3PX4A

Crystal structure of bacillus dna polymerase i large fragment bound to dna and ddctp-da mismatch (wobble) in ajar conformation
Total Genus 191
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
191
sequence length
579
structure length
549
Chain Sequence
KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural evidence for the rare tautomer hypothesis of spontaneous mutagenesis.
pubmed doi rcsb
source organism Geobacillus kaustophilus
molecule tags Transferase/dna
molecule keywords DNA polymerase I
total genus 191
structure length 549
sequence length 579
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2010-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3px4A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 3px4A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3px4A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3px4A01
3TFRA 4JRPA 4E1MA 3GIJA 4RQ3A 4E1NA 3ZSWA 5HRSA 4R66A 4K4HA 4F4XA 3M8PA 3AV9A 3E01A 3V4IA 4HYKA 3TR8A 4TQRA 1U4BA 1S97A 4YR3A 3EPIA 3VQBA 5FROA 4GMJB 5J2EA 7ICOA 2E4LA 3RBEA 5KT2A 3LDSA 5KFAA 1MQ3A 3CFOA 4BDYA 2PXIA 1A5WA 4CFBA 3T5JA 3HP9A 4DU1A 3UPQA 3MGHA 2HNYA 2QKKA 4Z0UA 2BQRA 1FXXA 1RPLA 4I2QA 1NK5A 2AQ0A 4DFKA 2A1SA 3AVIA 1NK4A 2P6UA 2E6LA 4CEFA 2ITGA 3KD5E 5EWEA 4PHAA 3RMDA 1O1WA 4KLSA 4G3IA 4WE1A 4PWDA 3DRPA 5D49A 4B9UA 4P2HA 1TAQA 4W5NA 2KZ3A 1RYRA 3MXMA 7ICQA 4KHSA 5L1IA 4DTPA 4KLDA 5KFZA 2C2DA 1JLBA 4I2AA 4O55A 3PNCA 4CJKA 2NRXA 3H8WA 3Q8MA 2BKEA 3KTQA 1VSHA 9ICTA 4Q5VA 4KAZA 3JPNA 2JGUA 3P83D 4E0DA 1HJPA 3LP3A 1VSEA 5K14A 3LDAA 3JSMA 4ICLA 3AVHA 4DS5A 1SL0A 2ASDA 3G6VA 2DY4A 1JXEA 4B8AB 2YKNA 9ICQA 4Q44A 1HYVA 2FPMA 5J2GA 2D5RA 5E41A 4I28A 9ICOA 5DG9A 4CECA 4RQ2A 3ZDEA 4NLNA 2PFPA 5KFXA 1EKEA 3RJIA 7ICTA 1JMSA 3H4DA 5DBBA 1S9FA 4HHTA 4YFKA 3K57A 4EZ9A 1S6QA 4HTUA 4KLLA 5L1LA 3H8JA 1HMVA 4RT2A 4CERA 2BCQA 8ICFA 1J5OA 1IG9A 1ZBUA 3HL8A 3V6KA 4FLXA 1ZBLA 1C7YA 3VQQA 8ICPA 4ED6A 2ALZA 5JS1A 5J0PA 3WNEA 2KQ2A 2Y1IA 4PPXA 4FS2A 5DK5A 4I2FA 4OPJA 1VSMA 4KN7A 3ZT2A 1TK0A 1HQUA 3DI6A 4MF8A 3UIQA 2J6TA 1CEZA 4BXOA 2M9NA 1RILA 1A77A 1RBSA 7ICSA 1HNIA 4BWJA 2UVVA 3UQ2A 3RRHA 2OPRA 3HVTA 4ECZA 1TKZA 1IH7A 3MEDA 2YHBA 4RPXA 4EYIB 4RPYA 1RDDA 4NYNA 1RTJA 1BPBA 2FBYA 3CM5A 4J9SA 4FVMA 1UT5A 4E7HA 5KFOA 3S9HA 3T19A 3GV5B 2P1JA 2A1RA 1NK8A 3S3OA 5J0WA 2V9WA 1EXQA 4CGHA 2JEJA 4EP4A 1BPDA 4O5EA 2HVHA 3ZT0A 2IMWP 1LAWA 4O3SA 2F96A 4QCLA 1SKRA 2YHAA 3RB4A 2VWJA 1ZQQA 4MFFA 4MEXA 2PFOA 3TAGA 3RJFA 4QW8A 2B21A 3TAPA 3L2WA 4KLQA 3K4GA 2R8KA 5DMRA 4KHWA 1ZJMA 1ZQTA 4CJTA 1NK9A 3LWLA 4DTXA 4ECRA 1YTUA 2GBZA 4DTSA 8ICAA 1ZQPA 3HPGA 4DFMA 3MR2A 3K59A 3ZDDA 1DTTA 3KK2A 5KT6A 5DLGA 2KW4A 4I2IA 7ICJA 1TV6A 5J1EA 8ICHA 2XC9A 4IFVA 5CZ1A 4I2EA 3V81A 1X1PA 3M9OB 1BCOA 1T7PA 1X9MA 1WLJA 1LW2A 4PGYA 2IA6A 5KI6A 1RTDA 4F2RA 3JPSA 1B43A 4KHQA 4XQ8A 5KGWA 1WSGA 5KFWA 3VQ8A 3B0XA 4YD1A 4P4PA 2BCVA 4O3RA 4O0IA 1LWFA 4Z4IA 5J2JA 5I3UA 2BPFA 9ICAA 3TFSA 9ICRA 4CJRA 4M6WA 4EBEA 3MABA 5F9LA 3RB6A 3RJJA 5KG1A 4AHUA 4Y1DA 9ICVA 3LPUA 2ATLA 2X6NA 5J2AA 3HXMA 4DTOA 3NAEA 4B8CA 2X6SA 4TUQA 3AO4A 3OJUA 2YNHA 3ZCMA 5KFVA 2BGGA 3RJGA 3SJJA 4JS4A 3U3GA 9ICLA 3PY8A 2BPCA 4RQ7A 1BCMA 5KG7A 4GC6A 1BPEA 4GVMA 1WN7A 4DL3A 3OY9A 4N76A 3GILA 1NJZA 4KTZA 3HO1A 1SUQA 5HMLA 4FJ7A 4KMUA 3V72A 4RUAA 3V1OA 3HVRA 4F5PA 5J0OA 2AGPA 1N48A 4M04A 3HYFA 4UB2A 3PW5A 3VQ5A 3KLIA 3C21A 4C8LA 3ZD8A 3L3VA 2Y1JA 3SUQA 1SKSA 4CJVA 4AILC 3M8QA 4FLVA 3T1AA 4UQGA 4Q8EA 2HMIA 4J2EA 3Q8LA 3EPGA 8ICGA 3RH4A 4CJWA 5HBMA 3NH1A 4YN4A 4M2YA 3JPOA 5CYQA 1XWLA 3MDAA 3RAQA 2BPGA 3SI6A 1XHXA 4QZBA 4XUSA 3OYKA 1V9PA 2FMSA 3QLHA 2IGIA 4CGFA 3JPQA 4YD2A 4AHCA 3WNHA 9ICHA 4BACA 3OHBA 4I9LA 4E19A 4KLIA 4LSNA 4HUFA 3QEIA 2OZSA 4FK2A 4O3PA 8ICOA 5CA7A 3RB0A 3DLKA 1TFRA 2R8JA 1MU2A 1WSEA 5CWRA 5HRNA 3ZSQA 4QOZB 3PX4A 3LAMA 1C1AA 3ORYA 1S0VA 2XHBA 4NY8A 3PW2A 3OYAA 3NF7A 2W9BB 9ICIA 1TVAA 4C8OA 1Q9YA 1L3SA 4H4OA 4O0JA 4FLYA 4J2BA 3SUPA 5J2HA 1TV9A 5KG3A 4F4WA 4FJNA 1JIHA 1QTMA 2FMPA 7ICPA 2LYHA 4YXMA 3LPTA 3OYCA 5EWGA 4C8KA 4CFDA 5J2MA 1Q8IA 3GIIA 4NYFA 5JUMA 4K4IA 8ICMA 4ECYA 3SPZA 2AQ4A 4M9NA 5J0XA 4F8RA 5DBCA 4QWDA 4ECTA 3NCIA 5KFPA 2FBVA 3AVFA 3AO1A 1HYSA 5DB6A 7ICEA 2JLEA 3DLHA 3RJEA 4LSLA 4RW7A 3HM9A 7ICMA 4C8MA 4RU9A 1RTHA 4FJMA 7ICVA 2ZTCA 4YQWA 1JL1A 3PW7A 1LB2B 3MAQA 5KFJA 5DGBA 8ICCA 2OWOA 3T5LA 3RAXA 2YKMA 3U6FA 4ELVA 4UBBA 4Z4CA 3PX6A 1BI4A 2IAJA 2YNGA 5SWMA 3D0PA 3IG1A 4I2GA 4K8XA 1RZTA 4IG0A 3KHHA 3MECA 3ZSXA 3AO2A 4CJ5A 4DSJA 4FLWA 5KFYA 1VK0A 1WSIA 2UVUA 3SV3A 1XO1A 1Y88A 4YMNA 3OJSA 1ZQCA 3LP0A 5HP4A 7ICLA 1RT2A 3VQPA 4O3QA 2JZBB 4OKKA 3S3MA 9ICNA 2V4QA 3C94A 4AHSA 4BWMA 4W5RA 1RBRA 1TK8A 1B9DA 1VSKA 1ZQUA 3AA2A 3SI8A 3RBDA 4J9QA 3K2PA 3ETLA 5J0RA 4BE0A 1T05A 1C6VA 4FJHA 3DLRA 4DSLA 1WCNA 5KFCA 3OS1A 3E2EA 4B9NA 4CEZA 2YV0X 4YXJA 4N47A 2G8IA 3LALA 3UXNA 3QEBZ 4IR1A 3UQ0A 3NGZA 3QEAZ 3KLEA 3IAYA 4OKEA 4CK1A 4F5NA 4Z6EA 1QE1A 4M3WA 5KFEA 4ED2A 3ZSYA 4CJLA 1I3AA 1ZQLA 2BQUA 3M8SA 4RQ8A 3VN5A 1D8LA 5D3GA 2NUBA 4ED1A 4E7LA 3MEEA 1ZQZA 4DQIA 1JLQA 3ZSVA 3T3FA 3RH6A 1Z25A 4IFYA 3AA4A 