3PX4A

Crystal structure of bacillus dna polymerase i large fragment bound to dna and ddctp-da mismatch (wobble) in ajar conformation
Total Genus 191
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
191
sequence length
579
structure length
549
Chain Sequence
b'KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase I
publication title Structural evidence for the rare tautomer hypothesis of spontaneous mutagenesis.
pubmed doi rcsb
source organism Geobacillus kaustophilus
molecule tags Transferase/dna
total genus 191
structure length 549
sequence length 579
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2010-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3px4A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 3px4A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3px4A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3px4A01
2FBXA 3JPOA 1TL3A 8ICEA 1QHTA 4DU1A 3ZSVA 4KHNA 4F4WA 1A76A 1YT3A 2P51A 3OYFA 3CQ8A 4DEZA 3K58A 4FZYA 2ZUCA 2JEIA 5J2KA 3VQAA 1IKWA 3NDKA 4DTSA 4GLXA 3V7JA 4TQRA 4KLEA 2P5OA 4NLNA 4H4MA 4M3RA 3M9NB 3T5JA 3VQ5A 2PY5A 2KN7A 4DS5A 3SYZA 5C5JA 3T5LA 3RBDA 1NKCA 4CJLA 4R66A 5DGBA 1S76D 1L5UA 8ICZA 1ZBLA 4O44A 3S3OA 4N76A 1QE1A 1TV6A 3HJFA 3P83D 4AILC 3RMAA 9ICVA 1KDHA 3NHGA 1D5AA 4NCAA 3K5NA 2R8IA 1ZQRA 4CERA 4FJKA 2AU0A 3T5HA 1TKXA 2C28A 1HNIA 4PHPA 3HYFA 1KVAA 4YCXA 4J2DA 1SL0A 1MSWD 1RBSA 4CIFA 2A1JB 4JS5A 3KK3A 4AHTA 3HT3A 3OYKA 4DOAA 1ZQPA 5DGAA 1RILA 4FZXC 2LSNA 5KGWA 4BDYA 3RB6A 2P6RA 3K59A 3SNNA 4XQ8A 4IR1A 4RQ2A 2YV0X 4CJEA 4RW8A 2BPFA 2GUIA 3LZIA 4CGIA 5D46A 4TSXA 4F2RA 3Q8KA 4ECXA 2BE2A 5KG2A 8ICIA 4GW6A 3IRXA 1T7PA 4B9VA 3F9KA 3MEEA 2JEGA 4OKJA 4DSFA 4I27A 4R65A 1SKRA 1NK8A 3NBPA 2IHNA 4CESA 3UXOA 3Q8LA 4CF9A 3GIMA 2HMIA 3CG7A 1HQUA 3V6JA 1CXQA 4HVJA 5KFFA 4RPXA 1RDBA 4GXKA 1RDAA 4O0IA 1UA0A 3E2EA 1JX4A 1ZQOA 3QIOA 4I2QA 4KO0A 4RNMA 4Q44A 5IIMA 3AVGA 3PW7A 1YTAA 2XC9A 4KLFA 4KHYA 5J2AA 1EXNA 4O3SA 4K4IA 1BVSA 4ECVA 2RN2A 3AU2A 5KFDA 3O3GA 1LV5A 3DRRA 1N56A 3ZT1A 1XI1A 3FYHA 1BPEA 1XSPA 4F5RA 1IKXA 4FVMA 4YP3A 3CYMA 4CJSA 1J54A 3HVRA 1WN7A 4OVLA 4W5TA 3MEGA 1JMSA 4F50A 1BL3A 4KREA 4BE0A 2YNFA 2W9CA 2DPJA 3KTQA 3RB3A 7ICIA 2IS3A 1KRPA 2AGPA 1JLFA 3WNFA 3BQTA 1RT5A 3QIPA 1T03A 2XCAA 2HVHA 2UVUA 1ZQDA 4FXDA 3F73A 5KT5A 3NFAA 3KLFA 3RJKA 4NLKA 1ZQWA 4KPYA 3MFHA 3GIIA 4IFYA 1NK6A 4RQ8A 1U9LA 4PGXA 1VSEA 1REVA 2D5RA 4UB4A 5EWEA 4UB1A 1BPDA 1KVCA 8ICBA 4ELTA 3K5LA 4RNNA 5D4BA 1FXXA 4RQ3A 3SPZA 1ASVA 5HHHA 3ZSRA 1Z3EB 1TV9A 2G8UA 2H5XA 2UVRA 1C6VA 1NOMA 4ED2A 2KW4A 4R5PA 5CR0A 4DFPA 1TKTA 2W9BA 3QZ8A 1NK0A 2OWOA 3H8WA 4RT2A 3VQ6A 4FM2A 3KHHA 3LWMA 4FM1A 5BOMA 5D49A 3QEVA 3VQ8A 3VQ7A 4GXJA 4M3YA 4DTRA 3B6PA 1UT8A 3V1QA 8ICHA 2ZTCA 4CK1A 4CFBA 3MEDA 9ICTA 4DSKA 3OSPA 4JK1A 9ICRA 1BQMA 4KTQA 1HJPA 1ZQKA 4DTNA 1NOYA 3RJGA 2LYHA 2NUBA 3QE9Y 3KK1A 4FLXA 1SV5A 3MBYA 4CEFA 1S1UA 4R63A 4EBEA 4B9SA 4CF0A 1RDCA 3LPUA 1KEJA 4KFBA 3JPQA 2PFQA 3RR7A 4ID1A 4B9NA 4Q0BA 1ZQLA 1KVBA 4F3TA 5KFMA 2NRVA 4FS2A 5KG6A 4YR2A 2HHXA 3DMJA 1S0VA 3VN5A 7ICTA 5J2EA 4O5KA 4RUAA 3MDAA 2VG5A 3KHGA 4ID5A 5K14A 3EPIA 1S77D 3P5JA 3PW0A 1HYZA 1VSIA 4DL4A 4EYIB 1RDDA 3OY9A 2KZMA 1RT7A 2NRTA 2R8JA 4B9LA 2FLNA 2IHMA 3MXIA 4DQRA 3ZDEA 1XSNA 1WCNA 2NRWA 4Z4EA 3SI8A 5DBBA 4O5EA 2BCVA 1CUKA 3ORYA 2YHAA 3QERA 3OSNA 4NY8A 1C0UA 3SPYA 3GV5B 1RNHA 2BQ3A 2X6NA 5J1EA 4ED3A 3RJIA 4KLSA 3IS9A 4HTUA 5DG9A 3AO1A 3NF6A 3H4DA 4E0DA 3ZSYA 2OYQA 2BQUA 2R8KA 1ZQMA 3MR3A 9ICAA 2ZD1A 4CK2A 3GILA 5J0WA 4ECZA 1NKEA 7ICMA 4JS4A 4PY5A 1NKBA 1QSYA 9ICXA 3UXPA 3VA3A 2BCSA 2P66A 3PX0A 3NF7A 4LD0A 4KLDA 5C25A 2VG7A 2WOMA 4CHPA 4ELVA 4CJUA 4ED1A 9ICPA 4DL2A 2Z1GA 3JPTA 1VRUA 4M3XA 3SUOA 4C8NA 4JRPA 2IA6A 4CF1A 3LZJA 4B9TA 2VA8A 4DS4A 4F8RA 4F5QA 4QWEA 3DOKA 5KG5A 2GWSA 9ICOA 4F4KA 3TWHA 4CJKA 3AA5X 1JLEA 3TABA 3QEWA 4IG3A 3M8RA 5KFAA 3Q8QB 2FLPA 2Z1IA 4M45A 4DTUA 1RPLA 5L1JA 2W8LA 4QWDA 2P6UA 5KFHA 5KG4A 1VSFA 3P1GA 3H40A 3IG1A 4Z4GA 3SUQA 3L3UA 2J6UA 2IOCA 4CE9A 3C21A 2ATQA 4HCBA 3KIOA 4ZH4A 4DTJA 3TARA 1UAXA 4R8UA 4DL6A 1VSJA 3AVJA 4I2JA 1RCHA 1ITGA 4W5OA 1YVUA 3MAQA 3V6HA 4DU3A 4J9OA 1JLAA 4FLWA 1XWLA 3AU6A 1U49A 4RUCA 2ZE2A 4ECQA 1NK9A 4DQQA 4BGDA 4DL3A 1X1PA 4MF8A 3RAXA 3HVTA 3L3VA 1IKYA 4CEAA 4HHTA 4GMJB 3GIKA 1XS9D 3TAGA 2I1QA 3ISDA 4DOCA 3V9XA 4B3OA 4NLGA 5KTQA 3PMLA 3WNHA 1LW2A 5J2QA 4M41A 3KLHA 3MXMA 1S9GA 2XY8A 4AHRA 4RT3A 3SQ4A 2W8KA 2VA3A 3AA4A 1NJZA 1S10A 9ICLA 1HPZA 3NCIA 3KK2A 5KFWA 4KMUA 4JUZA 4CJ5A 4OKKA 4KLMA 5DK5A 1WSGA 1H38A 9ICKA 1COOA 1RTHA 1QQCA 4KB1A 5KI6A 3DLGA 1RT2A 1NJYA 4J9SA 4J9LA 1ZQIA 2HHWA 2DFHA 3VQBA 3GIJA 3AVMA 2C2DA 3V9ZA 3C1ZA 4YR3A 2BGWA 4K4HA 3DLBA 3KHRA 2XGQA 3AO3A 1QS4A 5J2CA 4EP4A 1HNVA 4DF8A 2ITGA 4E7IA 3RJJA 4QWAA 1Y88A 1EETA 4CGJA 1I39A 7ICPA 2PI4A 4LY7A 1BGXT 2BPCA 3ZT3A 1RTJA 2E6LA 1PZNA 2OPPA 4YFKA 4Q45A 8ICKA 1RBRA 3WNGA 4F93B 4EZ9A 4I2CA 3MXJA 4PA1A 3FDSA 5J2NA 1BI4A 1ZQYA 2BGGA 5J29A 4Q8EA 4ZHRA 4O3PA 3QNOA 1O1WA 4R8UB 1X9WA 3AVCA 3DOLA 1HYVA 3NGDA 4K8ZA 4YD1A 1HMVA 1S6QA 4GC6A 2OPSA 2W9AA 5DBCA 3UPQA 4QZHA 4HUFA 4IQTA 2QKKA 5J2GA 