3KZXA

Crystal structure of a had-superfamily hydrolase from ehrlichia chaffeensis at 1.9a resolution
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
210
structure length
205
Chain Sequence
b'SMKQPTAVIFDWYNTLIDTSINIDRTTFYQVLDQMGYKNIDLDSIPNSTIPKYLITLLGKRWKEATILYENSLEKSQKSDNFMLNDGAIELLDTLKENNITMAIVSNKNGERLRSEIHHKNLTHYFDSIIGSGDTGTIKPSPEPVLAALTNINIEPSKEVFFIGDSISDIQSAIEAGCLPIKYGSDILSFKNFYDIRNFICQLIN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HAD-superfamily hydrolase, subfamily IA, variant 1
publication title Crystal structure of a Had-superfamily hydrolase from Ehrlichia chaffeensis at 1.9A resolution
rcsb
source organism Ehrlichia chaffeensis
molecule tags Hydrolase
total genus 82
structure length 205
sequence length 210
ec nomenclature
pdb deposition date 2009-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.730 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 3kzxA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3kzxA01
4Y3UA 3NIWA 3OPXA 1Q92A 2HF7A 4UW9A 3KZXA 4KX5A 5ALEA 4YGYA 1XVIA 3AR4A 2YMQA 3NUQA 2FUEA 2C8KA 2WFAA 5AW8A 3WK5A 5AM5A 3WKCA 1RKVA 3S6JA 2YJ5A 1CQZA 3F9RA 4L6AA 2JGAA 3AR6A 4BX3A 3A1DA 3E84A 2G07A 4Y2SA 2PKEA 1IWOA 3BWVA 2CFRA 2B8EA 5AW6A 1RPZA 3EF0A 2NO5A 3N5KA 1X42A 3QUQA 5ALQA 3KDPA 4YCNA 2B1RA 4Y2QA 2IYEA 3GYGA 2EATA 3DV9A 3ZW7A 3FPBA 1N8NA 2HI0A 2R8EA 1RKQA 2IOFA 5AM4A 4PNHA 1QYIA 4MUMA 3QU9A 5ALDA 4UM7A 3UMBA 4YCLA 2ZOSA 2DQSA 2NYVA 2I34A 3OCUA 5AI8A 5IT0A 1L8LA 1QQ6A 4UMEA 4Y2PA 2Q5EA 1ZD2P 1RLOA 2W4MA 5ALJA 2YMLA 5AI5A 2YFYA 3WK9A 2AGVA 3BA6A 2G0AA 3L8HA 5AW5A 2G1AA 2P9JA 4DW8A 3U19A 2WF8A 1ZD4A 2JAWA 4UARA 3SLRA 2I33A 3ET5A 3WK6A 1J97A 1YV9A 5ALPA 3QUBA 2QLTA 2X4DA 3UMCA 1WVIA 3UMGA 2ZBEA 2ZBFA 1YMQA 3UM9A 3EWIA 3AR7A 4KNWA 3KOOA 4BEWA 4CF4A 4EELA 3L1UA 1L7NA 2P11A 3A1EA 5ALSA 3ZI4A 3L0CA 2P27A 3ZWDA 4XOUA 2C4NA 3L5KA 4BNDA 2FPRA 1XPJA 1YS9A 1RC8A 2BDUA 3AR8A 4AS3A 5FP0A 1VJ5A 3AR9A 1KYTA 3QU2A 1F5SA 2FEAA 3SKXA 1Z4PX 3M1YA 3M9LA 3CZ4A 5AVVA 3WK8A 1Q91A 4NABA 1QH9A 4AS2A 5AKGA 3U7GA 5A3RA 4KN8A 5AKEA 3SMVA 4UAUA 1L7MA 2I6XA 5AW9A 3QUTA 3MMZA 3WK4A 5AK6A 1Z4KA 2GO7A 2HX1A 4OFZA 3W5DA 5AW1A 1CR6A 4F71A 4Y2RA 2RARA 5IT4A 3ESRA 4KX3A 5AVYA 3N28A 1MH9A 4MWOA 4BKMA 3QXGA 2OYCA 3DNPA 1U2TA 3NRJA 4EENA 2I7DA 1ZJJA 4L6CA 2YN4A 3IJ5A 2D2VA 4C4RA 3AR3A 4Y2YA 2WHEA 1L8OA 3ESQA 3U7HB 1Z4OA 1Z4JA 5AVWA 1U2SA 1YDFA 4HGQA 1TA0A 2YJ6A 5AKXA 3W5CA 2RBKA 3I28A 2CFTA 5AIAA 3PGLA 1NRWA 2YY6A 3PCTA 4UATA 3QNMA 1YJ5A 2W11A 3OCXA 4OHFA 3OTQA 2HDOA 4XQ0A 5AK5A 4NAVA 5AVXA 2ZBDA 2OA0A 2FPUA 2Q4TA 3ED5A 3ZX5A 3PDWA 1RLMA 3I76A 2HOQA 3J7TA 5E0OA 4YIKA 5A3QA 2B30A 1RQLA 5JJBA 4OD0A 1S2OA 4QQFA 2QYHA 5ALWA 4C4SA 3PGVA 4L57A 3L1VA 2BY4A 4RETA 4I9GA 4J2TA 3ZVNA 1RKUA 4HAIA 3U7EB 4B6JA 2HCFA 2EAUA 2HF2A 1VJRA 3E81A 3IB6A 3QU5A 3W5BA 1Z88A 5ALKA 1ZRMA 2VKQA 4IG4A 2C9MA 3ZVLA 2O9JA 2G09A 2WM8A 1QQ5A 1TJ5A 1EK1A 2R8XA 3P96A 3IRUA 3E8MA 4CF5A 4O8CA 4DFDA 2O2XA 2AUTA 3ET4A 3U13A 2ODAA 4EX6A 2GMWA 1K1EA 5ALXA 5AIBA 2G06A 3A1CA 1T9ZA 2AH5A 4UMVA 2YJ4A 4Y2TA 3B8EA 5AK3A 5AVZA 3W5AA 4HGRA 1SWVA 3AR2A 3FVVA 3HLTA 5AKIA 1Z4MA 5ALTA 4ZEWA 5AW7A 5AK4A 2WF7A 3AR5A 3MN1A 1ZD5A 3QLEA 3WKEA 2NO4A 5ALOA 4F72A 3B9BA 5AW4A 1L7OA 4Y2JA 5IS2A 1O03A 5AKZA 5ALUA 2HO4A 3ZVMA 2WF6A 3NANA 1SU4A 3L0BA 3ZUPA 2PQ0A 1ZS9A 1VFPA 2YJ3A 5AKJA 2FPWA 1WR8A 5AKYA 3B9RA 2MSNA 3L8EA 3FGOA 1TJ3A 4UM5A 4Y2VA 1NF2A 2JAUA 3WGVA 5AESA 1WPGA 1S8OA 4ZEXA 1XP5A 2YBDA 1U02A 2G80A 1ZD3A 5AI0A 4UAVA 4Y2XA 5AM2A 2FPSA 4KNVA 2R8YA 2IA5A 5AVTA 3I1YA 1EK2A 3ONNA 1O08A 2YMMA 2PR7A 3WK7A 3ZTYA 1PW5A 2B82A 5AW0A 2P69A 3WKDA 2FDRA 1U7PA 2Q4RA 5ALZA 3KC2A 3KD3A 4UASA 4DCCA 1T5SA 2FUCA 4UMFA 1RMYA 4FE3A 3WKBA 2HEGA 4BX0A 4BX2A 2OM6A 3DDHA 4OCZA 1U7OA 2I55A 1Z5UA 2C88A 2IOFK 4GIBA 4CE6A 4UMDA 5T41A 3NASA 4G9BA 5AW3A 2EARA 5AM0A 2RAVA 3ZU6A 2GHQA 5AI9A 4BYGA 3L8GA 2CFSA 4EEKA 3VAYA 2CN1A 3U26A 3L0YA 4EZEA 5AKLA 1Z4QA 3NAMA 2I54A 4BNDB 3RFUA 4NFLA 5AW2A 4ZEVA 4FYPA 2WF5A 4HGOA 2FPXA 1Z4LA 2BDEA 3SF0A 2ZBGA 4JDPA 4AP9A 5AI4A 4EX7A 1L7PA 3KBBA 4NWIA 3N07A 5AVUA 4CF3A 1QQ7A 2WF9A 3DAOA 5AKKA 3N1UA 3U7FB 4YCMA 1LVHA 1NNLA 5AICA 2GHTA 3E58A 4KYTA 5AHXA 3QU7A 2R8ZA 1RMQA 4I9FA 3FM9A 3OCVA 4FFDA 5AI6A 4Y2UA 4IFTA 1RLTA 2G08A 3R4CA 3D6JA 1ZOLA 5AKHA 3RF6A 1JUDA 4UU0A 2FI1A 4YH1A 3CNHA 3L8FA 1Z4NA 4HGPA 4XE5A 3EF1A 1N9KA 5A3SA 4BEVA 3WGUA 5ALFA 2ZG6A 2B8JA 2C8LA 3WKAA 3ZX4A 3ZTWA 4DWOA 1RQNA 5ALVA 4CNQA 3OCYA 3OCZA 1RMTA 2W43A 1LTQA 1J8DA 2AMYA 1ZRNA 3QUCA 3ZWKA 2B0CA 4RESA 4QJBA 5AM3A 1T5TA 2MU1A 4E88A 3I6BA 3TLMA 2RB5A 4JB3A 3SD7A 3EPRA 2JAOA 5ALIA 2B1QA 3FZQA 3HYCA 1TE2A 5AM1A 5AVRA 5ALNA 5AVQA 2ZXEA 1WZCA 2HHLA 3OCWA 4XPZA 1Z4IA 1RDFA 3SKYA 1Z5GA 2YMPA 3QGMA 2OBBA 3QU4A 3K1ZA 4YIHA 1Y8AA 5ALYA 4H1WA 3NALA 4NV0A 3L7YA 5ALMA 4BBJA 3QX7A 4HGNA 3QYPA 1FEZA 3SHQA 3MPOA 4J03A 5ALRA 3R09A 3FPSA 1SWWA 4UU1A 3N8GA 1RRCA 4HYTA 1YNSA 5ALLA 4GXTA 3A3YA 2IOHA 1L6RA 2JARA 3R9KA 4C4TA 5AVSA 1AQ6A 2GFHA 4G63A 5ALHA 3MC1A 2HSZA 1TJ4A 5ALGA
chains in the Genus database with same CATH superfamily
