1NJWA

Guanine-thymine mismatch at the polymerase active site
Total Genus 211
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
211
sequence length
580
structure length
580
Chain Sequence
b'AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA PRIMER STRAND
publication title Structures of mismatch replication errors observed in a DNA polymerase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 211
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2003-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1njwA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1njwA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1njwA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1njwA01
3SV3A 4DFMA 1ZQWA 1TVAA 3V9WA 2HHXA 4ICLA 1B9DA 2IHNA 3JPQA 2ZUDA 3DLHA 3IHQB 3HL8A 4YG2A 4ED8A 3C6UA 3QESA 1IG9A 3ZDEA 1UT8A 3TFRA 3DRRA 2RPIA 1SKRA 5KI6A 2W9CB 3OGUA 4E0DA 2ZD1A 2HB5A 3ZDBA 5L1IA 1T4GA 4OKJA 5DMRA 4CJSA 4E89A 2Z1JA 2LYHA 5KFLA 3QEAZ 5CA7A 2NRWA 1HYVA 3RAQA 5BOLA 3QEWA 1BCOA 4Q45A 3HT3A 1ASUA 2XY8A 3WNHA 1BPXA 4Q43A 4ECVA 4J2DA 1TV6A 2XGQA 1UA1A 1VSLA 3UQ0A 3PX6A 3DM2A 3V81A 3PNCA 3D45A 7ICNA 4RQ5A 4F5QA 3Q8KA 4O9MA 5CYQA 5KFJA 2XGPA 3M8RA 5I3UA 3DI6A 5J0XA 1UOCA 4I27A 4F8RA 3PW5A 2YNIA 3QIPA 1VRUA 1QHTA 3AA2A 3NTUA 2FBXA 3MXMA 5L1KA 3L2UA 4DQSA 4DSFA 5IIOA 1NK7A 4KLMA 4CFBA 4Z4FA 1NJXA 2DPIA 3CFOA 3K58A 3DOLA 2G8VA 3EYZA 4PPXA 4HUGA 3C1ZA 3DLGA 2HHSA 4DQRA 5EWGA 4Q0BA 3ZT1A 3JPNA 4CF8A 4FLZA 5KFRA 1NK5A 8ICNA 4E7HA 2I9GA 5CWRA 8ICAA 3T5KA 4DU1A 3Q8MA 7ICTA 1U48A 1NKCA 3P1GA 1KFTA 4OGEA 8ICGA 4CK1A 2UVRA 1A77A 1RDAA 3RJJA 3TAQA 4I2QA 3RB3A 8ICMA 2UVVA 1ZQLA 1C1BA 4KHNA 4TQSA 1S1WA 3T5LA 4MFFA 4IG3A 1BIZA 1JXBA 3WNGA 4W5TA 4J9OA 8ICCA 2KFZA 2IDOA 4Z0UA 3HYFA 1QSSA 3ZCMA 1S97A 4C8MA 4DTXA 3VQ6A 4CEQA 1K1SA 4GC7A 3Q8LA 1V9PA 3H8SA 5KT2A 4NLNA 1ZQJA 3EW9A 4ZHRA 3SNNA 3MGHA 2YKNA 3RMDA 3M8PA 5KG4A 3JPRA 1REVA 1S1UA 3VQ7A 3VA3A 4AHCA 3LP1A 4ED6A 2Z1IA 7ICLA 4QZGA 5DDYA 3C94A 4DTOA 1RBSA 3KK3A 4FJGA 5J0SA 1JKHA 1S1TA 1C0MA 3AVCA 3RB4A 2OZMA 3FYHA 2YNHA 2F96A 1WSIA 4P4PA 1T03A 1ITGA 4I2PA 4BDYA 1IKYA 4XQ8A 2G8UA 2FBVA 4CK2A 2IMWP 7ICMA 3TAMA 2G8HA 1RDCA 3QIOA 4PGXA 2R7YA 4M3WA 3E2EA 4B9UA 3RB6A 3PX4A 1LWEA 4F5PA 4MF2A 5KGWA 1RILA 4FM0A 3ZD8A 3QEIA 3IAYA 5K14A 5DG8A 1ZQKA 1ZBFA 3QERA 4CEFA 2XCAA 3ZD9A 4HCBA 4PA1A 3ZT0A 3MAQA 4FJXA 5JS2A 1QLNA 4B9VA 1A5WA 1S9GA 1NJWA 4X5VA 1D9DA 4ID5A 5CZ1A 4B9NA 3C2MA 4R64A 2PI4A 4QZEA 3RH4A 4I9LA 1TGOA 3DRPA 9ICVA 1XWLA 4FYDA 4OJRA 1WSFA 3OYAA 1S0OA 3LALA 3L2RA 3OYEA 4BACA 2ISPA 4KREA 1X9WA 2OPRA 1QTMA 3C2KA 5HMMA 1Z00B 2ZUCA 4KLQA 2Z1HA 4Z6DA 5KFQA 1ASWA 3HPOA 5KRTA 3V9SA 5KFOA 4CJTA 4ZTFA 5KFCA 5HMLA 1A5VA 3NFAA 2KZ3A 3B6OA 3O4QA 2EHGA 2ATQA 3PY8A 4KFBA 3T19A 4FM1A 2KQ2A 4Q44A 4O0IA 1WNSA 4YMMA 9ICPA 1C7YA 8ICUA 5HROA 5KFBA 2G8WA 4Y1CA 1PZNA 3AVBA 4Z4EA 2ZUBA 2BPFA 1RBUA 3ZSOA 4YP3A 1XI1A 3V6JA 3L2QA 3VQ4A 4CIEA 4O3PA 4DTSA 1Q9XA 4YMNA 4CF2A 3UXNA 3H8WA 1MQ3A 3OS2A 9ICHA 2FPMA 3MR2A 1TK5A 3ZDAA 4P4OA 3QLHA 4Q8FA 2G8FA 3SPYA 3N4MB 7ICOA 4PHEA 4ED0A 1ZQBA 3SCXA 2B6AA 4DS4A 1U47A 4DL3A 3SI8A 4HUEA 3MDCA 1BI4A 4CEZA 3V7LA 7ICRA 4QZ8A 1KDHA 4I2DA 1Y88A 1TKXA 4CHZA 9ICFA 4FLYA 4FVMA 3ZSXA 3RRHA 1S5JA 1RTJA 2R8JA 4YMOA 1ZBLA 3FFIA 3NGZA 3I8DA 4YXJA 4DEZA 9ICUA 3DLKA 3OYJA 4YVZA 4UAWA 1L3TA 4EYIB 2P51A 1ZQTA 4IFYA 4E19A 5J2AA 3GV7B 3QZ7A 3KK1A 4UB4A 5DQIA 2XY7A 4FBTA 2JGUA 3LP3A 3P83D 3NH2A 3MR5A 1YT3A 1BGXT 4QZBA 4W5NA 1BCMA 1RT1A 4OLBA 2HHWA 3L3VA 1IKVA 4MQ3A 2IC3A 2Y1IA 4IDKA 4OPKA 1KVCA 3RB0A 1GOCA 2XY5A 4JK1A 1VSIA 2DTUA 4CFCA 2F8SA 1YTAA 2UVUA 3OJSA 1CLQA 3ZSWA 4GXKA 3SI6A 1BPDA 3NE6A 1KTQA 1C0TA 8ICTA 4IR1A 4K4IA 4K4GA 4EEYA 2IOCA 4CJ3A 4RQ6A 1VSHA 3V6KA 2FPKA 3VQCA 2JZBA 4JWNA 1ZQQA 3TAFA 3SUNA 4NLGA 4OKKA 5C24A 3QETA 4CEAA 4ECSA 1JXEA 1RPLA 4ECUA 4I9QA 4RQ1A 4FXDA 1RXVA 3T3FA 4IR9A 1TKDA 4W5RA 1QS4A 2RDIA 2FMSA 3NGIA 1RDDA 1ZQCA 5KFTA 3KHGA 5CR0A 2P6RA 2ATLA 4DSJA 1ZJMA 4IRDA 2XHBA 9ICBA 4CERA 4FCYA 5HHIA 4E7KA 3PO4A 3GDXA 4FK2A 4RT2A 3ISDA 3LAMA 4FZXC 3IS9A 4E7IA 3MBYA 4FS1A 4QZIA 1KVBA 4CIGA 1ZBUA 4UBBA 1ZBIA 5D4BA 2IBKA 2KZMA 3HVTA 4F5RA 4CF9A 5KG5A 8ICWA 5KFNA 9ICLA 3MGIA 2W42A 3SPZA 3VQ8A 5J2BA 2PFQA 4FJ8A 4J9MA 4M9GA 4K4HA 3V9XA 3AVKA 4FLUA 4GLXA 4FK0A 3SQ0A 4KTZA 4CEBA 4FW1A 2AGOA 5J0QA 1NK0A 7ICSA 2AU0A 2XRIA 4ID1A 3JSMA 3MFHA 3MR6A 3V7JA 1J54A 2OPSA 4R63A 5KFIA 4RUCA 4C8LA 4CJWA 3LDSA 5CYMA 1H38A 8ICBA 4YN4A 5SWMA 3SQ4A 1KLMA 2NUBA 3MECA 1Z25A 2HHTA 2G8KA 3MEDA 4CGGA 5KG3A 2B4JA 1ASVA 4EP4A 3QNNA 2X78A 2ZTCA 4I2JA 5IINA 8ICFA 4AHSA 1O1WA 4I29A 4IQVA 1SUQA 3NAEA 3QNOA 4IQUA 1SL1A 4DL2A 3RMBA 1JLFA 1LB2B 4C8OA 1SKSA 1S9FA 1ZQRA 3H40A 3RR8A 3MEEA 3WNEA 3HXMA 3TAPA 4CE9A 4FZYA 3K5OA 1YVUA 2QKBA 2VA8A 1WSJA 4Z6FA 3G6YA 3DRSA 5J2MA 1WN7A 2O4IA 3LZIA 1S1VA 8ICJA 2NRZA 2HNYA 4RQ0A 2W9AA 4O4GA 4LY7A 4JRPA 3NF6A 2LSNA 5J2FA 1MU2A 9ICWA 2RDJA 4GVMA 3QE9Y 1S0NA 4CK3A 1S6QA 1ZJNA 1ZQMA 4EBDA 4YXMA 1RBVA 5HHHA 1A76A 2BHNA 4JLHA 4RW9A 3Q8PB 3HPHA 4DOCA 3G6XA 2ISOA 2NRTA 4YNQA 2BCQA 3LDAA 3V72A 3GILA 4KO0A 3QEXA 