3ZI4A

The structure of beta-phosphoglucomutase inhibited with glucose-6-phosphate and scandium tetrafluoride
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
218
structure length
218
Chain Sequence
MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Metal Fluorides: Multi-Functional Tools for the Study of Phosphoryl Transfer Enzymes
rcsb
source organism Lactococcus lactis
molecule tags Isomerase
molecule keywords BETA-PHOSPHOGLUCOMUTASE
total genus 76
structure length 218
sequence length 218
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2013-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3zi4A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3zi4A01
4CF3A 3QU5A 2O2XA 2FUEA 5AVRA 3SKYA 5AI9A 1O03A 2G08A 3HYCA 5AVXA 3U7HB 1ZD5A 2MU1A 4HAIA 5AW2A 3ZWDA 5AKXA 3WGVA 2D2VA 2W11A 3FZQA 1QYIA 3ONNA 2G0AA 2HO4A 4H1WA 4HGOA 2I54A 4J2TA 3W5CA 2OYCA 5ALWA 1LVHA 3A1EA 1VFPA 4I9FA 3WKBA 2HOQA 3R09A 1EK2A 5AKJA 3N1UA 3ZVNA 4KYTA 2FDRA 1U2TA 3MN1A 1K1EA 3BA6A 3OCYA 2RB5A 4UU1A 3ET5A 4I9GA 1Z4PX 5AKGA 1Z4QA 2FUCA 3AR5A 5ALEA 2BDUA 5ALYA 3RF6A 2MU2A 4YIHA 2GHQA 4XE5A 5AW4A 4JB3A 3A1DA 5ALMA 3QUBA 5ALGA 3HLTA 4HYTA 4DFDA 1ZRMA 5AIAA 2EATA 3P96A 5ALKA 2DQSA 2IYEA 3B9BA 2R8YA 4L57A 2YMPA 2ODAA 2EARA 1XPJA 4XQ0A 2HHLA 1O08A 4F72A 2CFSA 3I76A 2NO4A 3UMCA 4FE3A 1WVIA 2B30A 2YJ3A 2X4DA 2WF6A 3AR8A 3AR4A 5AM2A 5AKLA 3WK4A 5AI0A 3B8EA 3EWIA 5ALJA 3FGOA 3L1UA 2I7DA 2R8XA 3L0YA 3AR6A 3L1VA 3CNHA 2B82A 3PGLA 4G9BA 5AKHA 2AH5A 4HGNA 1NF2A 3WK7A 4Y2TA 2C8KA 1N8NA 1ZRNA 4UU0A 4IFTA 4YIKA 3L8HA 4L6AA 4UMVA 3AR9A 5IT4A 1SWVA 1JUDA 4KNVA 3OTQA 2AMYA 4KN8A 3ESRA 1VJRA 3U7GA 5AI6A 1Z4OA 2CN1A 2HEGA 1RMTA 1QQ6A 3R9KA 3S6JA 2WF8A 1CQZA 2AGVA 5AM0A 1YV9A 5AW6A 2P9JA 2ZOSA 2B8EA 3QUCA 5ALNA 3QU7A 5AI8A 4EX7A 3ZTYA 3M1YA 2GFHA 1L7MA 5AVSA 5AK6A 2P27A 5ALQA 2G09A 5AVTA 5A3RA 5AI5A 3I28A 5AW3A 3SLRA 2B1RA 2P11A 3NRJA 2WF9A 4HGPA 1J97A 1YMQA 3PCTA 4YCLA 4NWIA 4FYPA 3DAOA 4QQFA 2I55A 4BYGA 2YY6A 1J8DA 2ZG6A 4YCNA 1RKQA 1RPZA 1YNSA 3L8FA 5ALXA 3N07A 4UM5A 4B6JA 1RKUA 2YJ4A 4BNDA 2C9MA 2G07A 4ZEXA 5AKEA 3U19A 1QQ7A 4DCCA 5AW1A 5AW5A 5AKIA 3ZTWA 4Y2PA 4EZEA 1Z4IA 5AM4A 1U7OA 2ZBGA 1PW5A 3WKEA 4CF4A 1TJ3A 2JARA 3AR3A 4Y2SA 4BX0A 1ZD3A 4J03A 4XOUA 4AP9A 3UMGA 1Q91A 2P69A 3MC1A 3KOOA 2HF2A 2FPRA 2JGAA 1XVIA 2OM6A 5AM5A 1Z4KA 2CFTA 5AHXA 3WK6A 1RRCA 4UMDA 3E84A 1U02A 1S8OA 3U13A 2FI1A 5ALTA 3GYGA 3NALA 3WK9A 5ALLA 3L0CA 2NYVA 2B1QA 4Y3UA 3PDWA 5ALVA 5E0OA 4UASA 1TJ5A 4NV0A 2B8JA 2PKEA 4NAVA 3U26A 3M9LA 1QQ5A 3NIWA 3A1CA 1RLTA 4UM7A 5AVUA 1L8LA 2I6XA 4DW8A 3W5AA 2O9JA 4MUMA 2QLTA 2HDOA 4DWOA 1ZOLA 2ZBEA 4KX5A 3SMVA 4MWOA 4ZEVA 5AK5A 3RFUA 3UM9A 4ZEWA 1S2OA 3N28A 1YJ5A 3ZVMA 1TE2A 1X42A 1ZD2P 2YJ5A 5ALUA 5AM3A 4L6CA 4YGYA 1MH9A 1SU4A 1IWOA 3N5KA 1QH9A 1NNLA 3U7EB 5T41A 1L6RA 1Z4LA 2CFRA 2BY4A 4UMEA 4BX2A 1WZCA 4C4SA 3WKDA 3E58A 1T5SA 4Y2UA 4KNWA 3ED5A 3QUQA 5ALRA 2RARA 3OCWA 2NO5A 2HX1A 5AW8A 2GHTA 2YN4A 4Y2RA 3DDHA 2WM8A 1RQNA 2W4MA 2HSZA 2HCFA 1WR8A 1L7PA 3OCVA 1RLMA 2G06A 4OCZA 3ET4A 5JJBA 4CE6A 3W5DA 1FEZA 5IS2A 4OHFA 3R4CA 2FEAA 3A3YA 3AR7A 3CZ4A 2PR7A 3E81A 1Z5UA 2MSNA 4GXTA 2OBBA 5ALOA 4QJBA 3MPOA 3AR2A 3IJ5A 5IT0A 2PQ0A 2ZBFA 1SWWA 4O8CA 5ALPA 3QNMA 4BEVA 1Z4NA 4YCMA 1RMQA 3I1YA 3KDPA 2C8LA 3EF1A 3ZX5A 5AVZA 3DNPA 3OPXA 1Q92A 3ZWKA 4BBJA 1N9KA 4UW9A 5AVYA 1ZS9A 3KZXA 4BNDB 2GO7A 2YJ6A 2FPWA 2B0CA 4Y2JA 4AS3A 2VKQA 3I6BA 1AQ6A 2GMWA 2ZBDA 3N8GA 3ZX4A 3OCXA 1T5TA 1VJ5A 2HI0A 2FPXA 3D6JA 3FM9A 2QYHA 2G1AA 3NAMA 3PGVA 3NASA 4GIBA 1U7PA 4IG4A 3SKXA 3BWVA 3QU4A 2C4NA 4BKMA 3SF0A 3FVVA 4EELA 1WPGA 1L7NA 5AKZA 4RESA 3QU2A 3WKAA 1U2SA 5AW0A 2IOHA 1KYTA 5AW7A 4OFZA 2IOFK 2WFAA 4Y2YA 4RETA 3U7FB 3L8EA 2Q4TA 1EK1A 3QUTA 3UMBA 3QGMA 4BEWA 2FPSA 3QX7A 2JAUA 1RQLA 1Z88A 1L8OA 1LTQA 2RAVA 1ZJJA 4KX3A 1YDFA 3DV9A 4EX6A 3B9RA 4AS2A 2IA5A 2G80A 3QU9A 2YMMA 1F5SA 3ZVLA 3KBBA 3MMZA 3J7TA 2ZXEA 3ZUPA 5AM1A 4FFDA 2YMLA 5ALSA 5AKYA 1RMYA 4C4TA 5AVWA 4UMFA 5ALHA 3F9RA 1ZD4A 3KC2A 3E8MA 3L7YA 2WF7A 4PNHA 4UAVA 3QLEA 5A3SA 3ZU6A 4C4RA 5ALFA 2BDEA 1RKVA 2Q5EA 4EEKA 2FPUA 3OCZA 5AVVA 2JAOA 4EENA 5AK4A 3FPBA 4JDPA 1RDFA 3L5KA 2IOFA 4CF5A 2C88A 2Q4RA 3ZW7A 5FP0A 1TJ4A 3TLMA 2JAWA 3QXGA 5ALIA 1L7OA 1YS9A 4OD0A 4Y2XA 1RLOA 1Z5GA 4NABA 1T9ZA 4Y2VA 3WGUA 1CR6A 2I34A 5AVQA 2YBDA 3ZI4A 3K1ZA 4NFLA 2AUTA 2YMQA 4BX3A 2HF7A 4Y2QA 2I33A 3IRUA 3L0BA 3ESQA 3L8GA 3SD7A 3NUQA 4F71A 1Z4MA 2WHEA 2W43A 3WK8A 4CNQA 1Y8AA 1TA0A 3KD3A 4XPZA 4G63A 2RBKA 2EAUA 2R8ZA 4UAUA 3WKCA 2WF5A 3EPRA 5AIBA 2OA0A 4YH1A 5AW9A 1XP5A 5AKKA 5A3QA 3W5BA 4E88A 3OCUA 3VAYA 3NANA 1Z4JA 3SHQA 5AK3A 4HGQA 4UARA 5AI4A 3QYPA 3IB6A 3WK5A 2R8EA 1RC8A 5AESA 4UATA 2YFYA 5AICA 5ALZA 5ALDA 3FPSA 4HGRA 1NRWA 3EF0A
chains in the Genus database with same CATH superfamily