2XGPA 3AKDA 1DK2A 1QG0A 2WJYA 4W5OA 2A9OA 3K05A 1IK4A 2ZUFA 1Z6YA 4WKBA 4Y7DA 1R50A 4MLPA 1O97D 1QF9A 1EFVB 1YA6A 1SV0A 1LDEA 1V5FA 4L4RA 2XUPA 1SBHA 5BR1A 1RQRA 1EDDA 4PW0A 3GYGA 1MX1A 1UDAA 2GDJA 3E6AA 4YROA 3H2SA 3RUPA 5B4VA 4JBLA 1ZM3A 4TXNA 4DCOA 5KX5F 1W19A 1RXWA 5DYTA 2RE8A 3K6JA 5BQXA 1SCUB 4DOMA 4AJJA 5EE0A 2J3QA 1TQ4A 2QVCA 3UFXB 1KSJA 4ZVMA 1UBCA 5HDQA 1V2HE 2PBZA 1NJSA 3DLTA 1LSSA 3VSCA 5KFFA 1RXYA 1YMQA 2X8AA 3HR4A 4BP8A 3TADA 4B80A 2B0JA 2XDYA 4RK0A 3DGFC 4RFSA 1EXNA 4FDTA 1EIWA 3GRKA 1HUQA 2FJPA 2JCSA 2OSVA 4YI3A 3T52A 1O95D 1Z83A 2HEIA 2JLYA 1K6JA 5IVIA 3ISBA 1YUBA 2CNWD 2ODQA 2K89A 3GLKA 1OBCA 2KS6A 3AVQA 2ZRPA 4P2BA 2I5PO 1V1RB 1WMBA 3EXG1 1R0CA 3ECCA 1IG6A 4Q9NA 2WOOA 4XWTA 2WSLA 1IATA 4TLBA 4FS2A 5CA0A 4GKBA 2ONZA 3WGKA 3BXOA 4ODIA 4IFEA 3AXSA 3KSAC 3HCAA 3D8UA 1U7TA 2OHJA 3EULA 1KY2A 3A1FA 4QBIA 1SXJE 3RJJA 1WV1A 3EA5A 3RS8A 2WSSD 2J0VA 4A2PA 2B9VA 3A6LA 2HJRA 4Y2HA 2PX2A 4GR4A 3IT3A 4XSVA 2JFOA 1WXDA 4IV0A 4EF6A 1YOVB 3GFRA 4MOWA 4FFRA 1AU9A 1ABEA 4OFWA 1IRXA 3TZLA 3TRKA 2D2IA 1Z5NA 4N5MA 5AD1A 3HLTA 5KDOA 3H1AA 2FEMA 3LPCA 4IGEA 1N8SA 5GMOA 4YXWA 5AK4A 5C32A 2FPIA 2XI4A 2QRVA 1Z12A 3DWFA 1ONOA 1G5IA 3WICA 2VYVD 3AU9A 3GIDA 4CKXA 1MVNA 5JC8A 3RTBA 3EQ6A 3PNMA 2DGDA 3B5EA 2PUDA 2CJYA 1VL0A 3W5VA 4C6SA 1Y6RA 4MICA 2C78A 5TF0A 4MV9A 3N0RA 1TCAA 1CS0A 2WKRA 4OI0A 5JU5A 3DW1X 2CKDA 4GBMA 4QW8A 4I36A 3F5QA 1PK1A 4AZSA 3H13A 4Z6EA 2RAVA 1RI1A 1XTUA 1M2KA 1TNDA 4XM2A 4FR2A 4GE0A 4DSKA 3JWPA 4EEXA 5IVKA 2Q46A 4EX7A 5LOVB 4IG9A 2E18A 4O4IA 4M88A 5E9QA 1MRZA 4LDZA 2C0PA 1SOAA 4EZ9A 1EGAA 2H3HA 1R2QA 3UTCA 2G25A 2BC9A 2IPMA 3EGCA 2JW5A 4XB6B 2NUBA 1NBMA 3C2LA 4BMDA 4YT4A 2Y6UA 3B7WA 4J07A 3PXUA 5J2FA 2EJWA 4WW0A 2BONA 3HBNA 2IU3A 1PUIA 3JD3A 1NWCA 1Z7BA 4LE1A 5AVRA 5JV5A 3NWEA 5IIIA 3RWBA 1L7VC 2ID4A 1Q0TA 4V0SA 5DSTA 4HGNA 2R0QC 5D6OA 2P68A 1RCTE 2NQ2C 1YNSA 5DYIA 5U9CA 4KLDA 3WS7A 1TAMA 4WXPA 2XQIA 3HXMA 4HDQB 1W1UA 3TMYA 1G8FA 4U2CA 3B7PA 4EJSC 3A9UA 2V9ZA 2CNDA 1ST3A 3VZPA 4YRRA 3D6NB 1IB6A 4A0FA 1QIFA 3H0RB 2VDVE 3GPCA 4CR7A 4KUHA 2QAIA 4MI1A 4P81A 3DC2A 2QYTA 1VDVA 3UQZA 3H1EA 3M1LA 3AI1A 4DFKA 4ENPA 4H4EA 1UWVA 1X9MA 5AK0A 2OG2A 1CDZA 3CNQS 4YJHB 3GP5A 1QE3A 1P3JA 3OD5A 1Z0IA 5DT2A 1NNUA 5ITWA 2NP7A 3E22B 4JP8A 4MW4A 1FNNA 1ZH2A 2EFCB 2AW3A 1QIHA 4M0PA 4MS3A 4FDUA 5E7IA 2EGUA 4MB2A 2H2FA 3N0WA 1GN8A 2A35A 1ZNQO 4C0LA 1UM9A 3PR2B 3Q3IA 5F2KA 3TI9A 2RHRA 1QS0B 2IITA 1PJCA 2F67A 3IHKA 4V0OA 3PB3A 1R10A 3CW8X 4AS3A 1T2DA 5L7WA 2GOYA 4JBYA 1ZESA 3A8TA 1M6HA 4XJTA 4IV8A 5J0YA 3RV4A 4UAUA 3DDOA 1XTZA 1Y8QA 3OPVA 3CZAA 4D9GA 1OLUB 1Z73A 4NZMA 1ILEA 3RSFA 1GUDA 2OV4A 3K70B 2QI9F 3MOIA 1O58A 4I2HA 3DONA 1WWUA 2XNHA 2AC7A 1Q1BA 1YI8A 3V4OA 3EYZA 4X1KA 1ORVA 2YICA 2ZPUA 3OE5A 2RHLA 2YJ6A 3R3VA 2NT4A 2GTHA 5IFKA 3CX4A 2JVKA 5KPJA 5DLGA 3ZV7A 1UAGA 1SUIA 1BAPA 4PBSA 2HT1A 2Q5HA 3KJNA 2JL1A 2QMEA 5T8KA 2QGNA 2BCEA 1XEFA 4YA6A 3IBTA 3DT6A 4EHKA 4FQ8A 1EM8A 1ZQSA 4O6VA 1T9BA 1JSRA 4UD6A 1LH0A 3R3HA 3QKRA 4YUXA 1Z88A 2YJNA 1PVDA 10MHA 2ACVA 5DW3A 2QLBA 5THKA 3V2UA 1PJZA 5K20A 4E6PA 3RT1A 2V6FA 3KDAA 4RPGA 3WL5A 3DCJA 4I5IA 5DB8A 2JLCA 4HGRA 3IV7A 1X87A 2WTEA 5IBRA 4W9MC 4YRQA 3SNHA 1Q2UA 1UC8A 1X19A 1H5NA 4QAJA 1OLSB 1J39A 4RHUA 1Z8DA 3ROZA 2JEJA 1NK7A 3TEJA 3NRCA 4TKUA 5TC4A 3HDQA 1N5JA 4AY4A 4IRUB 1Y5IA 1HJPA 4O4LA 2W9AA 3H0EA 3PW7A 5HM8A 1C9KA 2RJOA 2G1JA 4QYSA 5DMHA 4LAFA 2P69A 2OL4A 2QTGA 1CULC 2DY0A 5E6RB 4L5AA 3GIWA 1Z2NX 3HZRA 5EIFA 2IPLA 1S96A 3OM8A 4J1TC 4A0QA 4LVCA 4LXUA 3R7DA 1WTAA 2VP9A 5AW2A 5IMSA 4MUYA 1G3RA 1KXZA 5KAIU 2GBPA 3V4PB 2REBA 2OBMA 5AVUA 4G5QA 2J6SA 4ZCRA 4C7OB 4DY6A 2EZ9A 2FKNA 1ZGBA 1PX0A 2R65A 3T1YB 2OAGA 2P0EA 4G5XA 4DLPA 5LZ2A 3JQPA 3COVA 3A6FA 3G5MA 1E9AA 2GXQA 4MQEA 5GJVC 5BMOA 1TK9A 4QZAA 1Y33E 1RQNA 2OXTA 2LPMA 1KEJA 2R7NA 2FW9A 5EUMA 2OHHA 1A9PA 4JBHA 3ROEA 5T64A 4IIXA 2CK3D 1GGFA 2WICA 4RF5A 2PJUA 5B1HA 2C99A 2DCUA 2AKYA 4RYLA 4OHCA 2FF5A 4PLFA 2OBBA 3NVKI 4LZDA 2Y68A 3NALA 1QHSA 4QODA 3S2ZA 4HNTA 1UBHS 1H2RS 4I9NA 1OXMA 2PZKA 3U6KA 5CLHA 4LHSA 1QHIA 4ZREA 3FCCA 5L3SA 2YASA 4XD7D 2SCUB 1FFBA 4RDIA 4DV3B 3FF1A 4JJ6A 1CC1S 4E11A 4RH0A 2CZQA 2FSVC 2ASLA 1GZ6A 2FUEA 1RI3A 3KQKA 1C3LA 4U7JA 4QDOA 4HVLA 4RPYA 4I2IA 3A1DA 3H8SA 4I6EA 4X3CA 3IXLA 1V47A 4UNNA 1BXGB 2R6JA 3BGSA 3OE7D 5DP1A 4H15A 1BHSA 3TNJA 1A8HA 4FHZA 2BRUA 3MTAA 5KJ6A 5A7FA 3GW8A 4K03A 2YX8A 4O63O 4F45A 1ZXBA 3QU9A 4BNJA 2FMUA 3KWMA 3MMXA 4LN1A 1DG3A 2QKQA 1JWBB 4KXMA 3PA6A 2Q6OA 1DKMA 1NFRA 3NI2A 4BO8A 1Q0LA 1J0CA 3BXPA 1GG2A 4LX0A 4BIIA 3U1TA 4KGVA 4YAGA 1U2QA 3GN2A 1Z68A 5LA6A 1NF9A 4MA4A 4P5EA 3UMCA 4Y9UA 2BZ1A 3RTCA 3FUUA 5DGTA 3Q3JB 1KE2A 3H5RA 1Z0JA 4N7MA 4PWYA 4UNSA 1PG0A 3BL6A 1I80A 3ER6A 4NENB 4KI0A 3I5UA 3PC8C 1ZGCA 3R1IA 4TWJA 1KYTA 2I7XA 4JL8A 3X2FA 1CERA 4YX9A 1Z4PX 4AM8A 2V6JA 1NGSA 1Q91A 4MMYB 3BDAA 2CPRA 4I28A 1V95A 1Y7HA 9ICQA 1SXQA 3TUJC 4B4OA 3VR3A 4WNAA 1RM0A 4I3GA 1D6NA 1JT2A 5C1OA 3DT9A 2V8OA 4R81A 1EFCA 1GNRA 1AK9A 3F6EX 7ICOA 3M6VA 2XZDA 1J5PA 5C4IA 1EWQA 1O6BA 3FMPB 4GBED 3NG1A 3AESA 3RTGA 5LB4A 3ONWA 1NBEA 1Q1NA 1L5OA 4KZKA 3UC9A 3LT4A 4GLLA 3OLQA 3TQSA 1JIIA 2BFAA 3EFEA 5JH7B 5IXYA 4H7FA 3F6YA 2H8KA 1NBAA 