3ZI4A

The structure of beta-phosphoglucomutase inhibited with glucose-6-phosphate and scandium tetrafluoride
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
218
structure length
218
Chain Sequence
MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-PHOSPHOGLUCOMUTASE
publication title Metal Fluorides: Multi-Functional Tools for the Study of Phosphoryl Transfer Enzymes
rcsb
source organism Lactococcus lactis
molecule tags Isomerase
total genus 76
structure length 218
sequence length 218
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2013-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3zi4A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3zi4A01
5ALXA 2HDOA 5AM4A 2IOFK 2Q4RA 1SWVA 2G08A 5AM1A 2I7DA 3DAOA 4UU0A 3L0BA 1RLMA 4L6CA 5AKHA 1TJ5A 5AVVA 1YJ5A 2G06A 2YJ6A 2HOQA 5AI5A 4QQFA 4FFDA 4XPZA 3U7FB 3J7TA 3IB6A 4JDPA 1ZOLA 5AKYA 3UM9A 2ODAA 3K1ZA 3AR4A 5AKZA 5AW5A 5ALNA 4Y2TA 1ZS9A 3NALA 3QYPA 5ALDA 3KBBA 2HHLA 5AM2A 4UMEA 2FUCA 4HGQA 3MC1A 1L7OA 3I28A 1Z4MA 2YBDA 4EX7A 3ZI4A 5AK4A 2HO4A 1ZD5A 4EZEA 2OBBA 4YGYA 1NNLA 1TJ3A 4YIKA 2R8ZA 5AVQA 1WZCA 4BYGA 1F5SA 3WKDA 4UMDA 3KDPA 2X4DA 2GHQA 1RRCA 5AVYA 3ONNA 3QNMA 2WF5A 2R8XA 3ED5A 4G63A 4XOUA 3QU7A 3QGMA 2G1AA 3L8HA 1KYTA 1VJRA 4GXTA 3NAMA 1Z4IA 3QUQA 4I9FA 4UM7A 3QUBA 2NYVA 2Q5EA 2YJ5A 4BNDA 1Z4NA 1L7NA 1TA0A 2FPWA 4DWOA 3D6JA 3UMCA 3MN1A 3BA6A 1ZJJA 3P96A 2C9MA 3ZWDA 4NABA 4F72A 3KZXA 5AI9A 1U7PA 2JAUA 3SKXA 2P69A 3WK5A 2R8EA 3W5BA 3L7YA 2FPRA 5IS2A 3IJ5A 5AK3A 2CN1A 1O03A 5AVWA 3FM9A 4CF3A 4B6JA 2B0CA 3AR5A 2YMPA 2O9JA 2OA0A 2EARA 4BX0A 5AW3A 3HLTA 2P9JA 3I76A 4XE5A 5AW7A 1O08A 1L8OA 1RKVA 2YJ3A 4YIHA 3A3YA 1RDFA 2CFRA 3DDHA 3DNPA 2IYEA 2RAVA 2W4MA 3WK9A 4YH1A 2IOFA 3SHQA 5ALUA 5ALMA 1U2SA 5AW1A 2AMYA 1Z4OA 5A3SA 2GMWA 2GFHA 4HGRA 1Z88A 1LTQA 4BEWA 3E58A 1PW5A 1VFPA 4Y2VA 5ALLA 2OYCA 3UMBA 2RB5A 4Y2SA 4J2TA 3N07A 3SLRA 2YMQA 1X42A 2FDRA 2WF7A 1QQ6A 3WK6A 2ZOSA 4EELA 1ZD4A 2HSZA 3R09A 4KX5A 5E0OA 3R4CA 5AI8A 2ZBFA 4UAVA 1L8LA 1EK1A 5AM0A 1VJ5A 5ALWA 1Y8AA 2RBKA 3NUQA 4HGNA 3PDWA 3QU5A 2B82A 2CFTA 2C8KA 3AR6A 3A1DA 3R9KA 4Y2XA 2HX1A 4UARA 3E8MA 4OHFA 4C4RA 5AI6A 5JJBA 1YV9A 4DW8A 1WR8A 3AR9A 4NFLA 1RKQA 4O8CA 4Y2YA 2P27A 4Y2UA 4KNVA 3VAYA 4KN8A 1T5TA 3ESRA 2W43A 1MH9A 4CNQA 1RLOA 4AP9A 3KOOA 3NIWA 4H1WA 3B8EA 1JUDA 1TE2A 3L8FA 1J8DA 4HYTA 3I1YA 4CE6A 3ZX5A 3AR7A 3EF0A 4E88A 2YMLA 1Q91A 3RFUA 3W5CA 2JAOA 2NO4A 2HF2A 3KD3A 4C4TA 5A3RA 3IRUA 3OCXA 5AW2A 2ZXEA 3WKEA 1J97A 3OTQA 2OM6A 3ZUPA 3L0CA 2CFSA 3WK4A 1L7PA 3L8GA 4AS3A 5ALFA 3ZVMA 4AS2A 3U7EB 3HYCA 3QX7A 4NWIA 4XQ0A 2MU2A 4Y2QA 1ZRMA 4BEVA 3SKYA 1Z5GA 1QQ7A 2HI0A 2WF8A 4ZEVA 5AKGA 2I55A 4BKMA 2I33A 3A1EA 4RESA 4BBJA 5AW0A 5AVUA 1Z5UA 2I34A 3N1UA 2BDUA 3OCVA 4UASA 4NV0A 1U7OA 3B9RA 1RMYA 2NO5A 1EK2A 2BDEA 3W5AA 5AKJA 4BX2A 2G07A 1CQZA 5AVTA 3RF6A 4L6AA 2WFAA 3MPOA 4BNDB 3UMGA 2VKQA 3ET5A 4YCLA 3ZWKA 2ZG6A 5ALEA 3WK8A 3ZTWA 1N8NA 3E84A 2PKEA 4FYPA 3AR2A 4QJBA 2D2VA 2FEAA 3N28A 3NASA 4EX6A 2WF9A 1TJ4A 1RKUA 2BY4A 4HGPA 5ALVA 4DCCA 2ZBDA 5AESA 3SF0A 2YN4A 1T9ZA 3I6BA 3OCWA 3OPXA 3ZX4A 5AKIA 2B1RA 3AR3A 3ZTYA 1Q92A 4L57A 4UAUA 2JAWA 3ZVNA 2MSNA 3NRJA 2G09A 2HEGA 1L7MA 1RMQA 1T5SA 2RARA 3WGVA 5ALZA 4PNHA 2O2XA 5ALSA 3OCUA 2IA5A 3OCYA 4HAIA 4HGOA 3L1UA 4Y2PA 2PR7A 1L6RA 3QUTA 1YS9A 5ALKA 5ALQA 5ALTA 2WF6A 3OCZA 4UMVA 3FPSA 4IFTA 3N8GA 5ALRA 3WGUA 1XP5A 5AKXA 3ESQA 3ZW7A 5A3QA 4DFDA 1RMTA 4ZEXA 5AM5A 2W11A 4YCMA 2QLTA 1ZRNA 1SU4A 4UU1A 5AM3A 3EF1A 3QXGA 1RQLA 1Z4JA 4UM5A 1N9KA 1RC8A 2JARA 4OFZA 1Z4PX 4KNWA 3QUCA 3FZQA 3GYGA 3PGVA 5T41A 1ZD3A 1S2OA 2WM8A 3M9LA 2B30A 3WKBA 3ZVLA 5AIBA 2EATA 2B8JA 1SWWA 5AICA 1CR6A 5ALPA 4EEKA 5AK5A 2AUTA 3QLEA 1QH9A 3M1YA 3WKCA 5ALGA 4NAVA 2G80A 3L5KA 1Z4LA 3QU4A 4G9BA 3U7GA 3PGLA 2WHEA 1QQ5A 5AIAA 3WKAA 1QYIA 4RETA 2ZBEA 3EWIA 2C4NA 5ALJA 4UMFA 3SMVA 2FPXA 4ZEWA 1AQ6A 1FEZA 1WPGA 4UATA 1U2TA 5AVRA 4Y2JA 2B1QA 4IG4A 5ALHA 4J03A 1NRWA 2QYHA 3CZ4A 1RQNA 5AI4A 3N5KA 3NANA 5ALYA 4GIBA 2YMMA 3QU2A 4OD0A 3CNHA 3S6JA 2Q4TA 2ZBGA 2B8EA 2I54A 2FPSA 3ET4A 5ALOA 1S8OA 3L8EA 3EPRA 5AVXA 3E81A 3WK7A 3FVVA 2MU1A 1ZD2P 2IOHA 2JGAA 2YFYA 3L1VA 4UW9A 1YDFA 5AVSA 1NF2A 3A1CA 4FE3A 1Z4QA 5IT4A 2R8YA 1LVHA 5AHXA 2DQSA 3U19A 5AVZA 2FPUA 3L0YA 4BX3A 5ALIA 1U02A 4I9GA 3B9BA 2EAUA 4Y2RA 2HCFA 5AW9A 3U7HB 1Z4KA 2P11A 5AK6A 5AKEA 4OCZA 4MUMA 1XVIA 1WVIA 3FGOA 5AW6A 3QU9A 2AGVA 2HF7A 3BWVA 5AW8A 2FI1A 2G0AA 4YCNA 4MWOA 3FPBA 2GO7A 3SD7A 2PQ0A 5FP0A 3ZU6A 5AKKA 1IWOA 5AI0A 4CF4A 1YNSA 3PCTA 3U13A 3F9RA 4KX3A 1XPJA 4C4SA 2AH5A 3W5DA 2YY6A 2GHTA 1K1EA 4EENA 1RLTA 4KYTA 1YMQA 2C88A 4CF5A 2C8LA 3TLMA 3AR8A 4Y3UA 4JB3A 3U26A 2YJ4A 3KC2A 2I6XA 1RPZA 5AW4A 3MMZA 4F71A 5AKLA 2FUEA 3DV9A 5IT0A
chains in the Genus database with same CATH superfamily
