3K4GA

Crystal structure of e. coli rna polymerase alpha subunit c-terminal domain
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
83
structure length
78
Chain Sequence
PEFDPILLRPVDDLELTVRSANCLAEAIHYIGDLVQRTEVELLTPNLGSLTEIDVLASRGLSLGMRLENWPPASIADE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the Escherichia coli RNA polymerase alpha subunit C-terminal domain.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Transferase
molecule keywords DNA-directed RNA polymerase subunit alpha
total genus 18
structure length 78
sequence length 83
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2009-10-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3k4gA00
2DPJA 4O3PA 3MR2A 3RBEA 3C2LA 4UB4A 4F50A 2ASDA 4RPYA 5HNKA 1S9FA 1S0OA 1KSPA 5J0RA 3C1ZA 4M6WA 5KFEA 1HUOA 2KTQA 5KFBA 1QSSA 1T7PA 5KFWA 4MEYA 2IA6A 1SZPA 5IIJA 5BPCA 1AROP 3RH5A 5J0WA 2R8HA 4O3QA 1JX4A 3RTVA 2FPKA 3G6VA 1NKEA 4QWCA 2W8KA 1ZQTA 2HW3A 4ECRA 4O0IA 8ICBA 2BR0A 4QWEA 3RAXA 9ICOA 4DQIA 3M9MB 4KLGA 4RNOA 5D49A 3PW4A 4I28A 4XRHA 1WCLA 4ECVA 4DFKA 4F4ZA 1RYRA 3JPSA 4F4XA 3THVA 1NK7A 5CA7A 2ATLA 5KFNA 4YN4A 4FS1A 2IMWP 4LZDA 1K1SA 3RJJA 2AGPA 3PO4A 2B21A 5J2FA 1T8EA 5J0QA 4YP3A 5J0TA 1UA1A 3GILA 3C21A 1Y88A 3MABA 2W9CA 4F93B 1DOQA 2NRVA 4DQRA 3M8SA 5IINA 5DBCA 4DQQA 3TQ1A 1CUKA 5KT7A 4RU9A 9ICEA 4UAWA 5KFYA 4KLQA 3EZ5A 5KT6A 4J9RA 1QSLA 3PW2A 5J2EA 4UQGA 1BPYA 1KTQA 2V4QA 2C22A 4NLGA 4KLHA 8ICAA 4I2DA 3RRGA 3RAQA 5DLFA 2RDIA 5J0PA 5DG8A 4CCHA 2XGQA 4XQ8A 2OWOA 1ZQZA 2LYHA 4QZIA 4DS4A 3PY8A 3PR5B 2R8KA 3C1YA 4DL5A 4O9MA 4F4YA 2JEJA 4M9NA 4KLEA 8ICRA 2UVWA 2AGOA 3IHQB 4IQVA 4JV0A 5J0SA 3BQ1A 2VA3A 7ICQA 1ZQLA 5DQIA 4ED1A 4I2CA 8ICPA 9ICQA 4DWIA 2ZJ5A 4ECTA 5J2CA 5DB6A 3JPOA 4GLXA 3N4MB 4Z6EA 4M2YA 4PGXA 4R64A 3UQ0A 5DB9A 2W9BA 9ICIA 4QZGA 3QEBZ 4XUSA 1NK4A 4ED6A 4B9VA 2UVVA 2ZTCA 4RQ3A 3MGIA 4K4GA 7ICMA 3AU2A 3KHRA 8ICWA 4JWMA 2HHVA 4M9LA 1Z00A 3GIJA 1BGXT 5L9XA 1HUZA 2BKEA 4YXMA 4R8UB 2AQ4A 1U45A 4J9KA 2MUTB 2BPGA 5EOZA 4QZBA 1XS9D 1U47A 5HMLA 3JPNA 4I2HA 3UXNA 4NY8A 2F1JA 5D46A 5DLGA 1T4GA 4O3NA 5BOLA 4JUZA 3Q8SB 5L1IA 3T5HA 3Q8KA 1S10A 4M9JA 3JPPA 1ZQKA 3RH6A 4O3OA 2AGQA 1SL0A 4BXOB 9ICLA 3RB0A 5DGAA 3B0XA 3PW7A 1EXNA 3Q8RB 2XY6A 3GV8B 4P4MA 1ZQNA 4DLEA 4M6WB 3TI0A 3JPQA 3BQ2A 4UB2A 2J6TA 1ZQSA 3FDSA 3ISDA 2BDPA 5KFZA 1SL2A 4IRCA 1A77A 4YCXA 3OJUA 3ETLA 4DQSA 4Z6CA 5IIKA 3TFRA 5JUMA 1ZQHA 1PZNA 4BWMA 2BPCA 1NK8A 4QZCA 1D8YA 9ICGA 7ICJA 5J0YA 5KT4A 4DEZA 4DSIA 3PV8A 2FMQA 4J9LA 3HPOA 1ZQRA 2KFNA 3C2MA 4B9LA 3PMNA 5KFLA 2XGPA 3RJIA 2BHNA 9ICNA 3HW8A 1XSNA 4DF8A 1COOA 3QZ8A 4FS2A 3PR4A 1X9WA 4I2JA 4GXJA 4GC6A 2C2RA 3SV3A 9ICUA 3AUOA 3RH4A 5KT5A 3RB4A 4B9UA 4IR1A 4Q43A 7ICIA 2W9AA 1JXEA 4RQ5A 2FMSA 1RXWA 5CJ7A 2R8IA 3LDAA 3RJKA 4J9MA 2PXIA 2UVUA 4NXZA 5J2AA 8ICXA 3PNCA 4ED3A 1IM4A 4O5EA 5KFFA 2W9CB 3SI8A 2JZBA 2PI4A 7ICFA 1X2IA 5HHIA 3TAPA 3ZDAA 2KFZA 9ICJA 4J9NA 3ZDEA 4I2EA 3V7JA 5HP4A 1X9MA 1H38A 2W9MA 4KLSA 2ZUCA 2PFOA 4C8LA 4DQPA 4MFCA 2MAXA 5DB7A 8ICQA 3C5FA 5J2IA 1D8LA 4KITB 3ZDBA 8ICYA 1A76A 4YD1A 2F1IA 1ZQUA 2ALZA 2ZTDA 4Q45A 4TUSA 7ICNA 4F92B 3BDPA 2VANA 2A1JA 3K4GA 3H8SA 4I2IA 2FPLA 4Q44A 1KDHA 8ICTA 4F8RA 3T5KA 4B9TA 9ICHA 2R8JA 4YFKA 5L1LA 4DOBA 4J9OA 1ZQDA 2PI5A 7ICHA 1RYSA 1ZQIA 1L3TA 3T5LA 1TFRA 1CEZA 4FBUA 5DGBA 1UT5A 4M9GA 3PX0A 4KLTA 1XSLA 4RPXA 2XCPA 3GIKA 4MFFA 4JV2A 3UQ2A 3MDAA 3AU6A 4F5PA 2I1QA 1XSPA 2MUTA 2J6SA 9ICRA 4P4PA 2FLLA 2Y1IA 1SL1A 1BPBA 2VA2A 9ICCA 2XY7A 1TK8A 4DF4A 5KFAA 3M9OB 4MEXA 5KFRA 4B9MA 4YD2A 5KG2A 2XC9A 3LK9A 1D9FA 4MFAA 5KFIA 3E2EA 2AJQA 2A1JB 2HHUA 8ICNA 8ICIA 5C5JA 4RZRA 2JEGA 5L1KA 1U9LA 3OHBA 3MR3A 3TFSA 5KFVA 4KLJA 4UB5A 4J9PA 2BCQA 4P2HA 1KFSA 4PHPA 3GFKB 3C2KA 1S97A 1KFTA 4TUQA 3GIIA 3RB3A 1SKSA 4YMNA 5KFDA 2ASJA 1L3VA 4JK1A 2XCAA 3GQCA 1ZJMA 2HVHA 3V7KA 5IIMA 2P6RA 3Q8QB 1ZJNA 4ELTA 8ICZA 1XO1A 3RJEA 4PGQA 4C8NA 1ZQYA 4RQ2A 4ECUA 4M04A 1Z00B 4PHEA 3ZD9A 4QW9A 4F2RA 1X9SA 3GIMA 4DL6A 4QWBA 5KFTA 2Y1JA 1MC8A 7ICKA 4DL3A 4ECYA 4F3OA 4FBTA 4YMMA 5KFGA 1QTMA 7ICGA 4IQUA 9ICTA 2AQ0A 3QZ7A 4EBCA 4ED7A 3UXPA 3PVXA 3OHAA 4YVZA 3HX0A 2IHNA 2IHMA 4Q8EA 1ZQFA 3V72A 5CP2A 4KLDA 4F91B 4JWNA 4KN7A 4Q8FA 5F9LA 3HP6A 4F4WA 1V9PA 4RQ0A 4F4KA 1N48A 1ZYQA 8ICGA 5HHHA 4DSEA 1LV5A 4DFJA 4RQ1A 3KHHA 8ICOA 1Z3EB 1NK6A 5CB1A 1K1QA 3NGDA 4YQWA 4EZ9A 1JXLA 4B9SA 4Z6DA 3RBDA 4NM2A 4RUCA 2W9BB 4DS5A 4EZ6A 2RDJA 4R63A 4LZGA 1ZQWA 5DKWA 9ICBA 4QZHA 2P6UA 1ZETA 3FYHA 5KFXA 2ASLA 4QZAA 8ICEA 4ECXA 3N97B 4MF8A 2XY5A 1TKDA 4ELVA 2C28A 4DO9A 2BCVA 3PMLA 5KFCA 4C8MA 3EYZA 2IBKA 2KZZA 4QZ8A 5EWFA 4DL4A 1BPZA 2HHWA 5HMMA 4QZFA 1UT8A 3ZDCA 8ICCA 5KFQA 1L3UA 7ICEA 2AU0A 1XC9A 5J2HA 4QZ9A 2HHSA 4IQWA 8ICLA 5J0XA 5J2BA 5KFSA 4GC7A 2DPIA 3RJFA 3K75D 5KG6A 3HT3A 2I9GA 3PW0A 2DFLA 2PFNA 4I2GA 4NLNA 8ICMA 1ZQBA 5EWEA 5DQHA 4X5VA 4DFPA 2GWSA 1MQ2A 3RJGA 4RPZA 7ICRA 2FLPA 2W8LA 4P4OA 5KFUA 4YMOA 1JIHA 5TZVA 3SV4A 4RNMA 3V6KA 4F5RA 4B9NA 2BPFA 2PFPA 2ISOA 3RR7A 3SZ2A 1S0NA 5KG4A 1XWLA 3NTUA 4KN4A 4E0DA 5KG1A 5J2KA 1U48A 3EWAA 4DLGA 3RRHA 3JPTA 4ECWA 1LB2B 2BCUA 4KLFA 4M0AA 2HHQA 1T3NA 4UAZA 3GV5B 2V9WA 4IR9A 1S0VA 2R8GA 4YR3A 1SKRA 4TURA 2KZ3A 1BVSA 2HVIA 2NRWA 3JPRA 1ZQEA 4UBCA 2Q0ZX 8ICFA 5IIIA 7ICSA 2NRXA 4DOAA 2FMPA 4QW8A 4PGYA 5KG3A 3H4BA 4ED8A 2BQUA 8ICSA 9ICVA 9ICXA 3MGHA 1NJXA 5KT3A 4I2AA 1QLNA 1S76D 4RT3A 5DBBA 3ISBA 3C23A 2ISPA 4K4HA 1NOMA 3LWMA 3EPGA 5CWRA 4ED2A 4DSFA 4DL2A 4KLUA 5KG0A 4BWJA 5DDMA 1D9DA 4DL7A 1RPLA 1MQ3A 4RQ6A 8ICVA 5DG7A 1L5UA 5L1JA 4YR2A 1JMSA 5CHGA 9ICSA 3TARA 1NJZA 9ICAA 3PX4A 7ICPA 5J2JA 4ED0A 2P66A 5DB8A 4I29A 9ICWA 4Z6FA 3T5JA 5KFJA 2NRZA 4R8UA 1TK0A 4QZEA 4EBEA 4C8KA 3H8JA 4ECQA 1XU4A 1NKBA 1B43A 4EYHB 2BCRA 4GXKA 1B22A 1BPEA 1ZQQA 1S0MA 5KTQA 4M9HA 3LWLA 3OGUA 5DDYA 4NM1A 4O3RA 4KLLA 5J0UA 4ECSA 4DSJA 4K4IA 4ELUA 2KZMA 4TQSA 4BGDA 2ZUDA 4YXJA 4IRDA 4I2FA 3V6JA 2HHTA 1BPXA 4F5QA 3ISCA 1NKCA 2ZTEA 2JEFA 1S77D 4DFMA 4I27A 4O5KA 4UBBA 4O5CA 5CR0A 4R65A 4J9SA 1RXVA 4O3SA 3PW5A 7ICVA 4F5OA 3MR5A 2C2EA 5IIOA 4QWAA 1WCNA 1NK5A 4JV1A 2H5XA 5KFPA 4ZH4A 2V4RA 3PX6A 1KFDA 5DQGA 3EW9A 1KEJA 4PH5A 1NK0A 2UVRA 2C2DA 4KMUA 4M47A 3ZD8A 1ZQJA 1TAQA 5KFKA 5DBAA 3RB6A 4NLZA 4IRKA 5J0OA 3IM1A 1JN3A 5D4BA 1KRPA 4DSLA 4RQ4A 4F2SA 4EBDA 5KFHA 1RZTA 4I2BA 1TK5A 4TQRA 4J9QA 1ZQXA 4KLOA 1UA0A 3B0YA 2JEIA 4UAYA 2FLNA 3Q8LA 2BCSA 4FO6A 4KLMA 4RT2A 4RQ7A 2J6UA 4PHDA 3UXOA 4EEYA 4BXOA 2PFQA 1ZQCA 2BQ3A 1HJPA 9ICKA 7ICLA 5DG9A 2ZJAA 4EYIB 2JZBB 2F1HA 8ICKA 1IXRA 4C8OA 3UPQA 5KG5A 3MR6A 2ZUBA 4GXIA 1TAUA 4RUAA 4HYKA 4RNNA 4IQTA 3V7LA 5EWGA 1U4BA 1N56A 4G3IA 2WTFA 4LVSA 3MBYA 2ZJ8A 3H7IA 4YR0A 3Q8PB 5BOMA 3M9NB 4DOCA 1QSYA 1NJYA 3HWTA 3ZDDA 3V6HA 1ZQMA 4ECZA 4QZDA 4QWDA 7ICOA 1ZQOA 2HHXA 5J29A 4BDPA 4UB3A 4R66A 1ZQAA 9ICPA 4MF2A 4YG2A 5KT2A 4XA5A 3GV7B 3EPIA 3QEAZ 4DSKA 2KN7A 3OJSA 3H8WA 3QE9Y 3H4DA 2BGWA 5KFMA 1NJWA 1NK9A 2BQRA 1L3SA 2FPMA 3GDXA 3MDCA 3OSPA 1MSWD 4NLKA 5KFOA 1U49A 1C7YA 4TUPA 3BJYA 7ICUA 3H40A 2VA8A 3C5GA 3T3FA 5F9NA 3Q8MA 1BPDA 5J2GA 3MFIA 3BQ0A 3KTQA 2NRTA 3KHGA 3SYZA 3G6YA 4RQ8A 1KLNA 1ZQPA 4PPXA 5KG7A 4KTQA 3G6XA 4F5NA 3RJHA 1TV9A 2XO7A 3TANA 8ICUA 3RR8A 7ICTA 4UB1A 3KHLA 3BQTA 4PHAA 1SKWA 1DGSA 8ICJA 8ICHA 3ORYA 1TVAA 5IILA 4KLIA 1ZQGA 5J2DA 3PO5A 3M8RA 9ICFA 1ZQVA 3MFHA 2M9NA 3OSNA 9ICMA 3TAQA
chains in the Genus database with same CATH superfamily
