3KZXA

Crystal structure of a had-superfamily hydrolase from ehrlichia chaffeensis at 1.9a resolution
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
210
structure length
205
Chain Sequence
SMKQPTAVIFDWYNTLIDTSINIDRTTFYQVLDQMGYKNIDLDSIPNSTIPKYLITLLGKRWKEATILYENSLEKSQKSDNFMLNDGAIELLDTLKENNITMAIVSNKNGERLRSEIHHKNLTHYFDSIIGSGDTGTIKPSPEPVLAALTNINIEPSKEVFFIGDSISDIQSAIEAGCLPIKYGSDILSFKNFYDIRNFICQLIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords HAD-superfamily hydrolase, subfamily IA, variant 1
publication title Crystal structure of a Had-superfamily hydrolase from Ehrlichia chaffeensis at 1.9A resolution
rcsb
source organism Ehrlichia chaffeensis
total genus 82
structure length 205
sequence length 210
ec nomenclature
pdb deposition date 2009-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.730 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 3kzxA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3kzxA01
3ZTYA 2FUCA 2ZOSA 5AM1A 3BA6A 5IS2A 4O8CA 1RQLA 3PGLA 3AR4A 3GYGA 1Y8AA 4NWIA 3HLTA 4G63A 2EATA 5ALPA 3U26A 4Y2JA 2BDEA 4I9GA 2MU1A 3QGMA 5AK5A 3M1YA 2AGVA 5AK6A 3L1VA 3ZWKA 4BNDB 4YH1A 2FPWA 3DAOA 1L7PA 4H1WA 5ALHA 1O08A 5AI8A 2W43A 4OD0A 5AM3A 2NO4A 3OPXA 3ZWDA 3QLEA 5AM5A 4EENA 2GO7A 2PQ0A 1Z4OA 4XQ0A 5AW8A 4KYTA 3AR3A 4NAVA 1N8NA 3AR6A 5AW6A 3FZQA 2IOHA 3AR9A 4HYTA 2WF8A 5A3SA 3NUQA 1T9ZA 3AR7A 3CNHA 3NIWA 5AESA 2I54A 3MN1A 4Y2VA 2ZBGA 3MMZA 1U7PA 1ZD3A 4UMDA 3M9LA 5AKIA 5ALFA 5FP0A 5AW7A 3OCYA 2G09A 5AM0A 2FPRA 4C4TA 3ZVLA 3P96A 4UU1A 2ZBFA 4F72A 2ZBEA 2B1QA 2I7DA 1RPZA 5AKLA 1VJRA 2C9MA 3KZXA 3WK4A 5A3RA 1TE2A 3L8GA 5ALSA 2FUEA 4BX3A 4RETA 2EARA 1RKVA 5IT0A 2IYEA 2P11A 1LTQA 4ZEWA 2JAUA 1FEZA 4AS2A 3DV9A 1Z4IA 1RLOA 2D2VA 2W4MA 3NAMA 4Y2YA 5ALRA 4DW8A 4HAIA 4F71A 3OCWA 3E8MA 5A3QA 4UMEA 2G0AA 2FDRA 4AS3A 1Z4NA 2YJ4A 4CNQA 2X4DA 2ZG6A 4KN8A 3AR5A 1CQZA 3QU7A 5AVUA 1K1EA 5AVZA 2Q4TA 3L0CA 3W5DA 2BY4A 4KNVA 3ZX4A 1RLMA 2Q5EA 3ET5A 2WHEA 3ZW7A 2GHQA 3EF1A 1QH9A 3I6BA 3K1ZA 3PDWA 4XPZA 5AKGA 3L1UA 3ET4A 3ZUPA 4C4RA 2RAVA 4FFDA 2P9JA 2G06A 4EELA 1MH9A 2HEGA 3FM9A 3I28A 4MUMA 4UMVA 3L8FA 4PNHA 3DNPA 2WF6A 5AI9A 5ALUA 2R8XA 4HGOA 5IT4A 3IB6A 2WF5A 1ZD4A 2B8EA 5AVWA 5AICA 3U19A 4Y2TA 3QUQA 3OCXA 2HSZA 1EK1A 2CFSA 4XE5A 3WK6A 4YCLA 2B0CA 4XOUA 1ZD2P 2OA0A 4Y2QA 4CF5A 5AVTA 5ALWA 1YMQA 5AIBA 1Z4JA 1WPGA 3L8EA 3EWIA 1Z88A 3NALA 3R9KA 1RMTA 3E58A 2ODAA 4UAUA 5AI4A 2HX1A 2G08A 2AH5A 1QQ7A 3ZX5A 4OCZA 1T5TA 2C8LA 4ZEXA 3IJ5A 2G1AA 1Z4KA 3WKDA 5AKHA 3U7EB 3D6JA 3QU4A 2OBBA 1NF2A 2YMMA 3A3YA 4BX0A 1RRCA 3WGVA 4BNDA 3KBBA 3QUBA 5ALZA 4UAVA 1Z5GA 2YJ3A 1L8LA 3L5KA 2P69A 2QLTA 2BDUA 5AI0A 5AW9A 1J8DA 2B1RA 3IRUA 2G07A 1RC8A 3FPSA 4HGNA 4UM5A 3ZU6A 2YBDA 5ALTA 1RMQA 3SMVA 5ALJA 2B8JA 3OCVA 4UASA 2NYVA 1QQ6A 2O2XA 1YNSA 3ZTWA 3B9RA 2HHLA 3N8GA 5AK3A 4HGQA 5AVQA 2ZBDA 5ALLA 1L7MA 2FPUA 5AVXA 2P27A 3ESQA 3SKYA 3W5AA 3ZVMA 1Q91A 4YGYA 1WVIA 1WZCA 3DDHA 1CR6A 4RESA 1L6RA 3MPOA 2C8KA 3QUTA 4CF4A 1ZS9A 1SWVA 2HF7A 2YMQA 4OHFA 2NO5A 4OFZA 3SF0A 1Z4QA 2HOQA 4UMFA 5ALGA 3WKEA 2OYCA 5AVVA 2B82A 2HDOA 3TLMA 3R09A 1NRWA 4L57A 5JJBA 3W5BA 2WF7A 1NNLA 5AW5A 1IWOA 2YFYA 3B9BA 4Y2XA 3UMCA 4EEKA 2RB5A 4E88A 1VFPA 4J2TA 2I34A 1YDFA 5ALQA 3R4CA 4J03A 2CFRA 3NRJA 1O03A 1U2SA 2HO4A 2YN4A 1Z5UA 2R8YA 2IOFA 1U02A 2JAWA 3OTQA 3I76A 3NASA 3ZVNA 1ZD5A 2ZXEA 3N1UA 3WK9A 5AW4A 4BKMA 4GXTA 3UM9A 2RARA 1AQ6A 4EX6A 2AUTA 4MWOA 4IFTA 5AKEA 3WGUA 1ZRMA 2JGAA 1U7OA 4YCNA 2HF2A 4BYGA 2I55A 3U7HB 3FGOA 3U7GA 2DQSA 5ALIA 2HCFA 2W11A 3NANA 2CFTA 3SKXA 3VAYA 1TJ4A 5AHXA 3N5KA 5T41A 3U13A 3U7FB 2YMLA 2YY6A 3QNMA 4HGPA 3PCTA 2FPSA 4Y2SA 4Y2RA 1RMYA 2R8ZA 4CF3A 2EAUA 4CE6A 3QU2A 1RKUA 4BEVA 1YV9A 3A1DA 2C4NA 4KX3A 5ALMA 1RQNA 4UATA 1SU4A 4KNWA 5AVSA 5ALEA 3QU9A 3PGVA 5AI5A 2OM6A 3KD3A 4HGRA 4C4SA 3E84A 4L6CA 3AR8A 4FYPA 1PW5A 3E81A 3ED5A 2WFAA 2FEAA 3I1YA 4B6JA 4JB3A 2JAOA 4UARA 5ALDA 1U2TA 1XP5A 5AW0A 5AVYA 1YS9A 2QYHA 1ZJJA 3EPRA 1LVHA 4I9FA 4NFLA 3OCUA 3QXGA 2YJ6A 2IOFK 3A1CA 3CZ4A 2VKQA 1L7OA 1Q92A 2PR7A 1QQ5A 1XPJA 4IG4A 3FPBA 4L6AA 5AW3A 4QQFA 4KX5A 3EF0A 3WKBA 1ZOLA 4NABA 3FVVA 4AP9A 4ZEVA 2WM8A 1SWWA 2B30A 4EX7A 1N9KA 1TA0A 3F9RA 3KOOA 5AKJA 1XVIA 3SLRA 5AW2A 4BBJA 2Q4RA 3WKCA 2G80A 2O9JA 3S6JA 5AKKA 2IA5A 3QUCA 1VJ5A 1YJ5A 5AK4A 5AM4A 4EZEA 4DFDA 1RDFA 3OCZA 4BX2A 2C88A 5AM2A 3QYPA 1TJ3A 4Y2PA 3WK7A 1Z4PX 3QX7A 3ZI4A 2FI1A 4YIHA 3A1EA 1JUDA 4UM7A 4DCCA 1L7NA 3W5CA 5AKZA 4G9BA 3KC2A 3UMGA 5AW1A 4DWOA 2WF9A 3B8EA 2CN1A 3ONNA 3SD7A 1S8OA 3BWVA 1RLTA 1J97A 1RKQA 3N07A 4NV0A 5AKXA 4UW9A 5ALOA 2YJ5A 5E0OA 5AVRA 3RF6A 3ESRA 3MC1A 5AIAA 3N28A 2I33A 4UU0A 2FPXA 2PKEA 1Z4MA 1T5SA 2HI0A 4GIBA 1QYIA 1X42A 4YCMA 5ALNA 1KYTA 3L8HA 4FE3A 1EK2A 4Y3UA 3HYCA 5ALKA 3RFUA 3WK5A 1L8OA 5ALVA 4Y2UA 4BEWA 2MSNA 1WR8A 2JARA 1ZRNA 3AR2A 3WKAA 2R8EA 3J7TA 2RBKA 5ALXA 2GHTA 2GFHA 3SHQA 4YIKA 3WK8A 2I6XA 4JDPA 3KDPA 1F5SA 2GMWA 5ALYA 1S2OA 3QU5A 4QJBA 1Z4LA 1TJ5A 5AKYA 2YMPA 3UMBA 5AI6A 3L7YA 3L0BA 2AMYA 3L0YA
chains in the Genus database with same CATH superfamily
