3K4GA

Crystal structure of e. coli rna polymerase alpha subunit c-terminal domain
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
83
structure length
78
Chain Sequence
PEFDPILLRPVDDLELTVRSANCLAEAIHYIGDLVQRTEVELLTPNLGSLTEIDVLASRGLSLGMRLENWPPASIADE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA-directed RNA polymerase subunit alpha
publication title Structure of the Escherichia coli RNA polymerase alpha subunit C-terminal domain.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Transferase
total genus 18
structure length 78
sequence length 83
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2009-10-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3k4gA00
1D8LA 4C8OA 1ZQVA 4XUSA 4GXIA 4FBUA 2W9CB 2A1JB 3RR8A 4M6WB 2FPMA 7ICHA 2PI5A 5KFSA 2BQRA 5KG2A 1SKWA 1QSSA 4MF8A 2Q0ZX 4ED6A 4UAZA 2BCQA 3GIJA 4TURA 3TARA 2NRVA 2BKEA 4J9MA 4DL2A 2C2DA 3EPGA 4DSEA 3JPQA 3ZDEA 1XC9A 1L5UA 1L3UA 1ZQDA 4QWBA 3HWTA 5KFNA 1BPBA 4RQ4A 3MFIA 3MABA 4DOBA 5KFVA 1HUZA 1ZQMA 5KG6A 2BPCA 4DSJA 2FLLA 4JWMA 1SKSA 4QZAA 3QZ8A 4B9SA 4TQRA 4I28A 1Z3EB 3RH5A 4YD1A 4DLGA 3C1ZA 1TK0A 4RT2A 5KFIA 3PVXA 4YMNA 4RUCA 1S10A 4NM1A 1KFDA 3ISBA 5DB9A 3TFSA 4MFAA 1DOQA 2NRTA 3RBEA 4M9HA 3PO5A 4YFKA 2J6UA 3RJKA 1D9DA 3RJHA 4YR2A 3C5GA 5KFTA 3RAQA 4KTQA 5KFRA 4TUSA 7ICOA 3UPQA 2BCUA 1KDHA 4ELUA 3GV5B 4QZIA 4M2YA 1ZQCA 5J0SA 2C2RA 2DPJA 8ICHA 3PV8A 4X5VA 2FLPA 2AJQA 2ZJAA 8ICVA 4DQRA 3TI0A 3RJEA 4F5QA 1JIHA 1L3VA 4DEZA 4R63A 3V7JA 3BQ0A 4J9RA 4KLLA 1X9WA 5IIMA 2HHXA 3IHQB 5J2JA 4YQWA 4B9LA 4KMUA 3H7IA 4BGDA 4O0IA 3OSNA 1S76D 3H8JA 7ICVA 4RQ8A 3T5KA 3PW0A 3RJJA 1T8EA 1RYSA 2ZUDA 2BPGA 1KFSA 1ZQZA 1ZQRA 4RNOA 7ICNA 5DBCA 4UAYA 5KFMA 5L1IA 5KT5A 3AU2A 2MAXA 3C21A 3MR3A 4ED0A 2OWOA 4DQIA 7ICMA 4Z6EA 2V4RA 9ICLA 4DS4A 1ZETA 3GV7B 4DF8A 4NXZA 3PW4A 5BOMA 7ICEA 2VA8A 5J0OA 2XGPA 4I2CA 2ZUBA 5J0PA 1NOMA 1A76A 4B9NA 2FMPA 3HP6A 1NK5A 5DLFA 2KZ3A 1TV9A 3H4DA 8ICFA 3KHHA 5CJ7A 5KTQA 3NTUA 2PFOA 4J9QA 4J9OA 1ZQSA 1Z00A 4YXJA 2XC9A 5KFYA 4QZ9A 3MR5A 3H4BA 5KT2A 4EZ6A 3V6KA 4DQQA 4FBTA 8ICYA 2V4QA 4DL3A 4Q8EA 2HHTA 3C23A 3MDCA 3M9MB 5KFXA 4IR1A 4QWEA 1XSPA 1B43A 4DS5A 3MDAA 5KFPA 4R8UA 2HHWA 3RH4A 1S0MA 4M0AA 2W9BB 1NKBA 4J9NA 2BCRA 4I2JA 8ICIA 4F5OA 3BJYA 2KTQA 4DL6A 4F4KA 3LWLA 2PFQA 2JZBA 4O3OA 3RAXA 4QZGA 1QTMA 4M9GA 2F1HA 4RUAA 5HHIA 5DQGA 5KFJA 4DLEA 1RXWA 4O5KA 5CP2A 2Y1IA 3GFKB 7ICLA 4MEXA 2XCAA 1NJYA 1ZJMA 4UB3A 3MBYA 4J9LA 3K75D 4ED3A 1LB2B 8ICKA 3ORYA 4J9SA 5J0XA 3PR5B 4E0DA 2F1IA 2BDPA 5J2FA 4O5EA 2BPFA 2JEFA 8ICTA 4TQSA 3JPRA 3EYZA 2FLNA 4EEYA 3M8RA 2WTFA 4BXOA 4YXMA 2ZTDA 4PGQA 2ISPA 2AGPA 4ECUA 4MFCA 2W8LA 4KLUA 1ZQJA 1HUOA 4KLMA 1ZQXA 8ICMA 2KN7A 4IQWA 1SKRA 1HJPA 5KG3A 3KHGA 3OJUA 1ZQGA 4JWNA 4DL5A 3PR4A 1JXEA 4DOCA 4DQSA 3Q8SB 1BVSA 4QZBA 2W8KA 1MSWD 2R8IA 4CCHA 4R66A 3SZ2A 2FMQA 3PW5A 1NK6A 9ICSA 1KEJA 4QZDA 4YR0A 4O3RA 1Y88A 8ICNA 1SL0A 2HW3A 2MUTB 3V72A 4IQUA 2V9WA 9ICGA 5KFGA 5KG0A 5KT7A 4ECSA 9ICEA 4I2DA 3RB3A 1XSNA 1KLNA 1SL2A 2ZJ5A 2R8GA 1ZQWA 4UB4A 3LWMA 3RB0A 4I29A 9ICUA 5DLGA 5KFCA 4JK1A 2AU0A 4KLTA 4ED1A 1IM4A 1ZQEA 1KSPA 3LDAA 4Z6CA 3RB4A 3PW2A 5CB1A 4YN4A 4DSIA 1H38A 8ICRA 4IQTA 4LZGA 4ED8A 3PX4A 2XGQA 4F2RA 5KFKA 4J9KA 4PPXA 4I27A 1N48A 1U47A 4F50A 4DFMA 3HX0A 3MR2A 3TAQA 4ECVA 2AGOA 1BPZA 2PXIA 5KG1A 3ZD8A 3T5JA 5D49A 5DBAA 4G3IA 4GC7A 2H5XA 1PZNA 2HHUA 1S9FA 4YR3A 2I1QA 3OHBA 5D46A 4QZ8A 1X2IA 5IINA 2UVVA 3KTQA 5L1KA 2ZTCA 4YMMA 1U48A 4I2IA 5KFAA 1ZQAA 4KLSA 4J9PA 2HHVA 3ISCA 3M8SA 4DQPA 4I2FA 3THVA 3C2LA 3TQ1A 4Z6FA 5DB6A 2C22A 4F92B 4Z6DA 4IRKA 8ICSA 3B0XA 4O3NA 3HW8A 1UA0A 1L3SA 5KFHA 2BR0A 2KFNA 5KG4A 4PGYA 1ZQYA 3UXOA 4QWCA 9ICWA 1K1QA 2M9NA 5BOLA 1NK0A 1MQ3A 1BPXA 4RQ6A 4R65A 4ECYA 3JPPA 8ICJA 2AQ0A 5HHHA 4B9UA 1X9MA 4K4HA 4TUPA 2C2EA 4YD2A 4O3QA 2BQ3A 8ICAA 4F4YA 3C5FA 2HHSA 5DG9A 4F8RA 7ICGA 5BPCA 4F5NA 1S0NA 5J0RA 4QWAA 3JPNA 5J29A 4QWDA 3V7LA 4KN4A 3ZD9A 5KFBA 4XQ8A 3BQ2A 2BGWA 1NKCA 2P6UA 1D8YA 4YMOA 4DFKA 1JX4A 2ISOA 1L3TA 4UB5A 5DBBA 2ASJA 3G6VA 5DQHA 1LV5A 3JPOA 3JPTA 9ICTA 4BWJA 2NRXA 2R8KA 5L9XA 3QZ7A 3Q8KA 8ICCA 3ISDA 4DO9A 3T5HA 1ZQLA 4ELVA 1BPEA 5JUMA 4IRDA 2ASLA 3RTVA 4EBDA 4GC6A 2GWSA 5CWRA 4IQVA 2B21A 5HMLA 2IBKA 3T3FA 1T3NA 3GIKA 1MQ2A 5DB8A 4RNMA 5KT3A 4NY8A 3SV4A 1ZQBA 3MGIA 4JV1A 1NJXA 1U4BA 4B9TA 4KLJA 1UA1A 1ZQTA 5F9LA 4DL7A 3FYHA 4PHPA 3G6XA 4F5RA 4KLHA 4YG2A 4C8MA 4UBCA 1D9FA 4NLGA 3E2EA 1IXRA 4UB2A 5IIKA 2FPLA 5EOZA 3UQ2A 4DWIA 4IRCA 8ICLA 3Q8LA 2JEJA 2HHQA 3H8WA 3IM1A 4DL4A 9ICQA 5KFDA 9ICKA 4DSLA 3B0YA 4ECZA 4PHDA 4M9NA 1B22A 4LZDA 5J2EA 5IILA 2F1JA 4BDPA 4RT3A 3GIMA 4EYIB 1CEZA 4ZH4A 2W9CA 4PH5A 2A1JA 4B9VA 4M6WA 4I2GA 1SL1A 3PO4A 4F2SA 4YCXA 4K4IA 2XY6A 3BQ1A 4KLEA 4RQ1A 1S0OA 4GXKA 5F9NA 2ZUCA 4XA5A 4UQGA 1KRPA 4NM2A 5EWGA 1UT8A 4BWMA 5J2DA 4DFPA 1ZQFA 2AGQA 4EZ9A 4KLQA 5L1JA 1ZJNA 2ASDA 4C8KA 3RB6A 4UAWA 4EBCA 2HVHA 9ICFA 2XY5A 3Q8QB 2XCPA 5KFQA 9ICNA 1JMSA 1NK9A 4RPXA 4FS2A 1ZQQA 1NK4A 5KT4A 3BQTA 5KFUA 5TZVA 3Q8RB 4KLFA 4LVSA 5J0QA 5CHGA 4F4XA 3OGUA 4F3OA 1CUKA 4IR9A 1T7PA 4P2HA 9ICIA 1WCLA 4O9MA 2RDJA 4DSFA 4R8UB 4I2AA 2C28A 2JZBB 4JUZA 4DOAA 4PGXA 3RR7A 1X9SA 1COOA 3C1YA 2R8HA 3GDXA 4F93B 9ICBA 3KHLA 3RJIA 4KN7A 2BCVA 2PI4A 7ICKA 4ELTA 5KFZA 1UT5A 4ED2A 4JV2A 1ZYQA 1NJZA 1ZQNA 4UBBA 8ICZA 3AUOA 1K1SA 1WCNA 2RDIA 3GV8B 4YVZA 4P4OA 2VANA 3H8SA 5KFLA 5C5JA 2ATLA 4Q8FA 4JV0A 1N56A 1SZPA 2UVRA 1TK8A 4GXJA 4BXOB 2IA6A 1ZQIA 3K4GA 4KITB 4FO6A 4M9JA 5IIOA 4M04A 8ICBA 4QZHA 7ICJA 8ICUA 5DKWA 4NLNA 5CA7A 4QW8A 5J2GA 9ICAA 3ZDCA 3M9OB 5J0TA 5HNKA 1RPLA 4YP3A 3V6HA 1XSLA 2HVIA 3PX6A 4QZEA 4F4ZA 3RH6A 1TAUA 4NLZA 3PMLA 9ICHA 2JEGA 1U9LA 1ZQUA 1V9PA 4ECXA 2BHNA 1NK7A 5DG7A 3N4MB 1C7YA 2PFNA 3ZDBA 3RJFA 1BPDA 1NJWA 5DGBA 3MFHA 9ICMA 5CR0A 3RJGA 2ALZA 2VA3A 4RQ3A 3M9NB 3ETLA 4MFFA 8ICQA 9ICVA 3MR6A 4P4MA 4TUQA 3G6YA 4FS1A 1KFTA 2IHMA 1AROP 5KFOA 9ICRA 2Y1JA 4PHAA 4ECWA 3T5LA 5J2CA 1ZQOA 8ICXA 4C8NA 4KLIA 4RPYA 3V6JA 4RQ0A 9ICOA 3LK9A 4ED7A 4M47A 4MF2A 8ICPA 4C8LA 2UVUA 5IIJA 3C2KA 2IMWP 5J0YA 1RXVA 9ICCA 3EW9A 4RNNA 3AU6A 5J2KA 4Q43A 2KZMA 3V7KA 4NLKA 4F5PA 4MEYA 2UVWA 2W9BA 1ZQPA 3BDPA 3RRGA 2W9AA 4RZRA 4RQ7A 3TANA 4ECTA 1ZQHA 4KLGA 7ICIA 3GIIA 1EXNA 3OHAA 3MGHA 4DFJA 4EYHB 4P4PA 1XO1A 5DDYA 2IHNA 3PNCA 2W9MA 5KFEA 3EPIA 3RRHA 4RQ5A 1TAQA 4PHEA 4UB1A 5KFFA 5L1LA 4GLXA 7ICUA 4RQ2A 3RBDA 2J6TA 4RPZA 1QSYA 3HPOA 1S97A 3Q8MA 2P6RA 4KLOA 3TAPA 1XS9D 1TKDA 4DF4A 4Q44A 7ICFA 3C2MA 3SYZA 2FMSA 1QSLA 3QEBZ 3QEAZ 1JN3A 9ICXA 2FPKA 1QLNA 2VA2A 3JPSA 5EWEA 5J2HA 1BPYA 2ZTEA 3SV3A 4B9MA 3PW7A 3N97B 3NGDA 1XU4A 4HYKA 4ECQA 4K4GA 1XWLA 4I2EA 9ICPA 3PMNA 4R64A 2J6SA 5HMMA 5KT6A 5DG8A 3GQCA 3UQ0A 1TVAA 1ZQKA 3PY8A 4KLDA 2R8JA 8ICOA 1NK8A 1JXLA 1S0VA 3ZDAA 5D4BA 4Q45A 2MUTA 4F4WA 3OJSA 5J2BA 4O5CA 5DB7A 4ECRA 7ICRA 2NRWA 4RU9A 3TFRA 4I2HA 4I2BA 1TFRA 4O3SA 5KG5A 5HP4A 1S77D 1TK5A 1MC8A 8ICWA 3OSPA 2BQUA 1RYRA 3HT3A 9ICJA 1BGXT 3EZ5A 3SI8A 5KG7A 3PX0A 3QE9Y 1U45A 5J2IA 2BCSA 3ZDDA 4DSKA 2AQ4A 2ZJ8A 5J0WA 3GILA 7ICQA 5DDMA 4EBEA 1Z00B 5J2AA 4QW9A 5KFWA 2P66A 2KFZA 2I9GA 2XO7A 2KZZA 2XY7A 2JEIA 3UXPA 4QZCA 5IIIA 5EWFA 8ICGA 3H40A 5DGAA 7ICPA 4QZFA 2DFLA 1NKEA 2NRZA 4XRHA 3Q8PB 1T4GA 1U49A 2PFPA 8ICEA 1KTQA 5DQIA 7ICTA 2LYHA 4O3PA 2DPIA 3FDSA 1DGSA 7ICSA 3UXNA 3KHRA 1RZTA 4M9LA 3EWAA 1A77A 5J0UA 4F91B
chains in the Genus database with same CATH superfamily
