4G9BA

Crystal structure of beta-phosphoglucomutase homolog from escherichia coli, target efi-501172, with bound mg, open lid
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
227
structure length
227
Chain Sequence
VMKLQGVIFDLDGVITDTAHLHFQAWQQIAAEIGISIDAQFNESLKGISRDESLRRILQHGGKEGDFNSQERAQLAYRKNLLYVHSLRELTVNAVLPGIRSLLADLRAQQISVGLASVSLNAPTILAALELREFFTFCADASQLKNSKPDPEIFLAACAGLGVPPQACIGIEDAQAGIDAINASGMRSVGIGAGLTGAQLLLPSTESLTWPRLSAFWQNVAENLYFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-phosphoglucomutase
publication title Crystal structure of beta-phosphoglucomutase homolog from escherichia coli, target efi-501172, with bound mg, open lid
rcsb
source organism Escherichia coli
molecule tags Isomerase
total genus 82
structure length 227
sequence length 227
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2012-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 4g9bA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4g9bA01
2WHEA 5AKGA 1RMTA 1TJ3A 2FUEA 1YNSA 3U7HB 2FPXA 4GXTA 2YMMA 4ZEWA 1L7MA 4NFLA 5AKIA 4UU1A 5AVVA 1K1EA 4OHFA 3ZTWA 4G63A 1YDFA 3ONNA 2NO5A 4AS2A 1Z88A 4UMDA 4L6AA 2G1AA 4C4RA 3QX7A 4IG4A 1RPZA 3SF0A 2NO4A 5AM3A 4HYTA 2C9MA 1QQ7A 3FGOA 3WK8A 5ALZA 3ET5A 3KDPA 3K1ZA 4QJBA 1CR6A 5IT4A 5AM4A 3A1CA 4EZEA 4XQ0A 2FDRA 5AKXA 4KYTA 1ZRNA 4O8CA 2VKQA 1CQZA 2RAVA 1O03A 3DDHA 3EF0A 5ALUA 3PGLA 5ALIA 3NALA 5AI6A 4L6CA 2AH5A 5AVQA 4GIBA 3N1UA 5AHXA 1QH9A 3OPXA 1S2OA 2FPSA 3AR2A 2PR7A 3N5KA 2JAUA 2DQSA 5AKJA 3AR9A 3OCYA 4UMEA 1L8LA 4AS3A 2ZG6A 1YMQA 3SD7A 3ZUPA 4YIHA 3L7YA 2RARA 3WKBA 2CN1A 4J03A 1AQ6A 4OD0A 2C8KA 2FUCA 3IB6A 5ALNA 5AW0A 1RRCA 5ALKA 2QLTA 2ZBEA 1Z4QA 3EF1A 4BNDA 5AKEA 2GHQA 3FZQA 5AM0A 1RLMA 3I6BA 5T41A 3L8FA 4BYGA 3OCZA 2FI1A 1VJRA 4EX7A 4NAVA 5AW8A 1ZD4A 3OCUA 2JAWA 3DV9A 4YCNA 1Z5GA 3BWVA 3ET4A 1NNLA 3E8MA 4I9FA 3ESQA 2HI0A 3NAMA 2OBBA 3W5BA 5AI0A 5ALJA 5AKHA 2WF5A 2IOFK 3R09A 4BX3A 1RLTA 4YGYA 4KNWA 4L57A 2W43A 3R9KA 3NANA 3U26A 3ZU6A 2MU2A 4F72A 1WR8A 3A1EA 3AR6A 4BBJA 4MUMA 1XVIA 1QQ6A 2B1QA 2FPUA 1O08A 2NYVA 2HHLA 1RMYA 3W5DA 1X42A 3PGVA 2WF9A 3W5AA 5ALLA 2AGVA 5AKYA 3UMBA 3NASA 3AR4A 4UMFA 1U02A 4Y2XA 1YJ5A 3CZ4A 3WK4A 2ZXEA 4DFDA 3ZWKA 2BDUA 3M1YA 2AUTA 3WK9A 1Z4MA 5ALXA 3WKEA 3U19A 2GFHA 2HF7A 3N07A 3ZW7A 1TA0A 2HOQA 2I34A 3FPBA 2C88A 2YMQA 2HDOA 3FM9A 1Z4KA 2PKEA 5ALFA 5A3RA 2P27A 1VJ5A 3ZVNA 2ODAA 5AKZA 4F71A 1ZOLA 3L1UA 5AK4A 5AM2A 3A1DA 4HGQA 3RF6A 2MSNA 5ALSA 3FPSA 2WF6A 2G07A 3UM9A 3SHQA 3SLRA 5AIBA 4FFDA 3HLTA 4DCCA 2I7DA 4FYPA 3SMVA 5FP0A 2R8YA 3OCVA 3I1YA 4HGOA 5AK6A 3ED5A 1ZJJA 2Q4RA 3WKCA 3R4CA 2JAOA 1U2SA 4UW9A 3KBBA 2CFRA 2GO7A 5AI4A 4Y2UA 2FPWA 3KD3A 5AW7A 1RMQA 3IJ5A 2HF2A 4CF4A 1RKQA 1RKVA 4BKMA 2OM6A 2R8ZA 4QQFA 3QU2A 1RLOA 3AR3A 1WVIA 4FE3A 4EX6A 5AW2A 4RESA 4UU0A 4XE5A 3QUCA 1Q91A 3OCWA 3QU7A 1XP5A 1TJ4A 3QU5A 3ZVLA 1J8DA 3QUQA 5AKLA 3QGMA 3L0BA 4BX0A 3GYGA 1PW5A 1IWOA 3L0CA 1EK2A 1ZD2P 1Z4NA 2EARA 5AVUA 5AI9A 1QYIA 1N9KA 2I33A 4BNDB 3SKXA 2I54A 1L7NA 2FPRA 3DAOA 5ALTA 4BEVA 5AESA 2W4MA 4Y2VA 3QU4A 5ALPA 3QYPA 3MMZA 5A3QA 1RQNA 1NRWA 4UAUA 4UMVA 2IA5A 3FVVA 3CNHA 1TE2A 3W5CA 4YIKA 5ALEA 3PDWA 4Y2RA 2ZBGA 2RB5A 2YBDA 4YH1A 2WF7A 5AVRA 5AVWA 3E58A 4E88A 1RKUA 2G0AA 2OA0A 4B6JA 1RQLA 4NWIA 3ESRA 2IYEA 4IFTA 2PQ0A 3PCTA 3M9LA 1XPJA 4AP9A 1TJ5A 5ALYA 3AR7A 4Y2YA 1RDFA 3KC2A 1Z5UA 2G08A 2C8LA 1F5SA 4KN8A 2GHTA 2X4DA 4CNQA 4UAVA 3ZVMA 4NABA 2WFAA 4CE6A 3U7FB 5AVTA 2YJ5A 3U7EB 3QU9A 3MC1A 3WK5A 2YJ3A 1Z4PX 2P69A 5AW4A 5AW6A 4EEKA 3N28A 4XPZA 2ZBFA 5AW5A 3ZTYA 1SWVA 2GMWA 3I76A 5AICA 1N8NA 2JGAA 5IT0A 3VAYA 4OCZA 3RFUA 3E81A 3QUBA 2B8JA 5E0OA 1ZD5A 1L8OA 2CFTA 1ZD3A 4YCMA 2YN4A 2ZBDA 5ALRA 2CFSA 1U2TA 3B9RA 3ZX4A 1JUDA 2IOFA 4HGPA 5ALGA 4Y3UA 1T5TA 3UMCA 3OTQA 1U7PA 2AMYA 2IOHA 3NUQA 4UM7A 3L5KA 1Q92A 4HGRA 4UASA 2Q5EA 1FEZA 4NV0A 4XOUA 3IRUA 2JARA 1RC8A 5AI8A 5AW9A 1KYTA 4Y2QA 3SKYA 1T9ZA 5AKKA 5AM1A 3L1VA 4BEWA 5AW1A 3QXGA 2YY6A 2B30A 2C4NA 5AK3A 3WK7A 2O2XA 1SU4A 2Q4TA 2YJ6A 1WPGA 2W11A 4MWOA 2EATA 2HX1A 5ALHA 3QNMA 4C4TA 5AIAA 4H1WA 3L0YA 2P9JA 3B9BA 3ZWDA 4ZEXA 2RBKA 2G80A 1T5SA 1NF2A 3KZXA 5AM5A 1QQ5A 3KOOA 4PNHA 4Y2JA 2YMLA 4Y2PA 5AK5A 1LTQA 3MN1A 2HSZA 3J7TA 1WZCA 3U13A 5AVYA 2HEGA 4CF5A 1Y8AA 4DWOA 5IS2A 3P96A 2HO4A 4HAIA 4JB3A 1YV9A 1LVHA 3B8EA 3ZI4A 3I28A 5ALQA 4KX5A 4CF3A 1Z4OA 3A3YA 3QLEA 5ALDA 4Y2TA 3NIWA 4UM5A 1Z4JA 2MU1A 2R8XA 4JDPA 2G09A 3TLMA 1ZRMA 2B0CA 3N8GA 2B82A 1U7OA 1MH9A 2EAUA 4DW8A 3AR5A 5AVZA 4KX3A 3ZX5A 2BDEA 3WGVA 2G06A 3WKAA 1L7PA 2QYHA 4I9GA 5A3SA 2OYCA 5ALMA 3WGUA 2I55A 3D6JA 3UMGA 5ALVA 3NRJA 4HGNA 2I6XA 4ZEVA 5AVSA 2B8EA 1Z4IA 4G9BA 3U7GA 4UARA 2WF8A 4YCLA 1L7OA 3E84A 3L8EA 3S6JA 5AVXA 3OCXA 3WK6A 3EWIA 3MPOA 4C4SA 5ALWA 3DNPA 3F9RA 2YMPA 2R8EA 5ALOA 3HYCA 1Z4LA 2D2VA 2B1RA 1L6RA 5AI5A 4UATA 1S8OA 2YJ4A 1VFPA 1J97A 3WKDA 1ZS9A 4EELA 4Y2SA 3BA6A 4RETA 3QUTA 2ZOSA 4J2TA 5AW3A 2P11A 5JJBA 4BX2A 2YFYA 1YS9A 2O9JA 3AR8A 3EPRA 4KNVA 2WM8A 3L8GA 2FEAA 1SWWA 2BY4A 1EK1A 3L8HA 4OFZA 4EENA 2HCFA
chains in the Genus database with same CATH superfamily