3WOHA 3KXIA 1MGPA 3NDPA 4I50B 1Z39A 2OO7A 2JB9A 4E5NA 1H4SA 3W2TA 1EIWA 3VSEA 3SVLA 3ADCA 1U94A 2JKYA 3EXEA 2QRUA 4YY3B 2AMFA 4MVJE 1SV0C 2O2CA 2Q3LA 3AESB 1UM9A 2XSZD 2FE9A 2JI6A 4Z0TA 4QD3A 1ZMTA 2V97A 1S7GA 4KZKA 5CXSA 3VJKA 4L51A 4F3NA 1Q0UA 3ZVLA 2J87A 5J1TB 3I4CA 4RF4A 4G8BA 1UXKA 2CL7X 5JSZB 1H85A 4C2TA 1NW3A 1GRNA 2Z4TA 3CLVA 2IYYA 1BNCA 4F4XA 4A23A 1JI0A 1CUVA 3UUGA 4B6GA 4IHQA 2V58A 1ZKDA 1ZW6A 3ZXXA 4BVJA 1H0HA 2K6GA 3WYFA 2C78A 3PZRA 4BTLA 1B0XA 1R37A 3CINA 1WBDA 1SR8A 1BMDA 1Z8DA 2C5SA 3L0CA 4NICA 4QYMA 3MGVA 3EF1A 2HHQA 4YJ3A 3GLFE 2WRZA 3FR7A 2HA7A 3OLCX 1MSWD 4I29A 2PPVA 1CDDA 3B2NA 2WU3A 1RYRA 5AXDA 1ZGCA 3KG2A 3JD1A 1VI5A 3M6VA 3RUPA 4KO8A 2CMGA 3AY6A 1W59A 1DLJA 4NDAA 4ELVA 5DI3A 2BW0A 3K5PA 4BXOA 3LWMA 3MGCA 4LZOA 4EB8A 3NX4A 2IV3A 1OKKA 3K16A 5J0OA 3LDGA 1RYUA 4CCHA 3NM6B 2ZUDA 3SFTA 2DLCX 2NV0A 3EC2A 1OMOA 1IM5A 3OF2A 1CZUA 4IVRA 3BF7A 3K6SB 3RLIA 3IT2A 4QHTA 4RV9A 2FZ4A 4XZ3A 3LUJA 2G0TA 3TAXA 3IE0A 5AO9A 1ESCA 2C4HA 1KJZA 2Q5FA 2BGIA 4HDRB 1U65A 5A03A 4GMFA 3DE1X 3FZGA 4C7VA 4L9SA 5HIAA 2OWOA 1KEEA 2RK6A 3CUWA 3NBUA 1ESEA 1CUIA 4HUJA 1DXYA 4R8LA 5TY0A 4I99A 2Z56A 4GXTA 3VDXA 5BOMA 2YBEA 2AUTA 3PX2A 5BQ3A 3AQ4A 4UEKA 5K8JB 3SXJA 1U31A 3L0PA 4Q3CA 3G2HA 4UDNA 1OXKB 1NFRA 3IQFA 3SI7A 3U7IA 5J2CA 3PJGA 3SYRA 2GPJA 4Q1FA 3W4JA 3N6XA 3AL2A 1TCCA 2HU5A 4B48A 1L0BA 2WIFA 2PZFA 3RU9A 3EK2A 1ESDA 1DQZA 2BCUA 1FU7A 2ZDQA 4Q6WA 2WEKA 3PNLA 4V0LA 2W71A 1IHUA 4XLTA 2RGEA 1GPUA 5GTIU 3K9HA 3W2HA 1J4AA 1B1AA 4L9WA 1G17A 4YJ2A 1ZC3A 1M0WA 2ANCA 1CR4A 3M4JA 4I4TF 3UJDA 4CQLA 4WGFA 3KOOA 5KG1A 1J90A 2O9JA 1GV0A 1E0JA 1GQSA 1KA9H 3NWBA 3CW8X 1UMDA 4JASB 2QZZA 4JL5A 3M5WA 4Q47A 1U9CA 1XAHA 4RTMA 2Q0XA 2EGGA 1GSIA 3U3JA 3DAPA 2I6UA 3TAHA 4NV0A 2EHDA 5KCMA 1B73A 1RPNA 5KNDH 2C95A 1MX5A 2EW1A 3K1AA 4JH0A 1ESNA 2PD4A 3RFUA 1AO3A 5ED4A 1E6WA 2BAGA 3UK6A 2Q1UA 4MYUA 3N0WA 4ED1A 5C8VA 1UKVY 1LBQA 2DPJA 5JD5A 2GJSA 3AHJA 4OMFG 1M75A 4BO0A 2QM8A 3PYXA 3ZLVA 1S2OA 1FF9A 4B43A 2JHGA 3RYIB 1XFAA 1TRKA 3IDOA 2B6NA 4KE8A 3EIQA 3JASA 4QBGB 4RX1A 4IDCA 4O8CA 1L7RA 3I5YA 2V6BA 4MQBA 4P33A 2HCJB 2SKEA 2WSLA 3CCCA 3KXKA 3OT5A 1FW8A 4FCTA 2AGVA 3O7WA 4PR3A 4MMZB 2OOKA 3QKTA 3QTBA 3VPGA 5CLGA 5C1BA 1MPXA 3JYPA 3N2LA 2GWRA 3BWXA 3JW8A 1TZCA 5TR9A 4N5MA 3E7DA 4RU9A 3HKEB 2RJNA 1LNZA 3MTBA 2I7DA 4XQCA 2I7XA 2QYOA 1LQUA 3TS1A 1HKHA 4EMUA 2OBXA 4MO9A 4TTAA 2PL3A 4HWSA 1W9HA 3PNMA 3PNOA 5KG0A 2BPOA 5ISMA 5LMCA 3QX3A 4QQKA 4CF7A 4D4LA 2JGMA 3T4PA 4OFWA 2JFXA 2XQVA 1V7QA 1EFPB 4C89A 2HRRA 4N3NA 4POAA 3BRSA 3WHIA 5FX2A 4HH4A 1UPAA 1KNQA 2F3TA 3D8NA 4CYMA 1ZM3A 1JAIA 2YDYA 4LY0A 2Y71A 4P4NA 1IEVA 1WW2A 3FM9A 1WLYA 3BJMA 5J63A 4E1VA 2CL5A 4MDEA 3ONEA 2AOVA 4E03A 1PR6A 4RPZA 1DC4A 1R4MB 5HKKD 3FNQA 3Q2IA 4I28A 1ZH4A 1RQPA 1Q0ZA 3L0IB 4BRSA 1H6DA 4Q4CA 2WB2A 4G85A 5G5HA 4HDKB 1RWKA 4YACA 3T7SA 1VYHA 5KFRA 4C4ZA 3CZ5A 3LX8A 3IE1A 4HX5A 2HSWA 4C87A 2I8CA 1E3WB 3QG5A 3O4IA 3E8XA 1SVIA 5JCJD 2NACA 3NT4A 4L15A 2PGNA 2HGSA 3ID6C 5AXCA 2CLIB 3D8UA 1KDPA 5CGQB 3TGWA 5IXJA 5LKAA 2B21A 2QRKA 5JG7A 3VDRA 2O8DA 1A76A 3QV2A 3MWLA 1NJGA 3L7DA 4JI0B 4MNTA 1JQ5A 2XCTB 3MPUA 1O95D 3WP0A 4FKZA 5KG2A 4ZEOA 5HIKA 2DR3A 1ZMRA 1ZBQA 3ABSB 4X00A 5CWRA 3AILA 1PD1A 4DLUA 3LHSA 4JAVC 2I2BA 3B6KA 3IDAA 2DFKB 4UQGA 1NQUA 1RCUA 4I4TA 1HDCA 3QI2A 1KMCA 2FMKA 4NP6A 5JWOA 3LL7A 3FPJA 2YRWA 2ID4A 3S99A 5JYEA 2VF2A 3H9CA 5FXMA 2VHQA 1N92A 4K2AA 4Y6LA 1L8QA 1K9VF 1DX4A 3P45A 1H2WA 3H4DA 1S96A 4IDDA 1V95A 4V1CI 1L1FA 3IMKA 3UXYA 3SJZA 3FNRA 3TR6A 2O6HA 4DDVA 1XS9D 1ZQUA 2G4LA 1W5FA 2X2PA 1RPLA 5K8LA 1RZRA 1J8QA 4JKOA 3MEQA 3NC1C 3I9JA 2UYQA 2V7VA 5EJEA 4HS9A 4M99A 5IEBA 3O4HA 2IWHA 3COWA 3ENWA 4HAUA 4QO7A 4Q4AB 3T3IA 4QYIB 1IHXA 2QT1A 3ICCA 3KKLA 4JMPA 2ZYVX 3EF0A 1J0XO 1V9LA 5I51A 5K3SA 3NP7A 4HXEB 4WXYB 1SNYA 1NRJB 2P3LA 3AL0C 1CJCA 2EP8A 1SCNE 5BXQC 4E51A 2R1ZA 2VFAA 1XV5A 1C9JA 3NC0C 1UP6A 3V7KA 2FN9A 2FW9A 2QTNA 2JIMA 3ZCUA 4JZKA 5DNVA 2Y0PA 1M1UA 3A27A 4M9JA 3WRYC 1T8SA 3RAQA 4ZIRA 2FQYA 2V9WA 3DOHA 3U16A 2P35A 1YAJA 3MLBA 4FS1A 4KLFA 2BTOA 4L2IB 1QRRA 1D9XA 3F5EA 1PJ8A 1WCWA 1E94E 3ZH9B 3GG9A 5E2IA 3UIEA 4BB9A 1U98A 2H4HA 4JUAA 3BA6A 2JS7A 4C0XA 3A04A 4G0MA 1U0SY 2GNPA 3RBZA 1Q1QA 5C35A 3G8CA 4L27A 2QB1A 1V7CA 3T34A 1UDBA 2OLKA 5GONF 3ZE9A 2A3VA 4N54A 4AF7A 1LY1A 2VTEA 3L77A 3F8SA 2JASA 3HT3A 1P1RA 4W5RA 2YS7A 2Z30A 1RHUA 3RWMB 4G4SO 2IDZA 5FBKA 4KLSA 2J46A 1YE3A 2G1JA 2L17A 4FS3A 2R8GA 4LHWA 1XK6A 3FDZA 3KDAA 2GAOA 3IN5A 5K8UA 2GTHA 1YS1X 1PDVA 5EERA 1G1MA 3T3GA 1R8JA 5KFUA 1Z15A 2Q3EA 3ORFA 2BGUA 3F97A 4UVGA 3GU3A 4GSKA 1G18A 1TF2A 1U0HC 3QE3A 4YO7A 1RM3A 2FW8A 3EDYA 7ICFA 1DKQA 3TFSA 5EZ5A 4Z3DA 5KS2A 4H1VA 2GHQA 5C8DA 4CMGA 1PL0A 3W3AD 4LGMA 2W6NA 3BRWA 3VR4A 5EPOA 2XBUA 2REOA 4ZI7F 4F2HA 2NU9B 2XVYA 2JCVA 4O29A 3ENVA 4XD7D 1CY4A 3OD5A 4WKPA 2GZ1A 3FCUB 3TE6A 3F74A 2RGCA 1QH0A 5F2OA 1RWOA 4EUEA 3LDUA 2GCPA 2NU7B 4ARIA 4Y1EA 3BILA 1MRNA 1OLOA 3EQ8A 4R01A 2XYPA 1M2OB 3INNA 2B4YA 3ML1A 2NLOA 3C2QA 1ZI8A 4AJPA 1COKA 5L40A 3DUFA 2YH2A 3QUBA 1CR2A 1UXGA 1UBOS 2Y1DA 4X66B 3C97A 3K70B 2HNBA 4ZKDA 4BL5A 1L3UA 5THXA 3CRQA 2LKYA 1MBZA 2CLKB 2XOKA 2LYBA 4KO2S 2G67A 1NW4A 3KHSA 3I9FA 1A04A 3VZQA 2HNAA 4XJSA 1M1XB 