3RBEA 3C2LA 4UB4A 2ASDA 5HNKA 3B9JA 5KFBA 3QU4A 1T7PA 5ALNA 3RH5A 3UM9A 2R8HA 2XIDA 4O3QA 3RTVA 2FPKA 2HW3A 2PMZC 2KJ9A 5F3XB 3KD3A 4QWEA 9ICOA 3BS5A 4Y2RA 5ALIA 5ALPA 4NWIA 1NK7A 3THVA 3A0BU 5CA7A 2ATLA 5KFNA 1A0PA 2RQ5A 5A0LA 1HEKA 1Y88A 3MABA 3H0RB 1DOQA 5ALKA 3M8SA 2LYAA 4DQQA 4UAWA 5KFYA 2LM4A 5J2EA 1BPYA 4Y2XA 8ICAA 4I2DA 2LBOA 2KKVA 5G5HA 3C1YA 5B66U 4CF5A 2H3FA 2AGOA 1O08A 1ZQLA 5DQIA 4DWIA 4ECTA 5J2CA 3JPOA 4Z6EA 3QEBZ 1O03A 5AI6A 4FFDA 8ICWA 2HHVA 3I28A 1Z00A 2KJ8A 3PSFA 1J97A 1HUZA 2G08A 4R8UB 3MGVA 2MUTB 3PSPA 1XS9D 4I2HA 4UAUA 5BOLA 4O3NA 2K4HA 3Q8KA 5L1IA 4M9JA 1SL0A 2ESEA 3U26A 3B0XA 2WB1F 3N28A 3H0LB 3Q8RB 1KBUA 4P4MA 3D2SA 1GO3F 2RP5A 3TI0A 3BQ2A 2BDPA 1A77A 2LPEA 5AKEA 5AKXA 2N1RA 3TFRA 3S6JA 4C4SA 2LHTA 1PZNA 1D8YA 2KIWA 4EENA 4DEZA 5AI0A 3C2MA 3ICXA 3RJIA 5TISU 3F5EA 1XSNA 5ALEA 5EE1A 3PR4A 1WUDA 5AM1A 4USAA 3SV3A 3RH4A 5KT5A 1JXEA 2FMSA 5CJ7A 2UVUA 5J2AA 2ES6A 5HHIA 9ICJA 3ZDEA 2EQYA 2W9MA 4KLSA 4C8LA 4MFCA 2YMMA 3T79A 1D8LA 5AIAA 1A76A 2F1IA 3BDPA 2VANA 4Q44A 3H8SA 2KIVA 3VC8A 5H2FU 2W55A 4EEKA 5L1LA 1ZQDA 2I6XA 4J9OA 2PI5A 7ICHA 1ZQIA 1CEZA 2KK0A 4M9GA 3PX0A 4KLTA 5AK3A 2HBKA 1XSPA 2MUTA 3TKAA 1BPBA 3UMBA 4DF4A 4MEXA 4YD2A 2AJQA 3IV6A 5KFIA 8ICNA 4QIWF 8ICIA 4ICAA 2JEGA 1N5XA 1U9LA 3MR3A 2CXYA 4UB5A 4P2HA 2G07A 3GFKB 1KFTA 1K5OA 2ASJA 2WAQC 1ZJMA 3V7KA 3R9KA 3RJEA 4FZNA 3ZD9A 1X9SA 1KN5A 1HIWA 1MC8A 3C28A 4DL3A 5KFGA 2ZIWA 4IQUA 4EBCA 2JH7A 2EH9A 4YVZA 3HX0A 2IHMA 4OJOA 1V9PA 3L4PA 4DFJA 1NI3A 1NK6A 2D6FC 1K1QA 4EZ9A 4Y2QA 2P35A 1JXLA 1RYUA 2WF7A 5ALUA 2WFAA 4RUCA 1PVQA 5DKWA 9ICBA 5ALLA 3FM9A 8ICEA 4ECXA 4MF8A 2XY5A 2ZIUA 4DO9A 3EYZA 2HBMA 5EWFA 1BPZA 1UT8A 4OCZA 1L3UA 4G9BA 2HHSA 4IQWA 5J0XA 5J2BA 5KL8B 4GC7A 2I9GA 4I2GA 3BQ7A 5EWEA 4X5VA 5AKZA 3AN1A 2OM6A 2YQEA 2FLPA 2W8LA 4P4OA 3SV4A 4RNMA 2BPFA 2ISOA 3SZ2A 1S0NA 2KD1A 2BCUA 4ECWA 3M6KA 3SEIA 4AP9A 1BNOA 1BVSA 2HVIA 1N61A 3JPRA 1ZQEA 4NV0A 2HOIA 2Q0ZX 1P7DA 8ICFA 1T3QA 2K8AA 4DOAA 5ALMA 4QW8A 8ICSA 2BQUA 1F44A 1QQ5A 2ZIXA 4I2AA 1SXEA 4EX6A 5ALSA 2FDRA 5ALQA 4ED2A 5DDMA 1LVHA 3RF9A 1RPLA 1MQ3A 4RQ6A 3SR6A 1JUDA 2Y9TA 2ZIVA 1NJZA 9ICAA 9ICWA 4I29A 1X6IA 3QXGA 1XU4A 1B43A 4EYHB 1Z1BA 2XVTA 2K8BB 1S0MA 1FFUA 4AYBC 4K4IA 4ELUA 2E8NA 1T94A 2YMPA 2YX8A 1F0MA 4F5QA 3QUBA 3ISCA 2JEFA 4O5CA 4R65A 4J9SA 3PW5A 2C2EA 2Y9UA 5KFPA 4KMUA 3ZD8A 4BUGA 5AI9A 1KW4A 5DBAA 4NLZA 5J0OA 2F3NA 2KSOA 3KBBA 4EBDA 1RZTA 3B0YA 3TADA 2VIXA 2BCSA 5L1MA 2W43A 3L3FX 4BXOA 1ZQCA 4EYIB 2W7PA 2BDUA 4C8OA 3UPQA 5KG5A 4RUAA 3V7LA 2CPRA 2D8CA 4Y2JA 3HWTA 3ZDDA 3V6HA 5HR7A 1ZQOA 2HHXA 4Y2PA 3H0MB 4R66A 9ICPA 4DFDA 3LVVA 2OH2A 3EPIA 1RM6C 2EANA 1NK9A 2BQRA 5KNIA 5KFOA 2KOBA 3H40A 3Q8MA 5J2GA 1QH9A 2FE9A 2E8PA 4PPXA 4QJFB 3ZI4A 2VJ4A 2VKQA 2XO7A 5AK4A 2G5HB 2ZIUB 7ICTA 3BQTA 1TVAA 2NO5A 4O3PA 4PL2A 4F50A 5AKHA 4RPYA 1S9FA 5J0RA 4M6WA 2KTQA 4J03A 1URJA 4MEYA 2IA6A 5IIJA 1Z1VA 5J0WA 1JX4A 1DXSA 4QWCA 1ZQTA 4O0IA 8ICBA 2E8MA 2QB0A 1SV4A 5ALOA 2AHOB 4DQIA 2WF6A 5J8YA 3PW4A 5AKIA 4P0QA 4XRHA 4F4XA 2KV2A 4FS1A 4YP3A 1SIJA 3C21A 1L7OA 5KT6A 3PW2A 4EX7A 2G5IB 4UQGA 4GFJA 1KTQA 2C22A 4NLGA 3RRGA 4UW9A 1UHUA 3RAQA 2YMLA 2KNJA 2OWOA 1ZQZA 2LYHA 4KMOB 5AKGA 4JV0A 2JXJA 4ED1A 5EE0A 5GTHU 3OTQA 2W9BA 4QZGA 2R18A 1NK4A 1AQ6A 1WG8A 2GLEA 3MGIA 2JH1A 4DCCA 7ICMA 3AU2A 4JWMA 4M9LA 1BGXT 1X9XA 5L9XA 2BKEA 4YXMA 2EAMA 2LKYA 5HMLA 5ALGA 5D46A 5DLGA 3Q8SB 1S10A 1RG6A 2YB1A 4O3OA 2AGQA 4OO1J 4UATA 5DGAA 4NLBA 4DLEA 3DEEA 4OJLA 2J6TA 5AI4A 3FDSA 1SL2A 2HMXA 2H3ZA 1J2MA 2W03A 2BPCA 7ICJA 4Y2UA 1B4FA 4DSIA 3PV8A 2FMQA 1ZQRA 4B9LA 5KFLA 2XGPA 2PKEA 3QZ8A 3E58A 4GC6A 4GXJA 2W54A 3RB4A 4WJ3B 7ICIA 1SWWA 2XI9A 2O6KA 4U6PA 1RXWA 3RJKA 8ICXA 2AXTU 3PNCA 1IM4A 4O5EA 5KFFA 2W9CB 3WU2U 3TAPA 2KFZA 4J9NA 3V7JA 2DL0A 5HP4A 4CDGA 1H38A 5G5GA 3D2NA 2F77X 3UMCA 3ZDBA 8ICYA 1SZHA 4TUSA 7ICNA 4F92B 3K4GA 4I2IA 4F8RA 2R8JA 4DOBA 1RYSA 3SENA 1RQLA 3GIKA 4JV2A 1L7NA 3M7DA 3MDAA 3AU6A 4F5PA 3N7PD 9ICCA 2XY7A 2LI6A 2KVCA 3WKDA 2XC9A 3LK9A 2OEHA 2OHFA 2A1JB 5C5JA 5L1KA 3HKZF 3OHBA 2K4EA 3C29A 4KLJA 4J9PA 2BCQA 5JTIA 1TAMA 3C2KA 5KFDA 5IIMA 3BZKA 1ZQYA 5ALDA 5ALWA 4PHEA 3BZCA 4QWBA 4ECYA 1QTMA 3NS1A 2CN1A 2GO7A 4Q8EA 4JWNA 3SQIA 4Q8FA 5F9LA 4F4KA 8ICGA 5AK6A 1ZYQA 5HHHA 1LV5A 3WKBA 2ZXIA 8ICOA 4B9SA 1IG6A 1SV0A 3RBDA 4NM2A 2W9BB 4DS5A 4EZ6A 2RDJA 4R63A 3AM9A 4LZGA 1ZQWA 4FZMA 2M0NA 2ASLA 4QZAA 1SB3C 1NZBA 5E79U 4ELVA 2C28A 4ACOA 5KFCA 4QZ8A 5HMMA 8ICCA 5KFQA 5J2HA 5AM2A 2MU2A 3QX7A 3K75D 1YZ7A 3PSIA 3PW0A 3AMZA 2PFNA 4PL1A 4DFPA 7ICRA 3A0HU 3QNMA 1SGGA 5KG4A 4E0DA 1LB2B 3EWAA 4DLGA 4M0AA 2HHQA 1T3NA 4TURA 2NRWA 2NYVA 4UBCA 5IIIA 1WYGA 7ICSA 2YB4A 4PGYA 1QQ6A 2HSZA 2YN4A 1X42A 1S76D 5ALFA 5DBBA 5JRTA 3C23A 1RDFA 3FAHA 4DSFA 3LWMA 4UASA 5B5EU 4DL7A 5DG7A 1L5UA 4YR2A 5CHGA 5AKLA 9ICSA 7ICPA 3PX4A 5J2JA 2P66A 4Z6FA 1DK3A 5KFJA 2NRZA 1TK0A 5AI5A 4QZEA 4C8KA 2EZZA 4ECQA 1BPEA 1ZD4A 4NM1A 2QKQA 5J0UA 4ECSA 2MRLA 2ODGA 3IG5A 2ZUDA 2HHTA 1UCVA 2QB1A 3F2CA 4LJXA 1S77D 2ZTEA 4F5OA 4US9A 1B0XA 1WCNA 2H5XA 3HRDD 2V4RA 2HBJA 1KFDA 2EAPA 4PH5A 1KEJA 5DQGA 1TAQA 2LM1A 4IRKA 5AM3A 1JN3A 4DSLA 4F2SA 2HDOA 2IOHA 5HR6A 4IC9A 3F53A 4TQRA 4J9QA 1ZRMA 2JEIA 4UAYA 2E8OA 3Q8LA 2YMQA 3NASA 4KLMA 2OYYA 5AM5A 4EEYA 2PFQA 2BQ3A 1HJPA 5DG9A 3WK7A 2JZBB 2F1HA 1IXRA 2W04A 2ZUBA 1TAUA 2IOFK 4RNNA 4BJQA 4UAVA 2WTFA 4LVSA 1QSYA 4YR0A 3H7IA 2QARB 3Q8PB 3M9NB 4DOCA 1DK2A 2QLTA 5FP0A 5J29A 2OCEA 1ZQAA 5KT2A 4XA5A 3GV7B 1PVRA 3QEAZ 4DSKA 3QE9Y 1N2XA 2KKPA 1L3SA 2FPMA 3GDXA 3MDCA 1MSWD 1U49A 1C7YA 1PUZA 3T3FA 5F9NA 3MFIA 3BQ0A 3KTQA 3IG8A 5KAFU 1KLNA 3RJHA 8ICUA 1DGSA 8ICJA 8ICHA 4U7CA 1SV0C 4KLIA 5J2DA 3M8RA 1ZQVA 2M9NA 3TAQA 2DPJA 3MR2A 3SAFA 1N63A 3WK8A 4C4TA 3SAGA 1BNPA 5ALRA 4C4RA 2RHFA 2QB0B 2NO4A 5BPCA 2F2AB 5CEHA 3G6VA 1L8OA 2BR0A 3PSTA 5AI8A 4NL9A 1L8LA 3CNHA 4RNOA 5D49A 4ZOHC 4ECVA 2EDUA 4YN4A 3ED5A 2IMWP 4LZDA 1K1SA 2AGPA 2B21A 5J2FA 5J0QA 5J0TA 1UA1A 4FZLA 4B6JA 1PK1B 4DQRA 2NRVA 5DBCA 3TQ1A 4RU9A 5KT7A 4KLQA 3F2DA 1QSLA 4J9RA 2V4QA 4KLHA 1L7PA 5DLFA 2RDIA 5J0PA 3NRZA 4CCHA 2HCFA 4XQ8A 3KOOA 3PY8A 4UARA 2R8KA 3CW2C 4O9MA 1VDVA 1ZXIA 5AKYA 2Q4TA 2JEJA 2DQNB 2MSNA 4KLEA 8ICRA 4IQVA 3BQ1A 4I2CA 8ICPA 9ICQA 2ZJ5A 5DB6A 3N4MB 1JRPA 1WWVA 4PGXA 1IV8A 4R64A 3UQ0A 5DB9A 4XUSA 4ED6A 2ZTCA 4RQ3A 2DUYA 2HBLA 4K4GA 3KHRA 3GIJA 1KKXA 1PK3A 4J9KA 3LYSA 3WKAA 2H3VA 4NY8A 2F1JA 2KEYA 3CP8A 4JUZA 3T5HA 3JPPA 3F2BA 1ZQKA 3RH6A 9ICLA 3RB0A 2K4IA 2GH1A 3NVZA 3PW7A 2XY6A 3GV8B 2ZIWB 2W3SA 2KG5A 3QYPA 4BX9C 4UB2A 1ZQSA 3ISDA 5KFZA 4IRCA 3AEVA 3TACB 4YCXA 3OJUA 1Z19A 3ETLA 4BWMA 1NK8A 4QZCA 1Z4OA 5J0YA 5KT4A 4C80A 2H3QA 2A19A 4J9LA 3OPXA 2KFNA 2KSOB 3PMNA 1L6NA 3BS5B 1X9WA 4I2JA 2C2RA 3AUOA 4IR1A 1MA7A 2HOQA 1ZQ1C 3I76A 2R8IA 2LMRA 1OW5A 3SI8A 2PI4A 5ALVA 3ETRA 7ICFA 1VLBA 4CF4A 1X2IA 3ZDAA 2K4PA 1Q46A 2WHEA 2ZUCA 4DQPA 3NUQA 2MAXA 3C5FA 4KITB 4YD1A 5AM4A 2ALZA 2F8KA 4Q45A 2FPLA 1YT3A 2YY6A 3KZIU 3QU7A 4B9TA 4CNQA 1L3TA 4FBUA 1UT5A 2QARA 3HKZC 1XSLA 4RPXA 2XCPA 3UQ2A 4OJ5A 2I1QA 1Z4NA 4P4PA 2FLLA 3AL0B 2AH5A 2LYBA 2Y1IA 3CRXA 1TK8A 1CI4A 5KFAA 4B9MA 5KG2A 1D9FA 4MFAA 3TFSA 2I5HA 2DF4B 1KFSA 4Y2VA 4GIBA 3QUTA 3GIIA 4JK1A 3GQCA 2EAOA 2P6RA 2JV3A 1XO1A 3TADC 4PGQA 4C8NA 4M04A 4A8EA 4QW9A 3GIMA 3DV9A 4DL6A 7ICKA 2OXOA 7ICGA 4F3OA 9ICTA 3NRWA 2Z7JA 1A6SA 4ED7A 3UXPA 3PVXA 2KMDA 3V72A 5CP2A 4KLDA 4CGZA 3LVWA 1X40A 4RQ0A 4DSEA 4RQ1A 5AM0A 2DKZA 3K1RB 3VCBA 4CE6A 4RQMA 4EELA 4QZHA 3FYHA 5KFXA 4NL9C 4CRXA 2JHDA 1TKDA 3SD7A 4DL4A 4RQNA 2HHWA 2D3DA 3ZDCA 2AU0A 8ICLA 5KFSA 2K89A 1PK1A 5AIBA 2DPIA 3RJFA 9ICNA 5KG6A 3HT3A 1Q3UA 4NLNA 5DQHA 2GWSA 3RJGA 1MQ2A 4RPZA 2ZIXB 4YMOA 1JIHA 5GTIU 5KL1B 4F5RA 2PFPA 2ZXHA 3RR7A 4KN4A 5KG1A 5J2KA 1U48A 3RRHA 4KLFA 3JPTA 1S0VA 2V9WA 4IR9A 2R8GA 4YR3A 1SKRA 2FI1A 1DGJA 1LKYA 3IDWA 2FMPA 5KG3A 4ED8A 1NJXA 1ZOLA 5KT3A 4US8A 1Q3VA 3ISBA 2ISPA 4K4HA 1NOMA 3EPGA 5KG0A 4BWJA 8ICVA 3TARA 3T5JA 2GOLA 4R8UA 4EBEA 3H8JA 1NKBA 4GXKA 2E3TA 1ED1A 2L5YA 3LWLA 3I1YA 1JALA 4KLLA 4DSJA 3SAHA 1DRGA 5EE3A 4YXJA 2E5SA 2DBYA 3WK6A 3GU3A 1NKCA 4DFMA 4I27A 4O5KA 4OJ6A 5CR0A 2ZIVB 3GZFA 7ICVA 3MR5A 5IIOA 4QWAA 3K1ZA 3M6ZA 4KX3A 3EW9A 2C2DA 3D6JA 1KL9A 3RB6A 3IM1A 2JGAA 5D4BA 1KRPA 5KFHA 1TK5A 2CRXA 2WF9A 1ZQXA 3ONNA 4KLOA 1UA0A 