4G9BA

Crystal structure of beta-phosphoglucomutase homolog from escherichia coli, target efi-501172, with bound mg, open lid
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
227
structure length
227
Chain Sequence
b'VMKLQGVIFDLDGVITDTAHLHFQAWQQIAAEIGISIDAQFNESLKGISRDESLRRILQHGGKEGDFNSQERAQLAYRKNLLYVHSLRELTVNAVLPGIRSLLADLRAQQISVGLASVSLNAPTILAALELREFFTFCADASQLKNSKPDPEIFLAACAGLGVPPQACIGIEDAQAGIDAINASGMRSVGIGAGLTGAQLLLPSTESLTWPRLSAFWQNVAENLYFQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-phosphoglucomutase
publication title Crystal structure of beta-phosphoglucomutase homolog from escherichia coli, target efi-501172, with bound mg, open lid
rcsb
source organism Escherichia coli
molecule tags Isomerase
total genus 82
structure length 227
sequence length 227
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2012-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 4g9bA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4g9bA01
4BX2A 2ZBGA 3KC2A 3L8GA 1Z4IA 3B9BA 2AUTA 2C88A 5ALNA 1ZD4A 3MMZA 3ZI4A 4CF4A 4HGQA 3WKDA 3AR2A 4BX0A 2IYEA 1L7OA 1Z4QA 5ALKA 3DV9A 3A1DA 4UMDA 3ONNA 2JAWA 3BWVA 2O9JA 3QU2A 2HX1A 1QQ6A 1L8LA 3MC1A 3U7FB 3QUQA 1XVIA 4E88A 1CQZA 3QU4A 1TA0A 4FE3A 1F5SA 5ALTA 5ALFA 1NF2A 3E84A 2FPSA 3U7HB 3L0CA 5AW3A 3SF0A 2YY6A 4Y2TA 2WM8A 2YMQA 4OCZA 4Y2RA 5AW5A 2WFAA 3R4CA 2IOHA 1SWVA 1AQ6A 2G06A 1Z4OA 3NAMA 5ALVA 1L8OA 4EENA 3D6JA 2P69A 4ZEXA 4NABA 1RMQA 3QGMA 4GXTA 4HYTA 1U2TA 3U26A 2I7DA 3E8MA 5AI0A 3N8GA 2YJ6A 2Q4RA 3PDWA 5ALLA 2FPRA 3OPXA 5AW8A 5AM0A 2JARA 1YS9A 3U7EB 2I6XA 2ZXEA 5ALZA 3QNMA 4Y2XA 2WHEA 2O2XA 3FPBA 3N07A 5ALUA 2PR7A 4I9FA 4HGOA 3UMCA 2G1AA 3AR5A 2I55A 3EF0A 3UMBA 5AVTA 3SLRA 3QUTA 1RMTA 1VJRA 2WF6A 3OCXA 1RRCA 5A3RA 4HGPA 5AESA 4UMEA 4FFDA 2HDOA 1RMYA 4EZEA 3E58A 2FUCA 3PGVA 4AS3A 5AKLA 5ALOA 1X42A 5AKGA 1S8OA 3IB6A 5ALIA 1Y8AA 1U7PA 4ZEWA 1U7OA 2EARA 3W5AA 4GIBA 3QXGA 1WVIA 2GMWA 3I1YA 1CR6A 2QYHA 3ZWDA 2R8ZA 3WGUA 5AKIA 1RKVA 1Z4JA 2I54A 4HGNA 3ZX5A 1U02A 5AI8A 2IOFK 4UW9A 5IT0A 3OCVA 3HLTA 2OYCA 1XPJA 4JDPA 3ZWKA 3SD7A 1Z88A 4L6CA 3QU5A 3ZVLA 5AKZA 5AICA 3K1ZA 2NO4A 4UARA 3ZX4A 1Z4PX 2OM6A 5AM4A 3I76A 3ESQA 2B8EA 4KNVA 2FDRA 4C4RA 4OFZA 4DCCA 2ZBFA 4Y2JA 4YGYA 2BDEA 3WK7A 4AP9A 2YMMA 5AVUA 2CFRA 3QX7A 2ZOSA 2ZBDA 5AKXA 3ZVMA 1S2OA 2DQSA 1ZD3A 1WPGA 5ALYA 3KDPA 5T41A 2Q5EA 4UM5A 3CNHA 5AVRA 3WKCA 2QLTA 3IRUA 1JUDA 1IWOA 4BX3A 2HO4A 3AR7A 1VFPA 1KYTA 5AI6A 3L1VA 3ZTYA 3WK5A 4NFLA 4IG4A 3DAOA 4EX7A 3WKEA 1ZD2P 3OCZA 4RESA 2R8EA 3KD3A 4NV0A 3W5BA 1RPZA 3WK4A 3QUBA 1Z5UA 3BA6A 3ET5A 4J2TA 4G63A 1RDFA 1LVHA 3KOOA 2YJ5A 3EWIA 4RETA 5AIBA 2ZG6A 3NASA 5AM1A 5E0OA 3IJ5A 4C4TA 5AKEA 2NO5A 2BDUA 5AW6A 1WR8A 1J97A 3ET4A 5AW7A 1ZS9A 5ALJA 4L57A 3L1UA 5AW9A 2ODAA 4Y2QA 4CNQA 1L6RA 3M1YA 2RAVA 3B8EA 5AK6A 2B82A 3E81A 3NIWA 3U13A 1YJ5A 1YDFA 4NAVA 3W5DA 5AI5A 2B8JA 4BEVA 4AS2A 5AVQA 2JGAA 3W5CA 1ZRMA 2R8YA 4Y3UA 3FVVA 1U2SA 3F9RA 4UMFA 3A1EA 2JAOA 4CF5A 2HHLA 5AHXA 2AH5A 2IOFA 3UM9A 5AIAA 4UMVA 5A3SA 1LTQA 3FGOA 4MUMA 3QU9A 4JB3A 1SWWA 1ZRNA 1L7MA 2FI1A 5AKKA 2FEAA 3UMGA 3AR6A 1NRWA 3I6BA 3NUQA 3AR3A 1RKQA 4XPZA 4HAIA 2OA0A 2OBBA 1MH9A 4CE6A 3P96A 4C4SA 2CFSA 1QYIA 2P9JA 4EEKA 1WZCA 2FUEA 3ZUPA 2YMLA 4EELA 5IT4A 4BYGA 4YIHA 5AW4A 3J7TA 2JAUA 4OHFA 3ZTWA 1Z4MA 2Q4TA 2BY4A 5AW2A 5ALMA 2C8LA 3FZQA 5JJBA 1Z4LA 5ALPA 3EPRA 2G07A 3ZU6A 5ALRA 1QQ5A 3FM9A 2PKEA 2W11A 2HSZA 3KBBA 1TE2A 2YMPA 2WF5A 1O03A 1Z4NA 4DFDA 4XE5A 2HOQA 3KZXA 2AGVA 2W4MA 2PQ0A 4F72A 1TJ3A 1T5SA 3MN1A 2WF7A 4O8CA 3NRJA 4H1WA 1FEZA 3HYCA 5ALHA 5AVSA 1SU4A 2G80A 4Y2VA 3GYGA 1T5TA 5AK3A 3VAYA 2CFTA 5AW1A 4BNDA 5IS2A 4BNDB 3SKXA 1RQLA 4UAUA 2GO7A 1RLOA 5AVYA 1PW5A 1TJ4A 5AVWA 4BEWA 4F71A 1YMQA 2G08A 3I28A 3N5KA 4KNWA 2FPXA 1EK2A 2C8KA 1O08A 1ZOLA 5ALGA 4XQ0A 5ALQA 5AK5A 4YH1A 3L0BA 4YIKA 3DDHA 4KN8A 2YN4A 1T9ZA 3N1UA 3WK6A 2B1QA 2HF7A 3WKBA 2I34A 3AR8A 3OCUA 2RB5A 1Q92A 3PCTA 3U7GA 1RC8A 3L8EA 3CZ4A 3WKAA 3FPSA 1L7PA 3TLMA 2MU1A 5AVVA 3OCWA 3U19A 2D2VA 1RLTA 3MPOA 5AI9A 4KYTA 3SMVA 5AKYA 4UM7A 4DWOA 3NALA 4UATA 4OD0A 4L6AA 5ALDA 4Y2UA 3EF1A 4BKMA 4UASA 2B0CA 3R09A 2HI0A 2W43A 3WK8A 1N8NA 3QU7A 2G0AA 3PGLA 2EATA 4XOUA 2C4NA 3DNPA 1NNLA 2CN1A 4DW8A 3R9KA 4CF3A 2YJ4A 5AW0A 2AMYA 2X4DA 5AKJA 3AR9A 3QLEA 3L8HA 4UU1A 3QUCA 4G9BA 1L7NA 2HF2A 4NWIA 2GHTA 3OCYA 3QYPA 3SKYA 4QQFA 1ZJJA 2GFHA 5ALEA 1ZD5A 3S6JA 3ZVNA 2MU2A 1N9KA 1RQNA 4Y2PA 2RARA 4EX6A 1QQ7A 1XP5A 4YCMA 3A3YA 1YNSA 4I9GA 2P27A 3L7YA 2FPUA 1VJ5A 4FYPA 4PNHA 5AK4A 5AKHA 2P11A 3L8FA 1Z5GA 2B30A 2HCFA 2RBKA 2YJ3A 5A3QA 4B6JA 3ESRA 5ALXA 4HGRA 2GHQA 1EK1A 1K1EA 1YV9A 1TJ5A 2EAUA 2R8XA 4KX3A 1Q91A 1Z4KA 3ED5A 5AVXA 2HEGA 4J03A 5AM5A 2YBDA 4Y2YA 3OTQA 1J8DA 4KX5A 3L5KA 3WGVA 4Y2SA 2NYVA 3WK9A 4YCNA 3B9RA 3RFUA 4QJBA 2VKQA 1QH9A 5AM3A 4ZEVA 1RKUA 3M9LA 2ZBEA 2I33A 3N28A 2WF9A 3AR4A 2C9MA 2FPWA 3RF6A 4MWOA 5ALSA 3ZW7A 5ALWA 4BBJA 2IA5A 4UU0A 5AI4A 2MSNA 4YCLA 3NANA 4UAVA 5FP0A 3A1CA 2WF8A 3L0YA 2YFYA 2G09A 5AVZA 4IFTA 5AM2A 2B1RA 3SHQA 1RLMA
chains in the Genus database with same CATH superfamily
