3KZXA

Crystal structure of a had-superfamily hydrolase from ehrlichia chaffeensis at 1.9a resolution
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
210
structure length
205
Chain Sequence
SMKQPTAVIFDWYNTLIDTSINIDRTTFYQVLDQMGYKNIDLDSIPNSTIPKYLITLLGKRWKEATILYENSLEKSQKSDNFMLNDGAIELLDTLKENNITMAIVSNKNGERLRSEIHHKNLTHYFDSIIGSGDTGTIKPSPEPVLAALTNINIEPSKEVFFIGDSISDIQSAIEAGCLPIKYGSDILSFKNFYDIRNFICQLIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HAD-superfamily hydrolase, subfamily IA, variant 1
publication title Crystal structure of a Had-superfamily hydrolase from Ehrlichia chaffeensis at 1.9A resolution
rcsb
source organism Ehrlichia chaffeensis
molecule tags Hydrolase
total genus 82
structure length 205
sequence length 210
ec nomenclature
pdb deposition date 2009-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.730 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 3kzxA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3kzxA01
2JARA 1S8OA 2FUEA 2JAUA 1Z4JA 3QU2A 3SLRA 5AKZA 2W4MA 1SU4A 3I28A 4KX3A 2YN4A 3U13A 4QJBA 4UAVA 1SWWA 3ZTWA 3B9RA 2ZOSA 5IT4A 3U7FB 4MUMA 3ZX5A 4NV0A 2G08A 1XP5A 4YCLA 3OTQA 3U19A 2OM6A 2YMLA 5ALNA 4I9FA 5AVWA 2B8JA 1JUDA 5AI0A 2G06A 1LTQA 5AM0A 4Y2SA 3S6JA 3L0CA 5AI4A 2W11A 5AK4A 1Z88A 1RKQA 3AR3A 1U2SA 1Z4NA 3QU7A 2YBDA 4Y2YA 3SHQA 1Z5UA 4L6CA 2JGAA 3WK9A 2YMMA 2QYHA 1KYTA 3PCTA 4HGOA 2Q4TA 4EEKA 2WFAA 1TA0A 3L8HA 3NALA 2P69A 2PR7A 4Y2UA 3AR4A 4AS3A 3NUQA 3KOOA 4UM5A 3KC2A 2ZBFA 2HEGA 2I55A 2WF7A 4RETA 5JJBA 5AKYA 3OCWA 4KX5A 1RQLA 3DDHA 2MSNA 4IFTA 1YMQA 2AUTA 3QUTA 5AKKA 3KDPA 3I6BA 2GO7A 2Q5EA 3WKAA 3WK4A 1U02A 3IB6A 4C4RA 3QNMA 3QUCA 5AVSA 3RFUA 4Y3UA 5AW0A 5AVQA 1WZCA 5ALWA 1NRWA 1AQ6A 4NFLA 3KBBA 5ALUA 2ZBEA 3NRJA 2HF7A 3ZVLA 3ED5A 2B1QA 3W5DA 3A1CA 3ZWKA 2R8XA 3QU4A 3HYCA 2G1AA 1K1EA 2WHEA 1ZD3A 2OA0A 3FGOA 2FPRA 3OCUA 5ALRA 5AICA 3B8EA 4EENA 4AP9A 2YMPA 4F71A 5A3SA 1YS9A 2WF9A 5AVVA 4EELA 1L7PA 1Z4LA 3SKXA 3ZX4A 4CF4A 2HOQA 3L1VA 2EARA 3EWIA 5ALOA 2HI0A 5AKLA 2Q4RA 2IOFK 3UMCA 3ZW7A 2CFRA 4UW9A 5E0OA 1Z4MA 1YV9A 2P27A 1U2TA 2C8KA 2O9JA 4KN8A 1RMYA 2B1RA 3WKEA 3ZTYA 5AESA 3DNPA 3ET4A 1L7OA 3A3YA 2GHQA 2HO4A 2PKEA 2RB5A 2I7DA 3AR5A 2RBKA 3ZI4A 2FDRA 2G80A 4UAUA 2VKQA 4DW8A 4ZEVA 2C4NA 2C88A 4BNDA 4Y2JA 2I33A 3I1YA 3N5KA 5ALPA 4BYGA 1RKUA 5IS2A 1O08A 3ZUPA 3NASA 2R8EA 1YJ5A 2AGVA 1QYIA 5AKJA 3K1ZA 1RQNA 1FEZA 2FI1A 1VJRA 3CZ4A 3PGVA 4GXTA 1U7PA 3L0BA 2IOFA 5AVRA 4H1WA 3W5AA 3TLMA 1X42A 2YMQA 4DWOA 2G0AA 3L5KA 3A1DA 4NAVA 4CNQA 3ZVMA 4UATA 5ALJA 5ALSA 1L8OA 3EPRA 2B30A 5ALIA 3BWVA 1NNLA 3L8FA 5AKEA 2P11A 1RRCA 5AI8A 5ALLA 3WK6A 2GMWA 1L8LA 5AW6A 1TJ5A 2QLTA 2AMYA 3ONNA 2P9JA 1L7MA 3W5CA 2FPSA 2CN1A 4EX6A 3QGMA 1QQ6A 1Q92A 3WK5A 4UARA 3W5BA 5AKXA 3QLEA 4BEVA 4DFDA 4OHFA 3CNHA 1L6RA 3KZXA 3AR7A 3WGUA 5AI6A 4B6JA 4HAIA 4FFDA 4J2TA 1T9ZA 2EAUA 5ALFA 1CQZA 1TJ3A 3EF1A 5ALYA 3R9KA 3F9RA 2O2XA 3L8GA 2C9MA 3L8EA 4HGQA 1ZS9A 5AIAA 4F72A 4XOUA 1N9KA 5ALMA 3QUQA 4XPZA 3WKDA 1QQ5A 4YCMA 3R4CA 3QX7A 3MN1A 1U7OA 4BKMA 2GHTA 2BDEA 1T5TA 3ET5A 1NF2A 1MH9A 3SKYA 3QYPA 4HGPA 3OPXA 2W43A 2FEAA 3E84A 5AW5A 2YJ4A 3BA6A 3E81A 1VJ5A 1ZOLA 3OCYA 4UASA 4YIKA 3UMGA 4BEWA 4UU1A 4YH1A 1J8DA 3QUBA 1F5SA 4KNVA 5AW8A 2I34A 3U7GA 1ZRNA 3U7EB 4UU0A 1Z4OA 2IOHA 2WF6A 3N8GA 2CFTA 3N07A 5AM5A 5AHXA 3WKBA 4Y2XA 5AIBA 1Z4IA 2JAOA 5AM3A 2HF2A 2ODAA 1QQ7A 1WVIA 3QXGA 4HGRA 3N1UA 2X4DA 3PGLA 5AK3A 1Z5GA 2RAVA 2C8LA 2NYVA 3AR2A 5ALZA 1ZD2P 2WF8A 1ZD4A 2OBBA 5T41A 4OFZA 4PNHA 3B9BA 4L6AA 3AR9A 4BBJA 2ZBGA 2B0CA 2IA5A 3P96A 3SD7A 2R8YA 2NO5A 5ALVA 4EX7A 3U7HB 2HSZA 1RMQA 3NANA 3E58A 4BNDB 3L1UA 3J7TA 4UMDA 5AVTA 5AW4A 2BY4A 1LVHA 3M1YA 5AM4A 4CF3A 1RLOA 5AW3A 4NABA 2HX1A 2YJ3A 1Y8AA 3HLTA 4KYTA 3FM9A 4Y2PA 1VFPA 4BX3A 4FYPA 3DV9A 3L0YA 1RDFA 3ESQA 5AM1A 5AM2A 1TE2A 4RESA 2WM8A 2ZBDA 4AS2A 3IRUA 1S2OA 2FPXA 4UM7A 5AVUA 2HDOA 4IG4A 5AKGA 5ALTA 3NAMA 3ESRA 3QU9A 3WK7A 1IWOA 1YNSA 1EK1A 3ZWDA 3L7YA 1RC8A 4O8CA 2HCFA 2IYEA 4OCZA 4G9BA 3EF0A 1RKVA 2YFYA 5ALQA 3SF0A 2FPWA 1N8NA 3WGVA 1EK2A 3FPSA 1Z4KA 4Y2TA 5AI9A 4CF5A 1ZJJA 3OCZA 3KD3A 2DQSA 5AK5A 4ZEWA 4E88A 1TJ4A 4YCNA 5ALGA 4BX0A 2CFSA 2WF5A 1T5SA 1ZRMA 3UM9A 1QH9A 1YDFA 1CR6A 4BX2A 4J03A 4C4TA 3ZU6A 4GIBA 4UMFA 4G63A 4JB3A 5AVZA 2ZG6A 3QU5A 2ZXEA 2HHLA 3PDWA 3WKCA 2PQ0A 3M9LA 3MPOA 3A1EA 2EATA 3FZQA 4I9GA 5ALHA 1XPJA 3WK8A 4Y2QA 4FE3A 2GFHA 5AW9A 3N28A 4HGNA 5A3QA 3IJ5A 4XE5A 4DCCA 3AR6A 3D6JA 2R8ZA 3OCVA 2I6XA 3NIWA 4NWIA 4Y2RA 1RLMA 1O03A 4UMEA 2B82A 2MU1A 1Z4QA 5ALKA 1RPZA 4QQFA 5A3RA 4YIHA 2G07A 3DAOA 1WPGA 2RARA 3I76A 1SWVA 1ZD5A 2B8EA 4C4SA 5AW1A 2AH5A 2OYCA 1WR8A 4UMVA 3UMBA 5IT0A 2YJ5A 5ALEA 2NO4A 4HYTA 2YY6A 2YJ6A 5AKHA 5AW2A 1Z4PX 3E8MA 2FUCA 3OCXA 4MWOA 3FPBA 4ZEXA 5AW7A 4Y2VA 5ALXA 1J97A 2BDUA 3R09A 5AKIA 5AK6A 4L57A 5FP0A 3SMVA 5AVYA 1PW5A 2JAWA 2FPUA 4JDPA 4EZEA 3RF6A 3GYGA 1L7NA 1XVIA 3AR8A 3FVVA 2D2VA 2I54A 5AVXA 5ALDA 3VAYA 5AI5A 4KNWA 1RMTA 3MMZA 2G09A 1Q91A 4OD0A 4YGYA 1RLTA 4XQ0A 3U26A 3ZVNA 4CE6A 3MC1A
chains in the Genus database with same CATH superfamily