2FLNA 1ZD2P 1N60A 4RT2A 4RQ7A 1F5SA 4Y2SA 1OXJA 3KKAC 4P0QB 9ICKA 2A1AA 3MR6A 1C20A 4GXIA 4HYKA 1N62A 4IQTA 1U4BA 1N56A 3IN5A 3MBYA 2ZJ8A 4F71A 1FEZA 2Y0SC 1S5LU 2MA1A 1XNSA 2JRZA 2KN7A 5C0YA 3H8WA 2DGZA 2KHVA 1X6JA 1NJWA 2H3IA 3OSPA 4NLKA 4TUPA 3PZPA 3BJYA 7ICUA 2JR5A 2VA8A 1BPDA 3SYZA 3G6YA 4RQ8A 1ZQPA 5KG7A 3N7RC 4KTQA 2F76X 3G6XA 4F5NA 1TV9A 1SKWA 4PHAA 1XO0A 3PO5A 9ICFA 3MFHA 3QUCA 1PVPA 2B0CA 1S0OA 1KSPA 3C1ZA 5KFEA 1HUOA 3KKAA 1FIQA 1QSSA 5KFWA 1SZPA 1AROP 1NKEA 3NVYA 1X66A 3RFAA 2W8KA 4ECRA 4MHVA 2ZG6A 4QNLA 3RAXA 2DKXA 3M9MB 5ALXA 4KLGA 3IRUA 4I28A 1WCLA 4DFKA 4F4ZA 1RYRA 3JPSA 3RJJA 4C0ZA 3PO4A 1T8EA 3GILA 2KVSA 5IINA 2W9CA 4F93B 2FJ6A 4AYBF 3EUB2 1CUKA 9ICEA 3EZ5A 1V38A 5DG8A 2XGQA 5CRXA 4QZIA 4DS4A 2A3VA 3PR5B 4DL5A 4F4YA 4P0PA 4M9NA 2UVWA 3IHQB 2VA3A 5J0SA 7ICQA 2E1EA 4GLXA 4M2YA 3WK4A 9ICIA 4B9VA 2UVVA 3QU2A 5ALHA 2F8LA 5JU5A 2AQ4A 1U45A 5AK5A 2BPGA 4UB8U 5EOZA 4QZBA 1U47A 1ECWA 2RRDA 3JPNA 3M1YA 3UXNA 3KFUF 1T4GA 4PJ0U 4BXOB 3FC4A 1D8BA 1EXNA 1ZQNA 4M6WB 4C7ZA 2G06A 3JPQA 1WWUA 2E1FA 4NLCA 1FFVA 4DQSA 4Z6CA 5IIKA 2K8CB 5JUMA 4Y2TA 1ZQHA 1V85A 9ICGA 4JMUA 1UQVA 3HPOA 2KHQA 2HI0A 2BHNA 3HILA 3HW8A 4DF8A 1COOA 4FS2A 9ICUA 4B9UA 4Q43A 2W9AA 4RQ5A 3LDAA 1ZRNA 2PXIA 4J9MA 4NXZA 4ED3A 3J81j 2JZBA 3HJEA 3D2QA 4I2EA 1X9MA 2WF5A 2F44A 1MN8A 2PFOA 1SXDA 4NJ8A 5DB7A 8ICQA 5J2IA 2YTUA 3CYMA 1ZQUA 2ZTDA 2A1JA 1KDHA 8ICTA 1J2NA 2W11A 2WAQF 1NNLA 3T5KA 2KP7A 4UB6U 9ICHA 2KE7A 4YFKA 1NZPA 3T5LA 1TFRA 5AICA 5DGBA 1M6YA 4MFFA 4QIWC 2J6SA 5AKKA 9ICRA 4CF3A 1SL1A 2G0AA 2VA2A 3M9OB 1RQNA 5K4LA 5KFRA 3E2EA 3N7SC 2HHUA 4RZRA 2RLTA 5KFVA 4PHPA 1TE2A 2Y0SF 3NVVA 1S97A 4TUQA 3RB3A 5ALZA 1SKSA 4YMNA 3QU9A 5KAIU 1L3VA 5ALYA 2K60A 3QU5A 2XCAA 2HVHA 3Q8QB 1ZJNA 4ELTA 8ICZA 4ECUA 4RQ2A 1JI7A 1Z00B 4F2RA 5KFTA 2Y1JA 1YZ6A 4FBTA 4YMMA 2AQ0A 3QZ7A 5EE9A 3MC1A 3H8MA 3OHAA 3NVWA 2IHNA 5ALJA 2IOFA 1ZQFA 4F91B 4KN7A 3HP6A 4F4WA 1N48A 1COKA 3WK5A 3KHHA 1Z3EB 4OJPA 5CB1A 3NGDA 4YQWA 4O3MA 4Z6DA 2W7OA 4FE3A 4HAIA 3DDHA 2P6UA 1ZETA 3N97B 2W3RA 2BCVA 3PMLA 2IBKA 4C8MA 2KZZA 5AKJA 4QZFA 1S8OA 3O0FA 2NV3A 7ICEA 1XC9A 3BS7A 4QZ9A 2WB1C 4IL6U 3ALRA 4PZOA 2DFLA 8ICMA 1ZQBA 3UMGA 5J8YC 4JB3A 2JMGA 1UPHA 5KFUA 5TZVA 3L5KA 2WF8A 3V6KA 4B9NA 1XWLA 3NTUA 3F5AA 1ZD3A 2BZFA 4UAZA 3GV5B 1QQ7A 2G09A 2KZ3A 2NRXA 3H4BA 9ICVA 9ICXA 3MGHA 4RT3A 1LKYB 5CWRA 4DL2A 4KX5A 4KLUA 1D9DA 5L1JA 1JMSA 4ED0A 5DB8A 3WKCA 1FO4A 2BCRA 1CRXA 1B22A 1ZQQA 5KTQA 4M9HA 3OGUA 5DDYA 4O3RA 4OD0A 2EZYA 5ALTA 3IP4B 5AHXA 2KZMA 4TQSA 4BGDA 4F72A 4IRDA 4I2FA 3V6JA 1V97A 1BPXA 1Q8KA 4UBBA 4O3SA 2KICA 1RXVA 1NK5A 4JV1A 3PX6A 4ZH4A 2HOFA 1NK0A 2UVRA 4M47A 1ZQJA 5KFKA 2PMZF 4RQ4A 4Y2YA 4I2BA 5T14A 4C7YA 1L7MA 1ZD5A 4FO6A 3WKEA 2J6UA 4PHDA 2EZXA 3UXOA 3WK9A 7ICLA 2ZJAA 8ICKA 3AQFA 1KQQA 1QCKA 2B6GA 5EWGA 4G3IA 1QLNA 5BOMA 1NJYA 1ZQMA 4ECZA 4QZDA 4QWDA 7ICOA 4BDPA 4UB3A 3SMVA 4MF2A 4YG2A 2XICA 1OUQA 3OJSA 2KJ5A 4IS7A 4PZNA 3H4DA 2BGWA 3QUQA 1VJ5A 5KFMA 1JROA 3C5GA 3E0FA 2NRTA 3KHGA 1SWVA 3AQEA 1N5WA 3TANA 2DWQA 3RR8A 4UB1A 3KHLA 3ORYA 5IILA 1ZQGA 4P0PB 2VJ5A 3OSNA 1IIPA 9ICMA 3KZXA
chains in the Genus database with same CATH topology
2DPJA 4O3PA 3MR2A 3RBEA 3C2LA 4UB4A 4F50A 2ASDA 4RPYA 5HNKA 1S9FA 1S0OA 1KSPA 5J0RA 3C1ZA 4M6WA 5KFEA 1HUOA 2KTQA 5KFBA 1QSSA 1T7PA 5KFWA 4MEYA 2IA6A 1SZPA 5IIJA 5BPCA 1AROP 3RH5A 5J0WA 2R8HA 4O3QA 1JX4A 3RTVA 2FPKA 3G6VA 1NKEA 4QWCA 2W8KA 1ZQTA 2HW3A 4ECRA 4O0IA 8ICBA 2BR0A 4QWEA 3RAXA 9ICOA 4DQIA 3M9MB 4KLGA 4RNOA 5D49A 3PW4A 4I28A 4XRHA 1WCLA 4ECVA 4DFKA 4F4ZA 1RYRA 3JPSA 4F4XA 3THVA 1NK7A 5CA7A 2ATLA 5KFNA 4YN4A 4FS1A 2IMWP 4LZDA 1K1SA 3RJJA 2AGPA 3PO4A 2B21A 5J2FA 1T8EA 5J0QA 4YP3A 5J0TA 1UA1A 3GILA 3C21A 1Y88A 3MABA 2W9CA 4F93B 1DOQA 2NRVA 4DQRA 3M8SA 5IINA 5DBCA 4DQQA 3TQ1A 1CUKA 5KT7A 4RU9A 9ICEA 4UAWA 5KFYA 4KLQA 3EZ5A 5KT6A 4J9RA 1QSLA 3PW2A 5J2EA 4UQGA 1BPYA 1KTQA 2V4QA 2C22A 4NLGA 4KLHA 8ICAA 4I2DA 3RRGA 3RAQA 5DLFA 2RDIA 5J0PA 5DG8A 4CCHA 2XGQA 4XQ8A 2OWOA 1ZQZA 2LYHA 4QZIA 4DS4A 3PY8A 3PR5B 2R8KA 3C1YA 4DL5A 4O9MA 4F4YA 2JEJA 4M9NA 4KLEA 8ICRA 2UVWA 2AGOA 3IHQB 4IQVA 4JV0A 5J0SA 3BQ1A 2VA3A 7ICQA 1ZQLA 5DQIA 4ED1A 4I2CA 8ICPA 9ICQA 4DWIA 2ZJ5A 4ECTA 5J2CA 5DB6A 3JPOA 4GLXA 3N4MB 4Z6EA 4M2YA 4PGXA 4R64A 3UQ0A 5DB9A 2W9BA 9ICIA 4QZGA 3QEBZ 4XUSA 1NK4A 4ED6A 4B9VA 2UVVA 2ZTCA 4RQ3A 3MGIA 4K4GA 7ICMA 3AU2A 3KHRA 8ICWA 4JWMA 2HHVA 4M9LA 1Z00A 3GIJA 1BGXT 5L9XA 1HUZA 2BKEA 4YXMA 4R8UB 2AQ4A 1U45A 4J9KA 2MUTB 2BPGA 5EOZA 4QZBA 1XS9D 1U47A 5HMLA 3JPNA 4I2HA 3UXNA 4NY8A 2F1JA 5D46A 5DLGA 1T4GA 4O3NA 5BOLA 4JUZA 3Q8SB 5L1IA 3T5HA 3Q8KA 1S10A 4M9JA 3JPPA 1ZQKA 3RH6A 4O3OA 2AGQA 1SL0A 4BXOB 9ICLA 3RB0A 5DGAA 3B0XA 3PW7A 1EXNA 3Q8RB 2XY6A 3GV8B 4P4MA 1ZQNA 4DLEA 4M6WB 3TI0A 3JPQA 3BQ2A 4UB2A 2J6TA 1ZQSA 3FDSA 3ISDA 2BDPA 5KFZA 1SL2A 4IRCA 1A77A 4YCXA 3OJUA 3ETLA 4DQSA 4Z6CA 5IIKA 3TFRA 5JUMA 1ZQHA 1PZNA 4BWMA 2BPCA 1NK8A 4QZCA 1D8YA 9ICGA 7ICJA 5J0YA 5KT4A 4DEZA 4DSIA 3PV8A 2FMQA 4J9LA 3HPOA 1ZQRA 2KFNA 3C2MA 4B9LA 3PMNA 5KFLA 2XGPA 3RJIA 2BHNA 9ICNA 3HW8A 1XSNA 4DF8A 1COOA 3QZ8A 4FS2A 3PR4A 1X9WA 4I2JA 4GXJA 4GC6A 2C2RA 3SV3A 9ICUA 3AUOA 3RH4A 5KT5A 3RB4A 4B9UA 4IR1A 4Q43A 7ICIA 2W9AA 1JXEA 4RQ5A 2FMSA 1RXWA 5CJ7A 2R8IA 3LDAA 3RJKA 4J9MA 2PXIA 2UVUA 4NXZA 5J2AA 8ICXA 3PNCA 4ED3A 1IM4A 4O5EA 5KFFA 2W9CB 3SI8A 2JZBA 2PI4A 7ICFA 1X2IA 5HHIA 3TAPA 3ZDAA 2KFZA 9ICJA 4J9NA 3ZDEA 4I2EA 3V7JA 5HP4A 1X9MA 1H38A 2W9MA 4KLSA 2ZUCA 2PFOA 4C8LA 4DQPA 4MFCA 2MAXA 5DB7A 8ICQA 3C5FA 5J2IA 1D8LA 4KITB 3ZDBA 8ICYA 1A76A 4YD1A 2F1IA 1ZQUA 2ALZA 2ZTDA 4Q45A 4TUSA 7ICNA 4F92B 3BDPA 2VANA 2A1JA 3K4GA 3H8SA 4I2IA 2FPLA 4Q44A 1KDHA 8ICTA 4F8RA 3T5KA 4B9TA 9ICHA 2R8JA 4YFKA 5L1LA 4DOBA 4J9OA 1ZQDA 2PI5A 7ICHA 1RYSA 1ZQIA 1L3TA 3T5LA 1TFRA 1CEZA 4FBUA 5DGBA 1UT5A 4M9GA 3PX0A 4KLTA 1XSLA 4RPXA 2XCPA 3GIKA 4MFFA 4JV2A 3UQ2A 3MDAA 3AU6A 4F5PA 2I1QA 1XSPA 2MUTA 2J6SA 9ICRA 4P4PA 2FLLA 2Y1IA 1SL1A 1BPBA 2VA2A 9ICCA 2XY7A 1TK8A 4DF4A 5KFAA 3M9OB 4MEXA 5KFRA 4B9MA 4YD2A 5KG2A 2XC9A 3LK9A 1D9FA 4MFAA 5KFIA 3E2EA 2AJQA 2A1JB 2HHUA 8ICNA 8ICIA 5C5JA 4RZRA 2JEGA 5L1KA 1U9LA 3OHBA 3MR3A 3TFSA 5KFVA 4KLJA 4UB5A 4J9PA 2BCQA 4P2HA 1KFSA 4PHPA 3GFKB 3C2KA 1S97A 1KFTA 4TUQA 3GIIA 3RB3A 1SKSA 4YMNA 5KFDA 2ASJA 1L3VA 4JK1A 2XCAA 3GQCA 1ZJMA 2HVHA 3V7KA 5IIMA 2P6RA 3Q8QB 1ZJNA 4ELTA 8ICZA 1XO1A 3RJEA 4PGQA 4C8NA 1ZQYA 4RQ2A 4ECUA 4M04A 1Z00B 4PHEA 3ZD9A 4QW9A 4F2RA 1X9SA 3GIMA 4DL6A 4QWBA 5KFTA 2Y1JA 1MC8A 7ICKA 4DL3A 4ECYA 4F3OA 4FBTA 4YMMA 5KFGA 1QTMA 7ICGA 4IQUA 9ICTA 2AQ0A 3QZ7A 4EBCA 4ED7A 3UXPA 3PVXA 3OHAA 4YVZA 3HX0A 2IHNA 2IHMA 4Q8EA 1ZQFA 3V72A 5CP2A 4KLDA 4F91B 4JWNA 4KN7A 4Q8FA 5F9LA 3HP6A 4F4WA 1V9PA 4RQ0A 4F4KA 1N48A 1ZYQA 8ICGA 5HHHA 4DSEA 1LV5A 4DFJA 4RQ1A 3KHHA 8ICOA 1Z3EB 1NK6A 5CB1A 1K1QA 3NGDA 4YQWA 4EZ9A 1JXLA 4B9SA 4Z6DA 3RBDA 4NM2A 4RUCA 2W9BB 4DS5A 4EZ6A 2RDJA 4R63A 4LZGA 1ZQWA 5DKWA 9ICBA 4QZHA 2P6UA 1ZETA 3FYHA 5KFXA 2ASLA 4QZAA 8ICEA 4ECXA 3N97B 4MF8A 2XY5A 1TKDA 4ELVA 2C28A 4DO9A 2BCVA 3PMLA 5KFCA 4C8MA 3EYZA 2IBKA 2KZZA 4QZ8A 5EWFA 4DL4A 1BPZA 2HHWA 5HMMA 4QZFA 1UT8A 3ZDCA 8ICCA 5KFQA 1L3UA 7ICEA 2AU0A 1XC9A 5J2HA 4QZ9A 2HHSA 4IQWA 8ICLA 5J0XA 5J2BA 5KFSA 4GC7A 2DPIA 3RJFA 3K75D 5KG6A 3HT3A 2I9GA 3PW0A 2DFLA 2PFNA 4I2GA 4NLNA 8ICMA 1ZQBA 5EWEA 5DQHA 4X5VA 4DFPA 2GWSA 1MQ2A 3RJGA 4RPZA 7ICRA 2FLPA 2W8LA 4P4OA 5KFUA 4YMOA 1JIHA 5TZVA 3SV4A 4RNMA 3V6KA 4F5RA 4B9NA 2BPFA 2PFPA 2ISOA 3RR7A 3SZ2A 1S0NA 5KG4A 1XWLA 3NTUA 4KN4A 4E0DA 5KG1A 5J2KA 1U48A 3EWAA 4DLGA 3RRHA 3JPTA 4ECWA 1LB2B 2BCUA 4KLFA 4M0AA 2HHQA 1T3NA 4UAZA 3GV5B 2V9WA 4IR9A 1S0VA 2R8GA 4YR3A 1SKRA 4TURA 2KZ3A 1BVSA 2HVIA 2NRWA 3JPRA 1ZQEA 4UBCA 2Q0ZX 8ICFA 5IIIA 7ICSA 2NRXA 4DOAA 2FMPA 4QW8A 4PGYA 5KG3A 3H4BA 4ED8A 2BQUA 8ICSA 9ICVA 9ICXA 3MGHA 1NJXA 5KT3A 