4NCBA 5D4BA 2GV9A 2OPSA 2XY8A 4TUPA 4CIGA 1A5VA 2XY5A 4M3XA 3TARA 1RDBA 1XC9A 2VA8A 2VANA 2PYJA 5DB9A 2ZTEA 2DPIA 2RF2A 7ICRA 4G1QA 4KHYA 4CEQA 3V9WA 2IDOA 4B3OA 1S1XA 4O5KA 5KFRA 4QWAA 3OYDA 3TWHA 3GV8B 4O4GA 3IHQB 4ELTA 4M9JA 4PGXA 2W9AA 4P4OA 2KFNA 1UAXA 4FM2A 1VSIA 1G15A 4YVZA 1HNVA 2ZE2A 5CY4A 5C24A 4GW6A 4FBTA 2FLPA 2MUTB 1U04A 3MXJA 3M8RA 4RPZA 5DB8A 5J2CA 3ALYA 4FO6A 2OA8A 4HUEA 2W9CA 5KG0A 1ASUA 4DG1A 3PV8A 1BQMA 1JLGA 3B0YA 4NLKA 4OGCA 1ZQXA 2OPPA 4RW9A 1ZQBA 3MXIA 3V7JA 5KFMA 1BPYA 1Q9XA 4PHEA 1KVBA 3AA5X 4FJ8A 1XSPA 2ETJA 4IDKA 2OYQA 2Z1GA 3LANA 3G6XA 5J0UA 4DL5A 5KFHA 1TKXA 2VWKA 1RXWA 5DG7A 3UXOA 3Q8QB 3BQ0A 7ICIA 1IKVA 4B9MA 4YR0A 3AVCA 4CHZA 4EYHB 3L8BA 4W5TA 4IRDA 1KCFA 4B9LA 4M9LA 1F21A 4KI4A 4MEYA 2F1HA 4DQPA 2Z1HA 3AU6A 5EWFA 2BGWA 3SPYA 2FC0A 2G8VA 3ZDAA 3K5LA 4K4GA 5J2DA 2ASLA 2B6AA 2OPQA 1BISA 1TGOA 4Y1CA 2F1IA 1ZQVA 2BR0A 3VQ7A 1AROP 1S1UA 1D9FA 3SYZA 2PFNA 8ICIA 4R8UA 5KFSA 4JV0A 3VQ4A 3N97B 3JYTA 1JLFA 2J6SA 4QWEA 3KHRA 1YTAA 1ZQNA 3P1GA 3L2VA 3NGDA 1JXLA 4MF2A 9ICBA 4E7IA 4M3RA 3TABA 4IQVA 1ZJNA 2DFEA 4O9MA 4R5PA 1TL1A 4KREA 1REVA 4UAWA 2R8IA 3LP1A 1RT4A 4F5QA 3CYMA 5KG4A 3KK3A 1NKBA 3C2MA 1U9LA 4DSEA 4KLEA 5KTQA 4LD0A 4KV8A 5I42A 2C2EA 1KSPA 1C0MA 1KFDA 1BPXA 5CR0A 3OYEA 4AHVA 4DLGA 1DOQA 2FMQA 2FBXA 3TAMA 5FRNA 3SUOA 4HVJA 2GUIA 3Q8PB 1CXQA 3ZT1A 4RUCA 4BE2A 2A1JA 3PW0A 2MUTA 1NKEA 3RH5A 4FJ9A 3V1RA 4FLZA 2RKIA 3EYZA 1C0UA 4UAYA 1TAUA 4Z4FA 4J9RA 9ICWA 3LZJA 5J0YA 4UB5A 5KFUA 2JZBA 4DQSA 3LZIA 3H7IA 3PO5A 5J2KA 4UB4A 5KG5A 4F92B 4IQUA 3KHLA 1XHZA 3C1YA 4KLMA 4KB0A 7ICUA 3ZDBA 4ZTJA 4Q0BA 2I1QA 5KT7A 3V7LA 4IQTA 2G8FA 3G6YA 4CGGA 4DO9A 1RTIA 3C2LA 4ZH4A 2DFFA 3AA3A 5KFTA 3OYHA 2DFHA 2HVIA 1IKYA 1U49A 4MFBA 3NHGA 2W8LA 1S1WA 2XGQA 1S0MA 2E6MA 4KHUA 3QEWA 3BDPA 1Z26A 5EOZA 1QQCA 4FJIA 4NLGA 3HX0A 3GIKA 3OVNA 3QERA 3C6UA 4R8UB 2RN2A 3L2QA 5HP1A 3AVMA 4PHPA 4I29A 4CHYA 3THVA 1I39A 2VG5A 4CHNA 1LWCA 3ZT3A 2C22A 5IIKA 4ECQA 4QWBA 3O3HA 4M45A 4OVLA 2NRVA 4Z4HA 2JEIA 3QINA 3QESA 4M3TA 3G0ZA 5DQIA 5KFBA 3HPOA 1PZNA 3EW9A 4LVSA 4CK2A 1X9SA 3TQ1A 1KVAA 2RDJA 3SZ2A 4CJ4A 2QXFA 3PUFA 2HHUA 5KG6A 1ZQRA 3KLFA 5DDMA 2IC3A 1ASWA 3KJVA 3RR8A 1QS4A 3OSPA 9ICUA 3H08A 2LSNA 4J2AA 4DTMA 4O3OA 3G10A 1RT3A 1RT7A 4UB3A 2AU0A 8ICKA 2HNDA 3DLBA 2WONA 4DSFA 4YCXA 1KVCA 1NOZA 1T3NA 2PI4A 3JPPA 3C5GA 1RBVA 9ICMA 5KRSA 1NJXA 4LZGA 4O44A 1D8YA 4CJUA 1JXBA 1JLEA 8ICYA 4PY5A 1YVUA 3QIPA 2FLLA 4RT3A 1FKOA 3HPHA 3EY1A 4RG8A 3BQTA 7ICNA 4ED0A 3ISCA 4PUOA 5KFDA 1W9HA 1XSNA 2ZUBA 5CYMA 1UA1A 3NDKA 1C0TA 2BQ3A 2YNIA 3KKSA 1HUOA 2BCUA 4PGQA 4F4ZA 1A76A 1HRHA 3S3NA 3SQ1A 4ZHRA 5EU7A 4DTUA 2G8HA 1U47A 4R64A 3NF6A 4TQSA 3MR3A 2GWSA 3Q8KA 1JL2A 9ICEA 5BPCA 4UBCA 3T5KA 3FYHA 4OKJA 8ICQA 3NFAA 3VQAA 3KHGA 4M9GA 1BVSA 4X5VA 4XA5A 3RTVA 2HHSA 2DTUA 5KFLA 1GOCA 9ICXA 3IM1A 4DL2A 3VQ6A 5HNKA 5KT5A 4JWMA 1S0OA 1D5AA 5F9NA 1DTQA 3GDXA 1VRTA 3AVKA 3OS0A 3H4BA 3PR4A 4MQ3A 3CFRA 4O5CA 5BOMA 5DQHA 4CJPA 4ED8A 3DRRA 4CJSA 4DS4A 4DMNA 4DU3A 1QSLA 4RNMA 4EBCA 1T8EA 4N56A 2ATQA 3OYBA 4CF8A 4RQ0A 8ICEA 1RDAA 4I2PA 1RBTA 1NKCA 4DTNA 4I7FA 1BPZA 4QZFA 4ELUA 2AGQA 1NOMA 8ICWA 1H38A 4JV1A 1SL1A 1YT3A 4DL6A 2IBKA 1RCHA 2QK9A 2D0BA 2JEGA 3KLGA 3KLHA 3H40A 3C95A 4DOBA 4EEYA 3VQEA 5FRMA 9ICKA 2I9GA 1X2IA 4PQUA 2ZJ5A 1WSJA 5HMMA 1VSLA 1S9GA 4QZIA 3NBPA 3K5NA 3MR5A 3RJHA 8ICJA 2NRWA 5DB7A 2PI5A 1ZQEA 2P66A 4QZ9A 2F1JA 4DL7A 2DPJA 2F8TA 4BE1A 3TAQA 4FJXA 1MC8A 4DQQA 3VA0A 3PX0A 2VA3A 4FCYA 1IKWA 3MR6A 3KIOA 1BI4B 3RMAA 4J9KA 5DG8A 4I27A 4ED7A 3QETA 4Q43A 4GXJA 1ZQJA 3OYLA 7ICHA 4RW8A 3GIMA 4I2CA 3OYGA 4KB1A 3MFHA 4E7JA 4IRKA 1WNSA 2HHXA 3N4MB 2Q3SA 5KFIA 3SQ0A 4CF2A 4J2DA 3C5FA 3LAKA 2BHNA 4DL4A 2XGPA 4CGJA 3ISBA 2HHTA 1WAFA 4HCCA 3MDCA 4GXKA 1FK9A 4KLHA 2IS3A 5DQGA 4ECXA 1ZQSA 2ZJ8A 1CLQA 3CM6A 1LV5A 3O4QA 4FM0A 3QO9A 2G8UA 3DLEA 4QZCA 4TURA 2KTQA 2X78A 3QEVA 3BJYA 4XIUA 1EX4A 4W5QA 4RQ5A 3QZ7A 3AO3A 5T7BA 4KFBA 3B6OA 2HHVA 2VA2A 8ICSA 4KTQA 1XS9D 4CGDA 2BCSA 1VSJA 4N41A 5CB1A 1GOAA 2I5JA 5L1KA 4CE9A 3EZ5A 5DDYA 3OYNA 1T4GA 3HW8A 4RW6A 3C1ZA 4M9HA 1HPZA 2RPIA 4O3NA 2HNZA 3MBYA 3VA3A 4KLUA 5KRTA 3BQ1A 1KTQA 2G8WA 5HHHA 5KFNA 4LZDA 1Y97A 2P6RA 5KFFA 2FLNA 2JEFA 3HP6A 4IG3A 5J2QA 4DF8A 4JV2A 1LAVA 1ZQFA 4F5RA 1J54A 4DSIA 1A5XA 2C2RA 3TI0A 4EBDA 4JWNA 3V9ZA 1IKXA 1JLAA 2AJQA 4P4MA 1B92A 1NK6A 1KDHA 2D0CA 5KG2A 3V7KA 9ICJA 2PZSA 2PYLA 2XCAA 4H4MA 4AH9A 3BQ2A 1QSYA 4QZAA 1FKPA 3MFIA 1ZQKA 1UA0A 2J6UA 1JN3A 4OLBA 1ZYQA 3KD1E 1NK7A 2AGOA 3DMJA 9ICSA 1NK0A 4Z6FA 3C23A 1NJYA 4CJQA 1ZQAA 2IHNA 2O4GA 1XU4A 4CIEA 7ICFA 4FW2A 4RQ4A 4DF4A 1KFSA 2C28A 4FK4A 2BDPA 4OGEA 4QZHA 4DWIA 1L3VA 4JLHA 2YNFA 4J9LA 3ZDCA 3NE6A 1UOCA 4CFCA 1U45A 3ISNC 4PH5A 5J2BA 4CEBA 2VG7A 4GC7A 4DOAA 4CHOA 4CF0A 1SZPA 2BANA 5HRPA 1IXRA 1QLNA 1WSFA 5CZ2A 4GXIA 1EXNA 1IO2A 4KKOA 3ULDA 4QZGA 4RNOA 4CESA 4DFJA 2ASJA 3AO5A 3V9UA 3GFKB 4DTJA 5KT4A 1X9WA 3OGUA 2ZQBA 5J0SA 3RB3A 4LH4A 1N5YA 2KZZA 4L8RB 4DTRA 4FLTA 2UVRA 3V6DA 4DOCA 1IM4A 4J9MA 1JLCA 1J9AA 3TAFA 3SUNA 3PO4A 9ICCA 2Q0ZX 3BGRA 3K5MA 3OYMA 1ZQWA 4BXOB 1RNHA 4NCGA 4KLOA 1ZQDA 1B22A 2EX3A 