4G9BA

Crystal structure of beta-phosphoglucomutase homolog from escherichia coli, target efi-501172, with bound mg, open lid
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
227
structure length
227
Chain Sequence
VMKLQGVIFDLDGVITDTAHLHFQAWQQIAAEIGISIDAQFNESLKGISRDESLRRILQHGGKEGDFNSQERAQLAYRKNLLYVHSLRELTVNAVLPGIRSLLADLRAQQISVGLASVSLNAPTILAALELREFFTFCADASQLKNSKPDPEIFLAACAGLGVPPQACIGIEDAQAGIDAINASGMRSVGIGAGLTGAQLLLPSTESLTWPRLSAFWQNVAENLYFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of beta-phosphoglucomutase homolog from escherichia coli, target efi-501172, with bound mg, open lid
rcsb
source organism Escherichia coli
molecule tags Isomerase
molecule keywords Beta-phosphoglucomutase
total genus 82
structure length 227
sequence length 227
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2012-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 4g9bA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4g9bA01
1WVIA 1ZD5A 1MH9A 3OPXA 2HEGA 3L0YA 3QYPA 4BNDA 2R8ZA 2IOFA 3IRUA 2FPWA 3DAOA 3KBBA 2ZBDA 3WK7A 2OYCA 5AVZA 2RAVA 2WF9A 5ALUA 4GIBA 2C9MA 2C8LA 4EZEA 4DWOA 5AHXA 2G80A 1PW5A 1SWVA 1YS9A 2W4MA 1VJRA 5AKKA 2B0CA 2WF6A 2BDUA 3IJ5A 4Y2QA 2RARA 3U13A 2B82A 5ALOA 2G0AA 2YY6A 2I55A 4C4TA 1RRCA 3DDHA 2P11A 3QLEA 5AK6A 4FE3A 4UM7A 4OFZA 1L6RA 4Y2YA 3E58A 2GO7A 3NIWA 4UU1A 1TJ4A 2FPSA 3R09A 2FEAA 3MC1A 2RB5A 1U02A 1NNLA 4G9BA 5AM1A 1O08A 2FDRA 1ZD4A 2ZBGA 5AVRA 4G63A 1YDFA 2MU2A 1Z4JA 4YGYA 3EWIA 4DCCA 5AW0A 4Y2UA 5AW2A 1ZS9A 1ZJJA 2HF7A 3OCUA 4HGQA 1L8LA 3ZVMA 1RKVA 3SHQA 3E84A 4YIKA 2HX1A 5AM5A 1LTQA 4XPZA 3W5DA 3J7TA 1RMTA 1TJ5A 2RBKA 1RKQA 3ZUPA 4XE5A 1X42A 5ALVA 1WR8A 2G07A 5ALIA 4BX0A 3ZVNA 1YMQA 1CR6A 3ZTWA 3W5CA 4UM5A 2WHEA 4UASA 5AI6A 3UMBA 4CF4A 2EAUA 3QUTA 3U7EB 4NWIA 2JAOA 4Y2JA 1RMYA 3DV9A 1T9ZA 5AW4A 2CFSA 3I28A 5AM4A 3N07A 4BYGA 1JUDA 1K1EA 5ALPA 3FGOA 3ZVLA 4Y2RA 2DQSA 2G09A 3W5AA 5AM3A 2VKQA 2YMMA 4XOUA 2P9JA 3ZX5A 5ALYA 1Z4OA 2W43A 3F9RA 4UW9A 3SMVA 3NASA 3QU5A 3KC2A 2MU1A 3ESQA 1RKUA 2NO4A 5AKEA 2W11A 2PQ0A 3U19A 3WK4A 3EF1A 5AI0A 5IT0A 2HF2A 5E0OA 5ALJA 3HYCA 5AKXA 2R8EA 3KOOA 3WKAA 3ED5A 5AM2A 3NANA 3PCTA 4CE6A 2I6XA 3L5KA 5ALRA 4UMEA 5AKLA 4HYTA 5ALFA 4Y2SA 1Z4LA 2WF8A 3L7YA 3MMZA 2BDEA 3B8EA 4KX5A 3WK6A 3NUQA 1ZD3A 5AVXA 2I7DA 4ZEXA 3WK5A 2B8JA 5ALHA 1Y8AA 5FP0A 2IOHA 1L7NA 2ZBEA 2ZXEA 3RF6A 3SKXA 2C4NA 4UMVA 5T41A 2WF5A 2WM8A 1WZCA 2OA0A 1U7PA 4YIHA 1NF2A 4BX2A 2GHQA 3OCYA 2G06A 4IFTA 1Z4IA 1SU4A 1XP5A 4RESA 3M9LA 3S6JA 4L6AA 4UATA 4AP9A 1ZRMA 2B30A 3FPSA 2NO5A 2WF7A 3U7GA 5AKYA 4BEVA 1RMQA 5AVYA 2YJ5A 2I33A 1QYIA 4F72A 1RPZA 2AMYA 2PKEA 2ZBFA 3L1VA 3EF0A 1T5TA 3L0BA 1EK1A 3W5BA 5AKGA 3A1DA 1N9KA 3WKBA 5ALZA 4BEWA 1IWOA 3AR3A 3AR5A 1F5SA 2YJ3A 3WGUA 5AIAA 4JB3A 3WGVA 5ALNA 3R4CA 2HO4A 4ZEWA 4FYPA 3AR2A 2R8XA 2G08A 2QYHA 1XPJA 2OM6A 3K1ZA 1VJ5A 5AVUA 4NABA 4EX6A 5ALWA 4Y2XA 5ALXA 2B1RA 4PNHA 2CFRA 3E81A 1QQ5A 3OCZA 4XQ0A 1XVIA 2GHTA 1U7OA 2NYVA 1N8NA 5AM0A 3ET5A 4Y2PA 4BBJA 4AS3A 1EK2A 1Z4QA 2B8EA 3UM9A 3QNMA 3ET4A 5AI5A 1RLMA 4E88A 3AR4A 4HGOA 2HHLA 4Y2TA 2CN1A 2AH5A 4QJBA 4EX7A 4C4RA 2O2XA 3L8EA 4OCZA 3R9KA 4MWOA 2FPXA 1ZOLA 3KZXA 4KN8A 2YN4A 5AVTA 2EATA 3TLMA 3SD7A 3PGVA 2JAWA 5AW1A 4AS2A 3MN1A 1Z5UA 4KX3A 2X4DA 4BX3A 3L0CA 2JAUA 5AKHA 2GMWA 4RETA 4HAIA 3CNHA 2YBDA 4L57A 3OTQA 4HGNA 2YJ6A 1QH9A 4F71A 5ALKA 3QXGA 3IB6A 2FUEA 4OHFA 2YJ4A 3NAMA 4EENA 1QQ6A 2IA5A 4FFDA 4Y2VA 1O03A 3U7FB 2I54A 5AI8A 3L8GA 5AKJA 1RLOA 2YMPA 4UMFA 4KNVA 2P27A 3GYGA 5AVQA 1U2TA 2HI0A 1FEZA 4YH1A 3ONNA 3MPOA 3QX7A 5AVVA 2ZOSA 3NALA 2WFAA 4H1WA 1RDFA 1TE2A 3PGLA 4CF3A 4DFDA 1L8OA 3A1EA 2HCFA 2C8KA 2IYEA 3QU9A 5AW8A 1ZRNA 2YMLA 4ZEVA 4BKMA 3U7HB 2BY4A 3AR9A 2ZG6A 2HSZA 1YNSA 2ODAA 1LVHA 1Z4MA 4HGRA 5AI9A 3ZW7A 3DNPA 4NAVA 3N5KA 4I9FA 3VAYA 5IS2A 4GXTA 1L7OA 2Q4RA 4KNWA 4NV0A 3WKCA 3A3YA 3PDWA 2FI1A 5AICA 5AVSA 1L7PA 1J97A 5AESA 2YMQA 5ALMA 3KD3A 3U26A 5AIBA 2EARA 2AUTA 3QGMA 1S8OA 3L1UA 3UMGA 4J2TA 4UU0A 1Z4KA 3ZWDA 3ESRA 1J8DA 3NRJA 5A3SA 4YCMA 5A3QA 4J03A 3QU2A 2IOFK 3D6JA 5AW3A 2FUCA 2I34A 5AW5A 3BA6A 2YFYA 3N1UA 2HDOA 1RQNA 2PR7A 3OCVA 3QUQA 4UARA 5A3RA 4YCNA 5ALTA 1U2SA 4HGPA 4JDPA 1T5SA 3UMCA 1Z4NA 5AI4A 5AK4A 3FPBA 1TA0A 4UAVA 3E8MA 5ALDA 4EELA 3P96A 3B9BA 5AW9A 1NRWA 3ZU6A 2P69A 4Y3UA 1RLTA 1S2OA 2JARA 2MSNA 4C4SA 3M1YA 2QLTA 4EEKA 2Q4TA 3I1YA 1RC8A 2CFTA 1Q92A 2Q5EA 4I9GA 3N28A 3BWVA 5JJBA 3ZI4A 3B9RA 4UMDA 3AR8A 3OCXA 2GFHA 2JGAA 4NFLA 2OBBA 3WK8A 5IT4A 3QU7A 2D2VA 1TJ3A 1Q91A 5AKIA 5ALQA 1RQLA 1ZD2P 3WK9A 1VFPA 4QQFA 3A1CA 1Z88A 3QUBA 1YV9A 3I76A 3ZTYA 1Z4PX 1SWWA 4KYTA 4BNDB 1YJ5A 4IG4A 3SLRA 2FPRA 3SF0A 5AKZA 5AW7A 3L8HA 1CQZA 3FZQA 3OCWA 4DW8A 5ALGA 3ZX4A 3WKEA 2B1QA 2O9JA 4CNQA 3QU4A 2FPUA 3FM9A 3WKDA 2C88A 3HLTA 3QUCA 4L6CA 3SKYA 3N8GA 5ALSA 4MUMA 5AVWA 3I6BA 1WPGA 3FVVA 2R8YA 2G1AA 4CF5A 2HOQA 4O8CA 1AQ6A 3AR6A 5ALLA 2AGVA 4B6JA 3L8FA 4UAUA 3AR7A 1QQ7A 3EPRA 1KYTA 5ALEA 5AK3A 3RFUA 1Z5GA 5AK5A 5AW6A 3ZWKA 1L7MA 3CZ4A 4OD0A 4YCLA 3KDPA
chains in the Genus database with same CATH superfamily