4QLAA 4DIKA 3JQ8A 3VC3A 4U9UA 4PNPA 3MFHA 3HJRA 3LLVA 1OWOA 2EX4A 3BERA 2J4DA 3K1TA 5DHUA 3MFQA 2YOFA 2OXIA 1Q77A 3OQ6A 1DC7A 4EBEA 3NVAA 5KYWA 3UATA 1NOIA 2CXHA 2ZVPX 3ZBUA 4X61A 3GD5A 3EBLA 2UKDA 4CQJA 4ML3A 4H0NA 3TLEA 3T5JA 1UP7A 4NOKA 5AM0A 4R01A 1EDOA 1SKUA 1XZJA 2BGGA 4CRWB 4ARUA 3GK3A 4LHEA 3WGTA 4J0HA 4E6PA 2FPGB 1CDZA 4I50F 1H85A 2X3UA 3WY9A 4Q7EA 2CLKB 4HNSA 3OX1A 1FDIA 3GNLA 1Z5NA 2FOIA 4WFJA 3AG6A 2QMHA 1SVMA 4OQXA 2QUIA 1DZ3A 1TD9A 1NUHA 5FT9A 1J33A 4Y9TA 1PK1B 1J1UA 1XGKA 4N9QA 2FUG1 1YIAA 2MYNA 1AKMA 3UK0A 1B3BA 3PNBA 4AI6A 1O9HA 3I32A 3LP8A 2QY9A 1MMFB 4G5QA 3HV2A 4ZPXA 2XF2A 2H3IA 1I51A 3KWMA 1GEGA 2I62A 2VJCA 1V96A 1KJQA 5K8LA 2XUFA 4H3SA 4EZBA 3CLSC 4J4TA 2BGRA 4RZ2A 3IQIX 3L79A 5BWNA 2HA2A 3NONA 1BCSB 3RLFA 1K8XB 4K8OA 1TAMA 1QIFA 1MQ3A 1P6QA 1VYHA 5GQSA 5L9XA 2CJXA 2PXAA 4BGVA 4DJ5X 1PKXA 1RJ9A 1N3BA 1V9PA 3I6IA 4IV8A 1NW4A 2AFRA 2C5AA 1IB0A 1Q0SA 3H3FA 1A27A 1TZ2A 3ZE1B 1VSVA 4DC9A 5JS8A 3UM9A 2OD7A 1GNTA 4FJ1A 1ELOA 3V4RA 2O5RA 1L5ZA 5L53A 5GOZA 4EYGA 5AJXA 3P96A 1NP7A 5JZ9A 1WY5A 5FQNA 5CA7A 3WRXA 1VTKA 2X1HA 3VYVA 1SRQA 4J16C 5CB4F 4YIHA 1U63A 1EXMA 5BWMA 1QF9A 2GZHA 4M36A 7MHTA 2PX8A 3EZ6A 3L8DA 821PA 4QPCA 2BY4A 5AW2A 4HKTA 3HWWA 3H6KA 2E8MA 1HE2A 4CTOA 1AU9A 4M76B 3B9QA 3NHUA 4OB8A 5EQJB 4RTLA 3G85A 1OVMA 1M7GA 4Q4JB 4Y2VA 1YZGA 4BIMA 1EX7A 4G5OA 3N2LA 1PBTA 2LZ0A 1ABFA 2GBLA 5JMWA 1EA5A 1LPOA 1IC6A 1XEWX 4MAMA 2VFAA 1FMCA 1V9SA 2NU6B 2YC4C 1U6IA 1I1OA 4RXTA 4YUXA 4JD5A 1KPGA 2WA2A 3GOQA 1UBCA 5T6BA 4AKSA 2ROQA 4AG5A 2VHXA 2N47A 4OO1J 4F85A 3TJZA 2RB5A 1GCGA 1URJA 1W0KA 4U7HA 3U9TA 4EUNA 3CUKA 2Q3CA 4LZNA 1ZW1A 4UM7A 5TSDA 5G2OA 1CUFA 1RWKA 1NAIA 3GP5A 2XZPA 4Q1BA 4YACA 5JJIA 4AY4A 4D46A 3L8HA 1TB4A 3W78A 4P7GA 3L40A 2I87A 2BTOA 2KE7A 1GILA 4R2HA 4HAVA 2PXCA 5DNAA 4EYQA 1K66A 3PJFA 1S2GA 1QMPA 3MMSA 1Z22A 2H1LA 3GEPA 3ICVA 5CYPA 1Z5ZA 2JIZA 1OH7A 1AKQA 5IKEA 2QN7A 4B6JA 1Q12A 5H4GA 3U7RA 2R8XA 4YHHB 3KEGA 4XXHA 3FI0A 3PTLA 4KWIA 1L3UA 4PXYA 3LOUA 5HOEA 1XJ5A 1UK6A 1WU8A 4ZVKA 4LWZA 1MEOA 5JYBA 3M6WA 1ZQCA 2G67A 2VP9A 4D6XA 4FYIA 4JSTA 4DL3A 3M49A 3OZBA 1XZBA 5FUBA 3M9OB 2AEFA 2XHEA 4LDRA 2XMCA 3WO1A 3HY3A 3IUMA 3BDAA 1CR4A 3DAHA 1Z3CA 3BE8A 1X7GA 2ZUSA 5CW1A 4DWJA 3CUVA 2XKAA 1U0BB 3BWVA 1KDTA 3TR6A 2FH5B 1ZGJA 3FROA 4G85A 3BH7A 1DGJA 2A3NA 4GL4A 1JXLA 4M8KA 1E0SA 4DS5A 1PV4A 2R96A 2BFFA 1CNFA 3H4TA 3NG1A 2O48X 3UPUA 2FPRA 5KINB 3G8DA 5AW8A 3BQTA 3ZNQA 1KZ7B 5BRAA 5IJWA 5LD2C 5J2GA 3ROPA 4UUOA 3WRWA 4Q12A 3QEJA 4M9XA 4DSFA 3X1KA 4TKZA 3NWEA 4AU1A 2GUWA 5E1MA 4QT4A 3H5TA 3CLKA 2AN9A 1I94B 1Y48E 3ZC3A 2O5VA 3SSAA 2PN1A 2R6GA 3QHQA 1LBHA 2Z6QA 4DC1A 2ONCA 1P7CA 3MERA 3AYZB 4RDHA 1FX1A 4EKDA 4QDJA 4POOA 5IK2D 1LPMA 3GRRA 5D6NA 4OHZA 2CUTA 1A8UA 4RJ2A 1AUQA 2ZRGA 3V2HA 4GLOA 3I9V6 5BOLA 1VE5A 3WAGA 4MICA 4EHJA 3OF3A 2KJ8A 3C3WA 2OXFA 3TZCA 3GFVA 2QTBA 3KQSA 3FETA 2H8KA 1D4AA 2ZB2A 2P5SA 3F3KA 4MIEA 4X1IB 3RYFB 2P6PA 2AMFA 1GYRA 4QOFA 2H65A 4LNUB 1PUJA 5AKEA 4RSMA 3O3CA 3S68A 3IR6A 5D46A 5AR1A 4YALA 4PG6A 3UF0A 5TRTA 3NBUA 1M2FA 1MRSA 1SXJB 3EZ9A 4XUSA 4KDEA 5JAIA 5JCJD 4ITUA 2WOOA 5ARDA 4LDZA 1MVNA 5C5CA 1ZICA 4PE5B 3CIFA 2KW5A 1JG7A 3NHPA 2QPTA 1U8CB 4R7TA 2E1PA 4NYMR 4N03A 1NSTA 2Z3VA 3FMFA 4CLRA 4KZKA 2JVKA 5BO5A 3QG1A 2H1VA 3QP9A 3OKFA 4IKOA 1KDZA 3TRIA 2Y05A 3A6ZA 1H4SA 2CVOA 1ML4A 4LFCB 4NQZA 1W4AA 1C1DA 2QNBA 1VGRA 2DGZA 2Z2YA 4C6SA 3G5LA 2X8JA 3HA5A 3NAZA 5B1DA 1Z7YA 5ALHA 3AFNA 4RFVA 3O7WA 2GM3A 4YJ3F 5LUBA 2GARA 1Y8QB 2UUAB 3W5SA 3WAKA 4N8EA 3NLLA 4O63O 4CMIA 1B43A 2BSXA 1HYGA 5K2OA 2DEUA 1QFYA 4YH1A 1XC7A 1JBKA 5IBRA 4J7CA 4HZIA 1HOTA 3MB8A 4Q4LA 4PGFA 4PSUA 1SG0A 5EIEA 2O7SA 1WW3A 1RPJA 1IXYA 5BYAA 2VDVE 4LJXA 3JVVA 3WJ7A 4IL5A 1YF3A 4ZJPA 5IK2A 5CA1B 5KVQA 5DK4A 2PMFA 2FV8A 2TMGA 2BQUA 4PR3A 3WGJA 1I24A 4XDYA 2JHPA 3I12A 3GJ7A 1MAWA 3M6LA 1C8KA 5KX5A 1KEVA 5IEJA 2FZKA 2XVMA 3FVWA 3GRAA 4LAFA 1RAGA 1AGXA 5LQSA 4YR7A 4KLJA 3K72B 1L7BA 3DZHA 2Z0MA 2PGAA 3L92A 1D1SA 4J0FA 4QU5A 4KX5A 4G4IA 5K4LA 1GVHA 2IEAA 3WDMA 3L5OA 1FU8A 3A2MA 2RHBA 1FFWA 2LYHA 4CMEA 5FYDA 3H5WA 4DIEA 1WBDA 1P72A 3ZHRA 3VH4A 3L1JA 1DO2A 4Q7QA 3P0EA 1VMIA 1B14A 3J81A 3G1WA 1N1DA 4OM8A 1DIGA 3KK0A 3DBRA 4MCAA 3AXTA 1PQUA 2OSBA 3MRSA 4MUYA 1SCIA 1AHPA 5JFTA 3KALA 2JCYA 1EGMB 4RJJA 2BEJA 5E8RA 2VHYA 1FQKA 2FR0A 3L41A 4UKDA 1TW2A 4KDFA 1F0MA 3CRW1 5CFNA 3L46A 2VK4A 3A26A 1XYYA 3U3MA 3DXYA 3QFHA 4J7AA 4MULA 5K0GA 3PR4A 4KN4A 1UA1A 3CLHA 1ODJA 1KOLA 2W9AA 1FSGA 3QOWA 4WNCA 3VDXA 2DF4B 2IHVA 1VLVA 3E3AA 1ZIYA 3SC2A 5BQ5A 2D8MA 2OBLA 3F5AA 4XWTA 4KC0A 5DNYB 2NTNA 3CR7A 3WNCA 3ABIA 4LNHA 5AKZA 1TYDE 4M9LA 4O2AF 2VTDA 3E27A 2ID8A 3AVUA 5KTRA 5IN5A 2PY6A 2YJZA 3WZMA 1ZVJA 3VR3A 4BU0A 4CLOB 2VEOA 2CHVA 3LYUA 4JU8A 2V4ZA 4E7PA 1N0IA 1UAYA 1M7BA 3T0FA 5FPYA 4BV8A 4NFLA 2DPLA 1JT9A 3KD3A 1R0YA 4IRKA 2VRBA 1UBRS 3QJ5A 1ZQUA 4K6CA 3Q5EA 4ROTA 1X1RA 3MBIA 1OZHA 2C5SA 2QQ0A 2Y1EA 1VLZA 1DQZA 2F9FA 3MTJA 1X6VA 3D8SA 2LPMA 5B7QA 3CKKA 3RAQA 4B47A 4D44A 2E89A 2MA1A 2R4UA 4OO3A 1RHUA 1AGRA 3HN6A 3W5CA 5K3SA 1SKMA 1T3GA 3MMPA 1NK9A 4TTAA 3EBOA 3VBEA 3DOEA 4N47A 4NC9A 4IHJF 4TZ6A 1M1UA 2IXTA 4B3RB 1H5QA 3CW8X 5JAOA 1Z7GA 4Y1GA 4TUSA 3VM6A 2Q3MA 