1NJWA 1U2DA 4CF3A 2XEDA 3HYSA 4KAJA 4Q4JB 5DV9A 3RYHA 4L16A 2JH9A 4LXXA 3OOEA 4U2GA 3PRHA 1B43A 4PQFA 2PYZA 1XP8A 3SIWA 4C89A 1H8HA 2I6SA 1GNQA 1L4FA 4FZVA 1WMDA 3PCRB 1O77A 3O93A 4EG7A 2AMJA 4AKSA 3IX7A 4ZI7A 2B69A 1TM1E 4X1IA 5LDGA 3RAXA 1RABA 4IIGA 3SX0A 1H1LA 3A3OA 3VPGA 2GAIA 4DYHA 1V6AA 1XDUA 1Z63A 4CLOB 2E48A 4H1WA 3M8RA 2Y4OA 4HGOA 1T9DA 3THYB 3WG9A 3WVNA 1S89A 1MO4A 2PXXA 3BDPA 2AT1A 4KE6A 2H00A 3O4RA 3HVIA 4PFJA 4QU8A 4RK7A 3RVLA 9ICKA 2SHKA 2SKCA 1O87A 1L5YA 4YMHA 5HRCA 4CFZA 2B3DA 3CRQA 3NT4A 2XWJI 4DM3A 4J6FA 5AKJA 2JGDA 2W6PA 4MRRA 4EG6A 3O31A 3DNMA 3IEKA 5DB7A 1XTJA 2F6RA 4UDNA 4E09A 3J80A 3JD1A 2DR3A 4LISA 2EKPA 2OZLA 3EW7A 1DBQA 1U3CA 2F9FA 2FR8A 3LJKA 4FDUA 2ZI7A 3ZE1B 2RB5A 1FFAA 3ZWMA 2GWSA 4HTAA 2HHSA 4XWOA 1B0AA 1DO0A 1Z4QA 2VTVA 2ZSBA 2DLNA 1C7EA 3BZBA 1L1RA 2Q9CA 1P0MA 4KI7A 4YAFA 4ECAA 4JEUA 3H13A 2DPHA 3FSRA 1F6WA 2H17A 4DMHA 1T1JA 4DA7A 4LBWA 3E82A 3HJHA 4RK6A 3N0VA 2DOKA 2GHQA 4JB3A 4YTEA 5E3IA 1QP4A 2CLEB 1UBGA 3RVNA 2E85A 5EQJB 3KZKA 2HPAA 2W3SA 4LMBA 4HB3A 4XKJA 3OOWA 3GLFA 4FINA 3GLHE 1ENZA 1Z5NA 2CDBA 3LVBA 3E53A 4RTLA 3AQEA 1PWHA 1LSUA 3KKAA 1MB2A 2JDID 3BN3A 4HEQA 4IMIB 1J0CA 1RAEA 4XVRA 5JG7A 3W9BA 4MWGA 1CR4A 4C5CA 2QRLA 1W85B 5K20A 1BDMA 2GD0A 4LF8B 3SZMA 1HI9A 3ROXA 3KXKA 4OQQA 2Z1DA 1TUIA 1PR1A 3AJAA 4RKYA 1J8FA 1H2AS 3OF3A 3KVRA 4IDOA 3FNGA 3CE9A 4EUFA 3QVMA 1UMBB 4ARCA 2UZ3A 5JUWA 5DOVA 4D92A 3U4IA 2HHTA 2RHJA 4YAUA 3CNHA 3I12A 1JRPA 4BMXA 5KDOA 1NN1A 1OC2A 3H1FA 4PICA 3KQQA 4Z1OA 2Q7XA 1JWLA 3QXSA 2C0CA 3GJ8A 2VJCA 4I08A 1V8BA 2M6KA 5DBBA 5GMOA 1YA8A 1ZRNA 1VL5A 2ADFA 5DN9A 3C2MA 4WCDA 1FX1A 2IUUA 3L8HA 4UMVA 2INGX 3W77A 5EXTA 8GPBA 2IC5A 8ICEA 3H0EA 1NJYA 4IJQA 4EHKA 1HE5A 3FSJX 1B4DA 1T8UA 3ZDBA 1SL1A 4FYYA 4P4NA 3I73A 3FWHA 5FIUA 3PNVA 4G07A 5JI2E 5AI6A 1NDUA 2UUAB 4UFPA 3DCJA 2H52A 2ZUVA 5AQEA 2H7CA 3JQDA 2VK2A 4N41A 1O8CA 2R8PA 3DMDA 4TRRA 4X5VA 4FM9A 1X9WA 1QG2A 2VJQA 4KPUB 1JMKC 4PXYA 5J2TB 7ICEA 1JX6A 1CZRA 3OEHA 4PANA 3ICPA 1NXVA 3WQBA 4BJ1A 4DCTA 2V7EA 4B2PA 1N5LA 3ZGVA 3A2LA 1RM6C 1CB7A 1VPTA 4V2IA 1TAUA 4KAAA 3ZOZA 1TIPA 3EQ9A 2WQ7A 4V0QA 2EZ8A 2OUKA 4JLAA 3LUDA 4RZ2A 2OYRA 2WB1C 3UB2A 5EEHA 1EFAA 2XCAA 3E7PA 4ZDIA 1Z7YA 3PUZA 3VC1A 4NS4A 2CV2A 1BEZA 1DX6A 3EOBI 1QHHB 2BCQA 5T4EA 2OZPA 3I2YX 5EXPA 1CUKA 3BAZA 4HXFB 4WXHA 3LT0A 3DMTA 4ASUA 1COKA 1PS9A 1T2EA 4WOJA 4WADA 1N5WA 3HJCA 3AESA 3K9WA 4AMGA 5KNCD 5G4KB 3OECA 3RAEC 3FPKA 3IMKA 1FFEA 3E2PA 2HV8A 4RGVA 4FYMA 4C2BA 5JAHA 1C7RA 5AXDA 4PO1A 3FMVA 2D0DA 1RPTA 5E7JA 1P2FA 1VTKA 3R5KA 5FUQA 4HLQB 1YT5A 3IIIA 1CXZA 1P39A 4AFNA 4BQSA 4Y9SA 3ER8A 2HV9A 5JS8A 1E2KA 1ADGA 4CFYA 4Q4AA 5K6TA 3AIMA 4DO9A 3H4BA 2GS9A 4E3ZA 3W5HA 1J2MA 2F9LA 5AVKA 5HF5A 1J23A 2HO5A 3PNMA 4Q37A 2VJLA 4GGMX 4WOBA 3WGQA 4JK3A 4FC6A 5CT5A 3I8OA 9ICUA 2R60A 4FJ2A 3EQ2A 3HWWA 3KKLA 2HT6A 1P81A 1A9ZA 2XQIA 2QJOA 3A1FA 4FMBB 3RTAA 1X7WA 3DKVA 4OQ4A 4CLRA 2J3MA 3FNRA 8ICJA 1KAHA 2VHJA 2FP4A 2X42A 3L7JA 4ZHQA 2A9OA 3CCFA 3FHOA 1HDIA 1VMAA 1Z4IA 5CJPA 4JI2B 4TQAA 2EAMA 1ISHA 1CE8B 2D2FA 1Z6TA 2QZ9A 2ZBGA 3F98A 4FZRA 5C80A 4ED6A 1SH7A 2OCEA 5EZSA 1UKCA 1C20A 1G8MA 5EIEA 2BUCA 1D1SA 4G0UA 2ES4A 1F4LA 4ZVPA 1RHJA 1P0QA 4BX0A 1UEIA 1J24A 3EDCA 4MWZA 3I2FA 2P69A 4KK3A 2H1VA 3T3PB 2QVLA 3CZ5A 4JQCA 1SKRA 2FF5A 4GP7A 3BBPA 4XFJA 4AUEA 4M9HA 4OQDA 4WXEA 5ENVA 4DKXA 1EPUA 2WB2A 2OOKA 3CWCA 1UXIA 4ZH4A 4PFKA 5KG1A 1CRPA 3HO8A 5SY4A 4RJJA 2I4RA 2P41A 2JCBA 1SC6A 4KE7A 5B58C 2CV0A 1IN1A 5BNZA 5FTJA 1D1PA 4I3FA 3BIXA 1M6VA 4YN4A 1MIOB 3CR3C 5CDGA 3SQWA 6REQA 1V5IA 3MJTA 3N7UA 4DE5A 2CLOB 4CV0A 4JV1A 3RRGA 1VLHA 4EJSC 3GJQA 1Y1TA 2QM8A 4NAVA 3U26A 5ECYA 4ZVSA 2BMWA 1BWPA 2ODQA 2Q6KA 2AKAB 2KKPA 2QL9A 1LPSA 3GJXC 2OHIA 3FB4A 3K72B 4G67A 1NBAA 4M1YA 2Z6AA 3GF4A 4IXWA 4P08A 5KKCA 1JFTA 4BKOA 2JJYA 1DQPA 1YBVA 3CGWA 3M3HA 4UM7A 4F2WA 4RNDB 2ZSFA 5FEMA 1KOGA 2FZCA 4LPKA 1EFTA 2HMYB 1KP3A 5IDYA 1G4HA 1GQYA 1X39A 5J8YA 4HATA 2B8TA 3FKSA 5LOVB 3RJEA 1FP2A 1WDTA 5K8UA 3MJSA 4NLNA 2GXUA 1D8LA 2QLTA 5THQA 4BNJA 4I2JA 1ZMOA 3T41A 5L95A 4I5FA 2VDLB 3RH4A 4F4HA 2G6BA 4N1AA 3M6AA 4W1RA 9ICMA 2VCYA 4LRTB 4EO4A 2XZLA 2UXBB 1F0MA 1EGAA 3IV7A 3KVYA 3WYBA 4A36A 2IUFA 4E32A 4PY2A 2P9EA 2D1RA 4C8NA 1GNVA 2RBEA 4G1CA 4G0YA 1D4AA 4PIMA 2V55B 1YJQA 3PTLA 1S8FA 1HDRA 1MH9A 1ZLXA 4GPTA 4HBGA 4OQLA 5DHPA 1CR1A 1E61A 2B1IA 4AURA 5MFZA 4XIGS 3GAMA 5D3KA 3U9SA 3MJCA 4BQNA 3V6KA 2YS7A 1QAMA 4HQ0A 4PRYA 5FR2A 3STYA 3AVVA 4LXTA 2FCAA 2Z98A 1KL7A 3ICWA 4GU5A 2QD5A 3LSTA 4PTLA 3VDXA 1UWVA 4JY7A 3ZZUA 1KJJA 1OB5A 4K1LA 2ZWIA 3ICOA 1QR6A 3T7TA 1NBEA 4Q82A 1RLJA 4FFBA 2Q4OA 4PYIA 4XJVA 3C3WA 2J0SA 5CP8A 3VU9A 5EJGA 5KSYA 4TUYA 4QOHA 5CVTA 5IXYA 2GFIA 2VNJA 2HCFA 3NTUA 1ZXLA 3SI7A 2QNBA 4WK2B 4HYKA 5KYYA 2WPNA 3DFMA 1QYRA 4ZTBA 3BIOA 5BYAA 2B6GA 3RFAA 1PR5A 2YB1A 2CNDA 2IJGX 1XJWA 2JGIA 1GU7A 2JLRA 4FILA 5DEOA 3T3NA 5THXA 2FG5A 4PSDA 4WCFB 1AH2A 1ZUHA 3L8YA 5U9CA 3L40A 1NX6A 2BD0A 3D8TA 4UZFA 2GJKA 2IHNA 2VHYA 4J90A 2GXSA 5SYAA 3ZIAD 4H2DA 1K89A 2C3UA 3E81A 1EK0A 4JCCA 4MUFA 2IPNA 2WWRA 4IQVA 3OO0A 4UBOA 4MO2A 3HJRA 3P4UA 3TNLA 1WDLA 2QF7A 3AR2A 3HP1A 1U8FO 1JR6A 2UVPA 1Y8ZA 2ORYA 2R8JA 1O96B 4EW3A 1I01A 1WBDA 4K4IA 3ZZMA 4NTZA 1A1SA 1IC6A 1UKZA 1JQEA 4JZKA 2QTRA 3CEHA 3MINA 3Q3VA 1WW2A 1YKFA 4EHAA 2R6GA 1YZTA 5HOQA 1ZLYA 4WCVA 3A1SA 4C01A 1RYMA 2W9CA 1YS7A 4K9MA 2I4IA 3PDUA 5I9MA 4QXRA 2J3LA 4PX3A 3ZGXA 4XTRA 2HSWA 