4DIFA 221PA 1SUWA 1XROA 3W3ZB 1Y34E 2C4UA 1J33A 1FP7A 3A36A 2XQGA 4IUCS 3U4AA 2O2YA 2AI1A 1X7ZB 3VV3A 4E5VA 4BUGA 4X97A 3L7LA 5FBWB 3GHYA 2D1FA 2WINI 1EJBA 5AOCA 1DAKA 4NL4H 1E89A 1JT2A 3TBHA 4C0HA 3K15A 2H7YA 5B3LA 4LBZA 3RSQA 2QE7D 5KFTA 4I2EA 4FWIB 3VR6H 3L01A 3R0QA 4LDAA 3O0DA 2FY8A 3E9MA 1A2BA 3DLCA 3WE7A 5C1DA 5MHTA 1T8TA 5KHAA 3PNQA 4YHHB 4JEMA 3V8QA 1AQ6A 1EFKA 3I30X 1OZAA 4WXEA 2Y76A 4RIEA 1H69A 3SYMA 3CCCA 3L8FA 4FYWA 1LWOA 1UL1X 1J2EA 2C3OA 3LGAA 4ITUA 1N2BA 1DK2A 4P5DA 4FFLA 5HM8A 3D2SA 3KELA 4ZU3A 4M8SA 4ELUA 1PLLA 2NSLA 1SXJD 3NANA 3UT6A 3JQ9C 1IOVA 5DI3B 4IQUA 1U2DC 1LX7A 2AN9A 4FONA 3GMTA 5A62A 2BHNA 5I9IA 2EW8A 3CW2A 1KYZA 2WVGA 5HFAA 2OKCA 5JEEA 5DB9A 4MIKA 4KQJA 3W4KA 4LZLA 2BEVB 4ZARA 3ZGLA 4QOFA 5J8YC 1WWKA 4N3NA 1PJRA 2QZSA 5J2TF 4H77A 1YR2A 1T5BA 2EZYA 1TVAA 2ZCUA 2HSWA 3SE7A 4CIWA 4DN6A 4NFHA 5J2UA 3FSGA 1T24A 1LK5A 1VM6A 3IT2A 5DX0A 1OWPA 1PT5A 2C59A 3OO1A 1C8VB 4RCZA 1P7DA 3EBPA 1KPGA 4OK6A 1KTQA 2I7DA 1ZLYA 2WZCA 2ZVPX 4QRHA 5ADVA 1A9RA 4JV0A 4R64A 2WP0A 2H16A 2C20A 3PYLA 4XLLA 3PC4A 2O4CA 1MABB 2GPYA 5M34A 3PVSA 2KVSA 5KTKA 4YRNA 2RHOA 2GM4A 4J1SA 4P84A 2R68A 3CZRA 3PICA 3MTGA 5DP2A 2GUWA 4NATA 2ID7A 2IFTA 1EDBA 2OE2A 4IGEA 1FY2A 1G8AA 7ICRA 4U1RA 2W4MA 5E6SA 3NPMA 1JU9A 1GKKA 2AEMA 3NRWA 4Z7NB 4I2IA 2WG1A 1BYUA 2WLTA 5JFTA 1N3BA 3W6UA 1XEXB 3SWWA 2E1RA 4JXZA 1WZUA 4RIIA 4ZOCA 3O90A 2DCUA 2PZAA 4JY7A 2FMSA 2RQ5A 3V97A 4GZ3A 3M6XA 1J2NA 3ZH9B 2UVUA 1UQUA 4GOXA 3MT9A 4B09A 1W4ZA 1ML3A 3C6XA 3K05A 3FJ1A 4BFCA 3KXIA 1RWVA 1FDTA 1OH6A 3JAKB 4HGPA 1VJCA 2WU4A 5BV7A 4KTVE 1ZONA 3HXQA 3FH0A 1TB4A 4AD8A 3D2QA 4L73A 4JLNA 2RKWA 2A1UA 4R2HA 2DYKA 2O1SA 4D9NA 2ZI7A 4BMSA 3HXTA 3UVEA 4D9GA 2R5FA 1O96B 3J7TA 3WDKA 1Q1ZA 3RUCA 1L4GA 5C8DA 4JJGA 1KJ9A 4Q12A 4YRKA 4MQEB 4URFA 3HVJA 5JVDF 4J9VA 4PL2A 4LXGA 5CHGA 3IEUA 1LKZA 1IN1A 1L7PA 4HNTA 3SXUA 5CIYA 2GTIA 2JGLA 4OJKA 3ZWYA 2H51A 1DIBA 2XI4A 4ACAA 2YZKA 5DM2A 2F9FA 2JEFA 1DMSA 1X7DA 2V97A 3PQ5A 1CY2A 5ITZB 3IVXA 3C1TA 3A31A 1GDDA 5K6AA 4DIBA 5JJBA 2YH2A 3FCXA 2X9VA 2R2AA 1YZYA 2FMXA 1DJLA 4WINA 1O77A 3IUBA 2CLDX 1EXDA 1FNMA 3KTAB 1DBQA 4RCVA 1PFQA 3PX0A 1R9JA 1KJ8A 2DHQA 2XYQA 4KXWA 4C30A 1TADA 1QRSA 3NVKI 1YVRA 1RPZA 3WMWA 1E0DA 4BXOB 2QVBA 2ODGA 4UTNA 1ZGGA 2B7BA 4BOYA 2Q1SA 5IEJA 1UANA 4RFSB 1T8RA 1GQOA 1P8AA 2FEMA 4FMCB 1MN8A 5KNCH 3JVIA 1E1QD 3U4CA 3ZQJA 4TV8B 2QRZA 1UBCA 3I6MA 3G89A 3FHOA 4K7JA 4PLWA 1B3RA 4J0QA 2PLFA 3ZE6A 1ESCA 3H0LB 1Y9JA 2X3YA 4BJ3A 3DEZA 5EVCA 2UUPA 1U0BB 3TTSA 4YUVA 1NK7A 2RGRA 3SN6A 3N2IA 4J4TA 2O1WA 4KO2S 5T41A 1PZMA 4A15A 3EIHA 2A30A 1EFVA 1YK0A 3AUSA 3QVOA 3OIYA 2BGRA 4C80A 4BFVA 3LYAA 2EJUA 3GJ7A 5EZYA 2IYVA 3ET4A 4YWHA 5A6SA 3ESQA 4BGUA 2PXAA 3WLIA 4O8ZA 4RL6A 1L9KA 2YVAA 2ACWA 4OM8A 4J29A 1T1GA 3PJGA 3LK6A 4Y6RA 1R3DA 1PV1A 1T3QA 4J1QA 2VKTA 4L4ZA 5CCDA 2PRJA 3WNZA 2I71A 4MLDA 2A0WA 5K3EA 1MAHA 1C4WA 3GY0A 5DW3A 2FWBA 2QNIA 2IEAA 1S3GA 4DC1A 3L0OA 3EQ9A 3ABIA 3OU7A 5BYBA 2W48A 1OT3A 2FR1A 2C83A 1FX1A 1J90A 2H2WA 4M9NA 4Q66C 2PJZA 1N5WA 3R3HA 2VQFB 1UBKS 2FZCA 3T5LA 2JBAB 3C15C 3KQSA 2NTEA 4MJLA 1KEEA 3N2KB 1Y1PA 3LCRA 4GSYA 4R9RA 3TN7A 3DBRA 3A37A 4L95C 1T29A 3C6QA 2BBOA 4PYQA 4E1BA 2JD2A 3MWYW 2B6NA 1P72A 3JD0A 3Q0EA 2Y9PB 4OHWA 1K4MA 4KLJA 3K94A 5CNMA 4ZOLB 2HA4A 4EB0A 5ALPA 3HFJA 3O8OB 2NU6B 4XOIA 1RPLA 1X80A 3HBMA 1WZ2A 1A8IA 1TCCA 3R5TA 1N57A 2P35A 2HHJA 7MHTA 3KVYA 2WWVD 4B47A 5A4IS 3TLKA 1W0CA 1WDTA 2XA1A 4KUHA 4FCCA 4RULA 3JQAB 1HYEA 1JEOA 1DDGA 3RYIB 1MIOB 1XCOA 3G6KA 3USCS 3V48A 5AW6A 2B6GA 1I4LD 2H5XA 1H3FA 5EUQB 1HQCA 1AZLA 3G2HA 4ECTA 1TA4A 5ALRA 5JAQA 2NZJA 4LMRA 4DPLA 5CG2A 2BONA 3MUNA 1Z6TA 1QMGA 3NUQA 3QWAA 1CJBA 4ZHSA 2VA9A 1CLEA 5BOLA 3AFIA 1U9IA 4L27A 2ZYGA 3HB1A 4JLMA 1Q95A 4CEIB 2F4NA 4AYTA 2VP5A 3WBKA 3O6VA 1Z63A 4O2BF 2LVBA 3EC7A 3BXXA 5TZVA 1V5IA 3QWBA 1NN5A 2W8KA 1LY1A 4ZO8A 3L0ZA 2OCLA 4LE2A 2XI9A 3UJ9A 3GRCA 1H4VB 3NLLA 3MWKA 3I2KA 4XUSA 2QN3A 2P0EA 2R4QA 1ZQLA 3K32A 1RKBA 4XX0A 2R8XA 1K3FA 3Q0IA 3LRTA 3L7AA 8ICAA 1EHYA 3KQTA 4MZDA 5CVJA 3PUHA 3HM9A 1I51A 4L08A 3DFKA 2HW3A 4LSZA 4BKOA 1NMQA 5H9VA 4JT2A 2F3PA 1MQAA 4AKSA 2ECQA 3AB7A 1DRWA 2OCIA 4ZV9A 5BSKA 1SRRA 1IATA 3VPFA 3NDJA 3V7LA 3I2IA 3TOCA 5KQPA 3RARA 5SICE 3TGLA 3GJ5A 3LWLA 3P0EA 3PFBA 4Q05A 2C0CA 4EELA 4FFNA 4BN5A 4KPUB 1JKJA 1VLBA 1IBMB 2JEOA 1O4VA 1I0IA 2VYVD 1J09A 4NF2A 2FE4A 1DT3A 1BXZA 1S96A 3AUFA 3KB8A 1CYDA 4HQLA 1E0SA 2YASA 4B46A 5LQUA 2Q29A 1U7XA 3OIFA 1A3CA 4PYLA 4X7BA 1KAOA 1X94A 4JXJA 3IALA 5I4CA 5FLXA 4KR6A 5BMVB 2GEJA 1E7YA 1TYAE 3M9XA 4Y30A 5ALIA 2J41A 2HA2A 3VH4A 1CS0B 4O1IA 4K4GA 3Q8XB 1KE2A 1ZXBA 3EVNA 4TXJA 5C8YB 1LSOA 3G8CA 4RDIA 1MU0A 4RY0A 4EFKA 2N1MA 1CS4C 3TJZA 5HR7A 3R5JA 4B9AA 2VHEA 2IYFA 4OAQA 1XZBA 3CUVA 5KNBA 1NG1A 2MTBA 1KR2A 4NJEB 1FQJA 2D13A 3PDHA 2YR0A 4FNAA 2XUJA 3EAFA 2YNMD 4DXHA 1AGNA 3RI3A 4O5OA 1C9DB 3TXYA 4ER7A 4RZ3A 4Z9BA 3IOYA 3SFTA 2Q2OA 4PWZA 3TXXA 2MRLA 1HSOA 3DV2A 4GGPA 4I1OA 3H7IA 3IO3A 5KYKA 4DA9A 5EJ9A 1T9DA 5IH3A 4D4MA 3HHEA 3NP9A 3OFNA 5HIJA 4Z4HA 2BGTA 2L0XA 4RPKA 3GCDA 2FN9A 1RHMA 4GZMA 2ZU6A 1IM8A 5B6PA 1S6YA 4CLHA 2C57A 2NXWA 2EANA 4AY3A 3DC7A 1OWLA 2J3IA 2LCQA 1JHDA 4RE6A 5LWQA 4I2CA 1WVMA 