3K4GA

Crystal structure of e. coli rna polymerase alpha subunit c-terminal domain
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
83
structure length
78
Chain Sequence
PEFDPILLRPVDDLELTVRSANCLAEAIHYIGDLVQRTEVELLTPNLGSLTEIDVLASRGLSLGMRLENWPPASIADE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA-directed RNA polymerase subunit alpha
publication title Structure of the Escherichia coli RNA polymerase alpha subunit C-terminal domain.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Transferase
total genus 18
structure length 78
sequence length 83
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2009-10-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3k4gA00
2ZUCA 4KLGA 1C7YA 4F4XA 4B9UA 1NK5A 3HP6A 5KT7A 2FMQA 4F5RA 2F1IA 5J2DA 2MUTA 2XY6A 4KLIA 1BPEA 4O3NA 3T3FA 5KFIA 2PFOA 4F2RA 4BGDA 4F50A 1ZQXA 3OJUA 2BR0A 1NK7A 1ZQBA 2W8LA 2F1HA 4QWBA 4EZ6A 2W9BA 1ZQDA 2XGPA 4IRCA 4EZ9A 3ISDA 5CHGA 1K1QA 2RDIA 3TQ1A 2JZBA 1U48A 5KFNA 3SI8A 4KLOA 4M6WB 3RB0A 1QSSA 8ICAA 5J2HA 4RQ5A 3EZ5A 4XRHA 4YD1A 1NJZA 3H8JA 1SKWA 4KLSA 1MC8A 5HNKA 5KFWA 4UB1A 4XUSA 4EBCA 3RB6A 4M9NA 4KLQA 4B9LA 5KG2A 5KFXA 3EW9A 1S9FA 4DQIA 3HT3A 1NKCA 3PMNA 1XSNA 5J29A 4BXOA 3PO4A 2AQ0A 4P4MA 4O5KA 1ZQOA 3PO5A 5EWEA 5DKWA 4UB4A 4E0DA 3PW7A 4RPZA 5DB7A 8ICUA 3GDXA 4PHAA 4QZ8A 4QZCA 4PHEA 5DB6A 2XC9A 1ZQHA 4PHPA 4F5QA 2V4QA 3MR5A 3ISCA 1ZQYA 2NRXA 1ZQZA 2FPKA 3H8WA 4KLTA 1BVSA 5IIIA 2FLNA 4I2CA 1EXNA 4BDPA 4UQGA 3IHQB 2JEGA 5C5JA 5J2JA 4RT2A 4MEYA 4DO9A 5HHHA 4YFKA 4DL3A 3KTQA 4M0AA 5CJ7A 8ICOA 3GIMA 1XWLA 1Z00B 5J2KA 4F4YA 4F8RA 1D9DA 4RT3A 4DQSA 4JWNA 5DDYA 5KFCA 4J9SA 3K75D 1A76A 4ELTA 4JUZA 5DG9A 5KG0A 1S97A 3V6HA 4IRDA 2BPFA 3RJHA 4KTQA 1XS9D 5CWRA 1T4GA 5L1KA 3GILA 1RPLA 2C28A 4ELUA 2HHSA 5DQIA 1ZQEA 1ZQQA 4KLLA 8ICSA 1BPDA 1UT5A 2XY5A 3GIIA 4FBUA 2ISPA 4PH5A 5J2AA 2VA3A 1TK8A 3C2LA 4JV0A 3KHGA 3ZD9A 3AU6A 5KG3A 7ICJA 8ICNA 5KFZA 1K1SA 4TQRA 4ECUA 4DS4A 4UB2A 5DB9A 4F4ZA 4QZ9A 2HHWA 1ZQWA 4KN7A 3MR6A 2PI5A 3JPNA 3M8RA 5KFFA 1SKSA 2HHXA 1JX4A 3LK9A 3Q8QB 4KN4A 3B0XA 4BWMA 1S0OA 2B21A 1U4BA 4MF8A 4J9KA 3RR7A 2P6UA 3NTUA 1WCLA 2ATLA 2UVWA 4I27A 4P4PA 4QWDA 3PMLA 1L5UA 9ICGA 1RXWA 2FMSA 5J0XA 3MR3A 3HPOA 1DOQA 4I2AA 4C8NA 4LZGA 1NJWA 5KFTA 9ICRA 1CUKA 3H7IA 4UB3A 3RBDA 1TKDA 3PY8A 4DSKA 2VANA 3UPQA 1Z00A 3QEAZ 3RJIA 4QW9A 4YR3A 5KT6A 4DOAA 3V72A 4KITB 3HX0A 4ED7A 1KFTA 4ECSA 4XQ8A 4QZBA 4KLEA 2P66A 1V9PA 5KFAA 4DWIA 3PW5A 7ICVA 2NRWA 2W9CB 4TURA 5DQGA 2ASJA 8ICEA 7ICPA 5CB1A 1ZQSA 1T7PA 4MFFA 2PFQA 4M9LA 3RR8A 1U45A 4IR1A 3AUOA 3PX0A 4YMNA 5KFYA 5L1IA 4O3PA 9ICWA 4YMMA 5KT2A 2NRVA 4I2BA 2VA8A 9ICFA 3V7KA 4B9TA 1UA0A 5BOMA 2PXIA 4B9MA 2ZJAA 4PHDA 4I2DA 1CEZA 1ZQRA 5KFKA 3T5HA 3RBEA 1ZQUA 5D49A 4QWCA 4DOBA 4F92B 4RPYA 5IIOA 4EBEA 2C22A 2ZUDA 3PW0A 2HHVA 2W9AA 3BQ1A 5KFGA 2A1JB 4DSEA 1NOMA 3AU2A 7ICEA 3OJSA 1AROP 7ICMA 1S0VA 8ICTA 1JMSA 5EOZA 4Q45A 4TUSA 4KLJA 8ICGA 2ZJ5A 4PGQA 3Q8PB 1NKBA 1BPXA 3MGIA 3GV8B 3Q8RB 3RJEA 5DDMA 4Q43A 4JK1A 5KG5A 5KT4A 5KFOA 3MBYA 2HVIA 4O3QA 3PX6A 1ZQKA 1ZQGA 4F5NA 4KLUA 1ZQLA 4B9NA 2R8JA 4IR9A 2XGQA 1BGXT 3JPQA 4I2GA 1WCNA 2FPLA 8ICHA 3EYZA 8ICQA 4Z6DA 5IIKA 2Y1IA 1Y88A 3PVXA 9ICSA 4K4HA 8ICXA 5DGBA 4JV2A 5HP4A 4XA5A 3LWMA 1RYRA 1ZETA 2BCSA 1KRPA 8ICLA 4F3OA 1KTQA 2DPJA 8ICIA 3RJFA 8ICYA 1NK9A 4QWAA 3MABA 4ECZA 1ZQJA 1B43A 2R8KA 4TUPA 2Y1JA 1N48A 1TVAA 3UXNA 4F2SA 5KFQA 3V7LA 4RZRA 4F4KA 3UQ0A 5HMLA 5D46A 3M9OB 7ICUA 9ICBA 1N56A 4C8MA 4QZIA 5D4BA 3PR4A 1X9WA 5EWGA 3MFHA 1T3NA 2ALZA 3PV8A 2NRTA 4KLHA 1XO1A 2A1JA 2V9WA 9ICMA 3H40A 1S77D 2ZJ8A 4KLMA 9ICQA 3C2KA 1ZJMA 4DSJA 1X2IA 4M9HA 7ICIA 3KHHA 9ICVA 3KHLA 2R8GA 7ICTA 4C8KA 3TFSA 1L3SA 2BCVA 4F93B 1S76D 5KFBA 4GXJA 2LYHA 3H4DA 4DQQA 4M6WA 3C1ZA 4R8UB 4GC7A 4DFJA 4MFCA 4DLGA 2PFPA 4UBBA 4J9PA 1QLNA 2BQ3A 9ICCA 4I2HA 1NK8A 4ED0A 3C2MA 2BCQA 3MDCA 3C23A 4ECQA 3RH5A 3QEBZ 4EYIB 1DGSA 3G6YA 3UQ2A 4O5EA 3RTVA 1IM4A 2BGWA 3Q8MA 3BQTA 1Z3EB 5J2FA 2AU0A 1D8LA 5DBCA 4QWEA 3C5FA 4F91B 3GFKB 1TFRA 4Q44A 5J2GA 3M8SA 1T8EA 1U47A 1D8YA 4NLKA 3MDAA 9ICKA 2KN7A 1QSLA 8ICBA 9ICJA 3RJKA 4DL5A 4TUQA 1JN3A 4NY8A 3OSPA 4NM1A 3FDSA 9ICXA 4ECXA 2R8IA 4Z6EA 4YR2A 9ICOA 4M9JA 4P4OA 1ZQIA 1COOA 3RH4A 1TV9A 4RQ0A 4QZDA 4NLGA 3N97B 2IHNA 2HHUA 2H5XA 3EWAA 2ZTEA 3RH6A 3RRHA 3JPPA 5KFUA 1MQ3A 2ZUBA 4RQ3A 5KFDA 5KG1A 4RQ1A 4DLEA 4RUCA 5HHIA 1L3UA 3BDPA 5KTQA 4YXMA 8ICCA 4YQWA 4RNMA 4PGXA 5J2IA 4DFPA 4M9GA 2KZMA 4Z6CA 3SV4A 1NKEA 3M9MB 2M9NA 2MAXA 1XU4A 4F5OA 4ECRA 2HHTA 4KLDA 4YR0A 3THVA 3RAQA 2XCPA 4J9NA 4IRKA 7ICKA 2W9BB 3UXPA 3Q8LA 1SL1A 2BCUA 4EBDA 9ICPA 4YN4A 2HHQA 4FS2A 2JZBB 4NM2A 2JEJA 1ZQAA 2KFZA 8ICZA 5CP2A 5IILA 3M9NB 1S0MA 4I2FA 5J0PA 7ICOA 5KG4A 3LWLA 5L1JA 2C2DA 2FPMA 1L3VA 4YMOA 1KDHA 1RYSA 1ZJNA 2J6TA 2UVRA 4DSLA 1X9SA 3C1YA 5DLFA 4J9RA 4ECYA 4K4IA 1ZQTA 8ICFA 1JIHA 3NGDA 3C5GA 3PNCA 1SL2A 3ZDBA 3K4GA 5KFEA 2W8KA 1QSYA 3EPGA 4FO6A 4UAWA 3Q8SB 2R8HA 2WTFA 2NRZA 4C8LA 2DPIA 1NJXA 3MFIA 3OSNA 9ICTA 9ICUA 9ICAA 3Q8KA 3HW8A 1L3TA 4O3OA 4ED1A 3ZDAA 3LDAA 5DG7A 4GLXA 2F1JA 5DBBA 4FS1A 3ORYA 4ED8A 4DL4A 4YXJA 5L9XA 1BPZA 4JV1A 4FBTA 4QZEA 3TAQA 4MEXA 2XCAA 1RZTA 3JPSA 3UXOA 3SYZA 4DOCA 2AGOA 3HWTA 2J6UA 2PFNA 1HUOA 4DF4A 4I29A 4LZDA 3TFRA 1XSPA 8ICJA 3PR5B 1TAQA 4M2YA 5DLGA 2ASLA 2FLLA 3JPRA 3TI0A 5J0YA 2ZTDA 2BPCA 1ZQPA 3JPTA 2PI4A 1S10A 1ZQFA 2W9CA 4YVZA 3RJGA 5IINA 9ICIA 4O3RA 2ZTCA 1SKRA 4RQ6A 5KG7A 5JUMA 1KFDA 5KFRA 1PZNA 4K4GA 3N4MB 4DQRA 7ICLA 2IHMA 2J6SA 4QZFA 1KSPA 2FMPA 5DB8A 3TARA 4B9VA 4UB5A 3GIKA 3KHRA 2IA6A 1MSWD 4YG2A 4EYHB 1JXLA 5IIMA 5J2CA 1XC9A 1ZQMA 2BKEA 4NXZA 3OGUA 4Q8FA 5TZVA 8ICKA 9ICHA 5J0UA 3ISBA 4GXKA 5BPCA 1TK0A 2P6RA 4DQPA 4YD2A 3QZ8A 2JEIA 4MFAA 5KT3A 4ELVA 4I2IA 4UBCA 5KFLA 4ZH4A 3PX4A 4QZHA 4J9LA 4QZGA 4RQ8A 3BQ0A 9ICEA 3RB3A 5J0TA 3H8SA 3G6VA 4QW8A 4RPXA 5J0SA 3PW2A 4DS5A 3RB4A 1RXVA 4DL2A 4I28A 4P2HA 8ICMA 9ICNA 2OWOA 5HMMA 3B0YA 3IM1A 3G6XA 2UVVA 5IIJA 1UT8A 4NLNA 4DEZA 4TQSA 4I2JA 2C2EA 4O5CA 2I1QA 5BOLA 4ECTA 1SL0A 1NJYA 1QTMA 4IQWA 7ICQA 1D9FA 4C8OA 1UA1A 1LB2B 2KZZA 1ZQNA 1BPBA 4J9MA 3RRGA 8ICVA 2ASDA 4IQUA 1B22A 4KMUA 3FYHA 1KEJA 4YCXA 2DFLA 3BJYA 3GIJA 4DF8A 4I2EA 3RJJA 3OHAA 2BQUA 5KG6A 4O9MA 2GWSA 2BCRA 4IQTA 3SV3A 1HUZA 5J2BA 2AJQA 5KT5A 3TAPA 3V6JA 4DL7A 2IMWP 2HW3A 5J0QA 2KTQA 3ETLA 5KFHA 5DG8A 3QZ7A 1TAUA 4J9OA 4KLFA 4BWJA 4GC6A 2V4RA 3GQCA 4F4WA 3PW4A 5DGAA 3SZ2A 8ICPA 4R63A 5KFJA 2AQ4A 4DL6A 3H4BA 1S0NA 2HVHA 1U9LA 7ICHA 5DBAA 5F9NA 1IXRA 2XO7A 2KFNA 5L1LA 1H38A 4R65A 5KFVA 1A77A 2BHNA 3TANA 1MQ2A 4DSFA 2MUTB 1ZQCA 3GV5B 3V6KA 9ICLA 4R8UA 3GV7B 4X5VA 1U49A 3T5LA 4G3IA 4YP3A 1KFSA 4QZAA 4RQ2A 8ICWA 4M47A 2AGQA 4RNNA 2FLPA 2I9GA 7ICFA 8ICRA 3MGHA 2KZ3A 4ED2A 4ED3A 4Q8EA 5KFMA 5J2EA 3T5KA 5KFPA 3RAXA 4DSIA 2W9MA 4HYKA 4ECVA 7ICRA 2JEFA 5KFSA 4RUAA 1ZYQA 1NK0A 4LVSA 4R66A 4Z6FA 5J0RA 4ECWA 4DFKA 4EEYA 4NLZA 2IBKA 4R64A 3JPOA 1ZQVA 3T5JA 2BQRA 1LV5A 1BPYA 3ZDEA 4IQVA 2AGPA 3MR2A 1HJPA 1SZPA 7ICNA 5CA7A 4ED6A 5J0OA 3ZDCA 5J0WA 3C21A 5EWFA 3ZD8A 2RDJA 7ICSA 4MF2A 4CCHA 1KLNA 3ZDDA 2BPGA 4O3SA 4RQ4A 2Q0ZX 5CR0A 1NK4A 4RU9A 1XSLA 1TK5A 4B9SA 4BXOB 4RNOA 3V7JA 4DFMA 1NK6A 4UAZA 5DQHA 2BDPA 4O0IA 4JWMA 2VA2A 7ICGA 2XY7A 4UAYA 3EPIA 3E2EA 4RQ7A 3OHBA 3QE9Y 3BQ2A 4J9QA 4GXIA 2ISOA 4PGYA 5F9LA 2C2RA 1X9MA 4F5PA 4PPXA 2UVUA 1JXEA 4M04A
chains in the Genus database with same CATH superfamily