3DDHA 4XUSA 2DBYA 1GO3F 2BQRA 1SKWA 4MF8A 2JR5A 2BCQA 1RG6A 4UATA 2BKEA 3BZCA 1ZQDA 3QX7A 1XC9A 3HWTA 1BPBA 4RQ4A 3MABA 4DOBA 3KBBA 2L5YA 4B9SA 4RT2A 5DB9A 2KVCA 5JU5A 2ZIUA 5ALEA 5ALNA 4KMOB 4YFKA 1SWVA 1D9DA 3SEIA 3C5GA 3GU3A 2BCUA 3HKZC 3IG8A 5J0SA 2DPJA 2H3IA 2AJQA 2JMGA 4AP9A 4R63A 3CP8A 2VIXA 5IIMA 5ALDA 3F53A 2RLTA 1AQ6A 1ZD5A 3S6JA 2BPGA 7ICNA 4BJQA 4UAYA 3AU2A 2MAXA 2WF7A 1WYGA 4NXZA 7ICEA 3PSPA 5BOMA 1DK2A 1LVHA 5J0PA 2Q4TA 1NK5A 1TV9A 3TACB 1PVQA 3BS5B 2VKQA 3NTUA 1SWWA 4J9QA 2HBLA 5KFYA 4QZ9A 3H4BA 3V6KA 4DQQA 5KL8B 1J2MA 2G06A 2GOLA 3C23A 4OCZA 3E58A 4IR1A 1B43A 4DS5A 4M0AA 8ICIA 4I2JA 5T14A 3BJYA 4F5OA 3LWLA 4QZGA 3AMZA 5AM0A 2F1HA 5DQGA 5KFJA 4DLEA 4O5KA 5CP2A 2Y1IA 3GFKB 4MEXA 4UB3A 2ZG6A 5JRTA 2E8OA 2KSOA 5AHXA 2JEFA 8ICTA 1V38A 5AI5A 2ZTDA 2W8LA 4KLUA 2K4EA 3NS1A 4JWNA 4O3MA 2ES6A 3Q8SB 1BVSA 1MSWD 2R8IA 5ALSA 4R66A 2W04A 1NK6A 1Y88A 1RQLA 1PVPA 3V72A 5AM2A 5KG0A 1XSNA 1SL2A 1S5LU 9ICUA 5DLGA 3IN5A 2AU0A 4ED1A 3AN1A 3ED5A 3RB4A 4YN4A 1Q3VA 2XGQA 5KFKA 2HBJA 1JROA 2MRLA 1U47A 2YX8A 3TAQA 4ECVA 2PXIA 5DBAA 3F5EA 4GC7A 2H5XA 2HHUA 4YR3A 3OHBA 4QZ8A 5IINA 3KTQA 2PKEA 4YMMA 1ZQAA 2KJ8A 4I2FA 3M8SA 3C2LA 3TQ1A 4FE3A 2C22A 5ALJA 3QU4A 1L3SA 5KFHA 2BR0A 2XI9A 3N28A 1ZRNA 5HHHA 4B9UA 3TADC 2W7PA 1FO4A 2HBKA 5DG9A 4U6PA 2HHSA 4F5NA 3JPNA 4QWDA 4KN4A 1HIWA 5J8YA 2A19A 2K8BB 3QU7A 4YMOA 1JX4A 4KX5A 4UB5A 3SD7A 5DQHA 9ICTA 2NRXA 2R8KA 2KK0A 3QZ7A 8ICCA 1ZQLA 2ZIVB 2GWSA 5AK6A 4IQVA 4GIBA 3MGVA 5DB8A 2F44A 4RNMA 4NY8A 1ZQBA 3ONNA 1NZPA 4B9TA 4PHPA 3G6XA 3E2EA 4UBCA 1D9FA 2DGZA 5EOZA 4DWIA 1Z1VA 4IRCA 2HHQA 9ICKA 4PHDA 4LZDA 4RT3A 2W9CA 4B9VA 1QQ6A 1JALA 1SL1A 1MN8A 1OXJA 4RQ1A 1PK1B 2G08A 4NWIA 5F9NA 2ZUCA 1UT8A 1ZJNA 5AM5A 4EBCA 2HVHA 9ICFA 4UW9A 5KNIA 2G5IB 2IOFK 5TZVA 2VJ4A 3Q8RB 4KLFA 4EX6A 2NO4A 5CHGA 2KOBA 5EE1A 2ZIXA 1SV0C 2C28A 1TE2A 2JZBB 5EE9A 4F93B 4KN7A 2BCVA 2YY6A 5AI6A 1ZYQA 3B9JA 4UBBA 1K1SA 1WCNA 3H8SA 3SAGA 1SZPA 3QUTA 4BXOB 2IA6A 4M04A 4M9JA 5IIOA 7ICJA 5DKWA 4NLNA 5CA7A 2E1FA 4OD0A 1TAUA 1RDFA 5AKZA 1NK7A 4ECXA 1NJWA 5DGBA 5ALPA 3RJGA 9ICVA 5KFOA 9ICRA 3IRUA 2WHEA 8ICXA 4C8NA 4KLIA 4RPYA 4ED7A 4M47A 4MF2A 4C8LA 1VDVA 2N1RA 4NLKA 2UVWA 2P35A 2KJ5A 2W9AA 4RZRA 4RQ7A 1PUZA 4ECTA 2GH1A 1K5OA 1L8OA 1EXNA 3MGHA 3K1RB 5DDYA 2KKVA 3WKCA 4RQ5A 1QSYA 5AI0A 2P6RA 1TKDA 4Q44A 1JN3A 1X42A 3JPSA 5J2HA 4UAUA 2NYVA 4K4GA 1ECWA 4I2EA 9ICPA 4R64A 3UQ0A 3PY8A 8ICOA 3M7DA 4C7YA 5D4BA 4Q45A 5J2BA 2NRWA 1S77D 4I2HA 4I2BA 2DUYA 2KICA 5KAFU 4Y2SA 1D8BA 1BGXT 2ZXIA 4DSKA 5J0WA 2H3QA 1T3QA 3L3FX 2HDOA 5DDMA 1KBUA 1FEZA 5IIIA 8ICGA 5ALMA 4CF4A 3TADA 1P7DA 4QZFA 2KE7A 2BDUA 4XRHA 1T4GA 3WU2U 1KL9A 1KTQA 4P0PB 2DPIA 2JRZA 3FDSA 3UXNA 1RZTA 3DEEA 3EWAA 3SAHA 4IR9A 3NRZA 1DK3A 4TURA 3TARA 2NRVA 2FMPA 3EPGA 4DSEA 3JPQA 1RM6C 5KFVA 1ZQMA 5KG6A 1X9XA 2FLLA 1ZQ1C 4CRXA 1ZRMA 4I28A 1Z3EB 1N5WA 5KFIA 1M6YA 4YMNA 4Y2JA 4NM1A 3TFSA 2YB4A 4Y2UA 2NRTA 1FIQA 2CRXA 3RBEA 2A1AA 4M9HA 1PK3A 2J6UA 3RJKA 3RJHA 4FFDA 5KFTA 3RAQA 2KIVA 2DWQA 3VCBA 1UHUA 4KTQA 2ZIWB 3GV5B 1ZQCA 2C2RA 1LKYB 8ICHA 5HR7A 2FDRA 3WKDA 1L3VA 1SXEA 5ALRA 5J2JA 5AI4A 1S76D 7ICVA 4RQ8A 2LI6A 1RYSA 2ZUDA 1KFSA 1NNLA 5DBCA 5KFMA 5KT5A 2W3SA 3MR3A 4ED0A 2OWOA 7ICMA 3IV6A 4Z6EA 4DS4A 3GV7B 4RQMA 2VA8A 2YN4A 2HOIA 1A76A 2HBMA 1L7MA 2VJ5A 3SQIA 2KZ3A 2G09A 2PFOA 2G5HB 1ZQSA 3MR5A 1QQ5A 4FBTA 2HHTA 4DL3A 3MDCA 1KN5A 2EZYA 3RH4A 1S0MA 2W9BB 2KTQA 4F4KA 4O3OA 1QTMA 5HHIA 1RXWA 1NJYA 2NO5A 1ZJMA 2GLEA 4J9SA 5J0XA 3PR5B 4E0DA 5J2FA 1JUDA 4TQSA 3JPRA 3EYZA 2FLNA 2WF9A 5J8YC 4YXMA 2QB0A 4MFCA 4IQWA 1SKRA 1HJPA 2G07A 5KG3A 3KHGA 3QUBA 4DQSA 3GZFA 3KOOA 3NVZA 4QZBA 4CCHA 4HAIA 3SZ2A 1KEJA 3QUQA 5AKGA 2HW3A 1RQNA 4IQUA 4FZLA 9ICEA 2K89A 1KLNA 2OHFA 4UB4A 4I29A 4JK1A 4P0QA 3KD3A 1L6NA 1IM4A 3LDAA 4A8EA 3PW2A 5CB1A 2LYBA 8ICRA 4F2RA 4PPXA 3MR2A 1C20A 1BPZA 4NJ8A 3HJEA 3T5JA 5D49A 2Y9UA 2I1QA 5D46A 1CI4A 2UVVA 5L1KA 1U48A 2HHVA 3WK9A 3ISCA 4DQPA 3THVA 5DB6A 2GO7A 4IRKA 2OH2A 1X6IA 1K1QA 2M9NA 5BOLA 1NK0A 4RQ6A 4ECYA 8ICJA 5H2FU 2AQ0A 4TUPA 1X6JA 1QCKA 2BQ3A 8ICAA 5K4LA 4QWAA 2EAMA 3KKAA 2BGWA 1NKCA 2P6UA 1D8YA 4DFKA 5ALTA 2ISOA 5DBBA 3JPTA 3Q8KA 4DO9A 3T5HA 3ZI4A 5JUMA 3RTVA 4EBDA 2F8KA 2B21A 2IBKA 5AI9A 2RHFA 3GIKA 1N61A 5KT3A 3MGIA 1F44A 2O6KA 4KLJA 1U4BA 1ZQTA 1N2XA 3FYHA 4C4SA 4UB2A 2W3RA 4Y2PA 3H8WA 3HKZF 3IM1A 4DL4A 3B0YA 4ECZA 1B22A 4BDPA 3GIMA 3K1ZA 4ZH4A 1CRXA 1NZBA 4YCXA 2XY6A 2K8CB 4RQNA 2WF8A 5ALFA 5TISU 4GXKA 1S0OA 4EENA 5EWGA 4DFPA 2OM6A 1ZQFA 5L1JA 5AKIA 4C8KA 3RB6A 1O03A 3Q8QB 2QB1A 3MC1A 2XCPA 2IOFA 9ICNA 5AKXA 2EDUA 4LVSA 3OPXA 4C0ZA 3OGUA 1CUKA 4F3OA 1T7PA 4P2HA 1WCLA 4DSFA 4R8UB 3F5AA 5ALKA 3CW2C 3TKAA 4NLCA 4DOAA 1COOA 3N7SC 3GDXA 1O08A 3RJIA 4ELTA 5KFZA 4ED2A 1NJZA 1ZQNA 1SZHA 2AXTU 3AQFA 3T79A 2VANA 2ATLA 4MHVA 1SIJA 4Y2XA 2UVRA 5AM4A 4GXJA 2ZXHA 1ZQIA 8ICBA 4G9BA 3AM9A 8ICUA 4QZHA 3ZDCA 4YP3A 4NLZA 3PMLA 2D8CA 5DG7A 1C7YA 3ZDBA 2LPEA 5B5EU 9ICMA 3IP4B 4UB8U 2ALZA 2VA3A 4RQ3A 4Y2TA 1Q46A 2EZZA 3HILA 3MR6A 3BS5A 2RQ5A 3T5LA 1F5SA 2W55A 3V6JA 9ICOA 4Y2QA 3LK9A 3C2KA 2IMWP 1RXVA 5J2KA 4Q43A 2KZMA 3V7KA 1IIPA 1SB3C 1ZQPA 3BDPA 1N60A 4KLGA 7ICIA 1FFUA 3LVVA 5ALWA 2LM4A 2IHNA 3PNCA 1UPHA 5KFEA 4FZNA 3EPIA 4PHEA 4UB1A 5L1LA 3RBDA 4USAA 1S97A 3Q8MA 2JXJA 1XS9D 4DF4A 3N7PD 1J2NA 2YQEA 2KHQA 3QEBZ 3QEAZ 1QSLA 2FPKA 3LYSA 5EWEA 2EQYA 2ZTEA 3SV3A 4B9MA 1XNSA 3NGDA 1XU4A 4ECQA 4OJOA 5KT6A 1TVAA 3GQCA 2HCFA 4KLDA 1JXLA 3ZDAA 2Y0SC 4AYBC 4O5CA 5DB7A 4ECRA 7ICRA 2YMLA 4O3SA 1TFRA 5HP4A 2BQUA 2ODGA 3HT3A 5AKLA 3QE9Y 3SMVA 3ZDDA 2AQ4A 2ZJ8A 2CXYA 3PSTA 1Z00B 4QW9A 2KFZA 1UQVA 2XY7A 3NVWA 5DGAA 2JH7A 4DFDA 2NRZA 8ICEA 2LYHA 2Z7JA 3FAHA 3H0MB 4FZMA 4C4RA 5J0UA 2LHTA 4C8OA 5AKYA 4GXIA 4FBUA 2PMZC 2A1JB 4M6WB 7ICHA 2PI5A 5KFSA 1QSSA 4UAZA 3GIJA 5ALOA 4UARA 5CEHA 1L5UA 3OTQA 3ZDEA 4QWBA 4NV0A 2FI1A 3SR6A 4JWMA 2Y0SF 2FE9A 4AYBF 4YD1A 4DLGA 3C1ZA 1TK0A 3PVXA 3C29A 1S10A 1KFDA 3ISBA 1DOQA 4QIWC 2ZIVA 3UPQA 1KDHA 5ALVA 4QZIA 5ALZA 2YMPA 3PV8A 3ETRA 2W03A 2ZJAA 8ICVA 4DQRA 3TI0A 3RJEA 4F5QA 1JIHA 4KLLA 2HHXA 4PL1A 1V85A 3V7JA 1X9WA 4UASA 4YQWA 4B9LA 2F77X 4KMUA 3H7IA 4CGZA 4BGDA 2K4IA 4JB3A 3PW0A 3RJJA 2KD1A 1ZQZA 3QYPA 3C21A 4F71A 3CYMA 4DQIA 2PMZF 2V4RA 9ICLA 2KVSA 2YTUA 5J0OA 2XGPA 1PK1A 3WKEA 4I2CA 2EAPA 5EE3A 1UCVA 3HP6A 1A0PA 5KTQA 1F0MA 4J9OA 1Z00A 2OYYA 5ALQA 4YXJA 2XC9A 3QU2A 5KT2A 3WK4A 4Q8EA 2WF5A 3H0RB 2DL0A 3M9MB 5KFXA 4QWEA 1XSPA 3MDAA 3HRDD 4QIWF 2BCRA 4J9NA 2PFQA 2LKYA 2JZBA 3RAXA 2F8LA 3RFAA 7ICLA 2XCAA 1LB2B 4ED3A 3MBYA 3UM9A 3L4PA 3VC8A 4OO1J 3KKAC 4QJFB 1V97A 2WTFA 3M8RA 4BXOA 2AGPA 4KLMA 5E79U 2KN7A 1ZQGA 2EAOA 3PR4A 4DOCA 3PW5A 9ICSA 4O3RA 8ICNA 4DCCA 1WWVA 1SL0A 2MUTB 5KAIU 2V9WA 5ALLA 5KFGA 9ICGA 5ALUA 5ALGA 3RB3A 2ZJ5A 2R8GA 1ZQWA 4KLTA 2CPRA 1ZQEA 1KSPA 4IQTA 4WJ3B 2KEYA 4J9KA 1L7PA 1N48A 4I27A 4F50A 1OUQA 3HX0A 2AGOA 1PZNA 1S9FA 1OW5A 2QLTA 2ZTCA 2KV2A 4F92B 4Z6DA 8ICSA 3B0XA 3HW8A 1UA0A 1ZOLA 1N5XA 2KFNA 5KG4A 1ZQYA 1BPXA 1JI7A 2C2EA 4YD2A 4O3QA 4CF5A 1WWUA 1S0NA 5J0RA 4OJ5A 3V7LA 3ZD9A 5KFBA 4XQ8A 3WK8A 1VLBA 2DKXA 3PZPA 1BPEA 2ZIUB 2ASLA 4GC6A 2DF4B 3ALRA 5HMLA 3T3FA 1T3NA 1MQ2A 3SV4A 3I76A 5ALYA 1NJXA 5HR6A 2EANA 4DL7A 4F5RA 4KLHA 4NLGA 4C8MA 4P0PA 5CRXA 3A0BU 3QXGA 4KX3A 3UQ2A 2K4PA 2JEJA 9ICQA 4DSLA 2WAQC 4PL2A 4M9NA 5AK5A 5J2EA 5IILA 1J97A 1KKXA 2F1JA 4EYIB 1CEZA 2AH5A 4PH5A 2E3TA 3PO4A 3BQ1A 5AKJA 1IG6A 4XA5A 4LJXA 1KRPA 4NM2A 5J2DA 3SAFA 3I1YA 2AGQA 3WK5A 4KLQA 4GFJA 4J03A 1URJA 3LVWA 5KFQA 2R18A 1JMSA 1NK9A 4RPXA 4FS2A 2E1EA 3BQTA 5J0QA 4F4XA 2RDJA 2JH1A 4I2AA 2ZIWA 3FC4A 2AHOB 1S8OA 1LKYA 9ICBA 3KHLA 1UT5A 4JV2A 1RYUA 2KSOB 5AK3A 4YVZA 1Z4NA 5C5JA 2OCEA 4Q8FA 4B6JA 5AI8A 1TK8A 4CE6A 3K4GA 5AKEA 2WAQF 3IG5A 4C7ZA 9ICAA 5HNKA 2HVIA 3V6HA 2LMRA 4F4ZA 2EZXA 9ICHA 2Y9TA 1U9LA 1ZQUA 2F2AB 1BPDA 5ALHA 2H3VA 1DXSA 4NL9C 4Y2VA 3M9NB 3ETLA 4MFFA 8ICQA 3G6YA 2W11A 4P4MA 4TUQA 1KFTA 2G0AA 1AROP 2F76X 3WKAA 5J2CA 1ZQOA 3D2NA 2LBOA 3WK7A 3D2QA 3AU6A 5AM3A 3BQ7A 3QU5A 3NASA 4F5PA 3PSIA 2W9BA 3RRGA 1VJ5A 3RF9A 3TANA 3F2BA 1ZQHA 2B0CA 1B4FA 4DFJA 1XO1A 1KQQA 4GLXA 2MSNA 5KFFA 4RQ2A 4RPZA 3HPOA 4KLOA 3TAPA 4CF3A 3C2MA 2FMSA 2F3NA 9ICXA 1HEKA 2MA1A 1QLNA 2VA2A 1SV4A 3R9KA 4HYKA 3U26A 2J6SA 5HMMA 5DG8A 1ZQKA 