2IUEA 2HHAA 4YVZA 1MXHA 1RZTA 3E7DA 3I37X 2AKYA 1WCIB 3Q7RA 1MKYA 1G7TA 3F49S 5D86A 1JSXA 1QSSA 2YYZA 4QOJA 1CUCA 4A0QA 4PAQA 4NOMA 1A3CA 1DU4A 4AJ9A 2W42A 2W7OA 2Q4DA 2ZJFA 2PUGA 3UV7A 2JIMA 5A4FS 1TDJA 1Q19A 2HMVA 3JWHA 3ER8A 3T1YB 3A6DA 3QY0A 3FRJA 4HK4A 2O0KA 5A05A 4AQDA 4ZI7F 2FN7A 4Q7LA 3TNYA 1H2YA 4OHPA 1NGSA 1TD9A 5JCZA 1W5FA 2F3TA 1ETUA 2FGJA 2REOA 3E9YA 2C7QA 2M9NA 1XP8A 5ALWA 3HXMA 3LT1A 2ZBEA 4J1TA 2EZTA 5ARCA 3ND7A 2PSFA 4QBHA 3ZHUA 2ZYDA 4K9NA 5HTKA 4R3NA 4AD8A 3P9QA 3U7IA 1GWNA 3JRNA 3VTFA 1PVVA 5TB5A 4RTOA 3K0HA 4K8OA 2YV2A 5FPHA 4KI7A 4N49A 3IV6A 1QYRA 1L5QA 4O8ZA 5JPDA 2RG7A 2E49A 3KE8A 2QLNA 1DG1G 1HE4A 3IBGA 1T2DA 3KCQA 4KXXA 4E0DA 3ZD9A 3ICWA 3A4MA 5EHZA 4UVDA 1XMOB 1Q1GA 1Q22A 3ONWA 3RT7A 3M7DA 2OO5C 3QOYA 4ZKEA 3R7NA 2PTHA 3DGEC 1DKLA 3MGIA 3CLHA 5ALSA 5DOVA 2V03A 2CNDA 5AKEA 4Q39A 4FGWA 3M70A 2ZSAA 4OKSA 4RY9A 2JZOA 2RSLA 4KFUA 2IHVA 3H5IA 4JD5A 4YRBA 2GBPA 1II8A 1X8KA 1TEXA 1CR1A 1XRRA 2PRZA 3GYBA 4KOAA 3PHJA 3U4AA 2XGOA 3RAXA 2XIJA 8MHTA 2DWUA 4Z0NA 3O82A 8OHMA 3C16C 5L95A 1KE2A 4RNCA 3WADA 4LYDA 2F17A 4DE5A 1ABFA 1KERA 3OWHA 4H2DA 1E1NA 4RTMA 3OQIA 3S55A 1N5WA 4ETNA 1IMJA 1P29A 3U7GA 4FR0A 3DV0A 2V7QD 3LKZA 5JNLA 1JI7A 1EWVA 3B0XA 2ILVA 2JIQA 5JISA 1J8MF 1KFKB 2YXLA 4QJFB 1QGDA 3RBZA 2F3NA 3CTMA 3RIXA 4TTAA 2RI6A 2XUOA 1F0MA 1AHHA 4LJKA 4CI9A 2NRWA 3BE6A 3DE6X 4JA2A 1W85B 1CRWG 4YO7A 3AESB 3REGA 3VJRA 1NJ8A 1YBHA 2XE4A 5L6MB 1N0IA 4K86A 2DX7A 4RDIA 4F5YA 1X7YA 5BT9A 1U9IC 3DO6A 3QFFA 1J21A 1H2EA 3FUCA 4CDGA 2E1RA 4HFMA 4DQKA 1EFDN 4JU9A 1YCDA 2AG8A 1KDVA 3RQIA 1PFYA 4DY4A 4FHCA 3IP7A 2EWWA 4Z4HA 4J03A 4GEGA 1WPQA 4G63A 2Z2JA 4B79A 5D3MA 5ENDA 3QZ7A 2POCA 4O4HA 3OFNA 1FYVA 4Y2QA 5HFJA 1BPZA 3QG5A 4HDNB 3BC1A 4R2LA 3WLMA 3CWQA 1OZ0A 1PI3A 7ICJA 4U0KA 4G81A 2V4UA 1YRWA 1KMCA 2HBMA 4KKVA 4CM9D 1II9A 3UWDA 4N76A 5A2QA 1BG6A 2COKA 3PJRA 2YWXA 5AUNB 2YWEA 3EZXA 3GRYA 3RABA 2FG5A 3RRYA 1Q0LA 1EVQA 2FPUA 4GW3A 4L9RA 1WUYA 3T38A 2G17A 3NR2A 1QG2A 5ALDA 1TKRA 4ML3A 4BZXA 5J2DA 2FE4A 2WV9A 3IEIA 1QK3A 4I5IA 3V2GA 4DLVA 2C2GA 4Q3BA 1S2GA 1TT7A 4KFCA 5F4ZA 4JQYA 3OY2A 1WB6A 1E3IA 1SQ5A 1V48A 2B8JA 4AXBA 1YQWA 1N2IA 3VKVA 4Q37A 2ID7A 3X1JA 3C3AA 4OQQA 4IDPA 1DRGA 1Z88A 2VBIA 2ZIEA 4QATA 5A5GA 1VZ2A 3N7SC 1DO8A 4EEKA 2HSEA 3BK2A 1XQ6A 4MYTA 1GGVA 1TK5A 2WQ6A 2XGMA 5NULA 4KSCA 5KFEA 4A2QA 4RFVA 5BNIA 4LNHA 3TFQA 4I9UA 4UPDA 4DYDA 4UBCA 1VA5A 3T3PB 4ZO6A 2WWVD 1L5LA 1B22A 2VAWA 3AKZA 1HT2E 5K0FA 4HRVA 1WUTA 4LC9A 1JIHA 2H3IA 1DBWA 1UMDB 2C9BA 4OLJA 1KTQA 5J2EA 2Z98A 1XCPA 2PS9A 4BFYA 3ZYCA 3V4RA 2P75A 1QRUA 2VZ9A 1U6IA 2GN9A 3SDZA 4CM7A 2W8BA 1FU7A 3D7MA 5K0EA 3HILA 2D6FA 3P20A 3DMRA 1MW8X 1JSZA 1Q0UA 4IFEA 5FI3A 3C8MA 2LRHA 4JJFA 5FYQA 4TXNA 3QXHA 1DXHA 3UCEA 4H9GA 3Q5GA 3FTEA 3PD1A 4CCHA 1E6UA 1RYHA 4QVIA 4YD1A 5CW2A 2ZYIA 1E0AA 1QDUA 1FRNA 5SYNA 3L0OA 4B47A 1XEWY 3P71T 4GI3A 4UDNA 2P9CA 2VO1A 3JTMA 4RY0A 4QLBA 3EDMA 3IAFA 4EZIA 2Q6LA 1RPJA 4FSDA 1RXUA 4L4UA 4CKXA 3WK5A 1XB2A 2IHTA 4RLSA 3EVFA 2D3TA 5EESA 3U31A 4ARZA 3JZMA 1RYSA 2BH2A 3JR3A 1TM2A 4ABYA 2GM3A 4PZLA 3SHOA 4PFKA 4ZCIA 2OZKA 4RO0A 1C3OB 1GAJA 2VZ0A 1VMDA 4PYIA 1VE3A 1P1IA 2PGIA 3WYDA 3FFTA 1QMGA 2H92A 4PLCA 1YKFA 2HU5A 1U7HA 3TKAA 3F4KA 2B3DA 5HKAA 2GWHA 4I1VA 2C8LA 3H9EO 3G2OA 3EULA 4EJSC 1EPUA 4OP2A 2J30A 1GILA 3KU4A 5AVTA 3HCWA 1TUIA 3OJEA 3VOBA 5HJ2A 3CG4A 4I2VA 1WXFA 1VE5A 1P2DA 4XM2A 2DUNA 3IMEA 1GUBA 1N2EA 2EZYA 3FPJA 2NSYA 2IEAA 3VO2A 4GG1A 1GTVA 2PRIA 4RQ2A 1UMKA 4EMSA 2NSDA 1QGED 5C7IO 4KGXA 3QKRA 2FB9A 1ZHHA 3O3CA 3UMRA 3C5CA 4D8YA 2GPNA 2A5YB 2HU2A 1SBTA 5ABPA 4URVR 1PNVA 2I65A 1E9VA 1X3SA 1E2EA 5JRJA 5AVZA 4HAYA 3II6X 2JLBA 4OUDA 3WZMA 4IQ0A 1Z2CA 3C5WP 4EFNA 1YZQA 4H7EA 5DW0A 2HRQA 4UB6U 1P1HA 3UOWA 3E0XA 4NBRA 2WA2A 3RSLA 2P40A 5AK0A 3T61A 4DJDC 2WKQA 4YMWA 5EMMA 5EVJA 2H48A 2GXAA 3TDNA 3T7DA 5BXYA 1HG0A 2CVHA 4U7HA 2FFAA 2YJ6A 4NAUA 2PJRA 4PL2A 4KV9A 3K35A 1F17A 4WA8A 2UAGA 3IVGA 4XR9A 1GY8A 3DNFA 3VX3A 5C7LO 4L57A 3B8HA 1PL8A 2WVHA 4E22A 4DBLE 3GLUA 4JJ6A 4DCJA 2QTBA 4PC2A 2JD1A 4GYJA 1P1RA 4F6RB 1KPIA 1ISPA 1TIPA 1PWZA 1ZQIA 4FWTA 1T2AA 3N9IA 3A6KA 1RJEA 1XDBA 5DF1A 3FZGA 3VPGA 1AU9A 3KTOA 1PSZA 2RHOA 4F50A 3HB9A 1CCWA 3L0CA 4OIMA 5JSKA 3ZZ1A 4UZSA 5A06A 4X24A 4C6TB 4KV7A 3QPCA 3CLKA 2G82A 4GAEA 3I9OA 3NAGA 2ZJZA 1YL7A 3A3OA 4FFBB 2V7UA 4LVOA 2ZW9A 2V8OA 5E38A 5EWGA 4RSMA 1JJFA 4TUPA 1NUQA 3K94A 1JQKA 4ZH4A 2IYFA 4BN0A 3LXMA 1HYGA 2GETA 5JVDA 1AQ6A 5HQTA 4Q9KA 2EIXA 2C3MA 4PO8A 1XYYA 4AMVA 5JWHA 2C07A 4OMDA 4TYPA 4TWRA 1M8GA 2APJA 1MNAA 4CIBA 4ID3A 3SJAA 1KKUA 3R9XA 3VSAA 5AKLA 4I1IA 2J33A 3KX2A 3D6HA 5C5CA 2O9JA 1ZLXA 3I04M 1USIA 4UB8U 2J3JA 1GRQA 2YQEA 3EEIA 3R9WA 4J0JA 4DANA 1OXXK 1L3TA 4E5VA 4QYXA 5J2JA 2H4FA 1XNQB 5H9VA 2FH5B 2BR5A 1WPRA 421PA 1G42A 4TZ6A 4L3OA 2HK9A 4HWPA 1N2GA 4C7YA 1DDOA 1KP3A 3BQNB 1T9AA 3QYFA 2VJOA 1NK4A 3IURA 1KI2A 1HE1C 2KKVA 2BFCA 3LV8A 4ZU1X 1ODJA 5AW6A 2DL0A 1BKYA 3CM0A 2Z6AA 4DLYA 4PR3A 1ZQLA 5J2UB 4HAIA 1MT3A 3UH0A 4F9EA 4OAPA 3A1UA 2VJDA 1T1EA 1EFVB 1Y88A 4G4JA 4I9NA 2AIRA 3VC7A 3W8NA 2W22A 4I8DA 5BMVF 1QE0A 4C2AA 4DC9A 3J80A 2VZ8A 3HP1A 2NPFA 4XA8A 3COYA 4EKIA 2E4AA 3DHNA 3DAPA 3GUCA 1XKLA 5KFRA 1LPOA 3HRIA 