1NJWA

Guanine-thymine mismatch at the polymerase active site
Total Genus 211
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
211
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of mismatch replication errors observed in a DNA polymerase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords DNA PRIMER STRAND
total genus 211
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2003-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1njwA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1njwA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1njwA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1njwA01
4TSXA 1K6YA 2YHAA 5D3GA 1TV9A 3PX6A 2EHGA 3Q8RB 3KHHA 4DL4A 3VQ6A 4KHWA 4RPXA 3AUOA 1ZYQA 1TAUA 4Q5VA 2NRZA 3KHLA 5KT2A 2WONA 4EBDA 4Z6EA 2VWKA 3ZSZA 4IFVA 4MFAA 1N56A 5CB1A 4N41A 1WAJA 3EW9A 2PZSA 2ZQBA 4FM1A 3GIIA 7ICOA 3GV8B 2BHNA 3PO4A 1VK0A 4FJ8A 4CHQA 3I8DA 4FXDA 3VA3A 5DBAA 5IIIA 1YVUA 5KG4A 5KI6A 1YT3A 3F73A 4MF2A 3HX0A 3SPZA 5TZVA 4DQQA 1NOMA 4ZTFA 3RH6A 2LSNA 2JGUA 3C5GA 2E6MA 3PR5B 1NOYA 7ICHA 4UB2A 5K14A 1QSYA 3TI0A 1XHXA 4JWMA 4ZHRA 3HXMA 2I5JA 4BDYA 4ECWA 3DYAA 7ICEA 1KVAA 2ATLA 4YVZA 8ICCA 3WNGA 3RMAA 4XIUA 1ZQJA 2ISPA 1JX4A 4M6WB 4CJ3A 4FVMA 3VQAA 3H40A 5C42A 3C21A 4DS5A 1RT3A 1L5UA 3QEAZ 4GW6A 2G8HA 3ISNC 1RBTA 5BPCA 1UAXA 3LPTA 3ZD9A 4LSNA 5J2FA 9ICEA 4M3YA 7ICMA 4ED3A 3O3GA 4QZ9A 3NAEA 4E7JA 3JSMA 4EYIB 4YG2A 4QOZB 4DOAA 4CFCA 2XHBA 4I2AA 4NLNA 5KRSA 3MDAA 4FJMA 4B8CA 5D4BA 4FS2A 1JL1A 3C2KA 5KFVA 1UWBA 4M9HA 1UOCA 3OYIA 2BCQA 2IDOA 4OGEA 3T5JA 2BPFA 3B0YA 3SV4A 4I9QA 4FK4A 4DL7A 2KZMA 4KHNA 3QEWA 1KEJA 1JLEA 3QZ8A 4DFJA 3MXMA 9ICCA 4KHQA 3GILA 2F1JA 3RMBA 1NJZA 2Z1JA 4RT3A 8ICMA 4DS4A 4NYFA 3QESA 1C0MA 3CYMA 5CYQA 4XQ8A 4M04A 4TUPA 9ICNA 3OVNA 2G8IA 2ZD1A 1ZQZA 5KFYA 8ICQA 3BQ1A 1S0NA 3O4QA 3TAQA 2HHVA 5DG7A 3U6FA 4F92B 2RDJA 4DTJA 3M8PA 2FMSA 4KLDA 4YD2A 1NK6A 3N97B 4ZH4A 4BE0A 5JS2A 2HNDA 3EZ5A 3PUFA 4PHDA 3AA2A 2X78A 4O5KA 2ALZA 1RTJA 2QKBA 3AVCA 4YFKA 1A5VA 4M3WA 4BE2A 7ICUA 9ICJA 3AV9A 5IINA 5KT4A 3HSTB 4QWEA 2F8SA 4J9LA 4RW9A 1N5YA 2HHSA 4ECVA 1WSHA 4CGFA 1W0HA 3JPPA 4LVSA 3TAPA 4RW7A 3C6UA 8ICRA 4DOCA 4N5SA 1S1TA 4MQ3A 4PUOA 1S1VA 3ZT3A 4YFUA 4F5NA 4DF4A 3NGZA 4PY5A 1ZQGA 4JLHA 1ZQAA 3OS0A 3T1AA 3IS9A 2DFLA 2ASLA 3ULDA 3KLHA 1J9AA 2P66A 3S3OA 3QE9Y 3KD1E 4RQ0A 3TAMA 3AVJA 5KFWA 4O3OA 3BQ2A 2FLNA 1XWLA 5KFAA 1LW2A 1RTDA 4DL3A 3KLFA 3ZDEA 1LWEA 2YKNA 3M9NB 4O3QA 3PO5A 4DFMA 5DMRA 1T03A 1ZJNA 3MGIA 5HBMA 4RZRA 3HVTA 2F1IA 3AU6A 1HQUA 3GV5B 3MBYA 3KTQA 2AJQA 4KRFA 4KREA 2HHTA 3ZSOA 2OZSA 4ED7A 4F93B 3LAKA 1J53A 1TV6A 5DBBA 3HVRA 1EXQA 2WTFA 4RPZA 4M47A 1I39A 2GUIA 4KPYA 2NRWA 1Q8IA 4RT2A 4J9KA 5KFNA 4HHTA 5J2HA 1BI4A 1RT6A 4AILC 4O3NA 4ED0A 4IDKA 9ICGA 3DLGA 4FJLA 4CJ4A 4Z4EA 4N47A 4JRQA 3JPRA 3V6HA 3K5NA 3UXNA 3L3VA 4DL2A 3QETA 3RBDA 1S5JA 1BIZA 4C8MA 4O3PA 9ICUA 5J2NA 4K4GA 1GOAA 4F3TA 3ISCA 4DSKA 3K2PA 3QNNA 1S97A 4DTSA 1RYSA 5J2MA 3ZT2A 1RPLA 1NKCA 4YCXA 1ZQOA 2BCRA 2KZZA 1SKSA 3T5HA 4RQ6A 1RCHA 3LANA 1BPDA 1RBRA 4PQUA 7ICIA 2D5RA 4DO9A 1KRPA 9ICKA 4LH4A 3JPSA 4CGIA 4ED1A 1ZQLA 5KFHA 2VG7A 3EPIA 1MC8A 3DRRA 2P6RA 2YNFA 4FBUA 2BE2A 1ZQPA 2P1JA 9ICHA 4DG1A 5CR0A 4DTNA 3PY8A 1QE1A 4TURA 3PR4A 5KG2A 2KQ2A 4BDPA 3UQ2A 4ED6A 4CHOA 3VQ7A 3PW4A 4E3SA 4KLEA 4FZXC 1NK9A 4IQVA 4KTWA 2IHMA 4BXOB 2NRXA 4CEOA 4PHEA 4NYNA 4RPYA 3WNEA 2DTUA 2F1HA 1D5AA 4R64A 3LALA 3V6KA 2PFQA 3KKRA 3ZDBA 4KLTA 4AHSA 4NXZA 3SNNA 4FM2A 3WNHA 1ASWA 4I2QA 4QCLA 1BHLA 2KW4A 4I2HA 8ICUA 5DLGA 3QEIA 2XY7A 5CY4A 5KGWA 4Y1CA 3LAMA 2GV9A 1FK9A 9ICAA 4BXOA 3HWTA 2VA3A 1UA0A 4DTMA 2OPSA 2HNZA 1ZBFA 5CJ7A 3RB3A 4K4HA 1JLAA 5EOZA 1HRHA 1KFTA 2FLPA 3RJIA 1Y88A 2ZJ5A 4R66A 1TK0A 3TANA 4DLEA 5HRSA 2O4IA 3OHBA 3MFHA 4KMUA 4CK2A 4B9NA 3F9KA 1B22A 4H4OA 2C2RA 1ZQTA 4PWDA 3K57A 2AU0A 3G6YA 3V9SA 4Q43A 3AVKA 1RBUA 1BISA 2ITGA 2DFFA 1L3SA 4Z4HA 2FLLA 2ZTCA 5KG7A 2Q0ZX 1Z3EB 4QAGA 3I0SA 5KFTA 5J0XA 3L2VA 3HPGA 4F8RA 4MFFA 2BQUA 2V9WA 4FK2A 4E0DA 4QWDA 4RQ7A 1COOA 4KN4A 3PV8A 3M8SA 9ICOA 7ICPA 1TKXA 1MQ3A 1A5XA 1QS4A 2ISOA 2XO7A 7ICQA 2ASDA 1HJRA 4JV0A 5D49A 3KHGA 3GV7B 2R8KA 4CERA 1BQNA 2KFZA 2C2EA 1UT5A 4TQRA 1LB2B 3MECA 1A5WA 3RMDA 1GOCA 5KFOA 1LWCA 3OYBA 4CFAA 5CHGA 2OWOA 4KFBA 1U9LA 4HUEA 2BKEA 1RTHA 4ED8A 1U04A 4C8NA 1WCNA 3HPHA 5J2JA 8ICXA 3S3NA 4DSJA 3OYKA 2QK9A 5HRRA 2IC3A 4HCBA 3SYZA 3ZT0A 1TVRA 4IKFA 5J2PA 1TVAA 5IILA 1Y97A 1T7PA 1ZQMA 3G10A 3IG1A 4UQGA 4IRCA 3AVGA 2XY6A 4UB3A 8ICZA 7ICNA 4CGGA 4RG8A 4OVLA 7ICSA 4FO6A 3UQ0A 1ASUA 4CJFA 4W5QA 2IBKA 4F4YA 4DOBA 2PYLA 4ELVA 5KTQA 4CIEA 5HMLA 3RWUA 4J2AA 2ZJ8A 1KSPA 4YMNA 3LZIA 4EEYA 4I27A 2MAXA 1EKEA 4Q44A 3U3GA 3FFIA 3BQ0A 4DFKA 2W8KA 1VSMA 2JEGA 3MR5A 4CJLA 4DQSA 2G8KA 4Z4FA 4DWIA 4NCBA 5L9XA 2JEIA 4DTRA 2YNGA 3DRPA 3DLBA 1RT7A 3PW0A 4IRDA 1B92A 2KFNA 4IQTA 1T8EA 4I2EA 1JN3A 4DF8A 4ZTJA 4C8OA 3OJUA 4FCYA 1F21A 3RRGA 9ICTA 3UIQA 3VQCA 3JPTA 2GBZA 3NCIA 1NKBA 4CE9A 1IO2A 4PHAA 1BPXA 3SV3A 2D0CA 5J2EA 3OYFA 5CZ2A 4CJWA 2UVUA 3H4DA 4FJ5A 3V1RA 3UXPA 4PGQA 2Z1HA 3RJEA 5HRNA 1CXUA 3PVXA 