4QNLA 2R8JA 4BX9C 4F4WA 3OJSA 1ZD3A 4RU9A 3TFRA 1YZ6A 8ICWA 1MC8A 3OSPA 9ICJA 1U45A 5KG7A 5J2IA 2BCSA 3GILA 4EBEA 5KFWA 3WK6A 2I9GA 2KZZA 2JEIA 3H40A 3UMGA 2BZFA 3Q8PB 5DQIA 2KG5A 4O3PA 1YT3A 1DGSA 7ICSA 2XIDA 2OXOA 2B6GA 1WG8A 4CDGA 1D8LA 1ZQVA 2W9CB 1QQ7A 3RR8A 2FPMA 2DKZA 5KG2A 3PSFA 2Q0ZX 4ED6A 3BS7A 4EX7A 1Q3UA 4J9MA 4DL2A 2C2DA 1L3UA 5KFNA 3MFIA 1HUZA 2BPCA 4DSJA 1SKSA 3IDWA 4QZAA 5JTIA 3QZ8A 4TQRA 3RH5A 3AEVA 4RUCA 4MFAA 3PO5A 5B66U 2ZIXB 2KIWA 4YR2A 3M6ZA 5KFRA 1X40A 4TUSA 7ICOA 2DQNB 4M2YA 4ELUA 2W43A 2E8MA 2I5HA 1FFVA 4X5VA 2FLPA 3NVVA 3A0HU 2M0NA 4DEZA 3BQ0A 4J9RA 3IHQB 3WKBA 2YMMA 4PZNA 2XVTA 4O0IA 3OSNA 5AKKA 3H8JA 3T5KA 1T8EA 1ZQRA 4RNOA 5L1IA 1ZETA 4DF8A 1BNOA 3PW4A 3M6KA 2MU2A 2ZUBA 5AM1A 1NOMA 1N62A 1N63A 1ZD2P 4B9NA 5DLFA 8ICFA 2WB1C 3H4DA 2W54A 3KHHA 4ICAA 5CJ7A 1ZXIA 3QNMA 1YZ7A 4EZ6A 8ICYA 2V4QA 3QUCA 1WUDA 2RP5A 2RRDA 5KFPA 4R8UA 2HHWA 1DRGA 1NKBA 4DL6A 1COKA 5AIAA 4M9GA 4RUAA 1BNPA 4C4TA 4J9LA 3K75D 4NL9A 8ICKA 3F2CA 3ORYA 3J81j 2F1IA 2BDPA 4O5EA 3L5KA 2BPFA 1B0XA 4EEYA 4PGQA 2ISPA 4NLBA 4ECUA 1NI3A 4OJLA 1HUOA 1ZQJA 1ZQXA 8ICMA 1L8LA 3OJUA 4DL5A 1JXEA 5AK4A 2D3DA 2W8KA 2KMDA 2FMQA 2I6XA 3QU9A 4QZDA 4YR0A 4UB6U 1Q8KA 1L7OA 2WB1F 4ECSA 5KT7A 4I2DA 1MA7A 3RB0A 3LWMA 3BZKA 5KFCA 4Y2YA 3AL0B 2YB1A 4Z6CA 4DSIA 1H38A 2QKQA 4LZGA 4ED8A 3PX4A 3NVYA 2HOFA 2QARB 4DFMA 2LYAA 5KG1A 3ZD8A 4G3IA 3M1YA 1X2IA 2E8PA 4KLSA 4I2IA 5KFAA 3EUB2 4J9PA 3E0FA 4Z6FA 4O3NA 2K60A 1DGJA 3DV9A 3N7RC 4PGYA 3UXOA 4QWCA 1L7NA 9ICWA 1MQ3A 3I28A 4OJPA 2OEHA 1ZD4A 4R65A 3JPPA 1X9MA 4K4HA 4F4YA 3C5FA 4F8RA 7ICGA 5BPCA 5J29A 3BQ2A 1TAMA 1L3TA 3D6JA 2ASJA 2HI0A 3G6VA 2W7OA 1LV5A 3JPOA 4BWJA 5L9XA 3ISDA 4ELVA 1SGGA 2HSZA 5AICA 4IRDA 2K8AA 2KNJA 5CWRA 1XO0A 1JRPA 3KZIU 2KHVA 4JV1A 3D2SA 1UA1A 5GTIU 5F9LA 5A0LA 4YG2A 1IXRA 5IIKA 2FPLA 8ICLA 3Q8LA 2JV3A 5KFDA 4U7CA 3CRXA 3O0FA 4I2GA 2A1JA 4M6WA 3C28A 4F2SA 4K4IA 4KLEA 2XICA 2LM1A 3ICXA 4JMUA 2FJ6A 1ED1A 4EELA 4UQGA 2KP7A 4BWMA 4EZ9A 4CNQA 5EE0A 2ASDA 5ALXA 4OJ6A 4UAWA 2WF6A 2XY5A 1SXDA 2E5SA 1ZQQA 1NK4A 2QARA 5KT4A 5KFUA 3F2DA 2K4HA 9ICIA 4O9MA 5AKHA 2A3VA 3SENA 4JUZA 3RR7A 4PGXA 1X9SA 3C1YA 2R8HA 2PI4A 7ICKA 8ICZA 3AUOA 2RDIA 3GV8B 4P4OA 5KFLA 5KL1B 4JV0A 2YMQA 1N56A 4KITB 4FO6A 2QB0B 4QW8A 5J2GA 3UMCA 3M9OB 5J0TA 1RPLA 1XSLA 3PX6A 4QZEA 3RH6A 3H0LB 2JEGA 1V9PA 2BHNA 3N4MB 2PFNA 3H8MA 5FP0A 3RJFA 1T94A 5AIBA 3MFHA 2NV3A 5CR0A 5ALIA 2JGAA 1IV8A 4ACOA 4FS1A 2E8NA 2IHMA 1Z1BA 2Y1JA 4PHAA 4ECWA 3KFUF 4IC9A 1Z19A 4RQ0A 4P0QB 8ICPA 3UMBA 2UVUA 4Y2RA 5IIJA 4US8A 5J0YA 9ICCA 3EW9A 4RNNA 3FM9A 5G5HA 1PVRA 3NUQA 2HMXA 4MEYA 2H3ZA 4PJ0U 3NRWA 1Z4OA 3GIIA 3OHAA 4EYHB 4P4PA 5L1MA 2W9MA 3RRHA 3AQEA 1KW4A 1TAQA 7ICUA 4BUGA 2J6TA 2WFAA 2JHDA 4US9A 2ESEA 4UAVA 1SV0A 7ICFA 3SYZA 4PZOA 1QH9A 2H3FA 1BPYA 2CN1A 4EEKA 3CNHA 3PW7A 3N97B 2D6FC 1XWLA 4IS7A 3PMNA 4ZOHC 1NK8A 1S0VA 4C80A 2MUTA 4F72A 2HOQA 5KG5A 1TK5A 1X66A 2EH9A 1RYRA 3EZ5A 3SI8A 3PX0A 7ICQA 5J2AA 1A6SA 2IOHA 2P66A 4IL6U 2XO7A 5C0YA 3UXPA 4QZCA 5EWFA 7ICPA 5F3XB 2DFLA 1NKEA 1U49A 2PFPA 7ICTA 5GTHU 2KKPA 3KHRA 4M9LA 2KJ9A 1A77A 5G5GA 3KZXA 4F91B
chains in the Genus database with same CATH topology
1D8LA 4C8OA 1ZQVA 4XUSA 4GXIA 4FBUA 2W9CB 2A1JB 3RR8A 4M6WB 2FPMA 7ICHA 2PI5A 5KFSA 2BQRA 5KG2A 1SKWA 1QSSA 4MF8A 2Q0ZX 4ED6A 4UAZA 2BCQA 3GIJA 4TURA 3TARA 2NRVA 2BKEA 4J9MA 4DL2A 2C2DA 3EPGA 4DSEA 3JPQA 3ZDEA 1XC9A 1L5UA 1L3UA 1ZQDA 4QWBA 3HWTA 5KFNA 1BPBA 4RQ4A 3MFIA 3MABA 4DOBA 5KFVA 1HUZA 1ZQMA 5KG6A 2BPCA 4DSJA 2FLLA 4JWMA 1SKSA 4QZAA 3QZ8A 4B9SA 4TQRA 4I28A 1Z3EB 3RH5A 4YD1A 4DLGA 3C1ZA 1TK0A 4RT2A 5KFIA 3PVXA 4YMNA 4RUCA 1S10A 4NM1A 1KFDA 3ISBA 5DB9A 3TFSA 4MFAA 1DOQA 2NRTA 3RBEA 4M9HA 3PO5A 4YFKA 2J6UA 3RJKA 1D9DA 3RJHA 4YR2A 3C5GA 5KFTA 3RAQA 4KTQA 5KFRA 4TUSA 7ICOA 3UPQA 2BCUA 1KDHA 4ELUA 3GV5B 4QZIA 4M2YA 1ZQCA 5J0SA 2C2RA 2DPJA 8ICHA 3PV8A 4X5VA 2FLPA 2AJQA 2ZJAA 8ICVA 4DQRA 3TI0A 3RJEA 4F5QA 1JIHA 1L3VA 4DEZA 4R63A 3V7JA 3BQ0A 4J9RA 4KLLA 1X9WA 5IIMA 2HHXA 3IHQB 5J2JA 4YQWA 4B9LA 4KMUA 3H7IA 4BGDA 4O0IA 3OSNA 1S76D 3H8JA 7ICVA 4RQ8A 3T5KA 3PW0A 3RJJA 1T8EA 1RYSA 2ZUDA 2BPGA 1KFSA 1ZQZA 1ZQRA 4RNOA 7ICNA 5DBCA 4UAYA 5KFMA 5L1IA 5KT5A 3AU2A 2MAXA 3C21A 3MR3A 4ED0A 2OWOA 4DQIA 7ICMA 4Z6EA 2V4RA 9ICLA 4DS4A 1ZETA 3GV7B 4DF8A 4NXZA 3PW4A 5BOMA 7ICEA 2VA8A 5J0OA 2XGPA 4I2CA 2ZUBA 5J0PA 1NOMA 1A76A 4B9NA 2FMPA 3HP6A 1NK5A 5DLFA 2KZ3A 1TV9A 3H4DA 8ICFA 3KHHA 5CJ7A 5KTQA 3NTUA 2PFOA 4J9QA 4J9OA 1ZQSA 1Z00A 4YXJA 2XC9A 5KFYA 4QZ9A 3MR5A 3H4BA 5KT2A 4EZ6A 3V6KA 4DQQA 4FBTA 8ICYA 2V4QA 4DL3A 4Q8EA 2HHTA 3C23A 3MDCA 3M9MB 5KFXA 4IR1A 4QWEA 1XSPA 1B43A 4DS5A 3MDAA 5KFPA 4R8UA 2HHWA 3RH4A 1S0MA 4M0AA 2W9BB 1NKBA 4J9NA 2BCRA 4I2JA 8ICIA 4F5OA 3BJYA 2KTQA 4DL6A 4F4KA 3LWLA 2PFQA 2JZBA 4O3OA 3RAXA 4QZGA 1QTMA 4M9GA 2F1HA 4RUAA 5HHIA 5DQGA 5KFJA 4DLEA 1RXWA 4O5KA 5CP2A 2Y1IA 3GFKB 7ICLA 4MEXA 2XCAA 1NJYA 1ZJMA 4UB3A 3MBYA 4J9LA 3K75D 4ED3A 1LB2B 8ICKA 3ORYA 4J9SA 5J0XA 3PR5B 4E0DA 2F1IA 2BDPA 5J2FA 4O5EA 2BPFA 2JEFA 8ICTA 4TQSA 3JPRA 3EYZA 2FLNA 4EEYA 3M8RA 2WTFA 4BXOA 4YXMA 2ZTDA 4PGQA 2ISPA 2AGPA 4ECUA 4MFCA 2W8LA 4KLUA 1ZQJA 1HUOA 4KLMA 1ZQXA 8ICMA 2KN7A 4IQWA 1SKRA 1HJPA 5KG3A 3KHGA 3OJUA 1ZQGA 4JWNA 4DL5A 3PR4A 1JXEA 4DOCA 4DQSA 3Q8SB 1BVSA 4QZBA 2W8KA 1MSWD 2R8IA 4CCHA 4R66A 3SZ2A 2FMQA 3PW5A 1NK6A 9ICSA 1KEJA 4QZDA 4YR0A 4O3RA 1Y88A 8ICNA 1SL0A 2HW3A 2MUTB 3V72A 4IQUA 2V9WA 9ICGA 5KFGA 5KG0A 5KT7A 4ECSA 9ICEA 4I2DA 3RB3A 1XSNA 1KLNA 1SL2A 2ZJ5A 2R8GA 1ZQWA 4UB4A 3LWMA 3RB0A 4I29A 9ICUA 5DLGA 5KFCA 4JK1A 2AU0A 4KLTA 4ED1A 1IM4A 1ZQEA 1KSPA 3LDAA 4Z6CA 3RB4A 3PW2A 5CB1A 4YN4A 4DSIA 1H38A 8ICRA 4IQTA 4LZGA 4ED8A 3PX4A 2XGQA 4F2RA 5KFKA 4J9KA 4PPXA 4I27A 1N48A 1U47A 4F50A 4DFMA 3HX0A 3MR2A 3TAQA 4ECVA 2AGOA 1BPZA 2PXIA 5KG1A 3ZD8A 3T5JA 5D49A 5DBAA 4G3IA 4GC7A 2H5XA 1PZNA 2HHUA 1S9FA 4YR3A 2I1QA 3OHBA 5D46A 4QZ8A 1X2IA 5IINA 2UVVA 3KTQA 5L1KA 2ZTCA 4YMMA 1U48A 4I2IA 5KFAA 1ZQAA 4KLSA 4J9PA 2HHVA 3ISCA 3M8SA 4DQPA 4I2FA 3THVA 3C2LA 3TQ1A 4Z6FA 5DB6A 2C22A 4F92B 4Z6DA 4IRKA 8ICSA 3B0XA 4O3NA 3HW8A 1UA0A 1L3SA 5KFHA 2BR0A 2KFNA 5KG4A 4PGYA 1ZQYA 3UXOA 4QWCA 9ICWA 1K1QA 2M9NA 5BOLA 1NK0A 1MQ3A 1BPXA 4RQ6A 4R65A 4ECYA 3JPPA 8ICJA 2AQ0A 5HHHA 4B9UA 1X9MA 4K4HA 4TUPA 2C2EA 4YD2A 4O3QA 2BQ3A 8ICAA 4F4YA 3C5FA 2HHSA 5DG9A 4F8RA 7ICGA 5BPCA 4F5NA 1S0NA 5J0RA 4QWAA 3JPNA 5J29A 4QWDA 3V7LA 4KN4A 3ZD9A 5KFBA 4XQ8A 3BQ2A 2BGWA 1NKCA 2P6UA 1D8YA 4YMOA 4DFKA 1JX4A 2ISOA 1L3TA 4UB5A 5DBBA 2ASJA 3G6VA 5DQHA 1LV5A 3JPOA 3JPTA 9ICTA 4BWJA 2NRXA 2R8KA 5L9XA 3QZ7A 3Q8KA 8ICCA 3ISDA 4DO9A 3T5HA 1ZQLA 4ELVA 1BPEA 5JUMA 4IRDA 2ASLA 3RTVA 4EBDA 4GC6A 2GWSA 5CWRA 4IQVA 2B21A 5HMLA 2IBKA 3T3FA 1T3NA 3GIKA 1MQ2A 5DB8A 4RNMA 5KT3A 4NY8A 3SV4A 1ZQBA 3MGIA 4JV1A 1NJXA 1U4BA 4B9TA 4KLJA 1UA1A 1ZQTA 5F9LA 4DL7A 3FYHA 4PHPA 3G6XA 4F5RA 4KLHA 4YG2A 4C8MA 4UBCA 1D9FA 4NLGA 3E2EA 1IXRA 4UB2A 5IIKA 2FPLA 5EOZA 3UQ2A 4DWIA 4IRCA 8ICLA 3Q8LA 2JEJA 2HHQA 3H8WA 3IM1A 4DL4A 9ICQA 5KFDA 9ICKA 4DSLA 3B0YA 4ECZA 4PHDA 4M9NA 1B22A 4LZDA 5J2EA 5IILA 2F1JA 4BDPA 4RT3A 3GIMA 4EYIB 1CEZA 4ZH4A 2W9CA 4PH5A 2A1JA 4B9VA 4M6WA 4I2GA 1SL1A 3PO4A 4F2SA 4YCXA 4K4IA 2XY6A 3BQ1A 4KLEA 4RQ1A 1S0OA 4GXKA 5F9NA 2ZUCA 4XA5A 4UQGA 1KRPA 4NM2A 5EWGA 1UT8A 4BWMA 5J2DA 4DFPA 1ZQFA 2AGQA 4EZ9A 4KLQA 5L1JA 1ZJNA 2ASDA 4C8KA 3RB6A 4UAWA 4EBCA 2HVHA 9ICFA 2XY5A 3Q8QB 2XCPA 5KFQA 9ICNA 1JMSA 1NK9A 4RPXA 4FS2A 1ZQQA 1NK4A 5KT4A 3BQTA 5KFUA 5TZVA 3Q8RB 4KLFA 4LVSA 5J0QA 5CHGA 4F4XA 3OGUA 4F3OA 1CUKA 4IR9A 1T7PA 4P2HA 9ICIA 1WCLA 4O9MA 2RDJA 4DSFA 4R8UB 4I2AA 2C28A 2JZBB 4JUZA 4DOAA 4PGXA 3RR7A 1X9SA 1COOA 3C1YA 2R8HA 3GDXA 4F93B 9ICBA 3KHLA 3RJIA 4KN7A 2BCVA 2PI4A 7ICKA 4ELTA 5KFZA 1UT5A 4ED2A 4JV2A 1ZYQA 1NJZA 1ZQNA 4UBBA 8ICZA 3AUOA 1K1SA 1WCNA 2RDIA 3GV8B 4YVZA 4P4OA 