3MLAA 5D5PA 5AVYA 5KU7A 4CEIB 1HOTA 2Q5JA 1NJ6A 3NVYA 1SCQA 2XYVA 1JLKA 4HGZA 5I7RA 4IC9A 5K3FB 1XYYA 3ASVA 1XCMA 3GGCA 4Q19A 1J1ZA 3HK2A 1AIPA 4JXJA 3WL8A 1PS0A 3ZIDA 8ICIA 4FZJA 5CITA 3O3MB 3KVVA 1U1FA 5KFVA 2C22A 1PZMA 1JDBB 3FYSA 4TLDA 1LA2A 2LM4A 1B73A 2NQTA 5E7IA 4C0QC 3GLFE 1XZCA 4MA0A 1T36A 3Q8XB 5EMNA 1U7PA 3DZBA 3GA0A 3COVA 4FKZA 4IG4A 3ZXSA 2RHBA 3PXUA 3IQIX 3FVVA 4FFPA 4EELA 3T1OA 4K8OA 1QZUA 3USZA 4LZPA 4X94A 3UJNA 1FNNA 2QUJA 3QU2A 2Y6VA 3H40A 4LZNA 4PVCA 1R27A 4BNMA 3ZGNA 2NU9A 4M0UA 2AZ4A 1BC5A 3CF6R 3UBMA 4DCMA 5KFXA 3R75A 2IYYA 2E49A 3G6KA 3OVMA 3P9RA 5TF0A 4UAGA 5AW7A 2XCIA 3MGCA 2OB2A 3L92A 4E3WA 4AWBA 4CM8B 3U7FB 1O89A 1P4RA 1BD3A 5E9JA 1FBNA 3O38A 4EZIA 4EYHB 3QUTA 1SKQA 4RUCA 2ECPA 3AETA 1CDEA 4DV7B 4A23A 4REQB 2QVGA 2H7YA 3QGMA 4YUYA 4Q1FA 4PEVA 1SUPA 4I99A 1N56A 3K0FA 2CC2A 4Q9HA 3WNCA 5JWRA 1CJTC 4QXPA 4TQ9A 3HKDB 1OH7A 2VA9A 1NLUA 3CLVA 5CLLA 1F8YA 4XA8A 5LOVA 2PVPA 4ZT5A 1STOA 1F38A 4E5MA 4KX3A 2V4ZA 1P4GA 4RM3A 1JDBC 2PH7A 1GV1A 3LXXA 1AXGA 4M1KA 4ZYXA 2A86A 4KYUA 5DGIA 3H8WA 3NBQA 3MGIA 1ZQMA 1KFCB 3NR2A 5LVAA 2UUOA 4MHVA 3PI7A 2C4HA 3KBBA 3F2BA 3N39C 4M8SA 5J0WA 1SXJA 4CEHB 5AM1A 1H69A 2ZU6A 4FFDA 3UPDA 3KAPA 1DAEA 3RVSA 3U4QA 4NZYA 2HPVA 3RB6A 3AILA 3EULA 5NULA 5SZIA 3G0GA 3P0RA 3JD4A 3N8IA 2DHEA 3UJBA 2C99A 1Q7BA 4NLLA 2GAOA 3Q3JB 4DLKA 4DSAA 2BSAA 4KQIA 3I72A 4RS3A 4V0ME 3P0HA 3U0BA 2W4IA 1I94B 2XWPA 1UKEA 1GL9B 1SVUA 3V7NA 2P2CA 2A3NA 1CZHA 1WJGA 3FUXA 3Q7IA 4ACAA 1GZ3A 3AP3A 3Q7EA 4ARUA 4UAVA 5A3SA 4AXBA 3GLRA 2WWXA 3GFPA 2HBMA 4ZU3A 5KYYB 1HG0A 5FJJA 4LG1A 5DT9A 1JZTA 1CS0A 1WCV1 3RJJA 1JHZA 1P62B 3BX1A 4PLTA 3V48A 5JV5A 8ICQA 2C9ZA 1T9GS 5E38A 1WB9A 3H4MA 1RDFA 2BGLA 3SNKA 2PX8A 3BD8A 5FP0A 2KE7A 1OF1A 2GYWA 2OK7A 2GERA 4L0MA 1II9A 3U17A 4MQEB 1L5KA 2P9HA 4GI1A 1PGQA 4YGXB 2JIBA 4IINA 3NMUF 3GFBA 1Q0HA 1NX9A 2ODNA 4Q3DA 1C4WA 4RF4A 3A4VA 3S29A 3E15A 4J76A 2XDQB 1XQYA 3CVWA 2JEZA 3JTEA 2PL9A 4L4UA 3FH0A 3RJZA 2ZIVA 2VP0A 3UC9A 4A7PA 3NO4A 4OGGA 4RMHA 3GYBA 3PWSA 4UFOA 4CR7A 2BZGA 5IEJA 3MFHA 5LR6A 1G6Q1 4RMNA 4A6DA 1VSQA 2RGYA 4KAFA 3A3NA 1V1JA 4X1YA 3ZWXA 1P6XA 4AZSA 4LDQA 3G49A 5KX5A 4BO4A 5JARA 7ICOA 3BXGA 4Y2QA 3VR1A 1X3LA 3WTCA 3CN7A 2PX2A 1FC0A 3LVRE 5KFRA 2NO9A 3MCZA 4GR4A 4H7FA 3DUFA 4B5KA 1C3EA 1LRJA 3EXHC 1P5ZB 3H9QA 5B7NA 2W43A 5DK4A 4P32A 1XTIA 3DT6A 4C07A 1C1XA 3KD3A 1I1OA 3AZOA 1YZKA 3ASZA 1E2PA 3E9MA 1G7SA 3P4XA 2HDHA 3R3YA 2VUHB 4YPVA 1P8AA 2ZAOA 5LNK6 1YDEA 1JJAA 1TJYA 3EPRA 10MHA 4BXOB 3CEPB 1JEAA 4FS1A 3QFTA 3NZEA 4UOQA 3TBFA 5K01A 4EPVA 1B3BA 4NV1A 1F2TA 5L4LA 1Z5ZA 3NETA 4O4IF 3UAGA 4EJ6A 1KFSA 1QGOA 5EG5A 3V8QA 1KEKA 4XA5A 3L0ZA 1FDVA 4K9QA 1Z4JA 3AEYA 1PV2A 3DNFA 4CLOA 2VAPA 3S55A 4I2VA 4DCVA 5HIIA 4ZJZA 5DM70 1F17A 7ICJA 4XD7A 4WNYA 2J6SA 4K4HA 5IYZB 5LMZA 2PH5A 1SXPA 2CYAA 3N7SC 1AA6A 4EM6A 4WRRA 3B0XA 3MWJA 2BFEA 3BWCA 4M2LA 3VC2A 4PHPA 4KV7A 2Z4SA 2D4AA 1OXKB 3M6XA 4HO1X 1MA3A 2J9FA 3TJMA 3VKUA 3WQSB 4QZIA 1NQUA 3PIIA 4FYKA 5E95A 5H02A 1OX4B 4BX9A 3UXEA 2H11A 1YB7A 3GZFA 4U2DA 2C29D 3W6UA 2Q2OA 4KQMA 4NOKA 4KV9A 3KOZA 2FSUA 3IHQB 2EFGA 4HRYA 4JROA 1EDBA 3RYCA 1BGWA 1ECBA 1RXCA 3W7VA 4DXDA 4E4RA 1WCIA 1DC5A 4DGQA 4D0RA 2ZIEA 2WNHA 1ZNXA 2OMEA 3K7EA 5C1PA 1DHTA 4X24A 2PN1A 3LK7A 3QVOA 4BS9A 2W11A 3H2BA 3IP4B 1VA4A 2X5JO 3IMEA 4DQXA 2IW3A 5JRJA 2JIRA 1QG0A 1BXRB 4PPGA 4DWVA 4TXMA 2I0FA 4MR7B 3IT3A 1URJA 2R3SA 2YHSA 3M6WA 2XY7A 1KE1A 1FVFA 3WHIA 4CTOA 3GEDA 3IHWA 1BTOA 3LM8A 4C4PA 1FTWA 1UK7A 3EPJA 2FE9A 2XMGA 4LNUB 3VNSA 1MENA 5FOUA 1MQSA 1RWXA 1PWXA 3EVFA 3PNYA 2LBOA 3KT6A 2J0UB 2O59A 5CHYA 5IIJA 5CLIA 4F3KA 1VHJA 3N8HA 2HN9A 1IWPB 3QEOA 2AJDA 1R0CA 3GUVA 1WNTA 3PXDA 1NMXA 1NUAA 1PU2A 3N8KA 1K6JA 1NFFA 4JC5A 2M6LA 4E70A 2C3MA 1YSCA 4DQUA 2BGWA 1TK0A 4OHOA 4CKZA 2ZUSA 4W5WA 2VAWA 1E18A 4YUXA 2VF5X 3ZG6A 4QXAA 1HA3A 1X94A 2CW5A 4QZCA 4DCSA 1E4YA 1T5HX 3RBEA 2FUG6 4L22A 4OHBA 4QLAA 4R8MA 5C8YA 3SE0A 4AZ3B 4BKPA 2QE7D 3V6HA 1TVKB 3AZQA 4JMUA 1JDTA 3FAKA 1N5DA 5JBQA 3UT0A 3UMYA 1PZNA 3O4FA 4OOFA 5KDLA 5C3MA 5M34A 3DV2A 1JDJA 2RP5A 4S1VA 3M6KA 2HA7A 5B3AA 3S1SA 2GYYA 1F0KA 4QVIA 1LQTA 4EYIB 1E5VA 1JFLA 2FDCA 3WRVA 3I76A 3U3XA 4U7CA 3FB1A 4FEAA 2D3DA 2PZKA 2PO5A 1E3DA 3SC6A 2EQYA 3VKFA 4B3TB 4LWQA 3B85A 2QV7A 1I1QB 3TQRA 3I9MA 4BO2A 1ONOA 1OSNA 1V35A 4J29A 4LWOA 1XTUA 5T3UA 5F3XB 2BR5A 3IO5A 1COOA 1I2CA 1FSPA 4DG5A 1QBGA 3FCOA 2P2YA 2X1LA 4I1OA 1MLDA 8ICSA 4Q7KA 3V1YA 2Q4EA 3U61B 2JHAA 4HY3A 4N3NA 3G6XA 4JX9A 4BZPA 1ENPA 3PGLA 3S81A 3LTNC 3Q98A 1KI8A 1HSOA 4ETMA 5C8DA 1S0OA 3UQ2A 3W8RA 1Z6AA 3QF7A 5TQJA 5H59A 2HEIA 2WD9A 1L7BA 1Q7TA 2BCEA 3ZWCA 4PX9A 1K63A 5EXXA 3TFRA 4C8OA 3VO9A 2I3BA 1IZ8A 3KTQA 3CVYA 4CRWB 2P35A 2CN1A 5L1MA 2KBFA 2YZ2A 1KOFA 5LDDC 1WMEA 1RMTA 3P9ZA 3W7AA 4MKZA 1QQ6A 3DVSX 4P58A 5U1PA 2CSUA 5EIAA 3DE2X 3X43A 4DRZA 1LBEA 3H2HA 3SAHA 2J6TA 4HN9A 5DN6D 4QSHA 1W36C 3ORQA 4PWYA 2P5UA 3EEIA 4RQ0A 4LY9A 4EX7A 2V7PA 4HXGA 5LQCA 2WFMA 4C7KA 2OE2A 4Z6DA 4UBLA 3V2GA 3ZE0B 5C81A 1DAFA 1UCFA 4GQAA 4IUDS 2PS9A 4F2DA 1XU9A 1US8B 2HA3A 4OMUA 3U62A 3Q3CA 5DXJA 3V4RA 1GCAA 3A58B 3OZRA 4XLTA 