 1N48A 5ALPA 2VA2A 4OJOA 4PPXA 2G07A 1ZQEA 3GV8B 5CB1A 4F2RA 2GLEA 1KLNA 2LYBA 4I27A 3E58A 7ICRA 4XRHA 2AU0A 2HHVA 2ATLA 3RJFA 2C2RA 4YN4A 7ICQA 2WHEA 2EANA 3PSPA 3RFAA 9ICTA 5ALRA 1WYGA 3HRDD 9ICMA 2H5XA 5KT7A 4NLCA 4EENA 4QZDA 4RQ1A 2NO5A 3AU2A 5BOMA 2XGPA 3H4DA 5AHXA 5B5EU 4NV0A 4FZLA 3V6HA 2D6FC 2W03A 4B9VA 4DQSA 4ZH4A 1MN8A 4U7CA 1DGJA 1F5SA 2ZIVA 2DF4B 2YB4A 2HHWA 4C8OA 2KMDA 5J29A 4P4MA 4FBUA 4I2GA 1ZYQA 4NLBA 1T3NA 3WK7A 4UB4A 4NLKA 2OEHA 4NLGA 1KDHA 1IIPA 4R63A 1X9MA 4JUZA 4KLOA 2NYVA 1ZD2P 5ALWA 4J9SA 2HVHA 5B66U 2OWOA 5ALXA 3RBEA 2FLPA 2KSOB 4O5EA 4M2YA 2E8PA 1U45A 4DFKA 3U26A 3PW4A 3NGDA 4I2HA 4KLEA 1L3VA 3TACB 3RB3A 5ALTA 4BDPA 5AK5A 1BPDA 3K75D 3QU2A 1BNPA 3Q8PB 3MFHA 1T4GA 2JZBB 3DDHA 5BPCA 2LYHA 3BS5A 2UVRA 4QWDA 1ZQPA 4QIWC 3GIIA 3K4GA 3GU3A 5KG3A 2G09A 3J81j 4DS5A 4B9UA 1XSNA 3PR4A 3QU9A 3FYHA 4KMOB 2W8LA 1SIJA 1B22A 2CRXA 5J2GA 2F1JA 2JEIA 5TZVA 5AKLA 4ED0A 4JV2A 2J6UA 2HMXA 5J2KA 2JHDA 5KG6A 1LV5A 8ICQA 2JH1A 2W11A 3TFRA 4ECSA 3Q8QB 7ICJA 3AN1A 5L1IA 2OXOA 2AH5A 5HHIA 5DBAA 1XU4A 1JXLA 3N4MB 3PVXA 1F0MA 2GWSA 3KBBA 1B4FA 9ICCA 5J0PA 3GV5B 4FZNA 3JPTA 4UB1A 4KLLA 5KFWA 1KL9A 3QUBA 4NWIA 1ZQUA 4FS1A 3RAXA 5J2AA 2KFNA 1NZBA 4YQWA 5L1LA 5IIMA 1FO4A 4YR3A 3PV8A 4BWJA 5KFVA 1UQVA 4EZ6A 2ZIXA 9ICOA 2E1EA 1COOA 2ZJ5A 1KRPA 2H3VA 2LHTA 3PZPA 3UM9A 2W7OA 5ALLA 1IXRA 1ZRNA 2FDRA 2JGAA 5EOZA 4QZGA 5DQGA 2W54A 1T7PA 2IMWP 2EZYA 2EZZA 4QZCA 4QZBA 2DPJA 4M47A 4ECZA 8ICBA 1T8EA 3TADA 4M9JA 3M9OB 1PK3A 1Z00A 3RB6A 4R8UA 1V97A 3BQ0A 4QWAA 5KFGA 4TURA 3KTQA 1KSPA 3UMBA 2KKPA 2NRWA 1NJWA 3EPIA 2B6GA 5ALIA 1S0OA 4HYKA 3ORYA 2GOLA 5KFJA 1ZQFA 3OJSA 4KX3A 5AKJA 2W8KA 5JTIA 4IRDA 2KEYA 5J0TA 2F8KA 1A76A 1ZQDA 2K4EA 1U49A 2Z7JA 4RPZA 2YN4A 5DLFA 2W9CA 4J03A 5AKEA 3DV9A 3OHBA 3RH5A 2PFPA 4YD1A 4DOAA 1S77D 1S8OA 1O08A 1SL0A 3TAPA 2ZXHA 3BQTA 4JK1A 1ZQXA 4CE6A 2JMGA 1ZQRA 3ONNA 4RT2A 5KG1A 3T5HA 4PGXA 9ICGA 5EE1A 4NXZA 2OM6A 1KN5A 2FJ6A 4NL9C 4DF8A 4DCCA 2FMSA 2EAOA 4RQ3A 2WB1F 4F4ZA 1BPZA 3JPOA 2EAPA 2WAQF 2F1IA 1X42A 5E79U 5AM1A 2E8NA 4I2EA 2ALZA 2UVWA 4M9HA 2AGQA 5EE9A 4P0QA 1JROA 1IG6A 1P7DA 4DFDA 3IRUA 3WU2U 2I6XA 2G0AA 4LZGA 2XICA 1PVRA 4I2AA 4ACOA 4C4RA 5KFPA 1ZQAA 5J2JA 5DDYA 3TI0A 2XI9A 4JB3A 1QSYA 4UAVA 1ZJNA 4RPXA 3PW2A 3C21A 3L4PA 4LJXA 1X66A 3BJYA 1NZPA 4U6PA 2MRLA 2ZTCA 1KKXA 2JEFA 4YFKA 4DQIA 3CNHA 4DFPA 5ALVA 1XSLA 3OPXA 4J9MA 3RJKA 2FPKA 4YXMA 2A1JB 5G5GA 3GDXA 1V9PA 1DXSA 5J0OA 5IIJA 3T5JA 4BXOA 4KLFA 2HW3A 9ICJA 2W9CB 1KW4A 4ZOHC 5AK3A 4KX5A 4ED1A 1F44A 3WK4A 4FFDA 4UB8U 1QQ7A 4IQTA 4FS2A 3C28A 2ZJ8A 1DOQA 2YB1A 4EZ9A 4QZEA 2VANA 4KN4A 3GIMA 3M9MB 4F4XA 1U48A 5IIIA 3QU7A 4DS4A 4CRXA 1B0XA 3M8RA 3UXOA 1DK2A 3PR5B 2AHOB 3RB4A 3FC4A 1JN3A 1QCKA 2AQ0A 2LYAA 4KITB 4MEXA 1TVAA 8ICAA 7ICLA 5KTQA 4MFAA 2Y0SF 5GTHU 3SAFA 1K1QA 2RHFA 5AKKA 5AKXA 2NV3A 2LKYA 4Q43A 7ICEA 2MSNA 3G6XA 5CRXA 3PX6A 2JV3A 5ALKA 9ICRA 1D8BA 3HP6A 3C29A 4EBDA 2KN7A 4GFJA 4KMUA 5AM5A 1Q46A 4O3MA 2F77X 1AROP 1ZXIA 1LKYB 3K1ZA 4JWNA 3IP4B 4B9NA 8ICUA 4YVZA 1YZ7A 5DQHA 5EWEA 5KFFA 1RXVA 3KFUF 1NOMA 4UAZA 2KOBA 1TE2A 3KKAA 1PUZA 2KNJA 2J6SA 3K1RB 4IQVA 2YMQA 4B9TA 4J9LA 3JPRA 3V6KA 2ASDA 5KAIU 2IOFK 4O0IA 3UQ2A 1SZPA 3PW5A 4DL4A 3PX4A 4US9A 5EWGA 1RYRA 3EUB2 5L1MA 1JALA 4QWEA 3H40A 2F8LA 1D9FA 4IQWA 3RH6A 2XCAA 3F53A 5TISU 2BCVA 1D8LA 5J0XA 4UBBA 2W9AA 2RLTA 4ELTA 8ICPA 5ALYA 2BQUA 1A77A 4O5CA 1FFVA 5KT5A 5T14A 4KLGA 1XNSA 5KFKA 4K4HA 3QZ7A 3RR7A 3C1YA 3JPPA 2JEGA 3OTQA 4I2DA 2ZUBA 3QU5A 2KSOA 4C0ZA 4MFFA 2KV2A 3HKZF 4EYIB 2KTQA 5ALSA 1JMSA 3LVVA 2PKEA 4KTQA 1JUDA 1UCVA 2CN1A 3TQ1A 2PFNA 1SB3C 1MA7A 5HMMA 4F2SA 1X2IA 3CRXA 2JZBA 4RQ5A 4I29A 5A0LA 