4NSNA 4AUMA 3E70C 2Q50A 1X3LA 3EUEA 4XSHA 2J48A 5E38A 2XCUA 2OCIA 2P30A 1P73A 3OLZA 8ICRA 4DS4A 3AHIA 4X8LA 4EW3A 2F43A 5T6BA 3MA0A 5IAOA 5T57A 1BQEA 2RHMA 3WYDA 1Q57A 2PJDA 3M4NA 1S2LA 2IIPA 2Q7DA 4J9MA 1FSGA 4V0ME 1Y4SA 2VYQA 3R3JA 4PXYA 3SZRA 1H2AS 1XAIA 2PQ6A 4GZ3A 3DEJA 5DNEA 4KN7A 3LVBA 3H9BA 4QDUA 4OQ4A 2A9KA 1B15A 4CKYA 4FBLA 4MYRA 3BIJA 2B83A 3N8KA 4UATA 5FO1A 4CTMA 1F9EA 1EK0A 1HUQA 1IUNA 5TGDA 1JJAA 3PR4A 3U17A 3I1JA 4QHSA 1UDRA 3LQRA 1YNOA 4Q45A 4IIBA 1SJ9A 3PC6A 1WUYA 2ECPA 1X13A 1WQ1R 5KFDA 2OORA 4R31A 1PR2A 1JFLA 5EJ8A 3TRFA 4BE7B 4FWBA 1W5BA 3RCBA 2C88A 1O6FA 5FWYB 4AF6A 4NKRA 1GD1O 4OVKA 2X0FA 3AFHA 2FI1A 1ZQDA 1GUYA 1EVIA 1L7NA 3CSUA 5IBQA 3G59A 1C20A 3HJEA 1SUIA 3WXBA 2PMZF 3C5GA 4WL0A 1C0IA 1VBFA 2WWIA 4LOAA 1OV6A 2Z43A 3OD1A 1KOLA 1KERA 4LRYA 4UB2A 4H3SA 1PKEA 1QGAA 3LQQA 1R0YA 2AMJA 4MUAA 1K6EA 1ZMXA 1BN7A 2IWRA 2P4QA 2PV0A 1C3VA 4J7XA 3DCNA 3HDHA 2B7LA 2QAJA 2OZLA 3PC8A 2ZJOA 2BP7A 1SKAA 4MCJA 1ITZA 4H3KB 5JPDA 1F0MA 3MJCA 1YD7A 4BV9A 4DJEC 3KPVA 2OR3A 4NWIA 3MILA 1XVAA 4F8JA 5GP1A 8LDHA 4DLLA 1KMNA 3QOXA 4ZI7A 3PG5A 5KT3A 3BFPA 3C28A 1CUZA 3E5MA 5KU7A 4YNBA 4IQUA 4BNGA 3EVNA 4OLAA 3ETHA 3HI4A 2O8BB 2I8AA 3B7GA 3CWZA 2ZBFA 3EPPA 3PQEA 1TVKA 4IRUB 5KAPA 4G1EB 3W79A 4K0RA 1VJGA 2EARA 2BEVB 3GG2A 2R5NA 3V7FA 1L5MA 4EGSA 1NRXA 4A6XA 2AR9A 3WIUA 1CQIA 5HF9A 1OAOA 1I3OA 3M1IA 1JXEA 2F1HA 3NORA 3K4GA 9ABPA 2A94A 3UXHA 3ZBTA 3FN4A 4OJ6A 2W7TA 1RVDA 1YRYE 3DYIA 3ZI7A 2NRTA 3IKMB 4YXMA 1Z36A 2O1SA 4MZDA 2G71A 4DCPA 5ERYA 4EELA 2YV3A 3KQSA 1KI9A 1JECA 1ABBA 5B6JA 1F8UA 1GPLA 4DMKA 1HQYE 2J4DA 5C31A 1P5RA 3RV4A 5F3XB 4FYMA 5AIBA 3BSFA 3T3EA 3TFOA 3EEOA 4E5YA 3HXOA 2QG9A 1XLTA 4QECA 3KPWA 1ZQMA 3PC3A 4LF7B 4R1NA 3M6AA 4ME6A 1YS2X 3F6SA 3EXIA 2MT9A 3RB0A 5G4KB 4ENPA 3GL9A 3OT1B 5H82A 2PXAA 2C3OA 2F8KA 4EO9A 1M34B 5E2BA 1PT6A 4X7MA 4ADSG 4ED0A 1K5OA 5EE3A 2XRMA 1BD4A 3T9FA 3TSAA 4DIOA 1P9RA 1S8NA 3HN6A 4DWJA 2HOFA 1NR7A 1PG2A 5AOAA 8ICWA 3S5JA 4I5IA 1A88A 2KG5A 1X2BA 1A8SA 3JWEA 2LNDA 1KFSA 2D13A 3UW3A 3I45A 4LMAA 5ADUS 3GLTA 3M9WA 4OHCA 2BHTA 3PFKA 1OF1A 3L40A 1PK8A 3PNKA 2H2DA 4R8UA 1EFRD 4LC1A 1IZ8A 4B9TA 4W7HA 3HMKA 2W5UA 5FLKA 1E18A 3H0LB 3UM9A 2EEPA 3PEYA 3HU2A 3BMCB 5DN6D 4ILEA 3O3OB 1BWSA 5LOVF 4L4YA 1XSNA 2M32A 5DSTA 1O97D 1USIA 2J3MA 1GARA 3TQSA 5DCYA 2FWMX 4RD3A 3ZWWA 3AQEA 1RZVA 3L6RA 3LXRA 3GMDA 5F12A 3H0KA 1H2ZA 2YHIB 5AJWA 1GPDG 1FSSA 3FDFA 5KOJB 2HNKA 2YB1A 5B1SA 1ZHOA 4K4HA 4BWMA 3ZDAA 3KTAB 3L8YA 1MD9A 4JUIA 5FPKA 4WJZA 1GNSA 4XIYA 2VT7A 4FYPA 3BWYA 1NL3A 3A6KA 2QSZA 5EE9A 3LUKA 2QYHA 1IPHA 1X9WA 1WD5A 1XKQA 1S7CA 3JSAA 4DR4B 2ZQ5A 1AGRA 4Y18A 3CNOA 1CRZA 4EX7A 1N9KA 1VDMA 1SKBA 4KACA 1D2EA 3ANMA 2B7CA 2HMVA 3LFHA 1N5JA 2Q1WA 4FBMA 1NT2A 1GSHA 1Y9AA 1FE8A 3PUKA 4KSBA 4M0FA 3TKAA 2ATCA 1W6UA 1XZNA 3AK4A 4D4IA 1GRRA 4O1IA 4B35A 1VKZA 3ASUA 2I2XB 1ZGZA 3OQNA 1S0OA 1X7ZB 1IOLA 5ICEA 5K0LA 5L6LB 1IXKA 4G0YA 1W0CA 4DR7B 4XWKA 2VAMA 2R8KA 4BB0A 1GHTA 1DAOA 4YRLA 1WY5A 4KRGA 4ENQA 5D6NA 3RAPR 1ZI9A 3OTWA 3ES9A 4L5CA 2ZYAA 2GTIA 3N0XA 2AFIB 4LJ6A 2AI1A 4PX3A 5IBRA 4GM4A 2M6LA 1WULS 1JEOA 1U8ZA 3G9QA 3PHGA 1JLHA 1PP4A 1ZR4A 8ABPA 3UK7A 2ODNA 3EGDB 4AO7A 1BA2A 1QYDA 2NV6A 2CE2X 4ZQBA 4Q24A 3ZY5A 3HM2A 2KE5A 3D3NA 1BIFA 4I14A 5LR6A 1CEZA 1HUZA 2X8BA 4LJYA 1NVUQ 1Y3DE 4RHFA 1KP9A 1VRWA 3FI0A 3WGQA 5F33A 3NUQA 1Z45A 1ZYUA 4KQCA 5CDHA 5H83A 3SDBA 1ZK0A 4UD2A 3RC2A 3RJEA 1N6IA 3HJHA 6AT1A 2ZQYA 1FP2A 3IBSA 4CQMA 1DQNA 2PUBA 3WJAA 1ZQLA 1GNVA 1EUCB 1XCOA 3KZXA 3EFEA 2HA4A 4TMFA 4C08A 1XRNA 4QYXA 2FQXA 4TT3D 2YZKA 1THGA 3IUQA 5J2JA 2F3PA 4OATA 3WNQA 4GKBA 2G6BA 2BOVA 2P3SA 4S24A 3DCJA 3EISA 4MFCA 2GARA 2XWJI 4M7OA 2A88A 2IXEA 2E82A 3NEYA 3SU8A 3AUAA 3AFIA 3AETA 5FOXA 1XDGA 3BD8A 2Q4OA 4NXZA 1BNOA 1ILWA 3QYJA 1MDFA 4CFSA 1K0UA 3ZDEA 1T8WA 4EGCB 4C22A 1V6SA 3NHPA 2UYOA 3KLMX 3RUCA 4YUVA 1XMPA 1RTKA 4KMMA 5HX7A 1QE5A 4PIMA 2H7VA 4PNHA 2H5EA 2FJUA 1C7RA 4BP1A 1LSJA 2R6DA 3DAYA 4JFAA 1OREA 1QGYA 5ESXA 1LRJA 4TMVA 3FFAA 3S8MA 4TXNA 1VPTA 1EH5A 1BXZA 4RBNA 3SSMA 4D2IA 3VR2A 5LOVA 2QX7A 2QUBA 2QORA 4F5OA 4HLNA 4YAWA 2BD0A 4OGWA 1HMYA 4YAGA 2VOEA 2EJUA 5ALJA 4XH9B 1P80A 2BDPA 5BYBA 3JQFA 2J6HA 1T2EA 2WVJA 4CUKA 4DQDA 2FPUA 1TTTA 3KJNA 3DL4A 2O48X 5J5CA 1JE1A 2KN7A 4IDPA 1E1RA 2E1FA 1SBQA 1CP3A 4M1EA 1IXRC 1CHNA 2ZJZA 1SU7A 4MVJD 2ZETA 3PKJA 3Q0TA 1SC1A 5I7OA 5DN9A 5SYNA 1YZHA 5IXYA 5TMPA 4D4KA 4L76A 4DCUA 1RBZA 3TLGA 1JR3E 2VRWA 3S1AB 4NPCA 3WK9A 1A2OA 3C6ZA 4BX9C 2V4RA 1E2FA 1GFIA 2CHGA 3GFQA 1XTZA 4J0EA 4J0GA 2YYSA 5ALIA 4PC3A 4Q0MA 4Y6QA 5KFKA 1AC5A 4U7PB 2JGEA 2X8AA 3G2NA 1HNNA 2EBUA 3JU3A 3MZ0A 5ARCA 1OW3B 2WWHA 3DMHA 3I6YA 4GSYA 2LD4A 3UTCA 5TS2A 3LA8A 1NBIA 1V71A 4M37A 5CR9A 2RGWA 4RSRA 4EBEA 3P2MA 2W6MA 4KTVE 1Q0HA 5KMGA 5C0YA 1XC7A 1KQ3A 2LRHA 2HRCA 4JSTA 1RI4A 4LECA 5CXXA 4PSAA 1EGMB 1K5GA 1QCCA 3IMFA 1KK0A 4OI4A 4A8JA 4AY3A 5E9JA 4AYBF 3S1LA 4Z86A 2AIRA 3EVFA 1SWWA 5ECGC 4D42A 3F9RA 5SV2A 3H40A 1H0KA 2HU7A 3QUCA 4S1OA 1NWCA 3TI9A 1CZHA 1WUKS 4WBNB 2Y1IA 4CV2A 2OGUA 3IP4B 4PGXA 5COQA 2J8ZA 2G63A 4C8NA 2V1XA 3THVA 1TTHA 4CFYA 2YV2A 5CH8A 3O47A 1FU4A 1CKEA 3GJ5A 4E15A 