3K4GA

Crystal structure of e. coli rna polymerase alpha subunit c-terminal domain
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
83
structure length
78
Chain Sequence
PEFDPILLRPVDDLELTVRSANCLAEAIHYIGDLVQRTEVELLTPNLGSLTEIDVLASRGLSLGMRLENWPPASIADE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the Escherichia coli RNA polymerase alpha subunit C-terminal domain.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Transferase
molecule keywords DNA-directed RNA polymerase subunit alpha
total genus 18
structure length 78
sequence length 83
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2009-10-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3k4gA00
4YXJA 1NKCA 1RXWA 2JEFA 4P4MA 4B9LA 4O3QA 3KTQA 5J2GA 3TAQA 5DB6A 5CWRA 8ICKA 4TQSA 4QWAA 3UXPA 5D4BA 4M9LA 2VA8A 5KFGA 9ICPA 4UBCA 2HHWA 4R63A 4QZIA 9ICWA 5DBBA 2W9BB 3HX0A 3UQ0A 3TAPA 1NK5A 3RJFA 2XY7A 3PR5B 1BPEA 3GIMA 5KG7A 5IINA 1U49A 5KFXA 3C5FA 3PX0A 4DEZA 3UPQA 4KLJA 3C1YA 4XA5A 3RJKA 4F5NA 4QZHA 1PZNA 2JEGA 4O0IA 1KDHA 4J9NA 3TFRA 2XY5A 4B9SA 1CEZA 4ED6A 2B21A 4LVSA 4EBDA 1ZQEA 3V7JA 1K1SA 1ZQUA 5KFJA 5KFEA 1A77A 3GFKB 4RQ2A 2J6TA 4YR3A 4R66A 5L1JA 5DBCA 5J2DA 4UB4A 3OSNA 3PW7A 4DSEA 2PFQA 3E2EA 9ICKA 1KFDA 4RT2A 1ZETA 8ICJA 4PGXA 3RJHA 2BR0A 4Q8EA 1D9DA 3LWMA 1BPXA 1NK7A 3ISCA 4O3SA 4DWIA 1UT8A 2IA6A 4DF8A 3HP6A 4GLXA 4Z6DA 4O3OA 3LDAA 4KLUA 3EYZA 4ECSA 1UA0A 2ISPA 1ZQSA 2IMWP 9ICHA 5J0YA 3PY8A 2W8LA 1XC9A 2FMSA 2W9CA 2HHVA 4B9TA 4ZH4A 3BQ2A 1ZQAA 3PMLA 2VA2A 3RAXA 5KFOA 4EYHB 4F3OA 9ICTA 2UVVA 3T5LA 2W9BA 4ELVA 1SKSA 4X5VA 4FS2A 4BXOB 5DQIA 3LK9A 4RQ4A 3JPOA 3H4DA 5J2AA 1XS9D 5J2KA 5KFFA 4BXOA 2KTQA 4RUAA 1HUOA 2R8HA 2P6RA 4FO6A 4PGYA 3RJIA 4R65A 4Z6CA 4XUSA 4RQ1A 5CR0A 4TURA 4F50A 4ED2A 3QE9Y 4K4IA 2BDPA 5J2JA 3M9OB 4UAZA 2BCRA 5J2FA 8ICXA 4I2DA 2XGQA 3KHRA 1ZQJA 3PW2A 1A76A 2C22A 2C2EA 3PO5A 1ZQKA 4O3RA 8ICVA 3KHLA 2BCVA 2HW3A 4YP3A 2BKEA 3RJJA 4LZDA 5J2HA 3PW0A 1ZQPA 2FMQA 4Z6EA 5KFDA 2P66A 2MAXA 4F93B 2ASJA 1WCNA 3JPQA 1MSWD 3RJEA 5JUMA 3BQ0A 7ICPA 5KFIA 5DBAA 4YQWA 2PI4A 4QWBA 5HMLA 2W9AA 1XSPA 4QZCA 2I9GA 2ASDA 4NLNA 4BWJA 4DLEA 3FYHA 5L9XA 5TZVA 5J0TA 4DS4A 2Q0ZX 5KFQA 4RT3A 1QSYA 1JIHA 4ED0A 4MEYA 1NKBA 1KEJA 1JMSA 4DSJA 2NRTA 3RBDA 4ECUA 5DG7A 4O3PA 2JEIA 4QZGA 1S76D 3Q8MA 4DO9A 3HT3A 3QEAZ 4KTQA 8ICZA 7ICQA 4I2GA 4DOAA 1NKEA 4KLMA 2MUTA 3SV3A 4IRKA 5J2IA 4M9NA 4DL3A 5DB9A 4BDPA 4J9LA 4I27A 4DSLA 5KFUA 4DQQA 1SL2A 2R8GA 4F8RA 3GV8B 3H7IA 2AU0A 3M9NB 4DLGA 4I2AA 2AQ0A 1MC8A 4BGDA 1UT5A 5KFKA 3GQCA 3ZDEA 3Q8LA 5DB8A 2HVIA 4DL7A 4EZ9A 2W8KA 3SI8A 1ZQIA 8ICYA 4NM2A 2I1QA 9ICNA 2R8IA 3NTUA 1T7PA 4ELTA 8ICEA 4PHDA 7ICVA 4Q44A 4M9GA 2Y1JA 5DB7A 1X9WA 3HPOA 5BPCA 4NLKA 2V9WA 3GILA 5KFZA 2WTFA 5CHGA 4RPYA 5KG1A 3MFIA 3QZ8A 1L5UA 4EZ6A 3NGDA 2FPKA 4J9QA 3RBEA 1L3SA 4I2JA 1KSPA 5IIKA 4YMOA 3RJGA 2ALZA 4DQIA 9ICCA 3B0XA 5CA7A 4QZ9A 4KLDA 3GIKA 1UA1A 3RR8A 4PPXA 4Z6FA 1BPZA 2KZMA 3N4MB 4ECTA 1WCLA 7ICKA 2ZUBA 5F9NA 3SYZA 1NOMA 3BQ1A 4M47A 5HHIA 1SL0A 1ZQMA 2BCQA 2W9MA 2C2RA 4F2RA 8ICLA 2AJQA 1S77D 3M8SA 5D49A 2ZTEA 2ZJ5A 1ZQWA 4F4ZA 7ICIA 7ICUA 2R8KA 1NJZA 5KFWA 3OGUA 4O5EA 4DFMA 3HWTA 2W9CB 4KLSA 4BWMA 2HHTA 3K75D 4G3IA 3T5KA 4TUQA 4J9MA 1QLNA 3BQTA 3KHHA 4LZGA 4EEYA 2DPIA 3EZ5A 4IQUA 2PFNA 4DSIA 3C21A 5KT2A 8ICFA 2AGPA 1D8LA 1Z3EB 3Q8KA 1S0MA 4MF2A 4UAYA 1BVSA 5KFNA 4DQSA 3RB0A 2UVUA 1ZQVA 5KG5A 4ED7A 1RXVA 4KLLA 2FLNA 2FMPA 4QZ8A 4M2YA 4KLIA 7ICHA 2BPGA 5KFAA 1XWLA 1RPLA 2ASLA 1NK8A 2C2DA 4O5KA 3AU2A 4F5PA 3RB3A 5DQGA 2BCSA 2IHNA 2DPJA 4NLGA 4TUSA 4QWDA 5IIMA 4FBTA 3ISDA 1XU4A 2FPLA 8ICGA 3T3FA 3GIIA 9ICEA 4UQGA 1ZQQA 1ZQCA 4DQPA 2KZ3A 3V6JA 1ZQBA 2HHUA 2PXIA 2R8JA 4DQRA 3H8SA 1N48A 7ICSA 1SZPA 4M6WA 1KRPA 4YN4A 1X2IA 1QSLA 9ICUA 3B0YA 4F92B 4EBEA 9ICSA 4IQTA 4EYIB 4ELUA 2NRZA 1Z00B 5C5JA 5L1IA 1IM4A 2MUTB 1ZQOA 3UXOA 4GC6A 4KLHA 1U9LA 4F91B 3QEBZ 3K4GA 4F4XA 4JV0A 2UVRA 1S0VA 2RDJA 2HHXA 3MR5A 1CUKA 1ZQXA 4QW8A 5KFSA 3PVXA 2XCAA 3GV7B 8ICMA 1NK4A 4DSKA 2ZUCA 3ZDAA 4KMUA 3H8WA 3JPRA 3T5JA 4C8MA 3OHBA 3RH5A 2HHSA 1X9SA 3G6VA 4YD1A 4TQRA 1S0NA 1ZQLA 3C2MA 1TK8A 2NRVA 4QWEA 5DDYA 5J2EA 1JX4A 1ZQRA 3RRGA 8ICIA 2PFPA 7ICRA 2ISOA 1KFTA 4KLQA 7ICLA 4UB3A 1S9FA 4JV1A 2VA3A 4ED8A 5L1LA 7ICJA 2F1HA 1MQ2A 2LYHA 2BQ3A 3AUOA 3V6KA 5DKWA 1TKDA 4F4KA 3Q8PB 8ICTA 5J2CA 4GXJA 3UQ2A 1U45A 4B9VA 2BPFA 3MR6A 7ICTA 4MF8A 3RAQA 3EW9A 2BGWA 4MFAA 5KG6A 9ICLA 4RU9A 4IRCA 4PGQA 4MEXA 2BPCA 4RZRA 4IQWA 2ZJAA 5KFVA 3PV8A 3OSPA 9ICGA 1N56A 5IIOA 4FBUA 1SKWA 4NLZA 3ZDBA 2A1JB 1H38A 5CB1A 4UAWA 4GXIA 2ZTCA 5KFHA 1EXNA 3RB6A 4RNNA 2XGPA 3TI0A 3BDPA 2XCPA 2P6UA 8ICUA 4KLEA 3OHAA 5DDMA 1TAQA 4RPXA 3GDXA 2BHNA 2NRXA 4NY8A 3N97B 4QW9A 1TV9A 3JPTA 4GXKA 2V4RA 3G6YA 1T3NA 4YVZA 2DFLA 4IQVA 5CP2A 4J9KA 4C8LA 3BJYA 4I2EA 5KFBA 2RDIA 2F1IA 4C8NA 4F5OA 3PX4A 3ZDCA 3PW5A 1DGSA 1JXLA 3MABA 2J6UA 1X9MA 1BPYA 4KITB 4RNMA 3MDCA 4C8OA 1S97A 4ED3A 3RRHA 3ETLA 2ZTDA 3OJUA 4F4YA 4DFPA 9ICIA 5J29A 4Q8FA 4RNOA 4DL2A 3FDSA 5HHHA 5KG3A 5KT6A 4Q43A 2HVHA 3RB4A 2F1JA 8ICSA 1TK5A 5DGBA 3ISBA 3H8JA 4B9UA 1ZQYA 4R64A 4JV2A 1TAUA 2AGOA 3G6XA 4DL6A 9ICJA 3PW4A 4F2SA 1V9PA 5J0UA 1XSLA 2KN7A 3ZDDA 1RZTA 5CJ7A 5BOLA 4C8KA 3TANA 8ICRA 2PI5A 2OWOA 3V7KA 4RQ7A 4O3NA 4F4WA 4M6WB 3C23A 5IILA 4IR1A 3PNCA 1NK0A 4DFJA 3C1ZA 4JUZA 5J0RA 4YCXA 4ECYA 1ZQHA 9ICAA 4DF4A 5KFRA 4DS5A 3MDAA 3TQ1A 4DOCA 2KFZA 4JWNA 4M9JA 4P4OA 4P2HA 2ATLA 8ICPA 3Q8RB 9ICMA 5KFMA 8ICAA 4QZAA 4FS1A 3SV4A 3H40A 1C7YA 1RYRA 3PX6A 2AGQA 4B9MA 5DQHA 1DOQA 5KFYA 9ICFA 4RQ8A 9ICQA 7ICEA 4Q45A 2JZBB 4RUCA 4DL4A 5KFLA 5J0WA 3GIJA 2Y1IA 4YD2A 1KTQA 3AU6A 2XO7A 5KT4A 5DGAA 3MR3A 7ICNA 1Z00A 3EWAA 3RH4A 3C2KA 5HMMA 4QZBA 5EOZA 4JWMA 3ORYA 2XC9A 4DL5A 1SL1A 1HUZA 4I2HA 1T8EA 4RQ3A 3T5HA 4YR2A 3ZD8A 5DLFA 1NJWA 2NRWA 3IHQB 4PHAA 1SKRA 4PHPA 1QSSA 7ICFA 5J2BA 4IRDA 4YMMA 3OJSA 4QZEA 8ICBA 4O9MA 5DG8A 3JPNA 4ED1A 3RH6A 4UB1A 4P4PA 2AQ4A 2FLPA 1JXEA 3TFSA 2C28A 4R8UB 9ICXA 4YR0A 7ICGA 1BPBA 4R8UA 4QZFA 5J0OA 1ZQGA 1COOA 4DFKA 1ZQZA 2VANA 3LWLA 5HNKA 4YG2A 1HJPA 1U48A 1S10A 1ZQDA 2UVWA 4E0DA 2BQRA 5KT5A 9ICVA 4HYKA 4UB5A 1NK6A 8ICNA 4M9HA 4QZDA 3M8RA 4ECQA 1ZJMA 3M9MB 1LV5A 1ZQNA 1BPDA 4YMNA 3H4BA 1ZQTA 4QWCA 5KFTA 1IXRA 4I2BA 5J0QA 3MGIA 4J9SA 4F5RA 5EWFA 4KN4A 2XY6A 4TUPA 1LB2B 4RQ5A 1AROP 3V72A 4ECZA 2GWSA 3RR7A 1QTMA 3TARA 5KG2A 5DG9A 8ICWA 4J9OA 2J6SA 2KFNA 4O5CA 1TK0A 2PFOA 3RTVA 8ICOA 4RPZA 4UBBA 1MQ3A 1TFRA 5J0XA 5BOMA 3MR2A 4KLTA 1TVAA 4CCHA 2HHQA 8ICQA 1D9FA 1XSNA 4KN7A 1K1QA 1T4GA 5IIJA 1ZJNA 4KLFA 4J9PA 3JPPA 2A1JA 4I2FA 4NXZA 1L3UA 2FLLA 4MFCA 4I28A 4PHEA 3V6HA 2BCUA 4I29A 4YXMA 3Q8QB 5EWGA 1ZYQA 5KT7A 2JEJA 1RYSA 4KLOA 8ICCA 3KHGA 4KLGA 4ECVA 5KFPA 1NJXA 1U47A 3EPGA 5J0PA 3EPIA 2H5XA 1B22A 4UB2A 2IBKA 1KFSA 7ICMA 3IM1A 3MGHA 2KZZA 1U4BA 7ICOA 9ICOA 3C2LA 3PMNA 5KFCA 1S0OA 1NK9A 3SZ2A 4DOBA 4RQ6A 1KLNA 2ZUDA 1B43A 4ECRA 3PO4A 1XO1A 5IIIA 9ICBA 4PH5A 4J9RA 4GC7A 1L3TA 4B9NA 5J0SA 5L1KA 5KG0A 1JN3A 4F5QA 3PR4A 4EBCA 1BGXT 4YFKA 3UXNA 5KTQA 1NJYA 4M04A 3Q8SB 3JPSA 3V7LA 2M9NA 4IR9A 4M0AA 3ZD9A 2BQUA 5EWEA 4RQ0A 4ECXA 4I2IA 4MFFA 1ZQFA 4K4HA 4NM1A 2ZJ8A 9ICRA 4JK1A 3MBYA 8ICHA 4ECWA 3MFHA 5KG4A 4I2CA 1L3VA 1Y88A 2JZBA 3THVA 3C5GA 5D46A 5KT3A 3QZ7A 2IHMA 5HP4A 4XQ8A 3HW8A 3GV5B 4K4GA 2V4QA 5F9LA 1D8YA 4XRHA 5DLGA 2FPMA 4DSFA
chains in the Genus database with same CATH superfamily