5AKGA 5AICA 4QZHA 4PHEA 4ECWA 3ZD8A 3L3FX 4BWMA 1V85A 5CEHA 3SEIA 4UATA 4M9LA 4OJ6A 2P6UA 4AYBC 2DQNB 1COKA 4RQNA 2HHUA 2BPGA 4TQRA 2HHXA 2KJ8A 3CYMA 1UA0A 3V72A 5F9LA 3JPNA 1Q8KA 2PI5A 3F2DA 2ZUDA 4B9SA 2LM4A 4EBCA 3BQ1A 3ISDA 4MHVA 1BPBA 3MBYA 5HHHA 1N61A 3C2MA 3F5EA 5AM2A 4KLMA 3C5FA 3HPOA 3SENA 2JR5A 3VC8A 4C8LA 4DO9A 4P0PA 3SV4A 1PZNA 2WF8A 2Y9UA 1T94A 8ICOA 3SAHA 4KLIA 2K60A 1N63A 2LBOA 2EQYA 4CGZA 4IR9A 8ICMA 1QQ5A 3AQEA 4B9LA 1C7YA 3WK6A 1C20A 1TK5A 1UHUA 3SR6A 1X40A 1ZD4A 3QUCA 3EWAA 3GQCA 4UB5A 3LYSA 2NRVA 3M9NB 1TK8A 5ALHA 2L5YA 5KFQA 3AQFA 3IHQB 5KAFU 3KZIU 5KG7A 1T3QA 3GIKA 1S0NA 5J0YA 8ICVA 4UBCA 3H4BA 4YMOA 3JPQA 8ICJA 1FEZA 4X5VA 4XQ8A 2KJ9A 2XIDA 4F4KA 4DLEA 4DWIA 2H3ZA 5ALMA 4NM1A 2MA1A 3ZDCA 5DDMA 2KE7A 2H3FA 4B9MA 2VKQA 4DQQA 2BPCA 4ICAA 3LK9A 2KIWA 4OJPA 4PHAA 1SV0C 8ICRA 2F1HA 5JUMA 5EE0A 4GXKA 2BCRA 4M0AA 1L5UA 5L1JA 2HBKA 4ELUA 4UAYA 5KFOA 3BDPA 1JIHA 4UAWA 3C23A 4GC6A 1BPEA 4Y2RA 2R8IA 8ICZA 4RQ0A 2VA3A 3MC1A 3WK5A 4MFCA 4BUGA 3SQIA 3RBDA 3CP8A 3IDWA 2F76X 2CXYA 2ZTDA 4FBTA 4ED3A 3OSPA 4Y2YA 4P0PB 2NRXA 3O0FA 4J9NA 2I9GA 1QSLA 3OSNA 1MQ2A 9ICAA 4IL6U 4NJ8A 3MR2A 3MR6A 4C4TA 1CUKA 3NUQA 2BQ3A 4UARA 4O5KA 4Q8EA 4K4GA 4KLJA 1DRGA 5KFNA 5J2HA 2XO7A 4I2IA 4QNLA 8ICLA 2KVCA 5AM0A 3QX7A 4YR2A 3M8SA 2EH9A 2R8GA 4IRKA 5J0SA 2AGPA 1TK0A 2AQ4A 4QZ8A 4DQRA 1A6SA 1PK1A 3B9JA 3UXPA 1XO0A 2ISPA 4E0DA 3ED5A 1HEKA 5DB8A 4TUSA 4JV1A 2VJ5A 4MEYA 3MGIA 2W43A 5J2CA 3HX0A 2ZJAA 2Q0ZX 7ICPA 7ICIA 5KFZA 8ICKA 1A0PA 5J8YC 5DQIA 4K4IA 4O3NA 4F93B 4YG2A 5AKZA 2C28A 2ES6A 3WKAA 2LMRA 4KLTA 5DLGA 1SXEA 1QH9A 1HIWA 3PX0A 1FIQA 4C4SA 2PFOA 2KK0A 5AKIA 4Y2SA 2YY6A 5AM3A 2R8JA 2RDJA 4Q44A 4DLGA 2QARB 4ED8A 2PI4A 2A1JA 5H2FU 3FDSA 4TQSA 3B0XA 5J0QA 5KG2A 4CF5A 5CWRA 1MQ3A 2JRZA 3IV6A 3QEBZ 4YXJA 9ICFA 4EEKA 9ICWA 2A3VA 5ALNA 3NASA 4PJ0U 1BVSA 2V9WA 4XA5A 4M6WB 2HVIA 4Y2UA 4QZIA 2OYYA 3RB0A 1HUZA 5ALQA 4Y2VA 1Z1BA 3EPGA 2BHNA 4NLNA 7ICUA 3SV3A 9ICQA 2ZIUB 3GV7B 2C2EA 2NO4A 3PNCA 2BDPA 2VJ4A 1IV8A 4BGDA 1NJZA 1NKCA 3H8JA 1PK1B 9ICVA 1M6YA 4IRCA 8ICFA 2W04A 3THVA 3E0FA 1RQNA 2QLTA 1ZQ1C 8ICXA 2VA8A 4F8RA 4KLSA 1ZQOA 3NVYA 3KHLA 2A1AA 1SL2A 3MABA 2W3RA 4NL9A 2PFQA 2QB0A 9ICKA 4DL7A 4I2FA 1Z4OA 2ZG6A 1K1SA 3ALRA 2HBLA 2P6RA 5J2EA 5J0WA 4O9MA 3UMGA 3TANA 4G3IA 3T79A 3IG8A 1NK0A 3HWTA 5DKWA 1LKYA 2BPFA 3QU4A 5G5HA 5K4LA 3GIJA 4F5OA 5J0RA 1RXWA 2M0NA 2ISOA 2A19A 1HUOA 3M6KA 1NK7A 2XY7A 2P66A 1N5XA 2HHSA 2RQ5A 2ZTEA 3M6ZA 1NK6A 3F2CA 5BOLA 3RRGA 4UASA 5F9NA 2Y1JA 3RF9A 1RPLA 3PW7A 4Q45A 3Q8LA 2V4QA 3M1YA 4Y2TA 4PGQA 1QLNA 3BZCA 3VCBA 5KNIA 3TFSA 5CA7A 7ICNA 2G06A 4JWMA 5C0YA 1U4BA 4C7YA 3D2SA 3QNMA 3Q8RB 4AYBF 2KZMA 4ED6A 3V7LA 2LI6A 1S97A 4PHDA 1NJXA 3H8SA 8ICYA 4IQUA 1ED1A 2LM1A 1PVPA 1ZQWA 3QZ8A 7ICKA 1BPXA 3WKBA 2VIXA 3NRZA 5KG5A 3HT3A 5KT6A 4YR0A 4QW9A 2K4IA 3H7IA 2KICA 2NRZA 4ECQA 1S5LU 1L8LA 2ASLA 4QWBA 9ICPA 4EELA 5AM4A 3OHAA 4DL3A 3ZDBA 1ZQHA 8ICEA 3KHRA 2QB0B 1D8YA 2K8CB 4RPYA 3PO4A 5J0UA 4ECTA 1QTMA 1BNOA 3WKDA 1TAUA 3RTVA 4QJFB 4PL1A 4O3SA 7ICMA 4DSKA 4CDGA 3QE9Y 4P4OA 2BQRA 4I2CA 4P2HA 4ELVA 1UT5A 5ALOA 3CW2C 3NVVA 1ZQBA 1RG6A 1OUQA 4YP3A 2FMQA 2YMLA 3I76A 2WB1C 1RYSA 4J9RA 3QUQA 5KL1B 5DBBA 4RQ8A 2XC9A 3H0LB 4O3PA 2MAXA 4FO6A 4FE3A 4F5QA 3I28A 2KZ3A 5AK4A 4ECVA 5KFLA 4QIWF 1HJPA 5AI5A 4QW8A 3IG5A 5C5JA 4LVSA 9ICSA 3Q8KA 2EZXA 1NNLA 3D6JA 3L5KA 3H0RB 5GTIU 1OW5A 3GZFA 3N7PD 1SZHA 3A0BU 5CP2A 1MC8A 2D3DA 2ZIWA 1B43A 3H0MB 1ZJMA 1N60A 4M04A 4TUQA 2HDOA 2KHQA 2OCEA 4I28A 1J2NA 2Y9TA 3KHGA 1ZETA 1ZQYA 4AP9A 1V38A 3F5AA 1ZRMA 2YTUA 3ICXA 3T3FA 2KZZA 1N5WA 4Z6CA 2BR0A 3RJEA 2G5HB 2EDUA 2MUTA 1S10A 4CF4A 3ZDDA 2AJQA 1Q3UA 3D2QA 4DEZA 5J2FA 2ESEA 1L3TA 9ICHA 4RQ2A 4UQGA 2HOIA 5ALFA 4EX7A 1ZOLA 4C8MA 5KFEA 4G9BA 3QEAZ 5DB7A 1N56A 8ICIA 1NJYA 4WJ3B 2XY6A 4US8A 1SGGA 4J9QA