4FFPA 2IIVA 5KNIA 2YWDA 3JQCA 1YL7A 4BNDA 4EW6A 3PX6A 2PLRA 4YAEA 1R6VA 1TDJA 1V9CA 1Z7BA 3GR6A 2G5IB 1EQ2A 4YV0A 3RAQA 4UU8A 4YRSA 4CMEA 1YRQA 2TMYA 4MINA 1EWQA 3AL3A 4GM1A 4LJ9A 4RDHA 3RRXA 2WJ4A 3GDWA 4GIBA 3QZ7A 1YRBA 4C8KA 3M2TA 3OH8A 4AU1A 2DXIA 1UQVA 2E82A 3ZD9A 1MOQA 2B25A 2RKWA 3Q8LA 3K9NA 4QGAA 5K0GA 3WHIA 3ZLVA 4YMLA 2EFGA 4CMGA 2FEPA 1YE3A 2Q2QA 3MF4A 3FTFA 1IXZA 1EGHA 2RAFA 4FNMA 3CT4A 4TN5A 4JKIA 1YZ6A 2C96A 1I6WA 4D4IA 2AN5A 3H40A 4PZ0A 2WF6A 2A9VA 3DLTA 1R0ZA 4C7ZA 1OMOA 3ZE2B 4KE9A 3LFHA 1Z1VA 3BQ0A 1ST2A 1RJ9A 2WINI 3NBZC 2R65A 3BF8A 3Q87B 1KF0A 1KU0A 1PF7E 1R6TA 1PK1A 3B36A 3FRIA 4B4DA 1QZUA 2YYAA 3FUWA 4BWYA 2YIMA 1Z2DA 4YPVA 1KEEB 3Q3CA 4FD3A 1OI4A 1ZI8A 4FFLA 5G4KA 3M2PA 1UIMA 3R7WB 2XTMA 4MGYR 3GG9A 4MR9B 5FFFA 2FXVA 1J24A 1YB6A 3B1YA 4AJ2A 2QR3A 3USCS 2I2FA 2I3BA 2RHRA 3PJFA 2QN1A 3G7SA 1L5GB 2A4KA 2PSSA 3PVSA 2D7JA 3WYFA 1FYWA 4N8DA 4WY2A 2AOTB 4DXAA 3L9WA 2UUCB 2GAAA 3TUIC 4RHYA 3HM2A 4IIFA 1G9TA 2XCPA 4XX1A 3VR1A 4ZVUA 1JG2A 5BORA 4Q4DA 3UHJA 3K0AB 2PS3A 2Y1OA 2YB4A 1RE0A 2R8PA 2HF7A 1MC1A 1N8KA 1OXUA 3JPTA 3K6KA 4OQNA 2XWQA 3W8FA 4BNMA 5LNK6 4E2XA 4OJPA 2AA3A 7ICKA 2IZ7A 4LZPA 5FTNA 4ENVA 3G5LA 4CLOA 3OE4A 1SEPA 4GSYA 2QN8A 5G5HA 4O5CA 1JQDA 2CL5A 3BH0A 3TLZA 1L4KA 2FG6C 1T26A 2YWBA 4WCVA 5IARA 1P2SA 5E1OA 2XDQA 3ZUPA 4P81A 1AT1A 1TFUA 1SIJA 4B6PA 4I5EA 1V9SA 1KK2A 2E1RA 4BX0A 2OD2A 7ICLA 1TAGA 2PLWA 2YS6A 3DM9B 4BJ6A 1YK0A 3C97A 2DUYA 3OFKA 2Y3IA 4NG5A 1ECJA 4XDGA 3DFIA 9ICAA 4LRWA 4OG2A 4YAUA 4W9MC 5F7JA 4JT4A 2IJGX 4L15A 4QQNA 2LNDA 4TPKA 1Z39A 3ZGOA 2E8OA 1C4XA 4NWIA 4GR9A 3C39A 4PY2A 6CHYA 2RP5A 3SC6A 1OHHA 3PQ4A 3QZUA 4IVNA 4JK3A 2XI9A 2WVGA 4C2UA 4LMAA 1Y6ZA 5B6JA 3A0UA 3UAZA 1VB3A 3R6TA 1U1FA 4G5QA 4U63A 4AL4A 1ZH2A 2BM1A 5SICE 2BFMA 2VJOA 3DWGA 1N7HA 3PGKA 2DQSA 3CH6A 1U2EA 2BGMA 3HBJA 1WUIS 2A0UA 2OCXA 4K6HA 4X8MA 5D7NA 3W8DA 4PLWA 5DN6D 2G88A 3WIDA 2P9JA 1PRYA 1MTOA 3VDNB 1HA3A 3CE9A 5TGZA 5GONA 4PLHA 3GVHA 4NZNA 2FAXA 2ZYAA 1D3AA 3DWIA 2R2AA 3ESQA 3K2QA 4INJA 1BDHA 1DGJA 3DB2A 8ICNA 4QPZA 4EGFA 3RTEA 1JKMA 3QEAZ 3QK7A 1L5ZA 3ESYA 4ZOQI 1K8ZB 3E0QA 5TEWA 2X7JA 2B36A 2HREA 1JDNA 1BRTA 2ZSUA 5BVHA 4JOCA 3EQ6A 1TZJA 4OLBA 1SUSA 4WK2B 1T1SA 1FJXA 1SXDA 1H6DA 3WGGA 2QT0A 1Y9DA 4H6PA 4NY8A 2FDCA 3TGPA 1DBVO 4M9GA 2H7YA 3DPIA 4I5GA 3EG9A 1O9BA 4IDDA 5AFSA 2OC4A 4Q18A 3IQEA 3V8RA 4EK9A 4R66A 4MDYA 5JSZB 4OYRA 2JJ1A 5D5QA 3ICEA 3SMQA 2JFOA 3PCXA 2GZ3A 3RJZA 3VXKA 3IT3A 4EF6A 4EHNA 1IC6A 1EFHA 1JNXX 4E4YA 5BW8A 1N5MA 1DBPA 1BXRA 1T13A 3OEWA 4CDMA 7ABPA 3CLRC 1UBSB 4KQCA 3VR2D 3AM3A 4ZKEA 4ZA2A 4K3VA 5F5LA 4KQ1A 4HFNA 2RE8A 1E1DA 1ZK0A 3H3FA 3PC3A 5LL6P 2DH5A 2ZS7A 3U7JA 4J0FA 5C7LO 2HQBA 1ZLXA 3BMNA 3OSPA 3M9MB 4G85A 1L4UA 4MWBA 2C8JA 3ROFA 3S28A 4C3VA 4DLSA 5B30A 2AF3C 4HDQB 2FJ6A 3RVBA 1TKRA 4EJSB 4BKRA 1RRKA 4N12A 3QWBA 3T4EA 3GK3A 2DU8A 2KZMA 1QIKA 1WB4A 2JIDA 1GDDA 3NKVA 2BELA 2D1FA 1M3SA 1VZ3A 3UG6A 3OE7D 1BNCA 1Z15A 1EESA 4RTLA 2HC9A 3P9SA 3RH5A 4WWHA 1ML4A 4IEIA 5F4ZA 2AKAB 1ZRMA 2DQ4A 2QRNA 3SSAA 3GZ4A 4D9MA 1KPHA 3ECCA 4NICA 5D2CA 2KZZA 2V0GA 1OXKB 1DJNA 2FP4A 2DF4B 5FH9A 3DCJA 3W9UA 1QYIA 4A4DA 3D54D 4O1MA 3OZFA 1HNXB 5HE9A 4B2LA 1JKXA 3M34A 4MYTA 2NPOA 1GEEA 4YJHA 2OLJA 1ECFA 5IK2D 5L6LB 4ARVA 1T5TA 4X1KA 1FMTA 1I30A 3L92A 1YR7A 2VHWA 4PPYA 3A6PC 1OAKA 1ZC3A 1NBAA 2AKYA 2CMFA 3NTVA 3AUXA 4WFJA 2AVDA 4YRRA 5A1JA 1TUIA 4FZRA 2HU2A 2VYVD 4MI1A 4BEWA 1LLFA 1P60A 4ZAWA 2XNKA 2Q0ZX 2OZVA 2WD8A 4HGZA 1C3OB 1A8UA 1XF1A 3IO5A 4J1NA 4UE3S 3T9AA 3FWKA 2NAFA 1YFZA 4AJPA 5IDXA 3DC7A 4OYHA 3OJUA 4M8LA 5A9SA 1A98A 1EP9A 1G8GA 3OPNA 1XX6A 3RH0A 4U5QA 2WUFA 3VHLB 4NH0A 4ND5A 3PE4A 4ZT6A 5GPBA 1E3WB 5K8JB 3ADCA 1I8TA 2I8LA 2VUUA 2B1RA 3DQPA 2EDAA 2V3VA 1MQ8B 1ZSNA 3RSOA 2NXCA 1KU6A 4TQGA 3TZKA 3UT6A 3DEJA 1IYZA 1LW6E 3DLIA 4KGVA 4CKWA 2H1FA 4HNTA 1KSJA 3MMPA 1E59A 4OMCA 2ZVQX 4URXR 2PXIA 3GFPA 4G1MB 4PQGA 1V8FA 3EXHA 1E6EA 5HF9A 1LI4A 4IQTA 4EG0A 1MFPA 2JFYA 4DUZB 2G4LA 2A3NA 3UATA 3S8MA 4Q4HB 3AGQA 1LPAB 4PHDA 2B78A 1YIDA 3ZEIA 5H3HA 1GA6A 3G8YA 1UH5A 3WIBA 4QIWC 2RDIA 3SI7A 8ICVA 1GGEA 2HDWA 4HMQA 1KDPA 4HAYA 4KVFA 2R8RA 2W6QA 4ZAXA 1ETUA 3BIOA 4F06A 1BNOA 1KWKA 1U3DA 1L5KA 1SXQA 1JHRA 2OGUA 1CJVC 2LCIA 3RAXA 3A37A 3SVZA 5HUJA 1MZPA 1C9NA 1O5OA 3C2KA 4NU5A 4OBBA 3U7RA 2PWAA 4YX9A 3JVDA 3LD9A 1AGYA 2FPKA 1GQQA 2YN4A 4KTQA 1R0KA 3P20A 2Y4OA 3MWGA 4ZMBA 1NJGA 2JAWA 2XDWA 4X93A 5K6AA 4Z6EA 5DU2A 3BQ2A 1VG9B 5F52A 1BTOA 2R1ZA 4CKEA 2OBMA 1XO0A 4NH4A 2H3ZA 3SYNA 5JYCA 1S2GA 1LRKA 1LQUA 3JZIA 3KSUA 5ICSA 5JD5A 2F44A 4DMLA 1UBOS 4YP7A 2ZULA 3K94A 5DTRA 5GMOA 5LBTA 9ICNA 1Q1ZA 2ZB8A 3ZW9A 1IWBB 4CV2A 3SAJA 4P4MA 5A71A 1KEEA 3Q8KA 4B4UA 2XE4A 5ERYA 3D4BA 1Z5WA 4F50A 3IBTA 2C3OA 1JDPA 3QKRB 4LJ4A 3NRZA 3D7NA 4FFNA 4WUTA 1Q15A 3T5TA 3W2GA 4QRIA 2A5LA 4OHFA 3E6AA 5K1ZA 1OYWA 1UXKA 4DNQA 1DUIA 2CJPA 3WS7A 1KARA 3NYQA 4KIFA 1TVKA 5ER6A 3OOJA 2YMPA 4J6EA 5EAIA 3CLRD 3D6HA 3LZCA 4DL9A 1ENZA 2IEYA 2FU5C 3I2HA 4MW7A 1XELA 4DNXA 4DRXB 4TZ0A 4YH1A 5CDTA 4JV2A 1A82A 1YCFA 3S2EA 1T34A 2C2HA 4C4OA 3MPOA 1WQ3A 5ITZA 2BL4A 3ZYCA 2R87A 3H42B 3IC5A 5AVVA 3FRHA 2QRGA 4DQKA 2UXDB 1MIOB 2XUOA 3KZCA 4L28A 4ETIA 5J2UA 1L8AA 4DFDA 4BLRA 4FWTA 4KLIA 