7ICJA 1D8YA 4ECQA 4ELVA 1L5UA 2W9BB 5HBMA 3QEVA 4FW2A 4RPZA 4O3QA 4J2BA 2ASLA 4NCAA 4B9TA 5KFEA 1RXWA 2B5JA 4F3TA 3TARA 1BI4B 3NHGA 1SL2A 1JLCA 4CEEA 9ICKA 4R8UB 5L1LA 2VG5A 3HW8A 1J53A 7ICGA 3AO3A 1UAXA 4QWDA 3LPTA 1CXUA 3N97B 7ICVA 3ZSVA 3LAKA 1XSPA 3CQ8A 4YR0A 4F91B 3AA4A 3LANA 3VQEA 2F8TA 4TUQA 2HHQA 3UQ2A 2NRVA 5KFGA 1RTIA 3BQTA 2OPQA 2HW3A 4YR3A 4BDZA 3M8SA 3G6VA 3RJEA 3RJGA 4AHUA 4CJ5A 4G3IA 1Z26A 2E6MA 1EX4A 3MDAA 3HWTA 1JLEA 9ICOA 4MF8A 3F73A 4NLKA 1VRTA 3M9OB 2HNZA 2G8IA 1HNVA 5L9XA 3CG7A 4NYNA 1JL2A 4QZ9A 1DTQA 4CJUA 1BQNA 4FK4A 5DBCA 1JMSA 2VWKA 3RBEA 3ITHA 4AHRA 5CP2A 4DFPA 2BQUA 2F1JA 5J2NA 3K4GA 1ZQSA 4C8NA 1X1PA 3ZT2A 3SUOA 5KFUA 5DKWA 2DY4A 4O5EA 4LSLA 3UXOA 4RUAA 3AVFA 3QINA 5D49A 3O3HA 4KKOA 1ZQIA 4KLIA 4DO9A 4HHTA 1SKWA 2ZJ5A 3UPQA 4YD1A 4ECWA 3HO1A 2JZBB 4DFJA 3AVLA 4IRKA 8ICIA 5EWFA 4K8ZA 3ETLA 1XSLA 5J1EA 4KLGA 5KFYA 3NGDA 4PHAA 1WCNA 1YTUA 4DL7A 4FLTA 4O3SA 4PUOA 5J0OA 1KVAA 4M9JA 5BPCA 1C1CA 4BWMA 4NY8A 2BQ3A 2GWSA 4LD0A 2M9NA 2FC0A 4M04A 4DL4A 2R8GA 4CJRA 2WONA 1BQMA 2AQ4A 5KFVA 3C6TA 3S3MA 3C95A 3AVMA 5FRMA 5TZVA 4CFAA 4AHVA 4NLZA 4ED2A 3M9MB 4J9NA 8ICKA 1RNHA 9ICGA 4M3YA 5IIIA 2BCVA 5J0RA 3AU6A 4CGHA 2RN2A 4O3RA 3SYZA 1HUOA 4RG8A 4ED7A 2BKEA 4KLHA 4HTUA 1JLAA 4M3TA 7ICFA 1B22A 2XO7A 3K59A 1BPBA 4Z4IA 4DLEA 1XC9A 4ZTJA 1JLGA 2XY6A 4J9LA 1VSFA 3ZSYA 1ZQNA 1RZTA 2JLEA 4DQQA 4KHUA 3OYFA 3OYCA 4CJPA 4BWJA 4CJFA 4DU3A 4YFKA 1VSKA 4I2HA 5J2HA 4F2SA 3OYGA 3MXJA 4CFDA 2D5RA 3CM6A 4FJNA 5EOZA 3RJHA 5J29A 4RPXA 2A1RA 4RQ8A 2FLNA 2BCSA 1HMVA 2ETJA 5HRRA 1KLNA 2Y1JA 4FJJA 1J5OA 3RAXA 3KD5E 4XIUA 1NJZA 3H4BA 4PQUA 2MAXA 2HNDA 1Y97A 1L3UA 5KT3A 3A2FA 4NCGA 3TWHA 3PW4A 5KFKA 4JS5A 4E1MA 5DGBA 1S6PA 4LH4A 2Q3SA 5J2DA 3V1QA 1B43A 4YFUA 4M3ZA 4KTQA 4M3UA 4DQPA 3NGYA 4F5OA 3VQ9A 4I2FA 2FBYA 1JX4A 2V4RA 5KG0A 1HYSA 3RH5A 3KKRA 4PGYA 2VA3A 5KFAA 4OGCA 3C1YA 1BPYA 3QZ8A 1XSNA 2GBZA 4J2EA 1CZBA 3GIMA 5C5JA 1IO2A 4AH9A 5DB9A 1IH7A 4JV0A 4DU4A 3GIKA 3NF7A 4CCHA 4PHDA 1RT2A 5KG6A 3ZT4A 2J6SA 5J2CA 4J9QA 2ASDA 1X9MA 4Q5VA 3GIIA 3RR7A 3NF8A 3SZ2A 4KAZA 2W9BA 9ICRA 3DLBA 4UQGA 3GV5B 1GOAA 3ISBA 1HUZA 4H8KA 2OA8A 3AVJA 2PYJA 3HPGA 3VA0A 4KMUA 2KZZA 4O0JA 5EWEA 3LP0A 2W8KA 4KRFA 1UT5A 3PR5B 3PO5A 4R8UA 1JN3A 2DPJA 2ZQBA 3KIOA 2BCRA 3IG1A 4CGFA 4DF8A 3NCIA 4KITB 4JWMA 9ICIA 5KTQA 3MXIA 4Z4HA 5CJ7A 3HM9A 5HRNA 5J2IA 2IA6A 2PXIA 3AVHA 3OYKA 4RQ3A 4B9SA 4ZH4A 1BHLA 3OY9A 3TAEA 4QCLA 2AQ0A 9ICXA 1LV5A 4KPYA 2YNFA 3BQ2A 1FXXA 4F5NA 4GW6A 4N76A 2QK9A 4DOAA 4F92B 4QAGA 3D0PA 1JLQA 4H4OA 4E1NA 2BGWA 4F4YA 1ZQZA 7ICPA 4G1QA 4ECXA 4N47A 4CEDA 4YQWA 4IKFA 1TAUA 2V4QA 8ICHA 1BL3A 4CJKA 1TK0A 1NOYA 5KGXA 2ASJA 5DBAA 1QQCA 4FO6A 8ICLA 4K8XA 3MABA 3BQ0A 1COOA 1EP4A 4R66A 5J2QA 3OYMA 2PFOA 1LWCA 3PW2A 3G0ZA 4N56A 1VSEA 2JEIA 5KFFA 3V1OA 5J2KA 1Q9YA 4RQ4A 4IQWA 5JS1A 3BDPA 3GQCA 3THVA 1ZQGA 4OPJA 3T5HA 1RT4A 5HLFA 4DMNA 4TURA 3V9UA 5HNKA 4F4ZA 2VG6A 4RNOA 1XHZA 5DLGA 1Z3EB 1EETA 4HUFA 9ICQA 3AUOA 3K2PA 3OVNA 1MC8A 2F1IA 1EXQA 3SV4A 4MEYA 1HQEA 1T7PA 4PGQA 3EPIA 4PH5A 4CIFA 3RRGA 4B3OA 1C1AA 4DOBA 2BANA 4QW9A 1SL0A 1N6QA 4F4XA 4M0AA 1RBTA 4QZCA 1RBRA 8ICRA 1U49A 3RTVA 4CF1A 4CGJA 1ZQAA 3EY1A 5DG9A 7ICQA 1ZQDA 1RTDA 4QZHA 8ICXA 2W8LA 2VWJA 1RYRA 4FM2A 1D5AA 2PYLA 5KT4A 4QWCA 8ICZA 4DTMA 1RT6A 4DFKA 5CY4A 1KEJA 3ZDDA 1IM4A 3DYAA 1Q8IA 4KB1A 4ECTA 4UB5A 5EU7A 4P4MA 1ZQVA 3ISNC 4CHPA 2BE2A 2IHMA 2JEJA 3ISCA 1NOZA 1QE1A 1HRHA 4HVJA 4IBNA 5I42A 5DQHA 5D3GA 1TKZA 4ECZA 5F9LA 4DF4A 4ED1A 4QWBA 4QOZB 3OJUA 3SQ2A 2A1JB 3SUQA 4RNNA 2XC9A 2MUTA 5HP1A 2BPGA 9ICCA 3PW7A 4UAYA 3I0RA 3S9HA 3EZ5A 3MR3A 3B0XA 3DOKA 3RH6A 4UB2A 1IXRA 4DSIA 5KFDA 5DB6A 3H8JA 3CM5A 1WCLA 3T1AA 2KTQA 4KLDA 8ICVA 1U45A 3Q8RB 2ITGA 4HCCA 4FJHA 2IAJA 2YKMA 4CJVA 4GXJA 2FLPA 3QEBZ 5KT6A 3DLRA 3OYDA 3PMLA 4OKEA 4RPYA 3BQ1A 3AVAA 3AO4A 1HQUA 4QW8A 4KHSA 4N5SA 2PFNA 4J9RA 4L8RB 2FPLA 2HHVA 3IM1A 4XUSA 3BJYA 3DLEA 4I2IA 4BXOA 5SZTA 3E01A 1HNIA 4OVLA 3QEPA 3AVNA 5KT7A 1KCFA 4KLEA 5KFZA 4CGDA 3OSNA 2BQRA 4I2BA 2BCUA 4EYHB 4KB0A 2OWOA 1B92A 3WNFA 5E41A 2E6LA 8ICPA 4KHQA 5KG2A 4I2EA 4I2GA 2B21A 2C2RA 1UWBA 4M42A 4MEXA 2OPPA 4LVSA 5J0UA 3I0SA 3DMJA 3KKSA 3K5NA 2FLLA 5KT5A 1D8LA 4FBUA 1ZBHA 2C2EA 1CZ9A 3HVRA 3KHLA 1QSYA 5FDLA 4KLJA 4CJ4A 3RWUA 3V6HA 4B8AB 4F93B 4N41A 1KSPA 4R5PA 5KFPA 5DLFA 4UAZA 4QZDA 2KW4A 4QZFA 3B0YA 1ZQYA 4NM1A 4FJLA 4RW6A 4PY5A 2DFFA 5IIMA 4O5CA 1TVRA 5T7BA 3FDSA 5DQGA 4W5OA 7ICIA 4KI6A 4DL6A 2P1JA 3LWMA 3TI0A 1KFSA 3GIJA 1S0MA 2C22A 4B9LA 2RF2A 2RKIA 3VQAA 4P2HA 4CEOA 3L2VA 1NJYA 1TL1A 3C5FA 1RT7A 1NKBA 4DSKA 2OZSA 2A1SA 4IQTA 4KTWA 2D0CA 3JPOA 3TAGA 3O4NA 2KN7A 4J9PA 2PY5A 4EZ9A 9ICJA 2KFNA 2VA2A 2WTFA 2QXFA 1F21A 5FROA 2HMIA 1KFDA 2ZE2A 3OS0A 2PZSA 2P66A 4PHPA 1LW0A 4TUSA 2HVHA 1DOQA 5J0WA 5L1JA 4KN4A 1A5XA 1R0AA 2C28A 4I7FA 3AA5X 1SV5A 3C5GA 2BR0A 1ZQUA 4JUZA 1NKEA 3L8BA 1ZQEA 2J6UA 3LP2A 1TL3A 1JXLA 2V9WA 4O5BA 8ICSA 2E4LA 3H08A 4B08A 5CHGA 3EPGA 4UB1A 1I3AA 4E3SA 1T05A 4EP5A 4M9NA 4I2AA 3V4IA 4DTRA 3JYTA 4KLFA 3KTQA 3TANA 5DK5A 3RJKA 4DTPA 1TFRA 7ICHA 1K6YA 1T8EA 4KV8A 1RTHA 1JIHA 3ULDA 