1PJSA 1KS2A 4D8XA 4TKUA 3V42A 1J0CA 2OORA 3PKIA 8ICCA 4P4UA 4WOKA 2F9LA 3O94A 3USCS 1HO3A 3HJBA 3PG5A 4UTPA 2F8SA 4GKBA 2IH5A 3DGFC 2BGTA 2O1EA 4CV1A 2ZJOA 5DGAA 5C52B 4L27A 4UXHA 4KXUA 4QUEA 4W6ZA 1XV5A 4XWAA 3WV5A 1Q0PA 3ITKA 3QLVA 5EMHA 3RUEA 4RVUA 3D2NA 5B7NA 1XZCA 5F9NA 4LF7B 2PU5A 3GVPA 5F33A 4YQEA 1DGQA 3IR5A 3QLUA 3CUUA 3EBLA 4BV9A 4O2AF 3AJDA 1P9RA 1PK1B 3C3YA 9ICQA 3N0XA 2OXOA 4F4YA 5EMLA 5FWDA 3A0UA 4DIUA 2OB1A 3OJUA 1GZVA 1Q6ZA 1DAEA 3DWIA 4BX9A 3LF1A 7ICQA 2WICA 1LNQA 1ZMTA 1H2WA 3GZNA 1XWIA 2Z8XA 1IJFA 3WLTA 5FT9A 3KUCA 2W48A 2Y1LA 4RUCA 5EP2A 4NNPA 2QW8A 3VTAA 1G21B 3HZOA 1PX2A 1QPGA 3L4JA 4MGZR 3ZN2A 3PWZA 4FS3A 2GOLA 1U7DA 1YQ9A 2C8JA 4FDVA 2HTEA 3VPDA 4M88A 3H1EA 3BWEA 3B53X 3NT5A 4FGJA 4GBED 1IHXA 1Q15A 3RJ9A 2XQIA 2BC9A 5CPFA 4RU9A 1EINA 2VDKB 2NXCA 2UVVA 5DTMA 1S01A 1QSYA 4EI9A 5HZKA 3WDKA 2P9TA 4GRIA 2VF2A 2RJNA 1JUDA 2PG3A 1O5IA 4Y0NA 3IILA 5LP6A 4FYWA 1P2FA 1YRAA 4C7OB 1OIVA 4KH1A 3P1JA 3RADC 3UCXA 1SRQA 4GPIB 3FPGA 4HDAA 3AGPA 5JNUA 1XFDA 2OD2A 1PJ4A 1QE3A 1O95A 3P52A 4XLZA 1KAGA 4MRNA 3A05A 2DR3A 4ER6A 5CDUA 2B1QA 1U2GC 5ESDA 4ZQGA 4EK9A 1VDZA 3BB4A 1R66A 1VJGA 1NV9A 3N8HA 3U40A 1Z7BA 4OI0A 1HM5A 1PGQA 3DEFA 1P2GA 2B5VA 2IOFK 2G7ZA 1QTMA 3MRSA 2P27A 4UB5A 4CU2A 4AS1A 3N59A 2NNWB 4NX2A 3E7FA 4MEAA 4XYMA 4DA4A 1ESDA 4G5HA 2C88A 4F3TA 4KXMA 1CNFA 4ZARA 3ZY2A 1XQYA 5CCBA 2FMIA 2QRQA 3HBAA 2YVQA 3VM6A 5BOLA 1DRKA 5JASA 3AP2A 7REQB 1O0SA 3TW4A 1K2VN 5B55A 5KL8B 1IIBA 3T4XA 5A4IS 1CIPA 3ABSB 4CF7A 5CX1A 3GELA 5AI8A 2AWNA 1JP7A 4P81A 2JLRA 2VQ3A 1QUFA 1Q92A 1GNQA 2EC5A 4G2NA 1CEZA 1E66A 1L5VA 3A9TA 1AXGA 2F43B 3FAHA 1XMJA 1QORA 1C9NA 1I3MA 2NUPB 2WFLA 4ZVKA 3UH1A 2VPYA 4CDMA 5A02A 2FETA 3SJCA 2IYZA 1TF2A 4LNUA 3TCKA 4K0RA 5A62A 1FFYA 3ZZUA 1JDPA 1P0MA 3E0QA 4YWJA 3GOQA 3Q40A 2CZCA 2VA9A 3C4QA 1GNTA 1C1HA 1X9GA 3ICCA 4IZHA 4Y2XA 4D9EA 3LDUA 2IDZA 2PK3A 2QW1A 1LQ2A 3K4PA 1KAMA 1XJWA 4WKOA 2LHTA 3AI1A 1E6EA 2P9FA 5F9HA 5ITVA 4Q93A 1X40A 2FPKA 3ZZ0A 2H1CA 3RH5A 3ILSA 4HNTA 1VL8A 1LDYA 3JAKA 1NXXA 3TMAA 4L22A 5U4QA 5CA1B 2P79A 3UXNA 3JD2A 2NV6A 2WNIA 3IPAA 3KZOA 5IFKA 4UQOA 1F2UA 4IVQA 4BVEA 1VHLA 1TTQB 2HCFA 3M89A 1H23A 2BONA 3NETA 1N8NA 3OM9A 2JEIA 2ACWA 1Z4KA 1JPJA 5YASA 1WWUA 2QAJA 1PR4A 4MMYB 3OZVA 1PSDA 2Q45A 1YZGA 1KDPA 4O59O 4WEOA 1L6IA 4GM1A 3IO3A 5BSFA 4PONA 4PNZA 3VC1A 1YI8A 3ZCXA 3AB8A 1B3RA 5ISMA 2CLLB 2BGWA 2CK3A 2Z8YM 2I71A 3HWRA 4FW8A 4YXFA 4RMGA 1CRPA 5IC4A 1WMSA 2MU1A 5CDGA 4IDOA 1EGMB 2ZSKA 4MRRA 4D82A 1GLVA 2XNDA 1X74A 4LYGA 3ILVA 3X1WA 4IIHA 4U7GA 4B9NA 4ZTBA 1NU8A 3K1AB 1ST2A 2AKAB 5IBQA 3AEKB 4P4OA 3A2MA 1BPBA 2ZREA 5HIMA 4JV5B 4V3CA 3ISJA 2QT0A 2VRNA 3BJEA 3NFRA 1P19A 3CFYA 1RW4A 5IDWA 1KI6A 1E5XA 1YB2A 1LLCA 1PQPA 3VFDA 4G0QA 3TVTA 3PC4A 3NRWA 3AJRA 3OZFA 4A8PA 3NYIA 3HZRA 3IULA 2WWWA 4JENA 1ZL2A 5BWBA 1KEVA 4Z53A 4NONA 3OLXA 2PUDA 4ND8B 2FP4A 5A5DA 4DZZA 3R7LA 4FNMA 2ZU0C 5J2BA 4KPFC 2L0XA 5EIXA 3BF8A 5CYOA 3KQNA 3EN0A 4AJJA 4HT3B 3ZD6A 1TAQA 1UWLA 2Q5HA 4CPDA 4JSYA 4W6QA 2WQ7A 3MEQA 3LA6A 3WL5A 1XC9A 1PJAA 1JDUA 2D06A 1UAAA 1VI5A 4I1YA 5KREA 1LD3A 2W90A 1N6LA 1LK5A 3MZ0A 2FG6C 4WXEA 4EP1A 3PITA 1BQ3A 2FMHA 1X1CA 1PFVA 2BBTA 4I5FA 1GGFA 3VH2A 2DHEA 1FTSA 4DCUA 1R0SA 4DV7B 4H6XA 1U0LA 2PZLA 2RLTA 1YUBA 4C3OB 3SC2A 2E6KA 4CCAA 3LF2A 3DDOA 3HEAA 4JHLA 4ZALA 1FDSA 2DJ5A 3H7IA 4WJLA 4MV7A 4NE2A 2ST1A 2VNKA 1KDOA 3S1SA 4QBTA 1Z07A 4N12A 4NJMB 4DVGA 2HIGA 2AG5A 1JQ5A 3G7NA 4R5MA 3OIFA 1SA0A 1FPMA 4FHFA 4ARBA 2J0SA 3OJFA 4RVDA 1YMVA 3H84A 4S1WA 1KQ3A 1MB2A 5AVRA 4PR0A 2YOFA 1JR6A 1UPHA 2BMEA 5EAIA 3S81A 4A6XA 2KMDA 2J6UA 2IK8A 2JFXA 4XPIA 3BH7A 3MJFA 1ZQ1C 2W0MA 3I6IA 4QG7A 4JROA 1XSLA 1FS5A 2CLFB 5EP3A 1GA1A 1P0FA 4EG0A 1IM5A 9ICAA 8ICJA 5FWYB 2O8CB 1E4VA 1DFGA 1AXEA 1ODLA 4UJ5A 4CLXA 4TM7A 5AD1A 2CW5A 3NTQA 2HMYB 3BTOA 4C0LA 3EXIB 4HYKA 3SKYA 1KEZA 5CB4A 4KREA 5IK2D 2H54A 1TEHA 1L5HB 5IJWA 1COWD 4YH1A 4MYSA 4Z99A 2R11A 1CE8B 4EHFA 3R74A 1ZIXA 3IIIA 3KFXA 1GO3F 4D3SA 2W2OA 1V9CA 1O4VA 2JLXA 1O97D 4BQOA 1IN6A 1OYVA 3SNHA 1GAQA 1I7PA 4RMHA 2CDRA 2ZTSA 3FYUA 4WOBA 2WD8A 4O3NA 1CJKC 4MKIA 2H3QA 4Q24A 1KTIA 5CB1A 4QDTA 3NTLA 4GO1A 1J22A 1HLDA 3SQNA 3PQ2A 2V98A 3W5VA 3JD3A 2FUG1 3WK7A 2WEKA 1YNSA 4PYKA 4CEHB 4X6XA 1C50A 4M89A 1RCFA 3FI0A 4YFKA 3IB3A 3PPWA 4WBNA 3QX9A 1N25A 2QRJA 5SYAA 2P6RA 1J07A 2I1WA 1PNQA 1YU9A 5F1KA 2JH9A 3KVVA 5BNFA 1GXSB 2CV0A 4EVQA 3PX0A 4IXTA 4TS4A 4WY8A 3GFQA 2LNDA 4JBYA 4UKDA 5JI3E 4BJQA 1AUVA 2Q2QA 3A32A 2C1EA 3KL2A 1A0PA 5EE5B 5TQVA 2Y0SF 1V6AA 2Q3DA 1GR1A 1XCBA 3GPDG 1TXGA 4XLTA 1QH0A 4F5EA 1BH2A 5IDXA 1VYHA 2AGQA 4U2BA 3SAJA 4IINA 4RIEA 3QVGA 2PSSA 3DL0A 3KJFA 2O8DA 2CV2A 3NHLA 2GDJA 1EFCA 3C3CA 4TYMA 3MA0A 1O9GA 2HA4A 2NWQA 2I9KA 3C7TA 5K03A 4JI8B 3RF6A 1U63A 1J2MA 1EFAA 3IAAA 2DWQA 1LWOA 1R8SA 3RLFA 4YJ2A 4K9LA 1X1AA 3BFXA 2X0FA 1SHKA 3IV9A 2JHGA 3U1VA 3SLRA 1EX9A 4DMMA 2YN4A 4MAMA 5G4KA 1SL1A 4XWTA 2GF0A 5I7WA 1I7QB 1L7DA 4RK4A 3S27A 1AZLA 2QN1A 3H8WA 3G9QA 5CXSA 4Z0TA 2A35A 4QREA 3FVQA 3T5KA 3LYSA 4Y2YA 4JYMA 5JS6A 2NV0A 1Z5PA 3KBOA 3OU2A 4URXR 4IZOA 2ERYA 1HDRA 3IUNA 1JQAA 9ICOA 1WVMA 2BBSA 4WASA 5AXCA 4V0LA 4UUNA 3BERA 