2VANA 3H8SA 5KFLA 5C5JA 2ATLA 4Q8FA 4JV0A 1N56A 1SZPA 2UVRA 1TK8A 4GXJA 4BXOB 2IA6A 1ZQIA 3K4GA 4KITB 4FO6A 4M9JA 5IIOA 4M04A 8ICBA 4QZHA 7ICJA 8ICUA 5DKWA 4NLNA 5CA7A 4QW8A 5J2GA 9ICAA 3ZDCA 3M9OB 5J0TA 5HNKA 1RPLA 4YP3A 3V6HA 1XSLA 2HVIA 3PX6A 4QZEA 4F4ZA 3RH6A 1TAUA 4NLZA 3PMLA 9ICHA 2JEGA 1U9LA 1ZQUA 1V9PA 4ECXA 2BHNA 1NK7A 5DG7A 3N4MB 1C7YA 2PFNA 3ZDBA 3RJFA 1BPDA 1NJWA 5DGBA 3MFHA 9ICMA 5CR0A 3RJGA 2ALZA 2VA3A 4RQ3A 3M9NB 3ETLA 4MFFA 8ICQA 9ICVA 3MR6A 4P4MA 4TUQA 3G6YA 4FS1A 1KFTA 2IHMA 1AROP 5KFOA 9ICRA 2Y1JA 4PHAA 4ECWA 3T5LA 5J2CA 1ZQOA 8ICXA 4C8NA 4KLIA 4RPYA 3V6JA 4RQ0A 9ICOA 3LK9A 4ED7A 4M47A 4MF2A 8ICPA 4C8LA 2UVUA 5IIJA 3C2KA 2IMWP 5J0YA 1RXVA 9ICCA 3EW9A 4RNNA 3AU6A 5J2KA 4Q43A 2KZMA 3V7KA 4NLKA 4F5PA 4MEYA 2UVWA 2W9BA 1ZQPA 3BDPA 3RRGA 2W9AA 4RZRA 4RQ7A 3TANA 4ECTA 1ZQHA 4KLGA 7ICIA 3GIIA 1EXNA 3OHAA 3MGHA 4DFJA 4EYHB 4P4PA 1XO1A 5DDYA 2IHNA 3PNCA 2W9MA 5KFEA 3EPIA 3RRHA 4RQ5A 1TAQA 4PHEA 4UB1A 5KFFA 5L1LA 4GLXA 7ICUA 4RQ2A 3RBDA 2J6TA 4RPZA 1QSYA 3HPOA 1S97A 3Q8MA 2P6RA 4KLOA 3TAPA 1XS9D 1TKDA 4DF4A 4Q44A 7ICFA 3C2MA 3SYZA 2FMSA 1QSLA 3QEBZ 3QEAZ 1JN3A 9ICXA 2FPKA 1QLNA 2VA2A 3JPSA 5EWEA 5J2HA 1BPYA 2ZTEA 3SV3A 4B9MA 3PW7A 3N97B 3NGDA 1XU4A 4HYKA 4ECQA 4K4GA 1XWLA 4I2EA 9ICPA 3PMNA 4R64A 2J6SA 5HMMA 5KT6A 5DG8A 3GQCA 3UQ0A 1TVAA 1ZQKA 3PY8A 4KLDA 2R8JA 8ICOA 1NK8A 1JXLA 1S0VA 3ZDAA 5D4BA 4Q45A 2MUTA 4F4WA 3OJSA 5J2BA 4O5CA 5DB7A 4ECRA 7ICRA 2NRWA 4RU9A 3TFRA 4I2HA 4I2BA 1TFRA 4O3SA 5KG5A 5HP4A 1S77D 1TK5A 1MC8A 8ICWA 3OSPA 2BQUA 1RYRA 3HT3A 9ICJA 1BGXT 3EZ5A 3SI8A 5KG7A 3PX0A 3QE9Y 1U45A 5J2IA 2BCSA 3ZDDA 4DSKA 2AQ4A 2ZJ8A 5J0WA 3GILA 7ICQA 5DDMA 4EBEA 1Z00B 5J2AA 4QW9A 5KFWA 2P66A 2KFZA 2I9GA 2XO7A 2KZZA 2XY7A 2JEIA 3UXPA 4QZCA 5IIIA 5EWFA 8ICGA 3H40A 5DGAA 7ICPA 4QZFA 2DFLA 1NKEA 2NRZA 4XRHA 3Q8PB 1T4GA 1U49A 2PFPA 8ICEA 1KTQA 5DQIA 7ICTA 2LYHA 4O3PA 2DPIA 3FDSA 1DGSA 7ICSA 3UXNA 3KHRA 1RZTA 4M9LA 3EWAA 1A77A 5J0UA 4F91B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D8L A;  4C8O A;  1ZQV A;  4XUS A;  4GXI A;  4FBU A;  2W9C B;  2A1J B;  3RR8 A;  4M6W B;  2FPM A;  7ICH A;  2PI5 A;  5KFS A;  2BQR A;  5KG2 A;  1SKW A;  1QSS A;  4MF8 A;  2Q0Z X;  4ED6 A;  4UAZ A;  2BCQ A;  3GIJ A;  4TUR A;  3TAR A;  2NRV A;  2BKE A;  4J9M A;  4DL2 A;  2C2D A;  3EPG A;  4DSE A;  3JPQ A;  3ZDE A;  1XC9 A;  1L5U A;  1L3U A;  1ZQD A;  4QWB A;  3HWT A;  5KFN A;  1BPB A;  4RQ4 A;  3MFI A;  3MAB A;  4DOB A;  5KFV A;  1HUZ A;  1ZQM A;  5KG6 A;  2BPC A;  4DSJ A;  2FLL A;  4JWM A;  1SKS A;  4QZA A;  3QZ8 A;  4B9S A;  4TQR A;  4I28 A;  1Z3E B;  3RH5 A;  4YD1 A;  4DLG A;  3C1Z A;  1TK0 A;  4RT2 A;  5KFI A;  3PVX A;  4YMN A;  4RUC A;  1S10 A;  4NM1 A;  1KFD A;  3ISB A;  5DB9 A;  3TFS A;  4MFA A;  1DOQ A;  2NRT A;  3RBE A;  4M9H A;  3PO5 A;  4YFK A;  2J6U A;  3RJK A;  1D9D A;  3RJH A;  4YR2 A;  3C5G A;  5KFT A;  3RAQ A;  4KTQ A;  5KFR A;  4TUS A;  7ICO A;  3UPQ A;  2BCU A;  1KDH A;  4ELU A;  3GV5 B;  4QZI A;  4M2Y A;  1ZQC A;  5J0S A;  2C2R A;  2DPJ A;  8ICH A;  3PV8 A;  4X5V A;  2FLP A;  2AJQ A;  2ZJA A;  8ICV A;  4DQR A;  3TI0 A;  3RJE A;  4F5Q A;  1JIH A;  1L3V A;  4DEZ A;  4R63 A;  3V7J A;  3BQ0 A;  4J9R A;  4KLL A;  1X9W A;  5IIM A;  2HHX A;  3IHQ B;  5J2J A;  4YQW A;  4B9L A;  4KMU A;  3H7I A;  4BGD A;  4O0I A;  3OSN A;  1S76 D;  3H8J A;  7ICV A;  4RQ8 A;  3T5K A;  3PW0 A;  3RJJ A;  1T8E A;  1RYS A;  2ZUD A;  2BPG A;  1KFS A;  1ZQZ A;  1ZQR A;  4RNO A;  7ICN A;  5DBC A;  4UAY A;  5KFM A;  5L1I A;  5KT5 A;  3AU2 A;  2MAX A;  3C21 A;  3MR3 A;  4ED0 A;  2OWO A;  4DQI A;  7ICM A;  4Z6E A;  2V4R A;  9ICL A;  4DS4 A;  1ZET A;  3GV7 B;  4DF8 A;  4NXZ A;  3PW4 A;  5BOM A;  7ICE A;  2VA8 A;  5J0O A;  2XGP A;  4I2C A;  2ZUB A;  5J0P A;  1NOM A;  1A76 A;  4B9N A;  2FMP A;  3HP6 A;  1NK5 A;  5DLF A;  2KZ3 A;  1TV9 A;  3H4D A;  8ICF A;  3KHH A;  5CJ7 A;  5KTQ A;  3NTU A;  2PFO A;  4J9Q A;  4J9O A;  1ZQS A;  1Z00 A;  4YXJ A;  2XC9 A;  5KFY A;  4QZ9 A;  3MR5 A;  3H4B A;  5KT2 A;  4EZ6 A;  3V6K A;  4DQQ A;  4FBT A;  8ICY A;  2V4Q A;  4DL3 A;  4Q8E A;  2HHT A;  3C23 A;  3MDC A;  3M9M B;  5KFX A;  4IR1 A;  4QWE A;  1XSP A;  1B43 A;  4DS5 A;  3MDA A;  5KFP A;  4R8U A;  2HHW A;  3RH4 A;  1S0M A;  4M0A A;  2W9B B;  1NKB A;  4J9N A;  2BCR A;  4I2J A;  8ICI A;  4F5O A;  3BJY A;  2KTQ A;  4DL6 A;  4F4K A;  3LWL A;  2PFQ A;  2JZB A;  4O3O A;  3RAX A;  4QZG A;  1QTM A;  4M9G A;  2F1H A;  4RUA A;  5HHI A;  5DQG A;  5KFJ A;  4DLE A;  1RXW A;  4O5K A;  5CP2 A;  2Y1I A;  3GFK B;  7ICL A;  4MEX A;  2XCA A;  1NJY A;  1ZJM A;  4UB3 A;  3MBY A;  4J9L A;  3K75 D;  4ED3 A;  1LB2 B;  8ICK A;  3ORY A;  4J9S A;  5J0X A;  3PR5 B;  4E0D A;  2F1I A;  2BDP A;  5J2F A;  4O5E A;  2BPF A;  2JEF A;  8ICT A;  4TQS A;  3JPR A;  3EYZ A;  2FLN A;  4EEY A;  3M8R A;  2WTF A;  4BXO A;  4YXM A;  2ZTD A;  4PGQ A;  2ISP A;  2AGP A;  4ECU A;  4MFC A;  2W8L A;  4KLU A;  1ZQJ A;  1HUO A;  4KLM A;  1ZQX A;  8ICM A;  2KN7 A;  4IQW A;  1SKR A;  1HJP A;  5KG3 A;  3KHG A;  3OJU A;  1ZQG A;  4JWN A;  4DL5 A;  3PR4 A;  1JXE A;  4DOC A;  4DQS A;  3Q8S B;  1BVS A;  4QZB A;  2W8K A;  1MSW D;  2R8I A;  4CCH A;  4R66 A;  3SZ2 A;  2FMQ A;  3PW5 A;  1NK6 A;  9ICS A;  1KEJ A;  4QZD A;  4YR0 A;  4O3R A;  1Y88 A;  8ICN A;  1SL0 A;  2HW3 A;  2MUT B;  3V72 A;  4IQU A;  2V9W A;  9ICG A;  5KFG A;  5KG0 A;  5KT7 A;  4ECS A;  9ICE A;  4I2D A;  3RB3 A;  1XSN A;  1KLN A;  1SL2 A;  2ZJ5 A;  2R8G A;  1ZQW A;  4UB4 A;  3LWM A;  3RB0 A;  4I29 A;  9ICU A;  5DLG A;  5KFC A;  4JK1 A;  2AU0 A;  4KLT A;  4ED1 A;  1IM4 A;  1ZQE A;  1KSP A;  3LDA A;  4Z6C A;  3RB4 A;  3PW2 A;  5CB1 A;  4YN4 A;  4DSI A;  1H38 A;  8ICR A;  4IQT A;  4LZG A;  4ED8 A;  3PX4 A;  2XGQ A;  4F2R A;  5KFK A;  4J9K A;  4PPX A;  4I27 A;  1N48 A;  1U47 A;  4F50 A;  4DFM A;  3HX0 A;  3MR2 A;  3TAQ A;  4ECV A;  2AGO A;  1BPZ A;  2PXI A;  5KG1 A;  3ZD8 A;  3T5J A;  5D49 A;  5DBA A;  4G3I A;  4GC7 A;  2H5X A;  1PZN A;  2HHU A;  1S9F A;  4YR3 A;  2I1Q A;  3OHB A;  5D46 A;  4QZ8 A;  1X2I A;  5IIN A;  2UVV A;  3KTQ A;  5L1K A;  2ZTC A;  4YMM A;  1U48 A;  4I2I A;  5KFA A;  1ZQA A;  4KLS A;  4J9P A;  2HHV A;  3ISC A;  3M8S A;  4DQP A;  4I2F A;  3THV A;  3C2L A;  3TQ1 A;  4Z6F A;  5DB6 A;  2C22 A;  4F92 B;  4Z6D A;  4IRK A;  8ICS A;  3B0X A;  4O3N A;  3HW8 A;  1UA0 A;  1L3S A;  5KFH A;  2BR0 A;  2KFN A;  5KG4 A;  4PGY A;  1ZQY A;  3UXO A;  4QWC A;  9ICW A;  1K1Q A;  2M9N A;  5BOL A;  1NK0 A;  1MQ3 A;  1BPX A;  4RQ6 A;  4R65 A;  4ECY A;  3JPP A;  8ICJ A;  2AQ0 A;  5HHH A;  4B9U A;  1X9M A;  4K4H A;  4TUP A;  2C2E A;  4YD2 A;  4O3Q A;  2BQ3 A;  8ICA A;  4F4Y A;  3C5F A;  2HHS A;  5DG9 A;  4F8R A;  7ICG A;  5BPC A;  4F5N A;  1S0N A;  5J0R A;  4QWA A;  3JPN A;  5J29 A;  4QWD A;  3V7L A;  4KN4 A;  3ZD9 A;  5KFB A;  4XQ8 A;  3BQ2 A;  2BGW A;  1NKC A;  2P6U A;  1D8Y A;  4YMO A;  4DFK A;  1JX4 A;  2ISO A;  1L3T A;  4UB5 A;  5DBB A;  2ASJ A;  3G6V A;  5DQH A;  1LV5 A;  3JPO A;  3JPT A;  9ICT A;  4BWJ A;  2NRX A;  2R8K A;  5L9X A;  3QZ7 A;  3Q8K A;  8ICC A;  3ISD A;  4DO9 A;  3T5H A;  1ZQL A;  4ELV A;  1BPE A;  5JUM A;  4IRD A;  2ASL A;  3RTV A;  4EBD A;  4GC6 A;  2GWS A;  5CWR A;  4IQV A;  2B21 A;  5HML A;  2IBK A;  3T3F A;  1T3N A;  3GIK A;  1MQ2 A;  5DB8 A;  4RNM A;  5KT3 A;  4NY8 A;  3SV4 A;  1ZQB A;  3MGI A;  4JV1 A;  1NJX A;  1U4B A;  4B9T A;  4KLJ A;  1UA1 A;  1ZQT A;  5F9L A;  4DL7 A;  3FYH A;  4PHP A;  3G6X A;  4F5R A;  4KLH A;  4YG2 A;  4C8M A;  4UBC A;  1D9F A;  4NLG A;  3E2E A;  1IXR A;  4UB2 A;  5IIK A;  2FPL A;  5EOZ A;  3UQ2 A;  4DWI A;  4IRC A;  8ICL A;  3Q8L A;  2JEJ A;  2HHQ A;  3H8W A;  3IM1 A;  4DL4 A;  9ICQ A;  5KFD A;  9ICK A;  4DSL A;  3B0Y A;  4ECZ A;  4PHD A;  4M9N A;  1B22 A;  