1BVSA 4RQ2A 1WSGA 3HSTB 2C2DA 4BGDA 3ZSZA 4RT3A 4FJKA 4M47A 2O4GA 1ZQFA 2ZTDA 1S10A 4LZGA 1BISA 3KLIA 1VSJA 4DTNA 1T3NA 5KFSA 4DSEA 3NBPA 4JV2A 1VK0A 3U3GA 4O3NA 3NF9A 3ORYA 5C42A 1TK8A 1HPZA 4AILC 3OYBA 4QWAA 1RT5A 3ZT3A 3PV8A 4DG1A 2JEGA 3L3UA 9ICTA 4DTUA 2R8HA 4MFCA 3VQDA 4QZAA 3Q8QB 2D0BA 2MUTB 2A1JA 1L3SA 2P6UA 4LSNA 2AGPA 2ZJ8A 1SZPA 2UVWA 1EXNA 4J2AA 3LWLA 1KRPA 1RCHA 3LK9A 3Q8SB 4O55A 1DGSA 1XO1A 2J6TA 5KG1A 3KLEA 2PFPA 5HP4A 2P5OA 4CGIA 2I1QA 3VQQA 4CJEA 1D9FA 3KHHA 5DGAA 2VANA 3AO5A 5JUMA 1NK9A 5DB8A 4M6WA 3F9KA 4KN7A 4F2RA 3O3FA 4E7JA 2ZTEA 4BXOB 9ICSA 4DL5A 4LH5A 2FBTA 5HRPA 3ASMA 4O3OA 3M8QA 4CJLA 3OYLA 2YHBA 1NK8A 4E7LA 4F4WA 3ALYA 3B6PA 3C21A 4J9SA 5KFWA 1NOMA 4ECYA 3PUFA 1ZYQA 4O44A 1BPEA 1S9EA 3CFPA 2H5XA 9ICAA 1BPZA 2GV9A 2OYQA 3VQ5A 2R8IA 7ICKA 3OS1A 3K57A 3AO2A 1WLJA 4NM2A 4M9LA 1W0HA 5IILA 3K75D 1ZQHA 1XU4A 4DS5A 3MFIA 4M3XA 1ZETA 4I2CA 1G15A 2X6SA 3GV8B 3RJIA 4RQ7A 3H4DA 1RYSA 3BGRA 3IRXA 4KHWA 1L3VA 1U04A 3KK2A 3V9ZA 2W9CA 3RMAA 3VN5A 1CXQA 1TKTA 1IKXA 1I39A 5KG7A 1TV9A 4RW7A 3AVGA 3ZSRA 4KHYA 4H4MA 2HVIA 4IG0A 5DBBA 3HP9A 2IGIA 4CJQA 3OYNA 4W5QA 1RT3A 3TFSA 4BE1A 2Z1GA 1ZQOA 2IS3A 3VQBA 2EX3A 1X2IA 1FK9A 5D46A 3AU2A 4DSLA 4MFBA 1MQ2A 2P5GA 2Q0ZX 1N5YA 4F50A 4KLLA 3HX0A 2DFHA 3SJJA 1VSDA 3NH0A 1U4BA 3UXPA 1NK4A 2W9MA 5IIJA 4JS4A 3G10A 5KFHA 3AV9A 2BPCA 5F9NA 3PMNA 2X74A 3L2WA 3U6FA 4UB3A 4F4KA 4IFVA 4YR2A 1C6VA 4BE2A 3NDKA 4FLWA 1NK6A 7ICEA 2DFLA 4B9MA 1VSMA 4FJMA 4DLGA 1IKWA 3OHBA 1BIUA 2I5JA 3HP6A 1RDBA 1FKOA 1LAWA 5KFMA 8ICOA 1MSWD 1GOBA 4CHNA 4MFAA 4LZDA 4TSXA 4RW4A 3SQ1A 3PR4A 1XHXA 4FJ7A 5KRSA 5DDMA 2X6NA 5KFXA 4CECA 1C0UA 2ALZA 3C23A 4FLXA 4RU9A 3OHAA 1W9HA 9ICNA 4RZRA 4DQIA 4ELUA 3MEGA 4ED3A 4IRCA 1CUKA 2YV0X 3V7KA 4GC6A 4M2YA 1JLBA 3OYHA 4DTJA 3HJFA 1U9LA 4BDPA 5J2JA 4TQRA 2PI5A 3PW0A 3P5JA 3RMCA 3AO1A 1WAFA 4NYFA 3PX0A 4B8CA 2AGQA 1X9SA 4QWEA 4XA5A 4JV1A 4Q8EA 1DTTA 4EZ6A 4BE0A 3GFKB 4EBEA 4GMJB 4M3RA 4FJIA 5J0PA 4F3OA 5J2GA 3H7IA 4KLTA 2YNGA 4TUPA 2GUIA 4JRQA 4CHYA 3JPTA 4ELTA 1B9FA 3U3YA 3C2LA 1XS9D 4AHTA 3KLHA 4Z4CA 4Z6EA 3CYMA 3V6DA 4M45A 3KLFA 1HJPA 2BDPA 2HHUA 4FJ5A 1S77D 4DWIA 3KHRA 5C25A 4RNMA 8ICQA 5BOMA 2F1HA 2D0AA 4FZZA 3M9NB 1LAVA 4O5KA 3AVIA 1UA0A 4WE1A 3PVXA 4YCXA 4M9HA 4M41A 5HRSA 2YHAA 2JEFA 7ICUA 4KLSA 1JL1A 1WSEA 3OYIA 5FRNA 5J0TA 3JPPA 5CZ2A 5DB7A 4FLVA 3V1RA 3RBDA 4KLUA 8ICYA 3AA3A 3O3GA 5J2EA 4NXZA 3K5LA 2AJQA 4FS2A 2FMPA 9ICEA 5J2PA 3ZSQA 3HK2A 1FKPA 4R65A 3TQ1A 1S76D 1TAQA 3NH1A 3RJFA 4CHQA 1LWFA 3VQPA 4XRHA 4PWDA 2R8KA 4UBCA 1HYZA 3SUPA 3LPUA 3TR8A 4OLAA 3CFRA 4CESA 1ZQPA 5IIKA 2WOMA 2QKKA 1S1XA 3TABA 5DG7A 2XCPA 2DFEA 4ECRA 3QO9A 4M6WB 3S3OA 5J0YA 1DLOA 4YD2A 4FJ9A 4Z4GA 4RW8A 1CEZA 4CF0A 1N48A 1J9AA 1WAJA 1N56A 4KI4A 2ZJAA 3OSPA 4KLOA 4GXIA 1AROP 4EBCA 2VG7A 2BGGA 3S3NA 1HJRA 2NRXA 4Y1DA 9ICMA 4NCBA 1Z00A 4HYKA 4CHOA 4Z6CA 3T5JA 4I28A 8ICEA 1S0VA 4C8KA 3EWAA 3K5MA 2FMQA 1EKEA 1LW2A 1WSHA 5CB1A 3KLGA 1QSLA 3UIQA 3KJVA 3ZDCA 1ZQXA 3JPSA 1K1QA 3LZJA 4J9KA 3KD1E
chains in the Genus database with same CATH superfamily
2DXFA 4OZJA 1B9DA 1QDUB 3H6EA 3N6LA 3OT9A 1IQZA 5EY4A 2QA1A 1IG9A 3ZDEA 3QMQA 4C0OC 3TFRA 3CJ4A 1OXJA 4ICAA 5KI6A 2KKPA 2IPOB 4E0DA 3CCJS 2HB5A 4RW7B 1T4GA 4CJSA 2LYHA 5TKYA 5CA7A 1HYVA 4EHUA 2W40A 1BCOA 3KZBA 3LTOA 1VBZA 1T02A 5F41A 4M94A 5AE3A 2K8AA 4Q45A 3CSKA 3QIDA 4CIOA 3US5A 1ASUA 5AQTA 1JJ4A 2XY8A 3FZKA 4ECVA 4Z7YA 4WQ5A 3J81O 3UQ0A 3EN9A 4USKA 4FYVB 2HSEB 4JKHA 1SIJA 1F5BA 2A18A 2KRRA 2WSEC 1F5SA 7ICNA 4LF7K 4WP9A 3SBMA 3B6BA 2ZM6F 3EWGA 4KH4A 3Q8KA 4H5NA 2ZGYA 3DXSX 2DEJA 3ZEUA 4N8NA 4FKXA 4NXMF 4O5FA 2AJ0A 2H5IB 3P31A 1N52B 5BYQA 4OJ1A 3W9HA 4WF9Q 3AA2A 3SAHA 4NLYA 2HQIA 4J90A 1VQPN 4KLMA 4JD2B 1IV0A 5E7OB 1QCKA 4IEEA 2HBKA 4NZ0A 1HWKA 3K58A 3DOLA 2G8VA 3UDEA 4HUGA 1JLBB 1W2IA 2VBWA 3WKAA 1XNQF 2WF5A 5EWGA 1NZBA 1WKLA 3N6NA 3C7NB 5T14A 3KJNB 1NK5A 8ICNA 4D3GA 5K8MA 4NI2A 1A7GE 5CWRA 3SXLA 4DU1A 4NB4A 7ICTA 1HL6A 3QATA 5RUBA 1KFTA 2UVRA 4JK8A 5THWA 3RJJA 3TAQA 1DK2A 2YXLA 4I2QA 2UXDJ 4UTGA 1FJGJ 1QM9A 1Q3UA 4JI5K 3PTWA 2UVVA 1A0PA 2H3GX 1S1WA 1VQ4N 4LF6K 4OJPA 3HTVA 3CD7A 1ZAWA 1ZM2A 4JKGB 2KDOA 4S0MA 4W5TA 8ICCA 1RGIA 4Z0UA 1OVYA 3ZCMA 4ZOSA 4C8MA 3VQ6A 3FUYA 1K1SA 3M6UA 2GVDB 4P9SA 1QZ6A 3LL3A 3Q8LA 3IBFB 2ZNZA 5J1NA 3HVTB 5KT2A 2W7PA 1ZQJA 3EW9A 4JV5J 2YKNA 4PKIA 2FHJD 3M8PA 5KG4A 1REVA 4LFBJ 2H65B 4A8YA 1S1UA 3LP1A 1X0PA 4C4SA 5ETRA 2QGFB 3MM5B 5GADP 5ALYA 4C0BA 1PSDA 3D2NA 2F96A 4P4PA 4YY3F 4BDYA 4XQ8A 2CG4A 3E3XA 2KKZA 3QICA 3TAMA 3GMGA 1JCEA 3J80O 3CC7S 3E2EA 1Y4ZB 3PX4A 4F5PA 1PJ6A 4MF2A 1WI6A 1WDTA 1WD6A 2WW4A 2XI9A 4OLOA 1RILA 5K14A 1P6TA 3QJJA 1EIYB 3AD9C 4QYZK 1GLCG 4CEFA 2XCAA 4C4RA 4HCBA 4PA1A 3ZT0A 3NNCA 3PRDA 1S1XB 5LY3A 1WF0A 2WRMA 1ECWA 1B64A 4B9NA 2OD4A 1U0SA 4X66F 2VZ9A 4YB6A 4QZEA 1DLOB 3RH4A 3DXKB 3DRPA 9ICVA 1XWLA 4FYDA 1ELOA 5L38A 3EX7B 1HUXA 1WSFA 3LDOA 5DM7Q 3UVJB 3OYEA 3CMEN 2ISPA 3HVWA 4KSEB 4H5RA 2VG7B 1FXLA 2WVFA 4X4VA 3O9UA 1OYDA 4Z6DA 2ZEJA 2Z1HA 2R4FA 2DGQA 3HPOA 3V9SA 3IP0A 4CJTA 5KFCA 3H1VX 1TAMA 4KFBA 1V5VA 4BVOA 4BJQA 1F2GA 