2NGRA 4LXTA 1USGA 1O9HA 3K0CA 3VI3B 2AJDA 1BRMA 3I5XA 2A5LA 1TZBA 2DG2A 1E1YA 4Y2HA 1C7IA 1EM6A 3QG1A 3R0QA 1LDBA 5JFOA 1AS2A 4DYHA 1MV8A 3H1GA 3M1IA 3WICA 1RBZA 1U98A 1UKVY 3C5HA 4RXUA 4N7RA 1RYRA 2B35A 3TL6A 1U2RA 2EFCB 1EMDA 5G4LA 2W70A 3LXRA 1NJXA 3RNOA 2R6CA 1JIQA 3FR8A 1EQAA 1E9CA 3TCNA 3HKZF 4CLOA 2RB5A 3EPJA 3ZI4A 2FDRA 3N87A 3H83A 3N2KB 2WR8A 4QO7A 4A92A 1E94E 4J3NA 3JQ9C 5K8JB 1HDIA 2G3YA 1E7SA 4YTEA 2ZDGA 1OLUB 2A9JA 5FTWA 2IUFA 4UBIA 2YKGA 1JQBA 1ZPDA 4Q43A 1IY8A 4CMHA 1Y37A 4OXQA 3F4BA 3ZK9A 4HO1X 2CL0X 3GMDA 3W0LB 1GPLA 4FOTA 3CEHA 2J46A 1NNLA 2WIAA 5KYNA 3DFZA 1NIPA 3OPYI 1PG0A 2PL5A 1Q6YA 3SHVA 5TLSA 3QEMB 4RZUA 1R6TA 2QWXA 5DYIA 1AHIA 4JR1A 1QHXA 2IEDA 4QKQA 3K0BA 1QMPA 1N9ZA 3OCCA 3EASA 4XIGS 3LCMA 1K98A 2XA9A 1DEXA 5DGTA 3WKDA 4X44A 4Z49A 7ICLA 3WLQA 2W9CA 2C5GA 1Z75A 3HY4A 2L18A 1A4XA 1T2UA 3TQ1A 3HU5A 1KVSA 2X8WA 2VXCA 1DBPA 2VN8A 2OK8A 3GAFA 3O1IC 2LTAA 4WESA 1VGRA 4I66A 4ZOQI 5EY5B 1ML3A 1RXIA 2HCRA 1N8KA 1NULA 5EJ7A 2ZBPA 2CJXA 1V8BA 4Q8EA 3CSDA 5EZYA 3GJYA 2XX3A 4JFAA 2I1VB 3IQEA 4BNUA 3WRYA 4QLOA 4JI5B 3QHAA 2VZLA 4MW7A 2C2OA 2IYVA 4D80A 2D2FA 4DWIA 2H4WA 1NVWQ 3MR6A 4ZIRB 2BFAA 1QGUB 5IAKA 5C7OO 1X15A 3EWNA 1IAVA 4BMYA 4MV8A 2IHMA 4AT1A 4C8NA 4I50B 5FEUA 1NR7A 3GRAA 2XA1A 3N6RA 1NK6A 4IUBS 2OXIA 1K88A 3PXCX 3FI9A 3E7PA 2FMPA 1D09A 3O9MA 4J43A 4J0GA 1LK7A 1I2AA 1XPOA 2NU9A 3C3XA 5CEEA 4UTOA 5F3RA 5FOQA 1A5TA 5BN3B 2X76A 1K92A 5KFIA 1RXCA 4IJWA 3TQSA 1GFZA 4NWIA 4KZPA 3AG5A 3M6ZA 4RKEA 4DADA 3RAPR 5BR8B 4GUAA 2W71A 1NKEA 3QJ5A 4HS9A 4D45A 1L8XA 1N1DA 4KUHA 1V1RB 3HR7A 4FWBA 2WWFA 1VMIA 5FL3A 2UDPA 4L4ZA 5TR9A 5AKIA 4I2JA 3C14C 5GONA 1W46A 4Z4EA 5B57C 4XX0A 2N75A 3HCDA 4K9OA 4YAEA 4LDNA 1UDCA 2LD4A 4OGWA 3VSDA 4EVRA 1O5OA 2FUEA 3GGJA 4I5EA 3U1TA 3KV3O 4PVDA 4D43A 3WY9A 5TY0A 1N7IA 2VLIA 1MG5A 2YRFA 2H2HA 5EPEA 2Y9PB 4XYLA 1U9LA 4KUGA 1NXPA 2C4VA 1XLUA 3SXUA 3HCPA 2WDZA 3SPXA 3HJNA 2Y3IA 2EKPA 3AEVA 5GOZA 3KQSA 4TSFD 4UUMA 1W76A 4HATA 4N8SA 3H87A 1LW6E 2B1JA 2NT3A 2OCEA 3AR4A 4BWGA 3KC2A 4DFPA 4ED3A 5JJBA 1QOQB 5AKYA 3BHNA 2GN8A 1IUOA 3DDHA 3LLCA 3NHPA 1FMCA 3I5AA 1V5FA 3BGIA 2Z4RA 3NH9A 2ZB8A 3IA2A 5DHUA 3ZKWB 1YR6A 4YT4A 1PFKA 1VIVA 4ZCTA 4XCQA 1DOZA 4YR9A 4JX9A 2G8NA 4OGFA 1R9GA 1LPPA 4GRDA 3BB1A 4ED0A 2FPRA 3PHIA 5C8YB 1GRVA 5FI0B 2X8AA 5TS3A 5IMSA 1YD7A 1PDWA 4U3JA 2W58A 3HYNA 1YFKA 1UP6A 2E4YA 3QZ8A 8ICQA 3WJ7A 1BYUA 4MAFA 2HMUA 5EJ9A 2QJOA 3QLVC 5LZ7A 2A86A 2ZYUX 3T3NA 6CHYA 4J3FA 1KK1A 3IOYA 3AK4A 2YQ5A 3EZLA 5HKOA 4HFNA 2PH7A 4GMHA 3KZKA 4MXDA 5IJ0A 4F5ZA 1Q0TA 4R9VA 2ECQA 2GJ8A 3KDAA 4RX1A 3O8OA 3ZG6A 1MAUA 2WZQA 4BE4A 1JWAB 3LA8A 1UH5A 3MYRA 3TL2A 2BCQA 1I3OA 3TF5A 2IF2A 1H8HD 1BHJA 4JHXA 3U17A 4Q18A 3TZ6A 4BTEA 2ZGVA 3ORFA 4AY5A 1FO4A 2OPBA 2R6HA 3OEYA 4FR5A 2BGLA 3BWXA 4ZV9A 2P6PA 2RI1A 2HLDD 4C80A 3P0IA 1OZAA 4BVLA 1WS6A 3C28A 1Z6PA 3G59A 2J9FA 2W6QA 2B8TA 1E8NA 4R40A 1DRJA 3OFSA 5DI9A 5JH7A 2XE8A 4XOUA 2GOYA 1XJCA 2VI5A 2G4LA 4JJEA 1X66A 3QVUA 3UK1A 3I42A 3BJMA 4EAQA 1JQDA 2IW1A 1DTEA 2KI5A 2ZULA 3KUXA 2AZ4A 3CKYA 1ABBA 1C1YA 2BR3A 1JTVA 5F7JA 4ZT4A 1N0HA 3KQOA 1PR5A 2VDQB 1BCRB 4HDQB 5MF6A 5HF5A 2IBMA 2QPLA 2NRXA 4B2LA 5T41A 1CY7A 1JG4A 1DBIA 3GLHB 4F8YA 4Q8FA 2IA5A 2PFKA 4OBEA 1SR8A 5ALVA 4WGGA 5HKBA 3UV6A 1NXOA 4MCJA 9ICEA 4ISBA 3FM9A 2P4SA 2YVAA 3PLNA 1SVMA 3EUWA 5K3FB 1ENZA 1OAOA 1D2CA 2D8CA 3IEXA 3ANTA 4KJXA 4GE0A 4XJVA 3VRHA 5J2TB 2HT6A 3L7YA 2WPDD 1XU9A 5AJVB 5BVHB 4BFSA 2FW7A 3GUVA 4K3UA 5DW3A 4G2TA 1JEOA 1SXJB 2ATIA 1E9BA 1I36A 2JDID 3MG9A 3IN5A 4I29A 5IT5A 3COZA 1U8EA 5BSMA 5LD2C 3TTWA 4E11A 3C3MA 2IV7A 1I1OA 4LMPA 13PKA 1ELOA 2O0LA 2ZJYA 1Y1KE 4PFJA 2J0UA 1WPGA 2FMSA 3ZDEA 4LX0A 4UZFA 1SFRA 1K1QA 1AKWA 3S2GA 2GAJA 4IDAA 4A8JB 2PFNA 1ID8A 5F1OA 4LE0A 2GHRA 3DBIA 3MILA 2R2GA 4BP9A 2XEXA 2X19A 2QTVA 4MIYA 1JDVA 5LCXA 5B1YA 2C5AA 1MF7A 4YEDA 1AV7A 3ZWVA 1IHPA 3M6XA 3QEOA 1Y5NA 2BKLA 2GN0A 2I54A 4G1MB 3VAYA 4KPUB 2ZUCA 4KH0A 2C04A 4AAYA 2HSWA 2H3FA 3F2VA 3HZHA 3JPQA 4JK3A 4KLZA 3AL0C 3TO5A 3I28A 2I6SA 1TK9A 3FCSB 3CLUC 3CZQA 3PQDA 2VUIB 5LZ5A 3TTVA 2K7FA 3MVEA 1C81A 2AQ4A 1ZN2A 1V11A 3M5PA 4RIIA 3FOZA 1D0SA 3WK9A 4NLNA 2XCRB 2ZIZA 1IJEA 2HJVA 5ELXA 4BAUA 4JLVA 4M8SA 3V8VA 3K1YA 2YOGA 1NOKA 1Z5ZA 1R88A 1VL6A 1VPEA 2H3HA 4YXJA 3NYQA 4J0KA 2VHTA 1SVIA 2C4HA 3AI3A 4F3NA 4I08A 3BZCA 2ISPA 3PX7A 1I94B 1O94A 4RE5A 2GPTA 3JQPA 4HF7A 1T6YA 4XUCA 4DDWA 4U9IS 3OGUA 4CWAA 3HYCA 2QY6A 4HWOA 1MT0A 1KVUA 1N1EA 4BNGA 3JWGA 2NZJA 4TN5A 3SKXA 3BEOA 3DZ8A 1EQ2A 2VJAA 2FQXA 3PE3A 2JFQA 5KOJB 1KZGB 2A1IA 3HO8A 5HZMA 4FM9A 4B09A 2P2SA 7ICHA 2GM4A 5IP5A 2YASA 1ULBA 5LOVB 1WZEA 3P7MA 2QV7A 3R0JA 3JATA 3DR5A 1GPJA 3C2KA 4B9AA 1Z0DA 5L1LA 8ICBA 2DSTA 4Q1VA 2Z3ZA 3OM8A 1NKTA 1N9GB 1MA3A 1GPBA 4FYMA 5IIOA 1WF3A 2XB4A 3BCUA 3L41A 3IDFA 1TPZA 1JL3A 2Q0HA 2WUFA 3L5KA 4Q9JA 5A1TA 2HF9A 2GBIA 4I46A 4MWZA 5JRDS 4DSEA 1XO0A 1MFZA 2JAQA 4OMUA 1WETA 2GPYA 2O2HA 3G5LA 3A1VA 3FHCB 5KT6A 3IC5A 1T9DA 4Q3DA 3M33A 1E1LA 4OQLA 3MR2A 5BN5B 2C3PA 1LCIA 2F00A 3D2CA 4Z2YA 3NBZC 4HDMA 2KMLA 4F7DA 2BR0A 4OATA 3KJEA 1PD1A 1Q2UA 2RHMA 4LOIA 1HDYA 1VLHA 4FXOA 4OB7A 3DOUA 2OZEA 3U49A 