3ZI4A

The structure of beta-phosphoglucomutase inhibited with glucose-6-phosphate and scandium tetrafluoride
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
218
structure length
218
Chain Sequence
MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords BETA-PHOSPHOGLUCOMUTASE
publication title Metal Fluorides: Multi-Functional Tools for the Study of Phosphoryl Transfer Enzymes
rcsb
source organism Lactococcus lactis
total genus 76
structure length 218
sequence length 218
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2013-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3zi4A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3zi4A01
5ALLA 2I33A 2HDOA 2R8YA 5AM5A 2W43A 3WGVA 3NRJA 2YN4A 1ZOLA 1O08A 3N1UA 1VJRA 1U7OA 5ALUA 4AP9A 4XQ0A 2G0AA 1Z4MA 1TJ3A 1RDFA 2JAWA 5AKYA 3FZQA 3ED5A 3DDHA 1T5SA 2MU1A 4YCNA 2ZXEA 4J2TA 3ZVLA 2HOQA 5ALJA 1U2SA 1SU4A 2C8KA 2C88A 1RKUA 1Z4NA 2O9JA 3N07A 1L6RA 4NAVA 4XE5A 3ZI4A 4BX2A 2GO7A 3KC2A 1XP5A 1XVIA 1LTQA 1NF2A 4DWOA 5AKXA 1L7MA 2G1AA 3CNHA 4UATA 4YIHA 5AVRA 4C4RA 1ZJJA 1U7PA 2FPSA 2X4DA 2HEGA 2CFRA 3WKEA 3W5CA 2WM8A 2C4NA 3PGLA 2EARA 4BNDB 2WHEA 3FPSA 4QQFA 3SHQA 5AVVA 3ZU6A 5AKEA 1XPJA 2G80A 3QGMA 3ZW7A 5AVTA 2P11A 2HSZA 5ALRA 2YMPA 5AI5A 5AI9A 2QYHA 3L5KA 5JJBA 4DW8A 1Z5GA 3U13A 3OCUA 4JDPA 3R4CA 2ZOSA 3DAOA 3GYGA 1N8NA 3WK6A 3NALA 3AR2A 1LVHA 3QUQA 4YGYA 3RFUA 1ZD2P 3QU9A 4YIKA 4ZEXA 3L1VA 4HGQA 2GHTA 5AK4A 3ZVNA 3B9BA 3K1ZA 3UM9A 4OD0A 3L7YA 3WK9A 4HGOA 4RETA 1CQZA 1PW5A 2YJ3A 3ESRA 2YJ5A 1RLTA 4IFTA 2G06A 3FPBA 2RAVA 3EF0A 4FYPA 4OFZA 4BBJA 3MPOA 1QH9A 2YY6A 2Q5EA 1TE2A 4RESA 4QJBA 3NASA 3NANA 3J7TA 3FM9A 5AW8A 5AK6A 1RKQA 3HYCA 5ALPA 4CNQA 1RPZA 4H1WA 5AW3A 1YDFA 3QLEA 3L8GA 5AIBA 3U7HB 2P69A 1NNLA 5AVWA 5AM4A 5AKJA 1VJ5A 1RQLA 2ZBEA 3OCYA 4BYGA 3N28A 2FDRA 4BEVA 3PCTA 3KBBA 1S2OA 4EX7A 2FUEA 2CFSA 3A1CA 3ONNA 2ZBGA 3IRUA 1Z4LA 5AW7A 2HHLA 1Z4IA 1SWVA 3FVVA 3F9RA 1Z5UA 4HYTA 1Y8AA 5AM3A 3I28A 2HO4A 4GXTA 2HCFA 2OA0A 2I7DA 2AGVA 1IWOA 4UMEA 4C4SA 4C4TA 2B82A 3ZTWA 2B1QA 2WF8A 4KYTA 3ESQA 4UU0A 2WF5A 3M9LA 2B1RA 3U7EB 1L7PA 2YFYA 2ZG6A 5AW1A 4DCCA 2JAUA 4IG4A 3WK5A 4J03A 3A1EA 1RKVA 3ZX4A 3NAMA 2CFTA 2W11A 5AVYA 2EAUA 4Y2YA 3ET4A 3EF1A 5AM2A 3W5DA 5FP0A 4KN8A 4ZEVA 2OYCA 1U02A 4L57A 3KOOA 4EELA 2B8EA 3E8MA 3FGOA 1EK2A 2IOFA 1MH9A 3IB6A 3A3YA 1ZD4A 4YCLA 2O2XA 3L8FA 3UMGA 5A3SA 3L0YA 4XPZA 3QYPA 5E0OA 5A3QA 2I6XA 2IA5A 4G9BA 4I9GA 4Y2XA 1Z4JA 3QU2A 1Q92A 2GHQA 5ALZA 3U26A 2RARA 3IJ5A 2PR7A 1O03A 4CF5A 2ODAA 5ALMA 2WFAA 1F5SA 2JAOA 1Z4KA 3I1YA 5T41A 5AI0A 1TA0A 2GFHA 1RRCA 3SF0A 5AKKA 1YS9A 2AMYA 4UARA 1WZCA 3WKBA 3AR7A 2FUCA 2HF7A 3OPXA 2W4MA 5AI8A 3ET5A 2QLTA 2FI1A 3PGVA 3I6BA 3OCXA 3SLRA 5AESA 1Z4OA 4HGNA 2G09A 4UAUA 2G07A 4Y2SA 2Q4TA 2C8LA 3WKAA 5AW6A 3DV9A 2RB5A 1FEZA 3L0BA 3E84A 2B30A 3UMCA 4B6JA 3AR5A 5ALFA 5AM1A 1QQ5A 4UW9A 4O8CA 5AK5A 4DFDA 2WF9A 1T5TA 3L8EA 3RF6A 3EWIA 2BDUA 2YJ4A 5AW0A 5AKHA 3QU5A 5IS2A 3WK8A 5AHXA 3R09A 5ALXA 3DNPA 2FPUA 3M1YA 2HX1A 1WR8A 4PNHA 4XOUA 3KD3A 4L6AA 1QYIA 4OHFA 3N5KA 2FEAA 3B9RA 3AR8A 2JGAA 4BEWA 2R8EA 3WK7A 5AW4A 4Y2TA 2YJ6A 2BDEA 2R8ZA 4NWIA 1AQ6A 2G08A 1ZD3A 4G63A 3ZVMA 1RLOA 5A3RA 4EZEA 1K1EA 2CN1A 4OCZA 4NFLA 3D6JA 5ALKA 3QU7A 1ZRMA 2WF6A 1KYTA 3AR3A 2I34A 3ZWDA 3BWVA 5AKZA 3QX7A 1L8OA 4AS2A 1WVIA 5ALYA 2YBDA 4UAVA 5AICA 3L1UA 4HGPA 2ZBFA 3OTQA 1ZS9A 2MSNA 1RC8A 4NABA 4FFDA 3OCWA 3OCZA 5ALGA 3WKCA 3AR9A 1S8OA 4FE3A 3VAYA 3WGUA 1ZRNA 2R8XA 5ALNA 2C9MA 5AVSA 4Y2VA 1ZD5A 3KZXA 1RMYA 5AIAA 3TLMA 1YMQA 4UASA 2RBKA 4EEKA 5ALTA 3CZ4A 4Y2PA 5ALDA 1QQ6A 1N9KA 3QNMA 5IT4A 3ZTYA 4BKMA 1J8DA 4YCMA 4NV0A 4JB3A 5AKLA 3A1DA 4ZEWA 3L8HA 5AKIA 3QUTA 2PKEA 4UMDA 1TJ4A 1VFPA 4KX5A 2YMLA 4UM7A 4UM5A 3U7FB 2WF7A 2P9JA 1U2TA 3B8EA 4Y2RA 3S6JA 4Y2QA 2PQ0A 3BA6A 1L8LA 1RMTA 1CR6A 2EATA 3W5AA 4Y2UA 3ZUPA 4AS3A 5ALSA 1EK1A 5AKGA 3OCVA 1X42A 5ALVA 4Y3UA 4L6CA 3NIWA 2YMMA 2D2VA 5AI4A 2P27A 3QXGA 4F71A 4KNVA 5AVUA 3NUQA 1Z4PX 4KNWA 2MU2A 5ALWA 2BY4A 4UMVA 2B8JA 1YJ5A 1RLMA 2DQSA 3QU4A 1RQNA 2NYVA 3WKDA 3SKYA 4MWOA 5AW9A 3AR6A 2I55A 5ALQA 2FPWA 3EPRA 3MN1A 5AW5A 3SKXA 1J97A 2B0CA 3QUBA 3L0CA 3P96A 5ALOA 2GMWA 1YV9A 4YH1A 4CE6A 5AVZA 4EENA 2OM6A 4E88A 3WK4A 2AH5A 2IOFK 3E58A 4HAIA 2IOHA 4Y2JA 1Z88A 5ALHA 2AUTA 4I9FA 3MC1A 4GIBA 1Z4QA 2JARA 3W5BA 3N8GA 4KX3A 2ZBDA 4UU1A 1QQ7A 3UMBA 3U19A 2YMQA 3ZX5A 1SWWA 1T9ZA 5ALIA 2IYEA 4BX0A 5AVXA 3U7GA 4BNDA 4F72A 2VKQA 4MUMA 3MMZA 2HF2A 4BX3A 1NRWA 3I76A 1Q91A 3E81A 3ZWKA 3KDPA 2Q4RA 1JUDA 5AVQA 1RMQA 3PDWA 3SMVA 3QUCA 1TJ5A 5IT0A 2NO4A 3AR4A 1WPGA 5ALEA 1L7NA 2FPRA 5AM0A 2NO5A 2I54A 4CF4A 3HLTA 2HI0A 5AW2A 1YNSA 5AI6A 3SD7A 4EX6A 4HGRA 5AK3A 3R9KA 4CF3A 4UMFA 2FPXA 1L7OA 2OBBA
chains in the Genus database with same CATH superfamily