4LZD A;  5J2E A;  5IIL A;  2F1J A;  4BDP A;  4RT3 A;  3GIM A;  4EYI B;  1CEZ A;  4ZH4 A;  2W9C A;  4PH5 A;  2A1J A;  4B9V A;  4M6W A;  4I2G A;  1SL1 A;  3PO4 A;  4F2S A;  4YCX A;  4K4I A;  2XY6 A;  3BQ1 A;  4KLE A;  4RQ1 A;  1S0O A;  4GXK A;  5F9N A;  2ZUC A;  4XA5 A;  4UQG A;  1KRP A;  4NM2 A;  5EWG A;  1UT8 A;  4BWM A;  5J2D A;  4DFP A;  1ZQF A;  2AGQ A;  4EZ9 A;  4KLQ A;  5L1J A;  1ZJN A;  2ASD A;  4C8K A;  3RB6 A;  4UAW A;  4EBC A;  2HVH A;  9ICF A;  2XY5 A;  3Q8Q B;  2XCP A;  5KFQ A;  9ICN A;  1JMS A;  1NK9 A;  4RPX A;  4FS2 A;  1ZQQ A;  1NK4 A;  5KT4 A;  3BQT A;  5KFU A;  5TZV A;  3Q8R B;  4KLF A;  4LVS A;  5J0Q A;  5CHG A;  4F4X A;  3OGU A;  4F3O A;  1CUK A;  4IR9 A;  1T7P A;  4P2H A;  9ICI A;  1WCL A;  4O9M A;  2RDJ A;  4DSF A;  4R8U B;  4I2A A;  2C28 A;  2JZB B;  4JUZ A;  4DOA A;  4PGX A;  3RR7 A;  1X9S A;  1COO A;  3C1Y A;  2R8H A;  3GDX A;  4F93 B;  9ICB A;  3KHL A;  3RJI A;  4KN7 A;  2BCV A;  2PI4 A;  7ICK A;  4ELT A;  5KFZ A;  1UT5 A;  4ED2 A;  4JV2 A;  1ZYQ A;  1NJZ A;  1ZQN A;  4UBB A;  8ICZ A;  3AUO A;  1K1S A;  1WCN A;  2RDI A;  3GV8 B;  4YVZ A;  4P4O A;  2VAN A;  3H8S A;  5KFL A;  5C5J A;  2ATL A;  4Q8F A;  4JV0 A;  1N56 A;  1SZP A;  2UVR A;  1TK8 A;  4GXJ A;  4BXO B;  2IA6 A;  1ZQI A;  3K4G A;  4KIT B;  4FO6 A;  4M9J A;  5IIO A;  4M04 A;  8ICB A;  4QZH A;  7ICJ A;  8ICU A;  5DKW A;  4NLN A;  5CA7 A;  4QW8 A;  5J2G A;  9ICA A;  3ZDC A;  3M9O B;  5J0T A;  5HNK A;  1RPL A;  4YP3 A;  3V6H A;  1XSL A;  2HVI A;  3PX6 A;  4QZE A;  4F4Z A;  3RH6 A;  1TAU A;  4NLZ A;  3PML A;  9ICH A;  2JEG A;  1U9L A;  1ZQU A;  1V9P A;  4ECX A;  2BHN A;  1NK7 A;  5DG7 A;  3N4M B;  1C7Y A;  2PFN A;  3ZDB A;  3RJF A;  1BPD A;  1NJW A;  5DGB A;  3MFH A;  9ICM A;  5CR0 A;  3RJG A;  2ALZ A;  2VA3 A;  4RQ3 A;  3M9N B;  3ETL A;  4MFF A;  8ICQ A;  9ICV A;  3MR6 A;  4P4M A;  4TUQ A;  3G6Y A;  4FS1 A;  1KFT A;  2IHM A;  1ARO P;  5KFO A;  9ICR A;  2Y1J A;  4PHA A;  4ECW A;  3T5L A;  5J2C A;  1ZQO A;  8ICX A;  4C8N A;  4KLI A;  4RPY A;  3V6J A;  4RQ0 A;  9ICO A;  3LK9 A;  4ED7 A;  4M47 A;  4MF2 A;  8ICP A;  4C8L A;  2UVU A;  5IIJ A;  3C2K A;  2IMW P;  5J0Y A;  1RXV A;  9ICC A;  3EW9 A;  4RNN A;  3AU6 A;  5J2K A;  4Q43 A;  2KZM A;  3V7K A;  4NLK A;  4F5P A;  4MEY A;  2UVW A;  2W9B A;  1ZQP A;  3BDP A;  3RRG A;  2W9A A;  4RZR A;  4RQ7 A;  3TAN A;  4ECT A;  1ZQH A;  4KLG A;  7ICI A;  3GII A;  1EXN A;  3OHA A;  3MGH A;  4DFJ A;  4EYH B;  4P4P A;  1XO1 A;  5DDY A;  2IHN A;  3PNC A;  2W9M A;  5KFE A;  3EPI A;  3RRH A;  4RQ5 A;  1TAQ A;  4PHE A;  4UB1 A;  5KFF A;  5L1L A;  4GLX A;  7ICU A;  4RQ2 A;  3RBD A;  2J6T A;  4RPZ A;  1QSY A;  3HPO A;  1S97 A;  3Q8M A;  2P6R A;  4KLO A;  3TAP A;  1XS9 D;  1TKD A;  4DF4 A;  4Q44 A;  7ICF A;  3C2M A;  3SYZ A;  2FMS A;  1QSL A;  3QEB Z;  3QEA Z;  1JN3 A;  9ICX A;  2FPK A;  1QLN A;  2VA2 A;  3JPS A;  5EWE A;  5J2H A;  1BPY A;  2ZTE A;  3SV3 A;  4B9M A;  3PW7 A;  3N97 B;  3NGD A;  1XU4 A;  4HYK A;  4ECQ A;  4K4G A;  1XWL A;  4I2E A;  9ICP A;  3PMN A;  4R64 A;  2J6S A;  5HMM A;  5KT6 A;  5DG8 A;  3GQC A;  3UQ0 A;  1TVA A;  1ZQK A;  3PY8 A;  4KLD A;  2R8J A;  8ICO A;  1NK8 A;  1JXL A;  1S0V A;  3ZDA A;  5D4B A;  4Q45 A;  2MUT A;  4F4W A;  3OJS A;  5J2B A;  4O5C A;  5DB7 A;  4ECR A;  7ICR A;  2NRW A;  4RU9 A;  3TFR A;  4I2H A;  4I2B A;  1TFR A;  4O3S A;  5KG5 A;  5HP4 A;  1S77 D;  1TK5 A;  1MC8 A;  8ICW A;  3OSP A;  2BQU A;  1RYR A;  3HT3 A;  9ICJ A;  1BGX T;  3EZ5 A;  3SI8 A;  5KG7 A;  3PX0 A;  3QE9 Y;  1U45 A;  5J2I A;  2BCS A;  3ZDD A;  4DSK A;  2AQ4 A;  2ZJ8 A;  5J0W A;  3GIL A;  7ICQ A;  5DDM A;  4EBE A;  1Z00 B;  5J2A A;  4QW9 A;  5KFW A;  2P66 A;  2KFZ A;  2I9G A;  2XO7 A;  2KZZ A;  2XY7 A;  2JEI A;  3UXP A;  4QZC A;  5III A;  5EWF A;  8ICG A;  3H40 A;  5DGA A;  7ICP A;  4QZF A;  2DFL A;  1NKE A;  2NRZ A;  4XRH A;  3Q8P B;  1T4G A;  1U49 A;  2PFP A;  8ICE A;  1KTQ A;  5DQI A;  7ICT A;  2LYH A;  4O3P A;  2DPI A;  3FDS A;  1DGS A;  7ICS A;  3UXN A;  3KHR A;  1RZT A;  4M9L A;  3EWA A;  1A77 A;  5J0U A;  4F91 B; 
#chains in the Genus database with same CATH topology
 3DDH A;  4XUS A;  2DBY A;  1GO3 F;  2BQR A;  1SKW A;  4MF8 A;  2JR5 A;  2BCQ A;  1RG6 A;  4UAT A;  2BKE A;  3BZC A;  1ZQD A;  3QX7 A;  1XC9 A;  3HWT A;  1BPB A;  4RQ4 A;  3MAB A;  4DOB A;  3KBB A;  2L5Y A;  4B9S A;  4RT2 A;  5DB9 A;  2KVC A;  5JU5 A;  2ZIU A;  5ALE A;  5ALN A;  4KMO B;  4YFK A;  1SWV A;  1D9D A;  3SEI A;  3C5G A;  3GU3 A;  2BCU A;  3HKZ C;  3IG8 A;  5J0S A;  2DPJ A;  2H3I A;  2AJQ A;  2JMG A;  4AP9 A;  4R63 A;  3CP8 A;  2VIX A;  5IIM A;  5ALD A;  3F53 A;  2RLT A;  1AQ6 A;  1ZD5 A;  3S6J A;  2BPG A;  7ICN A;  4BJQ A;  4UAY A;  3AU2 A;  2MAX A;  2WF7 A;  1WYG A;  4NXZ A;  7ICE A;  3PSP A;  5BOM A;  1DK2 A;  1LVH A;  5J0P A;  2Q4T A;  1NK5 A;  1TV9 A;  3TAC B;  1PVQ A;  3BS5 B;  2VKQ A;  3NTU A;  1SWW A;  4J9Q A;  2HBL A;  5KFY A;  4QZ9 A;  3H4B A;  3V6K A;  4DQQ A;  5KL8 B;  1J2M A;  2G06 A;  2GOL A;  3C23 A;  4OCZ A;  3E58 A;  4IR1 A;  1B43 A;  4DS5 A;  4M0A A;  8ICI A;  4I2J A;  5T14 A;  3BJY A;  4F5O A;  3LWL A;  4QZG A;  3AMZ A;  5AM0 A;  2F1H A;  5DQG A;  5KFJ A;  4DLE A;  4O5K A;  5CP2 A;  2Y1I A;  3GFK B;  4MEX A;  4UB3 A;  2ZG6 A;  5JRT A;  2E8O A;  2KSO A;  5AHX A;  2JEF A;  8ICT A;  1V38 A;  5AI5 A;  2ZTD A;  2W8L A;  4KLU A;  2K4E A;  3NS1 A;  4JWN A;  4O3M A;  2ES6 A;  3Q8S B;  1BVS A;  1MSW D;  2R8I A;  5ALS A;  4R66 A;  2W04 A;  1NK6 A;  1Y88 A;  1RQL A;  1PVP A;  3V72 A;  5AM2 A;  5KG0 A;  1XSN A;  1SL2 A;  1S5L U;  9ICU A;  5DLG A;  3IN5 A;  2AU0 A;  4ED1 A;  3AN1 A;  3ED5 A;  3RB4 A;  4YN4 A;  1Q3V A;  2XGQ A;  5KFK A;  2HBJ A;  1JRO A;  2MRL A;  1U47 A;  2YX8 A;  3TAQ A;  4ECV A;  2PXI A;  5DBA A;  3F5E A;  4GC7 A;  2H5X A;  2HHU A;  4YR3 A;  3OHB A;  4QZ8 A;  5IIN A;  3KTQ A;  2PKE A;  4YMM A;  1ZQA A;  2KJ8 A;  4I2F A;  3M8S A;  3C2L A;  3TQ1 A;  4FE3 A;  2C22 A;  5ALJ A;  3QU4 A;  1L3S A;  5KFH A;  2BR0 A;  2XI9 A;  3N28 A;  1ZRN A;  5HHH A;  4B9U A;  3TAD C;  2W7P A;  1FO4 A;  2HBK A;  5DG9 A;  4U6P A;  2HHS A;  4F5N A;  3JPN A;  4QWD A;  4KN4 A;  1HIW A;  5J8Y A;  2A19 A;  2K8B B;  3QU7 A;  4YMO A;  1JX4 A;  4KX5 A;  4UB5 A;  3SD7 A;  5DQH A;  9ICT A;  2NRX A;  2R8K A;  2KK0 A;  3QZ7 A;  8ICC A;  1ZQL A;  2ZIV B;  2GWS A;  5AK6 A;  4IQV A;  4GIB A;  3MGV A;  5DB8 A;  2F44 A;  4RNM A;  4NY8 A;  1ZQB A;  3ONN A;  1NZP A;  4B9T A;  4PHP A;  3G6X A;  3E2E A;  4UBC A;  1D9F A;  2DGZ A;  5EOZ A;  4DWI A;  1Z1V A;  4IRC A;  2HHQ A;  9ICK A;  4PHD A;  4LZD A;  4RT3 A;  2W9C A;  4B9V A;  1QQ6 A;  1JAL A;  1SL1 A;  1MN8 A;  1OXJ A;  4RQ1 A;  1PK1 B;  2G08 A;  4NWI A;  5F9N A;  2ZUC A;  1UT8 A;  1ZJN A;  5AM5 A;  4EBC A;  2HVH A;  9ICF A;  4UW9 A;  5KNI A;  2G5I B;  2IOF K;  5TZV A;  2VJ4 A;  3Q8R B;  4KLF A;  4EX6 A;  2NO4 A;  5CHG A;  2KOB A;  5EE1 A;  2ZIX A;  1SV0 C;  2C28 A;  1TE2 A;  2JZB B;  5EE9 A;  4F93 B;  4KN7 A;  2BCV A;  2YY6 A;  5AI6 A;  1ZYQ A;  3B9J A;  4UBB A;  1K1S A;  1WCN A;  3H8S A;  3SAG A;  1SZP A;  3QUT A;  4BXO B;  2IA6 A;  4M04 A;  4M9J A;  5IIO A;  7ICJ A;  5DKW A;  4NLN A;  5CA7 A;  2E1F A;  4OD0 A;  1TAU A;  1RDF A;  5AKZ A;  1NK7 A;  4ECX A;  1NJW A;  5DGB A;  5ALP A;  3RJG A;  9ICV A;  5KFO A;  9ICR A;  3IRU A;  2WHE A;  8ICX A;  4C8N A;  4KLI A;  4RPY A;  4ED7 A;  4M47 A;  4MF2 A;  4C8L A;  1VDV A;  2N1R A;  4NLK A;  2UVW A;  2P35 A;  2KJ5 A;  2W9A A;  4RZR A;  4RQ7 A;  1PUZ A;  4ECT A;  2GH1 A;  1K5O A;  1L8O A;  1EXN A;  3MGH A;  3K1R B;  5DDY A;  2KKV A;  3WKC A;  4RQ5 A;  1QSY A;  5AI0 A;  2P6R A;  1TKD A;  4Q44 A;  1JN3 A;  1X42 A;  3JPS A;  5J2H A;  4UAU A;  2NYV A;  4K4G A;  1ECW A;  4I2E A;  9ICP A;  4R64 A;  3UQ0 