4I2AA 1QLNA 1S76D 4RT3A 5DBBA 3ISBA 3C23A 2ISPA 4K4HA 1NOMA 3LWMA 3EPGA 5CWRA 4ED2A 4DSFA 4DL2A 4KLUA 5KG0A 4BWJA 5DDMA 1D9DA 4DL7A 1RPLA 1MQ3A 4RQ6A 8ICVA 5DG7A 1L5UA 5L1JA 4YR2A 1JMSA 5CHGA 9ICSA 3TARA 1NJZA 9ICAA 3PX4A 7ICPA 5J2JA 4ED0A 2P66A 5DB8A 4I29A 9ICWA 4Z6FA 3T5JA 5KFJA 2NRZA 4R8UA 1TK0A 4QZEA 4EBEA 4C8KA 3H8JA 4ECQA 1XU4A 1NKBA 1B43A 4EYHB 2BCRA 4GXKA 1B22A 1BPEA 1ZQQA 1S0MA 5KTQA 4M9HA 3LWLA 3OGUA 5DDYA 4NM1A 4O3RA 4KLLA 5J0UA 4ECSA 4DSJA 4K4IA 4ELUA 2KZMA 4TQSA 4BGDA 2ZUDA 4YXJA 4IRDA 4I2FA 3V6JA 2HHTA 1BPXA 4F5QA 3ISCA 1NKCA 2ZTEA 2JEFA 1S77D 4DFMA 4I27A 4O5KA 4UBBA 4O5CA 5CR0A 4R65A 4J9SA 1RXVA 4O3SA 3PW5A 7ICVA 4F5OA 3MR5A 2C2EA 5IIOA 4QWAA 1WCNA 1NK5A 4JV1A 2H5XA 5KFPA 4ZH4A 2V4RA 3PX6A 1KFDA 5DQGA 3EW9A 1KEJA 4PH5A 1NK0A 2UVRA 2C2DA 4KMUA 4M47A 3ZD8A 1ZQJA 1TAQA 5KFKA 5DBAA 3RB6A 4NLZA 4IRKA 5J0OA 3IM1A 1JN3A 5D4BA 1KRPA 4DSLA 4RQ4A 4F2SA 4EBDA 5KFHA 1RZTA 4I2BA 1TK5A 4TQRA 4J9QA 1ZQXA 4KLOA 1UA0A 3B0YA 2JEIA 4UAYA 2FLNA 3Q8LA 2BCSA 4FO6A 4KLMA 4RT2A 4RQ7A 2J6UA 4PHDA 3UXOA 4EEYA 4BXOA 2PFQA 1ZQCA 2BQ3A 1HJPA 9ICKA 7ICLA 5DG9A 2ZJAA 4EYIB 2JZBB 2F1HA 8ICKA 1IXRA 4C8OA 3UPQA 5KG5A 3MR6A 2ZUBA 4GXIA 1TAUA 4RUAA 4HYKA 4RNNA 4IQTA 3V7LA 5EWGA 1U4BA 1N56A 4G3IA 2WTFA 4LVSA 3MBYA 2ZJ8A 3H7IA 4YR0A 3Q8PB 5BOMA 3M9NB 4DOCA 1QSYA 1NJYA 3HWTA 3ZDDA 3V6HA 1ZQMA 4ECZA 4QZDA 4QWDA 7ICOA 1ZQOA 2HHXA 5J29A 4BDPA 4UB3A 4R66A 1ZQAA 9ICPA 4MF2A 4YG2A 5KT2A 4XA5A 3GV7B 3EPIA 3QEAZ 4DSKA 2KN7A 3OJSA 3H8WA 3QE9Y 3H4DA 2BGWA 5KFMA 1NJWA 1NK9A 2BQRA 1L3SA 2FPMA 3GDXA 3MDCA 3OSPA 1MSWD 4NLKA 5KFOA 1U49A 1C7YA 4TUPA 3BJYA 7ICUA 3H40A 2VA8A 3C5GA 3T3FA 5F9NA 3Q8MA 1BPDA 5J2GA 3MFIA 3BQ0A 3KTQA 2NRTA 3KHGA 3SYZA 3G6YA 4RQ8A 1KLNA 1ZQPA 4PPXA 5KG7A 4KTQA 3G6XA 4F5NA 3RJHA 1TV9A 2XO7A 3TANA 8ICUA 3RR8A 7ICTA 4UB1A 3KHLA 3BQTA 4PHAA 1SKWA 1DGSA 8ICJA 8ICHA 3ORYA 1TVAA 5IILA 4KLIA 1ZQGA 5J2DA 3PO5A 3M8RA 9ICFA 1ZQVA 3MFHA 2M9NA 3OSNA 9ICMA 3TAQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DPJ A;  4O3P A;  3MR2 A;  3RBE A;  3C2L A;  4UB4 A;  4F50 A;  2ASD A;  4RPY A;  5HNK A;  1S9F A;  1S0O A;  1KSP A;  5J0R A;  3C1Z A;  4M6W A;  5KFE A;  1HUO A;  2KTQ A;  5KFB A;  1QSS A;  1T7P A;  5KFW A;  4MEY A;  2IA6 A;  1SZP A;  5IIJ A;  5BPC A;  1ARO P;  3RH5 A;  5J0W A;  2R8H A;  4O3Q A;  1JX4 A;  3RTV A;  2FPK A;  3G6V A;  1NKE A;  4QWC A;  2W8K A;  1ZQT A;  2HW3 A;  4ECR A;  4O0I A;  8ICB A;  2BR0 A;  4QWE A;  3RAX A;  9ICO A;  4DQI A;  3M9M B;  4KLG A;  4RNO A;  5D49 A;  3PW4 A;  4I28 A;  4XRH A;  1WCL A;  4ECV A;  4DFK A;  4F4Z A;  1RYR A;  3JPS A;  4F4X A;  3THV A;  1NK7 A;  5CA7 A;  2ATL A;  5KFN A;  4YN4 A;  4FS1 A;  2IMW P;  4LZD A;  1K1S A;  3RJJ A;  2AGP A;  3PO4 A;  2B21 A;  5J2F A;  1T8E A;  5J0Q A;  4YP3 A;  5J0T A;  1UA1 A;  3GIL A;  3C21 A;  1Y88 A;  3MAB A;  2W9C A;  4F93 B;  1DOQ A;  2NRV A;  4DQR A;  3M8S A;  5IIN A;  5DBC A;  4DQQ A;  3TQ1 A;  1CUK A;  5KT7 A;  4RU9 A;  9ICE A;  4UAW A;  5KFY A;  4KLQ A;  3EZ5 A;  5KT6 A;  4J9R A;  1QSL A;  3PW2 A;  5J2E A;  4UQG A;  1BPY A;  1KTQ A;  2V4Q A;  2C22 A;  4NLG A;  4KLH A;  8ICA A;  4I2D A;  3RRG A;  3RAQ A;  5DLF A;  2RDI A;  5J0P A;  5DG8 A;  4CCH A;  2XGQ A;  4XQ8 A;  2OWO A;  1ZQZ A;  2LYH A;  4QZI A;  4DS4 A;  3PY8 A;  3PR5 B;  2R8K A;  3C1Y A;  4DL5 A;  4O9M A;  4F4Y A;  2JEJ A;  4M9N A;  4KLE A;  8ICR A;  2UVW A;  2AGO A;  3IHQ B;  4IQV A;  4JV0 A;  5J0S A;  3BQ1 A;  2VA3 A;  7ICQ A;  1ZQL A;  5DQI A;  4ED1 A;  4I2C A;  8ICP A;  9ICQ A;  4DWI A;  2ZJ5 A;  4ECT A;  5J2C A;  5DB6 A;  3JPO A;  4GLX A;  3N4M B;  4Z6E A;  4M2Y A;  4PGX A;  4R64 A;  3UQ0 A;  5DB9 A;  2W9B A;  9ICI A;  4QZG A;  3QEB Z;  4XUS A;  1NK4 A;  4ED6 A;  4B9V A;  2UVV A;  2ZTC A;  4RQ3 A;  3MGI A;  4K4G A;  7ICM A;  3AU2 A;  3KHR A;  8ICW A;  4JWM A;  2HHV A;  4M9L A;  1Z00 A;  3GIJ A;  1BGX T;  5L9X A;  1HUZ A;  2BKE A;  4YXM A;  4R8U B;  2AQ4 A;  1U45 A;  4J9K A;  2MUT B;  2BPG A;  5EOZ A;  4QZB A;  1XS9 D;  1U47 A;  5HML A;  3JPN A;  4I2H A;  3UXN A;  4NY8 A;  2F1J A;  5D46 A;  5DLG A;  1T4G A;  4O3N A;  5BOL A;  4JUZ A;  3Q8S B;  5L1I A;  3T5H A;  3Q8K A;  1S10 A;  4M9J A;  3JPP A;  1ZQK A;  3RH6 A;  4O3O A;  2AGQ A;  1SL0 A;  4BXO B;  9ICL A;  3RB0 A;  5DGA A;  3B0X A;  3PW7 A;  1EXN A;  3Q8R B;  2XY6 A;  3GV8 B;  4P4M A;  1ZQN A;  4DLE A;  4M6W B;  3TI0 A;  3JPQ A;  3BQ2 A;  4UB2 A;  2J6T A;  1ZQS A;  3FDS A;  3ISD A;  2BDP A;  5KFZ A;  1SL2 A;  4IRC A;  1A77 A;  4YCX A;  3OJU A;  3ETL A;  4DQS A;  4Z6C A;  5IIK A;  3TFR A;  5JUM A;  1ZQH A;  1PZN A;  4BWM A;  2BPC A;  1NK8 A;  4QZC A;  1D8Y A;  9ICG A;  7ICJ A;  5J0Y A;  5KT4 A;  4DEZ A;  4DSI A;  3PV8 A;  2FMQ A;  4J9L A;  3HPO A;  1ZQR A;  2KFN A;  3C2M A;  4B9L A;  3PMN A;  5KFL A;  2XGP A;  3RJI A;  2BHN A;  9ICN A;  3HW8 A;  1XSN A;  4DF8 A;  1COO A;  3QZ8 A;  4FS2 A;  3PR4 A;  1X9W A;  4I2J A;  4GXJ A;  4GC6 A;  2C2R A;  3SV3 A;  9ICU A;  3AUO A;  3RH4 A;  5KT5 A;  3RB4 A;  4B9U A;  4IR1 A;  4Q43 A;  7ICI A;  2W9A A;  1JXE A;  4RQ5 A;  2FMS A;  1RXW A;  5CJ7 A;  2R8I A;  3LDA A;  3RJK A;  4J9M A;  2PXI A;  2UVU A;  4NXZ A;  5J2A A;  8ICX A;  3PNC A;  4ED3 A;  1IM4 A;  4O5E A;  5KFF A;  2W9C B;  3SI8 A;  2JZB A;  2PI4 A;  7ICF A;  1X2I A;  5HHI A;  3TAP A;  3ZDA A;  2KFZ A;  9ICJ A;  4J9N A;  3ZDE A;  4I2E A;  3V7J A;  5HP4 A;  1X9M A;  1H38 A;  2W9M A;  4KLS A;  2ZUC A;  2PFO A;  4C8L A;  4DQP A;  4MFC A;  2MAX A;  5DB7 A;  8ICQ A;  3C5F A;  5J2I A;  1D8L A;  4KIT B;  3ZDB A;  8ICY A;  1A76 A;  4YD1 A;  2F1I A;  1ZQU A;  2ALZ A;  2ZTD A;  4Q45 A;  4TUS A;  7ICN A;  4F92 B;  3BDP A;  2VAN A;  2A1J A;  3K4G A;  3H8S A;  4I2I A;  2FPL A;  4Q44 A;  1KDH A;  8ICT A;  4F8R A;  3T5K A;  4B9T A;  9ICH A;  2R8J A;  4YFK A;  5L1L A;  4DOB A;  4J9O A;  1ZQD A;  2PI5 A;  7ICH A;  1RYS A;  1ZQI A;  1L3T A;  3T5L A;  1TFR A;  1CEZ A;  4FBU A;  5DGB A;  1UT5 A;  4M9G A;  3PX0 A;  4KLT A;  1XSL A;  4RPX A;  2XCP A;  3GIK A;  4MFF A;  4JV2 A;  3UQ2 A;  3MDA A;  3AU6 A;  4F5P A;  2I1Q A;  1XSP A;  2MUT A;  2J6S A;  9ICR A;  4P4P A;  2FLL A;  2Y1I A;  1SL1 A;  1BPB A;  2VA2 A;  9ICC A;  2XY7 A;  1TK8 A;  4DF4 A;  5KFA A;  3M9O B;  4MEX A;  5KFR A;  4B9M A;  4YD2 A;  5KG2 A;  2XC9 A;  3LK9 A;  1D9F A;  4MFA A;  5KFI A;  3E2E A;  2AJQ A;  2A1J B;  2HHU A;  8ICN A;  8ICI A;  5C5J A;  4RZR A;  2JEG A;  5L1K A;  1U9L A;  3OHB A;  3MR3 A;  3TFS A;  5KFV A;  4KLJ A;  4UB5 A;  4J9P A;  2BCQ A;  4P2H A;  1KFS A;  4PHP A;  3GFK B;  3C2K A;  1S97 A;  1KFT A;  4TUQ A;  3GII A;  3RB3 A;  1SKS A;  4YMN A;  5KFD A;  2ASJ A;  1L3V A;  4JK1 A;  2XCA A;  3GQC A;  1ZJM A;  2HVH A;  3V7K A;  5IIM A;  2P6R A;  3Q8Q B;  1ZJN A;  4ELT A;  8ICZ A;  1XO1 A;  3RJE A;  4PGQ A;  4C8N A;  1ZQY A;  4RQ2 A;  4ECU A;  4M04 A;  1Z00 B;  4PHE A;  3ZD9 A;  4QW9 A;  4F2R A;  1X9S A;  3GIM A;  4DL6 A;  4QWB A;  5KFT A;  2Y1J A;  1MC8 A;  7ICK A;  4DL3 A;  4ECY A;  4F3O A;  4FBT A;  4YMM A;  5KFG A;  1QTM A;  7ICG A;  4IQU A;  9ICT A;  2AQ0 A;  3QZ7 A;  4EBC A;  4ED7 A;  3UXP A;  3PVX A;  3OHA A;  4YVZ A;  3HX0 A;  2IHN A;  2IHM A;  4Q8E A;  1ZQF A;  3V72 A;  5CP2 A;  4KLD A;  4F91 B;  4JWN A;  4KN7 A;  4Q8F A;  5F9L A;  3HP6 A;  4F4W A;  1V9P A;  4RQ0 A;  4F4K A;  1N48 A;  1ZYQ A;  8ICG A;  5HHH A;  4DSE A;  1LV5 A;  4DFJ A;  4RQ1 A;  3KHH A;  8ICO A;  1Z3E B;  1NK6 A;  5CB1 A;  1K1Q A;  3NGD A;  4YQW A;  4EZ9 A;  1JXL A;  4B9S A;  4Z6D A;  3RBD A;  4NM2 A;  4RUC A;  2W9B B;  4DS5 A;  4EZ6 A;  2RDJ A;  4R63 A;  4LZG A;  1ZQW A;  5DKW A;  9ICB A;  4QZH A;  2P6U A;  1ZET A;  3FYH A;  5KFX A;  2ASL A;  4QZA A;  8ICE A;  4ECX A;  3N97 B;  4MF8 A;  2XY5 A;  1TKD A;  4ELV A;  2C28 A;  4DO9 A;  2BCV A;  3PML A;  5KFC A;  4C8M