3PX4A

Crystal structure of bacillus dna polymerase i large fragment bound to dna and ddctp-da mismatch (wobble) in ajar conformation
Total Genus 191
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
191
sequence length
579
structure length
549
Chain Sequence
KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural evidence for the rare tautomer hypothesis of spontaneous mutagenesis.
pubmed doi rcsb
source organism Geobacillus kaustophilus
molecule tags Transferase/dna
molecule keywords DNA polymerase I
total genus 191
structure length 549
sequence length 579
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2010-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3px4A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 3px4A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3px4A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3px4A01
3M9OB 1FKOA 2X6NA 3G0ZA 1WSIA 4CF1A 4Q5VA 5J2BA 2OPPA 4QZAA 1BPYA 1BIUA 5HP4A 3AVIA 1ZBUA 3AVGA 4CHPA 3RH6A 3C23A 3PR4A 3OYDA 4R5PA 4DTRA 4OKJA 5L1KA 4M9LA 1HMVA 4BWJA 5KFSA 3RTVA 1LWEA 4QOZB 3MEDA 2C28A 3ZSQA 4YCXA 4KN4A 4FBTA 4CJ5A 3V72A 4AHCA 5DGAA 1ZQIA 1QS4A 1VRTA 1RT5A 4DF4A 1U47A 4ECRA 3H4DA 1NKEA 5HROA 2BKEA 2C22A 2W9BA 2ISOA 3PW7A 1B22A 3TANA 4HUGA 4M3UA 3VN5A 1C1AA 3ZSZA 4IQWA 1BPXA 4WE1A 5IIMA 3OYKA 2P66A 1S76D 4BDZA 3ZSYA 4FM1A 4ED2A 7ICLA 4KV8A 3SUPA 3MFHA 4ELTA 4KHQA 3QZ7A 5J2QA 3VA3A 2D5RA 4ZTFA 4RW4A 3LK9A 1UOCA 4FJMA 3H8JA 1W0HA 3V1QA 4TUSA 3DRPA 4KLGA 1TL3A 1VSLA 4FJNA 4NCGA 4CERA 1X9MA 4CGIA 4YMMA 7ICNA 3PX6A 4M0AA 2IS3A 4UB4A 5BOMA 1KVAA 2Z1JA 4B9MA 1D9DA 4DU3A 2IAJA 4XQ8A 2ZUCA 2EHGA 1NK4A 1NK8A 1S10A 1NK7A 4FLVA 5HRRA 3IG1A 9ICTA 3AVBA 3C2MA 3BQ0A 4IRCA 4KFBA 3K57A 3V9SA 3EWAA 3SQ4A 2HHXA 3QIOA 3KD1E 1A76A 1HNVA 1RYSA 4DSJA 5DQGA 4QZ9A 8ICWA 2XO7A 4I27A 1BQNA 4NCBA 4QW8A 3BJYA 3K4GA 2E6MA 1CZBA 4I2CA 4KTWA 2HHSA 4N76A 3BQTA 3V1RA 2AGPA 3BQ1A 3B0YA 4DL7A 4I2QA 4DTMA 3AU6A 3EW9A 1XS9D 3RB0A 4B8AB 1ZYQA 4O3RA 1BIZA 1DLOA 3VQ9A 3QNOA 4FJLA 5DQIA 1AROP 1ZQWA 4M3WA 2DY4A 1JIHA 3AO5A 4EBDA 4OPJA 2PI5A 4EP4A 1KTQA 3HW8A 5EU7A 2C2EA 3ZSVA 3HXMA 1RT3A 4Z4EA 3PW5A 3QLHA 4QW9A 2F8TA 3SUOA 1ZBIA 4YP3A 7ICVA 5DMRA 3DLGA 4E89A 3RRGA 3GDXA 8ICUA 1T8EA 4HVJA 1RT6A 3NH1A 3ETLA 2R8IA 1ZQPA 2BPFA 3RJFA 3GIIA 4F4YA 2ZTEA 4DTJA 1TK8A 3OYLA 3TI0A 4IDKA 3MR6A 4YMOA 1IKXA 8ICMA 1BI4B 1KCFA 1CUKA 4B9UA 3PW0A 2ATLA 5FROA 7ICRA 3D45A 3B6OA 3MEEA 1QTMA 1NK9A 1ZETA 4DFPA 4NYFA 3ZDDA 1RT2A 3ISBA 3Q8LA 4J9SA 1HUOA 4UAWA 3NTUA 2FBVA 9ICRA 1S9FA 5DKWA 4UB3A 4FJJA 3OGUA 3DLEA 4QWEA 2XGPA 4O5BA 3UXNA 4OPKA 3OJUA 4Z4GA 3L3VA 2BPCA 4F2RA 8ICSA 2IMWP 5KFXA 2JZBA 2Y1IA 1HQEA 1XI1A 1RCHA 1VK0A 1HYSA 3MFIA 3S3OA 4EEYA 2AGQA 5KG4A 3RJGA 1RYRA 3DI6A 2DPJA 3KK1A 2PFPA 3OS1A 4ED7A 4JWNA 1ZQGA 4QZEA 1KFDA 4ELUA 4IRKA 5J2CA 1UWBA 1VSJA 4F4XA 4Z4IA 3AO4A 3FYHA 5J2JA 2YNHA 4UB2A 2WOMA 3OYMA 1XO1A 3OJSA 1IG9A 4NLNA 4CEQA 3E01A 2ZD1A 4YFUA 2W9BB 3EPIA 5JUMA 2PYLA 1S6PA 2UVRA 5J0RA 3KTQA 4C8MA 3SI6A 1NK0A 4QZCA 1CZ9A 3SPYA 4B08A 2NRXA 8ICRA 4FZYA 4CEEA 2HHVA 1HNIA 4E1MA 1T4GA 1J54A 5IIOA 4FS1A 5KG6A 2H5XA 5I42A 3LP0A 4AHSA 4F5NA 3QEWA 1XSLA 3HPGA 4CJFA 5DGBA 1BISA 4Z6CA 4PWDA 3WNEA 4EYIB 4TSXA 3THVA 3AO1A 2AGOA 2HB5A 4CJ4A 3V4IA 4ICLA 3C6UA 1RDDA 3I0SA 1L3TA 9ICPA 3VQQA 3G6XA 3O4NA 4KKOA 4QZGA 1Y88A 5C42A 4LZDA 3HM9A 3TFRA 3KLGA 7ICQA 4R63A 4Q43A 1J9AA 4O4GA 3K5LA 1S1TA 2G8KA 2G8FA 4EP5A 4CGJA 1WLJA 3DLHA 3QEPA 1EXQA 5HRSA 4KHYA 4CFAA 1ZQUA 1S1UA 1JLBA 3TAEA 2XGQA 1WAJA 5CY4A 3HL8A 1A5VA 4J2BA 5CZ2A 4W5NA 3QEIA 3B0XA 4LVSA 1FKPA 4CGGA 3KKSA 1MQ2A 1RTJA 2LYHA 4OKEA 2HVHA 8ICBA 3PO4A 8ICCA 2GV9A 5KG1A 5J2AA 2XCPA 1RT7A 1UAXA 3UXPA 2KFZA 2KW4A 1SKSA 2VWKA 2ZJ5A 3DRSA 4JWMA 3OVNA 4ELVA 5EWGA 3AA3A 4M6WB 2BE2A 4N56A 4LSLA 4FZZA 1S97A 3TAGA 3ZSRA 5KFIA 2UVWA 1YTUA 3HYFA 1N5YA 4DQQA 4O0IA 1S9GA 4OKKA 4I2BA 5KRSA 2IA6A 2I5JA 3HSTB 4KLTA 3LZIA 3LALA 3V6KA 3RR8A 3NHGA 3SQ1A 4RUAA 3I8DA 4JV0A 4PHPA 4JLHA 4E7JA 4DF8A 3KHHA 4DTXA 5SZTA 4KREA 2HHTA 2JGUA 3RJKA 5KFGA 5DQHA 5TZVA 4NY8A 4CEOA 4H8KA 1R0AA 3UQ0A 3BGRA 1X1PA 5HBMA 4QWCA 2RN2A 3VQAA 1CEZA 1D9FA 4KLDA 3QESA 2RDIA 1ZQYA 5EWEA 4K4IA 2G8VA 4RQ3A 4DMNA 1B9FA 4BDYA 2P6UA 2R8JA 4G1QA 3JPTA 4F8RA 1K6YA 4Q8EA 7ICKA 2YHAA 3NF6A 3QINA 4ECXA 4O0JA 2EX3A 7ICEA 4O55A 5KFRA 4CJSA 3T5LA 1ZJNA 5KFEA 4ECTA 1VSKA 4KLOA 9ICJA 2AU0A 5DDMA 5HHIA 4KLEA 3KHGA 4P4OA 2YV0X 3V1OA 3G10A 2FBYA 5DBAA 1Z00B 3NE6A 4DS4A 4PGQA 1HJPA 4Z6FA 5CJ7A 2IBKA 3IS9A 4LZGA 5KFTA 3KJVA 4RPXA 5KFMA 1L3SA 3O3GA 3K59A 5DBCA 3LP1A 1C1BA 3HK2A 3QZ8A 3SNNA 5J0UA 2X6SA 1QSLA 1REVA 4CJPA 1RBSA 4GLXA 3V6HA 4RW6A 5KT2A 9ICQA 5KFOA 1IH7A 2GBZA 2R8GA 3KHLA 2ASLA 9ICGA 1I39A 2VANA 3QNNA 3MR5A 4YXMA 3OYFA 3V6JA 2E6LA 4ECUA 3C2LA 1ZQSA 4MFFA 1S9EA 5DK5A 1A77A 1GOBA 2PZSA 3MR2A 2G8IA 4IRDA 2HMIA 2W9AA 3BDPA 3Q8SB 1ZQDA 4CEBA 3CFOA 1TFRA 3LAMA 3RBDA 2ZTCA 1TV6A 3O4QA 4CIGA 4HCCA 4DL5A 2C2DA 4IBNA 2F96A 3MAQA 3PNCA 3C5GA 1HUZA 4B9LA 4EZ6A 2A1SA 3JYTA 1UA0A 2ETJA 5J2EA 4RPZA 1FK9A 4KB1A 1BQMA 3NAEA 3NGDA 3CM5A 1UT8A 1ZQAA 1KLNA 3ZSOA 1VSMA 4PH5A 2QXFA 