3K4GA

Crystal structure of e. coli rna polymerase alpha subunit c-terminal domain
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
83
structure length
78
Chain Sequence
b'PEFDPILLRPVDDLELTVRSANCLAEAIHYIGDLVQRTEVELLTPNLGSLTEIDVLASRGLSLGMRLENWPPASIADE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA-directed RNA polymerase subunit alpha
publication title Structure of the Escherichia coli RNA polymerase alpha subunit C-terminal domain.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Transferase
total genus 18
structure length 78
sequence length 83
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2009-10-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3k4gA00
1ZYQA 3PX0A 9ICHA 2NRXA 2W9MA 1QSLA 2FLLA 1KEJA 2ZTDA 4ECTA 1Z3EB 4F5RA 4J9MA 5KFOA 4QWDA 2OWOA 4YFKA 4RPXA 5J0QA 4PHAA 4ECQA 4DSJA 5DGBA 1SL1A 3TAPA 4I28A 2HHVA 4GC6A 3RB6A 4FS2A 4RPZA 5CWRA 8ICWA 4DS4A 1RYRA 1B43A 1ZQNA 5DDMA 4TQRA 4YP3A 3ISDA 3RAQA 1D9FA 4YXJA 5J0SA 4YVZA 3BDPA 4EYIB 5CA7A 4UB1A 4M47A 4KLQA 3GV7B 5DB6A 1H38A 5KFUA 1KLNA 2ZTEA 2V9WA 4IRDA 1UT5A 4DEZA 1ZQKA 4I2BA 3UQ2A 4O3QA 2BQRA 4F92B 3NGDA 2KZ3A 4GXKA 3PW7A 4M9JA 5KG6A 4UB4A 3T5JA 1TAUA 7ICJA 1X9SA 4K4GA 8ICHA 3JPSA 9ICLA 4YR2A 4XQ8A 8ICFA 4JUZA 7ICKA 5DQHA 3ZDCA 4ECXA 4KLFA 2XGQA 4F4WA 3H8JA 4I2DA 3MDCA 4J9QA 4MFAA 4C8KA 2HHWA 3B0YA 2XY5A 5KFXA 3JPPA 4YD1A 1KRPA 5KFGA 3RJJA 3PX4A 9ICQA 5F9LA 3RH4A 2ISPA 1ZQQA 4JWMA 1Z00A 9ICGA 3PV8A 4B9NA 1NJWA 1CEZA 2MUTA 3HW8A 3RH5A 4UAYA 5DGAA 1NK6A 4KLSA 4DSIA 4E0DA 3RRHA 4K4HA 3MR3A 1ZQEA 5IIOA 5DQGA 5BOMA 4XRHA 7ICTA 4KLTA 1SKWA 1ZQZA 1NK9A 5J2GA 4ELUA 4YQWA 4DFKA 4O3PA 5J0XA 4I2AA 8ICIA 5J0PA 1Z00B 3M9OB 4GXIA 3T5KA 3ETLA 4DFJA 2DPIA 2MUTB 5IILA 2IHNA 3ZD8A 4ECZA 1NKBA 4RUAA 5HNKA 2ASJA 1A77A 2FLPA 1L3UA 1D8LA 4R65A 2BGWA 3HPOA 1B22A 2ZJAA 2ASDA 4QWCA 3EPGA 4I27A 4J9RA 4RQ8A 4R63A 1LV5A 2JEJA 3H8WA 4ECYA 4DQIA 4RQ5A 4NM2A 1XSNA 5KFJA 4RNNA 3GV5B 5KFWA 5KFZA 4ELVA 3JPTA 9ICVA 4YMOA 5HP4A 5DLFA 3NTUA 4PGQA 3PR5B 4F91B 5L1KA 4NM1A 1ZQAA 4JV1A 2AJQA 5KFRA 2I1QA 3ZDDA 5KG1A 3M8RA 2BR0A 4KLDA 1NK5A 5DB9A 5C5JA 4RPYA 3RTVA 1ZQDA 4J9OA 4C8OA 4M2YA 3PMLA 5D4BA 4NY8A 3UQ0A 4ED1A 4DOAA 3HWTA 3RRGA 9ICSA 5KT2A 2BDPA 5KFLA 4KLLA 3SYZA 8ICZA 5BPCA 1KSPA 5DLGA 2XCAA 1SKSA 3C2KA 4J9LA 4KLHA 1U9LA 3IM1A 4UQGA 1ZQMA 4FS1A 3FDSA 4YMNA 5DG9A 4FO6A 8ICJA 5J2HA 3QEBZ 2H5XA 3T3FA 3Q8RB 1NKCA 2IA6A 1X9WA 4ED0A 5KFKA 3Q8KA 2HHTA 4M9LA 1BVSA 4DF8A 3UXOA 1T8EA 4B9UA 4DSFA 4QWAA 5JUMA 1UT8A 3G6YA 2BPGA 4O9MA 7ICGA 3AUOA 2NRWA 2R8IA 3RB4A 2F1JA 2AGOA 7ICLA 7ICSA 4JV0A 1MC8A 3EZ5A 5L1IA 4K4IA 4TQSA 4IRCA 2J6UA 1ZJMA 5L1LA 4BXOA 7ICMA 4QZGA 3RJIA 8ICBA 5KFBA 8ICUA 4RQ0A 4NLGA 7ICPA 3M9NB 1TK8A 2BCRA 5CJ7A 3GIIA 3C2LA 3RH6A 2VA2A 4JV2A 2JEIA 3JPRA 2LYHA 4M6WA 7ICVA 3MFHA 2J6SA 4O3RA 4I2JA 4KTQA 3IHQB 4M0AA 4MEYA 3GILA 4BXOB 1BPXA 1S10A 4B9SA 2R8JA 7ICNA 4UBBA 2R8GA 4EBDA 1TK0A 5D46A 2IMWP 2R8KA 1NJXA 4PGYA 2DPJA 2C2RA 5KFMA 4M6WB 5DB8A 4I29A 4BWMA 1ZQPA 4C8MA 4RQ1A 3JPOA 4DL5A 4KLEA 1ZQUA 5IIKA 4LZGA 2P6UA 3HX0A 4NXZA 5KT3A 5KFHA 2VA3A 5J2IA 8ICOA 5DQIA 4EZ9A 3T5LA 3C2MA 1NKEA 5KG0A 4DO9A 4LVSA 4DOBA 3QZ8A 1ZQVA 4QZAA 4RT3A 3Q8MA 4GXJA 2Q0ZX 3KHHA 9ICCA 4QZDA 3OJUA 2J6TA 4IQUA 4ECSA 8ICYA 8ICTA 4I2IA 2GWSA 1XO1A 3H8SA 4YD2A 9ICKA 1WCLA 4YMMA 2XO7A 4JWNA 2W8LA 4UB2A 2BKEA 3EYZA 1KFSA 4M9GA 3THVA 4KLGA 4YG2A 2R8HA 4I2FA 1ZJNA 2VA8A 5KFAA 4FBUA 4ED2A 3PR4A 4DL3A 4M9HA 4RNOA 2JEGA 1IXRA 2KTQA 1BPBA 2ASLA 3ZDBA 1U49A 2XY7A 3GFKB 5EWGA 3TAQA 8ICCA 1NK8A 1TVAA 8ICPA 7ICUA 3Q8SB 3BQTA 4GC7A 3SV3A 2BQ3A 4B9MA 1XWLA 4F93B 4F4YA 2V4QA 1TV9A 4PHEA 4UBCA 2AGPA 1D9DA 3H4DA 2XY6A 3HT3A 1L3VA 1KDHA 1IM4A 4ED6A 3GQCA 2BCQA 5L9XA 5CHGA 1A76A 4Z6DA 1HUZA 5KFVA 1S0VA 2MAXA 3C1YA 1T4GA 5DBBA 4TUQA 3AU6A 4DF4A 4PH5A 2I9GA 3BQ1A 1SKRA 2A1JA 3MABA 4DFMA 9ICMA 4EYHB 1L3SA 2KN7A 3C21A 1XU4A 3G6VA 4Q43A 2FLNA 1XS9D 2KZZA 4UAZA 1U48A 2C22A 2B21A 5EOZA 3GIJA 4M9NA 5D49A 1ZQTA 1WCNA 4YXMA 4HYKA 2A1JB 5DG8A 5J2BA 1JN3A 3LWLA 4J9KA 2C2EA 1D8YA 2BPFA 3PY8A 1QLNA 5CP2A 5HMMA 4B9LA 2HHXA 3TQ1A 3PW4A 4YR3A 1COOA 5J2CA 3V6JA 3PO4A 3SV4A 1BPEA 2FMSA 2PFPA 5KFEA 3UXPA 4F4ZA 4UB5A 3BQ2A 4IRKA 1U45A 3GIKA 3V6HA 2UVRA 4YCXA 2HW3A 4ECRA 2Y1JA 3UPQA 2AQ4A 5J0RA 5KG5A 4ECVA 1KTQA 4EEYA 7ICEA 4J9PA 5DDYA 4Z6FA 1RXWA 4EZ6A 9ICIA 4NLZA 3OGUA 1RZTA 4RQ7A 4QZIA 1MQ3A 3KTQA 3MFIA 1LB2B 4NLKA 3Q8PB 1T3NA 3V7LA 1X9MA 4TURA 4IR9A 5KFIA 3JPQA 3EW9A 3M8SA 1NOMA 4B9VA 4O5KA 4ECWA 4NLNA 7ICHA 2ZUBA 5KG3A 4PPXA 8ICNA 2V4RA 4R64A 1JMSA 1ZQYA 3LK9A 3GV8B 4DLGA 4DOCA 3KHGA 4RUCA 4QWEA 1ZQJA 4DQSA 3PW5A 2ALZA 3BJYA 3QEAZ 2AQ0A 2ZJ5A 1SL0A 4DSLA 2M9NA 4O5CA 4KLJA 1JXLA 1BPDA 2XGPA 3N4MB 3PVXA 8ICXA 3RJGA 4JK1A 4I2GA 2W8KA 1QTMA 4RT2A 1NK7A 1L3TA 5IINA 2AU0A 1BPZA 2RDIA 4I2CA 4DL2A 5KT4A 4R8UA 4EBEA 4XUSA 1TK5A 4I2EA 9ICNA 9ICTA 2UVWA 5KFCA 1S9FA 5J0WA 4Z6CA 5J0OA 3OJSA 2HHQA 4KN7A 1ZETA 3PW2A 2JZBA 2FMQA 3HP6A 4I2HA 3KHLA 4KLOA 8ICMA 3TFRA 4R8UB 2P6RA 1HJPA 3TFSA 3V7JA 3C5GA 1C7YA 1U4BA 2NRZA 1U47A 1S76D 4IQTA 3OHAA 5KG2A 4DWIA 4LZDA 3PO5A 4BDPA 4IQWA 1ZQXA 5J2EA 3ORYA 2W9CA 3OSNA 1ZQOA 3EPIA 1MQ2A 3FYHA 2HVIA 4P4OA 2XCPA 2JZBB 1S0OA 1ZQFA 1QSSA 9ICRA 1K1QA 3RR8A 2KFZA 4Q8FA 9ICBA 1S0MA 4DQQA 1ZQBA 1KFDA 8ICRA 3UXNA 1XSPA 1HUOA 7ICQA 9ICXA 4F2RA 3JPNA 5KG7A 3PX6A 3H4BA 4O3NA 5J2JA 5KFTA 3AU2A 5KFQA 4RZRA 2W9CB 4DL7A 4DL4A 1S97A 4KLMA 8ICGA 9ICOA 1ZQWA 3EWAA 4QZBA 3ZD9A 3BQ0A 3GDXA 4ZH4A 2BCUA 2PFOA 1JXEA 3B0XA 4F50A 2P66A 5IIJA 4DSKA 5J2FA 8ICLA 3ZDAA 3RJFA 5KFPA 1ZQGA 2IHMA 5KFDA 2IBKA 4P2HA 3K75D 3ZDEA 1NJZA 9ICJA 4RQ3A 5F9NA 1ZQIA 1ZQSA 3TANA 4XA5A 7ICRA 4P4PA 2VANA 4QZEA 4G3IA 4MFCA 3H7IA 5KT5A 4FBTA 1ZQCA 2W9AA 2AGQA 4C8NA 4QZFA 1NK0A 2BQUA 5DB7A 1AROP 2WTFA 3ISBA 5L1JA 2NRVA 5DG7A 4QWBA 5J2AA 3RAXA 2FPMA 3C1ZA 5KFSA 5EWFA 2PFNA 1DOQA 4ED8A 5J0TA 1ZQHA 3QE9Y 1SL2A 4Q44A 5HHIA 4RQ2A 3V7KA 4F5NA 4Z6EA 1DGSA 3M9MB 4DQPA 5DKWA 4F2SA 5IIIA 3H40A 2ZUCA 1XC9A 3LDAA 4F5QA 3C5FA 4DL6A 3RB3A 1UA0A 1UA1A 4BGDA 5J2KA 4EBCA 8ICEA 4BWJA 9ICAA 2DFLA 5J0YA 4X5VA 5DBAA 4MFFA 3RBDA 9ICFA 2FPLA 9ICUA 4KN4A 1X2IA 5KFYA 3Q8LA 2C28A 4O3SA 3TARA 4UAWA 1ZQRA 2PFQA 1ZQLA 3KHRA 1RPLA 4KLIA 7ICIA 2PI5A 2ZJ8A 4PHDA 4B9TA 5HMLA 2RDJA 2BPCA 4F5PA 1SZPA 4C8LA 3TI0A 2HVHA 1V9PA 5IIMA 1K1SA 1MSWD 2BCVA 4QZ8A 3MR6A 2KZMA 3V72A 1N56A 3C23A 1BPYA 1N48A 3RJKA 4DQRA 4QW9A 4IR1A 1JX4A 5J0UA 2HHUA 3RB0A 9ICPA 4O0IA 3OSPA 5KFNA 3V6KA 4F4KA 4F8RA 2JEFA 5J29A 4PHPA 4RU9A 2ZUDA 4IQVA 3MGHA 1L5UA 5KG4A 5DBCA 4KLUA 4P4MA 1EXNA 1RXVA 4F5OA 1Y88A 3Q8QB 3SI8A 1TKDA 3RBEA 2BHNA 2KFNA 4TUSA 4R66A 2XC9A 3MR2A 8ICQA 3SZ2A 2ZTCA 3MGIA 4GLXA 1QSYA 8ICVA 3PMNA 1T7PA 4KMUA 3N97B 7ICOA 3RJEA 4DLEA 1KFTA 4F3OA 2C2DA 4CCHA 2Y1IA 5CB1A 5EWEA 4M04A 4DSEA 5KFFA 4QZHA 5KT6A 3PNCA 4RQ4A 4J9NA 1NJYA 3RJHA 9ICEA 4KITB 1S77D 4YR0A 3OHBA 2NRTA 8ICAA 3MBYA 1TAQA 3GIMA 4PGXA 4J9SA 2UVUA 3LWMA 4YN4A 4RQ6A 4DFPA 1S0NA 8ICSA 4DS5A 3K4GA 2W9BA 2BCSA 3MR5A 4TUPA 4O5EA 8ICKA 5TZVA 1RYSA 1PZNA 4UB3A 5CR0A 4F4XA 9ICWA 7ICFA 4Q45A 2F1IA 2HHSA 4QZCA 1TFRA 5J2DA 3MDAA 2FPKA 4ED7A 4RNMA 3G6XA 4MEXA 3RR7A 1CUKA 3E2EA 3QZ7A 3ISCA 2UVVA 2F1HA 2PI4A 4ELTA 5KTQA 4MF8A 4ECUA 1BGXT 2ISOA 5BOLA 2W9BB 4O3OA 1XSLA 4ED3A 4Q8EA 3T5HA 5HHHA 2PXIA 3PW0A 2ATLA 1NK4A 4MF2A 5KT7A 2FMPA 1JIHA 4QW8A 4QZ9A
chains in the Genus database with same CATH superfamily