A;  3EYZ A;  2IBK A;  2KZZ A;  4QZ8 A;  5EWF A;  4DL4 A;  1BPZ A;  2HHW A;  5HMM A;  4QZF A;  1UT8 A;  3ZDC A;  8ICC A;  5KFQ A;  1L3U A;  7ICE A;  2AU0 A;  1XC9 A;  5J2H A;  4QZ9 A;  2HHS A;  4IQW A;  8ICL A;  5J0X A;  5J2B A;  5KFS A;  4GC7 A;  2DPI A;  3RJF A;  3K75 D;  5KG6 A;  3HT3 A;  2I9G A;  3PW0 A;  2DFL A;  2PFN A;  4I2G A;  4NLN A;  8ICM A;  1ZQB A;  5EWE A;  5DQH A;  4X5V A;  4DFP A;  2GWS A;  1MQ2 A;  3RJG A;  4RPZ A;  7ICR A;  2FLP A;  2W8L A;  4P4O A;  5KFU A;  4YMO A;  1JIH A;  5TZV A;  3SV4 A;  4RNM A;  3V6K A;  4F5R A;  4B9N A;  2BPF A;  2PFP A;  2ISO A;  3RR7 A;  3SZ2 A;  1S0N A;  5KG4 A;  1XWL A;  3NTU A;  4KN4 A;  4E0D A;  5KG1 A;  5J2K A;  1U48 A;  3EWA A;  4DLG A;  3RRH A;  3JPT A;  4ECW A;  1LB2 B;  2BCU A;  4KLF A;  4M0A A;  2HHQ A;  1T3N A;  4UAZ A;  3GV5 B;  2V9W A;  4IR9 A;  1S0V A;  2R8G A;  4YR3 A;  1SKR A;  4TUR A;  2KZ3 A;  1BVS A;  2HVI A;  2NRW A;  3JPR A;  1ZQE A;  4UBC A;  2Q0Z X;  8ICF A;  5III A;  7ICS A;  2NRX A;  4DOA A;  2FMP A;  4QW8 A;  4PGY A;  5KG3 A;  3H4B A;  4ED8 A;  2BQU A;  8ICS A;  9ICV A;  9ICX A;  3MGH A;  1NJX A;  5KT3 A;  4I2A A;  1QLN A;  1S76 D;  4RT3 A;  5DBB A;  3ISB A;  3C23 A;  2ISP A;  4K4H A;  1NOM A;  3LWM A;  3EPG A;  5CWR A;  4ED2 A;  4DSF A;  4DL2 A;  4KLU A;  5KG0 A;  4BWJ A;  5DDM A;  1D9D A;  4DL7 A;  1RPL A;  1MQ3 A;  4RQ6 A;  8ICV A;  5DG7 A;  1L5U A;  5L1J A;  4YR2 A;  1JMS A;  5CHG A;  9ICS A;  3TAR A;  1NJZ A;  9ICA A;  3PX4 A;  7ICP A;  5J2J A;  4ED0 A;  2P66 A;  5DB8 A;  4I29 A;  9ICW A;  4Z6F A;  3T5J A;  5KFJ A;  2NRZ A;  4R8U A;  1TK0 A;  4QZE A;  4EBE A;  4C8K A;  3H8J A;  4ECQ A;  1XU4 A;  1NKB A;  1B43 A;  4EYH B;  2BCR A;  4GXK A;  1B22 A;  1BPE A;  1ZQQ A;  1S0M A;  5KTQ A;  4M9H A;  3LWL A;  3OGU A;  5DDY A;  4NM1 A;  4O3R A;  4KLL A;  5J0U A;  4ECS A;  4DSJ A;  4K4I A;  4ELU A;  2KZM A;  4TQS A;  4BGD A;  2ZUD A;  4YXJ A;  4IRD A;  4I2F A;  3V6J A;  2HHT A;  1BPX A;  4F5Q A;  3ISC A;  1NKC A;  2ZTE A;  2JEF A;  1S77 D;  4DFM A;  4I27 A;  4O5K A;  4UBB A;  4O5C A;  5CR0 A;  4R65 A;  4J9S A;  1RXV A;  4O3S A;  3PW5 A;  7ICV A;  4F5O A;  3MR5 A;  2C2E A;  5IIO A;  4QWA A;  1WCN A;  1NK5 A;  4JV1 A;  2H5X A;  5KFP A;  4ZH4 A;  2V4R A;  3PX6 A;  1KFD A;  5DQG A;  3EW9 A;  1KEJ A;  4PH5 A;  1NK0 A;  2UVR A;  2C2D A;  4KMU A;  4M47 A;  3ZD8 A;  1ZQJ A;  1TAQ A;  5KFK A;  5DBA A;  3RB6 A;  4NLZ A;  4IRK A;  5J0O A;  3IM1 A;  1JN3 A;  5D4B A;  1KRP A;  4DSL A;  4RQ4 A;  4F2S A;  4EBD A;  5KFH A;  1RZT A;  4I2B A;  1TK5 A;  4TQR A;  4J9Q A;  1ZQX A;  4KLO A;  1UA0 A;  3B0Y A;  2JEI A;  4UAY A;  2FLN A;  3Q8L A;  2BCS A;  4FO6 A;  4KLM A;  4RT2 A;  4RQ7 A;  2J6U A;  4PHD A;  3UXO A;  4EEY A;  4BXO A;  2PFQ A;  1ZQC A;  2BQ3 A;  1HJP A;  9ICK A;  7ICL A;  5DG9 A;  2ZJA A;  4EYI B;  2JZB B;  2F1H A;  8ICK A;  1IXR A;  4C8O A;  3UPQ A;  5KG5 A;  3MR6 A;  2ZUB A;  4GXI A;  1TAU A;  4RUA A;  4HYK A;  4RNN A;  4IQT A;  3V7L A;  5EWG A;  1U4B A;  1N56 A;  4G3I A;  2WTF A;  4LVS A;  3MBY A;  2ZJ8 A;  3H7I A;  4YR0 A;  3Q8P B;  5BOM A;  3M9N B;  4DOC A;  1QSY A;  1NJY A;  3HWT A;  3ZDD A;  3V6H A;  1ZQM A;  4ECZ A;  4QZD A;  4QWD A;  7ICO A;  1ZQO A;  2HHX A;  5J29 A;  4BDP A;  4UB3 A;  4R66 A;  1ZQA A;  9ICP A;  4MF2 A;  4YG2 A;  5KT2 A;  4XA5 A;  3GV7 B;  3EPI A;  3QEA Z;  4DSK A;  2KN7 A;  3OJS A;  3H8W A;  3QE9 Y;  3H4D A;  2BGW A;  5KFM A;  1NJW A;  1NK9 A;  2BQR A;  1L3S A;  2FPM A;  3GDX A;  3MDC A;  3OSP A;  1MSW D;  4NLK A;  5KFO A;  1U49 A;  1C7Y A;  4TUP A;  3BJY A;  7ICU A;  3H40 A;  2VA8 A;  3C5G A;  3T3F A;  5F9N A;  3Q8M A;  1BPD A;  5J2G A;  3MFI A;  3BQ0 A;  3KTQ A;  2NRT A;  3KHG A;  3SYZ A;  3G6Y A;  4RQ8 A;  1KLN A;  1ZQP A;  4PPX A;  5KG7 A;  4KTQ A;  3G6X A;  4F5N A;  3RJH A;  1TV9 A;  2XO7 A;  3TAN A;  8ICU A;  3RR8 A;  7ICT A;  4UB1 A;  3KHL A;  3BQT A;  4PHA A;  1SKW A;  1DGS A;  8ICJ A;  8ICH A;  3ORY A;  1TVA A;  5IIL A;  4KLI A;  1ZQG A;  5J2D A;  3PO5 A;  3M8R A;  9ICF A;  1ZQV A;  3MFH A;  2M9N A;  3OSN A;  9ICM A;  3TAQ A; 
#chains in the Genus database with same CATH topology
 3RBE A;  3C2L A;  4UB4 A;  2ASD A;  5HNK A;  3B9J A;  5KFB A;  3QU4 A;  1T7P A;  5ALN A;  3RH5 A;  3UM9 A;  2R8H A;  2XID A;  4O3Q A;  3RTV A;  2FPK A;  2HW3 A;  2PMZ C;  2KJ9 A;  5F3X B;  3KD3 A;  4QWE A;  9ICO A;  3BS5 A;  4Y2R A;  5ALI A;  5ALP A;  4NWI A;  1NK7 A;  3THV A;  3A0B U;  5CA7 A;  2ATL A;  5KFN A;  1A0P A;  2RQ5 A;  5A0L A;  1HEK A;  1Y88 A;  3MAB A;  3H0R B;  1DOQ A;  5ALK A;  3M8S A;  2LYA A;  4DQQ A;  4UAW A;  5KFY A;  2LM4 A;  5J2E A;  1BPY A;  4Y2X A;  8ICA A;  4I2D A;  2LBO A;  2KKV A;  5G5H A;  3C1Y A;  5B66 U;  4CF5 A;  2H3F A;  2AGO A;  1O08 A;  1ZQL A;  5DQI A;  4DWI A;  4ECT A;  5J2C A;  3JPO A;  4Z6E A;  3QEB Z;  1O03 A;  5AI6 A;  4FFD A;  8ICW A;  2HHV A;  3I28 A;  1Z00 A;  2KJ8 A;  3PSF A;  1J97 A;  1HUZ A;  2G08 A;  4R8U B;  3MGV A;  2MUT B;  3PSP A;  1XS9 D;  4I2H A;  4UAU A;  5BOL A;  4O3N A;  2K4H A;  3Q8K A;  5L1I A;  4M9J A;  1SL0 A;  2ESE A;  3U26 A;  3B0X A;  2WB1 F;  3N28 A;  3H0L B;  3Q8R B;  1KBU A;  4P4M A;  3D2S A;  1GO3 F;  2RP5 A;  3TI0 A;  3BQ2 A;  2BDP A;  1A77 A;  2LPE A;  5AKE A;  5AKX A;  2N1R A;  3TFR A;  3S6J A;  4C4S A;  2LHT A;  1PZN A;  1D8Y A;  2KIW A;  4EEN A;  4DEZ A;  5AI0 A;  3C2M A;  3ICX A;  3RJI A;  5TIS U;  3F5E A;  1XSN A;  5ALE A;  5EE1 A;  3PR4 A;  1WUD A;  5AM1 A;  4USA A;  3SV3 A;  3RH4 A;  5KT5 A;  1JXE A;  2FMS A;  5CJ7 A;  2UVU A;  5J2A A;  2ES6 A;  5HHI A;  9ICJ A;  3ZDE A;  2EQY A;  2W9M A;  4KLS A;  4C8L A;  4MFC A;  2YMM A;  3T79 A;  1D8L A;  5AIA A;  1A76 A;  2F1I A;  3BDP A;  2VAN A;  4Q44 A;  3H8S A;  2KIV A;  3VC8 A;  5H2F U;  2W55 A;  4EEK A;  5L1L A;  1ZQD A;  2I6X A;  4J9O A;  2PI5 A;  7ICH A;  1ZQI A;  1CEZ A;  2KK0 A;  4M9G A;  3PX0 A;  4KLT A;  5AK3 A;  2HBK A;  1XSP A;  2MUT A;  3TKA A;  1BPB A;  3UMB A;  4DF4 A;  4MEX A;  4YD2 A;  2AJQ A;  3IV6 A;  5KFI A;  8ICN A;  4QIW F;  8ICI A;  4ICA A;  2JEG A;  1N5X A;  1U9L A;  3MR3 A;  2CXY A;  4UB5 A;  4P2H A;  2G07 A;  3GFK B;  1KFT A;  1K5O A;  2ASJ A;  2WAQ C;  1ZJM A;  3V7K A;  3R9K A;  3RJE A;  4FZN A;  3ZD9 A;  1X9S A;  1KN5 A;  1HIW A;  1MC8 A;  3C28 A;  4DL3 A;  5KFG A;  2ZIW A;  4IQU A;  4EBC A;  2JH7 A;  2EH9 A;  4YVZ A;  3HX0 A;  2IHM A;  4OJO A;  1V9P A;  3L4P A;  4DFJ A;  1NI3 A;  1NK6 A;  2D6F C;  1K1Q A;  4EZ9 A;  4Y2Q A;  2P35 A;  1JXL A;  1RYU A;  2WF7 A;  5ALU A;  2WFA A;  4RUC A;  1PVQ A;  5DKW A;  9ICB A;  5ALL A;  3FM9 A;  8ICE A;  4ECX A;  4MF8 A;  2XY5 A;  2ZIU A;  4DO9 A;  3EYZ A;  2HBM A;  5EWF A;  1BPZ A;  1UT8 A;  4OCZ A;  1L3U A;  4G9B A;  2HHS A;  4IQW A;  5J0X A;  5J2B A;  5KL8 B;  4GC7 A;  2I9G A;  4I2G A;  3BQ7 A;  5EWE A;  4X5V A;  5AKZ A;  3AN1 A;  2OM6 A;  2YQE A;  2FLP A;  2W8L A;  4P4O A;  3SV4 A;  4RNM A;  2BPF A;  2ISO A;  3SZ2 A;  1S0N A;  2KD1 A;  2BCU A;  4ECW A;  3M6K A;  3SEI A;  4AP9 A;  1BNO A;  1BVS A;  2HVI A;  1N61 A;  3JPR A;  1ZQE A;  4NV0 A;  2HOI A;  2Q0Z X;  1P7D A;  8ICF A;  1T3Q A;  2K8A A;  4DOA A;  5ALM A;  4QW8 A;  8ICS A;  2BQU A;  1F44 A;  1QQ5 A;  2ZIX A;  4I2A A;  1SXE A;  4EX6 A;  5ALS A;  2FDR A;  5ALQ A;  4ED2 A;  5DDM A;  1LVH A;  3RF9 A;  1RPL A;  1MQ3 A;  4RQ6 A;  3SR6 A;  1JUD A;  2Y9T A;  2ZIV A;  1NJZ A;  9ICA A;  9ICW A;  4I29 A;  1X6I A;  3QXG A;  1XU4 A;  1B43 A;  4EYH B;  1Z1B A;  2XVT A;  2K8B B;  1S0M A;  1FFU A;  4AYB C;  4K4I A;  4ELU A;  2E8N A;  1T94 A;  2YMP A;  2YX8 A;  1F0M A;  4F5Q A;  3QUB A;  3ISC A;  2JEF A;  4O5C A;  4R65 A;  4J9S A;  3PW5 A;  2C2E A;  2Y9U A;  5KFP A;  4KMU A;  3ZD8 A;  4BUG A;  5AI9 A;  1KW4 A;  5DBA A;  4NLZ A;  5J0O A;  2F3N A;  2KSO A;  3KBB A;  