1NJWA

Guanine-thymine mismatch at the polymerase active site
Total Genus 211
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
211
sequence length
580
structure length
580
Chain Sequence
b'AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA PRIMER STRAND
publication title Structures of mismatch replication errors observed in a DNA polymerase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 211
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2003-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1njwA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1njwA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1njwA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1njwA01
1QHTA 2JGUA 7ICQA 2XY8A 1RNHA 4NYNA 2W9MA 4UB2A 1B9FA 4PA1A 3AVGA 2P5GA 2QKBA 1GOBA 3KLIA 1NK9A 1ZQPA 5DBBA 2X6NA 1KVCA 3RMAA 1B92A 5L1IA 1WSJA 2KZZA 1U9LA 1RTJA 3RJGA 3KLFA 1ASUA 4RQ1A 3AUOA 2D0BA 5KG7A 1S1UA 2P6UA 2R8IA 1S5JA 3EPGA 4I2QA 3OYJA 2ZQBA 1QQCA 4LSNA 4CIFA 9ICPA 1ZQSA 4NXZA 4OGCA 5J2DA 1ZQFA 1BPYA 4CK3A 1TGOA 1QSLA 7ICMA 4IR9A 2JEFA 1JLBA 3K57A 1COOA 5J0OA 3AVMA 4C8NA 2IDOA 2MUTB 2R8HA 3CFRA 4KLFA 3SI6A 1G15A 4E1NA 3BGRA 3HPOA 1K1SA 3ZT3A 9ICLA 3KD5E 4ZTJA 5DG7A 4O3SA 2BCVA 3ISCA 3C2MA 2X6SA 1X9WA 3ZSYA 4E7IA 4TQRA 3SQ0A 4M9JA 4Q8EA 2BANA 4FZZA 4DMNA 1QS4A 1VSFA 4DU1A 3QEVA 4G3IA 7ICJA 3UIQA 1YTAA 3NH0A 2G8IA 4IRDA 1Z00B 5IIIA 4M6WB 9ICFA 3QLHA 2I9GA 1KFTA 3QEWA 4KLJA 1JMSA 8ICOA 4CJRA 3SPYA 3SQ1A 1RXWA 1X1PA 3LDSA 2ASLA 3H4DA 1CLQA 4RQ5A 1RT4A 3HPGA 4QWDA 4CFCA 3V6HA 4CF0A 2BQUA 1B9DA 3V81A 3RJJA 1UA0A 3F9KA 2BCSA 4DU4A 4NY8A 1RTDA 4FJ8A 1HYZA 4I9LA 4FJGA 3HM9A 4E0DA 4M47A 4HCCA 4J9LA 3TI0A 4CJTA 2YNIA 3UPQA 9ICTA 1UT5A 2FBTA 1VSIA 4RQ6A 5D49A 4EP4A 2VG6A 2HHSA 4OKJA 2PXIA 3EWAA 1ZBFA 3C5GA 5DQHA 2OPSA 3AVLA 1KFSA 3V9XA 1RZTA 1TL1A 3VQAA 4CIGA 7ICFA 4KLLA 4MF8A 4CHYA 1IG9A 1RDAA 4B8AB 4J9PA 3MXMA 2W9CB 4RQ0A 9ICCA 3C6TA 4H8KA 4DFPA 5DQGA 5CZ2A 3G6XA 5HRPA 2R8KA 2PFOA 1YVUA 3VQDA 4AILC 3D45A 3KHHA 3IM1A 4F2RA 4K4GA 4DQSA 4DTSA 4PHDA 2A1JB 4ZHRA 5HHIA 4ELTA 4FJLA 4I28A 3KKSA 2BDPA 4IQWA 2P5OA 4I2FA 4CESA 2I1QA 2OA8A 3PMNA 1KRPA 3ZDDA 4CGDA 3JPNA 8ICXA 4FK0A 3SV3A 3OYMA 4J9MA 4ECQA 1MU2A 3VQ5A 3RRHA 3AA2A 1JLAA 4O55A 1C0TA 2XCAA 2F1HA 3KLGA 5FRNA 5HBMA 2HMIA 3L2UA 4CHPA 2Z1GA 4CHOA 5KT7A 1ZQAA 1D8LA 2BPCA 4KAZA 3RB6A 2HNYA 3L2QA 4RQ2A 3OHBA 4UB1A 5KT4A 5L1LA 3AA3A 2YHAA 4DU3A 5CYQA 5KT2A 1ZBLA 1IKXA 7ICVA 1N6QA 4JUZA 5D4BA 4CEBA 1FKOA 1SL0A 3LP1A 2NUBA 4M3RA 5KGWA 2NRVA 1ZQRA 2B4JA 4IRKA 4F5QA 4YXJA 4ECRA 4KTZA 4AH9A 3QNOA 2OPPA 4QWEA 5KFLA 3HK2A 4MEXA 4YR3A 1DGSA 1UWBA 5J2JA 3TFSA 3PR5B 3LZIA 4M41A 4KLMA 4F91B 2VWJA 3NF7A 4FS2A 4B9MA 1TVRA 4C8OA 3OYAA 1XO1A 3SI8A 1C1CA 3CFOA 3PY8A 3UQ2A 1XSPA 7ICNA 3JPTA 4O5CA 1UOCA 2AGOA 2AGPA 4OLBA 2OYQA 1HQEA 5DB6A 4ED1A 4FLTA 3RJHA 3PW2A 4M04A 4Z6EA 3DLRA 4XQ8A 3L2WA 1ZQGA 4B9LA 3RR8A 3RR7A 4RQ7A 1S76D 5DGAA 3K5OA 4EBEA 4OKKA 4JWMA 1WCNA 3NF8A 4IDKA 2KW4A 4QOZB 4M3XA 2AGQA 3PV8A 1NK0A 2LSNA 2JZBB 4B9VA 1BISA 2G8HA 4O44A 4QZGA 4E7HA 4M9LA 4RZRA 1UAXA 2V9WA 2BKEA 4DQIA 3OYLA 1TKDA 2MUTA 2VG5A 3V4IA 1TK8A 1IO2A 3NE6A 4FJKA 3MBYA 3NGZA 3LP3A 2O4GA 3NH2A 4KMUA 3S3OA 2DFFA 4I9QA 2ZUDA 4QZCA 4XIUA 3MGIA 4IRCA 4ED3A 1TKTA 4PUOA 1TK0A 1SKWA 8ICAA 3P5JA 3M9OB 4M0AA 2LYHA 1QTMA 2FBYA 3DLHA 1B43A 3NTUA 4QW8A 3KLHA 4F92B 1EXQA 3ZD9A 5DB9A 4KLUA 4B8CA 2Z1IA 3PVXA 5J2NA 2M9NA 2FMSA 2HB5A 1Z00A 5HRRA 4CEDA 4W5QA 3T5JA 4UAWA 5IILA 4DTJA 1EX4A 4IKFA 2UVRA 4FJJA 1RDDA 1L3SA 1ZQCA 5DGBA 3EY1A 1JXEA 5KFQA 3EPIA 3NGDA 5KFNA 1CXQA 4JLHA 3WNEA 2HHUA 4NLGA 3QINA 1NJZA 4JRPA 2XCPA 4AHSA 4J9SA 4FM2A 4QWAA 2Y1JA 4F4KA 2W8LA 4FCYA 4GXKA 2ETJA 1LAVA 4IQUA 1HUZA 1JXBA 4QZFA 4ELVA 2XC9A 5IIMA 3RJKA 1S0OA 3UQ0A 4KO0A 3TABA 4DL2A 2W42A 4KHUA 5C25A 2AQ0A 4ED6A 3T1AA 3B6OA 3OJUA 3ZSVA 4IG3A 1BPBA 2IC3A 1ZQLA 5J2CA 4NCAA 5J0RA 2RKIA 2BPFA 1Y97A 1S6PA 4QZAA 9ICQA 3NAEA 5KFZA 5HP4A 3C94A 5KFEA 3ISDA 2GUIA 8ICQA 1S0VA 2QXFA 4W5OA 4I2DA 1ZETA 1RT5A 2Z1HA 2R7YA 2P6RA 1NK5A 1RTIA 1C0UA 3NHGA 4CIEA 4ELUA 5JUMA 1R0AA 1D9FA 1CZ9A 4HUEA 3ZSQA 2ZTDA 5J0UA 1LWEA 4M9NA 4BE2A 5J2PA 4TUQA 4J2EA 4GMJB 3O3FA 8ICJA 3VA0A 5J2HA 4DS4A 3HL8A 3L3UA 3MR3A 4JV0A 3ZCMA 2A1JA 3N97B 4O5KA 1A77A 3FYHA 3PR4A 5KFPA 3V6KA 4PGXA 1RYSA 3LWLA 1NK7A 4LSLA 3SUQA 2JEGA 3EZ5A 5DLGA 3Q8RB 3T5LA 3NFAA 3RBDA 4KLQA 3C2KA 3MEGA 4O5EA 1S10A 2J6UA 4UQGA 5KFGA 1BIUA 3KK3A 3OSNA 5IIOA 2FC0A 1ZYQA 4KI4A 3PW7A 1YT3A 3HSTB 3OY9A 1BI4B 1QSYA 4DSJA 1LV5A 3UXPA 4HYKA 3H08A 3UXNA 2HHTA 4YQWA 3RH4A 3VQQA 2FPKA 3UXOA 1S9GA 4RU9A 1L3TA 5CB1A 4IR1A 4HUFA 8ICWA 4Z0UA 2BHNA 3KJVA 3RAXA 4M2YA 2MAXA 3AVJA 1ZBIA 2XY7A 4Z4CA 4P4OA 4KHNA 1KLMA 3HPHA 3RWUA 4O3QA 1SZPA 3G6VA 3PX0A 4CHZA 3V7LA 3NDKA 1W0HA 1VRUA 3HJFA 3MR6A 4F4WA 2FPMA 3OYIA 3MEEA 3I0SA 3AO4A 8ICZA 4I2PA 4N76A 3S3NA 1QSSA 1RDBA 5BPCA 4DWIA 1VRTA 3FDSA 3TAMA 3RH6A 3PW4A 4I27A 3ZSWA 4NCBA 3V1RA 4Z4GA 1RT6A 3M9NB 4CERA 4K8ZA 1H38A 3V6JA 4CFDA 4M3TA 4ECSA 4DSFA 9ICBA 5KRSA 4FJ9A 8ICPA 4DLEA 3SYZA 3H40A 4DQQA 3OHAA 3AU6A 3VQ4A 4F2SA 2JZBA 2DPIA 5CZ1A 4CEFA 4CHNA 3ASMA 1WCLA 4Z4HA 2VG7A 1REVA 1U49A 1MQ3A 3QE9Y 3BJYA 2BQRA 4ED0A 3QIOA 3QEXA 4KN7A 4FVMA 5EU7A 1U45A 1KDHA 3VQCA 2WONA 3ZT0A 3NCIA 1LW2A 4RQ3A 2BCUA 4KLTA 3KKRA 3RMDA 4BDPA 3LPTA 4LH4A 1JXLA 1ZQNA 1IH7A 2Q3SA 2HHXA 3MDAA 3T19A 3QERA 3AO1A 4FLYA 3MFHA 4IG0A 4FS1A 4Q45A 4B3OA 7ICIA 2D0CA 5HNKA 1S77D 4Z4IA 2W9BB 1WNSA 4E89A 4DTMA 1Q8IA 4PY5A 3KHRA 5KG6A 1NKBA 3PW0A 5J0YA 4J2DA 4Q0BA 5KFTA 5HHHA 1KTQA 3JPSA 2C2DA 1S0MA 2RF2A 3VA3A 2IOCA 2ATLA 3E2EA 2C22A 1JL1A 3AA4A 4N47A 4FJHA 2E6LA 4R5PA 4DL3A 4B9UA 4B9SA 4IQTA 1VSDA 2ZUBA 3K5NA 7ICEA 4O3NA 1SUQA 1HRHA 4J2AA 5KFKA 4JWNA 1ZQIA 4DG1A 3AVFA 3D0PA 4CF1A 3HXMA 4BE0A 1TFRA 4RNNA 3QEIA 3H8JA 5KFMA 9ICSA 3QO9A 4FJMA 2FLLA 4BWJA 1BCMA 4QW9A 1BPXA 5HRNA 3EYZA 1D8YA 1ZQUA 1JLCA 4RW9A 1S1XA 1NOYA 1XSNA 4M42A 1Z26A 5KFUA 5CHGA 2ZE2A 2FLNA 1S97A 4QZDA 3OYNA 2WTFA 1V9PA 1SKSA 3C1YA 3ZDCA 3JPRA 5J2BA 3JPOA 3AVAA 5KFBA 2NRWA 4PGQA 8ICSA 3C95A 3WNGA 4ECWA 3MABA 1WN7A 4FJIA 3MEDA 2V4RA 4DFJA 2DPJA 3CFPA 7ICTA 4DOBA 3KHGA 3EW9A 1XC9A 1UA1A 8ICRA 1JKHA 2F8SA 3DLKA 3ZT4A 1BHLA 3G0ZA 3RBEA 3OYEA 1KEJA 4DTPA 3SUPA 4PWDA 4Q44A 1GOAA 4O3PA 2KFNA 4N5SA 3ZSRA 3SZ2A 3CYMA 4KLEA 2PI4A 2YKNA 5J1EA 3JSMA 1WSFA 2XY6A 4IBNA 2JEIA 1XHZA 4FK2A 5KFJA 3PUFA 8ICHA 3V72A 3DLEA 1ZQZA 1BI4A 4YNQA 5IIJA 2ALZA 1U47A 4CEOA 4PPXA 4TUPA 3KHLA 3MAQA 3O4QA 3AV9A 4DTXA 1TV6A 3ITHA 3AVIA 5KFDA 5DG8A 1ZQQA 2HHWA 3I0RA 2VA8A 4KLOA 5L9XA 5E41A 1IKYA 1LAWA 1ZQXA 2PFNA 5J2MA 2R8GA 3AA5X 3HYFA 3HX0A 1HNIA 1RPLA 3GIIA 4Y1DA 2XY5A 5D3GA 9ICWA 4FBTA 4OGEA 3IHQB 2KTQA 3FFIA 3AVHA 4KI6A 4W5TA 4NLZA 4LD0A 1BL3A 4CFAA 1YTUA 1JLQA 2P1JA 2Z1JA 2ASJA 5J29A 4UB5A 1WAFA 5KGXA 4MFCA 5CJ7A 2YHBA 5HRSA 5FROA 3JPQA 4ZTFA 2XRIA 4CE9A 3ISNC 3SPZA 2B6AA 1D9DA 4F4ZA 5L1KA 4PH5A 1ZQYA 3VQ7A 5KI6A 4K8XA 5J0QA 2XGQA 4F5PA 5J2KA 4YXMA 1JLGA 4CEEA 5J0WA 9ICMA 4M3YA 3E01A 3RMBA 1WSEA 3RJIA 3M8QA 5DMRA 4CHQA 3C5FA 4CCHA 1ZQHA 4DSEA 2YNFA 3ZDBA 4H4OA 2IBKA 4CGFA 3DM2A 2GV9A 3DRSA 4KRFA 1C7YA 2C28A 3NGYA 4J9KA 2YKMA 2ZTEA 4KFBA 4QZ8A 3DRPA 1C1BA 5K14A 4O3OA 5KG4A 3LPUA 3PX6A 4N56A 8ICMA 1J5OA 3MGHA 2VWKA 2D5RA 4JS5A 4DLGA 1RT3A 2BGWA 1T8EA 4B08A 2KN7A 4OPJA 3SCXA 4IFVA 2IA6A 3KLEA 4YR0A 1DLOA 2BQ3A 1SL2A 3C2LA 2IMWP 4YN4A 5KFSA 5IIKA 5KRTA 1S9FA 4E7KA 3H8SA 4DQPA 5L1JA 1RT2A 3M8RA 3RB0A 1TKXA 3K59A 1S0NA 3ALYA 3TR8A 4K4IA 2F1JA 5KFIA 2IS3A 3DLBA 4M6WA 2OZMA 1BPDA 1ZQWA 3QEBZ 9ICNA 4YVZA 2RN2A 1BQNA 3KD1E 3Q8LA 1AROP 8ICCA 3K5LA 2JLEA 3Q8QB 4I2AA 4OVLA 4XRHA 1X2IA 4I29A 2HHQA 1ZBUA 3TAPA 1CXUA 3QIPA 3NH1A 2F1IA 3DRRA 4J9OA 2D0AA 1QLNA 1NOZA 4Z6FA 3OJSA 4R66A 1ZQEA 1XU4A 5KTQA 4F5RA 2IAJA 1S6QA 1ZJNA 3T5HA 4F3OA 3ZT2A 9ICVA 5KG1A 4OLAA 4DO9A 2B5JA 3DI6A 3AO5A 3RB4A 3HO1A 4JV1A 3GIMA 5KFFA 3VQ6A 3O4NA 7ICOA 4KTWA 2EHGA 3ZDEA 4TURA 5CY4A 4I2HA 3NGIA 5C42A 2DY4A 4FZXC 2JEJA 3Q8SB 3OYFA 1EETA 1BQMA 1LW0A 4FJNA 5KG2A 2HVHA 3RAQA 4R8UB 3V1QA 4KLGA 4QZIA 4KB0A 1C1AA 4RUAA 3GFKB 4GVMA 4HTUA 5C24A 3GV5B 4MFFA 5KFWA 2W9CA 5HP1A 4DTRA 4EZ6A 4O0JA 3T5KA 3OS1A 9ICXA 2PFQA 4BDZA 3IAYA 2ZD1A 1NJYA 1IXRA 4CK1A 3L2RA 3TQ1A 3CQ8A 1BPEA 4NCGA 2I5JA 1T4GA 1TKZA 4EYHB 4AHUA 2OPQA 4RT3A 5T7BA 3CG7A 2RPIA 2FBVA 1L3VA 4O5BA 4GC6A 1FXXA 4CK2A 1O1WA 3SUNA 3VQEA 3WNFA 4YD1A 1RBRA 4KN4A 1BIZA 1RBTA 4Y1CA 4RW6A 2QKKA 4FLWA 3AVBA 9ICAA 1ZQVA 4B9NA 1VSEA 4CJ5A 4CGJA 3JYTA 4BACA 9ICKA 7ICRA 4FLVA 4OKEA 4P4MA 4RPYA 1ZQKA 3RH5A 4TSXA 4PGYA 4XA5A 2ATQA 4FJ5A 3V1OA 3HP9A 2FLPA 2GWSA 3CM6A 5HMMA 1J54A 2OWOA 2HHVA 3IS9A 3GILA 4FLUA 4YFUA 1BPZA 4ECVA 3AO3A 5DBAA 8ICTA 3HW8A 3QZ7A 1TAUA 4FZYA 4CEZA 4C8MA 3OYBA 4FM0A 4I2IA 3N4MB 3GQCA 4GLXA 9ICEA 3VN5A 2WOMA 4RPXA 4O0IA 4EZ9A 2IHMA 2DFLA 2BGGA 3ZD8A 5EWFA 4DOAA 5DB8A 2PZSA 3ZT1A 3V9ZA 4O4GA 1K6YA 3GDXA 1BCOA 4CJVA 1ZQJA 4E7LA 4Z4EA 4DSLA 4OPKA 1RBUA 2XO7A 3TAGA 9ICOA 4DTOA 3K75D 4TQSA 4FYDA 4CJ3A 4KREA 8ICLA 1IM4A 5KFAA 3M8PA 3SQ2A 4CJPA 1EP4A 1XWLA 5BOLA 1GOCA 9ICRA 1JX4A 4I2CA 2KZ3A 3C23A 3TWHA 2W9AA 3SV4A 4QZHA 2ISOA 1ASWA 5SWMA 4DS5A 1U48A 1T03A 5DDMA 1B22A 2E4LA 2EX3A 3AO2A 1SV5A 1ASVA 1UT8A 4DSKA 3OYKA 9ICHA 4CGHA 3L2VA 3NBPA 3HVRA 4LY7A 4O3RA 2C2EA 2ZJ5A 8ICYA 2A1SA 1QE1A 4RQ8A 3SUOA 4GXIA 4O9MA 5D46A 3ZDAA 4I2BA 4DF8A 2FBXA 3C21A 1HJRA 2AU0A 4CJWA 4BDYA 2P66A 2G8UA 4FJXA 3DOKA 1NJWA 1NK6A 2ISPA 3ORYA 8ICVA 1NK8A 4EBDA 2KZMA 1TAQA 3HP6A 3C6UA 2ZJ8A 3LAKA 4BWMA 4M45A 3K2PA 1L3UA 2P51A 3RJFA 3TAFA 4LZGA 2RDJA 4QAGA 4ED8A 2KQ2A 3RMCA 4MEYA 4F93B 2ASDA 5KG3A 4MFBA 1CUKA 2VANA 3M9MB 3LAMA 4M9GA 4F5NA 1RT7A 3F73A 1ZBHA 4M3UA 1FKPA 4IFYA 5KFXA 1S1TA 1MQ2A 1HQUA 1N48A 3GV7B 4R63A 5J2QA 1ZJMA 3MFIA 2DFEA 5JS1A 2J6TA 1S9EA 8ICUA 1RDCA 1XS9D 8ICKA 1JIHA 1NJXA 2X78A 4KB1A 4M3WA 4ED2A 5J0TA 2BCQA 2UVVA 3NF9A 4KLIA 4F5OA 5EWEA 3CM5A 3OSPA 5J2AA 2AJQA 1LB2B 3KIOA 4KHYA 4HHTA 3VQ9A 4H4MA 1MC8A 4J9NA 4F50A 4YMMA 2G8VA 3OYGA 4FK4A 4L8RB 5DKWA 3IRXA 5KFRA 4ICLA 3BDPA 3S3MA 2IGIA 3QZ8A 5I3UA 4QZ9A 4Z6CA 3SNNA 4KHWA 4R8UA 4NLKA 3AU2A 3B0XA 3PW5A 4M9HA 4RPZA 1S1WA 1A76A 1MSWD 4ID1A 4OJRA 4UBBA 1RBSA 4JRQA 2QK9A 8ICBA 3U6FA 1IKVA 4EYIB 4Q5VA 1N5YA 2NRTA 5DLFA 3TAEA 