3ZI4A

The structure of beta-phosphoglucomutase inhibited with glucose-6-phosphate and scandium tetrafluoride
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
218
structure length
218
Chain Sequence
b'MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-PHOSPHOGLUCOMUTASE
publication title Metal Fluorides: Multi-Functional Tools for the Study of Phosphoryl Transfer Enzymes
rcsb
source organism Lactococcus lactis
molecule tags Isomerase
total genus 76
structure length 218
sequence length 218
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2013-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3zi4A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3zi4A01
5AKKA 2D2VA 1L7PA 4BX3A 4BEWA 1EK1A 4H1WA 3OPXA 4UU0A 3DDHA 2B1QA 1FEZA 1WPGA 3E84A 3WGUA 4UMVA 2HSZA 2G80A 4UM7A 1L8OA 3HYCA 1MH9A 2FPUA 3MPOA 2O2XA 5A3SA 5AW8A 5AVXA 3AR6A 3ET5A 5FP0A 3L5KA 2MSNA 5A3QA 2YMMA 1LVHA 1O08A 4E88A 5AKIA 4BBJA 5AKZA 4HGPA 1RMQA 4IFTA 3VAYA 5AVTA 3PDWA 4HAIA 2I54A 2Q4TA 2GMWA 3OCWA 3EF0A 5AK5A 3ZWDA 4O8CA 3L1VA 4YGYA 1WZCA 3L1UA 2P69A 5ALTA 4Y2RA 4F72A 2GFHA 3ZWKA 3B9BA 3R4CA 1X42A 4BEVA 4UW9A 4XPZA 4AP9A 4L6AA 3ZTWA 1Z4QA 2WM8A 1XP5A 2C8KA 5AW9A 2YN4A 4Y2XA 4FE3A 3NAMA 2GHTA 1TA0A 5AVQA 3QX7A 4RETA 5AKLA 3ET4A 1ZD5A 1TE2A 4YIHA 5AW3A 3CNHA 1N8NA 3QUQA 4EEKA 2ZXEA 5AVUA 1Z4IA 2RARA 1AQ6A 4BX0A 3K1ZA 3OCYA 4UMFA 2IOFA 1SU4A 2AUTA 2OYCA 2GO7A 1U2SA 2HOQA 3WK7A 3U7HB 4EX7A 2HHLA 4IG4A 3QNMA 4G9BA 4Y2QA 1ZRMA 3ONNA 3ZVMA 5ALZA 3W5DA 3L7YA 1F5SA 2OBBA 4CE6A 2WHEA 4EENA 2X4DA 4CNQA 2YJ3A 4GXTA 2AH5A 4YIKA 3DNPA 4YCMA 3ZW7A 1J97A 5ALQA 1QH9A 4EZEA 5AKXA 4UASA 2AMYA 3A3YA 3UMGA 2YJ6A 2HEGA 2JAUA 1U2TA 3OCXA 1K1EA 3A1CA 4XOUA 3NASA 1NNLA 1N9KA 3L8EA 4AS2A 4DFDA 4C4TA 1KYTA 5ALIA 3MMZA 4UAUA 1U02A 2I7DA 3OCZA 3QU9A 5ALFA 3U7FB 5AI9A 2BY4A 2DQSA 5AK3A 2HF7A 1NF2A 2HCFA 3EPRA 2PR7A 2PKEA 4OHFA 2CN1A 5ALDA 1YJ5A 2JAWA 1L7MA 3E58A 3WGVA 3W5BA 2YFYA 4I9FA 2CFTA 2G1AA 1EK2A 1QYIA 4J2TA 4HYTA 2B0CA 4I9GA 5AW0A 5IT4A 4DW8A 2JGAA 2IOFK 3WKCA 1Z4NA 3UM9A 3A1EA 3WK5A 4F71A 2FPSA 5AW5A 3W5AA 1CQZA 1Y8AA 3PCTA 4EX6A 5AW4A 4B6JA 3KD3A 1PW5A 1Z4MA 3KBBA 3EWIA 5AVSA 1L6RA 3MN1A 3N07A 3F9RA 4BNDA 1RMYA 5AM0A 1U7OA 1RLOA 3QU5A 3DV9A 4HGNA 2CFSA 4FYPA 3E8MA 4CF3A 1Z4KA 1O03A 4KNWA 4YCNA 5ALRA 2P27A 2I6XA 2P9JA 5AI4A 2HI0A 2W4MA 1L7NA 4NWIA 3QGMA 2OA0A 1Q91A 1Z88A 3NIWA 3QLEA 1WVIA 2IA5A 2GHQA 3A1DA 4DCCA 3DAOA 2FDRA 4C4SA 1QQ7A 3HLTA 4Y2SA 4NV0A 1RQNA 4Y2VA 4BYGA 3KZXA 4UU1A 3KDPA 5AICA 2MU1A 3M9LA 2R8YA 5JJBA 1ZD2P 4UM5A 2C8LA 5ALPA 5AKEA 5AM3A 1XPJA 3L0BA 5AVRA 5AVZA 3L0YA 5AIAA 3ZVLA 2G09A 5AESA 4CF4A 2HDOA 2FPRA 1QQ6A 5AI5A 1TJ5A 1T5SA 2FEAA 2G0AA 3I1YA 5ALYA 3PGLA 3UMBA 2B30A 4Y2PA 2YJ5A 3U7GA 4UARA 1Z4PX 3ESQA 3AR4A 1RKQA 4Y2JA 2AGVA 2QLTA 4UATA 5AHXA 1L7OA 2RBKA 3N28A 1JUDA 4RESA 2ZG6A 3U19A 2EATA 2B8EA 2B1RA 3FZQA 3B9RA 3WK8A 2RB5A 4NAVA 4G63A 3IJ5A 3SD7A 4XE5A 4HGQA 1ZD4A 3ZTYA 3MC1A 4UMEA 2WF7A 4ZEWA 4HGOA 1Z4JA 1J8DA 5AK6A 1RLTA 3RFUA 2EARA 2WFAA 5AW6A 1YDFA 1SWWA 3EF1A 2ODAA 5AVWA 3E81A 2RAVA 2YJ4A 4GIBA 2FUCA 5IS2A 2NYVA 4QJBA 3N5KA 3CZ4A 4C4RA 2HX1A 4Y2YA 3ZX4A 1YV9A 4EELA 5ALKA 2BDEA 3FPSA 4ZEVA 2YMQA 3QXGA 4JDPA 3NANA 4CF5A 2EAUA 2JAOA 1CR6A 3QU4A 2C9MA 2P11A 2I33A 1ZD3A 2HF2A 2R8XA 4BX2A 3L8HA 5AIBA 2ZOSA 4ZEXA 2C4NA 5AKJA 1Z4LA 1YS9A 1RQLA 3WKDA 1RKVA 3NALA 4L57A 2G06A 2W11A 5AW2A 4BNDB 2YMLA 2R8ZA 5ALEA 3R09A 4KYTA 1RC8A 3KOOA 3AR3A 5AKGA 1LTQA 3PGVA 4HGRA 5E0OA 3I28A 4Y2TA 3QU2A 4AS3A 2NO4A 5AVYA 1ZRNA 3ZI4A 1RKUA 5IT0A 1RRCA 3FGOA 3QUCA 3AR8A 3FM9A 5AI8A 3U13A 3L0CA 2C88A 3KC2A 5AM4A 3N8GA 1ZS9A 2WF6A 1Z5UA 2I55A 4BKMA 4YH1A 5AW7A 2G08A 5AW1A 3FVVA 5ALHA 2ZBDA 5A3RA 4OD0A 3WK9A 3SHQA 2NO5A 2R8EA 3ZVNA 3L8GA 4FFDA 5ALJA 1TJ3A 5AM1A 3L8FA 4Y3UA 5AKHA 5ALMA 2O9JA 3QYPA 5AK4A 4NFLA 1U7PA 1ZOLA 3I76A 3ZU6A 2ZBGA 1QQ5A 4QQFA 4UMDA 2VKQA 3U26A 4KX5A 3OTQA 3WK6A 1Z5GA 4KN8A 5ALUA 3WK4A 3B8EA 2Q4RA 5AKYA 2HO4A 2BDUA 3I6BA 5ALGA 2ZBEA 2FPWA 2YMPA 3AR2A 4XQ0A 4MUMA 2ZBFA 5AM5A 3FPBA 3TLMA 5AVVA 4OFZA 3NRJA 1XVIA 1RPZA 3ESRA 3W5CA 3IRUA 1VJRA 2CFRA 2OM6A 1IWOA 3AR5A 3U7EB 3UMCA 3OCVA 1NRWA 3J7TA 1Z4OA 3IB6A 3AR9A 2IOHA 5ALVA 1RLMA 1ZJJA 2B82A 3QUTA 1Q92A 2WF5A 3SKXA 2FUEA 3ED5A 4JB3A 3BWVA 3WKAA 5ALXA 1VJ5A 2MU2A 3SLRA 5AM2A 1T9ZA 4KX3A 5ALLA 3ZUPA 3RF6A 2B8JA 1SWVA 3SF0A 4NABA 3WKEA 3GYGA 1RMTA 2W43A 2WF8A 4UAVA 1TJ4A 3OCUA 3S6JA 3M1YA 3P96A 1S2OA 5ALSA 5ALOA 2JARA 3N1UA 1VFPA 1WR8A 3QUBA 3SMVA 5AI0A 3BA6A 2YY6A 4MWOA 3R9KA 1YNSA 5ALWA 5AI6A 1L8LA 2YBDA 5T41A 3AR7A 1RDFA 1YMQA 4L6CA 3WKBA 4OCZA 3NUQA 2QYHA 2IYEA 2PQ0A 3QU7A 3D6JA 1T5TA 2Q5EA 4KNVA 2I34A 2WF9A 3ZX5A 4J03A 4Y2UA 2FI1A 1S8OA 2G07A 4PNHA 3SKYA 4DWOA 4YCLA 5ALNA 2FPXA
chains in the Genus database with same CATH superfamily
