2H3FA

Solution structure of the hiv-1 ma protein
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
131
structure length
131
Chain Sequence
GARASVLSGGELDKWEKIRLRPGGKKQYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNTIAVLYCVHQRIDVKDTKEALDKIEEEQNKSKKKAQQAAADTGNNSQVSQNY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gag polyprotein
publication title Structural basis for targeting HIV-1 Gag proteins to the plasma membrane for virus assembly.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 30
structure length 131
sequence length 131
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2006-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00540 Gag_p17 gag gene protein p17 (matrix protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.90 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2h3fA01
1L6NA 2N1RA 4IC9A 2JMGA 2H3QA 1TAMA 1HEKA 2NV3A 2HMXA 2H3ZA 1ED1A 2GOLA 4JMUA 1UPHA 2H3VA 2K4EA 2H3IA 1HIWA 4ICAA 2LYAA 1ECWA 2K4IA 2H3FA 2LYBA 2K4HA 1A6SA
chains in the Genus database with same CATH superfamily
2J6SA 4KLUA 3WK8A 3M6KA 4ZH4A 2RP5A 4RNMA 4ED1A 1UHUA 1MSWD 3H4DA 3V7LA 1L8LA 2AH5A 2Q4TA 2W54A 1UA0A 5HR6A 4Y2SA 5JU5A 2FLNA 2YMQA 2QB0A 4K4HA 4R66A 1X9MA 1IG6A 2I5HA 5AIBA 5KAFU 2BCSA 5KG5A 4NLNA 1BPDA 4KX3A 2EZZA 1SKSA 4P0QA 5ALRA 4DCCA 4UB4A 2KHQA 1SXDA 1VDVA 4KLLA 5G5GA 1QLNA 2KFZA 3PW5A 2BGWA 4KLGA 2F1HA 2PMZF 4JUZA 2ZTCA 2KMDA 3KZIU 3JPOA 2NYVA 1TAUA 4B9UA 4KX5A 2JZBB 1N48A 5J0RA 9ICCA 8ICMA 3NGDA 1A77A 4UW9A 1TFRA 3TACB 3IHQB 4RQ4A 3TAQA 1TK0A 5B66U 5DLFA 4BXOA 1J97A 2KN7A 2Q0ZX 2ZIVA 5AICA 5J2IA 2DFLA 4PHAA 1PK1A 4ECZA 3MABA 1C20A 3ZDBA 2WF8A 8ICCA 3QZ7A 5DB9A 1MC8A 4MF8A 4QZAA 3I28A 2HSZA 4GIBA 2JEJA 3E58A 2LBOA 2DQNB 4B9VA 4F93B 1S77D 4KLQA 3KTQA 4XUSA 4IRKA 4RQ5A 3L3FX 2FMPA 8ICNA 2BCQA 1SKWA 1L8OA 4IS7A 2G06A 3FYHA 5CA7A 5ALYA 3M7DA 1DGJA 5KFFA 4Q45A 2ES6A 2W9BB 5AKHA 2JRZA 2KZMA 4J9SA 3RR8A 4QZDA 3PO5A 4NLKA 4KLEA 3ZDAA 4UAUA 2RHFA 3NTUA 3J81j 3LVWA 9ICJA 2HW3A 5KFRA 4NJ8A 1RQNA 5KFNA 5KFQA 4B9MA 2B21A 4YD1A 1LV5A 3V72A 1Z1VA 1ZQUA 3NRWA 3RB0A 2PFQA 3PR4A 4B9TA 1Z1BA 4NLCA 4XQ8A 3L4PA 3F2DA 3MGVA 5L1IA 2HBMA 1WG8A 4YCXA 2CRXA 3B0YA 2GWSA 4IQUA 3M8RA 1TE2A 1GO3F 3SV3A 2DPJA 2BCVA 5AIAA 1ZXIA 5BOLA 4CRXA 3M9NB 4QZBA 1ZQPA 3GV5B 2PFPA 5J2CA 4DLEA 3V6KA 3MDAA 2ZIUA 5AKXA 1QSYA 5DQHA 5AKYA 1ZQWA 5D49A 4ED6A 4O0IA 1AQ6A 4Q44A 3PW4A 1SZHA 1ZD5A 2F44A 3OHAA 4RZRA 4UAYA 2CPRA 1VLBA 2OCEA 4NM1A 9ICAA 1S9FA 2F77X 3NVVA 4J9OA 3TI0A 4ECTA 4OJLA 2JEGA 5KL8B 4EELA 2Z7JA 1NJXA 3F5AA 3PZPA 5HMLA 3MR2A 2YMLA 2YX8A 3PY8A 2NRZA 2ZUCA 4KITB 2FI1A 3V7JA 1DXSA 1ZQCA 2NO4A 4EBDA 1VJ5A 1TAQA 8ICUA 4DEZA 3QUTA 3OHBA 3UXPA 1KKXA 4O3RA 1KLNA 1ZQFA 4UB8U 4RQ2A 4PJ0U 1V9PA 4KLIA 1N2XA 1WYGA 1NZPA 4YR3A 9ICFA 4F4YA 2K4PA 4K4GA 1UPHA 3AM9A 1B4FA 3AU6A 3AUOA 2UVWA 1JX4A 2F1JA 2OM6A 4B6JA 3GIMA 5C0YA 4FS2A 4R8UA 4EEKA 2PMZC 4DSLA 3MR5A 3JPTA 4KLOA 1S0NA 5AK4A 3H7IA 3RJKA 2EDUA 1FIQA 5J0WA 1F44A 9ICLA 1A0PA 3UMGA 1U45A 2AJQA 5AKEA 2HHVA 3OJSA 1ZQYA 1WCLA 4LJXA 2R8HA 5DDYA 3HP6A 4EBCA 2W03A 2J6TA 5AKGA 4EYHB 2FE9A 3M1YA 4ECXA 4C8MA 4F4WA 2P66A 4B9LA 5L1JA 1JI7A 1H38A 5AKZA 1WUDA 5ALGA 2W8LA 4DFJA 3I76A 1LVHA 1RYSA 1U48A 3QNMA 5AK5A 3O0FA 1FFVA 8ICQA 2NRWA 2H3FA 1B43A 2WF9A 5AM2A 4RQ8A 3TADC 4C7YA 4MFFA 1KQQA 3OTQA 1XO0A 3FC4A 4DFPA 1Y88A 1MN8A 5J8YC 5KG7A 4GXIA 4KLMA 2OYYA 3QU5A 1N56A 3OGUA 3H0LB 4KMUA 3SEIA 2VA3A 4GXJA 2XICA 2PFNA 1BPYA 3RJGA 2ASLA 5KFZA 1XS9D 3NVWA 4BWJA 4J9PA 7ICHA 3PW7A 1SV0C 3EUB2 3K1ZA 2KE7A 3WKDA 4DL7A 5DG7A 5KG3A 5J2DA 4PL2A 5T14A 4ECSA 4OD0A 1X42A 3G6YA 3H0MB 2EQYA 2LM4A 1BPBA 4YP3A 5DLGA 5EE3A 2IOFK 7ICJA 4YG2A 5KFVA 5DGBA 1SWVA 2WB1F 3PV8A 3NASA 3SZ2A 9ICIA 5KFEA 2NV3A 1SB3C 4JK1A 4UAVA 4NY8A 1FO4A 7ICFA 4USAA 1ZQDA 1YT3A 1XSPA 2KG5A 5L1MA 2HHUA 8ICLA 4TUSA 3GV7B 2VANA 5HHHA 2N1RA 4O3MA 1S76D 3MFHA 5ALHA 1CRXA 2I6XA 2ZXIA 1F0MA 2FJ6A 2W9MA 1QSSA 3ETLA 5KFAA 1P7DA 1X9SA 4QIWF 7ICVA 4JV0A 5L1KA 3Q8MA 2AGOA 1Q46A 2V4QA 2IA6A 1ZJNA 1RQLA 3MDCA 3EYZA 1N62A 5FP0A 5L1LA 3PX6A 3GIJA 4F72A 4ECUA 1ZOLA 1D8LA 1X6IA 2ZJAA 3SENA 2R8IA 3WKBA 1TV9A 4TQRA 1RYRA 3H8WA 3RAXA 4Y2JA 4UAWA 3EW9A 4NV0A 4FZMA 3OSPA 4QWAA 3BS5A 1OW5A 1B22A 4B9SA 3RJFA 2KKVA 4JWNA 1S0VA 4Y2QA 1QCKA 2ZIWA 3UXNA 