chains in the Genus database with same CATH topology
4NWIA 2F76X 1T94A 2JMGA 2M0NA 3ONNA 3SAHA 4PL2A 1WUDA 4P0PB 3C28A 3O0FA 2LBOA 2F8LA 3M6KA 2ZXIA 4CGZA 1NZBA 3AQEA 3M6ZA 2OM6A 3F53A 1TAMA 2YB1A 3F2CA 1UPHA 4P0QB 1OUQA 3NUQA 2H3IA 2H3QA 2WB1F 2KKVA 2ZIXA 3PSIA 2A3VA 2E1EA 5T14A 3RF9A 3M7DA 2KJ5A 2YX8A 1XNSA 1DRGA 3SAGA 4CRXA 2WAQF 2WB1C 3LYSA 5KL1B 2OYYA 5HR7A 4BJQA 2HOFA 2JH7A 2G08A 1Z1BA 3AL0B 3AQFA 2H3VA 3PSFA 3H0LB 2DGZA 3VCBA 4QNLA 2LHTA 4A8EA 2G06A 5C0YA 4FE3A 2KVCA 2K8AA 3PZPA 2W7OA 2HBJA 2ZIUB 3KZXA 2LYAA 4C0ZA 2K8BB 2JGAA 4BX9C 3D2SA 5HR6A 2BDUA 4QIWF 2KV2A 2RRDA 3HKZF 4P0QA 2K4HA 3IG5A 4AYBF 2GH1A 4QIWC 2HBMA 2Y0SF 3HKZC 2VJ4A 2E5SA 4OJOA 3LVVA 3SAFA 3GU3A 3PSTA 1P7DA 2G07A 1A6SA 2G09A 1ED1A 3H0RB 2Y0SC 1XO0A 2CN1A 2G0AA 2RHFA 1PVPA 2LYBA 3GZFA 2XICA 3D2NA 1MA7A 2RP5A 1SZHA 2NV3A 3N7PD 2CPRA 1PVRA 2LKYA 2KJ9A 2XIDA 2ZIWA 4ACOA 1HEKA 3H0MB 2WAQC 4OO1J 1URJA 2H3ZA 2VIXA 2XI9A 4KMOB 2K89A 3CRXA 2ZIUA 3NRWA 2KHQA 2MA1A 2ZIWB 3MGVA 5CRXA 3PSPA 3RFAA 2CRXA 5A0LA 2Q4TA 2W04A 2W7PA 1YT3A 4NLCA 2VJ5A 2G5IB 2K4IA 3L3FX 3E0FA 2H3FA 2KICA 2KKPA 2VKQA 2ZIVB 2E1FA 3DEEA 2HMXA 3C29A 1D8BA 2JHDA 1ZQ1C 3N7RC 2OH2A 5KL8B 4ICAA 2JH1A 2KIWA 4GFJA 2PMZF 4IC9A 3IN5A 4OJPA 4U6PA 2MRLA 4OJ6A 4AYBC 3F5AA 3ICXA 4O3MA 2DQNB 1F44A 1A0PA 2F77X 1GO3F 3LVWA 4FZLA 4NV0A 2XVTA 2GOLA 2D6FC 2G5HB 2W03A 2OXOA 3K1ZA 2R18A 1ECWA 3IP4B 3F2BA 2KJ8A 3CYMA 4JMUA 2HBKA 4KX3A 4U7CA 4P0PA 3OPXA 2ZG6A 2KEYA 3ALRA 3F2DA 3KFUF 2HBLA 2KD1A 1KBUA 1Q3UA 3D2QA 2K4EA 2KOBA 2KHVA 2ZIVA 2HOQA 2Z7JA 2K8CB 2KNJA 2DF4B 2YB4A 3N7SC 4OJLA 2HOIA 2N1RA 1HIWA 3IG8A 3T79A 3F5EA 4NLBA 4FZMA 3SMVA 2F2AB 1CRXA 4QJFB 1PVQA 4FZNA 4BUGA 2ZIXB 4KX5A 4PL1A 4WJ3B 3VC8A 2PMZC 3SQIA 1L6NA 1IIPA 1Q3VA 3CP8A 4OJ5A 2ZXHA 4CDGA 1Z19A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H3V A;  4JMU A;  1HEK A;  2JMG A;  2H3Z A;  2K4E A;  2LYA A;  2K4I A;  2H3F A;  2K4H A;  1TAM A;  2HMX A;  2N1R A;  1HIW A;  1UPH A;  4ICA A;  4IC9 A;  2H3I A;  2H3Q A;  1A6S A;  1ED1 A;  2LYB A;  1L6N A;  2GOL A;  2NV3 A;  1ECW A; 
#chains in the Genus database with same CATH topology
 2I5H A;  2XGQ A;  3T5L A;  2P35 A;  1WUD A;  1UA1 A;  4Z6D A;  1ZQC A;  1BGX T;  3WK8 A;  3ETR A;  2C22 A;  3LDA A;  2E8O A;  2H3Q A;  1WCL A;  3MR3 A;  3SAG A;  1NI3 A;  4BJQ A;  4UAU A;  2G08 A;  4F5R A;  7ICS A;  1RYU A;  4RUC A;  1X9S A;  5J2I A;  3V7J A;  2HBJ A;  5AIB A;  1VJ5 A;  2K8B B;  3FM9 A;  4PH5 A;  3AU6 A;  3G6V A;  8ICW A;  4Q8F A;  2Y0S C;  5JRT A;  5KFU A;  3UXN A;  2BKE A;  2CPR A;  1S0M A;  8ICG A;  5F3X B;  2K89 A;  2ASJ A;  3NRW A;  4ECU A;  4J9P A;  2ZIW B;  3MGV A;  4DL5 A;  2Q4T A;  3ZDE A;  3C2K A;  1VDV A;  2G5I B;  2WF7 A;  3DEE A;  2R8K A;  3N7R C;  1ZQZ A;  4I2J A;  2WF6 A;  4DFJ A;  3LVW A;  2XVT A;  4F5P A;  1KFD A;  3ETL A;  2R18 A;  1D9D A;  2IHN A;  4RQ4 A;  3RJG A;  5KG4 A;  9ICX A;  3WKC A;  1NK8 A;  1KBU A;  2MUT B;  4KLU A;  4RQ7 A;  5KFS A;  4NY8 A;  4KN7 A;  4GXI A;  3Q8M A;  2WF5 A;  4FZM A;  3C2L A;  4TUP A;  4Y2P A;  3HJE A;  4UB6 U;  2PMZ C;  1L6N A;  1NK5 A;  1Q3V A;  4USA A;  1ZQN A;  3TAQ A;  1TV9 A;  1WCN A;  5AKH A;  3RRH A;  5ALZ A;  2R8H A;  1S76 D;  4F5N A;  5KT3 A;  1O03 A;  1TFR A;  4Z6F A;  3RJJ A;  1JI7 A;  2W9B B;  5AI9 A;  9ICI A;  4DSE A;  2BCU A;  8ICH A;  2KKV A;  2MU2 A;  3KD3 A;  5ALG A;  2YX8 A;  2Y1I A;  2HOF A;  2JH7 A;  2QAR A;  3PSF A;  1SV0 A;  1ZQL A;  3A0H U;  1K5O A;  1JX4 A;  3KZX A;  4BX9 C;  4KLH A;  4RZR A;  4OD0 