2Y1IA 4QZ9A 2G8VA 4M2YA 1TK0A 3LK9A 1JXEA 3I8DA 8ICTA 2ISOA 2ZJ5A 3OYIA 2NRXA 3ZSXA 2UVVA 5DB8A 2EX3A 2BCUA 3LANA 5CYMA 3MECA 1DTTA 1EP4A 4I9LA 3SQ0A 2AGOA 1Z00A 1RT6A 3HL8A 3ZDDA 3AA3A 1L3SA 4CFCA 1C1BA 1S1XA 4MEYA 3OJSA 1ZQVA 4C8MA 1L3UA 4KITB 4AHUA 4QZCA 4CIGA 4B8AB 3SV4A 4ZTJA 1ZQCA 4ELUA 7ICOA 4FW1A 4FS1A 4ZTFA 4IKFA 5I42A 3GQCA 4CGGA 3TAQA 1XSLA 4DTXA 5FRNA 1ZQAA 5J0RA 1X9SA 9ICCA 3MR5A 5J2HA 4FJXA 3Q8PB 5KG3A 4I2AA 3TI0A 4FJ7A 4YNQA 4M9HA 1D8LA 2F1IA 5DKWA 3OYCA 1JL2A 4YN4A 2XY5A 3RB4A 2X74A 5HROA 4CJWA 1FK9A 1UWBA 1ZJNA 4M9LA 8ICWA 1A5XA 4F5NA 5SWMA 5EWFA 3HM9A 5J2PA 4FJGA 3SUNA 4RW6A 4E3SA 1ZQJA 1BI4B 4UQGA 3RBEA 5KT4A 2ZJ8A 3ZD9A 1K6YA 3DI6A 1D8YA 1ZQEA 2QKBA 7ICSA 9ICMA 4P4MA 3T3FA 2J6TA 1CZ9A 3RJFA 4UAZA 4E19A 5EU7A 4CFDA 4RU9A 4FYDA 4PWDA 1VSLA 3TANA 2HNDA 3D0PA 1KLNA 3LWLA 5KT3A 5KFRA 1NJXA 9ICWA 2W9MA 4BDPA 1LWFA 3B0XA 3SUPA 4QW9A 1JLQA 4DSEA 2I5JA 4KTZA 4HUEA 1XHXA 2QXFA 4Q5VA 3C6UA 3C6TA 4CEQA 3IHQB 2ETJA 9ICJA 1Z00B 1RYRA 4KI4A 1NOZA 2G8HA 1ASUA 5KG0A 3QESA 3TAFA 1JXBA 4FO6A 4ECTA 3OYEA 4GXIA 1A77A 4Z4CA 3V4IA 4DTPA 2PI5A 4DSLA 4FM0A 3NH1A 1BIUA 1U4BA 2FBTA 3OS0A 3M9MB 4O0JA 3OYHA 3C2KA 4E1MA 4CHQA 3JSMA 4F5OA 4HCCA 4E7JA 4CECA 5DLGA 4DLGA 3OJUA 4DTOA 1L3VA 4ECRA 1ZBFA 1ZQQA 3H7IA 3OS2A 4CEDA 2HNZA 3HP9A 5KFCA 4QWCA 4FLUA 4ICLA 3OYLA 4DFJA 1ZQHA 1I3AA 3C5FA 1HUZA 3V9SA 3O3FA 3PX6A 1KFSA 8ICFA 3BQ1A 2M9NA 4QAGA 5DB7A 2G8WA 4I2IA 3QO9A 2XGPA 2FPLA 1XO1A 3EW9A 2AQ4A 4OLBA 4TQSA 3LAKA 1GOAA 3T19A 4FBUA 4X5VA 7ICJA 4H8KA 4DSIA 3V72A 4I2HA 4KHWA 4J9RA 1SKSA 5F9NA 3C23A 1UOCA 3LALA 4NLZA 2IBKA 4DQIA 4DWIA 3K4GA 1XU4A 3VQ4A 4NYFA 4M0AA 4IQVA 3EZ5A 3VQ9A 4KLTA 5DDMA 4LSNA 4DO9A 3NH0A 5I3UA 3KKSA 2NRZA 3LP3A 1HQEA 4JLHA 4I2DA 3ZSQA 4KLIA 3O3HA 4AHCA 2KZ3A 4CGFA 4E7LA 4FJNA 5CP2A 4IBNA 2OZSA 4FLTA 4PGYA 5CYQA 3OHAA 5DQIA 2FLLA 5DBAA 3OYGA 1ZQXA 4K8XA 5DQGA 4I9QA 4IQWA 1KLMA 3KD5E 4QWBA 1ZBUA 4O3QA 5EWGA 3JPRA 4I28A 3FFIA 1RYSA 5D3GA 3N4MB 4FJ8A 5KFPA 3LP2A 2OA8A 4RQ7A 7ICEA 2WONA 4J2AA 1NK7A 4KHQA 1IM4A 4LZGA 5KFSA 4Z4HA 3RB0A 2P5GA 3A2FA 1EKEA 4CGDA 4J9KA 5CZ2A 2HW3A 3NGYA 3JPNA 3AUOA 1BPXA 5KG7A 2FMPA 7ICGA 9ICBA 3RH5A 3Q8RB 4DQPA 3AVIA 5IILA 4KLQA 3H8SA 1ZQBA 1CXUA 5L9XA 1SUQA 5KFIA 8ICNA 4JWMA 5J2DA 3RRGA 3ZT2A 2KZZA 1KCFA 3QEIA 1D9FA 5J0OA 3KLIA 4M3TA 5HRPA 1BIZA 2D0AA 1MU2A 1J53A 4AHVA 3K57A 2PFOA 1T4GA 4CF8A 4P2HA 4EBCA 3TAPA 2YHBA 4EBDA 4Q8FA 3V1RA 2PFPA 2HHUA 4UB2A 5IINA 5J2FA 4CCHA 1GOCA 2FC0A 4M9NA 2IAJA 3K5MA 4TURA 4I2PA 1LW0A 4KLUA 2A1SA 1FKOA 4RW7A 1WNSA 2JGUA 5CB1A 2AJQA 3C1YA 2PFNA 1JIHA 5KFGA 1N5YA 4DQSA 4IRDA 4KLLA 3M9OB 3MABA 2X78A 3U3YA 1X2IA 5KFJA 4O3NA 5KRSA 1JLGA 3VQQA 4CJRA 4OGCA 5J2BA 1ZBHA 1NK4A 4J9QA 4TUSA 3I0RA 1NJWA 2Q3SA 3UIQA 4CHNA 4YD2A 1SL2A 3AVHA 4LH5A 5JS2A 1TL1A 5BOLA 1HRHA 5J2IA 3QEXA 3GV7B 4NM2A 4KLOA 5DMRA 4ED0A 1Q8IA 4F4XA 1TGOA 5C42A 1RXVA 4CF2A 4PH5A 1BCOA 2IDOA 3RRHA 2O4GA 2RPIA 4HYKA 4CJTA 4Z4IA 3DRPA 2P1JA 3UQ0A 3G6YA 1T3NA 3BGRA 5JUMA 1ASWA 8ICMA 5CA7A 3HW8A 3QZ7A 1Q9XA 4FLZA 5KFNA 4GC7A 3N97B 2HHVA 5KGXA 4QZBA 5KT2A 3QINA 4FLYA 5KFBA 3VA0A 5CHGA 1UT5A 4J9NA 3HPGA 3RJHA 2B21A 5KRTA 1F21A 8ICXA 4NXZA 1EXQA 3PV8A 3KLEA 5IIIA 2XO7A 3LP0A 3ISBA 4R64A 3PW5A 3HO1A 1TK8A 4NYNA 3HK2A 3RAQA 4Z6FA 1BHLA 2PXIA 1IG9A 4Z0UA 2KFZA 9ICFA 3MGIA 5EOZA 1CEZA 3EYZA 3Q8MA 4N41A 4Z4FA 4EP5A 1RBTA 4LH4A 1B22A 4DL5A 2X6SA 3RMDA 2GBZA 4CIEA 4I7FA 5KFTA 3BJYA 3DLEA 4DLEA 1LAWA 1S1WA 5J0XA 4Q43A 3ASMA 5CWRA 4C8OA 2BPGA 2MAXA 4JV2A 9ICGA 1C1AA 4OJRA 4CJVA 4KB0A 9ICQA 2MUTB 4CHOA 2FPKA 4CEBA 1DGSA 5HRSA 3OYAA 2BANA 9ICEA 1WLJA 4GVMA 2FBVA 1B43A 3AO2A 4KTWA 4N5SA 4N56A 3QEPA 2A1RA 4QW8A 1S0OA 4XUSA 2IC3A 3ZD8A 1FKPA 2HNYA 1DTQA 4IG0A 3E01A 4UBBA 1WSIA 7ICQA 5J0SA 4IR9A 9ICUA 3CFPA 3V7KA 2F96A 1WSJA 1WSFA 2E4LA 4FCYA 1G15A 5FROA 3PMNA 4IFVA 5KFYA 4LVSA 2PZSA 4C8LA 4J9PA 4YG2A 3KLGA 4RPZA 9ICIA 5BPCA 4OKEA 2DPIA 3LDAA 4QOZB 1B9DA 4EZ6A 1UA1A 2KFNA 4RQ6A 3QEAZ 3V81A 2ZJAA 3DLHA 4B9MA 2DFFA 3GDXA 4ECUA 4MFBA 9ICSA 3AO4A 4KRFA 3MR2A 3OS1A 2W42A 3UQ2A 4N47A 4UBCA 2G8FA 1RBUA 3CFRA 3JPPA 4M9JA 3AV9A 4BACA 4QZFA 3TFRA 3C95A 4AHSA 2IGIA 8ICCA 5IIJA 3H8JA 1WSHA 1ZETA 1QSLA 2RF2A 4Y1CA 3EWAA 2D0BA 4FK4A 3SJJA 2HHQA 1KFTA 1C0MA 3HXMA 5FRMA 4IDKA 5L1IA 4I29A 4G3IA 1XHZA 4AH9A 3G0ZA 4O5CA 4MF2A 2ZQBA 4FK0A 4I2FA 5HRNA 3DLKA 1S9FA 1YTUA 4YFUA 3PR4A 4DF4A 4UAYA 4NM1A 4TUQA 1RT4A 4FJMA 3AVKA 4RZRA 3O4NA 2Z1JA 3TAEA 5L1KA 3VQPA 4PGQA 1BPZA 3DRSA 3ITHA 4IQUA 4L8RB 4XIUA 4E1NA 3RWUA 2AQ0A 4PHEA 5KFKA 2BCRA 1S1VA 3K75D 4YXMA 4FJLA 5J0PA 1ZQUA 3NF9A 4CFAA 3MDCA 4M6WB 3KJVA 2F8SA 3S3NA 4P4OA 2YKNA 1MC8A 1Z25A 3PO4A 1S0NA 1T8EA 3RMBA 1LB2B 1EX4A 5DQHA 3TQ1A 4CEOA 1XC9A 1RZTA 5E41A 4FJIA 5SZTA 7ICVA 2R8HA 8ICPA 1J5OA 4TUPA 3PO5A 3MGHA 1KFDA 2AGQA 3KHLA 3ZDAA 5J0YA 5DG7A 4J9MA 1CZBA 2YNGA 4BXOB 4PUOA 1IXRA 4F4YA 1N48A 4FK2A 1VSMA 1JKHA 5CY4A 4BWMA 3DM2A 3L2WA 4B9UA 4E7HA 2ATLA 4O4GA 1RBVA 1Z26A 2JZBA 5JS1A 4Z6EA 3QEBZ 2G8IA 2UVWA 3AVLA 2E6MA 1WAFA 3PNCA 3AO5A 4I2GA 1BPYA 3C5GA 4RQ1A 4CJ4A 4ED7A 3T5KA 3U6FA 2BHNA 8ICSA 2OPQA 4QZIA 3M8SA 3NE6A 3L2VA 4JRQA 3JPSA 