1XHFA 3RF9A 1U0LA 4R64A 4OMDA 3TQOA 5LZ9A 5ERYA 2JZBB 5DX8A 4CUZA 4KN5A 3H5NA 4KZPA 5TF0A 1UP7A 1BPXA 1QF6A 2GNOA 1D7OA 3SBXA 3NTRA 4WZAA 3LQKA 2K2WA 3HDVA 4E70A 3U80A 2OBLA 3OHBA 3TSWA 4NQRA 5E4YA 4JBYA 3VHXA 1RI1A 3DKPA 5IHXA 3TGLA 5SYAA 1P60A 4DR5B 3DT8A 1OFVA 2C2ZA 2FEWB 5B3KA 4C8LA 1QM5A 2ZYDA 4UVGA 3UAGA 3GQVA 3R3UA 2A0FA 5HJ7A 1ZJJA 2B25A 3UPDA 2EZ8A 3WK5A 2KMDA 3OZUA 1JFTA 3B70A 3L9WA 5CVDA 1JBQA 4NMLA 1SVSA 3OLQA 1LC3A 4KDCA 3NQ41 3BBLA 2CNBA 3MFIA 3VI4B 3FOBA 3LGAA 3KZOA 2R7NA 3PHLA 5BRJA 1WCV1 2EKPA 1A2BA 1NLMA 1E58A 5HHTA 5IAOA 2YBEA 1W0CA 4X0EA 2I1VB 4WBXC 4CLRA 3UC5A 3AESA 1L4UA 1OWPA 2RBKA 5HWSA 4F4XA 4XRHA 3RRYA 3WNDA 1SD2A 1GU0A 2HMAA 4B4WA 4NVRA 1GPDG 5CDTA 5D51S 1L4EA 3SYKA 3GRVA 3WADA 2TECE 3ECCA 2GOLA 1NJ6A 4DEXA 2GZMA 2YXDA 2DULA 4MVJP 3VSBA 3QLVA 1AZSC 5KSWB 1WV0A 3UCEA 2F6RA 5ITSA 4H7PA 1E6LA 5FULA 2AJLI 1JXEA 4ND8A 1YZYA 1B0XA 1E2DA 1BGXT 1XZEA 3C6ZA 4ZMRA 2NSDA 3FDZA 4AMBA 3LY5A 3U6BA 1EH5A 3AQEA 4YDHB 2XRFA 2NO5A 1QLJA 1FYEA 1D5WA 1GEGA 2ZJOA 4EY6A 4OHXA 4BWGA 1JEQB 3HKEB 4HAUA 5KFIA 1G3QA 3TAXA 4PWZA 2VNAA 1YIDA 5C8YA 2GM9A 2WB2A 5TPWB 3P2MA 2HHCA 1PWHA 5C52B 1TUEA 3ZHUA 2WMOB 2PVPA 3ENQA 1LDYA 3G0DA 1CDZA 2PQMA 2ZIUA 3U4QB 1NR5A 1IUOA 1GU1A 1KNQA 2WT8A 5HS4A 3E0FA 3AZOA 5ADVA 3VNUA 2WM9B 2VS1A 3IV7A 3FAZA 4XD2A 5AM5A 1XDUA 4ZQCB 1PV4A 4ZOHC 4NH4A 4ICAA 4I4TB 3W3AD 4UDNA 2WUEA 2O05A 1S2OA 2F00A 1IZZA 2KBFA 4JFRA 4A8JC 1V6SA 1SVKA 4DDHA 3ORSA 3FLBA 2OSBA 1J24A 4G0UA 2CLFB 3M1YA 3AUTA 3CRW1 4ZT4A 4B4KA 1F51E 1GA1A 3OOHA 4P7GA 4OJ6A 4N7BA 4OOFA 4E4TA 1JLHA 5EEGA 3I01A 2Y1KA 3DCNA 1ILWA 4I8DA 2IZ6A 2WABA 2QMHA 3QVMA 1H9CA 1PKEA 1I3OA 9ICEA 2XICA 2WPNA 2AC2A 3EDMA 1A2QA 4QO7A 2NRVA 2OXFA 1UDAA 4RZQA 1W6UA 3T9CA 1PTJA 1BN6A 4QHTA 3HJFA 5TR9A 5AQ1A 3DB2A 5K8LA 4BLOA 2UVRA 1KI9A 5MFZA 4D4KA 3T6KA 2P9FA 4G5YA 3PNLA 2HLDD 2WWRA 2VPXA 1D0SA 5FBKA 3MMXA 4EG7A 3UHPA 3PSPA 3L8YA 3GLFB 3TFSA 3AU2A 1P4GA 3QVLA 2A0KA 4GRDA 3GPCA 4GSKA 3PFGA 2CMKA 3RIHA 5AKLA 1ZLXA 5AH0A 3GUCA 5JAZA 5JD5A 2G08A 3KT8A 5IZCA 3QFHA 1FJXA 3P0RA 5F2EA 2A9QA 4A26A 3Q8KA 5JLAA 1UMCB 1XWIA 3TOXA 3ZZTA 3D4OA 1U98A 1RABA 2OCGA 2R4QA 1R50A 1DP4A 4LVUA 1R2QA 1X1AA 3IKLA 5F1YA 4KWHA 1RPLA 1T8RA 2BFAA 3QU7A 4MWGA 4R9VA 3L84A 5LP6B 1E79D 3TOVA 1PJQA 5J2HA 5I7VA 4Z9YA 1N7HA 1QU3A 4F72A 1G2QA 2CC2A 2OQ2A 4JZKA 3QKSA 3SKXA 2QRKA 1NNEA 2ZJ5A 1J8FA 2BJHA 4FZNA 4YROA 3ANSA 4Q37A 4EJSB 2XGQA 3EYAA 1O5IA 1HLFA 2A4KA 3WNCA 4YT2A 3DP9A 4D9NA 3QW4B 2HLHA 2IIBA 5BQFA 1EP9A 1IN7A 2BPFA 4WZAE 3T79A 1MV5A 1UQUA 4ME6A 3T7KA 1EEHA 4Z0TA 2JXJA 3RTCA 2MSLA 4H1VA 4FUTA 3A4YA 4HNGA 2X13A 4I5EA 3F8SA 3STXA 2JKZA 2VAWA 3D1LA 1BW9A 2O5RA 3G2JA 4E1AA 3K2QA 1P7VA 7ICHA 1NXVA 3LX6A 1C7FA 5JHHB 4AB1A 3ZCPA 3HFRA 3GP3A 1YVDA 2DT5A 4NBUA 3O03A 2P0YA 1GPUA 5AW2A 1OH6A 1F6BA 2G9RA 1ODKA 3X1ZA 1CYDA 3T4PA 5KO2A 4KPFC 2X42A 2ALZA 1TKAA 1EE2A 4CHTA 2A9VA 3A04A 3QH4A 8ICIA 4FYYA 4HLQB 2WA2A 2OQIA 4E08A 3HYRA 1ECGA 1MCZA 2SCUB 2FU5C 1RQ7A 2BZSA 4BNKA 1HLDA 3WWYA 4N5LA 1CEYA 3ROQA 4OUDA 3QUAA 2A1TR 2A3NA 2G04A 1P9WA 1XVVA 1XZHA 1OWNA 1E4YA 1GTSA 1G8FA 4MHSA 2HU7A 5EUQB 3I0MA 5CLIA 1LQTA 2OCBA 4RUCA 5KWSA 2NO0A 2BGKA 1JH8A 5JSHA 5E6UA 3B82A 4C22A 4F6CA 3WC4A 4PNHA 3LKVA 3OCUA 1BE6A 3UPUA 5CB4B 2CYCA 3H8WA 3CJQA 1UJNA 2EJVA 3PDIB 4AJ2A 2UZ1B 4QXPA 3G0CA 2ZUFA 1GUZA 1II8A 2QU7A 1MW8X 3ZIAA 5I9NA 3B20A 1IQPA 1RE0A 3WQQA 2L18A 4GS5A 3FCYA 5KU1A 3FPEA 1YZNA 4H4EA 2G80A 4UCFA 1E2QA 4MVJG 1MVOA 1J0CA 1T25A 4G4SO 2H0QA 1OBVA 1AQ6A 1QIFA 4F5WA 4ZN6A 2DT8A 2HU5A 5FOUA 4X66B 5KTOA 4M4SA 3IVMA 4WZBB 5CVUA 1ADBA 2Q29A 3MOGA 4FIZA 1ENPA 2J1LA 3LWNA 3OX3A 5EHNA 3HXLA 3AI1A 1A0PA 4QHYA 3VPHA 4BO3A 2A88A 5EFOA 3RYIB 1XZJA 1QCDA 3HVUA 5K3BA 1YDHA 1SC6A 4XB6B 1XRPA 4ZHSA 2FJUA 5IIIA 3Q9LA 2GVZC 3KYCA 3FXAA 3S99A 4GH5A 3PA6A 4PTYA 1KC3A 3FYDA 5F3XB 3ZD8A 2G5HB 3EQ8A 1DDGA 2PX3A 4JEHA 4BZQA 3A7DA 2XVAA 3BYZA 1WZNA 5FUXA 4NCKA 5HPYB 1G5RA 8ICPA 1G21B 1BPYA 1FS6A 2LZ0A 5LLSA 3AFIA 5LWHA 3T34A 1SWVA 1XMPA 5CIQA 1ST3A 1FDIA 2FMHA 1NDQA 2PU5A 3HDYA 1NJZA 1N9GB 1RWMA 9ATCA 3MC1A 2NV6A 3S8EA 2M98A 4CKBB 1E94E 3VV2A 3UT5B 4NBNA 1EK6A 2YWRA 4DQDA 4BAUA 5DNCA 4R7ZA 3KDPA 2ODGA 1VIAA 1L7QA 1V9SA 1WHSA 2R5WA 1L4LA 3QFCA 2H1OA 1V71A 1F2DA 4OGLA 4EUNA 4G1FA 1T15A 5TGDA 3HJAA 3F5QA 9ICBA 2XMQA 2Y2UA 3I9V6 1VP9A 4I46A 3W5BA 2AR0A 4JUBA 2GF0A 2HJWA 3CTMA 3ISDA 4E6EA 4PGGA 5AW3A 1P4AA 3PXGA 3MDAA 1MAHA 1L8OA 1MB0A 4PHDA 1I8TA 2H17A 3O8OB 1W49A 2H65A 1WWVA 4CDRA 1XK7A 3H6HA 1RXEA 4CMHA 1W4CA 4FDUA 5DOVA 4QLAA 1QDLB 1FW8A 2HY7A 3T9EA 5C1DA 3RH5A 3GLUA 4NHEA 4XKJA 3GWGA 2QTAA 2ZBUA 4CDGA 3BEOA 3WNQA 3GUHA 3W3AH 1O5OA 1EVJA 4C4RA 3LVQE 4LZWA 5A4IS 4JL6A 4B76A 1KYIA 2YWHA 4C7JA 2QGNA 2UYYA 5BWCA 1KMNA 3T5TA 3H9CA 4JLJA 4CGYA 4S1PA 4Q9NA 2HA5A 4UUMA 2HL6A 1L7BA 3QX7A 4AZWA 4KQEA 3E4CA 3RV3A 1SA0A 2WWWA 3AY7A 2VT6A 5BVGB 2F8MA 3W3AA 5DFAA 2VP2A 3FPLA 3BRWA 3NEPX 1BHJA 3ZU3A 2NO6A 4DIDA 1CRQA 2I8AA 4A0GA 5IVPA 7ICUA 4BNNA 4K1LA 1E9CA 3L92A 1IEWA 1F0YA 2I6GA 5IAAA 3QXJA 2B5VA 1FNBA 4OJTA 3G68A 3O8LA 4HZGA 4YHHB 2QB0A 1IWBB 3GLIB 3BXHA 5IN4A 4AUKA 4D6XA 1I0IA 4NCXA 4RLHA 3RIYA 1II9A 3QRWA 2W6QA 5EWLB 4U6SA 1YA4A 5GWXA 4RA9A 2R25B 1XVTA 3CJTA 1SXEA 2PHZA 2EZZA 3JQ7A 3M82A 2WW8A 3STTA 2HSEA 4DIUA 4DMHA 5EWGA 1ZOSA 4I5GA 1YFZA 4K9NA 1MB3A 1YCDA 5BR1A 1ZUNB 1DL5A 4YCMA 2K60A 1PD0A 1AC5A 1MAUA 1RXVA 4MYDA 3OLXA 4UVEA 1SU6A 1XHLA 2HLDA 4RE6A 