4MP8A 2ZWVA 1FFCA 2A1TR 1K68A 1B2LA 3B6MA 4QEZA 4KO1S 1Z0DA 3CJRA 4GX1A 2G5TA 4AWXA 2GPSA 3H4VA 1W4LA 3TEMA 1L4GA 4JOQA 2XMZA 3M3PA 3WP0A 3UK6A 3JQRA 1MO5A 3BFPA 1Z73A 2DBVO 5C7OO 3G9XA 2PYIA 4UTOA 1CUFA 2JF0A 2OCKA 3B1WA 3VO1A 3G6KA 2ZJAA 4DV6B 3LDGA 2HA3A 1NRIA 1DARA 1WS6A 5IIIA 2N1MA 3QF7A 5DI3A 3RFXA 3WWYA 1O6GA 3VUFA 2FHSA 4GUAA 5EXTA 1VYVA 1Z0FA 1G8AA 1L7XA 3UMSA 2X2FA 4I2AA 2HIHA 4IOLA 1IG6A 3GIDA 2P6UA 1DBWA 1K7FB 2C3YA 2AH5A 4CDGA 3GPBA 4QT0A 3EXHB 3DOUA 4C01A 1CUKA 2JIMA 3LP8A 1X77A 4MQFB 4EUFA 2ODBA 2DE0X 4EG8A 2RRDA 2AEMA 3VZPA 3GPDG 2JFXA 3KSMA 3TE7A 1YR9A 2BMDA 4TYQA 3X0DA 3PD0A 3MWJA 4R40A 5EQDA 3BMCA 3IIEA 2VHUA 2Q7XA 1EFAA 2KEYA 3PXGA 3V4PB 3K35A 5ELMA 3NXSA 4R1MA 2GYYA 4X5VA 1SUPA 2YHBA 4GXRA 4GFDA 1VP9A 4H0NA 2I7VA 3ZU2A 4G2NA 2CMGA 1Z0KA 2XYHA 3PUYA 4BVBA 1FYVA 1T7PA 4NR0A 5CRIA 2ZUDA 4L5JA 3UB2A 2WTXA 1XPUA 5TPWB 3HGQA 3OA0A 5JCOC 3G8DA 4MW0A 4QOFA 2PMKA 2ZRNA 2O0KA 1X0VA 2NZXA 2M2IA 2ZWOA 2G09A 2YWFA 1OZGA 3CUKA 3ZE2B 4DLEA 5JXWA 3LJKA 3IXQA 2GCEA 3ZNQA 1U1EA 2VTBB 2R44A 4BFVA 5IKMA 3AHEA 1KE1A 1JQ5A 1Y48E 4K28A 5FA6A 4RCYA 3C5HA 3EEBA 4F91B 5LU8A 1Z0ZA 1T4CB 4H7DA 3B9JA 1WXHA 3FJ1A 5BQ3A 5AD1A 4B46A 2JEJA 3ZBTA 1S9DA 4UBMA 3O83A 4KIJA 4EZIA 2DH5A 4ZOQI 1THMA 1X9GA 2P67A 4C8NA 3QKWA 1EVYA 5FADA 4CV1A 5DASA 1RXIA 4F50A 4XB2A 4PYQA 2OHHA 2Z56A 8ICGA 4ZYTA 3BERA 4NLGA 3RH6A 3IEVA 4ECEA 1T8YA 1E1CA 2GARA 1DEXA 2XNSA 4INAA 1JHRA 1YUMA 4J76A 1GUDA 3HXMA 4Q03A 4QPPA 3EMVA 5D2CA 3RSHA 3D7KA 3D3WB 1VGRA 1C14A 1LQ2A 1QBGA 4O2RA 3KQPA 4GBGA 3ENNA 5CG1A 2FZWA 2INGX 3K05A 1I2MA 2QDXA 2W2MA 4IJUA 1FS5A 4RJJA 4BNIA 2EX0A 2XVZA 4L9AA 4XQ8A 5E2IA 5CVEA 1WBBA 1S02A 5KG1A 1U4SA 1THTA 3BXZA 1FMLA 2CLCX 4AURA 2RJOA 2R11A 1VIVA 3C45A 5CDHA 4FN5A 4Y3UA 1M5UA 3HXLA 1IJFA 4EGAA 3I76A 4EHDA 3ABRB 1IY2A 1IC6A 4ALJA 1F0NA 3VRHA 2PMFA 3H8JA 3VPAA 2HO4A 3CX8A 1R4NA 1DG9A 5DHUA 3Q1LA 3SQDA 1H1LA 4MUMA 2C58A 1DXQA 2A2ZA 2B99A 3NRJA 2P2DA 1FRNA 3G79A 4FMBB 3SLGA 1X8KA 3AR9A 3WLQA 1IZ9A 2O2YA 4O1MA 3RVSA 1OWPA 2ZYGA 1X9IA 2HRRA 2CXSA 4P4SB 1BGWA 3ZCVA 2QTTA 2HSDA 3V97A 5KFLA 1N9GB 2BV3A 2J3MA 3PQCA 2VPIA 4ZGGA 2F8MA 3EMKA 1GZ4A 1LDYA 2QHXA 3RSZA 3QYFA 4IDAA 1SGGA 4FDUA 2W2KA 1NZDA 4FHEA 4FOPA 4YRSA 4LXYA 4LHZA 2EP7A 4ZTUB 1CZLA 1N5OX 4JCOA 1BGVA 4C2AA 5LYJF 3OPXA 4J9RA 2ETVA 4MKFA 5JTIA 3WGUA 4UM7A 3I6ZA 3KQHA 2AFHB 3LY5A 3KV3O 3CF4G 3PEFA 4CFYA 3WLLA 3RSCA 4RTJA 3ISDA 3AI2A 4R65A 2AJCA 3L7CA 1ONNA 3M49A 1IPFA 3M6IA 4ALNA 5EEHA 4DZRA 3PNSA 4Y6PA 2C99A 1QOPB 2LPMA 1PD0A 2VA3A 3WMFA 2H7CA 3LY7A 4U0KA 2YV5A 1BOOA 4W82A 1XAGA 1VSTA 1Q15A 4TX1A 4JAVC 3O2NA 3K1ZA 4JYBA 5J0TA 2XUHA 4Y2QA 1Z6AA 1GDHA 5LB4A 2GCOA 2P6RA 3ZUGA 2MYPA 1TO2E 4F8EA 1YS2X 2PKQO 3ITKA 3LQFA 3PEEA 4J3JA 4PTZA 4JL8A 2HUNA 1KR2A 1ZOOA 4R1LA 3X1XA 1A7UA 5SY4A 4JC0A 5BT8A 2C7VA 1JR6A 3T34A 5FOWA 4IQWA 3ABIA 3KP1A 4X3OA 4TGLA 2E5WA 2X3UA 5CFOA 3FBTA 3VBEA 2BDPA 1JG6A 1QSYA 2OAP1 3H3FA 9LDTA 5JDCA 3FRIA 3SZOA 2CDBA 1M8GA 4G41A 3Q7SA 3BJMA 2QTFA 1A8QA 2IHBA 2OOKA 4MV0A 4F5QA 5CT9A 1YS4A 4E5DA 2ZIUB 3MF4A 4KQEA 3GRKA 4PINA 3WV5A 1MUUA 2AJDA 2X8BA 2Q6KA 1D1TA 5L3SB 4DIDA 1UBCA 4WCDA 4O4IF 4OJTA 3NVZA 4DEXA 4RDXA 2FSHA 2VC2B 4A5OA 2NIPA 3M6MD 1ZCJA 5FBLB 1TOAA 1CUVA 1M33A 4KXQA 3HADA 3IURA 4JYMA 1LZLA 3GA0A 4DLYA 3UVEA 2WJJA 1QZUA 3QBEA 1RPAA 3Q8KA 4CIVA 2QB0A 1QIEA 3V5NA 1G4UR 4QHYA 3FHTA 5DB7A 3SFVA 5H81A 3KCQA 4FZ3A 3LXRA 5F12A 1YOVB 3JASB 4NF2A 4RIHA 3IJ5A 2OHFA 1F51E 3CPSA 3DM9B 4NIMA 5H4HA 3NYIA 3RRGA 4MA0A 5J5VA 4BQEA 1UEJA 3U49A 2AG6A 4XLLA 1W49A 3CVXA 1P73A 1W36C 8ICIA 3MTAA 2J07A 2FWPA 1A9OA 2H8KA 1UPAA 2KI5A 1JALA 3L07A 4K0KB 2A1JA 2WWIA 4MW2A 1YQXA 1H2RS 3L6DA 2DXIA 4MVWA 3R24A 4BO9A 4V0RA 1DQRA 1A2OA 1R6DA 2Y66A 2QPLA 4MB0A 3IT1A 3RSSA 5BRNA 4JLMA 1HFJA 4ZEXA 4DQ0A 2XSZA 4DXHA 4RVCA 3T3FA 3FUCA 1WUYA 4CPDA 1O57A 1VL8A 1XTJA 3KOOA 3D1JA 1G60A 4W7IA 3ZGLA 2PLRA 4QQKA 5CNJA 4L51A 4OQ4A 2WYHA 1VE3A 1TV9A 4MTCA 3I37X 1GXSB 1GZSA 1WMBA 3TQTA 4IKEA 3RIYA 9ABPA 1DKLA 1E59A 1U2RA 1YT5A 3KJGA 4HEQA 5TQ2A 1P45A 5H02A 4GGOA 5EXDA 4A1FA 2DHCA 3FNGA 5DWDA 5J4VA 5SV2A 3V8RA 3ZDAA 1BRTA 1JTVA 2CY0A 4KAXA 2A84A 4DMCA 1KARA 4GZLA 3DB1A 3EUAA 4LJ8A 2X2EA 1N33B 4QZIA 2G17A 3L1HA 5LQJA 1DKPA 3ZE0B 3NRZA 3EQ2A 4GF5A 1EI9A 4XDGA 5E2AA 5H82A 1IB0A 1TK9A 2Q46A 2XYGA 3TQHA 4US9A 1RLJA 2EWWA 5EOZA 3REQA 1Z4OA 1PZHA 1A98A 2GOYA 4OP3A 4B2IA 1QH1A 1FVOA 3H2ZA 5IYZF 4DMKA 4JK1A 5G4LA 2G6TA 3O4FA 4M1MA 3N1UA 4LCJA 5HR5A 1L1QA 5AUNB 3MWDA 4GEGA 4OKSA 3B52X 4B73A 3NIBA 3JQ8B 2Z4TA 5K6AA 3ZJUA 4RANA 1UDWA 4A3SA 2H51A 4J9NA 3ZWPA 1OBOA 5GJVC 1D2NA 5IBQA 3CWZA 5DTJA 4RORA 2BFDA 4BQFA 1C20A 3H9GA 4TMWA 1QFXA 1JJAA 1SXJA 5ADVA 1QV7A 2HQSA 5I9MA 5K05A 4PGHA 1NG1A 1TADA 1D8LA 2R8JA 3OTOB 3KFXA 4I5IA 2BCVA 1XEAA 2ZJ1A 5IKPA 2AR0A 4CCWA 2AU0A 1E6KA 3KV1A 3H1AA 4J7UA 4KTTE 3ZWKA 4U6SA 1W4AA 4YA6A 1EBBA 1HNXB 1DG1G 4DWIA 2YHSA 4MWDA 4CG2A 1DAIA 2OGUA 1BZYA 5IN5A 2DVMA 1TF7A 5I6DA 5KMGA 3CNHA 4MB2A 3QVOA 2HHWA 4CKWA 1TZCA 1YR8A 4FT2A 1RI5A 5L40A 3G0OA 4BJ6A 3WNCA 3ZBQA 1Q0SA 4JBLA 3ZVMA 1YZNA 3EGOA 4DV3B 1UKEA 5KTRA 1MG5A 1Z7GA 4YBRA 4N7JA 2IE8A 4E0DA 1OKKA 1V85A 3PFHA 1HK7A 2ZB2A 3QM1A 5EYPB 1MFPA 4FHCA 2Q1YA 3GVCA 2BUAA 2J4CA 3AUUA 5JSZB 4JC5A 3MCTA 1TL7C 4OP2A 3URMA 4MRAA 4HYTA 4URFA 2JH9A 3ZWAA 1Z75A 4UZSA 5AW5A 3KETA 4RK0A 3OCJA 1U0SY 3ZQJA 2QTHA 3FE2A 1GSHA 4Q1BA 1JHXA 1ZBQA 2EX1A 4KQKA 2NRTA 2P5SA 2LNDA 1Z26A 