4G9BA

Crystal structure of beta-phosphoglucomutase homolog from escherichia coli, target efi-501172, with bound mg, open lid
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
227
structure length
227
Chain Sequence
VMKLQGVIFDLDGVITDTAHLHFQAWQQIAAEIGISIDAQFNESLKGISRDESLRRILQHGGKEGDFNSQERAQLAYRKNLLYVHSLRELTVNAVLPGIRSLLADLRAQQISVGLASVSLNAPTILAALELREFFTFCADASQLKNSKPDPEIFLAACAGLGVPPQACIGIEDAQAGIDAINASGMRSVGIGAGLTGAQLLLPSTESLTWPRLSAFWQNVAENLYFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Beta-phosphoglucomutase
publication title Crystal structure of beta-phosphoglucomutase homolog from escherichia coli, target efi-501172, with bound mg, open lid
rcsb
source organism Escherichia coli
total genus 82
structure length 227
sequence length 227
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2012-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 4g9bA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4g9bA01
3E84A 3IJ5A 4Y2QA 4UMVA 1TJ4A 3OCXA 5ALFA 4HGRA 2CFSA 1T5SA 4Y2PA 3OCUA 1ZD2P 1RKUA 1KYTA 3MC1A 1TJ3A 2PR7A 5AVVA 1O03A 4CE6A 4I9GA 1ZD3A 3QXGA 5ALDA 5AW9A 2C8KA 3KBBA 2P9JA 3U19A 4Y2YA 4KX3A 3ZX4A 2HO4A 1Z4IA 5AKEA 4Y2XA 2I33A 3K1ZA 2P11A 2JAWA 4EEKA 1QQ5A 4OFZA 1YS9A 2WF7A 3OCZA 4KX5A 3DNPA 1L7PA 5IS2A 2YMLA 2RARA 3WK9A 3I1YA 4YCLA 3R9KA 4KYTA 5ALWA 5T41A 4DCCA 4IFTA 1ZRNA 4YH1A 3WKEA 3EF1A 5AM0A 4YGYA 5AW8A 4KNWA 3E81A 5AESA 5AI9A 5ALSA 4FE3A 5ALIA 3QUCA 1F5SA 5AW5A 2OA0A 2I34A 5AW3A 2YBDA 5AKJA 1L8OA 5AW6A 3QNMA 2W11A 1RRCA 3WKBA 2W43A 5ALGA 2ODAA 1EK2A 1L7NA 5AVTA 3SLRA 1Z4LA 4YIKA 4J03A 4GIBA 1S8OA 3KOOA 3QU2A 5AHXA 1U2TA 1WVIA 3M1YA 3MN1A 3A1DA 5AKIA 5AI6A 3TLMA 3L8HA 5AIAA 5AK4A 1RMTA 1YJ5A 1RQLA 1WZCA 3ESQA 3N28A 1NRWA 3KD3A 4DFDA 5AK3A 5AKHA 2FPRA 3DV9A 4YCNA 1QQ6A 1K1EA 2B30A 4EX6A 3N1UA 3CZ4A 3U7GA 2YJ3A 4BX0A 3I76A 5A3SA 5AM5A 1RMQA 3W5AA 4UM5A 2ZOSA 4I9FA 4HGOA 4H1WA 3ZVMA 4BEVA 3FZQA 2JAUA 3ZWKA 4UMDA 1Z4MA 3U13A 1Z5GA 3NASA 1U02A 2G08A 5AVQA 2IOFA 1RQNA 1WR8A 4UU0A 4Y2TA 4XE5A 3L0YA 3WK5A 1VJRA 3ZX5A 1YMQA 1Q92A 4UATA 2ZBDA 2IOHA 1VFPA 2IA5A 1S2OA 2FPWA 4EELA 1QH9A 2HOQA 1ZRMA 3W5CA 4UAVA 4HGNA 3SF0A 1AQ6A 4BEWA 4UASA 5ALXA 2JARA 1SU4A 4Y2JA 2BDUA 3UMBA 4F72A 2WM8A 4IG4A 3U7FB 3WK8A 2HDOA 4G63A 4NV0A 4RESA 1WPGA 3J7TA 3OCYA 2D2VA 4OCZA 3OCVA 3MMZA 3FM9A 4JDPA 2YJ4A 1XP5A 1ZS9A 3WKCA 1Y8AA 1RKVA 2HEGA 5AM2A 3AR4A 2WF6A 3DDHA 4L57A 1L7MA 4C4SA 3SHQA 3EWIA 2GHTA 3PGVA 3A3YA 3RF6A 1MH9A 4BBJA 3QYPA 3L0BA 3E58A 1Q91A 3M9LA 2I55A 2RAVA 4ZEXA 4ZEVA 3EF0A 2P27A 5AVUA 5IT4A 2QYHA 2I7DA 3QUBA 3ZWDA 3WK7A 1EK1A 5AW7A 2EATA 3AR9A 5ALKA 5ALRA 2MU1A 3N8GA 2B8JA 3P96A 3QU7A 2HHLA 1SWVA 1RLOA 4OD0A 2I54A 2MSNA 1SWWA 3OTQA 3U7HB 3WKAA 2JGAA 2O2XA 4MWOA 3IRUA 2CN1A 4Y2RA 3ZTWA 2FUCA 2RB5A 1PW5A 1YNSA 1IWOA 3L8EA 5AVWA 1VJ5A 3NUQA 4NFLA 5AVRA 5ALLA 5AKYA 2R8XA 3R4CA 1O08A 3QGMA 4FFDA 3WK4A 4CF4A 2YFYA 2ZBFA 2Q4TA 3AR8A 5E0OA 3ZW7A 3SMVA 2EARA 4BKMA 3ZTYA 5ALYA 1Z4KA 2C4NA 4NAVA 2YMMA 2CFTA 1RMYA 4DW8A 5JJBA 3MPOA 5AW2A 2B8EA 1Z4PX 4AS3A 3I28A 1N9KA 1TA0A 2ZXEA 5ALTA 3VAYA 3D6JA 4L6CA 2IYEA 5ALHA 3WGVA 3HLTA 5AIBA 2AUTA 1Z5UA 3GYGA 3UM9A 4YIHA 1RLTA 3ZVNA 1Z4QA 3ED5A 4BX2A 5AVYA 2GFHA 2YMPA 2WF8A 5AVXA 1L6RA 4Y3UA 4UM7A 2B1RA 3PGLA 2YJ6A 5AI8A 3ZUPA 5AW4A 2P69A 1XVIA 5ALEA 2R8ZA 4O8CA 5AKKA 2HI0A 5ALOA 3FPSA 3QU9A 2BDEA 4QQFA 4AP9A 2FDRA 5ALPA 2B0CA 2QLTA 3B9RA 4Y2SA 4KN8A 2OBBA 4HGPA 3RFUA 1L7OA 1RPZA 2EAUA 4C4RA 3UMCA 2GHQA 2FPXA 5IT0A 1U2SA 3L1UA 4QJBA 3PCTA 1JUDA 2WHEA 5AICA 4XOUA 3KZXA 5AVSA 5AKXA 4HGQA 3DAOA 3QU5A 4E88A 4BNDA 3B9BA 1RC8A 4YCMA 3WK6A 2HF7A 1U7PA 2PKEA 4HAIA 2Q4RA 1RDFA 3AR5A 2C9MA 3KC2A 4CF5A 2MU2A 3NRJA 2G80A 5AK5A 5AKZA 2G09A 5AI5A 3SKYA 2AMYA 4MUMA 3WKDA 3B8EA 3QUQA 1ZD4A 2W4MA 5A3QA 4UMFA 5ALUA 1ZOLA 2G1AA 3OPXA 4C4TA 4Y2UA 3QLEA 3AR7A 3BA6A 3UMGA 3A1CA 4J2TA 4L6AA 1QYIA 2IOFK 3AR2A 2HCFA 1NNLA 2I6XA 3W5BA 3FGOA 1T9ZA 4AS2A 2G0AA 2WF9A 5ALZA 1YV9A 1TJ5A 3ESRA 4CF3A 3L5KA 5ALVA 1YDFA 2OYCA 2B82A 2R8EA 2HSZA 5AM3A 1U7OA 3OCWA 3NAMA 4KNVA 1N8NA 2WFAA 4G9BA 3L1VA 4RETA 5AKLA 3NIWA 3ET5A 3F9RA 3FVVA 4ZEWA 2FUEA 4UMEA 3R09A 4EZEA 3AR6A 3EPRA 4FYPA 3N07A 4BNDB 2R8YA 1RLMA 2X4DA 1TE2A 2O9JA 5AK6A 3ET4A 3W5DA 1LVHA 2PQ0A 3WGUA 2NO5A 5AM1A 3ZU6A 4BYGA 2GO7A 5AM4A 4EENA 2WF5A 3L8FA 5A3RA 5AW1A 4XQ0A 4UW9A 2BY4A 4DWOA 1L8LA 3QX7A 2FEAA 2DQSA 1T5TA 5AW0A 3U7EB 2VKQA 1J97A 3QUTA 4EX7A 5AI0A 1Z4NA 2FPSA 3FPBA 1Z88A 3I6BA 1FEZA 2AGVA 3N5KA 2C88A 1CQZA 3KDPA 2HX1A 2JAOA 4PNHA 5AVZA 5AI4A 4GXTA 1CR6A 2B1QA 5ALMA 4Y2VA 4OHFA 3ZI4A 1X42A 1QQ7A 5ALJA 3PDWA 2RBKA 2Q5EA 3IB6A 2YMQA 2OM6A 3ONNA 1LTQA 4XPZA 2ZBEA 2YN4A 3QU4A 2ZG6A 4CNQA 2ZBGA 3CNHA 1Z4OA 4UU1A 1NF2A 3L7YA 1Z4JA 2NYVA 3SD7A 2FI1A 5FP0A 2NO4A 1RKQA 1ZD5A 2GMWA 4JB3A 5ALQA 2FPUA 3L0CA 4UAUA 2YY6A 4NWIA 3A1EA 3AR3A 3NANA 3U26A 5ALNA 2YJ5A 2G07A 3S6JA 3SKXA 2G06A 4NABA 4BX3A 2HF2A 2CFRA 4F71A 1ZJJA 4B6JA 2C8LA 3NALA 3E8MA 1XPJA 3BWVA 4HYTA 2AH5A 3HYCA 5AKGA 4UARA 3ZVLA 1J8DA 3L8GA
chains in the Genus database with same CATH superfamily