4B81A 3GY0A 2WZDA 1SKBA 3IEMA 5TEVA 2Q8QA 4PANA 5LC1A 4ZK2A 1U0EA 2V59A 1T8SA 4XTCS 5EKDA 3LF1A 3I0ZA 4AJNA 4LNAA 1TIPA 4HV4A 4J9MA 4I2HA 5BV1A 1A76A 5FF9A 2K89A 4KQWA 5JRJA 3Q2OA 4QT4A 4FMBB 4Q7QA 4DIDA 1YL7A 2OCYC 5AVTA 3A4NA 1LLUA 2WQ6A 2ZSHA 3TZKA 1U7HA 1ZIYA 1AK2A 4PN3A 1DC6A 4YUYA 4X6XA 1GVNB 1TW3A 3K9FC 2G3YA 3M7IA 3HC7A 4H35A 3IQIX 4MDEA 2A0UA 2IIQA 5IXYA 2WDZA 4KDRA 2A7QA 3L8ZA 4AVYA 1F3LA 5BSVA 1FSSA 4MWCA 5A0VA 1RU3A 1MIOA 4FEYA 3IUYA 1T1EA 2W0MA 5E9WA 3RJ5A 1KIMA 4IMIB 1WQ3A 1E9RA 4J16C 2IIVA 3I62A 4BLTA 3ISCA 1ECPA 4DL2A 4CKCA 4L50A 4MEJA 1VHQA 5T67A 2FX2A 4QFMA 1U0RA 2JEIA 2AXPA 3ZNQA 4L3WA 4LIPD 3VHLB 3WDMA 5TGDA 1ABEA 3K75D 4G8JA 3WJ7A 4H0CA 5KFVA 4BNKA 1T1JA 4DZZA 2YV4A 1JHPA 4EL0A 4JX8A 4C3VA 4B7UA 1YHZA 4FCCA 4GMFA 1Y6QA 3GVPA 3ESZA 2CUTA 3Q5DA 5ARDA 2IWRA 2QDXA 2CPRA 4IQGA 1MH9A 4AURA 4OJLA 2V7VA 1KXJA 2G72A 4X85A 3AVPA 4PSKA 4RXTA 4XB6B 4PL2A 4R3UC 3KKPA 3HEMA 1J8VA 3KB2A 3HPRA 1TK8A 3VU9A 2MSKA 3TECE 1P0IA 3TRHA 5EWMA 3L7JA 3B52X 3ZE2B 5F5NA 3IDQA 2Y05A 4JEHA 4PYLA 2AFIA 5CCXA 4ZAZA 2KFZA 3GRVA 3K70C 1DAOA 1I6WA 3RRFA 3PS9A 2A1UB 3L8EA 5CM8B 4TMVA 1TM4E 4Q66C 2AJBA 4TTRA 1J0DA 1XQ6A 1YJCA 1CY7A 4IVNA 5EL0A 4UFOA 1A9RA 3TQCA 1P4SA 1QFJA 4UNPA 5BSFA 1GPAA 1D2CA 3T5AA 3KOXA 5BSUA 1W8IA 1A96A 4EJFA 2FSSA 2PAFA 2M98A 5BNFA 4HDCA 1P4AA 1N75A 4KH1A 1TOAA 4PNPA 1YL6A 1SVIA 4UTVA 5B30A 2C9MA 1V11B 3O38A 3RB3A 2GVNA 1NK5A 4RD2A 3D2SA 5G3ZA 2C99A 2VF4X 1KQNA 3MINB 4IJUA 1RXSA 2NT4A 2XKJE 5AUQA 5E79U 2OB1A 3P94A 1PJ4A 5FA6A 2ODQA 3S1LA 3ZNOA 3LLVA 2PLWA 4HAZA 4DCPA 3BA6A 3M9NB 3ZUPA 5DI3B 3H40A 4BCCA 3HTXA 4MVXA 3INYA 4DIOA 1NJGA 3EQ9A 4PBTA 5L51A 1RWMA 3QXGA 2Z2KA 4U0KA 1UPXA 4PL1A 3PDUA 2BGGA 3BK1A 1W85A 3FCYA 3VSBA 3TJRA 2H4FA 3QJGA 3IIMA 1BXRA 2GMWA 4HJRA 3U9SA 4K9LA 4BRZA 5LU9A 1ZG3A 1BDJA 1E9EA 4XIGS 3IMCA 1E2MA 3GAZA 3KOWA 2E4AA 2IYEA 1KC3A 5IM4F 4CMGA 1RXVA 5C8DA 4MS4B 2DKZA 1H1LA 4CEIB 1ZM3A 2VIIA 1AZWA 2E5LB 4DWJA 4PHEA 4YT2A 4DMUB 5DLFA 4JT9A 2LIPA 2G70A 2WVAA 2VA2A 7ICEA 3OC0A 4Z7JA 3M1IA 2DVMA 5L3RA 4QWCA 4O3OA 1XBTA 3G8BA 1C4KA 5CWRA 3P4YA 4W82A 2Z2XA 3L5OA 4D2IA 3KFLA 1D6SA 4QWMA 4Z7NB 1KQ3A 1QFSA 2IHVA 4EGCB 1WZ2A 3EVNA 1D0SA 1EXWA 4I9HA 3DLCA 2R751 3GLFE 3QEKA 4XWYA 4Z9XA 4BO0A 4BO7A 3U4AA 5TDHA 4N6OA 3PW5A 1Z56C 1C0PA 2GLEA 4NDAA 1HOTA 1AIPA 3ILHA 2NZJA 1J00A 3S5JA 2R18A 1J0AA 2RBEA 1DOQA 5L1IA 9LDTA 1N77A 3ZDAA 4BE4A 4MQ5A 2MYNA 1TAGA 3IPYA 1Y80A 2NU9A 1AO0A 5M04A 3I39X 7MDHA 2ZT5A 3RF9A 2YVUA 4QT0A 4DILA 3SEAA 1S0NA 1PW5A 5JARA 1XO0A 2CNWD 4ZMRA 3V8RA 4D6PA 4YO7A 2V4RA 1PLJA 1S2DA 3O8BA 4L07A 4UJ3A 4FUQA 2H85A 1U94A 4HYEA 3OJ0A 3I1IA 2JEFA 3PI7A 5J0SA 1IN8A 1M1YA 2ZTVA 3EGCA 2XVZA 3DZDA 5HUQA 3ORHA 4J9PA 3QVXA 3A9RA 4OG2A 1NVWQ 4HVTA 1IIBA 3I12A 4ZU6X 4MI3A 2J3IA 2YFQA 4IGKA 2PMZC 1HL7A 1HM5A 1AS3A 2C54A 5JFTA 3PR3A 2TECE 3K0HA 2HA7A 3CRVA 4R1TA 3LA6A 4H1HA 5A4FS 3UJPA 4AJ2A 3H3JA 5CAEA 2VNSA 4ENSA 2ECQA 2OYCA 3A0RB 2WHYA 2FSFA 3IE1A 4JV1A 4LECA 4CTMA 2G4VA 4ED8A 3D4IA 2N3ZA 3IVMA 3IH5A 4MCHA 4MCJA 2RMKA 4KFUA 3D64A 2Q7XA 4C7MA 2CXTA 4YJGB 3I37X 1H93A 9ICEA 3RPEA 3UHAA 2YCBA 4LDZA 3GN1A 3IQFA 2GYWA 4C4PA 5IJ0B 1U7WA 1QYRA 3TUIC 4OLHA 4MWEA 1XLUA 1NK6A 2PKRA 5H8WA 3PR5B 1G21B 4RT3A 3DUFB 1U5CA 1DX4A 1H05A 1Y1PA 3ZEAA 3TE7A 3QXCA 1Z5OA 1F2VA 3EX7C 5BYAA 4D0LB 1KBOA 5FTJA 4RQ2A 3MF4A 1N0HA 2ZCVA 1TMGE 4N0PA 5BVGB 4NL4H 3VV3A 3IURA 5KOJA 5FLEX 1VCNA 4KQIA 2ACKA 1UKBA 4ZODA 1HIWA 3W9BA 4A0HA 4RTPA 3BJIC 2FZWA 3ZHQA 2UYOA 4AZ0A 2H2GA 3ZR4B 3V7YA 2Z43A 3UG6A 1K1EA 4Q7MB 3GEBA 3QHAA 4PNEA 4KYIB 2W6JD 2GJ9A 3I42A 1TM1E 1SIWA 3WA7A 1W76A 1NF9A 3RYCB 5G5HA 1AKWA 3OQ6A 4XSHA 4D44A 4WOBA 4G84A 3DG9A 3UWPA 1YCHA 1QRSA 4RPLA 1SPBS 1VLMA 1CY2A 1EZZA 1JSXA 1M2FA 5HS6A 3ROTA 2YYAA 4ED9A 3UK1A 3TUZC 4M9UA 2HOFA 5KFGA 3IO3A 4D3ZA 5ESDA 1NOMA 5KTNA 2YHAA 3B8EA 1SOMA 3GLSA 2V65A 3ABRB 1OF1A 2EFYA 3A1TA 1RJ9A 5HTKA 4N7RA 1NJ5A 4GSLA 3HVJA 3AN1A 1NVEA 1DPFA 2PDAA 1DK2A 4YD1A 1SU8A 2P5TB 4WESB 3VVCA 3I01A 2VHQA 3IEPA 3RVKA 5C5EA 2XGOA 4O2AB 2FPWA 2AR9A 1JN0A 3DJYA 4DJFC 5HZGA 4H7EA 5K3BA 2PSDA 1DEHA 4H7FA 3RIHA 1L0BA 4HAIA 1BDMA 5BRNA 1RRFA 3BMXA 1CJBA 4D9KA 4Y18A 3RUFA 2I3GA 1DTWB 1Z68A 3ZDEA 2D2IA 2O8DB 3KTOA 2GRUA 1IXKA 1YB5A 4TROA 4PLFA 1I2DA 4FOOA 1D1TA 4FD2A 2A5LA 2X0JA 2HBRA 1AQIA 4B7ZA 4NICA 3ESAA 3P8ZA 3EF3A 4ND1A 4OSEA 3W9SA 3ZJUA 2GYYA 5JZVA 4PZZA 1KJ9A 2CE2X 5BUSA 2EFGA 1BCRA 4V0RA 3IAHA 3M2PA 1GPUA 4YHBA 3DHYA 3SVTA 3GPCA 2PI5A 5J4KA 3TRFA 1D5WA 4Q02A 4JYCA 4NBSA 4RF4A 2EW2A 1I1QB 3BZUA 3LECA 5JRDS 4MRRA 2YL2A 5AVRA 2FPSA 1ADCA 2NAPA 1E9VA 1SQGA 3FVRA 3SIWA 4E33A 1XEAA 1KJJA 1EXVA 5E4YA 1P29A 3DDUA 4YRDA 1FMCA 5J2HA 4ZZ2A 4X6YA 3WNQA 5IABA 1Z0ZA 4CCWA 4CG3A 1U28C 1BKSB 1KYZA 4IR7A 4XD7D 1ZISA 5BOVA 1YA6A 2OXTA 3WL7A 4IDBA 3OPNA 1PQYA 3MWLA 1TZ2A 1KO5A 4Z5XA 3J7TA 3IXQA 5CB1A 1UBSB 4W1QA 3SJAA 1R9GA 2JHGA 4YMMA 3AYXB 1L7BA 2BUBA 3S2SA 1UUFA 2PKQO 2V5AA 3ZGLA 5CDTA 3I28A 3VTZA 4GG1A 4MP3A 2XF8A 4WNIA 5LR6A 3IBFA 1X7HA 5IIIA 4AK9A 1M2JA 4AN0A 2F8MA 4QUGA 3TKYA 5IKPA 4MW1A 4MR9B 4BNTA 2O8BB 3NAMA 1I36A 1JR3D 5IVHA 3UA4A 1O3YA 4WADA 4E5SA 3NVDA 4Z6DA 2IEIA 1QGUB 4LE1A 2W0SA 1XKQA 1G20E 1WZIA 3GDGA 3OQHA 4BQIA 3RUIA 2Z6AA 3B82A 2AR0A 4DQVA 1YMUA 2AZMA 1TA4A 5IEJA 3COJA 3ZCRA 1U0SY 4PLHA 2X9LA 2FFQA 4J43A 3ZQKA 2E8MA 1KEVA 4FVTA 4A1FA 1KYQA 5ER9A 3S1SA 2GK7A 1GGFA 1XNSA 2YQ4A 4G1EB 2BF4A 1WM1A 3G59A 2J9YB 5J63A 1YDHA 5AW0A 1D7OA 