1F44A 3FAHA 4YXJA 2DBYA 3KTQA 5DB6A 2KG5A 3CYMA 4TQSA 2VA8A 5KL1B 2HHWA 4QZIA 1NK5A 2XY7A 1BPEA 1U49A 3PX0A 3UPQA 3C1YA 2KSOB 1KDHA 2XY5A 4UW9A 5KFJA 5KFEA 4RQ2A 5J2DA 3PW7A 4DSEA 9ICKA 4RT2A 1ZETA 1OW5A 1NZPA 4PGXA 1D9DA 1BPXA 3UMGA 4DF8A 3HP6A 4Z6DA 2ZXHA 3N7PD 1L6NA 5AHXA 5J0YA 2FMSA 4C0ZA 4B9TA 3IP4B 5KFOA 3IDWA 2LM1A 4CGZA 9ICTA 4ELVA 2PMZC 3LK9A 4RQ4A 3WKDA 5J2AA 5J2KA 4BJQA 3SENA 4RUAA 3RJIA 4R65A 4XUSA 3QE9Y 5J8YA 1L7NA 5ALNA 3M9OB 3D2SA 2XGQA 3KHRA 2C2EA 1UHUA 1YZ7A 3PW0A 1ZQPA 2P66A 1MSWD 1WCNA 4OD0A 2G08A 5DBAA 1ED1A 2KSOA 4QWBA 5ALUA 3F2BA 2K8CB 4QZCA 5ALLA 2I9GA 4DLEA 2WB1F 3BS7A 5J0TA 1Q3UA 2Q0ZX 1QSYA 4MEYA 3ICXA 4LJXA 1DRGA 1JMSA 3SAHA 4DSJA 2NRTA 3RBDA 3AEVA 4O3PA 1KW4A 2EAMA 4QZGA 1S76D 3QEAZ 8ICZA 4KTQA 4FZMA 4C4SA 4DOAA 4M9NA 4DL3A 1Z4OA 5AKXA 5KFUA 3H7IA 5ALGA 3M9NB 4DLGA 3RFAA 1MC8A 4BGDA 3ZDEA 3Q8LA 2HVIA 1F0MA 4NM2A 1LKYB 2R8IA 5AKKA 4ELTA 8ICEA 1O03A 3ED5A 2K4HA 3ONNA 4NLKA 5BPCA 3TKAA 2V9WA 1L5UA 3QZ8A 1N2XA 1B4FA 3QYPA 3RJGA 4DQIA 3BZKA 2H3QA 5CA7A 1BPZA 2KJ9A 1RG6A 3BQ1A 5KL8B 2W9MA 8ICLA 1S77D 1ZQWA 2L5YA 2B0CA 1NJZA 1N5XA 2W9CB 2E1EA 4LZGA 4EEYA 2PFNA 4DSIA 2FDRA 3E0FA 3RF9A 1S0MA 2Y0SC 3RB0A 2ZIXB 2FMPA 1NI3A 2AHOB 5KFAA 2ASLA 1RPLA 1NK8A 5G5HA 2N1RA 4F5PA 4MHVA 5IIMA 2KIWA 3L5KA 2GOLA 3ISDA 2FPLA 3OTQA 2KE7A 3H0MB 5L1MA 2PXIA 1SGGA 3HRDD 5AI8A 4M6WA 1KRPA 9ICUA 1QSLA 3B0YA 1XNSA 3NVWA 1Z00B 2WF5A 5C5JA 3DDHA 3UXOA 4F91B 3KKAC 2DWQA 2UVRA 4JV0A 3KFUF 3MR5A 3PVXA 3AM9A 3F2DA 3H8WA 3PSIA 2HHSA 3G6VA 4YD1A 3C29A 1S0NA 2NRVA 3H0LB 5DDYA 5J2EA 1ZQRA 1KFTA 3D2QA 4PL1A 2VA3A 2NYVA 2F1HA 3WKCA 1MQ2A 3AUOA 5DKWA 3K1ZA 2OH2A 3WK9A 3RAQA 3EW9A 2GLEA 4EENA 4IRCA 4MEXA 4IQWA 3OSPA 2DL0A 1SKWA 2A1JB 1H38A 5CB1A 4GXIA 2ZTCA 2LYBA 2P6UA 3NVVA 8ICUA 1TAQA 3F5EA 3GDXA 3H8MA 2OYYA 5CRXA 3JPTA 2KNJA 3G6YA 5ALKA 2DFLA 4IQVA 4C80A 4C8NA 3ZDCA 3DV9A 3D6JA 4RNMA 4Y2XA 3RRHA 3BS5A 2ZTDA 4F4YA 5J29A 1QQ5A 2HI0A 4RNOA 5HHHA 5KT6A 2CRXA 4R64A 4JV2A 4DL6A 2JGAA 2RQ5A 5J0UA 1ZQ1C 4C8KA 2OWOA 3V7KA 4O3NA 4F4WA 2K89A 4NV0A 1NK0A 4CF3A 3HKZF 4YCXA 4DF4A 2W11A 1SWVA 5EE0A 3MDAA 4Y2QA 2HDOA 4QZAA 2B6GA 2AGQA 1RYRA 3WK8A 4B9MA 5AK5A 9ICQA 1V97A 1S8OA 4YD2A 1KTQA 3AU6A 5EE9A 4OJ5A 5DGAA 3MR3A 7ICNA 4QZBA 3ZD8A 5DLFA 1WWVA 7ICFA 2F8KA 5J2BA 2Q4TA 1N61A 8ICBA 9ICMA 3JPNA 2C28A 4YR0A 4QZFA 2W7PA 1U48A 1ZQGA 1ZQZA 3LWLA 3NRZA 2BQRA 4CDGA 5KT5A 4HYKA 2XICA 1NK6A 2G09A 3M8RA 4YMNA 4QWCA 1IXRA 5EWFA 2GWSA 3V72A 4ECZA 5C0YA 3TARA 4J9OA 4GFJA 5AIAA 4O5CA 2PFOA 1XO0A 4RPZA 4UBBA 4QNLA 2HHQA 1HIWA 3PSPA 1UQVA 5IIJA 4KLFA 2ZXIA 4J9PA 4I2FA 2FLLA 5ALVA 1SB3C 2YY6A 4YXMA 1ZYQA 3M6ZA 2ZIVB 4KLGA 3EPGA 5J0PA 1X6IA 5ALWA 1KFSA 7ICMA 2KZZA 4A8EA 1L7PA 3SZ2A 4DOBA 1B43A 2LBOA 4NL9A 1ZD4A 1PK3A 4PH5A 3HILA 5J0SA 5AM2A 3E58A 1NJYA 3Q8SB 2M9NA 2QARB 4EX7A 2EANA 1GO3F 3MFHA 1L3VA 1Q3VA 2JZBA 5D46A 5HP4A 3HW8A 4XRHA 4UAUA 5B66U 4JB3A 5J2GA 3SQIA 5CWRA 2F44A 1ZXIA 4QWAA 4M9LA 4UASA 1KQQA 9ICWA 3RJFA 3HX0A 3UQ0A 3PR5B 3KOOA 5KG7A 5IINA 5KFXA 5JRTA 1A6SA 4F5NA 4QZHA 2JEGA 4QIWC 4O0IA 5KNIA 4B9SA 3TFRA 1CEZA 1ZQEA 3V7JA 1A77A 4R66A 4UB4A 1KFDA 8ICJA 3CNHA 2KJ5A 4O3SA 4DWIA 2W04A 1RDFA 3WK6A 3WU2U 3KZIU 2VJ4A 3LDAA 4NJ8A 4UB8U 1UA0A 2IMWP 1XC9A 2JHDA 2W9CA 2I5HA 3BQ2A 3PMLA 1SV4A 1J2NA 4F3OA 5ALPA 1PVRA 2LI6A 4OJPA 2RHFA 4X5VA 3JPOA 3H4DA 3F2CA 2KTQA 2P6RA 4FO6A 2JH7A 4TURA 4RQ1A 1TAMA 5CR0A 4F50A 4K4IA 2BDPA 5J2JA 1KKXA 2YMMA 2RRDA 4OCZA 2C22A 2BCVA 2Z7JA 2KVSA 4LZDA 4GIBA 3UMCA 5J2HA 4Z6EA 4F93B 4IL6U 1YT3A 4AP9A 7ICPA 2PI4A 2FE9A 5HMLA 2W9AA 1XSPA 5L9XA 2KOBA 1OXJA 3EUB2 1NKBA 1KEJA 3IG8A 5HR6A 4ECUA 5DG7A 2DKXA 1WWUA 4I2GA 2FJ6A 5G5GA 4J9LA 4I27A 2OXOA 4DSLA 4DQQA 1SL2A 2R8GA 4F8RA 2XIDA 3GV8B 2A3VA 1ECWA 2W03A 2VIXA 5K4LA 5KFKA 3BQ7A 4EZ9A 2W8KA 3SI8A 1ZQIA 4Y2YA 4PHDA 2YB1A 7ICVA 4Q44A 2ZIXA 5KFZA 4RPYA 3MFIA 4EZ6A 4J9QA 4U7CA 4I2JA 5AKEA 3B0XA 4QZ9A 1O08A 1UA1A 4PPXA 4Z6FA 3N4MB 7ICKA 1HEKA 1WCLA 2ZUBA 2HBJA 3NASA 1NOMA 5ALSA 2C2RA 4F2RA 1Q8KA 5AKJA 5D49A 2ZTEA 4F4ZA 7ICIA 7ICUA 3R9KA 2R8KA 4KLSA 4FE3A 3K75D 4J9MA 5AKZA 2DPIA 5AM4A 3C21A 5KT2A 2BDUA 1D8LA 2CXYA 3ALRA 4NWIA 1BVSA 5KFNA 1X6JA 2UVUA 2YX8A 1ZQVA 5KG5A 1OUQA 4M2YA 2BPGA 1XWLA 2W3SA 4CF5A 1RQLA 2BCSA 4NLGA 4FBTA 5ALJA 1ZQQA 2KZ3A 1Z19A 1ZQBA 2R8JA 3H8SA 1N48A 3DEEA 5ALTA 1PVPA 4IQTA 3IRUA 1ZQOA 4KLHA 4GC6A 3K4GA 2NV3A 2WF9A 1CUKA 2DQNB 4DSKA 3ZDAA 4KMUA 3JPRA 1X9SA 4TQRA 1FFVA 1TK8A 3RRGA 2PFPA 4FFDA 2EH9A 2VJ5A 5ALHA 2BQ3A 3V6KA 8ICTA 4RQMA 5J2CA 3UQ2A 3SAFA 1U45A 4B9VA 2YQEA 3MR6A 1X42A 3CRXA 2F3NA 4J03A 4MFAA 5KG6A 1LVHA 4RU9A 4OJ6A 1MA7A 2RLTA 4PGQA 4RZRA 2ZJAA 5KFVA 5IIOA 4FBUA 4UAWA 4US9A 1EXNA 5DDMA 2BHNA 4NY8A 3N97B 1TV9A 1T3NA 4Y2PA 1UPHA 5CP2A 4J9KA 4C8LA 3BJYA 5KFBA 2RDIA 3QX7A 3LVVA 2CPRA 1DGSA 3MABA 4KITB 4DFPA 9ICIA 5AI9A 4DL2A 3FDSA 5AM3A 4Q43A 5KG3A 1KBUA 5DGBA 3H8JA 1ZQYA 5AKLA 3G6XA 2H3IA 4PJ0U 3TANA 2PI5A 3QNMA 3C23A 5EE3A 3C1ZA 2MRLA 3PSFA 1CI4A 4DS5A 4JWNA 8ICPA 3Q8RB 3QUTA 5KFMA 2M0NA 2LHTA 2QARA 4FS1A 3I76A 4EX6A 1C7YA 1T3QA 3PX6A 4C4TA 2QB0A 1F5SA 2JZBB 4DL4A 3D2NA 5J0WA 3HJEA 2Y1IA 4ZOHC 3L4PA 2XO7A 2A1AA 2K8BB 3EWAA 3C2KA 2G0AA 1DK3A 2JV3A 4JWMA 1SL1A 1TE2A 1WG8A 1T8EA 2HOIA 4YR2A 1SV0A 3SMVA 1QSSA 2KD1A 4IRDA 2WFAA 4YMMA 2KK0A 3SD7A 5DG8A 2G5HB 2FLPA 7ICGA 1BPBA 5J0OA 2YB4A 5HNKA 4YG2A 1ZQDA 2UVWA 1S10A 2PMZF 2G5IB 4QZDA 4ECQA 1JRPA 1ZQNA 5E79U 2ES6A 1BPDA 4F72A 5J0QA 2R18A 4RQ5A 2JH1A 1QTMA 2KFNA 3QUBA 5A0LA 4KLTA 1TVAA 4KN7A 2D6FC 3B9JA 3CP8A 3JPPA 4NXZA 1L3UA 2BCUA 5EWGA 1RYSA 2WF6A 5CEHA 4ECVA 5KFPA 1U47A 2OM6A 2H5XA 1FO4A 4UB2A 2WF7A 2YMQA 5ALEA 3C2LA 1S0OA 3PO4A 1PK1B 1XO1A 1ZRNA 1PK1A 1DXSA 1IG6A 1L3TA 1JN3A 2DUYA 4YFKA 4M04A 4C7ZA 2LYAA 2WB1C 3ZD9A 5EWEA 4ECXA 4K4HA 9ICRA 4ECWA 1L7OA 1VLBA 4ACOA 1Y88A 1VDVA 4PL2A 3M1YA 4K4GA 5F9LA 9ICLA 2FPMA 1NKCA 2JEFA 4P4MA 4O3QA 3TAQA 8ICKA 1L7MA 3UXPA 5D4BA 3KKAA 5KFGA 9ICPA 4UBCA 2QB1A 4R63A 3TAPA 2EZXA 4UARA 4XA5A 3RJKA 4ED6A 2B21A 1K1SA 1ZQUA 2KHVA 2J6TA 5DBCA 3GZFA 4C7YA 2YN4A 4O3MA 3RJHA 2BR0A 3LYSA 3LWMA 2ZIWB 2RP5A 3ISCA 1UT8A 4GLXA 4O3OA 3EYZA 4ECSA 2ISPA 1ZQSA 2EQYA 2HHVA 2ODGA 4US8A 3RAXA 1Z1BA 1Z4NA 3QU5A 2W9BA 3T5LA 1SKSA 4BXOB 4FS2A 4BXOA 1XS9D 5KFFA 5AI5A 4PGYA 4ED2A 3M6KA 4UAZA 5J2FA 2BCRA 4I2DA 8ICXA 3PW2A 4O3RA 3WKBA 8ICVA 2HW3A 2BKEA 3RJJA 2G06A 2FMQA 5KFDA 3BS5B 3JPQA 3RJEA 3BQ0A 3IV6A 1X9XA 1MN8A 3IG5A 1A0PA 4YQWA 2LMRA 2LKYA 3SR6A 3FYHA 5TZVA 1ZRMA 2NO4A 1WYGA 1JIHA 4G9BA 1DGJA 3HT3A 2HSZA 1NKEA 4KLMA 4IRKA 3O0FA 5DB9A 4BDPA 2K4EA 1Q46A 1UT5A 2JR5A 3NTUA 2MSNA 2E3TA 4P0QA 4CE6A 2Y1JA 1X9WA 3I1YA 1BNPA 5CHGA 5KG1A 3NGDA 2FPKA 1L3SA 5IIKA 4YMOA 1P7DA 2ALZA 2ZIUB 2ZIUA 4KLDA 3GIKA 2AH5A 2KZMA 4ECTA 1RM6C 3S6JA 3ETRA 3SYZA 3QXGA 4M47A 3AN1A 2LPEA 5HHIA 1SL0A 1ZQMA 2ESEA 2AJQA 3M8SA 2W7OA 3KD3A 1L8OA 1SZHA 2EZZA 4DFDA 5KFWA 4O5EA 4DFMA 3HWTA 4Y2JA 4BWMA 2KEYA 2HHTA 4JMUA 4TUQA 3T5KA 1QLNA 3KHHA 3EZ5A 4IQUA 4U6PA 2AGPA 4MF2A 4UAYA 2D3DA 4KLLA 2FLNA 4QZ8A 1NNLA 7ICHA 3OPXA 3VC8A 2C2DA 3AU2A 5AKIA 3RB3A 2IHNA 8ICGA 2OHFA 3T3FA 9ICEA 4DQPA 1ZQCA 2HHUA 3V6JA 4DQRA 4ICAA 7ICSA 1SZPA 4YN4A 4BUGA 3NS1A 4F92B 4EBEA 4CF4A 9ICSA 4EYIB 4ELUA 2NRZA 1IM4A 2MUTB 1U9LA 1BNOA 1ZQXA 2QKQA 5KFSA 3GV7B 8ICMA 2I6XA 1YZ6A 3F5AA 3FC4A 4NL9C 3T5JA 3N7RC 3C2MA 2KKPA 4QWEA 1JX4A 7ICRA 3PSTA 2ISOA 4UB3A 4OJOA 1S9FA 4JV1A 4ED8A 7ICJA 1RQNA 4OO1J 1VJ5A 2H3FA 2EAPA 4GXJA 1PVQA 2O6KA 7ICTA 3LVWA 4UB6U 1UCVA 2BPCA 1N56A 4AYBF 4C4RA 3QU2A 2XGPA 1LKYA 2XCPA 2ZIVA 3OHAA 4QW9A 2KP7A 3QU9A 4GXKA 4I2EA 4F71A 2J6UA 1X9MA 3MDCA 3TADC 4C8OA 1S97A 4ED3A 1QQ6A 3ETLA 3OJUA 4PZOA 3QU4A 4Q8FA 3TADA 2HVHA 2F1JA 8ICSA 1KL9A 3ISBA 2IOFK 1TAUA 3H0RB 2JMGA 9ICJA 3PW4A 1V9PA 1XSLA 5CJ7A 2F2AB 4RQ7A 5AM1A 4IR1A 3PNCA 4DFJA 2PKEA 4ECYA 5J0RA 9ICAA 5KFRA 2KFZA 4DOCA 5ALDA 3H40A 4FZNA 1DOQA 5KFYA 9ICFA 1S5LU 4OJLA 7ICEA 4Q45A 4RUCA 1J2MA 2EAOA 3GIJA 1JROA 1Z00A 5EOZA 2XC9A 4DL5A 1HUZA 3KBBA 4RQ3A 3T5HA 5AKGA 4PHAA 3IHQB 1SKRA 2Y9TA 4PHPA 4QZEA 4O9MA 4UB1A 2F77X 2BZFA 2KMDA 1COOA 2E8PA 5F3XB 1HJPA 4E0DA 9ICVA 2YTUA 4UB5A 8ICNA 2HBKA 3M9MB 3H4BA 4I2BA 4J9SA 2XY6A 4TUPA 1LB2B 3J81j 3MC1A 1TK0A 5ALIA 1MQ3A 3MR2A 8ICQA 4CCHA 1D9FA 5ALRA 1K1QA 3NVZA 3C28A 2A1JA 4MFCA 4I28A 4PHEA 2ZIWA 4NLCA 2JEJA 8ICCA 