1NJWA

Guanine-thymine mismatch at the polymerase active site
Total Genus 211
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
211
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA PRIMER STRAND
publication title Structures of mismatch replication errors observed in a DNA polymerase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 211
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2003-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1njwA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1njwA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1njwA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1njwA01
3L2RA 1EX4A 2DPJA 5BOMA 1RT1A 4N47A 8ICVA 9ICCA 3AVMA 2G8WA 4ECVA 3KHHA 4RT3A 3LWLA 3KLEA 1ZQJA 5L1KA 1TKZA 5BPCA 4BXOA 4AHCA 3G6XA 2ZJ5A 2XGQA 3QZ8A 4C8MA 4NM1A 3SUPA 4IG0A 8ICSA 4YMOA 4ELUA 3QZ7A 1L3UA 1HYSA 5DKWA 1RBVA 1ZYQA 3RWUA 3ISNC 1K6YA 2GUIA 1RTDA 2VANA 4O3SA 3ZT4A 5J0QA 4FJMA 1RT6A 3LDAA 7ICVA 2ZTCA 1TAUA 7ICQA 5IIJA 3QEVA 1NJXA 2B5JA 2ATLA 4DTRA 4IQUA 1NK5A 3DLBA 2HNZA 1UAXA 4J9LA 7ICLA 1RT5A 4DMNA 2IS3A 4C8NA 4YD2A 4TSXA 4XQ8A 1KLNA 4R66A 4M42A 1A5WA 3ZSVA 3I8DA 4FM0A 3PUFA 1C0MA 3RH6A 4CJFA 3VQQA 8ICNA 3OHBA 5KFAA 1BIUA 3PX4A 1ZQQA 3V9ZA 2KFNA 1WSIA 3UXOA 3RJKA 4DOBA 2FPKA 1MQ2A 5CA7A 4CK1A 3L2UA 2F8TA 5KFMA 4JRQA 4FW1A 9ICRA 5J2DA 2BKEA 9ICJA 5KFIA 4FLWA 3GDXA 5EU7A 4RPXA 1IKXA 4CCHA 3KK2A 2QKBA 5J0RA 5DGBA 4YFKA 3C6TA 4FJIA 4AH9A 1O1WA 2NRWA 3RB0A 1VSHA 9ICOA 4L8RB 1RTHA 4Z6CA 3RB6A 4CF8A 1KRPA 3O4QA 4K8ZA 5DLFA 3OYKA 5J0XA 3B6OA 4M9HA 3WNGA 1JMSA 5KFLA 2ISPA 4YD1A 7ICGA 1S0NA 4I2JA 3TI0A 2JEGA 1NJWA 3C94A 4KITB 4RZRA 2AGPA 3L2WA 3P5JA 3PX6A 4CJ5A 4FK2A 3SI8A 3Q8KA 1JL1A 1QS4A 4RW7A 3LALA 2ZUCA 3SUQA 4RPYA 4NY8A 4JRPA 3V6JA 1IH7A 2AJQA 3K2PA 1C0TA 2NRTA 3LAKA 3K59A 5T7BA 1BCOA 5J0UA 5KFOA 3IRXA 3TAEA 4F50A 4RT2A 3KD1E 2D0AA 4HCBA 3ZSXA 8ICAA 2X74A 3BJYA 3QETA 5CR0A 3VQEA 5KFFA 4KHWA 4AILC 5HNKA 3ZSQA 4CJKA 1HNVA 1BCMA 5KFEA 1QQCA 4H4OA 2G8KA 3ZT2A 3L2QA 5DMRA 2BPCA 5F9LA 4KREA 2OPPA 3C2MA 3MECA 5HHIA 4FYDA 4F92B 1S0VA 4M3ZA 5J2CA 4QZGA 2R8HA 5KFSA 4ED7A 1W0HA 4KKOA 3M9OB 4CGHA 1DOQA 1N56A 2V9WA 4DQIA 1RBTA 2VG5A 4E89A 3O3FA 3NDKA 1ZQHA 3NF8A 4OKKA 4CFBA 4OLAA 4EYHB 1NOMA 3M8RA 3N4MB 3JYTA 8ICPA 4YMMA 4KI6A 4NLKA 4KB0A 5J2HA 1R0AA 2VA3A 4KAZA 3AUOA 3ZDBA 2D5RA 5C42A 5CYQA 4JLHA 2W9AA 8ICCA 1KTQA 4Z4HA 1S0MA 2HB5A 2HW3A 3ZSRA 1QSLA 4CGFA 9ICPA 4ECYA 4LZGA 1RDAA 4KLDA 1ZQUA 2VWKA 3C6UA 4JUZA 3Q8QB 1Z00A 1TAQA 3CQ8A 4PY5A 3PV8A 5KFZA 4FJJA 8ICUA 4PUOA 3T5JA 4O3OA 4C8OA 2AQ0A 4B9NA 3SI6A 4KHUA 4W5NA 2ZTEA 2H5XA 4KLTA 4N5SA 5I42A 4YNQA 1J9AA 4DL4A 1N6QA 2XY7A 4KHYA 3D45A 3V72A 1S0OA 3BQ2A 3AVHA 3DYAA 3T5HA 1ZQDA 4CEAA 1VSMA 3AA5X 3JPNA 1XU4A 4F2SA 4KV8A 4BXOB 4BGDA 3H8JA 1JKHA 4I2PA 2E6LA 1SKRA 8ICOA 4OPJA 1BPYA 1TVRA 1JLEA 2BE2A 2LSNA 4Q43A 2C2DA 4YFUA 3ZSOA 1N5YA 5SZTA 4MF8A 3SNNA 4F4KA 4F8RA 4YR3A 3BQ0A 3L3UA 1HMVA 3NF6A 3T5LA 4GXJA 2R7YA 4E1NA 4P4PA 3K75D 3AA3A 3V9WA 4Q45A 2AGQA 4KLFA 3WNEA 1D9FA 4CJVA 4DU3A 3RBEA 5J29A 3ZT3A 2UVUA 3KHRA 4G3IA 4F4YA 1WAFA 3RJHA 1BPDA 3LDSA 3QNOA 2PI5A 3AVBA 4KB1A 2VG6A 1HQEA 4UB1A 4CEZA 2MAXA 1BPEA 3H8SA 2GBZA 4DQQA 1W9HA 4K8XA 3MABA 4LZDA 4HUEA 2I1QA 3PW5A 1RXWA 4M3YA 4PWDA 3C95A 3AVCA 2XC9A 1RBSA 2FLLA 1KCFA 4DEZA 4DSJA 4B9SA 4ECXA 3NE6A 4IR1A 4RW6A 2BCRA 2QXFA 4ELTA 1Y97A 3OS2A 1TL1A 5KFWA 5I3UA 4ECZA 2DFEA 4K4GA 3SQ0A 3HP6A 4GXKA 4CJEA 3JPRA 4ECTA 3MFIA 3VQ4A 4Z6EA 2OA8A 4ED6A 4CF0A 5DG9A 4F4WA 4R65A 1SL0A 3NF7A 3UPQA 4M3WA 3DOKA 3ORYA 2G8FA 1Z26A 2IAJA 1CLQA 4KHNA 1DGSA 4QZBA 4DSEA 2Y1IA 3DLRA 1WCLA 3AO4A 4E7JA 4TURA 3ZT0A 5IILA 1MC8A 4OGCA 8ICZA 2BGWA 1WLJA 4FZZA 5L1LA 4YXMA 2NRVA 4DQSA 5J2PA 5KFJA 3V81A 3H4BA 4DSIA 5CHGA 4J9NA 4DFKA 3PO4A 2DPIA 4NM2A 2XY5A 2BPFA 4J9KA 3DLEA 4DL5A 3WNFA 9ICKA 4I2GA 5J2QA 4KN7A 2OPQA 1XWLA 1CEZA 4J9MA 4M9NA 1RPLA 4KLMA 4DWIA 3AU2A 4UBCA 4FLZA 4NCBA 2R8GA 2Z1GA 4RQ4A 4UAZA 1TVAA 4O9MA 3OGUA 3DLHA 1JIHA 2O4IA 4QWEA 2HHQA 5KRSA 1G15A 4NLZA 4UAYA 3VQPA 8ICKA 2FPLA 1FKPA 3ISCA 4KLLA 5L9XA 3EPGA 4Z4FA 4Z4EA 1S1UA 3V1OA 4QZCA 4C8KA 3HVTA 3NGIA 1RT4A 1NK4A 4FZXC 4ZHRA 2J6UA 4BE1A 3CM6A 4M04A 3C2LA 2B21A 4KN4A 1DTTA 4O0JA 1QTMA 4FO6A 1XS9D 5J0YA 3LK9A 4O5CA 5DB7A 4J2DA 2Q3SA 2I9GA 1D9DA 2PFNA 2RDJA 2WOMA 5HROA 2W9BA 5KT2A 4I7FA 4I2DA 2NRXA 2YNGA 4HUGA 4AHTA 1BVSA 1TKDA 1D5AA 5HHHA 4PQUA 3AU6A 3MEDA 4FJXA 4E7LA 4DG1A 4M9GA 4F5NA 1JLBA 4GC7A 3AVJA 1LW2A 3K5OA 3LP2A 1C1AA 3HYFA 1ASWA 2HVHA 4DO9A 4XUSA 8ICBA 1LW0A 1J54A 1S6QA 1FK9A 2RF2A 5DB6A 4RNOA 5J0WA 3QERA 5KFHA 1EP4A 3QEPA 4I2CA 4CHYA 3QEWA 4CGDA 3ZT1A 1RDCA 4ZH4A 1NJZA 4FJ7A 1NKCA 4E1MA 1Z00B 1IKVA 3GIMA 3TAQA 2Q0ZX 2G8HA 4CJQA 2BANA 8ICIA 3CFPA 3IAYA 4YCXA 2IMWP 5HRNA 4IFVA 3EZ5A 3THVA 1XSLA 2HHSA 1EETA 4DSLA 1ZQYA 3GIKA 1KLMA 4IBNA 3VQ8A 3KJVA 3SCXA 4CJLA 3E01A 1LB2B 4YN4A 1Q9XA 3UXPA 4O55A 4CIEA 1C1CA 3Q8RB 1B9FA 3GFKB 4Y1CA 3B0YA 4DSFA 5KFDA 3SYZA 2ZJAA 3PR5B 4QOZB 4B8AB 4F5RA 4QW8A 3SV3A 2UVRA 2YV0X 4ICLA 4OLBA 2NRZA 4B08A 2QKKA 1S1WA 4I2EA 1QSYA 3K5NA 2HHUA 4TUPA 