3PX4A

Crystal structure of bacillus dna polymerase i large fragment bound to dna and ddctp-da mismatch (wobble) in ajar conformation
Total Genus 191
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
191
sequence length
579
structure length
549
Chain Sequence
KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural evidence for the rare tautomer hypothesis of spontaneous mutagenesis.
pubmed doi rcsb
source organism Geobacillus kaustophilus
molecule tags Transferase/dna
molecule keywords DNA polymerase I
total genus 191
structure length 549
sequence length 579
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2010-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3px4A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 3px4A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3px4A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3px4A01
1REVA 2ZTEA 3PR4A 3DOKA 3UXNA 3RBDA 2OA8A 3OYFA 9ICRA 4F5RA 4NM1A 4WE1A 4C8MA 4KHWA 1MQ3A 3UXPA 3CFOA 4TUPA 2R8IA 1A76A 4HYKA 1WSFA 4DSEA 1KVBA 4RW6A 5J2DA 4QZEA 2G8FA 4HCCA 3V9UA 3LAKA 5KRSA 1S76D 5KFCA 3TAEA 3HJFA 1ZQVA 3PV8A 9ICWA 2LYHA 3L8BA 5J0RA 2BR0A 3UIQA 3PMNA 7ICJA 2BCUA 5J2AA 9ICJA 3H8JA 2IC3A 2XGPA 7ICNA 2DTUA 3SZ2A 4EBDA 1ZQFA 3ZD9A 4QZIA 1VSIA 2A1JB 2Y1IA 4IFYA 4FJLA 5IILA 3IRXA 1NKEA 4CEEA 1MQ2A 5DLGA 5HROA 5DK5A 5HBMA 4KLEA 3PO4A 1Q9YA 3PX0A 3CM5A 3QEAZ 4FJ7A 2D0CA 4AHSA 2G8KA 4ECSA 3VQ8A 3C23A 4BXOA 3MXMA 2GBZA 1ZQIA 3PW7A 3C6UA 2HHTA 1Z25A 1BHLA 4CHPA 4FK0A 4DFKA 8ICVA 2FC0A 4Z4HA 4FJNA 8ICNA 4E7KA 1QS4A 1WSGA 4ECUA 2BE2A 3KKSA 5SZTA 3AUOA 4M6WA 3G10A 1ZQTA 4O3PA 1JLQA 4QZAA 4IDKA 5D4BA 2R8KA 2NRZA 1U04A 3LWMA 4ED3A 1IKWA 4FK2A 4LSLA 5J2PA 4Z4CA 1BVSA 4KV8A 2W9BB 4GLXA 3CQ8A 1C1BA 5DB8A 4RQ7A 3TI0A 4M9NA 4ELVA 2DFHA 3P1GA 4HCBA 1YTUA 4RNOA 2NRTA 2KN7A 4I2IA 2C2RA 1TVAA 4M3WA 1ASVA 5DDYA 2BKEA 3K59A 4PA1A 4B8CA 2AGPA 4OJRA 4Z4EA 4Z6CA 3H8SA 4CGGA 5KG2A 4RQ5A 2YV0X 2HHXA 2KFZA 3ZSRA 4J2EA 1RYSA 4I2GA 4KLLA 3KK3A 1U48A 2BCRA 3KD1E 2HVHA 3CFPA 3ZSYA 4F4KA 3CFRA 4J2BA 4KTWA 3RJFA 3GQCA 7ICIA 4ECYA 3TABA 3NGZA 3OGUA 4F2SA 4RQ1A 4RW9A 7ICPA 1U49A 3SV3A 3V9XA 2BDPA 1K1SA 1WNSA 3L2UA 3QESA 5KFJA 2C2EA 2MUTB 3V1RA 4KO0A 4Y1CA 1WCLA 3WNHA 3MR2A 4O44A 7ICHA 1SUQA 3HYFA 4O5CA 3AU6A 3MFHA 1UWBA 5DBBA 4EBEA 5J29A 5J0OA 1JLAA 4R66A 4OGCA 4R65A 2BPFA 3EW9A 3RB6A 4I2AA 3L3UA 2XGQA 4CJRA 1ZQNA 3EZ5A 3QO9A 4GMJB 1S1TA 3TAQA 2Y1JA 5F9NA 4M9JA 4J9OA 4I2PA 1U47A 1TVRA 1S0MA 3QNOA 4BE2A 4IQVA 4C8KA 4DU1A 2DFFA 5DB7A 3C2KA 3ZDCA 3L2QA 4Z6FA 3C5FA 2GWSA 4E7LA 4O0IA 2KZ3A 4JK1A 7ICLA 3MEEA 5SWMA 4O3OA 4F4YA 8ICEA 2AU0A 1U45A 1ZQUA 4IKFA 1VSDA 3AVMA 7ICKA 9ICHA 4DL4A 2F96A 1MC8A 5EOZA 5D3GA 2I9GA 3RBEA 5KFDA 2VANA 4Z4FA 3OYGA 1NK4A 1ZBFA 4R8UA 2BCVA 3DLBA 2NUBA 4FJGA 1BPDA 2E6LA 2Q0ZX 3T1AA 4QW8A 3QEXA 5DMRA 4UAYA 1NK5A 2AQ0A 4UB4A 4CGIA 3CM6A 3NHGA 5KFZA 2AGQA 4QZDA 4CK1A 1VRUA 1RDAA 4CFDA 1Z26A 3LP2A 3BQTA 1ZQXA 3OJSA 3VQPA 3KLEA 4PWDA 4YFKA 4YMMA 4UAZA 1J54A 4YXJA 4FLXA 4PHAA 4TUQA 1NK7A 5CZ1A 4E1MA 4DFJA 2VG5A 3HVRA 2ZJAA 2B4JA 3H08A 1D8YA 5KT2A 4PY5A 5DB9A 4AHTA 1ZQHA 1ASUA 1C0MA 4K4IA 3T3FA 1ZQWA 3AA4A 5KFFA 2GV9A 2XCAA 4FW2A 4GXKA 4GW6A 2IHNA 1HQEA 2VA8A 4HTUA 5DBCA 1ZETA 8ICJA 3HL8A 4E1NA 1R0AA 4M42A 3AV9A 4F4WA 4DWIA 8ICHA 4DF8A 1HRHA 4KTZA 3ASMA 3RTVA 2G8HA 1LWCA 1ZQKA 4LZDA 1QTMA 4LH5A 5KG7A 1K6YA 3BDPA 1Z00A 3PR5B 4E89A 4G1QA 1B22A 2A1RA 4GC6A 3Q8MA 3U6FA 4M6WB 4J9LA 5EWFA 4N47A 4J9KA 4KKOA 3ZSQA 4RUAA 4QWCA 4ID5A 1UT8A 2ETJA 4UB1A 3K4GA 1D9DA 3RJHA 3LP1A 1SZPA 4B08A 1N5YA 3MDAA 2VG7A 2A1JA 3VA0A 4CJWA 2KTQA 4QWBA 5CZ2A 4CIFA 1NK0A 1QQCA 4RNMA 2Q3SA 5KT7A 5CA7A 5J2IA 1YTAA 4CF8A 4I28A 9ICFA 2XHBA 1KCFA 2XRIA 3NE6A 3WNFA 1W9HA 2AJQA 1L3TA 5DG8A 3LANA 1IXRA 4N5SA 3AVGA 1JLEA 5C42A 3RB3A 2Z1IA 2FMSA 4FW1A 3DLEA 3DI6A 5DQIA 4CJKA 1D9FA 2G8UA 2ZD1A 4RUCA 1NOYA 2IOCA 3V9WA 2QKBA 4IR9A 4F5NA 1BPBA 4X5VA 2PY5A 1XHXA 1CXUA 3VA3A 4FJMA 4R8UB 3EY1A 4G3IA 3SQ4A 4DL6A 4I2HA 1IKYA 3I0SA 3NGIA 3B6OA 3KHLA 1ZQPA 1EETA 3Q8SB 3NAEA 2BPGA 4QZCA 2ISPA 2LSNA 3GILA 2Z1JA 4O55A 5CYMA 1VRTA 1DTTA 3K2PA 1F21A 1WAJA 1TK0A 3V6JA 1KFDA 2P5GA 3RJGA 5DG7A 1S0NA 3S3OA 3M8QA 1HUOA 1RT7A 4DTUA 3CG7A 3NF8A 4DTOA 5KT6A 1NOZA 3HWTA 1VK0A 8ICAA 4M04A 4O5BA 3H8WA 5I3UA 5C25A 3NBPA 4FCYA 3AVIA 3KKRA 3SV4A 4MEXA 3G6VA 4DSKA 1FKOA 2ZQBA 3GIIA 1QE1A 5FRNA 1KRPA 3MR5A 3OS0A 4FLTA 5KFYA 3RAQA 5IINA 3OYEA 4M9GA 1CLQA 3DLRA 1Y97A 3OYMA 4B9UA 4CGFA 3SUQA 1JXEA 3C1YA 1C1AA 5HP1A 4FJ9A 1ZQRA 3E01A 1IKXA 2W8LA 5J2QA 5J2MA 1WCNA 4RG8A 3HO1A 4JWNA 3GV5B 1QSYA 1KEJA 3KJVA 4FJJA 1DOQA 2IAJA 3HP9A 1VSMA 3NGYA 3LP0A 3OYKA 4I2FA 4KB0A 4DLGA 2DPJA 4YG2A 4YNQA 4CGDA 4C8OA 2O4IA 4MF2A 5DG9A 3KLIA 4O3RA 4FLVA 4CJ4A 1RBRA 4DL2A 3HPOA 4E19A 3WNGA 3D45A 1S1UA 1CZ9A 1BPEA 1FK9A 1FXXA 2UVRA 5BPCA 2OYQA 2YHAA 4CEBA 3SUNA 4F8RA 4YR0A 2ZUBA 5KT5A 1ZQCA 4DLEA 1UT5A 4DQSA 3JPOA 4YP3A 3AO5A 4DOCA 4F5PA 3TQ1A 1UOCA 2UVVA 3VQ9A 3V72A 4W5TA 3EPIA 4MEYA 5KG6A 9ICMA 1VSEA 1PZNA 4ED7A 4B9NA 4HVJA 3K58A 3KLHA 3QEBZ 1J9AA 5KFIA 4FVMA 4FM2A 4F3OA 4FJ8A 4FM0A 4CFCA 4J9SA 3K5MA 2OZSA 