3ZI4A

The structure of beta-phosphoglucomutase inhibited with glucose-6-phosphate and scandium tetrafluoride
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
218
structure length
218
Chain Sequence
b'MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-PHOSPHOGLUCOMUTASE
molecule tags Isomerase
source organism Lactococcus lactis
publication title Metal Fluorides: Multi-Functional Tools for the Study of Phosphoryl Transfer Enzymes
rcsb
total genus 76
structure length 218
sequence length 218
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2013-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3zi4A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3zi4A01
1U7OA 2DQSA 3EF0A 3N07A 3WKCA 5AW0A 4BBJA 2QYHA 3WK4A 1QQ7A 2B30A 4JB3A 4EENA 2HF2A 1ZD2P 2GHQA 2Q5EA 3AR2A 2ZBDA 5AKGA 3WGUA 5AI4A 3TLMA 2WF8A 4HYTA 4Y2JA 2W11A 1ZS9A 3SMVA 3QUCA 4CNQA 2BY4A 4HGOA 5AVTA 3QGMA 3N28A 3N8GA 1U7PA 1RLTA 2O9JA 4XOUA 2QLTA 3UM9A 1RKVA 2PQ0A 4NAVA 2OYCA 4KNVA 4FFDA 5AKEA 4Y2PA 2YMQA 3QU2A 2HHLA 3QU7A 2I6XA 4EEKA 3N1UA 2C8LA 3KC2A 3PDWA 3L0YA 3KBBA 4Y2UA 2JARA 1RQNA 5JJBA 4RETA 3L8FA 3B9BA 4FYPA 3NANA 2R8EA 4HGPA 5ALYA 3PGLA 5ALEA 3QUTA 1ZD3A 3SHQA 1QH9A 2R8XA 5A3RA 3KD3A 3OCXA 4Y2VA 5AK3A 2R8ZA 2P27A 2FEAA 5AVXA 5ALDA 1L7PA 1Z4IA 4C4RA 2ZBEA 3A1DA 4AS2A 1T9ZA 1VJRA 2IOFA 5IT4A 3NASA 3J7TA 2HSZA 4HGRA 1RPZA 3FZQA 3L8HA 2RARA 4EELA 4BX2A 1J97A 3E8MA 2FPWA 2ZBFA 3KOOA 5AK4A 3MMZA 3U26A 3QXGA 2WHEA 3A3YA 4UM7A 3EWIA 1ZRMA 3FPBA 5AIAA 2G08A 1TJ3A 4DWOA 3AR5A 2ZXEA 4UMEA 1IWOA 2PR7A 2JGAA 5FP0A 5T41A 1YMQA 3ZWKA 4OHFA 4Y2RA 5AVQA 4HGNA 2JAOA 3NUQA 3EF1A 2EARA 1O03A 1T5SA 2I55A 1QQ5A 5AKLA 1RMQA 5AW4A 3I6BA 4YGYA 4G9BA 5AKYA 2W43A 5ALNA 2BDEA 2RAVA 5ALVA 1RDFA 2Q4RA 3WKBA 5AKJA 2I33A 5ALXA 4QQFA 2YJ6A 1Y8AA 4ZEVA 3IRUA 2B1RA 5AW8A 1ZD5A 1RKUA 2B8EA 5AVWA 4PNHA 3ZVNA 1Z4OA 1EK2A 3DV9A 1Z4NA 4HAIA 4KX5A 3DAOA 4C4SA 5AK6A 1NF2A 1QYIA 1TA0A 3OPXA 5AW3A 4UU0A 5ALQA 3CNHA 3BA6A 4NWIA 5AW7A 5AVUA 1XPJA 2GMWA 1CR6A 1WPGA 3B9RA 3SKXA 3U7GA 2WF5A 1Z4KA 1NNLA 2G06A 3FPSA 1SU4A 4AP9A 2BDUA 2IOFK 3WK8A 4ZEXA 3AR3A 1WVIA 3UMBA 4AS3A 4BYGA 4YCMA 2G80A 4Y2SA 5AHXA 2Q4TA 2YJ3A 2FPUA 2HEGA 1NRWA 2WF6A 4RESA 3L0BA 5AK5A 1LTQA 3QU9A 5ALUA 3A1CA 4XQ0A 2C9MA 4JDPA 3AR4A 4Y2QA 1Q92A 5IT0A 3WGVA 3W5DA 5AI9A 1Z5GA 5AKKA 4UMVA 5AIBA 2YMLA 4B6JA 5ALIA 4YCNA 5ALMA 1RLMA 3IJ5A 2GHTA 3ZUPA 3QX7A 2JAWA 3WK7A 2G07A 3SLRA 4KYTA 3OTQA 2C8KA 2IA5A 1ZOLA 3S6JA 3WK5A 1MH9A 3ZTWA 5ALPA 1YV9A 4UAVA 1YDFA 3ESRA 4QJBA 3EPRA 1T5TA 3E84A 1EK1A 1Z4LA 4OFZA 3AR6A 4UMDA 3DDHA 1Z4JA 2CFTA 4E88A 3B8EA 3ONNA 2EATA 1X42A 1U02A 4UARA 3GYGA 3WKDA 1L7OA 3NAMA 4I9FA 4UAUA 1L8OA 1VJ5A 5ALLA 2X4DA 2IYEA 2GFHA 4YH1A 2ZBGA 3U19A 3ZVLA 3W5BA 3IB6A 2PKEA 3ZI4A 3QU5A 1L7NA 1YS9A 4F71A 3L7YA 3W5CA 1JUDA 1AQ6A 4UASA 2I54A 2FPRA 5ALFA 3AR7A 4L57A 4ZEWA 4YIHA 3UMCA 5AVZA 3OCVA 1WZCA 5ALJA 4DW8A 2AH5A 5AI8A 2NO4A 2YN4A 2IOHA 5ALRA 2D2VA 2HX1A 1YNSA 5AW1A 3QNMA 3N5KA 5ALZA 2FI1A 1O08A 5AVSA 4BEWA 3I28A 5ALGA 3CZ4A 3R4CA 2CN1A 1L6RA 2MU1A 5A3QA 3L1UA 2OA0A 2ZOSA 2HCFA 5AM5A 3MN1A 3MC1A 4KNWA 3NALA 5A3SA 3L1VA 1J8DA 3AR8A 3L8EA 4Y2TA 3QLEA 5ALHA 3WKEA 1N9KA 1YJ5A 3HYCA 5AW9A 4C4TA 2WF9A 3U7EB 4UW9A 4MUMA 1SWVA 3K1ZA 1CQZA 1PW5A 4J03A 2YBDA 3DNPA 4BNDA 2YJ5A 1L8LA 2I7DA 4DFDA 3U13A 1Q91A 3KZXA 1RLOA 3AR9A 5IS2A 3OCUA 1S8OA 3VAYA 2VKQA 4G63A 2HF7A 2HOQA 2OM6A 3P96A 2ZG6A 2MU2A 4IFTA 5AM2A 2AGVA 4XPZA 4UU1A 3ZX5A 5AM0A 3ZX4A 1RMTA 4OD0A 4CE6A 3ZWDA 5AI6A 4I9GA 3W5AA 4DCCA 2G0AA 3FVVA 3R09A 3I76A 5AM3A 5AKHA 3NIWA 2O2XA 4EX7A 4F72A 2YMPA 1XP5A 5AKIA 2HO4A 4UATA 4Y3UA 1U2SA 2P9JA 1WR8A 3ESQA 3ET5A 5AM4A 3WKAA 2B1QA 5ALWA 3U7FB 5AICA 3L5KA 3ZTYA 1ZD4A 4YCLA 1ZRNA 4MWOA 3NRJA 5AVVA 1F5SA 2C88A 2G1AA 5ALKA 4BX0A 1FEZA 3WK9A 4UMFA 4Y2YA 4Y2XA 2NYVA 1N8NA 2YJ4A 2OBBA 3HLTA 2HI0A 1Z4PX 4NV0A 1SWWA 2GO7A 3SKYA 4CF4A 3ET4A 5AW5A 4NFLA 4UM5A 2R8YA 2FUEA 1LVHA 4OCZA 2B8JA 3M1YA 3MPOA 4IG4A 2NO5A 4GXTA 2C4NA 2WM8A 2G09A 1ZJJA 1RMYA 2B0CA 3D6JA 5ALSA 4BEVA 5AM1A 4L6CA 2FPSA 4BNDB 5ALTA 3WK6A 3UMGA 3KDPA 3L0CA 1VFPA 3OCWA 5E0OA 3ZU6A 3QUBA 3E58A 2ODAA 3ZW7A 2AMYA 5AVRA 2MSNA 4HGQA 4H1WA 3I1YA 3PCTA 2RB5A 5AKZA 4NABA 2AUTA 4KX3A 2HDOA 1Z5UA 4CF5A 3F9RA 1TE2A 3A1EA 2CFRA 5AW6A 1QQ6A 2WF7A 1S2OA 2FPXA 1L7MA 1XVIA 3M9LA 1Z4QA 2FDRA 3FGOA 3OCZA 2JAUA 4YIKA 1RKQA 3FM9A 3OCYA 3QYPA 2EAUA 1KYTA 1TJ4A 5AW2A 5AKXA 5AVYA 2P11A 4O8CA 4KN8A 1U2TA 3L8GA 4GIBA 1K1EA 4L6AA 3R9KA 1RRCA 4BX3A 3E81A 3PGVA 2CFSA 1RQLA 2WFAA 3ED5A 2RBKA 3RFUA 3U7HB 2FUCA 5AI5A 2W4MA 3RF6A 4EZEA 2B82A 2P69A 4XE5A 4CF3A 3SF0A 4BKMA 2YMMA 3ZVMA 5AI0A 4J2TA 1TJ5A 1Z88A 3QUQA 5AESA 1Z4MA 2YFYA 2I34A 3BWVA 5ALOA 1RC8A 3QU4A 3SD7A 2YY6A 4FE3A 4EX6A
chains in the Genus database with same CATH superfamily