2HCFA 1COKA 1B22A 2IBKA 9ICOA 3IM1A 2DGZA 5KAIU 3PMNA 2OEHA 2NO5A 2E8NA 1KLNA 4RQ6A 2ZUDA 5L1KA 1SV0C 1JALA 4F5QA 2HBMA 2XI9A 3PR4A 4EBCA 1URJA 4IR9A 4RQ0A 4I2IA 4MFFA 1K5OA 2F8LA 2ZJ8A 4JK1A 8ICHA 5KG4A 4I2CA 4B6JA 2WHEA 3THVA 3C5GA 5AKYA 1NZBA 4XQ8A 3ZI4A 3GV5B 2V4QA 3WK5A 1D8YA 5DLGA 5ALYA 1RXWA 4B9LA 3NRWA 4Y2VA 1AQ6A 5ALQA 2W55A 5T14A 3WKEA 5DBBA 2W9BB 3F53A 3SAGA 3GIMA 3L3FX 5TISU 3C5FA 1T94A 4DEZA 4KLJA 2W54A 2W43A 1PZNA 2MU2A 2OCEA 2Y0SF 4J9NA 4LVSA 4EBDA 3M7DA 1L8LA 3GFKB 4YR3A 5L1JA 2PFQA 3BZCA 3OSNA 3E2EA 2H3ZA 4P0QB 1D8BA 3UMBA 4Q8EA 1NK7A 5AK6A 2IA6A 2K4IA 3QU7A 3FM9A 1DK2A 3A0BU 4KLUA 1PUZA 3AQEA 1JI7A 1J97A 5AKHA 9ICHA 5AM0A 2HOFA 4P0PB 3PY8A 2W8LA 4ZH4A 1ZQAA 5FP0A 2VA2A 4EYHB 2UVVA 3AQFA 5AK3A 5DQIA 4UAVA 4EELA 1HUOA 2R8HA 3NVYA 4Z6CA 2ZG6A 1ZOLA 1ZQJA 1A76A 3PO5A 1ZQKA 3KHLA 2G07A 4YP3A 2EZYA 2MAXA 2ASJA 5JUMA 2YMPA 2GH1A 5KFIA 2H3VA 2ASDA 4NLNA 4BWJA 4Y2TA 1ZD2P 4HAIA 4DS4A 5KFQA 4RT3A 4ED0A 2JEIA 3Q8MA 1KN5A 4DO9A 7ICQA 4BX9C 2MUTA 3SV3A 5J2IA 1JUDA 4FZLA 2AU0A 1Z1VA 1ZD5A 4I2AA 2AQ0A 3QUCA 3GQCA 5DB8A 4DL7A 2Y9UA 4IS7A 8ICYA 2KICA 9ICNA 2I1QA 1T7PA 4M9GA 5DB7A 2IOHA 3HPOA 1ZD3A 3GILA 2WTFA 3PZPA 3N28A 3RBEA 1KSPA 9ICCA 4QJFB 3RR8A 1IIPA 2YMLA 2F76X 2JXJA 5F9NA 2KHQA 2BCQA 4CRXA 1B0XA 5EE1A 2ZJ5A 3NUQA 2GO7A 1X66A 3OGUA 4G3IA 4Y2SA 1SWWA 3BQTA 4KX5A 5AI0A 3K1RB 2KIVA 2IOFA 5AK4A 8ICFA 1Z3EB 3Q8KA 4CNQA 1SXDA 4DQSA 5AM5A 4ED7A 1RXVA 2JRZA 4KLIA 4O5KA 5DQGA 2QB0B 2DPJA 4TUSA 5ALMA 4QWDA 1XU4A 5KAFU 3GIIA 4UQGA 2HBLA 5GTHU 1X2IA 5L1IA 3QEBZ 4F4XA 1S0VA 2RDJA 2HHXA 4QW8A 1SIJA 3I28A 2XCAA 5AI6A 1N60A 1NK4A 2ZUCA 3IN5A 4C8MA 3OHBA 3RH5A 1ZQLA 2E1FA 8ICIA 4KX3A 4KLQA 7ICLA 2CN1A 1SXEA 5L1LA 5AI4A 4DCCA 2LYHA 1TKDA 1M6YA 4F4KA 3Q8PB 4UATA 2BPFA 4MF8A 2BGWA 5B5EU 4USAA 3PV8A 2DF4B 9ICGA 4NLZA 1QH9A 3GU3A 5H2FU 3ZDBA 5KFHA 2P35A 3RB6A 4RNNA 3TI0A 3BDPA 4KLEA 2XVTA 4RPXA 2K60A 5JU5A 2NRXA 5HR7A 2V4RA 4YVZA 4QIWF 2F1IA 5ALOA 4F5OA 3PX4A 3PW5A 1JXLA 1BPYA 3QUQA 2FI1A 2A19A 1QCKA 3SEIA 3VCBA 3RB4A 3HKZC 1TK5A 4B9UA 2MA1A 2AGOA 3WK4A 4F2SA 2KN7A 3ZDDA 1RZTA 8ICRA 2AXTU 5BOLA 4M6WB 5IILA 4JUZA 1ZQHA 3CW2C 3TQ1A 4M9JA 4P4OA 4P2HA 2ATLA 4KMOB 5GTIU 8ICAA 2E8MA 2QLTA 2WAQC 2HOQA 3SV4A 2KV2A 3U26A 5DQHA 4RQ8A 1C20A 5ALFA 2WAQF 5KFLA 2K8AA 5JTIA 3A0HU 3T79A 5KT4A 2KKVA 3RH4A 2DKZA 5HMMA 3ORYA 4I2HA 2LM4A 4NLBA 1NJWA 2KVCA 2NRWA 1WUDA 3OJSA 4ED1A 3RH6A 2AQ4A 4P4PA 1JXEA 2KJ8A 3TFSA 9ICXA 4R8UB 1CRXA 5AICA 4R8UA 2HMXA 4DFKA 2VANA 3KZXA 4M9HA 1RYUA 1ZJMA 1LV5A 2WF8A 3AMZA 1ZQTA 1V38A 5KFTA 3MGIA 4F5RA 5ALXA 4KN4A 2D8CA 1AROP 3RR7A 5KG2A 5DG9A 4Y2RA 8ICWA 2J6SA 3TACB 1N63A 3RTVA 8ICOA 1TFRA 4PZNA 5J0XA 5BOMA 4WJ3B 1XSNA 3UM9A 1T4GA 1ZJNA 2K4PA 1N5WA 3V6HA 1FFUA 4I29A 2E5SA 3Q8QB 5KT7A 4KLOA 3KHGA 4RQNA 1X40A 1NJXA 3EPIA 4P0PA 7ICOA 3MGHA 1N62A 3WKAA 1FEZA 1U4BA 4AYBC 4EEKA 5KFCA 1NK9A 3AL0B 4ECRA 2E8OA 5IIIA 1FIQA 1V85A 9ICBA 2VKQA 4J9RA 4GC7A 4B9NA 5KG0A 5J8YC 1BGXT 5KTQA 3UXNA 3JPSA 3V7LA 3N7SC 4M0AA 2W3RA 2BQUA 5ALZA 1IV8A 1ZQFA 4NM1A 3MGVA 3MBYA 1QQ7A 4IC9A 3WK7A 4Y2UA 2EDUA 5KT3A 3QZ7A 2IHMA 5AIBA 4DSFA
chains in the Genus database with same CATH topology
4YXJA 1NKCA 1RXWA 2JEFA 4P4MA 4B9LA 4O3QA 3KTQA 5J2GA 3TAQA 5DB6A 5CWRA 8ICKA 4TQSA 4QWAA 3UXPA 5D4BA 4M9LA 2VA8A 5KFGA 9ICPA 4UBCA 2HHWA 4R63A 4QZIA 9ICWA 5DBBA 2W9BB 3HX0A 3UQ0A 3TAPA 1NK5A 3RJFA 2XY7A 3PR5B 1BPEA 3GIMA 5KG7A 5IINA 1U49A 5KFXA 3C5FA 3PX0A 4DEZA 3UPQA 4KLJA 3C1YA 4XA5A 3RJKA 4F5NA 4QZHA 1PZNA 2JEGA 4O0IA 1KDHA 4J9NA 3TFRA 2XY5A 4B9SA 1CEZA 4ED6A 2B21A 4LVSA 4EBDA 1ZQEA 3V7JA 1K1SA 1ZQUA 5KFJA 5KFEA 1A77A 3GFKB 4RQ2A 2J6TA 4YR3A 4R66A 5L1JA 5DBCA 5J2DA 4UB4A 3OSNA 3PW7A 4DSEA 2PFQA 3E2EA 9ICKA 1KFDA 4RT2A 1ZETA 8ICJA 4PGXA 3RJHA 2BR0A 4Q8EA 1D9DA 3LWMA 1BPXA 1NK7A 3ISCA 4O3SA 4DWIA 1UT8A 2IA6A 4DF8A 3HP6A 4GLXA 4Z6DA 4O3OA 3LDAA 4KLUA 3EYZA 4ECSA 1UA0A 2ISPA 1ZQSA 2IMWP 9ICHA 5J0YA 3PY8A 2W8LA 1XC9A 2FMSA 2W9CA 2HHVA 4B9TA 4ZH4A 3BQ2A 1ZQAA 3PMLA 2VA2A 3RAXA 5KFOA 4EYHB 4F3OA 9ICTA 2UVVA 3T5LA 2W9BA 4ELVA 1SKSA 4X5VA 4FS2A 4BXOB 5DQIA 3LK9A 4RQ4A 3JPOA 3H4DA 5J2AA 1XS9D 5J2KA 5KFFA 4BXOA 2KTQA 4RUAA 1HUOA 2R8HA 2P6RA 4FO6A 4PGYA 3RJIA 4R65A 4Z6CA 4XUSA 4RQ1A 5CR0A 4TURA 4F50A 4ED2A 3QE9Y 4K4IA 2BDPA 5J2JA 3M9OB 4UAZA 2BCRA 5J2FA 8ICXA 4I2DA 2XGQA 3KHRA 1ZQJA 3PW2A 1A76A 2C22A 2C2EA 3PO5A 1ZQKA 4O3RA 8ICVA 3KHLA 2BCVA 2HW3A 4YP3A 2BKEA 3RJJA 4LZDA 5J2HA 3PW0A 1ZQPA 2FMQA 4Z6EA 5KFDA 2P66A 2MAXA 4F93B 2ASJA 1WCNA 3JPQA 1MSWD 3RJEA 5JUMA 3BQ0A 7ICPA 5KFIA 5DBAA 4YQWA 2PI4A 4QWBA 5HMLA 2W9AA 1XSPA 4QZCA 2I9GA 2ASDA 4NLNA 4BWJA 4DLEA 3FYHA 5L9XA 5TZVA 5J0TA 4DS4A 2Q0ZX 5KFQA 4RT3A 1QSYA 1JIHA 4ED0A 4MEYA 1NKBA 1KEJA 1JMSA 4DSJA 2NRTA 3RBDA 4ECUA 5DG7A 4O3PA 2JEIA 4QZGA 1S76D 3Q8MA 4DO9A 3HT3A 3QEAZ 4KTQA 8ICZA 7ICQA 4I2GA 4DOAA 1NKEA 4KLMA 2MUTA 3SV3A 4IRKA 5J2IA 4M9NA 4DL3A 5DB9A 4BDPA 4J9LA 4I27A 4DSLA 5KFUA 4DQQA 1SL2A 2R8GA 4F8RA 3GV8B 3H7IA 2AU0A 3M9NB 4DLGA 4I2AA 2AQ0A 1MC8A 4BGDA 1UT5A 5KFKA 3GQCA 3ZDEA 3Q8LA 5DB8A 2HVIA 4DL7A 4EZ9A 2W8KA 3SI8A 1ZQIA 8ICYA 4NM2A 2I1QA 9ICNA 2R8IA 3NTUA 1T7PA 4ELTA 8ICEA 4PHDA 7ICVA 4Q44A 4M9GA 2Y1JA 5DB7A 1X9WA 3HPOA 5BPCA 4NLKA 2V9WA 3GILA 5KFZA 2WTFA 5CHGA 4RPYA 5KG1A 3MFIA 3QZ8A 1L5UA 4EZ6A 3NGDA 2FPKA 4J9QA 3RBEA 1L3SA 4I2JA 1KSPA 5IIKA 4YMOA 3RJGA 2ALZA 4DQIA 9ICCA 3B0XA 5CA7A 4QZ9A 4KLDA 3GIKA 1UA1A 3RR8A 4PPXA 4Z6FA 1BPZA 2KZMA 3N4MB 4ECTA 1WCLA 7ICKA 2ZUBA 5F9NA 3SYZA 1NOMA 3BQ1A 4M47A 5HHIA 1SL0A 1ZQMA 2BCQA 2W9MA 2C2RA 4F2RA 8ICLA 2AJQA 1S77D 3M8SA 5D49A 2ZTEA 2ZJ5A 1ZQWA 4F4ZA 7ICIA 7ICUA 2R8KA 1NJZA 5KFWA 3OGUA 4O5EA 4DFMA 3HWTA 2W9CB 4KLSA 4BWMA 2HHTA 3K75D 4G3IA 3T5KA 4TUQA 4J9MA 1QLNA 3BQTA 3KHHA 4LZGA 4EEYA 2DPIA 3EZ5A 4IQUA 2PFNA 4DSIA 3C21A 5KT2A 8ICFA 2AGPA 1D8LA 1Z3EB 3Q8KA 1S0MA 4MF2A 4UAYA 1BVSA 5KFNA 4DQSA 3RB0A 2UVUA 1ZQVA 5KG5A 4ED7A 1RXVA 4KLLA 2FLNA 2FMPA 4QZ8A 4M2YA 4KLIA 7ICHA 2BPGA 5KFAA 1XWLA 1RPLA 2ASLA 1NK8A 2C2DA 4O5KA 3AU2A 4F5PA 3RB3A 5DQGA 2BCSA 2IHNA 2DPJA 4NLGA 4TUSA 4QWDA 5IIMA 4FBTA 3ISDA 1XU4A 2FPLA 8ICGA 3T3FA 3GIIA 9ICEA 4UQGA 1ZQQA 1ZQCA 4DQPA 2KZ3A 3V6JA 1ZQBA 2HHUA 2PXIA 2R8JA 4DQRA 3H8SA 1N48A 7ICSA 1SZPA 4M6WA 1KRPA 4YN4A 1X2IA 1QSLA 9ICUA 3B0YA 4F92B 4EBEA 9ICSA 4IQTA 4EYIB 4ELUA 2NRZA 1Z00B 5C5JA 5L1IA 1IM4A 2MUTB 1ZQOA 3UXOA 4GC6A 4KLHA 1U9LA 4F91B 3QEBZ 3K4GA 4F4XA 4JV0A 2UVRA 1S0VA 2RDJA 2HHXA 3MR5A 1CUKA 1ZQXA 4QW8A 5KFSA 3PVXA 2XCAA 3GV7B 8ICMA 1NK4A 4DSKA 2ZUCA 3ZDAA 4KMUA 3H8WA 3JPRA 3T5JA 4C8MA 3OHBA 3RH5A 2HHSA 1X9SA 3G6VA 4YD1A 4TQRA 1S0NA 1ZQLA 3C2MA 1TK8A 2NRVA 4QWEA 5DDYA 5J2EA 1JX4A 1ZQRA 3RRGA 8ICIA 2PFPA 7ICRA 2ISOA 1KFTA 4KLQA 7ICLA 4UB3A 1S9FA 4JV1A 2VA3A 4ED8A 5L1LA 7ICJA 2F1HA 1MQ2A 2LYHA 2BQ3A 3AUOA 3V6KA 5DKWA 1TKDA 4F4KA 3Q8PB 8ICTA 5J2CA 4GXJA 3UQ2A 1U45A 4B9VA 2BPFA 3MR6A 7ICTA 4MF8A 3RAQA 3EW9A 2BGWA 4MFAA 5KG6A 9ICLA 4RU9A 4IRCA 4PGQA 4MEXA 2BPCA 4RZRA 4IQWA 2ZJAA 5KFVA 3PV8A 3OSPA 9ICGA 1N56A 5IIOA 4FBUA 1SKWA 4NLZA 3ZDBA 2A1JB 1H38A 5CB1A 4UAWA 4GXIA 2ZTCA 5KFHA 1EXNA 3RB6A 4RNNA 2XGPA 3TI0A 3BDPA 2XCPA 2P6UA 8ICUA 4KLEA 3OHAA 5DDMA 1TAQA 4RPXA 3GDXA 2BHNA 2NRXA 4NY8A 3N97B 4QW9A 1TV9A 3JPTA 4GXKA 2V4RA 3G6YA 1T3NA 4YVZA 2DFLA 4IQVA 5CP2A 4J9KA 4C8LA 3BJYA 4I2EA 5KFBA 2RDIA 2F1IA 4C8NA 4F5OA 3PX4A 3ZDCA 3PW5A 1DGSA 1JXLA 3MABA 2J6UA 1X9MA 1BPYA 4KITB 4RNMA 3MDCA 4C8OA 1S97A 4ED3A 3RRHA 3ETLA 2ZTDA 3OJUA 4F4YA 4DFPA 9ICIA 5J29A 4Q8FA 4RNOA 4DL2A 3FDSA 5HHHA 5KG3A 5KT6A 4Q43A 2HVHA 3RB4A 2F1JA 8ICSA 1TK5A 5DGBA 3ISBA 3H8JA 4B9UA 1ZQYA 4R64A 4JV2A 1TAUA 2AGOA 3G6XA 4DL6A 9ICJA 3PW4A 4F2SA 1V9PA 5J0UA 1XSLA 2KN7A 3ZDDA 1RZTA 5CJ7A 5BOLA 4C8KA 3TANA 8ICRA 2PI5A 2OWOA 3V7KA 4RQ7A 4O3NA 4F4WA 4M6WB 3C23A 5IILA 4IR1A 3PNCA 1NK0A 4DFJA 3C1ZA 4JUZA 5J0RA 4YCXA 4ECYA 1ZQHA 9ICAA 