1NJWA

Guanine-thymine mismatch at the polymerase active site
Total Genus 211
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
211
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords DNA PRIMER STRAND
publication title Structures of mismatch replication errors observed in a DNA polymerase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
total genus 211
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2003-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1njwA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1njwA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1njwA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1njwA01
2PY5A 5BOMA 3RJFA 3NGYA 1G15A 4DSKA 3PR4A 2W9CA 1KLNA 4RPXA 1HJPA 2B6AA 3RMCA 3U3GA 4F3TA 2F96A 4DWIA 1RT7A 4FLTA 4CEBA 4EP5A 1HQUA 9ICEA 3ZDAA 4IRKA 2BGWA 8ICEA 3GILA 1NK8A 5KGWA 4GXIA 8ICZA 3G6VA 4DTRA 5KFHA 4CK2A 4KI4A 2ALZA 1BPXA 2ZE2A 3P5JA 4I28A 4ECUA 2JEIA 3PR5B 3Q8RB 1H38A 4O44A 1HYZA 3RBEA 1IG9A 2C2DA 4FZYA 1KEJA 4DL2A 1S77D 3IRXA 1TK0A 2KZMA 4YQWA 1JL2A 4RQ1A 4EYIB 3TR8A 4E0DA 4W5NA 4TQSA 2BCUA 5KT6A 1RT5A 8ICYA 5DQGA 3VQ6A 1ZQLA 2FMQA 1S5JA 7ICTA 1NOYA 3KKSA 4I2FA 1KVBA 3BQ1A 3OYGA 3RMAA 4XRHA 5KFNA 4DFMA 4FM0A 3SQ1A 4KB0A 4OPJA 5J29A 4ZH4A 2GV9A 4CGFA 2F1HA 4J9SA 5KGXA 4Q5VA 1YVUA 3TI0A 2C22A 5HROA 5KFLA 3MFIA 5IIOA 3AV9A 8ICIA 1JKHA 4CK3A 3K5MA 5KT5A 1JLCA 4JRPA 4O3OA 2IC3A 4DOCA 4ICLA 4RQ6A 4O3SA 1RTDA 3HP6A 3RB0A 4RNOA 4E7JA 4EBCA 4CESA 4O3RA 2FLNA 4OKEA 2DFFA 4F4YA 5J2PA 2YNGA 4MFFA 3MDCA 2YKMA 3DLBA 3C2KA 4TUQA 3IHQB 4FYDA 4FVMA 4J9PA 4J2BA 5T7BA 9ICGA 2KQ2A 2Y1JA 5DG9A 1Q8IA 5HP4A 3I0RA 1ZQOA 4RQ0A 4LSLA 3B6OA 4NLZA 3GFKB 3ALYA 9ICKA 2BDPA 4CJLA 4EEYA 4IG0A 1BQMA 4MEYA 5IIIA 5BOLA 3HJFA 1VSHA 2EX3A 1FKPA 3LAKA 1VSFA 3C95A 5CR0A 4F93B 4I2DA 1XSPA 4CE9A 1XSNA 2VG6A 1NK5A 5DGAA 2GUIA 2ATQA 5FDLA 2KFZA 3WNHA 4PGQA 4KPYA 1JLBA 4P4OA 4QZIA 4Z4HA 8ICMA 1VSLA 5J2QA 1ZBIA 3C5GA 5L1LA 4I2AA 4HUGA 3MEEA 3T5LA 2FMPA 4F91B 3K58A 1D9DA 3RJJA 3ZSXA 4CIFA 4H4MA 2FLPA 3KK3A 2P6RA 4F4KA 1WSIA 2W42A 2FPLA 3M8PA 3QEVA 4ED2A 3HPHA 4AHUA 2YV0X 3TFSA 1TV9A 4KHWA 4J9RA 4J9NA 4OJRA 8ICXA 2ZJAA 4MF8A 5J2CA 1FXXA 4F50A 4DL7A 4KITB 2I1QA 5DBAA 9ICCA 9ICIA 3ISNC 1SKRA 1BQNA 1BHLA 4OPKA 1XO1A 5CJ7A 4KLOA 2XCPA 4YR3A 4IFYA 3PO5A 3MR6A 4M9LA 3AU6A 2R8GA 1KVCA 5DQIA 4LZGA 1S0VA 4DL3A 4PPXA 1ZQWA 3ULDA 3DLKA 4R8UB 4RW4A 3LK9A 5J0YA 3SPYA 2OZMA 4IQUA 2KN7A 4OKJA 2RF2A 2ZUBA 3MFHA 4HCBA 3PVXA 4JWNA 3WNEA 3HWTA 2FLLA 4DFPA 2NRVA 4IR9A 3S3OA 5DK5A 2C2EA 4DU4A 3UXOA 3UQ2A 1AROP 4M9JA 1WAFA 3CFRA 3AVMA 5HMLA 4ID1A 2IGIA 4O5KA 3K4GA 1LAWA 4ID5A 3T3FA 2IAJA 3NGIA 3TAGA 1Z00B 2LYHA 1HUZA 3VQ5A 5C5JA 3LP2A 4ECZA 4CEFA 1BISA 1VSEA 4M3UA 3VQCA 4QZFA 3ZT1A 3U3YA 5HBMA 4GLXA 5KFTA 3PV8A 3OYMA 2A1JB 3S3MA 2F1IA 2KW4A 3ITHA 3O4QA 3AO2A 3EWAA 9ICWA 4XUSA 4R65A 2ITGA 2C2RA 4I2JA 3ZD8A 3AA2A 3QEIA 2W9MA 1KFSA 4ED0A 4HUEA 4ECSA 3QO9A 2BPFA 4JS4A 2Z1HA 4RG8A 1GOBA 2D0AA 4RQ2A 4DU1A 5HRRA 2OA8A 2FBVA 3ZSQA 3PW0A 1GOAA 4IKFA 1Q9YA 2D0CA 5SZTA 4KHSA 7ICPA 4RUCA 4WE1A 2Z1IA 1W0HA 8ICJA 4DEZA 3GDXA 3T5KA 2V4RA 3V72A 4FK0A 8ICNA 5J2EA 3O3FA 3C21A 9ICAA 3RJHA 3NHGA 3CFOA 3L2WA 4DQSA 4CHZA 4QZDA 3RH4A 1PZNA 4DS5A 4I2EA 1RCHA 3TFRA 4PHPA 1ZQJA 1KLMA 3SUPA 4KLFA 2DPJA 4QCLA 1ZQIA 3L2VA 1RTJA 4CFAA 4MFAA 4B9VA 5KFGA 5D4BA 2P6UA 3VQBA 4BXOA 3EPIA 5KFJA 3QEWA 1QSYA 5DLFA 4P4PA 3RB6A 2X78A 3GV7B 4HHTA 4AH9A 4CF0A 7ICQA 3C23A 2GWSA 2OPPA 3RJGA 5J0XA 4F2RA 4FJGA 4F5NA 3G6XA 5L1KA 3JSMA 3TQ1A 1SL2A 3VQ8A 2BQUA 5TZVA 3PX0A 2UVVA 4AHTA 4IBNA 2PI5A 2KZ3A 3SUOA 3GIJA 3TWHA 1QSLA 1RT1A 1ZQXA 4UB2A 1SUQA 1ZYQA 2MUTA 2GBZA 5J0WA 4DSFA 4CGGA 4RT3A 1QLNA 4CGJA 2HHTA 1JXBA 1RYSA 4RQ8A 3T5HA 1WAJA 4CK1A 4UQGA 3QIOA 1WSJA 1BGXT 3HX0A 5KFBA 3SYZA 4GXKA 4NM1A 3BQ2A 4CF9A 1ASWA 1ZQCA 3EPGA 4F4ZA 2ATLA 1Y97A 5HP1A 4QZHA 4RQ7A 3K57A 9ICTA 3ZDDA 4QWDA 3TAPA 3CM6A 3OY9A 4JLHA 5J0OA 4TUPA 2XCAA 1XC9A 4KTZA 3NAEA 3OSNA 3U6FA 4O55A 1QSSA 1BI4B 3VQQA 1T4GA 2QKKA 2F1JA 1S6QA 4LH4A 1X9WA 4R63A 3M8RA 7ICLA 3AVBA 3V6DA 3NF6A 2BPCA 4CCHA 2HNYA 1MC8A 5KG1A 1T03A 2KTQA 1RBVA 4JWMA 3IAYA 1NK0A 4CHPA 1IH7A 3TAFA 4KLMA 4CJUA 4N5SA 2P1JA 1QTMA 3HSTB 4O5BA 4YN4A 2P51A 2WOMA 1IKWA 3QZ8A 3G6YA 1WN7A 4QW8A 1U45A 2X74A 1FKOA 4J2AA 4B9UA 2JEGA 4Z6DA 1C0MA 4YMMA 3E01A 4PHDA 4RUAA 3OGUA 4J9MA 5HHHA 1ZQNA 2JEJA 8ICUA 4FBTA 3PMNA 2PXIA 1Z26A 4G1QA 3UXPA 4YR0A 4YD2A 1N48A 4OLAA 4FJ7A 3V7LA 3GV5B 5CYQA 3EY1A 3AVAA 4N76A 2PFOA 4M04A 1B43A 2NRZA 4UB5A 4Z4EA 5JS1A 1KCFA 5DBBA 2H5XA 1A5WA 3AO1A 3SV3A 4R5PA 1HRHA 3HP9A 4O0JA 4KLQA 2EHGA 1QE1A 3HVTA 4M3TA 1T3NA 4DTJA 3NFAA 2Q0ZX 3TABA 1N5YA 3OSPA 3DOKA 5J2KA 3OS1A 4IQTA 4O0IA 4CJQA 1RBSA 1C1BA 3SV4A 5D49A 1ZQAA 3V81A 1EX4A 3JPQA 4M6WB 3DMJA 3QIPA 3LAMA 3NH0A 5J2AA 1NJXA 3P83D 4KLUA 2Q3SA 3L2RA 4PQUA 1LW0A 4AHCA 5J2MA 5J2GA 1W9HA 3V6JA 2C28A 1TL1A 3VQDA 5KFWA 4F5PA 4ED1A 9ICLA 1VSMA 3PX6A 1B9DA 3BQ0A 3G10A 2I5JA 4AHSA 2G8WA 2FPMA 1KTQA 5CA7A 3M8SA 4CJSA 4RW8A 1HJRA 2DFEA 2VG5A 1S1XA 3LP3A 4KTQA 4P2HA 2HMIA 8ICFA 3L2UA 4Y1CA 2HHSA 2OZSA 4KLJA 