A;  1XC9 A;  4F3O A;  2FE9 A;  2FPL A;  3HKZ C;  2E5S A;  3NVW A;  4M6W A;  1YZ6 A;  2ODG A;  3PO5 A;  4UB2 A;  1KFS A;  3D2N A;  3AEV A;  2KFZ A;  4DL2 A;  1URJ A;  2WF9 A;  2ZIU A;  2KG5 A;  3RAQ A;  4CF3 A;  2W7P A;  2HCF A;  8ICC A;  1ZD5 A;  2ZIV B;  2QKQ A;  7ICO A;  4IC9 A;  5IIK A;  4O3R A;  1ECW A;  3EW9 A;  4GLX A;  1WG8 A;  1NKB A;  4PZN A;  3TAR A;  1IM4 A;  1X6J A;  7ICT A;  1KEJ A;  5AK6 A;  5KFT A;  2FMP A;  1SKW A;  3HW8 A;  3TAD C;  3AM9 A;  4GXJ A;  3KHH A;  7ICF A;  5CR0 A;  1X9W A;  3PML A;  1CRX A;  3ZI4 A;  5L1K A;  9ICE A;  4DF4 A;  1SL1 A;  3S6J A;  1UT8 A;  2NRT A;  1Z19 A;  4F71 A;  4CCH A;  3KOO A;  4PL2 A;  3V6J A;  3PW0 A;  1Z3E B;  2HHT A;  2W55 A;  4C7Z A;  4Y2J A;  2HHQ A;  2KP7 A;  1ZQT A;  2ZXI A;  9ICU A;  5DG8 A;  4R66 A;  1U47 A;  1KTQ A;  3PMN A;  5AKY A;  3H8W A;  1FFU A;  4YCX A;  3BS5 B;  2KJ5 A;  1JXE A;  2K4P A;  4GIB A;  1XSP A;  2EAM A;  4QZA A;  4C8K A;  2FPM A;  2K8A A;  3WKE A;  4C8N A;  5J8Y A;  2DBY A;  2JXJ A;  3NS1 A;  2DKX A;  2K4H A;  2JEJ A;  2GH1 A;  2IHM A;  2W9M A;  1ZQQ A;  5FP0 A;  4M9N A;  1WWV A;  9ICL A;  4R64 A;  2B21 A;  4Y2Q A;  4M9G A;  1VLB A;  4Z6E A;  5DGB A;  1XO1 A;  1YT3 A;  2F3N A;  2BCQ A;  4F72 A;  3FAH A;  2OHF A;  1X9X A;  1L3U A;  2D8C A;  5D4B A;  4DSF A;  1J2M A;  1ZQJ A;  1AQ6 A;  2O6K A;  2E3T A;  3R9K A;  3QXG A;  4EYH B;  5DG7 A;  4JMU A;  4CNQ A;  3N28 A;  2PXI A;  3MDA A;  4DOC A;  4YMM A;  4R65 A;  3OGU A;  3GFK B;  1RQL A;  3BS7 A;  3QUT A;  5AIA A;  2BZF A;  4KLQ A;  3B0Y A;  1SWV A;  2UVV A;  1EXN A;  4ED2 A;  3SMV A;  4P4P A;  2ZIX B;  4OJ5 A;  4Y2X A;  3EYZ A;  3UMC A;  8ICS A;  9ICB A;  5AI6 A;  4DSI A;  4QWC A;  4F50 A;  5DB9 A;  4RUA A;  1SV4 A;  2F44 A;  2DL0 A;  2HSZ A;  4RQM A;  1Z1V A;  2IBK A;  1KFT A;  4F91 B;  4UW9 A;  1L8O A;  3ZDA A;  1ZQK A;  7ICV A;  4QZF A;  1ZQS A;  1QQ6 A;  5HR7 A;  4O3O A;  2YMP A;  2XY5 A;  1Z00 B;  2B0C A;  4A8E A;  4J9K A;  2M9N A;  4NLZ A;  4R8U B;  4RNO A;  5KFB A;  2LPE A;  2XCP A;  4PGY A;  2IOF A;  2BDU A;  4F92 B;  1S9F A;  1SWW A;  2J6T A;  3BQ2 A;  3GIL A;  2C2D A;  5AI8 A;  1ZQI A;  1ZD3 A;  3PST A;  4IR1 A;  2I1Q A;  5AI4 A;  4PZO A;  2YQE A;  5ALJ A;  4ECX A;  5EWF A;  2RP5 A;  4RU9 A;  5D46 A;  5KT4 A;  1KQQ A;  3I1Y A;  1CEZ A;  4MF2 A;  2GO7 A;  4RNM A;  4EBE A;  5CHG A;  3LWL A;  4DQP A;  2RDI A;  5ALE A;  5HNK A;  2WFA A;  5JU5 A;  7ICH A;  1GO3 F;  4NM2 A;  3MFI A;  1WWU A;  4YD2 A;  3MGH A;  2FI1 A;  1CI4 A;  3F2B A;  4PHP A;  5DB6 A;  4LZD A;  1L7M A;  3BZK A;  5KT2 A;  3T5K A;  2HOQ A;  5KFA A;  1TAQ A;  4OJL A;  4DSL A;  2E8M A;  1L7O A;  2N1R A;  1SKR A;  2DUY A;  2KVS A;  2BCS A;  5DG9 A;  3Q8S B;  2DPI A;  9ICN A;  1ZQG A;  2UVU A;  2QB1 A;  4XUS A;  4ED7 A;  3AUO A;  3E2E A;  1PVQ A;  4EX6 A;  5KFX A;  1LVH A;  5CJ7 A;  3SZ2 A;  4ECR A;  5IIL A;  5J2B A;  3SYZ A;  1L7P A;  1OXJ A;  5L9X A;  1X6I A;  2AXT U;  3ISC A;  5EE3 A;  4B6J A;  3RJH A;  5IIN A;  1JRP A;  1UPH A;  4P0Q B;  1S0V A;  3EZ5 A;  2H3I A;  3PSI A;  3PY8 A;  1DGS A;  3NTU A;  4DL6 A;  4YMN A;  2DWQ A;  3KKA C;  5AI0 A;  1MSW D;  1DK3 A;  4RT3 A;  2DGZ A;  1SKS A;  5DBC A;  4DSJ A;  5KG0 A;  1NKE A;  2BGW A;  4RNN A;  5KFI A;  1QSS A;  4IS7 A;  2RRD A;  5KFY A;  2IA6 A;  2W3S A;  4QZ9 A;  1RZT A;  2HBM A;  3OJU A;  3JPS A;  3ISB A;  5HML A;  1NK4 A;  1ZQV A;  1NK9 A;  2WTF A;  3LWM A;  5DGA A;  3MR5 A;  2WAQ C;  4C80 A;  4OO1 J;  3V7K A;  4J9O A;  4RQ6 A;  3N97 B;  4HAI A;  1RDF A;  1H38 A;  3C5G A;  2E1F A;  2OH2 A;  1XS9 D;  1N2X A;  2DFL A;  5KL8 B;  5KFC A;  3AMZ A;  3IN5 A;  2PMZ F;  3G6Y A;  3C1Z