1TAUA 4YXJA 2VA2A 3H4BA 9ICHA 2D0CA 4F3OA 5DB9A 4MFFA 3PR5B 2ZUDA 3HWTA 3KD1E 2DFEA 1ZQFA 3V9WA 3HX0A 4FBTA 3PW4A 2VANA 3VQCA 3OGUA 1K1SA 4KLHA 2FMQA 5DDYA 2QK9A 4DG1A 1NK5A 1TKZA 4QZGA 2XRIA 4E89A 3G6XA 1D9DA 4B08A 4CJPA 1MQ3A 3B6OA 7ICLA 3V9UA 8ICOA 2OPRA 3NGZA 3DLRA 3QLHA 1U04A 4KI6A 2RDIA 1J9AA 3HP6A 2Y1JA 5KFLA 5J2JA 4C8KA 4M04A 3L2UA 4F4ZA 3TR8A 4F5PA 3SQ1A 2B6AA 1JLCA 1DLOA 2ZTEA 1LWCA 4QCLA 3V6DA 5DB6A 1RTDA 3LDSA 2KTQA 2B5JA 2FPMA 3TAMA 2Q0ZX 4BE2A 1S0MA 4O9MA 5HLFA 3BQ2A 1JL1A 1Y97A 3OYJA 1S97A 3LAMA 4ED8A 2C2EA 4RQ4A 2YKMA 2ALZA 4J2EA 2R7YA 4W5QA 2V4RA 4DOBA 4DSJA 8ICVA 4ECYA 4QZEA 4FJ9A 4KAZA 3SI6A 4JV0A 4YMOA 5J2MA 4M3ZA 4F91B 3GV8B 2RKIA 2BQRA 2PYJA 1BCMA 1ZQNA 4MEXA 3AVFA 5HMLA 4OPKA 2DTUA 3AVNA 3V1OA 1T05A 8ICLA 1K1QA 5J0UA 1C0TA 3T1AA 2BDPA 2JZBB 3PY8A 3AA2A 3S3MA 2FBYA 5C24A 1Q9YA 3NAEA 2KQ2A 2G8KA 3OYNA 4FJJA 3L2QA 5KFUA 1KSPA 1JXLA 3HPHA 4EEYA 4YMMA 1ZJMA 1MQ2A 4W5NA 3RJEA 3KKRA 4CJQA 7ICHA 1GOBA 5IIOA 5KFQA 4K4GA 1VSHA 4M9GA 5HNKA 1C7YA 3RMCA 4CHYA 2C2RA 4DL7A 4ECSA 4PQUA 8ICYA 4CHZA 5DG8A 3RR8A 4DTMA 1ZQGA 1IH7A 2JLEA 4I2BA 3SCXA 4OLAA 5KG1A 8ICRA 3UXNA 1BQNA 3ETLA 4PHAA 1KTQA 1TKDA 4CEEA 4YR0A 1BISA 2BR0A 4PPXA 3OYMA 4ED6A 4F2SA 2ZUBA 1VSKA 3ZSZA 3V7LA 4W5RA 3AVAA 4ECWA 2DY4A 4DU4A 4RW4A 3G6VA 3LP1A 3SQ2A 4KHSA 7ICUA 4EYHB 1WSEA 2DFLA 4HUGA 5J0QA 4O3RA 1N6QA 3JYTA 5F9LA 2W9CB 3L8BA 4FZZA 2ASJA 5KT7A 2HHTA 1B9FA 5CJ7A 1TAQA 3K5OA 4MFCA 3M8PA 2F1HA 4E7KA 2HB5A 2BCQA 3ZT0A 4OGEA 3ZCMA 4KN4A 5KFVA 4BWJA 4QZAA 2ASLA 4Y1DA 3ISNC 8ICAA 4M47A 1HJRA 2HVIA 3DYAA 3OHBA 2XY7A 3HPOA 4KLGA 3S9HA 2IMWP 5KT6A 3NF8A 4O5BA 3ZSWA 3QETA 4RQ5A 2RDJA 4XRHA 5HRRA 1ZQZA 3C94A 3U3GA 4FLVA 2V4QA 3RH4A 4J2BA 4CK3A 3OYDA 4YQWA 2C22A 7ICNA 2EHGA 4FJHA 5FDLA 2ASDA 4UAWA 3ZDCA 3QNNA 3M8QA 4PHDA 1RT1A 2FMSA 4KHUA 3SZ2A 3CM5A 4UB5A 3AVBA 3ZDBA 4M3WA 4M3UA 4KLJA 1RXWA 4G1QA 4QZDA 3PUFA 3VQDA 7ICFA 2W9BB 2MUTA 3HSTB 5KFZA 3D45A 2O4IA 1ZQSA 3IAYA 2V9WA 1HYSA 4IRCA 4BDZA 3K2PA 1TK5A 4RPYA 3NH2A 4KN7A 3LPTA 7ICKA 4JV1A 2VWJA 1QLNA 2OZMA 2ISPA 3OYBA 1ZYQA 1U45A 1HUOA 5HP4A 4RW9A 2J6SA 2B4JA 3CM6A 4DMNA 5L1LA 1QTMA 1ZBIA 4DFKA 4CGHA 3RH6A 3NTUA 4YVZA 1JLBA 4O3OA 1IKVA 1X9MA 4RNOA 1A5VA 4KKOA 1TFRA 2F8TA 5HMMA 1IO2A 2R8GA 1WAJA 1W0HA 3BDPA 4B8CA 2PYLA 1L3TA 4NCBA 5TZVA 2XCPA 5KFXA 1QSSA 2VWKA 4DFMA 4BE1A 1B92A 2XHBA 5CZ1A 4M42A 1LAVA 3NGIA 1SKWA 1RTIA 2XY6A 3BQ0A 3SV3A 1U47A 2JEJA 4RQ0A 1A5WA 5HHIA 2YNHA 5T7BA 3C2LA 2Z1HA 1VRTA 3RTVA 3THVA 3VQEA 4F92B 3C2MA 4CEZA 4FJ5A 3IM1A 3MFIA 4IRKA 4RG8A 4I2EA 4O55A 1C1CA 4MQ3A 4Z6DA 3PVXA 3MR6A 4NCGA 3EY1A 3ULDA 2VG6A 5KFOA 4FW2A 4UB3A 1RT3A 4LSLA 1WCLA 4QZ8A 4LZDA 4OPJA 1DOQA 2GV9A 8ICJA 3I0SA 1LWEA 1BPBA 4CJ3A 4P4PA 5J0TA 7ICRA 1SZPA 2A1JA 1ZQTA 3ALYA 5HBMA 1SL1A 8ICGA 4XA5A 1AROP 4CJFA 2ZTDA 4M6WA 3O4QA 2BKEA 2HHSA 8ICQA 1S5JA 3V6KA 2WTFA 5HP1A 1TVAA 4MFAA 5IIKA 3ZT4A 3PX4A 9ICNA 2YNIA 3GFKB 1W9HA 3OVNA 3Q8SB 1V9PA 4WE1A 2F1JA 3CFOA 3PW2A 3L2RA 2I9GA 1JN3A 1VK0A 4Z6CA 8ICUA 4H4OA 1TVRA 3B0YA 3EPGA 1VSDA 4BXOA 1S1TA 4YMNA 2JEFA 1S6PA 3H08A 1U48A 5KFEA 1R0AA 3TFSA 5DLFA 3ZSOA 1S9EA 3G10A 3WNEA 4JWNA 3ISCA 1CLQA 4KV8A
chains in the Genus database with same CATH superfamily
4MKAA 2F9TA 2BYCA 4IG3B 1MROA 1OYEA 2ZH3A 1TL3A 3ZSVA 5ITHA 4PKDB 5FPDA 3HKZF 3SDEB 3OYFA 2PA8D 2PIIA 4F02A 4DEZA 2RQ4A 2EXUA 5ALLA 1VISA 2ZUCA 3CRXA 5J2KA 4YDXA 3ZNUA 3NDKA 4DTSA 1RBAA 3CC7S 1NPPA 3S7RA 4CZLA 4NXNK 4F72A 4JI7F 1NKCA 1SQFA 2UUBJ 4CLZA 4KGXB 4L6V3 1XNRK 2N7CA 3H25A 2VJUA 1X3MA 3VETA 4B1ZA 2QA4G 1KDHA 2V6AA 2XSJA 3MOZA 3F2BA 4HACB 2ZXHA 4ID8A 1UVNA 1RT3B 2XZWA 1H74A 2ZF5O 4O0NA 5M1PA 2ODGA 4NXMJ 1NNEA 1TKXA 4QU7A 2NNWA 4J2DA 3NNCA 4JI1F 2VKZG 4DX5A 5ALMA 4JS5A 3F5TA 4DOAA 1ZBTA 5DGAA 1RILA 2UZAA 2QB1A 5AM3A 1O5JA 1ZTWA 1Q46A 4FZXC 2AHOB 5H2FU 3CDAA 5KGWA 2NQPA 4BDYA 3RB6A 4WYBA 4IR1A 2YV0X 3K8VA 1WHWA 4CGIA 2O67A 4TSXA 4UZCA 2EK1A 5KAKA 1V85A 2KVQE 3Q8KA 2ERRA 2BE2A 5KG2A 8ICIA 3IRXA 1RT2B 2KHVA 2IA0A 3M8ZA 2WFAA 3PJWA 5HMWA 1U6BA 1LNQA 3BKTA 1Z2ZA 1FEHA 1HR0J 2ZZMA 2GQQA 1U25A 2VIXA 5AQPA 1B7YB 4LVOP 2QG9B 4USJC 3QNMA 1HNVB 2MHEA 3HHDA 3EE8A 3R7SB 5E79U 1TL3B 4FYWB 2HS4A 3E2EA 2KJ5A 2CPZA 4A8XA 3PIPQ 4I2QA 4KO0A 4RNMA 4Q44A 2DXEA 2W6KA 5ETKA 3SJHA 1GFWB 2XC9A 2QFJA 3H0LB 4KLFA 3GONA 4ZHRB 1BVSA 1NI3A 4UB8U 2QT7A 4IFEA 4BRNA 3KOOA 3HHEA 2K1RA 3ZFVA 1LV5A 3U1LA 2K3KA 2E5LJ 1JJ2R 1XI1A 3FYHA 1BPEA 1S6QB 3A5MC 5LXRA 1N33F 5KQ8A 1ATNA 5L9NA 4KX5A 1UTAA 1VQ4S 4CJSA 1XMQF 2LU2A 3HVRA 3R2CJ 4OVLA 5CAAA 3BUZB 3NCQA 3OFFA 2HQIA 1BL3A 2E7XA 1B4FA 1U0HA 1BWFO 1NSPA 3MHYA 4BE0A 3AXKA 4C0BA 1RAEB 3BQTA 3B78A 1TKXB 2XCAA 4OHZA 1T95A 2JJ4D 5AKJA 1RDRA 4UUWA 4NLKA 2D69A 4QIWC 3GDQA 1RT6B 2YWKA 4KPYA 3MFHA 2H9ZA 2VDIA 2MYFA 3EE3A 1U9LA 1S1XB 3EVWA 2PO4A 4PGXA 1WC1A 1YKWA 5FJ4A 3TZWA 3C65A 1JNZB 1QAXA 2EKNA 1IWGA 4WCEQ 1BPDA 3UCUP 2PT0A 1KVCA 3PSFA 3QBWA 8ICBA 5EOYA 1WHXA 3NP5A 3QGPA 1UJ4A 3K5LA 3HZEA 3DWLA 3H98A 5LXYA 3CJBA 3E1YA 4X62J 5AQSA 2BE2B 2WB1D 3GFXA 2RIJA 3WEEB 1Q8KA 2IMOA 3A0BU 2AJFE 1TKTA 2W9BA 2G0JA 4CH7A 1MMDA 3L09A 2NPFA 2QFIA 1H73A 2LQBA 2Z30B 4LC9B 