3LX8A 2QR3A 1SC6A 3Q8QB 1L3TA 1OC4A 3CUTA 3MWEA 4FDLA 1ZOSA 3PQ7A 4CL8A 2YH2A 4B3SB 2JFUA 1HMYA 2IPXA 5AIBA 1THMA 3H7AA 3SN6A 1COOA 5LKAA 2HFKA 4ZU1X 2B2NA 3TRJA 5BW4A 3TIGA 2Z1MA 2RC6A 4HDKB 1XVUA 1KMHA 1DZIA 5EWMB 1Y80A 2QD1A 4CQLA 2AT1A 3LOQA 4UB6U 1L7AA 4X1YA 5JSUA 3LCJA 3DSRA 1Y81A 1EQUA 1T8PA 2AQHA 1NX9A 5J0RA 5F7OA 3RSLA 1TUBB 2OHIA 3I0NA 1YQUA 3D6TB 2AE1A 5EXSA 4LMRA 4M9CA 1IN7A 4AX8A 3N7SC 1J2TA 1U7WA 2HCBA 2EARA 5HUJA 4B40A 2ZI3A 2BGKA 3RR7A 1KY3A 3EGXA 1ZO8A 3AM4A 4X00A 2H4YA 2NTEA 1Y37A 2ZRBA 1P2VA 5IC6A 1UJNA 1ODIA 5EMNA 2FPGB 3FAZA 1SZCA 4HFRA 1IY9A 3WNQA 3PD0A 1XGKA 3FVQA 2I80A 2COEA 2CB0A 1D7AA 1L7QA 4QT4A 4B76A 4KN7A 2BL4A 4ZAXA 1YJCA 2VDNB 1G21B 1CJTC 2N1RA 2MUTA 1IOWA 4KIWA 4MPPA 1ECCA 1JQJC 2R8GA 3LP8A 3EXEA 1I3CA 1XSPA 4XX1A 3WLNA 1RDFA 4FYXA 4KUGA 2AOUA 1R4MB 3OLWA 5BXQC 4DM3A 5CT8A 2W98A 2VN8A 2B4QA 5JCOC 5DHFA 4J76A 4R83A 4IEFB 4QWCA 3WBJA 5TGTA 2LXNA 1QAMA 2ZWVA 3HGMA 4LNHA 3ER9A 3P4XA 4KMSA 1MNQA 2VDQB 4US9A 1AKRA 2DBZA 3PEWA 1T43A 4HX2A 1KI6B 1V7QA 4N0QA 1QHNA 1J2NA 4B9UA 5AW6A 1EFTA 1CDEA 2JK1A 4AYTA 3BBLA 3KSDO 2LHTA 2ACWA 2IZ1A 3GDXA 4HDOB 1YS6A 3OHBA 4JYPA 4RHYA 4UU7A 5DGXA 4A0GA 3T5BA 2IPOA 3ISDA 1QRTA 3P9KA 4XW2A 2PFPA 2JIDA 1XTIA 1Q20A 5MFPA 4E51A 1XTBA 2G0NA 1RHKA 1T0HB 4C7BA 2QK4A 5BWCA 4UTZA 1TK2A 1Q22A 1PG2A 3ICOA 1Q7EA 1GZDA 3OU6A 2BGRA 4E5PA 4RIIA 4LWZA 2JNWA 2EXXA 3WNVA 4C0KA 4RM2A 5J2TF 1YZNA 1TIPA 3GD5A 2O23A 2IJGX 4KUEA 1D1SA 2P0AA 3O31A 4YJ2A 3KT6A 3ULKA 3T3HA 4IW3B 4A0SA 2ZBPA 1WUTA 1M1UA 1H3NA 4OQXA 2XYQA 3MTBA 5DVZA 1IIPA 3ME5A 1E2GA 1Z4OA 5E1BA 3I2YX 1DKUA 5AKXA 4LMBA 1RRPA 1HK7A 3AOGA 2RHMA 4F4UA 2QRMA 4O1IA 3CEJA 4BV3A 3IH5A 3C1OA 1EU1A 3K0KA 3LQYA 2WSIA 1YJXA 1ZQTA 1TQDA 1A7UA 4LBYA 1CZKA 1O77A 1QZXA 1QIGA 1EVYA 3UTDA 2GJKA 1GUZA 4IG4A 1TKBA 4D8XA 2J4DA 1E3IA 3MHTA 2QGFA 4LYYA 5G3YA 2VTDA 3PGJA 4Y2TA 2ENWA 2WNHA 5JMPA 2FWJA 4EHAA 2G8NA 4KR9A 4TKLA 4U3JA 2V6BA 4DYVA 3GRUA 3WYFA 1P4JA 2PUJA 1WR8A 4HQLA 1I1HA 3WGJA 3K32A 4EZ6A 3P20A 4DLEA 1M0SA 3FGOA 4UM5A 5B36A 3BDPA 1L5WA 2PWBA 4MV4A 2AG6A 4V38A 4MQFB 5HGJA 5FAXA 3Q9NA 2A86A 1S9DA 4DSIA 3GG2A 3I5YA 3OUZA 4R8MA 1GTSA 2SNIE 3PFNA 4BNGA 3REOA 2J6HA 2IXFA 3NYRA 1YRAA 4JEMA 4U8HA 2OKGA 4BJ1A 4GH5A 3SBEA 4YCJA 1WZUA 1LKYB 3A6KA 1PGJA 4UEJA 1XCBA 5EE9A 3ZY6A 3EASA 1YUNA 3A0HU 3Q1KA 5BNFA 2X0RA 3V4LA 4D4KA 1SXHA 4E6EA 2HCTA 1IWPB 1D6JA 4QRDA 3GV0A 2NO0A 3UY4A 4DNFA 2WNIA 1F2VA 3P32A 1N9KA 5DSZA 1PJ3A 3B6JA 3NYIA 4BU1A 1DWPA 5LQAA 3S2EA 1U8CB 3B1YA 2ZPAA 2Q3BA 4JJ4A 5H9VA 3I9V6 4Q4JA 4NXMB 2C8JA 4I8XA 1K4KA 3ORRA 1DGSA 4HQNA 1JIHA 3LXRA 1B23P 4HPJB 1MMFB 1DKPA 4A8TA 3UHAA 3WIDA 5K09A 2RDMA 1JFTA 1DARA 3U4CA 4YQEA 3LV8A 2EW8A 4QHYA 3VPAA 3BS4A 4DR4B 4KLLA 1FEZA 3W8DA 1ITZA 3Q6NA 2R1TB 1HDYA 3Q7SA 2AMJA 1RTTA 1BEZA 3NEYA 1ST2A 3PO5A 2Q7DA 5CEFA 4Q4AA 4AC9A 4PX9A 1QIMA 1MFZA 2KV2A 3AVXA 3NGMA 4FKBA 3I6QA 4F3OA 3WADA 1GR1A 4YRCA 5BR7A 3KETA 2WDZA 5DBHX 4MI3A 4WAUA 3JPPA 1SC3A 2ZT7A 3FC4A 4F84A 1NSYA 4TWAA 1A4XA 2YC2C 3R6GA 1REQA 3KUUA 1QWOA 2F59A 4TM8A 2G7ZA 3KDSE 3DPSA 4MR7A 1ESDA 2VUTA 2F3UA 2JGJA 1N75A 3CH7A 3CUUA 4BZZA 1NTOA 3K1RB 2XGSA 3OURA 2HFJA 2R751 2HREA 3K31A 5JDIA 1OT5A 4CMIA 4KBGA 4OTZA 1HQDA 1OXVA 3NCHA 4DAEA 3SLRA 4KDFA 2P4SA 2ZRHA 1GAEO 1U28A 4WASA 1B3BA 2ZBFA 1U8FO 1PI3A 4YRIA 4U8GA 2AD1A 2ZEJA 2DWCA 3RHZA 2GZ3A 3V6JA 2Y0CA 3Q4GA 3O9ZA 4R8KA 5LBTA 2Z43A 5FWAA 2P0YA 1YXMA 5JRDS 5HUHA 4US8A 4G4SO 2LM1A 5CM2Z 2AFIB 5TMBA 4NU6A 2C95A 5AKGA 3WE7A 1IEWA 3MMZA 3MR5A 2CJWA 4ZVKA 3P9RA 4NR0A 1EXMA 1IPEA 3ZOZA 4JB8A 1HLGA 4NLNA 3ZDRA 4I4NA 1JN0A 5JBNA 1HDGO 1J9EA 3K9QO 3EC7A 3PT5A 3O3CA 2VDWA 1AHPA 3EN0A 3CF6R 2EAMA 4EGFA 4JP1A 1IHOA 3IUQA 3IG5A 3HJEA 1KAHA 3O8CA 2WDPA 1YQWA 4ZO4A 1IY2A 5L8VA 5EZYB 1EH5A 4Z1MD 1M5UA 4ITRC 2FN4A 1J0EA 4TS3A 2EFEB 3P27A 2IGTA 3FJYA 3QI7A 2VG8A 1OVMA 3A6ZA 4GGPA 3FNRA 5CTJA 4UMVA 3OG9A 2F3QA 1WWVA 4GKJB 3U2QA 2WF7A 5H4HA 4LJLA 1NP6A 4PO1A 3ZE8A 1JL3A 4HB4A 4B2LA 4C6TB 3PUKA 1RAIA 1TM4E 2H51A 1U7DA 1KO8A 1G9TA 3WGVA 1KEWA 2YBDA 3RGWS 5H80A 4YV1A 1FVOA 2XBLA 4FINA 2C2WA 3AERB 4HS9A 4YP5A 2WPNA 4DA8A 1Y8RB 2R86A 2JD1A 4NYIQ 1J07A 1NK6A 1DJQA 2O5VA 3NM6B 3I30X 4B81A 1ZUHA 3PPXA 5HW0A 2PBFA 3F5EA 1LGYA 4O5OA 1NZPA 3K6SB 4TMVA 2D3TA 3PW0A 4FSDA 4JI1B 3ZW9A 3F2IA 1DQRA 2Q9AA 1GSIA 3FSRA 1Z7EA 2JJYA 4B83A 4CEHB 5AUQA 4LTNA 1NP3A 3BTUA 3FYUC 2HADA 3BGOS 3UOGA 1AKTA 4Y2UA 2BYTA 4AULA 4G0OA 3NAQA 5DNWA 1K7CA 4KLTA 2A0KA 5DLEA 1L4KA 1II8B 1WHTA 5KFHA 7ICIA 3UUEA 2HA3A 2Y1XA 3EXHB 4FFBA 5I5GA 4QJBA 4MDHA 1ZNZA 4E88A 5TISU 3I1IA 4JB3A 1YRYE 3I2HA 3JVVA 2PVCA 1EZ4A 1NVKA 4G4JA 2IHJA 1A9RA 5J23A 3EAFA 3QM1A 5B7PA 1O7JA 3SHOA 3DO5A 3RSZA 3HY4A 3L7YA 3RUCA 1A7KA 1XQ9A 3GROA 2FWRA 1XDZA 4M55A 3OD1A 4U0KA 3T12A 4NCKA 4JIMA 2C98A 1C9DB 4FCCA 1YZQA 621PA 4WHMA 2JC3A 2HR1A 1K5GA 2WFAA 2YXNA 2W2OA 1OF1A 4H3VA 2CXTA 4TLEA 5JTUA 3T35A 5E9JA 3OEYA 1KYXA 4FC6A 2WV7A 3ZZ0A 4CCYB 1BGXT 3E0QA 3R3JA 4A7PA 3HJFA 1FXWA 3CLRD 4PNHA 4AU1A 2AWNA 5KFVA 4C8OA 1DBRA 3HJCA 4Q93A 3RS4A 2VJKA 3LD9A 3S8MA 4MIEA 1N0WA 1IMJA 1NJGA 5EQDA 4HWKA 4IQGA 2GAJA 3NBXX 2J3JA 1VRVA 1GILA 3GPBA 1EEXB 1PKXA 2QVYX 