5GTHU 2UVVA 5DQIA 4M9LA 4C4RA 4FO6A 3IP4B 2R18A 1NKCA 1L3SA 5J2GA 3Q8RB 4DOBA 2R8JA 2HBLA 2V4RA 3C2MA 3LVVA 8ICHA 4IQWA 2IHNA 1UT8A 2W7PA 2ISOA 3SAFA 1NJWA 4AP9A 4M2YA 2F1IA 1KFDA 2BHNA 4Y2PA 4QZEA 2KFNA 4UB2A 1N60A 3WK6A 2E1FA 4YXJA 2IOFA 3RFAA 4R65A 5ALSA 5AM5A 1HUZA 4PPXA 1UCVA 5ALWA 2DBYA 1WCNA 4KLJA 1KFTA 4B9NA 2P6RA 3T5HA 1U4BA 8ICAA 3ED5A 4O5EA 1SL0A 3DDHA 3H0RB 2DKZA 3AL0B 7ICTA 4Q43A 4J9MA 3WK5A 4DOCA 1BPZA 1RM6C 5ALJA 3DEEA 3MR6A 3KKAA 4MFAA 3WKCA 3PVXA 1QQ6A 3OSNA 3DV9A 2DWQA 3ISDA 2HHXA 3JPSA 5G5HA 3A0HU 2NRXA 5H2FU 4ELUA 2WF6A 4DL5A 1SL2A 5J2KA 1D9FA 1ZQAA 2WAQF 1QSLA 5J0SA 2XIDA 1BVSA 2HOQA 3QYPA 3FAHA 4C4TA 3Q8PB 1Z19A 3WKAA 3C5FA 3JPPA 7ICSA 4YMOA 1XO1A 4M6WB 4DS5A 2DF4B 5AKJA 3KHLA 3OPXA 4I2GA 1LKYA 5AKLA 2Y1JA 2BQRA 5AM4A 1BNOA 4O5KA 3ZD9A 4NLGA 2BQ3A 4ECVA 2LKYA 5E79U 1L5UA 3AU2A 3V7KA 3MBYA 9ICNA 3PSTA 2W04A 2DUYA 2ALZA 1YZ7A 1ZQXA 4CNQA 2JZBA 2WB1C 5ALKA 3CW2C 4OJ6A 3AMZA 3SAHA 7ICKA 1LKYB 1IXRA 5ALFA 4UB5A 4P4MA 2VA8A 3GDXA 5EE1A 3M8SA 3AQFA 1T8EA 5DBBA 3HT3A 4KLFA 5BPCA 2BR0A 3RF9A 4M9GA 1Z4NA 1ZQKA 3G6VA 4MFCA 3B0XA 3BZKA 2BKEA 3WU2U 5KFPA 8ICOA 2F8KA 2G0AA 2E8PA 4F92B 4QIWC 4UB1A 2ASDA 3C5GA 2XY5A 3C29A 1N5XA 3E0FA 3HW8A 3RBDA 4YR2A 3VCBA 2W9BA 2C2EA 1PZNA 3C21A 1V97A 2XCPA 4KTQA 2G5IB 4ELVA 2KIWA 1JUDA 4DL6A 2KHVA 1XWLA 1A6SA 4I27A 3MGHA 1JMSA 1Z00B 4DF4A 3RRGA 1PUZA 1MQ2A 1DRGA 4J03A 4DFKA 3L5KA 5CR0A 1KL9A 2DKXA 3CNHA 4DSEA 3QZ8A 5AI4A 1ZRMA 3NUQA 2XY6A 2LHTA 3JPNA 1SGGA 5IIIA 4CGZA 5IILA 1NJYA 2FMQA 4YXMA 4KLSA 1CUKA 5J2HA 2Y9UA 4I2BA 1QQ5A 1XSLA 4OJ5A 4FZNA 4RQ3A 5EWGA 1DOQA 3UMCA 4QW8A 5ALOA 4CF5A 4C8LA 1HJPA 9ICVA 3H8SA 9ICSA 3TAPA 1COOA 4F5QA 2LPEA 1RYUA 3EPIA 5J29A 4RUCA 1KTQA 2FLLA 5ALUA 3SAGA 3V6JA 5DG9A 1MA7A 4YMMA 5L9XA 3D2QA 4QZ9A 5KFLA 2H3ZA 4DQSA 5AK6A 9ICPA 4M47A 4NWIA 3TFSA 4EZ6A 4I2EA 4DFDA 3KHRA 2E8MA 4O3QA 3SI8A 7ICGA 1M6YA 1UA1A 3C2KA 2HDOA 2ESEA 3D2NA 5IIJA 2YY6A 4DWIA 1TK8A 1KSPA 5KFDA 1DGSA 1V38A 3WK7A 1X66A 5ALEA 4F4KA 1X9WA 5JTIA 2MSNA 3KBBA 4FZLA 3UQ2A 2WAQC 3NVYA 2EZYA 4FBUA 3SD7A 5ALTA 5KT5A 4IR1A 1WWUA 2W3SA 1JN3A 1NJZA 3RH6A 3FM9A 2H3QA 2EAMA 3T5JA 4IRCA 4F5PA 5GTIU 2BQUA 3PX4A 9ICRA 9ICQA 3PSIA 4PZOA 8ICWA 2W9CB 2PXIA 2K4IA 4R63A 3TQ1A 3RBEA 5KFKA 2R8GA 1Z3EB 7ICIA 2Y1IA 1Q8KA 2PKEA 4PZNA 1ZD4A 3T3FA 4QZIA 8ICXA 4FS1A 3IM1A 5HMMA 1T4GA 3VC8A 5J0OA 5KFSA 2JV3A 3PX0A 2KP7A 3ZI4A 4GXKA 5B5EU 1NK4A 4C0ZA 2PI4A 8ICSA 1L6NA 2BCRA 1KN5A 3BQ0A 5ALIA 2LYHA 5J0UA 1ZD2P 2FPLA 2KEYA 4I2HA 3UM9A 4YFKA 2QKQA 2XGPA 3KOOA 1U9LA 5DBCA 5C5JA 1NKEA 1TK5A 2J6UA 4JMUA 1AROP 3RTVA 1T3QA 4YN4A 1ZQEA 4QZHA 2PI5A 4PHDA 4UBCA 9ICKA 4O5CA 4P2HA 3QEBZ 1NK8A 3ISCA 4DSKA 4M04A 4NL9A 1KBUA 4ED2A 1KRPA 5J0QA 2A1AA 1BGXT 3BQ2A 1T7PA 4LVSA 5KFGA 3JPQA 1PVRA 2XCAA 2I9GA 3UQ0A 3R9KA 4Z6EA 2P6UA 4DQRA 7ICPA 2KSOB 8ICGA 3KHGA 4I28A 1WWVA 4DLGA 4A8EA 2H3IA 3U26A 3C1ZA 2BPCA 3HPOA 4RT2A 2BCUA 2AXTU 4RQMA 5J0YA 4RPZA 3FDSA 2QARB 4ECWA 5CP2A 9ICUA 2FPKA 1D9DA 4J9LA 4KLHA 1RPLA 2KK0A 4US8A 3HILA 2MUTB 2YB1A 3RRHA 4PGYA 4F2SA 4JV1A 2JGAA 4U6PA 3PO4A 2A3VA 1O08A 3LK9A 3QEAZ 4XRHA 4CCHA 3JPRA 2K60A 3RJJA 7ICNA 4LZDA 1IIPA 5KFWA 3RR7A 3QX7A 3N28A 4NLZA 5J2EA 4GC7A 4PL1A 3ZD8A 2K4EA 5KFMA 2BPFA 4C8KA 2WTFA 4F5RA 4PHPA 4F91B 1JIHA 5KFIA 1N5WA 3H8JA 4P0PA 5BOMA 3LDAA 1IM4A 3WK4A 3N7SC 1NK6A 2WFAA 4DL2A 1ZQMA 2ATLA 4Y2YA 4I2CA 2MU2A 3S6JA 4BGDA 5A0LA 4IQVA 1IV8A 5KFYA 1ZQOA 3HJEA 2KJ8A 3KHHA 1DK2A 2XVTA 2AU0A 5HR7A 1NK9A 2W55A 3MR3A 2ODGA 2QLTA 4ELTA 4F5NA 4F8RA 2GH1A 2ZUDA 3UMBA 2DGZA 2GOLA 3IN5A 4P4PA 2HVIA 3BQ1A 4P4OA 5J2AA 1B0XA 2ZIXB 2QB1A 4US9A 2XGQA 1ECWA 2BDUA 2FDRA 3KFUF 3QUCA 4DQIA 2RQ5A 1ZQTA 8ICBA 7ICEA 1LB2B 4X5VA 4NLBA 2EZXA 3F5EA 1HEKA 4PHEA 1S5LU 5IIMA 1XU4A 5AM3A 3N97B 3NRZA 5IIOA 2KJ5A 3BDPA 3SV4A 3GV8B 4IR9A 2NRTA 3SMVA 5EWFA 4ED7A 3BQ7A 2W7OA 4M0AA 5KFOA 4I2JA 2VKQA 4KN4A 3QUQA 4QWCA 5KL1B 4ACOA 1S0MA 4I2AA 4CE6A 1NK0A 2A1JB 4XA5A 4DS4A 4RUAA 9ICXA 3EZ5A 5ALDA 2JH7A 5AI0A 3PW2A 2VJ4A 1XSNA 3AEVA 1XNSA 2EH9A 2FLPA 3QXGA 3RB4A 2BZFA 3M9OB 3RB3A 5J2BA 7ICQA 2KOBA 4I2DA 8ICZA 4YD2A 3THVA 3N7PD 1COKA 5ALPA 2HHQA 2FMSA 3RB6A 2O6KA 2IBKA 2ZTDA 4O9MA 4M9JA 5ALNA 1U47A 4M6WA 1PVQA 4G3IA 4C80A 1S10A 5JUMA 1NKBA 3I1YA 5AK3A 2JR5A 3TFRA 4KLTA 4KLDA 4MHVA 2BDPA 2UVRA 1FFUA 5ALVA 