4JS4A 1IH7A 1T8EA 4J9MA 4BE1A 4ED1A 3KD5E 8ICMA 1LAVA 5EWGA 5D46A 4QWEA 3NGDA 2BANA 5J2FA 3VQCA 1JLCA 3C95A 3OYNA 1JN3A 2FPMA 1TV9A 2YNFA 1GOBA 4KHUA 3UQ2A 2YKNA 1RYRA 3RJKA 1T7PA 2I1QA 1EKEA 4IQTA 2F1IA 5KGXA 1RPLA 4KRFA 3ZCMA 1ZQGA 3SI8A 3AVFA 4YXMA 3LWLA 4YVZA 4PH5A 1AROP 3MGIA 3AVLA 4DOBA 3QINA 3ZT3A 3ZT1A 3KHGA 2BCSA 5KG4A 3UXOA 3QE9Y 3V1QA 4DL5A 2H5XA 2KZZA 3SYZA 1NJWA 1B9FA 4CJFA 3AA2A 9ICAA 3JPNA 4EZ9A 3M9MB 4IRKA 2FLLA 3GIMA 3O4NA 5KG3A 1XO1A 4KLDA 5BOLA 4M41A 3GDXA 1NJZA 2FPLA 1K1QA 4MFCA 4KLGA 3RH6A 4GC7A 4CHYA 2RDJA 5KFPA 3ZD8A 5FDLA 4PPXA 4Y1DA 4E7HA 4CF2A 4KLUA 1IG9A 3VQEA 4P2HA 3L2WA 5HRNA 3V6KA 4P4OA 2C28A 3LZIA 1Q8IA 3V9SA 3ZSWA 1ZBLA 2V4QA 4ECWA 2EX3A 4J9RA 4B9TA 4Q5VA 3VQ7A 4ECTA 3V9ZA 1BGXT 2X6SA 1ZQOA 9ICGA 2X74A 2F8TA 3OYJA 4KI6A 1HUZA 4YMNA 5J0TA 4Q8EA 4MF8A 1J53A 3TAMA 2ZJ5A 3HPGA 4DU4A 3NDKA 4O9MA 1NK9A 1ZQYA 3KTQA 3QLHA 4CFAA 1TKTA 7ICOA 4CIEA 5F9LA 3BQ2A 3QIPA 4KHSA 9ICKA 1KDHA 4FXDA 2FBYA 3PX6A 5KFVA 1JL1A 3SPYA 1A5VA 1TL3A 4DTXA 2E4LA 2B21A 4FK4A 3SNNA 1X2IA 3RJEA 2FLNA 5KFQA 1G15A 2ZUCA 3E2EA 2BGWA 5KFWA 4ELTA 3AVKA 4R63A 5IIJA 3C94A 4KN4A 1X1PA 3DMJA 3RH5A 2F8SA 5DGBA 2JEFA 4NY8A 1SKSA 2JEIA 4CHOA 2ATQA 1BI4A 8ICBA 2PXIA 5FROA 1MU2A 2P1JA 1QHTA 2DPIA 2W42A 2ZTDA 4JLHA 5I42A 2ASJA 4IG3A 3SPZA 2ITGA 2KQ2A 1NJXA 3HSTB 5KFOA 4YR2A 4EEYA 4EBCA 1ZYQA 3K57A 4BWMA 4BXOB 9ICBA 3U3YA 3B0XA 2VA2A 8ICYA 4DS5A 5HP4A 4GXIA 2ZE2A 4I2CA 3AO2A 1XSLA 3RMBA 1D8LA 3RB4A 5HRSA 2RDIA 2UVUA 4YN4A 3EPGA 4Z4IA 4IQUA 2W9CA 3OS1A 8ICGA 3ISNC 2FMQA 2YNIA 4CJQA 8ICLA 3JPTA 2ASLA 7ICFA 4CF9A 1Z3EB 4K4GA 1XHZA 1JX4A 4P4MA 2XY7A 4RW8A 1EP4A 2QKKA 2ZTCA 4M3ZA 1TAQA 4DSFA 1S1VA 4BDZA 3NCIA 3MFIA 4AHCA 9ICCA 3OYHA 1EXQA 1N48A 7ICQA 2YNGA 4CERA 2ATLA 4F2RA 4CJUA 2XY5A 4KHNA 4QAGA 4CHNA 3OYCA 5KG1A 4KLHA 4ECZA 1B9DA 4CJ5A 4M2YA 2BGGA 3OSNA 2PYLA 4FJ5A 3OYDA 1Z00B 7ICRA 1WSIA 4KN7A 2RN2A 1BI4B 4NXZA 5J0PA 4JWMA 4FLWA 5J2GA 8ICUA 2PFQA 4RQ0A 4W5NA 1S0VA 3PVXA 2VWJA 2P5OA 1S77D 3O4QA 4FLZA 4UAWA 3B0YA 4AHUA 3LK9A 3ETLA 1NK6A 3EYZA 4F4XA 4CGHA 3V7LA 4E7IA 4Q0BA 4EYIB 4CEDA 5CYQA 3ZSVA 1ZJNA 1XSPA 4UB5A 4CFBA 3OYLA 1JL2A 1GOCA 3TFRA 2O4GA 2IDOA 5J2JA 8ICWA 2FMPA 3OHBA 3ISBA 1XSNA 5KRTA 3NF6A 3K5LA 2QXFA 2R8GA 4AHRA 5KFHA 1RTJA 4ED8A 3LP3A 2V4RA 4DQQA 4M3XA 1ZJMA 3QEWA 4M0AA 1SKWA 9ICUA 3RH4A 1V9PA 5FRMA 4RPYA 4F5QA 4I29A 5CR0A 4RQ6A 3M9NB 2MAXA 3KHRA 4QW9A 1C0UA 4ED0A 1YT3A 3JSMA 1W0HA 3QEPA 1C6VA 3AVBA 4PGQA 1TK8A 4BGDA 3IG1A 1DTQA 1KVCA 2C22A 4LY7A 1CZBA 3PW2A 3HX0A 3V7JA 4RQ2A 3TAGA 2W9AA 1B92A 3C5GA 4LH4A 3V1OA 4FZZA 9ICPA 4O5EA 3PO5A 2EHGA 3NF9A 4N41A 1BCMA 2KW4A 5KFXA 2AGOA 4I7FA 1J5OA 3DM2A 2IHMA 3RJIA 4MFAA 1ZQZA 5J2CA 4YD1A 3BQ0A 3RAXA 4NM2A 3Q8QB 3ZSOA 9ICIA 4CJ3A 1JXLA 3MXJA 4KHQA 4EP5A 4QZHA 8ICZA 3PNCA 3IS9A 2JEJA 4YMOA 1BPYA 3V4IA 2FBTA 3V7KA 1KFSA 3IHQB 3KK1A 3QNNA 3VQQA 1TKXA 1S5JA 5DGAA 3AO1A 3SUPA 1BIUA 3L3VA 4CJTA 3Q8RB 4H4MA 4NYFA 1NK8A 2OZMA 2M9NA 2C2DA 5HHHA 5CB1A 5HRPA 3JYTA 2DY4A 4NYNA 2YKMA 5DQHA 2FPKA 1RDBA 4ECXA 5J2BA 4RNNA 3LPTA 3Q8LA 5D49A 2B5JA 4LVSA 1RXWA 1H38A 3QETA 5J2NA 1HYZA 4F50A 5EU7A 5L9XA 3GV8B 3N4MB 1RDDA 3OJUA 1WN7A 3QZ7A 3H7IA 2J6TA 4NCBA 3ZDAA 4QOZB 3ZDBA 4N56A 4J9NA 1TAUA 4CEAA 5KFTA 5DLFA 7ICEA 9ICSA 1CUKA 1RXVA 1LV5A 1RTIA 4UB2A 4H8KA 4F4ZA 4OPJA 4JUZA 2XY8A 3MDCA 4DQRA 3KLFA 2ZJ8A 4QCLA 4XUSA 3K5NA 4RT3A 4C8NA 3GIJA 3OSPA 3T5KA 8ICSA 5KT3A 5HHIA 3G0ZA 3SQ2A 5C5JA 4DSIA 4KLTA 4CCHA 1QSLA 4I2EA 3I0RA 3DLKA 4RW4A 5HMLA 5CWRA 1ZQSA 4FJKA 4CJSA 1RNHA 2NRVA 4B9LA 3NH1A 1I39A 1WAFA 4MQ3A 3GV7B 3ORYA 4QZGA 4R64A 5IIOA 1RTHA 4RPZA 4M47A 3GIKA 4XA5A 2HW3A 2HNZA 5DBAA 4M9HA 4KREA 5JS2A 4CE9A 2PFNA 3C2LA 3FDSA 1XWLA 4RQ3A 3PW4A 3ZSZA 4BDPA 4DQPA 3VQ6A 4I2BA 2Z1HA 4Z0UA 5J2KA 4MFFA 4CECA 3A2FA 5KFSA 1NJYA 4BE0A 1KLNA 1ITGA 4CJPA 1UA1A 4CF0A 8ICTA 3K5OA 1TFRA 3M8SA 2WONA 4K8XA 3GFKB 2PI5A 4FS2A 4FLUA 2F1JA 4RT2A 2JLEA 4OKKA 2JEGA 4Q45A 1TGOA 1RDCA 2I5JA 5T7BA 1ZBIA 3VQ5A 3RMCA 1U9LA 2G8IA 2ISOA 1S1XA 4Q44A 4EZ6A 4EP4A 4B9VA 3RWUA 5KFRA 4J9PA 4CEQA 4NCAA 4DOAA 2MUTA 4M3TA 3AVJA 4E3SA 4KLJA 1XI1A 4DSLA 3ZDEA 3AVHA 4FO6A 2HHSA 4FM1A 3AA5X 1QSSA 1ZBHA 1TL1A 2HHUA 2VWKA 1JLFA 3RR7A 3OVNA 1NOMA 1SL2A 5KFGA 4CK3A 1TKDA 1XU4A 4LSNA 3I8DA 1A5XA 4Z6EA 3ZT0A 2HHVA 2JGUA 3BJYA 1T05A 1SL1A 1L3SA 4DTRA 2RF2A 5K14A 4CIGA 5J2HA 3BQ1A 4I27A 2BCQA 4EYHB 4DL7A 5KI6A 4XIUA 2IMWP 4CF1A 4I2DA 4FBTA 4YQWA 1C1CA 3AVAA 4HUEA 1GOAA 3O3FA 2HMIA 4W5RA 3B6PA 4I9QA 3THVA 3S3MA 1S9FA 3T5LA 4O4GA 3M8PA 3P5JA 4K8ZA 4I2JA 1L5UA 4Z4GA 1Y88A 2PI4A 1TKZA 5KFUA 1I3AA 1T03A 4HUFA 1HJPA 4NLKA 3ZSXA 1ZQEA 4J2AA 3QEIA 4J2DA 3G6YA 5EWEA 4K4HA 2F1HA 4M3UA 1C0TA 5IIKA 7ICMA 4ICLA 1X9SA 5CHGA 2OWOA 1D5AA 4XRHA 3RRHA 4MFBA 4FS1A 1IM4A 4KAZA 7ICSA 5KTQA 5DKWA 4YD2A 5HNKA 1KVAA 2J6UA 1HMVA 5IIMA 1ZQDA 3QERA 3HXMA 4TSXA 4PQUA 1WSJA 4KFBA 4KB1A 3SQ1A 5KFAA 5J0XA 4FLYA 3HK2A 4Q8FA 4ELUA 2HHQA 3SI6A 4KLMA 9ICXA 4ZTJA 4ECRA 4FZYA 4F92B 2P66A 4DS4A 3VQ4A 1LWEA 8ICRA 1ZQQA 4F3TA 2ALZA 1L3VA 5HRRA 4RPXA 3QEVA 3NFAA 1HYVA 4DTNA 3PY8A 1U4BA 4DU3A 3KHHA 2WOMA 4M3YA 4GXJA 1SKRA 3MGHA 1RT1A 3JPRA 