3HILA 5AK3A 1NK5A 3T3FA 4F50A 3H0RB 2BR0A 1ZQBA 3SMVA 2W8LA 3NVZA 4IRCA 2XGPA 3ISDA 1JRPA 5K4LA 1QSSA 4RQ5A 5HNKA 4XUSA 4M9NA 4B9LA 3ICXA 3EW9A 1S9FA 3AL0B 1XSNA 2RQ5A 3SAFA 4BXOA 3BS5A 2DGZA 1Q46A 3QU4A 5EWEA 5ALWA 1IV8A 1QCKA 2KK0A 4PHEA 4PHPA 2NRXA 3KKAC 2FPKA 1T94A 1BVSA 5ALXA 2OEHA 5J2JA 4RT2A 3EUB2 4DL3A 2QB1A 4UARA 3GIMA 1OUQA 1XWLA 1Z00B 4DQSA 5DDYA 3K75D 4ELTA 2BPFA 3RJHA 4KTQA 5AM0A 1T4GA 5L1KA 3GILA 2HHSA 4C0ZA 2KJ9A 4KLLA 3D2QA 2XY5A 5G5HA 4GFJA 4JV0A 3KHGA 7ICJA 5KG3A 1CRXA 1SV4A 2D6FC 1ZQWA 4KN7A 2LBOA 2HSZA 3B0XA 2B21A 4J9KA 3RR7A 4P4PA 1L5UA 9ICGA 1N60A 3MR3A 2XI9A 3HPOA 1DOQA 5KFTA 2QARB 3WU2U 4DSKA 2ZXIA 2VANA 2A1AA 2XVTA 1WUDA 1FO4A 4QW9A 5KT6A 4KITB 3N7SC 3LVWA 4AYBF 1KFTA 3UM9A 2CN1A 4DWIA 2NRWA 4EX6A 4OCZA 4MFFA 4RQNA 2PFQA 5AM3A 1N5WA 5KFYA 5L1IA 4O3PA 4YMMA 1RQNA 4I2BA 2VA8A 1UA0A 4B9MA 4PHDA 1ZQRA 5KFKA 5D49A 4QWCA 4F92B 5IIOA 2C22A 1F5SA 8ICGA 3FM9A 2MSNA 5T14A 4PGQA 3Q8PB 3Q8RB 4NV0A 4O3QA 4B9NA 5ALVA 4IR9A 4NL9A 3JPQA 2FPLA 1N61A 4Z6DA 2YMPA 4XA5A 2A19A 3LWMA 1RYRA 1KRPA 8ICLA 4CGZA 8ICYA 3MABA 4ECZA 2B6GA 1N48A 3QU2A 3V7LA 4F4KA 1X40A 5D46A 4QZIA 5GTHU 4FFDA 1IG6A 2K4EA 3MFHA 2ALZA 3PV8A 3SEIA 2VJ4A 1ZJMA 3CYMA 7ICIA 1GO3F 7ICTA 4C8KA 1A0PA 1S76D 4OD0A 2LYHA 2WF9A 3C1ZA 1L8LA 4DLGA 4ED0A 3MDCA 1DGSA 3RTVA 1Z3EB 3KD3A 5J2FA 3C5FA 4Q44A 3WK8A 3VCBA 2WAQC 5J2GA 3F2BA 1NI3A 9ICKA 2NV3A 1SWWA 3E58A 1RYUA 1ZQIA 1TV9A 4QZDA 1V85A 1WG8A 4NLGA 2IHNA 3JPPA 2LYAA 5KFDA 5KG1A 4RQ1A 1L3UA 2W43A 2OCEA 3IRUA 1NKEA 2MAXA 4F5OA 4ECRA 3THVA 2W9BB 4U7CA 4G9BA 5JU5A 2ZIWA 2W7OA 3CRXA 7ICOA 2E8PA 2C2DA 2J6TA 1KDHA 3GZFA 4ECYA 1JIHA 4DCCA 3C5GA 2P35A 3EPGA 3Q8SB 2NRZA 3U26A 3UMGA 3OSNA 4PZNA 2A3VA 5KNIA 3HW8A 3ORYA 1BPZA 3BS7A 2XCAA 3JPSA 3HWTA 2W03A 1FIQA 8ICJA 3WKEA 3O0FA 5G5GA 1A6SA 3D6JA 1ZQPA 3RJGA 9ICIA 5ALJA 5KG7A 1KFDA 1X6IA 1L8OA 1Z19A 5KFRA 3N4MB 4DQRA 3F2DA 3TARA 5ALMA 4PJ0U 2IA6A 1MSWD 2G5IB 5J2CA 5TZVA 9ICHA 2P6RA 4DQPA 3QZ8A 4MFAA 5KT3A 4HAIA 4QZHA 4J9LA 9ICEA 3RB3A 3G6VA 2LI6A 4RPXA 2PKEA 4UAUA 5CRXA 5J0SA 2ZIVB 5AM4A 3UMCA 1RXVA 4I28A 3B0YA 2UVVA 4DEZA 1KQQA 4ECTA 4QJFB 1QTMA 1JROA 4KX5A 1UA1A 2Y9TA 3E0FA 2MU2A 5ALIA 8ICVA 1RG6A 4KMUA 3J81j 3GIJA 4DF8A 4O9MA 2HCFA 5KT5A 3TAPA 4DL7A 2XIDA 4UB6U 2G06A 2EZXA 2G0AA 2V4RA 5AKZA 1SV0C 1M6YA 5KFJA 1ZD4A 4CF4A 5ALKA 3TANA 1MQ2A 4DSFA 1ZQCA 5AI9A 5JRTA 2AGQA 2FLPA 4KX3A 2F2AB 4Q8EA 4RUAA 1NK0A 4Z6FA 4DFKA 1Z1VA 3T5JA 2E3TA 1HJPA 4ED6A 3ZDCA 5J0WA 3NASA 5EWFA 3ZD8A 7ICSA 4NL9C 4O3SA 2KNJA 4B9SA 3V7JA 4C4SA 1NK6A 2JXJA 1PK1A 2VA2A 1J97A 2XY7A 3E2EA 3OHBA 3BQ2A 2ISOA 3SD7A 4PPXA 4J03A 2UVUA 2ZUCA 4F4XA 4B9UA 4QIWC 2FMQA 2W55A 4F5RA 4KLIA 2MUTA 1BPEA 2EQYA 5KFIA 4BGDA 3DV9A 1NK7A 1YZ7A 1AQ6A 4OJPA 3WKCA 1K1QA 2JZBA 5KFNA 3DDHA 3SI8A 5J2HA 2WB1C 1MC8A 4KLQA 1UCVA 3N7PD 5KFXA 3HT3A 4ICAA 5J29A 1WYGA 4C4RA 3PO4A 3N7RC 1ZQOA 2GLEA 2W3SA 2JH7A 2KIWA 5DKWA 2KVCA 4E0DA 2YN4A 3GDXA 3BZCA 5AKKA 5AKGA 2V4QA 4ACOA 3MR5A 3H8WA 5IIIA 1EXNA 4UQGA 2K4PA 3IHQB 2K8CB 3KTQA 4YFKA 5CJ7A 3WKAA 1YZ6A 4Y2TA 4EELA 4F4YA 4RT3A 5L1MA 2HI0A 1A76A 1ZOLA 4US8A 5DG9A 5ALRA 3V6HA 4IRDA 4CRXA 5CWRA 1RPLA 2C28A 4ELUA 5DQIA 1UT5A 2KE7A 2VA3A 2D3DA 1TK8A 2KJ5A 3T79A 2W04A 4MHVA 5AKIA 3ZD9A 5AIAA 2KHQA 1K1SA 4TQRA 5DB9A 1KBUA 2HHWA 2PI5A 3M8RA 1SKSA 2HHXA 1JX4A 3Q8QB 1S0OA 4MF8A 2P6UA 4QWDA 3TADA 5J0XA 4I2AA 1V97A 4IL6U 1CUKA 3H7IA 4UB3A 1TKDA 1NZBA 5C0YA 4ZOHC 1Z00A 3RJIA 2MRLA 3ETRA 4ED7A 2YMMA 4KLEA 2P66A 2HBJA 5KFAA 3PW5A 7ICVA 2W9CB 1B0XA 4C7YA 2EZZA 4YMNA 3AQFA 2JR5A 5BOMA 2PXIA 3T5HA 3L3FX 5AI6A 2A1JB 3AU2A 3OJSA 5ALTA 1JALA 1JMSA 2ZJ5A 1L7PA 2JRZA 2YB1A 3OTQA 3MGIA 2DKZA 2RRDA 2JH1A 3GV8B 5DDMA 3RJEA 5KT4A 3MBYA 2HVIA 3ZI4A 1O08A 1WCNA 4OJOA 2OH2A 3DEEA 8ICHA 1Y88A 3PVXA 5HP4A 1LKYA 1Z4OA 8ICIA 1NK9A 1B43A 1TVAA 3UXNA 4F2SA 3QUQA 3WK7A 1J2MA 9ICBA 4C8MA 4NJ8A 1KN5A 2E8MA 2HDOA 4FZMA 1T3NA 5EE0A 4KLHA 1XO1A 3I1YA 4KLMA 9ICQA 3IG8A 3KHHA 2WHEA 5ALZA 2BCVA 2Z7JA 2JHDA 2ZIUB 4GXJA 4M6WA 5E79U 4OO1J 4C80A 2DKXA 3I76A 1NZPA 1LVHA 4J9PA 1NK8A 2BCQA 4ECQA 1COKA 3QEBZ 4EYIB 3G6YA 4O5EA 4NLBA 2BGWA 5DBCA 1YT3A 3M8SA 1U47A 1D8YA 3MDAA 2L5YA 2OHFA 8ICBA 3A0HU 4TUQA 3OSPA 4ECXA 4YR2A 1V38A 9ICOA 2E1FA 3F5EA 2AHOB 1X42A 2H5XA 2ZTEA 3RH6A 3RRHA 1MQ3A 5B66U 1DGJA 4RUCA 5HHIA 2F77X 5KTQA 2FJ6A 2KMDA 4YQWA 4RNMA 4PGXA 4DFPA 4M9GA 3SV4A 1XU4A 2HHTA 4O3MA 1FFUA 4IRKA 4J9NA 3UXPA 1SV0A 3Q8LA 3B9JA 9ICPA 1L6NA 1CI4A 1DXSA 4NM2A 3HRDD 3M9NB 4I2FA 5KG4A 4Y2JA 5L1JA 2FPMA 7ICRA 4DSLA 4K4IA 1ZQTA 3NGDA 2LYBA 3K4GA 3R9KA 5KFEA 2R8HA 3MFIA 9ICUA 5AHXA 5ALFA 4WJ3B 1L3TA 5DG7A 1ZQAA 4GLXA 2F1JA 4YXJA 5L9XA 3SAHA 4FBTA 3TAQA 1RZTA 1ZRNA 3SYZA 4DOCA 2LM1A 4LZDA 3HKZC 5J0YA 1FFVA 2G08A 4B6JA 3JPTA 1S10A 1ZQFA 3CP8A 3KBBA 2JV3A 1SKRA 4C4TA 2H3VA 1PZNA 2CPRA 2WF7A 2IHMA 5H2FU 2J6SA 4QZFA 1KSPA 3WK9A 2FMPA 2N1RA 4YG2A 1JXLA 3NRZA 1XC9A 1ZQMA 4CF3A 3OGUA 2W7PA 3SQIA 2HOFA 4ZH4A 3BQ0A 1L7MA 5J0TA 3H8SA 4NLCA 2EANA 4DS5A 3ONNA 9ICNA 4FZLA 1K5OA 4Y2SA 2LM4A 4NLNA 3TADC 1SL0A 2CRXA 1NJYA 2KZZA 1BPBA 3H0LB 3KFUF 1B22A 2H3QA 4YCXA 1Q8KA 3RJJA 3PSIA 5FP0A 4IQTA 5J2BA 3V6JA 5ALLA 2HW3A 5J0QA 2KTQA 3QZ7A 4J9OA 4BWJA 4GC6A 3QX7A 5DGAA 3PW4A 8ICPA 4P0QB 4DL6A 3H4BA 4NWIA 5AK5A 2EDUA 2KJ8A 7ICHA 5F9NA 5L1LA 1H38A 5KFVA 1TAMA 4R8UA 3GV7B 4X5VA 2ZIVA 3T5LA 3NVVA 4YP3A 4QZAA 4RQ2A 2K8AA 3MGHA 2GO7A 5AM1A 4ED2A 3T5KA 5KFPA 2W9MA 4ECVA 1ZYQA 4LVSA 4R66A 1OW5A 4R64A 2BQRA 1KW4A 5KAFU 1SXDA 2KSOB 3C21A 4MF2A 5F3XB 1HIWA 3ZDDA 2BPGA 2HOQA 2Q0ZX 4IS7A 4RNOA 4DFMA 4UAZA 5DQHA 2BDPA 4O0IA 4JWMA 7ICGA 3NVYA 3QU9A 4UAYA 5F9LA 2C2RA 1JXEA 5D4BA 4M04A 4KLSA 3AEVA 4KLGA 1C7YA 4CNQA 1X6JA 5KT7A 5J2DA 4O3NA 2BDUA 4F2RA 4OJLA 1SB3C 2F1HA 4QWBA 4EZ9A 5ALGA 3TQ1A 2CXYA 4P0PB 1U48A 3GU3A 4YD1A 1NJZA 3H8JA 5KFWA 4UB1A 4EBCA 1S5LU 1ZD2P 1SGGA 3PMNA 4UB4A 3PW7A 8ICUA 4PHAA 4F5QA 4QIWF 1ZQYA 2FLNA 4I2CA 4BDPA 5C5JA 4MEYA 4DO9A 5HHHA 2H3IA 4M0AA 2DF4B 4F8RA 5AICA 3KZXA 3QXGA 5KFCA 4J9SA 5KG0A 3CW2C 2QB0A 1XS9D 2ES6A 2WB1F 4JMUA 4DFDA 1F0MA 3WKBA 1UHUA 2WF8A 1DK2A 4RQMA 1BPDA 2ISPA 2KV2A 4PH5A 5ALHA 2HBKA 3C2LA 2ZXHA 5AKLA 3AU6A 8ICNA 5KFZA 4ECUA 4F4ZA 4QZ9A 3MR6A 3JPNA 2Q4TA 3LK9A 2LMRA 5HR6A 1QQ6A 1U4BA 2UVWA 3PSFA 3PMLA 2ZG6A 4LZGA 1NJWA 3PY8A 3RBDA 4OJ6A 4Y2YA 1Z4NA 2BZFA 4YR3A 4DOAA 4BJQA 3H0MB 4ECSA 4QZBA 1ZD5A 2KVSA 4TURA 2YY6A 4A8EA 2ASJA 7ICPA 1T7PA 1U45A 9ICWA 2XICA 4B9TA 2KP7A 4FE3A 4I2DA 1CEZA 4Y2UA 3RBEA 1ZQUA 2E1EA 4RPYA 4EBEA 3PW0A 1MA7A 5JTIA 2HHVA 5KFGA 3H8MA 1NOMA 4F71A 1S0VA 2H3ZA 5AI4A 1RM6C 3RF9A 4Q45A 4KLJA 4TUSA 1BNPA 1VLBA 1KKXA 3PX6A 1ZQKA 1ZQGA 4F5NA 3SR6A 2Y0SF 1ZRMA 4KLUA 1ZQLA 2E8OA 1BGXT 4I2GA 3L5KA 3WK4A 2KHVA 5IIKA 2ODGA 2Y1IA 8ICXA 5DGBA 1B4FA 1ZETA 1N63A 3AQEA 4USAA 1NNLA 3TKAA 4QWAA 2R8KA 4TUPA 5KFQA 3UQ0A 3MGVA 5HMLA 3M9OB 7ICUA 5A0LA 4EX7A 2IOHA 1X9WA 5EWGA 1N2XA 2A1JA 2V9WA 3H40A 1S77D 2E8NA 2ZJ8A 3C2KA 3UMBA 4M9HA 2F8KA 9ICVA 3KHLA 1L3SA 2I5HA 5KFBA 4DQQA 1N5XA 4Y2RA 5ALPA 4UBBA 5ALQA 9ICCA 4I2HA 4F72A 3IP4B 3C2MA 3RH5A 2IOFK 3BQTA 1D8LA 3SENA 4NLKA 9ICJA 3RJKA 4NY8A 1VDVA 2R18A 3FDSA 9ICXA 4Z6EA 4P4OA 3RH4A 2FI1A 2QLTA 2ZIXB 2PMZC 2HHUA 1PK1B 4RQ3A 1UQVA 2KIVA 4EENA 2F76X 3BDPA 4YXMA 1Q3VA 5J2IA 1S8OA 2KZMA 4Z6CA 1PUZA 3M9MB 1ECWA 3N28A 2RHFA 2DQNB 3RAQA 2EAMA 7ICKA 2BCUA 4EBDA 4YN4A 5KAIU 3FC4A 3KOOA 4FS2A 2HHQA 2JZBB 2YMLA 8ICZA 3LWLA 2UVRA 3PSPA 1RYSA 1ZJNA 1X9SA 4J9RA 8ICFA 3PNCA 2O6KA 4UAWA 4UAVA 2WTFA 3C29A 2HBMA 1NJXA 1T3QA 4ED1A 2QARA 3LDAA 5DBBA 4DL4A 4FS1A 3UXOA 2PFNA 2J6UA 1HUOA 2OXOA 2G5HB 3TFRA 3PR5B 1L7NA 1TAQA 2K60A 2ASLA 2FLLA 2ZTDA 2PI4A 5IINA 2ZTCA 4RQ6A 5JUMA 1RDFA 5AM2A 4K4GA 1QH9A 4PL2A 2WFAA 2EH9A 4B9VA 2DUYA 4UB5A 3GIKA 3KHRA 3QU5A 3L4PA 3QU7A 5AIBA 2BKEA 4NXZA 4Q8FA 5ALNA 1JI7A 8ICKA 5J0UA 3ISBA 4GXKA 5BPCA 3NRWA 4YD2A 2JEIA 3BQ7A 4ELVA 4I2IA 4QZGA 2YMQA 3K1ZA 4QW8A 3HKZF 2EAPA 3PW2A 5ALUA 2OWOA 5HMMA 3IM1A 5IIJA 4TQSA 4I2JA 5BOLA 3LVVA 2H3FA 4IQWA 1D9FA 4C8OA 7ICQA 1LB2B 3PSTA 2LKYA 1ZQNA 2ASDA 4IQUA 2KKVA 4FZNA 3FYHA 5J8YA 5EE9A 2DFLA 4I2EA 5KG6A 2BCRA 2KG5A 3SV3A 5ALEA 1ED1A 1KL9A 2AJQA 2YTUA 2IMWP 3ETLA 5DG8A 3NUQA 2ESEA 3GQCA 3SZ2A 1HEKA 2AQ4A 2DL0A 2HVHA 2G09A 3QNMA 1IXRA 2XO7A 9ICLA 2JGAA 4G3IA 1RQLA 4RNNA 5AK4A 7ICFA 8ICRA 