4DF4A 5KFRA 4DS5A 3MDAA 3TQ1A 4DOCA 2KFZA 4JWNA 4M9JA 4P4OA 4P2HA 2ATLA 8ICPA 3Q8RB 9ICMA 5KFMA 8ICAA 4QZAA 4FS1A 3SV4A 3H40A 1C7YA 1RYRA 3PX6A 2AGQA 4B9MA 5DQHA 1DOQA 5KFYA 9ICFA 4RQ8A 9ICQA 7ICEA 4Q45A 2JZBB 4RUCA 4DL4A 5KFLA 5J0WA 3GIJA 2Y1IA 4YD2A 1KTQA 3AU6A 2XO7A 5KT4A 5DGAA 3MR3A 7ICNA 1Z00A 3EWAA 3RH4A 3C2KA 5HMMA 4QZBA 5EOZA 4JWMA 3ORYA 2XC9A 4DL5A 1SL1A 1HUZA 4I2HA 1T8EA 4RQ3A 3T5HA 4YR2A 3ZD8A 5DLFA 1NJWA 2NRWA 3IHQB 4PHAA 1SKRA 4PHPA 1QSSA 7ICFA 5J2BA 4IRDA 4YMMA 3OJSA 4QZEA 8ICBA 4O9MA 5DG8A 3JPNA 4ED1A 3RH6A 4UB1A 4P4PA 2AQ4A 2FLPA 1JXEA 3TFSA 2C28A 4R8UB 9ICXA 4YR0A 7ICGA 1BPBA 4R8UA 4QZFA 5J0OA 1ZQGA 1COOA 4DFKA 1ZQZA 2VANA 3LWLA 5HNKA 4YG2A 1HJPA 1U48A 1S10A 1ZQDA 2UVWA 4E0DA 2BQRA 5KT5A 9ICVA 4HYKA 4UB5A 1NK6A 8ICNA 4M9HA 4QZDA 3M8RA 4ECQA 1ZJMA 3M9MB 1LV5A 1ZQNA 1BPDA 4YMNA 3H4BA 1ZQTA 4QWCA 5KFTA 1IXRA 4I2BA 5J0QA 3MGIA 4J9SA 4F5RA 5EWFA 4KN4A 2XY6A 4TUPA 1LB2B 4RQ5A 1AROP 3V72A 4ECZA 2GWSA 3RR7A 1QTMA 3TARA 5KG2A 5DG9A 8ICWA 4J9OA 2J6SA 2KFNA 4O5CA 1TK0A 2PFOA 3RTVA 8ICOA 4RPZA 4UBBA 1MQ3A 1TFRA 5J0XA 5BOMA 3MR2A 4KLTA 1TVAA 4CCHA 2HHQA 8ICQA 1D9FA 1XSNA 4KN7A 1K1QA 1T4GA 5IIJA 1ZJNA 4KLFA 4J9PA 3JPPA 2A1JA 4I2FA 4NXZA 1L3UA 2FLLA 4MFCA 4I28A 4PHEA 3V6HA 2BCUA 4I29A 4YXMA 3Q8QB 5EWGA 1ZYQA 5KT7A 2JEJA 1RYSA 4KLOA 8ICCA 3KHGA 4KLGA 4ECVA 5KFPA 1NJXA 1U47A 3EPGA 5J0PA 3EPIA 2H5XA 1B22A 4UB2A 2IBKA 1KFSA 7ICMA 3IM1A 3MGHA 2KZZA 1U4BA 7ICOA 9ICOA 3C2LA 3PMNA 5KFCA 1S0OA 1NK9A 3SZ2A 4DOBA 4RQ6A 1KLNA 2ZUDA 1B43A 4ECRA 3PO4A 1XO1A 5IIIA 9ICBA 4PH5A 4J9RA 4GC7A 1L3TA 4B9NA 5J0SA 5L1KA 5KG0A 1JN3A 4F5QA 3PR4A 4EBCA 1BGXT 4YFKA 3UXNA 5KTQA 1NJYA 4M04A 3Q8SB 3JPSA 3V7LA 2M9NA 4IR9A 4M0AA 3ZD9A 2BQUA 5EWEA 4RQ0A 4ECXA 4I2IA 4MFFA 1ZQFA 4K4HA 4NM1A 2ZJ8A 9ICRA 4JK1A 3MBYA 8ICHA 4ECWA 3MFHA 5KG4A 4I2CA 1L3VA 1Y88A 2JZBA 3THVA 3C5GA 5D46A 5KT3A 3QZ7A 2IHMA 5HP4A 4XQ8A 3HW8A 3GV5B 4K4GA 2V4QA 5F9LA 1D8YA 4XRHA 5DLGA 2FPMA 4DSFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YXJ A;  1NKC A;  1RXW A;  2JEF A;  4P4M A;  4B9L A;  4O3Q A;  3KTQ A;  5J2G A;  3TAQ A;  5DB6 A;  5CWR A;  8ICK A;  4TQS A;  4QWA A;  3UXP A;  5D4B A;  4M9L A;  2VA8 A;  5KFG A;  9ICP A;  4UBC A;  2HHW A;  4R63 A;  4QZI A;  9ICW A;  5DBB A;  2W9B B;  3HX0 A;  3UQ0 A;  3TAP A;  1NK5 A;  3RJF A;  2XY7 A;  3PR5 B;  1BPE A;  3GIM A;  5KG7 A;  5IIN A;  1U49 A;  5KFX A;  3C5F A;  3PX0 A;  4DEZ A;  3UPQ A;  4KLJ A;  3C1Y A;  4XA5 A;  3RJK A;  4F5N A;  4QZH A;  1PZN A;  2JEG A;  4O0I A;  1KDH A;  4J9N A;  3TFR A;  2XY5 A;  4B9S A;  1CEZ A;  4ED6 A;  2B21 A;  4LVS A;  4EBD A;  1ZQE A;  3V7J A;  1K1S A;  1ZQU A;  5KFJ A;  5KFE A;  1A77 A;  3GFK B;  4RQ2 A;  2J6T A;  4YR3 A;  4R66 A;  5L1J A;  5DBC A;  5J2D A;  4UB4 A;  3OSN A;  3PW7 A;  4DSE A;  2PFQ A;  3E2E A;  9ICK A;  1KFD A;  4RT2 A;  1ZET A;  8ICJ A;  4PGX A;  3RJH A;  2BR0 A;  4Q8E A;  1D9D A;  3LWM A;  1BPX A;  1NK7 A;  3ISC A;  4O3S A;  4DWI A;  1UT8 A;  2IA6 A;  4DF8 A;  3HP6 A;  4GLX A;  4Z6D A;  4O3O A;  3LDA A;  4KLU A;  3EYZ A;  4ECS A;  1UA0 A;  2ISP A;  1ZQS A;  2IMW P;  9ICH A;  5J0Y A;  3PY8 A;  2W8L A;  1XC9 A;  2FMS A;  2W9C A;  2HHV A;  4B9T A;  4ZH4 A;  3BQ2 A;  1ZQA A;  3PML A;  2VA2 A;  3RAX A;  5KFO A;  4EYH B;  4F3O A;  9ICT A;  2UVV A;  3T5L A;  2W9B A;  4ELV A;  1SKS A;  4X5V A;  4FS2 A;  4BXO B;  5DQI A;  3LK9 A;  4RQ4 A;  3JPO A;  3H4D A;  5J2A A;  1XS9 D;  5J2K A;  5KFF A;  4BXO A;  2KTQ A;  4RUA A;  1HUO A;  2R8H A;  2P6R A;  4FO6 A;  4PGY A;  3RJI A;  4R65 A;  4Z6C A;  4XUS A;  4RQ1 A;  5CR0 A;  4TUR A;  4F50 A;  4ED2 A;  3QE9 Y;  4K4I A;  2BDP A;  5J2J A;  3M9O B;  4UAZ A;  2BCR A;  5J2F A;  8ICX A;  4I2D A;  2XGQ A;  3KHR A;  1ZQJ A;  3PW2 A;  1A76 A;  2C22 A;  2C2E A;  3PO5 A;  1ZQK A;  4O3R A;  8ICV A;  3KHL A;  2BCV A;  2HW3 A;  4YP3 A;  2BKE A;  3RJJ A;  4LZD A;  5J2H A;  3PW0 A;  1ZQP A;  2FMQ A;  4Z6E A;  5KFD A;  2P66 A;  2MAX A;  4F93 B;  2ASJ A;  1WCN A;  3JPQ A;  1MSW D;  3RJE A;  5JUM A;  3BQ0 A;  7ICP A;  5KFI A;  5DBA A;  4YQW A;  2PI4 A;  4QWB A;  5HML A;  2W9A A;  1XSP A;  4QZC A;  2I9G A;  2ASD A;  4NLN A;  4BWJ A;  4DLE A;  3FYH A;  5L9X A;  5TZV A;  5J0T A;  4DS4 A;  2Q0Z X;  5KFQ A;  4RT3 A;  1QSY A;  1JIH A;  4ED0 A;  4MEY A;  1NKB A;  1KEJ A;  1JMS A;  4DSJ A;  2NRT A;  3RBD A;  4ECU A;  5DG7 A;  4O3P A;  2JEI A;  4QZG A;  1S76 D;  3Q8M A;  4DO9 A;  3HT3 A;  3QEA Z;  4KTQ A;  8ICZ A;  7ICQ A;  4I2G A;  4DOA A;  1NKE A;  4KLM A;  2MUT A;  3SV3 A;  4IRK A;  5J2I A;  4M9N A;  4DL3 A;  5DB9 A;  4BDP A;  4J9L A;  4I27 A;  4DSL A;  5KFU A;  4DQQ A;  1SL2 A;  2R8G A;  4F8R A;  3GV8 B;  3H7I A;  2AU0 A;  3M9N B;  4DLG A;  4I2A A;  2AQ0 A;  1MC8 A;  4BGD A;  1UT5 A;  5KFK A;  3GQC A;  3ZDE A;  3Q8L A;  5DB8 A;  2HVI A;  4DL7 A;  4EZ9 A;  2W8K A;  3SI8 A;  1ZQI A;  8ICY A;  4NM2 A;  2I1Q A;  9ICN A;  2R8I A;  3NTU A;  1T7P A;  4ELT A;  8ICE A;  4PHD A;  7ICV A;  4Q44 A;  4M9G A;  2Y1J A;  5DB7 A;  1X9W A;  3HPO A;  5BPC A;  4NLK A;  2V9W A;  3GIL A;  5KFZ A;  2WTF A;  5CHG A;  4RPY A;  5KG1 A;  3MFI A;  3QZ8 A;  1L5U A;  4EZ6 A;  3NGD A;  2FPK A;  4J9Q A;  3RBE A;  1L3S A;  4I2J A;  1KSP A;  5IIK A;  4YMO A;  3RJG A;  2ALZ A;  4DQI A;  9ICC A;  3B0X A;  5CA7 A;  4QZ9 A;  4KLD A;  3GIK A;  1UA1 A;  3RR8 A;  4PPX A;  4Z6F A;  1BPZ A;  2KZM A;  3N4M B;  4ECT A;  1WCL A;  7ICK A;  2ZUB A;  5F9N A;  3SYZ A;  1NOM A;  3BQ1 A;  4M47 A;  5HHI A;  1SL0 A;  1ZQM A;  2BCQ A;  2W9M A;  2C2R A;  4F2R A;  8ICL A;  2AJQ A;  1S77 D;  3M8S A;  5D49 A;  2ZTE A;  2ZJ5 A;  1ZQW A;  4F4Z A;  7ICI A;  7ICU A;  2R8K A;  1NJZ A;  5KFW A;  3OGU A;  4O5E A;  4DFM A;  3HWT A;  2W9C B;  4KLS A;  4BWM A;  2HHT A;  3K75 D;  4G3I A;  3T5K A;  4TUQ A;  4J9M A;  1QLN A;  3BQT A;  3KHH A;  4LZG A;  4EEY A;  2DPI A;  3EZ5 A;  4IQU A;  2PFN A;  4DSI A;  3C21 A;  5KT2 A;  8ICF A;  2AGP A;  1D8L A;  1Z3E B;  3Q8K A;  1S0M A;  4MF2 A;  4UAY A;  1BVS A;  5KFN A;  4DQS A;  3RB0 A;  2UVU A;  1ZQV A;  5KG5 A;  4ED7 A;  1RXV A;  4KLL A;  2FLN A;  2FMP A;  4QZ8 A;  4M2Y A;  4KLI A;  7ICH A;  2BPG A;  5KFA A;  1XWL A;  1RPL A;  2ASL A;  1NK8 A;  2C2D A;  4O5K A;  3AU2 A;  4F5P A;  3RB3 A;  5DQG A;  2BCS A;  2IHN A;  2DPJ A;  4NLG A;  4TUS A;  4QWD A;  5IIM A;  4FBT A;  3ISD A;  1XU4 A;  2FPL A;  8ICG A;  3T3F A;  3GII A;  9ICE A;  4UQG A;  1ZQQ A;  1ZQC A;  4DQP A;  2KZ3 A;  3V6J A;  1ZQB A;  2HHU A;  2PXI A;  2R8J A;  4DQR A;  3H8S A;  1N48 A;  7ICS A;  1SZP A;  4M6W A;  1KRP A;  4YN4 A;  1X2I A;  1QSL A;  9ICU A;  3B0Y A;  4F92 B;  4EBE A;  9ICS A;  4IQT A;  4EYI B;  4ELU A;  2NRZ A;  1Z00 B;  5C5J A;  5L1I A;  1IM4 A;  2MUT B;  1ZQO A;  3UXO A;  4GC6 A;  4KLH A;  1U9L A;  4F91 B;  3QEB Z;  3K4G A;  4F4X A;  4JV0 A;  2UVR A;  1S0V A;  2RDJ A;  2HHX A;  3MR5 A;  1CUK A;  1ZQX A;  4QW8 A;  5KFS A;  3PVX A;  2XCA A;  3GV7 B;  8ICM A;  1NK4 A;  4DSK A;  2ZUC A;  3ZDA A;  4KMU A;  3H8W A;  3JPR A;  3T5J A;  4C8M A;  3OHB A;  3RH5 A;  2HHS A;  1X9S A;  3G6V A;  4YD1 A;  4TQR A;  1S0N A;  1ZQL A;  3C2M A;  1TK8 A;  2NRV A;  4QWE A;  5DDY A;  5J2E A;  1JX4 A;  1ZQR A;  3RRG A;  8ICI A;  2PFP A;  7ICR A;  2ISO A;  1KFT A;  4KLQ A;  7ICL A;  4UB3 A;  1S9F A;  4JV1 A;  2VA3 A;  4ED8 A;  5L1L A;  7ICJ A;  2F1H A;  1MQ2 A;  2LYH A;  2BQ3 A;  3AUO A;  3V6K A;  5DKW A;  1TKD A;  4F4K A;  3Q8P B;  8ICT A;  5J2C A;  4GXJ A;  3UQ2 A;  1U45 A;  4B9V A;  2BPF A;  3MR6 A;  7ICT A;  4MF8 A;  3RAQ A;  3EW9 A;  2BGW A;  4MFA A;  5KG6 A;  9ICL A;  4RU9 A;  4IRC A;  4PGQ A;  4MEX A;  2BPC A;  4RZR A;  4IQW A;  2ZJA A;  5KFV A;  3PV8 A;  3OSP A;  9ICG A;  1N56 A;  5IIO A;  4FBU A;  1SKW A;  4NLZ A;  3ZDB A;  2A1J B;  1H38 A;  5CB1 A;  4UAW A;  4GXI A;  2ZTC