1PD1A 4K3UA 1H5NA 4NQZA 2KFNA 4KLQA 3HP7A 1QGYA 1NF9A 3PUZA 1IHYA 5HTOA 4XX0A 4A6DA 4G25A 4BGDA 5BWBA 4F8JA 2NV2B 2SICE 3K0EA 2W83A 3NKVA 1NFFA 1QVWA 1V45E 4DFKA 2EZ8A 4J9QA 2Q27A 3VR5A 5A4AA 1LF5A 4Q00A 4Y2HA 1B41A 3SDSA 1WXDA 2HGSA 4XE5A 1ZD4A 3QEAZ 2FV8A 2I7XA 4KIUA 4LV8B 2XCRB 3GCXA 2JZBB 2O4CA 4O4HF 3VFDA 1XSPA 4F38A 2KKPA 3ZQ4A 2OQRA 3RBAA 3KDAA 1X94A 2UUAB 2WHPA 3QKRA 3TRDA 2C4TA 5COQA 2D2XA 1B6TA 2F90A 4FDTA 2BSXA 1V4BA 4GSLA 4N9QA 2OB2A 4JJIA 3RGWS 2G72A 2GAIA 1P44A 1GG5A 1UC5B 3DTVD 2G71A 1KJQA 4DC1A 1XA4A 3HY3A 3EASA 2PQ2A 3K72B 5LP6C 2ZPTX 3C7CB 3VSBA 3HCAA 3QU2A 1ZYQA 4KQXA 3QZ8A 1Z83A 4KQMA 1MLDA 2O06A 3FLBA 2Q3MA 4I29A 4B7CA 2QN9A 5KT5A 5DEIA 2NO9A 3ECAA 3N0WA 2Q5IA 3WLJA 1BH6A 3ZXIA 4DWVA 4KK3A 1NT2A 1MOQA 5JZSA 4TQGA 2OV1A 1TJNA 4I2EA 5D1NA 2QL5A 2RKOA 3W3AD 3U26A 4K05A 4FS2A 3THXB 5IC5A 3BWYA 3KT6A 3E9YA 4XYLA 1BJTA 2EDCA 2WPDD 4M7PA 4D9IA 5BO5A 2FP4A 3KJQA 3F8SA 1XRNA 1J0AA 3HRKA 3DVRX 4ZOEA 3EK2A 2QRJA 4UEKA 3UT0A 3NGDA 1CUEA 4Q7QA 5EQTA 1IWOA 1VL5A 5K4GA 1S8FA 2K8BB 1HDZA 3CH7A 1FMTA 1RHRA 3HCRA 3JWHA 5J2JA 4I14A 3R3SA 2CUKA 2EIXA 3U4DA 3TO5A 4UNRA 4IIEA 5JNSA 1B43A 3OSPA 4BLRA 3U7RA 2OCXA 2Y0EA 4TS4A 4PSCA 1JIKA 3SAFA 5JWRA 1KEPA 2R8BA 1DG3A 1W0CA 4UBBA 2HHVA 1FFEA 4LX0A 5L1MA 3RJ9A 4D82A 3QEBZ 1XTRA 3UAOA 3NOVA 4G23A 3AV0B 4AWBA 3EF3A 4DA9A 3NVYA 1T8PA 2VAPA 1QU2A 2D2VA 2VRCA 3R9WA 3WQRA 3DEFA 3MGHA 1Q14A 2B1IA 3L4PA 1BVHA 3HVUA 3VYWA 4RY0A 4A1OA 3ADKA 2XY7A 2PWPA 4KPYA 1NJSA 4C3VA 4YXMA 4YYZA 1Q2UA 1GWNA 4ETNA 2XCAA 4A0SA 2XVTA 2CLMB 3DE4X 4GNKA 4D9HA 3DL0A 4X65B 1AS3A 1J8YF 2V0CA 2WAYA 5J0SA 2IW3A 2UKDA 4HQRA 4EYQA 1Z4QA 4KLLA 2C8KA 2OCPA 3CX3A 1M5RA 3OQIB 4PZAA 4LMRA 1ECGA 5E6UB 4WTOA 4D98A 1W0KA 4V3BA 4RV5A 1SFRA 1ND6A 3EY9A 4KMSA 1PGQA 4MDEA 3TW4A 4MCAA 1OFUX 3IPRA 1E9FA 3A1NA 2W8BB 1S7CA 3C6ZA 4HNQA 1DDGA 3VU3A 1SQ5A 9ICIA 5J0YA 3BDVA 3CWQA 4D99A 5AVKA 4TTIA 4JKYA 2C77A 1EX9A 5K8UA 3R3XA 1TW2A 2I9KA 2J6IA 1Y6ZA 1Y89A 3AV3A 3HUUA 3SGLA 4DAOA 3DMNA 4QXMA 1QVVA 5I7AA 4O1IA 4Y7CA 3UA4A 3ZQKA 2IKSA 3DFFA 3OIGA 2XRZA 1VI6A 4LMBA 1O9BA 5E2BA 3HKEA 3X1ZA 3IP7A 3CUWA 2C5GA 4LKOA 3L8CA 4AG6A 2PXHA 2ZQ5A 4D3DA 3EQ9A 2VWHA 3G6XA 4IS2A 3K70B 1RPTA 1S01A 2YZNA 1UAYA 2CEAA 4LGYA 1X86B 1UJ4A 4BUJA 3U4QB 4EWLA 1K6XA 2V7PA 3B7PA 2ERYA 3GJQA 1HRKA 2XA2A 4GE0A 3ZXXA 2ECFA 4E12A 3IR7A 1OC2A 4WOKA 3H5LA 1UK7A 3G0IA 4CMEC 3KE8A 5LUBA 3LL7A 1DK3A 4PLTA 3RFUA 1JZSA 3WB0A 4AJJA 1KEWA 1GGFA 1SGWA 1NX6A 2RGXA 2XTNA 4DA4A 2N0SA 3BQMB 2VPWA 1N6RA 5HA5A 3M6FA 3S81A 3S8EA 3A0BU 5GZ1A 2R8XA 1C2YA 3MJRA 3MTEA 4I5FA 4GC5A 1PUJA 2XB6A 4K4GA 4MGKR 3OTIA 3JYLA 3D0KA 2I1VB 1U3CA 2ZTUA 3IOCA 4U7CA 3UT6A 1TM2A 1X7HA 2DL0A 2X5NA 2W98A 2BIFA 4JENA 3H0EA 1GCAA 1CUBA 2B8TA 4WFIA 3BZKA 1II8A 1MSWD 3RRYA 2QN8A 4ZQHA 3VU9A 4HAZA 4ZYLA 2M32A 4UB8U 3H1GA 5FLEX 4FLFA 4DMRA 3BDIA 3U3XA 5C37A 7ICPA 3A6KA 1N5KA 3DEIA 3KYDB 4MUIA 3VAZA 2F8LA 1WUTA 4O4LB 4MLZA 4PZLA 1RFGE 1UBFA 2OM2A 3HLYA 2QUBA 4XIIA 1V7PC 3FGNA 5JEEA 5IW8A 4OLJA 5K01A 3BMQA 1M83A 2UUOA 5B57C 4Q0MA 1RKXA 1IOWA 1B15A 2V7WA 4AKSA 2V5UA 3S2ZA 2H3QA 3L4BA 2CVPA 1JFLA 3H1PA 5E1BA 1UAAA 3RBDA 5M29A 4PQFA 1E1KA 4M1SA 5LP1A 3DYBA 2KB0A 1RQ2A 1PZXA 4YUAA 1O97C 2VK1A 3DD1A 3CCCA 4F5PA 3PUIA 1WM1A 1T5TA 5D8DA 3ZDQA 4Q44A 5GTIU 1J0BA 1E89A 4ALMA 4WSOA 3CNLA 3AYXB 1FNBA 1YQGA 4JHXA 2V1XA 3VH3A 4LBZA 3DBRA 5LXTB 5HKLA 5IVPA 5LVAA 4HNAA 4EFDA 3ACBA 4LIPD 5IX8A 9ICWA 4X7RA 4RPXA 5CA1A 3F9IA 2DKZA 1K8QA 4KIGA 3OCWA 1VCMA 1ACLA 3TH5A 4UB2A 1VPVA 2O7NA 1RJ9A 4HQNA 4PW0A 3QRWA 4ENWA 2UUPA 3ZJYA 5CM8B 1U2QA 4TOIA 3PE3A 5H70A 2ODPA 3BILA 2YB1A 3V7KA 1ABEA 9ICTA 2QM0A 1PL7A 1E1MA 2RARA 5DYWA 4E09A 2HOQA 2EQBA 4OGGA 4YALA 1F5SA 4FZNA 4TUYB 4QUKA 2VQ3A 2HK6A 4K6FA 4GI2A 4GLFA 2JAUA 3W7VA 4X64B 3AO0B 1ZESA 5EE5B 1OH8A 2WG1A 1YZ7A 4WK6A 3UKDA 2IEIA 4UAUA 4ARVA 4AKGA 2EGHA 3AX6A 6CHYA 4CKBA 2YXLA 5FI3A 4AY6A 4R2HA 4RIEA 4EY6A 4MRMA 3JALB 1Y7LA 2VPYA 3BE4A 3Q2OA 5F76A 4HMOA 4RAQA 3ANLA 4G65A 4C4ZA 2W0MA 3PF9A 3KQQA 1YQTA 4HFNA 3H4BA 3MRSA 3UHPA 3E5NA 3IO3A 5CVVA 3LHIA 1O5OA 3R8CA 2PU5A 1LLCA 1KK2A 4PNPA 3I5AA 5CD1A 2B20A 1DWPA 4JSRA 5AXCA 2Q62A 4YP6A 4RZHA 3PT9A 1EINA 1PV2A 2P62A 5WRFA 3PE4A 1MMFB 3EW7A 1ZNQO 3PUJA 7ICIA 4R9NA 1NVDA 2F1HA 5KFKA 1ESEA 3IV6A 3SM9A 1N8SA 4MJ7A 4QDZA 4JP8A 4REMA 4E30A 5KREA 2JFHA 5DKWA 1NK4A 1ZQFA 3S99A 1OLUA 3ZK8A 3C21A 4B3XA 1CP3A 4R1TA 3TTWA 1ODSA 1C9JA 4D26A 2OESA 4XX1A 4LG1A 4AT1A 3CVUA 1DOQA 2AX4A 3D8BA 3AW8A 1XCGB 4C78A 1TFRA 4YLYA 2QP3A 5DHSA 3RS3A 3FKQA 5I8PA 1ZISA 5EZYB 2AKEA 5C5IA 4LS3A 5BW8A 5KC9A 1KKLA 4H0FA 2GZ1A 3D5QA 3QLUC 3C4QA 4N8SA 5D3QA 1TC2A 1M1ZA 1K7CA 3T5TA 1VMEA 2NGRA 1OWNA 2J9GA 3WB2A 2P30A 3RSLA 5FHRA 3JQGA 1E0AA 1WXQA 5D87A 1U3TA 2O1EA 1T0IA 2F1JA 2RBGA 3N87A 4B4DA 1Q1ZA 3LYSA 2PUTA 3VR3A 3KCNA 4HTFB 1ODKA 3PB3A 2XE6A 3OIUA 2IS4A 4I1SA 1HE1C 4MMYB 3LUGA 4P3KA 3DJYA 3WL5A 3V8BA 5FWYB 4F92B 5IIJA 5AM5A 4EJSB 5KYYB 4XLTA 3RJHA 3ORRA 2VA9A 1ORVA 3CPJB 4WECA 3PUVA 2RHDA 4MYDA 4YCAA 2WYVA 4X8LA 5IF3A 1KZ9A 2JCBA 2IUFA 3SVZA 2RC6A 3IH5A 1BKDR 2EV9A 2VF2A 5FOXA 3T99A 1VLLA 3P96A 3WDSA 