1BHLA 2O4IA 1S5JA 1UWBA 4Z6CA 4F5OA 1S1VA 5C25A 1CXUA 2XY7A 2P5OA 5DGAA 3O4NA 5HLFA 2HB5A 3ZD9A 4FZXC 2OZMA 3LWMA 4F93B 1Z00B 1ZQHA 8ICTA 3QIOA 2P5GA 3QZ8A 3ISDA 4RNNA 4UAZA 3QNOA 1TK5A 4FM1A 4DQRA 4M42A 4CGIA 3TANA 4PA1A 1HUZA 3OHAA 2X74A 3DOLA 3RMBA 4FZZA 4R65A 8ICZA 4E89A 8ICVA 4LY7A 4Z6DA 4F3OA 1RDCA 1LWEA 4CFAA 4J9PA 3H8SA 3NGYA 1Z3EB 1T03A 1KRPA 4KITB 4FJ5A 4ID5A 1B9FA 1KLNA 3NTUA 5J2NA 3HT3A 5TZVA 4XRHA 4CEDA 1N56A 4KLGA 3HJFA 1CZ9A 4K8ZA 1XSLA 2XO7A 3Q8RB 2KFZA 3AVLA 9ICPA 1WSHA 3OYJA 8ICBA 7ICGA 2R8GA 1Z00A 5J2IA 1TKDA 4CEEA 2WTFA 1ZQOA 4R63A 3AVJA 1C1BA 4CHQA 5D46A 2ISOA 1WCLA 1HYZA 9ICGA 4QW9A 4N5SA 4CHPA 4F4KA 3FFIA 4QWCA 4DSKA 4E3SA 1K1QA 5CP2A 1L5UA 1ITGA 5HRRA 4J9NA 4KPYA 4F3TA 3L3UA 1EP4A 5CHGA 2ISPA 4H8KA 3SNNA 2P51A 3TAEA 3K5OA 3QNNA 3DYAA 4M41A 1K6YA 5BOLA 2W9BA 4Q45A 1BIZA 2NRTA 5KFGA 4QAGA 3V6JA 4RZRA 2A1JB 4M6WB 3GV7B 4FS1A 1K1SA 4I9QA 3V9XA 2HW3A 3CG7A 2PY5A 3A2FA 4ECWA 5KT3A 8ICLA 3P5JA 4DLEA 4E7KA 4DEZA 4TUSA 2EHGA 4B9VA 3HWTA 4CEAA 1RYSA 3K75D 4O5BA 4YMMA 5DKWA 3RRGA 4FJGA 3AU2A 3V6HA 5L9XA 5KFKA 2WOMA 1HJRA 4FXDA 2ZUCA 2UVWA 3MEGA 3WNGA 4LH5A 2Z1IA 2ZD1A 4JUZA 3AUOA 3RR7A 4FK0A 3D45A 3ASMA 1MQ2A 4KI6A 5IIJA 4IKFA 5FDLA 1ASVA 4FLUA 1BIUA 4KN4A 3LP2A 3NF8A 3QEPA 3OYFA 3NF9A 3CQ8A 1D9DA 1SKWA 4AHTA 4I2DA 5KGXA 1VSFA 1L3TA 1NOYA 1LW0A 4RQ1A 3HK2A 3F73A 1QHTA 4IQWA 1ZBHA 2DFLA 3NGIA 4HUGA 4IR9A 1RXVA 4IBNA 4YG2A 3SV4A 3V9SA 3DRSA 4CEOA 1COOA 4KO0A 4CJEA 3RMCA 4AHRA 4CJFA 4FJLA 3VQDA 1JX4A 5J2FA 2B5JA 2ZJAA 4M3ZA 4YP3A 2PFQA 2IOCA 4OLAA 5C5JA 3VQCA 3V1QA 1NJWA 1RBUA 8ICUA 4KTWA 4EP5A 1BL3A 4CCHA 4NM1A 5IIIA 3PW4A 1SV5A 4I2JA 8ICXA 1XI1A 4Q8FA 4YMOA 3AVBA 1ZBIA 4JS5A 3OS2A 2W9MA 4NXZA 2D0AA 1ZQYA 4B9TA 1S10A 2BE2A 3PMNA 4QZEA 4J9OA 3UXPA 3OSNA 3DOKA 2Z1JA 1BGXT 2G8KA 3K58A 4FZYA 4NM2A 4QZDA 3ITHA 1TVRA 4QZ8A 4IRCA 4GLXA 4W5OA 4MFAA 3NH0A 3QE9Y 1S1TA 3L2RA 2ZUDA 1HQEA 5J29A 3SQ4A 4JK1A 3RJKA 4YNQA 3U3YA 3O3FA 1TKTA 1C1CA 2XCPA 3C6TA 4TSXA 4B9SA 3SCXA 4DFPA 8ICNA 1KEJA 4I2BA 4BDZA 4M3YA 4Z4EA 2ZTDA 3JPTA 4ECSA 3I8DA 3F9KA 5IIMA 4BGDA 4F2SA 3B6PA 2XY6A 5DLFA 4JRQA 4KRFA 4OJRA 1DGSA 5DBAA 3T5HA 1CZBA 3QEXA 1U48A 5J0TA 1ZETA 1VSDA 3I0SA 4UB1A 2HHQA 3KKRA 2XRIA 2F8SA 1ZQIA 3VQ9A 4F50A 2NRZA 4FJKA 3CFPA 1S76D 3SQ2A 3M9MB 4M3UA 3WNFA 9ICFA 1DLOA 3JPRA 1GOBA 1W0HA 4YFUA 4HCBA 2KN7A 4CK3A 3DM2A 1KFTA 1R0AA 3I0RA 4M47A 1VRUA 3NH2A 8ICRA 1ZQGA 3IRXA 4MFCA 4M0AA 4FBUA 1S0NA 4B08A 3HSTB 2FPLA 2W8KA 2MAXA 5L1JA 2W9CB 4KLJA 2B4JA 1SL2A 2V4RA 4PHDA 3ZT4A 3FDSA 1ZQMA 1WAJA 5SZTA 2FBTA 1KLMA 4FJJA 3KK1A 1N6QA 3C2KA 5HROA 1L3UA 3ZSZA 3Q8SB 4DU4A 7ICKA 3AVNA 4Z4GA 5HHIA 4EZ6A 4ZTFA 4CF1A 2KZMA 4RW4A 5IINA 4KLTA 4NLZA 4ID1A 3LK9A 4FYDA 4YR2A 3PR5B 3MGIA 5KFQA 5J2PA 2RDIA 2BCRA 3O3GA 3AVAA 1ZBFA 3GQCA 4RQ6A 4F4YA 1EETA 1S6PA 5J0QA 2FPKA 2R7YA 1MSWD 4CJ3A 2IHMA 1CUKA 2HHWA 3ZSRA 3L2UA 2R8HA 4C8NA 3M9NB 1S77D 1RT6A 3DLGA 3OYIA 1UT8A 3IS9A 5CJ7A 4KLFA 3PVXA 3AVGA 4CIFA 4FW1A 4ED3A 1J53A 2VG6A 4I2HA 4F91B 1QSSA 1JKHA 5C42A 2W42A 1BQNA 4BDPA 4ECVA 1S9EA 5JS2A 4OPKA 4KHNA 3EWAA 3ZSOA 5IILA 1RT5A 2H5XA 3RWUA 1RT1A 1TL3A 5IIOA 3PMLA 2QKBA 4CF9A 4ECUA 4NCAA
chains in the Genus database with same CATH superfamily
2YKOA 4EK2A 3EE3A 4RQ3A 4YB7A 1FFSB 5HRSA 1IV8A 5DM7Q 5MLCQ 3CDBA 2UXCF 2J8SA 1JLBB 2FHKA 4ILJA 1U4BA 1S97A 3VQBA 2QC3A 2AJ0A 4ZPTR 7ICOA 4BDYA 4CFBA 4ZVRB 3VF4A 5C15A 3THPA 2HNYA 4F26A 2QKKA 2AZ3A 1U1NA 1FE4A 4KH0B 3VAKA 4C23A 3KK7A 4U7CA 2O8BA 4NLBA 1X4HA 4UASA 5EWEA 4AUKA 4PHAA 1VI7A 2CGJA 4JI6K 3NVWA 4KLSA 5DM6Q 2CQ0A 1PO6A 1F2HA 1DAXA 3TKAA 4PWDA 5F8LA 5D49A 1JJ2R 4ZVOB 4P2HA 4G65A 4LF5J 1TAQA 4W5NA 2KZ3A 4KHSA 2N82B 1CS4B 4DTPA 3WU2U 3KLFB 5ETQA 1JLBA 4CYUB 2CQGA 4O55A 3TAMB 2NRXA 5U47A 2N3OA 1N4LA 1RTDB 2BKEA 4L3NA 4OLOA 2OTJN 1K8KB 3R5GA 3J80O 2OPQB 2XM3A 1X31C 5EE9A 3AJ2A 3CC2S 5ALSA 3GU0A 3LP3A 1F1BB 1U7LA 5K14A 4CP5A 4ICLA 3AVHA 2A6MA 4BRDA 1SL0A 2ASDA 2PSZA 2I38A 3QAUA 3B82A 4RUHA 5HMWA 2R7TA 2E1CA 2UUCF 2DCUB 4NXNF 4Q44A 3UFCX 1S1TB 3R2CJ 3DN9A 1VBYA 5E41A 3K8WA 4L72B 3OR1B 2QFIA 1U1KA 4IYQA 4LUBA 2UUAJ 4NLNA 4ILHA 2PFFB 3JTOA 3H4DA 2JL9A 3AD8C 4H5VA 4RW4B 4HHTA 5A76A 4JKFA 1S6QA 4ZVSB 4DKWA 4CERA 3P31A 3CIZA 2BCQA 2VFRA 3LM2A 5T14A 3KZXA 1ZBUA 1C7YA 4K4ZA 1MN8A 2BRKA 4TLRA 5JS1A 3PIPQ 2DUYA 4CF5A 4Z7CA 4BBYA 5ALTA 1QDUB 1OH5A 4FS2A 5DK5A 2HNDB 1CEZA 3PIOQ 2M9NA 3UR3C 4OYOA 2B4OA 1RILA 1S7IA 1RAOA 1YJVA 2ZM6J 1D4XA 1O0PA 3UQ2A 5AKEA 2FVPA 3OR1A 2XEXA 1IH7A 5HQMA 1KP6A 1RDDA 1GK8A 1RTJA 4DV2J 3MXHP 1BPBA 4FVMA 4OI4A 4PZVA 4E7HA 5KFOA 3GV5B 1OPIA 1NK8A 4PUOB 3S3OA 4NOHA 5J0WA 2A42A 4CGHA 4CLYA 2OUGA 4EP4A 4JYAK 3OR2B 1BPDA 3CD6S 5IT0A 4O5EA 4KH1B 2HVHA 5CQGA 1GXLA 1Q8KA 4QCLA 3I55N 4XTTA 3CCJN 3HZEA 2IFXA 2V8GA 4ZPWR 3QX7A 1VDVA 4Y28C 4MEXA 4OX8A 2GELA 1N36J 3NVMA 4ISFA 4FWLA 3UCZP 2HRUA 4JN4A 3TAPA 4CO0A 2P9LB 2RLTA 1GLBG 2R8KA 1TFWA 1U2FA 3MAAA 4QIFA 3WC2A 4KHWA 1K0TA 1IG8A 3LWLA 3MN6A 1X6JA 1DRZA 1RT6B 4DTXA 1EX8A 3UW1A 2QTDA 1ZQPA 1O08A 3IG5A 1IBKK 1B70B 4OJ5A 1VCTA 1S3XA 4PWDB 3ZDDA 4A8QA 4JI1F 3AODA 4DR5F 1YWXA 7ICJA 4KGMA 3UKRA 5J1EA 2CJXB 2GVZB 