A;  5KFH A;  1EXN A;  3RB6 A;  4RNN A;  2XGP A;  3TI0 A;  3BDP A;  2XCP A;  2P6U A;  8ICU A;  4KLE A;  3OHA A;  5DDM A;  1TAQ A;  4RPX A;  3GDX A;  2BHN A;  2NRX A;  4NY8 A;  3N97 B;  4QW9 A;  1TV9 A;  3JPT A;  4GXK A;  2V4R A;  3G6Y A;  1T3N A;  4YVZ A;  2DFL A;  4IQV A;  5CP2 A;  4J9K A;  4C8L A;  3BJY A;  4I2E A;  5KFB A;  2RDI A;  2F1I A;  4C8N A;  4F5O A;  3PX4 A;  3ZDC A;  3PW5 A;  1DGS A;  1JXL A;  3MAB A;  2J6U A;  1X9M A;  1BPY A;  4KIT B;  4RNM A;  3MDC A;  4C8O A;  1S97 A;  4ED3 A;  3RRH A;  3ETL A;  2ZTD A;  3OJU A;  4F4Y A;  4DFP A;  9ICI A;  5J29 A;  4Q8F A;  4RNO A;  4DL2 A;  3FDS A;  5HHH A;  5KG3 A;  5KT6 A;  4Q43 A;  2HVH A;  3RB4 A;  2F1J A;  8ICS A;  1TK5 A;  5DGB A;  3ISB A;  3H8J A;  4B9U A;  1ZQY A;  4R64 A;  4JV2 A;  1TAU A;  2AGO A;  3G6X A;  4DL6 A;  9ICJ A;  3PW4 A;  4F2S A;  1V9P A;  5J0U A;  1XSL A;  2KN7 A;  3ZDD A;  1RZT A;  5CJ7 A;  5BOL A;  4C8K A;  3TAN A;  8ICR A;  2PI5 A;  2OWO A;  3V7K A;  4RQ7 A;  4O3N A;  4F4W A;  4M6W B;  3C23 A;  5IIL A;  4IR1 A;  3PNC A;  1NK0 A;  4DFJ A;  3C1Z A;  4JUZ A;  5J0R A;  4YCX A;  4ECY A;  1ZQH A;  9ICA A;  4DF4 A;  5KFR A;  4DS5 A;  3MDA A;  3TQ1 A;  4DOC A;  2KFZ A;  4JWN A;  4M9J A;  4P4O A;  4P2H A;  2ATL A;  8ICP A;  3Q8R B;  9ICM A;  5KFM A;  8ICA A;  4QZA A;  4FS1 A;  3SV4 A;  3H40 A;  1C7Y A;  1RYR A;  3PX6 A;  2AGQ A;  4B9M A;  5DQH A;  1DOQ A;  5KFY A;  9ICF A;  4RQ8 A;  9ICQ A;  7ICE A;  4Q45 A;  2JZB B;  4RUC A;  4DL4 A;  5KFL A;  5J0W A;  3GIJ A;  2Y1I A;  4YD2 A;  1KTQ A;  3AU6 A;  2XO7 A;  5KT4 A;  5DGA A;  3MR3 A;  7ICN A;  1Z00 A;  3EWA A;  3RH4 A;  3C2K A;  5HMM A;  4QZB A;  5EOZ A;  4JWM A;  3ORY A;  2XC9 A;  4DL5 A;  1SL1 A;  1HUZ A;  4I2H A;  1T8E A;  4RQ3 A;  3T5H A;  4YR2 A;  3ZD8 A;  5DLF A;  1NJW A;  2NRW A;  3IHQ B;  4PHA A;  1SKR A;  4PHP A;  1QSS A;  7ICF A;  5J2B A;  4IRD A;  4YMM A;  3OJS A;  4QZE A;  8ICB A;  4O9M A;  5DG8 A;  3JPN A;  4ED1 A;  3RH6 A;  4UB1 A;  4P4P A;  2AQ4 A;  2FLP A;  1JXE A;  3TFS A;  2C28 A;  4R8U B;  9ICX A;  4YR0 A;  7ICG A;  1BPB A;  4R8U A;  4QZF A;  5J0O A;  1ZQG A;  1COO A;  4DFK A;  1ZQZ A;  2VAN A;  3LWL A;  5HNK A;  4YG2 A;  1HJP A;  1U48 A;  1S10 A;  1ZQD A;  2UVW A;  4E0D A;  2BQR A;  5KT5 A;  9ICV A;  4HYK A;  4UB5 A;  1NK6 A;  8ICN A;  4M9H A;  4QZD A;  3M8R A;  4ECQ A;  1ZJM A;  3M9M B;  1LV5 A;  1ZQN A;  1BPD A;  4YMN A;  3H4B A;  1ZQT A;  4QWC A;  5KFT A;  1IXR A;  4I2B A;  5J0Q A;  3MGI A;  4J9S A;  4F5R A;  5EWF A;  4KN4 A;  2XY6 A;  4TUP A;  1LB2 B;  4RQ5 A;  1ARO P;  3V72 A;  4ECZ A;  2GWS A;  3RR7 A;  1QTM A;  3TAR A;  5KG2 A;  5DG9 A;  8ICW A;  4J9O A;  2J6S A;  2KFN A;  4O5C A;  1TK0 A;  2PFO A;  3RTV A;  8ICO A;  4RPZ A;  4UBB A;  1MQ3 A;  1TFR A;  5J0X A;  5BOM A;  3MR2 A;  4KLT A;  1TVA A;  4CCH A;  2HHQ A;  8ICQ A;  1D9F A;  1XSN A;  4KN7 A;  1K1Q A;  1T4G A;  5IIJ A;  1ZJN A;  4KLF A;  4J9P A;  3JPP A;  2A1J A;  4I2F A;  4NXZ A;  1L3U A;  2FLL A;  4MFC A;  4I28 A;  4PHE A;  3V6H A;  2BCU A;  4I29 A;  4YXM A;  3Q8Q B;  5EWG A;  1ZYQ A;  5KT7 A;  2JEJ A;  1RYS A;  4KLO A;  8ICC A;  3KHG A;  4KLG A;  4ECV A;  5KFP A;  1NJX A;  1U47 A;  3EPG A;  5J0P A;  3EPI A;  2H5X A;  1B22 A;  4UB2 A;  2IBK A;  1KFS A;  7ICM A;  3IM1 A;  3MGH A;  2KZZ A;  1U4B A;  7ICO A;  9ICO A;  3C2L A;  3PMN A;  5KFC A;  1S0O A;  1NK9 A;  3SZ2 A;  4DOB A;  4RQ6 A;  1KLN A;  2ZUD A;  1B43 A;  4ECR A;  3PO4 A;  1XO1 A;  5III A;  9ICB A;  4PH5 A;  4J9R A;  4GC7 A;  1L3T A;  4B9N A;  5J0S A;  5L1K A;  5KG0 A;  1JN3 A;  4F5Q A;  3PR4 A;  4EBC A;  1BGX T;  4YFK A;  3UXN A;  5KTQ A;  1NJY A;  4M04 A;  3Q8S B;  3JPS A;  3V7L A;  2M9N A;  4IR9 A;  4M0A A;  3ZD9 A;  2BQU A;  5EWE A;  4RQ0 A;  4ECX A;  4I2I A;  4MFF A;  1ZQF A;  4K4H A;  4NM1 A;  2ZJ8 A;  9ICR A;  4JK1 A;  3MBY A;  8ICH A;  4ECW A;  3MFH A;  5KG4 A;  4I2C A;  1L3V A;  1Y88 A;  2JZB A;  3THV A;  3C5G A;  5D46 A;  5KT3 A;  3QZ7 A;  2IHM A;  5HP4 A;  4XQ8 A;  3HW8 A;  3GV5 B;  4K4G A;  2V4Q A;  5F9L A;  1D8Y A;  4XRH A;  5DLG A;  2FPM A;  4DSF A; 
#chains in the Genus database with same CATH topology
 1F44 A;  3FAH A;  4YXJ A;  2DBY A;  3KTQ A;  5DB6 A;  2KG5 A;  3CYM A;  4TQS A;  2VA8 A;  5KL1 B;  2HHW A;  4QZI A;  1NK5 A;  2XY7 A;  1BPE A;  1U49 A;  3PX0 A;  3UPQ A;  3C1Y A;  2KSO B;  1KDH A;  2XY5 A;  4UW9 A;  5KFJ A;  5KFE A;  4RQ2 A;  5J2D A;  3PW7 A;  4DSE A;  9ICK A;  4RT2 A;  1ZET A;  1OW5 A;  1NZP A;  4PGX A;  1D9D A;  1BPX A;  3UMG A;  4DF8 A;  3HP6 A;  4Z6D A;  2ZXH A;  3N7P D;  1L6N A;  5AHX A;  5J0Y A;  2FMS A;  4C0Z A;  4B9T A;  3IP4 B;  5KFO A;  3IDW A;  2LM1 A;  4CGZ A;  9ICT A;  4ELV A;  2PMZ C;  3LK9 A;  4RQ4 A;  3WKD A;  5J2A A;  5J2K A;  4BJQ A;  3SEN A;  4RUA A;  3RJI A;  4R65 A;  4XUS A;  3QE9 Y;  5J8Y A;  1L7N A;  5ALN A;  3M9O B;  3D2S A;  2XGQ A;  3KHR A;  2C2E A;  1UHU A;  1YZ7 A;  3PW0 A;  1ZQP A;  2P66 A;  1MSW D;  1WCN A;  4OD0 A;  2G08 A;  5DBA A;  1ED1 A;  2KSO A;  4QWB A;  5ALU A;  3F2B A;  2K8C B;  4QZC A;  5ALL A;  2I9G A;  4DLE A;  2WB1 F;  3BS7 A;  5J0T A;  1Q3U A;  2Q0Z X;  1QSY A;  4MEY A;  3ICX A;  4LJX A;  1DRG A;  1JMS A;  3SAH A;  4DSJ A;  2NRT A;  3RBD A;  3AEV A;  4O3P A;  1KW4 A;  2EAM A;  4QZG A;  1S76 D;  3QEA Z;  8ICZ A;  4KTQ A;  4FZM A;  4C4S A;  4DOA A;  4M9N A;  4DL3 A;  1Z4O A;  5AKX A;  5KFU A;  3H7I A;  5ALG A;  3M9N B;  4DLG A;  3RFA A;  1MC8 A;  4BGD A;  3ZDE A;  3Q8L A;  2HVI A;  1F0M A;  4NM2 A;  1LKY B;  2R8I A;  5AKK A;  4ELT A;  8ICE A;  1O03 A;  3ED5 A;  2K4H A;  3ONN A;  4NLK A;  5BPC A;  3TKA A;  2V9W A;  1L5U A;  3QZ8 A;  1N2X A;  1B4F A;  3QYP A;  3RJG A;  4DQI A;  3BZK A;  2H3Q A;  5CA7 A;  1BPZ A;  2KJ9 A;  1RG6 A;  3BQ1 A;  5KL8 B;  2W9M A;  8ICL A;  1S77 D;  1ZQW A;  2L5Y A;  2B0C A;  1NJZ A;  1N5X A;  2W9C B;  2E1E A;  4LZG A;  4EEY A;  2PFN A;  4DSI A;  2FDR A;  3E0F A;  3RF9 A;  1S0M A;  2Y0S C;  3RB0 A;  2ZIX B;  2FMP A;  1NI3 A;  2AHO B;  5KFA A;  2ASL A;  1RPL A;  1NK8 A;  5G5H A;  2N1R A;  4F5P A;  4MHV A;  5IIM A;  2KIW A;  3L5K A;  2GOL A;  3ISD A;  2FPL A;  3OTQ A;  2KE7 A;  3H0M B;  5L1M A;  2PXI A;  1SGG A;  3HRD D;  5AI8 A;  4M6W A;  1KRP A;  9ICU A;  1QSL A;  3B0Y A;  1XNS A;  3NVW A;  1Z00 B;  2WF5 A;  5C5J A;  3DDH A;  3UXO A;  4F91 B;  3KKA C;  2DWQ A;  2UVR A;  4JV0 A;  3KFU F;  3MR5 A;  3PVX A;  3AM9 A;  3F2D A;  3H8W A;  3PSI A;  2HHS A;  3G6V A;  4YD1 A;  3C29 A;  1S0N A;  2NRV A;  3H0L B;  5DDY A;  5J2E A;  1ZQR A;  1KFT A;  3D2Q A;  4PL1 A;  2VA3 A;  2NYV A;  2F1H A;  3WKC A;  1MQ2 A;  3AUO A;  5DKW A;  3K1Z A;  2OH2 A;  3WK9 A;  3RAQ A;  3EW9 A;  2GLE A;  4EEN A;  4IRC A;  4MEX A;  4IQW A;  3OSP A;  2DL0 A;  1SKW A;  2A1J B;  1H38 A;  5CB1 A;  4GXI A;  2ZTC A;  2LYB A;  2P6U A;  3NVV A;  8ICU A;  1TAQ A;  3F5E A;  3GDX A;  3H8M A;  2OYY A;  5CRX A;  3JPT A;  2KNJ A;  3G6Y A;  5ALK A;  2DFL A;  4IQV A;  4C80 A;  4C8N A;  3ZDC A;  3DV9 A;  3D6J A;  4RNM A;  4Y2X A;  3RRH A;  3BS5 A;  2ZTD A;  4F4Y A;  5J29 A;  1QQ5 A;  2HI0 A;  4RNO A;  5HHH A;  5KT6 A;  2CRX A;  4R64 A;  4JV2 A;  4DL6 A;  2JGA A;  2RQ5 A;  5J0U A;  1ZQ1 C;  4C8K A;  2OWO A;  3V7K A;  4O3N A;  4F4W A;  2K89 A;  4NV0 A;  1NK0 A;  4CF3 A;  3HKZ F;  4YCX A;  4DF4 A;  2W11 A;  1SWV A;  5EE0 A;  3MDA A;  4Y2Q A;  2HDO A;  4QZA A;  2B6G A;  2AGQ A;  1RYR A;  3WK8 A;  4B9M A;  5AK5 A;  9ICQ A;  1V97 A;  1S8O A;  4YD2 A;  1KTQ A;  3AU6 A;  5EE9 A;  4OJ5 A;  5DGA A;  3MR3 A;  7ICN A;  4QZB A;  3ZD8 A;  5DLF A;  1WWV A;  7ICF A;  2F8K A;  5J2B A;  2Q4T A;  1N61 A;  8ICB A;  9ICM A;  3JPN A;  2C28 A;  4YR0 A;  4QZF A;  2W7P A;  1U48 A;  1ZQG A;  1ZQZ A;  3LWL A;  3NRZ A;  2BQR A;  4CDG A;  5KT5 A;  4HYK A;  2XIC A;  1NK6 A;  2G09 A;  