3PX4A

Crystal structure of bacillus dna polymerase i large fragment bound to dna and ddctp-da mismatch (wobble) in ajar conformation
Total Genus 191
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
191
sequence length
579
structure length
549
Chain Sequence
KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords DNA polymerase I
publication title Structural evidence for the rare tautomer hypothesis of spontaneous mutagenesis.
pubmed doi rcsb
source organism Geobacillus kaustophilus
total genus 191
structure length 549
sequence length 579
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2010-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3px4A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 3px4A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3px4A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3px4A01
1XHXA 3TARA 4ED3A 2JGUA 3ZDBA 3HVTA 1JIHA 1T3NA 1ZBHA 3VQ8A 2UVRA 1LWFA 1ZQTA 4TURA 3C94A 5KTQA 1I3AA 4F5OA 3AUOA 2PI4A 8ICQA 1WSJA 2YNIA 3V4IA 4DOBA 3AA4A 1IH7A 4FW1A 2X74A 2KN7A 3K5OA 2WONA 1ITGA 2DY4A 5F9NA 3QESA 7ICGA 3SV3A 7ICVA 3V72A 4EZ6A 3QNNA 1B9DA 1FXXA 4KHQA 4RQ1A 4I9QA 2ASDA 4LZDA 5IIJA 2O4IA 9ICTA 4BACA 1RDCA 2P5OA 1NK7A 4I2DA 2ATLA 1RDAA 3ZDCA 4NCAA 2JLEA 4YNQA 5KG0A 8ICRA 1NK8A 4N56A 3NGZA 3RJFA 5KG5A 3QETA 4CJKA 2YKMA 5E41A 4RT3A 5KG7A 3LAMA 1D8YA 3EZ5A 1H38A 4O5BA 3TFSA 2IHMA 4C8OA 1BPBA 3LWMA 5KFRA 3HPHA 3VQ9A 3DLRA 3JPOA 3BQ2A 5CA7A 5J2QA 4CJRA 4MF2A 2XY7A 3OJSA 3QEVA 4FZZA 8ICTA 3O4NA 4YR0A 2D5RA 1B43A 1S9FA 4DTMA 9ICPA 2F8TA 1RDBA 4E7IA 1S77D 3RJKA 2HMIA 3UXOA 1C1CA 1U48A 5IIMA 9ICCA 3JPSA 4IR1A 2R8HA 4FS1A 5KG1A 2UVVA 1IO2A 3OS0A 1S97A 4PPXA 4KLSA 4FLXA 4ED0A 1KFTA 2BQ3A 4M3TA 1LWCA 3QNOA 4LZGA 3Q8RB 3TI0A 5KT5A 1RTDA 4EYHB 1QSLA 2BCRA 3OYBA 3V6HA 4O0IA 8ICNA 1HNVA 4TUQA 3MR3A 4QWCA 3TAPA 1GOAA 5J0QA 3BQTA 3HWTA 9ICUA 9ICWA 3C2LA 2NRXA 3L3UA 1BPZA 1BL3A 4IRDA 2W8LA 4BDPA 4PUOA 4JUZA 4DU4A 4FJ5A 3GIKA 4KHYA 4PGYA 4Z0UA 4XRHA 1LWEA 3KLEA 3MAQA 3AA2A 3KHHA 1VSLA 4AHCA 3V7LA 3RB6A 3SV4A 5DMRA 4K8ZA 5KFIA 2BKEA 2X78A 3UXPA 1SKWA 3JPPA 1O1WA 3G0ZA 2BCQA 3ISCA 4FK2A 3ZSZA 1RT7A 4W5NA 2E6MA 5J2GA 2X6SA 4RNMA 9ICXA 4CGDA 4FJ7A 9ICQA 4I2EA 4YMMA 3CG7A 3LPTA 1A77A 1VSKA 5J2EA 1K1QA 4B9NA 3HP9A 4BWMA 3VQCA 4CGFA 2XRIA 2F1IA 1QHTA 3ALYA 2R8IA 4FJKA 3LWLA 4I28A 1D8LA 4F50A 4I2CA 2HW3A 1ZQEA 1Y88A 3ASMA 4KLLA 2KZMA 4KLIA 4I9LA 5DB9A 4F5PA 7ICFA 4QZDA 3TR8A 5SWMA 4RNNA 4B9SA 4FJ9A 5HNKA 2FMPA 4HYKA 3OYAA 4O3NA 3GQCA 4FBTA 2G8WA 2OPSA 3M8SA 2ETJA 5L1KA 4YR3A 3KLHA 1HRHA 4CJSA 4CCHA 1TV9A 4CJFA 3VQAA 3C23A 5KFDA 4HVJA 4JWNA 4GVMA 2QXFA 3KIOA 5CYQA 4KLGA 3DOKA 1YT3A 3OYDA 4QOZB 3B6PA 4DG1A 2VA8A 4M3YA 5KT7A 1ZYQA 1WCLA 4M9LA 4CEQA 3IM1A 5KT3A 4KRFA 1SL0A 4KLTA 1C1BA 5KFSA 4CHZA 9ICGA 4DSLA 5KT6A 2OWOA 4PGQA 2KZZA 5KFBA 4UBBA 4Q8EA 4XUSA 4LSLA 7ICKA 4C8NA 4DL5A 4PY5A 4Q44A 1TV6A 4QZBA 4M9GA 2HHQA 3QEBZ 4AH9A 5FRNA 3AVLA 1A5VA 4QW8A 2BPFA 3C95A 3OYJA 3S3OA 3ZD8A 4M0AA 3LDSA 2IA6A 3ZT1A 1ZQGA 1L3UA 4DSEA 3P1GA 2XC9A 1SV5A 3WNHA 3PW7A 4RW4A 2C2RA 8ICUA 4KLMA 3AVFA 3ZSQA 2DPJA 4RQ4A 1SL1A 2UVUA 4FVMA 1DTQA 2PFOA 3NE6A 5J2KA 3V81A 2P6RA 3ZT2A 7ICMA 1UOCA 1VRUA 2BGWA 2VWKA 4IR9A 5FROA 1S6PA 1R0AA 2QK9A 4YMOA 4B9MA 3HT3A 5DLFA 2C22A 3T5LA 3H8SA 1TK0A 2DPIA 1TFRA 2BCUA 1EETA 2OPQA 5J0YA 1I39A 1VSDA 3NAEA 1T8EA 3O3GA 2JEFA 1LAVA 1S0MA 4RW6A 3LZJA 5C24A 2I9GA 2ZUDA 4P4MA 5D4BA 2QKBA 4FJMA 2P51A 4E7HA 3H40A 4E89A 2DFHA 9ICOA 2AU0A 5J0RA 1BPXA 1TVRA 2B4JA 3M8QA 4B3OA 4F5NA 1WAFA 1SUQA 4FYDA 3AO2A 4ELVA 3U3YA 5I3UA 4GMJB 4L8RB 4Q43A 1SZPA 4RUCA 4CFDA 3DRPA 2XGPA 4Z4IA 5HROA 2BANA 4BWJA 2A1RA 3MBYA 3AO1A 5KFVA 4J9RA 5IIIA 3DLBA 4TUPA 2XGQA 4LVSA 4IQUA 4FZXC 4Z4EA 3VQ6A 5KGWA 1REVA 2DFFA 2KQ2A 4FLVA 3GV5B 3ZCMA 2OA8A 4I2JA 3OYEA 3DRRA 4CHNA 3JPNA 2BE2A 4DTOA 3K58A 2RF2A 1BQMA 3ZSWA 3RB0A 3KHRA 1KVBA 1NKCA 4MFBA 2ASJA 1U9LA 5J0SA 3ITHA 1NJZA 2ZQBA 3QIPA 4OJRA 4R5PA 1RBSA 1KTQA 3NDKA 1RTJA 9ICHA 2NRTA 4MFAA 4OLBA 1TL1A 2IC3A 5CR0A 2BQRA 2G8HA 2YNFA 4JV0A 3A2FA 4EP4A 3AVIA 5EU7A 5HRNA 1IKWA 4F5QA 4FLWA 1ZQMA 4M3XA 1RXVA 4F3TA 3PW0A 4ECSA 3G6VA 3AO4A 4AHTA 2JEJA 3B0YA 1TKXA 4DTUA 3QERA 5J29A 3VQBA 2VG7A 4YVZA 4DL3A 2FLLA 1JLQA 3GV8B 2OPPA 5J0OA 4CJUA 1T7PA 3KD1E 4O5CA 1X2IA 4KFBA 3AVKA 3QLHA 4ED8A 1F21A 4DSFA 3KLFA 2EHGA 4N47A 4QWBA 3EW9A 4YP3A 4PHEA 2HHXA 3N4MB 4ZTJA 3CYMA 2FBXA 3B6OA 1S76D 3T19A 4TUSA 3HK2A 4B8CA 3T1AA 1BHLA 1KEJA 1XI1A 1JXEA 9ICLA 5K14A 4CIFA 4AHVA 3OYIA 1ZQBA 5BPCA 1S1WA 5J2FA 1HQUA 3V1QA 1UT8A 3SPYA 4DMNA 3PW4A 3SQ2A 5HP1A 2HVIA 2B6AA 1TL3A 1HJPA 5CY4A 4Z4CA 1S0VA 1KSPA 1S6QA 4ZTFA 3L2VA 3OGUA 1SKSA 2D0CA 3MGHA 1RTHA 4PHAA 4B9LA 5DQIA 4M9JA 4RQ0A 3D0PA 1HPZA 4EBEA 3C6UA 4CK3A 1HJRA 4NLZA 4CJ5A 5CHGA 9ICMA 4O5EA 4GXIA 5FDLA 1S1VA 4H4MA 3NGIA 1IKXA 4JV2A 3PX6A 1YTUA 7ICIA 1VRTA 4QZHA 3I0SA 2J6UA 3LP3A 4KTWA 5KFQA 3AU6A 4Z6CA 1LV5A 4UAWA 4CESA 4QW9A 5J2AA 1KRPA 9ICRA 2FMQA 3H4DA 1EXNA 3V7KA 3V6DA 3HPGA 3S9HA 4W5TA 3L8BA 4NCBA 2ITGA 3PY8A 4E3SA 3O4QA 1TKTA 4Q5VA 4J9KA 4ZH4A 3SPZA 2G8KA 5DLGA 5KFCA 4ECXA 1TAUA 7ICTA 5F9LA 