A;  5ALU A;  4BXO B;  5ALD A;  4F4Y A;  3H8M A;  2FLN A;  1J97 A;  1RM6 C;  4F4W A;  5KFD A;  3SD7 A;  2KD1 A;  1BPY A;  2KHV A;  3NVZ A;  1ZQM A;  2ZUC A;  3N7S C;  4I2B A;  3UPQ A;  5KFM A;  4DFM A;  2F2A B;  3RH4 A;  4KLD A;  4UB3 A;  2YMM A;  5KFR A;  3IM1 A;  5HP4 A;  1Y88 A;  3MDC A;  3QYP A;  2IOH A;  3WK9 A;  2FLL A;  3HIL A;  7ICG A;  5D49 A;  1SXD A;  1TKD A;  8ICN A;  3SI8 A;  8ICT A;  4EEY A;  4MF8 A;  1TAM A;  2KIV A;  2V4R A;  4OCZ A;  1L3S A;  5IIO A;  1N62 A;  2AGO A;  4DOB A;  3M7D A;  4O3Q A;  1Z4N A;  3BQ7 A;  2HI0 A;  3TKA A;  5J2D A;  3AL0 B;  1XWL A;  5KFH A;  3UQ0 A;  4ECY A;  3RJI A;  3ZD9 A;  4JV0 A;  1LB2 B;  5HR6 A;  1U9L A;  2W9B A;  3RR8 A;  1L7N A;  2DKZ A;  4GC7 A;  1N48 A;  5ALP A;  2VA2 A;  4OJO A;  4PPX A;  2G07 A;  1ZQE A;  3GV8 B;  5CB1 A;  4F2R A;  2GLE A;  1KLN A;  2LYB A;  4I27 A;  3E58 A;  7ICR A;  4XRH A;  2AU0 A;  2HHV A;  2ATL A;  3RJF A;  2C2R A;  4YN4 A;  7ICQ A;  2WHE A;  2EAN A;  3PSP A;  3RFA A;  9ICT A;  5ALR A;  1WYG A;  3HRD D;  9ICM A;  2H5X A;  5KT7 A;  4NLC A;  4EEN A;  4QZD A;  4RQ1 A;  2NO5 A;  3AU2 A;  5BOM A;  2XGP A;  3H4D A;  5AHX A;  5B5E U;  4NV0 A;  4FZL A;  3V6H A;  2D6F C;  2W03 A;  4B9V A;  4DQS A;  4ZH4 A;  1MN8 A;  4U7C A;  1DGJ A;  1F5S A;  2ZIV A;  2DF4 B;  2YB4 A;  2HHW A;  4C8O A;  2KMD A;  5J29 A;  4P4M A;  4FBU A;  4I2G A;  1ZYQ A;  4NLB A;  1T3N A;  3WK7 A;  4UB4 A;  4NLK A;  2OEH A;  4NLG A;  1KDH A;  1IIP A;  4R63 A;  1X9M A;  4JUZ A;  4KLO A;  2NYV A;  1ZD2 P;  5ALW A;  4J9S A;  2HVH A;  5B66 U;  2OWO A;  5ALX A;  3RBE A;  2FLP A;  2KSO B;  4O5E A;  4M2Y A;  2E8P A;  1U45 A;  4DFK A;  3U26 A;  3PW4 A;  3NGD A;  4I2H A;  4KLE A;  1L3V A;  3TAC B;  3RB3 A;  5ALT A;  4BDP A;  5AK5 A;  1BPD A;  3K75 D;  3QU2 A;  1BNP A;  3Q8P B;  3MFH A;  1T4G A;  2JZB B;  3DDH A;  5BPC A;  2LYH A;  3BS5 A;  2UVR A;  4QWD A;  1ZQP A;  4QIW C;  3GII A;  3K4G A;  3GU3 A;  5KG3 A;  2G09 A;  3J81 j;  4DS5 A;  4B9U A;  1XSN A;  3PR4 A;  3QU9 A;  3FYH A;  4KMO B;  2W8L A;  1SIJ A;  1B22 A;  2CRX A;  5J2G A;  2F1J A;  2JEI A;  5TZV A;  5AKL A;  4ED0 A;  4JV2 A;  2J6U A;  2HMX A;  5J2K A;  2JHD A;  5KG6 A;  1LV5 A;  8ICQ A;  2JH1 A;  2W11 A;  3TFR A;  4ECS A;  3Q8Q B;  7ICJ A;  3AN1 A;  5L1I A;  2OXO A;  2AH5 A;  5HHI A;  5DBA A;  1XU4 A;  1JXL A;  3N4M B;  3PVX A;  1F0M A;  2GWS A;  3KBB A;  1B4F A;  9ICC A;  5J0P A;  3GV5 B;  4FZN A;  3JPT A;  4UB1 A;  4KLL A;  5KFW A;  1KL9 A;  3QUB A;  4NWI A;  1ZQU A;  4FS1 A;  3RAX A;  5J2A A;  2KFN A;  1NZB A;  4YQW A;  5L1L A;  5IIM A;  1FO4 A;  4YR3 A;  3PV8 A;  4BWJ A;  5KFV A;  1UQV A;  4EZ6 A;  2ZIX A;  9ICO A;  2E1E A;  1COO A;  2ZJ5 A;  1KRP A;  2H3V A;  2LHT A;  3PZP A;  3UM9 A;  2W7O A;  5ALL A;  1IXR A;  1ZRN A;  2FDR A;  2JGA A;  5EOZ A;  4QZG A;  5DQG A;  2W54 A;  1T7P A;  2IMW P;  2EZY A;  2EZZ A;  4QZC A;  4QZB A;  2DPJ A;  4M47 A;  4ECZ A;  8ICB A;  1T8E A;  3TAD A;  4M9J A;  3M9O B;  1PK3 A;  1Z00 A;  3RB6 A;  4R8U A;  1V97 A;  3BQ0 A;  4QWA A;  5KFG A;  4TUR A;  3KTQ A;  1KSP A;  3UMB A;  2KKP A;  2NRW A;  1NJW A;  3EPI A;  2B6G A;  5ALI A;  1S0O A;  4HYK A;  3ORY A;  2GOL A;  5KFJ A;  1ZQF A;  3OJS A;  4KX3 A;  5AKJ A;  2W8K A;  5JTI A;  4IRD A;  2KEY A;  5J0T A;  2F8K A;  1A76 A;  1ZQD A;  2K4E A;  1U49 A;  2Z7J A;  4RPZ A;  2YN4 A;  5DLF A;  2W9C A;  4J03 A;  5AKE A;  3DV9 A;  3OHB A;  3RH5 A;  2PFP A;  4YD1 A;  4DOA A;  1S77 D;  1S8O A;  1O08 A;  1SL0 A;  3TAP A;  2ZXH A;  3BQT A;  4JK1 A;  1ZQX A;  4CE6 A;  2JMG A;  1ZQR A;  3ONN A;  4RT2 A;  5KG1 A;  3T5H A;  4PGX A;  9ICG A;  5EE1 A;  4NXZ A;  2OM6 A;  1KN5 