3KHHA 3LWMA 5AXMA 2BRKA 3VQ7A 4GXJA 4J9UE 4DTRA 3A5NC 3CQYA 1X6JA 2EAOA 2CQ1A 3IR5B 5HROB 5IT9O 1XQIA 3EN9A 3A5LC 4I2QB 1UVIA 4KO0B 4X65J 4JK1A 4A8MP 2GTDA 4NI2B 1NOYA 3RJGA 1DHMA 1A0PA 2GGPB 1NGGA 3KK1A 4FLXA 1SV5A 4C48A 2BJ1A 1Q0NA 1KL9A 1S5LU 4CZJA 5HR7A 2FVRA 3G8SA 2QIFA 4EBEA 4B9SA 5L8RC 4ZCMA 1YLXA 2KXHA 4YB5A 1KEJA 5J1PA 4ID1A 2X3DA 4Z37A 4BRPA 4F3TA 1FTRA 3M4XA 1L7OA 1N5QA 4K0KK 2V0NA 2FVQA 2IDLA 1Z4NA 3VN5A 1NDCA 1B0PA 4BRIA 3AGKA 3P5JA 3P6YC 4DV0F 2FQQB 2KNJA 3O5BA 1HYZA 1VSIA 1RDDA 3OY9A 3C6UB 2W2OP 2R8JA 4EI2A 4IUFA 3H0RB 4DQRA 1NCLA 4AT1B 1XSNA 1WCNA 3I56N 3SI8A 3C19A 1BUPA 1NMNA 3CCMS 1RWXB 1T9UA 2CPIA 2E8NA 5I9EB 2JVRA 3QERA 2HBRB 3OSNA 1YJWS 3SPYA 3GV5B 1OUQA 1PK1A 3RBZA 1JALA 4DN9A 1SPBP 4ED3A 3RGIA 2VH7A 3CCRS 2R2RA 2Q6BA 1H6KX 2CVEA 3IDHA 3ZC4A 2J9EA 2AKWB 2H51B 4M63A 5A2QO 1JI7A 5FLXO 3VCBA 3UMCA 5EGYA 3BKUA 1FNMA 3GILA 4ECZA 1Q95G 3EKSA 3RSEA 3D68A 1VHIA 1Q5YA 2F9WA 3G6EN 1UFWA 3PX0A 3NF7A 4KLDA 2HBQB 2WOMA 4ELVA 9ICPA 2Z1GA 4NA2A 4DUYJ 4C8NA 2CRLA 3O1LA 2P35A 5IWAJ 5FLXY 4UZBA 4FZVA 1VQNS 4FWLA 2BRLA 1J5EF 9ICOA 2O3DA 3TWHA 5DM7L 3HSGA 4K4SA 4H5RA 5KFAA 1RPLA 2HK3A 5LMNJ 2W8LA 4QWDA 4RCHA 4IOAL 1OSCA 1VSFA 1PC5A 3NWGA 3H45C 4OX9J 5B5EU 4DDFA 2G0AA 3R3TA 3FZKA 1GX5A 3CMEN 1HQEB 3D5MA 2J6UA 1YRTA 4LF2A 1NM1A 4OJPA 1U1NA 4CDGA 2WSEC 3TARA 4DL6A 3AVJA 4I2JA 4X4PA 2PAVA 2ZBQA 3V6HA 4KGKA 4GKJJ 2VFTA 1ZTTA 2A19A 4FVCA 1XWLA 4ECQA 3FUYA 4DR5K 5JLFA 1NK9A 4DQQA 3AH6A 4P52A 3FFIB 2WAQC 2KEYA 3PACA 1X1PA 3VC8A 1ZAVA 2EWHA 3MM8A 4TU9A 2WONB 4DUZJ 3L3VA 2CNLB 4IDHA 4FFDA 5K9FA 2I1QA 3NVZA 4DOCA 5HVFA 2GMLA 5KTQA 2QLFB 3WNHA 3AD7C 5AE3A 1LW2A 5J2QA 4OJGA 4M41A 1FWPA 1N33K 3BREA 1XMQK 2LMIA 2XLJA 3VALA 2Y0BB 2A2DA 1VQKS 1ZPVA 4LF9K 4XPEA 2A2CA 4RT3A 3IR6B 2W8KA 3UR3C 5F0UA 4ILJA 3D1QA 1S10A 9ICLA 1DJ0A 2O5DA 2AYEA 3C7NA 5KFWA 4X4TA 4BRAA 4KMUA 2O66A 3LQVA 4NXNJ 1U24A 3D28A 1LOTB 2WOMB 1RTHA 2Q36A 4ED4A 1QQCA 2ZHBA 2BJ7A 4OHWA 3MXHP 2MZRA 3CTRA 4ZP8A 5AICA 1A6SA 4K43A 3C16A 4J9SA 2E5GA 1CG2A 3MMVA 2RDDA 3GIJA 4OIXA 4ANEA 3V9ZA 1Y9OA 3C1ZA 4Y2CA 1BUXA 2WF9A 1UQVA 3W0LA 3ZX3A 3DEEA 1QS4A 3CCSS 4Y0FA 4DF8A 3K8WA 1F2GA 3SR6A 1LFPA 5K20B 1SGGA 3L4PA 3TP2A 1Y88A 4LFCF 4CGJA 1I39A 7ICPA 4LY7A 1H72C 5CHIA 1Q53A 5AFUA 3HTVA 2DHAA 2KN4A 1PZNA 2EFGA 2OPPA 2OFHX 4P71A 4DL0C 1K8KA 1RBRA 4TLRA 2QA1A 5J2NA 3FDSA 3QBCA 3BSOA 3VQTA 3QNOA 1TL1B 2IDEA 1X9WA 2FVPA 3JSBA 1VYAA 2KKPA 2E9RX 1SQGA 4XO0A 1YSJA 4OX8A 3KUEA 2QLTA 3QYPA 4I68A 1WBDA 2HAIA 2OFGX 1F3FA 4DCOB 3BGRB 5M2PA 2B4VA 1YK9A 2Y1IA 3GCWP 1QQMA 2E8MA 1RAAB 4KH0B 2G8VA 3ZTSA 1TK0A 3ENBA 3LK9A 1JXEA 4CGZA 1TL4A 3I5BA 2HDOA 2ISOA 2ZJ5A 2RMLA 3SK3A 4A8WA 3FGVA 5AQJA 1QVFM 5CYMA 2GO7A 5AXLA 4YY3F 2AGOA 1Z00A 5AK4A 3P4IA 4RBUA 4CO3A 3VCDA 1S22A 1ZQVA 1DT9A 4Y2VA 4C8MA 2BVZA 3CIPA 2EC2A 3OR2B 4B8AB 2CH5A 2ZIXA 3I32A 1RUSA 5BRFA 4I7FB 1FRXA 4NYOA 3CCES 1LWXA 3BO3A 3WT0A 4CGGA 3SEOA 2HRUA 2E1PA 2VB6A 3BF4A 5J0RA 1RABB 4LBIA 5KG3A 1RHKB 2R7RA 4R79A 4M5LA 2XO6A 1FXLA 3QAEA 2NSCA 2K4HA 2YX8A 1JL2A 3OFHA 1FKPB 2XY5A 3RB4A 3DKDA 2BACA 1WELA 4Y65A 4IQXA 1GLJO 1S72N 1M5PC 5T41A 2W54A 1K8KB 3AJ2A 4RW6A 2W40A 4X4SA 1NZBA 2MKHA 1FIQA 3T1HF 3RBEA 1GQEA 5KT4A 1AFJA 4Y0WA 1K6YA 2FHKA 3JQMA 3CPWR 2BJEA 2NZTA 1MWMA 1ROFA 4FSVA 4P4MA 3SIPB 1CJVA 3T3FA 4H0PA 3RJFA 4CBWA 5EU7A 1HNXK 1GXLA 1TR0A 3NMAA 4ZOHC 3HZGA 4PWDA 4OYMA 1VSLA 4JD2A 4CZMA 2OELA 3ZZZA 2MEWA 2XHWA 1UVMA 4JK8A 1TUGB 3NGKA 2QWOA 1J5EK 5AKGA 4TXSA 2L48A 1Y00A 5EX0A 2Y9UA 3Q23A 2I5JA 1P1TA 4OZLA 1HUXA 2GHWA 2QV6A 2I6XA 4NLSA 2HAFA 4KAIA 1U1RA 4P0QA 2ETJA 2R7QA 4YOYA 2XEXA 1VK3A 4EO8A 1Z00B 3HI0A 3CD7A 3HKWA 1RT4B 5KG0A 4FWMA 3DXKA 3OBIA 2D1CA 1S79A 3BSCA 2HG4A 2F9DA 1JXBA 1NLKL 2KXNB 3T1YK 4GXIA 1YZ7A 3V4IA 4DTPA 2PI5A 2QARB 1U26A 2ZIXB 2FBTA 2E7WA 4DR4F 4Y6IA 3M9MB 4UOCA 3OYHA 2GJ2A 3I55N 3AXMA 3BEGB 4C97A 4PG8A 3F5EA 2VWBA 3WBZA 4HHJA 4DLGA 4K0KJ 4WKYA 2HF4A 4ECRA 4CYUB 3VHQA 2NYVA 4KSEB 3OS2A 5D4LA 1KN6A 1SXDA 2HNZA 5KFCA 4B1UB 3D0IE 1J5OB 4WWSA 4CLSA 4HVZA 4ICLA 3OYLA 1KAXA 4YOXA 1MNEA 2BV3A 2CJBA 3JXUA 1ZQHA 3W5XA 1CPZA 1B99A 1HUZA 3R8EA 4Y2KA 3PX6A 4BQLA 8ICFA 5DDQC 3BQ1A 4O4GB 4CBXA 2G8WA 1NGJA 1HA1A 2CZ9A 1ATRA 3QO9A 2AQ4A 1SJ4P 3LAKA 1SWVA 1WC4A 3LL3A 3T19A 4RW6B 2G1HA 2AP1A 4I2HA 3FVYA 1BMQB 3O9TA 2IBKA 1K0TA 4DQIA 1PIEA 4DWIA 4H5TA 1UKUA 2W4DA 3B4MA 4X4QA 3VQ4A 2WVDA 1NBWA 3D2FB 4UUXA 4JB8B 1IVZA 3VQ9A 2LEBA 4KHRA 2A40A 4OI0A 4DO9A 2C1EB 3FZBA 4JD2B 5D4OA 2WAQD 4O23A 4URQU 2NO4A 1GMWA 3VVUA 4IBNA 3IMXA 5CYQA 3OHAA 2V4JA 1W7WA 4I67A 3WC2A 2FLLA 2YY3A 2OJ3A 1FFVA 7FDRA 4LFCK 4QWBA 2E20A 2XYHB 4DR7F 3H5UA 4B3RF 4P0QB 4IC9A 2E8OA 2XYPB 3IBPA 4ZLLA 5D3GA 4FJ8A 5KFPA 3CCUN 7ICEA 3HDSA 4ZVEA 5ADXH 1IM4A 4I6MA 2P5GA 2BXJA 2JRSA 1EKEA 1E3MA 1JJ2M 5CZ2A 3NVVA 2HW3A 3NGYA 3POTB 2B6AB 1BPXA 5KG7A 3E9PA 7ICGA 3OW2R 2ROPA 4KLQA 2HOEA 5KPZA 4V19S 2AEFA 2B5JB 1UW9A 5J2DA 2B9YA 2PDAA 7AT1B 4M3TA 5D77A 2OTLN 3BP8A 3RU0A 1J53A 2W7AA 4CF8A 4ZPVR 4DU8A 3TO8A 2HCFA 1ZAXA 2YHBA 1OQ6A 4Q8FA 5BREA 1F9HA 3M8WA 2PFPA 3A3NB 2HHUA 3DDNA 3FCVA 3BO4A 3QFPA 4UB2A 1ZH5A 4CCHA 2W4PA 2FC0A 2UUWA 