3MPWA 1MU2B 1FEEA 1Q82T 5KFBA 3PXGa 1YXQA 2G8WA 1IVZA 4LFBF 4Z4EA 5GVQA 1CULA 2BPFA 5A0YA 1N0VC 3ZSOA 3UCZP 4YP3A 3WC0A 1XI1A 1B0VA 4A46A 3L2QA 4DR6J 1U2VA 4CIEA 4BY9C 4YMNA 5LMNJ 4X4TA 2OANA 1MQ3A 5LL6Z 2L5YA 2EK1A 2VOOA 2KJ8A 2M52A 2UUAF 1KVIA 2C3OA 2ZD1B 3OR1B 4ZN1A 3N4MB 1KQQA 3CW2C 4PHEA 1ZQBA 3SCXA 2AZ3A 4HUEA 3SI8A 4CO5A 4B3TJ 2H3IA 4QZ8A 1KDHA 4I2DA 2IM0A 3R2DJ 3FBEA 2E5SA 3PHTA 4B02A 2DL0A 1TKXA 5CXTA 9ICFA 2DR9A 4B3SJ 4B3MF 4FVMA 5B0BA 1RTJA 2R8JA 1TV6B 1ZBLA 5D0HA 3I8DA 4DR1K 4YVZA 3DM2B 3UDLA 4CYUB 4UAWA 1M5OC 4EYIB 1ZQTA 4UAUA 1UWAA 3IP4B 2YPZA 3NVVA 2VFVA 4UB4A 5LSRA 4I6YA 1DGKN 2AYGA 3N9UC 4X4PA 2JGUA 1KBUA 2W2QP 3P83D 2AP6A 3R2CJ 2LI6A 3SFGA 3ULEB 1CZAN 3QIPB 1RT1A 4OLBA 1WG4A 4DV3J 2JC1A 3G87A 1OY8A 4QOTA 2XY5A 4ILJA 2NR0A 1YUWA 2DTUA 2A6AA 1F9EB 2UVUA 3TPQA 4KMOB 1D09B 4BC4A 3DFEA 4EK2A 2JJ4D 2WBNA 4DR4F 4K4GA 4EEYA 4EFAC 4CJ3A 5IFMA 3V6KA 1UVJA 2FPKA 4YHHJ 5AQVA 2E44A 1JQGA 5C24A 4CEAA 4FXDA 4WFBL 2D4WA 4ISFA 1UW9A 3BSAA 3ETRA 2FMSA 2R2SA 3KDNA 4DR3J 1V3RA 4WTYA 3WK6A 3ZO7A 4P73A 4P74A 4C1NK 1H2TZ 2ZXHA 1HR0J 1WI8A 4DI6A 5HHIA 3R5GA 3QSIA 2L41A 1TYQB 5ETKA 3GDXA 4B3SF 4FK2A 2QYGA 3ISDA 2BJ9A 1NSPA 2FSNA 1SJFA 2OEJA 2IDLA 2R7OA 4CIGA 4FZLA 3HI9A 2POKA 5FD1A 4ZHRB 5D4BA 3NG8A 5A8KB 5KFNA 9ICLA 1IUJA 2EI5A 3RSEB 4BRAA 2PMHA 3SPZA 3KG0A 1P9YA 3VGTA 1JKHB 1BC6A 4K4HA 2WBMA 3V9XA 2GA7A 4K50A 1T3QA 1VQPS 3U8XA 2LXUA 4OHVA 2QSWA 4CEBA 5A0LA 1TL5A 5J0QA 3R7BB 7ICSA 2AU0A 2XRIA 3NVWA 1J54A 2OPSA 1JLGB 3OVSA 1KD1T 2D0OA 5F1XA 2QM1A 1RUSA 5CYMA 2B9XA 3N7SC 1RWUA 3Q8VA 5HMXA 3OBWA 2ADCA 2N7YA 1KVKA 4CGGA 5KG3A 2LA4A 5IV3A 2B4JA 1S9GB 2CQCA 1ASVA 3QNNA 4JI6K 4JI7K 1X66A 2FPHX 5I4MA 4BRIA 4I2JA 2KICA 8ICFA 3DC2A 1I94J 2HVDA 5AQGA 4IQVA 1SUQA 2YKPA 3QU5A 4DL2A 3RMBA 2QFIA 1VQ4S 1LB2B 3O2IA 1S9FA 4WXWA 1ZQRA 5U47A 1IBKF 4XH5A 3VEVA 3H46O 2KIWA 4NCGB 3CD6N 2AW0A 2QTDA 3SR6A 3ZETB 1TUUA 2XHWA 4CM2A 2MEWA 4KR0B 2VA8A 2W6KA 1WSJA 3DRSA 2E8PA 3N79A 2KKHA 4DV5K 2O4IA 2KT2A 3A5OC 2ZJQL 3DNCA 2FGCA 4WK1A 4LY7A 4H0XB 2DR5A 4BR4A 4K5RA 3CCMN 4Y2AA 1ILYA 1WSVA 4XPEA 3W9JA 3IR5B 4GVMA 3PCOB 2IVOA 1ZQMA 4EBDA 4YXMA 1IIPA 1RBVA 1Q46A 2BYCA 3ZX2A 2I8EA 4JLHA 4FWLA 1RT2B 1A6SA 1A0OB 2BJEA 3I32A 1AYEA 4US9A 3H3NO 2BCQA 2RHKA 3AODA 1CG2A 1BO5O 3VGMA 2R7SA 1D8YA 4ELVA 2Y3YA 1FXDA 3FBBA 5HBMA 3AA9A 5DZ7A 4RPZA 4J2BA 2JH3A 3TVKA 4FWOA 4ZVRB 4IQMA 1HWUA 3LP0B 1JLCA 4DV6J 2P9SB 2WFBA 9ICKA 1GO3F 5D8HB 4TNOA 3T6BA 3FK4A 4R8UB 2VG5A 3VCDA 2YMMA 1UAXA 1YZ7A 3N97B 2V4JA 3CQ8A 1XSPA 4YR0A 4F91B 5KL8B 1K8KB 1YJ7A 1AZSB 2F8TA 4B1VA 2W3RA 3Q86A 1RTIA 3CDUA 3BQTA 3FFIB 4JN4A 1BXNA 3DLKB 3GU0A 5MLCV 3M8SA 5KOWA 3RJEA 3MWPA 4CJ5A 2JLGA 4G3IA 2OIHA 5K8PA 1F2HA 1HD1A 1EX4A 1Z26A 2E6MA 3I96A 3WXMB 1NGFA 1JLEA 3F73A 2RIJA 2OFGX 2CDQA 5L9XA 2Y1RI 1WWHA 2DO0A 2GHVC 1HD0A 5F8MA 3GU3A 1JMSA 4C11B 2VWKA 2BQUA 1BA1A 2IRXA 1XR7A 1IKVB 5J2NA 4FPAA 3K4GA 1QAJA 3WKDA 4C8NA 2CQ4A 4MLHA 2AKWB 4PHTX 4PKHA 3QJLA 3PSIA 2H3VA 2P2CB 4H5VA 2KT3A 4LSLA 3ZTQA 3UXOA 3C2PA 2YX6A 3AVFA 3QINA 1I3OB 1M1HA 1C0TB 1FJCA 2YKQA 4P7TA 4KLIA 5AKYA 5J2QB 4HHTA 1LWCB 3W1YC 3HKZF 1QQ7A 2ZJ5A 1UJ4A 2M4MA 2VDIA 4JI8F 2IM3A 2ZKUA 1T94A 3W9IA 4BQLA 2GEMA 4WQ4C 1ZOTA 4LF8J 1HNZJ 4K25A 1NZPA 4CO1A 4PHAA 4TY8B 4M5GA 3U9DA 2OMLA 2MQOA 4H5TA 3VTHA 4V19X 2E1EA 4M9JA 1R6VA 3BZCA 5DZ6A 1BHNA 5IV4A 2N1RA 2BQ3A 3QUQA 2M9NA 2FC0A 1K44A 4Y2TA 1P8ZA 4CLYA 3CCQN 4QNLA 1RKJA 2GAGC 2CQDA 1BQMA 4A8SA 3S3MA 1FDDA 1M5VC 1CRXA 3H8YA 2E1RA 2YX8A 2QYCA 5ADZA 4NLZA 2HKEA 4C8ZA 3FC4A 1KC8O 3TVZA 4JBCA 2FUG9 1E4GT 4CW7B 3THXB 2BW7A 2MLZA 1RABB 3OV7A 1FCAA 1ROFA 3KVGA 4RG8A 1HW8A 3DYAB 4OHZA 7ICFA 1OIAA 2OM6A 1B22A 3K59A 1QAIA 4Z4IA 3BGLA 1WC4A 4DLEA 4IZ9A 3H98A 3IDHA 4ZJQA 2EWSA 2B7CB 1KKXA 2GJIA 2Q66A 3K89A 4DQQA 3MECB 3OYFA 2Q1NA 1U0HB 3UN5A 3CJ2A 4YFKA 1YLXA 4W4MA 4I2HA 4F4AA 3NGKA 4NWIA 3J7AP 4F2SA 3HDSA 2D3OR 3MXJA 4OI6A 4FJNA 5EOZA 3RJHA 1NBEB 2A1RA 1Q3VA 2EFVA 1HMVA 1R8PA 1S5ZA 2K4PA 2KJ5A 2B9WA 1B0TA 2J8SA 5F3ZA 2BXJA 2Y1JA 4C3KA 5ETSA 2QE5A 1K8AO 4XIUA 3FGUA 3H4BA 4PQUA 1L3UA 3MEEB 2MQNA 5A2QU 2J9DE 3A2FA 4JS5A 2D9OA 2YKMB 5J2DA 3ICXA 4NLDA 4M3ZA 3N5FA 4M3UA 1QQ6A 2CQIA 3DGPA 4JKAA 4PPZA 5FPMA 3OHRA 5BN9A 2FSJA 5KG0A 4DZDA 4DV2F 3RH5A 3DLEB 2HNYB 2E5LF 4O4GB 4XK8C 1UEVA 5KFAA 4NE9C 1W7AA 3R5AA 4J2EA 4A8FA 2G5HB 3HJEA 3KZXA 2ABYA 3E9OA 1RTZA 5C5JA 5DB9A 1SC1B 5AQHA 2M8HA 1Q4RA 4MT1A 4JV0A 4ISGA 4BG8A 4RW9B 4DDFA 4AXJA 3NF7A 4CCHA 2OHDA 1F3FA 5JMNA 5IWAJ 3SAGA 5J2CA 1VQKN 4J9QA 3BH7B 3ILIA 4EHTA 4Q5VA 4KAZA 4WZMA 4ANCA 4HAIA 1HUZA 1X8DA 5A8RA 3ATUA 4H8KA 1NM2A 1P9QC 2OA8A 4UATA 1B0XA 1FJEB 3HPGA 3PIPQ 5EWEA 1XNSA 2QN6B 1NMDA 3VAMA 1UT5A 3PR5B 1JN3A 2H5JB 2ZQBA 4WBFA 1KOOA 3DCAA 2XLJA 2CJ9A 3CHWA 4L3QA 2P9UA 3HKWA 4XDDA 4JWMA 3O80A 4UB6U 4GVBB 1T3VA 2J9DA 3CEDA 5A2QY 1P8GA 1VLYA 5CJ7A 1Q0NA 4US8A 5C7PA 3CD6S 2ZJRL 3HI0A 2HZAA 2PXIA 3AFGA 2FXUA 5CCLA 4RBTA 4DR7J 1VRTB 2HNZB 1GXUA 2AQ0A 2HQGA 3BQ2A 1DTQB 4G6VB 1NSQA 4N76A 5GAHP 1RI7A 2BUPA 2DGVA 1JCFA 4W92B 1JLQA 4H4OA 3NCRA 4E1NA 4USMA 1ZQZA 3U1LA 4AQYK 3Q89A 1LK5A 3IM9A 7ICPA 2LM4A 