4QZAA 3M8QA 3BGRA 3QO9A 1ZQNA 1RDBA 3AVFA 3A2FA 3ETLA 8ICYA 3PW7A 7ICUA 1UA0A 3NFAA 5J1EA 4ZTJA 1F21A 5J2EA 4M41A 3HK2A 4BWMA 5IIKA 4UB4A 9ICNA 4Z4IA 5CB1A 7ICSA 1V9PA 3FDSA 4EZ9A 3PW2A 5IIIA 2M9NA 5KI6A 4I2FA 4JK1A 2XY8A 4UQGA 1Z25A 3U3GA 4F91B 5KG5A 4HYKA 1A76A 3OYNA 5KFPA 3LPUA 4E3SA 1KDHA 4KRFA 3DRRA 3GV5B 1RBRA 2VA8A 4CGJA 2JLEA 5KT5A 1SUQA 4M3XA 1ZETA 4JV1A 1ITGA 3G6YA 4RUAA 3TANA 3VQBA 4RQ0A 4CEFA 3NGZA 1X2IA 5J2FA 4CJTA 2XY6A 1LWEA 4KLEA 4YXJA 2W9MA 1T7PA 1NKEA 3AA2A 1EKEA 3DI6A 5J2BA 5D46A 3DLKA 4CGGA 3GV8B 5KRTA 5E41A 4WE1A 4DTMA 9ICTA 4FCYA 4EZ6A 9ICXA 4KO0A 1X9WA 4FLVA 1S5JA 3PNCA 1RT3A 4ZTFA 1U47A 1DTQA 3SV4A 1GOBA 2IA6A 2OZMA 3K4GA 4CEQA 1U45A 1B92A 3G10A 2FPMA 4DQPA 5D49A 3AVKA 4M3TA 1JLFA 3KIOA 2AU0A 8ICTA 1ZQKA 3AA4A 4KHSA 4E19A 4LY7A 1YTUA 4FLUA 1ZQTA 3HPOA 4DF8A 1T05A 1JLAA 4GXIA 3H08A 4O5KA 5BOLA 1KFSA 5HRSA 3UQ2A 3ASMA 1GOAA 2DFHA 3AO2A 2FBVA 3LP0A 3KK1A 3NGDA 4R64A 1ZQMA 2JEJA 5CZ1A 3L2VA 1B43A 5KFQA 1NK6A 4DOAA 4FVMA 1BIZA 3RB4A 2XCAA 3V6DA 4ED1A 4DF4A 4DL6A 1QLNA 7ICEA 4CF2A 8ICLA 4CEBA 1D8LA 1ASVA 2PY5A 4OPKA 5DBBA 1T4GA 3K58A 2RDIA 5FRNA 3Q8LA 1S1TA 4JV0A 4KFBA 4GVMA 4I28A 4CJWA 1TL3A 9ICWA 3EYZA 4YMNA 1RNHA 3OYAA 3RMBA 1KEJA 4YQWA 1RDDA 8ICXA 2Z1JA 2IDOA 3VA0A 3PY8A 1COOA 4CJ4A 1IM4A 4IQWA 1WSFA 3AVNA 1WN7A 4RW8A 3V9UA 4C8LA 1N48A 5FRMA 4CHNA 4JS4A 2W9BB 4CK3A 3OYGA 8ICMA 9ICBA 4E7HA 1EXQA 4YR0A 1UWBA 2ITGA 4HVJA 5KT4A 4Z4CA 2BCSA 2VA2A 5KG3A 4AHVA 2HHTA 3ALYA 7ICOA 3NH2A 1HYZA 3JPPA 4ECWA 4R8UA 2FLPA 4MFBA 4RQ5A 1BI4A 3LZIA 4Q8EA 2A1SA 1IO2A 4FJKA 4O0IA 1RTIA 4OGEA 5J0OA 2P6RA 2DFLA 9ICSA 4G1QA 1NK7A 1TFRA 4KPYA 4O3NA 2GWSA 1TKXA 3VQ6A 3HL8A 4DL7A 1BPXA 1X9MA 5DQGA 3NGYA 3MR2A 3C1ZA 1IKYA 3JPTA 1XHXA 5JS1A 4LSLA 4I2AA 1T8EA 3TFSA 5L1JA 2KQ2A 5J2KA 1GOCA 4IR9A 3PW0A 5DG7A 3KLFA 3RJFA 1HJRA 2W8KA 1RILA 2C2EA 3MXIA 2UVWA 4RQ2A 3LWMA 2R8IA 4RQ3A 1SKSA 3FFIA 4Y1DA 5KFVA 4NLGA 2PXIA 3TAPA 2X6NA 5SWMA 4B9TA 1IXRA 2R8JA 3RMAA 5IIMA 5D3GA 2BQRA 4FXDA 3IM1A 3NAEA 3PMNA 1TK0A 1RTJA 3RMDA 1HJPA 4CJPA 4DS5A 1U9LA 4BDZA 3RJEA 1YTAA 4BDYA 2VWJA 4FJHA 1KVCA 2BPGA 3V6KA 3OYFA 4EP4A 1S6PA 9ICIA 3SUNA 4ED0A 5KFGA 4DOCA 3E2EA 4IQTA 1BPBA 5DDYA 2OPSA 2Y1JA 1C0UA 3K5MA 3AVLA 4GW6A 2X78A 4BWJA 1T3NA 4B9LA 4IRKA 3LP1A 4FJ9A 2ZE2A 4M2YA 1A5XA 7ICPA 7ICNA 3LAMA 1ZBIA 3SUOA 5EOZA 3T19A 3TAFA 3B6PA 1WSHA 3HT3A 5DGAA 4DS4A 4QWAA 2V4QA 1L3TA 4DLGA 5KFYA 4O44A 4MQ3A 3SZ2A 2C28A 4F3TA 3I0RA 4EEYA 3B0XA 2ASDA 4FK4A 1JXEA 4QZFA 1ZQLA 4K4HA 4ID5A 2HMIA 2JEFA 1CXUA 1REVA 3P83D 5DK5A 2ASLA 4I2QA 4E7KA 3OYIA 5C25A 5HP1A 1WCNA 4CHOA 3ZCMA 3M8PA 2FBTA 3KKSA 4NLNA 3CM5A 4DTXA 1NK9A 1C7YA 5DB9A 3OYMA 4KMUA 2BHNA 4QZEA 4KTQA 3V1RA 4O4GA 3BQTA 4F3OA 4TUQA 1HRHA 1U4BA 5DQHA 4DTNA 4RUCA 4CGIA 3M9MB 4Q5VA 3NTUA 2IC3A 3V4IA 3CFOA 3K5LA 2FBYA 4RNMA 4GMJB 2EHGA 4PA1A 3HO1A 1J53A 1A5VA 1ASUA 3HJFA 1KFTA 4M6WA 7ICTA 4J9OA 3D0PA 4KLOA 1S9FA 4CJ3A 4DFMA 2RN2A 2DTUA 2J6TA 1FXXA 3TQ1A 3H40A 3RJJA 5HBMA 3HWTA 2FMQA 1FKOA 4YVZA 2BQUA 3DRPA 5KT3A 3RJGA 3Q8SB 3CYMA 2P5GA 5DBCA 1VSIA 5J0SA 1XC9A 3F73A 4I2BA 2D0BA 3AVGA 2ASJA 2GV9A 4ECQA 4NCAA 2VG7A 1SV5A 4FJ5A 1RCHA 1RYRA 1BHLA 1XHZA 2C22A 3H7IA 1VK0A 4R5PA 7ICJA 5DDMA 2HNDA 1S76D 4EYIB 3QINA 3ZDCA 3QEBZ 3U3YA 3QEIA 5KFUA 2X6SA 3KD5E 8ICGA 1NK8A 4OKEA 3DM2A 1NOZA 4N56A 3RRHA 5JS2A 4XIUA 4AHUA 3V7KA 1LAVA 4UBBA 1ZQAA 3OYEA 2AGOA 4QWCA 4F5OA 3EW9A 1BQNA 1VSJA 4RNNA 5CZ2A 3DLGA 4DU1A 1I39A 1K1SA 4QWBA 4M47A 3RBDA 4QWDA 3NH1A 4CHQA 4CEDA 4KTZA 4BACA 4PGXA 7ICMA 1VSLA 2F96A 2PFQA 2G8UA 3LP3A 3H8WA 1XSPA 4PHEA 4FLYA 2DFFA 4RW9A 1L5UA 2JGUA 3KLIA 4R8UB 5KFCA 4PPXA 4YR2A 1BI4B 3MFHA 3HP9A 3MDAA 3HVRA 1VSEA 3Q8PB 1UT5A 5KG2A 1VRTA 1TK8A 3AV9A 2KZZA 3TAMA 4KLJA 4F5PA 3SQ1A 3TR8A 1YT3A 1IG9A 1Z3EB 4PH5A 1RYSA 1HNIA 4J9RA 3KKRA 4B9MA 3S3NA 1S9EA 4YP3A 1ZJMA 1S9GA 3UIQA 4MEXA 4KLIA 2FMPA 2YNHA 4M9JA 3QIPA 4F2RA 4QW9A 4F5QA 4OJRA 3MBYA 2OYQA 3RRGA 2ZJ8A 4I27A 4X5VA 3VQDA 3CG7A 2FMSA 2XRIA 2BR0A 1ZQBA 2OWOA 3PVXA 3OYDA 4Q8FA 4CK2A 3C23A 4KTWA 3PW4A 3PR4A 1CZ9A 7ICFA 3TFRA 3RH5A 3UQ0A 1RXVA 3DRSA 4FW2A 4FBUA 2PFPA 2KZMA 3KHGA 4F4XA 1ZQEA 5CP2A 1JXLA 4LSNA 8ICWA 1NJYA 1WSJA 5J2NA 3BQ1A 3MR6A 4Z6DA 5HMMA 1C6VA 4DL2A 2W9CA 2Z1HA 2W8LA 4E0DA 4EP5A 1TK5A 9ICGA 1WSGA 3KLHA 4CF1A 1SZPA 1DLOA 2E6MA 1RBUA 1JLQA 1UT8A 4NYNA 2WTFA 4Z4GA 1XSNA 1D8YA 8ICQA 1S1VA 4CEEA 4JWNA 5HRPA 2G8VA 1MU2A 3V9SA 3M9NB 4P4MA 1BISA 1VSFA 2IGIA 4PHPA 1C1BA 2RKIA 5J2MA 3V1QA 5IIOA 3T5KA 4DTUA 2I5JA 9ICMA 3S3MA 4DFJA 3TABA 3RAXA 4JWMA 4IG3A 1CUKA 1I3AA 4KLGA 1YVUA 2ZQBA 3ITHA 3MR3A 2BQ3A 2O4GA 3OYHA 4RW4A 4FLTA 5HRRA 4K4IA 9ICFA 3IG1A 2MUTA 3T1AA 2BDPA 4I2HA 9ICEA 3OVNA 4KI4A 1TKTA 3VQ7A 4FS1A 4EBCA 3HW8A 2FLNA 2YNFA 4QCLA 1A77A 4Q44A 4F4ZA 5KG7A 5DBAA 2IOCA 1ZQIA 4LH5A 4W5OA 5HP4A 3MXMA 4IRDA 2XHBA 3C2KA 1WNSA 3SQ4A 4ED2A 3KTQA 3AVAA 4FZYA 2UVVA 1ZBLA 5HMLA 4B9VA 2HNYA 3OYLA 9ICLA 4LVSA 2XGPA 1UOCA 5CWRA 1HYVA 5KFTA 2BCQA 4Q0BA 4ECUA 3MXJA 5IINA 4N76A 4DQRA 1ZQFA 5KG0A 5J0TA 2KW4A 1JN3A 2DY4A 4Z6FA 2Z1IA 3JPSA 3EY1A 7ICRA 3HPHA 3JPQA 4CJUA 3O3HA 2LYHA 4M6WB 3RH4A 