4EBD A;  1RZT A;  3B0Y A;  3TAD A;  2VIX A;  2BCS A;  5L1M A;  2W43 A;  3L3F X;  4BXO A;  1ZQC A;  4EYI B;  2W7P A;  2BDU A;  4C8O A;  3UPQ A;  5KG5 A;  4RUA A;  3V7L A;  2CPR A;  2D8C A;  4Y2J A;  3HWT A;  3ZDD A;  3V6H A;  5HR7 A;  1ZQO A;  2HHX A;  4Y2P A;  3H0M B;  4R66 A;  9ICP A;  4DFD A;  3LVV A;  2OH2 A;  3EPI A;  1RM6 C;  2EAN A;  1NK9 A;  2BQR A;  5KNI A;  5KFO A;  2KOB A;  3H40 A;  3Q8M A;  5J2G A;  1QH9 A;  2FE9 A;  2E8P A;  4PPX A;  4QJF B;  3ZI4 A;  2VJ4 A;  2VKQ A;  2XO7 A;  5AK4 A;  2G5H B;  2ZIU B;  7ICT A;  3BQT A;  1TVA A;  2NO5 A;  4O3P A;  4PL2 A;  4F50 A;  5AKH A;  4RPY A;  1S9F A;  5J0R A;  4M6W A;  2KTQ A;  4J03 A;  1URJ A;  4MEY A;  2IA6 A;  5IIJ A;  1Z1V A;  5J0W A;  1JX4 A;  1DXS A;  4QWC A;  1ZQT A;  4O0I A;  8ICB A;  2E8M A;  2QB0 A;  1SV4 A;  5ALO A;  2AHO B;  4DQI A;  2WF6 A;  5J8Y A;  3PW4 A;  5AKI A;  4P0Q A;  4XRH A;  4F4X A;  2KV2 A;  4FS1 A;  4YP3 A;  1SIJ A;  3C21 A;  1L7O A;  5KT6 A;  3PW2 A;  4EX7 A;  2G5I B;  4UQG A;  4GFJ A;  1KTQ A;  2C22 A;  4NLG A;  3RRG A;  4UW9 A;  1UHU A;  3RAQ A;  2YML A;  2KNJ A;  2OWO A;  1ZQZ A;  2LYH A;  4KMO B;  5AKG A;  4JV0 A;  2JXJ A;  4ED1 A;  5EE0 A;  5GTH U;  3OTQ A;  2W9B A;  4QZG A;  2R18 A;  1NK4 A;  1AQ6 A;  1WG8 A;  2GLE A;  3MGI A;  2JH1 A;  4DCC A;  7ICM A;  3AU2 A;  4JWM A;  4M9L A;  1BGX T;  1X9X A;  5L9X A;  2BKE A;  4YXM A;  2EAM A;  2LKY A;  5HML A;  5ALG A;  5D46 A;  5DLG A;  3Q8S B;  1S10 A;  1RG6 A;  2YB1 A;  4O3O A;  2AGQ A;  4OO1 J;  4UAT A;  5DGA A;  4NLB A;  4DLE A;  3DEE A;  4OJL A;  2J6T A;  5AI4 A;  3FDS A;  1SL2 A;  2HMX A;  2H3Z A;  1J2M A;  2W03 A;  2BPC A;  7ICJ A;  4Y2U A;  1B4F A;  4DSI A;  3PV8 A;  2FMQ A;  1ZQR A;  4B9L A;  5KFL A;  2XGP A;  2PKE A;  3QZ8 A;  3E58 A;  4GC6 A;  4GXJ A;  2W54 A;  3RB4 A;  4WJ3 B;  7ICI A;  1SWW A;  2XI9 A;  2O6K A;  4U6P A;  1RXW A;  3RJK A;  8ICX A;  2AXT U;  3PNC A;  1IM4 A;  4O5E A;  5KFF A;  2W9C B;  3WU2 U;  3TAP A;  2KFZ A;  4J9N A;  3V7J A;  2DL0 A;  5HP4 A;  4CDG A;  1H38 A;  5G5G A;  3D2N A;  2F77 X;  3UMC A;  3ZDB A;  8ICY A;  1SZH A;  4TUS A;  7ICN A;  4F92 B;  3K4G A;  4I2I A;  4F8R A;  2R8J A;  4DOB A;  1RYS A;  3SEN A;  1RQL A;  3GIK A;  4JV2 A;  1L7N A;  3M7D A;  3MDA A;  3AU6 A;  4F5P A;  3N7P D;  9ICC A;  2XY7 A;  2LI6 A;  2KVC A;  3WKD A;  2XC9 A;  3LK9 A;  2OEH A;  2OHF A;  2A1J B;  5C5J A;  5L1K A;  3HKZ F;  3OHB A;  2K4E A;  3C29 A;  4KLJ A;  4J9P A;  2BCQ A;  5JTI A;  1TAM A;  3C2K A;  5KFD A;  5IIM A;  3BZK A;  1ZQY A;  5ALD A;  5ALW A;  4PHE A;  3BZC A;  4QWB A;  4ECY A;  1QTM A;  3NS1 A;  2CN1 A;  2GO7 A;  4Q8E A;  4JWN A;  3SQI A;  4Q8F A;  5F9L A;  4F4K A;  8ICG A;  5AK6 A;  1ZYQ A;  5HHH A;  1LV5 A;  3WKB A;  2ZXI A;  8ICO A;  4B9S A;  1IG6 A;  1SV0 A;  3RBD A;  4NM2 A;  2W9B B;  4DS5 A;  4EZ6 A;  2RDJ A;  4R63 A;  3AM9 A;  4LZG A;  1ZQW A;  4FZM A;  2M0N A;  2ASL A;  4QZA A;  1SB3 C;  1NZB A;  5E79 U;  4ELV A;  2C28 A;  4ACO A;  5KFC A;  4QZ8 A;  5HMM A;  8ICC A;  5KFQ A;  5J2H A;  5AM2 A;  2MU2 A;  3QX7 A;  3K75 D;  1YZ7 A;  3PSI A;  3PW0 A;  3AMZ A;  2PFN A;  4PL1 A;  4DFP A;  7ICR A;  3A0H U;  3QNM A;  1SGG A;  5KG4 A;  4E0D A;  1LB2 B;  3EWA A;  4DLG A;  4M0A A;  2HHQ A;  1T3N A;  4TUR A;  2NRW A;  2NYV A;  4UBC A;  5III A;  1WYG A;  7ICS A;  2YB4 A;  4PGY A;  1QQ6 A;  2HSZ A;  2YN4 A;  1X42 A;  1S76 D;  5ALF A;  5DBB A;  5JRT A;  3C23 A;  1RDF A;  3FAH A;  4DSF A;  3LWM A;  4UAS A;  5B5E U;  4DL7 A;  5DG7 A;  1L5U A;  4YR2 A;  5CHG A;  5AKL A;  9ICS A;  7ICP A;  3PX4 A;  5J2J A;  2P66 A;  4Z6F A;  1DK3 A;  5KFJ A;  2NRZ A;  1TK0 A;  5AI5 A;  4QZE A;  4C8K A;  2EZZ A;  4ECQ A;  1BPE A;  1ZD4 A;  4NM1 A;  2QKQ A;  5J0U A;  4ECS A;  2MRL A;  2ODG A;  3IG5 A;  2ZUD A;  2HHT A;  1UCV A;  2QB1 A;  3F2C A;  4LJX A;  1S77 D;  2ZTE A;  4F5O A;  4US9 A;  1B0X A;  1WCN A;  2H5X A;  3HRD D;  2V4R A;  2HBJ A;  1KFD A;  2EAP A;  4PH5 A;  1KEJ A;  5DQG A;  1TAQ A;  2LM1 A;  4IRK A;  5AM3 A;  1JN3 A;  4DSL A;  4F2S A;  2HDO A;  2IOH A;  5HR6 A;  4IC9 A;  3F53 A;  4TQR A;  4J9Q A;  1ZRM A;  2JEI A;  4UAY A;  2E8O A;  3Q8L A;  2YMQ A;  3NAS A;  4KLM A;  2OYY A;  5AM5 A;  4EEY A;  2PFQ A;  2BQ3 A;  1HJP A;  5DG9 A;  3WK7 A;  2JZB B;  2F1H A;  1IXR A;  2W04 A;  2ZUB A;  1TAU A;  2IOF K;  4RNN A;  4BJQ A;  4UAV A;  2WTF A;  4LVS A;  1QSY A;  4YR0 A;  3H7I A;  2QAR B;  3Q8P B;  3M9N B;  4DOC A;  1DK2 A;  2QLT A;  5FP0 A;  5J29 A;  2OCE A;  1ZQA A;  5KT2 A;  4XA5 A;  3GV7 B;  1PVR A;  3QEA Z;  4DSK A;  3QE9 Y;  1N2X A;  2KKP A;  1L3S A;  2FPM A;  3GDX A;  3MDC A;  1MSW D;  1U49 A;  1C7Y A;  1PUZ A;  3T3F A;  5F9N A;  3MFI A;  3BQ0 A;  3KTQ A;  3IG8 A;  5KAF U;  1KLN A;  3RJH A;  8ICU A;  1DGS A;  8ICJ A;  8ICH A;  4U7C A;  1SV0 C;  4KLI A;  5J2D A;  3M8R A;  1ZQV A;  2M9N A;  3TAQ A;  2DPJ A;  3MR2 A;  3SAF A;  1N63 A;  3WK8 A;  4C4T A;  3SAG A;  1BNP A;  5ALR A;  4C4R A;  2RHF A;  2QB0 B;  2NO4 A;  5BPC A;  2F2A B;  5CEH A;  3G6V A;  1L8O A;  2BR0 A;  3PST A;  5AI8 A;  4NL9 A;  1L8L A;  3CNH A;  4RNO A;  5D49 A;  4ZOH C;  4ECV A;  2EDU A;  4YN4 A;  3ED5 A;  2IMW P;  4LZD A;  1K1S A;  2AGP A;  2B21 A;  5J2F A;  5J0Q A;  5J0T A;  1UA1 A;  4FZL A;  4B6J A;  1PK1 B;  4DQR A;  2NRV A;  5DBC A;  3TQ1 A;  4RU9 A;  5KT7 A;  4KLQ A;  3F2D A;  1QSL A;  4J9R A;  2V4Q A;  4KLH A;  1L7P A;  5DLF A;  2RDI A;  5J0P A;  3NRZ A;  4CCH A;  2HCF A;  4XQ8 A;  3KOO A;  3PY8 A;  4UAR A;  2R8K A;  3CW2 C;  4O9M A;  1VDV A;  1ZXI A;  5AKY A;  2Q4T A;  2JEJ A;  2DQN B;  2MSN A;  4KLE A;  8ICR A;  4IQV A;  3BQ1 A;  4I2C A;  8ICP A;  9ICQ A;  2ZJ5 A;  5DB6 A;  3N4M B;  1JRP A;  1WWV A;  4PGX A;  1IV8 A;  4R64 A;  3UQ0 A;  5DB9 A;  4XUS A;  4ED6 A;  2ZTC A;  4RQ3 A;  2DUY A;  2HBL A;  4K4G A;  3KHR A;  3GIJ A;  1KKX A;  1PK3 A;  4J9K A;  3LYS A;  3WKA A;  2H3V A;  4NY8 A;  2F1J A;  2KEY A;  3CP8 A;  4JUZ A;  3T5H A;  3JPP A;  3F2B A;  1ZQK A;  3RH6 A;  9ICL A;  3RB0 A;  2K4I A;  2GH1 A;  3NVZ A;  3PW7 A;  2XY6 A;  3GV8 B;  2ZIW B;  2W3S A;  2KG5 A;  3QYP A;  4BX9 C;  4UB2 A;  1ZQS A;  3ISD A;  5KFZ A;  4IRC A;  3AEV A;  3TAC B;  4YCX A;  3OJU A;  1Z19 A;  3ETL A;  4BWM A;  1NK8 A;  4QZC A;  1Z4O A;  5J0Y A;  5KT4 A;  4C80 A;  2H3Q A;  2A19 A;  4J9L A;  3OPX A;  2KFN A;  2KSO B;  3PMN A;  1L6N A;  3BS5 B;  1X9W A;  4I2J A;  2C2R A;  3AUO A;  4IR1 A;  1MA7 A;  2HOQ A;  1ZQ1 C;  3I76 A;  2R8I A;  2LMR A;  1OW5 A;  3SI8 A;  2PI4 A;  5ALV A;  3ETR A;  7ICF A;  1VLB A;  4CF4 A;  1X2I A;  3ZDA A;  2K4P A;  1Q46 A;  2WHE A;  2ZUC A;  4DQP A;  3NUQ A;  2MAX A;  3C5F A;  4KIT B;  4YD1 A;  5AM4 A;  2ALZ A;  2F8K A;  4Q45 A;  2FPL A;  1YT3 A;  2YY6 A;  3KZI U;  3QU7 A;  4B9T A;  4CNQ A;  1L3T A;  4FBU A;  1UT5 A;  2QAR A;  3HKZ C;  1XSL A;  4RPX A;  2XCP A;  3UQ2 A;  4OJ5 A;  2I1Q A;  1Z4N A;  4P4P A;  2FLL A;  3AL0 B;  2AH5 A;  2LYB A;  2Y1I A;  3CRX A;  1TK8 A;  1CI4 A;  5KFA A;  4B9M A;  5KG2 A;  1D9F A;  4MFA A;  3TFS A;  2I5H A;  2DF4 B;  1KFS A;  4Y2V A;  4GIB A;  3QUT A;  3GII A;  4JK1 A;  3GQC A;  2EAO A;  2P6R A;  2JV3 A;  1XO1 A;  3TAD C;  4PGQ A;  4C8N A;  4M04 A;  4A8E A;  4QW9 A;  3GIM A;  3DV9 A;  4DL6 A;  7ICK A;  2OXO A;  7ICG A;  4F3O A;  9ICT A;  3NRW A;  2Z7J A;  1A6S A;  4ED7 A;  3UXP A;  3PVX A;  2KMD A;  3V72 A;  5CP2 A;  4KLD A;  4CGZ A;  3LVW A;  1X40 A;  4RQ0 A;  4DSE A;  4RQ1 A;  5AM0 A;  2DKZ A;  3K1R B;  3VCB A;  4CE6 A;  4RQM A;  4EEL A;  4QZH A;  3FYH A;  5KFX A;  4NL9 C;  4CRX A;  2JHD A;  1TKD A;  3SD7 A;  4DL4 A;  4RQN A;  2HHW A;  2D3D A;  3ZDC A;  2AU0 A;  8ICL A;  5KFS A;  2K89 A;  1PK1 A;  5AIB A;  2DPI A;  3RJF A;  9ICN A;  5KG6 A;  3HT3 A;  1Q3U A;  4NLN A;  5DQH A;  2GWS A;  3RJG A;  1MQ2 A;  4RPZ A;  2ZIX