1J2NA 1X2IA 2VIXA 3Q8SB 4J9KA 1JXEA 3NS1A 2MA1A 1S0OA 5KT7A 7ICOA 4DL3A 1S8OA 3F53A 1KEJA 3ZDDA 1ZETA 4ECYA 2HMXA 4J9NA 5AI6A 2KV2A 5KFHA 2IHMA 4CF4A 1RDFA 2HCFA 3EWAA 2Y0SF 3IDWA 3D2SA 4RPYA 4UBBA 2LI6A 1T3NA 3GU3A 2MAXA 3C2LA 2ISPA 3BZCA 3H4BA 2PFOA 1D8YA 8ICKA 5CRXA 4GFJA 4U7CA 5KG2A 3CRXA 2C22A 3GFKB 5CJ7A 2ZTEA 8ICVA 3K75D 3SQIA 4RNNA 2OEHA 2HBJA 9ICHA 2H3VA 2KNJA 2YMMA 2B6GA 2KIVA 2EAPA 3LWLA 5KG1A 4I29A 1L7NA 4C8OA 5KFCA 2M9NA 4P0PB 4BX9C 2WF5A 5K4LA 1N63A 4MEYA 2EAOA 4DO9A 5DB8A 4MEXA 3ISBA 5KFBA 4BWMA 4EBEA 4F2RA 4Q8EA 1ZQLA 1SL1A 2RLTA 1KW4A 4TQSA 4Y2XA 5AM0A 4PGXA 4ECRA 2JHDA 2QB0B 3QU2A 1BPEA 2P35A 1Z00A 3H8MA 4GLXA 2E5SA 3RH4A 4RT3A 4CDGA 1N61A 4OCZA 4P0QB 1QH9A 1D8BA 2M0NA 2E3TA 3IRUA 3C1YA 3HKZF 2E8NA 4DSJA 1ZD3A 2LYBA 5D46A 5DBAA 3ALRA 3WK9A 4DQQA 2EANA 4O3PA 1ZRNA 3IV6A 9ICGA 1K1SA 5ALZA 2E8OA 2F3NA 2JEFA 2RDIA 2KJ9A 3CP8A 4DSIA 5KFTA 4J9QA 5KG6A 3KKAC 3PMLA 2HHWA 4QZCA 2Y9TA 3KZXA 5DKWA 4BXOB 5EOZA 2ZIVB 5KNIA 5DGAA 2XO7A 1PK1B 2F8LA 4O3OA 2ASJA 4F4ZA 2IOHA 3RJEA 5TISU 4Y2VA 3GZFA 3PR5B 4QJFB 2R8KA 2BPGA 3PMNA 4ED0A 2W3RA 2AQ0A 8ICRA 4EENA 4F3OA 2A19A 1JRPA 4DQPA 5F3XB 2KVCA 8ICPA 5CEHA 5DB6A 2XC9A 5IINA 3K4GA 5HHIA 1UQVA 5TZVA 3LWMA 1SKRA 1L3VA 2KZZA 4Y2UA 3K1RB 4Q8FA 3TADA 5ALXA 3T5KA 5DDMA 3RH5A 4KN7A 1ED1A 5EE9A 5J8YA 1X9XA 9ICTA 2W9CA 4PH5A 5KTQA 4RQ1A 4ZOHC 1ZQSA 4O3NA 2D8CA 1ZQIA 1PVPA 2K8AA 4EX7A 2JEIA 3F2BA 3BS7A 3H40A 5D4BA 3ZDEA 4R64A 2W8KA 2CXYA 2GLEA 2D3DA 1NZBA 4DL4A 7ICRA 1NOMA 4IQTA 9ICMA 3MGIA 2KZ3A 3GQCA 2VJ5A 4RQ0A 3E2EA 1SIJA 4UATA 1SV0A 2DPIA 3IG8A 2NRVA 3G6XA 4TUQA 3HX0A 3AN1A 2KTQA 4UARA 1FEZA 1HIWA 2XY7A 2G5HB 2Y0SC 1URJA 4RQ7A 3T79A 2K4HA 5ALMA 2K89A 2OWOA 1TAMA 4UAZA 2ZIUB 3WKEA 4QZFA 1UT5A 4RQNA 4O3SA 3EPGA 1S97A 1NI3A 2KICA 1L3UA 1OXJA 1JROA 3B9JA 2LM1A 4E0DA 5J0PA 1ZQHA 7ICLA 4F4XA 2OH2A 3AQEA 1X6JA 2UVUA 4UB3A 4DF8A 2AQ4A 3RAQA 5KFJA 1J2MA 5CB1A 1F5SA 4UB6U 5J2FA 2JXJA 1MQ3A 1O03A 2AGQA 2D6FC 2YMPA 1ZQ1C 7ICMA 1RZTA 1SWWA 4JB3A 5ALLA 5AI9A 9ICEA 1HUOA 2G07A 3ONNA 9ICBA 4AYBF 2WF7A 4EEYA 1L7MA 5KT3A 1KDHA 3T5LA 2KSOA 2W43A 2YTUA 1T94A 1ZQQA 3SR6A 2K8BB 2LYAA 3CYMA 3HKZC 3ICXA 2HHSA 2XI9A 5J0XA 2YQEA 2OXOA 1JXLA 4R8UB 2QARA 4M9NA 5KAIU 2W9AA 2H5XA 5DQGA 2MUTA 4GC6A 4RNOA 1Q3VA 2KVSA 2I1QA 3PSFA 3M9MB 4J9RA 1OUQA 1ZQJA 4C4SA 5AKIA 2L5YA 2ZJ5A 3MC1A 5AHXA 2HOFA 5DG8A 4I2FA 1TVAA 4KMOB 1ZQZA 4EX6A 2V9WA 5EE0A 3D6JA 4UQGA 8ICYA 3KD3A 3F2CA 5JRTA 3LYSA 4YVZA 3Q8KA 1KFSA 3GIIA 2OHFA 4ED3A 3NVZA 1NK5A 4C7ZA 1BPXA 4G9BA 4Z6DA 4WJ3B 3C23A 1QQ7A 3QE9Y 3A0BU 4F5OA 5AI8A 3HWTA 2ZJ8A 3MFIA 4F50A 8ICTA 2DL0A 2W11A 4YQWA 1RXWA 1X40A 1A76A 2LMRA 3PSPA 2GO7A 2FPMA 1K5OA 1ZQVA 5KG0A 4EYIB 1CEZA 5KT2A 8ICJA 5IIKA 4I2IA 1ZJMA 1Z4OA 2C2RA 4YMNA 3Q8QB 3RJHA 3M6ZA 2ZIXA 3V6HA 2RRDA 1SXEA 1EXNA 1Q3UA 8ICIA 3QUBA 4OJPA 4TURA 2E1EA 1K1QA 2HHTA 1TKDA 5KG4A 4RPXA 3IG5A 5ALQA 1NNLA 5J2JA 4NM2A 3RJIA 3SYZA 4HYKA 5KT4A 2G09A 5F9LA 2ZG6A 3PNCA 4F71A 5EWEA 2VA2A 4IL6U 1ZQNA 5CHGA 4QW9A 3QU4A 4QZGA 4DSFA 1JALA 1RXVA 2HI0A 4CF3A 1QTMA 4QZ8A 2RDJA 1ZQRA 1CI4A 2NO5A 1V85A 9ICOA 1SZPA 3OJUA 2HVHA 2A1JA 4NL9C 2ZXHA 4Z6FA 1YZ6A 2HBKA 5KFXA 5HNKA 1SV4A 2AGPA 5AKKA 4FBTA 4DOAA 1ZYQA 2K8CB 5AM1A 2IMWP 3PW0A 1ZQBA 7ICUA 4MF2A 2F76X 2CN1A 4IC9A 4HAIA 1ZQGA 3ETRA 4FE3A 1C7YA 3Q8LA 5KFUA 4UASA 4JV2A 4EZ9A 2YB4A 4DFMA 3BQTA 2AHOB 4OO1J 2KKPA 3ZDCA 2ZUBA 5KT6A 1NK7A 2B0CA 3BS5B 2WHEA 4Y2RA 4PGQA 4BUGA 5DB7A 3TANA 4BJQA 5J0TA 4AYBC 3TARA 4IRDA 4Z6CA 4BDPA 2ZIWB 3TKAA 1L7PA 4C8NA 4ED8A 1BNPA 4TUPA 9ICWA 4M9HA 3N7RC 3UXOA 4K4IA 4FFDA 1PK3A 2F2AB 3UPQA 4JWMA 2YN4A 1RG6A 4Y2TA 2MRLA 1XC9A 1DK3A 3GILA 2C28A 1L7OA 2KD1A 4QWEA 4QWDA 2JH1A 2G08A 3QU7A 4OJOA 4ECQA 3C28A 4QNLA 5CWRA 3QU9A 2HOIA 3N4MB 4RU9A 1L3TA 2C2DA 2JMGA 5HP4A 3GIKA 3HRDD 5F9NA 4RQ6A 4YR0A 4QWBA 8ICFA 3ORYA 1U49A 8ICEA 4NXZA 4ICAA 3BJYA 4LZGA 5AI5A
chains in the Genus database with same CATH topology
