4G9BA

Crystal structure of beta-phosphoglucomutase homolog from escherichia coli, target efi-501172, with bound mg, open lid
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
227
structure length
227
Chain Sequence
VMKLQGVIFDLDGVITDTAHLHFQAWQQIAAEIGISIDAQFNESLKGISRDESLRRILQHGGKEGDFNSQERAQLAYRKNLLYVHSLRELTVNAVLPGIRSLLADLRAQQISVGLASVSLNAPTILAALELREFFTFCADASQLKNSKPDPEIFLAACAGLGVPPQACIGIEDAQAGIDAINASGMRSVGIGAGLTGAQLLLPSTESLTWPRLSAFWQNVAENLYFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of beta-phosphoglucomutase homolog from escherichia coli, target efi-501172, with bound mg, open lid
rcsb
source organism Escherichia coli
molecule tags Isomerase
molecule keywords Beta-phosphoglucomutase
total genus 82
structure length 227
sequence length 227
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2012-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 4g9bA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4g9bA01
1VJRA 5ALMA 3PDWA 2B1RA 3DNPA 3WK7A 1U7OA 1Z5UA 3ET5A 3I1YA 4JDPA 1IWOA 5AW6A 5AVSA 3M9LA 2WFAA 4UARA 2YMQA 1L7OA 2IOFK 2FDRA 1ZOLA 3NRJA 4GXTA 1LVHA 2IYEA 4QJBA 1N8NA 2JAWA 1RKVA 2AGVA 3QX7A 4L6AA 1PW5A 5ALIA 2HDOA 4RETA 3A3YA 5ALGA 5AM5A 3FZQA 1Z4PX 4GIBA 4KX5A 2EAUA 5AI0A 1NF2A 3QU7A 4CF4A 2B30A 4HGRA 1ZD4A 5AW8A 2C4NA 4UMFA 1VJ5A 1TJ4A 3N1UA 2FPXA 2I55A 3ESRA 2JAOA 3OPXA 4DW8A 5AI4A 2ZBEA 4OD0A 4OHFA 4XOUA 5AVWA 1TE2A 3WKEA 5AKLA 4Y2SA 1LTQA 4ZEXA 4Y2UA 4L57A 3ZVNA 5A3QA 1Z4KA 4MWOA 4H1WA 3W5DA 1Q91A 5AI5A 1T5SA 3L0CA 2Q4RA 1TJ3A 4NV0A 2MSNA 1JUDA 4EX7A 3WGVA 5A3SA 2GHQA 3E8MA 4BEVA 2RBKA 3R4CA 3SMVA 4KN8A 2FPWA 4G9BA 4KNWA 2C9MA 2RB5A 4YGYA 5JJBA 4CF3A 2HF2A 2GHTA 1Z4JA 3B9RA 2AH5A 2MU1A 3ZUPA 1AQ6A 3EF1A 2JARA 4YCLA 3ZX5A 5ALQA 1ZD3A 1Z4OA 2QLTA 5AKZA 3IRUA 4YCNA 3QGMA 4BX0A 3WGUA 2G1AA 3AR6A 1NNLA 2PR7A 4AP9A 3U7HB 2HSZA 4I9FA 4YCMA 3E81A 1X42A 3KBBA 2JAUA 3IB6A 4UU0A 2ODAA 5ALLA 3ET4A 5AW2A 5AK6A 2W43A 3MC1A 2HOQA 4BBJA 5AKJA 4NWIA 4Y2QA 1RKQA 3IJ5A 3L5KA 2FPSA 5IS2A 3SHQA 3I76A 3CZ4A 4YIKA 1Y8AA 3SF0A 3EWIA 3GYGA 2VKQA 2G0AA 2YJ4A 1U02A 1N9KA 2G08A 4L6CA 2R8EA 3NANA 5T41A 3QUCA 3WK4A 2ZBFA 1FEZA 2NO4A 5AM2A 3MPOA 1YV9A 4AS2A 2FPRA 5AW3A 1J97A 1T9ZA 2I54A 2CFSA 5FP0A 2OM6A 4FE3A 3L8GA 2YJ5A 2R8ZA 3ESQA 5ALNA 2PKEA 3FPSA 4G63A 3DV9A 3TLMA 4FFDA 1SWWA 2I6XA 2HI0A 4DWOA 3UMGA 4UU1A 2HEGA 3QU5A 3U26A 4BNDB 2CFRA 1J8DA 3KZXA 3U7FB 3OCWA 3W5CA 3ZWDA 5AKKA 1QYIA 3OTQA 3E84A 1Q92A 2W4MA 2YJ6A 1RQNA 1Z4NA 3L8HA 4HYTA 4HGOA 3KC2A 3WKBA 5AW1A 2B8JA 2Q5EA 3NUQA 2ZBGA 2YMPA 4Y2TA 4RESA 4CE6A 5AKYA 3WKCA 3N07A 5ALHA 4UASA 3DAOA 5ALKA 3MMZA 4ZEWA 2WM8A 2P9JA 1RDFA 1QH9A 3AR3A 5ALSA 4YIHA 5AW5A 3DDHA 2IOHA 4UMVA 5E0OA 2AMYA 2B1QA 3QU9A 3FVVA 3ZW7A 3HYCA 3L1VA 3L0YA 3SKXA 5IT4A 3AR5A 1MH9A 3WK6A 2P69A 5AM0A 2MU2A 1Z4MA 1ZRMA 4E88A 3U7GA 3ZTYA 2EARA 2ZG6A 5ALWA 1ZRNA 4F72A 2WF9A 1WZCA 2P11A 2WF8A 5AK3A 4Y2PA 2EATA 5AHXA 3KDPA 3U13A 5ALYA 4CF5A 4EELA 2W11A 5ALXA 5AW9A 3W5BA 3ONNA 3ZVMA 2G06A 1YMQA 2P27A 5AM3A 4NAVA 3I28A 1RMYA 3QYPA 5AVTA 4Y2JA 3R09A 2WHEA 5AKEA 3OCUA 1RLOA 1O08A 4EEKA 3OCYA 3A1EA 2C8KA 1T5TA 2I34A 2YBDA 3AR8A 4O8CA 1XPJA 1RC8A 5AVXA 3B8EA 5AW4A 1TA0A 3D6JA 1L8LA 3BA6A 3L7YA 2HX1A 3UMCA 3WK9A 4NABA 3U19A 2YJ3A 1XP5A 1Z4LA 2G07A 4UATA 3N8GA 4B6JA 2HF7A 5AVZA 2NO5A 5ALOA 5A3RA 4DFDA 4OCZA 5AVQA 4HGPA 4HGQA 2G09A 2FPUA 4DCCA 1YDFA 4UMDA 3R9KA 3QU2A 5AI9A 1F5SA 5AM1A 4Y2YA 1L8OA 1O03A 1L7PA 5AVUA 3F9RA 3E58A 3N5KA 3AR2A 4UAUA 1CR6A 2HHLA 3AR9A 4UM5A 2GO7A 3UM9A 3EF0A 5ALRA 2B8EA 2O2XA 4C4TA 1L6RA 2R8YA 2B0CA 3QNMA 5AKXA 3VAYA 3QXGA 1WPGA 3W5AA 4Y2XA 3PGVA 1ZD2P 3QUTA 3KD3A 3NAMA 4Y3UA 4I9GA 1U2TA 2CFTA 4KNVA 2DQSA 2HO4A 4BX3A 5AI8A 2FUEA 1XVIA 3WK5A 5AW0A 2BDUA 1RMQA 4FYPA 1L7NA 2R8XA 1VFPA 2IOFA 2G80A 3FM9A 4UW9A 3NIWA 5ALDA 1S8OA 4Y2RA 3ZI4A 1CQZA 2YY6A 2YN4A 4IG4A 4J2TA 4NFLA 2GFHA 5AESA 3FGOA 5ALEA 1SU4A 1RPZA 3SKYA 5AIAA 4UM7A 1U2SA 2FI1A 2OBBA 4XQ0A 2NYVA 5AW7A 1RLMA 3QLEA 1YS9A 2ZXEA 4IFTA 4KX3A 4BKMA 1RLTA 5AKHA 1QQ5A 2O9JA 3P96A 4CNQA 3I6BA 4MUMA 5AICA 3ZWKA 5ALTA 2I7DA 2RAVA 4KYTA 2WF6A 3WKAA 4UAVA 2RARA 2HCFA 4OFZA 1SWVA 3ZU6A 4EENA 4EZEA 2ZBDA 1EK2A 4ZEVA 3OCXA 3A1DA 1QQ7A 3WKDA 5AKIA 4EX6A 4UMEA 1RRCA 1WVIA 5AIBA 4YH1A 5AVRA 4C4RA 4QQFA 5AM4A 3RF6A 5IT0A 2C8LA 2OA0A 4XE5A 4BEWA 4Y2VA 5ALUA 2I33A 2C88A 1K1EA 5ALPA 4C4SA 4AS3A 3KOOA 3BWVA 2YMMA 2OYCA 3ZTWA 3J7TA 1RKUA 3NASA 4HGNA 5AVYA 5AVVA 1WR8A 1QQ6A 3S6JA 3L8EA 5AK5A 2B82A 4F71A 3ED5A 5ALFA 3PCTA 3QU4A 4J03A 2D2VA 3NALA 2BDEA 3U7EB 2CN1A 2WF7A 5AK4A 1U7PA 2X4DA 3A1CA 3K1ZA 1YNSA 1EK1A 2GMWA 3OCVA 4BYGA 5ALVA 4BNDA 4HAIA 5ALJA 3UMBA 3ZVLA 1Z88A 3RFUA 2JGAA 2WF5A 1RQLA 3FPBA 3AR7A 3AR4A 2QYHA 3PGLA 3WK8A 1Z4IA 1ZS9A 3MN1A 2IA5A 3QUQA 3OCZA 2Q4TA 3L8FA 1KYTA 2YMLA 1TJ5A 1Z4QA 4JB3A 2FUCA 5AI6A 5AKGA 1L7MA 3CNHA 3L1UA 3SLRA 2AUTA 1S2OA 1RMTA 1ZJJA 3EPRA 1Z5GA 1NRWA 2BY4A 2PQ0A 4XPZA 5ALZA 3B9BA 3L0BA 2FEAA 2YFYA 3SD7A 4PNHA 1YJ5A 1ZD5A 2ZOSA 3HLTA 3ZX4A 3QUBA 4BX2A 3M1YA 3N28A
chains in the Genus database with same CATH superfamily