1VL6A 1JGTA 1XXHA 2NYRA 3LZCA 2MSDB 4PZPA 1WXWA 2XX3A 4H4EA 4TVBA 2XNHA 2BGTA 1I24A 3TX2A 3A9CA 3H8MA 1HQYE 3FHJA 1QVZA 1FIQA 4KLIA 4NCBA 1Y1QA 4NYJQ 2WNHA 4NZPA 1TX4B 1WEHA 3GV7B 1R64A 2D1FA 2MWMA 3MCAA 5JU6A 5F98A 5FP0A 3NBYC 1UXHA 1T43A 2VJPA 2RGYA 4OXKA 5JG7A 2QV7A 4NZZA 3V4RA 4M0DA 5KYKA 2H6EA 1ZJNA 2O20A 4HWOA 4F72A 4R9SA 3GW8A 5L6MB 4KQCA 2HVHA 2Z5GA 4NFSA 1EG7A 2FLVA 2HW3A 5F5XA 1A1SA 1KNQA 1XQ6A 2ZUUA 5FYDA 4ZO4A 1RYNA 1LY1A 2NACA 2ORVA 2XE8A 2JCXA 3BH6A 4KYUA 4UM9D 1DJNA 5HHHA 1PU2A 5K03A 1F12A 3ZW7A 1KTQA 2E48A 2OAEA 2FUKA 2IFTA 3FTFA 1NNLA 4QNMA 2QRUA 3SPXA 1Z0JA 3JR3A 4FBTA 4MF8A 2P2YA 1J8QA 1SKQA 5KG5A 1CB0A 3PWKA 2ZFUA 2WMYA 5JBQA 1I3KA 1CQZA 4D4KA 1LW6E 4CTJA 2WKRA 2XWJI 4M55A 2QX7A 3U4IA 1E79D 3DE6X 5AM0A 2D1TA 3TAQA 3WHKA 5ALRA 4UFOA 3WJ2A 5SY9A 1C7JA 1K8XB 4X66B 4U7TB 4J0IA 5BNFA 2GEUA 1U7TA 3UQZA 3H2JA 2OENG 4JWNA 5G02A 3EGEA 5IF9A 4KLAA 5FQOA 5DNCA 3LNCA 4B7UA 2B7LA 3JAMA 3C3EA 2KJ9A 2O50A 1Z4PX 4DARA 2C2DA 3VH2A 2D13A 2ROQA 3KL2A 4M9NA 1XMIA 1F0KA 4YMNA 2JXJA 2I2XB 4II2A 4II3A 2VG8A 3BKXA 1PL0A 3SU8A 4ZJUA 2QMZA 2YXNA 3R5XA 1ORDA 5FBZA 4FZMA 4H18A 3P52A 1FL9A 3VR2A 1KH2A 3C3YA 5HFJA 1CJVC 1N7HA 4M0LA 3FYSA 5BN3A 4JHLA 3BXOA 1A95A 2OV6A 1EP3B 4YJ2B 4WCFB 2ECOA 3A2LA 3UV3A 2BE7A 3JVUA 4NEHB 3LUKA 1Y42X 2FEPA 2AIRA 1K4KA 3AEYA 1T36B 1V1MB 2W7TA 2FZVA 4G5RA 5IZ4A 1DCTA 3A7DA 3AR8A 4TURA 2ZBPA 3KC2A 2BE9A 5CP8A 1C80A 2E1PA 1RXCA 4HB3A 4M7RA 2AHRA 1A4RA 3V4ZA 3HXTA 5DV9A 1G63A 2R6GA 2VHXA 5L3QB 4B4KA 1WSDA 2J9ZB 3FCOA 5EAIA 1IVSA 2H4YA 7ICUA 5JTTA 2YZKA 3JYQA 4AF6A 2P91A 4BKOA 3FUWA 2PSSA 4OHOA 3E1KA 2QVXX 2E9SA 3KAKA 3CUYA 4FB5A 3WRXC 2HRZA 4ZXFA 1IJEA 3ETRA 1B22A 4OQNA 4I4TB 3E9QA 4GPTA 4RTRA 2WT4A 4IX1A 2EYQA 5K3EA 2Q6VA 4IF4A 4RHTA 1QGAA 2V9CA 1RADA 2BFNA 3UB3A 1PAUA 4MRNA 4BAGA 1AQLA 1I2CA 3C48A 4LWOA 2Q3LA 2FLPA 1NWHA 2RSLA 2GF9A 3ZI0A 2VJKA 4JV2A 2R6HA 3OESA 1II0A 1F8YA 4OSEA 2ZUWA 3D64A 4CQMD 4ENTA 4YUWA 5JTUA 5TLSA 4GPBA 1ZQ9A 4WXHA 3FNIA 3LRPA 4HVLA 3KOUA 1JQ3A 2XO7A 1O08A 2ZSAA 4LDJA 3OF3A 3SIWA 3AHDA 4FBMA 3P26A 1PR9A 3QBVA 2GMWA 4IR1A 3O3MB 1TU3A 2XMGA 3KOZA 2J3EA 4JGIA 2IXTA 3E7FA 3ASVA 3UO8B 3CZAA 4RM3A 3DZCA 4J4BA 1I4OA 1CEZA 1LJLA 2P1ZA 3JR7A 1JSLA 5DEOA 3B38A 1O0BA 5I48A 5A3VA 4ABTA 2CMKA 4ZGWA 1ZKDA 3Q12A 1OYVA 4R3WA 4XIGS 4HPXB 3DMDA 2PXAA 4JI1B 3KQUA 3L8EA 2WUGA 1V5FA 4K2HA 1HV8A 3TRFA 1KZ4A 5JY6A 1U0HC 1NSFA 3ZCPA 1XI2A 9ICOA 3K32A 2TRSB 3QVMA 1NSTA 1HGXA 2O54A 4RSGA 1VYHA 1LEHA 3VYSB 2ONKA 3QKUA 2XTMA 1WTAA 3ND8A 1JR3E 4QREA 3IBSA 5CXXA 2Z0MA 1NURA 2YV1A 1LS1A 1UKAA 4YJ3A 3C1UA 1RRKA 2E6UX 3P9SA 1GPAA 2YR0A 3I92A 3GJ6A 2PWAA 2Y0CA 5HRUA 1FUYB 4R98A 3DAOA 4GUDA 1PX0A 5KKCA 2VDJA 2UV8A 1BVUA 4E4RA 3HQ4O 4EARA 3HC7A 5JO0A 3D8NA 1H8ED 4XGIA 4UAJA 4ISCA 4PLVA 3UWSA 2JLAA 2I6QA 2LI6A 1HORA 2FPRA 5TGZA 1ZN9A 1Q11A 4QGAA 1XRLA 4WLNA 1G6KA 4YGXB 4F3NA 4QBHA 2DECA 1GNQA 4H7IA 4XFKA 3H5AA 4I50A 4BTVA 2HJ9A 5G1OA 4ZMSA 1IN4A 3TSYA 3IPAA 1L1RA 3TQQA 2K6GA 1QRUA 4M3NA 1FPQA 5CT8A 2Q9UA 1A5TA 3SXPA 3WADA 3DYVA 4Y2GA 1RHJA 4QTYA 1YV9A 3NANA 3HN6A 4KPFC 4LVOA 2P11A 1ILEA 2NAPA 2QTCA 2DSTA 1VE5A 2WDPA 3ZWMA 5MHTA 4IRDA 4PLGA 3X44A 4ERXA 4RQBA 4G1BA 5B37A 1YBVA 2GESA 2AI1A 4FX5A 5JDCC 2LYAA 5IMBA 2PGOA 2CGEA 2G4VA 3E18A 3TR0A 1E9BA 1HJPA 3SQXA 5B2EA 3P9CA 5DM70 2GBPA 1DAKA 4DF4A 1P0CA 1OXXK 1RU3A 3NDIA 1ZD9A 2ZBDA 2AD5A 3CZQA 3KXKA 4LWZA 1SOAA 1CBUA 3Q7IA 1QB8A 4E7OA 1FMFA 1KO4A 2C07A 5IDWA 1Y5LA 4TRRA 3DTTA 1U90A 4AJIA 4PZEA 3MMXA 5C1DA 3A9VA 1E2NA 4TL7A 4CV2A 1JIHA 4F11A 1T2DA 4CYMA 1Y8QA 3E23A 5ER6A 4Y6QA 3TPCA 4WADA 3EVBA 1NOKA 1NJ2A 2I6FA 4G09A 1FFXB 1UBEA 5DSTA 3M6AA 3W5HA 4K1XA 3BQNB 3BUSA 2HHHB 5JFOA 5B7GA 2XYPA 3ZI7A 1N78A 1EHCA 3I0ZA 2PJDA 3IQWA 4GVXA 3L1JA 4QAQA 4OOEA 4A82A 5IHPA 3X1KA 1IYZA 3OHMA 4X0EA 1VTKA 1ANKA 1JKXA 4KAFA 1IM2A 1EYZA 2JLSA 2AKAB 2V6BA 5AUQA 5EHIA 5FTWA 1KMQA 4WJLA 4AIRA 3MT9A 2OOSA 5EUQB 3O4GA 4QLOA 4ETWA 2ZIVB 1RWOA 3PZPA 1OFUA 3AERB 1DQNA 1XNQB 3FIJA 3NM5A 4OL0A 3QPCA 5F77A 5JYBA 2ZW9A 3WI7A 4B3DA 1JXOA 1OTHA 5L7WA 5BXYA 2BFWA 1Y9DA 2AGQA 1KMHB 4IQGA 4S1PA 5J1TB 3GFRA 2ZDGA 4BBZA 3ZWNA 1AQIA 4AZ3B 1M2VB 4AG5A 3F5MA 1KBUA 3M81A 3K2QA 4RSHA 1A6SA 3D2SA 4CVNA 1TU4A 3UWKA 4FCWA 2WKPA 2QOEA 2P0YA 3PWZA 4QQ8A 4P0PB 2H85A 3HWWA 5DT2A 1FJXA 4EBBA 3BQ7A 4BUCA 5EJEA 4P3XA 4LHEA 1Z7EA 4XB1A 1D3AA 3MHPA 4WW0A 4BE7B 5J2TA 4MIKA 1QRAA 1GGNA 4PLFA 3C1AA 1T6BY 1Y88A 5ALDA 3WGJA 2WQ7A 2G28A 1M2KA 3VNAA 2BMAA 4YN3A 4DC9A 5K6AC 3AMVA 5J2GA 1XV5A 4ZXPA 1IK6A 1SCUB 3BWEA 4EJ0A 4ZCLA 2FSSA 1XRPA 5BR7A 4CIAA 3O4VA 3RJEA 2WSSA 1SXJC 2DCMA 3C5WP 3NGXA 2JR5A 1CQWA 2H1SA 2W90A 2H5XA 5KT4A 4KGVA 4F86A 3QITA 4HVTA 2IHMA 3C15C 4N39A 4P22A 2EFHB 1K1SA 1TLLA 3PHGA 2IE0A 1VKOA 4N8EA 1X1SA 2V3VA 1G16A 5JNUA 5JRDS 3L06A 1RPJA 3R76A 3U19A 3M89A 1XAHA 5AH0A 4DGSA 2W6OA 1ICEA 3ZEAA 3HKDB 1R4MA 4LF9B 3QELA 1ENOA 4ZI3A 3LG2A 2IHNA 2C57A 5IJAA 3KSUA 4OK5A 1QS0B 5F23A 3M0EA 3RRBA 1AQNA 1XLVA 1ZQNA 1N6IA 2WFZA 3NAZA 5KUTA 3H83A 3AFOA 4UQPA 5FTKA 3HXKA 5C3UA 4WN9A 3WLAA 3EFOB 4PO3X 3V80A 3HR7A 2ZI3A 4D4IA 5AP9A 4FUQA 4D4MA 7ICNA 1H38A 