3AM9A 2W3RA 2W9MA 2FLLA 1YT3A 5J0QA 1SL1A 4I28A 3GZFA 4FS2A 4RPZA 4OJOA 2K60A 3NRWA 4DS4A 5AI5A 4YXJA 5AKIA 5J0SA 4JB3A 4EYIB 4CF5A 3DV9A 1KLNA 2F77X 4IS7A 4F92B 4M9JA 5KG6A 4NWIA 2CXYA 5DQHA 3I1YA 4ECXA 1WG8A 1PVPA 2W11A 4F4WA 3H8JA 4C8KA 2LPEA 2GO7A 4C80A 4YD1A 1KRPA 5KFGA 2OM6A 4PL1A 9ICQA 3OTQA 1IG6A 1ECWA 3ZI4A 1Z00A 2HCFA 3PV8A 4B9NA 9ICGA 2MUTA 3HW8A 1NK6A 3HJEA 2OXOA 5BOMA 5T14A 1NK9A 1X42A 5J2GA 4O3PA 8ICIA 1Z00B 3T5KA 2MUTB 3ZD8A 1SV0C 5HNKA 2FLPA 5E79U 1L3UA 1D8LA 5KL1B 4R65A 1J2MA 3HPOA 2ZJAA 2LM1A 4J9RA 4RQ8A 4DQIA 4ECYA 3GV5B 5KFZA 4YMOA 3NTUA 3PR5B 1ZQAA 4EEKA 2MA1A 1NZBA 1LKYA 3L4PA 2EZZA 1ZQDA 4C8OA 3UQ0A 9ICSA 1ZD2P 2BDPA 5KFLA 4KLLA 3SYZA 5BPCA 5DLGA 1SV0A 1LKYB 3IG8A 4UQGA 4FS1A 5DG9A 5AM5A 4FO6A 8ICJA 5ALJA 2H5XA 3T3FA 3QEBZ 4C4SA 4UAVA 1NKCA 5ALQA 4EX6A 1X9WA 1RDFA 3E58A 2HHTA 2CN1A 1VLBA 2YB1A 4QWAA 2BPGA 2R8IA 2H3ZA 7ICLA 1X6IA 4TQSA 4FZLA 4IRCA 1KN5A 8ICBA 5KFBA 4RQ0A 4NLGA 7ICPA 1TK8A 3GIIA 3MFHA 4O3RA 4I2JA 4NLBA 2ES6A 1WUDA 5D46A 4F72A 4BWMA 1ZQPA 1ZQUA 4KX5A 1V38A 2P6UA 8ICOA 5J2IA 4CGZA 1Q46A 4RT3A 2K4IA 1DXSA 2M0NA 3IV6A 2J6TA 9ICKA 1S8OA 4UB2A 4OJPA 1SXDA 1KFSA 4PZNA 2W54A 2KJ5A 4RNOA 2JEGA 2ASLA 3BZKA 1LVHA 3Q8SB 3NVVA 4BUGA 4F4YA 2Y9UA 2EZYA 3H4DA 3HT3A 2JHDA 1IM4A 3GQCA 5L9XA 1T4GA 4BX9C 2H3FA 4DFMA 9ICMA 2LKYA 2YQEA 2QARA 3RF9A 1L8LA 3C21A 1XU4A 3GIJA 4O3MA 5J2BA 4J9KA 2BPFA 3K1ZA 2F44A 1QLNA 2QARB 2HHXA 3TQ1A 4YR3A 3V6JA 2Z7JA 2PFPA 2G0AA 2UVRA 2WAQC 3UPQA 2G09A 5KG5A 4ECVA 2K8AA 4EEYA 7ICEA 4Z6FA 1T3NA 3I76A 2KICA 1KW4A 4O5KA 3AN1A 4ECWA 2V4RA 1SWWA 5AI8A 3L3FX 5HR6A 3KHGA 3IDWA 4DQSA 2AQ0A 2ZJ5A 2R18A 2WF6A 5AI9A 3N4MB 3RJGA 2D6FC 2W8KA 4KX3A 1NK7A 5ALXA 2AU0A 1BPZA 2YTUA 4XUSA 5ALUA 2GH1A 2N1RA 3OJSA 1JRPA 2WF5A 2JZBA 4I2HA 3KHLA 2HMXA 1C7YA 1U4BA 4DWIA 4LZDA 4IQWA 1ZQOA 3EPIA 2DUYA 1MQ2A 1X66A 3FYHA 2HVIA 2JZBB 3M6ZA 3RR8A 2KFZA 3D2SA 1S0MA 1SV4A 7ICQA 3QUCA 4F2RA 5J2JA 5KFQA 4KLMA 4QZBA 3ZD9A 4ZH4A 2PFOA 1JXEA 4F50A 3SAGA 1ZQGA 4UB8U 1NJZA 9ICJA 1ZQIA 1UQVA 7ICRA 2VANA 4FBTA 4C8NA 2W3SA 1NK0A 5DG7A 1N63A 1DOQA 1ZQHA 4Q44A 4PZOA 4RQ2A 3V7KA 2DGZA 5DKWA 3QU9A 2W55A 2ZUCA 4NV0A 3LDAA 3RB3A 3WKDA 2FE9A 4BGDA 3IRUA 2DFLA 4MFFA 9ICFA 4KN4A 4UASA 2C28A 2PKEA 4UAWA 1ZQRA 2PFQA 3KKAA 3QU5A 1RYUA 2E3TA 3M6KA 1SZPA 4C8LA 2WF8A 1K1SA 1X9XA 2DKXA 1MSWD 3WK7A 3V72A 1ZD5A 4IR1A 2ZG6A 1TAMA 2W7PA 3F2BA 5J29A 3AL0B 5KG4A 3VCBA 3K1RB 8ICQA 4KMUA 7ICOA 3RJEA 2C2DA 2F76X 4DSEA 4KMOB 5KT6A 4J9NA 3MBYA 3IN5A 1X6JA 2E8MA 3FC4A 4YN4A 5G5HA 1TE2A 3R9KA 3SR6A 4RQ6A 4DFPA 2W9BA 2BCSA 4TUPA 8ICKA 3FAHA 2F1IA 1PVRA 2NO4A 1B4FA 4RNMA 4U7CA 4MEXA 3QZ7A 3ISCA 2PI4A 3H0RB 5KTQA 4ECUA 1BGXT 2W9BB 1XSLA 3DDHA 1WWVA 2PXIA 1NK4A 4MF2A 5KT7A 1JIHA 1T7PA 1ZYQA 9ICHA 1KEJA 4J9MA 5KFOA 4PJ0U 4RPXA 4PHAA 3TAPA 2HHVA 3RB6A 8ICWA 1D9FA 3PZPA 2D3DA 1H38A 2ZTEA 2KD1A 4DEZA 2DL0A 4O3QA 3NGDA 1URJA 1O03A 7ICJA 2YN4A 1X9SA 3LVVA 4OJ5A 1YZ6A 3J81j 9ICLA 2KVCA 3ZDCA 2XGQA 3MDCA 4J9QA 2HHWA 4QNLA 2XY5A 3RJJA 3QU7A 3PX4A 5F9LA 4JWMA 1NJWA 2GLEA 4UAYA 4E0DA 3RRHA 4K4HA 1ZQEA 1DK2A 5AKZA 3TKAA 1SKWA 5J0XA 4I2AA 5J0PA 2DPIA 4DFJA 3ETLA 2IHNA 1NKBA 2JXJA 3WK6A 3WKBA 1B22A 3EPGA 1YZ7A 2NYVA 4R63A 2JEJA 4RNNA 1KKXA 5AKXA 5DLFA 4NLCA 4F91B 2JMGA 1NZPA 5KFRA 2I1QA 2K4EA 5KG1A 3E2EA 1NK5A 5DB9A 3RTVA 1FFVA 5D4BA 4NY8A 4ED1A 2F2AB 3RRGA 5KT2A 1N62A 1KSPA 4J9LA 3UMBA 3IM1A 4YMNA 5J2HA 3UMGA 1F44A 5AKHA 4Y2QA 5EE9A 4ED0A 2JH7A 1DGJA 3SMVA 3WK8A 3CW2C 3S6JA 1MA7A 2NRWA 2NO5A 7ICSA 1MC8A 4K4IA 2J6UA 3M1YA 1ZJMA 3RJIA 2BCRA 3C2LA 4CE6A 3AQFA 2LYHA 4M6WA 2WF7A 2J6SA 4BJQA 4CF3A 2IOFA 4M0AA 4MEYA 4B9SA 2R8JA 1DK3A 4UBBA 4EBDA 2E1FA 2G5HB 5AKGA 2C2RA 4M6WB 4C8MA 1QCKA 5KFHA 1N5XA 2EANA 2H3QA 3T5LA 1NKEA 5KG0A 5AM4A 4GFJA 5JRTA 4DOBA 1ZQVA 2Q0ZX 1SB3C 9ICCA 4IQUA 4ECSA 1Q8KA 3D2QA 1N2XA 2KEYA 4M9GA 4YG2A 2R8HA 5KFAA 4DL3A 4M9HA 5AM0A 2KTQA 5B5EU 2HOIA 2XY7A 5EWGA 8ICCA 2YMMA 1TVAA 7ICUA 2KJ8A 4GC7A 1XWLA 2HOQA 2V4QA 1TV9A 2ZIUA 1FO4A 2XY6A 1KDHA 4ED6A 1IV8A 3ED5A 5CHGA 1HUZA 4UATA 1BNOA 5AKYA 4TUQA 2I9GA 4PH5A 2ZIUB 2K4PA 3ONNA 1S5LU 2FLNA 1XS9D 2KZZA 4UAZA 4WJ3B 2B21A 3WKCA 5EOZA 1KQQA 5FP0A 4AYBF 3T79A 2C2EA 1D8YA 5CP2A 4B9LA 3PW4A 1COOA 5J2CA 3SV4A 2YMLA 5KFEA 3UXPA 4UB5A 3GIKA 1ZRNA 4OJLA 1T94A 2WHEA 2Y1JA 2AQ4A 2RLTA 4J9PA 1RXWA 2JRZA 4NLZA 3KTQA 1RZTA 4RQ7A 4QZIA 2YMPA 4NLKA 5AKEA 1X9MA 3EW9A 1NOMA 5ALDA 7ICHA 1JMSA 3LK9A 1NNLA 3SD7A 2LMRA 4RUCA 4QWEA 3BJYA 3WK4A 4KLJA 1JXLA 4FFDA 4I2GA 4P0QA 1FIQA 3BZCA 1QTMA 4RT2A 1AQ6A 5KT4A 4EBEA 1TK5A 9ICNA 1CI4A 2HHQA 3UM9A 4P0QB 5KAFU 3H0LB 1JROA 4Y2XA 1HJPA 3C5GA 4P0PA 2NRZA 2LI6A 1U47A 1S76D 3QX7A 3PO5A 4BDPA 1K5OA 1IIPA 5J2EA 3ORYA 2W9CA 3OSNA 5C0YA 2LYBA 4FE3A 9ICRA 1K1QA 2W03A 4DQQA 1RG6A 4P0PB 8ICRA 9ICXA 2WFAA 3JPNA 2HBLA 4O3NA 3IP4B 5KFTA 2W9CB 1S97A 1ZQWA 3EWAA 4USAA 2BCUA 3GDXA 5ALWA 2B0CA 3B0XA 1KBUA 5AIBA 2IBKA 5KFDA 2KOBA 5EE0A 5F9NA 4XA5A 1Z1VA 4QZEA 4G3IA 5DB7A 3AQEA 5L1JA 2JH1A 2NRVA 4QWBA 2FPMA 5EWFA 1M6YA 4ED8A 5AI4A 3KBBA 4F5NA 1DGSA 3M9MB 2OYYA 1UHUA 4F2SA 5IIIA 4F5QA 8ICHA 2EAOA 3NVZA 2OCEA 5J0YA 2H3VA 5DBAA 3RBDA 9ICUA 2DWQA 1X2IA 4O3SA 1RPLA 5KNIA 4KLIA 2PI5A 5HMLA 5AM1A 5AHXA 2HVHA 5AIAA 3C23A 1A0PA 1N48A 5JTIA 4DQRA 4QW9A 5J0UA 1PK1A 5KFNA 1L7OA 4EX7A 5AKJA 4RU9A 4PHPA 3MGHA 2ZUDA 5ALNA 4KLUA 5AK3A 3ETRA 4P4MA 2QKQA 1Y88A 3Q8QB 3SI8A 1TKDA 5TISU 3RBEA 4TUSA 4RQNA 2BZFA 3FM9A 2ZTCA 4GLXA 1PK1B 1QSYA 8ICVA 5AI0A 3N97B 2DBYA 4Y2TA 5CB1A 5EWEA 4QZHA 2CPRA 3PNCA 4RQ4A 3RJHA 2NRTA 2HBMA 3QUBA 3CRXA 5AK6A 4B6JA 2EAPA 4US9A 4O5EA 3L5KA 7ICFA 4Q45A 4QZCA 5J2DA 5JU5A 3G6XA 3RR7A 1CUKA 2UVVA 4MF8A 1PUZA 4Q8EA 3T5HA 1NI3A 1A6SA 5H2FU 1ZOLA 3N7RC 4QW8A 1HIWA 2G07A 2EDUA 3HKZC 3PX0A 2NRXA 1QSLA 3PSTA 4F5RA 4F71A 2E8OA 4QWDA 2OWOA 4YFKA 1RM6C 3F2CA 4DSJA 4QJFB 5DGBA 5CWRA 1B43A 1ZQNA 2QB1A 5CA7A 4UB1A 4M47A 3GV7B 5KFUA 2V9WA 4OD0A 3KKAC 4U6PA 1UT5A 1ZQKA 4I2BA 3UQ2A 2BQRA 4ICAA 2KZ3A 2E1EA 3PW7A 3N28A 2W43A 4UB4A 4YR2A 1ZRMA 2XI9A 1F5SA 3B0YA 3JPPA 5G5GA 3HILA 1CEZA 3HKZF 1VDVA 5ALVA 4DSIA 3SAHA 3PSIA 3MR3A 4XRHA 7ICTA 4KLTA 1ZQZA 5AI6A 4ELUA 2IOHA 3KOOA 4GXIA 3F53A 3M9OB 2KIWA 1A77A 1SGGA 5ALSA 2MU2A 1XNSA 4I27A 1OXJA 3KZIU 3H8WA 4RQ5A 4NM2A 1XSNA 5KFWA 2I5HA 3QUTA 3JPTA 4AP9A 5HP4A 4NM1A 4JV1A 2AJQA 3GU3A 3M8RA 2BR0A 5C5JA 4RPYA 2WB1F 4J9OA 4M2YA 1UCVA 5ALOA 4DOAA 1PVQA 3OPXA 3HWTA 5AM2A 1SIJA 1HEKA 1SKSA 4NL9C 1ZQMA 3FDSA 4Y2JA 5ALTA 2L5YA 2IA6A 3CP8A 2Y0SC 5K4LA 1BVSA 4DF8A 3UXOA 4DSFA 1UT8A 2MSNA 4G9BA 3G6YA 4O9MA 2KP7A 3AUOA 4Y2UA 3RB4A 2W04A 2ZXIA 5L1LA 2KE7A 4BXOA 4QZGA 8ICUA 2HOFA 3M9NB 5CJ7A 2JEIA 2VA2A 1JALA 4QIWC 3IHQB 5ALLA 3GILA 4NL9A 4BXOB 1S10A 1TK0A 2R8KA 5AKKA 2HI0A 2DPJA 5KFMA 4I29A 5DB8A 2ZIVA 4RQ1A 4LZGA 3HX0A 4NXZA 5KT3A 2A19A 3KZXA 2K8BB 4EZ9A 2ZIVB 2Y0SF 3NVWA 4GXJA 1Z1BA 3KHHA 3OJUA 8ICYA 2W7OA 2GWSA 1XO1A 3H8SA 1WCLA 2XO7A 1OUQA 4JWNA 2BKEA 3EYZA 1ZJNA 2VA8A 3AMZA 1L8OA 3GFKB 3TAQA 1NK8A 3F5AA 4QIWF 3BQTA 4B9MA 4UBCA 2AGPA 1N60A 1L3VA 2KHVA 3PSPA 2MAXA 5A0LA 3C1YA 5DBBA 2H3IA 4DF4A 3BQ1A 1SKRA 1L3SA 3G6VA 4DFDA 1U48A 2ODGA 2DQNB 2RP5A 2G5IB 4YXMA 2OEHA 5HMMA 1D8BA 3PO4A 2FMSA 1BPEA 1SZHA 4Y2SA 3BQ2A 4IRKA 1U45A 4RQMA 3V6HA 2HW3A 2KVSA 4YCXA 5J0RA 4HAIA 2Y9TA 1T3QA 5DDYA 9ICIA 2E8PA 1MQ3A 2VJ5A 3V7LA 4TURA 4NLNA 2ZUBA 5KG3A 8ICNA 3MC1A 3GV8B 3NASA 1N5WA 4DLGA 3SQIA 4CNQA 1SL0A 3QEAZ 4DSLA 4O5CA 2M9NA 2Q4TA 2XICA 2XGPA 4JK1A 5ALIA 5IINA 4C4RA 4JMUA 9ICTA 1FFUA 5KFCA 2XIDA 3QXGA 4Z6CA 5EE3A 4UARA 4KN7A 2MRLA 5ALRA 2QB0A 1Q3UA 1ZETA 2KIVA 5EE1A 2FMQA 8ICMA 3TFRA 2HSZA 2EZXA 4IQTA 3OHAA 5KG2A 1JI7A 2IOFK 1FEZA 1XO0A 2QB0B 4P4OA 2XCPA 1S0OA 1ZQFA 3ICXA 1ZQBA 2FDRA 1XSPA 2RRDA 3M7DA 2K89A 4DL4A 3AU2A 4RZRA 8ICGA 1OW5A 4AYBC 3A0BU 2O6KA 4OJ6A 5IIJA 4DSKA 3QU4A 3LYSA 3ZDAA 3F2DA 3K75D 1Z4OA 1ZQSA 4IC9A 3TANA 4P4PA 5KT5A 2W9AA 4QZFA 2BQUA 1AROP 4UW9A 5J2AA 5KFSA 4J03A 5J0TA 3QE9Y 1SL2A 5HHIA 5KL8B 2DF4B 1JUDA 4DL6A 3C5FA 5AKLA 8ICEA 4EBCA 3QU2A 2LM4A 5AM3A 5KFYA 3Q8LA 3TARA 3AEVA 1QQ5A 1ZQLA 4C7ZA 7ICIA 1CRXA 2ZJ8A 4B9TA 2RDJA 2BPCA 1V9PA 5HR7A 2BCVA 4QZ8A 3MR6A 2LYAA 2YX8A 2HHUA 3WKAA 4O0IA 5ALKA 2K4HA 3V6KA 2JEFA 1DRGA 4PL2A 5DBCA 4F5OA 2G06A 3C29A 4EELA 2KFNA 3MR2A 3SZ2A 3PMNA 4DLEA 4F3OA 4CCHA 2Y1IA 4M04A 