3QUBA 1TE2A 2KZ3A 2K89A 3RAXA 4HYKA 2JEFA 5KFSA 1PVRA 2G07A 5J0RA 2WAQF 3HJEA 1LV5A 1BPYA 4IQVA 5AI5A 2AGPA 3MR2A 1SZPA 7ICNA 5CA7A 4Y2VA 1WWVA 2RDJA 1SWVA 1KLNA 3TACB 5EE1A 1LKYB 4RQ4A 5CR0A 4C7ZA 1TK5A 1XSLA 4BXOB 3BS5B 3SAGA 1DK3A 4P0QA 5ALYA 4RQ7A 3QE9Y 4J9QA 1X9MA 4F5PA 2MA1A 1UPHA 4PZOA 3HP6A 2F1IA 2XY6A 2Y9UA 2PFOA 3KZIU 1ZQXA 3OJUA 3M7DA 1PVPA 1FEZA 2W9BA 1ZQDA 4EZ6A 1P7DA 5CHGA 2F3NA 3A0BU 2RDIA 5ALOA 4KLOA 4M6WB 3RB0A 8ICAA 4UW9A 1L7OA 3EZ5A 4XRHA 1SKWA 1OXJA 2KSOA 3RB6A 3IG5A 2KD1A 5KG2A 4DQIA 1NKCA 3AM9A 4UASA 4US9A 2KKPA 4P4MA 2AQ0A 4PL1A 4O5KA 3WK5A 3PO5A 5AM5A 4RPZA 5DB7A 4QZCA 4QZ8A 2KICA 5DB6A 2XC9A 1ZQHA 3ISCA 1ZQZA 3M6ZA 4KLTA 2JEGA 5AI0A 1J2NA 8ICOA 1VJ5A 5J2KA 2E5SA 1D9DA 1Z1BA 4JWNA 1JUDA 1X66A 4JUZA 4P0PA 1S97A 4AYBC 3D2SA 1DRGA 2M0NA 1ZQQA 1ZQEA 4UATA 8ICSA 4CF5A 3GIIA 4FBUA 2WF6A 5J2AA 2LPEA 2AXTU 1F44A 4DS4A 4UB2A 5KFFA 1ZQ1C 1SZHA 4KN4A 3IDWA 4BWMA 1SIJA 3NTUA 1WCLA 2ATLA 4I27A 1RXWA 2FMSA 4C8NA 9ICRA 3FAHA 3UPQA 3QEAZ 2W54A 4CDGA 2K4HA 3V72A 3HX0A 4XQ8A 2GH1A 2VIXA 3IV6A 1V9PA 5DQGA 8ICEA 3QUTA 5CB1A 1ZQSA 4M9LA 3RR8A 4IR1A 3LYSA 3AUOA 3PX0A 5KT2A 2NRVA 9ICFA 3V7KA 3RFAA 2FDRA 2ZJAA 1O03A 4DOBA 2YQEA 2ZUDA 2W9AA 3BQ1A 4DSEA 7ICEA 1AROP 7ICMA 8ICTA 1C20A 5EE3A 5EOZA 1NKBA 1BPXA 3NS1A 1X9XA 4Q43A 5AKXA 4JK1A 5KG5A 5KFOA 2F8LA 4Y2QA 2R8JA 2XGQA 3AN1A 3EYZA 8ICQA 1ZXIA 4UB8U 9ICSA 4K4HA 4JV2A 2B0CA 2BCSA 4F3OA 1KTQA 2DPJA 3C28A 3RJFA 1ZQJA 2Y1JA 4OJ5A 3F5AA 4RZRA 4EEKA 5J8YC 2GOLA 1N56A 2I6XA 5AKEA 3PR4A 2HBLA 2K8BB 2NRTA 9ICMA 2OM6A 1D8BA 4DSJA 1X2IA 2R8GA 1IIPA 3TFSA 4LJXA 4F93B 2VKQA 2F44A 2W11A 3H4DA 2DBYA 4R8UB 4GC7A 4DFJA 4MFCA 2IOFA 2PFPA 3F2CA 1QLNA 2BQ3A 2DWQA 3C23A 2KEYA 3QYPA 3UQ2A 1IM4A 2ZIWB 2RP5A 3Q8MA 4BUGA 2AU0A 2HMXA 4KMOB 4QWEA 4F91B 3GFKB 1TFRA 5B5EU 1T8EA 5CEHA 2KN7A 1QSLA 3KKAA 4DL5A 1JN3A 3S6JA 4NM1A 2R8IA 5TISU 1URJA 4M9JA 1XNSA 1COOA 4RQ0A 3N97B 3EWAA 3WK6A 5KFUA 2ZUBA 4DLEA 2OYYA 1BNOA 8ICCA 1PVQA 1MN8A 2M9NA 3BZKA 3IN5A 4KLDA 4YR0A 2XCPA 1SL1A 2VJ5A 2JEJA 2KFZA 4CE6A 5CP2A 5IILA 1S0MA 5J0PA 5AKYA 1L3VA 4YMOA 3MC1A 2AH5A 3C1YA 5DLFA 5ALSA 3OPXA 1SL2A 3ZDBA 2W8KA 1QSYA 4FO6A 4BX9C 4C8LA 2DPIA 9ICTA 9ICAA 3Q8KA 2PMZF 2ZIXA 4O3OA 3ZDAA 3NVWA 4ED8A 4JV1A 4QZEA 4MEXA 2AGOA 3CNHA 4DF4A 4I29A 1XSPA 2NO4A 2WF5A 4M2YA 5DLGA 3JPRA 3TI0A 2KOBA 2LHTA 2BPCA 2W9CA 4YVZA 3ALRA 4O3RA 4Y2PA 2HOIA 1N62A 7ICLA 2QB0B 3M1YA 3M6KA 5DB8A 3I28A 4EYHB 5IIMA 2K4IA 2EZYA 1TK0A 1PK3A 1Q3UA 4UBCA 5KFLA 3PX4A 5GTIU 3ED5A 4RQ8A 5ALDA 1QQ7A 4U6PA 3WKDA 2JMGA 3D2NA 3RB4A 8ICMA 2YB4A 4DL2A 4P2HA 3G6XA 1UT8A 3VC8A 3PZPA 5KL8B 2C2EA 4O5CA 2I1QA 5AKJA 4QNLA 3RRGA 4J9MA 4GIBA 4JB3A 3BJYA 1KEJA 3OHAA 2BQUA 2GWSA 2FE9A 1HUZA 2YX8A 2RLTA 5AK6A 5KFHA 1TAUA 1QQ5A 4KLFA 5AKHA 4F4WA 4R63A 1SXEA 1ZD3A 1S0NA 3K1RB 1U9LA 5DBAA 2NO5A 2KFNA 3F53A 4IC9A 2ZIUA 1A77A 2BHNA 4Y2XA 4R65A 2MUTB 3GV5B 3V6KA 1U49A 2NYVA 1KFSA 8ICWA 4M47A 2QKQA 1XO0A 2I9GA 5AI8A 2D8CA 4ED3A 5KFMA 2W3RA 5J2EA 4DSIA 5KL1B 4ECWA 4EEYA 4NLZA 2Y0SC 2IBKA 3JPOA 1ZQVA 3ZDEA 5J0OA 1WWUA 4CCHA 1NK4A 3AMZA 4RU9A 2EAOA 4AP9A 5HR7A 3EPIA 3QUCA 4GXIA 4PGYA
chains in the Genus database with same CATH topology
2ZUCA 4KLGA 1C7YA 4F4XA 4B9UA 1NK5A 3HP6A 5KT7A 2FMQA 4F5RA 2F1IA 5J2DA 2MUTA 2XY6A 4KLIA 1BPEA 4O3NA 3T3FA 5KFIA 2PFOA 4F2RA 4BGDA 4F50A 1ZQXA 3OJUA 2BR0A 1NK7A 1ZQBA 2W8LA 2F1HA 4QWBA 4EZ6A 2W9BA 1ZQDA 2XGPA 4IRCA 4EZ9A 3ISDA 5CHGA 1K1QA 2RDIA 3TQ1A 2JZBA 1U48A 5KFNA 3SI8A 4KLOA 4M6WB 3RB0A 1QSSA 8ICAA 5J2HA 4RQ5A 3EZ5A 4XRHA 4YD1A 1NJZA 3H8JA 1SKWA 4KLSA 1MC8A 5HNKA 5KFWA 4UB1A 4XUSA 4EBCA 3RB6A 4M9NA 4KLQA 4B9LA 5KG2A 5KFXA 3EW9A 1S9FA 4DQIA 3HT3A 1NKCA 3PMNA 1XSNA 5J29A 4BXOA 3PO4A 2AQ0A 4P4MA 4O5KA 1ZQOA 3PO5A 5EWEA 5DKWA 4UB4A 4E0DA 3PW7A 4RPZA 5DB7A 8ICUA 3GDXA 4PHAA 4QZ8A 4QZCA 4PHEA 5DB6A 2XC9A 1ZQHA 4PHPA 4F5QA 2V4QA 3MR5A 3ISCA 1ZQYA 2NRXA 1ZQZA 2FPKA 3H8WA 4KLTA 1BVSA 5IIIA 2FLNA 4I2CA 1EXNA 4BDPA 4UQGA 3IHQB 2JEGA 5C5JA 5J2JA 4RT2A 4MEYA 4DO9A 5HHHA 4YFKA 4DL3A 3KTQA 4M0AA 5CJ7A 8ICOA 3GIMA 1XWLA 1Z00B 5J2KA 4F4YA 4F8RA 1D9DA 4RT3A 4DQSA 4JWNA 5DDYA 5KFCA 4J9SA 3K75D 1A76A 4ELTA 4JUZA 5DG9A 5KG0A 1S97A 3V6HA 4IRDA 2BPFA 3RJHA 4KTQA 1XS9D 5CWRA 1T4GA 5L1KA 3GILA 1RPLA 2C28A 4ELUA 2HHSA 5DQIA 1ZQEA 1ZQQA 4KLLA 8ICSA 1BPDA 1UT5A 2XY5A 3GIIA 4FBUA 2ISPA 4PH5A 5J2AA 2VA3A 1TK8A 3C2LA 4JV0A 3KHGA 3ZD9A 3AU6A 5KG3A 7ICJA 8ICNA 5KFZA 1K1SA 4TQRA 4ECUA 4DS4A 4UB2A 5DB9A 4F4ZA 4QZ9A 2HHWA 1ZQWA 4KN7A 3MR6A 2PI5A 3JPNA 3M8RA 5KFFA 1SKSA 2HHXA 1JX4A 3LK9A 3Q8QB 4KN4A 3B0XA 4BWMA 1S0OA 2B21A 1U4BA 4MF8A 4J9KA 3RR7A 2P6UA 3NTUA 1WCLA 2ATLA 2UVWA 4I27A 4P4PA 4QWDA 3PMLA 1L5UA 9ICGA 1RXWA 2FMSA 5J0XA 3MR3A 3HPOA 1DOQA 4I2AA 4C8NA 4LZGA 1NJWA 5KFTA 9ICRA 1CUKA 3H7IA 4UB3A 3RBDA 1TKDA 3PY8A 4DSKA 2VANA 3UPQA 1Z00A 3QEAZ 3RJIA 4QW9A 4YR3A 5KT6A 4DOAA 3V72A 4KITB 3HX0A 4ED7A 1KFTA 4ECSA 4XQ8A 4QZBA 4KLEA 2P66A 1V9PA 5KFAA 4DWIA 3PW5A 7ICVA 2NRWA 2W9CB 4TURA 5DQGA 2ASJA 8ICEA 7ICPA 5CB1A 1ZQSA 1T7PA 4MFFA 2PFQA 4M9LA 3RR8A 1U45A 4IR1A 3AUOA 3PX0A 4YMNA 5KFYA 5L1IA 4O3PA 9ICWA 4YMMA 5KT2A 2NRVA 4I2BA 2VA8A 9ICFA 3V7KA 4B9TA 1UA0A 5BOMA 2PXIA 4B9MA 2ZJAA 4PHDA 4I2DA 1CEZA 1ZQRA 5KFKA 3T5HA 3RBEA 1ZQUA 5D49A 4QWCA 4DOBA 4F92B 4RPYA 5IIOA 4EBEA 2C22A 2ZUDA 3PW0A 2HHVA 2W9AA 3BQ1A 5KFGA 2A1JB 4DSEA 1NOMA 3AU2A 7ICEA 3OJSA 1AROP 7ICMA 1S0VA 8ICTA 1JMSA 5EOZA 4Q45A 4TUSA 4KLJA 8ICGA 2ZJ5A 4PGQA 3Q8PB 1NKBA 1BPXA 3MGIA 3GV8B 3Q8RB 3RJEA 5DDMA 4Q43A 4JK1A 5KG5A 5KT4A 5KFOA 3MBYA 2HVIA 4O3QA 3PX6A 1ZQKA 1ZQGA 4F5NA 4KLUA 1ZQLA 4B9NA 2R8JA 4IR9A 2XGQA 1BGXT 3JPQA 4I2GA 1WCNA 2FPLA 8ICHA 3EYZA 8ICQA 4Z6DA 5IIKA 2Y1IA 1Y88A 3PVXA 9ICSA 4K4HA 8ICXA 5DGBA 4JV2A 5HP4A 4XA5A 3LWMA 1RYRA 1ZETA 2BCSA 1KRPA 8ICLA 4F3OA 1KTQA 2DPJA 8ICIA 3RJFA 8ICYA 1NK9A 4QWAA 3MABA 4ECZA 1ZQJA 1B43A 2R8KA 4TUPA 2Y1JA 1N48A 1TVAA 3UXNA 4F2SA 5KFQA 3V7LA 4RZRA 4F4KA 3UQ0A 5HMLA 5D46A 3M9OB 7ICUA 9ICBA 1N56A 4C8MA 4QZIA 5D4BA 3PR4A 1X9WA 5EWGA 3MFHA 1T3NA 2ALZA 3PV8A 2NRTA 4KLHA 1XO1A 2A1JA 2V9WA 9ICMA 3H40A 1S77D 2ZJ8A 4KLMA 9ICQA 3C2KA 1ZJMA 4DSJA 1X2IA 4M9HA 7ICIA 3KHHA 9ICVA 3KHLA 2R8GA 7ICTA 4C8KA 3TFSA 1L3SA 2BCVA 4F93B 1S76D 5KFBA 4GXJA 2LYHA 3H4DA 4DQQA 4M6WA 3C1ZA 4R8UB 4GC7A 4DFJA 4MFCA 4DLGA 2PFPA 4UBBA 4J9PA 1QLNA 2BQ3A 9ICCA 4I2HA 1NK8A 4ED0A 3C2MA 2BCQA 3MDCA 3C23A 4ECQA 3RH5A 3QEBZ 4EYIB 1DGSA 3G6YA 3UQ2A 4O5EA 3RTVA 1IM4A 2BGWA 3Q8MA 3BQTA 1Z3EB 5J2FA 2AU0A 1D8LA 5DBCA 4QWEA 3C5FA 4F91B 3GFKB 1TFRA 4Q44A 5J2GA 3M8SA 1T8EA 1U47A 1D8YA 4NLKA 3MDAA 9ICKA 2KN7A 1QSLA 8ICBA 9ICJA 3RJKA 4DL5A 4TUQA 1JN3A 4NY8A 3OSPA 4NM1A 3FDSA 9ICXA 4ECXA 2R8IA 4Z6EA 4YR2A 9ICOA 4M9JA 4P4OA 1ZQIA 1COOA 3RH4A 1TV9A 4RQ0A 4QZDA 4NLGA 3N97B 2IHNA 2HHUA 2H5XA 3EWAA 2ZTEA 3RH6A 3RRHA 3JPPA 5KFUA 1MQ3A 2ZUBA 4RQ3A 5KFDA 5KG1A 4RQ1A 4DLEA 4RUCA 5HHIA 1L3UA 3BDPA 5KTQA 4YXMA 8ICCA 4YQWA 4RNMA 4PGXA 5J2IA 4DFPA 4M9GA 2KZMA 4Z6CA 3SV4A 1NKEA 3M9MB 2M9NA 2MAXA 1XU4A 4F5OA 4ECRA 2HHTA 4KLDA 4YR0A 3THVA 3RAQA 2XCPA 4J9NA 4IRKA 7ICKA 2W9BB 3UXPA 3Q8LA 1SL1A 2BCUA 4EBDA 9ICPA 4YN4A 2HHQA 4FS2A 2JZBB 4NM2A 2JEJA 1ZQAA 2KFZA 8ICZA 5CP2A 5IILA 3M9NB 1S0MA 4I2FA 5J0PA 7ICOA 5KG4A 3LWLA 5L1JA 2C2DA 2FPMA 1L3VA 4YMOA 1KDHA 1RYSA 1ZJNA 2J6TA 2UVRA 4DSLA 1X9SA 3C1YA 5DLFA 4J9RA 4ECYA 4K4IA 1ZQTA 8ICFA 1JIHA 3NGDA 3C5GA 3PNCA 1SL2A 3ZDBA 3K4GA 5KFEA 2W8KA 1QSYA 3EPGA 4FO6A 4UAWA 3Q8SB 2R8HA 2WTFA 2NRZA 4C8LA 2DPIA 1NJXA 3MFIA 3OSNA 9ICTA 9ICUA 9ICAA 3Q8KA 3HW8A 1L3TA 4O3OA 4ED1A 3ZDAA 3LDAA 5DG7A 4GLXA 2F1JA 5DBBA 4FS1A 3ORYA 4ED8A 4DL4A 4YXJA 5L9XA 1BPZA 4JV1A 4FBTA 4QZEA 3TAQA 4MEXA 2XCAA 1RZTA 3JPSA 3UXOA 3SYZA 4DOCA 2AGOA 3HWTA 2J6UA 2PFNA 1HUOA 4DF4A 4I29A 4LZDA 3TFRA 1XSPA 8ICJA 3PR5B 1TAQA 4M2YA 5DLGA 2ASLA 2FLLA 3JPRA 3TI0A 5J0YA 2ZTDA 2BPCA 1ZQPA 3JPTA 2PI4A 