3U3MA 4UUBA 4EUSA 1G19A 5AKGA 3HYTA 4RQNA 3SYNA 3ND5A 4QU8A 2BR4A 2MA1A 3B3FA 4O2LA 2VH2A 2C3MA 4Y9SA 2PR2A 1U1FA 2B7BA 1ZDMA 4P3PA 2HA7A 3HDYA 4P7BA 4C0ZA 3RJMA 2I4TA 5DBOA 1SIOA 3HNPA 5DP1A 3O0DA 1GD1O 4QJ4A 4WOCA 4X6YA 3PNBA 4URXR 1V11B 2PA0A 3Q7QA 3LCMA 8ICCA 4U39A 5D51S 4OJOA 1VA4A 4IIJB 2VNIA 4YXJA 4R8UA 5DTRA 3SZ3A 1GRQA 1MPTA 2CNWD 1NRWA 4P54A 3FB4A 2RK4A 4KODA 1FMCA 3ORYA 4D4GA 3ED5A 2RONA 3IAM1 2RI1A 3DC2A 4RMJA 2YIMA 2QARB 1YRYE 1US8B 1LDMA 4WCVA 5F5LA 5JLAA 3GYGA 1A04A 3EAFA 5FWDA 4AMBA 1O95D 1XN1A 2R62A 3NTRA 3IR5A 2QQ5A 5AI0A 4MUKA 3S1SA 4HF7A 3PD1A 5AI6A 1E5LA 5TGTA 3N7TA 3BFVA 5TISU 1RIIA 2OQ2A 5KFYA 1TUIA 1UXJA 1PQUA 3SOPA 5ABPA 4D4LA 2P6PA 5AQEA 3LUHA 4E2WA 1PG5A 1CUXA 1EDDA 1Q1GA 4LY6A 2VPQA 3PSAA 1EFTA 3QVVA 2YJTD 4FS3A 1W5BA 3AM4A 5DMXA 4JLNA 1M2GA 4YRFA 1CQIB 5BOSB 4MAAA 3LZ6A 2QE7D 4EB8A 4Y6LA 3H11B 1PR2A 2P2LA 1G3IA 4F3KA 1YB5A 3F71A 3GYBA 3RJIA 1DKMA 3T4XA 4HYKA 1JIVA 3LPCA 3QWHA 3RUEA 2PD3A 4WXRA 3NAMA 3QA9A 1EEXB 3ZR4B 2ZXEA 1EFRD 1L5RA 3FPFA 4YCSA 1HEUA 5EIAA 2C59A 4LXHA 1KAEA 4PF1A 5JASA 2YUTA 2PUJA 3P2OA 5JCZA 1SZPA 4OAPA 4YIKA 5CXSA 2AFIB 2NRZA 1C3XA 3OQ6A 4QFDA 1V3VA 2BKAA 4R8SA 4NCAA 4B5KA 3W2HA 4MI1A 5ALIA 5GGXA 2OFOA 1G7SA 1YA4A 4DZZA 3WBBA 3KUCA 1C81A 1XA3A 2C4MA 5MGNA 5EWLB 1ZQXA 4HMQA 2KVCA 1JAHA 3LQ2A 3RIHA 1Z38A 3PD7A 5HUQA 2W8ZA 4L8VA 2BR3A 4CHGA 5IEBA 3VZQA 1M34A 4XUCA 5DYYA 3PEYA 3G6YA 1J33A 3ED1A 2JIRA 1D9FA 4B31A 5I7SA 2PH7A 2KMLA 4MFCA 4BO1A 2I6XA 1XZEA 4HS4A 9ICXA 1PK1B 4QUAA 4I1YA 2A1AA 3WLEA 3NIWA 3GLFB 3JSXA 5IJ0A 1NMQA 1PVQA 1ZOPA 4OGWA 3IKJA 4UE2A 4DYVA 4IGFA 1TYCA 4D92A 4BXOA 1YMUA 1QZXA 1XAIA 3CUEF 4DLTA 1QYXA 3JPRA 2RK3A 3TANA 3CVWA 2XQGA 3H17A 1AO3A 4RACA 3ZEIA 3OJ0A 1SHUX 2JLCA 3UXYA 3B1FA 4RPYA 2AJBA 3IM1A 3OFND 3NT5A 2I1LA 1NNEA 2PZGA 1VKHA 5KHOC 3HJUA 5EP2A 4B82A 4CMHA 3OFJA 3Q7TA 2JJMA 3D8UA 4ZGBA 4X1KB 3CRNA 1HNZB 4XWKA 3J81A 3QOYA 1E4YA 5G3YA 1CUGA 1GUYA 3QQ5A 4GPEA 5IS2A 3U56A 4HH0A 2J1LA 3PRYA 2HHXA 3U16A 4ED9A 2H3IA 2O2HA 4DUGA 2II6A 4AN1A 5CUQA 3RJ5A 2Z83A 1IXYA 3ZVRA 4NJMB 1YS9A 3FOWA 3PNYA 3ZU4A 1MKYA 2R8ZA 5G3ZA 3OJLA 4D2IA 2YXBA 2CXTA 3K8OE 2ZGVA 3E9NA 1P9LA 2MYNA 1CNMA 1H3FA 1T2FA 3P0IA 3A6EA 2JBAB 4ZCMA 3MGIA 1QCCA 1QO9A 3T7IA 4CZ2A 4O2BA 3N8GA 3RK0A 1JDJA 2YQZA 2L82A 5K8IA 2XIQA 1L4YA 3OURA 2G63A 3BWMA 5BV8A 4EI2A 2J6BA 3MCVA 2X0JA 1NI3A 4PC3A 3LQYA 1GNTA 1G20B 1ADFA 2HLHA 4K5QA 1JQJC 4QUJA 1O96B 3EGCA 2CZQA 2VK4A 1KN5A 5ALUA 2OVBA 1UDRA 3V7LA 1D07A 3EQZA 4M0FA 1QV6A 5J0QA 1KWGA 1T9GR 2QF7A 3OHSX 3PENA 1URJA 5KYWB 4AJOA 5LFAA 4EHIA 3LCRA 1JDZA 5JH7A 5KX5A 1YC5A 3LUBA 1ZGAA 4ACOA 2H16A 3DE7X 3DWIA 1Q0PA 3E3OA 3RR8A 4MV3A 3GO4A 4HH3C 4WZBE 3TI9A 1W581 4TSRA 5C81A 4M9QA 5ALWA 1VDVA 2D5CA 1YFKA 5GADl 2CD7A 1ZNZA 4B8YA 4YXWA 2PUEA 2A5JA 3PNLA 2AZXA 1HUZA 1KAQA 5K3OA 3CE6A 4QEKA 3PX4A 4RD3A 4NM1A 4MIYA 2QVZX 1IDOA 2MSNA 3AI3A 3DB2A 3LK6A 5L4LA 4PG5A 3KHLA 4N3AA 4GQAA 4MPDA 5DZSA 1PFUA 3QENA 2C7QA 1Y9EA 2FRDC 4DTIA 5DG8A 3GJ5A 4JEIA 3MAJA 1O6ZA 4DSZA 1NI4A 2DBRA 2A57A 4EUKA 5KWEA 2QAGA 5JNWA 2PFGA 3R5JA 4K9KA 1N1DA 1X92A 3EEIA 3OMXA 4I2JA 1Z6PA 5DM4A 2WRZA 2RIPA 4CNQA 3U7QA 2JV3A 3EC7A 1QH9A 5BXQC 3L4BC 5LLDA 5T4BA 4BO6A 2BC9A 3NBAA 3C1ZA 4ED0A 1KSJA 2F44A 3QUSA 4GPD1 1WAMA 1T6NA 1W4BA 3RYCA 5B66U 5ALFA 3K6SA 5KVVA 3TUZC 3DL2A 3FFWA 4B0PA 1MJFA 3ZIUA 1E4EA 1FP7A 1DKRA 1K3UB 2JAHA 4TWZA 2JGAA 3CMMA 2VP5A 4E7PA 1ZU4A 1NUPA 1G4AE 1WB6A 2IUYA 1C8KA 2CJXA 2UZ1B 1GPKA 4AYBC 3WGKA 2CFSA 5LWQA 3OZ7A 4Y1FA 3HB5X 1BPYA 2PYDA 3F49S 2ISSD 3ZY5A 4WDRA 4KMMA 1N6KA 4TL6A 4ENSA 1YA6A 5IVIA 3H1BA 4G3XA 5AICA 2Q5FA 5DM60 4W1PA 1ZM3A 4YPFA 1H4TA 1E1YA 5HHIA 1Q7EA 4WGGA 1E3SA 1AHHA 1CUSA 1HBJA 1XJ0A 4ZQEA 1RPNA 1MAUA 3OY7A 3Q3CA 4UFNA 5KFHA 4F60A 3I73A 4TQRA 3SYMA 2XOXA 2FE4A 2KD1A 3QBTA 1I9GA 5CHYA 2VJ5A 1U98A 2BPOA 3HBNA 3QK7A 1ZONA 1Y4SA 2G5PA 2XI9A 1PT5A 1K86A 3IUMA 5IUJC 3Q0EA 4D9BA 2OFFA 4KH0A 5J9FA 4AROA 5EE0A 3UCXA 3HKZC 1YR1A 3WSWA 2OHIA 2KG5A 3LYHA 1KHHA 1LX6A 1SO8A 1DBIA 3SJZA 3SJ7A 4L28A 5BUZA 2I33A 2K8AA 4IL5A 1DTSA 2R97A 3FCEA 4YD1A 1A72A 4CLRB 2VJAA 1PJRA 3PA8A 3O2QB 1MAWA 3GFVA 1IVNA 4DQLA 4ZKEA 5A4IS 2GKOA 1E9VA 4AJ2A 4HWSA 1NVGA 1SBZA 3AW9A 1FU4A 4MGHA 3GNTA 3O4RA 5EQFA 4LXTA 1MIOA 3TW6A 4M1TA 3URKA 2KK0A 3MD0A 3FPKA 5IIKA 2R8GA 1ZO8A 3QV2A 1DAOA 4XWAA 2NTEA 1AKYA 4PPYA 1HTWA 1K06A 5BN5A 2J9FA 2Z1NA 1CS0B 7YASA 2QS9A 1HETA 1RHMA 4KFSA 4G1EB 1KAOA 4QYSA 4AJ9A 1F3LA 3NVKI 1UFVA 1T0UA 3VTKA 3ZQ6A 1YCGA 4I9HA 2YVKA 4X1YA 3M1AA 4UQGA 3KYJB 2PUBA 4D6XA 2XT6A 2IXFA 3O8CA 3G89A 2FW7A 3T1HB 2FZEA 1TLFA 2UVVA 1WP9A 4ASUD 3H97A 5GIPE 2Y0SF 1N56A 3FIUA 2OV2A 3N7UA 1A9QA 2V4RA 1QCZA 3ZXUB 1V1JA 2WUWE 3UUFA 4J9SA 3AL2A 2GPWA 1H3NA 1EMDA 2KSQA 2EHJA 5CH8A 1VI5A 5CG2A 1OU4A 2X8LA 5F7ZA 3EARA 3KXPA 4MWOA 1K5PA 4ZZIA 3AR7A 2JH7A 4P7FA 4JBNA 3IUPA 1IQRA 3T3DA 2ZBQA 1QDUA 2CFCA 3ENWA 4TLMB 1LPAB 4TKUB 2IYTA 2CL7X 3E84A 2H5IA 4C76A 4Q9DA 3RC1A 4L7QA 2QP9X 4ARZA 1X40A 1NXVA 4I66A 4MHOA 1DEHA 1UBMS 4ZRNA 3OQ1A 5LBIA 4HADA 4B75A 5EEGA 3DPIA 1JMKC 2H3EA 1DMSA 1O0CA 3CW2A 4NEGA 3P4YA 4K0RA 3AIIA 3IUJA 