1G3RA 1VYHA 1PUIA 1SXJD 4CM8A 1L4BA 8ICZA 3P7MA 3ZHYA 2VSNA 4RZHA 5CFNA 1KS2A 2GAFA 3UMVA 3L5OA 2ZJZA 5D4BA 4FMPA 3VOTA 3I39X 5F5XA 3T5JA 2A5JA 4BJQA 2E82A 1ZCZA 4V02A 1PT8A 3GLGB 4BP3A 4UUMA 2JIBA 2BP7A 3H8VA 5A5GA 4BBAA 3EOZA 2BCRA 1I6LA 1IUKA 2J48A 4RF2A 5E7IA 1XHFA 2VYQA 5EIAA 3N8IA 5AKIA 1KQOA 1DI0A 3IBYA 2IZ1A 1R12A 2CMDA 1GLNA 2CXTA 1FRFS 1E32A 3ME5A 2NU6B 2G40A 3F5EA 4OBEA 3U7GA 2G1KA 4R41A 5BWOA 2KHQA 3MUNA 4QGFA 2UUBB 4FEAA 2ZTCA 1U9LA 5LQKA 2NU7A 2HNAA 1IEXA 1PQPA 1M10A 4RM2A 1UOQA 1N9GB 4RJIA 3IUJA 5J43A 4FQ7A 4IMIB 4R0VA 2E5LB 1S8FA 9ICNA 4ZRNA 2VYNA 4JP3A 4UCWA 3TNYA 3HPQA 3B2QA 4HEJA 1ISHA 1DBWA 2BFDA 2O3UA 1NVWQ 2H7XA 4MKIA 2TMDA 4RM3A 3HKEB 1H2HA 2ONCA 3ZU4A 3SFTA 4CTNA 1KI8A 3ESAA 4CCHA 3CPSA 2IHUA 4R7GA 5JCJA 1MB9A 3KZIU 1CC1S 4F9FA 9ICXA 4KC0A 1YDEA 2XXJA 2CD9A 2AG1A 2XV1A 1SL0A 5EJ6A 3H19A 4IH9A 1KVSA 4RZIA 3RAJA 4FYXA 2LKDA 4R05A 1RYDA 4RQ8A 1LH0A 3LCVB 1ZQZA 5CX4A 2QJWA 2A92A 5I5EA 2XHEA 5BRNA 1L3CA 1KVQA 5TQ0A 3TZEA 3AM4A 4KLEA 3WIEA 3GRAA 3LMKA 2GXUA 3Q8PB 4PZLA 3ZIDA 3KAPA 2FFBA 5ISMA 2B2NA 3PFBA 5D49A 1BEUB 2QN9A 4PBSA 1N6HA 2W6IA 1TMOA 1EGVB 1LK0A 3EPJA 2JZBB 2R7AA 4BNDA 3QKRB 2Q2QA 4KZKA 1NRXA 1QR6A 3UMMA 1GG8A 2P5YA 3BXGA 5JYDA 2BOVA 2CBGA 1LRKA 3A1CA 4E94A 1F1JA 3EIWA 3N0VA 2OHGA 3QFSA 4IWYA 4C2TA 3T4EA 3MM4A 2XUPA 2UVVA 2FCAA 4IOKA 4G9BA 4DR4B 3HDJA 1TADA 3RVPA 3T7EA 2JJ8A 2ORYA 2J9FB 4N5HX 2F00A 2JIDA 3DE2X 4NLBA 5F7XA 1W94A 1JXAA 1TXGA 2GEBA 1RC1A 1W4BA 4XVHA 2FA9A 4ALMA 1FCJA 1UMCA 4BDTA 4W9NA 4GMDA 3TQHA 4JMLA 4B4DA 2B1QA 5ALMA 9ICMA 1M8JA 1VBFA 1GXSA 3S1LA 3EQ7A 1NHWA 4NJEB 4MFAA 4HH4A 1P7CA 4TLDA 1WWKA 3GJYA 1SUWA 2PL9A 4GOJA 2HJ9A 3ETEA 1B0UA 1P4JA 1NI4A 2YICA 4N8DA 1Z68A 1QPGA 2KVSA 2XTZA 3Q3GE 1CY4A 3CT4A 3KBOA 2GN2A 2RGWA 1NL3A 3LBIA 4O02B 1GEGA 3FZYA 4J16C 1L5VA 5EZYB 4ESVA 4QM6A 3MWDB 4LXIA 4E51A 2EP7A 4AM8A 1IULA 4ZZ1A 4X1KB 2DUUA 5BSFA 3WGJA 2BDTA 2Z8YA 4M0PA 1AKTA 3PIIA 2F2AB 2XZDA 4WK6A 1QB8A 3LUBA 1JE1A 5LJIA 4QUKA 3TBKA 1MRSA 3JQEA 4OQEA 2G8NA 4QIWC 1EVZA 4B9EA 1QZ3A 3T41A 3KDAA 3I9LA 5LLDA 1YF3A 3UC5A 4NHOA 4ARUA 3NHUA 1C3XA 2W55A 3I3OA 1ZZGA 1RS0A 4WLEA 4KQFA 2BR5A 1K1EA 3THYA 4XIIA 3DFUA 3NBAA 3EPLA 5BUSA 2Q62A 5KT5A 3OEWA 4IX9A 1UBJS 1S10A 4K9KA 5AWFC 2YXDA 3LSTA 2HOQA 2YUTA 4ZK2A 3FTFA 4JP5A 1QP7A 2N3ZA 4XTCS 4DILA 3KL4A 3KFUF 3PFKA 5CFMA 3A58B 3PC4A 5HDQA 1AMUA 4J6FA 3IKTA 2WM3A 2NNLD 1X9HA 2QB0A 4A0GA 2H54A 3S0JA 2QIPA 4PLFA 3UCEA 3H0RB 2VO1A 3M3PA 3P96A 4EZ6A 2CV0A 4E1BA 2RC5A 3O7WA 1IBMB 5IIKA 3KSDO 1ZIXA 3UT6A 3JAKB 3G9ZA 4GOMD 3GU3A 4C8LA 3PC8C 5B36A 3VNVA 1A9XA 3AUKA 4TVBA 4M88A 2WFMA 2FW0A 1Z17A 2VQ6A 5BT8A 4IJWA 5LQMA 2Z2YA 4URFA 3SVZA 4X8OA 1Y37A 3ZOKA 1UEJA 2AQ0A 2H08A 3LWMA 5FJJA 2JGKA 1NVKA 2P0YA 5KYYB 4DCUA 2E85A 3SQOA 4WINA 3NP7A 3I01M 1SCUA 3UAGA 4JJFA 2FKNA 2ZM6B 1X7XB 1RQPA 2D74A 4ZCSA 1R3DA 2A5LA 4P5PA 4E5PA 1N5JA 4Z4GA 3EZ2A 6AT1A 4WMLA 1X7ZA 1J0XO 1G5FA 2VTKA 3E27A 1KH1A 3HXPA 1CCWA 2LZ0A 4JVMA 1Q84A 5FTLA 2NADA 2V65A 1ML4A 4GH5A 4QBKA 3ZWVA 2N1RA 4B2PA 3BQMB 1QP4A 5FWYB 1XNGA 4QWMA 2WNSA 3C8HA 3I01A 4FR2A 3TINA 1X7HA 3KUXA 4RHEA 3UOGA 3K4QA 5FX2A 2X6RA 1UJBA 4QDJA 4AJ2A 2CLKB 2BR0A 4ZCPA 2D1FA 5AKLA 1T2NA 2IY8A 3ELYA 4YPFA 3L6RA 1YSCA 821PA 4YRRA 3ZJYA 2FN9A 3NO4A 4NL4H 3SK0A 1N78A 3N2ZB 2RI6A 4JVLA 4Q66C 4CMEC 2ZJOA 4BWFB 7ICKA 1E2GA 4BQPA 4I1PA 3PIRA 3NJ4A 4PZYA 3PO5A 4DKXA 5FOWA 3X1JA 3URMA 1RM3A 2B8TA 4FB4A 2HADA 2IELA 2JFFA 5DFAA 4U02A 1NU6A 3LVVA 4DBLC 3RFCA 4JB3A 4OY3A 2GXAA 3LHSA 3TJZA 1BE0A 3CRZA 4M86A 1CR4A 2ZB3A 2JL1A 2HF2A 4EG1A 1A4IA 2LDXA 2NXJA 2FPIA 2FEPA 1E3DA 3GGGA 3G0DA 3IJ5A 3LL7A 3DMGA 5KJEA 1VRCA 2HHHB 2F1IA 2IA6A 3QZ8A 7ICEA 2J6SA 1WWUA 1FTWA 1KJYA 1PJTA 5F9HA 4C0LA 4HADA 1DL5A 3PXCX 2GD6A 2J7PA 1MW8X 1CFJA 3RQIA 4D8XA 1I4EB 1NMZA 3HGMA 1N0VC 4DR6B 4Q0MA 4GI2A 4WHMA 4UB3A 3VV2A 5JPIA 1XDSA 5A9RA 2O4CA 5ERXA 2GXSA 1U0OC 1PNQA 3PHJA 4F5PA 1R15A 2IDJA 4EPWA 4YXWD 1CUFA 5KQGA 4YXMA 1ZGAA 2BQUA 1K88A 2OCLA 3W1VA 2RH8A 3PO4A 3HS3A 1E9AA 1SG6A 2QW8A 3CEPB 3D2CA 1DKPA 4C04A 2WSBA 5HP4A 5TGZA 1LZLA 4DMFA 1RTTA 4LRWA 3FX2A 2YJ3A 1RSZA 5EA2A 4HQFA 4S35A 1PKXA 3D6FA 3HV0A 4G0UA 4IAOA 1S2IA 2WYIA 4UUAA 1I51A 4JV5B 3TQTA 5C52B 1Z5OA 1XQ9A 4UB4A 4CIVA 1MO3A 3LIPA 3ABZA 4N7JA 2ZBDA 2BTOA 3KYDA 5GM2A 5B53A 4X62B 2CWWA 4ESHA 2OYYA 4CEIB 2VPZA 3BTOA 4ECWA 5P21A 2FZVA 4NMXB 1F9EA 5IAKA 4M60A 4A2CA 3A06A 2P3SA 1JH8A 2ZTDA 3M8RA 2GZMA 5E0KB 5EIXA 1SGGA 5CA1B 3B7GA 5BSKA 2KG5A 3H6HA 1DLIA 3IUQA 4MQ5A 3AMZA 5EIOA 3LQRA 5EJ4A 2QZZA 3BCSA 3AHJA 1Q7CA 4LXQA 3Q8SB 1KDVA 2F48A 4HAVA 1BVYF 3GK3A 1QOZA 3HA3A 4XDHA 2NMVA 4NARA 1V0JA 1U1DA 5JG7A 4QZIA 3SZRA 1J5XA 1IWOA 1BD4A 4MEBA 4N5LA 2V5VA 1I9CA 3LOUA 3MJFA 4C6TA 3CTPA 4LOHA 1FUUA 4GECA 3HL0A 4B6GA 2TMKA 4QU9A 2J3IA 1WKVA 2ODBA 5K20A 1LPAB 3GZNA 2AUTA 3ESDA 4L6IA 3N7TA 3TD9A 5AXCA 4WY5A 4Z3DA 4ZJPA 3JQFC 1K86A 2QQFA 5EZ5A 1Z37A 4NBLA 3HZOA 4D4IA 2VJNA 2KD1A 4B09A 1IZ9A 3V8PA 4LJLA 1GV1A 2DP4E 3DCJA 4IDPA 1IY0A 2J67A 3GVPA 1N5WA 3RFUA 4A92A 2I4TA 5LQNA 4FDVA 3LPNA 4N5DA 2HR1A 1XHEA 3VGPA 2BFEB 2QTRA 4UPDA 3H7AA 2BVNA 2ZJ6A 5IBRA 2DF8A 5TV2A 5KTMA 4CF5A 1RZUA 2YV4A 4FZLA 3KB8A 5HG0A 3ST7A 1H23A 3WKDA 5IIMA 4AURA 1UCFA 1P9NA 