1S10A 1ZQFA 2W9CA 4YVZA 3RJGA 5IINA 9ICIA 4O3RA 2ZTCA 1SKRA 4RQ6A 5KG7A 5JUMA 1KFDA 5KFRA 1PZNA 4K4GA 3N4MB 4DQRA 7ICLA 2IHMA 2J6SA 4QZFA 1KSPA 2FMPA 5DB8A 3TARA 4B9VA 4UB5A 3GIKA 3KHRA 2IA6A 1MSWD 4YG2A 4EYHB 1JXLA 5IIMA 5J2CA 1XC9A 1ZQMA 2BKEA 4NXZA 3OGUA 4Q8FA 5TZVA 8ICKA 9ICHA 5J0UA 3ISBA 4GXKA 5BPCA 1TK0A 2P6RA 4DQPA 4YD2A 3QZ8A 2JEIA 4MFAA 5KT3A 4ELVA 4I2IA 4UBCA 5KFLA 4ZH4A 3PX4A 4QZHA 4J9LA 4QZGA 4RQ8A 3BQ0A 9ICEA 3RB3A 5J0TA 3H8SA 3G6VA 4QW8A 4RPXA 5J0SA 3PW2A 4DS5A 3RB4A 1RXVA 4DL2A 4I28A 4P2HA 8ICMA 9ICNA 2OWOA 5HMMA 3B0YA 3IM1A 3G6XA 2UVVA 5IIJA 1UT8A 4NLNA 4DEZA 4TQSA 4I2JA 2C2EA 4O5CA 2I1QA 5BOLA 4ECTA 1SL0A 1NJYA 1QTMA 4IQWA 7ICQA 1D9FA 4C8OA 1UA1A 1LB2B 2KZZA 1ZQNA 1BPBA 4J9MA 3RRGA 8ICVA 2ASDA 4IQUA 1B22A 4KMUA 3FYHA 1KEJA 4YCXA 2DFLA 3BJYA 3GIJA 4DF8A 4I2EA 3RJJA 3OHAA 2BQUA 5KG6A 4O9MA 2GWSA 2BCRA 4IQTA 3SV3A 1HUZA 5J2BA 2AJQA 5KT5A 3TAPA 3V6JA 4DL7A 2IMWP 2HW3A 5J0QA 2KTQA 3ETLA 5KFHA 5DG8A 3QZ7A 1TAUA 4J9OA 4KLFA 4BWJA 4GC6A 2V4RA 3GQCA 4F4WA 3PW4A 5DGAA 3SZ2A 8ICPA 4R63A 5KFJA 2AQ4A 4DL6A 3H4BA 1S0NA 2HVHA 1U9LA 7ICHA 5DBAA 5F9NA 1IXRA 2XO7A 2KFNA 5L1LA 1H38A 4R65A 5KFVA 1A77A 2BHNA 3TANA 1MQ2A 4DSFA 2MUTB 1ZQCA 3GV5B 3V6KA 9ICLA 4R8UA 3GV7B 4X5VA 1U49A 3T5LA 4G3IA 4YP3A 1KFSA 4QZAA 4RQ2A 8ICWA 4M47A 2AGQA 4RNNA 2FLPA 2I9GA 7ICFA 8ICRA 3MGHA 2KZ3A 4ED2A 4ED3A 4Q8EA 5KFMA 5J2EA 3T5KA 5KFPA 3RAXA 4DSIA 2W9MA 4HYKA 4ECVA 7ICRA 2JEFA 5KFSA 4RUAA 1ZYQA 1NK0A 4LVSA 4R66A 4Z6FA 5J0RA 4ECWA 4DFKA 4EEYA 4NLZA 2IBKA 4R64A 3JPOA 1ZQVA 3T5JA 2BQRA 1LV5A 1BPYA 3ZDEA 4IQVA 2AGPA 3MR2A 1HJPA 1SZPA 7ICNA 5CA7A 4ED6A 5J0OA 3ZDCA 5J0WA 3C21A 5EWFA 3ZD8A 2RDJA 7ICSA 4MF2A 4CCHA 1KLNA 3ZDDA 2BPGA 4O3SA 4RQ4A 2Q0ZX 5CR0A 1NK4A 4RU9A 1XSLA 1TK5A 4B9SA 4BXOB 4RNOA 3V7JA 4DFMA 1NK6A 4UAZA 5DQHA 2BDPA 4O0IA 4JWMA 2VA2A 7ICGA 2XY7A 4UAYA 3EPIA 3E2EA 4RQ7A 3OHBA 3QE9Y 3BQ2A 4J9QA 4GXIA 2ISOA 4PGYA 5F9LA 2C2RA 1X9MA 4F5PA 4PPXA 2UVUA 1JXEA 4M04A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZUC A;  4KLG A;  1C7Y A;  4F4X A;  4B9U A;  1NK5 A;  3HP6 A;  5KT7 A;  2FMQ A;  4F5R A;  2F1I A;  5J2D A;  2MUT A;  2XY6 A;  4KLI A;  1BPE A;  4O3N A;  3T3F A;  5KFI A;  2PFO A;  4F2R A;  4BGD A;  4F50 A;  1ZQX A;  3OJU A;  2BR0 A;  1NK7 A;  1ZQB A;  2W8L A;  2F1H A;  4QWB A;  4EZ6 A;  2W9B A;  1ZQD A;  2XGP A;  4IRC A;  4EZ9 A;  3ISD A;  5CHG A;  1K1Q A;  2RDI A;  3TQ1 A;  2JZB A;  1U48 A;  5KFN A;  3SI8 A;  4KLO A;  4M6W B;  3RB0 A;  1QSS A;  8ICA A;  5J2H A;  4RQ5 A;  3EZ5 A;  4XRH A;  4YD1 A;  1NJZ A;  3H8J A;  1SKW A;  4KLS A;  1MC8 A;  5HNK A;  5KFW A;  4UB1 A;  4XUS A;  4EBC A;  3RB6 A;  4M9N A;  4KLQ A;  4B9L A;  5KG2 A;  5KFX A;  3EW9 A;  1S9F A;  4DQI A;  3HT3 A;  1NKC A;  3PMN A;  1XSN A;  5J29 A;  4BXO A;  3PO4 A;  2AQ0 A;  4P4M A;  4O5K A;  1ZQO A;  3PO5 A;  5EWE A;  5DKW A;  4UB4 A;  4E0D A;  3PW7 A;  4RPZ A;  5DB7 A;  8ICU A;  3GDX A;  4PHA A;  4QZ8 A;  4QZC A;  4PHE A;  5DB6 A;  2XC9 A;  1ZQH A;  4PHP A;  4F5Q A;  2V4Q A;  3MR5 A;  3ISC A;  1ZQY A;  2NRX A;  1ZQZ A;  2FPK A;  3H8W A;  4KLT A;  1BVS A;  5III A;  2FLN A;  4I2C A;  1EXN A;  4BDP A;  4UQG A;  3IHQ B;  2JEG A;  5C5J A;  5J2J A;  4RT2 A;  4MEY A;  4DO9 A;  5HHH A;  4YFK A;  4DL3 A;  3KTQ A;  4M0A A;  5CJ7 A;  8ICO A;  3GIM A;  1XWL A;  1Z00 B;  5J2K A;  4F4Y A;  4F8R A;  1D9D A;  4RT3 A;  4DQS A;  4JWN A;  5DDY A;  5KFC A;  4J9S A;  3K75 D;  1A76 A;  4ELT A;  4JUZ A;  5DG9 A;  5KG0 A;  1S97 A;  3V6H A;  4IRD A;  2BPF A;  3RJH A;  4KTQ A;  1XS9 D;  5CWR A;  1T4G A;  5L1K A;  3GIL A;  1RPL A;  2C28 A;  4ELU A;  2HHS A;  5DQI A;  1ZQE A;  1ZQQ A;  4KLL A;  8ICS A;  1BPD A;  1UT5 A;  2XY5 A;  3GII A;  4FBU A;  2ISP A;  4PH5 A;  5J2A A;  2VA3 A;  1TK8 A;  3C2L A;  4JV0 A;  3KHG A;  3ZD9 A;  3AU6 A;  5KG3 A;  7ICJ A;  8ICN A;  5KFZ A;  1K1S A;  4TQR A;  4ECU A;  4DS4 A;  4UB2 A;  5DB9 A;  4F4Z A;  4QZ9 A;  2HHW A;  1ZQW A;  4KN7 A;  3MR6 A;  2PI5 A;  3JPN A;  3M8R A;  5KFF A;  1SKS A;  2HHX A;  1JX4 A;  3LK9 A;  3Q8Q B;  4KN4 A;  3B0X A;  4BWM A;  1S0O A;  2B21 A;  1U4B A;  4MF8 A;  4J9K A;  3RR7 A;  2P6U A;  3NTU A;  1WCL A;  2ATL A;  2UVW A;  4I27 A;  4P4P A;  4QWD A;  3PML A;  1L5U A;  9ICG A;  1RXW A;  2FMS A;  5J0X A;  3MR3 A;  3HPO A;  1DOQ A;  4I2A A;  4C8N A;  4LZG A;  1NJW A;  5KFT A;  9ICR A;  1CUK A;  3H7I A;  4UB3 A;  3RBD A;  1TKD A;  3PY8 A;  4DSK A;  2VAN A;  3UPQ A;  1Z00 A;  3QEA Z;  3RJI A;  4QW9 A;  4YR3 A;  5KT6 A;  4DOA A;  3V72 A;  4KIT B;  3HX0 A;  4ED7 A;  1KFT A;  4ECS A;  4XQ8 A;  4QZB A;  4KLE A;  2P66 A;  1V9P A;  5KFA A;  4DWI A;  3PW5 A;  7ICV A;  2NRW A;  2W9C B;  4TUR A;  5DQG A;  2ASJ A;  8ICE A;  7ICP A;  5CB1 A;  1ZQS A;  1T7P A;  4MFF A;  2PFQ A;  4M9L A;  3RR8 A;  1U45 A;  4IR1 A;  3AUO A;  3PX0 A;  4YMN A;  5KFY A;  5L1I A;  4O3P A;  9ICW A;  4YMM A;  5KT2 A;  2NRV A;  4I2B A;  2VA8 A;  9ICF A;  3V7K A;  4B9T A;  1UA0 A;  5BOM A;  2PXI A;  4B9M A;  2ZJA A;  4PHD A;  4I2D A;  1CEZ A;  1ZQR A;  5KFK A;  3T5H A;  3RBE A;  1ZQU A;  5D49 A;  4QWC A;  4DOB A;  4F92 B;  4RPY A;  5IIO A;  4EBE A;  2C22 A;  2ZUD A;  3PW0 A;  2HHV A;  2W9A A;  3BQ1 A;  5KFG A;  2A1J B;  4DSE A;  1NOM A;  3AU2 A;  7ICE A;  3OJS A;  1ARO P;  7ICM A;  1S0V A;  8ICT A;  1JMS A;  5EOZ A;  4Q45 A;  4TUS A;  4KLJ A;  8ICG A;  2ZJ5 A;  4PGQ A;  3Q8P B;  1NKB A;  1BPX A;  3MGI A;  3GV8 B;  3Q8R B;  3RJE A;  5DDM A;  4Q43 A;  4JK1 A;  5KG5 A;  5KT4 A;  5KFO A;  3MBY A;  2HVI A;  4O3Q A;  3PX6 A;  1ZQK A;  1ZQG A;  4F5N A;  4KLU A;  1ZQL A;  4B9N A;  2R8J A;  4IR9 A;  2XGQ A;  1BGX T;  3JPQ A;  4I2G A;  1WCN A;  2FPL A;  8ICH A;  3EYZ A;  8ICQ A;  4Z6D A;  5IIK A;  2Y1I A;  1Y88 A;  3PVX A;  9ICS A;  4K4H A;  8ICX A;  5DGB A;  4JV2 A;  5HP4 A;  4XA5 A;  3LWM A;  1RYR A;  1ZET A;  2BCS A;  1KRP A;  8ICL A;  4F3O A;  1KTQ A;  2DPJ A;  8ICI A;  3RJF A;  8ICY A;  1NK9 A;  4QWA A;  3MAB A;  4ECZ A;  1ZQJ A;  1B43 A;  2R8K A;  4TUP A;  2Y1J A;  1N48 A;  1TVA A;  3UXN A;  4F2S A;  5KFQ A;  3V7L A;  4RZR A;  4F4K A;  3UQ0 A;  5HML A;  5D46 A;  3M9O B;  7ICU A;  9ICB A;  1N56 A;  4C8M A;  4QZI A;  5D4B A;  3PR4 A;  1X9W A;  5EWG A;  3MFH A;  1T3N A;  2ALZ A;  3PV8 A;  2NRT A;  4KLH A;  1XO1 A;  2A1J A;  2V9W A;  9ICM A;  3H40 A;  1S77 D;  2ZJ8 A;  4KLM A;  9ICQ A;  3C2K A;  1ZJM A;  4DSJ A;  1X2I A;  4M9H A;  7ICI A;  3KHH A;  9ICV A;  3KHL A;  2R8G A;  7ICT A;  4C8K A;  3TFS A;  1L3S A;  2BCV A;  4F93 B;  1S76 D;  5KFB A;  4GXJ A;  2LYH A;  3H4D A;  4DQQ A;  4M6W A;  3C1Z A;  4R8U B;  4GC7 A;  4DFJ A;  4MFC A;  4DLG A;  2PFP A;  4UBB A;  4J9P A;  1QLN A;  2BQ3 A;  9ICC A;  4I2H A;  1NK8 A;  4ED0 A;  3C2M A;  2BCQ A;  3MDC A;  3C23 A;  4ECQ A;  3RH5 A;  3QEB Z;  4EYI B;  1DGS A;  3G6Y A;  3UQ2 A;  4O5E A;  3RTV A;  1IM4 A;  2BGW A;  3Q8M A;  3BQT A;  1Z3E B;  5J2F A;  2AU0 A;  1D8L A;  5DBC A;  4QWE A;  3C5F A;  4F91 B;  3GFK B;  1TFR A;  4Q44 A;  5J2G A;  3M8S A;  1T8E A;  1U47 A;  1D8Y A;  4NLK A;  3MDA A;  9ICK A;  2KN7 A;  1QSL A;  8ICB A;  9ICJ A;  3RJK A;  4DL5 A;  4TUQ A;  1JN3 A;  4NY8 A;  3OSP A;  4NM1 A;  3FDS A;  9ICX A;  4ECX A;  2R8I A;  4Z6E A;  4YR2 A;  9ICO A;  4M9J A;  4P4O A;  1ZQI A;  1COO A;  3RH4 A;  1TV9 A;  4RQ0 A;  4QZD A;  4NLG A;  3N97 B;  2IHN A;  2HHU A;  2H5X A;  3EWA A;  2ZTE A;  3RH6 A;  3RRH A;  3JPP A;  5KFU A;  1MQ3 A;  2ZUB A;  4RQ3 A;  5KFD A;  5KG1 A;  4RQ1 A;  4DLE A;  4RUC A;  5HHI A;  1L3U A;  3BDP A;  5KTQ A;  4YXM A;  8ICC A;  4YQW A;  4RNM A;  4PGX A;  5J2I A;  4DFP A;  4M9G A;  2KZM A;  4Z6C A;  3SV4 A;  1NKE A;  3M9M B;  2M9N A;  2MAX A;  1XU4 A;  4F5O A;  4ECR A;  2HHT A;  4KLD A;  4YR0 A;  3THV A;  3RAQ A;  2XCP A;  4J9N A;  4IRK A;  7ICK A;  2W9B B;  3UXP A;  