1L4YA 1YIOA 3MUEA 2QF7A 5D8DA 5CB4A 3EF0A 5A0VA 2FLKA 1JQAA 1RVV1 4IHJF 3QE0A 1CCWA 1G5PA 2FZCA 2IHTA 1BQ4A 4ER6A 1IIRA 2AN4A 3BB1A 1BXGA 1MIOB 2FMPA 4PAMA 3FPEA 3GJ8A 3TUIC 3JPWA 3VI4B 2WFLB 3H0CA 3ZDYB 4HX2A 4DJ5X 1UJCA 3MHTA 4LI0A 1G19A 2REQB 2CXQA 2VBGA 1RP7A 3OE7D 4J1TA 4O2BB 5EP1A 5C7YA 4EBBA 2J30A 4FC7A 3HYNA 1AGXA 3HB1A 9LDTA 5GJVC 1PNRA 1M76A 1H9CA 4UXJA 2XCAA 3NNSA 2C3OA 5FA5A 3V7KA 5LQJA 4MPTA 4Q43A 2VRBA 4LZLA 3T4PA 3H7AA 1EXDA 4DQSA 1MOZA 2W8BA 3O8QA 4GLJA 2N3ZA 3H6KA 4TVOA 5J2TF 4HL6A 2HJ9A 3Q6NA 4RPIA 3L5OA 3EGIA 1YFJA 3F2BA 3GFVA 2AFIA 2V3WA 4G5RA 1HX7A 2AOXA 2XEXA 1XR3A 2BEJA 3IEIA 4ZXPA 2FMHA 4KNVA 5BN4A 3T3DA 2ZWMA 2P5TB 4PY2A 3BC1A 5CFOA 5EHGA 2DGZA 3VDQA 5GPBA 4EEKA 2I6XA 4RJLA 4A91A 2B78A 1HDZA 3ONFA 1EX9A 3VYSB 4IDOA 1P2VA 4OMUA 4C6SA 1QH8B 2HTEA 3ZC3A 5DB9A 4F85A 2YYAA 2OWDA 3PGLA 5ALEA 5JFTA 4Z3OA 2AFIB 5LVAA 2P67A 2GN9A 2DFKB 4HQLA 1UHUA 2XYQA 4EG4A 3LPDA 4KP7A 4HNGA 5SYMA 3FX2A 3FCSB 3QKRA 3ZI7A 1P6QA 4EQ6A 2ZM5A 1XELA 2PUDA 3ILHA 1OBCA 5TE9A 1N6NA 3PFHA 3CH5A 3VYVA 3VR4D 1LB1B 2FLPA 4PWYA 3RKRA 2C2KA 3RH6A 4RHEA 5KT7A 1G9XA 3NBAA 3Q8QB 4IS3A 1XTVA 4TKUA 5LA6F 3SBXA 5M29A 2WINI 3R0XA 4ILKA 4JJ4A 3TBHA 1C0PA 3BB3A 2C4MA 2RARA 4FCVA 1A9RA 1WL8A 2C2RA 1T3HA 1KVRA 3G1TA 2JFYA 1E6UA 4N39A 3NS1A 3O9MA 3QSYA 1QS0B 1E2JA 3FDXA 1N0HA 3IUQA 4X95A 3L4BA 5JJ5A 4RACA 5AK4A 3RVNA 2XY7A 1QYVA 4JC0A 1QZZA 3ITKA 4DFMA 4FX5A 2QLJA 3WLAA 5I7FA 3IE2A 4V0QA 1YOBA 4DT1A 4Z6FA 4MV4A 4LFAB 4WY5A 1PG2A 2HCTA 1XDDA 1VI6A 1G0NA 2HF8A 4E0DA 2P91A 3M81A 5B4TA 1J22A 1J7KA 4QUJA 2O8EB 4MPRA 1X6IA 5G0VA 2R68A 5IASA 2QV0A 1FFCA 3OQHA 4PHTA 3DUWA 4RTOA 3ZKWA 1EJ0A 4AECA 2EOAA 4MOWA 1XSLA 1A0PA 1DC8A 5FP0A 1UBGA 1WPQA 2VWGA 3H5OA 4OHRA 4URYR 3F7NA 3T79A 3MGHA 4OHFA 5I9MA 3KJQA 3S2SA 1Z5NA 2LIPA 4HGNA 2R8BA 1KOFA 1E77A 2FQYA 2KQUA 1O03A 1ZIYA 4PBRA 2RQ5A 3C43A 2FEKA 1VOTA 4E5KA 3TLEA 1LJUA 2YVQA 5AKLA 2XGOA 1HKUA 1XO0A 4BVHA 4G0UA 2OG2A 2J48A 1TK5A 4QGBA 1XD9A 4RIIA 4ZJYA 2KP7A 2C4HA 4PXYA 2X42A 5IAJA 5F52A 1PFWA 1J49A 3IE0A 5H0IA 1I3CA 2YWCA 1H3NA 4Q44A 2OH2A 3BREA 3DFUA 5EI5A 4U00A 4Z8YA 3KL4A 1TYAE 1YQ9A 4K3VA 1ND5A 3E61A 3GFGA 2Z58A 4MVJD 1PKEA 4IHJA 1COKA 4XR4A 1ONPA 4H6WA 4MUEA 3E7PA 1PR2A 3ZG6A 3EC7A 5BMVA 5I8WA 5CYOA 2B8EA 4W9NC 4DAOA 3NM4A 3CYMA 1KDVA 2VJDA 4KMMA 1NBMD 1D8YA 3AMVA 1ORHA 4KQMA 3W5UA 1Z4NA 2WP0A 3G8YA 4ZA2A 3PUYA 1MX3A 2W83A 3CN7A 4OXQA 2IUUA 2V7BA 4EF5A 1N5JA 5BW4A 4GXIA 4N5DA 4LVCA 1EGAA 1NF2A 3OZIA 1ISGA 3EDQA 4MV0A 3BAFA 3IIIA 4YJDA 1ZUNB 2WQ6A 3J7AC 1KR5A 1QF7A 4CM8B 4NZZA 2HA5A 2UVQA 3IPLA 1FVHA 3CH7A 2V0CA 2I7TA 3FUUA 1P19A 1CYDA 1WCIB 1YBHA 2K2QB 3HI6A 1WPGA 3CNQS 4MEAA 4R98A 3I01A 4DDHA 4YT8A 1IXKA 4EY7A 2ZZMA 4Q4JB 1JGTA 2XADA 5B58T 1W581 1PJBA 5A7HA 5KBYA 3CO0S 4EZ6A 4UBCA 5LP6C 2KX7A 3TZKA 1W36D 4PYMA 4CKXA 4D02A 3R3JA 3A1SA 3GQCA 3IHTA 3AB8A 1ZQHA 2BZ1A 1G17A 2C2YA 1PT9A 4IIDA 1W4AA 2D54A 2YUTA 2CV1A 2KWIA 2PAFA 4AJ9A 2WHPA 1SVMA 3FB4A 4DR6B 5J59A 3PW5A 4B71A 1P81A 5FPSA 3V6KA 1TTQB 2I2FA 3QP9A 4O2LA 5EZSA 3RJ5A 3VU8A 5CA1F 1W48A 5HFNA 1PAUA 2YXNA 5JMOA 1UCFA 3ZWWA 1RM5A 3U4HA 3K53A 3D2QA 5F1YA 1DMSA 1NQTA 4C88A 5ALIA 4EJSA 3IHWA 1NN3A 1ZQMA 5TQ2A 3RTGA 4AKTA 2GHTA 3OLVA 4MW5A 2HHAA 2JAWA 2JHAA 3S27A 3L8ZA 5KG3A 4ZANA 1NOJA 2XYRA 1NY6A 1XZQA 3C7CB 2CF6A 3QPCA 4FKZA 4NYIQ 5EIHA 2VUTA 1TAUA 3UXOA 2H65A 1U5CA 3IIEA 4RVFA 4IYRA 1J00A 5DN6A 5LBUA 4A8JA 1Y6FA 1EVIA 4QARA 2JVKA 2ZYHA 4GPTA 4YMMA 3FD8A 5FYQA 4JVLA 3QVWA 3BWYA 2WT9A 1D9ZA 2VUUA 2XEDA 1GOTA 3ESRA 3P9YA 4QJBA 4AQDA 1PTJA 3VSBA 3VKWA 2VAXA 4RTQA 3FTPA 3B9JA 1SXEA 3JCZA 4UPDA 2WWXA 3T52A 2J5BA 1VC2A 3GJ0A 4G2NA 4RAOA 3TEMA 3TOCA 4CUKA 3NH9A 3GUHA 3UAOA 3W9UA 4LY3A 2Q6TA 3P0EA 2A4MA 5HS6A 1PK3A 3ZCXA 3HDYA 2WJHA 1RYMA 5GTIU 2DJIA 3TCNA 2ONCA 2QTFA 1MTZA 3AEKA 1XAJA 3GT4A 5M34A 1W4RA 3QPBA 1FSFA 3FCCA 3RB4A 3T0IA 2IPOA 2VP0A 3P2IA 4TV8F 1OBHA 3G2MA 3V97A 5LMNB 3WRXA 1DK3A 1KL7A 2J09A 4QFBA 2GXAA 3M1LA 5L3VA 1N1EA 2FMXA 1KI9A 3B6EA 4AZVA 5G53C 2AKAB 4U2DA 3RABA 1BMFD 1S8AA 5JXWA 4AMGA 3KYBA 1YS2X 2GFHA 1JKFA 1FYFA 4LN1A 4Z4HA 3EA4A 5EUBA 1JQEA 2XWJI 3KPJA 4QUIA 1F2DA 3UW3A 4KDCA 1L1RA 2ZSDA 4NEGA 3CA8A 3VFDA 1F9EA 3LIIA 2UVPB 3BF7A 3CR8A 4OOFA 3KO8A 3WLKX 4KSYA 1BH6A 2BISA 5E4JA 3SX4A 5LYJF 3KYCB 2A0FA 3D4OA 4BFSA 3VJMA 2PKYX 1EFVA 2PWPA 3HUUA 2ZR7A 2ZYAA 3NGMA 3L6DA 4TRJA 3B1VA 3GRKA 4GPEA 1AQ6A 4PYRA 2ZLBA 1DC6A 1AK9A 3PC7A 1YCDA 3BD6A 2ZWOA 4UXIA 5HE8A 3ZS9A 4DQUA 3A0BU 1EHCA 2GK7A 3NV7A 1CW2B 2Q4BA 3L79A 1V1MB 1XMJA 4RULA 2X5KO 1WQ3A 2YHUA 3D1VA 2E4AA 2UYOA 4GEKA 4B3BA 4R3NA 1Q8KA 4IS7A 3V4PB 5A02A 4JL6A 4CETA 4L5AA 1GZUA 1J07A 3HBFA 5C2JB 3QKIA 4YRKA 2PV0A 1FUKA 2G82A 4C20A 2AZDA 4R41A 1XL1A 1JVSA 4TWBA 3R1IA 4GMFA 3QOWA 4IGIA 2XIQA 1PL7A 4EMSA 2P5UA 1WS6A 4IMPA 4UVHA 3AEVA 5DQGA 1NC3A 3DEKA 3DMTA 3WYBA 3ZHBA 5AVSA 5CNJA 5IN4A 5KYWB 2BFPA 3SI8A 1BJTA 4HTAA 4BFCA 3HA2A 2FAXA 1DKOA 1FP4A 5TS2A 1P74A 1SKQA 5LDDC 1V3UA 5DLPA 3GRVA 4DM7A 1WO8A 1ZAKA 3JAWB 5EJAA 3MCUA 2J3KA 2B2XA 1ZNQO 4YQWA 3RIYA 1GTVA 2LYHA 4G67A 4U6NA 1OXSC 4G5HA 1C7IA 1E2EA 1G6KA 1XZIA 2PZJA 3G6XA 2BSXA 2MSWA 1HG0A 1Y9JA 1LV5A 3CZQA 2Q46A 5C0YA 3FPJA 3HJUA 4LMRA 4XWYA 3LHFA 1QIGA 1W0CA 2F67A 1YJ5A 2ES6A 1DT5A 1E2KA 3E22A 4LPSA 3E3NA 4M1ZA 2BDTA 4MFFA 3ROTA 1UPBA 2YXEA 3HU1A 3I12A 4KI0A 3RYFB 1SWVA 2ASVA 1AQJA 1ZRSA 1J0XO 3S2YA 3PX6A 4KAJA 4D9HA 5B1DA 2YQ5A 3ER8A 4MW9A 3CLSC 5KJFA 