4QYXA 1NBIA 1XK7A 1EFPB 3C6QA 3MS2A 3I01A 1N4DA 4EPYA 2WM8A 4QQRA 1PG0A 2GF2A 2B37A 2F2TA 3QVGB 1YD7A 1ZUNB 2EDAA 3MGGA 3UMJA 1YDMA 4U0JA 2DFTA 3LX5A 1WXEA 4YG2A 3OT1A 4EYEA 3GLGB 3K9NA 2JLRA 1JT9A 5B6JA 1YRLA 2J3IA 4NLBA 1HKUA 4YAKA 2HA5A 2XUKA 1Q6ZA 2XBMA 2PWBA 1IQ0A 5IILA 4R2IA 4DM4A 2XQFA 3TFSA 1SCJA 1MC4A 1SZJG 3K9BA 2O8EA 3CXRA 1ZW1A 1JU4A 4HEA1 2V96A 4BNJA 5IRCD 3FCUB 1RP1A 4NM2A 3AQEA 3L1IA 2MR5A 3I8SA 2PS0A 2QZZA 3CLRC 4OMUA 4UNIA 4CRXA 4O3RA 4JY7A 3KALA 5L53A 2BD0A 3IMKA 2VSQA 3ILSA 4NARA 1AE1A 2PRKA 3WJ7A 1PW5A 4WZAB 1QHGA 4PAOA 2H2HA 2B2NA 1XS9D 2FPPB 1QUEA 1L5GB 3MEQA 5KJFA 2ZIXB 2AEJA 1BPEA 3OEEA 4BV3A 3CJQA 4RY9A 4RTNA 4DXAA 3A1SA 4O9MA 2R96A 1QIDA 1XPJA 5K0EA 1DV2A 5IAAA 5HDBB 5TQVA 5E1DA 4ZO9A 1RBZA 5JPIA 4LHXA 2KZZA 4E13A 4B3FX 5AOVA 4XJXA 4JT2A 1UCVA 4XEHA 2HHTA 1E9SA 1DRUA 3D4LA 1G9TA 3COYA 1G9XA 5TX7A 3FRHA 4XCXA 1PK7A 2KMDA 2ID7A 2WAQF 2B4QA 4BJ3A 1KKUA 3CR8A 6GPBA 1YBAA 4BO3A 5F9FA 1SWWA 3FDZA 2GN9A 3NHLA 1KYQA 1A97A 3FJYA 3ZU5A 4S1WA 2NTJA 1C30A 1ITZA 3LRTA 3HT3A 2Y1GA 1M1NA 4ZDJA 2DPGA 5DLYA 5FJJA 2X2OA 2C4NA 4D6PA 4E5KA 2HUPA 2C97A 4KK4A 5LNK6 2HA2A 1F8GA 3ZI4A 3H42B 2ASEA 2YVAA 4JZKA 1QAOA 1B26A 1FBTA 1UBRS 1MQ8B 5DDMA 5JS1A 4J3NA 4IEEA 1L7AA 4YUXA 4DSOA 5KOJB 4FLEA 4RZUA 1TUBA 5ALMA 1Z6TA 5BWMA 3GQBB 4NFLA 1KQGA 1V7CA 4ARIA 3NBQA 1EK0A 1GARA 5I9TA 4JS0A 3A0HU 3I8XA 1VJGA 4ZCPA 2A0XA 4A6EA 2OGZA 3BGVA 4KPUB 3H4TA 4RA6B 1IBLB 5L4NA 1EG2A 5JCPA 2CLKB 5JFGA 5LJIA 2PL9A 1BIFA 2BEUB 3PNQA 2XYQA 1BKSB 1NONA 3BZBA 3GZNA 4PSAA 1E3WB 1AJEA 3WIUA 2B98A 5D3MB 1ZNXA 1NW7A 4K8OA 3CKYA 2RG7A 3HLKA 2P9CA 2RDIA 2O1WA 5CCXA 5H3HA 3SC6A 1KYIA 3D3JA 5HIAA 1W52X 1SEVA 5DGDA 5KSWB 3WKBA 1RBQA 4R1PA 2HR1A 1NYRA 2CEKA 3B78A 4PBSA 4L27A 8ICSA 4UAWA 3V7NA 4PIMA 4GMHA 2WTFA 4R8MA 2WG2A 5CFZA 1SXDA 3BMOA 4NCJA 2ZEJA 3UXNA 4DLGA 2HYDA 3QFSA 2BCRA 3ETHA 4Y6GB 2QXYA 4MWCA 2P66A 5JAZA 3HO6A 1XZBA 2J6UA 7ICJA 3HDTA 4OHWA 1YF3A 3VYVA 2EZTA 2CCKA 1YZFA 1WULS 4U8GA 4JJ6A 3WLIA 1NY6A 4TSFA 1G2PA 4BL5A 3ZOZA 3QFTA 3KAPA 5BPFA 5IMSA 3UOGA 2C96A 4C5CA 2C1EA 7AT1A 3MWKA 3BGSA 5PNTA 3TZ6A 2LBPA 2OB1A 2QGNA 2HMVA 2M6RA 4N1AA 1F6DA 5HKBA 4PFKA 4BEBA 2D5LA 4I4LA 1JIIA 4RY8A 5HCNA 4UTNA 2SECE 3ZNPA 2HL6A 4DCTA 3CEHA 1Q7RA 3IAEA 2SCUB 3VPHA 4ON9A 1CRLA 4W1SA 3ZQUA 3K0CC 1RAFA 3G5TA 3W5BA 4NU0A 1MIHA 2AF3C 4ZT7A 1D0VA 2Z09A 4YROA 5HNKA 4F6RB 1NWCA 4FR0A 2OXFA 4TTSA 4ECXA 3SAJA 1EK5A 3VR4D 3K94A 4KVGA 5U9CA 1SUCA 2BZ0A 1CLEA 4IOMA 3OO0A 4N65A 3WIEA 3WU2U 2ATIA 2O8VA 4AUMA 3SXUA 2GWSA 5AI4A 1XP8A 1L7NA 2HTEA 4M21A 4HN9A 1U8AA 4R51A 1L9KA 4LY3A 4BMSA 1ZZEA 1ZUWA 3ILHA 3V48A 1VCHA 3QX9A 4BYGA 4ZN6A 4J29A 1WUJS 2WY2D 4QFMA 3CGGA 3EIQA 3GJ0A 5K0CA 1OXSC 2NXJA 2Y3IA 3HCDA 2XT0A 4FWBA 1KGDA 2VYCA 1ISRA 1N2BA 1NHGA 3U7GA 3AR4A 4AO8A 3HH8A 5IVHA 2FDXA 3AH8A 4OBEA 2IYLD 2DY1A 5CH3A 3N2EA 2IS1A 1W36B 4ZOAA 2L5YA 3O38A 2OCEA 1J2TA 1C9KA 2Z5FA 1Z4JA 4O25A 1WF6A 2OUKA 1ADCA 2DWUA 5IAKA 2D3WA 3KZCA 4FLMA 4GIBA 3UTDA 2OQVA 5K99A 1K2WA 5FUBA 2NSJA 2J5BA 2RDJA 1J70A 8ICHA 4OQPA 3HI4A 4PRYA 1R8SA 1V8FA 1UBUS 4Q1FA 1DIAA 4WD3A 5KSPA 3JQ7B 4BNDB 5ALEA 4Z4EA 3ZD6A 3ZHVA 3CFYA 4OX9B 3TOCA 3TZCA 5DGBA 5IARA 3K5HA 1T8EA 2A4MA 1GGEA 3VNRA 4TVSA 4UUMA 4BVJA 1WQ3A 3ESBA 5L3RA 5KWJA 4B17A 4BCDA 1H1TA 1RKBA 1TCAA 5IJZA 3R7WB 1FTNA 2EZ9A 1Y6GA 3QHQA 4XAQA 2SKCA 2PJUA 1R0WA 4GOOD 4JKIA 4KR2A 1DUVG 4KX5A 1PVVA 4J7CA 1GFSA 3AVUA 3BGOS 2DPIA 3B8EA 1QHHA 5FTLA 1LK7A 4AMZA 2O7QA 5CAEB 2E8OA 4Z2AA 1YI1A 5A6VA 2C7GA 2CBZA 4YRQA 3QVXA 4EW3A 4RE5A 2XQIA 5H9WA 4V0QA 3QVLA 2FOLA 4RE6A 1PF7E 3KJFA 3TTXA 2R66A 2H3HA 3RS2A 1W4CA 2UVPA 3R41A 4BN0A 3FNBA 1EQAA 1RZ3A 4LF5B 1PG2A 2C2RA 1KS9A 4YXFA 3VVBA 1GA6A 5DBGA 1P2VA 3ORSA 7GPBA 4TMKA 1SUAA 2BRUA 2YC4C 2A5GA 1HT3A 3DQQA 1LDNA 4OQQA 4E1VA 2Q2VA 2Q4DA 1E92A 1UT8A 1CE8A 4JYCA 1SD2A 3DH0A 3RAJA 2PT9A 3HYCA 1TKDA 3IXMA 4DLZA 4F4UA 3NWBA 1Y37A 3RHTA 1L5SA 4BX8A 4I1PA 1HE2A 4BNLA 4EW2A 3HWTA 3QMMA 3REOA 1V16A 2B1GA 2CUZA 3C43A 3VAYA 4EHBA 4XPIB 4JELA 3UFXB 1EVEA 1C3OB 1N5RA 1KIFA 5DQIA 3F97A 2V7QA 4F3RA 2UXBB 5IJ9A 4DQDA 2ASDA 1QC5A 1MN6A 4NMXB 1G21E 4MDYA 4MQUA 2GK3A 1M76A 3K1TA 3TQIA 4DO9A 4PHHA 1E2LA 1XZLA 3C6KA 5F35A 4C05A 2B61A 3DOCA 3KB6A 3PHJA 2Q4BA 3K96A 5AT1A 4RT3A 1PNQA 2FUG1 2A7QA 3WYNA 1Z35A 4LJ4A 4UCWA 1NRJB 4UASA 1RAAA 2HDWA 1VHDA 1GT91 4F4XA 4EA9A 1GVNB 3W4JA 1TVEA 2QP4A 4FC6A 5BSHA 5J43A 1XMOB 3STTA 3D81A 1KFSA 3U3RA 3LKBA 1AV7A 1G5RA 3OETA 1RRVA 16PKA 3DUWA 4JJFA 5IT4A 2Y1IA 3RK4A 2PO5A 6NULA 3NQ41 3GRFA 3VTAA 3T79A 3BL8A 5JQGB 4JJAA 5TT1A 2ST1A 3OLYA 1ILWA 4M9XA 3OBBA 4H35A 1WQ1R 1CIJA 3EMBA 3H7AA 4B34A 2WDZA 3J80A 1UP6A 4G5QA 3ZNNA 5IUKC 4MI6A 1V5WA 2FWMX 1V48A 4I2IA 3PC7A 5KNCD 1ML4A 5AWFC 1X2IA 4XGKA 4M4SA 1Q50A 5D46A 2VDLB 2R7NA 1V26A 4O5KA 4WUVA 1CHNA 1YH3A 2HZ7A 4NH4A 2KIWA 2JJQA 1L5HA 2NUPB 4M1OA 1M66A 4BVGA 1PEAA 4YQYA 4L9SA 2X7HA 2FF7A 2V1UA 2JKZA 3ROPA 4B6RA 4AMUA 1Y5RA 4RU9A 3KLBA 2NAFA 3ILVA 1M8JA 2QQFA 3U7JA 4V2IA 3T0IA 4TMVA 5GV8A 3MOIA 5C4GB 1GIAA 4QOIA 2VYVA 4YNBA 4N8DA 5KYUA 4B1FA 3TFRA 2C54A 3KFLA 2E89A 4GZ6A 1K66A 1HT2E 2K2WA 3DHYA 