3PEHA 4CD3A 2HFNA 4CEDA 2MLYA 2WVCA 1LKYB 2HF4A 1U8SA 5HSPA 5CYJA 4CJKA 1TK0A 2ZDPA 2ASJA 4K8XA 5CZVA 4GKKF 2ZNYA 1COOA 5M1FA 2CG8A 1U2FA 3GJRB 3OYMA 4QR2A 3NS6A 1VSEA 5JMVA 5E3QA 2RT3A 4DX5A 1H1VA 2AJFE 3MURP 1Q9YA 1HFEL 1ZQ1C 4RQ4A 4IQWA 1N34J 5F8HA 5JS1A 3W63A 5J1EB 1HBUB 1ZQGA 1RT4A 4DMNA 4TURA 1Q5YA 2ZIWB 5HNKA 4PUOB 2Z57B 3SENA 2HRTA 1PJ7A 1ATSA 1EETA 4HUFA 3K2PA 3OTEA 3UN2A 1T3OA 1WOPA 2KK0A 4MEYA 4ANDA 1CVJA 1LXNA 3OUYB 1GFWB 2E1MC 3MM9A 4Y3CA 4CIFA 3RRGA 4DV0J 1SC4B 3LGNA 1OVQA 3QFHA 1C1AA 2QL7B 3OXLA 4F4XA 4I0WA 2CZ4A 1SWVA 4DBQA 2V63A 1QJHA 1RBRA 3TO8A 1WHXA 4CF1A 5L39A 4H0TB 2LDYA 1V3ZA 4JI8K 1ZQDA 4OYXA 3TUZC 4OYOA 2W8LA 2GO9A 1IN0A 1RYRA 5A76A 4FM2A 2H3QA 5AXKA 5MAOA 4QWCA 2GOLA 4DTMA 3EDRB 3I6PA 3ZDDA 2WB1F 1IM4A 3J81j 1Q8IA 4KB1A 3WXLA 7AT1B 3GOIA 1HPZB 4CHPA 2BZ2A 2BE2A 2JEJA 3ISCA 1NOZA 2GWKA 2QO3A 3MMAA 1VQMS 2AX1A 2E1AA 1XMOF 1WKJA 3H1QA 4YB7A 4DX8H 5F9LA 3K0JA 2XS2A 3SUQA 4KT0C 4UAYA 3WUHA 1ZXIA 5AQUA 3S9HA 2EFPA 4OJ6A 3W7BA 4NLPA 4LRBA 2IMOA 4LJMA 4IO8A 5ITHA 5DB6A 4CLTA 3CJAA 3A8IA 2I7NA 3T1AA 2KTQA 4KLDA 2ESEA 3UKRA 1A9NB 1U45A 1RK8A 1S6PB 3CCQS 1GLJO 3Q8RB 4ISEA 2O8DA 1T9VA 4EX7A 4CJVA 3RW7A 2JH1A 4QW8A 4KHSA 2OMOA 1BLUA 3TTCA 2PFNA 3CJ8A 4ZN3A 3FM9A 4OFZA 3OXFA 2HHVA 3IM1A 1VQ8N 1BY9A 2NYHA 1J5EK 4BXOA 2DNKA 4BRLA 5F0XA 5SZTA 3V5RA 2KG0A 1SQFA 4OVLA 1GH8A 1IR1A 3AVNA 1WTBA 4IOAL 2DY1A 5B0AA 1C4CA 4JYAK 4CGDA 3OSNA 2BQRA 3R1LA 2A1AA 4MYTA 3WNFA 3BGOP 3KG4A 4CBWA 1J2NA 4H4KC 1Y5LB 1OO0B 4C2MA 3H2VE 4KHPJ 4PQAA 2Y8WA 2BMBA 1DBDA 1FD8A 5ETMA 3MK6A 2PO4A 4M42A 4MEXA 3J7A1 1TELA 1U6ZA 5J0UA 1T9WA 2MZSA 3GR0A 1Q81T 1MMNA 2FLLA 5KT5A 1RBAA 3ONNA 1FFVA 3BO3A 4DPOA 3OL9A 3IRXB 3KHLA 4Q2LA 2VJ5A 3JSRA 5FDLA 2NO4A 4KLJA 3KXDA 4ED5A 2F44A 1WEZA 4X64J 3MEKA 2NV3A 4DCJB 5AKZA 4UAZA 2VQFJ 4HT5A 2KW4A 3O9QA 3CDBA 3B0YA 3BZQA 1ZQYA 1X6IA 2P9CA 1NJIT 3FFKB 2DFFA 5ALDA 5CHIA 1YI2N 1VBKA 5G0RA 2VIHA 2LQBA 1QVFM 1O8BA 4R79A 4W5OA 3CI5A 5GAGP 2LQ8A 2P1JA 2HOIA 2CNKB 3MX2A 4PL1A 2UV8G 1KFSA 2ZKTA 2RKIA 2RF2A 2ATCB 4P2HA 4CEOA 1O08A 5AI0A 1N36J 4ZP6A 1TL1A 3KK7A 3IC1A 1HI8A 1RT7A 4IOXA 6FD1A 4MIAA 1B4FA 4DV7K 1FW6A 2JFDA 4IO9L 3AOBA 5HANA 3JPOA 5AXNA 1NGJA 3CIZA 3O4NA 4AL5A 2FDRA 2KN7A 2PY5A 2OEMA 4EZ9A 3EICA 2WTFA 1VQKS 1Z1ZA 2HMIA 1KFDA 1N61A 4IJAA 1EP4B 4TUSA 3AJ2A 2CQPA 2RDDA 4KN4A 2UUBF 4DMZA 4G65A 5EE3A 2VPZB 4CO2A 2BR0A 2K1RB 3CIMA 1NKEA 3MM8A 4K0KJ 1TL3A 4ZIWA 1E4FT 5G4DA 3A4TA 1RACB 3NGTA 3UMBA 3N4WA 2E4LA 5HLFB 4NLOA 3EPGA 3H8MA 4CNYA 4LRFA 4IJNA 1SJ1A 3MCOA 4M95A 1T05A 1U1LA 1MWKA 1XMQF 4I2AA 3V4IA 2YN4A 3BKFA 1XNRJ 2NZ4A 4KY3A 1ACMB 4MO4A 3VEYA 4DTPA 3T1YF 1F6TA 3LO3A 4KBIA 1ZZNA 3QU9A 1T8EA 1ESVA 1JIHA 2LYBA 2F7TA 2QB0A 2DVIA 4A8XA 4CRJA 5C0YA 4WKRA 1QVFR 2BOAA 1V9OA 4RQ2A 4GIBA 3HSTB 4H5WA 4UASA 4JI4F 4Z37A 2K8CB 1FRKA 4BGDA 4RT3A 3FZFA 1RTDB 2HCFA 2FSKA 1NRKA 4YORA 3W60A 4BRCA 3KLIA 4ZITA 4OHWA 4DSEA 3NBPA 1QUPA 3EVWA 1TUVA 2QTWA 3U3GA 4O3NA 2XMUA 3ORYA 2ZWHA 1TK8A 2KXNB 4EI2A 4DJBA 4AILC 1QE1B 2HVEA 2LHTA 2JEGA 4MFCA 4LBHA 2ADBA 4HHUA 1RWVB 2P6UA 3CIPA 5LSOA 3MMVA 2XBPA 2HHHF 1T95A 1XEZA 1EXNA 1LFPA 3ZZPA 1KRPA 2K06A 1NSKL 4LRDA 2E1PA 2KG1A 1DGSA 2ZIXB 4PWDB 1X3NA 3EE8A 2O5DA 4DUZF 4K2XA 2PFPA 1MA7A 2PN6A 3AD8C 2WOMB 4UW2A 3VGUA 4CJEA 2IAJB 4DR2J 1PK1A 5DGAA 1LK7A 2GO7A 1DXSA 4U9RA 3PACA 4YEAA 1WORA 1HW9A 5CAAA 4M6WA 3MOZA 3S7RA 5AKKA 4F2RA 3J7YP 4PL7A 3MGVA 4FDFA 1Q8LA 1O03A 3B8HA 4DL5A 3L95X 1GMUA 2FBTA 1SV0A 4M63A 1KXPA 2JV3A 2WBRA 2ZG6A 5KNIA 2EK6A 3ALYA 3B6PA 1XQSC 4J9SA 4ECYA 4I6MB 2O8BA 4O44A 3WXKA 4C9DA 1BPZA 3A8EA 3VQ5A 3QRQA 7ICKA 2OPPB 3K57A 1WLJA 3LDLA 4A8EA 4FWQA 4NM2A 3DMJB 5DDOC 3KUGA 3K75D 5ALTA 1AFIA 2F4VJ 1RA6A 1NPPA 4I2CA 1HBMB 1AUDA 1RYSA 2L9WA 4BBYA 3BGRA 3IBPA 3D0IE 3UO0A 1HIWA 3V9ZA 2W9CA 3PLAA 1CXQA 1TKTA 1IKXA 2PE8A 4DR5J 4N77A 1I39A 3GG4A 4ZPVR 1FRJA 1TV9A 1GAOA 3DLLL 1YRXA 2BDUA 3LVWA 4KHYA 4IG0A 3I4HX 3HP9A 2IGIA 4CJQA 2KHDA 4EIAA 2EFGA 3OTBA 2A42A 1FK9A 3U9ZA 5C2FA 1N5YA 3AA8A 1VSDA 1U4BA 1NK4A 1RQNA 5HJYA 5KFHA 5F9NA 4DUYK 1VQ9N 3G4SN 3LM9A 3P38A 4K4YA 4ZP9A 3U6FA 4UB3A 4IFVA 3HZGA 4YR2A 1L7PA 3QYPA 2CKWA 2M5YA 1BUXA 1UCNA 2WF8A 2LCWA 2HVZA 4DLGA 1IKWA 3HP6A 3J7AN 1RDBA 1FKOA 5KFMA 4B1XB 8ICOA 4UARA 2YNIB 3ENOA 2ZE2B 2Q0RA 4LZDA 4RW4A 1GXTA 3AXKA 1Q82O 4DV4K 2DNQA 3CP8A 3OHAA 1HWIA 3CCTA 2HMXA 1Y0HA 3BGUA 1NPRA 3C15B 3P45B 4ED3A 4IRCA 2GQ2A 3DLGB 5TKWA 2M8DB 4M2YA 4CH1A 4HEA9 3ZC4A 4KGXB 5BREA 3TR5A 1NUEA 5T7LB 4TQRA 1PJ5A 3IWXA 3PW0A 1YBTA 4PAAA 3ENVA 3SQGA 4V19S 2GWJA 1TR0A 4IUFA 4B8CA 2AGQA 1XC3A 4XA5A 4B6JA 3CWJA 1YI2S 4I4BA 4CZCA 2A3JA 2C3YA 4WIQA 1C1BB 1RTHB 1PIEA 4OYMA 4FJIA 4K5SA 4DHYA 4CNQA 4F3OA 4TUPA 1GTHA 1R8CA 1B9FA 1H6KX 2WSCC 3C2LA 2UUCJ 3KLHA 4Z4CA 4Z6EA 4M45A 3KLFA 4BUGA 2BDPA 4DWIA 3QBXA 4RNMA 3A1YG 5BOMA 2W24A 4WFZA 2MGZB 3M9NB 1CS4A 2FJEB 2QI2A 1CJUA 4GO7X 4BGBA 2P9PA 1FFWB 3KMSA 2DBBA 2UU9J 2GGPB 4YCXA 4M9HA 3D6MB 4DG1B 2H4WB 5DJBA 3OYIA 2QW9A 5J0TA 4Y2JA 3JPPA 5CZ2A 5DB7A 4FLVA 3CJKB 4AE5A 2MXYA 3V1RA 4KLUA 3PKMA 1RHUB 1J97A 3R1XA 4FS2A 2ASMA 9ICEA 4ZKAA 4FPIA 2A19A 5M1PA 