2H3FA

Solution structure of the hiv-1 ma protein
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
131
structure length
131
Chain Sequence
GARASVLSGGELDKWEKIRLRPGGKKQYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNTIAVLYCVHQRIDVKDTKEALDKIEEEQNKSKKKAQQAAADTGNNSQVSQNY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Gag polyprotein
publication title Structural basis for targeting HIV-1 Gag proteins to the plasma membrane for virus assembly.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 30
structure length 131
sequence length 131
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2006-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00540 Gag_p17 gag gene protein p17 (matrix protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.90 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2h3fA01
4JMUA 2N1RA 2K4IA 1A6SA 1UPHA 1L6NA 2H3QA 2HMXA 2H3VA 2JMGA 2H3IA 2K4EA 4ICAA 1TAMA 1ED1A 1HEKA 2NV3A 2GOLA 4IC9A 1HIWA 2LYAA 2H3FA 2H3ZA 2LYBA 2K4HA 1ECWA
chains in the Genus database with same CATH superfamily
2A19A 4ELVA 2HHWA 2R8GA 1X9MA 4Z6DA 4I2FA 1YZ7A 3C5GA 2RLTA 2E8PA 5AKEA 1WWVA 3QU2A 5HR6A 2H3ZA 2ASJA 3SR6A 3QZ8A 2MA1A 4OJOA 2RP5A 2XI9A 1SB3C 5KFZA 1ZQHA 1IIPA 3H8JA 2FMPA 2L5YA 1QLNA 3H0RB 4DSEA 2EZXA 4QW8A 3H8WA 1KRPA 3E2EA 3RB6A 1UQVA 1N5WA 2NO4A 4US8A 4YD1A 5J0WA 1ZQZA 3M7DA 1Z1BA 2XVTA 5AI9A 2KZZA 3C2MA 2MUTA 1ZQNA 1Z4OA 4YQWA 4C7YA 5DBAA 2QB1A 3ICXA 1ZRNA 5ALTA 3JPPA 4DQSA 3PX6A 3M9NB 3PW2A 3M9MB 7ICEA 3JPOA 3RH5A 1RG6A 4IQUA 4CCHA 1UHUA 8ICOA 3NVZA 1JROA 2PFPA 3ISCA 2JMGA 5EE3A 4DQRA 4RPZA 3MGVA 2LYBA 1L8LA 2ZXIA 2OWOA 4M9NA 4UBBA 4UASA 2DGZA 1NJYA 2WAQF 4F5RA 2DUYA 3KHLA 5KT5A 4P4PA 2Z7JA 4DFMA 4EX6A 4Y2RA 2AGOA 5L1JA 1V85A 3UQ2A 5GTIU 5J2CA 2HOIA 4IC9A 4XQ8A 4JB3A 3T5LA 4R8UB 5AM1A 4J9MA 1XWLA 4F4ZA 3MR3A 3QUTA 4IQTA 3TADA 4M47A 1N60A 3V7LA 3HKZC 4IRKA 3T5KA 4DQPA 8ICAA 1ZQDA 4OJ6A 1ZQUA 4DOCA 2FMQA 4ZH4A 2Q0ZX 4XUSA 5DB8A 2KHVA 3T3FA 4M2YA 4JMUA 3V6JA 2I5HA 2D6FC 3K4GA 4QWBA 4UB2A 1IM4A 2E1EA 4I2GA 3PZPA 2BR0A 1ZQBA 1RM6C 3BZKA 1BPBA 3GIJA 4YFKA 3Q8SB 5T14A 1NOMA 2H3FA 4DFKA 4C8LA 2BKEA 3DV9A 4QIWF 4F2SA 1ZYQA 2WHEA 5AI0A 4Y2TA 1Z3EB 5KG6A 3ZI4A 2PXIA 3HX0A 4BWJA 2BCSA 1DOQA 1L5UA 4G9BA 3ORYA 3GDXA 3MFIA 2G07A 5J2JA 5ALKA 5KG2A 2ALZA 4ED1A 2AQ4A 4RQ4A 9ICHA 3GU3A 3MR2A 2G0AA 5DDYA 5ALEA 4QZHA 4UB6U 4Y2SA 4PGXA 3M8RA 1JMSA 3TARA 5ALQA 1M6YA 4DL7A 2LKYA 2W11A 1XSLA 2MU2A 3B0XA 2NV3A 4NM1A 2LYAA 2I1QA 5DBCA 3IG5A 3N7PD 1TVAA 2WFAA 1TV9A 3HPOA 4CF4A 5EOZA 1V38A 3PW4A 3C1YA 2QARB 2AXTU 5EWEA 1S76D 3AN1A 3QXGA 5J29A 1ZQYA 2ISOA 4KLEA 4J9OA 5TISU 2ZIUA 4DLGA 9ICFA 4MF8A 3RB0A 3GFKB 5HMMA 4DS5A 8ICLA 2EH9A 1L7NA 3NVWA 5J2HA 1SL1A 5DBBA 1NNLA 5J2EA 1SIJA 4QWEA 1KL9A 1N61A 4MEYA 3MDCA 2PI5A 4C4SA 7ICJA 5AM2A 3FC4A 5KT3A 1RYUA 2ZIXA 2LHTA 3WK9A 4IL6U 3JPTA 2IBKA 3K75D 4YMNA 4KLUA 4B9LA 3CW2C 1NK8A 4KITB 1WYGA 4F3OA 2EANA 1ECWA 1MA7A 2KNJA 4DL3A 1N62A 9ICWA 8ICKA 1N56A 3GQCA 1S0OA 2HW3A 4MF2A 1S10A 4PL2A 4NM2A 2UVVA 3EYZA 2BCQA 4NLNA 5ALFA 4EBDA 4JK1A 1PUZA 1SKRA 2KIWA 2YB4A 2P6UA 1D9DA 4MEXA 4UAUA 2W04A 1SKSA 5CJ7A 3EZ5A 5J2BA 1SWVA 1PVPA 5HP4A 5KFDA 1JRPA 5DB6A 1FEZA 5ALOA 2CXYA 1ZETA 2LMRA 5F3XB 5AK6A 2RQ5A 5ALVA 4UB1A 2K4HA 1T3NA 4KTQA 2BPGA 3ISBA 1SXDA 2KZMA 5IIMA 2BCVA 1SV0C 3V6KA 2OM6A 2LM1A 4B9UA 3PR5B 3RAXA 1KFSA 7ICRA 1NKCA 2DPIA 2HBKA 3RJIA 2UVWA 3M9OB 9ICJA 4DSKA 5J8YA 2QLTA 4UAWA 3U26A 4ECZA 1RXVA 3J81j 4RQ2A 2UVRA 2DL0A 4O5EA 4QZAA 5CEHA 1H38A 2Y1IA 1ZQJA 4J9RA 1C20A 7ICOA 4JV0A 2K8AA 4I2CA 9ICRA 2KJ8A 1PK1B 2FI1A 1LKYA 4J9KA 4OJPA 1URJA 3TACB 5AK5A 5KFVA 2YY6A 5KFHA 4RPXA 3IV6A 1HEKA 4M9JA 4HYKA 3A0HU 3B9JA 4O0IA 4QZ9A 3KZIU 4C8MA 4CDGA 1ZD5A 3SQIA 1ZQRA 3D2QA 4XRHA 2FPKA 5AM4A 1QTMA 1ZD2P 4I28A 2FPLA 3S6JA 2F3NA 4ECTA 4RQNA 1KW4A 1Z00A 1X6JA 2ESEA 4GFJA 3PO5A 1L3TA 5DG8A 2RDIA 4P4MA 4I2HA 2WB1F 4UB5A 2VA8A 4I2JA 1N2XA 3QE9Y 1DRGA 1KBUA 4ED2A 4US9A 1KKXA 2XICA 4Y2JA 3MABA 4B9MA 2J6SA 4NLBA 2FLNA 4I2AA 5IIKA 5HNKA 3ALRA 1L8OA 2ZIWA 3CP8A 3CYMA 3OSPA 7ICIA 2F1HA 5TZVA 5KFKA 4DLEA 2FE9A 1QH9A 4KLQA 3N97B 3H8SA 3MR6A 2ZTEA 2N1RA 3GV5B 2IHNA 2KSOB 1A6SA 4P0PB 2HOQA 5KFPA 3SEIA 1U47A 8ICQA 4ECYA 7ICGA 4NY8A 3UMGA 1MN8A 4QJFB 1K1QA 1ZD3A 4KN7A 2I6XA 3PNCA 4P0PA 1QQ7A 