1IIBA 3OJUA 4MS1B 4D42A 2HJRA 1XQ9A 3WGQA 3IUYA 4A7PA 2OUKA 4MWEA 4UNQA 5CHGA 3D8UA 5L7TA 4QQ8A 4JL8A 3ZDFA 4IJMA 4QXPA 2K60A 5JU5A 5IC5A 4PVDA 3T94A 4TV9B 4ZU1X 4JP1A 2YTZA 1C29B 4UNNA 3KZ1E 3ZXYA 1VDMA 4B3BA 5IJZA 4FZMA 1ZOLA 4QEZA 5HK8A 4PSDA 4DV6B 2ZI5A 1V3UA 1R5BA 4ZQEA 3NNDA 3PK0A 2KVCA 3WKBA 1PR9A 1T1IA 1P4AA 2PUCA 2LKYA 3OTHA 2H7YA 1ORTA 2VUTA 4I2NA 3T3DA 3JQBA 1WCIA 4OIFA 4I6EA 3GWGA 2WPNA 1FNSA 4JLWA 5IKOA 3EZ7A 2EATA 3UB3A 4B9NA 1KZGB 1Y7PA 3W2FA 3BIJA 1CY4A 2XMRA 3S2UA 4QJ4A 3PF9A 4L15A 4EFLA 1PVQA 1ZD5A 2SKCA 2WSLA 3RBEA 5GONF 4TZKA 5BY2A 2WT4A 3W2HA 1YNSA 5G0VA 4GLJA 1QR2A 2B30A 4DSJA 3NVDA 3H2JA 3W4JA 1J09A 4C5CA 2CLMB 1ZQPA 3Q3JB 3CV3A 2YWCA 2J6HA 2XLBA 4K9NA 3CX6A 5C8ZA 1R0CA 5THQA 4IHKA 2ZTSA 3RVPA 5F98A 1DDIA 1E8NA 2ZKIA 4KSBA 3T1NA 3Q4GA 4D3ZA 3KOXA 5KG0A 4YAUA 4D74A 4JI5B 4HAYA 1H1TA 4X6UA 3NHRA 4KWHA 3B9BA 3BF8A 4OQDA 1Z18A 2HHCA 2C58A 3G8CA 2W2KA 3OE4A 2V7TA 5DTEA 3VZPA 3ED1A 2C7GA 1SOVA 4V0RA 4PAMA 1VL2A 3I2KA 3IMGA 3KAKA 1L8LA 2UYHA 3C1AA 4J6EA 4ZANA 2ECOA 2FZVA 3V1MA 4U7JA 1HPLA 5DWQA 1U9LA 2AFHA 1P1CA 4Q82A 3RVSA 5D87A 3O1LA 1XNSA 1KAEA 1KFDA 1L7DA 2PWPA 5JQGA 4E5MA 4ARZB 2ODBA 4IY1A 4I4IA 2PYZA 3FSRA 2W42A 4OK3A 1YS9A 1SCNE 3CE9A 5AK0A 4R2JA 3PR5B 4N0EA 1K3TA 4YI3A 3FDZA 3GA7A 2RH8A 2Z1NA 1OJ7A 2K89A 3H83A 4X44A 4EZEA 2AR9A 2WB4A 1SKQA 2ISCA 4OGKA 5IULC 4L76A 1X86B 3LIPA 3PTAA 2B7CA 1G7CA 3ONEA 1Q0LA 4XX0A 2X0FA 4LBYA 3STWA 2XBMA 1BEEA 1US8B 3IVAA 3JQFA 5SZKB 4KLUA 1NMYA 1ZGAA 2H5EA 8ADHA 5T4FA 1WMSA 4Z9AA 2GI4A 3KVYA 3VYRB 3EQ8A 2P3QA 3O9MA 3NR2A 1T1RA 1MENA 5EWEA 1ZM4A 4ETNA 1Z0KA 4G2TA 2FRVA 1KH2A 4GR5A 2G82A 2ZG6A 3A7DA 4ED0A 4MVJG 2QVXX 1J97A 1DMRA 1T8SA 2FW6A 1ZVVA 5J5AA 1ECLA 3MGHA 3BMXA 3E18A 4P4LA 3AB8A 4PFQA 3CLSD 4EBCA 1EFDN 2CNDA 3EIXA 3F46A 1HF3A 2GF0A 3K0FA 1K8ZB 3UMFA 4MWBA 3H3XA 5DBIA 4QT0A 2QZ4A 1XTQA 4PYOA 2Z9DA 2QJFA 2B35A 4ND7A 1R0RE 2XXBA 1CRZA 2XRZA 4DPMA 1R15A 1G63A 5FHRA 1XZAA 1KU0A 2WLSA 4YMSA 1ZQ1A 4A91A 4DQVA 3GMDA 3OC6A 4LTMA 1N5OX 4P4NA 5EZSA 1D0SA 3MTEA 3I2JA 2O6KA 3RIYA 3AU9A 1R5NA 1T5SA 4FE7A 5JD5A 3NRJA 3E0QA 1KOJA 1W2HA 2WU4A 3WLNA 2OENG 3WLLA 3C2QA 4HLNA 4H08A 4OFXA 3PFNA 2XDQA 3E7XA 3UJ6A 2YWXA 3CVVA 2XZDA 5CVVA 4R31A 2SCUA 3E9ZA 3QVGA 4FMBB 3NGLA 2FSHA 4LXGA 2FQ1A 4RPCA 1CSEE 1F4VA 5IYZB 2C8JA 4X1KA 1N9ZA 2ZM6B 2NV6A 1V8PA 4RPLA 1X87A 1SCDA 4TUYA 4S1NA 5JRJA 1Y88A 2VNKA 3EIEA 1KMNA 4P7JA 4FFNA 4MVJI 4MVWA 2Q0XA 1JLRA 5CX1A 4L4ZA 3C4JA 3DDUA 1BPEA 4LY6A 2VTEA 2AJCA 1GN9A 1E3IA 4UHFA 1E4VA 1NBAA 5IN4A 2WJ4A 2EERA 4CNBA 5CFQA 4IJUA 4S0ZA 3S6JA 2QNRA 1Y37A 2FE1A 2AUMA 2CLLB 4X94A 1L7EA 5AK4A 3CCBA 2X5KO 1HQDA 5AUOB 5T8KC 5J4YA 1XKQA 1H3EA 1HTBA 3KJXA 4Y2SA 1U3TA 2ADOA 2C2RA 1AMNA 2E5SA 1AO0A 3JQRA 1DCKA 2X0KA 4B6SA 3GX1A 2JGRA 4HNAB 2ZT6A 4FGWA 1TK5A 4AD8A 1M2GA 1DTWB 5DP1A 1RXVA 4KMRA 2O2JA 2VJYA 2XR1A 1D4ZA 3JASB 3F6YA 2C54A 3V7YA 1W581 2VYND 1NVUQ 2P7IA 4CFYA 2GTIA 4C7VA 2RBGA 2OV1A 4BS9A 4CEJB 2I80A 4RFLA 2RE8A 4R2WA 1LDEA 1XWIA 3RIXA 1S2IA 1L4BA 4OCZA 4NICA 4Z9YA 4LOKA 4YLGA 2J41A 4MWGA 4DUYB 4M0UA 1YDEA 3IB3A 4O25A 3ILHA 5BSHA 1NVVR 4MHSA 3KQUA 3MOSA 4EB6B 3PMNA 1SBQA 1XD2B 4RQ7A 3PF8A 1SD5A 1NJ1A 1Y1TA 4ZDKA 4KFTA 4BB6A 3TNFA 4EEZA 1PVRA 1S4MA 5TT1A 2O8FA 4HS9A 5KOIA 1QSSA 3R5FA 1N0WA 2OVBA 4QRHA 1E77A 1N63A 5IT5A 5BMVB 4L50A 2G1KA 2QP4A 4K8RB 3UKJA 2YZGA 1GU0A 4IRXA 1UF9A 1BD3A 3ZCXA 1Z74A 4H17A 1V41E 2I2FA 3EHEA 1SAYA 3W3AD 2YR0A 5F64A 4HQLA 4HDNA 3U4DA 1O5OA 4DLSA 5FTLA 2XA1A 2YIVX 3JQ8B 4AXBA 5JVDF 1MRZA 3CSUA 3OQPA 4JQZA 1JHDA 5HHTA 1DU4A 3PRJA 3HXPA 3MVEA 1MJNA 3WTCA 2ODGA 1BXGA 3IT3A 1H69A 1EZ1A 3H7AA 4LGMA 4AK9A 5KYWB 1F1BA 1R4AA 1LVHA 3MJCA 3QSYA 1BMTA 3B6KA 3BKXA 3ZDZB 4I2JA 4NHOA 5D3QA 1INLA 3V6LA 3PQ6A 4LVUA 5F3WB 3GT0A 1OYYA 4M0PA 3QXCA 3S29A 4DDWA 5AVQA 2O7NA 3HGTA 4PRLA 2XDWA 4UBCA 4MWCA 4XWKA 1U2SA 3JSXA 8ICFA 1VJDA 4M87A 5FV4A 4NY1A 2H7XA 3Q7IA 3L05A 2BHRA 5HQTA 3RHFA 3ZCQA 3TSOA 4LOLA 1VHWA 3PENA 4QHTA 2Y1XA 2R8GA 4G84A 2CLSA 1AUPA 1QDEA 5FYQA 1QQ5A 1NHGA 3ZD6A 3T9CA 5FOVA 2MMGA 4S05A 5KG4A 3UV7A 1BKDR 1ZLYA 2RQ5A 3DMTC 4JJGA 1OA0A 1RQXA 4UBMA 3ZDBA 4QXOA 1B8PA 3EVNA 2IDKA 3RG2A 1MW8X 1K3FA 1YU9A 2IHBA 5JW6A 2HDHA 3SQNA 4RGYA 4O4IA 1ECWA 1V4VA 2BE7A 1W8IA 4QFMA 4YRJA 2VR1A 4JR1A 5I9IA 1E4EA 3S2EA 4BFYA 2W90A 1LEHA 3R20A 4LC0A 5F2EA 3ROEA 8ICVA 1M1YE 2JAQA 4Y2UA 3OTIA 4LBZA 4R9RA 5CUQA 3X2SA 1XJCA 1C14A 1RJ9B 3WL4A 5CB1A 2AEJA 2MR5A 4RK5A 3TM4A 4PQGA 3DCYA 4G9BA 4LJ6A 2KYRA 4BKQA 2EIXA 3OSZA 5HCUA 2GFHA 4PPQA 2ZWPA 4ZYWA 2HD4A 2FJPA 4X1OA 1U0LA 2MINB 3FJOA 1VHJA 3B7WA 4DLLA 4BMSA 1OLUA 3IIJA 3O5AA 2XT9A 1SB9A 1HX7A 1L8QA 4L75A 1BIFA 3C8ZA 3FTNA 2DT8A 3LXXA 2FEOA 1SQ6A 3PGJA 3EIWA 4IGKA 2OOKA 3DE6X 2VQFB 1JJ7A 2DHDA 4K9SA 3E9DA 3COVA 4F06A 3ILSA 1OLXA 1T8YA 3DO8A 1YZHA 1C80A 3H5LA 3VYSB 5ENZA 5KNBA 4PHDA 2RGGA 4IFTA 1DCMA 1RYSA 3BD6A 5AXCA 2GZSA 1Q0ZA 3UICA 2OAQ1 1W48A 2JJQA 4YXJA 4KOEC 1KEUA 4HNHA 4Z6DA 1PS8A 1E9RA 2O9JA 5ESXA 5KT5A 2XWJI 1CE8A 3U7IA 1NFQA 7ICVA 4RVSA 3E05A 3RARA 5HE8A 1ZQ9A 1FY2A 5ALVA 5AH0A 2GEKA 1KQNA 4GZ3A 1ESNA 4DF4A 1SA0A 1DXHA 4CEIA 2XUJA 1S7CA 2A84A 5B64A 4BNTA 7ICSA 2QZPA 