3Q8L A;  1SL1 A;  2BCU A;  4EBD A;  9ICP A;  4YN4 A;  2HHQ A;  4FS2 A;  2JZB B;  4NM2 A;  2JEJ A;  1ZQA A;  2KFZ A;  8ICZ A;  5CP2 A;  5IIL A;  3M9N B;  1S0M A;  4I2F A;  5J0P A;  7ICO A;  5KG4 A;  3LWL A;  5L1J A;  2C2D A;  2FPM A;  1L3V A;  4YMO A;  1KDH A;  1RYS A;  1ZJN A;  2J6T A;  2UVR A;  4DSL A;  1X9S A;  3C1Y A;  5DLF A;  4J9R A;  4ECY A;  4K4I A;  1ZQT A;  8ICF A;  1JIH A;  3NGD A;  3C5G A;  3PNC A;  1SL2 A;  3ZDB A;  3K4G A;  5KFE A;  2W8K A;  1QSY A;  3EPG A;  4FO6 A;  4UAW A;  3Q8S B;  2R8H A;  2WTF A;  2NRZ A;  4C8L A;  2DPI A;  1NJX A;  3MFI A;  3OSN A;  9ICT A;  9ICU A;  9ICA A;  3Q8K A;  3HW8 A;  1L3T A;  4O3O A;  4ED1 A;  3ZDA A;  3LDA A;  5DG7 A;  4GLX A;  2F1J A;  5DBB A;  4FS1 A;  3ORY A;  4ED8 A;  4DL4 A;  4YXJ A;  5L9X A;  1BPZ A;  4JV1 A;  4FBT A;  4QZE A;  3TAQ A;  4MEX A;  2XCA A;  1RZT A;  3JPS A;  3UXO A;  3SYZ A;  4DOC A;  2AGO A;  3HWT A;  2J6U A;  2PFN A;  1HUO A;  4DF4 A;  4I29 A;  4LZD A;  3TFR A;  1XSP A;  8ICJ A;  3PR5 B;  1TAQ A;  4M2Y A;  5DLG A;  2ASL A;  2FLL A;  3JPR A;  3TI0 A;  5J0Y A;  2ZTD A;  2BPC A;  1ZQP A;  3JPT A;  2PI4 A;  1S10 A;  1ZQF A;  2W9C A;  4YVZ A;  3RJG A;  5IIN A;  9ICI A;  4O3R A;  2ZTC A;  1SKR A;  4RQ6 A;  5KG7 A;  5JUM A;  1KFD A;  5KFR A;  1PZN A;  4K4G A;  3N4M B;  4DQR A;  7ICL A;  2IHM A;  2J6S A;  4QZF A;  1KSP A;  2FMP A;  5DB8 A;  3TAR A;  4B9V A;  4UB5 A;  3GIK A;  3KHR A;  2IA6 A;  1MSW D;  4YG2 A;  4EYH B;  1JXL A;  5IIM A;  5J2C A;  1XC9 A;  1ZQM A;  2BKE A;  4NXZ A;  3OGU A;  4Q8F A;  5TZV A;  8ICK A;  9ICH A;  5J0U A;  3ISB A;  4GXK A;  5BPC A;  1TK0 A;  2P6R A;  4DQP A;  4YD2 A;  3QZ8 A;  2JEI A;  4MFA A;  5KT3 A;  4ELV A;  4I2I A;  4UBC A;  5KFL A;  4ZH4 A;  3PX4 A;  4QZH A;  4J9L A;  4QZG A;  4RQ8 A;  3BQ0 A;  9ICE A;  3RB3 A;  5J0T A;  3H8S A;  3G6V A;  4QW8 A;  4RPX A;  5J0S A;  3PW2 A;  4DS5 A;  3RB4 A;  1RXV A;  4DL2 A;  4I28 A;  4P2H A;  8ICM A;  9ICN A;  2OWO A;  5HMM A;  3B0Y A;  3IM1 A;  3G6X A;  2UVV A;  5IIJ A;  1UT8 A;  4NLN A;  4DEZ A;  4TQS A;  4I2J A;  2C2E A;  4O5C A;  2I1Q A;  5BOL A;  4ECT A;  1SL0 A;  1NJY A;  1QTM A;  4IQW A;  7ICQ A;  1D9F A;  4C8O A;  1UA1 A;  1LB2 B;  2KZZ A;  1ZQN A;  1BPB A;  4J9M A;  3RRG A;  8ICV A;  2ASD A;  4IQU A;  1B22 A;  4KMU A;  3FYH A;  1KEJ A;  4YCX A;  2DFL A;  3BJY A;  3GIJ A;  4DF8 A;  4I2E A;  3RJJ A;  3OHA A;  2BQU A;  5KG6 A;  4O9M A;  2GWS A;  2BCR A;  4IQT A;  3SV3 A;  1HUZ A;  5J2B A;  2AJQ A;  5KT5 A;  3TAP A;  3V6J A;  4DL7 A;  2IMW P;  2HW3 A;  5J0Q A;  2KTQ A;  3ETL A;  5KFH A;  5DG8 A;  3QZ7 A;  1TAU A;  4J9O A;  4KLF A;  4BWJ A;  4GC6 A;  2V4R A;  3GQC A;  4F4W A;  3PW4 A;  5DGA A;  3SZ2 A;  8ICP A;  4R63 A;  5KFJ A;  2AQ4 A;  4DL6 A;  3H4B A;  1S0N A;  2HVH A;  1U9L A;  7ICH A;  5DBA A;  5F9N A;  1IXR A;  2XO7 A;  2KFN A;  5L1L A;  1H38 A;  4R65 A;  5KFV A;  1A77 A;  2BHN A;  3TAN A;  1MQ2 A;  4DSF A;  2MUT B;  1ZQC A;  3GV5 B;  3V6K A;  9ICL A;  4R8U A;  3GV7 B;  4X5V A;  1U49 A;  3T5L A;  4G3I A;  4YP3 A;  1KFS A;  4QZA A;  4RQ2 A;  8ICW A;  4M47 A;  2AGQ A;  4RNN A;  2FLP A;  2I9G A;  7ICF A;  8ICR A;  3MGH A;  2KZ3 A;  4ED2 A;  4ED3 A;  4Q8E A;  5KFM A;  5J2E A;  3T5K A;  5KFP A;  3RAX A;  4DSI A;  2W9M A;  4HYK A;  4ECV A;  7ICR A;  2JEF A;  5KFS A;  4RUA A;  1ZYQ A;  1NK0 A;  4LVS A;  4R66 A;  4Z6F A;  5J0R A;  4ECW A;  4DFK A;  4EEY A;  4NLZ A;  2IBK A;  4R64 A;  3JPO A;  1ZQV A;  3T5J A;  2BQR A;  1LV5 A;  1BPY A;  3ZDE A;  4IQV A;  2AGP A;  3MR2 A;  1HJP A;  1SZP A;  7ICN A;  5CA7 A;  4ED6 A;  5J0O A;  3ZDC A;  5J0W A;  3C21 A;  5EWF A;  3ZD8 A;  2RDJ A;  7ICS A;  4MF2 A;  4CCH A;  1KLN A;  3ZDD A;  2BPG A;  4O3S A;  4RQ4 A;  2Q0Z X;  5CR0 A;  1NK4 A;  4RU9 A;  1XSL A;  1TK5 A;  4B9S A;  4BXO B;  4RNO A;  3V7J A;  4DFM A;  1NK6 A;  4UAZ A;  5DQH A;  2BDP A;  4O0I A;  4JWM A;  2VA2 A;  7ICG A;  2XY7 A;  4UAY A;  3EPI A;  3E2E A;  4RQ7 A;  3OHB A;  3QE9 Y;  3BQ2 A;  4J9Q A;  4GXI A;  2ISO A;  4PGY A;  5F9L A;  2C2R A;  1X9M A;  4F5P A;  4PPX A;  2UVU A;  1JXE A;  4M04 A; 
#chains in the Genus database with same CATH topology
 3HIL A;  5AK3 A;  1NK5 A;  3T3F A;  4F50 A;  3H0R B;  2BR0 A;  1ZQB A;  3SMV A;  2W8L A;  3NVZ A;  4IRC A;  2XGP A;  3ISD A;  1JRP A;  5K4L A;  1QSS A;  4RQ5 A;  5HNK A;  4XUS A;  4M9N A;  4B9L A;  3ICX A;  3EW9 A;  1S9F A;  3AL0 B;  1XSN A;  2RQ5 A;  3SAF A;  4BXO A;  3BS5 A;  2DGZ A;  1Q46 A;  3QU4 A;  5EWE A;  5ALW A;  1IV8 A;  1QCK A;  2KK0 A;  4PHE A;  4PHP A;  2NRX A;  3KKA C;  2FPK A;  1T94 A;  1BVS A;  5ALX A;  2OEH A;  5J2J A;  4RT2 A;  3EUB 2;  4DL3 A;  2QB1 A;  4UAR A;  3GIM A;  1OUQ A;  1XWL A;  1Z00 B;  4DQS A;  5DDY A;  3K75 D;  4ELT A;  2BPF A;  3RJH A;  4KTQ A;  5AM0 A;  1T4G A;  5L1K A;  3GIL A;  2HHS A;  4C0Z A;  2KJ9 A;  4KLL A;  3D2Q A;  2XY5 A;  5G5H A;  4GFJ A;  4JV0 A;  3KHG A;  7ICJ A;  5KG3 A;  1CRX A;  1SV4 A;  2D6F C;  1ZQW A;  4KN7 A;  2LBO A;  2HSZ A;  3B0X A;  2B21 A;  4J9K A;  3RR7 A;  4P4P A;  1L5U A;  9ICG A;  1N60 A;  3MR3 A;  2XI9 A;  3HPO A;  1DOQ A;  5KFT A;  2QAR B;  3WU2 U;  4DSK A;  2ZXI A;  2VAN A;  2A1A A;  2XVT A;  1WUD A;  1FO4 A;  4QW9 A;  5KT6 A;  4KIT B;  3N7S C;  3LVW A;  4AYB F;  1KFT A;  3UM9 A;  2CN1 A;  4DWI A;  2NRW A;  4EX6 A;  4OCZ A;  4MFF A;  4RQN A;  2PFQ A;  5AM3 A;  1N5W A;  5KFY A;  5L1I A;  4O3P A;  4YMM A;  1RQN A;  4I2B A;  2VA8 A;  1UA0 A;  4B9M A;  4PHD A;  1ZQR A;  5KFK A;  5D49 A;  4QWC A;  4F92 B;  5IIO A;  2C22 A;  1F5S A;  8ICG A;  3FM9 A;  2MSN A;  5T14 A;  4PGQ A;  3Q8P B;  3Q8R B;  4NV0 A;  4O3Q A;  4B9N A;  5ALV A;  4IR9 A;  4NL9 A;  3JPQ A;  2FPL A;  1N61 A;  4Z6D A;  2YMP A;  4XA5 A;  2A19 A;  3LWM A;  1RYR A;  1KRP A;  8ICL A;  4CGZ A;  8ICY A;  3MAB A;  4ECZ A;  2B6G A;  1N48 A;  3QU2 A;  3V7L A;  4F4K A;  1X40 A;  5D46 A;  4QZI A;  5GTH U;  4FFD A;  1IG6 A;  2K4E A;  3MFH A;  2ALZ A;  3PV8 A;  3SEI A;  2VJ4 A;  1ZJM A;  3CYM A;  7ICI A;  1GO3 F;  7ICT A;  4C8K A;  1A0P A;  1S76 D;  4OD0 A;  2LYH A;  2WF9 A;  3C1Z A;  1L8L A;  4DLG A;  4ED0 A;  3MDC A;  1DGS A;  3RTV A;  1Z3E B;  3KD3 A;  5J2F A;  3C5F A;  4Q44 A;  3WK8 A;  3VCB A;  2WAQ C;  5J2G A;  3F2B A;  1NI3 A;  9ICK A;  2NV3 A;  1SWW A;  3E58 A;  1RYU A;  1ZQI A;  1TV9 A;  4QZD A;  1V85 A;  1WG8 A;  4NLG A;  2IHN A;  3JPP A;  2LYA A;  5KFD A;  5KG1 A;  4RQ1 A;  1L3U A;  2W43 A;  2OCE A;  3IRU A;  1NKE A;  2MAX A;  4F5O A;  4ECR A;  3THV A;  2W9B B;  4U7C A;  4G9B A;  5JU5 A;  2ZIW A;  2W7O A;  3CRX A;  7ICO A;  2E8P A;  2C2D A;  2J6T A;  1KDH A;  3GZF A;  4ECY A;  1JIH A;  4DCC A;  3C5G A;  2P35 A;  3EPG A;  3Q8S B;  2NRZ A;  3U26 A;  3UMG A;  3OSN A;  4PZN A;  2A3V A;  5KNI A;  3HW8 A;  3ORY A;  1BPZ A;  3BS7 A;  2XCA A;  3JPS A;  3HWT A;  2W03 A;  1FIQ A;  8ICJ A;  3WKE A;  3O0F A;  5G5G A;  1A6S A;  3D6J A;  1ZQP A;  3RJG A;  9ICI A;  5ALJ A;  5KG7 A;  1KFD A;  1X6I A;  1L8O A;  1Z19 A;  5KFR A;  3N4M B;  4DQR A;  3F2D A;  3TAR A;  5ALM A;  4PJ0 U;  2IA6 A;  1MSW D;  2G5I B;  5J2C A;  5TZV A;  9ICH A;  2P6R A;  4DQP A;  3QZ8 A;  4MFA A;  5KT3 A;  4HAI A;  4QZH A;  4J9L A;  9ICE A;  3RB3 A;  3G6V A;  2LI6 A;  4RPX A;  2PKE A;  4UAU A;  5CRX A;  5J0S A;  2ZIV B;  5AM4 A;  3UMC A;  1RXV A;  4I28 A;  3B0Y A;  2UVV A;  4DEZ A;  1KQQ A;  4ECT A;  4QJF B;  1QTM A;  1JRO A;  4KX5 A;  1UA1 A;  2Y9T A;  3E0F A;  2MU2 A;  5ALI A;  8ICV A;  1RG6 A;  4KMU A;  3J81 j;  3GIJ A;  4DF8 A;  4O9M A;  2HCF A;  5KT5 A;  3TAP A;  4DL7 A;  2XID A;  4UB6 U;  2G06 A;  2EZX A;  2G0A A;  2V4R A;  5AKZ A;  1SV0 C;  1M6Y A;  5KFJ A;  1ZD4 A;  4CF4 A;  5ALK A;  3TAN A;  1MQ2 A;  4DSF A;  1ZQC A;  5AI9 A;  5JRT A;  2AGQ A;  2FLP A;  4KX3 A;  2F2A B;  4Q8E A;  4RUA A;  1NK0 