3D2NA 4OJLA 5KL8B 4WJ3B 2KOBA 4IC9A 3KFUF 1L6NA 4P0PB 1XO0A 4BX9C 2Z7JA 3C29A 3E0FA 3F5AA 3L3FX 3PZPA 3N7SC 3M6KA 2RP5A 2D6FC 4FE3A 2G06A 3N7PD 3VCBA 1KBUA 2KVCA 1ZQ1C 2YX8A 2OYYA 3M7DA 4FZLA 3H0LB 2WAQF 2YB4A 5A0LA 4OJPA 2WAQC 2Q4TA 2XIDA 3PSPA 2G5IB 2HOQA 4NV0A 4FZMA 2KIWA 5HR6A 2KJ8A 1Z19A 2XICA 2RHFA 4OO1J 2KKPA 2G07A 3ONNA 3LVWA 2JHDA 2KHVA 1PVRA 2XVTA 1PVQA 2KKVA 5HR7A 1A6SA 4AYBF 4BUGA 4BJQA 2DF4B 4AYBC 2ZIWA 2H3QA 3OPXA 2E5SA 1DRGA 2ZIWB 4KX3A 3K1ZA 2GH1A 4P0QA 1ED1A 4CDGA 2DGZA 2GOLA 3M6ZA 3IN5A 3NRWA 2ZIXA 3IP4B 4PL2A 2RRDA 4P0QB 2R18A 1D8BA 2M0NA 5T14A 3NUQA 1Z1BA 1Q3UA 1UPHA 2KHQA 4A8EA 2ZIXB 1T94A 4NLCA 2LHTA 2VIXA 3HKZF 2H3IA 2LKYA 2OM6A 3PSIA 2K8BB 2LYAA 1ECWA 2BDUA 2HBLA 2K4IA 2E1EA 2MA1A 3CYMA 3H0MB 3HKZC 3ICXA 3N7RC 3F2DA 2LYBA 5C0YA 3LVVA 1PVPA 2K8AA 3MGVA 2PMZF 2HBMA 2XI9A 3ALRA 3F2BA 2OXOA 2PMZC 3F53A 4OJ5A 3PSTA 2W04A 2WB1F 2CRXA 2F2AB 4NLBA 3IG5A 3F5EA 4FZNA 1HEKA 2WB1C 2W7PA 1NZBA 4OJ6A 2KJ9A 2NV3A 1GO3F 2HMXA 3SAFA 2MRLA 4KX5A 3CP8A 3SAHA 2VJ5A 1F44A 2KD1A 2G09A 2KV2A 2ZG6A 2KJ5A 2JH1A 1A0PA 2G08A 3IG8A 4OJOA 1Q3VA 2YB1A 3VC8A 1YT3A 3PSFA 3SMVA 3C28A 2W7OA 1HIWA 4QNLA 2Y0SF 1OUQA 4CRXA 3KZXA 3D2SA 2E1FA 2G5HB 2Y0SC 2JGAA 2HOIA 2ZIVA 4U6PA 1URJA 3AQFA 3T79A 3GU3A 3RFAA 2K4HA 4C0ZA 2A3VA 2VKQA 2K89A 2W03A 2ZIVB 2N1RA 3SAGA 2ZIUA 1MA7A 2HOFA 4O3MA 3RF9A 2JMGA 4KMOB 1TAMA 2ZXHA 5KL1B 4ACOA 2ZIUB 4GFJA 1CRXA 4U7CA 3D2QA 5CRXA 2KEYA 3CRXA 2F8LA 1SZHA 2ZXIA 2H3ZA 1IIPA 1WUDA 2HBKA 2KICA 4NWIA 3H0RB 4PL1A 3SQIA 3AL0B 2JH7A 2HBJA 3F2CA 2VJ4A 4JMUA 2LBOA 2H3VA 2KNJA 2K4EA 2K8CB 2DQNB 1P7DA 2OH2A 4CGZA 2CPRA 2G0AA 3O0FA 3AQEA 3LYSA 4ICAA 3DEEA 4QIWF 1XNSA 3GZFA 2H3FA 2F77X 4QJFB 4QIWC 2F76X 2CN1A 4P0PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L6N A;  2N1R A;  4IC9 A;  2JMG A;  2H3Q A;  1TAM A;  1HEK A;  2NV3 A;  2HMX A;  2H3Z A;  1ED1 A;  2GOL A;  4JMU A;  1UPH A;  2H3V A;  2K4E A;  2H3I A;  1HIW A;  4ICA A;  2LYA A;  1ECW A;  2K4I A;  2H3F A;  2LYB A;  2K4H A;  1A6S A; 
#chains in the Genus database with same CATH topology
 2J6S A;  4KLU A;  3WK8 A;  3M6K A;  4ZH4 A;  2RP5 A;  4RNM A;  4ED1 A;  1UHU A;  1MSW D;  3H4D A;  3V7L A;  1L8L A;  2AH5 A;  2Q4T A;  2W54 A;  1UA0 A;  5HR6 A;  4Y2S A;  5JU5 A;  2FLN A;  2YMQ A;  2QB0 A;  4K4H A;  4R66 A;  1X9M A;  1IG6 A;  2I5H A;  5AIB A;  5KAF U;  2BCS A;  5KG5 A;  4NLN A;  1BPD A;  4KX3 A;  2EZZ A;  1SKS A;  4P0Q A;  5ALR A;  4DCC A;  4UB4 A;  2KHQ A;  1SXD A;  1VDV A;  4KLL A;  5G5G A;  1QLN A;  2KFZ A;  3PW5 A;  2BGW A;  4KLG A;  2F1H A;  2PMZ F;  4JUZ A;  2ZTC A;  2KMD A;  3KZI U;  3JPO A;  2NYV A;  1TAU A;  4B9U A;  4KX5 A;  2JZB B;  1N48 A;  5J0R A;  9ICC A;  8ICM A;  3NGD A;  1A77 A;  4UW9 A;  1TFR A;  3TAC B;  3IHQ B;  4RQ4 A;  3TAQ A;  1TK0 A;  5B66 U;  5DLF A;  4BXO A;  1J97 A;  2KN7 A;  2Q0Z X;  2ZIV A;  5AIC A;  5J2I A;  2DFL A;  4PHA A;  1PK1 A;  4ECZ A;  3MAB A;  1C20 A;  3ZDB A;  2WF8 A;  8ICC A;  3QZ7 A;  5DB9 A;  1MC8 A;  4MF8 A;  4QZA A;  3I28 A;  2HSZ A;  4GIB A;  2JEJ A;  3E58 A;  2LBO A;  2DQN B;  4B9V A;  4F93 B;  1S77 D;  4KLQ A;  3KTQ A;  4XUS A;  4IRK A;  4RQ5 A;  3L3F X;  2FMP A;  8ICN A;  2BCQ A;  1SKW A;  1L8O A;  4IS7 A;  2G06 A;  3FYH A;  5CA7 A;  5ALY A;  3M7D A;  1DGJ A;  5KFF A;  4Q45 A;  2ES6 A;  2W9B B;  5AKH A;  2JRZ A;  2KZM A;  4J9S A;  3RR8 A;  4QZD A;  3PO5 A;  4NLK A;  4KLE A;  3ZDA A;  4UAU A;  2RHF A;  3NTU A;  3J81 j;  3LVW A;  9ICJ A;  2HW3 A;  5KFR A;  4NJ8 A;  1RQN A;  5KFN A;  5KFQ A;  4B9M A;  2B21 A;  4YD1 A;  1LV5 A;  3V72 A;  1Z1V A;  1ZQU A;  3NRW A;  3RB0 A;  2PFQ A;  3PR4 A;  4B9T A;  1Z1B A;  4NLC A;  4XQ8 A;  3L4P A;  3F2D A;  3MGV A;  5L1I A;  2HBM A;  1WG8 A;  4YCX A;  2CRX A;  3B0Y A;  2GWS A;  4IQU A;  3M8R A;  1TE2 A;  1GO3 F;  3SV3 A;  2DPJ A;  2BCV A;  5AIA A;  1ZXI A;  5BOL A;  4CRX A;  3M9N B;  4QZB A;  1ZQP A;  3GV5 B;  2PFP A;  5J2C A;  4DLE A;  3V6K A;  3MDA A;  2ZIU A;  5AKX A;  1QSY A;  5DQH A;  5AKY A;  1ZQW A;  5D49 A;  4ED6 A;  4O0I A;  1AQ6 A;  4Q44 A;  3PW4 A;  1SZH A;  1ZD5 A;  2F44 A;  3OHA A;  4RZR A;  4UAY A;  2CPR A;  1VLB A;  2OCE A;  4NM1 A;  9ICA A;  1S9F A;  2F77 X;  3NVV A;  4J9O A;  3TI0 A;  4ECT A;  4OJL A;  2JEG A;  5KL8 B;  4EEL A;  2Z7J A;  1NJX A;  3F5A A;  3PZP A;  5HML A;  3MR2 A;  2YML A;  2YX8 A;  3PY8 A;  2NRZ A;  2ZUC A;  4KIT B;  2FI1 A;  3V7J A;  1DXS A;  1ZQC A;  2NO4 A;  4EBD A;  1VJ5 A;  1TAQ A;  8ICU A;  4DEZ A;  3QUT A;  3OHB A;  3UXP A;  1KKX A;  4O3R A;  1KLN A;  1ZQF A;  4UB8 U;  4RQ2 A;  4PJ0 U;  1V9P A;  4KLI A;  1N2X A;  1WYG A;  1NZP A;  4YR3 A;  9ICF A;  4F4Y A;  