3MDCA 5J0SA 5TZVA 4KKOA 3I8DA 4HVJA 1D5AA 2V4QA 4BXOB 4NM1A 4F3TA 1HPZA 5KFOA 4EP5A 2NRZA 4W5NA 1RILA 2PY5A 5CP2A 9ICGA 4KLDA 1XHXA 2E6MA 4F4XA 4FW1A 5F9NA 1KLNA 5C5JA 1RBVA 3S9HA 2YNGA 3P83D 4K4HA 2KFZA 5FDLA 4E19A 4CEQA 1JL2A 2UVWA 2UVUA 3M8SA 5CWRA 4Q8FA 1N56A 1Q9YA 5F9LA 1TL3A 2FPLA 5I42A 2BPGA 1S1VA 3ZSZA 1KVAA 3RTVA 1WSIA 7ICKA 1DTQA 4DTUA 5DK5A 4QWBA 4YMNA 3VQPA 2DTUA 3VQ8A 4E1MA 4CECA 4EEYA 4NYFA 5KG5A 3TAQA 3G6YA 5KFCA 1T3NA 3BQTA 5CR0A 2B21A 4UB3A 4LVSA 4P4PA 4DL6A 2DFHA 4CJEA 4MFAA 2C2RA 4KHQA 1RT1A 1TVAA 3RRGA 3JPPA 3DOLA 2YNHA 4CF9A 3OYHA 5KT3A 4KITB 3PNCA 3B0YA 4FLXA 3TARA 1X9MA 4FO6A 3VQBA 2HVIA 3V7KA 1HYVA 2ITGA 1ZQMA 8ICEA 5J2GA 5IINA 3PO5A 4IQVA 1CZBA 4BE1A 4DL5A 4ECTA 1I39A 1ITGA 4UBCA 3ZSXA 3AVCA 3SQ4A 3G10A 1I3AA 5DBCA 2BR0A 4PHAA 4N41A 3OVNA 3PX4A 3P1GA 4CJKA 4YG2A 3T3FA 5KFHA 4QWCA 1IKWA 1EXNA 2AQ4A 4DSIA 3DLGA 1JLFA 4JV2A 3BQ1A 4TUSA 1NKEA 5CYMA 4DFKA 4XUSA 4DQRA 1L5UA 4Z6DA 4LZDA 2R8JA 1KCFA 4E3SA 2HNDA 2F96A 1ZQTA 4UAYA 7ICHA 4KPYA 1ZQDA 5BOMA 4KTQA 1VSLA 1CEZA 3A2FA 3ULDA 3H4BA 8ICIA 1HJPA 4GW6A 4CGIA 3ISBA 4ECYA 4CJLA 4CF2A 4DF4A 2J6SA 2A1RA 2W8KA 4HCBA 3MECA 3HWTA 1BGXT 4B9TA 3V9WA 1C6VA 3K58A 4J9RA 1RCHA 4RT2A 5KG0A 1HYSA 4KHSA 5FRMA 3Q8PB 9ICJA 9ICUA 2PI5A 4DEZA 4DOCA 2XHBA 4YMOA 4MF2A 4YR2A 5CA7A 3ETLA 3B6PA 1JN3A 2ZUCA 1VSJA 7ICPA 3KK1A 3QEAZ 4YD2A 5KT5A 3V6DA 1X9SA 2G8WA 4JK1A 1ZQOA 8ICNA 3LANA 3LP0A 1KVBA 5HLFA 3L3VA 1T7PA 3QNNA 9ICIA 4CJ4A 5DG9A 2O4IA 4J9QA 3V7JA 2PFPA 4GC7A 1SKRA 5DDYA 1VSHA 4R64A 2W9BA 5HMLA 4M3ZA 7ICUA 4FW2A 1VK0A 2HNZA 1XSLA 5DB7A 7ICLA 3LWMA 4FJ7A 4RG8A 3RJEA 5KT6A 3H8WA 4GXJA 1A5VA 4CJUA 1F21A 3THVA 4E7JA 1FK9A 1ZQBA 3QEPA 3LZJA 3MXJA 4UAZA 2FMQA 1TV9A 1T05A 1WLJA 3U3GA 4YCXA 4R65A 4F8RA 2HW3A 4WE1A 4UB4A 4ECUA 4DL4A 4P2HA 3PMLA 4Q43A 3TANA 1LWFA 4FXDA 3NF6A 3V9SA 3Q8KA 1J9AA 2RDIA 3L8BA 1A5XA 3O3HA 1NK4A 4W5RA 4HUGA 3BQ2A 3GV8B 4FLZA 2Y1IA 3DMJA 1U04A 2G8FA 7ICGA 4CJSA 4FM1A 4CFBA 1WSHA 1W9HA 4ID5A 3OYDA 3QESA 2VA3A 4DTNA 1TK5A 4I2EA 4RW4A 3O3GA 5HROA 4RNOA 4ED7A 3LP2A 4F4YA 3RB3A 2FMPA 3OS0A 1Z3EB 1U4BA 3QETA 2BCRA 4NM2A 3MR5A 3GIJA 5J2IA 4QZBA 4FBUA 4DFMA 1KFDA 4AHCA 4RNMA 2PYLA 2OPRA 2ZTCA 4BXOA 4KV8A 3K4GA 2GBZA 3K5MA 4CGGA 3SJJA 2G8KA 4I2GA 4CEAA 4YP3A 1LWCA 4JS4A 3KTQA 3PO4A 2F8TA 1VSKA 3DYAA 1Z25A 3AVKA 1PZNA 4KLSA 3LALA 4BGDA 4X5VA 4AHTA 2NRXA 4ZH4A 2PYJA 3H7IA 1HUOA 5DQIA 4DL7A 3MXIA 4MQ3A 2IHNA 4RUCA 2XGPA 3KK2A 3Q8MA 3OYCA 3BQ0A 5J2EA 4ECZA 4NLNA 4QZEA 2VA2A 1VSMA 4C8KA 5KFVA 3U3YA 3LDAA 4LH5A 5EOZA 3OS2A 2BE2A 4I2JA 2H5XA 4ECXA 4AHRA 1XI1A 3LK9A 1BVSA 1RYRA 3HVTA 1NOMA 4RQ4A 3TFRA 5KFYA 4CF8A 1RXVA 4RW8A 4CJFA 4KLHA 5EWGA 1SL1A 2Q0ZX 1EKEA 1HMVA 1WSGA 1JLEA 7ICSA 2X74A 4PQUA 2OZSA 1DOQA 4C8LA 4CJQA 3C1ZA 4G1QA 1K1QA 2YV0X 4PHEA 3IG1A 1A5WA 1Y88A 4RW7A 3V9UA 4EBCA 1DTTA 1WAJA 4PHPA 3OGUA 3HT3A 1KSPA 5J0PA 8ICGA 5SZTA 1HNVA 3MR2A 4J2BA 4QCLA 5J2FA 3WNHA 4YFKA 2ZJAA 4AHVA 4Z4FA 5J0XA 3GIKA 8ICFA 1RTHA 1J53A 3ZSOA 5JS2A 1NKCA 4I7FA 1Q9XA 3AVNA 1C0MA
chains in the Genus database with same CATH superfamily
3ZZPA 1QHTA 2JGUA 2XY8A 1BWEA 2PEBA 3AD7C 3D7EO 4UB2A 3M6UA 1HNZF 4BC9A 2VQEF 2JDJA 3N28A 2P5GA 2QKBA 5JXSA 4JI4F 2IA0A 2P8IA 2PE8A 1GOBA 3H5SA 3MM8A 1IBMJ 4IZ9A 5B0BA 3M2RB 4WFBQ 4FXWA 4A62A 4ID8A 1X42A 4WQ4C 1GFWB 2YPYA 1WSJA 2JL9A 2Z0GA 3RJGA 3KLFA 3CT9A 4RQ1A 3FBBA 3LW5C 4M63C 2EPIA 3EPGA 3OYJA 2XZDB 2B9WA 5BRFA 9ICPA 5LMUK 3AOCA 4Z94A 2G9OA 3DM2B 2GWJA 3FMBA 2CZVC 4CK3A 4A5BA 1WUAA 1V3ZA 4IR9A 1F9FA 4AE5A 5K14B 1Q81O 2NZ4A 1COOA 1U6BA 4C8NA 3CI5A 4CLFA 3RW6A 2CH6A 1U0HA 3HPOA 3M8WA 1K1SA 4WBFA 3AH6A 3ZT3A 1MWZA 3SLCA 5DG7A 4O3SA 2W2NP 3ISCA 4C4WA 3R8YA 1CJTA 1CJUA 3SQ0A 4ALZA 4QPXA 4DV5F 4M9JA 4Q8EA 3CJ0A 3KLHB 1QS4A 2MEWA 1MWQA 4DPXA 3QEVA 4NMXA 2RRBA 3UIQA 2VU5A 3VAFA 1N34J 1YTAA 2CNLB 4IRDA 1NGIA 2HLUA 4KT0C 1K8AO 1WG8A 2CQPA 3IFRA 3KOOA 1YRUA 1K5OA 4DL0C 5GAHP 3RBZA 1RKIA 2BKPA 4KLJA 4X65K 8ICOA 4CJRA 3UDVA 4CNZA 2QE5A 4ZLLA 3SQ1A 3CCSN 1IWAA 5ALSA 1QH9A 2VD3A 2DNQA 1LOTB 2W41A 2QWQA 2PDAA 1Q5YA 3EGNA 4WK1A 5AJ3K 4UUXA 1F1BB 1MMNA 3QWUA 1G3OA 2E8AA 3V81A 4LR9A 4FFDA 4KO0B 1U02A 1Q8KA 2BCSA 5C25B 1RTDA 4X4TA 4CO1A 4FJ8A 5ELZA 2CKWA 2YNIA 2XI9A 5ETLA 4NXNK 2FHOB 4DR5K 2KEYA 1DRZA 2HHSA 4OKJA 2E1PA 2PXIA 2V7ZA 3THXB 2HBJA 1BQMB 2OPSA 2N7YA 1KFSA 2Y8YA 2C3UA 1ZBTA 3VQAA 3WK9A 7ICFA 2FJVA 1F5AA 4XH5A 1RDAA 4B8AB 3OQ2A 9ICCA 2VKZG 4H8KA 3AAQA 1VQ4S 4URQU 5ETTA 3G6XA 1XNQK 2PFOA 2AXTU 3VQDA 4AILC 4K0KK 1HBMA 3R6MA 2VFSA 1XBWA 5AK6A 3KHHA 3IM1A 2WHEA 4DQSA 3DXKB 1MROB 4C11B 4UASA 4ELTA 1T95A 2OM6A 3R1LA 2UUWA 4I2FA 4OYIA 3I28A 1Q0NA 4CE6A 1CULB 1HNXF 4JI5K 3ZETB 3UPFA 3FZ2A 5LMUF 3OYMA 2J7UA 1BWVA 4LSLB 2FJ6A 3TVYA 3ZTSA 3TX0A 2ATCB 4O55A 1C0TA 4W92B 5E33A 3UCGA 2I5HA 2CVEA 5HBMA 2Z4PA 5GAHU 2Z1GA 3KK3B 1ZQAA 2OTJN 3PSIA 3IS9B 4OHXA 3RB6A 2LPEA 1H2UX 3HSDA 3T9NA 4UB1A 5KT4A 5L1LA 3AY9A 3AA3A 2DPNA 2W7OA 1S48A 2ZH5A 3G25A 1N6QA 2LXFA 1M5VC 1WDTA 1Q86T 1SL0A 1M1KO 2NYHA 4KIAA 4YY3F 3IC1A 4AFFA 1XMBA 1ZQRA 1Y00A 4PWUA 3GCXP 4IRKA 1IBKF 3VESA 3BO2A 1EWQA 2LDIA 4AH9A 1WHYA 