1NJWA

Guanine-thymine mismatch at the polymerase active site
Total Genus 211
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
211
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of mismatch replication errors observed in a DNA polymerase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords DNA PRIMER STRAND
total genus 211
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2003-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1njwA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1njwA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1njwA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1njwA01
4RNNA 1U04A 5DDYA 4TUPA 3TAMA 1SZPA 4Z6FA 3ZT4A 4PWDA 3HVTA 4IR1A 3RJKA 1RT7A 4JS4A 3MGIA 2QK9A 4F5NA 1ZQSA 2I9GA 1RBSA 2F1JA 4F50A 4KLIA 4M47A 5KFUA 2WOMA 3PW7A 3DRPA 3MR3A 3BGRA 4CF1A 4XIUA 4AHUA 4E1NA 5DQHA 1YTAA 3T19A 3IRXA 3S3OA 3LALA 4PHPA 5EU7A 2NRTA 2W8LA 1QE1A 4F4WA 4H4MA 4CEOA 5I42A 4FZXC 1GOAA 9ICLA 9ICOA 8ICLA 3DLKA 3OYGA 3V6HA 7ICRA 4DTNA 3VQQA 2A1RA 1NJZA 4W5TA 1R0AA 4MFAA 5IILA 2FBYA 3HP6A 3MXIA 2IOCA 1L3TA 4PGYA 4RQ5A 4CGDA 1JLCA 3L2UA 3OYKA 4B9TA 4E0DA 4AHRA 4CJTA 4FK0A 3NDKA 2OZMA 2EHGA 4IR9A 4Q43A 5KG6A 5CYMA 5KFOA 4KHYA 4KTQA 1CXUA 4KLDA 4PY5A 3DLGA 4DL2A 4MFBA 5J2JA 4HCCA 4QOZB 1VRUA 3O4NA 4TURA 2W8KA 1ZQZA 4N47A 4RUCA 4CF9A 4C8KA 1WAFA 4CJ3A 4OLAA 1HRHA 5J0YA 4I2HA 2HHWA 4OLBA 4CEZA 3V7JA 4M6WB 3GV7B 3AVNA 3I8DA 1ASVA 3TAFA 5F9LA 1S1VA 4BXOB 4NM1A 8ICBA 5KT2A 4CK1A 1LW2A 2R8JA 1QSSA 3Q8LA 3V4IA 2KTQA 5EOZA 4DU1A 5DG7A 5KFWA 4DSIA 3VA0A 4Z6DA 2PFPA 4CJRA 5CWRA 4E7JA 5KFSA 2ASLA 8ICJA 1BI4A 5HP1A 1KDHA 4DL3A 1VSDA 2GBZA 4AHCA 4IQUA 3AVMA 3IS9A 5SZTA 4Z4EA 1SUQA 4I27A 4FJKA 4QZ9A 1NK8A 3RJEA 1Z25A 1QQCA 4QCLA 3NTUA 4NM2A 1LAVA 2JZBB 1ZQKA 2VA2A 4OKJA 5E41A 3RR8A 1MQ2A 4DQRA 3MGHA 5JUMA 2VWJA 1RBRA 4FM0A 5DK5A 1N6QA 3RH4A 9ICWA 2B6AA 2ZQBA 1BQNA 4IRCA 4B9NA 5IIJA 4AHVA 4ELVA 8ICSA 4YXMA 2HNYA 3G6VA 1VSJA 3HW8A 3DRSA 3QE9Y 9ICMA 4JV1A 4OKKA 3VQ4A 4LZGA 5CZ1A 3RJIA 2C2EA 4KTWA 4CEDA 5KT3A 4DQQA 3PW5A 5IIIA 4CF2A 3G10A 4O3SA 1RZTA 2VA3A 4LZDA 3LZJA 4I2CA 4EEYA 3LWMA 1GOBA 4LSLA 4CFAA 4TQSA 1RCHA 1VSFA 1DTTA 4KLOA 1ZQUA 2NUBA 4Z4HA 3OY9A 2UVUA 3KJVA 5KFXA 4JWMA 1S0VA 7ICGA 5DG8A 3NCIA 3HVRA 7ICNA 4FLYA 2D0CA 3C1YA 5KFEA 3TAGA 3WNHA 3RJJA 4IQTA 5D49A 3I0RA 3ZSRA 4RQ2A 1BISA 5D3GA 3JPSA 3UPQA 1Q8IA 1NJWA 4DOBA 1ZQFA 2BANA 4FM2A 2KZ3A 4I9QA 4FJXA 3OYMA 2YNIA 2C28A 2P5GA 3QEAZ 4NCAA 4J9MA 1D9FA 4CIGA 3GV5B 3M8QA 4I2IA 3V9ZA 2YKNA 4PGXA 9ICQA 4DFJA 3DRRA 4ID1A 4N76A 1S0NA 2NRXA 3MFIA 4GVMA 5EWGA 2RKIA 4ECVA 2E6MA 2PY5A 4IRDA 4CGFA 4CEQA 7ICUA 2Z1IA 5J2FA 2V9WA 4EP4A 5DKWA 4ECZA 3G0ZA 5L9XA 4CGIA 3IAYA 4YR0A 2JEFA 3LZIA 1RDAA 3PV8A 3PNCA 2R8HA 4NLKA 2ZE2A 3NE6A 4FJJA 1IKVA 1LAWA 4B9SA 9ICIA 3HJFA 1RBVA 3WNGA 4DTMA 3Q8SB 4M9JA 4DFMA 1KFSA 3RMAA 4CFBA 4FJIA 4FZZA 3V72A 5J29A 3T5JA 3GDXA 9ICAA 4FLTA 3NAEA 1LB2B 3T5HA 5K14A 1Z3EB 1WSIA 3AA3A 3AU2A 4DO9A 4FW2A 1T05A 2FLPA 1TV9A 3HYFA 4BWJA 4RW8A 3LK9A 4DOCA 4CEFA 3MAQA 3M9MB 9ICTA 2IHMA 3B6PA 1DLOA 2WONA 4IBNA 4DU3A 4F4KA 2R8KA 7ICKA 3B0XA 3RB6A 4QZCA 4QW9A 1NOMA 5DG9A 4DTSA 2XGQA 3MXJA 3TANA 4DL6A 4RPXA 4M0AA 4CK3A 5KT4A 4YD2A 4J2BA 3JPPA 4QZDA 3KHHA 4UQGA 4E89A 5DQIA 4DS4A 1TKXA 3WNFA 4Z4GA 4YMNA 3PVXA 1HUOA 4XQ8A 2UVWA 5CP2A 3SNNA 1REVA 4IG3A 4XA5A 5HRPA 4CJWA 2AGOA 4IQVA 3K4GA 4FXDA 4JRQA 2YNHA 4RPYA 2DFFA 3THVA 1Q9XA 4C8NA 4DF8A 2PZSA 2IA6A 1JLBA 3KKRA 3OYHA 1UA1A 3KKSA 3RAXA 4GLXA 4M9NA 4RW4A 4KLFA 4RW6A 3JYTA 5CJ7A 4I2PA 4CHNA 3VQBA 4UB2A 5IIOA 5BOLA 3Q8MA 3K2PA 3AV9A 4Y1CA 2Q3SA 2QKBA 4CF0A 2X74A 2BCVA 4FJ7A 2G8HA 4YCXA 3NGYA 1JLFA 5C24A 3MEGA 4I2AA 1BCOA 2KQ2A 4QZ8A 1ZQEA 1EX4A 1BPDA 2ZJAA 4HHTA 4YR2A 4JRPA 2IHNA 1PZNA 4ECSA 2IC3A 5DGAA 4B9MA 1ZBLA 3PX0A 4DMNA 3ZDAA 2YHAA 1U49A 4FJHA 4QZBA 2AGPA 4QWBA 4R66A 4EBEA 4J9NA 1BVSA 4KLHA 1ZQVA 3QEIA 3T5LA 2HNZA 4M3UA 4CFCA 2G8WA 3ETLA 3MR6A 4ELTA 4ZHRA 2OYQA 3PX4A 1RNHA 3LAMA 4M6WA 3AVLA 5KRSA 1SV5A 1S1UA 4F4XA 2VA8A 3KHLA 2IS3A 3NFAA 1T8EA 4MF8A 4CHZA 1B92A 2FLLA 5KG4A 4I2EA 3RMBA 3OHAA 4N41A 4J9PA 1VSMA 5J2KA 1BIUA 2ATLA 4OGEA 4DL5A 4B8AB 2HHVA 3B0YA 1BCMA 1BI4B 1YVUA 2PI4A 5J2AA 4Q8EA 1WAJA 2A1JA 3AVBA 3C21A 1VSLA 3PMNA 3HSTB 4GC6A 7ICMA 4K4HA 4ED6A 3VN5A 4X5VA 4RT3A 5HRNA 4F5PA 4QW8A 2KFNA 2NRWA 4KLTA 2AJQA 2Y1JA 1KVCA 5J0SA 1VSEA 2E4LA 4QZGA 5KFKA 4ECRA 4KHWA 3TAPA 3P1GA 3M8RA 3SZ2A 2XO7A 1FKPA 3AO5A 1QTMA 1BPYA 2BCSA 3ZT1A 3K75D 2BQ3A 4ED3A 2C2DA 3HK2A 3QLHA 2V4QA 1TL1A 3PR5B 4KTZA 1QSYA 1JL2A 3I0SA 3LP3A 1F21A 2RF2A 1HQEA 3L8BA 3VQ7A 1B9FA 2ATQA 8ICQA 3TI0A 2PFQA 3QZ7A 2W9BA 4K4IA 9ICPA 3GIKA 1HYZA 4DSLA 4KO0A 4I2JA 4KHQA 4F3OA 4M9GA 4DG1A 4PH5A 1ITGA 4KV8A 5I3UA 4ED2A 4OPKA 5IIMA 1U45A 1B9DA 2O4GA 2G8VA 2DFEA 1S6QA 2ZUDA 3H4BA 3AA2A 4ECQA 1VSIA 4ED1A 1TGOA 3Q8KA 2V4RA 4Q8FA 4RQ7A 5KFYA 4BE0A 3AO3A 3HM9A 1X9SA 3CQ8A 4AILC 4Q45A 5KFLA 4EYIB 2ZTCA 2ZUBA 4UB4A 4KN7A 5HBMA 2Z1GA 9ICKA 9ICVA 4TSXA 1TVRA 3P83D 3O3FA 9ICBA 1S9FA 4R8UA 3U3GA 2ISOA 4RQ0A 1RT5A 5J2MA 3ASMA 3C23A 4C8LA 7ICLA 5KT6A 4Q44A 4F4ZA 