1YZ6A 1C2YA 1JN0A 2H1IA 1XELA 3IQZA 5BO5A 3SEIA 1ZEJA 3ZLJA 1XAJA 1SVNA 2VTKA 1L5FA 4PG7A 5C9ZA 3CKLA 3FYUC 2C2XA 2ZQZA 5C1OA 4PGMA 5ABPA 4U7TB 4EECA 3GLRA 4RZUA 4LBZA 3AJ9A 5CD9A 2FMPA 4MRVA 3RAEC 4CR7A 3CFYA 3U9SA 1R0BA 3AI3A 4HH3C 3IULA 5IT4A 9ICNA 2WK1A 4AZ3A 4DCUA 5HQTA 3S29A 3RFCA 2JAQA 3MMPA 2IS6A 5CT5A 1JRLA 4HATA 4K9LA 3TFWA 2GEJA 1ISIA 4QG3A 4PL1A 4QRIA 1HL3A 1QSYA 5K0SA 1E79A 1YFJA 4ZMSA 3CMCO 2JLAA 4NBLA 3VR1A 2D2XA 4ZU3A 2XV1A 4GF5A 3A1SA 2BMEA 3AR8A 4NATA 4DBLC 4OP1A 3GFPA 3TZEA 3ICPA 4CT0A 2BV3A 2CD7A 1XRLA 4W5TA 4G5FA 1QBGA 1DKRA 4NJOA 5KFYA 1S4QA 1IDN1 1L5WA 4TS1A 3R3JA 2Q0XA 4UMEA 4HGQA 4EZ6A 3WIOA 1FFSA 1JDJA 3NC0C 1WP9A 4N03A 4N6NA 3DCIA 3PTLA 5CYPA 4D4MA 2B94A 1BAPA 4KSYA 4LCBA 2DF4B 5DULA 3F9CA 1N2ZA 4R6XA 2Z3WA 1J1ZA 5DGTA 2XUAA 3VYUB 2R6DA 2KSOB 5ENVA 4L5CA 3RRBA 3ZWDA 5F9LA 3O9MA 4Q66C 2VATA 2QMQA 3CF0A 3K4HA 2LI6A 1CQXA 4K6OA 3EA5A 2NUPA 3WL6A 1FUKA 4M47A 4E03A 2DGZA 3ZXYA 3U7QA 4H7JA 1SHKA 4REMA 5IC6A 3BZCA 5KTSA 1MO5A 3H19A 3G2OA 4UB4A 4YFKA 2FN8A 5KG1A 4ACAA 5H16A 2PSEA 5KTPA 1A3CA 4NQZA 3QNUA 4C3UA 2HRQA 2V8BA 4DOBA 1ITZA 3C43A 3TQQA 2FFRA 1P7PA 4O3MA 4BQIA 1JXLA 2PUAA 1Y8AA 4PXAA 1OH5A 1Z75A 1F6WA 4C4YA 4MROA 1XLTC 2C3OA 3BSFA 2VSOA 4RCYA 3SIPA 1QRUA 5JBQA 1VBMA 4B6OA 3WGIA 3ICWA 5A71A 2WUWE 1X9IA 5AHOA 1U3TA 3TIFA 3WZ2A 4R5MA 3RB4A 1HDYA 3I23A 4PS1A 4R8SA 1F44A 3U7EB 1W35A 3KYJB 2D59A 2X15A 3LBHA 5CVJA 1RYHA 4YP7A 4RNCA 1LLCA 3P52A 3R7BA 2JAXA 1KSFX 4P31A 5B4VA 1RHUA 3OFJA 1SXHA 2TSYB 4RJJA 1Q1GA 4OMCA 5B2FA 2QGZA 1HE1C 4O4IF 1SUEA 4FKMA 4BZPA 3E48A 5HUHA 1WKBA 2E55A 3I6ZA 3C3PA 3UA4A 2KJ5A 1CERA 4PX3A 1DIBA 4O5EA 4NLZA 1XCJA 3RSOA 2I80A 1XMJA 4GWLA 5EIBD 4JX8A 1S1MA 1ZXXA 1CDEA 4HYKA 4RFSA 2L17A 2BKVA 4Y2HA 3EE6A 1QG0A 3K1JA 3KWMA 5CITA 3HL0A 3SEZA 4LUCA 2YNMC 2OZKA 2G9VA 5KI6A 5M04A 2J7PD 5GTIU 2QRVA 4MV7A 1SCNE 3NAGA 2HSWA 5CB1A 2FPIB 4U2CA 3JR7A 3L06A 2J0EA 2WG0A 5B3JA 3LQYA 4RA6A 4WZ6A 1HFEL 1FSPA 3W0LB 3D8HA 2KYRA 1C3XA 3V1MA 2J0SA 3LMKA 1R0ZA 2W9BA 3Q6MA 2REQB 4RM2A 1G38A 3KE8A 4KBFA 3BZUA 4RZ3A 3SQDA 3LQRA 3AF6A 1YRHA 3H1TA 4P2BA 2FPXA 1I5RA 5MGNA 3MK31 3MINA 3RJ9A 4IG4A 2Q1YA 2RH9B 1T8EA 3EHEA 4PYOA 3JCZA 5EMKA 3LFUA 2ORWA 4N0EA 1DNPA 2XYGA 3HYSA 5IULC 3GG2A 5J2UF 4Q3OA 5KG4A 4PAMA 5JI3E 3KKPA 4BNUA 1JDBC 3IBYA 8ICVA 5CA1F 1XTVA 4OX9Y 1DHTA 3HRKA 3QXHA 4CIVA 1BD3A 4DCNA 5AK6A 3VJKA 1NV8A 1NP7A 4TTRA 3A4NA 3N58A 1T0PA 3OVMA 4L8GA 4C43A 1QGZA 2QNIA 2C7GA 3THYB 3BJEA 3P9ZA 4E3WA 4QUGA 1C9JA 3KR2A 4YNBA 5COQA 2HCRA 1V6AA 4ZJPA 3L46A 2ZQYA 3OZ7A 2OOKA 1SULA 2P6NA 3HDQA 2R8RA 4UUAA 1TM2A 1PL0A 3VTZA 2PL1A 4BMYA 1ZIXA 1R6AA 1RLMA 4HYEA 4L6CA 3ETNA 4FD3A 5KOJB 1FMCA 5EKDA 4QEDA 1RPTA 3FWNA 4LNAA 4V0SA 1ABBA 3K9LA 1KDRA 1JQAA 9ICPA 2KZZA 2CB0A 2I3ZA 3Q6NA 1GQYA 1WTAA 1VE3A 2Q4DA 3HGTA 1T5IA 1W1IA 2Y77A 5EIEA 4XSVA 4C0BA 3U3DA 1GKIA 3WLSA 1TC1A 4GOKA 1T9BA 1TYAE 2PLNA 4RD3A 1KEJA 1E7MA 4BDPA 1ULZA 3EARA 3JAKB 4BCDA 2FYTA 2V6JA 3SSOA 4TLDA 1UA1A 4QW9A 3F53A 4WCDA 1SIBE 1GPYA 2H1LA 4IIEA 3B9QA 3MIZA 1L5VA 2QBYA 4DSAA 1N3BA 1PEYA 5AW7A 2J8ZA 2QR5A 1RKVA 1IXRC 3PC8C 2F90A 1OFIA 2G5TA 2Y93A 4RTNA 1PK1B 1M73E 3IA2A 4HAWA 3RJZA 3PFKA 3KKAA 4BEWA 3L18A 1WEKA 2H06A 2PSSA 1H5QA 3T0IA 1ZKMA 4TKVA 1A4XA 1E3EA 1RYBA 3SAFA 1NFFA 4CKWB 2FPKA 3H2BA 3LUCA 5J0RA 2PG3A 1E92A 1TMKA 4F04A 1B42A 1NYTA 4DW8A 3I9FA 3QLUA 1AKYA 1H94A 3T4XA 3GFKB 2C4UA 3TIGA 2R6AA 3PF9A 2Z6UA 1V85A 2N47A 1D04A 3JWHA 1P4JA 1BU5A 2WJ4A 4M2LA 5EQJB 4GNRA 1TA4A 1XE3A 3RJKA 1T7PA 1WB5A 3BMNA 3DL4A 3E3AA 3AERA 3EX7C 4C6RA 1U0NA 3QA3E 4RUAA 2IYAA 2LYBA 4HYYA 3UQYS 1MOSA 1SBTA 5FV7A 1X3LA 2ATIA 4K9KA 2P75A 3BWDD 5IHPA 1MAVA 2IHUA 4DSUA 4S1TA 1QMPA 3AG6A 2FMXA 4DL6A 4E15A 3ZY6A 3HLKA 2FG5A 3V6MA 1WF6A 5CJPA 3PR4A 1Z0UA 1Y7LA 1YCHA 2OQRA 1A0OA 5ELXA 3PCRB 1I4DD 4V0QA 1DC4A 5BT9A 1RI4A 4FMCB 1EP2B 3ZTYA 2J6UA 3KJEA 3DKIA 3C4VA 5EY5B 4UB1A 4I1SA 5BSVA 5KTRA 5IUJC 1NE2A 3RJIA 2P40A 1G8MA 4IXDA 1ABEA 1ZNZA 1ADJA 3UKJA 5L1IA 3CNLA 4IDAA 2F1OA 1ENOA 3B13B 4L72A 1WXIA 1M8JA 4AZ0A 1RMTA 2A84A 3GARA 5F23A 4LEIA 1Q5PA 2FSGA 4AIRA 1MEOA 2EATA 4BDTA 2PLFA 5BWLA 4L9RA 4RFVA 4BP8A 1IOLA 3I09A 2UYHA 1CQWA 1T3TA 3N0VA 4LYHA 3ZE9A 1Y3DE 2XCPA 2ZKIA 3PC3A 3HNRA 2NT3A 4BMOB 1PS0A 5KWEA 1JLLB 2FZEA 4DXHA 5K4HA 2Q4TA 1Q16A 5EYPB 1R4NB 4URUR 2FR0A 3IO3A 5EVCA 1V5WA 2H5LA 4X3CA 2ZI4A 2X1VA 2B8TA 1AS2A 1VJ0A 2P4QA 3PIIA 3LP8A 1M5TA 3CZQA 4ZI5A 1H1LB 3PUXA 4KK4A 4OH7A 1FVFA 1V7CA 4W63A 1VFNA 1OV4A 5BV1A 3L79A 2SKDA 4EYIB 3RAXA 2MR5A 3NTOA 2Q3FA 3AZQA 3WLTA 5DGAA 1N2CA 2YW2A 2DPHA 4EPVA 3BHNA 4KX3A 4B7XA 2HK9A 4LRTB 2P6MA 1UDWA 1NA5A 2NZVG 1M1YA 2H85A 3I9OA 3I9MA 2IFTA 3ZIDA 3EVZA 2W6JD 5KNDD 3NC1C 3DDOA 4U3JB 1PO7A 5EP2A 2YWGA 3AQ4A 2X19A 4Z4FA 2WFLA 2NUAA 4JKIA 1KQOA 1S3IA 121PA 2JPDA 5J47A 3G89A 2F1KA 1R6VA 3CHYA 4F46A 2XITA 4K6CA 4S2EA 1U0EA 1V4VA 4RZXA 4OHRA 1ODFA 2XIJA 4X3PA 2Q3LA 2D6FA 1C7QA 4ENQA 1PT9A 2GCIA 3X1WA 4KGVA 4HN2A 2QVYX 3HKCA 3BORA 4X1IA 3UMCA 2ZPAA 4G0QA 4QZEA 1D2CA 3A3PA 4F97A 2RHGB 1YASA 2IYYA 2VJLA 3JQ8A 3LG2A 3ZEIA 3BFJA 3MFQA 2JVIA 5D49A 4TV8B 2CFIA 5JDCC 3CSUA 1UBKS 