A;  4Z6F A;  4DFK A;  1Z1V A;  3T5J A;  2E3T A;  1HJP A;  4ED6 A;  3ZDC A;  5J0W A;  3NAS A;  5EWF A;  3ZD8 A;  7ICS A;  4NL9 C;  4O3S A;  2KNJ A;  4B9S A;  3V7J A;  4C4S A;  1NK6 A;  2JXJ A;  1PK1 A;  2VA2 A;  1J97 A;  2XY7 A;  3E2E A;  3OHB A;  3BQ2 A;  2ISO A;  3SD7 A;  4PPX A;  4J03 A;  2UVU A;  2ZUC A;  4F4X A;  4B9U A;  4QIW C;  2FMQ A;  2W55 A;  4F5R A;  4KLI A;  2MUT A;  1BPE A;  2EQY A;  5KFI A;  4BGD A;  3DV9 A;  1NK7 A;  1YZ7 A;  1AQ6 A;  4OJP A;  3WKC A;  1K1Q A;  2JZB A;  5KFN A;  3DDH A;  3SI8 A;  5J2H A;  2WB1 C;  1MC8 A;  4KLQ A;  1UCV A;  3N7P D;  5KFX A;  3HT3 A;  4ICA A;  5J29 A;  1WYG A;  4C4R A;  3PO4 A;  3N7R C;  1ZQO A;  2GLE A;  2W3S A;  2JH7 A;  2KIW A;  5DKW A;  2KVC A;  4E0D A;  2YN4 A;  3GDX A;  3BZC A;  5AKK A;  5AKG A;  2V4Q A;  4ACO A;  3MR5 A;  3H8W A;  5III A;  1EXN A;  4UQG A;  2K4P A;  3IHQ B;  2K8C B;  3KTQ A;  4YFK A;  5CJ7 A;  3WKA A;  1YZ6 A;  4Y2T A;  4EEL A;  4F4Y A;  4RT3 A;  5L1M A;  2HI0 A;  1A76 A;  1ZOL A;  4US8 A;  5DG9 A;  5ALR A;  3V6H A;  4IRD A;  4CRX A;  5CWR A;  1RPL A;  2C28 A;  4ELU A;  5DQI A;  1UT5 A;  2KE7 A;  2VA3 A;  2D3D A;  1TK8 A;  2KJ5 A;  3T79 A;  2W04 A;  4MHV A;  5AKI A;  3ZD9 A;  5AIA A;  2KHQ A;  1K1S A;  4TQR A;  5DB9 A;  1KBU A;  2HHW A;  2PI5 A;  3M8R A;  1SKS A;  2HHX A;  1JX4 A;  3Q8Q B;  1S0O A;  4MF8 A;  2P6U A;  4QWD A;  3TAD A;  5J0X A;  4I2A A;  1V97 A;  4IL6 U;  1CUK A;  3H7I A;  4UB3 A;  1TKD A;  1NZB A;  5C0Y A;  4ZOH C;  1Z00 A;  3RJI A;  2MRL A;  3ETR A;  4ED7 A;  2YMM A;  4KLE A;  2P66 A;  2HBJ A;  5KFA A;  3PW5 A;  7ICV A;  2W9C B;  1B0X A;  4C7Y A;  2EZZ A;  4YMN A;  3AQF A;  2JR5 A;  5BOM A;  2PXI A;  3T5H A;  3L3F X;  5AI6 A;  2A1J B;  3AU2 A;  3OJS A;  5ALT A;  1JAL A;  1JMS A;  2ZJ5 A;  1L7P A;  2JRZ A;  2YB1 A;  3OTQ A;  3MGI A;  2DKZ A;  2RRD A;  2JH1 A;  3GV8 B;  5DDM A;  3RJE A;  5KT4 A;  3MBY A;  2HVI A;  3ZI4 A;  1O08 A;  1WCN A;  4OJO A;  2OH2 A;  3DEE A;  8ICH A;  1Y88 A;  3PVX A;  5HP4 A;  1LKY A;  1Z4O A;  8ICI A;  1NK9 A;  1B43 A;  1TVA A;  3UXN A;  4F2S A;  3QUQ A;  3WK7 A;  1J2M A;  9ICB A;  4C8M A;  4NJ8 A;  1KN5 A;  2E8M A;  2HDO A;  4FZM A;  1T3N A;  5EE0 A;  4KLH A;  1XO1 A;  3I1Y A;  4KLM A;  9ICQ A;  3IG8 A;  3KHH A;  2WHE A;  5ALZ A;  2BCV A;  2Z7J A;  2JHD A;  2ZIU B;  4GXJ A;  4M6W A;  5E79 U;  4OO1 J;  4C80 A;  2DKX A;  3I76 A;  1NZP A;  1LVH A;  4J9P A;  1NK8 A;  2BCQ A;  4ECQ A;  1COK A;  3QEB Z;  4EYI B;  3G6Y A;  4O5E A;  4NLB A;  2BGW A;  5DBC A;  1YT3 A;  3M8S A;  1U47 A;  1D8Y A;  3MDA A;  2L5Y A;  2OHF A;  8ICB A;  3A0H U;  4TUQ A;  3OSP A;  4ECX A;  4YR2 A;  1V38 A;  9ICO A;  2E1F A;  3F5E A;  2AHO B;  1X42 A;  2H5X A;  2ZTE A;  3RH6 A;  3RRH A;  1MQ3 A;  5B66 U;  1DGJ A;  4RUC A;  5HHI A;  2F77 X;  5KTQ A;  2FJ6 A;  2KMD A;  4YQW A;  4RNM A;  4PGX A;  4DFP A;  4M9G A;  3SV4 A;  1XU4 A;  2HHT A;  4O3M A;  1FFU A;  4IRK A;  4J9N A;  3UXP A;  1SV0 A;  3Q8L A;  3B9J A;  9ICP A;  1L6N A;  1CI4 A;  1DXS A;  4NM2 A;  3HRD D;  3M9N B;  4I2F A;  5KG4 A;  4Y2J A;  5L1J A;  2FPM A;  7ICR A;  4DSL A;  4K4I A;  1ZQT A;  3NGD A;  2LYB A;  3K4G A;  3R9K A;  5KFE A;  2R8H A;  3MFI A;  9ICU A;  5AHX A;  5ALF A;  4WJ3 B;  1L3T A;  5DG7 A;  1ZQA A;  4GLX A;  2F1J A;  4YXJ A;  5L9X A;  3SAH A;  4FBT A;  3TAQ A;  1RZT A;  1ZRN A;  3SYZ A;  4DOC A;  2LM1 A;  4LZD A;  3HKZ C;  5J0Y A;  1FFV A;  2G08 A;  4B6J A;  3JPT A;  1S10 A;  1ZQF A;  3CP8 A;  3KBB A;  2JV3 A;  1SKR A;  4C4T A;  2H3V A;  1PZN A;  2CPR A;  2WF7 A;  2IHM A;  5H2F U;  2J6S A;  4QZF A;  1KSP A;  3WK9 A;  2FMP A;  2N1R A;  4YG2 A;  1JXL A;  3NRZ A;  1XC9 A;  1ZQM A;  4CF3 A;  3OGU A;  2W7P A;  3SQI A;  2HOF A;  4ZH4 A;  3BQ0 A;  1L7M A;  5J0T A;  3H8S A;  4NLC A;  2EAN A;  4DS5 A;  3ONN A;  9ICN A;  4FZL A;  1K5O A;  4Y2S A;  2LM4 A;  4NLN A;  3TAD C;  1SL0 A;  2CRX A;  1NJY A;  2KZZ A;  1BPB A;  3H0L B;  3KFU F;  1B22 A;  2H3Q A;  4YCX A;  1Q8K A;  3RJJ A;  3PSI A;  5FP0 A;  4IQT A;  5J2B A;  3V6J A;  5ALL A;  2HW3 A;  5J0Q A;  2KTQ A;  3QZ7 A;  4J9O A;  4BWJ A;  4GC6 A;  3QX7 A;  5DGA A;  3PW4 A;  8ICP A;  4P0Q B;  4DL6 A;  3H4B A;  4NWI A;  5AK5 A;  2EDU A;  2KJ8 A;  7ICH A;  5F9N A;  5L1L A;  1H38 A;  5KFV A;  1TAM A;  4R8U A;  3GV7 B;  4X5V A;  2ZIV A;  3T5L A;  3NVV A;  4YP3 A;  4QZA A;  4RQ2 A;  2K8A A;  3MGH A;  2GO7 A;  5AM1 A;  4ED2 A;  3T5K A;  5KFP A;  2W9M A;  4ECV A;  1ZYQ A;  4LVS A;  4R66 A;  1OW5 A;  4R64 A;  2BQR A;  1KW4 A;  5KAF U;  1SXD A;  2KSO B;  3C21 A;  4MF2 A;  5F3X B;  1HIW A;  3ZDD A;  2BPG A;  2HOQ A;  2Q0Z X;  4IS7 A;  4RNO A;  4DFM A;  4UAZ A;  5DQH A;  2BDP A;  4O0I A;  4JWM A;  7ICG A;  3NVY A;  3QU9 A;  4UAY A;  5F9L A;  2C2R A;  1JXE A;  5D4B A;  4M04 A;  4KLS A;  3AEV A;  4KLG A;  1C7Y A;  4CNQ A;  1X6J A;  5KT7 A;  5J2D A;  4O3N A;  2BDU A;  4F2R A;  4OJL A;  1SB3 C;  2F1H A;  4QWB A;  4EZ9 A;  5ALG A;  3TQ1 A;  2CXY A;  4P0P B;  1U48 A;  3GU3 A;  4YD1 A;  1NJZ A;  3H8J A;  5KFW A;  4UB1 A;  4EBC A;  1S5L U;  1ZD2 P;  1SGG A;  3PMN A;  4UB4 A;  3PW7 A;  8ICU A;  4PHA A;  4F5Q A;  4QIW F;  1ZQY A;  2FLN A;  4I2C A;  4BDP A;  5C5J A;  4MEY A;  4DO9 A;  5HHH A;  2H3I A;  4M0A A;  2DF4 B;  4F8R A;  5AIC A;  3KZX A;  3QXG A;  5KFC A;  4J9S A;  5KG0 A;  3CW2 C;  2QB0 A;  1XS9 D;  2ES6 A;  2WB1 F;  4JMU A;  4DFD A;  1F0M A;  3WKB A;  1UHU A;  2WF8 A;  1DK2 A;  4RQM A;  1BPD A;  2ISP A;  2KV2 A;  4PH5 A;  5ALH A;  2HBK A;  3C2L A;  2ZXH A;  5AKL A;  3AU6 A;  8ICN A;  5KFZ A;  4ECU A;  4F4Z A;  4QZ9 A;  3MR6 A;  3JPN A;  2Q4T A;  3LK9 A;  2LMR A;  5HR6 A;  1QQ6 A;  1U4B A;  2UVW A;  3PSF A;  3PML A;  2ZG6 A;  4LZG A;  1NJW A;  3PY8 A;  3RBD A;  4OJ6 A;  4Y2Y A;  1Z4N A;  2BZF A;  4YR3 A;  4DOA A;  4BJQ A;  3H0M B;  4ECS A;  4QZB A;  1ZD5 A;  2KVS A;  4TUR A;  2YY6 A;  4A8E A;  2ASJ A;  7ICP A;  1T7P A;  1U45 A;  9ICW A;  2XIC A;  4B9T A;  2KP7 A;  4FE3 A;  4I2D A;  1CEZ A;  4Y2U A;  3RBE A;  1ZQU A;  2E1E A;  4RPY A;  4EBE A;  3PW0 A;  1MA7 A;  5JTI A;  2HHV A;  5KFG A;  3H8M A;  1NOM A;  4F71 A;  1S0V A;  2H3Z A;  5AI4 A;  1RM6 C;  3RF9 A;  4Q45 A;  4KLJ A;  4TUS A;  1BNP A;  1VLB A;  1KKX A;  3PX6 A;  1ZQK A;  1ZQG A;  4F5N A;  3SR6 A;  2Y0S F;  1ZRM A;  4KLU A;  1ZQL A;  2E8O A;  1BGX T;  4I2G A;  3L5K A;  3WK4 A;  2KHV A;  5IIK A;  2ODG A;  2Y1I A;  8ICX A;  5DGB A;  1B4F A;  1ZET A;  1N63 A;  3AQE A;  4USA A;  1NNL A;  3TKA A;  4QWA A;  2R8K A;  4TUP A;  5KFQ A;  3UQ0 A;  3MGV A;  5HML A;  3M9O B;  7ICU A;  5A0L A;  4EX7 A;  2IOH A;  1X9W A;  5EWG A;  1N2X A;  2A1J A;  2V9W A;  3H40 A;  1S77 D;  2E8N A;  2ZJ8 A;  3C2K A;  3UMB A;  4M9H A;  2F8K A;  9ICV A;  3KHL A;  1L3S A;  2I5H A;  5KFB A;  4DQQ A;  1N5X A;  4Y2R A;  5ALP A;  4UBB A;  5ALQ A;  9ICC A;  4I2H A;  4F72 A;  3IP4 B;  3C2M A;  3RH5 A;  2IOF K;  3BQT A;  1D8L A;  3SEN A;  4NLK A;  9ICJ A;  3RJK A;  4NY8 A;  1VDV A;  2R18 A;  3FDS A;  9ICX A;  4Z6E A;  4P4O A;  3RH4 A;  2FI1 A;  2QLT A;  2ZIX B;  2PMZ C;  2HHU A;  1PK1 B;  4RQ3 A;  1UQV A;  2KIV A;  4EEN A;  2F76 X;  3BDP A;  4YXM A;  1Q3V A;  5J2I A;  1S8O A;  2KZM A;  4Z6C A;  1PUZ A;  3M9M B;  1ECW A;  3N28 A;  2RHF A;  2DQN B;  3RAQ A;  2EAM A;  7ICK A;  2BCU A;  4EBD A;  4YN4 A;  5KAI U;  3FC4 A;  3KOO A;  4FS2 A;  2HHQ A;  2JZB B;  2YML A;  8ICZ A;  3LWL A;  2UVR A;  3PSP A;  1RYS A;  1ZJN A;  1X9S A;  4J9R A;  8ICF A;  3PNC A;  2O6K A;  4UAW A;  4UAV A;  2WTF A;  3C29 A;  2HBM A;  1NJX A;  1T3Q A;  4ED1 A;  2QAR A;  3LDA A;  5DBB A;  4DL4 A;  4FS1 A;  3UXO A;  2PFN A;  2J6U A;  1HUO A;  2OXO A;  2G5H B;  3TFR A;  3PR5 B;  1L7N A;  1TAQ A;  2K60 A;  2ASL A;  2FLL A;  2ZTD A;  2PI4 A;  5IIN A;  2ZTC A;  4RQ6 A;  5JUM A;  1RDF A;  5AM2 A;  4K4G