3TVYA 4KC5A 3TQ1A 4AM6A 5M2RA 2DRDA 3WEEA 2EQYA 3VAGA 3WK7A 5EE0A 4XRHA 4WPAA 3K0SA 3T69A 3TR8A 3PKYA 1DY3A 3S6JA 4JB3A 3ILJA 4DX6A 2QKKA 3TABA 3DHXA 2FC9A 2BRKA 3CVKA 2LKYA 3M1FA 3QO9A 5J0YA 4Z4GA 2PA3A 1FEZA 1N48A 2L9NA 1XR5A 2RRAA 2QL9B 2K89A 2CVEA 4LF5J 2CXEA 3CJ1A 2BKPA 1AROP 1Q78A 2EANA 1HJRA 1Z00A 4CHOA 5AZJB 3T5JA 3BS5B 2MQQA 1RAHB 1S0VA 5CA5A 3G71N 4C8KA 1EB0A 2KL8A 2IIRA 4B1UB 4WP3A 2XYHB 4FN5A 3K8VA 1WC5A 1RG6A 1VC5A 4CH7A 2DYAA 4QPTA 5F0WA 1FT8A 2UXDK 1FJGK 3K9KA 2V8GA 3LZJA 1GK8A 1U24A 1K9MT 2V8VA 4M5IA 3KKFA 1MN7A 3KD1E 2P9LB 4DFMA 1ZQWA 4IKAA 4B3RF 1TVAA 2EFOA 2E88A 4PYAA 4M5DB 2GVZA 2CPRA 1YK9A 2ZUDA 3DLHA 3HL8A 4ED8A 2VCPA 4GRSA 3QESA 1UT8A 3QLHB 1SKRA 1RE1B 1FEHA 1KD1O 3FZ2A 4JV5K 2XYGB 4CLLA 5AQRA 1ZRMA 5DMRA 3TUIC 5KFLA 1VCTA 2COLA 1HPMA 5BOLA 1ZBSA 3QEWA 1T0TV 5F8JA 1MN8A 3QFPA 2YQEA 3EXCX 2EPIA 3FRYA 4BS2A 5AIAA 1K5OA 5AZIA 2WAQD 3HT3A 5FLXU 3WNHA 3GJSB 3UN3A 4J2DA 2XGQA 4EWTA 5EX3A 3I31A 1HNWF 4AF1A 5H9EJ 3MWTA 4IFYB 3V81A 1N8RT 2HAIA 5HOOA 3OL8A 5KFJA 1Z2LA 4C23A 2HG4A 1WUAA 2MZTA 3WKEA 4ZPTR 5I3UA 2BBEA 3DI6A 4KH0B 2V94A 3PW5A 3BO4A 3MCNA 2QWMA 4WIIA 1ZD2P 2IC3B 2ASPA 2NXNA 2GHWA 3L2UA 4DSFA 3CJ5A 5IIOA 4CFBA 4JI0F 4PWWA 2M0GB 2OXOA 1R0CB 2KXHA 1OY9A 3G96A 4JI1F 2G4BA 1EX8A 2LMRA 3AJ1A 5H1SV 3SK3A 3CGIA 5EXWA 3CJ3A 2ZH9A 2R2TA 2IVFB 4DQRA 3EMTA 2WAQC 4Y2XA 4Q0BA 2W3SA 3JPNA 3R6LB 3C16A 3U02A 3M2RA 1UZDA 3DXMA 5HVGA 1JJ2R 1PVPA 2JXJA 1CJKB 1U48A 3DEEA 4OGEA 3VETA 2I38A 1RDAA 3RRKA 3ZTRA 1MWQA 2A2CA 5FLXY 2UXCJ 5GMDA 2FF3B 3NCPA 1YBAA 2H5EA 4KHNA 4TQSA 2DD8S 1EHWA 1UKUA 4QIWF 1QQNA 4DR6K 1JXBA 3J80U 4O8KA 3ULHA 4ALZA 5AQZA 4FNIA 4DHVA 2IDOA 3M2UA 1SZHA 1GX6A 3SJHA 1VQ9S 3HYFA 3G4SS 4CP5A 2B8PA 3L3CA 5EE9A 4OD0A 4CEQA 3RGIA 2CJAA 3UKUB 4NLNA 1WTFA 3KZIU 4LFAJ 2ILYA 3RMDA 4AHCA 4ED6A 2Z1IA 2ZJPL 4B3TK 4WE1B 5J0SA 3R97A 4FF1A 5DDPC 5BR8J 1C0MA 3RB4A 3FYHA 1OMSA 2YNHA 3HFZB 2RUGA 1R31A 3IBCB 4FYXB 2KFYA 2ZGZA 1XQIA 2KVSA 7ICMA 4LJXA 2GCFA 3H25A 4JHDB 3JSMB 4PGXA 2R7YA 4M3WA 3L4BC 3TZXA 2OTLN 1RBOB 5KGWA 4MDAA 3ZD8A 3QEIA 2BKOA 4F02A 1ZBFA 3C28A 4FJXA 2AJ1A 2CADA 1A5WA 1R43A 1UFLA 4DV3K 1D9DA 4U67Q 5BRHA 1WHWA 2BJ8A 5AKLA 3MPVA 4O8UA 2CVIA 4TY9A 1HKAA 3UQSA 3A8JA 2G06A 3J80Y 4KHMA 2A2DA 3MDQA 3OYAA 3L2RA 2H3FA 4BACA 2CQBA 4OPAA 1P1TA 5EHHA 3CF5Q 2I1RA 4KREA 1X9WA 2OPRA 1QTMA 4U6PA 5HMMA 1PGZA 2ZH5A 1RAJA 3NNHA 2ODGA 1N5QA 4YHHK 5KFOA 5HMLA 4GY2B 1U6FA 1A5VA 3NFAA 3O6QA 5JVGQ 1LW2B 1QTNB 1YJWN 3T19A 1ZTTA 3MAAA 4FM1A 2OELA 4CTAA 4Q44A 3KLGB 2O8FA 1NB2A 5EOYA 8ICUA 5HROA 4BREA 4F67A 4DR3K 1S6QB 1S48A 1PZNA 2LPEA 3ADAC 3JSYA 3NWGA 3L7UA 1HR0K 4F9OA 3V6JA 2OJ3A 3VQ4A 4OX9F 3TUJC 4DTSA 4C80A 3H8WA 2HAFA 2WVBA 3MR2A 4KO0B 5KOXA 2O8EB 4BLGA 4PEOA 1TK5A 2CUYA 2V6AA 2G1HA 4ENOA 2EAPA 4C97A 2G8FA 2HK2A 3O1WA 2KO1A 3SPYA 2CQ2A 4ED0A 2J4RA 2B6AA 2QLTA 1JCGA 2DF4B 1BI4A 4ETXA 3VMFB 4CEZA 2WHOA 2MKKA 4RKUC 1IR2A 2V2VA 4CHZA 2XMWA 1Z19A 4FLYA 2RHQB 5GTHU 3HHDA 2MRLA 3I5CA 1S5JA 4OJGA 1UEKA 2Q6BA 4YMOA 1Y7PA 3NGZA 2XTJP 3CMQA 2DNRA 4DEZA 3OYJA 5AT1B 2QKQA 2P51A 3M1VB 1L7MA 5J2AA 4FKYA 5HL7L 3QZ7A 2MY7A 2HK3A 4HTLA 5DQIA 3MPUB 1JK9B 3ZEUB 1HBNB 4NXNF 5AJ3J 2HBJA 1J6ZA 3NH2A 1YT3A 4GNIA 3POTA 1MWYA 2BA9A 4W5NA 1LKZA 1I94K 2EKYA 4MQ3A 1ZD4A 3NAHA 4IDKA 1WEXA 3EO3A 1NDCA 1KVCA 1SH3A 4L74A 3RB0A 5GAEI 3FZMA 1GOCA 2FD2A 4JK1A 3I9V9 2F8SA 4JEPA 2WFAA 3FR0A 3ZSWA 5CHCB 1SGGA 2OKQA 1N32J 4K7QA 1YVNA 5BPNA 4OMFG 3NE6A 1KTQA 4LFCJ 3ISZA 4K4IA 1HNWK 4V19J 4Y2MA 2YH0A 2LECA 2MMYA 2QLWA 3SMPA 2JZBA 4NI2B 2UXBF 3QETA 4NJ8A 4ECSA 4OYAA 1RPLA 4ECUA 4RQ1A 1QS4A 4I2QB 2RDIA 1S72N 3N7PD 3NGIA 2A0FB 3KKAC 4JI3J 2BRLA 3VGLA 3M30A 1HJOA 1S1WB 4MAKA 5CR0A 5C2DA 1C1CB 1E3MA 4LVOP 5LJ5Y 5ETOA 2XHCA 4ER8A 1I5OB 4WCEL 2XB2D 4JKGA 4X65J 1VQNN 2WONB 3QXGA 2R18A 3LAMA 3IMQJ 4WK3A 3IS9A 2XLKA 1IBLF 4IL6U 3LQVA 1EQ0A 2RQ5A 3GJQB 2GVDA 2ZIUA 4UBBA 3BREA 3HVTA 2YKNB 5KG5A 2KXFA 3M8PB 4HACB 1REVB 5TISU 1S1UB 4CZLA 3LP1B 3VHQA 2E5HA 3VQ8A 4DV6K 5J2BA 4M9GA 3RAMA 3AVKA 3AD7C 3TEHB 2Z2MA 3KYLA 2DXEA 4PKDB 1COKA 2QLJB 3VF6A 4MJKA 3VWSA 4RJVA 3TAMB 3CDAA 4OYIA 4NLSA 4FZNA 5DDRC 3R9KA 3CO9A 3MFHA 3MR6A 2DNZA 2KYXA 5KFIA 3JXOA 3GIRA 2JFKA 1H38A 4YN4A 3F2KA 1WWVA 2OI2A 2BJ7A 3SQ4A 5K14B 1KLMA 4OI1A 1Z25A 3E9PA 4X62J 4KYZA 2BTFA 4EP4A 3FCVA 1WC3A 4AHSA 1NCLA 3N5BA 1O1WA 2I7PA 3WX8A 4CLFA 3I1YA 3K17A 1JLFA 3TKAA 2KV2A 3CRXA 2LXFA 4K4ZA 3I33A 5AK5A 3UM9A 4CO3A 3AOAA 2WK4A 3WNEA 3GFYA 3HXMA 3C46A 3ILOA 3K5OA 2YY3A 5I3PA 1YVUA 2VFTA 3THTA 4LR9A 1IG6A 4P71A 1V3SA 5CZXA 4CDGA 5J2MA 5M2PA 4KFBB 1EKSA 8ICJA 2NRZA 1S12A 4LF8K 4JRPA 1HNZK 2LSNA 1MU2A 1IQTA 5F3XB 3D2SA 1CULB 2RE1A 1NGBA 2MKSA 5A0YB 5HHHA 2YB1A 1SB3C 4NL9C 1CQNA 2BHNA 1X4CA 4KJIA 4FF3A 9ATCB 1U2VB 3A5LC 1FD2A 3VAKA 3QNWB 3RBXA 4CO4A 2OEHA 3QBCA 1CI4A 3HRDD 2LEBA 4ECQA 2OTLS 2W9BB 1FX2A 2GX9A 4O3QA 3NMAA 3OR1A 1HNXJ 2C2KB 2W41A 4B9TA 1G6BA 2B5JA 3D3CJ 1VQOS 2D69A 4CEEA 4USIA 3ZNUA 1KAXA 2CZVC 2W11A 4ZDNA 2A3VA 7ICGA 4NA1A 1OS5A 3AO3A 1G2EA 1TKXB 3WXJA 3VQSA 1CXUA 2G08A 4WQ5C 3LAKA 3AA4A 4MKBA 3GP9A 2OPQA 2V7YA 2E8AA 2HW3A 2HFVA 