3A9VA 3UV6A 3CRNA 3UMSA 3C28A 4GD3Q 4LYAA 1XB2A 1EVEA 4G07A 2C8JA 2IYXA 4ID3A 3ZDZB 3G8DA 2C3YA 3A6JA 4PIMA 3FNRA 1GPKA 3GXBA 1F5NA 4J49A 2ZJ0A 2OVFA 1XF9A 3WMXA 1SUCA 1BDHA 3NZEA 1QQ6A 3FZGA 3AL2A 1MAAA 4OJPA 4GP6A 4M8NE 4JGGA 2CFTA 2B82A 3AR6A 3GLGE 2CPRA 2RHJA 1CUYA 4ZODA 3CSSA 4CT4B 1WHTA 2Y1DA 3WSVA 2GD1O 1KBZA 5K99A 2D0DA 1MA3A 3KJGA 1EK5A 2AD1A 2VUTA 2XTAA 4U7JA 4WUTA 5B4UA 2WM2A 1AZWA 5ECYA 1I33A 4TTJA 3QMPA 4XWKA 4EHNA 2J7PA 4CKZA 2R8PA 5TQ0B 1ZXBA 3KXIA 1L8XA 4BFLA 2P4EA 3CTPA 3JX9A 3ZDEA 5G0TA 5JD3A 3EIFA 2LE0A 1XA3A 3DD1A 2KZ3A 1FDVA 2DGDA 4G1MB 1M2KA 1O94C 1KVSA 3L7BA 4J75A 3KKMA 5JYBA 2BEKA 2BL4A 3O2JA 3TINA 2W9AA 4LZLA 1U7OA 1U6JA 1YL6A 3W2FA 4DMUB 5AVJA 4AF6A 4FILA 3RT7A 1YR8A 3AFMA 5GVSA 2ZG6A 4WNCA 1TQDA 1KXZA 3D1VA 4XDYA 3ZGZA 3ENNA 4IXTA 1AY0A 1NK4A 5KVAA 2FMQA 3L7AA 3GT4A 1BRMA 2JIZA 2AEEA 4TMKA 5IABA 1PV1A 2HWKA 2MSWA 3PWKA 3G13A 4EZ9A 2Q5HA 2QTNA 4HB2A 3NMUF 5C81A 3H05A 4OQDA 2C77A 1VHJA 3E18A 2IY9A 2UZ4A 1XP5A 5J2FA 4KDFA 4IWNA 2EGUA 5BQXA 4RK4A 2QX9A 3AP2A 1KI3A 2R62A 4Z4HA 5FLXA 1EJ2A 2WUGA 5ED0A 5CBPB 1KPHA 4UFOA 5LC1A 5I9SA 3FDIA 2ZTSA 1RWBA 5I9BA 4E94A 3UWPA 1GTJ1 1BD4A 3P45A 1CUCA 2PY6A 4KV9A 5GAJA 2ZAIA 3RJHA 3TM4A 2MYNA 2AXNA 4HJRA 4CG0A 4NLLA 2WHXA 3R8CA 2XB4A 1RAFA 1ZH0A 5G40A 3PHBE 3OPMA 1J5XA 3PQ5A 3PFBA 1ZVMA 2IYTA 3O3NB 1B0PA 4MV9A 3VH4A 3DBHB 4EDHA 4KN6A 1NJYA 1FTGA 4HNUA 3EMDA 4CKCB 4MLDA 1A71A 3SCZA 3SOZA 4GBJA 1NNSA 1FSFA 2AWOA 1M3SA 5JS7A 1KERA 4HVCA 2REXB 3GFRA 5LDHA 4B6QA 3ZU5A 3DMFA 3VCBA 3IESA 3SD7A 4F0JA 1YNSA 3AMZA 4Q8EA 3RM3A 1T43A 3V6JA 1NZBA 4QNRA 4XJSA 2ZETA 1CR0A 4MP6A 2ZYGA 4XGKA 3IP4B 4KE9A 3CVXA 4A2WA 2RHLA 4Z6EA 4QD3A 2QP9X 3DS8A 2RCYA 5TJ9A 4Q47A 4QYIB 1DK2A 4AUNA 4ZCIA 2ZCVA 4ZT7A 3C3WA 2EKBA 1A96A 1OPRA 1DT5A 3NBMA 4QFMA 4HLDA 4RXUA 2W58A 2WAYA 6CHYA 4Q39A 4JC0A 1ZYUA 2XGMA 4BC1A 2O57A 2ES4A 1JKJB 1NP3A 4IHJB 1LTKA 4EB3A 3B1FA 4BQQA 2I7CA 5K3FB 3PT9A 1AGRA 1O4VA 3H4IA 3URKA 2PU7A 5AUOB 3LH5A 1QB7A 3M1LA 5I3ZA 2VSFA 5CU7A 1NQUA 3ALRA 1EE1A 2FHPA 3T4UA 4LNUA 2AJCA 3W9YA 1Z4IA 1TKBA 1N2CE 3KO8A 5C34B 5A7HA 3D6JA 2PL3A 2I66A 4MPRA 1PI3A 1T36A 2H9AA 1N25A 1SQFA 4IWYA 2VXCA 3JPRA 1M1YE 3MR6A 2A0YA 3DZGA 4R1MA 3AR5A 3M9NB 3NHSA 1YQDA 2O6LA 2Y92A 4OK6A 3VJLA 3BXEA 3MTDA 2YJ3A 1YQEA 1EFKA 3HU2A 3E8XA 4QXMA 4J0JA 4UTZA 2P2NA 4LOJA 3VC3A 4D6YA 4EP1A 2GPAA 1L7DA 4AY6A 5CA0F 1A95A 1YBFA 1PRYA 5IMBA 4FFLA 4DREA 3WLNA 4XW2A 2HGSA 4EELA 3MCZA 4ED7A 1TEVA 1M0TA 4R0NA 3PDWA 3JYHA 4C3VA 4DSLA 3KQLA 3ZDFA 2JCBA 1N61A 4L5AA 3T1TA 1XQVA 1JIKA 1Z9BA 2GEKA 4JV1A 1A9PA 4X20B 1Y0BA 1ZQEA 2HF2A 2AK3A 3HILA 1YRBA 1V16B 2W37A 4PLVA 4LWOA 5HCIA 4JC4A 5J58A 3TNLA 3AXSA 2I22A 1SGGA 4Y9SA 1RXUA 2R8IA 3PHJA 3OZAA 1H9BA 1C9YA 2XX3A 1Y3IA 2F1RA 4ZI7F 2AW5A 3SXUB 2HKIA 1RTKA 3KUUA 1H3FA 3S7TA 5CA7A 2VHEA 1PR9A 1IJEA 3TBFA 4PZYA 3A26A 1PX0A 4PC2A 1DJOA 1COKA 4LFAB 3QM1A 2P35A 1WU7A 1TEXA 3LRXA 3W2EA 4KMMA 4FNOA 4EKIA 1UBGA 5GPBA 4Z6CA 3CISA 3PFIA 5CB0A 2F55A 4L57A 2C2DA 1DRWA 2NZXA 1LK0A 2P67A 3BFXA 3QELB 2ZB4A 1E2EA 5EZSA 1Y9ZA 4UHHA 2P65A 1B2RA 1QONA 4QQ8A 4P0PB 1C80A 1SBQA 4B73A 4DM4A 5IMSA 3GC6A 1PL7A 3ZDDA 1WZ2A 3E9NA 3ND6A 5JMTA 4UM9D 2TMGA 5K8JB 1HEIA 4BMNA 4Q4AA 2BI4A 2Y99A 2WM8A 2MIIA 1G19A 4RE5A 4GE0A 3SAGA 3ZDAA 4BXOB 2DZDA 1DBIA 3NEYA 3FRIA 4PHPA 3A9RA 4AY3A 1D2HA 3F3YA 2FLKA 2X9VA 1S1CA 2LRHA 2W6JA 4J9RA 5KNDA 2IEDA 1V45E 1JWLA 4RJTA 1QXSA 2FHSA 2O3UA 3OZCA 1QIKA 3MT9A 2IXGA 7MHTA 5EHZA 1VPLA 4MLCA 1B3BA 3E1GA 4NY1A 4FS8A 5IW8A 4N48A 1KYVA 2BMAA 1PYDA 3UN1A 5JI2E 4M8IA 3L77A 4N3BA 2FPUA 1PR0A 2V7GA 4EJ2A 1YVEI 3SZGA 5U4XA 1DK3A 1OOEA 3ASYA 4ZJYA 1W25A 2Y2VA 3U7HB 1O57A 2PH3A 2YIVX 4LFCB 4KQIA 3V7NA 3KJFA 2YQ5A 4IV8A 3Q87B 1Y81A 1B8PA 1SG9A 1EX9A 2E6KA 4EG5A 3ZKAA 2DHEA 3NYWA 3PNOA 3BXOA 1OX4A 1U2DA 1ELOA 1QYWA 2DJ5A 1B22A 2PVSA 5EKUA 4MWTA 2V1XA 2TS1A 1PK3A 2IOQA 3M6ZA 3BHMA 2GCEA 3WOVA 4AKTA 4HFNA 5HHHA 1B93A 4IBOA 3AC0A 1XDDA 4IY1A 4W5JA 1RG6A 1ZQVA 3R6TA 3DF9A 4TLAA 3GJZA 3AVQA 4UMDA 3ZHBA 3GCGA 4PX9A 3SYLA 4YAUA 3PW7A 1H85A 1LDEA 2F3SA 3M8KA 3NJ4A 3QGMA 2GWHA 1GTVA 3QVXA 4GXTA 4BNZA 4D3XA 2HOIA 4LJRA 4Z3KA 2BGMA 2X0FA 3EXIB 1GCOA 2WKWA 4A2PA 5GMOA 5I7FA 3KZKA 3W5SA 2W6MA 1E3WA 4IDPA 2Z5GA 3I76A 1A88A 1Q2UA 4B3RB 3CUEF 16PKA 2Q0ZX 3GILA 3U5ZB 1Z6AA 2BD0A 3KAJA 3H6KA 4I8XA 5EE0A 2QUJA 1P2GA 4J2TA 2GGSA 3SY8A 4MQFA 2IBMA 1ENYA 2OGWA 1OLUA 5FDFA 4PSDA 2QVZX 2ZR7A 3R0JA 2ODEA 4NFLA 1JB1A 4Y7CA 3BH7A 3L02A 4PSAA 5J0WA 1PCXA 2PL5A 5FEMA 5JXGA 1NTOA 3PTAA 1OLXB 1MT3A 4FR2A 1TK8A 3BRWD 2WP0A 2O7NA 2PRKA 3TQCA 1S6YA 1NXOA 1OA0A 3QPDA 1HTTA 1XO0A 1PFUA 5A03A 4MF2A 2KHQA 3S1AA 1K0FA 1VPWA 1CUVA 1GXSA 3GI1A 1MABA 4YRTA 5DB4A 4M7OA 4MEBA 1N7GA 2BBSA 4O4JA 4DXDA 1OBHA 1SRQA 1R10A 4KPUB 3U56A 3LLVA 1OJLA 4MKGA 3QPBA 5IF3A 1JAYA 3VPSA 2I4NA 4Y1RB 2HOFA 1NU8A 4HRAA 4IXNA 3COPA 5DSTA 3B1VA 1PIWA 2G88A 1P9RA 5SZHB 3VA7A 5BN4A 1XQWA 2PZMA 1Q3TA 2GAFA 2POCA 4ALMA 3E5NA 1R0LA 3UC9A 3E2PA 3PSAA 4YRQA 3W6NA 4YASA 4D8VA 2J5XA 3I2JA 1UIRA 3J81k 4Y8VA 1UXJA 3H9EO 3WTCA 3V8EA 1QGUB 1K2VN 4N76A 3FFXA 1U2QA 1ICIA 3QYAA 5T8KA 3E03A 3H7AA 