1KLMB 1UETA 4MEXA 1HKGA 1DGSA 2F3NA 4Y28C 3M8ZA 5F0WA 4BG9A 1TVRA 3QDKA 4Y2IA 4OL8A 3MEEB 4X65F 2O8EB 1FDAA 1XO1A 3SI8A 4ZVTB 1XSPA 4M5MA 4O5CA 2PSZA 1VQ7N 4OLBA 1RBLA 2B8PA 3FCHA 5KNIA 2OYQA 4FP9A 4FWMA 3PW2A 2NSCA 2LU2A 3GWCA 2H3EB 2GVZB 4Z6EA 1T03B 4XQ8A 1N5WA 2OKQA 3DLRA 3RR7A 4RQ7A 1WF2A 2AJFE 3QGGA 1FXLA 3K5OA 3MCNA 4JWMA 2KW4A 4CLLA 2Y9TA 1NI3A 3HKZC 2MZ1A 2AGQA 1FERA 3VGTA 4LFBK 3BS5A 4LF7J 3MD1A 4UTGA 4KGVB 2G8HA 4GKKK 4O44A 3VAKA 2NUHA 4E7HA 4M9LA 2ZWPA 3ZX3A 4BRDA 3VENA 3OYLA 1FWKA 1TKDA 3V4IA 4IOCL 1TK8A 5M1OA 5B8HA 2LYAA 3SAFA 3TEGA 3S3OA 4USVA 2DFFA 4OJLA 2ZUDA 3D2FB 1XNQF 2FUG9 4USHA 1HJOA 4ED3A 4K0KF 3M9OB 1AZSA 4PPZA 1QTMA 2G1HA 1BUXA 2NZCA 1ATSA 1TR0A 4J9UE 2HSTA 4JI5F 4B02A 2M9NA 2FMSA 2R2SA 1QZ6A 4F72A 4DTJA 3WKAA 3BBCA 2V68A 1OO0B 1ZQCA 3S7RA 3V5RA 2K89A 2HI0A 1FDBA 4BR7A 1HQUB 4NLDA 3AOAA 4JLHA 3BF1A 3WNEA 4NLGA 4Y2SA 1TL5A 1NJZA 2IVYA 4AHSA 4J9SA 4QWAA 4A8XA 3BO3A 1NGHA 1SUQB 1F9EB 4HL9A 2HHHF 3JQKA 2NZTA 4LUBA 1N32F 5DM7L 3CD5A 1HR0J 3P8BB 1S0OA 4KHUA 1U1QA 1VMBA 4ED6A 3P4UB 1T9YA 3I55S 4H5RA 5ITHA 3C0BA 3EXYA 1MWMA 2GA7A 3SCLE 1LXJA 5AQWA 1ZQLA 1GH8A 5DM6L 2J4RA 4RW9B 1S6UA 2JWLA 4QZAA 1R6YA 2BZ2A 1HBNA 5AQFA 3HHKA 3J7YI 5KFEA 4F3MA 3ISDA 2AA4A 3THYA 1RXOB 2GUIA 1Y3JA 1S0VA 2MQ8A 5AM0A 3CSKA 4I2DA 1ZETA 2QC3A 2P9CA 2P6RA 4Y6IA 3WBZA 1UFLA 3NHGA 2W04A 4ELUA 4L3KA 5M1QA 4A2BA 4DUZJ 5J0UA 2GCFA 5J2PA 3OXFA 3VZIA 3H0MB 3DJCA 5J2HA 2VZ9A 3CJ2A 1VGYA 3MR3A 4JV0A 2F2AB 3W65A 3ZCMA 4O5KA 1A77A 4DX8H 1N33J 3V6KA 3IV6A 4PGXA 2EAPA 2R18A 1WWUA 2NXJA 2X51A 2O8BB 4DKWA 2J0SD 4PWDB 3F41A 5I42B 3T5LA 4LFBF 3FBCA 5IM0B 1T94A 2YVSA 4YS2A 1PO6A 3TJ9A 3UCUP 1HD1A 3CCLN 2E2OA 2FC0A 3GIRA 3SBTA 3IRUA 3GR1A 2QI2A 3NKYA 3HSTB 4MDBA 1IBLK 1QSYA 3GMGA 1HQ2A 3ETMA 3UXPA 4HYKA 2DGZA 4RNFA 3H08A 4OX8A 3D0GE 4DBQA 3UXOA 1FHTA 2UXDJ 4NLYA 4LFAJ 3LVWA 5LMNJ 2DGQA 5DZ6A 1KN5A 3KJVA 3AVJA 1ZBIA 1JCEA 3C7NA 4C23A 4CLZA 5RUBA 3CIPA 2H4WB 1L7OA 2QB0B 3RWUA 4OCZA 2MZSA 3PYEA 4FVUA 3DGVA 3PX0A 3NDKA 1W0HA 4WZQA 1DXSA 2FSJA 3QXGA 3CULA 3MR6A 3OYIA 2U1AA 3C8YA 4YB6A 4LF9F 3I0SA 3PG9A 3HILA 3NL0A 3O8MA 2MKSA 5H9FJ 2GZOA 2IOFA 4JYAF 1NCLA 2D3OR 1QSSA 1RDBA 1Y10A 3OA9A 1VRTA 4JKAA 1C4AA 1XR6A 3TAMA 3PW4A 2P9IA 2WVBA 2CQ0A 2ZDOA 1VQ5S 2JWNA 4NCBA 4C48A 4F36A 2MHNA 1LEOA 4ZCMA 2CUYA 3E58A 1RT6A 3M9NB 1I94J 1JLGB 3BGLA 4DSFA 9ICBA 5A8RB 9ATCB 4U67L 1U25A 1NB2A 4MIWA 4X4NA 1S59A 2QO3A 4H4OB 4ER8A 3OHAA 3AU6A 4F2SA 4LF8J 4BRFA 4QS7A 4CHNA 2F8KA 3IR7B 3ASMA 3EDQB 1U49A 1SV4A 5AQQA 1MQ3A 5IC6B 5GTHU 4RO0A 2C2MB 2J9DA 3QIOA 2DRBA 1MMDA 1CRXA 1KTVA 1LW2A 3Q24A 2Y9HA 2BCUA 1QAJA 1RT3B 3KKRA 3OBWA 2LEPA 1VISA 3FZBA 3IM9A 3LPTA 1JXLA 2XMTA 1IH7A 3AO1A 4CYUA 1NJIT 3MFHA 3AODA 4FS1A 3OPXA 5AKYA 2D0CA 1YI2N 2IOHA 3OTBA 2W9BB 2E1MC 4ZP7A 1Q8IA 2OH2A 5KFTA 1KTQA 3JPSA 2RF2A 3LDLA 4C4RA 2RQ5A 4XO0A 2G4BA 1JL1A 5AQXA 3SFGA 1VQ9S 3MTKA 3K9KA 3A0HU 4HH1A 3U1MA 2XI3A 2CQ3A 2HFVA 5F8HA 4R5PA 2MSTA 5A8KA 3H0PA 2J7WA 3NOGA 3K5NA 4GNIA 1IV8A 3QT8A 3QIPB 2MKYA 1NH7A 2R4FA 4KHPK 3HHLC 2AHOB 4CF1A 2ALYB 1LWFB 1U26A 3H5YA 1W2BM 4BE0A 1MN7A 3EKUA 1U24A 4CLSA 3AMZA 3CIZA 4C1NK 9ICSA 4BGAA 4BWJA 2ROEA 5E7OB 4ISFA 1ZH5A 3DMJB 1YJNS 3N4PA 3G8SA 2KG0A 4I69A 1KXPA 2P9UB 3BBFA 3I96A 5D8HB 5MAOA 4YDDB 2V0NA 3FC9A 4ANEA 4UOCA 1RAJA 1KNZA 1SQKA 1FRIA 3ULEB 5CHGA 5M2UA 1R8BA 1JJCB 3HZEA 1S97A 3OYNA 1LW0B 4JI0J 4S0MA 2XTJP 3JPRA 2VIXA 2DITA 7FD1A 1HWKA 5KFBA 2NRWA 4PGQA 1VQLN 2HAIA 3KNAA 2HF4A 4ECWA 1JJHA 3MABA 5IQ6A 3MEDA 2OPRB 4WCEQ 2ZD1B 1YJ7A 3VERA 2YX8A 4FPBA 3SQGA 1FJGK 5L1MA 4DFJA 2R7XA 2CPHA 4BJQA 4QBUA 1FVQA 2ROPA 4NCGB 3CJKB 4CLYA 4WIIA 2CQCA 3EW9A 1UA1A 8ICRA 3HULA 4JKDA 5A8WA 3ZT4A 3G0ZA 5F3TA 3OYEA 3MM5A 9RUBA 4LF4K 1CQMA 2WUSA 4ZVGA 4KLEA 2PI4A 2F8MA 3W5YA 4P9SA 5AKGA 4F3QA 4PG8A 1WSFA 2XY6A 2WCXA 4FK2A 2J9CA 5KFJA 4WU3A 2DH9A 4RBVA 1LWXA 3VEZA 3PUFA 1B0TA 2Y9UA 4KGKA 1Y3KA 2YMMA 2G5IB 3KYLA 2ROGA 1D8ZA 1PK1B 1BI4A 5LJVA 1IBMK 1CPZA 2CVIA 2YKAA 4CEOA 5K4LA 2GHPA 1UAWA 4UOHA 1VQYA 1N5XA 3AV9A 1OH7A 4Y2QA 4IKAA 3D0HE 2ZC4A 5DG8A 2HHWA 1JQGA 3I0RA 3UNYA 5E41A 5L9XA 1K9MO 4AL5A 1DFDA 4CF5A 2R8GA 3AA5X 3QBCA 4K5SA 4CZKA 1HNIA 3GIIA 1NXIA 2HWTA 3IG1B 4OGEA 3IHQB 4OZ5A 2GW8A 3WDOA 4C8ZA 1DTTB 5FIIA 2BM0A 4NLZA 1C20A 4LD0A 1BL3A 2D3UA 4NXMF 1OSCA 4DR4J 3KK7A 1YTUA 3W63A 1JLQA 2H5EA 2ZH2A 2Z1JA 5J29A 2CAJA 4WYBA 3SENA 1SIZA 1WAFA 2C3MA 3M1VA 3HDSA 1SCJB 3VVUA 5K8PA 1EP4B 2E8PA 5L1KA 4JI7F 3M2RA 1RTHB 1RFQA 3DN9A 1N52B 4GVEA 4I7FB 3QUTA 4H5NA 5J0QA 3MWTA 3HKWA 4F5PA 4IH7A 4B3RJ 5CA5A 5F8LA 1HIYA 1K73O 2J0WA 3H6EA 3M8QA 1FXRA 2HZAA 3C5FA 4CCHA 2RQMA 4BBYA 3QQCD 3MEKA 4YOVA 2GIRA 1ZAWA 1U7LA 1UVMA 4BG8A 4IOBA 2QWRA 3ENAA 1MNEA 1N34K 2XNQA 2BH1A 3DM2A 3GSIA 2YKMA 3WQPA 4LQ3A 4QZ8A 5ALDA 5K14A 4O3OA 1OUQA 3LPUA 3PX6A 4LQ9A 4I2QB 2VWKA 3ZTQA 4P71A 2A3ZA 2ZH7A 3A8JA 3SCXA 3JXOA 3MMCA 1SL2A 5KFSA 4LF5J 5G4DA 1S3XA 5L1JA 4M5GA 4C0ZA 1XNRJ 2F9WA 1U1KA 4TY8B 2IS3A 3DLBA 2YMPA 4QIEA 4ILJA 2XHCA 3QEBZ 1DBDA 9ICNA 1CJVB 1M0SA 4F0KA 4ILLA 2VQFJ 1BQNA 3ZTPA 8ICCA 3JS9A 4IFYB 1GLCG 2JLEA 4FZLA 1CLFA 2KM8B 2DNZA 