4V0ME 4HFNA 4OYHA 4IVRA 5DZSA 2ZI9A 3K94A 2ERYA 5FUYA 4FYVA 1CCWA 1YDGA 1KO4A 4RSRA 4OBXA 4BLUA 3NOOA 1FNSA 4NCXA 1JQBA 3UYKA 1KY4A 4I8XA 4N12A 1S7CA 1SIUA 1T3SA 4FHCA 4GHWA 4TV9B 3I72A 4BNZA 2EEPA 4UAVA 4G1VA 3H5AA 2HCBA 4MVJE 2CB0A 5C9ZA 2E1RA 3NWJA 5AHWA 3HG7A 3NATA 4DMHA 2DBVO 1I30A 3RJKA 1RZRD 4P0PA 1V4BA 1T9BA 3U4MA 4JKYA 2E82A 3GLKA 4G4IA 5F35A 3HL4A 5IZ4A 3UT5B 1TYEB 1PIWA 4ZIRB 3F2BA 3NDIA 1VQ1A 4J0JA 1ONOA 4FIZA 1EZ4A 3O83A 4OYYA 5CBPB 4R9NA 1E6LA 2BCVA 3GGSA 3GLFB 3H1EA 3VDMA 5AW9A 4DR2B 2OVBA 2IF0A 5KJEA 3L7KA 3GVIA 1CUVA 1QGDA 2I80A 2KE5A 2P3OA 2PWYA 1YV9A 4MPRA 3MB8A 4J9RA 3NZEA 1Z06A 1Z28A 1NR7A 2FG7C 4UEJA 1COOA 1SV0A 3OOSA 4PG4A 3W5SA 2PT6A 4R05A 2E5WA 4JQOA 3SYKA 3STWA 1Q83A 3U19A 4EZBA 4BBAA 1H65A 2P9GA 3R3SA 2NXNA 2PV0A 5EJ5A 2XNHA 5HKBA 2WU0A 4HXEB 1VJ0A 5CFPA 1RR6A 3FFTA 4Q1CA 2EX4A 1U6KA 4JUCA 2F76X 2JHFA 3GUUA 1MRZA 3DHVA 1BW9B 2C0PA 4PWZA 1KPHA 1DT3A 1LLCA 2YS6A 1WEHA 4QTXA 4DNOA 2VAVA 1SO8A 1VZ2A 1K7YA 5ICGA 3DDZX 1YZGA 3WBFA 5EFZA 4OJYA 1ZXBA 8ABPA 4Q4AB 4L72A 1Q3TA 1A5AB 4B6FA 1Z0JA 9ICJA 2ZZMA 5TF4A 4TVBA 2IQIA 4ICIA 3W5CA 1DKPA 1QAOA 1OAOC 1DUIA 1WHSA 1TD9A 1V96A 2C4VA 1YZUA 9ICMA 5EKXA 3TCXB 5KREA 4G1BA 2VUSA 1LK5A 3O82A 1AXEA 4HC4A 3G5LA 4H9GA 1SCDA 5KFKA 4WY8A 3T7AA 3U7JA 2B78A 9ICHA 4LV8B 4M46A 4EYKA 2C57A 2IUFA 3W6OA 1G8JA 2VK1A 5MDHA 1U1FA 1RZVA 4WZ6A 1P6XA 2AMLA 5ALPA 4P7BA 4MQEA 4R8RA 2XPCA 1SBYA 3U7HB 4Z6CA 1TRHA 2JVJA 2P91A 3LK9A 2YXDA 1R0LA 2VNIA 3MR3A 1D8BA 1R9MA 4K9RA 4M0LA 4X45A 5IVDA 4IMPA 2GXAA 2VHXA 1YZVA 1MPTA 4RWZA 5LCXA 3BHNA 5DTMA 1W0KA 2B82A 3CSDA 1W30A 4UM8B 4A82A 4O6VA 3I9LA 2BMJA 4G0QA 2G7ZA 1PYDA 1TCUA 2UUPA 2CXYA 3OU7A 4BL5A 2PFKA 5FBVB 3RVQA 5LYJB 4YP3A 2R66A 2V6GA 1I9GA 2EGHA 4IRKA 4AZ3B 4ZYVA 2ZRLA 4NHEA 3ZE6A 1I8TA 3HZOA 4DXAA 4PRLA 3DEEA 2Q7OE 1O9HA 4RQ7A 3EFOB 5CDSA 4WSOA 3SAHA 4F4XA 4BZQA 4UNIA 3MTAA 2EZTA 2P65A 2J8ZA 3HPOA 2V7QD 2QRVB 2R6CA 2PI4A 4EW1A 5JTIA 1ADYA 1UJ6A 1DK3A 3OZBA 1P5RA 2B9VA 2C8LA 2PCJA 1IG3A 4DRXA 2R1ZA 5H80A 1ISIA 3FWYA 2WF9A 2FMSA 1UAGA 3HJHA 3GJ6A 1E6KA 3IUPA 2PSSA 3EOAI 3QE9Y 5DKWA 2YRWA 4P1ZA 8LDHA 5FO1A 4WKBA 2IUSA 5T6MA 1T36A 1DKQA 2YJ6A 2JLBA 1U31A 5KG7A 3BWYA 3NS7A 5KFBA 4LHEA 2XRZA 3RG2A 3OTGA 1KNXA 5ECGC 4YUWA 4DYDA 2ZIWA 5CMLA 1Q1AA 4ASUD 2A9QA 1K4YA 3LX4A 5F1YA 2LUOA 1P1BA 5G53C 4DV2B 3PHCA 2W6MA 1Y33E 1FXSA 4R2XA 3BL6A 5KOHA 1PFWA 1J2NA 3WNDA 2IV7A 4CKXA 3ZW8A 2G9UA 3ZCQA 4HNSA 2NSJA 2Q1WA 3OLVA 3VTAA 2NM0A 5JSUA 1WY5A 1Z62A 4N6GA 5B1SA 1QIKA 1GZDA 3ZVRA 2F9FA 2GILA 2R00A 4QYSA 1K6MA 3NS1A 4C5CA 1GWNA 4GC9A 1GL6A 3ISBA 2HRDA 3AFNA 3QWBA 3CVOA 2OCGA 1HG1A 3WIOA 5LZ4A 1VI2A 1KDTA 4CIAA 1I0ZA 4U9IS 5JAMA 1J97A 3LUAA 1BVYF 1PP4A 2OM6A 2P3LA 1EGAA 1GN9A 4NZOA 1J5XA 1L4FA 5KG1A 3K30A 4LQ4A 4KX3A 2H48A 2ZBDA 4HPWA 3CNBA 1J23A 4MB2A 1UBOS 2VKQA 4J0GA 3M9XA 4CHTA 2R60A 1OLXA 1FE8A 1V41E 3CPEA 1FFAA 3SMVA 2XVMA 3QUCA 1VM6A 3OE4A 2AFHA 3ZHSA 1DKNA 3QE4A 5AD1A 1MZVA 3S2ZA 4RNOA 4C0XA 4EUEA 3T5MA 4WZBE 3WWEA 3NCHA 3FWKA 5F3XB 2WP0A 5DCYA 1YBMA 3EE6A 4M1SA 5EKTA 1UBNA 1LLFA 3EDQA 1OROA 3KQWA 3R24A 5A4DA 4YMWA 3RR2A 4DCNA 1WCNA 1QZ3A 1UC5B 1K1SA 2O20A 2PKXA 2JEOA 1B0XA 3KWJA 4IS3A 5J47A 5IX8A 3C8DA 4PYOA 5FBLB 3CT4A 1DGQA 2TYSB 1U7PA 1SM4A 4MW0A 1PSDA 3HDHA 4UUOA 1GQRA 3PGLA 3BWDD 5LLDA 4J3JA 1FRQA 3MTQA 4MCAA 3G88A 3SWWA 1R8XA 1GPKA 2XYGA 4DL7A 3WYNA 3C7DB 1G20B 5KNCA 4FMDB 5AK4A 4BKQA 4FE4A 3K1ZA 8ICCA 1PDVA 2GRJA 2A14A 4OFBA 3VM6A 4CQMB 2WWIA 4FMCF 4PCVA 3T7KA 1HEIA 2QG6A 3EDMA 3SQXA 4RMNA 4MKZA 4ER3A 3R1IA 2CVZA 1N2IA 2AQKA 4GRAA 1QV7A 1KLNA 2ATCA 2GF0A 3SZRA 2X23A 1ZK3A 1UDBA 1C4OA 1WVGA 4KKXB 2X8WA 2AWNA 4US9A 2H65A 1RRGA 2V8BA 9ICUA 6YASA 1RBQA 3K6RA 4D7AA 3IBCA 1P0PA 2GN6A 4C4YA 4GWGA 3FNHA 3PQ3A 2ZCJA 1TC2A 4NMWA 1HQYE 5DGXA 5DBHX 3C3DA 4LPKA 4KAJA 1KEPA 5I4BA 1O96A 4YJFB 2B61A 5DBCA 3DKVA 1Z4KA 4JJZA 1UJ5A 1UK6A 3FWHA 1PU2A 1WV1A 3R9XB 2W4MA 1WWUA 4GECA 3H8SA 2XIQA 3FMVA 4XRGA 2ZUUA 1FEZA 4Z0NA 3TZBA 3TSWA 4QJ5A 5I8ZA 2HWXA 5L3SA 5HR6A 2J5QA 1PFKA 2QR5A 4Q19A 4AC9A 4B8YA 2G63A 2WAAA 1RIFA 3FMOB 3UXEA 1FFHA 3OD1A 2WWYA 3BN3A 1GQFA 2UV8A 4RHXA 2QVBA 3W6ZA 2AN4A 1B7GO 1X0VA 4AIIA 4AWBA 3V7FA 2OFPA 3FF4A 5CFMA 1DG9A 5SZJA 2OHFA 3AP2A 5BN1A 3QPUA 5KX5B 4XW2A 1SHZA 1JG1A 4OA8A 2ZRIA 5CB0A 1VPTA 3OTQA 4JR2A 4WNAA 2JI8A 3LU1A 3QVTA 3ZKWB 3PSHA 3L40A 1HYBA 1AGYA 3WGTA 4NFSA 5HMMA 3U31A 1M75A 5LA6F 2PQ6A 4H2DA 2O3JA 4JU9A 4G4GA 2FWMX 1I0LA 4PBRA 1NN1A 2HHSA 3LZ6A 2VDKB 1P2SA 4CDMA 4WPGA 5KVQA 1J0BA 2GM4A 2AI3A 1O1YA 1YS1X 1QX4A 5U4XA 4JYBA 1N60A 1O9GA 4E13A 3BD7A 3P0HA 1G3RA 4CL8A 3BS7A 4CIBA 3MGBA 3UMMA 1NBHA 1UP7A 4DQKA 4QYIB 4M54A 1ATIA 1AV6A 2WA2A 4F4CA 2NYUA 2RC6A 2YW9A 1T94A 1YZKA 6LDHA 4BRUA 1A1VA 1GAQA 2AH5A 2BSAA 4BTEA 1O2DA 2J0UA 1ZJMA 2B83A 1TVKA 5DF1A 5FTKA 4UHCA 2QJFA 3NGDA 2ZRFA 2XDWA 3T54A 3FYUA 3VYVA 4EWLA 2AE1A 1B2RA 4C4ZA 2DKOA 1UPCA 3YASA 1CJMA 4U7FA 1C9DB 2ATVA 3TR0A 3LOUA 2G28A 3GMSA 4HFJA 1GA4A 2RGCA 3BGIA 2ZUTA 3SICE 3IPRA 1OH5A 2HXYA 2VOJA 1T2EA 2SKEA 1T15A 5JISA 1TEZA 3IESA 3L7IA 1CT9A 2P2SA 4DYVA 4Y2HA 1Y7HA 3I73A 2JLCA 2NVOA 4DCTA 1JDVA 