1N1DA 5CUQA 4FFBB 4KAXA 4KQCA 3HO6A 1ADYA 3ASZA 1XBTA 3A25A 2UYOA 3AUKA 1E9RA 1KGSA 3BS4A 1ODLA 4XGRA 2DUYA 3SC2B 3EZLA 4IGAA 4CL0A 5NLLA 3H9GA 3WB9A 4UB5A 4PRZA 2Y1CA 1ZD3A 4WBNF 5C7YA 3FJOA 1X87A 3MD9A 3OETA 5A7GA 3EPKA 1SWWA 1EFDN 1UK8A 2O0MA 2E1FA 4P93A 4DSTA 3R5SA 1Q7CA 3G7NA 3ROGA 2MR6A 3EWIA 2GQ0A 1J2UA 3UEOA 2BFFA 3LL7A 4I50F 3CA8A 1XPOA 3L4BC 3C5GA 4CV3A 4G4JA 2XY4A 3EWAA 1K3TA 5TMPA 1DINA 4UPDA 3O4GA 5CEEA 4OYYA 4YMMA 3IHKA 1R0WA 3SXJA 5HKOA 4KLZA 1NKSA 3NNSA 3NRBA 2K4IA 3KHRA 2OZLB 2QVCA 1DKQA 3IRVA 1V1RB 4IQFA 2QPLA 4KLQA 4XTRA 1WCLA 1NJFA 3L4KA 3OIGA 3PUHA 2ZYSA 4JYBA 4BNTA 5ER6A 3O2NA 3ESXA 4CUKA 5KYWB 2EFYA 3AVPA 4ZTZB 3NTXA 2C94A 3NJRA 4HGZA 3UENA 1N5XA 4DV1B 5B1YA 2D2FA 4BCBA 2XA9A 4YWJA 3VOBA 1LNQA 1EBUA 2WTUA 2I29A 3H5WA 8MHTA 1I10A 2YRWA 3V1UA 4WFKA 2IYNA 1GYQA 4R7GA 3F6SA 4FDMA 2W2QA 4KVZA 2Q5OA 3PFWO 1MORA 1GWNA 4Z8YA 4BGDA 2PZKA 4FX2A 2X4DA 5D7NA 2DBZA 3TADC 1RZUA 2BTQB 4FFRA 2WD7B 4FCCA 4G63A 1L3CA 3N6VA 1TW3A 2YICA 4YONB 3FYTA 4IRXA 2OXOA 4GEKA 2RDJA 4RIGA 1U1EA 4XVRA 2FXIA 2BRUC 4PYKA 4RZSA 4OQEA 5ADUS 1FBTA 1Z62A 1GGMA 4RHCA 4NU8X 1U47A 4BP9A 3P2EA 1R5BA 3G82C 2HTEA 1S2DA 1JROA 1J00A 4Z1OA 4CEIB 4U2BA 1YOVB 4C14A 4D8XA 2Z8YA 2IYRA 3CLTD 1JFFA 3IXQA 5FB3A 1PLKA 1T2FA 2I7XA 4MKZA 3TTWA 5J2DA 2O8FA 1G8JA 2Y1GA 3MJHA 2NTNA 4C0XA 1P5FA 4MV5A 3PV0A 5CK4A 3G1UA 1GQRA 2PUVA 2JGDA 1P9LA 4KXMA 4UJ5A 4BWFB 4XB2A 4EHLA 3DWIA 3EULA 3VVBA 4PGYA 2BT4A 2VK8A 4R98A 2BTOA 3LKDA 5F52A 3V4FA 4Y7DA 4FLEA 2O4UX 2CEAA 3I1YA 1E0SA 3M33A 3CW2C 1T8YA 3OHMA 8ICNA 1I1NA 4MGIR 4A0RA 1IHOA 2UYQA 1ZYQA 3K8QA 1CJVC 3BIXA 1KA9H 3HVKA 2X2OA 2R11A 4L9WA 2RIPA 5E7MA 5F4BA 3EEFA 3M3HA 4PHTA 1A9RA 4J9QA 1C4OA 1G3IA 4FNGA 1R88A 2WFZA 4CN8A 1D09A 4CFSA 1U8UA 1XRMA 2JS7A 3KETA 3W5AA 1ST2A 5TQ2A 3RVLA 3G2MA 4XWOA 1T3ZA 4TS4A 2P41A 4LY6A 1GA4A 4KYVA 3D0RA 2HM7A 2PZJA 4BKQA 2WF9A 5CCBA 8GPBA 3QE9Y 2H59A 1JEDA 3RBVA 4EEXA 3RCBA 3SFZA 4QYTA 1DV1A 1M1NB 4NJEA 4QSMA 1XC7A 4PL2A 1JLSA 5AXBA 2GOYA 2XE4A 1N33B 4PVCA 2XWQA 3AB8A 3PKZA 1TCAA 4D97A 2GZ2A 4C0KA 1E2LA 3RYCB 2ARKA 4YR7A 4BOYA 5LUAA 4KZKA 2F2AB 2H52A 4IZ6A 5JAHA 3PNPA 4BB6A 4DF3A 4GX2A 1ES9A 3EDQA 3JD2A 4JLWA 1WB9A 1AN9A 1IVYA 1VRVA 3DH0A 1DBVO 1HYEA 5FBLB 4PHHA 1WXEA 2CJWB 4HDAA 1FP4B 1Y3AA 5J0XA 3WMEA 4KTQA 4GPZA 1AS3A 4YO7A 2OK8A 4FOTA 5KFXA 1WUJS 5C37A 4TV9F 1LV5A 4N0PA 5IUNC 3MGGA 4M3NA 4UQOA 3QVTA 3CIFA 4BQSA 3N59A 2I54A 4WMLA 2JA2A 4QT0A 3E81A 1QS0A 3DTVD 2YHSA 3QVKA 3BL6A 9ICJA 3DFMA 3PVCA 4N9WA 5CT9A 1OHHD 1VZ2A 1MX1A 4LISA 3V4LA 8ICZA 3C48A 2IBTA 3SQLA 2O2IA 3FRJA 1DAGA 4LQDA 5IAKA 2AI2A 4H35A 3CEJA 1E89A 2FZLA 3UG7A 3QTLA 4ZAVA 2Q27A 5D84A 1V8ZA 1M7GA 2JJ1D 2XCTB 3ZY4A 2Q21A 3IEXA 1BXKA 5IJ0A 3SVLA 3DDUA 4FQ8A 3NLLA 2NU7A 3T9AA 4LOIA 3VDQA 1BO6A 2GFQA 2C5GA 3U4DA 1Z16A 2VT3A 2MT9A 5JNSA 1BXGA 2B4YA 4L27A 5ALXA 4J4BA 4FUQA 4YVFA 1P1IA 5SY6A 1H69A 2ZP1A 3R3WA 5EJAA 4JKYA 2DFKB 4IFEA 3RS7A 4BKUA 4ZYVA 5IC4A 2ERYA 1KNXA 2X8JB 5E7JA 2IPOA 1KSPA 1T4MA 4YX9A 1X0VA 3DHEA 1P2VA 1D1QA 1HKUA 2V6BA 2W22A 2Q5EA 1XA0A 4UBKA 1W36C 5G1NA 2Q28A 2XDYA 1XYGA 1W9HA 2J30A 2YJGA 4RQ2A 4O4IB 4QO8A 4FNAA 3WQRA 3PNQA 1E3TA 5FPYA 1XEAA 1E1YA 4QOSA 1J0AA 1DARA 1KRXA 3IV9A 4JLDA 1ZQIA 5FA5A 1NQWA 3KUXA 4MIYA 3MWDA 2HYDA 3RH6A 1JHDA 3M6XA 1Z4OA 4HNAA 5DYNA 4X5VA 3IT1A 1Z29A 3LDFA 3MWEA 5LPNA 3O8DA 1IN8A 3HBNA 5I4IA 2AQ4A 3PEUA 4F86A 1OXKB 1T91A 3CF4G 1FFEA 5TXGA 4DQXA 2FFQA 1B6RA 3LZ6A 3FR7A 2ZIEA 3VXKA 3RFVA 1T3SA 3UJ3X 1EA7A 4CCAA 4FB5A 9ICIA 2AXPA 2NXNA 4WLFA 3PUZA 1U80A 4KN8A 3GVXA 3HRIA 5KX5A 2B4KA 3ORYA 5C5EA 1XU9A 3AUJB 2ZUCA 1FU4A 1Q21A 4QFCA 3K09A 2QWXA 1DTWA 3E9QA 5KYUB 3ESYA 3A1UA 3E5HA 2A86A 1Q2XA 1NXPA 4ND1A 3HA7A 4CLDA 4LTMA 3AKZA 5LDDC 1U8YA 3TRFA 3L4PA 4UD2A 2F59A 2WI8A 4QJIA 5G4KB 2ZREA 4GM0A 3AVUA 2X8AA 3EGXB 4QYWA 4PO8A 4M1WA 1AN0A 1Y8QB 2IHYA 1AGXA 2ECOA 1G4HA 1J2YA 1QYRA 3LBAA 3BIOA 1QJ4A 3U3ZA 3ZTWA 8ICSA 5K0JA 1INLA 3H5OA 2VH1A 2Y6VA 4UDXX 5G0WA 3GY0A 4K05A 1PLLA 3S0JA 1PSZA 1ZGBA 2FUG6 1M0SA 4AW9A 2QTVB 4QM7A 5C18A 1E77A 3HP1A 4ZVQA 4JXJA 3C3AA 3NXSA 4KXYA 3CU5A 4KAAA 3EZ2A 3ETJA 4LY9A 3PCXA 4YRZA 1CUZA 5IDWA 2XUIA 1YU9A 5C7LO 4ED3A 3BQNB 1RNLA 4RMHA 4F5NA 4ES6A 1YQ9A 3VYTB 5FBHA 5A06A 4OGFA 1G5IA 2OEHA 1XZMA 3EOAI 4F21A 1ZRHA 3MGKA 5FTJA 3Q1KA 4RKRA 2NVWA 1O54A 2QARB 3H65A 1VSTA 1XMVA 1SPXA 3IL2A 3ECAA 2DHQA 3M3DA 4N3GA 3D02A 13PKA 1KO7A 3EJ6A 2ZIWB 3PB3A 1QMGA 5BOSA 4QRDA 2V8OA 1QHYA 5IAGA 4LYJA 1H4QA 2R96A 2B5WA 3P4UA 2BPCA 5JC1A 3HUDA 4LE0A 4FE3A 3WY9A 5BV8A 8ICFA 3DMRA 1DEOA 2CHGA 1IZYA 4RVCA 4B3FX 2YFKA 2FW0A 3A4MA 4RJ2A 1P0FA 3FGOA 3KTDA 4EI8A 2JDID 3H1GA 1NK0A 4FFNA 1DWUA 4C8OA 3I45A 3E61A 1H2XA 5IFLA 3V72A 1V5FA 5HK8A 2QZJA 3U13A 1FNCA 5FAKA 3D6TB 2JJMA 2ORED 5EMMA 4LRQA 4IKOA 3HS3A 1SNYA 2M1ZA 1NVVQ 1KO4A 1GRVA 3EUAA 2ORYA 2XW6A 2WUDA 4IYRA 2AT1A 5AVVA 5DLGA 2BM0A 2HOQA 3IAM1 3DONA 1XVLA 2ONJA 1YK1A 5AKZA 4UFPA 4XDGA 1N5JA 3GLVA 3KFXA 2ZTDA 3ZOKA 1YIOA 4Y6RA 1DXQA 3D8SA 2ONYA 4I1RA 3OTWA 2H1CA 5IYZB 4M04A 5E2IA 2XTZA 3BRQA 1AGYA 3ED5A 3JZMA 3GZNA 4AN1A 4ONEA 2POQX 421PA 3PICA 1EIZA 3DOCA 4H0CA 