3D2NA 2HGSA 4MVYA 5J2UB 5K0BA 4RQ7A 1H93A 3CMCO 3FWNA 2F44A 3LBHA 3MBOA 2N42A 3GNQA 4IDQA 2RHLA 4NKRA 4RMGA 4F8YA 7AT1A 4U7TB 3OZGA 5CPBA 1EVLA 3IAFA 4XZ3A 1SU7A 1JSRA 2ZT5A 4OXNA 4HGPA 2TRSB 2X5KO 3CXUA 4MP6A 4NWIA 1F6BA 4HDSA 1GRQA 2Y77A 1U4NA 3QPAA 1W36B 4IS2A 1NA5A 4IYRA 1JECA 3AB8A 3KZOA 4IVRA 3H04A 3KUXA 4BPRA 2HREA 3SF8B 1PTJA 1TRKA 1YNSA 3K9FC 4EABA 1ZJWA 2F8LA 1C9MA 1PUJA 4PINA 4OM7A 1MQ3A 1VZ2A 4HI0E 5BQPA 2XR1A 5KYVA 3VJMA 4XCVA 3ZV5A 3RT7A 5B6IA 4L5AA 5I3ZA 3IURA 3FSEA 4Z53A 1Z17A 1K7CA 1ZL2A 5JUMA 3KDAA 4M0DA 4X3PA 2NU6B 3ME5A 2GD2A 1DCMA 1IN7A 2WV9A 3HA3A 4WZAA 3AM1A 1WSDA 2QK4A 3DLIA 5B1YA 1Y9DA 5JMTA 1P74A 1Y5NA 2Q3LA 3ZTWA 4JJEA 4CYMA 3LNTA 4LE1A 3UJPA 5EUBA 2AFHA 1ZHOA 3SR6A 2DHRA 1U7OA 4R16A 5A6SA 3L7NA 2NGRA 4QT0A 1MAAA 2I2XB 3IMGA 2FR0A 2QTTA 1DDIA 5DWDA 4Y2SA 3KHLA 1IVSA 2V1UA 1N2HA 3T5JA 2AOXA 4Y1FA 4NK4A 2XSZA 5FADA 1KYIA 2I7TA 1ZESA 1JU9A 2FKAA 1BD4A 3L02A 1W0JA 1Z4KA 4MYDA 4CODB 1YD7A 4EDFA 4EF6A 1S10A 5HK9A 1Z0DA 3JU3A 4QU5A 1BPZA 4RZQA 5AR1A 4YJFB 1G9TA 2IXFA 4I6EA 1S9FA 3FDIA 4DY6A 2DETA 2FQXA 4LC1A 3T0IA 1QX4A 4KLSA 3SZLA 3ENKA 4EY3A 1JIIA 1OFTA 1TVMA 2ZB7A 4C08A 4QDZA 3H5TA 1FDSA 3L0CA 1DKRA 5ANRB 4YRFA 4UASA 4Z7OB 4R1PA 1BVYF 4NBNA 2B8JA 4EMBA 3TW8B 5TS3A 1G3MA 4K81B 2EF1A 1KJZA 4X91A 3RB4A 1UPBA 3OQBA 3MOGA 5CCDA 4ENRA 2ZTVA 2WHYA 2QM3A 4UHHA 1ZUIA 4XM1A 3ZY4A 3SVLA 3QE4A 4BLSA 1S0NA 2WDZA 1QRUA 1ZQXA 3ZGLA 1XA0A 2WAOA 5GZ3A 1TK3A 4KLUA 1S4MA 1MC1A 9ICOA 2AJTA 1Y1LA 2WYIA 2PNJA 3T99A 3U3DA 1KRWA 3UCEA 3PWZA 1EM8A 4S1TA 2VVTA 4LWPA 3LKVA 4YRTA 5F2KA 1B23P 3QLVC 1LX6A 1JDVA 3ID6C 4EYQA 3KQHA 5AK5A 3FNBA 1V5FA 1LXCA 3PFBA 4YAJA 1M7GA 5HQTA 5JO9A 3ZDQA 5EYPB 1VLLA 1UR5A 3LV8A 4C76A 3AHDA 3K30A 3HXKA 2C5AA 4Y1RA 3PRYA 4EI9A 1FK8A 4YBRA 1UBRS 2WHXA 3QVVA 5IN5A 4NZOA 4OB7A 2BQUA 1WDMA 3BIFA 2P7IA 3EIEA 4K2HA 1QV6A 1C81A 3MJHA 5DHTA 3KR9A 1U28A 4BJ5A 2H2WA 4IY1A 3UXPA 2IYQA 3HACA 4EVRA 5CB6A 1QIEA 5HZGA 4C4SA 1PT9A 3I01A 3SHTA 3D4IA 1W49A 3TEMA 2V5UA 1KMHA 4M9SA 1DFGA 1OXMA 2W9CB 4J9PA 1UZMA 4AJHA 2NSYA 1B8UA 4F3YA 4TTVA 3EZYA 3PXAA 3FCEA 3ZLTA 4L27A 5IKEA 4B8YA 2WP8J 5CLQA 2WM3A 1GDTA 2Z8YM 2FUG1 3N5CA 5TQVA 3X3HA 4ANFA 5JANA 2W54A 2FFJA 3RHSA 1QLWA 1O0CA 2CXYA 3BJMA 4G26A 5KTOA 1EUZA 3BE4A 1PR2A 1CULC 5H4HA 2OHJA 3T8YA 3PR3A 4PN7A 5L9AA 1ZQUA 3PNKA 4LJRA 5EL0A 4ALLA 2XJ9A 3THWA 4WKOA 4O4JA 1ZAKA 3JVVA 1J1IA 1UJ4A 5CT9A 4RNNA 1JJ7A 1AUVA 4QBGB 5JAQA 3MVEA 2PI4A 3QELA 4BWGA 3UFXA 4QM6A 1Z47A 1XMSA 1FUYB 1J2RA 3A3YA 2P6NA 2K7ZA 4KXWA 4MMXB 4X1KB 4LKOA 5F76A 2ZI3A 3I05A 4BVKA 5DO9A 4ZCIA 3PD1A 2IHUA 3PVSA 2ZYTX 5ER6A 3TE6A 2Q29A 1U8ZA 3HXTA 4GS5A 5EFOA 5K03A 5LOVF 3OEEA 4G1BA 5BSRA 3Q2KA 3IULA 2HRDA 3OUZA 4BQRA 1RBMA 1XELA 4Q03A 4DLXA 4DFJA 5A3JA 2C9DA 5MHTA 4B8ZA 5L1JA 5FJIA 1GZSA 3O4GA 3ND9A 4NYMR 3R8CA 4EMUA 5KC8A 1ULAA 4JP2A 2M0NA 3QNMA 3EVZA 4UUAA 5T4HA 3RRYA 4BEVA 3ZD6A 3IUEA 3HB5X 4G56A 3EF1A 3MQ4A 3RVOA 2JI6A 3VNQA 2IXBA 5FA6A 3LX8A 2WYVA 3RS4A 2HQSA 3MZ0A 2HPZA 1KZ6A 5LPNA 1F12A 2V96A 4TS1A 5C4MA 1UOOA 5CLGA 4YO8A 1OT3A 2C61A 3EYAA 4Q7MB 5FA8A 1V9SA 4CT0A 4DMUB 3QBVA 3JQFC 2Y8EA 4LI3X 5FLKA 5B1IA 1E8MA 3N74A 3AUFA 2WJJA 3TAXA 2QYHA 3F1KA 3VOAA 3FM9A 3ZV7A 3AVUA 1DKMA 1RQ2A 3AYXB 3CVVA 3NAMA 1KI7A 2ZRFA 3IJEB 3OFJA 4NIMA 4R1UA 5CLJA 2H3HA 3C7CB 3K96A 3PYMA 2WKPA 1ZQPA 1A2KC 1N5RA 4OB8A 4RK5A 2ES6A 4TYWA 1TAGA 1HNNA 4CKWA 4ZCMA 3B9JA 1M1NB 2PX6A 1QSLA 4N4AA 1WSWA 2HRZA 5JZOA 2AQHA 3AC0A 3QEJA 5G0SA 2AC4A 2DB3A 1KYTA 1LW6E 4Z8XA 4YD1A 1U3DA 5K05A 2OENG 3NTXA 3MTAA 4R1NA 2DTEA 2YJZA 1NVKA 4GH5A 3DCIA 4P4SA 3RUDA 3NJ8A 1QIKA 1JAHA 4BVAA 1RYRA 4YPOA 1EK1A 2ZI9A 1E4EA 1Q3UA 3GAFA 2P3SA 4DOBA 4IOMA 4L50A 3BEOA 3G5MA 2HJ9A 2P4EA 1GVNB 4R63A 1EM8B 2VPPA 3EK2A 3LY9A 2O3UA 3NBAA 1A7UA 3TMYA 2JAUA 5FV7A 1AKEA 5BT8A 1N2EA 1YIAA 1DB3A 1KK3A 2Q2VA 2W90A 3CEMA 3N3AC 2SBTA 3SENA 4FR0A 3VTAA 5TPZA 1GAEO 1GZ5A 4FDVA 1XRPA 4RQUA 2YINC 2YVUA 3C5EA 6ABPA 1OHHA 2QARA 1JG4A 2MYPA 2VSOA 1PUIA 2FFHA 2CF5A 2P9ZA 4ZARA 2Y1DA 2H48A 4PSVA 2XZTA 3E23A 4R81A 1M1YE 4ALNA 2VHVA 1N78A 4FGZA 3ZW9A 1QP0A 2XTZA 3N2GB 5IUJC 1MQ8B 2JJ1D 1XJ0A 2FW6A 3O3NB 3TOXA 4EKIA 1BGXT 1UANA 1KU6A 2P2SA 4TKZA 1NBHA 2MSLA 3TDMA 2WT8A 3ZZNA 3KC2A 4AO7A 1G2IA 2GX6A 5FWAA 4ZT7A 3OY7A 5HKKD 1ACLA 2MSWA 2KHZA 3K20A 1YBMA 2PZAA 2ZJ2A 2E8NA 5GV8A 3O84A 5JTIA 3PX7A 3B3AA 4P5EA 2O8CB 3UMJA 1QE0A 2EKLA 2VAVA 1GITA 1J07A 5ESDA 1EP2B 1Z5OA 1KSFX 3ZWPA 4DSOA 2UZ0A 2WEKA 1KVSA 1TX4B 4YYEA 2QAIA 4QUKA 4KJXA 2NRTA 3LPNA 4LHSA 3T0FA 1D2GA 5KSZA 1FBTA 2JZBB 2C7BA 4YHBA 3TPZA 1LVGA 4OL0A 2YV4A 3GJ7A 3KVOA 3NIBA 5KOHA 5IIMA 2GBFA 1EFPB 3QWBA 4HMPA 5B6JA 3HZOA 4CT4B 3IHKA 2Q0ZX 5KPJA 5FWYA 4KLGA 1RU3A 1PUXA 4KPYA 3BD9A 3HCBA 1BVRA 4O5EA 5EUCA 3HXQA 2VS1A 4ARZB 2V7QD 1ZIDA 2RGNC 1WHSB 1A9RA 5DWQA 5LQMA 1LUAA 2JH3A 3UAXA 5FUWA 1E6LA 1KIAA 1XFDA 1AGPA 4JP8A 4ZV9A 2WWFA 1Y1SA 4ND8A 3KXLA 3TTSA 4ESEA 4IM7A 2NVUA 5BYJA 1S3FA 3L0BA 3ESQA 1L7AA 1R37A 4EBFA 2JFGA 1OASA 2W9XA 2YNMA 1RXWA 1Z7GA 3OAAA 4KXQA 3VH4A 5BYKA 3O74A 4WK4B 1TVCA 4JC8A 2H1LA 3TUIC 2N46A 3MCUA 4DFKA 1WETA 5JNWA 2X0JA 2QN8A 