2XC9A 1BCOA 5KFUA 2P1JA 1X9SA 3H08A 4QWBA 9ICHA 4HUEA 2UVUA 1DTQA 1S1WA 2D0CA 4Y1DA 3OYBA 4KAZA 3SQ2A 1TGOA 3P5JA 3OHBA 1F21A 5DG8A 3JPRA 5CYMA 1JN3A 3GIMA 3KD5E 3OYGA 5J2PA 5KRTA 1ASWA 3SCXA 4MEYA 4LD0A 2P5GA 1HQUA 3LWMA 4Z4CA 4M9GA 3ZDCA 5C24A 2ITGA 1ZQOA 2KZMA 5K14A 3ZT1A 3OYJA 4J9NA 2GUIA 2RKIA 1TKTA 3CFRA 1C7YA 4I2HA 3K2PA 3U6FA 4O5CA 3P83D 1NJXA 2Z1IA 4Q8FA 5FRMA 4DSFA 4NCAA 7ICSA 5KFNA 4PHEA 2WONA 3Q8RB 3RRHA 2JEIA 1VSDA 2D0BA 3RH5A 4DQPA 4ID1A 4C8LA 1C0UA 4B9NA 1HPZA 1COOA 4IFYA 3SZ2A 4GVMA 5L9XA 3DYAA 4CCHA 5KG7A 3MDAA 4XRHA 8ICAA 4M47A 2OYQA 1CXQA 3LDSA 4CJLA 3RB3A 1BPBA 2B6AA 3RBEA 1EP4A 3AVNA 4CFDA 5DB9A 5EWFA 4GC6A 1Q9XA 1ZQXA 4KPYA 2OPSA 2FLLA 3ZT4A 3RH4A 2FLPA 4I2FA 3V81A 1TV9A 4BE1A 1Z25A 1KSPA 1N48A 1Q9YA 4FVMA 1S1VA 4I9LA 4UAZA 1U9LA 3MABA 4NM2A 2G8WA 4CIEA 3PR5B 4B9VA 3DOLA 1EX4A 4DSKA 3AVLA 3ISNC 3NF7A 4R64A 1Y97A 3Q8QB 3HP9A 5BOLA 1ZQLA 2Z1GA 1U04A 4I2JA 3GQCA 1RT4A 3H8WA 1VSHA 2ZTDA 4E0DA 1RXVA 2BCQA 4DL6A 7ICJA 4RU9A 4DWIA 4IQUA 9ICVA 2VWJA 5KFBA 1YTAA 4C8KA 1QLNA 1ZQFA 1JXLA 4P2HA 3HT3A 4BDPA 3ZD8A 5J2GA 1I3AA 1HYZA 1RNHA 1RXWA 4E7HA 2OA8A 4YR3A 4Y1CA 4KLHA 3AUOA 4FO6A 5HMMA 4FXDA 4F4WA 2NRTA 2Y1JA 4CJEA 4RPYA 2FBXA 4DU4A 1KEJA 4AILC 2DFLA 1K1QA 3ZCMA 3NH2A 4CK3A 4KB0A 5KFWA 4RQ4A 1H38A 3T5JA 1TVRA 2G8UA 4ECWA 3RWUA 3RJHA 2ASJA 8ICVA 1XSNA 4CIFA 4QZDA 2B21A 4YFKA 1WNSA 4CHNA 9ICAA 1EKEA 4CHZA 2XY8A 1ZBHA 4W5TA 1SZPA 1JL2A 2E4LA 3O3FA 3L2VA 2HW3A 4CF9A 1NK6A 4PHAA 1TVAA 5L1JA 3ITHA 4P4PA 2MUTB 4ECVA 4MFAA 5J0TA 1ZQRA 2YNGA 3OYIA 3PUFA 5HHHA 2KN7A 4YMNA 4QZ8A 1Z00A 2W42A 1XU4A 4CK1A 4FM0A 1EXNA 4O3QA 1MSWD 2BCRA 2ASDA 3C2KA 1U49A 3TAFA 4BWMA 4RW8A 3TAMA 1A5XA 3KK3A 5JS2A 3SQ0A 3N4MB 3SV4A 2HHQA 4FK4A 1JLAA 2ZJ8A 4CK2A 4DTOA 3TQ1A 2YNFA 4NM1A 4W5OA 1BL3A 1ZQTA 3RMBA 2YKMA 1KLMA 2DFEA 1BCMA 3OYEA 3ZDBA 2PYJA 1G15A 2W9MA 8ICEA 4K8XA 4FJ5A 4M9NA 3V9ZA 2I9GA 3ZT0A 2W8KA 8ICJA 4GMJB 4W5QA 4YXJA 4ECQA 3M8PA 3RMDA 4PPXA 3C94A 4JV2A 5D4BA 3KHRA 4C8OA 1LWFA 4QCLA 4I2IA 3L2RA 1ZQNA 3PX0A 3PV8A 1BPEA 1QHTA 3NBPA 4AH9A 5KT3A 1BGXT 2OZMA 3MXIA 4J9MA 9ICBA 2M9NA 4PGXA 5FRNA 4DO9A 5IINA 2NRZA 2F8SA 4F50A 4IFVA 4H4MA 4HUFA 9ICMA 4O5EA 5CHGA 3UIQA 4FLXA 4QWAA 3LPTA 2NUBA 1MQ3A 3MDCA 4NXZA 5KT7A 1JXBA 4RQ8A 1J53A 9ICEA 4F3TA 2DPIA 5KGXA 3JSMA 5KFPA 4TUPA 3MR3A 4DS5A 5J2NA 4CEFA 3OS0A 1SKWA 3C95A 2YNIA 4FLZA 4F91B 1J5OA 4GXIA 4AHUA 4KI6A 4PGYA 1IKVA 1IM4A 3MBYA 4I7FA 1K1SA 4YD1A 4G3IA 4B9TA 8ICXA 1HYVA 4K4GA 1WCLA 1RTDA 4FJHA 3DRRA 2R7YA 2KQ2A 4CF8A 5KFKA 4RUCA 1QSYA 4JS4A 3VA0A 1MC8A 5KFYA 2KTQA 3PW4A 4QZHA 9ICUA 4YNQA 4CESA 2O4GA 4F4KA 3O3HA 3TAQA 3HVRA 2IHMA 3WNFA 5KFFA 3RJIA 4XA5A 3C5FA 4I28A 2VG7A 2RDJA 4RQ2A 2XY6A 3TAPA 2ZE2A 4F4ZA 3M9MB 4ECZA 4R8UB 5KTQA 2W9CA 1SV5A 4FBUA 1LW0A 2ZJAA 3RMCA 4B9SA 4ID5A 1JKHA 4EBEA 1U4BA 3PY8A 4ED3A 5J0OA 1QE1A 4IR1A 3AO2A 5CP2A 1QSSA 4RNMA 1N56A 4KTZA 3NGZA 4M04A 2BDPA 4IG3A 5CZ1A 2YKNA 1ZQHA 3V9XA 4RW9A 2IGIA 1NOMA 5EOZA 4RQ0A 3KLIA 1TK0A 1Q8IA 2J6SA 4DG1A 4JUZA 4DL3A 4FLUA 2X78A 1RZTA 2VA3A 2FPLA 5J0XA 1ZQVA 4CFBA 3OYHA 3ZT2A 4KHSA 5KFHA 4J9KA 3TWHA 4AHTA 5KT5A 2QK9A 1TL1A 5FDLA 1A5WA 3K75D 8ICFA 4CHYA 4HYKA 1B9DA 1Z26A 4KLMA 1HRHA 3G6YA 1NJWA 3C6TA 1RTHA 3NCIA 3OS2A 1LB2B 4LY7A 5DBBA 3ZSXA 5KFJA 9ICFA 3QEVA 4PY5A 2FMQA 1JLEA 3Q8KA 4KMUA 3AU2A 4J9OA 4Q45A 1C0TA 3OYNA 2KZZA 1W9HA 4FK2A 1LW2A 5HMLA 8ICGA 1S1XA 3F9KA 3MXMA 2AQ4A 1SUQA 2C2RA 4FLYA 4Z6EA 3ORYA 7ICTA 4Q44A 9ICCA 5J0QA 3H4BA 4O3NA 2LSNA 4F5OA 5J0PA 5IILA 3LWLA 4JK1A 1L3UA 5KI6A 2RPIA 1BVSA 4XIUA 8ICZA 4DSEA 4O5KA 3U3YA 4YR0A 3A2FA 4NLZA 4UBCA 2P51A 3V9UA 2VG5A 4DEZA 4DFJA 2RF2A 4DQRA 3B6PA 5DG9A 4TURA 3QIPA 2FC0A 4FW2A 3M8SA 3HO1A 4YVZA 4R8UA 4CF2A 4MQ3A 1RBVA 4RNOA 3AA2A 2G8HA 4DOBA 8ICPA 5HNKA 3GIKA 3RB6A 5J2MA 1XWLA 3NF8A 1CLQA 3PX4A 1RT1A 4QZIA 8ICIA 4KHNA 1KDHA 1T05A 5J2DA 1BPDA 4FZXC 1ZQBA 2X74A 3T5HA 4E3SA 3H8SA 1RDBA 3MGIA 4JV1A 3KK2A 4N5SA 4HCBA 4AHVA 1ASUA 3ZSWA 3MEGA 3JPOA 7ICMA 3OHAA 4DTNA 4DFKA 3T19A 4R66A 3EYZA 4CFCA 4M3RA 4RQ6A 3QE9Y 4CF0A 4RQ1A 3FFIA 4OLAA 8ICNA 3Q8PB 4I2EA 5HRPA 5J29A 5D46A 1ZQQA 3RB4A 4BE2A 4PHDA 4DSIA 1KFSA 4O3SA 2VA8A 1ASVA 1JLCA 4MF2A 4QZBA 4ED1A 9ICKA 1O1WA 2AQ0A 1S0OA 4DU1A 5HRNA 2KZ3A 8ICQA 4BE0A 1TK5A 4M9HA 7ICUA 5I3UA 1U48A 3P1GA 1RBRA 3HWTA 4LH4A 4FJKA 5IIKA 4P4MA 1ZJMA 3RAXA 3NF9A 5IIJA 3PMLA 4DQIA 4IG0A 3SPZA 2XY5A 4CJTA 1VSFA 5KFZA 4UBBA 3MECA 3NDKA 3UQ2A 3VQBA 1TKXA 3T3FA 3GIJA 4FJXA 3M8QA 4QAGA 2BQRA 2V4QA 2YHBA 1TAUA 3ISDA 4CJUA 3SJJA 1WSGA 3HP6A 5HLFA 4R65A 1NJZA 4FM2A 3L8BA 4YQWA 5J0SA 4MF8A 2XRIA 3AVFA 3TABA 2BQUA 4UB5A 4IR9A 2J6TA 4FJ8A 2NRWA 1VRUA 3I0RA 2AJQA 1EETA 4CJ3A 5T7BA 4MFCA 4B8CA 4E1NA 1JX4A 7ICOA 3GV5B 9ICNA 2A1RA 4M42A 1BI4A 1KRPA 4CE9A 4E19A 3VQ7A 2Q0ZX 4XUSA 4O9MA 3DLKA 3OSNA 1DOQA 3AO3A 4OJRA 1MU2A 2XHBA 3PVXA 1U45A 4YR2A 3AVMA 5L1IA 1C1CA 1KVCA 4Z6DA 2QKBA 5JS1A 3H7IA 5L1LA 1RBTA 4FK0A 2BHNA 2FPKA 8ICYA 2OZSA 4TUQA 5CWRA 3AVKA 4YD2A 1JL1A 3L2UA 5C5JA 3SUQA 3V9WA 2ZUBA 1ZQEA 4F3OA 1ZBLA 5CYQA 2A1JB 2FMSA 2VG6A 3PW2A 1YT3A 4J2EA 3N97B 1S0VA 1WSEA 1S5JA 4J9QA 5CR0A 2J6UA 4M41A 3NFAA 7ICGA 