4ZA2A 5D85A 3IBSA 1GQSA 3P9NA 2VNKA 5EC8A 2IV7A 4Q00A 821PA 3H2KA 4NL9A 1QJCA 1GTL1 4HTAA 1EBBA 1Q3KA 4P53A 1KEVA 2GPBA 4OJLA 4WADA 1Y4AE 2QRPA 2PMZC 1CUBA 1K6MA 3UK2A 3H5TA 4Z53A 5JBNA 3GL9A 1U99A 1B1CA 2BFDA 1KZGB 3DZFA 3LOUA 1Z00B 3IURA 2G8NA 4OIMA 3TCKA 4UTRA 3N07A 2HHSA 3R7WB 1I2CA 4P22A 1FIUA 4KWEA 4NBRA 3LC1O 4YUXA 5U1PA 4OJQA 4RDIA 1EK1A 2P9EA 4UNNA 1V8FA 4EYOA 3T3GA 1E9VA 2HXSA 1EPUA 1FXSA 3OQVA 4JB8A 4PZPA 2G7MC 3HY6A 1H0HA 2H1WA 5KFRA 2NO7A 1TK0A 3Q41A 3CLHA 4LZJA 3ZX5A 2ECQA 4X45A 1WUYA 3RFUA 2ZRFA 3G5MA 5G41A 4YDSA 3R3VA 1C7YA 1BHQ1 1KQGA 5JSUA 5DBBA 4OAOA 2WJJA 3L0CA 1LK5A 2QRGA 1U49A 3FIJA 1NMYA 2OHJA 5JAMA 4GUDA 5HK9A 3OOJA 4JI5B 2XUZA 1ADCA 3RVNA 1GD1O 3E82A 3BX1A 4O5OA 5FBZA 4OA5A 1U8XX 1KEZA 2IIQA 3SZUA 2JIZD 3NP7A 1UT6A 3MB5A 1EK2A 5AKJA 4MUHA 2PSHA 2PPVA 3MFHA 4AO6A 4U39A 1ZIYA 5FLKA 6GPBA 4EKDA 4AUEA 1JALA 4RPLA 2FETA 4JXXA 2A2ZA 5AOAA 4HGPA 1PGOA 3DV0A 2ZBDA 2X9LA 3TJMA 4R54A 1R0XA 2HK7A 5ICEA 3EZ7A 3T7EA 1C1XA 2EWVA 3NWEA 2W6IA 3JQ9C 4C6SA 2DXIA 1DCKA 1B74A 9ICWA 2QXTA 3DTVA 5IVHA 3GMIA 2WKSA 4E0BA 1OHHA 1LCIA 3RKRA 2X9NA 2Z6VA 3AEQB 4DJFC 3WGUA 4HEJA 1VOTA 4GNKA 3BS5A 4DLAA 3K71B 3I9KA 3R5KA 3IP3A 2FWPA 4NU5A 1NFRA 1JHZA 5FQNA 4F6RB 2Q6LA 3L82B 3G88A 3TTTA 1T8SA 3TL6A 2JJ1A 3IP8A 2C78A 1X9XA 4G85A 1R4MA 1U8ZA 4EPTA 2QUHA 2RHBA 3EEBA 1TEZA 3THWA 3ELYA 1K8QA 1MQ2A 4U2DA 4P34A 3KR9A 4JWNA 5SZJA 3SMVA 2QUAA 1IV8A 1WPGA 3GLGA 4REQA 1OT5A 1JILA 1UK7A 2NO1A 2HFJA 3FGNA 2EV9A 1V4BA 1W85B 1JEJA 3H99A 1M8FA 4NDZA 3VJRA 4AI6A 4N82A 3I30X 1MDBA 4LJLA 4URHA 1ZVVA 1A7JA 1G4AE 1AHHA 3AUYA 1ZUHA 1ZJ5A 4ND7A 1ISFA 5SZKB 2IPAB 2PBFA 1VBNA 1WVIA 4A8JB 5B5EU 1LWNA 4KGXA 3F2IA 2FEOA 4WXEA 5JV5A 4G36A 4EDFA 5MHTA 1ONBA 3MHPA 4E51A 3ADDA 3FROA 2V4UA 1XEFA 5DSZA 5TZVA 1XNQB 2IA6A 2YINC 3I9V1 1L4HA 2PKQP 1C1DA 2JLUA 5KNIA 1KZ6A 2QUZA 1P3JA 1DFHA 1WIWA 3JD0A 5D3ZA 1BGVA 2YX1A 5CM2Z 4XIYA 3IB3A 1B6GA 1PS8A 4XJXA 5KL1B 2JRLA 4YGYA 4N3CA 1TJ3A 5J8YC 2XCOA 1PZXA 1PR1A 4HNTA 5A1JA 5DLEA 3A58B 1GPH1 4F3NA 4JAVC 2IC5A 4MJLA 2XCRB 1HYBA 1LK7A 2ESEA 2CKMA 1FUUA 1E1CA 1R27A 4IZOA 4BFUA 4GM1A 2J07A 2F43B 3S1SA 2JW5A 1EUCB 1GYRA 2J3KA 5A5DA 3FM9A 2J85A 4OU4A 1D4FA 2FMUA 2HHQA 4EW6A 4BB9A 2GPYA 2R97A 3AKDA 5K2OA 1U28C 1RQXA 3A3YA 2FWBA 2CFRA 3UHJA 4C80A 3N70A 2F8SA 5HGXA 1NDUA 4CETA 1KZHA 1EAYA 1MJ5A 4MRNA 8ICJA 4CMKA 1BCSB 4XQ9A 2P62A 3M6VA 4R40A 5ECWA 4TWJA 3UANA 5AI8A 3U48A 1BJKA 4BMDA 3MRTA 2R87A 4HFMA 1EAMA 1RHQA 4K9MA 1EG7A 1DVRA 3BIWA 1KPIA 3SAHA 1X8JA 2VP5A 3UOWA 2ONZA 1T6YA 4B9VA 3SSAA 4V3CA 5EXDA 3OHSX 1IH8A 3L8MA 3INNA 1HGXA 1XNRB 1T5LA 5CAEA 3LDAA 1Q0TA 2AJBA 2HU2A 2E8OA 3WK4A 2PEYA 3TLGB 3UAXA 1R12A 5FYQA 4JS0A 5M29A 1GTZA 5IKPA 2O7QA 1Y1SA 1CE8A 4EYEA 4LYDA 3G2LA 4HDNA 3WYFA 5AKGA 4JQSA 1QH8B 5B6PA 2O7RA 2WMYA 2YVUA 1LLDA 4OBBA 2ZDQA 4RC9A 3VAAA 3GR6A 5IDQA 4CLXA 1K68A 1WWUA 3ZD9A 3A6KA 5GJWC 3KQHA 2ENWA 1DOZA 4LF9B 2FRVA 1PEKE 4JL5A 2OFPA 5J59A 3RK4A 4YRDA 4MB0A 4AECA 1ZXIA 2JGJA 1S77D 4UVIA 5CDUA 3R20A 2GBIA 4C7OA 1IEVA 1EE9A 1AKEA 3E2IA 3GFVA 1ORHA 1MB2A 1VPVA 5LVAA 4I55A 2JFXA 4W9NC 3E1SA 1KJ8A 4HOYA 1OC2A 2PKXA 3ZOZA 4A6XA 4PCLA 1SIUA 4F3CA 4K3VA 4X94A 5F76A 1PKXA 3PZRA 4MRAA 2JDIA 2A8YA 3EDOA 2B30A 1L5MA 4KKVA 5B55A 3HC7A 3FKQA 4WFJA 2R00A 3EC2A 4J0DA 3TQHA 5AICA 3H5VA 4PBSA 1ZU4A 1RKXA 2H11A 3ZDYB 3MJEA 5DMXA 1N1MA 4R81A 1DBWA 1FFBA 2ST1A 1MZPA 3PNKA 1KTIA 4D2IA 2CMFA 2I1LA 3ZJ4A 3WFZA 4G23A 1U2TA 5IM4F 3MSXA 2JAPA 2FMSA 3NANA 1RADA 3CN9A 1FDTA 3HM2A 2J4FA 5F2NA 4PRKA 3N2YA 1M5RA 1NF2A 1KYYA 1RZ3A 1PZGA 2IPXA 1THGA 5HF9A 3DM9B 2OV2A 4WJ3B 1EGHA 2W9CB 4B81A 2SKCA 4GPTA 4N65A 4OQFA 4RM3A 4XZ3A 1DZ3A 4BFWA 1TKRA 3AYXB 1W46A 3ZYZA 1LJUA 3W8FA 5IAEA 3GJ6A 5ESXA 5KL8B 3RS8A 1S7GA 1V1MB 5HFAA 3V33A 2DE0X 5CJ7A 1ZNYA 5J0PA 3AFGA 3D3WB 5LL6P 1MVNA 3O8NA 2M0NA 1G59A 4Z7JA 3EXHA 3GW8A 4CMCA 4FXPA 2WT9A 1YHZA 5SY4A 4HQ0A 3U7FB 1GNSA 1BQEA 1DFIA 4L5YA 2XGGA 3SPXA 4M0KA 1ZSYA 3QY0A 2D00A 1Y5IA 5AHRA 3TWOA 3ZI4A 2ZJ4A 5JAIA 2DECA 5EZ6B 4BGUA 2AYZA 1KY5A 1OSNA 4ZHQA 1HIWA 3MJTA 5BT8A 4KHPB 4V1CB 3BEDA 3HCAA 3OFND 3COWA 1ZW6A 5H80A 3IP5A 5JHGB 1Z8NA 1IMOA 4UBIA 4Q9KA 4QU5A 3ISJA 2P78A 4AP5A 1V96A 2L5YA 1NBAA 4MVYA 4EWLA 1U0GA 3PU6A 4XB1A 5J2BA 1Y37A 1FPMA 1F2VA 5DB6A 4Q15A 4CLHA 4QYSA 3PFHA 4P81A 1PQYA 1A9ZA 2VDLB 3KPUA 3L0IB 4YRPA 1VCOA 4K0RA 3C5EA 1WMEA 5F2KA 1JHQA 2J9RA 3FTEA 4CJXA 1ISJA 5KFZA 4L8LA 1TL7C 2I6FA 5DX0A 1HNZB 3NHRA 2O3QA 1SUAA 4F4IA 3DE5X 4X93A 3PXAA 1JBKA 1U0HC 1SXPA 1NOKA 4LK2A 3P0FA 3HCDA 8AT1A 2W2OA 3RU9A 4AP6A 3RVRA 4YJGB 4KLDA 4FEYA 3FOWA 1H3EA 1GZ7A 3DEZA 1WU8A 4RLQA 3URMA 3HKDA 1ZD8A 3I2IA 3TGWA 2XGOA 1FVHA 4DMLA 3UQZA 1TTHA 1FTSA 4ZAFA 1H23A 5KC9A 3TZQA 2ZXUA 3OZRA 2GYWA 1SBZA 3LLSA 2C5HA 3MLEA 4ZEVA 3A27A 3EC1A 4YJFA 3SFTA 2BEVB 1J22A 4B6GA 3W78A 3GMDA 2OORC 2VAXA 3VGPA 2QTBA 4D98A 1D8AA 4KGZA 1E1NA 5DTMA 3RF6A 2PBZA 4DY6A 3U7RA 3HYLA 2LIPA 2YXEA 3VNAA 4YRLA 2K2QB 1T3NA 3WIEA 1Y89A 3SF0A 5CMLA 2DR3A 4U4AA 4ZIRB 2ZSFA 2IIVA 2A5GA 3LUJA 4W7IA 1RR6A 2MSNA 1FDSA 5GV7A 3D3NA 2Q07A 5BPCA 3B2QA 2V3CC 3X2EA 1YS9A 4JGBA 2DUMA 1RYYA 