2FG5A 4WD3A 5HR5A 4LGMA 1BCRA 1NNUA 3SJAA 4GI7A 1U4OA 4PCVA 4JLBA 2HHQA 4MS1B 4F3TA 2HN9A 1MSWD 3Q7TA 1H69A 2QUIA 1EFAA 2D1SA 4JQZA 4L85A 1ZEJA 2CBZA 3M6WA 3ZWPA 1E3JA 4BRUA 1ZIXA 2CLKB 3T5HA 4HK4A 1KORA 5IHXA 2C20A 4G5FA 1BKSB 3EA5A 1PFQA 2GLEA 5EXDA 3O2SB 2GFQA 1VE7A 2O2SA 1I3MA 5KFYA 2WUEA 3LFHA 5AM0A 3FPCA 3AEQA 2V4ZA 2CHGA 3B3AA 3HR8A 1GRNA 2D1TA 2BCQA 4TKVB 5EERA 3C24A 3VC2A 1G2OA 4PVDA 4EPVA 3CLUC 9ICXA 3K4HA 5SICE 1W25A 5JANA 2ZBUA 3KOWA 4Q7MB 1ISPA 1UPAA 1AB6A 5CJ2A 1UBMS 5IARA 2Q2QA 2PZEA 1GTZA 2WFMA 3SJUA 3DQQA 2CMKA 4IUDS 4JI6B 3C6YA 3IV9A 2LGJA 1RAIA 4IXMA 5BN1A 5IYZA 1C7RA 1P80A 2QG9A 3DBRA 2ZFUA 1CZOA 3MFIA 3KZVA 4KQ9A 1G6OA 2C8VA 3FZYA 3OQIB 5TQJA 3G85A 5FLEX 2CV2A 3BEOA 2BGUA 2B1QA 3F71A 4LBZA 1AUPA 5LCXA 4YYZA 3KQUA 1GNTA 1KZ1A 4PPFA 4CQJA 3RVMA 4E2YA 2QLBA 2ZBVA 2FEMA 4KV7A 4X91A 3H5VA 4REQB 4YCLA 5C37A 4YXWD 1F5SA 2EAOA 2Z7JA 4AKEA 4RNNA 2GVNA 3GJSA 5B1EA 2Q7DA 5FTWA 5KNCH 3WOVA 4Y6LA 4NL9A 4P7GA 9ICNA 2OG1A 1T0UA 2COKA 5TJ9A 2V0NA 1WM1A 4PGQA 2DLDA 4Y2XA 3OIFA 4PS0A 5DCUA 1LBEA 4L07A 4MKHA 2V4RA 3ICVA 4TKUB 4F5EA 4YAGA 3C8ZA 4RMJA 4OHCA 3V5NA 1BRTA 4RPCA 2FRXA 4ZAGA 1OFUA 3G3EA 4O2AA 5DF1A 2AXTU 5E6UB 1PUXA 2W6OA 4LOKA 3DLIA 3QENA 1JEYA 3M3HA 3BMNB 3CGWA 1WMDA 2PTGA 1S2GA 4TXLA 3B1FA 3D6FA 1L3BA 2AW5A 1LVHA 1T6ZA 1AKVA 1N3IA 4S1OA 5JAUA 1W35A 1G5RA 1MV5A 2IBTA 3MUFA 5DNUA 1SV0C 1J21A 2BI4A 2W48A 1UC8A 4CIDA 1R6TA 3GC6A 5J2EA 1TDJA 1X1CA 2G67A 4L3WA 3THWA 4NIMA 3ZCSA 2ZTLA 1KNQA 3LYLA 4ENSA 4NULA 2BFCB 2IYFA 2J3DA 3K1AA 3DBHA 1JFFB 3L7IA 4A6DA 4UTZA 3GLUA 4RZHA 2V55B 1NG1A 2RHRA 1J2RA 3NIFB 4OQEA 3IQEA 3LHSA 4PL2A 1VL2A 4HFNA 1UMCB 4OQNA 2CWDA 3I04M 1QORA 1CVRA 2JGDA 3DVQX 4I1VA 4F6LA 5J0XA 1L5VA 2PYDA 3EFOB 4HDSA 4MRVA 1YQXA 4WKBA 4BMZA 1FDSA 3E5RA 3HXKA 4GXQA 2PEZA 1TUBB 4QULA 4XCQA 2Y9UA 3LDAA 3EZLA 1BXZA 4AWAA 5GIPE 4DJAA 2W8BB 1D2CA 3A6HA 4PR0A 4C7VA 3AUJB 3IP5A 4EUFA 5A4JA 1P2GA 4DB2A 4E5DA 1E2HA 2VJOA 1M7HA 3GP8A 4P98A 3H2KA 1CUJA 3KV3O 1F1JA 3Q7IA 1QSYA 4F5PA 2ZSKA 1U0TA 3R6GA 5GY7A 1WB6A 1RJ9A 1JZTA 5B2EA 3A4VA 3BS5B 2RGYA 3UAVA 1PQ4A 3E2PA 5SYAA 2IZ7A 5FFMA 1PT5A 2W6PA 2OD7A 3AEYA 1WB9A 1QLWA 4Q3AA 4A3SA 2PL5A 1Y1KE 1VBNA 3H1TA 4JVNA 3TW0A 5G41A 4ARAA 2WBLC 1E9BA 3DOCA 1R4ZA 2FSHA 1JR6A 2DHDA 1BDBA 2BGMA 4CZ2A 5E4FA 1Z6PA 4GXKA 5IYZF 1GPAA 4CNBA 1G7CA 5B57C 1N6KA 4LQ4A 3FNHA 4K9DA 4PCLA 1GUZA 4TTJA 2DPYA 3HJCA 3N0XA 2B4KA 3ORSA 5HJ2A 2F3UA 1MT0A 2HIGA 4CN9A 4ED1A 1RQLA 1LEHA 2TRSB 2ZETA 2EDUA 4F93B 4FS2A 2XDQB 4J90A 1GYQA 3QWBA 4OI2A 1STOA 1Q0LA 2RDIA 3RFCA 3OQPA 4PIMA 5BMOA 3UB3A 3KKLA 3MDCA 4CF3A 1K5HA 1LQ2A 3MCAA 3Q0TA 5J2UB 3P9IA 4OY3A 4JJ6A 3UUWA 2YFYA 3KYJB 3PEEA 1VJTA 4LE0A 2VJQA 2WWTA 2O20A 2QXYA 3RQSA 3V72A 4M9UA 4TTRA 3URMA 2GNAA 3AUKA 5DK6A 4Z1OA 1QZTA 2I7CA 3HSYA 2QL7A 3ENVA 4PXSA 3VGPA 4K9QA 4DJFC 4EFKA 3FUVA 1UXJA 2BFAA 2D8MA 1UMDB 3LP8A 1N5DA 4H7PA 4JLNA 4N5LA 2F43B 4C4PA 1DP4A 1SUCA 1X0XA 2C58A 1U63A 3LBAA 2GHQA 3K1TA 1S2DA 1O4WA 5KFSA 1QPGA 4TKLA 2QSYA 1SHZA 3H2SA 1T9AA 4L9RA 4A26A 2QU8A 4G0OA 1YZKA 1A0OA 4DCMA 2W11A 3GMTA 4M1WA 5KNBD 5F12A 3RHZA 1EA5A 1YACA 3UT6A 3M8SA 1FY2A 1TIKA 4LXXA 5K09A 2IYAA 3MTDA 4ASUD 3EZYA 2OUKA 4AZTA 3ESYA 4R2KA 5JBNA 5LLSA 3MG9A 3GPCA 4DR2B 4PZYA 2HLDD 2UYGA 2YFKA 1HLPA 3C8UA 3RUDA 1HETA 4N1AA 4F12A 5EJ6A 3WYDA 1NVVQ 1VRVA 1S02A 5AJYA 2R6CA 4DNOA 4Y2PA 1KY5A 3QPWA 4PSVA 1TQ4A 4W5OA 3JAKA 2C7VA 4REOA 4Y2UA 1N5IA 3V3TA 1Y1QA 1E6MA 2H4YA 3PIIA 1I1NA 2PZAA 2R8EA 2LDBA 1Z83A 2W6NA 2ZUVA 1J09A 4BVLA 1F3LA 3H1PA 2C99A 2I3DA 4RSHA 1E0SA 2HK7A 3OKPA 5FNVA 3WR5A 4CCWA 4LC9A 1NVMB 4Y2VA 2D5BA 1J0AA 4FN5A 1U3UA 3EFOA 3PWKA 4XCVA 1SXJD 1EXWA 1Z4IA 3THYA 5EN4A 1M73E 8ICTA 4B9MA 1VJRA 4FYVA 1FUUA 2O8DA 3UFBA 2K7FA 1P7ZA 4A16A 1NQUA 4HGRA 2VTDA 4Q39A 1VLMA 2G04A 4HV4A 2V6MA 4MI1A 1P44A 5JMTA 4NLNA 1SD5A 3HM2A 1Q3VA 1N2CB 1YNOA 2NZVG 4IC9A 4J3FA 1A2BA 2H1CA 2XGSA 2IXGA 1WXIA 4GXNA 4D3XA 3PJRA 1Z6TA 4BJ5A 4MS1A 3ZCPA 1FFWA 2ZBFA 3WLJA 3KOOA 2PA3A 1MW9X 4TOIA 3UMFA 1JR2A 1SBYA 2WHQA 1NUUA 1YJAA 1ZUIA 5DBHX 4AKHA 1OH5A 5IXYA 4GR5A 2G08A 2ABWA 4FXPA 3TLCA 2P4UA 1U0GA 3AR5A 1BNPA 4MKRA 3UKDA 4AZ0A 1L7EA 4MW0A 2Y71A 3F2IA 3EULA 4HTFB 4OIMA 4OQQA 4FT4A 5ENVA 4QM6A 1L7VC 5JCZA 1SKMA 3GLTA 1NLFA 3A7DA 4UNPA 1NKVA 1Z7GA 1SQGA 2JAOA 4HGZA 2Z2ZA 3L8YA 2R8PA 1VIYA 4GP6A 2L42A 3VTKA 4FK8A 5CFMA 1DEKA 3D02A 3R7WA 3NMUF 4ABTA 1QYWA 4I6EA 4C0XA 3K6KA 4QG3A 2Z5VA 2ZDGA 3Q9UA 2EZ9A 2V4QA 5ICSA 5IFKA 1OHHD 1E8MA 3TQOA 4PIPA 3HJGA 3JD0A 3WMEA 1KRHA 3ZGZA 1NRXA 1RE1A 1PWXA 2BCGY 4R64A 1KXZA 4JC5A 4RD3A 2PZKA 2VTBA 2VPIA 4ND1A 1OXJA 1K08A 3ZE0B 2W42A 1I51A 2WNSA 3D2SA 3CE6A 4G5GA 4K9SA 4O4IF 3IA7A 5AKJA 3AU6A 1O54A 3CWCA 2CD7A 4HDAA 4FS1A 1CS4C 1KI4A 4NBNA 4RSMA 4UHCA 2D1FA 3S40A 4F4JA 4XQ8A 1D2RA 1D7AA 5TQ0A 5MF6A 3SIRA 4D92A 5KL8B 3L82B 1Z6YA 4M46A 5BR4A 2XUPA 1ACMA 4U2BA 3ZU3A 2J9YB 1M10A 4L7QA 1E58A 3CRMA 3TQQA 3ZWNA 3UFXB 1IJFA 4ZJPA 3MWDA 4P0QB 1G4HA 1M6NA 1HNZB 3ZXYA 1T5HX 3ME5A 3U3XA 4ZOHC 4EA7A 5PGMA 3JQ9A 1M2NA 4YP5A 2EAMA 2XUGA 4NLZA 4WXYB 4DLAA 3PC3A 2LYAA 3DLAA 1F8UA 3FPKA 2ZRHA 1YHNA 4OYRA 5EWLA 