4MFCA 3AVGA 3ULDA 3SQ2A 2JGUA 3DLRA 1O1WA 3OYAA 1T3NA 1IM4A 5DB9A 4KFBA 3RB0A 4PQUA 4K8XA 4ZH4A 4CJEA 4J9SA 1H38A 1BIZA 5KFVA 9ICGA 4CHYA 3DLHA 5J2GA 2F1IA 5J0UA 3DOLA 5HMLA 1BPXA 1BHLA 2YKMA 1XC9A 4P2HA 4E7LA 1HUZA 4KI4A 3NBPA 8ICHA 2GWSA 4LY7A 4YN4A 1TKTA 1X1PA 1L5UA 4KMUA 3NH1A 3O3HA 1RXVA 3CG7A 1ZQPA 5HHIA 3U6FA 1VK0A 5KGXA 4BDZA 3RR7A 4PGQA 4F3TA 4CERA 5CB1A 1FKOA 3H8JA 1A5XA 4BGDA 7ICEA 3NGDA 4WE1A 5J0WA 3C2KA 4J2DA 4QWDA 2HHTA 2BCRA 4KLGA 1L3SA 2BQRA 4B08A 1ZJMA 5D46A 3SJJA 1L3UA 4YMOA 3EPGA 3MEDA 1ZQCA 3AVFA 5CR0A 4DTOA 2GV9A 4N5SA 4FLXA 5BOMA 3MR5A 3BQ1A 3C94A 2BHNA 1NKCA 4FO6A 1ZQJA 1RDBA 3ISDA 2LYHA 3H4DA 1Q9YA 1TL3A 2ZUCA 3K58A 4JV0A 4JLHA 3VQCA 4YNQA 1ZETA 3Q8PB 1ASWA 4CEAA 3TAEA 3QIPA 3M9NB 4RT2A 4CGHA 4YP3A 7ICJA 1ZQWA 3T5KA 9ICRA 3PR4A 1JN3A 4M3TA 1KVBA 4M3ZA 3ZSWA 3UQ0A 5L1KA 3CFOA 1XO1A 4GXIA 5KG0A 1Y88A 3E2EA 5KTQA 1XU4A 4C8MA 2VG7A 1LW0A 3ISCA 2H5XA 4JV2A 1ZQXA 1RDDA 2LSNA 4GC7A 2OWOA 2J6TA 1T7PA 3V9SA 4RU9A 2BPCA 1TKDA 4CE9A 3V1OA 3F73A 8ICZA 4CJVA 4KLLA 4QZHA 1Y97A 1MSWD 1EETA 1UT8A 2FPMA 4HUEA 1A5VA 3EY1A 3H8WA 3SYZA 2F8SA 5T7BA 4I29A 3VQ5A 4J9RA 9ICFA 9ICCA 5JS2A 5L1JA 2EX3A 3OHBA 4M3WA 3LPUA 1WSFA 3GIIA 5KFCA 4Q5VA 3HPOA 3QEXA 4BXOA 3Q8RB 1KFDA 1JX4A 4KB1A 2FMQA 2D0AA 4DSEA 4QWAA 4I2GA 1Z00B 3RJGA 1CZ9A 3M9OB 4R8UB 4PHDA 2OA8A 4ELUA 8ICOA 4GXJA 1S6PA 3OYFA 3SUPA 1B43A 1MU2A 3FYHA 2UVVA 4JS5A 2NRVA 2KN7A 4RQ4A 1CLQA 2OZSA 5BPCA 2B21A 7ICIA 2J6UA 3SUNA 4DEZA 8ICGA 3V1RA 4UB5A 4ECTA 1KLNA 1D9DA 2BDPA 3QETA 3EWAA 1SKWA 3JSMA 1NKEA 3H40A 3GIJA 1X2IA 3PMLA 3KLFA 5KFJA 1XHZA 4KI6A 3P5JA 1ZBIA 1C0TA 4DU4A 2PXIA 1S0MA 3K5LA 2BCUA 4IFYA 5DB7A 2PYLA 2ETJA 1L3VA 2XGPA 3IHQB 1XI1A 5FROA 4DTRA 5J2DA 3NF8A 1U47A 1TVAA 1D5AA 3QNNA 4DQIA 3V1QA 4FJGA 9ICXA 3C6UA 4UBCA 2KFZA 2XCAA 4Z6EA 3EYZA 2BGGA 3JPTA 5FDLA 8ICEA 5KFNA 4M04A 5J2EA 5KFGA 2A1SA 4IKFA 1S77D 5DQGA 4DOAA 2P6RA 3LWLA 4CIFA 1COOA 3KHRA 5HROA 3UQ2A 2B5JA 4YVZA 7ICHA 3BQ0A 2E6LA 2FBTA 2BKEA 1T03A 3UXPA 3JPNA 3BDPA 7ICFA 3V6DA 3OYJA 2Z1HA 3TFRA 1RT6A 1SKSA 2DFLA 3PUFA 1ZQYA 3BQ2A 4QZIA 5KFIA 2D0BA 3HX0A 4F5RA 4Z6CA 3LP1A 3CFPA 4R5PA 3K5MA 4M41A 1AROP 4QZFA 8ICNA 4CJLA 2PYJA 3C2LA 3NF6A 4NLZA 4GXKA 9ICNA 3GV8B 4J9QA 5HMMA 3MFHA 4RQ8A 1WNSA 4ED8A 1XS9D 4ICLA 3SQ4A 4YD1A 5J2NA 1RT1A 4RG8A 3ZDCA 5KFAA 4FJ8A 4DL7A 3C5GA 4BE1A 1S97A 5HHHA 4DLEA 3ALYA 3G6XA 5J0XA 4FJMA 1WSEA 4OVLA 4LD0A 1RTIA 4CK2A 3S3MA 1KEJA 4FCYA 1KFTA 5KT5A 1C6VA 4KLMA 1IKWA 3SCXA 1HQUA 4H4OA 5KFPA 1VSKA 2AGQA 1A76A 3OYCA 3SQ0A 1VSHA 3K5OA 4FS1A 1KTQA 1C0MA 3CFRA 1SKRA 1KLMA 4FJ9A 3K57A 3KLIA 1MC8A 2FPLA 4LH5A 3AVCA 1XWLA 2JLEA 4HCBA 3DMJA 3UIQA 1S1WA 7ICTA 1QHTA 2VWKA 4CCHA 2DPIA 1Z26A 3VQEA 2DY4A 4E7IA 5KFHA 4DLGA 4I2FA 1XSNA 3FFIA 1ZBUA 1RTDA 3ZSVA 2IGIA 3OYLA 4L8RB 1S76D 5DLGA 1MQ3A 4I2DA 1NJXA 3OJUA 4M45A 3RH5A 2HW3A 2W9CB 1TKZA 3QERA 8ICMA 3ZD9A 8ICVA 5KG2A 3OYEA 3QZ8A 3QO9A 5F9NA 3QNOA 4HTUA 5KGWA 1ASUA 4E19A 3MECA 3SUQA 1B22A 4IRKA 3OS2A 1FK9A 1JL1A 3S9HA 1NK4A 4IG0A 4OJRA 3T3FA 4DS5A 2O4IA 4P4PA 2YNFA 3RMDA 4C8OA 1KVAA 1ZBHA 2ZD1A 2W42A 3QEWA 4HVJA 7ICVA 2BPGA 4YR3A 4O44A 4F2RA 2Q0ZX 1D8YA 1NOYA 4UAWA 5DB6A 4R65A 5KFTA 2BPFA 8ICFA 4IDKA 4O5BA 5J0PA 4EYHB 2OPSA 4XRHA 1BPZA 3TARA 2HMIA 5KG5A 4N56A 4YFUA 4KLSA 1ZQLA 5IIKA 2FMSA 2KW4A 3KLEA 4RPZA 4FK2A 3NF7A 4HUFA 3LDSA 2Y1IA 4CJQA 4W5RA 4DFPA 1VRTA 2B4JA 1W9HA 3KK2A 3DOKA 3VQAA 3AO4A 3V9WA 4NY8A 2DFHA 3N4MB 3VQDA 5J2QA 1JMSA 1K1SA 3RB3A 4YXJA 4KAZA 4LVSA 2XY6A 5J2CA 3PO5A 3M8SA 4DTXA 3SPZA 3C2MA 4AHTA 2F1HA 3H7IA 4MFFA 1EKEA 3RAQA 9ICSA 4FLVA 1ZQRA 3KD1E 5FRNA 3EW9A 4M42A 4ECYA 4PPXA 8ICCA 1BPBA 1HNIA 5DMRA 3TR8A 4EBCA 4ID5A 2FLNA 5EWEA 3MBYA 4O0JA 1RT2A 3NGIA 4R63A 4E1MA 4Q0BA 3L3VA 1UA0A 3TWHA 4RZRA 3JPOA 2QXFA 1TK0A 5TZVA 3AVIA 4KKOA 3L3UA 3OGUA 3OJSA 2G8FA 5L1LA 1HNVA 1K6YA 2MUTA 4CECA 1TV6A 1S9EA 5KI6A 3NH2A 2J6SA 3U3YA 1ZQDA 3LP0A 4O3NA 2BCQA 4O3RA 4QZEA 3L2QA 4FBUA 2XY5A 3QESA 1ZQBA 4ZTFA 3AO1A 1HMVA 3ZSZA 2YNGA 3LANA 3K5NA 4GMJB 5D4BA 2G8IA 1ZQTA 1S0OA 2FC0A 4PHEA 4DWIA 2ITGA 5CYQA 3E01A 1IG9A 3ISBA 1A5WA 1ZYQA 4M2YA 1HJPA 4CJFA 1HPZA 3KIOA 1BL3A 4OGCA 1ZQAA 5DBBA 3TABA 9ICJA 4ED7A 4TQRA 2HHQA 1C1AA 1NJYA 2KZMA 1WLJA 2BR0A 4DFKA 3HP9A 5J2PA 1N5YA 1QLNA 3L2VA 3DI6A 1RT4A 4CESA 4TUSA 5HP4A 1ZQOA 3PX6A 4DTPA 1DGSA 2WTFA 3ZSYA 4PHAA 2W9BB 3KK1A 3Q8QB 3OS1A 5L1IA 4DF4A 5J0QA 5KFRA 3RTVA 3RB4A 4Z4CA 1J9AA 1J53A 4RW7A 4F5QA 3S3NA 2BGWA 1DTQA 5J2BA 5DDMA 4W5OA 4I28A 2R8GA 4YQWA 2HVIA 4HYKA 1JIHA 4CFDA 2I5JA 4TUQA 4K8ZA 1U9LA 1RILA 2I1QA 4NYFA 3V9XA 1K1QA 4O3PA 4IFVA 5J0OA 3RJHA 8ICRA 4I9LA 5HRRA 1EXNA 3QEPA 2P66A 3AVHA 1WSJA 3ZSXA 3GQCA 4YG2A 3AVAA 5C5JA 2HB5A 3RBDA 8ICXA 2RPIA 1S10A 3MDCA 4UB3A 3RRGA 1UT5A 1CUKA 3VQ6A 2XCPA 4OKEA 1ZBFA 4KN4A 3SQ1A 3FDSA 5CHGA 2DPJA 1RT3A 1TFRA 3ZSOA 1CZBA 3C5FA 1G15A 2ISPA 3V81A 1BGXT 4QZAA 3ZDBA 4BACA 1YT3A 4B8CA 4BE2A 4CEEA 4J9OA 3IM1A 3CM6A 9ICUA 4FW1A 5IINA 3RH6A 4I7FA 5SWMA 4MEYA 4O9MA 4EZ9A 2BQUA 1S5JA 3SV4A 3KLGA 3V7LA 4CIEA 1JLGA 3O3GA 4EZ6A 4DSKA 2VG5A 4BDYA 1QS4A 4KHUA 1D8LA 4G1QA 3LAKA 3NH0A 4FM1A 3D45A 