2IDJA 2G1PA 2ODWA 3EASA 4FI3F 4UC0A 4ZU3A 4ABYA 5CMLA 1ECGA 4I50A 4GPTA 2BJWA 3VR5H 1TCAA 3RRJA 3CX3A 4QJIA 4X63A 3M3HA 4ATNA 2VZEA 2EWWA 1JAZA 3LIIA 1H2XA 2YHAA 2H17A 3V4PB 1PFWA 5EXPA 4K4HA 2PUGA 3WGUA 4LKRA 3F4BA 4XVHA 4HP8A 2CFIA 2Z9BA 3AKZA 4KDRA 5DIZA 1DIAA 2DPXA 1WMEA 2J0EA 1ZU4A 1TECE 2A9RA 4QYSA 2KK0A 1KZ9A 4I3FA 4HZGA 5B12A 3N97B 2OG2A 3M0EA 2OQRA 2IYSA 5D49A 1DVRA 1YULA 2NADA 3BRWA 2E9SA 5LQMA 4RABA 5L3VA 1HZZC 3MEQA 4IKEA 1OX5A 2JLVA 3A37A 3QI2A 4ZDJA 1M0EA 3HYTA 1RRGA 1C3JA 2HLDA 3MWEA 2OCIA 2Q1YA 3QKSA 2EKPA 2BFFB 2IEZA 2AI3A 2Q2NA 1C7QA 4OQPA 2ZB3A 1HDYA 2B21A 3PDHA 4Q43A 4QUBA 3HBMA 4HNUA 1VLBA 4W5NA 1SXDA 1Q2UA 3C3KA 4N1AA 5KFHA 2PR2A 4UHDA 4WXYB 2JLQA 3I5XA 2RKBA 1XZHA 4ZC1A 5CB4A 4C7JA 4HH1A 1P1IA 1P9OA 4X54A 2RJ3A 2OLEA 5EWGA 1ZXLA 1E3MA 1KE1A 1RM3A 4E51A 5HZHA 4D9FA 3EPRA 1A8SA 4NQRA 4MJ3A 4OA5A 3KBBA 1VL1A 2NO0A 2WAAA 3WR5A 4C4XA 2AGVA 4ELVA 5DQIA 1CUXA 1MOSA 3DE2X 4YI5A 4C0WA 4YFKA 1BVUA 1ZQYA 4G4SO 4BNNA 1GDTA 3ACCA 5MGNA 5ER6A 3VX3A 2VHJA 1R0ZA 4M8LA 4RBNA 4G97A 3ADPA 1WS6A 1RCUA 3A14A 3HS3A 1GYQA 1F7UA 5LQCA 4FBUA 3ZV4A 2DHQA 3OX2A 2P0YA 1YOVA 3E61A 3TLJA 2IEYA 1Q92A 2W4IA 5FBHA 3K1RB 2IU0A 3TIFA 2GEBA 2V7UA 3DFFA 4YDRA 3W3AH 2FDXA 3ZGLA 4BX9C 1W73A 3ZHYA 3TW6A 3K9BA 3MIZA 2K4PA 3RBVA 2QTMA 1PS0A 4Y1RA 3HI4A 2AZTA 4Q3EA 3I2HA 3MCZA 2B2CA 4CLRB 4UBNA 4MPRA 4V1CI 4RZQA 3NPAA 4M9CA 2RBKA 5HIKA 3EVGA 4RF2A 3T3IA 2ZS8A 3T7KA 4X8MA 4FW9A 1P74A 4O08A 4DMHA 1C1DB 5LMZA 2CKMA 2X8JB 9ICTA 2VNAA 3MCVA 2AHOA 3C5WP 4P4SA 2VATA 1Q1BA 3MJFA 4K3VA 3CH6A 2I2AA 4L95C 2KPOA 4WLUA 4L07A 1WWKA 1NBMA 1ZH0A 1RYNA 3MTBA 4DMCA 4G37A 4GPEA 4CMIB 5AVTA 2IOYA 3QXXA 3KQPA 5KAIU 3WL3A 3ZI4A 1X9SA 4YMVA 4P86A 3HY6A 3RUCA 5A0FA 4CCYA 4G24A 4UPVA 2P9BA 1G8KA 4PLWA 4GM0A 5KNDH 2J9XB 5J2FA 1SGWA 4OI1A 1NKTA 7ICMA 1YRAA 4X8LA 5IBCA 5MGBA 5LB2A 3RAGA 5HHIA 1RYFA 2D4AA 2JI6A 3VTAA 5KX5B 1MGOA 2I6XA 5BUQA 4CFSA 1RC0A 5LU8A 3UJAA 3H11A 4RHUA 4H7EA 3DE5X 4YYEA 1XRJA 4CI0B 3C1UA 2W48A 2QXYA 2QGFA 3MDCA 2FWBA 1OTYA 2BCRA 4RTSA 1NLYA 3P2EA 2Z9CA 1ODKA 3FYDA 2B8WA 2HMSA 3CW2C 3WZLA 3TMKA 4YCCA 5KYXA 2IGBA 3GJTA 2WWHA 4D57A 4MMYB 3C3PA 1CXZA 2PQ2A 2GLXA 3DMHA 1T6ZA 4MSUA 4D3FA 3SSOA 2B2XA 8GPBA 3HBNA 4L0DA 3BD7A 2HVHA 2G28A 3H1TA 3DBRB 1XQ6A 3M4JA 4GSYA 4FW8A 4IXDA 3DXFA 2JFNA 4RY2A 3G59A 1LH0A 3BORA 5B1IA 3R6LA 2EZTA 1Z00A 2XNDA 2WJGA 3OMLA 3IKJA 2BKXA 5F9LA 2QYSA 4HB2A 4HFNA 2QKYA 2R1VA 4PINA 3SF8A 1L1RA 2IUTA 4GI1A 4DM3A 5AK6A 3WDLA 1EBUA 1MP0A 5JS2A 3RJ5A 4RE5A 4XDHA 1CIJA 1N48A 3ELDA 4DDKA 1KKUA 3PO4A 5EI5A 3W9YA 4Z2YA 2D59A 1CR1A 2IQIA 1XC9A 2AI1A 1DTEA 1OZ0A 4O4HF 4BFVA 2X23A 3U4IA 3LSTA 4DIUA 5B3AA 1P7WA 3MRTA 4F5EA 2OBBA 2VDKB 1O9BA 2DM6A 3HBAA 2X0IA 3OIVA 4H31A 1ZK2A 1TO2E 2PUHA 2D5IA 3SC2B 2HA4A 2OCBA 3JAWA 2JLBA 1OFUA 4I08A 1CJSA 3FZQA 1H4VB 4DIDA 4YJ3A 3BAZA 4UOQA 4BP3A 1LV5A 1KIAA 1YBMA 1KO8A 4KUGA 4L7QA 3I05A 4ZYTA 1VCHA 1KW4A 3QUSA 3SJBA 1KYXA 4XIIA 3BJZA 1Z73A 3L0IB 1EVLA 1LNQA 4DT1A 1W5TA 1PW5A 1IWBB 4QBFA 1QCKA 4DWVA 2CL0X 2UYGA 2O0LA 3GFPA 3QBTA 5LQJA 4FN4A 4XQ0A 4UXJA 2ZRKA 2Q8QA 4M1OA 2QY6A 1T9HA 4J75A 3M7DA 4I2IA 4HMPA 2R68A 3Q6NA 1DCFA 1J0BA 1J23A 2C77A 1SIUA 5SYNA 4OOEA 2A4KA 3HB5X 2R84A 3M6XA 4JV2A 3GH1A 1T8UA 1K8QA 1ARZA 1VXRA 2PZEA 1U0JA 3IURA 1G66A 5IXJA 3D8NA 3QOFA 3SFZA 1DDGA 3GLFA 4P54A 4G6ZA 3U7QA 2GHTA 3A6DA 4CFZA 1V5IA 3U56A 1I3KA 2Q7XA 3NHZA 5L45A 5L4SA 1RAEA 2RHLA 3UQZA 2BCJQ 3BHMA 3RIEA 2A5FA 4BNVA 4JNKA 5B3JA 5GTHU 4QQRA 2PL3A 3S2IA 9ICKA 5CB0A 1P31A 2R751 1RHMA 4P84A 1W2WB 3HB0A 4ZICA 2E4WA 1DV2A 2O0JA 2A9KA 2DJ5A 2D5LA 4GXIA 4LF8B 4QDXA 1JIIA 4F5DA 4UOEA 3EG9A 5IMBA 2Y1DA 5D1NA 3FTQA 2R6FA 4ZMBA 4NCHA 3LA6A 1GGKA 1Z28A 3ZD7A 5BR1A 4NK4A 4AF8A 3FYUA 2VJ4A 4ZO4A 4RNOA 3TLXA 3UAWA 521PA 1XT6A 3TSZA 4F5QA 4AZTA 1I14A 4U7DA 3DKRA 2COUA 1PD1A 3KFXA 4FUQA 1KY3A 1E2HA 4ZOHC 4KH0A 5G4KA 4M7RA 3DBLA 1WCIB 4BV3A 3PD1A 3QG5A 5B4TA 1NJSA 1IH8A 5D2CA 3Q8KA 1KGDA 2CXQA 1RI2A 2Y76A 2Z8ZA 1ZH8A 1NW9B 2CE2X 1C81A 5C4IA 5I9NA 5ALLA 4WKBA 3S2SA 3GDOA 1VLMA 1Z0FA 1XL1A 3EDMA 4P0QA 3WGIA 1OB5A 4Z4HA 3ISJA 1FVHA 2QQGA 4WJKB 3JYPA 4JDUA 1N4AA 1NJZA 4P7FA 3H2KA 5DGXA 3HEMA 1I30A 2AUNA 1IN1A 5IDWA 1TKCA 1P6UA 2ZT8A 8ICNA 2AJQA 4O2AA 3TADA 3Q7RA 3WGNA 3MGAA 5HKBA 4AY5A 3RB4A 3LKVA 1YJXA 4V0KA 1TM7E 3A3OA 2FOXA 3O1HB 4L5YA 3STVA 2XGSA 4GMGA 1ZU5A 1XTVA 4OLBA 3GZ4A 4ZAYA 1LPNA 4D4HA 4KNYA 1ISSA 3FMVA 2HWUA 2A19A 4Y2JA 3RB6A 4AJIA 1XZPA 1PJAA 4RIIA 2ZOSA 4J0IA 2PT7A 3N2IA 4DLVA 4RIGA 5DRYA 5KTSA 4OHOA 3WG9A 3R7LA 2W2KB 1H3FA 3LMKA 4TN5A 3H1AA 1TT5A 4MJ7A 1KQ3A 2YVLA 3T1VA 4EPXA 3QMWA 1A5SB 2CXSA 3NI2A 4JZYA 2O1WA 1KJIA 4FMPA 3TIVA 4GPIB 3WE7A 2AFHB 3C3DA 3IDQA 1KY2A 2C83A 2NZ2A 5JQGB 4BQIA 4YRLA 4JI6B 3LX6A 2H4XA 2O0KA 3NWPA 5FJIA 4IHJA 4KXXA 3QH4A 4JIMA 5D6OA 1OGYA 1N8SA 1Z83A 4C5BA 4CMBA 3FDZB 2ZE7A 1QP0A 4NKRA 3DONA 3HJHA 3ZCSA 2F64A 1XTPA 1Y7HA 2QPLA 3HL0A 3RWOA 3JPQA 4ER5A 2GCGA 5F9MA 4F8JA 2IIVA 4LRTB 2JAPA 4XX0B 4LF5B 4JLDA 3X44A 1Q74A 1HM5A 4I2EA 4TXNA 1U04A 4X8OA 4KK3A 2B25A 3UAXA 5TC4A 2REXB 5EE5B 2ZI3A 5IS2A 4RZRA 3RVLA 4K81B 5ANRB 4IQWA 1X1QA 4Y9SA 7ICFA 4ER0A 1NKBA 5B1HA 