3G0ZA 4FJ8A 3TWHA 1LWCA 4OVLA 4TQSA 3GV7B 3S3OA 1ZQZA 3JSMA 2R8KA 5CJ7A 4CFAA 4O3QA 4CJRA 4HHTA 4IKFA 8ICRA 3S9HA 1LV5A 2XCPA 1S10A 4LH4A 2HHXA 4M0AA 3OY9A 2J6SA 3ISBA 5DB8A 3QEAZ 4DSKA 5EWFA 1NOYA 4PGQA 2KZ3A 1JX4A 2BGGA 9ICQA 3OJSA 4PHAA 4MFFA 3SPZA 4UB3A 3SJJA 2P51A 2ATQA 1ZQXA 3VQ9A 3OS1A 3ZSZA 3QE9Y 3H4DA 5J2GA 5D4BA 4O3PA 1X1PA 2JZBA 4YG2A 3C21A 1HQUA 4UB5A 1JLGA 1U49A 4P4OA 4TQRA 3M8SA 3IS9A 3MGIA 5J2JA 1ZQCA 4CIGA 2IBKA 1JXBA 1XO1A 5KG6A 5EWEA 2HHVA 3HXMA 4LD0A 9ICUA 5KGXA 3RAQA 4QZ9A 3RJIA 1RT2A 4M3UA 4M3RA 3RR8A 4NCGA 3SQ2A 4Z0UA 1ZQGA 2V4RA 4FJLA 2YKNA 4HUFA 1TV9A 2A1RA 9ICHA 1QSSA 4B3OA 4EBEA 4CEOA 4W5RA 4H4MA 3ZDAA 2A1JA 1H38A 5DQIA 3TARA 2XO7A 4J2BA 5J2AA 4ECRA 4R63A 5J2IA 4ED3A 4P2HA 1LWFA 3PMLA 4DTOA 4FS2A 1ZQOA 4CF9A 1Y88A 4QZIA 3Q8MA 3AO1A 1ZJNA 3WNHA 2F1HA 1BQMA 1HPZA 3F9KA 3KLGA 3LANA 1J5OA 1AROP 5KFKA 4PGYA 1LAWA 4HCCA 3RMCA 3OSNA 4I9QA 4GLXA 5FROA 2FBXA 2ETJA 3VN5A 4UB2A 4CHZA 4ELVA 4KLQA 4CIFA 4CFDA 3OHAA 5L1IA 2PFOA 1NKBA 4RG8A 2FC0A 5KTQA 2YHBA 3MDCA 1ZQRA 4FK0A 4DTJA 5KT6A 5C24A 4IQVA 1K1QA 3ZDEA 5C5JA 4ID1A 4W5TA 4B8CA 5KG4A 1VRUA 3OYJA 4XRHA 5DLGA 3IHQB 1KSPA 5DG8A 3MAQA 2PYJA 3EWAA 5KG1A 2KN7A 3ZD9A 1S97A 4QZHA 3HM9A 2ZUDA 3AO5A 2ZUBA 4RQ8A 3OSPA 4DTSA 2W9CB 4MF2A 3PO5A 2ISOA 4MEYA 4FBTA 1WSEA 4TUSA 1QE1A 3RB3A 4J2AA 3MEGA 4I9LA 4BE2A 3QNNA 2B6AA 4FLXA 3ZSWA 3HX0A 4OKJA 2C2RA 3DMJA 1S1XA 2KTQA 4CFCA 1TV6A 3TAGA 3HPGA 5KFBA 3T3FA 4DL3A 2WONA 4MFAA 2P66A 3VQAA 4O5BA 4UAWA 4DTPA 2ALZA 5KFXA 1VSKA 2RPIA 2BCUA 4I29A 3MEEA 3QLHA 2F1IA 1T03A 3FYHA 4J9PA 9ICAA 3K57A 2OZSA 1X9SA 4FJGA 1L3VA 4CESA 8ICFA 2MUTB 3V7LA 3KHLA 1ZBHA 2P5OA 1PZNA 5CYMA 2E4LA 2F1JA 7ICIA 1U48A 4J9SA 3ULDA 2PZSA 3AVIA 2EX3A 3CFRA 2PYLA 3QESA 1ZQPA 1IKWA 4PHDA 4O3RA 1XI1A 4XA5A 1RZTA 3JPOA 5HLFA 5J0PA 3NH0A 3OYCA 3PX0A 2G8IA 4W5QA 3V7JA 1JL2A 2PI4A 4CJSA 3VQCA 2P6UA 1TGOA 4JV2A 3GIIA 3HSTB 2B4JA 2HHWA 3V9XA 4E7IA 3N97B 3KK3A 2ZD1A 2HVIA 7ICKA 4BDPA 4M9LA 3C5GA 5F9NA 5CY4A 4KLHA 4FM2A 4RPZA 4NYFA 1SL2A 3SPYA 7ICHA 3DOLA 1S77D 8ICHA 3BDPA 3MR5A 1NK0A 5KGWA 4IFYA 5KT7A 4ECSA 2YKMA 3UXNA 2IHMA 2KFZA 1KVAA 1Q8IA 1VSDA 3QEXA 3LPTA 3RTVA 4EBDA 5TZVA 2F8SA 3NCIA 3GQCA 4BE0A 4H8KA 3U6FA 4MFCA 3MGHA 1Q9YA 4GC6A 4DFPA 1ZBUA 4JS5A 3GIJA 3RR7A 3NBPA 3ZSYA 4NXZA 3NHGA 3LZJA 4O5EA 1HUZA 1B9DA 4AHRA 3NF9A 3OS0A 4KHQA 4QAGA 4CHPA 4FM1A 4RQ6A 2W42A 4RQ1A 1MQ3A 5EWGA 5K14A 2ZTDA 5FDLA 3AO3A 5JUMA 3GILA 1CZBA 4F93B 5KFNA 1QHTA 3I0SA 2D0CA 1UA1A 4DLEA 1HUOA 3O3GA 3OJUA 4CECA 1BL3A 4AHSA 3G6VA 2YHAA 1L3SA 2NUBA 2JZBB 3C1YA 3ISDA 4QZDA 1MSWD 1WAJA 2OPRA 3VA3A 4N41A 5KFRA 2QK9A 3EPIA 2AQ4A 3O4NA 4KLUA 4CE9A 1BPZA 2BCVA 2YNIA 3P1GA 3ZDDA 1CXQA 3VQ5A 1KVBA 1ZBFA 1SL1A 1JLCA 1U04A 1EXNA 3OYBA 1RT7A 4M45A 3QIOA 1KFDA 4J2EA 4QZ8A 8ICJA 3V6HA 4HTUA 1SKWA 1ZQSA 2A1JB 3L3VA 1ZQWA 1BGXT 4IDKA 4CERA 4I2IA 2IHNA 4B9UA 2P1JA 1B22A 4J9QA 3C5FA 8ICEA 4RU9A 3L8BA 4ED8A 2JEIA 4IRCA 4KLSA 4RQ7A 3ZD8A 1ZQVA 4FJNA 9ICVA 4DU4A
chains in the Genus database with same CATH superfamily
4DR4K 2DPJA 1BWVA 2F9DA 8ICVA 1PUZA 3O9QA 4ECVA 3KHHA 5MLCV 2ZJQL 3LWLA 1ZQJA 4RX6A 5BR8F 4XPEA 3MGJA 5BPCA 1NZPA 2LMRA 3F5TA 2XLIA 1UPHA 4K8RA 4JB3A 2IM3A 4O3MA 3GU0A 1S12A 5I4MA 4LF4F 1J97A 1EWQA 2U1AA 1L3UA 4DR5K 3HZ6A 5DKWA 1DQ8A 3RWUA 2KHDA 4R25A 4NV0A 2AP6A 3ISNC 2R7SA 5C2CA 1HUXA 1IVZA 2FY8A 3ZT4A 3OHRA 5J0QA 2QGFB 1HR0K 5ETTA 4FJMA 3QSIA 3O08A 7ICQA 1S59A 1KNZA 3CJRA 1X3NA 2LBOA 2EC2A 3ONQA 3H6EA 4IQUA 3M2VA 5CAAA 1NK5A 2FB0A 3I9ZA 3D7EO 4DV1J 3PIOL 4XK8C 3T1YF 3QIDA 4R66A 3FZKA 5LMNK 3FM9A 4P2MA 4CJFA 8ICNA 1MA9B 3HHLC 1VQLN 3DMJB 4RNFA 3PX4A 1TV6B 1ZQQA 1DY3A 1V38A 2IM1A 2PAVA 3SSQA 3O44A 5EUHA 2VQEF 4WU3A 3RBZA 2GMHA 2F8TA 4ZLLA 3KNGA 1JMTA 9ICJA 4FLWA 2M0GB 1IKXA 3KK2A 1HD0A 1T03B 3LM9A 2C2NA 4YFKA 5G5HA 4C9DA 1Q5VA 2EKNA 1FKAF 3RB0A 4Y2YA 3D2EA 2GELA 1VJ5A 2Z58B 5LT5A 3W3DA 4ZP8A 2WW4A 5GAGI 4IH5A 2OFGX 4UF4A 2KHCA 4M9HA 1SXEA 5M2PA 2UUBF 2VOOA 3V5RA 2HWTA 5KFLA 3NS6A 1S0NA 5AKEA 2ZBQA 1HQ2A 2G0CA 1D4XA 1O8BA 4JK9A 3L2WA 3P5JA 3PX6A 4FK2A 4OPHA 2HGMA 3EDRB 2XNQA 1R8BA 3CC7N 1QS4A 4RW7A 1VR6A 2J5AA 4DPOA 4K4TA 3QT8A 2ZOFA 3LAKA 5AXMA 3VENA 2HDOA 3H98A 4KT0C 3GJRB 4XH1A 3LDQA 3NL0A 2QMWA 4IEIA 4RT2A 3EVOA 1VOMA 2VBYA 4HI2A 3BF1A 3BJYA 2G1HA 3D0GE 2PMWA 1ZD4A 2XMWA 4KHWA 5HNKA 1HBUA 3R5CA 3ZSQA 1BCMA 5KFEA 3NBPB 5DMRA 2BPCA 4KREA 1JJ2M 2DY9A 4BCAA 1BWEA 5B0EA 4F92B 3UM9A 4JOUA 5J2CA 5KFSA 1NSKL 4X4VA 3P96A 2VZ9A 4ED7A 3QICA 4KKOA 5K14B 4CQ1A 1PGZA 1SJ3P 2J76E 5F2RA 4CGHA 2RLTA 3I87A 4DQIA 1HD1A 3I0SB 2NNWA 3NGTA 3CIPA 2I7NA 4PXCA 1GQEA 2UUTA 4PG7A 2ZIUB 4MO4A 1VBYA 4BC3A 4IZ9A 4KI6A 4NLKA 3AY9A 4H0VB 3NRWA 2OPRB 1YZ7A 3I6PA 1FDNA 5J2HA 5AXKA 4UZBA 2VA3A 2G08A 1C2PA 1KAZA 3RF9A 2NSCA 4HAIA 4LC9B 4ER8A 5CYQA 2D9OA 2OD6A 1JLCB 1RT7B 2CQ0A 1GMUA 2HB5A 3WQPA 4DV1F 2E5IA 4C7QA 9ICPA 3GFHA 1RDAA 5GAHU 4KLDA 1ZQUA 4FZNA 3C6UA 1OYDA 1H1VA 2H65B 1Z00A 2DQNB 5AQVA 4QIEA 3MCOA 3KJNB 3P6YC 2XB2D 5KFZA 3BF3A 3T6JA 4FJJA 1OS5A 3T5JA 1F2GA 2DL0A 4MT1A 2AQ0A 4HKQA 2CPIA 1O0PA 4KHUA 4O23A 2ZTEA 2H5XA 4A48A 3Q24A 