3VQ8A 4W5NA 3BJYA 2JEIA 1I39A 4IQWA 3HPHA 5J2IA 4CGJA 1NK6A 1JXLA 3RWUA 5J0RA 1XHXA 4K4GA 1NK9A 2RDJA 3AVJA 1XSLA 3AU6A 3PW4A 3AA4A 4AH9A 4E7KA 2OPRA 4LH4A 2ASJA 8ICYA 3V9UA 4DL4A 2ASDA 4F8RA 1NOZA 1BQMA 4KLUA 4JWNA 1CXQA 1JKHA 1LWEA 4EP5A 4Z4IA 5J2HA 1RYRA 4KB0A 5KG3A 1ZQMA 4O55A 4H8KA 4M3XA 8ICTA 4RQ1A 4PA1A 4KPYA 3V7KA 4PUOA 2G8KA 1EXQA 2XC9A 4NLNA 5J0TA 1NK0A 3ZT3A 7ICOA 4F2SA 8ICPA 3G6YA 3O4QA 4CJ4A 4J2EA 1ZQHA 3RBEA 2PFNA 2IAJA 1IKYA 5KFDA 3OSNA 4FJ5A 4R64A 3V6KA 2A1JB 5FRMA 1T4GA 7ICPA 1C1CA 3DLBA 4KLJA 4O3QA 3UXNA 1NK5A 4O5EA 1RBUA 5JS1A 4O5KA 3N97B 3LDAA 2XHBA 5KG7A 3HWTA 3GFKB 4G3IA 1TAUA 3K59A 4CHOA 4KRFA 4O0IA 1ZQIA 1N48A 2JZBA 3SI8A 3KLHA 1V9PA 4MQ3A 1S1XA 3KD5E 1ZQNA 1WSGA 3B6OA 3H08A 1SL0A 4B3OA 5DBAA 3KHGA 2X6NA 3QEBZ 1IO2A 2D5RA 2HNDA 4XUSA 8ICAA 1SL1A 1I3AA 4RQ6A 4F93B 3C95A 7ICSA 2HHUA 4I2BA 3AA5X 4F5OA 3QINA 3T1AA 3A2FA 3DLEA 8ICWA 4B9VA 4FS2A 1JXBA 4O4GA 5KRTA 3WNEA 2FMPA 3TQ1A 4FK4A 4NCBA 1KSPA 2FBXA 4ECXA 3CM5A 3OYNA 1RYSA 3QIOA 2P6UA 3OYIA 4J2AA 2P1JA 4AHSA 1W0HA 2YV0X 3VA3A 4ZTJA 3QEVA 1IH7A 1LV5A 2XY8A 3RMCA 3DYAA 2P5OA 2M9NA 5KFBA 3ISNC 1WN7A 1JLQA 4P4OA 2F8TA 2MAXA 3M8PA 2HHSA 3HO1A 5DGBA 2GUIA 1ZJNA 1RPLA 1ZQQA 3GILA 5DB8A 1Z00A 1HYSA 5KFQA 4QWCA 4M9LA 1XSPA 3TFSA 1NK7A 1HYVA 1WCLA 1RTHA 1TK5A 5HLFA 5EWFA 3VQPA 4FJNA 4CJUA 1TAQA 5HRSA 3ZT0A 4RW9A 2MUTB 4CJKA 4OPJA 4FZYA 3H8SA 3L2RA 3D0PA 4F4YA 1QSLA 4ECWA 4DSFA 2ZTEA 3C1ZA 1UWBA 3JPRA 3KK3A 4FLZA 3RJFA 3ORYA 3LPTA 2F96A 2PFOA 1WSHA 2W9AA 1RBTA 1UOCA 4M3YA 4E7HA 2IDOA 2Z1JA 3EPIA 3PW0A 1S1TA 3MABA 3ITHA 4P4MA 4UAYA 2ZJ8A 2KZZA 5DLFA 1LWCA 4J9LA 3RRHA 1NKBA 4JK1A 2W9CA 4CF8A 4F91B 3AVKA 4NYNA 4Z4FA 2R8IA 2OPQA 5KFFA 2X78A 4NXZA 1FXXA 2DTUA 4FBTA 1KRPA 1RTJA 4KLQA 4RQ3A 1BPEA 4F92B 3MXMA 8ICUA 4CHPA 3L2WA 2JEJA 4RNMA 2P51A 4E3SA 3TAQA 1U4BA 3ZSQA 2YHBA 4FLWA 1EP4A 2FBVA 3F9KA 3ZDDA 4LSNA 1U48A 3ZT2A 3OYDA 1UAXA 2W9MA 1S9GA 5CZ2A 5KG1A 1JLAA 3OVNA 1C0UA 4O3OA 3PO4A 4YMMA 3JPQA 2ALZA 4UBBA 3MEEA 4ED0A 3KTQA 4FVMA 1RXWA 3AUOA 3ZCMA 4M3RA 2C2RA 4FLUA 9ICHA 3ZDEA 4CGGA 3SUOA 3SI6A 3HT3A 1J5OA 4NLGA 5J1EA 3V6JA 3NF9A 2ZJ5A 5KT7A 4KHSA 8ICIA 4MF2A 9ICEA 4JUZA 1J54A 2XY7A 1ZQGA 5C25A 1HJRA 4DTJA 3AO2A 7ICQA 1CEZA 2JEGA 1C7YA 3VQ9A 4KHNA 3UXOA 4RNOA 3BQTA 3MDAA 5CA7A 4KREA 2VANA 1RDCA 4CJPA 5KFMA 2IBKA 3SPYA 2AU0A 4BDPA 3ZD8A 4DQPA 4I2QA 4KITB 1JXEA 1X9WA 2PI5A 3NGZA 2C22A 1A77A 1DOQA 3OS0A 2ZTDA 2AQ0A 8ICKA 4BWMA 4EBDA 1X9MA 4QAGA 3PY8A 2RN2A 3C6TA 3IG1A 4Z0UA 3HPGA 3MR2A 1JLEA 2RDIA 4CHQA 2NRZA 5HNKA 2IMWP 4FYDA 3HL8A 4FJLA 4MEXA 2R7YA 1TK8A 2OPPA 4CJSA 4QWEA 2HHXA 1LWFA 3OYBA 3NHGA 1GOCA 1WCNA 4M9HA 4UAZA 4GW6A 2HVHA 2VG6A 4DSJA 5KFZA 1C1BA 1KCFA 4NCGA 3GIMA 4O5CA 4Y1DA 3OSPA 4ECUA 4B9UA 5C42A 2G8UA 2XRIA 4KLEA 4J9KA 4DQSA 1YTUA 1SL2A 4CEBA 4CJ5A 1IXRA 3EZ5A 2X6SA 4YFKA 4HUGA 5DBCA 3CYMA 4DTUA 3DM2A 4B9LA 1IKXA 5CY4A 2FPKA 4UB1A 3PW2A 1N56A 3SV3A 3HXMA 3LP2A 2AQ4A 2BE2A 4W5QA 4RUAA 2QKKA 2UVRA
chains in the Genus database with same CATH superfamily
5DDYA 3ENAA 4YOEA 3DCAA 1K73O 2HFVA 2P2CB 3JB9k 4G1IA 2CPFA 2UUCF 2ILYA 3FCWA 4ZP9A 3KKAA 3MGIA 4K4UA 2G06A 2I9GA 1HQEB 1GK8A 5KFUA 2ZH6A 3PW7A 3MR3A 4CZHA 4PHTX 1X0PA 3IRXA 3AAWB 3ETRA 3WX8A 3T9ZA 4H4MA 3PKYA 1HR0J 1WJ9A 2DNKA 3JAMY 5AT1B 9ICLA 2BOPA 1YJ9N 1ATRA 3GJRB 4UY8T 1WDDA 3VQQA 4R5PB 2NZTA 1R0AA 4KH0B 4CGDA 4CBUA 3W65A 4B9TA 1N5QA 3H25A 4CJTA 4FK0A 3OTBA 2VQEK 1PYTA 2OZMA 5CYMA 4PPDA 1X6IA 4KLDA 2VONA 2CQBA 3QJPA 3R7SB 5J2JA 3CCVN 4C3KA 4HAIA 4C9DA 1VRUA 3CD5A 4P2SA 2W8KA 1RABB 3N79A 4G1QB 4YUDA 4OLAA 1GLAG 1HRHA 4CEZA 4OX9F 1RK8A 2HBLA 3W5YA 3AVNA 4EFHA 4JKBA 4FZLA 5THWA 3TAFA 3OR2B 5F9LA 2R7VA 5KAFU 2GMHA 4CZFA 2BH1A 1QQ7A 4CK1A 3ADAC 2YNGB 3ONQA 3Q8LA 4ZA1A 2KTQA 5EOZA 1S7IA 4FN5A 3AOBA 5KFWA 4WXWA 4GY2B 1DFDA 8ICJA 3CCLS 2J4RA 1YI2N 4PQAA 3HZEA 3PG9A 3G8TA 2XMMA 4IQUA 3CI5A 3UDLA 1W97L 2KV2A 1HJOA 1SUQA 3HHKA 4QZ9A 4ID8A 1NK8A 4ERDA 3C6TB 4A61A 2YQ1A 4NXMF 2Z58B 3TTDA 4MO5A 2JZBB 4Z94A 1K0VA 2QLWA 4G9ZA 1CBKA 2IBOA 3TVYA 2HBYB 5ETRA 4FKXA 1ZAWA 1ZD2P 2MLYA 4K4TA 3VF4A 2EFGA 3HI0A 1RBRA 5AI5A 5HMWA 3A5NC 5DK5A 1XUPO 1PUZA 1N6QA 2IVOA 1IKYB 2YXLA 2F8KA 1BQNA 2QE5A 3UR3C 5IIJA 1KQGB 4AHVA 3UFCX 2CQ2A 1MN9A 2HNYA 3VMFB 2K8CB 1VSJA 2Y0SC 3HW8A 4ISEA 3TO8A 3VQ4A 4LZGA 1GX6A 2E5IA 1B0VA 5GAEU 4DV3F 1XNQJ 3DI6B 4LT6A 4X66F 3GDQA 1KD1O 4JI5K 2J0QD 2Z8QA 3QPIA 4CW7B 3N4QA 2HOIA 1GOBA 3F2CA 3UN5A 2BJEA 1DTTA 4KLOA 2BXJA 5KFXA 3BZCA 2IYIA 1W2BM 3FZLA 5DG8A 3O3LA 5KFEA 2QWNA 1V6HA 4NYOA 3WNHA 3T79A 3U1MA 1K47A 3ISZA 4F72A 2W40A 2MKHA 3UNGC 3QYPA 4RQ2A 1QVFM 3NG8A 4Z2XA 3UPQA 4DOBA 4USTA 3EKUA 1YUWA 4FM2A 4M8LA 2ROEA 4NXNJ 2YNIA 3CERA 2FVSA 2Q31A 2VBYA 2B7BB 4J9MA 4WU3A 2K8BB 4CI6A 3M8QA 3RYLA 3CCES 2DHHA 3OA9A 4N76A 4BC7A 3MFIA 4GVMA 2RKIA 1F60B 2E6MA 1KVIA 4KGKA 3G8QA 3A0IX 3PNIA 4CGFA 3CRXA 2YMMA 5J2FA 2V9WA 1TV6B 3CJSA 5L9XA 5FD1A 1YBTA 4F9OA 4YR0A 3HHLB 4BRKA 2ZE2A 5TKWA 1KC8O 1WBBA 2V5HG 5AQOA 3NE6A 1IKVA 4LFCJ 2DNRA 1P8ZA 3L3FX 4M9JA 3TTFA 3T1YF 4ANDA 2VIXA 3RMAA 3MN6A 2ZBCA 4QJVA 1RTZA 1SPBP 2HMXA 4OJ5A 1F5SA 