5HBMA 1RPLA 1XO1A 2FC0A 4HUEA 1ZQVA 5EWGA 2XCAA 4F4ZA 3ZD9A 1WNSA 3I8DA 2XCPA 1IXRA 2NRWA 1A5XA 4CJEA 3VQPA 4BGDA 4LH5A 4FJHA 9ICFA 4OKEA 3C21A 5DDMA 4M04A 3SQ1A 1K6YA 3QEPA 4B9UA 1LW0A 2H5XA 4TQSA 2D0BA 4ELUA 1EXQA 4OLAA 4J9NA 4DSKA 4CHPA 3OYHA 5HMMA 4MF8A 1WSIA 1UT5A 4AILC 1BCMA 1EX4A 2W9AA 2FBTA 1UA0A 3QEXA 5KI6A 2C28A 4DSIA 4AHUA 4J9LA 3RBDA 2B5JA 2ZJ8A 5HLFA 2HNDA 3S3MA 4E1NA 9ICNA 1QQCA 3HL8A 3AVJA 4R64A 4ED6A 3MGIA 2ZTEA 3GDXA 4O55A 3UIQA 3PW5A 1G15A 4JLHA 1XC9A 4N41A 4Q8FA 1WSFA 4F4WA 4J9MA 4YQWA 2IHNA 2P6UA 4KPYA 4TSXA 3JPTA 4LH4A 4FXDA 4NY8A 7ICUA 7ICJA 4DL6A 3V1RA 4RQ3A 3SI6A 1RCHA 3ISNC 1KFDA 2PZSA 4O3OA 3JSMA 2Y1IA 1ASWA 3QO9A 4FJLA 4J9PA 2PY5A 1WSHA 3ORYA 4I27A 4E7JA 4QZEA 3RH4A 5KFFA 4NYFA 5TZVA 1RT3A 3KHGA 7ICSA 5HMLA 1J53A 4PHDA 1RT6A 4Z4FA 4KB0A 4YG2A 4DFKA 4DS5A 2XHBA 1RXWA 1NJYA 1FK9A 3RAQA 3CFOA 1A76A 5IIOA 4HCCA 3RTVA 5DG7A 4DTXA 4PH5A 3ZDAA 4KTZA 4KMUA 1ZQZA 4BDZA 2RPIA 3RJGA 1RBUA 1J54A 3T5JA 4F4XA 1WN7A 3ISBA 2R8KA 4O4GA 4O3RA 5KFAA 2ZTDA 4YR2A 4CJLA 4H4OA 1KVCA 1ZJMA 2YHAA 4O44A 4KLFA 4ECRA 4CJWA 3TAGA 1L3TA 3NF8A 4M47A 2HNZA 2XY6A 3MECA 3VA0A 4QZGA 1HUOA 3NF6A 1CUKA 1MQ3A 3IS9A 3MFIA 3E01A 1ZQQA 4DU1A 1ZBIA 4JWMA 2VG5A 3U3GA 1JXBA 2E4LA 3UQ0A 1HYVA 2HVHA 2JEIA 2W8KA 3SCXA 1Q8IA 4ED7A 4MQ3A 2YNHA 4IFYA 1B92A 4CJTA 4CK1A 1JN3A 5J1EA 3BDPA 4DTNA 4KLHA 1JXLA 4FLTA 5KFZA 1S10A 5EOZA 3AVGA 3LPUA 3RMCA 4NYNA 3WNEA 5DG9A 4NXZA 1JLBA 5KT4A 3MR2A 1V9PA 4BE0A 4IRCA 3G6YA 1KCFA 4GLXA 3CQ8A 5L1JA 4Y1CA 4OKJA 2I1QA 4J9OA 2NUBA 4KB1A 1B9FA 2A1SA 2RKIA 3ZT0A 1X1PA 4DL4A 4M3WA 1JKHA 1GOBA 1TK5A 4FJJA 3M9NB 4ED2A 5C25A 3Q8SB 4WE1A 3AO3A 5EWEA 4K4GA 3SQ0A 4Z4HA 2ISPA 4IQVA 3KKSA 2M9NA 2AQ4A 4DTRA 4G3IA 1WSEA 3TQ1A 4KO0A 2FPKA 1RZTA 4N76A 3MR6A 1C1AA 1WSGA 4DQSA 4GW6A 4OVLA 4IKFA 3RB4A 4CJVA 3TABA 4FLYA 2RDJA 3DLKA 3FFIA 4CJ4A 3C1YA 8ICBA 5KFYA 3GV7B 4FJ8A 3P83D 2W9MA 1LB2B 1QS4A 3L2RA 1TVAA 4DF4A 3OHBA 4JV1A 1NK6A 5CJ7A 2ASLA 3HO1A 4DQQA 3GILA 4GXKA 2ZTCA 3PX4A 1ZQPA 2F8SA 3M8PA 4CK2A 2ZUBA 2BPGA 5IINA 3PUFA 1CZ9A 3MEGA 3VN5A 3KJVA 4UB5A 3SJJA 1EP4A 4FO6A 4G1QA 4FJNA 2Z1IA 3V9ZA 3V9XA 4J2EA 3K2PA 3TAFA 3DLHA 4R8UA 2V9WA 4QZ8A 3OJUA 3HW8A 5HRSA 5KG2A 2ZJ5A 3AO5A 3C2KA 1RBTA 3K5LA 4RZRA 4FZYA 2J6SA 3K57A 1ZETA 4UQGA 3GIJA 4DLGA 4UB2A 4DL7A 3ZDDA 4I2HA 3NH1A 4J9QA 7ICHA 3MXIA 4R8UB 3AU2A 1BPYA 4KREA 3PNCA 4DQRA 3K4GA 4R66A 1JLGA 3OYKA 1JMSA 3DOLA 1DOQA 4CF8A 4KITB 3N97B 5KFEA 1ZQYA 1IG9A 4K4HA 4DOCA 3H08A 3MEDA 3H7IA 4CIGA 4E0DA 3Q8LA 3QEWA 5KFJA 5KG3A 7ICNA 1BIZA 2HHTA 2Z1JA 8ICYA 5J2NA 4XA5A 5HHHA 1RYRA 3QEIA 4MEYA 1IKYA 3ZT4A 4CEOA 5DB8A 1U49A 1VSEA 1NKBA 4UBCA 1ZQKA 1BVSA 4CEFA 3JPQA 5KFXA 1ZQFA 1IKVA 1RT1A 5KT2A 3KKRA 2MUTA 1Z25A 2VA2A 4CF1A 2E6LA 3PMNA 3AVBA 4CGJA 4W5QA 4XQ8A 1TK8A 2GBZA 4DOAA 1PZNA 2BCVA 5J2IA 3DLGA 5CZ2A 3VA3A 4EZ9A 4O0JA 1S1XA 5J2HA 1ZQRA 2MUTB 9ICVA 1ZBLA 3AVMA 4FLUA 2P5GA 2WTFA 3AVCA 1NJWA 3M9MB 4I2QA 4CEBA 1RNHA 3KD5E 1EKEA 4FCYA 3OS2A 3SI8A 1L3SA 2GUIA 5KFMA 3AVHA 1MSWD 8ICAA 4GC7A 2HHWA 4FK0A 9ICSA 3ZSOA 1D9DA 2W9BA 4EBDA 1XSPA 4DS4A 1DLOA 3OY9A 4Q0BA 2C2EA 1JX4A 4NLKA 2HHVA 4E7LA 4NM1A 3F73A 1WCNA 1RT5A 5D49A 5D3GA 5KFNA 5J2PA 1U47A 2R7YA 4LSNA 2RN2A 1S9GA 3V6KA 5J0TA 3AV9A 4UB1A 4YMNA 4UAZA 4NCGA 3SQ4A 4QCLA 5JS2A 2GWSA 2Y1JA 1U04A 3RR8A 3QZ8A 1S0OA 5CP2A 3EPIA 4DL2A 3L2WA 3HJFA 3CM6A 4KI6A 4DFJA 3T5KA 9ICEA 4GC6A 2XO7A 8ICMA 8ICOA 3TWHA 2YV0X 2G8FA 1BIUA 3RB3A 4IBNA 2IOCA 5HP4A 3RJEA 4RW8A 4PWDA 3OHAA 5J2JA 3RH5A 4M45A 1ZJNA 3HSTB 2IBKA 3K59A 4F5RA 4ED1A 4EEYA 2LYHA 5KFHA 4YD1A 4CJ3A 3CFRA 4FM2A 4MFCA 3EWAA 2VWJA 4ECYA 1QLNA 1CXUA 3MDAA 4PGXA 2HHSA 8ICGA 3C5FA 4M6WA 3G10A 4FW2A 4CF0A 5DB7A 3HX0A 3VQQA 4Z6EA 5KRTA 1RTIA 9ICAA 4ECTA 8ICXA 3RJIA 4JK1A 4DEZA 5I42A 3EYZA 4QZCA 4M6WB 4CEEA 4E19A 2FBVA 3QEAZ 4LD0A 4CF9A 1C6VA 4HTUA 3BGRA 3MDCA 1C0MA 4QWDA 5J2BA 5KFPA 3PW2A 4RU9A 1KLNA 4HUFA 5DGAA 1XU4A 3KHLA 4RG8A 4CHYA 3NHGA 3CFPA 1ZQUA 2PFQA 4RPYA 2VA3A 4RUAA 1N56A 3H8JA 4QZFA 8ICIA 3DRSA 5DBBA 3TAEA 4KHNA 3F9KA 5L1LA 4JS4A 4KTQA 4BE2A 4C8LA 4H8KA 3O3HA 2AGOA 1NOZA 4DFPA 4DFMA 1NKEA 4CFAA 3Q8KA 4DQPA 4DTJA 5EWFA 3AVAA 4DTPA 4KN4A 1HMVA 3Q8MA 3H8WA 2FPMA 5KFTA 3RMDA 4CJPA 1J5OA 3Q8PB 1ZQCA 5CWRA 1LW2A 3JPRA 4IRKA 2AJQA 3VQ7A 3ZSRA 1ZQIA 3V1OA 1UAXA 2KTQA 1CZBA 3ZT3A 4CEZA 2ALZA 2ZD1A 1CEZA 4KLEA 2PYLA 1VSJA 5J0XA 4CERA 1NOYA 2W9CA 2WOMA 1N6QA 4QAGA 3DLEA 2PYJA 4KAZA 3T3FA 1DTTA 1ZQWA 4ZHRA 4KKOA 1BPEA 3THVA 3NCIA 2R8JA 3C1ZA 4RNOA 4AHRA 1S1TA 4KLOA 5DBCA 1QTMA 1N48A 2W9CB 4W5OA 3NF7A 2OZSA 4B08A 1XS9D 3BQ0A 2AQ0A 2BPCA 3PX0A 1XHZA 3RWUA 4RQ6A 2C2DA 3LDAA 4PA1A 4CHQA 4P4OA 2V4RA 3RH6A 2BCSA 2OPRA 1W9HA 3EY1A 3SUNA 3DM2A 1VSIA 2FLPA 4QWAA 4EP5A 1ZQOA 3Q8QB 1D5AA 1TAQA 3D45A 1ASVA 4FJGA 1JLCA 4DU3A 4FK4A 3TFRA 1YVUA 3LZIA 4RPZA 4KI4A 4Z6DA 3SYZA 3OSPA 4CECA 1WLJA 3RAXA 3NGYA 4DO9A 1BPDA 4BXOA 3V9SA 2KW4A 4M41A 4KHUA 2XY8A 4FS2A 3DI6A 4Z6FA 4R63A 9ICJA 1ZQLA 4KV8A 2B21A 4KLJA 8ICPA 4BXOB 4EBCA 4CIEA 3P5JA 1UWBA 3NH0A 1SL2A 4MEXA 1ASUA 3U6FA 4C8KA 4CHOA 1RDDA 5C42A 4DWIA 7ICLA 1X9SA 4OPJA 4EYIB 2RDIA 1XSLA 7ICEA 1RBRA 3IHQB 9ICBA 