3KZXA

Crystal structure of a had-superfamily hydrolase from ehrlichia chaffeensis at 1.9a resolution
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
210
structure length
205
Chain Sequence
SMKQPTAVIFDWYNTLIDTSINIDRTTFYQVLDQMGYKNIDLDSIPNSTIPKYLITLLGKRWKEATILYENSLEKSQKSDNFMLNDGAIELLDTLKENNITMAIVSNKNGERLRSEIHHKNLTHYFDSIIGSGDTGTIKPSPEPVLAALTNINIEPSKEVFFIGDSISDIQSAIEAGCLPIKYGSDILSFKNFYDIRNFICQLIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a Had-superfamily hydrolase from Ehrlichia chaffeensis at 1.9A resolution
rcsb
source organism Ehrlichia chaffeensis
molecule tags Hydrolase
molecule keywords HAD-superfamily hydrolase, subfamily IA, variant 1
total genus 82
structure length 205
sequence length 210
ec nomenclature
pdb deposition date 2009-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.730 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 3kzxA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3kzxA01
2JARA 4FFDA 3U19A 4Y2SA 3M9LA 4CE6A 3DV9A 1Z4NA 5AKXA 2GHQA 1L8OA 3QUQA 2W43A 1MH9A 2YBDA 1K1EA 3OCYA 3QUTA 1RLMA 3E8MA 2YN4A 4UASA 1NNLA 5ALQA 3ZVMA 3NIWA 4AS3A 5ALNA 5AKJA 2B82A 3OCXA 5ALUA 3UMCA 1L7NA 4BKMA 2JGAA 3M1YA 4CF3A 1NRWA 3I76A 4UATA 5AVYA 3FPSA 3AR2A 1T9ZA 2BDEA 2HI0A 3OCVA 2AH5A 2FUCA 4RETA 5AVWA 4E88A 2HO4A 4JDPA 3OCZA 4EX7A 2CFSA 1U2SA 2YMPA 3WKEA 3ED5A 3ET5A 3PGLA 4EELA 1SU4A 3ZX5A 3WK6A 3HYCA 3L1VA 3OCUA 4HGRA 4HGNA 5ALWA 1ZJJA 4UW9A 4UMEA 2B8JA 1Z5GA 3QX7A 3L7YA 4IG4A 2B1RA 3WK4A 3U7HB 2G09A 1U7PA 2WF7A 2IOFK 1F5SA 3L1UA 4UMDA 4BEVA 1YJ5A 1RQNA 4XE5A 1KYTA 3R09A 2I34A 2MSNA 1EK2A 5AHXA 2Q4RA 2P9JA 2GFHA 4UAUA 2EATA 4XPZA 4H1WA 1Z4QA 1YNSA 5AKGA 3W5CA 5AM0A 3MN1A 4KX3A 4NABA 2WHEA 5AI0A 1ZRMA 4NWIA 1N8NA 3KDPA 2NO5A 5IT0A 3SF0A 3UM9A 1J97A 4F72A 3QGMA 1Z4LA 4CNQA 3PCTA 4YGYA 2YJ6A 1WPGA 2W11A 4J03A 4F71A 1RDFA 4RESA 5AI9A 2B0CA 3NUQA 3B9BA 2B1QA 4KNVA 1S8OA 3N5KA 1ZD2P 3I1YA 3PGVA 4I9FA 5ALGA 2YMLA 3KBBA 3ZX4A 4DWOA 3L8GA 4Y2TA 1PW5A 3AR3A 4YH1A 2C8KA 2C88A 2YFYA 3AR7A 4UAVA 5AI6A 1Q92A 4Y2XA 3WK7A 5ALMA 4JB3A 3N28A 1Q91A 4Y2YA 5AK5A 3U13A 2RARA 2BY4A 4C4TA 2Q4TA 1U7OA 3UMBA 5AW5A 4EZEA 5AW4A 4BNDA 5AKKA 3L8HA 1Z88A 3N8GA 3DNPA 5AIBA 2R8ZA 5AM5A 3FPBA 3TLMA 3ZWDA 4XQ0A 1ZRNA 4BBJA 2FUEA 2YJ3A 1IWOA 4NFLA 3NALA 4IFTA 1RMTA 5AVUA 3WKCA 1X42A 1RPZA 3FZQA 3GYGA 4AP9A 1N9KA 3QXGA 2O2XA 4Y2VA 1XVIA 2MU1A 2R8EA 1AQ6A 4AS2A 2AGVA 1VFPA 3A1EA 3SKYA 1YMQA 2ZBEA 2ZBGA 3IB6A 3WKAA 2P69A 5AW8A 2IOFA 3B8EA 3U7GA 3CNHA 1XP5A 3MMZA 4FYPA 5ALDA 4HAIA 4BX3A 3QU5A 5AKZA 2NYVA 5AW0A 5AESA 4QJBA 5ALHA 2RBKA 2I7DA 3E81A 1TA0A 1QH9A 5AK4A 3ZVNA 2YMQA 2B30A 3ZU6A 3SLRA 2OA0A 4O8CA 2R8XA 2W4MA 3SHQA 3W5BA 3L0YA 3ET4A 5IT4A 5FP0A 1Z4OA 3A1DA 3ZI4A 1RLOA 5AVVA 2RAVA 1NF2A 1VJ5A 2O9JA 3QU7A 4QQFA 2OBBA 3FVVA 1L6RA 1U02A 4HYTA 2CFRA 4DW8A 4EEKA 3QUBA 1RLTA 2JAOA 4Y2PA 5ALSA 1SWWA 2C9MA 5A3SA 3F9RA 4OFZA 4MUMA 1CQZA 1RMYA 3L5KA 3EWIA 3I28A 4B6JA 2B8EA 2FPRA 3WKBA 3ZVLA 3ZW7A 1RMQA 2YMMA 2R8YA 3OTQA 4C4RA 1CR6A 5ALLA 5AK6A 1L7MA 3OCWA 1U2TA 2NO4A 2ZOSA 3KOOA 3QU4A 4Y2UA 5AVXA 3L0CA 4BX0A 3QLEA 2G80A 3WK9A 4BNDB 1LTQA 1T5SA 4UU1A 2GHTA 3QYPA 1YDFA 3KC2A 1RKUA 1TJ4A 2PQ0A 2RB5A 5ALTA 4HGPA 5AI4A 3D6JA 4YIHA 3R4CA 1WR8A 4UM7A 5AKHA 4DCCA 1RRCA 2FPXA 2I33A 3U26A 1TE2A 5AICA 2VKQA 2ODAA 3RFUA 1EK1A 1ZD3A 3NANA 3EPRA 2PR7A 5ALEA 3NRJA 1J8DA 3QU9A 1FEZA 3WK5A 1L7PA 2G0AA 4Y3UA 3ZTYA 2X4DA 2PKEA 2I54A 3DAOA 2GO7A 3WK8A 3UMGA 3QU2A 3PDWA 3W5DA 2HF2A 5AKLA 2G1AA 3HLTA 3ZWKA 4XOUA 4KN8A 2HCFA 3SKXA 5ALFA 3SD7A 1LVHA 2QLTA 5AKEA 1QQ7A 1ZD4A 1O03A 3FM9A 5AVZA 4EENA 3EF0A 4G9BA 4OHFA 5AM1A 5AIAA 5AVRA 4MWOA 2I6XA 3E84A 3L8EA 4ZEXA 3SMVA 5AW7A 1Y8AA 4FE3A 3KZXA 4Y2JA 5AW9A 3MPOA 1WVIA 3AR8A 4UM5A 3L8FA 4UMVA 5ALYA 4GXTA 1L7OA 2P11A 3U7FB 1Z4PX 5AKYA 4NAVA 1Z4MA 3W5AA 2WF5A 1SWVA 4DFDA 4BX2A 1S2OA 3ONNA 4ZEWA 4ZEVA 2JAWA 2ZBDA 3ESRA 3ZUPA 2YJ4A 3J7TA 4G63A 1QQ5A 1ZOLA 1QQ6A 3S6JA 2CN1A 2FI1A 3B9RA 5ALOA 3AR5A 2IA5A 5AVTA 3CZ4A 2ZG6A 1WZCA 5A3QA 2IOHA 2WF6A 4KX5A 4BEWA 1Z5UA 3RF6A 5ALJA 2G06A 1ZD5A 4HGOA 3KD3A 4EX6A 2FPUA 3FGOA 1JUDA 3BA6A 2WM8A 1RKVA 1YS9A 1ZS9A 2BDUA 3I6BA 3L0BA 2YY6A 4UMFA 1TJ3A 5AM2A 2HSZA 2FPWA 2D2VA 2OM6A 1T5TA 2HDOA 2DQSA 5T41A 2FDRA 2HF7A 2C8LA 2WF8A 3IJ5A 5AM3A 2CFTA 4CF5A 1VJRA 1XPJA 3WGVA 3A3YA 3AR9A 3AR4A 5AVQA 2G08A 2EAUA 3QNMA 2HHLA 5AKIA 1Z4IA 4OD0A 1L8LA 1RC8A 5ALKA 2WF9A 4PNHA 1O08A 2ZXEA 4CF4A 5A3RA 5JJBA 2JAUA 3A1CA 3P96A 5AI5A 4J2TA 2OYCA 5AW6A 1Z4JA 1RQLA 2GMWA 3QUCA 4OCZA 3OPXA 3E58A 5AW3A 1Z4KA 3WGUA 3N1UA 5ALRA 3U7EB 5AI8A 4UARA 4L6AA 5ALVA 5IS2A 2ZBFA 2G07A 3AR6A 3VAYA 5ALPA 2Q5EA 1YV9A 2AMYA 5AVSA 3N07A 2FEAA 5AK3A 2HEGA 2QYHA 4YIKA 4YCMA 2I55A 5ALXA 4Y2RA 1TJ5A 5ALIA 3BWVA 2IYEA 1RKQA 4L57A 3EF1A 3ESQA 4UU0A 5ALZA 2HX1A 2FPSA 3NAMA 4KYTA 4BYGA 4YCNA 4L6CA 4KNWA 4NV0A 3WKDA 2AUTA 2P27A 4Y2QA 3ZTWA 1QYIA 2HOQA 4HGQA 4YCLA 3R9KA 5AW2A 3K1ZA 5AW1A 3DDHA 3IRUA 4I9GA 5E0OA 4C4SA 5AM4A 2WFAA 2YJ5A 4GIBA 2EARA 3MC1A 2C4NA 3NASA
chains in the Genus database with same CATH superfamily