4X1KB 3PX0A 5KT7A 1XCLA 4UVDA 4O2AB 2CLFB 2C8KA 2HLHA 4TWZA 5AW8A 4I36A 2YMLA 1QYWA 5DWVA 4BBPA 5G41A 1K9VF 3CZMA 3T5JA 4O3SA 1J6UA 1OX4B 3BSYA 1UBMS 3EQZA 4O0LA 4YRFA 4ZIRB 4OJTA 1VI2A 1X7WA 3T3FA 1CNMA 3MQ2A 1JIHA 3OO0A 4RD2A 2EF0A 3TNFA 3BM5A 1C9DB 4JAVC 4XTCS 3ND9A 3PXBA 2WIFA 8ICYA 1KMMA 1NR1A 3CZRA 5B4UA 1ZJ5A 1ZETA 3T7SA 5MFPA 5A2GA 5AI9A 1LI7A 4DANA 2I7TA 4YYEA 1BDBA 2Q6KA 1T1EA 1LH0A 1W2GA 1NW7A 2JVIA 2QE7D 4JVNA 2Q4RA 3AV3A 3LXUX 4Q3EA 1EBBA 3A3YA 5GIPE 4CIXA 3G6KA 5K0FA 3C14C 5AHRA 1EGVB 3GL9A 4HXGA 4RQ2A 2PUJA 3T7AA 4C29A 3QVGA 1AY0A 2WJAA 2OC9A 2SCUB 3CF2A 4C8OA 2E18A 4DG5A 3ANSA 3G88A 4YBZA 2P6OA 5JASA 4KXNA 2BV3A 4ZARA 1NUQA 3KS9A 4B3CA 3L7DA 2I22A 3LI2A 1A0PA 4B8WA 5KYKA 121PA 2EZZA 1ZICA 3ZBQA 1DKMA 1NXXA 4GM0A 1UK7A 3AUOA 2PZKA 4O2BA 1RYFA 2N0SA 4PPNA 4Y9TA 5EE5B 1MTZA 3TFOA 4GKAA 2HBYA 4WKNA 3OPVA 4HDKA 5HCUA 1BN7A 5KJ6A 1XKTA 2OFPA 2DETA 2Q29A 3BA6A 5CP2A 3HYNA 1AU9A 3ZWPA 5LZ9A 2KK0A 1XZJA 1P7DA 2QRZA 3KQYA 4QYWA 4RXTA 1CYEA 2PR7A 3N0XA 2PKWA 2GLXA 4S12A 3KJXA 3WGYA 2AMVA 4MARA 2NSHA 2R00A 2AQ0A 4B9MA 2GBGA 2OFXA 2W6PA 1KC3A 1GFIA 3CIOA 4JDPA 4BO1A 3OPQA 3WGOA 3LYAA 4FJ1A 1F44A 1DBQA 1EQUA 3KEFA 4CKZA 1J8YF 4JSYA 1F0PA 3NGMA 1PUXA 3PZBA 4G1VA 4IH1A 4TLBA 4ZJYA 4R2XA 1JS1X 1AKVA 3QKWA 4B3IA 5KQMA 5JADA 2XYHA 5LZ5A 4IWYA 4BXOA 2OUKA 3FAZA 5DX0A 4F12A 1QSYA 4GXKA 3DCYA 2YNMD 4H4DA 2I7VA 3ROTA 2NO0A 1D1TA 3BQ9A 4JJFA 3NUGA 4YAIA 3KXDA 3AWIA 4K2HA 4N6OA 4PR0A 5E0KB 2WJ3A 4RY8A 4ED2A 5CVUA 5A06A 4PYMA 3B53X 2Z2XA 4EQ6A 2RIRA 5BN5A 5IIMA 3EA0A 4LGMA 5DV9A 4LRYA 5EJIA 4EEKA 1CUBA 4O4IA 3U3ZA 1AKMA 3I1YA 4A8EA 5KNCD 1Q92A 1OJLA 2RG1A 3UNXA 4I9GA 3FE2A 3ZHRA 3P5BA 1TAUA 3LUHA 3OZXA 2PI5A 1XWFA 1E2NA 3EVCA 2VH2A 4BMZA 3KV1A 1NW3A 5BSRA 2C58A 1N2JA 3WK8A 3FY4A 4GU5A 5DRTA 4YR0A 3RUAA 3W5UA 1TCUA 3DG9A 2OCBA 2XNCA 1ZI6A 1XA0A 3MJVA 3QHAA 5HS4A 3INRA 4JLAA 3G9ZA 3GFRA 3QBTA 4J0EA 2II6A 1N3IA 2IPMA 2AXNA 2X0NA 4IDPA 3V97A 4PNEA 4AB1A 4DQUA 1EWTA 3P97A 2GKSA 5JT1A 2BCJQ 4QQFA 3G5AA 3EC1A 4J9UE 1QP4A 2ZXFA 3V8MA 2IBMA 4DIKA 3TAQA 3R0JA 1I3MA 5CLJA 3V8EA 1RW4A 4N8SA 1YJ5A 4JC8A 3Q8XB 3EY4A 3WIUA 1SIOA 5LZ4A 3UZUA 1PLJA 4KSCA 3HN6A 2ZAOA 1YWGO 1U65A 4CTMA 3NDRA 1IULA 4JEMA 4E51A 3KXKA 1IK4A 3TB6A 2Z95A 5AYVA 2AMFA 3CF4G 3FWZA 4FFSA 1KS9A 2PGNA 2ZJ4A 4ZZIA 2P0EA 1V8BA 3FGNA 3OSNA 8LDHA 3SHFA 3CCCA 1GZ4A 4JLDA 3NPMA 5ALSA 1JTEA 1KVQA 1L9KA 5JQGF 1GNSA 3CEHA 3EDOA 5JI3E 1WPGA 2QEQA 3DJFA 3FVVA 1N33B 1B6SA 1X40A 5LP1A 5EIBC 3H2BA 4CF5A 2G5TA 4G0YA 2HOQA 4BJ5A 2E48A 3LGXA 4O8CA 1XSEA 3OTIA 1D1QA 1OAOA 3AHFA 3EH2A 5FTMA 2XT9A 4M6WB 1G8PA 1L4EA 1XE3A 2H92A 1MOZA 4JQZA 4Z6DA 1VL8A 3QY9A 1ZHHA 1JLKA 4Z1MA 3RT1A 3MELA 4D45A 3I2FA 4CT4B 5DIFA 2MCFA 4TKMA 4M1ZA 2HU8A 3TFRA 2XHEA 3DQQA 3K09C 1WE2A 3ONWA 3Q0EA 4TTQA 1ORHA 5GVSA 1NNSA 1Z6ZA 4XA8A 3LQYA 4IP0A 2ANCA 4K9SA 2Z57A 4GR5A 3QMMA 1ZD5A 2MAXA 2BCQA 2A2ZA 5JALA 2H4ZA 1HUOA 1PGQA 3ORYA 3MR5A 1D4OA 1A88A 2WYVA 1XWWA 4RM3A 3BREA 4GRIA 4XH9B 4XJVA 2B83A 2DWOA 4Z7QB 3AY6A 4E33A 5A0TA 3C3BA 1XLVA 4YA6A 4ITVA 2VH1A 1RWQA 4LQDA 1ZNWA 2Q3BA 2XZDA 1Y3FE 1FTGA 3N8NA 4MCJA 4PZAA 3J81j 3E53A 2FB9A 3K92A 4FSXA 3UBTA 1DT5A 1GRNA 4NXMB 2XTJA 1GAJA 2VXOA 3EULA 4EJMA 1EFAA 3R3UA 3GARA 5CK4A 4BB5A 1TT5B 2GFQA 4H31A 4ZZ2A 1W47A 2VFAA 4ZVSA 3DZDA 3LSYA 3LBHA 3FYTA 2TSYB 1XNGA 2WSSA 3KR1A 4IICA 3KHHA 4C14A 1GSOA 5THXA 3WVNA 2XBUA 3CX6A 1MG0A 1WHTA 3SKVA 4EW2A 3NBXX 5KX5F 5KYWA 3IP5A 3WXMA 2MOKA 1SCJA 2YXNA 4R2KA 4Y2QA 4Z4GA 5HFNA 2P67A 3U13A 1NW4A 2GZ2A 2MSLA 4FEEA 4GQIA 1DOZA 4DS3A 2HCBA 1SCIA 4KQ6A 2DC1A 1DE0A 3IJPA 2BMWA 4U3JB 3ZYZA 1XVAA 3H5AA 2H08A 3HV0A 4MV3A 1X70A 3WU2U 5FUBA 3EW9A 2ZJ8A 1L6RA 2DE0X 4NCHA 9ICPA 4WN9A 1U0NA 3PC4A 4KIWA 2GO7A 5J4KA 3H0LB 2IHBA 3PGXA 1JSCA 1GV0A 1GQSA 5KSYA 4FM9A 1F0YA 2FWBA 3FF4A 4M1KA 3WLFA 3X2SA 1W36D 3DULA 5JS2A 1PR2A 5TQVA 2FN4A 3WADA 3JD3A 3MABA 1O08A 4C8LA 3O26A 5KFXA 1JQEA 2QD5A 4YRJA 2DR3A 1YASA 3QPWA 2ORYA 4MVXA 3WLTA 4D3FA 4NM2A 4LJ5A 1JZSA 4S05A 1Y4SA 4XEUA 2OB2A 1Z73A 2I3AA 3VSEA 2O4CA 1T2NA 3EWIA 1ENPA 1ACJA 4NXNB 2EX4A 4O2RA 3OX4A 2R1TB 2ZXHA 2IHUA 4FW9A 1RM3A 9MHTA 3C3XA 3GMTA 4HRVA 4RZQA 4RQ1A 4PZDA 2H57A 4ITRC 3LT2A 4FLEA 2Q3FA 4EH1A 1QX3A 2OLEA 1A5SB 1TK3A 1CUVA 4CHTA 3IBCA 2OVBA 2HX1A 2YRFA 5GV7A 1ZN8A 1N6KA 4Y6GB 3J7TA 1YMUA 2EFDB 4L16A 1IH8A 1CB0A 4X95A 4FWBA 1T6BY 2K5UA 1MP0A 4BDTA 3CPJB 1K08A 4HH0A 3M1LA 5I7AA 5J63A 1CR6A 3SLKA 3IHWA 1ZHFA 1NMEA 3ZTWA 3IL2A 3AIOA 1IDOA 3OU2A 4UASA 4XRRA 3C87A 3DE6X 4MW9A 5ECWA 1GUZA 1JAYA 1NVFA 4D80A 2ZREA 4X5OA 2I2AA 4Z0NA 4A10A 3G2NA 1JJBA 5CP8A 3R8CA 2A5GA 2UUPA 4O4HA 1V11A 1E9CA 5IUKC 2B6HA 3ZHZA 4A5OA 5C9ZA 2VCYA 4BEBA 2E4AA 2QT1A 3GJ4A 2PLAA 4L72A 2XECA 1P2DA 5IMBA 3RASA 5J43A 4DMUB 2K2WA 3B12A 4ML3A 4Q7QA 3OO1A 1YD7A 2C03A 1ZCZA 1BVRA 2AI1A 2RHWA 3BGIA 3HPRA 3L0PA 3PVXA 4UD6A 1QTMA 1GADO 1ZUIA 4ZHQA 4DLGA 4ZHQB 2E7ZA 3FDFA 4GMFA 4XCVA 5FDFA 4FO6A 2I65A 3JAKB 2EW8A 4WLNA 2FPPA 3G3EA 1Q0SA 1XMJA 2KBEA 1J7JA 2O14A 3PUKA 4IWNA 5LB2A 1DAFA 3JQ8B 3PXAA 1WS6A 2R60A 2WVAA 1FVOA 3HYSA 2JB9A 3PQ7A 2FMSA 2YJZA 2N47A 2QUIA 1IBMB 3F2BA 4YCDA 2IYRA 1R37A 1Y3CE 2R5NA 