1X94A 3ZWNA 2D4AA 5BP7A 3PDWA 1XNHA 3AKCA 2ZIUA 1QG6A 1Z5UA 4YY3B 3NAZA 3VR3A 1ODLA 2JIDA 2ZRHA 1ICIA 3DWGA 2ZYAA 2A30A 4TN5A 3VU9A 3B1WA 1XPRA 4QGGA 1WLSA 3WFZA 4HNGA 3DFUA 3ND8A 5LLDA 1JHUA 1KORA 1U7HA 4EK9A 2CBXA 3AW8A 3NYIA 3GV0A 2R2GA 3HGTA 2VH2A 4ZI7A 4YRQA 4F3CA 2ZS8A 1RM5A 5FNVF 3JAKB 3KKEA 3EH1A 4MRPA 4QUEA 3B1ZA 3OH8A 3WNBA 1AS2A 2GYUA 1FS5A 4PFQA 3REQA 4PVCA 2GEUA 2O14A 2WB4A 5FTKA 4ZVTA 5TQVA 5BQXA 1RWOA 5MFPA 1MEOA 3EDRA 3TL6A 4DF3A 4MUHA 2ZM5A 2GD2A 3H84A 3GYBA 4DLEA 1WHSA 3QLJA 2D5IA 2AFIE 2FSGA 3E4CA 1W9HA 4IFEA 3TNYA 4EF5A 2GEVA 3NBYC 4BUZA 4LF8B 3V1TC 2A0WA 3Q7SA 1RYHA 3BUSA 3VYVA 5DM0A 2OILA 1VKHA 3GT0A 2PUCA 5A4AA 2BFBA 1RI3A 1JALA 4O4JB 2UDPA 3I1JA 3C43A 4ZYTA 4WKNA 3SEQA 1Q77A 3GHHA 3GRFA 1OLOA 3A2MA 3DL2A 3AUKA 4UEJA 5J5VA 2GEBA 1U0GA 4I0WB 2R7AA 3LHIA 5TVKA 2GEKA 3P20A 2GN1A 4ZO8A 3NTLA 4QPNA 3OU6A 1S2NA 4XFDA 1NF9A 2VRCA 1NQ5A 3LPCA 2C78A 2PUAA 3EZYA 2HYIC 1S5PA 3WRXC 4UHJA 3ZTTA 1T36A 4TYQA 5AI4A 3ZDEA 2AVDA 4PG6A 1AQIA 3TVTA 3WB9A 1WAMA 5CNJA 2QYOA 3NW9A 5IIMA 4I29A 2KFNA 5DXJA 3F0TA 4JJFA 3EY4A 2XRYA 3IHLA 4ZQBA 1ZNQO 5AKLA 4M9JA 4Y2SA 3IOEA 5F5NA 2AYZA 2YN2A 1Y8CA 4J0IA 4UC0A 4CDMA 4RU1A 2DP4E 2A1JA 3EPPA 4GAEA 4NDNE 3WJ7A 3EPKA 2HLNA 2HGZA 2RK6A 3AUXA 1Y5RA 2H48A 4G0VA 3CISA 5DX8A 5JXJA 1E5LA 2TMYA 5ARBA 3WL7A 2JCSA 2NLOA 5DPMA 3KT6A 1XC7A 5TPZA 1CUZA 1N25A 4WNAB 4AIIA 4X00A 1SCKA 3KFVA 1L4HA 1DX9A 3G9XA 2ISCA 3D8NA 3ZV6A 4TTJA 2G8NA 3HCBA 2I2CA 2JLUA 3NM6B 5IG2A 4QXRA 2NYRA 3V8BA 4RHEA 3EB9A 4NP6A 2ANBA 1JIHA 1HRDA 1QO0A 3MJSA 4LRSB 2YRXA 2R68A 4TVBA 1Y48E 3GEGA 2F4VB 5COBA 2PCJA 3MQFA 1TTPB 4Q4JB 4N0PA 2PBRA 5BSUA 1X9GA 3HEMA 1CUVA 1ZXLA 3DBIA 3RK1A 5JDCA 2IYTA 4EY3A 2FMTA 1NSYA 3RI3A 3O8QB 3OPQA 1U48A 2IF2A 4PYRA 3GROA 1XJ5A 3O8LA 4L85A 4LSMA 3FETA 4J9NA 1NAIA 1LCIA 5T3YA 4FT2A 1IHDA 2GI4A 3ZCXA 3KHTA 4KN9S 1BS1A 3QGMA 5B6JA 1UK7A 2ID7A 3LG2A 1OC2A 3CV3A 3P9RA 2Q4OA 5K3CA 8ICIA 1Y7PA 3BMOA 4I9FA 3PIRA 3A27A 2ZUBA 2WTBA 3B53X 3LYLA 1L5ZA 2G77B 2PT9A 2XW6A 3B1JA 3DAHA 1Q57A 4X97A 5IC5A 4DM3A 4ER3A 5BOMA 4XARA 2W22A 1U47A 3A4VA 3GL9A 4Z1MD 4ZAZA 2I6FA 4QBGB 2D0DA 4F4ZA 1GLVA 4ZJYA 1WCLA 2Z09A 3QHAA 3QJGA 3G5LA 1HWYA 3RWBA 3CZRA 3Q3CA 4MQBA 2VNKA 1ZN9A 2XGPA 2H5LA 3RWMB 2DLCX 1T0PA 2Q3EA 3RC8A 3SBDA 1P4SA 1EI9A 1YE5A 1ZA2A 1KFDA 3I30X 2B94A 1LFDB 1RR6A 1RAHA 2P62A 4JK3A 1QUFA 2J3HA 4PAWA 3WRVA 2H7YA 3KAPA 2XMRA 4B9NA 3EUB2 2ZWAA 1I6LA 1W48A 2C82A 4H17A 2ZSIA 5JBNA 2WSSA 4QNNA 4CLRB 4GC9A 4GBED 3ROFA 3S40A 3VZQA 1MO2A 1J97A 4ZOLF 8ICRA 4H7PA 3WHPA 3EZLA 9ICWA 5B3KA 3HHEA 3MGKA 4DLBA 1R4NA 1YXMA 1R8YA 4DPMA 5TT0A 3AEUA 2GRUA 4WL0A 2M6LA 1VL6A 3HRIA 3MWKA 1ISGA 5CVDA 4FFDA 1KRPA 3HJHA 4I50B 4K9MA 4J8PA 5TJ9A 3UFXB 5F9LA 1JFVA 3BCRA 3JZDA 3UXEA 5KSYA 4GPAA 1DKMA 2HWWA 2W2NA 4JI2B 5ICCA 4ZI3A 4ON9A 1DFGA 3R24A 3ESDA 2GPTA 4K1LA 2JCVA 5ERGB 4HF7A 2DB3A 4LQLA 5JARA 5K0GA 2XYRA 4LDJA 2AW3A 3KUKA 4H18A 3NC0C 2QQ5A 1U3CA 1EWQA 1MAUA 3FYUA 3ICQB 1OZAA 3VR1A 4MP8A 5J0QA 4WHMA 5CPBA 2P8SA 3ELUA 3JVVA 5LQSA 4BJ1A 4HNTA 4JP8A 1QFXA 4CM9A 3LBIA 5CK4A 1IN7A 1YO6A 2REBA 1LB1B 3OEHA 1M6EX 2ZE8A 5B1SA 3PFNA 4DKXA 2Z6UA 1X66A 3KWFA 4WRRA 2I2FA 3K96A 4CE6A 3C23A 4QFCA 1FBTA 4ZAVA 1KEVA 1SUEA 5DWDA 5D46A 4OYYA 1NJ6A 4RV5A 5ALKA 5J4HA 3EZGA 2RAPA 3C74A 3RVKA 3ZQJA 2PNJA 2I5HA 2P9JA 3HG7A 4HYYA 3ZHQA 5KYWB 4MRVA 4GP7A 4X8OA 3R7LA 4LGYA 1JMYA 2AJ8A 1DXQA 2F2TA 2GUWA 2HWXA 2C59A 2J5RA 4MGYR 4IHJA 3W8EA 3P9IA 5HSGA 3TGPA 2ARKA 2W54A 4D3XA 1IIPA 2FSPA 3KUCA 2FX3A 5JROA 1TYBE 2QVBA 5BQ5A 4JR2A 5KJ6A 1BCSA 4FW9A 4OQLA 4ND8B 1E2EA 4U3JB 4AO8A 4GD3Q 1OJ7A 1SQGA 1P7YA 5BQFA 5KSWB 2NV0A 3ENNA 2B1QA 3DAYA 1T36B 4L5BA 1M33A 4TWIA 5BMOA 4GWKA 3UG7A 5BN3B 5KYKA 4MWGA 4WNCA 3GIDA 3C7CB 4FFBA 3LYUA 1E9SA 4M1MA 3IQDB 4ZA2A 3R7WB 4DWWA 1KPHA 4G1VA 3D6MA 4YP1A 1J22A 3G7SA 2P69A 3CW2C 1UBOS 3GLKA 4ASUD 4RNCA 1R0WA 4NZNA 4JQOA 5JUWA 1AZWA 3MBOA 3ZDBA 3I9NA 1RWKA 2UZ1B 8ATCA 4L0DA 1U31A 5CCEA 5JHGB 1NHWA 1NQVA 3DBHA 3GAMA 5TXGA 1VL8A 2B8WA 1UZAA 4OP2A 1NVMB 1TO6A 2WZBA 3F4BA 4U8HA 3RRBA 4KITB 1IN8A 2A6PA 2BGJA 1DBQA 3E9DA 1C7ZA 2XOXA 4RS3A 4ZRDA 3V4FA 1H0SA 1GCUA 1KO7A 1W34A 2IKSA 2V7PA 1DI0A 3NNSA 5KC9A 3EXFB 1PHRA 4N6GA 5G2OA 4LHSA 5DWVA 3U3KA 2DKXA 4FZNA 1DCMA 1U28A 2K8BB 4IP0A 5CCXA 2GHIA 1JEQA 5TB5A 2NZYA 1ZH6A 3GLFE 2GM5A 5FOWA 2WM3A 4NOJA 1CVIA 1AHHA 3JQBA 5C3UA 2BW0A 3ER6A 1FTYA 4DSUA 1BXGA 1GZSA 2P91A 4FEYA 5GOZA 4C88A 4F3TA 5CLLA 5AM3A 3IUEA 3AUSA 3A9WA 2C2KA 4R8SA 4Q7EA 2AFHB 3H2IA 2OENG 2GTIA 2XNSA 3UAXA 1NI3A 1K3UB 4UCQA 3VTKA 2KTQA 2PGAA 1QWSA 1J6UA 1WUDA 1X7ZB 1XEXB 4CDGA 5AHOA 2OORC 3WQRA 2OZPA 4D79A 4YAGA 3L7AA 2H63A 1K6XA 4OKIA 2XBUA 1FDSA 2E6UX 2ZJ0A 1EHIA 4URXR 4NF2A 2VXYA 1KIFA 5HS6A 2P3QA 2O0JA 4ZYZA 1H2ZA 1YR3A 2IY8A 3K92A 2HBRA 2QRVA 1JP7A 3K20A 4PO3X 1BGXT 5CDTA 3DQQA 2DUUA 1UBUS 1SRQA 2XPCA 3DKPA 7ICFA 2YIMA 1QQTA 3COPA 2C8VA 3PTAA 3EXG1 5D8DA 3D6JA 1SCBA 3PF9A 2D7JA 1PEKE 5LZ5A 2Z3VA 5THXA 4DILA 3L8MA 7ICLA 3SXUA 2KIVA 1B7GO 1G8JA 1ZAKA 3O0TA 4N7JA 5ADWA 1YFLA 4BCBA 4O9MA 1BPXA 5C5JA 4X92A 4XM2A 3RHZA 3WTBA 4LXXA 4KRGA 1WVGA 4OK6A 2OXCA 5F1KA 1C7EA 2XCUA 1LS1A 3LGSA 1J56A 3SHVA 1BKYA 3W3AA 4TS4A 2AJDA 5A9RA 2KWIA 2NO5A 1T3LA 3ICPA 