2U2FA 9ICAA 2EK6A 5K8PA 3KUGA 3CJ5A 1BWFO 3FZ2A 4K7QA 1NM2A 3K89A 1Z3EB 1WSIA 3AU2A 2XYPB 4DO9A 4NLRA 4FW2A 4OX6A 2FLPA 2ILZA 2ZF5O 3KZXA 3GSDA 5AZJA 2YH0A 5M1QA 3HYFA 1RJJA 4BWJA 1GMWD 4RW8A 4YY3F 3LK9A 2Y8WA 4B3SK 3MAQA 1WI6A 5I3PA 1FRIA 3CCUS 4Y34A 4JYAK 2R8KA 4CYUA 2X7IA 4FL9A 5A2QO 1VI7A 3QXGA 1RWKB 3RJMB 4DL6A 4RPXA 4M0AA 4RW7B 4CK3A 1TUUA 1HNZK 3AEVA 2QA4S 2VQFJ 2C3PA 3F41A 2UUCJ 3ZTSA 1N32F 2Y9UA 1C1BB 4WWSA 3OLBA 6FD1A 5D4LA 3JS9A 2PMZD 4DS4A 3WNFA 3GJTB 2CADA 2B6AB 4WP9A 1FKOB 4K4VA 2WAQC 4XQ8A 2UVWA 5CP2A 5EDWA 5AM1A 1CULA 4JI6F 1Q81O 3KMSA 3TPQA 1JNZB 3KG4A 3K4GA 4FXDA 1JQGA 4AXJA 1OPIA 2YNHA 5DDOC 3THVA 2MKCA 4DF8A 2IA6A 1JLBA 1UA1A 2JWKA 3H98A 3SENA 4RW4A 4KLFA 2JFKA 3JYTA 5CJ7A 1EZZB 4CHNA 3KLHB 4UB2A 4WK1A 3W64A 3F9MA 2QKBA 4CF0A 2BCVA 4YCXA 1JLFA 2VB6A 5D3GB 1RBOB 1EQYA 3LM9A 4I2AA 3NY0A 2KQ2A 1N5TA 1EX4A 4OYBA 3G8SA 3C6AA 5HSPA 1KDNA 4PXCA 5HQLA 4NOHA 4ECSA 4CZKA 2WAQD 4B9MA 1KXPA 4BRCA 3VERA 3JSMB 3ZDAA 1FO1A 2JGAA 4DR5J 3O80A 4QZBA 2VGNA 4JAXA 2AGPA 1SV0A 5ETMA 3UR0A 4QWBA 2HVEA 4HACB 2I6WA 2YPYA 2ZH9A 1UETA 3JQJA 4ZVQB 4QIEA 2G8WA 1NGFA 5J1EB 4ELTA 1LW2B 4DKWA 3PX4A 2R7SA 3QAEA 4BQZA 5BR9A 2JC0A 3LAMA 4CVNE 2XHCA 3AVLA 1S1UA 2ZJPL 2VA8A 5HLFB 3KHLA 2IJNA 4MF8A 4CHZA 4PEOA 3BEXA 5AKGA 3KG1A 2KL8A 1XC3A 3UVJA 1WEXA 1YJTA 1VSMA 2FJAB 5J2KA 1CQMA 4DV2K 1OIAA 4H5RA 4DL5A 2HHVA 3H2LA 4WFAL 1FDBA 2ZDPA 4A8FA 1OH5A 4QBUA 2DNMA 1RQNA 1YVUA 2A18A 4BRQA 1Y10A 1BXNA 2IVNA 4JI2F 1WAJA 2PO4A 1NZAA 3C21A 3PMNA 4JHDA 3MMCB 4IH5A 4ED6A 3U1NA 4Y2JA 4X5VA 3TNVA 4A5BA 1X7VA 2KKPA 4KLTA 2Y1JA 3QT6A 2RS8A 1HARA 2R7WA 1SIZA 2RQ4A 2Q97A 3CMAN 5DETA 2CJKA 1WB9A 3TAPA 5IV4A 2AYEA 3C7NA 1FE0A 3BO4A 1FKPA 4OPAA 3AO5A 2BCSA 5IWAJ 4CJ7A 4ED3A 2C2DA 1RT6B 2V4QA 2V8HA 4WQ5C 4EWTA 3BBFA 5GADU 3WKAA 1MMNA 1N62A 2DWQA 1NDCA 1SC4B 4IDKB 1J2NA 2YX8A 2HOFA 1REGX 1FEEA 5JJBA 1HNXK 2D4WA 4K4IA 4O8UA 4I2JA 3VPZA 4M63C 4DCHA 4M9GA 4PH5A 5I3UA 3ZTQA 2XG8A 3A0HU 4ED2A 3T1HF 4FWOA 5IIMA 2DCUB 2KDOA 1DY3A 4Y00A 1L7OA 1NBEB 2C2ZB 4CLYA 3A3PB 1ILYA 4O5FA 2VDHA 4DZDA 2SXLA 3Q8KA 2FD2A 4FWLA 3B9JA 5GVQA 1X9SA 2BOAA 4P74A 4H5NA 2Y9HA 4EYIB 2ZUBA 4AE5A 3FAHA 3D7SB 4DDFA 9ICBA 2YNIB 3A8JA 2RQCA 1RT5A 1N4LA 2OH2A 4Q44A 3RRKA 1NPRA 4F4ZA 4Y2KA 4BGBA 1IBCB 4G6VB 4DX7A 2XWXA 2V8GA 5B7WA 1MA7A 1HI0P 3DYAB 1IM4A 4KFBA 2HYIB 2WBRA 3BSOA 2QWPA 4K8XA 5RUBA 1IBLJ 5CYMB 3T41A 3VESA 2DR6A 5CD4A 1KD1T 1R3NA 1S1WB 3DOLA 5HMLA 3N4PA 1GLBG 1GH8A 2YKMA 3GCXP 4M5KA 1HUZA 4WF9Q 3SK3A 3LGNA 2KD1A 3NBPA 2GWSA 2V7YA 1P9YA 3F53A 2LBOA 3R3LA 2F7TA 4ZIWA 1WWHA 3OL8A 4KMUA 3VF6A 2YKMB 3O3HA 5IWAK 1TFYA 2G1HA 3CF5Q 5KGXA 2ZNYA 3RR7A 2O67A 3KUHA 2HBJA 4CERA 1GXLA 3VCDA 3H0PA 5CYQB 4ZVEA 4KC5A 2MA1A 4QWDA 4M5DB 2HHTA 1DZ5A 1L3KA 2YQ3A 4YOXA 2CQGA 2HBMA 3J81j 3UMGA 4ZVSB 3IR7B 3BYPA 3EXCX 1ZQCA 3AVFA 1XR7A 4C4WA 2HNYB 4D3GA 1GMWA 3MMBA 3Q22A 4DTOA 2GV9A 4DR4J 1FFSB 2GVDB 1NKCA 2OYYA 2NPFA 2KRRA 4N7TA 4FO6A 1AFIA 5LY3A 2CQHA 1M1GA 1RDBA 1SJQA 3SMVA 3GONA 1I94F 1YF5L 3V81B 4JV0A 4YNQA 4OX8A 3OTOJ 3LM2A 3TAEA 3L95X 5LJ5Y 3QIPA 2V50A 4RKUC 4BC2A 4GV6A 2IC3B 4NLYA 4YOYA 3WKDA 3HOSA 4M3TA 1KVBA 5F8MA 3ZSWA 5BYRA 1UQVA 3VC8A 1FVQA 3KJFB 1XU4A 4DI6A 2MQQA 1LW0A 2WZ1A 4LFBK 3MTKA 2OWOA 5D0HA 1YJWS 4YDUA 1VBZA 2ZBQA 5A0YB 5CXTA 5CAAA 4EAHD 3KFUF 2D9PA 1RAJA 3QICA 3F73A 3M6GA 3B8AX 2GMLA 1VQ8N 2ZOFA 4BC5A 4PXEA 5LL6d 4K5SA 3GWCA 2IMOA 2UXCJ 1UTAA 1XNQF 1U1QA 3KWMA 3K17A 3H8WA 1FNOA 4RO0A 3ENOA 5T7BA 3JTOA 1O03A 5HR7A 3M30A 1FA0A 5L1JA 2OEKA 4WQ4C 1WSFA 5KFCA 3BSCA 2KJVA 2VDIA 2UUCK 1KFDA 2WB1D 1S72N 2FHJA 5AE2A 5ETNA 1GLJO 2L9DA 2QB1A 4OX7A 2OFHX 3RJGA 3R1LA 4R8UB 4XTTA 4ELUA 2P9CA 3PACA 1G7CB 1CJVA 1WF0A 1PJ7A 1RHQB 2ADBA 2NRVA 2G9OA 2KN7A 4RQ4A 1CLQA 5BPCA 2B21A 3CCWA 1YX2A 2B8QA 2VGMA 4DEZA 5IFMA 3PRBA 4JKDA 2BABA 4ECTA 1D9DA 2BDPA 3EWAA 3JSMA 1NKEA 3H40A 3PMLA 1X42A 3KLFA 2W43A 2Z7JA 1BQNB 1C0TA 4O4RA 3NS5A 2PXIA 4CLPA 1S0MA 2D9OA 4A57A 4IFYA 1A6LA 1OS5A 1V3SA 2W2QP 3EZUA 3QX7A 2MQLA 4QNLA 3HDSA 5J2DA 3NF8A 4MO4A 1WUAA 2WF7A 1TVAA 1U47A 2ALYB 2OELA 2DGVA 4PWUA 3QNNA 3ENWA 2GW8A 4YB7A 5A6PA 9ICXA 3A3NB 3C6UA 4CO3A 4HTIA 2YNFB 2ASPA 3M8ZA 2KKZA 2BYCA 2ZZMA 1IBMK 4Z6EA 8ICEA 5KFNA 4CDIA 1V9OA 2VCPA 2AWZA 1S77D 4NA3A 5DQGA 4DOAA 3LWLA 1COOA 5HROA 3D6HB 1BY9A 3JTPA 3H8MA 4DHYA 1RAEB 2QMXA 4FNIA 1XMOJ 2DGZA 4EIAA 3Q2SC 1RGVA 3W63A 3BDPA 3TYTA 4B1ZA 1GXTA 7ICFA 2ZC3A 2G07A 3V6DA 1VQ7S 4LFBF 4DR1K 3TFRA 1ZQYA 4OD0A 3BQ2A 1FRJA 4A47A 4LRCA 3HX0A 4U95A 2ROPA 3LP1A 3QNMA 3VEZA 1AROP 4B3OB 4IS7A 4JI8K 1T44A 1QTNB 2HNZB 4NLZA 2QA2A 3HTVA 2YWFA 2CPRA 1KQSR 5AXNA 4C0HA 9ICNA 3GV8B 2WCXA 2AJ2A 1HD0A 5C2CA 4KBOA 1WNSA 4ED8A 1XS9D 3SQ4A 5HQMA 4RG8A 3ZDCA 5E3QA 2ZXHA 4USAA 3CDWA 2ZUAA 1KVKA 5J0XA 4O4GB 2K3KA 3H5SA 5ALKA 5H1SQ 1VQ4S 4FCYA 4KLMA 1QZ6A 2JMGA 1NHUA 3M6KA 1HQUA 3ZX3A 1VSKA 1PBUA 5E79U 3VGVA 1A76A 3IXQA 3OYCA 3BN7A 1WELA 3FC9A 3CFRA 2V51B 3UPFA 1KLMA 1M1HA 4OO1J 2LMIA 1MC8A 2ZWOA 1JLGB 2F9WA 3AVCA 3PM9A 1DKGD 3NEKA 1U7LA 3MHYA 3KXDA 3UIQA 2DNYA 2VWKA 4A2BA 2VJ4A 1SV0C 2CPJA 4IOAQ 4IFEA 2UUBK 3WXIA 4OZ1A 