1WWUA 4LJXA 9ICEA 4KITB 1S77D 8ICAA 2JV3A 1TAQA 3GIMA 2KMDA 1COKA 2OH2A 1S0NA 4UAUA 4DS5A 3K4GA 3MR5A 5GTHU 1RYSA 3E0FA 4UB3A 4F4XA 1TFRA 3MDAA 4CDGA 2D8CA 1P7DA 2F1HA 5ALHA 4ED3A 3NUQA 5HHHA 1L7MA 3MGVA 2A3VA 2ATLA 3SEIA 2FMPA 5L1MA 4QZ9A 3PSFA 4MHVA 2ZTDA 4ECTA 1Z3EB 4ECQA 5GTIU 4GC6A 1RYRA 2XVTA 5DDMA 4TQRA 4YP3A 3ISDA 5ALPA 3RAQA 4YVZA 2YY6A 3BDPA 4KLQA 5DB6A 4IRDA 2EAMA 4GXKA 3T5JA 1TAUA 4K4GA 3JPSA 4XQ8A 4JUZA 5AK5A 3QNMA 7ICKA 1Z19A 1ZXIA 4KLFA 2AXTU 4Y2VA 1QQ6A 4I2DA 4MFAA 5KFXA 1BNPA 2KG5A 2FJ6A 2HBJA 3RH4A 2ISPA 3DEEA 1ZQQA 2KV2A 3RH5A 5DGAA 4KLSA 3BS7A 2F8KA 5IIOA 5DQGA 4FZMA 3TACB 4YQWA 4DFKA 5ALYA 5IILA 4ECZA 4RUAA 2ASJA 2BGWA 3RFAA 2ASDA 4QWCA 3EUB2 1LV5A 3O0FA 5KFJA 5ALZA 3LVWA 4ELVA 5ALMA 9ICVA 2G08A 1Q3VA 1SWVA 2E8NA 4PGQA 5L1KA 2NV3A 2AHOB 3ZDDA 4KLDA 4Y2RA 5J8YC 3PMLA 3H0MB 4NJ8A 4ZOHC 5ALFA 5AK4A 8ICZA 1RQNA 2XCAA 2DKZA 3C2KA 2KHQA 4KLHA 1U9LA 1V97A 3KFUF 3NRZA 3Q8RB 4ACOA 2ZXHA 1VJ5A 5KFKA 3Q8KA 4M9LA 1T8EA 4B9UA 7ICGA 5JUMA 5F3XB 2KKPA 3B9JA 2AGOA 2F1JA 4JV0A 5L1IA 3EZ5A 5J8YA 2VIXA 2KKVA 7ICMA 2JGAA 4JV2A 3RH6A 3JPRA 7ICVA 3HRDD 4KTQA 1BPXA 7ICNA 2R8GA 2YB4A 2IMWP 1NJXA 2WAQF 4PGYA 1QQ7A 3VC8A 3QUQA 2KK0A 3JPOA 4DL5A 4KLEA 5IIKA 2HDOA 2VA3A 5DQIA 2BDUA 3C2MA 4DO9A 1L6NA 4LVSA 1GO3F 3QZ8A 4QZAA 3U26A 3Q8MA 4QZDA 4OCZA 1X40A 8ICTA 4I2IA 4DCCA 3A0HU 2WB1C 4YD2A 2ZIXA 3QYPA 3WKEA 4YMMA 2W8LA 3THVA 4KLGA 4I2FA 4FBUA 4ED2A 3PR4A 1IXRA 1BPBA 2LHTA 3ZDBA 1U49A 4C7YA 4EENA 8ICPA 2ZIXB 3D6JA 2FI1A 2BQ3A 3SV3A 4F93B 3KD3A 4PHEA 1MN8A 1D9DA 3NS1A 2BCQA 1A76A 4Z6DA 2I6XA 5KFVA 5CRXA 1S0VA 3WK5A 3AU6A 2A1JA 3MABA 4EYHB 2KN7A 3UMCA 1F0MA 4Q43A 1WYGA 2C22A 4M9NA 5D49A 1ZQTA 3N7SC 4US8A 1WCNA 4HYKA 2A1JB 5DG8A 1JN3A 3LWLA 3PY8A 2PMZC 2RHFA 4F4ZA 3N7PD 4ECRA 2GOLA 2AH5A 1KTQA 4EZ6A 3OGUA 3MFIA 1LB2B 3Q8PB 1J2NA 4IR9A 5KFIA 4CF4A 3JPQA 3M8SA 4B9VA 4UB6U 3BQ7A 4PPXA 1C20A 2WF9A 5KAIU 4R64A 4Y2PA 1ZQYA 2VKQA 4DOCA 1QH9A 2ESEA 1ZQJA 2JR5A 3PW5A 2ALZA 8ICFA 2LBOA 1BPDA 1PK3A 3CNHA 3PVXA 3SENA 3CYMA 8ICXA 5B66U 1L3TA 4I2CA 2RDIA 4DL2A 4R8UA 4I2EA 2UVWA 1L7PA 1S9FA 5J0WA 2VJ4A 5J0OA 2PMZF 3PW2A 3HP6A 4KLOA 4R8UB 2P6RA 3TFSA 3V7JA 3ALRA 3WU2U 2KSOA 5ALGA 1ZQXA 2YMQA 5ALEA 1QSSA 4OO1J 4Q8FA 9ICBA 1KFDA 3UXNA 1HUOA 5KG7A 3PX6A 2KSOB 3H4BA 3TADC 4DL7A 2KNJA 1L7NA 9ICOA 3BQ0A 2EH9A 1Z4NA 2P66A 5J2FA 8ICLA 3RJFA 2P35A 5KFPA 2IHMA 4P2HA 3ZDEA 2KJ9A 4RQ3A 2CRXA 4MFCA 3H7IA 1ZQCA 1ZD4A 2AGQA 2WTFA 3ISBA 1ZD3A 4GIBA 3RAXA 3C1ZA 2K8CB 2PFNA 1KL9A 3IG5A 4Z6EA 4Y2YA 3TADA 2EQYA 5AICA 4DQPA 3H40A 1XC9A 1UA1A 1UA0A 5J2KA 2A1AA 4BWJA 9ICAA 5CEHA 3WK9A 4X5VA 1ZQ1C 2FPLA 3D2NA 4C4TA 3KHRA 4PHDA 4F5PA 3SAFA 3TI0A 5IIMA 2KZMA 1N56A 1BPYA 3RJKA 1N61A 2F3NA 1JX4A 2B6GA 3RB0A 9ICPA 3OSPA 4F8RA 4F4KA 1J97A 4C0ZA 3NVYA 4IQVA 1L5UA 2ZIWA 1B0XA 1EXNA 1RXVA 2BHNA 4R66A 2F8LA 2XC9A 3MGIA 1RQLA 3BS5A 2HBKA 1O08A 1KFTA 2ZIWB 5KFFA 1NJYA 2QLTA 3I28A 3H8MA 1ED1A 4YR0A 3OHBA 3BS5B 4J9SA 2E5SA 4PGXA 2UVUA 3LWMA 2OHFA 8ICSA 4A8EA 2RQ5A 5TZVA 1PZNA 3F5EA 5CR0A 9ICWA 1UPHA 2HHSA 1V85A 2FPKA 4ED7A 3C28A 4ELTA 2ISOA 5BOLA 4O3OA 1SXEA 4FZNA 4IL6U 3PW0A 4CRXA
chains in the Genus database with same CATH topology
1ZYQA 3PX0A 9ICHA 2NRXA 2W9MA 1QSLA 2FLLA 1KEJA 2ZTDA 4ECTA 1Z3EB 4F5RA 4J9MA 5KFOA 4QWDA 2OWOA 4YFKA 4RPXA 5J0QA 4PHAA 4ECQA 4DSJA 5DGBA 1SL1A 3TAPA 4I28A 2HHVA 4GC6A 3RB6A 4FS2A 4RPZA 5CWRA 8ICWA 4DS4A 1RYRA 1B43A 1ZQNA 5DDMA 4TQRA 4YP3A 3ISDA 3RAQA 1D9FA 4YXJA 5J0SA 4YVZA 3BDPA 4EYIB 5CA7A 4UB1A 4M47A 4KLQA 3GV7B 5DB6A 1H38A 5KFUA 1KLNA 2ZTEA 2V9WA 4IRDA 1UT5A 4DEZA 1ZQKA 4I2BA 3UQ2A 4O3QA 2BQRA 4F92B 3NGDA 2KZ3A 4GXKA 3PW7A 4M9JA 5KG6A 4UB4A 3T5JA 1TAUA 7ICJA 1X9SA 4K4GA 8ICHA 3JPSA 9ICLA 4YR2A 4XQ8A 8ICFA 4JUZA 7ICKA 5DQHA 3ZDCA 4ECXA 4KLFA 2XGQA 4F4WA 3H8JA 4I2DA 3MDCA 4J9QA 4MFAA 4C8KA 2HHWA 3B0YA 2XY5A 5KFXA 3JPPA 4YD1A 1KRPA 5KFGA 3RJJA 3PX4A 9ICQA 5F9LA 3RH4A 2ISPA 1ZQQA 4JWMA 1Z00A 9ICGA 3PV8A 4B9NA 1NJWA 1CEZA 2MUTA 3HW8A 3RH5A 4UAYA 5DGAA 1NK6A 4KLSA 4DSIA 4E0DA 3RRHA 4K4HA 3MR3A 1ZQEA 5IIOA 5DQGA 5BOMA 4XRHA 7ICTA 4KLTA 1SKWA 1ZQZA 1NK9A 5J2GA 4ELUA 4YQWA 4DFKA 4O3PA 5J0XA 4I2AA 8ICIA 5J0PA 1Z00B 3M9OB 4GXIA 3T5KA 3ETLA 4DFJA 2DPIA 2MUTB 5IILA 2IHNA 3ZD8A 4ECZA 1NKBA 4RUAA 5HNKA 2ASJA 1A77A 2FLPA 1L3UA 1D8LA 4R65A 2BGWA 3HPOA 1B22A 2ZJAA 2ASDA 4QWCA 3EPGA 4I27A 4J9RA 4RQ8A 4R63A 1LV5A 2JEJA 3H8WA 4ECYA 4DQIA 4RQ5A 4NM2A 1XSNA 5KFJA 4RNNA 3GV5B 5KFWA 5KFZA 4ELVA 3JPTA 9ICVA 4YMOA 5HP4A 5DLFA 3NTUA 4PGQA 3PR5B 4F91B 5L1KA 4NM1A 1ZQAA 4JV1A 2AJQA 5KFRA 2I1QA 3ZDDA 5KG1A 3M8RA 2BR0A 4KLDA 1NK5A 5DB9A 5C5JA 4RPYA 3RTVA 1ZQDA 4J9OA 4C8OA 4M2YA 3PMLA 5D4BA 4NY8A 3UQ0A 4ED1A 4DOAA 3HWTA 3RRGA 9ICSA 5KT2A 2BDPA 5KFLA 4KLLA 3SYZA 8ICZA 5BPCA 1KSPA 5DLGA 2XCAA 1SKSA 3C2KA 4J9LA 4KLHA 1U9LA 3IM1A 4UQGA 1ZQMA 4FS1A 3FDSA 4YMNA 5DG9A 4FO6A 8ICJA 5J2HA 3QEBZ 2H5XA 3T3FA 3Q8RB 1NKCA 2IA6A 1X9WA 4ED0A 5KFKA 3Q8KA 2HHTA 4M9LA 1BVSA 4DF8A 3UXOA 1T8EA 4B9UA 4DSFA 4QWAA 5JUMA 1UT8A 3G6YA 2BPGA 4O9MA 7ICGA 3AUOA 2NRWA 2R8IA 3RB4A 2F1JA 2AGOA 7ICLA 7ICSA 4JV0A 1MC8A 3EZ5A 5L1IA 4K4IA 4TQSA 4IRCA 2J6UA 1ZJMA 5L1LA 4BXOA 7ICMA 4QZGA 3RJIA 8ICBA 5KFBA 8ICUA 4RQ0A 4NLGA 7ICPA 3M9NB 1TK8A 2BCRA 5CJ7A 3GIIA 3C2LA 3RH6A 2VA2A 4JV2A 2JEIA 3JPRA 2LYHA 4M6WA 7ICVA 3MFHA 2J6SA 4O3RA 4I2JA 4KTQA 3IHQB 4M0AA 4MEYA 3GILA 4BXOB 1BPXA 1S10A 4B9SA 2R8JA 7ICNA 4UBBA 2R8GA 4EBDA 1TK0A 5D46A 2IMWP 2R8KA 1NJXA 4PGYA 2DPJA 2C2RA 5KFMA 4M6WB 5DB8A 4I29A 4BWMA 1ZQPA 4C8MA 4RQ1A 3JPOA 4DL5A 4KLEA 1ZQUA 5IIKA 4LZGA 2P6UA 3HX0A 4NXZA 5KT3A 5KFHA 2VA3A 5J2IA 8ICOA 5DQIA 4EZ9A 3T5LA 3C2MA 1NKEA 5KG0A 4DO9A 4LVSA 4DOBA 3QZ8A 1ZQVA 4QZAA 4RT3A 3Q8MA 4GXJA 2Q0ZX 3KHHA 9ICCA 4QZDA 3OJUA 2J6TA 4IQUA 4ECSA 8ICYA 8ICTA 4I2IA 2GWSA 1XO1A 3H8SA 4YD2A 9ICKA 1WCLA 4YMMA 2XO7A 4JWNA 2W8LA 4UB2A 2BKEA 3EYZA 1KFSA 4M9GA 3THVA 4KLGA 4YG2A 2R8HA 4I2FA 1ZJNA 2VA8A 5KFAA 4FBUA 4ED2A 3PR4A 4DL3A 4M9HA 4RNOA 2JEGA 1IXRA 2KTQA 1BPBA 2ASLA 3ZDBA 1U49A 2XY7A 3GFKB 5EWGA 3TAQA 8ICCA 1NK8A 1TVAA 8ICPA 7ICUA 3Q8SB 3BQTA 4GC7A 3SV3A 2BQ3A 4B9MA 1XWLA 4F93B 4F4YA 2V4QA 1TV9A 4PHEA 4UBCA 2AGPA 1D9DA 3H4DA 2XY6A 3HT3A 1L3VA 1KDHA 1IM4A 4ED6A 3GQCA 2BCQA 5L9XA 5CHGA 1A76A 4Z6DA 1HUZA 5KFVA 1S0VA 2MAXA 3C1YA 1T4GA 5DBBA 4TUQA 3AU6A 4DF4A 4PH5A 2I9GA 3BQ1A 1SKRA 2A1JA 3MABA 4DFMA 9ICMA 4EYHB 1L3SA 2KN7A 3C21A 1XU4A 3G6VA 4Q43A 2FLNA 1XS9D 2KZZA 4UAZA 1U48A 2C22A 2B21A 5EOZA 3GIJA 4M9NA 5D49A 1ZQTA 1WCNA 4YXMA 4HYKA 2A1JB 5DG8A 5J2BA 1JN3A 3LWLA 4J9KA 2C2EA 1D8YA 2BPFA 3PY8A 1QLNA 5CP2A 5HMMA 4B9LA 2HHXA 3TQ1A 3PW4A 4YR3A 1COOA 5J2CA 3V6JA 3PO4A 3SV4A 1BPEA 2FMSA 2PFPA 5KFEA 3UXPA 4F4ZA 4UB5A 3BQ2A 4IRKA 1U45A 3GIKA 3V6HA 2UVRA 4YCXA 2HW3A 4ECRA 2Y1JA 3UPQA 2AQ4A 5J0RA 5KG5A 4ECVA 1KTQA 4EEYA 7ICEA 4J9PA 5DDYA 4Z6FA 1RXWA 4EZ6A 9ICIA 4NLZA 3OGUA 1RZTA 4RQ7A 4QZIA 1MQ3A 3KTQA 3MFIA 1LB2B 4NLKA 3Q8PB 1T3NA 3V7LA 1X9MA 4TURA 4IR9A 5KFIA 3JPQA 3EW9A 3M8SA 1NOMA 4B9VA 4O5KA 4ECWA 4NLNA 7ICHA 2ZUBA 5KG3A 4PPXA 8ICNA 2V4RA 4R64A 1JMSA 1ZQYA 3LK9A 3GV8B 4DLGA 4DOCA 3KHGA 4RUCA 4QWEA 1ZQJA 4DQSA 3PW5A 2ALZA 3BJYA 3QEAZ 2AQ0A 2ZJ5A 1SL0A 4DSLA 2M9NA 4O5CA 4KLJA 1JXLA 1BPDA 2XGPA 3N4MB 3PVXA 8ICXA 3RJGA 4JK1A 4I2GA 2W8KA 1QTMA 4RT2A 1NK7A 1L3TA 5IINA 2AU0A 1BPZA 2RDIA 4I2CA 4DL2A 5KT4A 4R8UA 4EBEA 4XUSA 1TK5A 4I2EA 9ICNA 9ICTA 2UVWA 5KFCA 1S9FA 5J0WA 4Z6CA 5J0OA 3OJSA 2HHQA 4KN7A 1ZETA 3PW2A 2JZBA 2FMQA 3HP6A 4I2HA 3KHLA 4KLOA 8ICMA 3TFRA 4R8UB 2P6RA 1HJPA 3TFSA 3V7JA 3C5GA 1C7YA 1U4BA 2NRZA 1U47A 1S76D 4IQTA 3OHAA 5KG2A 4DWIA 4LZDA 3PO5A 4BDPA 4IQWA 1ZQXA 5J2EA 3ORYA 2W9CA 3OSNA 1ZQOA 3EPIA 1MQ2A 3FYHA 2HVIA 4P4OA 2XCPA 2JZBB 1S0OA 1ZQFA 1QSSA 9ICRA 1K1QA 3RR8A 2KFZA 4Q8FA 9ICBA 1S0MA 4DQQA 1ZQBA 1KFDA 8ICRA 3UXNA 1XSPA 1HUOA 7ICQA 9ICXA 4F2RA 3JPNA 5KG7A 3PX6A 3H4BA 4O3NA 