4P4OA 3H8SA 3L2UA 5J0SA 4M3UA 4KLJA 4GMJB 3DOKA 1S0VA 4YXJA 4TUQA 3V9UA 4UBCA 5HP1A 1SKRA 4EP5A 3VQ8A 3NGYA 4F50A 3G6VA 1RT2A 5KFFA 4PH5A 1D8LA 2W9CA 3Q8PB 5F9NA 1ITGA 4J9RA 4PA1A 3DLHA 3OYMA 2ZJAA 4Z6CA 4KLSA 2HHUA 4QZDA 1X9MA 1XO1A 4H8KA 5KFRA 5FROA 1ZETA 5KG3A 3RJKA 2HB5A 4E19A 1U49A 4CHNA 3V6JA 4O44A 1O1WA 4ID1A 3C1YA 3OS2A 5IIKA 2BPGA 8ICYA 4AH9A 4UAYA 1BVSA 4F3OA 4BWMA 3NGIA 2BR0A 3V1QA 5J0RA 2IA6A 4DL6A 2AQ0A 3QINA 3A2FA 3ZT4A 4QWAA 3LPUA 3EYZA 4FZYA 3TAFA 5L1KA 3KKSA 4F4WA 3AVBA 3FYHA 5CWRA 8ICTA 4GXJA 2GWSA 5JUMA 4M0AA 1BPBA 3AVLA 5J2AA 1REVA 3V7LA 4ECQA 4EZ6A 4RNNA 3E2EA 1HYZA 1C6VA 2BANA 3TAEA 4IRKA 2VG6A 4B9SA 1Z00A 2PFPA 1L3TA 3NE6A 4B9VA 4YMOA 2IHNA 1RDBA 1IG9A 4KHYA 4KB0A 1X1PA 4FW1A 1NK4A 3QIPA 3VQPA 1TL1A 2B5JA 1RT1A 1RDAA 1ZBUA 1ZQBA 8ICIA 4CF2A 4O5BA 5KFLA 1ZQKA 2FMPA 3E01A 1JLGA 3N4MB 4RUCA 4MEYA 3LWLA 1ZQFA 4FBTA 1JLCA 4ICLA 8ICEA 2R8HA 1SL2A 4IG3A 3RB0A 2VA2A 2W8LA 5KFPA 5HLFA 5HP4A 3KK1A 4CIGA 5KG1A 2A1RA 4Z6DA 1S0MA 3JPOA 8ICNA 1ZJMA 1RYRA 2D0AA 4W5TA 3QEXA 4AHCA 2A1JB 2FBTA 4OLBA 4KLFA 3ISDA 1BL3A 4DQPA 2W9MA 4IFYA 1D8YA 1NKEA 2YV0X 4MFCA 9ICRA 2MUTA 3AA5X 1FKOA 5C25A 3TABA 3TARA 1ZQQA 3HP6A 3ISBA 5DBCA 3OYAA 4O55A 3MGHA 3NF6A 1ZBHA 3VN5A 2O4GA 2HVHA 5KG5A 3AVHA 2FMQA 1EETA 4H4MA 4CJPA 3P83D 3Q8KA 2BCSA 4M3RA 3O3FA 1U48A 3MAQA 3QLHA 1I3AA 1S9GA 4BDZA 1WSEA 3SI6A 3MABA 4IG0A 2FPKA 4HTUA 3GFKB 1S6QA 3V9XA 4F91B 3SUNA 1D9DA 4KLGA 4QW8A 4J9PA 3OYEA 5DG8A 2BCUA 3PW7A 3CM6A 4CHPA 7ICTA 4F5QA 4OPKA 1QTMA 5HRPA 2ZTDA 4CK3A 3TWHA 8ICBA 2BPCA 4CEAA 4CHZA 7ICRA 5CA7A 4NCAA 3AO2A 3VA0A 4FJNA 3IHQB 5F9LA 3MEGA 5J0OA 4KLIA 3OSNA 3PX0A 2R7YA 5J2QA 2ZTEA 3ZSRA 3M9MB 2ETJA 4NLGA 4K8XA 4Z4GA 3OYHA 3I0RA 4DTUA 3RB6A 2DPIA 1KLNA 2V4QA 5J2CA 1S1XA 4YQWA 3QNOA 4R8UA 3MXJA 4ECUA 1JXBA 5EWEA 1CLQA 3G6XA 1HNVA 4DSIA 3HW8A 3VQBA 5DKWA 4R5PA 2RPIA 4GVMA 2KTQA 5DQHA 4FS1A 4X5VA 1ASVA 3TQ1A 4M9LA 4J9QA 3RAQA 3DRSA 4I2PA 1K1SA 5KT6A 4JS4A 4GC7A 4W5RA 1IKVA 5KG6A 2W42A 3V1OA 1Z25A 1FKPA 1N6QA 4QZGA 1ZQVA 4I29A 1MU2A 1WSJA 3NTUA 4OKKA 1S6PA 5KT5A 5SZTA 4CGJA 4DTXA 8ICAA 4KB1A 4JV2A 4DSEA 4NCGA 3T19A 4I2JA 3V81A 4IQUA 4Q45A 1NJYA 1VSLA 3NF8A 4CJQA 2ASJA 3CG7A 1U47A 4E7KA 3CM5A 4FLWA 2G8UA 2J6SA 1Q9XA 1PZNA 9ICXA 2YHBA 3LP2A 3THVA 3OYDA 1A77A 4M3ZA 4I9LA 3LZJA 4ED2A 1J5OA 4GXIA 2VANA 1TKZA 3OY9A 5FRMA 9ICBA 1WSIA 4F2RA 5KFGA 5KFBA 1A76A 1ZBLA 3SI8A 4I28A 5J2BA 4I2CA 4CJ5A 3RTVA 4RQ1A 1ZBIA 4DU1A 4FK0A 3NF9A 2IS3A 5DDMA 4UB5A 4AHTA 1VSJA 1NOZA 4CEQA 4I2FA 3GIKA 2RF2A 3ORYA 4I2DA 4DMNA 4HYKA 3PX4A 2QXFA 1ZQUA 2PY5A 1C7YA 4LY7A 5I3UA 2BQ3A 5DB7A 3UXOA 3RR8A 1W9HA 5JS1A 3RBEA 4L8RB 4FJGA 1TKDA 3NFAA 4ELTA 4O5EA 3M9OB 5D46A 1SL0A 4CEZA 4DQIA 5KFUA 3GIMA 4HUFA 4P4PA 3HO1A 1ZQHA 3NH1A 3V7KA 3RH5A 4YNQA 4QZEA 2Y1JA 4RQ2A 4UAWA 3AO4A 2KN7A 3M8RA 3SCXA 9ICPA 3CFRA 3KK3A 2FPLA 9ICVA 3ZSWA 1TK8A 4FJ7A 1C1BA 4Z6FA 3BQTA 3V7JA 2YNHA 5J0TA 4FM0A 4LD0A 3VQEA 3U3YA 2V4RA 1QLNA 3IRXA 1RTIA 5J0WA 1ZQIA 4FLUA 1FXXA 4QZIA 4KN7A 3V4IA 4HUGA 2IAJA 1S1UA 2YNIA 4QZHA 4QW9A 4R65A 1WNSA 4I7FA 2XC9A 3RJFA 5CZ1A 3H08A 3DLKA 4LZDA 4F5OA 3S3MA 2XY8A 4DSLA 2UVRA 2FC0A 1TAQA 4MF8A 4TUSA 4M9NA 2Z1GA 9ICWA 5KFCA 2OYQA 1VSIA 4E7IA 3HPOA 5J0YA 5DG9A 4FJHA 3K5LA 5HHIA 4BGDA 3MEEA 2LYHA 4NLKA 3LDSA 1S10A 5HROA 2ZUBA 4C8KA 4DTOA 3L2RA 5DB8A 2C22A 4KTQA 4DTPA 1XSLA 3MDCA 2M9NA 5J29A 1C0TA 3DMJA 1ZQNA 2EX3A 8ICFA 4Q0BA 2FBVA 3C23A 2A1SA 4BE1A 3C2MA 4FYDA 3LK9A 3LP0A 3SUQA 4K4IA 3C94A 2J6UA 1LV5A 4QWCA 2KZ3A 5DDYA 2HNYA 3DOLA 3H8JA 3IAYA 2R8IA 4AHUA 4EZ9A 4PHPA 4J9NA 1B9DA 3K5MA 4YR2A 4KLLA 4KLQA 4P2HA 1VSKA 5L1IA 3P5JA 2OZMA 8ICGA 3BJYA 3SQ0A 4PGYA 4YMMA 3AO3A 1JIHA 3HJFA 5C5JA 2B6AA 4KLHA 4BACA 4OJRA 1DLOA 5J2GA 4LZGA 2PXIA 4F4ZA 4ECTA 4KLUA 1RBSA 5J1EA 2XRIA 5KFQA 3NBPA 3ZT1A 4IR9A 1RXVA 2OPPA 4B9TA 1LAWA 3H8WA 4LSLA 2JZBB 4BWJA 4F4KA 3CQ8A 5KGXA 2ZE2A 1XS9D 1WCLA 1WSFA 3V72A 2NRTA 2P6UA 2XGPA 3B6PA 4UB4A 4RQ5A 5SWMA 4B9UA 5DB6A 2B21A 3AU2A 3M8QA 3AO1A 3CFOA 4YR0A 1VRUA 1U4BA 2W9AA 3K5OA 3GIJA 1KFDA 3K75D 3RRHA 1G15A 3OS1A 2P5OA 3MR2A 1AROP 1S9FA 2W9BA 3V9WA 1HPZA 3VQQA 1BQMA 4PGXA 3WNFA 2AGPA 2R8JA 3AA4A 2ATQA 8ICSA 2JLEA 4M3TA 2IOCA 1X2IA 2F96A 3QO9A 4ID5A 1YTUA 4GLXA 3QERA 1DOQA 2P51A 1DTTA 4CJSA 2VG5A 4FLYA 4RU9A 4JS5A 7ICGA 3LP3A 5I42A 4EBCA 4KKOA 2A1JA 4CJRA 5KFIA 5J2IA 4KI4A 5T7BA 4CGDA 4FJ9A 3VQDA 2HHXA 2IGIA 5EWFA 3EPGA 1BCMA 2MUTB 4J2DA 1KVCA 4YP3A 5KFEA 3CFPA 1TGOA 1QSSA 2RDIA 1R0AA 4HCCA 4O9MA 2W9BB 4MFBA 4DL5A 1VRTA 3L2QA 4N76A 4FJXA 1VSFA 4O3RA 4J9SA 4CF0A 4AHVA 1DGSA 4EBEA 3TFSA 2C28A 1RILA 1RDDA 3C5FA 1T4GA 2NUBA 4F4XA 8ICVA 4O0IA 4NM2A 3EY1A 1S9EA 3GDXA 1S76D 4NLZA 1N48A 4E7LA 1BI4B 3ZSYA 1BGXT 2RKIA 1RXWA 2G8WA 4W5NA 3JPNA 2BQRA 2BGGA 4UBBA 1NJWA 4EYHB 2DFEA 1EP4A 1TK5A 1CEZA 2HW3A 4YXMA 4ECSA 3LWMA 2XCPA 2ZUDA 1X9SA 1QSLA 3RB4A 1ZQSA 4KO0A 9ICSA 2BGWA 4O0JA 3OYLA 9ICFA 1BPZA 4FLVA 2R8GA 4OKEA 3OYGA 4P4MA 2BDPA 4CFBA 1KTQA 3SUPA 4RW6A 1C1AA 5CP2A 1JLBA 3P1GA 1QHTA 2PI5A 2DY4A 3SQ4A 1NK8A 2AGOA 1IKXA 4M6WA 1IXRA 2JEFA 3B0XA 4CF8A 3IM1A 4XA5A 7ICJA 5FDLA 3KD5E 1T05A 