1RXOB 2O5DA 3HHEA 3M9OB 2W4DA 3SCJE 1BCOA 1R8HA 3J7AN 4CE6A 4PGYA 2IA6A 1RAEB 1FJ7A 5EXWA 2QKQA 1RTDA 2QWRA 4DN0A 2Y0BB 4LF5K 4XQ8A 5M1PA 3CJKB 1Y11A 1KKHA 3B0XA 4O3RA 1HW8A 1LWFA 4RBUA 4B3RF 4EAHD 1L7PA 2BPFA 2YN4A 1LWEB 3SK3A 2JZ5A 3RJJA 4H0PA 5KG1A 5GIPA 5DDOC 3D6MB 4DTOA 1SZHA 2H51B 3THXB 2ZJRQ 4B8CA 2ZBPA 4TUQA 3AO4A 3DWLA 2MEWA 3UVJB 4B3MJ 1ULRA 5GIOA 2JV3A 4X4RA 4RQ7A 1BCMA 4GC6A 1X4BA 3A0IX 3G9CA 3UKRB 1WN7A 3GTYX 4L6V3 1NJZA 3FGUA 2RIJA 3HO1A 4F04B 1SUQA 3MN5A 1AUSL 4RU2A 4FJ7A 4KMUA 1HKCA 2PIIA 1RB0A 4OZ5A 2JR5A 4ZPCA 1R8PA 1N48A 1HNVB 2ZE2B 4UB2A 3EX7B 3PW5A 3TACB 2QMXA 3ZTSA 3OTOJ 3C65A 4C8LA 2VFVA 3SCIE 4ILMA 4USIA 3B8AX 5IOLA 3L3VA 4KH4A 5AJ3J 5AKXA 3BSNA 2F40A 3CC7N 1CULB 4FNHA 2B4UA 2HMIA 4J2EA 4K4XA 3AHPA 8ICGA 2RHSB 3L3CA 3CXCR 4CJWA 5B0CA 5LSLA 1NRKA 4K2JA 4OJ6A 4XDCA 2AEFA 3VEVA 3GR0A 2XI3A 4YN4A 1PYSB 2VICA 3PTWA 2P9SA 3G6ES 5ETVA 1T05B 2Q1NA 3RAQA 4L3QA 1QVGR 1XHXA 3BKUA 2Q0RA 1S4FA 2X3GA 1V9PA 1OYDA 3H1QA 4AHCA 3MM9A 2EK6A 9ICHA 4BACA 2JWNA 3CJ5A 1YKWA 4I9LA 4E19A 3DRRB 1GMWD 4BR2A 4KLIA 5ALLA 2OZSA 4O3PA 1VAZA 8ICOA 5CA7A 2HOIA 1TFRA 4WFNL 1L3KA 5CWRA 1QTNB 1RTZA 3UQSA 3M1FA 4MN4C 3GBTA 5GVQA 4OQJA 1S0VA 2XHBA 5KPTA 1KQQA 1TVAA 4C8OA 2GIRA 2HMIB 4X66J 1Q9YA 3ITHB 4O0JA 3H7HB 3RF9A 1B0PA 3SUPA 3M6ZA 5J2HA 4K4YA 1RWMB 5ALIA 1N36K 1IQTA 3I28A 1TV9A 1IM6A 1T6CA 3Q89A 3R5JB 2OTLS 4FJNA 4BRKA 1QTMA 2FMPA 4LRFA 3UDVA 5J2MA 1Q8IA 3QDKA 4NYFA 5A8WB 5JUMA 3SPZA 2UUCK 4KGXB 3NCIA 3TA1A 2F8KA 1GX5A 3FSIA 7ICEA 5IWAK 4ZIVA 5LJ3Y 1LFPA 2DGQA 2X1BA 1NJIT 1P8ZA 2G1HA 1TKXB 1EO1A 4Y0FA 1F5AA 2WBNA 1U1RA 3AH6A 1LB2B 1ZD3A 5ALHA 5KFJA 8ICCA 3ULHA 3U6FA 1YRUA 3PXGa 4ELVA 2MYFA 2JRZA 1UHUA 3PX6A 3QRRA 2I1RA 2RHFA 2HYIB 3IG1A 1A7GE 4I2GA 2HBJA 4P73A 4WKRA 1HBNB 2KRRA 3CMAS 1RZTA 3A3OB 2D1KA 1QD1A 3ZSXA 3NP5A 4CJ5A 1VK0A 1XO1A 4YMNA 3GWCA 5HP4A 1YJTA 2XI2A 1FXRA 5D8HB 4OX9F 2WFBA 4OKKA 3S3MA 2D7SA 2V4QA 4BWMA 4ZP8A 2NYVA 1UW9A 4J37A 1KBRA 1RBRA 1ZQUA 3AA2A 5AM2A 4J9QA 5F8NA 2I0XA 1SKUB 3CCMS 4C7YA 2ASMA 4DHVA 1IBCB 1VR6A 5BR8J 4JHDA 2YV0X 4I68A 4A8XA 7FDRA 4Y2VA 4YB6A 3LALA 3UXNA 1RWNB 3QEBZ 3AFGA 3DEEA 2HPUA 4FPBA 4USMA 2FZKB 1BQXA 1AZSB 4M3WA 4YY3J 2VC1A 2IRXA 2KHDA 3SJHA 1I3AA 3PFOA 4KV8B 4WQ5A 5B5EU 1RJJA 4RQ8A 2IIHA 5K8OA 2GAHC 2Z56B 4HT5A 3CCVN 4LQ9A 3MEEA 1ZQZA 3VETA 1NMEB 1H74A 4UY8O 3WX4A 2V8PA 3AA4A 5D4BA 3W0LA 2OPSA 3TOQA 3V6DB 2ERRA 4CIGA 1G7CB 5K20B 5C2CA 1YIJS 1FO1A 3BF4A 5ALRA 2VU5A 5GAHP 4DPXA 4WFBL 1UAWA 3BO2A 1R0CB 2YWKA 1YJWS 2G9OA 4JHDB 1YK9A 4G1QA 2OH2A 1X7VA 5B09A 4O4GA 1K47A 5A0LA 3M8PB 5IT9Y 4WQ5C 4M9JA 4PGXA 4USWA 1IBKJ 2KFNA 2GUPA 4HTIA 1G15A 4BRCA 3M2RB 4FFDA 5CY4A 5C24A 4GW6A 5HATA 1U04A 3FQLA 3CF5L 3IR7B 1Z1ZA 4FZNA 5E2QA 2OA8A 3OUYA 4IG0B 2IY5B 2QB0B 5KG0A 1B0TA 4PG5A 3HX9A 2CA9A 2P5VA 4P7VA 4NLKA 3SQGB 2Z58B 3LGMA 2DNMA 4RW9A 3L0QA 1TTHB 4IOCQ 5KFMA 5B0FA 4FJ8A 2WB1D 4YDXA 3BZKA 3TSUA 2A0FB 2DR9A 1DKGD 4DL5A 5KFHA 2VWKA 1RXWA 4LF8F 2KM8C 3BYPA 1UWAA 4B9LA 4LF4J 4QBUA 3IG8A 2HBZB 2F1HA 5IT4A 3I8BA 5AKIA 3AU6A 5LMUJ 2BGWA 1Y3JA 5KNIA 4ZPBA 2O6KA 2FC0A 5AIBA 1SIZA 1FFWB 1XJWB 1XR5A 3K5LA 4GNIA 4WPAA 5CABA 1YBAA 4PXCA 2DNHA 2QT7A 2OEKA 3VQ7A 3KJNB 3R8YA 4CLFA 4JV0A 4ZN3A 3IMXA 3PZPA 4QWEA 3KHRA 1Z2ZA 1NNEA 4FZMA 3DRXA 3BGRB 5EE3A 3RW6A 2HLUA 4MF2A 5JMVA 4M3RA 3FBEA 4DV3K 4DR6J 4IQVA 1KLMB 4KGVB 1FKOB 1HNXF 1RT1B 2LCWA 1Q1KA 2AT1B 4UZBA 1HNWJ 4GVBB 2BJDA 3A0BU 4LF6K 2JRSA 2UUAK 2FC8A 3HTVA 3KK3A 5ETMA 1ZAWA 3M7VA 5KTQA 2K7KA 2R7XA 4KV8A 1KSPA 3PACA 3HKZF 3OYEA 5A2QO 4CVNE 3QYYA 3MK6A 4DLGA 1DOQA 2FBXA 3W66A 5FRNA 5D77A 3LVVA 1GT8A 2YH1A 4C8ZA 2AP1A 1WOPA 4TNOA 3CC4S 4CZJA 4RUCA 2OYYA 2K4IA 2A1JA 2GH1A 1YJNN 3WKDA 3R27A 5HJXA 3ONNA 3SDEB 1J5EK 1XEZA 4A4JA 2RKIA 3DLJA 5F8IA 3BEXA 4UAYA 1TAUA 2VPYB 5FPEA 2KIWA 3AQEA 4Y2MA 1NDCA 3QGGA 5TKYA 3H7IA 4UB4A 2GX8A 4JAXA 3ONQA 3WKCA 3QFPA 4RWXA 1SB6A 2GNKA 4PL2A 1UKUA 1XHZA 4B3SK 3C1YA 1C4CA 4Y65A 2IIRA 5ETTA 4Y2XA 2CXYA 2I1QA 1RA6A 3U1MA 4CGGA 4DO9A 1RTIA 4D3GA 4QS8A 3AA3A 3VEYA 1CG2A 3OYHA 2KV2A 2DFHA 1NZ8A 1K0VA 4HI1A 1S0MA 1FDBA 4WK1A 4BC5A 2HAFA 3QEWA 2WW8A 5G0RA 4FJIA 3OVNA 2NRHA 2Z57B 1K9MT 4HHJA 4K7QA 1Z1VA 2HNYB 2H3IA 3C6UA 1UJ6A 2PMZF 2EG1A 3KLHB 1XMOK 4R8UB 3AVMA 4I29A 4CHYA 3DKDA 1WTFA 4PRFA 3V2UC 1W26A 4PXBA 2CIMA 3CCES 3VEWA 1UP1A 4Z4HA 5HVHA 4M3TA 2R7OA 1H0HB 2A10A 2NCKL 1RZMA 3MOZA 1FRLA 4NYOA 2LA4A 1TAMA 1T94A 2HHUA 4OHZA 4JP8A 1RT4B 3L9ZA 4E98A 3U4LA 3DXKB 3VEXA 1FWKA 3K1RB 1KOOA 3B54A 4UB3A 2HNDA 4OYAA 4YCXA 3UDEA 2GVDA 4KHMA 1WUDA 2DR5A 1RBVA 4RBTA 1S99A 2VODA 3NNCA 2NPIA 4Y2AA 4O44A 3IRWP 2DR7A 3OXLA 4CLSA 8ICYA 4PY5A 1YVUA 1C0UB 3IKMA 2F3JA 1FKOA 1SQEA 2KJ5A 1E4FT 2BJ9A 2CDQA 4UUXA 2O67A 5KFDA 3M8YA 2HWHA 1VLOA 3HMJG 1VHIA 3NDKA 5JLFA 5M1OA 3KKSA 2DNYA 3A8KA 3GSDA 5IM0A 3F5TA 4NRUA 2LEAA 4YOXA 4A61A 1KL9A 5EU7A 1IJJA 3EDQB 2O8FA 4OYPA 2ES6A 1Y9OA 2P6SA 4HTJA 1X5SA 5AQKA 3TTCA 4UBCA 2BW2A 4OKJA 2K06A 1DBDA 8ICQA 3MM5B 4M9GA 1LFWA 1BVSA 2UU9J 1YHQS 4XA5A 3TP2A 3RTVA 2HHSA 4GKJJ 2IJRA 5FPNA 1GOCA 1P9QC 3VQ6A 2PEHA 4NXNK 2QMWA 4UAUA 1MA9B 4JWMA 1CJUA 4TLQA 5AE1A 3DXBA 1D5AA 