3QU9A 1L3SA 5ALXA 2YMPA 2FJ6A 2CRXA 4NWIA 5KFNA 3SENA 4I2BA 4QZDA 1ZJMA 1CRXA 2OCEA 4RQMA 4GXJA 2OEHA 2ZUBA 5AK3A 3JPQA 3AMZA 2A1JB 3Q8RB 5IIIA 4OJLA 2Y0SF 2R18A 3MDAA 4TUSA 3WK8A 1EXNA 1ZQEA 3OHBA 4M9LA 4JUZA 1UPHA 2W54A 2G08A 4O3PA 5C5JA 4DEZA 4F5PA 1S8OA 3Q8LA 3NTUA 5ALJA 2ZTDA 1P7DA 4R63A 4QNLA 1J97A 1Q46A 4UAVA 2EQYA 3BQTA 5AHXA 1B0XA 1X9XA 5JTIA 1KTQA 3NVVA 2W8LA 2J6UA 4K4GA 5ALDA 5KG0A 1COKA 3RJKA 1CEZA 2B0CA 2G5HB 3QU7A 8ICVA 2JRZA 4EZ6A 5AM3A 7ICVA 3PY8A 4GC7A 4DL4A 4YVZA 4EEYA 1VDVA 5KFUA 5J0SA 5AM5A 1RYRA 3BZCA 3KTQA 1ZQKA 1ZJNA 3HWTA 3BS7A 4QZFA 2XO7A 1TKDA 1COOA 2OH2A 2H3QA 5KFQA 4DSLA 2EZYA 3PSFA 5DGBA 1L7OA 1OW5A 3PSIA 4DL6A 2W03A 4ED3A 1ZQXA 2AQ0A 1BPYA 4QIWC 4O5KA 4QZCA 4Y2QA 2PKEA 1YT3A 1T7PA 3LDAA 2ZJ8A 3OTQA 5AKHA 2YMMA 1NZBA 2ZJ5A 1HUOA 3F5AA 4YR2A 2HMXA 2PFQA 4A8EA 2F8LA 4KLTA 2KVCA 4BUGA 3THVA 2V9WA 5J2DA 8ICEA 2W9BB 1SKWA 5HMLA 3SMVA 3RJHA 4PHEA 5AK4A 2OHFA 4TURA 5ALMA 4QWAA 3D6JA 3I28A 2DKZA 5HHHA 3ZDCA 2KFZA 3PW7A 2NRWA 1F0MA 4YR3A 4QWDA 3QX7A 2V4QA 1XSPA 3LWLA 2NRXA 3RBDA 2VIXA 4I2DA 2DKXA 1L7PA 4O3SA 1ZQFA 5DQGA 3PO4A 3EPGA 5H2FU 3ZDBA 3KKAC 8ICGA 7ICFA 4Q45A 9ICXA 4TUQA 1PVQA 2ZXHA 4C4TA 4RPYA 3TFRA 2HHUA 4RUCA 4Q8EA 2BQUA 4QZEA 1X40A 1RZTA 2EAPA 2Y9TA 1FFUA 3PMLA 3IM1A 5KFTA 2WTFA 4DF8A 4PHAA 1ZXIA 2DQNB 1FIQA 2GWSA 3FDSA 5K4LA 3N4MB 3PV8A 1T3QA 3M8SA 1T8EA 1KFTA 3SAFA 4ECWA 4ECSA 1NZPA 4R8UA 4ED6A 3ZDAA 3C5FA 2Y1JA 2HBLA 2YMLA 3FAHA 1TFRA 8ICZA 5KFJA 2KD1A 5DB7A 5D4BA 1LV5A 3LWMA 7ICNA 2ZJAA 3OHAA 3WK6A 3TKAA 9ICIA 1NKEA 3ZDEA 1S0MA 1JIHA 2WF7A 4Y2YA 4ICAA 3LVWA 5KG5A 1F5SA 3NASA 4DOAA 1LVHA 1K1SA 2NRTA 4GXKA 4YG2A 4YXJA 4DFDA 2AJQA 1SV0A 3T79A 2XCPA 2GLEA 3KHGA 4PL1A 3VCBA 5ALNA 4J9SA 2HI0A 4P2HA 4EENA 4FZNA 3QUCA 4NV0A 9ICEA 1JN3A 3HT3A 4EYIB 5E79U 1ZQ1C 5BPCA 4KLSA 1IV8A 4OO1J 2ATLA 1OXJA 2YN4A 5BOLA 2HVHA 2E8MA 8ICXA 1ZQVA 3RH4A 1A77A 8ICYA 4FS2A 5IILA 1O03A 3RR7A 1L6NA 1WCNA 1KDHA 3IN5A 2AGPA 1KFDA 2GOLA 4BWMA 4LJXA 1ZQCA 2W9CB 4FE3A 1T4GA 2JHDA 3M1YA 4C0ZA 1ZQGA 1X6IA 2ZUCA 4DQQA 3C29A 4ELUA 1ZQIA 2E8NA 1RQNA 3DEEA 2MRLA 3WKCA 1ZQOA 4CF3A 3G6YA 2XCAA 2QARA 4F5QA 2HSZA 4ECRA 4QZBA 3BDPA 4C8OA 4HAIA 2HHQA 3M6ZA 4GLXA 4UBCA 1U49A 3KHHA 2LM4A 4OJ5A 2YX8A 8ICFA 2KOBA 2VANA 1N63A 4FO6A 5ALWA 3BQ2A 1TAUA 4U7CA 2HHTA 9ICGA 3GV8B 5CRXA 4BGDA 3IDWA 3KBBA 4UQGA 3MBYA 2NRVA 3AEVA 4O5CA 1UT8A 3H0MB 8ICTA 1ZRMA 4TQRA 3QNMA 4PPXA 4KLOA 5DDMA 2NYVA 1MQ2A 2B21A 5ALSA 1VLBA 3G6XA 4KLLA 1QCKA 2VJ4A 4U6PA 3EPIA 4CF5A 1Z19A 3ED5A 2VA3A 3UPQA 4JV1A 8ICIA 2WB1C 2W7PA 1UT5A 2YQEA 4RQ0A 4IRDA 9ICVA 4PZOA 8ICHA 3RRHA 1NJZA 3WK5A 3OJSA 3IP4B 2QB0B 4X5VA 3GIKA 1SL2A 2BPFA 4UW9A 1XC9A 4KLFA 1ZQPA 5KFIA 4UARA 2G09A 4M04A 4YP3A 3TADC 2KV2A 2FPMA 2AU0A 3AQFA 4M6WB 4AP9A 3TANA 3RAQA 1BPDA 4CRXA 4P0QB 2DWQA 4NL9A 2K4IA 4UB4A 2KKPA 4M6WA 3RTVA 3RF9A 2EZZA 1SZPA 1J2MA 3UXPA 2BPCA 4YXMA 4R65A 1DGJA 1L3VA 3L5KA 3MGHA 4EEKA 5ALYA 3PSPA 3SV4A 1S5LU 2HOFA 5DLGA 4JWMA 4Y2XA 1D8BA 2JEJA 2FDRA 5KG3A 2JZBB 2XY6A 3SD7A 4FZLA 4RQ6A 4F50A 1RQLA 2E3TA 1HJPA 2EAOA 1UA0A 1NJWA 1ZQWA 1JXEA 3PMNA 3LVVA 2W55A 4ED7A 4WJ3B 5GTHU 2G5IB 5J0UA 4NLGA 3CRXA 5KFYA 4B6JA 2HHSA 1PK1A 1X9SA 1QSLA 3ZD9A 4KMUA 2CN1A 5L1LA 2JH7A 5L1MA 3V7KA 3MFHA 1KLNA 2J6TA 5J0TA 7ICTA 2PFNA 1X2IA 1UA1A 1NK6A 5ALUA 2R8KA 3KFUF 4NJ8A 1BGXT 4OD0A 4BDPA 3F2CA 3UQ0A 3ZDDA 3C23A 1L3UA 4DO9A 1TK8A 4GC6A 5KFEA 4EYHB 4B9SA 5EE0A 7ICLA 3T5JA 4RNNA 1TK5A 2XIDA 3SI8A 1D9FA 4O3OA 2E1FA 4PHPA 4I2EA 4KX3A 3L4PA 4DQIA 1SWWA 2MSNA 3UMBA 4C7ZA 1WCLA 3RB4A 4B9NA 2A1AA 4F2RA 3N28A 2K89A 3RB3A 1A0PA 4F5NA 4RQ7A 4IR1A 5KG7A 4DL5A 4KLIA 4DSIA 5G5HA 1SV4A 4AYBF 2AH5A 3ZD8A 3V7JA 1V97A 3RJJA 1XNSA 1KSPA 2LI6A 5KFMA 2G06A 1DK3A 2D3DA 1ZQAA 2KSOA 2R8JA 4Y2VA 3WKBA 4IR9A 5JU5A 5CP2A 4RT2A 1U9LA 4USAA 1RXWA 1NI3A 1YZ6A 1ED1A 1SXEA 5J0OA 4EBCA 5AKLA 4TQSA 4YR0A 1Z1VA 2WAQC 1O08A 2K4PA 3JPSA 3BQ1A 3MR5A 2EDUA 3UMCA 3KZXA 4LVSA 4Y2PA 3MC1A 2K60A 2R8HA 3PW5A 5AIAA 3RFAA 3TQ1A 2A1JA 4F4YA 5AICA 3EW9A 2XGPA 4DFPA 5EE1A 2PMZF 2M0NA 5KFBA 7ICQA 2W3RA 1J2NA 5DG9A 4IQWA 5F9LA 4CGZA 4R64A 9ICPA 3BS5B 2IOFA 1ZOLA 2ZG6A 4YMMA 5L9XA 1XU4A 4RU9A 2OYYA 2Y9UA 4C8NA 1DK2A 5J8YC 3NRZA 2KJ5A 5A0LA 1B43A 4F5OA 2LPEA 1CUKA 3AQEA 1MSWD 5IIJA 3EUB2 1JX4A 5KFRA 3RJEA 2HCFA 3Q8PB 3PVXA 3KD3A 