5DS7A 3DGVA 5K9FA 3U1LA 1NGAA 1WHXA 1QUVA 4OZJA 4L8RB 4I6AA 2VUGA 4TVAB 3ILLA 2IYGA 4OZLA 2VBZA 3EVMA 4IDHA 2F9TA 3MTJA 3OJUA 4M45A 3TTCA 3RH5A 3QERA 3ZD9A 2GQCA 2HVZA 1A0OB 1NPKA 2LXUA 4DBQA 3OYEA 5F9NA 3QNOA 4YOTA 4HTUA 5KGWA 3Q83A 1TAMA 4DR7J 2QN6B 3KK1B 3SUQA 3ZNUA 1PAEX 1W7AA 3QSIA 2H1YA 4M5IA 1K44A 4IG0A 1TR0A 3T3FA 2V69A 2G5HB 2H3EB 3PHEA 2ZOMA 2O4IA 3HULA 1UZHA 2DGTA 4P4PA 3L5KA 4CO2A 1TYQA 1Q81T 4C8OA 1EHWA 4ALZA 4GVEA 3MGJA 3QEWA 1V97A 3M7DA 3QUQA 1CS4A 4ZCMA 1FDNA 2HWIA 4UAWA 5DB6A 1U6ZA 4R65A 4PZNA 3THWA 5KFTA 5GTHU 1Q86O 2ASYA 1F9EB 2QM1A 8ICFA 2MRLA 5K8OA 2DXDA 3MURP 1AZSB 1UW4A 1IBKK 3TARA 1HBUA 5KG5A 3O1WA 4YFUA 2PFFB 1Q7YT 2NLXA 5M1NA 2KW4A 3FSYA 3FRZA 1M6YA 2HOEA 4C1NI 4HUFA 3I5BA 3LDSA 1UZDA 4Q7AA 2B4JA 4GO5X 4I2QB 2XWYA 1QD1A 2O8FB 2DFHA 3HSCA 2CJAA 1LOTB 3CPEA 4Y0FA 2GVDA 3H90A 3ATVA 1T3QA 1HBMB 3HBTA 4IJNA 2DNGA 2L3MA 2XTJP 4US8A 1EKEA 3BO2A 1VQPS 3HT0A 2CA9A 4FLVA 3KYLA 2LQ9A 2E2OA 2XBPA 3AY0A 2OPPB 4ECYA 5KOWA 1WOSA 3QJJA 3MBYA 2CQPA 5EHHA 3VEXA 3HD1A 4Q0BA 3L3VA 4HR2A 4I6WA 1UA0A 3TWHA 3CCSS 3EWGA 5GAEP 3NVKA 3FCHA 3RVCA 5ALEA 2RRBA 3OJSA 5ETSA 2I2YA 4B17A 2WF9A 1YIJN 2DUYA 4CECA 4OJOA 1WWUA 2G0CA 1R0CB 4L74A 5IXUA 4ER8A 1VAZA 1F3FA 4DX6A 1FXLA 4I6MB 3WEEB 3KLIB 4KGMA 2BJ7A 1DT9A 4FBUA 4J90A 3QESA 2BDUA 4ZTFA 3AO1A 4JN4A 1HMVA 4X4VA 2N3LA 2J9DA 2FHJD 2YNGA 3LANA 1HNZF 1NGJA 1ZQTA 4DWIA 2LKZA 2MY8A 1SJ3P 1A5WA 2Q2RA 1VR6A 4P0PA 1ZYQA 4F71A 5AQYA 4NRTA 3EE8A 5AXLA 4PCQA 1K73T 4CO4A 1HPZA 1BL3A 5DBBA 2GIRA 3NVYA 3BKUA 2HHQA 2KZMA 2OI2A 2I1RA 1WLJA 1O51A 5KL8B 4AQYF 3HP9A 5D4PA 5EGYA 4QS8A 3J7AP 3NOCA 1M5HA 5HP4A 4C3MA 4WFYA 4NXMJ 3PX6A 4MKYA 2KICA 2HMPA 4GKJJ 1MWQA 2EG1A 3HRDD 2XZDB 1IVZA 4PHAA 3N0VA 1LOUA 5CZXA 4DF4A 2AYBA 4QYZJ 1D0EA 3K8VA 2P9UB 2ZM6K 3PSTA 1URRA 3D1HA 2JH7A 1YJUA 4KT0C 4JI8F 3JSBA 4Z37A 2ZIUB 2BGWA 4W5OA 2WBNA 5AQWA 1QQOA 2R8GA 3W66A 2HVIA 4RBUA 4ZCKA 3HHEA 5CYJA 4HYKA 4JKGA 3I9V9 4TUQA 5ALJA 1U9LA 1N60A 2ZH7A 4IFVA 5J0OA 5AQIA 5M2UA 2WOMB 5HRRA 1TTHB 3UDEA 3AVAA 5AIBA 3RBDA 2RPIA 1S6QB 3RRGA 3BBCA 3J7ZT 1TMJA 5JMNA 2Q1NA 3VR1A 2HIQA 4RUBA 3N7SC 4KN4A 3NS7B 4ETZA 5ADZA 4RTFD 5M1PA 3RF9A 3VEWA 4JV5K 1G15A 3V81A 4TY9A 1BGXT 2ZBIA 5IT4A 1UCVA 3IBFB 1GAOA 5E3PA 4BACA 3HCXA 4H4OB 4WZMA 1X4HA 2RHKA 3G9CA 4FPBA 2FZGB 3N4WA 4DV2J 5SWMA 3B6BA 2WB1F 1GQEA 2OP5A 4AF1A 1ULRA 4J37A 1HNWF 4FWKA 1AFJA 4EZ6A 3CJ4A 2B56A 3NH0A 1YRXA 4FM1A 3VQ8A 4NMLA 3M2UB 1VMBA 1SB6A 3R6GB 4P2MA 4QQBA 2EPIA 3HPHA 2CKWA 1NK6A 5J0RA 3G6EN 1XSLA 3AU6A 3FMBA 4AH9A 4NB4A 1HQUB 4DL4A 2GO7A 3HSZA 2Q4TA 3C14A 3NNHA 3P3DA 3X3UA 4JBCA 2QLTA 1Y5IB 5AR0A 1LWEA 3J7Z5 2E5LF 4KB0A 4BQLA 1H0HB 4LF1A 4H8KA 1SS6A 1TQLA 4BUGA 4UARA 3V7KA 4MDBA 4PUOA 2G8KA 2K60A 2XC9A 2DVIA 3V2UC 4JI3K 1NK0A 4Y65A 1CC7A 3SR6A 4F2SA 8ICPA 4FF1A 3G6YA 5JU5A 3CC4S 4IH7A 4J2EA 4QIGA 3CCQN 2IAJA 1IKYA 5KFDA 3TX8A 4FJ5A 1VDVA 3AAQA 3V6KA 2KKVA 4I1TA 1WOOA 1ZXIA 3ZLJA 1C1CA 4IWVA 2HRYA 4KLJA 2AKWB 1RG6A 4KGXB 1Q3VA 3I96A 4UAVA 2EANA 1NK5A 3OTOK 4BRGA 1B4FA 3N01A 1FWPA 1RBAA 1UWAA 3HWTA 2E8PA 1JLCB 3W3SA 1TAUA 2OTJN 1JJ2M 4O0IA 1ZQIA 1VQMN 1CJUB 2VC0A 1CC8A 3D2FB 2V8PA 1SV4A 5BRDA 2EBEA 3H08A 4B3OA 3KHGA 1M0SA 3UCZP 1SL1A 3O8WA 4L6V3 3C95A 3LVWA 2AIRB 3W7BA 1MA9B 2WVEA 5HK4A 1YKWA 2XO6A 3QINA 2ITMA 1JXBA 4O4GA 4YHHJ 5AI6A 5F8NA 4PG6A 2K1RB 3C16A 2YN4A 1KSPA 2O66A 2FBXA 4LRDA 4JI5F 4X66K 3V6DB 3M6WA 1U2VA 4KBIA 3IGVA 3QUBA 2AA4A 4ZVOB 2DRAA 2VKRA 4KE5A 2FF3B 4JI3F 4BRAA 2IY5B 4ZTJA 1FWKA 1J97A 3GU3A 1BE4A 4Y28C 4B9QA 4WQ4A 4OHXA 4H4KA 2VG7B 5IQ6A 4B1UB 2M9NA 3ISNC 1KBRA 3C15A 5M1KA 3I56S 2F8TA 2AX1A 4CTAB 2MAXA 1IBKJ 1N34K 2I0XA 4ILLA 2GUIA 1ZQQA 5DB8A 3DU6A 2BKNA 4QWCA 4M9LA 4F0MA 2EH9A 4RW8B 1XSPA 3CJKB 1U1OA 3TFSA 1WSVA 5AIAA 1MROB 2O1PA 2XQCA 2BBEA 4O23A 2E5JA 4KX5A 1BD6A 1TK5A 3HX9A 3VENA 5HLFA 2QJ3A 5I9EB 5EWFA 5HRSA 2P9KB 1HWUA 1Y00A 3R5GA 2Q3PA 4OPJA 4Y2XA 1X9JA 3H8SA 3L2RA 4FZYA 2KLAA 1RBLA 4ED5A 2FVPA 4DR5K 4KPCA 3C1ZA 2CRLA 4W98A 3SDEB 1MLAA 3SQGB 4ZCIA 3BPSP 4NWBA 5MLCQ 3OR2A 3CVKA 5FLXO 3FSIA 4DV6F 3LPTA 1F5AA 3R9LA 3WKEA 3HM8A 1RBTA 1UOCA 4M3YA 1VQYA 1SQEA 3MMCA 3EPIA 1N52B 3C28A 1QAXA 1WSRA 1U0SA 2E1MC 2AJFE 1VQNN 2KJ5A 4JNEA 2KZZA 4LF9J 3D2FA 3RRHA 3DDNA 1TKZB 4B02A 2KVIA 4DV1K 3QGPA 3CPWM 4XDCA 1L7PA 1LEOA 3NVZA 4CZLA 1WC3A 5KFFA 2X78A 3HILA 2ZITA 1KRPA 2VKQA 1VQSA 1NU0A 4RQ3A 3ZZRA 1C0FA 4CHPA 2JEJA 2OTLN 2P9EA 3TAQA 1U4BA 1PIEA 1TP7A 1EP4A 3F9KA 2A2CA 2CG8A 4RBTA 1MW7A 3MPDA 3NCPA 3OYDA 2D69A 2H51B 5CZ2A 5B0BA 3SQIA 3OVNA 1KHVA 4O3OA 1ZPWX 3PO4A 4WYWA 2ZFHA 4YMMA 3VGKA 3IWNC 4MHVA 4E2FB 4A8KA 1T3OA 1CS4B 1RXWA 3AUOA 5GAHI 3TW0A 4KH6A 2C2RA 1RHMB 3RZAA 3CCZA 2WFBA 5C2FA 3RW7A 3HT3A 3G86A 1J5OA 3V6JA 4NLUA 2ZJ5A 5KT7A 2ZUGA 2H3IA 4JUZA 2XY7A 1ZQGA 5C25A 5ALIA 2C2MB 1RAAB 3RUBL 1TUVA 1CEZA 2EQYA 2JEGA 2I6XA 1C7YA 4KHNA 3NNAA 3DLEB 5A8KA 1XQSC 1F5BA 2BTFA 4KREA 4X84A 4NJ8A 3SPYA 2AU0A 4BDPA 1VC5A 1C20A 2VV5A 1D1UA 1RT5B 3K5PA 2OSRA 3CJ3A 3ENBA 4CZCA 2ZIXB 2L9NA 2C22A 2O8BB 1A77A 1XQIA 3PEJA 3OS0A 1Z1BA 4XPCA 2WW4A 2AQ0A 4PL8A 4EBDA 3QGIA 1X9MA 5FLXU 4QAGA 