1IIBA 3JATB 3V8QA 8ICJA 3VMFA 4ZYYA 3GBSA 4WD3A 1OYOA 4I50A 3UPQA 2JL1A 2EC5A 4XIGS 4V0QA 2Q1YA 3PC8A 5BUZA 3FROA 3RSLA 2A5DA 3PC2A 3I34X 4JXKA 3MLBA 3OD5A 1R8QA 1Z8NA 4PIPA 3CT6A 3CNBA 3M6FA 3BS4A 4P32A 4ROSA 3TAXA 2BCVA 4MWSA 4A2CA 4O4IF 2Y1XA 3QVLA 4G0UA 2M6SA 2LV8A 1KJJA 2AJ8A 4MB6A 4LE1A 1ZUD1 2OYSA 1U94A 3DKIA 4KX5A 4YP3A 3Q2KA 4YXFA 1P6XA 3E15A 3SQOA 4A23A 2CV1A 1E1RA 4YHBA 5BUCA 3OUZA 4KR9A 5A0FA 1OBHA 4MUFA 4YJ3B 3PUYA 4B32A 4QM7A 3VGPA 3ZIAD 3SZMA 1E0AA 3GMIA 4L5IA 4BC1A 1X13A 1UT8A 2HWUA 5DLPA 5IKEA 4NJ8A 3MWEA 2ECPA 2Y1DA 2I7XA 5AJUA 1DBIA 4CLRB 2R1UA 1QGDA 2XDQB 1VL6A 1G6HA 1CWUA 4JLNA 4KLNA 3ZBUA 1QZTA 2GAJA 3TSCA 2QBYB 1HE8B 3QVOA 1A7AA 1AXRA 1BMTA 2CPRA 8ABPA 4Q7EA 1PR3A 1ZU5A 1G0OA 3E35A 1I10A 1N2OA 2AT1A 1FUYB 1H5NA 3V7KA 3FPLA 4F93B 4YO8A 3AL0C 2GHQA 3MGKA 4KIGA 1Z4IA 4GNKA 4J43A 1OVGA 1YVEI 4TKVA 1RYRA 1PWHA 4RANA 5A3VA 3HTXA 4GOOD 3AUYA 3TPFA 3WTBA 3K2IA 1Z0FA 2ZJ0A 4RQAA 2H3QA 2XICA 5BOMA 3A1NA 2SHKA 3DONA 1WW8A 2JIPA 1ONOA 2PUCA 2J3KA 2WQ6A 2PSHA 5JEDA 1JSZA 1Y0BA 2PHZA 2OWEA 4OQYA 5GONB 1OFHA 4FT4A 4B2IA 3VNUA 5JD6A 4BQNA 4R65A 2Z5FA 4CMKA 4ZTBA 1W96A 3JR7A 4LZAA 5JROA 4A5SA 4UZEA 3TCNA 3RJTA 3TTUA 4I1VA 2QRJA 3V8BA 2HHVA 3MIZA 4Y1EA 1VLMA 2POQX 4BDSA 1SCBA 4O4LA 2PMZF 1I3LA 2CV2A 2YR0A 2IVFA 2QQFA 2J5XA 5M29A 3RB0A 1G98A 1T9CA 3DBOB 3PPXA 1KORA 1FP7A 3U4IA 4MWDA 4QYMA 3KKAA 4M60A 2WT4A 3ABOB 1E8NA 1SD2A 4QHYA 4BE4A 4LF6B 2HADA 1BCSA 1T0JB 1ODSA 1VLLA 2FSVA 2WZBA 3ASUA 4B44A 3MFIA 4I81A 4I6EA 4KQHA 4YJFA 4ZEWA 1JR6A 3GCXA 2PFPA 3AR2A 1M2JA 1MFZA 4I50B 1EFLA 1XPJA 4ENPA 1JVNA 3QTTA 1HEYA 1JSRA 1R0WA 4K87A 1Z6TA 3RSQA 1LBTA 4CF6A 5KZMB 3HU1A 3PJEA 4OU5A 3CVYA 1YZ3A 4RM2A 4YCCA 3F7NA 4BNJA 3UMVA 5ALXA 3I4CA 2QE7A 1QJ4A 4DLTA 2UZAA 3DMRA 3EGEA 2DEUA 4TTRA 3NU1A 4CRWB 3PK0A 4KMSA 4H1TA 4F4KA 2P4QA 1C5KA 2GQ0A 2VH5R 2JIRA 5CVVA 4PYIA 1E79D 3BXGA 4IZHA 1NQWA 2Y1LA 1SG6A 4HB0A 1JBEA 2VTBB 2P2NA 5GZ1A 1ZUNB 1YS7A 4RNOA 1K86A 1N2BA 1P0MA 1XKQA 2IP4A 3D5TA 3EIOA 4Y0AA 5BOVA 5IRCD 1DTSA 2DYKA 2WMYA 1KZ1A 5EKTA 3RT9A 3SR6A 2HOFA 1K6MA 1TU0A 2B21A 5KWJA 3RUCA 4NS1A 3RVSA 1MB4A 2WNHA 3TRFA 1TU3A 2PMDA 2ZSBA 1NLMA 1DOAA 2VP4A 4Z2YA 4NZ9A 1D8BA 4Q9JA 1KO4A 4DCVA 4CLRA 5EWMA 4RV5A 3BTVA 2XCTB 4ZDWA 3FC4A 1K0UA 3QVKA 4J1SA 3VNAA 5I51A 3A6KA 3C98A 5JS6A 1C30B 1REQA 4MWOA 4FGSA 3JD0A 1FXWA 5J8YA 4Z8YA 3BBLA 3EZ6A 1FTYA 4HWKA 4LOAA 3UY4A 1KI8A 2B92A 5EQFA 4MA4A 4Z9YA 4AVYA 1Z2PX 3W6PA 2BW0A 2VQ3A 1PZNA 1CUEA 5BO5A 1IZZA 1WEHA 3RNLA 1RYBA 2J46A 2X6TA 2AMJA 2XJ4A 9ICJA 1FXUA 4M7WA 2AN9A 2ZJ7A 1EE2A 4M1MA 3GLQA 2PWZA 3UCFA 2BZGA 3O3CA 2JFZA 2ACKA 2R86A 3IBYA 1NA5A 1GO2A 1OU4A 1P1BA 1J1ZA 2A5FA 4G4GA 3DEAA 4RUKA 2HVIA 1QP8A 1ZLYA 1ZM4A 1SOUA 2PZEA 4Q48A 5J4YA 2VPQA 1VE9A 4CKCB 1WPXA 1T8TA 3QOYA 2QX7A 4U6SA 4US2R 5KTMA 2WVHA 2JAHA 2GTPA 2VJMB 2PL1A 2VP2A 1XYYA 2D0OB 1AA6A 2QUZA 1RZRD 1GQYA 2ZAGA 1UQRA 2C42A 3NAMA 4K26A 1W75A 4M9RA 5DEIA 4IRCA 1P39A 1RYYA 4NULA 2I54A 2MHCA 3QPCA 1DXOA 4ZVTA 2W2LD 3KTOA 3MYRA 4AYXA 1ZEMA 4DDHA 5L45A 5L3VA 2J0VA 2C9CA 2CZGA 2DULA 3DBHB 3JS5A 4URHA 4A0RA 3ZXYA 1ZKDA 3GJXC 3N2KA 5ITWA 5CA1A 2YHBA 2CVFA 1SL1A 4JL6A 4IDCA 5EVCA 3KJQA 2Q4EA 3PSIA 1F20A 1S01A 3ABZA 4RT2A 1B8PA 3KJHA 4B1FA 2VJ5A 3RO7A 4EY4A 4P08A 2QM3A 3I42A 2FWMX 4RXUA 4IDHA 3LP5A 1KOGA 1RDFA 5KG2A 1CI4A 1I5EA 1MIOA 1ZMBA 2C0CA 4MEYA 2JDID 1RJFA 2WSLA 4MRVA 4HT3B 2ZIWA 4FGJA 4HB2A 3WWEA 5IHPA 5E6RB 4AN4A 4D26A 2IZOA 2X8JB 3UK2A 4HDRB 4PRZA 1M76A 5HQ3B 1U2PA 4ZOEA 1ZRNA 2W48A 1O5TA 4MIEA 4TV8B 1ZA2A 3NOOA 3AIIA 4S2EA 3G8BA 3HABA 1X7YB 3BEDA 1U8AA 2ZJAA 3ME5A 3CLHA 4KNYA 4PC7A 3DFMA 3EPHA 4XSHA 2CJWB 3KZOA 2EV9A 3PQDA 5FCDA 3DZIA 4DCTA 4IL5A 4AP5A 4YUYA 2A0KA 1Y8QA 1PI3A 3BDPA 2GN2A 2P1DA 2XKAA 3C7KA 4NAVA 1YE8A 2C3YA 3FMVA 4PW0A 4HYQA 5ER9A 5BMVB 3WGJA 4BCDA 1L7OA 4NV0A 1X3LA 2OQ2A 3DGEC 4M88A 3PDWA 5KBYA 3D3KA 1E1YA 1XAIA 4DT1A 1D5WA 1CQJB 1FMLA 1II8A 2PBZA 2Q50A 1V26A 4OB8A 4UNIA 5ADHA 1U49A 4FUTA 3VPDA 1JSLA 4EVQA 2ZTEA 5BW4A 2XGJA 3Q8WA 1DEHA 1PJ8A 1W9MA 3R0QA 1XN1A 3LK9A 4RD0A 1QK4A 3VPFA 1LXCA 3FTPA 1U7TA 1A71A 3AEUA 1ADGA 2BLLA 1HY3A 1VLQA 4RK7A 4IO1A 2XV1A 1DAHA 3AESB 4RPXA 4FWIB 4QXAA 4BO4A 4KZPA 5AW5A 4EG4A 1G59A 4AS1A 3WRXC 3HUEA 5JECA 1IVNA 3SR4A 2R5FA 3JSXA 3OIWA 2N46A 1G2PA 2DT8A 3NI2A 2M6KA 3Q8SB 3QUQA 1FNBA 1B0AA 1CS4C 1JHQA 1TVKB 2VQ6A 3QVSA 2YQZA 4MCIA 5FI0B 4CR7A 5KQRA 4B9NA 3TZLA 3C3WA 1NQOA 4I99A 1LBQA 1HG0A 1N5DA 2O2SA 3F2DA 1VIMA 5EWJB 4QZDA 2JS7A 4D0SA 4TLAA 5DNCA 2GM4A 1JQBA 2B4TO 3GAFA 3RAGA 3N7SC 3RDPA 2C82A 1DB3A 3P96A 5DBGA 3KYCB 4X00A 5SY9A 3MXTA 1NVMB 4KHZA 4K7JA 4ZI2A 3CUSA 4WBSA 3TQSA 4UTVA 3H0MB 4UCXA 1A9OA 3OEHA 5CDHA 4BLPA 3UUWA 1W581 1NJYA 2SCUA 5FKJA 2AYZA 5DYYA 3WSVA 1T4CB 2CKDA 2IX9A 1ZDMA 2TYSB 2VNKA 4UM9B 2IKQA 3FFBA 2HH9A 2I2WA 3JAWB 3E8SA 4TS3A 4WBXC 5DXAA 3UT5A 4I28A 3HO6A 4MEJA 2QLTA 4E5YA 5GTDA 3PMNA 3N39C 4IHJA 3DOUA 4TYNA 2VP3A 4RU9A 1ZQHA 2XOKA 1PZMA 2EJUA 1QZZA 1U4NA 2H1CA 3ELBA 4JODA 4M49A 4P3KA 4DNFA 3V9PA 2O2HA 1S10A 2OGSA 2BBSA 2QZZA 4OFXA 1GITA 2NUBA 2VHYA 4XGQA 4EGAA 5JATA 5AHWA 2H3EA 1TVEA 2QVCA 1VE3A 3D7RA 4RK5A 3ODPA 1I6MA 2PD6A 