1U5AA 4YRDA 1WRBA 1UPBA 1TK2A 1UT5A 4PE5B 1M7BA 3I9V6 2GWHA 4MTLA 1BE8A 1QANA 4OMDA 2HIMA 1XWFA 2AMYA 3BDPA 2GB4A 2Y68A 4DSFA 3I09A 4HXGA 3L3BA 4DEZA 1DJMA 3H7IA 1SK8A 5REQA 3O8QA 4U7WA 2C5AA 2C9CA 3L04A 3EWSA 2L0XA 2FN3A 4L9AA 2A5YB 4JJAA 3ISVA 4QU9A 3TIFA 4FFSA 4OREX 3L8DA 3AR3A 4UTOA 5TMBA 3CNQS 4EP1A 4FNAA 4MPJA 1PZGA 1TO1E 5SYMA 4KPUB 1PTJC 1YK0A 4WI1A 3L92A 2HSGA 2Q0ZX 4NV3A 4IMPA 4YRTA 2XKJE 1S02A 4LDAA 2YC2C 2FJPA 4BUGA 4ZU3A 5FBHA 2H57A 4V2UA 3W5HA 1NNSA 3FCEA 4IF6A 3FTNA 4LY6A 2QD3A 2RKOA 1WW3A 2V98A 2W90A 3PIIA 2A57A 2JIPA 3JPPA 1YOVA 1SVWA 3BGOS 4IRMA 4DANA 1F2TA 3A9CA 4ETMA 3WWDA 3PFBA 3ESAA 3OLWA 3MR2A 2QD5A 1K4YA 4FX2A 1L5LA 3OAAA 2ZCJA 1TTPB 2D1YA 3DVSX 2PGAA 3QA3E 2E4UA 1OYOA 3KU1A 5JDCA 1N9ZA 3E9YA 2VNKA 3KFVA 2A1JA 2MINB 4KWTA 5BYKA 3VZRA 3EY9A 4NDZA 3F7OA 2P3QA 4PVDA 4YJFB 4ZC1A 2HQOA 2LZ0A 4BO3A 4BU1A 2GEJA 1XTUA 5CP2A 2IQIA 2K4MA 3D4BA 3S7TA 2G1UA 1KH2A 5LBIA 4S1VA 5IIOA 1QMPA 2CT8A 4NJOA 2CCGA 5KFVA 1RJWA 3FOBA 1HT1E 4QSHA 4TM8A 3RS3A 1Z8HA 2O2XA 1KETA 3TPZA 4K6GA 3V1KA 3GLGA 4YRKA 2Y9PB 4Z6KA 1W30A 4XIIA 2C83A 1Y7PA 1ISMA 4EW6A 4I1YA 1I36A 3FUCA 2JF0A 2ZKIA 1G8HA 4UTNA 3VOTA 3V7YA 2OYCA 2UXCB 3MS7A 3EDMA 4ZOLA 1RTTA 4DY6A 2Y4OA 1KW4A 4AX8A 4H6PA 2BMDA 2Q1SA 1GGVA 3GGSA 2IOFA 2UVVA 721PA 5HRCA 1N0UA 3KU4A 4ZI3A 3GOQA 3KUCA 1ZO8A 4C07A 2R7NA 1C1XB 1NA5A 1NVEA 4EUSA 5DDIP 1W36C 4MQLA 4TXLA 5G5GA 1KTQA 3M6IA 5E9AA 3E6AA 1RQRA 4YQEA 2DQSA 1Q12A 1H8ED 4RL6A 1X66A 3X1JA 4KYVA 3LIPA 2NXJA 5A02A 2ES6A 1QOZA 1SUWA 9ICEA 3ESZA 4DXHA 2CCJA 1XCJA 1X7YA 1FFHA 1M2FA 3OE7D 3CRXA 2Z4RA 5C32A 1CY7A 4K9QA 1X7HA 5KKNB 4DMFA 1SU4A 3E9NA 4XGNA 1E2IA 4N5NA 3LC1O 1LZKA 4WZAB 2R79A 4IV0A 2AE1A 3SS9X 2Z6AA 1YB1A 3PLAE 1M2KA 3PXDA 2HHAA 2FE1A 1MFPA 2O8NA 1AKRA 1WHSA 2OZEA 4TZ0A 5EP4A 4RTQA 1JQLB 3SZUA 3IV6A 1YE8A 2X4IA 4C7JA 2X22A 2O8FB 4BB5A 2UZIR 4R71A 4ARZA 4OK6A 2W6ID 4WKOA 1TW3A 2QXTA 3M89A 1JXAA 1CIPA 4Z9FA 4GBJA 2CC2A 4E4YA 1S8OA 1O9BA 5LBUA 1G5QA 2WSIA 3LZ6A 5F9FA 5ALOA 3N7AA 3ZGXA 3RF6A 2DH6A 4YP5A 4KH0A 3C41J 4IRKA 4REQA 4QUDA 1XVTA 1E9VA 2XUJA 1FVXA 4RQ1A 5FR1A 1QVZA 5K0CA 3DZIA 2G5IB 2YWHA 3MXOA 3RABA 4MVYA 4EATA 3EIUA 4RWEA 4MAAA 5IK2A 3AHFA 4QU0A 3NVWA 4FGLA 4ECRA 2FCRA 2MDTA 4Z7QB 4GOMD 5FYQA 3EF3A 1D2NA 4KLOA 1NVVQ 2CDRA 1R6XA 2XA1A 1MAAA 4R69A 4DQXA 3T4UA 1OFIA 2W22A 3R5SA 3B13B 4HRAA 4O5CA 1DS6A 4KOEC 3JWPA 1T5DX 3LZDA 5AJTA 2X6QA 2CKDA 3STWA 3O8BA 4PWYA 3MRVA 5J4YA 3TW8A 1YDGA 1BPYA 1N8KA 2ZUTA 2QTZA 1Q1BA 1A50B 4XDGA 2K5UA 3B51X 4CLXA 4Z3KA 1R66A 5WRFA 2PZ8A 2FYTA 1ZG3A 4EIWA 2CJPA 2BGRA 3H83A 5DBAA 4KUHA 3L7OA 1NKBA 2AG8A 1AX9A 1BGVA 5HJ7A 1OX5A 1LB1B 3O2SB 1SBNE 1U0BB 1ZNZA 2KQUA 2FUNB 3ROZA 4XUSA 4EMBA 2ZROA 4IDQA 1L6IA 2GS9A 2NO0A 2JGDA 4B2IA 3I9KA 3T0FA 3ZV5A 1TYAE 4BMNA 5F98A 3KKQA 1KEVA 2OXRA 1P2SA 1SZHA 1YJCA 4RAOA 4D0SA 2RHJA 2XCPA 5IANA 1NK9A 4BFUA 4ABYA 1XWIA 5IKOA 5FBWB 3SJ7A 2IVFA 3M7DA 4LJ9A 3AOEA 3KVVA 4PTZA 2FWJA 2ETXA 1T2NA 1WSDA 2NYAA 2XE6A 2OC4A 4MQ6A 4LAFA 1VTKA 2OV2A 5BW8A 4X24A 1GCAA 2QMHA 1L4HA 3UXMA 2WKWA 4RDIA 1RRMA 4UUPA 1GZ7A 2Z9DA 5LLDA 2J32A 5DNWA 3ODPA 1KTVA 1SU8A 3W5AA 1PR9A 1KDYA 1QGZA 3V1LA 2V8OA 5T67A 1L5HA 4HAYA 2KKVA 3LUDA 5KG6A 4R1OA 4A0HA 2HHUA 3HACA 5KHOC 2W00A 3NYIA 2P9FA 4L5BA 4M76B 3EZNA 3BL5A 4GI1A 1KZGB 4N6NA 1DDIA 1WUIS 1ND5A 1HIWA 2QD2A 5CGZA 2YN4A 2QRMA 4BBAA 3ZCRA 2ZXIA 4G4GA 1EK5A 4F2DA 3SIPA 4PH5A 2C4VA 1SC6A 1QOPB 4QG3A 2VJNA 1T3LA 3IOMA 2O1WA 4RORA 2P6MA 3N7TA 4G5OA 1B74A 2BFBB 2HK7A 3E3MA 3PDHA 2JFFA 3CZCA 3I9OA 1U2GA 4UBNA 4LSWA 2Q62A 1WY7A 3LUBA 1KR5A 2EAUA 4HQ0A 4NK4A 3N70A 3T12A 4IL5A 1MOSA 3HNOA 2X8JB 3FCXA 4YGXB 5B1YA 3OO0A 3IV7A 5FUQA 4RQ8A 3BN3A 1JAYA 3Q87B 4YRCA 1ECFA 3KAKA 4YPVA 4XR9A 3OKPA 4CETA 3C6KA 3TI0A 2VEOA 1KYVA 2QAIA 3UJ7A 1LEHA 3TO5A 2XUQA 3QTTA 3DV0A 4X1KB 3O7MA 4FB5A 3GLFB 2Y05A 3TSOA 3WHPA 1E5LA 3X1KA 3OMWA 2O8VA 3AV3A 8ICUA 4PS0A 2VA8A 5C53B 3QZ7A 3N2GB 4ZQGA 4USAA 1W8IA 2ORWA 4TQGA 5LVAA 4MI1A 5AW1A 3ZDFA 2FZVA 1C7FA 3RVLA 1NN0A 4R05A 2RJ3A 1RAIA 4AZSA 4DDMA 4LY3A 3SQXA 4N0EA 2X86A 3B1YA 5IASA 1W1WA 4AU1A 5A05A 5FULA 1Z00B 4RFSB 1N1DA 4BVAA 3DVLA 4M1QA 2D00A 3UQ0A 5EHGA 4TKZA 2GOYA 1TZJA 2JI8A 4CDMA 4E5UA 4D5GA 1WO8A 4PLWA 3HKDA 3THYA 2QNRA 3Q8XB 4I2CA 4M9HA 1RYNA 5DGTA 4W5OA 3JAKB 1E2DA 3KALA 2DHRA 4ZVPA 4DA7A 3HLTA 3K70D 4BNHA 4JYCA 1NATA 4G1CA 2Q6TA 3G8AA 5DTQA 4MKHA 3V48A 2AC4A 1J99A 3RUIA 3CVXA 1OC2A 1V6CA 2CJWA 1KK3A 4YI5A 2X5OA 2JH7A 3USCS 3O9ZA 4S1TA 3UT0A 3H17A 5IDQA 3AVQA 2ZIXA 4X8HA 1CUSA 4H3HB 4OJYA 4Q3NA 4DGQA 3ZWYA 4BAUA 4CV3A 3AYZB 1XXLA 1R1DA 1P17A 2IPOA 3F6PA 1VJRA 5TQVA 4JGIA 2I3BA 1SVNA 2C4TA 2Y0EA 1NI4A 4PCUA 5JD3A 2PX8A 1NVKA 3HKZC 2EZUA 1KDHA 3ZDXB 1U8UA 3QHPA 5TMEA 4G0WA 3WIOA 3OF5A 3GGCA 1PT5A 1TKBA 1YZVA 5E6UB 1DRVA 4J9PA 4ZALA 4OK5A 2V6MA 2XADA 4PAQA 2OAEA 1YFZA 4FFBA 4DIBA 2OCPA 2QW8A 2O3JA 1GAQA 1J0AA 3BD6A 3Q10A 2HT1A 4RIGA 4RF2A 2XH8A 2QX8A 5GIOE 2VCYA 1UBTS 1AMOA 3ASZA 3HY6A 2OPHA 1NQOA 1CF2O 2AH5A 5JXWA 4MEAA 4HP8A 3B1JA 3H1AA 4CIYA 2B98A 2VAWA 1FSZA 2P4HX 1K88A 4ER6A 3WNVA 2ZUFA 3OG9A 3QH4A 4OOFA 1ZNXA 5EINA 2YYZA 4QVKA 3KXPA 3RSZA 2FAXA 2WIAA 1JQJC 1EFVA 