1Z26A 1ZQWA 2AQ4A 3NF7A 4O5CA 7ICVA 4DU3A 2PI4A 3BDPA 3PNCA 4XRHA 1S0OA 4OGCA 4KITB 4R8UB 1S77D 3MR6A 5EWGA 1GOBA 3RJJA 4QZAA 3G0ZA 3DLRA 1CUKA 3DLEA 2P5GA 4M2YA 1WLJA 1UT8A 1ZQDA 4E89A 2HMIA 3SUOA 4GXKA 5DGAA 3ZDCA 4Y1DA 2VWJA 1IM4A 5E41A 1JKHA 3ASMA 1SL1A 2HHWA 1BPYA 8ICHA 3RAXA 5KFJA 4MEXA 2JZBA 4J2EA 3RR7A 3FDSA 1JLQA 9ICIA 3VQ5A 5J0PA 1SZPA 5L1LA 1ZQRA 1JXEA 4C8LA 4CGHA 3LDAA 4B9MA 4PPXA 3AVNA 1RT4A 2D0BA 3OJSA 4QZBA 8ICKA 2Q3SA 4CEDA 3BGRA 4ECZA 2PFOA 4J9MA 3OHAA 3HL8A 5IIOA 4CJVA 1XI1A 4CEBA 1WN7A 5HMMA 1XSNA 2Y1IA 3H7IA 4IR1A 5CYMA 4R63A 4DFPA 1RNHA 4LH5A 2XGQA 1JXLA 1NJXA 8ICOA 3ZSVA 8ICPA 1KDHA 3V6DA 1IH7A 3OSPA 4UB1A 1TL3A 3ZSXA 1QQCA 2HHQA 4RQ8A 2X6SA 2Z1IA 1C1CA 4ECRA 4M45A 4B8AB 4E1NA 1HYSA 3MR3A 2G8VA 1J54A 3PW2A 1XHZA 3QEBZ 3QEPA 3KJVA 4XUSA 4KLOA 1HJPA 4Z0UA 4F2SA 1SV5A 3NH2A 1ZQCA 4EP4A 5L1JA 2X74A 4QZCA 1NK0A 1NK7A 1U45A 1HUZA 1K1QA 4DSFA 4I2BA 3HT3A 3D45A 4YD1A 4CECA 3RMCA 4CF9A 1Z00B 3ETLA 2PFNA 1ZQYA 1XC9A 4G3IA 1NK5A 1KVBA 4FJKA 5KG0A 4CHYA 3TR8A 1HYVA 3HYFA 4B08A 3QZ7A 2PYJA 2I9GA 3SZ2A 4AHRA 4CJTA 4KTZA 5DQGA 4RNOA 3JYTA 1TKTA 3MXIA 1V9PA 2YKMA 4F5PA 5FRNA 4JK1A 3K58A 3QEVA 3KLGA 4O4GA 1UA1A 4KLMA 1BIUA 1WSGA 4M9JA 2UVVA 4ECYA 1H38A 4DQRA 3AVIA 1RDCA 3Q8LA 5IIMA 3OGUA 1CZBA 1HNIA 4ECXA 1WAFA 1MSWD 3SQ2A 2QKKA 1RT5A 1D9FA 3L2WA 3OYCA 4DEZA 4HVJA 2OA8A 1X9WA 2ZUCA 4Q8EA 2E6LA 4CFDA 4FLXA 3RJGA 8ICWA 3ZSQA 5HHHA 4KHSA 3H4BA 3ZDAA 4M3XA 4JRPA 1LAVA 3Q8SB 4CJKA 4RQ4A 3HP9A 4B3OA 1ZQEA 2FBXA 1ZQXA 9ICLA 4M42A 2VA8A 4WE1A 3L3UA 4CCHA 1IKWA 8ICLA 4DU4A 2OPRA 4RW8A 3Q8MA 4FLZA 1EX4A 1Q9YA 1LWFA 4KV8A 1CXQA 5KFXA 3ZDDA 1MQ2A 3AA3A 3S9HA 1HQEA 2OPQA 5DK5A 1VSDA 4RQ3A 3NGDA 3KHRA 4NY8A 4YN4A 3LP1A 4KAZA 3DI6A 3PMLA 2DPJA 8ICJA 4J2BA 3C6TA 3AO5A 1BCOA 1KCFA 4KHUA 2B4JA 4RW4A 1DTQA 3T3FA 3T5LA 4IQWA 1HUOA 1JLFA 3C95A 4W5OA 5BOLA 4F5RA 9ICQA 5KRTA 5BOMA 4ELUA 4M9GA 3MFIA 4OPJA 2F8TA 5DB9A 4E7HA 5KT3A 3KK2A 4QZFA 3RH4A 3O3HA 2AGQA 3MEDA 1RZTA 1HMVA 1VSHA 4I2IA 4NM1A 3ZCMA 5KFDA 3AVFA 4B9LA 4J9OA 4OLAA 2J6TA 3ZD8A 3K4GA 2XY5A 2JEJA 3QIOA 1KFSA 3D0PA 2UVWA 5HNKA 2HVIA 1XSPA 3TAGA 4IBNA 5J0QA 1L3VA 7ICFA 4CIFA 1L3UA 5IIJA 3EWAA 3C1ZA 1KLMA 3NDKA 5DGBA 3DM2A 3C2LA 3OYNA 4CEFA 2I1QA 4QWBA 2XCAA 2IMWP 2DFHA 4FJJA 1XU4A 5EU7A 2E4LA 5J0UA 4Z4IA 1TFRA 9ICMA 3Q8QB 3VQ9A 4FLTA 2W9CB 3SJJA 3AVAA 2RN2A 1T3NA 1IKYA 4QZ8A 4TQSA 1JMSA 4GC6A 1YTAA 5KFMA 7ICKA 4JWNA 3KLIA 4K8ZA 5J2DA 4RNMA 3PW5A 1C0UA 3VQ4A 7ICLA 4Q8FA 1VSEA 3K59A 3TFRA 5KFSA 5KFZA 4G1QA 1LW0A 4FJIA 4N56A 4DLGA 4CEEA 3JPQA 3SQ1A 3ITHA 4M41A 2FPMA 5DQIA 3O4NA 5KT7A 2WOMA 3PMNA 1SKWA 3L8BA 2FBYA 3GQCA 4Z4CA 2G8FA 3NH0A 1B43A 5DLFA 3RJHA 2NRVA 4JUZA 1S1WA 3OYJA 1SUQA 3AVMA 4RUAA 5C24A 2X6NA 4E1MA 5J2KA 1B9FA 5KFKA 3HM9A 4YR3A 4O3SA 3HK2A 4CJEA 4JV1A 1EXNA 1BPEA 3KIOA 4KI6A 4CF1A 1RBVA 2BCVA 3SPYA 4CK1A 4FW2A 3KLEA 4FZZA 3V9ZA 3ALYA 2H5XA 1CZ9A 3B6OA 4OKJA 4I2GA 3NHGA 3UPQA 2C2DA 4CESA 4CJUA 3T5KA 4UAZA 1JL2A
chains in the Genus database with same CATH superfamily
5J1EB 2NZTA 1K6YA 5D3GA 1SUQB 2F40A 2EHGA 4DZ6A 2OPPB 3Q8RB 3JAMY 1DFDA 1RAGB 2VD3A 1P9YA 4WE1B 4Q5VA 2NRZA 2N3LA 3VGTA 3EUNA 1HKAA 2CZ4A 3SDEA 5E79U 4F3QA 4LFBJ 1VMBA 3JS9A 3QU2A 2E1RA 2F8LA 4M94A 4NI2A 2CIMA 2ZQBA 4TNOA 1U26A 7ICOA 5KQ8A 3PO4A 1KDNA 2H3IA 2H3EB 3M6WA 4X62J 4XH4A 2DJWA 3NLCA 4JKBA 3MM9B 2LYVA 4Y2PA 1FESA 5KG4A 2Q79A 1GX5A 1VQKN 3SPZA 2DQNB 5A8KB 2UYTA 4B1YB 4ZLPA 4K2JA 2LSNA 2JGUA 3PR5B 2MZQA 1NOYA 1I1GA 3SK3A 1QSYA 4HAIA 4WU3A 3A8JA 2IVPA 1BLUA 2L9WA 1CQNA 4YOTA 4CZMA 1HNZF 4YVZA 3OTQA 1DKGD 5IWAF 3U9ZA 4XIUA 2HMXA 3VETA 1LKYA 3T69A 1JX4A 1GFWB 4CJ3A 5HO4A 3E0FA 3H40A 4AL5A 2O01C 3C21A 3H5YA 5AK4A 1HWIA 1RT3A 3B6BA 3KMSA 3SAHA 4MKVA 3CJ9A 4GW6A 3RBZA 3BZQA 4LRDA 4UOFA 3UNYA 7ICMA 2IJNA 4QZ9A 2E5SA 4YG2A 1Z2LA 1VDVA 4CFCA 2XHBA 2GLEA 2K2PA 4A8YA 5KRSA 5D4BA 5HJYA 4FS2A 1S48A 1WB9A 2AJ4A 1LVHA 5JRTA 1WACA 3TZWA 3OYIA 2RJZA 4DV4K 2IDOA 4OGEA 2E7WA 4WKRA 4KH1B 3O4WA 3SV4A 3CD7A 1WHYA 1FE0A 4LF6J 1N63A 1Q18A 3QEWA 4C4RA 2YX6A 2HFSA 2HNDB 2LMIA 2OEJA 3UCGA 5H9FJ 2HQFA 3HHDA 4R79A 1RZMA 2MLXA 2P9NA 4DS4A 3QESA 3LQVA 2E8PA 3OT9A 2ZHOA 1C0MA 3CYMA 4K4XA 4ID8A 5CYQA 4TUPA 9ICNA 3OVNA 2G8IA 2ZD1A 2QXLA 4KPCA 1W97L 3BQ1A 3I9ZA 3TAQA 1NGGA 2CA9A 2I38A 3QPIA 3GBTA 2ILYA 2ASOA 2FMSA 1FRMA 2IM1A 4YD2A 3VEVA 3N97B 2H65B 4ZVFA 5IC4B 1ILYA 2HNDA 1WKJA 1N0UA 4O5KA 3OA9A 2MZ1A 3BF4A 2ALZA 3AVCA 3AV9A 5KT4A 1TUYA 3OFGA 2F3NA 5JVGL 3LDQA 5GADI 1ZTTA 2WSCC 4ZPAA 2YKMB 4ECVA 2XYGB 3O9TA 4LVSA 3UFCX 4A48A 2F5GA 4P6QA 3E9OA 5CABA 4DV1F 3FVYA 3G82A 2PFFB 3DWLA 3ZT3A 4BLGA 4BR4A 4F5NA 3NGZA 4JLHA 2QTDA 4MYTA 3P8BB 3G6ES 2HZVA 1L6NA 2ASLA 3R6MA 3Q7CA 4F9OA 2A0FB 3DFEA 3THXB 1FNOA 2M2BA 4RQ0A 3TAMA 3C28A 3AVJA 5KFWA 1GEHA 4BHQA 2OGUA 4GY2B 3PIPL 5FLXO 1CJUB 1ZOLA 1LW2A 3BEGB 5LM7E 1OXJA 1RISA 4P71A 1LWEA 2D7SA 4O3QA 2DGUA 3H5XA 1XN9A 5DMRA 4RZRA 1GK8A 4PZNA 3AU6A 5DZ6A 1I94K 4CVNE 5CAAA 2E9ZA 2VKZG 3D2EB 1UP1A 3VGUA 4U96A 3GV5B 3MBYA 1HNWJ 1CZAN 1TFWA 4ZPTR 1JCEA 2OZSA 2FZGB 1J53A 1TV6A 3TX0A 2WTFA 5LL6d 2BH1A 4CF5A 3M8ZA 4RW9B 