4I7FA 3LALA 2IS3A 5JS1A 1N5YA 4B9VA 1C7YA 2MAXA 3MABA 4DTSA 5KFWA 1L5UA 1U45A 5DB6A 1Y97A 3RMAA 3RMBA 1ZQDA 3SUOA 5DQGA 8ICCA 4UAYA 5KFUA 4O3SA 4M9NA 5DQHA 4GXJA 4FM1A 4TQRA 3SNNA 1WAJA 4MFFA 8ICKA 1JL2A 4QZIA 2IGIA 3V9WA 2OZMA 3AVNA 5JUMA 4ECUA 5DDYA 7ICPA 4ECWA 3HPOA 5L9XA 3OVNA 3C2MA 4YXMA 1VSMA 4YD2A 1BI4A 5KGXA 3TAMA 4I2IA 3NBPA 1ZQXA 4KHSA 1BQNA 4FM0A 4B9TA 4F92B 5IIKA 3AA5X 4FBUA 1SKRA 4FJIA 1KDHA 3GFKB 1JLEA 8ICVA 1BI4B 2Q3SA 3ULDA 3OYCA 2YHBA 1VK0A 3QZ7A 4W5RA 4F93B 2PXIA 3K5MA 4HCBA 3MXJA 4R65A 5BOMA 4FLZA 2R8GA 3E2EA 3FDSA 4IG0A 1RT4A 4IQWA 4KHWA 3V9UA 8ICJA 3LANA 3LP1A 4JRPA 4YN4A 2W42A 4RW9A 1B22A 8ICFA 1CXQA 2XY5A 4F8RA 3K5NA 3VQDA 1UA1A 1J9AA 5L1IA 2ATQA 3PV8A 3M9OB 4I2BA 1L3VA 1LAWA 1C0UA 2I5JA 3MEEA 5DKWA 1CLQA 2BR0A 1YTAA 1BCOA 1ZBFA 4LY7A 4O3QA 5BOLA 2OYQA 3PO5A 5J0UA 8ICZA 3KLGA 3HYFA 3RR7A 4PQUA 1XWLA 3LP2A 4ECVA 1ZQNA 4O5KA 2Z1HA 4NLNA 3UXNA 1S9EA 4Z4GA 4F4YA 4X5VA 2PI5A 3I0RA 4P4PA 4KN7A 4DF8A 1Q9YA 3T5HA 3NFAA 4RQ8A 2JEGA 2HB5A 3DMJA 3H4BA 4CGGA 5DBAA 2NRVA 4OGEA 3ZSXA 5HHIA 3M8RA 1HNIA 3C5GA 1TGOA 2KFZA 3HM9A 3ZSVA 1BGXT 2JZBA 2O4GA 3QE9Y 1Z26A 1RBVA 3LP0A 4KLUA 1T05A 3G6XA 3VQ4A 3ISDA 8ICHA 3VQEA 2F96A 3V6JA 4K4IA 4O9MA 5KG6A 1KFSA 5CYMA 2JZBB 4XIUA 3GIIA 3C6TA 2J6TA 4KLDA 3MFHA 5J2DA 3HP6A 4ID1A 3L2QA 3OYNA 2FPLA 1FKPA 4RW7A 2V4QA 4F2RA 3QINA 1NK5A 1KVAA 8ICWA 4JRQA 3RRGA 1XSNA 1X9MA 1QSYA 4J2BA 1ZBUA 4ICLA 4M9HA 7ICQA 5KFOA 1ZQAA 3CM5A 1HYSA 3KLIA 4M3UA 4CEDA 4I2PA 2VG6A 1JL1A 5J0WA 8ICEA 4J2DA 4HHTA 3JYTA 2PFPA 4DSJA 5HRPA 1MU2A 3PMLA 3KK2A 2QKKA 3MR5A 1D9FA 4NLGA 4ID5A 2A1JA 4AHSA 1QSSA 4RQ2A 3L3VA 2PFNA 2YNGA 7ICOA 4F91B 3BJYA 3PVXA 2BGGA 5DGBA 4E7KA 5C5JA 2FBYA 2X6NA 1K1SA 4J2AA 4Y1DA 1BISA 4YFUA 1HQEA 3FYHA 3RRHA 4I2GA 1MC8A 2A1JB 3WNGA 3PR5B 4YFKA 4NM2A 4QZ9A 1TKDA 2LSNA 4OGCA 4CEAA 2YKNA 4E1MA 1T4GA 1TKZA 2IAJA 1S1UA 4M3ZA 1NK9A 1X9WA 5J2MA 3OYGA 1U4BA 3OYMA 1FKOA 3HVRA 3VQ5A 3B0XA 5FRMA 2UVWA 4CGIA 8ICLA 3QIOA 2VANA 2DFLA 3OYFA 1IM4A 1S0NA 3S3NA 2EX3A 3GIMA 4JS5A 5HRRA 2IDOA 1NJXA 5J2CA 5J0PA 5KRSA 3UPQA 2G8UA 2ISOA 4F4KA 4B8AB 3V7JA 1DGSA 3L2UA 4CJQA 4CE9A 4ECQA 1GOCA 3OS1A 3ETLA 1RYSA 1ZQSA 2FLNA 1AROP 3ZDEA 1MQ2A 4I2AA 4CF2A 1QE1A 2W9BB 2ZUCA 4N5SA 2NRZA 3HXMA 3MXMA 4IFVA 2GV9A 3OSNA 3IG1A 3IRXA 2KFNA 3DYAA 2DTUA 4C8MA 5KG4A 1Z3EB 2HHUA 4ECZA 2G8VA 1C0TA 4Q45A 1NOMA 2G8IA 4YXJA 5IILA 8ICSA 3RJHA 2F1HA 4CGHA 4RQ7A 9ICKA 3KTQA 3NGDA 3IAYA 4UB3A 1VSFA 4I2FA 1Q9XA 2Q0ZX 3EPGA 3ZSYA 3RBEA 2AGQA 5DK5A 4RQ5A 3SUPA 3AA3A 3SZ2A 3KK3A 2KZ3A 1JLAA 3RJJA 4ELTA 4BDYA 4I29A 1ZQJA 3BQ1A 4DQIA 1NK0A 4P2HA 3O3FA 4BE1A 3LAKA 4IG3A 2BHNA 9ICIA 3PO4A 1HUZA 2AGPA 3TANA 4FJXA 4K8XA 4KLQA 4IDKA 4F3OA 5D46A 2ZE2A 5DG8A 3OYLA 4OKKA 7ICRA 2F1JA 4DLEA 5KFLA 2HNYA 4UB4A 4J9SA 2FMSA 2IMWP 2D0AA 2P1JA 2ZJAA 4PHPA 5SZTA 2BQUA 4RT2A 3NH2A 5CB1A 4O3PA 2Z1GA 1T03A 3K75D 4QZAA 1S5JA 4CFBA 3UQ2A 5KFGA 3KK1A 4CFCA 3NF9A 3WNFA 1W0HA 4YCXA 1Z00A 4M2YA 4M3RA 1COOA 5T7BA 3PR4A 2DFEA 5CZ1A 1A5WA 3NTUA 4OPKA 1JLFA 3LK9A 4F2SA 2P66A 1Z00B 1VSHA 4HUGA 2BDPA 1RT2A 3TAQA 1HYZA 5KFKA 1KLMA 1ZQHA 4QWEA 4IQTA 3SUQA 1NK4A 4RPXA 1RILA 4M42A
chains in the Genus database with same CATH superfamily
3OT9A 2PFFB 3HVTA 3ZDBA 1JIHA 1VHXA 3TR5A 2UVRA 4TURA 3BO2A 3VZIA 2RRBA 1I3AA 2E8NA 5JMNA 2Q31A 5ALTA 1R8BA 1YXQA 2D3ZA 4FW1A 2WONA 1LW2B 3JAMU 2CA9A 1V4SA 5AQKA 3SV3A 4GIBA 2P9NB 7ICVA 4EZ6A 2H5EA 1F5BA 4RQ1A 5EE0A 5CA5A 4I9QA 2JX2A 2QSWA 1SZHA 3MXHP 4YB7A 4C1NK 4KHPK 5D8HB 3N01A 1Q8BA 3PJXA 2WOMB 4DR5F 2P5OA 1NK7A 4MT1A 3MTKA 2ATLA 2E5IA 4ZHRB 4NCAA 1WC6A 8ICRA 2GFFA 2K8AA 2NXCA 2CQ4A 2YKMA 3NMAA 4EAHD 5E41A 4B3MF 1U1KA 4O5BA 4PRFA 1SXDA 2O8EA 2OPRB 3TEGA 4C8OA 1FO4A 2Q4TA 3LWMA 1M5PC 4WQ4A 1YKWA 1RWWB 1VC0A 2Z57B 2ZIVA 5CA7A 3LOUA 4CJRA 5F8HA 4CJ7A 5AM4A 3QEVA 4PKGA 2QTDA 2IM0A 4FZZA 1X4BA 3D67A 2LMRA 3FCWA 2JWNA 1S49A 4C0OC 1S77D 1ZRNA 3RJKA 4HL9A 3PHTA 2DEJA 2Z30B 2ZJPQ 9ICCA 2YX7A 2B3TB 2FQQB 2L08A 5ETKA 2K60A 5KG1A 1T11A 5AQSA 2GEMA 2HRTA 4FPBA 4ED0A 1LWCA 1ATRA 3QNOA 2R7QA 4Y2VA 2HS4A 1RDRA 2B6GA 2WF6A 1WELA 2X3DA 1NSKL 3OYBA 3MEKA 3ZX0A 8ICNA 2LXUA 2OEJA 4L72B 3VALA 2XLKA 2LM4A 3CW2C 1KR4A 3TAPA 5J0QA 9ICUA 2H3GX 2CPEA 2A5XA 1NB2A 1RTDB 2WF8A 1BL3A 1Q3UA 3CCSS 5C2DA 2O66A 4BDPA 4I7FB 3A5OC 1S3XA 4DU4A 1N34F 3GIKA 2Q1LA 1I3OB 4PGYA 3B8AX 5IT0A 3KHHA 4AHCA 1Q82O 3SV4A 3O08A 5DMRA 4K8ZA 2J7WA 2W41A 2I5HA 2ZH3A 4JI6J 3UXPA 1FA0A 2BKPA 1HFEL 2F77X 4PUOB 3EO3A 3G0ZA 2BCQA 3G8QA 4FK2A 1LWEB 3AM9A 1F1BB 3I82A 4CI0B 2KJ9A 2RNEA 4U6PA 4XDDA 4CGDA 5J8YC 5AJ3F 2UU9K 2LMIA 3ZETB 1OH7A 4LR8A 3WEEB 4WU3A 5ALQA 4DV2F 2DYAA 4BHQA 1VSKA 1Q16B 1RT7B 3TWZA 4ANEA 2KVQE 2MKJA 2WBRA 1YZ6A 4L75A 1K1QA 1NGAA 4B9NA 2JC1A 2XRIA 2Q6CA 1WB9A 1BQXA 2UXDK 3PFEA 3LWLA 1Q53A 4F50A 3ASMA 1WF1A 1AQ6A 2M8DB 4KLIA 5DB9A 7ICFA 4QZDA 2QWPA 4PKDB 2NS1B 4R79A 1VC6A 4Y2UA 4FXVA 2FB0A 1VJ5A 1MDUB 4J37A 3FZLA 2D3O1 3GQCA 3C15A 3I5AA 4YR3A 4AM6A 4IO9L 4JN4A 2MQPA 5BPLA 1TV9A 2A2DA 2P9LA 2HOEA 4GVMA 2QXFA 1BU6O 3S1TA 3IUCA 4WFBL 3B6PA 5GMEA 1BOTO 1X5TA 3IM1A 2E2OA 3VAIA 4O8UA 3AA8A 2ZHAA 1YVFA 2BJ3A 3C8YA 1FO1A 