5DBOA 3EYZA 4R8VA 3H13A 4IOMA 3T95A 1LRLA 3EVDA 4RZXA 5JDIC 4N6OA 4OAOA 4RKQA 1ULSA 4N5HX 3HXLA 3LUGA 2PYZA 1JMKC 3DZFA 4XSGA 2ZBPA 2HHCA 1QO0D 1D8BA 3BWCA 2AQHA 2W98A 4MWBA 2ZZKA 2EKPA 3EDOA 1Z5UA 1CY0A 3ECCA 2P6UA 3PEFA 4BO6A 2ROQA 2FG5A 4NM1A 4LRSB 4D4GA 3FPAA 5HK8A 3WO0A 4TX1A 3HA3A 4M86A 3B5IA 2YDXA 5C52B 3S40A 1NTOA 3DMRA 4IYJA 4S0XA 1AD2A 2X7JA 5IJXA 3FVTA 1ZXIA 1B23P 3NOVA 4WLFA 3P9ZA 3DLPX 5D2CA 1BAPA 5FJJA 3LL4A 3EGVA 4B2PA 1BHQ1 5BQXA 5CX4A 4IEIA 1RQXA 1PUJA 4TKMA 3IR5A 1F5NA 4ITUA 4AMVA 2DCMA 2GN4A 3RUAA 3UZUA 4CTOA 5KTQA 1AHNA 4Q9LA 2QV0A 2HDNB 4H0NA 4R1UA 4RQNA 1IIRA 1ZM2A 1JB1A 1ABFA 5KFZA 2GXSA 3ROQA 3PGMA 1KC3A 1S1CA 2KX7A 5EE0A 1W5TA 4FFRA 1JB9A 2PY6A 4LVNA 1V3VA 1XPJA 2J9FB 3M1AA 4REMA 8ADHA 1IBMB 5TQ0B 3PUJA 3D2BA 1X6JA 4DFDA 4DIMA 3LPMA 3WIVA 5JD6A 1U3FA 2I91A 1W0JD 1R18A 5G0TA 5HKBA 4YIHA 4TV8B 3S7ZA 4DCJA 2WWWA 2O1EA 1M6EX 1JAXA 3E9CA 5KFQA 2R2AA 4X5OA 3H8MA 3WNDA 1NUPA 3EH1A 5TC4A 4QGSA 1BX3A 5CB1A 2X0KA 1D6JA 1HE3A 3RYFB 3U0BA 4DYDA 3KJHA 1IN4A 3D7KA 1SB9A 1TQDA 3P94A 1R0SA 5A0FA 2XMSA 5KAMA 3QU5A 4QJBA 2QU7A 2FWBA 5FYDA 2HJGA 1CFJA 3ABRB 3LGXA 1OB2A 1U5CA 1V97A 4KLDA 1M72A 1O0BA 4ZCLA 3ADDA 3GV7B 3OZUA 3FETA 4BQQA 2OGSA 5TARA 2C2XA 2WOOA 3H99A 2G3YA 2YWGA 1G4AE 1U5BB 5K8CA 3TQHA 4D44A 4TLCA 3W6PA 3RJTA 3CH7A 4CEHA 3VA7A 2QS9A 1X9IA 1IPFA 3UGJA 2GERA 3TSYA 8OHMA 1HRDA 3EH2A 2QUKA 4YD2A 4D43A 2I5PO 2FTKE 3GPIA 4QT4A 3C8MA 3QELB 3G68A 2XB9A 4QXAA 1S77D 3Q4GA 3DA8A 3PEUA 3M6KA 4TTJA 5JU6A 3PSHA 1AQIA 5HXAA 3LNTA 2DFVA 3F3MA 2VDWB 5HCNA 2XTNA 1PFKA 3ORYA 4YAEA 3DBLA 2JIBA 3IERA 5BW4A 5EIAA 1OY1A 5KI6A 3BXPA 4B17A 3WL3A 2RI0A 1AS0A 5L95A 1U8AA 3JQBC 1AKYA 2C1EA 2FG6C 4CG3A 3BE6A 5LLTA 4CDRA 5KFXA 4L8GA 1CVLA 4A9AA 3H9GA 3KLBA 4WE3A 4WBSA 4GOXA 3O90A 2JDIA 4OTZA 1KBOA 3LHIA 2VC2B 3ZCQA 1CUFA 4LHVA 3LY8A 3VR1A 5DWDA 4IIYA 1FMCA 1NI5A 1MX1A 2NSLA 5F4ZA 3FOAA 1V8ZA 3H16A 4DSIA 3N5CA 1VYVA 3FHTA 3ABOB 4RNCA 3HCEA 1NI3A 4TXHA 3HGQA 1IQPA 2I7TA 4RMIA 3K94A 3L4SO 1J07A 2O8EA 1OR8A 4XA8A 3ONVA 2EX1A 4OG2A 3TNLA 3GHYA 4RULA 3ZZTA 3KSBC 1IQRA 4OMUA 4H27A 4A27A 3BD7A 3T3HA 1KVSA 4C7BA 3GIIA 3BTOA 4PLCA 1C3LA 1MKYA 4XAQA 4JXKA 1TAUA 1U4NA 3GXBA 3UPTA 3E0QA 2JW5A 4E88A 1K08A 3NI2A 3K1RB 2YFKA 4W63A 1IVSA 4M7PA 3WB2A 4JI7B 1U02A 2AHOB 3PB3A 2AOTA 2HRQA 3K5IA 3MCVA 4C0QC 6REQA 4JDUA 4FLFA 5JYBA 3C29A 4I55B 2V7QD 2IZ0A 4QSMA 1J33A 5IF3A 2A30A 4QXOA 3SR0A 4BUJA 2MOKA 2IU0A 1E1QA 3FYUC 4QJ5A 3MTDA 3OX4A 2P6OA 3KV3O 4EB3A 2BHRA 3IXQA 1WU8A 5LNK1 4P9NA 3LO8A 1P4HA 2PDAA 2BTQA 4D4JA 3LQKA 4F45A 1ZGGA 5JHGB 4ZHQB 2QIPA 4CKZA 4UB4A 5F78A 1ONOA 2HKIA 4YV2A 1LVHA 2QJOA 4A5SA 1KYIA 3INGA 3IDQA 3OZIA 4DQKA 1NXVA 2B30A 5HZHA 2Y0BA 2G7ZA 5IIIA 3TN7A 3DOIA 5CB0A 5SY4A 3N4MB 4TQAA 5EAIA 1AY0A 4I2BA 2ZUVA 2AQ8A 4F3YA 3IEMA 2IZOA 3QX9A 3N7UA 3NCTA 3FE2A 1ML3A 4MYSA 5EP2A 4UU0A 3SLGA 3MELA 4L85A 1T43A 4TTRA 1EK2A 4YXWA 4RQUA 4G56A 4JX8A 3CG4A 2HVHA 3DHWC 1BCRB 3V4OA 5B2FA 3BH0A 1A95A 2HD4A 1JWAB 2WFLA 5JECA 4YROA 1J0BA 4YP7A 2KPOA 3A14A 4A0GA 1M6YA 5D1NA 4EHFA 3ITDA 1YZNA 3UOGA 3SHOA 5DO9A 4ZQCB 1QGED 3BB3A 1JR3D 2IPNA 5AI8A 1W4ZA 3E7FA 4Q7JB 5JXJA 3WMEA 2ZB8A 3RKSA 1GPAA 4MH0R 3PE3A 3N7RC 2WF8A 9LDTA 2QTLA 1BPZA 4M0KA 1NJSA 1AGYA 3VPDA 4WEOA 3WB0A 1ULTA 4FNGA 3D54D 2IODA 5L3QB 1W46A 3N74A 1KL9A 2JLCA 2W4MA 5CVTA 1PRYA 3O1JC 1GZSA 4G5GA 8ICAA 1I10A 5JBIA 4NBKA 4XQ8A 1XKXA 4YUAA 3VPCA 4N7MA 4DJDC 1JZQA 1GR1A 3OZXA 3LCRA 1B8PA 4C4RA 4EI9A 4AWXA 5GINE 2BI8A 2GPNA 4UMVA 1XFDA 4MLDA 5ITSA 3D6VA 4W99A 1VYTA 4YV7A 3AL3A 5I8ZA 5EXXA 1Z5ZA 2AE2A 3F6YA 3HK2A 2CVFA 3SJUA 3R9KA 4HAOA 3ACDA 1EK6A 3O2JA 4LFAB 3PY8A 5GQSA 1P1FA 3H1GA 4IZ6A 4LOLA 4P3OA 4EITA 1JDVA 1RXYA 4V0KA 2JATA 1OB5A 2F76X 3KD2A 5JS7A 1IVNA 2ZRJA 4GAEA 1DC5A 1ZP6A 3TW0A 2Z8YM 3Q7QA 1K86A 1UPXA 4FSDA 1EVYA 2R48A 2RHLA 1V25A 5I6DA 2FKNA 1AVTA 2V8BA 4F4ZA 4EW1A 5C7LO 3SBOA 2XITA 2RONA 1FFCA 4P86A 4Q1BA 1FP4B 2OE2A 5GONA 1IHYA 2ZPAA 4MUJA 5F1PA 4ZPJA 3QEMB 3C21A 1RCFA 4EKDA 3QPWA 5C8YF 1B14A 3DXZA 2PO7A 2NU8A 4C04A 3UK0A 4K6KA 4ZZ3A 3AIKA 2VTBA 3JPNA 4RYLA 3BHNA 4QM7A 1WW8A 4KAAA 4H4DA 2WJ4A 5K4HA 3EXFA 1TNDA 3JY6A 2VPTA 1PNRA 4TUYF 4OL9A 5F52A 2YZ7A 4PIVA 5BW5A 1JR4A 4YVFA 2ZTUA 4DAEA 2DQYA 1VHWA 1BO6A 3BDIA 4JLNA 2OC9A 3HCNA 4KYIB 5DLFA 2WWYA 2A0UA 4WCFA 5JMOA 3GILA 2YIMA 5P8WA 2ACWA 5J5VA 1ZN7A 1MO6A 2OP1A 4KKVA 3ZJUA 4RVNA 1FBTA 1ZRHA 3LXMA 3KD3A 3HJFA 4HGRA 1KXJA 1C1HA 3AEQA 4NHEA 1E79D 3BH6A 1JJBA 4YMHA 5BSKA 3OIVA 1TAMA 1JSCA 4XJXA 1PWXA 2CLHB 1CB0A 4HRVA 3QVXA 2YN0A 2JC3A 1DC6A 2M1XA 2WM8A 4BKRA 2J6TA 2QPLA 4EJ0A 2F8MA 4DRYA 3QKRA 6Q21A 3KEFA 2QTHA 4N12A 4C3UA 3AM9A 4XIJA 1JQEA 1ZQFA 2VYFA 3ZU4A 1QLHA 5L4LA 4UNQA 2PTGA 4S35A 2N1RA 2WTXA 2IUUA 5AKZA 4QULA 5KNIA 1YT5A 2XE4A 1JI7A 1KI6B 3OQOA 2XIJA 4IJVA 1DP4A 2CF5A 2H5JA 3A8TA 1YFKA 5H4HA 1E7WA 3LQFA 2VAXA 4Q03A 4F91B 2D1TA 2W2PA 3P27A 4G0PA 3TW6A 4GKAA 2BFPA 2YR0A 3N28A 3P9QA 4ZDJA 4V1CB 5J0WA 1GZ5A 5E3JA 2OK7A 7ICUA 1P6QA 1XSEA 3EVTA 1RHMA 1N57A 4Z3OA 4X90A 1C5KA 4O5EA 1DC8A 3VYTB 3PQ2A 3K8YA 4QTTB 2DSNA 1QXSA 2QT9A 1FFVA 1RRFA 3UMBA 2RP5A 3JAWB 3WLKX 1EYZA 1GTRA 1ZGHA 1GPBA 1KSPA 