2HHQA 4IS7A 1ZBUA 2BANB 2D6FC 2VIHA 5AQPA 5EX5A 5F8GA 2EI5A 3NVWA 2KMDA 3DRRA 4J9OA 2HIQA 1HBUB 2D0AA 1IBMF 4LF2A 3KZXA 4DCOB 2IAJA 3T5HA 3ZT2A 2YY6A 3CB4A 2DH7A 3DI6A 3HCXA 3AO5A 2DKXA 3FEYB 4KAIA 1F5BA 2DR7A 5KFFA 2KD1A 3O4NA 3MAAB 2DIUA 1D3WA 2X3DA 1VQ4N 4IOAL 5IXUA 4FN5A 3ZDEA 3JQJA 4NI2B 5CY4A 1RU2A 2DXFA 4C4SA 2ERRA 2ZOFA 3NGIA 1G2EA 3IBFB 2FD2A 3J7Z5 1H72C 3IXQA 3CJTA 3THXA 1X4EA 4ICLB 3OYFA 3GYGA 1BQMA 4YOYA 4PKIA 5I3UB 4R8UB 1BA1A 3V1QA 2VWBA 4QZIA 4KB0A 4OV1A 4F0HA 5IS2A 4GVMA 1CS4A 4HTUA 4QJVA 3GV5B 4MFFA 3N6NA 5ETPA 3OS1A 1KDNA 3H42A 1OPZA 1KR4A 4LR8A 1IXRA 2DJWA 4ILGB 4CK1A 3L2RA 1RU1A 1XMQJ 2WW8A 1HI1A 4RT3A 3C19A 4C11A 3D1OA 5JMNA 5T7BA 3AB4B 4DCPB 1SC4B 3A5OC 5AI5A 3OLAA 2FBVA 3ZZRA 4FO0A 4J37A 4ZVSB 3BZCA 3ZETA 1U2FA 2CQ4A 3J81O 2HHPA 3W2VB 1WKJA 4FLWA 3R7NB 1TL3B 3JYTA 4BACA 5ALOA 4GFJA 5EDWA 2QXLA 4OKEA 2UZAA 4JI1J 4WFAQ 4RPYA 1ZQKA 3OR1B 1YBUA 1DZ5A 5BXIA 4DR3J 3IS9A 4B1WB 5LXYA 3AN1A 4MHVA 2AIRB 4BC5A 2LHTA 4X4SA 2CJAA 4ECVA 3VCDA 3AO3A 3TA1A 2VONA 3BR9A 1RT1B 3RSEB 1MU2B 2UUBJ 4K5RA 3I33A 3CCZA 1XERA 4I2IA 3FM9A 3NWRA 2P9NB 4RPXA 4O0IA 3HI0A 5AKJA 2IHMA 2DFLA 3PXGa 2LEAA 4DOAA 4PKDB 4J90A 1VQPS 2HNYB 2IPOB 1BCOA 1ZBSA 4E7LA 5TISU 3ZX0A 2KG1A 3PYFA 2EC0A 2W7AA 4LF7K 3MF5A 3F5AA 3MUVP 1OMSA 4DTOA 3K75D 4CJ3A 4DV4J 4KREA 1ZQ1C 5KFAA 1KC8O 1XWLA 2XULA 1GOCA 4NWBA 3QWPA 3IWLA 4X64F 2R2RA 1G1XA 2E2NA 1HWLA 1A6LA 1RA7A 2RUSA 1GLFO 2VFTA 2CADA 4PJ0U 4QZHA 2FJAB 3QATA 4PWWA 4DS5A 2FJEB 4K4YA 3Q8YA 1T03A 4AT1B 4JK8A 1RGIA 2HCFA 3WXJA 2DNLA 2E4LA 2ZH8A 4ZCIA 1ASVA 1UT8A 9ICHA 3CRXA 4CGHA 3MMAB 3NBPA 4K4TA 2C2EA 8ICYA 3SUOA 2WC9A 5ALKA 4O9MA 3O6WA 1FX2A 3R3LA 3PJXA 4Y65A 3C21A 1RWNB 2AU0A 1HJRA 2KLAA 3CCUS 1T11A 2PMHA 3AQFA 1NK6A 2ISPA 4KH4A 5A2QU 2KRBA 1Q95G 4IDKB 4EIAA 4EBDA 4G65A 2KFYA 1NGJA 1URNA 4AQYJ 5D4OA 3M6GA 3C16A 4BWMA 4B6JA 1HR0K 3K2PA 4B3MJ 3RJFA 1H73A 1U8SA 1NMNA 3WK4A 3L0QA 4CH1A 5F8JA 1NUEA 3RMCA 4JI6J 1MA9B 4CZHA 3QRRA 1FJCA 1XJWB 4JKGB 1ZZFA 4M9GA 4CQ1A 4ZS6A 4BRLA 1I1GA 1HHTP 3BGOP 4TYBA 1ZBHA 1TKTB 1IG6A 2ZITA 1FKPA 3TACB 2QMUB 5KFXA 2JGAA 2CGLA 1HQUA 1MWYA 2PFFB 1FFSB 3I55N 4R63A 2HK3A 5J2QA 2ACMA 4NMLA 3CXCM 1S9EA 1RDCA 3I4HX 4X4RA 4DUZK 2Z7JA 4I6WA 4NRTA 1NJXA 2X78A 4KB1A 2H4YB 2GJ2A 3PKYA 4HH0A 4ED2A 2BCQA 2UVVA 4KLIA 4F5OA 1NGAA 5GVQA 3KIOA 4RR5A 4KHYA 3C14B 2WK4A 2CNKB 1N33K 4FWSA 3WXIA 3G82B 4ZA1A 4F50A 2K1RB 3UDEA 4WFNQ 3J80O 5DKWA 4BLGA 5LY3A 2D41A 4KSEB 4ID5B 1NDCA 4C1NI 3HHLA 5CRXA 2VV5A 1XC3A 3S3MA 4ZP8A 2D0OA 2IGIA 4QZ9A 2H3FA 2A2DA 2V7YA 1E6YB 4CW7B 4LF7F 4M9HA 2H65B 4JRQA 2YWFA 3U6FA 4JB8B 4P75A 4TKTA 2KKHA 4FYYB 4X4UA 3TAEA 3MDCA 3DEEA 5J0SA 3ADAC 4FWNA 1M5HA 4UW2A 2RMLA 4IH5A 3H3NO 4G9ZA 1HPZA 3R9LA 3H46O 2OFHX 4ZCLA 5KPZA 4EEKA 4Z7CA 2PY5A 1DKGD 2NSBA 5F9NA 1WG5A 1RBVA 2UXDK 4K4HA 4LFAK 5LMNK 3L09A 4WFYA 4CEQA 2IJFA 2WB1F 2UVWA 2QKQA 2BW2A 1CJKB 1RACB 1Q7YT 2O8BA 3OXGA 3FK4A 3PEJA 3R5AA 2Y0SC 4M1KA 4OJOA 1N5TA 4UT4A 5I42A 3MUTP 2BPGA 1U1RA 1VIOA 3KK2B 4A8OA 4A5AA 4DTUA 5DK5A 4OYWA 4DX6A 3J81Y 2IVNA 2AD9A 2E5IA 4CECA 4NYFA 1DGKN 3G6YA 5H9FK 2CJQA 4UB3A 3OVBA 1VDHA 3UCZP 3BN4A 4DU7A 1L7MA 4KITB 2Z2YB 2X3GA 3PNCA 3MEGB 4BRPA 3ZO7A 1I94K 3EL2A 1JLEB 2M2BA 4RUBA 4IO8A 4LRFA 3W9JA 2H51B 3KUHA 2OTLS 1MN9A 2ZEJA 4AYBC 5D78A 2NNWA 3A8YA 2K7JA 4M5KA 8ICEA 4YHHF 1VQ5N 4QYRA 3B78A 4GV3A 1SWWA 3PO5A 4HTJA 4DL5A 4NJ8A 4NB4A 1SJRA 4IJAA 1VQSA 4LF8K 3MTJA 3KDOA 3G10A 4N41A 3OVNA 3F0NA 2YHYA 4EX7A 4AL6A 2H3QA 1X60A 3DC2A 3L7UA 4DSIA 5GAGP 1X4BA 2XMUA 1DEJA 2MYFA 4TUSA 5CYMA 1VQ8N 4FYVB 4DFKA 3F5EA 4Z6DA 1QHAA 2R8JA 3I87A 4K7QA 2E5LJ 6FD1A 1X6JA 3FCVA 1VRUB 1VC6A 1EWRA 2EZZA 1N0UA 2EZYA 1WNEA 5H1SV 3TTCA 5BOMA 2B7BB 3QAUA 2YB4A 5AI6A 1CEZA 1N33F 3A2FA 3ULDA 8ICIA 3RW7A 1ACMB 4CGIA 3A0BU 4ECYA 4CJLA 2VC0A 4DF4A 3HWTA 3GG0A 3MPUB 5AKLA 3MOZA 4OYZA 1GLEG 2XVTA 3V9WA 3R2DJ 1C6VA 1HYSA 2A2CA 4M5JA 3A3NB 5FRMA 1RTJB 9ICUA 4ZJOA 2K4IA 4DEZA 3H1VX 5FD1A 5CA7A 3CMAS 5T7LA 1S5ZA 3B6PA 4WTOB 4QR2A 2E88A 3CJRA 5FLXU 7ICPA 5KT5A 4CZGA 3MK6A 8ICNA 2CQDA 3LP0A 1VQ9N 3SCKE 2CGJA 2D7SA 2O4IA 2ZJQQ 2W4CA 2PMWA 2PFPA 5DDYA 4R64A 3VF6A 2W9BA 2WTUA 3D66A 1LKYB 5LMNF 1RE1B 2WHOA 4K4SA 1PILA 3EMTA 3I9V9 4JI8F 3BGRB 2V52B 3LWMA 1WEXA 2ZIVB 2B9XA 2FIUA 1TUUA 4PABA 4R0EA 5KT6A 2EFPA 3OBIA 4B3OB 4KH0B 1VLYA 3MGVA 1F21A 1ZQBA 1UP1A 5AM4A 3LZJA 2V2ZA 1OVQA 1ZM3A 1SS6A 1FE0A 3QJPA 1TV9A 2CPIA 1T05A 4FF1A 2PA8D 4WE1A 2FDNA 4PHTX 3U9ZA 1PVPA 1LWFA 1GK8A 3D7SB 1OJ4A 2EFGA 3QLHB 3EE3A 3L8BA 1KS2A 1Q78A 1A5XA 3O3HA 3DOMB 1Q79A 2HSEB 3BQ2A 3W66A 3DMJA 1T44A 4FM1A 4MH8A 1NDLA 1KBRA 3NASA 4F26A 1QAIA 4HT7A 3QAEA 2RHKA 4CBWA 2OHFA 2F63A 3QESA 4DTNA 3A3OB 3CMES 2P2CB 2FMPA 4JI2F 2D1KA 3JTPA 3J80Y 2DXDA 4M8LA 4WIQA 1U4BA 1KVKA 2L08A 3QIDA 2BCRA 1IR2A 2CWXA 2DNYA 2XO6A 4X4QA 4FBUA 1HW9A 3THTA 4OZ2A 3WT0A 4ZPVR 2C2KB 2CZ9A 2PYLA 2OPRA 3K4GA 2G8KA 2IVFB 2ZE2B 3W9IA 1N8RT 1WJ9A 3OW2M 2XMMA 2WSFC 5B66U 3GG1A 4HHJA 4ZVRB 1VSKA 5F8NA 3O9RA 1Z4OA 1Z25A 2YTCA 5KAIU 1PZNA 4KLSA 4BGDA 2NRXA 2PYJA 1VQOS 3SMPA 5FPNA 1OXJA 3CERA 4IO1A 2RQ4A 1Z4NA 4JOUA 4RUCA 2VJVA 