1KYIA 5EEHA 5I9TA 1SBZA 5KG6A 2W7TA 2JFUA 5EZQA 2Q1XA 2H1OA 3PUJA 2ZIFA 1NXWA 1SXJE 2EC5A 4XUGB 2BH2A 4NF2A 1XBTA 5BSTA 4CCWA 3AUSA 3SYNA 1QIGA 5JISA 2YUTA 3K0FB 1ZG3A 1X38A 2C2ZA 1LFDB 5LZ8A 5GONA 3I1JA 4D8WA 4PAWA 4DR4B 4NBVA 3ZZTA 2FZEA 3VR1A 1PP4A 3AWIA 4UUNA 3V1YA 4G5XA 4DQQA 1HDXA 3Q3VA 5EYPA 2CXXA 1XP5A 3S99A 2X6RA 2JD1A 4JBYA 1OH5A 5IINA 5C8XA 3JZAA 2PX6A 2CHUA 3A6PC 1ZO8A 2I3GA 1WV0A 4CIBA 1E89A 1CETA 1CW2B 2XMGA 3WFIA 4V2IA 2LBOA 4A8JC 4PGAA 2DBQA 4YT8A 4NS1A 1ZC3A 3K4GA 2H48A 3PQ8A 2XDQB 4Z6EA 3D02A 2HK9A 4WCFC 3WL8A 2SCUB 4GM1A 3QVGB 4LRXA 4WDQA 1D8BA 2PCJA 2ECKA 3UJDA 4X1KB 3AR2A 5BOVA 3H2SA 4P3KA 1XHLA 2KJ5A 4PGYA 3BFKA 1DKQA 1IPFA 3K30A 3GH3A 2WV9A 5GY7A 3I9LA 5EUBA 4IZOA 4TUYB 1KMIY 2PL5A 3N8HA 2AGOA 5KHLB 5KFEA 3GAZA 3STYA 3R0VA 5CX1B 1OFUX 4H18A 2H5XA 1AHHA 4HDKA 3VU3A 3K5HA 1T2AA 2MSCB 2PU7A 4LE0A 1U1DA 4IIXA 3G0CA 4C8NA 4CQLA 1OFHA 1KI3A 4RTQA 4PLYA 3PUKA 3GJQA 3DJYA 1CERA 2PSSA 4RUCA 2QSJA 4NY8A 1F0NA 3E58A 5DNUA 2GK4A 5TPZD 2PZLA 3L0SA 3OZGA 3HXTA 3R5JA 2R6AA 2YYAA 3HT3A 1I4WA 2PAFA 1ZAKA 2PA0A 1S2NA 3WYAA 5ADWA 4AJPA 4TZTA 4GC7A 4QL3A 5I4CA 1TX4B 1UK9A 5KFIA 5L3SA 2QWXA 3ZHVA 3C1YA 1NXXA 4LRUA 3GJ6A 3TN7A 3FOEC 3OOWA 2JFQA 4TLCA 2YWRA 4L74A 1DQRA 4WINA 3GLQA 5JCXA 5FBKA 4IGIA 2GCPA 2CUKA 2P9HA 4C87A 1P5ZB 5KYTA 5M2QA 4CLXA 4MITA 4UVEA 5E1OA 3N2NA 3AIOA 2XV1A 3V1LA 4KLNA 4R71A 3PPVA 1UCVA 3SEZA 1Z68A 4BKUA 2P9FA 2DHEA 1JJIA 4PO1A 5FWYA 3VC2A 1EX1A 3IKTA 1E2GA 4YPOA 1U9CA 1FFDA 3O82A 4RF4A 4QIWC 2BPGA 2J33A 3EIHA 1LLCA 4O3FA 3ICQB 1KKMA 1C5KA 4B43A 4KIUA 5J0TA 2FEAA 5AOBA 1RKQA 2VT6A 5CBPA 2O8FB 1NBIA 1N62A 4ECRA 4I6GA 2VHUA 4A0QA 1DG1G 1GGHA 5E9QA 2B7BA 2ETVA 3PX7A 3MPUA 1DAHA 2ZWMA 2JG3A 2BCSA 1OHHD 2ZUEA 3RAEC 1Z6AA 2NQ8A 7REQA 3W34A 4JWTA 2BFNA 3T5TA 5AJZA 3AZQA 3CZQA 5JT1A 1M0TA 4MOWA 4PN7A 3IPCA 3R7WA 2NRVA 5IDXA 2ONKA 4HDNB 5IZCA 3QPWA 5LLSA 4EYSA 5G3ZA 1CF9A 4B9SA 4YEDA 5JCJA 2R62A 4AO7A 1NTOA 4W7SA 3M6ZA 3TNJA 4WLNA 1ATZA 1I4OA 3D3QA 2AC2A 1BXGB 4JJFA 5KU1A 4FHEA 4QWCA 2AGQA 3GT4A 1KZ6A 4KKVA 4WSOA 4KN6A 5AVVA 1GAXA 4R3NA 4HGYA 5G0WA 1KBZA 4AJHA 4AZ3B 1FTGA 1VMEA 4RF3A 9ICFA 2JGMA 3ZE2B 1PWYE 1AKYA 4UASA 4CGZA 4HLUA 1C3EA 2BGLA 3TRDA 3GCGA 3OSUA 2MYTA 3QPBA 3ESBA 2Y6VA 2GYWA 4RQ0A 2EJWA 5CDHA 4RC9A 5BUSA 1N5XA 4C8OA 3E3NA 4TVBA 3M34A 5KDDA 1AK1A 4ZAGA 3LXMA 5D7NA 3OJ0A 1EVIA 3GAFA 2P67A 3NWBA 4IIFA 4PHAA 5TV2A 4H27A 3TD9A 1ZNXA 1T8TA 3BB4A 3MR3A 1BXKA 1J8DA 1B3RA 1L5OA 2R1TA 2CE7A 1YD7A 5DG7A 5FA8A 3CCFA 1RZUA 1YK1A 5DW0A 3UIEA 4N8SA 1VIYA 4NJMA 2XUDA 4D81A 4RZ3A 5BURA 5EXXA 3U37A 3Q88A 1CZOA 1XZGA 2NV2B 5AM2A 4ILEA 4ZWNA 5AJYA 3D6VA 4O4IB 2UUBB 2GKGA 1E4EB 4CODB 3Q7EA 4UB5A 1L7QA 2OOSA 3GLHA 4Q03A 4RPYA 4FZ5A 1Z12A 3PEVA 4LZPA 1G5HA 1OHHA 2WJPA 1QPGA 3L82B 3L6UA 3WP0A 2EBWA 5TB5A 3AERA 1BNOA 3DEHA 4HBZA 3OTGA 1TRHA 5FPSA 5L1MA 1FQJA 3AU8A 3PDWA 2HPAA 1QUFA 1ZMOA 2CSUA 4E3WA 2BHTA 4Z2AA 4C7YA 1A98A 3E2PA 3OZRA 4HUTA 4Q1VA 1FFEA 1OLUB 2QZSA 3COPA 4UAZA 4WACA 4PHGA 3ZU4A 3QE9Y 3V97A 1FX0A 4L28A 2WJVA 2W2XA 3GJ4A 3PLNA 3P2JA 3O3OB 4GLLA 2QVYX 3RFTA 1OLXB 4M88A 4GG1A 5ES4B 2C96A 5JVDA 3E1KA 2JI8A 3NDRA 2YMMA 2XQKA 1ZCAA 5AKXA 1LI5A 2VJKA 1KHTA 1RRMA 2WWVD 4IR9A 1WNTA 1E6CA 2NXJA 3T5KA 1CE8B 3UCXA 1RQ2A 5AM1A 3LX4A 2WSIA 4CL3A 4QWEA 2H5LA 1GAQA 4EEXA 4CIXA 1CUVA 4ZT6A 1WSAA 1SA0B 4CEIB 5EE9A 4XTRA 4RKEA 1P2TA 1ZRMA 4EFDA 5A4DA 1W5SA 2VHEA 4I50B 5E3HA 4L22A 4N7BA 1HDCA 2GM9A 5J59A 2M0NA 3TECE 1P3DA 4EPTA 3DZIA 2FPPA 4BO9A 1HNXB 3NT4A 2HCRA 3LQKA 5CDUA 4I9HA 4XCXA 4I0WB 4RJLA 1N6IA 3K9WA 5DG8A 2EVWX 1NZPA 2WWIA 2CEAA 4ES6A 1SJ9A 9ICQA 1UMDA 2OFWA 2BISA 1T3ZA 2XCRB 3IBCA 1T91A 4OKNA 2E21A 4B9VA 3WTBA 1CCWA 1DARA 3E3MA 4BEWA 3NRWA 4AKIA 4O5CA 3OH8A 4Z0PA 4YAGA 2AG6A 4BNIA 4B9MA 3K4QA 3T99A 2ST1A 3DHVA 1T4CA 3GHYA 4OAOA 4GWLA 1UXGA 3EZYA 1MIHA 4G9GA 3RSCA 1JQ5A 2WKQA 4DLWA 3MWEB 3QKSB 3SI7A 4FLEA 1ZR2A 2M9MA 5DYYA 4OP1A 3PQ5A 1IVYA 4L0CA 4W82A 2Q49A 4LRQA 5DE3A 1SC9A 4IIGA 5KSOA 3O1IC 1UOOA 3PV8A 2IT1A 1GPUA 2EGGA 2F9MA 4EY7A 4JK1A 1U0SY 4KGVA 1AK2A 4CR8A 3G2MA 5KCMA 1S0VA 1HRKA 3BMOA 3QYPA 3E8XA 5CB4B 5MHTA 3N4MB 3RFXA 3LY9A 4WN3A 3JYLA 2C28A 1HKUA 3K0EA 2V6GA 3QBEA 4UE3S 1GN8A 9ICCA 3KKZA 5ES3A 2QK4A 1OGJA 3SSMA 1AHNA 5J0QA 4DSOA 3UAZA 3N2KA 4KX3A 4WOKA 1NK0A 5BW5A 4HSGA 3ISVA 3KT6A 2DX7A 4EIWA 2K2QB 2QLMA 2V7BA 5TXGA 3W06A 2COKA 5FI1B 3RM3A 4ZT4A 3JQPA 1XRNA 1GGJA 3KSUA 3EFOA 4FHCA 1JTEA 1M5TA 1UBUS 1KI6A 1VMAA 1YOVB 4UHEA 5H9WA 5HTOA 1ILEA 3AHGA 4LX8A 1RJDA 1JVNA 1CVIA 1GZ3A 4GECA 2QUAA 4FYJA 2PZ8A 5BWOA 2C1XA 3II6X 3LOQA 5IXYA 4L4UA 2YB1A 2HCBA 3BM5A 3C41J 1QTQA 3LBAA 3ONFA 4EG6A 3PVCA 4JZKA 1SBYA 3FC4A 3Q0EA 4C0KA 4XA8A 1KTIA 2CLCX 4Y1RB 1K89A 3DD1A 3HCWA 1E2QA 1I3CA 4QBGB 1WB6A 4UB3A 2IA6A 5KYYA 3VKFA 1ZGCA 1BXZA 2FLLA 7ABPA 3LHIA 4MI3A 2YS7A 1NYTA 3KU4A 4U6SA 2AN4A 3ZZ1A 2XE7A 4ND2A 1I0ZA 2G40A 2KBEA 2GJKA 5DXFA 4Z4IA 2H7VA 1LF0A 3OIFA 2V1XA 1II9A 3QYJA 8ICRA 4K6GA 1G41A 5E4YA 3HK2A 2AHOB 4UW9A 4P4SB 1GT6A 1SC4A 2G1JA 2IELA 4F84A 2VHTA 4RDIA 4H1UA 3SNHA 2HBRA 2VT3A 2F1RA 4KNVA 1YAJA 4E1VA 1EJ6A 4X6YA 2ZBDA 3H99A 4FLMA 1H4TA 1NONA 2FJUA 2R6CA 2Q5EA 4QWMA 