1ACMA 1ZJJA 4AAYA 1QRDA 4EJMA 3GNSA 1R9NA 2QRPA 4ECQA 2J5KA 2CFIA 3RU3A 3D9QX 1TL7C 2PT5A 4HO1X 3HABA 3O6VA 4DSKA 4B5KA 1OW3B 2HPHA 2C5EA 2BUCA 1FVXA 3NTQA 3NUGA 3OH8A 3GJYA 4U0JA 3JU3A 3BCHA 3OEHD 1NXWA 1KI9A 1UXHA 1P3DA 3FYDA 2ZATA 1OASA 4LJXA 5HKKA 1SBQA 3DL4A 3AL3A 3JQ8A 1NVMB 3U7IA 1XMQB 3PFGA 4D9FA 1ZNZA 2C4UA 2HM7A 1A95A 1RVDA 3IV6A 3OE7D 3PCTA 4MS1A 1B26A 3O21A 4GPBA 5ELXA 2ZTHA 2COKA 1YKSA 3M5PA 4J9UE 1EFTA 2I7DA 4WLUA 1XTVA 5H7XA 4E5KA 1Y48E 1D8LA 2R4TA 3GJ5A 1HFKA 4F96A 4N49A 1E98A 3CC8A 4BO8A 1NVBA 5K6AA 3A2LA 2VF7A 1FFUA 4HN9A 1VKZA 2V3VA 3LQ1A 5KTPA 5IYZB 3BXEA 4PS0A 5G2OA 2DHRA 4NJMB 1C9JA 3KG2A 5JS7A 4Q93A 4CEJA 1EG7A 5BXYA 1BH2A 3RUDA 4TYQA 1U48A 4RSHA 4TLDA 1XA0A 2UVQA 3HBMA 4NJEA 4OIMA 1VYHA 4U3JB 4RGQA 1CLEA 4EUSA 1HZZC 2Q2QA 2QN6A 1N4AA 1CULC 2HBMA 3ZWPA 4P5PA 1UMCB 4RC9A 2LNDA 2ZSFA 1AY0A 2BBTA 1G5TA 4ZGBA 5AM1A 5HQJA 2O1EA 2AOUA 1NIJA 5KVSA 5AVKA 3EQ6A 1OYWA 2JD0A 5B53A 3TH5A 1VE9A 2J5XA 3AWDA 4XARA 1ZLXA 5KCZA 5KFCA 1ZMTA 4P86A 4A73A 4H0NA 2YNMA 4RY2A 5DBFA 2BMWA 4IEFB 1ZGBA 3LCJA 4RLFA 2AOWA 1ZQUA 3H2YA 4S1NA 1FP6A 4WKCA 1AKRA 4HWPA 5HSGA 4L0DA 4GKKB 3VU0A 5FUWA 2WU4A 2W9BA 1IJBA 3MK31 4COKA 1LXCA 1RFLA 3DMDA 3QVJA 3EPGA 5IBCA 1ECFA 4UOQA 1TAMA 5GPBA 5J9FA 5DP1A 1CHNA 4AYWA 4EEYA 3AM9A 4RQMA 1N78A 1R9JA 2Q1XA 4DO9A 1EP9A 3BPSA 4E46A 4RHTA 2VG8A 4WZBB 4A5OA 4IVPA 4LX8A 2CUNA 2GPJA 1SXJD 4AKSA 1DL5A 1E5QA 3TCKA 4ZCMA 1EWKA 3VR1A 3L0PA 4PHPA 4DQUA 4MHTA 4HUQA 5I51A 3VISA 4B3SB 4YV1A 3A9UA 4B6OA 2OFOA 1OI7A 3PQ6A 2Y1GA 2OV6A 1MJGM 1XCPA 3BS5A 4MEBA 3ZCVA 8ATCA 4LYHA 1BJTA 2OXCA 2GHRA 1UXGA 4UUMA 2W2NA 3B3AA 3GLRA 5BWLA 2WU3A 1X74A 1HNXB 4EJSA 2D8CA 4QIWF 2HIGA 3R3JA 1AOXA 1DXSA 3V1MA 2W2MA 1XZNA 1KSJA 4RGYA 2ZITA 3ETGA 2X9NA 2WJ3A 3TCNA 4CF4A 5DT9A 3W6PA 4ED7A 2XEXA 3NRWA 2O8FB 3O93A 2XICA 2ILTA 1GO2A 1EIZA 4K6KA 2QIPA 4I1OA 2C03A 4J90A 1ULAA 2WYHA 3BZBA 4OQMA 4HP8A 1CUBA 2ZXEA 2VQ6A 4J2TA 5C3MA 3SP1A 1R18A 1L9XA 1O89A 1WCIB 4TTTS 4RIIA 4ER6A 8MHTA 3HBNA 4JROA 1OIWA 5DGTA 1P7PA 3DBHA 3HY3A 4ENPA 1U6JA 5ADVA 3GGDA 2BFAA 4E1BA 4AZSA 2XAAA 1BHO1 4M9SA 2QXUA 2G5GX 2IKQA 5D85A 1W8DA 2FKAA 1TFUA 2VBGA 2Y9UA 421PA 2RK3A 3TZEA 4QGGA 2HPZA 1KDZA 1YULA 1KSHA 1JR2A 5D51S 1H23A 1L1EA 1BS2A 4ZI2A 3L41A 3CN9A 3TNDA 3OJXA 1T8WA 2RHRA 2CMKA 1GGHA 3B20A 5A3JA 4K3UA 5AM3A 3UENA 3PHJA 3RWOA 2XXBA 2NACA 2JZCA 4BQNA 2X2EA 5HQ3B 2MT9A 2F9MA 3BRWD 1FDTA 4CMEC 2VN8A 3GLIA 5C32A 3KUCA 4X92A 1BO6A 4NYMQ 4WINA 5EHNA 4QUHA 3EGVA 3O84A 1WUJS 4M3NA 3WGYA 3RANA 2VJAA 4J2OA 1G21E 3FBWA 3RTDA 1L3IA 1ZJYA 3ANNA 4FBLA 2OPHA 1LBEA 1F48A 3QKSB 7REQA 2WHXA 2GBPA 4R1NA 1T3HA 3Q2KA 1X7XB 2ZBVA 2QN2A 4CLEA 3DLTA 2PS1A 3W2HA 5B6JA 4PFSA 4UE3S 2UYHA 2J31A 2J09A 1QHHA 2FZVA 2O5VA 2BFDB 5GTDA 1QORA 3O2JA 1A77A 3DE4X 3OJUA 3FMGA 5C1PA 3UICA 3R7DA 1YRAA 2GBLC 1OD6A 3HJBA 3EASA 3HRIA 3QW4B 4JEIA 2J9FA 2WMNB 1OWOA 2BHRA 2VT7A 3MFIA 1H22A 3VO9A 1MGPA 1VL5A 3O4GA 4G8BA 4DDVA 8ICZA 4BWYA 1T3ZA 2A9JA 5CXUA 9MHTA 2F44A 3LBIA 3ZE1B 4IXDA 3T7DA 2GBFA 3H18A 4BPRA 2P62A 3TIIA 4MHSA 3JQFC 5BN3B 4IR1A 4X63A 4B1FA 4EI9A 4AWXA 4LJ9A 3JYOA 3Q7SA 3I9OA 3LLSA 2A86A 3PFBA 2XGMA 2PH5A 4DUGA 3PGMA 3G2IA 5FPPA 3U1TA 2HB6A 3N6XA 4NK4A 1KTQA 1DFIA 2FOXA 1FB5A 5DNWA 2IIPA 4LJ4A 3E2IA 1M2NA 4FW8A 1E6MA 5GOTA 3L0OA 2Y27A 2Z83A 4H4CA 2ZBQA 1WXXA 3V7KA 1OQAA 5K7SA 2GM3A 1C29B 1RCTE 2CSUA 5LQDA 2ESEA 4G3XA 1L4NA 5LB4A 4QGSA 3VR0A 4KN9S 3H5IA 4CI9A 4HQRA 1X1EA 3VAZA 1P9RA 3COWA 4NULA 1CEQA 5HR7A 3IUBA 3ZYCA 3EA0A 2IEZA 1ARZA 4CQLA 3O73A 3HR8A 4LTMA 5F9NA 3DF9A 1BOOA 3K6SB 4EUNA 1U3WA 5KFOA 1CFZA 1KQPA 3H86A 4QODA 3T38A 1KDVA 5J2DA 2RRDA 2RB4A 1TJ5A 2NO4A 2J3QA 5DRYA 5TY0A 3HZHA 3ZJVA 3LPLA 5J2TF 2PX6A 5LBIA 1KNQA 5DDYA 3D3EA 4DC9A 3B0XA 2X4GA 1ZNWA 5F2KA 3QWFA 2XZDA 3H2IA 3F5MA 3V00A 2Q2OA 1XR3A 2IPOA 2H9YA 2PRKA 3IDFA 4RF5A 4TTVA 4KXMA 1JVBA 3FE2A 1GADO 1DJLA 3EK2A 2J6IA 4A7PA 5F77A 4EUKA 2CL6X 1XD2B 3PG5A 4QD3A 2DERA 3EMBA 4G41A 3N74A 4L4SA 3C3PA 2FLPA 5E2AA 2ORYA 1PJZA 2UVUA 5BOSB 4P34A 1A8SA 2A35A 2JCYA 1L5GB 3Q88A 1N5DA 4EB8A 8ICQA 3DSRA 1OU4A 1SUWA 4NAHA 3AJ9A 4EMSA 2ECPA 4OKIA 4DEZA 2H0QA 4ENTA 3I4FA 2QL7A 3MMXA 1HE1C 1KDRA 4EHHA 4DNPA 2WEKA 2A59A 2ALJA 4DCVA 4K9OA 3TZCA 1UDAA 1HL3A 4LHWA 1F1BA 2ZSEA 4HAUA 4PC6A 2Z3WA 2VDWB 3C0KA 4UAWA 3KQPA 4RPIA 1P1JA 5DK6A 5CYFA 4HFRA 3JR7A 1WA5A 2PUBA 2P6MA 4G36A 2FW9A 5JBIA 2BI8A 4BEJA 2CT8A 3V7NA 3SVLA 3RSOA 4EGAA 2YFYA 4C7VA 1RC0A 1G8MA 4LJ7A 8ICLA 3K9LA 4G2NA 4C14A 2FTKE 3A1WA 4ZU1X 2PBFA 3PX3A 3TANA 5JWRA 4ID9A 2RHHA 1LV8A 2XY7A 3ISJA 3L93A 2OZPA 3D3JA 4YXWA 4OHKA 1RQGA 4MUAA 3OZWA 1MG5A 1J0EA 2OLJA 3C39A 4OJQA 1CBUA 5K4LA 1GQ2A 5JHHB 1ZM9A 2HSJA 1FS6A 3UKJA 2Q6LA 2VUIB 4NOJA 1HYQA 4KJXA 1P8JA 2C4TA 3Q5EA 2ZULA 1ZM2A 5ITZA 3UV7A 3KS9A 3PPWA 3KJQA 4LYJA 1J22A 4FM9A 1YL5A 3EXIB 1DGJA 1ZJZA 1DKOA 3RIEA 4QWDA 1OI3A 1T5TA 2SBTA 1OXUA 4F9TA 4KXWA 4GFJA 4BC1A 1EM6A 1NMYA 5K0JA 1EE2A 4QU8A 1TC1A 5EPOA 4V2UA 1KBUA 3Q8WA 2XE4A 5EJ6A 2HFJA 4FSDA 1F44A 4BLQA 3ZGNA 3F3YA 4HDKB 3FKJA 2PR2A 5JQGF 3VI3B 1DJMA 5TC4A 3KL2A 5A71A 1E2FA 2BMAA 1LKYB 4EH1A 1JFSA 5T3UA 