1ZQKA 2J6TA 2IS3A 1ZQEA 5CZ1A 1X9MA 3KHLA 2VA2A 2G8FA 4XA5A 8ICVA 1D9FA 1RDDA 4BE1A 7ICGA 3EZ5A 1D8LA 3QE9Y 3HXMA 5DKWA 4YMOA 4CJFA 4Q8FA 5KG2A 1S0OA 5BPCA 3K5LA 1DOQA 4RZRA 3JPRA 5KFSA 5CP2A 1XHXA 3OYLA 1YTAA 4GMJB 4N56A 1U4BA 1TKTA 3C1YA 3NGDA 4G3IA 4GW6A 5DB6A 4J2EA 2VG7A 3V4IA 4CHYA 4EYHB 2E6LA 4B9NA 5J0PA 3RWUA 5EOZA 3PUFA 3NF7A 2Y1IA 3KIOA 3KK2A 1MSWD 1XWLA 1SL0A 3M9MB 5J2FA 4EBEA 2AGOA 4Q0BA 1LW2A 2JZBB 3ZT4A 2X6NA 3RMBA 3GIMA 4PA1A 5JUMA 1S0NA 1T05A 3QNNA 1BCMA 1S10A 2UVRA 1VK0A 2Z1JA 3M9NB 7ICOA 2P5GA 3RR8A 2AQ4A 1J54A 5D46A 1SL1A 4NXZA 3LZJA 3HK2A 1DLOA 2XRIA 2XGQA 3BQTA 4RU9A 4KFBA 3K59A 4FLVA 2WONA 2ZTCA 1A5VA 1ZETA 2E6MA 1T7PA 3C6UA 2A1RA 3NF8A 1ZQZA 1TV6A 1SKWA 4B8CA 3DRSA 2PI4A 3KHRA 4KKOA 4I7FA 3KD5E 3GV8B 3LDAA 8ICCA 4B8AB 3C2MA 5KT2A 4H4OA 1NJWA 1MQ2A 3AO4A 1BCOA 1JLFA 1JXEA 2W8LA 3KKRA 3JYTA 4KHQA 3JPOA 4YXMA 4Z6EA 3Q8KA 1IM4A 3FFIA 4ECTA 1KFTA 5HRPA 8ICBA 1XHZA 1ITGA 1BPDA 3LP0A 1ZQYA 5C42A 4KI6A 4C8MA 2W9BA 4RQ4A 3BJYA 3N97B 1A77A 4NM2A 8ICAA 4DTNA 3MABA 2ZJ8A 2R8IA 4E7HA 1ZQPA 3ISCA 1TK5A 3AUOA 3AVJA 2DY4A 4FJXA 1RDAA 5DB9A 5FRMA 5DB7A 5KFEA 3DRRA 1RBTA 4J9OA 4O3QA 4PGYA 8ICQA 4Z0UA 4DLEA 4I2IA 3Q8QB 4M9NA 1VRTA 4GC6A 3NTUA 4ECQA 4EP4A 3F9KA 3QERA 4M3XA 4HCCA 5J2JA 3LALA 4ED3A 4DF4A 2BCQA 2F8SA 4QWCA 2YKNA 7ICFA 3HYFA 3CQ8A 5EWFA 3TANA 3L3VA 4HYKA 4FJMA 1KRPA 4BWJA 3AVNA 5IILA 2IHNA 4ECRA 2YNHA 2PYJA 4RNMA 4UAYA 3SQ4A 3DLHA 3PNCA 1WSHA 3T1AA 1UT5A 2ISOA 2PFNA 4M45A 8ICGA 3KK1A 3OYBA 4HTUA 3MDAA 1LWEA 2HHUA 4QZBA 4W5OA 5JS2A 9ICJA 4FK2A 4DU3A 3PW4A 4QZGA 5KFMA 3HM9A 3OJSA 1EXQA 5FROA 4HUFA 3JPNA 4M41A 2MAXA 3D45A 3V7JA 9ICMA 4QOZB 2JGUA 4KAZA 3VQPA 4KLLA 3MEDA 3NBPA 5J2NA 3LPTA 2D0BA 5J1EA 3LP1A 5DBCA 3MR5A 4FCYA 3AVHA 4QWAA 2KZZA 3SCXA 5KG7A 4FM1A 5J2BA 4DL6A 2WTFA 5J0QA 1L5UA 2ETJA 4ECYA 1A76A 1WLJA 4KLDA 1L3SA 4NYNA 3H08A 4ELTA 4M3WA 2FC0A 4CIGA 3GIKA 4BGDA 4RPYA 3PMLA 1N6QA 4LH5A 1HMVA 4LD0A 3B6PA 4M0AA 4Z6FA 4UB3A 3TAMA 3KD1E 1HYVA 2AJQA 2ASJA 2HW3A 3IM1A 4UB4A 1ZBUA 4Q44A 8ICOA 1LAVA 5KFFA 4E7IA 3OHBA 2NRTA 2ZD1A 1S0MA 2G8VA 4PHEA 3C2LA 2IMWP 3TAEA 1DGSA 3V1QA 3OS2A 4Z4FA 3C6TA 4ED6A 5J0RA 7ICRA 4MFBA 4CEAA 3ZT0A 5IIJA 4JV1A 3DM2A 2ASDA 1NOMA 5KFOA 3V1RA 3LWMA 4GC7A 1LWCA 3UXNA 2W9CB 1UT8A 2JEFA 5CYMA 1Z3EB 3PW7A 1RT4A 1IKXA 5J0TA 4JV2A 1ZQUA 2IBKA 1WCLA 3OVNA 5KG6A 3LPUA 4CEZA 1JX4A 5EWEA 2HHVA 1NK9A 1JXLA 3MECA 2OYQA 1U47A 3VA3A 1S1UA 3DLGA 3MEGA 5J2DA 4CJTA 4JRQA 2BANA 3K5OA 3PY8A 3RR7A 5KI6A 3H40A 5CY4A 4KB1A 2NRWA 4KV8A 4R8UA 4E89A 1UA0A 3N4MB 4I2GA 3OYHA 3RB4A 1RXWA 3OYKA 5C25A 4YFUA 1I3AA 1COOA 2G8IA 3AA5X 4DTUA 1RILA 1JIHA 1TK8A 3RTVA 1EKEA 1ASUA 4CEOA 4CIEA 5CHGA 5E41A 3H4BA 1ZJNA 4KHYA 2VA8A 4CF8A 4E7KA 2YNFA 4FBUA 3HL8A 4CERA 4E1NA 1L3TA 1X9SA 7ICNA 4DOBA 2HNDA 3S3NA 4DQIA 4UAZA 3L8BA 5J2IA 4KLSA 3M9OB 4ZTFA 2XY7A 2YHBA 4CF1A 2ZUCA 4I9LA 2XY6A 1Z00A 3KLGA 4KMUA 4YNQA 3IG1A 4ZTJA 3THVA 1RBRA 3OS0A 3WNFA 2J6SA 2RKIA 1BPEA 2W9AA 4DTMA 2A1JA 3VN5A 3LZIA 5K14A 5DG8A 4M2YA 2FPKA 3ZCMA 4CGDA 4QZ9A 3ZDBA 1JL1A 1RT6A 4F8RA 4O3NA 4I2BA 1B92A 3UPQA 5KFQA 4M3RA 4FJ9A 1JMSA 3QEAZ 4Z4CA 3ZSWA 1BPBA 1QS4A 2VWJA 3AVCA 4CJPA 2A1SA 4YG2A 1TKZA 3V6KA 4CJVA 2AGPA 3RAQA 3VQ9A 3RJKA 1B9FA 1NJZA 2G8HA 2B4JA 1Q9XA 4EBDA 4RT2A 4R64A 5KRSA 3HPGA 8ICWA 1I39A 3SJJA 1EETA 3KHGA 4KREA 2DTUA 4Z6CA 3RH6A 4M3ZA 1O1WA 3A2FA 4CECA 1U9LA 3EW9A 5KG4A 4JV0A 1S1WA 7ICEA 4L8RB 4NY8A 2RPIA 1LWFA 4DG1A 1C7YA 4KRFA 4MQ3A 4CFDA 3KHHA 1A5XA 2FBYA 5HNKA 4KHUA 4YVZA 4OVLA 4FJNA 2VA3A 3HVRA 3ZDCA 1RXVA 1ZQQA 1TKDA 4XIUA 3KLHA 3L2QA 4CHNA 2JLEA 3RJEA 4C8LA 4KHNA 5KFPA 4YR2A 5KFAA 3H8SA 1CLQA 3GQCA 4KO0A 4CJRA 1CZBA 2BE2A 1HUOA 4RW6A 4Z4GA 1VRUA 3KLEA 3SI6A 4FLXA 3QEBZ 7ICJA 9ICXA 4LY7A 3VQAA 1R0AA 1ZQSA 4FJ8A 4W5TA 2FMSA 2HHQA 4CHOA 4N41A 4Q45A 1UA1A 4DO9A 3T19A 1D5AA 3NE6A 5KFYA 3JPTA 1ZQGA 4K4HA 4ECWA 3OYAA 5KFKA 3V7KA 4YP3A 3NGZA 5F9NA 1B22A 1L3VA 4I2PA 2QK9A 1C6VA 1ZQFA 1T8EA 3VQEA 2B5JA 1EP4A 2ZTDA 3DRPA 3V9UA 2YNIA 1RTHA 4DSEA 9ICHA 3NH1A 5KG5A 2HNZA 3KTQA 3E2EA 4DL4A 2XC9A 4LZDA 4X5VA 8ICKA 1ZBLA 3AVFA 4Q43A 1Z25A 1C1CA 2R8HA 2BQ3A 1KVAA 3HW8A 2VANA 3I8DA 4CJWA 3MGIA 4F5OA 7ICKA 2BHNA 4YCXA 3HT3A 3TAQA 9ICOA 4K4IA 1BI4A 1RTIA 4IRCA 1WNSA 3NCIA 2R8KA 2VWKA 5KFXA 3Q8LA 3PO4A 3AA4A 2IA6A 3OYEA 5L9XA 4N47A 1BIUA 1REVA 4UBBA 3RRGA 4FLYA 4KN4A 4DQPA 2AQ0A 3MBYA 1RDBA 1UWBA 3S9HA 4BE0A 4FJ5A 3MR3A 2J6UA 1BPYA 2BPGA 1CXUA 3I0SA 1TL3A 3SZ2A 5IINA 1TFRA 1XSLA 1KDHA 5J0SA 4DFJA 5IIKA 3PW5A 3H8JA 3SUNA 2XHBA 1TAUA 2RDIA 4YMNA 4AHVA 2O4IA 3C5FA 3V1OA 5I42A 4E7LA 1KSPA 1S9EA 4IRDA 4IR1A 5HRSA 4QZCA 3VQ4A 1K6YA 3WNGA 3PW2A 3KLFA 5KFDA 3F73A 3MXIA 9ICFA 2M9NA 4FJKA 4FW2A 4FW1A 1NOZA 4DSJA 1SV5A 4IDKA 3RB3A 5F9LA 5L1IA 4B08A 4RQ5A 3RRHA 2D5RA 4ED7A 3NF9A 3LANA 4PHAA 4DS4A 2BCRA 2R7YA 4OKKA 5KT3A 4DTOA 9ICUA 4UB1A 2OPQA 5J2HA 4C8NA 2YHAA 4M42A 3B0XA 4H8KA 1MU2A 4B9SA 4NCGA 5KG0A 4BXOB 3HPOA 3QNOA 2LSNA 4QW9A 1S76D 4JS5A 4FJJA 5D3GA 7ICMA 1S1VA 2X6SA 2ZJ5A 2W8KA 5DDYA 4E1MA 5I3UA 8ICPA 1XI1A 4UBCA 2BR0A 7ICVA 3ORYA 4QZAA 2HHWA 4ECVA 4J9KA 3ZSRA 4JK1A 4IQWA 