2K4P A;  4K4G A;  1UPH A;  3AM9 A;  1B4F A;  3AU6 A;  3AUO A;  2UVW A;  1JX4 A;  2F1J A;  2OM6 A;  4B6J A;  3GIM A;  5C0Y A;  4FS2 A;  4R8U A;  4EEK A;  2PMZ C;  4DSL A;  3MR5 A;  3JPT A;  4KLO A;  1S0N A;  5AK4 A;  3H7I A;  3RJK A;  2EDU A;  1FIQ A;  5J0W A;  1F44 A;  9ICL A;  1A0P A;  3UMG A;  1U45 A;  2AJQ A;  5AKE A;  2HHV A;  3OJS A;  1ZQY A;  1WCL A;  4LJX A;  2R8H A;  5DDY A;  3HP6 A;  4EBC A;  2W03 A;  2J6T A;  5AKG A;  4EYH B;  2FE9 A;  3M1Y A;  4ECX A;  4C8M A;  4F4W A;  2P66 A;  4B9L A;  5L1J A;  1JI7 A;  1H38 A;  5AKZ A;  1WUD A;  5ALG A;  2W8L A;  4DFJ A;  3I76 A;  1LVH A;  1RYS A;  1U48 A;  3QNM A;  5AK5 A;  3O0F A;  1FFV A;  8ICQ A;  2NRW A;  2H3F A;  1B43 A;  2WF9 A;  5AM2 A;  4RQ8 A;  3TAD C;  4C7Y A;  4MFF A;  1KQQ A;  3OTQ A;  1XO0 A;  3FC4 A;  4DFP A;  1Y88 A;  1MN8 A;  5J8Y C;  5KG7 A;  4GXI A;  4KLM A;  2OYY A;  3QU5 A;  1N56 A;  3OGU A;  3H0L B;  4KMU A;  3SEI A;  2VA3 A;  4GXJ A;  2XIC A;  2PFN A;  1BPY A;  3RJG A;  2ASL A;  5KFZ A;  1XS9 D;  3NVW A;  4BWJ A;  4J9P A;  7ICH A;  3PW7 A;  1SV0 C;  3EUB 2;  3K1Z A;  2KE7 A;  3WKD A;  4DL7 A;  5DG7 A;  5KG3 A;  5J2D A;  4PL2 A;  5T14 A;  4ECS A;  4OD0 A;  1X42 A;  3G6Y A;  3H0M B;  2EQY A;  2LM4 A;  1BPB A;  4YP3 A;  5DLG A;  5EE3 A;  2IOF K;  7ICJ A;  4YG2 A;  5KFV A;  5DGB A;  1SWV A;  2WB1 F;  3PV8 A;  3NAS A;  3SZ2 A;  9ICI A;  5KFE A;  2NV3 A;  1SB3 C;  4JK1 A;  4UAV A;  4NY8 A;  1FO4 A;  7ICF A;  4USA A;  1ZQD A;  1YT3 A;  1XSP A;  2KG5 A;  5L1M A;  2HHU A;  8ICL A;  4TUS A;  3GV7 B;  2VAN A;  5HHH A;  2N1R A;  4O3M A;  1S76 D;  3MFH A;  5ALH A;  1CRX A;  2I6X A;  2ZXI A;  1F0M A;  2FJ6 A;  2W9M A;  1QSS A;  3ETL A;  5KFA A;  1P7D A;  1X9S A;  4QIW F;  7ICV A;  4JV0 A;  5L1K A;  3Q8M A;  2AGO A;  1Q46 A;  2V4Q A;  2IA6 A;  1ZJN A;  1RQL A;  3MDC A;  3EYZ A;  1N62 A;  5FP0 A;  5L1L A;  3PX6 A;  3GIJ A;  4F72 A;  4ECU A;  1ZOL A;  1D8L A;  1X6I A;  2ZJA A;  3SEN A;  2R8I A;  3WKB A;  1TV9 A;  4TQR A;  1RYR A;  3H8W A;  3RAX A;  4Y2J A;  4UAW A;  3EW9 A;  4NV0 A;  4FZM A;  3OSP A;  4QWA A;  3BS5 A;  1OW5 A;  1B22 A;  4B9S A;  3RJF A;  2KKV A;  4JWN A;  1S0V A;  4Y2Q A;  1QCK A;  2ZIW A;  3UXN A;  5GTH U;  2UVV A;  5DQI A;  4M9L A;  4C4R A;  4FO6 A;  3IP4 B;  2R18 A;  1NKC A;  1L3S A;  5J2G A;  3Q8R B;  4DOB A;  2R8J A;  2HBL A;  2V4R A;  3C2M A;  3LVV A;  8ICH A;  4IQW A;  2IHN A;  1UT8 A;  2W7P A;  2ISO A;  3SAF A;  1NJW A;  4AP9 A;  4M2Y A;  2F1I A;  1KFD A;  2BHN A;  4Y2P A;  4QZE A;  2KFN A;  4UB2 A;  1N60 A;  3WK6 A;  2E1F A;  4YXJ A;  2IOF A;  3RFA A;  4R65 A;  5ALS A;  5AM5 A;  1HUZ A;  4PPX A;  1UCV A;  5ALW A;  2DBY A;  1WCN A;  4KLJ A;  1KFT A;  4B9N A;  2P6R A;  3T5H A;  1U4B A;  8ICA A;  3ED5 A;  4O5E A;  1SL0 A;  3DDH A;  3H0R B;  2DKZ A;  3AL0 B;  7ICT A;  4Q43 A;  4J9M A;  3WK5 A;  4DOC A;  1BPZ A;  1RM6 C;  5ALJ A;  3DEE A;  3MR6 A;  3KKA A;  4MFA A;  3WKC A;  3PVX A;  1QQ6 A;  3OSN A;  3DV9 A;  2DWQ A;  3ISD A;  2HHX A;  3JPS A;  5G5H A;  3A0H U;  2NRX A;  5H2F U;  4ELU A;  2WF6 A;  4DL5 A;  1SL2 A;  5J2K A;  1D9F A;  1ZQA A;  2WAQ F;  1QSL A;  5J0S A;  2XID A;  1BVS A;  2HOQ A;  3QYP A;  3FAH A;  4C4T A;  3Q8P B;  1Z19 A;  3WKA A;  3C5F A;  3JPP A;  7ICS A;  4YMO A;  1XO1 A;  4M6W B;  4DS5 A;  2DF4 B;  5AKJ A;  3KHL A;  3OPX A;  4I2G A;  1LKY A;  5AKL A;  2Y1J A;  2BQR A;  5AM4 A;  1BNO A;  4O5K A;  3ZD9 A;  4NLG A;  2BQ3 A;  4ECV A;  2LKY A;  5E79 U;  1L5U A;  3AU2 A;  3V7K A;  3MBY A;  9ICN A;  3PST A;  2W04 A;  2DUY A;  2ALZ A;  1YZ7 A;  1ZQX A;  4CNQ A;  2JZB A;  2WB1 C;  5ALK A;  3CW2 C;  4OJ6 A;  3AMZ A;  3SAH A;  7ICK A;  1LKY B;  1IXR A;  5ALF A;  4UB5 A;  4P4M A;  2VA8 A;  3GDX A;  5EE1 A;  3M8S A;  3AQF A;  1T8E A;  5DBB A;  3HT3 A;  4KLF A;  5BPC A;  2BR0 A;  3RF9 A;  4M9G A;  1Z4N A;  1ZQK A;  3G6V A;  4MFC A;  3B0X A;  3BZK A;  2BKE A;  3WU2 U;  5KFP A;  8ICO A;  2F8K A;  2G0A A;  2E8P A;  4F92 B;  4QIW C;  4UB1 A;  2ASD A;  3C5G A;  2XY5 A;  3C29 A;  1N5X A;  3E0F A;  3HW8 A;  3RBD A;  4YR2 A;  3VCB A;  2W9B A;  2C2E A;  1PZN A;  3C21 A;  1V97 A;  2XCP A;  4KTQ A;  2G5I B;  4ELV A;  2KIW A;  1JUD A;  4DL6 A;  2KHV A;  1XWL A;  1A6S A;  4I27 A;  3MGH A;  1JMS A;  1Z00 B;  4DF4 A;  3RRG A;  1PUZ A;  1MQ2 A;  1DRG A;  4J03 A;  4DFK A;  3L5K A;  5CR0 A;  1KL9 A;  2DKX A;  3CNH A;  4DSE A;  3QZ8 A;  5AI4 A;  1ZRM A;  3NUQ A;  2XY6 A;  2LHT A;  3JPN A;  1SGG A;  5III A;  4CGZ A;  5IIL A;  1NJY A;  2FMQ A;  4YXM A;  4KLS A;  1CUK A;  5J2H A;  2Y9U A;  4I2B A;  1QQ5 A;  1XSL A;  4OJ5 A;  4FZN A;  4RQ3 A;  5EWG A;  1DOQ A;  3UMC A;  4QW8 A;  5ALO A;  4CF5 A;  4C8L A;  1HJP A;  9ICV A;  3H8S A;  9ICS A;  3TAP A;  1COO A;  4F5Q A;  2LPE A;  1RYU A;  3EPI A;  5J29 A;  4RUC A;  1KTQ A;  2FLL A;  5ALU A;  3SAG A;  3V6J A;  5DG9 A;  1MA7 A;  4YMM A;  5L9X A;  3D2Q A;  4QZ9 A;  5KFL A;  2H3Z A;  4DQS A;  5AK6 A;  9ICP A;  4M47 A;  4NWI A;  3TFS A;  4EZ6 A;  4I2E A;  4DFD A;  3KHR A;  2E8M A;  4O3Q A;  3SI8 A;  7ICG A;  1M6Y A;  1UA1 A;  3C2K A;  2HDO A;  2ESE A;  3D2N A;  5IIJ A;  2YY6 A;  4DWI A;  1TK8 A;  1KSP A;  5KFD A;  1DGS A;  1V38 A;  3WK7 A;  1X66 A;  5ALE A;  4F4K A;  1X9W A;  5JTI A;  2MSN A;  3KBB A;  4FZL A;  3UQ2 A;  2WAQ C;  3NVY A;  2EZY A;  4FBU A;  3SD7 A;  5ALT A;  5KT5 A;  4IR1 A;  1WWU A;  2W3S A;  1JN3 A;  1NJZ A;  3RH6 A;  3FM9 A;  2H3Q A;  2EAM A;  3T5J A;  4IRC A;  4F5P A;  5GTI U;  2BQU A;  3PX4 A;  9ICR A;  9ICQ A;  3PSI A;  4PZO A;  8ICW A;  2W9C B;  2PXI A;  2K4I A;  4R63 A;  3TQ1 A;  3RBE A;  5KFK A;  2R8G A;  1Z3E B;  7ICI A;  2Y1I A;  1Q8K A;  2PKE A;  4PZN A;  1ZD4 A;  3T3F A;  4QZI A;  8ICX A;  4FS1 A;  3IM1 A;  5HMM A;  1T4G A;  3VC8 A;  5J0O A;  5KFS A;  2JV3 A;  3PX0 A;  2KP7 A;  3ZI4 A;  4GXK A;  5B5E U;  1NK4 A;  4C0Z A;  2PI4 A;  8ICS A;  1L6N A;  2BCR A;  1KN5 A;  3BQ0 A;  5ALI A;  2LYH A;  5J0U A;  1ZD2 P;  2FPL A;  2KEY A;  4I2H A;  3UM9 A;  4YFK A;  2QKQ A;  2XGP A;  3KOO A;  1U9L A;  5DBC A;  5C5J A;  1NKE A;  1TK5 A;  2J6U A;  4JMU A;  1ARO P;  3RTV A;  1T3Q A;  4YN4 A;  1ZQE A;  4QZH A;  2PI5 A;  4PHD A;  4UBC A;  9ICK A;  4O5C A;  4P2H A;  3QEB Z;  1NK8 A;  3ISC A;  4DSK A;  4M04 A;  4NL9 A;  1KBU A;  4ED2 A;  1KRP A;  5J0Q A;  2A1A A;  1BGX T;  3BQ2 A;  1T7P A;  4LVS A;  5KFG A;  3JPQ A;  1PVR A;  2XCA A;  2I9G A;  3UQ0 A;  3R9K A;  4Z6E A;  2P6U A;  4DQR A;  7ICP A;  2KSO B;  8ICG A;  3KHG A;  4I28 A;  1WWV A;  4DLG A;  4A8E A;  2H3I A;  3U26 A;  3C1Z A;  2BPC A;  3HPO A;  4RT2 A;  2BCU A;  2AXT U;  4RQM A;  5J0Y A;  4RPZ A;  3FDS A;  2QAR B;  4ECW A;  5CP2 A;  9ICU A;  2FPK A;  1D9D A;  4J9L A;  4KLH A;  1RPL A;  2KK0 A;  4US8 A;  3HIL A;  2MUT B;  2YB1 A;  3RRH A;  4PGY A;  4F2S A;  4JV1 A;  2JGA A;  4U6P A;  3PO4 A;  2A3V A;  1O08 A;  3LK9 A;  3QEA Z;  4XRH A;  4CCH A;  3JPR A;  2K60 A;  3RJJ A;  7ICN A;  4LZD A;  1IIP A;  5KFW A;  3RR7 A;  3QX7 A;  3N28 A;  4NLZ A;  5J2E A;  4GC7 A;  4PL1 A;  3ZD8 A;  2K4E A;  5KFM A;  2BPF A;  4C8K A;  2WTF A;  4F5R A;  4PHP A;  4F91 B;  1JIH A;  5KFI A;  1N5W A;  3H8J A;  4P0P A;  5BOM A;  3LDA A;  1IM4 A;  3WK4 A;  3N7S C;  1NK6 A;  2WFA A;  4DL2 A;  1ZQM A;  2ATL A;  4Y2Y A;  4I2C A;  2MU2 A;  3S6J A;  4BGD A;  5A0L A;  4IQV A;  1IV8 A;  5KFY A;  1ZQO A;  3HJE A;  2KJ8 A;  3KHH A;  1DK2 A;  2XVT A;  2AU0 A;  5HR7 A;  1NK9 A;  2W55 A;  3MR3 A;  2ODG A;  2QLT A;  4ELT A;  4F5N A;  4F8R A;  2GH1 A;  2ZUD A;  3UMB A;  2DGZ A;  2GOL A;  3IN5 A;  4P4P A;  2HVI A;  3BQ1 A;  4P4O A;  5J2A A;  1B0X A;  2ZIX B;  2QB1 A;  4US9 A;  2XGQ A;  1ECW A;  2BDU A;  2FDR A;  3KFU F;  3QUC A;  4DQI A;  2RQ5 A;  1ZQT A;  8ICB A;  7ICE A;  1LB2 B;  4X5V A;  4NLB A;  2EZX A;  3F5E A;  1HEK A;  4PHE A;  1S5L U;  5IIM A;  1XU4 A;  5AM3 A;  3N97 B;  3NRZ A;  5IIO A;  2KJ5 A;  3BDP A;  3SV4 A;  3GV8 B;  4IR9 A;  2NRT A;  3SMV A;  5EWF A;  4ED7 A;  3BQ7 A;  2W7O A;  4M0A A;  5KFO A;  4I2J A;  2VKQ A;  4KN4 A;  3QUQ A;  4QWC A;  5KL1 B;  4ACO A;  1S0M A;  4I2A A;  4CE6 A;  1NK0 A;  2A1J B;  4XA5 A;  4DS4 A;  4RUA A;  9ICX A;  3EZ5 A;  5ALD A;  2JH7 A;  5AI0 A;  3PW2 A;  2VJ4 A;  1XSN A;  3AEV A;  1XNS A;  2EH9 A;  2FLP A;  3QXG A;  3RB4 A;  2BZF A;  3M9O B;  3RB3 A;  5J2B A;  7ICQ A;  2KOB A;  4I2D A;  8ICZ A;  4YD2 A;  3THV A;  3N7P D;  1COK A;  5ALP A;  2HHQ A;  2FMS A;  3RB6 A;  2O6K A;  2IBK A;  2ZTD A;  4O9M A;  4M9J A;  5ALN A;  1U47 A;  4M6W A;  1PVQ A;  4G3I A;  4C80 A;  1S10 A;  5JUM A;  1NKB A;  3I1Y A;  5AK3 A;  2JR5 A;  3TFR A;  