2EG9A 2ZBFA 2ZJ1A 4NBLA 4MQ6A 1KK3A 1M8PA 1NXXA 1QBKC 2C58A 1Z7BA 1NFQA 4UBJA 3GCZA 4OP1A 3NW9A 3RAFC 2NMVA 3D8RA 4Q3KA 4OXQA 1VLJA 3ETRA 3CJRA 2OGUA 1KK0A 1MT3A 4EAAA 2XMDA 3EGXB 2A58A 1AKTA 1GG5A 3AM5A 4TWAA 3ZHVA 2O7SA 4IV8A 1NBWB 2MRLA 3WNVA 2XUPA 1AH2A 4A6PA 4CG0A 2P27A 4KNVA 6AT1A 3PHBE 3KXLA 1E89A 2C3MA 4OHYA 4MTLA 4RA6B 1X7WB 3B6ZA 4EF6A 3BL8A 4V39A 3OZUA 2Z95A 4UB2A 1QZXA 5TNXA 1RRVA 3ZDYB 3LVFO 1E3QA 4I6GA 5ANRB 5HOQA 2VJLA 1NATA 4ZI3A 4D3FA 2FN8A 5TARA 3CS3A 5JPDA 2ABWA 3FNGA 2QMHA 2WYVA 4HDAA 2XUHA 1QC5B 4MKFA 1U2QA 4IYRA 2W2TA 4AT1A 1JKXA 4AQYB 2AFVA 2QTMA 3C2LA 3H9GA 1REQA 4HRVA 4UCXA 2OXFA 3N0TA 3WMFA 3FA2A 2VTBB 2L5YA 4RFVA 3SJBA 2QR3A 4AJHA 2X9VA 1A97A 2ZUSA 2ZSIA 2GJSA 3RCBA 1JDUA 1CRPA 1K9VF 2FPIB 5E9JA 3SZ2A 3A1SA 4CT0A 4H4EA 2FZLA 2R6JA 2RGNA 4JI8B 5AKXA 2CGEA 4IDCA 3IAUA 4JL8A 4HG2A 1BCSB 3DAGA 4EZ9A 2P11A 1SD1A 4WAUA 1UQRA 3H2KA 1AHPA 1UPBA 3QPCA 2JW5A 4PM4A 3U5TA 3HY4A 1IV8A 4NL9A 1UKAA 3GJ7A 3OOWA 5HBGA 1HLFA 1Z8FA 1QVAA 4OQYA 3HYCA 4JQSA 2IXGA 4NRDA 2IPMA 4GR5A 2EKLA 1W47A 3RAQA 1RWVA 2NXWA 2ZBGA 1K3UB 8ICTA 2D74A 1Z6XA 1N2OA 3CB2A 2R8IA 4ND2A 1QSSA 2CNBA 3AP1A 4E4YA 4LOIA 2AGVA 2WICA 2J6TA 2CXNA 3SAGA 4IXTA 4ZOQI 1GP2A 3B6EA 3CX8A 3FCAA 1I24A 2WWXA 4RIHA 5JXWA 4JR1A 4F5ZA 2B8WA 1FFWA 4UAGA 1U8EA 2JV3A 1JJBA 3WZLA 4Z9AA 1YIDA 1A88A 4QUDA 5A3SA 3HV0A 4X8LA 1ZQNA 5F21A 4HDSA 2WQZA 1FW8A 3UIEA 3D3KA 4IO0A 1DWUA 2XMCA 4IJQA 3E6AA 1US8B 3V1KA 3WLLA 2FSVA 5MFPA 4A8JB 2FJ6A 4AZVA 1AK1A 3V2HA 1RYEA 3WKAA 1C20A 4Y6SA 5LA6A 4ZVRA 3PFIA 1C80A 1Y1SA 4F91B 1R8QA 4F8EA 3EIWA 3SS8A 5ITSA 3KU1A 3PVXA 1PS8A 3HB4X 3F7MA 2GB4A 3KQLA 2VXCA 4ECTA 4YDQA 5L3QB 1F06A 4BY9E 1F8XA 1QRTA 3ZDZB 2C0QA 3L1IA 2AI2A 3FHLA 5TRTA 1SUDA 1Q2XA 1N0UA 4P7JA 4F5QA 1JBQA 1NLZA 1CQXA 1XAJA 3B1ZA 3C6ZA 3KDSE 4D8WA 2NU7B 5ALGA 3AR9A 3KETA 1BXZA 2R8XA 2SICE 4I3FA 1R4ZA 1LU9A 2R6GA 1F14A 2RBKA 2GYVA 3FUUA 3V8VA 5EJAA 3CY6A 4RQ5A 1AUPA 4JEMA 4CKZA 1OZFA 4YAEA 3W4JA 3DBRA 1CUFA 3RVBA 4MB0A 1MX5A 2E8PA 3RS9A 1U8FO 4WBSA 2MSWA 4CT4B 4IIJF 2WG1A 1KYXA 3PC8A 5C8VA 3IXLA 1HZJA 3A9WA 2CLFB 1Z4PX 4B9UA 2Z98A 4RJKA 3IHQB 4L4ZA 1GV0A 2I7TA 1E3LA 4KLEA 1PJAA 2CCGA 2F59A 1IQ0A 2DFNA 1BOFA 3NYQA 5CTAA 4UNNA 4Q7LA 5F7JA 3RGWS 4QZCA 4CUKA 2NZWA 3ROFA 4U2EA 2RGDA 3KO8A 1MNAA 5EZ5A 1URJA 4TMTA 1ZHFA 3M6UA 2R5NA 4EK9A 2IYRA 4MQMA 3ELYA 3SQMA 1OKKD 4YK7A 4M9QA 3HKCA 1RD4A 1ECLA 3V33A 4KSBA 5CEEA 2RHDA 4BTVA 4OI1A 1LS6A 3LY7A 1DRWA 2OUKA 3TR6A 2EAMA 3DTVD 3X1DA 3TOCA 2H9IA 1KVTA 1OGYA 4RVCA 4BEVA 5HHTA 2JI4A 4Q9AA 3PV0A 1TJPB 1KZ9A 1WSDA 2HL6A 5IH7A 2Y1LA 4MUYA 2VP9A 2I8LA 3CNNA 2M6KA 1YB6A 5SYMA 4ZKEA 1Y37A 4Z7OB 3GN2A 1KFEB 1L5MA 2QWXA 1QIJA 1CUIA 3WL5A 4MGZR 1BYUA 2IU0A 4JK3A 3UVEA 3KSBC 1ZC4A 5JNRA 1AKUA 2PXAA 4HTFB 2FFAA 2FFHA 1RHJA 1S0OA 4C5AA 3CKMA 4ZH4A 3MR2A 3N2LA 5ISMA 2M0NA 4DPMA 5KNBA 3FI0A 3GLUA 4U6QA 1DAEA 3OBBA 1QKKA 1V1RA 2WD9A 3ILYA 4Q9DA 1RWXA 1F9EA 4FS2A 1XCOA 5WRFA 1QRAA 4K05A 4B09A 4O8ZA 4TTQA 3DT9A 5FNVF 2VQ3A 1H0KA 1WWKA 4FCWA 3CVVA 2YJGA 1TT5A 4G0XA 4YYEA 1FFXB 3SHFA 4GPEA 2WHRA 3VU8A 1C7QA 1ZIPA 5JZSA 3HA7A 4DJJA 2W8BB 4KMOB 4UHHA 4B6RA 1VPEA 3VPXA 4QPZA 4DFJA 4S3MA 4YFYA 2O4CA 4LAFA 5DN6D 1VLBA 1JVNA 3NHSA 2EQ5A 2VDQB 3OZCA 4OMFG 5BN4B 2BR0A 8ICYA 4IO1A 3PL1A 2ZR0A 2HY7A 3GEDA 5KFMA 1DQNA 1N8TA 4GQAA 3TS1A 4O5KA 3RTCA 1JDBC 2ZIVB 4Y2XA 3HX0A 3GFQA 2VSXA 1PR1A 3KAQA 2CEAA 3TQTA 4JL5A 2ODAA 4OBWA 3FWPA 2W2KA 1IHYA 1JEYA 1MA0A 4DANA 2XT6A 2FF5A 4QPCA 3QPWA 4LZPA 3GEMA 2PVPA 4PXAA 1EFPA 3BT7A 3Q8SB 4PZOA 2XB2A 3LFHA 1RSZA 3AR5A 3TZ6A 4GWLA 3N2NA 2OC9A 1ICEA 2AT1A 4CMHA 3HCBA 3WGQA 3ZXIA 1KZ7B 3KOZA 4JJIA 2NUPA 2ZJAA 5HRCA 4XDYA 3KZMA 5EZYB 3X2SA 3QPAA 1Y8RB 1RTTA 3HLYA 1FMLA 2O2CA 1HRDA 3MUOA 4YMGA 4EP1A 1YFKA 1G3UA 1KYTA 5DQHA 1Z5NA 1XWWA 3W77A 4DV0B 1DELA 3HCFA 2FJPA 2OLEA 3M70A 3JQ9C 2JLAA 3PA8A 5T4BA 2IY7A 1T6YA 4O3MA 1L8QA 4AI6A 5FDFA 5J2AA 5C1IA 1VMKA 1XTBA 5DTIA 4B46A 2XCRB 3T95A 4Y1RA 4LY0A 1T5HX 3COYA 5EJ4A 1PZMA 3KHKA 3MHPA 5IKXA 4FGZA 2XBMA 4LF7B 5IDXA 2D4AA 3JQAA 4NM1A 3G2NA 3AF5A 4BQEA 1ZQSA 1WAMA 3HFSA 3N97B 1V0JA 1Y9AA 2PBZA 4IX1A 3STXA 2P2DA 4A9AA 2ASVA 5JS2A 4LRSB 1F12A 5HJ5A 5DSXA 2F6RA 5JD6A 3VPFA 1PWEA 4MUJA 5K3FB 1KEEB 3VSAA 3QUBA 5E38A 3TIVA 1EXMA 1DKUA 1GRCA 4GDMA 2WIJA 2RHBA 3V7JA 3U3ZA 4PYKA 3GI1A 2MHCA 3B8HA 1JKJB 4JWMA 4W9MC 1SFRA 5J4LA 4HDRB 1RYBA 1RYFA 4PINA 4EYOA 4ERXA 3KKEA 4MYRA 2D6FA 3ANTA 2FHSA 5F9LA 1FUYB 2OY0A 3T52A 4B3RB 2I9PA 3EUFA 5CU7A 2ZJ4A 2QQ5A 4KFCA 4BJHB 2PY6A 3K92A 4U6NA 2I6GA 3PQ5A 4HH4A 4M86A 5H0IA 1GZ3A 4B84A 1VE6A 3O8RA 1C3JA 4PZUA 5EWFA 1DHTA 4F4FA 3DEZA 1L7MA 3R6DA 4BMNA 2UDPA 3PFCA 1T0UA 4PONA 3JARA 1KOJA 3ZGXA 5L4SA 1NYQA 3HHPA 1XQ1A 3UMVA 3B78A 4FO6A 5KFTA 4JI0B 2H2DA 3BG5A 2FR0A 3AR2A 5JSQA 1NW5A 4CIVA 3CEMA 3LFTA 1I7SB 2IEGA 1G8KA 4FYPA 4O2BB 1A2QA 3NIBA 2E5FA 2FWPA 2O57A 3NJRA 1YVRA 3PMNA 1UIRA 2OLKA 3KSZO 1ZQDA 5AW3A 3O0DA 2Q2NA 3QY9A 3V1TC 4EMUA 3D6HA 3AQ4A 2PGDA 3WIDA 1BE1A 2O2HA 1HR0B 1UXKA 3ZXXA 4XVRA 4N8DA 1XDWA 3RFAA 2GQ0A 2VHUA 4JQYA 1BX3A 2QLJA 2O06A 1EH5A 2KLBA 1MPXA 3QEJA 4HSGA 3WMXA 3E03A 