3M6FA 2VI5A 4MUJA 1UFRA 2YX1A 2WIAA 4JLKA 5IANA 2WV9A 2ZQ5A 4Z2AA 1UKBA 3RPEA 4BECA 1DWUA 2WG1A 4KXVA 3FPAA 1ZGJA 4JJEA 3AR8A 5L9XA 5KFZA 1XYYA 1PL8A 4MV0A 3ZWBA 1AXGA 2A2ZA 3TVTA 4HD8A 4CWAA 5KC9A 4J7AA 4L0DA 1KFBB 5EHIA 1KZ6A 1RVDA 2AOTB 1DAFA 3MUNA 3ZIAA 1VCOA 5DB9A 1GDHA 1LI5A 4OOFA 1VPDA 1AJEA 4B71A 2HBZA 5E9AA 2FE9A 1DWQA 4L3VA 8ICGA 1CRXA 5HTKA 3T0IA 4CLOA 4MVJA 2HMXA 2YN0A 3AHIA 3C1TA 2CHVA 3GAMA 3RJGA 3ZIUA 1VLBA 3SYMA 5CYPA 4EYOA 3T7EA 3M4NA 2ZRNA 5AVWA 3RYHB 2NSHA 2G1PA 3AETB 3W5CA 1DI0A 3HCBA 3JPWA 2WB1F 5EXDA 2GJSA 4IYJA 4NAVA 2EKDA 3EODA 3K6KA 2XOEA 2GNAA 1SCAA 1YHZA 3PDWA 4R2MA 3EGWA 4Z54A 3P71T 5KNCH 1DCTA 4OLFA 1EDBA 1NY6A 1YQQA 3GEGA 1GNQA 1I5OA 3PXXA 2VKQA 3ZVLA 1HX7A 5EC8A 5IASA 4JBWA 1QQ5A 1KRHA 4NYMQ 3HILA 3FMFA 4DTCA 4B5LA 3K1AB 1Z18A 1W0KD 1X7YB 4YDQA 3B1XA 1KQOA 1UCFA 3MK31 2BKXA 4LI3X 1L6NA 4P3NA 2ZTLA 3M4ZA 3LRPA 3VM6A 4ZVVA 5T7BA 1FYDA 1I0IA 1VXRA 1EWVA 1N2CE 1OU4A 1AKYA 3WL7A 2EFJA 1M2VB 4WNYA 3GNQA 1P0QA 1NL3A 1PP4A 5CXUA 2FPSA 2GYUA 1ZNWA 4G3IA 3L49A 4OA8A 1WHSA 2P5UA 3CVXA 3E05A 4ON9A 5IXJA 2Q7XA 3ZZUA 3OZWA 2HLNA 5HCUA 2GEUA 5I7AA 3BICA 4B82A 5C52B 4OX9B 4QTTB 1CK4A 3GNTA 3BWDD 4OIFA 5GGYA 4HX5A 4YRMA 2GCGA 2R6GA 2UVDA 3ND5A 4Q00A 3CT4A 3KKMA 3OJ0A 1WCYA 7ICEA 2VNJA 4TXJA 3KVRA 5AICA 1XZDA 5F9MA 4QFDA 1I3OA 1P19A 2Y1LA 1EYZA 1BA3A 2N1BA 1MG0A 1LTHR 1SN7A 4GXIA 4L08A 4QWEA 4H1VA 5HDBB 3KKAC 2VDPB 3H2GA 2QTTA 3TSCA 3ZTWA 4JLSA 3CNEA 4TL8A 3ZJUA 3SNKA 2BT4A 2ZIVB 2PK3A 1DLJA 3ITEA 3REGA 3BJZA 3HYCA 5JASA 3EQZA 2D0PB 4XDYA 2GFIA 1OV6A 3MGVA 5KFYA 3A6HA 3ZGXA 2AV6A 3SSNA 3OH8A 2AXPA 2WVGA 1NBHA 4K5QA 4DC1A 4C4TA 1XIVA 4ZOCA 5BQ3A 5CURA 3QVGA 2BCGY 4WIAA 2KJ5A 4RHFA 4M8NE 2DQYA 4D4MA 4RTNA 2XWQA 3BMNA 3D1JA 1F8UA 4OL9A 4K87A 1MNAA 3P26A 3W3ZB 2BEWB 4J0IA 1DT3A 1W2GA 1QH0A 2X5OA 2CSXA 3A2MA 4JROA 3AK4A 4AAYA 4NYMR 5DHSA 1Z19A 3I2GA 3BULA 5LL6P 1DAEA 5BN5B 1V3UA 4MP8A 4QUKA 3M2PA 1KP3A 1MQ9A 1SQSA 1A8SA 4JVSB 4FMCF 2OUIA 3WNZA 4YHBA 4IOJA 2QN1A 2OFXA 1V7ZA 5DLYA 1S97A 2AD5A 4NI5A 3H11B 4JVLA 1A96A 3FYHA 4B1FA 1OY1A 1P0FA 2C3UA 4KFUA 1KI7A 1AUOA 3N8IA 2JH7A 3JQDA 1SV4A 3ZJ5A 2A5DA 2ZJ7A 2Z8XA 8ICUA 4BRUA 1NW8A 1L5RA 3VYSB 2VDLB 4YAOA 1ZNXA 4F0JA 3G5AA 3KKPA 3U4GA 3ZDZB 2P2DA 4ZODA 3JQFC 1E1LA 4RQ6A 4AURA 4PSAA 4PPQA 3PUXA 4NBRA 3LC1O 2V7UA 3M3PA 1F48A 4N65A 1X1DA 3SEAA 3SJAA 1R6TA 3TK1A 3RODA 3TE7A 2CFCA 3HXTA 2J07A 4RIHA 3AT1A 4ECEA 4E2YA 1G20B 5AIAA 5CD9A 3MHPA 1Y98A 3ZE6A 3VR5H 4CFZA 3NOXA 2AEMA 3RB0A 4K8RB 4M0KA 2P9FA 4QJIA 1SOMA 2H5IA 2AGPA 3DDZX 2V03A 3OEHA 3K0FB 1RI4A 1DAMA 4FXPA 5EINA 1Z0UA 3EC1A 3KTOA 4EPRA 2GWSA 2ZAIA 2WKWA 2GOLA 3EGEA 4QZCA 4QGFA 2G09A 4DIFA 4DSOA 1GU7A 3PYMA 3K9BA 3RB4A 1FYEA 3BE5A 4OOEA 1F8XA 2AQIA 5AKIA 4F2DA 1V1MA 4DCVA 5FRDA 4RMHA 3M3DA 1TQ6A 4OMFG 1DRKA 1U5CA 3ORHA 1K66A 4B09A 4KXFB 4EITA 5H16A 3DWIA 1S2GA 3STXA 2PMDA 1PJRA 3DFMA 3GO4A 1G5HA 4KRGA 4KQKA 2XUHA 4RANA 2OZEA 5KOJB 1X7WB 4U6SA 5AI0A 3PGMA 1VMKA 1M7GA 4FEEA 1VPVA 2IYRA 5CA1A 1O08A 4S1VA 2B35A 2WZCA 4DA4A 1NJXA 3IAM1 1T1JA 3V34A 4EWLA 1FTNA 1YZGA 1JBQA 4ZZ3A 1QMGA 2XUIA 4C9BA 1AIPA 2YFQA 4QBGB 3CT6A 7GPBA 3B36A 1VECA 3SOPA 3RH4A 4QREA 1PN3A 3L6UA 1NW3A 2EEZA 3RBVA 4IL6U 1L4BA 2QU7A 4ECUA 1Y7TA 1U2GA 2AUNA 4BHTA 4R0NA 2W2LA 4B5KA 4HBZA 4HF7A 3ROMA 4P7FA 2WYOA 4Y98A 4K3UA 3OKFA 4QARA 3M9OB 1UFKA 1BCSA 3V72A 4G9EA 4ZQIA 5F9HA 3ABQB 1LZLA 1NJ2A 4R1UA 2MINA 1WCXA 2MU1A 2BM1A 1TCVA 3DMYA 4ZYXA 1Z6GA 1QJ4A 5AM1A 6ABPA 2Q4DA 5KFGA 3EPHA 4RZRA 2FRDC 2L42A 1JHOA 4A92A 2DXIA 3SHQA 1BS1A 3P52A 2AFRA 4GXTA 4RTQA 1MAWA 1WPRA 2AA3A 3MLBA 4O0LA 2GLTA 3IMCA 5FBVB 3V4RA 5FFFA 5BOVA 5CFMA 2X42A 2YXDA 3EPIA 4I4CA 4UUAA 2F2TA 3UWOA 1G16A 1V45E 1OIXA 3VNVA 3SBDA 4P3PA 4ZOLB 5ERGB 2G07A 3WIEA 1T8UA 3MT9A 4LZJA 5ES4B 4AY6A 3JYPA 2LBOA 1JEYB 1IJEA 3MR6A 4Q44A 5CNKA 1V9PA 4B6OA 1JMKC 3CYMA 2R68A 2PG3A 4AF6A 2Z8YM 3DFFA 4H16A 1EA7A 1EXWA 4X1IA 2HKIA 4CMKA 1J2JA 3PA8A 1Q21A 1KKLA 2IUTA 3AJ9A 3IPRA 2HBMA 9ICAA 1USVA 1L8LA 1O94C 3IJEB 1MR3F 2ZVPX 2OHFA 2F1IA 4O8ZA 4UHKA 1JXLA 3A1UA 4NNPA 3GIMA 1XXHA 2Z2YA 2RHBA 3B5IA 3OKCA 3H2JA 4IF6A 1KZGB 2KYRA 3HMQA 4JC0A 2ZIXA 2VJMB 1T9HA 3AY3A 3DL4A 2AK3A 2OYRA 1ISIA 2HN9A 4DLRA 2P9TA 2ZYHA 2Z4SA 4EHNA 1XJWA 1C1XB 2Q2NA 4L4UA 4P22A 4CL0A 5JQGF 3D8TA 2A57A 3HGQA 1MAHA 4B6SA 2KEYA 1SVNA 1YVPA 1Q3HA 2XR1A 4IIBA 1E69A 4C43A 3ZGLA 3L7NA 3AHJA 4LV5B 3ZLVA 2ZB8A 2E6UX 3I2JA 3MJCA 4HXFB 3H8VA 4ZO6A 3TW8B 2ZYWX 2J0UB 1XN1A 1Z4KA 2XUQA 3AI7A 3HXOA 1KDHA 1BRTA 1K98A 3AP2A 4EA8A 1ZQMA 1Z0ZA 3BC1A 1W5FA 3P0JA 1S02A 4W99A 4R69A 5C5IA 2DJ5A 1L1QA 2FMXA 4WECA 3AL0B 1NN1A 3DEKA 4ZO7A 1XTRA 2PKXA 2DY1A 1HTTA 4BN5A 1OASA 2MCFA 5B30A 3SJZA 1OXTA 5K0LA 5C53B 2X9NA 4RMJA 4J9PA 3WZMA 4GUDA 4K2AA 1SJ9A 2Z09A 3ZVNA 3LLCA 2VP6A 4I2CA 4TWIA 2P5TB 3FPHA 1LU9A 1S5PA 4YUWA 2PL9A 5EJ2A 2O8BA 1R9NA 2IFTA 3PTZA 2E85A 4MI6A 3MTIA 3A9TA 1PUXA 3WLPA 2Q99A 1U4SA 1CCWA 4D41A 2X9LA 1JAXA 4J0CA 9ICSA 1JROA 2BGIA 4MR8B 3UXEA 2OPBA 4WUVA 2V55B 1TI7A 4B0OA 3SC3A 4INOA 2VPWA 3F97A 4B84A 4IQ0A 3W04A 5ESRA 1DOHA 1JIKA 5HUQA 1I4OA 1SUBA 2VRBA 1FP4A 3DD5A 4H77A 3H9GA 3JQEA 2QNIA 1FC0A 1FY2A 1S2IA 3L43A 