4QW9A 3JPNA 1WUDA 1WG8A 2NRZA 3H7IA 1AQ6A 3SAGA 1NK4A 4UAZA 1N5XA 4YMOA 4F4XA 3H4DA 2AHOB 1BNPA 5ALHA 5DB9A 2KMDA 5EWFA 4RQ5A 4BXOB 1JXLA 3LYSA 5J0XA 1JUDA 2ES6A 9ICOA 2HBMA 1BVSA 3GIIA 5J2KA 3PSTA 4BXOA 3ETLA 5J0RA 3QEAZ 3AU6A 2PI4A 4TUPA 5F9NA 8ICSA 5KFAA 2BHNA 2F8KA 2KKVA 5AKJA 4JWNA 3AU2A 3GIMA 2W9MA 2MUTB 2W9AA 2R8IA 1XO1A 1ZQSA 2W9BA 5KFSA 3A0BU 2JXJA 4O3MA 1NK5A 2KEYA 3D2NA 3I1YA 2JGAA 4EZ9A 3ISDA 3RBEA 9ICBA 2ZTCA 1Q3VA 8ICRA 4OCZA 2KG5A 4QZGA 2UVUA 1SL0A 4BJQA 5J2FA 5AKKA 3HP6A 3WU2U 4XA5A 1UCVA 3HRDD 3O0FA 4RT3A 8ICWA 3H40A 4UAYA 4ED0A 2F44A 4BX9C 2WF9A 2HHVA 9ICUA 1XS9D 1B4FA 5DGAA 1S0VA 4I2IA 1DXSA 3QEBZ 4PZNA 3H4BA 5ALRA 2IOHA 2WF8A 3V72A 5CHGA 5ALIA 4ECXA 2KHQA 5D49A 3C2LA 2DF4B 4F91B 3I76A 1X9WA 3PX0A 4QZ8A 4LZDA 2DPJA 4RNOA 2KZ3A 5C0YA 3KHRA 2DBYA 4Q43A 4MHVA 1L7MA 4ECQA 3N7RC 5JRTA 2BDPA 4B9TA 4QWCA 4NLKA 1GO3F 4I27A 2GH1A 4KMOB 3NUQA 4KLJA 1U48A 3OPXA 2NO5A 4I29A 9ICTA 3BQ7A 1WWUA 4NLCA 4F93B 5ALGA 2W43A 5KTQA 1N48A 2BCUA 1U45A 4O3NA 1C7YA 4Z6EA 8ICUA 1X42A 3Q8QB 2YMQA 2ISPA 1PK3A 5J2IA 3WKEA 3G6VA 3PX4A 2JEFA 3WKAA 5KAFU 5KT2A 2C2RA 1DGSA 9ICCA 3AM9A 3HJEA 9ICNA 9ICLA 4CE6A 1FFVA 4J9PA 5KAIU 4MFFA 2QKQA 2W9CA 3Q8KA 4PGQA 2AGQA 5J0QA 2A3VA 2WF5A 1V9PA 2M9NA 4GIBA 5KFGA 2C22A 3SZ2A 3E0FA 4DFJA 4E0DA 2ASLA 8ICPA 2ZIUB 4DL2A 3FM9A 3IRUA 5AKGA 3T5HA 2KK0A 3WK4A 2RHFA 2K8CB 4O3QA 3OGUA 1BPEA 5L1KA 8ICMA 3F2DA 2IHMA 2C2DA 2FLLA 5CA7A 3QUQA 4M0AA 1RYSA 3DDHA 5KL8B 4FFDA 1ZQQA 2LYHA 4ELTA 3CNHA 3FYHA 5AI5A 2ZIXB 5J2GA 2KJ9A 5CB1A 1TAQA 5IIOA 3ONNA 4C80A 5KFOA 3N7SC 1NK9A 5CR0A 2HVIA 4RZRA 8ICCA 3RJGA 2BDUA 2ODGA 3D2SA 2E8OA 1TAMA 2GO7A 3HKZF 5KT4A 2ASDA 7ICPA 3C1ZA 4NLZA 4Z6FA 3Q8MA 1Z4NA 3QU5A 1OUQA 4IRCA 4GXIA 2LBOA 9ICAA 4PHDA 4K4HA 5J0PA 8ICNA 3OJUA 2KTQA 3RH6A 1S9FA 1ZQTA 4K4IA 4DS4A 5J2AA 5J0YA 2DFLA 1HIWA 4EBEA 3QUBA 2P66A 3K1RB 9ICKA 4C8KA 3NVYA 1Q3UA 5KG1A 3BQ0A 1S0NA 2W3SA 5DKWA 2H5XA 2K8BB 1F44A 2QB0A 3AL0B 2F77X 2KVSA 1B22A 4J03A 2OXOA 7ICHA 2BQRA 4AYBC 2PFOA 2KICA 5HHIA 4DWIA 5AKZA 1Q8KA 2P35A 5AKYA 4F92B 2VJ5A 1NKBA 2FMSA 5AKIA 4P0QA 4UB3A 3NGDA 4J9QA 4DSJA 2W7OA 2C2EA 4PJ0U 1SGGA 4RUAA 5AI4A 1BNOA 3C28A 2IMWP 1MQ3A 2BQ3A 7ICKA 3R9KA 3PR4A 1IXRA 2BGWA 5KL1B 5KFLA 1BPZA 1FO4A 3WKDA 3K1ZA 3V6HA 2ZIVB 1A76A 2FLPA 2H3VA 3NS1A 4Y2UA 4ECVA 5BOMA 1XO0A 2YB1A 4PGYA 1IG6A 3B0YA 2JZBA 2ZIVA 2HBJA 1KN5A 3ETRA 2F76X 2KFNA 4FZMA 4FS1A 2Y0SC 3NRWA 4Z6CA 2XY5A 3TAQA 2P6RA 4B9VA 1NJXA 2XY7A 1CI4A 3IHQB 2Q4TA 2JH1A 3F5EA 4M9GA 2YTUA 2PMZC 3OSNA 1LKYB 1ZD4A 5AI6A 5KT6A 4G3IA 3UM9A 3LK9A 2KN7A 1QSYA 3RJFA 4F71A 2KE7A 2F1JA 4ZOHC 4F4WA 1RPLA 4FBTA 3TAPA 5DLFA 2K4EA 7ICUA 4MFCA 4UB8U 8ICBA 4O9MA 2KIVA 4F8RA 3QU4A 4PH5A 1ZQMA 4EX7A 2RRDA 4RQ1A 2W8KA 5EWGA 4JV2A 5DG7A 1NK7A 5B5EU 4Q44A 1Z00B 1NK0A 1ZQLA 5AI8A 4M9HA 4YN4A 2JR5A 1JI7A 2CPRA 4LZGA 4YD2A 1VJ5A 2VKQA 1D8YA 2F1IA 4KLMA 3H0LB 3E58A 1Y88A 5ALZA 1S97A 5B66U 4RQ8A 4ED8A 4QZIA 3H8MA 4O3RA 1X66A 5EE9A 2ZIWB 5CWRA 4Q8FA 4IS7A 5AIBA 1U4BA 5KFFA 3UXOA 2EAMA 4FBUA 9ICMA 3KKAA 4J9NA 2HDOA 2C28A 2IA6A 3RRGA 3C2KA 3F53A 3WK7A 1KEJA 5JUMA 5G5GA 3EWAA 4DSFA 1QSSA 2JEIA 5D46A 5KG4A 3VC8A 5ALPA 2BCRA 4UATA 4RNMA 1BPXA 1JALA 1QQ6A 2O6KA 1KQQA 1QQ5A 9ICSA 2XC9A 2F2AB 4ECUA 3KOOA 3RR8A 5KFCA 2IOFK 1LB2B 5FP0A 3HILA 3MGIA 3F2BA 2ZUDA 4DF4A 5DQHA 5KNIA 4CNQA 2RDJA 2KP7A 2VA2A 1T94A 3SV3A 2MAXA 5ALLA 4ACOA 4DCCA 7ICMA 7ICSA 1S77D 4C4RA 4R66A 5AKXA 2E5SA 2HHXA 3UXNA 4KX5A 2XGQA 3SYZA 4NL9C 1D8LA 4YCXA 3QYPA 3BJYA 2JEGA 4KN4A 3IG8A 5KFXA 3M6KA 4P4OA 8ICJA 5HR7A 3C21A 3L3FX 3TI0A 4F4KA 4KLGA 1RDFA 2V4RA 2I9GA 1K5OA 1MC8A 3BS5A 5KT7A 1SZHA 9ICQA 3SAHA 4F72A 4KLDA 5KFWA 1PZNA 5L1IA 3GZFA 1TE2A 2B6GA 4RQ3A 3HW8A 1PVRA 2BZFA 1HUZA 3GILA 4KLHA 2H3IA 1XSNA 3GV7B 3TFSA 3AUOA 3PW0A 4IQVA 5IINA 4NXZA 2JV3A 2D8CA 1TK0A 4DOBA 4MFAA 4EELA 2WF6A 3QZ7A 5AM0A 1AROP 5DQIA 3JPRA 4J9LA
chains in the Genus database with same CATH topology