3DP7A 2KBFA 1XZNA 3OFJA 3ZDRA 4F2GA 2UUAB 3QYJA 3QVJA 2VBGA 2V03A 1KH3A 4HDNA 2YWFA 4KAXA 4HX2A 3ZLUA 4YMTA 1BEZA 1V8PA 3L0PA 1XTZA 2WILA 5CT4A 1XQ9A 2XC9A 2EW1A 5DGXA 5EFZA 3EXHC 5FLXA 5F51A 1CEQA 4FOOA 4AYBC 3OT4A 3M3PA 4H7DA 1P1KA 3AEKA 4KLDA 4Y2YA 1L5SA 5HIIA 3LCCA 1OXSC 1NMXA 3ZI7A 2HV8A 5KO2A 5I51A 4TYMA 2V8BA 3L6UA 4LC1A 4AZSA 3UM9A 4PLVA 4TROA 5JZOA 1E62A 2GBPA 3R76A 3T5HA 1MC1A 3PX7A 4TUQA 1JZQA 3H3XA 2O06A 2BTOA 3PKZA 4GOLD 3W6UA 2AXNA 1OUMA 2R1VB 4M9HA 2J6TA 3W5AA 1M2FA 3GT4A 1E69A 1JJAA 1T9GS 2XYHA 2DWCA 3LK6A 3IAS1 1QV6A 4FDAA 1XDBA 4NG4A 2HCTA 7ICMA 1MT0A 1NDQA 2A7XA 4MICA 4BN0A 2RHWA 1YR7A 4XJSA 4YAOA 4CIWA 1YIOA 4KXWA 4OY3A 4YT4A 2I2DA 1BOOA 4GXJA 3OJCA 3AJ9A 3U7QA 1HNXB 1ECWA 2OCXA 4P7KA 4W1SA 4TRRA 1L7XA 4DY6A 4ESVA 1IXRC 1KVUA 2LIVA 2O2EA 2RC5A 3WMRA 1LVGA 4BP1A 3M4JA 3TL3A 1F0MA 2A3VA 2NO1A 3BEDA 2D3WA 2PT5A 4UM9D 4FYPA 1JR4A 3BJYA 2V7BA 1JR2A 3I23A 3SC3A 3B1KA 2YRWA 1H0KA 2WC1A 4NYMR 3EYWA 4P31A 3VNAA 1Z5ZA 4NU8X 3QX8A 4A2CA 4UDNA 1RBYA 1UPXA 4BUJA 2WICA 4AJNA 4DEYA 2BCGY 4WEQA 3SKYA 3C1UA 5BN5A 2B21A 1FFHA 3ADOA 4HG2A 2ZUSA 5J5CA 3EG9B 4OF4A 4MYTA 1I7QB 1EB9A 4XQ0A 2ZSKA 4KOEC 2W3RA 1EFAA 2XTAA 4MDFA 3NVZA 1E7RA 2NTEA 4K40A 5EWMB 2ZZMA 4AJPA 3PUIA 3P96A 3N7TA 1G8GA 4RLHA 3E61A 3UAGA 4Z4FA 3O4IA 3ZKWA 2QX7A 2AC7A 1AKEA 1OASA 3MMNA 2GXSA 3BL5A 3OLQA 4IIEA 2SKCA 2FA9A 1C9MA 3E27A 1GCGA 4LHZA 4RUKA 1RCFA 4WESB 1UA0A 2FETA 3HDVA 1GUYA 1IUOA 2RG7A 2LP4Y 1BTOA 3K1AB 4EX6A 1W1UA 1NPYA 1WVIA 3K1AA 2QAGC 3EVTA 4YQFA 1UAAA 2Q2VA 3DE2X 3OZTA 4AT1A 2GWHA 1T4CB 2HPZA 1ICEA 3CN7A 1DSSG 1Q20A 4Z51A 5BOSB 5I7VA 5CXQA 1MA0A 2K4HA 3IT3A 2Q5FA 3RO7A 4E51A 2OCGA 1QK3A 2WW8A 1LJLA 3LCRA 2I33A 3TXXA 1ZOSA 3JZMA 1WD7A 1W4CA 3F74A 1CETA 3A37A 5IM4A 1IQ0A 2QDXA 3QH4A 2WYIA 1O6CA 4AXBA 5C2JB 3Q87B 4LJKA 1GPYA 2QUIA 3V4SA 5AK5A 5CPFA 1IL0A 2VDWB 1ZJ6A 2VKTA 3NHWA 4IS2A 1SVWA 5IHXA 2O2CA 1IC6A 3GDOA 1X6VA 4UOQA 1P75A 1KI4A 4YP5A 4EB3A 4EFNA 5E4FA 3SV3A 1TDJA 2LPMA 1Q3VA 2NXCA 2OGSA 3E9YA 1NKSA 3O2NA 1W0CA 5CRXA 2WP0A 1XZDA 2FN3A 3ELBA 1V7ZA 5C1OA 5KG7A 4QO7A 3UWPA 3RBEA 4HN2A 1VIAA 5AUQA 2VNHA 4RQ5A 1E8MA 1E4OA 3HFGA 3F6EX 4LE2A 4ZK6A 3LNTA 4QPJC 4AWBA 4DQ0A 3IT2A 4JSYA 1M2VA 3X1KA 2JH7A 1QO0D 1UPFA 5T57A 4B8ZA 4WNAA 4W5TA 2ODTX 1NMYA 1SXIA 1X7GA 3JQFA 2P5YA 1G6KA 2FW7A 3L8FA 4D0GA 1HDGO 3QVGB 5SZKB 2HMSA 6Q21A 3EZNA 2L0XA 1Y1TA 1GNTA 1OFIA 3SIXA 5SYMA 4QYMA 4DB2A 2AW5A 3OJ0A 3KSZO 3OT5A 4P4UA 3QKSB 3AVQA 2YQ4A 2E49A 1BE6A 3W8FA 1TUEA 2P4EA 1QVRA 2Q9UA 5G40A 5JI2E 1YKFA 4R1LA 3ZHXA 3FAKA 3AUFA 4MI3A 3WGGA 5ABPA 3CSUA 3HU5A 1GUAA 3F97A 3SQMA 1ZJWA 1LJUA 5I48A 4JJAA 1P91A 3RRNA 4O4JF 3P7MA 3OP4A 4HNAB 3RBVA 3ZHOA 3JRWA 3ZK9A 1J5EB 1FUUA 4C0XA 3H9QA 2G8LA 4E1BA 4L3OA 5LMCA 3HJTA 4Q18A 2IHVA 5DLQC 4P33A 1O8CA 4P32A 3N28A 3BGVA 1KC1A 3S1LA 4LFAB 4PNEA 2QB0B 3K0FA 5J8YC 5JALA 1AN0A 4J90A 1IIBA 4NARA 2Q3JA 3I1YA 1MC8A 3AHGA 1BPDA 1LU9A 3FZNA 5REQB 1US8A 1D0SA 1J21A 1B8VA 1R0YA 3NKFA 2JRCA 1HEUA 3CW9A 4O63O 4PHEA 4WUVA 1SUCA 1A5TA 1EVQA 2A59A 2NACA 1P0MA 4J07A 2RHHA 2LKCA 1RTKA 3GPBA 1K5HA 4RQ2A 3HJFA 5DB7A 1L3IA 2IPLA 2OZLA 3FCEA 2AGVA 1WKBA 2X6QA 3KLNA 3M2TA 4X1IA 5I9BA 3T7KA 2OBMA 5C8VA 1G7SA 3L6EA 4RETA 3WLAA 3K9FC 2V7TA 5ALGA 4ALMA 1COOA 1PFGA 3ND7A 4MCAA 4NXZA 5BQOA 3G2NA 2RHRA 1KOLA 5K4GA 2AR0A 1SB9A 1VM6A 1L1QA 4MW7A 2RGGA 4OJMX 2VHVA 3SBEA 4C14A 4V03A 5IJZA 3I6IA 4I6EA 3V3TA 3RYCA 4KVAA 2O54A 2V7EA 5KAIU 1Z08A 2BE7A 4F5WA 4F4KA 2CE2X 3ECSA 1Q0LA 1OQAA 1ZMOA 4P7GA 5KOJB 1SQ5A 4RPGA 1ISIA 3V8PA 4QT4A 3FYDA 2G4CA 2BKLA 3N1UA 4DNOA 3KZOA 2QUZA 3P5BA 3VR2A 4AD8A 2I3AA 4RSRA 5BVGB 2X22A 3QW4B 4K05A 3PUHA 5AFSA 1WBDA 3NI2A 2P78A 3MIZA 1NW6A 3T0GA 3KR2A 3H6GA 4TPKA 3LOQA 1IEVA 3H18A 3TLBA 2BMVA 1A8PA 1PJTA 3SQDA 1H69A 1EHYA 2ZWOA 4I8XA 2IRWA 3I2IA 1WB4A 1NLMA 2B9EA 3RJMA 3DMTC 1ZGAA 2O52A 3PJFA 1QDUA 8GPBA 3VJRA 4AM8A 1NW9B 2VAVA 4PZLA 4RKYA 1RRKA 3GHYA 4D57A 4YV0A 3HADA 3W5DA 1AUXA 4M49A 2OV8A 3AB8A 5HW0A 3GJTA 3BFVA 4FDTA 3VNRA 1GARA 1V4NA 1L4GA 4P0PA 1U0HC 4KR6A 1W87A 4NC9A 3L05A 2NUAB 4XAQA 4HI0E 2RGCA 1Z73A 2AF3C 1RYMA 2G5TA 3E8MA 2BD0A 3I5AA 3Q5EA 3N2GA 5J0XA 2D8CA 2G04A 3RVBA 1IQRA 3GWGA 1I7SB 3AUOA 3EAQA 16PKA 1TXGA 1DV2A 1ODKA 1QE0A 1BU8A 3DQZA 4PPQA 5E3HA 5HUQA 2QRQA 5JJBA 4DFPA 3GRUA 3L5OA 1E20A 3CLSD 2OO7A 4FOSA 2ZI4A 4PX2A 3EQ6A 3ZWBA 2Q1XA 1MQ2A 4IR7A 2FY8A 4I27A 3QF4B 2JARA 2JLSA 1EM8B 1LLCA 1KRHA 1SCQA 1VSQA 1GV0A 4AX4A 4EG3A 1DMRA 4HUTA 1YT3A 1ES9A 2XXJA 4DCPA 5JSUA 5DHUA 3ADBA 3AM3A 8ICXA 1X3LA 4CODB 1AM4D 4B6SA 4FWTA 1RWQA 2ONYA 3IRUA 2Y1IA 2Y1WA 3TX2A 3RJHA 1E3LA 1A4RA 3OEWA 3M3HA 4AMVA 1OX4B 2Z1MA 3AR6A 5DX1A 1JTEA 3WA6A 3U39A 2KNJA 4PGQA 2EFJA 2QQ0A 3CUEF 3K6RA 1Z74A 2AJTA 3AEZA 1UJ5A 4A8PA 4MVJD 1HE2A 1KFJB 1SZHA 2A9RA 1RI1A 4BFLA 3NHYA 4ER6A 3MC1A 2FEOA 1U4NA 3TADA 5CM8B 2MR6A 3SEZA 1ZCAA 4OXYA 1SA0A 4PZDA 2FPSA 4E94A 4ALJA 2QTLA 4ZTBA 3THWA 1IPEA 3ZG6A 5CFOA 1GZHB 3A6JA 1R4MA 3WB1A 3PC8C 1QZ3A 2ERYA 2RBGA 2YW9A 4M88A 1T8UA 1E2PA 4IDNA 1YB5A 1PG5A 2HTFA 1E2QA 1T9BA 2XIJA 3SZGA 1V11B 2BF7A 4MUJA 4X64B 4Z6DA 4R1PA 3AHIA 3KETA 4XGIA 3PX3A 1REQA 3DB1A 4DCVA 1AGRA 1B6SA 