4KTQA 3NH2A 3KLGA 4BACA 4QZFA 1WSEA 4GVMA 4RQ8A 3HW8A 4DFPA 1RT6A 2DFLA 3QZ8A 4RW7A 4LZGA 1HNIA 3AU2A 3UQ0A 4IRCA 2BPCA 1C7YA 4XQ8A 1BIZA 1JIHA 3PW5A 2XY6A 3VQAA 3S3NA 1Q9XA 4UQGA 4CJEA 4FYDA 8ICFA 4R5PA 4E7JA 1EXNA 3DRRA 3T5HA 3RMDA 3PW0A 4CEOA 1RTDA 4N76A 1DGSA 3AVCA 4FJXA 1NKCA 3C2MA 8ICPA 3DLHA 4B9MA 3TFSA 1RBVA 2D0BA 2OPSA 3LAMA 4FJIA 1N56A 4IFVA 3LPUA 4UBCA 4IR1A 4AHVA 3CYMA 5DDMA 1XC9A 2B6AA 4DTMA 5KFKA 1T3NA 1B43A 3DYAA 3PMLA 1XS9D 4DL3A 3RMAA 3OYIA 3PX4A 3L2RA 3MAQA 3MXIA 2R8JA 2UVWA 3VQDA 4BDYA 4CJVA 5TZVA 3NH0A 4E0DA 4KMUA 3ZT2A 2YNHA 8ICXA 1IKVA 2RPIA 3OYAA 4KLIA 4LD0A 1LW2A 8ICKA 4Q43A 4HHTA 2QK9A 4KLFA 4JV1A 3C21A 2R8HA 3RRGA 1HJRA 4DO9A 3VN5A 4CEFA 4KITB 4H4OA 4ECVA 1JKHA 4DTSA 2AQ4A 2HNDA 4OVLA 3MR3A 3SQ0A 3TAPA 3T19A 1S10A 4JS5A 2X78A 4IBNA 2BQUA 1LB2B 5JS1A 3RR8A 4ED6A 1ZQJA 2XC9A 3JPSA 4F91B 4PGYA 9ICTA 2KZMA 4CK2A 3MABA 5E41A 1NKBA 3O3GA 2DFEA 1S97A 4UB3A 4YFUA 4O3SA 3MECA 1EX4A 3LDAA 3N97B 1JMSA 3ISCA 2D0AA 1JLGA 2PZSA 3HP6A 2XO7A 4F5OA 5KG5A 4M3RA 4OKEA 9ICNA 1S1WA 4OGEA 3TANA 2IGIA 3OHAA 1TV6A 3SUOA 1WLJA 4BWJA 1S6PA 1ZQMA 2V9WA 9ICVA 2PYJA 4NCGA 1N6QA 4C8LA 2X6NA 4B8AB 4DFMA 3F73A 4DQIA 4CGJA 1UA0A 4B9SA 3HVTA 4DEZA 3AVNA 1VSFA 1S0OA 3SCXA 2PFOA 3JPPA 1TK5A 3ALYA 1BCOA 4CJLA 1RBUA 1ASWA 4JRQA 3FYHA 4DG1A 5DQGA 2W9CB 2YHBA 1ZBUA 5IIIA 5KFLA 2R7YA 2NRXA 3FFIA 1RT5A 3AO3A 2FBVA 4AH9A 5J0YA 2HHWA 4ED2A 3ITHA 4CEZA 3IM1A 1KLMA 3KIOA 4RU9A 4UBBA 2ZUDA 1RBTA 1JXBA 4OLBA 3QIOA 4KLSA 1A77A 3V81A 5L1JA 2IA6A 3DRPA 3MBYA 4TUSA 4M9LA 4QWDA 1BPXA 4DSJA 1BISA 7ICVA 4CHZA 4B3OA 5KFEA 5L1LA 4O5KA 1BQMA 2IS3A 4PHPA 4NLNA 1BL3A 3UPQA 4JRPA 3JPQA 8ICOA 2BQ3A 2IBKA 1HYSA 4TURA 1CXQA 1RCHA 3H4BA 4RQ4A 4IG0A 4YCXA 4W5OA 1VSHA 3H40A 1T4GA 3MR6A 3V6DA 3K75D 4QZ8A 2KFNA 1QLNA 3TWHA 3KK2A 3NTUA 1SL0A 4FBUA 2W8KA 1RT3A 2Z1GA 2P51A 4YR3A 4OKJA 2OPRA 2VA3A 1RZTA 3WNEA 4ID1A 3Q8KA 1VSJA 1WSHA 4FJHA 5J0WA 1RILA 2JZBA 4O3QA 1BPZA 3TARA 2HVIA 2BQRA 4DMNA 3P83D 2FBXA 4OPKA 7ICGA 3RB0A 1L3UA 3V6HA 3AO4A 1MSWD 3H4DA 5KGWA 4OLAA 5BOMA 9ICQA 4FZXC 5J0SA 4QZ9A 4P4PA 3OS2A 1COOA 1LWFA 5L1KA 3S9HA 3DLGA 1ZQLA 1ZQAA 2W9BA 3LDSA 2G8WA 1LW0A 4Z6DA 4L8RB 2RKIA 3M8RA 1A5WA 3HPHA 8ICIA 5J0QA 4I2QA 9ICLA 2E6MA 3LZJA 3T5JA 8ICCA 4I9LA 1JLBA 3ZDDA 4RZRA 4PHEA 4KI4A 5HLFA 5J0UA 2JZBB 4PUOA 4ZHRA 1BQNA 5KT4A 4W5QA 3IAYA 3M9OB 1X9MA 5DB6A 5CY4A 2OPPA 4IQWA 9ICOA 3VQBA 4CHQA 3BGRA 2G8VA 4ECQA 3LALA 2FLPA 5CJ7A 3C1ZA 3G6XA 2P6RA 4PHDA 3RJJA 1DLOA 2WTFA 4DTJA 4CESA 4DTPA 3SJJA 5C24A 5CP2A 4ZH4A 5J2EA 4DF4A 4O0JA 4KHYA 1VSLA 9ICEA 1CEZA 4ZTFA 4F93B 2NRWA 1ZQBA 3OYBA 4JV0A 1SV5A 4M45A 4KPYA 4KLQA 4NLGA 2ASDA 4IRDA 3DOLA 4PGXA 3O3HA 4J9QA 5KG0A 3ULDA 2VG6A 4NLZA 1RBSA 3L2VA 3ZT4A 2D5RA 5KFBA 3U3GA 2J6SA 4JV2A 4KLOA 5HMMA 3HM9A 3ISDA 2P6UA 2GUIA 1UAXA 2HB5A 1KSPA 1O1WA 3PUFA 2BHNA 1HQUA 4HUGA 5KFNA 5L1IA 1IO2A 1KFTA 4TQRA 4QWAA 3D0PA 3MEDA 3Q8PB 4O3NA 8ICQA 2OPQA 2PFPA 1RT4A 3F9KA 3HT3A 1HNVA 1S9GA 1RT2A 7ICUA 1FKPA 1X9WA 3MEGA 1VSKA 5J1EA 3NF7A 3TR8A 2W9MA 1S9EA 4TQSA 1KTQA 3OY9A 2A1SA 3DRSA 4AILC 3EWAA 3AA3A 3C6TA 7ICTA 5KFMA 2XCPA 1LAWA 3TAFA 1S6QA 1HPZA 4QZBA 2HNYA 5JUMA 1YVUA
chains in the Genus database with same CATH superfamily
2HNYB 3CP8A 2JL9A 2XIDA 3DOKA 2DKXA 2I8EA 2MSSA 5GAGU 5AZJA 2ZNYA 3OYFA 9ICRA 1B70B 4C80A 3SDEB 4C8MA 4ZJQA 4K0KJ 4TUPA 2GC8A 4QZEA 2GJ2A 2ZXIA 3P96A 4RL1A 5KFCA 4CD3A 1CJKA 1ZQVA 1S8OA 4ZP7A 2CJQA 3L8BA 2BR0A 1B99A 4QIVA 1QQNA 3IR7B 3UIQA 3P5TL 1FO4A 3ETOA 1X60A 2L41A 2DH7A 2EK1A 4OYIA 1RA6A 4DUZF 9ICJA 3W8PA 4R79A 3H8JA 2OFGX 1V38A 3AAWB 4K4WA 4OYPA 2YCHA 4UB6U 1F2HA 3ZD9A 1UP1A 4QZIA 2VWBA 2Q6CA 1RWPB 2Y1IA 2WHOA 3NCQA 2GELA 1BOTO 1JRPA 2WK4A 5I3QA 2X1AA 1MQ2A 3ENQA 3OW2R 5HROA 5DK5A 5HBMA 3PX0A 3QUTA 1KKXA 5EE3A 2D0CA 3WK6A 1NU4A 2KHQA 3G4SN 4ECSA 1XIQA 4WFZA 3LM2A 2RE1A 3R5DA 2CQCA 3PW7A 4FZMA 3PJWA 1Z25A 1YLXA 1BHLA 1FWPA 2KK0A 1P1TA 3A5NC 4WP3A 1EO1A 2QMWA 3EX7B 5GADU 1C0TB 4WF9Q 1WC5A 3H46O 2CJKA 3A8JA 4M7XA 4Z4HA 4FJNA 3I55S 2FHJD 3QFHA 5GAHI 3MMBA 3DXKA 3PRVA 3AUOA 4WFBQ 2F9TA 2YWEA 1OH5A 1Q8BA 1ZQTA 1JK9B 1VQ7S 4NMLA 3FEZA 2M3DA 5D4BA 2R8KA 4LR7A 2B3TB 4ED3A 3M1VB 4FK2A 1RBAA 4LSLA 2LPEA 2KKZA 1J5EK 3A0IX 4BRNA 1UJ5A 3KLFB 2W9BB 2ZIVA 1PBAA 3DFEA 2AZ1A 3L7UA 3TI0A 3MM9A 4ELVA 2DFHA 4HCBA 4RNOA 4OX7A 4I2IA 2HOEA 3EXYA 5DDYA 2BKEA 5AQZA 4PA1A 3GG4A 3H8SA 2OI2A 4LF6J 2IOFA 3VOVA 3AD9C 2L5YA 4ZLLA 3E9LA 2HHXA 2ATCB 1IM6A 3KK3A 2DHSA 2FJ6A 2BCRA 2QTDA 2LFVA 4IFYB 3R3LA 2HIQA 3CFRA 3KYLA 4KTWA 2P9PB 4N8NA 7ICIA 3NGZA 7ICPA 2EFPA 4DR3F 3RAMA 1E4GT 2BDPA 2ITMA 1CPZA 3BSNA 4XK8C 2VQEF 4UY8T 2HBZB 1SC4B 4KV8B 2ZH6A 5T7LA 2IRUA 4Y1CA 1WCLA 3MUMP 1Z2ZA 3TR5A 3M6WA 3AU6A 3QQCD 5CAAA 2E88A 1LFPA 5AM5A 1P8ZA 2MSNA 2I9SA 5J0OA 5AJ3K 3I87A 2P9KB 4R65A 4C0OC 1FEHA 3K5PA 1SJ3P 3RB6A 4L3NA 4I2AA 4A8SA 3L3UA 5E79U 2Y0SF 3EZ5A 1S1TA 3VVUA 5AIAA 1X3NA 2DGOA 3IWXA 2H51B 2KT2A 2F8LA 5D77A 3JXOA 5E33A 2CNNB 2ZH7A 2QI2A 4IQVA 4OZ5A 4DU1A 4LF5K 5DB7A 7FD1A 1T6CA 3R1XA 4J91A 4HTJA 4ZIVA 5K8NA 1NPKA 2E2NA 1RGVA 3J80Y 2ZUGA 2AJ1A 1U45A 5BR8F 1VQ9N 4IOBA 3H2LA 1JNZB 2F96A 3TO8A 3A0BU 