3NRWA 2ZXHA 2G5HB 2KJ9A 3N7RC 1DRGA 1KBUA 3ONNA 3N7SC 3KFUF 3KZXA 2XICA 1L6NA 1GO3F 3IP4B 2Q4TA 2JH1A 2BDUA 3F5EA 2GH1A 4NLBA 3RFAA 3D2SA 2F2AB 1TAMA 4KMOB 4O3MA 3HKZC 3IN5A 2KEYA 3D2NA 3NUQA 2PMZC 3ALRA 2ZIUA 3F2CA 2GOLA 2OM6A 2ZIWA 3CP8A 3CYMA 3HKZF 3OPXA 2PMZF 2M0NA 5HR6A 2H3ZA 1PVQA 2G09A 4FE3A 4OJ6A 2HBKA 2JGAA 2JHDA 4C0ZA 2MA1A 4OJOA 2RP5A 3F2BA 2KV2A 4NLCA 2XI9A 4CGZA 2DQNB 3AQFA 1OUQA 1IIPA 3C29A 2LBOA 2KHVA 2XIDA 1Q3VA 3H0RB 4JMUA 1T94A 2N1RA 2D6FC 4CRXA 4P0QB 2ZG6A 4ACOA 2E1FA 2K4IA 2E1EA 4KX3A 2OH2A 1A6SA 2H3QA 4P0PB 2KKPA 3PZPA 3DEEA 3SAFA 2HOQA 2K4EA 2MRLA 4BJQA 3M7DA 2OYYA 1Z1BA 2XVTA 3RF9A 2E5SA 2ZIXA 3PSFA 2LHTA 1HIWA 4KX5A 2KJ5A 3PSIA 4QJFB 5T14A 1Q3UA 2H3FA 2W03A 2K89A 5A0LA 3O0FA 2K8BB 2RRDA 2HBLA 1A0PA 2K8AA 4QIWC 1F44A 3ICXA 3M6ZA 2KD1A 2KJ8A 3AL0B 4QIWF 3IG8A 3AQEA 3M6KA 2F77X 1ECWA 3PSPA 1MA7A 2CRXA 2OXOA 4OJ5A 1YT3A 2KNJA 4NWIA 2HOFA 1D8BA 2YX8A 4BX9C 5HR7A 4AYBC 4OJPA 2KOBA 1NZBA 3L3FX 1WUDA 2KICA 4AYBF 3F5AA 4FZLA 2CPRA 2HMXA 1URJA 3SAGA 2JMGA 1CRXA 2G07A 2VKQA 4ICAA 4A8EA 2F8LA 2KVCA 3LVWA 4U7CA 4BUGA 2A3VA 1HEKA 4PL2A 3H0LB 1XNSA 5CRXA 2VJ5A 1SZHA 3LVVA 2G06A 3SAHA 4P0QA 3E0FA 3GU3A 3MGVA 2W7OA 3T79A 2LYBA 2ZXIA 4CDGA 2G0AA 3SMVA 4WJ3B 3H0MB 3C28A 3SQIA 2DGZA 4PL1A 4OJLA 2WAQF 3GZFA 3VCBA 2KIWA 2G5IB 2ZIUB 2ZIWB 2YB4A 2Y0SF 2R18A 2W04A 5KL1B 3LYSA 3D2QA 1PVRA 4FZNA 3CRXA 2KHQA 1PVPA 3K1ZA 4NV0A 2Z7JA 2ZIVB 1UPHA 2RHFA 2DF4B 2G08A 2K8CB 1ZQ1C 2H3VA 2LKYA 2H3IA 2HBMA 3F2DA 2VJ4A 1ED1A 3PSTA 4U6PA 2NV3A 2HOIA 2VIXA 4IC9A 1XO0A 4P0PA 2YB1A 3F53A 2CN1A 1P7DA 2LYAA 4GFJA 4OO1J 4QNLA 3IG5A 5C0YA 3N7PD 5KL8B 1Z19A 2JH7A 2ZIVA 2HBJA 2WB1C 2F76X 2KKVA 2WB1F 2WAQC 2W7PA 4FZMA 2K4HA 2ZIXB 2Y0SC 3VC8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JMU A;  2N1R A;  2K4I A;  1A6S A;  1UPH A;  1L6N A;  2H3Q A;  2HMX A;  2H3V A;  2JMG A;  2H3I A;  2K4E A;  4ICA A;  1TAM A;  1ED1 A;  1HEK A;  2NV3 A;  2GOL A;  4IC9 A;  1HIW A;  2LYA A;  2H3F A;  2H3Z A;  2LYB A;  2K4H A;  1ECW A; 
#chains in the Genus database with same CATH topology
 2A19 A;  4ELV A;  2HHW A;  2R8G A;  1X9M A;  4Z6D A;  4I2F A;  1YZ7 A;  3C5G A;  2RLT A;  2E8P A;  5AKE A;  1WWV A;  3QU2 A;  5HR6 A;  2H3Z A;  2ASJ A;  3SR6 A;  3QZ8 A;  2MA1 A;  4OJO A;  2RP5 A;  2XI9 A;  1SB3 C;  5KFZ A;  1ZQH A;  1IIP A;  3H8J A;  2FMP A;  2L5Y A;  1QLN A;  3H0R B;  4DSE A;  2EZX A;  4QW8 A;  3H8W A;  1KRP A;  3E2E A;  3RB6 A;  1UQV A;  1N5W A;  2NO4 A;  4US8 A;  4YD1 A;  5J0W A;  1ZQZ A;  3M7D A;  1Z1B A;  2XVT A;  5AI9 A;  2KZZ A;  3C2M A;  2MUT A;  1ZQN A;  1Z4O A;  4YQW A;  4C7Y A;  5DBA A;  2QB1 A;  3ICX A;  1ZRN A;  5ALT A;  3JPP A;  4DQS A;  3PX6 A;  3M9N B;  3PW2 A;  3M9M B;  7ICE A;  3JPO A;  3RH5 A;  1RG6 A;  4IQU A;  4CCH A;  1UHU A;  8ICO A;  3NVZ A;  1JRO A;  2PFP A;  3ISC A;  2JMG A;  5EE3 A;  4DQR A;  4RPZ A;  3MGV A;  2LYB A;  1L8L A;  2ZXI A;  2OWO A;  4M9N A;  4UBB A;  4UAS A;  2DGZ A;  1NJY A;  2WAQ F;  4F5R A;  2DUY A;  3KHL A;  5KT5 A;  4P4P A;  2Z7J A;  4DFM A;  4EX6 A;  4Y2R A;  2AGO A;  5L1J A;  1V85 A;  3UQ2 A;  5GTI U;  5J2C A;  2HOI A;  4IC9 A;  4XQ8 A;  4JB3 A;  3T5L A;  4R8U B;  5AM1 A;  4J9M A;  1XWL A;  4F4Z A;  3MR3 A;  3QUT A;  4IQT A;  3TAD A;  4M47 A;  1N60 A;  3V7L A;  3HKZ C;  4IRK A;  3T5K A;  4DQP A;  8ICA A;  1ZQD A;  4OJ6 A;  1ZQU A;  4DOC A;  2FMQ A;  4ZH4 A;  2Q0Z X;  4XUS A;  5DB8 A;  2KHV A;  3T3F A;  4M2Y A;  4JMU A;  3V6J A;  2I5H A;  2D6F C;  3K4G A;  4QWB A;  4UB2 A;  1IM4 A;  2E1E A;  4I2G A;  3PZP A;  2BR0 A;  1ZQB A;  1RM6 C;  3BZK A;  1BPB A;  3GIJ A;  4YFK A;  3Q8S B;  5T14 A;  1NOM A;  2H3F A;  4DFK A;  4C8L A;  2BKE A;  3DV9 A;  4QIW F;  4F2S A;  1ZYQ A;  2WHE A;  5AI0 A;  4Y2T A;  1Z3E B;  5KG6 A;  3ZI4 A;  2PXI A;  3HX0 A;  4BWJ A;  2BCS A;  1DOQ A;  1L5U A;  4G9B A;  3ORY A;  3GDX A;  3MFI A;  2G07 A;  5J2J A;  5ALK A;  5KG2 A;  2ALZ A;  4ED1 A;  2AQ4 A;  4RQ4 A;  9ICH A;  3GU3 A;  3MR2 A;  2G0A A;  5DDY A;  5ALE A;  4QZH A;  4UB6 U;  4Y2S A;  4PGX A;  3M8R A;  1JMS A;  3TAR A;  5ALQ A;  1M6Y A;  4DL7 A;  2LKY A;  2W11 A;  1XSL A;  2MU2 A;  3B0X A;  2NV3 A;  4NM1 A;  2LYA A;  2I1Q A;  5DBC A;  3IG5 A;  3N7P D;  1TVA A;  2WFA A;  1TV9 A;  3HPO A;  4CF4 A;  5EOZ A;  1V38 A;  3PW4 A;  3C1Y A;  2QAR B;  2AXT U;  5EWE A;  1S76 D;  3AN1 A;  3QXG A;  5J29 A;  1ZQY A;  2ISO A;  4KLE A;  4J9O A;  5TIS U;  2ZIU A;  4DLG A;  9ICF A;  4MF8 A;  3RB0 A;  3GFK B;  5HMM A;  4DS5 A;  8ICL A;  2EH9 A;  1L7N A;  3NVW A;  5J2H A;  1SL1 A;  5DBB A;  1NNL A;  5J2E A;  1SIJ A;  4QWE A;  1KL9 A;  1N61 A;  4MEY A;  3MDC A;  2PI5 A;  4C4S A;  