2MKJA 2QTDA 2IA0A 2QB0B 3L4QA 2ZH4A 2RN2A 3NXZA 5EE9A 4ILJA 1JLEA 1Q78A 3MM8B 2NRZA 2MPUA 2IMWP 4X62J 3HL8A 1RAIB 2OPRB 4MEXA 4F4AA 1HQ2A 3LA0A 4CJSA 1M5VC 1LWFA 1OH6A 2B4UA 1WCNA 4M9HA 4KGVB 4K2JA 4WTYA 1N8RO 1H3DA 2I7PA 4LF6K 1E3MA 5KFZA 1KCFA 3IG5A 2XLJA 2HK3A 3GIMA 4O5CA 2IIHA 1U1LA 4Y1DA 2R7OA 3WQTA 1AW0A 1RKIA 4OHVA 4ZLPA 4KR0B 1SL2A 4FKYA 4DU8A 4CJ5A 1Z05A 3J7YU 1WC0A 2F8LA 2XI9A 4P0QA 3M2UA 2OEMA 3NAIA 2W4PA 2KHVA 2E7WA 3DGPA 4LF8F 2ZWHA 2BE2A 4P0QB 4EHTA 3Q24A 1U04A 2RQMA 4LJMA 2OJ3A 3VGUA 3ZT4A 2QARB 4PWDA 1SAZA 1LFWA 1QQ6A 3HVTA 3OXFA 3MUVP 2DO0A 1ZQSA 1RBSA 2F1JA 3P45B 4F50A 4M47A 4M95A 4H4MB 2WOMA 3DRPA 4LF4K 4AHUA 3QLHB 5DQHA 2KEYA 4YEAA 3S3OA 3IAS9 4OZ5A 4JKGB 3ET6A 3I5CA 5EU7A 3PHTA 5K4LA 3CJ2A 3N5FA 5A6WA 3S8SA 5I3UB 3MUMP 1VLYA 5LMUK 1SH2A 4FZXC 1GOAA 3FM9A 4KX3A 5A8KB 1H2TZ 1E4FT 3C46A 4CNQA 2A1RA 1Z4NA 1NJZA 4MFAA 3LPEA 3D66A 2CJQA 3LGMA 3I1YA 1YVFA 1JLCA 4E0DA 5B0FA 2MZQA 2EHGA 4Q43A 5KG6A 4OI6A 4DR5F 1FFWB 4KTQA 1L7MA 3DLGA 4EHUA 4JYAF 5L1MA 2UUBF 4DL2A 4OMFG 1VBYA 2YHXA 3G4SS 4ZVTB 1OQ6A 2KIWA 2GHWA 3TADC 1ZQZA 2QSFA 4C8KA 4CJ3A 3CCJS 5J0YA 2IHR1 4B6JA 3VAMA 1PCAA 1UEVA 2MDAA 2E1CA 4JI1K 3ZC4A 3I8DA 4EK2A 5C24B 2Y0SF 1S1VA 3BKFA 3WXMB 5LMUJ 3PXGa 1APSA 1I51B 3OW2R 8ICBA 2K1RA 3C16B 5AICA 3KOAA 4A62A 2R8JA 5ALUA 1QSSA 5AQMA 1E6YA 3V4IA 4DU1A 4C2MA 1Q7LB 1BA0A 2G09A 4CJRA 3NBPB 2WAQF 4UUWA 5KFSA 2ASLA 1T9YA 1WEYA 2XS5A 1BI4A 3PDNA 2I7NA 1VSDA 2KM8C 2LQJA 2HQ3A 2DISA 5SZTA 2WVCA 3M1YA 3MECB 3IG1B 3QRQA 3GSIA 1Z25A 3TEGA 4QCLA 4NM2A 2GTDA 2UXDK 3WQUA 3J7YI 4DV5K 5GMEA 3W61A 3CCMN 1RDRA 3DKDA 1S1XB 3CIZA 4FWQA 1I1GA 1MQ2A 1IQTA 5JUMA 1NAQA 4US9A 3FBBA 3SSQA 3Q86A 1Q4RA 1OH7A 2DH8A 3CCEN 5K8NA 3RH4A 1J27A 2ZQBA 4IRCA 1P90A 2WFAA 4IO9L 1REVB 5L9NA 4BRIA 1HI8A 4IOCL 3DRSA 9ICMA 1HNXF 2VPWB 3LP1B 2CVEA 1G6BA 2A6MA 2J8SA 3ULHA 3VV2B 3PW5A 5IIIA 1RISA 3DHXA 4O3SA 1I6JA 4LF6F 5H1SV 5KPRA 3CJ8A 2RQKA 3TADA 4I68A 2YX4A 3QGGA 3CQYA 3MCNA 1RCHA 1HFEL 2FC9A 1RT1B 4Z4HA 1JLBB 2R7XA 3S1TA 1S0VA 4JD2B 4CZIA 3GPAA 4FLYA 3C1YA 3LF0A 3MF5A 3PIPQ 1S5LU 1VJ5A 4K59A 4IJAA 4U7BA 2KYZA 3H5UA 3I0RA 4P2XA 4KHPJ 2JWNA 2P9GA 3CD7A 5D3GA 3VEOA 3F44A 3CIPA 5T14A 4TN2A 2FDNA 4X66J 2BANA 4OI2A 1HX1A 2C28A 3IMQJ 1FF2A 1H98A 2CQ1A 4I2IA 2XYGB 3TZYA 3V9ZA 4RW9B 2Y3YA 1U6FA 1SCJB 2E9ZA 1ZOLA 3DRRA 4CZJA 2HKEA 4ID1A 2LLZA 4OLOA 1YVNA 4HHUA 4AL6A 1IWAA 4IRDA 3H0LB 1X5OA 4ECZA 2C3OA 3IRWP 3CPWR 4JK8A 1R27B 1RA6A 2R8HA 4FZVA 3CC2N 1X3NA 2FJBB 2A40A 4CGZA 4B9SA 3HJFA 2V63A 1RBVA 3WNGA 3Q8SB 1YAGA 1KFSA 4X4TA 5CA5A 3ZETB 4DUYK 3MR7A 4FZZA 4H0YB 2LYAA 3T5JA 4M5HA 3B82A 2EFOA 4RNFA 5HP1B 2EAMA 2EZYA 1ZA2B 3TA1A 4A8WA 2KNJA 2NCKL 3HKZD 4LVOP 2HSTA 1T05A 4CIOA 5C42B 2XLIA 2RMLA 3HSJA 4DOCA 3VALA 3EN9A 1XNQK 5LMNK 1HLUA 3BF4A 3EL2A 4FZMA 2J7WA 3B6PA 3SMZA 2EWHA 4DU3A 3FKBA 1VLBA 3QFWA 3CO9A 3DWLA 3ZEUA 4QW9A 1X5SA 2IPOB 2P35A 3CEDA 5DG9A 4DTSA 2ZJPQ 2VHGA 4IUFA 3MXJA 1CJUA 1NLKL 3TUZC 2BMBA 1PILA 4TY8A 5F3TA 1ZA1B 2FIUA 4FWMA 1WG5A 6FDRA 3DGPB 5AKXA 3VAKA 4IG0B 3EGNA 2FY1A 1KQQA 4Z4GA 3IDWA 3T6BA 4CH0S 3ID6A 4IG3A 3O6QA 3QBWA 4HHJA 3TUIC 4CJWA 3UWTA 1QQMA 3TOQA 4ZPTR 4DN0A 4HTLA 2ZIWB 2M5YA 2DFFA 1NNDA 2DXFA 5HMZA 3WK4A 3DXMB 1NZPA 3RAXA 3POTB 1S9GB 3JSYA 3FZMA 3ULEA 4RW6A 3MMBB 3AJ1A 2BE7D 3S01A 1YGYA 1LKZA 3AODA 5BOLA 3A8KA 3L7PA 2YH1A 4FWNA 2VBWA 4WCEQ 3Q7BA 2JH1A 2UXCF 2DR5A 5J2QB 4ZLNA 3MEGA 3SFUA 3QFUA 4B3SF 1IXKA 1ZQEA 1WF2A 4KV8B 5AQSA 4GKKK 4YR2A 4CF3A 1V85A 1VQ6S 2DHSA 3DJCA 3W9HA 3PX0A 9RUBA 5A8WA 1FFUA 1U49A 4FJHA 5IWAF 2E9TA 4Z7CA 5KAKA 4R66A 4FF4A 2DNLA 4J9NA 3KUEA 1ZQVA 3VCBA 3TR5A 1H7WA 1Q95G 2HHHF 1FIQA 2W4DA 4CFCA 2W54A 1R43A 2DR8A 4YS2A 3MR6A 3P6YC 5AQUA 3FJ2A 2OYQA 2RSQA 2BJDA 3HKZF 3UVJB 1FFVA 2Q6CA 1N5WA 1O13A 4ZOHC 1SV5A 1PG5B 5IZHA 3SLCA 3H3OB 4E8UA 4QS7A 2FLLA 3F2DA 5KG4A 4DN9A 5EX0A 5AKLA 3RMBA 3OHAA 4N41A 4J9PA 3SMPA 3TEHB 3J7ZO 2BJ1A 3D2NA 2MXYA 4OGEA 3FEYB 4FDFA 2PI4A 5ALPA 5ALZA 3IBCB 2EVZA 2A1JA 1VSLA 1Y3JA 4GC6A 4K4HA 4CO1A 2HFSA 1FX2A 3TSQA 3VN5A 4RT3A 4F5PA 2KFNA 4AM7A 3O2IA 1HKGA 1TELA 1TL5A 1VSEA 2E4LA 1P1LA 2CPXA 3PYFA 2NYIA 1Q3UA 4LFAJ 5KFKA 2XMTA 1JNRB 3SZ2A 3WKBA 3MZIA 2E29A 3MM6B 2WVDA 1HPZB 4HWIA 3K75D 3SIPB 1L8OA 4UW2A 1TL1A 3WBZA 4U8YA 3K1RB 4ZN1A 3LP3A 1F21A 4CRJA 5JVGQ 4DV6K 1N32J 1PSDA 2RQ5A 4ENOA 4USJC 2E5GA 1QM9A 3VQ7A 3PIOL 4ZJLA 3BGRB 2ZJRQ 2PFQA 2MLZA 5B0DA 2WHOA 1N36F 5BR8J 2G2YA 1Y3KA 2V52B 1BWVA 2J9DE 3MCSA 2H3GX 5BYSA 1HYZA 3GOIA 2MJUA 4KO0A 3FQLA 4DU7A 2CIMA 1ZRNA 4F3OA 4KV8A 2MQNA 3HMJG 3IUCA 1KVJA 1U45A 5T41A 1B9DA 1RTIB 3ONNA 3FGVA 2BEFA 2RB7A 3UCGA 3PJXA 4PR6A 1TGOA 4TKTA 3ZX2A 2V4RA 2IDLA 2HLUA 3WXJA 4AILC 4KSEB 4Q45A 3KOOA 3FFIB 5KFLA 1NSAA 3TVZA 2Z1GA 3ET6B 3IRUA 2QV6A 4DPOA 3L3CA 4TSXA 2OD6A 1AUDA 1YJNS 2HAIA 2ISOA 2KG0A 4I6MA 3WEEA 5IM0B 1WEZA 5J2MA 2W01A 1Q82O 3FRYA 7ICLA 5KT6A 4TU8A 2C3UA 1TMMA 4UOCA 3PFOA 2O8DA 1O1WA 4OJ3A 1T3NA 4PKGA 5DB9A 3SEIA 3RB0A 4ZH4A 5ETKA 2ZEJA 4CJEA 2QA4G 1ZM2A 4J9SA 3KKAC 1M90O 2RH3A 9ICGA 5ETQA 1S9EB 3D4JA 1W26A 3DLHA 5F1XA 1BHLA 3WZ0A 2Q6BA 4CLFA 3CETA 3RU0A 1G2EA 