5LSRA 1JJCB 3CJCA 9ICGA 3MGJA 2UXBK 4B3RJ 1QUVA 3D9BA 3C66A 2EBGA 3BO4A 3A1YG 2DXFA 5CR4A 4GVEA 2LDYA 1X4DA 4CNYA 3OXFA 2DNHA 4DL5A 2CPHA 1YRTA 1S5LU 1VQNS 3UE5A 4M9GA 1NGFA 3C95A 3RSEB 3M7VA 2LQ5A 1FDNA 3MM6B 2Z2YB 1B4SA 3ZT1A 1BWFO 1CJUA 1MWMA 2XC9A 4DUTA 1GLBG 4DUZF 4BRPA 8ICUA 1R8PA 4I4BA 4G1IA 2XZDB 3J7ZO 3QNWB 1IM6A 1URRA 1J2NA 3A8JA 4LFCF 2KRRA 2Q43A 1XNQF 1DTQA 2EAOA 2FGOA 5ETRA 1L3KA 1B0VA 4K5RA 2P6RA 3V81A 1FTCA 3CJSA 4ZDNA 1UOCA 4L3QA 3O9QA 5FROA 5D4NA 4U67Q 2Q66A 4B9MA 5DLFA 2A1AA 2DPIA 2OPQA 2IVYA 5J0YA 1Z1ZA 2CJ9A 1T8EA 2WSFC 3DDNA 2JEFA 5IV3A 1LAVA 3LZJA 2ZUDA 4LF7F 1P6TA 1RXOB 3KK2B 2Z0GA 3M8QA 5HANA 2CZVC 4NXMJ 1HPMA 4ELVA 1OH6A 3DC2A 3U3YA 3VEWA 2ZKTA 1RACB 1RLCL 3NGKA 1SZPA 4Z7YA 4C6AA 2FVRA 1TVRB 4H54A 2BANA 4BWJA 4KBIA 3SQOP 2ZIWA 5K8NA 2XGQA 3IRWP 4Z4EA 1XBWA 3KUHA 1REVA 2IAJB 4FLVA 3D6JA 2J76E 5J2MB 3TSUA 5HVFA 1PCAA 1NUEA 1FKOB 3UVJB 2R7WA 5JLFA 2M5YA 4P52A 5LMNJ 4CHNA 3JPNA 6FDRA 2ZOGA 4DTOA 2DNNA 4H0OA 1GQEA 1TMJA 1KVBA 3OPXA 3FRZA 1IR0A 2HQ3A 4OV6A 3NVKA 1U9LA 2BE9B 2CFXA 1VLYA 2IVPA 5AKIA 4J91A 1NJZA 1U02A 4B3TJ 4XH4A 2DJWA 2ROGA 3HSZA 1BQMB 2RRNA 4WP9A 1RTJA 4OLBA 2ROPA 2G0JA 3AOCA 4FZNA 2GAHC 4X4VA 3FBFA 2VUGA 4EP4A 2CQ2A 5EU7A 5EE1A 1HKCA 3CE8A 3MPUB 5ETPA 4X62J 4H5WA 4CBWA 4H0TB 1TL1B 3PW0A 4AHTA 2JEJA 3B0YA 2NRRA 2RP5A 3VQBA 2HFSA 3Q7CA 2LQBA 3MD1A 1KHVA 4JI4K 2QV6A 2QIFA 4F25A 4Y28C 2W55A 3VAJA 5BPMA 1T7PA 4O5CA 1X2IA 3SFGA 2EPIA 2MPUA 2Q0RA 2HLTA 3ENOA 3MM7A 1KL9A 3DAWA 3BSOA 1XNRJ 2FF3B 2J0QD 3EW9A 2JHDA 2HZCA 2HHXA 2WVCA 2W2QP 3CYMA 1HWKA 4DV0J 1JLAB 1S76D 2CNKB 5B7WA 2ES6A 4M5DA 4NO7A 2QA4G 1LOTB 2G06A 1AFJA 4TUSA 2HSZA 3MMCA 1RK8A 1XEZA 1DY3A 4IDKB 1BHLA 4GV6A 3EZUA 1D4XA 4GV3A 5K14A 2HBYB 1M1HA 4OZ2A 1JQGA 5BPCA 2L5YA 1SAZA 2QMUB 4KMOB 1HQUA 2JR5A 3CJKB 2HVIA 3UMGA 3UDEA 1RCXB 3JB9k 5DO2A 1S6QA 1DK2A 3MGHA 1KVJA 4PHAA 4M9JA 4WFNQ 3ILJA 3OTCA 5GINA 5BPNA 2YCHA 4NLZA 1PGZA 2MZRA 1CQNA 2OELA 3K0JA 4KIAA 4QZHA 2J6UA 3C6UB 4KTWA 3TOQA 4F36A 2X3GA 4Z6CA 1PVQA 3WHIA 1LV5A 4CESA 4QW9A 2QEXN 4QQBA 3GP9A 5KNIA 1RDUA 3V7KA 3DDIA 3L8BA 4NCBA 2NXJA 4E3SA 4QPXA 2IFXA 3O4QA 1TQLA 4F0HA 2F76X 3KZIU 4OZNA 4ZH4A 4ZJQA 3CCVN 1B7YB 5DLGA 4BRHA 2J5AA 1CJKA 5F9LA 3J80Y 3MF5A 5HBMA 4ZLJA 1XO1A 3J81U 1U1NA 5AM3A 2FC0A 3CB4A 4TXSA 1A7GE 2XCAA 3D68A 2FHOB 3CSKA 3I8DA 3IFEA 2NPIA 4NWIA 2LKYA 3VQPA 4BGDA 2VPZB 4DR2K 3TZYA 3C21A 4JI0F 1FNXH 1YRUA 4M5KA 1U2VB 3SQ1A 2XSJA 3QEPA 1LW0A 2D0BA 2G9OA 4DL0C 1U0HB 4G9BA 1DK3A 2WMMA 2J7UA 1UT5A 2ZWHA 4QNLA 2H4YB 4BS2A 2C2NA 2CPJA 3OW2M 4ZVRB 4E98A 1R8AA 2FBTA 3KD3A 3UDVA 3NNHA 1L7PA 2OHDA 3D3BJ 1XUPO 4DSIA 4AHUA 4J9LA 2ZJ8A 2V4JB 4Y34A 5HJYA 3CJ5A 3AVJA 4B1YB 2Q36A 3EUNA 3GDXA 2H54B 1G15A 2KKHA 4X4TA 5HLFB 3D7SB 3DGVA 2PT0A 4Q8FA 1WSFA 2V51B 2XMWA 2IHNA 4A2BA 5C15A 4NE9C 1FVSA 3UNGC 4KPYA 3QICA 1UHUA 2WTUA 1F9HA 5G0RA 3F2KA 2KI2A 7ICJA 4DL6A 2GA7A 3V1RA 3W9JA 4LUBA 2DGWA 3SI6A 3ISNC 3WQPA 1VBXA 1K47A 3JSMA 4J9PA 2DT9A 4ZCLA 2PY5A 1UAWA 2UUCJ 1YJNN 4CO3A 1ZM4A 2W25A 4NYFA 2ALYB 3KHGA 7ICSA 1RU1A 3RU0A 4PHDA 1NDLA 1RT6A 4Y2SA 3D2WA 4YG2A 2EWHA 4DS5A 1A6SA 1C0GA 4P72A 3JQKA 3CFOA 3EICA 2R7VA 3MCMA 5AKKA 3KHYA 1RT3B 3UPFA 3ZTQA 4PH5A 3EL2A 1ZQZA 4BDZA 5MAOA 3RJGA 1RBUA 2YHYA 3W60A 4F4XA 3D66A 4U9RA 2V2QA 4O3RA 2N7YA 2QLJB 5AXNA 4CO4A 1BA0A 5KFAA 3CD6S 1ZXIA 4YR2A 5BR8J 3A3NB 3OVSA 3H0PA 1RGIA 4CJLA 1ZJMA 3H5YA 1EJ7L 3DOMB 2WK4A 3PHEA 2H3QA 3RRKA 4KLFA 4CJWA 3TSPA 4QU6A 3NF8A 3TAGA 4M47A 2HNZA 3VA0A 1HUOA 2CQPA 3NF6A 2QRRA 3W7BA 1IIPA 2EZZA 1N88A 1ZBIA 4FE3A 1SCJB 2FTRA 4H4OB 2VG5A 3U3GA 4KH6A 2P9EA 4PG8A 3SCIE 5LM7E 2F4VK 1ICEB 2HVHA 2E9TA 1Q8IA 2GVDA 3MECB 4JNEA 4USJC 2YNHA 5BR9A 1NPKA 3OTOF 2J9EA 2MMYA 4OI2A 4ETXA 5J1EA 5ETTA 4BRIA 4ZIWA 3D3CJ 4BRNA 4GVLA 4QOTA 3BPDA 4PZOA 3GZ7A 3T9ZA 1Q95G 1V9PA 2BJ9A 4GLXA 1HKBA 1DKGD 1U0SA 4HTJA 2I1QA 4KB1A 1RAFB 1RABB 3W9HA 4DL4A 1U8WA 4M3WA 2D0OA 3M30A 2I7PA 2ZH1A 5H1SQ 2HOIA 1DGKN 1TK5A 2OSRA 1VQON 5C25A 4WE1A 2GHVC 1SGGA 2D69A 4IS7A 3AMZA 3MMVA 3NCRA 2ASOA 4PKIA 2RKIB 3KKSA 4B3SJ 2AQ4A 2BJ8A 3DOKB 4K41A 4G3IA 3TQ1A 5GMKa 4GKKF 3EVMA 3SMSA 5HQLA 3MR6A 2XG8A 2HRYA 3VOVA 3CTRA 4CJVA 3TABA 1M5VC 2AYBA 4FLYA 2RDJA 3DLKA 3FFIA 4OYZA 5A6WA 1YLXA 5KFYA 2VKQA 3GJSB 4MLHA 3HCXA 4PG5A 1QS4A 3L2RA 2RHKA 3OHBA 1HHSA 2QJ3A 3THPA 2ZH7A 2Q0UA 2IIRA 3JS9A 4DV4K 4DCOB 2GZOA 4P2SA 4DQQA 1SQGA 2MSTA 3TJ9A 3GILA 2C2MB 3PJ9A 2F8SA 2MSNA 3M8PA 4CK2A 2BPGA 4C8YA 2GV1A 3RBXA 3PUFA 1CZ9A 2GHPA 3A0HU 3ZZYA 3KJVA 2VPYB 2Z2LA 3SJJA 4CF5A 2F9DA 4FJNA 2YI1A 4QIGA 2HWTA 5CEHA 3MMBB 5J1PA 3DLHA 3E66A 3KVGA 3QU9A 4KHPF 1A0OB 4WTYA 2AYMA 3HW8A 4I56A 3PEHA 5AFUH 1NI3A 1UVIA 3M6KA 4DL7A 4I2HA 2W40A 1RE1B 3FZ2A 1BPYA 4URGA 1JLGA 2E8AA 3IWXA 3JAMO 1HBMA 4QJFB 1X4FA 1WBBA 4B1UB 3MM9B 3HHDA 4CIGA 2X7IA 2HFOA 4DV6K 4E0DA 3QEWA 4FNHA 1VISA 4BGAA 8ICYA 4QYZJ 2KG1A 4WFAL 2GOLA 2M52A 3B4DA 1RYRA 2GO8A 1KBRA 3ZT4A 5DB8A 1FXRA 5BYRA 1VSEA 1NKBA 4JI1K 4H4KA 4DX5A 5L46A 3NS1A 5J2NB 4CEFA 1KAYA 1HR0J 3KKRA 3PNIA 1QVFR 3BF1A 2QZ8A 3OBYA 1Z25A 4CF1A 2CQHA 1NG9A 1F6TA 3PMNA 4W5QA 1HBNA 1TK8A 1W7WA 4DOAA 1PZNA 5J2IA 