7ICJ A;  5AM2 A;  3FC4 A;  5KT3 A;  1RYU A;  2ZIX A;  2LHT A;  3WK9 A;  4IL6 U;  3JPT A;  2IBK A;  3K75 D;  4YMN A;  4KLU A;  4B9L A;  3CW2 C;  1NK8 A;  4KIT B;  1WYG A;  4F3O A;  2EAN A;  1ECW A;  1MA7 A;  2KNJ A;  4DL3 A;  1N62 A;  9ICW A;  8ICK A;  1N56 A;  3GQC A;  1S0O A;  2HW3 A;  4MF2 A;  1S10 A;  4PL2 A;  4NM2 A;  2UVV A;  3EYZ A;  2BCQ A;  4NLN A;  5ALF A;  4EBD A;  4JK1 A;  1PUZ A;  1SKR A;  2KIW A;  2YB4 A;  2P6U A;  1D9D A;  4MEX A;  4UAU A;  2W04 A;  1SKS A;  5CJ7 A;  3EZ5 A;  5J2B A;  1SWV A;  1PVP A;  5HP4 A;  5KFD A;  1JRP A;  5DB6 A;  1FEZ A;  5ALO A;  2CXY A;  1ZET A;  2LMR A;  5F3X B;  5AK6 A;  2RQ5 A;  5ALV A;  4UB1 A;  2K4H A;  1T3N A;  4KTQ A;  2BPG A;  3ISB A;  1SXD A;  2KZM A;  5IIM A;  2BCV A;  1SV0 C;  3V6K A;  2OM6 A;  2LM1 A;  4B9U A;  3PR5 B;  3RAX A;  1KFS A;  7ICR A;  1NKC A;  2DPI A;  2HBK A;  3RJI A;  2UVW A;  3M9O B;  9ICJ A;  4DSK A;  5J8Y A;  2QLT A;  4UAW A;  3U26 A;  4ECZ A;  1RXV A;  3J81 j;  4RQ2 A;  2UVR A;  2DL0 A;  4O5E A;  4QZA A;  5CEH A;  1H38 A;  2Y1I A;  1ZQJ A;  4J9R A;  1C20 A;  7ICO A;  4JV0 A;  2K8A A;  4I2C A;  9ICR A;  2KJ8 A;  1PK1 B;  2FI1 A;  1LKY A;  4J9K A;  4OJP A;  1URJ A;  3TAC B;  5AK5 A;  5KFV A;  2YY6 A;  5KFH A;  4RPX A;  3IV6 A;  1HEK A;  4M9J A;  4HYK A;  3A0H U;  3B9J A;  4O0I A;  4QZ9 A;  3KZI U;  4C8M A;  4CDG A;  1ZD5 A;  3SQI A;  1ZQR A;  3D2Q A;  4XRH A;  2FPK A;  5AM4 A;  1QTM A;  1ZD2 P;  4I28 A;  2FPL A;  3S6J A;  2F3N A;  4ECT A;  4RQN A;  1KW4 A;  1Z00 A;  1X6J A;  2ESE A;  4GFJ A;  3PO5 A;  1L3T A;  5DG8 A;  2RDI A;  4P4M A;  4I2H A;  2WB1 F;  4UB5 A;  2VA8 A;  4I2J A;  1N2X A;  3QE9 Y;  1DRG A;  1KBU A;  4ED2 A;  4US9 A;  1KKX A;  2XIC A;  4Y2J A;  3MAB A;  4B9M A;  2J6S A;  4NLB A;  2FLN A;  4I2A A;  5IIK A;  5HNK A;  3ALR A;  1L8O A;  2ZIW A;  3CP8 A;  3CYM A;  3OSP A;  7ICI A;  2F1H A;  5TZV A;  5KFK A;  4DLE A;  2FE9 A;  1QH9 A;  4KLQ A;  3N97 B;  3H8S A;  3MR6 A;  2ZTE A;  2N1R A;  3GV5 B;  2IHN A;  2KSO B;  1A6S A;  4P0P B;  2HOQ A;  5KFP A;  3SEI A;  1U47 A;  8ICQ A;  4ECY A;  7ICG A;  4NY8 A;  3UMG A;  1MN8 A;  4QJF B;  1K1Q A;  1ZD3 A;  4KN7 A;  2I6X A;  3PNC A;  4P0P A;  1QQ7 A;  3QU9 A;  1L3S A;  5ALX A;  2YMP A;  2FJ6 A;  2CRX A;  4NWI A;  5KFN A;  3SEN A;  4I2B A;  4QZD A;  1ZJM A;  1CRX A;  2OCE A;  4RQM A;  4GXJ A;  2OEH A;  2ZUB A;  5AK3 A;  3JPQ A;  3AMZ A;  2A1J B;  3Q8R B;  5III A;  4OJL A;  2Y0S F;  2R18 A;  3MDA A;  4TUS A;  3WK8 A;  1EXN A;  1ZQE A;  3OHB A;  4M9L A;  4JUZ A;  1UPH A;  2W54 A;  2G08 A;  4O3P A;  5C5J A;  4DEZ A;  4F5P A;  1S8O A;  3Q8L A;  3NTU A;  5ALJ A;  2ZTD A;  1P7D A;  4R63 A;  4QNL A;  1J97 A;  1Q46 A;  4UAV A;  2EQY A;  3BQT A;  5AHX A;  1B0X A;  1X9X A;  5JTI A;  1KTQ A;  3NVV A;  2W8L A;  2J6U A;  4K4G A;  5ALD A;  5KG0 A;  1COK A;  3RJK A;  1CEZ A;  2B0C A;  2G5H B;  3QU7 A;  8ICV A;  2JRZ A;  4EZ6 A;  5AM3 A;  7ICV A;  3PY8 A;  4GC7 A;  4DL4 A;  4YVZ A;  4EEY A;  1VDV A;  5KFU A;  5J0S A;  5AM5 A;  1RYR A;  3BZC A;  3KTQ A;  1ZQK A;  1ZJN A;  3HWT A;  3BS7 A;  4QZF A;  2XO7 A;  1TKD A;  1COO A;  2OH2 A;  2H3Q A;  5KFQ A;  4DSL A;  2EZY A;  3PSF A;  5DGB A;  1L7O A;  1OW5 A;  3PSI A;  4DL6 A;  2W03 A;  4ED3 A;  1ZQX A;  2AQ0 A;  1BPY A;  4QIW C;  4O5K A;  4QZC A;  4Y2Q A;  2PKE A;  1YT3 A;  1T7P A;  3LDA A;  2ZJ8 A;  3OTQ A;  5AKH A;  2YMM A;  1NZB A;  2ZJ5 A;  1HUO A;  3F5A A;  4YR2 A;  2HMX A;  2PFQ A;  4A8E A;  2F8L A;  4KLT A;  2KVC A;  4BUG A;  3THV A;  2V9W A;  5J2D A;  8ICE A;  2W9B B;  1SKW A;  5HML A;  3SMV A;  3RJH A;  4PHE A;  5AK4 A;  2OHF A;  4TUR A;  5ALM A;  4QWA A;  3D6J A;  3I28 A;  2DKZ A;  5HHH A;  3ZDC A;  2KFZ A;  3PW7 A;  2NRW A;  1F0M A;  4YR3 A;  4QWD A;  3QX7 A;  2V4Q A;  1XSP A;  3LWL A;  2NRX A;  3RBD A;  2VIX A;  4I2D A;  2DKX A;  1L7P A;  4O3S A;  1ZQF A;  5DQG A;  3PO4 A;  3EPG A;  5H2F U;  3ZDB A;  3KKA C;  8ICG A;  7ICF A;  4Q45 A;  9ICX A;  4TUQ A;  1PVQ A;  2ZXH A;  4C4T A;  4RPY A;  3TFR A;  2HHU A;  4RUC A;  4Q8E A;  2BQU A;  4QZE A;  1X40 A;  1RZT A;  2EAP A;  2Y9T A;  1FFU A;  3PML A;  3IM1 A;  5KFT A;  2WTF A;  4DF8 A;  4PHA A;  1ZXI A;  2DQN B;  1FIQ A;  2GWS A;  3FDS A;  5K4L A;  3N4M B;  3PV8 A;  1T3Q A;  3M8S A;  1T8E A;  1KFT