5J2JA 5KFTA 3AU2A 5KFQA 4RZRA 2W9CB 4DL7A 4DL4A 1S97A 4KLMA 8ICGA 9ICOA 1ZQWA 3EWAA 4QZBA 3ZD9A 3BQ0A 3GDXA 4ZH4A 2BCUA 2PFOA 1JXEA 3B0XA 4F50A 2P66A 5IIJA 4DSKA 5J2FA 8ICLA 3ZDAA 3RJFA 5KFPA 1ZQGA 2IHMA 5KFDA 2IBKA 4P2HA 3K75D 3ZDEA 1NJZA 9ICJA 4RQ3A 5F9NA 1ZQIA 1ZQSA 3TANA 4XA5A 7ICRA 4P4PA 2VANA 4QZEA 4G3IA 4MFCA 3H7IA 5KT5A 4FBTA 1ZQCA 2W9AA 2AGQA 4C8NA 4QZFA 1NK0A 2BQUA 5DB7A 1AROP 2WTFA 3ISBA 5L1JA 2NRVA 5DG7A 4QWBA 5J2AA 3RAXA 2FPMA 3C1ZA 5KFSA 5EWFA 2PFNA 1DOQA 4ED8A 5J0TA 1ZQHA 3QE9Y 1SL2A 4Q44A 5HHIA 4RQ2A 3V7KA 4F5NA 4Z6EA 1DGSA 3M9MB 4DQPA 5DKWA 4F2SA 5IIIA 3H40A 2ZUCA 1XC9A 3LDAA 4F5QA 3C5FA 4DL6A 3RB3A 1UA0A 1UA1A 4BGDA 5J2KA 4EBCA 8ICEA 4BWJA 9ICAA 2DFLA 5J0YA 4X5VA 5DBAA 4MFFA 3RBDA 9ICFA 2FPLA 9ICUA 4KN4A 1X2IA 5KFYA 3Q8LA 2C28A 4O3SA 3TARA 4UAWA 1ZQRA 2PFQA 1ZQLA 3KHRA 1RPLA 4KLIA 7ICIA 2PI5A 2ZJ8A 4PHDA 4B9TA 5HMLA 2RDJA 2BPCA 4F5PA 1SZPA 4C8LA 3TI0A 2HVHA 1V9PA 5IIMA 1K1SA 1MSWD 2BCVA 4QZ8A 3MR6A 2KZMA 3V72A 1N56A 3C23A 1BPYA 1N48A 3RJKA 4DQRA 4QW9A 4IR1A 1JX4A 5J0UA 2HHUA 3RB0A 9ICPA 4O0IA 3OSPA 5KFNA 3V6KA 4F4KA 4F8RA 2JEFA 5J29A 4PHPA 4RU9A 2ZUDA 4IQVA 3MGHA 1L5UA 5KG4A 5DBCA 4KLUA 4P4MA 1EXNA 1RXVA 4F5OA 1Y88A 3Q8QB 3SI8A 1TKDA 3RBEA 2BHNA 2KFNA 4TUSA 4R66A 2XC9A 3MR2A 8ICQA 3SZ2A 2ZTCA 3MGIA 4GLXA 1QSYA 8ICVA 3PMNA 1T7PA 4KMUA 3N97B 7ICOA 3RJEA 4DLEA 1KFTA 4F3OA 2C2DA 4CCHA 2Y1IA 5CB1A 5EWEA 4M04A 4DSEA 5KFFA 4QZHA 5KT6A 3PNCA 4RQ4A 4J9NA 1NJYA 3RJHA 9ICEA 4KITB 1S77D 4YR0A 3OHBA 2NRTA 8ICAA 3MBYA 1TAQA 3GIMA 4PGXA 4J9SA 2UVUA 3LWMA 4YN4A 4RQ6A 4DFPA 1S0NA 8ICSA 4DS5A 3K4GA 2W9BA 2BCSA 3MR5A 4TUPA 4O5EA 8ICKA 5TZVA 1RYSA 1PZNA 4UB3A 5CR0A 4F4XA 9ICWA 7ICFA 4Q45A 2F1IA 2HHSA 4QZCA 1TFRA 5J2DA 3MDAA 2FPKA 4ED7A 4RNMA 3G6XA 4MEXA 3RR7A 1CUKA 3E2EA 3QZ7A 3ISCA 2UVVA 2F1HA 2PI4A 4ELTA 5KTQA 4MF8A 4ECUA 1BGXT 2ISOA 5BOLA 2W9BB 4O3OA 1XSLA 4ED3A 4Q8EA 3T5HA 5HHHA 2PXIA 3PW0A 2ATLA 1NK4A 4MF2A 5KT7A 2FMPA 1JIHA 4QW8A 4QZ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZYQ A;  3PX0 A;  9ICH A;  2NRX A;  2W9M A;  1QSL A;  2FLL A;  1KEJ A;  2ZTD A;  4ECT A;  1Z3E B;  4F5R A;  4J9M A;  5KFO A;  4QWD A;  2OWO A;  4YFK A;  4RPX A;  5J0Q A;  4PHA A;  4ECQ A;  4DSJ A;  5DGB A;  1SL1 A;  3TAP A;  4I28 A;  2HHV A;  4GC6 A;  3RB6 A;  4FS2 A;  4RPZ A;  5CWR A;  8ICW A;  4DS4 A;  1RYR A;  1B43 A;  1ZQN A;  5DDM A;  4TQR A;  4YP3 A;  3ISD A;  3RAQ A;  1D9F A;  4YXJ A;  5J0S A;  4YVZ A;  3BDP A;  4EYI B;  5CA7 A;  4UB1 A;  4M47 A;  4KLQ A;  3GV7 B;  5DB6 A;  1H38 A;  5KFU A;  1KLN A;  2ZTE A;  2V9W A;  4IRD A;  1UT5 A;  4DEZ A;  1ZQK A;  4I2B A;  3UQ2 A;  4O3Q A;  2BQR A;  4F92 B;  3NGD A;  2KZ3 A;  4GXK A;  3PW7 A;  4M9J A;  5KG6 A;  4UB4 A;  3T5J A;  1TAU A;  7ICJ A;  1X9S A;  4K4G A;  8ICH A;  3JPS A;  9ICL A;  4YR2 A;  4XQ8 A;  8ICF A;  4JUZ A;  7ICK A;  5DQH A;  3ZDC A;  4ECX A;  4KLF A;  2XGQ A;  4F4W A;  3H8J A;  4I2D A;  3MDC A;  4J9Q A;  4MFA A;  4C8K A;  2HHW A;  3B0Y A;  2XY5 A;  5KFX A;  3JPP A;  4YD1 A;  1KRP A;  5KFG A;  3RJJ A;  3PX4 A;  9ICQ A;  5F9L A;  3RH4 A;  2ISP A;  1ZQQ A;  4JWM A;  1Z00 A;  9ICG A;  3PV8 A;  4B9N A;  1NJW A;  1CEZ A;  2MUT A;  3HW8 A;  3RH5 A;  4UAY A;  5DGA A;  1NK6 A;  4KLS A;  4DSI A;  4E0D A;  3RRH A;  4K4H A;  3MR3 A;  1ZQE A;  5IIO A;  5DQG A;  5BOM A;  4XRH A;  7ICT A;  4KLT A;  1SKW A;  1ZQZ A;  1NK9 A;  5J2G A;  4ELU A;  4YQW A;  4DFK A;  4O3P A;  5J0X A;  4I2A A;  8ICI A;  5J0P A;  1Z00 B;  3M9O B;  4GXI A;  3T5K A;  3ETL A;  4DFJ A;  2DPI A;  2MUT B;  5IIL A;  2IHN A;  3ZD8 A;  4ECZ A;  1NKB A;  4RUA A;  5HNK A;  2ASJ A;  1A77 A;  2FLP A;  1L3U A;  1D8L A;  4R65 A;  2BGW A;  3HPO A;  1B22 A;  2ZJA A;  2ASD A;  4QWC A;  3EPG A;  4I27 A;  4J9R A;  4RQ8 A;  4R63 A;  1LV5 A;  2JEJ A;  3H8W A;  4ECY A;  4DQI A;  4RQ5 A;  4NM2 A;  1XSN A;  5KFJ A;  4RNN A;  3GV5 B;  5KFW A;  5KFZ A;  4ELV A;  3JPT A;  9ICV A;  4YMO A;  5HP4 A;  5DLF A;  3NTU A;  4PGQ A;  3PR5 B;  4F91 B;  5L1K A;  4NM1 A;  1ZQA A;  4JV1 A;  2AJQ A;  5KFR A;  2I1Q A;  3ZDD A;  5KG1 A;  3M8R A;  2BR0 A;  4KLD A;  1NK5 A;  5DB9 A;  5C5J A;  4RPY A;  3RTV A;  1ZQD A;  4J9O A;  4C8O A;  4M2Y A;  3PML A;  5D4B A;  4NY8 A;  3UQ0 A;  4ED1 A;  4DOA A;  3HWT A;  3RRG A;  9ICS A;  5KT2 A;  2BDP A;  5KFL A;  4KLL A;  3SYZ A;  8ICZ A;  5BPC A;  1KSP A;  5DLG A;  2XCA A;  1SKS A;  3C2K A;  4J9L A;  4KLH A;  1U9L A;  3IM1 A;  4UQG A;  1ZQM A;  4FS1 A;  3FDS A;  4YMN A;  5DG9 A;  4FO6 A;  8ICJ A;  5J2H A;  3QEB Z;  2H5X A;  3T3F A;  3Q8R B;  1NKC A;  2IA6 A;  1X9W A;  4ED0 A;  5KFK A;  3Q8K A;  2HHT A;  4M9L A;  1BVS A;  4DF8 A;  3UXO A;  1T8E A;  4B9U A;  4DSF A;  4QWA A;  5JUM A;  1UT8 A;  3G6Y A;  2BPG A;  4O9M A;  7ICG A;  3AUO A;  2NRW A;  2R8I A;  3RB4 A;  2F1J A;  2AGO A;  7ICL A;  7ICS A;  4JV0 A;  1MC8 A;  3EZ5 A;  5L1I A;  4K4I A;  4TQS A;  4IRC A;  2J6U A;  1ZJM A;  5L1L A;  4BXO A;  7ICM A;  4QZG A;  3RJI A;  8ICB A;  5KFB A;  8ICU A;  4RQ0 A;  4NLG A;  7ICP A;  3M9N B;  1TK8 A;  2BCR A;  5CJ7 A;  3GII A;  3C2L A;  3RH6 A;  2VA2 A;  4JV2 A;  2JEI A;  3JPR A;  2LYH A;  4M6W A;  7ICV A;  3MFH A;  2J6S A;  4O3R A;  4I2J A;  4KTQ A;  3IHQ B;  4M0A A;  4MEY A;  3GIL A;  4BXO B;  1BPX A;  1S10 A;  4B9S A;  2R8J A;  7ICN A;  4UBB A;  2R8G A;  4EBD A;  1TK0 A;  5D46 A;  2IMW P;  2R8K A;  1NJX A;  4PGY A;  2DPJ A;  2C2R A;  5KFM A;  4M6W B;  5DB8 A;  4I29 A;  4BWM A;  1ZQP A;  4C8M A;  4RQ1 A;  3JPO A;  4DL5 A;  4KLE A;  1ZQU A;  5IIK A;  4LZG A;  2P6U A;  3HX0 A;  4NXZ A;  5KT3 A;  5KFH A;  2VA3 A;  5J2I A;  8ICO A;  5DQI A;  4EZ9 A;  3T5L A;  3C2M A;  1NKE A;  5KG0 A;  4DO9 A;  4LVS A;  4DOB A;  3QZ8 A;  1ZQV A;  4QZA A;  4RT3 A;  3Q8M A;  4GXJ A;  2Q0Z X;  3KHH A;  9ICC A;  4QZD A;  3OJU A;  2J6T A;  4IQU A;  4ECS A;  8ICY A;  8ICT A;  4I2I A;  2GWS A;  1XO1 A;  3H8S A;  4YD2 A;  9ICK A;  1WCL A;  4YMM A;  2XO7 A;  4JWN A;  2W8L A;  4UB2 A;  2BKE A;  3EYZ A;  1KFS A;  4M9G A;  3THV A;  4KLG A;  4YG2 A;  2R8H A;  4I2F A;  1ZJN A;  2VA8 A;  5KFA A;  4FBU A;  4ED2 A;  3PR4 A;  4DL3 A;  4M9H A;  4RNO A;  2JEG A;  1IXR A;  2KTQ A;  1BPB A;  2ASL A;  3ZDB A;  1U49 A;  2XY7 A;  3GFK B;  5EWG A;  3TAQ A;  8ICC A;  1NK8 A;  1TVA A;  8ICP A;  7ICU A;  3Q8S B;  3BQT A;  4GC7 A;  3SV3 A;  2BQ3 A;  4B9M A;  1XWL A;  4F93 B;  4F4Y A;  2V4Q A;  1TV9 A;  4PHE A;  4UBC A;  2AGP A;  1D9D A;  3H4D A;  2XY6 A;  3HT3 A;  1L3V A;  1KDH A;  1IM4 A;  4ED6 A;  3GQC A;  2BCQ A;  5L9X A;  5CHG A;  1A76 A;  4Z6D A;  1HUZ A;  5KFV A;  1S0V A;  2MAX A;  3C1Y A;  1T4G A;  5DBB A;  4TUQ A;  3AU6 A;  4DF4 A;  4PH5 A;  2I9G A;  3BQ1 A;  1SKR A;  2A1J A;  3MAB A;  4DFM A;  9ICM A;  4EYH B;  1L3S A;  2KN7 A;  3C21 A;  1XU4 A;  3G6V A;  4Q43 A;  2FLN A;  1XS9 D;  2KZZ A;  4UAZ A;  1U48 A;  2C22 A;  2B21 A;  5EOZ A;  3GIJ A;  4M9N A;  5D49 A;  1ZQT A;  1WCN A;  4YXM A;  4HYK A;  2A1J B;  5DG8 A;  5J2B A;  1JN3 A;  3LWL A;  4J9K A;  2C2E A;  1D8Y A;  2BPF A;  3PY8 A;  1QLN A;  5CP2 A;  5HMM A;  4B9L A;  2HHX A;  3TQ1 A;  3PW4 A;  4YR3 A;  1COO A;  5J2C A;  3V6J A;  3PO4 A;  3SV4 A;  1BPE A;  2FMS A;  2PFP A;  5KFE A;  3UXP A;  4F4Z A;  4UB5 A;  3BQ2 A;  4IRK A;  1U45 A;  3GIK A;  3V6H A;  2UVR A;  4YCX A;  2HW3 A;  4ECR A;  2Y1J A;  3UPQ A;  2AQ4 A;  5J0R A;  5KG5 A;  4ECV A;  1KTQ A;  4EEY A;  7ICE A;  4J9P A;  5DDY A;  4Z6F A;  1RXW A;  4EZ6 A;  9ICI A;  4NLZ A;  3OGU A;  1RZT A;  4RQ7 A;  4QZI A;  1MQ3 A;  3KTQ A;  3MFI A;  1LB2 B;  4NLK A;  3Q8P B;  1T3N A;  3V7L A;  1X9M A;  4TUR A;  4IR9 A;  5KFI A;  3JPQ A;  3EW9 A;  3M8S A;  1NOM A;  4B9V A;  4O5K A;  4ECW A;  4NLN A;  7ICH A;  2ZUB A;  5KG3 A;  4PPX A;  8ICN A;  2V4R A;  4R64 A;  1JMS A;  1ZQY A;  3LK9 A;  3GV8 B;  4DLG A;  