3GYXB 1IKVB 4EZ9A 4C4SA 1N5TA 1P8GA 1ZQRA 2MUTB 1ZBLA 2PSZA 3AVMA 2WTFA 1T95A 3AVCA 2YQ0A 3KD5E 5CHCB 4UZBA 4LRAA 2VQEJ 4C3KA 3OS2A 2ZZNA 1O08A 3DLGB 2GO9A 2RF2B 3E1YA 3W3SA 2XMTA 3MPDA 1UVMA 3UB5A 2HHWA 4YB5A 4FK0A 5D4OA 1M1KO 1X4GA 2XYGB 4I2QB 4HT7A 2YKQA 4U7UD 2BOPA 2JRZA 3BM7A 1SC1B 3PFOA 4NM1A 2DHXA 3QIPB 1WCNA 3F73A 4XPCA 3MX2A 2NQPA 1R3NA 3ZZOA 1F0XA 1HLUA 5J2PA 3MMAA 3VEVA 1U47A 2R7YA 1UZHA 1S9GA 4MO5A 2ABYA 2OEHA 4UAZA 2YNFB 2GWSA 4PWWA 1RT5B 3N9UC 3TVYA 5CYJA 5CP2A 2WF5A 3EPIA 1H6KX 3D7EO 2WRMA 3C7NB 3HJFA 4DFJA 8ICMA 8ICOA 3SSRA 2UUWA 4RW8A 2JXJA 3OHAA 3W8GA 1ZJNA 1WHYA 2UXDF 3HSTB 4HHUA 3BY5A 4K0KK 1FTRA 2ZOFA 1E4GT 4OYOA 2F65A 3EWAA 2Y0SD 3M6VA 4XO0A 1HKAA 2C3YA 4KFBB 1NGCA 2ESEA 1RQNA 1QM9A 4OFZA 4PABA 2G1DA 3C5FA 5AI9A 2MKKA 4CF0A 5LY3A 4GKJK 4Z6EA 2PD1A 2CH6A 4CTAB 9ICAA 3E8OA 4ECTA 3RJIA 4JK1A 4BRDA 2PFDA 2LVWA 3THWA 1YJVA 2FF6A 4LF9J 3VTHA 2RU3A 3C0BA 4FSVA 4M6WB 3FMBA 4X64J 3GSIA 3QQCD 4Q2MA 1UW4A 3J7AP 3P8BB 4CF4A 2VQFK 4LD0A 4K4SA 1Y4ZB 4HTUA 1VQYA 3BGRA 1C0MA 3CC2S 1EKSA 4HUFA 5ALIA 4DCPB 2R2RA 4RG8A 1ESVA 3NHGA 2E5GA 1SQEA 2BKOA 3CFPA 1ZQUA 2VFRA 4BR2A 4RPYA 3G71N 3LDQA 2MGZA 4BRMA 4QZFA 2H3VA 2Y9HA 2B9WA 1FJGJ 2GWJA 4YDUC 5L1LA 4JS4A 2W2NP 4US9A 4QS8A 4KTQA 1UWAA 4HTLA 4NEYA 2KKPA 4H8KA 2UXBF 1TL3B 1OH5A 3NGTA 3UCUP 3CWJA 5AM5A 1MWQA 3DRSB 4OX9J 3H8MA 2HQDA 3AVAA 4DTPA 2Z58B 2ILZA 1GK8A 3MM5B 1Q81T 4H4MB 3KG0A 3FMWA 1LW2A 5CWRA 2CDRB 2E9RX 3VPZA 3BZKA 4B6JA 3V1OA 1UAXA 1IWAA 1CPZA 4BRKA 1KP6A 1CZBA 2ALZA 4KLEA 1JMTA 1NOYA 3ZFVA 2WOMA 1N6QA 3BS9A 3UO0A 5H2FU 2DB1A 3CIPA 4KAZA 3T3FA 4JI7J 5LSLA 1AT1B 4ZHRA 1Q8KA 1V5IB 1N36J 3MGVA 1QTMA 1N48A 4CM0A 4W5OA 3PZPA 4ZITA 5I9EB 1XS9D 2QMWA 2AQ0A 1N5QA 2HBZB 3QJPA 1HKGA 4CWBA 1RQLA 3PSTA 4RQ6A 3HRDD 3W9IA 4CHQA 2OPRA 5B5EU 1KQKA 3NNAA 4AXIA 1VQ9N 1ZD2P 5GADI 5AE2A 3IM8A 3PSPA 4QWAA 2DD8S 2XB2D 3CIMA 3UN2A 1J5EJ 3CT9A 3TFRA 5A0YA 2R2TA 4FK4A 1VQ6N 3H90A 2G2OA 1N62A 4DR6J 3VC8A 4LF1A 3V9SA 2P9PA 2VJUA 2OTJS 4FS2A 4FVUA 3QU5A 4Z7CA 1X8DA 1NSAA 2W4DA 4QS9A 2W7PA 2APOA 3FEXB 4KLJA 1IVZA 4CZEA 4BXOB 3P5JA 2VBZA 2PMHA 2WB1F 2FJEB 3M2VB 1N5XA 3NH0A 1SL2A 2AX0A 3DI6B 4B02A 1ASUA 2IM1A 1U2RA 3NG8A 1RDDA 3CJ2A 7ICLA 3SR6A 3O9RA 3IG8A 3I96A 1VHFA 3H20A 2RDIA 3THYA 4CH7A 3I4PA 1RBRA 4I69A 3QO9B 4I7FA 3CDEA 1AZSB 2IS3A 3GTYX 4YUDA 5C42B 1ZPWX 2MAXA 5GIPA 5KFWA 2CJXB 4DR5J 5DB6A 3RMBA 2O1PA 3CJTA 1RAEB 5DQGA 1VIOA 4FDFA 3T1YK 3TTDA 4H5TA 2WUSA 2KXHA 4O3SA 4YOWA 2DVIA 2KM8B 2VHGA 4JV5F 4BC7A 2CPXA 1Q8LA 1JNZB 2M4MA 3ZETA 4P0QA 2FVPA 3WEEA 4F71A 2YPZA 3SNNA 4OX7A 1JL2A 4QZIA 5HMWA 3UDCA 2H5IB 5AXLA 2OEMA 5JUMA 2FY8A 4X66K 1HNXK 2D4WA 4NLXA 4YXMA 1VSMA 1PYTA 1PC4A 3F0NA 2ZG6A 3TAMA 4I2IA 3W0LA 2RDDA 2MTLA 4JI4F 2G08A 3VF6A 4CZKA 4KHSA 3F41A 4TYBA 1VQ5S 1WORA 1G3OA 5IIKA 4FWSA 1VCTA 3O4WA 2YMPA 1SKRA 2VF3A 2Q3SA 3OYCA 3RF9A 5FPNA 2DO4A 2QEXS 2ZXHA 1GTHA 4FF3A 4IQXA 3PIOQ 4HCBA 3MXJA 4R65A 5BOMA 4FLZA 3CCEN 4CLKA 4WQ4C 4H0YB 5AFUA 5LMUK 2BUNA 3FDSA 4IG0A 1TTHB 2IVOA 4TYAA 3I5BA 2DHSA 2QL7B 5KQDA 3MAHA 4JB8B 2ZH9A 2GGPB 2JLFA 2BJDA 3QRPA 2FLOA 4BGBA 1UJ4A 2WBMA 1YJ9N 5LXRA 4O8KA 3G8SA 3ISZA 4IFEA 1IBLF 1JKHB 5DM7Q 1YTAA 5EVZA 1BCOA 4HDGA 2GIFA 4HEA9 4LRFA 3SSSA 5AI5A 3TYTA 1ZOTA 4Y2PA 1XWLA 4M1KA 1HNWK 2Y0BB 3S7RA 3QFUA 4ECVA 3MOZA 2YWGA 4Z4GA 3EXYA 2F2AB 2FDRA 4DF8A 2VONA 3KLGB 1F2HA 4RQ8A 2JC0A 4KPCA 2RMLA 3N4WA 3KXDA 5DBAA 1S8OA 4OGEA 2FJ6A 5GAHP 1IJFB 3A8IA 2G5HB 1HNIA 1S9EB 2HGMA 2V34A 2KFZA 4UARA 5D4PA 1J97A 2JZBA 4DV2J 2O4GA 3QE9Y 3MPYA 1Z26A 2RS8A 2RB7A 2D9PA 2ZM6J 1FRKA 3BGOP 3D0GE 1CC7A 2Y8YA 3VQ4A 3F56A 8ICHA 3VQEA 3EXCX 2YB4A 5GAGI 4ZCMA 3C6TA 2J6TA 1FDBA 3MFHA 3LP0B 4AYBD 1QH9A 5J2DA 4KH0B 3M3ZA 3QGPA 2DNYA 2CPDA 1PK1A 1NK5A 5FP0A 2OHFA 5CYMB 4YOTA 1YJNS 3RRGA 1XSNA 4PWUA 3J80U 5HSPA 3POTB 2RHFA 1ZBUA 3MWTA 4M9HA 7ICQA 1VOMA 3D0HE 5HATA 5BYSA 4M3UA 1QQ6A 3F53A 1R43A 4DR2F 4J2DA 3VTIA 4HHTA 4DSJA 1UPMB 1G2EA 2A41A 3QNMA 3CUNA 1B4FA 2JV3A 3KK2A 4ICLB 4JD2B 2NYIA 2QWLA 4ID5A 4AHSA 5IQQA 2PFNA 4NZ6A 3ADAC 4OI0A 2VG6B 1V4TA 2DY1A 1FXDA 2B0CA 3TUZC 3JYTB 1CVJA 2DR9A 5C5JA 3D6HB 4DUYJ 1SS6A 4J2AA 1MU2B 1RU2A 4ZIVA 4YFUA 1HQEA 3FYHA 3BGUA 1XERA 4RPFA 3MCSA 2A1JB 4A8EA 1RLDA 4MIWA 4K50A 2YNGB 2E8OA 3M2RB 4QU7A 4NM2A 4YB1P 1SJRA 4OGCA 2LSNA 1NNEA 2DPNA 2YKNA 4E1MA 1MWZA 2RHSB 2IAJA 2UYTA 3HKZD 3GOIA 5J2MA 3OYGA 1FKOA 2KYZA 3UVJA 4IUFA 3EE8A 4CGIA 3OYFA 1OMSA 1S0NA 2NSBA 2P5VA 3JSRA 2NXEA 2LEAA 3E51A 1S57A 4DUZJ 2W2PP 3T79A 3R9LA 3UPQA 2ISOA 5HL7L 3VGMA 3V7JA 2FPHX 3W5YA 3K17A 4JI8J 5AQUA 1XNQJ 3L2UA 2PMZD 4ES3A 4CE9A 4ECQA 2F1FA 4USUA 2QARA 2DXEA 2P6SA 3G25A 1U09A 3KMQA 4I2AA 1LXNA 4CF2A 5AKGA 1ZS6A 2AP1A 2ZUCA 1VQOS 4FZMA 1FRXA 1WSVA 2A6MA 4DBQA 1P8ZA 3HXMA 4KBOA 2F4FA 4IWVA 2SXLA 2M8HA 4PL8A 3IG1A 5ELZA 1V3RA 5EGYA 2KFNA 1NCLA 2DTUA 4BREA 2G8VA 4Q45A 1X5SA 4LF7J 1NHVA 2G8IA 4AFFA 4I1TA 2DK2A 5IILA 3RJHA 2KYXA 1SH0A 5HN0A 2GJIA 9ICKA 3KTQA 2KHDA 2LU2A 3IAYA 3RG6A 4OLOA 3DYAB 5BRDA 3EPGA 3ZSYA 3RBEA 3MDQA 5K4LA 3WK8A 4EFAC 3ULEA 2F4VF 3DXKB 3KK3A 2KZ3A 1J2MA 5AKXA 1JLAA 1ZBTA 4MDAA 4EX7A 3NVZA 1YG0A 4HLBA 2O8BB 