A;  2FJ6 A;  4NL9 C;  4DF8 A;  4DCC A;  2FMS A;  2EAO A;  4RQ3 A;  2WB1 F;  4F4Z A;  1BPZ A;  3JPO A;  2EAP A;  2WAQ F;  2F1I A;  1X42 A;  5E79 U;  5AM1 A;  2E8N A;  4I2E A;  2ALZ A;  2UVW A;  4M9H A;  2AGQ A;  5EE9 A;  4P0Q A;  1JRO A;  1IG6 A;  1P7D A;  4DFD A;  3IRU A;  3WU2 U;  2I6X A;  2G0A A;  4LZG A;  2XIC A;  1PVR A;  4I2A A;  4ACO A;  4C4R A;  5KFP A;  1ZQA A;  5J2J A;  5DDY A;  3TI0 A;  2XI9 A;  4JB3 A;  1QSY A;  4UAV A;  1ZJN A;  4RPX A;  3PW2 A;  3C21 A;  3L4P A;  4LJX A;  1X66 A;  3BJY A;  1NZP A;  4U6P A;  2MRL A;  2ZTC A;  1KKX A;  2JEF A;  4YFK A;  4DQI A;  3CNH A;  4DFP A;  5ALV A;  1XSL A;  3OPX A;  4J9M A;  3RJK A;  2FPK A;  4YXM A;  2A1J B;  5G5G A;  3GDX A;  1V9P A;  1DXS A;  5J0O A;  5IIJ A;  3T5J A;  4BXO A;  4KLF A;  2HW3 A;  9ICJ A;  2W9C B;  1KW4 A;  4ZOH C;  5AK3 A;  4KX5 A;  4ED1 A;  1F44 A;  3WK4 A;  4FFD A;  4UB8 U;  1QQ7 A;  4IQT A;  4FS2 A;  3C28 A;  2ZJ8 A;  1DOQ A;  2YB1 A;  4EZ9 A;  4QZE A;  2VAN A;  4KN4 A;  3GIM A;  3M9M B;  4F4X A;  1U48 A;  5III A;  3QU7 A;  4DS4 A;  4CRX A;  1B0X A;  3M8R A;  3UXO A;  1DK2 A;  3PR5 B;  2AHO B;  3RB4 A;  3FC4 A;  1JN3 A;  1QCK A;  2AQ0 A;  2LYA A;  4KIT B;  4MEX A;  1TVA A;  8ICA A;  7ICL A;  5KTQ A;  4MFA A;  2Y0S F;  5GTH U;  3SAF A;  1K1Q A;  2RHF A;  5AKK A;  5AKX A;  2NV3 A;  2LKY A;  4Q43 A;  7ICE A;  2MSN A;  3G6X A;  5CRX A;  3PX6 A;  2JV3 A;  5ALK A;  9ICR A;  1D8B A;  3HP6 A;  3C29 A;  4EBD A;  2KN7 A;  4GFJ A;  4KMU A;  5AM5 A;  1Q46 A;  4O3M A;  2F77 X;  1ARO P;  1ZXI A;  1LKY B;  3K1Z A;  4JWN A;  3IP4 B;  4B9N A;  8ICU A;  4YVZ A;  1YZ7 A;  5DQH A;  5EWE A;  5KFF A;  1RXV A;  3KFU F;  1NOM A;  4UAZ A;  2KOB A;  1TE2 A;  3KKA A;  1PUZ A;  2KNJ A;  2J6S A;  3K1R B;  4IQV A;  2YMQ A;  4B9T A;  4J9L A;  3JPR A;  3V6K A;  2ASD A;  5KAI U;  2IOF K;  4O0I A;  3UQ2 A;  1SZP A;  3PW5 A;  4DL4 A;  3PX4 A;  4US9 A;  5EWG A;  1RYR A;  3EUB 2;  5L1M A;  1JAL A;  4QWE A;  3H40 A;  2F8L A;  1D9F A;  4IQW A;  3RH6 A;  2XCA A;  3F53 A;  5TIS U;  2BCV A;  1D8L A;  5J0X A;  4UBB A;  2W9A A;  2RLT A;  4ELT A;  8ICP A;  5ALY A;  2BQU A;  1A77 A;  4O5C A;  1FFV A;  5KT5 A;  5T14 A;  4KLG A;  1XNS A;  5KFK A;  4K4H A;  3QZ7 A;  3RR7 A;  3C1Y A;  3JPP A;  2JEG A;  3OTQ A;  4I2D A;  2ZUB A;  3QU5 A;  2KSO A;  4C0Z A;  4MFF A;  2KV2 A;  3HKZ F;  4EYI B;  2KTQ A;  5ALS A;  1JMS A;  3LVV A;  2PKE A;  4KTQ A;  1JUD A;  1UCV A;  2CN1 A;  3TQ1 A;  2PFN A;  1SB3 C;  1MA7 A;  5HMM A;  4F2S A;  1X2I A;  3CRX A;  2JZB A;  4RQ5 A;  4I29 A;  5A0L A;  5AKG A;  5AIC A;  4QZH A;  4PHE A;  4ECW A;  3ZD8 A;  3L3F X;  4BWM A;  1V85 A;  5CEH A;  3SEI A;  4UAT A;  4M9L A;  4OJ6 A;  2P6U A;  4AYB C;  2DQN B;  1COK A;  4RQN A;  2HHU A;  2BPG A;  4TQR A;  2HHX A;  2KJ8 A;  3CYM A;  1UA0 A;  3V72 A;  5F9L A;  3JPN A;  1Q8K A;  2PI5 A;  3F2D A;  2ZUD A;  4B9S A;  2LM4 A;  4EBC A;  3BQ1 A;  3ISD A;  4MHV A;  1BPB A;  3MBY A;  5HHH A;  1N61 A;  3C2M A;  3F5E A;  5AM2 A;  4KLM A;  3C5F A;  3HPO A;  3SEN A;  2JR5 A;  3VC8 A;  4C8L A;  4DO9 A;  4P0P A;  3SV4 A;  1PZN A;  2WF8 A;  2Y9U A;  1T94 A;  8ICO A;  3SAH A;  4KLI A;  2K60 A;  1N63 A;  2LBO A;  2EQY A;  4CGZ A;  4IR9 A;  8ICM A;  1QQ5 A;  3AQE A;  4B9L A;  1C7Y A;  3WK6 A;  1C20 A;  1TK5 A;  1UHU A;  3SR6 A;  1X40 A;  1ZD4 A;  3QUC A;  3EWA A;  3GQC A;  4UB5 A;  3LYS A;  2NRV A;  3M9N B;  1TK8 A;  5ALH A;  2L5Y A;  5KFQ A;  3AQF A;  3IHQ B;  5KAF U;  3KZI U;  5KG7 A;  1T3Q A;  3GIK A;  1S0N A;  5J0Y A;  8ICV A;  4UBC A;  3H4B A;  4YMO A;  3JPQ A;  8ICJ A;  1FEZ A;  4X5V A;  4XQ8 A;  2KJ9 A;  2XID A;  4F4K A;  4DLE A;  4DWI A;  2H3Z