2GUPA 3OYCA 2E5SA 4I0WA 5HVFA 4DR1F 2IMOA 3U3YA 2G0CA 2MQOA 5ETOA 4KGMA 2QL7B 3HOTA 4CZFA 3GCWP 4OJPA 3B4MA 4LH5A 4DR4K 5EOZA 2BE2A 2H5XA 5DJBA 1NZ8A 4AHRA 2KU7A 2OCEA 2PD1A 1PVRA 2VKQA 5GINA 2XS7A 1RYRA 5EVZA 4NLOA 2Q36A 1EHWA 4RW8A 5FPDA 5E3CA 5EWGA 3A13A 1L7PA 1HMVA 4P74A 1W7AA 4B3RK 2YKNB 4B3SJ 2FI1A 4UARA 2X74A 4PQUA 1FVSA 2W6LA 2OZSA 2J8AA 4C8LA 2NPIA 2EKYA 1LVHA 1LQ9A 3M6VA 3HTVA 4C3KA 3BF3A 3IG1A 1A5WA 2WZ1A 3HOSA 3FZMA 2L48A 4EBCA 1DTTA 5CYQB 2U2FA 2IVPA 4JN4A 5B7WA 4AUKA 4PHPA 1BMQB 4UUWA 4DR2F 3BS9A 1KSPA 1FKOB 3UN5A 3LP1B 3DU5A 3NLCA 4QOTA 2V69A 4PL7A 4DDFA 2E7VA 2A6MA 1UPMB 4YFKA 3BM7A 2Q1LA 2KKPA 2E1ZA 3ENVA 1TL7B 2QT7A 4EX6A 2QMWA 4FYWB 1RTHA 5JS2A 4I7FA 3SMZA 1VQMN 3JSBA 1Q9XA 3CC4S 1N36J 2PFDA 5ETKA 1NBEB 3QU9A 2JFDA 4NYNA 3PCOB 1A7GE 4LF5K 4M7YA 4P2SA 3AVGA 2P9PA 2C2ZB 2MTLA 2M8HA 1T0TV 1NK9A 1XNRK 4ES2A 4OJ6A 5DBBA 3V4MA 1KVCA 3IAS9 2QGFB 3UNGC 3AAPA 3RMAA 1HQEB 4EENA 1B92A 1W2IA 3HMJG 5L1IA 3BB5A 2VQFK 3EUNA 2PC6A 3CCQN 2MU2A 3FQKA 2R7OA 1ASUA 1PUZA 2D0BA 1F3VA 2Q0RA 5KG7A 1JI7A 3ET6A 3VF2A 4I2QA 2ZQBA 1TAMA 4LSNA 2IM1A 4B1VA 5AE1A 2ZNYA 2ZXIA 4GO7X 4OGCA 4RQNA 4CIOA 2Z58B 3PIPL 4ZLJA 1X6IA 4ZP6A 1RHJB 4HKQA 3VF4A 2ZGYA 3PTWA 2WB1C 2EH9A 2DGVA 3K57A 4FSVA 4Y2VA 3SFUA 2IDOA 4YORA 2MUTB 5LT5A 2VG5B 2Q97A 3MDQA 1R27B 4DZDA 4M95A 3F2KA 3SI6A 1ZM9A 5D77A 2KK0A 4H0VB 3J7AP 4TY8A 2Q66A 4FF2A 1SJ1A 2RP5A 1RYUA 4ZJLA 4OD0A 3KD5E 1CJVA 2E20A 3OTDA 2DBBA 4FWLA 1X9WA 3ZSYA 1FNMA 4I6MB 4E7IA 4TQRA 5E3AA 1WOQA 4JMUA 3O9SA 2BANA 1TKXB 4FZZA 1VSFA 3QUBA 4USTA 4H54A 3UE2A 2ILZA 4ZVOB 2G8IA 3GJTB 4IWVA 1PVQA 2DISA 4YOWA 5B08A 2I9GA 1XMQK 3G86A 3MM7A 3FUYA 2VC1A 1JROA 3QEWA 2GFFA 2XMVA 3T41A 1HEKA 5AQNA 5BREA 4OMFG 3TUJC 4UB8U 1RXWA 1PC4A 2V9KA 3MAAA 4Y2AA 1BY9A 4NI2A 4WJBA 4E8UA 2KVSA 1GTEA 4CFCA 4CI0B 3M32A 1FFGB 3AD9C 4GKJF 3R7BB 3FRZA 2EFNA 1ZA2B 2AYBA 1UA0A 1D09B 3ZZ0A 4CWBA 5H2FU 2EK1A 5EE3A 1B64A 3F2BA 3HM9A 4E0DA 4M47A 1NSQA 4J9LA 3N01A 5SUHA 4CJTA 2W3RA 2W4PA 3UR0A 3BQ7A 2ZBCA 3DAWA 2YTUA 4OO1J 3TO8A 3QBWA 2IC3B 4DR3K 2FBTA 4K43A 1LNQA 3N5FA 3NNAA 2RKIB 5D49A 4OI0A 2D3DA 4EP4A 5IT4A 1S6PB 1GAOA 3W3SA 3UO0A 4NLSA 1VQ6N 3CCES 3QJJA 2UUBK 4OHYA 3V9XA 1RZTA 1YJUA 1PSDA 3D0IE 1EB0A 4CIGA 4CBUA 4LF5F 4FOEA 4MF8A 1IG9A 1RTIB 2W9CB 2E29A 1WF1A 2HFNA 1X3MA 5GADI 3GZ7A 1LWEB 1Z6RA 5HRPA 1YVUA 1B0XA 5CABA 4GIBA 4OI3A 2OANA 4F2RA 1HNZJ 2A1JB 2VQFF 3MOJB 4DXLA 1V3RA 2NS1B 1RWWB 4I28A 3ILIA 4JI4J 1HD0A 4DV4K 1DQ8A 4CESA 1RCXB 2IJNA 1VQPN 2OA8A 2CZ4A 3ZDDA 1SVDA 4V19S 2HOIA 2BUPA 4ECQA 3TSUA 1RAHB 4CH7A 3RSEA 1MU2A 2W3SA 2AEFA 5I3QA 3CJCA 1YG0A 2HAFA 3DDIA 3CEDA 2RLTA 2XCAA 2F5GA 3K0JA 4HACB 1D8LA 3PM9A 4KAZA 5L8RC 2HNYA 3L2QA 1DRGA 4RQ2A 5HK4A 4DU3A 4OZNA 4JI3F 1JNRB 1IKXA 3KLVA 2VBYA 5D4BA 2HF3A 2EFOA 1WC4A 1HBOA 5AQOA 5KGWA 3A5NC 2E9ZA 4A61A 2WOMB 3OD2A 4YXJA 2NPFA 2GH1A 5MLCV 5KFLA 1NGCA 2HURA 1UWBA 3TFSA 4AQYK 1VBZA 3WX8A 2GMLA 4JD2A 2D74B 3ENQA 4DV5J 1YK9A 2B4VA 2ZBIA 4WP8A 1YHQN 4V19J 2QTWA 4YB5A 3CCUN 4B3MK 3L5KA 3O1BA 3M8PB 2AEJA 3W5ZA 2EFVA 3OR2B 2JRSA 4N8OA 4K4WA 3UQ2A 1WTBA 4JI6K 4A8SA 7ICNA 5AK3A 3JPTA 3KKAA 4CO4A 3O0FA 1SBRA 5ETSA 1YJTA 4NLWA 2C3PA 3P6YC 4PAAA 2JVRA 2RNEA 4WTYA 2XSJB 4C80A 4M5IA 2OHDA 5ALYA 2O67A 2QB1A 4OKKA 1WCNA 4IDKA 4DV7F 3NF8A 4QOZB 3H7HB 2DNGA 1N5QA 1IJJA 3PV8A 3HRGA 2LSNA 2JZBB 2IM3A 2H3IA 4GVBB 1XMOK 2LM4A 3SJHA 2GJFA 4QZGA 1REVB 3T7ZA 1OIAA 2BKEA 4DQIA 4MKYA 3DNCA 3QU2A 2FVRA 5JVHQ 5GMDA 1IO2A 3NE6A 3MBYA 1GMWA 3LP3A 4HLBA 2WONB 4K41A 1JUDA 2RJZA 4QZCA 3MN7A 3MGIA 4IRCA 1TKTA 4NEZA 2GIFA 4NA3A 4PUOA 2LA6A 1SKWA 1UZHA 2GQCA 3P5JA 1TUWA 4CLKA 3TR5A 1IVZA 1JB0C 2A1AA 4IQMA 3NTUA 4F92B 1EXQA 3TU5A 3ZD9A 3R1XA 4KLUA 4MFBB 2DNOA 1Z00A 2D3ZA 5JICA 4W5QA 4C3MA 1YQHA 5IILA 1F0MA 5AIAA 1RT7B 1T02A 2RIJA 4IKFA 3TUIC 3UI3A 2E9TA 1T3VA 1HL6A 1OKJA 1JXEA 2KI2A 5KFQA 3HZ6A 5AQGA 4F9OA 2MQMA 3C14A 1HNXJ 1CXQA 3C6AA 2WBRA 2QLTA 2HHUA 1NSKL 3G82A 3IKMA 4JRPA 2XCPA 1RAGB 3O1LA 4FCYA 4GXKA 4KHRA 1PYTA 1UTAA 4IQUA 1HUZA 1JXBA 2ZHOA 2OAUA 8ATCB 1J6ZA 2YN4A 2DKZA 1R7IA 3G87A 2V2QA 1E6YA 1RP5A 5DO2A 3PYDA 4C2MA 2ZIUB 2AQ0A 2XMAA 3I9ZA 4MLHA 3MCSA 1JLCB 3G9CA 5J2CA 5J0RA 3MPVA 3CGIA 1UFWA 3DHWC 1Z1VA 3IFEA 3NAEA 5KFZA 4CLWA 1IJFB 1WYGA 4AQYF 1UWAA 4YY3J 2VGNA 1ZTTA 2R7YA 2Z1HA 2B3TB 1I3OB 1IBKJ 1C0UA 4UATA 4OI2A 1CZ9A 4HUEA 2BJ3A 2AYEA 1CJKA 2X1BA 3RJMB 1D1UA 4J2EA 4CTAB 3VVTA 3T1HF 3O3FA 8ICJA 3VA0A 2PEHA 2DNNA 1TE2A 2KICA 1C4CA 3FYHA 3PR4A 2FXUA 2I6WA 2F3JA 1GLAG 1WSRA 2OTLN 4K8RA 5FDLB 1SC3B 1A9NB 1LFWA 2KXNB 3VZHA 3MM9A 1RYSA 3LWLA 2X7IA 3FSYA 2MB0B 3EZ5A 5DLGA 3NFAA 3MEGA 2E5LK 3J7ZO 2RH3A 3ICLA 1XMOF 4ETXA 1NB7A 1S10A 3CC7S 2J6UA 4UQGA 5KFGA 2C1EB 3JSMB 3DFEA 4WXWA 1F44A 4FPIA 5L9NA 2Z56B 4J91A 2XB2D 2FVQA 3QSIA 4YB7A 1I51B 4FWQA 3PW7A 3VC8A 1QTNB 3NGRA 5IT9U 3R8EA 2IOFK 1NGDA 4DSJA 3DOLB 1HI0P 3N4QA 3EM1A 2FPKA 1YKWA 3O5TB 4RU9A 5CAAA 3D3CJ 3VEWA 4CNYA 5G5GA 4HUFA 3RAXA 4M2YA 3CNQP 5J2MB 4P4OA 4KHNA 5AI4A 4O3QA 4NLCA 3IP4B 3WUHA 3WEEB 3JS6A 3CVKA 4CHZA 3FFIB 1SAZA 3CD6S 1VRUA 4A48A 4F4WA 1ZD5A 5AI0A 8ICZA 2ZIWB 2FY8A 4I2PA 