B;  4YMO A;  1JIH A;  5GTI U;  5KL1 B;  4F5R A;  2PFP A;  2ZXH A;  3RR7 A;  4KN4 A;  5KG1 A;  5J2K A;  1U48 A;  3RRH A;  4KLF A;  3JPT A;  1S0V A;  2V9W A;  4IR9 A;  2R8G A;  4YR3 A;  1SKR A;  2FI1 A;  1DGJ A;  1LKY A;  3IDW A;  2FMP A;  5KG3 A;  4ED8 A;  1NJX A;  1ZOL A;  5KT3 A;  4US8 A;  1Q3V A;  3ISB A;  2ISP A;  4K4H A;  1NOM A;  3EPG A;  5KG0 A;  4BWJ A;  8ICV A;  3TAR A;  3T5J A;  2GOL A;  4R8U A;  4EBE A;  3H8J A;  1NKB A;  4GXK A;  2E3T A;  1ED1 A;  2L5Y A;  3LWL A;  3I1Y A;  1JAL A;  4KLL A;  4DSJ A;  3SAH A;  1DRG A;  5EE3 A;  4YXJ A;  2E5S A;  2DBY A;  3WK6 A;  3GU3 A;  1NKC A;  4DFM A;  4I27 A;  4O5K A;  4OJ6 A;  5CR0 A;  2ZIV B;  3GZF A;  7ICV A;  3MR5 A;  5IIO A;  4QWA A;  3K1Z A;  3M6Z A;  4KX3 A;  3EW9 A;  2C2D A;  3D6J A;  1KL9 A;  3RB6 A;  3IM1 A;  2JGA A;  5D4B A;  1KRP A;  5KFH A;  1TK5 A;  2CRX A;  2WF9 A;  1ZQX A;  3ONN A;  4KLO A;  1UA0 A;  2FLN A;  1ZD2 P;  1N60 A;  4RT2 A;  4RQ7 A;  1F5S A;  4Y2S A;  1OXJ A;  3KKA C;  4P0Q B;  9ICK A;  2A1A A;  3MR6 A;  1C20 A;  4GXI A;  4HYK A;  1N62 A;  4IQT A;  1U4B A;  1N56 A;  3IN5 A;  3MBY A;  2ZJ8 A;  4F71 A;  1FEZ A;  2Y0S C;  1S5L U;  2MA1 A;  1XNS A;  2JRZ A;  2KN7 A;  5C0Y A;  3H8W A;  2DGZ A;  2KHV A;  1X6J A;  1NJW A;  2H3I A;  3OSP A;  4NLK A;  4TUP A;  3PZP A;  3BJY A;  7ICU A;  2JR5 A;  2VA8 A;  1BPD A;  3SYZ A;  3G6Y A;  4RQ8 A;  1ZQP A;  5KG7 A;  3N7R C;  4KTQ A;  2F76 X;  3G6X A;  4F5N A;  1TV9 A;  1SKW A;  4PHA A;  1XO0 A;  3PO5 A;  9ICF A;  3MFH A;  3QUC A;  1PVP A;  2B0C A;  1S0O A;  1KSP A;  3C1Z A;  5KFE A;  1HUO A;  3KKA A;  1FIQ A;  1QSS A;  5KFW A;  1SZP A;  1ARO P;  1NKE A;  3NVY A;  1X66 A;  3RFA A;  2W8K A;  4ECR A;  4MHV A;  2ZG6 A;  4QNL A;  3RAX A;  2DKX A;  3M9M B;  5ALX A;  4KLG A;  3IRU A;  4I28 A;  1WCL A;  4DFK A;  4F4Z A;  1RYR A;  3JPS A;  3RJJ A;  4C0Z A;  3PO4 A;  1T8E A;  3GIL A;  2KVS A;  5IIN A;  2W9C A;  4F93 B;  2FJ6 A;  4AYB F;  3EUB 2;  1CUK A;  9ICE A;  3EZ5 A;  1V38 A;  5DG8 A;  2XGQ A;  5CRX A;  4QZI A;  4DS4 A;  2A3V A;  3PR5 B;  4DL5 A;  4F4Y A;  4P0P A;  4M9N A;  2UVW A;  3IHQ B;  2VA3 A;  5J0S A;  7ICQ A;  2E1E A;  4GLX A;  4M2Y A;  3WK4 A;  9ICI A;  4B9V A;  2UVV A;  3QU2 A;  5ALH A;  2F8L A;  5JU5 A;  2AQ4 A;  1U45 A;  5AK5 A;  2BPG A;  4UB8 U;  5EOZ A;  4QZB A;  1U47 A;  1ECW A;  2RRD A;  3JPN A;  3M1Y A;  3UXN A;  3KFU F;  1T4G A;  4PJ0 U;  4BXO B;  3FC4 A;  1D8B A;  1EXN A;  1ZQN A;  4M6W B;  4C7Z A;  2G06 A;  3JPQ A;  1WWU A;  2E1F A;  4NLC A;  1FFV A;  4DQS A;  4Z6C A;  5IIK A;  2K8C B;  5JUM A;  4Y2T A;  1ZQH A;  1V85 A;  9ICG A;  4JMU A;  1UQV A;  3HPO A;  2KHQ A;  2HI0 A;  2BHN A;  3HIL A;  3HW8 A;  4DF8 A;  1COO A;  4FS2 A;  9ICU A;  4B9U A;  4Q43 A;  2W9A A;  4RQ5 A;  3LDA A;  1ZRN A;  2PXI A;  4J9M A;  4NXZ A;  4ED3 A;  3J81 j;  2JZB A;  3HJE A;  3D2Q A;  4I2E A;  1X9M A;  2WF5 A;  2F44 A;  1MN8 A;  2PFO A;  1SXD A;  4NJ8 A;  5DB7 A;  8ICQ A;  5J2I A;  2YTU A;  3CYM A;  1ZQU A;  2ZTD A;  2A1J A;  1KDH A;  8ICT A;  1J2N A;  2W11 A;  2WAQ F;  1NNL A;  3T5K A;  2KP7 A;  4UB6 U;  9ICH A;  2KE7 A;  4YFK A;  1NZP A;  3T5L A;  1TFR A;  5AIC A;  5DGB A;  1M6Y A;  4MFF A;  4QIW C;  2J6S A;  5AKK A;  9ICR A;  4CF3 A;  1SL1 A;  2G0A A;  2VA2 A;  3M9O B;  1RQN A;  5K4L A;  5KFR A;  3E2E A;  3N7S C;  2HHU A;  4RZR A;  2RLT A;  5KFV A;  4PHP A;  1TE2 A;  2Y0S F;  3NVV A;  1S97 A;  4TUQ A;  3RB3 A;  5ALZ A;  1SKS A;  4YMN A;  3QU9 A;  5KAI U;  1L3V A;  5ALY A;  2K60 A;  3QU5 A;  2XCA A;  2HVH A;  3Q8Q B;  1ZJN A;  4ELT A;  8ICZ A;  4ECU A;  4RQ2 A;  1JI7 A;  1Z00 B;  4F2R A;  5KFT A;  2Y1J A;  1YZ6 A;  4FBT A;  4YMM A;  2AQ0 A;  3QZ7 A;  5EE9 A;  3MC1 A;  3H8M A;  3OHA A;  3NVW A;  2IHN A;  5ALJ A;  2IOF A;  1ZQF A;  4F91 B;  4KN7 A;  3HP6 A;  4F4W A;  1N48 A;  1COK A;  3WK5 A;  3KHH A;  1Z3E B;  4OJP A;  5CB1 A;  3NGD A;  4YQW A;  4O3M A;  4Z6D A;  2W7O A;  4FE3 A;  4HAI A;  3DDH A;  2P6U A;  1ZET A;  3N97 B;  2W3R A;  2BCV A;  3PML A;  2IBK A;  4C8M A;  2KZZ A;  5AKJ A;  4QZF A;  1S8O A;  3O0F A;  2NV3 A;  7ICE A;  1XC9 A;  3BS7 A;  4QZ9 A;  2WB1 C;  4IL6 U;  3ALR A;  4PZO A;  2DFL A;  8ICM A;  1ZQB A;  3UMG A;  5J8Y C;  4JB3 A;  2JMG A;  1UPH A;  5KFU A;  5TZV A;  3L5K A;  2WF8 A;  3V6K A;  4B9N A;  1XWL A;  3NTU A;  3F5A A;  1ZD3 A;  2BZF A;  4UAZ A;  3GV5 B;  1QQ7 A;  2G09 A;  2KZ3 A;  2NRX A;  3H4B A;  9ICV A;  9ICX A;  3MGH A;  4RT3 A;  1LKY B;  5CWR A;  4DL2 A;  4KX5 A;  4KLU A;  1D9D A;  5L1J A;  1JMS A;  4ED0 A;  5DB8 A;  3WKC A;  1FO4 A;  2BCR A;  1CRX A;  1B22 A;  1ZQQ A;  5KTQ A;  4M9H A;  3OGU A;  5DDY A;  4O3R A;  4OD0 A;  2EZY A;  5ALT A;  3IP4 B;  5AHX A;  2KZM A;  4TQS A;  4BGD A;  4F72 A;  4IRD A;  4I2F A;  3V6J A;  1V97 A;  1BPX A;  1Q8K A;  4UBB A;  4O3S A;  2KIC A;  1RXV A;  1NK5 A;  4JV1 A;  3PX6 A;  4ZH4 A;  2HOF A;  1NK0 A;  2UVR A;  4M47 A;  1ZQJ A;  5KFK A;  2PMZ F;  4RQ4 A;  4Y2Y A;  4I2B A;  5T14 A;  4C7Y A;  1L7M A;  1ZD5 A;  4FO6 A;  3WKE A;  2J6U A;  4PHD A;  2EZX A;  3UXO A;  3WK9 A;  7ICL A;  2ZJA A;  8ICK A;  3AQF A;  1KQQ A;  1QCK A;  2B6G A;  5EWG A;  4G3I A;  1QLN A;  5BOM A;  1NJY A;  1ZQM A;  4ECZ A;  4QZD A;  4QWD A;  7ICO A;  4BDP A;  4UB3 A;  3SMV A;  4MF2 A;  4YG2 A;  2XIC A;  1OUQ A;  3OJS A;  2KJ5 A;  4IS7 A;  4PZN A;  3H4D A;  2BGW A;  3QUQ A;  1VJ5 A;  5KFM A;  1JRO A;  3C5G A;  3E0F A;  2NRT A;  3KHG A;  1SWV A;  3AQE A;  1N5W A;  3TAN A;  2DWQ A;  3RR8 A;  4UB1 A;  3KHL A;  3ORY A;  5IIL A;  1ZQG A;  4P0P B;  2VJ5 A;  3OSN A;  1IIP A;  9ICM A;  3KZX A; 
#chains in the Genus database with same CATH homology
 2DPJ A;  4O3P A;  3MR2 A;  3RBE A;  3C2L A;  4UB4 A;  4F50 A;  2ASD A;  4RPY A;  5HNK A;  1S9F A;  1S0O A;  1KSP A;  5J0R A;  3C1Z A;  4M6W A;  5KFE A;  1HUO A;  2KTQ A;  5KFB A;  1QSS A;  1T7P A;  5KFW A;  4MEY A;  2IA6 A;  1SZP A;  5IIJ A;  5BPC A;  1ARO P;  3RH5 A;  5J0W A;  2R8H A;  4O3Q A;  1JX4 A;  3RTV A;  2FPK A;  3G6V A;  1NKE A;  4QWC A;  2W8K A;  1ZQT A;  2HW3 A;  4ECR A;  4O0I A;  8ICB A;  2BR0 A;  4QWE A;  3RAX A;  9ICO A;  4DQI A;  3M9M B;  4KLG A;  4RNO A;  5D49 A;  3PW4 A;  4I28 A;  4XRH A;  1WCL A;  4ECV A;  4DFK A;  4F4Z A;  1RYR A;  3JPS A;  4F4X A;  3THV A;  1NK7 A;  5CA7 A;  2ATL A;  5KFN A;  4YN4 A;  4FS1 A;  2IMW P;  4LZD A;  1K1S A;  3RJJ A;  2AGP A;  3PO4 A;  2B21 A;  5J2F A;  1T8E A;  5J0Q A;  4YP3 A;  5J0T A;  1UA1 A;  3GIL A;  3C21 A;  1Y88 A;  3MAB A;  2W9C A;  4F93 B;  1DOQ A;  2NRV A;  4DQR A;  3M8S A;  5IIN A;  5DBC A;  4DQQ A;  3TQ1 A;  1CUK A;  5KT7 A;  4RU9 A;  9ICE A;  4UAW A;  5KFY A;  4KLQ A;  3EZ5 A;  5KT6 A;  4J9R A;  1QSL A;  3PW2 A;  5J2E A;  4UQG A;  1BPY A;  1KTQ A;  2V4Q A;  2C22 A;  4NLG A;  4KLH A;  8ICA A;  4I2D A;  3RRG A;  3RAQ A;  5DLF A;  2RDI A;  5J0P A;  5DG8 A;  4CCH A;  2XGQ A;  4XQ8 A;  2OWO A;  1ZQZ A;  2LYH A;  4QZI A;  4DS4 A;  3PY8 A;  3PR5 B;  2R8K A;  3C1Y A;  4DL5 A;  4O9M A;  4F4Y A;  2JEJ A;  4M9N A;  4KLE A;  8ICR A;  2UVW A;  2AGO A;  3IHQ B;  4IQV A;  4JV0 A;  5J0S A;  3BQ1 A;  2VA3 A;  7ICQ A;  1ZQL A;  5DQI A;  4ED1 A;  4I2C A;  8ICP A;  9ICQ A;  4DWI A;  2ZJ5 A;  4ECT A;  5J2C A;  5DB6 A;  3JPO A;  4GLX A;  3N4M B;  4Z6E A;  4M2Y A;  4PGX A;  4R64 A;  3UQ0 A;  5DB9 A;  2W9B A;  9ICI A;  4QZG A;  3QEB Z;  4XUS A;  1NK4 A;  4ED6 A;  4B9V A;  2UVV A;  2ZTC A;  4RQ3 A;  3MGI A;  4K4G A;  7ICM A;  3AU2 A;  3KHR A;  8ICW A;  4JWM A;  2HHV A;  4M9L A;  1Z00 A;  3GIJ A;  1BGX T;  5L9X A;  1HUZ A;  2BKE A;  4YXM A;  4R8U B;  2AQ4 A;  1U45 A;  4J9K A;  2MUT B;  2BPG A;  5EOZ A;  4QZB A;  1XS9 D;  1U47 A;  5HML A;  3JPN A;  4I2H A;  3UXN A;  4NY8 A;  2F1J A;  5D46 A;  5DLG A;  1T4G A;  4O3N A;  5BOL A;  4JUZ A;  3Q8S B;  5L1I A;  