A;  3SAF A;  4ECW A;  4ECS A;  1NZP A;  4R8U A;  4ED6 A;  3ZDA A;  3C5F A;  2Y1J A;  2HBL A;  2YML A;  3FAH A;  1TFR A;  8ICZ A;  5KFJ A;  2KD1 A;  5DB7 A;  5D4B A;  1LV5 A;  3LWM A;  7ICN A;  2ZJA A;  3OHA A;  3WK6 A;  3TKA A;  9ICI A;  1NKE A;  3ZDE A;  1S0M A;  1JIH A;  2WF7 A;  4Y2Y A;  4ICA A;  3LVW A;  5KG5 A;  1F5S A;  3NAS A;  4DOA A;  1LVH A;  1K1S A;  2NRT A;  4GXK A;  4YG2 A;  4YXJ A;  4DFD A;  2AJQ A;  1SV0 A;  3T79 A;  2XCP A;  2GLE A;  3KHG A;  4PL1 A;  3VCB A;  5ALN A;  4J9S A;  2HI0 A;  4P2H A;  4EEN A;  4FZN A;  3QUC A;  4NV0 A;  9ICE A;  1JN3 A;  3HT3 A;  4EYI B;  5E79 U;  1ZQ1 C;  5BPC A;  4KLS A;  1IV8 A;  4OO1 J;  2ATL A;  1OXJ A;  2YN4 A;  5BOL A;  2HVH A;  2E8M A;  8ICX A;  1ZQV A;  3RH4 A;  1A77 A;  8ICY A;  4FS2 A;  5IIL A;  1O03 A;  3RR7 A;  1L6N A;  1WCN A;  1KDH A;  3IN5 A;  2AGP A;  1KFD A;  2GOL A;  4BWM A;  4LJX A;  1ZQC A;  2W9C B;  4FE3 A;  1T4G A;  2JHD A;  3M1Y A;  4C0Z A;  1ZQG A;  1X6I A;  2ZUC A;  4DQQ A;  3C29 A;  4ELU A;  1ZQI A;  2E8N A;  1RQN A;  3DEE A;  2MRL A;  3WKC A;  1ZQO A;  4CF3 A;  3G6Y A;  2XCA A;  2QAR A;  4F5Q A;  2HSZ A;  4ECR A;  4QZB A;  3BDP A;  4C8O A;  4HAI A;  2HHQ A;  3M6Z A;  4GLX A;  4UBC A;  1U49 A;  3KHH A;  2LM4 A;  4OJ5 A;  2YX8 A;  8ICF A;  2KOB A;  2VAN A;  1N63 A;  4FO6 A;  5ALW A;  3BQ2 A;  1TAU A;  4U7C A;  2HHT A;  9ICG A;  3GV8 B;  5CRX A;  4BGD A;  3IDW A;  3KBB A;  4UQG A;  3MBY A;  2NRV A;  3AEV A;  4O5C A;  1UT8 A;  3H0M B;  8ICT A;  1ZRM A;  4TQR A;  3QNM A;  4PPX A;  4KLO A;  5DDM A;  2NYV A;  1MQ2 A;  2B21 A;  5ALS A;  1VLB A;  3G6X A;  4KLL A;  1QCK A;  2VJ4 A;  4U6P A;  3EPI A;  4CF5 A;  1Z19 A;  3ED5 A;  2VA3 A;  3UPQ A;  4JV1 A;  8ICI A;  2WB1 C;  2W7P A;  1UT5 A;  2YQE A;  4RQ0 A;  4IRD A;  9ICV A;  4PZO A;  8ICH A;  3RRH A;  1NJZ A;  3WK5 A;  3OJS A;  3IP4 B;  2QB0 B;  4X5V A;  3GIK A;  1SL2 A;  2BPF A;  4UW9 A;  1XC9 A;  4KLF A;  1ZQP A;  5KFI A;  4UAR A;  2G09 A;  4M04 A;  4YP3 A;  3TAD C;  2KV2 A;  2FPM A;  2AU0 A;  3AQF A;  4M6W B;  4AP9 A;  3TAN A;  3RAQ A;  1BPD A;  4CRX A;  4P0Q B;  2DWQ A;  4NL9 A;  2K4I A;  4UB4 A;  2KKP A;  4M6W A;  3RTV A;  3RF9 A;  2EZZ A;  1SZP A;  1J2M A;  3UXP A;  2BPC A;  4YXM A;  4R65 A;  1DGJ A;  1L3V A;  3L5K A;  3MGH A;  4EEK A;  5ALY A;  3PSP A;  3SV4 A;  1S5L U;  2HOF A;  5DLG A;  4JWM A;  4Y2X A;  1D8B A;  2JEJ A;  2FDR A;  5KG3 A;  2JZB B;  2XY6 A;  3SD7 A;  4FZL A;  4RQ6 A;  4F50 A;  1RQL A;  2E3T A;  1HJP A;  2EAO A;  1UA0 A;  1NJW A;  1ZQW A;  1JXE A;  3PMN A;  3LVV A;  2W55 A;  4ED7 A;  4WJ3 B;  5GTH U;  2G5I B;  5J0U A;  4NLG A;  3CRX A;  5KFY A;  4B6J A;  2HHS A;  1PK1 A;  1X9S A;  1QSL A;  3ZD9 A;  4KMU A;  2CN1 A;  5L1L A;  2JH7 A;  5L1M A;  3V7K A;  3MFH A;  1KLN A;  2J6T A;  5J0T A;  7ICT A;  2PFN A;  1X2I A;  1UA1 A;  1NK6 A;  5ALU A;  2R8K A;  3KFU F;  4NJ8 A;  1BGX T;  4OD0 A;  4BDP A;  3F2C A;  3UQ0 A;  3ZDD A;  3C23 A;  1L3U A;  4DO9 A;  1TK8 A;  4GC6 A;  5KFE A;  4EYH B;  4B9S A;  5EE0 A;  7ICL A;  3T5J A;  4RNN A;  1TK5 A;  2XID A;  3SI8 A;  1D9F A;  4O3O A;  2E1F A;  4PHP A;  4I2E A;  4KX3 A;  3L4P A;  4DQI A;  1SWW A;  2MSN A;  3UMB A;  4C7Z A;  1WCL A;  3RB4 A;  4B9N A;  2A1A A;  4F2R A;  3N28 A;  2K89 A;  3RB3 A;  1A0P A;  4F5N A;  4RQ7 A;  4IR1 A;  5KG7 A;  4DL5 A;  4KLI A;  4DSI A;  5G5H A;  1SV4 A;  4AYB F;  2AH5 A;  3ZD8 A;  3V7J A;  1V97 A;  3RJJ A;  1XNS A;  1KSP A;  2LI6 A;  5KFM A;  2G06 A;  1DK3 A;  2D3D A;  1ZQA A;  2KSO A;  2R8J A;  4Y2V A;  3WKB A;  4IR9 A;  5JU5 A;  5CP2 A;  4RT2 A;  1U9L A;  4USA A;  1RXW A;  1NI3 A;  1YZ6 A;  1ED1 A;  1SXE A;  5J0O A;  4EBC A;  5AKL A;  4TQS A;  4YR0 A;  1Z1V A;  2WAQ C;  1O08 A;  2K4P A;  3JPS A;  3BQ1 A;  3MR5 A;  2EDU A;  3UMC A;  3KZX A;  4LVS A;  4Y2P A;  3MC1 A;  2K60 A;  2R8H A;  3PW5 A;  5AIA A;  3RFA A;  3TQ1 A;  2A1J A;  4F4Y A;  5AIC A;  3EW9 A;  2XGP A;  4DFP A;  5EE1 A;  2PMZ F;  2M0N A;  5KFB A;  7ICQ A;  2W3R A;  1J2N A;  5DG9 A;  4IQW A;  5F9L A;  4CGZ A;  4R64 A;  9ICP A;  3BS5 B;  2IOF A;  1ZOL A;  2ZG6 A;  4YMM A;  5L9X A;  1XU4 A;  4RU9 A;  2OYY A;  2Y9U A;  4C8N A;  1DK2 A;  5J8Y C;  3NRZ A;  2KJ5 A;  5A0L A;  1B43 A;  4F5O A;  2LPE A;  1CUK A;  3AQE A;  1MSW D;  5IIJ A;  3EUB 2;  