2I9SA 3BP8A 2R2TA 5D0EA 5GTIU 3FNNA 3ZNUA 4OYMA 2OXOA 4DWIA 4M5HA 3ZSWA 2EDUA 2M4MA 4BC7A 4OI1A 2JX2A 4BRMA 1NO8A 2R42A 1KOHA 3WC0A 1H0HB 3CCRS 4NYOA 4IEIA 3O9QA 5C12A 3V6JA 4O23A 4P7VA 3Q8VA 5B09A 5KRSA 1TU0B 5ETMA 5AZJB 1BE4A 1W26A 1VI7A 4FJ9A 2HHHJ 3ENOA 4YB1P 4TY9A 1N32J 4CI6A 1YJ9N 3MECB 4CEFA 4C0HA 3SCJE 5EUHA 2VG7A 5KOWA 5AKEA 4BR4A 4NLTA 4HDHA 1Q81T 5CD4A 4KFBB 4ED0A 3DRPB 4F04B 3QEXA 1FWPA 3LDQA 1LKYA 4FVMA 1U45A 1KDHA 3ZT0A 2QLXA 4BUGA 2L9DA 3HVWA 3G96A 2L9NA 4KLTA 3RMDA 4KPCA 3ZZOA 1AQ6A 2HZCA 2OMLA 1ZQNA 3EX7B 2ZIVA 2HHXA 3MDAA 2DNKA 1PIEA 1UW4A 4GRSA 1HUXA 2Q3SA 4FLYA 4B3OA 2H48B 7ICIA 4LRBA 3CC2S 5HNKA 1S77D 3ENHA 1S57A 4PY5A 4QIGA 5J0YA 2H1YA 4Q0BA 2C2DA 1K8AT 3CMEN 3VA3A 4KH1B 2IOCA 3BZQA 3E2EA 4MKVA 2I8EA 4Y00A 2UV8A 4N47A 4PKGA 2BOPA 1AFIA 4C3LA 4B9UA 2KSOA 3M30A 4CBXA 1S22A 4X4PA 2LLZA 1SQEA 1VDVA 1HRHA 2ZOMA 3DDKA 3M2VB 3ENBA 4JWNA 1ZQIA 1ZOTA 4EK2A 3AVFA 4NV0A 1Q4RA 1F5CA 1XUPO 3H8JA 2HIYA 3QO9A 3VQTA 3S8SA 1HWIA 1BCMA 3UWTA 2SXLA 5HRNA 5AE2A 3RUBL 1FRJA 4G1PA 1D8YA 1ZQUA 2FVPA 1VQON 2E1CA 1VBKA 1O08A 2EANA 4WF9Q 3NVKA 4JV5J 2BDUA 2ZE2A 2NXNA 4RW4B 3EUB2 1T9TA 4LJMA 1A6SA 1KKHA 1RAOA 5EN1A 1Y11A 5AKZA 4XAKA 3AVAA 4JK7A 1E4GT 5C24B 2FZCB 2XICA 3C95A 2O8FB 4PL8A 4CJ7A 3S01A 1Y7PA 4KV8B 3KG1A 4LF9J 4OZ0A 4FPAA 1LWCB 1KN6A 1UKUA 2DPJA 7ICTA 2I5JB 4JYAJ 3ZTRA 4EHTA 1TMMA 3OT9A 3T1YJ 1XC9A 5BR8J 2PAVA 1HKCA 1BHLA 4I1TA 3RBEA 3BZKA 4XTTA 3JAMO 3R6LB 1RG6A 1NGEA 4DTPA 4Q44A 4RW6B 5JVGQ 2LM1A 4O3PA 4N5SA 1RTZA 3SBMA 3CDAA 2HQIA 5T41A 3A8KA 2F4VJ 1N36K 2YKNA 1ZD3A 4CGZA 3EWGA 4KB7A 1XHZA 3HBTA 1FCAA 3V72A 4KMOB 3DLEA 1ZQZA 5IIJA 2ALZA 1U47A 4N77A 4L3QA 1B3TA 2WAQD 3S1TA 5KAKA 4TUPA 2QRRA 2FTRA 3KHLA 2ZWOA 2RQCA 4O0NA 4P2MA 4DPYA 2AV5A 4DTXA 1M1KT 1ZQQA 3UDLA 2VA8A 4KLOA 3GJQB 2ZXHA 5F0XA 5HOOA 2PFNA 2O01C 1NM1A 3CPEA 1TL7A 5D3GA 4FBTA 4O4GB 2KH9A 2KTQA 5GAEP 4KI6A 4P72A 4BVPA 2DR6A 5AQUA 4CFAA 3L95X 2ASJA 3PZPA 1SC1B 3H1QA 5KGXA 2VYPA 1UW9A 5CJ7A 1GXUA 5HRSA 4ZTFA 2XRIA 2B6AA 5HR6A 5ADXH 5ETRA 3NCRA 5KI6A 2CXEA 4WFXA 1P8GA 2XGQA 4EFAC 5CCMA 2N1RA 2RE2A 3R5CA 2R7VA 3ZZYA 4ZVQB 3E01A 5A0YB 4RBTA 1YX2A 1WEYA 3MN9A 1URRA 4FXVA 4DSEA 3M6WA 3ZDBA 3MWBA 1E6VA 2BKNA 3Q2SC 1YAGA 4CGFA 4CF3A 2N4CA 4JKHA 2W55A 1SIWB 2ASPA 2GV9A 2YQ0A 4H4KA 3CDWA 4DUYF 4NYPA 5ALFA 2ZTEA 2HBYB 1ZPVA 2LQBA 2FGOA 5KG4A 1FI4A 4N56A 1J5OA 3MGHA 3C46A 4A2AA 3DOKB 3GE9A 2D5RA 4DFDA 1G7CB 1PKUA 3BH7B 3I32A 2EG2A 4DLGA 5AZIB 2BGWA 3G71S 3DXBA 3H2VE 1FFVA 5HJYA 3DGPB 3C6UB 3KLEA 3BO4A 4YR0A 3OTCA 1OH6A 2BJ8A 2BQ3A 1ZRMA 3GJRB 1IJEB 4TU7A 4DQPA 4AXJA 2Q31A 3RB0A 1TKXA 3K59A 2GELA 4TNOA 2QL9B 3HSZA 3TR8A 2YJFA 3P38A 4YOXA 2VHGA 2FHMA 2AX0A 5KFIA 2XG8A 2V50A 3OL8A 2OD6A 4PYDA 5EY4A 3WK8A 1UJ4A 4X66J 3O5BA 1SZHA 5HQLA 5HVGA 2VKRA 1N36F 3NAHA 3K5LA 1SV0C 3Q8QB 4I2AA 2ZUGA 4BRIA 3OFHA 2DY1A 4XRHA 4U96A 4CH0S 5HR7A 1WG4A 4U7UD 3TAPA 3B82A 2FHJD 1ZS6A 3IR5B 3WKDA 3GU3A 5KL8B 1H98A 2J5AA 1W2BR 1WDDA 3CCWA 3EVWA 4Z6FA 3OJSA 1XU4A 4USAA 4AXIA 1S6QA 3M1FA 3CCEN 9ICVA 3I4PA 5KG1A 1K8KB 4DO9A 3HJVA 2IJRA 4XH1A 2F40A 1U2CA 1HNZK 3HO1A 3U7JA 3GIMA 5LJ5Y 4JI4K 2F44A 2DHXA 4H4MB 3AEVA 3DU6A 2DY4A 3IRXB 2P9KA 2JEJA 5ETNA 3WK6A 2YQ1A 1EETA 4FJNA 5KG2A 2HVHA 4KLGA 4RUAA 1B0VA 3GFKB 3QGHA 2MGZB 2JSXA 1FJEB 5KFWA 2W9CA 5HP1A 3F56A 2BJ7A 3GP9A 2YH1A 2PFQA 5BYQA 3ILLA 4DI6A 4WU2A 1ZTWA 3D3BJ 2A0FB 2M0GB 3OHRA 4OQJA 4IDHA 4NXMJ 2KOBA 3M8YA 3CQ8A 2Z30B 2Q6BA 1UHUA 1T4GA 1NGBA 2ASYA 2LCWA 3CG7A 2RPIA 2YX1A 3I31A 3FR0A 4O5BA 2ZJRQ 1FXXA 4CK2A 3NRBA 3C6TB 4JI7J 3VQEA 3UKRA 2L9WA 1RBTA 2GV1A 1NLKL 3AXKA 3KJFB 3O9TA 2QKKA 3NAIA 2K3IA 3AVBA 3C3LA 3P4IA 9ICAA 5CEHA 4OV6A 3JAMU 4USWA 4CGJA 3MMVA 2HGLA 1EARA 3MHYA 4P4MA 4ZHRB 4DV5K 3RH5A 3EJMA 4XA5A 2ATQA 4FJ5A 1TL4A 4LRCA 2QWNA 3CCMS 5HQ8A 3HSJA 4HACA 1NHUA 3JQMA 4YFUA 1OH5A 3I6PA 4U6PA 3HW8A 2AW0A 2GAHC 2NXUA 2YWKA 2KB2A 3BY5A 2GC8A 1N5VA 3L4PA 5KAFU 3OYBA 3GQCA 5ALTA 4GLXA 2K8AA 1FRHA 3H8MA 3VN5A 2WOMA 2HMIB 3OTEA 2VBXA 2R3VA 4LRDA 2YKOA 4C97A 5EWFA 1KQGB 1K6YA 3GDXA 3J7YP 1ZQJA 3IO1A 2KJ9A 3I76A 4GV9A 4PXCA 1WD6A 1RBUA 3BSOA 3TAGA 1FNXH 4J7CA 4BC2A 4BREA 3QNMA 4LIRA 2I38A 3KJQB 4USKA 3M8PA 3VEOA 3OR2A 5ADXA 1IKWB 9ICRA 3DLGB 4I2CA 2G08A 1FEZA 2KZ3A 1R8PA 4A46A 3C23A 2AMCB 2CJYB 2NXEA 3SV4A 2L5YA 4Y2PA 5F41A 5JLFA 1NMEB 2C2NA 1GLBG 3D4JA 2ASOA 1BWFO 1B22A 4Y2MA 1SV5A 3TNVA 3ENWA 3KMSA 3OYKA 1C1CB 2WSCC 3L2VA 1VC5A 2F8EX 3CQYA 1RWOB 3LDNA 2IM0A 2ZJ5A 3DKDA 4DHYA 2ACYA 4ENOA 2A1SA 4GMKA 4CP5A 3ZDAA 3NMRA 2V34A 2OFGX 2PMZF 4KR0B 1LXNA 3AL0B 4EU0A 5J1PA 4OLOA 2BOAA 1HNXK 4L6V3 2O6KA 2D3O1 2R7SA 2DR5A 8ICVA 1FEEA 3Q23A 1FFWB 2VDHA 3J8AA 2ABYA 1FDDA 2A41A 4M45A 1NG9A 1YZ7A 1L3UA 2HS4A 5HLFB 4LZGA 4P0QB 5E3QA 2YKPA 4UOGA 4MEYA 2ASDA 2ZIXB 5KG3A 2DRAA 4MFBA 2LMRA 2W1BA 5ALVA 3M9MB 4WZMA 2HNZB 2A19A 1RT7A 4FNIA 3SDEB 4JAXA 5E3PA 3EEQA 4M3UA 2D9OA 1KHVA 2V8HA 4CO3A 5LM7E 3O80A 1S1TA 2XBPA 3E9OA 4YY3K 3LF0A 3J7YU 1IBKK 2F65A 2DFEA 2FF3B 5JS1A 3PHEA 2J6TA 5J2NB 3CD0A 4NA1A 1JIHA 1MWKA 3E3XA 4M3WA 5J0TA 2DGUA 1TZ0A 3CM5A 5BR9A 2PA3A 2A40A 2UU9F 4CD1A 2AJQA 2LKZA 