3TZYA 4YR3A 3DJCA 4AHUA 1ITPA 2Q1LA 2HI0A 4A5BA 4X4NA 2RQMA 9ICOA 4MF8A 3VAHA 1QUVA 1YG0A 3M9OB 2G8IA 3FZHA 1HNVA 1TTHB 5LMUJ 3CG7A 1ULRA 4CJUA 1BQNA 1YJWS 4PXEA 3GG1A 2FI1A 4P52A 4WU2A 1B0PA 1R89A 2F4FA 4AHRA 2C2OB 4NA3A 2YX1A 1FFSB 2F1JA 2AZ1A 5BRDA 1IJJA 5K9FA 4ILLA 3HFKA 3VZHA 2B0GA 4IFEA 1NHUA 4FOIA 5DKWA 5KFUA 1KVJA 4BX9C 2HDOA 4LT6A 4YB1P 2B3TB 4PL2A 3O3HA 2B56A 4KKOA 4ZK7M 3W65A 3OVBA 3VESA 5BPLA 1YRTA 3CCLN 4DO9A 3MF5A 1GMWD 5IS2A 3UPQA 4YD1A 2CPHA 3HO1A 1O5JA 2XSJA 3M6VA 1PAEX 3CJRA 1Q81O 4YN3B 3CCUN 4K8ZA 2GJFA 1G7CB 3ETLA 5AK3A 3L7OA 3QJPA 1IM6A 1WCNA 2R2RA 1VQ5S 1L8LA 4M5MA 4DL7A 4JI2J 4FLTA 4O3SA 5J0OA 3DDNA 4MK7A 4BWMA 5IWAK 4J9VA 4NY8A 3SAFA 4LD0A 4M04A 4DL4A 3O1BA 2KSOA 1TYQA 4CJRA 2H51B 1NJIO 2AMCB 2QWOA 2J0XA 3AY9A 2AQ4A 1HHQA 3C6TA 2YQ3A 3OPXA 4ZLNA 3C95A 3OTOJ 1N6QB 1W2BM 5TZVA 2PC6A 4DFDA 2YWWA 1KOHA 4AD6A 1X9JA 4J9NA 4KIAA 2UZAA 3R3TA 2BE7D 2AF6A 2JRZA 1T9YA 2LKZA 1KN5A 3SBGA 2BCVA 1NGHA 2RN2A 4C1NI 2EZZA 5HN0A 2BKEA 3UNGC 1JLAA 2D7SA 1CJVA 3THYB 1UVMA 2XICA 1HIYA 4MDBA 4ZTJA 1JLGA 4XH1A 2XY6A 4UZCA 3TSPA 5CYMB 4A2AA 4DR7K 2J7UA 2JLEA 3GYNA 1QQOA 4QYRA 5I42B 2W2PP 3OYCA 2W54A 1VBXA 2KJWA 1VSKA 4LF9J 3JAMO 4CVNE 2YPYA 3T79A 5ADXA 2QWLA 5E79U 5HP1B 2IIHA 4PG6A 1XMBA 4CLKA 2D5RA 4EAHD 4RPXA 1RCOB 4CLPA 2VQEJ 2FLNA 2BCSA 2YKAA 2ETJA 5JRTA 5HRRA 4G1PA 4R0JA 1N2XA 3K7RA 1N33F 4LF4F 1J5OA 5C12A 4QS9A 2OTJS 5J8YA 2AYEA 3FJ2A 4NCGA 2P35A 1VQNS 5GMKa 2XIDA 4XAKA 2HWTA 3V1QA 1B43A 3PEJA 1UJ5A 3WT0A 4YFUA 5LOQA 2F1FA 1HQUB 2XI2A 3DRSB 3I4PA 1PO6A 2VJUA 4WYLA 2ASYA 1HYSA 2V5HG 2FJDB 3KKRA 2CJKA 1N34K 1W26A 1OY6A 1W2BR 3A5MC 1BPYA 3MR7A 4ZCLA 5GIPA 1XSNA 1IBCB 3FMWA 4EFHA 4EELA 1IR0A 1NNDA 4K4TA 4AH9A 2EG1A 1RT2A 1UPPA 1VHIA 4L3NA 1FWPA 5H9FJ 4DV1K 4WFYA 3ZT4A 2O66A 5IT9O 2J6SA 2F9DA 1X9MA 4DV0K 4H0VB 5DRKA 3HHLB 3RR7A 5HBMB 2DITA 2M7SA 3SZ2A 3TNVA 2R3VA 1GOAA 3K1RB 1NG9A 3H3OB 4DCOB 2MHNA 2MKIA 1N62A 4K59A 1IJEB 3GFZA 1JLCB 3D68A 3VA0A 4LF7F 1S7HA 2AJ4A 3OTCA 3LP0A 2VG5B 3IRUA 1OJ4A 4KRFA 3M5RA 4GMKA 3CNQP 1WUUA 4R8UA 4F04B 2K3KA 5EGYA 3KIOA 3K8WA 2BCRA 3IG1A 2V4JB 5BR9A 1RTIB 4ERDA 1AZSA 3MXIA 2JVOA 2VHGA 1Q86O 5HRNA 2CH6A 1TVRB 1JLEB 1E6YB 4ZH4A 3TAEA 3PSPA 4P0QA 5D0EA 1RHJB 5MLCQ 4KPYA 2YNFA 4KQZA 4WFBQ 3AQFA 4C4WA 1WF1A 1FXXA 4GW6A 2YVSA 4QYZJ 4DOAA 3SEIA 4QAGA 1VBYA 5J2NB 2BGWA 3OFEA 3MDFA 4G1QA 4ACOA 3HZEA 4N47A 4OZ1A 4PZNA 3VEZA 2W2NP 1U1QA 4IKFA 2GJ2A 3ZZRA 5AICA 4FYYB 3PM9A 2V4QA 4LSLB 4JI5F 5KGXA 5DBAA 4RQMA 1Q18A 1QQCA 8ICLA 4LF6F 3BQ0A 1LW0B 2H54B 2KM8C 5M1KA 3M2VA 3MCAB 5J2QA 2PFOA 1LWCA 3G0ZA 2WF6A 1RDRA 1YRUA 1S6UA 2HZCA 2JEIA 4U7UK 2AEJA 4JKCA 3V1OA 2K3IA 2XM3A 1M5SA 2OYYA 3D67A 3BDPA 4DL0C 1JROA 3THVA 3ISND 2JWLA 3MXHP 2QWRA 4F4ZA 4L75A 2FZCB 5ALRA 3T1HJ 3NOCA 4F0KA 9ICQA 4LBPA 2DT9A 3JYTB 5BRFA 2GLEA 3SV4A 1M1KT 3IN5A 1HQEA 2CPYA 1T7PA 3F9MA 4KHPK 1DQ8A 2CNNB 1Z4NA 3HSCA 4PH5A 1BQMB 3GCXP 3D3BJ 1ATRA 2E8OA 2K8BB 2RSQA 4B3OA 2BANA 3KOOA 1SL0A 1V4SA 1WSRA 4TU7A 2CGKA 1RBTA 4QZCA 2K7KA 4OYWA 2P9EA 2XMVA 1U49A 4X4RA 2M3DA 2X1BA 3EY1A 5ALFA 3SMZA 7ICQA 2MSTA 8ICXA 3G82A 4X64K 1D5AA 8ICZA 2VQFK 1RT6A 1FDAA 3JB9k 3QUCA 3DYAA 4UB5A 3ISNC 3F5TA 2OGUA 1IBMF 3G8QA 3OPKA 5CR4A 1KQGB 2FVRA 1KAZA 2ZJQQ 5FPDA 4HVJA 2J9EA 4K8RA 3RUBL 2HLTA 4CM0A 1LCUA 4X4QA 2R7XA 2DCLA 1SJ4P 2Y0SD 3RVCA 3CULA 4BC9A 4DXLA 2KU7A 3HHLD 2MUTA 1MDUB 2BPGA 3QGGA 1N36K 9ICCA 2GX8A 3EGVA 3P8BB 4QBUA 3BUZB 1HMVB 3I0RA 2HGLA 3E8OA 4HLBA 2Z4PA 4AYBF 1WG1A 2GMJA 4GV3A 3DOKA 4UB2A 1NHVA 1IXRA 1NU4A 4DSIA 5AM3A 3H8JA 4PQUB 2DKZA 1WCLA 4YDDB 1JI7A 3HFVA 3RG6A 2F9WA 2ITGA 5AIBA 2YKMA 2Z0GA 4GXJA 3QEBZ 5KT6A 3PMLA 3QT7A 4F0MA 4HWIA 2F7VA 4J9RA 4L8RB 4ZJLA 1ZRNA 5AHXA 2NYIA 4HH1A 5AQQA 3DLEA 2ZM6J 2MZQA 4K0KK 3NRWA 4I2IA 5G5GA 2ACMA 4ZPWR 4XPCA 2RVJA 3BF3A 3M8QB 5KT7A 3AB4B 2CAJA 5KFZA 2HBQB 4NXMJ 2C2ZB 1V85A 5ETQA 4OI2A 2MZJA 5EE1A 3O8MA 2QMUB 2Y0SC 1XNRK 4JK9A 3HHLC 3RJMB 3HHEA 4I2EA 1QY7A 1VGYA 4H4KA 5I3QA 2D74B 2DNNA 2QLBB 1UWBA 4CWBA 4HKQA 3I0SA 3EM1A 5A8RB 2VJVA 4DR1F 2HGMA 5AQIA 2VKQA 2QC3A 1ZBHA 1XNQJ 3L4IA 3DLJA 1OQ6A 1GQEA 4KE5A 3FZLA 1QH9A 4J91A 2GC8A 3RWUA 4F93B 5KFPA 5DLFA 4CF4A 4QZFA 1SQGA 4GVBA 1S6OA 4H4MB 4NM1A 1HLUA 3HOTA 4PABA 2HS0A 4PY5A 1TMJA 5IIMA 2Y1LB 1VK8A 2NNWA 1S22A 3LDPA 1OH6A 2FZGB 3IR6B 3O9SA 2DKOB 4DL6A 3HVAA 4OYZA 3LWMA 4Y65A 2C22A 4B9LA 1KONA 1VMBA 4ZPBA 3N4QA 2W7AA 4H4OB 1P1LA 5B0CA 4USVA 2XWYA 1MWMA 3C5FA 3IRWP 1UVIA 1K0TA 2G9OA 3L6QA 3H20A 4MKYA 2LXIA 4KTWA 4IQTA 3SQOP 1LKYA 4NLVA 2OAUA 1FFUA 4YY3J 4J9PA 2PAVA 4DR2K 1F9FA 4BRHA 1JRPA 5FROA 2B43A 2P66A 1U25A 3M3ZA 3OBIA 1AW0A 1RAIB 1DOQA 5J0WA 2E9ZA 1R0AA 4I64A 3C5GA 5FLXO 1BNPA 1PVRA 3DN9A 4FWPA 1BOTO 1VISA 2F3JA 3IO1A 4U8YA 8ICSA 5BYRA 3H08A 2G2ZA 2FVPA 2ZIWA 1EETB 3V2UC 1TP7A 4X66J 3TW0A 3FE1A 4HHHA 5AE1A 4KLFA 3TANA 3GFXA 4PYDA 1TFRA 4FE3A 2NLWA 3QT5A 1K6YA 3L09A 4OV1A 4KV8A 4N7TA 3OL6A 5IM0B 1QQMA 3DWLA 3FSXA 2W6LA 1IWAA 2F4VK 1C0GA 3PJ9A 1BWVA 4CRXA 4KAIA 4NL5A 2C2DA 1DRZA 1SCJB 1Y00A 3W61A 4FSVA 2O4GA 2ZTDA 1S10A 1N5TA 3V6DB 1KS2A 3MTJA 2NUUG 1UAWA 4DR5K 4JKFA 4DKWA 1N8RO 