2QA5A 3MPUA 4KJZA 2Y1FA 3KZNA 3CUVA 4BVGA 2MU2A 3MAGA 3Q1LA 4C8LA 1XE3A 3D8RA 7GPBA 2VRCA 3RVQA 5TT1A 1FLAA 2PFPA 4EGCB 4WKPA 2PZ8A 4B4DA 3DQZA 3QW4B 4B85A 1E0DA 4AN4A 4JEIA 3MMNA 3OG9A 1R1DA 4MWBA 1ESNA 4AJKA 3OJ0A 1XZKA 5T6MA 1J5EB 2FPMA 2QR3A 3AEZA 4MUFA 3ONEA 3CUEF 4DWJA 1MO5A 2OZLA 3M8KA 3ZWXA 4LYYA 2VHWA 1PLLA 2VUHB 1D03A 3BCHA 3W7BA 1CF9A 1SUFA 5KS2A 4NZYA 2BJWA 4Q4AA 1GT6A 3C6ZA 2B37A 3BD8A 3IT1A 5ALQA 3EF0A 4LRSB 4CF5A 1ZJJA 2Z5FA 3TGWA 4ENQA 1XDZA 1YDFA 1I30A 3P94A 5FD8A 1MJHA 4C2BA 4MFCA 4YRAA 4JBNA 1JFFA 5L3SB 2JEFA 2BFDA 2QARB 2XDYA 3NBXX 2PQ0A 4AX8A 1KR2A 4I81A 2WTBA 3L7AA 1LW7A 1USKA 2REXB 8ICGA 5JBQA 1BU5A 3HNRA 5DEOA 1PIWA 4Q9NA 4JJZA 3TQTA 2RARA 5FQOA 4PPQA 2YOHA 4OI2A 4D44A 4US2R 3MS2A 1VRVA 1T7PA 3RYCB 3GHYA 2GWSA 1F6BA 3UJ7A 1ITZA 3Q7TA 3G8YA 2DBQA 2YV4A 3DMYA 3ZZTA 3HDTA 3JU3A 4B6FA 3MHTA 1D9DA 2ZRHA 2E5FA 3PSAA 3SYTA 2I7CA 3ND6A 1Y42X 3W34A 1WU8A 3TPFA 3ECAA 1CTQA 3O2NA 4MWGA 1MX1A 4KMSA 1OU0A 3F3KA 3DMGA 1MHTA 4IIYA 2R2AA 2CEKA 4O08A 3D2LA 1Z3EB 2D2IA 1EWKA 4A2CA 4PG5A 1JU9A 1BNCA 4O2BF 5H7XA 3UKOA 2BUCA 4CNBA 4NC9A 1VE6A 4HDSB 1QRAA 1WB4A 5H3LA 2F64A 2VYCA 2F3QA 3GO4A 4TKZA 3KOOA 2ID8A 5GAJA 3I0MA 1IVSA 6AT1A 3ZK8A 2J0VA 3VAAA 1Z2AA 3RIYA 5KFWA 2SHKA 2HW8A 1H0RA 4M6WB 4FT4A 4EEYA 2H0RA 2IXBA 4WXRA 4N3NA 1C30A 5AJWA 1NBEA 4FKMA 3R7DA 4PE5B 4JGGA 4R5HA 1O77A 4YALA 1B6GA 2O2GA 2WWHA 2IUTA 4D9KA 4GOMD 1JROA 1ZETA 2J41A 5DEIA 2BEKA 1RWPA 3ZX4A 1JB1A 4B76A 4JEMA 3AUYA 3EWIA 3PPXA 4ZQHA 3PI6A 2A0XA 3U60B 2YIMA 4K9RA 4TYWA 2NP7A 1SVSA 4PRLA 3N2ZB 1GPAA 2JI8A 3T1HB 2PAFA 2FX3A 2EKQA 3LUDA 3EXFA 1MABA 4R8LA 3TG2A 3IAM1 4MEYA 1OAAA 4JLBA 1X1SA 3UK0A 2NZ2A 5KWEA 1HDZA 2MSLA 4ZZ1A 4RA6A 3KPVA 3CZ4A 2PD4A 3DBLB 4J0DA 1XK7A 4LJ8A 3GBVA 2PUAA 1F2TB 3FB4A 1EWRA 1SUCA 4OJNA 4MRMB 2K2WA 2C2DA 3MCWA 3OIWA 1A2KC 4B9TA 3EPRA 2BMJA 3RAFC 3EBOA 2P9JA 1RQXA 4ABTA 3PB3A 3INGA 3F9CA 1FFUA 2GN6A 3IAHA 2BQUA 3CH6A 4D25A 4UNNA 2FOIA 3L6BA 3JWPA 4YRPA 3QUQA 3U81A 3VYTB 2C96A 3TRKA 5LYJF 3HLYA 4L8FA 4UCWA 2EQAA 1UC5B 1PQ4A 5KNDA 4H7FA 4RTLA 4V1CA 3UMGA 1Y89A 3IHWA 5FNVB 1HXHA 4M21A 1G1AA 2NV3A 3OQVA 5KYXA 2B83A 2R8HA 4EEZA 1ZK4A 3F1KA 1ZQJA 5TGZA 1ACMA 3CURA 4IX1A 3DKRA 4MB0A 5DHAA 1IXKA 3HYRA 3X3HA 4ZC8A 3U7HB 3EEOA 4ZV7A 4NEHB 2FWNA 4Q02A 4BO1A 4LISA 2IHYA 4RQMA 3KKZA 4Q4JB 4BAGA 2Z4TA 2HRBA 1EUDA 4FBUA 1XWLA 3DOCA 2DBVO 3STVA 1EP1B 4MGIR 3GEHA 2H2AA 2M6RA 4EYEA 3N4MB 2ISQA 4I5GA 3BORA 1C7ZA 1IDN1 1ECPA 3O93A 5JMPA 2V9PA 2ZG6A 5FUWA 2P90A 1LKYB 1CS0A 1L5MA 3HV0A 3ONVA 3C6XA 1LLDA 2RCYA 2W6ZA 3PXGA 2Q8NA 4NKRA 3IX7A 2Z3WA 3ENZA 2VDVE 2V3CC 1NLZA 1UKBA 4BO7A 3RSHA 4WZAA 4LWOA 1HPLA 1YHNA 1WIWA 5IABA 5T4HA 2CEAA 1JKXA 3R6TA 5KFQA 5DYGA 2Z9BA 3PMLA 1EUCA 3CLSC 4GDFA 1CUBA 4ZVRA 2F1JA 1CRQA 5K3EA 5CUQA 1SVKA 1RYNA 4M1SA 1I7DA 2XMZA 1PJLA 4GH5A 1Z2OX 3KELA 5DRTA 4CKWA 1A9YA 4XM1A 1VIDA 3COSA 3N05A 3GC6A 3JSXA 3VDMA 2GPSA 2JARA 2XAAA 1DJLA 1DKMA 4ENTA 4MF8A 4ZYTA 4MIOA 1XU4A 1VYUA 1DTWA 1F8GA 3QF4A 2Q6VA 2Q5JA 2XQKA 2BR4A 1L4EA 4P53A 3OZ7A 4POOA 4QYMA 3GFBA 3DQPA 1PHPA 3TFRA 3LRPA 4UXJA 3VMMA 3IO5A 2E4VA 1DX9A 4PSAA 2EX4A 3ZXSA 3INNA 2WW8A 2RBGA 4CUKA 4GZ3A 4RF4A 4L5AA 3ZY5A 4IGAA 4TUYB 1EBBA 5C35A 1JVBA 3GJ8A 4KLHA 3KOYA 1Y3CE 1UFVA 1Y4SA 3WHKA 3KSDO 4BRWA 5CX4A 3KIPA 2VK4A 4BOYA 3AL2A 4OL0A 3MWEA 2W9MA 3M6VA 3U0VA 4IYRA 3U16A 1IZ9A 3HXQA 1NY6A 3BMCA 1W29A 2IPLA 1H05A 4MA5A 3LC0A 3K4GA 3IXMA 4B3XA 2RIPA 2QQFA 1JRPA 3DJFA 1WUIS 4PZNA 2O8FB 4G5RA 2X3FA 4P2HA 4LHXA 4QZIA 3TBKA 3IVRA 4F06A 5IN4A 2ZJ6A 2QZSA 2EJBA 1EK0A 1XTVA 3FUUA 3QRWA 2B21A 4YR7A 4BZWA 4NBSA 1IEQA 2WWRA 1ED1A 1I24A 1KVTA 4DWOA 1E7RA 2JGDA 3FUVA 5IM4A 1L7BA 2YNMC 1SD2A 1ULTA 3PQ8A 5KHLB 4CQLA 5CDFE 2BPGA 3RUPA 4NM2A 2NO7A 1S4QA 4NDNE 4KQEA 2YXDA 1LV8A 4EPVA 5HIKA 2QE6A 3ZLTA 4K6FA 3OHMA 1YZVA 4NCXA 1FVXA 2GZMA 1E89A 4QXAA 3L8EA 1MOPA 4O5AA 2XKBA 5DP1A 2QGFA 3CN7A 4I14A 1MO6A 3BREA 4J9SA 4NLCA 1BX3A 4CM8B 3ZWAA 2ALZA 1Y34E 4WKGA 5JNWA 5KFSA 5EKTA 1FUKA 1VLBA 2EQBA 4FJ0A 1MN6A 1KVQA 2HF8A 5KFXA 2P35A 8ICOA 2IHUA 3EGWA 5AK3A 1YZFA 3L4EA 4JH0A 3UQZA 1Y6ZA 4JASB 4G97A 1KH3A 3NANA 5FBVB 4DWWA 1DAMA 4LF4B 3TD9A 4R16A 4KYTA 2BCRA 1FXSA 3Q2KA 4PLVA 4EB6B 4I99A 2VQEB 5LIPA 4E5MA 3O31A 1XD9A 4IO0A 1ZQSA 3GD5A 4H6PA 1M0EA 4FGLA 4M04A 1OH8A 3MGCA 3EG9B 4BIMA 2I7VA 3F8WA 4HNUA 3I72A 3UN1A 2I2CA 3K8YA 4L7QA 1VPTA 5DBHX 2C7RA 4ZO8A 1E20A 3ES9A 2FMUA 4GICA 4N18A 1KAQA 3A1EA 3FNEA 1K1SA 5BV2P 2A5DA 3EZNA 5JDCC 3JCZA 4ZC1A 3U62A 3FHJA 3UKDA 1G5RA 4ZRDA 1W5EA 1ZESA 3RVDA 4O1MA 3HWX1 3GV7B 1LVUA 4NMWA 4IFIA 1XNRB 1CR4A 3CRMA 4L72A 3B6KA 2GZAA 4NV3A 1E1RA 4DNQA 1JVSA 4DYVA 2J6TA 2VF4X 4ZTUB 5GV8A 2P8SA 1PWYE 4HX9A 3EXHB 5LYYA 4HR7A 1ZEJA 2JLQA 5AI5A 3HXKA 1UDWA 4FDMA 3FMGA 1ISGA 3DR3A 3L77A 2LCFA 5DZSA 4MITA 2OWEA 2FJ6A 4G5XA 1BEZA 4QJ5A 4YP9A 1ZQVA 1RHJA 1WCYA 5IKOA 1T6ZA 1YASA 4MS1A 4MHOA 5DTRA 1SKAA 1FUIA 2EERA 5MN5A 1Z5OA 4H7HA 1E18A 2FPIA 1XT6A 2CLKB 2BUBA 4C07A 1ZH2A 4Y18A 2AYZA 4YRJA 3D1LA 1FXWF 3TIFA 3W6ZA 2P9ZA 4HNVA 1EDZA 3IT3A 4G9GA 4KGVA 2ZE8A 3NHAA 5JD3A 3HKDA 3RBAA 4YUAA 3DZIA 1M7BA 1LY1A 1S0UA 2D7CA 4CKZA 1JBKA 2R25B 4AL4A 3FGOA 1HQYE 