9ICIA 4I9QA 3SYZA 2Z1HA 4ED0A 1NOYA 3HJFA 4JRQA 1S0MA 5KG0A 2BCSA 5DLGA 1FXXA 3EPGA 3VQ4A 4X5VA 4DTSA 4BXOA 3ULDA 4F5QA 4QZFA 1SL2A 2IHNA 4B3OA 2PFNA 2BGGA 3ASMA 2JZBB 1UT5A 5DLFA 3ZDAA 4O44A 3RAQA 4HTUA 2XY7A 1X2IA 3AV9A 3CM6A 8ICHA 2IDOA 3L2WA 5J2KA 4KLLA 4DL2A 2F1JA 3WNHA 2DFFA 4F92B 4OVLA 3D0PA 3ZDEA 4H4OA 4KHUA 3K58A 4DTUA 1IKWA 1T3NA 1N6QA 3QEXA 2QKKA 4E7LA 4JS5A 3IRXA 8ICKA 5D3GA 4ED6A 4RZRA 2W8LA 4J2AA 4QWDA 3CFPA 4FCYA 4I2PA 5KG5A 1NKCA 3MGHA 2UVVA 4I2DA 3LAKA 3SI8A 4FLWA 1NJYA 4DQSA 1RILA 1CXUA 4M6WA 4DL4A 3LDAA 1JLQA 1RBUA 4EYHB 4CJVA 3ZD9A 4M3XA 9ICWA 2HVIA 1NKBA 4MFBA 5J0YA 4GXKA 3LANA 1SL1A 8ICOA 7ICHA 3VQEA 3K5MA 1XSPA 3EZ5A 3ISCA 3AVJA 4RQ7A 4E7IA 5KGWA 4BACA 3SUNA 1L3VA 3G6VA 3JPNA 5KFAA 5KFLA 3U3GA 4RT3A 1ZQMA 4F5PA 1QQCA 5KFQA 9ICOA 5DG7A 3ALYA 5J2HA 3F73A 1X9WA 1RDCA 2R8HA 5KG3A 4CEZA 2PXIA 1L5UA 4PA1A 1UA1A 3V7LA 3AA4A 2Q3SA 3CG7A 4KI4A 1VSEA 2ATQA 4FYDA 1ZQKA 3IM1A 1BHLA 4RNNA 1D8YA 2R8KA 1D8LA 3DLRA 4FS2A 4ZTJA 5E41A 1KVBA 4CJWA 4Z4HA 2VA2A 3QEBZ 3OYAA 3C1YA 4LH5A 4IQVA 4FJ9A 4KLFA 1T7PA 1RPLA 5CA7A 4ED8A 4NLKA 3LP2A 3FDSA 1V9PA 1VSIA 2ISPA 3KIOA 5F9LA 3ZT3A 1DTTA 3K5NA 4CJRA 4FJIA 3IAYA 2NRVA 1IO2A 4Z4FA 1IKYA 1WN7A 4KLIA 4O3PA 3GV8B 3OY9A 3RJEA 2ALZA 4M2YA 1PZNA 3L3UA 4OGEA 3HPOA 2JEGA 4DLEA 1WSJA 4KHWA 7ICPA 1C0MA 1IXRA 2KFNA 4M3ZA 5DB8A 4CEDA 2ZQBA 1B43A 2V9WA 5CB1A 3C21A 1WSHA 8ICLA 2WTFA 9ICLA 1XC9A 1LAWA 4CGFA 4OGCA 1NK5A 1ZQZA 4KLUA 4I2GA 5C25A 2GWSA 4DOCA 2OPQA 3LPUA 3TARA 4CHQA 4KO0A 4Q0BA 4DOAA 4ECSA 3GV7B 3QERA 2V4RA 4BGDA 4GW6A 3VQ5A 3DMJA 2XCAA 1YVUA 3HPHA 3H40A 4JRPA 1ZBFA 4GXJA 4KLJA 4PQUA 4ZHRA 1DGSA 4FJGA 1GOAA 2HNZA 3VQ8A 3LP3A 2BANA 2P6RA 1JXEA 2PFQA 1HJRA 4FW1A 3V7KA 3T1AA 5J2FA 2DFHA 2HNDA 4RW7A 3C1ZA 1WAFA 5DDYA 4K8ZA 4GC7A 3Q8MA 1WCNA 4DLGA 2I1QA 3DOKA 3K5OA 3TR8A 1JLFA 1JMSA 2DTUA 1ITGA 5J0WA 2FBTA 3HVTA 4CHOA 3TFSA 1GOCA 2HNYA 2O4IA 4CGDA 4O3OA 4AHRA 4W5RA 1WSFA 3EY1A 3KLHA 3V6DA 4C8NA 3JPPA 4KN7A 1LV5A 4N41A 4J9LA 4EZ9A 3NGIA 4IQTA 2IOCA 1XHXA 2P5OA 3JPSA 4M45A 1S0NA 4K4HA 2BQ3A 3QETA 4DSLA 2W9CB 4Z0UA 3E2EA 2F1IA 1LWCA 3AVAA 4TQSA 4NLGA 3RJJA 1ZQCA 3S9HA 3MXJA 4LSNA 3AVHA 4J9RA 4MEXA 2MAXA 5KG2A 4J2DA 3M9NB 4I2AA 2PFOA 3SV3A 3QO9A 1Z3EB 3KKRA 4YG2A 5DB7A 4DFMA 2PY5A 5KT4A 4PUOA 2JLEA 1TKDA 3PMNA 3KLEA 2PI4A 4FLTA 4RT2A 7ICFA 3NGYA 5DB6A 3RMAA 4RG8A 3V7JA 2BR0A 4FJ7A 4UB1A 4F5RA 4UQGA 3VQ6A 5J2IA 3LZJA 2BCVA 2OPRA 4CEAA 2FMPA 4KLQA 3GFKB 4KLSA 1C6VA 3S3MA 7ICIA 4L8RB 1ZQJA 3T5KA 2FLNA 5BPCA 3BQ2A 4KTQA 4HHTA 4CECA 3WNGA 2HHWA 4M9JA 1JLGA 4J9PA 4N47A 2ZUDA 2F1HA 2B4JA 5D49A 1SKRA 4TQRA 4EBCA 4KRFA 4UAYA 3HX0A 1S6QA 3VQCA 2BPGA 3OSPA 4M3TA 1B92A 1RTIA 3UPQA 3VQDA 8ICTA 1T03A 1D5AA 3AVCA 4KITB 5KFCA 4RQ5A 4IKFA 3DM2A 3CYMA 4M3YA 3PO5A 3M8RA 4YN4A 1TKZA 3NH0A 4CGHA 3GILA 5F9NA 4ECYA 9ICSA 3KLFA 2JEJA 5KT6A 4I29A 4NYNA 2MUTA 2HHUA 2BCUA 4F2SA 5J1EA 9ICXA 3JPQA 3AA5X 1NOZA 2D0AA 4BXOB 2JEFA 2BGWA 3QEAZ 3CQ8A 4DTPA 5SWMA 1BPZA 2FPMA 3S3NA 1RDAA 1S77D 4E7KA 2B5JA 4CJQA 3IHQB 1SL0A 1XHZA 5IIIA 3RR7A 5HP1A 2IC3A 3L2QA 5KFVA 4CJKA 4F93B 1KFTA 3DLBA 2OWOA 3OYCA 5KFDA 1TAQA 3VQPA 2A1JA 4OLBA 4ZH4A 1LAVA 3UXOA
chains in the Genus database with same CATH superfamily
4Y2TA 1FKOA 2X6NA 1WSIA 5B66U 4R25A 4WFXA 4JKDA 4MK9A 5GAEP 3AVGA 2ZZMA 4PWUA 1EQMA 2MYFA 3C23A 2NCKL 1XMQJ 3OT9A 3HKZC 3PR4A 5KL1B 3DDKA 4CRJA 2YX6A 4K2JA 4OKJA 4M9LA 3QGPA 2P9PB 3F56A 2ZIXA 2C28A 3I56N 3M1YA 2KKHA 2Z57B 4CJ5A 3V72A 3M30B 1P8ZA 2MZJA 4AHCA 1VRTA 3T1HF 2WF7A 4DF4A 4ETXA 3BKUA 1M0SA 2YTCA 1V5IB 4M3UA 4MIWA 4HUGA 2V2QA 4NB4A 1NGHA 3T6BA 4HDGA 1IBMF 2W3SA 3OYKA 3CHWA 2P66A 3ZSYA 4FM1A 1VBZA 4KV8A 2Q4TA 3UKUA 1LCUA 2JZ5A 1NGBA 2LLZA 4C9DA 1JNRB 4JI2J 5I42B 2NLWA 2FGCA 4B3RJ 2RS8A 1MWZA 3M32A 4B3MJ 3Q89A 1NBWA 4FJMA 4I0WA 1ULRA 1YWXA 3DRPA 3OXGA 4NCGA 1WWVA 1A6LA 3R3TA 2G2YA 3T6JA 2CPDA 5ALJA 2KD1A 5BOMA 1KVAA 1FWKA 5GVQA 2IAJA 4XQ8A 3G86A 2P9UB 3VGTA 4Y2SA 4K4SA 4OHXA 3A5NC 5HRRA 2N1RA 3IG1A 3QPIA 1PBUA 1EHWA 1RU2A 2KE7A 4KFBA 1HJOA 1JLCB 3BO2A 1GXLA 2G0CA 3EWAA 2FJXA 4C11A 3R9KA 3P6YC 4NCBA 2GQCA 1E3MA 1EP4B 3KG4A 2Z8QA 1JMTA 2WAQC 2CJAA 2DHHA 3AD8C 3V1RA 1XNQK 4FWLA 4HI1A 3EW9A 2NYVA 3GIRA 3NGSA 2B9YA 3OHRA 3HT0A 4B8AB 1ZYQA 1M1KT 4R79A 4DV1K 3R8YA 4DPUA 4FJLA 4WTYA 1ZQWA 2W7PA 2W2PP 2KNJA 5D4OA 4M3WA 3NVKA 2DY4A 5LJ3Y 4MT1A 1RK8A 4X64K 4NCGB 1KTQA 2R7XA 3ZSVA 3PW5A 3VGMA 5D4NA 3HZGA 1D9AA 1C4CA 4YP3A 2K60A 2MY8A 2BX6A 4WJBA 1HQUB 3J8AA 1TMJA 2HFUA 3NH1A 3EE8A 3FE1A 2E7XA 2BPFA 1YHQS 4F4YA 3ZX0A 4JKGB 1CZAN 4PXCA 3I28A 3OYLA 1YI2S 4JI5K 5AKZA 3KLIB 3Q8YA 1V5VA 4YMOA 2ZWOA 4DV3J 8ICMA 1PO6A 2KVCA 3UMGA 3B6OA 3MEEA 1KQQA 2KHVA 3MX5A 3GZFA 4NYFA 4DFPA 2BE9B 3FBBA 4J9SA 5HROB 2GOLA 1ZM3A 1YX2A 1RWKB 1S9FA 5F41A 3J80Y 4F0HA 2F1FA 4O5BA 3NS1A 3BS9A 1IR1A 2BPCA 5KFXA 5GTIU 3A8YA 2GELA 1HQEA 5GAEI 1RDUA 1XI1A 1HEKA 1HYSA 1DBDA 2MQLA 3QWUA 4EEYA 2AGQA 4FXWA 3RJGA 3OVBA 1T6DA 2NXUA 2GIFA 1WI6A 1RDRA 4FXVA 2PFPA 4JWNA 2LXUA 2H5IB 2Z2MA 3LM2A 3L5KA 1SUQB 1Y9OA 4DR7F 5J2CA 1Z4UA 2QWOA 1FTRA 2J8SA 3WK7A 1T0TV 2FI1A 2NXCA 3CNHA 2LCWA 3OYMA 4UB2A 2WOMA 4DR3F 5G4DA 