4EYQA 3LVWA 2K8AA 1ADGA 3GCWA 3H9EO 3A3OA 3TLGB 2ZTEA 2PSHA 2EGGA 1JQ5A 4YYEA 4JV5B 3BVPA 1B93A 2GF9A 3L4JA 1IL0A 1P60A 2YUIA 4EHIA 3GMSA 4M9QA 3S1AA 4K9LA 4AMYA 2OWDA 4QYMA 4EPTA 2D62A 4L4SA 5DGBA 5KSPA 2JAPA 4DQUA 5CT6A 5JLJA 4FFNA 1KERA 2XO7A 4YYZA 5A6VA 3KHRA 3PY8A 1KOLA 2R6FA 2WTAA 2XXAA 3DQZA 4F1KA 1TA4A 2R8ZA 1L1EA 3QKUA 1BZYA 4IRMA 2Q5FA 4JUDX 3NOVA 4N7RA 3QFTA 4UNQA 4DQIA 1EFLA 1RP7A 3ANNA 4UHHA 1KO4A 3RTEA 4NV1A 3GFKB 4DXDA 5THXA 2MA1A 5KT2A 4CNQA 1I9CA 1XPRA 5L45A 1NHGA 1RWPA 4O1MA 4RESA 2XOKA 1M10A 3ZLTA 1QG6A 1WOMA 1I4WA 1WCWA 4I1IA 3HR7A 4OHKA 3I53A 3HFJA 1SUEA 2QTBA 3FXAA 3H5AA 2C9CA 1O9HA 2DFTA 1XVAA 2G67A 1PZXA 3KUXA 2GJ8A 1QDEA 5ALYA 2P2YA 3KB8A 4AJIA 1YB2A 4J03A 1IIRA 2VPPA 1PGPA 4HYTA 3TTYA 3K70C 1CUSA 3K4PA 4R16A 1W581 4DTIA 1Q46A 2OHGA 1VSQA 3L2OB 3TQTA 4I1PA 2R7AA 4RUCA 2JFFA 3AR4A 4B4UA 1Q14A 2G4VA 3M6UA 1KQQA 4YAKA 5IFLA 3GP3A 1TQ8A 4R1PA 1KJ9A 5LYJF 2XBMA 3RS0A 1IEXA 4DGQA 1DQPA 3EDMA 3QEJA 3EF0A 2ZLBA 4LBWA 1JHVA 1SC1A 4X71A 4OHWA 5K3CA 2J1LA 4PINA 2ZKIA 1XN4A 5L3QB 1FVXA 4D3FA 1ELOA 4MVJH 1JALA 1TM3E 5BSGA 4D3YA 4OP2A 2QARA 1NXWA 1GLNA 2IF0A 2XIQA 5H81A 4GRIA 1LRLA 5B7NA 2ST1A 2I2BA 3D0KA 1NY5A 3PQ4A 1PIWA 1ULSA 1VL5A 2DSTA 3O4JA 3IVCA 2JCGA 2CLDX 4HTAA 3OQIA 4DEYA 1T2UA 1F4VA 1MVOA 4WPGA 4WADA 4BFVA 4BLSA 3QI2A 6YASA 2YHAA 2ATVA 2PGOA 3WNBA 4UXHA 2Q3CA 3HA5A 2ZR0A 5KSYA 3C3WA 3F2VA 4RQNA 3RR2A 4LHVA 3DGEC 2W2QA 3QENA 4YRGA 3AF2A 4YRZA 3VYUB 1VJCA 1EUDB 1DAKA 3UK6A 5IULC 4CM9D 2FMKA 3EVZA 2YWDA 5CLIA 2JK0A 4D8UA 4WGGA 1U2SA 4UB5A 2GPAA 2PYIA 1ZUD1 3BWEA 3PRJA 3PCTA 1SOUA 4R1LA 3LNCA 1RFGE 2ZSDA 1MDFA 2OORC 2R6R1 2ZBDA 3IYLW 1JGTA 5TEVA 4EY5A 3QTBA 5T3YA 3VC3A 2FNAA 1KNXA 1WMDA 1DXQA 4MRPA 1E7SA 5JJBA 5C8YF 1S2OA 5C1PA 1WU7A 1W8DA 3EGVA 4UNPA 4KMMA 3KL2A 2XTZA 4JBNA 3C4QA 3EX7C 2ZB4A 3CG0A 6NULA 3LBAA 4WOCA 1KTQA 3JQBC 4OXYA 2XB2A 1LNSA 4ELVA 1AK2A 1FVHA 3TDMA 2FLPA 5CB0A 2BMJA 2JBAB 2B20A 1W88B 3B60A 5BV2P 5KYYA 3JVUA 4KP7A 5DWDA 4GVLA 4IDNA 1ZS9A 4URUR 3WWZA 1BN6A 5BQFA 3SWWA 5HQTA 1R6BX 3F5FA 1US8B 1XHEA 2GVNA 4WZAE 5AJYA 5EL0A 3K1JA 3AEQA 2CYCA 1BEUB 3ELUA 4EF4A 2YMMA 1AKWA 1QIKA 1BW9B 1X9GA 3TD9A 4HFJA 2H5LA 1E1YA 4BWVA 3AQEA 1PZGA 2FP4A 4UU8A 1ZGHA 4O2AF 1ZGGA 3WB9A 2ZITA 3RVOA 1K6MA 3TMKA 3DMTC 4OCZA 2QX6A 2C88A 3SC6A 3BJYA 4JT4A 2O8FA 4OU4A 2YXPX 1R64A 4BNDB 3MZ0A 1TQHA 1PGQA 3D4IA 1D8TA 1P80A 1T3LA 5T14A 1IUOA 3N07A 4OJTA 4UFOA 3G9ZA 4I9FA 4HYEA 1AKMA 4CETA 3LDUA 5KTQA 3RF6A 1N9GA 5CRXA 4YH1A 4G5GA 3JVEA 2AYYA 3ZCTA 2WA1A 2VFAA 2JVJA 3T9DA 4AZWA 3E3NA 4OIMA 2A1TS 3O95A 1UMBA 4H6WA 5KVAA 5CX1A 5KFLA 2VEOA 1YZUA 3EPRA 2I99A 4PYKA 2D7JA 4EFKA 4KWHA 2ZIWA 1ACLA 3C3MA 3K0CA 3HWWA 2G36A 4OHXA 3W78A 5JS8A 2E4VA 3REFA 4GICA 3B3AA 3N7AA 4YIHA 2P9QA 5FHRA 1JH8A 2C4HA 2I29A 1RRCA 4RFLA 4YAUA 3WXBA 4R64A 2RKWA 4ALNA 2AMFA 2QAGB 4MJLA 3ED1A 1DBIA 2EU8A 2P67A 2C4UA 4Z51A 2Z04A 4Q4HB 3AFGA 3ZXYA 3OX4A 4KXUA 1WXEA 2EZZA 4QIWF 1QPBA 1IJFA 2O2DA 2QJOA 1YRWA 1PS0A 5BT9A 1FDWA 1MRSA 3KWFA 5JZMA 1XKLA 1E9FA 4WINA 4H7EA 2KVCA 1E9VA 3H9BA 3V4ZA 2IOFA 3ESBA 2E9SA 2ROQA 1AM4D 4Y1EA 3OIWA 3PITA 4YNBA 1N2BA 3E70C 5EE3A 2RLTA 1UMDB 2YFYA 5J2UF 3NGLA 3GUVA 1EMDA 4NBKA 4DOCA 1BVYF 5JSZB 3DOHA 4AP5A 5BPFA 5KFJA 4P35A 5DM60 4DFMA 5FOUA 1DZ3A 1S89A 3M33A 1DK3A 6LDHA 1DHTA 4KXQA 3OWOA 3GEHA 5C5CA 5DCUA 3C3BA 1FXSA 4E7PA 1NXVA 4X90A 1SZJG 3TDKA 3DMRA 4C3ZA 3TBHA 1LEHA 3N4MB 3OSPA 3JRWA 2DLNA 4QU0A 2FE4A 5I45A 3SVLA 1RWKA 1F20A 4ME6A 4Z1OA 3NKLA 4GYYA 4QRIA 3QPWA 3LS2A 4DNOA 3M5WA 2GO7A 4OFZA 2FFAA 1R0XA 1C29B 5FEUA 3B9PA 1FQWA 1AV7A 1ZY2A 1DRWA 4Q02A 5HIJA 3RB6A 4BKMA 4YT2A 2OYCA 8ADHA 2VXYA 5IBCA 1NASA 2D2VA 2PANA 5A0FA 1NV8A 4Y1RA 5EJ4A 4MQ5A 2OQ2A 2BP7A 3ENVA 3QWAA 4OHFA 2ECQA 4DSEA 4XUCA 5L1IA 4RXMA 3NBKA 3WBKA 4L8YA 3PGVA 1H1DA 1P31A 1M1NB 1NT4A 3L07A 3D81A 3UJCA 3CR7A 4QXAA 1UKCA 2V98A 4GBJA 1U45A 2QNBA 3MVEA 1AC5A 4NESA 1KVRA 4YN3A 2AH5A 4QUAA 3KLNA 4NLZA 2Q9UA 1F0PA 2BFDA 3W4JA 5B64A 4EUEA 4HB3A 2X5XA 3UAVA 4LJRA 2YVQA 3HKZF 5J2IA 4EHBA 2J5KA 5ARCA 4TYQA 3I01A 3FKSA 1X8XA 3ZY2A 2V7EA 3IOYA 2G80A 3OM9A 4MEXA 3LK6A 4PFQA 4DJDC 3LUBA 5I01A 5EESA 4QZIA 2MSWA 4LHWA 1OPXA 2CLHB 3SBOA 3AM3A 2CFOA 1GV1A 1T5HX 3WZLA 3WMFA 2HK8A 2DEUA 4KLHA 4MA0A 1Z4QA 1MA7A 2I5HA 1ATIA 1YRHA 4HGOA 5IUNC 4XAQA 5F3WB 2WMNB 2Q3LA 1I6LA 1JJFA 5K9ZA 4Q19A 3IKJA 1RFLA 3F67A 3PCXA 3U9TA 3RROA 2BTQA 8AT1A 1UZUA 1SD5A 3COSA 4HDRB 3SQOA 4AW9A 3CR3C 2LKCA 4PPNA 5CDUA 4ECAA 3WKAA 3C15C 4XLLA 3ZX4A 5HA5A 4TWBA 1CEZA 2XYVA 1LTQA 4XDHA 2OXCA 2W83A 4ZI2A 5EHGA 2DBQA 3ITKA 2RB5A 5K6RA 4I81A 2WIDA 1WOYA 1JTVA 5BWBA 2JBWA 3R5JA 4FS8A 2BHSA 1DIRA 2GGSA 3EQ9A 4B4VA 2F00A 1M33A 3S4YA 2ZWPA 3MAJA 1NR7A 4PLPA 2AFHA 5AJZA 1ZIPA 4JUBA 1RXSA 2NZWA 5FLXA 3WWCA 4ZRMA 2DHQA 2X0EA 2ACEA 5AM5A 4Y67A 4ZRNA 1M6NA 5EE5B 3UG6A 4U7DA 4M7RA 4U7GA 2OGZA 3UB4A 3HDYA 2CFRA 4Q66C 4DIBA 4M0AA 1XRJA 4YCNA 3BD6A 1VJGA 3L8DA 4CG2A 4NG4A 4XUGB 2BCSA 1E2PA 1JDSA 3E03A 1NRIA 3ITNA 2X0FA 4WJ3B 2GSDA 4DOAA 2YIJA 1ESEA 3DV2A 4DFJA 3FI9A 4FE7A 1UBFA 5B37A 3CMCO 3ESYA 4C4OA 1LPNA 2KBEA 2G1AA 4LZOA 5DLQC 2GZRA 1XZNA 1MZPA 1QVVA 5JARA 1OYVA 4DL5A 3RS7A 