2LGJA 1RLIA 3H87A 5EIBD 3UT0A 2JLXA 1EFDN 2VPZA 2PD3A 1VLBA 1DPFA 4DF4A 3L6BA 1GAWA 4N5NA 2EZXA 5IYZF 4C8NA 5JNRA 3U9LA 4Z4IA 3IA7A 3L7DA 4BV8A 3RSCA 2F17A 1YZGA 3MWGA 4HZUA 2K5UA 4YP9A 3VOTA 2JLWA 3TZQA 1PIWA 4DLAA 1ZJMA 4G63A 3ZDDA 1I2DA 1FP4A 1KSPA 1SCNE 2VRCD 3AO0B 1XX6A 2I6XA 1FUIA 2ZR9A 3TOCA 4MEYA 1URJA 1XBTA 4HFMA 1R5BA 3OJFA 4DSZA 3TNJA 3C7AA 3TRHA 4YMLA 1A1SA 1Z3EB 2FN4A 1OFUA 2MSLA 1WMAA 1TVKA 1F0NA 5CH8A 5FNZA 1E3TA 2RIRA 3SF8B 2MTBA 3W5CA 2B1IA 4B3GA 4E13A 4I2AA 1CS0B 2QY6A 3RKSA 1Z6PA 3E9NA 4O02B 4XQ8A 3AY7A 3NHKA 1QGZA 1NXSA 2OCIA 1WOYA 5JAZA 3IPLA 1D9DA 3B1VA 2IHZA 3L8HA 1FZTA 4HYTA 3U1TA 4DDHA 1A7KA 1Q7TA 1JIVA 5IJ9B 5HRUA 2G72A 3HJGA 2PUFA 1H1LB 4XUCA 1GSHA 2DWQA 4RWEA 3V46A 1CQXA 2IUYA 5KTPA 2F3TA 2GM4A 1KO5A 4LQDA 4MCJA 2KOBA 2I7XA 2PKCA 4L8GA 5ESWA 1SURA 5IKOA 2CJXA 2JIOA 1ZETA 2OC4A 4JI4B 1ZUNB 2GZ3A 3E9EA 4K6CA 1C4KA 4C8MA 2XMQA 3MS2A 3L7OA 4F50A 3SFZA 4OSEA 2CYAA 4UZSA 2OV3A 2OMEA 1KAGA 2X1LA 1CKEA 3F1KA 3LUHA 4F96A 1Z0SA 2JBWA 3GGPA 3TVDA 5I9MA 3IFSA 4S1TA 5E6SB 2JFWA 3CF2A 1SN7A 2GH1A 4DL3A 7YASA 3JPYA 3NO4A 1E3WA 2LCIA 4IS7A 4TXLA 5BYKA 1XR3A 3CNLA 3K0EA 1Q3UA 2H4XA 1DBWA 3HYCA 1FBNA 3HXLA 2R8HA 3CYMA 5IEBA 1BFUA 2D3TA 3Q15C 1C9NA 1Y4UA 4LZAA 2I3GA 9ICKA 4L50A 4DQIA 3QP9A 1NNUA 3UW1A 4EM6A 4YUAA 1S0NA 3JZIA 2FWBA 3ZE9A 2ZSUA 1V1RB 4YMVA 5GINE 1O89A 2GK6A 3A2KA 1FQOA 4MFCA 2QGFA 1ZGGA 3PT5A 3BTSA 3EZXA 3U7GA 4NM1A 3I4LA 4IDGA 3E0QA 3NRWA 1B73A 3M49A 2E4YA 3FXAA 5EP1A 3J81A 5JYBA 5JY6A 1DRJA 1PBNA 2WF9A 2ZTSA 5CHGA 4ZU1X 1OH5A 1TUBB 1OLXA 3AW9A 3IP7A 3L4PA 3STXA 3RH5A 1D4FA 3RPEA 1RI4A 2WQZA 3DAPA 3UJAA 1NK5A 4O5AA 4Y2PA 3TARA 2AIRA 2Y99A 4ID9A 3HBAA 1DAFA 2QTWB 2JEZA 2ONCA 5ITVA 5ALYA 1L5OA 2G83A 2NU8A 5ALXA 1DWQA 3TRKA 2BFWA 1LBEA 5FWDA 4C7OA 4J0QA 3CX7A 3UJ6A 2ZQYA 5TMBA 2NU8B 4OV6B 4LK2A 2QAGB 4FD2A 2P9BA 3E2EA 3O91A 3UHJA 2BP7A 4CMKA 3IRVA 1KY3A 2QQEA 1N2CA 3PKIA 9ICMA 1M0TA 3CT6A 1NW8A 5AJWA 3D59A 3NTRA 3ZGXA 2QG4A 4OJPA 4HP8A 1G5IA 4BXOA 2A1TR 1CRWG 1U1FA 2AJCA 2Q1UA 2R3SA 3QG5A 2EANA 3ZGVA 4G4IA 2Z56A 1B0AA 1BN7A 3FJOA 3DHEA 5EP3A 3FW1A 4BJ3A 4LJLA 1N6NA 4IQ4A 3U44A 1KMNA 1QANA 5E9AA 4BFYA 3OTGA 4EEYA 2PSSA 1FQKA 1GYRA 3AR8A 3E70C 4KUGA 5HEKA 3ZKAA 1T0BA 3HDGA 4IGFA 4JP5A 4KLZA 3GO4A 3LVWA 1FYFA 3OJXA 1P7DA 4LY6A 3BJRA 3LJKA 4YT5A 1H3FA 5F5XA 2D3DA 4BMVA 4MRMB 4ARUA 1TC2A 5HIAA 2A1UA 3KQMA 2HX1A 3UMCA 3SLGA 4IOMA 2ODWA 3SHTA 2IV2X 4C9BA 4R2JA 2OESA 3NC4A 3GB9A 3D4BA 1QG0A 1NN5A 3GZ4A 3LTNC 1XNGA 4HATA 4I14A 4OHBA 3VZDA 2YJ3A 3EXEA 3X43A 2R5NA 4O2BB 1FVXA 1GCOA 4LXGA 4RK6A 1VDVA 1N5KA 1QH1A 2YNMC 4J9KA 2HNKA 4X90A 3UENA 5KG4A 4UATA 1N0VC 5CIQA 4IXNA 4GX2A 1QIEA 4MUFA 4P92A 1H5UA 1P0IA 2DUJA 2HF7A 1RQRA 3AEXA 3FPAA 3GN2A 4PS0A 4QSHA 4HLUA 1J4AA 2YXEA 2VDWA 4OCZA 4JUDX 4YJFA 4BP3A 4Q4DA 2LDXA 5ICGA 4ASUA 3SAGA 4L0CA 2ZIWB 3F5AA 3FX2A 4PXSA 4LWPA 1AUPA 4F2HA 3T7SA 3KVYA 4M9GA 4RH3A 3SFTA 2W4QA 3QWIA 3SVZA 5H59A 4YCBA 1JZSA 3OM1A 2FJPA 1IPHA 3SEIA 1IQUA 1NBHA 3N5KA 1FTGA 1H5NA 4QG3A 5L6LB 2O5VA 2XUDA 4A03A 2H3VA 1FTQA 3RSGA 1W4LA 1KJ9A 4X66B 3SE7A 1Z7WA 4Z4EA 2L19A 1XLTC 1AG9A 2FV8A 2YWBA 3L7NA 2W37A 3LDHA 2PE5A 1ZHOA 4ED3A 1BMTA 4IRXA 4Q1VA 5A6SA 4XR4A 1VMAA 4I55F 1ZMTA 2V65A 5C8XA 1H1DA 2GN6A 1H05A 3WV5A 2CF6A 4AFNA 2ZRAA 3TKLA 3T0IA 3NIDB 4LV5B 3H5LA 1RYBA 4FGLA 3T06B 4ZD6A 3HR4A 4C89A 1I6WA 1VCIA 1NG1A 3X2FA 3WMFA 3AEYA 5C7LO 1X6JA 3QOYA 3PIIA 2O8EA 1P2SA 1CHDA 1PV2A 3HUEA 4GE3A 2VEDA 2A58A 3HI6A 4TVKA 1DKOA 5FHRA 3TKYA 3WLLA 4D4IA 4ES6A 4OJQA 2WSSD 4FOLA 3OU7A 3ABQB 4C7YA 4Y1FA 4C7VA 1KXZA 4D3DA 4LGVA 1JIJA 3ROZA 5BSKA 5DHAA 2P2SA 1KRXA 2R96A 5CWRA 2V5AA 1SOAA 5EAIA 5CAEA 1VPDA 1U65A 2G80A 2V7VA 4Y98A 4B32A 2W55A 1TF2A 2PS1A 2XB8A 1H5QA 4UBIA 2C1EA 5CYPA 3L6OO 3URKA 3W3AD 4BATA 2J3QA 1WULS 3GP5A 4D9KA 4B3JA 2DT8A 4WI1A 3FGOA 1OIWA 3KFUF 4KWHA 2G4LA 2JA1A 1MNQA 1ECLA 3E15A 3FWPA 4J0HA 3PDIA 3SBXA 3RAFC 1LS6A 1CDZA 1DS6A 3C6XA 1E2DA 3GU3A 3U56A 3IKVA 1RYRA 2NX2A 3P0FA 5H4GA 3CVOA 3L6CA 1K5GA 4HX9A 3L93A 5CYFA 2C31A 2WUFA 3B9PA 3GJZA 5BV1A 5L6MB 2WE7A 1TAMA 4O6VA 3NCTA 3TG8A 2Z7JA 4FYWA 1M54A 3PW4A 5DG8A 2Y1CA 1T0IA 2BHNA 4HNAA 3CX3A 3KZMA 3E0XA 4KIUA 3N97B 4OLHA 2QB1A 3SICE 2BGNA 3T7RA 1EHCA 1NYTA 2PH1A 3L4EA 3H40A 3H65A 3AEVA 1J1UA 2OZLB 1A7JA 3HBFA 2EIXA 2HIMA 1X3SA 2HFKA 4R2MA 4QZIA 4FFSA 4LJ8A 4UUQA 4NLNA 4W8GA 5HHTA 1QS0A 3BVPA 5ED4A 1BDHA 2OORA 4G5FA 1B2LA 4KQKA 4WJZA 5HFAA 5AIBA 4IJ6A 4YH1A 4J4HA 3TI9A 4E5VA 3M83A 2JLVA 4N9WA 2RAFA 4NJ8A 1UKBA 1VPVA 3K5IA 4L9AA 4Z5XA 3FUUA 2DFNA 4BLVA 1SCUB 1SBQA 4NDAA 3BN3A 1N7GA 2EHJA 5JJKA 5IUKC 5EIEA 4BLWA 2ZRJA 2QR3A 4S35A 2E5FA 4YAFA 3ISBA 3AONB 3G1TA 3HSSA 3WLIA 4C7XA 1N6IA 1HFEL 1DADA 2H52A 3KZKA 4K9LA 1VHQA 4WN3A 1OXXK 2FXIA 2FWRA 3ADKA 2PQ6A 3OQIB 4HAVA 2ECFA 4JJZA 4N3CA 1MIOB 1V1MB 2KJQA 5KFPA 4RA6B 2B35A 2X8BA 3TE7A 2C7OA 2GYWA 2VHUA 2P6UA 5KFZA 1P31A 4QU9A 4LXQA 3ZE8A 3B78A 4URUR 4E0BA 1KO1A 4X65B 3T61A 1KERA 4OQYA 3AIOA 4QWDA 3QBTA 2JJ1A 4OMUA 3SI7A 3OLYA 1T5LA 1ZOOA 3H17A 3ZV3A 4RXUA 4ZU3A 1W581 1T7PA 4PSDA 3PR3A 3ZDAA 2GBLC 1A2QA 1LDMA 1NVVR 1D7AA 2GM9A 2GLEA 3AF3A 4UREA 5DYGA 4EVSA 1U9CA 