1UJ6A 5L4NA 1AROP 1K98A 1JHUA 1Q91A 1OX4A 3N8DA 5AKIA 1TAQA 1QMGA 3NVWA 3KB8A 4RZXA 5FQOA 2J6UA 1X1SA 3PUJA 1D2AA 3HB5X 1T2EA 2ODPA 4AKSA 3SI8A 3OY7A 3WLMA 1YFLA 3SM9A 1BPEA 2AW3A 2H11A 2QB1A 3C3AA 4D74A 3SZGA 5ITVA 2KHVA 4HXYA 2WABA 2M2IA 3RIEA 3DEKA 4UEQA 4EGSA 1B74A 4JI7B 2G0NA 5AKZA 1BS9A 2W4QA 4IV0A 1X7ZA 4URWR 5M2QA 4QT4A 2VJYA 7ICIA 1FU7A 3A1SA 3PNBA 1R3UA 5ALGA 2VDVE 5AP9A 3SHOA 1J7KA 1Z47A 3D1JA 5GTHU 1T1IA 2V97A 4AZ0A 4OLAA 1KFBB 1T7PA 4XLLA 4PTYA 4ER5A 4IIJF 1ZISA 4IMRA 4FZ3A 3TMAA 4B2PA 1XWIA 3LJKA 4LWQA 5IJ0A 1OZHA 3CA8A 4PC2A 2G40A 3PYMA 3TFSA 1IZ7A 1OA0A 3V2HA 5AVWA 2PJRA 2W22A 5JWHA 3KEQA 3DEHA 1K4KA 4UVHA 1YGPA 3SEAA 4DM7A 4JUDX 1BRMA 5DI9A 5B4VA 5C7YA 3CO5A 3QKRA 1NBEA 3WHKA 1AQ6A 4P92A 3WWOA 2PKQP 4O4JF 2JK0A 4LJ6A 2EGUA 1Q0ZA 4IDQA 1EP3B 4CMIB 3OURA 1NXWA 2O57A 2V9ZA 2XUDA 3UMFA 2O3UA 4ND8A 1C3EA 3TLGA 1RBQA 2WZDA 3C5GA 1YXMA 4BMVA 4G25A 2F8MA 3OHMA 3G6WA 3OUTA 3CYFA 2UDPA 3ROQA 1JFTA 5J9FA 3F5AA 3IELA 2W04A 2OKGA 4H0NA 2I80A 3D2BA 4JH0A 2HEGA 4Q6BA 4RGYA 5ENDA 1P7PA 1T8UA 1YS1X 1E0DA 5J59A 3TQHA 2D06A 1KKUA 2F43B 3GJZA 3NHWA 1JJ7A 2C0QA 3QA9A 1SNYA 1X1QA 3GGSA 5D6NA 2OXEA 5ANRB 4AXBA 3FUCA 3BFKA 1DQNA 1NRJB 4JI3B 4A6XA 5DH9A 3GUUA 1GPBA 2PL5A 4M6WA 1Y1KE 4BWGA 4EZEA 4MAFA 5G3ZA 3SOZA 4WZBA 5KAFU 1BPXA 5AHXA 2UVRA 2LR0A 5JFTA 3TLJA 4DSJA 3NGDA 2H7XA 3EC2A 5JXJA 1YZTA 2WZCA 3HP1A 3IPRA 5J1SB 3KJNA 1PKEA 5AVJA 3WYBA 1HUZA 4BUGA 2FLPA 1YKFA 3TE7A 3GAZA 4GPD1 4YMTA 5CYFA 4M9CA 2AW5A 3M5WA 2XSZA 3U4MA 3MMXA 4TUYB 4FHDA 1XXHE 3D81A 3EXIA 3D6UA 3LRPA 4YNBA 1NI3A 3U7QA 1P9NA 1UEXC 3JQFC 2FW6A 4LCJA 3TGWA 4UM7A 4AG6A 3ZQ4A 1ZN2A 4BO7A 2PUBA 2ZE8A 2XF8A 4DNOA 2NVUB 3RC7A 3W2EA 2O8NA 5F76A 5CMLA 1JECA 1UXIA 3QMPA 5FWNA 1ENOA 1XK7A 4MR8A 2CKMA 1JHAA 2EIXA 3QOXA 1U02A 3UWMA 1DUVG 2WHQA 3GNLA 4L22A 1PG0A 5AM1A 1EFVA 2WG1A 3C6QA 3GT4A 1QCYA 2QUKA 5FI3A 5JTIA 4F2WA 4JQYA 4QU5A 2YX8A 1VA4A 1FTNA 3R0VA 4MUXA 4TQAA 5BSFA 1TEZA 2HO5A 2QTAA 1VYVA 1CDEA 2BHSA 3INYA 5DTJA 4WCFA 1QU2A 1TNDA 2V7QD 3OCUA 3A2KA 4WACA 3ZD7A 4G2TA 5DNYB 3ZDYB 4O5KA 1TGVA 4ENRA 3JQ9C 2V6JA 5AHKA 4YREA 3VUFA 3LYHA 4YXWD 3FTEA 1PVVA 2XYQA 2G8LA 2R1VA 3FPHA 3WL4A 2GRJA 2ZAIA 3F2IA 3JQDA 4C7KA 2PMZC 5AHOA 2WAQC 4C3OB 1C1DB 1JLLA 2RBKA 3I01M 2Z30A 2VTEA 1X42A 2F8SA 4F1WA 5ALVA 3JTEA 3I4FA 1YFJA 3MWFA 3C2LA 1MGOA 1N8SA 2GWHA 4HG2A 4AUNA 1C9JA 1OLXB 3ZVNA 1X6JA 1X19A 1FTSA 3ACDA 4M8SA 4DQ0A 1YUBA 3R9XA 4EMTA 5GADl 4CTNA 5J0UA 1BWRA 4Q00A 3UMBA 2HKIA 3S2FA 2I4IA 4UOEA 4DCJA 4UUPA 3K72B 3AUSA 4GYYA 4URUR 1MHTA 1E4EB 5DYIA 5E9JA 5IKOA 1Q5PA 2EIHA 2QSYA 5CD9A 4GFJA 1L5SA 1C81A 2BM0A 3OETA 3DFKA 4HF7A 4KVAA 2BCUA 1DXHA 2VUSA 5EYPB 4MPDA 1P5FA 3R23A 4R7ZA 4RDXA 1JEAA 1A0OA 3DZ8A 3GEPA 4LG1A 1N5LA 1U9IC 821PA 1LK7A 1K6JA 5EZQA 1BD3A 1P7YA 4K46A 1WNTA 2XDAA 4TXHA 1L1FA 3TUZC 1P9WA 4Z3DA 2CLEB 1DXSA 4NS4A 2E4XA 5LQKA 3EX7C 3Q7IA 1GCIA 3FNIA 4OQMA 1TC1A 2Q1TA 2ESRA 3HH8A 1EIZA 1U7UA 2QVBA 3AQIA 4XR9A 1T9DA 4UUQA 3GLGB 1DKPA 2Q9CA 5C4MA 1Y9JA 1LA2A 2JGNA 1I6KA 4HZGA 3RT7A 4B9VA 1F1BA 5IG2A 1UK8A 3MT9A 2GCOA 4PPQA 1GKKA 3LG2A 3IHKA 3BQNB 3KZMA 2QRVA 3QX3A 4CEIA 4UB8U 2QI9F 1IQUA 1SO8A 2HYDA 1T8RA 3C4JA 3WK4A 3L4SO 4YRIA 4YJ2F 4QZGA 4OQEA 1GUYA 3WO0A 3EIUA 3LQKA 3W3ZB 2IYFA 4JKOA 2I6XA 1T9AA 4DS4A 1VG0B 3I9V1 5ALRA 4KO8A 5E2BA 5SZKB 4UMEA 2RAUA 2JH8A 3IVXA 4EAAA 1M8GA 2WICA 1H9BA 4FZJA 4P8RA 3JAKA 4WNCA 1QRDA 2JFGA 4IIYA 2NXWA 5BSGA 3DF7A 2DM6A 4PCUA 3AY3A 4DMFA 4TMTA 4GFDA 4GOKA 1KJQA 4ZD6A 2XY5A 4DYDA 1XJCA 2X9GA 3MCUA 3E7WA 4MQEA 4MULA 2GD2A 1ZNYA 4UHJA 2B1IA 2FMXA 5GJVC 3T4XA 4U7PB 1ZD3A 3UJAA 3V7NA 3RTBA 3FZGA 1V37A 3DDSA 1JHXA 4JVOA 5AVXA 3AIMA 4YP6A 7ADHA 1IN8A 2CLKB 5L95A 4IGEA 4FMPA 4BP8A 2FF7A 2NV6A 2VJLA 2ZS8A 4N0QA 4X97A 4F4DA 1UZNA 1Z0UA 2QXUA 5LDHA 2P2SA 2CVOA 4GC7A 5KG7A 1JMSA 3QEKA 4NLKA 4CL2A 1XK6A 5BQOA 3Q8QB 4K8RB 3GGDA 1Z25A 2IZ6A 3ADPA 5LP6F 4PNZA 2OBYA 3CRXA 1IHOA 1Z9BA 1TYBE 2HPHA 3LUDA 3KR0A 3KOXA 1JJFA 1UWVA 4DGQA 4EY5A 2FQ1A 1NQVA 3PNVA 4HXEB 1VECA 3VBCA 3CMCO 2A58A 1VLBA 1TEHA 2FETA 2IF0A 3VC7A 2B30A 2D1TA 3KD2A 5FWYA 2BCSA 1Z74A 3U5ZB 4PSDA 1D2NA 1SUEA 2P0YA 1XMOB 1RMQA 4QFBA 5HKKA 1E3LA 1V2GA 3KQQA 3X44A 1G8KA 1VBMA 5B1EA 4OXNA 3BFVA 4L95C 3O9MA 1RWWA 2FEXA 1QDEA 4KO4S 2PH5A 2WQZA 1PSDA 3EF0A 4IQFA 3M3DA 3T5GA 1WCXA 2B5VA 4Q3LA 1UINA 5DZSA 1L0BA 4DDTA 4BGUA 4CQNA 1AB6A 3RLIA 3K70B 2QU8A 1SQ0A 3DZKA 2WHYA 4HNQA 2KW5A 1N9KA 2HTFA 5ED0A 3TDNA 1D9FA 3RODA 5BSVA 7ICUA 3HBNA 3O90A 1MNAA 4JQOA 3LLSA 4XXHA 3EGIA 1UMCA 3G0IA 5K6AC 1V45E 3QIAA 4P31A 3P7MA 4YWJA 2ORIA 4G5RA 4WXPA 5FUMA 1U8ZA 1AUVA 2OH2A 2ILTA 2CMHA 1H9CA 2D3DA 4P4TA 1A5AB 2FEWB 3NNDA 5LUBA 2PUAA 1MF7A 3GRFA 4Y9UA 5J2FA 7MDHA 2DP4E 1I0ZA 5TARA 3RAPR 2Q6VA 1I9CA 3BWDD 3D0OA 2E5SA 4BZPA 4F5RA 1NKSA 5WRFA 1MJHA 5T4FA 3WNDA 1L5OA 1ID1A 3OC6A 4UHEA 4X1YA 3H2GA 1CUXA 3VSDA 1IHXA 1AK1A 4UE2A 1LDEA 1ZWKA 4W7HA 2ZZNA 3WYAA 1KFTA 5GJBA 2VT3A 4LRTB 3FTCA 5KNBH 3ZD8A 1SCDA 4Z99A 4DL4A 3AFOA 3CHYA 3KKQA 4ARSA 5TV2A 1BPZA 3UK7A 2E85A 4TXJA 4B81A 2GBCA 1J5PA 2JAQA 1DX6A 3GZNB 1KIFA 2EF1A 2OGTA 3O3OB 4FCCA 3UAXA 4HHEA 1BO6A 3OOEA 4OI4A 4G0WA 4Y67A 3VR6A 