5D0RA 3T41A 4NLNA 4CEQA 2MU2A 1C1BB 4YFUA 1FDAA 1S6PA 1S8OA 3CD5A 3SI6A 1NK0A 4QZCA 2DK2A 1SV0A 4LFBK 3CIZA 2LA4A 2FQQB 4QQBA 2XSJB 1RB0A 3WIUA 1ZH5A 4M5LA 4CZIA 5IIOA 4FDFA 3IMQJ 3PRDA 2D8CA 2MB0B 2VH7A 1O03A 3LP0A 3FGVA 2CGLA 1VDVA 1VOMA 2V2VA 2LECA 4F5NA 3HPGA 3P4UB 4CJFA 4M63C 4ZVTB 3NGTA 3WKBA 4TSXA 3AO1A 1ILYA 3J7YI 3EKUA 2HB5A 2BW2A 3CCJS 4CJ4A 2BMBA 2P9CA 3C6UA 3JXOA 4W92B 1N61A 5B0FA 1L3TA 1E6VB 9ICPA 2AA4A 3VQQA 3UKRB 2KKPA 4IOBA 3O4NA 4KKOA 3ZEUB 1VISA 2KFYA 4QS7A 4LZDA 3DGPA 3TFRA 1Q1KA 7ICQA 4R63A 3FZ2A 1NGGA 3GSIA 3U8XA 1CJUA 4NLBA 4NYOA 4EGLA 1A0PA 3DLHA 2HS4A 2E5SA 5I3QA 3LOUA 2HIQA 5HRSA 4CFAA 3A0HU 1S1UA 2J0WA 1VBYA 1WAJA 1PVPA 5IWAK 4W5NA 2GZOA 5ALMA 3MX2A 4JD2A 1KAXA 3KKSA 1MQ2A 2VFUA 1OY6A 1JQGA 2LYHA 4OKEA 3QFWA 2D41A 4AM6A 1TR0A 4W98A 2NO5A 3P96A 3TA0A 5JMVA 2HAIA 1N32F 2XS2A 3DDIA 3DRSA 2QEXN 4RBVA 1WC1A 4HH1A 4WK1A 2UXBJ 5HOOA 3OV7A 5KFIA 2NXJA 1X4GA 5JU5A 2Q6BA 2XI3A 1S9GA 1HBUA 3GTYX 4KLTA 4LR8A 3LALA 2AYGA 4B17A 1J6ZA 4PHPA 4NLTA 4DJBA 3ID6A 1QUPA 5SZTA 3NWRA 2W1BA 1RQLA 2HHTA 5K8OA 4IJAA 3RJKA 5KFGA 4H0OA 2A42A 1VQLN 1VC6A 1AZSA 2ACYA 3BGRA 1X1PA 2NZ4A 3I82A 5AQWA 3VEWA 3HKZF 1D9FA 4KLDA 2X1BA 3DLJA 3SQGA 3QESA 4I4BA 1T9WA 1ZQYA 1IJEB 2EWHA 4RW4B 2P9LA 4BDYA 1AUSL 1BOTO 3N4PA 2R8JA 5LSOA 4G1QA 4Y34A 1DHMA 4Q8EA 2CNKB 3U1NA 3THWB 2BKNA 3AGRA 2DWQA 1U6BA 5C10A 3V6DB 5T41A 4DCCA 4CJSA 2QW9A 2F9WA 1K8AO 4PZVA 4LF5K 4B3SJ 4WQ5C 1ZQ1C 1H7WA 5HHIA 3A5MC 2D74B 1J5OB 4LF6J 3QYPA 4DV2K 2YJFA 2WC9A 1XQIA 1HJPA 1RHRB 2IBKA 2Y9TA 3KJVA 4BRPA 5K8MA 2F9DA 5DBCA 3O3GA 1Q7YT 1FFUA 3QZ8A 2VPZB 4FPRA 3QJPA 2PMZF 2XNQA 3QUCA 2CPRA 1RBSA 4GLXA 4C4RA 2CQGA 3BF1A 5ETRA 5KFOA 4F02A 2O1PA 3W9IA 1I39A 1V38A 1K8KA 1NZ8A 2D1KA 4OI1A 2ITMA 1M90T 2Z0GA 4UUWA 2E6LA 3ULEA 3C2LA 1ZQSA 2K2PA 2WUSA 2ZXIA 4F72A 2M0NA 4DOZA 3MR2A 2G8IA 3NUQA 4LF2A 4ATNA 1KAZA 2B9EA 4NLWA 1QQMA 2CJ9A 1HHQA 4X4UA 1EX8A 2RRAA 3EDQB 1AYEA 3O4QA 3KZBA 4CIGA 4XPCA 4HCCA 2BRLA 3UNGC 2RB7A 2C2DA 4CGZA 3ZYYX 2F96A 4B9LA 3F9MA 4JI6J 1KEKA 2ASMA 1XC3A 5AM5A 1BQMA 3KLVA 2MZRA 2H54B 3N6NA 3NAEA 1H7XA 2QWQA 3NGDA 4EX6A 3AM9A 2EPIA 3E9PA 1KLNA 3I5AA 1VSMA 5ETKA 2PGCA 4WZMA 3H0RB 2XZTB 1BCOA 1K5OA 2B6GA 3H08A 4ILRA 2UVUA 4KAZA 3BQ7A 4USKA 1Y4ZB 1F21A 2HF4A 2L48A 3SQIA 5DG8A 3JPRA 2MLZA 4WK3A 3N4QA 5D4LA 4B3OB 3SCXA 5TKYA 1RAAB 5FIIA 3ENHA 3L7PA 1F9FA 4J91A 2ITGA 5EUHA 3ZT1A 5EN1A 2I6WA 2RKIA 3OVAA 1TKTA 5IFMA 4OJ3A 2A3ZA 2MQMA 5I9EB 4ZPWR 3ZEUA 4LQ3A 2AW0A 3FAHA 2YWGA 1U1QA 2WONA 1JCEA 5K8NA 2ZH1A 2D0BA 1NNEA 2R4FA 3QDKA 2YWFA 3KK2B 2O8EB 2YY3A 4JI3K 2XEXA 2LHTA 4LF8F 2K3KA 2CYYA 2WFAA 5L9XA 2NLXA 4PWWA 4ITSA 5KG7A 1HNXK 1VQLS 3I56S 4XRHA 8ICAA 2OD4A 1S9GB 1NH8A 3TZZA 4DR2J 2C2MB 3MUVP 3R1LA 4CJLA 4BC9A 2YQ1A 4ZVHA 4BC3A 2XMAA 5DB9A 1CC8A 4GC6A 1QQNA 1JB0C 5J2PB 3GYXB 3OTEA 2OAUA 1ZQXA 1XIQA 4G1PA 2OPSA 1WWUA 3ZT4A 3RH4A 4J37A 4FWSA 3M8WA 3MAAA 5FD1A 1KW4A 2PA8D 1TV9A 3ULHA 1SXEA 3A13A 4JEPA 4J03A 2EK1A 3H25A 1N48A 2P9NB 4WU2A 4YOXA 1S1VA 1RLDA 3Q8VA 1U9LA 4NM2A 4DV1F 4B3SK 4GKKK 2O67A 1TP7A 3AVLA 2EK6A 4X4TA 1M1KO 2CZ9A 2ACMA 3UDVA 1Y97A 1ZQLA 1JXVA 1NB2A 4RW8B 4I2JA 3GQCA 1RT4A 4KGZB 1DARA 1VSHA 3M32B 4H5TA 4DWIA 9ICVA 2JX2A 3BBFA 1ZQFA 4P2HA 4NL9C 1EB0A 3BR9A 3G25A 1VFJA 4DU8A 3MMBB 4AP9A 2KXFA 1RNHA 5B0GA 3AUOA 3DRYA 2Q97A 1R8HA 2QFJA 5HMMA 4JB3A 3W65A 3DLKB 4X66K 2Y1JA 2RP5A 2DFLA 3RYLA 3CCTA 3MOJB 4A8WA 1TVRA 4DV4K 2CNLB 5HP1B 2QLTA 1HBOB 3ZFVA 3RWUA 1PSDA 3CD0A 3FBFA 2ASJA 2HGMA 3KUHA 1DQ9A 2O8FB 1BU6O 3U1MA 2B21A 4YFKA 2UV8A 3KUGA 1NH7A 2DXEA 2XZDB 1WNSA 3L3FX 4CHZA 5KL8B 2XY8A 1Q86T 4CF3A 1Y7PA 4CF9A 1BUXA 1VLBA 4PHAA 3GJRB 2DL0A 3ZNJ1 3T7ZA 2MUTB 1ZQRA 2RS2A 2B43A 2YNGA 4DPOA 2XMKA 2W42A 1EXNA 4O3QA 3CETA 1SZ2A 2K4HA 1Y5NB 1JJ4A 5IT9U 4A2AA 1YRUA 5JS2A 3TR5A 2GX8A 1YJWN 1NNDA 1JLAA 1VQ7N 3J81Y 1JJ2R 1S1TB 3UCUP 3N7RC 4BLGA 2YNFA 5DDRC 1BL3A 3RMBA 2JWNA 3GR1A 2I7PA 1BCMA 1SVDA 5HVGA 4CIOA 8ICEA 3GL1A 2H3IA 1KN6A 5LJ5Y 3HZEA 1HWJA 4KRWA 5L8RC 2ZJRL 1FEZA 2N3LA 2QA1A 4MDAA 4BR2A 4IH5A 4PPXA 1R0AB 1KONA 3CDAA 4I2IA 2CJQA 3L2RA 4KH4A 2WHEA 1BPEA 2BZFA 3NBPA 2FPHX 4AH9A 2MKIA 2YXLA 5E3AA 3ZTRA 3G6EN 4OJOA 2B8PA 2HSZA 3GFHA 4JI2F 1BUPA 4O5EA 1NDPA 1NG9A 1MQ3A 3L6QA 2ZXHA 3CJ1A 4F3TA 3JSMA 3PYGA 3KG1A 2QGFB 4ZN1A 3MR3A 4DS5A 1MN8A 4P6QA 4M5GA 5J2NA 4RNFA 2DXFA 2Z2ZA 1J2VA 3C95A 1Q8LA 4FF1A 3ET6A 1ZAWA 2KHDA 2B6AB 4NYPA 3L7UA 3C2PA 1IKVA 3KDNA 4O23A 2IIHA 3KOAA 4B9TA 4IWVA 8ICXA 2VKZG 4K4GA 4DV6F 1HYVA 1SPBP 2VPYB 4CF8A 1QSYA 4JS4A 3VA0A 1MMDA 4DU7A 1XMQF 1X4CA 2HHPA 4NASA 1NGIA 4CESA 2O4GA 1GX6A 2IHMA 1TYQB 4EELA 5KFFA 4I6MB 4MKAA 4X62F 3C6TB 3A12A 2DGOA 1I6JA 2VG7A 1IBLJ 3TAPA 2DD8S 2ZE2A 2YQ0A 4ZJLA 4DQ8A 4URQU 4AQYJ 1HHTP 2DGZA 5KAKA 1SV5A 1GLLO 3T1HK 1LW0A 5AKEA 3S01A 1R31A 4NLPA 3HM8A 1YHQN 2DNNA 2KO1A 4CH0S 2BDUA 3PY8A 4ED3A 3VR1A 5J0OA 4PG7A 1IBMK 1ZRMA 1N56A 1RBOB 4N8NA 2QB1A 1U1NA 1IQTA 2OCEA 2CNNB 3GR0A 2HSTA 3RW7A 2DY1A 6AT1B 4ANDA 2NRHA 2DGXA 2J0XA 3GG0A 1NOMA 4ZCLA 3KLIA 4BC2A 2GLEA 2UUCK 4KQZA 2I2YA 4XEIA 1UPMB 4DG1A 4DL3A 1XR5A 1RZTA 1FWLA 2ATCB 1LKYB 3C19A 3I55N 4RW9B 4LSZB 2JXJA 