5LQCA 3PDIB 2Y1CA 4BO0A 5DI9A 3VR4A 4QGGA 3TRFA 3DW1X 2HGSA 4R64A 1B42A 1ZLYA 4F97A 4P7BA 1KFJB 1G3IA 2EJWA 1P7PA 5HRCA 3X1DA 4B48A 1JMVA 1WB4A 4GP7A 2CW5A 3BQTA 3OLYA 3QELB 4R9VA 4E2YA 1JI7A 4ZDIA 2Z7JA 2CDAA 1JPJA 1LEHA 2OQVA 3ZU5A 1P44A 1F0NA 3OZVA 4FYHA 4HNGA 1M2OB 4JB2A 4EJSA 3WDKA 1OX4B 5K03A 3TADA 5E2AA 4JBLA 2JKZA 2FWMX 4Y9UA 2J0UB 1FC0A 4URXR 4I55F 2V8OA 1E2JA 4HDQB 2QAGA 1WYGA 1DXSA 4GP6A 3KQVA 3DGEC 1PQUA 4F6RB 5TIIA 3W2HA 4HDKA 4FNMA 3RH4A 3T95A 4HYTA 1SIBE 3NGMA 3K8YA 4UARA 4UU7A 1XN4A 4D42A 5BSVA 1MX1A 4UB1A 5F33A 1QFXA 3HRHA 3ICQB 1A2KC 2CKDA 5ITZB 3P2IA 5FDFA 4EL0A 1KAQA 1PRYA 3A6FA 1UC5B 1TYCA 2Y6VA 2QL5A 3ILVA 4GMGA 4R7TA 5SY4A 3RU7A 1EAYA 1QU2A 9ICLA 221PA 4CMIB 3KEFA 2DTDA 1KNQA 4WN3A 1N5MA 2WUGA 4RVUA 3IQZA 3T7DA 1JDPA 1NYQA 1KARA 3K9FC 4PC3A 1W76A 1L8OA 5AKJA 4TVKA 4ZJYA 2FWJA 4U7DA 4D1YA 3OLCX 4I50B 4ZT6A 3VO2A 3QVMA 3M6VA 2IBSA 3E9EA 3IAUA 3A1DA 4IJ6A 2LHTA 4I8DA 1N6OA 4D92A 2HQ1A 1XD2B 3THXA 2BMDA 3OFSA 4JSYA 3B5EA 3T1QA 3FHCB 1GFWA 3THSA 2RP5A 1K89A 3KUKA 1Y6RA 1F14A 1DS6A 1VKNA 3SAGA 4UMDA 3Q9UA 1VIAA 8ABPA 1ZXXA 3M9OB 4JX9A 3ZX5A 3P0FA 2UYQA 2PO7A 1G0NA 1GZ5A 2FPWA 5AOBA 4IGAA 3D6HA 3QLUA 4MRSA 2Z6VA 2CXRA 3DF9A 3UMBA 1XXHB 4I5FA 1AQNA 3NTXA 2R6JA 3CQ9A 4QG3A 4TN5A 2X6QA 1EESA 4MF8A 2AG6A 5JI2E 3L4PA 4Q4DA 1E9VA 4CIDA 1MH9A 2ZUCA 4MV6A 4M9GA 3MG9A 4PXSA 5H9VA 1T2UA 1L5RA 2R0QC 5GADl 1ESMA 4UM9D 3SC6A 3MCTA 2DBQA 3ZHVA 4U00A 2W22A 3P9QA 1DUIA 1OWPA 1AKUA 3U9SA 5MGBA 4WXMA 1Z5PA 1SZDA 1AGNA 3N7UA 4FFBB 5TF0A 4A16A 2ZRJA 4CM9A 4F21A 4ICAA 4JQSA 3H1GA 1JU9A 1Z1VA 5EJ8A 2IITA 3W34A 3RUPA 1DKOA 3ZC3A 5BN5A 4Q1DA 5IAEA 4YIHA 1XL0A 2BFPA 4Q4AA 4IICA 3GUCA 2HTEA 2QMOA 3WNCA 4K9OA 4YMIA 3LF1A 5KVAA 2YWJA 1RWQA 3C3KA 5EJIA 3IT1A 5TC4A 1I0LA 4S1WA 5K0BA 1X77A 2OXCA 4JC5A 7ICIA 3WMRA 2GJ9A 2YV2A 4OREX 1X15A 4M1MA 2GBPA 3P20A 2QD2A 3O47A 2KI5A 1YRYE 2A1UB 5F3RA 3CKLA 4RQAA 3E1GA 4EG0A 3EX7C 5CPBA 2C8JA 1E2LA 3AEUB 5AKZA 1PZXA 3ND7A 4FYWA 1NURA 4TUQA 3C2KA 1E9EA 1ZM7A 2GN6A 5J4KA 3AU6A 4RF4A 5LL6P 3A70A 9ICIA 2G4CA 1TAGA 2GAJA 2OB2A 4BNKA 4BVGA 2BV3A 1T9ZA 2LPEA 4DZZA 3N5CA 3ANMA 2H2HA 3W5UA 4IIJB 3MB5A 2E8OA 2ZYTX 3EDCA 4J1TC 2VZEA 3DOHA 1DPFA 3FMGA 2EQ5A 4ELUA 4A0SA 3DKRA 1P9OA 1G8YA 4ND1A 1YT5A 2W2VA 3A25A 3S2EA 3KNZA 3UKOA 1R37A 2HHWA 3BIWA 3EEFA 5CB0A 4MV8A 4DABA 1YONA 1HNXB 3OLVA 4KPUA 2W6NA 4MQBA 5IYZB 4R1UA 3JZAA 5BR1A 1FVHA 4IMJB 2VYND 2RQ5A 4Y0AA 3RFAA 1DX9A 4PXAA 3RDPA 4MH0R 3OQIA 3AWIA 4NYMR 3HLKA 4A36A 1QCCA 2PZAA 3KE9A 2QMEA 2IWRA 5GIOE 2I2XB 4KK4A 2M0NA 3PPVA 3V97A 4B7ZA 4NCJA 5AOAA 2Q5FA 5JCJD 1XRMA 1VGVA 4KAAA 5HJ7A 1PDWA 3ZDYB 4HTAA 4K3UA 3NHPA 5CEEA 2ERYA 4WOJA 4QU5A 2BHTA 1KI1A 4MLPA 1L5WA 4KX3A 4NMMA 5MHTA 3K1ZA 4PZ0A 4ED1A 3OCZA 2PT5A 5LP6B 2HA0A 1EUYA 2PWZA 5EHNA 3ROGA 1BPZA 4P53A 2F8LA 2FW1A 4Z4QA 1AC5A 4XLLA 3URKA 1BNPA 1QZTA 5DBIA 1RIIA 1G3MA 5J2BA 3EWAA 5B12A 3PE6A 4GYWA 2E3JA 3D6MA 3CBQA 4ZGGA 2W6ID 3R4VA 2DE0X 1E92A 3KKEA 4CUJA 3O8BA 3HU2A 3COYA 5CRXA 1X9XA 5CRIA 1E3LA 3QXXA 3T0IA 3UHJA 1ZQFA 4KHPB 5EOVA 3GVHA 1J6UA 3KOMA 4GDFA 4GI7A 5LM3A 4RT3A 1MO2A 4C4ZA 2HD4A 2JANA 3WGHA 3NDRA 4CWAA 3WNBA 1M6VB 2VUTA 2G08A 2HZBA 2GBIA 1I1NA 1ZQQA 3JPWA 4MCAA 1WHTA 4U7WA 1IXRC 4EI7A 4CG2A 4JROA 1U2GC 3NH6A 1XZMA 2V97A 2B3DA 3H3XA 5JD4A 4QJFB 5LYJA 1SRRA 4HDNB 1QHHA 2SCUA 1Y4AE 3U17A 1RYUA 2YVLA 2BGJA 2QYSA 3PQFA 1JHVA 4L50A 3X44A 2IUYA 2ZRIA 3TM5A 4OGWA 3KYCB 1TTTA 5C9ZA 1NX6A 1SKQA 4BLQA 5T4FA 5I8ZA 4NBNA 4NHEA 5DNWA 3KQSA 2C5BA 3T5LA 4C3UA 4RPHA 4QO8A 1K6XA 4A3SA 2DWPA 2VZ8A 4JDUA 5I51A 5IUKC 2LYBA 3UAVA 3JQ9A 4XYBA 3DBHA 5U9CA 1JBKA 3NG1A 5F4BA 3MTDA 4F56A 5CYOA 2OO5C 1K4KA 4MW0A 5FO1A 5A3JA 1TLTA 1ZPDA 4KR9A 5B7GA 4TMTA 5AKYA 4B6SA 2KHZA 4BXOB 3CUEF 3K0FA 5SZHB 4IXWA 3SMVA 2B2XA 1FW8A 1FFVA 3F2DA 1RPNA 4XIJA 2VNSA 1Z83A 5FAKA 4TYPA 4BFVA 4G85A 1PL8A 2R65A 2EJBA 2X0RA 2AEEA 4GPEA 3U81A 5DM4A 2D2XA 1G6HA 4B3XA 1O6CA 2AUNA 3D54D 2ZATA 3WSVA 4RTQA 1FLAA 4F0JA 1XRRA 4K2HA 3U1BA 1G7CA 3DE4X 3IVXA 3SBXA 4R6WA 1S1MA 3BICA 4M9RA 1F8XA 5ADVA 1GRCA 2VJQA 4E88A 4I6GA 3N8HA 3GA0A 2QTGA 2W83A 1NK9A 4JR0A 1N0UA 4EPYA 4CG3A 1Q1BA 2PS3A 3ZHXA 2HQOA 1WVMA 2XGMA 4HY3A 3IBTA 5F1OA 2OQIA 1VYTA 4C5CA 1ZK4A 2PLAA 3L3BA 4ZYYA 2EC5A 4TTSA 4KTQA 3NTOA 2HHCA 4FW9A 5KHAA 1NQTA 4LNUA 1FQWA 3I92A 3WGQA 3AX6A 1J1ZA 3FCCA 1JFTA 4AF6A 3E5NA 3D3KA 3CSSA 2VCHA 4F5OA 2MDTA 2DU8A 3PJEA 1NOJA 4GC9A 3W5DA 1H6AA 4Y9TA 4YJ3F 1DK2A 4D9FA 3WWEA 2QZ9A 1T29A 5KFJA 1K0FA 2QLMA 1Z5VA 1NN0A 4ZTZB 4S1OA 4HP8A 4GOKA 2SICE 3AWDA 4MR9A 1U0JA 5KG3A 3BRWA 3V7FA 1Y6QA 3ZHSA 4RFSB 3WLAA 4JU9A 3H2ZA 1AKYA 4NBTA 4FK8A 1OIXA 2IMWP 3H5OA 1BGVA 3IDFA 4HWKA 3IE0A 1X80A 2IH4A 5JCOA 1U3UA 4GLFA 4CRXA 3WLPA 2FWBA 2ZT8A 4PCUA 2GCOB 4AKSA 1OY1A 5J2FA 1UBKS 2A9FA 3BVPA 4G41A 5KJCA 4FHCA 7ICHA 3CZ9A 4DCPA 1ZNWA 3K5PA 1IAVA 5IMSA 5K1ZA 3FE2A 3WB2A 3WV4A 5ENZA 1M74A 1GPWB 1ZGZA 3R8CA 4BCDA 3QWFA 3VU8A 4R8VA 5JADA 3WBKA 4CDRA 1S7GA 2B0JA 4TS9A 2XB8A 3B9JA 1N6RA 1KTVA 2LGJA 2NPIA 2X3FA 1B15A 2KOBA 1RYEA 2JJYA 4XGNA 4F4KA 4FHGA 2QUZA 4J4TA 3ZWQA 2XMZA 3I2GA 2X2OA 4QOHA 4OXIA 1S96A 4GD3Q 5AIAA 1SCDA 1ZOOA 1JG6A 3D7MA 