1SXEA 5D3GA 5DZ7A 5A0YB 4DR4F 1U6BA 5EY4A 4EO6A 1XBWA 1ZBFA 3NXZA 2OGUA 4OYZA 3EJMA 1WKJA 1Q0NA 3UVJA 2RQ4A 2NUBA 4FJGA 3EL2A 5KAIU 1LFWA 4ZCMA 3UCGA 3O8WA 2FGCA 2YWFA 1VJQA 2MZRA 3I56S 4DUYK 2MLXA 3W1YC 5IWAF 4YB5A 5IS2A 5C2GA 2EZXA 5DMRA 1NK5A 3RVCA 2VJVA 4LIWA 4CGIA 4X65J 1M5PC 2RUSA 4A47A 5KFZA 2AGQA 4KX3A 1RDAA 5E84A 4CFDA 3LP2A 3BKFA 1ZQXA 3ZZUA 4PWDA 4YMMA 2MKJA 1KAZA 5TKWA 3K7RA 3HVRA 1MROB 1D8YA 2O8DB 5DB9A 1IBKJ 2B56A 2W2PP 3A8IA 2IIRA 4NZ7A 1C0MA 2GV9A 5AQWA 5AE3A 1KS2A 2IHNA 3HBTA 2VA8A 3NASA 4HTUA 3MMCA 2PO4A 1IBLK 2LM1A 8ICJA 3MX5A 1R0AA 3AV9A 4DWIA 1HRHA 1JLCB 1KONA 1V4SA 4V1Ak 2E1YA 3AAPA 5AQXA 1RWMB 3UE2A 3O9TA 4JI8J 4FF3A 1HNVB 3AB4B 2UUBK 2NO4A 4LH5A 2CJ9A 3BDPA 1Z00A 1QVGM 4TU8A 4JI4J 4GC6A 3Q8MA 3J8AA 2JHEA 4M6WB 3ZSQA 2R7VA 5ALXA 5BJRA 4RUAA 1M5SA 2CNLB 2P9IB 3I0SB 2A18A 4UB1A 1D9DA 4FF1A 2I7NA 4ZK7M 2XMTA 1ZXOA 4JKCA 2DNRA 1BO5O 4JYAJ 3VA0A 2KTQA 3WXMB 3CJBA 4RNMA 4LRBA 5KT7A 2AYEA 4JI0K 5A6WA 2MKIA 4I28A 1GX5A 2XHBA 4TKTA 3SFGA 4OMFG 5DG8A 3NUQA 3FCWA 2WFAA 4N5SA 4R0JA 3AVGA 3SEIA 2Z4PA 5C42A 3RB3A 1HQ2A 3OT9A 4LF7F 2Z1IA 1YRXA 2AJ0A 1R31A 4BRPA 1NXIA 1D9FA 2G8UA 2EANA 5I4MA 2BH1A 1HI0P 3MI7X 1NOYA 4LF5J 1PKUA 5E3AA 4L76A 1ATSA 3P8BB 3J7AP 4NLRA 1XHXA 4FJMA 2A6AA 4I67A 2H3FA 1U1RA 4FF4A 2E5LF 3NGIA 5ALTA 4OJOA 3CDWA 4DZ6A 1EETA 3M1VA 3CCJN 2B4UA 2VCPA 2LSNA 1WHWA 3T1HK 4P2XA 5CYMA 1VRTA 1S49A 3D1HA 1DGKN 1S6UA 3CD7A 3MOJB 3RJGA 3QGGA 5CYQB 5HI7A 3J7YP 1Q5YA 3S3OA 3M8QA 1RT7A 2B7BB 3CG7A 3AB2B 3NF8A 3ISZA 5KT6A 5HMXA 1XNQJ 3HWTA 5GAHP 4O5BA 1IJJA 3RYLA 3AVIA 4DV0J 2LQ9A 3KKRA 2V0NA 1ESVA 4MEXA 4ISGA 1HYSB 4H0YB 3W64A 2YMMA 2ZQBA 1SQEA 1QE1A 2RHKA 1YI2S 3TX0A 2XNRA 3N9UC 5FRNA 3PYGA 4UUWA 2K8AA 4FLTA 3EE8A 5IINA 3MAAA 4M9GA 3DLRA 4UW9A 1Y97A 5AICA 2M2BA 5M1KA 2UXCF 4NASA 1P1LA 1JXEA 4BC9A 3SUQA 1BUPA 1C1AA 2EEYA 2EWHA 4BX9C 1IKXA 5J2QA 5J2MA 5I42B 3HO1A 4JWNA 1KEJA 4CLSA 2FJWA 2QWNA 2OPQB 4DUTA 1DOQA 2H3IA 2IAJA 1VSMA 3NGYA 2ILZA 2Z0GA 4KB0A 1KW4A 2VUGA 5I3PA 4QPTA 4YG2A 3EGZA 4DFDA 3HCXA 2OPPB 4QZVB 1E3MA 4ETZA 4CJ4A 3HPOA 5IQ6A 2YXLA 4LFAF 3F5EA 3D45A 1G4CA 2EAMA 1IKYB 1JROA 1FK9A 2OYQA 4CEBA 3SUNA 4YR0A 1HJOA 1QAJA 4PJ0U 5CD4A 2E1MC 3J7AN 2P9CA 3BH7B 2EFQA 5HSPA 2UXBF 3AO5A 3AA8A 4WKRA 3IP4B 5AKZA 2CIMA 1MWQA 2LEAA 4MJKA 3VERA 1AT1B 3T79A 1EIYB 1G1XA 4RBVA 5CXTA 2DT9A 4MEYA 5AI4A 2NXNA 5E2QA 1WG4A 1LWEB 5KG6A 1JB0C 3OA9A 3O44A 5GMEA 2YTUA 1PZNA 2QWOA 4B9NA 4QOTA 3EGVA 4WTYA 5ALUA 1N2XA 3QEBZ 2B6AB 4PWUA 1J9AA 3O08A 4J9UE 4FM0A 2WB4A 4DV3F 4J9SA 3K5MA 2WOMB 2P9UA 4NXNK 3G82B 4FOEA 1UEKA 1T8EA 3BS9A 1VQMN 3HT0A 1VQNN 2XICA 1HR0J 8ICMA 3CJSA 1HW9A 3BF4A 4CBUA 5BRDA 1HWKA 2DVIA 1FDBA 1F9EB 1TKZB 1RFQA 5J2FA 1JLCA 5M1PA 5M1QA 3OYNA 5B08A 2A40A 2FPMA 4K43A 5JVGL 3BS5B 4J03A 2YNFA 1GOBA 4DXLA 3HFKA 3RJKA 1EJ7L 2KDOA 2K4EA 2K3KA 1J27A 3NNAA 3SBTA 5KGXA 1SC3B 4JHDB 3MPUB 4ZP8A 4DPXA 4CNYA 3AVFA 4PH5A 1IBKF 1K47A 2DGVA 3ZT3A 4CO2A 2ZH1A 3UXOA 1ZC6A 3UR3C 5IM0B 1NJWA 3PZPA 1EWQA 3AA2A 4L3QA 1RTZA 9ICAA 4EZ9A 1XMOF 5KG3A 1XO1A 1KHWA 2CUYA 2FPLA 4GC7A 1T03B 2A1AA 2JV3A 2MEWA 4J7CA 2J4RA 4Y1DA 4JB3A 3EVMA 2E1CA 2XWYA 2GGPA 2C2OB 3MM7B 4DR6K 1ZBLA 4ECWA 1U7LA 1GT8A 4J9RA 3QICA 4WIQA 1NUEA 4MIBA 4FFDA 1WJ9A 3V9ZA 3E0FA 1YJ9N 3DLKB 1BGXT 1ZQOA 1SQFA 1M1KT 2X74A 2Y8WA 1HIWA 3QJPA 3LPEA 1ACMB 1V5VA 3B82A 3GLJA 3C3LA 2DKOB 3QLHA 1FK9B 3G8TA 2MZQA 4CIEA 5F9LA 3L7OA 3I4HX 4CTAB 4NJ8A 3MCSA 3BQ2A 1H1VA 3G86A 2QSFA 4X66J 1NZAA 3I96A 2UUAF 1TYQA 3WKCA 4EX7A 3PX6A 2JMGA 1OS5A 4PL7A 4BR5A 3SPYA 2KJ8A 1ZAVA 2KKHA 2A10A 4TY9A 4P71A 4DBQA 3TEHB 2B21A 1LW2B 3D1OA 1X2IA 3RJEA 2FLNA 2W4CA 4GO7X 2VIXA 1D1UA 1X4AA 3CNQP 2AXTU 2RQ5A 5KFWA 4LIRA 2H5JB 1DT9A 4OPHA 4OHXA 4EUVA 2YWHA 2HQDA 1SKSA 4NL5A 2J8AA 3H7HB 1BI4A 1UQVA 3EWGA 1VQLS 2P1JA 2ZTDA 1VQLN 1WC4A 1RHKB 4H0VB 3R5JB 3Q7CA 1PYTA 5KFOA 5CYMB 3SQOP 4XDDA 4EBCA 2ZKTA 4URGA 4BXOB 3U3YA 2VA2A 8ICYA 3C2PA 2R2UA 4H0OA 3EKSA 4RTFD 2PSZA 3PIOL 3ZLJA 5TKYA 2XZTB 3PIPQ 3AD8C 3I5CA 4AXJA 3FSXA 4F3MA 4LT6A 4DR4J 1Z4OA 3R7SB 3DXMB 8ICLA 1N5XA 2IC3B 4ED5A 4LF6F 2GVDB 2XY7A 1EP4A 1TKTB 4M3ZA 3JS9A 2VG7B 2YMPA 2CAJA 4DCCA 3NCIA 2ALYB 2ASMA 1N48A 3NGSA 1M1GA 2YNGA 4CERA 1X5OA 5J2QB 3ZNUA 3ENWA 4MIAA 3OYCA 4KLHA 2XS7A 4M2YA 1I94F 2D3ZA 2YTCA 4RQMA 2FB0A 1Q4RA 4G1IA 4ANDA 5J2GA 8ICUA 1SH3A 1K8AT 4DV5K 3G8QA 5G0RB 2W1BA 3ILLA 3L4QA 2F44A 5D4OA 4IH5A 1Y64A 2YWKA 5IV4A 4KY3A 4IDHA 3VEZA 3H0MB 4FLZA 1XR5A 3B0YA 4AHUA 3F56A 3DHXA 3VZIA 4E7IA 2W04A 3RW7A 2KT5A 2BJEA 4A8EA 4OZLA 5F8LA 3IR5B 5EOYA 1QAIA 3ULEB 3PIPL 3VV2B 3DRPB 2ZH3A 2IDOA 1XUPO 2FMPA 3W0LA 3ID8A 4U7UK 1VYAA 5ETKA 3NF6A 5H9EK 3K5LA 2R8GA 1J2VA 3KNGA 2V4RA 1V85A 2MZJA 4BRCA 2XSFA 2EZZA 1EQ0A 9ICUA 1GNKA 1KAXA 2V8DA 2Z56B 6AT1B 4I29A 5CR0A 4TU9A 4CM2A 3R1HA 2MAXA 5EE0A 4QW9A 1C0UA 1SIJA 3W66A 4P72A 2LQ5A 4FYWB 1C6VA 1GMWD 4AQYF 4AQYJ 3EZUA 2C22A 3WEEA 3PW2A 4F36A 4RQ2A 5JTIA 3C5GA 1NDLA 2B6GA 4O5EA 1BCMA 3CIZA 1QAYA 3QIPB 3KK7A 5ALPA 3CWJA 1UW4A 1HHTP 2VBXA 2H3EB 3MWTA 1CJUA 2V52B 1JJ4A 1CZAN 3RJIA 4X2BA 2QA4N 4MFAA 3LVWA 5J2CA 4F72A 2KM8B 3RAXA 4NM2A 3Q8QB 1KQKA 9ICIA 3BREA 