1JX4 A;  5KFR A;  3RJE A;  2HCF A;  3Q8P B;  3PVX A;  3KD3 A;  4QW9 A;  3JPN A;  1WUD A;  1WG8 A;  2NRZ A;  3H7I A;  1AQ6 A;  3SAG A;  1NK4 A;  4UAZ A;  1N5X A;  4YMO A;  4F4X A;  3H4D A;  2AHO B;  1BNP A;  5ALH A;  5DB9 A;  2KMD A;  5EWF A;  4RQ5 A;  4BXO B;  1JXL A;  3LYS A;  5J0X A;  1JUD A;  2ES6 A;  9ICO A;  2HBM A;  1BVS A;  3GII A;  5J2K A;  3PST A;  4BXO A;  3ETL A;  5J0R A;  3QEA Z;  3AU6 A;  2PI4 A;  4TUP A;  5F9N A;  8ICS A;  5KFA A;  2BHN A;  2F8K A;  2KKV A;  5AKJ A;  4JWN A;  3AU2 A;  3GIM A;  2W9M A;  2MUT B;  2W9A A;  2R8I A;  1XO1 A;  1ZQS A;  2W9B A;  5KFS A;  3A0B U;  2JXJ A;  4O3M A;  1NK5 A;  2KEY A;  3D2N A;  3I1Y A;  2JGA A;  4EZ9 A;  3ISD A;  3RBE A;  9ICB A;  2ZTC A;  1Q3V A;  8ICR A;  4OCZ A;  2KG5 A;  4QZG A;  2UVU A;  1SL0 A;  4BJQ A;  5J2F A;  5AKK A;  3HP6 A;  3WU2 U;  4XA5 A;  1UCV A;  3HRD D;  3O0F A;  4RT3 A;  8ICW A;  3H40 A;  4UAY A;  4ED0 A;  2F44 A;  4BX9 C;  2WF9 A;  2HHV A;  9ICU A;  1XS9 D;  1B4F A;  5DGA A;  1S0V A;  4I2I A;  1DXS A;  3QEB Z;  4PZN A;  3H4B A;  5ALR A;  2IOH A;  2WF8 A;  3V72 A;  5CHG A;  5ALI A;  4ECX A;  2KHQ A;  5D49 A;  3C2L A;  2DF4 B;  4F91 B;  3I76 A;  1X9W A;  3PX0 A;  4QZ8 A;  4LZD A;  2DPJ A;  4RNO A;  2KZ3 A;  5C0Y A;  3KHR A;  2DBY A;  4Q43 A;  4MHV A;  1L7M A;  4ECQ A;  3N7R C;  5JRT A;  2BDP A;  4B9T A;  4QWC A;  4NLK A;  1GO3 F;  4I27 A;  2GH1 A;  4KMO B;  3NUQ A;  4KLJ A;  1U48 A;  3OPX A;  2NO5 A;  4I29 A;  9ICT A;  3BQ7 A;  1WWU A;  4NLC A;  4F93 B;  5ALG A;  2W43 A;  5KTQ A;  1N48 A;  2BCU A;  1U45 A;  4O3N A;  1C7Y A;  4Z6E A;  8ICU A;  1X42 A;  3Q8Q B;  2YMQ A;  2ISP A;  1PK3 A;  5J2I A;  3WKE A;  3G6V A;  3PX4 A;  2JEF A;  3WKA A;  5KAF U;  5KT2 A;  2C2R A;  1DGS A;  9ICC A;  3AM9 A;  3HJE A;  9ICN A;  9ICL A;  4CE6 A;  1FFV A;  4J9P A;  5KAI U;  4MFF A;  2QKQ A;  2W9C A;  3Q8K A;  4PGQ A;  2AGQ A;  5J0Q A;  2A3V A;  2WF5 A;  1V9P A;  2M9N A;  4GIB A;  5KFG A;  2C22 A;  3SZ2 A;  3E0F A;  4DFJ A;  4E0D A;  2ASL A;  8ICP A;  2ZIU B;  4DL2 A;  3FM9 A;  3IRU A;  5AKG A;  3T5H A;  2KK0 A;  3WK4 A;  2RHF A;  2K8C B;  4O3Q A;  3OGU A;  1BPE A;  5L1K A;  8ICM A;  3F2D A;  2IHM A;  2C2D A;  2FLL A;  5CA7 A;  3QUQ A;  4M0A A;  1RYS A;  3DDH A;  5KL8 B;  4FFD A;  1ZQQ A;  2LYH A;  4ELT A;  3CNH A;  3FYH A;  5AI5 A;  2ZIX B;  5J2G A;  2KJ9 A;  5CB1 A;  1TAQ A;  5IIO A;  3ONN A;  4C80 A;  5KFO A;  3N7S C;  1NK9 A;  5CR0 A;  2HVI A;  4RZR A;  8ICC A;  3RJG A;  2BDU A;  2ODG A;  3D2S A;  2E8O A;  1TAM A;  2GO7 A;  3HKZ F;  5KT4 A;  2ASD A;  7ICP A;  3C1Z A;  4NLZ A;  4Z6F A;  3Q8M A;  1Z4N A;  3QU5 A;  1OUQ A;  4IRC A;  4GXI A;  2LBO A;  9ICA A;  4PHD A;  4K4H A;  5J0P A;  8ICN A;  3OJU A;  2KTQ A;  3RH6 A;  1S9F A;  1ZQT A;  4K4I A;  4DS4 A;  5J2A A;  5J0Y A;  2DFL A;  1HIW A;  4EBE A;  3QUB A;  2P66 A;  3K1R B;  9ICK A;  4C8K A;  3NVY A;  1Q3U A;  5KG1 A;  3BQ0 A;  1S0N A;  2W3S A;  5DKW A;  2H5X A;  2K8B B;  1F44 A;  2QB0 A;  3AL0 B;  2F77 X;  2KVS A;  1B22 A;  4J03 A;  2OXO A;  7ICH A;  2BQR A;  4AYB C;  2PFO A;  2KIC A;  5HHI A;  4DWI A;  5AKZ A;  1Q8K A;  2P35 A;  5AKY A;  4F92 B;  2VJ5 A;  1NKB A;  2FMS A;  5AKI A;  4P0Q A;  4UB3 A;  3NGD A;  4J9Q A;  4DSJ A;  2W7O A;  2C2E A;  4PJ0 U;  1SGG A;  4RUA A;  5AI4 A;  1BNO A;  3C28 A;  2IMW P;  1MQ3 A;  2BQ3 A;  7ICK A;  3R9K A;  3PR4 A;  1IXR A;  2BGW A;  5KL1 B;  5KFL A;  1BPZ A;  1FO4 A;  3WKD A;  3K1Z A;  3V6H A;  2ZIV B;  1A76 A;  2FLP A;  2H3V A;  3NS1 A;  4Y2U A;  4ECV A;  5BOM A;  1XO0 A;  2YB1 A;  4PGY A;  1IG6 A;  3B0Y A;  2JZB A;  2ZIV A;  2HBJ A;  1KN5 A;  3ETR A;  2F76 X;  2KFN A;  4FZM A;  4FS1 A;  2Y0S C;  3NRW A;  4Z6C A;  2XY5 A;  3TAQ A;  2P6R A;  4B9V A;  1NJX A;  2XY7 A;  1CI4 A;  3IHQ B;  2Q4T A;  2JH1 A;  3F5E A;  4M9G A;  2YTU A;  2PMZ C;  3OSN A;  1LKY B;  1ZD4 A;  5AI6 A;  5KT6 A;  4G3I A;  3UM9 A;  3LK9 A;  2KN7 A;  1QSY A;  3RJF A;  4F71 A;  2KE7 A;  2F1J A;  4ZOH C;  4F4W A;  1RPL A;  4FBT A;  3TAP A;  5DLF A;  2K4E A;  7ICU A;  4MFC A;  4UB8 U;  8ICB A;  4O9M A;  2KIV A;  4F8R A;  3QU4 A;  4PH5 A;  1ZQM A;  4EX7 A;  2RRD A;  4RQ1 A;  2W8K A;  5EWG A;  4JV2 A;  5DG7 A;  1NK7 A;  5B5E U;  4Q44 A;  1Z00 B;  1NK0 A;  1ZQL A;  5AI8 A;  4M9H A;  4YN4 A;  2JR5 