1ZMBA 1I3LA 2Z58A 1FRFS 3O1JC 1V7CA 4EQZA 1XLVA 1XPJA 2OAP1 4B45A 5KDDA 3WQQA 3PLRA 3F49S 4DF4A 3KVVA 5FBWB 4JUCA 2GEVA 3ZYZA 3M1YA 4OMCA 2Z6UA 2TMGA 4LRTB 4YECA 2J31A 2AR9A 2JZBB 4PPGA 5CNMA 2K4PA 1A5SB 1SG9A 3BTVA 5KC8A 3BQNB 3H5LA 3ELDA 4J6FA 2EZ8A 3TTWA 2BZFA 5FWNA 4NVRA 3UXYA 1YZKA 5BVHB 4RDXA 1ILWA 1DPFA 4U9HS 2VK4A 5JWOA 3ISCA 3HSYA 3DE7X 3EPJA 1CRLA 2GN2A 2FA9A 1WQ4A 4F56A 2VNIA 4V0ME 1E4OA 2PFOA 4I4IA 1C9JA 3BGWA 1YJ5A 4UB1A 1ZAYA 3NHWA 5K3FA 3OETA 2KSOB 4N39A 1FSPA 2GAOA 2G83A 4ZAVA 4PZAA 1EWKA 1NJWA 2V7BA 3DDUA 3HXKA 1UBTS 1FP7A 7YASA 3ECAA 1WZEA 4PZPA 1IVYA 5IP5A 3INRA 1JJIA 4PX2A 3E35A 2C94A 1HNXB 3UN1A 4FUTA 2K2QB 1L4HA 5BRNA 3JQ6A 4GI3A 4BUZA 4YR0A 4WOKA 2ZYRA 3DLHA 1XCJA 5HFNA 3ZY3A 3MJVA 5CBPA 1Y8ZA 5CFZA 1G59A 4K6GA 4BN4A 3VMMA 2XCTB 4A8JB 1UKAA 1ZVQA 3L0BA 3C4JA 4O2BA 2J9ZB 1LRJA 4EYKA 2XXBA 3OCCA 4IIGA 2XWBF 4XZ3A 1RYNA 1VLMA 4B6PA 5DDYA 4HAUA 4INJA 2NV3A 2CLEB 1OW3B 2BFFA 5FDFA 4RMGA 4RENA 5B4TA 2FR0A 2WP0A 4A0RA 3WK7A 2WFMA 2X1HA 4UCQA 3HJNA 1KBZA 3I04A 1GD1O 2WB4A 3F8SA 4F5WA 2ZUBA 1BS2A 1Q3UA 5U4XA 5EIBC 1T9AA 2RHHA 4FT4A 3RRBA 3HO8A 3KTAA 3EA4A 1QK4A 2JGRA 2JGMA 1YA4A 2EIHA 4LYAA 1R8SA 1U7XA 4HDMA 1E0JA 3E9ZA 3S5JA 4V39A 4GPTA 5AI4A 4RNMA 4OYLA 3C16C 5AOCA 4TOIA 5G02A 1YB7A 2XCIA 2I0FA 1DKQA 2ZJZA 4RKQA 1W35A 4JKOA 4WDRA 4OAQA 4C3OB 1E1MA 3T9FA 3ELBA 5AKHA 1XL1A 4MSUA 4IUCS 2OK7A 1PQ4A 3U3JA 2QQ5A 1VMIA 2YNMC 1PJSA 2A1UA 1Z38A 2OO3A 2QD3A 3DD1A 2VBCA 3UW3A 4FOTA 5JFTA 3UH1A 4MGKR 2FZ5A 3VVBA 2XV1A 3FGZA 3R7WA 1VLQA 2PS1A 2PNJA 1IEVA 4EYEA 1TTPB 4YGXB 2BLLA 2RSLA 3EARA 1YUMA 5JI2E 4IO1A 2G9RA 1EP9A 3RC7A 4RCYA 3FCEA 2HGZA 4XQCA 5F2EA 2AVNA 4O4JA 3QPCA 1T2NA 1WMEA 1K08A 1NBWB 3QEOA 5CVUA 2BKLA 3D4BA 1V48A 1H9BA 3HJTA 1R6DA 1COWD 1LW6E 1E2IA 3MCTA 3SSMA 2PO7A 1EXDA 4DDKA 3IO5A 4AY5A 1PUJA 4LMAA 3IAM6 3A05A 1EGMB 3X1ZA 1RKQA 2VNHA 2PL1A 4L1KA 3ZCQA 4YUAA 8ICYA 1AGNA 3W8FA 5AOBA 4E0DA 4OUDA 5A9RA 1JJBA 3DBRA 4Q1DA 1OJ7A 2D06A 4I55F 3DEYX 1J70A 5HHTA 3AF6A 4EIWA 3QY9A 1ZD4A 4GL4A 3RS2A 1IPHA 1CQIB 2VAVA 3SDBA 4FFWA 3FTCA 3P8ZA 4R6XA 4KNWA 1BG6A 2FFBA 1G4HA 1L7NA 4ZYTA 3C48A 1T6XA 4YQZA 1P1CA 5AJXA 4F04A 1QSLA 1RZTA 1HQYE 2XCQA 2Y0DA 3GLFB 3I2KA 3A10A 3MSCA 5K6TA 3DBLA 4E0BA 4BP9A 3OZTA 4LQLA 4HGYA 2I1QA 1AVTA 3OQBA 3Q88A 1DE0A 4MGIR 2X1MA 1QIJA 1PGNA 2AQ4A 1WB4A 1NC1A 4Y18A 1XSEA 4W1QA 1WIWA 1E6CA 2RBKA 4WACA 3I28A 2ZJ6A 1EXVA 2JLXA 1O4VA 1PZNA 3B6MA 1E1NA 2XECA 3OCXA 2O1XA 5E95A 3V7YA 4RA9A 4F5YA 3ORQA 2RGWA 4NLKA 4XJXA 1JLKA 3ADPA 2WUEA 2LYBA 5ILOA 5JJCA 1DV2A 4UB2A 2FWNA 1UBNA 3LYSA 3HWTA 2LVBA 1SKMA 4O5EA 2NVUA 1DUSA 1VJRA 2GZ1A 3FYCA 5EIXA 1YR7A 2WU0A 4HMPA 9MHTA 2GZAA 3K9FC 1Z06A 2AKEA 5HG0A 1RR6A 1D3AA 4Y7CA 2G06A 2FVXA 3TB4A 3H1PA 4DM4A 2JLZA 4B7ZA 3HA2A 3WJ7A 4QECA 3NV9A 3AR5A 4YAEA 1ZQJA 4YS6A 2NXCA 3MLAA 4CMAA 2OXEA 5IS2A 3T4EA 1D6SA 4IEEA 3ZIDA 4C78A 3R3UA 5F3XB 3T7RA 3EXG2 2A1JA 5SY6A 2WYVA 5IIJA 1GL9B 4LJXA 4FMDF 1DC3A 3ONNA 1GZSA 2DECA 1TTHA 1FTGA 1A72A 2IL1A 4H7JA 2IXGA 2GN9A 3O92A 3PW4A 8ICPA 3HP1A 3G5TA 1U0SY 5GV7A 4FGZA 1OSNA 1ZCAA 2VJNA 4TXMA 3RIGA 5E7QA 1DU4A 1NUHA 3NTUA 3ROXA 1I2AA 4OMDA 4QPNA 2PX8A 5IZCA 4MS1A 4QWDA 1GPJA 2O2GA 3ICCA 5GZ3A 2W0SA 4YV7A 3RG8A 1X1AA 1CY4A 3NTVA 3KPYA 2W4QA 4BEBA 4LISA 5LM3A 1DFHA 3V48A 4Y6LA 5I3CA 3Q6IA 3BPSA 1UXOA 2WHRA 4EFMA 4YLYA 2ZXIA 4QGBA 4LXXA 2ASDA 3OZSA 2CEAA 4N54A 3E5NA 1V6CA 1IUNA 4MARA 4F8EA 4JWKA 2A14A 1O96B 4GP6A 4P36A 1IN8A 5DI9A 2UYCA 1DQNA 1MX3A 3MJRA 2AK2A 3RADC 2FSSA 1LK7A 3QVUA 4Z53A 4L9SA 5H1YA 3ESDA 4MGEA 1NJ8A 5G1NA 5JISA 1W2WB 4RQAA 2VHJA 5EFZA 3I9JA 3L0SA 1DAIA 4I4TA 1KW4A 4B6GA 5AP9A 1NULA 2C84A 3NHFA 1UEIA 4U0JA 5KO2A 1SPXA 1MOSA 3ICQB 1GQOA 8ICKA 2VA2A 2BH9A 5I8WA 5DTIA 5DNYB 2V3VA 1ZH0A 1UBKS 1XT6A 5ER6A 3RWMB 2DAPA 1USIA 4FHGA 2YHIA 4LECA 2CWWA 3DPUA 3HC7A 3EIEA 1E5QA 3F5DA 1WMFA 3AFIA 1KFDA 4TRMA 2F3NA 2CLLB 3V9PA 5JS6A 5CIWA 3VKWA 1OGIA 1WA5A 4LX8A 1E6UA 4XOIA 1FCJA 3FLBA 5C8VA 4B7UA 4DL2A 2JVIA 4J1NA 5JLAA 5E1OA 3C7DB 2F1OA 2OZVA 3PNYA 1ZJWA 2ZW9A 5IJAA 1IZZA 1B3RA 4M47A 4F4FA 2DFNA 5LMZA 1KOJA 1U0TA 2A1AA 4BO0A 4Q1BA 1NZBA 1NU8A 3OFKA 5G4KB 3W9SA 1VHTA 3ZWVA 1J24A 1TM5E 6AT1A 4F92B 5FTNA 1GO3F 2BGLA 3A9VA 3FPJA 4JR1A 2BTOA 1OI7A 3KQPA 2C3YA 4NEQA 5FOSA 2JF0A 1RCFA 3VI3B 3H2HA 1A98A 1SGGA 2OAQ1 2QDKA 4ZZ1A 2PD4A 3NZEA 4CIBA 4KREA 5GQSA 2GXAA 3FSGA 5JALA 1E3TA 1BOOA 4KWIA 3OWHA 2OCGA 4QZDA 4WESB 3V9AA 3CTMA 4AQYB 4ZQEA 3NBQA 1LPAB 1SD2A 2V58A 1EK0A 2YZKA 1MGOA 1AH2A 4XQ0A 5FOWA 4Z9FA 4TRJA 1X2IA 1MGPA 5DCYA 1NMZA 3EPGA 2X0IA 3BK7A 5B7QA 3WGTA 2M1XA 4E13A 5EJ8A 4RD0A 1ENYA 4RV4A 3R75A 2IKQA 2Z98A 3KYIB 1ZKDA 4JLMA 5AFSA 1U3GA 4PGXA 1WUJS 2ZE5A 4YPFA 1SRRA 4XA8A 4Y6RA 2V7VA 2X3UA 2OP0A 4G2TA 2JB9A 2AX3A 3JQAB 4CV3A 2ODGA 3PTAA 1X7XA 1TK3A 4RK6A 5CVTA 3QVTA 3R9XB 4DKXA 1VIVA 1TF5A 2WHPB 2HDHA 1P2GA 1IBMB 3ZXSA 1ZIXA 4OG2A 1H8HA 4ENRA 5GONB 5TPWA 3FRIA 2DUJA 1W59A 1YE5A 3R77A 4KVAA 4LF7B 4C7YA 2AKAB 4CF6A 4RF2A 3MGGA 5TMPA 3AU6A 3T34A 1TRHA 2EQAA 5HJ2A 2X76A 3ETJA 5TGDA 1JDBB 1G64A 1V9SA 3LUCA 5HIKA 3WSTA 4BB0A 1E7WA 4HG2A 3EZ5A 1VIAA 4E46A 3GLHE 5GP1A 3AKEA 4Q1EA 5JXIA 1CQJA 1Z0DA 