3OQJA 2FN7A 1U2GA 2ASDA 4XAQA 4GOXA 4BNKA 2H17A 1ZJZA 4BJQA 3D6MA 4G85A 4Z4IA 4Z8XA 4CIXA 4ZYLA 4B85A 1H4TA 3IAEA 4ZAYA 8OHMA 3U1BA 1T91A 3SMQA 4ZI2A 4ZVLA 4AD8A 3PD7A 1PJ4A 4BYGA 5I4CA 1Q0PA 5KG2A 1U0JA 3U44B 3GPDG 4R9VA 3U4QA 2JANA 3TR0A 4L73A 1UDCA 3RT1A 5D4BA 1N2SA 3BQ0A 4TUSA 1MPXA 1FVOA 4EBCA 5KJCA 1D0SA 2EKDA 4LXHA 1CJSA 3IQWA 4F4CA 2CLDX 1S0MA 4RL6A 1H2RS 4RJJA 3H4IA 3SQMA 2PJRA 4JDPA 2BVNA 1QIKA 3GJYA 3DEIA 3K16A 5IT0A 5IM4A 4QLAA 5C31A 5AI9A 3U7QB 1Z5GA 3DKIA 1H0HA 4UB2A 3FGPA 4BIIA 3MGCA 4BQQA 1UP4A 4LSWA 1URJA 3MMSA 4U2KA 2X9VA 3TQRA 1USKA 2PS3A 2KIWA 3QLTA 4KWIA 4PLCA 1GKYA 4KYTA 5CVTA 1OFHA 4R71A 3VU0A 3A9CA 3K96A 3WDSA 2CVHA 4N76A 1MVOA 5JQGF 1JEAA 1E2FA 1U81A 4G84A 3IT2A 1A8SA 4I7EA 4RZ3A 4TYQA 3PZRA 1L5HA 1DO0A 4ALMA 4BFXA 1H1LA 1ZQYA 4W4TA 2UU9B 2ZBRA 2AQKA 5H9WA 1A9QA 2GZAA 2OCXA 2EIXA 3ZDDA 3O84A 2FE4A 5DN6D 2PJUA 1AUOA 3LLUA 4Q4HA 8ICXA 4E09A 2VDQB 3DDOA 2PH7A 4P4UA 2QNIA 3ISTA 1DWPA 1BCSA 1SUAA 1C1XA 1XF9A 4YRGA 1MB4A 2XCTB 1CEZA 1WU7A 3ICXA 2CVFA 2Q1XA 3WL4A 5JY1A 2I66A 2CKMA 2H8KA 4BQSA 4A8PA 2M9NA 3R6DA 2Z2KA 3EG9B 3CB2A 1IUNA 121PA 3WQSB 3UENA 5CVDA 3V1KA 4BIMA 1NK7A 3DMTC 4HRXA 4KR9A 4INJA 1L8OA 3LC0A 4TX1A 4P0PB 2IEAA 4W5TA 2Y9PB 3JQEA 4FD3A 3OFND 3LYHA 4LC0A 4NLLA 4RVDA 3PJDA 5BT8A 5KX5A 2B5WA 2WTNA 3WHLA 2PVSA 1N62A 4M21A 4FNGA 3EAFA 4PRKA 3TPZA 1R6UA 1IXSB 2HPZA 3RVBA 5IF3A 1FFBA 3DVRX 1X1TA 1FFYA 2J6TA 3P32A 5KFMA 1CT9A 5A2GA 4C0ZA 7ICKA 4G0WA 3CF6R 1KARA 1HZZA 3ZI4A 4QU9A 4CV0A 5KU7A 2WOOA 1L4LA 3JWPA 5L40A 1BS1A 3DCYA 5MHTA 2XECA 4Q3NA 1R4AA 2ZIEA 2E55A 3SQIA 3ZH2A 5BQOA 2EZYA 4KLLA 1XBTA 2WAOA 3DOOA 4MZXA 4AWXA 5D85A 3C21A 1B41A 2K8CB 1PJCA 2ERCA 2FPRA 3L84A 3PHIA 4RKRA 3RRZA 1QYCA 3IURA 4YIHA 4KTQA 3DMNA 3LZDA 4A0SA 2WWIA 4DLPA 2QM0A 3K92A 1Y3IA 2VWHA 3FZGA 4OBBA 1R18A 3CMCO 1J5PA 1TQ6A 1K98A 5DEIA 3HNPA 8ICSA 2EDAA 3QPVA 4KBFA 3F5MA 5AJXA 4AJNA 3W9YA 1US8A 1Z5PA 5ALRA 3NFRA 1KI1A 3O4IA 1R6VA 1OPXA 1TCUA 4TVSA 1TF7A 4J76A 3KKAC 3WSVA 3FHCB 2C97A 5DX1A 4GL4A 1WMEA 1M1YB 3HRHA 1QGAA 4N0MA 4BRSA 2OB2A 2XMQA 4NOLA 2C94A 1C3EA 2CL0X 4PEVA 4C08A 5K0FA 5K3EA 2VIIA 3A10A 4MQ5A 2GEBA 4X44A 2JEZA 3P71T 4B47A 1KU6A 4XUGB 4CR6A 3RD5A 2AU0A 4R7TA 1M2EA 4GSLA 4CU5A 3L6CA 4BYMA 4ZKDA 2Q9UA 1KWGA 1XKXA 4IDBA 3ICOA 3QV2A 4IIXA 2VIXA 3M4YA 1ISIA 2JCSA 3BRCA 1UP7A 3TAUA 4AY2A 1H1TA 2YWDA 3C5VA 1Z36A 2GJSA 1UXHA 3GG2A 2ORVA 3NTRA 3RREA 1JDVA 1UBFA 4KWHA 5KVCA 3BMNA 3D4NA 2XGJA 1IM4A 2VP6A 1YOVA 4UU7A 4EPTA 4PO3X 1YASA 4ZDKA 3H97A 4PZNA 1E18A 4DXAA 1ZQBA 2IKSA 5KNIA 1F0PA 3DR5A 3MOIA 4EB6A 1XEWX 3RS8A 3U7EB 5HUHA 1KNXA 4E2ZA 1VP3A 2KNJA 1Y63A 2HU8A 2IIBA 3BDVA 3DVSX 2BQUA 1QKKA 3EY9A 3MBIA 4UUOA 5DVZA 5FKJA 2Y1IA 1DEOA 2V7QA 2RGUA 4JV2A 1JF8A 2ZTMA 4HAUA 4MB0A 4Q4AA 8ICIA 3ACDA 3DMDA 4ED6A 4PL1A 2VBFA 1AC5A 4QNLA 1QONA 1ZZEA 1GJRA 2RONA 5LZ9A 2HRQA 4JMPA 4Z4FA 2PZLA 1FUYB 1JRLA 4M9ZA 1W5FA 1SHTX 4ZT7A 4LXGA 4EEYA 1PO7A 3WYGA 1TKCA 4RTRA 3GJXC 1V39A 1T9GR 2C84A 2B5OA 4BAGA 1N5LA 1IZ9A 4GLOA 3RRYA 4BO1A 1VE1A 4GSKA 3DQPA 1OYYA 4IQGA 1F17A 3ACCA 4FFBB 5E9JA 3RAJA 2P2ZA 1CUCA 3IALA 3T7SA 3ABQB 4OLAA 1P4SA 2VLBA 3OCJA 2QPLA 1K4MA 1Q1QA 4L2IB 1Y6ZA 1OW3B 3Q41A 5KFXA 3PT9A 2RHJA 3DFIA 4ZZ3A 1RMTA 4IVNA 4CLEA 3DHWC 4BVGA 2JIBA 4AO7A 4FYIA 5JDCA 1WSWA 1NV9A 1Y4ZA 1KMQA 4ITUA 4C5CA 3DDWA 3NRZA 4U3JA 4WIAA 3K70D 4TUPA 1DQZA 1V26A 4WNAB 3WIEA 5FWDA 4F4UA 1CF2O 1KK0A 3I3SR 4OJTA 2JLZA 1V11A 4MO9A 4A0FA 3AEQB 3M5WA 2GRJA 1SULA 5C18A 3TG2A 2FPGB 3NOQA 1B8VA 5EG5A 4IILA 3WSWA 1MX5A 2XE6A 3BCRA 2VBCA 3CU5A 3AUXA 2QQ5A 3OP4A 3Q4GA 3UXPA 4OQ4A 4QPDA 3I8XA 1OROA 4DIUA 1MQ9A 3SYTA 3GLIB 2NV3A 3OEHD 2YHIB 4YCXA 3E9ZA 4FM9A 1WW8A 2QUAA 4WTOA 3DHNA 4IG9A 5AICA 1CUSA 2W3SA 2WB1F 1BH2A 1U1CA 1W4BA 1Z6AA 1ULSA 4QHSA 1V2HE 2C04A 3O4GA 4FFLA 5E1MA 4F1WA 5IDXA 1KKUA 3KXKA 5CIQA 4DS4A 4R66A 1ORRA 1SC6A 1HWYA 1PBTA 2ZATA 3KQQA 4KXXA 4DS3A 3WBKA 3AEZA 4UB5A 1AO3A 3CINA 4HVAA 2YIVX 1E0KA 1ZGJA 5EMHA 4H9GA 3GT0A 5HA5A 1NZDA 3PUKA 3V4FA 4HY3A 3EZNA 4F7WA 1BXRA 3ET4A 3ADBA 1SCNE 1VPLA 4NFLA 1GDTA 2H0RA 2EKZA 3WIDA 2BJHA 2JAHA 4U7CA 2VJLA 1JHAA 1ILEA 1JAZA 4B7AA 2G5GX 2ZPAA 5AUOB 3IV6A 2ATLA 4B34A 1F0NA 1I13A 4M87A 1N6LA 2CDCA 2OBXA 3C16C 4P3XA 6ABPA 1GGNA 1AQLA 3EOBI 3PFBA 2RE8A 2C4NA 1R88A 3M83A 3MTGA 1RAHA 1XCJA 4HEJA 4E1BA 5IZCC 3AHHA 1XZPA 4R5HA 3I01M 1N1MA 4JWNA 2KMDA 1HA3A 2QYOA 3L4EA 4GMXA 4I46A 4KB5A 3SZGA 4HLNA 3BSYA 1PVQA 4AP6A 3LUAA 3QEBZ 4FFRA 2EG9A 2HC9A 4CTKA 1X7ZB 1YZNA 1QP0A 3VAAA 4NXZA 2R1TB 3UHPA 3WLIA 2OSVA 1FRNA 4HNHA 4QJIA 2RD2A 4ARUA 1IJBA 2Q50A 3D3QA 1HO3A 3AO0B 4C80A 3E6AA 4FYWA 4GZLA 4S0XA 3CFYA 4RVHA 3TIXB 4JXZA 4FZ3A 1ZD8A 3CLKA 5LB2A 4E15A 2Z4SA 2I2BA 4K6MA 3AN1A 1WUKS 3R3VA 2C5BA 6ADHA 5KFJA 3THOA 4B81A 4NLKA 5J23A 2X0RA 3LPNA 3RWOA 5JEDA 3THXB 2MUTA 3D4PA 3QY0A 4ITRC 3WIOA 3IQXA 2YYZA 3SEZA 2Y68A 3EXEB 4LGVA 2PSSA 3GB9A 4S2UA 4BJ3A 1USGA 3ES9A 3L6BA 5DPMA 4O4JA 2ZRKA 4RVNA 3TXXA 4GRIA 4J16A 2HTFA 4AQYB 3GMDA 2XE4A 5D1HA 1Y4SA 2RB4A 3HU5A 2M6LA 4RNMA 1UXIA 1PZMA 5B1YA 5LQDA 5AUPB 7ICPA 3U7JA 1IULA 4O4JF 421PA 2EZZA 2IEGA 4M8IA 4DNXA 2I6GA 