4J9KA 4HDHA 4OZLA 1BI4A 1SPBP 4BC2A 1LW2B 5AXNA 4ED0A 1AA1B 3UE2A 5AI8A 1VCTA 3IBWA 4PYAA 1YK9A 3DLGA 4TYBA 4FJLA 5HANA 2J7WA 3K5NA 3DGPA 4DV7K 5GAGP 1QAYA 4K4WA 5GAGI 3IS9B 2JX2A 4DU7A 4JK7A 3SAGA 5J2NA 2BOAA 3B4MA 4I2PB 4NA2A 1GOAA 3GFHA 2MZRA 2WSFC 5CZVA 1FD2A 3K2PA 2KVSA 1FRLA 1RYSA 1K8AT 5J2MA 1NKCA 1U2VB 1VOMA 3D68A 1JLBB 2ZDOA 2EFNA 3T5HA 1PK3A 1WDDA 5EGYA 3LANA 1BPDA 1RBRA 1UEUA 7ICIA 2DB1A 2A6AA 4QIWD 1B4FA 1VQ8S 4WQ4A 1KRPA 4DXLA 1ACMB 1WWHA 4BRQA 1JJ2R 4NWBA 1KBRA 4S0MA 1TAMA 4LFBK 2UP1A 2ZM6J 5LMNF 3KHYA 3W0LA 5ETOA 1ZQPA 2LCWA 3NEKA 2VF3A 5AQVA 1F9HA 3GONA 1IIPA 2CXYA 3HKZD 3K17A 1NGAA 5B0FA 1IBCB 2W24A 2KT2A 2ZWOA 2MLZA 2CDRB 4IS7A 2OPRB 3UQ2A 3F41A 1Z05A 3AOBA 4ED6A 3WIUA 3BYRA 3VQ7A 4E3SA 5F1XA 1Q8KA 1Z1VA 3IP4B 4KLEA 1URNA 1YITN 1I51B 1H6KX 1NK9A 4KTWA 1TL7A 5EDWA 3PHEA 4IOXA 4OHXA 9RUBA 4UARA 2LEAA 4C6AA 3QDKA 2N4CA 4NYNA 2RVJA 2DTUA 4R64A 3LALA 2ODGA 1D0EA 1XMQK 4RX6A 3B8HA 2B4UA 4AHSA 4K4YA 4NXZA 1N52B 4LF6K 5G5HA 3HDSA 2BV3A 1ASWA 4A8QA 3FSYA 3CDUA 4I2HA 1NAQA 3D0HE 8ICUA 5DLGA 1VJ5A 5F8IA 3QEIA 3UNGC 4M63A 4Z7YA 3O1WA 1HD1A 2B4OA 5IM0B 3KK2B 1G4CA 1SJ3P 3RG6A 4BXOA 5ALHA 3TVKA 2VA3A 4DTMA 1C20A 5AJ3J 5KAKA 3KNGA 4CGZA 1Y88A 1X7VA 4X65F 5HRSA 3TR5A 1FO4A 3MFHA 4BCAA 4H4OA 4JI2J 2JOQA 1ZQTA 1QQOA 2AU0A 1H74A 3V9SA 3DOMB 4Q43A 1YJRA 1VHIA 3I32A 3PFOA 3NNCA 1YVFA 3AVKA 2ITGA 2CPYA 2Q0ZX 4LF2A 1Z3EB 3QBCA 4HL9A 3N79A 5J0XA 3L2VA 2XWXA 4F8RA 2I9SA 1R0CB 4ETZA 4E0DA 1FVSA 2QWOA 1LK7A 2VYPA 1COOA 4AYBD 2FSKA 3PV8A 3M8SA 9ICOA 3BR9A 4ILMA 1A5XA 4KBOA 4JN4A 3GZ7A 2ISOA 3CPWM 5T7LA 3IWLA 5D49A 4FYWB 5A0YB 2R8KA 2KHVA 1GXTA 2KFZA 1UT5A 1LB2B 1NNLA 2W2OP 1SJ1A 2OWOA 3HF5A 4YUDA 1XC3A 4X4VA 1U9LA 1RTHA 4YOEA 4ED8A 3PSFA 1IJFB 2A2DA 2IYGA 3EUB2 3BP8A 2QWQA 1QQNA 2ZDPA 2IC3A 4C0HA 2MKJA 5HK4A 3SYZA 4JV5F 4IKFA 2DNMA 4DX7A 5J2PA 1QVFM 4ZKAA 3SCKE 3C16B 1CVJA 1Y97A 5E3RA 2E8OA 2QE5A 4UB3A 3ZTQA 2CRLA 3AB4B 4RG8A 1MW7A 1ASUA 4IJAA 4CJFA 2CH6A 2FJWA 1S9EB 3NRZA 2LDIA 4GRSA 4CIEA 2ZJ8A 1KSPA 5AQYA 3LZIA 1SZ2A 2K89A 5CRXA 1B0TA 4B1WB 3T1YF 1IBLJ 3FFIA 3BQ0A 3NNAA 4X64F 3G96A 5U47A 4CJLA 1YZ6A 2BJ9A 3GYGA 1RXOB 2QYGA 4DWIA 5L9XA 3C16A 1N5TA 2KVIA 4JI7K 3PW0A 4IRDA 2ZH4A 2DKXA 1B92A 1HI0P 1JN3A 4DF8A 3OQ2A 1N2XA 1N36F 1OYDA 2IY5B 4ZCLA 1WEYA 4OPHA 4PR6A 4KSEB 2YX1A 2DNRA 3UIQA 2PD1A 3NCIA 1NKBA 4CE9A 4NLTA 4YOVA 1VQ4S 3GE1A 3SR6A 3CB4A 2UVUA 3F2CA 3CCVS 5FDLB 4ZOHC 4A5AA 3QMQA 3TACB 2UXBJ 3RJEA 5DJBA 4P4OA 4Y6IA 5J0SA 4KLJA 4GMJB 3OVSA 4WXWA 2DXDA 1KC8T 4YXJA 3N6NA 5KOWA 2NNWA 1S99A 1KAXA 3UN5A 3L4IA 5HP1A 1SKRA 2G2YA 4AFFA 3CRXA 4EP5A 2OLWA 3G6VA 2DNNA 1SI9A 1RT2A 5KFFA 3DXMA 1UW4A 3P96A 5A6PA 3KZBA 4OYIA 3U1LA 2YNGB 2V0NA 1VQLN 4PA1A 3OYMA 2ZJAA 1WOQA 1VQ6N 4F67A 3HILA 5DM6Q 4F36A 4H8KA 5KFRA 4USTA 2BX6A 4F25A 1PAEX 4CZFA 1U49A 2IOFA 3F2KA 1FKAF 3G86A 3GJQB 4ZJLA 4B3MJ 5EE0A 2OI2A 3CCLS 2QEXN 8ICYA 4AH9A 3TP2A 4RNHA 2AQ0A 1K9MT 4FZYA 3TJAA 1NWKA 4CJ7A 1OVYA 3FQKA 4DV5J 3AVBA 5CWRA 2ZM6F 5HOOA 2GWSA 5JUMA 2X1AA 1BPBA 3AVLA 5J2AA 4ECQA 1HWKA 3CP8A 3WQTA 1QD1A 2KV2A 1E6VA 2VBXA 1L3TA 3R5BA 3NE6A 3IKMA 4B9VA 1SH0A 4ALZA 1NHKL 2DY1A 1B7FA 4JI1F 1X1PA 3QIPA 2AYGA 3VQPA 1TL1A 2AJFE 2ITMA 1RJJA 1MNEA 3D2FA 1V4TA 4X4SA 2GQQA 1ZD2P 4CF2A 4O5BA 5L1MA 4FF3A 5AFUA 5AZIA 1UKUA 2GUPA 2BOPA 3LWLA 2C3OA 1V3ZA 1DURA 8ICEA 4RUHA 4HDGA 3HHLA 4UTGA 3CSKA 4IG3A 1NSPA 2RHSB 1HARA 2J9DE 5HP4A 2CUYA 4OL8A 2Y0SF 2MZSA 4CNZA 2ES6A 2MKCA 1S0MA 3BKUA 4KKOB 3QEXA 1O08A 1TUVA 2LXIA 4KLFA 3ISDA 3F53A 4WCEL 1FNXH 1BL3A 4DQPA 3FFIB 4R0JA 1D8YA 2YV0X 2MUTA 1HNXJ 2VG6B 3TZXA 1ZOTA 3VN5A 1DEJA 5KG5A 4CJPA 4RTFD 3TU5A 1R8PA 3OW2R 3R27A 3QLHA 2HBJA 3UO0A 1S9GA 4HTUA 1DK2A 2O8FA 2WBRA 1K73O 3FK4A 3N7SC 3BN4A 3R7BB 2BCUA 4G1IA 4X62F 7ICTA 2WB4A 1YDLA 4PQUB 2B51A 3HULA 5C25B 4CK3A 4DN0A 4QBUA 2F7VA 4CH7A 1MA7A 3ZZ0A 1VLYA 7ICRA 3HZGA 2QWMA 3AO2A 2WVEA 2MJUA 4CO2A 1BMQB 2L48A 2YWKA 1X4EA 2VPWB 3PX0A 5J2QA 3ZSRA 1R89A 2XLKA 2ETJA 4M95A 2BJ8A 4Y2JA 1RUSA 2DPIA 2CPFA 4DQ8A 1SWWA 4R8UA 2HURA 1JXBA 3CJQA 1VQPS 3W5ZA 1KAZA 2H5IB 4F0KA 2FJEB 2CQHA 3H46O 2A1BA 1N8RO 4PAAA 4DX8H 2CQPA 2YBVA 2EAMA 4X66J 1QVFR 4DR2J 4M9LA 3RAQA 4J9QA 3DRSA 5KT6A 1IKVA 3HCXA 2RRDA 1M5VC 2W42A 1Z25A 1FKPA 4YDDB 3AD8C 4QZGA 1N6QA 3CF5L 3TTCA 3RFAA 3J80O 2V8PA 4RLEA 4Q0BB 5D0EA 1IBLK 3BSNA 1S6PA 2E1EA 4Y2XA 1Q0NA 8ICAA 3NS6A 5AZJB 4DSEA 3T19A 1DBDA 1Y64A 4I2JA 1VHXA 3KDNA 4JI7J 2WVDA 2W4CA 1Q5YA 4EGLA 2FHJD 5AK5A 3HD2A 2DH8A 3NF8A 4IOCL 3A3PB 3M6UA 2ASJA 2DNPA 3RBXA 2LQ8A 5AKGA 2CVEA 2NPFA 4F04B 4C1NI 2NXUA 2G8UA 2J6SA 2MY7A 4N7TA 1S59A 1Q9XA 3R3LA 3LP2A 1O0PA 2GW8A 1FX2A 3D2FB 3TEGA 3T1HK 4M3ZA 1QQ5A 1F0MA 1J5OA 1N0VC 2XMVA 1FA0A 3JTNA 3ENQA 4RW7B 3OY9A 4J91A 1WSIA 4BRIA 2N1RA 5HQMA 3MCOA 1VC6A 2VGNA 2UXBK 5KFBA 1PSDA 1A76A 1T0TV 1X4HA 4IG3B 1MN9A 3O80A 2V9KA 3MK6A 5AQXA 4I2CA 4CJ5A 2LMRA 3CJ5A 2D4WA 1ZBIA 4W90B 5JLHA 2VZ9A 1KP6A 2IS3A 2PMHA 2D3ZA 4JI5K 2JDJA 2YHYA 2GNKA 4J5OA 4I2FA 2GX9A 1S1UB 2CGJA 3W8GA 2IVMA 4Y2QA 4XK8C 4BC7A 2QXFA 4LY7A 3P6YC 5DB7A 3UXOA 5ETLA 3RR8A 2GH1A 2J0XA 4A57A 3BGOP 3S41A 