2BGJA 1C9EA 1RNLA 1MC8A 2ZBRA 4W5RA 1KI2A 3S2IA 1KPGA 3L8GA 3V7UA 4MJ7A 1GHTA 2I78A 2DUYA 1XJ0A 3K72B 4G1EB 1DRGA 3CW2A 2CCJA 3FTPA 3OHSX 4N3GA 1U6KA 1P7ZA 2HK7A 4KYTA 5LLDA 5TPZD 1F7VA 1WKBA 3MMPA 4ARZA 2A0XA 2NVWA 4IDOA 1T0BA 4DQDA 3L0IB 1E2DA 4CTMA 4PSVA 1YK1A 1T13A 3C4VA 4TYMA 3QK7A 3BQ9A 1LS6A 5A03A 1T5TA 4EKNB 4HZGA 2G8LA 3M1IA 3ROPA 1PFKA 4XTRA 3K16A 1KIAA 1ZQNA 1P8JA 2CVQA 3IMKA 4MKXA 4DLBA 5T4BA 3BWMA 4I66A 4ZV7A 7ADHA 4M7PA 3DZHA 3U5ZB 1ORIA 1KDOA 1NA5A 2H1RA 4G84A 3MRXA 1R0LA 3WRYA 4LW8A 3OZAA 3FPSA 3LECA 5DG8A 4FBUA 4X7PA 1N2HA 3RSQA 1OA1A 1RYUA 3MMNA 4ZU3A 2HLPA 1Y4SA 4Q5IA 4QYWA 3K0HA 4BVBA 2AIRA 5T3UA 5HWSA 2O7SA 2YMQA 3JQ7B 4F6RA 5EWLA 2JAQA 4BZPA 3PNQA 4WKGA 1OFIA 2H06A 3MBIA 5LJIA 3K4HA 1UMCA 4XWYA 3CRXA 3Q98A 1X8JA 4L9RA 3VNAA 3IO3A 3PXDA 2XHZA 1BA2A 1K2VN 1UBGA 4MQMA 2B7BA 1T10A 3FMGA 1GCGA 1DEHA 5KCZA 3O73A 4TM7A 1UIRA 3CMMA 4V02A 1ESMA 1NJZA 3PFBA 3GOQA 3OQOA 4FTWA 4EW1A 5JXGA 1AX9A 4X45A 3ROKA 3A2LA 4E21A 1EE9A 1JSXA 1IXRA 3OHAA 4GZ3A 1LPPA 1YRBA 2AEJA 1TLLA 4C0BA 2PMZC 4KXLA 3BL5A 1T3HA 3OLXA 5EIOA 4FIZA 3IX7A 3LYUA 3PW2A 3H17A 3TBKA 1LSOA 1UFQA 2OG1A 4F4CA 3DF9A 1JHQA 3OQNA 2D2EA 2JEIA 4DIEA 2F7SA 4H6XA 4DABA 1VYHA 4XH9B 2I91A 2E8PA 2W6JD 1RJDA 2V5UA 3VKGA 1E2NA 4Q1CA 2GYWA 5ICFA 2PXAA 2QP9X 3INTA 1QZ3A 2P7IA 4PZLA 3C7KA 4JQSA 2W42A 2NO7A 3UYKA 3GZNA 1KI3A 1J25A 4PM4A 1CX9B 4ZT3A 2OAEA 1EUYA 1Z5WA 5EP3A 2OGWA 4R40A 2FVYA 5FKJA 2IYUA 3QPAA 1PL7A 421PA 4II2A 5AVXA 4WMLA 4TYNA 4G24A 5E0OA 2H2WA 1V26A 1U0NA 3L06A 2QQ0A 3P0EA 2II6A 3ORYA 2JAHA 4GEKA 1BKSB 4C5BA 3S2FA 5H5JA 1PCXA 4QELA 1T9GR 3BH6A 1TJ5A 5LR6A 4I50F 3CE6A 1YKGA 2EBWA 3SYZA 4RVNA 4JU9A 1JPJA 3M5CA 1QNFA 5JPDA 1XRNA 1CRZA 3O1HB 3S7TA 2JANA 4UHFA 4JELA 5CNJA 3NVYA 2JFWA 2E21A 3QTTA 3TSAA 4S04A 3WOHA 1Y9AA 2BFBA 2PGNA 2OWEA 2VLBA 4ZAFA 5CHEA 3UYLA 3TTSA 4OGLA 3S68A 1NMSA 5CLJA 3D3EA 4O4HF 3WKDA 3U4MA 3HL4A 3IBSA 4EO4A 2WFLB 5IX8A 2IHKA 4XQ9A 1AG9A 2EZYA 1MV5A 4FC7A 1T3QA 1XDUA 2LUOA 2Y9UA 2J6BA 1R0YA 4BQPA 1KJNA 1D8BA 5GVSA 1SKYE 2YS6A 4BXOA 4HYKA 3LM8A 4QPDA 2EIXA 2ZCUA 5A5DA 3ESZA 1VYVA 2X1VA 5FADA 1P2FA 1U9IA 2XJ4A 3P9NA 4X6UA 5C81A 5BUSA 4NE2A 5KX5A 2NZJA 2XVMA 3BWBA 2QTFA 4URYR 1BU5A 1M8KA 2RIRA 5CDFE 1YBHA 4RXTA 4LHYA 4DWIA 2PS3A 1HFWA 4TTJA 2QZ4A 2D8MA 3ZWAA 1KVQA 3CP8A 2RI1A 4BDPA 1Y34E 2JA2A 1UIMA 1RKXA 4PIPA 5BVGB 2B0CA 1YONA 1E63A 3UV7A 5F4ZA 1AO3A 3A3PA 1YQEA 1BEEA 1J7JA 4RE6A 5I9LA 4B8ZA 4P4TA 3UGKA 3F9IA 1GZHB 3ROQA 3QKIA 1V8ZA 2BEUB 3QBEA 4AP6A 1OQAA 1OT3A 1ZVMA 2G40A 2YV5A 2HA0A 1POXA 2KICA 3ONDA 1ODFA 3ZV5A 4MFCA 5WRFA 5CB6A 2R85A 4YXFA 3NNNA 4XDGA 1CU1A 5I7WA 3CC8A 1U9YA 1TQ2A 3DOOA 2IEYA 2G5CA 4BO7A 3G85A 3KT0A 5FBQB 2I03A 1ZQCA 1Y4ZA 5MGBA 5JNSA 2YCLA 1JI7A 1LW7A 2IYFA 3NVWA 3A6GA 1K89A 2GCIA 4LZLA 2NV2B 4EAAA 5H8WA 2A7XA 1CUFA 2VRNA 3O8RA 3HVRA 2XT6A 3BM5A 1H9AA 2FEWB 4YMWA 1Y3DE 3E7DA 5FA5A 3OPQA 2YJTD 2DTXA 2YINC 5IF9A 2B7LA 4E22A 3II6X 5L7YA 4EHDA 2G0AA 4IQ4A 2IXAA 1ULHA 3OGUA 2QHXA 1WDTA 2HPZA 1NBMD 1NVMB 2BQRA 1I7PA 2WJWA 3LPLA 4Z49A 2BFNA 4OBBA 5HRAA 1JNYA 2H2GA 2I71A 4DMLA 5CT9A 1T4DA 1G5TA 1CE8B 1WXHA 2PGLA 1DDOA 2J3KA 5FUQA 1QR2A 5JVDF 1KOGA 1LB2B 4AK9A 2R62A 3PC2A 3AKZA 3E9QA 3MRSA 1RAFA 3IBYA 4TS1A 3MBYA 1XTKA 4BEJA 2QIPA 5ESXA 3AG6A 3B2EA 1SU6A 4LHZA 4H7HA 2R8IA 2ZI4A 3PLAE 4Y2GA 1WYGA 1EJ0A 1D2HA 1X80A 2DYKA 1Q1AA 1JFRA 4HRVA 1P2BA 4OJPA 5LZ5A 5G0SA 1KMMA 5ETJA 5KMGB 3H2ZA 3SXUA 3LXMA 2WJ4A 3JTEA 2BGUA 1F2UB 2EQYA 5TS3A 3LDFA 2BMWA 1DIAA 1NQWA 3REQB 4OFBA 1VMEA 3ZKWB 3AYXB 3LDAA 3HKBB 4YAJA 2PZGA 4FEAA 5K8CA 1VC2A 1I3MA 4CCHA 4I8DA 4ZT4A 3PIDA 5KIAA 3BL8A 2WUVA 4HAIA 4R2KA 2O2IA 5CNIA 9ICNA 1SVLA 2XIDA 1HO3A 2PLRA 3D3WA 2KWIA 4LQDA 3ZDXB 4M0FA 1SKAA 2Q3MA 2VJBA 4DFDA 4H1TA 4TV8F 4UTXA 4MHSA 3HYTA 2B4KA 1ZMOA 3MA0A 5FUMA 2VK8A 1OAAA 5BQOA 4U2BA 1CJKC 3NOOA 4NZOA 4KLGA 4Y9DA 4JCOA 1L7OA 3KR2A 8ICFA 1TC1A 4OM8A 2PMKA 3N5CA 1JAZA 4IJUA 1JFFB 2FGKA 1P39A 3SE0A 4QBTA 3K75D 5KJFA 2HMUA 1F9AA 4ID9A 2XLCA 3HG7A 3GVCA 3ZDBA 3T4XA 3HX0A 4WD3A 2M2IA 3N6VA 1USWA 2IYQA 4BVHA 1ZVVA 2AJDA 4X64B 4Q1VA 2BFPA 4EUKA 3IFSA 3L1KA 1OR8A 2HEGA 1E4EB 3ZDEA 1GNVA 3BMCA 1T5DX 1I2BA 3D6UA 3NBYC 1TT5B 4UUNA 4EPYA 2OBNA 2V4RA 1H65A 2D00A 2QY9A 4RTJA 3L0YA 3G2PA 2J30A 1ID8A 1PT9A 1OA0A 3OM1A 3GUUA 1KMIY 3DL0A 4KCGA 3JARA 1FIQA 1K8XB 3IPLA 1OWPA 1DKLA 1I33A 3INNA 4GX0A 4LXQA 3UAYA 4X1OA 2ZU6A 1N2JA 5FH9A 5DO9A 3GU3A 1UC5B 5EP1A 3D6FA 1E7MA 3RB3A 3WIVA 1W5TA 4URXR 4HNAB 2UKDA 3AKCA 3FVTA 3JASB 1DV1A 3TSOA 2XH8A 5EZQA 5K6AA 2IHNA 4D0LB 4GFDA 2N1MA 3A4NA 4FSHA 4LYFA 1G1MA 1FFWA 3DB1A 4D8YA 1R74A 2W90A 5CB4B 1G4UR 2RGNA 3TD2A 3LVBA 3CWCA 4O3OA 4S2EA 2YMPA 4PX3A 1UDCA 1LPBB 5KNDA 1TU4A 2OH2A 4WOBA 2QJTA 4ICIA 3EBOA 1DCMA 1PT5A 4G5HA 3OZCA 3EVBA 3S5UA 4BFTA 3IEXA 1X7GA 1JR3A 5E6UB 4D9BA 1CR2A 3AFMA 1T1SA 5KT7A 4BRSA 3FDFA 3HBFA 1II9A 4IIFA 1YCFA 4CMCA 1CG6A 4OXNA 1S3SA 5ELMA 5KUTA 1ZMTA 3A4IA 3BWVA 4KJZA 2NO5A 2RG1A 5CP2A 1IHXA 2B34A 1QU3A 4LFAB 1R5NA 2IYXA 4KFRA 4C7MA 1MDBA 3Q10A 1Z00A 1T3NA 4U1RA 2ZP1A 3Q0TA 3AWDA 5BNTA 5LQMA 3GDOA 5H83A 1T8YA 4TUQA 2GASA 2XCPA 3WTCA 4KU4A 4NY8A 1C3OB 4C6HA 2PQ2A 4H7PA 