1J0DA 2HL6A 3H0LB 3Q87B 4Z4EA 2EP7A 3CCBA 1Z4NA 1VFNA 3ZU5A 3N7UA 3NBUA 4RQUA 1CJSA 5ADVA 1O0BA 3MT9A 1XR3A 2J7KA 2LCIA 3ES9A 4BBZA 2CVPA 2WBLC 1A69A 3JXEA 4KXUA 3TVTA 1J70A 4LE0A 3ZIAA 1JHAA 4BX8A 3QHAA 3PEUA 1F6DA 3OGUA 1H5UA 4RUAA 1RAIA 3PIRA 3UENA 4JEUA 2C2KA 3WA6A 1OFGA 3OJOA 3QKSA 4YHHB 3LUPA 4X71A 4NFHA 4Q02A 5ILOA 2OHFA 2J7PD 1CU1A 1GG2A 2DG2A 3ZG6A 3UFXA 3VH4A 1D7AA 2REOA 1M7GA 1DFHA 1OIXA 1TVMA 1CIJA 1FFEA 1WCWA 1W6RA 2J6HA 1RI1A 1YMVA 3GR6A 4YAGA 4IV0A 2BKVA 4GPZA 1Y3FE 2BKUA 2GJKA 4D5GA 3KYJB 2I66A 3PFGA 2FUKA 3LVBA 4BNVA 4P3PA 3RC2A 3V1UA 1NRWA 4E12A 4RMJA 5IIIA 2WI8A 1MO4A 2ZAGA 4KVZA 1TCCA 1TM7E 1IOZA 2XITA 3AIOA 3M6WA 5DW0A 3ZU2A 1AGPA 1P8JA 4JI5B 3G6YA 2VHYA 1IHDA 3H3XA 3NHMA 1TKCA 1KI3A 5L9AA 1CQWA 1T8YA 3P0IA 4FI3F 2AZTA 3M6IA 3H75A 1H42A 4ZOCA 2UYQA 3VR5H 1JKIA 1GL9B 3BTVA 4M9GA 4OQQA 3P2YA 1R4MB 4KLNA 3TQHA 4FYIA 3I6MA 2OKCA 3AL2A 3EHDA 3WK6A 1C8VB 1JXAA 1HQCA 2IXEA 2YN2A 3L1VA 4NNPA 4U4AA 4BNXA 6REQA 5L53A 3S8EA 4UNPA 1VMEA 3FZYA 4OQYA 1JQLB 1QCYA 3QMMA 4QULA 4Z99A 1VJCA 5LP6B 4U3JA 1Z18A 1N5WA 2XCAA 3TQQA 1G3RA 1NN1A 4RK1A 1NBWB 2HPZA 1N0VC 1YIOA 2RH9B 2P6NA 1DQRA 1PK9A 1SOVA 4DDKA 4LJ5A 3RH6A 4PN3A 2NAFA 4QDKA 2I1LA 3KUKA 5DNDA 2BFBB 4AG3A 5L3SA 3NYIA 1P0MA 2W8BB 4JAVC 4MUIA 1JT2A 1XXHE 1TVKB 1JI3A 1XF9A 2F1KA 4JBNA 2Z3WA 1TZMA 1Z0UA 3OUZA 3JAWA 3IHQB 2DHQA 3VV3A 1ZXXA 4LYHA 2OCAA 4EO9A 2XOKA 2KSOA 4ECWA 8ICLA 1G8HA 2WAXA 3QITA 1UJ4A 2ON6A 5AHXA 3N2KA 4K81B 4KU4A 1JU3A 1SL2A 1LW7A 1T0JB 1L6IA 2O2ZA 2Q3LA 1ZXBA 4J9KA 4H27A 2K8CB 1FNBA 4AUEA 5K01A 2XDWA 5FQOA 3MGIA 4ECQA 2Q46A 3F71A 3HYRA 4GR5A 2O1SA 3AMZA 3A1UA 1E1LA 4GMFA 1KFEB 5DX8A 2A6PA 2KX7A 3RIMA 9ICNA 1IK4A 3TW4A 1U8EA 4ER0A 3F73A 2ZKIA 1Z2OX 3CEHA 3EZ6A 1XC9A 4N47A 1NOIA 4LJ8A 4DV7B 4KLMA 3DKRA 4Z1OA 1MEEA 3D0QA 5LZ2A 1S5PA 1GL7A 1MX3A 2YZKA 1EWKA 5K0EA 2AN9A 1EB9A 3KE9A 4FZJA 4QGSA 1Z37A 5FPSA 1XZEA 4KUHA 2QBYB 3RM3A 3ANNA 1XO0A 5FJJA 5AQ1A 1K4KA 2FK8A 5LB2A 3DYIA 2D4AA 4FFBA 4HQFA 4UPDA 1Z3IX 1YRAA 5HP4A 4P35A 3EA0A 5C46F 5DYWA 1G66A 4QZHA 1P2GA 1DXHA 2WTEA 3DOCA 4LY0A 3F2DA 4MKHA 2YWDA 4PE5B 4YCJA 2QZSA 2O3SA 2QN9A 3N5KA 1IATA 2O2IA 3QG1A 1EFRD 3K1AB 4CYMA 3L8GA 1R8XA 1NW4A 4A5OA 1MQAA 5HZGA 3IURA 1L7BA 3TKLA 4BNKA 2ICAA 3LYUA 2VDWA 2DPGA 2YWFA 3D8HA 4BGEA 5C8DA 1I9GA 3RW9A 5GONA 3TSYA 5HUJA 3HSSA 5KVCA 1ZQEA 2P6MA 5DTEA 2ST1A 4MVXA 3ST7A 1WZIA 4X6LA 1QYXA 1XZGA 4LVCA 5K0NA 4GL2A 1BG6A 5JV5A 3AF0A 4K40A 3GNSA 3KKMA 1Q3KA 3Q2IA 2WHYA 3UQ0A 1JQEA 2VYCA 1A77A 3CLRD 2QTBA 4GRAA 3THRA 2VJYA 1MFZA 1W4CA 3MWFA 4HDMA 4XQEA 1Z3CA 4Q03A 2Y4OA 3E3AA 5EFZA 3BOSA 4OHRA 5EP3A 3T3MB 4IR9A 1ZUIA 5FKJA 1ISRA 1YS6A 3BWXA 4FOLA 1G1AA 4H7EA 3ZWDA 1N2CE 2L19A 2WK1A 4R64A 1UBLS 1UDCA 4Q1VA 3TM5A 1I1OA 2G7MC 2ZB8A 3A31A 4RACA 1X1SA 3RSOA 3QPUA 2P3SA 5BMVF 5LM3A 3FBWA 4NP6A 3PBKA 1PNOA 1V3VA 4TV9F 5GZ6A 2QTHA 4PM4A 4BLUA 4ND1A 3CVOA 2CMFA 1XTPA 2B78A 3M2TA 3IIEA 4GR4A 1YS2X 2ZRMA 2IOFA 1E9CA 4EVRA 4HPXB 1EFCA 4PPFA 5EFOA 5ALDA 1P80A 1VE3A 4V1CB 1YFKA 1D9FA 2QPLA 4AJIA 4A26A 3TOZA 1B6GA 1R7RA 4O4LF 5FOXA 1HRKA 3HBJA 4P7JA 2HLPA 2J6BA 3W04A 1RHRA 3GK3A 2H1WA 4V0LA 3IDQA 4BUCA 3IBCA 1Z39A 3JWIA 2KE5A 2DKNA 1DC5A 3AHIA 3L7JA 3EIOA 2PPLA 4JZYA 3IEMA 3IO5A 4JD5A 5A0VA 1U7UA 1M5RA 1TU3A 1UK6A 1MW9X 4PO9A 1V5IA 1OF1A 5EQFA 5JI2E 3DV0B 4ZT2A 3TLGB 3W5SA 5GWXA 3IAS6 4F97A 1N2JA 4UD2A 2P8JA 2ZT8A 3E8XA 1NUTA 3GROA 2JLWA 4TYWA 2GPTA 3IDZA 4ZTUB 3TAQA 1Z16A 2FZVA 3DDWA 1LH0A 1IBSA 2ZR9A 4H7DA 1T0PA 4PL2A 1RRGA 4R8UB 1VMIA 2ZUSA 4RZ3A 2BHTA 2AMJA 5KNBD 1YL5A 5DNWA 4M9HA 2COEA 1ML4A 2OBXA 2PVPA 3CUSA 3K15A 3QEMB 4MUXA 2VSXA 4LJ9A 4Y7CA 1UXJA 1A9QA 2AF4C 3L5KA 3IAFA 2DPXA 3LS2A 1NJYA 1E6KA 2RGCA 3EWIA 4JY7A 4KQ9A 2WIKA 4AS3A 1QKJA 3JQ6A 5BNWA 4J9RA 1TT7A 1H6BA 1ZISA 2BEVB 2F64A 3DMDA 4MYTA 3WIEA 4A6PA 5JQGB 3HFJA 4RV4A 2NZ2A 1FNNA 2NAPA 4ZAWA 2XIDA 5EXSA 3VX3A 1UZMA 4QFMA 5EJ5A 3IHLA 1TCAA 4FC6A 3E18A 2PFGA 4QUEA 4Z0HO 1KYZA 2IIBA 4LYYA 2ZOSA 4WZAA 5A03A 4YK7A 3KOOA 3O38A 4PZZA 4ECRA 1EIWA 4CT5A 1JTEA 2CVOA 4JI2B 3AB7A 2IZ0A 1P8AA 2Q1SA 3MJ4A 5J4VA 3B1VA 3B3GA 3I30X 8ICUA 4RNCA 1R9NA 1SMKA 1ZI8A 1Z6PA 2J9ZB 2NNWB 3F2IA 3UAXA 3SIRA 3K6RA 2V6IA 4ESVA 7ICPA 3HPQA 4CPDA 4ELTA 4XTRA 4HLNA 4ESOA 4K0RA 4OQXA 2WWGA 4YQWA 1OZHA 3GMTA 4DOCA 4BNYA 1XZDA 4PANA 3ZWWA 1E0KA 1T8TA 1DAGA 4IM7A 5HBGA 3T4EA 2OGSA 2XUJA 3A6JA 5LDHA 4GWGA 3LOQA 4RPGA 4UKDA 2KJ8A 4RPLA 1BQ3A 4BO8A 1N63A 1TFUA 1TO6A 4NEQA 3D6JA 2OR3A 4KIGA 1NR5A 2WVGA 3G7SA 1GAEO 2J0EA 3IA2A 3MGVA 3EG5A 1CZNA 4O59O 2X0DA 5EJEA 4JXZA 5KYVA 5KG6A 1X9MA 4Q7QA 1IVSA 2ETXA 4R1PA 1D4FA 3M8SA 2Y9PB 1RS0A 3DKPA 4INAA 1Y3DE 2W9XA 5IK2A 4FFLA 5NULA 3USCS 1QX3A 4ZZ1A 5CAEA 2R8RA 3OU6A 1ECGA 4GYJA 5T8KC 4GE3A 3EZ5A 2O20A 4I4NA 4W5WA 4KLUA 1NATA 4FEEA 1HDRA 4B9AA 2GJ9A 3W5VA 1D5CA 3GIMA 3C6KA 2Q5JA 1YU9A 1VXOA 5GOZA 4NLGA 3TCKA 1YK1A 2XWQA 1VRVA 2FW8A 1QWOA 1AIPA 3MMPA 4PO8A 2FSSA 3WFIA 3QIVA 4XASA 1PEAA 2JR5A 2QE7D 1JAIA 4XPIB 4FINA 1RYFA 1HFKA 4REQA 2PWAA 2VP5A 3O2QB 2AXTU 4F50A 1MQSA 4TQRA 1PBTA 2FMHA 1MA3A 3MTIA 2ZCJA 1N2HA 3O0TA 8ICEA 5E4JA 1FSSA 1QCDA 3C74A 3FUVA 1K8YB 3S1LA 5F9HA 1Y6RA 3SD7A 2VT7A 2CSUA 3FUTA 4S0XA 4TTVA 5L95A 4IHQA 5K7SA 4ID9A 3PL1A 3BQ1A 4MGIR 