3VQTA 1OS5A 5IT4A 3EE9A 4J9KA 4AHTA 2LDYA 1TL1A 4HYKA 2EFQA 1W97L 3BGFA 3HMJG 4JI5J 1Z26A 4HWIA 5ALFA 4C4TA 4BC4A 5H9FK 2DCLA 2O5DA 3LW5C 5HBMB 3SK3A 5BR8F 3ZSXA 4DR1F 3QEVA 5GADP 1TUVA 2MZQA 1VQNS 3AU2A 2VOPA 4P72A 1LWXA 5GMEA 1W9HA 4FK2A 1LW2A 3FBCA 4BY9C 4BR7A 7ICTA 5J0QA 3H4BA 4O3NA 3WC0A 2LSNA 5HLFB 5J0PA 4FNIA 3TA2A 3LWLA 5AKXA 2DJWA 3GE9A 4XIUA 4O5KA 3U3YA 4J5OA 3ZTPA 3V9UA 4DQRA 2JFDA 2E1EA 1QH9A 3ETMA 4EUVA 1XNQJ 2CGKA 5DG9A 3KXDA 2FC0A 4FW2A 1O5JA 3CEDA 5GAHU 2CQIA 4R8UA 2G8HA 4OYZA 5HNKA 4LF4K 3RB6A 2KSOA 5J2MA 3NF8A 1S1UB 4QZIA 4KHNA 4MO4A 1VQSA 5ETOA 4UAUA 4DX6A 1FKOB 3AB4B 5CCMA 5FPDA 1ZQBA 3CB4A 3QX7A 2DO4A 1Q81T 5ADXH 4E3SA 4O8UA 4A5AA 3MGIA 4JV1A 3KK2A 4J90A 2V7ZA 1QHAA 2VJ5A 1WWHA 3AJ1A 4AHVA 5AK3A 3OHAA 7ICMA 4LVNP 4PKHA 4DTNA 3IM9A 2ZHOA 3C16B 3EYZA 4WIIA 1KOHA 2KJ5A 4M3RA 5HVHA 3QBWA 2FHMA 3UKRA 4CF0A 1F9HA 2ZM6J 4OLAA 3OBIA 1ATRA 4I2EA 4XDCA 5D46A 1ZQQA 3RB4A 3O9QA 4LF4J 4DSIA 1KFSA 5F1XA 4O3SA 2VA8A 1ASVA 1JJCB 1M1GA 2A2CA 3OL9A 2IYGA 4AM7A 2ZH4A 4LF7J 3C3LA 5FP0A 2W4PA 2DIVA 1VIXA 2AJ2A 3ZTSA 1TK5A 2VBWA 4M9HA 2B4VA 1U48A 1LW2B 1WC4A 4LF4F 4LMZA 1GLJO 4CI6A 1ZJMA 2PFUA 3NF9A 2DCUB 1RAOA 1NZBA 4WFNL 1OY9A 3VESA 2IM3A 1JI7A 3SPZA 1BY9A 2XY5A 3I5CA 4CJTA 1VSFA 5L38A 1ZD4A 3ZNUA 1S5ZA 3I6PA 1TKXA 1L7NA 2DGTA 3GIJA 4FJXA 3H8YA 4QAGA 4NEYA 3VF0B 2BJ7A 1EQ0A 1TAUA 4BG8A 1X0PA 3SJJA 3HP6A 1RACB 1SWVA 3MMAA 1KR4A 2JL9A 4V1Ak 3VZIA 3L8BA 4YQWA 5J0SA 1Q79A 2MHNA 3M7DA 3TABA 4UB5A 2HQGA 1VQKS 2ZD1B 2V8GA 3D5MA 4DFDA 1FDNA 3QWPA 3ONQA 4E19A 4XUSA 4O9MA 4QYRA 4X64F 2UU9F 4OJRA 3LGHA 3N9UC 2XHCA 5L1IA 2HNDB 2A6MA 1VR6A 3B82A 3SXLA 3H7IA 1CULA 4J8FA 1RBTA 2FY8A 2DRAA 2VBZA 2OZSA 4FVCA 4RTFD 5AK6A 3OTQA 4Y2MA 2HGNA 4WQ5A 2A6AA 2FZCB 9ATCB 2VFTA 2A1JB 1S6OA 2WVEA 4X4VA 1YT3A 3PW2A 3CD6N 1HBNB 2VASA 4J9QA 1RKJA 5CR0A 1HNXJ 4M41A 4D3HA 9ICIA 3SYZA 2Z1HA 1NOYA 3SDEA 1W2BM 5AJ3K 2ZH3A 1S0MA 1GO3F 3EDRB 1KBRA 4H0PA 4NX9A 3MAHA 1UCVA 4CLPA 1RT5B 1B70B 4X4RA 2HQFA 1BDGA 3C65A 3OL7A 3AOCA 3DI6B 3THTA 2DISA 1SL2A 2YKPA 2IHNA 1YXQA 5DDOC 1LOTB 2BGGA 1R59O 4XK8C 2FE9A 2FUG9 4EI2A 2RHKA 2W41A 2MQQA 4B3MF 3RAQA 3H42A 2A3VA 1VQ4N 2J9DA 3LTOA 3A0BU 2FJBB 4OJ6A 4DL2A 3PRVA 2F1JA 2C3OA 4NWIA 1FDBA 4WFAQ 4LR9A 4DZDA 1NJIO 1NHUA 5EX0A 1IKWA 3EVOA 2YWHA 1FW6A 3TOQA 5BYQA 2O8BB 2QKKA 3UCGA 3ZZ0A 2W6LA 2W8LA 3B78A 3NAHA 1DKGD 3MTJA 2WHOA 2ALYB 1NKCA 2Z4PA 3M8ZA 3MGHA 5AK4A 2VYPA 4FLWA 1RILA 2FY1A 4DL0C 2FVPA 2E1YA 2BXJA 1AZSB 1SS6A 4X62J 2ZUGA 4EYHB 2KVSA 3F41A 3ZD9A 1HNZJ 4FOEA 2RE1A 4M3XA 4OZLA 4L73A 3LANA 1JLFB 2YMQA 2AWZA 1FJGJ 3X3UA 3K5MA 1QUVA 1XSPA 3EZ5A 2RU3A 3SUNA 1L3VA 1LOUA 4DV6J 1D4XA 5I4MA 2GW8A 3TQEA 2ASOA 2KLAA 1RYUA 2NR0A 3NASA 3UQSA 2XMVA 1QQCA 4X4NA 5KFQA 3ALYA 1QJHA 3BZCA 2R8HA 1LKZA 5AIAA 3C7NB 3CJAA 3SR6A 4OO1J 3BEGB 2HBLA 2OKQA 4CEZA 4LIWA 2PXIA 2IOFA 1O13A 3V7LA 3RAMA 2ATQA 1YTYA 4GIBA 2R8KA 1UKUA 3OR2B 1W2IA 3VEZA 1WDDA 4BQLA 8ATCB 3P5BP 4KFBB 1F2HA 1K9MO 1RWMB 4LREA 4P74A 1RPLA 2QSFA 4X65K 4FNHA 3FZFA 3FDSA 4DKWA 5ALTA 3US5A 5IM0A 3ENAA 3K5NA 4CZHA 2PA3A 4IEEA 2X1GA 2NYHA 4PR6A 3HTVA 3WBZA 5C15A 2P9KB 2VCPA 1RQ0A 4QIWF 4KLIA 4CLUA 4BVPA 5C42B 2ALZA 1UEUA 1UL3A 4FSVA 1R27B 1G1XA 1L6NA 3L3UA 4ZS6A 7ICPA 1IXRA 4GKJK 1DZ5A 2WVDA 3SAHA 2ZQBA 3EKSA 1N4LA 1WSHA 3DHXA 4OJHA 2X1FA 2G06A 3I4HX 3VGVA 1S9EB 4OGCA 2QYCA 4I2GA 3QGGA 4JKFA 4FOIA 2QLBB 2Q36A 4CHQA 1B0VA 5IC6B 4Q0BA 2PEHA 1OVYA 4Y2AA 4I56A 2B4UA 1YVUA 3IO1A 3H40A 5M1KA 1ZBFA 1JRPA 1GOAA 3DJCA 3VQ8A 2YWEA 4ID8A 1SB3C 2PFQA 2QJ3A 3T1AA 2DFHA 2HNDA 1QAXA 3TX8A 1AA1B 2CQ0A 1BQXA 3Q8MA 1TKZB 4ILLA 3IR6B 3WHIA 3PM9A 3K5OA 3TR8A 1JLFA 1YIJN 1ITGA 2CVIA 2QZ8A 3IWNC 4ZA1A 1LKYA 2E1FA 3ETOA 2HNYA 3NLCA 4AHRA 4AQYK 4W5RA 1WSFA 3K0JA 2YPZA 5BJRA 4KN7A 5GAGU 4N41A 4J9LA 4KX3A 5M1NA 1XHXA 1KAYA 4M45A 2BQ3A 3GONA 4LSLB 4LFCF 1HLUA 3QETA 2HLUA 3BPSP 4DSLA 1MMNA 2ZC3A 2Y1RI 2Y0SD 3GG1A 1LWCA 2RQ5A 1D1UA 3RJJA 3QAEA 4L76A 4LSNA 3UN2A 1MWQA 2LKYA 2KHOA 4MEXA 2MAXA 5KG2A 2QMUB 3MCSA 2IM0A 3D2WA 1VQ5S 4IJNA 1Z3EB 5F8MA 3Q22A 3L7OA 5KT4A 4L74A 3PMNA 3MMCB 2AZ1A 4RT2A 4B1WB 3Q23A 5DB6A 2ES6A 3IGNA 4FJ7A 3OLAA 3DGPB 2ZEJA 4IOCL 2G4BA 3R6GB 4ZVGA 3H20A 1SZHA 4KLSA 3UN3A 2GA7A 1ZQJA 2EEYA 3T5KA 2FLNA 3BQ2A 2AXTU 2NZCA 3R7BB 2HHWA 3BDEA 3ZO7A 4DV5F 5C0YA 1K0TA 4PG5A 2NPIA 4GKKF 2F1HA 2B4JA 2XQCA 1J5EK 2YX8A 1APSA 2ZHAA 2FTRA 2GHWA 1YVNA 4UAYA 2OELA 4C7ZA 4DPWA 2E9RX 2CPYA 2NS1B 4ENOA 3KWMA 1S1WB 3QB0A 3NBPB 3HKZD 1B92A 2E5LK 3AA8A 4QIWD 3GE1A 8ICTA 4ZJOA 3N79A 3ZC4A 4V19J 2GS8A 4M3YA 3J7ZT 1FDDA 4YN4A 1Z6RA 4CGHA 5BRDA 2C2OB 1NMDA 5EX3A 3OTOJ 3F2BA 5KT6A 2EFGA 2XB2D 2MUTA 3H98A 2FF3B 2JFKA 1AT1B 3AA5X 4MMOA 2D0AA 2VPXB 3DRXA 1RE1B 2NO4A 2JEFA 1QAYA 3O6QA 4DTPA 2FPMA 2OD6A 4DV4F 4E7KA 1NGAA 2VHGA 4CJQA 2HBMA 3VHQA 1RADB 1TAMA 4FO0A 3OL6A 3RR7A 1JLAB 5C7PA 2KK0A 1N88A 1I94J 5A76A 4QOTA 1Q3UA 2IC3A 2DKOB 2HBQB 5KFVA 2UU9J 1KFTA 1C0FA 3OYCA 1TAQA 2A1JA 3HOTA 4MH8A 4PZNA 3UXOA 4H4OB 1HNWJ 1KD1O 4DX8H 2VIXA 3KKFA 1QVFR 2DH8A 1HYSB 3QBXA 1I94F 4RQMA 3RW6A 2Y0SC 1X3MA 5J2BA 2OPPA 3BH7B 4QZAA 1S6UA 5HP4A 4O0NA 1ZBUA 1U2RA 2LQJA 