3DLRA 1IKYA 5J0UA 2V9WA 4E3SA 3ISDA 1RNHA 4QAGA 3L3UA 1LV5A 1BVSA 9ICNA 8ICTA 4B3OA 1ZQBA 3DLEA 1ASVA 3OYIA 4M6WA 3AVKA 2NUBA 4DOAA 2MUTB 1NK4A 5KT4A 3D0PA 4CEEA 3ZDEA 3MAQA 8ICLA 3AA3A 1RZTA 4PWDA 3RJIA 2AGQA 3VA0A 1ZQTA 1NK7A 3K75D 3T5JA 4TURA 1UAXA 4F92B 1WSEA 5KRTA 2AU0A 3QLHA 5HMMA 3DI6A 1CEZA 9ICVA 2BCSA 8ICRA 4NCAA 2FBXA 5EWGA 3BGRA 4EZ6A 3TARA 1XS9D 3RH5A 3LDSA 9ICQA 5C24A 4LSNA 3ETLA 1QQCA 3SI8A 7ICIA 2ZUDA 1NKEA 3DYAA 5DGBA 4NLGA 1C1AA 9ICSA 4K4GA 1HNIA 1S6PA 3QETA 4I9QA 4QZ8A 4I29A 1VSKA 1HQEA 3RBDA 1EXNA 3V9WA 1RYRA 1UOCA 4FXDA 2B21A 4ED8A 1TVRA 4F5RA 4K8XA 2DFLA 2NRXA 2G8KA 3SNNA 1JN3A 1F21A 4B9LA 2IDOA 3H7IA 4TUSA 4FS1A 4DSLA 3CG7A 4K8ZA 4MFCA 1JLAA 1HPZA 3MXMA 5KFUA 2DFHA 1U49A 1TGOA 4ZHRA 3ZD9A 3GIIA 2OPRA 3UQ0A 1ZJMA 3OYCA 4GXJA 1CUKA 4QWEA 4NLKA 3O3HA 3Q8MA 1MQ3A 1HNVA 3C94A 1X2IA 4DTPA 3HO1A 1N56A 5DQHA 4RPZA 4MF2A 3ZSOA 5CB1A 4NYFA 1TAQA 4DL5A 2JZBA 1S9GA 4FLUA 3ZT2A 3G0ZA 3B0YA 4TSXA 4BACA 3RAXA 3QEPA 3OYFA 3V9SA 4KN7A 7ICHA 4M3YA 4BDZA 1QHTA 3ZSZA 3V9XA 1ZQMA 1RPLA 1J53A 1U48A 4IQVA 4KLIA 4F4WA 4RNNA 4O4GA 1IO2A 3K2PA 3SQ2A 4C8KA 4PH5A 4FZXC 2FBTA 3OYNA 4CHQA 4R66A 3UIQA 1CZ9A 2P66A 1Y88A 2ISPA 1C0TA 2UVWA 3MXJA 7ICSA 2OWOA 4I27A 1SKSA 1BL3A 4M9HA 4E19A 5HRNA 1NJYA 1X1PA 5CZ2A 1NKBA 7ICUA 4CFBA 4QZEA 4GVMA 4IFVA 1JLEA 2PYLA 4FLZA 3OJUA 1K1SA 3LWLA 2O4GA 1VSIA 1VSDA 1BPZA 1K1QA 4Z4IA 2ZTEA 3KLIA 2KFNA 4TQRA 4CGHA 4O9MA 4C8OA 4DTSA 2F8TA 4PGXA 4PY5A 5KT7A 3VQ7A 4M47A 4OLBA 2DPIA 4XQ8A 3AVGA 4FJLA 5KG3A 8ICSA 5KFVA 1NKCA 4IG3A 3EYZA 1DTTA 1ZQHA 4EZ9A 3CYMA 4F5QA 1ZBHA 2V4QA 2IOCA 3AVLA 3ZSYA 1C0UA 4DFKA 1JLGA 5DDMA 1YT3A 2RN2A 2OPSA 1XU4A 2HHXA 2BQRA 3KJVA 4FS2A 1J5OA 5DG7A 3CM5A 3V6HA 3K5NA 1KFDA 2PFQA 1ZQRA 4DLGA 4QWBA 4YD1A 4O5CA 1IXRA 4LVSA 4F2SA 4NCBA 5IIMA 3SUQA 5CWRA 3ASMA 5EU7A 4OGEA 9ICBA 2E4LA 1HYSA 2XGPA 4OGCA 4FM2A 1D8YA 4KTWA 3Q8SB 1TVAA 3ISBA 4CJ4A 3IS9A 3QINA 4YFKA 1S9FA 4KLEA 1RDCA 4FO6A 3MR2A 4W5RA 2I9GA 5L1JA 2BKEA 4HVJA 3QESA 1GOCA 1ZQVA 4O3PA 1NK6A 1U04A 5KTQA 4AHRA 3Q8PB 4BDPA 5DMRA 3RMDA 3JPPA 3AO3A 4I2CA 4DF8A 3SPZA 4RW9A 4CJEA 1ZQDA 9ICPA 4NLNA 2XO7A 1J9AA 3NH2A 3QZ7A 4Y1DA 4KLHA 3P1GA 1WSGA 4Q8EA 2R8JA 3BDPA 2XY5A 4ELVA 2Z1GA 1DTQA 2QXFA 5HHIA 4FJIA 1LB2B 4O5EA 4BDYA 5SWMA 4BWMA 1VSJA 1ZBFA 4DQRA 4J9QA 4JUZA 4PUOA 4M9GA 4KLGA 3FDSA 4RQ3A 1YTUA 4DMNA 3H8WA 4B9MA 3NDKA 5HLFA 2UVUA 2HB5A 1V9PA 3OYJA 3H4DA 3V9ZA 1SZPA 2PFPA 3DOLA 4B9TA 4FK4A 2BGGA 4FLWA 4YXJA 1IKVA 5DLGA 5KFCA 4CJKA 2BCVA 2ZQBA 4MEXA 4RW7A 1L3UA 3OYDA 5KFRA 2XY8A 1JLQA 1RBUA 3C1ZA 4KLTA 4CJ5A 4W5QA 1FK9A 4DSIA 1S97A 3FYHA 1RT3A 5KFZA 9ICRA 4AILC 2IHMA 1WSFA 1TKXA 4CF2A 3O4NA 4F4XA 4CGIA 4UAWA 3AO5A 3CFPA 5DB8A 1CXQA 5FRNA 4BE2A 4CJ3A 4FJHA 3M8QA 3ZSVA 3MGHA 4CEQA 1RT2A 2P5OA 4J2DA 4P4MA 4J9LA 4F3OA 2G8UA 3OHAA 2HVHA 4ELUA 2QKBA 3PX4A 4FZZA 1S1TA 3ZT3A 4DQQA 3O3GA 3AVIA 2RDJA 5KFIA 1BIZA 3JPSA 3QEXA 2HVIA 4DTXA 3SQ0A 4I2HA 8ICHA 4I2QA 4CFCA 4CEDA 2PZSA 2W9BB 4ECXA 3AU2A 2ASLA 1WCNA
chains in the Genus database with same CATH superfamily
2Z7JA 3TTFA 4CLUA 1DKGD 4K7QA 4MYUA 1G15A 3NGYA 4DSKA 2HQDA 5EN1A 1BY9A 2W2PP 1KVJA 2B6AA 2H3VA 1NMEB 3DRRB 4ANCA 2MLXA 1VRTB 3MDFA 4AL5A 2KICA 9ICEA 4K0KF 1NK8A 2FC8A 2E5HA 3G6VA 3Q8UA 3ZEUA 4K41A 5M1KA 5DM7Q 1G6BA 5KFHA 3KFUF 3MUTP 2KT2A 2KRRA 2VQEJ 1DY3A 5E2QA 3LM9A 1YRUA 2M70A 1NSPA 2HAFA 2YNHB 2HRYA 4E2FB 4HH0A 2KVCA 1HYZA 2ASOA 1IG9A 2LM4A 2C2DA 3N5FA 4FZYA 1KN5A 2Y1RI 4DL2A 2E7VA 2GZOA 1HARA 2NZCA 5AQKA 3IRXA 4OJ1A 3KUEA 4OHVA 2KZMA 3VVUA 4RQ1A 3D2FB 2WF9A 1FI4A 1ZA1B 5DQGA 1Q18A 3VQ6A 1S6OA 1ZQLA 3BGLA 1S5JA 3M6ZA 3TUPA 4I2FA 3FSXA 1OMSA 4QBUA 3BQ1A 5H2FU 5JLFA 1JJ2R 3CPWM 2YTCA 2D0OA 4DV3F 3CJCA 4NI2A 4DV0K 3PLAA 3KJQB 3A0BU 3NVVA 2PAVA 2AKWB 4J9SA 4Q5VA 1YVUA 2C22A 3TA0A 3ILOA 4DQ8A 3MM9A 4K42A 3K5MA 1HPZB 4QIEA 4CK3A 3L5KA 4ZHRB 3LP1B 5E79U 1A7GE 5GTHU 4RNOA 1FXDA 4E7JA 4EBCA 1E4GT 5ALSA 1NHUA 2FLNA 2LXIA 2DFFA 3M2VA 5J2PA 2BRKA 3MDCA 2YKMA 3EO3A 4TUQA 1S72N 3IHQB 5ALNA 4J9PA 5DM7L 1KAXA 9ICGA 5AM3A 3VF2A 1Q8IA 1X3NA 4NV0A 4USKA 1CVJA 3ALYA 3FLCO 1RWXB 4NWIA 5FLXY 3TUZC 1BQMA 4MEYA 1ZTTA 5IIIA 3HJFA 1VSHA 1FNMA 3O80A 4OI2A 1U2CA 4O4GB 2DGZA 2IBOA 3GR0A 4F93B 4CE9A 2QLFB 4FWLA 1P27B 5F8LA 4FDFA 1NK5A 3OVAA 3S6JA 3B6BA 4LFAF 4V19S 5FDLA 2ZBIA 3HT0A 3WNHA 4L3QA 2D3UA 3R7SB 3MX2A 3NVYA 3IRUA 4MFBB 4CDIA 1Q0NA 1L7PA 1TMMA 3LW5C 3N6NA 5CYMB 5HJYA 5L38A 1B99A 2WVBA 3M1YA 4H4MA 4F4KA 1WSIA 2F8HA 4MKYA 3R97A 2O67A 4GKKK 3M8PA 1QCKA 5ALKA 2X1AA 3CCSN 3HPHA 4NLQA 5E3QA 5T41A 1TV9A 3K1RB 4J9NA 1UMJA 2L41A 8ICXA 4OJRA 4B3RF 1DTTB 1FXXA 4F50A 4DL7A 3MECB 3D6JA 1RA6A 2G06A 3SLCA 1DHMA 1S1UB 2ZUGA 4OPKA 2FI1A 1Y10A 4Y0FA 2XCPA 2XMUA 1YIJS 3I5CA 4X4OA 1F5CA 1KAYA 4KV8B 4R8UB 1PVQA 3NS7B 4BC4A 4BRFA 3SPYA 1X66A 2ZUBA 3BF3A 4ICAA 2C1EB 3CD7A 2NZ4A 5DK5A 4IC9A 1MG7A 3H42A 1BHNA 3UQ2A 3UN5A 2DVIA 1W2BM 1VC6A 4FYXB 4PG8A 2CAJA 4ZVRB 2YNFB 2A5XA 1RI7A 1IBMJ 3ET6B 1K9MT 1NH7A 5HMLA 1GLLO 2QEXN 1WUAA 3ZTSA 5LJVA 1N63A 1JJHA 5JRTA 3FRZA 1B0PA 2IAJA 2LYHA 2VH7A 4ECZA 2AJFE 2AXTU 1IJJA 1VSEA 4QZFA 2GNKA 4MT1A 