1DARA 1XR7A 3BSAA 4HHTA 3D6RA 2XEXA 2A3VA 2G8VA 4YMMA 2JWKA 4LF6F 1UPHA 1KD1O 3Q8UA 1PAEX 2WMMA 3GYXB 1BQXA 3BDPA 1YJWN 4Z6CA 3LP2B 4NLKA 3AU2A 5CCLA 3B0XA 1RDRA 3F5TA 2RRAA 4RPZA 4KBIA 1S1WA 3FZFA 1MSWD 4DN9A 1GX6A 2BABA 1RBSA 2QK9A 1OQ6A 3KNGA 1IKVA 4ZP9A 1O6XA 6FDRA 1ZXOA 1VS3A 1N5SA 3DLLQ 4Q5VA 2MQPA 2NRTA 5DLFA 1JALA 4IG3B 5TZVA 2DNHA 1YITS 1V38A 2RVJA 3DRXA 2FY1A 2NYVA 1D5AA 4BXOB 2NQPA 2VOPA 4BGBA 1APSA 4PZNA 1U2RA 4TLRA 5KFOA 3AQPA 4EP5A 2ZZNA 3KUEA 2QEXS 5CP2A 5T14A 1U1LA 3CC7N 4YN3B 3CMQA 2E6MA 3LGHA 4F4XA 1FD2A 2KXFA 1KLNA 5C5JA 4USUA 3NCQA 1R59O 3P83D 4MIAA 5FDLA 4X64J 4E19A 2F9JA 1ZM4A 2MRLA 1DAXA 1Q7YO 5G5HA 3TSQA 1BNOA 1O51A 4PKHA 1Q9YA 3W60A 1Y4ZB 1S7IA 3QUCA 1DTQA 1UEKA 4X4VA 3H5XA 2P6SA 2W43A 3J81j 3VQ8A 4E1MA 3G6EN 2KHOA 3AQOA 3TAQA 1T3NA 2B21A 4PL2A 4LVSA 2QA4G 4WWSA 2GX9A 4DL6A 5CYJA 4CJEA 3H25A 1MN8A 4Y2TA 1RHQB 5HL7Q 4U7UK 1TVAA 3HVTB 3DOLA 5KT3A 1K47A 4FLXA 2EC2A 3TARA 1K9MT 4DUTA 2OEKA 2DF4B 2MQQA 1Z1BA 2C42A 2RQKA 2HVIA 2ITGA 3A1YG 2P35A 2HHHK 5IINA 1N32K 2BUNA 3CJ4A 4ZN1A 3UDCA 2YCHA 3ZSXA 3SQ4A 3AVCA 3CCVN 1I3AA 5DBCA 3TJ8A 4PHAA 2Z2ZA 3K8WA 3PX4A 1S9GB 2HBMA 4WFAL 2QA2A 2FZKB 5HMXA 2AQ4A 1V3SA 4CM0A 1DQAA 5ALWA 3L4BC 2ZC3A 2LQ8A 4DQRA 2H3VA 4OHVA 4HI1A 4KGZB 1WOPA 5ALQA 2DHGA 3M6XA 2ZG6A 2HNDA 1BA0A 2DQNB 4ISGA 1DK3A 1G99A 4P6QA 2M0NA 2F96A 1ZQTA 1GXTA 2YHWA 4UAYA 7ICHA 4KPYA 2GTDA 3W1YC 3TA2A 2HBKA 2CA9A 1VSLA 1T9XA 2Y1RI 3H4BA 2GIQA 3CO9A 4I67A 5H9EJ 3ISBA 4CF2A 2A1RA 2J6SA 3PSFA 1VK8A 2MQNA 4HCBA 2KO1A 3MECA 3DXMB 2HVEA 2HQFA 4B9TA 2FGCA 1QQ5A 3AHPA 4RT2A 1WTFA 2FJXA 1BDGA 4UQTA 1RWMB 2H54B 4BQLA 2JJ4D 3FCWA 4CM2A 1YWXA 4DOCA 1WHVA 2XHBA 2KVCA 4Z2XA 4YR2A 2BJ9A 4O8KA 3ETLA 4WJ3B 2D1CA 1VSJA 1PJ5A 3V6DA 1ECWA 1ZQOA 3ID8A 1KVBA 1T7PA 5EOYA 3BYRA 4LSZB 4CJ4A 4I6YA 2H5IB 4J9QA 2O1PA 5K20B 1VSHA 1EQMA 5HMLA 2G0JA 2QARA 2JXJA 2OD4A 3LA0A 1NGFA 4FW2A 2JFKA 3MCOA 4O4RA 2KYZA 4JV5K 4AD6A 3NMAA 4BR0A 1ZXIA 3IRWP 1J5EF 2A42A 4IG0B 3H8WA 1CJTB 3CXCR 2HOFA 2HRYA 1L8OA 4E7JA 1JCFA 1GQEA 5DZ7A 2F4FA 1GTHA 3D2NA 4F8RA 2HW3A 2K06A 1M90T 3TANA 4LF9K 1ULRA 1D9AA 1SV0A 1X4GA 4W5RA 2W24A 4ATNA 2JRZA 1TUYA 4JYAK 2Y1IA 3T1YK 2P9SA 2LQ5A 1X5OA 5BR8K 4EMDA 3EE9A 2IRUA 2AZ3A 4DG1B 3OYDA 4N8NA 4QIFA 4I2EA 4RW4A 2QG9B 5HROA 4IOXA 4XDDA 2I2YA 2R2UA 2F4VK 3V81B 2KL8A 2VFRA 3SBGA 3QETA 4L73A 3WXKA 3CCSS 4YHHJ 5GMKa 2QV6A 4AHCA 2O8FA 2EG1A 4KV8A 4Q2MA 4PXEA 2GBZA 3LM9A 4CEAA 1LWCA 2MSSA 3PO4A 2FJBB 4A8YA 2OPSB 5B0DA 2VICA 2Q1NA 3AVKA 3TA0A 1SH2A 2O8CA 2E8NA 2K8CB 3O1WA 3BGFA 1RHMB 5E5NA 3ZLJA 3MXIA 4MQ3A 3QT5A 2IHNA 1FKAF 2PMZC 4WFNL 3GFZA 3BQ0A 3IBCB 5J2EA 1RKJA 2FZGB 4IC9A 5KFVA 3FE1A 2G2ZA 5A0LA 4K4VA 3QICA 3OS2A 3DHXA 5ADZA 2RUGA 4UY8T 2DR8A 4U9RA 3MN5A 3MN6A 1MDUB 1UFKA 3LK9A 2YWGA 1NOMA 4RQ4A 3TFRA 1RUSA 3AA8A 4WYWA 4TU9A 3BSNA 4A8KA 1IUJA 1RZMA 2Q0ZX 1EKEA 1N61A 1WSGA 1VOMA 5J1EB 5TKYA 1AUDA 2F8LA 4CJQA 5HBMB 1O0PA 2CPZA 3DWLA 4U95A 5B0CA 5HJXA 2FDRA 4NLPA 3R5DA 3ZTOA 3OUYA 2JOQA 4DR6J 4CO5A 1WAJA 4JV5F 1P8ZA 1S4EA 3OGUA 2AYMA 1TV6B 2HMPA 2MY7A 1J97A 4UAUA 1JXVA 2LFVA 1HNVA 2CYYA 4P0PB 1R8AA 1IKYB 4PZVA 4QCLA 5J2FA 5AIBA 5AKIA 3MX5A 4JI8J 2ASMA 1N88A 1L6NA 7FDRA 4Z4FA 5K8NA 2OTJS 1X4HA 1HIWA 2DKOB 8ICFA 4DV6F 4EELA 1J53A 5M1FA 2NLWA 5ALMA 3DXSX 5IWAF 7ICQA 5ALEA 1ZM2A 2KKZA 1RNHA 2DEIA 2KJWA 2W9MA 3R1HA 1TVRB 2JH1A 5A0YA 1P7DA 1B9FA 4USIA 4K50A 3ID6A 4FZNA 4PA1A 3T1YF 2A6AA 3GTYX 5BR8F 1GLDG 3S41A 3PIOQ 3KLIA 4EAHD 1ZQPA 3G71N 4QNLA 2X6NA 3EZOA 2F76X 3EDRB 3WQUA 1JJ2M 1X66A 5AQYA 5HATA 4X66K 2XNRA 2F4VF 1X5PA 4URSA 3AUOA 4EUVA 3M2UA 2P6UA 3C15B 1S5JA 2YMLA 1YGYA 1QQCA 1ZQSA 2HOQA 3NY0A 2YNFB 4PR6A 5AZIA 1VQ7S 2J8SA 3DGPA 4JI2J 1BPYA 5J1NA 1AYEA 3ZI4A 1IR0A 5I4MA 1TGOA 1QSLA 2FB0A 2JEFA 1C1BB 2YX7A 1JLBA 1BU6O 3AVMA 4DV3F 3V4IB 1QAXA 1G15A 2ZH3A 3W64A 4HHUA 2FJDB 3BKTA 2F1FA 1BXNA 5FPEA 2JNJA 3SR6A 2XSFA 3C2MA 2EXUA 2E7XA 2X6SA 4H5VA 2KXHA 1AZSB 1N62A 2CRXA 1S99A 2HMXA 3TQEA 1RHKB 4DMNA 2R7WA 4AL7A 3NH0A 2QA1A 5IIIA 4DR1J 5L38A 9ICFA 1P9YA 2OEHA 2ADBA 4NXMK 3Q83A 1ESVA 1NZAA 4B3TJ 4DV0J 1JMSA 2KJ5A 3M1YA 2W01A 1J2VA 3K8VA 2Y8WA 3OVSA 4FZVA 4C98A 3BPSP 2ZJQL 2RB7A 2Y0BB 5EX3A 2KT5A 2KT3A 4NLVA 4CT9A 3U1LA 4JI7K 4RQ5A 3HPGA 4W90B 3LVVA 2BZFA 4QWDA 3NVMA 2HWIA 3SXLA 4NX9A 5AQSA 2BQUA 2OEJA 3RJJA 1I6JA 2B5JB 3A8IA 4NY8A 4I9LA 4ILMA 4FJGA 3U02A 4TLQA 3TI0A 4HCCA 3OTOF 3UPQA 3M7VA 2Z2LA 2P9EA 2DIVA 3JSYA 1UT5A 3OW2R 2CFXA 1VSIA 4RQ6A 5C42B 2VG6A 3N7PD 4DR2J 3G4SS 1ZBFA 4FWPA 4L74A 3AVLA 5ALPA 4DB3A 1TL1A 2OSRA 4OX9F 4KLLA 4ED5A 2B4UA 3CCMN 4CHYA 5AKKA 2P9LA 3AAWB 1KQSR 4DX7A 3MXMA 4RQ0A 3C6TA 3PJWA 4I68A 4DFPA 1RQNA 4RKUC 1P9QC 5AQJA 3HSCA 2VF3A 2WB1D 4X66F 2OPQB 2GHVC 5HHIA 4ZHRA 2HWHA 1TFWA 3KKSA 1V6HA 2P5OA 2K3KA 1YIJN 2EAMA 1BUPA 4CGDA 7AT1B 3QSYB 4FK0A 2ZVSA 3SV3A 1UJ6A 2Z8QA 1EQ0A 2MZTA 3VQ5A 1JLAA 1H74A 2ZH1A 3AXMA 3MMJA 4F7VA 3AJ1A 3KG4A 1Q7LB 3OFEA 2F1HA 3KLGA 5FRNA 3P45B 2HMIA 2VJ4A 4CHOA 3KBBA 5KT7A 1VRQC 3GDQA 3UM9A 3NS6A 2OGUA 4AF1A 4ZVHA 3OHBA 1Y64A 3IUCA 1ZBLA 7ICVA 4ZIVA 4JUZA 4CEBA 3C66A 1UCVA 2JH7A 1TUVA 2BYCA 1GNKA 3UMBA