2QE7A 3HDYA 1ZWKA 3G79A 1J2RA 2QSYA 1A8SA 1R64A 2AFHE 2AW5A 2DERA 3MK31 5TISU 3FSRA 4YJ3B 1NAIA 4GT1A 2Q1WA 3L6RA 2JV3A 2WD7B 1MPTA 1RPTA 4R0NA 1PGPA 3A26A 4ZEVA 3B3JA 2WZBA 1E9DA 4O5EA 3KSRA 4CW7A 1B6RA 4MGYR 2G9QA 4JLJA 1QYDA 1ZQPA 3S1AB 1JHQA 5KVSA 2YFHA 3UMMA 5ELLA 5HGXA 1P4SA 3IESA 1K7SN 5LZ2A 1G9XA 1Y6RA 3AKYA 4PSKA 2KZZA 3EG5A 3TARA 3N8NA 4QDXA 1ODCA 1M0WA 2QM0A 5DO9A 4GBMA 4LIPD 4CHGA 2A88A 1DOAA 4UAYA 1AMOA 1PAUA 4HL6A 2HA5A 5EA2A 3MWGA 4J1TC 1T9HA 1GITA 1VE9A 4RANA 3GGCA 4DFDA 4XQEA 4D0LB 3PY8A 3AR7A 4O1HA 3VNAA 3D8BA 1ZO8A 4LHYA 3AW8A 1D0VA 4XB1A 4EFDA 1NDUA 1BWQA 3NEPX 4FFDA 2HWUA 3ZV6A 4RACA 4IGFA 3NM4A 4HGQA 3JZDA 5CAEA 1REQB 5EN4A 4KQXA 1TZ2A 4ITVA 2OC4A 4KKXB 5IXYA 4HPXB 3X2SA 3ZHZA 1Z06A 1JLHA 2EHJA 3E5HA 3NXSA 6PFKA 4K40A 1YGYA 4TPKA 1DQSA 4IXNA 3ZIDA 4KMMA 1HEIA 4WT7A 3MAJA 3P0EA 1TU4A 2V0CA 3OT4A 4WDQA 3SG0A 3B3GA 2FMXA 5E1BA 4N39A 2WU0A 5IIIA 5DT2A 2YWHA 4EI2A 2ZBGA 3PHBE 1SXGA 1U6JA 2DGZA 1W4AA 1ZXXA 3LKVA 3RVMA 2SCUA 2XUGA 2OSBA 2VA2A 4PQRA 4ARUA 1V1MB 3A7DA 1UKAA 3PGXA 1GTRA 3QWBA 1HMPA 3HABA 1S5LU 4R7ZA 5CJ2A 4LRXA 1E1KA 1JEEA 2II6A 4CTKA 1S2IA 1ZCZA 2Z09A 4D4IA 3KT3A 5KCMA 1KJWA 4OCZA 2OV4A 4E0BA 4YLYA 1DEKA 4NIMA 1Y6JA 1VZ3A 1Q0ZA 2V6FA 1DO2A 5JSQA 1A8QA 1N5KA 4C3VA 3GJTA 4JXZA 3ETDA 5GJBA 4CQNA 2DFNA 2H1OA 3RB4A 2C3UA 2R6AA 4LYAA 1RWOA 1PEYA 4KAFA 4HFJA 2QVCA 2OM2A 3ROPA 2QX6A 3QVMA 4K26A 1WD5A 4TWIA 4B6RA 4WZBB 4MKRA 1WQ1R 5GY7A 4OYHA 3TRHA 1A71A 1E96A 1TGVA 5H81A 1SKYB 1RQ7A 2ZBQA 3T5BA 4M9GA 2ZBUA 1UBLS 1ZONA 3A70A 5KDDA 3NDPA 4GX5A 2OFXA 5F1YA 2WLTA 1RE1A 1W94A 4U7CA 4JITA 2RDJA 4NCNA 3SFTA 2Z6QA 4PQFA 3EBPA 1KTVA 1WDTA 4JKYA 4J94A 4X1YA 2QN9A 3BXGA 2C3OA 5CFZA 5CYFA 1KMIY 3K1JA 5BV1A 8ICSA 2BCEA 4AMYA 3UXMA 1HGXA 1Q84A 3HN6A 2K2QB 5DLYA 1Q91A 4JUDX 3RIEA 1NJSA 1X9SA 2GEKA 1SG9A 3D64A 1XXLA 3SR0A 1QANA 4WN9B 4XVUA 3TS1A 3O4IA 2W55A 1BXZA 1CDEA 4W5OA 1KXZA 1RHKA 1LTKA 4GXJA 4C6RA 5BUQA 5JWOA 1G8JA 2G08A 4G0WA 3M83A 1OUQA 3DTNA 4LZJA 3LK6A 1Q21A 4RNMA 4YWHA 1G2IA 4TMYA 2OXCA 2GN2A 3GAMA 2PJUA 2XGSA 4MX8A 5CRXA 5DHQA 1VLMA 3EPKA 3AF0A 2J6IA 3FCYA 3CS3A 1D7AA 1XEFA 3PFIA 2ORVA 1QDLB 5KDOA 4Y0VA 1SHZA 4K4GA 1G7CA 1PDOA 4YXWD 4OQ4A 2CLOB 3RJ5A 4FYVA 4GPEA 3PQFA 3ZWNA 5J0TA 1B6SA 4MINA 1DUIA 1QHSA 1BIFA 3S2EA 4E4RA 4DJJA 2XBUA 4JEUA 2XNCA 5E1DA 4GM0A 1I0LA 3QITA 3GJ6A 1U7XA 5L1KA 4CMJA 4UPEA 5K0LA 1A9ZA 3V55A 3OLQA 3W9YA 4LC1A 1FX1A 3ZH2A 2WP0A 2PO7A 5A4MS 4RVGA 1NLYA 3K15A 4CM3A 4ON9A 2BZSA 2JIZD 1XN1A 3QKTA 1T5HX 2BFPA 4WEQA 3JPTA 5I7EA 3VVBA 4MW1A 2QSJA 3IT0A 2R47A 2A5FA 1FVFA 2WTMA 1P5JA 4O1IA 1EWTA 1P4AA 3E61A 2HBQA 3SSNA 4LQ4A 3HVJA 4FCVA 4JMLA 5CIYA 1M33A 5IBCA 3GP5A 1N8TA 4WKBA 3RD5A 5A4AA 3SSAA 1GJRA 4L28A 2J32A 4ZRMA 3GMSA 1F1BA 3EZ7A 2EAUA 1NBIA 2RH4A 2W4QA 2CHUA 4FHZA 1OTYA 4HJXA 1MBZA 4RTRA 3PQEA 5HIAA 4L3WA 3GT4A 5KOYA 4HCJA 1Z15A 3GLGB 2Y68A 3NTUA 5JMOA 2D6FC 1Y3IA 5C8DA 1RS0A 3SP1A 1Q7GA 4N01A 3VDXA 3U7RA 2FLNA 3ZIAA 4ZHQA 5F98A 5KYTA 4WUVA 1VGVA 1Z2EA 3HZZA 1VKOA 2ETVA 4V3BA 2OQVA 2IY7A 4IIGA 4FD2A 4ZT2A 2CUNA 1WEKA 9ICCA 3N7AA 4F2DA 2SKCA 5SY6A 1SXDA 4EYIB 1ADFA 1H1LA 3L0DA 2J4CA 3IE1A 4LSZA 5JY6A 2FK8A 3M6WA 1EFHA 1R4MB 3E3LA 3MJTA 2L82A 1RC0A 2JZBA 1YFZA 2DECA 2ZTCA 1YAJA 3O7WA 1ILEA 4L2IB 3O47A 3CO0S 1NE7A 4JIGA 3OX2A 2F59A 3SF0A 3ZOKA 1NJFA 3PEEA 1OB2A 5BRNA 4I4TF 1D8BA 4NK5A 2HVIA 3EFBA 5GZ3A 3F6EX 1IIRA 4DQPA 4JXKA 3RHTA 1U0EA 3TAQA 5TQ0B 1MJGA 3CR8A 3IUJA 1TVKB 1TIBA 3FAKA 4ER3A 3DAOA 4QWWA 1NASA 4CL0A 2GAIA 4YUXA 5BO5A 1ZXLA 1J39A 3L04A 2O8BB 2H5EA 3HYSA 2BTQB 3K2IA 5FP0A 4C0XA 1YI0A 1ZI8A 1DIAA 1HKHA 4DFKA 3WYGA 1Z0ZA 1AZSC 3TQCA 1SBNE 3PT5A 5ADHA 4UAJA 2IV2X 2XICA 3MC1A 4EI7A 3B3FA 3LI2A 1J8VA 4ENVA 2GYYA 4BV8A 2ZI6A 1NHWA 4WFKA 2QXTA 5KNDH 1HFEL 3FPCA 2QB1A 1UXGA 5IT4A 4YMTA 1A8UA 3KYCA 2R60A 1RIIA 1U0BB 5K4GA 3AERB 1ZHOA 3DT8A 4HMPA 4BMNA 3LYHA 4TLBA 4ZVVA 1NR5A 3QU7A 4GI1A 3AU9A 3GLVA 5J0SA 4KRFA 3ZS8A 2AZDA 5KNLA 4B7CA 4E5KA 3VR2D 1HR0B 1X9XA 3VR6A 2XE7A 4G1EB 3G2NA 3OCWA 3VU9A 5IULC 3F2IA 3WKAA 3WL6A 5ITWA 1M1YA 5KAPA 2AJLI 1B0PA 2YL2A 1JJBA 2FOXA 1N5IA 3MIZA 3FYDA 3NHMA 4QFBA 5DNWA 1B43A 1V45E 4O0LA 1FP1D 1EK5A 4HJRA 5DV9A 5BSEA 1DSSG 4NXMB 3DDNA 1CQJA 4PHHA 4K9SA 1L7EA 1SG6A 2P9BA 4RVNA 4AWXA 3HTXA 1CUEA 3B9JA 1CUSA 4JGBA 4PPYA 3DW3X 3NGLA 3JVVA 4FSXA 4DV2B 3ME5A 4AO6A 1UK8A 4E7PA 2P67A 5JQGF 5ALPA 5H70A 1JKIA 5DX8A 4ADSG 1FRVA 2DVMA 3C8DA 3OZXA 1V7PC 3TZKA 1WA5A 1NNUA 4RY8A 2OCIA 3SQWA 3IXQA 3MBKA 1X42A 1A4IA 1DRVA 3HXTA 1NG1A 8ICRA 4K4IA 3JARB 2VDJA 2NNLD 2BPCA 2QLFA 3MUEA 3HADA 2GJ9A 4CM1A 3F5DA 2G9RA 3HEBA 4MAAA 2Q5OA 3UQ2A 1UBRS 3FZEA 4P58A 1JH8A 4FMCF 2WM9B 4TL6A 4QZVA 4NH0A 1DC6A 1RBYA 3TAUA 3NUGA 3Q5EA 5IRCD 4YAKA 2Y4OA 2RGBA 1GU0A 2ODNA 4WY5A 5TS2A 3ZLJA 1SV4A 1HEYA 3QMWA 3VQTA 4C0JA 1A9TA 5HF9A 3IDAA 2AHOA 3JQ8A 4MKGA 1J8DA 3BE8A 2HCBA 4A23A 2PS3A 1BNOA 2A33A 2Z30A 1VI2A 4KLOA 2WMNB 2PV7A 3IBSA 3WRWA 1Y1TA 1QG0A 4AP6A 1QGOA 3G1UA 3R76A 4F2WA 4KP7A 1L1EA 1LB2B 4ZOAA 1EE1A 2ILTA 1VBNA 3H19A 4FZJA 1J06A 1QFSA 4U6SA 1TC2A 1MHPA 3STUA 5CXQA 3RWOA 1KQFA 1Z68A 2PWYA 2IPOA 1LBHA 4R8UB 1SELA 1YE8A 5JAHA 3RRJA 1NHGA 4EJSB 