1C9DB 5LBTA 1Q0UA 2FE4A 3SZ3A 3PFCA 2FEMA 5DYTA 2AN9A 4PH5A 3DKRA 2BFFB 5JS7A 5K3EA 1HEYA 4YRAA 2XXAA 2Y0CA 3KUKA 4BAUA 3GGPA 2IHZA 1E60A 3DAPA 1C50A 3N58A 4RKRA 3RD5A 1GYRA 4F91B 2ZYSA 2J08A 3TTXA 1Q44A 4ALKA 2O2SA 4IEFB 3ORHA 4E88A 1PVOA 3O1LA 3LL7A 1M1XB 4MQ5A 3PQEA 4JLBA 3EA4A 3SHQA 3RIHA 2LCFA 1YDMA 2W3RA 5FOWA 4R1OA 1EFVA 2WWGA 4B48A 1QK3A 3WMGA 1QE5A 3NG1A 2VDMB 3PNLA 1COZA 5B36A 2R8EA 3IXMA 3CMMA 4ZI7F 4OI2A 3UT5A 2VI5A 1QH1B 1GILA 3UHFA 1QANA 4WCFC 4B3GA 5KG7A 1JL3A 1VCNA 3B6JA 3MILA 4HGRA 3FSGA 2V8BA 4NPAA 5BVGA 4EJFA 4H3VA 3BSWA 2ZR0A 4EATA 1ZDMA 4AC9A 4EB6B 1GUDA 1RJDA 4UTPA 3FI0A 3E3NA 2WTUA 1TTTA 1Y6JA 2HL6A 4YR2A 1IJKA 4KWTA 1Q95A 4KP7A 3U7RA 4WT7A 3KEFA 1J1UA 5A1TA 2QARB 2XY6A 1Y3FE 4J9RA 3L1IA 3L7MA 1FRVA 3H1EA 1XKLA 3N0WA 5KYXB 1WD5A 3JV7A 3ESDA 3HO6A 3VPDA 3D54D 4AP5A 1ISFA 2B4AA 2HXYA 4URYR 1YQXA 4LA4A 1NVTA 2QXTA 2MRLA 3LDAA 5J0RA 4MW2A 4UB5A 1X9GA 4K9LA 2FZVA 4MWCA 5DMXA 1ZQYA 5F9MA 3WQRA 1JV2B 3JARA 1GGVA 4ML3A 3LT1A 4FVTA 4TOIA 5JS1A 1VLBA 5FL3A 4ZVVA 2X40A 5EESA 2HOQA 4F4UA 1WWKA 1NNEA 1SMKA 3MHPA 2QZZA 3N1UA 1K7YA 1RQGA 1Z8HA 4KYTA 4A92A 2QP4A 3IRVA 2QN7A 3AP1A 4JVNA 4DQDA 2DUYA 3MN1A 1IY1A 1JIVA 3B3JA 1IK6A 2M9NA 3B3QA 4ZOHC 4XPIA 2QSUA 3IEPA 4L2IA 3RS7A 1JHVA 2E8MA 1I2DA 3HFSA 4P54A 4E22A 2CK3D 2VK4A 4TZTA 5DISB 1E0AA 4C0ZA 4GMGA 4OFBA 1QG4A 4U00A 3WRWA 2XB9A 4PCUA 3VU8A 3ADCA 1E9FA 1REQB 3DKPA 1XAHA 3Q5EA 5EJ8A 2YZKA 2Y1EA 2B7LA 1ORDA 2WU1A 2FUCA 4AZWA 5ALEA 1D4OA 1DVRA 3NEPX 4KO2S 5EWGA 4EL0A 5IT0A 1JVBA 3QEMA 4KE9A 2NTEA 3BS5B 5KOHB 4P0PA 2MHCA 1ZNZA 2CT8A 4FX2A 3M9NB 4QGGA 3KQUA 1X1AA 1PR0A 1NHGA 3A3PA 3HGTA 3KO8A 3QW2A 4UCXA 4R0VA 3WWYA 2LUOA 1THMA 2DPYA 1I36A 3NV9A 5F7XA 3I58A 3L6OO 4K9OA 2R1VA 2YY5A 3RUHA 3T5PA 3B8HA 3GW8A 4E5KA 4C7ZA 1Z25A 2JIMA 4A6EA 3AQIA 4OXQA 1XSLA 1PLKA 1KE2A 1TZJA 2AUMA 2PU5A 2OD2A 1GNSA 4BVGA 1KYXA 1QHIA 2EL7A 1WVIA 2R68A 2OXOA 1SVMA 2KI5A 2VP2A 4NEGA 2AEFA 4Q5IA 5B3KA 3E5MA 3C43A 2QVBA 2NUAB 3NNDA 4Q1EA 4BWVA 3AR6A 4ZDKA 3K3PA 1GADO 4Z4QA 5BUCA 2BISA 2A0UA 3Q7QA 4DA9A 3PWTA 3CCBA 3HWTA 5AKHA 1L4HA 4E07A 1PR3A 1YJAA 4HGNA 1XLWA 3B9QA 1XMVA 2O0HA 3HXLA 4O9MA 4UU0A 2Y9PB 1ZQWA 3GA5A 3A06A 3OGUA 2NZJA 4F12A 3X1XA 5CBKA 1XRRA 2G25A 3WGTA 4JYBA 4ZMBA 2IGTA 1QHYA 3L43A 3RIEA 1B93A 2GN9A 3B52X 3E4CA 1L2TA 2Y27A 4X20B 1XAGA 1R2QA 3T3MB 4ZOBA 2OV8A 1N60A 1RVV1 3GLQA 3VYVA 2GTIA 4PZNA 3KZNA 3O8QB 1V48A 3QUSA 5AI8A 1U0EA 5A1JA 2LMRA 4WZAB 4UKDA 1J8VA 2V98A 4JEHA 4YDSA 1CCWA 1FSSA 3EJ6A 3U3RA 3DCYA 3K2BA 1V85A 1TT7A 2PYIA 3LVWA 3EB9A 4Y6OA 1VHDA 3WR5A 1U98A 2A78A 3V2UA 4E1VA 1YHYA 2V7TA 2V3CC 4AQDA 4DDKA 1YQGA 1ZP6A 2BFPA 2W6OA 4YJHB 1XZFA 3T38A 1JEDA 1IBKB 3DE1X 4M83A 3LCJA 3Q6MA 3X1JA 4EHFA 4W5NA 4FIZA 4LHWA 5AW3A 1FSGA 2R0QC 1XQXA 1MKYA 3K15A 2ZVPX 1PG0A 4MV1A 1L4NA 5IDQA 2RGXA 3NC1C 1IEVA 3TF5A 1HO3A 4IXMA 3G2JA 3ZZTA 1PZGA 1UPXA 1XTSA 2H4XA 4HHEA 1FIQA 2XC9A 3L9WA 4LHZA 4WEQA 2GBLC 2XITA 1E5XA 3LX5A 2JJMA 1CZKA 2PRZA 2XYQA 3D6MA 4KUGA 3WV4A 1GCUA 2YRXA 1KXJA 2QTNA 2EZZA 2GK7A 3FPJA 4LNUA 1YQWA 3FHJA 3IQDB 3QEKA 3SFZA 3RV4A 3I01M 3ZGOA 4CL2A 1RKUA 3DDCA 5G0WA 3ZWAA 4BNDA 1ICIA 3DZCA 4O3MA 5COQA 5BORA 1I7NA 5KYNA 5IDWA 2UYCA 4KLJA 2JFHA 1RZRD 1E96A 4UBIA 3QLUA 4DCCA 4D3FA 1ZITA 1TVAA 1HWYA 2H5EA 4OV6B 3QTTA 4QAQA 2ZTCA 4LMRA 3LBYA 5DBOA 3PQ7A 3R8XA 3GLSA 1ADFA 2NSHA 4M89A 1U8YA 2LPMA 3UHOA 3V8EA 5L53A 1I7SB 4EZEA 3QJYA 1HDEA 2JR5A 1FMCA 5AM4A 1KORA 1WUJS 1KBQA 3AFMA 3JVIA 4R05A 3DL0A 4QFMA 3TBKA 3TW8A 1ILEA 1JPUA 3TVDA 2ZRCA 3KWMA 1NI3A 3RIYA 3OLWA 4GXKA 3KL4A 3MEQA 5DM0A 3W9UA 1GZHB 1A5AB 1OZHA 4G24A 3K5WA 1R0BA 1Y1KE 2ACKA 2Q49A 2Q5QA 1U99A 4OMCA 1OX4A 1W0CA 1OY1A 1NW4A 3DVLA 3T5CA 4FGSA 5JW6A 5KQMA 3QKRA 2RHGB 1GUAA 5TGDA 1FNBA 5C7IO 1GKIA 4E2FA 1XKTA 1N0UA 5ALTA 3DQZA 4K6OA 4LGCA 4MOWA 2O3QA 5DDYA 2ARKA 2WTNA 1ZM7A 1WCNA 1WKCA 3K0CC 4R8VA 3FYUC 4JEIA 4EZ9A 1FDIA 2BELA 2FGJA 3CJTA 1N5KA 3GVHA 2RI6A 4Q1AA 2VXBA 5SZHB 4XWGA 4CN9A 4GLFA 3WLHA 3ORFA 1UJCA 1DX9A 1NQOA 2WTMA 4XVHA 3RTEA 3T9EA 5DRYA 3VDRA 1K6XA 2CVZA 3E2EA 4RD0A 2ZB8A 2ZJ1A 4XI9A 1MP0A 4R6WA 3HU2A 4UZSA 4BVJA 3OHSX 4P34A 2F3TA 3R9XB 2I99A 1PHPA 3OJEA 1B8PA 4QUEA 1L5MA 1Y8RA 1AQJA 1ULBA 2I3AA 4TWJA 1FXSA 1P9RA 4JI8B 1P7CA 2VANA 1ZM2A 3W5SA 4PZEA 4ZODA 2HRRA 3LXUX 1BKDR 2NACA 2DQ4A 1E62A 4KVGA 5K3SA 3UH0A 1LJ8A 5DHFA 4CM3A 1QIJA 4RO0A 3BRQA 3D6VA 3NONA 3UXOA 1HE1C 4RVOA 4N47A 1UT8A 5KAFU 3RTVA 4A5SA 3DZJA 3ANXA 4Q47A 4EA6A 2VNKA 1XF1A 1QVRA 3W05A 4ETNA 1AQUA 4ZEWA 1E7MA 1X1EA 3G1UA 4UVHA 3F67A 4PLYA 1GOTA 3NBYC 1Z13A 2F48A 3C6MA 2PBLA 3EEFA 2Q3EA 1C30B 1X38A 3IPYA 4LK2A 1PK7A 1W9MA 2C4TA 3SX4A 2XGPA 1PIWA 1VSVA 4KOEC 2AJ8A 3UFBA 2DBZA 4ER7A 2FWNA 2W2VA 4NYIR 4ENVA 1M3SA 5KFMA 5CB0A 5EKDA 2R8HA 4X92A 1V3UA 3IDAA 3WMEA 2NZXA 3OQ6A 4US1R 1JPVA 4XUCA 3WKDA 4O6VA 4GYKA 4YXWD 4R7GA 3RRNA 2NUPA 4EJMA 4JLNA 2PSJA 1SIJA 3OCWA 1YU6A 4DARA 2Z2JA 4O59O 1OT5A 1GQFA 2NTNA 1KGDA 5DB9A 1BQ3A 2DC1A 2VPIA 3O8NA 2QY9A 4NNPA 1WO8A 3DDHA 2FQWA 1LW7A 2WM8A 3OLZA 4FYXA 3QZUA 4P82A 4Z4GA 2A9QA 3IQEA 2XHEA 3LO5A 4TTPA 2Q62A 2ZJ3A 3AF1A 5ERXA 3K35A 2Q0SA 3PMNA 