A;  1QH9 A;  4PL2 A;  2WFA A;  2EH9 A;  4B9V A;  2DUY A;  4UB5 A;  3GIK A;  3KHR A;  3QU5 A;  3L4P A;  3QU7 A;  5AIB A;  2BKE A;  4NXZ A;  4Q8F A;  5ALN A;  1JI7 A;  8ICK A;  5J0U A;  3ISB A;  4GXK A;  5BPC A;  3NRW A;  4YD2 A;  2JEI A;  3BQ7 A;  4ELV A;  4I2I A;  4QZG A;  2YMQ A;  3K1Z A;  4QW8 A;  3HKZ F;  2EAP A;  3PW2 A;  5ALU A;  2OWO A;  5HMM A;  3IM1 A;  5IIJ A;  4TQS A;  4I2J A;  5BOL A;  3LVV A;  2H3F A;  4IQW A;  1D9F A;  4C8O A;  7ICQ A;  1LB2 B;  3PST A;  2LKY A;  1ZQN A;  2ASD A;  4IQU A;  2KKV A;  4FZN A;  3FYH A;  5J8Y A;  5EE9 A;  2DFL A;  4I2E A;  5KG6 A;  2BCR A;  2KG5 A;  3SV3 A;  5ALE A;  1ED1 A;  1KL9 A;  2AJQ A;  2YTU A;  2IMW P;  3ETL A;  5DG8 A;  3NUQ A;  2ESE A;  3GQC A;  3SZ2 A;  1HEK A;  2AQ4 A;  2DL0 A;  2HVH A;  2G09 A;  3QNM A;  1IXR A;  2XO7 A;  9ICL A;  2JGA A;  4G3I A;  1RQL A;  4RNN A;  5AK4 A;  7ICF A;  8ICR A;  3QUB A;  1TE2 A;  2KZ3 A;  2K89 A;  3RAX A;  4HYK A;  2JEF A;  5KFS A;  1PVR A;  2G07 A;  5J0R A;  2WAQ F;  3HJE A;  1LV5 A;  1BPY A;  4IQV A;  5AI5 A;  2AGP A;  3MR2 A;  1SZP A;  7ICN A;  5CA7 A;  4Y2V A;  1WWV A;  2RDJ A;  1SWV A;  1KLN A;  3TAC B;  5EE1 A;  1LKY B;  4RQ4 A;  5CR0 A;  4C7Z A;  1TK5 A;  1XSL A;  4BXO B;  3BS5 B;  3SAG A;  1DK3 A;  4P0Q A;  5ALY A;  4RQ7 A;  3QE9 Y;  4J9Q A;  1X9M A;  4F5P A;  2MA1 A;  1UPH A;  4PZO A;  3HP6 A;  2F1I A;  2XY6 A;  2Y9U A;  2PFO A;  3KZI U;  1ZQX A;  3OJU A;  3M7D A;  1PVP A;  1FEZ A;  2W9B A;  1ZQD A;  4EZ6 A;  1P7D A;  5CHG A;  2F3N A;  3A0B U;  2RDI A;  5ALO A;  4KLO A;  4M6W B;  3RB0 A;  8ICA A;  4UW9 A;  1L7O A;  3EZ5 A;  4XRH A;  1SKW A;  1OXJ A;  2KSO A;  3RB6 A;  3IG5 A;  2KD1 A;  5KG2 A;  4DQI A;  1NKC A;  3AM9 A;  4UAS A;  4US9 A;  2KKP A;  4P4M A;  2AQ0 A;  4PL1 A;  4O5K A;  3WK5 A;  3PO5 A;  5AM5 A;  4RPZ A;  5DB7 A;  4QZC A;  4QZ8 A;  2KIC A;  5DB6 A;  2XC9 A;  1ZQH A;  3ISC A;  1ZQZ A;  3M6Z A;  4KLT A;  2JEG A;  5AI0 A;  1J2N A;  8ICO A;  1VJ5 A;  5J2K A;  2E5S A;  1D9D A;  1Z1B A;  4JWN A;  1JUD A;  1X66 A;  4JUZ A;  4P0P A;  1S97 A;  4AYB C;  3D2S A;  1DRG A;  2M0N A;  1ZQQ A;  1ZQE A;  4UAT A;  8ICS A;  4CF5 A;  3GII A;  4FBU A;  2WF6 A;  5J2A A;  2LPE A;  2AXT U;  1F44 A;  4DS4 A;  4UB2 A;  5KFF A;  1ZQ1 C;  1SZH A;  4KN4 A;  3IDW A;  4BWM A;  1SIJ A;  3NTU A;  1WCL A;  2ATL A;  4I27 A;  1RXW A;  2FMS A;  4C8N A;  9ICR A;  3FAH A;  3UPQ A;  3QEA Z;  2W54 A;  4CDG A;  2K4H A;  3V72 A;  3HX0 A;  4XQ8 A;  2GH1 A;  2VIX A;  3IV6 A;  1V9P A;  5DQG A;  8ICE A;  3QUT A;  5CB1 A;  1ZQS A;  4M9L A;  3RR8 A;  4IR1 A;  3LYS A;  3AUO A;  3PX0 A;  5KT2 A;  2NRV A;  9ICF A;  3V7K A;  3RFA A;  2FDR A;  2ZJA A;  1O03 A;  4DOB A;  2YQE A;  2ZUD A;  2W9A A;  3BQ1 A;  4DSE A;  7ICE A;  1ARO P;  7ICM A;  8ICT A;  1C20 A;  5EE3 A;  5EOZ A;  1NKB A;  1BPX A;  3NS1 A;  1X9X A;  4Q43 A;  5AKX A;  4JK1 A;  5KG5 A;  5KFO A;  2F8L A;  4Y2Q A;  2R8J A;  2XGQ A;  3AN1 A;  3EYZ A;  8ICQ A;  1ZXI A;  4UB8 U;  9ICS A;  4K4H A;  4JV2 A;  2B0C A;  2BCS A;  4F3O A;  1KTQ A;  2DPJ A;  3C28 A;  3RJF A;  1ZQJ A;  2Y1J A;  4OJ5 A;  3F5A A;  4RZR A;  4EEK A;  5J8Y C;  2GOL A;  1N56 A;  2I6X A;  5AKE A;  3PR4 A;  2HBL A;  2K8B B;  2NRT A;  9ICM A;  2OM6 A;  1D8B A;  4DSJ A;  1X2I A;  2R8G A;  1IIP A;  3TFS A;  4LJX A;  4F93 B;  2VKQ A;  2F44 A;  2W11 A;  3H4D A;  2DBY A;  4R8U B;  4GC7 A;  4DFJ A;  4MFC A;  2IOF A;  2PFP A;  3F2C A;  1QLN A;  2BQ3 A;  2DWQ A;  3C23 A;  2KEY A;  3QYP A;  3UQ2 A;  1IM4 A;  2ZIW B;  2RP5 A;  3Q8M A;  4BUG A;  2AU0 A;  2HMX A;  4KMO B;  4QWE A;  4F91 B;  3GFK B;  1TFR A;  5B5E U;  1T8E A;  5CEH A;  2KN7 A;  1QSL A;  3KKA A;  4DL5 A;  1JN3 A;  3S6J A;  4NM1 A;  2R8I A;  5TIS U;  1URJ A;  4M9J A;  1XNS A;  1COO A;  4RQ0 A;  3N97 B;  3EWA A;  3WK6 A;  5KFU A;  2ZUB A;  4DLE A;  2OYY A;  1BNO A;  8ICC A;  1PVQ A;  1MN8 A;  2M9N A;  3BZK A;  3IN5 A;  4KLD A;  4YR0 A;  2XCP A;  1SL1 A;  2VJ5 A;  2JEJ A;  2KFZ A;  4CE6 A;  5CP2 A;  5IIL A;  1S0M A;  5J0P A;  5AKY A;  1L3V A;  4YMO A;  3MC1 A;  2AH5 A;  3C1Y A;  5DLF A;  5ALS A;  3OPX A;  1SL2 A;  3ZDB A;  2W8K A;  1QSY A;  4FO6 A;  4BX9 C;  4C8L A;  2DPI A;  9ICT A;  9ICA A;  3Q8K A;  2PMZ F;  2ZIX A;  4O3O A;  3ZDA A;  3NVW A;  4ED8 A;  4JV1 A;  4QZE A;  4MEX A;  2AGO A;  3CNH A;  4DF4 A;  4I29 A;  1XSP A;  2NO4 A;  2WF5 A;  4M2Y A;  5DLG A;  3JPR A;  3TI0 A;  2KOB A;  2LHT A;  2BPC A;  2W9C A;  4YVZ A;  3ALR A;  4O3R A;  4Y2P A;  2HOI A;  1N62 A;  7ICL A;  2QB0 B;  3M1Y A;  3M6K A;  5DB8 A;  3I28 A;  4EYH B;  5IIM A;  2K4I A;  2EZY A;  1TK0 A;  1PK3 A;  1Q3U A;  4UBC A;  5KFL A;  3PX4 A;  5GTI U;  3ED5 A;  4RQ8 A;  5ALD A;  1QQ7 A;  4U6P A;  3WKD A;  2JMG A;  3D2N A;  3RB4 A;  8ICM A;  2YB4 A;  4DL2 A;  4P2H A;  3G6X A;  1UT8 A;  3VC8 A;  3PZP A;  5KL8 B;  2C2E A;  4O5C A;  2I1Q A;  5AKJ A;  4QNL A;  3RRG A;  4J9M A;  4GIB A;  4JB3 A;  3BJY A;  1KEJ A;  3OHA A;  2BQU A;  2GWS A;  2FE9 A;  1HUZ A;  2YX8 A;  2RLT A;  5AK6 A;  5KFH A;  1TAU A;  1QQ5 A;  4KLF A;  5AKH A;  4F4W A;  4R63 A;  1SXE A;  1ZD3 A;  1S0N A;  3K1R B;  1U9L A;  5DBA A;  2NO5 A;  2KFN A;  3F53 A;  4IC9 A;  2ZIU A;  1A77 A;  2BHN A;  4Y2X A;  4R65 A;  2MUT B;  3GV5 B;  3V6K A;  1U49 A;  2NYV A;  1KFS A;  8ICW A;  4M47 A;  2QKQ A;  1XO0 A;  2I9G A;  5AI8 A;  2D8C A;  4ED3 A;  5KFM A;  2W3R A;  5J2E A;  4DSI A;  5KL1 B;  4ECW A;  4EEY A;  4NLZ A;  2Y0S C;  2IBK A;  3JPO A;  1ZQV A;  3ZDE A;  5J0O A;  1WWU A;  4CCH A;  1NK4 A;  3AMZ A;  4RU9 A;  2EAO A;  4AP9 A;  5HR7 A;  3EPI A;  3QUC A;  4GXI A;  4PGY A; 
#chains in the Genus database with same CATH homology
 2ZUC A;  4KLG A;  1C7Y A;  4F4X A;  4B9U A;  1NK5 A;  3HP6 A;  5KT7 A;  2FMQ A;  4F5R A;  2F1I A;  5J2D A;  2MUT A;  2XY6 A;  4KLI A;  1BPE A;  4O3N A;  3T3F A;  5KFI A;  2PFO A;  4F2R A;  4BGD A;  4F50 A;  1ZQX A;  3OJU A;  2BR0 A;  1NK7 A;  1ZQB A;  2W8L A;  2F1H A;  4QWB A;  4EZ6 A;  2W9B A;  1ZQD A;  2XGP A;  4IRC A;  4EZ9 A;  3ISD A;  5CHG A;  1K1Q A;  2RDI A;  3TQ1 A;  2JZB A;  1U48 A;  5KFN A;  3SI8 A;  4KLO A;  4M6W B;  3RB0 A;  1QSS A;  8ICA A;  5J2H A;  4RQ5 A;  3EZ5 A;  4XRH A;  4YD1 A;  1NJZ A;  3H8J A;  1SKW A;  4KLS A;  1MC8 A;  5HNK A;  5KFW A;  4UB1 A;  4XUS A;  4EBC A;  3RB6 A;  4M9N A;  4KLQ A;  4B9L A;  5KG2 A;  5KFX A;  3EW9 A;  1S9F A;  4DQI A;  3HT3 A;  1NKC A;  3PMN A;  1XSN A;  5J29 A;  4BXO A;  3PO4 A;  2AQ0 A;  4P4M A;  4O5K A;  1ZQO A;  3PO5 A;  5EWE A;  5DKW A;  4UB4 A;  4E0D A;  3PW7 A;  4RPZ A;  5DB7 A;  8ICU A;  3GDX A;  4PHA A;  4QZ8 A;  4QZC A;  4PHE A;  5DB6 A;  2XC9 A;  1ZQH A;  4PHP A;  4F5Q A;  2V4Q A;  3MR5 A;  3ISC A;  1ZQY A;  2NRX A;  1ZQZ A;  2FPK A;  3H8W A;  4KLT A;  1BVS A;  5III A;  2FLN A;  4I2C A;  1EXN A;  4BDP A;  4UQG A;  3IHQ B;  2JEG A;  5C5J A;  5J2J A;  4RT2 A;  4MEY A;  4DO9 A;  5HHH A;  4YFK A;  4DL3 A;  3KTQ A;  4M0A A;  5CJ7 A;  8ICO A;  3GIM A;  1XWL A;  1Z00 B;  5J2K A;  4F4Y A;  4F8R A;  1D9D A;  4RT3 A;  4DQS A;  4JWN A;  5DDY A;  5KFC A;  4J9S A;  3K75 D;  1A76 A;  4ELT A;  4JUZ A;  5DG9 A;  5KG0 A;  1S97 A;  3V6H A;  4IRD A;  2BPF A;  3RJH A;  4KTQ A;  1XS9 D;  5CWR A;  1T4G A;  5L1K A;  3GIL A;  1RPL A;  2C28 A;  4ELU A;  2HHS A;  5DQI A;  1ZQE A;  1ZQQ A;  4KLL A;  8ICS A;  1BPD A;  1UT5 A;  2XY5 A;  3GII A;  4FBU A;  2ISP A;  4PH5 A;  5J2A A;  2VA3 A;  1TK8 A;  3C2L A;  4JV0 A;  3KHG A;  3ZD9 A;  3AU6 A;  5KG3 A;  7ICJ A;  8ICN A;  5KFZ A;  1K1S A;  4TQR A;  4ECU A;  4DS4 A;  4UB2 A;  5DB9 A;  4F4Z A;  4QZ9 A;  2HHW A;  1ZQW A;  4KN7 A;  3MR6 A;  2PI5 A;  3JPN A;  3M8R A;  5KFF A;  1SKS A;  2HHX A;  1JX4 A;  3LK9 A;  3Q8Q B;  4KN4 A;  3B0X A;  4BWM A;  1S0O A;  2B21 A;  1U4B A;  4MF8 A;  4J9K A;  3RR7 A;  2P6U A;  3NTU A;  