3IL2A 1YMVA 2CJFA 1SXJC 2W54A 2H63A 1QHYA 4LZPA 1UDCA 2UXBB 2R96A 4GGMX 1HLFA 4AJ1A 4EY7A 4QTUB 1Q7TA 3B6EA 4C6TA 3C3PA 3ZEIA 2XUDA 2IV7A 3JQ8A 3N8DA 1DXOA 1NVTA 2L19A 3AB7A 3PUXA 3RTBA 5BVGB 5AESA 4I1RA 3DDOA 3BRQA 1NY6A 4BN0A 1FDTA 1LX6A 5KFGA 2B1QA 1FIQA 4WGGA 4IJWA 5C3UA 5BNWA 4JJZA 5IIMA 3LC7O 4CVNA 1DK2A 4II2A 3M6XA 4JENA 2QAGB 3DTTA 4A1FA 1E4EA 3L79A 1Z0IA 5DHUA 5L8VA 2YJTD 3QSYA 3VUFA 4MWCA 2OAGA 5AJUA 1NBMA 3EHEA 1QZUA 4KWEA 4JQCA 5TDHA 3GUVA 3OJSA 3KWFA 1DFGA 2XF2A 4L07A 3IMCA 4PZZA 3HILA 5IT4A 2BSQA 3WGJA 1R50A 1ZCAA 2DERA 3TI7A 2CE7A 3OQIA 2I7VA 3PGKA 1OXVA 4WBXC 1ZN8A 3AQFA 3R24A 3O03A 3RYTC 2HIHA 2Q21A 1TFUA 3TWOA 1Y6FA 4QC2A 4OXRA 2Q46A 4KPFC 1TYCA 3U7EB 3QY0A 4TUYA 2BVNA 4PPFA 1W93A 1N1EA 3FW1A 2ANBA 2WYIA 2CL6X 3RVDA 2WWTA 3GEMA 5CNIA 2KICA 3ZTWA 2BR4A 5SZHB 5ALLA 3BTSA 1ZL0A 2JFOA 1AB6A 4U02A 5KNCA 4PINA 3S68A 4MJLA 4F4WA 1EM6A 1EXWA 3VR5H 4CMIA 1RD4A 1QJ4A 3OWOA 5K3EA 5J2BA 1S1MA 3R0XA 6NULA 5JJBA 4IV5A 3O83A 5GTHU 1HWYA 1YS4A 2ODTX 3NWOA 2TSYB 4LNAA 2P2DA 1TEVA 1TUEA 1OAAA 9ICKA 1TJYA 1YCDA 2FETA 1BMFA 2ZWVA 4DRXA 3WGUA 1Y7IA 2FGJA 2FMIA 2GAAA 1ISGA 4WLVA 2ZM6B 5LU8A 4F6RA 2H07A 5LP6C 2DPYA 5I4BA 1X0XA 3U13A 3WGMA 2CXRA 4EAQA 4LC0A 4Z2AA 1LLFA 3WC4A 4A92A 3N87A 3R6DA 1QBKC 2GCOA 3R6TA 1EDZA 5DU2A 5HBRA 4WLUA 4FNMA 7REQB 4JB3A 2KBFA 2VZ9A 4NMMA 4PJ0U 5LA6B 3PE6A 3LU1A 1IY9A 3VSBA 4A4DA 4Z0HO 1JPJA 4YPOA 4ZRNA 3I39X 4BVFA 3FKSD 2NXEA 1IEQA 5AW2A 2VYNA 2CYBA 2DH5A 2AQIA 1WZNA 1UQUA 4FC7A 3UUWA 1SHKA 1YC2A 4A6EA 4NG5A 4A36A 1U0FA 3O84A 5IFLA 3DO5A 5JNVA 2K87A 3WSWA 1OHHD 3SZ2A 1OU0A 4WSOA 3R5JA 2VWGA 2NUTB 1AURA 3O74A 5BN4A 4FKBA 3UC9A 1V9CA 4B4OA 4K9NA 3SC4A 1UBJS 3DTVA 2TS1A 1E3JA 4MRAA 2XB4A 4X91A 3VKUA 4DJAA 2C96A 4A15A 3C4VA 4KAFA 2HIGA 5AMXA 5IAGA 3UUFA 4QAQA 4B73A 2H0QA 3DT6A 3EGWA 5JAQA 5C4IA 2EW8A 3AWDA 4B7ZA 2CUNA 3CVJA 1J39A 2Z5GA 3ZTYA 1XPRA 2QEQA 4ECQA 4DT1B 1MC4A 4WV3A 3E5RA 5KJCA 3TD9A 4CNBA 1V5EA 3RYHB 1T2DA 3DDWA 4FGSA 3SPXA 3FHOA 5FNVB 4DMGA 5AM5A 4GLXA 2VJQA 4MV5A 1XAGA 2X6RA 3WZMA 1HEYA 3UMSA 3T1TA 1BD3A 3G5LA 4R63A 3G02A 4DV6B 4FGWA 1DB3A 1KQNA 2RBGA 2DVMA 4FDUA 3N58A 2IZ6A 1YZLA 4EMSA 1G0NA 1OIWA 1LBTA 2ZBEA 1YTUA 3FTCA 2JLUA 3MRSA 4BNZA 5ALSA 1EZZA 3OU2A 4ECTA 5DXAA 2HF9A 1AF4A 1DAGA 1KY2A 4NCNA 2C5GA 2FKAA 1JTFA 1FYWA 4MXDA 4JN6B 5DGDA 2JVKA 1JEQA 3KVOA 2ZLBA 3VO2A 1OH5A 4ECXA 3WTCA 4NEQA 4DBLE 2HA5A 3WRXA 3C8UA 4FZ5A 2SCUB 1MB2A 1NP7A 3GJQA 4LBZA 4HQKA 4QWEA 5E7IA 3I37X 1YK1A 5JADA 3FNHA 2NUPB 1VRCA 1PUZA 4UM8B 1AS3A 4IP0A 4PQYA 1G8GA 3IT3A 4KV9A 4PL1A 3CSSA 2NG1A 2QQGA 3Q85A 4BNNA 2Q2WA 3NAGA 3KQVA 1PSWA 2FPPB 3ZZUA 3U3MA 4U3JA 3Q12A 3E05A 5KO2A 1V96A 2P77A 3VDMA 3ILHA 1OX4B 1EE9A 4BWJA 4IR9A 4K28A 2BKAA 4GR5A 5KDLA 2WKSA 3OU7A 2BF7A 5BW6B 4ND7A 3KKAA 2FWRA 2DQZA 4HB0A 4K9LA 3MRXA 4M53A 4CM3A 2HOQA 1YXMA 1L5GB 4R54A 1YAHA 2O57A 3G6WA 3HO1A 2BUBA 5H5JA 3ZWMA 2AXTU 4AYTA 3K09A 2Z5FA 2O3UA 2IHTA 4BATA 3SK0A 1WP9A 4L8YA 2QLFA 4EHIA 3ZVNA 3QLTA 3QM1A 3H5AA 2D1QA 2QUAA 2B5VA 4KV7A 4QUEA 4QZAA 1WCV1 4DSJA 1NR5A 4ZAXA 4KLGA 2FLNA 3HKCB 2E4ZA 4LX0A 1OH6A 3OE5A 1WD7A 1NSFA 1R0RE 3H6KA 3GW8A 1NMYA 4CPDA 1NHWA 5LQDA 4ELTA 1HTTA 2JRLA 1UF9A 1QKJA 1DXQA 3RSLA 2AR7A 1BDMA 3JD0A 2UVQA 3CMCO 3MB5A 1Y6QA 1YRHA 5F7JA 1R5NA 1RXVA 2YZNA 5D00A 1FVOA 3FOWA 3RB3A 3H3JA 3MJTA 5FV4A 4MJXA 5K45A 3WLPA 5K03A 2N1BA 3A32A 4IC9A 2Q3DA 4DLWA 3PDCA 3O4VA 1XCGB 3IEPA 3UQ2A 4NBLA 3GBSA 2D62A 3QLVC 3AVXA 4WN9B 3DEYX 5BPHA 1VP9A 3WLLA 4Q4HA 1SD2A 5KSPA 3FFBA 4DZRA 3U4MA 1K5DA 2GM4A 3MC1A 4QQNA 4RXUA 4HQOA 2CD9A 4J0JA 1L8OA 2H4XA 1H1LA 3O1HB 1PR4A 1ZRNA 3SNKA 2ZYSA 3AF1A 4MCAA 1ECCA 3KQKA 3NQ41 1Z4LA 3RH6A 4FW8A 1QO9A 1WAMA 4AXXA 3OFNA 3CS3A 2PRSA 4QQRA 2PA3A 5CXUA 1RQLA 3RJFA 5I7RA 1BHO1 1XTKA 1EX1A 1W29A 1A2KC 4YP1A 2IUTA 4DFMA 4PHTA 4C0JA 3GLVA 2XUKA 3V8NA 3HL0A 4ENVA 4R6WA 3I5AA 3U1BA 3VO8A 1IU9A 2FFJA 1IUKA 4M55A 2QL7A 8ICTA 2ATIA 2OQ2A 4XKJA 2DT8A 4H6XA 3ZXIA 3NVVA 1JEEA 5FTLA 2EDAA 1ULUA 2OCKA 1LNSA 1K6JA 3GVHA 4DLPA 1YVEI 4C0WA 1TF7A 1X7WB 1P3JA 4TT8A 3K1YA 3FMIA 4OJLA 3GRVA 3N2YA 4LVCA 4KFRA 1VPLA 3G9TA 5KBYA 1DO0A 3ETCA 3IDWA 1BJKA 4NPAA 2HBYA 3W7BA 2BIFA 2W6ZA 2D6FC 4UKDA 4YP0A 4DNXA 1X7DA 1KJ8A 4EBDA 3SJAA 2P9TA 4MWEA 4US1R 4EYIB 4QOSA 1CU1A 2FR0A 3OPMA 1MH9A 1PX2A 2H48A 2HEGA 5HIMA 1KJNA 3RFVA 4EUHA 1DAHA 1UJ4A 4MQEB 2GD1O 2WNSA 2XHZA 4MEYA 4BEJA 3ZJ4A 4EJSA 2C42A 1MA0A 4AG3A 4BLSA 1U9ZA 1XLUA 1WPGA 4UE3S 1ZGBA 2FX2A 2Y99A 4OFXA 3TL2A 2X0JA 5DQGA 4RIFA 1NSYA 2PL5A 2UZ1B 3I2GA 4HPXB 4U7CA 5DLPA 2JGRA 3WMRA 3IEXA 1GNLA 1CI4A 3DONA 4UPEA 3U4QA 4FYYA 4NU6A 2DGDA 3PDIB 1D4AA 1EA7A 3A1UA 4V2IA 1PZMA 5DLGA 4KMOA 2P4SA 3TK1A 2HMXA 1UZLA 4MVXA 3GC6A 3B36A 3BMQB 4YJDA 1E89A 2WW8A 1R15A 2VTVA 3SKYA 3H9UA 2PUVA 3PNVA 4GMHA 4OY3A 2QJFA 4F2RA 1TKAA 3ICVA 5KWEA 4AJ9A 3W1WA 5BV8A 3AHHA 4UMFA 2BFFA 3R09A 3H2HA 4D81A 1P18A 4WXMA 2XT9A 4BGEA 1K4MA 1NVGA 1ZQGA 4OJPA 3LOPA 4IRCA 3K32A 4D0GA 2PJUA 3IELA 4JJ7A 2OD2A 3OCJA 4JLMA 5DNYB 2AOWA 1OLUB 1P4JA 5EPUA 5JAMA 4IQVA 2QVGA 4B3JA 3C3YA 2BPFA 4O2BB 3E2EA 3R41A 2NUAB 2Y1WA 5DHAA 3TAUA 3UJ9A 1GQYA 4G0VA 1SQFA 4MK4A 3NHFA 3PFCA 2ZIWA 1ODLA 