4ODIA 4E30A 1ZI9A 2J3LA 2MYTA 2PFPA 4O2AF 1Q21A 2DECA 1ODSA 1SXGA 2CRXA 3FMFA 4ZQGA 3RC3A 4QGHA 3LK9A 3EDQA 4V0NA 1Y33E 1XDGA 4Q4JA 4AJPA 4KMUA 4I46A 3HXMA 3N2LA 5AHWA 3MWJA 2AJLI 2DY0A 1TLLA 3ILVA 3HYNA 4PSUA 4B4VA 3QXJA 3K2IA 1W59A 1DCMA 5AESA 4W63A 1X9HA 2W7PA 1SZPA 1B15A 4IIUA 1KSJA 4K88A 4MYDA 5F52A 4O0LA 2Y0SF 2E4VA 2X2FA 3EFBA 3AEUA 1PGJA 4IHJB 3RC9A 4H7DA 4TOIA 3LL4A 1OQAA 3QIVA 2HWUA 4KQKA 3AFNA 5CJ7A 2QUHA 5HF5A 3HJEA 1YOVA 4BNXA 4MUNA 3VR4D 5ESDA 4GGMX 4B4OA 4TWZA 4N0PA 5BR4A 2JGAA 3LQKA 4I4TB 4RNMA 3INTA 1CUIA 4KR2A 1ZD5A 1R6TA 1W6RA 2NZVG 1U7WA 3AZOA 1O6BA 1TF2A 5LWHA 1HY3A 1X9WA 3NHWA 2KI5A 3IEIA 2BEWB 3ELWA 2AN3A 3I5MA 5KFZA 1NW6A 4NBWA 5HFNA 1BX1A 4KLDA 3KT6A 5BYAA 2B2XA 4F4DA 2LYBA 4E22A 3TW0A 4UB3A 4BRSA 4ECZA 3CH4B 4ZZ2A 3WOVA 4J16A 5DTJA 3D3JA 3WB1A 3ICWA 4IRXA 4X00A 1DO0A 4NBKA 4HX9A 1G5PA 4EPRA 1PGOA 4LZWA 5HJ7A 1YBVA 3V6LA 3ETLA 2WFMA 3ISJA 3T7IA 4YJ2A 1PYDA 3LUHA 5F76A 4BJQA 4PHHA 3NV9A 3U5TA 5LDHA 3HU2A 5CDSA 2V4ZA 4KDEA 1Z4LA 2QTWB 2VDWA 4DEVA 2VBCA 1TT7A 1GGMA 3KHGA 1PJBA 3WRYA 3CF2A 1ADYA 2UVDA 1C9MA 1NF3A 2I29A 3MNFA 1UFVA 1ZUWA 4C0ZA 4Y9RA 3I9JA 2J07A 4LJRA 2EIXA 3QEJA 5DBOA 2PUJA 4URVR 4FCVA 2QVGA 2VNKA 3PXBA 2I1QA 3OFJA 1QGAA 3UW3A 1KEWA 4YV7A 4BVJA 2JJ2A 1N8TA 2IPMA 1DO8A 5LP6C 3OTWA 1YJ8A 1S4QA 5K8IA 1I7LA 3K8OE 1HNWB 4E5UA 3WYAA 1PSWA 1NM5A 3WQSB 1KOLA 2GTHA 3VYRB 4FOTA 4YCXA 5DG8A 2VSNA 4ECUA 4JGGA 3PR1A 5AW0A 5ALKA 3KLBA 3S2FA 4GRDA 5IZCA 2XMCA 1SQSA 2ON6A 4FQ5A 4LF9B 4EGFA 4YCSA 1HXHA 1JIKA 2FOIA 2ONCA 3QPDA 1V95A 1WW3A 1XQXA 4F56A 4KK3A 1W87A 1EQUA 1KWGA 3CT6A 2XGMA 3G2IA 4FFMA 5K3FB 1TEVA 2DU8A 1D8TA 1N5MA 3N2ZB 4NK4A 1R10A 4PHPA 2F3TA 1WSBA 2D6FA 1ZNZA 1IXRC 3AR4A 1BYIA 2O3RA 4RJIA 2O2ZA 4DKXA 2WZQA 3ULKA 2GF0A 1SBNE 3BM5A 4LJYA 1N2XA 4R41A 1ZJZA 1EVKA 4Y67A 1GPAA 4UCFA 1OAOA 2XICA 3ENZA 2KK0A 1SQGA 1TI7A 5JSKA 1II8B 3KSDO 3SMVA 2O8FA 1MV8A 2YCLA 1ZJJA 4YP0A 1B0ZA 3PEUA 2AK3A 3MWLA 4GKJB 3KSMA 3BJEA 3QBEA 3SAFA 3D8BA 2X0FA 5BWNA 4BNFA 4FE3A 3VOTA 4OGWA 2RGYA 4M54A 4QXQA 2XVZA 3INNA 4P4MA 5BURA 1ZDMA 2JLZA 2QQGA 1WCIB 3LUGA 1HTWA 5D8DA 4M8IA 5KL8B 3GMIA 4HDRB 3ND5A 3LHFA 3MMZA 2QPTA 4C76A 3PIIA 1P7WA 2I5HA 4DG5A 5CFZA 3B82A 4GWKA 5F9LA 2ZIXA 5LFAA 2F43B 2VDVE 2ERYA 4IDFA 4B45A 1GNLA 3ZQ4A 2ZUSA 2I2AA 4H0FA 2OK7A 4H0CA 1U1DA 2EAPA 3ASYA 1Z15A 1JQAA 4DB2A 3H1BA 4LYJA 3AU2A 2E49A 3UOGA 4KZKA 5IT0A 3CLHA 3C3XA 3EGIA 3FUVA 4AULA 2CUTA 4S2UA 4PY2A 3G2NA 1TUBA 2FPMA 4EI2A 5K2OA 4DUGD 4I1PA 5CEJA 1JB9A 1F2VA 1OIWA 1W0JA 4KBFA 1ID8A 3G0DA 2H3FA 4IIBA 3LVVA 5LMZA 3KZCA 4QREA 1P0FA 4D99A 3OJWA 5INTA 4DM4A 1W73A 4JNCA 4PYKA 2A19A 1DQPA 1VBKA 1XCPA 4IEFB 2A3NA 1H6BA 1W85B 1JSRA 2WSSD 5C31A 2AG6A 1TVEA 2HV9A 1LRJA 4XX1A 3KYCA 3NO4A 3N8GA 2W6JA 1CG6A 2DFTA 2ZIVA 1EZ1A 1XTQA 3EFOB 2OWOA 3RRXA 4KIWA 5JD3A 2BCVA 1OROA 3RKRA 2IGTA 2QN9A 1V48A 5GONA 1M0EA 3T7JA 1FDSA 5H70A 3G49A 1T0BA 4BQRA 1EFRA 4BFUA 6NULA 2ZB4A 1QZ3A 1C5KA 1WABA 5B58C 5DM70 1T4GA 5C4IA 2ESRA 4JI8B 4WQMA 3OKPA 3BD8A 1ZI8A 1GG9A 4X5VA 3HYRA 1ZXXA 1LTHR 4C0JA 3KKQA 1OTYA 4BB6A 2X4LA 2NAFA 5H83A 2R44A 4LDJA 5JU5A 4X63A 2HVHA 4J2HA 2PZBA 1N2ZA 2WM2A 1O57A 3EARA 4IG4A 3TJMA 1WUJS 3HPQA 4L5JA 3RRMA 1V96A 1QQ7A 5IULC 3P0RA 3DFMA 4UTXA 1MPTA 3FUTA 5EMHA 2BFDB 4R0NA 4E2WA 1KO5A 2CL7X 2Q1XA 3WQRA 5AI6A 1BU8A 4FHDA 3L1HA 1JJ7A 1RI1A 5F51A 1HNNA 4I9NA 1SXPA 1VYVA 1GZUA 1E9VA 5HIIA 1XV5A 4DDUA 1GL7A 2RCNA 3QVJA 3FY4A 5A06A 2H07A 4O4IB 4IKEA 3LIIA 4M76B 4MFCA 4B8ZA 3CRW1 1W4LA 2PSFA 3B60A 4IIJF 3MMNA 4YD1A 1XDWA 2GBGA 3W79A 1NNLA 3A6DA 2HJ9A 2PNFA 1S1CA 2CEKA 2WQ6A 3GK3A 4HX5A 5LPNA 2XYHA 4YDSA 1JG3A 2JEGA 1HDEA 3ND6A 4BZPA 4ZYVA 3EIFA 3GJTA 3FNEA 1GQ2A 2DFLA 3Q5DA 4HZIA 4JOBA 5GV8A 2WUVA 1NE7A 4UE2A 5K03A 1W25A 4X65B 2DT8A 4Q7JB 3QNUA 5PNTA 2WU8A 4I14A 4RDHA 1BCRB 4OJPA 1XXHA 3QK7A 2FJ0A 5BWOA 1ZYQA 1X8XA 5ICEA 3PLAE 4TM7A 1CZHA 1H1DA 4CQLA 4LJ8A 1SXHA 1QBKC 3TS1A 1N48A 4TMFA 4DLPA 3ETNA 1X9XA 3FPCA 3OHAA 1F8GA 2VUIB 1B6TA 3FSEA 1NSYA 2PJRA 2PS9A 4HQ0A 1JE0A 1OXVA 2WJHA 4PG8A 5B1YA 4BNDB 1XR3A 2NSHA 3CB2A 2NO0A 5KTSA 2FMHA 3AC0A 4G0NA 4PO1A 2AFHA 4IR9A 5KYGA 3H5TA 5CJJA 3C43A 2OA0A 4JJIA 2HZ7A 2W9CA 3BEDA 4FNOA 2W58A 4ZVSA 2NO6A 4ZZ3A 2HPAA 2PH7A 4F6RA 1E6LA 3C14C 3FYUB 2WM3A 2YS7A 3RSHA 1D5WA 3FKSD 1V3UA 2ID4A 4GP9A 5AUPB 1CU1A 5F78A 1K9SA 2DTXA 1YASA 5AW4A 3OY2A 3UHJA 3F53A 3BH6A 3BK1A 2ZBFA 1TAGA 5J2TB 5AICA 3PIDA 3F4KA 3INYA 2Q0HA 1U48A 3A0BU 4QVGA 4IMRA 5DHTA 2R6ZA 2XR1A 5SV2A 1M7GA 5BSRA 4AJEA 5COBA 2KV2A 1S2NA 3WGKA 2XVTA 2Q6LA 1MORA 3UAXA 3CIFA 4AY4A 3M3HA 4JJ4A 2GZAA 3BWBA 4RLQA 4BFZA 4HN4B 3KQUA 3W9UA 5BSFA 4KRFA 5C46F 1L9XA 4GI3A 4CT0A 1K0FA 4WDQA 4HAXA 1D7OA 3RSSA 3PDCA 3LPLA 2PXHA 1QVAA 3ETHA 5JSHA 3MMPA 4CMIB 1Z5WA 2WB2A 3G9TA 2F59A 1JYFA 3MYYA 4ZVUA 2Y1XA 1NE2A 1QPGA 4JLPA 4NBLA 4BVBA 3UANA 3VYSB 3GV8B 4MQ6A 2WJ6A 1KNQA 3L41A 3R3JA 2WIDA 2B8EA 2XZPA 5I51A 2ZI5A 9ICVA 3GUZA 3DC2A 4U6QA 4ZP1A 2BQ3A 3ORHA 5K99A 4M0DA 4G8JA 2QMYA 2Y4NA 2VI5A 3KOMA 1P1CA 3SQIA 2H5IA 5A5GA 3ZE9A 1LH0A 2XIJA 5GGYA 2QTFA 4N3AA 4NNOA 4RTQA 4ZCMA 4MQ4A 1KFSA 1V11B 3D4BA 1NYQA 3MLEA 1EPUA 1K7YA 1DX6A 1SC6A 1ZH8A 