4DOC A;  3KHG A;  4RUC A;  4QWE A;  1ZQJ A;  4DQS A;  3PW5 A;  2ALZ A;  3BJY A;  3QEA Z;  2AQ0 A;  2ZJ5 A;  1SL0 A;  4DSL A;  2M9N A;  4O5C A;  4KLJ A;  1JXL A;  1BPD A;  2XGP A;  3N4M B;  3PVX A;  8ICX A;  3RJG A;  4JK1 A;  4I2G A;  2W8K A;  1QTM A;  4RT2 A;  1NK7 A;  1L3T A;  5IIN A;  2AU0 A;  1BPZ A;  2RDI A;  4I2C A;  4DL2 A;  5KT4 A;  4R8U A;  4EBE A;  4XUS A;  1TK5 A;  4I2E A;  9ICN A;  9ICT A;  2UVW A;  5KFC A;  1S9F A;  5J0W A;  4Z6C A;  5J0O A;  3OJS A;  2HHQ A;  4KN7 A;  1ZET A;  3PW2 A;  2JZB A;  2FMQ A;  3HP6 A;  4I2H A;  3KHL A;  4KLO A;  8ICM A;  3TFR A;  4R8U B;  2P6R A;  1HJP A;  3TFS A;  3V7J A;  3C5G A;  1C7Y A;  1U4B A;  2NRZ A;  1U47 A;  1S76 D;  4IQT A;  3OHA A;  5KG2 A;  4DWI A;  4LZD A;  3PO5 A;  4BDP A;  4IQW A;  1ZQX A;  5J2E A;  3ORY A;  2W9C A;  3OSN A;  1ZQO A;  3EPI A;  1MQ2 A;  3FYH A;  2HVI A;  4P4O A;  2XCP A;  2JZB B;  1S0O A;  1ZQF A;  1QSS A;  9ICR A;  1K1Q A;  3RR8 A;  2KFZ A;  4Q8F A;  9ICB A;  1S0M A;  4DQQ A;  1ZQB A;  1KFD A;  8ICR A;  3UXN A;  1XSP A;  1HUO A;  7ICQ A;  9ICX A;  4F2R A;  3JPN A;  5KG7 A;  3PX6 A;  3H4B A;  4O3N A;  5J2J A;  5KFT A;  3AU2 A;  5KFQ A;  4RZR A;  2W9C B;  4DL7 A;  4DL4 A;  1S97 A;  4KLM A;  8ICG A;  9ICO A;  1ZQW A;  3EWA A;  4QZB A;  3ZD9 A;  3BQ0 A;  3GDX A;  4ZH4 A;  2BCU A;  2PFO A;  1JXE A;  3B0X A;  4F50 A;  2P66 A;  5IIJ A;  4DSK A;  5J2F A;  8ICL A;  3ZDA A;  3RJF A;  5KFP A;  1ZQG A;  2IHM A;  5KFD A;  2IBK A;  4P2H A;  3K75 D;  3ZDE A;  1NJZ A;  9ICJ A;  4RQ3 A;  5F9N A;  1ZQI A;  1ZQS A;  3TAN A;  4XA5 A;  7ICR A;  4P4P A;  2VAN A;  4QZE A;  4G3I A;  4MFC A;  3H7I A;  5KT5 A;  4FBT A;  1ZQC A;  2W9A A;  2AGQ A;  4C8N A;  4QZF A;  1NK0 A;  2BQU A;  5DB7 A;  1ARO P;  2WTF A;  3ISB A;  5L1J A;  2NRV A;  5DG7 A;  4QWB A;  5J2A A;  3RAX A;  2FPM A;  3C1Z A;  5KFS A;  5EWF A;  2PFN A;  1DOQ A;  4ED8 A;  5J0T A;  1ZQH A;  3QE9 Y;  1SL2 A;  4Q44 A;  5HHI A;  4RQ2 A;  3V7K A;  4F5N A;  4Z6E A;  1DGS A;  3M9M B;  4DQP A;  5DKW A;  4F2S A;  5III A;  3H40 A;  2ZUC A;  1XC9 A;  3LDA A;  4F5Q A;  3C5F A;  4DL6 A;  3RB3 A;  1UA0 A;  1UA1 A;  4BGD A;  5J2K A;  4EBC A;  8ICE A;  4BWJ A;  9ICA A;  2DFL A;  5J0Y A;  4X5V A;  5DBA A;  4MFF A;  3RBD A;  9ICF A;  2FPL A;  9ICU A;  4KN4 A;  1X2I A;  5KFY A;  3Q8L A;  2C28 A;  4O3S A;  3TAR A;  4UAW A;  1ZQR A;  2PFQ A;  1ZQL A;  3KHR A;  1RPL A;  4KLI A;  7ICI A;  2PI5 A;  2ZJ8 A;  4PHD A;  4B9T A;  5HML A;  2RDJ A;  2BPC A;  4F5P A;  1SZP A;  4C8L A;  3TI0 A;  2HVH A;  1V9P A;  5IIM A;  1K1S A;  1MSW D;  2BCV A;  4QZ8 A;  3MR6 A;  2KZM A;  3V72 A;  1N56 A;  3C23 A;  1BPY A;  1N48 A;  3RJK A;  4DQR A;  4QW9 A;  4IR1 A;  1JX4 A;  5J0U A;  2HHU A;  3RB0 A;  9ICP A;  4O0I A;  3OSP A;  5KFN A;  3V6K A;  4F4K A;  4F8R A;  2JEF A;  5J29 A;  4PHP A;  4RU9 A;  2ZUD A;  4IQV A;  3MGH A;  1L5U A;  5KG4 A;  5DBC A;  4KLU A;  4P4M A;  1EXN A;  1RXV A;  4F5O A;  1Y88 A;  3Q8Q B;  3SI8 A;  1TKD A;  3RBE A;  2BHN A;  2KFN A;  4TUS A;  4R66 A;  2XC9 A;  3MR2 A;  8ICQ A;  3SZ2 A;  2ZTC A;  3MGI A;  4GLX A;  1QSY A;  8ICV A;  3PMN A;  1T7P A;  4KMU A;  3N97 B;  7ICO A;  3RJE A;  4DLE A;  1KFT A;  4F3O A;  2C2D A;  4CCH A;  2Y1I A;  5CB1 A;  5EWE A;  4M04 A;  4DSE A;  5KFF A;  4QZH A;  5KT6 A;  3PNC A;  4RQ4 A;  4J9N A;  1NJY A;  3RJH A;  9ICE A;  4KIT B;  1S77 D;  4YR0 A;  3OHB A;  2NRT A;  8ICA A;  3MBY A;  1TAQ A;  3GIM A;  4PGX A;  4J9S A;  2UVU A;  3LWM A;  4YN4 A;  4RQ6 A;  4DFP A;  1S0N A;  8ICS A;  4DS5 A;  3K4G A;  2W9B A;  2BCS A;  3MR5 A;  4TUP A;  4O5E A;  8ICK A;  5TZV A;  1RYS A;  1PZN A;  4UB3 A;  5CR0 A;  4F4X A;  9ICW A;  7ICF A;  4Q45 A;  2F1I A;  2HHS A;  4QZC A;  1TFR A;  5J2D A;  3MDA A;  2FPK A;  4ED7 A;  4RNM A;  3G6X A;  4MEX A;  3RR7 A;  1CUK A;  3E2E A;  3QZ7 A;  3ISC A;  2UVV A;  2F1H A;  2PI4 A;  4ELT A;  5KTQ A;  4MF8 A;  4ECU A;  1BGX T;  2ISO A;  5BOL A;  2W9B B;  4O3O A;  1XSL A;  4ED3 A;  4Q8E A;  3T5H A;  5HHH A;  2PXI A;  3PW0 A;  2ATL A;  1NK4 A;  4MF2 A;  5KT7 A;  2FMP A;  1JIH A;  4QW8 A;  4QZ9 A; 
#chains in the Genus database with same CATH topology
 3AM9 A;  2W3R A;  2W9M A;  2FLL A;  1YT3 A;  5J0Q A;  1SL1 A;  4I28 A;  3GZF A;  4FS2 A;  4RPZ A;  4OJO A;  2K60 A;  3NRW A;  4DS4 A;  5AI5 A;  4YXJ A;  5AKI A;  5J0S A;  4JB3 A;  4EYI B;  4CF5 A;  3DV9 A;  1KLN A;  2F77 X;  4IS7 A;  4F92 B;  4M9J A;  5KG6 A;  4NWI A;  2CXY A;  5DQH A;  3I1Y A;  4ECX A;  1WG8 A;  1PVP A;  2W11 A;  4F4W A;  3H8J A;  4C8K A;  2LPE A;  2GO7 A;  4C80 A;  4YD1 A;  1KRP A;  5KFG A;  2OM6 A;  4PL1 A;  9ICQ A;  3OTQ A;  1IG6 A;  1ECW A;  3ZI4 A;  1Z00 A;  2HCF A;  3PV8 A;  4B9N A;  9ICG A;  2MUT A;  3HW8 A;  1NK6 A;  3HJE A;  2OXO A;  5BOM A;  5T14 A;  1NK9 A;  1X42 A;  5J2G A;  4O3P A;  8ICI A;  1Z00 B;  3T5K A;  2MUT B;  3ZD8 A;  1SV0 C;  5HNK A;  2FLP A;  5E79 U;  1L3U A;  1D8L A;  5KL1 B;  4R65 A;  1J2M A;  3HPO A;  2ZJA A;  2LM1 A;  4J9R A;  4RQ8 A;  4DQI A;  4ECY A;  3GV5 B;  5KFZ A;  4YMO A;  3NTU A;  3PR5 B;  1ZQA A;  4EEK A;  2MA1 A;  1NZB A;  1LKY A;  3L4P A;  2EZZ A;  1ZQD A;  4C8O A;  3UQ0 A;  9ICS A;  1ZD2 P;  2BDP A;  5KFL A;  4KLL A;  3SYZ A;  5BPC A;  5DLG A;  1SV0 A;  1LKY B;  3IG8 A;  4UQG A;  4FS1 A;  5DG9 A;  5AM5 A;  4FO6 A;  8ICJ A;  5ALJ A;  2H5X A;  3T3F A;  3QEB Z;  4C4S A;  4UAV A;  1NKC A;  5ALQ A;  4EX6 A;  1X9W A;  1RDF A;  3E58 A;  2HHT A;  2CN1 A;  1VLB A;  2YB1 A;  4QWA A;  2BPG A;  2R8I A;  2H3Z A;  7ICL A;  1X6I A;  4TQS A;  4FZL A;  4IRC A;  1KN5 A;  8ICB A;  5KFB A;  4RQ0 A;  4NLG A;  7ICP A;  1TK8 A;  3GII A;  3MFH A;  4O3R A;  4I2J A;  4NLB A;  2ES6 A;  1WUD A;  5D46 A;  4F72 A;  4BWM A;  1ZQP A;  1ZQU A;  4KX5 A;  1V38 A;  2P6U A;  8ICO A;  5J2I A;  4CGZ A;  1Q46 A;  4RT3 A;  2K4I A;  1DXS A;  2M0N A;  3IV6 A;  2J6T A;  9ICK A;  1S8O A;  4UB2 A;  4OJP A;  1SXD A;  1KFS A;  4PZN A;  2W54 A;  2KJ5 A;  4RNO A;  2JEG A;  2ASL A;  3BZK A;  1LVH A;  3Q8S B;  3NVV A;  4BUG A;  4F4Y A;  2Y9U A;  2EZY A;  3H4D A;  3HT3 A;  2JHD A;  1IM4 A;  3GQC A;  5L9X A;  1T4G A;  4BX9 C;  2H3F A;  4DFM A;  9ICM A;  2LKY A;  2YQE A;  2QAR A;  3RF9 A;  1L8L A;  3C21 A;  1XU4 A;  3GIJ A;  4O3M A;  5J2B A;  4J9K A;  2BPF A;  3K1Z A;  2F44 A;  1QLN A;  2QAR B;  2HHX A;  3TQ1 A;  4YR3 A;  3V6J A;  2Z7J A;  2PFP A;  2G0A A;  2UVR A;  2WAQ C;  3UPQ A;  2G09 A;  5KG5 A;  4ECV A;  2K8A A;  4EEY A;  7ICE A;  4Z6F A;  1T3N A;  3I76 A;  2KIC A;  1KW4 A;  4O5K A;  3AN1 A;  4ECW A;  2V4R A;  1SWW A;  5AI8 A;  3L3F X;  5HR6 A;  3KHG A;  3IDW A;  4DQS A;  2AQ0 A;  2ZJ5 A;  2R18 A;  2WF6 A;  5AI9 A;  3N4M B;  3RJG A;  2D6F C;  2W8K A;  4KX3 A;  1NK7 A;  5ALX A;  2AU0 A;  1BPZ A;  2YTU A;  4XUS A;  5ALU A;  2GH1 A;  2N1R A;  3OJS A;  1JRP A;  2WF5 A;  2JZB A;  4I2H A;  3KHL A;  2HMX A;  1C7Y A;  1U4B A;  4DWI A;  4LZD A;  4IQW A;  1ZQO A;  3EPI A;  2DUY A;  1MQ2 A;  1X66 A;  3FYH A;  2HVI A;  2JZB B;  3M6Z A;  3RR8 A;  2KFZ A;  3D2S A;  1S0M A;  1SV4 A;  7ICQ A;  3QUC A;  4F2R A;  5J2J A;  5KFQ A;  4KLM A;  4QZB A;  3ZD9 A;  4ZH4 A;  2PFO A;  1JXE A;  4F50 A;  3SAG A;  1ZQG A;  4UB8 U;  1NJZ A;  9ICJ A;  1ZQI A;  1UQV A;  7ICR A;  2VAN A;  4FBT A;  4C8N A;  2W3S A;  1NK0 A;  5DG7 A;  1N63 A;  1DOQ A;  1ZQH A;  4Q44 A;  4PZO A;  4RQ2 A;  3V7K A;  2DGZ A;  5DKW A;  3QU9 A;  2W55 A;  2ZUC A;  4NV0 A;  3LDA A;  3RB3 A;  3WKD A;  2FE9 A;  4BGD A;  3IRU A;  2DFL A;  4MFF A;  9ICF A;  4KN4 A;  4UAS A;  2C28 A;  2PKE A;  4UAW A;  1ZQR A;  2PFQ A;  3KKA A;  3QU5 A;  1RYU A;  2E3T A;  3M6K A;  1SZP A;  4C8L A;  2WF8 A;  1K1S A;  1X9X A;  2DKX A;  1MSW D;  3WK7 A;  3V72 A;  1ZD5 A;  4IR1 A;  2ZG6 A;  1TAM A;  2W7P A;  3F2B A;  5J29 A;  3AL0 B;  5KG4 A;  3VCB A;  3K1R