2MWMA 4UUQA 4F92B 3JQ8B 3QJGA 4X65B 3LUGA 1OAOA 3N97B 2O0JA 3R6DA 5CJ2A 4DS4A 3ZLVA 1U9IC 4C7VA 1ISGA 3GB9A 2NZYA 2QAIA 4DKJA 3COPA 5HJEA 3W2EA 4UDNA 2JHFA 1QPBA 3PF9A 2H2FA 2ZKIA 4QREA 3TFOA 3M1AA 2X58A 3WYCA 1XAIA 2J32A 1YVEI 1WCNA 1LQUA 4MR7B 2AFIA 4O4HF 1LKYB 1SXGA 2ZYVX 1TYBE 4OCZA 3LZDA 3NAGA 1CU1A 3DHNA 4WBNB 5FUQA 1II8B 4B5KA 3TAQA 5CB4B 4MVJI 2C42A 2GARA 1XHLA 1EDZA 3I64A 1CSEE 3IDAA 3WRVA 4A8PA 4M53A 1NBEA 4RZQA 3T7JA 3I6ZA 3I5AA 3RHTA 3NT4A 4C87A 1J4AA 4YP6A 5D3QA 4NXMB 7ADHA 1OH7A 4URUR 4U39A 1YOVA 5IDVA 3UATA 1FFXB 4IV8A 2R1UA 3PX6A 1NHGA 2NV3A 3MWLA 5J0PA 4EYOA 1QQTA 1XCPA 3DFFA 1BDIA 1IG3A 2WINI 5E4FA 1XZAA 1X7WA 3CG0A 3VH3A 3N0WA 4IS3A 4B83A 3TECE 1AO0A 1FXWA 3RU2A 4WOKA 2FPGB 4F3NA 3MTIA 5IXSA 2JIPA 1II9A 3EDQA 2IVFA 1YR7A 1E7QA 8ICTA 2RH4A 4IVRA 2KP7A 3B1ZA 4BGDA 2J7PD 3A1UA 3FC4A 4R16A 1A82A 5B1HA 3UW1A 1ZW6A 2H2IA 3NV7A 3LLSA 2K8AA 4EYEA 1SBZA 3QE4A 4DIKA 2LKCA 1JKMA 2XCTB 1N3YA 2C00A 2Y0DA 1ZQDA 1B74A 4UD2A 5KS2A 2MT9A 3MRVA 3RAFC 4RLSA 1U1IA 3TTSA 2C9MA 1R0RE 2CNLA 4C6SA 2HT6A 2CFIA 1OTYA 3DOEA 3HEBA 2JFQA 4FBTA 1KF0A 4G6ZA 1XDGA 2F1OA 2J0SA 3LKDA 1JAZA 4MS3A 3WGYA 2OORA 5E2IA 1CHNA 5J2GA 3W2TA 3C1YA 5LZ9A 1M34B 3RRYA 2JI7A 3AEVA 3GW8A 1S3IA 4BKQA 1T8YA 3PDCA 2H7YA 1DARA 3MELA 3HP4A 2B34A 4XTRA 1W96A 4CNBA 2I78A 4NM2A 3MWKA 4D74A 3HI4A 2HA2A 3LVRE 4FYVA 4B79A 4YLEA 2FMIA 1DFIA 2I2FA 3GRYA 2YVAA 1AKNA 3RU9A 1Z36A 3UK0A 5CA0B 3CLSC 1PSDA 1C7EA 2RONA 1C3JA 3KSUA 3Q3CA 4WN9B 1CUWA 3W7VA 2D7CA 3UK6A 3IOYA 4UBNA 1V38A 3S40A 2F4VB 5FP0A 2E6KA 3E0QA 1VMDA 1D8YA 1HT3A 2LDBA 3DHEA 4X3CA 1KK2A 3LPAA 2A1TS 2G06A 1HDXA 2ALJA 2UVUA 4MWZA 5JSYA 2AFIE 2XDAA 3QK7A 4N0MA 5JZ9A 1G21B 4MNTA 5J0SA 2I2CA 1DX4A 2XZOA 2ONKA 2Q0SA 4RD1A 4BB0A 4P6VF 4WDQA 5BPHA 3I6MA 1JU3A 2L82A 1OD6A 4RIGA 2R7KA 4CCYA 3R6GA 1Y4ZA 4GWLA 1S9HA 2H5JA 4DDVA 1RWNA 2PD4A 4ZIRA 3FMVA 4PSKA 4C0KA 2H16A 3UXNA 3U48A 2PU5A 1JZQA 2W43A 1K06A 1AUPA 3FF1A 2D4AA 1RHJA 4TGLA 3C6XA 2RSLA 5CR0A 4DEXA 2D1RA 1MAWA 3PXAA 2ZCUA 1EAMA 1X87A 4FHZA 4YJ2F 3GEEA 3CGWA 5ITSA 2KW5A 1LNSA 1M76A 2G5TA 5CJPA 2XMCA 5IN5A 3HO8A 4LY6A 4OK6A 1L4KA 4YJHB 5EZ6B 4H1WA 3FZQA 1W5FA 1AZSC 2C2MA 1W48A 1SC1A 4H18A 1HDGO 4KDCA 3T1YB 3WGMA 2TMYA 4UEQA 4CR6A 4F6LA 3V3KA 4BO8A 1TAUA 1MGPA 1AA6A 3VR4D 1LJ8A 1VFPA 2NXWA 1DJQA 4XSVA 4YREA 5EC8A 4U0KA 3H5LA 4F85A 4ZFNA 1XSNA 3WLJA 3PJDA 3HFSA 2WAMA 2A0XA 2HXGA 4KWIA 2FWAA 5IJ9A 1T5LA 3RNOA 1D2EA 3PGVA 2HLPA 4S24A 3UJDA 1RPAA 3QYPA 3SPXA 5IT4A 2W93A 3X1YA 1JROA 3A1TA 4JK1A 1TU3A 5B5SA 1IN4A 1XJCA 3A4VA 5AXBA 3MJEA 3T52A 5TMBA 1W36B 4EGCB 2CGEA 5E1DA 5KX5A 2DKZA 3AVYA 4HVAA 1ZBDA 2H92A 3GV5B 2W90A 5ALLA 2PZ8A 1L0BA 4BS9A 3SAFA 1ODSA 1PR6A 2PA0A 4XD7A 3AR8A 1BKSB 1XTKA 4F9TA 1YUBA 2ZPTX 5B37A 1K3TA 3E15A 4L3WA 1Z4KA 3K70D 4K8RB 9LDTA 4YVZA 2NV6A 4EFNA 2IW3A 5LBUA 1CUIA 4OLJA 3PPXA 3V6KA 2PGNA 3I83A 2H7VA 4X95A 2BMVA 4QUBA 1SU7A 5HF9A 4C8NA 4PRZA 2V54A 3S5UA 1UT6A 2R44A 1O6FA 2EDUA 1JKXA 4PQFA 3A26A 2BFBA 2E4VA 1N92A 2O50A 4QDKA 2FE1A 5KFXA 4HYQA 1FYDA 1C2TA 1RXCA 4RSMA 1TM5E 1R74A 3AIIA 3B9BA 3QE3A 1RJWA 3RWMB 2K8BB 3H1PA 1G6OA 2VP0A 5JSZA 4XWWA 3SAHA 1KI7A 1Z1BA 1OLXB 5IZCA 2M6RA 2HJHA 3FYUA 1TJPB 3I6YA 4L0MA 4Y1GA 1XA3A 3PK0A 2VNKA 4RPKA 3VKFA 4CJXA 4MRNA 2NTYC 1KH2A 1TAHA 2KB0A 4N54A 2WYWA 5BO5A 4TOIA 2F8SA 1POWA 3KD2A 4OBWA 1DIRA 5KSZA 4ZRDA 5DE3A 1SHLA 4G1VA 2CB0A 3NB0A 2ZRNA 4J9LA 4U7FA 2NU9B 1DKQA 5KT3A 5E8RA 3OT5A 121PA 2FEAA 1P1IA 1CEXA 2PS0A 1DC3A 5TDHA 1QV6A 1Z4NA 2ASVA 1K0UA 2JAHA 3VR3A 5KTOA 2OPBA 3FR7A 1TTHA 2I8AA 2CVQA 5IN4A 5HW0A 4UBLA 1SM4A 4B6JA 5MN5A 3A04A 2ZWMA 1A7JA 4FGWA 1J8DA 4YRFA 4ARZB 3K0SA 4BX9C 1TJ4A 1ZIDA 3L2OB 3F7OA 4C4PA 5K0CA 5KT4A 1R8YA 2DHEA 2K89A 1X13A 1Y5LA 4YMMA 3CYFA 4CM9D 4DQIA 4OFZA 4R2KA 3T5CA 1SVMA 3WHIA 5I9LA 1TMKA 3C14C 5DYWA 5H02A 1F2UA 3ZD7A 3GEIA 3ZD6A 2ZRMA 4RSRA 1Z63A 3VZQA 2P9TA 2E3TA 1W4CA 2RH5A 1GZ4A 2X9VA 5F2OA 5JW6A 3FTDA 4L07A 2EYQA 3BZUA 4BECA 2YWDA 3BH7A 5KYUA 1YRAA 3TB4A 4AY6A 2F3PA 2Z4SA 4NDAA 2IHZA 5HIJA 2P9BA 4KMMA 2NUAA 2QJRA 3OC6A 2DCUA 4NAUA 3TE7A 1G3QA 3A9RA 3G89A 1ZJNA 5A4MS 4BP1A 3KD3A 4YT5A 4IRKA 5JMPA 2I1LA 3HO1A 3ZUGA 1PW7A 3L8MA 4PHPA 1G7SA 2DBRA 2QP4A 2JHDA 4TUYA 2R47A 2YS6A 2SNIE 4F5ZA 3TSYA 5CT8A 3HDGA 1JB9A 2A59A 1N4DA 5JAUA 2CL0X 3MMNA 1Q1EA 3T5TA 3AVUA 2PD6A 4Z0HO 3TMYA 3B3GA 2V6GA 3R6WA 8ATCA 1VLBA 4KHZA 1V7CA 2NUPA 4D8UA 2OCEA 3SHQA 4YASA 1PTKA 4KDFA 2C9BA 1HE5A 4FONA 4YRJA 4GYYA 1B0AA 2QV0A 2HHLA 5KO2A 3HYLA 3K6SB 4QECA 3DOJA 3LK9A 4YCJA 2GUGA 1YZFA 2CNBA 1N7GA 3W04A 5JS6A 4LE0A 2PFPA 1R4MA 2FJPA 4RVDA 3MFIA 4ZI7F 3T9EA 4ZWNA 3JARB 3LXXA 2E4UA 3JQBC 5FWNA 3BGOS 3EZNA 1NJWA 3FKJA 1E3WA 1P74A 1O96A 1Z5UA 3MGCA 4JKYA 2X3YA 3K75D 1ZR4A 1UKBA 2BDPA 4OQYA 5E9QA 1EG7A 4AKTA 3U4CA 3OCJA 3EAFA 1U81A 4ASUA 3GFSA 2ILTA 2DPMA 1V7PC 2Z8YM 4HGPA 3OPVA 4J9RA 2WSLA 1GY8A 3ILYA 3UMSA 4OAQA 1ESEA 3O03A 4YCSA 3BQ7A 3CUKA 3CX6A 4M1EA 1Z39A 2WT9A 5HZGA 3N7RC 4ZHQF 5JZOA 4DWWA 3GUZA 1EHIA 3EVDA 4MARA 5D2CA 4QWWA 1S1CA 1GL7A 4CLOB 2HAEA 1G8KA 3SYRA 3L8YA 1CJUC 4J0JA 4IHJA 3EJ6A 4JOSA 1QYIA 4O4IB 4ND8A 5D46A 1N3BA 1BJRE 2R7MA 4PGQA 1YV9A 3GT0A 