1JXLA 4KHQA 4EP5A 3IDHA 3A8EA 8ICZA 4P6QA 4FWQA 3PNCA 2HOFA 2Z58B 2KFYA 3H1VX 4YMOA 2XMJA 1WF0A 3LQVA 1AFIA 2FIUA 5ETOA 4JI6J 3I1YA 3IHQB 3KK1A 4RO0A 1S5JA 3V4MA 5LMUF 1U8SA 3L3VA 4CJTA 2NXCA 3NGKA 1NK8A 2M9NA 2KHCA 5HHHA 4L6V3 4K41A 3JYTA 2PIIA 5HRPA 2E3TA 2J7KA 4HT7A 2WB1F 5DQHA 1LK7A 2KIVA 4ECXA 1P90A 1GLBG 3QETA 4JBCA 1VQPS 4F50A 3CD0A 4WCEQ 1RDDA 4O3MA 4UOHA 3UKRB 4NCBA 3PTWA 3TTCA 3ZDBA 1AQ6A 5IC6B 1TAUA 3WDOA 2VQFF 2NYHA 4RW7B 7ICEA 1WTBA 3HILA 1ZD3A 4FYYB 1RTIA 1EKRA 2KG1A 4UB2A 1DZ5A 4H8KA 3TVYA 3QJLA 4LSZB 2VZ9A 4P52A 4BS2A 4QCLA 2DNGA 5FPDA 1UL3A 4RT3A 3OSPA 3ULEA 2E1PA 5HHIA 3V81B 3TADC 1PYOB 4EI2A 1S7HA 2MRLA 3DNCA 2X7IA 4CCHA 3N7SC 3RF9A 2K7KA 2P9LB 4ES3A 3C7NB 2HS0A 4I2EA 3DLKA 1WKLA 5CWRA 4UB8U 3IAS9 2NRVA 5AXMA 4OHYA 1I51B 3SSRA 4R64A 5IIOA 1S1UB 1QQMA 1RTHA 1P8GA 2RHFA 2AX1A 4BVPA 4M47A 2QRRA 3O2IA 2HNZA 2CPYA 4M9HA 1H73A 5JS2A 5ALDA 5BR9A 2GA7A 2BJDA 5CD4H 2N3LA 3FDSA 3S7RA 4RUHA 1XWLA 4ANEA 4ZLPA 1NGDA 3UCUP 1HFEL 4JYAF 2A6MA 4DR7F 1QTNB 4KAIA 5HBMB 1IR2A 3F5TA 3GR1A 2Z1HA 2YNGB 5J2KA 3N79A 3A2FA 4BE0A 1KLNA 5IV3A 3CC2S 3WXJA 8ICTA 3K5OA 1TFRA 3M8SA 2KYZA 1SAZA 1C20A 3OTOK 2I0XA 5JMNA 2MJNA 3HI9A 4OKKA 1RT4B 3NL0A 5GVQA 4LF7J 1KQQA 3DI6B 3GFHA 1RDCA 3C6UB 1ZRMA 3ZEUA 1OKJA 2CN1A 3PHTA 1NRKA 4EP4A 5D3GB 5AQRA 3WK8A 1TE2A 3BPSP 1VC0A 4I6WA 1IBMF 5DDQC 1IBMJ 2CH6A 1T3OA 2EFGA 5GTIU 4XTTA 3VAHA 1XI1A 4DSLA 1VQ7N 4F3QA 2R7RA 4NYPA 3AA5X 2WB1D 3Q8YA 5K8PA 2JC1A 1ZBHA 1S99A 4JMUA 3MM8A 5B5EU 4DU7A 2DXDA 2OD6A 2V94A 2R9LA 1XU4A 2R42A 3I8DA 3R27A 5THWA 1A5XA 4PKHA 3ZT0A 2HHVA 2JGUA 3BJYA 1T05A 1Y3JA 2RF2A 3JQJA 4DTRA 2AJ2A 4NV0A 3LGNA 5BRHA 4C23A 3MEGB 4PUOB 3HSGA 2BCQA 3OR1A 4DL7A 2QTWA 5KI6A 5D78A 4KPCA 3BZQA 1FKOB 4CF1A 4I2DA 2K2PA 4YQWA 2IVNA 4HUEA 3RSEA 3PFOA 3ETRA 2HMIA 2E2OA 5E26A 3K0JA 3IO1A 1N8RO 2ZFHA 5AQSA 2VV5A 3T5LA 1GLJO 4Y0WA 3H25A 3BN4A 3P5JA 3WK9A 4K8ZA 3H8YA 3M5RA 9ATCB 1I3AA 2W41A 4UY8O 3MEEB 3CO0P 2AYGA 4K42A 4KX5A 4WFNL 4U67Q 1FVQA 4HUFA 2M9KA 3LP0B 3NRBA 3POTA 4ZIWA 4DV2K 3QEIA 4NWBA 2L48A 4K4HA 3DM2B 3R8YA 4C4RA 3GE1A 4KGVB 2KVIA 1S12A 1X9SA 3M8WA 4K4SA 4U95A 1YK9A 2LDIA 4K4VA 1CJVB 2MSTA 5F0WA 4MFBA 2E66A 4FS1A 2VIHA 5C25B 1KD1O 3FBFA 4KHPF 1WC6A 4J90A 3MCOA 4OI0A 3ZNJ1 4ATNA 2IA0A 2VJ5A 2IDLA 3QMLA 1R6YA 2FHKA 4C7ZA 5IIMA 1E4FT 2D41A 3EM1A 1WSJA 1BUXA 5C2DA 4LQ3A 4QIGA 3BEXA 5J0XA 3HK2A 1XNRK 4DV7K 4KLMA 3MD1A 1HD1A 2E5JA 9ICXA 1BXNA 4ZTJA 2OXOA 2O8CA 1KQGB 1DAXA 4FZYA 1K9MT 2HYIB 1H74A 4YOEA 1ROFA 5J2MB 1CG2A 4CO5A 2EQYA 3NFAA 4DTNA 1U4BA 2KMDA 3TYTA 4X62F 1HBNA 3J81j 2QYCA 4GXJA 1GMWA 2UP1A 3MGHA 1RT1A 4I7FB 5DDRC 2HFNA 4KTQA 1FDAA 3DC2A 4QZFA 1WBDA 2G13A 5GAEU 4FL9A 2G09A 1XTZA 2F40A 1HNIA 3AU2A 4G9ZA 2HZCA 2BPCA 2YB4A 3Q22A 1BIZA 1PJ6A 3PW5A 2MDAA 2XY6A 3VQAA 5L9NA 1VGYA 4CJEA 3CO9A 3LOUA 5AQPA 4R5PA 2DWQA 2H3GX 2EAOA 3RMDA 4W4MA 2FVQA 3ZX3A 1RTDA 2DGXA 3AVCA 5L38A 1HEKA 1NKCA 1TL3B 1NGCA 4H03B 2QB0B 3DLHA 4JI4K 3TFSA 3WXKA 3EKUA 2M88A 3QRQA 2J5AA 3DWLA 1VIOA 4AHVA 5IT0A 3BO4A 5JLFA 1W2BM 3MMJA 3KLHB 3H5XA 3I82A 4DTMA 2ERRA 3DYAA 4DL3A 3CCRS 4UOFA 3QUBA 2DY9A 3QSYB 4EENA 3S6JA 3MXIA 2HOIA 4BDYA 3J7ZO 5EGYA 4B1VA 3W9IA 4CZIA 3NH0A 4E0DA 4KMUA 3ZT2A 3BYRA 4MMOA 1IKVA 1U25A 1X4EA 5A2QU 2L9DA 4AP9A 4RX6A 2EWSA 1DTTB 5HLFB 3CJ2A 3KXDA 3DHWC 3QGIA 1T6DA 2XMMA 2FYXA 3TW0A 4Z37A 1WF2A 4H4OA 1R27B 2CQ4A 1N60A 4CLPA 3CMEN 2RKIB 5GIOA 2QYGA 4DR1F 2HNDA 3OL9A 3C6TB 1OMSA 4FWPA 1S5ZA 4JS5A 1WOQA 3ULHA 3W2WA 1N62A 1Q5VA 1LB2B 1JLBB 3RR8A 1Y4ZB 3D0GE 2EG1A 4F91B 1FCAA 1S97A 4A46A 2I7PA 4G1PA 1TKXB 4ZVUB 5JRTA 2NS1B 1NGIA 1MNEA 2MTLA 4M5KA 1CULA 5HK4A 3M4XA 4UQTA 3HP6A 4C4WA 5KG5A 3HHLB 3DAWA 2ZH2A 2RDDA 2P9LA 4OGEA 1S1WA 1B7FA 2EKYA 3CJ4A 2IGIA 3OHAA 3H5SA 1TV6A 1X5PA 3KKAC 3SUOA 3P31A 1NDPA 1YHQN 2HGLA 5IQQA 4X62K 3LL3A 2OTJN 2GFFA 3PSPA 4DFMA 4C3LA 3CE8A 2ODGA 1VQYA 1RG6A 3HVTA 2E1AA 2GWJA 3I5AA 3AVNA 1VSFA 1S0OA 5DM7Q 3SCXA 1V4TA 4USMA 1RA7A 3EVWA 1RBUA 1ASWA 5AKLA 3FYHA 2FZCB 3LDQA 1FTCA 4DG1A 5DQGA 3OVAA 3OXGA 2LLZA 2R7YA 1Q7LB 3BSAA 2WC9A 4DV7F 4OYMA 2F2AB 1XNRF 2E5LJ 3IM1A 2Y8YA 4DV6J 2B8QA 2NSCA 5AJ3J 2Y9HA 5DM6L 4OLBA 1S4EA 2NRRA 3P39A 3BS5A 5GAEI 3CXCR 4TUSA 5T14A 2JVOA 4A8WA 7ICVA 2YKMB 3LYSA 5L1LA 4O5KA 1QQ7A 5D8HB 2Q36A 1BA0A 4NLNA 2FUG9 4GKKJ 1BQMB 4X4OA 8ICOA 1HYSA 2KB2A 3P38A 5HR7A 5BYQA 4C3KA 3CUNA 1EQYA 1L3KA 4W5OA 3QWUA 1MDUB 4ISEA 3V6DA 2AZ3A 1YXQA 1XMOJ 2KFNA 5AK4A 5HMYA 2XEXA 4I6MA 1BNPA 3TA0A 3NTUA 4H5NA 2HFSA 1WI8A 2PT0A 5BN9A 4KSEB 2W8KA 3TUJC 3AJDA 3HF5A 2Z1GA 4OKJA 2OPRA 3FBEA 1RZTA 3CC4N 2LCWA 3W8GA 3Q8KA 1CC8A 2RRAA 3NGUA 1TUVA 3O1LA 2VHGA 1UVIA 4FJHA 1WSHA 3T9ZA 1NLVA 2UUAJ 2JZBA 2HVIA 2BQRA 1VQ9S 1GFWB 4P2SA 4JP8A 2JZ5A 4Z94A 1N88A 3P83D 2KVSA 2FBXA 7ICGA 3V6HA 3FR0A 2OJ3A 1EETB 2RUGA 3CVKA 5LJWA 4TLQA 3M7VA 1VK3A 4GIBA 9ICQA 1R89A 4X62J 4P4PA 3HHEA 2Y3YA 2QA1A 1DGJA 2DR9A 2W9BA 1Y5LB 4K0KF 2FSNA 2UXBJ 2DNQA 2D3UA 2K7JA 3FE1A 3QU7A 1A5WA 4OJ1A 1FX2A 3F53A 3UKUB 2XVTA 3WQTA 1N52B 1FE0A 3F9MA 8ICCA 2UV8A 4IKAA 3QU4A 2D74B 2PKEA 2W11A 4ITSA 3R5GA 4ZHRA 2RB7A 1N4LA 5ALYA 4TXSA 1RQLA 2C2NA 5KT4A 5JICA 