2Z09A 3KEOA 1SHUX 4JI7B 1DRUA 1XTKA 2ZT7A 3STTA 3IAS1 4BDPA 1XZBA 3W5DA 5JSHA 5IS2A 4F5DA 1HLGA 621PA 3GPLA 2CXHA 4FWBA 1IHDA 2OFFA 3UB4A 4PBRA 1D2MA 5CFRA 4LF7B 2PE5A 1DU4A 4TRMA 4BZXA 1TYZA 3JYLA 1Z2PX 2OXCA 3PSPA 1P9OA 2X3FA 3HJGA 3NATA 5GONA 2DQNB 4Q9DA 1XD2A 3OTHA 4IJ5A 4RZ3A 1TLTA 3N8DA 4MKFA 3GT3A 1A5SB 4FYIA 4GXTA 1QE3A 2VBFA 4JCOA 4QUGA 1WRBA 1MW9X 3MPOA 5HF9A 2QRVA 4IEIA 3TOVA 3WB9A 1Q1EA 1ONPA 1TK2A 1ULUA 2OGWA 3M5DA 4C43A 5LLDA 4CIYA 4LF5B 2QBYA 1NWHA 2JAPA 4H31A 2Q0XA 3W2FA 1ABEA 3I3SR 4M9RA 1BAPA 1SU6A 4NECA 2VF7A 1FS6A 1SG0A 2RGGA 4HAZA 3IP3A 5EHXA 3H05A 1TDJA 2JCVA 2UKDA 4PX5A 3F6RA 5DGDA 5LQSA 1LDEA 4DR3B 2HU7A 4FT2A 2D7CA 4JSRA 4P4SB 4LRYA 3C7AA 4K40A 5EIBC 5CDTA 3V34A 2P1RA 4XGQA 4CHTA 2P9CA 1OA0A 1CR2A 2BEWB 3MG9A 5CK4A 3F3SA 9ICQA 2IP4A 3QFSA 1E77A 3GRUA 4GF5A 1YZQA 2CJYA 2PKRA 1NVVQ 4MYUA 4POAA 4CU5A 1XOIA 3EG9B 3DC2A 5F5XA 3B6IA 4H1TA 1URPA 1F2DA 1HORA 1NUHA 3B2EA 4LNAA 4ZQGA 4CV3A 4M6WB 4Q9NA 2Z6VA 4D82A 3A9SA 1A72A 2OESA 1DGJA 3SDBA 1Z37A 5LDHA 4GSYA 3SYMA 2HUNA 4AUNA 1R8XA 2WHPB 3DHYA 3NPAA 2C4NA 4K46A 4Q15A 4WY5A 4R0MA 5KNBA 1W36D 5L7YA 1KHTA 4QFCA 1MZPA 1TU0A 1KJQA 4GGOA 1KY4A 1FUUA 2L17A 3U1TA 4C1BA 2DP4E 3C7DB 3EFOB 4KL8S 5D5QA 5JTUA 2IXAA 3R41A 4RQ4A 1H3FA 2ZBPA 2GF2A 2QMUA 3CA8A 3O73A 4FD2A 4KKXB 4PCLA 4DDUA 4XDGA 2HA2A 3G9QA 4E6EA 1WZIA 4Q3LA 4KSBA 1YFLA 5DM1A 3WGOA 3IDQA 3DMGA 2EJWA 1YE8A 1TUBB 1VIMA 2X5NA 1P4HA 3TRHA 2ZT6A 2R8GA 4TTJA 2P91A 3OX2A 3OKFA 1HUZA 4UU8A 2A9PA 2RAPA 4DSIA 2FWAA 3JQAB 4C30A 4J4HA 4PYKA 5A0LA 2OP0A 4LFAB 1XZKA 2C0PA 1W96A 2NVWA 3DDUA 3F5DA 1DC6A 1UM9A 1UBKS 1GCOA 2IA5A 4QOFA 2YB4A 2R9VA 4DV2B 1MB4A 4PGGA 3BE6A 3EFBA 3N7RC 3HCFA 4KO1S 3X2SA 1X7YA 5FYQA 1EVYA 2ZB3A 4RC9A 2BFDA 5DNAA 4A73A 1SZHA 5CG2A 1NZFA 1NVFA 4RQBA 4PL1A 5D2CA 3WLLA 2HHXA 2WSYB 3UXMA 4NJEA 4EGFA 4O4JB 4I1VA 4RZXA 4RVFA 5F33A 3V2IA 2UXCB 2HWYA 1ZK2A 1PL6A 2M1ZA 1WE2A 1YB2A 2OVBA 2BHTA 4UMFA 3W6PA 4CL0A 5JWOA 4C7OA 2VHUA 3PSIA 3RVDA 3SQDA 3AN1A 3IALA 4AWXA 2ATLA 2ZYUX 4D8XA 1XC9A 4O4HB 4LKRA 4Q21A 1DHRA 3T94A 4F8JA 2D3WA 1FUKA 1GUFA 5JDIC 4JLVA 2XOKA 2A6PA 3H8VA 2VQFB 4RY9A 4FX5A 4FSHA 3G88A 3TL2A 3EPHA 4MCIA 1BDBA 1VBKA 1W88A 2Y93A 5ALFA 2IHKA 3QMMA 5J2KA 4Z0HO 9ICFA 2QMHA 3IAHA 3PIRA 1K4MA 3SP1A 1E5TA 3OCZA 4N6GA 5BN4B 2O8DB 1WW8A 4Q7LA 2O8BB 3K0KA 2PGJA 3IP7A 3WWEA 3JATB 3ZKWB 4PS0A 3BJZA 2IKQA 3M5WA 4RZIA 4AY6A 4JQYA 4H35A 4BNVA 2KD1A 1AZWA 3SYTA 2QI9F 4BWMA 3KJGA 1JEQB 2R4QA 5ALIA 4F60A 3WAGA 1L7OA 1RW4A 2PUFA 1DMSA 1W47A 1WMSA 3HCWA 4AX8A 4GD3Q 1ADCA 1B2LA 2QA5A 4Y2VA 3AOEA 2XQVA 4G4SO 2IF2A 5IC5A 1BN6A 1SA0A 2I34A 1XMJA 2EF0A 2YQZA 1JKFA 3LQYA 2YBDA 1OLXA 4L9WA 1KK2A 3I9FA 4D74A 3G3EA 1OX5A 3LVQE 2ILTA 3AL2A 1ORTA 3F2DA 1X74A 2BLNA 3ALRA 1IXRC 2XNSA 4KXLA 4RQ6A 4RQ1A 1WXFA 2IVZA 2ECFA 1CX9B 2YV2A 1U0FA 3JQFA 4LC9A 3SC2B 2Y71A 4AN0A 4C3ZA 3C2LA 1B41A 3LDFA 3DOJA 3O4VA 3NUQA 4LXHA 4O2AB 4MR8B 1XQWA 4KXNA 1UODA 1Z4MA 2JD1A 1Y88A 4G0OA 4KGDA 121PA 3EMVA 2ZUCA 1ECLA 3FNHA 3KWLA 4LSZA 1AN0A 2Y4NA 3EG9A 3D31A 4RDIA 3H5WA 3NHFA 3RIMA 2EW1A 1CQIA 4TMTA 5DHAA 5KT2A 3LF2A 3O8OA 3P2OA 2K8AA 3PX0A 5SZKB 3T61A 4F45A 2IH2A 1GEEA 4IJMA 3JAWA 4ZQFA 5F4BA 4B3IA 3PUJA 5DT2A 2W03A 3QKUA 2DX7A 4WKGA 1Z38A 2HSDA 2QRZA 1GU1A 2BM8A 4RIHA 2A0XA 2W6CX 5FKJA 4JI4B 2FMSA 1BHO1 1RNLA 3GJ5A 4NU0A 3ESCA 3PY8A 5CDFA 2ZWOA 5JAUA 3QZ8A 2EYQA 1XJQA 1WLYA 1R6DA 2B35A 4HB4A 1JT9A 1C29B 4GMDA 1VBFA 2DPJA 1DC3A 4AG5A 5DI3B 2R87A 1Z83A 4ITRC 5TEWA 4KR2A 5DASA 1NP6A 3O47A 1H2ZA 3PEEA 4O3OA 1XO1A 4B2LA 1DWQA 3EOZA 1M2FA 3CNQS 3WNQA 1R00A 1LJUA 3MCTA 4EUNA 5LZ4A 5E6UA 1R8YA 3EZNA 3NHLA 3PX2A 5AJYA 1Q74A 1LPBB 5GVSA 1Y6GA 3HI6A 3OD5A 2BBOA 4KW7A 2AJQA 4FC7A 4Q3AA 3GK3A 2QWXA 3BRWD 3EF0A 1VHWA 3K6SA 1P77A 3WHPA 2CDAA 3PJFA 3CX7A 1AHPA 1VCIA 4OAOA 1ZN2A 2KTQA 1ZUNB 4WD3A 2H0AA 4F5ZA 1JQAA 1RRPA 2RG1A 3FBGA 3UT5B 3DBVO 2H92A 2ZIZA 1GA4A 2OYSA 3CLTC 1D7OA 4Y1GA 2ZJ6A 2IBKA 3BMNA 4HMQA 1XTRA 3HU3A 4IRCA 4B6OA 3SF8A 2GRAA 1L9KA 4BNZA 3K09A 1DIRA 4NYMQ 3FD8A 4DMFA 1JALA 4NLBA 1NPTO 3I53A 1P2UA 3P2YA 4DPLA 4RJKA 1ZEJA 2MCFA 4O1IA 5JSZB 1LVHA 3FAZA 1XD8A 5TPWB 4CM1A 5A9SB 1E32A 4BO7A 4P4LA 5K0CA 1UAGA 4R3NA 3A1EA 4B1FA 3H7AA 2PA0A 4ZOLB 3K6RA 4LJKA 4I19A 3JPWA 2A5DA 3BJYA 1PVPA 1OZGA 2AN3A 1WOMA 1R9NA 4X1YB 1O95C 2A1UB 4KXYA 3UQ0A 5E3HA 2I76A 3TX6A 5I9BA 1L7RA 2PIAA 2FSIA 1EEHA 1VL6A 2ZTDA 1XZGA 3IERA 1KDYA 4RA9A 4ECTA 5JSYA 4BCBA 4X8MA 4EHLA 5FTLA 5C1IA 3R9IA 4DLAA 3ANTA 4GKBA 1RKBA 4RX1A 4FHCA 3REFA 3FBWA 5MN5A 2IS4A 1XEWY 1RYDA 1W2WB 4ERXA 3A1DA 4ECSA 4HYTA 1YIDA 4Q48A 2NIPA 2P62A 2WBLC 3U80A 3VPAA 2IYEA 3ZKWA 4ZALA 1AZLA 1DK2A 3DV0A 2ZI6A 1G17A 4J75A 4LOHA 4US0R 1U6KA 2XBLA 4MVJG 3IEXA 1UC4B 3IOEA 4NOMA 1VG9B 2AHOB 1KJ9A 1M72A 2EZ4A 2W83A 4HXYA 5KTRA 3CPHA 2QYOA 2CFSA 1W52X 1QF6A 1W59A 4J9OA 2HJVA 1VJCA 2HU8A 2QTZA 1I14A 5JY6A 1EGHA 3U16A 2WF6A 3RROA 2OM2A 2QAGC 2X13A 5ER9A 2BFBB 5AKLA 4ETIA 3Q6IA 5AI0A 1ZM9A 2Q5CA 3RC7A 1RAIA 2M32A 5ALJA 1I1HA 4MCJA 4P7KA 3V7KA 2BFEB 4HWKA 5CUQA 5DW3A 3U48A 3MGBA 3ZE2B 5ITZA 4WHMA 3TW6A 1JHOA 1NBMD 3RU3A 5LMCA 1IY2A 1VE1A 3NHKA 