A;  3PY8 A;  8ICO A;  3M7D A;  4C7Y A;  5D4B A;  4Q45 A;  5J2B A;  2NRW A;  1S77 D;  4I2H A;  4I2B A;  2DUY A;  2KIC A;  5KAF U;  4Y2S A;  1D8B A;  1BGX T;  2ZXI A;  4DSK A;  5J0W A;  2H3Q A;  1T3Q A;  3L3F X;  2HDO A;  5DDM A;  1KBU A;  1FEZ A;  5III A;  8ICG A;  5ALM A;  4CF4 A;  3TAD A;  1P7D A;  4QZF A;  2KE7 A;  2BDU A;  4XRH A;  1T4G A;  3WU2 U;  1KL9 A;  1KTQ A;  4P0P B;  2DPI A;  2JRZ A;  3FDS A;  3UXN A;  1RZT A;  3DEE A;  3EWA A;  3SAH A;  4IR9 A;  3NRZ A;  1DK3 A;  4TUR A;  3TAR A;  2NRV A;  2FMP A;  3EPG A;  4DSE A;  3JPQ A;  1RM6 C;  5KFV A;  1ZQM A;  5KG6 A;  1X9X A;  2FLL A;  1ZQ1 C;  4CRX A;  1ZRM A;  4I28 A;  1Z3E B;  1N5W A;  5KFI A;  1M6Y A;  4YMN A;  4Y2J A;  4NM1 A;  3TFS A;  2YB4 A;  4Y2U A;  2NRT A;  1FIQ A;  2CRX A;  3RBE A;  2A1A A;  4M9H A;  1PK3 A;  2J6U A;  3RJK A;  3RJH A;  4FFD A;  5KFT A;  3RAQ A;  2KIV A;  2DWQ A;  3VCB A;  1UHU A;  4KTQ A;  2ZIW B;  3GV5 B;  1ZQC A;  2C2R A;  1LKY B;  8ICH A;  5HR7 A;  2FDR A;  3WKD A;  1L3V A;  1SXE A;  5ALR A;  5J2J A;  5AI4 A;  1S76 D;  7ICV A;  4RQ8 A;  2LI6 A;  1RYS A;  2ZUD A;  1KFS A;  1NNL A;  5DBC A;  5KFM A;  5KT5 A;  2W3S A;  3MR3 A;  4ED0 A;  2OWO A;  7ICM A;  3IV6 A;  4Z6E A;  4DS4 A;  3GV7 B;  4RQM A;  2VA8 A;  2YN4 A;  2HOI A;  1A76 A;  2HBM A;  1L7M A;  2VJ5 A;  3SQI A;  2KZ3 A;  2G09 A;  2PFO A;  2G5H B;  1ZQS A;  3MR5 A;  1QQ5 A;  4FBT A;  2HHT A;  4DL3 A;  3MDC A;  1KN5 A;  2EZY A;  3RH4 A;  1S0M A;  2W9B B;  2KTQ A;  4F4K A;  4O3O A;  1QTM A;  5HHI A;  1RXW A;  1NJY A;  2NO5 A;  1ZJM A;  2GLE A;  4J9S A;  5J0X A;  3PR5 B;  4E0D A;  5J2F A;  1JUD A;  4TQS A;  3JPR A;  3EYZ A;  2FLN A;  2WF9 A;  5J8Y C;  4YXM A;  2QB0 A;  4MFC A;  4IQW A;  1SKR A;  1HJP A;  2G07 A;  5KG3 A;  3KHG A;  3QUB A;  4DQS A;  3GZF A;  3KOO A;  3NVZ A;  4QZB A;  4CCH A;  4HAI A;  3SZ2 A;  1KEJ A;  3QUQ A;  5AKG A;  2HW3 A;  1RQN A;  4IQU A;  4FZL A;  9ICE A;  2K89 A;  1KLN A;  2OHF A;  4UB4 A;  4I29 A;  4JK1 A;  4P0Q A;  3KD3 A;  1L6N A;  1IM4 A;  3LDA A;  4A8E A;  3PW2 A;  5CB1 A;  2LYB A;  8ICR A;  4F2R A;  4PPX A;  3MR2 A;  1C20 A;  1BPZ A;  4NJ8 A;  3HJE A;  3T5J A;  5D49 A;  2Y9U A;  2I1Q A;  5D46 A;  1CI4 A;  2UVV A;  5L1K A;  1U48 A;  2HHV A;  3WK9 A;  3ISC A;  4DQP A;  3THV A;  5DB6 A;  2GO7 A;  4IRK A;  2OH2 A;  1X6I A;  1K1Q A;  2M9N A;  5BOL A;  1NK0 A;  4RQ6 A;  4ECY A;  8ICJ A;  5H2F U;  2AQ0 A;  4TUP A;  1X6J A;  1QCK A;  2BQ3 A;  8ICA A;  5K4L A;  4QWA A;  2EAM A;  3KKA A;  2BGW A;  1NKC A;  2P6U A;  1D8Y A;  4DFK A;  5ALT A;  2ISO A;  5DBB A;  3JPT A;  3Q8K A;  4DO9 A;  3T5H A;  3ZI4 A;  5JUM A;  3RTV A;  4EBD A;  2F8K A;  2B21 A;  2IBK A;  5AI9 A;  2RHF A;  3GIK A;  1N61 A;  5KT3 A;  3MGI A;  1F44 A;  2O6K A;  4KLJ A;  1U4B A;  1ZQT A;  1N2X A;  3FYH A;  4C4S A;  4UB2 A;  2W3R A;  4Y2P A;  3H8W A;  3HKZ F;  3IM1 A;  4DL4 A;  3B0Y A;  4ECZ A;  1B22 A;  4BDP A;  3GIM A;  3K1Z A;  4ZH4 A;  1CRX A;  1NZB A;  4YCX A;  2XY6 A;  2K8C B;  4RQN A;  2WF8 A;  5ALF A;  5TIS U;  4GXK A;  1S0O A;  4EEN A;  5EWG A;  4DFP A;  2OM6 A;  1ZQF A;  5L1J A;  5AKI A;  4C8K A;  3RB6 A;  1O03 A;  3Q8Q B;  2QB1 A;  3MC1 A;  2XCP A;  2IOF A;  9ICN A;  5AKX A;  2EDU A;  4LVS A;  3OPX A;  4C0Z A;  3OGU A;  1CUK A;  4F3O A;  1T7P A;  4P2H A;  1WCL A;  4DSF A;  4R8U B;  3F5A A;  5ALK A;  3CW2 C;  3TKA A;  4NLC A;  4DOA A;  1COO A;  3N7S C;  3GDX A;  1O08 A;  3RJI A;  4ELT A;  5KFZ A;  4ED2 A;  1NJZ A;  1ZQN A;  1SZH A;  2AXT U;  3AQF A;  3T79 A;  2VAN A;  2ATL A;  4MHV A;  1SIJ A;  4Y2X A;  2UVR A;  5AM4 A;  4GXJ A;  2ZXH A;  1ZQI A;  8ICB A;  4G9B A;  3AM9 A;  8ICU A;  4QZH A;  3ZDC A;  4YP3 A;  4NLZ A;  3PML A;  2D8C A;  5DG7 A;  1C7Y A;  3ZDB A;  2LPE A;  5B5E U;  9ICM A;  3IP4 B;  4UB8 U;  2ALZ A;  2VA3 A;  4RQ3 A;  4Y2T A;  1Q46 A;  2EZZ A;  3HIL A;  3MR6 A;  3BS5 A;  2RQ5 A;  3T5L A;  1F5S A;  2W55 A;  3V6J A;  9ICO A;  4Y2Q A;  3LK9 A;  3C2K A;  2IMW P;  1RXV A;  5J2K A;  4Q43 A;  2KZM A;  3V7K A;  1IIP A;  1SB3 C;  1ZQP A;  3BDP A;  1N60 A;  4KLG A;  7ICI A;  1FFU A;  3LVV A;  5ALW A;  2LM4 A;  2IHN A;  3PNC A;  1UPH A;  5KFE A;  4FZN A;  3EPI A;  4PHE A;  4UB1 A;  5L1L A;  3RBD A;  4USA A;  1S97 A;  3Q8M A;  2JXJ A;  1XS9 D;  4DF4 A;  3N7P D;  1J2N A;  2YQE A;  2KHQ A;  3QEB Z;  3QEA Z;  1QSL A;  2FPK A;  3LYS A;  5EWE A;  2EQY A;  2ZTE A;  3SV3 A;  4B9M A;  1XNS A;  3NGD A;  1XU4 A;  4ECQ A;  4OJO A;  5KT6 A;  1TVA A;  3GQC A;  2HCF A;  4KLD A;  1JXL A;  3ZDA A;  2Y0S C;  4AYB C;  4O5C A;  5DB7 A;  4ECR A;  7ICR A;  2YML A;  4O3S A;  1TFR A;  5HP4 A;  2BQU A;  2ODG A;  3HT3 A;  5AKL A;  3QE9 Y;  3SMV A;  3ZDD A;  2AQ4 A;  2ZJ8 A;  2CXY A;  3PST A;  1Z00 B;  4QW9 A;  2KFZ A;  1UQV A;  2XY7 A;  3NVW A;  5DGA A;  2JH7 A;  4DFD A;  2NRZ A;  8ICE A;  2LYH A;  2Z7J A;  3FAH A;  3H0M B;  4FZM A;  4C4R A;  5J0U A;  2LHT A;  4C8O A;  5AKY A;  4GXI A;  4FBU A;  2PMZ C;  2A1J B;  4M6W B;  7ICH A;  2PI5 A;  5KFS A;  1QSS A;  4UAZ A;  3GIJ A;  5ALO A;  4UAR A;  5CEH A;  1L5U A;  3OTQ A;  3ZDE A;  4QWB A;  4NV0 A;  2FI1 A;  3SR6 A;  4JWM A;  2Y0S F;  2FE9 A;  4AYB F;  4YD1 A;  4DLG A;  3C1Z A;  1TK0 A;  3PVX A;  3C29 A;  1S10 A;  1KFD A;  3ISB A;  1DOQ A;  4QIW C;  2ZIV A;  3UPQ A;  1KDH A;  5ALV A;  4QZI A;  5ALZ A;  2YMP A;  3PV8 A;  3ETR A;  2W03 A;  2ZJA A;  8ICV A;  4DQR A;  3TI0 A;  3RJE A;  4F5Q A;  1JIH A;  4KLL A;  2HHX A;  4PL1 A;  1V85 A;  3V7J A;  1X9W A;  4UAS A;  4YQW A;  4B9L A;  2F77 X;  4KMU A;  3H7I A;  4CGZ A;  4BGD A;  2K4I A;  4JB3 A;  3PW0 A;  3RJJ A;  2KD1 A;  1ZQZ A;  3QYP A;  3C21 A;  4F71 A;  3CYM A;  4DQI A;  2PMZ F;  2V4R A;  9ICL A;  2KVS A;  2YTU A;  5J0O A;  2XGP A;  1PK1 A;  3WKE A;  4I2C A;  2EAP A;  5EE3 A;  1UCV A;  3HP6 A;  1A0P A;  5KTQ A;  1F0M A;  4J9O A;  1Z00 A;  2OYY A;  5ALQ A;  4YXJ A;  2XC9 A;  3QU2 A;  5KT2 A;  3WK4 A;  4Q8E A;  2WF5 A;  3H0R B;  2DL0 A;  3M9M B;  5KFX A;  4QWE A;  1XSP A;  3MDA A;  3HRD D;  4QIW F;  2BCR A;  4J9N A;  2PFQ A;  2LKY A;  2JZB A;  3RAX A;  2F8L A;  3RFA A;  7ICL A;  2XCA A;  1LB2 B;  4ED3 A;  3MBY A;  3UM9 A;  3L4P A;  3VC8 A;  4OO1 J;  3KKA C;  4QJF B;  1V97 A;  2WTF A;  3M8R A;  4BXO A;  2AGP A;  4KLM A;  5E79 U;  2KN7 A;  1ZQG A;  2EAO A;  3PR4 A;  4DOC A;  3PW5 A;  9ICS A;  4O3R A;  8ICN A;  4DCC A;  1WWV A;  1SL0 A;  2MUT B;  5KAI U;  2V9W A;  5ALL A;  5KFG A;  9ICG A;  5ALU A;  5ALG A;  3RB3 A;  2ZJ5 A;  2R8G A;  1ZQW A;  4KLT A;  2CPR A;  1ZQE A;  1KSP A;  4IQT A;  4WJ3 B;  2KEY A;  4J9K A;  1L7P A;  1N48 A;  4I27 A;  4F50 A;  1OUQ A;  3HX0 A;  2AGO A;  1PZN A;  1S9F A;  1OW5 A;  2QLT A;  2ZTC A;  2KV2 A;  4F92 B;  4Z6D A;  8ICS A;  3B0X A;  3HW8 A;  1UA0 A;  1ZOL A;  1N5X A;  2KFN A;  5KG4 A;  1ZQY A;  1BPX A;  1JI7 A;  2C2E A;  4YD2 A;  4O3Q A;  4CF5 A;  1WWU A;  1S0N A;  5J0R A;  4OJ5 A;  3V7L A;  3ZD9 A;  5KFB A;  4XQ8 A;  3WK8 A;  1VLB A;  2DKX A;  3PZP A;  1BPE A;  2ZIU B;  2ASL A;  4GC6 A;  2DF4 B;  3ALR A;  5HML A;  3T3F A;  1T3N A;  1MQ2 A;  3SV4 A;  3I76 A;  5ALY A;  1NJX A;  5HR6 A;  2EAN A;  4DL7 A;  4F5R A;  4KLH A;  4NLG A;  4C8M A;  4P0P A;  5CRX A;  3A0B U;  3QXG A;  4KX3 A;  3UQ2 A;  2K4P A;  2JEJ A;  9ICQ A;  4DSL A;  2WAQ C;  4PL2 A;  4M9N A;  5AK5 A;  5J2E A;  5IIL A;  1J97 A;  1KKX A;  2F1J A;  4EYI B;  1CEZ A;  2AH5 A;  4PH5 A;  2E3T A;  3PO4 A;  3BQ1 A;  5AKJ A;  1IG6 A;  4XA5 A;  4LJX A;  1KRP A;  4NM2 A;  5J2D A;  3SAF A;  3I1Y A;  2AGQ A;  3WK5 A;  4KLQ A;  4GFJ A;  4J03 A;  1URJ A;  3LVW A;  5KFQ A;  2R18 A;  1JMS A;  1NK9 A;  4RPX A;  4FS2 A;  2E1E A;  3BQT A;  5J0Q A;  4F4X A;  2RDJ A;  2JH1 A;  4I2A A;  2ZIW A;  3FC4 A;  2AHO B;  1S8O A;  1LKY A;  9ICB A;  3KHL A;  1UT5 A;  4JV2 A;  1RYU A;  2KSO B;  5AK3 