2RLTA 4P2HA 3BPDA 4E7LA 4KI4A 1FRMA 4WFXA 3CQXA 2E5HA 1VLOA 4LY7A 4YN4A 5HL7L 4P52A 4H0PA 4X4UA 3R1HA 2N1RA 3NH1A 3FBEA 1MN7A 2G2OA 1RXVA 3BY5A 3U6FA 4OZNA 3ALRA 2NXJA 5ETPA 1WUUA 1FXRA 4JI7J 1E4GT 4PGQA 2K8GA 3B8HA 3BH7B 5AQGA 5CB1A 2ZVSA 2VASA 1A5XA 2EFNA 1S3XA 4BGDA 7ICEA 2ERRA 2CQ0A 4WE1A 5J0WA 4J2DA 1FNXH 5LT5A 4QR2A 3G87A 2XSFA 1Q8BA 3LTOA 2IAJB 1X0FA 3CJTA 3NMUA 4Y2RA 1KBUA 2A6OA 2KB2A 4V19J 5BRFA 2GWJA 3UDCA 1AA1B 3V5RA 5KPTA 3CSKA 2K4IA 1NXIA 3ILIA 1YSJA 2NUHA 4N5SA 4CLZA 1MWZA 3S6EA 1WYGA 3DM2B 3TU5A 3C6UB 4WKRA 3OR1A 5CQGA 2CPEA 3ISDA 4ZCLA 3H4DA 2ZUCA 4L76A 3K58A 1G3OA 5KPZA 5A2QY 2AD9A 3AARA 1K5OA 4CEAA 4NA2A 5GAHP 4ETXA 5ALNA 2B0GA 1FJGF 4YP3A 5I42B 4TNOA 3U27A 3ISND 4UUXA 2MSTA 4M3ZA 4U67Q 3NNCA 2WRMA 3C2PA 2CZ4A 5KTQA 1DRZA 2X3GA 1NMEB 3UM9A 2VG7A 1ZQXA 3J81U 2LSNA 2F77X 3T6JA 4C7QA 1T7PA 3V9SA 4IZ9A 4KHRA 4Y2YA 5LMNJ 2H5EA 2OANA 2QA4N 8ICZA 4CJVA 2E8MA 2HAFA 4MLHA 4G65A 1Y97A 4IQMA 4DL0C 2FPMA 4HUEA 5HBMB 2JLGA 4CM0A 3UE5A 3VTHA 3SEOA 3BREA 4JI4K 1DK2A 4JI2K 4I29A 2GGPA 9ICFA 4JI6J 2FJDB 2W7AA 3SBMA 2J0WA 4FVUA 3OHBA 1UHUA 4Q5VA 4GFJA 4ZJOA 2B0CA 3HPOA 5AI4A 1DQ8A 4BXOA 4RBVA 1JX4A 3VGMA 2F2AB 2HSZA 4QWAA 2RU9A 1HD1A 2Z2ZA 4PHDA 1AXQA 4GXJA 2K89A 3FYHA 4Y2TA 1N5YB 2R7TA 4MKAA 4JS5A 4ED4A 2XSJA 2OZSA 3DNCA 3HSDA 3OUYA 2XICA 5AM4A 3SUNA 3H2VE 3PIOQ 3EGVA 3V1RA 1KLNA 4DZ6A 2B4PA 3CCTA 3KBBA 1SKWA 1QQ5A 3GIJA 1X2IA 4LR9A 5KFJA 2KIVA 1B3TA 4K4XA 2ZKUA 4AQYK 2LEBA 1FFGB 2YX7A 3K5LA 4KKOB 2BCUA 3L6QA 1PVRA 4PG5A 4HLBA 2PYLA 2ETJA 1HNWJ 3PSIA 3VOVA 1WBDA 3JXOA 3QIDA 4DV1J 3FC4A 2ZD1B 5ALFA 2XEXA 1GLFO 2FVCA 3ZTPA 1N33J 3EE3A 3H20A 4P9SA 4UBCA 3GCWP 3Q8VA 2KFZA 2BGGA 3JPTA 5FDLA 4M04A 5J2EA 2L08A 4OZ2A 5KFGA 1SXDA 3O0FA 3KJVB 3IO1A 1H74A 3N28A 3JXUA 4P71A 2P6RA 4FPAA 3KHRA 3UQ2A 1F2HA 2HGMA 3BQ0A 2E6LA 2FBTA 3UXPA 1YBAA 1OSDA 5ADXH 1EJ7L 2WONB 2OCEA 2MYFA 4C48A 2KVSA 1RT6A 1NGHA 3P31A 3UE2A 4C0OC 4DR2F 2NYHA 2DFLA 1CJTA 3EDRB 3OT9A 4ZIVA 4QZIA 5KFIA 2D0BA 2CXEA 4R5PA 4M41A 3NVVA 2R4FA 3TSPA 2FPHX 3MM9B 1SJRA 4NLXA 2B4VA 4ZVGA 4WZQA 4DUYJ 5IC6B 2YVSA 4BR2A 3JQMA 3U26A 2A1BA 5JVGL 3U02A 3J80O 2GGPB 1DTQB 3GE1A 4DL7A 4DLEA 2DH7A 1PK3A 4MYTA 5D0EA 4LD0A 1RTIA 3WK5A 2KO1A 3MPYA 4FWRA 3SCLE 1H6KX 2IM0A 1KFTA 3F2BA 1IKWA 3X1LB 1NMNA 2MY7A 3ICXA 3ULEB 1C2PA 2DXEA 2DGSA 2M52A 2KVQE 1V3RA 1VSHA 3HHDA 3ID8A 4CWBA 3K57A 4L3QA 4UOFA 2MZRA 3UKUB 5BRHA 2FPLA 1XWLA 5AJ3K 4HCBA 5DDRC 3DMJA 1S1WA 2XMUA 7ICTA 2J5AA 1FWLA 4CCHA 4CDGA 1Z26A 1RTHB 3VQEA 2DY4A 4NEYA 5KFHA 2RAQA 4OL8A 3E01B 1XSNA 5CH7B 3WK9A 2BUPA 3CCLN 4QIFA 1WKLA 1K8AO 3PIPL 2W03A 4NLVA 1NU4A 1Q82T 1MQ3A 4I2DA 5AQRA 5FPNA 3SSSA 1HIWA 1TKZA 1GX5A 2F4VJ 3AD8C 2PIIA 3HHLD 1LNQA 3MM8A 2V9KA 2V2KA 5J1PA 1TL4A 2YY3A 4XK8C 2VIHA 2DIVA 1ASUA 1UJ4A 2RE1A 3HVTB 1CRXA 2A0FB 2B51A 1F9FA 2B3TB 3C7NB 4AL7A 3S9HA 3H42A 1F9HA 3DDIA 3M3ZA 2MKYA 4M5NA 4JOUA 2KRBA 4J8FA 3PTWA 1KVAA 3QAUA 1ZBHA 4ZP6A 2W42A 2UUWA 1RUSA 2GVZB 4HVJA 7ICVA 1D3WA 4URGA 1OYEA 2Q0ZX 2V34A 1NOYA 2DPNA 2JNJA 3I32A 2KHDA 2FVQA 3W62A 3IM9A 4K0KF 2FUG9 4O5BA 5J0PA 2OPSA 1MWMA 2HMIA 3TRGA 3MPUB 4MK7A 4WE1B 2FF6A 1NGBA 1DQ9A 3CWJA 1VJQA 1FTRA 4R25A 3NCQA 4ACOA 1TE2A 3E66A 2HMIB 5GTIU 2LYVA 4DFPA 1VRTA 1D9AA 3KK2A 1TL1B 4B3RF 2GCFA 3AO4A 3ED5A 3IP4B 1M5PC 3NL0A 1S6UA 3M5RA 2KHCA 4ZJQA 1JMSA 3KD3A 3RB3A 2F65A 3VTIA 1ZD3A 4LVSA 3MAHA 5C25B 4QZVB 1FJEB 3EEQA 4JI7K 3PCOB 3PO5A 2LMRA 4DTXA 2WVBA 3C2MA 1LW0B 3EGZA 3I55S 5L38A 2B7CB 3RAQA 1HHSA 4W4MA 3I82A 1S72S 3VEYA 2FJXA 4ILMA 1ZQRA 3KD1E 2KT2A 5FRNA 3UD5A 4PPXA 8ICCA 1HNIA 3HHLA 1Y11A 2ADCA 1GEHA 4DR2K 4DR6K 1RT2A 2J0XA 1EIYB 3NGIA 3CHWA 4R63A 1T9WA 4KH5A 5IQQA 5FP0A 3W9JA 2QXFA 4Y2IA 1TK0A 5IT9U 5TZVA 1U1RA 5M1FA 4K4YA 3AVIA 1SGGA 5CEHA 2MUTA 5ALDA 1TV6A 1S9EA 3AFGA 3CDAA 2CQCA 3OL7A 5KI6A 3U3YA 4FWSA 2QEXS 5LSOA 3ZZYA 2EC0A 1UMJA 2QFJA 3DXKB 4QZEA 1YQHA 2Q0RA 4ISGA 2CWKA 1F0MA 1UVKA 3FBCA 2RRAA 3EM1A 4ITSA 3DOMB 3K5NA 1Q8LA 4GMJB 5D4BA 4LR8A 4CBWA 3FVYA 4PHEA 2ITGA 3BB5A 5CYQA 3WK8A 1NGCA 3CD6N 3ISBA 1NGGA 1RGIA 4URSA 3OFFA 3ILJA 4CJFA 3O1BA 3TABA 3EVWA 1FVSA 5HR6A 1U2FA 3D2EA 2ZH1A 2QL9B 1V38A 4LSZB 1C1AA 2KXHA 3JS6A 4YOUA 2NYVA 2BR0A 2NO4A 1N5YA 3P8BB 3CCSN 4F0KA 3DI6A 1WOQA 6AT1B 3UB5A 5HOOA 3M8YA 4BC4A 2VBXA 2W9BB 3KK1A 1QHAA 2F9JA 4OYPA 3OS1A 5KFRA 3RTVA 1J53A 4RW7A 4PL1A 1UKUA 2DGQA 5E26A 5J2BA 1RTJB 1HBOB 4IFYB 3GE9A 2F44A 2YKPA 1QZ5A 2NO5A 1S99A 1ZTWA 3UKRB 1JIHA 2MU2A 3IAM9 2I5JA 4A8SA 2XS7A 4K8ZA 2HNDB 2KFYA 4QIVA 1T02A 4NYFA 3V9XA 3J7YP 2BANB 3OW2M 3QEPA 1LKYB 3BZQA 3IGNA 3OBIA 4BRNA 5C5JA 4KY3A 2HB5A 1CJTB 3K9KA 3UI3A 1S10A 1UT5A 1N33K 1CUKA 1NEEA 2NS1B 3VQ6A 4OKEA 3SAFA 1IV8A 2C2OB 1IV0A 1RT3A 5LSRA 2IRUA 1QUPA 2RJZA 4OZ0A 4FYWB 5E0OA 3M30B 1FRKA 3ZDBA 1Q53A 3QB0A 1YT3A 3E9PA 1B0XA 5IINA 4QOTA 2M3DA 2UU9J 1RTDB 3OL6A 2MQPA 5L8RC 2XMWA 1HWKA 4EZ9A 2BQUA 4HTJA 2UUBJ 1S5JA 3SV4A 2LQ5A 4KJIA 1FD8A 1JLGA 2E7VA 4TXSA 4DSKA 1NWKA 5B66U 1VQOS 2ZH3A 2X1FA 4CF4A 5CR4A 4A8XA 1M1KT 4PXBA 4W5NA 4B3MJ 4P2FA 4DUZK 4C8YA 5AM3A 1ZM9A 4IQWA 4OV1A 2LDIA 2GV1A 1JXLA 3P49B 1XHXA 4K4GA 