1UIMA 2QG6A 2REQA 4TTSA 1S9DA 1W48A 2VQSA 5C4MA 5L7TA 5KPJA 4RTLA 3LH5A 5AVRA 1QHHB 2H3HA 1VL2A 1C2YA 2A1AA 3B48A 3LWBA 3KTOA 5L4LA 4LCBA 1FFBA 3PNYA 2AMFA 4EO7A 3AY3A 4J0KA 3QXHA 4MVJD 4CEIA 2YHUA 5D3ZA 9LDBA 1M7HA 4N5DA 3I62A 3JAKB 2R1ZA 3KQVA 5E7MA 4IJ6A 1VKHA 4MPDA 4AMVA 2H18A 1PUZA 3QENA 3ZE7A 4Q7JB 3HXQA 2BFPA 3C6YA 3AJAA 3BIFA 4NV1A 3AJ9A 3RUFA 3S4YA 4YRKA 1C7YA 4BDTA 3TB4A 1G2PA 2OORA 4GXNA 2GF2A 3R2JA 2I2WA 1SV4A 5JEEA 1Y4SA 3OJ0A 2N1MA 4FHCA 3P9KA 1ENZA 3M8RA 3OZDA 2RSLA 2HF9A 3RHSA 3NOOA 2B6NA 2OENG 2O2CA 2QAGB 4M0FA 1MG5A 1Q19A 1L5GB 1E2DA 1I3CA 4B82A 1OXVA 3HB0A 2YV5A 1PJTA 2PPVA 1SCKA 1T1JA 2H9YA 4YRTA 5IULC 1JRPA 2N3ZA 4U5QA 2KZ3A 3KRTA 4QARA 1BMDA 4HAYA 4JVSB 1L6NA 1VHWA 1R8JA 1JECA 1QFYA 1U31A 1QF7A 5F9MA 3PE6A 4ALKA 2BPOA 2ZJ4A 1CCWA 1RPJA 1OLSA 2ZU0C 1AE1A 1JQDA 1TZ2A 3FF1A 3IMCA 4PTYA 1RWNA 2KW5A 5JS1A 1KOFA 1UMBB 1GDHA 2DGDA 3FCAA 3JPYA 4RKRA 3HR7A 5IDVA 4B5KA 1W5EA 3PUJA 4XJXA 2FPUA 1PHRA 4DYVA 4IGAA 5KAIU 5EJIA 1D4OA 4X7PA 1HNZB 1S6YA 1ZP6A 2XVYA 1FTYA 1LZLA 3VR5A 2PL1A 4E5SA 1K92A 2BDUA 1K4MA 1CUAA 4RXUA 4ISBA 1PW7A 5D7BA 2VYVD 5E6RB 4NM1A 4OSEA 2HCJB 4ROTA 4J29A 4Q45A 3TAHA 5KVSA 4DLVA 1L7XA 3L0IB 2HWYA 3UK2A 3I2YX 1QS0B 4HUJA 5C7YA 4DARA 4EJSB 3IG8A 2C07A 1WXIA 2Y77A 2ZSKA 2QMQA 2X1HA 2GN4A 3GEIA 3UO8B 7ICMA 1CR4A 2GA8A 3BGDA 3CBQA 3NXSA 5EKUA 4CM4B 1OGYA 1XKTA 1KSHA 5K3EA 2Y9MB 1PNTA 1VJRA 3GCGA 4YT5A 1QE3A 2Q50A 4IEIA 3GVPA 2BP7A 1VCIA 2YXNA 3ILYA 3AR4A 3OI7A 4WIAA 4LV8B 1YXMA 3WGZA 4DBLC 3S2FA 2Z6VA 4IRKA 2ZJ6A 5AKIA 3R8CA 3PVXA 3AFOA 1XPUA 3S7TA 4EA7A 4YJ3F 2W2VA 3E8SA 3TLZA 5DIZA 3P2IA 1LLDA 1L4GA 1BNOA 3M9WA 3OHSX 4JSRA 5I9TA 2IU0A 5IG2A 3RIYA 1Z68A 1XTSA 2OWDA 1RKXA 1BN6A 1RAAA 1TT5B 1ZUWA 4KDFA 4DLAA 2VH5R 5GY7A 4YMNA 3GIJA 1G21E 4N7RA 5F2KA 3TCNA 3KSMA 3OPXA 5AW3A 4FYXA 2PRIA 3HLYA 1Z6AA 1O96B 2XNDA 3ONVA 1UMDA 5CXQA 3HKBB 1PYDA 3JWJA 1CT9A 3EOBI 1OI4A 1ZL2A 4BO5A 2FZ5A 1RRMA 1HEIA 5ITVA 4HB0A 5KFJA 4B46A 3ISBA 1YGYA 1EGQA 4BZPA 1S10A 1GUAA 4IHKA 1N0HA 1B15A 3WL3A 4DJEC 1GIAA 1O58A 2QX6A 3WJ2A 2Y0SC 4DIMA 1M1YA 1S0UA 3ORQA 4EB6B 5CITA 1BCSA 1D3AA 2J5RA 3DMRA 4HWSA 1D2AA 2QD2A 4UBIA 1RHQA 4O0IA 1MC5A 5DT2A 1TKDA 4R5HA 3VSDA 3QMVA 521PA 1UOEA 2JGDB 3C3JA 1R9GA 4Q6BA 4JC8A 3OZRA 3EVGA 1A9PA 2WAYA 3INNA 3U40A 1Y88A 1DB3A 2F7SA 4C88A 4GM1A 3OZEA 2LTAA 4QJ4A 3UBTA 4QDUA 4NYIQ 1HY3A 3C1YA 2EQYA 3CQ9A 1OX6A 4KYTA 1B8UA 1MD9A 2DQYA 5DDYA 5CH3A 5B7QA 1H9BA 1NXXA 2IYRA 4POAA 2ONCA 3RSCA 1NVVQ 1ORIA 1NJXA 4CLDA 5IHXA 3STYA 3SAFA 3FCOA 4FYKA 1RCFA 1BROA 4MQUA 1RTTA 5JMOA 3N5CA 1A2KC 2ES6A 4UJ5A 1SCNE 2P5SA 1VIAA 3G7NA 2I8AA 3BL6A 3HCAA 4NLCA 5E0OA 1NK8A 3OPNA 2UYOA 3MRXA 4A23A 2V1UA 3TOCA 1E8NA 3HYNA 3L6OO 2CXHA 3TZ6A 4BLPA 4KLLA 3BWYA 2JXJA 3ZQKA 4B73A 5CFMA 1RXIA 2XGPA 1U11A 3BJMA 1N32B 3DB1A 1P9NA 2AJ8A 3KSZO 5KZMB 4FYYA 4WDQA 4KHPB 5LD2B 2J8ZA 1QIFA 1O6BA 5HJ2A 4LHSA 2P2CA 5EIBC 2CDBA 3E3OA 3TGLA 4LX0A 3ZDAA 4TV8A 3PZBA 2IYNA 1ZBQA 4MIKA 5ELLA 1BX3A 5K8TA 3T7IA 3UJPA 4IJUA 4LZPA 2IC5A 2WWVD 1LDNA 3BCHA 3YASA 4G37A 4J8PA 3G0GA 5EWMA 1X9HA 1PK8A 4E2YA 1HYEA 2WU8A 3GBVA 3LQ4A 4PZEA 1PKXA 3WO0A 1TCUA 2G1KA 5FUVA 2L69A 3P45A 1GR1A 1GTVA 1WV0A 3BBPA 1LLCA 1OXBB 5REQA 1OI2A 5J4HA 1MC1A 1WB6A 1PWXA 1LC0A 2GBFA 5KFMA 3MMXA 4AJ2A 2JLZA 1NQWA 4JVMA 5E4TA 1S4QA 4FIDA 2Q1TA 4UTVA 2FDCA 3AVXA 2DWQA 1T10A 3AHFA 2H4FA 1T9ZA 2KFNA 3AIIA 1UBUS 3PHCA 4GVPA 4I6JA 2R6ZA 4L5BA 3RRYA 3OIFA 2M2IA 4DNPA 5CCXA 5CA7A 1VLZA 4DDVA 4H1HA 3DDNA 1MU0A 1QGZA 4PC7A 3UJAA 4QZ8A 1ZDMA 5JPCA 2V4UA 3EZGA 3G8YA 4O3PA 1KJIA 2AV6A 4I1UA 1U2SA 1N6OA 2PBFA 1UH5A 1EX9A 1XB2A 2C61A 1QQTA 3F6BX 3Q85A 4HH3C 2ZIFA 4NCHA 1QV7A 4L5YA 5EE3A 1VIYA 1RZ3A 2NXJA 2XMSA 2VUUA 5JSUA 1VKJA 3JPOA 1P77A 3H9GA 4RYLA 5AJWA 1GILA 2Y1KA 1EUQA 3DHVA 1CDEA 1KJZA 5EHGA 3MM4A 1BNCA 3OEHA 4CKEA 5LUAA 3QLUA 1NR1A 3TRKA 4E51A 1FSGA 4HS9A 1T9GR 2O48X 2B1RA 2QUKA 2N46A 3D2SA 1U3WA 1C9MA 2AFIA 2Q3CA 3WK4A 1GKUB 3F6YA 3KR1A 1T8SA 2FLNA 3OLQA 4BVKA 1M2JA 5EPUA 2GASA 3ZEAA 4DCPA 4F2HA 1AMNA 3AVYA 1J49A 3IQWA 4ZOAA 3GDFA 4TUYB 2WA1A 3CTPA 1WKBA 3A0UA 3PZRA 5FO0A 5C7IO 1U5CA 4FQ5A 2H1RA 3AFHA 2GLTA 3G8BA 2OK8A 4NPCA 3D3QA 3JU3A 3BAFA 4HYQA 4B7AA 3U3JA 2OZVA 1UMKA 4EL5A 1KFSA 1H3EA 2R6R1 4XYLA 4GNKA 2H2FA 3FMPB 2ZS9A 3IESA 4FSDA 3KOMA 1GGJA 3VC3A 2AD5A 3D4LA 3DB2A 3UY4A 5JIBA 5JI3E 4P92A 4DSFA 1QGUB 4GE0A 4RL4A 2ACEA 4H60A 3SM9A 3P52A 4IYRA 4NXZA 3E9RA 3D1LA 4KX3A 2NO1A 1VLVA 2DL0A 3AU2A 4J0HA 4NABA 3VR3D 3TBFA 1SIOA 3EEOA 1D0IA 4L0QA 3PLNA 1VCMA 3OFVA 2KYRA 3C6MA 4U7GA 5EJAA 3UJCA 2H1CA 1KZGB 2GCNA 2JJ2A 1LW6E 4QQRA 4GOJA 5JLJA 1HUZA 5GTDA 1QRTA 2VJNA 4DJ5X 2PUGA 5DBHX 4U0KA 3GRZA 3IALA 2A1TR 3FKJA 3FSEA 2W11A 3FWZA 4HEJA 3CP8A 2OV1A 1CYEA 2PVSA 2EAMA 4KCGA 3HSKA 2IT1A 1VJ0A 3I64A 4P3OA 4X5VA 2DY0A 5E1OA 3DJFA 2Q6TA 1NYRA 2J6SA 1FFGA 2BKAA 1NSYA 2WJJA 1GPBA 3HB9A 4J1NA 1GYPA 4M1WA 2A0XA 4S1TA 4UUBA 1A4IA 4BB6A 1IXRC 3KLMX 2LDBA 4YJ3A 3KBBA 2OCDA 2I65A 4NICA 3VPDA 1ZETA 3C7KA 4EUFA 5DRYA 2MCFA 3M34A 4B9VA 4D0RA 4RJLA 2C8KA 2YRXA 4MHTA 3X43A 4EDHA 2RGGA 5AI6A 8ICBA 4BEBA 5JATA 1YS4A 2HCBA 5G1NA 4Y2XA 4BLRA 2H9IA 4BNUA 3ZHBA 4WKOA 1D2NA 