3SF8B 4D56A 1Z35A 2CNWA 2XCIA 4G0ZA 3KEGA 1WDMA 2OKCA 2IBSA 5A04A 5CXUA 3JPOA 1LQUA 3ABIA 4HMQA 3B1ZA 4H4DA 4MQFB 5IX8A 4AJIA 3OMLA 2XUQA 4XOIA 4BXOB 2NVUB 2W9AA 4UBJA 3T8YA 3PQ4A 2G6BA 2V7VA 2VCEA 4G86A 5ALHA 2MR5A 4GLFA 3BULA 5E4YA 3X44A 4KPGA 3ZJ5A 2X40A 3IOMA 2R4TA 1JXMA 1PGNA 3ZNNA 2OORC 3B38A 1YNOA 1C8VB 4ELVA 2IP1A 4HQNA 3JRWA 3RAJA 4Q1AA 2JC3A 2V6MA 1S77D 4LF6B 3INRA 1C41A 1L7QA 4LMRA 3P5SA 4RIGA 3PDIB 3CTPA 3E27A 3EIOA 1UFQA 3DZBA 5LBIA 4C87A 4P4TA 5F9MA 3LX5A 5FULA 5B1IA 3LC1O 1T6BY 5DWDA 1TYCA 1FJGB 5F4BA 3NKFA 4XCVA 4CE6A 3MGHA 5JAPA 1TLFA 3LLUA 3GLIA 3QLUC 3PLRA 3O1JC 3ENWA 4O3PA 3REQA 1CDDA 1FZTA 2ZZKA 4YS6A 3EGIA 4Z9BA 1DC5A 1FFXB 5EWFA 1UKZA 5BQOA 3PO5A 4DSTA 4BX9C 5AK4A 1QRTA 2RKBA 1H3NA 1MAAA 1R0ZA 1R0YA 1OVMA 1T24A 4KLDA 3RJIA 2KSOB 1T3HA 2VP5A 3TW8A 4KE7A 2E48A 3WXBA 2MMCA 4RETA 5D7BA 1JQLB 4G8BA 2GO7A 4YMHA 3FJYA 4H6VA 1P74A 1ZVQA 4MR7A 4I55F 2QLJA 4LXGA 4UM9D 1P1CA 4ZA2A 3F6PA 2WDPA 4X45A 3DB2A 2C22A 2QMZA 5I8ZA 5E4FA 4B34A 1B26A 1NRXA 2ZBRA 4QJIA 3K0FA 2CHFA 3PNSA 1V4VA 2YHIA 2TMYA 2HRDA 3PHHA 1Z7EA 3QY9A 4Q3LA 5J4LA 1KC1A 2ZJ4A 5IN5A 1NW3A 4M1TA 5DYTA 2D59A 1JZTA 4PO1A 1AB5A 3BGVA 4B3CA 1WP4A 1RKUA 2ZT5A 5ECGC 5EWMA 5LP6C 4S1PA 1FNDA 3SZMA 3KZMA 3QSYA 1OTXA 3H5TA 2FZKA 3H2IA 4DR7B 3NKVA 1YRBA 3RFAA 4BWYA 2X6TA 1JIIA 3LUAA 2Q0QA 5G0SA 2F44A 4WNCA 4WINA 1JAYA 2O1WA 3ZBQA 3WLIA 3AHHA 2XCSB 3I3OA 1O95C 4ILKA 4LWPA 4QLAA 3LWBA 1A4RA 1XK6A 1QC5A 4WECA 2CHQA 2AI1A 3ESDA 1X7GA 1JVNA 3LZDA 5I8PA 1KBOA 3TMYA 4KPEC 1CUGA 2C4UA 2IRWA 1G17A 3VZDA 5THKA 5H1YA 5C1PA 3EGXB 2JLYA 4A0GA 4D79A 4HGPA 3SDBA 5JNRA 4BNLA 5EQFA 1UIMA 2C2EA 3DXXA 4FYYA 1SUPA 1YB6A 4AF8A 4K8RB 4GI7A 3PGA1 2Q3HA 2VK8A 4RH1A 1ISIA 5AOAA 1J0XO 1ZC3A 1UMBA 1P7YA 4LZAA 4Y67A 3V4VB 4JLMA 4Q1FA 2HBYA 1WUKS 3E70C 3PR3A 5CGQB 2CUKA 4KSBA 5K0GA 4DFMA 1FLDA 1LF5A 2JJ2A 4RMNA 4TKVA 4LF8B 1FXUA 3HPQA 4IJ5A 1ZQMA 3ZYZA 1ZJNA 1FFCA 1EK2A 2RHTA 1U3TA 2FU5C 4UQPA 1E0SA 1Y7PA 1EFLA 4WSOA 2FTKE 4OP1A 5IWCA 2CBXA 1WSWA 2ZXEA 3P4YA 2OESA 2X1LA 1X77A 3FSGD 2QOEA 2CV1A 1UODA 5HM8A 2G1PA 1A5ZA 4PG8A 8LDHA 3WBJA 1ZGBA 1YCFA 4YBRA 1R5JA 3X43A 1LVGA 2XYRA 4B9LA 4MV6A 3OA0A 3L8DA 4IVNA 3AH8A 2E5WA 4FKBA 1YDEA 4P7GA 5TC4A 3RASA 3D3KA 1XNJA 3GH1A 2VH1A 4J0EA 1GGNA 1BFUA 5AK6A 4O3SA 4ZJUA 3F6CA 3IL2A 3FSEA 2VXYA 1BEUB 3FMIA 2W6CX 4QEDA 4CV0A 1CT9A 1KJZA 2G09A 3CJQA 4YGYA 4C5BA 2BSXA 3M6IA 4CG2A 4QW8A 2LYBA 4C78A 2FZ4A 1SUDA 3AF5A 2W04A 5L4LA 3FETA 4KQCA 3HRKA 4M0LA 1X6VA 1TECE 2F3RA 4EQZA 1CZLA 1FA9A 1RJWA 5BR7A 1Z00B 2KX7A 2XEDA 4BO6A 1CQIB 1A2OA 5IAOA 2A5JA 1KSGA 4G26A 3MBIA 4P4GA 2BMDA 1MO3A 1L4BA 1X0XA 4HWKA 1U0RA 2CVZA 3KJZA 1OIWA 1GL3A 1K63A 1W93A 1RSZA 3ADDA 3Q6IA 2HSGA 1TQ6A 3CP8A 3MNFA 5EPOA 4O25A 4NZPA 4BV3A 1H5UA 3W5DA 2IYSA 5G02A 4LZZA 4QTYA 1AXRA 1M75A 5JJ5A 4MR9A 3WGMA 5LVAA 1R6UA 2NVBA 3G7UA 3ZU4A 5LQSA 3NTVA 3PW5A 4BLWA 4BBPA 3LX6A 3IDZA 4BNWA 3TVYA 3N76A 1YV9A 1XMPA 3WAJA 4R05A 1JPUA 1HZZA 4FCWA 1YQDA 1I3CA 4RZQA 3U3MA 4I9HA 1ZISA 4LJ4A 1IUKA 1V6CA 5HKLA 2EZ4A 2OCLA 2J5BA 3GQCA 5KFNA 4M7PA 4RZ2A 1VHTA 3PE6A 3GFGA 4TXJA 2MYTA 5KPDA 1U2DA 3GDFA 3DE7X 3UF0A 4QARA 5A7HA 3KYDB 1GZSA 3EZYA 4NMLA 4BRSA 3AF2A 2A2ZA 4PO9A 3Q8KA 1N0VC 4E4TA 4TV9F 3WDSA 3HFRA 4P80A 4CEIA 3LC2O 2CN1A 5EWLA 3I2GA 1DVRA 5GP1A 5JYDA 1CWUA 4KWEA 5KAFU 4FVTA 4BLSA 2V4ZA 3W04A 4YG2A 3PFBA 1ZQTA 3BZWA 2QMEA 2K4MA 3K6SA 4CKYA 2QGNA 4RQ3A 2GJSA 2YXEA 4UFNA 1I5EA 4O4JF 3NVWA 1U0HC 2AK3A 5TNXA 4ZEOA 4OY3A 2AW3A 3K6JA 1FLNA 2AMFA 4ILEA 4CEJB 3O9VA 1NBME 4BQIA 1WW8A 1TEVA 4XWGA 3UBTA 5EE9A 1IJKA 3UXEA 3PGLA 2XUFA 4JV2A 1Q1BA 5JROA 1NVGA 1FYEA 3K0AA 1GSHA 4OTZA 1U2QA 4NESA 3B9BA 1I13A 2SBTA 2REBA 5JZVA 2I4NA 1LVHA 2FZLA 3EUAA 3QWAA 4IIFA 1RDFA 3E8XA 2CXRA 1C20A 3QXXA 5AM2A 3IGFA 4D26A 3MDCA 2JD2A 2FPGA 1Q17A 2UYCA 4IRUB 4LVSA 2C2YA 4ALIA 1V3TA 3O8QA 2EWVA 4JI0B 3ST7A 1E5TA 2PFGA 3VR4A 1DC4A 3C5VA 4JVSB 5JYCA 2KSQA 4KLQA 1UQRA 2AOVA 4UREA 2P7HA 3EGDA 3TM5A 1Y7IA 1FW6A 2V7GA 3K70D 1VLLA 1JG2A 3E03A 4ZDKA 2A19A 4C0WA 4UE6A 4AY3A 1DJPA 3GEPA 4BNJA 3ORSA 1JYFA 3RS2A 3U5ZB 2BGRA 4EJMA 1KHHA 4R51A 5A0FA 4IMJB 2PMCA 1O03A 1Z4QA 1WOYA 3ER9A 3C5FA 2RHHA 2ZRMA 3U4DA 2J3EA 2J5XA 4TQUS 1XG5A 3EOAI 1TM1E 4LWQA 3G7SA 5EMJA 2EFEB 3FYUC 3QVXA 1E3LA 2ZRQA 4DGQA 3MBOA 3L7CA 3TOVA 2ZETA 1M83A 1DEOA 4O3OA 1RR6A 1MV5A 4OHOA 3CH5A 2GWRA 2DR0A 3UMSA 2BFBA 2WABA 4N4AA 3H40A 3NU1A 2AFIE 4KNWA 1U8YA 4M9ZA 3FNGA 1G20B 2BELA 2WC1A 4P84A 4AJOA 1ZMOA 3AQFA 2V8BA 4LECA 4PNEA 2ASVA 4AJ1A 2IPNA 4UE3S 4EL5A 3WC4A 3TADA 5H4GA 2A7QA 3G9TA 2PR2A 1VSUA 4PX9A 1LTQA 4DCVA 3LCRA 4A16A 3MIIA 5AUOB 2BGJA 3AZOA 2YMMA 4NICA 2GTIA 2E8MA 1UZNA 1WLSA 1DAKA 3BSWA 4JT8A 4DDVA 4RU1A 3NUQA 5KT3A 1TM4E 3CEMA 1EXNA 2HEGA 5DU2A 2DPIA 1SBQA 3FDJA 4PIMA 2Z5LA 4XFKA 4LJ9A 3L6DA 4XGIA 1NRWA 2GYWA 2PJZA 3GUZA 1ILWA 4R2MA 3GVCA 1UP4A 1Q2XA 5KFUA 2JJQA 4XIIA 4B3IA 2Q50A 4XZ3A 1FBTA 1O6GA 1M6EX 3WZ2A 4KXFB 5K0SA 2B99A 4LHWA 5DBGA 5DI3B 3FFAA 3IE0A 1JAZA 5CH8A 4CV3A 5JG7A 4Q3CA 1LDMA 4M46A 1YIAA 1AKVA 1C0PA 4UW9A 3FRHA 3HJGA 2ZJBA 4RSHA 3DDZX 3N8IA 5J4HA 2QKQA 3EIUA 1AY0A 2EZZA 1MJFA 5HDBB 4R69A 3DE1X 3Q9LA 3I4FA 1ONBA 