3S3MA 1Y5LB 2LHTA 2GQCA 4M1KA 1URRA 4F3QA 3D66A 4JD2A 3EWAA 4R65A 2CJXB 3GFZA 4BRIA 1W7WA 2WB1D 3OD2A 3AA2A 1HHQA 4HUEA 2XMTA 1HWLA 3BR8A 4WKRA 1YBUA 4RQ2A 5HRRA 4Y28C 3M30A 4H0PA 4FZLA 2A3VA 2DEJA 2MMYA 5AQSA 3PW0A 1EQYA 5ALHA 2JLGA 2GO9A 4XDCA 1FDAA 4A4JA 4RUCA 4WE1A 5A8KB 4LF6K 1ESVA 2G07A 4J9VA 3GDXA 1NI3A 2DPNA 2V4RA 2B4OA 2RDDA 4FK0A 8ICNA 5HATA 3WXMB 5J2EA 1PBUA 4F0MA 3RJHA 5B0BA 4J91A 1VQ8N 4DQSA 1OQ3A 4DG1B 1RAHB 1PZNA 3CCRS 3D68A 4FFDA 1XK8A 4DV6F 2DPJA 3OUYB 4PL8A 3U1MA 1WWUA 4DR1K 4OYXA 3KLHB 2CNNB 4KRWA 3L4IA 4DV4J 2BJ3A 5D4BA 2QXLA 1U1OA 2RS8A 1PJ7A 3HKZF 2GC8A 1Z2LA 5A2QY 4BXOA 3SDEA 2BDUA 3CSKA 4HWIA 5KFJA 3K0SA 2X78A 4HHTA 4RW6B 1ZM9A 2OPPA 5J0XA 1K0VA 4HR2A 3FBCA 2MPUA 3BN4A 4CH1A 1ULRA 3O5TB 1R0AB 3G6XA 1WHYA 4HEA9 4DMZA 2LDYA 4ZJOA 2OD6A 2B0CA 1FIQA 3DHXA 5TZVA 3L4BC 3PX0A 2HF4A 4AHTA 3WXJA 2YX8A 2YWFA 3QQCD 3TWHA 5ALQA 2F7VA 1ZYQA 1NLVA 4UY85 1EP4B 1G1XA 4H03B 1HL6A 4RT3A 4CGJA 1EWQA 3CCJN 5AQXA 1RYSA 1RTHB 4RQ8A 2NQPA 4UQGA 1NJIO 4LC9B 2OEJA 1WSJA 1BGXT 2GCFA 3HX0A 2N82B 5C2FA 3MWBA 4G6VB 3V2UC 4CF9A 1ASWA 1WOSA 1C1CB 3CD5A 4TNOA 2EWSA 2OAUA 2OI2A 1K5OA 4CJ7A 2E9TA 1QDUB 3K57A 9ICTA 3KOAA 3SAGA 4RKUC 5J0OA 2XCAA 3OR1A 4OZ1A 3U6FA 4O55A 5A8RA 1T4GA 4MIBA 1S6QA 1FDNA 3ZZRA 2VQFK 3M8RA 3SFUA 1N0UA 3QUQA 3AVBA 3V6DA 2CZVC 2DIUA 3SBTA 2DNGA 2D4WA 3NF6A 4H0VB 1UWBB 4DPOA 1X0FA 1MC8A 1RHRB 2IRUA 2KTQA 1RBVA 2J9CA 1VLBA 3EL2A 4DCPB 5DETA 3I8BA 3P4IA 1JLCB 2V4JB 3GDQA 2P1JA 2L08A 4YN4A 4OX9K 3QZ8A 1FKOA 1LWXA 2ZH1A 2MKCA 2FJVA 4J2AA 4CE6A 2JEGA 1OYDA 4LF8F 2FZCB 2NXCA 3ZETB 4FWKA 5JJBA 2ZZMA 5HHHA 4ZITA 2B9XA 3BZKA 2CWXA 5CAAA 3BH7B 3S6EA 5HMXA 1R7IA 3O8WA 2GJFA 1N48A 4KH1B 1NNEA 4OLAA 2KHVA 5LL6d 3KBBA 3G6ES 3CJ2A 3F2CA 4A8XA 2DEIA 3BBBA 4HTJA 3FZBA 4BC7A 2HZAA 5CYQA 2AD9A 4ZVOB 4ID8A 2OTJS 3AB4B 4UB5A 2MSSA 1KCFA 3HHLA 3L95X 3M7VA 2H5XA 1D0EA 1A5WA 3HM8A 3MMVA 3I4HX 3MPVA 4KLQA 4FKXA 3QUCA 3TADC 2QSWA 1QE1A 3GPAA 4CLTA 4CZFA 2JGAA 3NWGA 4M3TA 1FJGJ 4NJ8A 2M9KA 3VAKA 3BGOP 4WKYA 1FEEA 3DOKA 5AI4A 3NXZA 2XMVA 1VBZA 3I5BA 1L7NA 1RBSA 4XH5A 3FJ2A 1C1BA 3CCLS 3LA0A 1HJOA 2HI0A 5D49A 3V81A 2K7JA 4M6WB 3JB9k 3QIPA 3H0LB 1FXLA 2UXCJ 2W2MP 4EX7A 3MWPA 3KJFB 4URQU 1PC4A 2VPYB 3NMAA 1LW0A 5J2MA 5J2GA 4KH5A 3SCIE 3V6JA 4AM6A 2MSTA 4F5PA 2OYYA 2HKEA 2P9NB 2I5JA 4LF4J 4JI2J 3CCES 4BREA 4CM2A 1Q46A 1ZH5A 2E1CA 3PRDA 5AKGA 5CH7B 5DRKA 4DUZJ 3LP3A 4OJHA 4KTQA 2OSRA 5DDRC 5F8IA 4C3KA 2J6TA 5M1PA 2N4CA 4LSNB 5CZ1A 2A42A 4I6MA 1RFQA 3ZNUA 1IWAA 2VA2A 3GE1A 1XMQK 4XA5A 1WYGA 1Q8KA 5G0RA 2HHHF 3EZ5A 1HNIB 4NOHA 3TEGA 2W40A 3QWPA 3CDEA 1FRXA 4B17A 3HXMA 3HOSA 5DKWA 4Q8FA 5GADU 2LVWA 1S0OA 3WQUA 2FD2A 3JQJA 4RZRA 2UV8G 4OFZA 3H3NO 1UHUA 5K5MA 1S79A 5H9FK 1UZHA 3JPRA 1EJ7L 1TYQA 1YTAA 5CD4A 1B70B 4G3IA 1BNPA 1CJUB 2J0QD 2EQYA 5DB6A 2OPRB 3NMRA 5E0OA 5CCMA 3NG8A 1HNVB 2A2DA 2M88A 4AL6A 1FEHA 2KKZA 5B7WA 1OH5A 3MTKA 3M9MB 2L9NA 2AGOA 2JZBB 3G9CA 1PAUB 3GIMA 3J7AP 3GU3A 1T05A 7ICOA 1H73A 2ZBPA 3BUZB 4RWTA 3EUB2 3TSUA 2V50A 5L1MA 4NXZA 1RWWB 4H4KA 4OV1A 5I3PA 2E5IA 3K59A 2VKZG 3ICXA 1WKKA 4QIWC 2Y3YA 1CJTB 2MZ1A 1ZETA 3GOIA 1O03A 1T7PA 3C6UA 1C0TB 3M6VA 1QUVA 5JLHA 1BOTO 4B8CA 1ZBTA 4LJXA 2V52B 3DRSA 4JI3K 4UB6U 2VFUA 2JRZA 3KWIA 3H5SA 4IFVB 2QA2A 1WDDA 3KKAC 1IXKA 2W4CA 3GV8B 2PMZC 1KKXA 4EO8A 3PTWA 4PZNA 1QAXA 5ETRA 1VHXA 4B8AB 2FXUA 1JJ4A 4CT8A 4H4OA 3J7A1 4ZCMA 1MQ2A 5U47A 1BCOA 3D2NA 3VF6A 3OR2A 1JLFA 5AQMA 4RCHA 2CDRB 1FE4A 1NGCA 3O9RA 3Q8KA 3IAS9 3FFIA 4ECTA 3ZI4A 4FPAA 5HRPA 3JSMB 5GIOA 1ITGA 1VQYA 4LF7J 4NLCA 1LOUA 3MN6A 1K0TA 1GLJO 2BKOA 8ICAA 1V5IB 2YI1A 3B54A 4I0WA 2GMHA 3AEVA 3MABA 2ZJ8A 1K44A 3I4PA 3WZ0A 1ZQPA 2RT3A 1YVFA 3ISCA 3AUOA 2DY4A 1ECWA 2DNQA 2IRXA 1LOTB 4OJ3A 4KBOA 4F67A 3E9OA 4M9NA 4GC6A 2G2OA 3NTUA 2IY5B 4A48A 4ECQA 4EP4A 1VQ9N 3SMVA 2RHFA 3K1ZA 4A8KA 3A8EA 3LALA 4ED3A 2BCQA 1RU1A 5M1QA 1N5TA 2YKNA 4O23A 3OLBA 2E1MC 3L3VA 2KG1A 1KRPA 3MPYA 3CC7S 4WTOB 1Z1ZA 4DV4F 1RCOB 5ALOA 2B3TB 1RU2A 3RJMB 1VQSA 3NAHA 5AJ3F 3T1AA 1UT5A 2W01A 1NGBA 2ISOA 2VWBA 1B64A 1ICEB 4KR0B 4RTFD 1LWEA 2HHUA 4QZBA 3J7YP 1MN8A 4RW9B 5IV3A 2E44A 4V19X 1XNRK 2JRSA 5ITHA 2Y1LB 4DU3A 2ZWPA 2GGPB 5FROA 3N9UC 3G25A 3A0HU 1WKLA 2MAXA 2KVQE 2GVDA 1DTQB 3VAMA 3J80O 9ICMA 3D9BA 4C4RA 4KAZA 4PUOB 1S5ZA 4P2SA 2BV3A 3MEDA 3NBPA 3LPTA 4YOEA 2D0BA 3NCQA 1F9EB 4OJ6A 3MN9A 3AVHA 2RJZA 1KL9A 3SQGA 4ZMMA 5KG7A 4FM1A 4Q7AA 1IJFB 5J0QA 1LXJA 1KQSR 2XEXA 1NGFA 1UVKA 2HQCA 4PCQA 1F0XA 1CI4A 3C66A 2GX9A 3A8YA 3UE2A 4RW7B 3UD4P 2VICA 4EUVA 1YIJN 4WCEQ 1W7AA 2VFTA 3WK6A 2V67A 4CIGA 3B78A 2E7WA 3CNQP 4RPYA 2KXHA 2LFVA 3QGIA 3L3FX 1N6QA 1HNXF 4LH5A 5KQDA 3B4MA 3QICA 4Z6FA 4UB3A 3KD1E 2AJQA 3M8QB 2ASJA 1PCAA 4Q44A 1CJVA 2J4RA 2XBPA 3OHBA 1XMOF 2KJ5A 2ZD1A 1NPRA 2CQCA 1S0MA 2G8VA 3P4UB 5M1OA 3RBXA 3TAEA 2VPZB 1X60A 5H1SQ 1N33K 3K89A 1DGSA 4I2QB 3V1QA 5H9EK 1F5BA 3HFVA 4B3TJ 3VEYA 4LF2A 5TISU 3DM2A 1OO0B 1H3DA 4CF5A 3BN7A 4GC7A 3V1RA 3WK8A 1UT8A 4HTLA 4JKCA 4WFBL 1RABB 1IR2A 1FX4A 4QYZJ 1YAGA 2B6AB 3KFWX 1Z3EB 3HJVA 3NNCA 5J0TA 2CJ9A 1D1UA 1ZQUA 3AGKA 4CT9A 4EGLA 3NASA 3EGWB 2R7XA 