2O2GA 4Z6CA 1QH8A 1DJLA 4CM6A 4DM7A 1XK7A 3AKDA 3IIIA 2XKAA 3BQ9A 2HCJB 1M0SA 2LDBA 5IT9A 4GDFA 4A1FA 3QUQA 3DLHA 3IUPA 1C1HA 2WWTA 5CA0A 3OLCX 5EE9A 1KYTA 4F4YA 3CNOA 3CVVA 1NBWB 3D2NA 2PGLA 5G3ZA 1UBMS 3RYTC 3LKBA 4NE9A 1EM6A 4GLJA 4ZVQA 2B6GA 3ACBA 3BIJA 4N3BA 4OHMA 4B47A 1KFTA 2IX9A 2QL7A 4A27A 3GBVA 1XYGA 4RZXA 3SX0A 1G5RA 3KEFA 2G7ZA 4KTVE 3CNHA 5IIJA 1EM8A 1EVIA 2FHPA 3K70C 1UFRA 2JCBA 1P1FA 1SVLA 2FPGB 3OHAA 1NRWA 1Z7BA 2UYCA 1Z6XA 1NMZA 1TTQB 2Y6UA 1YMUA 1CZKA 4UB2A 3BMXA 4Z9YA 3N7PD 2P9QA 4ED7A 3B3QA 3PE4A 1COZA 4A8EA 3HJBA 4J0EA 1J1ZA 1RM0A 4NZYA 1PZFA 3X2SA 2C2ZA 1F12A 4B6PA 4PLGA 1U5BA 3QRWA 5HNKA 2YZMA 4B3XA 4M0KA 1A4UA 2M98A 1KSHA 3DYVA 1R88A 1IWOA 1KK0A 1SBTA 4PBSA 3RUHA 2OV2A 1MOQA 4CCSA 5KFAA 4OQDA 3C2QA 3L4KA 2Y77A 4Q4JA 2NO9A 4HQKA 1C2YA 1IATA 1Y6JA 4N40A 4CQNA 3SDSA 2QX6A 1CERA 4TUYF 4DCSA 2OXOA 1JB1A 1FTNA 2ZYGA 3PTLA 1CC1S 1PJZA 2AV6A 4YP6A 1ZQFA 3I64A 4QPPA 3TQHA 3NRJA 1BZYA 2KV2A 1VL0A 2C7QA 4JIGA 1YBAA 2HQSA 1QFJA 3NIFB 3BM5A 3UJNA 1REQB 4Q3KA 3RVSA 3LRPA 5JU6A 4TYYA 1SUPA 1ZEJA 2QD2A 3HA7A 5G5HA 3T5KA 3RF7A 4DCUA 4ZEMA 1QU2A 1TEHA 1NX9A 5IJXA 4MF2A 2L5YA 3MXOA 2O6LA 2WHQA 2C96A 3ABSB 5E8RA 2XKKA 1HGXA 3TQSA 2XB6A 2O2ZA 3PJGA 3VUFA 3L1IA 4TZTA 1R27A 2X58A 5IF3A 1V71A 1AK1A 3FPFA 1SA0B 3KYBA 4Z7NB 3WAGA 2ZFUA 4PU0A 2C04A 4FSHA 1WB5A 2Q0QA 4KZKA 4PWYA 4LMAA 1D07A 2RJOA 5IAEA 1KI2A 1K6JA 1W73A 3M7IA 4UMFA 4ZRMA 2ZJZA 2EKQA 1FU7A 1U2GA 3DTYA 5HKLA 2AFHA 5SY4A 2CXSA 4EHNA 3BHNA 3UK7A 1JLKA 3U1BA 1QYWA 5CIWA 3OPVA 1CULC 4R2XA 1LV5A 3OD5A 2Y0PA 1T34A 4P84A 1PN3A 3ABZA 5K4HA 3F2VA 2AX3A 1DTSA 4MDHA 2AQ4A 4OBBA 1XZHA 3AF4A 4ZIRA 4I2HA 4H3SA 3SYKA 2ZBEA 3CJQA 1NN0A 5J0OA 5DCUA 2W5UA 3I32A 3RAEC 5FHQA 1VGVA 3H9EO 2O57A 2I8CA 1RXYA 1E8NA 2H0QA 2YCBA 4IXWA 2Q4EA 2X1HA 3W6NA 5BUCA 3KSMA 4HVCA 4KDRA 5JVDA 5A0LA 1O96B 4REQA 2PI5A 2DTXA 4I50A 4RPZA 2A5LA 3IBFA 1BEEA 4BU0A 2P7HA 3VR5D 4MULA 3RSQA 3HFSA 1XQVA 1AVTA 4FLFA 2W8BA 2Q4RA 3D7RA 4ZALA 3EIXA 2JCYA 2GESA 3GRRA 3E8XA 4RTPA 2AS0A 1FJXA 4G1BA 2Q7XA 3CZ5A 1XU9A 3CYFA 3K32A 2H1WA 4RAOA 5K20A 1L9KA 3SEFA 4FEAA 4BNFA 1WJGA 3TSWA 1DX4A 2XT9A 1I5EA 4LJ4A 3QELB 3KTOA 4M9UA 3H1TA 1E1QD 4CF3A 1N2OA 4MYRA 3TRFA 2O5EA 5BV0A 1QFSA 2OLKA 1BEUB 1U8TA 1V96A 2DAPA 5DTQA 1YQUA 3BAFA 3QITA 3AMZA 3ESXA 4OAQA 5D3QA 3IV9A 5B53A 4EABA 3F2BA 2JAQA 5FPYA 3F3MA 3JRNA 3DE0X 1ZQEA 5B5SA 3CCFA 1Q0ZA 1EZ1A 3PRYA 1Z4OA 1SU7A 3D1VA 3O03A 2XEXA 1R5OA 3GVIA 3ILSA 3VPHA 4PAGA 4GM0A 3JAMA 3ESBA 4N6OA 1F4VA 1TUBA 2O8NA 4HADA 3CLTD 4NPAA 1KI9A 1WCIB 4HLDA 3R5TA 4KPGA 4Q4HA 3WLRA 4BVJA 3HI4A 1R2QA 1P61B 3SR3A 5FTLA 1EWYA 4P34A 3RJIA 4DA8A 1VLHA 4Z9AA 2PWZA 1TK2A 3LUCA 4UUNA 1ONSA 2HVHA 2OO5C 3EG9A 3PRKE 4MGZR 3TSCA 3S27A 5IVPA 1NL3A 1E4EB 4HVLA 1G2QA 1W5TA 3ZHVA 3PZRA 3FWYA 5CD9A 1TK3A 1CQIA 3LW8A 4YREA 5B57C 3TUZC 1UOQA 1RAIA 3Q9NA 2DPJA 3Q5DA 3VR3D 5BW8A 1N6HA 5EPEA 1E7MA 3L0DA 1ZQ1A 1P77A 5JXWA 3MPOA 1UXHA 1Z0JA 3HCRA 2EKPA 1CEYA 3JASB 3MABA 1J2RA 2WJPA 3EA4A 1JKXA 2Y1LA 5ICFA 2W2QA 4IVNA 1ATZA 1JMVA 1Z3IX 2WD7A 1RHJA 5G1NA 5G4LA 1RZRD 2GKOA 3MTAA 2QVXX 3SJZA 4HDAA 2H4HA 5M2QA 2DQKA 3AUAA 3HB4X 2X0KA 4OSOA 4YCDA 4XM0A 5H3HA 1UBNA 4BVLA 3NDBB 3QVSA 1TZMA 2QXTA 4M98A 1OV4A 4JP1A 3PSIA 3M9NB 4QBIA 2PKYX 5FPPA 2RHDA 2ROQA 1BXGB 2O8FA 2QUAA 3BYZA 2C42A 3E82A 4BMZA 1I0LA 2YQ5A 4CI0B 5AUNB 4I5DA 3IL2A 4JQYA 2CWDA 1C7FA 4P3KA 2XNDA 5DBCA 1Z18A 4J0DA 1MAHA 4OEHA 1GADO 4F1JA 1GTSA 1HEKA 1RIFA 4DLWA 3INRA 3VYTB 1N1MA 1P9OA 4KQIA 4LBVA 4OH7A 3FPJA 1RRFA 3GFVA 4EUKA 5C51B 2X0FA 1JBQA 2VFAA 3EXIA 1AKYA 3QPUA 3PO4A 1T3NA 3O9MA 5KFLA 3NX4A 3OHSX 1MZPA 1B26A 1RBMA 3LUBA 5C34B 3L40A 1YFJA 5KDOA 4CV0A 4YJ3B 3RS3A 5BR8B 4MS4A 5GOTA 4F4CA 2FR0A 1KE2A 1K66A 2PX6A 4EZ9A 3NJ4A 5TS3A 4PHHA 4M53A 4NCHA 1NUUA 5H2FU 2OD9A 2RKBA 4HEHA 4P4MA 4I6GA 3O4GA 1GFWA 1DBIA 3A7DA 3HCDA 4ZEWA 4JV1A 2WVHA 3VNBA 4AKTA 4KIGA 5ALSA 2HDWA 3H3JA 3GGDA 1UKVY 4Q66C 2QPTA 4RKEA 4A0RA 2DEUA 3CRRA 1OFVA 2C0CA 1WUJS 1WV1A 3LBHA 5B3AA 5KFMA 3L46A 5EKSA 4MIEA 5F2OA 5GGYA 1M34A 1WXEA 1E3QA 2Y27A 1HYEA 4JC4A 3FI0A 2RONA 1Y37A 2F3PA 3FB1A 4XJTA 3SBOA 3FVWA 1MX1A 4RH1A 2LYAA 3N59A 4NV3A 5C35A 1LBQA 2ODQA 1ZI9A 3U3JA 4JYZA 2DR2A 1GGMA 2P9ZA 4H1HA 4PS1A 3W4KA 4KHPB 3W2GA 4DBZA 3JYNA 3OOWA 2JD0A 1N57A 3HLYA 3OQVA 3EZ9A 1P7WA 2BM9A 4L27A 2C95A 4L95C 2ES4A 3T6KA 2D6FC 4BVAA 5HVNA 2GBGA 2Q8NA 1Y7LA 1AQJA 1KEJA 2HOFA 3BMCA 3ZE0B 4CKCB 2J7PD 2FMSA 1JSRA 1PX2A 1UKEA 2M1ZA 4I2FA 3SLKA 3QG1A 4TL6A 1E3EA 3DDZX 3GAAA 3WXBA 3H11A 2IQ5A 4N5MA 1Z6GA 2XQIA 1IY0A 4FMPA 1SM4A 1BROA 2BFMA 3VAAA 3SHWA 2EL9A 3CINA 3K09A 3R5HA 4TKVB 3BTUA 1LC3A 5EG5A 4CMIB 1J42A 1JG4A 4YJGA 3WLJA 2TS1A 1N1GA 4BYMA 4DLPA 4ZOAA 4EELA 1YVUA 5LQJA 1RPTA 3LI2A 5DK6A 2EYQA 4CQMB 2C84A 4ZV4A 1O87A 2Q50A 3NTOA 3QXHA 4LN1A 1MQ9A 3EOZA 1AMNA 3P94A 4I1VA 2HA0A 1E92A 2XVTA 5KFTA 3RBDA 2LYBA 1ZQBA 1ZISA 2CDRA 1BS2A 2X8AA 1Y1SA 2AN3A 3N86A 3VGPA 3QZ8A 1YVEI 2JDID 3UAZA 4QDTA 3U7QB 4GXKA 1AF7A 2GLUA 2FLNA 3AWDA 1VYHA 1PJSA 3OG9A 2WHEA 1N2GA 1UMKA 3O3OB 3RS7A 4INOA 1ID1A 1RQ7A 2PZKA 3KAJA 1V25A 2PBFA 4TTRA 4Z8XA 5LSAA 5COAA 3AFNA 4Z49A 1Q0TA 2C8KA 2C92A 4C4PA 