3GG1A 4G6VB 2XSJB 5ALFA 2B4OA 1S7IA 1X9MA 5L46A 4I6YA 4IQWA 3M8PB 4OHVA 4CIOA 4FPBA 2HFOA 3LALA 2OIHA 1RLDA 3BF1A 5B0GA 4N8OA 3PEJA 4DR7K 4P9SA 4JYAK 3C1ZA 4QR2A 1DLOA 3W65A 1QVGR 4DTPA 3UDVA 1GLDG 3MCMA 4ES2A 2Q0UA 3NS6A 3I8BA 5J2EA 1RHQB 3LVVA 2DRAA 1VSLA 3CJKA 4CF5A 2AF6A 4EO8A 3CQYA 3G71S 1IUJA 2QA4S 4CI6A 1RUSA 3H8MA 1CEZA 4ZTFA 4NA1A 2ZIUB 4OJGA 1VQPN 4ICLB 4FNHA 1N36F 2G1DA 2WVBA 4IQMA 5C2FA 5C10A 2C42A 4P73A 3O3HA 2ZM6J 2DKZA 3O1BA 2KXHA 4OYOA 1RBSA 1D8BA 1YJTA 3L2VA 1FKAF 2HQIA 3VGVA 1ZA2B 3EUB2 2J6SA 2DEJA 2LKZA 2ASYA 3ISDA 2GCFA 2LQ8A 1RDRA 3SLCA 2WB1C 2GUIA 4BBYA 2YKAA 1NB7A 1IG8A 3A3PB 1IN0A 1HQUA 5KFNA 2YPZA 5L1IA 5EXWA 3DJCA 1RYUA 4RNHA 4O3NA 3QATA 1ZS6A 2BW7A 2NPIA 1RT2A 1FKPA 2LEPA 4ZCLA 4H4OB 5J1EA 5A0LA 2YKNB 1B0PA 4TQSA 1KTQA 3OY9A 3VPZA 2GQCA 2ZJRL 3C6TA 2C3OA 2XCPA 3DGPA 4A8XA 3A5MC 3ZC4A 4QZBA 1WWUA 4LRFA 4E1JA 2DTUA 2ZTEA 1DY3A 3D68A 1OYEA 2GEMA 2P2CB 1X9JA 3RBDA 2OA8A 3DLGB 1U1KA 4F5RA 4BC5A 4P75A 1A76A 4HYKA 3SAHA 4DSEA 1KVBA 2BKOA 3JAMY 2F9DA 4KO0B 3V9UA 3MN6A 5EE9A 4WWSA 1S76D 2V4JB 1NBEB 4WFYA 2LKYA 3TAEA 2RHSB 5F41A 1XNRJ 2XS2A 3PV8A 9ICWA 3K1RB 3ENBA 5J0RA 1N0VC 7ICJA 3B8AX 2HVDA 2HI0A 4EIAA 5B0EA 5J2AA 3IWLA 4ZHRB 4Y2YA 2AX0A 2IC3A 3BZKA 2IVOA 2G2YA 1JALA 3ZETA 2FJEB 3PYEA 3NGTA 5IILA 3T69A 5AFUA 1NKEA 4CEEA 5KNIA 4MAKA 2HQ3A 4EFAC 2FHMA 1VFJA 3PO4A 4FJ7A 1S1WB 3M05A 5AQOA 4AHSA 2YQEA 5A8KB 3G71N 3VQ8A 4BXOA 2VOOA 2BRLA 1Q1KA 4CHPA 2V8PA 1HBOB 4FK0A 2CNOB 2WFBA 2P9EA 5LJ3Y 2YKQA 3C15B 4ECUA 2YY6A 3KKSA 3U1LA 3CDUA 3P4IA 4M6WA 4QYZK 1N36J 4QZAA 1NGHA 4IDKA 2VDHA 1I94J 4WK1A 2DRBA 2NRZA 3AY0A 1U04A 3LWMA 2K1RB 1IKWA 4USUA 1DK2A 3NKYA 4JI2J 2F4VJ 1OY9A 2HNZB 5FPNA 4I6MB 1BVSA 4KV8A 1DKGD 2ZC4A 1K73T 2AT1B 4QJFB 3D2NA 3NMRA 1XC3A 1RAAB 3PKMA 2E8MA 1T94A 1SB6A 1WKKA 2RIJA 4DN9A 4Z6CA 2RH3A 2JRZA 1GXLA 2YBVA 4CGGA 4RQ5A 1HI8A 3JB9k 1RAJA 2KFZA 4KLLA 2QLJB 1SCJB 2MPUA 4WP8A 3IKMA 3CFPA 4WPAA 1ZD2P 2YX7A 4F4KA 4C8ZA 4EHUA 4J2BA 3DLJA 3GQCA 1ZPVA 4ECYA 1HPMA 1SH2A 4RQ1A 2J7UA 4RW9A 1U49A 1X6IA 3H90A 3GJTB 2YB1A 1WNSA 3R97A 4V19X 2DCLA 2V8VA 5KFJA 4M1KA 1H2TZ 1RTIB 2FTRA 3U1MA 4PR6A 5IFMA 4LFCJ 4ZITA 2F3NA 5IOLA 4PWWA 3MF5A 2FVSA 2N1RA 3WKEA 2HFVA 3FVYA 2KJWA 4O44A 4ZJLA 3TSQA 4PXCA 3MPWA 3U9ZA 3MFHA 2I38A 4EBEA 5J29A 1JLAA 1MN9A 2Y1LB 4R66A 3L3CA 3OTOF 4WYWA 2B43A 4DB3A 2XGQA 4CJRA 1ZQNA 1C0UB 2FY8A 3QMQA 2Y1JA 2VPXB 3QT5A 2HMXA 2Q79A 4LJXA 5ALRA 4I2PA 1TVRA 1NCLA 3G4SS 1S0MA 2LA6A 3NAHA 3SMVA 5AZIB 1PG5B 4H5WA 3C2KA 1MMDA 3ZDCA 1FIQA 4Y28C 2G06A 2ZC3A 3KK3B 5B0DA 4E7LA 1MMNA 4JK1A 4WIIA 3J7A1 3MEEA 2IAJB 1LK5A 4O3OA 3TUZC 8ICEA 1IWGA 3E9OA 3DLEB 2KKPA 3CJ5A 2IBOA 5AE1A 5JLHA 3BV8A 2QXLA 2C2MB 4AL5A 3MM6A 5ALKA 2DHXA 2M4MA 1X0FA 2O8BB 2ADCA 3CCLS 1H6KX 2BCVA 5E3CA 5BREA 2GHPA 2RT3A 5F3XB 1BPDA 2ZH8A 2Q0ZX 2ZJPL 2D8CA 5F8MA 1T3QA 1MA9B 2AP6A 3I31A 2AQ0A 4DV4F 4QS7A 2MKCA 4PKDB 4CK1A 1PJ7A 1VRUA 4X4TA 3VGKA 4KQZA 1L6NA 1U2RA 2GJFA 1GH8A 2ZVIA 3KLEA 3VQPA 5KL8B 4YXJA 4FLXA 4PHAA 3V2UC 2VG5A 2F8KA 2DRDA 5CHCB 2ZJAA 3H59A 5AM4A 4DV2J 4NLXA 4CF4A 3K9JA 3TX8A 4AHTA 2XI9A 3KKFA 1SKUB 1ZQWA 1ZAXA 5C0YA 4GW6A 3GJRB 3VAJA 1GO3F 1PK1B 1F5CA 1UVMA 4K4ZA 4E1NA 1F0MA 1FRIA 5LMUK 2OPRB 2KYXA 2B4VA 4DF8A 1FWKA 5ITHA 4G9BA 1CQMA 1YAGA 3NVMA 2I2YA 4RW9B 1XMOK 3ASMA 2XB2D 4YHHJ 2CQ0A 4FN5A 2L08A 2M8HA 2CQ2A 1Q46A 1JLFB 1QTMA 4TN2A 1K6YA 3PR5B 4AM7A 2XNQA 3IMXA 2HLTA 2WBRA 2A41A 4PRFA 5EWFA 4N47A 4F0HA 4KKOA 2R18A 5M2UA 3C15A 4ID5A 3K4GA 4YORA 1VQKS 1SZPA 2K4HA 2WMMA 3MDAA 4M5IA 4EX6A 3SMSA 4CBXA 4QWBA 3NS1A 1PUZA 3MURP 5CZ2A 4F02A 1OH6A 5ETMA 4FYVB 4HEA9 4A5BA 5CA7A 5J2IA 4CF8A 4FZNA 3LGHA 1YGYA 2FF6A 4DR5J 1RWOB 4YOUA 1W9HA 2G07A 1S6PB 4NXNF 1RKIA 4YOTA 2XYPB 3CSKA 1S3XA 1JLEA 3JXUA 3W7BA 2E20A 2OEMA 5K5MA 1Q7YT 5J2NB 3HSJA 2LDYA 4RUCA 4ZDNA 3V9WA 1RT1B 3AGRA 2QKBA 1S1XB 1P9QC 4MKVA 3C65A 2PY5A 1V5IB 1CXUA 2E5GA 3CD5A 4G3IA 3IA0A 4DL6A 4Y2MA 1U1LA 3CCVS 2CQBA 1IKYA 4ZVGA 5EX5A 2UXBK 1IIPA 1IKWB 3Q8SB 3NAEA 3ZXWA 3QLHB 2BPGA 3DRXA 3GILA 1JMTA 3FSYA 4O55A 3K2PA 4FXWA 1WAJA 3V6JA 3POTB 5DG7A 1TQLA 4LFAK 4KMOB 4H0XB 1HUOA 1HWJA 3AFGA 1A7GE 4DCOB 3VTIA 2GHWA 4JV5J 4DTOA 1QD1A 1NOZA 2R7TA 4P0QA 5FDLB 4JD2B 1JNRB 3OLAA 1U2CA 4RCHA 5C25A 2NCKL 2VL1A 2KLAA 1XEZA 4DSKA 3QO9B 1M5KC 3GIIA 3C29A 4GVLA 1NAQA 3MR5A 1NGBA 3OW2M 2GO9A 2KG0A 3RAQA 3OYEA 1CLQA 1MU2B 5LSLA 4B9UA 3TJ9A 2GTDA 3KFWX 6FDRA 3C1YA 4LRCA 5HP1A 1ZQRA 2MLYA 3O80A 1HBUB 1W2BR 1FFSB 2F65A 2BYCA 1Z6RA 4RG8A 4CZFA 1VHXA 1HA1A 2XMKA 2IM3A 3HP9A 1UWAA 2FVCA 3OR2A 3OYKA 3O4WA 4PG4A 4JNEA 2EI5A 4I2FA 3W5XA 2DEIA 2DPJA 5D0RA 4CGDA 4HTIA 2G2OA 4DOZA 4MF2A 2KO1A 4FLVA 3OL8A 2Z2YB 2BEFA 3LTOA 4DL2A 1VC6A 3X1LB 2NZ4A 2ACYA 3FMBA 3QFPA 4H5VA 1CZ9A 1FNXH 4EU0A 1KVIA 2DGWA 1TUUA 2LEBA 1FXXA 5GINA 4JI6K 3DXSX 3IP0A 3VALA 2BZFA 1VBXA 1AB8A 2ZUBA 2HDOA 1ZQCA 4BC7A 1RU1A 2KXNB 4DQSA 3TJ8A 4YP3A 2GJIA 2DXEA 4DOCA 2EBEA 2WVFA 5KPZA 2E9ZA 3VQ9A 1F6TA 1EAYC 4W5TA 4FP9A 2JH7A 3ONNA 2OH2A 2ZBCA 3QBWA 1QE1B 4CJ7A 2LHTA 1UFWA 2NXEA 3KLHA 4WFAL 1WSVA 4NLSA 4FVMA 2PMZC 3RW6A 4FJ8A 1UEUA 4CFCA 3NWGA 5HATA 2E1RA 2DGSA 2RQCA 4JS4A 