3T5H A;  3Q8K A;  1S10 A;  4M9J A;  3JPP A;  1ZQK A;  3RH6 A;  4O3O A;  2AGQ A;  1SL0 A;  4BXO B;  9ICL A;  3RB0 A;  5DGA A;  3B0X A;  3PW7 A;  1EXN A;  3Q8R B;  2XY6 A;  3GV8 B;  4P4M A;  1ZQN A;  4DLE A;  4M6W B;  3TI0 A;  3JPQ A;  3BQ2 A;  4UB2 A;  2J6T A;  1ZQS A;  3FDS A;  3ISD A;  2BDP A;  5KFZ A;  1SL2 A;  4IRC A;  1A77 A;  4YCX A;  3OJU A;  3ETL A;  4DQS A;  4Z6C A;  5IIK A;  3TFR A;  5JUM A;  1ZQH A;  1PZN A;  4BWM A;  2BPC A;  1NK8 A;  4QZC A;  1D8Y A;  9ICG A;  7ICJ A;  5J0Y A;  5KT4 A;  4DEZ A;  4DSI A;  3PV8 A;  2FMQ A;  4J9L A;  3HPO A;  1ZQR A;  2KFN A;  3C2M A;  4B9L A;  3PMN A;  5KFL A;  2XGP A;  3RJI A;  2BHN A;  9ICN A;  3HW8 A;  1XSN A;  4DF8 A;  1COO A;  3QZ8 A;  4FS2 A;  3PR4 A;  1X9W A;  4I2J A;  4GXJ A;  4GC6 A;  2C2R A;  3SV3 A;  9ICU A;  3AUO A;  3RH4 A;  5KT5 A;  3RB4 A;  4B9U A;  4IR1 A;  4Q43 A;  7ICI A;  2W9A A;  1JXE A;  4RQ5 A;  2FMS A;  1RXW A;  5CJ7 A;  2R8I A;  3LDA A;  3RJK A;  4J9M A;  2PXI A;  2UVU A;  4NXZ A;  5J2A A;  8ICX A;  3PNC A;  4ED3 A;  1IM4 A;  4O5E A;  5KFF A;  2W9C B;  3SI8 A;  2JZB A;  2PI4 A;  7ICF A;  1X2I A;  5HHI A;  3TAP A;  3ZDA A;  2KFZ A;  9ICJ A;  4J9N A;  3ZDE A;  4I2E A;  3V7J A;  5HP4 A;  1X9M A;  1H38 A;  2W9M A;  4KLS A;  2ZUC A;  2PFO A;  4C8L A;  4DQP A;  4MFC A;  2MAX A;  5DB7 A;  8ICQ A;  3C5F A;  5J2I A;  1D8L A;  4KIT B;  3ZDB A;  8ICY A;  1A76 A;  4YD1 A;  2F1I A;  1ZQU A;  2ALZ A;  2ZTD A;  4Q45 A;  4TUS A;  7ICN A;  4F92 B;  3BDP A;  2VAN A;  2A1J A;  3K4G A;  3H8S A;  4I2I A;  2FPL A;  4Q44 A;  1KDH A;  8ICT A;  4F8R A;  3T5K A;  4B9T A;  9ICH A;  2R8J A;  4YFK A;  5L1L A;  4DOB A;  4J9O A;  1ZQD A;  2PI5 A;  7ICH A;  1RYS A;  1ZQI A;  1L3T A;  3T5L A;  1TFR A;  1CEZ A;  4FBU A;  5DGB A;  1UT5 A;  4M9G A;  3PX0 A;  4KLT A;  1XSL A;  4RPX A;  2XCP A;  3GIK A;  4MFF A;  4JV2 A;  3UQ2 A;  3MDA A;  3AU6 A;  4F5P A;  2I1Q A;  1XSP A;  2MUT A;  2J6S A;  9ICR A;  4P4P A;  2FLL A;  2Y1I A;  1SL1 A;  1BPB A;  2VA2 A;  9ICC A;  2XY7 A;  1TK8 A;  4DF4 A;  5KFA A;  3M9O B;  4MEX A;  5KFR A;  4B9M A;  4YD2 A;  5KG2 A;  2XC9 A;  3LK9 A;  1D9F A;  4MFA A;  5KFI A;  3E2E A;  2AJQ A;  2A1J B;  2HHU A;  8ICN A;  8ICI A;  5C5J A;  4RZR A;  2JEG A;  5L1K A;  1U9L A;  3OHB A;  3MR3 A;  3TFS A;  5KFV A;  4KLJ A;  4UB5 A;  4J9P A;  2BCQ A;  4P2H A;  1KFS A;  4PHP A;  3GFK B;  3C2K A;  1S97 A;  1KFT A;  4TUQ A;  3GII A;  3RB3 A;  1SKS A;  4YMN A;  5KFD A;  2ASJ A;  1L3V A;  4JK1 A;  2XCA A;  3GQC A;  1ZJM A;  2HVH A;  3V7K A;  5IIM A;  2P6R A;  3Q8Q B;  1ZJN A;  4ELT A;  8ICZ A;  1XO1 A;  3RJE A;  4PGQ A;  4C8N A;  1ZQY A;  4RQ2 A;  4ECU A;  4M04 A;  1Z00 B;  4PHE A;  3ZD9 A;  4QW9 A;  4F2R A;  1X9S A;  3GIM A;  4DL6 A;  4QWB A;  5KFT A;  2Y1J A;  1MC8 A;  7ICK A;  4DL3 A;  4ECY A;  4F3O A;  4FBT A;  4YMM A;  5KFG A;  1QTM A;  7ICG A;  4IQU A;  9ICT A;  2AQ0 A;  3QZ7 A;  4EBC A;  4ED7 A;  3UXP A;  3PVX A;  3OHA A;  4YVZ A;  3HX0 A;  2IHN A;  2IHM A;  4Q8E A;  1ZQF A;  3V72 A;  5CP2 A;  4KLD A;  4F91 B;  4JWN A;  4KN7 A;  4Q8F A;  5F9L A;  3HP6 A;  4F4W A;  1V9P A;  4RQ0 A;  4F4K A;  1N48 A;  1ZYQ A;  8ICG A;  5HHH A;  4DSE A;  1LV5 A;  4DFJ A;  4RQ1 A;  3KHH A;  8ICO A;  1Z3E B;  1NK6 A;  5CB1 A;  1K1Q A;  3NGD A;  4YQW A;  4EZ9 A;  1JXL A;  4B9S A;  4Z6D A;  3RBD A;  4NM2 A;  4RUC A;  2W9B B;  4DS5 A;  4EZ6 A;  2RDJ A;  4R63 A;  4LZG A;  1ZQW A;  5DKW A;  9ICB A;  4QZH A;  2P6U A;  1ZET A;  3FYH A;  5KFX A;  2ASL A;  4QZA A;  8ICE A;  4ECX A;  3N97 B;  4MF8 A;  2XY5 A;  1TKD A;  4ELV A;  2C28 A;  4DO9 A;  2BCV A;  3PML A;  5KFC A;  4C8M A;  3EYZ A;  2IBK A;  2KZZ A;  4QZ8 A;  5EWF A;  4DL4 A;  1BPZ A;  2HHW A;  5HMM A;  4QZF A;  1UT8 A;  3ZDC A;  8ICC A;  5KFQ A;  1L3U A;  7ICE A;  2AU0 A;  1XC9 A;  5J2H A;  4QZ9 A;  2HHS A;  4IQW A;  8ICL A;  5J0X A;  5J2B A;  5KFS A;  4GC7 A;  2DPI A;  3RJF A;  3K75 D;  5KG6 A;  3HT3 A;  2I9G A;  3PW0 A;  2DFL A;  2PFN A;  4I2G A;  4NLN A;  8ICM A;  1ZQB A;  5EWE A;  5DQH A;  4X5V A;  4DFP A;  2GWS A;  1MQ2 A;  3RJG A;  4RPZ A;  7ICR A;  2FLP A;  2W8L A;  4P4O A;  5KFU A;  4YMO A;  1JIH A;  5TZV A;  3SV4 A;  4RNM A;  3V6K A;  4F5R A;  4B9N A;  2BPF A;  2PFP A;  2ISO A;  3RR7 A;  3SZ2 A;  1S0N A;  5KG4 A;  1XWL A;  3NTU A;  4KN4 A;  4E0D A;  5KG1 A;  5J2K A;  1U48 A;  3EWA A;  4DLG A;  3RRH A;  3JPT A;  4ECW A;  1LB2 B;  2BCU A;  4KLF A;  4M0A A;  2HHQ A;  1T3N A;  4UAZ A;  3GV5 B;  2V9W A;  4IR9 A;  1S0V A;  2R8G A;  4YR3 A;  1SKR A;  4TUR A;  2KZ3 A;  1BVS A;  2HVI A;  2NRW A;  3JPR A;  1ZQE A;  4UBC A;  2Q0Z X;  8ICF A;  5III A;  7ICS A;  2NRX A;  4DOA A;  2FMP A;  4QW8 A;  4PGY A;  5KG3 A;  3H4B A;  4ED8 A;  2BQU A;  8ICS A;  9ICV A;  9ICX A;  3MGH A;  1NJX A;  5KT3 A;  4I2A A;  1QLN A;  1S76 D;  4RT3 A;  5DBB A;  3ISB A;  3C23 A;  2ISP A;  4K4H A;  1NOM A;  3LWM A;  3EPG A;  5CWR A;  4ED2 A;  4DSF A;  4DL2 A;  4KLU A;  5KG0 A;  4BWJ A;  5DDM A;  1D9D A;  4DL7 A;  1RPL A;  1MQ3 A;  4RQ6 A;  8ICV A;  5DG7 A;  1L5U A;  5L1J A;  4YR2 A;  1JMS A;  5CHG A;  9ICS A;  3TAR A;  1NJZ A;  9ICA A;  3PX4 A;  7ICP A;  5J2J A;  4ED0 A;  2P66 A;  5DB8 A;  4I29 A;  9ICW A;  4Z6F A;  3T5J A;  5KFJ A;  2NRZ A;  4R8U A;  1TK0 A;  4QZE A;  4EBE A;  4C8K A;  3H8J A;  4ECQ A;  1XU4 A;  1NKB A;  1B43 A;  4EYH B;  2BCR A;  4GXK A;  1B22 A;  1BPE A;  1ZQQ A;  1S0M A;  5KTQ A;  4M9H A;  3LWL A;  3OGU A;  5DDY A;  4NM1 A;  4O3R A;  4KLL A;  5J0U A;  4ECS A;  4DSJ A;  4K4I A;  4ELU A;  2KZM A;  4TQS A;  4BGD A;  2ZUD A;  4YXJ A;  4IRD A;  4I2F A;  3V6J A;  2HHT A;  1BPX A;  4F5Q A;  3ISC A;  1NKC A;  2ZTE A;  2JEF A;  1S77 D;  4DFM A;  4I27 A;  4O5K A;  4UBB A;  4O5C A;  5CR0 A;  4R65 A;  4J9S A;  1RXV A;  4O3S A;  3PW5 A;  7ICV A;  4F5O A;  3MR5 A;  2C2E A;  5IIO A;  4QWA A;  1WCN A;  1NK5 A;  4JV1 A;  2H5X A;  5KFP A;  4ZH4 A;  2V4R A;  3PX6 A;  1KFD A;  5DQG A;  3EW9 A;  1KEJ A;  4PH5 A;  1NK0 A;  2UVR A;  2C2D A;  4KMU A;  4M47 A;  3ZD8 A;  1ZQJ A;  1TAQ A;  5KFK A;  5DBA A;  3RB6 A;  4NLZ A;  4IRK A;  5J0O A;  3IM1 A;  1JN3 A;  5D4B A;  1KRP A;  4DSL A;  4RQ4 A;  4F2S A;  4EBD A;  5KFH A;  1RZT A;  4I2B A;  1TK5 A;  4TQR A;  4J9Q A;  1ZQX A;  4KLO A;  1UA0 A;  3B0Y A;  2JEI A;  4UAY A;  2FLN A;  3Q8L A;  2BCS A;  4FO6 A;  4KLM A;  4RT2 A;  4RQ7 A;  2J6U A;  4PHD A;  3UXO A;  4EEY A;  4BXO A;  2PFQ A;  1ZQC A;  2BQ3 A;  1HJP A;  9ICK A;  7ICL A;  5DG9 A;  2ZJA A;  4EYI B;  2JZB B;  2F1H A;  8ICK A;  1IXR A;  4C8O A;  3UPQ A;  5KG5 A;  3MR6 A;  2ZUB A;  4GXI A;  1TAU A;  4RUA A;  4HYK A;  4RNN A;  4IQT A;  3V7L A;  5EWG A;  1U4B A;  1N56 A;  4G3I A;  2WTF A;  4LVS A;  3MBY A;  2ZJ8 A;  3H7I A;  4YR0 A;  3Q8P B;  5BOM A;  3M9N B;  4DOC A;  1QSY A;  1NJY A;  3HWT A;  3ZDD A;  3V6H A;  1ZQM A;  4ECZ A;  4QZD A;  4QWD A;  7ICO A;  1ZQO A;  2HHX A;  5J29 A;  4BDP A;  4UB3 A;  4R66 A;  1ZQA A;  9ICP A;  4MF2 A;  4YG2 A;  5KT2 A;  4XA5 A;  3GV7 B;  3EPI A;  3QEA Z;  4DSK A;  2KN7 A;  3OJS A;  3H8W A;  3QE9 Y;  3H4D A;  2BGW A;  5KFM A;  1NJW A;  1NK9 A;  2BQR A;  1L3S A;  2FPM A;  3GDX A;  3MDC A;  3OSP A;  1MSW D;  4NLK A;  5KFO A;  1U49 A;  1C7Y A;  4TUP A;  3BJY A;  7ICU A;  3H40 A;  2VA8 A;  3C5G A;  3T3F A;  5F9N A;  3Q8M A;  1BPD A;  5J2G A;  3MFI A;  3BQ0 A;  3KTQ A;  2NRT A;  3KHG A;  3SYZ A;  3G6Y A;  4RQ8 A;  1KLN A;  1ZQP A;  4PPX A;  5KG7 A;  4KTQ A;  3G6X A;  4F5N A;  3RJH A;  1TV9 A;  2XO7 A;  3TAN A;  8ICU A;  3RR8 A;  7ICT A;  4UB1 A;  3KHL A;  3BQT A;  4PHA A;  1SKW A;  1DGS A;  8ICJ A;  8ICH A;  3ORY A;  1TVA A;  5IIL A;  4KLI A;  1ZQG A;  5J2D A;  3PO5 A;  3M8R A;  9ICF A;  1ZQV A;  3MFH A;  2M9N A;  3OSN A;  9ICM A;  3TAQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...