1PGZA 1V6HA 3ZEUB 1UJ4A 1V5VA 3CQYA 2AZ3A 2ZHBA 1QVFR 1GNKA 1AYEA 1GLEG 1WWHA 3VA3A 4YB1P 4NB4A 2VG5B 5J2DA 2FJAB 2DISA 3JAMY 1ELOA 2IYIA 1I94K 4CYUA 5LJ3Y 4CLYA 3JTNA 3GYXB 3OPKA 5HOOA 6FD1A 3IRXB 4NEYA 5ALGA 3RB4A 3TJ8A 4BRLA 1RXWA 3OYKA 3TQEA 1I3AA 1JIHA 1MN7A 1NHKL 3RTVA 4ZN1A 2F9WA 1UVMA 4CIEA 2F65A 1FESA 3QU7A 5GMEA 4A8OA 4ERDA 3NNAA 4NI2B 1WOPA 1TUWA 4E7KA 4FBUA 1CPZA 3CCRN 4ENOA 7ICNA 2M52A 4ISEA 4IH6A 2W3SA 2FVCA 4JAXA 4MK8A 4E1JA 3MM9B 2CPIA 1KW4A 2XY7A 1NDCA 4C3MA 2ZUCA 4F04B 4JI2F 4KMUA 2DT9A 2CPZA 3BSOA 1LKYA 3CIZA 1Z1VA 2OANA 3WNFA 4WP9A 4BR7A 3BB5A 4BR5A 2A1JA 2LU2A 3M2VB 5DG8A 5JMVA 4M2YA 5J2PB 2FPKA 3AD7C 2YKMB 3H45C 3ZDBA 2HOQA 3EGZA 3IAM9 1YKWA 2MRLA 4O3NA 2OMLA 4M3RA 4ITSA 1OQ6A 1JMSA 1QS4A 4WK1A 1HIYA 4PL7A 4NYPA 4OHZA 1K47A 3KDNA 3NAIA 2KI2A 3BF4A 1NJIT 4ZLJA 2QRRA 1BQMB 4K4TA 1HKAA 1Q9XA 4WFZA 3PCOB 3R5AA 4IEIA 4J90A 4BQLA 3HPGA 3D2WA 3H0PA 3WK9A 1I39A 2KJWA 3AA8A 1JMTA 2POKA 3DLLQ 4Z6CA 4CECA 4N77A 3OBYA 3QBWA 3AB2B 5FDLB 2WSFC 1UEKA 3WQPA 3VAIA 1U8SA 1NGHA 2YHWA 3KVGA 4NY8A 2ZG6A 3U7JA 3SMSA 4U7UK 3RBZA 1F1BB 4KRFA 4CFDA 4OZJA 3LO3A 3SSSA 5HNKA 1N34J 3HKZD 4H4MB 2OP5A 4XIUA 2XI2A 4DUTA 3PYGA 3DC2A 3OXFA 1QAIA 1RM6C 2UU9K 4OZNA 2JL9A 4Y2KA 2B56A 2BE2A 3M4XA 1HUOA 3D6FB 2D9PA 2CFXA 2Y8WA 2YJFA 4Y2VA 4JYAF 1VRUA 2LXFA 4FLXA 3QEBZ 7ICJA 3VQAA 2MA1A 4DR6F 3OHRA 2UXDJ 4CHOA 1CC8A 4L75A 5IQQA 3J81Y 1VAZA 2PEHA 5KFYA 3JPTA 1ZQGA 2UP1A 3VF0B 4X4RA 1B22A 2BMBA 3C3LA 4I2PA 3RVCA 3ZYYX 3CHWA 2JHDA 2F9TA 4FZNA 2ZTDA 1JK9B 3NLCA 3DRPA 2B0GA 3V9UA 2EFVA 2BJ7A 1ZXIA 4OHXA 1YVNA 3MGVA 3VEOA 5B0GA 3FBBA 3KTQA 4DL4A 1ZBLA 2BE7D 1ZTWA 3G6EN 3FNNA 4CLWA 1R3NA 1WEZA 3CMQA 4DV0J 2R8HA 1F6TA 2OTJN 3AH6A 3MGIA 4UF4A 4FZMA 3BO2A 1YRTA 4YCXA 3TAQA 9ICOA 4BBYA 3MPWA 1Z1BA 3HLUA 3R3LA 4UOCA 3EM1A 5JVHL 1GAOA 1RTIA 4IRCA 1HBMA 3NCIA 3MZIA 3WKDA 2GX8A 2R8KA 3AQOA 3AA4A 5L9XA 3ETOA 4JD2B 1GQEA 4UBBA 1TTHB 2IDEA 4FJ5A 2V68A 1F9FA 2MGZA 2BPGA 2Y9TA 4Y2IA 1CXUA 2Z0GA 3CCLN 2E2QA 3R5CA 3M30B 4KYZA 1F3VA 1DAXA 4YMNA 3ENOA 2QTDA 3O0FA 2O4IA 2FDRA 2EBGA 3C5FA 1OYEA 4GRSA 4ILGB 5I42A 3GFHA 1KSPA 1CZAN 1E3MA 4MO5A 4WE1B 1RTZA 1T9TA 3SQIA 2EZXA 1RHUB 4A59A 1X4DA 3CCEN 4RPFA 4FJKA 1WACA 4FPBA 4JKHA 1SV5A 4Z37A 5L1IA 2D5RA 2EZYA 4HAIA 2FJDB 4BG8A 5EE0A 3BS7A 2WAQF 4EWTA 4ES3A 2YBVA 3JQMA 3SBGA 2J76E 9ICUA 4F9OA 4ALZA 1XEZA 4M42A 3B0XA 1BA0A 4H8KA 3M6GA 1VJQA 4DR2K 2I7PA 4BXOB 3SDEB 2NXEA 4QIVA 3AMZA 2AX1A 5D3GA 4JS5A 4GKKJ 4FJJA 1NMNA 3Q8YA 3K17A 2FHJA 4E1MA 2OPPB 5AFUA 3C6TB 4UBCA 4OJLA 1O5JA 2BR0A 5L9NA 4CO1A 3ZSRA 1VHIA 5J0UA 3ISDA 1NWKA 4QAGA 3HI9A 1FWLA 4X4VA 2GMLA 5LXYA 9ICNA 3VZHA 1SJFA 1IN0A 4B3OA 3DLEA 3CULA 3AVKA 4BC2A 2NUBA 2DR9A 2ZJPQ 5JU5A 3F44A 3CMES 3CIPA 3QUBA 1NGAA 4CEEA 3ZDEA 2HBRB 3AA3A 1Q86O 5JVGQ 2ZIXB 1RZTA 4P71A 1ZQTA 4YHHJ 1WF1A 3PHTA 4LFBK 4KE5A 1NK7A 3T5JA 1UAXA 3N5BA 3WC2A 2UUAK 5AQTA 1XNQF 1QUPA 2E1FA 3DI6A 3TSQA 8ICRA 2K4HA 3TARA 3VOVA 4RO0A 1Q79A 2MKHA 3NVKA 3M5RA 3SIPB 4B1WB 9ICQA 5C24A 2GQQA 5A8RB 3ETLA 2YPYA 3UMBA 1S6QB 1NZBA 1EX8A 3TJAA 2C2ZB 3E8OA 1Q3UA 3V6DB 3QETA 4NA1A 3SMZA 4I9QA 4FE3A 5EE9A 3RW6A 2R7QA 4OYIA 1NZAA 4Y2MA 4C11A 1YJRA 3QRPA 4HH1A 1RYRA 4LR9A 4FXDA 3AAQA 4ED8A 2KDOA 1UQVA 2DFLA 3ENQA 4X4PA 3G2XA 2XZDB 4UT4A 3DKDA 1FKOB 4TUSA 4FS1A 4DSLA 1NSKL 4MFCA 1JLAA 3LUYA 2AJ0A 5LOQA 1TGOA 4RQNA 4BRGA 1FO4A 3H2VE 2E1EA 2ZJPL 5ALWA 2K4PA 4QWEA 4WQ5A 1GLDG 4Y2YA 1WEXA 5EDWA 3Q8MA 4MDBA 1NBWA 3GFYA 3A8KA 3D3CJ 4OPAA 1N56A 1Z4NA 4LF6J 3CJQA 3WU2U 3AN1A 4RPZA 4CBWA 2UZAA 1JCEA 1OWXA 4OX6A 5ETLA 5AQJA 5CB1A 1JUDA 3GCWP 1LQ9A 2HBKA 3IGNA 4FLUA 2LQJA 2X1GA 4CIOA 2MZQA 3IM9A 5ETVA 3VGVA 3CE8A 3B0YA 3ZX3A 5CYQB 2Z2LA 2HOFA 4M5KA 3FAHA 3RAXA 4PKHA 2KYXA 1N52B 4C4SA 2B9WA 2QJ3A 1I6JA 4KN7A 4ZPAA 2I2YA 3HHLB 3BSAA 1ZQMA 3AJ2A 4IQVA 1GMVA 4A8FA 4DR1J 2YQ3A 1S22A 3FSIA 2K8CB 3E1YA 3SQ2A 2ZEJA 1QE1B 3CC7N 4OI3A 3M6KA 4R66A 2ZH5A 2UVWA 3MXJA 3FQLA 5AE1A 1U0HA 4I27A 1SKSA 4M9HA 3DOKB 1X1PA 4D3HA 1QZ6A 4CFBA 1XJWB 3G4SS 3VMFB 4QZEA 4GVMA 2DNLA 1JLEA 2PYLA 1C1BB 3DXKA 3V81B 1K1SA 1VSIA 1VSDA 3AARA 4Z4IA 4LBHA 4BHQA 3BEXA 2WSEC 3KLIA 1LW0B 5J2MB 5KAIU 4N7TA 3QFPA 5KT7A 1Y0HA 4XQ8A 1P1TA 1XUPO 2I5JB 3Q0AA 4IG3A 4OLOA 4DR5K 4XPEA 2YB4A 4LF5J 2Z30B 1JNZB 4CZHA 3EZOA 3THPA 3ZSYA 2OKQA 3CC2S 1C0UA 2ACYA 3VEZA 1JLGA 1M5PC 3GJSB 3H5YA 3R6GB 1XU4A 2GO8A 2BQRA 2P9PA 3O1BA 2B5JB 4FS2A 4ILMA 1PVRA 4J5OA 3CM5A 3V6HA 4DV7K 3KMSA 4YMEA 4BC9A 4QWBA 3DU5A 3P96A 4K2JA 2MTLA 3B4DA 2QYCA 5G0RB 3GMGA 1O08A 2IVPA 3A8JA 4OGEA 9ICBA 2QC3A 2XGPA 4OGCA 4FM2A 2VC1A 3O5BA 2E66A 2VQFJ 3IS9A 4NLBA 3MM5A 4QOTA 4P7VA 3MR2A 1GX6A 3LYSA 4UUWA 1TYQB 4JI5F 3TOQA 2F8MA 4HACB 2GAGC 2XS7A 3CJ1A 3JPPA 3AO3A 4DF8A 2HFNA 1NGGA 2IJFA 1HW8A 2O01C 3FCHA 1ZZNA 4OX9J 3KJNB 1J9AA 3QZ7A 4TYAA 3W61A 4Y1DA 3U1LA 1Z4UA 3P1GA 4Y6IA 4Q8EA 4DJBA 4DR3K 3BDPA 2XY5A 4RBVA 2KK0A 3MGJA 5SWMA 4BWMA 1YJWN 1VSJA 5LY3A 4DQRA 4J9QA 3VTHA 4Y00A 1XIQA 1T05B 2Q3PA 3EEQA 5KPZA 3PSFA 2ZWHA 4NXNJ 1WDTA 3H59A 4FO0A 4JN4A 5TKYA 2F3JA 2OFHX 1V9PA 9RUBA 4LF9K 1ZOLA 5SUHA 3H4DA 2RQ4A 1YJVA 4B9TA 4FK4A 3BYPA 4URSA 