4KLT A;  4KLD A;  4MHV A;  2BDP A;  2UVR A;  1FFU A;  5ALV A;  1J2N A;  1X2I A;  2VIX A;  3Q8S B;  4J9K A;  1JXE A;  3NS1 A;  2MA1 A;  1S0O A;  5KT7 A;  7ICO A;  4DL3 A;  1S8O A;  3F53 A;  1KEJ A;  3ZDD A;  1ZET A;  4ECY A;  2HMX A;  4J9N A;  5AI6 A;  2KV2 A;  5KFH A;  2IHM A;  4CF4 A;  1RDF A;  2HCF A;  3EWA A;  2Y0S F;  3IDW A;  3D2S A;  4RPY A;  4UBB A;  2LI6 A;  1T3N A;  3GU3 A;  2MAX A;  3C2L A;  2ISP A;  3BZC A;  3H4B A;  2PFO A;  1D8Y A;  8ICK A;  5CRX A;  4GFJ A;  4U7C A;  5KG2 A;  3CRX A;  2C22 A;  3GFK B;  5CJ7 A;  2ZTE A;  8ICV A;  3K75 D;  3SQI A;  4RNN A;  2OEH A;  2HBJ A;  9ICH A;  2H3V A;  2KNJ A;  2YMM A;  2B6G A;  2KIV A;  2EAP A;  3LWL A;  5KG1 A;  4I29 A;  1L7N A;  4C8O A;  5KFC A;  2M9N A;  4P0P B;  4BX9 C;  2WF5 A;  5K4L A;  1N63 A;  4MEY A;  2EAO A;  4DO9 A;  5DB8 A;  4MEX A;  3ISB A;  5KFB A;  4BWM A;  4EBE A;  4F2R A;  4Q8E A;  1ZQL A;  1SL1 A;  2RLT A;  1KW4 A;  4TQS A;  4Y2X A;  5AM0 A;  4PGX A;  4ECR A;  2JHD A;  2QB0 B;  3QU2 A;  1BPE A;  2P35 A;  1Z00 A;  3H8M A;  4GLX A;  2E5S A;  3RH4 A;  4RT3 A;  4CDG A;  1N61 A;  4OCZ A;  4P0Q B;  1QH9 A;  1D8B A;  2M0N A;  2E3T A;  3IRU A;  3C1Y A;  3HKZ F;  2E8N A;  4DSJ A;  1ZD3 A;  2LYB A;  5D46 A;  5DBA A;  3ALR A;  3WK9 A;  4DQQ A;  2EAN A;  4O3P A;  1ZRN A;  3IV6 A;  9ICG A;  1K1S A;  5ALZ A;  2E8O A;  2F3N A;  2JEF A;  2RDI A;  2KJ9 A;  3CP8 A;  4DSI A;  5KFT A;  4J9Q A;  5KG6 A;  3KKA C;  3PML A;  2HHW A;  4QZC A;  2Y9T A;  3KZX A;  5DKW A;  4BXO B;  5EOZ A;  2ZIV B;  5KNI A;  5DGA A;  2XO7 A;  1PK1 B;  2F8L A;  4O3O A;  2ASJ A;  4F4Z A;  2IOH A;  3RJE A;  5TIS U;  4Y2V A;  3GZF A;  3PR5 B;  4QJF B;  2R8K A;  2BPG A;  3PMN A;  4ED0 A;  2W3R A;  2AQ0 A;  8ICR A;  4EEN A;  4F3O A;  2A19 A;  1JRP A;  4DQP A;  5F3X B;  2KVC A;  8ICP A;  5CEH A;  5DB6 A;  2XC9 A;  5IIN A;  3K4G A;  5HHI A;  1UQV A;  5TZV A;  3LWM A;  1SKR A;  1L3V A;  2KZZ A;  4Y2U A;  3K1R B;  4Q8F A;  3TAD A;  5ALX A;  3T5K A;  5DDM A;  3RH5 A;  4KN7 A;  1ED1 A;  5EE9 A;  5J8Y A;  1X9X A;  9ICT A;  2W9C A;  4PH5 A;  5KTQ A;  4RQ1 A;  4ZOH C;  1ZQS A;  4O3N A;  2D8C A;  1ZQI A;  1PVP A;  2K8A A;  4EX7 A;  2JEI A;  3F2B A;  3BS7 A;  3H40 A;  5D4B A;  3ZDE A;  4R64 A;  2W8K A;  2CXY A;  2GLE A;  2D3D A;  1NZB A;  4DL4 A;  7ICR A;  1NOM A;  4IQT A;  9ICM A;  3MGI A;  2KZ3 A;  3GQC A;  2VJ5 A;  4RQ0 A;  3E2E A;  1SIJ A;  4UAT A;  1SV0 A;  2DPI A;  3IG8 A;  2NRV A;  3G6X A;  4TUQ A;  3HX0 A;  3AN1 A;  2KTQ A;  4UAR A;  1FEZ A;  1HIW A;  2XY7 A;  2G5H B;  2Y0S C;  1URJ A;  4RQ7 A;  3T79 A;  2K4H A;  5ALM A;  2K89 A;  2OWO A;  1TAM A;  4UAZ A;  2ZIU B;  3WKE A;  4QZF A;  1UT5 A;  4RQN A;  4O3S A;  3EPG A;  1S97 A;  1NI3 A;  2KIC A;  1L3U A;  1OXJ A;  1JRO A;  3B9J A;  2LM1 A;  4E0D A;  5J0P A;  1ZQH A;  7ICL A;  4F4X A;  2OH2 A;  3AQE A;  1X6J A;  2UVU A;  4UB3 A;  4DF8 A;  2AQ4 A;  3RAQ A;  5KFJ A;  1J2M A;  5CB1 A;  1F5S A;  4UB6 U;  5J2F A;  2JXJ A;  1MQ3 A;  1O03 A;  2AGQ A;  2D6F C;  2YMP A;  1ZQ1 C;  7ICM A;  1RZT A;  1SWW A;  4JB3 A;  5ALL A;  5AI9 A;  9ICE A;  1HUO A;  2G07 A;  3ONN A;  9ICB A;  4AYB F;  2WF7 A;  4EEY A;  1L7M A;  5KT3 A;  1KDH A;  3T5L A;  2KSO A;  2W43 A;  2YTU A;  1T94 A;  1ZQQ A;  3SR6 A;  2K8B B;  2LYA A;  3CYM A;  3HKZ C;  3ICX A;  2HHS A;  2XI9 A;  5J0X A;  2YQE A;  2OXO A;  1JXL A;  4R8U B;  2QAR A;  4M9N A;  5KAI U;  2W9A A;  2H5X A;  5DQG A;  2MUT A;  4GC6 A;  4RNO A;  1Q3V A;  2KVS A;  2I1Q A;  3PSF A;  3M9M B;  4J9R A;  1OUQ A;  1ZQJ A;  4C4S A;  5AKI A;  2L5Y A;  2ZJ5 A;  3MC1 A;  5AHX A;  2HOF A;  5DG8 A;  4I2F A;  1TVA A;  4KMO B;  1ZQZ A;  4EX6 A;  2V9W A;  5EE0 A;  3D6J A;  4UQG A;  8ICY A;  3KD3 A;  3F2C A;  5JRT A;  3LYS A;  4YVZ A;  3Q8K A;  1KFS A;  3GII A;  2OHF A;  4ED3 A;  3NVZ A;  1NK5 A;  4C7Z A;  1BPX A;  4G9B A;  4Z6D A;  4WJ3 B;  3C23 A;  1QQ7 A;  3QE9 Y;  3A0B U;  4F5O A;  5AI8 A;  3HWT A;  2ZJ8 A;  3MFI A;  4F50 A;  8ICT A;  2DL0 A;  2W11 A;  4YQW A;  1RXW A;  1X40 A;  1A76 A;  2LMR A;  3PSP A;  2GO7 A;  2FPM A;  1K5O A;  1ZQV A;  5KG0 A;  4EYI B;  1CEZ A;  5KT2 A;  8ICJ A;  5IIK A;  4I2I A;  1ZJM A;  1Z4O A;  2C2R A;  4YMN A;  3Q8Q B;  3RJH A;  3M6Z A;  2ZIX A;  3V6H A;  2RRD A;  1SXE A;  1EXN A;  1Q3U A;  8ICI