4Y00A 1NK0A 4F9OA 2ASMA 2JH1A 3AAPA 3BF4A 5KAKA 3L5KA 1LOUA 4FJXA 2H4WB 5FJ4A 4IDKA 3MAAA 4F3OA 5D46A 4MKVA 3G9CA 3AGRA 1SXEA 2FI1A 4LF6K 2F1JA 2MZTA 3EGNA 5KFLA 5AZIB 5C2CA 1RDWX 3M32A 2D0AA 3PRVA 4V19S 2JWLA 4RT2A 1OSCA 3B54A 3VETA 1YK9A 4CFBA 3PRDA 1R7IA 3PYFA 2H5JB 1FJEB 3NF9A 1C20A 2Y9UA 3V5RA 4YCXA 4Y2QA 4KHRA 3MCPA 4M2YA 4M3RA 5T7BA 1NXIA 1QAYA 4RR5A 3KK1B 2AWZA 3LK9A 1UQVA 3HHLB 2P66A 3ZZZA 4HUGA 3N6NA 2BDPA 5B09A 3TAQA 3NVMA 3FCVA 1NDPA 3EM1A 2NUUG 1KLMA 1JLFB 1ZQHA 2MQ8A 4IQTA 3BZCA 4P2XA 3GSDA 1YQHA 1RILA 3P5TL 4UY8T 1XHXA 4ED3A 1ZZNA 2G1HA 4DV4F 3CI5A 5IC6B 2K3KA 1EKRA 5KTQA 4F5OA 3AUOA 1OWXA 2BJEA 3AA4A 3QFPA 2X74A 3CXCM 1UEVA 2OCEA 3HVTB 2P9SA 1VS3A 3V72A 3G82A 3QNNA 2V8VA 4FN5A 4KHQA 4ZJOA 2ASDA 2Y0SC 5IIJA 2O4IA 2OKQA 4BACA 4KGZB 4LF2A 1RDCA 4BR4A 2W1BA 3BDEA 1DQ8A 2PMWA 2O8DA 2KHOA 1FT8A 5AQIA 2JLEA 4YNQA 5KG0A 1NK8A 4WQ5A 2ZITA 4N56A 1FJCA 3TJ8A 3NGZA 1MA9B 5HQMA 1U2VA 1OYDA 3ENHA 4RT3A 1U0HA 3EE3A 3LAMA 1D8YA 3TFSA 3HD2A 1WWUA 3GFZA 4FFDA 8AT1B 2VU5A 3G87A 5ALHA 2YKMB 1QD1A 3HPHA 4FWMA 1EARA 4HI2A 4ZVUB 3H98A 4DV6F 3K8WA 4CT9A 4MF2A 3BBFA 2HSTA 4YR0A 5KAFU 2IDEA 1B43A 5CAAA 3GZFA 4LQ3A 2D5RA 1FF2A 9ICPA 4P9SA 3Q8VA 4DV1J 1BE4A 4JI1F 2V50A 1TYQB 4DOZA 3WK7A 4IR1A 4DHYA 2G0CA 5C2FA 1S97A 5LJWA 3CQXA 3ATUA 1HLWA 1S99A 2HHPA 4M3TA 3J7YI 2UUAJ 1KKHA 2WSCC 4PZNA 3TI0A 1VIXA 2MZQA 5K20B 1QSLA 3HLUA 4UAVA 4TUQA 2D8CA 2ZOMA 1PAUB 1LWCB 3HWTA 3TZZA 4C4RA 3C2LA 2MZSA 4IRDA 2LKZA 2NO4A 1H3DA 1SJ3P 4ZVHA 5LXYA 4OZ3A 1HHTP 1M5KC 4XRHA 2BACA 5H9EK 3AQFA 3E9PA 1GLAG 3H2VE 3AA2A 3HM8A 1Q3VA 4YY3K 3FZBA 4FYVB 2XMVA 3N6MA 5AXMA 2X78A 3JPPA 1O1WA 1BUXA 5D77A 4U7CA 2F8LA 3G71S 3M6WA 2G07A 3IG5A 2X6SA 4RNMA 9ICXA 4PXBA 3UE2A 3A13A 2W54A 2KHVA 4OJGA 4JI3K 4I2EA 1NNDA 4YMMA 3NWRA 3B78A 1LNQA 2YKPA 2GNKA 3F5TA 5J2EA 2AF6A 3HP9A 5BN9A 1QHTA 3A8KA 3IAS9 2CAJA 4DR4J 4I28A 2GLEA 4I2CA 2LCWA 4K0KF 4YOVA 3EVOA 4I9LA 4DV5J 4TLQA 1N33J 1W26A 2EH9A 7FDRA 3OL8A 1JJ4A 3OTDA 3EKUA 1LXJA 4FWPA 4RNNA 4B9SA 1EHWA 5HNKA 2FMPA 5F1XA 2DUYA 2GO7A 4O3NA 4F4AA 1B7FA 2G8WA 2OPSA 3M8SA 2ETJA 2HQCA 3KLHA 3CCQS 3VGSA 2KKVA 2RE2A 1B99A 3H25A 5U47A 4O23A 1B70B 1FFSB 4DCJB 2VQFF 5CYQA 4NI2A 4ZVSB 1YZ7A 3DOKA 3BH7B 3M6XA 5AZJA 1YT3A 2H3IA 4QOZB 2VA8A 4LSZB 1HNZJ 1CULB 2AIRB 1HA1A 2MHEA 4NEZA 2FVSA 5DDPC 1SL0A 2P9LB 4QS7A 2KT2A 1C1BA 2AD9A 3EUB2 1VQ9S 2ZGYA 3T41A 2OWOA 1ACMB 4PGQA 4UBBA 4Q8EA 3LP2B 4LSLA 2BM1A 4CDGA 5FPMA 1QVGR 1VQ6S 1KXPA 4QZBA 5IS2A 4OCZA 1FERA 2HHQA 3K7RA 3AVLA 1A5VA 2BPFA 1L8OA 2MKSA 3ZEUA 5KPZA 2KE7A 4NASA 2Q1NA 3UWTA 3KOOA 2AYGA 4HHHA 4M0AA 4OYXA 2DNKA 4ZVGA 2IA6A 2HVEA 3WNHA 1SV5A 2A42A 4RW4A 2YY3A 2C2RA 1DRGA 3CJAA 2RIJA 2HKEA 4KLMA 3AVFA 3QUCA 1WTBA 1QDUB 4YS2A 3CCZA 4RQ4A 2HGLA 3C29A 5AQVA 2XO6A 1LKZA 5E79U 3OTOJ 1CJUB 2CXEA 1K8AO 5FIIA 3PLAA 2KOBA 3VZHA 1SC4B 1PC5A 3ZT2A 4M95A 3R8EA 2E8PA 1VRUA 1HWIA 2BGWA 4ZPBA 2VWKA 5CABA 3TVKA 5CCMA 4IR9A 5ALOA 1QHAA 4BQLA 1DTQB 1R0AA 2QK9A 2UV8A 4YMOA 3GLJA 2QKQA 3LGHA 3T5LA 3IBPA 1TFRA 3N7RC 4B3MK 4OLPA 5AE3A 3RW7A 1JJ2R 4K8RA 3O3GA 2CKWA 4IQMA 3OL7A 3MOJB 1RGVA 5LJ5Y 4P4MA 5KAIU 2QKBA 4E7HA 3H40A 2XS2A 1RTZA 4BBYA 2DFHA 9ICOA 2PEHA 1SQFA 2UUBF 4B3OA 3NVWA 1ZC6A 4FYDA 1NSQA 5I3UA 4L8RB 4Q43A 1JALA 2FZCB 3OVAA 3DRPA 2Q97A 1QAXA 2KV2A 2FVCA 3M8QB 5ALMA 3P38A 5KFVA 3LPEA 5IIIA 4GFJA 2JMGA 3UMCA 4LVSA 2JZ5A 1O8BA 3ZNUA 1TKZB 5KGWA 3AXMA 2DFFA 3CJBA 3QBWA 3CCUS 2B0GA 1LCUA 5TKYA 3DU6A 3OYEA 3DRRA 2ZIWB 3K58A 1RWUA 2RF2A 2M0NA 4MAKA 1REVB 3ZYYX 4RQMA 3KHRA 2DKOB 1KKXA 4AYBC 4MFBA 2LYBA 2ASJA 3JXOA 2DTJA 1XC3A 1HBUB 1E3MA 5JMVA 3A8EA 5GAEI 3QIPA 2LXIA 3PIPQ 3NDKA 1KTQA 3QYYA 1KD1T 3N0VA 3L3FX 3T1YF 3R6MA 2IC3A 4WCEL 2G8HA 2YNFA 3IMXA 3I9ZA 4JV0A 2Y3YA 1WTFA 3ENAA 4WFXA 1QE1B 5HRNA 3O80A 4F5QA 4M3XA 5AKJA 1SJ1A 4ZN1A 3AO4A 2FE9A 5GTIU 3Q23A 3IRXB 2QLBB 2AJ0A 3BKUA 4BRGA 3D6RA 2CIMA 3CF5Q 2IHR1 1MNEA 4I6AA 3B6BA 1WC1A 2IDLA 2P9UA 3KZXA 3R5JB 3GV8B 5J0OA 1PILA 2HHHJ 2RQ4A 2LDIA 2KHQA 1XMOK 1AUDA 4CZGA 4JAXA 4KFBA 3QLHA 1NB7A 4ED8A 4DSFA 2EHGA 3L4PA 2IJNA 3HKZC 2EK6A 5EHHA 3DLLQ 3B6OA 1AB8A 1V5VA 5LMUF 4IO8A 4ZLNA 2RSQA 3T19A 2QA4N 1NMEB 3HK2A 1SBRA 1S79A 2VGNA 2K4HA 2ERRA 4B8CA 1FDDA 2NXNA 4OPHA 1Z4NA 3ENWA 4LFBJ 2FC9A 1ZQBA 1P90A 3A0BU 3MMCB 4H4KC 1S1WA 3LF0A 1T9XA 4EO8A 1UT8A 3NKYA 4DMNA 2PMZC 3PW4A 3BR9A 4J7CA 1TL3A 4ILLA 4ZTFA 3OGUA 2D0CA 3FLCO 5IWAJ 2EI5A 4OZ1A 9RUBA 1HQUB 1HNWF 1X3MA 4RQ0A 3D0PA 4A61A 1HPZA 3RFAA 3SAHA 4CJ5A 5CHGA 4P6QA 4RU2A 4O5EA 5FDLA 1S1VA 1Q5VA 1S6QB 4H4MA 5A2QY 4FYXB 4C11B 2LP4A 2VBYA 3W66A 6FD1A 1YTUA 7ICIA 1VRTA 2UU9J 4MJKA 4X4RA 3I0SA 3THXA 2B8PA 1RWMB 5B0BA 9ICRA 1WUDA 2E3TA 2FMQA 3H4DA 1NMNA 1UP1A 2IJFA 1YIJN 4W5TA 1MWKA 3EGZA 2YNIB 3NWGA 2UXDJ 4MMOA 1I5OB 5AM0A 3DEEA 4B3TK 2YQEA 1TKTA 3QAUA 2YY6A 3FBBA 3P45B 3SPZA 5KFCA 4ECXA 3PTWA 4USAA 1RPLA 1T44A 2IVFB 5LJVA 2YTUA 1V3ZA 5EWGA 4F4ZA 1GLJO 3ZD9A 1WNSA 4LF8K 1RADB 3HOSA 3IM9A 4OJHA 3VGLA 3DU5A 4KB7A 1IXRA 4XH5A 3CCLN 5CRXA 2ZH8A 4X62K 1CJKB 3R5GA 4LH5A 5HBMB 4X65J 4OKEA 2E5LK 4M04A 3GG1A 4HVZA 2V8HA 4ELUA 4OLAA 4J9NA 3H7HB 4CHPA 4MF8A 3OFGA 1WSIA 