3PA8A 2E8OA 1W88B 1W4AA 3AEXA 3QU2A 4I9HA 1RKUA 5EHNA 4IINA 2C4NA 3X3HA 2H3QA 1GPH1 3CF6R 5EMMA 5AVSA 1DEKA 3D02A 1N63A 2WWRA 3VAZA 4WUTA 2QRQA 1TEXA 1IJFA 1UWCA 4IKOA 1O58A 4NLLA 4OYRA 5AW0A 3GJ4A 5DQIA 3QTLA 1DQYA 1ZCZA 4U7TB 5IN4A 1CUEA 2O07A 3FZNA 3RVKA 3I5XA 4CW7A 1JEDA 4O4LF 4C8MA 3VX4A 1SIJA 3MVEA 5IJZA 3CLHA 4UTPA 5CHEA 4NYIR 5BSRA 5HWSA 4IKPA 2QARB 4ZJZA 4JC4A 2R9VA 3D2LA 1D5CA 2KI5A 5IKXA 3D1VA 2A3NA 1ZQ1C 2P79A 1NVDA 2E8PA 3ZBUA 3FZYA 4FJ2A 3NHWA 4MVJM 4DCMA 4B9LA 5JS6A 4OJ5A 2HN9A 4KRXA 3K0SA 4UVDA 2D59A 1JKJB 2JHCA 4B4VA 5FL7D 1AJEA 2Q5JA 2RHWA 1FMTA 1QDEA 2IPLA 4ECUA 5CK5A 2DWCA 4LXGA 4FEAA 1NMSA 2QX6A 4BEWA 5ADHA 2FEOA 3S2UA 3GT3A 4GPZA 5B3LA 3AJAA 1SA0B 3KSRA 4YTEA 5ENDA 4W4TA 4AKSA 1M6HA 3DUWA 4XFKA 2FPKA 1IZ7A 5I4IA 3RANA 4UCQA 4IQGA 5JEEA 1KK1A 4DJJA 4H59A 2PCJA 2BHSA 4KFCA 4Z4CA 2IBMA 2K7ZA 4X1IA 1YQQA 1GOTA 3CKLA 3I6IA 3PVZA 4XASA 5GV7A 5BV1A 4P5PA 2GBCA 4COKA 4X20B 4X7RA 4Q1DA 4HLUA 4JBLA 3JPSA 1M73E 1BPDA 4PFQA 3I73A 2F3RA 1PR0A 5B5SA 3VU9A 1PK1A 3OO1A 3EULA 3Q3IA 1J2UA 1U7PA 1LDMA 1I1QB 3OQMA 1QRAA 1C8KA 5HF5A 4PZOA 3C16C 2P9ZA 2HC9A 2QD4A 1BOFA 3HUFA 2VRBA 5ALRA 3JQ9C 4U5XA 4DW8A 3Q5GA 2PS1A 4B0PA 4ETNA 1UANA 4IJMA 2MSWA 4PYNA 1KTIA 1P5ZB 1TM3E 4XCXA 4HBZA 3T7EA 4FS8A 4M9QA 1GLVA 4QDJA 1WXEA 3EZ9A 2W6JA 3ETLA 1M66A 4BQFA 2B25A 2HPVA 2NVBA 4N9QA 4LRUA 3RSFA 1FUIA 3JVDA 3M9NB 4IOKA 4ZJUA 1U4SA 4XOUA 3C5EA 3T5CA 3CLRD 1KI8A 1AHIA 1NUAA 1M8FA 2FEPA 4PF1A 16PKA 4KQFA 1OBCA 1Z6PA 2CXHA 1UINA 2IHJA 5J2UB 1F3LA 3E7PA 2AC2A 5CJ7A 4BVGA 1YRAA 1DKNA 3THSA 4IM7A 3W2EA 2X8LA 1N34B 3MERA 3Q8SB 5CJ2A 1V8OA 5MHTA 4EA9A 3FRJA 1DCKA 2POQX 3NGDA 1R4NB 3MWJA 4FEYA 3N8GA 5I7FA 2IHBA 3UAYA 1SMKA 6ADHA 1DAPA 4KUGA 3A06A 3MT7A 4P7JA 2L2QA 4X3OA 3BX1A 1ZS9A 1PS8A 4H7EA 2FGKA 2WR8A 3QUAA 1JDZA 1R0KA 3WB9A 1CDEA 1DBIA 5D84A 1WKBA 1AV6A 5B12A 3ZD6A 3PIDA 2Q9UA 1VRVA 4JJGA 1T4CA 1UT6A 5FV7A 2LBPA 3LK6A 4S1PA 1SH7A 1GL6A 4IGKA 3D5TA 1PJRA 4QE3A 5KT4A 3Q3EA 2NZWA 4DNPA 3KQNA 1P4GA 2OXEA 4GLFA 5FWXB 1QVVA 2CLEB 3T41A 4P0QB 1YC5A 4URWR 1AUXA 1XEXA 4EB6A 4DSEA 3F98A 4YJHB 5LXTF 1ZVVA 4DVJA 5JANA 2XNDA 3VC8A 1SGGA 4NMHA 1W5AA 2ZWMA 2AYZA 2CXTA 4FU0A 1KP2A 2R00A 1QMGA 1E96A 1X74A 4N5DA 4BN4A 1S9FA 3MLEA 1PYGA 4L6CA 1PUIA 1PW5A 4FCWA 4B81A 5JXIA 4FMBB 3IV9A 2Z3WA 3PZPA 3E9ZA 4M6WA 4B71A 1NN5A 4RQMA 5YASA 3PXXA 1FA9A 5CCXA 3TNDA 8ICIA 4Q9DA 4CIXA 2VQ3A 3IO5A 4B0OA 4MS1B 4N8DA 4BAZA 5A3JA 4AIIA 1PDWA 1ODTC 4DCCA 4KDRA 2K2WA 2QRGA 2GAFA 3BERA 3RE1A 1VKRA 2Z8XA 2BSAA 4QDTA 1SIWA 3KB8A 5E0OA 2ZT6A 4UBIA 5JQGF 1NLMA 3VFDA 2FPXA 4EKYA 1T5SA 4C05A 3X2FA 3K9QO 3LWNA 3GFVA 2JJ1D 2G6TA 1YJ8A 3DZJA 3UAZA 4CKEA 4B3GA 2AFHA 2XCIA 1VHQA 3OHBA 5I7VA 5DF1A 2R8OA 4R9UC 1GAEO 5DEOA 5DNDA 2H4ZA 4AC9A 1QCDA 1GCGA 1JLLA 5AKYA 1YSCA 4WKCA 4EKEA 1NP3A 3WFIA 1T91A 2JIZA 2VJAA 5KC9A 2XRZA 4DWVA 2VQDA 2VNJA 4ATNA 4OHUA 1W4BA 3E1KA 3M5PA 4XUDA 1DC7A 3CN7A 4JNKA 5AK5A 2W37A 4EZ9A 2ZBUA 2HA2A 4ASUD 1KPGA 4PHHA 3HJTA 4W1RA 3IJRA 2L69A 2KK0A 5CM8B 2I99A 4K0KB 2GBGA 1WLSA 3GT4A 1BZYA 4NBWA 4X61A 2Y1EA 1ORRA 1I2DA 3A4VA 5IG2A 4RQ5A 3DWGA 1DTEA 4HNTA 4P3YA 1TE2A 1E1DA 4NBUA 2AEJA 1K6IA 4AZ0B 3IEVA 2DUUA 4ZVQA 4QPDA 5JISA 2DPLA 2IHZA 1X2IA 1XQYA 1W25A 3KOYA 2KFNA 1XYYA 1CQZA 3STTA 3VPHA 4EYHB 3RS4A 4YYEA 5I45A 4L8LA 5EWMA 1PQYA 2O7NA 2BHNA 3O4GA 2FZEA 2P1ZA 1V37A 2Z0MA 3NCHA 3L46A 1E9EA 3C70A 5E6RB 4QNRA 1HM5A 4BLWA 3ASYA 3KO8A 4Y0AA 2VXOA 1XTBA 1A7UA 2BKEA 2VXCA 4IDBA 3D2NA 1RLUA 3WWOA 1RADA 2C9ZA 3EVEA 5CFOA 2NPIA 1RMTA 1K8ZB 5K4LA 3NVYA 3I2JA 5KAIU 1S01A 2FP4B 1QRUA 2IYQA 5TISU 1M7HA 1PR5A 2X3YA 4BNVA 3DLIA 2C2ZA 3ORQA 3ORRA 2HJVA 4CZ2A 1IXZA 3AONB 1KEPA 5FQOA 2VIIA 4GI5A 4P31A 2CMKA 2A67A 4FZVA 1NQTA 2MR6A 1KJJA 5LXTA 2HBKA 4CEIA 3QQPA 3SYTA 3ESQA 1INLA 1X1RA 3BQMB 3OOSA 4MB2A 4BQNA 3SEFA 1L6RA 3PTZA 3TFQA 3T5AA 4JJIA 4FXPA 1EVZA 2R8PA 1JQ3A 3B6MA 3FB4A 1URPA 2QE7D 4N76A 1X1SA 2G17A 1WXFA 4ZVRA 5J0RA 2W8KA 3CRZA 2JH8A 1E6EA 1EZ1A 3WYNA 3WLQA 3HBJA 4QREA 4MB0A 4RVDA 2Z6UA 3UXOA 5BNIA 4RUKA 3OEEA 3CP8A 3GT7A 4GYYA 1UMCA 4R1SA 1LFAA 3FNBA 4WINA 2ZTHA 1OXXK 5EJGA 1MC8A 2ZFUA 1ZZGA 1OWOA 2NT4A 4NQZA 3PYMA 3ZN2A 4O2AF 4AJ2A 3WZ2A 4KX3A 1M6NA 4KVFA 3MK31 4RQ4A 4M0AA 1B00A 1YI0A 2GCGA 1ULHA 1JX6A 4Y2GA 5TVGA 5IMBA 3NETA 2BFDB 2VJCA 2PI4A 3NEPX 1TM2A 2XA2A 1DOHA 5BT8A 1JLRA 5JZBA 3LT4A 1PX0A 3BSSA 4KX5A 1V8PA 3R40A 4KXFB 4D6PA 2H7YA 1E0SA 4WT7A 3K8QA 3C23A 3IT1A 3BSWA 4EY3A 3EQZA 1XPOA 2APJA 1M1YE 2J3DA 3GLSA 1N5KA 2J7PA 1Z0JA 1SBHA 3GJ3A 1DWOA 5BV0A 1QF6A 2GPYA 4B6RA 3COJA 4BFZA 2ZZNA 1A9TA 4WNCA 4KZPA 5KFTA 5FPTA 1AU9A 3ELWA 2RK3A 3ZWOA 1JBQA 3OEHD 2WA2A 3WKAA 1C0EA 2KJ9A 3U4GA 3VPFA 1N2BA 2EOAA 4M0MA 4ECZA 2D1RA 4AX4A 3G2MA 1GPYA 2BUAA 4I4LA 5THKA 3L0YA 1IY1A 1XDWA 3T5GA 7ICEA 2B9VA 3BAZA 4HHEA 5DNUA 4IILA 4MKFA 4E22A 4JQSA 2A58A 2WI8A 4QUIA 1LPNA 3NVAA 3ETNA 2NZYA 2WHQA 3I61A 3QIVA 4WRRA 4XB2A 1GNPA 3T79A 4ALMA 3PSTA 4DV4B 5TGTA 2QVYX 2MSEB 2C2EA 5AYVA 1YJAA 2E49A 5CH3A 2DPMA 2XGGA 5CCEA 1M2JA 2J3EA 4TWAA 1SXQA 3MT9A 1CNMA 3W6UA 2QSJA 1Y1LA 5CA0F 4FDMA 3M9XA 1LXCA 4L5AA 1V38A 1UKEA 4MUFA 3EMBA 3A0HU 4LZGA 4ZCIA 1YA6A 1HG1A 