B;  8ICQ A;  4KMU A;  7ICO A;  3RJE A;  2C2D A;  2F76 X;  4DSE A;  4KMO B;  5KT6 A;  4J9N A;  3MBY A;  3IN5 A;  1X6J A;  2E8M A;  3FC4 A;  4YN4 A;  5G5H A;  1TE2 A;  3R9K A;  3SR6 A;  4RQ6 A;  4DFP A;  2W9B A;  2BCS A;  4TUP A;  8ICK A;  3FAH A;  2F1I A;  1PVR A;  2NO4 A;  1B4F A;  4RNM A;  4U7C A;  4MEX A;  3QZ7 A;  3ISC A;  2PI4 A;  3H0R B;  5KTQ A;  4ECU A;  1BGX T;  2W9B B;  1XSL A;  3DDH A;  1WWV A;  2PXI A;  1NK4 A;  4MF2 A;  5KT7 A;  1JIH A;  1T7P A;  1ZYQ A;  9ICH A;  1KEJ A;  4J9M A;  5KFO A;  4PJ0 U;  4RPX A;  4PHA A;  3TAP A;  2HHV A;  3RB6 A;  8ICW A;  1D9F A;  3PZP A;  2D3D A;  1H38 A;  2ZTE A;  2KD1 A;  4DEZ A;  2DL0 A;  4O3Q A;  3NGD A;  1URJ A;  1O03 A;  7ICJ A;  2YN4 A;  1X9S A;  3LVV A;  4OJ5 A;  1YZ6 A;  3J81 j;  9ICL A;  2KVC A;  3ZDC A;  2XGQ A;  3MDC A;  4J9Q A;  2HHW A;  4QNL A;  2XY5 A;  3RJJ A;  3QU7 A;  3PX4 A;  5F9L A;  4JWM A;  1NJW A;  2GLE A;  4UAY A;  4E0D A;  3RRH A;  4K4H A;  1ZQE A;  1DK2 A;  5AKZ A;  3TKA A;  1SKW A;  5J0X A;  4I2A A;  5J0P A;  2DPI A;  4DFJ A;  3ETL A;  2IHN A;  1NKB A;  2JXJ A;  3WK6 A;  3WKB A;  1B22 A;  3EPG A;  1YZ7 A;  2NYV A;  4R63 A;  2JEJ A;  4RNN A;  1KKX A;  5AKX A;  5DLF A;  4NLC A;  4F91 B;  2JMG A;  1NZP A;  5KFR A;  2I1Q A;  2K4E A;  5KG1 A;  3E2E A;  1NK5 A;  5DB9 A;  3RTV A;  1FFV A;  5D4B A;  4NY8 A;  4ED1 A;  2F2A B;  3RRG A;  5KT2 A;  1N62 A;  1KSP A;  4J9L A;  3UMB A;  3IM1 A;  4YMN A;  5J2H A;  3UMG A;  1F44 A;  5AKH A;  4Y2Q A;  5EE9 A;  4ED0 A;  2JH7 A;  1DGJ A;  3SMV A;  3WK8 A;  3CW2 C;  3S6J A;  1MA7 A;  2NRW A;  2NO5 A;  7ICS A;  1MC8 A;  4K4I A;  2J6U A;  3M1Y A;  1ZJM A;  3RJI A;  2BCR A;  3C2L A;  4CE6 A;  3AQF A;  2LYH A;  4M6W A;  2WF7 A;  2J6S A;  4BJQ A;  4CF3 A;  2IOF A;  4M0A A;  4MEY A;  4B9S A;  2R8J A;  1DK3 A;  4UBB A;  4EBD A;  2E1F A;  2G5H B;  5AKG A;  2C2R A;  4M6W B;  4C8M A;  1QCK A;  5KFH A;  1N5X A;  2EAN A;  2H3Q A;  3T5L A;  1NKE A;  5KG0 A;  5AM4 A;  4GFJ A;  5JRT A;  4DOB A;  1ZQV A;  2Q0Z X;  1SB3 C;  9ICC A;  4IQU A;  4ECS A;  1Q8K A;  3D2Q A;  1N2X A;  2KEY A;  4M9G A;  4YG2 A;  2R8H A;  5KFA A;  4DL3 A;  4M9H A;  5AM0 A;  2KTQ A;  5B5E U;  2HOI A;  2XY7 A;  5EWG A;  8ICC A;  2YMM A;  1TVA A;  7ICU A;  2KJ8 A;  4GC7 A;  1XWL A;  2HOQ A;  2V4Q A;  1TV9 A;  2ZIU A;  1FO4 A;  2XY6 A;  1KDH A;  4ED6 A;  1IV8 A;  3ED5 A;  5CHG A;  1HUZ A;  4UAT A;  1BNO A;  5AKY A;  4TUQ A;  2I9G A;  4PH5 A;  2ZIU B;  2K4P A;  3ONN A;  1S5L U;  2FLN A;  1XS9 D;  2KZZ A;  4UAZ A;  4WJ3 B;  2B21 A;  3WKC A;  5EOZ A;  1KQQ A;  5FP0 A;  4AYB F;  3T79 A;  2C2E A;  1D8Y A;  5CP2 A;  4B9L A;  3PW4 A;  1COO A;  5J2C A;  3SV4 A;  2YML A;  5KFE A;  3UXP A;  4UB5 A;  3GIK A;  1ZRN A;  4OJL A;  1T94 A;  2WHE A;  2Y1J A;  2AQ4 A;  2RLT A;  4J9P A;  1RXW A;  2JRZ A;  4NLZ A;  3KTQ A;  1RZT A;  4RQ7 A;  4QZI A;  2YMP A;  4NLK A;  5AKE A;  1X9M A;  3EW9 A;  1NOM A;  5ALD A;  7ICH A;  1JMS A;  3LK9 A;  1NNL A;  3SD7 A;  2LMR A;  4RUC A;  4QWE A;  3BJY A;  3WK4 A;  4KLJ A;  1JXL A;  4FFD A;  4I2G A;  4P0Q A;  1FIQ A;  3BZC A;  1QTM A;  4RT2 A;  1AQ6 A;  5KT4 A;  4EBE A;  1TK5 A;  9ICN A;  1CI4 A;  2HHQ A;  3UM9 A;  4P0Q B;  5KAF U;  3H0L B;  1JRO A;  4Y2X A;  1HJP A;  3C5G A;  4P0P A;  2NRZ A;  2LI6 A;  1U47 A;  1S76 D;  3QX7 A;  3PO5 A;  4BDP A;  1K5O A;  1IIP A;  5J2E A;  3ORY A;  2W9C A;  3OSN A;  5C0Y A;  2LYB A;  4FE3 A;  9ICR A;  1K1Q A;  2W03 A;  4DQQ A;  1RG6 A;  4P0P B;  8ICR A;  9ICX A;  2WFA A;  3JPN A;  2HBL A;  4O3N A;  3IP4 B;  5KFT A;  2W9C B;  1S97 A;  1ZQW A;  3EWA A;  4USA A;  2BCU A;  3GDX A;  5ALW A;  2B0C A;  3B0X A;  1KBU A;  5AIB A;  2IBK A;  5KFD A;  2KOB A;  5EE0 A;  5F9N A;  4XA5 A;  1Z1V A;  4QZE A;  4G3I A;  5DB7 A;  3AQE A;  5L1J A;  2JH1 A;  2NRV A;  4QWB A;  2FPM A;  5EWF A;  1M6Y A;  4ED8 A;  5AI4 A;  3KBB A;  4F5N A;  1DGS A;  3M9M B;  2OYY A;  1UHU A;  4F2S A;  5III A;  4F5Q A;  8ICH A;  2EAO A;  3NVZ A;  2OCE A;  5J0Y A;  2H3V A;  5DBA A;  3RBD A;  9ICU A;  2DWQ A;  1X2I A;  4O3S A;  1RPL A;  5KNI A;  4KLI A;  2PI5 A;  5HML A;  5AM1 A;  5AHX A;  2HVH A;  5AIA A;  3C23 A;  1A0P A;  1N48 A;  5JTI A;  4DQR A;  4QW9 A;  5J0U A;  1PK1 A;  5KFN A;  1L7O A;  4EX7 A;  5AKJ A;  4RU9 A;  4PHP A;  3MGH A;  2ZUD A;  5ALN A;  4KLU A;  5AK3 A;  3ETR A;  4P4M A;  2QKQ A;  1Y88 A;  3Q8Q B;  3SI8 A;  1TKD A;  5TIS U;  3RBE A;  4TUS A;  4RQN A;  2BZF A;  3FM9 A;  2ZTC A;  4GLX A;  1PK1 B;  1QSY A;  8ICV A;  5AI0 A;  3N97 B;  2DBY A;  4Y2T A;  5CB1 A;  5EWE A;  4QZH A;  2CPR A;  3PNC A;  4RQ4 A;  3RJH A;  2NRT A;  2HBM A;  3QUB A;  3CRX A;  5AK6 A;  4B6J A;  2EAP A;  4US9 A;  4O5E A;  3L5K A;  7ICF A;  4Q45 A;  4QZC A;  5J2D A;  5JU5 A;  3G6X A;  3RR7 A;  1CUK A;  2UVV A;  4MF8 A;  1PUZ A;  4Q8E A;  3T5H A;  1NI3 A;  1A6S A;  5H2F U;  1ZOL A;  3N7R C;  4QW8 A;  1HIW A;  2G07 A;  2EDU A;  3HKZ C;  3PX0 A;  2NRX A;  1QSL A;  3PST A;  4F5R A;  4F71 A;  2E8O A;  4QWD A;  2OWO A;  4YFK A;  1RM6 C;  3F2C A;  4DSJ A;  4QJF B;  5DGB A;  5CWR A;  1B43 A;  1ZQN A;  2QB1 A;  5CA7 A;  4UB1 A;  4M47 A;  3GV7 B;  5KFU A;  2V9W A;  4OD0 A;  3KKA C;  4U6P A;  1UT5 A;  1ZQK A;  4I2B A;  3UQ2 A;  2BQR A;  4ICA A;  2KZ3 A;  2E1E A;  3PW7 A;  3N28 A;  2W43 A;  4UB4 A;  4YR2 A;  1ZRM A;  2XI9 A;  1F5S A;  3B0Y A;  3JPP A;  5G5G A;  3HIL A;  1CEZ A;  3HKZ F;  1VDV A;  5ALV A;  4DSI A;  3SAH A;  3PSI A;  3MR3 A;  4XRH A;  7ICT A;  4KLT A;  1ZQZ A;  5AI6 A;  4ELU A;  2IOH A;  3KOO A;  4GXI A;  3F53 A;  3M9O B;  2KIW A;  1A77 A;  1SGG A;  5ALS A;  2MU2 A;  1XNS A;  4I27 A;  1OXJ A;  3KZI U;  3H8W A;  4RQ5 A;  4NM2 A;  1XSN A;  5KFW A;  2I5H A;  3QUT A;  3JPT A;  4AP9 A;  5HP4 A;  4NM1 A;  4JV1 A;  2AJQ A;  3GU3 A;  3M8R A;  2BR0 A;  5C5J A;  4RPY A;  2WB1 F;  4J9O A;  4M2Y A;  1UCV A;  5ALO A;  4DOA A;  1PVQ A;  3OPX A;  3HWT A;  5AM2 A;  1SIJ A;  1HEK A;  1SKS A;  4NL9 C;  1ZQM A;  3FDS A;  4Y2J A;  5ALT A;  2L5Y A;  2IA6 A;  3CP8 A;  2Y0S C;  5K4L A;  1BVS A;  4DF8 A;  3UXO A;  4DSF A;  1UT8 A;  2MSN A;  4G9B A;  3G6Y A;  4O9M A;  2KP7 A;  3AUO A;  4Y2U A;  3RB4 A;  2W04 A;  2ZXI A;  5L1L A;  2KE7 A;  4BXO A;  4QZG A;  8ICU A;  2HOF A;  3M9N B;  5CJ7 A;  2JEI A;  2VA2 A;  1JAL A;  4QIW C;  3IHQ B;  5ALL A;  3GIL A;  4NL9 A;  4BXO B;  1S10 A;  1TK0 A;  2R8K A;  5AKK A;  2HI0 A;  2DPJ A;  5KFM A;  4I29 A;  5DB8 A;  2ZIV A;  4RQ1 A;  4LZG A;  3HX0 A;  4NXZ A;  5KT3 A;  2A19 A;  3KZX A;  2K8B B;  4EZ9 A;  2ZIV B;  2Y0S F;  3NVW A;  4GXJ A;  1Z1B A;  3KHH A;  3OJU A;  8ICY A;  2W7O A;  2GWS A;  1XO1 A;  3H8S A;  1WCL A;  2XO7 A;  1OUQ A;  4JWN A;  2BKE A;  3EYZ A;  1ZJN A;  2VA8 A;  3AMZ A;  1L8O A;  3GFK B;  3TAQ A;  1NK8 A;  3F5A A;  4QIW F;  3BQT A;  4B9M A;  4UBC A;  2AGP A;  1N60 A;  1L3V A;  2KHV A;  3PSP A;  2MAX A;  5A0L A;  3C1Y A;  5DBB A;  2H3I A;  4DF4 A;  3BQ1 A;  1SKR A;  1L3S A;  3G6V A;  4DFD A;  1U48 A;  2ODG A;  2DQN B;  2RP5 A;  2G5I B;  4YXM A;  2OEH A;  5HMM A;  1D8B A;  3PO4 A;  2FMS A;  1BPE A;  1SZH A;  4Y2S A;  3BQ2 A;  4IRK A;  1U45 A;  4RQM A;  3V6H A;  2HW3 A;  2KVS A;  4YCX A;  5J0R A;  4HAI A;  2Y9T A;  1T3Q A;  5DDY A;  9ICI A;  2E8P A;  1MQ3 A;  2VJ5 A;  3V7L A;  4TUR A;  4NLN A;  2ZUB A;  5KG3 A;  8ICN A;  3MC1 A;  3GV8 B;  3NAS A;  1N5W A;  4DLG A;  3SQI A;  4CNQ A;  1SL0 A;  3QEA Z;  4DSL A;  4O5C A;  2M9N A;  2Q4T A;  2XIC A;  2XGP A;  4JK1 A;  5ALI A;  5IIN A;  4C4R A;  4JMU A;  9ICT A;  1FFU A;  5KFC A;  2XID A;  3QXG A;  4Z6C A;  5EE3 A;  4UAR A;  4KN7 A;  2MRL A;  5ALR A;  2QB0 A;  1Q3U A;  1ZET A;  2KIV A;  5EE1 A;  2FMQ A;  8ICM A;  3TFR A;  2HSZ A;  2EZX A;  4IQT A;  3OHA A;  5KG2 A;  1JI7 A;  2IOF K;  1FEZ A;  1XO0 A;  2QB0 B;  4P4O A;  2XCP A;  1S0O A;  1ZQF