1R0CA 4EYKA 3BS5B 4Z6EA 3L46A 3U4HA 4WRRA 1OLSA 4EG4A 3M5WA 5KFNA 5LP6B 2WP8J 3AHGA 1YHYA 3AVOA 2E0IA 3L82B 3DE1X 3LY9A 3IT3A 2R8PA 4JNKA 1KVTA 1JNYA 1U9IA 3EX7C 4U7HA 5IT0A 4HJXA 2ZSUA 3VR6D 3QKSB 1LPNA 4RABA 2JK1A 3UWPA 3O74A 5EFOA 1P8AA 4YMGA 3HVRA 2X76A 1P8JA 3A4VA 3BQ1A 3EDRA 3PCRB 3RF7A 1TB4A 2XAUA 5THXA 2RCYA 1P0QA 3ETDA 5JISA 2Z2YA 1U2DA 4C9BA 1U8EA 4M8SA 1NQ5A 3OH8A 1AF7A 3HJBA 3NB0A 1MO3A 4G4SP 3I9NA 2R1VA 3WC4A 2QXTA 2MYTA 9ICFA 2BEJA 4KKVA 3GBPA 2OLJA 5JI3E 3JRNA 2CFRA 3QX3A 2XZDA 3FWZA 2MYUA 4RV4A 4CGZA 3S29A 2B25A 1UDAA 4R83A 3ZWWA 2ZSFA 2V9WA 3ELUA 2ZUVA 1RM6C 4DSEA 3OZTA 4Q7JB 1WCIB 3AILA 4R9VA 1KFCB 1I2AA 2RGWA 5D49A 5TQJA 1EZ1A 5FAXA 1Q1QA 2EFJA 5ALSA 2NP6A 1T13A 2WU3A 3KWLA 2HWWA 2HK9A 4K6HA 1ZK4A 3M1LA 2XMRA 4BOYA 4E2ZA 5JARA 3F47A 3ICQB 4QIWF 1OYOA 2Q45A 5LIRA 2A19A 3AETA 3W3ZB 2A3VA 4WESB 2ZJZA 1D2EA 2XJ4A 4CI0B 4K87A 2AZMA 3E61A 2ATXA 3K5WA 3Q0IA 4OJQA 1KIAA 3DPSA 3GK3A 3AKCA 1R5JA 1XF9A 3FHLA 4FE7A 5COAA 3UJNA 1X80A 1GCOA 4IQ0A 4ZIRA 3HUFA 2J5QA 3TR6A 3IHTA 4XFDA 5EKSA 1VHWA 4URWR 4EF6A 1N8TA 2ZYIA 1ZCZA 1JYSA 4M7WA 2QTZA 2XDYA 2CZGA 1J99A 1JN0A 5T14A 1GKUB 2EL7A 5J0PA 3UJDA 5IKXA 5CR0A 3MWYW 1PT9A 4PO9A 5ISMA 4LE0A 4R31A 2UZIR 2CNKA 1RT9A 2G9ZA 3DVSX 1N2CA 2AQHA 3PX6A 1IRIA 3MFQA 5KFBA 1L5FA 5KG4A 4JZYA 4ALIA 2HNBA 4KQFA 3ILYA 1X1QA 4JYAB 3DBLB 3EVCA 1CS4C 1ZJ6A 1IFXA 5DXJA 3SDZA 4CMGA 4REOA 1T5LA 1N9KA 3IUNA 3W9YA 1JSXA 4O2AB 2FJPA 1B4FA 3GJYA 2X9VA 1T1JA 4UBKA 2KM1A 4UHFA 4JJ7A 3OKCA 2FSPA 3BTUA 1CJUC 2H1IA 2OGTA 1ABBA 3ZG6A 4I6EA 4BGVA 1HE4A 1Q77A 2FZGA 3L0IB 2H5JA 3K4PA 4PVCA 5I7UA 4E07A 4LZGA 2Z1MA 1GTG1 2EBWA 2HH9A 4QM6A 1U5BB 3CR3C 5CEHA 3RRFA 5A0LA 1FLDA 1T10A 4XARA 3QGMA 3PGMA 1FO4A 5G4KA 2QY9A 1BWQA 1U8XX 1C1XA 3FTQA 1X9XA 4RJKA 3ANMA 3GPCA 2OE2A 4IHJF 1L4EA 3MT7A 3IT0A 3IT2A 4B09A 1M2JA 3U48A 2LP4Y 2J7KA 1I32A 3Q2IA 3NUZA 1ZH0A 1R37A 4KE7A 3FDFA 2HHJA 2R5FA 2VSXA 2PBFA 1ZM9A 3CMCO 1K5HA 1GR0A 2XI4A 5A6SB 10MHA 1T5DX 1Z28A 2F6RA 4NICA 4P4MA 3K1JA 3MJSA 3EDOA 1AKVA 5FR1A 2FUCA 3LGSA 3ETNA 4EKGA 5LKRA 4YR2A 3JWPA 2WJHA 1NASA 4PG4A 1WRBA 3ICCA 2JAOA 5C31A 4MVJM 3SEFA 2HF2A 4LJSA 3PFGA 5GQSA 3Q3VA 3N2KB 1BEZA 3R74A 4W5QA 3TKYA 2OMEA 2QLJA 1ADGA 3OMLA 3C0KA 3FZGA 1BJRE 3NC4A 2WBLC 1OR8A 2QI9C 2F3UA 1NJWA 4HDAA 2WABA 2FWBA 4W5TA 4PCVA 4LYFA 1NBME 1CUJA 4HVAA 4FFWA 1L4LA 2E49A 4F6LA 1O77A 5BPCA 3DBOB 4TSKA 2BHSA 2YW2A 4RC9A 3GUVA 2VCEA 3OSNA 4ML3A 5KQMA 4L3WA 2CCGA 3CWCA 1WB4A 2VBGA 1G18A 3T5BA 2IWRA 5BSEA 3LPDA 2CUTA 3BF8A 3N2GA 3I2FA 2WIKA 2OFXA 4ZC1A 4BZQA 1NN0A 4TTTS 3KE9A 3RYIA 3QE3A 3G02A 3HM9A 2IHZA 4IR9A 3AXSA 1U8ZA 1IZZA 1CLUA 2K60A 4PYLA 3RFFA 4GDFA 1DTWA 1OFHA 4U2CA 4KQHA 4IGKA 1PK8A 3A28A 2ZTSA 4ND5A 3D1LA 2GAAA 2WMNB 1J1IA 5K0NA 1ULBA 3LOUA 3SKXA 1VDMA 3ECSA 3QPDA 1SY7A 3A6FA 4NPCA 5JD5A 4F4DA 1VYUA 4R9RA 3OP4A 4QODA 3M1YA 5BYBA 3LA6A 1UPBA 2GTPA 2XGMA 4NEQA 3JWJA 3EUB2 3R5SA 2BR5A 1DHRA 4ZARA 5T41A 3E2PA 4PR3A 3P2IA 2YS7A 3TZBA 5BURA 3QTBA 1OHHA 4JP3A 2FI1A 3OPYA 4PNHA 2IYVA 1JEQB 2ZSEA 1E32A 1KJ9A 4YP9A 3C5EA 3IEPA 4CM9A 1XCJA 2FPUA 4HZIA 4UVGA 2P6OA 2CVOA 2OGWA 1JG7A 2F8KA 2H8GA 4LMAA 1YONA 4JUFA 1ETHA 2WD8A 5KFPA 4V1CA 4CN9A 2C9CA 5DO9A 3GG9A 2G40A 4AY4A 3QW4B 3BD8A 1A4IA 4BEVA 4DQIA 4JLDA 1DT5A 1BE0A 2XD9A 1A9YA 1P1HA 5IEJA 4CV3A 1S3GA 1D2HA 2Q6OA 4JI6B 1MVOA 4KWEA 1NL3A 5TF4A 1H9CA 2AN4A 2GFIA 3C14C 4P33A 3LO8A 5B2ZA 2P7HA 2CLDX 2GO7A 4I8DA 4RXUA 3NS1A 3LF1A 1JTFA 3PFFA 4UTRA 1B6SA 1YHZA 4FFOA 1M7BA 5AKXA 4YMUA 1XQ1A 3OCXA 4BO4A 1JJVA 1X7WA 1AHNA 4EMTA 3LO5A 1X7XA 3JYNA 4Y6RA 2HF7A 1UMDB 2CN1A 1GL3A 1KDRA 3EVDA 3G2LA 3S55A 4MQ6A 4LDRA 2PZBA 5EI5A 1K5GA 1UK6A 1FXWF 5HOQA 3A2KA 3OUUA 3DLTA 1D0SA 3MRTA 2VSYA 4H60A 2V03A 4DDTA 4XSGA 1YJAA 3AESB 3K9WA 1XZPA 4X91A 4R2KA 4ZOLB 5CFRA 4IDEA 3NR2A 4IYRA 5KYGA 4Z4GA 2IITA 4DPKA 1Z4KA 4IY1A 2IL1A 3CYFA 3UCFA 1B1AA 4ELVA 5BMVA 2HXGA 2O5CA 4X62B 4FYJA 1H05A 1QPBA 2LD4A 1PHPA 5C1BA 3V00A 2NUAB 2UVWA 3DKIA 4KUEA 3QPVA 2XVXA 1BU8A 1CK4A 1SHZA 3E9DA 1UT6A 2OKCA 3ZVLA 3F6CA 4J0KA 4YVZA 4ZO7A 5DB6A 2QJWA 3MIZA 1K5DA 1J23A 1HE5A 5DK4A 2HWUA 3FETA 3PJEA 1NV8A 1R6VA 1M2OB 1BPDA 1N2JA 3PI6A 3DZHA 5F1YA 2QAGC 1L8QA 2BGLA 4MKGA 2GVZC 4E2FA 5KNDA 3L7IA 4MV1A 2PUGA 2IHJA 2IPLA 3MAAC 1HDRA 1I7DA 1T3LA 3DEYX 3IBCA 4WERA 4A16A 3VU8A 3OAAA 3MGBA 3HCCA 2ARKA 4ZHQA 1AKRA 5BYKA 1VBMA 2JBWA 3ZDBA 1S9FA 1T6XA 2V6IA 3T9FA 2P9ZA 3DKRA 3FG9A 1KGSA 4GI1A 1PR4A 4HDMB 2XJ9A 1ZQIA 4AIIA 4EI8A 4JI3B 5DK6A 5DISB 1PWZA 3JZFA 4AS3A 3MFYA 3R7DA 3W7AA 4H3SA 2IF0A 3A6LA 4XWTA 4MDFA 2ZWIA 4F45A 4KW7A 4GRAA 4OXYA 1I0IA 3H9CA 3E5MA 4RK7A 3D3EA 3ER8A 1T94A 4I3HA 2E1RA 3GELA 4EITA 3CSSA 1G8GA 2ZTMA 4ELUA 3ID6C 2CXUA 1CUCA 2WJ6A 4PLHA 3LUAA 4CM8A 4O4JF 1D2GA 3KUUA 3S3TA 4HDKA 4ZVNA 2YQ4A 3UA3A 1JFFB 5JVDB 1FFDA 4QXOA 4BKUA 1KY4A 3H6GA 4AFNA 5F4ZA 3FD8A 5LMUB 3IRUA 1Z2EA 1ORRA 4LOAA 1ZJJA 3BGIA 3IKLA 3TWOA 3MFIA 3OZSA 4Z9XA 4ZO6A 1DB3A 1ODIA 1JI3A 1X7YB 4HBGA 3VXKA 4UAVA 2GK7A 2M0NA 1VG8A 2G1PA 3VDMA 5FI0B 1NW8A 2NTNA 5DBBA 2V6JA 2CE7A 4FINA 4PFSA 2MUTB 3F6RA 1FUKA 4N82A 2JIPA 3GUYA 3BXEA 4M99A 1CJTC 1L4UA 