4LF5F 5LT5A 1VRTA 3OS0A 1GFWB 5JMNA 3MM9B 2DT9A 5DQHA 2JMGA 4CJPA 4BC9A 5BYRA 1MN7A 4DMNA 5E3QA 4JI0J 3IFEA 1W2IA 5AQNA 4EBCA 1RTIB 2HBKA 4N56A 2XMWA 1VQ6S 4CF8A 4RQ0A 4KHPJ 4ALZA 2OIHA 1NB7A 3MD3A 1RDAA 4DX7A 2WVDA 1QY7A 1YTYA 4IFEA 1BPZA 3ENBA 3PSPA 4QZFA 4TY9A 5JRTA 2AGQA 3I56S 1NOMA 3BUZB 3PJWA 3FC4A 4JV1A 1YT3A 1S57A 1E4GT 3CIMA 1YBTA 3TJ8A 3C3LA 2EI5A 2D0BA 4MO4A 2ZM6F 1VQ9S 1YXQA 4DOBA 2V8VA 3KG1A 4DV1F 4NI2B 1JQGA 1RI7A 2IRYA 1S9GA 1XO0A 4DZ6A 5LM7E 3N0VA 3DNCA 2IYGA 2DB1A 4JYAF 2V7YA 1VQNN 1F0MA 2MKHA 2MZ1A 2GX9A 4QZ9A 1U25A 3D67A 1DARA 4DL7A 2O8DA 2DPJA 1T9VA 3F56A 3KLVA 3ZC4A 4KFBB 1E3MA 2HQFA 3KIOA 3RMAA 3CPWR 1UEVA 4FVUA 4CF4A 4Q43A 1VQ8S 3OYLA 3OYGA 3CQYA 4NLOA 3KJFB 4OZ3A 2HHXA 3O6WA 2Q3SA 3SQ0A 3D68A 3OTQA 1YQHA 4EUVA 4DV5K 2E1FA 4WZQA 2RHQB 2XGPA 4CGJA 2HHTA 5HQLA 3CC4N 4GXKA 3C7NA 5DQGA 3F44A 1T3OA 4O44B 3L09A 2KKPA 2ZJ8A 3CM6A 1LV5A 2CH5A 3O4QA 3DFEA 5AZIA 5HO4A 3GR1A 4AE5A 2A2DA 3DLEA 5A2QU 2VD3A 3QUCA 2X78A 3QEVA 1TUWA 1KONA 3G4SN 3BJYA 1LK7A 3P8BB 1H73A 2WC9A 2C42A 4AP9A 4C1NK 3J7AP 1S1VB 2E7XA 2HOFA 1OYEA 1NM1A 4OJOA 3MUTP 2KD1A 2VL1A 3FE1A 2VA2A 4ZJQA 3SFGA 1RUSA 2FVRA 3H2LA 4BLGA 2D3O1 3EZ5A 2IYIA 4ZITA 3BGFA 3OYNA 5HVFA 3WKBA 3AEVA 4RLEA 1QAIA 3UM9A 2KL8A 2CQIA 4O3NA 3MBYA 4OHVA 2FJBB 1K8AT 2RT3A 4GKJF 4KLUA 2ZBIA 5KRTA 3BQ1A 2P9CA 1Y97A 2FLNA 4WYLA 1S5LU 4EMDA 3QO9B 3AQFA 1LXJA 3M30A 3U02A 2QL9B 3KLGB 4TU8A 1RADB 3FSXA 4DSIA 2LPEA 2C2RA 1LCUA 2I6WA 1WSRA 1JLAA 4MK7A 1B92A 2DNNA 1XR7A 4Y2IA 2KMDA 1KDHA 1RHUB 4RTFD 2K8AA 1RBOB 3V7KA 3CSKA 5FLXO 3TSQA 2PZSA 2DKZA 5L8RC 4AT1B 4AH9A 3NNHA 2KYZA 3D2FA 2DGVA 1U2VA 3BB5A 4JI1J 4A46A 4QZAA 1FKPA 2D3DA 1MWZA 1ZQKA 2M4MA 4UT4A 1JN3A 2PE8A 5HMXA 2QLFB 3QBCA 4DR4J 3CW2C 3TUJC 4A48A 4MDAA 2DR6A 5CHCB 3W2WA 1NK0A 2M88A 4EX7A 4DUYK 3T1YF 2XLJA 2XNRA 3CCRN 4WJ3B 1UW4A 1UEUA 2FGOA 2KVQE 1U1PA 2LEBA 3AA8A 2KT2A 5I3PA 2YKPA 1WNEA 2QJ3A 2V0NA 2JGAA 3TZZA 2YNFA 4DR2J 3C6HA 1NGBA 1UOCA 5HL7L 4CFCA 4X4PA 4BROA 2EAMA 5L39A 4GO5X 4CEBA 2WHOA 1ELOA 2RE1A 2FHJA 2LMRA 4Z94A 2BRLA 3KLIB 1L7OA 3D7EO 3QFUA 2CXEA 2EKYA 3P96A 4ES1A 1WSFA 3R2DJ 1EXNA 2V67A 5KOWA 1SJQA 4CESA 3AO5A 3CJTA 5HSPA 1QJHA 2J9DA 1NGGA 4ICAA 3H5SA 2HF4A 1VQ7N 4QIWC 4O23A 3H0LB 4RNFA 1GNKA 4M5DB 4FLTA 2UVRA 3D5MA 3V6DA 4IEEA 4LF7K 1XERA 3UPFA 1NH8A 4KBOA 3K5MA 4B3MF 3NG8A 2VIXA 1UVJA 1Y3KA 2KJWA 1ZQWA 4BXOB 3ZTPA 4NCGA 1ZQDA 3QYPA 1RM6C 4N77A 4F5OA 1S1VA 2YWFA 4FO0A 2XY7A 2BOAA 3DGVA 3O4NA 3HSDA 3MWBA 1H3DA 2P5GA 3QZ8A 4JI5J 3ISDA 5KAKA 2Q6BA 2ACMA 1QVGM 2B5JB 5IQQA 3PJ9A 2ZWHA 3EVOA 1PBUA 1VRQC 2KVIA 1S8OA 2LDYA 3SEIA 4R65A 4U67L 8ICZA 3J81U 1LEOA 4E89A 3O6QA 8ICVA 2J7UA 5D15A 1QE1B 3W60A 3CDEA 2MDAA 2L48A 3DXMB 2R3VA 2KRBA 1LWEA 1D09B 1WKJA 2QA1A 3TUPA 2W11A 3H8SA 3NGYA 1UPHA 3CT9A 1DQ9A 2EFVA 4KITB 4CW7B 4EFAC 2J7WA 4KLGA 1WHVA 3WK9A 2YPZA 1H2TZ 3J7ZO 1CJTA 1CZ9A 4O8UA 3B4MA 2LQBA 1NGCA 2HFUA 4IDKB 2DGZA 2KFZA 3W1YC 3VGUA 1ZXIA 3QGHA 5CD4H 4JKHA 3OYJA 3KFUF 1NNLA 4R63A 3MMBB 4LR7A 3QT8A 3EKUA 2EW9A 1HYZA 5EE0A 4FF1A 4BR5A 4N5SA 3TA2A 4F4KA 4RJVA 1E6VB 1VFJA 2UUBJ 2W2PP 3VEZA 1GLDG 1NEEA 2VASA 1RSCA 2O8CB 3C6AA 1EP4A 1WJ9A 4H8KA 4QJFB 4KGZB 3QNNA 5BOLA 2W9BA 1BIZA 1U6ZA 3QWUA 2ROPA 3V6JA 5DZ7A 4RZRA 4OZJA 5ALWA 1R7IA 3TWZA 3J7A1 1ZTWA 2F9DA 5IZHA 1HBOA 1K1SA 2HMXA 3CMQA 2QLTA 3C29A 2NSBA 2PY5A 1ZAVA 4BRPA 1XNQK 3CPEA 4ANEA 2HQCA 8ICLA 3OTDA 4Y2KA 1ILYA 2EZYA 2UUBK 1RDFA 3HWTA 2IOHA 5AE2A 1N6QB 3RRGA 4V19S 1SXLA 1T3VA 5KFKA 4DI6A 4C11A 1ZTTA 2ZUCA 4PL7A 2UVWA 5GINA 3MEGA 2LA6A 4LH5A 4DR1K 2Z1IA 4JUZA 4Q2LA 1SH3A 1XMOJ 4FK0A 3D45A 1HW9A 3ASMA 3I4PA 2DHXA 4KI6A 2EG2A 5IIJA 5FDLA 4FWOA 4DPWA 5B66U 4P72A 3QEPA 2ILYA 4X4QA 4OZLA 2M8HA 2A3VA 2BM0A 1U0SA 4F0HA 4TY8A 5ITHA 1I51B 5AQPA 4AHTA 4I2DA 1LW0A 3CRXA 4JD2B 3VHQA 2APOA 4AYBD 4BRHA 4MYUA 4HUGA 2E8OA 1ZD5A 2KDOA 3CJ3A 1R0BG 1FX2A 3HHLC 1V5IB 4CEOA 3AM9A 4C3LA 3THWA 3VEOA 3CCQS 3QBXA 1WOSA 2MLXA 3DC2A 4AHRA 4CJFA 4P71A 2E1EA 4FJLA 4QIGA 2HRYA 2B5JA 4DXLA 5C5JA 4A8YA 3V1QA 4YOUA 5AQHA 4EP5A 1WHWA 5EUHA 4A8EA 3GONA 4P10A 1B64A 2R7RA 3PW4A 1FRKA 4I2JA 8ICXA 1VC6A 4Q8FA 5LJVA 4YORA 5AM5A 3AVBA 4DV0J 3OS2A 4NXZA 2D0AA 2KVCA 5EDWA 2EK1A 3HKWA 3MN7A 1N60A 1S10A 1KBUA 5C0YA 2RDDA 1GLJO 2KE7A 2KOBA 4UAVA 4YN3B 2AKWB 3UXPA 1MMDA 5M2RA 4AL5A 4DG1B 2CG8A 3T6JA 4K0KF 2JHEA 3IS9B 2W03A 1RDWX 3WXLA 1RT7B 3QNMA 1TVRA 5LSRA 1YDLA 1KR4A 1BUPA 2ZUDA 5J29A 4JK1A 3U3YA 2QIFA 2VPZB 1C1CA 3C6TA 4TSXA 3G8SA 3CJAA 4B9SA 1CPZA 3U9ZA 8ICNA 1KEJA 4M3YA 2ZTDA 1WKKA 4JRQA 2HCFA 4OJRA 1DGSA 4M5IA 1CZBA 2FF6A 3QEXA 2IVNA 2RS2A 4K41A 3O9RA 3PDNA 2CJYB 4KHPF 4JNEA 2K8CB 2F8HA 4F50A 2NRZA 4FJKA 4M3UA 3WNFA 3UCGA 3NL0A 4YFUA 3OW2R 2KN7A 3I0RA 2XMAA 2NLXA 3VGLA 2E2OA 4B08A 2W8KA 1UPMB 3AGKA 3IM9A 1FEEA 1IBLJ 5L1JA 1HEKA 4LVOP 2ABYA 2QEXN 1BU6O 3MEDB 4DZDA 1HNZJ 3F0NA 3M1VB 3FDSA 3E1YA 1HBMB 3SLCA 4FJJA 2NQPA 3KK1A 4DR4K 1N6QA 1EKSA 2VG6B 2MGZB 5AI5A 5HROA 4U95A 2BABA 5L38A 2NO4A 2E5LJ 3E0FA 4NLQA 4ITSA 3N6LA 1HIYA 7ICKA 2DITA 3GU3A 2BBEA 2KSOB 1JNZB 2O8EB 4RCHA 3MURP 5AI8A 5IINA 4P75A 4DCOB 1IQZA 1Y0HA 5BN9A 2O01C 4R79A 3PR5B 