4M22A 3RG8A 5ICFA 1LPMA 4YJDA 4L76A 1H8ED 3S8MA 1EINA 4PG6A 5H16A 1B4FA 1V47A 2ZWIA 3G6YA 3TKYA 5MGBA 1NAIA 5DBIA 4BZQA 4Y98A 2IU6A 1T5DX 4KYTA 4EFDA 4OQQA 1PT9A 4Q01A 1YCFA 4JELA 4R0VA 2JIZD 1ZO8A 3ZBTA 4ON9A 1ULHA 3RRJA 1N36B 3BE6A 5JVDB 4XA8A 2R751 4INZA 1H23A 4A8HA 2BTOA 4WKNA 1HF3A 5HTOA 1Z7WA 4JL8A 3TQTA 3DZJA 5EKUA 4P82A 1E58A 4MO2A 1C3JA 4Z2YA 3A9SA 4X7PA 5HE9A 1HDOA 3IOCA 3HFRA 3MCZA 1E7WA 4HNSA 5ALJA 1PD0A 3R7WB 3M7IA 3ZJ4A 1BS2A 4KR0A 2NRXA 4DZRA 2N47A 4ZOHC 1GTMA 4MUMA 5IKEA 4LRUA 4YX9A 3KX2A 4OJQA 3FTPA 1FW6A 1UDBA 1P4GA 2HTEA 4N9WA 1Q6YA 4O3MA 5DI9A 2VAMA 2GYYA 3WYDA 2SCUA 3TMKA 3BF8A 3HBNA 1UOOA 1NULA 4WWHA 4FD3A 4RZXA 4ND8B 4UAJA 3LBHA 2XZLA 4OSPA 4FB4A 2WHXA 1LPNA 5EEGA 2WA2A 1N5IA 3QM1A 2QD5A 1KYIA 3CH5A 5IVPA 4KIFA 3SZ2A 1Z00B 3DEIA 3VR3D 1QRAA 4M0EA 2ECPA 2I7VA 2VDKB 1QIMA 4NDAA 5E3IA 4RD1A 4CXMA 1PJSA 3R40A 1ZQBA 4GP6A 3QGMA 4M0MA 2YWXA 4MIEA 5M29A 2C2DA 4QICA 8ICIA 5AXBA 4IDNA 4F2PA 1THZA 3V1KA 3PIRA 3E03A 1PQWA 1T5OA 1UQVA 4XGIA 2OQIA 2HCBA 4RM3A 4NU6A 4YMVA 3TFOA 4XWTA 3M9LA 5DF1A 2WUGA 1G6KA 4KN8A 5KWIA 3FI9A 1I7PA 5F3RA 4P0PB 3QU9A 1XC9A 3L7NA 4WX2B 3D02A 4LGMA 4EG5A 2J09A 4YRDA 2JVKA 3HB4X 3STXA 1XQ6A 3SHOA 4HRAA 5J0SA 1CE8B 2V7PA 4K9PA 1NAHA 1BE6A 3GJXC 3GT3A 1CJUC 1TVKA 2IZ0A 1Z0DA 4UASA 4EDHA 3H18A 4G23A 4CL2A 3H5AA 3MR3A 4EG6A 5L7TA 3L1VA 4RQ1A 4EZ9A 1IE3A 2BJHA 1ST2A 1HJPA 2GJSA 4E3ZA 4IMPA 4EG1A 1DQRA 5JH7A 1CWUA 1B16A 3LA6A 4B9VA 2MSDB 5AM5A 1XCLA 3ENNA 2JFYA 1Z6QA 2Q7DA 5IF3A 3AHJA 2QMQA 4RMHA 1LEHA 4ED3A 5IBQA 4EY8A 4RQ3A 3FPLA 3VZQA 1VLZA 5LYYA 3QVGB 1MX9A 1VGQA 1L5HA 1QGYA 2SECE 1DDOA 1DG3A 1THTA 3MTQA 1XSLA 4E7PA 4OHBA 2VXYA 3TE6A 2PX4A 3CLSD 5JCZA 1QZXA 2J5BA 2JLRA 4IQTA 3PHJA 2I22A 2QZPA 3UXNA 2IDJA 5FADA 4DBVO 1RE0A 4Z7QB 4FEAA 4LGCA 1JKXA 2AR7A 5HS4A 3FGNA 1Z6ZA 2FEAA 3TSZA 4OIFA 1RMTA 3CLKA 1NXWA 3RWMB 4YJHA 1QYXA 1Z1VA 5EVJA 1G8MA 4YP7A 3DE6X 3ZV5A 3PW4A 1KI6A 2Q6KA 5FOQA 4O2BB 5HUJA 3B85A 4MUBA 3DT6A 3IILA 1GTVA 4DUZB 4MA0A 1ODFA 1YZKA 4D3DA 2DUNA 4XQEA 2WD8A 2HBJA 3G0HA 1GOTA 4D8TA 1O03A 5FX2A 4CT4B 2C5HA 2AMVA 3LZCA 2PZKA 1HT3A 4BN4A 4FK8A 4PIPA 1II9A 4YVFA 3T0GA 3KEOA 3TO5A 2PGJA 4IS2A 4P22A 1E4VA 1KSHA 3TH5A 5G0WA 3GA5A 2BM8A 3EVAA 4DPMA 2C8KA 1TF7A 2IPLA 4NNPA 1SBCA 4O5EA 5CLQA 3AF1A 2NVBA 3GIJA 2B8TA 4ZAWA 3UJHA 2IV7A 1UWLA 3GNSA 4PPYA 4O4JA 1LPSA 3PHHA 4GRIA 1GAXA 3MT7A 5AJYA 3SV4A 4COKA 4KXXA 2CC2A 2WF5A 1W8DA 1WS6A 3RU2A 1XTSA 5KFOA 5DH9A 4BQIA 2JEJA 3BMOB 5DPMA 3FBWA 3IDSA 1QAMA 2R00C 5HR5A 3R1IA 3W5AA 2JLWA 4JVOA 2OZEA 3R6DA 1TQ2A 1BO6A 5LA6A 3BMQA 2P78A 4E5KA 4LHZA 1XZIA 1P5JA 4G5QA 2LTAA 5CYPA 4ARBA 4BMOB 3MGHA 2BI7A 3ITNA 2CHEA 4JSTA 4ZAXA 1X7HA 2FW0A 5IAJA 1PTJC 3O5AA 2F4VB 1JI0A 2O07A 5FI1B 3OQNA 2I3GA 4QKQA 4JK1A 2JLUA 1OUQA 1QC5A 1PVDA 1EESA 4YONB 3ZD9A 1UM9B 4NU0A 2CHVA 3SBEA 1FDOA 2AHRA 4P54A 4MRMA 3UJ6A 1QRUA 4Q21A 3QUQA 3PTLA 1NQVA 3L6BA 1SBYA 4IW3B 2HUNA 5CA0A 2HZBA 4I1VA 3D8UA 1R0BA 3PHCA 1GQRA 3A9TA 4B9LA 3P52A 3DXFA 4L74A 1MO6A 2LPEA 4G4GA 3RVLA 3S4YA 4PCUA 3BE4A 1N5OX 3S1AA 1JXMA 5SYMA 1TZJA 9LDTA 1JT9A 1XWLA 3WLHA 2DCMA 1YUBA 3ZVMA 4LZPA 4TMYA 3G2QA 5CW2A 1CY6A 3WK5A 4BNLA 4D8XA 4B80A 3JPNA 3I76A 2PNJA 2JI9A 2OK8A 1AB6A 2C94A 2O8CB 2FK8A 4PAOA 2JIBA 3TRKA 1R4ZA 5CFMA 4RPJA 4UTOA 4BZZA 3V6HA 3HO6A 4JFRA 2AC2A 1NG9A 3H2YA 4O2AB 5DWVA 2XIQA 4I81A 2F17A 3E0XA 4AYBF 2HBRA 4AO7A 3F6SA 3HCFA 1J0EA 3RS8A 2HOIA 3DDOA 3MINB 3PFNA 2B30A 2VYCA 1G5RA 3EGVA 5TF0A 3VDMA 1GKYA 1T13A 1ZK3A 6AT1A 4ROSA 3V1UA 4CTJA 3F6CA 2O2DA 2R0QC 1U8UA 2AI2A 1L5MA 3T06B 5J0WA 1YA4A 1R0LA 5KT6A 4S2EA 2DBVO 3B5IA 5EIFA 3PQEA 1X8LA 2W9XA 4KEAA 1P5RA 1W88B 1Z8DA 3K1AB 3GUYA 1PL8A 1QV9A 2WUEA 3ADKA 4A8EA 4MW1A 5EPUA 5K0ZA 1KTVA 2QAIA 2XE7A 5FH9A 3QHPA 4U2EA 1WXFA 4D2IA 3AJ8A 3WLLA 3A70A 3GVHA 3RIEA 5JARA 5DP1A 2G72A 1TJ3A 4F60A 4J9KA 1VG9B 5NLLA 3TB4A 1GA6A 1WEKA 3PTAA 1GPMA 3PR5B 1AKQA 1BOOA 2C31A 2QARB 1XS9D 3TZBA 1DEAA 4QDOA 2YHBA 4WGFA 2XTNA 4BNMA 1KNXA 4M98A 2AUMA 1U2QA 1WW2A 2CKMA 3CR8A 1OXTA 4FYMA 3FE2A 4H7KA 2EG9A 4NXNB 4ARUA 4XJVA 2ZFUA 2P67A 3OX4A 4RVHA 3BICA 4CI9A 5ENZA 2R6GA 1WQ3A 5AHXA 1XJ5A 2PU5A 1CETA 4RQNA 3IUYA 3ZHBA 1T6ZA 3ZXUB 2J30A 1NVVQ 4XJXA 3WLEA 3CEPB 4K9OA 1FYDA 2HRBA 1NTOA 1OXMA 1IBRA 2IWHA 1C0EA 4GKAA 3F90A 2PI4A 4ASUA 2PYDA 3HADA 3C7DB 1N4AA 4F3OA 2OBBA 1FVHA 2FR8A 1TKCA 4UUBA 4HDCA 1Z5OA 1H6CA 1Y82A 2BGWA 2FF7A 2EKDA 1I24A 1TZKA 1AE1A 2HHLA 2XZOA 3F9IA 4TSKA 4YYZA 1EFUA 4OYLA 2Y66A 3OLCX 3THSA 3OEYA 1YK1A 5JMPA 4HQOA 1CFZA 5ALXA 2HLNA 4P2GA 5J4LA 4UJ5A 3NATA 1QLWA 3ICVA 3CMCO 2V0GA 3JQ8B 3AERB 2BGJA 4N5HX 1D9XA 1A77A 4O5KA 4KO1S 2G71A 1JA9A 3DQQA 1FNBA 3EMVA 3O2SB 1HLPA 5EWEA 1JSXA 1NWHA 1S7GA 5FNVB 1NPDA 1Z45A 4Y7CA 2EKQA 4OJMX 2VPPA 5KYUA 1MC1A 3HKEA 3U3JA 1FJHA 4JHLA 2ZYWX 1OBCA 4IVNA 3OZBA 2CDRA 4KW7A 2X13A 3HV2A 5E1DA 4LQDA 4WK0B 5EHZA 1ULZA 4ZEOA 3DOFA 4C4ZA 4FYJA 3E27A 3B1KA 4ZEMA 2XD4A 1B00A 2FEOA 1XMSA 4WLUA 4NAUA 1XK7A 1QUEA 2BZ1A 2OHXA 1CUUA 3M5WA 3BH7A 1NKTA 5L1KA 4MUFA 2VSOA 1SZDA 1W34A 2HMYB 1E2NA 2CNNA 3S2YA 2ZITA 2NYAA 1EWVA 3W5SA 2Y2VA 3ZCRA 1A9XA 1ZNQO 1XEFA 1N33B 1DKNA 1NFRA 5GPBA 5B4TA 3P9NA 1CEEA 