3M8R A;  4YMN A;  4QWC A;  1IXR A;  5EWF A;  2GWS A;  3V72 A;  4ECZ A;  5C0Y A;  3TAR A;  4J9O A;  4GFJ A;  5AIA A;  4O5C A;  2PFO A;  1XO0 A;  4RPZ A;  4UBB A;  4QNL A;  2HHQ A;  1HIW A;  3PSP A;  1UQV A;  5IIJ A;  4KLF A;  2ZXI A;  4J9P A;  4I2F A;  2FLL A;  5ALV A;  1SB3 C;  2YY6 A;  4YXM A;  1ZYQ A;  3M6Z A;  2ZIV B;  4KLG A;  3EPG A;  5J0P A;  1X6I A;  5ALW A;  1KFS A;  7ICM A;  2KZZ A;  4A8E A;  1L7P A;  3SZ2 A;  4DOB A;  1B43 A;  2LBO A;  4NL9 A;  1ZD4 A;  1PK3 A;  4PH5 A;  3HIL A;  5J0S A;  5AM2 A;  3E58 A;  1NJY A;  3Q8S B;  2M9N A;  2QAR B;  4EX7 A;  2EAN A;  1GO3 F;  3MFH A;  1L3V A;  1Q3V A;  2JZB A;  5D46 A;  5HP4 A;  3HW8 A;  4XRH A;  4UAU A;  5B66 U;  4JB3 A;  5J2G A;  3SQI A;  5CWR A;  2F44 A;  1ZXI A;  4QWA A;  4M9L A;  4UAS A;  1KQQ A;  9ICW A;  3RJF A;  3HX0 A;  3UQ0 A;  3PR5 B;  3KOO A;  5KG7 A;  5IIN A;  5KFX A;  5JRT A;  1A6S A;  4F5N A;  4QZH A;  2JEG A;  4QIW C;  4O0I A;  5KNI A;  4B9S A;  3TFR A;  1CEZ A;  1ZQE A;  3V7J A;  1A77 A;  4R66 A;  4UB4 A;  1KFD A;  8ICJ A;  3CNH A;  2KJ5 A;  4O3S A;  4DWI A;  2W04 A;  1RDF A;  3WK6 A;  3WU2 U;  3KZI U;  2VJ4 A;  3LDA A;  4NJ8 A;  4UB8 U;  1UA0 A;  2IMW P;  1XC9 A;  2JHD A;  2W9C A;  2I5H A;  3BQ2 A;  3PML A;  1SV4 A;  1J2N A;  4F3O A;  5ALP A;  1PVR A;  2LI6 A;  4OJP A;  2RHF A;  4X5V A;  3JPO A;  3H4D A;  3F2C A;  2KTQ A;  2P6R A;  4FO6 A;  2JH7 A;  4TUR A;  4RQ1 A;  1TAM A;  5CR0 A;  4F50 A;  4K4I A;  2BDP A;  5J2J A;  1KKX A;  2YMM A;  2RRD A;  4OCZ A;  2C22 A;  2BCV A;  2Z7J A;  2KVS A;  4LZD A;  4GIB A;  3UMC A;  5J2H A;  4Z6E A;  4F93 B;  4IL6 U;  1YT3 A;  4AP9 A;  7ICP A;  2PI4 A;  2FE9 A;  5HML A;  2W9A A;  1XSP A;  5L9X A;  2KOB A;  1OXJ A;  3EUB 2;  1NKB A;  1KEJ A;  3IG8 A;  5HR6 A;  4ECU A;  5DG7 A;  2DKX A;  1WWU A;  4I2G A;  2FJ6 A;  5G5G A;  4J9L A;  4I27 A;  2OXO A;  4DSL A;  4DQQ A;  1SL2 A;  2R8G A;  4F8R A;  2XID A;  3GV8 B;  2A3V A;  1ECW A;  2W03 A;  2VIX A;  5K4L A;  5KFK A;  3BQ7 A;  4EZ9 A;  2W8K A;  3SI8 A;  1ZQI A;  4Y2Y A;  4PHD A;  2YB1 A;  7ICV A;  4Q44 A;  2ZIX A;  5KFZ A;  4RPY A;  3MFI A;  4EZ6 A;  4J9Q A;  4U7C A;  4I2J A;  5AKE A;  3B0X A;  4QZ9 A;  1O08 A;  1UA1 A;  4PPX A;  4Z6F A;  3N4M B;  7ICK A;  1HEK A;  1WCL A;  2ZUB A;  2HBJ A;  3NAS A;  1NOM A;  5ALS A;  2C2R A;  4F2R A;  1Q8K A;  5AKJ A;  5D49 A;  2ZTE A;  4F4Z A;  7ICI A;  7ICU A;  3R9K A;  2R8K A;  4KLS A;  4FE3 A;  3K75 D;  4J9M A;  5AKZ A;  2DPI A;  5AM4 A;  3C21 A;  5KT2 A;  2BDU A;  1D8L A;  2CXY A;  3ALR A;  4NWI A;  1BVS A;  5KFN A;  1X6J A;  2UVU A;  2YX8 A;  1ZQV A;  5KG5 A;  1OUQ A;  4M2Y A;  2BPG A;  1XWL A;  2W3S A;  4CF5 A;  1RQL A;  2BCS A;  4NLG A;  4FBT A;  5ALJ A;  1ZQQ A;  2KZ3 A;  1Z19 A;  1ZQB A;  2R8J A;  3H8S A;  1N48 A;  3DEE A;  5ALT A;  1PVP A;  4IQT A;  3IRU A;  1ZQO A;  4KLH A;  4GC6 A;  3K4G A;  2NV3 A;  2WF9 A;  1CUK A;  2DQN B;  4DSK A;  3ZDA A;  4KMU A;  3JPR A;  1X9S A;  4TQR A;  1FFV A;  1TK8 A;  3RRG A;  2PFP A;  4FFD A;  2EH9 A;  2VJ5 A;  5ALH A;  2BQ3 A;  3V6K A;  8ICT A;  4RQM A;  5J2C A;  3UQ2 A;  3SAF A;  1U45 A;  4B9V A;  2YQE A;  3MR6 A;  1X42 A;  3CRX A;  2F3N A;  4J03 A;  4MFA A;  5KG6 A;  1LVH A;  4RU9 A;  4OJ6 A;  1MA7 A;  2RLT A;  4PGQ A;  4RZR A;  2ZJA A;  5KFV A;  5IIO A;  4FBU A;  4UAW A;  4US9 A;  1EXN A;  5DDM A;  2BHN A;  4NY8 A;  3N97 B;  1TV9 A;  1T3N A;  4Y2P A;  1UPH A;  5CP2 A;  4J9K A;  4C8L A;  3BJY A;  5KFB A;  2RDI A;  3QX7 A;  3LVV A;  2CPR A;  1DGS A;  3MAB A;  4KIT B;  4DFP A;  9ICI A;  5AI9 A;  4DL2 A;  3FDS A;  5AM3 A;  4Q43 A;  5KG3 A;  1KBU A;  5DGB A;  3H8J A;  1ZQY A;  5AKL A;  3G6X A;  2H3I A;  4PJ0 U;  3TAN A;  2PI5 A;  3QNM A;  3C23 A;  5EE3 A;  3C1Z A;  2MRL A;  3PSF A;  1CI4 A;  4DS5 A;  4JWN A;  8ICP A;  3Q8R B;  3QUT A;  5KFM A;  2M0N A;  2LHT A;  2QAR A;  4FS1 A;  3I76 A;  4EX6 A;  1C7Y A;  1T3Q A;  3PX6 A;  4C4T A;  2QB0 A;  1F5S A;  2JZB B;  4DL4 A;  3D2N A;  5J0W A;  3HJE A;  2Y1I A;  4ZOH C;  3L4P A;  2XO7 A;  2A1A A;  2K8B B;  3EWA A;  3C2K A;  2G0A A;  1DK3 A;  2JV3 A;  4JWM A;  1SL1 A;  1TE2 A;  1WG8 A;  1T8E A;  2HOI A;  4YR2 A;  1SV0 A;  3SMV A;  1QSS A;  2KD1 A;  4IRD A;  2WFA A;  4YMM A;  2KK0 A;  3SD7 A;  5DG8 A;  2G5H B;  2FLP A;  7ICG A;  1BPB A;  5J0O A;  2YB4 A;  5HNK A;  4YG2 A;  1ZQD A;  2UVW A;  1S10 A;  2PMZ F;  2G5I B;  4QZD A;  4ECQ A;  1JRP A;  1ZQN A;  5E79 U;  2ES6 A;  1BPD A;  4F72 A;  5J0Q A;  2R18 A;  4RQ5 A;  2JH1 A;  1QTM A;  2KFN A;  3QUB A;  5A0L A;  4KLT A;  1TVA A;  4KN7 A;  2D6F C;  3B9J A;  3CP8 A;  3JPP A;  4NXZ A;  1L3U A;  2BCU A;  5EWG A;  1RYS A;  2WF6 A;  5CEH A;  4ECV A;  5KFP A;  1U47 A;  2OM6 A;  2H5X A;  1FO4 A;  4UB2 A;  2WF7 A;  2YMQ A;  5ALE A;  3C2L A;  1S0O A;  3PO4 A;  1PK1 B;  1XO1 A;  1ZRN A;  1PK1 A;  1DXS A;  1IG6 A;  1L3T A;  1JN3 A;  2DUY A;  4YFK A;  4M04 A;  4C7Z A;  2LYA A;  2WB1 C;  3ZD9 A;  5EWE A;  4ECX A;  4K4H A;  9ICR A;  4ECW A;  1L7O A;  1VLB A;  4ACO A;  1Y88 A;  1VDV A;  4PL2 A;  3M1Y A;  4K4G A;  5F9L A;  9ICL A;  2FPM A;  1NKC A;  2JEF A;  4P4M A;  4O3Q A;  3TAQ A;  8ICK A;  1L7M A;  3UXP A;  5D4B A;  3KKA A;  5KFG A;  9ICP A;  4UBC A;  2QB1 A;  4R63 A;  3TAP A;  2EZX A;  4UAR A;  4XA5 A;  3RJK A;  4ED6 A;  2B21 A;  1K1S A;  1ZQU A;  2KHV A;  2J6T A;  5DBC A;  3GZF A;  4C7Y A;  2YN4 A;  4O3M A;  3RJH A;  2BR0 A;  3LYS A;  3LWM A;  2ZIW B;  2RP5 A;  3ISC A;  1UT8 A;  4GLX A;  4O3O A;  3EYZ A;  4ECS A;  2ISP A;  1ZQS A;  2EQY A;  2HHV A;  2ODG A;  4US8 A;  3RAX A;  1Z1B A;  1Z4N A;  3QU5 A;  2W9B A;  3T5L A;  1SKS A;  4BXO B;  4FS2 A;  4BXO A;  1XS9 D;  5KFF A;  5AI5 A;  4PGY A;  4ED2 A;  3M6K A;  4UAZ A;  5J2F A;  2BCR A;  4I2D A;  8ICX A;  3PW2 A;  4O3R A;  3WKB A;  8ICV A;  2HW3 A;  2BKE A;  3RJJ A;  2G06 A;  2FMQ A;  5KFD A;  3BS5 B;  3JPQ A;  3RJE A;  3BQ0 A;  3IV6 A;  1X9X A;  1MN8 A;  3IG5 A;  1A0P A;  4YQW A;  2LMR A;  2LKY A;  3SR6 A;  3FYH A;  5TZV A;  1ZRM A;  2NO4 A;  1WYG A;  1JIH A;  4G9B A;  1DGJ A;  3HT3 A;  2HSZ A;  1NKE A;  4KLM A;  4IRK A;  3O0F A;  5DB9 A;  4BDP A;  2K4E A;  1Q46 A;  1UT5 A;  2JR5 A;  3NTU A;  2MSN A;  2E3T A;  4P0Q A;  4CE6 A;  2Y1J A;  1X9W A;  3I1Y A;  1BNP A;  5CHG A;  5KG1 A;  3NGD A;  2FPK A;  1L3S A;  5IIK A;  4YMO A;  1P7D A;  2ALZ A;  2ZIU B;  2ZIU A;  4KLD A;  3GIK A;  2AH5 A;  2KZM A;  4ECT A;  1RM6 C;  3S6J A;  3ETR A;  3SYZ A;  3QXG A;  4M47 A;  3AN1 A;  2LPE A;  5HHI A;  1SL0 A;  1ZQM A;  2ESE A;  2AJQ A;  3M8S A;  2W7O A;  3KD3 A;  1L8O A;  1SZH A;  2EZZ A;  4DFD A;  5KFW A;  4O5E A;  4DFM A;  3HWT A;  4Y2J A;  4BWM A;  2KEY A;  2HHT A;  4JMU A;  4TUQ A;  3T5K A;  1QLN A;  3KHH A;  3EZ5 A;  4IQU A;  4U6P A;  2AGP A;  4MF2 A;  4UAY A;  2D3D A;  4KLL A;  2FLN A;  4QZ8 A;  1NNL A;  7ICH A;  3OPX A;  3VC8 A;  2C2D A;  3AU2 A;  5AKI A;  3RB3 A;  2IHN A;  8ICG A;  2OHF A;  3T3F A;  9ICE A;  4DQP A;  1ZQC A;  2HHU A;  3V6J A;  4DQR A;  4ICA A;  7ICS A;  1SZP A;  4YN4 A;  4BUG A;  3NS1 A;  4F92 B;  4EBE A;  4CF4 A;  9ICS A;  4EYI B;  4ELU A;  2NRZ A;  1IM4 A;  2MUT B;  1U9L A;  1BNO A;  1ZQX A;  2QKQ A;  5KFS A;  3GV7 B;  8ICM A;  2I6X A;  1YZ6 A;  3F5A A;  3FC4 A;  4NL9 C;  3T5J A;  3N7R C;  3C2M A;  2KKP A;  4QWE A;  1JX4 A;  7ICR A;  3PST A;  2ISO A;  4UB3 A;  4OJO A;  1S9F A;  4JV1 A;  4ED8 A;  7ICJ A;  1RQN A;  4OO1 J;  1VJ5 A;  2H3F A;  2EAP A;  4GXJ A;  1PVQ A;  2O6K A;  7ICT A;  3LVW A;  4UB6 U;  1UCV A;  2BPC A;  1N56 A;  4AYB F;  4C4R A;  3QU2 A;  2XGP A;  1LKY A;  2XCP A;  2ZIV A;  3OHA A;  4QW9 A;  2KP7 A;  3QU9 A;  4GXK A;  4I2E A;  4F71 A;  2J6U A;  1X9M A;  3MDC A;  3TAD C;  4C8O A;  1S97 A;  4ED3 A;  1QQ6 A;  3ETL A;  3OJU A;  4PZO A;  3QU4 A;  4Q8F A;  3TAD A;  2HVH A;  2F1J A;  8ICS