1WCL A;  2ATL A;  2UVW A;  4I27 A;  4P4P A;  4QWD A;  3PML A;  1L5U A;  9ICG A;  1RXW A;  2FMS A;  5J0X A;  3MR3 A;  3HPO A;  1DOQ A;  4I2A A;  4C8N A;  4LZG A;  1NJW A;  5KFT A;  9ICR A;  1CUK A;  3H7I A;  4UB3 A;  3RBD A;  1TKD A;  3PY8 A;  4DSK A;  2VAN A;  3UPQ A;  1Z00 A;  3QEA Z;  3RJI A;  4QW9 A;  4YR3 A;  5KT6 A;  4DOA A;  3V72 A;  4KIT B;  3HX0 A;  4ED7 A;  1KFT A;  4ECS A;  4XQ8 A;  4QZB A;  4KLE A;  2P66 A;  1V9P A;  5KFA A;  4DWI A;  3PW5 A;  7ICV A;  2NRW A;  2W9C B;  4TUR A;  5DQG A;  2ASJ A;  8ICE A;  7ICP A;  5CB1 A;  1ZQS A;  1T7P A;  4MFF A;  2PFQ A;  4M9L A;  3RR8 A;  1U45 A;  4IR1 A;  3AUO A;  3PX0 A;  4YMN A;  5KFY A;  5L1I A;  4O3P A;  9ICW A;  4YMM A;  5KT2 A;  2NRV A;  4I2B A;  2VA8 A;  9ICF A;  3V7K A;  4B9T A;  1UA0 A;  5BOM A;  2PXI A;  4B9M A;  2ZJA A;  4PHD A;  4I2D A;  1CEZ A;  1ZQR A;  5KFK A;  3T5H A;  3RBE A;  1ZQU A;  5D49 A;  4QWC A;  4DOB A;  4F92 B;  4RPY A;  5IIO A;  4EBE A;  2C22 A;  2ZUD A;  3PW0 A;  2HHV A;  2W9A A;  3BQ1 A;  5KFG A;  2A1J B;  4DSE A;  1NOM A;  3AU2 A;  7ICE A;  3OJS A;  1ARO P;  7ICM A;  1S0V A;  8ICT A;  1JMS A;  5EOZ A;  4Q45 A;  4TUS A;  4KLJ A;  8ICG A;  2ZJ5 A;  4PGQ A;  3Q8P B;  1NKB A;  1BPX A;  3MGI A;  3GV8 B;  3Q8R B;  3RJE A;  5DDM A;  4Q43 A;  4JK1 A;  5KG5 A;  5KT4 A;  5KFO A;  3MBY A;  2HVI A;  4O3Q A;  3PX6 A;  1ZQK A;  1ZQG A;  4F5N A;  4KLU A;  1ZQL A;  4B9N A;  2R8J A;  4IR9 A;  2XGQ A;  1BGX T;  3JPQ A;  4I2G A;  1WCN A;  2FPL A;  8ICH A;  3EYZ A;  8ICQ A;  4Z6D A;  5IIK A;  2Y1I A;  1Y88 A;  3PVX A;  9ICS A;  4K4H A;  8ICX A;  5DGB A;  4JV2 A;  5HP4 A;  4XA5 A;  3LWM A;  1RYR A;  1ZET A;  2BCS A;  1KRP A;  8ICL A;  4F3O A;  1KTQ A;  2DPJ A;  8ICI A;  3RJF A;  8ICY A;  1NK9 A;  4QWA A;  3MAB A;  4ECZ A;  1ZQJ A;  1B43 A;  2R8K A;  4TUP A;  2Y1J A;  1N48 A;  1TVA A;  3UXN A;  4F2S A;  5KFQ A;  3V7L A;  4RZR A;  4F4K A;  3UQ0 A;  5HML A;  5D46 A;  3M9O B;  7ICU A;  9ICB A;  1N56 A;  4C8M A;  4QZI A;  5D4B A;  3PR4 A;  1X9W A;  5EWG A;  3MFH A;  1T3N A;  2ALZ A;  3PV8 A;  2NRT A;  4KLH A;  1XO1 A;  2A1J A;  2V9W A;  9ICM A;  3H40 A;  1S77 D;  2ZJ8 A;  4KLM A;  9ICQ A;  3C2K A;  1ZJM A;  4DSJ A;  1X2I A;  4M9H A;  7ICI A;  3KHH A;  9ICV A;  3KHL A;  2R8G A;  7ICT A;  4C8K A;  3TFS A;  1L3S A;  2BCV A;  4F93 B;  1S76 D;  5KFB A;  4GXJ A;  2LYH A;  3H4D A;  4DQQ A;  4M6W A;  3C1Z A;  4R8U B;  4GC7 A;  4DFJ A;  4MFC A;  4DLG A;  2PFP A;  4UBB A;  4J9P A;  1QLN A;  2BQ3 A;  9ICC A;  4I2H A;  1NK8 A;  4ED0 A;  3C2M A;  2BCQ A;  3MDC A;  3C23 A;  4ECQ A;  3RH5 A;  3QEB Z;  4EYI B;  1DGS A;  3G6Y A;  3UQ2 A;  4O5E A;  3RTV A;  1IM4 A;  2BGW A;  3Q8M A;  3BQT A;  1Z3E B;  5J2F A;  2AU0 A;  1D8L A;  5DBC A;  4QWE A;  3C5F A;  4F91 B;  3GFK B;  1TFR A;  4Q44 A;  5J2G A;  3M8S A;  1T8E A;  1U47 A;  1D8Y A;  4NLK A;  3MDA A;  9ICK A;  2KN7 A;  1QSL A;  8ICB A;  9ICJ A;  3RJK A;  4DL5 A;  4TUQ A;  1JN3 A;  4NY8 A;  3OSP A;  4NM1 A;  3FDS A;  9ICX A;  4ECX A;  2R8I A;  4Z6E A;  4YR2 A;  9ICO A;  4M9J A;  4P4O A;  1ZQI A;  1COO A;  3RH4 A;  1TV9 A;  4RQ0 A;  4QZD A;  4NLG A;  3N97 B;  2IHN A;  2HHU A;  2H5X A;  3EWA A;  2ZTE A;  3RH6 A;  3RRH A;  3JPP A;  5KFU A;  1MQ3 A;  2ZUB A;  4RQ3 A;  5KFD A;  5KG1 A;  4RQ1 A;  4DLE A;  4RUC A;  5HHI A;  1L3U A;  3BDP A;  5KTQ A;  4YXM A;  8ICC A;  4YQW A;  4RNM A;  4PGX A;  5J2I A;  4DFP A;  4M9G A;  2KZM A;  4Z6C A;  3SV4 A;  1NKE A;  3M9M B;  2M9N A;  2MAX A;  1XU4 A;  4F5O A;  4ECR A;  2HHT A;  4KLD A;  4YR0 A;  3THV A;  3RAQ A;  2XCP A;  4J9N A;  4IRK A;  7ICK A;  2W9B B;  3UXP A;  3Q8L A;  1SL1 A;  2BCU A;  4EBD A;  9ICP A;  4YN4 A;  2HHQ A;  4FS2 A;  2JZB B;  4NM2 A;  2JEJ A;  1ZQA A;  2KFZ A;  8ICZ A;  5CP2 A;  5IIL A;  3M9N B;  1S0M A;  4I2F A;  5J0P A;  7ICO A;  5KG4 A;  3LWL A;  5L1J A;  2C2D A;  2FPM A;  1L3V A;  4YMO A;  1KDH A;  1RYS A;  1ZJN A;  2J6T A;  2UVR A;  4DSL A;  1X9S A;  3C1Y A;  5DLF A;  4J9R A;  4ECY A;  4K4I A;  1ZQT A;  8ICF A;  1JIH A;  3NGD A;  3C5G A;  3PNC A;  1SL2 A;  3ZDB A;  3K4G A;  5KFE A;  2W8K A;  1QSY A;  3EPG A;  4FO6 A;  4UAW A;  3Q8S B;  2R8H A;  2WTF A;  2NRZ A;  4C8L A;  2DPI A;  1NJX A;  3MFI A;  3OSN A;  9ICT A;  9ICU A;  9ICA A;  3Q8K A;  3HW8 A;  1L3T A;  4O3O A;  4ED1 A;  3ZDA A;  3LDA A;  5DG7 A;  4GLX A;  2F1J A;  5DBB A;  4FS1 A;  3ORY A;  4ED8 A;  4DL4 A;  4YXJ A;  5L9X A;  1BPZ A;  4JV1 A;  4FBT A;  4QZE A;  3TAQ A;  4MEX A;  2XCA A;  1RZT A;  3JPS A;  3UXO A;  3SYZ A;  4DOC A;  2AGO A;  3HWT A;  2J6U A;  2PFN A;  1HUO A;  4DF4 A;  4I29 A;  4LZD A;  3TFR A;  1XSP A;  8ICJ A;  3PR5 B;  1TAQ A;  4M2Y A;  5DLG A;  2ASL A;  2FLL A;  3JPR A;  3TI0 A;  5J0Y A;  2ZTD A;  2BPC A;  1ZQP A;  3JPT A;  2PI4 A;  1S10 A;  1ZQF A;  2W9C A;  4YVZ A;  3RJG A;  5IIN A;  9ICI A;  4O3R A;  2ZTC A;  1SKR A;  4RQ6 A;  5KG7 A;  5JUM A;  1KFD A;  5KFR A;  1PZN A;  4K4G A;  3N4M B;  4DQR A;  7ICL A;  2IHM A;  2J6S A;  4QZF A;  1KSP A;  2FMP A;  5DB8 A;  3TAR A;  4B9V A;  4UB5 A;  3GIK A;  3KHR A;  2IA6 A;  1MSW D;  4YG2 A;  4EYH B;  1JXL A;  5IIM A;  5J2C A;  1XC9 A;  1ZQM A;  2BKE A;  4NXZ A;  3OGU A;  4Q8F A;  5TZV A;  8ICK A;  9ICH A;  5J0U A;  3ISB A;  4GXK A;  5BPC A;  1TK0 A;  2P6R A;  4DQP A;  4YD2 A;  3QZ8 A;  2JEI A;  4MFA A;  5KT3 A;  4ELV A;  4I2I A;  4UBC A;  5KFL A;  4ZH4 A;  3PX4 A;  4QZH A;  4J9L A;  4QZG A;  4RQ8 A;  3BQ0 A;  9ICE A;  3RB3 A;  5J0T A;  3H8S A;  3G6V A;  4QW8 A;  4RPX A;  5J0S A;  3PW2 A;  4DS5 A;  3RB4 A;  1RXV A;  4DL2 A;  4I28 A;  4P2H A;  8ICM A;  9ICN A;  2OWO A;  5HMM A;  3B0Y A;  3IM1 A;  3G6X A;  2UVV A;  5IIJ A;  1UT8 A;  4NLN A;  4DEZ A;  4TQS A;  4I2J A;  2C2E A;  4O5C A;  2I1Q A;  5BOL A;  4ECT A;  1SL0 A;  1NJY A;  1QTM A;  4IQW A;  7ICQ A;  1D9F A;  4C8O A;  1UA1 A;  1LB2 B;  2KZZ A;  1ZQN A;  1BPB A;  4J9M A;  3RRG A;  8ICV A;  2ASD A;  4IQU A;  1B22 A;  4KMU A;  3FYH A;  1KEJ A;  4YCX A;  2DFL A;  3BJY A;  3GIJ A;  4DF8 A;  4I2E A;  3RJJ A;  3OHA A;  2BQU A;  5KG6 A;  4O9M A;  2GWS A;  2BCR A;  4IQT A;  3SV3 A;  1HUZ A;  5J2B A;  2AJQ A;  5KT5 A;  3TAP A;  3V6J A;  4DL7 A;  2IMW P;  2HW3 A;  5J0Q A;  2KTQ A;  3ETL A;  5KFH A;  5DG8 A;  3QZ7 A;  1TAU A;  4J9O A;  4KLF A;  4BWJ A;  4GC6 A;  2V4R A;  3GQC A;  4F4W A;  3PW4 A;  5DGA A;  3SZ2 A;  8ICP A;  4R63 A;  5KFJ A;  2AQ4 A;  4DL6 A;  3H4B A;  1S0N A;  2HVH A;  1U9L A;  7ICH A;  5DBA A;  5F9N A;  1IXR A;  2XO7 A;  2KFN A;  5L1L A;  1H38 A;  4R65 A;  5KFV A;  1A77 A;  2BHN A;  3TAN A;  1MQ2 A;  4DSF A;  2MUT B;  1ZQC A;  3GV5 B;  3V6K A;  9ICL A;  4R8U A;  3GV7 B;  4X5V A;  1U49 A;  3T5L A;  4G3I A;  4YP3 A;  1KFS A;  4QZA A;  4RQ2 A;  8ICW A;  4M47 A;  2AGQ A;  4RNN A;  2FLP A;  2I9G A;  7ICF A;  8ICR A;  3MGH A;  2KZ3 A;  4ED2 A;  4ED3 A;  4Q8E A;  5KFM A;  5J2E A;  3T5K A;  5KFP A;  3RAX A;  4DSI A;  2W9M A;  4HYK A;  4ECV A;  7ICR A;  2JEF A;  5KFS A;  4RUA A;  1ZYQ A;  1NK0 A;  4LVS A;  4R66 A;  4Z6F A;  5J0R A;  4ECW A;  4DFK A;  4EEY A;  4NLZ A;  2IBK A;  4R64 A;  3JPO A;  1ZQV A;  3T5J A;  2BQR A;  1LV5 A;  1BPY A;  3ZDE A;  4IQV A;  2AGP A;  3MR2 A;  1HJP A;  1SZP A;  7ICN A;  5CA7 A;  4ED6 A;  5J0O A;  3ZDC A;  5J0W A;  3C21 A;  5EWF A;  3ZD8 A;  2RDJ A;  7ICS A;  4MF2 A;  4CCH A;  1KLN A;  3ZDD A;  2BPG A;  4O3S A;  4RQ4 A;  2Q0Z X;  5CR0 A;  1NK4 A;  4RU9 A;  1XSL A;  1TK5 A;  4B9S A;  4BXO B;  4RNO A;  3V7J A;  4DFM A;  1NK6 A;  4UAZ A;  5DQH A;  2BDP A;  4O0I A;  4JWM A;  2VA2 A;  7ICG A;  2XY7 A;  4UAY A;  3EPI A;  3E2E A;  4RQ7 A;  3OHB A;  3QE9 Y;  3BQ2 A;  4J9Q A;  4GXI A;  2ISO A;  4PGY A;  5F9L A;  2C2R A;  1X9M A;  4F5P A;  4PPX A;  2UVU A;  1JXE A;  4M04 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...