1O2DA 1COKA 4Y2YA 2H29A 2JIZA 4C4TA 1W93A 2VJLA 3W9SA 2Z3ZA 3E05A 5FADA 4PWYA 1PVOA 1SXQA 4Q43A 3FPFA 1KF0A 5CEHA 3ITDA 2C78A 3QHPA 1ZO8A 3DHYA 1CY4A 3FFWA 4AVYA 2I2DA 5C3MA 3VAAA 5CFPA 4F3TA 4PXYA 4MMZB 1A8SA 5FPQA 3T5BA 2HHCA 3AF4A 3GVXA 3VPSA 1A9ZA 3KVNA 1N2BA 5EIWA 4DQVA 4F3NA 3I0NA 1LB2B 3M0EA 4DSEA 5AHOA 1X80A 3R5TA 2OV8A 1JAHA 2QGZA 4RT3A 2YJ3A 2ZP1A 3A6GA 2IEYA 5JH7A 1IWOA 3DLTA 4YXWA 3ZBPA 3AEVA 3BH0A 1X42A 1FQWA 1J0EA 1KH2A 4JHXA 2R8OA 2NV2B 4L78A 5ENVA 1MB4A 5L51A 3QXGA 1ZQGA 4TSKA 2RMKA 3TGPA 3RRXA 4CCYA 2XVMA 3DP7A 4WNIA 3F6RA 4XUSA 1G20B 1QHIA 2G6BA 3AG5A 4Z6FA 3HDJA 3B7WA 2BMEA 3GCZA 3PJEA 5EJFA 4W5QA 2QBYA 5EIEA 2IUTA 4WQMA 3KL4A 3B8EA 2ZIUA 2VRCD 3U7GA 4MUAA 1CZLA 3HE3A 3VZQA 2Y1WA 4K6KA 2J1LA 4D46A 3MB8A 3VR0A 4EBBA 3NONA 2I7DA 3U37A 1UKZA 2XWPA 2HOFA 2ORVA 1ZGCA 4HF7A 3RAEC 1L5HB 1RBZA 2YMQA 1S76D 1DTEA 1DX4A 1R6XA 3V2GA 1TMGE 1W44A 4A91A 1X2IA 4TURA 3EGDB 4B45A 3PYLA 2OA0A 2V58A 4U2GA 1GKYA 3THOA 1GVNB 4PR3A 4YP9A 3SHQA 3T7DA 4CUKA 4CXMA 4ALMA 4PCVA 4PQYA 4D4JA 1RHUA 3LQKA 1U8AA 4IMIB 4DSUA 4J3FA 3DLBA 2JANA 5KMGB 1SZDA 2JFNA 3AJRA 3SU8A 2Q2VA 1M0EA 2ACWA 4O4IA 1P61B 2Q4DA 3VMMA 3EW7A 3FCCA 3T12A 4BV2A 1FSFA 4WCFA 4PYOA 1TVKA 3H4BA 2HSWA 4DR6B 4TXHA 3TJMA 3CSDA 4D3DA 5LSAA 3TRDA 1XIVA 4EGAA 1TAQA 3FVVA 1P45A 4RFVA 4X90A 5HFAA 2W2KB 3MLBA 3T8YA 4XTCS 1SUCA 4NENA 2ZT6A 3FTNA 3GMSA 2C1XA 3PF9A 1EK6A 1YQTA 1WCYA 1E9AA 1G291 2G0NA 3GJ6A 2EP8A 3NHYA 3NJRA 3CXUA 4KWEA 1PK1B 1GLGA 1CIVA 1PG2A 2W9BA 2WVJA 2YXLA 3CF6R 2B3TA 2QJFA 3KX2A 1P7PA 1CE8B 5K3CA 1NKVA 3G1UA 4I36A 1EQ2A 2GJ4A 2KHZA 3C5GA 2NV6A 2WYIA 1G5HA 2YJNA 4NL9A 4KG7A 4AO8A 4P54A 4BWMA 2XGQA 5DEIA 5TQ0A 3URMA 4YRJA 4LTMA 3D8BA 2FR0A 4BATA 2WPNA 4LC9A 3W6NA 3QVTA 2DWUA 3I58A 3L04A 1SA0A 5DM4A 2X0JA 5EIFA 4GYKA 3WLTA 2C3PA 2FMIA 4CRWB 3IV6A 5C34B 3A25A 2QM3A 4US1R 3HVJA 4OLBA 5IRCD 1WXDA 3LLMA 1ZX1A 5DXFA 1WAMA 3ZLUA 5JG7A 5KG0A 3ITNA 4MIEA 4PYIA 1S2MA 3RF7A 3C1OA 4MPTA 1MEOA 2DULA 1JKJA 2IUFA 3SKVA 2M1XA 1KO7A 3O1HB 4KN5A 5LMCA 1VIDA 3VPFA 2VTBA 3O4IA 2O5VA 4EG0A 3SAHA 1OC2A 2HJHA 1B8VA 4BKQA 3H2HA 1ZYUA 1L5YA 1GPMA 1GTMA 3PIDA 4XB6B 1YDFA 2LCFA 2Q0XA 3C4VA 4XCVA 4JLJA 4F9FA 3EISA 5KI6A 5HM6A 1DUIA 5HKOA 2Z1DA 3NMUF 4QWDA 2B7LA 1KETA 4XAQA 4ETMA 4MI9A 2RLTA 2Q5IA 5IVPA 5BPFA 4HAWA 2CVHA 3L01A 5E7JA 2JZBA 2FSPA 3R4CA 2YS6A 4TLLB 5BOSB 4C14A 1WBJB 4IR1A 1EP3B 3TL6A 3I6IA 3MJCA 2ZI7A 3UZUA 1XROA 3U1BA 3U26A 3AMVA 3GIDA 1QWSA 3P97A 7ICEA 4YJ2B 3L1HA 2E4VA 5T3UA 5HGXA 2VKQA 1SHKA 4QZFA 2IZ7A 1UP7A 2V5AA 5DTRA 1QHEA 2ZRBA 4OJQA 2XE6A 1EJ2A 3QWIA 1SD1A 3D3EA 3DDUA 5EERA 5I7HA 1NG9A 5K8VA 4EG5A 2FK7A 4LZAA 4OXIA 2UVRA 2HRRA 4JQSA 4C2TA 2QX4A 3HNRA 3PQFA 2ZZKA 1UBKS 1WUDA 2YVQA 3OJWA 5IMSA 4CLOA 1NVWQ 3GLFE 4M1TA 2IS6A 3I9NA 4DKJA 4RE6A 5GM2A 2NN3C 4YAKA 4IHJA 4FHEA 2LKYA 3LK6A 4OQZA 5I51A 4BPBA 4RZIA 3UAGA 1KYYA 2H3FA 9ICBA 1C7JA 2PZBA 2NOAA 1W2GA 2Q5FA 3DL7A 2PO7A 4KNYA 1L5SA 4LGMA 4V0MA 3N76A 3AM4A 4Y6LA 4A36A 1E3LA 2AJLI 1D1PA 1Q0RA 1BC5A 1MJNA 2QR5A 4I4TF 4JEMA 3DL2A 2QLTA 5J2IA 4TVKA 3RT9A 1VHQA 5CFRA 4OHOA 2LR0A 2ZTCA 3IVRA 4C0LA 3PS9A 1NL3A 1OT5A 3W0LB 3HCWA 4YMSA 4XJVA 5EVJA 2OAQ1 4LZNA 1UBJS 3BVPA 2IEAA 4RQNA 3HCNA 2OZLB 2HHTA 1JALA 1ZNZA 3EXG2 2R4TA 1M54A 3EGWA 3QXSA 1H9AA 1J2YA 1TCVA 2X9QA 3D4OA 4LV5B 3WTCA 4RUKA 4G0VA 3QV1A 2D7CA 3BB3A 5HKLA 3CZCA 3E03A 4F96A 4K9LA 2VJKA 1T3SA 1VBFA 1W88B 2EJWA 3DOIA 1ZVQA 2E1EA 2C4WA 4F3RA 1JQBA 5A4AA 4XIGS 2JCXA 2JFYA 1AKRA 1H2HA 2IZZA 2NPIA 5AKYA 2NQTA 2XZDA 4ILEA 1WL8A 4NAVA 1TO1E 2CJXA 1UBEA 1NMQA 1E4VA 2QN6A 5JW6A 3Q6IA 4U9HS 3ICOA 3JSAA 2VYFA 1CIPA 1F8UA 2BCVA 3LVQE 4LJ6A 1MF7A 3AHDA 4Q4LA 1W5SA 3QJGA 1KVRA 4KP7A 4U7JA 2PUDA 4ZIRB 5LA6A 3PUVA 1QH8B 3BXGA 3JZDA 1ZJWA 2F55A 1NW7A 2C4MA 3O4FA 4HFMA 4Q24A 2B36A 1SFRA 3B9RA 1GD1O 1HPLA 1SZJG 2WZDA 3BE8A 1IIRA 1RP1A 2BP7B 2IA5A 3MLAA 4JYCA 4OEHA 3UXPA 4U0JA 4E5VA 4E5DA 5C1OA 4AURA 5K0CA 1B0XA 1WXXA 5E3HA 1TVCA 1U81A 2VK8A 2D7JA 4FGUA 1RI3A 8ICFA 2PD4A 3HXTA 3QW4B 2OCXA 4M1YA 5F7ZA 4A8JC 2BJHA 3I09A 3RAXA 2ODGA 3JQRA 4CU2A 1Q0LA 2H63A 1UEXC 5CBPB 5FLXA 4R8SA 1LGYA 3MIIA 2H7XA 4X61A 3OIWA 1HFJA 2C5HA 3FR7A 3NW9A 1FS5A 1U7TA 2ORIA 3F5MA 3NU1A 4KB5A 3MT0A 4I9NA 4AQ7A 3Q5GA 4F5DA 4UMFA 3ZIDA 1E9EA 5BN5B 1FS6A 1KFBB 4PFQA 1JR3E 4WOJA 2CV2A 1ODIA 2AOVA 4RHTA 1T5TA 1YZHA 2DQSA 2PX2A 4Q3DA 4R9SA 3ZYZA 1X9XA 4H0NA 2ODTX 3SXUA 2DCMA 4B4WA 4QODA 4BNGA 3LDHA 5JPIA 1D2EA 2FEKA 2PV7A 5KQPA 4KQJA 2VTBB 4JI0B 3ZHZA 1USKA 4URXR 5BO5A 4RMGA 4LCEA 1AGXA 3DT6A 1NRXA 3BWDD 3ELUA 4RFSB 1NOMA 5DM2A 1PUJA 1UODA 2WFZA 3SBOA 2XCRB 2DC1A 3RS7A 4F45A 3P4XA 1DCKA 2G5IB 2O8FA 1SXIA 3EVEA 3OTWA 1G9SA 1QRDA 3OAAA 5ALKA 2GPYA 4PH5A 2P5TB 1J2MA 3KQQA 5DNAA 5BQ5A 2ZRLA 5EUBA 4L8GA 1IB0A 3ANMA 4NV3A 4OLJA 4QWEA 4DXHA 5EWEA 4GXKA 2H4WA 4Z6CA 2Z09A 3DCNA 5JC1A 2G6TA 5ILQA 2HZBA 4FNMA 5E95A 2XWBF 3W1WA 2CY0A 2VPZA 2Y99A 1YJ8A 1MH1A 4G3IA 3W2EA 1WRBA 1R6BX 1DQZA 3N1UA 3K4GA 1SCBA 1CVRA 1GT6A 1NWCA 1TX4B 4X00A 3TLCA 4R2KA 2N1BA 4L6AA 4L72A 5IKMA 1JDJA 4ZVMA 4XFJA 1Z2AA 2WAMA 4KYIB 2WV9A 1L9KA 3ETGA 2P9FA 4JBHA 2C2MA 4WFJA 2X6TA 1C5KA 1VKRA 4G5FA 3TXAA 4O3NA 