1IH7A 4J9MA 2DJWA 3M2RA 3RGIA 4BE1A 4BQLA 3FFKB 3BO3A 5EWGA 2BANB 4PL2A 4ZJOA 2JWNA 3FUYA 2P9IA 2MYFA 4NLTA 2ZOMA 1HX1A 1LKYB 3B8HA 4R5PB 3B9JA 2HCFA 1JN3A 1SV4A 1TV9A 3KD3A 1RYRA 1O03A 3CJ9A 1OQ6A 5F8JA 3H6EA 4USJC 4YUDA 3SI8A 1BWVA 4YXMA 3LWLA 3N6MA 4DR6F 2BMBA 2CNKB 3GPAA 4JKFA 1KHVA 1ZBSA 1KBRA 2MQOA 3QE9Y 2V6AA 2H5XA 3Q23A 2Y0BB 1X4DA 3ATVA 2MKYA 1VDVA 1B9FA 4CJFA 2VODA 1VQ6N 3AOCA 3JPNA 3M9MB 4RU2A 2IMOA 3CNHA 2FLLA 4YY3F 4WF9L 4GV6A 3O4NA 4WJ3B 3KDNA 4M41A 5BRFA 3GDXA 1NJZA 4KLGA 3ZD8A 4PPXA 1NZPA 5C7PA 4CF2A 2DHAA 3VQEA 2D1KA 1KN5A 1Q8IA 3V9SA 1SV0A 3WK5A 2F9WA 3HHDA 1N54B 4Q5VA 4JKDA 3VQ7A 4BC2A 2K8BB 1YTYA 3C6AA 4UARA 1U6ZA 1AZSA 3KHYA 3VC8A 3ADAC 2XLJA 1HUZA 5J0TA 1OVQA 4MF8A 1J53A 2ZJ5A 4DU4A 4O9MA 3AH6A 3KTQA 4DUYF 2QT7A 1EP4B 1TKTA 7ICOA 3TZWA 3CDAA 3F2CA 2XULA 1Q95G 2CQIA 2BE9B 4B1ZA 2FBYA 3EE3A 4B3OB 5H1SQ 2QM1A 2WSEC 1W7WA 1A5VA 4DTXA 2LMRA 4KH5A 3ET6A 3CC7N 3PACA 1QCKA 5BR8K 3CERA 4DUYJ 4PHTX 3H2UB 4PL8A 3CRXA 2YMQA 1UVKA 2XM3A 3AVKA 4R63A 3EE9A 5IIJA 2IYIA 3IM9A 5L8RC 1X1PA 1UFKA 2OTJS 3OXLA 3IBPA 2QW9A 2F8SA 5DGBA 1RISA 4NY8A 4CHOA 4BUGA 3SFUA 2ATQA 8ICBA 2KHVA 2VDIA 4MLHA 5ALMA 2G5HB 1MU2A 1RHRB 2W42A 4JLHA 3SPZA 4TVAB 2PEHA 2KQ2A 1NJXA 1XNSA 3D7EO 3J7YI 2W6LA 1Q81T 3W5YA 3P4UB 1S72S 4ZVQB 2V7YA 3VCBA 2FJXA 4GVEA 5HP4A 1NGFA 1XQIA 3TNVA 5AFUH 2IM1A 3LGMA 3AO2A 1Q86O 3VAKA 3RB4A 5HRSA 5HQMA 2UVUA 2E8AA 8ICGA 2U1AA 2MQNA 3TZXA 2L3MA 4Y00A 2VBWA 3O5TB 3JPTA 7ICFA 4PQUB 1Z3EB 2YPYA 3HSZA 4F9OA 1XHZA 2ZZTA 4M94A 2UUCF 3U7JA 1TAQA 2Q2RA 4DSFA 3MGJA 4AHCA 2UXCK 2CJXB 1EXQA 2D1CA 2ZIWA 3ELHA 1S1VB 2ATLA 2CXYA 4F2RA 2GMJA 2R7XA 3WEEB 4CJUA 2ZITA 3CJTA 3OV7A 5ADXH 3GCWP 4KHNA 3SQGA 2LMIA 5M1NA 3E3XA 3W2VA 1RWKB 4QAGA 5KG1A 4X4SA 2RLTA 1B9DA 4CJ5A 3N28A 2BGGA 4L3KA 1LNQA 2J8SA 3OYDA 3CIMA 5LM7E 4XH4A 2A5XA 1BI4B 1RE1B 4NXZA 3THYA 4IUFA 2QL5B 1NB2A 4RQ0A 4X64J 5C15A 1S0VA 3UVJB 4C0HA 1JI7A 2VWJA 2P5OA 3O4QA 3T1HF 1KKHA 3THXB 2O66A 1X5TA 2LXFA 1UCVA 1O8BA 3U8XA 3V7LA 1X9XA 4EYIB 2VQEJ 4NLPA 5CYQA 3ZSVA 3MM8B 2E5LK 4UB5A 4CFBA 3UE5A 1NJIT 3VAFA 3TFRA 3VGSA 3C14A 4OYXA 1K8KA 1SWVA 4AE5A 3OHBA 2DNNA 1RBLA 3PIOQ 4C11A 2R2TA 5KRTA 1SUQB 4CD1A 2WF8A 4KHPJ 3C46A 1VBZA 2QXFA 4AHRA 5KFHA 4BJQA 2DNZA 1RTJA 4CI0B 3HZ6A 1ZJMA 4LF7K 4J9VA 4M0AA 2VASA 3AT1B 1SKWA 3RH4A 1HL6A 2D9PA 3FKBA 1HKAA 4RQ6A 4IS7A 2RRNA 4FSVA 3KHRA 3CTRA 1NSPA 3MOZA 2FPHX 4B1XB 3QEPA 3MX2A 3SCLE 3AVBA 1Z4NA 3IG1A 1VQ4S 1DTQA 4X4UA 4LY7A 1CZBA 3HX0A 3V7JA 4NXNJ 3HDSA 2ZZMA 4LH4A 3DV9A 1FF2A 1K44A 1OPIA 3PO5A 2EHGA 2VU5A 3HJEA 5KFXA 4DUZK 3CCMN 2POKA 4QNLA 2KH9A 3DM2A 1KR4A 3BY5A 2K89A 3BP8A 1J6ZA 4B3MJ 1ZQZA 1OIAA 4YD1A 4XDCA 3BQ0A 2H3VA 5FPMA 3ZSOA 3MXJA 1NSQA 2CA9A 3J81U 2VG5B 3JSBA 1AZSB 2CYYA 2PAVA 3CJ3A 2ZZNA 1QUVA 2JEJA 2CDQA 1JQGA 1SWWA 3FC4A 1P9YA 4AT1B 3G9CA 2QX0A 5HVGA 3V7KA 5E0OA 2C3UA 4A8MP 3PDNA 4ED4A 3AHPA 5DGAA 2VBZA 1H2VZ 1DEJA 2FLOA 4NYFA 2OZMA 2IVPA 5CB1A 2P9GA 3KWIA 4UATA 1B4SA 3MUTP 2DY4A 1X3MA 1SZ2A 2ZH4A 3RUBL 2W03A 2V2VA 5D0EA 4DI6A 4ZOSA 2WF6A 3VGLA 1T9WA 3PJXA 2DR6A 4JI2F 2DO4A 1YHQS 1LXJA 1H38A 1YBUA 4TU7A 1HYZA 4LF8F 4F4AA 2K06A 3FM9A 3PYDA 5L9XA 3L9ZA 9RUBA 5ETVA 2JXJA 3OJUA 3O8MA 2LVWA 3QGHA 2GO7A 2Y9UA 3BGRB 5CQGA 1UPMB 4IL6U 4J9NA 1N33K 3OPXA 5KFTA 9ICSA 3RBZA 1RXVA 1LV5A 3HVWA 1Q79A 4F4ZA 3AXKA 4DHYA 1REGX 2BX6A 4JUZA 2XY8A 3PM9A 3KLFA 3GIJA 3C14B 4K4TA 5AQFA 3G0ZA 3ZZRA 1K9MO 4DR4K 3F5AA 4M5LA 2NYVA 4KLTA 1RQ0A 3GYXB 1X7VA 1BHNA 1D0EA 2GMHA 4CJSA 4MDAA 3S8SA 4PG8A 4MQ3A 3SEOA 3CDBA 2NREA 2BZ2A 1DXSA 4RJVA 1VRTB 4KREA 4LF5F 4BRGA 4U7UD 1U8WA 4RQ3A 3CJRA 3ZSZA 4BDPA 1FRMA 1ZPWX 2BUNA 4M8LA 1Y5IB 1MW7A 4Z0UA 2KSOA 4CECA 2X3GA 1NJYA 3HX9A 1UA1A 4BRLA 2XBPA 5JVHQ 4BVOA 1QAXA 1T9XA 2HRYA 3HOTA 3GFKB 2KU7A 4FS2A 2WW8A 4HVZA 2JLEA 2JEGA 3FZMA 1UZDA 4BG9A 2J0XA 4GRSA 1TGOA 2DNPA 1F0XA 2A19A 2I5JA 1WDTA 3IAM9 1JJ2M 3R7NB 3RMCA 1U9LA 4M5MA 2EH9A 2ISOA 3HKZC 4Q44A 1RB0A 3R8EA 3RWUA 5KFRA 4J9PA 4P7VA 4CEQA 2E7VA 4FWKA 4DOAA 3U1NA 4B3RK 2G0JA 2ZIXB 2UV8G 5ALZA 3AVJA 2NR0A 2FJAB 3M8YA 1KC8T 4QIWC 3ZDEA 1FFVA 3CMQA 1F5AA 3Q7BA 3OFGA 2ROPA 3LH2S 4FF2A 3CCEN 4FO6A 2FJDB 1YJUA 1KOOA 1DK3A 2NXJA 3RR7A 3OVNA 4CK3A 4X4VA 2RRBA 1VIXA 3D28A 4FNIA 2BKNA 4LSNA 1RAOA 2E2QA 3TUPA 2DXFA 4Z6EA 3D67A 1LKZA 1SL1A 1L3SA 1CJVA 5K14A 2O6KA 4CIGA 2LXIA 3QU2A 1JJCB 4LRAA 1SQKA 5ALIA 1B64A 4LJMA 3CPEA 3HVAA 2IMWP 1C1CA 1NM1A 3O3FA 3W5ZA 1Y9OA 4JI5K 2K8GA 1G99A 3B6PA 3THVA 4NRTA 4O4GA 1J5EF 3MPDA 1CS4A 1L5UA 3VAGA 1Y88A 2PI4A 2ZEJA 4ICAA 1YIJS 2MZSA 1NDCA 1T03A 4OO1J 4RNFA 3NS7B 2HK3A 3H3NO 1LWFB 4NLKA 2GVZA 1AYEA 4J2DA 3CW2C 5I9EB 5EWEA 2CVIA 3AAQA 1RGIA 4Q0BB 3VTHA 4DR7J 4M3UA 4DU8A 1QQ6A 3JYTB 4A8FA 1C0TA 1JKHB 4O8KA 5IIKA 5DO2A 2ZH9A 5CHGA 3D66A 4PWDB 4PZOA 5IT9Y 1A6SA 4XRHA 1SGGA 3RRHA 3TADA 3IFRA 4YOWA 3L6QA 2ZNZA 1IM4A 5KTQA 3VQTA 5DKWA 1P27B 1G7CB 4YD2A 5HNKA 1HMVA 2P5VA 2XYHB 4P2FA 1ZQDA 3THXA 4IO1A 3QERA 4TSXA 3OTOJ 4NPOA 4KFBA 3CF5Q 1SXDA 1PJ5A 3SQ1A 4ELUA 1RACB 1V6HA 1VRQC 2HHQA 3SI6A 2O1PA 4ECRA 5EHHA 4ZPWR 4BRKA 1KD1T 3G8SA 4F92B 2P66A 1NO8A 2JNJA 3IMQJ 4DS4A 1PK3A 1W7AA 4F3TA 3DKDA 