5JYDA 2VK1A 1SQ5A 1WF6A 1MDBA 1XALA 2O59A 3TRIA 3BDVA 2QL6A 3FTDA 4B3HA 4ADSG 3L4JA 2D5BA 3ZE7A 2YYAA 4CVNA 3V5NA 3MUEA 1K27A 2VF8A 5JLJA 1U0RA 3E9RA 4LEIA 4TTIA 1PE0A 2ZAMA 5J2FA 3RT7A 1L7EA 3PTZA 4PZZA 3QLUA 1ZQ1C 2G63A 3X43A 5KSZA 5KINB 1V9PA 4PQFA 2JCGA 4U6NA 1GKUB 2HLHA 5H0IA 4J9UE 1D2RA 2YW9A 2P5UA 2WM9B 1KZ4A 4HDOB 3KQHA 2EH9A 2ZUVA 3PQCA 1AA6A 1B0AA 2EAUA 2XWSA 1FSFA 5BRJA 4X45A 2CB9A 1JROA 3HP1A 7ICKA 4DJDC 3Q8PB 5IJ9A 4N0MA 4K86A 4REQA 3EWIA 5CDHA 3PUIA 1G3MA 2BMWA 4MKIA 4BO6A 1EUCA 5DOVA 3LQFA 3KXDA 4L07A 2GQ0A 4WACA 4B5KA 4LXQA 3RUHA 2QW0X 5L3RA 4CHTA 1DL5A 3FCSB 1Z56C 1WM1A 4DL6A 5I4KA 4U5XA 3MOIA 2PV7A 3P2MA 4NLCA 2RAFA 3LHKA 2CNWD 5KFGA 4UCQA 2VTEA 3KKOA 1Z6AA 4YC7A 4PSDA 1NK0A 4FNGA 3KJIA 2Z2KA 1PLJA 1VL6A 3DAHA 1E5XA 2N1BA 4TS1A 1V2HE 3MXTA 3VVMA 2VCYA 3RH0A 1JHQA 1OF1A 2NO4A 3GDXA 1USWA 2WWIA 3D5QA 3D7LA 4TV9F 1NKEA 3SNKA 1B1AA 2OSBA 1WA5A 4UQOA 2GJ8A 4S1PA 1RTTA 1PL6A 4EW6A 2DFDA 2WFZA 1KRXA 2HKIA 3CJRA 3T7KA 3UAOA 1DAGA 1GN8A 3FVRA 3E5NA 5EWLB 3K1TA 3MQFA 1QG0A 1IZYA 1GQYA 3ONDA 5LCXA 2KE5A 5DGTA 9ICQA 4AN0A 5C5EA 3R3SA 3U17A 1Q46A 1XZ8A 3PU6A 2Z9BA 3OCUA 2REOA 1NZBA 5BPCA 4ZZ1A 4B17A 3UJDA 2E37A 5EWJB 1AQIA 4UFPA 3W5BA 4BNIA 1IOZA 2R9VA 2W37A 4DBZA 1D03A 4EITA 4B3CA 2Q8NA 3ZS9A 1DBVO 1YL6A 3W5JA 3DB1A 1N78A 5J40A 4DWVA 4Q47A 2FSUA 4CL8A 4B4UA 4GEKA 4EAQA 4UJ3A 4ZYTA 2O6LA 5KC9A 1JIVA 4CCAA 3SS8A 3UOWA 1L4MA 3LXMA 3A2LA 3NHLA 2IHNA 2RGBA 4YB8A 1XPUA 3HR8A 2BIFA 3HDYA 3GLGB 1JXLA 4F3YA 1MJNA 1PKEA 4R3UC 3FPSA 3QEOA 1GO3F 2NQ8A 5KTOA 3JPPA 4BUZA 1TMKA 5JUWA 1BFUA 1WXIA 4XYLA 4M0CA 2BZ0A 3W6ZA 2BFFB 1LRLA 3ILYA 4MIYA 2I9PA 3GT7A 5H02A 2BGKA 5J2EA 1NR7A 3AEQA 1B8VA 2LM1A 4F96A 3I09A 3F96A 4IHQA 2O2SA 3GYGA 5KDDA 5BQXA 3CSUA 5FWYB 1EBFA 2KHQA 4F06A 4ML3A 2HH9A 4OO3A 4IIJB 1I33A 3TPFA 1RWKA 2WUDA 4GPTA 3C1ZA 4LHEA 2J8ZA 1ID1A 1MN6A 2Y9TA 1KVUA 4PYNA 3SENA 4UTVA 4IQ0A 4Q00A 1MZPA 5IVIA 3BB4A 1RT9A 3NEPX 5JE8A 1V37A 3NONA 3ZE2B 2GPAA 2HJWA 1QHGA 1A27A 3LX8A 5ICGA 4TL9A 1YE3A 5HF6A 2WY2D 5SZJA 9ICEA 1L8QA 5AJXA 5KKAA 2X41A 1JNYA 3CLVA 1O9HA 6PFKA 5JR3A 1M5TA 3GBSA 5J0UA 3JD3A 3U7RA 2QVXX 4GC7A 5FWDA 4WECA 1CNMA 4XD2A 4G07A 3R7BA 4WVFA 2YOGA 1BNOA 2ZJ7A 5EXSA 2D8CA 1Y4DE 3BHNA 1XA4A 4RSHA 3OE7D 4JB3A 2C8JA 2I7TA 3WHPA 4DFKA 3GN1A 3PWTA 3FMPB 4YXWA 3RLIA 1YZGA 4QAQA 3IP3A 3HSSA 1KHTA 1U7OA 1E92A 1K75A 2BCQA 2QTVA 1Z12A 2A1JA 4I9GA 2UVVA 1CUJA 5HJEA 4U7JA 2OC4A 1N2EA 3FUCA 2KE7A 3A9VA 3NNDA 2GJKA 2B1GA 4RACA 5CDTA 1A72A 3RB0A 1L6RA 3WMXA 3ETEA 4NLKA 3A9CA 4J7CA 1NMXA 4JYPA 2JVIA 3I53A 3ZY3A 1ZQ9A 3EA4A 2DQYA 3V8MA 2PFNA 2IIQA 5JI3E 3RAQA 4B84A 1PHRA 3F6EX 3ZDZB 3DYIA 1DIOB 4M2LA 2NVUB 2HOFA 1PDVA 3G0CA 4GNKA 4XVHA 1ZEMA 1NKVA 1TQ8A 2NUBA 2UZ1A 4UU1A 4P98A 4WUTA 1IOWA 2UVRA 1FYFA 4QECA 5DN6D 5CA1A 4TLAA 1XRNA 5J1TB 5JPIA 1Z13A 1JA1A 3G5UA 3GRKA 4IWXA 4TKLA 5FFFA 3I01A 1DOQA 3U0VA 4RUAA 4HNQA 3MGGA 2GF2A 3QBTA 3KL2A 1CR4A 3A6GA 2J0VA 2ZBRA 4FBMA 1TFRA 1QDEA 4Q37A 2BSAA 4AJIA 3LFTA 3T3IA 1SN7A 3QEKA 1L3UA 5NULA 1OLSA 3N5KA 4GWGA 4BQEA 4UUAA 4W1QA 1N6PA 2BDTA 3TZLA 4J9NA 1NLFA 5DISB 2GDZA 3W90A 1NLYA 1L3VA 1ZQPA 5AKEA 3Q7RA 2EJBA 1Z0ZA 3LCVB 1J2UA 4K8OA 4LBVA 2VJMB 3T8YA 4CLOA 4AIRA 3FYUC 3MAGA 3ZBUA 5BR7A 4K9RA 1ZKMA 3DDCA 4RX1A 3V8PA 3LY5A 2ONKA 3NBYC 2ZWMA 4WVLA 4QBTA 1D8YA 1Z06A 3ZQUA 4MV0A 1Y81A 3R9KA 1YFZA 4Z0PA 2JIOA 3R4VA 4U63A 3P97A 2VPWA 1OH7A 1DRUA 4C03A 5HXAA 4LYEA 1EE2A 3UIEA 2XQKA 3TPCA 3T3PB 4RTPA 2XUOA 1NZDA 1XZAA 2H5JA 1SBTA 1NPTO 3VBEA 4R69A 3PNKA 2QWXA 1V1MB 1XZKA 2Y3IA 5KU7A 4KN9S 5LM3A 3E3LA 5B4UA 3ENWA 1G41A 3N7AA 3DMRA 5FRDA 2FRXA 1BX0A 2C82A 3ENQA 3CE9A 2BP7B 4J7AA 2QAJA 4E6PA 2ZE5A 4M4SA 1M0WA 4IX9A 5IVHA 2NYRA 1O94D 5IIIA 3OO0A 3N8HA 5LQMA 1YC5A 1UBNA 4M6WB 4I19A 4WN9A 2GBLA 3I5XA 3DZ8A 3QZ8A 5DGXA 1WD7A 4ICIA 4AZ3B 1G9SA 4NBSA 4K87A 1D4ZA 1W94A 3OQHA 5KNDA 1HI9A 1RJGA 3RIHA 1IPFA 1P1HA 3UA4A 2IDZA 4YH1A 1V5WA 4A6XA 4QD3A 3F8SA 3KO8A 2OQVA 4NU5A 4W8OA 1SKBA 2J9FB 4XPIA 5KJEA 1KPIA 1LVGA 3KQLA 2EEZA 2YWRA 2V6JA 1Z8HA 3OMXA 3Q98A 2HRRA 2WSBA 3OQIA 2HPZA 1T3TA 5AUQA 4B3BA 3E81A 1QGUB 1L4UA 3TEJA 1TQHA 3ABZA 3CYFA 5EE5B 3FZYA 2O8EA 3IQHX 4P5PA 4MKFA 3ZNPA 5BW8A 2EL7A 1UJNA 3VSEA 3PENA 5KYNA 4FBUA 4OB7A 2FA9A 4LHVA 1K5HA 4NFSA 2B3TA 5KFCA 4IJMA 2EX0A 3PDIB 3TBFA 5ECYA 1SU4A 3ZU2A 1ZCAA 2RSLA 4J9QA 2A86A 2W83A 4JUFA 4P0QB 3OJ0A 1N34B 2QPOA 3QHAA 1SOMA 1P9OA 1Z6PA 2F1HA 2OO5C 2Q5OA 4E32A 3QLEA 2WPDD 2EFYA 2J7KA 1XP8A 2G09A 2O8VA 1PJ4A 4L6IA 3LF2A 3H99A 4YXMA 1KBQA 1NBIA 4LXHA 4K4IA 4CM9A 3FYDA 4DTIA 3DEJA 1P2BA 4AT1A 2P9TA 2XIDA 4LWQA 4MV8A 3B36A 1AK9A 1JI7A 1P3DA 3IAS6 4DKJA 5G4LA 5G0SA 4RKWA 3LWNA 1C0LA 2VANA 1J97A 1BNPA 4QL3A 2ZJ6A 2D3WA 4RHCA 1PN3A 3REQA 4CM4A 1ISHA 4R5MA 3KWJA 2VUSA 1E8DA 2RGXA 2Z1NA 4ED0A 1K2VN 3VR2D 4RLHA 1N92A 2FPXA 2I2BA 2OL4A 1FLDA 4YCCA 3AVTA 3CCFA 1H0HA 3AI7A 3OF2A 3ONFA 1Z7GA 2HA6A 4ECQA 1VI5A 2X4IA 4HAYA 4NRDA 1AY0A 4LE0A 1CJTC 4OJLA 2O8DA 1XHFA 3K1RB 3T3MB 5IKXA 5CFOA 4YCDA 4KMOB 5ITSA 2E6UX 4PG5A 3K1ZA 4ZYLA 1SCDA 3TFRA 4JA2A 4LOKA 1YACA 4C7OA 4ZH4A 3BHMA 4FTWA 4OXIA 3AVYA 3SJCA 4IIVA 4U7CA 3RGGA 4D3FA 3D6FA 4KH0A 3S44A 