2QA1A 3TYTA 5GAHI 3H5UA 3RBEA 4L8RB 4ZITA 1GLLO 4F0HA 3NAHA 1JCFA 3LGHA 3UDVA 2W55A 5EX5A 5D46A 3H1QA 5CE3A 4DQIA 1TKTB 4X4PA 1Y5IB 4P4PA 2C2OB 2ZUAA 4YN3B 4QZEA 3J7AN 2OHFA 4A8EA 3ICXA 2Y1JA 5ALDA 2B9WA 2CQCA 5CH7B 3M8RA 5E5NA 4MKAA 4A8FA 1IR1A 3CFRA 1BWVA 3ZSWA 1TK8A 4WKYA 2MKIA 4FJ7A 1YHQN 1YJ7A 1WHXA 3BQTA 4U9RA 2YNHA 4JV5K 1U2FA 2G0JA 3UN2A 3AFGA 1KN5A 2DHXA 1RQNA 4OJ1A 1V85A 2OEHA 3BBBA 3N4QA 2IIRA 3D7EO 5AKEA 4DI6A 2J4RA 4QW9A 1CC8A 4LRBA 3UE5A 4KHRA 3FSIA 2EW9A 3H08A 3QJLA 3POTB 3W65A 4DX5A 5E3PA 2BKNA 3S3MA 4JNEA 1FRHA 1Z1BA 1NSAA 2UVRA 3I55S 2FC0A 4G9BA 2Z1GA 1Q3UA 2H3GX 5LL6Z 4X64K 2OYQA 4ZVPB 5J0YA 5DG9A 3U1MA 3DJCA 5HHIA 3WZ0A 4FPIA 4NXMF 4DV3F 4DTPA 3W66A 2Z0GA 1XSLA 5ALOA 1N32K 1SIWB 4LQ9A 5BR8J 1C0TA 1RT2B 2W7PA 1ZQNA 4Q0BA 1CJTB 3C23A 2VFTA 3C2MA 2G0IA 5BXIA 2C3UA 4DR1K 4K4IA 3DLLL 2J6UA 2HBLA 1LV5A 2HBYB 3U9DA 1REGX 4I2QB 2IFXA 3DOLA 4LSLB 2R8IA 2QARA 1WI8A 1NB2A 4J9NA 1B9DA 2KG1A 1KLMB 4KLQA 3O9RA 2UXCK 1F5CA 3U7JA 1KQGB 3CD0A 3FZLA 1JIHA 1Q7YT 2F9DA 3D7SB 4M7XA 4ID5B 1F2HA 2C42A 4LZGA 3Q8UA 3T41A 4ECTA 2XRIA 1X4BA 3NBPA 2P9SB 1NBEB 2CPIA 4IR9A 2KN4A 3MEEB 2VBZA 3OTOJ 3N5FA 4LSLA 3UWTA 4LF8K 4JB8B 1NNDA 4BWJA 3CQ8A 1N36K 1H2TZ 1EAYC 5KGXA 4ZLJA 2UXDJ 2UXCF 1WSFA 2FYXA 3I82A 3EX7B 2GVZA 4DBQA 3H8MA 2COLA 4PG6A 4LFAJ 5ALQA 4I67A 5SWMA 4GVBA 4JMUA 4FYYB 1Q95G 1TL1B 2B21A 4LR9A 3AU2A 2P9KB 3CFOA 1VRUA 4CLTA 1RP5A 3GIJA 2G0AA 4P0PB 3CETA 4PWWA 1F2GA 2RHKA 2CYYA 3MUMP 1VQ8N 3EDRB 1J2MA 2W9BA 3V9WA 1HBNB 3ULHA 3WNFA 5AK6A 2AGPA 2FDNA 5IWAK 3AA4A 2ATQA 4UUXA 1SCJB 3EICA 4U8VA 4ZCMA 2JLEA 1X2IA 1AZSA 3BS9A 1YTUA 3KFUF 2P51A 2VG5A 3OBIA 3C6AA 4KKOA 2A1JA 4O23A 2KHDA 1XNRJ 2XM3A 5KFIA 3C65A 4CGDA 4LF4F 4FJ9A 1YJUA 3B9JA 1M5SA 4J2DA 2MQPA 4YHHJ 4YP3A 5D8HB 3TADA 2IJRA 1S7IA 1R0AA 4HCCA 5IFMA 3IRUA 2DYAA 4MFBA 4OX6A 4N76A 1N34K 4FJXA 3H0MB 2AD9A 4O3RA 3ZX0A 2QL9B 4EBEA 1TZ0A 2VFSA 3C15B 3TAMB 2F65A 1FDBA 4PPDA 3N4WA 4NM2A 3EY1A 1S76D 4NLZA 4WIIA 3FQLA 1GH8A 3ZSYA 3MMAB 2PIIA 3RF9A 1U6BA 1UETA 1B70B 1BGXT 1UTAA 2RKIA 4W5NA 3VWSA 3D67A 2BGGA 1RKJA 2BANB 1UVNA 2DFEA 1SXLA 1N4LA 4LF5F 3K1RB 3AJDA 3HFZB 3FZBA 3OFFA 4MFBB 2AXTU 2ZZNA 5CCMA 4CO1A 2EKNA 1RQLA 1R8CA 3ZTSA 2R8GA 1O13A 2KICA 3SENA 4P4MA 1FCAA 4CFBA 4CH1A 3FLCO 3CVKA 1C1AA 2OH2A 3AH6A 3MM9A 1VQ4N 3WK9A 3Q2SC 1QHTA 1JLCB 4PL8A 3DGPB 2KU7A 3KFWX 1CJVA 1Q8BA 5A8KA 1OW5A 1FFGB 2ZWPA 2XMUA 2NR0A 5DDOC 3UB5A 2F4FA 3D2SA 1VQYA 4X66F 5ALWA 5BYRA 1VLOA 1HWJA 3P4UB 3MMBB 2HBKA 3NF7A 3W9JA 1VQOS 5K8NA 4LC9B 3BDPA 3PNCA 1S0OA 1RCOB 4C98A 3GTYX 1S77D 3VCDA 2YKQA 5AQHA 2BZ2A 2V2KA 3BDEA 3SSQA 3G0ZA 4OZ0A 3NRBA 1ZH5A 5B09A 4M2YA 1WLJA 2CQDA 5LJ5Y 1UT8A 1ZQDA 3ZX2A 2HLUA 3SUOA 1PG5B 2FD2A 4Y1DA 3OUYB 3SQIA 3SSSA 1IM4A 2CKWA 2EEYA 3DN9A 4OJ6A 3ASMA 1SL1A 3ALRA 2HHWA 8ICHA 4WFBL 4NO7A 2VH7A 4DR3F 4AQYK 4YDXA 2HDOA 2O6KA 1FDAA 2D3UA 1JLQA 3GE9A 1URRA 3SEOA 4AUKA 5J0PA 3VQ5A 3QT6A 1ZQRA 1JXEA 3TUIC 2GVZB 2W03A 2ZBRA 5AI5A 4B9MA 5E2QA 1OSDA 4NZ0A 2DT9A 2IVFB 3BGRA 4ECZA 3ZLJA 1SB6A 1PC4A 2CPHA 3J7ZT 1XI1A 3Q24A 2Z2YB 5HMMA 5F0UA 3H7IA 5CYMA 4R63A 4LH5A 2HFNA 5H9FK 1JXLA 2FC9A 1NJXA 3AL0B 2UU9F 2QTWA 1JK9B 3CJRA 8ICPA 1KDHA 3V6DA 2VONA 3LA0A 3M8PB 1IH7A 4DV5K 4NA1A 4LR8A 3VTHA 2HBRB 4LBHA 1TV6B 2QLJB 1LFPA 2HHQA 1N32J 1C1CA 4I68A 4E1NA 1HYSA 3QB0A 3MR3A 5KNIA 3R5AA 4XTTA 1HNWF 3EE3A 1K8KA 3PW2A 4MK8A 2ZNZA 5GTIU 3VENA 1R59O 1KQKA 3QEPA 3KJVA 1C0UB 4F2SA 3NH2A 1ZQCA 2OJ3A 4BGAA 2Y0BB 4ZN1A 2X74A 2V69A 5C7PA 4EP4A 2VHGA 4YY3F 5I3PA 1SBRA 3OR1A 4I2BA 2G13A 2XSFA 3ETLA 2IYIA 4P72A 2KHQA 2D8CA 4DV5F 4CD3A 2BE9B 2XMWA 2JWLA 5CD4H 1XC9A 1NK5A 4UT4A 5HJXA 2VPZB 4IKAA 4NRUA 2KJVA 2YX7A 3A8EA 3WC0A 3ZYYX 3AARA 2I9GA 4RNOA 3JYTA 3KLHB 4PQAA 1TKTA 2VC1A 3QYYA 5FRNA 2XI3A 4OYBA 3KLGA 3J81j 1UA1A 4LFBF 4V19X 3C8YA 1H38A 3BSAA 3QSYB 4ICLB 3GSDA 3AVIA 1OY9A 3CCMS 3S6JA 5IIMA 2JWNA 3VF6A 2DNGA 1X4CA 2HVEA 1N36J 2F77X 4RR5A 3ZFVA 2OA8A 5HVFA 1DGJA 1SKUB 4Q8EA 4ED5A 4FLXA 4MLEA 1APSA 8ICWA 2J76E 2W6LA 2DBYA 4LFAK 1L8LA 3OL6A 2Q2RA 1OSCA 3M05A 3ET6B 3J81U 1M0SA 4BC9A 1UQVA 3IGVA 4MTPA 1L7MA 4DR7K 5AXKA 4WE1A 3IR7B 2CQ0A 3Q7BA 4JYAK 2RQCA 1P8GA 4CCHA 3BV8A 1S12A 2OPRA 3CI5A 3QNMA 1T9WA 4IOBA 4BRAA 4FLZA 1EX4A 1LWFA 1RACB 4ANDA 1CXQA 1Q82O 5KFXA 3ZDDA 2AZ1A 3MMBA 2GZOA 2OPQA 3LM9A 3CMAS 3ILJA 4NYPA 1VSDA 4LVNP 4YN4A 4KAZA 1XR7A 3CIMA 4DV1J 3PMLA 3C14B 1FI4A 5K4LA 4J2BA 1BCOA 2RILA 2GMHA 3U1NA 2QIFA 3WUHA 3BYPA 3OBYA 5BYSA 2CQGA 3AODA 4W5OA 3UKRA 3CC4S 1ZXIA 4NASA 3IRWP 3MCSA 4WFNQ 5BOMA 4ELUA 1J2NA 4M9GA 3MFIA 3IG8A 5DB9A 3FZFA 4E7HA 3VR1A 4USMA 3RH4A 3QATA 1HMVA 2HFVA 4BRKA 1L8OA 3ZCMA 3W60A 4WFXA 5F3TA 2K4HA 4J9OA 5GAEU 3LH2S 5J2MB 1KFSA 4FVUA 5H9EJ 1AYEA 4HEA9 2UVWA 4GO7X 4UF4A 4V1Ak 4CTAA 1CS4A 3O6WA 3TAGA 1D9AA 1VLBA 7ICFA 1HKCA 1L3UA 5IIJA 2DK2A 4R25A 1RA6A 2DIVA 3QBXA 3DM2A 4ZIVA 5AHXA 1QDUB 1ZPVA 4HT5A 4CLYA 4P74A 5AKLA 2KHCA 3NCQA 3CNHA 4DV7J 3ITHB 4KYZA 3MX2A 5EU7A 3GL1A 2EFQA 4NL9C 2W9CB 1GLAG 4W92B 2YMMA 1NCLA 1T3NA 4DR3J 4DR4K 1IKYA 2MA1A 1I3OB 3VZIA 3E58A 2P9KA 3CCEN 7ICKA 3KK7A 5FLXY 4ZCKA 3VQ4A 3W63A 