A;  1KL9 A;  3ISB A;  2IOF K;  1TAU A;  3H0R B;  2JMG A;  9ICJ A;  3PW4 A;  1V9P A;  1XSL A;  5CJ7 A;  2F2A B;  4RQ7 A;  5AM1 A;  4IR1 A;  3PNC A;  4DFJ A;  2PKE A;  4ECY A;  5J0R A;  9ICA A;  5KFR A;  2KFZ A;  4DOC A;  5ALD A;  3H40 A;  4FZN A;  1DOQ A;  5KFY A;  9ICF A;  1S5L U;  4OJL A;  7ICE A;  4Q45 A;  4RUC A;  1J2M A;  2EAO A;  3GIJ A;  1JRO A;  1Z00 A;  5EOZ A;  2XC9 A;  4DL5 A;  1HUZ A;  3KBB A;  4RQ3 A;  3T5H A;  5AKG A;  4PHA A;  3IHQ B;  1SKR A;  2Y9T A;  4PHP A;  4QZE A;  4O9M A;  4UB1 A;  2F77 X;  2BZF A;  2KMD A;  1COO A;  2E8P A;  5F3X B;  1HJP A;  4E0D A;  9ICV A;  2YTU A;  4UB5 A;  8ICN A;  2HBK A;  3M9M B;  3H4B A;  4I2B A;  4J9S A;  2XY6 A;  4TUP A;  1LB2 B;  3J81 j;  3MC1 A;  1TK0 A;  5ALI A;  1MQ3 A;  3MR2 A;  8ICQ A;  4CCH A;  1D9F A;  5ALR A;  1K1Q A;  3NVZ A;  3C28 A;  2A1J A;  4MFC A;  4I28 A;  4PHE A;  2ZIW A;  4NLC A;  2JEJ A;  8ICC A;  2HCF A;  1COK A;  1B22 A;  2IBK A;  9ICO A;  3IM1 A;  2DGZ A;  5KAI U;  3PMN A;  2OEH A;  2NO5 A;  2E8N A;  1KLN A;  4RQ6 A;  2ZUD A;  5L1K A;  1SV0 C;  1JAL A;  4F5Q A;  2HBM A;  2XI9 A;  3PR4 A;  4EBC A;  1URJ A;  4IR9 A;  4RQ0 A;  4I2I A;  4MFF A;  1K5O A;  2F8L A;  2ZJ8 A;  4JK1 A;  8ICH A;  5KG4 A;  4I2C A;  4B6J A;  2WHE A;  3THV A;  3C5G A;  5AKY A;  1NZB A;  4XQ8 A;  3ZI4 A;  3GV5 B;  2V4Q A;  3WK5 A;  1D8Y A;  5DLG A;  5ALY A;  1RXW A;  4B9L A;  3NRW A;  4Y2V A;  1AQ6 A;  5ALQ A;  2W55 A;  5T14 A;  3WKE A;  5DBB A;  2W9B B;  3F53 A;  3SAG A;  3GIM A;  3L3F X;  5TIS U;  3C5F A;  1T94 A;  4DEZ A;  4KLJ A;  2W54 A;  2W43 A;  1PZN A;  2MU2 A;  2OCE A;  2Y0S F;  4J9N A;  4LVS A;  4EBD A;  3M7D A;  1L8L A;  3GFK B;  4YR3 A;  5L1J A;  2PFQ A;  3BZC A;  3OSN A;  3E2E A;  2H3Z A;  4P0Q B;  1D8B A;  3UMB A;  4Q8E A;  1NK7 A;  5AK6 A;  2IA6 A;  2K4I A;  3QU7 A;  3FM9 A;  1DK2 A;  3A0B U;  4KLU A;  1PUZ A;  3AQE A;  1JI7 A;  1J97 A;  5AKH A;  9ICH A;  5AM0 A;  2HOF A;  4P0P B;  3PY8 A;  2W8L A;  4ZH4 A;  1ZQA A;  5FP0 A;  2VA2 A;  4EYH B;  2UVV A;  3AQF A;  5AK3 A;  5DQI A;  4UAV A;  4EEL A;  1HUO A;  2R8H A;  3NVY A;  4Z6C A;  2ZG6 A;  1ZOL A;  1ZQJ A;  1A76 A;  3PO5 A;  1ZQK A;  3KHL A;  2G07 A;  4YP3 A;  2EZY A;  2MAX A;  2ASJ A;  5JUM A;  2YMP A;  2GH1 A;  5KFI A;  2H3V A;  2ASD A;  4NLN A;  4BWJ A;  4Y2T A;  1ZD2 P;  4HAI A;  4DS4 A;  5KFQ A;  4RT3 A;  4ED0 A;  2JEI A;  3Q8M A;  1KN5 A;  4DO9 A;  7ICQ A;  4BX9 C;  2MUT A;  3SV3 A;  5J2I A;  1JUD A;  4FZL A;  2AU0 A;  1Z1V A;  1ZD5 A;  4I2A A;  2AQ0 A;  3QUC A;  3GQC A;  5DB8 A;  4DL7 A;  2Y9U A;  4IS7 A;  8ICY A;  2KIC A;  9ICN A;  2I1Q A;  1T7P A;  4M9G A;  5DB7 A;  2IOH A;  3HPO A;  1ZD3 A;  3GIL A;  2WTF A;  3PZP A;  3N28 A;  3RBE A;  1KSP A;  9ICC A;  4QJF B;  3RR8 A;  1IIP A;  2YML A;  2F76 X;  2JXJ A;  5F9N A;  2KHQ A;  2BCQ A;  4CRX A;  1B0X A;  5EE1 A;  2ZJ5 A;  3NUQ A;  2GO7 A;  1X66 A;  3OGU A;  4G3I A;  4Y2S A;  1SWW A;  3BQT A;  4KX5 A;  5AI0 A;  3K1R B;  2KIV A;  2IOF A;  5AK4 A;  8ICF A;  1Z3E B;  3Q8K A;  4CNQ A;  1SXD A;  4DQS A;  5AM5 A;  4ED7 A;  1RXV A;  2JRZ A;  4KLI A;  4O5K A;  5DQG A;  2QB0 B;  2DPJ A;  4TUS A;  5ALM A;  4QWD A;  1XU4 A;  5KAF U;  3GII A;  4UQG A;  2HBL A;  5GTH U;  1X2I A;  5L1I A;  3QEB Z;  4F4X A;  1S0V A;  2RDJ A;  2HHX A;  4QW8 A;  1SIJ A;  3I28 A;  2XCA A;  5AI6 A;  1N60 A;  1NK4 A;  2ZUC A;  3IN5 A;  4C8M A;  3OHB A;  3RH5 A;  1ZQL A;  2E1F A;  8ICI A;  4KX3 A;  4KLQ A;  7ICL A;  2CN1 A;  1SXE A;  5L1L A;  5AI4 A;  4DCC A;  2LYH A;  1TKD A;  1M6Y A;  4F4K A;  3Q8P B;  4UAT A;  2BPF A;  4MF8 A;  2BGW A;  5B5E U;  4USA A;  3PV8 A;  2DF4 B;  9ICG A;  4NLZ A;  1QH9 A;  3GU3 A;  5H2F U;  3ZDB A;  5KFH A;  2P35 A;  3RB6 A;  4RNN A;  3TI0 A;  3BDP A;  4KLE A;  2XVT A;  4RPX A;  2K60 A;  5JU5 A;  2NRX A;  5HR7 A;  2V4R A;  4YVZ A;  4QIW F;  2F1I A;  5ALO A;  4F5O A;  3PX4 A;  3PW5 A;  1JXL A;  1BPY A;  3QUQ A;  2FI1 A;  2A19 A;  1QCK A;  3SEI A;  3VCB A;  3RB4 A;  3HKZ C;  1TK5 A;  4B9U A;  2MA1 A;  2AGO A;  3WK4 A;  4F2S A;  2KN7 A;  3ZDD A;  1RZT A;  8ICR A;  2AXT U;  5BOL A;  4M6W B;  5IIL A;  4JUZ A;  1ZQH A;  3CW2 C;  3TQ1 A;  4M9J A;  4P4O A;  4P2H A;  2ATL A;  4KMO B;  5GTI U;  8ICA A;  2E8M A;  2QLT A;  2WAQ C;  2HOQ A;  3SV4 A;  2KV2 A;  3U26 A;  5DQH A;  4RQ8 A;  1C20 A;  5ALF A;  2WAQ F;  5KFL A;  2K8A A;  5JTI A;  3A0H U;  3T79 A;  5KT4 A;  2KKV A;  3RH4 A;  2DKZ A;  5HMM A;  3ORY A;  4I2H A;  2LM4 A;  4NLB A;  1NJW A;  2KVC A;  2NRW A;  1WUD A;  3OJS A;  4ED1 A;  3RH6 A;  2AQ4 A;  4P4P A;  1JXE A;  2KJ8 A;  3TFS A;  9ICX A;  4R8U B;  1CRX A;  5AIC A;  4R8U A;  2HMX A;  4DFK A;  2VAN A;  3KZX A;  4M9H A;  1RYU A;  1ZJM A;  1LV5 A;  2WF8 A;  3AMZ A;  1ZQT A;  1V38 A;  5KFT A;  3MGI A;  4F5R A;  5ALX A;  4KN4 A;  2D8C A;  1ARO P;  3RR7 A;  5KG2 A;  5DG9 A;  4Y2R A;  8ICW A;  2J6S A;  3TAC B;  1N63 A;  3RTV A;  8ICO A;  1TFR A;  4PZN A;  5J0X A;  5BOM A;  4WJ3 B;  1XSN A;  3UM9 A;  1T4G A;  1ZJN A;  2K4P A;  1N5W A;  3V6H A;  1FFU A;  4I29 A;  2E5S A;  3Q8Q B;  5KT7 A;  4KLO A;  3KHG A;  4RQN A;  1X40 A;  1NJX A;  3EPI A;  4P0P A;  7ICO A;  3MGH A;  1N62 A;  3WKA A;  1FEZ A;  1U4B A;  4AYB C;  4EEK A;  5KFC A;  1NK9 A;  3AL0 B;  4ECR A;  2E8O A;  5III A;  1FIQ A;  1V85 A;  9ICB A;  2VKQ A;  4J9R A;  4GC7 A;  4B9N A;  5KG0 A;  5J8Y C;  1BGX T;  5KTQ A;  3UXN A;  3JPS A;  3V7L A;  3N7S C;  4M0A A;  2W3R A;  2BQU A;  5ALZ A;  1IV8 A;  1ZQF A;  4NM1 A;  3MGV A;  3MBY A;  1QQ7 A;  4IC9 A;  3WK7 A;  4Y2U A;  2EDU A;  5KT3 A;  3QZ7 A;  2IHM A;  5AIB A;  4DSF A; 
#chains in the Genus database with same CATH homology
 4YXJ A;  1NKC A;  1RXW A;  2JEF A;  4P4M A;  4B9L A;  4O3Q A;  3KTQ A;  5J2G A;  3TAQ A;  5DB6 A;  5CWR A;  8ICK A;  4TQS A;  4QWA A;  3UXP A;  5D4B A;  4M9L A;  2VA8 A;  5KFG A;  9ICP A;  4UBC A;  2HHW A;  4R63 A;  4QZI A;  9ICW A;  5DBB A;  2W9B B;  3HX0 A;  3UQ0 A;  3TAP A;  1NK5 A;  3RJF A;  2XY7 A;  3PR5 B;  1BPE A;  3GIM A;  5KG7 A;  5IIN A;  1U49 A;  5KFX A;  3C5F A;  3PX0 A;  4DEZ A;  3UPQ A;  4KLJ A;  3C1Y A;  4XA5 A;  3RJK A;  4F5N A;  4QZH A;  1PZN A;  2JEG A;  4O0I A;  1KDH A;  4J9N A;  3TFR A;  2XY5 A;  4B9S A;  1CEZ A;  4ED6 A;  2B21 A;  4LVS A;  4EBD A;  1ZQE A;  3V7J A;  1K1S A;  1ZQU A;  5KFJ A;  5KFE A;  1A77 A;  3GFK B;  4RQ2 A;  2J6T A;  4YR3 A;  4R66 A;  5L1J A;  5DBC A;  5J2D A;  4UB4 A;  3OSN A;  3PW7 A;  4DSE A;  2PFQ A;  3E2E A;  9ICK A;  1KFD A;  4RT2 A;  1ZET A;  8ICJ A;  4PGX A;  3RJH A;  2BR0 A;  4Q8E A;  1D9D A;  3LWM A;  1BPX A;  1NK7 A;  3ISC A;  4O3S A;  4DWI A;  1UT8 A;  2IA6 A;  4DF8 A;  3HP6 A;  4GLX A;  4Z6D A;  4O3O A;  3LDA A;  4KLU A;  3EYZ A;  4ECS A;  1UA0 A;  2ISP A;  1ZQS A;  2IMW P;  9ICH A;  5J0Y A;  3PY8 A;  2W8L A;  1XC9 A;  2FMS A;  2W9C A;  2HHV A;  4B9T A;  4ZH4 A;  3BQ2 A;  1ZQA A;  3PML A;  2VA2 A;  3RAX A;  5KFO A;  4EYH B;  4F3O A;  9ICT A;  2UVV A;  3T5L A;  2W9B A;  4ELV A;  1SKS A;  4X5V A;  4FS2 A;  4BXO B;  5DQI A;  3LK9 A;  4RQ4 A;  3JPO A;  3H4D A;  5J2A A;  1XS9 D;  5J2K A;  5KFF A;  4BXO A;  2KTQ A;  4RUA A;  1HUO A;  2R8H A;  2P6R A;  4FO6 A;  4PGY A;  3RJI A;  4R65 A;  4Z6C A;  4XUS A;  4RQ1 A;  5CR0 A;  4TUR A;  4F50 A;  4ED2 A;  3QE9 Y;  4K4I A;  2BDP A;  5J2J A;  3M9O B;  4UAZ A;  2BCR A;  5J2F A;  8ICX A;  4I2D A;  2XGQ A;  3KHR A;  1ZQJ A;  3PW2 A;  1A76 A;  2C22 A;  2C2E A;  3PO5 A;  1ZQK A;  4O3R A;  8ICV A;  3KHL A;  2BCV A;  2HW3 A;  4YP3 A;  2BKE A;  3RJJ A;  4LZD A;  5J2H A;  3PW0 A;  1ZQP A;  2FMQ A;  4Z6E A;  5KFD A;  2P66 A;  2MAX A;  4F93 B;  2ASJ A;  1WCN A;  3JPQ A;  1MSW D;  3RJE A;  5JUM A;  3BQ0 A;  7ICP A;  5KFI A;  5DBA A;  4YQW A;  2PI4 A;  4QWB A;  5HML A;  2W9A A;  1XSP A;  4QZC A;  2I9G A;  2ASD A;  