5MF6A 2P2CA 1CY1A 1KW4A 3L7YA 1VE6A 3IAHA 1EGVB 4K9LA 4QU9A 5AWFC 2PZGA 3CO0S 3PXXA 4NYIR 3U7QB 1WPQA 3WMEA 1GA4A 1XEWX 3KYDA 3S8EA 2JGMA 3BG5A 2JAWA 4L50A 4B75A 2B36A 2PG3A 2XAAA 2G67A 1ADGA 1EMDA 3I9MA 4DSAA 1N8SA 1J8FA 4Q19A 3AUTA 4F5YA 3QF4B 1NBMD 3Q8RB 1M9NA 3RU9A 4I3FA 3UF0A 4I2JA 2QPLA 1ZH0A 3U4QA 4LKRA 1XG5A 2CEAA 4HNGA 1D0SA 2IXEA 1NR1A 3RG2A 3BTUA 1AHNA 3S2SA 3UMYA 1DCFA 2QUZA 3BN3A 3SOZA 5HM6A 2RIRA 1Z4KA 4BVLA 1T9BA 2W6ZA 4WY2A 3QVMA 5LZ7A 3DZBA 4NZMA 3S2ZA 2JH3A 3VR4H 1LDMA 3RF6A 5FYDA 5DG7A 1FC0A 1U45A 1X7XB 3GQCA 5J2UF 4PTYA 4I0WB 4KN7A 3LXXA 3CGWA 3LC2O 1NATA 1QNLA 4OU5A 3BE5A 5CVEA 4BNYA 4BNZA 4LK3A 1RVV1 3P1JA 4IH4A 2ZBPA 2MT9A 5FUMA 2Y6VA 1JQ5A 3N58A 2I6FA 4LMPA 2CDAA 4LDZA 3FWKA 2ZPAA 3N53A 4M9LA 5CDFA 3I5AA 4D74A 4HVLA 4KMMA 3WAGA 2JNWA 4EI7A 2O1XA 4MWSA 4NMWA 4F11A 3UV7A 5LXTA 5CVUA 5J59A 2BMEA 5DLGA 1VPVA 3VNUA 2J31A 1RQLA 5HCIA 3O1HB 3QYFA 4JT8A 5E2AA 3KLMX 5JPDA 2KKVA 4I2AA 3T35A 3QMMA 2P9QA 3MFIA 4WV3A 3G17A 4P7FA 5B55A 1KBOA 2FX2A 5LSAA 3NUZA 4IO1A 4U2DA 1F1JA 1ZD1A 3UGTA 2HHQA 5CYFA 4U7DA 1INLA 1ESDA 3A26A 1L8OA 1FFUA 1MX3A 4X85A 4DGQA 2AX4A 5FL7A 3DXXA 3RTAA 3C1OA 2IY9A 4M1SA 1WHSB 1O9BA 5T7BA 1AKVA 4PYJA 3JARB 3T4XA 3EA0A 4KLAA 3SF8A 3UB2A 1GEGA 3EGEA 3ESXA 2V74B 2YDXA 1A0OA 4UC0A 4CN8A 3B5EA 3VTFA 2ZVQX 1IEVA 3L7CA 4KLIA 2F48A 1USKA 3RJEA 3O8QA 9ABPA 4NQZA 3T1NA 1CBUA 1XVVA 4OJTA 1E5VA 3F2BA 2HO4A 3LDFA 3GVXA 3ZDFA 2IXTA 5TEWA 3BQNB 2VSFA 4KX5A 3PC6A 2CHQA 1C30A 1WV1A 3OM0A 4YK7A 1TJPB 1JX4A 1LKYB 3S3TA 2A0FA 3SR3A 2VHWA 1NKSA 2NM0A 5J47A 3C97A 2J6BA 1Q12A 3HEAA 3KJFA 4PAQA 3WIEA 4MS1B 4F85A 2RHHA 4GS5A 2X3FA 3C8ZA 3JQFC 2F44A 2EW1A 2PIDA 4H4CA 4RANA 1E4EB 3IGFA 4F7DA 3QUTA 1B6RA 4XQCA 3CR7A 5DEOA 3I4FA 1EK1A 4QZIA 3C3MA 3H40A 4NR0A 3HKBB 1FDVA 2V98A 4G3IA 4JL5A 4XB6B 5G1OA 3D7RA 2COEA 3HB9A 3V7KA 1J5EB 5EESA 1GPH1 5IM4A 2NUAB 4P83A 1EA5A 2VJBA 5DHSA 3NNSA 4CMGA 3SHTA 4J9RA 4G5RA 4MVJA 1D3AA 3Q3VA 3RAEC 4DMRA 1ECCA 4YS6A 1ZM9A 3LHIA 1NP3A 1GM5A 2IEDA 1V85A 2UYQA 4PLHA 3SC3A 2TECE 3O83A 4R8LA 1XLTA 2IYQA 1KSFX 1F1BA 2I2XB 5CXUA 4EFLA 4YN4A 4M9GA 3RE1A 2A0KA 4ZCLA 4M0FA 3WYEA 4DMLA 3WKBA 4QZDA 1JQKA 1D2GA 1KGDA 1RW4A 1XRJA 1X6VA 3DMTC 1DQSA 1FBTA 1PR1A 4QDJA 4NS4A 1VL1A 2QN2A 2YIMA 3SYLA 4LI0A 1C0IA 3P9YA 2ZUTA 5KAMA 5LVAA 4FKMA 3K5IA 3CRXA 4H0NA 2HK9A 1QG6A 3BWYA 1YBHA 2GGSA 1SKMA 1CY4A 3OEWA 3LDHA 2YFQA 2HD4A 5EZYF 3U44B 1FU7A 3VNQA 4H7PA 3MR6A 1GT91 1Y8QA 4QBGB 1E3IA 2GZ2A 4BO7A 3BHJA 1QF6A 1OWOA 4FZRA 1U2GA 5IX8A 3L6EA 5BPFA 4JI5B 3W3AA 3FPBA 2Y71A 4PYOA 3QVLA 1FP6A 1SUFA 3PG5A 2W0MA 3ML1A 4D02A 1AQNA 3IBTA 1B14A 1ED1A 2A0YA 2ZAIA 5ADWA 3B0XA 3B53X 2FMUA 2IP1A 2GNAA 1G6Q1 1JFLA 1EWKA 4TUPA 1SC1A 3LH5A 2NO1A 2NRZA 3DWGA 4MUJA 4G9GA 2DSTA 3F3KA 3AVUA 3FDJA 1IJEA 2IQ5A 3TF5A 4WNAB 1RKVA 2DH6A 2ZWAA 3QU2A 2PX6A 4Q8FA 2RGGA 3L9XA 4JMPA 5IIJA 3KJGA 4RTRA 4B40A 1Y3HA 2ZDHA 2XUDA 1N9KA 3MWDB 1H9BA 5TMEA 3HW8A 5TRTA 3O4VA 2GERA 1RQNA 1O58A 4AM8A 4O3RA 3FNGA 4D43A 3EGXA 1OTHA 2KJ8A 4B32A 4RD0A 2PKQP 5DIFA 1XRRA 3TNJA 4UDNA 3EYWA 1NURA 2ODTX 3ZLJA 1RPAA 2VTKA 4Z6FA 2HY7A 3ZN2A 3EMDA 4C6TB 3G7SA 4CM3A 2JHDA 2REQB 3M9NB 1N8NA 3K4QA 1A88A 4MMXB 5FUQA 4C7YA 5IWCA 2WSLA 1N2CE 4JQSA 1RYFA 1GR1A 2NRWA 4FILA 4JJEA 3GNQA 3ZHQA 2V1XA 1ZNYA 5BOSB 5FUXA 3HCBA 1V8OA 2ZRQA 3OQ6A 1R88A 5C80A 1N2CB 2W6ID 5F7XA 3E7WA 4TT3A 5J9FA 1LLQA 3LBFA 3I23A 3CNLA 3GDHA 4MW5A 3TR6A 1PBNA 1X74A 1GCUA 2KSOB 1JB1A 5L1JA 1E1LA 4LWZA 1DELA 3KKMA 1N63A 2HEGA 5PGMA 4XDYA 3TKLA 5IS2A 3FDFA 1L6IA 9ICRA 3S2UA 4TWAA 5A1JA 4WCFB 4JLUA 4DS5A 1YDHA 5ADHA 1TDJA 4KQWA 1M6YA 5LQCA 1F4VA 2WJIA 1MQ2A 1UIMA 4M46A 2C4WA 3THVA 4WZAA 2FE9A 3KBOA 3OD5A 1YHYA 3TMAA 4FZLA 2BHTA 3M83A 3N6VA 3JQBA 4MCJA 4GG1A 3ROKA 3OFVA 4A1FA 5M2QA 3KQPA 4PLYA 1FOEB 1W49A 4DVGA 3EVCA 2P4UA 4XSGA 1NOIA 1PJCA 2HCFA 3PYMA 1S0VA 3IPYA 3ITDA 2M6KA 1XN1A 1E6UA 1JI3A 3B1ZA 5AKIA 4PIVA 2F1IA 5DBEX 1RZRD 4CCYB 2F7SA 3K6KA 2YC2C 3E3AA 4EDFA 3OPYB 1JR3D 2C1XA 4AECA 1P4RA 2Y27A 3WRVA 4BVFA 3FGOA 2V3WA 3KDPA 3FUXA 1NJGA 2QSZA 2X2EA 3JATA 5H82A 3EXFA 1SD2A 2R8JA 1P0CA 3DKRA 4YJ3A 2FSSA 4FJ0A 3SZRA 5FTMA 3ZCSA 4FGJA 3OBIA 3JQQA 3T5PA 2H4JA 2H3IA 3E7DA 1A4IA 2QLTA 3KTDA 4MWBA 3H7AA 3NZEA 4N6OA 2WYVA 5U4XA 5B30A 3WWCA 3O95A 4RVOA 3AZPA 3CCBA 4ZAZA 3IVAA 4E5DA 3WYBA 5JROA 2AR0A 3FPKA 2XXJA 4M89A 5H59A 1D2AA 2OHJA 1J1UA 2WPNA 2YVUA 1JEJA 2BUBA 4G25A 4TXNA 4L78A 3GZJA 3L06A 4EARA 2PJUA 3VU9B 2QMUA 4TV9B 3AJAA 4IJWA 4GYWA 1NNUA 1RYZA 3E0QA 5AH0A 3KKEA 3FZNA 2CXHA 3EMKA 3GQBA 4XIYA 5IIOA 4OI0A 4OHKA 4DF3A 4P6VF 2XMQA 3UC5A 1IXZA 2JJMA 3HVRA 1LBSA 3WTCA 3DJFA 4MV5A 1FS5A 1N60A 1PWYE 5HTKA 3NC1C 3PQ6A 1XP5A 4UBIA 5IHXA 4Q9IA 1QKJA 1TKAA 1QYIA 4PC7A 2H11A 4RLSA 4CDGA 2DX7A 1V9CA 4NG4A 5J2KA 4OLFA 3GG2A 3ZCUA 4C4XA 1A2QA 3E3OA 2LKCA 1D2EA 4A4DA 2WQ7A 3PP8A 2G6TA 3SZ3A 1NDQA 2V3CC 2O7VA 2G0AA 4JYCA 2PX5A 3CEAA 1N8KA 2Q2NA 4QQNA 1ZSYA 3ID6C 4G81A 2ZXUA 2O57A 2IL1A 4JBLA 2QJOA 4LNUB 1CI4A 1DIRA 1PZXA 3A1NA 4ENRA 1UKBA 4MHVA 3U9TA 5WRFA 1SWVA 4TX1A 4LOAA 2G3YA 1LDNA 2CNLA 1H2AS 5CYOA 5LZ2A 4JXXA 3VO8A 1Z5VA 1XD2B 4GKKB 3WGOA 1DV2A 3T5KA 2GILA 1G8SA 2VFAA 3QBDA 