1VBFA 3UH1A 3FM9A 2ISCA 5IIJA 1F51E 4HB2A 3ROPA 2D3DA 2WDZA 2X3UA 3QLUA 2VSYA 4DV1B 4RF3A 1FP7A 3Q3EA 2QS9A 1CE8A 2EGHA 5AVYA 3E05A 3KSRA 5LQSA 3TSWA 3TNDA 3KZ1E 1GTG1 2ZYGA 5JPDA 2RHDA 4L6AA 1SV0A 4WXHA 1MF7A 4BX3A 4WECA 1XWIA 3LZ6A 1HOXA 3RWMB 4A36A 3G1UA 1SCIA 2C2MA 4EI7A 2XUHA 1NR5A 3MTQA 3UTDA 3HL0A 1T2FA 2WE8A 4ED9A 3RBEA 1E79D 1JMKC 6YASA 2MJLA 4RS4A 3RF6A 3INGA 1PIWA 2PUGA 3ZHQA 1MQAA 4RPLA 3TW8B 4WZAE 4BKMA 3W5HA 1RXVA 1CUWA 1PWYE 5K3CA 4B1FA 1QIIA 5IHPA 3DOFA 1DVRA 3IHLA 3WDKA 1Y3HA 4ECSA 4C14A 5AESA 5HKOA 1P0IA 4PE5B 3JV7A 3Q7EA 2PIAA 2FFJA 1DKPA 4MMXB 4DPMA 1D9XA 1IL0A 1U5BB 1SXJE 2EF0A 1LLFA 4GNRA 1K2VN 4E14A 4EKNB 4ARSA 5FTJA 3VISA 5JC8A 3UQZA 1XS9D 4NE9A 2GPTA 5G3YA 2J3QA 3MRTA 4BBJA 1NU8A 3V3KA 4ODIA 4B6FA 1K6XA 1KETA 1RI5A 2ZIZA 5ERYA 1DOAA 3FBTA 4YR2A 1XNHA 1V7CA 5CCXA 4N3CA 2II6A 3AR2A 4DG5A 2ZBDA 1WB4A 4TUYF 2H06A 3TADA 1ZXLA 3CUWA 4MGEA 4PSDA 5H8WA 2J33A 1RQXA 1V1MA 1Z68A 2X4GA 2WIJA 5B7GA 1YB1A 4GICA 4R1UA 5CHEA 5DRYA 2FW0A 2ZRIA 3AM4A 4UTPA 1E0DA 1EE1A 5AVTA 1GCIA 4CMBA 1T0HB 2DUNA 2ZZKA 3B53X 2NTNA 9ICEA 1NK6A 1TM2A 4RK0A 5THQA 1B8UA 5DLGA 2HYDA 4LRSB 4INZA 4DA6A 5AVXA 4P7BA 4YXMA 1Z7WA 2KMLA 1D3AA 3FPGA 4LTMA 1ZJWA 3DHEA 4JA0A 4W7IA 5JSZB 1KIAA 3PWTA 4NG4A 4ZOBA 5EEGA 2CHVA 1Q7TA 4QUHA 4YAWA 3GLGA 1D2GA 3HPQA 2IIVA 4JJAA 1JJFA 2HV8A 3KWJA 2XQFA 1VLJA 4FMDF 3EIOA 5JAIA 5FI1B 3QU7A 3N1UA 3TTVA 1KGDA 2AN1A 4HNTA 2GK6A 4V02A 2EV9A 1B0UA 2E4VA 3ZK7A 1PU2A 4MPJA 4X97A 3OOWA 1W44A 4K9MA 6AT1A 2Q28A 4Z7OB 2A30A 2C07A 3W1EA 5A4KA 2GSDA 2PSHA 2V98A 3DD5A 2ZEJA 1SMKA 1L9KA 2HM7A 3V8VA 3TI7A 2JK0A 2DFDA 2ZSAA 1KFDA 9ICIA 3NAZA 4MAMA 1V16B 2QTVA 1G6HA 2VLIA 3CEPB 2HD4A 4R1TA 1IRIA 1E89A 3N6XA 3HVKA 1XD2A 4F91B 2R3SA 1V5GA 2ZQZA 2ZYIA 4JI0B 3A26A 1GZVA 5L7TA 2CVZA 4A4DA 2X1VA 3I9V6 1OB5A 1BE1A 1DIRA 3NWBA 2O2HA 4LF8B 1FP1D 3CHYA 3TM4A 3W4JA 3HG7A 3BBLA 2C2WA 1XNSA 1JS1X 4YMIA 2P4EA 5HZMA 5FRDA 1T8TA 5JZVA 2HMXA 2QARB 2H31A 4BX2A 1SM4A 1EA7A 4ALIA 1OI7A 5JSZA 2FZVA 3EGOA 1XZCA 5CCEA 4PFKA 1H05A 2AQ0A 1JBEA 3LK6A 3MS4A 3PE3A 4HF7A 4C01A 1BMQA 4K5QA 5CA0B 4NONA 2WHEA 1N2CA 3L6RA 3QUSA 4B6QA 2JFVA 2VATA 1ZRMA 3D6TB 6REQA 4IM7A 3NDJA 4L72A 3CNBA 2DFPA 2JLBA 2QVXX 3QWFA 1WULS 3I52A 1NVVR 3OBIA 3QFRA 4YJHB 1DV2A 1XCOA 2OBLA 4WSOA 3CP8A 1H22A 3S99A 1K3FA 3B2EA 4ENRA 4QFMA 2HU5A 1SC9A 4AIIA 3E4DA 2JGNA 2NVUA 5EIFA 3VDXA 1X70A 3RLFA 1LPAB 1TYBE 1YUNA 1ZQDA 2H7CA 4UBOA 1KE1A 5I48A 2H5JA 3N9IA 3KKPA 2QTCA 3DA8A 2WJAA 1LPSA 1C7FA 2WKRA 5DIZA 5KHLB 5KYUB 1RMQA 2VDWA 4OAPA 4X1KA 5CAEB 1T0JB 5LD2C 1T8EA 2W43A 2VEDA 3OLZA 5A5DA 1HE5A 2GK3A 4M9NA 1ENOA 1CQJB 1T0IA 1VYHA 2I2XB 3WL7A 1RW4A 3CKLA 4CTMA 5CA1B 2PMZF 1MKYA 4TWRA 2VZ0A 2YIJA 1QR2A 1PQYA 4ZT2A 5LU9A 2X4IA 1JMSA 3DG9A 2CHQA 2JBWA 4ARZA 4GYWA 4EUHA 2DC1A 2QXUA 4Y0AA 4P4OA 1QIDA 2MSKA 2OM2A 2W2LD 4HKTA 5T4HA 4EEZA 3FOEC 4DQKA 1ZD5A 2GWSA 1JIVA 1GL9B 2EBUA 4J0FA 4B75A 4MVCA 1T35A 4PPQA 4G5OA 4MUGA 5DWQA 5KAMA 3GY0A 3TRIA 1GTSA 3L4BC 1P9OA 4D9MA 1DRWA 4MF2A 4L3VA 2HIHA 3F8WA 4NEQA 4P5DA 3DEFA 2NACA 4WGFA 2RHOA 2XVZA 1M1YE 1RC0A 1XCGB 4NV3A 1NJ2A 2J6BA 2BFFA 2MHCA 3IPYA 4ONEA 5AW3A 3EIQA 1B00A 1XWWA 1ZGZA 3PCXA 3FSRA 4HH4A 4C6TA 1KA9H 1XPJA 2HCRA 2ACKA 4O25A 2XGPA 1CR6A 1UBLS 4P08A 4WKCA 2G25A 3O21A 1NY5A 2BIFA 5HIJA 2G06A 1F8YA 3PJEA 5KKAA 5CYGA 1RT9A 3TMYA 4B2IA 3RYIA 3OQMA 4PGXA 1EUDA 2QW1A 1HDIA 4HHEA 4TN5A 3RFTA 2C28A 4P32A 3N2KB 3B20A 3T3MB 3ZD8A 3V4ZA 4Q7QA 3IKTA 5HMLA 3DSRA 3OESA 4KHZA 1F4VA 3EHEA 3L01A 1OAOC 2YZ2A 3LF2A 2C0PA 2W2KA 4L3OA 4PU0A 1U0OC 3MJTA 3OZFA 2D3WA 1DIGA 2H2GA 3PXEA 4B3HA 5I01A 2CXOA 4FZLA 1ZLYA 4YCAA 2ZRBA 1X77A 1OKKD 3L7AA 3O2NA 3WMRA 4LX8A 3NWOA 2TMYA 2X14A 2F76X 1ZR4A 3PV0A 2I6TA 1DPFA 2FYTA 1Y9EA 3E03A 5BOLA 1OBVA 3H3FA 4LXTA 2W4IA 3PYLA 5ALMA 4C1BA 4Q3LA 2FCAA 2KTQA 1B3RA 1AKWA 4BQIA 3WBFA 1N5WA 3QX7A 4KWEA 4KQ2A 1IHPA 2JJ2D 4U7JA 1W1IA 5C1PA 5HK9A 2Y1EA 3DFFA 4UJ3A 2SHKA 5CT4A 5JFGA 3FWNA 1AGPA 3UK1A 3RARA 1AA6A 2Q5QA 3P2KA 3ZJVA 3FRIA 3ROZA 1Q0HA 3M5DA 3RJFA 1ILWA 3R5XA 2J4FA 4FGWA 5B6IA 4ND4A 4ZVUA 3F73A 2C22A 3UO8B 4B0PA 1XMOB 2Q3HA 2IZOA 1E62A 1JPJA 4XLLA 1R4NA 1WDKA 3MERA 5EZQA 1XNGA 4LYGA 3QE3A 4KO4S 4TLDA 2RAFA 4YQFA 1UWKA 2AN5A 4OFZA 1JU4A 5KVAA 1KJ8A 5DBOA 3V33A 3ILXA 2AMLA 4DUGA 2JFFA 2NYAA 1OIXA 1XRNA 5HSGA 2DPMA 3BH7A 1BNOA 2XI9A 3AI1A 3MCZA 5C1OA 3PNCA 1JILA 2IUYA 4G81A 1AKUA 3WGLA 4DIEA 4IF6A 3NGLA 3H8VA 4J0JA 2Z57A 1UBEA 1HFWA 3MWLA 4I9FA 4OL0A 2GEJA 4YRCA 3FYUA 1YXMA 3M6VA 2ORED 4O5OA 3KM0A 8ICAA 1ZQQA 1DKNA 2QXTA 3OECA 4CM4B 1CR4A 4ICIA 4UD6A 3IIKA 3IMEA 2F3RA 3OE1A 2W6MA 3OSZA 3ISDA 4UNQA 5FIUA 1LV7A 4RLHA 1YMUA 1WOYA 3VNUA 2CJYA 3VZQA 1BEEA 1OU0A 3RANA 1ZETA 3RGWS 3U5ZB 3I61A 1SOWA 2IC5A 1U7WA 2AMVA 1ARZA 4HH0A 4WNAA 2RRDA 3FY4A 1JKJA 1PV4A 5JAHA 1ODCA 4ZOCA 5DTRA 3EQ2A 1EWVA 3IBFA 4BFYA 2OKCA 2J4CA 4UASA 1ABEA 5ALFA 4WN9A 5B5SA 1D09A 1E32A 1XLUA 3LCVB 4B6GA 3C5GA 1QXSA 3R40A 4FO6A 3PW4A 3A2MA 3WA6A 4JODA 2IRWA 4R16A 4YONB 4B73A 2V6BA 3ESZA 3HFJA 1V38A 5FUWA 3UA4A 4AG3A 2RH5A 1JDNA 3GAZA 3DE3X 5LU8A 1X40A 1HQDA 2CNWA 2R79A 3CNEA 1EGVB 4XA8A 