A;  3ICX A;  1ZQB A;  2FDR A;  1XSP A;  2RRD A;  3M7D A;  2K89 A;  4DL4 A;  3AU2 A;  4RZR A;  8ICG A;  1OW5 A;  4AYB C;  3A0B U;  2O6K A;  4OJ6 A;  5IIJ A;  4DSK A;  3QU4 A;  3LYS A;  3ZDA A;  3F2D A;  3K75 D;  1Z4O A;  1ZQS A;  4IC9 A;  3TAN A;  4P4P A;  5KT5 A;  2W9A A;  4QZF A;  2BQU A;  1ARO P;  4UW9 A;  5J2A A;  5KFS A;  4J03 A;  5J0T A;  3QE9 Y;  1SL2 A;  5HHI A;  5KL8 B;  2DF4 B;  1JUD A;  4DL6 A;  3C5F A;  5AKL A;  8ICE A;  4EBC A;  3QU2 A;  2LM4 A;  5AM3 A;  5KFY A;  3Q8L A;  3TAR A;  3AEV A;  1QQ5 A;  1ZQL A;  4C7Z A;  7ICI A;  1CRX A;  2ZJ8 A;  4B9T A;  2RDJ A;  2BPC A;  1V9P A;  5HR7 A;  2BCV A;  4QZ8 A;  3MR6 A;  2LYA A;  2YX8 A;  2HHU A;  3WKA A;  4O0I A;  5ALK A;  2K4H A;  3V6K A;  2JEF A;  1DRG A;  4PL2 A;  5DBC A;  4F5O A;  2G06 A;  3C29 A;  4EEL A;  2KFN A;  3MR2 A;  3SZ2 A;  3PMN A;  4DLE A;  4F3O A;  4CCH A;  2Y1I A;  4M04 A;  1WWU A;  4LJX A;  9ICE A;  4KIT B;  1S77 D;  8ICA A;  2JV3 A;  1TAQ A;  3GIM A;  2KMD A;  1COK A;  2OH2 A;  1S0N A;  4UAU A;  4DS5 A;  3K4G A;  3MR5 A;  5GTH U;  1RYS A;  3E0F A;  4UB3 A;  4F4X A;  1TFR A;  3MDA A;  4CDG A;  2D8C A;  1P7D A;  2F1H A;  5ALH A;  4ED3 A;  3NUQ A;  5HHH A;  1L7M A;  3MGV A;  2A3V A;  2ATL A;  3SEI A;  2FMP A;  5L1M A;  4QZ9 A;  3PSF A;  4MHV A;  2ZTD A;  4ECT A;  1Z3E B;  4ECQ A;  5GTI U;  4GC6 A;  1RYR A;  2XVT A;  5DDM A;  4TQR A;  4YP3 A;  3ISD A;  5ALP A;  3RAQ A;  4YVZ A;  2YY6 A;  3BDP A;  4KLQ A;  5DB6 A;  4IRD A;  2EAM A;  4GXK A;  3T5J A;  1TAU A;  4K4G A;  3JPS A;  4XQ8 A;  4JUZ A;  5AK5 A;  3QNM A;  7ICK A;  1Z19 A;  1ZXI A;  4KLF A;  2AXT U;  4Y2V A;  1QQ6 A;  4I2D A;  4MFA A;  5KFX A;  1BNP A;  2KG5 A;  2FJ6 A;  2HBJ A;  3RH4 A;  2ISP A;  3DEE A;  1ZQQ A;  2KV2 A;  3RH5 A;  5DGA A;  4KLS A;  3BS7 A;  2F8K A;  5IIO A;  5DQG A;  4FZM A;  3TAC B;  4YQW A;  4DFK A;  5ALY A;  5IIL A;  4ECZ A;  4RUA A;  2ASJ A;  2BGW A;  3RFA A;  2ASD A;  4QWC A;  3EUB 2;  1LV5 A;  3O0F A;  5KFJ A;  5ALZ A;  3LVW A;  4ELV A;  5ALM A;  9ICV A;  2G08 A;  1Q3V A;  1SWV A;  2E8N A;  4PGQ A;  5L1K A;  2NV3 A;  2AHO B;  3ZDD A;  4KLD A;  4Y2R A;  5J8Y C;  3PML A;  3H0M B;  4NJ8 A;  4ZOH C;  5ALF A;  5AK4 A;  8ICZ A;  1RQN A;  2XCA A;  2DKZ A;  3C2K A;  2KHQ A;  4KLH A;  1U9L A;  1V97 A;  3KFU F;  3NRZ A;  3Q8R B;  4ACO A;  2ZXH A;  1VJ5 A;  5KFK A;  3Q8K A;  4M9L A;  1T8E A;  4B9U A;  7ICG A;  5JUM A;  5F3X B;  2KKP A;  3B9J A;  2AGO A;  2F1J A;  4JV0 A;  5L1I A;  3EZ5 A;  5J8Y A;  2VIX A;  2KKV A;  7ICM A;  2JGA A;  4JV2 A;  3RH6 A;  3JPR A;  7ICV A;  3HRD D;  4KTQ A;  1BPX A;  7ICN A;  2R8G A;  2YB4 A;  2IMW P;  1NJX A;  2WAQ F;  4PGY A;  1QQ7 A;  3VC8 A;  3QUQ A;  2KK0 A;  3JPO A;  4DL5 A;  4KLE A;  5IIK A;  2HDO A;  2VA3 A;  5DQI A;  2BDU A;  3C2M A;  4DO9 A;  1L6N A;  4LVS A;  1GO3 F;  3QZ8 A;  4QZA A;  3U26 A;  3Q8M A;  4QZD A;  4OCZ A;  1X40 A;  8ICT A;  4I2I A;  4DCC A;  3A0H U;  2WB1 C;  4YD2 A;  2ZIX A;  3QYP A;  3WKE A;  4YMM A;  2W8L A;  3THV A;  4KLG A;  4I2F A;  4FBU A;  4ED2 A;  3PR4 A;  1IXR A;  1BPB A;  2LHT A;  3ZDB A;  1U49 A;  4C7Y A;  4EEN A;  8ICP A;  2ZIX B;  3D6J A;  2FI1 A;  2BQ3 A;  3SV3 A;  4F93 B;  3KD3 A;  4PHE A;  1MN8 A;  1D9D A;  3NS1 A;  2BCQ A;  1A76 A;  4Z6D A;  2I6X A;  5KFV A;  5CRX A;  1S0V A;  3WK5 A;  3AU6 A;  2A1J A;  3MAB A;  4EYH B;  2KN7 A;  3UMC A;  1F0M A;  4Q43 A;  1WYG A;  2C22 A;  4M9N A;  5D49 A;  1ZQT A;  3N7S C;  4US8 A;  1WCN A;  4HYK A;  2A1J B;  5DG8 A;  1JN3 A;  3LWL A;  3PY8 A;  2PMZ C;  2RHF A;  4F4Z A;  3N7P D;  4ECR A;  2GOL A;  2AH5 A;  1KTQ A;  4EZ6 A;  3OGU A;  3MFI A;  1LB2 B;  3Q8P B;  1J2N A;  4IR9 A;  5KFI A;  4CF4 A;  3JPQ A;  3M8S A;  4B9V A;  4UB6 U;  3BQ7 A;  4PPX A;  1C20 A;  2WF9 A;  5KAI U;  4R64 A;  4Y2P A;  1ZQY A;  2VKQ A;  4DOC A;  1QH9 A;  2ESE A;  1ZQJ A;  2JR5 A;  3PW5 A;  2ALZ A;  8ICF A;  2LBO A;  1BPD A;  1PK3 A;  3CNH A;  3PVX A;  3SEN A;  3CYM A;  8ICX A;  5B66 U;  1L3T A;  4I2C A;  2RDI A;  4DL2 A;  4R8U A;  4I2E A;  2UVW A;  1L7P A;  1S9F A;  5J0W A;  2VJ4 A;  5J0O A;  2PMZ F;  3PW2 A;  3HP6 A;  4KLO A;  4R8U B;  2P6R A;  3TFS A;  3V7J A;  3ALR A;  3WU2 U;  2KSO A;  5ALG A;  1ZQX A;  2YMQ A;  5ALE A;  1QSS A;  4OO1 J;  4Q8F A;  9ICB A;  1KFD A;  3UXN A;  1HUO A;  5KG7 A;  3PX6 A;  2KSO B;  3H4B A;  3TAD C;  4DL7 A;  2KNJ A;  1L7N A;  9ICO A;  3BQ0 A;  2EH9 A;  1Z4N A;  2P66 A;  5J2F A;  8ICL A;  3RJF A;  2P35 A;  5KFP A;  2IHM A;  4P2H A;  3ZDE A;  2KJ9 A;  4RQ3 A;  2CRX A;  4MFC A;  3H7I A;  1ZQC A;  1ZD4 A;  2AGQ A;  2WTF A;  3ISB A;  1ZD3 A;  4GIB A;  3RAX A;  3C1Z A;  2K8C B;  2PFN A;  1KL9 A;  3IG5 A;  4Z6E A;  4Y2Y A;  3TAD A;  2EQY A;  5AIC A;  4DQP A;  3H40 A;  1XC9 A;  1UA1 A;  1UA0 A;  5J2K A;  2A1A A;  4BWJ A;  9ICA A;  5CEH A;  3WK9 A;  4X5V A;  1ZQ1 C;  2FPL A;  3D2N A;  4C4T A;  3KHR A;  4PHD A;  4F5P A;  3SAF A;  3TI0 A;  5IIM A;  2KZM A;  1N56 A;  1BPY A;  3RJK A;  1N61 A;  2F3N A;  1JX4 A;  2B6G A;  3RB0 A;  9ICP A;  3OSP A;  4F8R A;  4F4K A;  1J97 A;  4C0Z A;  3NVY A;  4IQV A;  1L5U A;  2ZIW A;  1B0X A;  1EXN A;  1RXV A;  2BHN A;  4R66 A;  2F8L A;  2XC9 A;  3MGI A;  1RQL A;  3BS5 A;  2HBK A;  1O08 A;  1KFT A;  2ZIW B;  5KFF A;  1NJY A;  2QLT A;  3I28 A;  3H8M A;  1ED1 A;  4YR0 A;  3OHB A;  3BS5 B;  4J9S A;  2E5S A;  4PGX A;  2UVU A;  3LWM A;  2OHF A;  8ICS A;  4A8E A;  2RQ5 A;  5TZV A;  1PZN A;  3F5E A;  5CR0 A;  9ICW A;  1UPH A;  2HHS A;  1V85 A;  2FPK A;  4ED7 A;  3C28 A;  4ELT A;  2ISO A;  5BOL A;  4O3O A;  1SXE A;  4FZN A;  4IL6 U;  3PW0 A;  4CRX A; 
#chains in the Genus database with same CATH homology
 1ZYQ A;  3PX0 A;  9ICH A;  2NRX A;  2W9M A;  1QSL A;  2FLL A;  1KEJ A;  2ZTD A;  4ECT A;  1Z3E B;  4F5R A;  4J9M A;  5KFO A;  4QWD A;  2OWO A;  4YFK A;  4RPX A;  5J0Q A;  4PHA A;  4ECQ A;  4DSJ A;  5DGB A;  1SL1 A;  3TAP A;  4I28 A;  2HHV A;  4GC6 A;  3RB6 A;  4FS2 A;  4RPZ A;  5CWR A;  8ICW A;  4DS4 A;  1RYR A;  1B43 A;  1ZQN A;  5DDM A;  4TQR A;  4YP3 A;  3ISD A;  3RAQ A;  1D9F A;  4YXJ A;  5J0S A;  4YVZ A;  3BDP A;  4EYI B;  5CA7 A;  4UB1 A;  4M47 A;  4KLQ A;  3GV7 B;  5DB6 A;  1H38 A;  5KFU A;  1KLN A;  2ZTE A;  2V9W A;  4IRD A;  1UT5 A;  4DEZ A;  1ZQK A;  4I2B A;  3UQ2 A;  4O3Q A;  2BQR A;  4F92 B;  3NGD A;  2KZ3 A;  4GXK A;  3PW7 A;  4M9J A;  5KG6 A;  4UB4 A;  3T5J A;  1TAU A;  7ICJ A;  1X9S A;  4K4G A;  8ICH A;  3JPS A;  9ICL A;  4YR2 A;  4XQ8 A;  8ICF A;  4JUZ A;  7ICK A;  5DQH A;  3ZDC A;  4ECX A;  4KLF A;  2XGQ A;  4F4W A;  3H8J A;  4I2D A;  3MDC A;  4J9Q A;  4MFA A;  4C8K A;  2HHW A;  3B0Y A;  2XY5 A;  5KFX A;  3JPP A;  4YD1 A;  1KRP A;  5KFG A;  3RJJ A;  3PX4 A;  9ICQ A;  5F9L A;  3RH4 A;  2ISP A;  1ZQQ A;  4JWM A;  1Z00 A;  9ICG A;  3PV8 A;  4B9N A;  1NJW A;  1CEZ A;  2MUT A;  3HW8 A;  3RH5 A;  4UAY A;  5DGA A;  1NK6 A;  4KLS A;  4DSI A;  4E0D A;  3RRH A;  4K4H A;  3MR3 A;  1ZQE A;  5IIO A;  5DQG A;  5BOM A;  4XRH A;  7ICT A;  4KLT A;  1SKW A;  1ZQZ A;  1NK9 A;  5J2G A;  4ELU A;  4YQW A;  4DFK A;  4O3P A;  5J0X A;  4I2A A;  8ICI A;  5J0P A;  1Z00 B;  3M9O B;  4GXI A;  3T5K A;  3ETL A;  4DFJ A;  2DPI A;  2MUT B;  5IIL A;  2IHN A;  3ZD8 A;  4ECZ A;  1NKB A;  4RUA A;  5HNK A;  2ASJ A;  1A77 A;  2FLP A;  1L3U A;  1D8L A;  4R65 A;  2BGW A;  3HPO A;  1B22 A;  2ZJA A;  2ASD A;  4QWC A;  3EPG A;  4I27 A;  4J9R A;  4RQ8 A;  4R63 A;  1LV5 A;  2JEJ A;  3H8W A;  4ECY A;  4DQI A;  4RQ5 A;  4NM2 A;  1XSN A;  5KFJ A;  4RNN A;  3GV5 B;  5KFW A;  5KFZ A;  4ELV A;  3JPT A;  9ICV A;  4YMO A;  5HP4 A;  5DLF A;  3NTU A;  4PGQ A;  3PR5 B;  4F91 B;  5L1K A;  4NM1 A;  1ZQA A;  4JV1 A;  2AJQ A;  5KFR A;  2I1Q A;  3ZDD A;  5KG1 A;  3M8R A;  2BR0 A;  4KLD A;  1NK5 A;  5DB9 A;  5C5J A;  4RPY A;  3RTV A;  