A;  5ALM A;  4NM1 A;  2MA1 A;  3ZDC A;  5DDM A;  2KE7 A;  2H3F A;  4B9M A;  2VKQ A;  4DQQ A;  2BPC A;  4ICA A;  3LK9 A;  2KIW A;  4OJP A;  4PHA A;  1SV0 C;  8ICR A;  2F1H A;  5JUM A;  5EE0 A;  4GXK A;  2BCR A;  4M0A A;  1L5U A;  5L1J A;  2HBK A;  4ELU A;  4UAY A;  5KFO A;  3BDP A;  1JIH A;  4UAW A;  3C23 A;  4GC6 A;  1BPE A;  4Y2R A;  2R8I A;  8ICZ A;  4RQ0 A;  2VA3 A;  3MC1 A;  3WK5 A;  4MFC A;  4BUG A;  3SQI A;  3RBD A;  3CP8 A;  3IDW A;  2F76 X;  2CXY A;  2ZTD A;  4FBT A;  4ED3 A;  3OSP A;  4Y2Y A;  4P0P B;  2NRX A;  3O0F A;  4J9N A;  2I9G A;  1QSL A;  3OSN A;  1MQ2 A;  9ICA A;  4IL6 U;  4NJ8 A;  3MR2 A;  3MR6 A;  4C4T A;  1CUK A;  3NUQ A;  2BQ3 A;  4UAR A;  4O5K A;  4Q8E A;  4K4G A;  4KLJ A;  1DRG A;  5KFN A;  5J2H A;  2XO7 A;  4I2I A;  4QNL A;  8ICL A;  2KVC A;  5AM0 A;  3QX7 A;  4YR2 A;  3M8S A;  2EH9 A;  2R8G A;  4IRK A;  5J0S A;  2AGP A;  1TK0 A;  2AQ4 A;  4QZ8 A;  4DQR A;  1A6S A;  1PK1 A;  3B9J A;  3UXP A;  1XO0 A;  2ISP A;  4E0D A;  3ED5 A;  1HEK A;  5DB8 A;  4TUS A;  4JV1 A;  2VJ5 A;  4MEY A;  3MGI A;  2W43 A;  5J2C A;  3HX0 A;  2ZJA A;  2Q0Z X;  7ICP A;  7ICI A;  5KFZ A;  8ICK A;  1A0P A;  5J8Y C;  5DQI A;  4K4I A;  4O3N A;  4F93 B;  4YG2 A;  5AKZ A;  2C28 A;  2ES6 A;  3WKA A;  2LMR A;  4KLT A;  5DLG A;  1SXE A;  1QH9 A;  1HIW A;  3PX0 A;  1FIQ A;  4C4S A;  2PFO A;  2KK0 A;  5AKI A;  4Y2S A;  2YY6 A;  5AM3 A;  2R8J A;  2RDJ A;  4Q44 A;  4DLG A;  2QAR B;  4ED8 A;  2PI4 A;  2A1J A;  5H2F U;  3FDS A;  4TQS A;  3B0X A;  5J0Q A;  5KG2 A;  4CF5 A;  5CWR A;  1MQ3 A;  2JRZ A;  3IV6 A;  3QEB Z;  4YXJ A;  9ICF A;  4EEK A;  9ICW A;  2A3V A;  5ALN A;  3NAS A;  4PJ0 U;  1BVS A;  2V9W A;  4XA5 A;  4M6W B;  2HVI A;  4Y2U A;  4QZI A;  2OYY A;  3RB0 A;  1HUZ A;  5ALQ A;  4Y2V A;  1Z1B A;  3EPG A;  2BHN A;  4NLN A;  7ICU A;  3SV3 A;  9ICQ A;  2ZIU B;  3GV7 B;  2C2E A;  2NO4 A;  3PNC A;  2BDP A;  2VJ4 A;  1IV8 A;  4BGD A;  1NJZ A;  1NKC A;  3H8J A;  1PK1 B;  9ICV A;  1M6Y A;  4IRC A;  8ICF A;  2W04 A;  3THV A;  3E0F A;  1RQN A;  2QLT A;  1ZQ1 C;  8ICX A;  2VA8 A;  4F8R A;  4KLS A;  1ZQO A;  3NVY A;  3KHL A;  2A1A A;  1SL2 A;  3MAB A;  2W3R A;  4NL9 A;  2PFQ A;  2QB0 A;  9ICK A;  4DL7 A;  4I2F A;  1Z4O A;  2ZG6 A;  1K1S A;  3ALR A;  2HBL A;  2P6R A;  5J2E A;  5J0W A;  4O9M A;  3UMG A;  3TAN A;  4G3I A;  3T79 A;  3IG8 A;  1NK0 A;  3HWT A;  5DKW A;  1LKY A;  2BPF A;  3QU4 A;  5G5H A;  5K4L A;  3GIJ A;  4F5O A;  5J0R A;  1RXW A;  2M0N A;  2ISO A;  2A19 A;  1HUO A;  3M6K A;  1NK7 A;  2XY7 A;  2P66 A;  1N5X A;  2HHS A;  2RQ5 A;  2ZTE A;  3M6Z A;  1NK6 A;  3F2C A;  5BOL A;  3RRG A;  4UAS A;  5F9N A;  2Y1J A;  3RF9 A;  1RPL A;  3PW7 A;  4Q45 A;  3Q8L A;  2V4Q A;  3M1Y A;  4Y2T A;  4PGQ A;  1QLN A;  3BZC A;  3VCB A;  5KNI A;  3TFS A;  5CA7 A;  7ICN A;  2G06 A;  4JWM A;  5C0Y A;  1U4B A;  4C7Y A;  3D2S A;  3QNM A;  3Q8R B;  4AYB F;  2KZM A;  4ED6 A;  3V7L A;  2LI6 A;  1S97 A;  4PHD A;  1NJX A;  3H8S A;  8ICY A;  4IQU A;  1ED1 A;  2LM1 A;  1PVP A;  1ZQW A;  3QZ8 A;  7ICK A;  1BPX A;  3WKB A;  2VIX A;  3NRZ A;  5KG5 A;  3HT3 A;  5KT6 A;  4YR0 A;  4QW9 A;  2K4I A;  3H7I A;  2KIC A;  2NRZ A;  4ECQ A;  1S5L U;  1L8L A;  2ASL A;  4QWB A;  9ICP A;  4EEL A;  5AM4 A;  3OHA A;  4DL3 A;  3ZDB A;  1ZQH A;  8ICE A;  3KHR A;  2QB0 B;  1D8Y A;  2K8C B;  4RPY A;  3PO4 A;  5J0U A;  4ECT A;  1QTM A;  1BNO A;  3WKD A;  1TAU A;  3RTV A;  4QJF B;  4PL1 A;  4O3S A;  7ICM A;  4DSK A;  4CDG A;  3QE9 Y;  4P4O A;  2BQR A;  4I2C A;  4P2H A;  4ELV A;  1UT5 A;  5ALO A;  3CW2 C;  3NVV A;  1ZQB A;  1RG6 A;  1OUQ A;  4YP3 A;  2FMQ A;  2YML A;  3I76 A;  2WB1 C;  1RYS A;  