4UW2A 4USAA 5HRRA 4LVNP 5CZVA 2VFVA 4DPTA 3QEVA 2W24A 1HYVA 3PY8A 4WFAQ 1WHVA 3OBYA 1XMQK 5HAOA 4DV3J 4W98A 4DU3A 1R7IA 3KHHA 2X51A 4M3YA 4NCGB 4KB7A 3FZBA 3MM6B 3NH2A 4X64K 3OUYA 4PYDA 4RQ8A 3DOMB 1L8LA 1RHJB 3KG1A 2PMHA 3UQ0A 1FXRA 4X66K 2FVPA 4XPCA 3WC0A 1JIHA 3WU2U 3J81Y 2GNKA 2CXEA 1VISA 1YVNA 4FYDA 4QBUA 2RQMA 2DBYA 2KRRA 3T5HA 3ALRA 3BKUA 4NA2A 4LF9J 3VGMA 4NLBA 1HWIA 4FJXA 4YDUA 1GLFO 2GQ2A 4FZLA 3NCPA 2CPIA 4US8A 3LAMA 3C19A 1N56A 2Z30B 4RW4B 3D5MA 3LPUA 2O8FA 3PEHA 4QQBA 4ILHA 2YX4A 3HKZD 4UASA 3CJ1A 5KFKA 4H54A 1T3NA 1B43A 4QR1A 5IZHA 2WVDA 5AKKA 1N61A 4WP9A 3MGVA 3CJCA 3PX4A 2MQLA 3SK3A 5LT5A 2VB6A 1J2MA 3KK2B 4Y2UA 5A8WA 2RPIA 3OYAA 1LW2A 8ICKA 4Y2CA 4HHTA 1TL4A 4JI1K 2QK9A 4Y2XA 2VF3A 1FJGF 3N0VA 5KQDA 2CPJA 3I28A 1ZTWA 4DV6K 2R8HA 3DRYA 1M90T 4KITB 4DTSA 3C0BA 4DV1F 3KLIB 2JGAA 3MR3A 3TAPA 3JS6A 1S10A 2M70A 1ZQJA 2XC9A 3JPSA 2YJEA 2WSFC 4PGYA 2J0QD 3MABA 2DFEA 2JWKA 3KZBA 5ALJA 1I3OB 3SSSA 4FPRA 2D3O1 4Z7CA 1FFUA 3N97B 3TRGA 1VQMS 2FXUA 2D0AA 3VVTA 1YSJA 3ZZPA 2V2KA 4DV1J 4AYBD 2P9SB 4OD0A 3BBBA 4US9A 3JTOA 4F5OA 2HHHK 9ICNA 3TANA 2YKOA 3L09A 4BWJA 3J7YU 3BN7A 1PVRA 2QWMA 2LYBA 1N6QA 3AN1A 3F73A 3TWZA 1UA0A 2AW0A 2YQ1A 3W9HA 2QMXA 1JWWA 4V19S 3CXCM 2PFOA 2HAFA 1TK5A 3DGPB 1BCOA 1Q53A 1NMDA 2YHBA 3R9PA 4Y6IA 1RT5A 2GOLA 3WC2A 2KL8A 1WC1A 4AH9A 3VESA 5J0YA 2EFOA 5IXUA 4ED2A 3ICLA 3Q86A 2KIWA 4PPZA 3WIVA 4UBBA 4CGZA 5BYRA 3MMAA 4NLDA 1X6JA 4R0EA 4KLSA 3V81A 5L1JA 3MBYA 1NI3A 4QWDA 2OPSB 5FIIA 4KH4A 2W54A 1A0OB 1BPXA 4DSJA 2IDEA 5LMNK 4B3OA 1IXKA 2UUWA 4OZ2A 4PCQA 4IOCQ 2QWPA 4PHPA 3OD2A 1NSKL 2B0GA 2BQ3A 4Q7AA 4TURA 2CPZA 2XMAA 1JLQB 4B3SK 4KYZA 1NNDA 4IG0A 1VSHA 4FWSA 3QUQA 3MR6A 2DGQA 1OY6A 2R4FA 1FEZA 1R59O 1SL0A 1GTHA 5AK3A 1HUXA 4FVCA 4WTOB 3FK4A 1RT3A 2KVCA 1S72N 4YEAA 1RWVB 5HOOA 2VA3A 2YVSA 1GMUA 3MHYA 3A0HU 2QLFB 3WNEA 4ID1A 3GWCA 1JJ2R 2LYAA 1N5QA 3QT7A 2VONA 2YX6A 1I1GA 1BPZA 4E2FB 2IY5B 3IDWA 5LMNF 4K50A 2Q66A 4DR1J 6FD1A 4DMNA 2FI1A 2PMZF 2E1EA 4KR0B 2MHNA 3H4DA 2QO3A 5BOMA 4FZXC 3P6YC 1NG9A 5J0SA 2RHQB 1VLBA 4BHQA 2PFUA 3OS2A 3AQFA 1COOA 1LWFA 3S9HA 4OI6A 5ALNA 1ZQLA 4NLCA 1N5SA 1LW0A 4M7YA 4Z6DA 1C4CA 2HBJA 1S6OA 4F04B 4OFZA 1KBUA 2XHCA 3HPHA 3GU0A 2VH7A 4LFBF 2WBMA 2E6MA 2KM8C 3D1QA 2VC1A 2B7CB 3ZDDA 4RZRA 4PHEA 4DR3J 1VAZA 3MM7A 4DCPB 5HLFA 5J0UA 1IQTA 3O6WA 4OZ3A 1M5VC 4PUOA 1N34K 5GTHU 4JAXA 1Q86T 1K8AO 5GAGP 2A2DA 2HHHF 4W5QA 2WF5A 5SUHA 4HTLA 2JLFA 1RI7A 9ICOA 1FEEA 3MMBB 3THPA 4BRHA 2FLPA 4OX9F 2OMOA 4IH6A 3WBZA 4Y0FA 3G6XA 3F2DA 2WTFA 4DTJA 4CESA 4NLUA 3CD6N 3HHKA 2AP1A 3MK6A 3CJQA 4LSLB 4DF4A 2D3OR 2Q31A 4O0JA 4F7VA 4KHYA 9ICEA 4EHTA 1QZ5A 1H98A 2E7WA 3MPVA 3CDEA 2VYPA 2NRWA 3OYBA 4ER8A 3WUHA 1OPZA 1ELOA 4M45A 1JLAB 4KPYA 4FOIA 1VLYA 2DISA 2LU1A 3H0PA 1X66A 1WG1A 5DDOC 1ZBTA 1FJGK 3EEQA 3NBPB 3LUYA 1COKA 4NLZA 1VQKN 2XZDB 1WOSA 1IJFB 3ZT4A 2H4YB 4OI3A 1F5SA 1UW9A 3U3GA 5J2PB 2RU3A 3HM9A 1L7PA 1N33F 4C8YA 4TYBA 1GK8A 1UAXA 3M8QB 1KSPA 4GKJK 2DNYA 3GZFA 1X4BA 3VEYA 2V4JA 1HNXF 1MROA 1B4FA 4IQXA 1KFTA 4QWAA 2DR8A 3D0PA 4ZPCA 3W2VB 5J8YC 2PFPA 1RT4A 2UUCJ 3MEGA 1WI6A 5HO4A 2QARB 2C2KB 1PGZA 2ZWHA 1X8DA 3BZCA 3ILJA 3THWB 4DX7A 3G82A 1EX8A 5KFMA 2BABA 3TAFA 1HPZA 2DNKA 3LM9A 2HNYA 3HSDA 3L3FX 2GIQA 1PBUA 5JUMA 3TSUA 2R2SA 2F9JA 1REVA 3ZZ0A 2IJFA 3ZX2A 5A8RA 4EAHD 3U26A 4IDKB 5M2PA 3PR4A 3UXNA 5FP0A 2GIRA 3J7Z5 2HG4A 1FDNA 1FT8A 2MKKA 1MQ3A 3UXPA 4ZPBA 2R8IA 3CULA 1PO6A 2DNOA 1WSFA 1BY9A 3KJQB 4RW6A 5J2DA 3DEEA 5KRSA 2CADA 3P49B 4OLOA 4FWMA 4YDUC 4JHDA 2KN4A 4LMZA 1XR7A 2LYHA 3BR9A 3TJAA 3PMNA 1XMQJ 3S01A 1RTJB 3CCSS 3OL7A 5LSOA 2L9NA 3N4PA 4X84A 2U2FA 4CO4A 4M5DB 2BM1A 3SZ2A 4EBDA 1PILA 1WSRA 1VSIA 2A1JB 4FJLA 4LUBA 2JH3A 1RKJA 4D3GA 5DLGA 1SXLA 4CRXA 1IKVB 5ALQA 1HWUA 5MAOA 1Q9YA 4CNQA 1CRXA 2M5YA 2HGNA 2ZM6F 1CVJA 2EAPA 1YJNS 3MXMA 1HI1A 1ZQIA 2ZDOA 2CZ9A 1YJRA 1YJ7A 2HHTA 1GXTA 2EC2A 5LMUJ 1Z1VA 3OFHA 8ICVA 2FC0A 1YDLA 3R5BA 2I6XA 2ZJRQ 2MGZA 1QS4A 2E5HA 1WSGA 1XERA 2XLIA 1ATRA 2BE2A 5SZTA 1JLQA 5D15A 4FDFA 3GDQA 3PHEA 1FRXA 4NX9A 5J2PA 4Z4CA 4JI1J 1RCXB 2HBLA 1TL1B 1OH7A 3F2KA 3KNAA 8ATCB 1C1BA 1FD8A 5DB8A 4RQ7A 3P1GA 3SENA 4ZP6A 2C2RA 1TVAA 1T0TV 3MMVA 4M3WA 3K59A 4LF4J 4B8CA 2QLBB 4OJRA 3GTYX 1L7NA 5KG2A 2N3OA 2YV0X 2HEKA 3ZSRA 2EFVA 4I2GA 3BB5A 3CHWA 1U48A 3DRSB 5IC4B 2BW2A 4DV0K 4IG0B 4YHHK 3L95X 2QARA 4M63A 4KBOA 2G9OA 2CPDA 3VEOA 2L9WA 4C3MA 3RJFA 2B4PA 1YJVA 4I2PB 3MMCB 3TABA 3OGUA 4F2SA 3SV3A 3V9XA 5AI5A 1LWXA 4DR2K 4JI8F 3QESA 1FA0A 4IG3B 2C2EA 4PG7A 1GAOA 2MZTA 2UUCK 4RW8B 1D09B 3M6XA 4P0PB 4B3RF 5HQ8A 4UAVA 4LBHA 5AI0A 4FKXA 3MR2A 1SUQA 3HYFA 1FNMA 4O8UA 2AWZA 2IHR1 2HNDB 2O8EA 2O8BA 5EN1A 4OGCA 1SJ1A 4HHHA 3AA9A 3NVKA 3T1HJ 2HS3A 4QYZJ 1EB0A 3QO9A 4P10A 3CCES 4GMJB 1PAUB 3TAQA 5F9NA 3KOAA 3F2BA 4M5DA 3IG1B 1BQNB 1U47A 3K8WA 1BNOA 3QNOA 4BE2A 2QV6A 2C1EB 3CEDA 3CT9A 4PYAA 2DFFA 4O4GB 3HFVA 2X3DA 5KAFU 3M7DA 4RWTA 4Z6FA 3C5FA 2BJ9A 7ICLA 4ILRA 4ZLJA 5A2QO 2ZD1B 2AEFA 3GBTA 1VHIA 4DPOA 2AU0A 1TL7B 1ZQUA 4H4KC 4CP5A 1R0BG 1B7YB 9ICHA 1MC8A 5EOZA 5AXNA 2P35A 1WB9A 3RBEA 2QSWA 5KFDA 3VF6A 4Z4FA 3OYGA 3ZO7A 2HFZA 1IQZA