1YDFA 1JRPA 4B32A 1Y4SA 1J21A 5BSRA 4OK3A 1EB8A 4B6RA 2X14A 4TRNA 4J0HA 1E64A 3K2BA 1NN3A 2C9CA 4G4JA 5TLSA 2EGGA 5EXTA 4Q05A 4WFIA 4O29A 4EG3A 4NFSA 5EMLA 2JLCA 3DS8A 4QYMA 3VU9A 2FPSA 4BUGA 1ZH4A 2YHBA 4CIWA 3AJ8A 3AERA 2WUDA 1HYHA 2AW5A 2Y93A 3PHCA 2JPDA 3VR5A 1ZQKA 4PGYA 3OFVA 2H0RA 1PUJA 3VU1A 4ILEA 1ULHA 2DHQA 4FIDA 2G9UA 5JS1A 4EATA 2JIMA 5CAEA 4A8JA 3PUJA 1PJ4A 4HX9A 4Y1FA 3SG0A 4MYUA 2HMWA 2RDJA 1FJ2A 1PLLA 5A2QA 2ODQA 5HJ5A 4MW7A 1G5RA 4OQLA 1W19A 2OCAA 1U4SA 3PLAE 5BMVB 5HHHA 5AW9A 4EYIB 3NYIA 3NOOA 1P5RA 5GJWC 4CMJA 5JQWA 4PXYA 3A9TA 2DUMA 4LZNA 4PSDA 4DG8A 4F60A 1ZY2A 3AP1A 1NTOA 1KEEA 5KWVA 5BV7A 1XMPA 2OP1A 1V11B 3H17A 1XAHA 1PCXA 2VXOA 4G5HA 4I2CA 2BJWA 2BPOA 3MJCA 5REQB 3Q8KA 2CMHA 2IL1A 2VJ5A 2BMJA 3OE7A 3ZWOA 5LYYA 4LF9B 2I34A 3D4OA 1S4MA 5EVJA 2OFWA 3EY4A 1M2EA 2R11A 3UJ9A 1PDOA 1Z4LA 4LCJA 2PUCA 4UQOA 4FSXA 5K0GA 3OLQA 3RKRA 3VPHA 5KJ1A 1F2TA 4R2WA 4OQ4A 4QGAA 4OHVA 1N1DA 4TQGA 2O48X 4HB2A 8ICMA 4D9KA 9ICTA 1XCBA 4NYIR 1QFSA 4EX6A 3EXIB 4QA9A 3JSXA 1H42A 1HX7A 1THZA 3DLIA 5HOQA 3HCDA 5KDOA 3OVMA 2XYQA 3VAZA 2WZCA 4ZU6X 4YMHA 1CLEA 2CCGA 1ADJA 1T6BY 4LISA 3PSAA 1PHPA 2IFTA 3Q2OA 3T7TA 2ZIXB 1CYDA 2QMQA 1PR5A 4FCVA 2VLBA 3L93A 2NV2B 1NUQA 4OJYA 3VSCA 1RHMA 2C07A 4JCCA 4ES6A 3DO8A 1A1VA 4JBGA 1X66A 2JRCA 2WFZA 3B7WA 5HTKA 1AQJA 3ONDA 4QWBA 4WL0A 2PFQA 1IM4A 3N6XA 4LRTB 4RF3A 2ZQZA 4WJLA 5CR9A 1N5RA 1TKRA 1DOQA 1ISJA 3N2EA 2V58A 1TQDA 4ZTUB 4IC9A 2XJ4A 3STVA 2C28A 4Y6RA 4K1LA 4MS1A 4PG8A 2ZFUA 3RIHA 5SICE 1COWA 4P4OA 5A1JA 2DG2A 3DAPA 3RC9A 3LP6A 3CE6A 3WK4A 1G8GA 4G0PA 1VPEA 4D44A 4MW5A 4IKPA 2B8EA 2OBFA 4YG2A 4S04A 3GG9A 1TI7A 4PNEA 5JXHA 3PENA 3BD7A 3KB1A 3HJUA 3AP3A 2IUSA 1A7AA 2GZ3A 3QEKA 5KT7A 3O1JC 2P69A 3MFYA 5A5DA 2AG8A 2C2RA 3FPSA 1AS2A 3LPCA 3G5AA 4ZV7A 1GTJ1 4WAUA 1DG3A 5AJTA 1L7VC 2GD2A 2JGDA 4MYRA 3IEKA 5KT6A 5CITA 2QN6A 1FFGA 3DAFA 2AI2A 1CUJA 1XBTA 2NNWB 4IIVA 3P9ZA 2ZUWA 2XUIA 1ONBA 4LXUA 1D8TA 4GM1A 1GN8A 2MU2A 4J29A 1SPBS 2G9QA 1WMFA 3NVVA 1PFWA 1DBSA 2FG5A 2DTXA 4WNAB 1F6WA 2X2PA 1ESCA 2ABWA 2MMCA 1SH7A 4I1SA 1XSPA 4MUNA 2JDIA 4KTVE 3D5TA 1DO8A 3OSZA 5CCBA 4AS2A 4DSLA 4TV8B 1IJEA 1JFLA 2P2YA 2VJKA 2DL0A 4MWBA 1KYVA 4YRKA 3UWSA 3OQMA 2C2YA 3G8AA 3CCFA 5J9FA 3F9RA 4ACBA 3AFNA 1TAQA 5FWAA 5D1HA 3VR6A 3SM9A 2V4RA 3ZCRA 2O9JA 2QRUA 3U60B 1ZRSA 2G36A 5I47A 3EGXB 4MDYA 3QFFA 4Q5IA 1N56A 5L1KA 2EKLA 2IY7A 3SZGA 1QDUA 2OV8A 3GLVA 2XE6A 4IXNA 2I8CA 2PUHA 3GHYA 4G1BA 4P84A 5JRTA 2QU7A 4DJEC 4G3XA 3C5WP 3HKBB 4WXHA 3A31A 2ZITA 2HMUA 1KXJA 4JL6A 5B3LA 4QDZA 2KJ8A 5CLQA 1AMOA 3JVIA 4WACA 1M6WA 3PE3A 4MKGA 4RL4A 1G60A 2QRPA 3KYBA 5AUPB 4V3BA 5J2TB 3OICA 2YZ7A 2BUAA 2P4QA 3G2QA 1JXEA 3VC7A 5CLGA 2ASLA 2DR3A 4IH4A 4E4RA 1EFVB 5IF9A 5KNCD 1VL0A 3DEEA 1DWUA 1YI1A 4QZ9A 4BO2A 8ICVA 9ICVA 4RPZA 3FPGA 1TGYA 2Z1DA 2Y4OA 3K8ZA 4Q1AA 2JRLA 4RV4A 4US9A 1JDTA 5AJUA 5L6MB 2OV4A 4CF7A 4J3FA 1N25A 2P3OA 3O31A 2YBDA 3PQ8A 2JJ2D 1KW4A 5HK9A 2X40A 5J59A 4KDEA 3PQDA 4CIYA 1VKOA 3MUFA 1EXNA 4U6NA 1UR5A 3L8HA 3FDZA 3JZMA 2W6JA 4KLAA 4MW9A 3OX1A 1WD7A 4OUDA 1VLLA 5DWDA 2YDYA 2Z8ZA 4Y9SA 1JIHA 5IW8A 1VL2A 1GQFA 1YQEA 3ZDEA 3ZWKA 4PLWA 5B6PA 3OH8A 2BLNA 1Y88A 3NBQA 4TZKA 4IH1A 3AVTA 3MSCA 2D5AA 3OBIA 4C1NA 2VNIA 3SS7X 5F2NA 3GT3A 3T1OA 4ML3A 2HSJA 2I5HA 1US8B 2V7PA 4PQYA 4DDWA 4YPVA 5EWEA 3IQXA 2PKCA 2W8BB 4FFPA 3ZYCA 2R48A 3E7PA 3P8ZA 2NVUA 2PR2A 3DZGA 2J4DA 4ZXFA 5D3MA 1Z18A 3MJTA 2FN4A 3GIKA 2QUHA 4MI3A 4V39A 2FR1A 1B0ZA 3ANYB 3QKUA 1ZICA 1RLOA 1KEUA 1E5QA 5K8JB 3IRUA 3J81k 5LJLA 1ZQSA 3C41J 3NUQA 9ICPA 3KSRA 4EH1A 2ZJFA 2QYOA 3N6RA 4UE2A 3OHPA 2JI6A 3GL9A 1BMFA 2Z4RA 1QANA 4Z6DA 2HWKA 2Y99A 4DW8A 1W4LA 3RS9A 1MJNA 1TK5A 4I4CA 1N60A 3INGA 3CRVA 4JI6B 1YK0A 3E35A 1GVHA 3P45A 4PSCA 1KR2A 3ZV6A 1SC4A 3M4ZA 3VNUA 3MRTA 4JLKA 1CR0A 2J6BA 3W5IA 4O2AF 4JLWA 5J2CA 4TSRA 5BWNA 4AYWA 2NVWA 4KMUA 5JWHA 4C4RA 5C4GB 4UHFA 1S2NA 2DQ4A 2I66A 4KQEA 3U4AA 2VSOA 2YFQA 2DLNA 5HCIA 3K71B 1IEVA 4A1OA 1RJGA 1KAHA 2K87A 2JFHA 3D4PA 3ZWPA 4BO9A 4PHHA 2JZCA 4BNMA 2ZR9A 2ECOA 3LY8A 2EERA 2G09A 3MRSA 1U8YA 4UMFA 5JY1A 2HU8A 3U4QB 4BCBA 2ZYWX 1BHJA 1MC8A 2CXQA 2A0UA 1H38A 2G63A 3TLZA 2I6TA 3NEYA 1G8JA 3ET5A 1HH4A 1WCIA 4BL5A 1GZHB 2P3LA 3AXTA 1R9JA 2V7GA 2M2IA 3B6JA 5DCLA 4BU0A 2ZVQX 4JT2A 5D8DA 4ECEA 5FUWA 3EMVA 1P81A 1K9SA 2V0CA 3DXXA 1E4VA 1Z88A 2BJHA 4V0QA 3MABA 4HNRA 2IS1A 3T61A 5L7YA 4F4IA 5FEUA 3MW8A 3G2JA 4Y2VA 2XCOA 3Q40A 1NK6A 4BWMA 2K6GA 1DCFA 3QUAA 2Z58A 3IA2A 3TZQA 1F6DA 4PC6A 1BX0A 3BMCB 2Y0CA 2X5NA 3I1JA 3QG1A 3KYIB 3H86A 3K9GA 4CETA 2WE7A 2Y0BA 3FKSA 4TL6A 2YQ5A 1D1SA 2WJPA 3Q7SA 2ATIA 2CLMB 4II7A 4WKOA 1MQ3A 1BCRB 2Q1TA 1B0XA 4DBVO 5K0LA 1TYEB 4NZPA 4B5LA 5J58A 2QVCA 4HUQB 4OO3A 5JAPA 3VR1A 1YB4A 1CNFA 1NONA 4U7JA 3GFBA 4XD7D 4CEHA 1JEJA 2J85A 1GCUA 4R1OA 3ZQUA 4PQGA 5LQJA 2D1YA 2REXB 4BN0A 2F3QA 1A4UA 1OFUA 3LSYA 3RM3A 3NDBB 1XAGA 4Y1EA 5EMMA 3O8NA 1PWEA 3IEPA 5IULC 4AO6A 4F4UA 1OFHA 3Q0EA 1TK2A 3HCPA 4M0UA 1H2XA 1FYFA 2RH9B 3SC4A 5AHWA 5DV9A 4K3VA 1L4UA 5KSYA 1YC2A 3IKLA 1JDJA 1QQ6A 1LUAA 3N2YA 4GLXA 4D3ZA 2QMHA 3I05A 3DPSA 2HK6A 3L7LA 4U9UA 4O2LA 4ARIA 3X1WA 2IEBA 4IM7A 1JHUA 3LHFA 