5J1SB 1XUOA 3VR5H 3DR3A 1TQ4A 4OUKX 3RJMA 3EHDA 2RHOA 5IU6A 2EX0A 4JP3A 4PG5A 3MWGA 4F93B 2JAQA 1HF3A 1C7YA 1B0UA 4E2YA 2OE2A 5L1KA 4GOLD 2I91A 3R0JA 3L8FA 3RS5A 4JK1A 4KNYA 3TYXA 3BWEA 5FUXA 1A2BA 4E4RA 3BREA 3Q7EA 1VSBA 3EXFA 3AJAA 4ZXPA 1I01A 1ISRA 2QDKA 1Z1BA 2QR2A 4L16A 3BMNA 2G09A 3IE0A 1P74A 1XRMA 4DDKA 5D7BA 3ETJA 2UZ3A 1NOJA 3LA8A 4RFSB 2WK1A 3NTOA 1Q77A 5EXTA 4YCAA 2WB1F 2WAXA 1GAEO 2P35A 3BB4A 3AU6A 3IUSA 5LDHA 4PSUA 3QTLA 3DLAA 2EBFX 2WJJA 1P7ZA 1BE8A 5EE1A 3GQCA 3FN4A 4N54A 4RNCA 4EDHA 1PNTA 5FR1A 3VCBA 3UWDA 4EQ6A 3QX7A 4TLMB 5B12A 2JFQA 2EZ9A 4A8TA 1ZESA 4TQ9A 2IEDA 5EJIA 3NRBA 1G60A 2E4ZA 4RU9A 4DJ5X 3FDFA 1M1NA 4Q4LA 2HMUA 1RKXA 1XTKA 1DXOA 2DUWA 1LK0A 1U3FA 1TLLA 3ONDA 3V2IA 1XC7A 2NSDA 1C8BA 2P0AA 2Q28A 1AGPA 4OGFA 1LDEA 5J2TA 1EK0A 3GZ4A 4IUBS 1GUZA 4R8KA 1CR6A 1EHCA 2A3VA 2KN7A 1N2HA 4K9PA 5ALVA 1ZMXA 1SEPA 1VSVA 4J3FA 1DKMA 4F06A 1APBA 1WPRA 5DNVA 3SQWA 3GLHA 2ZJ7A 2B9EA 2X15A 3CX6A 4NLZA 1OHHD 1R1DA 4R8SA 5A4AA 1YUNA 3O3NB 2AHOA 1YHYA 2BIFA 1LTHR 4L2IA 3WFJA 2AF3C 4QYMA 3BDVA 4RV9A 4UD2A 3D7LA 1ZC3A 1FDIA 1SKMA 1JDJA 1I7PA 1RJDA 4GVXA 2ZAOA 1JHUA 2ZJ8A 3CONA 1UQUA 2WILA 5IF9A 5EE3A 1EG2A 5KDDA 1GQOA 4D26A 4WCFC 1JI0A 5DTJA 3MFQA 5GGYA 4PLCA 1UJNA 3PW0A 1VGQA 1S0VA 3HJTA 3PPXA 3B3FA 3RVMA 2FPRA 3E0XA 5FWAA 4M0KA 3IIEA 1YNSA 2YY5A 1EDZA 5CNMA 4QZ8A 4DFMA 1SA0A 3N7TA 4TUYA 1M0EA 1E1MA 3LF2A 2VZLA 3A2KA 2GVZC 1AS2A 3K8QA 5GIPE 4D9EA 3L8MA 4U7WA 3FSGD 4DEXA 2PEYA 3OZFA 2M9MA 3LS2A 4CCYA 2FU5C 4Q21A 4BBZA 4FFOA 2A6PA 4US1R 2HJWA 3C8HA 3S81A 1P39A 2IPNA 3CX7A 4MQFB 4LTNA 5DB9A 4IUCS 1HSOA 1GPWB 2QRMA 4O2RA 3GELA 4U8GA 2GZSA 2R8HA 4LZLA 5EWLA 1KI2A 3UG7A 1TB4A 5AI5A 1V5IA 3ICPA 2DFLA 2EJWA 2BQUA 4DW8A 2C2OA 2J48A 5DHUA 3UGQA 2O8EB 2O8CB 1E2UA 4R1SA 3R41A 4NENB 4KMUA 2OCBA 2GZHA 3OCJA 2OM2A 4JLNA 3VR5D 4YP0A 4WKPA 2B1IA 4UDOA 4BJ5A 1F7UA 1N5IA 4P35A 4G97A 4JJGA 4YP5A 2X9QA 4TKVA 1ZKDA 1M9NA 3GEIA 1XDDA 2NTNA 4DIBA 4FR0A 3DDNA 8ICSA 1A04A 1L4HA 3Q8RB 1SVLA 2EWWA 3E4DA 4HX2A 4O0MA 1BNOA 1MO5A 4AXXA 1NI3A 3GIKA 2QSYA 3I64A 3NBXX 2W9MA 2XQGA 2QBYB 1KZGB 5KG2A 5C5JA 4A8HA 4MHVA 3T4EA 1JWLA 2RHFA 4GP7A 1UPHA 1IOVA 1EWRA 3I8SA 2B69A 1CZNA 3DPIA 1GITA 3C4VA 2V97A 3V7WA 5HM8A 2QY9A 4PPQA 4HI0E 2ORWA 3N76A 4I5IA 5SZIA 3ZV3A 1PTJA 1XCBA 2Y8EA 5JQGA 2ASJA 5J2CA 4P33A 3DM5A 3GA0A 1QB8A 2J9RA 3KVYA 2PM8A 5JSYA 4BVJA 1VJTA 1R3UA 3FLEA 3ZCSA 1FJHA 1RJEA 3OQIA 3IMGA 3VC3A 1USWA 3CQ9A 1ZMBA 1I4TD 2BGJA 1G3MA 1YJQA 2H51A 2R5FA 3EG9A 4H6XA 1SB3C 2G17A 1RADA 3AHEA 3FKSD 4MDHA 2WKSA 4YAJA 2KHVA 1HE8B 3G17A 3RUEA 3CZ9A 3GHYA 2O0KA 2FEAA 4IRDA 7GPBA 1EUCB 4QWWA 3HN2A 3V4LA 3CG0A 2C7PA 3RB8A 3AG5A 3RH5A 4KHZA 3QUSA 4E30A 2HHWA 3LUJA 1BPXA 5AKZA 4LV5B 5KYYB 4BFSA 2QRJA 2SKDA 3SC2A 1P81A 3O1LA 1UBGA 4AO8A 1U9JA 1PQUA 4PYNA 1NBMD 3LPAA 3RRNA 3I04A 4QSHA 1SXIA 4KFSA 3F4KA 3FG9A 3V3KA 3VC2A 5EIBD 2I78A 4IBOA 3FUVA 3ND7A 5GV8A 3FJYA 4BKRA 5LB2A 4I50F 4RY0A 4Y6LA 4DG9A 3K4GA 2CVQA 3FD8A 4RIGA 2GDZA 1S77D 2QE7A 1USVA 4OHXA 1ACLA 4YAGA 4F21A 1QLJA 2FY8A 2OHOA 4RVOA 1NURA 4N3GA 1U3TA 1H6AA 5BWNA 1UBJS 1I3KA 1XMPA 1ENZA 1WP4A 2XH8A 4PRYA 4I2JA 2C4KA 3LX8A 1O94A 3FAZA 4W5OA 3GK3A 2Q2WA 1ZVVA 3AJEA 3RBVA 2DFVA 3GLGA 1V4NA 4JFRA 5LXTB 2FN9A 1X66A 3WLEA 4YH1A 3TVDA 3V8BA 1TTTA 5CA1F 3GVHA 5KWSA 1G2IA 4Z6EA 4BPBA 3H5LA 4IQTA 1XKXA 4BGIA 3ISDA 3R23A 1D1SA 3IMKA 3X0DA 4Q01A 4KWEA 1JG2A 2P2GA 2AJDA 3CT6A 1IBMB 5HGJA 3HCDA 4R2LA 1JLKA 4E5DA 1WDTA 2D8AA 2DWQA 4WLNA 1LB2B 3O2QB 5AW2A 1K2WA 1FQKA 5AK3A 2BZ1A 2FPXA 4MSUA 4JBHA 4CMIB 2J6UA 3RRXA 3ICOA 2DR2A 4KTVE 1VSQA 3FLBA 4MRVA 4BKOA 5DYNA 4TRRA 4L02A 3DLBA 4X8OA 4J91A 4TGLA 3E0FA 3T3EA 3QE0A 4TSFA 4TKUB 1NF3A 1WKCA 1D0VA 3O2NA 4MUXA 1E1QD 3PZPA 2R62A 3K0BA 3MRTA 1KAEA 2X2PA 4GX2A 1SIOA 4IUDS 4RJ2A 3NKVA 2Q3BA 4WK2B 1QK5A 4L0MA 2ZS7A 4BWVA 2EKBA 4YHHB 3IUJA 3WGGA 3ZY3A 4V03A 5H4HA 1J1UA 2BN4A 4MZDA 1LJLA 2AGOA 5TMDA 2RC5A 3I9MA 2DM6A 3RQIA 3PR2B 1E69A 2VUHB 3ZLJA 4URXR 5TPWA 4P84A 1GNRA 3TFSA 2ATEA 2Z9CA 3PJRA 1OA1A 2I3ZA 1DJNA 3D5QA 3VPBA 4JLUA 1LNSA 5KZMB 1CJVC 1EVQA 1VYUA 1QKIA 2R2GA 1OVMA 1T3NA 2VYVD 3QELA 4ZI7B 4JLBA 4UHJA 1XNQB 3SE0A 4KN7A 1DRJA 1W5FA 2W2LA 2CCKA 5DHTA 1NBEA 2FLWA 2LPEA 1ZQGA 1P33A 2FRDC 3RS7A 2AXEA 2WPDD 5DVZA 1ZH6A 1FTQA 3BIOA 3U7EB 5K3CA 2GJ8A 4ZYLA 3IDWA 1ULZA 3DFKA 4EFMA 2C1XA 2ZYVX 4Z3OA 2IYUA 4W99A 1T7PA 1FRVA 5JROA 1YE5A 3WLTA 3BVPA 3RVNA 5KYTA 1T0HB 3NVYA 1Q7TA 2P9BA 4QARA 4LF9B 3U1VA 1JHRA 2NGRA 3NV9A 1NVKA 5BP7A 3V8PA 4DBVO 3AEUB 1IVYA 4X7PA 1DOHA 1UFRA 3PB3A 3HSYA 5BYKA 1RCFA 2Q3EA 3K05A 1A9XB 1D6JA 4OB8A 4FCVA 1N6NA 1RZUA 5A9SA 3URMA 3LQKA 2B8TA 2PT7A 1BPDA 3QUAA 4TQRA 3E9CA 4D81A 3FZGA 4WOPA 1QIIA 1QBGA 5JXGA 1KMCA 3TX6A 1TZKA 1FTNA 2V6FA 4IIJA 5KTMA 4FHDA 4P4SB 2BCRA 3G2MA 1TMKA 5E7QA 4PXSA 1GCOA 4DL5A 3F5AA 1U49A 4KGDA 2IJGX 5KMGA 2YWHA 4KDEA 2WPNA 1U0FA 4MYSA 4BZWA 3DT8A 1R7RA 2ONZA 3RGGA 3VPHA 1I94B 3FMIA 1EEHA 3ZIAD 2Z57A 2OQ2A 2W6ZA 3AEVA 4M7PA 4EEKA 1X0XA 4RMJA 2EANA 5FORA 2GN8A 4UMDA 4B3JA 4GBMA 4N0MA 3LOQA 5IRCD 4IJWA 2P9JA 4AS1A 1E1KA 3V6KA 3RIMA 2H4ZA 5D3QA 2ZJ2A 2I65A 5AVUA 3EA4A 