5AM0A 1R8AA 2KMDA 4DV4J 4IG0B 3AGKA 3BF4A 4DV0J 4R5PA 2XICA 5KFSA 5AI4A 2APOA 3MEDA 2FHJA 5IM0B 3ZSQA 4KN4A 1XMOF 4IQXA 4FBTA 2OPQB 2E2NA 1PK3A 1QS4A 2R2RA 1RT5A 3CCZA 2IA0A 3VEVA 1U47A 4ECRA 1NKEA 4K50A 3MGJA 1VQ7S 2ISOA 2VG6B 1B22A 7FD1A 2AP6A 4WP9A 1C1AA 3ZSZA 4E1JA 5GINA 1BO5O 1BPXA 4WE1A 1NM2A 1NRKA 5E3RA 3SJHA 1PC5A 4ED2A 2A19A 1HNWK 7ICLA 1LFPA 4BRIA 2B9WA 2BE2B 3SUPA 3R7SB 2UXBK 1HIWA 3MFHA 2KJVA 4YN3B 1XNRJ 2HQDA 5J2QA 1FX2A 4GKKJ 2UUAJ 2G08A 4RW4A 5AQRA 4KHPJ 1UOCA 2WF9A 2A3JA 1K73T 5AI6A 1KC8O 4CNYA 4C11B 1UVLA 3V1QA 3O2IA 2R7UA 2BM0A 1TL3A 1VSLA 3PJXA 4CERA 3KWGA 4YMMA 1QQ5A 3PX6A 1BE4A 2DEIA 2QX0A 2LEPA 2Z1JA 1SKUB 2GO9A 1C0UB 4DU3A 4MJKA 4X66F 2W01A 4PXEA 9ICTA 3L9ZA 3AVBA 1YDLA 2GUPA 5AKKA 1F1BB 2H4YB 1AB8A 4QR2A 3ENWA 3SQ4A 2HHXA 3QIOA 4Y2UA 2PMWA 4G65A 4JKGA 2EG1A 2GTDA 4CLZA 3CC7N 1N2XA 1VCTA 2E7VA 5EY4A 3HSGA 4Y0FA 3J81U 1Q86O 3ETRA 2XO7A 1XNSA 1PJ6A 3EGNA 4WKYA 3LYSA 5C2CA 1QM9A 2FJDB 3BJYA 3K4GA 1CZBA 4C98A 4KTWA 4DR4J 5LL6d 3BQTA 3VAKA 3MM7A 3C7NA 2AGPA 4A8SA 3BQ1A 1KKXA 4G9BA 1CQNA 3R2CJ 3AU6A 1JJ2M 3MPUB 4LF9K 3RB0A 4LFCJ 4CF5A 1HPZB 2HS3A 5IQ6A 4RWXA 3CJBA 2WF5A 1IKWB 1F6TA 1AROP 5A6WA 2O8BA 3AO5A 2UXCK 1VYAA 2MRLA 4EBDA 2PI5A 5H2FU 5EU7A 2AKWB 2C2EA 3H90A 1RT3A 2MSTA 4PZOA 5EHHA 3QLHA 1F0MA 5E7OB 3AAWB 3ZX2A 3SUOA 4CJ7A 4RLEA 3CDWA 2O6KA 1UJ5A 3CCWA 3JYTB 3DLGA 4E89A 3RRGA 1YJWS 3GDXA 1J97A 4UOFA 3KNAA 2VGMA 2WZ1A 3NVVA 2MJNA 1RT6A 1ZQPA 2YBVA 2XVTA 5AI8A 2Q1LA 1GEHA 2NNWA 2P5VA 2PAVA 3TI0A 2UUBF 2MSSA 4IDKA 3THYA 2K4IA 3MR6A 2BJEA 4JI6K 1KQSM 2F4VF 4PKDB 1VQMN 4BVOA 4LFCK 1ZAVA 1P9YA 1NJIT 1Q18A 2LKZA 1NK9A 4RBTA 2HK3A 3L4QA 3Q8LA 2QV6A 3TVZA 1HUOA 3MMBA 2FBVA 9ICRA 5IXUA 5DKWA 4UB3A 3OGUA 5JLFA 2XGPA 3OJUA 1IM6A 1TL5A 2CPJA 2HRYA 5U47A 1VK0A 2WB1D 5A2QU 2CJBA 1SC4B 2EAMA 1AUDA 2EQYA 3KK1A 3ISZA 4ED7A 2QMXA 4KYZA 1ZQGA 3HD2A 5D77A 2DPNA 4NWBA 1UWBA 4OI3A 1VSJA 3W0LA 3HJVA 2R7QA 2K3IA 2E8AA 1FT8A 1IG9A 3PEJA 4GV6A 1Q4RA 3H5UA 3W66A 2BJ3A 3THYB 1SIZA 4KHPK 2P9LB 2HLTA 3EPIA 4GNIA 2PYLA 2DR7A 2B5JB 1FK9B 1GLCG 2KI2A 3KTQA 4DZ6A 4ZK7M 1CZ9A 1JCGA 3QMQA 4B08A 3HHKA 2NRXA 3L4PA 3H3OB 1NGEA 3LP1B 4NE9C 4OYIA 4FZYA 4CEEA 2QLFB 2HHVA 1HNIA 1RTJB 1T4GA 2PN6A 4A2BA 1ZBSA 3CIPA 1HR0K 4EFHA 2LP4A 1TYQA 2V69A 4A8XA 4IS7A 5B09A 2GCFA 4AHSA 3CDBA 4JI7F 1Z1ZA 5DGBA 2QIFA 4MK7A 1HWIA 2CQCA 5AXNA 3BY5A 3BREA 2KKZA 3K7RA 4EYIB 1CS4B 3THVA 2ZBCA 4OZJA 2DR8A 2UUCF 1JLGB 3W3SA 3NNAA 4NEZA 4BROA 3CJCA 4ICLA 1L8LA 4NLCA 2YMPA 3C6HA 2H3ZA 1ROFA 3O3LA 4DV0K 1VRTB 2HQIA 2AYEA 1V3SA 3TZXA 1NDLA 3IBPA 4DV2F 1HNZF 4FYYB 2H3EB 4K4VA 1XNRF 1Z2LA 3OR2A 2OTJS 1TKXB 3I0SB 4Q43A 3BPDA 1J9AA 2IFXA 3W2WA 1G7CB 4O4GA 2DNYA 1S1TA 3SIPB 4RWWA 2RILA 4DV1J 5C2FA 3QEPA 3PIOL 3FZBA 4FL9A 1ZQUA 1N33K 3O1WA 4ISEA 2DNMA 4WZQA 3DLLL 5CY4A 4OZNA 5CZ2A 4RW7B 1PKUA 4JAXA 4F0KA 2KHCA 2M9KA 2QARB 1UFWA 3AJ2A 2ZH9A 2HVHA 2N4CA 3VV2B 3FM9A 2KKVA 3CC2S 2GV9A 4F04B 4FWMA 5J2AA 3BM7A 1V3RA 5AZIA 1FXDA 3V81B 2J7WA 2N4DA 3D0HE 2PFFB 4DV0F 4TN2A 1LXNA 2VJ4A 2KFZA 4A8KA 2ZJ5A 1A6SA 2VWKA 4JWMA 3OVNA 3E01B 5EWGA 2E8OA 3AA3A 2IVYA 5HL7Q 4N56A 2HZCA 3UWTA 4AL5A 4YOTA 1J2MA 1YTUA 1LK7A 3DOKB 4WYWA 1X66A 4M5MA 1UVNA 3MMCA 2QLJB 1ATNA 3NHGA 4CO2A 4MYTA 4Y2CA 4OLPA 2ZVSA 4JV0A 1L7PA 1LEOA 4JLHA 4E7JA 4DF8A 3KHHA 4IO9L 2MGZA 4KREA 4B3RK 1JLBB 1Z1VA 5T7LA 3V4MA 1LXJA 4CYUB 5F8HA 4PKIA 1HI0P 3BSAA 4O3MA 2RH3A 4BRNA 2LQ8A 4H8KA 4CEOA 1R0AA 4ZCIA 5FLXY 4QWCA 5ALUA 3DMJB 2MZTA 1R6YA 3BN7A 3SMPA 3H6EA 4DMNA 4F26A 2YMMA 4NXNK 2ZGZA 3JAMY 4F8RA 1X5OA 1HKAA 1GMVA 5ETMA 3J7YP 7ICKA 3OL8A 2YHAA 2C1EB 3QINA 3EGWB 3E0FA 4YHHJ 4AT1B 4O0JA 2EX3A 5D8HB 2WTUA 4O55A 4NXMK 2B7CB 5KFRA 5CD4H 3AD7C 2FSNA 4JYAK 2PKEA 4ECTA 1VSKA 4KLOA 9ICJA 3TUPA 5DDMA 2BABA 4KLEA 4BGBA 3KHGA 4P4OA 4ID5B 5M2PA 2FBYA 3THPA 4CWBA 2QO3A 2BA9A 4RPFA 2UUCJ 1Q5VA 2CVEA 2C42A 4YY3K 4RPXA 3QBCA 3K59A 5AQNA 3LVWA 1ZTTA 3HK2A 4IFYB 2GNKA 3SNNA 5J0UA 3WZ0A 1RGVA 4YMEA 3FGUA 3V6HA 3JQMA 5KT2A 2D9PA 4DR2F 3R9LA 2B4PA 1HX1A 2KJ8A 2Y1LB 1CBKA 5KOWA 3O08A 3QNNA 1PUZA 2DBBA 4K0KK 3V6JA 3IDHA 3UVJA 1SQFA 5A8RA 1S9EA 3T1HJ 2EVZA 3F53A 3TA1A 3HZ6A 4FWNA 4Z7CA 5AQTA 4NA3A 2B0CA 3KK1B 3H3NO 1NMEB 4OX8A 2D3OR 2NQPA 5ALIA 2HMIA 4LF7F 5AQMA 2RAQA 3LAMA 1NSKL 3IMXA 2BACA 3IWLA 4GVEA 4QS8A 5LMUJ 3RBDA 1WACA 1XR6A 3M2UB 4OZ3A 1D8ZA 3MMAB 2L9NA 3MAQA 4JYAJ 3C5GA 4EZ6A 2A1SA 3CDUA 3GDQA 4DV3K 5J2EA 1QVGR 4KO0B 1FK9A 5CAAA 1Q82O 4KB1A 1F5BA 2GMLA 1FCAA 3SSSA 1YJTA 4KSEB 2N7YA 3CJSA 2QB0B 3CM5A 1BA1A 1DTTB 2H3VA 2ZBRA 5AQQA 5AICA 3A4TA 4C6AA 3FSIA 2QXFA 1WUAA 2P1JA 2GQ2A 4QWBA 1FO4A 9ICHA 2JSXA 3UB5A 1S1WA 2FYXA 3VWSA 3OTCA 4Y1DA 3UMCA 2DHXA 3OHBA 3ZZOA 1F5CA 3MURP 3MMVA 3GCWP 4MEYA 4LD0A 5FJ4A 5AKLA 2QXLA 3MCAB 1QAJA 1XNQF 1H2VZ 4JI6F 5K14A 3MCNA 1NHVA 5GIPA 3EL2A 1WHVA 2W54A 3U6FA 3BGRB 3P83D 5AXLA 1NJXA 2Z1IA 2OTLS 4ZOHC 2ESEA 3Q8RB 3RRHA 2IHR1 5ETSA 4M5DA 3BZKA 2YKMB 4ID1A 1R8BA 4JI3F 4WFNQ 1K9MT 3BS5B 4B9NA 3SAFA 2JWLA 3FZKA 2BZ2A 3SZ2A 3CCMN 4GVMA 4JI1F 1UP1A 2E5LF 1HW8A 1X7VA 1GH8A 1PG5B 4CCHA 1YRTA 3MDAA 3TZWA 4M5JA 3MCMA 3D1HA 4M47A 1ZZFA 2JC0A 1RBAA 2OYQA 4BR9A 