3QPIA 4CJKA 3C6UB 2ACMA 3HBTA 4ZVUB 1AZSA 2RMLA 1P7DA 3SCKE 3DRSB 1J2NA 1FK9A 3FRYA 1S97A 3FYHA 3LH2S 5KFZA 4BLGA 4AILC 1WSFA 4CF2A 4LFCF 4USAA 4CLPA 1VK3A 5HAOA 3ATVA 3EWGA 3CFPA 5DB8A 4BX9C 4H4OB 4FJHA 3ZSVA 3OR2B 4M8LA 2G0CA 1JLFB 2P5OA 2G8UA 5IT9O 4QPXA 3PX4A 4JOUA 2JWLA 1S59A 3ILLA 3ZT3A 4DQQA 1CC7A 5B0EA 2RDJA 1H1VA 4KGKA 1A9NB 3SQ0A 4I2HA 2DH8A 1FJCA 5BR9A 4ECXA 2AEMA 2WBMA 3AU2A 5JUMA 1WCNA 2PY5A 3TVKA 1Q82O 3RJFA 4P0QB 3IBWA 1N5SA 3EE3A 1U0SA 3D67A 4E8UA 2EI5A 1HJPA 3Q7BA 2C2NA 5JTIA 2F96A 2CVEA 4DWIA 4AYBC 3UR0A 4CEBA 4M5MA 8ICEA 3GILA 3VGKA 4ZPVR 1WI8A 4DTRA 2YKNB 2MDAA 3T6JA 2ALZA 1BPXA 2ZE2A 1XMQJ 3P5JA 1EHWA 4PKGA 4QU7A 4I28A 2QW9A 2F4VK 2JEIA 3TADA 2KO1A 4KHMA 3BZCA 1HKBA 3PR5B 1Z4OA 3THWA 4NPOA 2D1KA 2KLAA 2KKVA 2LKZA 3RBEA 3QU9A 5AR0A 4P2MA 3FCWA 1TK0A 4WP3A 4YQWA 5IT4A 4E0DA 4MJKA 1LWEB 3OW2R 4TQSA 2CH6A 2BCUA 5F3XB 5KT6A 1RT5A 4ZLLA 3NOCA 1SC4B 3T1YK 1NOYA 1FFGB 3WDOA 4NLPA 4A8QA 2R7VA 3OYGA 3RMAA 1WBBA 4C7QA 2D3O1 4DFMA 1HQEB 2QTWA 3SQ1A 3QT6A 2Q31A 4K4SA 5F3ZA 2W7AA 2F1HA 3MOZA 1IJEB 3TI0A 5M2UA 2A41A 1FFSB 1I1GA 3MEDB 3MFIA 4EMDA 1UFWA 3TEHB 4JRPA 3CCVS 2KHDA 4DOCA 5AKLA 4ICLA 3O08A 3HP6A 1S6UA 3J80Y 4ER8A 3SQGB 4WFXA 1VQ7S 1RWOB 2KM8B 2XS5A 2C42A 3PYFA 2CPFA 4O3MA 1C0FA 3ZX0A 4PL1A 3VERA 4CVNE 2KJ8A 5ALZA 5T14A 1JRPA 1UVJA 2CXYA 2HBLA 5DJBA 2KQ2A 2QFJA 5HP4A 4RQ0A 1Q81O 4A47A 4NLZA 3KNAA 3TX8A 4JHDA 9ICKA 5CQGA 4EEYA 1N6QB 1T9WA 4JI3J 5KAFU 5ALTA 5HMWA 3UR3C 4YOUA 2HAIA 3LAKA 5AICA 3OQ2A 3C95A 5CR0A 1CJVB 5LMNK 2DR7A 2RHQB 2R7WA 2VG6A 2QT7A 4B3MK 4BJQA 2GUIA 3KKFA 2ATQA 4JKAA 2KFZA 3GU0A 1MWMA 4Z4HA 1NU4A 3GSIA 4GV3A 2CXEA 1ZBIA 4ZOSA 3C5GA 2BX6A 1U09A 2NR0A 3DM2B 3MEEA 3T5LA 5D0EA 4DU8A 2K1RA 3RJJA 2VYPA 2X7IA 4DB3A 4CIFA 2FLPA 4PKDB 2ZM6J 2XHCA 5KNIA 2B43A 4AHUA 1TE2A 2YV0X 2LM1A 1X6IA 2UUBK 5IFMA 1KQSM 1Q1KA 2DK2A 2EW9A 2YKQA 3NMUA 5FIIA 3MCNA 5J2CA 1DJ0A 4QIGA 2C3PA 2I1QA 3PIOQ 3ISNC 1BQNA 3ZTQA 2Z8QA 3CJ7A 4NRUA 1BHLA 4MLEA 1XO1A 5CJ7A 1ZBSA 2IM3A 4KLOA 4U8VA 5IWAJ 3RFAA 3PO5A 3MR6A 4M9LA 4CYUB 4DR1F 2R8GA 3SD7A 2N3LA 3KJVB 1P6TA 3BYRA 3NEKA 1ZQWA 1NM2A 1KXPA 3J7AN 2KN7A 4OKJA 1CJKA 2RIJA 1RG6A 3MFHA 3PVXA 4P7TA 4JWNA 4CWBA 2W25A 3RYLA 4DFPA 2V63A 3S3OA 1NLKL 3UXOA 3EXCX 2JH3A 3EX7B 5A8WA 1XNRJ 2J7UA 4X64K 5BR8K 1D3WA 4QR0A 1HI8A 4PHTX 3CJSA 2XLJA 2ITMA 1JI7A 1RACB 1HUXA 2IGIA 3AQFA 3ZZUA 4USVA 5HQMA 3UE5A 4RUBA 1HUZA 3LP2A 4CEFA 3OL6A 4DN9A 4ZJLA 4M3UA 3U3YA 1IBMK 2A1JB 2L48A 4OHWA 2OH2A 2DHSA 2WRMA 4ZVPB 1IBKK 3MM7A 2DNOA 3ITHA 1FRLA 3OL8A 3FM9A 3AO2A 3IBCB 4BRPA 3UN2A 1UCVA 4ZVHA 3QEIA 4ZVGA 1HBUA 4ECSA 3UQSA 5DZ6A 4JS4A 4M5IA 4JI4K 4DU1A 5M2RA 2KYZA 3ZSQA 4IH7A 1Z05A 2VQFF 3BY5A 4RNHA 4IKFA 2VD3A 1NPPA 2FSKA 1I3OB 3P5BP 2WF5A 2ZWOA 1SXDA 5ETOA 1DBDA 2QA4S 3T5KA 1N5QA 1D09B 1N61A 2HCFA 3V72A 1KQGB 2O8BA 2WAQD 3CCZA 5LMUJ 4O5FA 2UUCK 3N7SC 3C21A 9ICAA 3NHGA 2XSFA 2O6KA 3L2WA 4Y2TA 1TL4A 2OELA 3AY0A 3B8HA 1K8KA 3RH4A 3M6XA 1N33J 2W6KA 5EY4A 3ZNJ1 3CCWA 4MN4C 1RCHA 5H9EJ 1JJCB 4IO9Q 2N3OA 3SUPA 4KLFA 5ETKA 3OLAA 2ZJRQ 1HD0A 4QS8A 1SQFA 3R27A 1YG0A 2EANA 4WU3A 3VPZA 3VQBA 3MF5A 1SS6A 4P4PA 3RB6A 3GV7B 5ETQA 4CF0A 7ICQA 3DDIA 2ALYB 1VRUB 3RJGA 4F2RA 4FJGA 5L1KA 2VBXA 4FOIA 2AHOB 1ZS6A 4B9QA 1HKGA 4PZOA 3MOJB 3QJLA 4A8MP 4BC5A 2EKNA 4AFFA 4IBNA 2KZ3A 3WEEA 2W4PA 1RT1A 4I2PB 2NXJA 1U1MA 4DCCA 4UB2A 2MUTA 3P39A 4WFNL 2GBZA 5J0WA 4DSFA 3I76A 4OJOA 3DRPB 1QLNA 1RBOB 2HHTA 1O13A 4YORA 2MJUA 1RWKB 2V0NA 9ATCB 3T5HA 3Q89A 4F71A 1WAJA 4CK1A 2CPJA 5AQPA 2QN6B 3FC9A 5GAEU 3FCVA 5M2PA 1EKSA 5LT5A 2HFSA 3R7NB 2Y0SC 3EPGA 4DN0A 1WUDA 3K5PA 3IA0A 2ATLA 1DXSA 3D6TB 5HP1A 3KXDA 3C0BA 4RQ7A 2FHKA 1OH7A 4OZLA 4QWDA 2NCKL 3VV2B 4AT1B 4B6JA 3OY9A 4TUPA 1AUSL 1XC9A 3OSNA 3QNWB 1QZ5A 3VQQA 3FKBA 1RTIB 3L7PA 1HBMB 5F8HA 4LH4A 1PAEX 3KDOA 3CC4S 1X7VA 2KEYA 4FL9A 7ICLA 1PK3A 1NRKA 1VMBA 4CCHA 1Q5YA 3O9TA 1PO6A 3G4SN 2PO4A 2MGZB 1AFIA 5AQOA 2OLWA 4JK8A 3TAFA 4CJUA 4N5SA 3HHLC 3WIVA 2V8GA 2IC3B 1BXNA 3HZGA 3G6YA 3QMQA 1Y11A 1NB2A 2E5LF 3PRVA 5I42B 4N8NA 5DM6L 2HK3A 4DZ6A 3ID8A 2DGVA 4PHDA 4CBUA 3BBFA 3OGUA 1JCFA 1ZQNA 3OT9A 5DS7A 2JEJA 2GHVC 1SVDA 2VCPA 2ZC4A 1SV5B 3A3OB 3RG6A 2PXIA 3CC2N 4US8A 3UXPA 3QSIA 3A3NB 2KH9A 2BRLA 3IC1A 2V51B 2IYGA 1B4FA 2W6LA 1N0VC 3M3ZA 3OTOK 1ZAWA 2QFIA 3LTOA 4CO0A 3N28A 1DK3A 4M04A 1B43A 2HS0A 3S01A 3DOMA 4A2BA 4JV5F 4USMA 3CJBA 2BJ9A 5FPEA 4DUYF 5JICA 3HI0A 2UU9J 1T3NA 4HLBA 2AYMA 3IN5A 1VJWA 1ZD4A 2EC0A 1T3OA 4C0BA 1Q16B 2NS1B 4B3OB 3RSEA 3DLEB 3JPQA 3DMJA 3LAMA 3NH0A 2GVZB 2RQCA 5J2AA 1R6VA 1FW6A 4A5AA 3P83D 4KLUA 4PQUA 3PJXA 5HSPA 1HNWF 1PILA 4MIWA 3VQDA 1K73O 1D8BA 5ADZA 1B9DA 4B1ZA 3A8IA 2G2YA 4JI3F 4AHSA 2N7YA 2G8WA 1FRHA 1WWVA 2FPMA 1NM1A 3VZIA 5CA7A 2HVZA 1WOQA 3CXCR 1HX1A 2XVTA 2DFEA 1L6NA 2BH1A 4RW4B 3WC0A 2XO6A 3DI6B 3FMWA 2WSCC 1VQLS 5LSLA 4FXVA 2HHSA 4LF4K 4EAHD 5C24B 1FRIA 4X65F 3VR1A 3C28A 3KHLA 2LMIA 3AOAA 4YOXA 4DUZK 4DZDA 7ICGA 3LGMA 4PPDA 3QRRA 3UDEA 4AQYK 5ALRA 4YMOA 1AUDA 1FNXH 1DURA 4C11B 1TELA 1G3OA 5EGYA 3JS6A 2KHCA 2DXEA 2WMMA 1XHXA 1N4LA 4H4KC 4GMJB 3EICA 5HANA 1S57A 1JLAB 1Q82T 