4J9R A;  3QUQ A;  5KL1 B;  5DBB A;  4RQ8 A;  2XC9 A;  3H0L B;  4O3P A;  2MAX A;  4FO6 A;  4FE3 A;  4F5Q A;  3I28 A;  2KZ3 A;  5AK4 A;  4ECV A;  5KFL A;  4QIW F;  1HJP A;  5AI5 A;  4QW8 A;  3IG5 A;  5C5J A;  4LVS A;  9ICS A;  3Q8K A;  2EZX A;  1NNL A;  3D6J A;  3L5K A;  3H0R B;  5GTI U;  1OW5 A;  3GZF A;  3N7P D;  1SZH A;  3A0B U;  5CP2 A;  1MC8 A;  2D3D A;  2ZIW A;  1B43 A;  3H0M B;  1ZJM A;  1N60 A;  4M04 A;  4TUQ A;  2HDO A;  2KHQ A;  2OCE A;  4I28 A;  1J2N A;  2Y9T A;  3KHG A;  1ZET A;  1ZQY A;  4AP9 A;  1V38 A;  3F5A A;  1ZRM A;  2YTU A;  3ICX A;  3T3F A;  2KZZ A;  1N5W A;  4Z6C A;  2BR0 A;  3RJE A;  2G5H B;  2EDU A;  2MUT A;  1S10 A;  4CF4 A;  3ZDD A;  2AJQ A;  1Q3U A;  3D2Q A;  4DEZ A;  5J2F A;  2ESE A;  1L3T A;  9ICH A;  4RQ2 A;  4UQG A;  2HOI A;  5ALF A;  4EX7 A;  1ZOL A;  4C8M A;  5KFE A;  4G9B A;  3QEA Z;  5DB7 A;  1N56 A;  8ICI A;  1NJY A;  4WJ3 B;  2XY6 A;  4US8 A;  1SGG A;  4J9Q A; 
#chains in the Genus database with same CATH homology
 4NWI A;  2F76 X;  1T94 A;  2JMG A;  2M0N A;  3ONN A;  3SAH A;  4PL2 A;  1WUD A;  4P0P B;  3C28 A;  3O0F A;  2LBO A;  2F8L A;  3M6K A;  2ZXI A;  4CGZ A;  1NZB A;  3AQE A;  3M6Z A;  2OM6 A;  3F53 A;  1TAM A;  2YB1 A;  3F2C A;  1UPH A;  4P0Q B;  1OUQ A;  3NUQ A;  2H3I A;  2H3Q A;  2WB1 F;  2KKV A;  2ZIX A;  3PSI A;  2A3V A;  2E1E A;  5T14 A;  3RF9 A;  3M7D A;  2KJ5 A;  2YX8 A;  1XNS A;  1DRG A;  3SAG A;  4CRX A;  2WAQ F;  2WB1 C;  3LYS A;  5KL1 B;  2OYY A;  5HR7 A;  4BJQ A;  2HOF A;  2JH7 A;  2G08 A;  1Z1B A;  3AL0 B;  3AQF A;  2H3V A;  3PSF A;  3H0L B;  2DGZ A;  3VCB A;  4QNL A;  2LHT A;  4A8E A;  2G06 A;  5C0Y A;  4FE3 A;  2KVC A;  2K8A A;  3PZP A;  2W7O A;  2HBJ A;  2ZIU B;  3KZX A;  2LYA A;  4C0Z A;  2K8B B;  2JGA A;  4BX9 C;  3D2S A;  5HR6 A;  2BDU A;  4QIW F;  2KV2 A;  2RRD A;  3HKZ F;  4P0Q A;  2K4H A;  3IG5 A;  4AYB F;  2GH1 A;  4QIW C;  2HBM A;  2Y0S F;  3HKZ C;  2VJ4 A;  2E5S A;  4OJO A;  3LVV A;  3SAF A;  3GU3 A;  3PST A;  1P7D A;  2G07 A;  1A6S A;  2G09 A;  1ED1 A;  3H0R B;  2Y0S C;  1XO0 A;  2CN1 A;  2G0A A;  2RHF A;  1PVP A;  2LYB A;  3GZF A;  2XIC A;  3D2N A;  1MA7 A;  2RP5 A;  1SZH A;  2NV3 A;  3N7P D;  2CPR A;  1PVR A;  2LKY A;  2KJ9 A;  2XID A;  2ZIW A;  4ACO A;  1HEK A;  3H0M B;  2WAQ C;  4OO1 J;  1URJ A;  2H3Z A;  2VIX A;  2XI9 A;  4KMO B;  2K89 A;  3CRX A;  2ZIU A;  3NRW A;  2KHQ A;  2MA1 A;  2ZIW B;  3MGV A;  5CRX A;  3PSP A;  3RFA A;  2CRX A;  5A0L A;  2Q4T A;  2W04 A;  2W7P A;  1YT3 A;  4NLC A;  2VJ5 A;  2G5I B;  2K4I A;  3L3F X;  3E0F A;  2H3F A;  2KIC A;  2KKP A;  2VKQ A;  2ZIV B;  2E1F A;  3DEE A;  2HMX A;  3C29 A;  1D8B A;  2JHD A;  1ZQ1 C;  3N7R C;  2OH2 A;  5KL8 B;  4ICA A;  2JH1 A;  2KIW A;  4GFJ A;  2PMZ F;  4IC9 A;  3IN5 A;  4OJP A;  4U6P A;  2MRL A;  4OJ6 A;  4AYB C;  3F5A A;  3ICX A;  4O3M A;  2DQN B;  1F44 A;  1A0P A;  2F77 X;  1GO3 F;  3LVW A;  4FZL A;  4NV0 A;  2XVT A;  2GOL A;  2D6F C;  2G5H B;  2W03 A;  2OXO A;  3K1Z A;  2R18 A;  1ECW A;  3IP4 B;  3F2B A;  2KJ8 A;  3CYM A;  4JMU A;  2HBK A;  4KX3 A;  4U7C A;  4P0P A;  3OPX A;  2ZG6 A;  2KEY A;  3ALR A;  3F2D A;  3KFU F;  2HBL A;  2KD1 A;  1KBU A;  1Q3U A;  3D2Q A;  2K4E A;  2KOB A;  2KHV A;  2ZIV A;  2HOQ A;  2Z7J A;  2K8C B;  2KNJ A;  2DF4 B;  2YB4 A;  3N7S C;  4OJL A;  2HOI A;  2N1R A;  1HIW A;  3IG8 A;  3T79 A;  3F5E A;  4NLB A;  4FZM A;  3SMV A;  2F2A B;  1CRX A;  4QJF B;  1PVQ A;  4FZN A;  4BUG A;  2ZIX B;  4KX5 A;  4PL1 A;  4WJ3 B;  3VC8 A;  2PMZ C;  3SQI A;  1L6N A;  1IIP A;  1Q3V A;  3CP8 A;  4OJ5 A;  2ZXH A;  4CDG A;  1Z19 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...