1QH8B 2H1LA 1YTLA 5FI3A 4D0LB 1CY7A 1SELA 4HDSA 2P91A 2FPPA 4M0KA 4MS3A 2WG0A 1U6JA 3EZ9A 4HS4A 3NT4A 1LVUA 2IUFA 1BCSA 3R7DA 1ZQXA 3HCCA 3R74A 4WGGA 4YDQA 1Z3CA 2LKYA 3NXSA 3Q5EA 5CT4A 2JIRA 2GZHA 2YMLA 3M6FA 3KQKA 3B3AA 2HIGA 5EHIA 4PICA 3BIOA 1WHTA 1L6NA 1UXGA 1WRBA 3NHFA 2ARKA 1BMDA 4JN6B 4ZPJA 3BQTA 4J1TC 3T9DA 2W5UA 4ZVRA 2ZRKA 1VKJA 2Z98A 1YJAA 5A0FA 1XC7A 3TPZA 2VAPA 1XVLA 1P3JA 1RHQA 3LW8A 4YJ2F 1JEDA 4AZ0A 5DX1A 2H48A 3GLVA 1ZA2A 1J39A 5FJIA 3HJCA 5EWMA 3GPDG 2PFSA 5I7AA 3G0IA 3I2JA 3NS1A 2E18A 2QNRA 2QRKA 1OILA 2EZXA 5KKNB 2BFOA 4PSCA 3LZDA 3HNRA 4AX8A 2XSZA 1DJNA 3L7MA 4XLTA 4ECXA 3A2MA 1HE3A 1UFQA 3K0BA 3JYNA 5HRCA 1GPDG 1D8BA 1HE8B 3MK31 4R6WA 4JLVA 1I14A 5JD6A 1L5NA 3HR7A 5F1KA 1NUHA 5CXXA 3RAXA 4JJKA 3IAS1 3QE4A 2EBFX 5ELMA 4G1MB 2W2OA 5HF9A 4LXYA 4PPGA 1CTQA 3OZTA 1CNEA 4QJIA 2VDNB 4CMEC 3GG9A 4QYIA 4PIMA 1PJTA 1NQXA 1K08A 1VMKA 2V7EA 3IHQB 3EXEB 3K9HA 4A73A 4XR4A 2F76X 5DB8A 1YMQA 2ZRDA 1UWKA 2JA1A 1XQYA 3U31A 4F2SA 1VL0A 1MP0A 1ZICA 3T1QA 2O0KA 2FI1A 3P9XA 2FPLA 1E18A 2O2GA 4RQTA 1Q7CA 1GG8A 5IN5A 4RXMA 1XDDA 1XE3A 3LQ4A 2FMKA 2JRZA 1RLTA 3BH0A 2VL7A 2D4AA 1R5JA 4L57A 1I3NA 3A28A 4ZC1A 1HZZA 3VZPA 4F97A 1Q83A 4Q4HB 1P75A 1XCMA 3EEBA 2O48X 4TSFD 2AHOA 3E1KA 2HCJB 6ADHA 3ZWKA 2A1TS 1Q2XA 4DT1B 1JKMA 4ZMBA 5JRTA 3TQSA 4BLQA 5K0CA 5HUHA 1T36B 2GZDA 2C9OA 3NCHA 1OW3B 1Z7EA 1ZOLA 4UVEA 1HQDA 5JQGA 3A1DA 2RG7A 1OPRA 2BKXA 1IC6A 2NUTB 3PDJA 1ENOA 1MVNA 1UUFA 4FFPA 1ZLXA 2XDQA 2H2AA 3OBBA 3F5AA 4KLOA 1X0XA 4IDAA 4LVNA 1ICIA 1V0JA 5JCOA 2EFGA 3CNQS 1MEOA 5B1SA 5KUTA 4OHUA 1MB4A 4I2NA 3ZVLA 1LQ2A 3SZLA 4JVSB 1E64A 3DTVB 4G5FA 4ARZA 3UUEA 3DAOA 4DL4A 1C1DB 1V6SA 4DSZA 1KJNA 1KJIA 1ZWKA 4G5YA 2BZGA 1JF8A 3GW8A 3NH6A 3IUSA 4Z4FA 1A5BB 1OYVA 2PPVA 4BBPA 4CKBA 3ZWCA 4WI1A 1HOTA 4ENPA 2M9NA 4RMIA 4CNQA 1JVSA 4ZAFA 5BWLA 3QVWA 4QOJA 2Q3HA 5DB7A 5DV9A 4PHCA 2BVNA 1I6MA 4HUTA 4LSWA 4A6DA 4JP8A 2R87A 1CQIA 1ILEA 3N75A 2PMWB 4RF5A 1V8ZA 1ETUA 4YCMA 2CNDA 4DSOA 4OQYA 2PR2A 4MGIR 4BO3A 3QKRB 5F12A 2GJ9A 2P2DA 3RFFA 5KFKA 2XGOA 3FLAA 5KHOC 3RC7A 2PFKA 2MR6A 4RQ4A 2VZ8A 1OZ0A 4N7MA 2XUIA 3ZC3A 3EQ8A 2PWAA 1H66A 1E4YA 4MWOA 3IPAA 5L1IA 3KKKA 2PKXA 3JYHA 1M34A 4FSHA 3QKIA 2JGEA 5DLQC 3EWSA 4QZGA 5JISA 3C1AA 2IE0A 1YC2A 1HR0B 2ZTDA 1LV7A 1O9GA 3DEEA 2KIVA 1DQYA 4ZDIA 4YDRA 4WKCA 3E9QA 4PCAA 3OPYI 5KFNA 3TLAA 2X7XA 3KTFA 2VJLA 5JY6A 2I4OA 4N8DA 4IJQA 5FPHA 3QTBA 1SKQA 1P1JA 4HKTA 3GV5B 2XEDA 5IC6A 1GGVA 3TFWA 4WLVA 1E1RA 1BAPA 3SQXA 3GUUA 3PE3A 2ZDQA 4ZT7A 3DDUA 3SOPA 1JXAA 4PZ9A 5FO0A 1T8WA 1BMFD 2QEQA 2QD3A 3O4FA 2NNLD 2PFGA 1NSFA 5GONF 2NADA 2CDNA 4GPZA 2G4VA 3AILA 1TW3A 4FW8A 3KJXA 1AH2A 1N1MA 2YV3A 1YR1A 2E8NA 3USZA 5M04A 5FI0B 1Z33A 3I73A 2OCDA 2WMNB 1E9FA 1VL5A 3M6UA 3N2YA 3HZOA 4RJKA 1M54A 1TTHA 1IWBB 3LQRA 4YRIA 3ODGA 5DTRA 2VP0A 3OCCA 3BZWA 3WNQA 3VAZA 3EIWA 1KA9H 4JZYA 3GT4A 1L1QA 2IHMA 1KY5A 1US8B 1Z29A 4W9NA 1M6VB 3A4TA 4WLFA 2F8SA 1ND6A 3O21A 2YDYA 1M2KA 1D07A 1OLUB 1ZH6A 3UAVA 1EXWA 1KU6A 1XZNA 4LPSA 4LOIA 4J0DA 3M6LA 3B3QA 3SM9A 3GEGA 5GWXA 3GC6A 3OLXA 2F3UA 7GPBA 2I1VB 2J9YB 2AKAB 3E7FA 3I6BA 4OUDA 1EFPA 3KSRA 2X58A 4NLNA 1X1BA 3GT0A 4RCYA 3E8MA 1E3WA 1RPTA 4B34A 4JODA 5AI0A 2FGKA 3Q8SB 1RJEA 3LMKA 3LT0A 4ZCTA 1HEUA 3KTQA 3DL4A 2VZ0A 4AJ4A 1FFDA 3GP3A 1ABBA 5EOVA 2P2ZA 2FKNA 1WUYA 1UA1A 1I6LA 5JU6A 3WX0A 5B6JA 1T9GS 1BEEA 1I0LA 2ZXEA 1CT9A 4D3YA 2JASA 3DG9A 4KXYA 3ZW7A 3EC2A 4E2ZA 2CFIA 3LZ6A 5F3XB 2OHVA 5A3RA 5FTNA 5I8ZA 4HWSA 2VLBA 4AJJA 4IJVA 4N3CA 1COWA 1E9AA 2X14A 3ZKAA 2FWAA 3QMVA 3F4BA 4MV7A 5CH3A 3MIZA 1M1NA 1UPUA 1PYGA 2R65A 4HEHA 2AK2A 3RGWS 5GMOA 4Q24A 2YRXA 4V24A 3R44A 5JRJA 4QQFA 4JT9A 5EWFA 1O8CA 5JASA 5IYZA 2SKDA 4GEGA 5K8JB 9ICLA 5L7YA 3FAHA 1G8KA 3FHLA 4HSEA 4I4LA 4JEUA 5TR9A 1SOUA 2B9VA 2JD1A 4EEYA 2OT3B 1XTBA 1W5AA 2JZBA 2VJ4A 3WXMA 4GLBA 3PFGA 1RQXA 4PGGA 4PRKA 1SCNE 3ZIAD 1T3NA 4B31A 3OF3A 3DYBA 5A71A 2H59A 5C8ZA 1ZCZA 1UJ5A 3QVKA 5KG3A 1T4BA 3AO0B 3BDIA 3F74A 5CW1A 2TMKA 1PWEA 3C3CA 1NVWQ 4LG1A 2WWRA 3DFUA 3L3BA 3TFQA 5DBAA 5CXSA 1QANA 1L5RA 2VJOA 1GV0A 4FYVA 1DAMA 3ER8A 5J2UB 4MGEA 1H0RA 4UB6U 4QYMA 3FKQA 4TVSA 2G9NA 2BYTA 2AKEA 3QUAA 1QFXA 1B43A 4RSGA 2ZYSA 5M7EA 4PLZA 3PX3A 2L82A 5DHRA 1GL9B 3H5LA 4IBOA 4DA4A 1EWYA 3D59A 3Q2KA 3G8YA 1WXGA 4KRGA 2FWJA 4J75A 5J2IA 4YP6A 2FRVA 2QGFA 2VA2A 2GCGA 5FB3A 4RKFA 3S81A 4AP6A 3HWRA 2WV9A 5E6SB 1OZFA 5IBCA 3GDFA 1N6OA 5FOWA 1FYEA 3HJNA 2QRGA 2BFBA 4QJFB 2EYUA 3WLAA 2Z1DA 3JV7A 9ICKA 3RS0A 4C7MA 1G4AE 2PDAA 4W5QA 1EAMA 1IYZA 4NMXB 5KFRA 1EJ2A 2W4IA 3ZBPA 2D5AA 5DKFA 4GM0A 4WSOA 2DQZA 1KRWA 3BGDA 3COZA 3ORQA 4L9SA 4QOEA 3LYUA 1NVBA 2WHEA 1DEKA 4MGKR 3C21A 2QTRA 1K6XA 2I78A 3GLGE 3KFUF 2G04A 3S8YA 5T4BA 3WJ1A 2JCSA 2JA2A 4IIFA 4ZVVA 2C84A 4N7BA 1KQ3A 1ECLA 4TZKA 1X9IA 3D8RA 3RANA 2C4TA 4M0LA 4DNFA 2UUCB 2A1UB 4HB2A 2FN7A 1Y3AA 1YB5A 3C6BA 3D1JA 4MR9A 4KR7A 4EZBA 1B6GA 5D5QA 2VIXA 1LW6E 2NNWB 3A3PA 4XYGA 3KQQA 2RH5A 1QP4A 3A0HU 4DSFA 3FMOB 3U1VA 4B3JA 4MJ7A 3BJRA 3FNFA 5FFNA 3EASA 5BOVA 1U3CA 3MTAA 4W99A 2XQVA 4KWTA 3W77A 2KTQA 4B7ZA 1EXNA 1EFLA 1UJ4A 3FNIA 2IZ5A 1OKKD 1EJ6A 1NR5A 4BMVA 3LP8A 1CZNA 3V4LA 4B81A 