3FCHA 2CPDA 1DY3A 5GMKa 4BRPA 3TFRA 5KFSA 1JLEB 4G1QA 2KRRA 4CZEA 2VOPA 2FSNA 2LKZA 1NDPA 3VGLA 2R7UA 3SQ1A 3QUCA 3ITHA 4ZVOB 5ALTA 3E1YA 4JKAA 1Q7LB 2ERRA 1WUAA 2E2PA 2KYXA 1SKWA 3L8BA 2YH0A 2Z2MA 4YDUA 3SBGA 2G8FA 1B43A 2ZD1B 1QVGR 3THWA 3CJ2A 5DLFA 3GOIA 5AQPA 2R2UA 3NVZA 4DUYJ 2QZ8A 3PIOQ 2K4EA 5C24A 4RUAA 2X6NA 4E1MA 2W3SA 4O3SA 2YWFA 1SQGA 2WUSA 1U09A 1NI3A 1EXNA 4UB8U 2MRLA 2R9LA 3I6PA 3PSPA 5DRKA 3T6JA 3OXLA 3FGUA 4FZZA 1KVIA 4JKCA 4QQBA 2B0CA 1D4XA 2NXNA 2VODA 2C2DA 3OLBA 7AT1B 3IV6A 4U8YA 1N88A 4V19J 3EXYA 4K0KJ 2KT5A 3KHHA 3VQ6A 2F8KA 2OTJN 4D3HA 1ZYQA 1TAUA 3O8MA 3BZKA 5KPRA 3TA0A 3HTVA 2JH1A 4NLCA 3ONNA 2VWKA 3ZSZA 2DTJA 4MFAA 3H25A 3R9KA 5D4PA 2FVSA 2GQ2A 4ZHRB 2PZSA 3QT5A 2ZIVA 1RBLA 1IG8A 3GV8B 5AM0A 3CCQS 1VK0A 2W6KA 4NB4A 4FJ8A 2PE8A 4NMXA 3I8DA 3DDKA 5IIIA 1FTRA 2DHSA 3HBTA 1YVUA 4WK1A 1TVRB 3HVTB 3CQXA 3F73A 2HIYA 4MF2A 2DNYA 3HX0A 4RUBA 5BRDA 5AM5A 2E1MC 2HK3A 2QA4G 4DQQA 2O5DA 4BROA 3IN5A 3RH6A 2HGNA 4ZLLA 1S72S 3C5GA 2E6MA 3OW2M 1V9OA 2GA7A 2LKYA 1DTTB 3TI0A 5F8LA 5HR7A 4JWMA 4ZHRA 1YHQS 4RNFA 2AF6A 4C0OC 1QAXA 1KVAA 2ATLA 3LL3A 1S22A 2O8DA 8ICCA 4MDAA 3WNGA 3RMAA 4CO5A 2ISPA 2ZBQA 3BGUA 1I6JA 2ZJPL 3VQAA 5C42A 4DS5A 3I9V9 3DDHA 1L5UA 3FM9A 2XSJB 3R7SB 3TSUA 2G8HA 5AKXA 1NDLA 3ISNC 3R3TA 4L73A 2C3PA 1UAXA 1TL5A 4MKBA 5J2FA 2HRYA 9ICEA 3Q86A 4ED3A 3LUYA 1V97A 5ETSA 2JFKA 2QWRA 2M9KA 1D09B 2DGSA 4A8SA 5BN8A 2O8EB 4DOAA 1BQXA 5T41A 2RRAA 5F8GA 4DV6F 3MDAA 4TVAB 1YKWA 4B8CA 4ANEA 1JL1A 3C2KA 3GPAA 4ACOA 2A6MA 5CYJA 2RHQB 3CPWR 5LMUJ 5C42B 2YWEA 4ENOA 1SIJA 2BCQA 4Z94A 3T5JA 2BPFA 4NLOA 1QQ7A 2KZMA 2HQDA 5AI9A 2A42A 5FJ4A 1JLEA 1FEZA 4G1QB 4JI6F 2EVZA 9ICCA 5AKJA 1FJGF 4KHQA 4US8A 3HHEA 3C2PA 2E3TA 5F8HA 4OO1J 4NYFA 3UR3C 3QIPB 4OI3A 4WFYA 3S01A 2Q66A 3UDCA 8ICQA 4NWIA 3O4QA 3F56A 2CQ2A 2LXUA 1U8WA 2EAOA 4AP9A 4CP5A 3FCWA 3ZTOA 1N8RT 3RSEA 1XBWA 2QMWA 4FPBA 1FDDA 1BOTO 1U6FA 2NUUG 1IBLF 4OYMA 4TYAA 2YPZA 3KYLA 4M3WA 3C66A 3D2WA 3Q89A 4J9LA 4RW9A 1N5YA 3KLFB 2HHSA 3IBPA 2HSEB 1HFEL 1F0XA 4LF1A 4TY8A 2W40A 4CGFA 3MPYA 1W0HA 4Y2TA 4Y65A 3JPPA 2IVOA 1TKZB 3C6UA 2B8QA 2K8AA 5ALZA 1S1VA 4GV6A 1HQUB 4EHUA 2OUGA 1ZQGA 2R7SA 5A8WB 1FJGK 1HA1A 3FBCA 3R5CA 2B9XA 4A47A 2DFLA 3IS9A 4JBCA 2W7AA 3ULDA 1RAHB 1J9AA 2P66A 3KD1E 5IT9Y 4EI2A 4BC4A 3BQ2A 5ETPA 4H5TA 1SJRA 3NOCA 2MDAA 4DR4J 4DR3K 2KJ9A 3KLFA 4W98A 1N34J 1X42A 1GT8A 4Z2XA 3K9KA 3M9NB 3DOMA 2W4DA 3PO5A 3CCVN 5JJBA 1T03A 3MGIA 5F0WA 3HVTA 5ETVA 3TTDA 5TKWA 3PACA 3G82B 4FOEA 3KWIA 3KTQA 2AJQA 4IXCA 2JNJA 4Y0FA 1HHTP 4ED7A 1KW4A 3A13A 4P10A 5DBBA 1EXQA 2J9DA 4Y2KA 1QZ6A 5IT9O 4RPZA 2GUIA 1ROFA 4KPYA 1R8BA 2DY9A 3NWGA 2DGZA 2Q4TA 1RT6A 4DPOA 2W41A 4Y2RA 1OQ3A 4U6PA 4TLQA 4O3NA 2DH7A 9ICGA 3RAMA 2LFVA 1Q4RA 3MPUB 4J9UE 1P1TA 3L09A 3ZTRA 4AD6A 1U1RA 5DM7L 3UXNA 3L3VA 3FC9A 2O8BB 2E1PA 1VYAA 4BR9A 4UATA 5GVQA 4DUYF 3VAMA 4K5RA 1S5JA 4WTOB 3CWJA 3OR2B 1EQYA 3DRSB 1S6UA 4P2SA 2XSJA 5CA5A 4F3TA 5BPNA 2N7CA 4OHZA 5AR0A 3V4IB 2LPEA 1HNXK 1S97A 4DTSA 2GGPB 2YHWA 4DG1B 4QNLA 2IDEA 4YCXA 2OELA 4ZP7A 1SKSA 3FBFA 2UUBF 4RQ6A 3MN5A 1RCHA 2WF9A 2JRSA 2W43A 1M1KT 1VQ9N 2KKHA 4DO9A 9ICKA 4ANCA 3WDOA 1YBUA 4BRGA 4L6V3 1QQ6A 2VDIA 1SV4A 4RO0A 4YY3K 3SQGA 4CM2A 3EPIA 3GFZA 1PK1A 3D9BA 4PKIA 4ILJA 3POTA 4Y3CA 4WFAQ 2BACA 2IOHA 4EUVA 3VVUA 2AJ2A 3A0HU 3CTRA 2Z7JA 3PY8A 5GAGU 1SQKA 4CO3A 3PR4A 5KG2A 2YHXA 4CHOA 4KQZA 4IQVA 2CPZA 3JSBA 2MXYA 2NRXA 4BJQA 4PHEA 3US5A 2DNOA 3AJ1A 2HNZB 3MM6B 3V6KA 5LMUK 2VDHA 4WTYA 1IBMJ 3DV9A 3ZDBA 4LF9J 1Y9OA 3SNNA 4HHJA 5B66U 3T6BA 4I2QA 2C1EB 4BUGA 2K1RA 3DHXA 2KW4A 1TYQA 1RHRB 2YXLA 2E5GA 5ALSA 3I56N 5KGWA 3TEHB 1WOSA 4LFCF 4DHYA 1WKKA 2ZVIA 1JMTA 2F1FA 1TMJA 1FK9A 4Y2IA 3NVYA 3QT7A 3MAAA 2FIUA 1F3FA 2ZZTA 2ACMA 1ITPA 2BTFA 4K4HA 5EOZA 4OZ1A 1RU1A 2DR6A 3NWRA 3WKEA 5IQ6A 3TANA 4K50A 4DLEA 2H48B 5BN9A 2XI9A 1IBMF 2HEKA 3F9KA 1P27B 1N33F 1A7GE 4DR1F 2FVQA 4JK8A 5L9NA 1ZXOA 2VQEF 1H0HB 3IWNC 2QX0A 1RBUA 3CIPA 1BISA 4H0OA 1HR0J 2BM1A 2DFFA 1KWMA 5LSLA 1XMBA 2FLLA 3K1ZA 2ZTCA 5KG7A 1LWCB 4QAGA 3NASA 4L3NA 5KFTA 2QLBB 3DKDA 1IJJA 3K0SA 1YBAA 4DR2K 3EVMA 5LMNJ 3T1HJ 3PJ9A 3T9NA 1OQ6A 2Q1NA 1FD8A 4KN4A 4KBIA 4P7VA 5LY3A 1RT6B 3O08A 2M8DB 1WG8A 2XO7A 3UQSA 4EWTA 1HJRA 5EX0A 5DM6L 2PN6A 3GMGA 3QUTA 3PYGA 3MTJA 4TQRA 1WTFA 1A5WA 2W04A 2WONB 2I8EA 1LWCA 5HVHA 1YRXA 1X8DA 2JZ5A 3TQEA 1X66A 4Y2MA 4ZPVR 4TXSA 1U04A 4C8NA 1WCNA 4BX9C 4ZJOA 2NREA 2D0OA 3HPHA 4ISFA 5J2JA 8ICXA 3KKAA 3CMAN 1DJ0A 2OPQB 2D6FC 4HCBA 4A46A 3EGNA 5AQSA 3FEXB 2GGPA 3UCUP 1OJ4A 1Q86O 3THPA 2DCLA 4AL7A 2AEFA 3EWGA 3DRPB 1T7PA 2ZF5O 1W25A 4UQGA 2GVDA 2XY6A 4JKGB 4CGGA 1F5SA 3O9SA 3O5TB 4FO6A 1DK3A 2L3MA 4BREA 1RAFB 4F4YA 2PYLA 3UKRB 2MU2A 2RDDA 5KTQA 2FHKA 4J2AA 2VGMA 2ZOFA 4YMNA 4EEYA 1VQ5S 3HVWA 2MAXA 4USWA 2YKPA 4Y2YA 3VGVA 2AMCB 2RKIB 2VIXA 3H5SA 1VRQC 4DQSA 2BE2B 2DXFA 3O9QA 5J2PB 1U2RA 2JEIA 2YNGA 3DRPA 4OI4A 4NZ7A 1RT7A 5DS7A 2K4PA 2QWNA 2V68A 1U8SA 1FT8A 1SWVA 2V8GA 1T8EA 3CCUN 4ZTJA 2EZXA 4FCYA 3LO3A 4ER8A 3P49B 2BVZA 3RRGA 3C0BA 5H9EK 2ZE2B 4ISEA 2LXFA 2RD5C 3VQCA 2VUGA 4AM7A 1HLUA 3O1BA 2APOA 5GMDA 