2BKAA 4B71A 3DHVA 4RH0A 3PFGA 1XCOA 1SUWA 3KVOA 4F4UA 5AI5A 3HJRA 4J16A 1Z0ZA 4RDIA 4BGIA 4B3GA 3B60A 3V4PB 3VHRA 3SQXA 3T7EA 3EXHC 1TCCA 2ZRIA 1J9GA 1S4MA 2QXYA 3NM6B 3LDAA 1W35A 2IDMA 4KQWA 5EKUA 3CRMA 3WBKA 5MGBA 4FPXA 4A3SA 3D0KA 3H1TA 1N0WA 3PXEA 4M53A 2JEOA 3O0TA 1H42A 3L77A 4XI9A 3VDMA 1VDZA 5KFVA 1B4DA 3HGMA 3WBJA 4DV1B 5CT6A 1WW2A 2EKPA 1I51A 3KLBA 1R6BX 2NLOA 4JIGA 2JIOA 4PX9A 1QOPB 1V71A 2BFCB 4K9OA 1T1GA 3U3OA 3IUYA 5EXXA 1Z5UA 2AGQA 3DVSX 4ZQHA 4CBVA 1L3SA 5HJ5A 2BEVB 3AC0A 2JAUA 4XA5A 5H3LA 4DVGA 2PSJA 5LJIA 4OQPA 1E32A 7ICJA 1Z38A 3MLAA 1JA0A 4CIDA 3RJ5A 3LOUA 2GJKA 1T9GR 3P4YA 4GH5A 4REQB 1NI4B 2WE7A 2NNWB 2J8ZA 1KETA 4BNLA 1R0SA 1M34A 3IDSA 4MEXA 5DMHA 3G2OA 5IVPA 5EHXA 1VSUA 5L7WA 3K0CC 3R2JA 2CHFA 2FG7C 4JFRA 1YF3A 1F8YA 4PAQA 5JZ9A 1O57A 5CYGA 3PJDA 1VCIA 3T5LA 3CRVA 2NTVA 1CETA 1S2NA 3E3OA 3LQFA 3NBAA 4I2EA 4QSHA 4E3ZA 1WD5A 3FOFC 4OL0A 3WRVA 3PNOA 1TVMA 4O59O 4KN7A 1HGXA 4OHWA 2PX3A 1Y7IA 3P0HA 4KPUA 4O4HF 5IJ9A 3UAWA 4GX2A 3KSDO 1UKBA 4XB6B 1V7CA 5J2AA 1GT91 3QX7A 3VU9A 1T3LA 3VM6A 2ZZMA 5EP4A 1PSZA 1L3VA 3C23A 5F1YA 1F8GA 3JQEA 3PW5A 3SGLA 5KFCA 3M5PA 1W2WB 1I4OA 3PGLA 4LJYA 3KCNA 4NYIR 5DK4A 2C7VA 4GVXA 3W5VA 2R62A 3ZHOA 3DLHA 5BXQC 2QMZA 4UXIA 2WHXA 3G2JA 4L9SA 1C8BA 5KQSA 3EUEA 5EJ9A 1OJ7A 4ZEVA 3C1OA 1CEQA 3N2ZB 1EMDA 1MRZA 4L3VA 1T6YA 1U5BB 3QE0A 4B3XA 2FFRA 1NI4A 1CUZA 2RHMA 2X8BA 2DERA 2FLKA 1O58A 1UMCB 4DLXA 2HA6A 4LYFA 2VAMA 4FOLA 5EXDA 1AKUA 2QBYA 4J0DA 3JQ7B 5BSHA 4NMWA 4RYDA 5L8VA 6ABPA 4NLLA 1N60A 4IF6A 4WXYB 3B6EA 3ROZA 1TF5A 3LDFA 4C21A 5I4IA 5IS2A 1HDGO 3R5XA 1TQDA 1JMKC 4KIUA 4M89A 2VT7A 2A9RA 2YUTA 4GVLA 2W54A 1HMPA 1IQ0A 3EZFA 3Q72A 2UV8A 2NN3C 4QZFA 2AX4A 2GRAA 3QGMA 3U16A 1LEHA 4V1CI 1R0YA 4TKUA 4JUAA 3FLEA 2VP0A 2CWWA 5ITZB 1Y82A 3AY7A 4FN4A 3M4NA 4YROA 1GAWA 3A25A 2BD0A 2G5HB 3AMVA 4ZCSA 4EECA 2WT8A 4WLEA 4C0QC 3VYWA 4BZXA 3IEUA 4F4ZA 2PR2A 2RH5A 2HDOA 2QRPA 1MX5A 4MJ7A 4S0ZA 5JNLA 3EYAA 1CQXA 2RI1A 1DFGA 2JFUA 3LMKA 3NCHA 4MQMA 2QARA 3KAKA 2C83A 3WQHA 2P65A 3TD2A 2C2RA 2F4NA 4TLCA 2DBRA 4QG7A 4BNNA 5KHAA 2P6PA 3T9BA 3W7AA 3MEQA 1FLVA 2W2LA 3O8OB 4UFPA 1NVVR 5AXAA 3SEQA 3FDIA 4KLJA 2ODEA 3QKTA 2X1VA 3UMRA 5CXXA 2I78A 3ZWWA 3M5DA 3CRNA 2Q6IA 3BGSA 4N0PA 2GYUA 2J6BA 3D6FA 2HJVA 1MX3A 5DXFA 3ZU6A 2P69A 2ZFUA 2XB2A 1KO1A 3FF1A 1SIBE 1DBRA 1P7ZA 2CBZA 1IIRA 4HWRA 1JA9A 3CKYA 1USUA 3FAKA 3SE0A 2P9CA 2NUTA 1B23P 3AQFA 2FPGA 2H9IA 3K2EA 2EBFX 4TWBA 5GTIU 3DR5A 5CLIA 4AO8A 2RGNC 1C8LA 2GH1A 1QK3A 1RAFA 4JBIA 5FYDA 4FFWA 3OJWA 4EA8A 3NIFB 4YMHA 4I1PA 1UBKS 2KICA 1CCWA 3B9RA 1SXJC 2IPAB 3DD1A 1U9LA 3D0RA 1RWMA 3EZXA 3MM4A 3OCXA 4Q66C 1XPRA 1A5ZA 5DIZA 5FOSA 9ICFA 1JR2A 3EZ5A 4J4BA 1IM2A 1KDVA 3ROGA 3G2PA 4WZBB 4U6NA 2IUSA 3BH7A 3NXKA 4GX0A 4RLSA 1FSGA 5C4GB 1W5SA 1TT5A 5C51B 4QHSA 4R16A 1WOYA 4RF2A 3MGCA 4EI2A 2J6TA 1H1DA 4LVNA 2ATVA 2JDIA 4Y98A 3K8YA 4Q3BA 1QQBA 2J9ZB 2MTBA 1MHPA 4X61A 5DBEX 4A6EA 3KIPA 3V6JA 1KOLA 5LWQA 3HMKA 4ZCTA 5HQJA 2WD7B 1ZNXA 3BJRA 4TUQA 3KEOA 3PC8C 3L0IB 4FINA 1SKUA 2AN1A 5FBKA 4G1CA 3W4JA 4P3NA 3UQ2A 4Y6LA 3O0FA 3WMFA 3PNYA 1UAAA 5BV0A 1KJZA 2G70A 3IOYA 3QU4A 1JLMA 4JA0A 2PX0A 3GI1A 4JYBA 3UJ7A 3WQQA 4LXQA 2WWTA 2OXFA 4BX2A 2FNAA 5U4XA 4F21A 2VN8A 3T3EA 1JR3D 3ZCPA 3RVOA 3TBFA 4R2LA 2PD4A 2N3ZA 3GMSA 5A4MS 2XZLA 1NXPA 2R8YA 4MPJA 3KLMX 1ZQNA 1BOOA 4DWWA 3HK2A 3IJRA 5FB3A 1Y7TA 1Z8FA 2GEVA 2IGBA 3F49S 2XVYA 4H9GA 4OIMA 3ZE8A 3UK0A 5H9WA 3JPPA 5I47A 1C29B 4BPBA 3ANLA 2ALZA 3VC2A 3HR7A 3PD0A 5EIBD 4CIYA 3LCMA 3T7TA 3BQ1A 2YYSA 2WW8A 4LOHA 4BXOB 2Q9BA 4EA7A 1HEIA 3BUSA 3WGMA 4DYHA 1W94A 1Z5GA 2PNFA 1IIPA 3IP6A 4PQEA 4N3NA 3ZDDA 3I3OA 3ZWKA 1L7MA 2KNJA 5DYNA 1JFFB 1ULSA 3H0KA 3C74A 4FBMA 4U3JA 1ECLA 1R2QA 4S0XA 5B1SA 5CA1B 5KYXB 4IOKA 3K9GA 3CUUA 4TX1A 1C8VB 1N6RA 3F1LA 2C2WA 2FMIA 2ATIA 5C4IA 3FUUA 3E70C 4FOOA 4K9KA 4ETMA 4YMGA 4UHHA 1GGVA 2OYCA 2Q21A 4TVOA 1ZEJA 3BF7A 3N59A 4HQNA 5B1DA 3GDOA 3NWEA 3LHKA 2NU8B 4LXXA 4C80A 4UBIA 2NUTB 5KG3A 6GPBA 5FJJA 3MGIA 1A2OA 1RTTA 2P2LA 4B3JA 4CETA 1DJQA 5HYVA 2FWAA 3BB4A 2ISOA 2QV7A 4Q4JA 3SDSA 4GL4A 4WFQA 1MCZA 2ZTHA 2FZKA 2ROQA 3B78A 2W9AA 5CWRA 5B58C 1LDMA 3RBAA 4ER7A 4UFOA 3M8SA 2VK1A 4CQLA 4EZBA 2P68A 3E1GA 1GPMA 1N1DA 2XTNA 4D4GA 3QVTA 3CRZA 5SZHB 1DAEA 3A1WA 3U7QB 3DYVA 3RANA 3W7BA 2I55A 2A0YA 3B52X 4BFYA 5FPPA 3COJA 3QLEA 4DF4A 4EKDA 4F45A 1M0SA 2OHFA 1NK6A 3C3JA 5CA0B 4ARCA 4B9UA 2BFDA 2GLUA 1I4EB 1JN0A 2PVPA 3OQJA 4M37A 4R5MA 1WXXA 4C0LA 1QGUB 3G0DA 2Z09A 3GZFA 1WUYA 1G3QA 2KB0A 4C6SA 4ZOLB 2OPBA 4C0AC 3N7PD 1BEUB 4ECTA 3AINA 2A14A 1I01A 3SQNA 1G6OA 4TYMA 1YR3A 4ZVQA 4OUKX 3O38A 2LDXA 1PU2A 1YDFA 4L8FA 2Y9PB 3THVA 4DSLA 2H65A 3STWA 2UYCA 8ICAA 3DD5A 1PHPA 3LUCA 1CVLA 1K75A 3DOHA 5GM1A 5JNTA 1SKAA 1KQ3A 2WJVA 3GIMA 2ZYVX 3GJQA 3GLKA 4O2AF 4F6RA 1E9VA 1LKZA 1O7JA 4FGKA 4NJMA 4NJMB 4BRUA 3GY0A 3QFRA 3LT4A 2AL7A 1TTQB 5CNMA 3M6UA 4Z86A 2GVDC 3A04A 3SG0A 2NGRA 1OH7A 4BWMA 4FOSA 5KYUA 4RY2A 3MTQA 2H2HA 2REQB 3T12A 3GRAA 4XPZA 1LTQA 5LLSA 5J40A 2OOKA 3UJ9A 2RHGB 3PT5A 2ASEA 5K3AA 1FVXA 2BKUA 3A4YA 2PXCA 1GQ2A 1NTOA 3MGGA 2ORWA 2Q49A 1KP9A 1JN3A 1P0CA 4KOAA 1DI0A 4ZU3A 2XQVA 