1ZQD A;  4J9O A;  4C8O A;  4M2Y A;  3PML A;  5D4B A;  4NY8 A;  3UQ0 A;  4ED1 A;  4DOA A;  3HWT A;  3RRG A;  9ICS A;  5KT2 A;  2BDP A;  5KFL A;  4KLL A;  3SYZ A;  8ICZ A;  5BPC A;  1KSP A;  5DLG A;  2XCA A;  1SKS A;  3C2K A;  4J9L A;  4KLH A;  1U9L A;  3IM1 A;  4UQG A;  1ZQM A;  4FS1 A;  3FDS A;  4YMN A;  5DG9 A;  4FO6 A;  8ICJ A;  5J2H A;  3QEB Z;  2H5X A;  3T3F A;  3Q8R B;  1NKC A;  2IA6 A;  1X9W A;  4ED0 A;  5KFK A;  3Q8K A;  2HHT A;  4M9L A;  1BVS A;  4DF8 A;  3UXO A;  1T8E A;  4B9U A;  4DSF A;  4QWA A;  5JUM A;  1UT8 A;  3G6Y A;  2BPG A;  4O9M A;  7ICG A;  3AUO A;  2NRW A;  2R8I A;  3RB4 A;  2F1J A;  2AGO A;  7ICL A;  7ICS A;  4JV0 A;  1MC8 A;  3EZ5 A;  5L1I A;  4K4I A;  4TQS A;  4IRC A;  2J6U A;  1ZJM A;  5L1L A;  4BXO A;  7ICM A;  4QZG A;  3RJI A;  8ICB A;  5KFB A;  8ICU A;  4RQ0 A;  4NLG A;  7ICP A;  3M9N B;  1TK8 A;  2BCR A;  5CJ7 A;  3GII A;  3C2L A;  3RH6 A;  2VA2 A;  4JV2 A;  2JEI A;  3JPR A;  2LYH A;  4M6W A;  7ICV A;  3MFH A;  2J6S A;  4O3R A;  4I2J A;  4KTQ A;  3IHQ B;  4M0A A;  4MEY A;  3GIL A;  4BXO B;  1BPX A;  1S10 A;  4B9S A;  2R8J A;  7ICN A;  4UBB A;  2R8G A;  4EBD A;  1TK0 A;  5D46 A;  2IMW P;  2R8K A;  1NJX A;  4PGY A;  2DPJ A;  2C2R A;  5KFM A;  4M6W B;  5DB8 A;  4I29 A;  4BWM A;  1ZQP A;  4C8M A;  4RQ1 A;  3JPO A;  4DL5 A;  4KLE A;  1ZQU A;  5IIK A;  4LZG A;  2P6U A;  3HX0 A;  4NXZ A;  5KT3 A;  5KFH A;  2VA3 A;  5J2I A;  8ICO A;  5DQI A;  4EZ9 A;  3T5L A;  3C2M A;  1NKE A;  5KG0 A;  4DO9 A;  4LVS A;  4DOB A;  3QZ8 A;  1ZQV A;  4QZA A;  4RT3 A;  3Q8M A;  4GXJ A;  2Q0Z X;  3KHH A;  9ICC A;  4QZD A;  3OJU A;  2J6T A;  4IQU A;  4ECS A;  8ICY A;  8ICT A;  4I2I A;  2GWS A;  1XO1 A;  3H8S A;  4YD2 A;  9ICK A;  1WCL A;  4YMM A;  2XO7 A;  4JWN A;  2W8L A;  4UB2 A;  2BKE A;  3EYZ A;  1KFS A;  4M9G A;  3THV A;  4KLG A;  4YG2 A;  2R8H A;  4I2F A;  1ZJN A;  2VA8 A;  5KFA A;  4FBU A;  4ED2 A;  3PR4 A;  4DL3 A;  4M9H A;  4RNO A;  2JEG A;  1IXR A;  2KTQ A;  1BPB A;  2ASL A;  3ZDB A;  1U49 A;  2XY7 A;  3GFK B;  5EWG A;  3TAQ A;  8ICC A;  1NK8 A;  1TVA A;  8ICP A;  7ICU A;  3Q8S B;  3BQT A;  4GC7 A;  3SV3 A;  2BQ3 A;  4B9M A;  1XWL A;  4F93 B;  4F4Y A;  2V4Q A;  1TV9 A;  4PHE A;  4UBC A;  2AGP A;  1D9D A;  3H4D A;  2XY6 A;  3HT3 A;  1L3V A;  1KDH A;  1IM4 A;  4ED6 A;  3GQC A;  2BCQ A;  5L9X A;  5CHG A;  1A76 A;  4Z6D A;  1HUZ A;  5KFV A;  1S0V A;  2MAX A;  3C1Y A;  1T4G A;  5DBB A;  4TUQ A;  3AU6 A;  4DF4 A;  4PH5 A;  2I9G A;  3BQ1 A;  1SKR A;  2A1J A;  3MAB A;  4DFM A;  9ICM A;  4EYH B;  1L3S A;  2KN7 A;  3C21 A;  1XU4 A;  3G6V A;  4Q43 A;  2FLN A;  1XS9 D;  2KZZ A;  4UAZ A;  1U48 A;  2C22 A;  2B21 A;  5EOZ A;  3GIJ A;  4M9N A;  5D49 A;  1ZQT A;  1WCN A;  4YXM A;  4HYK A;  2A1J B;  5DG8 A;  5J2B A;  1JN3 A;  3LWL A;  4J9K A;  2C2E A;  1D8Y A;  2BPF A;  3PY8 A;  1QLN A;  5CP2 A;  5HMM A;  4B9L A;  2HHX A;  3TQ1 A;  3PW4 A;  4YR3 A;  1COO A;  5J2C A;  3V6J A;  3PO4 A;  3SV4 A;  1BPE A;  2FMS A;  2PFP A;  5KFE A;  3UXP A;  4F4Z A;  4UB5 A;  3BQ2 A;  4IRK A;  1U45 A;  3GIK A;  3V6H A;  2UVR A;  4YCX A;  2HW3 A;  4ECR A;  2Y1J A;  3UPQ A;  2AQ4 A;  5J0R A;  5KG5 A;  4ECV A;  1KTQ A;  4EEY A;  7ICE A;  4J9P A;  5DDY A;  4Z6F A;  1RXW A;  4EZ6 A;  9ICI A;  4NLZ A;  3OGU A;  1RZT A;  4RQ7 A;  4QZI A;  1MQ3 A;  3KTQ A;  3MFI A;  1LB2 B;  4NLK A;  3Q8P B;  1T3N A;  3V7L A;  1X9M A;  4TUR A;  4IR9 A;  5KFI A;  3JPQ A;  3EW9 A;  3M8S A;  1NOM A;  4B9V A;  4O5K A;  4ECW A;  4NLN A;  7ICH A;  2ZUB A;  5KG3 A;  4PPX A;  8ICN A;  2V4R A;  4R64 A;  1JMS A;  1ZQY A;  3LK9 A;  3GV8 B;  4DLG A;  4DOC A;  3KHG A;  4RUC A;  4QWE A;  1ZQJ A;  4DQS A;  3PW5 A;  2ALZ A;  3BJY A;  3QEA Z;  2AQ0 A;  2ZJ5 A;  1SL0 A;  4DSL A;  2M9N A;  4O5C A;  4KLJ A;  1JXL A;  1BPD A;  2XGP A;  3N4M B;  3PVX A;  8ICX A;  3RJG A;  4JK1 A;  4I2G A;  2W8K A;  1QTM A;  4RT2 A;  1NK7 A;  1L3T A;  5IIN A;  2AU0 A;  1BPZ A;  2RDI A;  4I2C A;  4DL2 A;  5KT4 A;  4R8U A;  4EBE A;  4XUS A;  1TK5 A;  4I2E A;  9ICN A;  9ICT A;  2UVW A;  5KFC A;  1S9F A;  5J0W A;  4Z6C A;  5J0O A;  3OJS A;  2HHQ A;  4KN7 A;  1ZET A;  3PW2 A;  2JZB A;  2FMQ A;  3HP6 A;  4I2H A;  3KHL A;  4KLO A;  8ICM A;  3TFR A;  4R8U B;  2P6R A;  1HJP A;  3TFS A;  3V7J A;  3C5G A;  1C7Y A;  1U4B A;  2NRZ A;  1U47 A;  1S76 D;  4IQT A;  3OHA A;  5KG2 A;  4DWI A;  4LZD A;  3PO5 A;  4BDP A;  4IQW A;  1ZQX A;  5J2E A;  3ORY A;  2W9C A;  3OSN A;  1ZQO A;  3EPI A;  1MQ2 A;  3FYH A;  2HVI A;  4P4O A;  2XCP A;  2JZB B;  1S0O A;  1ZQF A;  1QSS A;  9ICR A;  1K1Q A;  3RR8 A;  2KFZ A;  4Q8F A;  9ICB A;  1S0M A;  4DQQ A;  1ZQB A;  1KFD A;  8ICR A;  3UXN A;  1XSP A;  1HUO A;  7ICQ A;  9ICX A;  4F2R A;  3JPN A;  5KG7 A;  3PX6 A;  3H4B A;  4O3N A;  5J2J A;  5KFT A;  3AU2 A;  5KFQ A;  4RZR A;  2W9C B;  4DL7 A;  4DL4 A;  1S97 A;  4KLM A;  8ICG A;  9ICO A;  1ZQW A;  3EWA A;  4QZB A;  3ZD9 A;  3BQ0 A;  3GDX A;  4ZH4 A;  2BCU A;  2PFO A;  1JXE A;  3B0X A;  4F50 A;  2P66 A;  5IIJ A;  4DSK A;  5J2F A;  8ICL A;  3ZDA A;  3RJF A;  5KFP A;  1ZQG A;  2IHM A;  5KFD A;  2IBK A;  4P2H A;  3K75 D;  3ZDE A;  1NJZ A;  9ICJ A;  4RQ3 A;  5F9N A;  1ZQI A;  1ZQS A;  3TAN A;  4XA5 A;  7ICR A;  4P4P A;  2VAN A;  4QZE A;  4G3I A;  4MFC A;  3H7I A;  5KT5 A;  4FBT A;  1ZQC A;  2W9A A;  2AGQ A;  4C8N A;  4QZF A;  1NK0 A;  2BQU A;  5DB7 A;  1ARO P;  2WTF A;  3ISB A;  5L1J A;  2NRV A;  5DG7 A;  4QWB A;  5J2A A;  3RAX A;  2FPM A;  3C1Z A;  5KFS A;  5EWF A;  2PFN A;  1DOQ A;  4ED8 A;  5J0T A;  1ZQH A;  3QE9 Y;  1SL2 A;  4Q44 A;  5HHI A;  4RQ2 A;  3V7K A;  4F5N A;  4Z6E A;  1DGS A;  3M9M B;  4DQP A;  5DKW A;  4F2S A;  5III A;  3H40 A;  2ZUC A;  1XC9 A;  3LDA A;  4F5Q A;  3C5F A;  4DL6 A;  3RB3 A;  1UA0 A;  1UA1 A;  4BGD A;  5J2K A;  4EBC A;  8ICE A;  4BWJ A;  9ICA A;  2DFL A;  5J0Y A;  4X5V A;  5DBA A;  4MFF A;  3RBD A;  9ICF A;  2FPL A;  9ICU A;  4KN4 A;  1X2I A;  5KFY A;  3Q8L A;  2C28 A;  4O3S A;  3TAR A;  4UAW A;  1ZQR A;  2PFQ A;  1ZQL A;  3KHR A;  1RPL A;  4KLI A;  7ICI A;  2PI5 A;  2ZJ8 A;  4PHD A;  4B9T A;  5HML A;  2RDJ A;  2BPC A;  4F5P A;  1SZP A;  4C8L A;  3TI0 A;  2HVH A;  1V9P A;  5IIM A;  1K1S A;  1MSW D;  2BCV A;  4QZ8 A;  3MR6 A;  2KZM A;  3V72 A;  1N56 A;  3C23 A;  1BPY A;  1N48 A;  3RJK A;  4DQR A;  4QW9 A;  4IR1 A;  1JX4 A;  5J0U A;  2HHU A;  3RB0 A;  9ICP A;  4O0I A;  3OSP A;  5KFN A;  3V6K A;  4F4K A;  4F8R A;  2JEF A;  5J29 A;  4PHP A;  4RU9 A;  2ZUD A;  4IQV A;  3MGH A;  1L5U A;  5KG4 A;  5DBC A;  4KLU A;  4P4M A;  1EXN A;  1RXV A;  4F5O A;  1Y88 A;  3Q8Q B;  3SI8 A;  1TKD A;  3RBE A;  2BHN A;  2KFN A;  4TUS A;  4R66 A;  2XC9 A;  3MR2 A;  8ICQ A;  3SZ2 A;  2ZTC A;  3MGI A;  4GLX A;  1QSY A;  8ICV A;  3PMN A;  1T7P A;  4KMU A;  3N97 B;  7ICO A;  3RJE A;  4DLE A;  1KFT A;  4F3O A;  2C2D A;  4CCH A;  2Y1I A;  5CB1 A;  5EWE A;  4M04 A;  4DSE A;  5KFF A;  4QZH A;  5KT6 A;  3PNC A;  4RQ4 A;  4J9N A;  1NJY A;  3RJH A;  9ICE A;  4KIT B;  1S77 D;  4YR0 A;  3OHB A;  2NRT A;  8ICA A;  3MBY A;  1TAQ A;  3GIM A;  4PGX A;  4J9S A;  2UVU A;  3LWM A;  4YN4 A;  4RQ6 A;  4DFP A;  1S0N A;  8ICS A;  4DS5 A;  3K4G A;  2W9B A;  2BCS A;  3MR5 A;  4TUP A;  4O5E A;  8ICK A;  5TZV A;  1RYS A;  1PZN A;  4UB3 A;  5CR0 A;  4F4X A;  9ICW A;  7ICF A;  4Q45 A;  2F1I A;  2HHS A;  4QZC A;  1TFR A;  5J2D A;  3MDA A;  2FPK A;  4ED7 A;  4RNM A;  3G6X A;  4MEX A;  3RR7 A;  1CUK A;  3E2E A;  3QZ7 A;  3ISC A;  2UVV A;  2F1H A;  2PI4 A;  4ELT A;  5KTQ A;  4MF8 A;  4ECU A;  1BGX T;  2ISO A;  5BOL A;  2W9B B;  4O3O A;  1XSL A;  4ED3 A;  4Q8E A;  3T5H A;  5HHH A;  2PXI A;  3PW0 A;  2ATL A;  1NK4 A;  4MF2 A;  5KT7 A;  2FMP A;  1JIH A;  4QW8 A;  4QZ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...