4BGAA 3DCAA 5DRKA 5A0YA 2IAJA 4DR5J 3K5MA 3CJ8A 3AB2B 3UQSA 3ENOA 1FKOA 1WNSA 1TELA 4YY3K 4NLPA 1EIYB 3QO9B 3C1YA 2ZBIA 4WYLA 1HIYA 1OWXA 1RISA 3T41A 3UM9A 4CVNE 4ZN1A 2FF6A 2QL9B 3MR7A 3U3YA 1WI8A 1N88A 4ES3A 4AL7A 3QT8A 1N33J 3IM9A 3VQQA 5J2BA 3CC7N 2ESEA 3R8YA 4LF9J 5JVHL 3WU2U 4CHNA 4XPCA 2QLJB 2QB0B 3FEYB 1YGYA 5K8OA 4DPTA 2ZEJA 2ZH5A 3SAHA 2FVSA 2L41A 5A8RA 3QU5A 3C14A 4MK8A 1PJ5A 2EPIA 5C15A 1SIZA 5CYQB 3K1ZA 4ED0A 1Q8IA 4CF2A 3LP1B 4BRKA 4PH5A 2IDOA 2K2PA 2RPIA 2IM2A 1NHVA 5D3GB 3LPEA 3UQ0A 3D1OA 4LF4F 4WTOB 5BR9A 1NPRA 2HURA 5CA7A 3OA9A 5ETSA 4FLZA 2YX4A 4I6MB 1KD1O 2DEJA 5KFNA 4GC7A 2DD8S 2V63A 3FCHA 3T1HK 3AL0B 2HHVA 1RHMB 1X5SA 5KGXA 4HH0A 2C3UA 4KGZB 3VZHA 3SEIA 3HPGA 1BDGA 2ZKTA 5BYQA 2LYAA 1NBEB 5KRTA 2I5HA 1ZAWA 4C0ZA 2GO8A 1F21A 3CMAS 5AM4A 5ETRA 3KLEA 3P8BB 5IIIA 3DYAB 2XO7A 4JEPA 2DISA 3ZYYX 2BW7A 1RYUA 4DV3F 3VV2B 5KOXA 2KFZA 1X4AA 3UW1A 2CKWA 1ZQ1C 3CJ4A 5ALJA 4N41A 2VODA 4DL5A 3FBCA 4ENOA 2GBZA 2XQCA 3M8QB 2AZ3A 4QU6A 2K60A 4OJ5A 3BJYA 1T02A 2ALYB 2IOHA 2AXTU 1S1WA 2EKYA 1GTHA 1FKOB 2CG8A 4OO1J 3ASMA 3G25A 4JV2A 1C1AA 1SKUB 4OJRA 9ICQA 2MUTB 3VAFA 4CEBA 1DGSA 1FD2A 3WC0A 2BANA 1K9MT 5GTIU 4MO4A 1M5OC 3BO2A 1B43A 3OPKA 4KHMA 3EJMA 4KTWA 3FZFA 2YWGA 3W65A 2IC3A 4DR4K 2HOIA 5EE3A 4DHVA 3J7Z5 2HNYA 3QMQA 1DTQA 2I38A 4JKFA 3E01A 4QPTA 1WSIA 1NGHA 2IVMA 3D0GE 2LDIA 3N28A 4RW9B 1VQ4N 4H0XB 4FDFA 1SH0A 3NS6A 1YWXA 1MA9B 2VASA 1RQNA 4IFVA 5A8WA 5A8RB 2YTCA 2N3LA 1LFWA 1KVIA 3KLGA 3C14B 2IOFK 4QOZB 4EZ6A 2CPRA 4FP9A 2W01A 2MSSA 1FDNA 1FWLA 3DLHA 3GLJA 1U1QA 3NXZA 2OD6A 4ILLA 3TQEA 2W42A 2D3OR 2NS1B 1AZSA 4HH1A 3IR7B 3FRZA 5BR8F 1FJGF 4M9JA 3AV9A 3GU0A 1ZXOA 4MK9A 2EFOA 2F8HA 3TFRA 5EHHA 3SBTA 3BSAA 2IVPA 2IGIA 3O9UA 4CLUA 3H8JA 2RF2A 1B7FA 3EWAA 2C2NA 4A48A 4NPOA 2ZH9A 1KDNA 4IDKA 1HHSA 5L1IA 2P9SB 4G3IA 1XHZA 4LRFA 3KLEB 4Y2UA 5T7LA 4O5CA 1P7DA 5HRNA 2W2PP 3MPUB 1KP6A 4TUQA 4EMDA 3MMJA 4WFNQ 2LI6A 4WK1A 3AAPA 5TKYA 4FYYB 3TAEA 4BC4A 2CAJA 3VQPA 4PGQA 3DRSA 2W04A 3OUYB 5EY4A 2R9LA 4GVEA 3RWUA 1FDBA 2CPFA 2LCWA 1HNXJ 2JH1A 1C4CA 1CJTB 1S1WB 1TZ0A 5J0PA 5C2CA 2IHR1 4DR7K 4B3RK 4CZCA 2E2NA 4UQTA 1OH6A 4LF6F 2CQHA 2XTJP 2PMZD 2HWHA 2AJ0A 4ZOSA 5HP1B 3OTDA 4NL9A 1J5EJ 3HZ6A 1IV8A 1XC9A 3TTDA 5ETVA 3M32A 5DDPC 4TUPA 1YTYA 2H3IA 2D7SA 5DG7A 1GTEA 1TUUA 2IC3B 1CZBA 2YNGA 5AQOA 1DTQB 1NGEA 4ZVOB 1JKHA 4BWMA 3DM2A 4E7HA 4P73A 5F3ZA 3E0FA 1U1KA 2IJRA 2WFBA 3OVSA 2CQPA 3T1YJ 1Y5IB 2GUPA 4IL6U 3JS6A 3Q7CA 4ETXA 3CJSA 3C5GA 2GV1A 2V50A 2H3FA 1FX4A 1N4LA 2OPQA 1OY8A 1T3VA 3NE6A 3L2VA 1HHTP 3VERA 1TAUA 4YXJA 2C3PA 5EX5A 3EX7B 1PO6A 2D0CA 2KJ9A 4BREA 4F3OA 2DFEA 1ZRMA 1WOOA 3HX0A 1KBUA 2VANA 1N2XA 1IKWB 3SCJE 5GAGP 2UXCF 3GU3A 1WWHA 3BYPA 1A0OB 3TTFA 4KLHA 5DDYA 1HW8A 2IM3A 1WKJA 4DG1A 2G08A 3JSRA 1Q5VA 4QZGA 2RNEA 4E89A 4B1YB 1QE1B 2NLXA 3U1MA 4FYXB 5T7LB 1CI4A 2MPUA 2OPRA 2P9KA 2L08A 2RDIA 4DX7A 2Y1JA 1FNOA 2DNHA 4P9SA 4C3MA 3DRSB 1DLOA 1LWCA 1IG6A 1RTDA 5ETTA 2P9PA 3IG5A 3TAMA 3IBFB 4MTPA 4NLYA 2L3MA 3OBWA 5HLFA 3FBFA 1BD6A 1S97A 3LAMA 2C2EA 1C2PA 4EFHA 2VZ9A 5EDWA 2MRLA 4NJ8A 2VC1A 4QR0A 4JI0J 4M63C 4RW8B 2R7YA 2EEYA 3D6HB 4W5QA 2KG5A 4W90B 2V2VA 4YB6A 4M3ZA 4ZVPB 4F91B 2J7KA 4LFCJ 2PYJA 1I94F 2YNGB 3AVFA 4OPKA 3MX5A 3AVNA 2XMUA 2F77X 1K1QA 2D3UA 1C0TA 3G86A 1ECWA 1KQQA 3MWPA 3PG9A 4MK7A 4DV3K 2Q3PA 1HQUB 3DXBA 2FBYA 5LOQA 3D6TB 3D7SB 5HQMA 5KFUA 1KSPA 2DVIA 1N8RO 2WVEA 2KT5A 2DNKA 1ZJMA 2A3ZA 2AD9A 2M70A 3VF0B 4MJKA 4OL8A 3I9ZA 4CHYA 1FEEA 4CHZA 5DG8A 2MKSA 2J8SA 1ZQGA 2JLEA 2DKZA 3F44A 4B3MK 3ETLA 4PHAA 3R6LB 3U27A 3OFGA 4TY8A 4AF1A 4DG1B 1IKXB 2PEBA 3VF4A 4ECWA 4LBHA 5HVGA 4DU4A 5IFMA 2O8BA 1NB7A 2OPRB 5DDRC 5J0QA 5M2RA 1N6QA 3DXMA 5F9LA 2YNFB 3NG8A 3L8BA 3E9OA 2ASJA 4O8UA 3VTIA 3VGKA 4A8KA 4MFCA 3M8PA 2BCQA 2MQPA 1E6YA 2L5YA 1X4FA 1V5IB 5LJ5Y 1NGDA 3DGPA 4P10A 1M1KT 4UTGA 3O1BA 1KVJA 2ASLA 3KFWX 4Y1DA 3ISNC 8ICAA 1NMDA 4M47A 1HJRA 3QU9A 2AF6A 2YMMA 3EGNA 1T9TA 3OHBA 3TAMB 2XMAA 1BA0A 3Q24A 4KLGA 4DHYA 3D3BJ 5HLFB 5BN9A 1REVB 4RQ5A 4OI6A 5AZJA 2FHOB 4FLVA 4J2BA 3U3GA 2V4QA 5BR8K 2C22A 2HBMA 4PKHA 3MM9A 3RUBL 2VKRA 3VF2A 5ALKA 3ZDCA 3VOVA 2NSBA 2E3TA 2FMSA 2UUAK 4KHUA 3O6QA 5SUHA 4I56A 4UB5A 3AVBA 2NV3A 3CCSN 1K47A 3P38A 3WZ0A 3RVCA 4MIWA 2WAQF 2QX0A 1RXWA 4MKVA 5ALIA 1C0TB 5DETA 3VZIA 4M5DA 1RDFA 5KFZA 3T1HJ 2KT3A 3D45A 3ILIA 4DR3J 1ZQSA 2O4IA 2R18A 5CZXA 4JB3A 5IT4A 1TK5A 2HVEA 4L74A 3LPTA 2DGSA 3HULA 3B8AX 2WSCC 3NS7B 7ICKA 1AW0A 1SS6A 2WVCA 3G71N 2CNNB 2ACYA 1QLNA 4LF6K 2ISPA 3KK7A 1HUOA 3CM6A 2D74B 4LVNP 1VQ5S 2FI1A 2ZC4A 3IC1A 1QTMA 3U4LA 4TY8B 1JLBA 1IKVA 1X9MA 1B0VA 1TMJA 4K42A 2KK0A 1WUUA 1S99A 2VICA 4KFBB 2KIVA 3S6JA 3H8MA 4OHVA 4B8CA 2PYLA 1L3TA 1SZ2A 5KFXA 2VWKA 4IXCA 2ZM6F 5AI5A 4JKCA 3PLAA 3CERA 1QHAA 4NE9C 3PFOA 4KJIA 2MQ8A 2MSTA 4M42A 2VG5B 2E5HA 4ID5B 2YMLA 1RTIA 4PEOA 3M8PB 4YDUC 4K4YA 3O9SA 4DR4J 2JEJA 4RQ0A 1KKHA 3Q89A 3W1YC 3RAMA 3CGIA 2YNHA 2RILA 3N4PA 4V19X 4AYBD 1N34F 1ZPWX 2KYXA 4I2EA 4CW7B 4O55A 4B1VA 3CT9A 3BZKA 1GLBG 3MR6A 2VG6A 1QUVA 5KFOA 2NR0A 1EAYC 2FC8A 4LSLA 2UXCK 4TLQA 3SCKE 4QZ8A 3UCZP 4OPJA 3NL0A 2G1DA 5D0RA 1RLCL 3MURP 