4GV9A 2OD6A 3W63A 2XSJB 2W9AA 4FWQA 4JKHA 1UA0A 3OTBA 4YHHF 4C7YA 3QEXA 1T3QA 3U27A 1I94J 2ZFHA 2B5JA 4CLFA 1GO3F 2HNDA 1XNRK 3S3MA 1WG8A 3MPWA 9ICNA 1TZ0A 5HMYA 1QQCA 3HL8A 4UASA 4DV0K 2Z56B 2ZTEA 3IXQA 8RUCA 5ETLA 4O55A 3PW5A 3DXBA 4JLHA 1KHWA 1BDGA 4N41A 4J9MA 1LQ9A 2NPFA 1G99A 5E7OB 3JPTA 2PEBA 4NY8A 2VH7A 4PHTX 3IA0A 3QUQA 3GYGA 4RQ3A 1CG2A 1RCHA 3QO9A 3O5TB 3LL3A 4QPTA 5TZVA 1IJJA 1YJ7A 1EAYC 5G0RB 1J53A 4US8A 3I33A 4Z4FA 1PK3A 4KB0A 4KH5A 5AKEA 1HNVB 3JSMB 2RHQB 4B1XB 3RAQA 4HCCA 1M6YA 2CNLB 5DETA 2ZWOA 3NS6A 4KTZA 5L9NA 1WN7A 1Q86O 3HSGA 2B51A 4C1NI 4C7QA 5AK4A 1KVIA 1GAOA 3FQLA 2FSKA 2B7CB 5ALRA 3TJAA 3KJNB 3DRXA 5AQHA 2R9LA 5CZVA 2ZJRQ 3I55N 1FFUA 4DPXA 3AD9C 2KXFA 2HGNA 2I7NA 4HH1A 1L3TA 2W01A 1UKUA 4QZGA 1N32J 1MQ3A 3GB0A 4Y2YA 2XVTA 4DU1A 1FD8A 2HBMA 3BGLA 1OY6A 1JXBA 3OHRA 4TU9A 1K9MT 3AB2B 1HYVA 4RCHA 1X5OA 2HNZB 4DPOA 4CJTA 4LVOP 1U1OA 3CMAN 2NV3A 4RL1A 2VG5B 4OMFG 2O8CA 3LA0A 5A8WA 1VBKA 4Y2CA 5I3PA 2HBKA 2IBOA 4LVNP 4Y2AA 1S10A 5EOZA 3AVGA 4BRQA 3LPUA 3RMCA 2GVDB 1QAJA 2YNHB 4Y0WA 5KT4A 3MR2A 4A4JA 1Z4OA 4UZCA 5J1EB 4WYBA 4BE0A 1R8HA 1F3VA 4OV1A 3CQ8A 3WIUA 2HFNA 1RA6A 5ALSA 4J9OA 2A1SA 2YTCA 3TX0A 3ZT0A 3QWUA 3QYPA 2O8FA 2GVZA 1JKHA 4RQNA 2X1FA 2GX9A 4RUBA 4ED2A 4V19X 3CCJN 3AO3A 2QLWA 3PYEA 2YVSA 4Z4HA 2IOHA 5M1KA 2KK0A 4IQVA 2MQOA 4MKAA 2XMJA 2M9NA 3QB0A 4DTRA 2F44A 2UXCK 1FX2A 1BG3A 3H1VX 2GH1A 3FSYA 3M30B 2Y1LB 2D3UA 4N7TA 5C25B 4WE1B 5GADP 5BRFA 3E3XA 4OVLA 4GW6A 4IKFA 3RB4A 1ZD4A 4WF9Q 3C1YA 8ICBA 2GMJA 1Z19A 2WF9A 3NMRA 2YKOA 4WXWA 4DF4A 4BRFA 4F04B 2AA4A 2GQCA 2DKXA 4CZHA 2OH2A 1QQ5A 2UUCK 1TV6B 2ZTCA 4BJQA 3PX4A 2YJEA 2AEJA 2ZUBA 3T7ZA 4DR1F 2E29A 4TU7A 1Q4RA 2A6OA 4UB5A 5A6PA 1EP4A 1XMQJ 4FO6A 2HURA 3V9XA 4J2EA 1DQ9A 1IV8A 3K2PA 3KKAA 4HACA 1RHKB 3GG4A 2V9WA 4QZ8A 1H2TZ 3VR1A 3KJVB 5HRSA 5KG2A 3AO5A 3IR6B 4CZMA 1K5OA 1L8LA 3K5LA 4WP3A 4FZYA 3K57A 4UQGA 3GIJA 4NWBA 2F7VA 5AQPA 3L0QA 1A9NB 4A46A 3AU2A 4KREA 3K4GA 4F67A 1Y3JA 4JD2A 4CF8A 1HI1A 1S6PB 1SWWA 3H08A 3MEDA 1Y5LB 1WI8A 2FC8A 3AQEA 1JLGB 1KOOA 5LT5A 1EX8A 3BP8A 2BW7A 5KFJA 7ICNA 2ZJQL 2P9KA 2L48A 1IJEB 3EWGA 2HHTA 4IH6A 2VBXA 2Z1JA 5AK5A 1U2FA 4DCHA 4XA5A 3FC9A 2BXJA 5HHHA 1IKYA 2DH8A 1JXVA 4FF2A 3J8AA 3T69A 4A2AA 5E3RA 3M1VB 4N8NA 1WDDA 1ZQKA 3H5SA 4ZVOB 3L7PA 5KFXA 1ZQFA 1ITPA 1O51A 3D1OA 1NM2A 2VGMA 2A3JA 1WWVA 4D3GA 2E6LA 4ZVEA 4R25A 5JJBA 3TZWA 3AAQA 2BCVA 1VQ8N 4OYIA 5CZ2A 4J8FA 1ED1A 2CADA 3MM8A 2CG8A 4ACOA 2JWKA 3PKMA 3NGSA 3U1MA 1RNHA 2KVSA 1IQTA 1DT9A 2GHWA 1HBNB 1QQ7A 2CWKA 1K44A 3SI8A 1L3SA 1X9JA 2GUIA 2MA1A 1FXLA 3PRBA 2ZVIA 9ICSA 4Y2XA 5D6GA 4NOHA 4EBDA 1FRLA 1KTVA 4Q0BA 4NLRA 2HHVA 2H1YA 1YGYA 2F3NA 4R5PB 4YY3F 5D3GA 3IMQJ 3F5AA 2CGLA 1QZ6A 2RN2A 4EHTA 2WAQC 4DR2J 3AV9A 3FVYA 4PXEA 3SQ4A 1JRPA 5JS2A 2GJFA 1PJ7A 1S0OA 3ETOA 5J2PB 4JI3F 3L2WA 1S9GB 4KI6A 2HWIA 9ICEA 1RP5A 5CE3A 2G8FA 1S72N 1BIUA 2ODGA 3RB3A 4C97A 2IOCA 3DXKA 2MY8A 5AR0A 2QE5A 2VG7B 1DRZA 5J2JA 3RH5A 3F5EA 3G96A 4BR9A 2IBKA 2HAIA 1JLQB 1PBUA 2LYHA 2J9CA 1JCGA 4MFCA 1CXUA 3MDAA 5HR7A 4RW8B 2D41A 1IQZA 1JCEA 2HHSA 3NXZA 8ICGA 4URSA 5AZIA 1UVNA 1BNPA 3KK7A 5GAGP 4B1WB 1XQIA 4EEKA 8ICXA 2XI2A 5I42A 1ATSA 3EYZA 4QZCA 3I76A 1HEKA 1R0CB 3FJ2A 3P6YC 3NASA 2MQNA 5B0EA 3I32A 4OHYA 2FBVA 3QEAZ 4CF9A 1C6VA 5EUHA 4LF5J 3THWB 1P27B 4RU9A 5DGAA 1XU4A 3MI7X 3KHLA 3U1LA 1Z2ZA 4QYZK 4CHYA 3N4QA 3WQTA 3HHLA 4RUAA 5H9FK 4DX7A 4A59A 2B6AB 1GXUA 4ISFA 4GKKK 2A1BA 2WZ1A 3L6QA 5JTIA 1HR0K 5ALLA 4NZ0A 2WF7A 1NKEA 1RTHB 2MGZB 1YITN 2Z2ZA 4DTJA 2ZUAA 1Y00A 1EQMA 4KN4A 3Q8MA 1HMVA 2FPMA 3L4QA 1Y11A 5KFTA 3RMDA 1F3FA 1IKXB 1J5OA 2WC9A 3FRYA 2KG0A 3Q8PB 3UCGA 1IV0A 1ZQCA 4UAUA 3JPRA 4IRKA 2AJQA 2C2KB 2NYHA 1V3SA 3ZSRA 2BYCA 1FCAA 3UCZP 5HO4A 4CEZA 4CO5A 3SQIA 5EX5A 2W9CA 3IBCB 4CE6A 4NV0A 1BHNA 1FEHA 1RAJA 3T1HJ 3BEGB 3THVA 3UD5A 2AJFE 3NP5A 4AHRA 4M94A 4KLOA 5DBCA 1S12A 1YUWA 1E6VA 1N6QB 2K1RA 2XTJP 3I5CA 3NGRA 3CETA 3AGKA 2C2DA 1WF2A 3JTPA 3LDAA 2BW2A 3RH6A 3CGIA 3MPVA 3K9JA 3L09A 3LM9A 3X1LB 3FE1A 2ZZTA 2R7UA 1X6IA 1R31A 1ZQOA 3KBBA 4KSEB 1X42A 2YMQA 5KPRA 3D45A 2FXUA 3ONQA 2ZBIA 3L3CA 1Q5YA 3LPYA 1Z6RA 3MN7A 3D2EA 4OJLA 5AXKA 2IIHA 5KPTA 1XR6A 4CECA 3W3DA 4KYZA 5ALKA 5CCLA 2K2PA 2LQ9A 3NAHA 3NGYA 3MC1A 4DO9A 1P7DA 1NZBA 2CPZA 1SQKA 2KW4A 1TYQA 3KNGA 3QXGA 5A0YB 3VAHA 4Z6FA 2EG1A 2VL1A 4IOAL 1ZQLA 4KV8A 2B21A 2KL8A 1SXLA 4FWKA 8ICPA 4CZFA 5LSOA 5AQOA 1KONA 2P9PB 4CIEA 4WJ3B 2I38A 4FP9A 1UTAA 3FEZA 3OL6A 1GLDG 3OR1B 4LF9K 4BR7A 2EKNA 4MEXA 1P1TA 1HI0P 2RQ5A 2QLFB 2P9IA 2DNOA 4NLUA 3P31A 3M6GA 1RBAA 1KAZA 1UZDA 2EKYA 3IHQB 2BJ1A 1NNLA 3EZOA 2FZGB 2WFBA 2YQ1A 1QQMA 3LALA 3K1RB 3SAFA 3CIZA 4OZJA 1N5YA 1WOSA 1FJGK 3MABA 1R27B 2MQQA 3THYB 4DKWA 2YWFA 3CNHA 4B3RF 2A3VA 3CJ9A 3I28A 1WSRA 4LBHA 4HWIA 2FHJD 4UAYA 1GMWA 5KFUA 1GT8A 2EC0A 4OX9K 5DQHA 1FWPA 3WXMB 4TQRA 2M3DA 2W7AA 1WAJA 1PYSB 1G1XA 1MMDA 4OI1A 2IGIA 2OZMA 3AVNA 1ZPVA 1E6YA 3VCBA 3HPOA 3HF5A 5L9XA 3KYLA 3D2FA 1BI4A 4P0QB 4HI1A 4AF1A 4IL6U 4WQ5C 1BQNA 4B9TA 3X3UA 2B4OA 2DGVA 3KG4A 3W61A 2VJ4A 3AA5X 3H5XA 5DM6L 4JI7K 4FBUA 4FJIA 3VAGA 3GFKB 1JLEA 5K9FA 4CLPA 1XMOF 