1QQAA 1T5BA 4FJ2A 2M6RA 3ZNNA 2X5OA 4MUIA 3HKZC 2I9KA 2GETA 2IIVA 3AEQB 2IFTA 5EINA 4BKUA 5KU1A 4KQFA 3EPLA 3PDIB 1I2CA 3EVCA 5TE9A 2H8GA 4LZGA 4UNIA 5J59A 4RLFA 3D0OA 5LOVF 4NE2A 1YB4A 3DMHA 2XMDA 3KOUA 4BGEA 1FPMA 4FFLA 4MR8A 1P9NA 1W5BA 2PTHA 5T7BA 4YDHB 3Q98A 1U49A 3SDBA 3JD3A 3IC5A 3Q7RA 2F3NA 3EYAA 3JD0A 5B7GA 1G3IA 2HKIA 1Q12A 3C70A 1EUZA 1XP5A 3F3KA 1Z62A 2ZYIA 5GWXA 3QSGA 1RC1A 4GI1A 3ZQUA 5FX2A 4B6JA 5EZSA 3N8GA 3LVFO 2LR0A 3S55A 2DQZA 5EZQA 2FW0A 4JNCA 1TAQA 3FCOA 5EIWA 3QWBA 3WNZA 4ECYA 1RJ9B 1X1RA 3F1LA 3VHRA 3FI9A 8ICYA 2Q3LA 1SC6A 7ICHA 4QWCA 3IHKA 1J8VA 4F3KA 2XCOA 2XGJA 3I6QA 2P4UA 3IMGA 3GDFA 2CL6X 4DMFA 1GKYA 3BCHA 4KL8S 1CU1A 1E79A 1UBSB 2XIDA 2J85A 2CY0A 3LDFA 4KSBA 1XF9A 2RHJA 1NXPA 3LOUA 4A0FA 3CUKA 5D85A 1K92A 1CR6A 1U90A 2HHLA 4Q12A 2VLBA 3BL8A 2A57A 5BR1A 1GUFA 2EEPA 1ZU5A 3EFOA 2PAFA 4RVHA 5PGMA 5CITA 3ISDA 5DHRA 3L1KA 4DVJA 2IZOA 4FB5A 1NXTA 4JUBA 4O2BF 3V33A 4LJRA 3WB2A 2Q3BA 3Q9UA 5KQSA 5L1LA 4ED6A 1OPRA 1NT4A 2R4QA 4LMBA 4DSKA 1IZ7A 3FTEA 1WPGA 2ZXHA 1B2RA 3FFAA 1RXCA 2LBPA 4RQBA 4CL3A 3O1IC 4YHHB 1GL6A 3LM8A 3GLFA 2G4VA 2YWGA 4KQ9A 1BCRB 1HLGA 3DXZA 3MTDA 4PQFA 4R1QA 5EXXA 4BLTA 1AT1A 4LS3A 2QVYX 2CFTA 4OQNA 4QWBA 2RHCA 3O9ZA 4TLEA 4YRJA 1NTOA 1SG9A 5IBPA 1ISRA 2ABWA 4Q44A 2E82A 2PFSA 1ZQGA 2IV7A 3O8DA 3O9VA 4DQRA 4K9NA 4FYJA 4NL9A 4FK8A 2Q29A 1R18A 2NTYC 4FFRA 2YDXA 4N0DA 3USZA 5C7IO 2K2WA 1E9CA 2K4MA 3AKEA 5CFRA 2FPGA 2ZR0A 3UANA 3WISA 4YT8A 2RGEA 4HDSB 1U0RA 4NMLA 4YONB 5C1PA 2V1UA 4KFUA 2BV3A 3I73A 2H2AA 5L3SA 2JA2A 1QTMA 2QLJA 2V54A 1ODTC 1XRQA 3BRSA 3HB7A 2RBEA 4GX1A 4Q7JB 4CM7A 1V8OA 3ZD9A 2FGJA 3C85A 3CNQS 4U7FA 5I8ZA 1EE9A 5IK2D 1UQUA 3RBXA 1OVGA 3GRAA 3KTQA 1K8RA 1OHHA 2ECQA 1L3SA 1Z6QA 2F1KA 4YO7A 3SKVA 5G0TA 1T10A 3MRXA 1U2DC 1PBTA 1ZM2A 4DCMA 1Q0SA 1RZTA 4J7CA 2QD5A 1T5HX 3SIWA 1T4DA 3QBEA 1C14A 1RLMA 1YK0A 5FB3A 2I99A 4IFTA 5JADA 4O4HF 3KTDA 4BKMA 1PK1A 1A9SA 4YGXB 1TEZA 1Z7YA 4EA6A 2RD2A 1EEXB 2WB2A 1Y5IA 1ILEA 1FJ2A 3PSTA 3K2IA 9ICXA 3NOQA 3F6RA 3KUUA 4IFBA 1XZFA 3NGLA 1WUHS 4D2IA 4DRXA 2RAVA 2HNAA 1II9A 3NNDA 4C05A 4P3YA 4AWXA 1IVSA 2A5FA 1KDOA 3V1NA 4DUGD 2Q9BA 2LHTA 4PNPA 1G3MA 3DEAA 3JPQA 1MNAA 2Q7OE 1CJUC 1QPZA 4A6PA 1P0CA 4BLOA 3WKDA 4FS2A 4HXGA 4UMEA 1RJEA 3N7AA 3T95A 1I01A 3KJIA 3OCJA 1PUZA 5AVRA 4XVCA 4OQEA 4K9SA 1RXUA 4QDZA 1B4DA 1E59A 2BGIA 2SECE 2VXCA 2OQRA 4Z2AA 4HQ0A 1Y3CE 3EODA 4HHEA 5BPCA 4NMMA 2B69A 2ZE5A 1P9WA 1U8FO 3NWOA 2Z5FA 2Q3MA 4PH5A 2OYSA 3TNFA 4CIYA 3ZD6A 2Z9CA 1GWNA 5IMSA 2C2GA 2RKWA 4OUDA 2YYAA 2KB0A 3GP3A 3UA4A 3NASA 3UPQA 2DUWA 1ZRHA 2BZ0A 3K9GA 3UBMA 2ID8A 2YUIA 1NUPA 1HT0A 2WOJA 2I87A 3T3FA 1M67A 2BHRA 2REQB 4FYVA 5FV4A 3CR8A 4EF4A 1OI4A 1MVOA 1NOMA 3RB6A 4UM8B 1GLGA 4BE4A 4CEJA 4J49A 4DJAA 4D99A 1M0WA 5KG1A 3P9SA 2W6ZA 5D5QA 2HU8A 4LE0A 4JJ4A 1V45E 3A7EA 2WWHA 3H3FA 1W93A 2EOAA 3R7SA 5B4UA 4E03A 4FLEA 1KFKB 1KY2A 2FJ6A 4PZPA 2ZTCA 1YZYA 3BQ1A 4C5BA 4G0UA 2QI9C 2PTGA 4MLCA 3HGQA 3JQ7B 4MV0A 4BLUA 2PUBA 1MDBA 2Q5QA 4M89A 2REOA 3KQHA 1DUVG 4X60A 5DLYA 3GA7A 1I6MA 2PUWA 3FPBA 3PLRA 2OCEA 2XZTA 5CEEA 4ZO7A 4PG8A 2A4KA 1II8A 3CG0A 5DGBA 4KLNA 5EA2A 3BWYA 2Q3FA 3O94A 4PC1A 4D98A 2PANA 1YBFA 3N3AC 4YUYA 5IF9A 3IIEA 2QLBA 4IINA 5M34A 1Y8ZA 2UUBB 1SO8A 3FTFA 2XB2A 4DFKA 4JB3A 4H3VA 2BMEA 4DSNA 1U0OC 3N2IA 3B1FA 4FBMA 5GJCA 3ZY6A 1RI5A 5FWXB 3EAGA 4MA4A 4MV5A 4QELA 1YA8A 3WDMA 4BFWA 5C3MA 1SOWA 1UZLA 5KEIA 1S2OA 4FZ5A 1ZI8A 3T5GA 4DLLA 3ZW8A 3GJ7A 2O5CA 3AY0A 4DGQA 2JZNA 3D8SA 5FI3A 1O9GA 4QODA 2FRDC 2W6JD 2WG1A 1E60A 1YQQA 3U40A 5J2KA 3IBCA 3P97A 1YGPA 3QBVA 4QOGA 4DWVA 2PS9A 5KT6A 4GVXA 1P5JA 1CP2A 1GPH1 3AU6A 5D00A 3M1YA 2WYOA 1LNZA 4DIBA 5GIOE 2FUG6 1BG6A 5EQTA 5CB4F 5ALMA 1NC3A 1ZRSA 3L7IA 3RSOA 1H0RA 4JDPA 5IM5A 3NDIA 3TTUA 2EKZA 5TMEA 2BHLA 3DOHA 4K3UA 1K8QA 4KLTA 3CZ9A 3B12A 1LVUA 4NPHA 3R77A 2KMDA 2JC3A 2EQAA 2UUCB 4F4XA 3M9LA 7ICOA 1CUDA 3F5QA 5SY6A 3ZXYA 3U09A 2UVUA 2X2FA 3OUUA 2OXFA 1L7OA 1S76D 1P60A 5TV2A 4K6MA 2Q2OA 5K0CA 3RH4A 1N34B 1NMEA 4FGZA 2IIPA 2WAQC 4HO1X 4TS9A 3X1JA 9ICNA 4GR5A 1CEEA 3QPVA 3U3RA 3QX7A 1VIDA 3F3SA 1UA1A 1B3RA 2QTGA 4G4GA 2GXAA 5ALIA 4AJIA 2Q07A 3PQEA 3D6NB 4AY3A 1E1DA 3FZQA 3NWBA 4MPPA 5HDBB 4MJ7A 3CTPA 3H2HA 2I0FA 4BNWA 3W7VA 2BI8A 4E5PA 4MQFA 1DKRA 5JSZB 3O7WA 4TRJA 4W4TA 3KU1A 4OJ6A 2SKDA 1Y42X 2XNDD 4ROTA 3PHJA 5L1KA 1DIGA 1ZGJA 2GBFA 1DK3A 2WAAA 3CN9A 2PLAA 3V80A 4RIGA 4EHIA 2C3YA 5BXYA 1NK0A 2VDNB 5HJ5A 4IJMA 2UVWA 4IJVA 3MLEA 1XFAA 5K8VA 4M1YA 1KH2A 2QI9F 3NV7A 2X8WA 1O9BA 1DKLA 2X9VA 3ANXA 4GHWA 4HQFA 5ESDA 3GJQA 3D6UA 4YR2A 1I3MA 3CGGA 5F77A 4XDYA 3ZGNA 2VK1A 3CTMA 5EJ9A 5THKA 5JNLA 5JSHA 1BWRA 5A5DA 2PU7A 1H4VB 1EH5A 3OHPA 4KQHA 3MS7A 3OZGA 1NYLA 1TE2A 1GZVA 1C7JA 1JWAB 5CHYA 2WTUA 2GDJA 1CUXA 2VF7A 2X3YA 3SJBA 1I1QB 2GCOB 4LJAA 2E1RA 4UCFA 4X54A 3UWMA 4C78A 2Y9MB 4MOWA 3FLAA 4HSEA 3TLEA 3PHBE 1GCAA 4WLNA 3TOXA 3OQMA 4CETA 1X9MA 3P27A 1N5JA 2Z2XA 1GEEA 3TZHA 1UBCA 5KHLB 3H7AA 4D0RA 4CG1A 1ZMRA 2ZIAA 5C8YF 1W4ZA 1YKSA 1AQYA 1JXMA 1V7CA 4ETMA 3FPEA 2WWVD 1BXRB 3U49A 2Z5VA 4BMOB 3JW8A 1YBHA 1PCXA 5GVRA 5A6SB 3VH1A 1NRIA 2BC9A 1GUZA 2CMGA 4HDMB 1EUQA 2FEMA 3H1BA 