1COKA 3RC8A 1JU9A 1TF7A 2IYTA 2C94A 3C74A 4CCYB 4J6FA 4PHFA 3Q9NA 4MR8A 3VPCA 4LA4A 3K4HA 3K5IA 2YJTD 3KVRA 3NS7A 1ZH2A 2BWJA 1JFRA 2C5BA 1KJJA 4P5PA 3VR5D 2VHCA 1MJFA 4YNBA 3FNGA 3EA0A 2GBIA 3WGMA 4O2LA 2XOXA 4P32A 4Z3KA 3LGSA 4HH0A 2ATCA 4B17A 2EFDB 2JKZA 1JIJA 2B5WA 3AO0B 3R74A 1ADYA 1S4QA 3WL6A 4ID9A 3H11B 4GWGA 4UD6A 2B37A 3EODA 5U1PA 1NRWA 3OJWA 3DSRA 1Q7GA 3L0OA 5IVPA 4I27A 3AW8A 3I34X 3IAM1 4BAZA 2LHTA 5GINE 5KYXB 4IVPA 3EPHA 3WIVA 2DPHA 4G5GA 1PQWA 1VFNA 1U90A 3DO6A 4EJSC 1RACA 1FIUA 4YGXB 1D5CA 3OE7D 3H9UA 3GP8A 3GD7A 3ZLVA 4JP3A 4H1VA 1QO9A 3R9WA 4AC9A 4RQ2A 1ADJA 1VBMA 2Z5GA 5E7IA 3LWZA 1NZBA 4RTKA 2AE1A 1NG1A 3K9CA 1Z00B 1DK3A 1L9XA 2R1VB 1E66A 3SF8B 1ZHHA 1HIWA 4QGFA 1EDZA 3N6XA 3N76A 4J9RA 1JA1A 4EAQA 2RGEA 4LOHA 5IVDA 4G0UA 3EUFA 1WKBA 1K1SA 4B48A 3SAJA 3WMFA 3CUYA 4J16A 1YCGA 3PCRB 5K0TA 3GEMA 5KFWA 1MA0A 3HYSA 3SKYA 1ISGA 4M7OA 3RSSA 4J0CA 3ZBPA 1TKRA 2GR9A 4NMMA 2NSDA 3TQIA 1E0JA 3N86A 3C48A 4AICA 5AKHA 3NO4A 1NF9A 3JAWB 5K05A 2UZIR 2VJQA 3JQDA 3BMNA 4M9UA 2A5GA 1U8ZA 3ZQUA 2ZE6A 1I2ZA 4YJ3B 2XYQA 1ZMBA 1W0JD 3A1SA 5GTIU 3IDZA 1NGSA 4C0BA 1DEAA 3HUEA 3PC7A 5J4VA 4R8UA 2J1LA 4LJYA 2P78A 2C9MA 1O4VA 4FFLA 2LUOA 2V7GA 1F0KA 3KU1A 4DT1B 1Y8CA 3IHLA 5KYUA 5EJ9A 5FI0B 4B5KA 2P5YA 4D4IA 4DWWA 2H4FA 2R0QC 1PV1A 4KXWA 4KIWA 3SQXA 2EAOA 5IKPA 2UVPA 2CHFA 4ZAXA 3DFMA 1NBOA 5B5SA 3NUZA 1J8VA 1AGPA 2A8YA 2W4QA 4UXHA 2ZS9A 3UOAB 1BPXA 1C3XA 3SZOA 1TM3E 4W7HA 3QLTA 4YUWA 3AH8A 3M9WA 2AYZA 3O4IA 3DE0X 1IULA 1P1JA 3MMNA 2DAPA 4I5FA 3H4BA 2IP1A 3AUUA 4URZR 2AX3A 5B1YA 5TISU 3PFGA 4CJXA 4GRIA 1YAHA 2FJ6A 3H0CA 3GLFB 3JD1A 3UK7A 3U7QB 4WHMA 3C3XA 2JGFA 2ZCUA 1KEWA 3SIWA 2Q4BA 2WIBA 3ABSB 4K87A 2GEDA 2G63A 4DUPA 1GZ6A 4TWZA 2YICA 4DR5B 4R1MA 1E7SA 3KWLA 4R84A 1POWA 4F4ZA 3DD5A 5AHRA 3B82A 1IK6A 4BZZA 4CM6A 1A9ZA 2R65A 2VJPA 1VG8A 4DF3A 2GK7A 5DZSA 1K88A 3OE1A 1LJLA 1J1IA 3HKZC 1ZUWA 1N5IA 3L7MA 4EO4A 2VYNA 2GF2A 2FFAA 1BX1A 1E3QA 1XPJA 3IJPA 5K45A 2FPKA 1Z88A 4C3OB 1C7JA 4WPGA 3QE4A 3EG9B 3KLOA 4YP3A 1Y8ZA 4Y9RA 4ACOA 2OFOA 2RFLA 5KNDD 1SL2A 4M0KA 2E5FA 2O14A 2ZROA 5EJ2A 2VSXA 2ISPA 4X00A 4ALLA 3FYUB 1DK2A 2HIAA 1O1YA 1XV5A 3K9QO 4KQJA 3UPDA 4RQAA 1WXHA 1XTUA 4YONB 2SKEA 2QTZA 1NZFA 5G4KB 3DP7A 1KI7A 4Y2GA 3DBLB 4ZO9A 1YKSA 2ZBUA 5KREA 1XB2A 2ZJZA 4G23A 1XA3A 4HWPA 3F7NA 3RU3A 4WAUA 4LMRA 1Z39A 4QM7A 1SFRA 1UWCA 1AUVA 3M4NA 3RH4A 1XCMA 1TGVA 3KZVA 2JA2A 4B3IA 4WNYA 4JJ8A 4O4HA 3IESA 2JPDA 3GVHA 4DLXA 1NE7A 4KN5A 2EZXA 4P0QB 2I78A 4Q34A 4EHBA 4ARCA 2QV0A 2I2DA 3OWHA 4KWEA 4EKEA 4YQYA 5THKA 4EG7A 2FMQA 4ESVA 3W3AA 3I6BA 4X91A 5JZBA 2Y9UA 2J3KA 2NUPA 4TS9A 5CYOA 4EG5A 2DFVA 4WCFA 4O2AB 4CF6A 1G21A 1AH2A 4OLJA 2EZ9A 2C2EA 4ZH4A 4OBWA 1CKEA 1LCIA 1N32B 3T3NA 5BT8A 1V8BA 3BCRA 3BILA 4D0NA 4B84A 4HB4A 1HNZB 2W55A 3SYMA 2M32A 3N7SC 3F8SA 3A9CA 3HYCA 1ZDMA 1U3VA 2FRDC 1M2KA 2YCBA 2WWYA 2WUDA 1YRBA 1PZHA 1TT5B 1TUGA 4L5BA 3KEQA 4XYBA 3KKQA 4DANA 4N8DA 4IO0A 1ZETA 5A7GA 1MLDA 3FYHA 1E99A 2HYIC 3G9ZA 2QW0X 3NKFA 2CK3D 4ECWA 1HOXA 2N9UA 2O5EA 2B0CA 4UBLA 1UKYA 3DNPA 4IHJB 3L07A 3KM0A 1VJTA 2PPVA 1RIFA 4NU8X 1XCPA 4ARVA 2WSMA 5FR2A 4URYR 1IIRA 1P81A 5IW8A 5T57A 4EY5A 3GZNA 3CYFA 3LK6A 3AVPA 5CCXA 3ST7A 1RKBA 2NACA 4JNCA 4U2CA 4KLMA 3VV3A 1W76A 5MFZA 4IIUA 3M1IA 2CVZA 4EHAA 2IHUA 4PW0A 3L7KA 3IAS6 3BQ1A 2HV8A 4FGLA 4PX5A 1TL7C 1QE0A 8ICJA 2B83A 3IIIA 4ND6A 4IDFA 4MAAA 5CNJA 1JECA 3VYUB 4G07A 5F1KA 4NJOA 5DLEA 2R7AA 3EVDA 3SC3A 1U1EA 4HWGA 4M0AA 3H6HA 5B53A 1J2JA 4EL0A 1YRWA 3PT9A 2RHWA 1E6MA 5GV7A 2WTBA 4JA0A 2P79A 3FY4A 3GY0A 1JSLA 1AUXA 4DABA 2FU5C 3FHCB 3THYA 3EUEA 2FN8A 1YS1X 4URWR 1R3DA 4MWTA 1RFLA 2GT1A 1QQ6A 3BC1A 2F43A 2ZBQA 3SXPA 2BKAA 2CXYA 4K0RA 3KX2A 1ZZGA 1TA0A 2E4AA 4L6IA 1UK8A 5BR4A 4QRIA 1NN5A 3PHBE 2WZBA 2WM8A 3H8VA 4CMGA 1BWQA 4ZXPA 2XUIA 4QEKA 5GONB 3JWPA 1D2HA 4RVNA 4WZ6A 3CUWA 4LZGA 1BWRA 3SXJA 4ZQGA 3QNWA 1SHUX 1KXZA 3B3FA 5FOSA 3C3JA 2XMZA 4DCGA 5EYPB 5BW4A 3KDSE 1DLIA 2CHQA 4FR0A 2XRYA 3CEPB 2JI4A 4RDCA 1KYYA 4K46A 4F46A 1Y82A 2GM4A 1K98A 3JAKA 1Y81A 1K1QA 4QNMA 1K9SA 1U3WA 2LMRA 3RADC 2Y4NA 4X9XA 2EARA 4FWIB 2B9EA 3OA2A 3VI3B 3GGGA 3VPDA 1DKNA 4MMZB 2X5JO 3MS4A 3DG9A 2PLAA 4V0QA 1QKKA 5T64A 4WE3A 2FSUA 2HA6A 3Q7PA 4QDKA 4CGYA 2Q6KA 5HRUA 1JTVA 2J59A 1QDLB 4ZXFA 4RTOA 2OESA 3IXQA 2DFDA 4G0OA 1U80A 2WDPA 1B23P 2XCAA 4AN1A 2YVKA 3OCZA 4ETMA 1TKDA 2QJOA 5AHKA 3KQNA 1DQYA 4UBOA 4MROA 3O83A 5I7HA 1Z62A 4KMOA 4BQOA 4RETA 4DVGA 4PX3A 1H6DA 2OEPA 2QW1A 4J1SA 3H2GA 4HDKB 3T5CA 3VNAA 4E03A 2OMKA 2FFQA 4MQ4A 1W75A 5I4KA 4PIVA 5KVAA 2P6NA 2D0OB 4CQLB 1S0UA 1TUIA 1H2YA 2OP1A 4JQSA 6AT1A 2VVTA 1DOAA 2ZB8A 7ICTA 1U9YA 2D2XA 3A2LA 4MUMA 3FGOA 4NLGA 3EPJA 1Y6GA 3OOYA 2Q9BA 3PVZA 3VDQA 3K0AA 2EU8A 2DCUA 2NXWA 1WXGA 2NPFA 3U3DA 2IXAA 5H02A 1Q6YA 1AJEA 4L3OA 4X6LA 5ENVA 1Q21A 4IZHA 2XMSA 1FU7A 2PKWA 3VKGA 4BJHB 3F1LA 4TZ0A 2QQ5A 1MOQA 4RIFA 1GWNA 1S9HA 4GD3Q 1T9AA 4TMFA 1RCTE 4B3FX 4JYPA 1D4OA 1SVIA 1P1HA 4HJXA 1W4LA 4H4DA 4EO9A 5L3SB 1ZLXA 2CLDX 2C3UA 1CY1A 1ZXXA 1F44A 2VQ6A 3IOCA 1HDGO 3SKXA 2W3SA 3UMRA 1XDUA 3UO8B 4MGHA 1N2OA 5CIQA 1GZDA 3F8WA 3ORYA 2AT1A 5EESA 1VA5A 1BH6A 4B3JA 3K2BA 