A;  4YVZ A;  1Z4N A;  5C5J A;  2OCE A;  4Q8F A;  4B6J A;  5AI8 A;  1TK8 A;  4CE6 A;  3K4G A;  5AKE A;  2WAQ F;  3IG5 A;  4C7Z A;  9ICA A;  5HNK A;  2HVI A;  3V6H A;  2LMR A;  4F4Z A;  2EZX A;  9ICH A;  2Y9T A;  1U9L A;  1ZQU A;  2F2A B;  1BPD A;  5ALH A;  2H3V A;  1DXS A;  4NL9 C;  4Y2V A;  3M9N B;  3ETL A;  4MFF A;  8ICQ A;  3G6Y A;  2W11 A;  4P4M A;  4TUQ A;  1KFT A;  2G0A A;  1ARO P;  2F76 X;  3WKA A;  5J2C A;  1ZQO A;  3D2N A;  2LBO A;  3WK7 A;  3D2Q A;  3AU6 A;  5AM3 A;  3BQ7 A;  3QU5 A;  3NAS A;  4F5P A;  3PSI A;  2W9B A;  3RRG A;  1VJ5 A;  3RF9 A;  3TAN A;  3F2B A;  1ZQH A;  2B0C A;  1B4F A;  4DFJ A;  1XO1 A;  1KQQ A;  4GLX A;  2MSN A;  5KFF A;  4RQ2 A;  4RPZ A;  3HPO A;  4KLO A;  3TAP A;  4CF3 A;  3C2M A;  2FMS A;  2F3N A;  9ICX A;  1HEK A;  2MA1 A;  1QLN A;  2VA2 A;  1SV4 A;  3R9K A;  4HYK A;  3U26 A;  2J6S A;  5HMM A;  5DG8 A;  1ZQK A;  4QNL A;  2R8J A;  4BX9 C;  4F4W A;  3OJS A;  1ZD3 A;  4RU9 A;  3TFR A;  1YZ6 A;  8ICW A;  1MC8 A;  3OSP A;  9ICJ A;  1U45 A;  5KG7 A;  5J2I A;  2BCS A;  3GIL A;  4EBE A;  5KFW A;  3WK6 A;  2I9G A;  2KZZ A;  2JEI A;  3H40 A;  3UMG A;  2BZF A;  3Q8P B;  5DQI A;  2KG5 A;  4O3P A;  1YT3 A;  1DGS A;  7ICS A;  2XID A;  2OXO A;  2B6G A;  1WG8 A;  4CDG A;  1D8L A;  1ZQV A;  2W9C B;  1QQ7 A;  3RR8 A;  2FPM A;  2DKZ A;  5KG2 A;  3PSF A;  2Q0Z X;  4ED6 A;  3BS7 A;  4EX7 A;  1Q3U A;  4J9M A;  4DL2 A;  2C2D A;  1L3U A;  5KFN A;  3MFI A;  1HUZ A;  2BPC A;  4DSJ A;  1SKS A;  3IDW A;  4QZA A;  5JTI A;  3QZ8 A;  4TQR A;  3RH5 A;  3AEV A;  4RUC A;  4MFA A;  3PO5 A;  5B66 U;  2ZIX B;  2KIW A;  4YR2 A;  3M6Z A;  5KFR A;  1X40 A;  4TUS A;  7ICO A;  2DQN B;  4M2Y A;  4ELU A;  2W43 A;  2E8M A;  2I5H A;  1FFV A;  4X5V A;  2FLP A;  3NVV A;  3A0H U;  2M0N A;  4DEZ A;  3BQ0 A;  4J9R A;  3IHQ B;  3WKB A;  2YMM A;  4PZN A;  2XVT A;  4O0I A;  3OSN A;  5AKK A;  3H8J A;  3T5K A;  1T8E A;  1ZQR A;  4RNO A;  5L1I A;  1ZET A;  4DF8 A;  1BNO A;  3PW4 A;  3M6K A;  2MU2 A;  2ZUB A;  5AM1 A;  1NOM A;  1N62 A;  1N63 A;  1ZD2 P;  4B9N A;  5DLF A;  8ICF A;  2WB1 C;  3H4D A;  2W54 A;  3KHH A;  4ICA A;  5CJ7 A;  1ZXI A;  3QNM A;  1YZ7 A;  4EZ6 A;  8ICY A;  2V4Q A;  3QUC A;  1WUD A;  2RP5 A;  2RRD A;  5KFP A;  4R8U A;  2HHW A;  1DRG A;  1NKB A;  4DL6 A;  1COK A;  5AIA A;  4M9G A;  4RUA A;  1BNP A;  4C4T A;  4J9L A;  3K75 D;  4NL9 A;  8ICK A;  3F2C A;  3ORY A;  3J81 j;  2F1I A;  2BDP A;  4O5E A;  3L5K A;  2BPF A;  1B0X A;  4EEY A;  4PGQ A;  2ISP A;  4NLB A;  4ECU A;  1NI3 A;  4OJL A;  1HUO A;  1ZQJ A;  1ZQX A;  8ICM A;  1L8L A;  3OJU A;  4DL5 A;  1JXE A;  5AK4 A;  2D3D A;  2W8K A;  2KMD A;  2FMQ A;  2I6X A;  3QU9 A;  4QZD A;  4YR0 A;  4UB6 U;  1Q8K A;  1L7O A;  2WB1 F;  4ECS A;  5KT7 A;  4I2D A;  1MA7 A;  3RB0 A;  3LWM A;  3BZK A;  5KFC A;  4Y2Y A;  3AL0 B;  2YB1 A;  4Z6C A;  4DSI A;  1H38 A;  2QKQ A;  4LZG A;  4ED8 A;  3PX4 A;  3NVY A;  2HOF A;  2QAR B;  4DFM A;  2LYA A;  5KG1 A;  3ZD8 A;  4G3I A;  3M1Y A;  1X2I A;  2E8P A;  4KLS A;  4I2I A;  5KFA A;  3EUB 2;  4J9P A;  3E0F A;  4Z6F A;  4O3N A;  2K60 A;  1DGJ A;  3DV9 A;  3N7R C;  4PGY A;  3UXO A;  4QWC A;  1L7N A;  9ICW A;  1MQ3 A;  3I28 A;  4OJP A;  2OEH A;  1ZD4 A;  4R65 A;  3JPP A;  1X9M A;  4K4H A;  4F4Y A;  3C5F A;  4F8R A;  7ICG A;  5BPC A;  5J29 A;  3BQ2 A;  1TAM A;  1L3T A;  3D6J A;  2ASJ A;  2HI0 A;  3G6V A;  2W7O A;  1LV5 A;  3JPO A;  4BWJ A;  5L9X A;  3ISD A;  4ELV A;  1SGG A;  2HSZ A;  5AIC A;  4IRD A;  2K8A A;  2KNJ A;  5CWR A;  1XO0 A;  1JRP A;  3KZI U;  2KHV A;  4JV1 A;  3D2S A;  1UA1 A;  5GTI U;  5F9L A;  5A0L A;  4YG2 A;  1IXR A;  5IIK A;  2FPL A;  8ICL A;  3Q8L A;  2JV3 A;  5KFD A;  4U7C A;  3CRX A;  3O0F A;  4I2G A;  2A1J A;  4M6W A;  3C28 A;  4F2S A;  4K4I A;  4KLE A;  2XIC A;  2LM1 A;  3ICX A;  4JMU A;  2FJ6 A;  1ED1 A;  4EEL A;  4UQG A;  2KP7 A;  4BWM A;  4EZ9 A;  4CNQ A;  5EE0 A;  2ASD A;  5ALX A;  4OJ6 A;  4UAW A;  2WF6 A;  2XY5 A;  1SXD A;  2E5S A;  1ZQQ A;  1NK4 A;  2QAR A;  5KT4 A;  5KFU A;  3F2D A;  2K4H A;  9ICI A;  4O9M A;  5AKH A;  2A3V A;  3SEN A;  4JUZ A;  3RR7 A;  4PGX A;  1X9S A;  3C1Y A;  2R8H A;  2PI4 A;  7ICK A;  8ICZ A;  3AUO A;  2RDI A;  3GV8 B;  4P4O A;  5KFL A;  5KL1 B;  4JV0 A;  2YMQ A;  1N56 A;  4KIT B;  4FO6 A;  2QB0 B;  4QW8 A;  5J2G A;  3UMC A;  3M9O B;  5J0T A;  1RPL A;  1XSL A;  3PX6 A;  4QZE A;  3RH6 A;  3H0L B;  2JEG A;  1V9P A;  2BHN A;  3N4M B;  2PFN A;  3H8M A;  5FP0 A;  3RJF A;  1T94 A;  5AIB A;  3MFH A;  2NV3 A;  5CR0 A;  5ALI A;  2JGA A;  1IV8 A;  4ACO A;  4FS1 A;  2E8N A;  2IHM A;  1Z1B A;  2Y1J A;  4PHA A;  4ECW A;  3KFU F;  4IC9 A;  1Z19 A;  4RQ0 A;  4P0Q B;  8ICP A;  3UMB A;  2UVU A;  4Y2R A;  5IIJ A;  4US8 A;  5J0Y A;  9ICC A;  3EW9 A;  4RNN A;  3FM9 A;  5G5H A;  1PVR A;  3NUQ A;  2HMX A;  4MEY A;  2H3Z A;  4PJ0 U;  3NRW A;  1Z4O A;  3GII A;  3OHA A;  4EYH B;  4P4P A;  5L1M A;  2W9M A;  3RRH A;  3AQE A;  1KW4 A;  1TAQ A;  7ICU A;  4BUG A;  2J6T A;  2WFA A;  2JHD A;  4US9 A;  2ESE A;  4UAV A;  1SV0 A;  7ICF A;  3SYZ A;  4PZO A;  1QH9 A;  2H3F A;  1BPY A;  2CN1 A;  4EEK A;  3CNH A;  3PW7 A;  3N97 B;  2D6F C;  1XWL A;  4IS7 A;  3PMN A;  4ZOH C;  1NK8 A;  1S0V A;  4C80 A;  2MUT A;  4F72 A;  2HOQ A;  5KG5 A;  1TK5 A;  1X66 A;  2EH9 A;  1RYR A;  3EZ5 A;  3SI8 A;  3PX0 A;  7ICQ A;  5J2A A;  1A6S A;  2IOH A;  2P66 A;  4IL6 U;  2XO7 A;  5C0Y A;  3UXP A;  4QZC A;  5EWF A;  7ICP A;  5F3X B;  2DFL A;  1NKE A;  1U49 A;  2PFP A;  7ICT A;  5GTH U;  2KKP A;  3KHR A;  4M9L A;  2KJ9 A;  1A77 A;  5G5G A;  3KZX A;  4F91 B; 
#chains in the Genus database with same CATH homology
 1D8L A;  4C8O A;  1ZQV A;  4XUS A;  4GXI A;  4FBU A;  2W9C B;  2A1J B;  3RR8 A;  4M6W B;  2FPM A;  7ICH A;  2PI5 A;  5KFS A;  2BQR A;  5KG2 A;  1SKW A;  1QSS A;  4MF8 A;  2Q0Z X;  4ED6 A;  4UAZ A;  2BCQ A;  3GIJ A;  4TUR A;  3TAR A;  2NRV A;  2BKE A;  4J9M A;  4DL2 A;  2C2D A;  3EPG A;  4DSE A;  3JPQ A;  3ZDE A;  1XC9 A;  1L5U A;  1L3U A;  1ZQD A;  4QWB A;  3HWT A;  5KFN A;  1BPB A;  4RQ4 A;  3MFI A;  3MAB A;  4DOB A;  5KFV A;  1HUZ A;  1ZQM A;  5KG6 A;  2BPC A;  4DSJ A;  2FLL A;  4JWM A;  1SKS A;  4QZA A;  3QZ8 A;  4B9S A;  4TQR A;  4I28 A;  1Z3E B;  3RH5 A;  4YD1 A;  4DLG A;  3C1Z A;  1TK0 A;  4RT2 A;  5KFI A;  3PVX A;  4YMN A;  4RUC A;  1S10 A;  4NM1 A;  1KFD A;  3ISB A;  5DB9 A;  3TFS A;  4MFA A;  1DOQ A;  2NRT A;  3RBE A;  4M9H A;  3PO5 A;  4YFK A;  2J6U A;  3RJK A;  1D9D A;  3RJH A;  4YR2 A;  3C5G A;  5KFT A;  3RAQ A;  4KTQ A;  5KFR A;  4TUS A;  7ICO A;  3UPQ A;  2BCU A;  1KDH A;  4ELU A;  3GV5 B;  4QZI A;  4M2Y A;  1ZQC A;  5J0S A;  2C2R A;  2DPJ A;  8ICH A;  3PV8 A;  4X5V A;  2FLP A;  2AJQ A;  2ZJA A;  8ICV A;  4DQR A;  3TI0 A;  3RJE A;  4F5Q A;  1JIH A;  1L3V A;  4DEZ A;  4R63 A;  3V7J A;  3BQ0 A;  4J9R A;  4KLL A;  1X9W A;  5IIM A;  2HHX A;  3IHQ B;  5J2J A;  4YQW A;  4B9L A;  4KMU A;  3H7I A;  4BGD A;  4O0I A;  3OSN A;  1S76 D;  3H8J A;  7ICV A;  4RQ8 A;  3T5K A;  3PW0 A;  3RJJ A;  1T8E A;  1RYS A;  2ZUD A;  2BPG A;  1KFS A;  1ZQZ A;  1ZQR A;  4RNO A;  7ICN A;  5DBC A;  4UAY A;  5KFM A;  5L1I A;  5KT5 A;  3AU2 A;  2MAX A;  3C21 A;  3MR3 A;  4ED0 A;  2OWO A;  4DQI A;  7ICM A;  4Z6E A;  2V4R A;  9ICL A;  4DS4 A;  1ZET A;  3GV7 B;  4DF8 A;  4NXZ A;  3PW4 A;  5BOM A;  7ICE A;  2VA8 A;  5J0O A;  2XGP A;  4I2C A;  2ZUB A;  5J0P A;  1NOM A;  1A76 A;  4B9N A;  2FMP A;  3HP6 A;  1NK5 A;  5DLF A;  2KZ3 A;  1TV9 A;  3H4D A;  8ICF A;  3KHH A;  5CJ7 A;  5KTQ A;  3NTU A;  2PFO A;  4J9Q A;  4J9O A;  1ZQS A;  1Z00 A;  4YXJ A;  2XC9 A;  5KFY A;  4QZ9 A;  3MR5 A;  3H4B A;  5KT2 A;  4EZ6 A;  3V6K A;  4DQQ A;  4FBT A;  8ICY A;  2V4Q A;  4DL3 A;  4Q8E A;  2HHT A;  3C23 A;  3MDC A;  3M9M B;  5KFX A;  