1OIAA 4C0ZA 2QMWA 3EUNA 5ALGA 1WEYA 2BKOA 3LDSA 3MM7B 1BPBA 4NLQA 4Q0BB 4FWQA 4ISGA 4J9VA 5EWFA 1Q9XA 3TYTA 3ENOA 2MMYA 4PPDA 2FLLA 4MO5A 2XYHB 4CNZA 3D6RA 2GJIA 4N7TA 3ZTQA 4ICAA 2G9OA 1KSPA 4IKAA 1Q9YA 3G87A 1KLMB 4FVMA 2OEJA 4I9LA 2IVFB 3QU9A 2AYMA 3SBTA 2J76E 3D2SA 5AQOA 3DOLA 3NF7A 3VEXA 5AXMA 3Q8QB 5FPMA 1REVB 4QYZJ 4US9A 4LR7A 3C28A 2NUUG 1ZRNA 1U04A 3KFWX 2W43A 5ALXA 1UTAA 1HWUA 5KQ8A 3H8WA 2YI1A 1RXVA 4DL6A 8RUCA 2K1RA 5KFBA 4X84A 4C8KA 2P9KA 3BH6B 3M2UA 3MMJA 4GO5X 1YSJA 4X66J 4UW2A 1Y5IB 4I6YA 1WG1A 3A5LC 2DHAA 2OA8A 4NA2A 3CULA 5I3UB 4FO6A 5H9FJ 3TKAA 3B8AX 1HA1A 1UPPA 4FXDA 3FC4A 4F4WA 3WEEB 1YAGA 3LO3A 4AF1A 4CJEA 1KEJA 3AARA 4IXCA 2RUGA 4JI4J 4CK3A 1VQOS 4KB0A 4DR3K 3M6ZA 4RQ4A 2X3GA 2G8UA 1XMQK 1K0VA 1HR0J 1B99A 4QIEA 3RJHA 8ICVA 3R3LA 4JBCA 4CIFA 4DV7J 4W5TA 5IV3A 2V50A 4WQ4C 1NK6A 1TL7B 1NI3A 4ECVA 5J0TA 3OYIA 1ZM2A 5HHHA 2I38A 2ASPA 1Z00A 2AZ3A 3MCOA 1XU4A 1D8BA 4CK1A 4WYBA 1EO1A 3G8TA 3DXMA 4USAA 4M7YA 1NNLA 2E8PA 1LQ9A 1U49A 4BRFA 3TAFA 4RW8A 1W7AA 1N5QA 3G71S 1BWEA 3D67A 3SV4A 4CK2A 2IM1A 3FRZA 1X5PA 4TU8A 4C7QA 1Y3KA 1H2UX 4B02A 2YKMA 3EWGA 4EIAA 1KLMA 2ADBA 2DFEA 3R1HA 3PYFA 5L9NA 5AQVA 2PYJA 4E2FB 1G15A 4BBYA 2W9MA 4FJ5A 2A40A 4M9NA 4EAHD 2CIMA 3ZT0A 5D15A 3VERA 3SLCA 2M88A 2JDJA 4LRAA 4YHHF 4ECQA 1PJ5A 3D1QA 1T94A 3P3DA 4JV2A 2ODGA 3QNMA 1LWFA 3IV6A 4QCLA 2QARA 1ZQNA 2VFVA 3PX0A 1YVFA 3NMRA 4OYMA 5AQFA 1QHTA 2I7NA 3RGIA 1CJKB 1X8DA 2C3YA 3PSIA 5KT3A 2VF3A 1FNOA 3G4SN 3W1YC 4AFFA 3PKYA 2F4FA 3R6LB 2UUWA 4ZMMA 5CZXA 5IINA 3G2XA 2V4JA 1Z2ZA 3N0VA 4JP8A 4F50A 3CC4S 3A8EA 4H4MA 3NVMA 9ICMA 4ZVOB 4CZMA 1RHKB 3UIQA 3LPTA 1NSAA 4ER8A 5KT7A 2H48B 1JXBA 2IIRA 2BE7D 3TVYA 3F5AA 2DPIA 3KHYA 1BQMB 1V4SA 2KU7A 3VCBA 5KFPA 1Y3JA 4IOXA 2ABYA 1TL4A 5GAGI 5ALPA 1Q5YA 3IG5A 2JR5A 2MQOA 3PLAA 2YNIA 4OYXA 4F91B 1J5OA 4GXIA 4AHUA 4KI6A 4HVZA 5K9FA 3DXBA 1K1SA 4LF7K 2WF8A 4YD1A 4G3IA 2W2OP 4B9QA 1U2FA 3HF5A 2LYVA 1KQGB 2HNYB 2KQ2A 4ZPAA 1HIYA 2G0AA 4OD0A 4NMLA 2BJ1A 1RT3B 3BGUA 2XLIA 3TAQA 3HVRA 3WNFA 2IAJB 5MLCQ 3RJIA 2CQDA 3C5FA 4P2MA 4YB1P 4H0TB 4PG6A 3D3CJ 3ICLA 3M2VB 4F4ZA 1A0OB 1LWEB 1MDUB 1LWCB 2VKRA 4JI8J 3CE8A 4CLKA 3VTIA 2QL7B 4FBUA 1WHXA 1OMSA 3WQUA 4B9SA 3MPWA 4ID5A 1JKHA 4UZCA 1U6FA 2HVEA 4U8VA 3IS9B 1SAZA 3UDEA 4YS2A 4RNMA 1S7IA 4ZIWA 5HR7A 3NGZA 2L5YA 3HVTB 1NPPA 1ZQHA 2F9TA 3V9XA 2ZJQQ 2IGIA 4FVUA 4RQ0A 1RM6C 4AYBC 4IDKB 2J6SA 2VA3A 4DV2J 1B4SA 4J7CA 2RHSB 3THWA 3TADC 3OYHA 3ZT2A 3CJTA 4PQUB 4FKYA 2QK9A 3EVWA 8ICFA 3T79A 2RDDA 3P8BB 2W03A 4L3KA 3G6YA 2XSJA 2EBEA 2DRDA 3M6XA 1RTHA 5ELZA 1TL1B 2HBRB 2QWPA 1PK1A 4CDGA 3N5FA 2AV5A 4CZGA 4OQJA 4LJMA 2MSNA 2KHQA 1JLEA 3Q8KA 4FN5A 1KVKA 3FCVA 3OYNA 1PC4A 3MXMA 2EC2A 2AQ4A 4P2FA 1RWOB 4H4KC 5B0CA 4Z6EA 7FDRA 2F7VA 4Q44A 2X7IA 1FRMA 3KOOA 2A6OA 1T9UA 1L3UA 3L95X 4NZ6A 2MZ1A 8ICZA 4IG3B 3H2UB 2W04A 1MWMA 4DFJA 3NY0A 3DLGB 3B6PA 4X65F 3D68A 1S12A 1ATSA 1ZS6A 4PPZA 2H3QA 3ZTOA 2ZH6A 1ZOLA 3PZPA 1CJVB 4ES2A 4MQ3A 3AA2A 4DPYA 3GIKA 1XWLA 3PX4A 2FF6A 3HRDD 8ICIA 4UB6U 2J9DE 1LVHA 1T05A 1BPDA 4FZXC 4EEKA 3UFCX 1Q53A 3T5HA 3NG8A 1EKSA 1ZD2P 3H8SA 1RDBA 1N5YB 2E5GA 1EIYB 1BLUA 3ADAC 2PC6A 3D9BA 3ZSWA 3W5ZA 3WIVA 4CFCA 3IRWP 4OI0A 2F8HA 4RQ6A 3QE9Y 1G99A 4RQ1A 3FFIA 1U6ZA 1GXUA 3KNGA 4USUA 5EOYA 5HRPA 3PSFA 5H9EJ 4JKCA 5GTHU 3J7Z5 5GAGP 3C6AA 3IG8A 1JLCA 4PEOA 3JQKA 3MD3A 4MF2A 4QZBA 3CCSS 2O8CB 2P6SA 9ICKA 1IBKK 1DLOB 4DU1A 4M1KA 2NPFA 1N8RO 3HFKA 4CE6A 4CTAB 3V4IB 1UJ6A 2ZJPL 5F3ZA 3LP0B 4KH6A 2JVRA 2FZGB 4YB6A 5B7WA 1RBRA 2W3RA 3BV8A 4LH4A 2CQ2A 1RTDB 4P4MA 3RAXA 3PMLA 4DQIA 3HKWA 4CZKA 2ROGA 3S1TA 3NDKA 3EICA 3UQ2A 3FSXA 3VQBA 3TRGA 2OFHX 3M8QA 5HMZA 2XM3A 5ALNA 3IXQA 3ISDA 4CJUA 1TZ0A 4ZLNA 5HLFA 4R65A 3CF5L 3EM1A 5BPMA 3ZI4A 2DNLA 1FJGF 3DEEA 1XR7A 3BF3A 4F36A 2XO6A 2Q2RA 2J6TA 3RBXA 2NRWA 3WKAA 1VRUA 3I0RA 3N4WA 1L3KA 3SD7A 3HSCA 2I9SA 4E1NA 3TPQA 4UOGA 4U7CA 2CXYA 2DVIA 2ZZNA 2A1RA 4M42A 3GZ7A 5BRHA 2KV2A 2W7AA 1V9OA 3OUYB 1QD1A 2Q0ZX 1ZM4A 5A8KA 4HDHA 3R1XA 3BN4A 2CH5A 3KFUF 5A8RB 2E9ZA 2WMMA 1FNXH 4WFYA 5LXYA 1JNZB 1MU2A 5ALLA 5E33A 1KVCA 2OIHA 5JS1A 2OTJN 3E9OA 4C3MA 2IJRA 2BHNA 4OI6A 1F3FA 2FPKA 8ICYA 3LGNA 5CWRA 1R7IA 2R18A 4YD2A 1JL1A 4DCHA 4KE5A 4FYVB 3NKYA 1ZQEA 5DO2A 3RSEA 5AQUA 1HW9A 4WFAL 2FMSA 2VG6A 5AQZA 5C2GA 2V8DA 4V19S 4J2EA 4ZPTR 3N97B 4NO7A 3NL0A 3PXGa 3NFAA 1O0PA 3KJFB 1N5SA 1EETB 2UUAF 1JROA 1K8KB 5KG0A 3DFEA 3DLLQ 4BJQA 2IVOA 4DCJB 2Y0BB 1Q8KA 1FXXA 4X5VA 2OANA 1KOOA 4BXOA 4F5QA 1ZD3A 2Q0UA 3R7NB 4P75A 1RT6B 5IOLA 2IRUA 2LQBA 2OM6A 1BWVA 2V9KA 3ASMA 2JZBB 3ZDAA 1ICEB 4L6V3 4P2SA 3AV9A 3CERA 5AJ3F 2HOFA 3L2WA 1HLWA 4GKJJ 2HOEA 2JLFA 1T9TA 2FHJD 3ZDEA 4H4OA 4KHUA 4DTUA 4KIAA 1FEHA 2BYCA 2Q6CA 4UF4A 5E84A 1T3NA 3PHTA 4Y2XA 3BYRA 3QEXA 3U26A 3IRXA 3CCLN 3HJEA 4QWDA 2YN4A 3K5PA 4I68A 1X5TA 5ALWA 3OVSA 4YOEA 2DHGA 2DUYA 3LAKA 3SI8A 3CCES 2QA4N 4DQSA 1CXUA 2D4WA 1JLQA 1SB6A 3R5AA 3A3NB 5CABA 1I94K 1BD6A 3D7SB 4OZ2A 5F8GA 1OH6A 5J0YA 2A10A 8ICOA 3VQEA 1RWWB 3CO0P 3KLEB 1S4EA 3J7AP 2FZKB 5ALYA 4RQ7A 5KGWA 4X4QA 3HHNB 2M52A 4FYXB 3NS7B 2LEBA 5KFAA 5KFLA 1DY3A 1YZ6A 4A5BA 1ZQMA 3TTFA 4Q2LA 