4NLN A;  4BWJ A;  4DLE A;  3FYH A;  5L9X A;  5TZV A;  5J0T A;  4DS4 A;  2Q0Z X;  5KFQ A;  4RT3 A;  1QSY A;  1JIH A;  4ED0 A;  4MEY A;  1NKB A;  1KEJ A;  1JMS A;  4DSJ A;  2NRT A;  3RBD A;  4ECU A;  5DG7 A;  4O3P A;  2JEI A;  4QZG A;  1S76 D;  3Q8M A;  4DO9 A;  3HT3 A;  3QEA Z;  4KTQ A;  8ICZ A;  7ICQ A;  4I2G A;  4DOA A;  1NKE A;  4KLM A;  2MUT A;  3SV3 A;  4IRK A;  5J2I A;  4M9N A;  4DL3 A;  5DB9 A;  4BDP A;  4J9L A;  4I27 A;  4DSL A;  5KFU A;  4DQQ A;  1SL2 A;  2R8G A;  4F8R A;  3GV8 B;  3H7I A;  2AU0 A;  3M9N B;  4DLG A;  4I2A A;  2AQ0 A;  1MC8 A;  4BGD A;  1UT5 A;  5KFK A;  3GQC A;  3ZDE A;  3Q8L A;  5DB8 A;  2HVI A;  4DL7 A;  4EZ9 A;  2W8K A;  3SI8 A;  1ZQI A;  8ICY A;  4NM2 A;  2I1Q A;  9ICN A;  2R8I A;  3NTU A;  1T7P A;  4ELT A;  8ICE A;  4PHD A;  7ICV A;  4Q44 A;  4M9G A;  2Y1J A;  5DB7 A;  1X9W A;  3HPO A;  5BPC A;  4NLK A;  2V9W A;  3GIL A;  5KFZ A;  2WTF A;  5CHG A;  4RPY A;  5KG1 A;  3MFI A;  3QZ8 A;  1L5U A;  4EZ6 A;  3NGD A;  2FPK A;  4J9Q A;  3RBE A;  1L3S A;  4I2J A;  1KSP A;  5IIK A;  4YMO A;  3RJG A;  2ALZ A;  4DQI A;  9ICC A;  3B0X A;  5CA7 A;  4QZ9 A;  4KLD A;  3GIK A;  1UA1 A;  3RR8 A;  4PPX A;  4Z6F A;  1BPZ A;  2KZM A;  3N4M B;  4ECT A;  1WCL A;  7ICK A;  2ZUB A;  5F9N A;  3SYZ A;  1NOM A;  3BQ1 A;  4M47 A;  5HHI A;  1SL0 A;  1ZQM A;  2BCQ A;  2W9M A;  2C2R A;  4F2R A;  8ICL A;  2AJQ A;  1S77 D;  3M8S A;  5D49 A;  2ZTE A;  2ZJ5 A;  1ZQW A;  4F4Z A;  7ICI A;  7ICU A;  2R8K A;  1NJZ A;  5KFW A;  3OGU A;  4O5E A;  4DFM A;  3HWT A;  2W9C B;  4KLS A;  4BWM A;  2HHT A;  3K75 D;  4G3I A;  3T5K A;  4TUQ A;  4J9M A;  1QLN A;  3BQT A;  3KHH A;  4LZG A;  4EEY A;  2DPI A;  3EZ5 A;  4IQU A;  2PFN A;  4DSI A;  3C21 A;  5KT2 A;  8ICF A;  2AGP A;  1D8L A;  1Z3E B;  3Q8K A;  1S0M A;  4MF2 A;  4UAY A;  1BVS A;  5KFN A;  4DQS A;  3RB0 A;  2UVU A;  1ZQV A;  5KG5 A;  4ED7 A;  1RXV A;  4KLL A;  2FLN A;  2FMP A;  4QZ8 A;  4M2Y A;  4KLI A;  7ICH A;  2BPG A;  5KFA A;  1XWL A;  1RPL A;  2ASL A;  1NK8 A;  2C2D A;  4O5K A;  3AU2 A;  4F5P A;  3RB3 A;  5DQG A;  2BCS A;  2IHN A;  2DPJ A;  4NLG A;  4TUS A;  4QWD A;  5IIM A;  4FBT A;  3ISD A;  1XU4 A;  2FPL A;  8ICG A;  3T3F A;  3GII A;  9ICE A;  4UQG A;  1ZQQ A;  1ZQC A;  4DQP A;  2KZ3 A;  3V6J A;  1ZQB A;  2HHU A;  2PXI A;  2R8J A;  4DQR A;  3H8S A;  1N48 A;  7ICS A;  1SZP A;  4M6W A;  1KRP A;  4YN4 A;  1X2I A;  1QSL A;  9ICU A;  3B0Y A;  4F92 B;  4EBE A;  9ICS A;  4IQT A;  4EYI B;  4ELU A;  2NRZ A;  1Z00 B;  5C5J A;  5L1I A;  1IM4 A;  2MUT B;  1ZQO A;  3UXO A;  4GC6 A;  4KLH A;  1U9L A;  4F91 B;  3QEB Z;  3K4G A;  4F4X A;  4JV0 A;  2UVR A;  1S0V A;  2RDJ A;  2HHX A;  3MR5 A;  1CUK A;  1ZQX A;  4QW8 A;  5KFS A;  3PVX A;  2XCA A;  3GV7 B;  8ICM A;  1NK4 A;  4DSK A;  2ZUC A;  3ZDA A;  4KMU A;  3H8W A;  3JPR A;  3T5J A;  4C8M A;  3OHB A;  3RH5 A;  2HHS A;  1X9S A;  3G6V A;  4YD1 A;  4TQR A;  1S0N A;  1ZQL A;  3C2M A;  1TK8 A;  2NRV A;  4QWE A;  5DDY A;  5J2E A;  1JX4 A;  1ZQR A;  3RRG A;  8ICI A;  2PFP A;  7ICR A;  2ISO A;  1KFT A;  4KLQ A;  7ICL A;  4UB3 A;  1S9F A;  4JV1 A;  2VA3 A;  4ED8 A;  5L1L A;  7ICJ A;  2F1H A;  1MQ2 A;  2LYH A;  2BQ3 A;  3AUO A;  3V6K A;  5DKW A;  1TKD A;  4F4K A;  3Q8P B;  8ICT A;  5J2C A;  4GXJ A;  3UQ2 A;  1U45 A;  4B9V A;  2BPF A;  3MR6 A;  7ICT A;  4MF8 A;  3RAQ A;  3EW9 A;  2BGW A;  4MFA A;  5KG6 A;  9ICL A;  4RU9 A;  4IRC A;  4PGQ A;  4MEX A;  2BPC A;  4RZR A;  4IQW A;  2ZJA A;  5KFV A;  3PV8 A;  3OSP A;  9ICG A;  1N56 A;  5IIO A;  4FBU A;  1SKW A;  4NLZ A;  3ZDB A;  2A1J B;  1H38 A;  5CB1 A;  4UAW A;  4GXI A;  2ZTC A;  5KFH A;  1EXN A;  3RB6 A;  4RNN A;  2XGP A;  3TI0 A;  3BDP A;  2XCP A;  2P6U A;  8ICU A;  4KLE A;  3OHA A;  5DDM A;  1TAQ A;  4RPX A;  3GDX A;  2BHN A;  2NRX A;  4NY8 A;  3N97 B;  4QW9 A;  1TV9 A;  3JPT A;  4GXK A;  2V4R A;  3G6Y A;  1T3N A;  4YVZ A;  2DFL A;  4IQV A;  5CP2 A;  4J9K A;  4C8L A;  3BJY A;  4I2E A;  5KFB A;  2RDI A;  2F1I A;  4C8N A;  4F5O A;  3PX4 A;  3ZDC A;  3PW5 A;  1DGS A;  1JXL A;  3MAB A;  2J6U A;  1X9M A;  1BPY A;  4KIT B;  4RNM A;  3MDC A;  4C8O A;  1S97 A;  4ED3 A;  3RRH A;  3ETL A;  2ZTD A;  3OJU A;  4F4Y A;  4DFP A;  9ICI A;  5J29 A;  4Q8F A;  4RNO A;  4DL2 A;  3FDS A;  5HHH A;  5KG3 A;  5KT6 A;  4Q43 A;  2HVH A;  3RB4 A;  2F1J A;  8ICS A;  1TK5 A;  5DGB A;  3ISB A;  3H8J A;  4B9U A;  1ZQY A;  4R64 A;  4JV2 A;  1TAU A;  2AGO A;  3G6X A;  4DL6 A;  9ICJ A;  3PW4 A;  4F2S A;  1V9P A;  5J0U A;  1XSL A;  2KN7 A;  3ZDD A;  1RZT A;  5CJ7 A;  5BOL A;  4C8K A;  3TAN A;  8ICR A;  2PI5 A;  2OWO A;  3V7K A;  4RQ7 A;  4O3N A;  4F4W A;  4M6W B;  3C23 A;  5IIL A;  4IR1 A;  3PNC A;  1NK0 A;  4DFJ A;  3C1Z A;  4JUZ A;  5J0R A;  4YCX A;  4ECY A;  1ZQH A;  9ICA A;  4DF4 A;  5KFR A;  4DS5 A;  3MDA A;  3TQ1 A;  4DOC A;  2KFZ A;  4JWN A;  4M9J A;  4P4O A;  4P2H A;  2ATL A;  8ICP A;  3Q8R B;  9ICM A;  5KFM A;  8ICA A;  4QZA A;  4FS1 A;  3SV4 A;  3H40 A;  1C7Y A;  1RYR A;  3PX6 A;  2AGQ A;  4B9M A;  5DQH A;  1DOQ A;  5KFY A;  9ICF A;  4RQ8 A;  9ICQ A;  7ICE A;  4Q45 A;  2JZB B;  4RUC A;  4DL4 A;  5KFL A;  5J0W A;  3GIJ A;  2Y1I A;  4YD2 A;  1KTQ A;  3AU6 A;  2XO7 A;  5KT4 A;  5DGA A;  3MR3 A;  7ICN A;  1Z00 A;  3EWA A;  3RH4 A;  3C2K A;  5HMM A;  4QZB A;  5EOZ A;  4JWM A;  3ORY A;  2XC9 A;  4DL5 A;  1SL1 A;  1HUZ A;  4I2H A;  1T8E A;  4RQ3 A;  3T5H A;  4YR2 A;  3ZD8 A;  5DLF A;  1NJW A;  2NRW A;  3IHQ B;  4PHA A;  1SKR A;  4PHP A;  1QSS A;  7ICF A;  5J2B A;  4IRD A;  4YMM A;  3OJS A;  4QZE A;  8ICB A;  4O9M A;  5DG8 A;  3JPN A;  4ED1 A;  3RH6 A;  4UB1 A;  4P4P A;  2AQ4 A;  2FLP A;  1JXE A;  3TFS A;  2C28 A;  4R8U B;  9ICX A;  4YR0 A;  7ICG A;  1BPB A;  4R8U A;  4QZF A;  5J0O A;  1ZQG A;  1COO A;  4DFK A;  1ZQZ A;  2VAN A;  3LWL A;  5HNK A;  4YG2 A;  1HJP A;  1U48 A;  1S10 A;  1ZQD A;  2UVW A;  4E0D A;  2BQR A;  5KT5 A;  9ICV A;  4HYK A;  4UB5 A;  1NK6 A;  8ICN A;  4M9H A;  4QZD A;  3M8R A;  4ECQ A;  1ZJM A;  3M9M B;  1LV5 A;  1ZQN A;  1BPD A;  4YMN A;  3H4B A;  1ZQT A;  4QWC A;  5KFT A;  1IXR A;  4I2B A;  5J0Q A;  3MGI A;  4J9S A;  4F5R A;  5EWF A;  4KN4 A;  2XY6 A;  4TUP A;  1LB2 B;  4RQ5 A;  1ARO P;  3V72 A;  4ECZ A;  2GWS A;  3RR7 A;  1QTM A;  3TAR A;  5KG2 A;  5DG9 A;  8ICW A;  4J9O A;  2J6S A;  2KFN A;  4O5C A;  1TK0 A;  2PFO A;  3RTV A;  8ICO A;  4RPZ A;  4UBB A;  1MQ3 A;  1TFR A;  5J0X A;  5BOM A;  3MR2 A;  4KLT A;  1TVA A;  4CCH A;  2HHQ A;  8ICQ A;  1D9F A;  1XSN A;  4KN7 A;  1K1Q A;  1T4G A;  5IIJ A;  1ZJN A;  4KLF A;  4J9P A;  3JPP A;  2A1J A;  4I2F A;  4NXZ A;  1L3U A;  2FLL A;  4MFC A;  4I28 A;  4PHE A;  3V6H A;  2BCU A;  4I29 A;  4YXM A;  3Q8Q B;  5EWG A;  1ZYQ A;  5KT7 A;  2JEJ A;  1RYS A;  4KLO A;  8ICC A;  3KHG A;  4KLG A;  4ECV A;  5KFP A;  1NJX A;  1U47 A;  3EPG A;  5J0P A;  3EPI A;  2H5X A;  1B22 A;  4UB2 A;  2IBK A;  1KFS A;  7ICM A;  3IM1 A;  3MGH A;  2KZZ A;  1U4B A;  7ICO A;  9ICO A;  3C2L A;  3PMN A;  5KFC A;  1S0O A;  1NK9 A;  3SZ2 A;  4DOB A;  4RQ6 A;  1KLN A;  2ZUD A;  1B43 A;  4ECR A;  3PO4 A;  1XO1 A;  5III A;  9ICB A;  4PH5 A;  4J9R A;  4GC7 A;  1L3T A;  4B9N A;  5J0S A;  5L1K A;  5KG0 A;  1JN3 A;  4F5Q A;  3PR4 A;  4EBC A;  1BGX T;  4YFK A;  3UXN A;  5KTQ A;  1NJY A;  4M04 A;  3Q8S B;  3JPS A;  3V7L A;  2M9N A;  4IR9 A;  4M0A A;  3ZD9 A;  2BQU A;  5EWE A;  4RQ0 A;  4ECX A;  4I2I A;  4MFF A;  1ZQF A;  4K4H A;  4NM1 A;  2ZJ8 A;  9ICR A;  4JK1 A;  3MBY A;  8ICH A;  4ECW A;  3MFH A;  5KG4 A;  4I2C A;  1L3V A;  1Y88 A;  2JZB A;  3THV A;  3C5G A;  5D46 A;  5KT3 A;  3QZ7 A;  2IHM A;  5HP4 A;  4XQ8 A;  3HW8 A;  3GV5 B;  4K4G A;  2V4Q A;  5F9L A;  1D8Y A;  4XRH A;  5DLG A;  2FPM A;  4DSF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...