5JISA 3LWZA 4DSUA 2QSUA 1LLUA 2JKVA 4RQ8A 3HKDB 1KFDA 1L5UA 2UZ3A 4K0RA 5F21A 2D5CA 3E48A 4M98A 3RK0A 9ABPA 3GB9A 3EIEA 1XWLA 5BNZA 1EWVA 4ZREA 2W0SA 1R0XA 2VUTA 3D4OA 3F5FA 4LCEA 1SC3A 3QMVA 4Z0PA 4F38A 2K4PA 5EE1A 3PV0A 2C4UA 3OOHA 2LP4Y 1I0IA 5DASA 1HL7A 2AK2A 1AURA 5K4LA 2KP7A 3SFZA 5I3ZA 1F2TA 1Q7CA 3K32A 3LM8A 1NU6A 1CJMA 3ICVA 3OLQA 5FXMA 2LBOA 2YFQA 3ELUA 3VU8A 4MUBA 1IXRA 2FQYA 3C4QA 5LQAA 4PG8A 9ICCA 8ICIA 1OBCA 2FOLA 2UYQA 5TRTA 4OO1J 1T35A 3C85A 1T9HA 3AH8A 1N7IA 3S2IA 2XE8A 1D04A 4IHQA 1KZGB 1F0NA 1U9ZA 1Y3HA 5F64A 2BHTA 2G72A 1YDEA 1J1IA 3GFTA 3BMQB 1UBRS 3WWYA 1PL7A 2ZUCA 5KYYB 3M4JA 1BKSB 1Z13A 3B9QA 4N9QA 3CEAA 4QRHA 1JA1A 5T64A 3HBLA 1BW9B 1X14A 3ISVA 3SR3A 2M6LA 1TKAA 2PQ0A 2V6FA 2XF2A 3UUFA 5I7UA 1TGYA 4YN4A 1TZBA 1WU8A 3ANMA 3V1UA 4DDVA 2NXEA 1Y1RA 2IE8A 5HE8A 2MA1A 3VR6D 3KOOA 1LI5A 1FVFA 4RK1A 2VZ0A 4B87A 3IIMA 3DMNA 4CE6A 4TL9A 5FYQA 5HUQA 3TGLA 4NFSA 3NVZA 3T3NA 1NJ8A 2FTKE 3IIKA 3BTOA 4G26A 4G89A 3VR3D 2WM3A 2E0IA 3DV0A 1SXJD 3AKEA 4X1OA 3T5DA 1PQPA 3WWDA 1Q1EA 3C6BA 1N5JA 3PI6A 2OXOA 2CFIA 2HWWA 3B8EA 4KQ2A 4GAEA 5HIIA 2NT3A 2A1AA 4WKCA 1IN1A 3O21A 1IBRA 2VZ8A 4KLEA 3G79A 2OSBA 2BN4A 4UAYA 3R9IA 5JSZA 1T8SA 1KY2A 2C20A 3PRYA 3GV7B 2PFGA 5K3FB 4CMBA 2ENWA 3ILXA 2GOYA 4OHKA 5JC8A 4E5SA 1QC5A 1ZH6A 1YI0A 3PEYA 2JHPA 4KSYA 4JQCA 4PO3X 4RLFA 2RGEA 1ZM9A 3LCVB 1BAPA 3VFDA 4CIBA 3U6KA 1S4QA 5KT2A 1TM5E 1U9YA 2C4HA 3BOSA 3OIVA 4KKVA 3P45A 1XS9D 4RMGA 3HR4A 2IDZA 2V7EA 1DKRA 1XLUA 1PT5A 4IJ5A 4I1SA 4RTNA 1GA4A 2CJWA 3FA2A 3I8SA 3QYAA 1C1XA 2ACWA 2C54A 2QY9A 4BUCA 1VIVA 3FOWA 5EWEA 4J8PA 1JKJB 1UWLA 3HBMA 4LV8B 1RYNA 4MNTA 2WM2A 2W2NA 1P9OA 1CYDA 1QRRA 3IP4B 4MUGA 2XZTA 1EUYA 2GKGA 3SQWA 5D3MA 2UU9B 3EVDA 4F4WA 3NAZA 4J1QA 1J56A 3IVAA 5CNJA 3PIDA 3BDIA 4HI0E 3ICWA 3JD4A 5F7XA 4QOFA 4KBGA 4MV7A 4EG7A 1MN8A 2I99A 1U0TA 3WB9A 5FBQB 4PLVA 3THYB 3NEYA 4JOQA 1TKCA 3K1AB 4UEJA 1SBHA 4J0GA 3L4EA 3WYGA 1E3DA 3FYHA 1P5JA 1XHEA 2BGUA 4NPAA 2H5EA 3R3ZA 3HJGA 2NPFA 4Q02A 1YDWA 2O07A 4KTVE 1JE0A 1WP4A 5LZ7A 3E5HA 2KEYA 2JGKA 1VE1A 2D8AA 1PZEA 4Q1DA 4ZOAA 5IIKA 1XZGA 3JWPA 3EBOA 2QNRA 3ITKA 2UVPA 2VYNA 4UBOA 1TMOA 4YASA 2Z7JA 4DY6A 5DQGA 1F6BA 5CVJA 1YOVA 3RREA 2OMEA 4L4UA 2I5HA 1BCSB 1NONA 2C2GA 3E05A 1R4MB 3K9QO 1I1NA 2H1WA 3W78A 4DJFC 2Z5GA 2YYYA 4EABA 2R8BA 4Q4AA 3QP9A 1WSWA 3HP7A 4MW1A 3TFWA 5TR9A 4QBHA 3KYCA 1E6WA 3IPLA 2OM6A 4JGGA 1VJ5A 2QB0B 3D7LA 1EM8A 4YMSA 2XUIA 3HCBA 1TCAA 5JARA 3R5SA 5DTEA 2FFAA 5KCMA 2QJFA 3AYZB 3I04A 3O2SB 4Z2AA 5CUQA 2H2AA 3AKDA 1SKRA 4ZCIA 1X2IA 1KY5A 1QIFA 1J2EA 3LPAA 2JJ2D 2WIGA 2A1TS 4PZNA 4YP1A 4QAJA 4CW7A 3RJKA 1FA9A 3W5SA 3WA7A 2PV0A 4YWHA 5CBKA 1KVTA 1I1OA 3LY7A 4NLBA 1XL0A 4ZJZA 2FJPA 3Q88A 1YTLA 4LZWA 3NGXA 1PR1A 3QKIA 2MT9A 4M8IA 5EJ7A 1SCKA 2XWJI 1U5BA 1NN5A 4YRBA 1P77A 3S5JA 3PEWA 2M0NA 3AETA 4N4AA 4ECXA 4QJBA 3L7AA 4EX7A 2EZYA 2EZ9A 3L8EA 1WXQA 1WSBA 2R4TA 3R9KA 3TG2A 1YS2X 4HDMA 4WLOA 2OYYA 4MVJH 2HF8A 4YJFB 4XYMA 1JQJC 1DXQA 3W5HA 2NTEA 2AWOA 5CEHA 3WL7A 1K9SA 4S04A 4KE8A 3TLMA 2IP2A 3I8OA 3JWHA 4H16A 5TF4A 2WLTA 2XB6A 3KU4A 4AJIA 3MN1A 4Z54A 4KX3A 3LCUA 2DWCA 2MYPA 1EFCA 2JLSA 4CM9D 3WTCA 2I3GA 5HTOA 2BH9A 2C78A 5DBHX 3IDAA 4XDYA 1ZBQA 4X24A 1GAEO 1YCDA 2QS9A 3HFRA 3NHFA 2H1VA 3GA7A 4GW3A 2H1LA 3CNHA 3O8QA 2AHOA 4C03A 2WDZA 4HGNA 5KEIA 1G7CA 3EQ8A 4L0CA 1H8HA 4Z0HO 5TXGA 4KQGA 5GM2A 4N3AA 2JEGA 3T3GA 4F46A 1U0BB 4TUPA 2YJ4A 1Y1PA 4FDMA 3CNLA 1RRFA 3G5TA 1EBUA 3MRSA 4RSMA 4KYUA 4OBEA 2DPIA 5AKJA 4K4GA 2XC9A 1QPGA 5KJEA 2LMRA 4AD8A 1JPUA 2G1KA 1WWVA 5IXJA 1HE3A 1E8MA 3EEIA 4HEA6 4TL8A 2LXNA 4PNPA 1WSAA 5HKAA 2ZUBA 3V6KA 3NLLA 4O33A 3S70A 5K0LA 2NVBA 4MQFA 1OZAA 2C31A 4E15A 1RRGA 1MD9A 1WKBA 2JKZA 2LDBA 1VMEA 3GJ8A 3HUDA 5TQ2A 3TQIA 4CYMA 3RTVA 4KBFA 4ESEA 3TO5A 1COWD 2IGTA 4DV7B 1TO1E 2J3MA 4FX2A 3GFGA 4Y1RA 1RWVA 1L5MA 2B7CA 2CZQA 2CYCA 1WDKA 2REXB 2NZXA 1AVTA 3HC7A 2VDJA 1ECBA 3I6MA 3M0EA 3OLXA 2P30A 3G0GA 3RS3A 3ISBA 3T7DA 4FD2A 1LLQA 1NBME 3IAS6 1J07A 3GD7A 3W8NA 2ECFA 4J0JA 1ZWLA 4MKHA 5JSYA 2IEAA 3B9JA 4F4XA 1M2NA 1T3QA 2YHUA 3DMGA 1PFGA 4NMLA 1H6CA 3Q1LA 2J5QA 2JLBA 1YU6A 4HB4A 4HGRA 4FE7A 3PW2A 1BDIA 2HJ9A 2PQ2A 1XDBA 4Q4AB 3VPXA 1Z16A 4RPLA 3VX3A 1N34B 4FCVA 1R66A 2L69A 3GPLA 2JZBA 4BLWA 4P7JA 2V7TA 4RUCA 2F59A 3K53A 5CFPA 1IB0A 3D59A 2IEBA 5DGBA 1H1TA 2FK7A 4RKYA 5G1PA 3ZGZA 3AT1A 3H9QA 3GLFA 5ULLA 4F3NA 4REOA 1FMJA 3UO8B 4EATA 3RFXA 2K6GA 4CU2A 5J2DA 3K5IA 3D02A 3I01A 4G3XA 3VOTA 3OIFA 2BTEA 3SICE 7ICNA 1EZZA 4XVQA 1RXCA 3HCNA 1UPBA 1QTRA 4QSMA 5LQMA 1ZGGA 4BHTA 2J41A 2O8FA 3C1YA 1WB6A 2E6KA 2FRDC 2VJQA 1ADBA 2F1IA 1XYVA 3FGPA 2F6RA 4S1OA 3C1TA 4R8SA 4KFCA 1RBMA 1UFOA 4EUHA 1Y9AA 4MJXA 2EWVA 5G0UA 1O4VA 3DTVB 4Z8XA 4UARA 1KH1A 4XFDA 5ALTA 1GP2A 4F11A 4O3PA 1SKSA 1PJLA 1VI6A 1Z2CA 1QR2A 2FPOA 3PP8A 4FFRA 1DJOA 2O2JA 1ZG3A 5FFNA 3VH2A 1QIMA 4U4AA 2AFIE 1Y81A 4FYXA 4G0OA 4QGGA 2QDXA 4R3WA 3AU2A 1QIIA 3N7AA 2ZAMA 3BCUA 3SOPA 1RP1A 1JG1A 4ZPXA 4DZZA 3PEEA 3WAGA 3B9BA 1N2IA 2ATEA 1QYXA 2O2GA 2F2AB 2RGNA 4FFVA 3UGTA 2HYIC 4MAAA 3ITNA 4ECZA 3GRVA 3L8DA 5K6TA 1AZSC 1CY0A 2PRKA 4BIMA 5EIAA 3CS3A 5JE8A 3KKNA 1PV4A 4KUGA 5GZ6A 2RG7A 