2PA3A 4OJ1A 4DV6J 2VICA 2XSFA 2XMUA 2G0AA 2XY7A 4KHYA 5D0HA 1S0OA 3AVHA 1HARA 3AN1A 1RT1B 3BKUA 2EWSA 1WBBA 1H72C 3DYAA 1Q0NA 2ATCB 1VQ6N 1VSMA 2NYHA 2BE9B 4DCPB 3ENBA 1WSRA 3KLEB 2DD8S 4F2SA 1URNA 3ZZUA 3VAGA 4BXOB 5AFUA 3G8QA 2D7SA 2GWJA 2ZHBA 5T41A 2LSNA 2Z57B 4GO5X 4YHHJ 1KKHA 4MF8A 3RRKA 1HYSB 5AXNA 2VJUA 3QPIA 4WQ5C 3NF6A 3T5LA 2J0SD 4GXJA 4DCOB 2BOAA 2YBVA 1RTDB 2CGLA 1FVQA 4KQZA 4EO6A 4XO0A 3CJSA 2CUYA 3WNEA 3FSIA 1RT6B 1D9FA 2BV3A 1GMWA 1PJ7A 5J29A 3ZT3A 2UVUA 4UW9A 3KHRA 1J6ZA 3TZYA 3FRYA 1UVKA 2VB6A 3RJHA 1BPDA 3LDSA 1CS4B 2PI5A 3M6VA 4B3TF 4CEZA 2KH9A 4C4SA 2PMZF 5EE1A 4WP3A 4DQQA 4PL7A 2W4CA 1RT5B 4JB8B 3PIPQ 3MN9A 4UASA 1QAIA 4LZDA 2O8BA 2WUSA 1JRPA 2DGUA 3BGFA 2XC9A 4N7TA 1RBSA 2HMXA 3D2FB 4DEZA 3T69A 3D68A 4ECXA 5A8RB 3OTDA 4RBUA 1JJHA 2DO4A 4RW6A 4H4KC 3FZBA 2DGQA 5JVHQ 1VK8A 2ADBA 3N4PA 4ELTA 2E2NA 2NREA 2R7XA 5I3UA 3U1NA 2DFEA 2ZHOA 2W7PA 3CGIA 4OYAA 4GXKA 4CJEA 1AA1B 4Z6EA 4F72A 1RTHB 5CE3A 3QBWA 5DG9A 3H20A 1FO1A 4MKAA 2ZZNA 4H0TB 1SL0A 2CZVC 1VQSA 4LF5K 3N28A 3SJHA 4OI6A 1Z26A 3I5AA 1CLQA 4OI0A 4DSEA 3ISZA 4LBIA 4K43A 4TURA 1MC8A 2X7IA 3M2RB 2K06A 3ZETA 1WLJA 4FZZA 2RU9A 5L1LA 3CHWA 3LPEA 4QIVA 4DQSA 2BM1A 1X3MA 1KL9A 1FDBA 1YBUA 5HANA 2BPFA 3WK8A 2Q1LA 2V94A 2FJWA 3DLEA 4DL5A 4NO7A 1N36K 4JBCA 4LMZA 3FZMA 2OPQA 4BRFA 3IRXB 2CJAA 1M6YA 3G87A 2L5YA 2QWPA 1UHUA 4NCBA 3OFEA 5IOLA 3H2UB 2R8GA 2XZTB 4CWBA 1TVAA 1VISA 1URJA 3W63A 2FYXA 4QIWC 4Y2UA 4NLZA 3H5SA 1VQPN 1HNVB 8ICKA 3C16B 2WFBA 4H4OB 4DV6F 2P5VA 3EPGA 5B5EU 1S1UA 1UW9A 3V1OA 1HKBA 2BXJA 3OR2A 4BRCA 4YORA 1FRXA 2QWNA 2CQCA 3FQLA 4QOTA 1NK4A 2ESEA 3WK7A 1IBLJ 1H0HB 4ILJA 4O0JA 3NGSA 3OV7A 2YJEA 3GU3A 1BU6O 2HBZB 1XS9D 4YHHF 4DV4K 3LK9A 4O5CA 5DB7A 4J2DA 3JYTB 2WOMA 5HROA 4OI3A 4CE6A 2A0FB 2YNGA 5IT9Y 5AI5A 3GONA 3AU6A 1Q8KA 2HS0A 4G6VB 3AAQA 3MEDA 3JTOA 4F5NA 3OUYB 3O5BA 2ZJPL 1M0SA 3QX7A 3LP2A 5C42B 2AMCB 4K5SA 8ICBA 3NS1A 2RF2A 4IO9Q 1IWAA 1FXLA 2FI1A 4JI8J 1B4SA 4KHMA 1EJ7L 5J0WA 1ZAWA 1EP4A 4OZ1A 2JGAA 4ZVOB 5B8HA 1RGIA 3QEWA 2F2AB 3ZT1A 1DK3A 1E3MA 4ZH4A 1NJZA 3ZFVA 4QJVA 1IKVA 3GIMA 5AQHA 2G8HA 2H51B 2BANA 3IAYA 4LFBJ 1E6YA 3NS7B 2WVDA 4IFVA 4X62K 2ZUAA 5HR7A 4K25A 1Q53A 1KS2A 3CCWA 3NAHA 3A5OC 4YN4A 1R43A 3U02A 3FC4A 4NZ0A 1B9FA 1VI7A 4Y1CA 3UD3P 3B0YA 4I2PB 4GKKK 1YHQS 3QU9A 3W9HA 4F5RA 1Q46A 1JLEB 1HBMB 1N32J 3WXKA 4M1KA 3HT0A 1N5YB 1YVNA 2MZTA 2ASMA 4EHTA 4NOHA 4I2EA 1QSYA 5GAEI 3BZKA 3KUGA 2QL5B 1ZM4A 3TSUA 4WFBQ 2HHUA 3WDOA 3GG4A 3AVFA 3OL8A 8ICYA 3ATUA 5J1EA 4CLLA 4KH4A 3KDNA 4C98A 5CH7B 2EFVA 2DHAA 5MAOA 1RWUA 4Z4IA 4BG9A 1RKJA 1VQMN 1RAIB 2IFXA 3IKMA 2E1FA 4I0WA 3D4JA 2M9NA 3ZNUA 1Q16B 4DV7K 3B8AX 5AXLA 2GIRA 1BD6A 1SQKA 3CCMN 4LF8F 3U3GA 4HYKA 5KG5A 4DUZK 4HTJA 1DBDA 4E3SA 2QWMA 4X66K 4KRFA 5J1PA 4A8OA 4LUBA 4JV1A 3FE1A 3UQSA 4RUAA 3TANA 5D0GA 4RQ0A 1FNOA 3NGZA 4C0BA 4R0JA 3EUB2 5J2FA 4CJTA 2XY6A 4GVLA 4OMFG 1L7MA 3CD6S 3NP5A 2HQDA 1NUEA 3DI6A 2KT5A 2XMJA 2WVFA 1PKUA 1T02A 4U8YA 3AMZA 1JQGA 4DFDA 4ZVTB 5HQMA 4DTMA 3W8PA 9ICXA 4DV0J 4X65J 1X9WA 4M7XA 3S01A 1V4SA 4XH5A 1DTQA 1FD2A 3EZUA 3W2WA 5CCLA 3J7AN 2A41A 1GOBA 2DR9A 2Z8QA 2R2UA 1KXPA 4CEQA 1U45A 2LQ9A 2RT3A 4OX9F 4DQPA 2L08A 3G10A 4NA3A 3TVZA 3BSOA 3BH7B 3SAHA 1TTHB 4YB6A 4M3TA 4B17A 1QVGR 3HD2A 4JI3K 3R97A 4BGAA 3AA4A 4K50A 3THYA 3A13A 1B0PA 3BN7A 4E19A 4PL8A 2YWWA 3CO9A 1ZQTA 2J7UA 1BXNA 3LA0A 4DF8A 4HDGA 4NWBA 1UL3A 4CLTA 2VBXA 1SJ4P 5BOLA 5HRSA 5AQZA 4OHVA 2VQFK 2K3IA 3AO2A 2FBVA 1I6JA 3HVWA 2EBGA 4LF9K 1RWVB 1S7HA 3KK1A 2QL9B 3OPXA 4P0PA 1KN5A 3QRQA 2OMOA 3TQEA 1NK6A 2CQDA 1VQON 2XCAA 4ED1A 2NUUG 5GAEP 1YHQN 8ICLA 1RP5A 4LFBF 3NUQA 4CO2A 1MMDA 3CJ2A 3Q8LA 1WKJA 1HNWJ 5FDLB 2RS8A 4CTAA 2QFJA 3EYZA 2BRKA 2HFSA 1RT4B 4ZVUB 5C12A 8ICXA 3SFUA 3FCWA 2Z1JA 3PY8A 1DTTB 2XS5A 5BRDA 3AVNA 2AYMA 1N32F 3FJ2A 3A12A 4F3MA 3C19A 4C8LA 2W2QP 4JI7K 1RBLA 1XNRJ 2H3EB 1T0TV 4CHNA 5IC6B 2V7YA 2W9BB 4CK3A 3OYGA 2RRBA 1ICEB 4I7FB 1ECWA 1U1RA 9ICBA 4E7HA 1UWBA 2V5HG 4H5WA 4HVJA 4IC9A 1JNRB 1V6HA 4ZVSB 1M1GA 4U95A 4DG1B 4KX5A 4CD3A 4CI0B 3NH2A 2RRAA 5ALOA 5EE3A 4TKTA 4UOGA 4BRDA 1Q81T 3IM8A 2EFNA 2LEBA 3HHLB 4MFBA 3LZIA 1FK9B 3I9V9 1T3OA 3CTRA 3A5MC 1IO2A 5KAIU 3MMAB 2DK2A 9ICSA 2G0JA 3R8YA 2FJAB 1GNKA 2CQPA 2GWSA 1IBCB 3LYSA 3HL8A 3NVZA 1PG5B 1X9MA 2CPHA 5DQGA 3C1ZA 1NJIT 1V5VA 1UTAA 1RWKB 4I2AA 2KQ2A 3TFSA 5L1JA 1GOCA 2DWQA 4X4RA 1TR0A 3EO3A 2HG4A 4JKDA 2QSWA 3E01B 3RJFA 3U27A 4TYBA 1RM6C 3J7AP 1YI2N 1W2IA 4RR5A 2R8IA 4DZ6A 2HQIA 4QYZK 3CI5A 1IXRA 2P6TA 2H3FA 3BREA 4X65F 4DV0F 1H2UX 4WJBA 1R8HA 2KG1A 3IM1A 1S1WB 1TK0A 5B0GA 1HJPA 3O8MA 1XTZA 4Y2KA 2E1YA 3RJEA 3MM6A 1YTAA 2NZCA 3VR1A 4ZPBA 1KVCA 2BPGA 4AFFA 4WCEQ 1S6PA 2A42A 9ICIA 3G82B 4W98A 4EELA 5ALIA 4DV2J 1S7IA 1BPBA 1OY8A 4J7CA 1NGHA 2KKHA 2Y1JA 1C0UA 3CCQN 3A4TA 1UJ5A 3F41A 1J27A 4Z94A 4BWJA 3WEEA 2HK3A 3TW0A 4FJ9A 4M2YA 3OD2A 4CT8A 5EDWA 3KOAA 1A5XA 3LAMA 1ZBIA 2MQPA 4L73A 2GHVC 4I56A 1QCKA 4RCHA 1U8SA 1GLAG 1SPBP 3HT3A 5DGAA 1SUQB 2GV1A 4DS4A 4DLGA 2CQHA 2XWYA 2C28A 2H4YB 3PCOB 2MLYA 3M1FA 3LH2S 4EEYA 2Q6CA 2XEXA 1JXEA 4QZFA 4AL5A 2F4FA 4K4HA 1REVA 