2B9EA 4HH0A 3C0BA 5KFQA 2MQLA 5J2PA 2E2NA 3O3GA 5A8RA 3GQCA 2C2MB 3EGWB 1BWVA 1N52B 4JI2K 1IR0A 5AKZA 3IWXA 3M6XA 1RGVA 2D3UA 2K2PA 2R7YA 5BRDA 3MCAB 5E26A 4DV5F 1RK8A 2GO9A 1LKZA 4ETZA 2R8HA 3R8EA 2FHOB 5HMYA 2FZGB 2R9LA 3M2UA 4KLFA 3AVGA 2G0CA 2YMQA 2VG6A 3G6EN 1QSSA 4ZLLA 1WG1A 1JKHA 4D3HA 2W42A 2GS8A 2Y9TA 4ECVA 5C2GA 2YJEA 3CERA 1S9EA 5JS2A 1KC8T 4DCCA 3UN3A 3EWAA 5IILA 3PYGA 4C0HA 4B17A 2QKBA 3HVWA 4CF9A 4DV1J 1S6OA 3C19A 4OI1A 1HBUB 5AKJA 4E1NA 3R5CA 3JXOA 5AQRA 3V4IA 3E01A 3AV9A 2DGUA 4HYKA 5A8KB 1Z2LA 3FBFA 4CQ1A 2HRTA 4JK9A 4GMJB 2E4LA 1HHQA 4BUGA 4WQ4A 3G96A 1HR0F 2WMMA 2UZAA 1FVSA 4KE5A 4ILGB 4NI2A 4UY8T 2DO4A 3IBWA 3MM5A 1RPLA 1NK5A 1FT8A 2AQ0A 4DFKA 2LU1A 3C6TB 3CJ7A 3NCQA 2P6UA 1OSDA 2ITGA 1DFDA 2EEYA 1LWCB 1MLAA 1S9EB 3RMDA 2NYHA 1R89A 3TZYA 4G3IA 4TVAB 2O8DB 2MPUA 3M05A 1AYEA 5CR4A 2BH1A 3BS5A 1OWXA 2FSKA 4NWIA 3MXMA 3DCAA 4KBIA 5KFZA 2OFHX 3VGVA 4M7YA 3O44A 4I2AA 3PNCA 2I5JB 4CJKA 3BO4A 4I0WA 1JI7A 3I0RB 2FI1A 1VRUB 2HSTA 3KWMA 3KTQA 4CWBA 2RUGA 5F8MA 9ICTA 4H5NA 1YSJA 2HS0A 2FDNA 2LYAA 4E0DA 2NYIA 2K4EA 1HJPA 1CZAN 4K5SA 2NSCA 1VSEA 3VESA 1PJ6A 2DY4A 3JS6A 1JXEA 4B8AB 5D4OA 3FRYA 1HYVA 2DBYA 3PRDA 2FPMA 5IV3A 3KK1B 1RQ0A 3CNHA 2MGZA 3DDNA 1YRTA 2D5RA 3S7RA 2K1RB 3G8TA 4JKGA 4BRFA 1SV0C 2ZIUA 1C1CB 2LXUA 3B6BA 9ICOA 2N3LA 4BQLA 1N8RO 1HKAA 3BN7A 2ZDOA 4CECA 2PFPA 2EWHA 3OL7A 4LF9K 3BF3A 1S9FA 1BXNA 1S4EA 4KLLA 1YBUA 3NS6A 1HMVA 4GRSA 4MIWA 5F3ZA 1GEHA 2RS8A 3SMPA 4EEKA 2K8BB 1J5OA 3HL8A 2D3ZA 5ALMA 8ICPA 4ED6A 4IUFA 3QU7A 2DH8A 4IO8A 4P0QB 2EZZA 2V6AA 3ULEA 1SQGA 2JNJA 3KG0A 5M1FA 1YVFA 1VSMA 3VF6A 3DRYA 4KN7A 1RKIA 2J6TA 4BXOA 3M2UB 4AL7A 1RBSA 5GAHU 3K0SA 4BWJA 2UVVA 2K1RA 3RRHA 4IH5A 4ECZA 1Q95G 1TKZA 2K7JA 2XWYA 3SBGA 1RA7A 2A1BA 2L41A 3CM5A 4J9SA 1UT5A 1FJGF 2E66A 1B4FA 5K8NA 5HROB 5D6GA 2QX0A 5LXRA 2P1JA 2A1RA 4LFAK 3IWLA 4WU3A 2V9WA 2WHEA 1F5SA 1EXQA 4IO9L 4BC2A 3I96A 5C12A 5BN8A 2IMWP 5JVGL 3D2QA 3BBFA 2F96A 1SKRA 2Q66A 2CZ9A 3F41A 4EELA 1ESVA 4MHVA 2QL7B 1NHKL 2DKXA 5A0YA 1FDAA 3ENWA 1VQLS 4CNYA 4Y2YA 4KLQA 4DB3A 1MWYA 2W40A 2F65A 5THWA 3ICXA 4ATNA 2LQ8A 1P1LA 2YHYA 3L5KA 1YIJN 1YTUA 4ICLB 2CQBA 3BP8A 1PCAA 4C97A 4GKKJ 4DFMA 1ZH5A 2ZBQA 3C66A 2FD2A 4WFZA 5KT6A 4CO5A 3ZNUA 3BS5B 4I2IA 1MROB 4DV3F 1N0UA 1XIQA 2XC9A 2KHCA 4IFVA 3CC2N 3IFRA 1V3RA 1ATSA 5M1KA 3ZTQA 2WB1C 5ALYA 5HMZA 2BV3A 4F2RA 3W8PA 4DR5J 4KHQA 5G5HA 1UPPA 1WSGA 5KFWA 2CQ1A 3VQ8A 4P4PA 2OSRA 4Y34A 3V4IB 1VIXA 2EAOA 3TFSA 5J2MB 4M6WA 1XQSC 4QQBA 5F9LA 1O03A 1W7WA 3US5A 4W4MA 4CBXA 2ZH3A 4AHUA 4B3MK 5AQSA 1HKGA 4HWIA 2V63A 4Y1DA 4YDUC 3A3PB 2I7NA 5HR6A 1HNXK 3LPUA 2ATLA 5J2NB 3HXMA 3NAEA 1JALA 5FLXY 3ZCMA 2DGSA 4TU9A 1JJCB 3C16A 3PY8A 4LF6F 1Q8LA 1D1UA 4GV3A 3OY9A 1LOUA 4H5WA 1VQ5S 1PJ5A 4US9A 3KUHA 1K73O 4KTZA 3FEXB 2HBQB 5EGYA 4Y2RA 5HMLA 3HZGA 2JJ4D 4EO8A 1J5OB 3UE5A 5J0OA 1PAEX 2IBOA 3IC1A 3DGPB 1IWAA 1OH7A 2HGNA 1XQIA 2R42A 3OTBA 1BNPA 4MH8A 3ZD8A 4UQTA 2X1GA 2FJDB 3SUQA 4NLSA 3M8QA 4FLVA 3E9OA 5AK5A 2UXCJ 5GTHU 3J81O 1JLGB 2KG5A 3Q8LA 5EHHA 4FPRA 5K8PA 2Y1LB 4H4OB 3DDIA 1VBZA 4A8WA 4C80A 1JMTA 3C16B 2CJBA 2WB1F 4DR2K 4IOAQ 3BBCA 3PEHA 1JNRB 2BPGA 3SI6A 4NCGB 3MM6B 3OYKA 3QLHA 3TW0A 2IGIA 4WFXA 4CGFA 5CEHA 4YD2A 5FJ4A 2Q0UA 3FGVA 3PRBA 4U96A 2W41A 2YHXA 2NNWA 3WNHA 5HLFB 4HACB 2EKNA 4K0KJ 4DPUA 4FK2A 4M7XA 3I31A 4WQ4C 3NKYA 4JYAJ 2QXLA 3DLKA 5ALPA 4MIBA 5F8GA 1ZA2B 3PX4A 4KH5A 5F0WA 5B0DA 3LAMA 1ZD2P 1SWWA 3AA9A 1C1AA 2QI2A 2C3UA 3DOMB 3OYAA 3NF7A 2W9BB 9ICIA 5GTIU 2XG8A 3FC9A 5DO2A 3OVBA 3DXMA 1X5OA 4P6QA 3OL8A 2IPOB 4F4WA 4ILRA 2P9IB 4YXMA 2WBRA 3QT6A 3LPTA 3OYCA 4C8KA 4IOCL 3PIOL 1WEXA 1XC3A 2Q43A 3O8MA 3JB9k 8ICMA 4ECYA 4OJGA 3KMQA 2YB1A 5J0XA 5DBCA 4ECTA 4TYBA 3TJ9A 4UTGA 3QQCD 2JLEA 2R2RA 3K9KA 2PFUA 3RJEA 2DNZA 3C8YA 3A8EA 4USKA 3HM9A 1TYQA 1TKZB 4B3SJ 4ZKAA 2F3NA 3MMBA 1OW5A 4FJMA 2DTJA 3DAWA 1IBLF 1FWLA 4GKKF 3PW7A 2NREA 5DGBA 4WTYA 3I9ZA 2QA4G 3RAXA 5BXIA 4LFCJ 5HL7Q 1Q82O 4Z4CA 2MHNA 4NL5A 1BI4A 3QUBA 3WXMB 4WIIA 5AQWA 1JCFA 4IG0A 1EQYA 3A3NB 3D0HE 3HSGA 1SIJA 2GV1A 4B1YB 5KFYA 2M9KA 3SQGA 1WSIA 2HEKA 1J97A 3SV3A 5A0YB 4EX6A 2ZH2A 7ICLA 3VQPA 1JLQB 4K25A 2JZBB 2E1PA 4QYZJ 3D4JA 4AHSA 4W5RA 5CZVA 1HJOA 4UUWA 2PGCA 2YI1A 2F9WA 4OZ2A 2ZIVA 1VSKA 3TEGA 3Q86A 3ETLA 5BPNA 3MUVP 2VFTA 1NDKA 2B7CB 4NYZA 4FJHA 4ENOA 5C2FA 2GWKA 3E2EA 4CEZA 4CLTA 3A8IA 1I1GA 3LF0A 4N47A 1XMQJ 2CPZA 3T9NA 2MLZA 2P9KB 3PFEA 1URRA 5CXTA 3IRUA 1G3OA 4X65J 3QEAZ 3NGZA 3IAYA 4OKEA 4CK1A 4Z6EA 4EENA 5KFEA 1BWEA 4ED5A 4Q2MA 3CD0A 4CJLA 1ZQLA 4PYAA 5KL8B 4DR2F 4DR1F 1KVJA 2YWHA 1FRXA 2ALYB 1TVRB 4J91A 3OL6A 1D8LA 3L7OA 4CO1A 3I5BA 5M1NA 1R0AB 1F9HA 1S5ZA 3T3FA 3RH6A 3KFWX 1Z25A 4IFYA 2MHEA 3B78A 3IBFB 4TUPA 4P52A 1YVNA 2VGMA 2H5JB 2H3ZA 2V69A 5EX3A 1SZ2A 1JJ2M 1RDBA 2P6TA 1XC9A 1NGDA 4KSEB 3QLHB 3CULA 2PYJA 3WK7A 3CHWA 2XMMA 5ALVA 2RF2A 2GIQA 3OQ2A 2RE2A 2D1CA 4CEQA 2FUG9 3W65A 2WF9A 4JOUA 4ZLPA 4O5KA 4WP9A 3G87A 1R8BA 3OYDA 3TWHA 5AK4A 3F2DA 3C2PA 2PC6A 1H2VZ 3O1LA 5IWAF 4IH6A 1J6ZA 1SVDA 4M5KA 3UN5A 1NBWA 2FVCA 2FLPA 1LWXA 2A1AA 3MXJA 1WBDA 5DB8A 2YNGB 2Q31A 2GGPB 4ZN1A 3ALYA 4G1PA 3MMCB 