2HCTA 3PGKA 3QKUA 4EJ0A 1OFUX 4R64A 1AN0A 5C1DA 1FC0A 2CL6X 2JLAA 2R8EA 4NMXB 5KINB 1NN3A 8ICAA 4TVKA 1V1JA 3OPYB 4B4OA 1NWHA 2IP2A 2GTHA 3B6EA 3THWB 4D4MA 2JGRA 3K0CC 3BZBA 1H38A 1LC3A 5F5NA 1S0OA 5IU6A 5BWLA 2QVLA 4RNDB 5BRAA 5L1IA 3W5CA 4V0KA 3E22A 3KOZA 1X92A 5AJUA 1L6RA 1JR3E 2MCFA 3HBFA 2PGXA 3VCBA 2YB1A 4H59A 4X95A 1SQGA 2O2XA 3BICA 3L8GA 4QYIA 5CCEA 1L5NA 2VDLB 4U7TB 1EA7A 2DT5A 1XWWA 2JPDA 1UBMS 3T15A 3Q11A 1YBFA 3UJAA 3RNLA 3CUKA 2GXUA 3WIVA 5FUXA 3G2KA 2I3GA 3FNFA 4DJTA 1UEIA 2OHJA 5C8XA 1Z6XA 2QYSA 1LI5A 2F1HA 1QLNA 4G0XA 1KRWA 3T94A 1PKXA 5KNBA 5P21A 4BLQA 2HCJB 16PKA 4OK3A 1EFRA 5KVCA 2XCAA 1X7WA 2I5HA 4IWYA 3ESBA 4PRZA 1O6CA 3C1AA 2FLWA 4N3GA 1U3WA 4G09A 3FNIA 1Q3VA 4KR9A 3C7DB 2QXUA 2YWRA 5AVUA 2WJYA 5CHEA 2OBMA 2ODQA 1N78A 1L3IA 1RABA 3QEAZ 4R01A 1UK9A 2BFEB 4G9BA 3P8ZA 10MHA 1F06A 3WP1B 3G5TA 1QVVA 1OASA 4M1YA 3HB7A 1C9JA 2W2LD 1OFVA 1AG9A 3W7AA 3RUAA 4REMA 2O1SA 4EHAA 4M1OA 3V8EA 1NW6A 4WJZA 4K1XA 3EVZA 3SZUA 5KMGA 1CNMA 2D2EA 1N2CA 1B15A 5CA0A 3L9WA 2BGUA 4LN1A 3K9QO 2O8EA 1HT0A 3WLRA 1J5PA 3QPBA 3TLAA 3NI2A 2RGWA 2FZVA 4CMBA 4UULA 4GGPA 1MUUA 1VI6A 1XIVA 1E7WA 5B1HA 3WRYC 2QI9F 3M34A 2HZ7A 3ENVA 5JZOA 4IOKA 2W2KB 2EFHB 1SQSA 4AICA 3Q1KA 2A57A 1T5DX 3R0IA 4BYMA 2D2VA 5D6OA 3HVKA 2LIPA 1DJMA 4KODA 1ZD9A 1PFWA 5E7MA 2JAUA 2HWXA 3HE3A 1URJA 1MG0A 2ZUSA 4UAVA 1SWWA 4EUEA 3D6FA 4DG5A 3EFOA 4TQSA 4OB6A 2IE8A 2AYXA 3ZHXA 5CXXA 3DUFA 4NENA 1CJVC 5DIZA 2FCRA 5L8VA 4GX0A 4G25A 1YJ8A 1H5QA 2GK6A 1BQEA 2C95A 3LOUA 3FIJA 2V59A 4OO3A 1D2MA 3AJ8A 3BMOB 1LSUA 3A6FA 4IJUA 5K3AA 3UO8B 3D3NA 2FJPA 1CK4A 2DFLA 2H1IA 2IXDA 4AQYB 1ZXBA 1DV2A 4INOA 1KDHA 4FOOA 3V48A 4B1FA 3KHSA 1JLKA 3E3OA 3I30X 6NULA 3NONA 3QI7A 5BRJA 1XYGA 3LP6A 3DYBA 4CT4B 3EVAA 3FCCA 3GXOA 5A3SA 2QLMA 5J47A 4BX8A 3TNLA 4EATA 5KFOA 4F84A 3IJRA 1YB7A 1NXTA 4GECA 3FMPB 1XNGA 3C3WA 1VJ0A 1CY0A 4S1OA 2XWSA 4HTFB 3RKSA 2ATLA 4QXPA 3L79A 1PYGA 1NP7A 4MJ7A 3NVAA 3WB9A 4DUZB 4PTYA 3FGPA 4FONA 5EG5A 5BPCA 1Q83A 4BNDA 4PTLA 3DLPX 3W05A 2VSFA 2PUWA 1CS4C 1SULA 4D96A 1RYZA 1VFNA 1RQNA 4GZ6A 1VG0B 3TOCA 3ZWQA 3S7TA 2QNRA 5JD5A 3NMUF 4QUDA 4FQ8A 2ATCA 3TX6A 3YASA 5BPHA 2C00A 1QHHB 5GWXA 5BV7A 2FW6A 4P98A 2WYHA 3GMIA 3QGMA 1XAJA 3JW8A 3IHQB 1R6XA 1GP2A 1F7VA 1E5LA 4KQHA 4RPZA 4RV5A 3NWJA 4GPAA 1X9IA 4DSNA 5FTNA 4E12A 3MN1A 1Q11A 4CV2A 4PO3X 4OQZA 1ISFA 3DLHA 5CP2A 4JYPA 1HC7A 3V72A 7ADHA 1JEYA 2H57A 5FQNA 1NBMD 3FROA 1T8RA 1N8SA 2ZI4A 2DBZA 5CB6A 2OFFA 2MSCB 5A6SB 1SUAA 1K9VF 3T9EA 3H75A 1OFTA 3U3ZA 3LK9A 3WBKA 1EEHA 1T1SA 4ZD6A 3UJBA 3AKCA 3OU6A 5E79U 1E6WA 5G53C 1WY5A 3CRW1 5KG3A 2AE2A 2K89A 5EIHA 2CF5A 4C29A 4Q4HB 2JEGA 4ENUA 5JBIA 5TVKA 1U8CB 3F1LA 2BLLA 3T5AA 2IITA 4G36A 4BMDA 2ZB4A 3PR5B 4HD8A 2HADA 4M2YA 4AKGA 1ZOPA 4A6EA 2Q29A 4A82A 1RKVA 4DLXA 4P0TA 4IJQA 4C20A 3G68A 4AZ0A 3A0BU 3W9BA 3RBXA 1SG0A 4JQOA 1FFEA 4GC7A 2YWDA 4G9EA 2D8MA 1H3EA 3Q0TA 1R0KA 1S0MA 2INGX 4US8A 4ZQCB 1NNSA 3V00A 2YB4A 3KKPA 2FPPA 3LMKA 5HPYB 2VXOA 3JASA 3BQ7A 1GV1A 4F4XA 4Y2RA 3EXAA 1C4OA 2QRUA 3VI4B 1Y3FE 3ZY4A 2ZFUA 1IM8A 3TVDA 3UEOA 4IJKA 4QQRA 2Q7DA 5LXTF 4XAQA 3IQDB 2DAPA 2C82A 1Q3KA 3IELA 4QBIA 1JLRA 2W7TA 5A4JA 4XUSA 4CT0A 1NYTA 1B0ZA 1QTNA 4HHEA 1E79A 1SO8A 1T3ZA 1SCUA 2X1MA 1OAOC 4W8GA 2YZKA 3I01M 1XXHE 2HV8A 3SZGA 3AVVA 3U13A 5JRTA 5DB8A 1WCV1 2R7AA 5KFAA 4W99A 3I5MA 5KEIA 4DCNA 3NDBB 1G291 2EBHX 3ICQB 4G67A 3IE2A 1IRXA 3WI7A 2UVRA 2VP9A 3N2LA 3GFKB 3DTVD 1D3AA 1I2DA 3AONB 5JSZA 2CY0A 2B20A 4KUEA 4HUQA 3RYHA 2C2KA 2LCIA 3IUSA 4J6EA 1QHGA 4LHVA 1GTSA 3CUWA 2SKEA 4REOA 4F93B 3Q0EA 2PLWA 3QWFA 1KH1A 5KYWA 2VA3A 4LBYA 1ZSVA 1XX6A 1L7RA 2Q27A 3BGOS 1DT5A 4C2UA 3B9QA 2IX3A 3O8LA 3HR8A 5HG0A 2BHTA 2GLUA 3HO1A 4F71A 2FJUA 4IHJF 2GKOA 3RSCA 3QVSA 5I7SA 4U6QA 4QDJA 2HOQA 5FPPA 4O4LB 3AQIA 3UUFA 2IXGA 2HJRA 4Z9XA 2R44A 3NUZA 4FCTA 1GO2A 2UYQA 3M4NA 1JEQB 3JPYA 3OFJA 3GWGA 4S04A 2QJWA 1QCZA 1XLTA 2HHTA 1XRQA 1EHIA 4PHPA 4LE1A 2HPHA 1OA0A 3KYIB 1G8HA 1N60A 1UMCA 2A1UA 2PN1A 1GPH1 2VPPA 3CEAA 4MS3B 3C6YA 1WMFA 3TINA 2VNIA 3USZA 2DQZA 3FWNA 2GRAA 1VP3A 2JS7A 5JAQA 4DS3A 3ETNA 3PCRB 2OSVA 2Q5IA 3D8UA 5L3QA 2QRLA 2QDKA 1O94C 4BNHA 3SLKA 1BHSA 3A9SA 1JHRA 1ZQDA 1JR3D 5KTPA 1UWVA 2G6TA 3TANA 2F1IA 2GFQA 4QGHA 3LBFA 3QOXA 4X8LA 3M9OB 2G5GX 2PANA 3GOHA 4QEZA 1OXVA 1N5LA 4EB3A 1NUPA 2H5IA 1Q1AA 1QF9A 3OFKA 2C31A 3S5UA 2QQ0A 1UM9B 3DEJA 2OYSA 4YCAA 2OHXA 5E6SA 1SPXA 1E58A 3PRYA 3EZ9A 2VTBA 5KX5A 3CW2A 1Y7TA 1Z4IA 2IU0A 3QJGA 2M6LA 1L4NA 1BU8A 3BRWD 4X20A 1PVQA 5D1NA 4GLJA 5BXQC 4ZT5A 3Q8QB 3P19A 3TLGB 3A4YA 5IHXA 4OFBA 1GAXA 2MIIA 1DADA 3F5MA 1M1NB 1OKKA 2A9KA 4E5UA 3A28A 1NW4A 3AIOA 4MHTA 1IBSA 3WL7A 3TRFA 4HB4A 3C1OA 1C0KA 4EEXA 1JJIA 1YC2A 4EYOA 1XAGA 1CR0A 1V8FA 4BVFA 3WLOA 1XTQA 4NHEA 1CUXA 5JEEA 1POXA 2DQSA 5BWMA 2HIMA 1SIUA 4NPAA 2O48X 4KLNA 2EFYA 2V97A 3DV2A 3WGQA 4DDHA 1WNFA 2NU7A 3UUEA 1Y3HA 4NYMR 2ZU6A 4ZTZB 3VU3A 4KQJA 3R7SA 1QIGA 2ZSJA 5A3QA 3NHBA 2BCGY 2BEUB 3BIXA 1C1DA 1NI4A 5KFBA 2PKCA 5DRYA 5IXSA 1DAIA 3I76A 4TMTA 3NYRA 4TSKA 5I47A 5LD2B 2QU7A 4UOQA 1OE0A 2PTGA 2H3EA 3TZCA 1U0NA 5HMMA 1A9RA 3G6YA 3R20A 3ZU2A 3L4BA 5K45A 1SCQA 5HR6A 4QYSA 3KSMA <