4QIFA 2Q43A 4JI6F 4JI7F 3M7DA 5KFSA 5C25B 2G2YA 3C65A 2N82B 5DS7A 2DGZA 1SIWB 1VK0A 3NF9A 2BE2B 1HPZA 1C0FA 2KJ9A 1RM6C 2DB1A 1RAOA 1RT5A 3MMAB 1KQFB 2M70A 3L3UA 9ICTA 5D4OA 2VPYB 4DTUA 2HFUA 5AI8A 2UUAJ 2YWKA 4QZAA 1S57A 2WF9A 1EQYA 4ED4A 2P9KB 4UOFA 1IV8A 2RILA 1YDLA 2AD9A 2AGPA 2CQHA 4Y0WA 4ZA1A 4DV5F 3LWLA 1BE4A 1RXOB 3FAHA 4ZCIA 2DBYA 2G1DA 1RCHA 3LK9A 3Q8SB 3QQCD 2GIQA 2MSNA 2AV5A 4B1WB 3KLEA 2A3ZA 3QRPA 4FVUA 1DARA 3UKRB 4FWKA 3UD5A 5ADXH 2O8DB 1D8BA 5EX0A 4B3MJ 4HDHA 1D9FA 1QHAA 2VU5A 5E3PA 3KHHA 3TA1A 1CC7A 2ZHOA 5HK4A 1REGX 5DB8A 2CQ3A 3LDQA 4RBUA 1CSJA 4P2SA 1IBMK 1HBOA 3O3FA 3ENQA 3S01A 3PHEA 2ZTEA 1U09A 2FLOA 4BXOB 2IVYA 1SVDA 4FOEA 4X4OA 3H5UA 5HRPA 3QSYB 2P9GA 4OCZA 1F3VA 3D9BA 3ASMA 1S5LU 2E2QA 4O4RA 3OYLA 1FA0A 2MLXA 2NS1B 4F4WA 2ZJRQ 3W62A 3IAM9 3NVYA 4KHRA 4IS7A 4DN9A 5BN8A 1NOMA 4L3KA 2G09A 3PUFA 1ZYQA 2ZBQA 3KJQB 3BEGB 3KJVB 2ZBPA 4FYWB 4C3MA 1RDFA 2GIFA 3AO2A 5IILA 3FLCO 2LU1A 2D3ZA 4DR4J 5KPZA 5IT4A 2JH7A 4ICLB 1K47A 3MFIA 3PYGA 1G15A 3FZBA 3GV8B 4TU8A 4RQ7A 3HILA 3H4DA 4DOZA 5K8NA 3IRXA 2UUCK 1VDVA 5FDLB 4KHWA 3KK2A 4HL9A 1WKKA 2AYBA 1EJ7L 2F2AB 5AM0A 2HRYA 5KG7A 3B54A 3BYPA 3F53A 3ZX0A 1M5PC 3BGFA 5DBBA 1Q53A 1Y3JA 4RUBA 1RT3A 2UU9K 1NPKA 3VQBA 1XBWA 4IOCL 2Y0BB 2DXDA 3CC2S 2KT5A 4MFBA 3NY0A 3PG9A 2V2ZA 4NZ7A 2P5GA 2P6TA 1MN9A 4H0PA 2DFHA 2B4PA 2ZZTA 2RKIB 3UXPA 5IIJA 3DHWC 3PMNA 3CUNA 2RUSA 3W2WA 4JK7A 3ZI4A 2KIVA 3GE9A 4F4KA 4PJ0U 1RAGB 1C6VA 5HQ8A 5CYQB 2PMZF 3UDVA 4EU0A 3MTKA 5AKGA 2OD6A 4FJMA 2XWXA 2CWKA 2YB4A 2I5JA 2D41A 1BIUA 1PYSB 3BO2A 4R25A 4CHNA 4MFAA 2RRBA 5B66U 1M5KC 4TSXA 1XHXA 5DDMA 2X6NA 4CECA 1C0UA 3LGMA 2Z8QA 2C3MA 4M5HA 4CI0B 2VIXA 3W8GA 2VGMA 2CH5A 4LF5K 1W9HA 3MM8B 2K1RA 4DQIA 2C1EB 3CT9A 1WOQA 4ELUA 3NOGA 3TTDA 3W2VA 2FE9A 2VV5A 2A10A 2W4PA 2JSXA 3T9NA 3V7KA 4DTJA 3HJFA 5EN1A 3GE1A 4AFFA 3ONQA 2PI5A 3V4IB 1FE0A 3BH6B 1FERA 2PT0A 4F3MA 1X9SA 2I5HA 5CRXA 3RBZA 2YTCA 4JP8A 2V8HA 2F63A 4P72A 3GFKB 1IBKJ 3WK5A 4BE0A 4EBEA 2F8EX 2KRBA 3SCLE 2IRYA 1JJHA 3I5AA 3TJ9A 2B9YA 1NMNA 4USWA 5G5HA 2DWQA 1RU1A 3H7IA 4KLTA 2YNGA 3GYGA 5B0EA 5AQSA 3I28A 1SV4A 4CZKA 4NEYA 7FDRA 1MA9B 1XS9D 2V69A 3VEOA 3CYMA 1Z4UA 3KLIB 2L3MA 2EW9A 1TMMA 4GVEA 3NUQA 2CIMA 3D6TB 1ZPVA 1TUWA 1S77D 3NBPB 3KHRA 1UP1A 3W3SA 2F1HA 2D0AA 4FZZA 3KK3B 4O5KA 2FC8A 3AVIA 3E58A 3PVXA 3SSRA 2RHFA 7FD1A 2QX0A 2G0JA 4I2PB 1HKBA 3A3PB 3GYXB 3OR2B 2YHAA 1J2MA 4KLSA 1IKYB 3P5TL 5FRNA 4RL1A 1I51B 3RBDA 4Y2PA 2P6SA 3NAIA 4IOAQ 5J2EA 4NXZA 5CCMA 5H9EK 4O23A 3FMBA 1LWEB 2Z7JA 1VJ5A 3ZSQA 1Z4OA 1FKPA 1NAQA 4R65A 1X4BA 1Y11A 2K4EA 1S76D 1BD6A 3N01A 2GIRA 3MMBA 3EE3A 3RJFA 3NH1A 4FP9A 4PWDA 2Z30B 4UBCA 3ID6A 4HR2A 3NS1A 3CFRA 1VC0A 1GEHA 3C0BA 4ID5B 2WOMA 4NPOA 5CABA 5H2FU 1PK1B 2AXTU 4I6WA 1YZ6A 3NNAA 2HBYB 4ECRA 1N5VA 4M6WB 2D9PA 3A8KA 3MCMA 5JXSA 4F3QA 4FJ9A 4RW8A 1J9AA 3BPDA 5AE2A 1QZ5A 3NWRA 1N56A 4K42A 4IOBA 2D3DA 2DR7A 2ZJAA 4KLOA 1RGVA 3HHNB 1D8ZA 3HSGA 3M4XA 4NMLA 3S3NA 4NCBA 1Z6RA 3KFUF 1PC4A 4YOVA 2W4DA 4MH8A 2HSTA 2DO4A 4RPFA 1H73A 3VAFA 4A2BA 2D1KA 2FY8A 4O44B 1RADB 4A57A 3VPZA 3Q2TC 5CB1A 2IJFA 4AM7A 5HMYA 3FBFA 1NH7A 4IH6A 2OSQA 1VQSA 2LVWA 4YOUA 1ZQXA 3CCWA 2R7RA 2UXCK 3UE5A 2L08A 2B7BB 2W55A 5BPMA 2QFJA 1O51A 2HHXA 2OUGA 4P0PB 3JPQA 3NL0A 4YG2A 1HBMA 3C6UA 3BGRB 3Q7BA 4JI8J 3DRRA 2RPIA 4AYBC 2W9CB 3BBBA 4IO9Q 2I2YA 4OQJA 4LFAK 3FKBA 4OKJA 4C98A 4E89A 3DRYA 3ELHA 3TWZA 4AQYF 3LVVA 3MGJA 2M0NA 3UR3C 2QLXA 2JGAA 5BR8K 5CE3A 1FK9B 2I0XA 2FZKB 2IYIA 2EC2A 4PWUA 1N5YB 1X7VA 5E26A 2M2BA 2HHPA 1KC8T 5B8HA 4CZIA 3EDQB 1UA1A 1VSLA 4BQZA 1U02A 1JJCB 2JL9A 2D6FC 3D2WA 3AY0A 4KH6A 4IFVB 2R7WA 3D54A 1H72C 3KK1B 1L6NA 4FVCA 4RQ5A 2R7VA 3RU0A 2JNJA 3A0HU 3M8RA 1FKOB 5J0XA 1UOCA 2YNIA 4RW4B 1VRUA 2MQPA 1RB0A 3GONA 1QHTA 1AT1B 3JTNA 1C20A 5BJRA 3NTUA 2F3NA 2ZZMA 2A6OA 1RDWX 1XIQA 3MPDA 4Z4FA 1YHQN 1NJXA 2MSSA 1F5CA 3IG5A 2XYPB 1Q8KA 3CFOA 3IR7B 2CDRB 3EYZA 2ZUGA 3C1ZA 5DM6L 1CPZA 1VJWA 3DLGA 2HHSA 1VQMN 1X4EA 4P7VA 4CF8A 4FLZA 5KFRA 5ALGA 4RO0A 3SQGB 4E7HA 5CH7B 8ICAA 3T5KA 2ACYA 4MYUA 3Q8MA 1SWWA 1TL4A 3JTOA 9RUBA 8ICGA 4CK1A 1A77A 4CZEA 2G13A 3R8EA 1O0PA 2XS7A 3RB3A 3HD1A 5ETNA 1C1BA 3VEWA 4Y00A 3T5LA 2C42A 3CE8A 4IG3A 4FWMA 1V97A 4J9OA 2KFZA 1K73T 1QSSA 3QBWA 3T6JA 1S97A 4DV2J 4DTXA 3KLHB 2E5LJ 3H2UB 4AUKA 4HH0A 4GC7A 3KLFB 4Y2YA 1V9PA 4PPDA 3H8SA 1M90O 5HMWA 1RLCL 4CO0A 3JPRA 3VA3A 4Q2MA 1UQVA 1CJUB 7ICLA 4QZGA 2MGZA 3C94A 1L8OA 1RBSA 1LEOA 3LYSA 3CERA 1S1TA 5CQGA 4KX5A 2E5JA 2KE7A 2LBOA 1U1NA 4BR2A 3MX5A 3ZFVA 1T03A 1ITGA 4F0HA 4YDUA 1LXJA 1BWEA 1VJQA 2N3OA 3CJKA 2IMWP 2G8HA 2WHEA 3QIOA 1FNMA 5ALEA 1X31C 4M5KA 2QA4G 4B9UA 2B6GA 2BV3A 2YX4A 3TJ8A 3TTFA 3IAYA 3R5BA 3L9ZA 1J5EF 5AJ3K 1ZQKA 3QERA 3ZD9A 3MAQA 2ITMA 1QLNA 4B9VA 2IOFK 2V52B 4JYAF 4Z7CA 4ZLPA 3HCXA 3C2MA 3I55N 4BRQA 3QO9B 3R6MA 2RS8A 1HEKA 4I9LA 3UD4P 1TGOA 3EKUA 4OJRA 4OHXA 1S0OA 3AQEA 4IEIA 3B78A 3UMGA 1N32K 3FRZA 3CETA 3C2KA 1R0BG 4LFCK 3KHYA 3EGWB 1Z00B 5GAEP 4RNHA 3W5ZA 3DLLQ 5AZJA 1RFQA 1ASWA 5KRTA 3M8WA 4ZTFA 4M7YA 3B6OA 2EHGA 3R7NB 9ICPA 4DU7A 4C7ZA 3IFEA 4IC9A 4JI3K 4Y1CA 1GLAG 2HURA