A;  1JI7 A;  2CPR A;  4LZG A;  4YD2 A;  1VJ5 A;  2VKQ A;  1D8Y A;  2F1I A;  4KLM A;  3H0L B;  3E58 A;  1Y88 A;  5ALZ A;  1S97 A;  5B66 U;  4RQ8 A;  4ED8 A;  4QZI A;  3H8M A;  4O3R A;  1X66 A;  5EE9 A;  2ZIW B;  5CWR A;  4Q8F A;  4IS7 A;  5AIB A;  1U4B A;  5KFF A;  3UXO A;  2EAM A;  4FBU A;  9ICM A;  3KKA A;  4J9N A;  2HDO A;  2C28 A;  2IA6 A;  3RRG A;  3C2K A;  3F53 A;  3WK7 A;  1KEJ A;  5JUM A;  5G5G A;  3EWA A;  4DSF A;  1QSS A;  2JEI A;  5D46 A;  5KG4 A;  3VC8 A;  5ALP A;  2BCR A;  4UAT A;  4RNM A;  1BPX A;  1JAL A;  1QQ6 A;  2O6K A;  1KQQ A;  1QQ5 A;  9ICS A;  2XC9 A;  2F2A B;  4ECU A;  3KOO A;  3RR8 A;  5KFC A;  2IOF K;  1LB2 B;  5FP0 A;  3HIL A;  3MGI A;  3F2B A;  2ZUD A;  4DF4 A;  5DQH A;  5KNI A;  4CNQ A;  2RDJ A;  2KP7 A;  2VA2 A;  1T94 A;  3SV3 A;  2MAX A;  5ALL A;  4ACO A;  4DCC A;  7ICM A;  7ICS A;  1S77 D;  4C4R A;  4R66 A;  5AKX A;  2E5S A;  2HHX A;  3UXN A;  4KX5 A;  2XGQ A;  3SYZ A;  4NL9 C;  1D8L A;  4YCX A;  3QYP A;  3BJY A;  2JEG A;  4KN4 A;  3IG8 A;  5KFX A;  3M6K A;  4P4O A;  8ICJ A;  5HR7 A;  3C21 A;  3L3F X;  3TI0 A;  4F4K A;  4KLG A;  1RDF A;  2V4R A;  2I9G A;  1K5O A;  1MC8 A;  3BS5 A;  5KT7 A;  1SZH A;  9ICQ A;  3SAH A;  4F72 A;  4KLD A;  5KFW A;  1PZN A;  5L1I A;  3GZF A;  1TE2 A;  2B6G A;  4RQ3 A;  3HW8 A;  1PVR A;  2BZF A;  1HUZ A;  3GIL A;  4KLH A;  2H3I A;  1XSN A;  3GV7 B;  3TFS A;  3AUO A;  3PW0 A;  4IQV A;  5IIN A;  4NXZ A;  2JV3 A;  2D8C A;  1TK0 A;  4DOB A;  4MFA A;  4EEL A;  2WF6 A;  3QZ7 A;  5AM0 A;  1ARO P;  5DQI A;  3JPR A;  4J9L A; 
#chains in the Genus database with same CATH homology
 3NRW A;  2ZXH A;  2G5H B;  2KJ9 A;  3N7R C;  1DRG A;  1KBU A;  3ONN A;  3N7S C;  3KFU F;  3KZX A;  2XIC A;  1L6N A;  1GO3 F;  3IP4 B;  2Q4T A;  2JH1 A;  2BDU A;  3F5E A;  2GH1 A;  4NLB A;  3RFA A;  3D2S A;  2F2A B;  1TAM A;  4KMO B;  4O3M A;  3HKZ C;  3IN5 A;  2KEY A;  3D2N A;  3NUQ A;  2PMZ C;  3ALR A;  2ZIU A;  3F2C A;  2GOL A;  2OM6 A;  2ZIW A;  3CP8 A;  3CYM A;  3HKZ F;  3OPX A;  2PMZ F;  2M0N A;  5HR6 A;  2H3Z A;  1PVQ A;  2G09 A;  4FE3 A;  4OJ6 A;  2HBK A;  2JGA A;  2JHD A;  4C0Z A;  2MA1 A;  4OJO A;  2RP5 A;  3F2B A;  2KV2 A;  4NLC A;  2XI9 A;  4CGZ A;  2DQN B;  3AQF A;  1OUQ A;  1IIP A;  3C29 A;  2LBO A;  2KHV A;  2XID A;  1Q3V A;  3H0R B;  4JMU A;  1T94 A;  2N1R A;  2D6F C;  4CRX A;  4P0Q B;  2ZG6 A;  4ACO A;  2E1F A;  2K4I A;  2E1E A;  4KX3 A;  2OH2 A;  1A6S A;  2H3Q A;  4P0P B;  2KKP A;  3PZP A;  3DEE A;  3SAF A;  2HOQ A;  2K4E A;  2MRL A;  4BJQ A;  3M7D A;  2OYY A;  1Z1B A;  2XVT A;  3RF9 A;  2E5S A;  2ZIX A;  3PSF A;  2LHT A;  1HIW A;  4KX5 A;  2KJ5 A;  3PSI A;  4QJF B;  5T14 A;  1Q3U A;  2H3F A;  2W03 A;  2K89 A;  5A0L A;  3O0F A;  2K8B B;  2RRD A;  2HBL A;  1A0P A;  2K8A A;  4QIW C;  1F44 A;  3ICX A;  3M6Z A;  2KD1 A;  2KJ8 A;  3AL0 B;  4QIW F;  3IG8 A;  3AQE A;  3M6K A;  2F77 X;  1ECW A;  3PSP A;  1MA7 A;  2CRX A;  2OXO A;  4OJ5 A;  1YT3 A;  2KNJ A;  4NWI A;  2HOF A;  1D8B A;  2YX8 A;  4BX9 C;  5HR7 A;  4AYB C;  4OJP A;  2KOB A;  1NZB A;  3L3F X;  1WUD A;  2KIC A;  4AYB F;  3F5A A;  4FZL A;  2CPR A;  2HMX A;  1URJ A;  3SAG A;  2JMG A;  1CRX A;  2G07 A;  2VKQ A;  4ICA A;  4A8E A;  2F8L A;  2KVC A;  3LVW A;  4U7C A;  4BUG A;  2A3V A;  1HEK A;  4PL2 A;  3H0L B;  1XNS A;  5CRX A;  2VJ5 A;  1SZH A;  3LVV A;  2G06 A;  3SAH A;  4P0Q A;  3E0F A;  3GU3 A;  3MGV A;  2W7O A;  3T79 A;  2LYB A;  2ZXI A;  4CDG A;  2G0A A;  3SMV A;  4WJ3 B;  3H0M B;  3C28 A;  3SQI A;  2DGZ A;  4PL1 A;  4OJL A;  2WAQ F;  3GZF A;  3VCB A;  2KIW A;  2G5I B;  2ZIU B;  2ZIW B;  2YB4 A;  2Y0S F;  2R18 A;  2W04 A;  5KL1 B;  3LYS A;  3D2Q A;  1PVR A;  4FZN A;  3CRX A;  2KHQ A;  1PVP A;  3K1Z A;  4NV0 A;  2Z7J A;  2ZIV B;  1UPH A;  2RHF A;  2DF4 B;  2G08 A;  2K8C B;  1ZQ1 C;  2H3V A;  2LKY A;  2H3I A;  2HBM A;  3F2D A;  2VJ4 A;  1ED1 A;  3PST A;  4U6P A;  2NV3 A;  2HOI A;  2VIX A;  4IC9 A;  1XO0 A;  4P0P A;  2YB1 A;  3F53 A;  2CN1 A;  1P7D A;  2LYA A;  4GFJ A;  4OO1 J;  4QNL A;  3IG5 A;  5C0Y A;  3N7P D;  5KL8 B;  1Z19 A;  2JH7 A;  2ZIV A;  2HBJ A;  2WB1 C;  2F76 X;  2KKV A;  2WB1 F;  2WAQ C;  2W7P A;  4FZM A;  2K4H A;  2ZIX B;  2Y0S C;  3VC8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...