2W4PA 2NSCA 5J2EA 5CZ2A 3LYSA 3CCLN 4FJ5A 3MEKA 4QS8A 4H0PA 3A0BU 3TOQA 2Z1HA 3D3BJ 5EN1A 3FZHA 3QQCD 5A2QO 4O8UA 3H8SA 3L2UA 2QMUB 4X62K 2XG8A 2HVDA 1D8BA 3WBZA 5HL7L 2G0CA 1FK9B 3MF5A 3VQ8A 1CJKA 3WQUA 5CHCB 1D8LA 5F9NA 1G99A 2HRUA 3OUYA 4IO1A 2GV1A 8ATCB 4Y28C 4Z6CA 2Q1LA 4OYAA 1ZETA 4DV4J 2UXCJ 4ZPCA 4ILLA 4Y2CA 1N5VA 3OS2A 1KNZA 3HHLB 2KXHA 2HYIB 2P6SA 5CXTA 1UHUA 1NGDA 4F3OA 1HNZJ 3NGIA 4YY3J 1BNOA 5B08A 5J0RA 1T6CA 3CDEA 4DL6A 4XPEA 1YJ9S 1Y7PA 3QINA 3ZT4A 3EYZA 5L1KA 4TU8A 5KOXA 3BKTA 4M0AA 1U1OA 2OFGX 5CYMB 5BR8K 1REVA 3KG0A 3V7LA 3G8QA 3G8SA 1A0OB 4IRKA 3KUGA 4E1JA 2JHDA 2PFPA 3FR0A 2HF3A 2WC9A 2FDRA 1WOOA 4ZDNA 3G6EN 3HSZA 4KB0A 2JC1A 3NG8A 3CJ4A 4DCOB 5F41A 3ZZRA 4RWXA 1RGIA 4U7UD 1RDAA 1ZBUA 1YJWS 2OD6A 3HKZC 1K0VA 5KFLA 2B9YA 4YB5A 1IXKA 3QMLA 4RUCA 4FBTA 1JLCA 2OTJS 4IDKB 2UUAF 1HX1A 1RB0A 1CG2A 3K9JA 2H5JB 5JTIA 4O44B 4XH1A 2AHOB 2Y0SC 3RB0A 2VA2A 5M2RA 2ZFHA 5KFPA 2FVPA 1XNQF 5HLFA 2KRBA 1JJHA 4CO0A 2WZ1A 3IFRA 3E8OA 1RTJB 4GKJF 3TVZA 5KG1A 1YJTA 2P9PB 1I94F 2ZOGA 2AX0A 4RKUC 1AUDA 2ZH7A 2BJEA 3JPOA 8ICNA 1WG5A 5DETA 1RYRA 1DXSA 4W5TA 4AHCA 2A1JB 5E3AA 3VCBA 3M3ZA 4OLBA 2HWTA 3GG1A 3BUZB 1NKEA 4MFCA 3OYAA 4O55A 6AT1B 3NF6A 2AJ1A 2K3IA 2FMQA 2F7TA 3VF2A 2MSTA 4PXEA 5J2NB 4M3RA 3O3FA 1U48A 2KIWA 3MEGB 4K42A 1I3AA 4BDZA 3SI6A 4DV6K 2FPKA 4E8UA 1S6QA 2ZGYA 3R5GA 5IWAJ 3DNCA 1VHFA 3MMAA 2R7VA 5AQKA 4QW8A 3OYEA 2ACYA 3CM6A 7FD1A 2YKNB 4USJC 3GZFA 2MHNA 2WF6A 3CCSS 3JS6A 3TWHA 2ADBA 2KXFA 8ICBA 2KSOB 4CEAA 2ZH8A 1Q81T 1Y00A 5CA7A 4NCAA 3N0VA 3VA0A 3FBEA 3NL0A 3MX5A 4FJNA 3DDIA 5F9LA 3UN3A 2X7IA 3MEGA 5J0OA 4MDBA 3TVYA 4EAHD 3AD7C 1KKHA 3HHKA 1NEEA 4K8XA 3F2DA 1D1UA 4P73A 1KLNA 1W7AA 5J2CA 1S1XA 4YQWA 3QNOA 4IO9L 3LVVA 1U1QA 3G6XA 2OANA 1T9VA 4KY3A 5AQLA 3HW8A 2DVIA 1JNZB 3H1VX 1XMQF 4FF4A 2GHPA 4OX8A 4GVMA 5JICA 1TE2A 2G4BA 2Q36A 5DQHA 1KVKA 3IC1A 4K7QA 2D3DA 1K1SA 4JS4A 5KG6A 5IT4A 1SGGA 1PC5A 3WEEA 4IJNA 2IM2A 3V1OA 3W3SA 3PYEA 3ENOA 1ZQVA 1WC6A 3V2UC 2YY3A 4BVOA 1UVIA 3F9MA 3KZIU 5ALFA 4OKKA 2LU1A 3TZYA 1ECWA 2OMLA 5SZTA 4C3MA 5IV3A 5DZ7A 4DTXA 4KB1A 3ED5A 2VJ4A 2CG8A 3MM8B 3DM2B 2KG5A 2K7JA 4IQUA 2QL7B 1N5YB 5AKHA 1NJYA 1A6SA 2XHCA 3VAJA 2HRTA 1BUXA 1MMNA 2Y8YA 4CZHA 3I1YA 3WXLA 2ROPA 4CJQA 4PKHA 2OEKA 3CG7A 1KD1O 1U47A 2LVWA 4NEYA 2IBOA 3HZ6A 2MQQA 3CM5A 1F5AA 3SMZA 4EEKA 2YHBA 1COKA 2OFHX 5ALNA 3ADAC 4ZVHA 4CWBA 4FXVA 4DV0F 4B02A 4B3TF 2K60A 3GJTB 5HVGA 5FRMA 2JC0A 4F2RA 5KFGA 3V6DB 3SI8A 5AIBA 2ZH5A 1UVLA 3AHPA 1NLKL 1RG6A 3N6LA 1RTIB 3P38A 2HHHK 1R31A 4A8OA 2WVBA 4FK0A 3D1QA 2DRAA 5DDMA 4NOHA 1ZD4A 3BS5A 4L74A 3LP2B 3GIKA 2ZH2A 3RW6A 4IC9A 5A0YA 2PY5A 1C7YA 5I3UA 2BQ3A 1X31C 4IH5A 1W9HA 3SSRA 3J7Z5 3CMEN 4FJGA 2ZXIA 1KAYA 2ZJQL 3IBFB 3GWCA 3VGKA 2DNKA 3BS7A 2F3JA 1Y5NB 3M32B 3VF4A 4ELTA 3M9OB 1FRXA 4QJFB 4GIBA 3I56S 3GIMA 4NLPA 3G25A 1ZQHA 2P6TA 3ID6A 2DR8A 4ZCIA 4UAWA 3C29A 2UUAJ 3AO4A 4U67L 2KN7A 3SCXA 4LF4K 9ICPA 3BBFA 1R0AB 1E3MA 5KPTA 3VERA 1YQHA 2YB1A 2WFBA 4OJ5A 1C1BA 3V7JA 4G6VB 1JXVA 3VQEA 2RQKA 3IRXA 3TUZC 1ZQIA 2C2ZB 3C46A 4FLUA 5AFUH 1NGFA 4URQU 2DGWA 4CLWA 3H2VE 4QZIA 3UDLA 3MR7A 1SQFA 4KV8B 2IAJA 4DR2F 3FFKB 3E9LA 4QZHA 1CULA 3H0PA 2MGZA 2P9LA 2UUCK 1OUQA 4BGBA 5BREA 3ZEUA 1OYEA 3H98A 4LZDA 5GADP 3J7YU 1DLOB 2W1BA 4ZVUB 2WK4A 2VOOA 4M9NA 5KFCA 4E7IA 2E1ZA 4RWTA 4FJHA 2LQ9A 1LWFB 4BGDA 2FC8A 3MEEA 5HROA 1S10A 1RSCA 3M1VB 4C8KA 3C7NB 1ZM4A 1FNMA 3L2RA 2C22A 2Q3PA 2IDLA 4L76A 3FMBA 3KWGA 3CMES 5CQGA 4BRMA 2LM4A 4F3MA 8ICFA 4DR5K 2CAJA 5F3ZA 4ETXA 3LK9A 3SUQA 2PGCA 3DXKB 3O9UA 1ZAVA 3H8JA 2GMJA 2XEXA 5ALJA 3GCXP 4JYAJ 3K5MA 4KLLA 3MM5A 4XDDA 2GIRA 2OZMA 3BJYA 1T94A 1S4FA 2A5XA 4ZVRB 4B6JA 4NX9A 5D4OA 4OYPA 3BKFA 1S4EA 3M6XA 2V63A 1UVMA 3M2UB 3RGIA 5TKYA 1OY6A 3HJFA 4KLHA 2B6AA 3PEHA 1EJ7L 4UQTA 3GYXB 3MUTP 4BACA 2BEFA 2ZIWA 4OJRA 2OPSB 4F4AA 3A1YG 2PXIA 3HSJA 2YVSA 1K9MO 2P9EA 2VFVA 4KLUA 5J1EA 1RBSA 2MZJA 3OTOF 1RXVA 2OPPA 2DHGA 3S6EA 4F4KA 3FSXA 1SJFA 1M5PC 2UUWA 3MM5B 3V72A 1LW0B 2Z58B 4K4TA 2NRTA 1RDUA 1HBMA 4RQ5A 1RQ0A 4ZA1A 2F8EX 2AZ3A 3M8QA 3AO1A 1R6YA 1U4BA 1HR0K 1EZZB 1EB0A 3VMFB 4K4UA 1HEKA 2EDUA 2BXJA 2JXJA 1AROP 3EZWA 2ZC4A 3SCLE 5I3UB 3VQQA 1N54B 4PGXA 1GXLA 3MWTA 4CZJA 1SC4B 2AT1B 2LLZA 4PXBA 8ICSA 2J0SD 3EDQB 1XUPO 2B5JB 2PKEA 2XYHB 1GLCG 2P9PA 3QERA 3AQFA 3ZXWA 1DTTA 4KH0B 4FLYA 4RU9A 4GVBB 2P35A 2EXUA 4WP3A 3E51A 3LP3A 1QVGM 1VQ7N 3O0FA 2E1YA 1S8OA 2JWKA 4KI4A 1OPZA 1SIZA 2G5HB 3VQDA 2IGIA 5I4MA 3EPGA 5EWFA 4UASA 4WP9A 3ZO7A 1KVCA 3HRGA 1QSSA 2AIRB 1EARA 3VQTA 2W9BB 3L2QA 4DL5A 2D41A 4QR1A 3ENHA 4J9SA 2DGTA 1QCKA 4B3SK 5HN0A 2C28A 3JSYA 4IOCQ 1RILA 3IRXB 3C5FA 1T4GA 1VI7A 8ICVA 3FGVA 4A2BA 2CNLB 2MKKA 2GQCA 3GDXA 3D6MB 4QOTA 5E7OB 1N48A 4TU7A 3KLGB 2ASYA 5M1FA 1UJ4A 4C1NK 4C3LA 1RXWA 2E20A 1C2PA 1A9NB 1NM2A 1NJWA 4QPXA 5AJ3F 5AXMA 3HVAA 1TK5A 4CBWA 4YXMA 4ECSA 3LWMA 2KOBA 2KSOA 1NGJA 1RT5B 5M2UA 5JVHQ 1ZQSA 2FZKB 4BC5A 1FWLA 2VBYA 2UUBJ 2BGWA 4O0JA 1L3KA 1N5XA 1BPZA 1T9TA 2HVZA 4FLVA 2XLJA 1U0HA 4F26A 2BDPA 4U7UK 2HHHJ 2DO4A 3SUPA 4QIWF 5AQGA 1KR4A 4EU0A 1KQSM 4LREA 4IQXA 3EZOA 1VIXA 