1ZD1A 1GFZA 1UL1X 5E0KB 4RWZA 1GZSA 2ZI3A 3GAAA 2GN0A 1I7NA 2GD6A 1ZNQO 2QAGC 1RQLA 5F3DA 2PMKA 4URVR 4M9NA 1ADFA 3WGTA 4AFNA 3O8RA 3A6PC 5CDGA 4M1QA 3KV1A 1Z34A 3HBFA 2XB8A 2P91A 4R9UC 5F9MA 1MUUA 1XDBA 2A9PA 3ZG6A 4LHYA 5KWIA 3T7TA 3X1JA 3CBGA 3OOEA 1HE4A 1PFQA 2Z56A 4GXIA 3X2FA 4CEJA 4NNJA 5JCOA 4US1R 3H0RB 2ONKA 1BX3A 2E1EA 2DCUA 5GONF 2WD9A 3TTVA 2J3MA 1V0JA 1P18A 2ERCA 1VG0B 3KNZA 2BLNA 3LGXA 3NWJA 4BEBA 4L5BA 7ICGA 2LYHA 1ZD9A 1YC5A 2LBOA 2ANBA 4KMRA 3OA0A 4G9GA 2GA9A 5L4NA 2AQIA 2B4QA 1B8NA 4BNJA 4UTOA 2VDOB 4LI0A 1G3UA 5IZ4A 5DN9A 4Y3UA 2ZWIA 3UXHA 3ZCQA 2RK3A 4J16C 4N7RA 4DCVA 5IT0A 1ORTA 4EA7A 2C2OA 1PR4A 1CU1A 3K75D 4BFZA 1JIIA 2NV0A 2ZBPA 4H0FA 2FGKA 1VLHA 2HNKA 2F64A 5DYIA 1QHFA 2C83A 4P84A 5AW5A 4QYMA 3KBBA 2QP3A 4PFSA 4MICA 1N2GA 3RRJA 2V74B 2ZVPX 1NVGA 2R8ZA 1F14A 3B0XA 3TSOA 1MW9X 3KVNA 1NSFA 5CD1A 1IN5A 4HDRB 4CODB 2EZTA 2H2AA 1VJRA 1J42A 3HJHA 3GUZA 4B3MB 1SK8A 3L3FX 4YY3B 4OI0A 4KVFA 4EY5A 1VSBA 1YZQA 4J7XA 1NNUA 1KAGA 3K6RA 1CZOA 4B3SB 2CCJA 3L7YA 2AK2A 4DEVA 3OQJA 4EVSA 1FO4A 4MV6A 3TZ6A 2KG5A 1NN0A 3H4VA 5ETJA 3TI9A 4KIWA 1B6SA 2X3FA 2JIBA 4QBGB 5BNIA 1QPBA 4L0DA 2WHPA 3B38A 1FY2A 2GM5A 5CT4A 5EXPA 3ICVA 4BV8A 4MVJF 3TLYA 3ME5A 3QE0A 5E38A 4Q24A 4DG9A 3RG8A 2B7LA 2KD1A 4TXHA 4TZ6A 4Z9XA 3SQIA 3HU5A 4ER6A 4U8GA 5KNDH 3T7IA 5LA6F 1JDPA 1X7GA 8ABPA 1ULAA 4XLLA 1KMCA 2P5UA 1Z0SA 1N6IA 4F4CA 4YT5A 1Z19A 4KIGA 4UOEA 2G72A 3ND5A 3ITEA 3DR5A 4P2GA 4DLKA 3LLMA 4HRXA 4FNMA 4PQGA 4BKMA 5HJEA 1Z13A 2AUNA 4IR1A 1SOWA 4EYGA 2CYAA 4G5GA 2FEKA 1EU1A 3WXMA 4WXPA 2I9KA 4K2HA 3SQWA 5C2JB 1PYOA 1D03A 2DCMA 2PLWA 4J9PA 2OTCA 5CBKA 4WXRA 3UUWA 3L6CA 1L5HB 3IBTA 3CPJB 1QRRA 4D42A 3E7DA 2O2JA 1I4EB 2E2WA 2XT6A 2KMLA 4UDYX 4BQOA 2B1RA 2I0FA 4G41A 2BFBB 3IEKA 4ROTA 3SR3A 2QRHA 5HE8A 1L7MA 1RFGE 4DLSA 5CT6A 1RACA 1EK0A 3HL4A 4WKCA 4Z9FA 3WG9A 3FNHA 4FKZA 3V4OA 1DRUA 2HDHA 1UQRA 2FRXA 1NVTA 3AOGA 4M1EA 1KP2A 5BOVA 1T9GS 1SCUA 2E5SA 1F7VA 1HQCA 4DFDA 3WL3A 2HRZA 3M4NA 3WGKA 5AM3A 2BP7A 2N1RA 3RGGA 4RY0A 4MX8A 5DB8A 4L02A 3ZD6A 4D8YA 4CEHB 3ADBA 3RARA 3PXUA 1PN3A 2XQJA 4YACA 2CLOB 2KJ8A 1US8B 2QLBA 1XZFA 3QLEA 1D2RA 1NM5A 4INZA 1Z6XA 4G9BA 1Q83A 4OP3A 5FPHA 5KTNA 2OCKA 4QBIA 4HDOB 1K97A 3GNQA 5F2OA 3EUWA 1SKUA 4DLGA 3OJWA 1OFTA 2D4HA 3G85A 1X8KA 4UNRA 2LIVA 1J7JA 3EPRA 3FZNA 5FOQA 1FYVA 4D4HA 5BW5A 4JXZA 3IUPA 2ZYIA 2DKNA 3OKCA 4TVBA 3IAXA 1ECPA 2OYYA 1YKGA 1GG5A 5E6SA 1P0IA 3HX0A 4M9LA 3OFNA 4MUXA 4HTFB 2Z83A 3HXMA 1NI4B 5EHGA 1U90A 4IQGA 1IWOA 1G16A 1KMQA 2ZWOA 3I3SR 4RMGA 3TKAA 4YRBA 4GSYA 2WR8A 4CNBA 4ESEA 1R18A 2C03A 1LS1A 4DC0A 3DNFA 4Q9DA 2YJ4A 4AMGA 1BE0A 5EKXA 4WTOA 3G3EA 1TZMA 2MUTB 1EUDB 5FUQA 4G3XA 3L1IA 4QBHA 1JHMA 2WA1A 4J9NA 2QY6A 2Q4RA 3GWZA 4BN4A 1DAOA 3AVOA 4DQ0A 4HUQB 4XRRA 1PNRA 2AJQA 4OHBA 2IY7A 4XVCA 3MCWA 3RBDA 2V45A 4TQAA 4KIJA 4LDRA 1K7CA 4HT3B 3SJ7A 2FQYA 3SWWA 1V2GA 4NBTA 4Q9AA 1JDBB 3M2PA 4B3BA 1Z15A 4UZFA 5EA2A 2H1VA 3W9UA 1KDHA 3ON5A 3CGGA 4JJGA 2Q2QA 3WYNA 5F64A 3DWEX 1TA0A 5K03A 2HBJA 1KJ9A 2IX9A 3P96A 5AI9A 1U2GA 3Q3JB 1I2AA 1IY8A 4OX9B 3LCMA 2PRZA 3GFGA 3H16A 1CNMA 4GBGA 2PQ6A 3RR8A 3L0SA 5E9WA 5AVWA 3H5LA 1K3UB 4P83A 4ZOLA 1IATA 4GQAA 2WKQA 3C3DA 3HFSA 1DJQA 5MF6A 2JC3A 1X9GA 1UPXA 4IMJB 3S81A 4Q1FA 2IE8A 2QLMA 1FFGA 1K5OA 3CYMA 4E2XA 3OX1A 2ACEA 2QNRA 1DIGA 5L53A 4L8VA 4QUIA 1H1TA 2H5EA 1KH2A 1JQKA 3CRXA 2YMQA 3UV7A 1NW8A 4ZT5A 4YFYA 3D2LA 4FP9A 3WAKA 3SEQA 4NOJA 2EFDB 4D9GA 1PZNA 3DAHA 4PC1A 2N1MA 4FGUA 2PMWB 2XGJA 1EFPB 4GYWA 3IO5A 4PHCA 3K32A 3IP7A 2OHIA 1RJWA 1U1DA 5SYNA 3PX0A 1SXJC 2V6IA 4PYJA 4NYMQ 1G1MA 4W6QA 1BNCA 4OSPA 1WW3A 4A91A 2DOKA 4RIHA 5H3LA 4KPYA 2O50A 1VIYA 4DQVA 5ITWA 2QUIA 3OPYI 4JHLA 3P9SA 3I58A 3SKYA 3RBAA 1BVRA 5KG5A 1UBOS 4XVHA 3IE2A 3G0HA 3L7IA 2HA6A 5A7FA 2W4IA 2AE2A 4Q48A 3UMJA 1O6GA 4EQZA 4MHTA 3JVIA 2DHCA 3SSNA 4BNDB 3BRCA 2FAXA 4LYFA 3WRXC 3GJ4A 2FRDC 4RPYA 5AT1A 1N4DA 3NAQA 4BO7A 4OKSA 1MF7A 3OLWA 3IUEA 1PQPA 4YT8A 3RVKA 1PJTA 3O21A 5LWQA 3HVIA 4KB5A 2G0NA 4HAOA 2FPGB 4QDUA 5EKSA 3L7OA 3DMNA 2C04A 3W2IA 3LM8A 3E7FA 3V32A 4UPVA 5AOBA 2VP3A 4PCAA 4BVBA 1T1SA 4KL8S 5JALA 1E59A 3LPCA 3VH1A 2AQ8A 1NQ5A 2NT4A 2HJVA 3CLSD 1YL7A 3HXKA 2PTHA 3THRA 2YWXA 5BYBA 2PI5A 1W1WA 3LK6A 4NYIQ 4Y18A 1SB9A 3UIEA 1L7VC 1DB3A 4KI0A 1MMFB 1Z82A 2PMZF 2A0UA 1SB8A 1GN8A 3KB6A 5J2IA 5DGDA 1SV0A 3DYIA 4RUKA 2QW0X 5IXJA 3GRAA 3MQ4A 4CMAA 3RSZA 3ZWBA 4GI1A 4DV3B 1TU4A 4Q3EA 5EIOA 3UYLA 4REOA 4TLEA 2GCOA 2JKYA 2PUHA 3WOHA 2JFYA 3F7NA 3PJEA 4RABA 3H2YA 3IV6A 3C98A 1HBJA 4MR9A 1E5XA 1AA6A 1E9DA 5HUQA 2V0GA 2EJWA 2Q3EA 3U62A 4ZI2A 5HIIA 1SZDA 1UFQA 2NX2A 3K0AA 2O7VA 3PQ8A 1N5OX 2H16A 2JD1A 2IHKA 3AF4A 3A4TA 3PPVA 4JB3A 1DRJA 3H0EA 3FCOA 1Y6FA 3O74A 2H08A 4GE3A 2XVMA 5HZGA 1KP9A 4U8HA 4B4OA 4MI6A 4GO1A 4MCAA 1WMDA 1TJ5A 3KZVA 2RRDA 2F1JA 2ZUBA 2VWHA 3L7MA 3I1IA 4K81B 3F2BA 4BKRA 2FFAA 1Q46A 3MJRA 4XWAA 4ZH4A 1XTQA 4Q7EA 1R8XA 3TIXB 3I04A 4Z49A 1AX9A 1O0BA 1IHYA 2EZYA 1KE1A 4RCZA 2LTAA 2H4XA 5I9MA 3QKRB 3L8HA 4G0WA 2EHJA 4X7RA 1KQNA 4WOPA 4WK2B 4TQUS 3TG8A 1ZGHA 3M4JA 4QGHA 3R1IA 1J5EB 5KQGA 4EZBA 5I7AA 3AVWA 4MVWA 3PDCA 