2VG7A 4G1PA 4OD0A 4H54A 3MMAA 2YHYA 2E6LA 3RWUA 3QT5A 2VBYA 3NF7A 3C15B 3G96A 5J2FA 4EBEA 1YX2A 4NZ0A 4Q0BA 3ZZYA 3M7DA 1X4HA 3RMBA 2YB1A 3MPUB 5HL7L 3T7ZA 4U7CA 1OH6A 1BCMA 1S10A 2XNQA 2P5GA 2AQ4A 4A8SA 4LRAA 5K8OA 1J54A 1OY9A 1SL1A 4IOAL 3CCTA 1SXLA 3VHQA 4QJFB 3BQTA 8AT1B 2HFVA 3L0QA 4FLVA 2WONA 2IMOA 2UV8A 2B4UA 4KHPK 2E6MA 1SIZA 4TY9A 1T95A 1IBLJ 1FT8A 1WG8A 4A61A 3NF8A 1ZQZA 1TV6A 4LBPA 1U0HB 3EVOA 2MQOA 3H8MA 2W04A 2OJ3A 3GP9A 2PI4A 4US9A 4KKOA 1UPPA 2CNOB 3DGPB 1JLEB 1HA1A 4OI6A 4JI0K 3DXKB 5CHCB 2K3KA 2VJ4A 3LDAA 3G87A 8ICCA 2QMUB 1TUVA 1K9MO 2MEWA 1NUEA 3I56S 1NJWA 3AO4A 2ZUAA 2C3OA 5AQUA 4NX9A 1R8HA 1HR0J 1J27A 2R9LA 4Z6EA 3ENHA 1IM4A 3D0GE 4NZ6A 5AXKA 1HPMA 8ICBA 1XHZA 3DXMA 4UOFA 4IG3B 2W7PA 5C42A 4C8MA 4OO1J 4L76A 2W9BA 4RQ4A 3RGIA 1H72C 3BJYA 2X3DA 4NM2A 2MY8A 1C0UB 2R8IA 4LFBJ 1JLGB 5AZIA 2E2NA 4CZLA 3CCVN 5FRMA 4DV3K 5KFEA 2P9PB 1SV0A 1WTBA 4J9OA 4PGYA 8ICQA 4URGA 3Q8QB 3IKMA 2H3ZA 4GKJF 4LF7K 2CZ9A 1Q81T 3E66A 1M0SA 1P90A 4H5TA 3QERA 1WOOA 3MMJA 5J2JA 1NMDA 5HI7A 2C2MB 7ICFA 3CQ8A 2L9WA 2AF6A 5EWFA 2R4FA 3HHNB 2QWLA 3IS9B 3OV7A 2GIQA 2MXYA 2R7RA 3AVNA 3MM5B 3CO0P 2PYJA 2V69A 2AT1B 4DX6A 3SQ4A 3PNCA 4I69A 2PFNA 4PEOA 1R59O 3U02A 1ZRNA 3KK1A 4JI7J 2BKNA 2WVCA 3KK7A 2FVRA 1RLDA 4RU2A 3CPEA 5LJ5Y 9ICJA 2MQQA 4I56A 3DLJA 3PW4A 4ZK7M 3HM9A 1XO0A 1I94F 4M41A 2QMWA 3HZ6A 4EFAC 2VBZA 3D45A 2VODA 3Q83A 1JNRB 3OFEA 1AQ6A 4JI6F 2JGUA 4PRFA 1P9QC 1RDFA 4LFAK 5BJRA 5H1SV 4RBTA 4KX3A 5J2NA 4JBCA 2Q36A 2DR6A 5J1EA 2B9EA 3MR5A 1MMNA 2KZZA 3SCXA 5JMNA 5AQQA 1L5UA 3WXIA 2EEYA 2B4PA 2YWWA 4BG9A 4CI6A 2EKYA 4I64A 1WLJA 3UDLA 4KLDA 1AZSB 4NYNA 1J5EK 3R2DJ 2PKEA 1M90O 4ELTA 3T9ZA 2DBYA 3PEHA 2FC0A 1J2VA 2J0XA 5K8MA 3KWGA 1DT9A 5BRHA 2KIVA 3CIMA 4B3RK 3HTVA 1FK9B 2IDLA 4JKEA 2EFOA 2FJBB 3GB0A 2YY6A 2H3QA 1RGIA 1VOMA 1RP5A 3MTJA 4A8YA 5F8JA 1PYTA 2FSJA 3TAMA 3R6MA 3UVJA 4BRNA 2HW3A 3IM1A 4UB4A 2FVPA 1RWNB 4CZCA 2JSXA 5KFFA 4M5HA 2WW8A 4PHEA 3C2LA 4K50A 4CNYA 1OS5A 5D0HA 4KT0C 4K4VA 3OS2A 4Z4FA 4ED6A 1T3VA 5IIJA 1Q3VA 5ETPA 5IT9Y 4Z94A 5KFOA 4DR5J 3LWMA 1LWCA 4QIWF 2JEFA 3D28A 1RAOA 1YF5L 2JH1A 4FN5A 2V8HA 2K4IA 4DCHA 4DR7K 2YHXA 4B3SK 2P9EA 3MUMP 4LIWA 3OVNA 1WCLA 4FOEA 3AXKA 1FWPA 2KNJA 2O8EA 4DV7J 2PMZF 2XULA 1MROA 4OLPA 4LUBA 4TU7A 1JXLA 2ZH7A 3MN7A 2ZE2B 4IZ9A 4KAIA 4CD1A 3MAAA 1SCJB 1WHWA 4C97A 3DLGA 3AJDA 3SSRA 5C7PA 2WF7A 3G71S 4JRQA 2BANA 3D2EA 1HEKA 3K5OA 3RR7A 1UVLA 3H40A 1NH8A 3QIDA 3AAWB 4QJVA 4DR4K 4FP9A 3BSNA 2UU9F 3W65A 4YDUC 1Y3KA 4E89A 3OYHA 2K8BB 2LA4A 2UUTA 2P9KA 1RT5B 2YX1A 1APSA 3CJAA 2P9GA 4ZJQA 4YFUA 2GS8A 2QARB 1COOA 3IFEA 3QMLA 4DTUA 2QA4N 2V2VA 3HFKA 2DHXA 2VASA 1X9JA 1GTHA 1ASUA 4CEOA 2CQ1A 4GIBA 2JVRA 2FE9A 3E9PA 3S8SA 4E1NA 5AQZA 1L3TA 2WB4A 1X9SA 1F5SA 4DR3J 2D7SA 4DQIA 4ZTFA 4HI1A 4GFJA 4K59A 1FD2A 1FXRA 2XYPB 2QA1A 4I9LA 1Z00A 3KLGA 3IG1A 4ZTJA 3THVA 4ICLB 3V4IB 3OS0A 2G5HB 1WTFA 2BA9A 2RKIA 5BYQA 3N7RC 1BPEA 2W9AA 3H0MB 2NZTA 4IDHA 4DV6K 3ZCMA 2M2BA 4LF9J 4QZ9A 1RT6A 4F72A 4F8RA 4IO1A 3OL7A 5EHHA 3N6LA 1WF0A 4OZ2A 3UM9A 4F02A 1O0PA 3HHKA 2VWJA 3AVCA 3VENA 2V7ZA 4DV2F 1TKZA 4NLOA 1V4TA 2AGPA 4JHDB 1P8GA 1PYSB 3RAQA 3VQ9A 3RJKA 1B9FA 5HQLA 1NGIA 2W43A 2RUSA 1DLOB 1NGDA 3TR5A 3M1FA 2HPUA 1U2FA 1SQKA 4IOCL 5KRSA 4ZP7A 2GW8A 3SJJA 5E84A 4NLVA 5AK6A 2WZ1A 4F0HA 4M3ZA 2VG6B 1O1WA 2CRLA 2BABA 2CKWA 2FHJD 3EW9A 5KG4A 4JV0A 2YMPA 1O51A 3GE9A 7ICEA 2G13A 4L8RB 2RPIA 5AM5A 4WP8A 1C7YA 3MEEB 4IQXA 4MQ3A 1VQNS 4IL6U 4NZ7A 1A5XA 1U8WA 2K1RB 2DNMA 4FJNA 5F8GA 3ZDCA 1RXVA 4M5JA 1ZQQA 4CHNA 2JLEA 1LK7A 5AK5A 2XICA 3RJEA 4C8LA 4KHNA 5KFPA 5KFAA 3N4WA 3CC4N 3H8SA 1CLQA 5HVFA 4MTPA 4KO0A 5HVGA 4CJRA 2CYYA 2ZJQL 2ILYA 5G4DA 4QIFA 4Y2QA 4CLLA 2ESEA 3KLEA 3SI6A 1BQNB 3M2UB 2NREA 1ZQSA 3F2BA 5AE3A 2PGCA 4CZKA 5HMYA 1LKZA 4N41A 3GG1A 4DO9A 3K9JA 4LREA 3T19A 2F4VJ 1SH3A 1SWVA 2F77X 2FGCA 3NGZA 4DR2F 3ULHA 3ID6A 2JFKA 1L3VA 5MLCV 4AL7A 1C6VA 1CJKB 3VQEA 1SC6A 1UPHA 3QUTA 3T79A 3P38A 2UXDK 3WXLA 4M5DA 1QQNA 2RB7A 2VPWB 2KE7A 1U6ZA 1WUUA 5A8WB 1RQNA 4TLRA 4ZVEA 3T1YJ 3KOOA 3KUHA 3E2EA 1YJTA 2XC9A 3HMJG 4X5VA 8ICKA 3IP0A 4QZVB 1R8CA 1WG1A 4RR5A 3MMCA 2CQDA 5AZJA 1KR4A 2F5GA 3QGGA 3THYA 3LP2B 2QB1A 3U9DA 5JXSA 3IR7B 2FJEB 1BI4A 4Z7CA 4Y65A 1TR0A 4LFBF 2VWKA 5KFXA 4KMOB 2IA6A 1N32K 3MM7B 2LMRA 3ITHB 4PZVA 2EDUA 2C3MA 1REVA 3RRGA 1VQMS 4FLYA 4KN4A 1PSDA 4DQPA 4P72A 2UUAF 5CZXA 1HBUB 2J6UA 1BPYA 1X5PA 4ZPDA 1K73T 2EK6A 2ZIWA 4R0JA 4A62A 3M2RB 1XSLA 1KDHA 4Y2AA 4BUGA 3H8JA 2XHBA 4E98A 4NLSA 2QLBB 1Q8BA 1S9EA 1H2VZ 5CR4A 1N5WA 2APOA 5HRSA 2AW0A 4UZCA 3VQ4A 1RE1B 3DXSX 1MA7A 3KLFA 5KFDA 2RNEA 2UXBF 9ICFA 3DDKA 1IV0A 5LMNJ 1NOZA 1KONA 3CP8A 4IDKA 3RB3A 5F9LA 4B3MJ 1XERA 4CZMA 2ZNZA 2I8EA 3BZQA 3LANA 1K8KB 4PHAA 2H3FA 4DS4A 1PVPA 4USHA 4U95A 2BCRA 3IV6A 1LFPA 2R7YA 4OKKA 1VQLN 5KT3A 1RUSA 7FDRA 4UB1A 3C6AA 2DGXA 2YHAA 2BJDA 3IM8A 1MU2A 4B9SA 1IM6A 1VQPS 3QNOA 2LSNA 1S1VA 2B9YA 1IUJA 3ZO7A 2W8KA 2IFXA 2UUBJ 1XI1A 2H48B 3WQTA 4ECVA 3CPWR 2MQLA 2D3ZA 3DLRA 3THXA 1IKYA 5KL8B 2CN1A 3TZZA 1Y00A 4P10A 1RT4B 2DWQA 1A6LA 3MDQA 3IR6B 1ASVA 3TRGA 1KAZA 3JSBA 