A;  3QUB A;  4OJP A;  4TUR A;  2E1E A;  1K1Q A;  2HHT A;  1TKD A;  5KG4 A;  4RPX A;  3IG5 A;  5ALQ A;  1NNL A;  5J2J A;  4NM2 A;  3RJI A;  3SYZ A;  4HYK A;  5KT4 A;  2G09 A;  5F9L A;  2ZG6 A;  3PNC A;  4F71 A;  5EWE A;  2VA2 A;  4IL6 U;  1ZQN A;  5CHG A;  4QW9 A;  3QU4 A;  4QZG A;  4DSF A;  1JAL A;  1RXV A;  2HI0 A;  4CF3 A;  1QTM A;  4QZ8 A;  2RDJ A;  1ZQR A;  1CI4 A;  2NO5 A;  1V85 A;  9ICO A;  1SZP A;  3OJU A;  2HVH A;  2A1J A;  4NL9 C;  2ZXH A;  4Z6F A;  1YZ6 A;  2HBK A;  5KFX A;  5HNK A;  1SV4 A;  2AGP A;  5AKK A;  4FBT A;  4DOA A;  1ZYQ A;  2K8C B;  5AM1 A;  2IMW P;  3PW0 A;  1ZQB A;  7ICU A;  4MF2 A;  2F76 X;  2CN1 A;  4IC9 A;  4HAI A;  1ZQG A;  3ETR A;  4FE3 A;  1C7Y A;  3Q8L A;  5KFU A;  4UAS A;  4JV2 A;  4EZ9 A;  2YB4 A;  4DFM A;  3BQT A;  2AHO B;  4OO1 J;  2KKP A;  3ZDC A;  2ZUB A;  5KT6 A;  1NK7 A;  2B0C A;  3BS5 B;  2WHE A;  4Y2R A;  4PGQ A;  4BUG A;  5DB7 A;  3TAN A;  4BJQ A;  5J0T A;  4AYB C;  3TAR A;  4IRD A;  4Z6C A;  4BDP A;  2ZIW B;  3TKA A;  1L7P A;  4C8N A;  4ED8 A;  1BNP A;  4TUP A;  9ICW A;  4M9H A;  3N7R C;  3UXO A;  4K4I A;  4FFD A;  1PK3 A;  2F2A B;  3UPQ A;  4JWM A;  2YN4 A;  1RG6 A;  4Y2T A;  2MRL A;  1XC9 A;  1DK3 A;  3GIL A;  2C28 A;  1L7O A;  2KD1 A;  4QWE A;  4QWD A;  2JH1 A;  2G08 A;  3QU7 A;  4OJO A;  4ECQ A;  3C28 A;  4QNL A;  5CWR A;  3QU9 A;  2HOI A;  3N4M B;  4RU9 A;  1L3T A;  2C2D A;  2JMG A;  5HP4 A;  3GIK A;  3HRD D;  5F9N A;  4RQ6 A;  4YR0 A;  4QWB A;  8ICF A;  3ORY A;  1U49 A;  8ICE A;  4NXZ A;  4ICA A;  3BJY A;  4LZG A;  5AI5 A; 
#chains in the Genus database with same CATH homology
 3D2N A;  4OJL A;  5KL8 B;  4WJ3 B;  2KOB A;  4IC9 A;  3KFU F;  1L6N A;  4P0P B;  1XO0 A;  4BX9 C;  2Z7J A;  3C29 A;  3E0F A;  3F5A A;  3L3F X;  3PZP A;  3N7S C;  3M6K A;  2RP5 A;  2D6F C;  4FE3 A;  2G06 A;  3N7P D;  3VCB A;  1KBU A;  2KVC A;  1ZQ1 C;  2YX8 A;  2OYY A;  3M7D A;  4FZL A;  3H0L B;  2WAQ F;  2YB4 A;  5A0L A;  4OJP A;  2WAQ C;  2Q4T A;  2XID A;  3PSP A;  2G5I B;  2HOQ A;  4NV0 A;  4FZM A;  2KIW A;  5HR6 A;  2KJ8 A;  1Z19 A;  2XIC A;  2RHF A;  4OO1 J;  2KKP A;  2G07 A;  3ONN A;  3LVW A;  2JHD A;  2KHV A;  1PVR A;  2XVT A;  1PVQ A;  2KKV A;  5HR7 A;  1A6S A;  4AYB F;  4BUG A;  4BJQ A;  2DF4 B;  4AYB C;  2ZIW A;  2H3Q A;  3OPX A;  2E5S A;  1DRG A;  2ZIW B;  4KX3 A;  3K1Z A;  2GH1 A;  4P0Q A;  1ED1 A;  4CDG A;  2DGZ A;  2GOL A;  3M6Z A;  3IN5 A;  3NRW A;  2ZIX A;  3IP4 B;  4PL2 A;  2RRD A;  4P0Q B;  2R18 A;  1D8B A;  2M0N A;  5T14 A;  3NUQ A;  1Z1B A;  1Q3U A;  1UPH A;  2KHQ A;  4A8E A;  2ZIX B;  1T94 A;  4NLC A;  2LHT A;  2VIX A;  3HKZ F;  2H3I A;  2LKY A;  2OM6 A;  3PSI A;  2K8B B;  2LYA A;  1ECW A;  2BDU A;  2HBL A;  2K4I A;  2E1E A;  2MA1 A;  3CYM A;  3H0M B;  3HKZ C;  3ICX A;  3N7R C;  3F2D A;  2LYB A;  5C0Y A;  3LVV A;  1PVP A;  2K8A A;  3MGV A;  2PMZ F;  2HBM A;  2XI9 A;  3ALR A;  3F2B A;  2OXO A;  2PMZ C;  3F53 A;  4OJ5 A;  3PST A;  2W04 A;  2WB1 F;  2CRX A;  2F2A B;  4NLB A;  3IG5 A;  3F5E A;  4FZN A;  1HEK A;  2WB1 C;  2W7P A;  1NZB A;  4OJ6 A;  2KJ9 A;  2NV3 A;  1GO3 F;  2HMX A;  3SAF A;  2MRL A;  4KX5 A;  3CP8 A;  3SAH A;  2VJ5 A;  1F44 A;  2KD1 A;  2G09 A;  2KV2 A;  2ZG6 A;  2KJ5 A;  2JH1 A;  1A0P A;  2G08 A;  3IG8 A;  4OJO A;  1Q3V A;  2YB1 A;  3VC8 A;  1YT3 A;  3PSF A;  3SMV A;  3C28 A;  2W7O A;  1HIW A;  4QNL A;  2Y0S F;  1OUQ A;  4CRX A;  3KZX A;  3D2S A;  2E1F A;  2G5H B;  2Y0S C;  2JGA A;  2HOI A;  2ZIV A;  4U6P A;  1URJ A;  3AQF A;  3T79 A;  3GU3 A;  3RFA A;  2K4H A;  4C0Z A;  2A3V A;  2VKQ A;  2K89 A;  2W03 A;  2ZIV B;  2N1R A;  3SAG A;  2ZIU A;  1MA7 A;  2HOF A;  4O3M A;  3RF9 A;  2JMG A;  4KMO B;  1TAM A;  2ZXH A;  5KL1 B;  4ACO A;  2ZIU B;  4GFJ A;  1CRX A;  4U7C A;  3D2Q A;  5CRX A;  2KEY A;  3CRX A;  2F8L A;  1SZH A;  2ZXI A;  2H3Z A;  1IIP A;  1WUD A;  2HBK A;  2KIC A;  4NWI A;  3H0R B;  4PL1 A;  3SQI A;  3AL0 B;  2JH7 A;  2HBJ A;  3F2C A;  2VJ4 A;  4JMU A;  2LBO A;  2H3V A;  2KNJ A;  2K4E A;  2K8C B;  2DQN B;  1P7D A;  2OH2 A;  4CGZ A;  2CPR A;  2G0A A;  3O0F A;  3AQE A;  3LYS A;  4ICA A;  3DEE A;  4QIW F;  1XNS A;  3GZF A;  2H3F A;  2F77 X;  4QJF B;  4QIW C;  2F76 X;  2CN1 A;  4P0P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...