1B8PA 4YXFA 1NQUA 1XYVA 3L8ZA 3CUUA 3UWMA 4O8ZA 2P4UA 5DT9A 2NRXA 4MRMA 5KU7A 1XXLA 3BEDA 1WJGA 3CNOA 2XCRB 4ONEA 4WFJA 1J7KA 4BJ6A 3C5CA 1O5OA 1PEDA 1NE2A 1GFSA 4M0MA 1DLJA 1UOOA 1ULBA 2YHIB 3Q11A 1AB5A 1K7SN 2UYCA 3RYIB 2P67A 2PU7A 4YACA 4ZQEA 3VR3D 4NOKA 4YT8A 3JQ6A 3KJGA 4G1EB 4J90A 1H1LA 4BQEA 3W6ZA 5KBYA 2G28A 3PV8A 4FU0A 2E4WA 1JBQA 1VECA 1WB9A 3X1MA 3R9IA 3FGZA 1UBGA 3DSRA 1RTKA 5TQ2A 3VTAA 4CV1A 5B57C 4BQFA 4KREA 4UDXX 3RYCA 2G25A 1UMDA 4L6CA 4A4DA 4W6QA 4BYMA 1PYGA 5FTKA 1R0KA 1XZPA 3OJCA 4A2WA 2VA3A 3O83A 5HIKA 1HG0A 1JLLB 4QBIA 2A9VA 1FS6A 4L72A 2AX4A 1R5JA 4GKKB 5DLGA 1ZA2A 3L7IA 4D4KA 1CF2O 3JRXA 4N6GA 1S0MA 1VBNA 2Y1FA 4DOAA 1OXVA 1HT2E 2JVKA 4DPKA 2JJ1A 3X3HA 4QNLA 2ODWA 2XUFA 2XY5A 3RBZA 1HFJA 3G3EA 3RREA 2WC1A 4AJEA 3DJFA 1NOKA 2WT8A 3S81A 3UIEA 1Z5NA 1XMIA 3GAFA 3OF5A 3TGLA 1E89A 4EO4A 1VE5A 2AKEA 4QQNA 3D8UA 4JX8A 4D9BA 4KIJA 4PC7A 5K3FA 2NZXA 1FSSA 2UVPB 1MLDA 4UEWA 1QCZA 5JZBA 1N2BA 4L4YA 3SM3A 3PITA 3UK1A 4C76A 3GO4A 1WQ4A 1NW4A 13PKA 4DAEA 1R0XA 3TNFA 1QIJA 5IFKA 2J5XA 4WZBB 5C8YF 2NU8A 3OZWA 5DYTA 3ESXA 4BZQA 4BYGA 5AM4A 2Z56A 1H65A 4OFBA 5KIAA 3OPYI 4DL4A 1HA3A 1T5TA 2WRZA 4N0EA 3I6BA 5HR5A 3S7ZA 4B7CA 4WIAA 1Y8QA 3ZI4A 4HYYA 2OT3B 3K92A 3VPBA 2WIBA 1MVNA 3M6WA 1ABFA 4EB6A 4HNQA 4R1LA 3VOBA 3AF5A 3VSDA 3DP7A 4JKOA 2GN8A 4AF8A 4F11A 3ABSB 2Q8NA 4NL9A 1QIGA 3A9VA 3UYLA 4NEQA 5K3AA 4NBWA 1BN6A 1G98A 4MLZA 4OXQA 2QG6A 5T7BA 5HR6A 2BT4A 2CYCA 1IE3A 5DM70 3GFVA 5ESWA 5GGXA 2C78A 4PGMA 5LLTA 3A2MA 1W59A 4UAGA 5B58T 2IPOA 2NXNA 3EVFA 2WU0A 5EI5A 4Q4HA 4MAAA 1VB5A 4FZJA 4PTLA 3DE5X 3DDCA 3RCBA 4TMKA 4W7SA 5AW8A 4RQ0A 4KEAA 3E81A 1E9DA 2JIQA 4MVJH 1XDZA 2NVOA 1M2NA 4NQRA 5DBAA 5AW3A 1Y89A 2IGTA 1VMIA 5HF5A 2VH1A 4ASUD 2AG5A 4HAXA 5U1PA 3NWOA 3TE6A 5ILQA 3OT4A 4K9QA 2XUJA 3TOVA 4QPPA 3VI4B 3LKBA 1GZDA 5TRTA 1TW2A 2O5VA 3HBMA 1G55A 5G40A 1NR5A 3REOA 4EFKA 2FPRA 2VF8A 3BUSA 4QBFA 1EWYA 2EJTA 4PYLA 1UJ2A 3DMTA 1X9MA 1UEIA 3H97A 2OHXA 1BWSA 1JWAB 3EXHA 4EM6A 3IS3A 3AYZB 5P8WA 1IEWA 3RARA 1UMBB 1N8KA 3AEKA 1OX5A 5DLQC 4LA4A 4JR1A 1J20A 1AQ6A 4BEWA 5HMLA 2IP2A 1JDBB 4RKRA 5KFCA 1MTZA 4K9PA 2E49A 5CNIA 5KNBH 2VK8A 4PHFA 1D1PA 1GQYA 5CT6A 4JWTA 1QUFA 3M9LA 2Y1DA 4P0QA 1E2NA 3ZZ1A 1M2FA 1CQIB 1H69A 5AW7A 3U44B 5EJFA 2Y8EA 4J0EA 4JA0A 3VR5D 1TW3A 4RTOA 1OROA 3DDSA 3PHBE 1B8OA 1HY3A 1OYWA 3KPWA 2AJQA 4RULA 3TARA 4U3JB 4EABA 3DTVA 3MQFA 2PXHA 1P6XA 1XJ5A 3CO0S 3K16A 1H1DA 2E1PA 1E2HA 3H6KA 3ITDA 1C4KA 2A5GA 5GMOA 3FFTA 1GO2A 3MNFA 1YR9A 4AYXA 1UFRA 2CHFA 2RI1A 4WOBA 2I22A 2IXDA 1KDRA 4RVFA 5ICFA 4TMWA 3C3CA 4NZMA 3I42A 4PYKA 3BAFA 2ZZMA 2NTEA 4MV5A 1ENPA 4RADA 3MMSA 4DVJA 4X63A 2P2CA 5ALEA 5CEFA 4EMUA 3WMFA 2I29A 621PA 1KJWA 3ZY2A 4MQ4A 1DBPA 2GN0A 3PVXA 1N3IA 3OE7D 2VLIA 4JELA 1I1HA 4FMDB 3RBXA 5E79U 2NO0A 3VVMA 4TKVB 1X3LA 1BMTA 2Y6UA 2ASJA 3W6OA 3GJXC 4JYMA 2JBWA 1JFRA 1KMNA 3DFIA 3T9DA 2YRWA 2HCFA 3FCSB 3S1AA 3JWJA 4LXXA 4U2DA 1M7GA 4RETA 3IURA 4I1RA 1NBOA 4NV3A 5BW5A 5L9AA 2X0EA 1U3VA 2CUNA 2QW0X 4B3IA 4H0FA 2Q5LA 1CS0A 2LXNA 4JSTA 3WIOA 5CDHA 5SZJA 3HX0A 3E8SA 3FTQA 3TH5A 2JGFA 2GLEA 2V7WA 5I9NA 4KV9A 1QMPA 1LSOA 3ZNNA 4ZO8A 1JIXA 2X0NA 3P97A 5HZKA 3TSCA 2RBKA 1RLUA 5HYVA 5CA7A 5F35A 3FZNA 4CRWB 2VA9A 1R9GA 4ZOCA 4OLFA 4XW2A 2IRWA 2MYNA 1HRKA 1M8KA 1GNSA 3DAYA 5ALNA 4ECSA 4CKXA 2BRUA 5CFPA 1ZQ9A 3WISA 4OAOA 1ZM4A 2OO7A 1DBRA 2TS1A 4R8SA 4YAJA 3KZ1E 5IIOA 3OCUA 5AMXA 5AVVA 1COWD 5FTWA 2VZ0A 4GRIA 2D5BA 1M0SA 4P3NA 1NM5C 1UJ4A 1ACLA 5L8VA 4JUCA 1O94A 5PNTA 4ELVA 1XCGB 3GN1A 1QGUB 5KYKA 4XZ3A 4DCSA 2O20A 2KMLA 2QBYB 2P2SA 3GH3A 3S7TA 2I2BA 2O0LA 1A9YA 2N0SA 5BNTA 3DO6A 2CHEA 5IVKA 2ISOA 2H85A 3VKHA 2AXQA 2G17A 1C9EA 4AB1A 1XMQB 3QNMA 1L4YA 3KSAC 3L05A 4MVJP 2Q1WA 2LBPA 4YBRA 3KCNA 2DBZA 3NUZA 4Z7OB 4J75A 4GPD1 4ENRA 1L2TA 5DGCA 1WZCA 1O1YA 4XX0A 4ENQA 3TTWA 4BFYA 1T26A 4N5IX 1T9AA 2J9XB 5G5HA 5G5GA 2XEXA 1ZGCA 4YXJA 3PFWO 5K3EA 1ESDA 5BN3B 1XDBA 1A7KA 4MHVA 3PDJA 4GZLA 3GMDA 2YKGA 3SF0A 2XBUA 1WTCA 3I0NA 4DF3A 3LBYA 1WPXA 5CYGA 1JDSA 1VLHA 3ZI0A 1XZNA 3OCYA 3MYRA 1DO0A 4JDPA 3HCNA 3PC2A 1T1JA 4DARA 3Q9SA 3A3YA 3IRVA 1RVV1 3HABA 1L1RA 2OB1A 4EECA 3HQ4O 3SXUA 4XWGA 2EEPA 3A9CA 5KG1A 5ALRA 4GOND 3VPXA 4G1MB 2ORVA 1GNVA 3IAS1 1GNPA 5BQ3A 4WK0B 2FWNA 1TGVA 2OGUA 3SYMA 3SYTA 3J81j 3FPFA 4LNAA 1VG9B 2BGIA 4K4GA 4HLUC 3RRZA 4RPXA 3WL3A 4ZEMA 4HK4A 3H4DA 4ISBA 2O0HA 5KYWB 1HQDA 1K97A 3T99A 4IFEA 1UHUA 3FRHA 1I94B 4Y1RA 3EA0A 1E0SA 4G67A 2C82A 3CRMA 2BEWB 2OVBA 3UKDA 4NS1A 4UKDA 2ST1A 1FSPA 1QO9A 1TKAA 4M7RA 1KDPA 4OIFA 2A78A 1QGED 4B84A 4O2BA 1GKUB 3KUCA 3NBUA 3IKMB 4RD6A 1OV6A 1ZVQA 4KO2S 4DWJA 3GUHA 4C1BA 4U2KA 4Z53A 3OPYB 3GAAA 2OAQ1 1YCGA 4MP3A 1HUOA 2H5EA 1LW7A 3EEYA 4INAA 3A1SA 2CVOA 2Z9DA 1A8QA 1ZGJA 1JVBA 4PFQA 3DOIA 3BRSA 2IIPA 4NFYA 1NW5A 2PLRA 1EGHA 2WA1A 1YUMA 5EE0A 1GYRA 3I73A 3STTA 3Q8LA 1ZA1A 1REQB 2IZOA 4M9JA 2IZZA 4FZNA 1I4LD 1S89A 4KGVA 2O8BB 4JVSB 4PFJA 2YWXA 3E18A 2WZBA 1R7RA 4R3NA 4OA5A 4C6HA 2IE8A 5KTSA 2OFOA 4JWMA 2YYSA 1EVYA 4MW2A 2IZ6A 3RQSA 4AMZA 3G68A 2HT1A 2GN9A 1LVHA 1BPEA 2MINA 3HBFA 1WZ2A 4U7CA 2GZRA 1UOEA 4TKUB 4UUOA 2GLUA 3OZUA 1LI7A 3TL3A 4OG2A 