1MJFA 2I2XB 4JGBA 4P2GA 3FRHA 3F5AA 4QDZA 2FEAA 4HO1X 5IM5A 2VSOA 1XDSA 2ZTSA 4J49A 1E20A 3FYUB 4BQRA 7YASA 2BAGA 2HPHA 3KWFA 4OXKA 1NDHA 4PGHA 1T5IA 3UGTA 1L3UA 1PQUA 3RBVA 2F3QA 3NCHA 2A3RA 2AXEA 1DRKA 1Y8QB 1CVLA 3DEEA 3IQEA 5G2OA 4FZMA 1F4VA 1ODLA 1T4CA 4Z2YA 3IOEA 2C5GA 4HNUA 1MAWA 3IKLA 3RADC 2UVPB 2QNBA 3L8DA 1BD3A 1NY6A 1T3HA 3W5JA 1FYWA 2W90A 2ZTHA 4TMXA 3RKUA 1FX0A 3IEXA 4KYVA 2E8MA 3RC1A 1I2MA 4QYXA 2KOBA 4EAAA 4AYBC 3TQCA 3QF7A 3PYMA 3AT1A 1O95A 2KLHA 3GH3A 4JLDA 4TSRA 4PAMA 3C39A 4D99A 3IX7A 2PKQO 5H1YA 3S2SA 2ZWPA 3SHWA 3DDHA 5IHPA 3K4HA 2RG1A 4WOPA 1GNQA 4AG6A 5AM4A 2HRQA 1M8PA 2K4HA 5CIQA 3SHTA 2REBA 1A95A 4A92A 2WIDA 2V9ZA 1HQDA 3NASA 2BCSA 2VQDA 1DG1G 1GZDA 1L5VA 3EDMA 1NUSA 1P3DA 1Z15A 1ZIYA 3MRVA 5AKXA 2I7XA 3EXFB 4OL0A 4BUJA 3FD8A 1OWOA 1HNWB 1GL6A 3CLSC 3ALRA 1IPEA 4P34A 5D86A 1Z7YA 1MH9A 2XJ9A 4YP7A 3CVUA 2FEWB 4MV7A 3UT0A 4BFLA 5FTNA 4EFKA 1I3OA 2ZJFA 3V55A 3W6PA 1R5JA 1X80B 1KC1A 3GUHA 2G70A 1PWYE 5L7YA 1HF3A 4AF7A 5BW4A 5HHTA 1ZQTA 2IVZA 1NNLA 4HLCA 1QZUA 3MBOA 4A2WA 4C0JA 3RR7A 4O3OA 3ZWVA 1QIMA 1U0JA 2WKSA 3DM5A 2QY9A 5FA6A 4RXMA 2JHDA 1KKMA 5LYYA 1MZVA 4A0GA 1LJUA 1LS1A 4KXFB 4XWAA 9ICAA 2JGAA 2A0KA 2PZLA 3IPAA 1DJOA 4Q3BA 3LTEA 5IX8A 3BQ7A 3I76A 5AVYA 3ROQA 1BPDA 3GVCA 3SQIA 1Y6FA 2HI0A 3RF9A 1V2GA 1JQKA 4IDCA 1Q1AA 2TECE 3BMNA 4OJYA 2Y1FA 1SXJC 2HV8A 1T8EA 1OI7A 4KPUB 2OHJA 1KIAA 1Z3EB 2FLKA 3EDQA 3QPCA 1XMJA 1QR6A 5EP2A 3SX4A 2AUNA 1W7AA 2BR3A 4AZ0A 3H13A 4YJ3B 1QHYA 5JWRA 3KO8A 2Z08A 4J4TA 4FD2A 5KFRA 3P71T 1ESEA 2H0RA 1E5QA 4V3CA 3MSXA 5D5PA 3WB1A 3K0BA 4C3VA 4DCOA 5KOHA 5KFDA 4W4TA 1NJWA 1E6EA 2HWUA 1E1RD 4HWTA 5EMNA 1VPTA 3CZPA 1NK5A 1L3IA 2HA7A 2IY8A 2H1SA 2YZ7A 1VBMA 3G82C 3HV0A 2W9CA 3KAJA 4HGNA 4MTLA 4RF5A 4UMEA 1KY5A 1TK5A 2PN1A 2PRJA 2VUIB 3AI1A 2GJ8A 2XMCA 3FB1A 3FPHA 3BXZA 3L5OA 3QX7A 4E1VA 3PR1A 5H02A 1SZHA 3FNBA 2D1TA 1T8WA 2XEXA 5TT1A 1BD4A 2C29D 1ZQQA 3B13B 4FT2A 4IO1A 3RJZA 3CW9A 3FWYA 2C7VA 4UB4A 2PIAA 5G0VA 3NYQA 4Q6WA 1JE0A 3TZKA 3TLGA 3HHEA 4GWKA 1VLQA 2OBLA 2J3QA 3L4BC 4EG7A 3ZC3A 3OURA 1U3DA 1QP8A 2VT6A 3H11B 4RU9A 3H9UA 1YU6A 3IIJA 4OMFG 4DJAA 2WR8A 1ZL0A 1OHHA 5CDFE 4QZDA 2CL6X 3UPTA 4Y1GA 2MSNA 3DWFA 3DZ8A 3A0BU 4P1ZA 5JXJA 1JLSA 1HTTA 3KVRA 4Q4AA 4KGDA 4UBNA 5E8JA 3F8WA 1KYXA 4TKUB 3PY8A 5FI5A 1JA9A 1NGSA 4W1RA 2O0LA 4LFCB 1Q46A 1WU8A 1O95D 1X1CA 3VH1A 1J7JA 1WVGA 4O4HA 4Y8VA 5ED4A 1JXOA 4YP3A 2QXUA 4RVUA 4I1SA 3GHYA 3ISVA 3DTVD 3SR4A 5JZVA 1N8NA 2JGLA 3LT0A 2I2BA 3RB8A 3WAJA 3RYTC 3GDHA 1Q3TA 4W63A 3RU7A 3V6HA 5BOLA 4RCYA 1S8NA 1CZRA 3FPAA 2BCEA 3B12A 4PINA 3QE2A 1JMVA 4RUCA 3L41A 5F23A 5DB4A 4OJLA 4CNQA 2PGOA 3HFGA 4DYDA 3OOWA 1FDVA 4MHOA 4OHBA 1UR5A 4QXRA 1I33A 1E6LA 1VMKA 2GN0A 1Z9BA 3DBOB 1KY4A 3FSGA 1PR5A 4BLOA 1KMHA 2Q9BA 1AQYA 3CNNA 3DZKA 1YZ6A 1RIFA 5LXTA 5H70A 3R6GA 1BE6A 3S68A 5CB6A 4O1IA 1E0JA 5A9SA 5ALGA 4HWRA 2HVHA 4C7OB 4D82A 1M1NA 5JRDS 4Y2TA 2V6FA 1PW5A 1R0YA 2VJOA 4M7OA 4GXQA 4PYMA 4R9VA 4ROSA 5HK9A 4GKJB 4FYWA 4D0GA 4UAVA 3IDWA 2O3RA 4WFQA 3UC9A 2GUWA 3IAAA 3ZXYA 5DNUA 3S5UA 1NHWA 1ELOA 3WBJA 3M33A 3WYDA 3VOAA 1PZGA 1KOGA 1T2FA 4B5LA 4NENB 5DYGA 1PLJA 4PFKA 1GPDG 3F6EX 1ZIPA 4JC0A 1V9LA 1RJEA 5AK5A 2FFBA 1NFQA 2GZDA 2FLWA 4M0UA 3F5EA 4DLRA 2W7TA 4DC1A 3BEDA 2RGBA 3EPGA 4FCWA 4LISA 4YR0A 3HJHA 1KSJA 2FQWA 3DE4X 1GR0A 4P38A 1C4XA 2RKBA 5EXTA 3DAYA 2EZYA 3B52X 5FQNA 4E5KA 2EYUA 1LA2A 3D5TA 5AM5A 4GDMA 4LF6B 4RGQA 1J0AA 5CTJA 1YRBA 2XXAA 1KAQA 1S2NA 3UJ8A 1NXQA 5KTRA 4D25A 1DCTA 4NARA 2HHWA 1EPUA 4R69A 4UQOA 2IHYA 3NBXX 4M0LA 4V2IA 3E2EA 2H59A 3WTBA 3X3HA 2GXUA 3GYGA 1KQOA 5ESWA 2OMKA 1FDUA 1HC7A 1TUBB 1IMOA 2IITA 2PCJA 4JLWA 4M3NA 4L16A 1GCAA 3ZE0B 2NX2A 2RHLA 5D87A 4K8RB 3QY0A 2BMVA 4DBVO 4DQLA 3EODA 4KI0A 4QREA 5DT9A 4YRMA 2J87A 4ZYWA 2P69A 1RNLA 5D3QA 3WO1A 2H17A 3SV4A 3K1YA 4RA9A 3ZK7A 1I2BA 3ZV5A 7REQB 4HLQB 4YALA 4PTZA 2JD1A 4ECEA 1R5NA 3H5VA 5AKZA 3HN6A 1KDHA 1V0JA 3I9MA 4QJBA 4E2ZA 1PL8A 1DWUA 4TWBA 1CQPA 1H1DA 3B5EA 1M10A 4TMZA 1JWAB 1DCFA 2IYQA 5EE9A 3FUUA 3PGXA 3QKIA 4JMLA 4KXXA 4WMLA 1KARA 1ZINA 4H6XA 4YPOA 5ICFA 2XH8A 1Z0KA 4IG9A 4L5CA 1LLFA 4ELUA 1Z6TA 2BR4A 2NVOA 3SLRA 5BSWA 1X9GA 4N5LA 4NQRA 4P83A 2QUBA 1NK7A 3MS7A 4XUEA 5FPKA 4MV4A 1UWVA 1Y0BA 3AYXB 1Z4OA 2WHPA 4XXHA 4L4UA 3BCRA 1M2EA 5SY9A 1G3QA 1RLOA 2HMAA 3O7MA 5DRTA 4H59A 3TPFA 3TSOA 5TPWB 4NRDA 4V39A 1RP7A 5TJ9A 2P1DA 2BZFA 1X6VA 3STHA 4GZ5A 3CF0A 4ZZ0A 1HG1A 1QJ4A 4CLOB 3G0CA 3QVJA 5EE0A 4EEKA 1HE1C 4FDVA 3TBKA 4DW8A 5KEIA 4WKBA 4HNRA 1JB9A 1JPNA 3CR7A 1KO5A 1Q77A 3OHBA 3AHGA 2OK7A 5J2HA 3EFBA 4EGQA 4LQDA 5A5GA 1U28C 2NUAA 2BELA 3PQ6A 3KM0A 2OGTA 3Q0IA 3G5MA 2DFNA 4OJNA 3JR3A 5HQJA 3M6FA 2G04A 4DEZA 4LBWA 3UANA 3G79A 1YONA 4XRGA 1EFVA 1YQDA 1YL7A 3NHRA 5H0IA 4JC5A 1V5FA 4X7RA 3S2YA 4YJ2A 2RI6A 4OJOA 2OM2A 5FH9A 3UJ9A 4N5IX 2N1RA 3NP9A 4DCGA 5KNDD 2QQ5A 3IV9A 2O0MA 3ZHOA 3OCWA 2Y6UA 2JHAA 1J1IA 4FGWA 2NO4A 1ZCZA 1ZIXA 1GFWA 5E2IA 6GPBA 5HQ3B 4TMWA 3DZFA 3W6ZA 2I6QA 2QN8A 1FYDA 2EQ5A 1KBOA 2A4KA 2D3DA 2O8FB 5IVHA 2XNJA 3UAWA 5K05A 1UC8A 3E22B 4AYXA 4CFSA 3I45A 3TG8A 3R74A 4AKIA 4KFRA 1Z17A 5J8YA 1GU7A 3WK9A 3I5AA 3ND6A 2ZYDA 2H4YA 1SUIA 