2XYHB 3AODA 5L8RC 1T3VA 3N6MA 1HNWF 2ASLA 1VQ8N 4I2QA 3UB5A 3Q89A 3PNIA 4I6MB 4BR0A 3OYIA 4E7KA 3DXKB 4ANDA 4CHOA 2L48A 2H54B 3ZCMA 2R2SA 2FBTA 4WE1B 3OLBA 3MCMA 1NK9A 4JKEA 2E1AA 4KO0B 3Q23A 2JL9A 3P8BB 4DPTA 4P72A 1RT3B 3VTIA 4KHPK 2QWQA 1WYGA 5JJBA 2C3YA 4F3OA 2E1ZA 4RLEA 2E20A 1TE2A 1GH8A 1HRHA 5AZJA 2JXJA 1XNRF 4DTNA 4YOVA 4MKYA 4OYXA 4FXVA 2YX6A 4ETZA 1B0TA 1BO5O 4GMJB 2P9GA 5RUBA 4M95A 4LVNP 2JVRA 3T9ZA 2GGPA 3HJFA 1KFTA 2QWLA 7ICTA 3OXGA 2W54A 5L38A 4NMLA 1VAZA 4DFMA 1F9FA 4FL9A 5AI6A 4JI5K 3LP0B 2ZKTA 3S6EA 2Q0RA 3R27A 4C3KA 2AIRB 1JXVA 3HWTA 4I4BA 2AHOB 3DRPA 2BQUA 3WXJA 5KT3A 1DHMA 4Y2CA 3CYMA 3ENOA 1X66A 2N3LA 3V6DB 1VSIA 2D0BA 1IIPA 2GV9A 4ECQA 4URGA 1RCHA 1ZRNA 1BHLA 3H7IA 1UWAA 7ICJA 4PL1A 1TFYA 1S4EA 3PACA 2AYGA 2CDRB 4JI8K 2WVBA 1U24A 1NGJA 1QVFM 3HHLD 2CQ1A 2X6SA 4GVEA 3QEIA 8ICGA 3W60A 3DC2A 1FE0A 2HPUA 2W1BA 3CDBA 1NOZA 5E26A 2Y3YA 4QS9A 2CVIA 4WYWA 2K8CB 4OJHA 1PAUB 2I6XA 3V7KA 3ZZOA 1LAVA 4QWCA 1FERA 1XNQJ 1EWRA 5CZ2A 4YY3K 2AZ3A 4DU1A 2W41A 4QWBA 3GJQB 2E1MC 3NH1A 4CEDA 4BACA 4DV5J 3EL2A 2LKZA 2UU9J 3A3PB 5F8MA 1OSDA 5ALTA 3KXDA 5IV3A 3TA1A 2PFUA 1FO4A 4R8UB 5AQRA 4DV2F 1WORA 1MG7A 4PPXA 4YR2A 3HSZA 1Q4RA 1RABB 2JFDA 3HP9A 3DHWC 1WUAA 1VSEA 1UT5A 5KG2A 1NHKL 4Y2XA 1RTIB 1MLAA 2AJ2A 1K47A 3A0HU 1Z3EB 4KX3A 3QWPA 3R2DJ 1RYSA 4PXDA 4B9MA 3S3NA 3CCSN 1Q81O 1X4CA 4KLIA 1IKYB 3N5BA 4F2RA 4QW9A 3B6BA 3DDKA 3W61A 3MBYA 1YJUA 4YOXA 4I27A 4DX7A 1YK9A 2LHTA 3VQDA 3CG7A 2FVQA 2XRIA 3CVKA 1ZQBA 4QR1A 3FFIB 3PW4A 3AOBA 2JZ5A 1WC3A 3BPDA 4FBUA 2KZMA 4CP5A 3D1OA 5D3GB 1ZQEA 2M8DB 1JXLA 3LM2A 1QVFR 3CXCR 3CIMA 2A3ZA 1N5WA 4BREA 3LDPA 1M5SA 5J2NA 3BQ1A 4MMOA 4NB4A 1T9YA 5EX3A 1IBMK 2W8LA 4E0DA 2OLWA 1FHTA 4H0OA 4EP5A 4CBUA 4BC2A 4CJ7A 1WSGA 1NGCA 3DLLQ 1RBUA 2UUCJ 5B66U 2KYXA 1Q7LB 2OPSB 2FY1A 1VQNS 2ZH2A 4NYNA 2WTFA 1HNXJ 6AT1B 4JWNA 1EB0A 5HRPA 2Z30B 5EY4A 3V9SA 2CQGA 2BKOA 4USKA 4MLEA 1SXLA 1BISA 3C65A 5J2MA 1ZBSA 2MGZA 1U09A 4AQYJ 4JKGA 4DTUA 4NLXA 2I5JA 2HZAA 4OHYA 2HK2A 2A6AA 1K0TA 3GYNA 4GVBB 3JB9k 4IG3A 4TY8A 3JSBA 4KLGA 3HX9A 4O44B 3IR5B 3W64A 4ZP6A 2BQ3A 1QY7A 4B1ZA 4RW4A 3JSYA 1HW9A 5CZVA 3SQGA 5AI9A 4I2HA 9ICEA 3O9SA 1PK1B 3OVNA 2Q4TA 1S8OA 3BZCA 1WEZA 3HW8A 4Z37A 5C25B 1A77A 4Q44A 3M8PB 1FESA 4PYAA 3R1XA 3Q8VA 5AK6A 1ZQIA 1V9OA 2DB1A 1ZOLA 2Q97A 3VESA 3FZHA 4O4GB 3FSYA 4B9VA 3NEKA 5BJRA 3UMCA 4YDDB 2YWKA 3W66A 1WG1A 2CRLA 1UOCA 1XNQF 4M5NA 5A0YB 5J0TA 2IC3B 3KK7A 3TJ9A 2KKVA 2AA4A 4DV5F 5JVGL 2UU9F 2DY4A 1CLFA 1HFEL 3HKZF 1UPPA 3EY1A 2AEFA 2OSRA 4CJUA 3TADC 4M6WB 3G0ZA 2YB4A 1SVDA 4NYPA 4FJ8A 3I32A 3UO0A 3TWHA 2PFDA 1LWCA 4EMDA 1GLFO 2KK0A 2P9IB 5F8GA 3S3OA 3JSMA 4O3QA 2LP4A 1SS6A 2ZHAA 3E3XA 5AQYA 3WU2U 1FKOB 2OGUA 3GG1A 4ZMMA 3QT5A 1TMMA 4LH4A 4DHVA 4PABA 1P8ZA 3OY9A 2OUGA 2DISA 4IJAA 2WFAA 1NOYA 1WTBA 2KZ3A 5C15A 1JX4A 1GLEG 5H9FJ 2VG7B 1U1KA 2WTUA 1CJKB 4R5PB 4G65A 3GE9A 4M5DB 4WQ5A 1KWMA 2HNDB 3K8VA 3WK9A 3SJJA 2KL8A 1M5PC 4OI2A 4CT9A 4YOEA 4MJKA 4X4NA 3E1YA 3OS1A 3QE9Y 3DDHA 4FWSA 1RLCL 4ILGB 1NGFA 1QAXA 3U26A 1NZBA 1HQUA 2CVEA 3KMQA 3QGGA 2KMDA 1U49A 1VQNN 1WEXA 3DGPA 4P0QA 2WSCC 2IBKA 1BQNB 2MSNA 2KSOB 4I64A 3P5BP 2GJIA 3R1HA 2LEPA 3C28A 4QZ9A 3PHTA 4USAA 2IOHA 2V4RA 2YKNA 2LU1A 1TV9A 4B3OA 2UUCF 4H4MA 5F0WA 1TUYA 5LJVA 3KLIB 2YY6A 5DQIA 2DR6A 3ADAC 4AM7A 3ED5A 2FDNA 4J2BA 5F8NA 5J2AA 1HNXF 4ZCIA 4EIAA 4NLPA 4WFAQ 3TAMB 4OZNA 1JCEA 2EAOA 4FS2A 2AEMA 4CF9A 3WQUA 3Q8MA 4TXSA 4AQYF 1HNIB 3Q83A 3BP8A 1SWWA 1S9EB 2UZAA 3J7YI 1NSQA 4HCCA 1XEZA 1TYQA 3BKTA 3BYRA 1YJ9N 2BJDA 5FROA 1Y4ZB 1SJQA 3AJ1A 2ETJA 3KJQB 1JROA 2GH1A 3VZHA 4U8VA 4GRSA 4GFJA 1B0XA 4WF9L 3CO0P 2MKKA 2OTLN 1ZQRA 1A6SA 4FK0A 4DTJA 5KT6A 5C24A 4WFXA 2UP1A 4PWWA 5AR0A 3MZIA 4MIAA 3MM9A 4KGMA 4QIWD 4B8CA 4F0HA 5KG4A 1VRUA 3SMZA 5D6GA 5HN0A 5DLGA 4UB8U 3IHQB 4LSNB 2KNJA 4KGXB 1X9JA 5KG1A 2KN7A 3BR9A 3P5TL 3ZD9A 4B3RJ 1S97A 1UVMA 4QZHA 3HM9A 3AO5A 2ZUBA 4RQ8A 3OSPA 5HMYA 2FSJA 4Y2AA 4HDHA 3E51A 4RTFD 1WSEA 3KLHB 3RB3A 1WDDA 1KVKA 1JLQB 4BJQA 3SEIA 1SH3A 3ZSWA 3HX0A 3T7ZA 2C2RA 3HOSA 4UARA 5ALDA 5IXUA 4NPOA 2KTQA 1MU2B 1GXUA 3W2VB 1U1OA 3O2IA 2E7WA 2W24A 3TAGA 4ZOHC 3T3FA 1ULRA 3MR7A 3H1QA 2V8GA 2FZCB 2ZH1A 2GHWA 4HTIA 1VSKA 2RPIA 3GB0A 2MQNA 3AAPA 3E66A 2AKWB 1HI8A 1YBAA 3QLHA 4Y65A 4JK7A 1ZTWA 3BGUA 5ALFA 3BSCA 4F26A 5B0DA 5DM7L 1L3VA 1F44A 4CESA 8ICFA 3CCJS 2MUTB 1FDDA 5AKYA 2E4LA 2WW8A 5A76A 3EWGA 4G1IA 3AVIA 2BYCA 2YNFB 4O3RA 1XI1A 4CVNE 2E5LK 4XA5A 5HQ8A 4N8OA 5A8KA 3IRWP 5HK4A 5HLFA 2IVOA 3FGVA 2GVDA 2XI3A 3MXHP 5AHXA 2EG1A 1N34J 1CBKA 3OTQA 3HSTB 2HHWA 4PHTX 2F8MA 1D8ZA 4E7IA 3KK3A 2V50A 2RB7A 4M9LA 5K5MA 3C5GA 3F5EA 3LOUA 4X4QA 1SL2A 7ICHA 3DOLA 3BDPA 1NK0A 2MRLA 1FFGB 2NV3A 1FNMA 3AARA 1Z1ZA 1KEKA 2VIHA 4ZCLA 4Y2JA 5TZVA 2JLFA 2MMYA 3GQCA 2LM1A 2CPFA 2V63A 3C14A 2Q79A 2EFPA 2EPIA 4GC6A 4DFPA 4B9QA 1SC4B 1IUJA 3CRXA 3ZSYA 2KIWA 4LFAK 3NHGA 4FVCA 2MZ1A 4O5EA 2JOQA 2KJ8A 1MW7A 3WC2A 4CHPA 4FM1A 4NLOA 4C1NI 4B3SJ 3NASA 4RQ1A 3EVWA 3D6JA 2BE7D 2DEIA 1K44A 4PG5A 5JUMA 3GILA 1CZBA 2AV5A 4ILRA 3O3GA 4C4WA 1Q7YT 3OJUA 3FZLA 2DEJA 1OW5A 2O8EA 2LXFA 1AXQA 