4KR0B 1NH7A 2DY4A 3M2VB 3A5NC 4X4RA 1NK8A 2AGOA 4CRXA 2J0QD 4JI4F 2E1FA 2RRBA 2JEFA 3B0XA 4MIWA 4K0KK 1T05A 5MLCQ 1ZQWA 3N01A 3SMVA 3WK7A 1Q46A 4FWNA 3RSEB 7ICVA 3SQOP 4MO4A 3HKZF 2LBOA 3NMAA 2ZHAA 3MR6A 2A3JA 3L6QA 2GWJA 5EWGA 2W2QP 3RJJA 4QZAA 3N7RC 3DLRA 1CUKA 4WYBA 2P9CA 2I5HA 4DV0J 1XERA 2H51B 5LXYA 3PSIA 5KL8B 8RUCA 4B1XB 2HMIA 2ZNYA 5DGAA 2E2NA 1NHVA 1FJEB 5E41A 1WSVA 1IBKF 1JKHA 4F72A 1BPYA 3FEYB 3H0RB 1TL7B 2NRRA 5KFJA 3QFWA 2ZIUA 3W9IA 3RR7A 3FDSA 3EZUA 2G1DA 3L3CA 4OI6A 2WMMA 4HHUA 4C8LA 2YX4A 2AP1A 1CS4B 1HD0A 3OJSA 4EENA 4BRNA 8ICKA 2Q3SA 2HBQB 5BJRA 4CEBA 2QA4S 2Y1IA 1U1NA 1P1LA 5IOLA 1LKZA 3CC2S 3Q8VA 2NUHA 3WHIA 2XGQA 1ZM2A 1O03A 2QA2A 3MN9A 4J7CA 3BBCA 2NPIA 3ZSVA 2VQFJ 4JK9A 1BWEA 4USAA 5GAEI 4CO4A 1F1BB 2V6AA 1IR2A 3R1LA 1MWZA 3J80U 2L9DA 3H7HB 2Z1IA 4M45A 5LJWA 2PEHA 3CXCR 4A8WA 2QW9A 1HQ2A 3WQPA 4LRAA 5L1JA 1U45A 3X3UA 1EHWA 1VFJA 3BO4A 4YD1A 4CECA 2XICA 1Z00B 4CF9A 1SV0C 4AYBF 2PA8D 1KS2A 1ZQYA 3OR2A 5AIAA 4G3IA 1KVBA 4FJKA 3NGTA 2YCHA 3TR8A 3HYFA 4LBIA 1QQMA 4FN5A 2V2VA 2KJWA 4KTZA 3THWB 1W2BM 3CCWA 2XWYA 3JTPA 3N5BA 3K58A 1Q53A 5AQJA 1BIUA 1WSGA 1HIYA 4DPYA 3ISZA 4MN4C 1FTCA 2XO6A 3W5XA 4DQRA 1IQZA 3U02A 3F5TA 3Q8LA 3SIPB 5E33A 5HBMB 4BVPA 1Z4NA 1CZBA 2QKKA 3SQ2A 3P5TL 1RT5A 2EFVA 4KGVB 3OYCA 3G71N 2JLGA 1HLWA 2V7ZA 4FZNA 3BN7A 2HQCA 5ETRA 3ZSQA 3D0IE 3H4BA 3FMWA 1Q86T 4M3XA 1LAVA 3Q8SB 4RQ4A 3CHWA 3HP9A 1UW9A 4IFYB 4IFEA 2FBXA 4M63C 4DUZK 2CJBA 5BRHA 5AE2A 3L3UA 4FNIA 3KDOA 5JVGQ 3AA8A 1IKWA 2ABYA 1NU4A 1A6LA 4DU4A 3JTOA 2IM0A 2ILZA 4RW8A 2X51A 3Q8MA 1CC7A 1QUPA 4QIFA 1U02A 5JU5A 5K5MA 1TUWA 5DK5A 1VQMN 3UMCA 4LRCA 1H7XA 4RQ3A 3KHRA 1FJGJ 1V3RA 1X40A 2QLXA 4M5GA 3DI6A 1UFWA 1WWVA 4FWMA 8ICJA 3AAWB 4CZIA 3AO5A 1KCFA 4MK7A 4KHUA 4FWOA 3ZZPA 4UOGA 3T3FA 4XAKA 3TNVA 3LP0B 1HUOA 2MSSA 2YWWA 3D1HA 3DXKA 1JJ2M 4F5RA 2M3DA 4JI5J 2F8TA 1H7WA 5FIIA 2EZZA 3KK2A 4QZFA 4DV2J 1FJ7A 5F3XB 4PXDA 1NU0A 1IJEB 1VSHA 5IS2A 3VESA 5KFDA 2FY8A 5FD1A 2P9IA 2BUPA 4GKKJ 5B0BA 3K4GA 3CEDA 4OX9K 2HS3A 3QIOA 3PSTA 5HSPA 3LOUA 3D0PA 1J2VA 4EO6A 3IR6B 4IO8A 4C11B 2QWLA 3AD9C 3BF1A 1SC1B 4EHTA 1RT4B 4UOCA 2Q6BA 1JROA 1XSPA 5D4NA 1ZQ1C 4WCEQ 1NZAA 2EK1A 3EWAA 3D4JA 3VF0B 5DO2A 3I5AA 5DGBA 3C2LA 2FUG9 3OYNA 3E66A 4QWBA 2XCAA 2DFHA 2IMWP 2BKOA 3LP1B 4ZVGA 1XU4A 2K3KA 2MQ8A 1HKBA 2YNIB 1ZBSA 1YTYA 4I7FB 3Q8QB 1RBOB 4YB1P 2EC0A 2B0GA 2RN2A 2Q0UA 9ATCB 4QZ8A 4CT8A 1U7LA 5FLXU 1MMDA 4TU9A 4FO0A 1YTAA 3VEWA 3V81B 5J2DA 4RNMA 1WTBA 2KFYA 5T7LB 2ASPA 2FQQB 7ICLA 1VSEA 4JI0K 5KFZA 3BR8A 2WVCA 2WRMA 4FWKA 1VR6A 4CEEA 1NDKA 2ZOMA 5DQIA 3GJRB 4BY9C 3TSPA 3I31A 3PMNA 3GQCA 4X64J 5L39A 3RJHA 2WB1D 3W5YA 2K1RB 2LDYA 1IKYB 1X6IA 2DR7A 1NB7A 2QGFB 2NRVA 4PRFA 3CCSN 3HMJG 5CD4A 3VGMA 4X2BA 1YGYA 2KMDA 3DU5A 5J2KA 4CLZA 1B9FA 6FD1A 3HM9A 5HL7Q 2UXDK 4JKGA 2FGOA 2Y1RI 2J8AA 3UPFA 4KI6A 3I96A 2QJ3A 4FW2A 1B64A 3NUQA 1B0VA 3UPQA 2QRRA 1FE4A 3W1YC 3TKAA 4PG4A 2KL8A 4WWSA 3VQSA 4CESA 3T5KA 2ZG6A 1YIJN 4TSXA 2YHAA 1E6YB 3PX6A 4HVZA 4USVA 5AQUA 4JB3A 4DL4A 1WI6A 1KTVA 3ZI4A 3QBWA 3A5LC 3KHLA 1F3VA 5KT2A 4EBDA 1OWXA 4Z6EA 1N56A 4JI5F 5GADU 4N41A 1WAJA 1GQEA 3OTOK 1YI2S 2BHNA 4LF8J 1VQNS 3EKUA 1S1WB 1Y0HA 2E5HA 2QLTA 4RW6B 4QU7A 2HKEA 4CLPA 4KHPF 2M88A 2WCXA 1AW0A 5KI6A 1BQNB 1YT3A 3ZEUB 2I7PA 2DWQA 4KX3A 4JI6K 4K4ZA 4C23A 1NOMA 2J0WA 3HOSA 2QWPA 4JEPA 4ZTFA 2YJFA 3EJMA 4OFZA 3V5RA 4QS7A 1SC6A 1OH8A 3CQYA 4LSNB 4DUZJ 5K14A 1EWRA 2NZCA 4JI2F 1VQ5N 4J37A 5B0DA 1XHXA 4CI6A 2I5JA 5AM2A 4ECWA 1X60A 1VS3A 2LYAA 5HMYA 2GAGC 4IZ9A 4OYWA 3O1LA 1NSKL 2XBPA 4CZCA 4M6WB 1VJQA 1BG3A 2O8BA 2MYFA 2VKRA 3E3XA 2NCKL 5AE3A 4PCQA 3UM9A 4AE5A 4ATNA 4UB6U 4K25A 1UFKA 1XNRK 4GO5X 3TADC 3F0NA 3VEOA 3ZD9A 3MD1A 2Q43A 4M3YA 2O8CA 1WHWA 3BREA 3ZZZA 3NAEA 4E7JA 4EYIB 4HACA 3MMCB 2HGLA 2ADCA 4KGXB 2EKYA 4H0VB 5KFVA 3MN7A 1UOCA 2R2RA 2JR5A 2DRBA 4GKKK 3D2NA 1QJHA 3SBTA 2JMGA 3FC4A 2DGOA 4I9QA 5G5GA 4FK4A 1JCGA 4KHNA 5E84A 3SQGB 1NZBA 1DRGA 3QZ8A 2MKYA 4DFJA 3MXMA 4ITSA 4C7YA 4QJVA 1GLJO 3GILA 1FEEA 1WC0A 3RMBA 3IXQA 4RT3A 8ICMA 2RT3A 4R5PB 1VK3A 4TY9A 4X4UA 1ZD5A 4M04A 3THXA 4YMEA 4KIAA 5AZJA 1ZQZA 4MMOA 2VASA 1E4GT 1YJNS 3NKYA 5ALGA 2CNOB 2HHVA 2YJEA 3UKUB 3H2LA 3ETRA 1ATRA 3L4QA 2P9SA 5GIPA 4P0QA 3U6FA 4ZPBA 4ERDA 3D5MA 4F92B 4WQ5C 2ZIXA 3GIRA 4DTJA 3WEEB 1T6DA 3M8PA 1XMOF 4UY8T 4JI8F 5C2GA 1D8ZA 1NGIA 1NK6A 4ZH4A 1P90A 4BE0A 3MM6A 5JS2A 3EZ5A 3PUFA 3AA2A 1QH9A 2X78A 1RTJA 3N7PD 2QKBA 4YFKA 4OX9J 4JI0J 9ICJA 4BE2A 3HSTB 3K7RA 4KGMA 5ALYA 3KJVB 4QWEA 4KE5A 2F8SA 1WSHA 2WF8A 3TA2A 3KZXA 5LJVA 1U6ZA 2ZH6A 2LQJA 1T02A 1ZC6A 4MQ3A 4DF4A 4PY5A 1ZQAA 1BA1A 2P9NB 1FHTA 3OS0A 3CO9A 4BRLA 3ULEB 2VWBA 2NYIA 4MJKA 2K4IA 1MG7A 1R8AA 3ELHA 3QGIA 5AE1A 5KFAA 4DL3A 2K8GA 4JKFA 2CNKB 3R1HA 3ZDEA 2JFDA 4ZVTB 1ZJNA 4NLYA 2VBWA 1S7HA 2HZCA 3R8YA 1TUUA 1HQUA 2Y3YA 2KKVA 3MDFA 4KRFA 1YBTA 3ZSOA 3HD1A 4F93B 1BE4A 1OMSA 3HVRA 3BO3A 4O4RA 3L9ZA 3C3LA 4M47A 1I39A 3W8PA 2NRWA 2E5IA 4RT2A 2DXEA 1VISA 1HNZK 1C4CA 4AILC 1U1KA 3AXKA 3W2VA 3TJ8A 4IDKA 3T9ZA 2B43A 1M90O 4PUOB 2EPIA 2JVOA 4CJ4A 1LFWA 2UUBK 4Z4EA 4JRQA 3KOAA 3BY5A