4P4PA 4Q7AA 1Y5NB 4PL1A 5J0TA 2I1RA 2A1JA 3ALYA 1HEKA 3M6KA 3WXKA 3MM7A 4K7QA 2XS2A 4DV1K 4HWIA 1NPKA 3QATA 4A46A 1IBCB 2ZWOA 1S5JA 2WTFA 2KXFA 5IIKA 3ZT4A 1HWJA 2YNIA 1FHTA 3OW2M 3QJPA 2OSQA 3BF3A 3OVNA 2VG7B 2ZH6A 4USHA 3PNIA 3CFOA 5IOLA 1XTZA 3THTA 3N79A 8ICUA 3B0YA 4BXOA 1VSDA 4A8QA 3QU4A 3GR0A 2E8AA 1XNSA 4ALZA 5ALNA 3EDRB 1NU4A 4RT2A 2QSFA 4D3HA 1UWAA 2NXNA 2FBXA 1I6JA 5ALTA 8ICEA 1WD6A 1JLBB 3TZZA 1QHTA 4KHNA 3WXMB 3CD6S 3IG1B 3ZZPA 3R7NB 1YJNN 3ONNA 5CEHA 4H0OA 1Q81T 2JEIA 2L9NA 2XULA 2XS5A 3SD7A 1WG1A 2ASOA 5ALXA 2EK6A 5AXNA 3SMZA 2KVIA 4CLPA 1RDWX 3VQAA 3GP9A 3V7JA 4TQRA 2P5OA 4NLNA 4H4MA 2JDJA 2PY5A 4DS5A 3CJ5A 3SYZA 5C5JA 3M8YA 4CLWA 5DGBA 5EX3A 3GE1A 1S76D 1L5UA 8ICZA 1ZBLA 1RBOB 4O44A 2IM1A 4ILHA 3BH6B 4P2MA 3DLJA 2UP1A 3PRBA 4AILC 3RMAA 5LSLA 4UW2A 4NCAA 2HLTA 3Q86A 3MCMA 4CERA 1VI7A 3A0IX 4FJKA 3R9LA 3T5HA 3KWGA 2V8GA 1HNIA 2YKAA 3HYFA 1KVAA 4IO8A 5JJBA 1MSWD 2YHYA 4QNLA 3KLHB 1RBSA 4U7CA 3RW6A 4CIFA 1N8RT 2QW9A 2A1JB 5B0CA 3HT3A 3TJ9A 2J9DA 2KHQA 4C4SA 3FLCO 3KK2B 4YOEA 3AA8A 2P6RA 4BHQA 1GLEG 5AK5A 5HMXA 4CJEA 4ZPBA 3VGUA 1VQOS 4M5MA 3HKZC 4NLQA 3NAHA 4ZITA 1OW5A 4UY8T 3MOJB 3CJCA 3MMBB 3MEEA 3VEYA 4OKJA 4DSFA 1SKRA 2V8HA 1NK8A 5HO4A 2YBVA 2ZBRA 3GBTA 4NMXA 3QGGA 2GMJA 1VBYA 4HVJA 4NX9A 5F2RA 4RPXA 4FE3A 1NDKA 4LFBK 4P75A 4ZPWR 4WU2A 1RDAA 4O0IA 2WBNA 1EETB 5BYRA 4LREA 1JX4A 1ZQOA 3M30B 3J81O 2N82B 2LECA 3OFEA 5IIMA 1PVRA 3AVGA 3QIDA 1WHYA 3ED5A 4M7XA 4MYTA 4HI1A 1ZM9A 2RN2A 3AU2A 4LFAF 5KFDA 3M1VA 4ICAA 3WK9A 1BLUA 4X64F 4OZNA 3K7RA 4UF4A 1XSPA 3K9KA 1NGIA 2V2KA 4YP3A 3FNNA 2YY6A 5AQQA 3CYMA 4BG9A 4O44B 5KAIU 4PYDA 1WN7A 2UXBF 1JMSA 1HBNA 3OTQA 2VHGA 4F50A 2OP5A 4QR2A 4UAUA 1SJQA 2W2NP 2O8CB 4KREA 4DV3J 3ISND 2DH8A 2W9CA 3MD3A 3KTQA 3RB3A 3THPA 2YKPA 4WQ5C 3WNFA 1RT5A 4HHHA 1CJUB 2GVZA 1SC1B 2C2MB 3F73A 2HI0A 3NFAA 3RJKA 4R0EA 2HMPA 1MWQA 2OTJN 3KKAA 3O9QA 1QDUB 3KNGA 3MM6A 4PQAA 4RQ8A 1M1GA 1C1BB 2F4VJ 2ZM6K 2M8DB 1HBMA 4H5NA 4B3MJ 1YVFA 4M5GA 4ZP9A 5AKZA 4UB1A 4EFAC 1M90O 1X5OA 3VGVA 4ELTA 1RQ0A 4P2XA 5D4BA 1FXXA 5HHHA 1Z3EB 2OAUA 5I42B 1TV9A 1N34K 1FCAA 3W63A 1OKJA 2F3NA 4EX6A 2YQ0A 3H2VE 1NOMA 4ED2A 2H3GX 2RB7A 4CO5A 5CR0A 4R5PA 3D7EO 3CJQA 1TQLA 3FFKB 3HOTA 3JB9k 1R6VA 5D49A 1URJA 1ZRNA 4H4KC 1CQMA 4M3YA 3MCOA 3V1QA 4Y2PA 1Q82O 1UWBB 1X8DA 3UNGC 5GIPA 3MGJA 1FXDA 2BJ9A 3MEDA 3WK6A 3HLUA 3OSPA 2J0WA 1BQMA 1HJPA 1W97L 1ZQKA 2OEKA 4JYAF 3O9RA 4YB7A 3F2KA 4LF5K 2YB1A 3DI6B 3HHKA 3HHLA 2NCKL 3M1VB 2H4WB 5DM7Q 1S1UA 4R63A 2GNKA 3OL9A 4USTA 3KKFA 2UUAJ 2IVOA 1F0XA 1BG3A 2B8PA 1KVBA 2WMMA 5MAOA 4L76A 2A6OA 4IOAQ 4WXWA 1HBNB 3A12A 5KG6A 3M6UA 2HHXA 3CMAN 2ZH7A 3MMCB 4LR7A 2HNDB 1K8AO 7ICTA 5J2EA 3QICA 3CC4N 4EX7A 4K50A 2HGNA 3G4SN 3HRGA 1ZOTA 1OIAA 1GXUA 2GVZB 3PW0A 1YF5L 2BJ8A 2I8EA 4JKGA 4EYIB 2NRTA 4E2FB 4B9LA 1G6BA 1S12A 1YJVA 2IHMA 3MXIA 3DDKA 4NEZA 3IN5A 4LF6J 1YHQN 3DDHA 2ZOFA 5DBBA 2JV3A 3MM6B 3BS5A 4HTJA 1HBMB 2WF7A 1VRQC 1RNHA 3H46O 2X6NA 5J1EA 5DJBA 3MMAA 1GX6A 2HFOA 2UUBF 4HTUA 4GO5X 1QQOA 5DG9A 3AO1A 1Q86O 4QS7A 4KH4A 3MR3A 2E29A 1XR7A 2ZD1A 3A5OC 2NPIA 4EWTA 2KVSA 2IJFA 4JS4A 3R1LA 1NKBA 3GE9A 1YBTA 2GWKA 2OCEA 2CA9A 3O5TB 3N6MA 1VBXA 4LD0A 4UT4A 1V9OA 4CO2A 3PIOL 3CDWA 2WRMA 2NXCA 4H0YB 5F8NA 2KB2A 3I1YA 2CADA 2E66A 2DXFA 4M3XA 4PPDA 4JRPA 2GELA 2WVFA 2IA6A 3QNWB 1Y3KA 3MEDB 2MLYA 4ZLJA 2X51A 2EDUA 4B9TA 4F5QA 4F8RA 4QWEA 3DOKA 1J2VA 2D41A 4OZJA 3KUGA 4H0TB 5KG5A 4F4KA 1VQMN 1MWZA 2DJWA 1AYEA 2BZFA 1JLEA 3HHLB 3TABA 2GVDB 3QEWA 3M8RA 3T79A 1S1UB 2FLPA 4ZP7A 2C42A 2MA1A 3W62A 2P6UA 5AXKA 3UN2A 4DV1J 3RYLA 3H40A 4NLDA 4X84A 2AYGA 3BGFA 4OZ3A 1JJ4A 3C21A 3SSRA 2ATQA 1A7GE 2ZHAA 4HCBA 4AFFA 5DS7A 1BQXA 1ZD5A 4R8UA 1KHVA 1RCHA 2Y9HA 2HHPA 2ZITA 4NO7A 4C11A 1JLAA 2J7UA 5D0HA 1KLMB 4RUCA 1P1LA 1U1LA 2MQNA 2V69A 2WF8A 4JI4F 2RLTA 3GFHA 4MF8A 3LO3A 2D8CA 1JNRB 1IKYA 2HFVA 1DK3A 4HHTA 2V8DA 2MLXA 5J8YA 1HBUA 1XS9D 3TAGA 4LFAK 2FHMA 2KV2A 4X64K 2QSWA 2AA4A 1XR5A 1SUQB 4FZMA 2AYMA 3U7JA 4FWQA 1GLLO 3PHTA 3KLIB 3CDUA 4NASA 1UVJA 1S9GA 2V2ZA 1SC6A 2UXBK 2DIVA 4WU3A 2VA3A 4A62A 1HPZA 4MO5A 3NCIA 4P72A 5IQQA 4DCHA 4FWRA 4CJ5A 4OKKA 3I56S 5DK5A 2KL8A 4WJ3B 1CS4A 3FZHA 1H38A 3B9JA 4HT7A 4I2PB 1LW0B 1VC6A 3ILOA 5CD4H 4KB1A 2GHPA 5KI6A 3DLGA 1FVSA 3B82A 4WF9L 2W41A 1ZQIA 4BR7A 2DFHA 3VQBA 2AIRB 3DOKB 2PBDA 1GXTA 4CM0A 4FF4A 1N62A 3EM1A 3W3SA 3KHRA 3AO3A 4AYBF 5J2CA 2WUSA 1IBLK 2QL7B 2ITGA 1KONA 3I82A 2DGWA 4E7IA 1HNWJ 2LXIA 1YDLA 2H3QA 3QFWA 3D2EB 3G6ES 2ZDOA 3VAKA 4BRMA 2BPCA 2P9CA 2ZVSA 3UR0A 2BMBA 1J27A 2Q6CA 4F93B 4EZ9A 3NMUA 2F7VA 1GMWD 5J29A 4O3PA 1ZD4A 3FZMA 4NYPA 4R8UB 3FM9A 4I69A 2IIRA 3NGDA 1ZS6A 1RCOB 4C11B 4DOZA 4J37A 2XMKA 4GC6A 4WFXA 2Y1LB 4X65F 2Y0SC 2W9AA 1LKYA 1HW9A 1LK5A 1OY9A 4BC9A 4IQTA 1WYGA 2FD2A 3MCAB 2AP6A 1RU2A 2GS8A 4JYAK 4QZ9A 5HATA 4LFBJ 3AJDA 3O3LA 3CMES 3HD2A 3OYIA 5DB8A 3SSQA 2BCUA 2O8FA 2HSEB 3MECA 3LP0B 2GH1A 1DTTA 1EP4A 1HJOA 2HQDA 2ZGYA 1Q82T 4PL7A 2FJXA 4CFCA 3OJSA 2V94A 3IO1A 4AHUA 4J03A 4KH6A 3RJMB 9RUBA 2FSJA 4ZTJA 1ZQCA 4TKTA 3GZ7A 3D6FB 2P2CB 2LYVA 1IV0A 4YMEA 3KLVA 1XSLA 5G4DA 1ZQAA 5F8GA 9ICCA 3MR5A 