5ALVA 3FZ2A 3BUZB 1J5EK 3F0NA 1L3SA 3RJMB 3J7ZT 5EVZA 3VA3A 2GMJA 5KFRA 4U96A 4IH7A 1S3XA 2AQ4A 5ELZA 2MQLA 1XMOJ 3ID8A 4FVUA 2D41A 5GMDA 3HRDD 2V68A 2VODA 5AQXA 3HSJA 4LRFA 3UR0A 2GQCA 4B3RF 3VQ5A 2DR7A 4CZFA 5KOWA 1U04A 4NCGB 4O8UA 1Y3JA 3THTA 2WVEA 2V52B 2A1JB 2G0IA 4RWTA 4Y2SA 2O8DA 2VBWA 4CERA 4BRKA 4I2IA 2OO4A 3ALRA 2LXIA 2W2PP 3VEVA 2FGCA 2FJXA 3KWGA 3L3FX 4RU9A 3QRRA 4RQ7A 2JRZA 3MTKA 5KNIA 2QN6B 2VBZA 1OQ3A 1BQMB 2HCFA 2GO8A 3C0BA 4FZLA 4JI2J 2G8WA 1F60B 2YKOA 3JQKA 3A3NB 3IWXA 1BWFO 3FFKB 4FF3A 1TKZA 5H9EJ 1BLUA 4PJ0U 2HGLA 5LSOA 4NJ8A 4AHCA 2C42A 3G6XA 5DDQC 2A6OA 4C8MA 2VCPA 3M6WA 2NXJA 4IG0A 1YKWA 3CQYA 5AT1B 4YMOA 4ELUA 2EZXA 2W6LA 1RBVA 1NM2A 1FRHA 2QLFB 4I1TA 1RAHB 1RCXB 2GUIA 4USVA 1W2BM 1X60A 3VGKA 3CCUS 3K9JA 4CNQA 1ZH5A 4O3SA 2I0XA 3L09A 3THWA 4PXBA 5K20B 3MMCB 2ZTCA 2N3OA 1TAUA 1RAGB 2PSZA 1NJXA 3HMJG 2P9UA 2B5JA 4U6PA 3CC4S 4FWRA 2ATLA 2F40A 3DLBA 5ETKA 1U02A 2HNZA 4D3GA 3VQTA 4J9LA 3JXUA 3VAMA 2DT9A 3B4DA 2EFGA 3UI3A 4NLDA 2IS3A 5EGYA 2HBRB 9ATCB 4ERDA 1KLNA 1FEZA 2B6AB 3I8DA 2KJ5A 1C0MA 5ETNA 4ZKAA 3GOIA 1NO8A 3W62A 3AB4B 2XQCA 2RHFA 2Y0SF 3U7JA 3KKFA 1WSIA 1FW6A 2UXDK 1IR2A 4WQ4C 1U26A 4DOBA 2V6AA 4FWOA 1MQ2A 1X6IA 4DN0A 3T9NA 4CZEA 4JRQA 1FXRA 3MMBB 2VPWB 4RPXA 2FHMA 5J0RA 1MWYA 4FO0A 4EX7A 5LJ5Y 3SDEB 2NSBA 4YEAA 4B3SF 4FJIA 5ALEA 2NRWA 2Y9TA 4ILMA 2CXYA 4L8RB 1Y00A 2KJWA 4DXLA 4PG8A 2UUAJ 3CJKB 4CF8A 1IKWB 4K8ZA 4MK7A 3OYKA 1N0VC 3QFHA 4P71A 4LRCA 2B56A 3WNGA 3WKBA 5DM6Q 4IOCQ 2ISPA 7ICGA 5IWAJ 4M63C 3C94A 3MDFA 4RZRA 2AGPA 2EANA 1TUGB 3PEJA 4WXWA 2KM8B 1U1PA 4CJ5A 2ZD1B 2GEMA 2L9WA 5GADU 1EKRA 2DGWA 4PZVA 4GY2B 3G8SA 2E1RA 5KL8B 3WKDA 1IH7A 3RAMA 3I96A 3NCPA 5KFOA 5AE3A 2XSJB 4F25A 3R3LA 2P8IA 5B7WA 3IFEA 2YKMB 3A5NC 4HCBA 3BQ7A 2R7OA 2QIFA 4WIIA 3D6RA 5CZXA 4DV3J 5LJ3Y 3VQEA 1UEKA 3CJ8A 3BS5B 3AAWB 4CJKA 1YWXA 1F0MA 3GLJA 1VQ9S 1REGX 4QS8A 3N7RC 5F9LA 4ES2A 5ALHA 6FD1A 2KB2A 5AM0A 5HHIA 3IO1A 3C46A 4JI2F 3CCUN 1FRKA 2BRLA 2K1RA 5AM5A 2GX9A 4B6JA 2V9WA 1SZ2A 2J0WA 3CPEA 3DFEA 3O3FA 2Z0GA 3CULA 2E7VA 5A2QU 4OLAA 3CC4N 1EZZB 4B1XB 2E8MA 2CIMA 5AI4A 4BR2A 4KMOB 1Z4OA 4ZN3A 2J0XA 4YMMA 1H2VZ 4KB0A 5FIIA 1NRKA 3FEXB 1CSJA 3LDOA 2Z2LA 3JS6A 5AQGA 4DUTA 3HDSA 4LREA 2FUG9 2YNIB 4C48A 1Q7YO 3ZDBA 2D5RA 4CF3A 3M2UA 3J7ZO 1TQLA 2W9AA 2XZDB 4OPAA 3D6MB 2NYIA 1S0MA 4RPFA 1ED1A 3LDLA 1QSLA 3E8OA 4ECYA 1NG9A 1HNZK 1HHSA 1W97L 4FNIA 2VWKA 2FHKA 4JUZA 4RU2A 5G0RB 4CZJA 4IDKB 2CPRA 4DX8H 1YJWS 4B9NA 5E7OB 4KLTA 1A0OB 2QYCA 1SJFA 3PJXA 2B4OA 1WELA 1U8WA 3ZX2A 3T5HA 4FZVA 4ED5A 4ICAA 2HBJA 3WXLA 1WF1A 4O5FA 1XU4A 5BPMA 4QIGA 4DCCA 4HWIA 2MLXA 4BGDA 1JKHA 3H0MB 1QM9A 1SKRA 2BE2A 1VIOA 4Q43A 2MJUA 4CM2A 3ZSOA 3ATVA 4L6V3 2MQ8A 5A2QO 2HOFA 2QA4S 2UUAF 2RMLA 2KHQA 3CMES 1HMVA 4A8FA 3NMRA 2EG2A 4E1NA 4P4PA 3K75D 3UN3A 4HT7A 1RAJA 4C80A 4KLFA 2VV5A 2BJ8A 5IWAF 4DU3A 3RBEA 1Y7PA 5AZIA 3KUEA 4F4YA 2QARA 4JV5J 2ZM6J 4KB1A 2VG6A 1IM6A 3TO8A 1BPEA 1DKGD 4NYZA 2HHHK 1VQ9N 1FJGJ 5AE2A 2C2OB 3F44A 4USJC 3NMAA 4DUYF 2AJ0A 3E0FA 3DRYA 3PW5A 4M3YA 2HOQA 1FWKA 1N34K 3UDLA 2XVTA 3N7SC 3DOMB 1KCFA 4DV3F 4DSJA 1PO6A 3D66A 3NE6A 1R27B 1XN9A 1KHWA 5AK5A 1VDHA 4KH6A 1Q5YA 1W7WA 2IJRA 2YH0A 5ALRA 2ZEJA 2WAQF 3FVYA 1Q82T 3AOCA 2FJEB 2Z7JA 2WF5A 4CZCA 3PFOA 4NA2A 3VF0B 3C6TB 3SQ0A 2F9WA 3PIOQ 2PA8D 3HP6A 2CH5A 3HILA 4ECTA 3VQ4A 2OA8A 3IGVA 1KQFB 4F4WA 4DR6J 1YDLA 3NF7A 3UPQA 3DOKA 2DNLA 2G8FA 5B09A 5AK3A 2IAJA 4KHNA 2MZSA 4C6AA 5IILA 4ZPDA 3FGUA 2VGNA 8ICZA 3CPWR 3Q86A 1NB2A 5J1NA 5KFJA 2D3DA 2BJ3A 2ZIWB 3I33A 1YJWN 1K73O 3TZWA 2W40A 5J2QA 1C0TB 2YMLA 2YKAA 2DBBA 3EDQB 2V7ZA 4EUVA 1ZM2A 4DWIA 4UBCA 2ZVSA 1U2FA 1GLCG 2AZ1A 4DR1F 1XMOK 4O9MA 3VTHA 3OGUA 2QX0A 3MOJB 2GW8A 3F2KA 2HHQA 5TKYA 5KRSA 4J03A 1S5LU 3VQPA 4LQ9A 2FPLA 2FXUA 2XNRA 3WXMB 4PZOA 4L75A 2QA4N 4KLLA 5L9XA 3O4WA 3M4XA 2OPPB 2YX7A 3CMEN 1HEKA 4B3MJ 3MECB 4LF7K 3CCES 4HR2A 4YUDA 3HVTA 4H5VA 3NGIA 3OVBA 3RW7A 1VQ4S 4ZHRA 4ETXA 3K9KA 4BE1A 2Z2MA 5AIAA 1AB8A 1KD1T 2VG5B 1BC6A 3LF0A 2NXCA 5AQKA 1HBOB 3HJVA 2CPYA 1NM1A 2I9GA 1U1MA 1N33K 2N1RA 1T9VA 5KT2A 4UZCA 2RS2A 4BRNA 5D4LA 2NRXA 3QGPA 4I6YA 1P1LA 1TKDA 5HHHA 5IC4B 1R0AB 1YJNS 3SLCA 1NZAA 1IV0A 4GMKA 3IMQJ 1JLBA 3KG4A 4GC7A 1X5PA 3AVJA 4C0OC 3K5OA 4JV5F 3LUYA 4F71A 3EGZA 2ZM6F 3HYFA 3VMFB 1RKIA 3PXGa 2R7RA 2K8GA 1LW0A 5EE9A 5AQIA 2XIDA 1DFDA 5KFHA 3QEPA 1J2NA 4I2CA 4EI2A 1FJGF 3N6LA 2WVCA 2JRSA 3LTOA 4CF4A 5K8NA 5D4PA 1K8AT 3L4PA 3MD1A 1L7PA 2MKSA 1R6YA 5HAOA 3I4HX 4PUOB 1OPIA 3CFPA 2KJVA 4BX9C 2IMWP 5HRNA 4CZLA 3EZ5A 1Y11A 5I42B 2DF4B 1ATSA 1T94A 3O9TA 1N6QB 1T9WA 4NL9A 1ZQYA 3GIKA 3KJVA 3CCZA 3OVAA 4WK1A 2HBQB 3M5RA 4WTOB 1I5OB 3G2XA 2HRTA 4CIEA 2LU2A 4QZVB 3Q8RB 3IDHA 2SXLA 4KV8B 3WZ0A 3OL6A 2ALYB 3I56S 3PR5B 4A8QA 4QW8A 4USTA 3OVSA 1TVRB 2W11A 3SV3A 2CWKA 4NEYA 2UVRA 2YV0X 4ICLA 4RBTA 4P2FA 4DR6F 4ISEA 1GT8A 2AJ1A 7FD1A 3K5NA 2ASPA 1RHQB 2HQCA 3BGRA 3QO9A 5JVHL 1YSJA 3BR8A 3ETLA 3TADA 3AA9A 7ICUA 1HWLA 2ZWPA 3M32A 4HH1A 3H59A 4ZTJA 2OEMA 3VAKA 3IBFB 1V85A 3HK2A 4BWMA 4IYQA 5IIKA 4UB4A 2RHQB 9ICNA 4G9ZA 4NXNJ 1V9PA 1E6VA 1HQEB 4DR4J 