3ULDA 1N36K 1Y9OA 1ZH5A 3TAMB 1VK0A 2H3ZA 3GJQB 2MLZA 3TADA 1UVLA 2KJ5A 1L7OA 2C1EB 4NLVA 4IFYB 5HVGA 1YIJS 4NYOA 3E2EA 4MIAA 5ALUA 4IQWA 4KHWA 3V9UA 4DR3J 3LANA 2ZXIA 4YN4A 2W42A 5EX0A 3G2XA 4DR7J 1B22A 3VF4A 5LL6d 1CXQA 4F8RA 2LFVA 1JLBB 2YWEA 4AE5A 4IG0B 2ATQA 1VDVA 4DV7J 1P9YA 2ZC3A 3WXLA 1L3VA 1CULA 4FO0A 2GMLA 1S59A 1LAWA 4JKGA 3TU5A 3WK6A 3CCLS 2BR0A 4QR2A 2ZNYA 5BOLA 5AI0A 3GWCA 2ACYA 3PO5A 1VJQA 4NXMF 2DNZA 8ICZA 4M7YA 1Y64A 4AQYJ 4G65A 3U02A 3H45C 3LP2A 5F8IA 2HCFA 5LL6Z 4O5KA 3UXNA 4KO0B 3TVZA 4P4PA 3BGFA 1Q9YA 1MA7A 2H65B 3T5HA 3NFAA 2JEGA 1NGIA 3Q2SC 4NA2A 2HB5A 5AQMA 1R6YA 1WYGA 5L1MA 1FD2A 5HHIA 5B0GA 2FHMA 3A3PB 4JI2K 5A2QU 4XPEA 1BGXT 2KKZA 4H5VA 2K89A 1HWLA 1SZ2A 2DCUB 4KQZA 3PSIA 1HNIB 2VD3A 2YWHA 2F96A 4DMZA 4K4IA 4O9MA 1KFSA 1IWGA 2JZBB 1Q1KA 3O44A 4KLDA 4B3TF 1QTNB 1WWHA 2DIVA 1DARA 3L2QA 2DO0A 2FPLA 1FKPA 2VJ5A 3J7YP 3F2BA 4ZVQB 2C2ZB 4A47A 5DS7A 1YVNA 2ZJPL 2NZCA 2OI2A 3C6TB 4LF8F 4J2BA 3BYPA 3VEXA 4GKJJ 5JVGQ 2W3SA 3AHPA 2VV5A 1WKLA 1Y0HA 3CM5A 1D8ZA 4X62F 4CEDA 1PK1B 1VQ4N 4I2PA 1DFDA 2H3FA 4BG8A 4WIIA 2E5LF 8ICEA 3SBTA 1R89A 3HSJA 1VQ7S 2PFPA 3PMLA 3OD2A 4KX5A 2QKKA 2QT7A 5ALVA 3Q0AA 3MR5A 3LQVA 1QSSA 3L3VA 2D1CA 2LBOA 3KFWX 4F91B 3BJYA 3L4IA 2X1BA 4Y1DA 3QT7A 3RRHA 3FM9A 4ID5B 5AM2A 3IR7B 2HZVA 3WNGA 2GUPA 1XNRF 4ERDA 3NVVA 5CQGA 4W4MA 5ALWA 5KOXA 3E9LA 3VF2A 4C4TA 4DV0F 1T9UA 1HQEB 1TKZA 5AKZA 4M3ZA 1NK9A 3CEDA 2YX8A 2IVMA 1X9WA 3OYMA 3B0XA 1RT1B 2UVWA 2V7ZA 4Y2KA 2VANA 2DFLA 1SIZA 2YBVA 1KEKA 2YKNB 3H5UA 3CMAS 5EY4A 4UUWA 3GIMA 1Y5IB 3PEJA 3ZZ0A 4C0ZA 2CJAA 2MSSA 1HBUA 1HD1A 2ROEA 2DISA 3C46A 2WW8A 5IXUA 5J0PA 4WPAA 5KRSA 4A62A 2KU7A 3T9NA 2LA4A 1AYEA 4MK9A 4B1ZA 4ZK7M 4F72A 4PG4A 4F4KA 3G4SN 4QIWF 4OQJA 4CJQA 5DZ7A 4ZPVR 4BR5A 3CDBA 2JLGA 3OS1A 3QIDA 3ETLA 1RYSA 1ZQSA 1AROP 3ZDEA 1FX4A 3PACA 1G6BA 3ALRA 1QE1A 3WKDA 3H8YA 4MDBA 3CCJS 1H2UX 3FEYB 3JS6A 2QARB 3R6GB 5IV4A 4JV5K 2GV9A 3QT8A 1HHQA 3OSNA 1QZ5A 4M5JA 3IRXA 4DCCA 2ZM6K 2PFUA 5CXTA 3NY0A 4C8MA 4FVCA 2XMMA 4OHZA 2ZH4A 1HW8A 4TU8A 1YWXA 1VQPS 4RQ7A 3IG1B 5CZXA 2HQIA 1VSFA 3Q83A 1FWLA 4X4OA 2RQCA 2AGQA 5DK5A 3HOTA 5LOQA 1YRXA 2GELA 3WU2U 5E26A 5MLCV 1RAGB 1S22A 4ELTA 4I29A 2K8CB 1ZQJA 4P2HA 1HUZA 4JKFA 3ULEB 2AGPA 4KLQA 1U6FA 5DG8A 3KK3B 1VQLS 3TACB 4X2BA 3FAHA 4PEOA 4P71A 4DLEA 4NZ7A 4J9SA 2FMSA 2UUTA 2IMWP 2W7OA 3D4JA 5E3AA 4FOEA 4OYAA 4O3PA 2Z1GA 2VASA 3K75D 1S5JA 3MAAB 5KQ8A 3UQ2A 4BRAA 1UFLA 2KVIA 2G13A 3WNFA 5F0WA 1UL3A 4A8OA 3M32B 4OL8A 2CVEA 4DUYK 3PSFA 2IOFK 1RI7A 4NA1A 1IBLK 3D6MB 2A18A 3IC1A 2DR5A 2UXCF 3NTUA 4YORA 3CJ8A 1CS4A 1OPIA 3SMVA 3WK5A 1XJWB 4R0EA 1T9WA 2I2YA 2DHHA 1NJIT 3C6AA 1ZA1B 5EDWA 1ZAVA 1S6UA 4C11A 1XR7A 2V0NA 2DL0A 3SMZA 4U67L 5JVHQ 2PAVA 3OTEA 5KL8B 5AQTA 3F44A 4U7BA 3VMFB 2AP6A 2JGUA 4X66J 1HNXJ 1ZBHA 3VQ8A 1LWFA 2KP7A 3HHLD 4HT5A 3O1WA 3C94A 1SKUB 2UUCF 1KLMB 4P73A 4WKYA 2PI4A 2YNIA 5JRTA 1WSJA 2HF4A 3V4IA 4DOBA 1IH7A 3K5OA 3KWMA 4NB4A 5TISU 2DY4A 3QESA 1RWVB 1B9DA 4JI8K 2BJ7A 4LMZA 4FWOA 4LZDA 2ZD1B 4DN0A 9ICTA 1VYAA 1VQ8S 3N7PD 3E0FA 2IYIA 4ZA1A 2K8BB 2QW9A 3DLEB 1RZMA 4I2DA 2P9SB 1NH8A 3G82B 1DTTB 5LMUJ 3ZDCA 4CZCA 4H0XB 3WKAA 2DH9A 2HFZA 4OX6A 4HAIA 3GJTB 4CI6A 3RJFA 5KG5A 4IJAA 3LDOA 3DDHA 3R2CJ 5BR8F 2DGQA 1ZAWA 3BSAA 4PG7A 5KG7A 2HWHA 5GAEP 2O8DB 1NM1A 3EZ5A 2W6LA 2IHMA 1SB6A 3IP0A 4UW2A 3CJ0A 1I51B 1RISA 5AQJA 4OJ6A 5KFRA 3DM2B 2HMPA 3VQ9A 2B4UA 4ZN3A 3DLRA 4C9DA 3BQ2A 5J2QA 3AODA 4LJMA 2BDUA 2OFGX 3EN9A 3O4NA 1UFWA 4NLOA 3Q22A 3BUZB 4K42A 5E33A 2RILA 4DTMA 1ELOA 3P5BP 4UB6U 1RDBA 3BN7A 4E7IA 2BABA 4QIVA 1RKIA 1U48A 1S72S 2O3DA 5IIMA 3JPSA 2HI0A 4M5GA 2MLXA 3SEIA 2UVVA 2MZ1A 3OS0A 4KLSA 4DZ6A 2R3VA 2J4RA 1KFTA 2LECA 2B4PA 2OTLS 3Q8RB 5EE9A 5A8RA 4NLWA 4NXNJ 4ZPCA 2BCRA 3U9DA 4IOCQ 4O0IA 1T6CA 1HNVA 4P75A 2EW9A 3MR3A 4QWCA 3AARA 3CPWM 3BQTA 9ICWA 2JNJA 2NRXA 2ACMA 2E5JA 2WW4A 1XO0A 4CLLA 4JUZA 4Z0UA 2W6KA 1OUQA 3M6UA 3KLEA 4XDCA 3NRWA 1X6JA 2PA3A 3M1YA 1VSLA 3QBCA 3V7LA 1SIJA 2CH5A 3ISCA 3LUYA 2YQ3A 3ZSZA 2OJ3A 4W5NA 2E6MA 3CERA 2C3PA 4JKEA 4FYYB 3WZ0A 4FJ7A 4P74A 9ICQA 2HFUA 3CG7A 3HD1A 4ATNA 5ETNA 3HT0A 4AL5A 2DITA 2E1FA 1U6ZA 1YITS 2MB0B 4BWMA 3VQCA 1Z05A 1GMWD 2WB1D 4LBIA 3WBZA 3ILIA 2CPRA 2K3IA 3R5CA 3VHQA 2M2BA 1N2XA 3ALYA 4FJKA 1D8LA 3NBPB 2HW3A 1ZQEA 1U6BA 2IYGA 3ICXA 1WUUA 4KLLA 2KZMA 4EMDA 2QI2A 4WFNL 3N4PA 4F5PA 2K7KA 5B0AA 3LDLA 1SJ4P 3TO8A 4JMUA 1B64A 2EFQA 4CZJA 4FJ9A 4KGVB 3OYAA 2XLJA 1VQMN 1S4FA 3M2UA 4HTIA 4FBTA 4JEPA 2QA2A 1SJFA 5L1KA 3RVCA 1JJHA 1RT4B 1F60B 4CCHA 1VHIA 3KJFB 4X4UA 2VOOA 3C23A 5KFDA 3HHEA 1RWXB 1R59O 3NNCA 3BH6B 3WKEA 2OPSB 4LBPA 3NVYA 3KLHB 4DG1A 3R2DJ 4NL9A 2CUYA 5BYQA 3D2NA 1ZBSA 2WAQF 1K0VA 4M9LA 5KT3A 4PR6A 1C0UB 2I5JB 4KRFA 4KC5A 5AKHA 4DV1K 2D3DA 3UN5A 3DGPA 3VQSA 5KFSA 5CYQB 4NI2B 4CHZA 4CRJA 5AZJB 5KT6A 4DU7A 2CQGA 1HR0F 2KZZA 5KFBA 2KJVA 3SBGA 4XUSA 7ICKA 1C1BB 3LM2A 4LFAJ 1X4AA 4IJNA 4Q44A 1TV6A 2UUAK 3QEBZ 5FRNA 2ZIUA 3CC7N 2CJBA 2HVZA 3VF0B 4QW8A 2MKYA 4LF4J 3ELHA 2AMCB 4LSLB 3HI0A 2GS8A 2XYPB 2KM8C 3J81j 3S3OA 4EFHA 4PPZA 3LDSA 3BPSP 2XBPA 3S6JA 2GW8A 4UY85 4YOEA 3P1GA 4WWSA 4F7VA 3PW7A