4P80A 8ICVA 1YL7A 4LCJA 3VNRA 3SGLA 4C88A 1S2MA 3EB9A 1B0PA 2CNBA 3GJQA 3ZI7A 1G0OA 3E8SA 1G42A 5AJTA 3VZSA 3SZ2A 5H7XA 5DQGA 1XZKA 1JYSA 5J0PA 3GILA 1RABA 1DL5A 4TV9F 1JLHA 1YZ6A 2PU5A 1SC9A 4NABA 4CQMD 3T4PA 4K28A 3USCS 1GN9A 1NW9B 3BFVA 2WQZA 3DW3X 5AK6A 1F2TA 4D6XA 1P5FA 1I5EA 3BQTA 4ZXPA 3BGVA 1VA5A 4UREA 4YRPA 4MWCA 3W77A 3A9WA 2DF4B 2GX6A 4F5PA 5KSOA 5KS2A 1U9ZA 1PK7A 2SBTA 4EHLA 2FU5C 2NUPA 1G7CA 4ZVQA 1YR3A 2CLOB 3LCUA 3ZCRA 2PKYX 1M2OB 4N8EA 5FNVA 2QD4A 4GLOA 3S2UA 3M8SA 1SKQA 3FN4A 3INYA 2J7KA 4R4JA 4HDAA 2C77A 2HYIC 3VVMA 4G25A 2BGTA 1GLVA 1QLHA 3OPYI 3MJDA 1RPLA 4CKWB 4ZMSA 4QTZA 2O9JA 4UBKA 2IS1A 3HDHA 2W6IA 5KG3A 4EX6A 1T6BY 4PN3A 4QWAA 3H2YA 1Z7WA 3MFYA 2W6OA 4BLQA 3BGDA 3AEVA 1Z4MA 2QTWB 2JKYA 4DLNA 4FOOA 5A0VA 4HBGA 3IUPA 1ECPA 2YJ3A 2IE0A 3HLKA 5IW8A 3L7KA 2QAGC 4MPDA 3FCUB 3QX8A 2J3HA 4WLVA 3VQTA 3SYNA 2D1FA 2H1FA 4WFKA 2WK1A 3LBHA 1K5DA 3KCNA 1NATA 4X6YA 4HDCA 2L18A 2IZ5A 1ZU4A 4Q3EA 2DPHA 1HZJA 3BAZA 4H27A 3CTPA 4TSRA 5HFJA 2WHQA 3R0ZA 1YZLA 3R3ZA 3QJ5A 2IPAB 1B0XA 2C4VA 2OM2A 3ABZA 2AG0A 3P97A 2AF4C 4CUZA 2O1EA 3DZIA 3U17A 2NAFA 4J49A 2HMAA 3N2GA 1SIWA 5E6SB 1FX1A 4C8NA 4PS1A 1TPZA 1KQPA 3P5SA 4PYNA 1MEEA 2W3RA 3HADA 2ZT6A 4B3XA 2QY6A 2RMKA 1XYGA 5DJ5A 4PYJA 1MJGA 4CEIA 5IDQA 1VHWA 1DJNA 4RHTA 3V6HA 4Z9BA 4DBLC 4MYDA 4V3CA 2IIBA 3OFND 1JTEA 3WL3A 5J3JA 3D02A 4LYEA 4LE0A 2RI0A 4PGHA 1ESNA 3FZQA 5DPMA 4A23A 2F77X 4BAZA 1FDSA 2H5JA 2YN2A 2BSXA 5IJ9B 3DJFA 3V1NA 2EJCA 2O8CA 4I5GA 5FXMA 3K35A 1JKJA 3DTVD 4ADSG 3UMMA 5KEIA 2GAFA 1WXQA 4QU5A 4OHRA 4ZHQB 2ZJ1A 4D26A 1PT6A 2J5RA 3PQ2A 4AZVA 1DADA 4YAWA 4Y3UA 3VC2A 1GXSA 2LCQA 1G5QA 4X63A 3OFSA 5KNCD 1N6LA 1HLPA 5EPUA 4R8SA 5AW8A 3RK4A 4QICA 3LW7A 3K0AA 4ASUD 1N6HA 4WX2B 2ET6A 4CV0A 1XZFA 4HB2A 5CH3A 1CY7A 2FX3A 4AKEA 2VRCD 3N5KA 1NQTA 4D9FA 1Z45A 5EA2A 3DVAA 3T5HA 4Z4IA 3TEMA 5A4KA 1RM4A 1E6MA 2VL7A 2Z56A 4ISBA 3OTGA 5FIUA 3L04A 5IIOA 2YXLA 3FCSB 3SHTA 2W6CX 3LBIA 4G5YA 1TO1E 4MKZA 5MN4A 2QLTA 2YHBA 5CH5A 3KHTA 2X77A 1M1XB 5CLQA 3JVDA 4NDNE 3HSSA 4NDZA 4M9NA 1ODLA 3WDSA 3IDAA 2P27A 4JSYA 1FS4A 3PQ5A 3LPMA 3DEIA 2BI4A 3UWMA 1P61B 4MAMA 1LZKA 3B70A 3DAGA 3IQHX 5HEKA 1RZRA 2PX3A 4C7ZA 4LJAA 3CZ4A 2UAGA 1J56A 2RHWA 1O0BA 4XWGA 2LIVA 3P0HA 2WVAA 3WLOA 3EXIA 3QUTA 3V7NA 2ZULA 3IVGA 5IAGA 1QFXA 5DRYA 2EL7A 4CDGA 5DBIA 3AVWA 4KKXB 5JCPA 5CVVA 1W52X 3LTEA 4E7OA 4HWTA 3C2QA 1H4VB 1NW7A 1ZQ1C 2XCSB 4BPBA 1QGAA 3BERA 2N9UA 4BLPA 3PXEA 1V6AA 3O03A 2GAAA 4UD2A 1R16A 2P75A 4IWYA 2Q1SA 2HGSA 1SXJA 4MQBA 4IIUA 4UFPA 1QRRA 1V5EA 3EISA 4PYIA 2WC1A 3RJTA 4FHDA 4BCBA 2PCJA 4YLGA 5IG2A 3D2LA 2XUKA 2PFKA 4UAYA 4DSTA 4ALMA 3CLTD 3MS7A 1P1HA 3GJ4A 1UJ6A 1GR0A 5KQRA 3UT0A 4ZYZA 5COAA 4ECSA 4Y0NA 4GW3A 4AJ9A 3EMKA 5GM1A 2JIPA 4RL4A 4AKGA 4HRXA 3HVJA 1K7XB 3PIIA 1L8AA 4GMHA 3VI4B 2NSDA 2Q9CA 3VBCA 5M2QA 2PQ0A 4ER5A 1PJAA 3F7TA 2X86A 1X1CA 3PTLA 4F5NA 2QB0B 4G0WA 1WO8A 4YJ3F 3I8SA 3FIUA 4Q3DA 5KFMA 1ZQKA 5IT9A 4DBVO 1Y9DA 4BTEA 4AN4A 2PQ6A 5UKDA 2GN6A 3AUUA 4AQDA 2OOSA 3RE1A 5C51B 3G9XA 3GOHA 4R05A 5ESWA 1K6EA 3T3EA 3BG5A 5H3LA 2KLHA 4ENUA 4AL4A 2Q62A 2FETA 3RIHA 1BDBA 2BN4A 3QWHA 1B4DA 4FGJA 1CJVC 3TOVA 2MHCA 3QU7A 3EVNA 4QPPA 1RSZA 3GLIE 3DZFA 1QLWA 2J7PD 2G08A 4ZPXA 4C76A 3TSYA 2H4ZA 1L4YA 1TMOA 3SSAA 4B74A 5C31A 3C0KA 3H4IA 3BCSA 4Q39A 1B0UA 4D4JA 1AURA 4DWOA 4E2FA 3MJ4A 1NNEA 3DVRX 5KOHA 4BQSA 2LCFA 5ARBA 4JFAA 1N0IA 2ECKA 5ELLA 2JDID 2V9WA 1YZYA 1D0SA 1QFZA 4LVOA 3ZH2A 4ZEMA 2ZJ4A 4EG1A 4FJ2A 2OC4A 4BNYA 2OMEA 3W34A 1BSVA 4WN9A 1C30B 2X7HA 4OYYA 2QLNA 5REQA 2YYYA 3Q7PA 1PQPA 2Z95A 1VP9A 5ALLA 3HHEA 5THQA 3VR5D 2MU2A 4DMKA 1QRAA 4QFMA 3T9AA 3WWEA 5A9SB 5J2EA 2DPMA 5K03A 1Q7TA 3WIBA 4HLQB 2XMQA 3SHWA 2OESA 4EYHB 2VXCA 7ICVA 2QOEA 2WKSA 4IWXA 1RXCA 3N7UA 1T94A 1NNI1 3MWYW 3RYFA 3V7LA 2GK7A 1KAEA 4GAEA 4I2BA 2WABA 4TVOA 4J1QA 2PXCA 4A5OA 4CDMA 3EPLA 3LWLA 2Q28A 1OVGA 1YR2A 3M4JA 5CG2A 1TOAA 3FPCA 3TH5A 5LKRA 5BOSB 3V1YA 4YCLA 1CJSA 3GGCA 4DLWA 4MV8A 3BA6A 3O8LA 4BZWA 4DQLA 3U19A 2FAXA 4PO8A 2YY7A 4KXYA 2XCOA 3N2NA 2ATXA 4RF3A 2HO5A 5K0EA 4C06A 4A8JC 3AR7A 5FEMA 4HL6A 1IIBA 1H85A 2EFYA 2HH9A 3NAGA 3UC5A 1SQGA 5FF9A 3KTQA 4AD8A 5BMVA 1U4BA 3IQXA 4UAZA 2XB4A 4JGGA 2VH2A 3E1KA 5LN1A 3UAZA 1AROP 4C2UA 1UA1A 3IBCA 1M2GA 1U9JA 4FS1A 2R2GA 3PP8A 1A9XB 1P3DA 5FPKA 5AW1A 2G0TA 3EK2A 2QN3A 5EKUA 5EHQA 2OO5C 4ZYYA 1M0WA 1YIDA 4MWOA 3GCGA 1OROA 1JEDA 2IXDA 1G21E 4YBRA 4EPXA 3WWPA 3OTHA 3UBMA 3ANXA 4P0QB 4QEKA 1N4AA 3M3HA 3U1BA 2XCAA 2VDRB 3DLPX 1AZLA 4RORA 1GTG1 4CG0A 4UBBA 3C3CA 4ARSA 4Q3AA 3VTAA 2V0NA 2WU3A 3WHPA 5BUCA 3KQTA 1TGYA 2PZJA 3SIWA 1BYUA 3O93A 2ZRFA 4M87A 2PDAA 4MFFA 4L57A 1RTKA 1G38A 3DXFA 1F06A 2D54A 1Q11A 3GVIA 4CHTA 1P7YA 4D92A 2VTBA 4F97A 3IIEA 1RPNA 1OH8A 4RZHA 1ZJYA 4K40A 2J9FA 3LX4A 5KYUB 3NO4A 5CG1A 4I1YA 1JEQA 4UVGA 3IEUA 2UVRA 1SC4A 5G0WA 3ZGVA 3TI7A 1ZD5A 3PJRA 4DNPA 3P9CA 2DFVA 3QKTA 3VR0A 3RBAA 5LOVF 2E4ZA 1YB4A 2YVKA 5IHXA 2VATA 4DA0A 3U16A 1H38A 4OXIA 1ZQPA 2FR8A 2PA3A 1AQLA 1OXBB 5HKAA 1OHHD 4J16A 1SCJA 2R4TA 4KTQA 1CUUA 4LFBB 1PSWA 3U7QA 3VRHA 4RNDB 5JO9A 1ZQBA 2HJ9A 7ICNA 5J0SA 5ALZA 2BCJQ 3GMDA 3T1TA 5LUAA 4ZT6A 5I9SA 4BX2A