1PYTA 1ZBTA 4CO5A 3VERA 3PW2A 2KRRA 2R7QA 5KI6A 2PFFB 2DR8A 2XY8A 4UQGA 3FMBA 2ZIVB 2LA4A 5JLFA 2VC1A 5L1MA 4OHXA 4F91B 3OYNA 1FFUA 3CCEN 3POTB 5KFPA 2FC9A 1KDHA 3V2UC 4PWDB 5E3RA 1U2VA 1RBRA 4CGJA 2VA8A 1NNEA 3ZLJA 5HJXA 1VQ4N 4M3XA 3H2LA 3G6YA 4DR5J 3VQBA 4CEFA 2MY7A 3QUQA 2Y9UA 3RSEB 5F8IA 1VQKS 3D5MA 4KLEA 1YIJS 1HR0J 5LOQA 4JI6K 1TL1B 3M30A 1ZAXA 1EKEA 4B3MF 1F5AA 2F8LA 4DR2K 4NLBA 1YJRA 3ILJA 2YY3A 4CGGA 5CHIA 5E41A 5D15A 9ICTA 2VD3A 1YJNN 1EQMA 4ZVEA 3CERA 2ASYA 1S5JA 1HBNA 2GS8A 2BA9A 3M1VB 2W25A 1CJUA 2HRUA 2OZMA 5GIPA 1PK3A 4ZLNA 5LMNJ 3OTEA 1N60A 3QU5A 2J7KA 1CQMA 5IM0A 3VGLA 1MNEA 4FN5A 3AVKA 2LMIA 3KIOA 8ICTA 5AKGA 1ZQKA 4BRLA 4PWUA 3D7SB 1U1QA 3UKUA 4LY7A 2WBRA 1QHAA 5M1FA 5J2PB 5ALNA 3MM5A 3QUCA 1U6ZA 1SZHA 2YQ1A 1T05A 3BGOP 4O5KA 1K9MO 3MM8A 1V5IB 1PYOB 1OH7A 2DFHA 1FWLA 2H48B 3VALA 1UFKA 2DXEA 2C3PA 4R64A 2FZGB 1CZAN 3J81U 1BIZA 4DF4A 3I56N 5IS2A 2EAMA 4DL6A 3PZPA 1QLNA 7ICEA 4CEBA 1D8LA 1ASVA 1FKPB 1ZM9A 4JV0A 4JHDA 1VIXA 3GYGA 1IBKF 4WKYA 2ZC3A 5AQJA 2G5HB 3BBFA 3IBPA 3QJJA 1VQ5S 4R79A 1SB6A 1RNHA 4YQWA 1S6UA 2XG8A 4OZLA 3TR5A 3VA0A 5HSPA 3CJAA 1COOA 5TISU 1IM4A 5SUHA 1WSFA 2IYGA 5E5NA 2DYAA 1YRXA 3UVJB 2XS2A 5IQ6A 4OYZA 4JMUA 3Q2TC 3AD9C 1WC4A 2VFTA 8ICMA 2DVIA 3TSPA 2YX1A 5B0BA 5G4DA 4A61A 1V3ZA 4PQUB 2G4BA 4Z4CA 1AFIA 1B99A 2VA2A 1WC5A 3IR6B 2HHTA 4BY9C 2K2PA 3JPPA 1LW2B 4MDAA 4NXNF 4K5RA 1W7AA 4DR4F 1VQKN 1S6QB 3OA9A 4Q8EA 1SKUB 1FWPA 2IJNA 3UNGC 1JWWA 1YIJN 4O0IA 2P6RA 3AB2B 1N5SA 3QYYA 1TKXA 2Q43A 3QNMA 3ENAA 2H4WB 3J81O 1BPXA 4DR7K 5GTHU 1NPPA 3HHEA 3JPTA 2H3ZA 4DR5F 1NDKA 1DARA 4CDIA 1EETB 3OW2R 3PW0A 1KLMB 1LNQA 2ZJPQ 2WB1F 2GLEA 2GNKA 3IMXA 1X4DA 3KLFA 1HR0F 3VEOA 4AYBF 3MXIA 4H5NA 4ZPTR 1C1CB 4RQ2A 3DRXA 4A2AA 2QLXA 3AQPA 1D8BA 1SKSA 1XMQK 4Y1DA 1LKYA 5KFVA 2X6NA 2OEKA 5SWMA 5J8YC 4DDFA 2R8JA 4LJXA 2DGOA 3THPA 3NAEA 3PMNA 3RMDA 3THXB 4DS5A 1U9LA 5D0RA 5LMNF 4MIWA 3MPYA 3M8QB 3KWIA 1SGGA 3NVMA 4FJHA 4AL7A 4I67A 3V6KA 2D9PA 2Q6BA 3PSIA 1WUUA 2RRNA 4EP4A 3HOTA 1J2MA 2LI6A 2J9EA 1MROB 2WBNA 1P27B 4KSEB 1VJWA 3AA8A 3K5MA 3AVLA 4GW6A 2X78A 2YQ0A 1K0VA 4IRKA 2DRBA 3LP1A 3GL1A 2RE1A 4NRTA 3D3BJ 1N8RT 3K89A 3T19A 3DRRB 1VQ5N 3OR1B 4M5KA 1R89A 5K8PA 1G1XA 4QR0A 3DV9A 3SZ2A 4CLYA 5HMZA 1YITS 3MCAB 4KGVB 3FNNA 1LWEB 3CJ7A 2VF3A 2IMOA 2KJ9A 1X0FA 4OJ5A 2XICA 4NLRA 3JTPA 9RUBA 1WCNA 3DLKB 5HP1A 4C2MA 4I6AA 3HHKA 4NLNA 4DTXA 2EWHA 1C7YA 5DB9A 3T1HK 2DXDA 4KTQA 3EXYA 2RE2A 3SD7A 3GR1A 2AH5A 2EBEA 3DU5A 2B4PA 2W4PA 3OL9A 3D1HA 4CGIA 3ZTRA 4Q5VA 1JLFB 3NTUA 3BBCA 4DB3A 3CFOA 4KYZA 1B7FA 4RNMA 1YBTA 2BUNA 4BQZA 3G6ES 1QQMA 2CFXA 4PA1A 2BJ7A 4DX6A 1A5VA 2ZIXB 5M1NA 1AUDA 2HFOA 4J9OA 1JLAB 4ZJOA 1XQIA 1EQ0A 2D1KA 2HZCA 4KLOA 1S9FA 4CJ3A 3C7NA 4KPCA 2RN2A 3WHIA 2J6TA 3CD0A 5T7LB 1FXXA 4USIA 5HBMA 3RJJA 4YOUA 4AM6A 1GLLO 1MMNA 2FMQA 2CRXA 5AJ3K 4YVZA 3RJGA 4ACOA 3Q8SB 2P5GA 4LF5J 2CZ4A 5DBCA 2QB0A 5J0SA 4UW2A 3F73A 4I2BA 3KDOA 2ASJA 1KHVA 3IP0A 3L7UA 4FF4A 3PRDA 1RYRA 3ENVA 1XHZA 2C22A 1COKA 1VK0A 1S1TB 3VETA 4KFBB 2N7YA 2OJ3A 2YPZA 4EYIB 1WD6A 3L4QA 2P9NA 1TL3B 3ZI4A 3QINA 1AZSA 2A18A 1L7NA 4CI6A 2V67A 1NK8A 2IOFK 3DM2A 3C2PA 4MAKA 4N56A 3P4UB 3TUIC 4XIUA 1N36J 2OIHA 1Y3KA 1AUSL 4RW8B 3AGRA 2ZOGA 1ZQAA 4HEA9 3OYEA 5BR9A 2AGOA 5DS7A 4F5OA 4RNNA 3DLGA 4EU0A 4TVAB 2YMQA 3RBDA 4AT1B 2P9LA 2GVZB 1LK7A 4IO1A 4F0KA 4PGXA 3C6AA 1VSLA 3QT7A 2MJNA 4YB5A 4P2XA 3LP3A 2UXBK 1E4FT 1XSPA 4PHEA 4FLYA 2DFFA 4GO7X 1L5UA 1DK2A 5AQQA 4WQ4A 3TA2A 1BI4B 1OH6A 4MHVA 3H8YA 3HVRA 2F4VK 1WF0A 1VRTA 1TK8A 3SSSA 4F67A 1VHXA 5AQSA 1U0HA 4G1QB 3SQ1A 1TL4A 3FEYB 3TR8A 1YT3A 3PKYA 3H42A 4NLUA 1KAYA 4UATA 1RA7A 3HSGA 3CC7S 2DNKA 1FJEB 4DV4J 4YP3A 4KHRA 1S9GA 3B9JA 3ULEB 3ET6B 3S6JA 3IG8A 2FMPA 3LGHA 2YNHA 3QIPA 1AQ6A 3SQIA 4LSLB 1F9EB 1RAFB 2HZVA 4OJRA 2OYQA 3RRGA 2R7UA 4BUGA 3ZEUB 1KC8T 2AYEA 5FPDA 4M63A 4CK2A 3C23A 1WEYA 4ALZA 1N63A 2L41A 4CBWA 3TFRA 3MDQA 4NI2B 3G6EN 4OZJA 3EUNA 3KHGA 3CJ3A 4IS7A 8ICWA 2HFNA 1WSJA 4UY8T 1RTJB 4WTYA 2LQ5A 4EHUA 4DR3K 3AXMA 1EX8A 2CPJA 4Y3CA 5BYQA 1XERA 1HIWA 2Z1HA 4JD2A 3C15B 2ZH8A 1RAEB 4WYLA 4C7ZA 4JI1K 4IXCA 3CNHA 1DLOA 1S5ZA 4F36A 2ILYA 4X62J 5GAHI 3LVWA 5F0UA 5AQPA 1H98A 2F9TA 1XSNA 1RHUB 1S1VA 2KVIA 3IDWA 3OTOK 1ZD2P 1YVFA 1F5BA 5AIBA 3FBEA 4TYAA 2PN6A 1VSFA 4ZITA 1B4FA 1XMBA 3QFPA 1Z2ZA 2ZE2B 2F8EX 2K8AA 4EK2A 3D2WA 4ZPWR 4GKKJ 3VCBA 2OKQA 3O9RA 3S3MA 2FJBB 4DFJA 1NBEB 2XULA 3TABA 1UFLA 5FD1A 5A8WB 4ISGA 1I3AA 3MAAA 3ITHA 1YVUA 3F9MA 3A8KA 2V4JA 3MR3A 2WMMA 4LF5F 2O4GA 3OYHA 3QNWB 2EVZA 3I0RB 4X4SA 4Z2XA 5HRRA 4K4IA 5LSLA 2VJ5A 3IG1A 2NPFA 3O9UA 2QFIA 1LCUA 2HMIB 4ID5B 4KI4A 4CW7B 1WTFA 1NH8A 2P9KA 1KQGB 2FLNA 1FI4A 3WK5A 4HACB 4QCLA 4F4ZA 3OFFA 2DHGA 2C2MB 5DBAA 3KFUF 2AW0A 5HVHA 4IRDA 1WNSA 3AVAA 4FZYA 5HATA 2CDQA 4P74A 1ZBLA 2R18A 5EHHA 5HMLA 4DV7J 2HNYA 4ENOA 3A8EA 1WG5A 1YJ7A 1N36F 9ICLA 3IWLA 2YQEA 2NLXA 3MC1A 2P9PA 4DUZJ 1VQ6S 5ADXH 4ZIVA 1HYVA 4GV6A 4X66J 3R5BA 3MXJA 5IINA 1VQYA 3TYTA 4N76A 2BZ2A 2PD1A 3TOQA 5KG0A 2A3VA 3CCRS 3V4IB 3I8BA 1JN3A 2QLTA 1RAOA 1HX1A 1D3WA 4Z6FA 1LFPA 6FDRA 2RQMA 7ICRA 2O8CA 5FPNA 