1J25A 2Q3MA 4R8LA 5KYVA 3RQSA 2VAMA 1ZEJA 4J9SA 2A5JA 2GPAA 4WOJA 4CU5A 2H17A 3WQHA 4WASA 1U3UA 2ZYGA 1XZLA 4OJ5A 3CPSA 3ZD7A 1UC4B 3UJBA 3DO6A 3W8RA 3RVRA 1JX6A 1MVNA 5PNTA 3EVZA 3LCRA 3DQZA 4AL4A 4LGCA 2DMRA 2GA9A 1X9MA 4M9CA 3PI6A 1WPGA 4LCBA 3L92A 2NO5A 3KU4A 1A0PA 4U7JA 1CR0A 4DR3B 4B6GA 4I4IA 1S96A 2NUTA 2A3RA 4DL4A 4I1IA 2R8YA 4C0QC 4KVZA 5FNVA 4OK3A 2B5OA 1PWXA 2PA0A 2B3TA 2Q5LA 3OKCA 3OJEA 1RYYA 1LBTA 3OIYA 1XZMA 3V8QA 3B6KA 1QONA 3UMSA 3U62A 2LBPA 1VPVA 2QVLA 4TMKA 5DO9A 1GZHB 2E89A 3ZLVA 2IT1A 2QB1A 5D3MB 2JF0A 3S1AB 5NLLA 1NMZA 4UB3A 2VNJA 2YTUA 3SZMA 3AW9A 2A57A 5JAPA 4BQSA 1J1IA 1U9YA 4QELA 1DQZA 4BIMA 1AZTA 2WM8A 3OHSX 4LSZA 5ICCA 1NMQA 5HX7A 2BSQA 3O4IA 3H75A 2VDLB 2ZB3A 4N0DA 2WTNA 4OHWA 3C16C 3J81k 3SC4A 2BTQA 4F12A 3QFTA 1FQJA 3S40A 1ES9A 4A0RA 3TM4A 1C3EA 3RT7A 4AJIA 1YWGO 3DAFA 1BXGA 1KP3A 4A0SA 1NMEA 1QR2A 4M1KA 4Z0TA 4J1TC 3E9NA 4M0DA 3V1LA 3EXHC 1ULSA 2JGRA 1UJ2A 2WIDA 3FPGA 1SWVA 4UAYA 3DOJA 3I2YX 1G8GA 1E2NA 2PFQA 3ETLA 2QYTA 4R5MA 1JMSA 1JIUA 2A1UA 2CL7X 1R0ZA 2BLLA 4IIFA 4ETMA 4MUNA 5IFKA 3Q3VA 3OZAA 4JOCA 3RWMB 2MDTA 4FBUA 2J87A 2NXJA 2IOFA 3M9WA 4MRMA 1VMEA 1I5OA 2JIZD 3GR6A 1Q1BA 3OQJA 1QKJA 3P9YA 4B8ZA 1WOMA 5E9AA 1Z34A 4MVJF 5EZSA 1D2AA 1VKNA 4YRBA 5C1OA 4MI1A 4JASB 4ZARA 1ZVMA 1II8A 2HNKA 4LQLA 3MD0A 3OCXA 2VNHA 1YQDA 2R8JA 1ZXLA 1MOQA 4B6JA 1TCVA 3H4MA 2QA5A 3HSKA 3CG4A 2WTFA 3V3TA 1E6EA 4D4HA 4IGAA 4UBIA 3MINA 3FTNA 4PLPA 4PGHA 4IR9A 4DA6A 3QE2A 4QSMA 5CCDA 4QQKA 3OFVA 2YINC 4CF6A 1V8BA 2QRQA 1E0AA 2GZDA 2ZPAA 3NB0A 5DI3A 1D7AA 1BA2A 2VQFB 3MRVA 3D4NA 3LCUA 3K2QA 1FYXA 3LYHA 4J49A 4U2GA 3WO0A 2B7CA 1PZNA 5JSZB 3GD5A 1OXSC 3WIBA 4RSMA 2ZUCA 4K8OA 1AZLA 3AOEC 1ZQOA 3GZTB 4JJ8A 1KGDA 1WB5A 4WIAA 2AGQA 2Y68A 3G2PA 5TX7A 3A3KA 4MLDA 4I1VA 1BC5A 4MS4A 4MVJP 3EZFA 4Z54A 1DAPA 4AMVA 4HAWA 2X41A 1Y81A 3U7FB 2H0RA 4AF6A 1QHNA 4LY3A 2P30A 4EF4A 3RNOA 3GIMA 2YBEA 4JOSA 2W55A 4LZJA 5M3BA 3WMRA 7ICHA 4CMKA 1E2HA 1QIFA 5LD2B 2R79A 2AJ8A 5M2QA 1BWRA 4UMVA 1ZJWA 1YJ5A 4NY1A 3FGZA 1JDNA 1IEWA 3JATB 4Z53A 1GPMA 1SD2A 2JS7A 4XM0A 5E3JA 2RAPA 3WYGA 1C2TA 1X9XA 3WLIA 1EE9A 4OMUA 2JR5A 4YAUA 1SXJC 3KFVA 1S8NA 4TUYF 1T8YA 3AM3A 4XEUA 3BRCA 4RNNA 2IUUA 2O3UA 5LP6C 5AHRA 3MRXA 2K4PA 3IR5A 5ECWA 1WZEA 2ZJ5A 4D8YA 1AQUA 2NZUG 1DG3A 1KYIA 5HF5A 3LRTA 3OJOA 2BKUA 1EJBA 1BN6A 1TPZA 4H7IA 4QZGA 4F8YA 4XDZA 3ORYA 1SXPA 3CUUA 4XI9A 5T6BA 1CUYA 2PTHA 3IMFA 2G6BA 3EPPA 4UTZA 4C5BA 2MUTA 5GV7A 4EKDA 2AG5A 2HA6A 4P32A 1PL6A 1ECWA 2X5OA 1Q21A 1LS1A 2HMYB 5JQWA 1SCKA 2M1XA 5LWQA 4QZHA 4FYMA 5BNIA 1EM8B 4QOHA 1XA3A 4M0PA 3A6JA 3B53X 4QZIA 2OSBA 1M8KA 1U4OA 5KTTA 1C1HA 4YQZA 1M33A 4XRRA 4B82A 1TVMA 1GUYA 3H7AA 4RHYA 1L5UA 3R4CA 4PQYA 4EB6B 5JW6A 1BS1A 1E79A 1HKUA 4FC7A 5CDGA 3H1TA 1ZX1A 1NTRA 3L7YA 5FWXB 4IFTA 4K9SA 1E7RA 3ENQA 3UBMA 4ECYA 1RKQA 5K8CA 1BZYA 1NVUQ 4YJGA 3V97A 7AT1A 5FT9A 4OO1J 3HVRA 1OIXA 5C81A 1YCGA 3ZXYA 1Z5UA 3GXOA 3C1ZA 1JEOA 3E23A 5J4YA 3UFXB 4U6PA 1SN7A 5JI3E 4FFWA 1P2GA 1B0AA 2IIBA 3BCUA 3S0JA 3N8HA 1I4LD 3UN1A 3A2MA 2FEKA 3GZFA 1BYIA 1LI7A 2W9CA 3OJCA 2WUGA 1FNNA 1DC7A 4UB8U 3B9QA 4KXVA 1IB6A 2E21A 5I9LA 3AVWA 1CX9B 3VHRA 4EHIA 1EWYA 3PMLA 1Q92A 4U2CA 3B5EA 3KKOA 3KEGA 2UZIR 2H7XA 2WVHA 3TW8B 1FO4A 2V7WA 3ZWYA 4RTLA 5EQTA 2NV3A 2D5CA 1JFFA 2WWFA 9ICTA 3GEGA 4HQOA 3PRKE 2Z4TA 3GWZA 3D2CA 3U60B 5FEUA 4PZ9A 5K0BA 3OEYA 1QX3A 2UYYA 2OGTA 3B7PA 1K66A 2LM1A 1SC9A 2W6NA 5KVAA 5HKLA 1R74A 1YO6A 4IL6U 4MUBA 4NKRA 1NQ5A 4LFAB 5IKOA 4KQEA 3MW8A 2R11A 4HUJA 4DLVA 3PU6A 1L8OA 2BBOA 4CT5A 4OP2A 2D7JA 2YJNA 4BNHA 3BXOA 3NM6B 1XTUA 3DOHA 4WKOA 4H3SA 4MHOA 4DSOA 3BHMA 4Q37A 4AJ1A 4C4AA 1GG9A 1OILA 3ZV6A 2A78A 2O6LA 1FNBA 3N7RC 3V9PA 2BP7A 2B4KA 10MHA 3B2QA 4HZGA 1E9AA 4EF5A 3R5FA 3ICQB 4P4LA 2KHZA 3PQDA 2CK3A 1UKVY 5BN5B 2I6QA 3U4IA 4RKWA 3K0EA 1JZQA 1HDOA 1OLSB 2DFDA 2TRSB 5AKIA 2CNOA 2AW3A 1QOQB 3K2IA 4NZMA 5J59A 4C7ZA 4P7GA 2RHCA 1NZDA 1RWOA 3R6WA 1QP0A 5U1PA 3ZNPA 3NIWA 4CPDA 2YMMA 5IAJA 3UJHA 3CZ5A 1F3OA 3J81A 3HEBA 3OJFA 1IAQA 4A26A 3WLKX 1V35A 2BZSA 2R0QC 2JFPA 1NM5A 4B9NA 1X1SA 1XZPA 3RR8A 3GRCA 4CE6A 1WZNA 3W4KA 4BMCA 1E5XA 1D6NA 3WC4A 2EHDA 4OP3A 1YZ6A 4B83A 3A3OA 1KMQA 5I4CA 3MGGA 3M5WA 2R48A 1XYVA 2AA3A 5IJAA 2HV8A 4TXJA 1M6EX 5KYGA 1LEHA 3BWXA 1U7DA 5KYUA 5KIAA 3RLIA 2O3TA 1SURA 2ISSD 3USCS 2CJWA 4PR3A 1R2QA 1QE5A 3QVWA 4MRSA 4HSEA 1HDIA 5DGBA 1E2BA 4WEQA 5K0SA 1S2GA 1SULA 4UE2A 3T0IA 1XC9A 2D0DA 1H4QA 3NGLA 1YZTA 3IHTA 3JPTA 1UEIA 3KJEA 3F8TA 3WSWA 2XITA 4WTOA 3TPZA 2O9JA 2VAWA 4NXMB 2GO7A 3DLPX 4OHZA 1Y4DE 3T7CA 4OQDA 4O25A 5K0ZA 4UEQA 5JJLA 1IFXA 4KLRA 1YRLA 2ZDHA 4OXRA 4DM7A 3P97A 3UQ2A 2QYHA 1UWVA 3GQBA 1T91A 4J07A 4RTSA 3R0VA 2O8BA 3D2QA 2FRVA 4HGQA 1EPUA 1QGUA 4PIPA 2WTUA 2G04A 4CBVA 1LDGA 4RANA 2XDYA 2FUNB 3EIQA 3ANSA 3RRBA 5FUMA 1TYBE 2VS1A 2PUGA 1MABA 3TMKA 4V0OA 4KBGA 5HS4A 3UB4A 2ZBEA 3NT4A 4IV0A 3QQ5A 4LHSA 4E32A 3QVOA 3UCEA 4D5EA 1IUPA 3C7AA 3LM8A 3O0FA 5EI5A 4XDHA 1QNLA 3W1EA 4YR3A 2UZ1A 4JV5B 4Z4FA 5TQ0B 2AR7A 2W6PA 3EMKA 1PUXA 4WEOA 3U1BA 4YLYA 1KMMA 1TIBA 1RC1A 5K8IA 2Y1EA 1K7SN 3DKIA 5DDMA 2Y92A 2JGJA 1J21A 