2OBNA 3C21A 2Q2NA 3E9MA 3IESA 4ZT2A 3UWKA 4C6TA 2C98A 4KDEA 3PCRB 1LWOA 2NUPA 1L1RA 4MR7B 3BZWA 2R8IA 3LUJA 4X44A 4CM1A 3SFTA 2Q99A 4HDNA 4B74A 7ICRA 3UB2A 4C01A 5JJKA 3E0XA 3ZEAA 4I5DA 4NFLA 3WISA 1V5GA 2FZGA 4EIWA 1KEVA 1Y89A 1YB5A 1OASA 2C5HA 1LF0A 3NVVA 1EVLA 3LC1O 4MMXB 4QECA 4UUNA 1TJ3A 2CDNA 3Q3EA 4ND1A 3JYPA 4GOXA 4DQRA 4Q7JB 1HDCA 2PIDA 5EUMA 3RSCA 2ZPTX 5F73A 3UQYS 1IBCA 3TLGB 4CUZA 2ZYTX 3HXLA 5BSMA 1CZOA 3A1CA 1KMHA 3RRZA 1Z88A 3H9EO 4MHVA 5ESXA 1A96A 3KLOA 4MDEA 3HZZA 1B0PA 1OVMA 1YV9A 2ZKIA 3IAM1 1I2ZA 3JARB 1V3TA 1WMDA 1Z4PX 2YRWA 3LYSA 1EINA 2GXUA 3I04M 5DOZA 3ZWVA 3RFAA 9ICKA 1ADJA 1G8MA 2QZ4A 4N5HX 1E58A 2JZCA 4UAZA 1QFXA 2DFDA 3DT6A 3PITA 2NTJA 2VHZA 3FCEA 3PW4A 4GYJA 1GGHA 4OQQA 5AH0A 2A9KA 4NYJR 1U28A 2YWGA 5KYTA 5J29A 2ZCVA 5DX1A 4ZCLA 1V8ZA 1OFUA 1IY9A 2GM9A 4NEHB 1SBZA 1PZXA 2WEKA 2KYRA 4O25A 3EDCA 1VRVA 2AQHA 4NNJA 4YLYA 3JYQA 4U9UA 4RH3A 2D7CA 2BFDB 1Y5IA 2QZSA 1GSHA 3DVQX 1X7WB 1TMYA 4OJKA 5LCXA 1KVRA 3K31A 4EHLA 1P0PA 1YRAA 1AHNA 3I52A 1NN0A 4IKPA 1CJUC 2PXHA 1SKQA 1D6NA 1JSXA 1LRJA 3OSZA 1TXGA 2IY9A 2BMDA 4BO2A 5I4KA 2TMKA 3L8FA 4NF2A 4UAUA 2RH9B 3W4IA 4UHKA 5HP4A 1W4BA 1N2XA 3AERB 4QLAA 5FBVB 5IEJA 1GRVA 2QP9X 4TMFA 1XZ8A 1URPA 2PZGA 1DV1A 5AK3A 1ZQYA 1GCGA 2IYXA 4R2IA 1NOMA 1MX9A 3HKZF 1KI3A 3QBEA 4IOJA 4RVFA 4L5CA 3KQTA 3CE6A 1P62B 4JEIA 2JVKA 3H16A 1FDWA 3WL8A 5F78A 4JXZA 3A0HU 2ES4A 4QLOA 1T4GA 2VDKB 4HVCA 4LTMA 4RJTA 4U7DA 2R8ZA 3FBTA 3MS4A 4AICA 1B8VA 4C4ZA 1N2SA 2HMVA 4KIJA 4QT0A 4AI6A 3MDCA 1EA5A 4JSRA 3HMQA 2IV7A 3ZJ5A 1YU9A 2J3EA 3AHIA 4BO0A 4XSVA 2A3VA 1GPAA 1E18A 1IDN1 1Y37A 2CEAA 2FRXA 2R7KA 2VAVA 3X2FA 2RLTA 3K0CA 4C6RA 1IBLB 1BJTA 1E2MA 1MLDA 2Y0DA 3HI4A 2GPTA 3NW9A 3PPYA 1JG4A 4LXIA 3GUCA 4QDJA 2MYNA 5BQPA 5AJHA 3UEOA 4EJSC 1A8IA 1HDRA 4GKJB 2GARA 1LFAA 4YY3B 1QG0A 4BYMA 3KKAC 4ZJUA 4DJDC 1ZD9A 5I3CA 1EK5A 2AUMA 2Q3DA 1HBJA 1SC1A 2XVXA 3AUAA 4ZKDA 4YI5A 3L7BA 5ETJA 1EE9A 4NEQA 4OK5A 4L2IB 4WJ3B 2CLHB 5JAQA 4EPRA 5EHZA 2F3QA 4N0EA 3D8RA 1PFKA 2NSYA 1PUJA 2IV2X 3V4OA 4C0SA 4ZYUA 2CK3A 2X2FA 4TLDA 2OM2A 2NZ8A 1NNI1 1JAHA 3WMXA 5DDMA 1P75A 3DGFC 3FD8A 2OEHA 4Y2YA 2MSDB 4HFRA 1TPZA 4P3XA 1N6IA 1S7GA 5J2TB 1P1CA 2FEAA 4I3HA 2BEKA 2V55B 2RB5A 3SIRA 5KFKA 2JR5A 1MAVA 4RUAA 1KBOA 1W9HA 2WIJA 3L6CA 4NJEA 2RIPA 4E7OA 1CS0A 1W88B 4Y30A 1GLNA 4KV7A 5K9ZA 3BS5B 3V3KA 2WAQF 5FNVA 4O3QA 1H2XA 1YO6A 2Y4NA 3FKSA 3OJLA 2BR4A 1WCNA 1K68A 4ETWA 4URFA 1E9AA 2JI9A 4L76A 2JEIA 4KXXA 1CP2A 3UYKA 5LLDA 2SKCA 3GC6A 3TR5A 7ICHA 3NVAA 5E1BA 1YVUA 5GV8A 1S5LU 3TR0A 2FE9A 2BQUA 1K66A 5B2ZA 3RE1A 1UJMA 1ZQXA 4NCXA 16PKA 4D92A 8ICPA 3HRDD 2BTOA 2ICAA 3HG7A 3T5HA 4RJ2A 1R7RA 5ESWA 1CZUA 3GRPA 4OQXA 5F2EA 1OD6A 1V0JA 1TF7A 3TKAA 5CB0A 3P2OA 3GAAA 4MAMA 3RC2A 2ZB3A 3H11B 2C0PA 2JVJA 1BJRE 1OZ0A 2VWQA 1RKQA 2XMPA 4XOIA 5G0SA 3A0BU 1JR3A 2WAOA 3E5NA 3ZCVA 5MN6A 3B3JA 3EAFA 1UR5A 9GPBA 3P1JA 1S76D 1BKDR 2YINC 4EVSA 1XL1A 5B3LA 3AHCA 4TMZA 1S77D 4IKEA 2W6JD 1SK8A 2OZLA 4N48A 2J9GA 1BX1A 1YUMA 2OO5A 3LC0A 3HZHA 1V3QE 3QLVA 4UM5A 3ESZA 1EGQA 4QFMA 2LYAA 5F7OA 4PHEA 3QW2A 1ONPA 1BGWA 4YRMA 3THSA 1Q7BA 4ELTA 2B98A 2WWYA 2ZI6A 4ZP1A 3ECAA 4MP6A 1KRXA 1OI7A 2Z6VA 3GCWA 2QD4A 1IRIA 4ZN6A 3F4KA 2JI6A 1GDHA 1UQUA 4RTSA 1XA3A 1UMBA 3MTJA 5ADVA 1Z63A 3PR2B 4WNAA 4DXHA 2L0XA 3G2LA 4QZEA 3N07A 4RSRA 1NZBA 1KIAA 3FFWA 5ENZA 4V0ME 5EG5A 2D8MA 2HR1A 3ZVLA 4NLCA 3IR7A 1FFGA 3QITA 3ZGLA 1E9SA 2Z6QA 3HLYA 4PH5A 4D9BA 3C48A 5EXSA 1U28C 4M1EA 2GBFA 3LUGA 3TZHA 3AUTA 8ICGA 3BRWD 2BGTA 4WOCA 5FWXA 3OQOA 1L2TA 3LK7A 1SHZA 3BL6A 1SUDA 4BAZA 1CR0A 4BAUA 3QA3E 1KN5A 2BGKA 4DCSA 5C1OA 1JG6A 2GCOB 4E07A 4HNVA 1DMSA 1EFVB 5KFLA 2UAGA 3L6DA 1C3LA 4J07A 4RK4A 3NIBA 3ZCXA 5AKEA 2XMSA 2EG9A 4DR1B 1GEGA 3KWLA 3EF1A 1F06A 2ZBVA 2FKAA 3H6HA 1SU8A 2J6SA 5JR3A 5FOWA 2YASA 1Q84A 3T3DA 1Z35A 2DCUA 4P38A 1SXGA 1YBAA 1J2UA 5IVKA 4K0KB 2F1HA 3OVMA 2ODTX 3EGOA 4FMCF 5D5HA 2XMBA 2PRIA 4JBYA 4L0MA 5J5CA 4XQEA 1NP3A 5EMJA 4OAPA 4QREA 4CMJA 4AMBA 3CXRA 1ZH0A 2QPTA 5CH5A 4WL0A 3VYTB 4CNBA 2JHGA 1LSJA 3TOSA 1VL1A 1P6UA 2WJ6A 3BYZA 3H4VA 3L7YA 4YUWA 4PFSA 4FYYA 2FN9A 4GGMX 2BEWA 2P7IA 1VKJA 4N0MA 4PC6A 1DWQA 3CY6A 5JW6A 3N3BC 1V25A 4QBTA 4IO0A 1Y80A 2XDYA 2C95A 4TKVB 3SX0A 1OQAA 3ZZUA 1RS0A 4DOBA 3RBVA 5AUOB 1S96A 3SV4A 3SM3A 4LY9A 3KPVA 4U7JA 4C88A 2I7DA 2IW3A 4DM4A 1JDVA 3IT2A 1RPLA 1G6Q1 1M5UA 4XWOA 4OOEA 4MQ6A 2QTVA 4NARA 1A7UA 2H3HA 4BB6A 2VANA 3OC0A 4PBTA 4AG5A 5CG1A 1IEQA 2CXSA 2IOHA 2ZEJA 4CI9A 5KNLA 2D5BA 3II6X 3HDYA 3B6KA 3CX7A 4OHOA 3WLKX 2EX0A 2VHCA 2Q6LA 3QE2A 1R9JA 1J5XA 2D5IA 4YB8A 4LXGA 1ATZA 1YZYA 3B85A 3DDCA 4KODA 2OA0A 3U1TA 4CM7A 4DBLE 1IG6A 2VJAA 2XEDA 5HZGA 1GAXA 3IUNA 3EXFB 3H6KA 2AX3A 2NQ8A 2R3SA 3JU3A 3PWKA 3EZ2A 3KOMA 1J2TA 1UODA 4F5WA 3OEEA 2P2GA 3PSFA 1XZLA 3Q4GA 4J4TA 4R9NA 4DOMA 2FR8C 3AVUA 3WAKA 1DHRA 3C8UA 2VK2A 5LD2B 4LC0A 4RYLA 5JWOA 1QO0A 1ZK2A 3DM5A 4KZKA 2I4NA 2YOGA 4X9XA 1JHZA 2VHJA 4LZJA 1V5EA 1DARA 2QMHA 4I1OA 4R31A 5DOVA 4CZ2A 5FAXA 2ZE6A 4EUSA 4G3IA 3FTQA 3O1HB 4D9HA 2NZ2A 2V1UA 4MIKA 4KR0A 3EPJA 1KI7A 2IZ5A 5E6RA 1QSLA 2A86A 2D62A 3EMBA 3OLWA 1HNWB 1KZ4A 2BHRA 3T7IA 4OHXA 4RC9A