4OJGA 2NO5A 1C20A 4DHYA 5DO2A 1T9UA 3VHQA 4JP8A 2PEHA 4JN4A 5CJ7A 4CFAA 2VPXB 1M5OC 5U47A 2IA0A 1MWKA 4ZCKA 1DJ0A 1S10A 1UEVA 1FRIA 5DB8A 2B7BB 4DV4F 2LFVA 2WF7A 2YMMA 3MM7B 3NWGA 1SV5B 3UKRA 2B6GA 4YDXA 2DY1A 4Y2QA 3OJSA 1SQEA 2QL7B 5HVFA 2MU2A 4FPIA 5AM4A 4Y28C 4JI3J 4BVPA 3SPZA 2QKQA 2N7CA 1ZS6A 4CZGA 1D0EA 4LSZB 2ATQA 3X1LB 1APSA 3ZSZA 5GAHP 3Q8YA 5ETQA 1H74A 2MB0B 1QZ5A 1X1PA 3M05A 4JI4K 1NPRA 4JKHA 4YG2A 3R3TA 3C21A 3N6NA 2P2CB 2IVFB 3A8IA 3TX8A 5CRXA 4UB5A 2P9SA 1DAXA 1F5SA 2VQFJ 1RGVA 1RU2A 3IS9A 1NI3A 4LF9J 1JXBA 1XO1A 2CJ9A 5EWEA 4OLOA 3HXMA 4LD0A 5KGXA 3FUYA 3EJMA 4ZPAA 1RT2A 3CCVS 3RR8A 1HKAA 5A2QY 4Z0UA 3DCAA 5BYSA 2K89A 1RWNB 2ZNZA 3NNHA 1C4CA 1QSSA 4RW9B 1IN0A 2EFOA 4W5RA 4X62F 2D1CA 4F7VA 3TARA 2F1FA 2Q31A 5GVQA 1I51B 4ECRA 4R63A 3D6HB 4ED3A 2POKA 2XWXA 5D4OA 8ATCB 1ZQOA 1Y88A 4QZIA 3KWMA 4GKKF 4E1JA 3PJ9A 3LANA 1O03A 5KFKA 4PGYA 1LAWA 4JI7J 3M6XA 4AE5A 1GXLA 5BPLA 1Q3VA 2IVPA 1X4BA 1OYEA 2HFZA 3K7RA 2LEAA 1MWMA 2NXNA 2HAIA 4UB2A 3QFWA 2EZYA 4KLQA 4C11B 3G71S 2FJVA 2F7VA 5L1IA 4KJIA 3JTNA 4X2BA 4RG8A 4C8YA 1R7IA 1YZ6A 3IC1A 4FYXB 3BV8A 3CCRN 2CQ4A 3L0QA 2W3SA 1CJVB 2V2VA 4BVOA 4IQVA 2CPXA 5GMKa 1VQPS 3DRSB 4W5TA 3US5A 4A8YA 5BREA 3OYJA 4XRHA 2FD2A 3CJ9A 1CC7A 5DG8A 3DXMB 4DV7F 3DWLA 1JB0C 1IQZA 3AQFA 4DUZF 1D09B 2UXCK 2ZH6A 4X66F 2YHWA 4DTSA 2W9CB 4MF2A 2L3MA 4MEYA 1W26A 5ALPA 4J2AA 3QT6A 3BM7A 3QNNA 4UY8O 4PG6A 2RQ5A 4OKJA 3WK4A 3WBZA 3DMJA 2YXLA 1HWJA 3W5ZA 4M94A 3BY5A 1RDFA 1TV6A 2NQPA 3BEXA 2GIFA 3HPGA 5KFBA 3DU6A 1C1BB 2RKIB 4MFAA 2ROPA 3VQAA 4DTPA 4QYZJ 3LDNA 2PKEA 3UD5A 3FEZA 2IBOA 2W43A 2ALZA 5KFXA 3BSNA 2QRRA 3UE5A 2BCUA 2VC0A 2LQJA 5LY3A 2A1AA 2QWOA 2XMVA 4IOBA 2AXTU 1T03A 3FYHA 4J9PA 2B4UA 4M5LA 1X9SA 2CJKA 4FJGA 4NASA 2LM4A 5HJYA 2HOEA 1ZBHA 1P9YA 2P5OA 1TKTB 4CO0A 1PZNA 1IXKA 2F1JA 1U48A 2PZSA 2EX3A 3CFRA 2HEKA 2PYLA 3QESA 5IT0A 2M0NA 3CCVN 1ZPWX 1RZTA 3JPOA 2N82B 5J0PA 3NAIA 2VYPA 3NH0A 3PX0A 1M1HA 3G9CA 2ZKUA 5ALSA 2PI4A 4TLQA 4CJSA 3CJTA 2P6UA 4KH1B 3VQCA 4JV2A 4PCQA 3GIIA 2VQFF 3I5BA 2B4JA 1Y9OA 1YJVA 4FPRA 3DJCA 7ICKA 4LF9F 4Q0BB 4BDPA 4PXEA 5ALKA 1XR7A 4KLHA 4WP8A 5DDRC 4NYFA 1H73A 3CUNA 1S77D 4AXJA 3MR5A 1O08A 1ZC6A 2LLZA 5E2QA 2MKYA 3UXNA 2IVMA 4OI1A 1KVAA 1TUUA 1TL7B 1Q8IA 4Y2PA 3RZAA 3RTVA 2ZZTA 2HSTA 4BE0A 2W4DA 2Y0SD 3VWSA 4H8KA 2B3TB 3G71N 3U6FA 1V4TA 1ZBUA 3NBPA 1LOUA 3WT0A 4KHPJ 1VQMS 1RTZA 3TUZC 4EFHA 3NF9A 4X4TA 2EK1A 4RQ6A 2PDAA 2ZOMA 3BB5A 1R8AA 4TU7A 5JICA 2YPYA 5K14A 1EIYB 3CCMS 1N5QA 3QQCD 2DNNA 3AO3A 2OTJS 4F93B 5KFNA 1CULB 3I0SA 2D0CA 2RP5A 3VAIA 4DLEA 2CPZA 1HUOA 4WFAL 1U7LA 5CABA 1B3TA 4FWQA 4CECA 2HGNA 4ITSA 4R0EA 2ZIUA 1X6JA 2CA9A 3RG6A 2JZBB 3ISDA 4QZDA 1MSWD 2OPRA 2WSFC 5D78A 2QK9A 3SCJE 1U1NA 1JLGB 2K7JA 3O4NA 4JI5J 4H0YB 4KLUA 4CE9A 4GKJK 1A9NB 3JSRA 1JJ4A 3ZDDA 3GJSB 2EEYA 2XO6A 4BRMA 1KVBA 2QB1A 1IG6A 1JLCA 1YUWA 2FQQB 3UN5A 1RT7A 3H5UA 1FT8A 1FCAA 4QZ8A 8ICJA 4HTUA 2D69A 1ZQSA 4EGLA 2QMXA 5EE0A 2F3JA 2E2QA 4LIRA 2GQ2A 2MA1A 2RVJA 4ZJLA 2DKOB 2JJ4D 2YCHA 2IHNA 1BA1A 1Z1VA 1LWFB 2IPOB 2O01C 2GCFA 3S1TA 4ED8A 2K4PA 5F0XA 4ZPCA 4KLSA 1IWGA 4OYPA 3R9KA 4FJNA 2P6SA 1HPZB 3GIRA 2J9CA 1J5OB 1EX4A 5BOMA 1RT1A 2M4MA 3AVMA 2JMGA 3KLEA 5L1KA 4YY3J 2CGJA 4BXOA 4JEPA 4M5IA 2ZJ5A 4QNLA 4UTGA 4NM1A 1U2CA 2MZRA 2X3GA 2OSQA 4CYUB 4L3KA 1VS3A 3NXZA 3QZ7A 3O0FA 3P31A 4RBVA 1VQOS 1HYSA 2BBEA 2XMTA 4IQXA 4HVZA 4FPBA 2DTJA 1RTDA 2P35A 2VANA 1QVGM 3E9PA 5E84A 3N9UC 1RT6A 3LDAA 3KKAC 1XO0A 5IIJA 3E9OA 4X84A 3QEVA 5I3QA 2WSEC 1ATRA 3QUTA 1CS4A 3I5CA 2VUGA 2XI2A 1Y5IB 1UAXA 3IGNA 4QJFB 4JYAK 1RT5A 3L7OA 1SBRA 4DU7A 1QE1B 3MEGB 4C8NA 1NGGA 4BG8A 4YD2A 1WI6A 2B7CB 4TSXA 3D6FB 4M42A 1A5WA 3L5KA 4WF9Q 1H6KX 3PUFA 4PKDB 2WB4A 3OHBA 5KFAA 1S1XB 2K4EA 2AX0A 3D2FA 5F3TA 1QQ5A 5AQUA 5HL7L 3V9ZA 2OTJN 2KFNA 4OZ2A 5A8RA 3UXOA 2WONB 5EN1A 2HLUA 1QQOA 2FPKA 2A2DA 4H0PA 3PSTA 1R8PA 1T9TA 4DZDA 1XNSA 1EARA 1FX2A 5KFMA 5J2DA 2BKEA 3MEEB 3GDXA 2IVYA 3L95X 4KHPF 2RQKA 4CCHA 2QKBA 2B9WA 5DGBA 2Q0UA 4AH9A 5B0AA 3C6HA 1OKJA 2FHOB 1IBMJ 3KHYA 9ICOA 1RTHA 4E2FB 2J7WA 5AE1A 4U7BA 5CYMB 3RB6A 3LGMA 1DZ5A 3MK6A 5DLFA 3OT9A 1A7GE 5J0XA 1IG8A 1MWQA 2D3O1 5T14A 2VKZG 2OYYA 4AD6A 5H1SQ 2D3UA 4NZ7A 1IBLF 1Q79A 4YD1A 4WU2A 1NNLA 2CYYA 4ZN1A 3TI0A 2JEGA 3HULA 3M2RA 4KITB 4BS2A 5DDOC 4JI5F 3PG9A 1S4FA 3Q8KA 1JL1A 1YI2S 2QI2A 1N88A 2W2NP 3LALA 2J8SA 3SUQA 1F3FA 4P7VA 4JRPA 2WZ1A 1TUWA 3IAM9 2Y0BB 3V6JA 2AJQA 3K2PA 2NRTA 3K59A 3EE3A 1BCOA 1K8KB 1VHFA 3IRXA 4IFYB 2D0AA 2NR0A 4DPXA 3ZSXA 1WHXA 8ICAA 1RHRB 4A8WA 3MPDA 3SEOA 3EKSA 4LFCK 1CQNA 1NAQA 1Q18A 3IV6A 3UWTA 4DN9A 3CJ1A 3TTFA 4JI8F 3TRGA 3M7DA 1FNXH 5KFFA 1Q1KA 2E7XA 1YXQA 2WK4A 1HNVA 1X4EA 3C16A 2ACYA 1M5VC 3IP4B 4H4OA 2MHEA 2G8KA 3DXBA 4OV1A 3MCNA 2DNMA 3U4LA 4ZVFA 3MCPA 4FYYB 5B0FA 3CCQS 4FYDA 1S0VA 4QZGA 1NH7A 2R8HA 1VRQC 2A3JA 2DHXA 3R5JB 3VVUA 3MURP 4YY3F 2EZZA 1DOQA 1M90T 1RBTA 4E89A 1NDLA 2KXNB 3NDKA 3ZZRA 3J81Y 4DX5A 2JNJA 4CFBA 2V2ZA 3KJFB 1WKLA 4EYHB 3N4MB 3JYTA 2CKWA 8ICPA 1RQNA 3KMSA 1SQFA 1K5OA 3M6UA 3LPYA 4K0KK 4OX6A 4QYRA 1RK8A 1VQ8S 5M2UA 2MKIA 3OUYA 3AUOA 2O8FB