3E3MA 3LBNA 3FNEA 1TK3A 3LNCA 1V41E 3TRDA 4TV9B 4BKPA 3T5MA 2Z57A 3L7YA 1PG5A 1RBZA 4Q1EA 2IK8A 2G0TA 2YCBA 1XNQB 5LMCA 2E18A 3HB1A 4NABA 3F6YA 4J16A 2Y2UA 5F3XB 1P31A 4WXEA 3GQBA 2AC7A 1JJBA 4U2FA 1UDXA 3OSUA 2A9JA 3OIVA 4P3KA 2EANA 1N2IA 4KMOB 4GAEA 3LDGA 4CDGA 4KAXA 2O52A 1QHYA 2AOVA 3DVAB 5FPSA 1BMFD 4MQFB 4KOAA 4ANFA 3VYTB 2XCQA 3BE4A 2MUTB 3UWOA 2ZYAA 3OF3A 4FX2A 1C1XB 4UEJA 3A11A 4FN4A 5G1OA 3U5ZB 2VJLA 3JR7A 4QZDA 2QR5A 4GNKA 2QZPA 4I1YA 3RADC 4Y6SA 3D2QA 4QDOA 5J5AA 4KUGA 1C0IA 4G81A 1CQWA 3RBVA 4YAWA 4DNOA 4DFKA 4B74A 2X5KO 3RVLA 1QZZA 2JBAA 2GKOA 4M1YA 1JS1X 2QXYA 4MW6A 4H1UA 1JIIA 5DO9A 1QGOA 4TYMA 4ZPJA 2YN2A 4JV1A 1PT7A 3VR2A 4BX0A 5DHAA 5IK2A 4UCXA 5LXTF 2J87A 1V4BA 1M6YA 1UADA 2OC9A 1UJMA 1U0BB 3DR3A 3EEBA 3BJRA 3KHGA 2QT1A 1QLNA 5DM0A 2IYTA 2D8AA 4UQGA 1U7ZA 3IMKA 2ZUUA 4YJGA 2EFYA 1L5GB 1ZXLA 1RKXA 1EIZA 4UNRA 4G01B 4RD3A 3E9QA 3OC0A 2ZPUA 3STYA 2OWEA 1C30B 3K30A 3QFTA 3JQQA 2B21A 4U2BA 5H81A 2B4QA 2IV7A 2PBLA 5DLEA 2GCPA 3DAGA 4ZVOA 4BV8A 5EGSA 1HNNA 3ROEA 1P80A 4AJOA 2WSMA 3R24A 1T0HB 1W5AA 1VL6A 2VRCA 1G8HA 4FXOA 4ZXPA 3BQ9A 3EZLA 3EUB2 3MUOA 1WBBA 3S2ZA 4YAEA 2XKKA 2BTEA 1VDZA 1F3LA 4WUVA 2AJ8A 3MR2A 1E0JA 3K94A 1CZRA 1PJZA 1E5TA 5IABA 4LWZA 1JKJA 1OH5A 5EQTA 4WX2B 3TUIC 5B2EA 3FKSD 4KCGA 4QNNA 3IV9A 2BGMA 4MSUA 2UV8A 2QX8A 4CW7A 3ZE6A 1QTMA 1V8OA 2IYPA 5AOCA 1RD4A 1M2VB 5I7EA 1NVGA 4WEOA 2TSYB 1XVIA 3C23A 1J06A 2XYHA 2BLLA 4CYMA 1UXGA 4J0IA 5JBQA 1SXJB 3BZCA 2GWSA 4PO1A 1CP3A 4BKUA 3NAQA 4EVQA 5J0UA 2PL3A 3HUTA 1UFKA 1LX6A 2AE1A 4I8XA 3HL4A 2E1FA 1IXSB 1A88A 4MMZB 1T9CA 7MDHA 3PX2A 4WASA 1EB9A 4DJFC 1GU7A 2QENA 4LBVA 2J0EA 1N6IA 4YX9A 2FFHA 3GJ5A 3ICXA 3OPQA 4O4JA 4F2DA 1XD8A 1SG9A 2VHXA 4TLBA 4X3OA 3S70A 4LTMA 4FZ5A 3D7RA 3VXKA 3GIJA 3HB9A 3D81A 1Y3FE 4PW0A 3B78A 1XC9A 2QARB 1UXKA 3R8XA 4K6FA 3OTWA 2O8DA 2OWOA 2YYYA 3OZAA 2C61A 2Y27A 2DPHA 4M1ZA 1Z0FA 3LQ2A 2O8CB 3ABIA 4RH0A 1VL1A 3UUGA 1TM1E 2ODNA 2B78A 4MYCA 3S2FA 3P5BA 5DRTA 1DAFA 4UVGA 4RQ3A 2LR0A 4U2CA 1UJ6A 4HL6A 2OZPA 2OZLB 2ZUSA 1NJGA 1X86B 5FBRB 4DSKA 2Q9BA 2EEZA 1NVUQ 3FBTA 3DD5A 3H5VA 1FUKA 2NUTB 4MV7A 8ICNA 2XOKA 1ZJJA 4EWLA 3TANA 5FBKA 4WUTA 4NG5A 1OBFO 2X5JO 4DXDA 1G20B 3RNLA 2YHUA 3OQJA 3NBKA 4KUHA 4TL7A 1VIDA 4FC6A 2E7ZA 1LTKA 1I9GA 3K8QA 2I6UA 4EY8A 2I33A 3AVOA 4ER6A 3H11B 3TTTA 3SDSA 4AJJA 4BFLA 2H1VA 1E7MA 1TVEA 2IYVA 4A8EA 4PLPA 2IYOA 1Q21A 3OTOB 2B1JA 3KQLA 4ZYUA 4CU2A 3ETLA 3KV1A 4PX2A 4FBUA 2WFLB 3B6EA 2UXDB 2O0KA 3AVPA 4AZ3A 5AW6A 3UV6A 2GI4A 4OLHA 2WMYA 3BHMA 1F38A 3I3SR 3LCCA 2G72A 2NN3C 3DNMA 4MGZR 3V8NA 2BL4A 2B37A 1VI2A 1AGPA 2A0WA 5EE3A 3PNSA 1HK7A 1BW9A 5KSPA 4A03A 3ROFA 4QUDA 4ZAFA 3RYFB 4MFCA 1J2NA 2PYIA 1XB2A 2C7PA 1QFJA 4GRDA 1MEEA 3T34A 1P9RA 1FFHA 1MU0A 2HMSA 1GJRA 1YKSA 1IQUA 3NT5A 4MUGA 5J8YC 1EVIA 3OKPA 3KZKA 2X8LA 2H65A 2WKRA 1DAIA 3RS0A 2IOHA 5KTRA 4LF7B 3FLAA 3RB8A 4P7GA 3QWBA 2FWIA 4YB8A 1VHTA 4CDNA 3LY5A 2QQ5A 2C1EA 1XD9A 1MO5A 3G2NA 3RRNA 1Z0KA 1QLWA 3PQ3A 3SJCA 4YI5A 2LW7A 2UVDA 3HJTA 3QX8A 5F2EA 3OUZA 5I3ZA 2C83A 1G5HA 5A7HA 4AX4A 3C3YA 2QSZA 5DHSA 4PZNA 4X1IA 5ELXA 4YRMA 3PKZA 1QYXA 1MPTA 1Z6YA 5FADA 4K6GA 2JFNA 4N3CA 3K6JA 3W1WA 4KXQA 6Q21A 4R84A 3U7IA 1N7IA 1CUEA 1J9ZA 1XMXA 5G3ZA 2P6UA 3ABOB 1VP3A 3ILXA 3FW1A 4AY2A 4PYMA 5C46F 3TR0A 1TVMA 1QE3A 1MABA 3I9JA 3JTEA 5E0OA 4FFOA 4LXTA 1SK8A 4DBLE 4J4BA 4QNRA 1D9DA 2UYGA 1NNI1 2ZTSA 1DKMA 1GSAA 2O7SA 4R31A 1D6JA 3A0RB 3WGVA 1XF1A 1R0LA 5FBQB 1KJZA 4EMBA 2YXPX 2FSSA 1V1MB 2H63A 5EFOA 1ISMA 2HRQA 4MVJG 2PT9A 2O06A 3AQEA 1NAHA 2C3YA 4DR5B 4CLEA 5K45A 3DOUA 4X1YA 4R3UC 1JQ3A 5JH7B 2XUGA 3M6AA 5HIMA 2CJXA 5LR6A 1QRRA 4QTUB 4GGMX 1YIAA 2VDMB 2RGCA 4N0QA 3JAWB 3A10A 1ISPA 3W06A 1M5RA 1GGFA 4OQMA 1E0AA 3PZPA 2VQDA 2GERA 3EPPA 2IZ0A 2PMWB 2OWDA 3BXEA 4O3FA 1JVSA 4QRDA 3IX7A 4IIDA 3TLBA 1N8NA 2CB9A 1QCYA 2WFAA 3QV1A 1MC1A 1KK0A 3L82B 3IPCA 5H68A 1SOAA 3AR6A 3EPRA 1KO8A 4P36A 3K0EA 4RA6B 5KOIA 4TYNA 5F73A 4EKGA 3HWSA 5JFTA 5F5NA 2YV5A 4CKYA 3NW9A 3GRZA 3PUKA 2GETA 3K2IA 3OQ6A 4URWR 2HCTA 4JFRA 3ER9A 3ZIUA 2QY6A 3U7EB 3PUYA 3H9QA 5BY2A 3BWXA 1KKLA 1X42A 1L4HA 2QRVA 3SSMA 3EY9A 4LZLA 4FYYA 2I8LA 3RASA 1Z6GA 2EF0A 3LJKA 1PSWA 1X1AA 1GZUA 4K1XA 3VZDA 3QVVA 1L5UA 3IP6A 2HNKA 5FTNA 1GAWA 3BIXA 2PWBA 5TR9A 2CEAA 2GCIA 1YC5A 1WXFA 4FZMA 4AZVA 1WMBA 4KPYA 4L5BA 4BMZA 1VE1A 1VHLA 3DTVD 3PBKA 1TT5B 1CUAA 2VZ9A 5IHXA 2W2MA 1M3SA 3CA8A 2X8JA 3NZEA 3KT8A 4RL6A 2WDZA 5KCMA 1Z82A 1HKUA 1TMGE 3L18A 3HTXA 3DWEX 3FUWA 3A6EA 2EBHX 5AI9A 3BRWD 4QTZA 1ZSVA 1Y42X 2A67A 1SEPA 2PX2A 5THQA 5BT9A 4UM8B 1YKFA 5C5IA 1C9DB 5DX1A 2ANBA 4HI0E 3EVAA 4OHUA 4C01A 2OD7A 2ZT6A 3ZLTA 1IUOA 1GQOA 3HXLA 4KXLA 3KOUA 5KMGA 3R6TA 3KLBA 3UXMA 1ZW1A 4IQWA 1QCKA 4R68A 3HM2A 5B4VA 1OW5A 4HF7A 3R7WB 4M9HA 1UPXA 3WWDA 1XQXA 3DC7A 5T5QA 3HJCA 4N40A 1ZMRA 4XIGS 1MKYA 4F5NA 4UC0A 3RLFA 4LDZA 3DMFA 2Q41A 4Y2JA 4U1RA 1MNQA 4KN7A 1HT1E 5GZ6A 4LF4B 4RMGA 3RBEA 3FMIA 4EYHB 5HTOA 3F46A 3PXGA 2BF7A 1QMGA 3T7CA 4XWKA 1B0PA 5IARA 4G37A 4OXNA 3KG2A 2HMVA 3KZMA 1Q8KA 1GPNA 1V37A 4DQRA 3C8UA 3VVLA 2HRCA 5CVUA 1L8QA 1VSQA 4D45A 3KVYA 4Q3OA 1D4ZA 5JALA 3F71A 1SV0C 5JATA 5FLEX 2JI9A 