3FNRA 2OG2A 5KFLA 1TK3A 2I2AA 2VXOA 4BNIA 1EDOA 3PC2A 1T35A 1UPTA 3NRWA 3ASUA 4AIIA 3NVAA 2ETVA 3EIXA 5JAIA 3OJSA 3EUB2 3VO2A 3Q9UA 2A5YB 1IG3A 2I9GA 2H07A 5AI4A 3BXHA 3R23A 4DV4B 2JKZA 4MQEB 1RRVA 5B66U 3OQOA 7ICOA 4Q01A 4OI1A 5DDIP 4M89A 5K0GA 2IEDA 5AKHA 2V7VA 2BLLA 4BXOA 2WFLB 3AUYA 4P4NA 4CL8A 4QNNA 4WGGA 4PWZA 2GO1A 1JI0A 1S1MA 1J9GA 2ZKLA 2IX9A 4L3WA 1YUBA 4ZMRA 1LKYB 1UBCA 2ZIXA 4U8GA 3EPRA 2VHVA 3H2ZA 3NS7A 4RC9A 4QJIA 5EEGA 3PXGA 4J1QA 1U9ZA 2VH1A 2XXJA 2YX8A 2FWJA 3LP5A 3WK5A 2QRGA 1GA6A 2X7HA 5HDQA 3L1IA 4AJOA 2XKKA 1JEYB 4KPEC 4Q4CA 3PFBA 1ZQZA 1SN7A 1NBME 1T3NA 3WLQA 4LFAB 3N53A 2HHQA 2R8KA 1CJTC 3I4CA 4OLAA 4E6EA 4KQHA 4BN4A 5IT9A 3RU9A 1JQAA 3GCWA 1P4SA 4J6FA 3IPRA 1N2SA 4NCKA 4L15A 3BULA 1M6NA 2CE7A 4H6WA 1FQOA 3FIJA 2AKYA 1NQVA 5J8YC 2YY5A 3OZBA 3GXBA 1NF3A 5EOVA 5H7XA 4R0MA 3BX1A 4DA4A 4P31A 1OYVA 4YRCA 4I5EA 3IUJA 3B3QA 4D74A 1UPCA 5FBVB 4IVPA 5CVUA 5F33A 1T5DX 2EP5A 2I6GA 4M8IA 3T0IA 4E07A 5CFNA 1NKBA 1QORA 1CF9A 2QP3A 1RYSA 1XTBA 3VR3A 2IPXA 3TMAA 1Z8NA 4CM3A 2CZGA 4OYHA 2H2WA 1WMDA 1VCHA 3ZY3A 1UDBA 3DZIA 1B42A 4KJZA 3FOCA 4U5XA 1U2QA 4RM3A 4CTMA 1GAXA 4JJZA 2IHJA 5IBPA 4OUDB 3GAAA 3NIBA 3MOSA 1SC9A 4AT1A 3U3DA 3IPLA 2XQJA 4C2BA 4CWAA 2Y0BA 2WB2A 3G88A 1E2IA 3CMMA 4ZOQI 4FFRA 4NCIA 4WH0A 1BIFA 1M1XB 1CQJA 1V95A 4YXMA 5J23A 4O5CA 2J59A 4H4EA 1KL9A 1JR4A 1D9XA 3COPA 4FUTA 1Z35A 5JS8A 3IKMB 4IXWA 4C8KA 1L4KA 2FW0A 3EUAA 3AESA 2ID9A 1LPNA 3Q3JB 1CJVC 4H15A 1H4VB 4YV0A 2VT2A 4DFJA 3LSTA 4NL9C 4QW8A 1KC3A 1SD2A 2XCLA 3AERB 1ZQ1A 5JAQA 4BNTA 4R8MA 4QDTA 4PONA 3C28A 4HOYA 3WU2U 1PVPA 2PSFA 3E1GA 3NKFA 4R05A 1N6HA 2PFQA 4XSVA 3AEZA 2FZCA 4HP8A 5HCNA 3DBLA 2LBOA 1XOIA 3M2PA 1ZW6A 1T91A 2J3IA 1UOQA 2EZ4A 3L84A 1RWOA 3PEVA 4YJFB 1AF7A 2JFQA 1CULC 3QY9A 1KKUA 1N0UA 4RQ8A 4MLZA 4M86A 3KD3A 4M76B 4EF4A 1KTQA 2V74B 1U8TA 3OU7A 4WKCA 4DXDA 4L4YA 4E3WA 2KHVA 2UAGA 2F1JA 1VZ3A 1M34E 2WHPB 5C7LO 1U65A 4DAEA 3FJ1A 2X4IA 3TF5A 4FMDB 2ZANA 1URJA 2HY7A 1Z74A 3C3EA 7ICJA 3T35A 3OQJA 3S2UA 4AXBA 2BFOA 2C8JA 3E5NA 3MTEA 2OM6A 4OXRA 2W03A 1H1TA 4CL3A 4MKRA 4LQ4A 5HKKD 1XHEA 3PUYA 1UL1X 3V4FA 5BWNA 5KC8A 3MCVA 2WTFA 2JFBA 3TI0A 3BXPA 3IUSA 5I4KA 2FOLA 3DMGA 4DA6A 5TMBA 3M3HA 1U0EA 2JS7A 4ZAXA 4CF5A 2C96A 4TUQA 4QWBA 5CVCA 4AZTA 4YXWD 4Z4FA 1ZH6A 4NJEB 3AY0A 1QMPA 3HKDA 3PX4A 3KKZA 1PX2A 3EMKA 3NAQA 1XPRA 3F6CA 2J3LA 1GQYA 2AG5A 2HQBA 3GZJA 4LEIA 1J8YF 1Z6GA 2ZATA 3NBZC 4KLQA 2ACKA 5IANA 3DNMA 4UUAA 2ALZA 4PNHA 4UAGA 3RVSA 3HRHA 2PGXA 4ZOLF 3O83A 3ECAA 5A3RA 3U7IA 3NM4A 1GP2A 5JAPA 5LP1A 1VPEA 1DDIA 1O5IA 1T5OA 4ZQEA 3TN7A 1NVFA 5KAFU 2VO1A 4LHEA 5ICSA 5CFZA 3A58B 4F4WA 1A7KA 4MP6A 2HDHA 2FKAA 2Q5LA 2EBFX 3LCRA 3MFIA 1QYCA 1H66A 1NNUA 1KIMA 3CM0A 1JVNA 2H3EA 4IDPA 2KIVA 4YO7A 4H0FA 5I7OA 1K7YA 4MWEA 3IE1A 4QTXA 1T3GA 4AKTA 2LCQA 1MT0A 1KJJA 3UJNA 1DAIA 2F1OA 3Q41A 2QQEA 4B7XA 3W78A 4ENWA 1SBTA 3BM5A 5AVSA 5F21A 3DC2A 1BQ4A 3H9EO 2JD2A 2DPJA 4OB6A 3REQA 4DV2B 3OSZA 2BI8A 1EA7A 3HBMA 4MDHA 2QSYA 4NDZA 2I9KA 3LW7A 2QYHA 3D4NA 3K8QA 4BWFB 3D0RA 4PLGA 2GERA 4KQXA 3JPTA 3B8HA 3IBYA 2JNWA 1ONNA 3GYBA 3FGNA 3B1FA 3MINA 4RD2A 4C7VA 1M2FA 2ZRKA 4OKNA 4BO9A 3T3IA 3ZZUA 2HGZA 1IOVA 3KSBC 4IC9A 4QHYA 3BWVA 2JJ2D 2HXGA 2FMFA 4R01A 4CCWA 2PFOA 5BSMA 2OCPA 4MQ4A 5DM0A 5HIMA 4UNRA 7ABPA 1SQ6A 2FKNA 3D2AA 3NNSA 5DCYA 1N2OA 1ECWA 4UB1A 1LI5A 2WHXA 3HBAA 2K4PA 4WFKA 3SBXA 3VU3A 4LGVA 1JFRA 1Z7EA 2CUTA 2VQ3A 2ZJZA 1Q7BA 3OT1A 3DPIA 1YBVA 4KKVA 2J31A 1W75A 1JH8A 2CEAA 4EKNB 1ZR2A 4OFWA 1NVXQ 3HRKA 3SM3A 1IN1A 4YCLA 5AW2A 3BH7A 4ZN6A 1CZOA 4EYIB 2MWMA 2VHJA 4RANA 1JHUA 5DTQA 1DK3A 1O9GA 4OYRA 2O6KA 3HILA 3IDSA 1DZ3A 3REGA 2C4NA 3RVNA 4BU0A 3GPBA 4G1VA 4RNDB 5ITWA 3ZPXA 3AUFA 1R8YA 4DR2B 1L8XA 2DLNA 4Q1CA 3QSYA 3FIUA 3N8NA 3W5UA 1SXJB 4KGZA 3N86A 2Z58A 1E2JA 1Y4DE 2X5JO 3RFCA 1JQJC 4TKUA 5FUXA 2QL5A 3TE6A 4IQ8A 5AJTA 4DC0A 2H2AA 1HEUA 1XUOA 2Y1XA 4EUEA 1C2TA 3ZNQA 5JPDA 4KLFA 4D4MA 1P74A 3LQ1A 4XGIA 3TLXA 3V46A 3DE7X 1YQUA 3KJZA 3PWSA 1WOMA 2HF8A 3OIYA 2WWWA 4PFJA 2PK3A 3W4JA 1QC5B 4IMPA 4IIFA 3WSWA 4CU5A 4B6GA 5TGZA 1XD2B 4BV9A 4HRVA 1KVQA 1W8IA 1C1XB 3W6UA 4BFCA 2OHHA 4F85A 2JLXA 4ND8A 2W93A 1CUHA 4FLFA 4L0DA 4ZYTA 4ZAVA 4QWMA 3OZ7A 1MNQA 3JQAA 4IWNA 16PKA 5DHUA 3ZS8A 4E2WA 2OV2A 3DE6X 5JD4A 3ELWA 5JDCA 4Q1FA 4KAAA 2QU7A 2ISPA 5B1HA 4X8MA 3VGPA 4M9RA 4CCYB 3E82A 4OHMA 5C1BA 1Y63A 4I2EA 2C95A 4QA9A 1Z00A 3N6VA 3GLVA 5K0JA 5ESRA 3PHLA 5T64A 2O1EA 3JQAD 4D02A 4ZXPA 3DG9A 3EOAI 1H9CA 3RC8A 4OA8A 4EELA 1FXWA 1R8QA 1SU4A 1YCFA 4J0EA 4A4DA 4PLCA 1NBHA 2ZQZA 3I5UA 5E1BA 4RHFA 2BFFA 2I3DA 2KJQA 1ZJJA 5C9ZA 4YJHB 3ZXXA 1X3LA 4AKEA 1BMQA 1VB5A 5DHSA 2GBLC 3T7JA 2J4DA 5BV0A 3O8OB 1J90A 4P32A 3ZCVA 3GJZA 4MW7A 2NO0A 1ZJMA 2AQKA 5CH5A 4LYDA 5BSTA 2JFFA 4XD7D 5BUQA 2O57A 4PLYA 3LWMA 3RS8A 5EKTA 2ZLBA 1ZK3A 3PUWA 4C3UA 2NTJA 1NDUA 5JD3A 5FWDA 2FE4A 3OZUA 4TLCA 5FNZA 2I6FA 1EFDN 1TQ2A 1UT8A 3HO1A 2R2GA 3JQGA 2Q5CA 3KXIA 1J99A 1DO2A 3DS8A 3L1UA 3OQMA 1Q17A 2NYUA 4O3SA 4GGOA 5JAUA 4U6SA 2PMKA 4HX2A 1A5SB 3LQ2A 1WXWA 4O2BB 1NMYA 1WA5A 2M9MA 4X24A 4BZWA 4PGXA 4HRXA 4ED1A 2Y4NA 5KNCA 2W6ID 3GGJA 1NMSA 3VKHA 2EATA 4H1WA 1LCIA 