3WHIA 4EPXA 5JRZA 3I1IA 5EQFA 1ATIA 2KN7A 3T0FA 2NU6A 4DDMA 4XUSA 4HDRB 2QT1A 4FYKA 1ZA2A 4GNKA 1U80A 7ADHA 1SA0A 4F5YA 2OORA 2QN2A 3O47A 3DXYA 3VHQA 3AZOA 3WGTA 1NE2A 4FUTA 2DR0A 4MR9A 3R7SA 1S9DA 1I0LA 2Q5FA 5D7NA 5FWXA 1U2GC 4S04A 5FLXA 3GLKA 1KMHA 3O92A 3WYEA 1ZJYA 2DKOA 2B98A 2RP5A 3TD9A 3FN4A 4H59A 1HC7A 4V0MA 4AJLA 2ZOSA 4LDRA 1U9IC 5KFTA 5DP1A 4D5EA 1R2QA 2GOYA 4YCCA 3L1KA 2OXOA 1UM9B 4KL8S 5AOVA 2VJ5A 3AM5A 5EY5B 1M83A 2Q4DA 2D00A 1TFUA 1ULUA 1ODTC 1ZINA 3RS4A 3PGXA 2OZLA 3IAAA 1HE8B 1L7AA 2YH2A 3PXAA 3BK1A 1OKKA 5JWRA 4X20B 2QTHA 3SGLA 2G3YA 3VRHA 3Q85A 1KZ6A 4UW9A 3SC6A 2RDJA 1E6CA 1YZ7A 4FTWA 3RK4A 4YDQA 2OAEA 1BS9A 3RBXA 6LDHA 1SB3C 4F2HA 1G4AE 2QA5A 2PGNA 4WASA 2JLAA 3COSA 4R5MA 4B79A 4R1OA 1U8ZA 3KXLA 4NX2A 2NRWA 2C54A 2GT1A 3IPRA 3T7DA 2R751 3DFMA 3I2KA 4IJWA 3OX3A 4WFJA 2VKQA 4F4ZA 1NHGA 4U3JB 1M2VA 3C97A 3DMYA 3GZNA 3CPSA 3KB8A 3PF8A 4QBTA 4UAGA 4XTCS 1P7WA 1Q22A 5EPEA 2EIHA 4LHYA 5E7IA 3VR2D 2WRZA 4BU1A 5K45A 1RS0A 4UBBA 3FWZA 3LI2A 1SC1A 3ZV4A 2I7VA 2W6CX 3CZ9A 1PGQA 4KXLA 1AD2A 3D43A 1Y88A 4GO1A 4QVKA 1AZSC 2JJ1D 3ISVA 1ZX1A 5F3RA 1SRQA 1Z73A 2P9ZA 3HZZA 3IVMA 4LX0A 3SBDA 3HK2A 5EUMA 1F9AA 2YNMC 1B3BA 1KH2A 1QLHA 5BY2A 4ZICA 5AM3A 4LHVA 3EUEA 4DWOA 2NMVA 4RXUA 5DSXA 1X9HA 1JVBA 2CDRA 3BL6A 3O7WA 5EGNA 4F45A 1BHQ1 1XZFA 3CG0A 5DBAA 1SXJB 4F72A 2YMPA 1QX4A 1KMMA 2AUMA 2BM9A 3ONWA 4PHHA 1QTMA 5DBEX 3HKZC 2BE9A 3RG8A 2W7TA 4DYHA 4EHJA 4LJXA 2LRHA 2PGDA 3MWJA 4IXWA 3EVEA 3JARB 2QY9A 4KLUA 5BYJA 4JWMA 1TK9A 3PUXA 4KMOA 5K2OA 1MD9A 2ZYSA 4N5HX 3UJPA 4QE3A 4YXJA 1UZNA 3L7MA 7MDHA 4Z9FA 3HDQA 1HH4A 1I32A 1L3UA 2G1AA 1G8YA 1M6HA 1ITZA 3QXJA 1FEZA 4ERNA 5IP5A 5H1YA 1SR8A 1S2IA 3ZDAA 1AKMA 5KG0A 1VJCA 4DR4B 3SE0A 2A9QA 4J9PA 2FPIB 2I2CA 4NV0A 3PL1A 3F3YA 1MO4A 2IMWP 4IV8A 1XDUA 1Y8QA 2VHUA 5D5QA 5KYKA 1AT1A 1M75A 2RI1A 1Y0BA 1H2FA 4GGMX 4Q05A 3VI3B 4HQKA 2RBEA 2E85A 5KSOA 3PQ2A 2I67A 1REQB 3OHAA 4MWSA 4Q9KA 4OGFA 2NO5A 1K89A 2PHZA 4OHVA 1N2GA 2OV8A 4YJ3A 5DEOA 1HG1A 2JBAB 3RK1A 1XT6A 4IDPA 4G41A 3SZ3A 1WKCA 1BA3A 1BHJA 1SBHA 1VIVA 2C3UA 2P0AA 2VQSA 3BQMB 2PGOA 3ZCUA 7YASA 1SAYA 2ID9A 5HR6A 4ZREA 3W9BA 4DOBA 4AYTA 4YRNA 2WM9B 4BNDB 5SY4A 3O31A 1Z6XA 3T4EA 3GJTA 1THMA 3GLGB 1QIEA 1IBCA 4MUNA 3TTYA 3H3XA 2AD1A 4PZPA 1ZCBA 3UG6A 3QY9A 4C0HA 3QBEA 2ONJA 1KAQA 4DSOA 4DRXB 1KZYC 1VRCA 3GCDA 4G1CA 3OX1A 3X2SA 4QATA 3SDBA 5I9LA 2WA2A 5A62A 1X87A 2JRZA 2GX6A 1NVGA 1TM1E 3UVEA 1A27A 2VDUE 3JWEA 1Z22A 1UPHA 7ICNA 2CBGA 4HNVA 4BBAA 3WJ2A 2PGJA 5ULLA 4S1VA 3COJA 1B6SA 2NVWA 4XB6B 5E79U 1N61A 1ML4A 1YZQA 1Z5UA 2A7QA 2WJVA 3C41J 1N75A 3IIMA 4ZI7F 1KPIA 1PWHA 4BS9A 4C06A 1CUKA 5KSYA 1FTNA 5JI2E 1QQ6A 2HRRA 1BWPA 5C0OE 5A4DA 5IH7A 4UCFA 3T3OA 5KX5B 4QBKA 5LQCA 4MF8A 3Q87B 5CNMA 4JEIA 1SGGA 2EAPA 2P5SA 2HMVA 1IXRC 1XTKA 1M54A 2PZGA 1GZ6A 3DEJA 3OCZA 2ZXIA 4XD7A 5JH7F 1ZMBA 3KQTA 1OXVA 3PI7A 4YIKA 5ER6A 5F76A 1MJGA 3K32A 8MHTA 2DFTA 4RE5A 3DDCA 4GBED 1RM6C 3JARA 5CW2A 1YL7A 3UK2A 3TL3A 4F4KA 2REBA 4EAQA 5EHNA 5D46A 3VMFA 4EJ2A 3FCAA 1K1QA 5AQ1A 3G82C 3HABA 3BL5A 4HNAA 3R9KA 2IGTA 5A06A 3TSCA 5DTEA 4DQVA 1W5EA 1SUPA 1PL8A 4C4ZA 1BX1A 2P9GA 3IDZA 1PQWA 1W76A 5DFAA 5ITZA 3REQA 4ER5A 1V9CA 2FFQA 4X1IA 1NK4A 2CE2X 2PMWB 3SIWA 5HBGA 3TZHA 5J29A 4B35A 3MTIA 5G1NA 1E7MA 3GCWA 1OXXK 1MQ2A 4B09A 3F5QA 1JLLA 1TNDA 2BM1A 1L1FA 1GAQA 1J2MA 1I2ZA 2DBZA 2R6DA 5ALOA 1RIIA 4OK6A 2CLFB 2JHPA 2ZI6A 2IU4A 1GQSA 4YP7A 4D4MA 5CT9A 1KF0A 2BP7B 1XA3A 1VKJA 1A8HA 3UYKA 3BIOA 3ZZUA 1EQUA 2B1IA 2OC9A 5DCLA 1IUPA 2B4YA 4WK4B 4RF4A 4A9AA 3VC3A 2PUWA 2AZ4A 2TMGA 4X61A 2RK4A 1ZJ6A 5K3SA 8ICOA 3W6ZA 2B3TA 5BVHB 4QUGA 4Q3CA 4HBGA 3TNLA 2FOXA 5D49A 1LXCA 1JNXX 1UBNA 3BSFA 3L1JA 4NZYA 3C15C 3VNRA 3WC4A 2JLWA 1JIXA 1WPRA 2QROA 1IG6A 3F3SA 4X6YA 3LX6A 5A04A 4P36A 4IQTA 5EWEA 1D04A 1GLNA 1Z7YA 2J5XA 2LPMA 2VVTA 2H3VA 2WTBA 2Y1DA 3PWZA 1JR3A 4YMLA 2P40A 4JWKA 3PVCA 2ZZNA 1BXKA 4ZO8A 3NVMB 1EJBA 1J4AA 1XL0A 2DY0A 3CX6A 3KUKA 1BD3A 3MINB 4K6CA 3VNQA 1IBKB 4ZMRA 1FA9A 2ASLA 1XMSA 3FDZA 4L5YA 3SN6A 1OVMA 3LJKA 1M2KA 4FJ2A 4X9XA 3VZBA 4MPDA 1Q74A 2VG8A 3ACBA 3GV5B 1YUBA 3EZ9A 3C5FA 4MV5A 1HPLA 5K3FA 3TI9A 4HSGA 3M49A 5BPFA 3SZOA 3RJJA 4MV6A 2YMQA 1L4FA 1UK9A 5JASA 2QG6A 2JFOA 5JNSA 5IN5A 3ICQB 1W0JD 5FWXB 3LBYA 3QFSA 2GERA 4MB6A 3KBBA 1KSFX 4YRZA 3FLEA 4QU0A 2CYBA 2V7UA 4FC6A 4BB0A 2BZGA 4QHTA 4YD2A 2JEFA 1JMYA 5SZKB 3HB9A 4EFDA 5DM1A 2BFNA 2R8XA 5L7WA 2OAQ1 9ICJA 1D1TA 1DBQA 2OAGA 3B8HA 1EDZA 1SU8A 4KLAA 4WINA 5IK2A 1M72A 1EQ2A 1DKLA 4CQLB 1NQAO 1AHIA 2R1VA 1SOAA 4Q03A 1PVRA 4LKRA 2AG8A 2E4YA 3M89A 3KEQA 3HJFA 1IPFA 4ER0A 1G16A 2UKDA 1J20A 3LFTA 3HGQA 4KLCA 5IT4A 1OLSB 3LP5A 2QSUA 2QMQA 3MT9A 4XW2A 5TARA 4N0DA 1TQHA 1FQOA 3AVOA 4G0MA 4XVHA 1RE0A 2HXSA 4JWTA 2W9BB 4QNMA 5BUQA 5JWOA 2OO7A 2VAPA 4OQXA 3GFTA 3CJTA 4PBTA 1GSHA 3L8HA 5CLHA 3SZ2A 1G4UR 3NX4A 4MUYA 2XTNA 3TZEA 3USCS 4OX9Y 1SL1A 3EISA 2J59A 2QGFA 3FH0A 3OX4A 3FNIA 4NCBA 2RGXA 5AJVB 2A5JA 2MYPA 3RADC 1XZNA 4HWRA 3ZXUB 5CB4F 1FMFA 5KYNA 1NJGA 3FWKA 4KLSA 2IHBA 4W5HA 3EAQA 5FAKA 3GOHA 4KUHA 3O1LA 2P9FA 2XVYA 4O4JB 5AJZA 1SBZA 5H9VA 3AVPA 2CY0A 