2PKRA 3AR8A 5L3ZA 5CG2A 1UM9A 3Q6MA 4JFRA 1TLLA 5C32A 4HAWA 3ESXA 1T3SA 1LNSA 4BVKA 5DN6D 2G9UA 1ZJNA 3EHDA 1PK7A 2RHDA 3ODPA 5J4KA 2WHXA 1XMQB 4MF8A 4H7KA 1TJPB 2M9NA 4LQDA 2VTKA 4CHGA 1H2EA 1TMOA 1ZX1A 5CW2A 2ZSKA 1MOZA 2HRBA 3FJYA 1DZIA 5T3YA 1X14A 2O2IA 1EZZA 1N5WA 3V2IA 2V45A 3RVMA 5CBPB 4UD2A 4YRAA 2ZZNA 4H7FA 3X2FA 5ILGA 2FPUA 3UAYA 1DLJA 1T4BA 1Z9BA 1H23A 3SOPA 4TLEA 2YN2A 1AF4A 5JADA 4EY3A 1JKJA 1TAUA 2J3DA 3RUHA 3BQNB 4O0IA 7REQB 4RLFA 4YCNA 5K3OA 1LVUA 2YN0A 3HILA 1YZ3A 3ZD9A 1JDPA 3DF7A 1GO2A 2VSYA 3R7WB 4BBJA 1E32A 5SZIA 3BF7A 3VR6H 3UPTA 5C7IO 1KTQA 4K6KA 2VRWA 4DHWA 4XB1A 2I4RA 2ZBGA 1ISHA 4E4RA 3KJIA 2VTVA 4W1QA 1PVVA 4X1YA 3TNDA 1YKGA 2ZEJA 2C9ZA 5JMPA 3JRXA 3NWOA 3JVUA 5AJUA 2NAPA 4B2PA 4KAXA 1EUYA 1B73A 2J3JA 4L72A 1OA1A 1SVUA 5D1HA 5A1JA 4BFLA 3KE9A 1DQSA 4DSZA 1UDWA 3MJVA 3U26A 1NFRA 1QRUA 2UVUA 4K9RA 4ECYA 1KK0A 2IS2A 1R4NA 3DJFA 4EMTA 5M04A 4QZHA 4LXUA 3ZXSA 3KTAA 4KWTA 4O6VA 4RL6A 1GV1A 1WVGA 2JD0A 2MSLA 1O5IA 2GASA 2OCAA 4I9NA 4WXMA 3ZWWA 1SVNA 4MTLA 4UCQA 1Y9DA 3TDKA 4Y6GB 5HOQA 4TN1A 3RVNA 3RYCA 2JGIA 2ZQYA 1SQSA 3R6GA 1WCLA 2CNWD 2ZRQA 1FP7A 4QFCA 2P6RA 4DR2B 3HYLA 2R1TB 3ZX5A 1I3NA 3A8TA 3TCNA 4NULA 2RC6A 1JLMA 5J2HA 4NJMB 2CLEB 4FWTA 1G6HA 2IW3A 4INOA 2FCRA 4E0DA 3URMA 1II0A 4QGAA 3IYLW 2QRZA 3TZBA 3BIXA 3T4PA 1D3AA 2VWPA 1GPLA 3ER6A 3ZXIA 4YMUA 3GLHB 3HCCA 1MKYA 1MX9A 3DVSX 1OV4A 2R8JA 1S9DA 4OAPA 2YDYA 4N7RA 1EFKA 3AERB 5B2ZA 2C2BA 4N5IX 2F17A 2H2WA 4DKJA 4OUKX 2GCOA 2IHYA 4NNPA 4UE2A 2VYCA 1D2MA 2KB0A 4WY8A 4GX2A 2UVVA 3HP7A 5LDHA 2KX7A 3D1VA 2YXBA 2DUUA 4LV5B 2I6UA 3RK0A 4FMCF 3EXAA 4P36A 4WK0B 1DWUA 4O3SA 3HXQA 3NTQA 3E9RA 3U2QA 1YGYA 2BSAA 1ZL0A 4B2LA 3FG9A 2GCNA 3QVLA 2HWWA 3BL5A 1E2JA 3KWJA 3R8FA 2QX7A 2RI0A 1FX0B 2PT5A 4FYVA 1Y3FE 1K5OA 5CVUA 5ADUS 2GXAA 1B6SA 4WZBA 3W3ZB 2H2DA 2W4MA 3TGWA 3ASVA 3C8UA 1X6IA 4LWQA 3D0RA 1JFFA 1U31A 5JVDB 1P17A 2Z09A 5B7NA 4XR9A 2KOBA 4NYIQ 4ZVTA 3RJZA 5I7EA 1EFPA 1FLNA 3EZNA 3KZOA 2BLNA 3RR7A 1KYZA 2RGUA 2ODPA 1RP1A 2AFHE 1IJBA 3BUSA 3DDHA 4GAEA 3DKVA 2QUHA 2Q4EA 1MC8A 2GD0A 3Q8RB 1LBTA 2EKLA 2IPMA 3L8EA 2V3WA 3AEXA 3C5EA 3MPOA 4IJVA 4R3UC 1HYEA 1QFJA 3ORRA 2QN8A 1KDPA 4Z3DA 1HR0B 1TLFA 1GP2A 2YQ4A 4UULA 1YMVA 4QIWF 1M6EX 1O97C 3BG5A 4UU1A 4JFAA 1D7OA 2ISQA 4C8MA 4XTCS 2P65A 2ZJOA 5E3JA 3PHLA 1BMDA 2W3RA 1R8JA 3GUZA 4EG1A 1NM5C 5BSVA 2FPPB 1USWA 2DKNA 5DOVA 5TMPA 1GPWB 1YL5A 1G5FA 4KHPB 2JA1A 1ADGA 3NHYA 1CQIA 4NK5A 3BZWA 4D4JA 3N7AA 3OIUA 3E7DA 5HS4A 3DMGA 1FXSA 3RRZA 1UMDB 4EY6A 2I33A 1PTJC 5L1IA 3VH2A 4H1HA 2GQ0A 3TW8A 4FC6A 5ICEA 3T8YA 3TK1A 4C14A 5B36A 2X0NA 3DC7A 4U02A 3AQEA 3MT8A 3KJHA 4OFWA 1OIVA 3Q9UA 5E9JA 4UREA 3THSA 2OV6A 2ODNA 1EGAA 1T4CB 4Q3LA 3IGFA 2JASA 2JAWA 1DRKA 4TS1A 4UVGA 3RUIA 3EBPA 4AMUA 3HW8A 2EX0A 1J7JA 3OEED 1F5SA 4B6QA 1E6EA 3F5DA 3MGIA 1Q84A 2HADA 3Q2IA 3TSYA 2O8CA 5CLGA 1A7KA 4F2PA 4EAAA 3C3EA 3DTNA 2PLWA 2JEGA 4M9QA 4O2RA 1O0BA 2EAMA 3CBGA 3BMOB 3CWZA 4NCAA 5T8KA 4X24A 3KTQA 3LUFA 2VUIB 2DF8A 2W6ID 3BHNA 4MW0A 4EB8A 4IH1A 1PQPA 1XK6A 3ELWA 3N2KB 4ZYYA 4DO9A 2HH9A 4YC7A 1U7WA 4NCXA 3UJ7A 1VLHA 3ETLA 5BWBA 2FWPA 1O2DA 4EJ2A 4AKGA 3R75A 1TU0A 3O31A 1UFRA 3RREA 3OLWA 1DKUA 4ARSA 4REMA 1J07A 1T3NA 1HLGA 5CB8A 1TV9A 4XUEA 4B8ZA 1EXWA 3EFOB 1E7WA 1N36B 3QV2A 5KMGA 4WQMA 5K0JA 2C04A 2O07A 5EP3A 1G4AE 3X0DA 5F76A 3I4LA 2R8RA 1KI6B 3CC8A 1DXQA 3KUKA 4UDXX 2FN9A 4FVTA 2H07A 3D4PA 2NU7A 4PEVA 1ZD9A 4JV1A 4GI3A 3MUOA 2EEPA 3LTEA 3WGLA 3T06B 1WP4A 1I6LA 2EGUA 3TFQA 1NOMA 1D8YA 2KIVA 4MRSA 1MB4A 1QHGA 3AT1A 3HDYA 3GDHA 3RGGA 1I3OA 2OB2A 3GP3A 3QEOA 4FN5A 3LUBA 4QYIA 2C2HA 4HUQA 5C34B 1KVUA 3KHSA 4Q16A 1AKVA 4L4RA 5KYYB 5FLXA 1AKRA 1GKUB 2ZSEA 5K0SA 5DNVA 1L7MA 4M6WA 4QPZA 3UHFA 2J9YB 3FTEA 4HYQA 1DT3A 2ON6A 2V6BA 2EG9A 5KFPA 2VIIA 4ECXA 1LJ8A 4IDPA 3OQ1A 3JYNA 4LPKA 3QPCA 4PL1A 1J0AA 4FHZA 2P5TB 4C6HA 3PXAA 3LPMA 3IXMA 5JS7A 3HJCA 3R76A 2HSZA 2H9AA 4RM3A 3KPJA 1R8XA 3RJFA 3LW7A 1Z1BA 1Z38A 3EMBA 1N7IA 4F2RA 3ZHSA 1S3IA 3HABA 4KR6A 1PR3A 3PV0A 4OKSA 3NBMA 4IDBA 3GRZA 4HQFA 3ZS9A 1XKXA 2NSYA 1EX9A 2W6OA 3LJKA 2NLOA 1DC6A 3A05A 4MR8B 4CL8A 2KKPA 4ICAA 5EQTA 1G9SA 4ZAWA 5DHTA 3VJKA 4KLCA 8ICLA 5KWIA 2ZYTX 3IAXA 5EQDA 1PNRA 1NY5A 5DGDA 2KBFA 3WISA 3PX0A 4PTLA 3B51X 2NP6A 4CUZA 1CQWA 1DXYA 1GL7A 5DN9A 5C0OE 1N6KA 2A5DA 3FIUA 3FZYA 4C2BA 3TQQA 5EIHA 4CN8A 5A9RA 1NUAA 3AFGA 4IQFA 1C3VA 2ZQZA 4OEHA 2OPBA 8AT1A 4BPBA 3DMTA 4L3VA 4HAOA 3LBNA 4KR2A 1AV6A 3EWAA 1K1EA 1EZ4A 4KREA 3I9OA 3ED5A 2NNWB 5AXDA 3RTEA 4C06A 3OTQA 5JYEA 3QX3A 2XVAA 2GTHA 2XCPA 2NOAA 3I2GA 4DL7A 2ZTEA 3L3FX 3H3JA 3GLSA 3TZHA 2ZWOA 2P4HX 3WLKX 1IFXA 4OTZA 4I66A 4BLVA 4OHCA 3EZ2A 4TMYA 1EVJA 4RMHA 1CZNA 4LYHA 1QYWA 4YT2A 1TPYA 4XIFA 1E3JA 1GFSA 1EU1A 1WZUA 1RT9A 3NHWA 2ZRMA 4ON9A 2UVDA 4MP3A 4LF7B 2G6BA 1FRNA 1KNXA 4OGFA 5A6VA 2QRLA 1SG6A 1OW5A 1ZYQA 2HHJA 3W9UA 4UNPA 1Z6YA 1ZOOA 1L8AA 3ISTA 4N5MA 4I1SA 2JIQA 1FDOA 2AXPA 2A7XA 4F04A 3UB2A 4AF6A 4GX1A 4DLZA 3OPXA 2DQ4A 1IXRC 3DO5A 3Q3IA 2DUNA 3ETHA 3FOWA 5BXQC 1NRXA 3MUNA 4G81A 5TQ0A 4YT5A 4UMEA 4MKXA 4J9QA 1RS0A 2G9NA 4LOAA 1Y3HA 3BMNB 1OB2A 3SJZA 5LQAA 3RRBA 1Y8AA 3OJEA 1WSDA 5BV0A 