2VSYA 2FEKA 2HB6A 3P9NA 1KGDA 4COKA 3GT7A 3CW2A 2QARA 3MTEA 3NHPA 4MS3B 3AOEA 3WLOA 2OD7A 1BDMA 1Z4JA 3W79A 2BCUA 1UC4B 3CONA 4HLUC 4XW2A 4PZYA 3EGXB 4TVSA 4QOJA 5C4IA 3OQPA 3LQYA 1TL7C 4M9ZA 4AMBA 1HL3A 1LBSA 2HHSA 2D2XA 3G2IA 5DHSA 3LKDA 3T3EA 1DKNA 3F4KA 1CZOA 1YZLA 1PGOA 1IDOA 5BN4A 1H85A 2I71A 5DYYA 3ZWPA 3W06A 4F4JA 5EJ8A 1NSTA 3LVVA 3KFXA 3OC6A 5HRCA 1WDTA 3HYTA 4CKCA 4EHKA 3IDQA 1BN6A 1BYIA 5FQNA 3WIVA 4AZWA 4ABTA 2VDRB 3AL2A 1NNLA 3DL7A 3FVTA 4M9SA 4BN5A 2I6TA 5M3BA 2VAWA 2Z43A 1WB6A 4TKUB 5IT5A 1EXNA 3KBBA 1II8B 1RM3A 3FNHA 4UU0A 5CP8A 1JFRA 4HUJA 5CNMA 2DHRA 5FULA 2BJHA 5LVAA 2A5JA 5AK6A 4AI6A 3WLEA 1V3QE 4Z4GA 5DDMA 1E1RD 3QFRA 4IMRA 1VECA 4LRTB 3ZJYA 2R1VA 4Z0PA 4Q82A 4K6KA 4CG2A 4TV8B 5JZSA 3BMQB 2N0SA 1WETA 1DRVA 1XSPA 1EFUA 1MZVA 1U99A 2Q1WA 2EAPA 1P4RA 1VZ3A 3K71B 5JCOC 5TISU 4JUIA 1YZKA 3C1YA 2D5AA 2E87A 2E1EA 2OFOA 4JYMA 4ZODA 2HW8A 1UZMA 3EWIA 3Q8MA 3IUYA 4O0IA 3QFHA 1XYYA 4QHTA 1JQDA 1A2BA 1E3SA 3V6HA 2ZBFA 4W9NC 2H65A 3YASA 1N5MA 1K2WA 4ZQGA 1F8UA 5FFMA 2ZJBA 2FF7A 4D25A 2I54A 1GTZA 2B5VA 2G9NA 3K9HA 3U1VA 1YS2X 5KQLA 3L8GA 4U7WA 2JMGA 1SRRA 3CF4G 1Q7BA 4J0KA 3P9XA 4KQGA 3ZQ4A 5FA8A 3V2UA 1NW3A 2VHCA 2PRZA 4G5GA 4JP3A 5B4TA 4E22A 4JKYA 4EUNA 5TQ0B 1Z9BA 2OECA 1R8QA 5HF9A 4AY4A 1Q0PA 2HEGA 5CDHA 3KU4A 4OHWA 4MAAA 2HV9A 3CCBA 3A4YA 2YYYA 2X1MA 2JIZD 5AT1A 4E2FA 5FOQA 1E9DA 1QYIA 3Q7QA 5LZ4A 1EINA 1YI1A 4O08A 3ZH2A 2F67A 1Q92A 4HEA6 4ZAGA 3CSSA 3VR5A 5HKKA 1JR6A 2LNDA 5LJIA 1RAAA 1S01A 1AHNA 3LA6A 1BVSA 1Q17A 4CM5A 5K3FB 1H6DA 2EBHX 1CG6A 4F8JA 3IIKA 1GPMA 3SG0A 3D0KA 3ER9A 2IBSA 1X2BA 1EFPB 3D54D 3ZQKA 5IIOA 3Q8KA 1G3UA 1G4AE 3KP1A 3BRQA 3Q3IA 1KY4A 1QAQA 1AE1A 1K2VN 2ENWA 2ZS9A 3V7WA 1RDFA 1UXGA 3GARA 4MR8B 2FX5A 1AOXA 4KK4A 4RLQA 3NEAA 8ICAA 1QRSA 4KV7A 3UHPA 1QF6A 1YJQA 4NCIA 4CLRA 1U4BA 3THYB 5EIXA 4PPGA 3T99A 2CHVA 2GFIA 2NQ8A 3CKLA 2PLRA 3THYA 4I1SA 1JKFA 1O5OA 1YFKA 3PUXA 3RYFA 3CF0A 2QN7A 4CIVA 1H4SA 1GHTA 2WFLA 3SSMA 1I51A 4RQ4A 1NMSA 1KYVA 5KG0A 5MDHA 2QP9X 5EMJA 2GPJA 2Z8ZA 4UBKA 1OX5A 2B8NA 4OHKA 3Q7PA 3TF5A 1IBMB 2DHCA 4BB0A 2W58A 3SJUA 3LW7A 1QFZA 4M0MA 1CFZA 2JL1A 3MJRA 4L74A 2XDQA 4KXYA 2H0AA 5JUMA 1W88A 2AOVA 3WRYC 3CLTC 4Q03A 1Q22A 3D6HA 4G0PA 3IYLW 2HHWA 1ZRMA 3ELWA 3LDUA 1ZGZA 4GI2A 1W88B 3OKPA 4PG4A 3QE2A 3WJ2A 1RKBA 1JPJA 4ZZ1A 2GKGA 4F72A 1R00A 3GXOA 4IMJB 2GNOA 2BRUA 3NLLA 2PMWB 5A7GA 2XAAA 5LQDA 1CDEA 1P7ZA 4LXIA 2OY0A 4WBNA 2WUVA 3KDPA 1ISSA 1PNOA 1F17A 1RJWA 2JFGA 3N0XA 1KA9H 4LISA 5AW9A 1SKMA 1T9AA 5LQMA 1UK9A 1HK7A 4RQMA 1IY1A 1XI2A 2DCUA 4OO3A 3K70D 1FW8A 4EFMA 3VISA 4EWLA 4ECUA 1EP3B 2RCNA 2BSXA 2UYQA 3MTGA 3QIVA 5COQA 5CA1A 1RFGE 2FJUA 3F8TA 5GJBA 4FR5A 1GQFA 1ZYUA 5TRTA 2NXNA 4WBNF 2CJYA 3CJTA 4YQYA 1QC5B 2RHLA 2BR0A 3HKEA 2CE7A 3IUQA 3JCZA 4JBIA 2NIPA 2AUNA 1R37A 1DRUA 2IIBA 1RLOA 4M7WA 3ETEA 2K7FA 3CLHA 3ZC3A 1GRNA 1ZJNA 2IHYA 2JFZA 1AO0A 1FP7A 3Q7TA 4IWXA 2QX9A 5DGAA 2BDTA 4W6QA 1DX6A 4O4HA 2G1PA 1V5FA 4ZDIA 3EJWA 3I9OA 1XCBA 2WPDA 2VQFB 4QPZA 4UTNA 4P53A 3SVLA 2O19A 3FWZA 1XRRA 1G291 4DV5B 4JWKA 3Q3GE 4U00A 3U3MA 2P30A 2HJRA 1UMCB 1ZQRA 3JPRA 4FJ1A 3SE0A 5IJAA 4NPCA 4EHHA 2O48X 1FNMA 1K0UA 2YL2A 4ARCA 4DHEA 5FIUA 2CK3D 3JSAA 5ITWA 1ZAYA 2JV3A 5DHFA 5DU2A 3FMPB 4Q7LA 5LZ2A 2E37A 4ED0A 2HK7A 1EYZA 2BFOA 2PI4A 4R8LA 5A7FA 5CLJA 3I34X 3EYZA 1U2PA 2ZTVA 3E1KA 4R7GA 5DBEX 4EG0A 3WIUA 5AVZA 4RPKA 4CYMA 4H3KB 3K8ZA 1HG0A 2X19A 1K7CA 1VL5A 2A3RA 3VGJA 4CV1A 4ESHA 5JPCA 2AG5A 4DAOA 5JVDB 2CNLA 4HGPA 4O3MA 5CH5A 4BVGA 3LT1A 1NVKA 1KI6A 3LZCA 1YZHA 4OMCA 4E3ZA 1XTJA 2LD4A 4IYJA 3BT7A 3R9KA 1DT3A 4JASB 3E9RA 1PR4A 1S2GA 2PMKA 4B9MA 2Y9PB 1JRLA 4QXPA 3OAAA 3UWOA 4WOCA 3PK0A 4RELA 3KHHA 3GAZA 3JAWB 1LZKA 1YUBA 2XGGA 4QLBA 3LU1A 3A6PC 2R6ZA 4P4SB 4RE5A 3JQ7A 2KQUA 4RDXA 1AB6A 3DEZA 5KTOA 1G21B 2HQ1A 1TRHA 3FDJA 4LY9A 4YLEA 2YWJA 1E6WA 4PSAA 5AOCA 1JHQA 2OFXA 3P1JA 4GKVA 3USES 4ER0A 5CDGA 2REQA 3LDGA 1M1NA 4RM3A 4P3XA 5E4TA 3UXMA 3V6KA 1GZDA 4A36A 3QNMA 3C3EA 1CF9A 2CF5A 4ED1A 2FSHA 4DR3B 3GFRA 2F90A 4A8JB 2C5AA 5ER6A 3MHPA 4RTKA 1TPZA 3KOMA 1HDOA 3JVIA 1HYBA 1NJ1A 3A14A 3SS8A 3VC3A 1EFPA 1O96A 4REQB 3W9BA 1LK7A 4WD3A 1AN9A 4D6PA 3E3LA 1QM5A 2QTZA 3G3EA 1AV6A 1E98A 1U98A 5J0TA 4HGZA 5CVUA 3WL6A 2QMOA 4BFTA 3LVRE 2IS6A 3IDZA 4KLSA 2CBZA 4PN3A 1EBFA 4DVGA 1C3LA 1JAZA 3FWHA 1JHAA 4N82A 1YB7A 4H7FA 4J16A 3FYUB 5B37A 1T8WA 1QHHA 3GC6A 4OI1A 1GSIA 4DOMA 3QVOA 2C2HA 2Y2UA 2OAQ1 1ODIA 1QHHB 3DZCA 3NTXA 3QXXA 1W0JA 2AL7A 2GFHA 1Y4ZA 4G8DA 3HN2A 4TQ9A 3ON5A 1PUIA 1E5TA 1Y3DE 1ZQYA 2CVZA 4TXMA 4YXJA 1FFUA 5IDYA 5IVIA 1TCAA 3ZQ6A 2O8CB 1U3UA 3LRXA 4O4IB 1E66A 2AI3A 1F38A 1DL5A 1M6HA 2JATA 1GU7A 3KVRA 4FI3F 2I3DA 2OAP1 1CF2O 3I8OA 4Q02A 4U2BA 2G7MC 3TQCA 3UUWA 3JATB 3MWDA 1MDFA 4H35A 2P65A 5JWRA 3JATA 3MWDB 2F8KA 4P4OA 1LGYA 5IX8A 1UT5A 3DE6X 5TMPA 1JU3A 2BFEA 4MGEA 3V2HA 2Q2WA 1JQJC 4GLBA 2W2LD 4J1NA 8ICOA 1UBGA 1N2JA 3PNPA 4Z7OB 1I4WA 1Z29A 1M6NA 1QAMA 2HW3A 3KJHA 3OCXA 3ND9A 3AI3A 2JHDA 5C0YA 1XCPA 2GNPA 2IJGX 2PT7A 4PCAA 1LX7A 5DO9A 4WLEA 5TT1A 3G1UA 3VDQA 3ZV4A 1X7HA 1KR2A 1R10A 1U3WA 4EBCA 1Z2AA 3R3ZA 2ZRBA 4IDBA 4P86A 2C8LA 4QQFA 4B75A 5BUSA 1EX6A 