3TNYA 1DC4A 2XSZA 3UMGA 2EQBA 2EJVA 1UC9A 4MV8A 4FDVA 3RJEA 2KYRA 3O91A 2GK4A 4DV5B 3THYB 4FHEA 4RBNA 1HNWB 5ALMA 3N6VA 4LWZA 1PR4A 4DMLA 4IGEA 4D74A 5DJ5A 4RF3A 1U5AA 4ZP1A 2I3AA 1ISFA 1NQTA 2JHAA 4FDMA 1Z12A 1Z16A 3JWJA 2ZE8A 4BUCA 3A1FA 2V0NA 1O0SA 3D5TA 4I50A 3GYBA 3CVYA 3IVCA 5T7BA 1QK4A 1DGSA 4LEIA 2AE2A 5DEIA 3UT5A 3PHIA 3IAS6 3BTSA 2ZTCA 4ND8B 4XVCA 4ZIRA 4F8RA 4H3HB 4B44A 2OHJA 4WN9B 3SR4A 2W3SA 4I6EA 5JASA 1Z00B 5CBPA 1IIPA 2KW5A 1A7AA 3H11B 3N6RA 1QIMA 1PGOA 3UUEA 3COZA 4FLFA 3QVUA 4I8DA 2FMFA 1L6IA 1P1HA 3G02A 1W4BA 4II3A 2FW8A 3LLMA 1NVGA 1ZM4A 5EXSA 3VMMA 1Y4UA 1GKYA 7ADHA 5CA1A 4KLLA 5K6RA 5CLQA 5HDQA 5G0SA 2CE7A 5C8ZA 1P0FA 2I76A 2X8JB 2LPMA 4KEAA 4BO6A 3TIGA 1V7ZA 1IHXA 5ALTA 3RYHB 2XUGA 1Z18A 2ZZKA 4OLAA 4E3ZA 4YRRA 5CFQA 2ZTUA 3TKLA 4LY9A 2IP4A 1ZWLA 2H4WA 2GPYA 1M7HA 4I9UA 1Q44A 1CIVA 3S2EA 4C06A 2HBZA 1VJGA 3ZHZA 1BW9A 3ZW9A 5CXXA 4LJLA 3OAAD 1PUZA 1E61A 4MMZB 5J43A 2Z8YA 4BGEA 4XEHA 2BR4A 5EEHA 5TVGA 2C96A 4G1CA 1U4NA 2HJ9A 3GRUA 2HC9A 4Q4AA 1PR2A 2XNDD 2JJ1A 5BV2P 1R0WA 1NA5A 2DUUA 4NZ9A 1JN3A 9ICIA 4F45A 4RD6A 4F3TA 5CIQA 3IVRA 1G1MA 1G66A 1EFAA 1GKKA 3TRDA 2GFQA 3PVZA 5T4HA 3RC9A 4GLFA 1ZEMA 4LF8B 1CS4C 5GMOA 4GMDA 3LTEA 4C87A 2GWRA 4Z51A 1TQ6A 2VCYA 1PTKA 1TNDA 4YREA 5HNKA 4F5PA 4F4ZA 3FRIA 1TKCA 2OHIA 1TZMA 4G8CA 2W43A 5D6OA 4M1MA 3O7MA 5KNCH 4HVCA 4WOKA 2C5AA 5EE9A 5KT7A 5E1OA 4C2BA 2GN0A 2O7NA 1N48A 3KZCA 2JASA 2JDID 1JSZA 1KE1A 3QM1A 1E1LA 2EYUA 3P0JA 2QRNA 4EKNB 3ZBUA 2EGGA 4YJDA 2GEDA 4EZ6A 2B92A 4UU7A 3KC2A 4E5PA 3PDJA 3RU9A 4EY3A 2PJZA 1XO1A 1SXDA 2I8AA 3RU7A 3ENNA 2C2KA 2EAPA 2FFRA 3UH0A 2XC9A 5K01A 2KICA 3SC6A 1KDHA 3ZW7A 1XL0A 5EFOA 1U99A 1ODKA 5A5FA 1U9LA 4I9NA 4IF6A 2CZCA 2Q3HA 3FFAA 4YGYA 1Z63A 3AVOA 4XQCA 4FYYA 5LYJA 2PKWA 3NU1A 2ZTDA 3EPLA 1C41A 2YIJA 3A26A 5FHQA 1Z1VA 1SJ9A 4ISCA 3PXBA 4BAZA 3QLEA 1DKLA 2J3EA 5CH3A 3FFWA 3SHTA 1VE1A 3VR3A 1ZOOA 1DAHA 4RVGA 2P79A 2OG2A 2E3TA 4N65A 1VHDA 3MTJA 3ROQA 2GJKA 5KG5A 2HO4A 5L1MA 3D3WB 2A19A 1Y5NA 3TQIA 4EPTA 4LG1A 2EV9A 2RLTA 2FPMA 2RG7A 3FHJA 3Q9LA 4GOOD 1C9EA 3SQNA 4QZEA 2NW6A 2CWDA 4S1TA 2WINI 2IZ7A 1M73E 2DPIA 2II6A 3O74A 5K9ZA 3HGTA 3PC4A 4US0R 3WIEA 3SS9X 4I4CA 3DZFA 1FMJA 3PXAA 1A5TA 4IMRA 2HQOA 1MX9A 3VKHA 3MJDA 2JZBA 1X9HA 2ZRDA 3KFXA 4L75A 2Q62A 1VC2A 2JPDA 4AYBC 5A1JA 3TXXA 3N39C 2DCMA 5DW0A 2NPFA 4BIIA 4L5YA 5IINA 3GDHA 4M9JA 1N2SA 5I7OA 1NRXA 1L3TA 3RK4A 1TCBA 1DO2A 3EH1A 2CLIB 1KTIA 4H3KB 1P2VA 3C3CA 3QITA 1E9SA 3F67A 3LDAA 2GX6A 4XIIA 1OBVA 1X7YB 2JLZA 2OGZA 2NYAA 4ON9A 3AVUA 3WB0A 3TL6A 2YHSA 3ZBPA 5TEWA 5IN5A 4K87A 3EBOA 2D3TA 5L40A 4IJ6A 4EVRA 1R5JA 4IC9A 4QULA 5F12A 3PEEA 4LISA 5JC1A 3GA7A 4PG7A 1NW6A 4CUZA 1Q0QA 3DVRX 3ZHTA 5FOWA 4PC2A 3DXFA 1ORDA 3VNQA 4C0ZA 3HJNA 2ACWA 1SG0A 2ZS9A 3L7MA 3LXRA 3K5WA 1J8DA 4TZKA 3EIXA 4NMMA 1E96A 2P4QA 4TRJA 2WF7A 3T9BA 2IYAA 2QSZA 4D9BA 1OWNA 5TS3A 2F1JA 4DF3A 3P2JA 3T34A 5K20A 3NTUA 3SENA 3TAPA 5GVRA 4RHCA 4Q4CA 4QW9A 4RQ1A 1CRQA 1L5QA 2RH9B 2BGKA 4PV7A 4B3MB 1TKBA 3DE3X 3S4YA 1YRHA 4DCGA 3WKDA 4BN5A 3KJNA 3X2EA 4GKVA 4IQ8A 3RC7A 1FC0A 3MCAA 5DI9A 2EJCA 4J1SA 3STVA 3W1WA 2R1VB 4GYKA 3VZDA 5T8KC 4DIEA 2KNJA 1P19A 2NV0A 4QNMA 2PGIA 3F49S 1TEHA 4J75A 3QRWA 2OORC 1W19A 1CE8B 3GGGA 4GT1A 1VLQA 3P9NA 5JAOA 4HATA 3OESA 4I08A 1U0HC 2CHUA 4X1OA 3ZWKA 2Q4RA 5BW5A 4CM7A 1LBIA 4ZQGA 4FS3A 2J3KA 3W6UA 1H8HD 1D2MA 2ZYRA 3UJ7A 1OXMA 3HI4A 1DJOA 4PJ0U 3EZ5A 1YT5A 4W1SA 1KJNA 221PA 4INAA 4CQMA 1DMRA 4R7ZA 4HEJA 1IN4A 8OHMA 2XXJA 4FOSA 5FFMA 4FFRA 3WHLA 1XU9A 3ZLBA 4CW7A 5TPZD 4AP5A 2OXRA 3RJGA 7ICGA 4FFVA 1P0MA 2ZIUA 3ZZTA 2J6HA 2DPYA 5GIOE 4ED1A 4K9MA 4CM4B 2QW1A 3GUZA 3M8SA 1GCIA 1PX0A 4JVSB 2R4QA 2Q3DA 3WICA 3PNSA 4IM7A 3GYGA 1CLUA 4AIRA 3QUQA 2C9OA 1ZD2P 4JVNA 1Z75A 5IC4A 2GHTA 3MWDA 4AKTA 1LB1B 3AUUA 4HLDA 4D1YA 2VANA 2JVIA 4MVJA 2XUJA 1NJWA 1NNUA 2K8AA 2ZWVA 4G8DA 2IP1A 1QH1B 3RYFB 3MGKA 1Q20A 4HQ0A 4WZAB 4D99A 1M6YA 3IRUA 4IZHA 2C42A 3SM3A 4PYIA 3R9XA 4EG4A 2V6JA 1PK1B 1AKQA 1WL8A 3E5NA 4PLZA 1AO3A 3EEFA 2HLNA 3KZNA 2KS6A 1AF4A 3T12A 4J0EA 3RYTC 3AVQA 2L18A 3EVFA 1IM4A 4UNQA 1KK2A 4RA9B 1VTKA 3EWNA 1HT2E 3EXAA 2G4CA 5CH5A 3D43A 3HWWA 4C04A 4URZR 4DQ0A 1NNSA 4PQFA 5HZMA 3MXTA 1IVSA 4GKBA 9GPBA 1M10A 3QU2A 3F5DA 4TZ6A 1FFDA 3JQBC 4ZPXA 5J2KA 2P2CA 3A6PC 1JECA 3DTTA 3NWBA 1PNRA 3AR7A 3R40A 2FI1A 4HGNA 3MQFA 3ONEA 3H83A 4IHJB 4NFYA 3E84A 3K70B 4OHBA 5JDIA 4PC7A 4PQRA 1T5IA 4O8CA 9ICKA 4O2AF 2PMEA 3I5XA 4KL8S 3JQ7B 3SPXA 4KVGA 4R2HA 4EKGA 3JQGA 4G2TA 3R2JA 3OZTA 1ZH8A 1NK9A 2QTVB 3ZDXB 1GZ7A 1DAMA 2XODA 4G0UA 3BJEA 2BMVA 4GRIA 2BSXA 4TL6A 3QU7A 3T9DA 2JI7A 3NLLA 3THXA 2LGJA 1ZQPA 3FSEA 4QYIA 3A05A 5DX1A 3PE6A 2EVWX 3HT3A 3MIIA 4WXEA 1O9BA 2B8NA 4P5EA 3JD1A 1QQBA 5H70A 1M34A 5CDUA 2PSEA 1B73A 3PWZA 2UUCB 1FDUA 1E9DA 2KBFA 2C4MA 5AIAA 4XUEA 5BSHA 3K9QO 2QUJA 1TQ8A 3SX2A 3QG1A 4JP1A 5BQ3A 5JAIA 4PNZA 3RTBA 4JJAA 3DOOA 5IAAA 4AULA 3E70C 4BMOB 1R16A 2D1SA 4MV0A 2OTCA 1AXRA 2K2QB 5HKAA 5ETJA 5JY6A 3GRYA 3SE7A 1E4EA 1OJLA 1ZK4A 5F5XA 1IVNA 1EX9A 2BELA 5KTRA 3QSGA 4CTOA 2CV0A 3QLJA 3PUVA 1CJSA 2A9VA 4OREX 2NUAB 3W8FA 4QGFA 5DXFA