3WK7A 2MUTB 1YGYA 2ZIVA 1RB0A 5EE3A 4WJ3B 8ICLA 1NSQA 2ZNYA 2F1FA 2V2ZA 1Y9OA 2J7KA 4TURA 4H5VA 5A6WA 2WVFA 4X64J 2BW7A 2PEBA 3PIPQ 5BR8J 1WSEA 3BQ7A 2V8VA 3QLHA 5HMMA 2PT0A 1CEZA 9ICVA 5CYJA 4NCAA 1S8OA 1FE0A 4WQ5C 1XS9D 3RH5A 5CEHA 3LDSA 4K25A 2HBMA 4YHHK 5K9FA 4JI1F 3SI8A 7ICIA 3D2FA 3O1WA 3O4WA 1IVZA 4ISGA 3GJTB 9ICSA 4K4GA 4U7BA 3UKUA 1TUUA 2BBEA 5B8HA 2DTJA 1N36F 2AJ4A 1LNQA 3FEZA 5LJWA 4I29A 1DK2A 1IBKJ 1EQ0A 2RRAA 5ELZA 2NV3A 1HIWA 3RBDA 4ILHA 3S7RA 4MAKA 2B21A 3AY9A 1TVRA 4X62F 2HQIA 3CJ3A 2O8DA 2BKPA 2QI2A 2Y8YA 3MUVP 2G8KA 3I56N 2ZOMA 3VQSA 2CH5A 1JN3A 4B9LA 3CG7A 3H7IA 4JI4J 1HPZA 3MXMA 3LDOA 2JR5A 5KFUA 3AFGA 2DFHA 2RHKA 2LXUA 3ZD9A 4ZHRA 3RAMA 1KP6A 4M7YA 2HBQB 5HQ8A 2AYGA 5CA5A 1J6ZA 5E33A 1SH0A 1WELA 4DTPA 3HO1A 5ALJA 3KNGA 4YDDB 1T6DA 3NRBA 3MC1A 1S9GA 4A8WA 2UUCJ 4BS2A 3ZT2A 2XLKA 1CLFA 1M1GA 3PIPL 4F0KA 1KBUA 4I6WA 2ADBA 3R5DA 4BACA 1Q7LB 4LF1A 2LA6A 7ICHA 1QHTA 2EG1A 5F0WA 3ZSZA 4ZPBA 2DB1A 2W3RA 1U48A 1J53A 1U7LA 4DR3F 4F4WA 4K4ZA 4O4GA 2AMCB 5T7LA 1IO2A 1UW4A 3K2PA 1S1WB 4BRCA 1L8LA 4FZXC 3H8YA 5GADI 4CHQA 1CZ9A 2P66A 2ISPA 1VJ5A 1YK9A 5AKXA 2Q1NA 2QV6A 2KOBA 5AKYA 1Y3JA 1BL3A 1W2BR 1U1QA 1NJYA 4MMOA 4Z2XA 2F9JA 4X4TA 3QWUA 3ADAC 4NL9A 4FYWB 3VCBA 1HNZF 2HOIA 2DJWA 2O8CA 2D8CA 3LWLA 2KT3A 3DMJB 3UDCA 2O4GA 4N8OA 1L3KA 1T11A 3QU5A 5AQLA 4FZVA 2MKSA 1VLOA 4PQUB 2X1BA 3OVSA 4CGHA 4NXMF 3T6BA 5AJ3K 5CHIA 4PY5A 2A1BA 4M47A 1WEYA 2FHMA 2Q4TA 2MKKA 3A3PB 8ICSA 1U1PA 1DTTA 1QVGR 3ZZTA 4EZ9A 1RAGB 2AIRB 4EFHA 2V4QA 4DV5J 1J2MA 3QT7A 4DFKA 2L5YA 2H3IA 1YITS 5DDMA 3IBPA 2V5HG 1FRKA 1UEUA 5F0XA 2MYFA 2HHXA 3OBIA 2XYGB 2AYBA 2OMOA 4DV1F 5AM1A 1M90T 1SGGA 1H98A 2EG2A 1KFDA 2RRNA 1GO3F 3FE1A 4LF5K 1OW5A 4F2SA 5IIMA 1FERA 2HQGA 2R2UA 1QAYA 2E4LA 1HYSA 4FYYB 2VOOA 5BPMA 3Q8SB 4CJ4A 2EK1A 3OXGA 3QINA 4I4BA 3ALRA 1ZM4A 3BS5A 1HI1A 3L6QA 1YJ7A 3QESA 1GOCA 3UW1A 4DCJB 4O3PA 1X6JA 3VAJA 3Q8PB 2DR5A 4C80A 4C0OC 2MKIA 3KZIU 3SPZA 1U24A 2CPDA 4CJEA 3E58A 1ZQDA 1GMWA 3P3DA 2VG7B 9ICPA 5EX3A 3VQTA 4NLNA 3RU0A 3UFCX 3MMAB 1DRGA 3WBZA 2JVOA 4OJGA 2GH1A 1Z19A 4KLHA 1W26A 2Q0UA 2NO4A 1WSGA 4FF3A 2FGOA 1RCXB 1TL3B 1DGJA 4OYOA 5HHIA 1FO1A 4ZPTR 4Q0BB 1XMOK 4FWSA 1OY8A 1FKAF 4WFYA 4KQZA 2OEHA 1UKUA 2VQEF 1XN9A 5GTIU 4YOWA 1YTUA 2N4DA 1UW9A 2F40A 1VBXA 4DMNA 4TY8A 4Y2JA 4USTA 2NUUG 3NDKA 3OTOJ 5A0YA 3QAEA 1ZPWX 3V9ZA 1C4CA 3DOLA 1PG5B 4O4RA 1N5VA 2WONB 4K4UA 4LR7A 4YXJA 2ZOGA 2FY8A 5DLGA 3TKAA 5KFCA 1KDNA 1SC3B 4NMLA 5ALUA 3WX4A 2ZQBA 3G71N 4MEXA 3L9ZA 1TV6B 1RBLA 3OYDA 4NXNK 5KFRA 1JLQA 1RBUA 3C1ZA 4P0PA 3NGUA 3FZHA 9ICRA 2KJVA 2IHMA 1TKXA 5A2QO 2I5HA 4F4XA 5ALFA 3NGRA 4UAWA 4CGIA 3AO5A 2H3EB 2WTUA 5FRNA 4BE2A 4CJ3A 2AEJA 1R27B 3OUYA 3W1YC 3QYPA 1RT2A 4CEQA 3F56A 3OHAA 2GTDA 5I3UB 2QKBA 2P6SA 4CO2A 3PDNA 2V94A 3AVIA 1BIZA 3DXMB 2HVIA 5C42B 2EAPA 4QIWD 2W9BB 2Z56B 2F2AB 2ASLA 1IR1A 5BOMA 2ZIUA 2MQ8A 3NL0A 5AZIB 5GINA 3GJQB 3LPEA 3PR4A 3CJRA 1KLNA 4RPXA 3H0RB 4I6YA 2CWKA 3RMCA 1PBAA 1HQ2A 3U3GA 4F3TA 3T41A 3OTEA 1RT7A 2PMZD 2LEPA 3IWXA 3GR1A 4JNEA 4EP5A 2D1CA 1UFLA 4U7UD 4BRAA 4IRKA 4OIXA 3DNCA 3UD5A 2ZITA 4GXIA 3IR5B 2A3ZA 2LEAA 8ICZA 5MAOA 2XHWA 3NS1A 4CK2A 1F9HA 4KI4A 4ZLNA 1HHTP 3UMCA 3J7Z5 3Q8RB 1H38A 3D0IE 1VC5A 1UPMB 4D3GA 4AQYJ 4KGZB 4NLRA 1MW7A 1F44A 3DFEA 3CTRA 3FZMA 1KEJA 2NYIA 4RWWA 4HDHA 4YOTA 4B1VA 2FJWA 2KFYA 2MQMA 3FBFA 2ZVSA 1JL2A 3KK1B 4BY9C 4EYIB 2AP1A 4Y2SA 2G1HA 3AGRA 2E2PA 5FLXU 1ZD5A 5AM2A 3KKSA 1A6SA 1KVBA 4UY8O 4XRHA 1ILYA 3TO8A 2MZTA 1L7OA 2IM0A 2MY7A 3PFOA 2ZFHA 3D6HB 1VQNN 4ZH4A 1GEHA 5KGXA 1OUQA 2Y0BB 5KFLA 4LRFA 3BO3A 1NSAA 5J2NB 4CH0S 5KT5A 2K89A 1JLCA 3VEXA 1UWAA 4W92B 5J1EB 1VDVA 2HSTA 3T1HK 4X4UA 1OSCA 4RQ6A 2QO3A 4O3SA 3RB0A 3GIRA 2QLJB 1X5OA 5BR8F 1MN9A 4CESA 4FWRA 4O3RA 4OKEA 4F4YA 1XR6A 1EWRA 4PG6A 4MFFA 4UUXA 4JP8A 3DLBA 1DQ8A 4FYDA 1UEVA 1ZZFA 2U2FA 5T7BA 3Q2SC 3DRXA 3CF5Q 5DG9A 2YH0A 4P73A 3W8PA 2KVIA 4KHPJ 5GAGI 4PPZA 3B6OA 4Y2UA 2R7UA 3GFKB 2QSFA 2V7YA 4CJLA 2W2OP 1ZA2B 1IBMF 5BOLA 2EX3A 4DR6K 1FKPA 3TAMB 1IBKF 3UVJB 4JI0J 1VSFA 4Y3CA 4KH6A 4A57A 4IJAA 1RWVB 2B6GA 3VGUA 1XSNA 4BGBA 3LDPA 2IIHA 5DGAA 1S7IA 3M1VA 2I1RA 3VGLA 1T02A 4KPYA 2RP5A 1JLBA 3M6WA 2ZH3A 4JI4F 2MSNA 4PKIA 1I5OB 2MZSA 4M5NA 5J2QA 5AI9A 3GZ7A 4DCOB 4HUGA 4I2AA 1FA0A 3O44A 5I9EB 4F91B 2PMHA 1D9DA 2EXUA 2D41A 2G4BA 3ZSXA 1U6BA 1CRXA 2P6RA 2W42A 2I0XA 3WKEA 3UD3P 1LVHA 4ED2A 1GMUA 4DV3J 3TFSA 1S4FA 2I38A 3I96A 4KHWA 1MA9B 4J9RA 2O8EB 4LVOP 1VQMN 2E29A 1KOOA 1MROB 3BM7A 9ICIA 7AT1B 3DLGB 2DIVA 2JWKA 1QTNB 1T9UA 2BANB 4Q2LA 4YR3A 3D2EB 1FWKA 2ZM6K 3AU6A 3CF5L 2VDHA 2K8GA 4NO7A 2IVFB 4DFDA 3HX9A 5J0YA 2OZMA 4ZLPA 2YKAA 2RF2A 4HCBA 3WNEA 5GVQA 2MZJA 4WZMA 2QA4G 4CO4A 3CCQS 5IWAK 3CERA 1BMQB 4DU4A 2I9SA 2E3TA 4EX6A 2AV5A 4RLEA 4AYBF 1AROP 3NRZA 5IM0A 5LXRA 1N62A 2E9RX 1FFUA 1WAFA 2OIHA 4OJ5A 3AVMA 1RBAA 2RU9A 1TL5A 3TZXA 5AK3A 3DCAA 2V6AA 4LQ9A 4ID1A 2AJ1A 4O5KA 3UN3A 4ID5A 3CT9A 1Y7PA 3FSYA 5EVZA 5B0DA 3J7ZO 3TAGA 1Z00B 3KLGB 5C5JA 1SB6A 3IG1B 3CUNA 4LFAJ 1BISA 1K8AT 1VQPN 4QYRA 3ZT1A 4BR2A 2RKIB 5KFTA 3OYMA 1CJUA 3HF5A 5ETSA 2IM2A 3IUCA 4LRBA