4HUEA 2VZ9A 2OKQA 3NWGA 2AJ4A 1VOMA 1O5JA 2I2YA 4B1VA 2DNOA 4YB1P 2A41A 4OGCA 2OPPA 1SV4A 1YZ7A 4LT6A 1UWBB 3L95X 2AX1A 2GQCA 5ALOA 4ZVUB 3QT7A 2W24A 3QSYB 2CADA 1Q86T 2D0PA 1KVBA 1V97A 1W2BR 1C0FA 3LANA 3G6XA 5BPMA 2E9ZA 3VAJA 3BQ0A 1TELA 2WOMB 4B9MA 3AVCA 4Y6IA 1QZ6A 4KYZA 4R5PB 1PVRA 3AB2B 3L8BA 4FWQA 5HQ8A 3N9UC 1F21A 2KI2A 4KI4A 5B0GA 4DQPA 1E6YB 5ELZA 4NZ0A 3CUNA 1Q0NA 2OXOA 1XUPO 3K7RA 1RKJA 1OJ4A 2B6AA 4ZCKA 2VPWB 4NL9C 4YUDA 4A2AA 2G06A 4WP8A 3D6TB 1U1LA 4DV2F 3CCSN 1M5OC 1RWKB 2G5HB 2F1IA 1NLKL 1ZQVA 2NZTA 4F3MA 2BR0A 4K42A 4X4OA 1AROP 1S1UA 1RAJA 3SYZA 4CZCA 8ICIA 2QLBB 4AQYF 4HAIA 2VOOA 3I4HX 9ATCB 2DPNA 2FSNA 3DRSB 3X3UA 3RGIA 4P2MA 2WB4A 3L6QA 4O3MA 4ZVPB 1PUZA 2YQ0A 3P3DA 1YTAA 1ZQNA 1XR6A 3MI7X 4NE9C 4LBPA 3M32B 9ICBA 5AK6A 2B56A 3NRWA 3A5NC 2HQGA 1Q46A 2A6OA 2DFEA 1N61A 4R5PA 1FX4A 2J0WA 4JI0K 4IXCA 3AN1A 1SV5B 4K4VA 4PL1A 1X3MA 5E3AA 1RT4A 4F5QA 4NB4A 3CYMA 4F72A 2KSOA 5KG4A 4CH7A 3DXKA 2EFPA 1RDRA 1U9LA 3NS7B 3O9QA 5I42A 3ENVA 1C0MA 4H0OA 3ULEB 5CR0A 4HR2A 4AHVA 5IT9U 2PKEA 2NXJA 2WVFA 2VYPA 3NVYA 2JC0A 3TAMA 2GUIA 2DXFA 2UUAF 2PMWA 1EIYB 3ZT1A 1D9AA 4BE2A 2AH5A 3PW0A 4C6AA 4FJ9A 2DGTA 3LH2S 3LA0A 3V5RA 2JH7A 1TKTB 1G2EA 3SAGA 3M8WA 4K5RA 1N34K 9ICWA 4UB5A 3MWPA 2CGKA 5AM0A 5B0EA 4DBQA 4JB8B 5IT9O 7AT1B 3ETMA 1DTQB 1SJFA 4F92B 2PD1A 2HDOA 3KHLA 4PEOA 4OJPA 4I6YA 7ICUA 4ZTJA 4RWTA 2Q3PA 1FEHA 5KT7A 3KD3A 2ZHBA 1CJVB 1GXUA 2ZJPL 1HD0A 3C2LA 4GO7X 4ZH4A 4OZ1A 2DFFA 3OXFA 2QRRA 4JB3A 1WWUA 1O51A 2HWIA 1TL7B 1PJ7A 2E6MA 3OLBA 5A8KA 3MMCA 5K5MA 2UXCK 1Z26A 4UW9A 5EOZA 1QQCA 3QNWB 3UMGA 2UU9F 1VK8A 1JJ4A 3QB0A 3AL0B 2ATCB 3L2QA 2RN2A 4JKGB 2OP5A 3GG1A 3NVVA 1HNIB 1RWPB 4WFNQ 3H2VE 1I39A 2VG5A 2CQCA 2Z2MA 1LWCA 4CHNA 2ZH1A 3ZT3A 4FNIA 5IIKA 1FNMA 4EI2A 1NPKA 4OVLA 2NRVA 2EWSA 3E66A 3O0FA 5DQIA 5KFBA 4HKQA 1OIAA 3SIPB 1QVFM 1L7MA 3EW9A 4LVSA 2B7BB 3VGKA 2VQFK 2ZH6A 1KVAA 3QU2A 3QBWA 4NA1A 3I82A 5KG6A 2G2ZA 4URGA 1S1WB 1IKWB 2C1EB 2HBMA 3LL3A 1IN0A 3O9TA 2ZD1B 1QZ5A 3OSPA 9ICUA 2LSNA 4J2AA 4O3OA 1RT7A 8ICKA 3CCRS 3DLBA 2CKWA 2N4DA 4DSFA 2OLWA 3MGJA 4OJLA 1B0XA 3OVAA 1GMUA 1T3NA 1QAJA 2Z7JA 2PI4A 5G5GA 2KKHA 4CLZA 4J8FA 2KJ8A 4DV0F 4NLWA 2XYHB 2F1FA 3ZEUB 4LZGA 3JTPA 2GJ2A 2OPPB 1HLWA 3P6YC 3CJBA 2E8NA 5DDRC 2FLLA 5E33A 3KDOA 4RT3A 3HPHA 1H6KX 3D2EA 2XS7A 1TL5A 5AQXA 3ISCA 4B9QA 1XSNA 4C4SA 4LF1A 1UA1A 3P38A 3Q23A 2LECA 1C0TA 5J1EB 2YNIA 5AM4A 3D3CJ 3VERA 1HUOA 3GCWP 2BCUA 4PGQA 1A76A 1HRHA 5B0AA 3OPKA 4Y2PA 1VMBA 2CPRA 3CMES 4ZHRA 4NXMF 2XMUA 1XBWA 1LW2B 1G4CA 4DV7K 3MR3A 2GWSA 9ICEA 3T5KA 1SBRA 3G82A 3NFAA 4CDIA 4ZCMA 2W01A 2LKYA 1NSAA 1IG6A 3H5XA 4X5VA 3KUGA 2UXBJ 2DTUA 4HI2A 4RX6A 3THTA 2WSCC 2Z0GA 5KT5A 2O66A 5ADXA 3CCUN 3M1VA 2R7UA 4I69A 3K89A 1HBMA 4ZIWA 1RCOB 2RQKA 3THXA 3L7PA 1DTTB 5F9NA 2G13A 5B0BA 2GTDA 3JQJA 2DKOB 4E8UA 3PR4A 3CFRA 1F0XA 3QRQA 4O5CA 1S59A 5AIAA 4KX5A 4DS4A 3VPZA 3ZETB 4ZVHA 2YX7A 4DU3A 2UYTA 2DR8A 2KFYA 2YKAA 4H4KA 3TVYA 3OYBA 2Q2RA 1LQ9A 4WFYA 4CF3A 6FD1A 5J2PB 4NYPA 1RBTA 4TN2A 5A8RB 2IM1A 1FERA 4DTNA 4UOCA 4I7FA 3PKMA 5GAGI 8ICWA 1LXNA 2GCFA 1TMJA 1TZ0A 3HF5A 1RCHA 1CULA 3ETRA 2W55A 2F44A 4DV3J 2JEGA 3KLGA 3D54A 1I6JA 3MPDA 3P45B 4EEYA 4PQUA 2ZJ5A 3GJQB 2EAPA 3ZX2A 1DK3A 3R7BB 4LSLB 4XDDA 1EAYC 1FXDA 3EDRB 2DD8S 2XB2D 3MR5A 1T9XA 5EN1A 4M8LA 3M8ZA 3S6JA 5DB7A 4WTOB 2CPHA 2PI5A 1ZQEA 2P8IA 2P66A 2QWPA 2AIRB 1BC6A 3QJLA 3N4PA 1MROA 5HN0A 4BC7A 3ID8A 4BE1A 2QM1A 1OY8A 1N36F 3VA0A 3PX0A 2VA3A 4GV9A 1VQMN 1IKWA 3MR6A 4LJMA 2IAJB 4J9KA 2XO6A 2RILA 5C2DA 3W2WB 2HI0A 4GY2B 4C3MA 4PCQA 2BANB 4I2CA 2XIDA 3MFHA 4E7JA 3N4MB 2CNNB 2ZH4A 4J2DA 3C5FA 3LAKA 4FOEA 1EKRA 2DRAA 5ALZA 4C3KA 4OJ3A 1T9TA 1PKUA 3W3DA 2DWQA 3EZUA 3GFHA 4KLHA 1VQPN 4WJBA 3PIPL 1ZQSA 2M2BA 4X4VA 1CLQA 3A5LC 4WYBA 2DHGA 4OO1J 5K14B 4XPEA 2G8UA 3D66A 1M6YA 1JB0C 3HLUA 4P0PB 1SWVA 3CCQN 4W5QA 1Y5IB 2YWWA 4C1NI 5EOYA 2IVFB 3AO3A 1X5TA 2H1YA 5T7BA 1SC1B 1Y00A 4R0EA 4OYWA 1WEYA 3HDSA 4CGDA 2HURA 5CB1A 2ZOMA 5JVHQ 3MX2A 4O4RA 1BO5O 5AQIA 4BREA 5LMNK 3DGPA 3HD2A 2VOPA 2HHHJ 3VA3A 2XMVA 2DYAA 4YOEA 3W7BA 2Z30B 2P9LA 2M0GB 3MHYA 3R6LB 2P6RA 3IAS9 2P9EA 2JEFA 4C7ZA 3ZZPA 3HP6A 2J0SD 1RHKB 1V4TA 4QNLA 3CWJA 4I6WA 1D0EA 1GO3F 3TI0A 4EBDA 3ELHA 4JWNA 4U8YA 3H8YA 4OYMA 1IKXA 2AEMA 2UUCJ 1NK6A 1TV6B 3MPWA 2DNQA 3ZETA 5E3PA 5KG2A 4EGLA 1NGIA 2M8DB 3R1XA 3EE9A 3D2EB 4JK7A 2PYLA 5M2PA 4H4MA 1FJCA 3BQ2A 3NGSA 2VG7B 3MFIA 2CUYA 1A6LA 4OLBA 2BDUA 2YY6A 1NK7A 1AB8A 2UUBF 4LFCK 3HJEA 1VQ4S 1X0FA 3ZZOA 2KK0A 3Q7BA 3NY0A 2C3OA 5HAOA 3VF0B 4WYWA 2OCEA 4K4UA 3O9UA 4Z6FA 3P4IA 2C2KB 4RWWA 1NJYA 3KUEA 3G4SS 4ZPDA 1HNZF 3N5FA 4N8NA 1HWKA 4NRTA 1NBEB 1ZQAA 1N5XA 2RQMA 3CTRA 3AQOA 2FY8A 3BS9A 2IHNA 2O4GA 5LJ5Y 4CIEA 2HBRB 4DR3K 2D8CA 4JMUA 4DF4A 1KFSA 2C28A 1X4DA 2QEXS 1T9UA 2CQ4A 4JLHA 5AZIB 2VQFJ 3W9JA 2F4VK 1U45A 3Q2TC 5J2BA 2MJNA 5JVGQ 5SUHA 3H6EA 1QQNA 3D6JA 4ZLJA 1Q16B 4DOAA 1UCNA 3R5BA 3VVUA 2BMBA 3R9PA 1SZPA 5I4MA 2BANA 2R2SA 1EP4B 1JWWA 3ULDA 2ADBA 4RNOA 3GFKB 2YX1A 4DTJA 1EB0A 4FYYB 2MZRA 4RW6B 3RW7A 4U7BA 4ZCLA 4LH4A 1RHMB 1IUJA 4WP3A 1IM4A 2HQDA 3MN9A 3VENA 3FUYA 4X66K 5EVZA 2H9ZA 