2P6MA 1C9YA 3TS1A 1N0IA 3VR1A 1I3MA 1FEZA 4LZLA 5DXFA 1GAXA 3AEQB 3OFKA 2EZZA 4LV5B 3IVAA 5CBKA 4M0PA 5EZ5A 1GFIA 1DIBA 5DH9A 3R7NA 1KEEB 3H0LB 1DBSA 1XC9A 4G86A 2Q5LA 2HBJA 2XMPA 5E95A 5LUAA 4MYRA 1CDOA 2PWZA 3VC7A 1RZUA 3GNSA 1F14A 3QIVA 1XP5A 2PUVA 1JHUA 1RM0A 4JQOA 1F1BA 2JIZD 4C6TA 4CQLA 1UQVA 1J0DA 5BN1A 2JFZA 3HN2A 3WAGA 3QEMA 1AHPA 3R5TA 4YJFA 2NVWA 1DXYA 4ISBA 5JROA 1XELA 3AF1A 4WFKA 2R6JA 4UEOA 3W5DA 5IC6A 2XB4A 5IUNC 4K9MA 4X61A 2VT3A 3IAHA 3SQLA 4YAEA 3GXBA 2BGUA 3V7YA 1PNVA 1J9EA 3ZCUA 2R3SA 3PDCA 3P19A 4UOEA 1NQOA 5ES3A 2B69A 5HSGA 1IM5A 2YQEA 4PRKA 5SZHB 4AXBA 1PJBA 4KLHA 4RH1A 1UT5A 3TGWA 3NRCA 4KFTA 4EG1A 1X9MA 1RJFA 4MW1A 3IDQA 4WVFA 1W4RA 1SKYE 2WV9A 4DQKA 1JHYA 3TUIC 3VVLA 2WA1A 4YCNA 5KT7A 1SC9A 4FGJA 4UJ5A 5C8XA 3Q5EA 3DMRA 2P2CA 1KE2A 1L5ZA 3AUKA 3DXFA 3U5ZB 1G7CA 4A8PA 3LW8A 2BCUA 1ODTC 1FVHA 2VT2A 4UU1A 4HLNA 4TS1A 1C7FA 5CURA 1JHOA 2WFMA 3CW2C 2GZ2A 5DI3B 1PQPA 4G36A 3LWDA 2QJFA 2B5OA 3ZXSA 3HU3A 3BH0A 2NLOA 4M9SA 5GV7A 2IOQA 2V65A 1W2HA 4V02A 4B6FA 4RULA 1P1JA 4LCBA 3AHCA 1SVKA 2ZM6B 1CV2A 2HNKA 1V95A 1SVLA 5T8KA 1OAOA 4UTPA 5EMNA 1XZQA 2HHAA 4QGBA 1VE9A 4U7DA 3GDXA 3GIWA 3EAQA 3I61A 4AZ0A 1LA2A 1YDFA 1ZN2A 3E81A 2CL6X 1PWYE 3BD9A 3ZCTA 3M6WA 4DEZA 1DTEA 4QICA 4EG0A 4OU5A 3WVNA 4YX9A 4PSKA 3BMCB 5KFAA 4K9NA 4C14A 4C7VA 3MTBA 2C9ZA 3R0JA 2JH3A 3L4SO 3FHCB 1D09A 2IDZA 3LY8A 4LGMA 3UXHA 4XR4A 2XLCA 4GD3Q 3DT6A 2QRPA 2JMGA 3I28A 3BSWA 1UUFA 2CHEA 1A2BA 2IH5A 3O4JA 5FNVA 3D7LA 3MTJA 4YWJA 4BO5A 1T8SA 2VJQA 1B0UA 1TK5A 4NJEA 1WZIA 2WB1C 5J2HA 5EJ9A 2WB2A 4KXUA 1WSWA 1KRHA 4QO7A 3BM5A 1F2TA 4DR6B 3IDFA 2P9QA 4B4OA 1QGUA 3GJTA 3E0XA 3FSEA 4E94A 4TROA 4GKKB 2REXB 2BM1A 3BD6A 4G81A 4QWBA 5GMOA 4OJPA 4RHCA 3QE9Y 4KP7A 5DYNA 3BXHA 1WZEA 4W8GA 4WACA 1VJ5A 3T5KA 1YVPA 1FP4B 3DV0B 3G3EA 2YY5A 3PVXA 3GH3A 4E5UA 3I4LA 4DC0A 1E1CB 3AJ9A 4HLDA 4XUDA 2JARA 4ED6A 4KLFA 4DL6A 3VMFA 1R1DA 2PCLA 4M0CA 4BFXA 1IBCA 3MTQA 5BVHB 1EU1A 5T67A 3NJ8A 2V54A 5CDUA 4M9RA 2PKRA 3BXPA 3MTGA 2Y4NA 4BBPA 2PMDA 4Q24A 1C7QA 2ID4A 2ZQZA 4ZDIA 1V41E 4JL6A 4LF6B 1T3QA 4ODIA 4CETA 4OEHA 2AEEA 3STUA 2PUWA 3LDUA 1FFAA 8ICNA 4Z7NB 2Q1WA 3ZWDA 2BZFA 1S2DA 2C92A 5LL6P 3R4CA 1X42A 2P6NA 2CNOA 3RT7A 3SSNA 3E03A 3NTVA 1Y4UA 1K6IA 2YIVX 7ICGA 2W9BB 2H1CA 2NU8A 4XUSA 1MJNA 2O2DA 3KAJA 1FDOA 4BX0A 1HDGO 1MJHA 2AE2A 4M53A 4J6EA 3AP1A 5JNTA 1XCLA 3TRKA 5IKOA 3LBHA 5EKDA 1V1RB 3D4NA 3HSKA 3JD2A 1A9RA 4BNUA 1UCFA 3PFNA 4I2VA 3ZU3A 1Y1PA 4Z4CA 5JXJA 2QX6A 3MMZA 1S96A 1QRTA 4G26A 4BVFA 2W2KB 4PAGA 1X1EA 3F1LA 2ZT5A 2WOOA 2JHGA 1EE9A 4YV7A 1SPBS 1AGYA 4LRXA 3AZQA 4I9FA 2QMQA 2NPFA 2AYXA 3LQKA 1P9RA 2I76A 3LC7O 1SXHA 4XYBA 2W93A 2H9IA 3WYBA 2ONYA 1MN8A 1Q20A 1P0PA 3EGDA 3T95A 3KBBA 4YP3A 4XQEA 4H1TA 1PJZA 3GOHA 1JHZA 2JAXA 4LQLA 4R6XA 4M1ZA 2QRHA 1R12A 1NXOA 4DL5A 4XQGA 4XYGA 3BK2A 1XTIA 4AM8A 3JPYA 5A0VA 2FWAA 2KVSA 1QF6A 4WLFA 3U3ZA 2EKPA 3PW5A 2MTBA 1JHDA 1XZHA 2XNCA 3CF6R 1Z37A 2O14A 3RUHA 3TTYA 4UARA 2H2IA 5C7IO 3ZGOA 3OGUA 5TIIA 2C9BA 2NW6A 2QLTA 4IPTA 1L7OA 1GZVA 2CXRA 2GOLA 2HVIA 2GCOB 3HGTA 4BWJA 4OB7A 1ZIPA 4IUDS 2VYQA 4Y98A 4I3GA 4CLDA 5JRZA 3TL6A 2HWXA 3JWIA 5B30A 3H9UA 3WO0A 3AINA 1EXMA 5FJIA 3PHBE 3N0TA 1G42A 4ACAA 4CBVA 2WUEA 3EF1A 4BUGA 3R7BA 3M9OB 1WJGA 1AC5A 3PDUA 2BGNA 3VISA 1OBHA 4L9WA 4QUHA 3KSBC 4JKOA 2OHOA 3QPBA 3QWBA 4PEVA 5TR9A 3TM4A 3L8HA 2YUIA 4EUEA 3EAGA 2Z2XA 1QWOA 2IBSA 2QSZA 4MPJA 2GZAA 3WOVA 3PQ7A 1H0SA 3AHFA 2AMVA 3RTDA 4FDMA 1V8ZA 3GLVA 1ZSNA 4X7PA 5DHQA 3NBUA 4KWIA 1QGOA 2OQIA 4U7WA 1AGNA 2I1WA 1ZFNA 2UVQA 4QLBA 4U00A 4H3HB 5EHZA 4IV5A 3B1YA 4NDZA 4FFDA 2R87A 3LHKA 5EZ6B 4NFHA 2WWHA 5MFZA 3B1XA 4NTZA 2QB0B 2EFYA 2Q5OA 2I3AA 1IMJA 4ROSA 1DX9A 2CF6A 4LYDA 2B0JA 3DFKA 4WL0A 5KFVA 5J4HA 4D1YA 3IG8A 1MZPA 2VA8A 2I6TA 3OD1A 3OPVA 1IIPA 2W37A 3BAZA 3CVJA 4ZI7F 2QSUA 3QJYA 3R3JA 2G1KA 4NDAA 2A1JB 2X5OA 2IYFA 4ZMBA 2ZIFA 4J1QA 3W3AH 3EPKA 2K4EA 5ICEA 1NV9A 3FPEA 4PGYA 4FGZA 2ZRDA 4E1BA 4REQA 1FNNA 4GDMA 1SIUA 4II7A 1W46A 3LCCA 2DKXA 1K1QA 3MD9A 5L8VA 3PV0A 2XCLA 4LC0A 3LWNA 4CM5A 1NAHA 2OPHA 3T15A 3AG5A 1D03A 3J81j 2PZ8A 3IP5A 4Y2UA 4JT9A 2HREA 3B3GA 4XW2A 1ZIOA 5L95A 1CY2A 5DCYA 5JXGA 3BT7A 3EUEA 5E9WA 1KJJA 4W8HA 5TQ2B 2PH1A 1Q0ZA 4Z7QB 3E7XA 1LVHA 1ZHOA 2YY7A 4RQ1A 2X22A 3ADOA 4BLVA 1GFWA 1BE1A 1EB9A 1JBEA 1G5TA 4GXIA 2RE8A 1VLZA 4X92A 4C04A 2BFFA 3ET4A 4QL3A 3QUQA 4KXNA 4MR7B 1RJDA 4LYGA 2C04A 2AUTA 4UD6A 2I8CA 1JG2A 1PZEA 2Q2WA 3P94A 1NOIA 4F3YA 5D7NA 5SYMA 3DP9A 4MW4A 2H3FA 2W6JA 4GC6A 3CB4A 4JLUA 4F6CA 1LNSA 1O7JA 5FOTA 4LZAA 1Q22A 3KZVA 1BU5A 4KJZA 3MWDB 2IQIA 4QZFA 2OSBA 4FCVA 3R2JA 3BJYA 5BYAA 4QGHA 4XVCA 3WG9A 1JFRA 2VSFA 3VZRA 5CA7A 1EESA 3O2JA 4UVHA 1PN3A 4RQ8A 1SXJB 3FPCA 5CYOA 4DMFA 1TKCA 2CXNA 3K5PA 1UK9A 1UBSB 3K70D 2WTMA 3DT9A 3CC8A 4FYWA 4G3IA 2Y68A 3PZBA 3DSRA 1U0OC 1ZMOA 5D6OA 6AT1A 5K0FA 2IDJA 1C3JA 2PS3A 4EJ2A 2JS7A 1Q2XA 3W6NA 4YQWA 3GGCA 3OOJA 2MU1A 1AMOA 2WUFA 4IWNA 1DJOA 3OJOA 4QFBA 5KMGB 2WWVD 1OXMA 4RTQA 4O63O 4HPWA 4X41A 4CKWB 1M0WA 4PYIA 1F3OA 3C3AA 2VI5A 1H2YA 4OOFA 1J21A 5I7WA 2B1JA 1WW3A 3OQMA 2IXEA 5KTYA 1KDHA 4DY4A 3QVUA