4QQRA 1PYGA 4C0WA 4I5DA 1YKSA 3SS7X 2V98A 3K70C 4W7SA 1ZI9A 5CYOA 3TLKA 2GBCA 3E58A 2Y0SC 4LPSA 6LDHA 1TIPA 4D0RA 3WGGA 3O4HA 1W4AA 2WMDA 2ZOSA 1XI2A 3R09A 1U0RA 2DTXA 5E0OA 5KFAA 3ZZUA 3QENA 2HRRA 1U31A 3DBRA 4ECTA 3UJCA 1NQOA 1UFRA 2CV1A 4ED9A 5B2EA 4L8FA 4AS1A 4ED0A 1HOXA 4GR5A 1T0BA 1AURA 3IALA 4PNZA 1S10A 2VQEB 1UBRS 1KE2A 1XZNA 5GJBA 4RHUA 1N92A 4GT1A 2GN9A 2YUIA 1HDIA 4J0KA 2VJCA 3R7NA 2A1UB 1NUUA 1IUPA 1GLVA 3U9LA 3MG9A 2QQFA 3PF8A 4TT3D 4OXXA 4C88A 2Z5VA 3HWX1 4DA7A 5J1SB 4UAGA 3HJUA 4IAOA 2W6ID 2UVWA 1Q3HA 5I9IA 2GM3A 4ZO9A 2XXAB 5TGTA 1Y8RA 1BVUA 1U7XA 1WCXA 4I9NA 1VPDA 3ZV4A 2QVLA 3A9SA 3BWMA 5ALVA 2ID9A 4MHOA 2P5TB 2VJMA 1QHHA 2ZB7A 3Q6IA 4H1UA 4MQLA 2O23A 3BMCA 3LBNA 4M9GA 3WL7A 1U5BA 1QCKA 1TO2E 3R9WA 4XUCA 3LDGA 4CM8A 3M5CA 3ZLUA 1CZKA 5DQHA 3AOEC 2IH4A 1A27A 4ER5A 4KAFA 2VNIA 3IPRA 5KTYA 1RI3A 5J63A 1MBZA 4YJDA 4QTYA 3EF1A 1AK2A 4FMDF 4DHWA 4PYRA 4JV0A 3DBOB 2JI4A 2IXDA 1FMFA 4L2IB 4JI7B 1DIHA 2HJSA 4Q3BA 4BYMA 4F4KA 3PSFA 1W5TA 4LDJA 5BNZA 3RSLA 1OGIA 4O4LF 2VK4A 2VUHB 5K0FA 3EEOA 4JLSA 3GX1A 4YGXB 4D4IA 5TARA 2P0AA 5E2AA 5CPBA 2VLIA 4ZO7A 3QKUA 1SXQA 4UAZA 2FPSA 3JALA 4JT2A 2EFJA 3IVAA 1VJGA 4EKNB 3AILA 4FDVA 2O20A 3FUCA 5C53B 4UW9A 2I2BA 2FSHA 5DEOA 5LYJF 4PNEA 3U19A 4IIVA 2HHVA 2RGDA 1EWRA 2HBKA 5ALIA 1U02A 1Y80A 1DDOA 5FT9A 2Q2WA 4F11A 2FA9A 3NGMA 4N7MA 2ODBA 2RHMA 4DN6A 4GU5A 3OEED 1CY2A 1QFSA 1EX1A 2YYZA 2H4HA 1J0XO 1FNDA 1B26A 1T2CA 1C0EA 3BFKA 4RK0A 4E0DA 1AA9A 3MFYA 4B9NA 3AUAA 5MN5A 2IQ5A 4TZTA 1IOVA 5CXXA 3S2SA 4MA4A 1X7YB 4LDAA 2Q2VA 2M6SA 5CDYA 1JDSA 4JODA 2SNIE 3D5QA 1VYVA 1J2EA 4CMEA 4WXMA 4PS0A 3BL8A 4C0LA 1K5PA 1YGYA 2D62A 3ZDBA 1ZOIA 1RYMA 1OX6A 1CQIA 3B6EA 1PBTA 2OWOA 3IS3A 4JSTA 4D0LB 1HOTA 2F1HA 1L4YA 4EHFA 1RAGA 1GG8A 3LV8A 2XVXA 3MF4A 5JECA 3KOXA 4MKIA 3I39X 1KRWA 3TSCA 1XJCA 4YP3A 4ND5A 4Z4GA 1Q14A 2DPXA 1JLKA 3EMKA 2VDVE 5I45A 5EJMA 2GTIA 1EMDA 4NS1A 3SM9A 3PR1A 1JHXA 4Q82A 3JQ6A 2HXGA 5JXWA 2NP6A 5KFGA 2GEBA 2HCBA 5J2UB 2O9JA 1KR5A 1LFDB 1AXEA 5CA1B 2RI0A 4UD6A 2UYGA 4RKYA 4ZMBA 2CNOA 3G0GA 3CW9A 3SHQA 2DQKA 4XGIA 3HDHA 1KK1A 4HK4A 3PFFA 1P3Y1 1F4PA 1U0FA 2CNDA 3DNMA 3QZUA 2WQ6A 5DCUA 2A92A 1N8TA 1DCTA 3KSUA 3B60A 1P7DA 3VTFA 4D9FA 3IAEA 1N3LA 4AQDA 1WW8A 3SYRA 5BNWA 2CJYA 6REQB 1KH1A 3T06B 1M2VA 2I4TA 4ZO6A 4MV0A 3KEFA 5KT6A 4ECEA 4GFDA 1DIOB 2H3IA 1MNAA 2XECA 1V7QA 1Q95A 4ABYA 5I01A 1V47A 4JVSB 4IF4A 3HRDD 2DPJA 2XMDA 1TCCA 3ESAA 3WKEA 2FF7A 5LZ7A 2K89A 2CHEA 4L4SA 1F8GA 1E5LA 2ZIZA 1U9CA 4OFXA 3INGA 4DRYA 3H8VA 3REQB 5CH8A 4KUHA 2QSZA 2DP4E 2P7IA 1GUDA 2QN9A 5K1ZA 3ADKA 2CUTA 2BEWB 2OKCA 4LJ5A 1T9DA 3B3FA 1JFLA 3U3KA 2J6CA 3HNOA 6AT1A 4Y6OA 3UWSA 4IVPA 1H2YA 3W90A 1T34A 3CLUD 4B6PA 3UMGA 4TMFA 5HBGA 3UK0A 3ZWKA 4CMJA 3WK8A 4ZOEA 1ISSA 3LHSA 4GGPA 2WU8A 4FC7A 5A9SA 1H4TA 4WWHA 2EJUA 1TD1A 3VR4D 3IQHX 3KR0A 2Q9CA 5K3EA 3PHIA 4MB6A 1R9NA 1ANKA 2NAFA 4BY9E 2Z2KA 4MAAA 2Y66A 3AKCA 5I7RA 4DA8A 4C2TA 3ZTTA 4YJ2A 5HZMA 4PIVA 2QLTA 5KS2A 2EKQA 1WPRA 3UBMA 3QUCA 4BTEA 1VE5A 4YJKA 2NVUB 4JMUA 3R5HA 3B2NA 3SNHA 3ETCA 5EE5B 4KLHA 4ELUA 4HZUB 1ECJA 3CZ9A 4XFDA 2QX4A 3IAS6 3G79A 3K9BA 2Z0MA 1A72A 2ZQ5A 2F3TA 3NUGA 4UTPA 1NKTA 4DQQA 1DADA 1HDZA 1XTTA 1BEEA 2GFIA 4Q01A 3ZGYA 4OSEA 3F2CA 3P97A 3LTEA 4P0QB 1YZFA 2VWQA 5TS3A 3OUUA 4X6YA 4GR9A 1QYVA 1TECE 4JI2B 2CLEB 3BFPA 3EFOA 3AL0C 1Z26A 1QOQB 4WSOA 1B41A 4NYJQ 1LZKA 2AGQA 3ZCVA 2CV2A 3JD3A 1OB5A 2AMFA 4CCYA 3WMWA 1FQWA 3I5UA 5B4TA 3BWYA 2AB0A 1SUIA 4RD0A 1EVKA 3E23A 4L9AA 1JU9A 3KVYA 4DR6B 4ZZ2A 3OE4A 1IK4A 3H97A 4MAFA 4CTNA 4IH9A 4RTLA 2IPLA 1UPHA 2ZU0C 2JCSA 4TLLB 4EENA 2C88A 2JFZA 2DFPA 4MCJA 2PUFA 3TJRA 1ZONA 5DQIA 1Y6JA 4O2AA 4WKBA 1TB4A 1U1GA 2VQ3A 5K0NA 1XWLA 1BYUA 4MB2A 2JL1A 1B16A 1KFKB 3ILSA 3Q1LA 5TY0A 4BQFA 2WAAA 4KBYA 4RVSA 1RS0A 2FW8A 1BFUA 2PGJA 1M6YA 4KXUA 5JS8A 3KEGA 3AEKA 1EJ6A 2RGWA 1ZQCA 3W8NA 1O89A 1ZN9A 3BTSA 5CG2A 4K87A 5TMEA 2RFLA 1N48A 4BVFA 4NNPA 2CXNA 1U81A 2X4GA 1DC7A 2JFUA 2C0QA 4FGZA 4A36A 3BK7A 4E5YA 4B6JA 4RBNA 1M2OA 3UXEA 4FCTA 4TYMA 3HLTA 5GZ3A 2CVPA 4RJLA 4TT3A 2PNJA 4UUNA 1FFXB 3HB5X 4V24A 4LZAA 5BY2A 5JTUA 3ZJVA 5KOYA 2BFEB 1D6NA 4ARZB 1QDEA 1UC4B 1EGMB 2D54A 3DOIA 3PPXA 1HRDA 2VUIB 1Y42X 1QG4A 3T3IA 4TYPA 5JJ5A 2QTTA 2B78A 2EJCA 3WQHA 4HGNA 2KHZA 2K8AA 4X85A 4RK5A 3HUFA 5K0EA 2ZTHA 1LBQA 1CRLA 4RSGA 3P0IA 1AKMA 3ORQA 5DOZA 2WNSA 5LIPA 1HQKA 1F2UA 4P82A 2H18A 2GCNA 3SF8A 3ACCA 2RG1A 1L9XA 4HLUA 4HV4A 4OG2A 4CMGA 2JLWA 1P91A 1Q3UA 4PO9A 4MDEA 1NF3A 1Q44A 3QVUA 3REGA 2H4JA 4MI3A 3JYNA 1PJZA 1UC8A 2NWQA 2B21A 1N6LA 4RESA 2ODWA 1BQ4A 5H82A 1EVZA 4CQMB 1XRJA 4D82A 5J40A 4A23A 3CT6A 3WGNA 4MITA 4DAEA 1XMXA 4QZFA 2H0AA 1BZYA 1GT91 4MR7B 3AM4A 5AXCA 1D9FA 2P2ZA 4YPOA 4RPZA 2VQ6A 2JA1A 5AKIA 3PZBA 2CDNA 1ZK3A 1FOEB 2GN4A 2PDAA 3SEFA 4B44A 3OEWA 3O4JA 4B3XA 4FQ7A 4ECVA 1BSVA 4MWZA 4KACA 4DOAA 5TEWA 5CX1A 4CL8A 5CVVA 5HTKA 1Q1QA 3AUUA 4I14A 1FFUA 5KTTA 1NBOA 4RIFA 5BUSA 3WU2U 3OEEA 2BHTA 2HIGA 1BCRB 3RF7A 3CX7A 5TVKA 5JNRA 2P1DA 4PYNA 3L9XA 5JU5A 4DCMA 3IOMA 5CEHA 4S2UA 5ALGA 1MNQA 2WU0A 1UM9B 3ZGVA 3KWFA 3BBPA 4LZGA 2D5CA 1FS5A 3R5TA 2I91A