2MJLA 3D2NA 4N18A 4FLEA 2JAQA 3FD8A 1JU4A 4R54A 1Q95A 3RS2A 4A91A 1X1SA 3BXXA 2RFLA 1LPPA 1T34A 4EQ6A 2JW5A 2FSVC 2DWOA 5H8WA 4FE7A 3O75A 4FFWA 4EDHA 2HWXA 4LMBA 2D0IA 3HLTA 4UQPA 4NMLA 4BZZA 3KVVA 4GZ3A 4C5BA 4LWOA 4KRXA 1S8AA 1OI7A 3WJ2A 1O94D 2FUKA 2JA1A 2NO7A 3AZPA 1AUXA 3JVVA 3PSHA 2GSDA 3H42B 5H3HA 4K9NA 4RNOA 5CPFA 3RJFA 1VYVA 3K0CC 2COKA 4W7HA 3GJ0A 3U3ZA 1U0SY 1D7OA 2UYYA 3BTVA 4B3SB 2YW9A 1I7PA 1AN9A 5J0OA 5JJIA 3L1IA 1Y8RB 4HXFB 2IEGA 3ANSA 1DZIA 2KZ3A 1HRDA 4YV0A 1DQRA 1I3NA 3C1AA 1MP0A 3DAHA 3DKPA 2IW1A 4BZPA 5AJVB 2IYSA 1Z7YA 2H1CA 1YNOA 4LHXA 1Y6FA 1D8BA 1KY2A 1HUQA 3C3WA 4MLCA 1Z2EA 4HX5A 1Z6ZA 3DKVA 4FD2A 1GADO 3QF4B 5JPDA 5JQGA 1R6XA 3DMRA 4J9MA 3E6AA 1IN8A 3NVDA 3GIDA 3G5UA 5LC1A 1R4NA 3ZCSA 1B16A 4EENA 3WB0A 4GBGA 1V35A 1PDVA 1XK7A 1M6HA 1XTBA 3R0QA 2PX0A 3HXTA 4ZDJA 5CVDA 2NQ2C 4L2IA 2VQ3A 5IIIA 3KDPA 1EGAA 3CLVA 5F3DA 1T7PA 2H2WA 4WCDA 4DR2B 1K7EB 3RS4A 5DH9A 4URZR 4DM4A 4UFNA 1CI4A 2PG3A 4ZAZA 3B6ZA 3U26A 4JWKA 3QHQA 3NC1C 4UNNA 2JKVA 5ULLA 5JE8A 3L92A 3W9BA 4BUZA 1KDOA 4YFVA 5MN4A 3NT2A 3O84A 5CEJA 1S2LA 3AEYA 3B7PA 2B4RO 3PC6A 1BDMA 2GVDC 1ODKA 1QO7A 1EU1A 1EUZA 4D97A 5LQRA 2O6LA 1ADGA 4RY0A 3ASVA 1GSOA 4I9GA 1QDEA 5ALDA 2EBUA 4IDFA 1XPOA 1ENOA 2OCBA 1QKJA 2HBJA 3IDZA 3W3AH 3ZDQA 2GZSA 1VJDA 3HBNA 1TMYA 4LN1A 5DBHX 2HN9A 3NTRA 4NJMB 5IC4A 2X4LA 1UZMA 2EF1A 3ZHCA 3C6YA 1ZH8A 5J2UF 3EF1A 4D9GA 1AHPA 3TAXA 2VJMB 5I7UA 3CW8X 1QBKC 2A57A 2WTMA 2VP3A 4IJUA 3M3DA 3ZBTA 1OXKB 1UKEA 3BCHA 3G8BA 2ERCA 5ALGA 3SR3A 2AXTU 3C16C 2QRNA 4W5OA 3IXQA 3S2UA 2AZXA 1RYFA 1E98A 1PEAA 1BPDA 5JU6A 2IX9A 4NZ9A 4MUKA 1ULUA 4ZQBA 3TEMA 2E4AA 3IVRA 1YHZA 3OD1A 5AK4A 3HBJA 5DASA 2RKWA 1CX9B 3BJEA 3I37X 2X22A 1IXRA 3FJYA 4P4PA 4A73A 4HBZA 1SZCA 1ISSA 5KFBA 4CLHA 1HLFA 2EJVA 4EBDA 2CVPA 4YCDA 1JIUA 2BR3A 1U5BA 5LOVF 2Z9BA 1ZQMA 5D51S 3BSFA 3F4LA 5HBGA 2H5LA 3HXKA 2VDWB 3FIUA 1IRXA 3T5BA 3LYLA 3TW8B 4GU5A 1U5CA 1ST2A 2ZXUA 3FNHA 2RKOA 1UKCA 3CVJA 4ZZ3A 1KZGB 4X6YA 4PHGA 1WOYA 4KLNA 2V7XA 2PUVA 3VZPA 2I91A 3G5LA 2VTVA 2ZSFA 4ENWA 1SZPA 2OO5A 1YJ8A 2FP3A 3B0YA 2A30A 2EFJA 2RHDA 1XC7A 3C70A 1I3MA 4MX8A 4DYDA 4C08A 2BW0A 2VDLB 2XUQA 4IZOA 4QELA 4B8WA 1YFLA 3TPZA 4ZICA 2VJ4A 3UGJA 3SE7A 2WQ7A 4TRJA 3LHIA 3F67A 4HVCA 3CZRA 2YZ2A 2D59A 4M1QA 4OSOA 3N7PD 3LO5A 4GL2A 3BTSA 2O2IA 4EFLA 2Q4TA 2XCUA 2RGUA 4AN1A 1S76D 2WWIA 2H2DA 2HBKA 4X61A 2HWUA 4OMDA 2BE9A 3PGA1 2GPAA 2AC2A 1Y9DA 3H1AA 2ZVPX 3OA0A 3V1MA 3SSAA 3ZUPA 2BGRA 1KAOA 3ITKA 2RAUA 2WA2A 2WYHA 2ZIUA 2IQIA 2HI0A 2X15A 1PJLA 1CUUA 2PZBA 1UDAA 1K66A 4MKFA 3CW2C 2QDXA 3CVYA 1ZGHA 3PR2B 1YRHA 2O2JA 2P0AA 3AJAA 5EHQA 3T3EA 1WY7A 3ZIAA 2C5EA 3HRDD 3V8EA 2JG3A 4Q7QA 1RPJA 4CQNA 3Q4GA 1XSLA 4AMYA 4WGFA 2DUWA 5CTJA 1VZ3A 1CRPA 3JVDA 4YS6A 4PIPA 2FF5A 3RJJA 2P68A 3D2LA 4BRSA 4ZANA 4QRIA 5I8PA 2GNPA 1IN6A 1R9MA 7ICLA 3WQSB 2R68A 4QZEA 4CF3A 1NA5A 5IKOA 2FXIA 5CX1A 5H80A 3VR2D 3V1NA 2I4OA 2ZXFA 5IK2D 4DV6B 5TGDA 3DC2A 2DXIA 4ZCQA 4J9UE 1RLMA 1DDIA 2LIVA 4MQMA 4G0WA 4H7KA 5I9TA 3EZYA 3K9NA 2PRKA 2PUEA 3CY6A 3E0FA 4PV7A 3HWRA 1N32B 1UK6A 2GYVA 4KE7A 4TTRA 3WY9A 1V8BA 1RAAA 3A3OA 5B1DA 5IBQA 3CF2A 3LXRA 2IEAA 4BE9A 5HM6A 3E05A 1S02A 5JNUA 2Q5IA 5BV1A 1EX6A 1R5BA 5LBIA 4I8IA 2ZR8A 2VRCD 5FWXA 4BP8A 1IRIA 4C88A 4HGRA 4Y6GB 1ZQRA 4OMUA 4UM9B 1EFUA 3PP8A 2Z5FA 2IF2A 5F78A 3NHRA 4H16A 1YJBA 5IU6A 3AMVA 4FNAA 4QUGA 1SHUX 1ILEA 5PGMA 5EQFA 1MEOA 2O3TA 4RF5A 4JODA 3CLTC 1AKWA 4FBLA 3DBRA 1P2FA 2JI8A 1AU9A 1OYOA 3OF2A 4KLLA 1WSBA 4L5CA 1JNYA 1T5OA 1DC4A 3JATA 4Z1MA 1ILWA 1U9IA 2UVRA 3P0EA 4JHXA 1QHXA 3HM9A 2ZWAA 3KU4A 5HUQA 4EA6A 3F2BA 1GU1A 1Z0ZA 1EUDA 1Q3KA 4QDXA 5HVNA 3L7NA 3PNYA 2G6TA 1JEOA 3GLFA 4YDSA 3H99A 5AM5A 1ZKMA 4L8YA 3TVDA 3ODGA 4R9RA 2BP7B 1E9RA 1J7JA 2HEIA 2ZUVA 3HCEA 3L0YA 5IMBA 1Q92A 2YW2A 4MIYA 3MT8A 4G0YA 1R4AA 4TLCA 4RJLA 3FVRA 2H3QA 5AHOA 1WS6A 5FNZA 1A2BA 3BKWA 1O6ZA 4O5EA 1AXRA 2KMDA 3D6NB 1J2TA 3W8NA 5IINA 5KSOA 2LUOA 2V7UA 1TX4B 1UBUS 2IUUA 1VLZA 4L4SA 1YBHA 2NRTA 4Z9BA 2WWWA 5JVDF 3EIUA 4FUTA 4Z4IA 4MCJA 2D8MA 1UP6A 2X1MA 4J1QA 3D7SA 2QLBA 1H2ZA 1WUIS 4GGPA 1ESNA 3PDUA 4G4GA 3EVGA 4DV3B 1FYWA 4DC1A 1DHRA 1DJNA 1J2RA 3ISBA 3SBEA 2OESA 4FWIB 2YVUA 3KXDA 1T15A 4Q9DA 3GI1A 5J0WA 1KP9A 2XOKD 2QPAA 4JUDX 2BFDB 3I4CA 2J9RA 4Q48A 5ITWA 1S5PA 3GJRA 1GQ2A 3F3YA 1VMKA 3FHOA 1PL0A 3FPCA 2FZWA 3EYWA 4MPJA 2W4QA 4QQRA 1RU3A 4XQ8A 3Q88A 3H9CA 4XWTA 2BF4A 3SX0A 2WJVA 4LGYA 2JVJA 4AQ7A 1SUCA 1VJCA 1Z2NX 3CFYA 3UMCA 4V24A 4XFKA 1JJVA 4ZCRA 4J0CA 3PSFA 4MUFA 1ONSA 3ELBA 4OP3A 5CVTA 1YE8A 4H15A 2RHFA 2UAGA 3EHEA 2JIZA 3DQZA 4AJIA 4DREA 1YU9A 4KLSA 2FX3A 3I8XA 1ADFA 1JLSA 4R2XA 3RJIA 4JS0A 1H2RS 1FMTA 4G84A 2FDXA 4U63A 1R16A 2AD1A 2ZREA 4BNFA 2VF4X 3HVUA 5K4GA 1H8HA 3QMWA 5A4AA 1ODLA 1KETA 1L5LA 1JQDA 4QUIA 3HY4A 1A9QA 5FBHA 2XQGA 4F86A 1E6EA 3G0OA 4BNDB 2B4KA 3R3HA 4J0FA 3A9WA 4FEGA 2WTBA 4D26A 5HOEA 1I32A 1AHNA 2GPTA 2NSDA 4TL8A 3GLFE 4P3OA 1VPTA 4M1KA 3NWPA 3NHAA 1T1RA 4LJ5A 4P32A 4O3PA 3Q15C 3ZE8A 4IR9A 3O3NB 4YTEA 1DEAA 2R1TA 1FP1D 1R18A 3EC2A 3EQ6A 4PL2A 5E6UA 4ED2A 4FEEA 3F5DA 2P7IA 5AKGA 3ERCA 2OQ2A 3SJUA 3NBMA 5DYGA 3BBPA 2H3IA 4E2ZA 5TY0A 4IOLA