1RWXB 3CJ7A 5J8YC 5M1PA 1X9WA 1RDCA 4PQAA 3UDCA 2W2MP 2W7OA 4Z7YA 3UPFA 2CGJA 1X6IA 2GHPA 1UA1A 5CQGA 2VQFJ 2Q3SA 1SGGA 2A1BA 2JJ4D 1VSEA 4KI4A 4RNNA 1D8YA 1D8LA 1UQVA 2OO4A 2HHHK 3DLRA 4FS2A 3MM5A 4CJWA 2IOFK 2VA2A 2E1PA 3DDNA 4IQVA 3GWCA 1WHWA 1I1GA 4KLFA 1WF0A 4ICLB 2E1CA 3CQXA 1V3ZA 2BTFA 4AYBF 2ZIUA 4ED8A 1VJWA 1S99A 1YGYA 2P6TA 2RMLA 4BREA 3W2VB 2P9GA 2WK4A 4JI8F 2QE5A 3SAGA 1XUPO 3PIPL 4Z4FA 4RO0A 2AJ1A 3DC2A 3NAIA 2H4WB 3OY9A 3RJEA 3ENVA 2VG5B 2DR6A 4M2YA 2HBKA 3UR3C 1PIEA 2B7BB 3ZZZA 3J7ZO 5CHCB 4I6WA 3MC1A 5RUBA 2KYXA 3IAS9 4ALZA 5AKHA 1UWBB 2IVMA 5BXIA 4U7BA 1C0MA 4LFBJ 4DUZK 2KFNA 3DOLB 2QA4G 3PFEA 3QGIA 3TVKA 1SJFA 1T3QA 1F9EB 2YH1A 4DPXA 4PCQA 5B0BA 4RJVA 1NK5A 2M2BA 4ZVSB 1X42A 1RKIA 2PT0A 2OPQA 3V5RA 3LPUA 3TARA 3IAM9 4XH5A 5BPNA 5AQKA 1JKHB 3QERA 2K8CB 2V4RA 4GW6A 2YPYA 2W40A 4GY2B 1CQMA 4JRPA 1Y00A 1NMNA 4ZHRA 4K8RA 2G07A 2HNZA 1KBUA 5AJ3J 3FR0A 3LP3A 3VEOA 2P6RA 5KNIA 4V19X 3LGMA 3QU2A 4UASA 1VK8A 2BW7A 3V7KA 3FZLA 2V51B 4DX7A 3C1ZA 4IH6A 2ZG6A 1WAFA 1PBAA 3G8SA 2E9TA 4K8ZA 3DKDA 2R7WA 4OHYA 1F0XA 2HWHA 5JVGL 3U7JA 2I1QA 2DTUA 3GJSB 2G2ZA 5TKWA 5BR8J 5F3XB 2U2FA 2RNEA 5GMKa 3HFZB 1GOCA 4CGDA 4TY8A 3KLHA 5AI0A 4C8NA 3JPPA 4KJIA 1M5KC 2JWKA 2WRMA 2XG8A 1NSQA 2GMHA 4H03B 3P39A 2RKIB 2RSQA 2XYPB 3O5BA 1CJTA 4U6PA 3AXMA 5AFUA 2ZZTA 3T69A 2GQQA 4KH0B 3E2EA 4YB5A 4LQ9A 4TQSA 1GMUA 4GV9A 1QVFM 1ZQCA 1YG0A 2E5HA 4G6VB 4GFJA 3AVHA 3CTRA 4CH1A 4J2DA 3HSDA 3EO3A 5J8YA 4I2AA 1K44A 2PFOA 3SV3A 4IFVB 2M8DB 3VGSA 4DFMA 4ILGB 2PI4A 1SJ3P 4FLTA 7ICFA 3NGYA 4JN4A 4I2QB 3RMAA 3V7JA 1QTNB 4F5RA 4ANCA 2OPRA 3MN5A 3S6EA 3ONNA 1N63A 4ZLPA 3X1LB 1U1MA 4DV7F 1FERA 1I51B 4JI5F 2O3DA 3S3MA 2DYAA 7ICIA 1NZPA 5EE1A 2A18A 4LF6F 4HHTA 1DQ8A 4A8OA 4CECA 1Y64A 1JLGA 4J9PA 3GFZA 4B3SF 5D49A 1VQ8S 4TQRA 5LSRA 4QPXA 4C8ZA 4NLOA 1FD8A 4KRFA 2V4JB 4QJVA 3OXLA 1IVZA 4HHJA 4QZVB 2MQPA 2N3OA 2UU9K 2BPGA 4NZ7A 3W60A 4UTGA 2RU9A 4JD2B 1RTIA 3P5TL 5ETPA 7AT1B 3MN6A 5HAOA 5GMDA 3U4LA 1T03A 4NLSA 4KITB 4WCEQ 2YB4A 1RWPB 4RQNA 3PO5A 3M8RA 2P9UA 3NH0A 5F9NA 3M1VB 1IXKA 4ECYA 9ICSA 3QRRA 2JEJA 4I29A 1RAJA 2LFVA 4C8YA 2HHHJ 2YNIB 4JI8K 4O4GB 2VQEK 3JPQA 2C3UA 4NOHA 3D6HB 1N36K 3HVAA 4NJ8A 4YB7A 2BGWA 2MKHA 3CQ8A 4OYOA 5G5HA 3S3NA 1RDAA 2ILZA 4NI2B 3SSQA 1SL0A 3H2LA 1E6VA 2P9SB 4KV8B 4F93B 2YVSA 1YUWA 1QQ6A 2OWOA 4FPIA 4ZPVR 3VQPA 3GPAA 2FD2A 3MEKA 3AOAA 2ZKTA 4M94A 2PSZA 2WB1C 3DXKB 3SEOA 1C20A 4CF1A 4F9OA 3QO9B 4WJ3B 1KXPA 2F8EX 5CE3A 3RH6A 4K4XA 3OYDA 1H72C 4B1ZA 1Q82T 4DTRA 1VHFA 1X31C 4QR1A 2OEMA 2DH7A 4BWJA 3RTVA 1LWEA 3VAJA 4QOZB 3QFUA 1RABB 4IFEA 5H1SV 1M1HA 2PO4A 2F8KA 5DGAA 1IV0A 2HS0A 3O44A 1FA0A 4M5DB 3E8OA 2KRRA 1RCOB 4K2XA 2BKEA 2C22A 1XN9A 1ZC6A 4DB3A 1Q16B 3EGZA 4K0KF 3TANA 1U26A 4KH5A 3THXB 2CG8A 2E66A 4IQWA 5IIMA 1W2BR 3AQOA 1RG6A 1KS2A 2EXUA 2MKCA 3PG9A 1VS3A 3R5DA 1VQ6S 1DAXA 3AEVA 4ELTA 2VPWB 4KHQA 1VLYA 4ZTFA 1LFWA 3O8WA 4CT9A 3HRGA 3LK9A 4CM0A 1WG5A 1W0HA 4KBOA 3AMZA 4BC7A 2DB1A 3C29A 2PMZC 3M4XA 4KLGA 4DN0A 3I31A 2N82B 2C2KB 2WAQF 4NLRA 4KGVB 2E5IA 6FD1A 4YDXA 3G8QA 4M0AA 2GAHC 2IS3A 3K8WA 4B9MA 3SENA 3JS9A 2ZUCA 2KVQE 2MTLA 1X4DA 2EHGA 4DUYF 1S10A 1HARA 3BGLA 4LRCA 4MKYA 3BQ0A 5HQ8A 1X5SA 3FC9A 3NCQA 2CDRB 3K57A 1FRXA 2AIRB 3V9SA 5M1FA 4NXNF 1B7FA 2E29A 3KD1E 3MWTA 1HNVA 5AKYA 1RYSA 5LMUF 3W2WB 2OHFA 5KAIU 8ICWA 2GVZB 4I27A 1BQNA 3T1YK 1M5HA 3RZAA 2E6MA 4CO1A 3OR1B 4I2CA 4KX5A 3O6WA 4DR1K 2HHSA 3KJNB 4N76A 1OVQA 3KBBA 4MK8A 2ZIVB 3B0YA 4DL7A 4I2QA 1XS9D 3DM2B 5B8HA 3JS6A 5SUHA 4DR3J 1ESVA 1VRQC 1FE4A 1S72N 1S49A 3QNOA 2VUGA 5DQIA 1U09A 2FSKA 5DM7L 4H5NA 1E6YB 1JIHA 1EARA 3WK8A 3HBTA 1CRXA 3QT8A 4EP4A 3HW8A 4BRLA 4OJ5A 3HXMA 1SJ1A 1KQKA 3PFOA 4QW9A 3VAFA 1ZBIA 2WSCC 2I5HA 5DMRA 4BRDA 2ZWPA 2CDQA 8ICUA 3D6MB 1T8EA 4JKAA 4HVJA 4LF8J 2R8IA 4LF1A 3MF5A 1OO0B 3RJFA 4H5WA 2ZTEA 4DTJA 4BGAA 3ZZYA 1IKXA 3TACB 1W26A 1NPRA 1ZBTA 4BRHA 1M5OC 3IP4B 1BI4B 2QG9B 1KCFA 2QWNA 2RUSA 1CUKA 4B9UA 3PW0A 2ATLA 1T44A 5FROA 2VDIA 4K4YA 3D45A 1RHUB 3KD3A 2WB4A 4A8YA 3ZDDA 1HPMA 2J9CA 3K1ZA 2GHVC 2K06A 5AM2A 5HMWA 1B3TA 4UAWA 4Y2YA 1X0FA 4RU2A 4QWEA 2QYGA 3UXNA 4Z4GA 1YBUA 3A5OC 4F2RA 8ICSA 2IMWP 3BKFA 3QAUA 4BHQA 3CMES 2JZBA 5AI5A 1RCHA 1PCAA 4LRFA 3M8PB 1U2VB 4XPEA 2VU5A 2ZBPA 4PYDA 2DPJA 3IC1A 1IJFB 4QZEA 1KFDA 3OFFA 4IRKA 2ZDOA 3IA0A 3JAMO 4BR0A 1QVGM 1S6QB 3FMBA 4F25A 1YBAA 1WBDA 3FYHA 2YNHA 3OJSA 4CP5A 4TYAA 3L4IA 1HBNA 4NA1A 1FRLA 1Q7YO 4DN9A 2W9BB 2F8MA 4C2MA 1HNZK 5JUMA 2CPIA 4CNQA 2IRYA 5J0RA 4C8MA 2QTDA 4Q2MA 1RWVB 4H5VA 3MECB 1TTHB 3M6GA 1GLDG 8ICRA 2V6AA 5AK5A 3QU5A 2X51A 2D0OA 4E1MA 3ALRA 3WKEA 3T9NA 1MROB 1SJ4P 4UY8O 2V8PA 5KG6A 4P2XA 5JLHA 3QLHB 1VI7A 1IKYB 3QEWA 1FXRA 3BKTA 1NPKA 3W5YA 1BISA 1GK8A 4Z6CA 4JKBA 4PWDA 2AGOA 3NRZA 4BUGA 3V4IA 4DUTA 2OI2A 2CQ3A 1VQ4S 1FFWB 4CO5A 2AH5A 3K89A 1H98A 3G6XA 5D6GA 3W9JA 3GU0A 1YJRA 4DV5K 1Y88A 3VENA 5C42A 1A9NB 3HM9A 4JI0F 4LFAK 3CJ9A 4RBUA 3KLGA 5IT0A 4B1XB 3C6UB 3BUZB 5EXWA 5CXTA 1ITPA 3K5LA 2G8FA 2YHYA 4EP5A 1WLJA 4RX6A 4ZLJA 1AFIA 1WG4A 2DGQA 4KHYA 1RT1B 1IBMJ 2IVPA 1WBBA 3TAEA 1N8RT 1A5VA 2FHKA 4YDDB 1UEVA 3TW0A 4PUOB 1WHYA 3B0XA