3PSTA 4FKBA 2H3ZA 4H15A 1TMGE 2VUSA 1LNQA 3GWGA 3DTVA 2IH5A 5EMMA 3Q6MA 2FEOA 1QFYA 4DVJA 3WGIA 2ZXEA 1TO2E 4MICA 4XGQA 3JPOA 3OJXA 1JQBA 1TVMA 3FPLA 4PZZA 2Q7OE 4ENUA 1KRWA 3SYLA 1B0ZA 1T0BA 1O96B 3N58A 3ZNOA 3Q6IA 1CIVA 5JNLA 1W19A 2X5OA 5DBCA 5HHIA 4B9NA 2JD2A 3AILA 3M4JA 4JJFA 3X43A 3LXRA 2BMWA 4H31A 1T5SA 1WB5A 2CNKA 3OVMA 4WBSA 2H1RA 5GAJA 5FHRA 1O87A 3PQ8A 4RJTA 5LXTA 4O5EA 1Z29A 2PH3A 5CJ7A 1XU7A 3RSHA 3PPIA 3ETCA 3N7SC 2IHUA 2R8GA 2M9MA 4G89A 4P4LA 4P4SB 2BRUA 3FDSA 3IJPA 3FMOB 2F3NA 3OPYB 3SX0A 3ZDXB 1ZU4A 5DXJA 3Q5GA 2DUMA 1O95C 3GLFB 1C81A 2C4WA 4JIGA 1GG2A 1ONNA 1W29A 5KL1B 1U90A 2XDYA 2XRMA 1XA4A 5JNWA 2CLIB 2F1OA 1B22A 1CRZA 2ZYTX 3HFRA 1U4SA 1Y8AA 2VAWA 3PHCA 4RF5A 1A9XA 1OZFA 3CRQA 2W3RA 2J9ZB 3U81A 2GZMA 2OAP1 2Q5JA 3DWIA 2FR0A 1PHPA 1ZMOA 2GCEA 3N8HA 4O4LB 2KOBA 2F77X 4I2AA 1CS0A 1N3LA 3IESA 4J4HA 3SM3A 4YPFA 4WW0A 3CY6A 3NIDB 3B0YA 1ODSA 1P9LA 1O5IA 2NUBA 1CRQA 5A71A 1NVUQ 3WLLA 1CF4A 3EZXA 4AAYA 5B36A 3Q0EA 4XIGS 4XEUA 2IVFA 4DC0A 5LYJA 1PR5A 2VJBA 2W9CB 1XNJA 4FI3C 5BQ3A 4HMQA 3UHOA 5JNRA 1UQVA 3GFRA 1SUIA 5AVUA 1C1YA 2HDHA 4UEWA 3EF3A 4G2TA 4CFZA 2QUZA 2SCUB 3MR6A 2WF5A 2YS7A 3ASVA 1WMFA 1IIBA 2A1AA 5EL0A 5WRFA 2XY5A 2ZB7A 4YRTA 3FLAA 4QUKA 5IEBA 3BS5A 4IGKA 3HR7A 5COQA 1BN6A 1TA9A 4LECA 2O48X 4IFIA 1J33A 1E5VA 2Y4NA 1U0HC 1JJVA 4ZIRB 4UAJA 5J1TB 1XZKA 1JN0A 3CURA 2Y4OA 4TZKA 1HNXB 4KDFA 3RV3A 1FS4A 4ZHQA 3LVVA 1Y34E 5SZIA 3WFZA 2YWRA 2VF2A 3KQVA 5BW5A 1LTQA 1E4OA 1OZ0A 4ZXFA 2Q0XA 3WO0A 3BXGA 3K9LA 4M9QA 4LF4B 1EIWA 5AXCA 1ZQVA 5E6UA 1N6IA 1IG0A 1VKHA 5IBQA 2DWUA 4E6EA 4UMVA 3IVXA 1E9RA 2NU7A 1GCGA 3KIPA 4KI7A 2CZGA 5E0KB 1R8XA 3OZ7A 3WDLA 4UB4A 2UXDB 2EBWA 3ETEA 3HXTA 1CJUC 3NAQA 4HR7A 4KLRA 3GLIA 5DDYA 5IDWA 2ZR9A 1QP7A 3N97B 2IA5A 4HAYA 5ESWA 3ZZTA 2W6JD 4UTXA 3QHPA 3BWMA 3D0KA 3FDJA 2V1XA 4J9UE 1RRFA 4PZUA 2ZI7A 4ESHA 2WZBA 4OBWA 4C0JA 1THGA 2QRHA 5EIBD 4JEHA 2P1RA 2WKQA 2CWWA 1HE4A 3O1HB 3P9PA 1H42A 4GC9A 2P2YA 1OA1A 2N42A 3EPRA 4KC0A 4P92A 3GLSA 4WZBB 4DMHA 4B3RB 3WA7A 3DBLA 1LK5A 1JLHA 2R6JA 4X62B 1HDXA 1YT5A 2ZIVA 1NF3A 2ZKIA 4M47A 2XRYA 5B7NA 1ZNYA 3EY4A 1V3VA 5CA7A 1U3TA 1WY7A 5CM9C 5JYDA 2CD9A 4LDNA 1UJ6A 4DL5A 5KG1A 3KSZO 4CLHA 1YZYA 1PLJA 3GGGA 3KKNA 3DBIA 4QTXA 2XCQA 2REQA 2ZUTA 3GDWA 2HR1A 1G59A 2BR0A 3VZCA 4RNOA 3WLNA 1Z0FA 4IXNA 4YDHB 4DCTA 3I6QA 4OQDA 3NKVA 1PZGA 2E82A 5E3HA 5C9ZA 3ZGLA 4AY6A 4BQFA 1SB9A 1IAQA 1NX9A 3HA5A 3IMGA 2RLTA 1VL1A 1UJMA 3TAQA 3KLBA 1JI7A 1NXQA 3GVXA 2JZCA 1NIJA 2O8BA 2OWEA 3FYDA 4BQPA 2YXLA 3A3OA 3LBHA 4IUYA 4MVJP 3VTAA 1ZESA 3ZLJA 4I50F 4X3PA 5LC1A 4WWHA 1VKNA 8ICUA 1LNZA 1EB9A 2AJ8A 1NJ6A 1A98A 1HL3A 3GVIA 3HUDA 4FB5A 3ZHTA 1W5AA 2BSAA 3PENA 1WHTA 5FO0A 1GM5A 2QQ0A 3EDYA 3K2IA 4J0DA 4OB7A 3C4JA 1RZTA 2OLKA 4J7UA 5BV2P 2H2HA 1ORIA 1TUBA 2G7MC 3CVYA 2QTRA 5EKUA 4D4IA 4NBSA 2EWMA 2YVLA 4R7ZA 1I7SB 4WVLA 2PKCA 3UEOA 3BS4A 3ZV5A 1QANA 4QBIA 5IJ0B 2JCGA 1PGOA 2YQ4A 4B3SB 5E7JA 3BXEA 1GG8A 5LZ7A 1Z16A 1UP6A 1YE3A 3UJ3X 3JQFA 1GPUA 3D4BA 4MVJE 3RIHA 3V1NA 5K6AC 5J1SB 1OGJA 3GGCA 2H9IA 4DLSA 1A8UA 2GTPA 1NXTA 2QJWA 3PFNA 1G2QA 3UC5A 8ICLA 2IU6A 3UBMA 1QHXA 1NM5A 3QPDA 5BN3A 1YE5A 1EX1A 3AF2A 2MDTA 5DT2A 3ZD9A 3RB0A 1HFJA 1V3TA 4M7PA 4YPOA 4RFSB 4TMWA 4ALJA 4Q15A 2Z09A 3D8SA 2YX1A 3BZKA 1XTIA 5DGCA 1J2EA 5KYXA 4AJEA 4FE7A 1J99A 2BC9A 1U1IA 4BMVA 1MABB 4J2OA 4MGYR 4Y7CA 2R00C 2IE8A 3LHIA 2DPGA 4ZV7A 1QE5A 4B9UA 3MC1A 2NAFA 2X5XA 4ETMA 4A2WA 3INYA 3WE7A 3PR4A 2PGLA 3LLSA 4D26A 4UB6U 4U02A 3RCBA 1HGXA 3B9PA 4RTLA 4NJ8A 4EB3A 3V1UA 3PEYA 2IHMA 2NN3C 3QELB 4Q66C 2KJQA 2AI2A 1WTCA 5ICFA 3L93A 3QLEA 3W7AA 4ZVTA 3QQPA 2AT1A 3CTMA 4JUCA 1LPMA 2ROQA 4TV9A 3C2MA 1EP1B 2ZWPA 3N74A 1DO8A 3IQGX 4TLLB 5HF8A 3SHVA 1U49A 1U7UA 4S35A 2AEEA 3DNPA 3NKLA 4F2WA 3AM3A 3ZDBA 1GGVA 2VTKA 1IB6A 3D2BA 3IUJA 7ICLA 1JDBB 4IIUA 4M0KA 3Q3GE 3BFVA 3Q5EA 1MJGM 2I7DA 3MAAC 1TUEA 4TYPA 5FNZA 1Q17A 1SZDA 4KGDA 3BHNA 1QYRA 4G0QA 3T9CA 2QARA 3O4FA 4F2PA 1H2HA 3UAGA 1V95A 2WTEA 4KQGA 2PXCA 1LDYA 1IOVA 4FHEA 4PCAA 3UGQA 4AF8A 1K6JA 3HO6A 2O19A 1WBJB 4UE3S 1EINA 3RBZA 1A4UA 2JW5A 1HT3A 1V3QE 2AGVA 4G86A 3ZXIA 5KX5F 1J23A 3H5NA 4BC0A 3PFCA 3SK0A 3ZX5A 3TFSA 2MIIA 3GPBA 1QU2A 1Q1NA 4KE7A 3AGQA 1M2OA 4TQ9A 2X7XA 4ZOLB 4X7MA 4PRZA 3TZ6A 4COOA 4F4IA 3KAJA 2PX6A 2HY7A 3NHWA 4OB8A 2RH4A 4XYMA 2V7QD 4HAZA 3UN1A 3PQ6A 4FZJA 2NPFA 2QTLA 3C1YA 4TLMB 1FU8A 1XZAA 5G4KB 4EARA 1LI4A 1ISSA 1JMVA 1ST3A 4OO1J 2IE0A 2Q7XA 2KFNA 1NGSA 2XI4A 2CVPA 2XYVA 1U1FA 2INGX 3PDCA 3RM3A 3WGGA 4YXFA 1RWBA 1BOOA 2QOEA 3SOPA 1M34E 1YI1A 5FWYB 4MNTA 1DAIA 1GV1A 4JU8A 4GM0A 4V39A 5E2BA 2PLAA 4K4IA 1DCFA 1ZQRA 1H94A 2EZ4A 3U7FB 3MAJA 1O6BA 4RZ2A 1RWNA 3I9V1 4Y2GA 2XMPA 3WLSA 1XDZA 3TFWA 1U48A 4R8SA 3JASA 5J2JA 4V0KA 2X15A 2MOKA 4MWOA 3UJ7A 4BDTA 4FBTA 3EFBA 2UVWA 2JJYA 2QJOA 2PMEA 2V7PA 3VOAA 1REQA 4CW7A 4EJ0A 1SHUX 2CHFA 3R3HA 2HHCA 5E1BA 3NDBB 4DJEC 1JDTA 4YY3B 2JGMA 4TLAA 3KQLA 5K0TA 4OFWA 3K0CC 1BFUA 4ADSG 3CLRC 1EHYA 1N8NA 2WSYB 2OBBA 1E1QA 4CFYA 5J4YA 3MTBA 3SKYA 1F12A 4INPA 5D2CA 1YQUA 3O90A 1XK6A 1XUOA 2NO1A 2P2SA 2R8YA 2HDNB 4I5GA 1BOFA 5CK4A 3MJEA 2PUTA 