4S1WA 2H2FA 3MD0A 4AUKA 1WB5A 2FZ4A 4WESA 4YECA 2D1YA 3R6WA 4MCAA 3ICEA 1Y7HA 1H2BA 1WJGA 3WICA 1DSSG 4II3A 2IZ7A 1QHSA 3ZCPA 4LRSB 2WIJA 2IV3A 4RT2A 4F4XA 3U6KA 3ZGOA 1NJXA 3ABQB 2G07A 1NI4A 1Z2PX 2CT8A 4DIUA 5LMNB 2C4HA 5IUJC 3JWEA 3RJGA 2M6LA 3BT7A 2LIPA 2Q2VA 5AW7A 4JK3A 3ISTA 1Q1QA 2GLXA 3JW8A 4H7IA 3JPWA 5EIOA 4GLOA 5E2IA 4I5DA 2VQEB 3RAFC 2A9FA 4FYIA 2ASJA 2E5SA 3NWOA 3PNOA 3LVRE 4PRZA 3Q8WA 5JWRA 2FWNA 1T1IA 1X38A 3JSXA 3K9BA 3U7JA 1N6HA 2H1HA 3UUGA 3CF6R 2B35A 3GRUA 3RQSA 1EFVB 3OEED 2C9BA 3BK2A 1BE1A 2GAFA 5A6SB 3ZGVA 2YWGA 5HQJA 1L3CA 2B20A 4ZGBA 1H3EA 1IY8A 4FI3F 1LC0A 2F9LA 1B0PA 4IXNA 5T64A 2NG1A 2XGSA 1VA5A 3FCUB 3D3EA 3T94A 2XJ4A 3DTNA 4JR0A 1L4KA 1PJ8A 4C0LA 3INRA 3S2IA 3TSOA 3U09A 3PUKA 4IRUB 3BZKA 4PZOA 4PPFA 1PZFA 3RHZA 1GAJA 1LNZA 3WZMA 1U7PA 3L9WA 3D3WA 4GMXA 4W1SA 5DWQA 4MO9A 1QVVA 5FBLB 3DDWA 1D6SA 4LDPA 4HYQA 2QLBA 1G8PA 3P9KA 4NG5A 1ZHOA 1K88A 1RI5A 4POAA 4EUNA 3RSZA 1FDUA 2P6PA 1OT5A 1KEEB 1T8PA 3HZRA 4Q44A 1QRDA 2BFEA 3PHBE 2ZI6A 3AHHA 3ECCA 3NORA 4NZPA 3RK4A 3DBRB 3LKVA 3TB6A 5JH7F 3OIUA 5CVVA 5FBRB 3VUEA 4XWGA 3KB1A 2VJQA 3FW1A 3ZI4A 2X9QA 3L3FX 4QRIA 1PR3A 3HL0A 3V1NA 4MUKA 2LCIA 3O38A 5KFWA 5L3ZA 1MX5A 4LSGA 1JH8A 1RD4A 3DVAB 1X80B 1DMRA 1ZJ5A 4KBYA 4X1OA 3R24A 4AS1A 3Q9NA 1XI2A 1EVYA 4R1QA 3JYQA 4E2FA 2BKUA 1JDPA 5A0VA 3FTFA 3JU3A 1YZFA 4DLSA 1BVUA 1YXMA 2ZULA 3PMLA 3NYIA 2A5YB 4RZSA 3C45A 1ZINA 4EB6A 2ANCA 3DWEX 1MNQA 1LC3A 4DAEA 2I4TA 3T1TA 2PS3A 5J3JA 1QP8A 3E15A 2CD9A 4B9UA 4P7GA 3SZGA 3QFCA 2W2XA 3EB9A 1YRLA 4D4IA 1HE4A 1ILWA 1NK5A 3HFSA 1VHWA 5EI5A 3PUJA 1E98A 2Z2JA 2R66A 3HRKA 1M76A 4C07A 4OLJA 1M2FA 4RV4A 4GT1A 2VDUE 1V43A 3E7PA 3KT0A 4QTTB 1A69A 1GTZA 3PGLA 4RPGA 1S2OA 2VHXA 4QUIA 3NGDA 3PT9A 4Q7KA 3VC8A 2HCRA 5L4LA 1YZQA 2QB5A 3MSCA 4PCVA 3RQIA 4XX0B 1VSTA 3MJHA 2H1VA 3OPQA 2PKWA 4PX3A 3VUFA 5D01A 2KHZA 3K1JA 1EP9A 2Q0QA 3LJKA 3A2KA 3GZNA 5I48A 3EXG1 4PVCA 1GU7A 3ASUA 1MAVA 2BCEA 1SOAA 5AQEA 4TN5A 2NX2A 1WWVA 1HDIA 1QMPA 2PY6A 2NAPA 4O4JF 1VLLA 2Q27A 2ZYTX 2H0AA 1OVGA 2Q3CA 3LBYA 2K4IA 3KOZA 1JKJB 3TUIC 1ZQKA 4YBRA 4YLEA 5HILA 3WQQA 4JX9A 4G4SP 5DYNA 4BNJA 4MDHA 2TMDA 3ISBA 3TRHA 2RI0A 4AG5A 3L7OA 4QHYA 4OX9Y 1U8AA 3VCBA 4MV9A 4UFOA 3TR0A 3OAAD 1PO7A 2VPTA 2PT7A 5LA6F 5AXAA 5AKZA 2ZRAA 1HFWA 2G5TA 3RHFA 1V71A 4K2HA 9ICSA 2X9NA 3VJKA 4BU0A 3UHAA 1F5NA 4NL9C 2WU0A 3V7UA 3O8RA 1SEVA 2J1LA 3D4IA 1YI8A 2PA0A 3JQRA 3V8NA 4WCFC 5ADUS 1EBUA 1XAHA 3DA8A 1NJWA 1OFGA 3ZJUA 2E8PA 2Q5CA 4G4IA 4MVXA 1RLJA 2Z09A 1U63A 5KOHA 1ZH2A 4Y6SA 4FHZA 4GYKA 4YFVA 1JPJA 2WJGA 1TOAA 4F92B 3KAKA 1SUBA 5CA0F 3COJA 1V97A 3GU3A 3C23A 4LHSA 5LQSA 4NZNA 2O4UX 2C5SA 3PCTA 3ANYB 2KJ9A 5LQDA 1ZG3A 5L1LA 2HQSA 4UAVA 2BPCA 4F46A 1KL9A 2PHZA 4M9CA 1ZZEA 4CM1A 2O2CA 2ONJA 3OZUA 4GOLD 4E94A 3V6JA 1PS8A 4DF8A 4ENUA 1RM5A 2PBZA 5T67A 3LY8A 4X61A 2WYWA 4GO1A 2J0EA 2QTCA 3QRWA 3GWZA 4DCJA 4PBTA 5K6TA 1JUDA 3DAYA 3KXLA 4HQKA 4L15A 2ICAA 1D4FA 3MCUA 1GCOA 2JARA 4GOKA 4NDZA 5CPBA 1P7VA 2GD0A 4URXR 5JQGF 3B9JA 4TQ9A 4H1UA 3M0EA 2PUDA 4I2VA 4H1WA 1UJMA 4Q4JB 1WNTA 2DBRA 3OECA 4XRHA 4I66A 4QPDA 5K9ZA 5KJCA 5AVYA 3OTIA 4C0QC 2O3TA 2Y6UA 4XWKA 3SVZA 2ZSAA 2PN1A 4B83A 2PKCA 2IT1A 3B7WA 1E9SA 1FFCA 3LUJA 3NTVA 4ZFNA 3TLMA 3L04A 3WGVA 1AT1A 1Q3TA 2OYCA 1DHRA 5KFPA 3OPNA 4OI4A 3AEUB 2DHRA 3F47A 3TM4A 1VLJA 5IIKA 1YOVB 1BGWA 4F5ZA 3ZV4A 3WRXA 1P0IA 2VLIA 5FA8A 1SHKA 1K86A 4H17A 2EZTA 3NCTA 4G0PA 1YNSA 1UH5A 5K0FA 2HLDA 2ZYHA 1ZQOA 2HJVA 2PWBA 3KYIB 4LJSA 5E6UA 3RVSA 3N7PD 3PEFA 9ICOA 2WQZA 5HJ5A 5HWSA 1XJ0A 2H31A 2YXEA 4PGXA 1XYGA 2IS4A 3DTYA 4BVAA 1RQPA 4F4YA 2OZKA 3NM5A 2Z4RA 5C5CA 2VCEA 5BYKA 3I12A 1R5OA 4BP3A 2PO7A 5IXJA 1U1GA 3DHWC 4GIBA 1U9ZA 2JAUA 2UYYA 3EW7A 3IAUA 2A9KA 2BFWA 1J00A 2QRMA 4RUCA 4V2IA 4KE7A 4H60A 1NRXA 3AKCA 1ONBA 3KR0A 3T7RA 5IDQA 3DZIA 5EE0A 3NTQA 3TVYA 3WISA 4NAVA 3OIGA 4BDPA 3GEIA 5DIZA 2HSGA 2BHSA 1O95A 2JIDA 1D9FA 3MS7A 1NZFA 1F60A 4BECA 4DLEA 5JDCA 4YGYA 1OA1A 3IAXA 5BNZA 2FZVA 1LNSA 2NU9A 1CUDA 1U1CA 4DMUB 1NDHA 4IZOA 2P79A 2AJQA 3NNNA 4TUYA 4A16A 3SM3A 4RYDA 3VDQA 1U8FO 3FWHA 5DTQA 4PSVA 4JLKA 3KPUA 4KNYA 4C7XA 4KDRA 5BSHA 4EYKA 4AJ2A 3V46A 1ORHA 1X9GA 3VKUA 1RLUA 4CODB 2EFDB 2RJOA 2QR3A 5LQKA 3PC7A 5CDGA 1CCWA 2LNDA 2YIJA 2ZKLA 4M36A 2A4KA 3C8MA 2I7XA 2WHQA 2OSVA 1J2JA 3MB8A 3FNRA 4CV3A 5H4HA 4KLQA 1QLNA 1QO0A 2P1DA 1SHUX 1ZD2P 4UB5A 2LIVA 4BFLA 4FLFA 1TQ4A 4D9EA 2VUHB 1UP4A 1ITZA 5ES4B 4F86A 1LV5A 4EQ6A 4CYMA 1EFCA 3U5ZB 2SHKA 4MUGA 4MDYA 3PT5A 5HMMA 2V7QA 2XF8A 3WLSA 3FIJA 4E2XA 4E88A 1O97C 5MN6A 1F12A 3L82B 4MPPA 2AF3C 5G3ZA 3TX6A 5HQ3A 1T6BY 4IRDA 2H1SA 1Z75A 2WRZA 2BPFA 3UBTA 1Z4PX 4YRQA 4JBNA 1IHUA 1IK4A 2PTHA 4CGYA 2JF0A 4UPEA 1XZJA 4YAKA 3N3BC 5EZ5A 2ZBDA 2PAFA 1YJQA 1YB6A 3E5RA 3U1TA 1M6NA 3Q6IA 4NM1A 1Y8RA 3ROEA 2XMBA 1AUVA 3WLNA 1U3GA 4RHUA 2R1ZA 1JR2A 2QTTA 4D4JA 2VZEA 2O8FB 4GI1A 5AR1A 3KFVA 3TLJA 2AQ4A 1FCJA 3VHRA 5EIAA 3ZY5A 4LYHA 5J29A 1QQ5A 3JQDA 4QVKA 1OAKA 4AF7A 1VHTA 3CBQA 2OXRA 3VPXA 5M3BA 4BGDA 1FK8A 1Q0PA 2ET6A 4MDFA 1FS4A 2FP4A 1WSWA 1AQLA 3TAUA 2H57A 3PL1A 1VLQA 3AI1A 1XDSA 4M1OA 3ZX5A 1P19A 5L4SA 4LE1A 1MA0A 2DBYA 4OB6A 8ICJA 3UWSA 3JQA