1XQYA 3OTHA 3WC4A 2HBKA 4LN1A 3M82A 4O0LA 1Y3BE 3O26A 4TTQA 3W5CA 3ISCA 4HBGA 5FWYA 4BQOA 5B3JC 4PHFA 3M1IA 3S40A 1ZRMA 3GUZA 5CEFA 2O0KA 2REXB 1IK6A 2BFDB 2GK3A 2IYTA 3I8XA 1T34A 3VTKA 5B1YA 2C7QA 2M6KA 2FY8A 3V8VA 5JZSA 5FORA 1X13A 3JVDA 1E64A 1WCLA 4WZBA 4JUFA 3BWEA 4C30A 3HJEA 4FGSA 5ADWA 3HI6A 3KCNA 2F90A 3K8OE 1S3GA 1PSDA 4QWAA 2R85A 3O90A 2CLIB 2YHIB 2DB3A 2X1MA 4LOAA 4M7PA 3PRKE 4D9KA 1ED1A 3AU8A 2WJ6A 4IQTA 1RDFA 1W0KA 3Q7QA 1SQSA 3OKPA 1ZUNA 2B0CA 2NU8B 1USVA 3PRJA 2P2LA 4DTCA 1FRQA 1G2QA 2IXBA 3I37X 4JCOA 2GHIA 2CJWA 2A9OA 2GRJA 4IOLA 4M53A 1L4EA 2H92A 1GV0A 4YH1A 2ZJ8A 1D07A 2HYIC 2EWMA 3GWZA 1Q3HA 5GJBA 5E8RA 2NTEA 2PGIA 4R1NA 4ZGBA 4UJ3A 1JSLA 3WK7A 5FPYA 1G8YA 3MA0A 4F3YA 3S1SA 1TEXA 1H38A 1KJ8A 1LNQA 2ADMA 2AOTB 3JQEA 4DFMA 1U3UA 5JRJA 2YRFA 4DMMA 1RYYA 4E30A 3CKMA 2VDQB 3A06A 3AQFA 4QZBA 1XX6A 2WG0A 2ZVDA 4HMOA 3AEXA 4MGKR 1AHIA 3EQ2A 1ZQKA 1TMOA 2D1YA 3K9WA 4KFTA 1IHOA 3GDXA 1XU4A 3ZWAA 4Y1FA 4LF5B 2VA3A 2I67A 4QL3A 1VJDA 3BSFA 3T7KA 2H2HA 1L5WA 5D85A 3GEGA 3V7WA 5J0QA 2I91A 2ZTEA 1M7BA 3GGSA 4ZYZA 1XD9A 2J5XA 1P1IA 1FP6A 2FLLA 2F17A 2XYHA 4JQYA 4LRUA 2QX9A 1ADCA 5J1TB 3ZE8A 5CFQA 3LV8A 4O4HB 5F98A 4I2VA 3P9SA 2DF4B 3IPXA 3MTQA 3K70C 4YP1A 4M1EA 1SNYA 5IZCA 1JRLA 1Z26A 3WADA 1X7ZA 2PQMA 1UC4B 1VFPA 3DC7A 3MJHA 3OQVA 4HX5A 4ZVRA 5PGMA 2Z5FA 5SY4A 3SKYA 3P4YA 3D4BA 4ON9A 2ZJYA 2O8DA 4ERXA 3EUWA 4REOA 3RJ9A 3AB8A 1NJZA 4Z6EA 1U9JA 4ZU1X 3D6AA 2AGQA 2XX3A 2GB4A 3PXEA 4C2AA 3QVGB 3LKDA 1JR3A 4IQVA 2JJ8A 4IP0A 5D5QA 1NUPA 3GEEA 3WL6A 1TTTA 1CUYA 4HUTA 2UZ3A 3B9JA 4HYEA 1B4FA 2B6HA 1HKHA 2SBTA 3CA8A 4GYWA 4F3KA 5E1MA 1IH8A 3PGA1 3AFMA 1U2GA 4BRSA 5LU8A 1NYLA 1OXSC 1H8HD 4GPAA 5ERXA 2C5AA 1R0ZA 3DE2X 2PMBA 2XT0A 3NLLA 3UMSA 3K9LA 1QVWA 4P7GA 3N4MB 2F1IA 2YB1A 3EIHA 5IT4A 2A5DA 3ZLBA 3FTQA 2O8CB 3CCFA 3FDSA 2OVFA 4QTZA 2AYYA 3H6GA 1NU8A 4FGKA 5AVVA 1QXSA 5GPBA 1ONPA 1IY1A 2RBEA 1VL0A 1T4DA 1SV0A 3TFSA 2DQ4A 3CLTC 3MS4A 4GX0A 1KI1A 4PZPA 1W47A 1HYQA 4K6GA 1L6RA 4RPCA 1U02A 4KPUA 1DINA 3QUBA 2R86A 2QPAA 4CQJA 5IJWA 5DBBA 4C0QC 2GSDA 2PUFA 1YZ7A 1CSEE 3IP9A 3LF1A 1ZC4A 1RZRA 1E2UA 4HNQA 5HE8A 2MSLA 5KHLB 2HBRA 1II9A 4EHBA 3MLEA 4BFZA 4M9NA 2F48A 2WQ7A 2OQRA 4MUBA 2IY7A 3D6NB 3EDCA 1G4UR 1YFZA 3PFKA 2X6QA 1T5BA 1QF6A 2AE2A 2BKEA 1XS9D 2F44A 2D0IA 1UEJA 2HWXA 1PZNA 1WMSA 3GLKA 5EHQA 3ZVLA 4MVJA 3ZW7A 3F3MA 2GKSA 4UC0A 3FBGA 5IEJA 3OQHA 4E21A 3CN9A 4KQ2A 3HKZF 2PZJA 5D3MB 4PYNA 2EH9A 4KC0A 1LUAA 5KAPA 2NG1A 3JQBC 3NGMA 3A36A 3NKLA 1EU1A 2Z4TA 4MYRA 1UKBA 3CW8X 3QU4A 5F1PA 1R6AA 4DQDA 2FPGB 4AAYA 5DK4A 4QICA 2WE7A 4US8A 4KN6A 4BFXA 2HLHA 4MCJA 4C6SA 3KR0A 3LP8A 1ZXLA 3H87A 3COYA 4FGLA 1NPYA 1HDZA 2I3GA 9ICMA 2HUPA 1RE0A 4MPPA 1KGDA 4BNDB 4KO1S 4F8EA 5KYWB 2E18A 4BQSA 4C0AC 4N0PA 4P82A 3G6VA 3BKXA 4Z7NB 4Z3OA 7GPBA 4J7UA 3P9ZA 4H7KA 4OHVA 1JKMA 1NBAA 1NOJA 5KHAA 4PG8A 3VPHA 1G38A 2AFHE 3DHEA 1TUIA 3KQSA 2DE0X 9ICFA 3MXTA 5JCOC 4CI0B 3T7AA 5K0BA 1RFGE 3C3YA 5DGHA 4PPNA 3I1JA 3CPSA 1Z12A 4BFTA 1C4OA 2ZBRA 2Q6KA 1WR8A 4DCCA 1RRPA 4AUNA 2G83A 2FUNB 5IJ0A 5KX5B 4B74A 2VDKB 4LY6A 4EKYA 5JMTA 1POXA 2ZRPA 5CLFA 3G8CA 4NBNA 2H0QA 4EBDA 3HFSA 4QHTA 4R1UA 4DDTA 1TEHA 5CG2A 4L9RA 3RS0A 3SQOA 3DCYA 1SL1A 5JWOA 2QUAA 1BVSA 2WNIA 3M6MD 4IIYA 4EI2A 4YV2A 1FEZA 2AJQA 1UXKA 3Q8KA 2O2SA 1M0TA 1S7CA 2VUSA 3LC7O 2QRKA 2X3FA 4WZBE 1JSZA 4M9LA 1TIBA 2CLLB 4KMSA 4CETA 4KOAA 2Z43A 4TGLA 3GDOA 3QU2A 1WXGA 4L22A 4G1UC 3PDWA 2V0CA 4RGBA 3SEFA 5KPDA 3W5DA 4WNAB 4Q3OA 1PTKA 2PQ6A 3C8HA 1Y48E 3QH4A 4TYNA 2AOUB 3C3MA 4F7DA 3FI9A 1I32A 4IV5A 4XQ8A 1ZM9A 2MINB 1DFGA 1GL3A 1V6SA 2K7ZA 2OXRA 5ALFA 2IYLD 2E89A 2OCBA 1LDYA 3FN4A 1YFJA 1QQ7A 4IVRA 3OZTA 4YMLA 2PUCA 1R88A 3RJFA 5AVZA 1KDRA 3HO6A 2CXTA 4EVSA 4PEVA 1GSAA 5BOSA 1JBEA 4H1TA 3AKZA 1SBNE 2GLUA 5J3JA 3FOFC 3BMQB 4LDNA 4YLYA 4TYYA 5AW7A 1GTJ1 3AK4A 4NJEA 3ZCRA 2P3OA 5KTQA 4UTXA 3M9OB 3AEKA 1PR9A 1S96A 3F4LA 5CIWA 4MR9A 2VNAA 3ID6C 2O06A 1TAUA 3LQRA 5EPEA 3BJYA 2HWKA 1AUQA 3VHQA 3UXEA 5NLLA 4C0KA 3ICEA 2B1IA 3HA2A 2YJGA 3AEQB 1DKPA 4JP3A 3EOZA 4Q9JA 1DEHA 2VPYA 2WIAA 5DG9A 1GOTA 3N7RC 1O1YA 3D2LA 3N7TA 4D3XA 3SBDA 1AKVA 4Q16A 4QYMA 1S2OA 3ONNA 2EKQA 1C0EA 3CW2A 1AQNA 2QE6A 1NLMA 2JAWA 5BSRA 5BYJA 2G9ZA 4KE9A 5EZYA 2EW1A 3E3NA 2WWHA 4QIWF 5DGBA 4YNBA 4ZO8A 3J81j 3RG2A 5KNBH 5DB6A 2F9FA 2RHHA 3E1KA 1JAZA 4X1YA 4IFIA 3VR6H 1QV9A 4L2IB 5E3JA 2PU5A 2BOVA 1IXSB 4HAUA 3QE0A 2IV7A 5C32A 4IUYA 5IDQA 3V6JA 3O91A 2A92A 3M7DA 4AKSA 2X9NA 1I94B 5DBCA 1KKLA 3RJIA 1SCUB 1CDZA 3AQEA 1QM5A 1UC5B 1K2VN 3EAFA 3BRQA 2G06A 3BWMA 4YBRA 5CBKA 2ZFUA 5HKAA 2A33A 4W5NA 1UQVA 3OUUA 2K60A 3TTWA 1SB9A 2PXAA 3AP1A 3RIHA 2UYHA 1YE5A 2PE5A 4I55B 3QFRA 4XGRA 2ZCUA 2X2OA 2FQQA 2FSIA 1XMVA 4U6QA 3I6BA 2YIJA 3H40A 5T6MA 5I6DA 3NC0C 2EERA 2WRZA 4I9UA 4TLMB 1JIVA 2ZI4A 4DNFA 4PYJA 4IIXA 3OLVA 1O3YA 3ESXA 3JD0A 1LK0A 2IXFA 2PSHA 2PS9A 4MJ7A 4U2FA 1Q50A 3DQQA 1CJCA 2M9NA 2HDOA 1UK8A 3BN3A 2VXYA 3PXUA 3C1UA 3R41A 4QBFA 3PL5A 3UTDA 2OORC 4BO1A 5DYIA 3UW1A 4D9CA 1EVEA 1HGXA 4M9QA 4NK5A 4E6PA 4AJ9A 5CFOA 3AO0B 5HOQA 5I7WA 3K6SA 1JG4A 3CPHA 3JQ9A 5FI0B 2XJ4A 8ICVA 2ZJBA 1JEQA 2XUPA 2XICA 3AM5A 4QUKA 