2JFHA 3DPUA 3HKBB 4GZ6A 2CB9A 3K15A 3QSGA 3W6NA 1S2NA 3DAGA 4Q1AA 9ICPA 1N6HA 1EUQA 2WM8A 4GOOD 4JUAA 2C9BA 2Q1SA 2KICA 1P4GA 1S3FA 1T3ZA 2WAYA 4NMXB 3ZV7A 5K4GA 4N0PA 5KVQA 2B0CA 1CY6A 1ESCA 1LZLA 5GTHU 4UE6A 1UADA 1PQUA 3BWEA 2UXCB 4BO4A 5KT2A 1EK0A 3BXFA 3G8AA 3H65A 2WB4A 1X7XA 3L0CA 1TF5A 2VHVA 3OCCA 1NN1A 1DG9A 3EGWA 5HR7A 1HFKA 1NVXQ 3GH1A 1Z1BA 3P0IA 5E0OA 4X64B 1JLMA 2BD0A 2H3QA 2NADA 1I1OA 3OP1A 4P81A 4EHNA 4Z4GA 3QIAA 1DWOA 3ZIAD 3RTCA 2CUZA 3ENKA 1SUFA 5DWVA 1KAHA 1ZH4A 4CEHB 5ARDA 3WP1B 2OGSA 4DA4A 2ZQ5A 2OZPA 1N9ZA 1ZK3A 2JIMA 2TYSB 1D8AA 4HB0A 4J0EA 1YBMA 2WQZA 5A6SB 2V03A 2AUTA 2NVBA 1AUVA 2ZREA 1BWQA 2CXXA 4L16A 1N2ZA 4IZ6A 3G5AA 2WB1C 4UCWA 4CUZA 1OC2A 4S12A 4H3HB 2QYTA 3AQEA 2O8BB 2IP2A 2LNDA 1XZHA 2WF7A 4Q45A 1CERA 3B2NA 3OH8A 1QR6A 3GUYA 3LA6A 2XICA 1T4DA 2MTBA 1XVVA 3LF1A 1LPOA 3M9LA 3NWEA 3QG5A 4OJKA 3SXUA 5LNK6 4I4IA 5M04A 1DMRA 5EHZA 3KQMA 3LECA 5G4KA 1O2DA 1TZCA 2HV9A 3SZUA 1O97C 1SCBA 2VXOA 1S76D 3FJ1A 5JT1A 2WW8A 4HYYA 2QRPA 4BXOA 2G1KA 2WJPA 2KE7A 2IF2A 2N75A 3AXSA 3DMGA 4N7RA 4QZAA 2W6JA 3EC2A 5KVSA 2KJ5A 4YUVA 4BVAA 1GNQA 3F4BA 1T9KA 2VRNA 1JFRA 1TTPB 2Z4TA 4XUEA 4QZVA 3FXAA 1IY9A 1Q6YA 5B1IA 1Z1VA 5GZ1A 3R9XB 1RRCA 2YW2A 8ICQA 1QG2A 3ZHXA 3IT1A 3L7LA 3M7IA 4IW3B 1CB0A 5HF9A 4ETWA 1RAEA 4Q7JB 2B8TA 4Z3KA 3AJRA 3G9TA 3O8RA 1NQVA 2AV6A 2FPPA 1MEOA 3WFJA 3ONEA 4G1BA 1M5UA 1XKQA 5KG4A 2OTCA 1VRWA 3CF0A 5D5PA 3W4KA 3MLEA 4BNNA 4KH1A 4ISCA 4Y9RA 3A0HU 1HYGA 3UANA 4Z1MD 5FDFA 1E3LA 4E31A 1EIZA 4KQWA 2IV7A 4BUGA 3ADPA 1U7OA 1IWBB 1ECCA 1OAOA 1S8FA 4DANA 3E0QA 4ZAXA 1KOGA 3GGPA 2DPLA 4LWPA 2IYTA 1H9AA 3A4NA 3BXHA 1W46A 4PICA 5LOVA 3R5JA 5ICMA 3HVHA 1G8AA 1E3IA 3LCUA 3G9XA 3MJ4A 4ND7A 5J58A 3UB2A 1DEXA 2CMHA 3SG0A 2J9GA 2GJ4A 1JSCA 4TTPA 1X19A 3TKAA 3FUCA 4FR5A 3BF8A 3KK0A 2I03A 2YZMA 1HK7A 5C8VA 5I7EA 4JXJA 5E9AA 1MZPA 1YC5A 1ZPDA 3KUUA 3HN7A 4AZ3B 1E61A 3AJAA 4KUEA 4Q8FA 4YRAA 2R87A 1E4VA 1OUMA 4AROA 3UGJA 3UAWA 3UK7A 1W9HA 3V7YA 2R4QA 1E1QD 4DM4A 4IKEA 5L95A 1CE8B 1E7QA 4YALA 2QB0A 2Q9AA 3N0WA 1ZGCA 4ON9A 1M0TA 5ERGB 1R0XA 1X1RA 1TA4A 1VYUA 3DGFC 3TW4A 4DKXA 1RFGE 4RPYA 1WMBA 4FHZA 3TRKA 2V3VA 4EA6A 4DWJA 5D3QA 3RS3A 3OFJA 4KG7A 4OI0A 4JBNA 4ND6A 3DP9A 2QP3A 3NHUA 1QO7A 3IQHX 1FJ2A 4YJ3B 5EMLA 2DEUA 1MN8A 1K5GA 4DCGA 4WFKA 4HQFA 5KYGA 1W49A 3I53A 5J0YA 2HHLA 1FSSA 1SKYB 1SIWA 3C1AA 3NTVA 3PDJA 3GPIA 4G0NA 4RL4A 2AOTB 3PDWA 4CCHA 1ZWKA 1QBKC 2JARA 4CUJA 4BMDA 5JJBA 1EM8A 4FYPA 4MJXA 1TRKA 3BWCA 1DARA 2C77A 4I5IA 1FFDA 3KLOA 4IV5A 4HYEA 2I1WA 2PRYA 3QUTA 5EP4A 3O38A 4HRVA 4QWMA 1DUSA 2I29A 4UBNA 1P29A 4ALNA 1CZUA 2QRVB 2HHUA 3TNJA 2YDYA 3FCOA 1KEJA 5BYKA 4E5NA 1FJHA 3E9CA 4XIYA 4YRDA 5K51A 3QITA 3J7TA 3K75D 5LSAA 4KPYA 3PO4A 1RNLA 4C6HA 3ZE8A 3O1JC 3FOFC 2DE0X 2ZWIA 4D43A 4DV7B 1N8KA 3BWDD 3OJOA 4ZRDA 1ZAYA 4BBPA 5K4AA 1RHRA 4N03A 4D81A 4Z6KA 5LJIA 1DKRA 4HH1A 3LYAA 1QDUA 3KT6A 3FUTA 4MARA 1T3NA 4KDEA 1NTOA 3HKDA 4J1SA 3DOUA 1DAPA 3PNQA 2W2MA 1NJ8A 2FLLA 3LD9A 5T4FA 3HXMA 4D3SA 3U26A 3R4VA 4FDVA 5KWEA 4RAQA 2GHIA 1M9NA 3V8QA 3ND8A 4L0CA 4MP3A 2HJHA 5CVEA 3ZY5A 3U61B 1NMEA 4OKSA 1QSLA 1NWHA 3ITEA 4JEMA 2XNCA 4NBRA 3HO1A 1PR3A 1QIHA 1THZA 1YOVB 2X0IA 1A9SA 4KREA 1HFEL 1ORVA 2W7PA 1IU9A 4L28A 2EFJA 4J9VA 1UDAA 1J0CA 2P5YA 4I1OA 4BLOA 2FN4A 4B32A 5DNYB 3FPAA 3KSUA 1IB0A 3DWEX 2OUIA 2VZ9A 1TRHA 2RGBA 1D6NA 2O3RA 3P2EA 3LWMA 1CPYA 2JH8A 4X6LA 4CKWB 3BDIA 2F6RA 3HDTA 4L9WA 4KO3S 5T64A 3ZWQA 4NCXA 1Y6RA 1QGED 1GEEA 4D1YA 1ZYUA 3GEIA 5ALNA 2J1LA 2G5IB 1RLJA 3N8DA 1DFIA 1SB8A 3DM5A 1KDZA 1MT3A 1GGFA 4LQDA 3SCZA 1W0JA 3LXMA 4CJXA 3HH8A 2ZCJA 2DQZA 1ABFA 1GDHA 2FRDC 2YHAA 5H02A 2Z9CA 4L0DA 3IAUA 4UNSA 4NNPA 1Y6GA 3SSOA 4JI8B 1JTFA 5H7XA 4A2PA 2B1RA 3M4ZA 4MB2A 1HMYA 1E3DA 2RMKA 3R77A 1H5NA 3GNQA 4MV8A 1OREA 2PWYA 3FTEA 1GKIA 2BHNA 1HDCA 4WPGA 3V9PA 4F56A 4AX8A 1IBRA 2EW8A 3K94A 3TFQA 4BTLA 2V9WA 1UKYA 5BP7A 3O2QB 4C4YA 2CL5A 4RU1A 4DUYB 4WZ6A 1RI1A 1T36A 2WJJA 1GITA 3F6RA 5AK6A 2WD7B 1IUKA 3MD9A 4E7OA 1RYNA 2IEDA 2Y2UA 1U28C 2VH5R 3ILSA 3I05A 3LSYA 2IOQA 3OOHA 1Y8RB 3OZXA 3PGJA 5IVDA 3VDMA 1OCEA 1ODFA 3QRWA 3HTXA 4AP5A 1LLUA 3AG6A 4OU4A 2ZJ5A 3T8YA 1MDBA 5BN4B 1NNLA 2Q29A 1M0EA 4BGDA 1OXUA 1RADA 4M7OA 3ZDZB 1U2EA 2FHPA 3UMYA 2QRKA 1NJYA 3NBZC 1Z2NX 2BV3A 2W2LA 2ZE6A 3KFXA 3WNZA 5CBPA 3KHGA 1V2GA 2Q4TA 2VDWB 2OXEA 5DBGA 5JE8A 2HUPA 1P7YA 3M0EA 5JTUA 3K35A 2D7JA 3OOYA 4INAA 3PP8A 5IU6A 1D4AA 1NJ5A 3RH5A 2Z2IA 4I3GA 1Z74A 2C9MA 4LWZA 4Z3DA 2EJWA 4KFRA 4DUGD 5JBQA 3DZ8A 3I5YA 4BMNA 1T6BY 3FF1A 1MAWA 5F7ZA 5ITWA 4MJLA 4DJJA 5C4MA 4L0MA 3UHFA 2YMLA 1YSCA 4IIEA 3EEQA 4RVCA 3KYDA 4B5LA 5TIIA 1RLMA 1W0KD 2P6OA 1I7LA 4YRPA 3VO2A 5FWNA 1FBNA 2GUGA 2BFBA 3HKCB 4EKDA 3MIZA 4JJKA 1LKYA 2HWKA 1C9DB 2VSXA 3KKKA 1RJGA 4GZ3A 4XARA 3ZWOA 2BI8A 1B0PA 2XUZA 3JPQA 3NP7A 5J2DA 1GUYA 3DC2A 4LWOA 3RS2A 1KYXA 3T3PB 3JASB 4UVDA 4JB0A 4P86A 3UMVA 1QF9A 4XLZA 2V58A 3EBOA 3QLUC 4QW9A 2WMNB 3KXIA 5E6RA 1SVSA 5EKDA 5BSHA 2HNAA 4CTNA 2KVCA 1EH5A 1T5DX 1QZXA 5BV0A 4KUGA 2V4MA 3E84A 3OU2A 4EUKA 3R8FA 4JCCA 1EK1A 4BLSA 4I1UA 5LQMA 3AR6A 2P3LA 2R6ZA 1MC1A 4ZK6A 4E88A 1RPNA