5J2HA 2EFQA 3CULA 3NVKA 3O8MA 4FJ7A 5ADXA 1RA6A 1XNQJ 1AUSL 4NMLA 1T11A 4DCCA 3KG0A 5JXSA 4NB4A 4IG0B 4IOXA 1X4EA 2HMXA 2X74A 3OTOJ 2QWPA 1I5OB 1QTNB 2ZWHA 4CJWA 4J5OA 4O3MA 1ZJNA 3A3PB 3QGIA 3IRWP 2ZM6J 5AKIA 3HVWA 8ICWA 1A5XA 3LGMA 5SWMA 5J2PA 2ITMA 4BUGA 2XI2A 4FJGA 3J7A1 3HSCA 2YKOA 2DQNB 4NLRA 2GW8A 2P6SA 4USWA 3F2DA 4I6AA 3BGOP 3L3CA 4A4JA 2OMOA 4K4ZA 1YUWA 9ICMA 2P9IA 2FYXA 1N34J 2E8PA 4MFBB 2DNOA 4UAZA 2MY7A 3C15B 2H1YA 3VEOA 4DV4F 4FYDA 3L4BC 1QQ5A 3CNHA 5LSOA 3TANA 2EFVA 4C8YA 4LT6A 2J0XA 3L7PA 3I28A 2DCUB 3MCSA 1KS2A 4PXEA 5KFRA 1LWFA 3H8YA 2A41A 3B0XA 3PSIA 3F41A 4QW9A 1JLQA 5LM7E 2Q66A 4CM2A 5LMNF 4FOIA 4JKAA 1XHXA 2KSOB 1AT1B 2O8FB 4C0OC 3MECB 4OYPA 4OX9F 1EP4B 4ZIWA 2Z57B 9ICJA 2AEJA 3I8BA 2XSFA 2FZGB 1EQ0A 1VLYA 4E8UA 1JWWA 3OXLA 1ASUA 4DB3A 4P7VA 3QESA 4FO6A 4LF5J 2VJVA 1A77A 1X4HA 4YS2A 4DSLA 3OS0A 4O0JA 5AKHA 2GQCA 4P2SA 3JSMA 4HCCA 1U6ZA 1UETA 4KC5A 4LF1A 3OJUA 1L3VA 4JI4K 3G2XA 3D1HA 1HWKA 4FPRA 1HWLA 1YG0A 3UI3A 4C2MA 2AYBA 1DRZA 4UARA 4FLUA 3N5FA 1RDUA 2YCHA 1RLDA 3PKMA 3C5FA 4JKHA 2B9EA 3V9SA 2RSQA 1VQ5N 1KQKA 3O3FA 1DY3A 2N3OA 2X1GA 5DB7A 4I2IA 4PXCA 2DNPA 2QO3A 1CRXA 4HTLA 2IFXA 1GOAA 1K73T 4USIA 2C3YA 4HLBA 3OHRA 4AQYF 4DSIA 2BUPA 3V72A 4KH5A 5F9NA 3F5AA 1V97A 1U2VA 3AQFA 1K44A 3C0BA 2ROEA 3ETMA 4GVLA 4QR1A 3DLLL 3THWB 4M0AA 2ZG6A 2DBYA 3TVZA 2W55A 5DDMA 4LSNA 5I3UA 2JOQA 5JVHQ 1YJ9N 4OYZA 4KLIA 3IAM9 4Y3CA 4CGFA 3QUBA 4E7LA 4Y28C 4MAKA 2M0GB 2QL5B 1LWFB 2OZSA 4FLTA 4PGYA 1TKZB 4NA3A 3VAMA 5DBAA 3OYGA 4MKYA 2OI2A 1WG5A 4K8XA 1OPIA 4I9QA 3KD5E 3CJTA 1KTVA 2KRBA 1ZBUA 3ETRA 3JPRA 4KIAA 3W9JA 4UY85 4I28A 4OI1A 1QD1A 4BGBA 4CTAA 2HZVA 2KLAA 4JI6K 4CIOA 3LP2A 5BPNA 2OA8A 2DRDA 1HARA 2GIFA 4HL9A 4KHQA 5I4MA 4Z4HA 2HLUA 3LTOA 4CLYA 3A2FA 2MDAA 3X3UA 4FXWA 2J76E 1Y64A 1UFLA 2E1MC 3JPNA 3AUOA 3K0JA 1JLCB 5JICA 9ICBA 4U7UD 4B17A 3AVIA 1CXUA 2ZUGA 5AZIA 5U47A 2QI2A 3RRGA 1KCFA 1D9FA 5J0OA 2BM1A 1VJ5A 2D0AA 4X65K 3TX0A 1MU2A 2YH0A 4AHVA 3K57A 4NZ7A 4O5FA 3IBCB 2PKEA 4EBDA 4L75A 2HF3A 1FESA 2C3OA 1FXRA 1WC0A 4AM6A 5IINA 1UEKA 1U8WA 5J2MB 2V7YA 1CSJA 4M9NA 3J7AP 1H0HB 2RKIB 4PZOA 4NA1A 4RO0A 2F4FA 4TURA 4PJ0U 3BZQA 3B6BA 3EGWB 4OJ1A 3I87A 3VQSA 2AJQA 3I55S 1N5YA 5D0EA 3M2VB 4BX9C 2M3DA 4KLLA 2ZUAA 4M5NA 2WB1C 1U1PA 3UVJA 2WW8A 5KRSA 3OXGA 1SC4B 5DZ7A 1ICEB 1ZBHA 1UVLA 3A0HU 3GYNA 2FC9A 3I0RA 2ZOGA 1NJWA 2RRAA 3ULHA 4QYZK 3GR1A 3FCWA 4E98A 1O13A 2Y0SD 4L73A 1JROA 1RGVA 4LH5A 5JS2A 3D0HE 5BOLA 3KOAA 3AT1B 3NY0A 3IP0A 3THXA 4JAXA 4NM2A 4KLOA 1F5SA 4EELA 4QJFB 3H6EA 4FNHA 1TGOA 1X4BA 1RXVA 2H48B 2NXJA 3GJRB 3CCQS 3ENHA 4JHDB 2OEJA 4CJTA 1G3OA 3DRPA 4DX6A 2P1JA 4CTAB 1T3NA 4WZMA 1PYTA 1HBOA 2Y8WA 2XG8A 3G87A 3FK4A 1Q9XA 3QZ7A 4MKBA 3M05A 4V1Ak 1IBLJ 2CPHA 5KT2A 3H0PA 3VA0A 5CHGA 1UT5A 4OZ5A 4PWUA 3TTCA 2H5EA 1U1OA 1COKA 3PV8A 1IJEB 3TUJC 1NSQA 3ADAC 3HK2A 1LCUA 2O1PA 4DV4K 3WX8A 3IA0A 3MZIA 2I7NA 1TUWA 4Z0UA 3BPDA 5GADU 9ICFA 3ULEA 3M6ZA 4LRDA 3WK7A 1T94A 4EP5A 2HFZA 1RBTA 3L9ZA 3EWGA 3CCUS 1R8CA 4CIEA 2RS2A 4BS2A 4XH1A 3GFYA 5KFTA 4FWNA 2P9EA 4JKBA 2ZIVB 1S49A 4Z7YA 1LAWA 5J0XA 2VGMA 4Q43A 4OX9K 4C8OA 1U09A 1FJEB 3U1NA 4LR9A 2D0PA 2YQ1A 2MAXA 2F8MA 2Q4TA 4JYAJ 1HYSB 1WLJA 3TOQA 4GVMA 4Y2JA 2FBVA 3SBMA 2OXOA 2PFDA 2HGMA 1F44A 4N56A 3QEPA 1KWMA 1F60B 2CPXA 5LMUK 2OM6A 1ZXIA 2Z4PA 3ZD8A 2PD1A 3GFZA 3U9DA 3TADC 4UBBA 3CCVN 1KC8T 3I0RB 3PDNA 2Z0GA 3CJ7A 4IR9A 2MQMA 3BV8A 1WSJA 3LVWA 3US5A 1ELOA 4OI2A 1GO3F 4FCYA 3MX2A 1NO8A 4LVSA 2PZSA 3KWMA 4XH4A 1TMMA 4KB7A 2NXEA 3U8XA 3CCWA 4OKEA 1D0EA 2DPIA 1JMTA 1B9DA 3CJ0A 3H59A 2M0NA 4ZJOA 4RUBA 1RWWB 5FPMA 4RQ6A 1FRJA 3QEAZ 3D6JA 3V81A 3FQLA 2ZJAA 4B9MA 4I0WA 2DFFA 3LDLA 2MJUA 4KRFA 3MR2A 1QJHA 3J81j 2UU9F 1YIJS 3UQ2A 4N77A 2LXFA 3JXOA 1N5VA 3AFGA 1CJKA 3CFRA 5JU5A 4B1XB 5HR6A 3JPPA 4AQYK 3GCXP 4B6JA 3OLBA 1QSLA 1WSHA 4Y1CA 2Z8QA 3H42A 1KOOA 3QUCA 5FRMA 3AOBA 2OLWA 1C1CB 3G0ZA 5HSPA 4ZVTB 2ZQBA 4YOUA 1MG7A 2HBZB 1P8GA 1SQKA 3O80A 3DLKA 4WPAA 1JK9B 4F7VA 4CD1A 3PR4A 4FJMA 4CO4A 2HHHJ 2YMQA 2Z1JA 2D4WA 1DQAA 3W2WA 1RZMA 2B8QA 2VPWB 4QBUA 4L8RB 1L7NA 2OH2A 3ENVA 4XIUA 4JN4A 3VVTA 2ROGA 3A8KA 4E1NA 4AL5A 4GVBB 1BHNA 1KVKA 1S1VA 3VEWA 3K75D 2O8DB 2V52B 4ZCLA 1VQLN 5ETLA 2ZGZA 1ZQUA 2JC0A 4FVUA 3RBXA 4M6WB 1T9VA 3KJVA 1UCNA 3ISZA 1WJ9A 3VEZA 2KJWA 1ZC6A 1H7WA 1Z25A 3PO4A 2JNJA 1T8EA 2XWYA 1LB2B 3RMBA 1YITN 5DQHA 3W64A 5E41A 3CJ2A 5SZTA 2R8HA 2JL9A 4ES1A 3KHLA 3CJRA 5J0YA 3M1YA 2HQGA 4J9MA 4PXDA 4ER8A 5FIIA 1TVRB 5F0XA 4PUOA 1IXRA 3U02A 1N48A 2GA7A 4WTYA 4B9UA 2BOPA 3PEJA 1L7MA 1O0PA 2JZBA 5M1NA 5JS1A 4FF3A 2G8IA 2JWNA 2QMWA 2K8GA 2E6MA 3CW2C 1WAFA 1KQSR 3PNCA 1MROB 1JCEA 3W3DA 1HQ2A 4ED7A 3T5KA 2BHNA 4DR5F 4QZIA 4UOHA 4ILRA 1QAIA 4DZ6A 3GJQB 3V81B 2NRRA 4JI4J 2IM0A 2CXEA 3FGUA 2G09A 4N8OA 3NCPA 8AT1B 1NGBA 1J97A 5B08A 5AQZA 3V9WA 3I4PA 4FBTA 2Y8YA 5LT5A 3VQCA 1CJKB 2K89A 1LK7A 4CF3A 1RB0A 1R43A 2QK9A 1TUVA 4TY9A 2V67A 4Y2XA 1MMLA 1UJ5A 2Z2ZA 1VLOA 2JSXA 2R3VA 3G6XA 4LF9F 2CJ9A 1AA1B 4YHHF 4ZPAA 7ICLA 3V9UA 2XLIA 3DLRA 3TUPA 3DLKB 5EE9A 3QLHA 2OEMA 5ALYA 2XSJB 1C4AA 4KI6A 5HQ8A 1B70B 3HP6A 5J2JA 4C8KA 4M04A 5D4PA 3QMLA 