4PL2A 1RCOB 4I4BA 3H45C 3TZXA 1S8OA 2ES6A 3IBWA 1RAGB 1HW8A 2KVCA 3AA4A 4E7KA 4DR3K 4XPEA 4LH4A 2ASJA 8ICYA 2P5VA 2LDYA 3V9UA 1X4GA 4DHVA 1KQKA 3EE9A 2K2PA 2ASDA 2ROGA 1WG1A 3LQVA 5J1NA 5G0RA 3UMBA 1Z2ZA 1OH8A 5G4DA 1RT4B 1NG9A 1RYRA 2KSOA 3VAIA 3QYYA 1PC4A 1W25A 2MHNA 2QB0A 3LDNA 1YJRA 1LQ9A 3NVWA 2ASMA 3HZ6A 3QATA 2N7CA 1CJKB 2HFNA 2ZJQQ 3CCQS 3O08A 4HHHA 4WPAA 1LWFB 2V2ZA 2F63A 4YHHK 3VF2A 1T4GA 4UW9A 3CW2C 7ICPA 4OYMA 1TYQB 3L9ZA 3WIUA 3U4LA 2F4FA 4EO6A 4NYZA 2F8MA 2KYXA 2P9NB 3CMAS 4CLWA 2R42A 3GG0A 4UZBA 3N97B 1SVDA 3HD2A 2PMHA 4BC3A 4G3IA 2EFQA 4JI2J 4KRFA 4ZS6A 1VQ4N 2GUPA 1N48A 2JZBA 1GTHA 3SI8A 2LYBA 3HKWA 3SCIE 4ES1A 1V9PA 3KLHA 1YK9A 2ACMA 1ZQNA 2VICA 1PJ5A 5DBAA 2QI2A 1PVPA 3DLKB 2GIFA 1NPPA 3W2WA 3ZX0A 8ICAA 4IOXA 1I3AA 4F93B 2VPXB 1T11A 2AX0A 2ZOGA 1U09A 2OPSB 4KAIA 1KLMB 4XH4A 4BY9C 5AKKA 4X62F 2ZWPA 3A2FA 8ICWA 4IG3B 4FS2A 1FHTA 2R2UA 3MX5A 2FMPA 1FJGK 3MMVA 3QBXA 1SH0A 4Y2QA 2UUAK 3OYNA 4AP9A 3JQKA 5A76A 4JI3J 4DV0F 5K5MA 5LSLA 4USHA 4URQU 2E8AA 1XJWB 4LREA 5JRTA 1RAFB 2HG4A 3B54A 3D2SA 4DR3J 5F41A 1VK3A 3LDQA 3RMCA 5M2RA 3DYAA 3A1YG 4F0HA 3EO3A 2XSJB 1WN7A 1JLQA 1CG2A 2CJXB 5AM2A 3M8PA 1U1MA 3O5BA 4FSVA 3THYB 1ZJNA 2EDUA 4KGZB 5HMYA 3GILA 1HYSA 1Z00A 3IR6B 4C7YA 2UXBF 4W92B 4I7FB 3W3DA 1ZBSA 4DXLA 1NK7A 1WCLA 2W7OA 2IRXA 1RTHA 1UEKA 2JLFA 2O8CB 1F0XA 3CJ0A 3VQPA 1DJ0A 1Q46A 5F8GA 3NGUA 1UCNA 3G6ES 2ZJRL 4NL5A 2MUTB 4CJKA 3P38A 1FESA 4F4YA 4JI4F 1QSLA 4ECWA 4DSFA 2ZTEA 2X1GA 3R5BA 4DR1F 3LOUA 2A3VA 4D3HA 2D74B 4FLZA 1JMTA 3RJFA 1Y9OA 1JALA 2CUYA 2PFOA 3HFZB 2FQQB 4OI0A 4C11A 4WKYA 2QWQA 5BR8F 2W3RA 3MABA 3J8AA 2CDRB 4BR4A 5ETTA 4UAYA 2ZJ8A 2BVZA 1IBMF 3GFYA 4J9LA 3KZIU 2W9CA 2YKQA 1NRKA 2A3ZA 1OUQA 5HMXA 5JTIA 4MIBA 4NXZA 2DTUA 4WTOB 4DV5J 4TYBA 1GMVA 2HVDA 2RHSB 2JFDA 4RNMA 4ZVPB 2UV8G 3MEGB 2YHBA 4YB5A 2J0SD 2C3MA 4FLWA 3THXB 2FBVA 1YI2S 5JLHA 1UAXA 1S9GA 2AJ1A 5KG1A 1WKJA 1JLAA 4NPOA 5LMUF 1SZ2A 4X65J 1C0UA 3R7NB 1VHXA 3E58A 4LFAK 3KLEB 1NSKL 3JPQA 5ELZA 1KL9A 1SI9A 3THXA 4UBBA 3MEEA 3KTQA 1UEUA 3RG6A 3ZCMA 4M3RA 2IRYA 4FLUA 1RLCL 3ZDEA 4CGGA 2UYTA 4MK9A 1CLFA 4I69A 2XHWA 3AQEA 3HLUA 3IA0A 8ICIA 5ITHA 1XMQK 4MF2A 9ICEA 1WF1A 1J54A 1MWKA 4H54A 5K8MA 3E8OA 2C42A 2KT3A 3DU5A 2H4YB 1VRUB 1COKA 3IR5B 4YOWA 1VISA 2D0OA 1Q5YA 3MDAA 2AZ3A 1RDCA 4IOCQ 4KQZA 4NYPA 3KLVA 4FPIA 3G82A 4DQPA 4KITB 5TKYA 1JJHA 3L7OA 2XMJA 2N4DA 3AL0B 2GMJA 4DR7F 8ICKA 8AT1B 2JOQA 2DGOA 1H2VZ 4JV5J 5JVHL 2RDDA 3PY8A 1DGKN 2KXFA 2UUAF 2E2NA 2DNZA 2BJ9A 4Y2VA 2RDIA 3O9QA 3GFHA 1Q18A 5HNKA 4FYDA 4FJLA 5AQLA 4QWEA 2BUNA 2LM4A 2HHXA 1HNIB 2VPYB 3I8BA 2A41A 1VS3A 1JJ2R 3OYBA 5CZVA 3B78A 5ETOA 3VVUA 2HVHA 2VG6A 2MSNA 3D7EO 3CJKA 2VWBA 4CLLA 1ZM3A 2HHHK 3DXBA 4NCGA 2VQEF 2IM2A 3OSPA 4YDUC 2QFIA 1P9QC 5AZJB 2M8DB 2XRIA 1IJEB 2AZ1A 3AXMA 4GVLA 2GA7A 1IXRA 2KI2A 4Y2CA 3R8EA 3G71N 1VQ9S 3EZ5A 2X6SA 4YFKA 3VEVA 2VL1A 2HHHJ 4DTUA 2DCLA 4B9LA 1XNRF 3OBYA 1IUJA 2VOPA 3PW2A 2EKNA 3CC7N 1HL6A 1N56A 2A5XA 4RUAA 2UVRA 1RQ0A 2KN4A 2QW9A 1NLVA 4HVZA 1WG8A 4TUPA 3H59A 3TAMA 1SZPA 4Z6FA 1GLEG 3UKRA 5G0RB 3RJKA 2GJ2A 4KH1B 5AKJA 4LF9F 4JS4A 4F5NA 3IFRA 3NP5A 3M1VA 4CF1A 3BGRA 5FPMA 4XIUA 1R89A 4E1NA 1YTAA 2YWHA 3LALA 3I31A 3H3NO 3I0SB 2J9EA 3DRSB 1QE1A 4F4WA 2LP4A 2HZVA 4TY8B 3NVMA 5I42A 1ZQ1C 3TZZA 5AK5A 2Z2MA 2VJUA 7ICRA 1WC5A 4DTNA 5LJWA 4W5TA 2RKIB 5D4OA 5IILA 2OAUA 2FBYA 3MXIA 1XMOF 4PGYA 4YB1P 2H3VA 3OYKA 4HDGA 3NGTA 4P7VA 5HVHA 3O44A 3FZBA 3FQKA 1YDLA 3TZWA 2YNHB 1CXUA 2JXJA 4PY5A 5KQDA 5JLFA 2ZE2B 4MFBA 2UV8A 4HCCA 4ZPCA 1N63A 2MZTA 3OTEA 3G2XA 4TURA 4ICAA 5B0GA 4RUCA 4CF9A 2F1FA 5HJYA 1VQLS 2NXUA 3FEZA 4I2HA 1NMDA 4OLBA 4M6WB 1X4CA 4BRDA 3R8YA 1ASVA 3W60A 4AXIA 2KJWA 2NPIA 4BXOB 4NM1A 4WFAQ 3EZWA 5IT0A 1HPMA 2BA9A 2CXYA 2BW2A 4H5WA 2G2ZA 3RBXA 1XK8A 2ZH5A 5DG7A 4DSIA 5G5GA 3VA0A 2PFPA 3DEEA 1OY6A 2MLXA 5HP1A 4IQXA 1KDHA 4DL3A 2A19A 4A8MP 2GBZA 2ZHOA 3AVMA 3IS9A 1OMSA 1TUGB 4Y2AA 3BSNA 3D2QA 1U1KA 3NTUA 3SQOP 1LAVA 1ZQKA 3MMAA 3N9UC 4DV3K 4NASA 2G0JA 5E41A 3MGHA 2XMVA 1C1CB 1I94K 3I5AA 2X1BA 2VWJA 1X60A 3MGVA 4W90B 4FM0A 1VQ9N 1CZAN 2AEFA 3O1LA 2VFSA 9ICWA 2B6AA 4B9NA 1VQPN 1HBOA 3O8MA 1XTZA 4ELVA 8ICSA 2CPDA 3BBBA 3KG0A 1RHRB 5AI8A 4NRUA 2Z2YB 3G6VA 4LF2A 1RFQA 1TU0B 5B8HA 4OKKA 2CQ4A 1V5VA 5CZ1A 2C2EA 4CEDA 2NXNA 3KVGA 3GG1A 4C4SA 2YB1A 3G10A 4K50A 4CF2A 1RZTA 2Z56B 3ZI4A 5AQZA 4LFCK 4I2CA 3LWMA 4LSLA 2MKIA 4TQSA 3T69A 3AOCA 1VSFA 5JVHQ 3OY9A 1ZQUA 3I87A 3KJVA 2NXCA 2NUBA 3EKSA 4JWMA 5MLCV 3OBWA 2MGZA 7ICGA 4X2BA 1URJA 3NCIA 3HVRA 3DDHA 7ICNA 3UN2A 3H5XA 2D0CA 4LF5F 5E33A 2LEAA 3RJJA 5D6GA 1EP4B 4IQTA 1EX8A 5EY4A 5D49A 1HBUB 3O9UA 2IVYA 4OI1A 3ZSRA 2DY9A 1DGJA 1BISA 1LWXA 1NJWA 2NZ4A 4A8OA 2VQFK 2AMCB 4I9QA 4B3TK 4FJXA 2DR7A 3OYMA 1H1VA 4J9UE 2W4CA 2P5GA 3QEAZ 1D9FA 1XEZA 3OTOF 7FD1A 3IBPA 4DJBA 1YRUA 4OX9K 3GV5B 4H4KC 2YKNA 3QNWB 1YHQN 5BYQA 2FSNA 4TU7A 5EWGA 3QIPB 1EARA 3VF0B 3BF3A 3ZZ0A 4CEQA 5JICA 1PKUA 1VCTA 4OYXA 4F67A 1VFJA 3OV7A 3G0ZA 4XO0A 2AXTU 2OMLA 4IO1A 1UVNA 4CGIA 3IAYA 4LF7F 2JEFA 3LZIA 1IKWB 3PNCA 3BDEA 3BR8A 4FJJA 1NBWA 1LAWA 1PC5A 9ICIA 5B0CA