2HGLA 1HL6A 5J8YA 3OYMA 3OD2A 1OY6A 4DL0C 5AKGA 4PQUB 2EX3A 1VQON 2O4IA 3CCWA 4Z6CA 1YJWN 5C25A 1RLCL 3NGTA 4CD1A 2KKZA 3WIUA 5DGAA 2G0IA 4PG4A 4KR0B 2OZMA 8ICTA 3QIOA 3LP1B 3O4WA 2P9UB 3WQPA 3D2WA 1RAHB 4RNNA 2RQCA 1VHXA 2ASPA 2K3KA 3QNOA 2HK2A 1RHJB 4M42A 3KDNA 3TANA 3OHAA 4QJVA 1BA0A 1H2UX 1Z6RA 4AXIA 3V4MA 4FL9A 1ZPWX 1RDCA 3EKSA 3GJSB 2YWEA 4UOFA 3T69A 1DQ8A 5K8MA 4EFHA 2QWLA 3T41A 1Z3EB 1KRPA 1T3QA 4H0TB 1NUEA 1B9FA 3UNGC 2HOEA 3NTUA 4CLWA 3HT3A 2IJFA 4XRHA 2V9KA 3HFVA 5I3QA 4K8ZA 1FFUA 1XSLA 1FFGB 2CWKA 3LGHA 4CTAA 2V2ZA 2V2KA 3AVLA 4JI5K 9ICPA 1VQSA 2W4CA 1GTEA 2R8GA 2BX6A 4K8RA 1JUDA 2MKIA 1TKDA 2NXCA 1VQ7S 4MIAA 3QGPA 1VDHA 4CHQA 1C1BA 5D46A 3T1YJ 3QUTA 3QIDA 1WCLA 1NO8A 4GV6A 9ICGA 4JI3K 4CHPA 4MTPA 3FFIA 3VZHA 1F5BA 3MUMP 3UKUB 1K1QA 4GVBA 4UB8U 2Y3YA 5FP0A 4LSNB 4Y00A 4KPYA 4F3TA 1QAXA 3L3UA 2ISPA 2FJAB 2P51A 1ZXOA 3CO9A 3VC8A 4CNQA 4M41A 1N32K 4LR8A 3ZXWA 1YJNS 3RBZA 2NRTA 2PN6A 3W2VA 2A1JB 4KRWA 3GV7B 4P74A 5A2QY 5CHIA 3C15A 1U0HA 3A8YA 2NV3A 3CG7A 3A2FA 4ECWA 1NCLA 2L9NA 5KT3A 1FRJA 4ACOA 2AXTU 4NLRA 3L4BC 3BO3A 3P5JA 4E7KA 2LVWA 4TUSA 1WD6A 4C8YA 1COKA 4CEAA 4JKDA 1GLFO 3DXSX 2ZBCA 1KD1O 4AF1A 3V6HA 2WOMA 3NS1A 4FXDA 1NDPA 1KW4A 3WNGA 3OFHA 2ZD1A 3AUOA 1LK5A 3RR7A 1HLUA 1Q5VA 2VGNA 3MPVA 2P9NA 4IKFA 1ASVA 3K8VA 4LFAJ 4KN4A 1GLCG 4B3SF 2MRLA 1BA1A 3ZZUA 3CQ8A 3QFWA 4ZJLA 2Q4TA 1YJRA 1VSFA 3EMTA 3KMSA 3A8JA 3R1LA 3E58A 2EC2A 4ID5B 1SIWB 4NXMJ 2OANA 4CZGA 3SV4A 3EICA 3C6UB 2FC9A 4MK9A 4LMZA 2BKPA 4KO0A 2BA9A 4PWWA 2HFSA 1BHNA 2VJVA 3R5DA 3TU5A 2MU2A 2ZVSA 3QU5A 5J2FA 2LXIA 4M3ZA 5KPRA 4YP3A 3NXZA 2IOCA 1ZRMA 3VQCA 3B9JA 1NJWA 3WQUA 4BR0A 4C4TA 2D41A 1BL3A 4CCHA 4NMLA 2BJEA 3UDCA 5IIIA 4DV2K 1SV5A 1XI1A 2CQ3A 3RG6A 2Z8QA 4K4SA 2W9MA 2VF3A 1K8KA 1N88A 3N01A 1ZQYA 5LMUK 4B9TA 3D2SA 3VCBA 3POTA 1MU2B 2XS2A 4DR3F 1S72S 1REGX 5LOQA 1SCJB 4QZEA 3MM8B 4JI6F 3EE8A 4J9OA 1NSKL 3TZWA 2NXEA 3D9BA 2AYEA 2C3YA 2G8KA 4FZYA 4NM2A 3ITHA 4QZ8A 2F9JA 2LMIA 3RJMB 4CTAB 4MFAA 3QE9Y 2HFVA 3N7RC 3MM7A 3BZQA 1HQEA 1IBLK 2K3IA 2RAQA 1TUYA 1IBMJ 1XNRF 3H42A 2UV8G 1YRXA 4FP9A 4Y2CA 4DFPA 4WKYA 2GMLA 1ZD4A 4BGDA 1R3NA 3UD5A 3B6PA 3OHRA 1P7DA 5DLFA 4UZCA 1U48A 1HBUA 2JFDA 2MSNA 3IMQJ 2ZUAA 3DRPB 4C0OC 3QU9A 2OEJA 4IWVA 1B99A 4I7FB 3KKRA 3R1HA 2F8SA 3QMLA 3W5XA 5IM0B 3ILJA 3CFPA 2F2AB 1UVKA 3SEOA 2B0CA 3MM8A 1W0HA 1ZM9A 5E5NA 2LFVA 4BRQA 4FSVA 2QWOA 4CD3A 2D3OR 1R0AA 2MZTA 3AQPA 2CZ4A 4TKTA 4IJAA 4B1ZA 4ZCIA 3SSRA 3W64A 3HSTB 4KJIA 1EARA 1T03B 3TVZA 5AXKA 4BRNA 3CJSA 4ZLNA 3Q22A 3IBPA 4QOTA 3TSPA 2OO4A 3QT5A 2X1FA 1WC6A 1ZQMA 1UQVA 1WAJA 1KLMA 3EZOA 3ADAC 5AXLA 3AAQA 3TADC 1W97L 3KVGA 2H4YB 3EEQA 1NDLA 1QH9A 1WC1A 1C1BB 2W4PA 5HHIA 4EZ6A 1H98A 4ZTFA 4CF1A 3BH6B 2KZMA 4ID1A 3RFAA 4OZ0A 4FYDA 5DM6L 4QYRA 3G82B 2A19A 3EL2A 3AVAA 1YLXA 3ZX0A 4RQ6A 4ZVEA 2YWGA 2R2TA 1EETA 3CCMN 1DK2A 1SC3B 2IHMA 5DZ6A 3KBBA 2XSJA 2YH0A 2LM1A 4A47A 3F5EA 3M9NB 4G9BA 2QARA 3IS9A 3DJCA 5KAFU 5LJWA 3PVXA 2VHGA 3N79A 3CCTA 4FW1A 1J53A 3I87A 3GG4A 5HOOA 2V52B 4FZVA 2M7SA 1BQNA 4BDPA 4PG7A 2MQPA 5JJBA 5GMEA 3D1QA 4XH1A 4KHNA 3CMAN 3FLCO 3CD7A 3LDPA 4CNZA 1UETA 1HI0P 1RT5A 5IIOA 2HVZA 4KQZA 3G8QA 1RP5A 1CBKA 3TFRA 3CJKA 4R66A 3MCNA 2W2NP 3M8PA 1M1KT 3TR8A 1N5TA 3PG9A 4YR3A 2ACYA 5FROA 4OI6A 3SBMA 4LF2A 3LOUA 3WHIA 3RBEA 1S1UB 4IH7A 3LDSA 4IG3B 2PXIA 2E1MC 2E5LK 5IC4B 3HP9A 4DU1A 4X4UA 3UPQA 3KJQB 3RZAA 3MGHA 4K43A 4Z0UA 4FXVA 3E9PA 1D8ZA 3KZBA 1FXXA 4JI8J 3BREA 3MMVA 3WK6A 1IIPA 2F77X 3IV6A 3AVIA 2VBXA 3K1ZA 4KC5A 3KD5E 3MC1A 2F8LA 2V7ZA 1ECWA 1NGFA 2YJFA 1DT9A 1A9NB 4BQZA 4A8FA 1S79A 2B8PA 4DHYA 1RT5B 3AT1B 4S0MA 4WE1A 3DRPA 4QIVA 4HDGA 4B9UA 2MXYA 2VQEF 2CRLA 2GVZA 4I56A 4A5BA 3OV7A 2BE7D 5L1IA 5I42B 2KP7A 1NHUA 4KLDA 2ZZMA 1WC4A 3S6EA 4X4TA 2DNRA 2ITMA 2JVRA 4USVA 2OTJS 2H3EB 3Q8MA 1U1OA 2LQ5A 1AT1B 1VSHA 2WCXA 5IS2A 3JPNA 3QPIA 1LWFB 2MTLA 3C14A 3J7Z5 3OXGA 2GOLA 2CPYA 2AWZA 4DR7K 3W63A 4JI7K 4ZVFA 4YOTA 1Y10A 2YX4A 1B7YB 3G6VA 5CCLA 2YKNA 4X64J 1V38A 3J80Y 5AQQA 5J2GA 2ZFHA 1KWMA 1MDUB 1YI2S 3AOAA 1PK3A 4YHHF 2VONA 4M5NA 3FAHA 4I28A 2C3PA 2AJ1A 1WELA 1JKHB 5KFXA 2XQCA 1EKEA 4U67Q 3RJIA 3NLCA 5DBBA 1EHWA 1CJVA 3VZIA 3K57A 4EZ9A 2XMJA 4HTUA 2G07A 2LYVA 2YXLA 2VKQA 1RAIB 2UP1A 1U2VB 2OI2A 3ED5A 3MX5A 1ZBLA 2W2MP 1MWMA 3VGMA 2KXFA 3TVKA 4DV4F 1ZQ1C 2BJ7A 2ALZA 1KVIA 3KK3B 3VR1A 5J0PA 5F3XB 2KQ2A 1CQNA 3CJ2A 3ID6A 2KICA 2QFJA 3U7JA 2DXEA 2K89A 3WK4A 3CCLS 3ZT2A 1TK0A 1TE2A 4UY85 5JICA 1VJWA 4MF8A 3JSBA 7ICSA 1HYSB 1HNIA 1WWVA 3SXLA 4RQNA 2LM4A 3FVYA 4H54A 2M70A 3HVTA 4JI3J 3B8HA 1L7NA 2RUSA 4RPYA 4NYNA 1WDDA 2PT0A 2L3MA 3QIPB 2FBYA 2MZQA 1U02A 2IJNA 3S9HA 3T19A 2JWLA 3QFHA 2X1AA 2CAJA 4DDFA 5JU5A 2FVSA 2Y1RI 3WDOA 4JI3F 5HI7A 3ZT0A 1QUPA 2WTUA 4LF8K 2DIVA 1ZRNA 3FMWA 1ZM2A 5AKYA 5AQMA 2VWJA 4MFFA 1YJ7A 2PFOA 4YOWA 2W2OP 1NAQA 4IDHA 3RJFA 3C46A 4JV5F 2G0JA 3GP9A 2C2ZB 1S6PB 2V50A 5DDQC 2B21A 1YG0A 4NLDA 4C48A 3K4GA 1FW6A 1HPMA 2CVEA 3BGOP 3CPWM 5DMRA 1WTBA 4MAKA 4LF6J 2KU7A 4QIWD 4CJTA 3NBPB 3HHNB 4ECRA 1KTVA 8ICAA 5A8WA 3HPGA 4OYXA 4P9SA 3K59A 4WE1B 3CQXA 2FHJD 3KK2A 4DR6K 5DLGA 2KW4A 4DUYJ 4JI4F 1TV6A