4IR1 A;  4QWE A;  1XSP A;  1B43 A;  4DS5 A;  3MDA A;  5KFP A;  4R8U A;  2HHW A;  3RH4 A;  1S0M A;  4M0A A;  2W9B B;  1NKB A;  4J9N A;  2BCR A;  4I2J A;  8ICI A;  4F5O A;  3BJY A;  2KTQ A;  4DL6 A;  4F4K A;  3LWL A;  2PFQ A;  2JZB A;  4O3O A;  3RAX A;  4QZG A;  1QTM A;  4M9G A;  2F1H A;  4RUA A;  5HHI A;  5DQG A;  5KFJ A;  4DLE A;  1RXW A;  4O5K A;  5CP2 A;  2Y1I A;  3GFK B;  7ICL A;  4MEX A;  2XCA A;  1NJY A;  1ZJM A;  4UB3 A;  3MBY A;  4J9L A;  3K75 D;  4ED3 A;  1LB2 B;  8ICK A;  3ORY A;  4J9S A;  5J0X A;  3PR5 B;  4E0D A;  2F1I A;  2BDP A;  5J2F A;  4O5E A;  2BPF A;  2JEF A;  8ICT A;  4TQS A;  3JPR A;  3EYZ A;  2FLN A;  4EEY A;  3M8R A;  2WTF A;  4BXO A;  4YXM A;  2ZTD A;  4PGQ A;  2ISP A;  2AGP A;  4ECU A;  4MFC A;  2W8L A;  4KLU A;  1ZQJ A;  1HUO A;  4KLM A;  1ZQX A;  8ICM A;  2KN7 A;  4IQW A;  1SKR A;  1HJP A;  5KG3 A;  3KHG A;  3OJU A;  1ZQG A;  4JWN A;  4DL5 A;  3PR4 A;  1JXE A;  4DOC A;  4DQS A;  3Q8S B;  1BVS A;  4QZB A;  2W8K A;  1MSW D;  2R8I A;  4CCH A;  4R66 A;  3SZ2 A;  2FMQ A;  3PW5 A;  1NK6 A;  9ICS A;  1KEJ A;  4QZD A;  4YR0 A;  4O3R A;  1Y88 A;  8ICN A;  1SL0 A;  2HW3 A;  2MUT B;  3V72 A;  4IQU A;  2V9W A;  9ICG A;  5KFG A;  5KG0 A;  5KT7 A;  4ECS A;  9ICE A;  4I2D A;  3RB3 A;  1XSN A;  1KLN A;  1SL2 A;  2ZJ5 A;  2R8G A;  1ZQW A;  4UB4 A;  3LWM A;  3RB0 A;  4I29 A;  9ICU A;  5DLG A;  5KFC A;  4JK1 A;  2AU0 A;  4KLT A;  4ED1 A;  1IM4 A;  1ZQE A;  1KSP A;  3LDA A;  4Z6C A;  3RB4 A;  3PW2 A;  5CB1 A;  4YN4 A;  4DSI A;  1H38 A;  8ICR A;  4IQT A;  4LZG A;  4ED8 A;  3PX4 A;  2XGQ A;  4F2R A;  5KFK A;  4J9K A;  4PPX A;  4I27 A;  1N48 A;  1U47 A;  4F50 A;  4DFM A;  3HX0 A;  3MR2 A;  3TAQ A;  4ECV A;  2AGO A;  1BPZ A;  2PXI A;  5KG1 A;  3ZD8 A;  3T5J A;  5D49 A;  5DBA A;  4G3I A;  4GC7 A;  2H5X A;  1PZN A;  2HHU A;  1S9F A;  4YR3 A;  2I1Q A;  3OHB A;  5D46 A;  4QZ8 A;  1X2I A;  5IIN A;  2UVV A;  3KTQ A;  5L1K A;  2ZTC A;  4YMM A;  1U48 A;  4I2I A;  5KFA A;  1ZQA A;  4KLS A;  4J9P A;  2HHV A;  3ISC A;  3M8S A;  4DQP A;  4I2F A;  3THV A;  3C2L A;  3TQ1 A;  4Z6F A;  5DB6 A;  2C22 A;  4F92 B;  4Z6D A;  4IRK A;  8ICS A;  3B0X A;  4O3N A;  3HW8 A;  1UA0 A;  1L3S A;  5KFH A;  2BR0 A;  2KFN A;  5KG4 A;  4PGY A;  1ZQY A;  3UXO A;  4QWC A;  9ICW A;  1K1Q A;  2M9N A;  5BOL A;  1NK0 A;  1MQ3 A;  1BPX A;  4RQ6 A;  4R65 A;  4ECY A;  3JPP A;  8ICJ A;  2AQ0 A;  5HHH A;  4B9U A;  1X9M A;  4K4H A;  4TUP A;  2C2E A;  4YD2 A;  4O3Q A;  2BQ3 A;  8ICA A;  4F4Y A;  3C5F A;  2HHS A;  5DG9 A;  4F8R A;  7ICG A;  5BPC A;  4F5N A;  1S0N A;  5J0R A;  4QWA A;  3JPN A;  5J29 A;  4QWD A;  3V7L A;  4KN4 A;  3ZD9 A;  5KFB A;  4XQ8 A;  3BQ2 A;  2BGW A;  1NKC A;  2P6U A;  1D8Y A;  4YMO A;  4DFK A;  1JX4 A;  2ISO A;  1L3T A;  4UB5 A;  5DBB A;  2ASJ A;  3G6V A;  5DQH A;  1LV5 A;  3JPO A;  3JPT A;  9ICT A;  4BWJ A;  2NRX A;  2R8K A;  5L9X A;  3QZ7 A;  3Q8K A;  8ICC A;  3ISD A;  4DO9 A;  3T5H A;  1ZQL A;  4ELV A;  1BPE A;  5JUM A;  4IRD A;  2ASL A;  3RTV A;  4EBD A;  4GC6 A;  2GWS A;  5CWR A;  4IQV A;  2B21 A;  5HML A;  2IBK A;  3T3F A;  1T3N A;  3GIK A;  1MQ2 A;  5DB8 A;  4RNM A;  5KT3 A;  4NY8 A;  3SV4 A;  1ZQB A;  3MGI A;  4JV1 A;  1NJX A;  1U4B A;  4B9T A;  4KLJ A;  1UA1 A;  1ZQT A;  5F9L A;  4DL7 A;  3FYH A;  4PHP A;  3G6X A;  4F5R A;  4KLH A;  4YG2 A;  4C8M A;  4UBC A;  1D9F A;  4NLG A;  3E2E A;  1IXR A;  4UB2 A;  5IIK A;  2FPL A;  5EOZ A;  3UQ2 A;  4DWI A;  4IRC A;  8ICL A;  3Q8L A;  2JEJ A;  2HHQ A;  3H8W A;  3IM1 A;  4DL4 A;  9ICQ A;  5KFD A;  9ICK A;  4DSL A;  3B0Y A;  4ECZ A;  4PHD A;  4M9N A;  1B22 A;  4LZD A;  5J2E A;  5IIL A;  2F1J A;  4BDP A;  4RT3 A;  3GIM A;  4EYI B;  1CEZ A;  4ZH4 A;  2W9C A;  4PH5 A;  2A1J A;  4B9V A;  4M6W A;  4I2G A;  1SL1 A;  3PO4 A;  4F2S A;  4YCX A;  4K4I A;  2XY6 A;  3BQ1 A;  4KLE A;  4RQ1 A;  1S0O A;  4GXK A;  5F9N A;  2ZUC A;  4XA5 A;  4UQG A;  1KRP A;  4NM2 A;  5EWG A;  1UT8 A;  4BWM A;  5J2D A;  4DFP A;  1ZQF A;  2AGQ A;  4EZ9 A;  4KLQ A;  5L1J A;  1ZJN A;  2ASD A;  4C8K A;  3RB6 A;  4UAW A;  4EBC A;  2HVH A;  9ICF A;  2XY5 A;  3Q8Q B;  2XCP A;  5KFQ A;  9ICN A;  1JMS A;  1NK9 A;  4RPX A;  4FS2 A;  1ZQQ A;  1NK4 A;  5KT4 A;  3BQT A;  5KFU A;  5TZV A;  3Q8R B;  4KLF A;  4LVS A;  5J0Q A;  5CHG A;  4F4X A;  3OGU A;  4F3O A;  1CUK A;  4IR9 A;  1T7P A;  4P2H A;  9ICI A;  1WCL A;  4O9M A;  2RDJ A;  4DSF A;  4R8U B;  4I2A A;  2C28 A;  2JZB B;  4JUZ A;  4DOA A;  4PGX A;  3RR7 A;  1X9S A;  1COO A;  3C1Y A;  2R8H A;  3GDX A;  4F93 B;  9ICB A;  3KHL A;  3RJI A;  4KN7 A;  2BCV A;  2PI4 A;  7ICK A;  4ELT A;  5KFZ A;  1UT5 A;  4ED2 A;  4JV2 A;  1ZYQ A;  1NJZ A;  1ZQN A;  4UBB A;  8ICZ A;  3AUO A;  1K1S A;  1WCN A;  2RDI A;  3GV8 B;  4YVZ A;  4P4O A;  2VAN A;  3H8S A;  5KFL A;  5C5J A;  2ATL A;  4Q8F A;  4JV0 A;  1N56 A;  1SZP A;  2UVR A;  1TK8 A;  4GXJ A;  4BXO B;  2IA6 A;  1ZQI A;  3K4G A;  4KIT B;  4FO6 A;  4M9J A;  5IIO A;  4M04 A;  8ICB A;  4QZH A;  7ICJ A;  8ICU A;  5DKW A;  4NLN A;  5CA7 A;  4QW8 A;  5J2G A;  9ICA A;  3ZDC A;  3M9O B;  5J0T A;  5HNK A;  1RPL A;  4YP3 A;  3V6H A;  1XSL A;  2HVI A;  3PX6 A;  4QZE A;  4F4Z A;  3RH6 A;  1TAU A;  4NLZ A;  3PML A;  9ICH A;  2JEG A;  1U9L A;  1ZQU A;  1V9P A;  4ECX A;  2BHN A;  1NK7 A;  5DG7 A;  3N4M B;  1C7Y A;  2PFN A;  3ZDB A;  3RJF A;  1BPD A;  1NJW A;  5DGB A;  3MFH A;  9ICM A;  5CR0 A;  3RJG A;  2ALZ A;  2VA3 A;  4RQ3 A;  3M9N B;  3ETL A;  4MFF A;  8ICQ A;  9ICV A;  3MR6 A;  4P4M A;  4TUQ A;  3G6Y A;  4FS1 A;  1KFT A;  2IHM A;  1ARO P;  5KFO A;  9ICR A;  2Y1J A;  4PHA A;  4ECW A;  3T5L A;  5J2C A;  1ZQO A;  8ICX A;  4C8N A;  4KLI A;  4RPY A;  3V6J A;  4RQ0 A;  9ICO A;  3LK9 A;  4ED7 A;  4M47 A;  4MF2 A;  8ICP A;  4C8L A;  2UVU A;  5IIJ A;  3C2K A;  2IMW P;  5J0Y A;  1RXV A;  9ICC A;  3EW9 A;  4RNN A;  3AU6 A;  5J2K A;  4Q43 A;  2KZM A;  3V7K A;  4NLK A;  4F5P A;  4MEY A;  2UVW A;  2W9B A;  1ZQP A;  3BDP A;  3RRG A;  2W9A A;  4RZR A;  4RQ7 A;  3TAN A;  4ECT A;  1ZQH A;  4KLG A;  7ICI A;  3GII A;  1EXN A;  3OHA A;  3MGH A;  4DFJ A;  4EYH B;  4P4P A;  1XO1 A;  5DDY A;  2IHN A;  3PNC A;  2W9M A;  5KFE A;  3EPI A;  3RRH A;  4RQ5 A;  1TAQ A;  4PHE A;  4UB1 A;  5KFF A;  5L1L A;  4GLX A;  7ICU A;  4RQ2 A;  3RBD A;  2J6T A;  4RPZ A;  1QSY A;  3HPO A;  1S97 A;  3Q8M A;  2P6R A;  4KLO A;  3TAP A;  1XS9 D;  1TKD A;  4DF4 A;  4Q44 A;  7ICF A;  3C2M A;  3SYZ A;  2FMS A;  1QSL A;  3QEB Z;  3QEA Z;  1JN3 A;  9ICX A;  2FPK A;  1QLN A;  2VA2 A;  3JPS A;  5EWE A;  5J2H A;  1BPY A;  2ZTE A;  3SV3 A;  4B9M A;  3PW7 A;  3N97 B;  3NGD A;  1XU4 A;  4HYK A;  4ECQ A;  4K4G A;  1XWL A;  4I2E A;  9ICP A;  3PMN A;  4R64 A;  2J6S A;  5HMM A;  5KT6 A;  5DG8 A;  3GQC A;  3UQ0 A;  1TVA A;  1ZQK A;  3PY8 A;  4KLD A;  2R8J A;  8ICO A;  1NK8 A;  1JXL A;  1S0V A;  3ZDA A;  5D4B A;  4Q45 A;  2MUT A;  4F4W A;  3OJS A;  5J2B A;  4O5C A;  5DB7 A;  4ECR A;  7ICR A;  2NRW A;  4RU9 A;  3TFR A;  4I2H A;  4I2B A;  1TFR A;  4O3S A;  5KG5 A;  5HP4 A;  1S77 D;  1TK5 A;  1MC8 A;  8ICW A;  3OSP A;  2BQU A;  1RYR A;  3HT3 A;  9ICJ A;  1BGX T;  3EZ5 A;  3SI8 A;  5KG7 A;  3PX0 A;  3QE9 Y;  1U45 A;  5J2I A;  2BCS A;  3ZDD A;  4DSK A;  2AQ4 A;  2ZJ8 A;  5J0W A;  3GIL A;  7ICQ A;  5DDM A;  4EBE A;  1Z00 B;  5J2A A;  4QW9 A;  5KFW A;  2P66 A;  2KFZ A;  2I9G A;  2XO7 A;  2KZZ A;  2XY7 A;  2JEI A;  3UXP A;  4QZC A;  5III A;  5EWF A;  8ICG A;  3H40 A;  5DGA A;  7ICP A;  4QZF A;  2DFL A;  1NKE A;  2NRZ A;  4XRH A;  3Q8P B;  1T4G A;  1U49 A;  2PFP A;  8ICE A;  1KTQ A;  5DQI A;  7ICT A;  2LYH A;  4O3P A;  2DPI A;  3FDS A;  1DGS A;  7ICS A;  3UXN A;  3KHR A;  1RZT A;  4M9L A;  3EWA A;  1A77 A;  5J0U A;  4F91 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...