1YJCA 2XQGA 3ILVA 3LHDA 3RWOA 1P1FA 2AR0A 3A11A 4I1PA 2J5RA 3DTVD 4QPCA 3CH6A 4N3BA 1N8NA 3NHSA 3M3PA 1MTOA 1O2DA 1QKKA 2CLHB 3L77A 3O9MA 1RXVA 4DSNA 1BIFA 2VYND 4S0ZA 2GLUA 2X4GA 9ICAA 1R9GA 4JT4A 1EWRA 3T7RA 4F97A 1MA0A 3GCZA 1ICEA 4ZP1A 5HGXA 4KRFA 2QQ0A 5J4YA 3DV0B 3RT1A 3U09A 2Q9AA 3E7WA 2Z5FA 3LCUA 4JXZA 4PRKA 1IQRA 3BEDA 4O2BF 1R3DA 3TZCA 2HEGA 4GLXA 4B4DA 2GQ0A 4JT8A 2QYSA 3RKUA 1E1DA 4DWIA 1SBTA 1OBHA 1C3OB 3S6JA 1W4ZA 3KR1A 4I0WB 1MORA 2WWVD 3ZU2A 4F0JA 5KWEA 3HWSA 1A69A 2ZYVX 4BN0A 1SRRA 2NLOA 4QYSA 1L3BA 3RB8A 3EDYA 2YWEA 3PHCA 4KUHA 1UMCB 2OCPA 3UEOA 3GFGA 4K26A 2XCRB 4ZPXA 5DG8A 3GROA 3IB3A 3JS5A 4J9LA 2WJVA 3QG1A 2B78A 5JR3A 4AUMA 2C1XA 1IUNA 1QONA 1IAQA 2AOUB 3C6QA 4ECUA 1MFPA 1Z12A 2WVJA 2V6MA 4LF4B 2JI9A 3RS2A 1AKWA 2XF2A 3EFOA 3B36A 4OQMA 3QSGA 2F3NA 4GO1A 4KGZA 3FETA 3E8XA 4WLUA 2ZVQX 1YZYA 5EI5A 1X86B 3BSFA 4UDYX 3WXMA 5KNCH 3QMVA 4ECVA 2ZB2A 3NRJA 4USAA 1V2GA 4GXIA 1J97A 4HNAB 2RGBA 5CVJA 3VDMA 1IN8A 3X1KA 3EXAA 4DMKA 1ID8A 3OZBA 5BNIA 5HG0A 1OPRA 4WGGA 4B0PA 2J9XB 2MIIA 1VXOA 2PZEA 1IRXA 1XZIA 3C6ZA 3CBGA 2BBWA 2W9BB 1PYGA 2COEA 2EX4A 2H4YA 4C9BA 2NT3A 1BX0A 4NXZA 2IEAA 4JXXA 5CRXA 3T9AA 5FXMA 3E5RA 3D6FA 1T0JB 5DULA 1N77A 2GEJA 1D09A 3BD6A 2G9NA 3P71T 3SM3A 2JVKA 2Q7DA 1JT2A 3PDHA 1V97A 4F84A 1QQ7A 4NZNA 4JYMA 5K8LA 3ACCA 1SXEA 2KIVA 2OAP1 4Q4DA 2WAQF 1A8UA 4B44A 3W5UA 3WIEA 3LSYA 3KTOA 2PXHA 3BWXA 4A2QA 1KPGA 1T4MA 4P38A 4J2HA 4LRXA 4B31A 5K3CA 1HT1E 1NBME 3A6ZA 3QQ5A 4HQKA 4PGAA 3CKLA 3ZDCA 4RF3A 2FMPA 1DC4A 4FDMA 4C7OB 4RCYA 3KOUA 3RSGA 3DTNA 1NVBA 4KR6A 3PUKA 2JB9A 2BMJA 5J0OA 1GTG1 2PLFA 4QGHA 1A5BB 2R7AA 4IV8A 2MINB 3EMBA 1J5XA 4MVJE 1CBUA 1KFKB 3ORSA 3LTEA 4BRZA 1VB3A 4D2IA 4ND2A 2RHMA 3HKEA 1KS2A 2FY8A 3BMOB 4FJ0A 1BROA 2B8NA 2ZYGA 5KG3A 3EZGA 1GL7A 1WVGA 4HTFA 3QXCA 4B3MB 4OYYA 3KEGA 1P7PA 4GDMA 4IXNA 1ILWA 1W4BA 4GEKA 5LQJA 1MXHA 3I9OA 4MPRA 5LWHA 1FQJA 3D2SA 1XBTA 3E27A 3IG8A 3GFVA 1J2YA 3OHAA 3MRVA 4S3MA 3ONFA 4XQ9A 5FX2A 4MWTA 2FB9A 1NXSA 2JNWA 3PDWA 5ALVA 5JNLA 1HLDA 2NPFA 4BNUA 1DGSA 1U45A 1T26A 4TWRA 2O2IA 3ZZ0A 5JCJD 3K5IA 4IQ8A 2WJAA 1EFLA 1QIDA 4PTYA 3O4HA 4R2HA 4S1NA 4MF2A 2WJHA 5BOVA 2AX3A 2X1MA 5J0UA 5TT1A 3A1CA 1DINA 2QL5A 4TMWA 1NQVA 2Z6UA 3PSTA 3GLFB 4UVGA 1B7GO 4DF8A 1XVVA 2KICA 1NIPA 2P4SA 3B2QA 5TMBA 4KLIA 1JU3A 5A4DA 3G0CA 4G5FA 4IJUA 1GXSB 3JYPA 1RG6A 3ETDA 3KZCA 1NI4A 4CR6A 4DNQA 1DBSA 1YZ3A 3I9LA 4XGKA 1JQDA 3R7AA 2NYAA 5AHOA 4XRGA 3H5NA 4CTMA 3N2NA 5T7BA 5E1DA 1EVKA 3GIIA 1V7ZA 4R9VA 1N36B 3TRKA 5KT4A 2BVNA 1HGXA 2C2DA 1JJIA 1M8GA 1P80A 1Q14A 2BMDA 5EQDA 3EGDB 1DTSA 1XDZA 1YB5A 3RBVA 3QLUC 2F2TA 1L6RA 3NHUA 2RGNA 1DRKA 1KPIA 2XUKA 5J8YC 4UMEA 3WGMA 4ARSA 2Y1XA 4PG6A 4K6CA 2O50A 4R2IA 4PNZA 3MT0A 2DKFA 4TRNA 3OSPA 1I3CA 1QDEA 2GUGA 4V0RA 3WNBA 1DAHA 3BJIC 3S2EA 3HKBA 2XCUA 3O95A 3U5ZB 2Z2XA 5BWLA 3E22A 4OI4A 2YKGA 1E2HA 4JL6A 2GHTA 2QKYA 3LX4A 5CXUA 4YAGA 3H5AA 3HRIA 2WUWE 3LWBA 1I3KA 3IPLA 1EXWA 3KZIU 5DEIA 1XCLA 3BMQB 3AVXA 1N3BA 3WE7A 4OVKA 1EJ6A 3ISCA 3ZYZA 2BZ0A 1E2BA 2WIJA 3FTEA 3QF4A 3HABA 3ET4A 4YT4A 4RLSA 3LMKA 1YONA 4Q4JA 4LBVA 3I0ZA 3RYHB 4R7ZA 4CGYA 5C35A 5ICMA 2O0KA 2CF6A 2CRXA 1NPYA 1O9HA 4FFNA 4Q8EA 1KZ9A 5AJTA 2FRXA 1HQDA 2CL6X 1QB7A 3CH5A 2VLBA 3OQVA 1P1CA 2ANCA 2FMFA 3HB0A 5CFLA 1Z08A 4WLVA 2O7QA 3ICXA 1PT6A 1RRVA 1GPUA 2YHAA 2TSYB 3HGMA 4NU5A 3VYWA 4BZQA 3H1GA 3VZPA 3IA2A 2GPWA 3EVCA 3GPDG 3X1YA 4E30A 3U4QB 2A0YA 4F86A 2AI1A 3VU9B 2OFWA 2J3JA 2CCKA 4KMRA 3ZDXB 2ZBFA 1H65A 2ZSJA 2WZQA 3Q5DA 2G5IB 1DLJA 3Q87B 1VIAA 1G3RA 2FPIB 4I81A 1VM6A 2QTVB 3R20A 1U8UA 2E5SA 1C7IA 1N2ZA 1ZOSA 2GUWA 3EQ8A 4TZ0A 1X1RA 2Q2QA 3SDSA 4WOKA 3W90A 5EHQA 2J6BA 4UW9A 4QZDA 4DIBA 1EFRD 4V0NA 2EGGA 2E1RA 2RMKA 3ABRB 1Y4SA 3BTUA 3ZPXA 4RH1A 2FSGA 2PRJA 5TF4A 4NFHA 3ICCA 5EJFA 4DC0A 2JBAB 5FBHA 2PMZC 4DR2B 4N5LA 3M6MD 2Y0EA 4ZU6X 3TWOA 4AYBC 2ZIXB 2HI0A 1GT6A 1N2CB 1T8PA 3ZX4A 5JZSA 1DBRA 3HDGA 1XNSA 2EERA 2X77A 2XTJA 3GMSA 5DGAA 2O1SA 3MJDA 1GARA 3SR4A 5F7JA 3ISTA 4B9VA 3A9WA 1LSJA 4FW9A 3ZLJA 3QBTA 3V6JA 3CR8A 2NZWA 4H15A 1UKAA 1NVXQ 3BB3A 3O4JA 2HA6A 4QYIB 3BZKA 1N25A 1JXEA 3EGXB 2HOIA 2IOFK 1NF3A 1IXSB 1CQWA 1W1UA 1RVDA 4C0HA 4BBPA 4Y1RB 3O3OB 5CBPB 1IB6A 4FMCF 1IUKA 4KCGA 4B4KA 4HNAA 5BO5A 4UD2A 3N2KA 3VOSA 1IOZA 4J9KA 3AG5A 1KMIY 3H97A 4PZPA 1YCFA 1T15A 2VT6A 3PNPA 3DMYA 4HVLA 4F5PA 1YBHA 5B4VA 4NYIQ 1GU0A 1OGIA 1DP4A 1JE1A 1EH5A 2C83A 3DQQA 1RTTA 1CZLA 2B99A 2XGSA 3HP7A 1SAYA 4P3XA 5EMKA 1MIOA 9ICSA 4HDRB 1UJNA 4QZGA 4HN2A 2HRCA 1HIWA 1OB2A 4ZO4A 5TVKA 5ERGB 1SCBA 4HZUA 3U31A 5E6RB 3QWFA 4GWLA 1F20A 3BTVA 3MWGA 2UZIR 5HRUA 1Q3TA 2IP1A 1YFZA 1FCJA 5IJWA 3LD9A 3PGKA 5HQ3B 2D8AA 1KI9A 3NH6A 4TL7A 4BFLA 2JFXA 4WUVA 3C0KA 1XVLA 5AJHA 1DXQA 4URFA 4C0BA 2R5FA 3VX3A 4Q4HA 4DA8A 1F8UA 2WVHA 5K8JB 3BHMA 3OMWA 4L78A 1U5CA 3F2VA 3EIOA 3V4LA 4KU4A 2FR1A 1V26A 5KNIA 1NP3A 2HVHA 3MIIA 3DBOB 1PS8A 1S5LU 1KC3A 1MC5A 1QSSA 4FHGA 4E5PA 1ZU4A 3ISVA 4QYXA 2NYUA 3IBFA 5T67A 3TLJA 3RVKA 3GV5B 3IH5A 1PNVA 2FNAA 3R3HA 4B6FA 1XLUA 2ZXIA 1V7CA 1BDJA 4GRIA 1TXGA 2E4YA 3MF4A 1IQ0A 4BUJA 1ZQTA 4Z3KA 4P3NA 1VG1A 2J9YB 3WYDA 