2FWJA 3C3AA 2HJ9A 4RCYA 4R8UB 1RZTA 1KAQA 3F74A 1T2EA 1VE7A 5DTQA 1M8KA 2C7PA 3G6YA 4HX2A 4X7RA 2XNJA 3ZDAA 2A1AA 5KYUB 2WIGA 1PWEA 3SM9A 4P35A 4MLZA 3PJRA 3V8RA 4RT3A 2UVPB 3OO0A 2CB0A 4CCHA 4JJKA 1E3EA 1JE1A 4DLBA 1KI9A 4TT8A 2VHWA 3HB7A 1JHUA 1HE3A 3ZZ0A 5C37A 2YW2A 1OT5A 4RQMA 3E8SA 5TPZA 3SHVA 4GOKA 1MT3A 5TGZA 2VHZA 1U8FO 1YRLA 1KO5A 2Q28A 5JDIC 1PVOA 5TQJA 2F3UA 5LVAA 4EF5A 2MSDB 3ND5A 4I1PA 1ZM7A 3O8CA 3MJTA 5I7UA 2VRCD 2QRQA 5AIAA 1NQVA 1UPAA 3OD5A 1ZRNA 2P2CA 2PUBA 2BI8A 5KYGA 2P1ZA 5I3ZA 4OMUA 2WVAA 4LXXA 5BSMA 4C78A 3UJNA 4F5WA 1RBZA 1N3YA 2BKUA 5A5DA 5K3EA 2BLLA 4U2GA 1FFBA 1KTVA 3AF2A 3BGVA 1TTTA 3GUCA 4WY2A 1E5XA 3EQ7A 2IIPA 3F73A 3VSDA 5EN4A 2XTJA 2IF2A 1HZZA 3JW8A 4U00A 3AI1A 4HVCA 1T25A 1TYCA 3GFQA 3L7IA 2I22A 1L5QA 2QPAA 3FPCA 5CFMA 4OXQA 1V2HE 1LZLA 4YK7A 4R5HA 1AZLA 5C1BA 3JPSA 1PIWA 4O5OA 5DT9A 4NE2A 4IX9A 4XARA 3RVQA 1LS1A 3EDRA 3A6KA 5J2TF 3ADDA 1PR5A 3U3JA 3ZJTA 4ACAA 4JA2A 4WKCA 2K8AA 4F7WA 3PPYA 5LD2B 5EUQB 3W6OA 4LW8A 1T2NA 4O4HB 3BE6A 1ZRSA 4Q3DA 5JD3A 1VPEA 2W37A 4R81A 3M3PA 5I4IA 1PT9A 4IL6U 1IV8A 1F06A 3RQSA 4GPAA 2TMYA 2PX4A 3LXRA 2WINI 1RRFA 3BIOA 5JOQA 1X13A 2NUPB 1AB5A 4OJ5A 3IBFA 2Z6VA 2R2GA 4WCFB 4B6PA 2W5UA 3WLMA 1G21B 4NARA 5HILA 2BGKA 3L4BC 3K70C 4DC0A 4BLPA 2V03A 2XGMA 4MARA 5CU7A 3C23A 3LLSA 4EFNA 5E9AA 3H0KA 1X3SA 4WOJA 1UKEA 5B6JA 2DE0X 4WWHA 3RFUA 3SBXA 2AGPA 5LWHA 1PWHA 4MRVA 5HUJA 3HEBA 3UWSA 1C4KA 3ER9A 3AF0A 3BTOA 5TX7A 1D6JA 1BN7A 3TAHA 3BSWA 3G2HA 3GFRA 4ZT3A 4BX9A 1U5BA 4XUCA 2XNCA 1U8TA 1JZSA 3OBBA 2HX1A 3PHGA 3FYSA 3Q40A 2J4CA 1NVXQ 3CZAA 1UKZA 5TY0A 1B16A 4HT3B 4E2ZA 1U2GC 4JUBA 4TLMB 2ZAOA 5T4EA 1WEHA 2CD7A 3MWDA 3CRXA 3A4NA 4IFIA 3CONA 4GXTA 2FLWA 4WNIA 3B1VA 1U2TA 3EDQA 1E96A 2VDWA 4LJRA 3T9BA 3E2EA 5ALZA 5ALUA 3RSLA 3GZNB 4Q9LA 5C7LO 1PYGA 1IIPA 5A0TA 4RSRA 1RMTA 5CLJA 1H94A 1FTNA 1E7RA 2JEZA 1P4HA 5HIMA 4PLPA 1ULBA 2XYVA 3HCPA 1T3HA 4UEWA 4G0PA 2YYSA 4UB8U 1KEZA 4DV1B 3LKZA 2P0EA 4J29A 5KFFA 1GSOA 4ZDWA 1ESMA 2P4UA 2VZ0A 5C7OO 3M4XA 4Y98A 3DT6A 3I76A 1FTSA 2YH2A 1Z2AA 4WBSA 2DTDA 3DBOB 3KYIB 1QX3A 2CY0A 2ABWA 3NRCA 1N56A 3THYB 2JV3A 1H8HD 2A1UA 4LJKA 5JTTA 2VLBA 3FPLA 5AVKA 5AI6A 4UTOA 2B98A 7ICJA 1XJWA 3ICWA 1P0FA 1KEEA 4USAA 3PIIA 3DFIA 2F43B 3TQRA 5JDCC 3DLHA 1UBEA 1G7TA 1UPUA 2O3JA 4G5SA 1UIMA 3QV1A 4YP7A 1JI3A 3G23A 4WECA 2QD3A 3DFKA 5J47A 4O33A 1T2UA 4OGWA 2X0EA 5K1ZA 1ZL2A 5C4GB 4G5YA 4CVNA 4OXXA 3ZHBA 4QSHA 4GKKB 1TAHA 3F9RA 4IICA 3ERCA 2JBWA 4DMKA 3CW2A 1TO1E 2C78A 3JQGA 1LDYA 3JAKB 5BOSA 2IV7A 3GFGA 3HKZF 5H81A 4Y18A 4DDUA 1HNWB 2N0SA 4JJEA 3I92A 2D3DA 1CB7A 4MF2A 5KL1B 1O58A 1ADBA 4BNHA 1KRXA 1NBME 1Y3AA 3MWJA 3UVEA 4PC2A 1EK0A 3GG2A 5DGTA 2WF5A 2HOIA 4NZPA 2X1VA 5IAOA 2RGDA 3MN1A 4QTZA 2Z3ZA 3ICPA 1LI4A 3Q7SA 3ENZA 4DM4A 2RD2A 2KICA 3INTA 4US0R 3O3MB 3RBZA 4Z9BA 1WW8A 1N5DA 5J2JA 4P7BA 2AJ8A 3ABOB 3P9PA 1FS6A 2ZI4A 3VTZA 1A72A 1OLSA 3QOXA 1F6BA 1I2BA 2Y68A 1JMKC 4KMOB 2I34A 1N6LA 4ETWA 3DM9B 2OBMA 4FPXA 1OREA 5EJFA 1AS2A 2SNIE 3PNQA 4LXYA 2DKFA 3P0RA 1QYCA 2P2DA 5JE8A 3QU7A 2CLOB 4B80A 3KPUA 3QF4A 1E20A 1CP3A 1NXPA 3USES 2OO3A 2PX3A 3QLJA 4BKRA 3V1NA 1UWLA 1G60A 5IHXA 1NWHA 4E5UA 1OBFO 3F96A 1IN6A 3K0AB 5LUAA 1QQ7A 1O97D 2XI9A 4RPGA 1H8HA 1D2NA 3ZKWA 1Y4SA 2XGPA 3W90A 3DEZA 2W2PA 4BO0A 4JMPA 2YWJA 2PGLA 4ADSG 4QRDA 5EFOA 5L3QA 3GJ0A 1JIVA 3E0FA 4AECA 1GSHA 1BH2A 1JLKA 4AJ1A 4ZK2A 3OU6A 4RPZA 4L2IA 4EF4A 3ZN2A 4YPVA 3TOSA 5CVEA 3FRIA 1PNTA 2J6BA 4PXSA 4DCVA 1RYUA 2X42A 1YTUA 2RK3A 1VMKA 4BX2A 3KAPA 3VNUA 1QB8A 2F3NA 5EJIA 4D8YA 4XUDA 4J9KA 4TQ9A 5D01A 2XUAA 2IYEA 4QWBA 1UM9B 3CRZA 2UYYA 4HSEA 4Q0MA 3WMRA 4LE1A 4XGRA 3PCXA 1CQZA 4MAFA 3N7TA 3EF3A 2JEOA 2QD4A 3D7RA 4Y2TA 1R0WA 4BMCA 5JNVA 1SPBS 4KQ1A 4XGKA 4BJ5A 3ALRA 3QGMA 2GPYA 4FCTA 1Z82A 3WOVA 2I7XA 4F4FA 2Z30A 2EW1A 2PFPA 2H4WA 4DUGD 3R23A 1V5FA 1WXFA 1YO6A 4ZVOA 3RH5A 1Z2NX 5E4FA 3W7VA 3QNMA 2GETA 3QVSA 3T38A 4K9MA 1GRCA 1UJNA 2UZ0A 1C0IA 4DBVO 1EVQA 1SEVA 3EX7C 5TE9A 2ZXHA 2C22A 4AULA 3UWPA 1J24A 2PGDA 4RS3A 2QQFA 3BCHA 1JKJB 4EBFA 1R0KA 1UFKA 1VECA 1I01A 3AZPA 3QBVA 4GQBA 4PBRA 4H7JA 3I62A 3HKBA 2QP9X 2Z04A 4EJFA 2EKQA 2QHXA 3HH8A 4R8LA 1RCFA 2W0SA 2EH9A 1ZGBA 2ZREA 5JCPA 4C7OA 1MO3A 3DAFA 4EHFA 3ICXA 1EE1A 4XDGA 5DBFA 4IIHA 4WBXC 3QEBZ 1T5OA 4X1YB 4RQBA 5A71A 3F78A 5E2BA 1UODA 4G4JA 4ZOEA 4EA8A 8ICAA 1CUHA 4MDHA 4NL4H 2ZSBA 3WSTA 3F6PA 1L5WA 1TFUA 2OHIA 4JC8A 4NENA 4KR3A 4BLUA 4FXOA 1KBQA 1E6UA 3UTDA 2Z2XA 2VJBA 1L5RA 3GLFE 2C0CA 3OT1A 1M6NA 2EKDA 4J0KA 1OXJA 2AL7A 4OXRA 3EZLA 3VAZA 1R4NB 2GKSA 3KTAB 4Q5IA 1W88A 2BJHA 1FP2A 4NSNA 5CLFA 1JAHA 2Q6VA 5KQSA 5GZ1A 1S76D 4NDZA 1O95C 2PGJA 3RYCB 3MF4A 1KMQA 4CKCA 1BNCA 4QIHA 4ER6A 1QQBA 4FINA 5F9HA 1GO3F 1YZQA 2HHUA 1K97A 2AXQA 5F2OA 4IVRA 4D0GA 2KQUA 4EGCB 3A70A 3FM9A 3GFOA 4YRDA 4M0EA 4PO3X 2HOQA 4X84A 1QZXA 4YN3A 1EWTA 3G0OA 3VR5A 4E2FA 2ZRHA 1UJBA 2F48A 3DWFA 3K73O 4PONA 5I9SA 1E2EA 1U2PA 4P3NA 3NHKA 3EIOA 4GP6A 5CH3A 5B3LA 1QO7A 3AKDA 5I7SA 1NVMB 3RRGA 4B1FA 4BB5A 4R51A 3LHKA 2R47A 1U0OC 1JJFA 2HPZA 4G1CA 1RXCA 4L5IA 3ZHQA 5K0LA 4RVHA 2YOHA 3UJHA 1NPYA 1RJEA 4HOYA 2OQIA 4DWOA 4LHYA 1GA6A 2ENWA 5GTDA 5ALDA