2ENUA 3I9FA 4C8KA 3OOSA 4L4YA 2NPOA 4DL2A 4PTZA 1GLNA 1POWA 5DLEA 1GDDA 2B4YA 1ZXIA 4QGFA 1MVLA 1TKAA 1KIAA 3U0VA 1UM8A 5ALPA 3TLZA 1VJ1A 1BHO1 4HGNA 2F3SA 3JY6A 3RFFA 3L82B 4I4TF 5DYTA 1WR8A 1E18A 4R98A 1OX4A 4F5RA 2M1XA 4ZQEA 3L8EA 1FY2A 1C9DB 3RVOA 2BCSA 3M8RA 4N7MA 3HNOA 1I2BA 1C1XA 2BM0A 2KLBA 2ZANA 1NZFA 3TM4A 1UXJA 2Y0EA 3PL5A 4U9UA 1JH8A 5GJVC 3IAHA 2C5HA 5FOTA 5JO9A 1J33A 4RTRA 4FS1A 4LVSA 4BNJA 1V7QA 2QUBA 2AJQA 3VUEA 1KQFA 3IALA 2BMJA 5JPDA 1DJQA 3NRZA 4C80A 1TI7A 3GLVA 1TM3E 3Q2KA 5EP4A 3WZLA 5CBKA 4WW0A 3PW0A 4CZ2A 3R9IA 2JBHA 3PXCX 1FP6A 1PGPA 1T3ZA 1TU0A 1XZKA 2DULA 2R48A 4NBLA 1JGTA 5LZ7A 3DL0A 3ZWWA 3QI7A 1T2AA 2ZPTX 4F6LA 5LP6B 4C5AA 3MT9A 3W8DA 2GKSA 2EJBA 2R6HA 4UJ5A 1KP2A 1Z0KA 3AR7A 1CEZA 2YDYA 3M6VA 1STOA 3WK8A 1PWYE 2FOLA 3AERA 3GVCA 3DE4X 3KE9A 2QARB 4INJA 4B4UA 1P6XA 3GLIE 3HU2A 2CJWB 3CXRA 3N8DA 4GKAA 3R7AA 5KQPA 1CD5A 1QZUA 1K4KA 3MW8A 2OHHA 1ZN2A 3Q3VA 2HF8A 5EXSA 5F76A 3PHHA 1G7CA 4FIDA 5E1OA 2V8OA 4BO0A 1N6LA 1Z4QA 1MO6A 2AMLA 2VPPA 1J39A 1PYDA 2WAMA 4ID3A 1R7RA 4PX3A 1R12A 4PYOA 2F64A 2O0KA 4IIVA 5L51A 4B33A 3PX6A 3RFCA 4BKQA 4ZOQI 1P2FA 4QGSA 1PVOA 2C22A 1C3JA 1QTNA 1ZM4A 4JLDA 1RMTA 4N18A 1DEKA 2VNSA 2RFLA 1LPNA 1TCBA 4IJUA 1OC4A 1VTKA 4BAUA 2JEGA 4H6PA 3WIEA 2PGIA 3LLMA 1VPTA 5FPTA 4C7MA 5EE0A 1HL7A 1I3CA 4K26A 4JT2A 4UDXX 5J2JA 3IV6A 2X7XA 5FNVA 4D9HA 1CCWA 4YRIA 2OWOA 4Z0HO 3Q7IA 3HWWA 3D64A 1HZZA 1QCKA 3HEBA 1YR6A 3FFWA 3QVGA 3FWKA 1N5LA 3UPUA 1U7OA 3T7EA 1ZD9A 1DIAA 2HGSA 4RQ1A 4KHZA 4BQIA 2JG3A 1QDEA 1PNVA 1D5CA 1LPSA 2DUYA 1NF3A 2IYQA 3D6FA 3I04M 5AVSA 4Y9SA 3FBGA 4FWIB 4JKIA 1C3EA 4A16A 1HUZA 1TIBA 2HIHA 2MINB 3SPXA 3TD9A 2QLMA 4ARIA 3L7CA 5EI5A 3VO8A 2C7PA 4UQGA 4GX0A 3QOXA 2PXAA 3FLBA 5F1YA 1D1QA 3BQTA 3UJ3X 2HA6A 4DXAA 2R751 2KZMA 2OH2A 4KV9A 2AN4A 4DG8A 1GT91 5DQGA 4YXMA 4QDJA 1SKYB 4QUJA 4EMBA 1RZVA 1J1IA 2PMZC 4YUVA 1XZMA 1KSGA 1CRLA 4LF9B 5CLHA 5BNZA 4DFMA 1QHYA 2AQHA 4OAPA 2VJQA 5A1JA 2BKXA 4D92A 3E9ZA 3V1MA 2EAUA 1ZGBA 3M1LA 5CT6A 3BORA 4BJ5A 1UP7A 5LDDC 3UB2A 4L0MA 1DHTA 1ZIDA 2XEDA 3DOOA 1L7RA 3TO5A 4A0GA 4N3GA 3T3MB 5CK5A 5H3LA 1ZD4A 3GDHA 5AJTA 4G6ZA 1PEAA 2C4NA 2HXYA 3K0AA 4NEHB 4PZ0A 4WLVA 5DCWA 2IV3A 1N2CB 1QLJA 4I5FA 4PGGA 2QZZA 1UFVA 1O6ZA 3CZAA 4MROA 2Z1DA 1TYAE 4JLPA 4ELUA 1W35A 2WIKA 4R6WA 2QNBA 5H7XA 3LLVA 1JKJA 1TW3A 3RSFA 4D5EA 2E89A 1QBGA 3VPXA 3H1AA 5CDUA 3OPXA 3N6XA 2AEEA 4H3HB 3GDGA 1DBSA 2IEAA 1VCNA 4TMVA 2ZB3A 3KWLA 4BBZA 5FQOA 1EIWA 4IIHA 4BFSA 2A9JA 3F8WA 4A73A 2X9GA 1XT6A 3C3KA 3JQ9C 4Q9NA 3CR7A 5F9HA 4KG7A 1DWOA 1JSCA 2IUFA 3CH4B 4M60A 2UZIR 1PSWA 1X7DA 4L57A 2J5QA 1P39A 1RM6C 2H92A 3OZRA 4D9GA 7ICSA 1EUYA 4F7DA 1K9VF 1PDVA 3IMEA 5CX1A 5JE8A 3ZOKA 2R0QC 1ZC3A 4TMYA 2P9FA 1YR1A 1WB9A 4PHAA 1JAHA 1LPMA 3R23A 1TEXA 1SUWA 2H5IA 2MSNA 1KVSA 1C9JA 2GJKA 2R1UA 4Y6OA 5CNKA 4OKSA 3E4DA 5A3SA 2GZAA 3T41A 4NECA 1Z2PX 3FGPA 4A92A 1PQWA 5JJ5A 3R4CA 2YJTD 3DOFA 3PQ2A 2YZ2A 4KN8A 4B74A 1TVAA 4HSGA 1DG1G 3ANSA 5BW4A 2H7VA 1W46A 2MRLA 1FYVA 1WCNA 1K6MA 1FNNA 1VCOA 2DFVA 3V4VB 3W77A 3WWCA 1YL6A 2Z6QA 2VSXA 3UQYS 2HMUA 2ZSAA 2CCKA 2PLNA 2BUCA 5DBHX 3NBMA 2AH5A 3L1JA 4XX0A 3B2EA 4HB0A 3RIGA 4I1PA 3UUGA 1D1PA 2FQQA 4CM4A 9ABPA 3EF1A 2WFLB 1YDHA 2EZUA 3K1YA 4MVJA 4FO6A 4RTJA 2OBFA 4D8TA 5FJJA 2FKAA 1UXIA 2ATCA 2PLWA 3SDZA 2YHIA 3WXMA 1HOTA 1ZD3A 4O5EA 1AZLA 1UWLA 2C9BA 2ZWVA 4LQCA 4P8RA 5CNIA 1U45A 1A69A 3TNDA 3ZNOA 4GECA 3DXXA 1YRWA 1I7LA 1OI7A 1FUKA 3MGAA 3R9XB 3IQGX 3K9CA 3IEPA 1Q1GA 4OH1A 3MQ2A 5NULA 2CXQA 3ZE1B 1AMOA 2IGBA 4F1WA 2NXWA 2NVOA 2NYUA 2ODAA 3I9JA 3WBBA 4MUNA 3ONWA 5AW2A 4UTOA 3O1JC 2YTUA 1C9YA 2GZMA 1WUKS 3K9LA 4BBJA 4EHFA 2VT7A 3COJA 1QP8A 3CGWA 3U61B 1ENPA 1WZEA 2O6HA 1A8UA 3O2SB 3A6ZA 3KHGA 4NS4A 5TX7A 3VJMA 4R8VA 4BNMA 4HKTA 1PL6A 2G71A 2IWHA 1RQPA 3TXYA 5IC4A 1CY4A 4W1PA 4BC1A 2ACEA 2HRCA 4TQSA 2WJ6A 5LM3A 2IHKA 3THXA 4X71A 3T4XA 4MYSA 3ENZA 2VKQA 2AFHE 1SB3C 3HXPA 4H1TA 2Y0BA 4PF1A 3OC0A 3X1ZA 3FKQA 1JQEA 3L4BA 3PUKA 3QNUA 1RWWA 5A0VA 2FPRA 4JJEA 4NK4A 3TI7A 4OJ5A 5I4BA 3K31A 1S96A 2YVUA 4QREA 3CRQA 1T29A 5LBTA 3MGHA 5E6UA 3MM4A 1UEJA 3MRSA 1NLZA 3W34A 1P2DA 3C41J 4NMHA 1QKJA 1GG2A 1B16A 3EBPA 4TYPA 5H4HA 2R8BA 4PPXA 1D6SA 4A7PA 1K3TA 1GP2A 1J2NA 5ECYA 2HI0A 1U2DA 1XD2B 1LDNA 2FLKA 3ETGA 5E7JA 4BFVA 4MPRA 2GYVA 1SD2A 3IAM1 4D4MA 1SXGA 4EZBA 5LMUB 3I01M 1H9AA 1SCDA 3GLHE 1K6IA 3MJCA 2HK6A 3CEHA 3K4QA 3OA2A 2QSZA 3OE7A 3SCZA 1QYRA 4B0OA 4TTVA 2IY7A 4IDCA 5GP1A 3GIKA 2ZIZA 3MUNA 3VJKA 2JZBA 5KFOA 4Z8YA 1UMCA 2WIDA 5GGXA 3WHIA 4LPSA 4RVUA 1NV8A 1TK9A 2WJYA 3E84A 4YLGA 4BTVA 1U8CB 2QN9A 3OQBA 2OEHA 2AG6A 2O5RA 2Q3DA 3COWA 3E9QA 3FSRA 4DDTA 1T2VA 5HZKA 1U0NA 4DOCA 3RU9A 1JFTA 2EBFX 1IEWA 1ZNWA 1NQTA 2OMKA 4ZO4A 4QJ3A 3ROKA 4NIMA 2H17A 1YGYA 4XCQA 3B5EA 1X39A 4O4HB 2ZBGA 4HZUB 4XQCA 4OLAA 2GBIA 3UOGA 3R3JA 5KVCA 4IKEA 3JQQA 5AJXA 3TMYA 1QWOA 1HFWA 1EAYA 4H77A 3L6RA 3GR6A 1OU4A 3N07A 5ALHA 1AO3A 4UASA 4LECA 3C7DB 1N4DA 1N6KA 2JDIA 1T26A 3EE6A 2DPXA 1V95A 2EGGA 3PXEA 1VYTA 2E21A 4Y18A 3DZIA 3L4JA 1HR0B 4H0NA 2QD1A 1KDZA 3SR0A 4YT2A 4GYYA 3QNWA 1PWHA 1J8QA 2PUVA 4RIHA 1QUEA 4H1UA 3KFLA 1NW4A 3F49S 4C0AC 1V85A