3TFWA 5KDOA 3EGXA 3GRCA 1KMQA 3LDFA 2ZUCA 4H2DA 3PHBE 4CM7A 3AR9A 4A0RA 3A7DA 4DQXA 3T34A 2GZMA 4QZGA 1JFLA 4XYMA 5B2ZA 1TTPB 3EZ2A 4B9EA 3KQPA 3ZQ6A 3T1YB 1FFSA 3H04A 4H1UA 1JQ5A 3A1NA 4COOA 4DLNA 4XGKA 1AZLA 2QLLA 5JMWA 1F2UB 1UJCA 1H4SA 3QFHA 2IH4A 1O57A 1Z00B 1DXQA 3CJTA 2ZPTX 3QOYA 4J2TA 5JAMA 3OOJA 1RXVA 2WUGA 4G5YA 4YR2A 3N0XA 4MCAA 3FRIA 2AJBA 2NTYC 4V0SA 1WWUA 1GSIA 2WAOA 4JSTA 1QP0A 1E94E 2KPOA 3VYTB 4OSOA 3QKWA 2DXIA 4PPQA 2H6EA 2WJ4A 5K3SA 3SWWA 5IKOA 4IUDS 4HQOA 1EWTA 3M1AA 3D8NA 5JY1A 2V98A 2YYZA 2UVDA 2YWHA 4U9UA 1I51A 4L8VA 5GM1A 3RUPA 3TNDA 2R8IA 4M8LA 4ZPJA 4QLBA 5CYGA 1KOJA 4E13A 4EW3A 4KSCA 5MGNA 3GH1A 1VL8A 1NUUA 4C80A 5BRNA 4YIKA 4IZOA 3NBQA 1PR2A 4CG1A 1ORTA 3P0EA 4PRLA 5ALXA 4UDNA 4F0JA 4PNZA 4EAQA 3QPBA 1IOWA 3GFQA 4B3DA 3CJRA 2OHXA 1AK9A 1XU9A 2B8NA 3NDRA 3ZE1B 1PR6A 3WYAA 4DOMA 2FPSA 3NAMA 5CDGA 5KYGA 1AUOA 3T5JA 1VHTA 1XCGB 2WTXA 1TAHA 4NV0A 3ZWNA 1OVGA 5BRJA 2DTDA 5D1HA 3V1TC 2NP6A 3MGGA 1E2KA 1EDEA 1AHHA 5G3ZA 2J0QA 3BMOB 1MA0A 4EB3A 5ISMA 1I6LA 4R2WA 2PWPA 4JJ6A 4I2NA 5LNK1 3K9BA 5IAEA 5LKAA 3K1ZA 4DLLA 2PD3A 1FJXA 2Y68A 3VNRA 3K31A 3E9MA 3OEEA 3P32A 1MA7A 1H69A 2ZROA 3GLUA 3TLKA 4DJDC 2DFKB 3GT7A 4MFCA 5B2EA 3T5CA 1NKTA 3C6QA 1V85A 1M8FA 1CEQA 3KPWA 4CE6A 3L07A 4D4GA 1PWZA 4UFOA 3ZHTA 3WA7A 2CFOA 2Q3EA 1JHMA 3D7KA 3ILXA 1DQNA 3USZA 3BQMB 3QFCA 4JYZA 2A1UA 1FDRA 4F4XA 2O1XA 1J00A 2HU5A 1AGNA 4L50A 1E3QA 2BISA 2KP7A 2QZ4A 3EYWA 1OILA 3JQFA 3OP1A 3MJRA 4TQSA 3GIIA 3V00A 5DMHA 3N8IA 1G3IA 4BP1A 5BP7A 2ZXIA 1WUTA 5A6VA 1ULSA 1XMXA 4RPXA 4TZ6A 3VXKA 3FPEA 4FBTA 1W5TA 1HMYA 3FDXA 3KCQA 4XVQA 3H5TA 5CVJA 2JJ1D 3ROEA 1QGYA 2C7BA 4F1KA 1OU4A 3E70C 2E4UA 3KLPX 4BMXA 2EBWA 1MBZA 1P60A 1GT91 4LMPA 4EYKA 2AN5A 5IF9A 1GTZA 4KBFA 4TZTA 5BY2A 5C53B 1IQUA 4XYGA 4X6XA 1ZGJA 1LPMA 1SK8A 1H6DA 1U5BB 2RHCA 4L7VA 3OSPA 3NAGA 1CB0A 2ADFA 2O3JA 4LDPA 2PFKA 3RJMA 4YPVA 3H6KA 1NN5A 2XY7A 1BMFA 3KOWA 4EZIA 2FMPA 2GNPA 2Q2OA 4A5SA 4RBNA 4B35A 2I9PA 3L0PA 1LPBB 3M5DA 4AUMA 3GFOA 3NEYA 2BCJQ 1ZHOA 5E6RA 1O54A 4DR7B 3IEIA 1BXGB 4KVGA 2O5RA 5ERYA 3O74A 2DWCA 3VKUA 3WMWA 3KHRA 2FW6A 2R6DA 3G02A 3JYHA 4BRWA 2F8LA 2ZI6A 4YN3A 3OCUA 4YTEA 1KIFA 1DG9A 2BM0A 5DM1A 5FYDA 4JK3A 4B8WA 3ZIUA 1KXZA 4K28A 2RCYA 1SB3C 3MJEA 2DPMA 3HJCA 4OGLA 2NU9B 3WL4A 4RD3A 2IVFA 3PGKA 2NZUG 1MAHA 3MVEA 5DLDA 2XYRA 2OD9A 1KOLA 3NTRA 2NRXA 4ACOA 1U9YA 2OUIA 1XNQB 3S8YA 3IM1A 4RFLA 2GWSA 3A4TA 1VDMA 2P2DA 3BFXA 3HB5X 5TMEA 3INTA 1JYFA 3WGTA 3D0KA 4QQKA 1B93A 3SE0A 1Z33A 2FXVA 1HO3A 1AXGA 1BFKA 1JKJB 1EE1A 3AI2A 2Q45A 3GV0A 1F5SA 1LNZA 3SYZA 4GX2A 2OO3A 3B7PA 2IOQA 3K0CA 4M22A 1HZZA 3GPCA 3I2GA 2KTQA 3LI2A 3ORHA 3WS7A 5DHFA 4EYQA 1C4WA 5LZ5A 3NVMB 4ER3A 1MB0A 2OCKA 2CLMB 2BE7A 2XWJI 1ZEJA 3IAS1 1EK2A 3C16C 1JDNA 4DIOA 2AFVA 2H8KA 3KKAC 4TLAA 4CDGA 4W5OA 2HSJA 2F4NA 2OHVA 2VDRB 3SC2B 3E0FA 4JVLA 4OIFA 3L6CA 3C7DB 1N9ZA 2ECPA 2L18A 2R00A 4YONB 1XMSA 4D1YA 1SHZA 3KQNA 3CVYA 1PT7A 1ZA2A 1BXRB 1R12A 2WTBA 5EWGA 1QCCA 3CF4G 4TVOA 3FLBA 4UU7A 1P2TA 2VDLB 4Q37A 3TO5A 3X2SA 3KKPA 4U7DA 1OXJA 3GGGA 1K6IA 1CC1S 4B34A 1JPVA 1XDDA 1GAWA 4NYMQ 5IT0A 3T3PB 4M1MA 3UM9A 3GV7B 4P5EA 1GYQA 3RVRA 3RAFC 3AVVA 2QD5A 5CLIA 5HG0A 4QEDA 4CM8A 3CUVA 4M9UA 1D1QA 4C0ZA 4MCIA 3CLUC 4R2LA 4ENQA 4QZIA 2QARB 3I2JA 2XA2A 3LKBA 5D5HA 4DKXA 4BO2A 2JI7A 2V54A 3TRIA 1RXSA 3RK4A 2AT1A 3CX7A 3V2HA 3DDOA 1KVSA 4UHBA 2B1QA 1IZYA 1MIOB 5CGZA 3UWKA 4CMJA 3QBDA 1JBKA 4ENUA 1QP4A 1V37A 4XFKA 4E5UA 3PVSA 1JLHA 1RT9A 1A1VA 3AR3A 3EJWA 3EF3A 2DYKA 3ML1A 2HHAA 4N6NA 4XARA 2PZFA 3JYNA 1J2UA 3PG5A 3REOA 5T6BA 2FWBA 1FUKA 1ORHA 1X7WB 3KSUA 5ITZA 2NYRA 4HD8A 3OQBA 3A32A 1Q8KA 4MQFB 4EIWA 1D6MA 3FUXA 2PUEA 5HR5A 3U61B 1ZQAA 3EWNA 3EBPA 3VNQA 3PR2B 4P53A 5T57A 4KQCA 3R9IA 3UAZA 3VVCA 2PKCA 4KN4A 5AKKA 1NTOA 3L8HA 3PQCA 3RSHA 4NS1A 4RSRA 3AL3A 3C87A 1Z0IA 5T7BA 1FDTA 2VA9A 3E22A 4P08A 5CK5A 1QNFA 3B6JA 3M6LA 1GU0A 5EMKA 1JYEA 2ZRAA 1BPZA 3FCSB 3WRXA 5DI9A 2W9CB 3OTIA 5C5EA 4H7JA 4CM9A 1SUSA 3FZNA 4JT9A 4L74A 3RYIA 3D54D 2YBEA 1LJLA 1XLTC 4B9NA 5AVUA 1N3LA 5DNEA 4FWTA 1AX9A 1ZWLA 4HMPA 2XGMA 4KKXB 3HV2A 4M98A 3QOWA 3GCDA 3W5IA 1A5BB 3R5JA 2GPNA 1M3SA 3A9CA 4C4YA 3GFFA 3COWA 2COKA 4AP5A 4DV0B 1E3EA 1M1ZA 1TYAE 3AI3A 2LM4A 2ZBEA 5TGTA 4G8BA 5F52A 1M2WA 3EVDA 1IPFA 1OLOA 2AGOA 4Z6KA 3TIFA 2IPLA 2WKPA 4MPJA 3SXJA 2BF4A 1XWWA 2H1FA 3NRZA 1WCNA 1U1EA 3VA7A 3K20A 4TUYA 1PYGA 2NYVA 3KYDA 1LV5A 4TMYA 5IXJA 1UADA 1ADFA 3EWSA 4O2BF 5KNDA 2OYYA 4KR2A 3E81A 1C8KA 1URPA 1B6RA 2JFUA 2HIHA 5KNCD 3KALA 5U4XA 5D49A 3NXKA 4S12A 3AKCA 1EDDA 2H5EA 3UK0A 1L4HA 5I45A 5J2UF 2HOIA 5KNLA 1VGRA 1YAJA 1YFLA 1ZQJA 4IJ5A 4O1HA 4E2FA 3U16A 1XMQB 1RHJA 2FSVC 2OBFA 3GFBA 3KJNA 4GLFA 1PFYA 5CJJA 2CT8A 1RQGA 2I7VA 2NYAA 3HCCA 4BKRA 3FH0A 5CX4A 2NSYA 1E79D 4G26A 4BJ3A 2VTKA 3GDGA 4WLNA 2ZJ5A 3WQBA 4M54A 1D1SA 3ZI4A 1QCZA 2GPJA 1XVAA 4B6FA 2C2ZA 1KHHA 1RAGA 1F2VA 5B4VA 2ZRNA 3SR3A 2XA1A 5BN3A 5AMXA 3K71B 3WAGA 4E2XA 3PSFA 3O8QA 4AY3A 5LQJA 4EY8A 1T15A 4D0NA 3RJ5A 4OBBA 2P7IA 1GPH1 1E2EA 3WHIA 1TK8A 4RMNA 3ISDA 2HA2A 4Y2PA 1D0SA 2C4VA 3NTOA 3RGGA 1RJWA 1O9BA 2C5LA 3EZ9A 4G2NA 4MI3A 4JZKA 1GGEA 2E82A 3MG9A