5JAIA 3SJ7A 4RVHA 2Y2VA 1JQKA 3DBHB 4PPXA 3D3JA 3HI4A 3CLSD 1E2QA 1E89A 3GDWA 4GXNA 4RF5A 3H8JA 1ARZA 3AO0B 3G13A 4RFLA 3C1AA 2IXGA 4JC4A 3CZQA 5ED4A 4BTEA 2EW8A 2PFOA 2KWIA 2Y0SC 3LKBA 1AG9A 2BGMA 3V4FA 5LQAA 4OPMA 1U9YA 4Y6RA 3BORA 1HXHA 1FU8A 5JTTA 4DDTA 3MXOA 1SCNE 1Y9AA 1OYWA 3CV3A 1M8JA 1Q3KA 3VPFA 4KH0A 2F2AB 5IDXA 1JLMA 1FLAA 1PZHA 3WB0A 1RJ9B 1NJGA 2Q6TA 4PHGA 1TM5E 3UG7A 5JZMA 5HUJA 5F9FA 3LOPA 1CR6A 3PKIA 3GRKA 3UJCA 3MSCA 3CUSA 1VA5A 4BB6A 7REQB 4RULA 1HYQA 4AYTA 2PS3A 3K1ZA 3B6ZA 4FONA 5FTKA 3Q9SA 4KVFA 1XWIA 3OZCA 1SHKA 2AR7A 3CX3A 2HF7A 3K9NA 3GVXA 5F1OA 3TNJA 3TZHA 4DLTA 5I6DA 3DLBA 1AS2A 3C3AA 2NQ2C 2P90A 3PUYA 4ND1A 2L0XA 3LXRA 4RW0A 5LBUA 4WH0A 3EQ6A 3S99A 3TW4A 4CG3A 1XNHA 5EIHA 3BJEA 4GBGA 4N0DA 1D07A 1IYZA 9MHTA 4NDZA 4GR5A 4TMFA 2MTBA 1L5HA 4AT1A 4HLDA 3VRHA 1H0SA 3C6KA 3D3QA 3C41J 3EQZA 3W3AH 4EYEA 1FP1D 1FZTA 1WB4A 3UK7A 3G8CA 3WKCA 1DK3A 5DBAA 2V03A 1L6IA 4QXOA 1G3QA 4F6CA 3Q85A 4PGFA 2D2EA 4LJSA 1K9SA 4PR3A 4REMA 4NRDA 4RVNA 2ZDGA 1XZEA 1FLNA 2VF8A 2XEXA 3TRJA 3AFIA 4HAXA 3U7IA 3WJ2A 3JYNA 3VNAA 5A3QA 5IT9A 4Q16A 2C2BA 3CJQA 4EG3A 3KUCA 2Q3HA 3RVJA 3KZVA 4BRSA 5J9FA 3AM9A 1UBTS 5BW6B 4UARA 4HDCA 4UVIA 3AK4A 4D81A 3M0EA 1WDKA 1ABBA 3QYPA 3FHLA 5CW2A 3NFRA 4EGJA 2R85A 5FOXA 1GQSA 2HHWA 1LNSA 1R6UA 3PPWA 1JDNA 3UPQA 2D5IA 4YI3A 2I1WA 2IE8A 5FWXB 5EKUA 3D3NA 1TZCA 2SNIE 3DP7A 4B3DA 5LXTA 2HLDA 2MSEB 1J42A 1PVRA 1C9EA 3L5OA 3OTGA 4QUBA 3NHAA 3RS8A 3CPSA 1K88A 3TPFA 1X8XA 1R6XA 4QELA 1SVKA 2DFPA 1NATA 5KFQA 2IU4A 4FDLA 3SHWA 5AOCA 4A0QA 2A3VA 2OV2A 5MFPA 2P2DA 1AKVA 1T8TA 4URHA 4UXHA 4DF3A 5AKXA 3DWFA 4YUVA 5JSKA 5K7SA 7ICQA 5KFAA 4B6GA 3DE6X 4D6PA 1Q1NA 4PHHA 4XEHA 1W5FA 4QXQA 2FVXA 4CQJA 1NSYA 2EIHA 3HCEA 5I01A 1X1TA 1FFHA 2J1LA 4MPDA 1Y1RA 5FTWA 3GFTA 4UNIA 3E3OA 2ZRHA 3F1LA 3UJ6A 4BX9C 3MNFA 4KIJA 3UXNA 1PEAA 1CY6A 2H4WA 3WKBA 1B4FA 1X2EA 5KT6A 4FYVA 4WBNB 3RC2A 2XCLA 1ZEMA 2OGTA 2EZTA 3HB4X 3WGHA 1J6UA 4R83A 4A91A 2FEPA 2FG6C 2P8SA 4CEHA 1GGEA 1YCHA 1MX9A 3LIIA 2ODBA 3EY9A 4OKSA 4J3FA 1KAGA 2ZTEA 4GPZA 1K8YB 4IIBA 4PBTA 3UHAA 5JCZA 1ZISA 2D5LA 1IG0A 2ASLA 2DBYA 2YQEA 1NZBA 4V1CB 3DUFB 1NJZA 3GUYA 4Q34A 1EINA 2FFRA 3LLSA 2C7PA 5ARCA 2IY7A 2QTLA 4X8OA 4DR1B 3KALA 1UT5A 1G4AE 3BGWA 3OLVA 5J1SB 5J2TA 4JJGA 1WD7A 2N0SA 3HEBA 4GC5A 4KTVE 2P1ZA 3SK0A 5HUHA 1QPGA 3ELYA 3PQCA 1W4RA 2EATA 3KAKA 2R8YA 1YL7A 3EUB2 1B1CA 4ICIA 3U1VA 1HDXA 2RKWA 4RADA 3ENVA 3ABIA 1MX5A 2E4AA 2ODAA 3AHJA 4GYJA 2VIXA 3OY2A 4RZUA 1XXLA 2IZ1A 3FN4A 1GR1A 4Z54A 3FTDA 4JL8A 2FDXA 4JB0A 4TUSA 3WP0A 5IU6A 3IIJA 2OAQ1 1A88A 2GILA 3GEPA 4TV8F 1JHQA 4MS4A 3GFKB 3EUWA 5D85A 3W06A 3RS9A 3TRIA 5IAGA 2JEYA 4LYFA 3VQTA 3VM6A 2V6BA 3B3FA 3Q8QB 1NVEA 3B8EA 3TKLA 1X15A 1KWKA 3EWIA 4B9SA 3FOZA 1B8NA 1RM0A 1WY5A 2QLJA 3DO5A 3FGOA 3NCTA 4MWEA 2CXQA 4MRAA 5AXCA 3TTYA 5AOAA 4HQFA 3U3JA 2JHFA 1YRBA 3L1VA 2PWYA 3UV3A 1A97A 3CX6A 5G02A 4YACA 4TV9B 2XUZA 1OCEA 5K5EA 1NLZA 3C16C 4KRYA 4CCYA 4Q8FA 1NRJB 3H2ZA 4KMSA 5EWJA 5HE8A 3H7IA 1FNCA 3EGOA 1QV7A 1WZNA 3WK7A 4MUYA 1M2VB 2ZIWB 2X22A 2VC2B 2DU8A 2C42A 3EPPA 1P0CA 5TC4A 1JSZA 1O95D 3QOFA 4AKIA 2BOVA 4GFJA 1V41E 1GPJA 1YZHA 2FE1A 2X2FA 2Y76A 4L5IA 4QOSA 3TLYA 2DUJA 3SYRA 4C6TA 1E1RD 5LMNB 3SHOA 4KNVA 4XJSA 3R6GA 2ERCA 2ZJYA 4OHKA 2EJBA 1VJRA 3WIDA 2FZWA 2AOTB 4LX8A 1X92A 3ENZA 4H1VA 4MW0A 4GGPA 1NNI1 2HHQA 1IFXA 1QG6A 1WCXA 4YRDA 4CMAA 3OLYA 4B47A 2HYIC 4F5RA 1XN1A 3ZCXA 3LWNA 4LF6B 5C52B 5EE9A 4EG0A 5K3OA 5DI3A 5AM0A 3IUPA 3M6VA 4Q3NA 4HUQB 4TLLB 2EVWX 1A8QA 4PFSA 3W2IA 3ZTYA 2ZRIA 4CM5A 2VDWB 4AZTA 3M8SA 3COPA 1E4EB 5FWDA 4B6RA 1NY5A 3FRJA 4P0TA 4NL9C 2GDJA 2IPMA 3V4OA 1T6NA 2W71A 3DFZA 1LV8A 1RWVA 4D43A 5ELXA 2VUTA 3F6CA 1FVOA 5F35A 2W6NA 3D2BA 3JYHA 4TTTS 3FA2A 4YECA 4ERNA 1GPNA 4JJ4A 1XMOB 2P68A 3ZQJA 3UOAB 1W0KA 2OCBA 1EQUA 2PT5A 3S27A 2X3UA 3DWIA 3AERB 3ST7A 1KAQA 3V4VB 2EZXA 1QUEA 1XXHB 3H0CA 3SSAA 4DDVA 5JU5A 1G5IA 1ZH4A 1BYUA 1SXHA 1ZXXA 2QX4A 4JOBA 3IBCA 2QPLA 2YY6A 4KAXA 3GL9A 4PYQA 4QQFA 2KSOA 4QXMA 5DTJA 4D3XA 2BUAA 4OG2A 1OVGA 2AC2A 1FF9A 2E5FA 3LQRA 3M49A 4Y8VA 1CUHA 1UPTA 4A9AA 1UXGA 4CUJA 1P7VA 4WDQA 4OA8A 4A8TA 1JZQA 3OE7A 4BV2A 1L6NA 4BQQA 4J3JA 1FMLA 2WA1A 1Y7HA 1KNXA 3HR4A 2YJ4A 3IQHX 1SR8A 1ZCZA 2NVOA 2R79A 3NKLA 5FNVA 3OJ0A 1CRWG 1FTSA 5TPWA 4BKQA 1AGRA 3FPAA 5FUMA 3AEUB 3R3SA 3SV4A 1MD9A 2JD2A 5CW1A 3LDGA 4P84A 4Y9DA 4GOJA 4ZI2A 1K3FA 1PGJA 4CIVA 2C57A 4GX1A 1C1DB 5IF9A 4BUCA 1QDLB 3EWNA 2O8FA 1U1EA 3K94A 5AHKA 2R6CA 1G6KA 4KITB 1WCIB 2CWWA 2EFEB 3L1JA 4JOQA 2VFAA 5J1TB 3ESBA 2C2MA 2B4TO 4IXDA 2H85A 4EPXA 4HVCA 3VVLA 3B53X 1ZD3A 2PZJA 2E6UX 4AP9A 1PYOA 1R4AA 2FHSA 4ED8A 4RFVA 4RELA 5EMJA 2JGAA 3SAGA 1XVIA 3G59A 5I7AA 4JWNA 1I4TD 4E08A 4ESVA 1QU2A 2JIZA 2H57A 3RR7A 3Q15C 3HVKA 4EO7A 1Y48E 2ASJA 2BMFA 2HSEA 2R84A 4MEJA 4BLQA 1J90A 1XIVA 2E1PA 4L15A 5C3UA 3WC4A 4W99A 3K71B 3II6X 1TZBA 5F23A 4PL2A 3E1GA 5T6MA 4LCEA 5KTNA 4HD8A 5K4LA 2HJHA 3MOSA 4O08A 1Z2OX 3N4MB 4CN8A 5AUOB 3IG5A 1EUQA 2ZRAA 1NI5A 1UC8A 1Z39A 1JYEA 1NR1A 3UO8B 4CCHA 5A6SB 4NV0A 2AFRA 2QVZX 2XD4A 2K4PA 2LYHA 2A5YB 2IGBA 3PC8A 3PQDA 3R1IA 3S68A