2JLFA 2KE7A 2Z2MA 4PR6A 1SV0A 3V6DA 4CZKA 3LDSA 2KTQA 3T9NA 1W25A 3H1QA 2UUCF 2Q0ZX 3BZCA 5C10A 1JL1A 1EX8A 1L6NA 1HKGA 2PGCA 4BRDA 2ALZA 3HFZB 2MGZA 4DSJA 1UPMB 5BRHA 3VGLA 4FJ9A 4KAZA 2IVNA 4JV0A 2RHSB 5B09A 1BCMA 3H5YA 3IRXB 2DTUA 3CIMA 4JI6J 3V1OA 1UJ6A 2KYZA 4WQ4C 4QIGA 5ALDA 2FHJA 2JZBB 2MY8A 3AA2A 1X9XA 3V2UC 5C24A 1XERA 1Q9YA 2XYGB 2KQ2A 4BQZA 2QMXA 4CQ1A 1Q3VA 2RS8A 3HSJA 1KAYA 3CCJN 1JXLA 4CDIA 4EEYA 4BR0A 2VU5A 1OVQA 4YMMA 4W5NA 3ET6A 2B0GA 7ICHA 2MZSA 4K4GA 3ZTOA 2CPEA 1KNZA 4M9GA 1C7YA 3N4QA 1NGFA 5M1QA 4RTFD 8ICYA 3MCNA 4FWKA 3RR8A 4KR0B 5HL7L 4DTMA 3Q8VA 1CC7A 4I2BA 3SCXA 2DGXA 3UXNA 2K1RB 5AE2A 5BYSA 2ZOMA 4AUKA 5H9EK 4YR0A 2LBOA 2BR0A 4PPXA 5F41A 1TYQA 4ED6A 3ZSZA 3AVAA 4OHYA 1NDLA 3J80U 2HPUA 4RW4A 5ALUA 1YX2A 1U0HB 5KAFU 1B4SA 4EYHB 4O3RA 3MDFA 3N7SC 4FZZA 1JUDA 5KT7A 1X0FA 3K5OA 2F65A 2NUUG 2R4FA 2J8AA 3D2WA 3J7ZT 3VEVA 1LVHA 4QZAA 3ALRA 2X1AA 2RU9A 1F9EB 1X4CA 4QYZJ 3U9ZA 3MUVP 1T3OA 1X66A 2LQJA 2K8CB 2UU9K 3MN6A 2QLXA 4NEYA 3QRPA 1T6DA 2LKYA 1NJIT 1ZQZA 4CK3A 5F8LA 3ZX2A 1FJ7A 2VPZB 3QFHA 3CE8A 3DGVA 4OYOA 4UAWA 5I3QA 2A3VA 1WEYA 1UZHA 3SZ2A 5AHXA 2K3IA 4KLJA 2DO0A 4G1QA 2XI3A 3PUFA 3VQDA 1TKTB 2W9BB 1SVDA 2CGJA 2XS7A 3IMQJ 1VJQA 3FMBA 4CBUA 4HHUA 3IAYA 2V9WA 5GMEA 3GG1A 4AL6A 4MIAA 3K2PA 4PG6A 4RPYA 4QPXA 4KN7A 3NH2A 2CDQA 1NXIA 1DQ9A 2XWXA 4LRAA 1T6CA 1HNXF 1FRKA 3BEXA 4HKQA 1M5SA 3J7YI 2F63A 4IO9L 4F71A 2G4BA 2VWJA 4DV4J 2WTUA 1ZYQA 2GLEA 1O6XA 3DOMA 3KK1B 2B4JA 1SV5B 3HMJG 1HI8A 3SQIA 2GZOA 1Y7PA 3IBWA 1YRXA 4OYBA 1L3KA 2AX0A 3LW5C 5L1LA 2F44A 4A57A 2DO4A 3RH6A 4YVZA 4CP5A 2DGOA 4KKOA 1TFRA 2JHDA 4NV0A 1N54B 3BDPA 2VQFJ 3L4IA 3WKDA 2WHEA 4OJ3A 1UCVA 1U7LA 4AE5A 1SC3B 5B0FA 3KUHA 2RT3A 2XHBA 3T1YF 1LAVA 2GWJA 4QS9A 4C9DA 3SV3A 2DKXA 5LMUJ 3VGTA 1A5WA 2YJFA 2JR5A 2VFUA 2EG1A 5T7BA 3C2LA 1VRTA 3RTVA 4CEZA 2BE9B 2J9DE 4FJ5A 2FVCA 4ZS6A 1DAXA 1FFGB 1R59O 5JVGL 2Z7JA 4NCGA 3EY1A 3FEXB 1SCJB 3MF5A 1NHUA 1PK1B 2DHGA 2DNYA 3ZZUA 1WCLA 3PKYA 1X60A 4LZDA 1SJRA 4MMOA 8ICJA 3I0SA 4KQZA 1XN9A 4HAIA 1LWEA 3MM5A 1M5KC 2H3EB 1L7PA 2Y0SF 1NZPA 2ZC3A 2RJZA 5M1FA 2LM4A 4ZVFA 3SSSA 4OJLA 1AUDA 4YHHK 4XA5A 4Y2TA 4G1QB 1AROP 2P9GA 2F40A 3O4QA 3BBBA 2BKEA 3RSEB 5HMZA 4AQYJ 1XEZA 4C3KA 3SLCA 1NU0A 3PX4A 3Q2TC 4HI2A 3CCLN 1Q1KA 3UCGA 4MDAA 2VIHA 1EB0A 4P2FA 1V9PA 4WE1A 3IG8A 3NVWA 3PW2A 3L2RA 3ZZYA 1DZ5A 3BS7A 3CD0A 1VK0A 4Z6CA 2GFFA 4ETZA 4H4OA 3PYFA 3EPGA 5BPLA 1S1TA 3FKBA 3MPWA 2UUCK 1S6PA 2LA4A 3H08A 1U48A 1R0AA 2PFFB 2VBWA 5IV3A 3ZSOA 1S9EA 3KG1A 4JWNA 3DOMB 4JI0F 3HBTA 3HHLD 4JI8J 3UDCA 4KV8A 2HIQA 1FFSB 5AQNA 2CVIA 2E2QA 2QRRA 4H0VB 1Z4OA 7FD1A 4F4WA 5D0GA 4IS7A 1A76A 1YT3A 1IR1A 1U6FA 1VQ7N 1UEVA 4Q2MA 3K58A 3ZZTA 2NREA 4LF7J 4RX6A 4FZYA 2F8KA 2GIQA 1UL3A 2HBJA 1SJFA 1UZDA 2EG2A 4GLXA 3VAGA 4J91A 4RKUC 1M5HA 3G71S 1Q7YO 1YAGA 2W2MP 1Z05A 2KN7A 2KDOA 3T5LA 3RBDA 1BXNA 3NS5A 4R66A 4C3LA 3JS9A 3OPXA 1WSRA 4N76A 1CVJA 2Q79A 1TV6A 5E3PA 2LYBA 3MM8B 4K8RA 2GC8A 3P83D 4QOTA 1YXQA 2QC3A 9ICVA 4PCQA 4CLTA 3NHGA 2R42A 3HJEA 1D3WA 3Q0AA 2G0CA 3LA0A 1ZQRA 3R9PA 3N0VA 4M1KA 5GAHI 1NH8A 2C28A 1LW2B 2C2ZB 5J2QB 2CQIA 3I0SB 1LWEB 1RKJA 2MZQA 2D0OA 1IJJA 1NH7A 2VDHA 2WHOA 3D67A 1YZ6A 4K2XA 1IJFB 3C7NB 4XQ8A 5L38A 2CPJA 2BPFA 2GUIA 2LHTA 4MN4C 4EU0A 2W25A 1RTHB 1J2NA 2CNOB 4ECXA 2IVYA 3ENAA 1C0GA 1BU6O 1RKIA 4GW6A 1S1TB 4JI5F 4LF8J 4B9VA 3F9KA 3C16B 2JEGA 1MA7A 1VQPN 2V9KA 4DCPB 2VBZA 3UNYA 3NBPA 1R0AB 3MWBA 4CESA 3UXOA 3Q8LA 1R89A 3GIMA 2HMIA 3CG7A 3NRBA 3V6JA 2K4PA 1CXQA 5A2QU 2EZXA 2DYAA 3D54A 3R5AA 1RDBA 4GXKA 1HWUA 1RU1A 5L46A 4PKIA 1UA0A 4USKA 2PC6A 2G07A 2YWEA 4OJ6A 3RW7A 4W4MA 2OPPB 2ZIUA 4OZ0A 2M8HA 5EXWA 4OMFG 1YTAA 3QXGA 3IUCA 5E3RA 1EHWA 1FI4A 5J2NB 2DEIA 4AP9A 1EXNA 1ZZFA 4DR3F 4K4IA 4MLHA 2RE1A 3NCRA 3WQPA 1N63A 4KPCA 2FY8A 3O3GA 2CJQA 3DRRA 1N56A 2DXDA 2G13A 2V7ZA 3ZT1A 3ZX0A 5M1KA 4F5RA 4PABA 4FVMA 4C1NI 2WBMA 2P9UA 2YB4A 2BBEA 2YPZA 4W5TA 3MEGA 2LQ9A 3SQGA 2ZHOA 3IFRA 1D9AA 3LF0A 3ZETA 5IM0A 1NUEA 3L95X 5AI9A 3TR5A 1OSDA 3QT5A 7ICIA 1KAZA 2CQBA 3J7YU 4U7UK 4PAAA 2PEHA 1F5CA 1YJNS 3QIPA 1T03A 3ZZ0A 2QWQA 2UVUA 1ZQDA 1ZM2A 5CYMB 5KT5A 3KLFA 2A1AA 1JCGA 4X4NA 2B9WA 4IFYA 3IDWA 1OO0B 1S5ZA 2LEPA 2D5RA 3FSIA 1GMUA 1HKAA 5H9EJ 3H5XA 5G5GA 4Y2MA 5LJ3Y 3JQKA 1PCAA 1Z6RA 1W7AA 4RQ3A 1ASVA 3ZSRA 1FRIA 2U2FA 4A5AA 4KHPF 2OKQA 5AI0A 1UFKA 3QWUA 2J9CA 2I2YA 3BR8A 2G8UA 2UVRA 1C6VA 3SQOP 4RUHA 1NK0A 2OWOA 4LQ3A 1PYOB 3VPZA 2PA3A 4XAKA 2EAPA 4X4RA 3CJKA 3KD3A 1K5OA 3QEVA 1CULA 1KOHA 3VQ8A 2PMZC 5ADZA 3AARA 3C6HA 4ZK7M 1UT8A 2XMTA 1RWPB 3PIOQ 3IGNA 2ZTCA 4CK1A 4CFBA 4CJ7A 9ICTA 3R3LA 4DSKA 2UU9J 2NZ4A 9ICRA 4DPOA 4F04B 3DC2A 2VONA 5GTHU 1EJ7L 3CCQN 3KHYA 2G0IA 3L0QA 2DNLA 4JK9A 3A1YG 2LYHA 5GMDA 1ITPA 3QE9Y 2NUBA 3NOCA 2P9LA 3UO0A 4BLGA 1PBAA 1E4GT 4GKKJ 4KY3A 3DRRB 3MBYA 4OZ2A 4NLBA 2NUHA 1BWEA 1CJVB 1RDCA 1UP1A 4BJQA 1WOPA 4X4VA 4ITSA 4NLUA 1FFWB 3JPQA 2JLGA 1FJCA 4Q0BA 2A1BA 1M6YA 5KFMA 2NRVA 3SQGB 3CDEA 5CD4A 4OX6A 4PWDB 3AM9A 3ZETB 3DMJA 1S0VA 1O03A 1FO1A 2CH6A 3CMQA 4URSA 2A10A 3R5JB 5IM0B 3H0MB 2NYHA 1KQSM 2FLOA 1ZA2B 1HL6A 4Q2LA 4JI0K 4RUAA 3OV7A 2CQ4A 4U96A