4KRFA 2P68A 3NAMA 2HDHA 1PYDA 3AG5A 1JEYB 1U48A 4RH0A 2VHTA 4LVSA 5KNBA 3UICA 2R6FA 4QOIA 3PPVA 1F8YA 2OSVA 3ZX4A 3K71B 1KH3A 1FRFS 1SUSA 4F12A 4MINA 2NV3A 1I51A 1BU8A 5DOVA 2C2MA 2NZ2A 4L0DA 4R1LA 2R8XA 3W7VA 3WLMA 2A9JA 5K0ZA 4ELUA 3Q8KA 1L3TA 1Q3UA 4G01B 4B2YA 2RDMA 3T61A 3L84A 1A77A 4KWHA 4RA6A 1Y82A 7GPBA 2Z6VA 1JXOA 4Q7QA 2XCRB 3M4ZA 4E5KA 1E5VA 2IEAA 2HHVA 4XWGA 4GU5A 2G1AA 1LV8A 4JP5A 3BXFA 1EP1B 1KYYA 2NO1A 2EKZA 4DPMA 4FIZA 5IDVA 2JAQA 1L8LA 5H3LA 1D3AA 5E79U 3GEIA 3VH1A 2Q7OE 2YBDA 2DHCA 4YRIA 3IM1A 4XX0B 4ARSA 2JJ2A 4H77A 2HUNA 4IWYA 4O2AA 1W85A 5EYPA 2OPBA 1NW9B 1Y63A 3TOSA 5JQWA 1A0PA 2WNHA 2C2OA 5HM8A 1X1AA 3VO1A 4DCNA 3FA2A 2RHGB 3U3ZA 1NRWA 3Q11A 3H0MB 3KRTA 4FT4A 3BXEA 2WF7A 2I76A 1U1DA 1K66A 2NVUA 2BPGA 2V5AA 4WWHA 2WPNA 3DO8A 3S2EA 3UF0A 1DDGA 4JP2A 5EJ7A 2CVZA 3BFJA 2ZJFA 1L4UA 1CD5A 1D4ZA 3M7IA 4INOA 1K1QA 1NZBA 3KELA 1E2JA 4D9EA 1YUNA 2WFZA 1CY6A 1BCSB 1QIHA 1SKMA 2ZYRA 3TX2A 3W2IA 1WPQA 3VH2A 1LX7A 4D3FA 2A7QA 2YMLA 3IP7A 4Y2SA 1HYHA 3HCBA 4BQRA 1JG4A 5IJ9A 2H17A 3UJAA 3ZLTA 2HUPA 5KG5A 3RSSA 5GVRA 4HYQA 1GGHA 2VDNB 5EQDA 5G0SA 5F4BA 3WQQA 3A4MA 1LW6E 1F6DA 3LCMA 2GM3A 1ZJJA 3KSUA 1FQKA 5EMJA 4N47A 1Z1VA 3F2DA 4D9HA 5IJWA 2C7OA 2BM0A 3F6BX 1KMHB 1CJMA 4ZEVA 1DAKA 1YQDA 2B4KA 1NXWA 1IAVA 1TVAA 1CRWG 2DHQA 3H1PA 3T3DA 2HB6A 1GRCA 5SICE 3QUSA 3ISTA 3HO6A 1MQ8B 2JHFA 1W4LA 2GJ8A 5GV8A 1FFDA 4TKVB 1F51E 4HNAA 4OKNA 1IJEA 9ICJA 3MHPA 5FI3A 4LHXA 1KKLA 3DVQX 5CA0A 2FN7A 3HO8A 2C5EA 2IW1A 4O8ZA 4FSXA 2PRYA 5BOSA 1TMOA 5IUNC 4Q9HA 3QFSA 3MGIA 3E0FA 4EUNA 1AV7A 4US0R 4KLHA 1CC1S 1VG0B 4O1MA 4FHFA 3W90A 3QI7A 1H69A 4NVRA 2PBZA 2GCNA 3AKCA 5JYCA 2EF0A 3AR4A 3SP1A 4NJEB 2PX6A 2Z5LA 4DUYB 1MOQA 5K6TA 2WUGA 3PHJA 3ON5A 1T6YA 4F4KA 4L8VA 1GEEA 1BDHA 2PKCA 1LV5A 2PI5A 1YZUA 1X80B 5B2ZA 3KZOA 3VZSA 3UV7A 4QBTA 3U56A 1GRQA 3BXXA 4ZARA 4ZPXA 3W9UA 2JLZA 2XIDA 1CS0B 5KG3A 1SBYA 3LW8A 1QYWA 4L3OA 3DWFA 4HAZA 1Z4IA 1EZ4A 3ZE2B 1ZJZA 2D0OB 4WESB 4BNUA 5HMMA 1M8JA 2R8IA 3N6VA 1VGRA 2J09A 2OBMA 3F4BA 2KZ3A 3C3JA 2J08A 5CA1F 1MCZA 2VPYA 1MA7A 4YXJA 3E0XA 1MO4A 1XZDA 3IQGX 2CV0A 2PXHA 4ZDKA 2VEDA 4EHDA 2KKPA 1RM0A 4DLBA 5EY5B 2Z3ZA 1RJ9A 1Y3FE 5DISB 1Q20A 4WXEA 5I3CA 4UU8A 3UKDA 4MWGA 1NF3A 4MEBA 1M6WA 2WM9B 4FEGA 4GLOA 3VHQA 3WV4A 4WNIA 1WPXA 2I67A 2VQSA 4K46A 4JP3A 1O94D 2IW3A 4DQQA 3ZLUA 3BZKA 2E5FA 1CUXA 4MP6A 3BS5A 3A6GA 2MCFA 3GQVA 1P1KA 5KYYA 4EG6A 1PZFA 3AW8A 4D97A 1QAMA 4E6PA 1KZ7B 4CM1A 3ZXYA 2A5GA 1E20A 1GTL1 4DREA 1RAGA 3GNTA 4KUEA 3CJTA 2E6KA 3IOEA 2OORC 2H92A 1KSHA 4TMYA 1C0PA 4GNRA 4I81A 3D3JA 3G6YA 4KRYA 5IJ0B 3SHWA 3DZKA 2XMDA 3H86A 2GZMA 3GGGA 3JRNA 2J5QA 2QK4A 3WDMA 3KKNA 3H04A 3CZQA 5IINA 2Q1YA 5KFEA 3HUUA 2BZGA 4E4TA 4MTCA 4LMBA 1UJNA 1JHPA 3VU8A 3MJRA 2O0HA 5EE5B 3G3EA 4MW4A 3DEKA 1K27A 4M9LA 2GJKA 4K6FA 4LSGA 4Q7KA 2B8NA 1YULA 3PC8C 3FWZA 3C7CB 4IIHA 3VR3D 3SSAA 3N9IA 4U39A 4H35A 5KT7A 3O8RA 2WMOB 2XW6A 4NNPA 1MQ2A 4TSKA 7MDHA 1N25A 1P9NA 2ZIFA 1QC5A 2HIAA 8ICVA 2WG0A 4IMJB 4Z6EA 2XQJA 4HWPA 4MJ7A 1SKYE 3NNNA 4HDNA 4XWOA 1PK7A 1J24A 4TM7A 3V97A 1WMBA 2YVUA 1GA4A 2WZDA 4DSOA 1ZM4A 4GMXA 4NULA 3MAGA 5K3FA 5CFQA 4N3AA 2WJJA 5TF0A 4EZEA 2OG2A 3MWDA 2DR2A 7ABPA 5KYUB 2B7BA 1CQWA 2C2GA 2OP0A 2QB0A 4DLGA 4G07A 2X1HA 4YLEA 4QLAA 3OLYA 2CEKA 3SD7A 2YRFA 1A4UA 1P74A 4JV5B 1L3SA 2BZSA 4JJ8A 5EMHA 1SU6A 2IUFA 1FDVA 1OAOC 2WSSD 3FD8A 2BEKA 4I3HA 4F2SA 1RXEA 2A1TR 3E23A 5L1JA 4TSFA 3AG6A 4X95A 3C7KA 2YW9A 4UEQA 1V5GA 1RAAA 4RA9A 1IN5A 4Z51A 3L6OO 4F56A 5L3SA 2ZVJA 1G16A 4CI9A 4TTQA 3TRJA 4ML3A 1QIKA 2O20A 4C76A 3HCPA 3HKBB 3QOWA 1XZEA 2JLRA 2PMWB 4Z6FA 5C8YA 3EW7A 4CLOA 5CA1A 3IG5A 1KVRA 4FOOA 1CEYA 2J6BA 5L1MA 3K1JA 4Y6SA 4KK4A 3VJLA 4BNDB 4D6XA 5DGBA 1Z1BA 2OV8A 1N7HA 4QUBA 4GICA 2PMCA 4F38A 1PJ3A 4FMDB 3IBCA 1XELA 4W5WA 2GSDA 4GX5A 3UT5B 4WFKA 2ISOA 5K0EA 4CIAA 4NFYA 4BMOB 4AK9A 3JVIA 2FSPA 2ZBGA 1MT0A 2ZYWX 3W6OA 1XDZA 4RLSA 1RP7A 1AKTA 3L9WA 1QHIA 1PL8A 2QTTA 5KTPA 4IFBA 4QHYA 4DIUA 4KPEC 3C4JA 3KZ1E 5KWVA 2VJMA 2JK0A 1E7RA 2AG6A 4DILA 1MUUA 2SKCA 4G97A 4AN0A 5A2GA 2MYPA 1PIWA 2BI4A 3ANNA 3KYBA 2BN4A 2RIPA 5JZMA 5CLLA 5E4JA 5HE8A 4F1JA 1DT3A 3SFVA 2BCEA 4UUAA 1VPEA 3OE1A 5HZGA 1O5TA 1Q14A 1X39A 3BK1A 3O1LA 3NFRA 4ECYA 5GY7A 5J4KA 5IIJA 5AICA 1US8A 1C0KA 1Y5NA 5IRCD 3OX3A 1S3GA 4RDXA 4IF4A 3EJWA 1MV8A 1ZJ4A 4EY4A 2ZAMA 1ZUNA 4Q9KA 3A11A 2RK4A 3AEUB 3AZPA 3LAWA 5K0FA 1D1QA 4R7GA 5ABPA 1UM8A 2B1RA 1JS1X 4QIHA 5ECWA 3SF8A 3ZU6A 4QEDA 4G09A 4N8SA 3ZHQA 1II8A 2W2LA 4B9VA 3DNFA 4ND4A 1RHRA 2IZ7A 4GX1A 2IQ5A 5TPZA 1K5PA 3PCXA 1PJSA 1WVIA 2E21A 2P9EA 4OXXA 5CR0A 5GJWC 2PZBA 2IYFA 3H2BA 4FDLA 1RHKA 1FQWA 5AVVA 4B6OA 5LDHA 4C8OA 1FC0A 3VTKA 1DJNA 4YQFA 2BPCA 3UWSA 3JPOA 1QS0A 1XGKA 2WUDA 4CT0A 3VYSB 2HR1A 4N4AA 1CDOA 4DOAA 3QRWA 3G1TA 2XB8A 4CCSA 4NZPA 3UHJA 2WD7B 4A03A 2WAYA 1VMEA 3FOEC 1L4LA 2FUG1 4J0IA 3W4IA 4ER3A 4PPXA 1GT91 1UC9A 1KS9A 3QWAA 1RAHA 4YMNA 3R6WA 4MKXA 1J1ZA 2A35A 3WSVA 1P8JA 3PCTA 5D6OA 4NLGA 4LYEA 4HN9A 4LXXA 1OPXA 2ZB2A 1H8HA 5DBFA 5LN1A 2LDXA 4OPMA 5T64A 3BQTA 4I19A 1H9CA 4MROA 2HCRA 3AR8A 1ONSA 2E1PA 2XIQA 4HX2A 3QWBA 2R2GA 1G4HA 4P7FA 4J9UE 3IQWA 3ZE1B 2ZIUB