1LKYA

Structure of the wild-type tel-sam polymer
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
77
structure length
77
Chain Sequence
SIRLPAHLRLQPIYWSRDDVAQWLKWAENEFSLRPIDSNTFEMNGKALLLLTKEDFRYRSPHSGDRLYELLQHILKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTION FACTOR ETV6
publication title Native interface of the SAM domain polymer of TEL.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 24
structure length 77
sequence length 77
chains with identical sequence C, E
ec nomenclature
pdb deposition date 2002-04-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 1lkyA00
2QB1A 4RQNA 1B0XA 3SENA 2L5YA 1PK3A 3BS5B 1SV0A 2D3DA 3IDWA 1SXEA 2JV3A 2ES6A 4NL9C 1SXDA 2K60A 1F0MA 1OW5A 1DXSA 5JU5A 3HILA 1SGGA 4PZNA 1UCVA 2KIVA 1V85A 3TACB 2D8CA 2DKZA 1V38A 2Y9TA 1OXJA 2DKXA 3TADC 4IS7A 1PK1A 1X66A 5J8YA 2QB0A 2E8NA 2K4PA 2E8OA 2GLEA 2EANA 1X40A 2EAPA 3KKAC 3H8MA 2KMDA 2B6GA 4RQMA 4NL9A 2KSOA 4PZOA 2E8PA 2EAMA 2F44A 4NJ8A 1PK1B 2KE7A 1SV4A 2QB0B 4MHVA 1RG6A 1SV0C 2E8MA 2QARA 1LKYA 5JRTA 5KNIA 2Y9UA 3TADA 2KG5A 3K1RB 2LMRA 2KSOB 2F8KA 1KW4A 3BS7A 2F3NA 2FE9A 1UQVA 2ESEA 3BS5A 2YTUA 1JI7A 3SEIA 1COKA 2QKQA 3KKAA 5JTIA 2QARB 5F3XB 1LKYB 1WWUA 2DL0A 5L1MA 1Z1VA 5J8YC 3BQ7A 2LPEA 1WWVA 2EAOA 1B4FA 1X9XA
chains in the Genus database with same CATH superfamily
5KFLA 7ICKA 3Q8KA 5ALJA 3H8SA 4P0QA 4ELTA 5E79U 5K4LA 1UPHA 4R65A 5J0OA 3RJEA 3N28A 5J0UA 3HPOA 3M7DA 1XS9D 3L3FX 3B9JA 5AKEA 2KEYA 3NVWA 3TADC 4R64A 3DEEA 5EE3A 3MABA 2HHXA 1RDFA 4NLBA 3MDAA 3RB4A 4QZBA 2C2DA 1JIHA 1KLNA 4NV0A 8ICNA 2RRDA 2OCEA 2K8CB 1TK0A 4B9VA 5KAIU 2KHVA 2CPRA 4B9UA 4YG2A 2W3RA 1MC8A 5KT2A 1FEZA 2ZIVA 4M2YA 1NOMA 3FDSA 5J0PA 4UQGA 2NRZA 1JX4A 2F1HA 3TARA 1SV4A 5CA7A 1WYGA 4JB3A 4O3SA 4F4XA 4DO9A 5KT6A 3ED5A 4B9LA 4KTQA 4M9LA 4MFAA 4MF2A 1KDHA 4M9GA 3NVVA 1FFUA 4F2SA 2HHTA 2LMRA 1V9PA 5EE1A 2F8KA 2AXTU 2VJ5A 1YT3A 5CB1A 4J9QA 3H4DA 3ETLA 4FFDA 5CEHA 2RHFA 5HR6A 5J2JA 5KL8B 3EUB2 1NK6A 1UT5A 4C0ZA 2ZJ5A 3RJJA 1XWLA 4WJ3B 8ICBA 2ZIUB 4A8EA 4YQWA 1CUKA 4BDPA 4O3QA 3HW8A 8ICSA 1L3VA 1B43A 4O0IA 4UB6U 5KFBA 1ZQQA 2P66A 2W03A 4B6JA 1JALA 4UW9A 3Q8PB 4F5OA 3IV6A 3QU7A 3PVXA 4PGYA 1RQLA 4G9BA 3PSPA 3HKZC 4FZLA 5J0WA 5KFOA 1OXJA 3PNCA 5KFCA 3RAQA 1L7OA 5ALQA 4RUCA 1X9WA 4IS7A 3V7LA 4ICAA 2ZIXB 5AM3A 1ED1A 1WG8A 1XNSA 4CGZA 5AI8A 5AHXA 1LV5A 1BPXA 3D6JA 2NO4A 4O3PA 2E8OA 8ICJA 3T79A 3KTQA 1YZ7A 2FPLA 5AKYA 2PMZC 2WFAA 4FS2A 1RYSA 2B6GA 3EZ5A 3I28A 1D8YA 2KIWA 4DQQA 4CF3A 3V7KA 1ZQYA 5AM0A 3F5EA 1DK2A 5KG7A 3QUBA 1L3SA 3UMBA 3BJYA 3SR6A 2KOBA 4GXJA 2P6RA 2DQNB 4AYBC 3NASA 3TFSA 2OXOA 2RDJA 4EBDA 2YY6A 2MSNA 4Z6CA 3F2BA 4KLQA 1S9FA 3H0MB 5ALTA 4OJLA 4PHPA 3AU6A 2JXJA 4F4ZA 5C0YA 4P4MA 3M8SA 4YP3A 2QARB 3TQ1A 1LKYB 2HCFA 2H3ZA 4F2RA 2KZZA 2EAOA 1S0MA 4NLZA 2ASDA 2R8KA 1S0NA 1ZQDA 4ECYA 1DK3A 1T3QA 4TUPA 5KG4A 1B0XA 2L5YA 5DGBA 5J2CA 3IG8A 4MFCA 4ED3A 4GXIA 2JH1A 4RQ5A 1XO1A 4I28A 4BJQA 4TURA 2XC9A 2HDOA 4J9SA 4KLJA 4PPXA 4Q44A 1SZPA 4QZ8A 2KFNA 1NJYA 9ICTA 1ZETA 7ICSA 4F71A 2R8GA 4XA5A 4PH5A 3RJGA 4F50A 3AEVA 1JRPA 3RJIA 4Q43A 3NRZA 5J2GA 1ZJNA 2XI9A 7ICMA 5DB8A 4PGQA 2W3SA 5A0LA 5IIMA 1ZQEA 9ICNA 4Y2PA 1ZQPA 1EXNA 1PUZA 3HJEA 2JR5A 2LHTA 2IHNA 3KKAC 4DWIA 3V72A 3N7RC 2WF5A 3FAHA 2K4EA 4BWJA 2YX8A 1VJ5A 1LB2B 4R8UB 4J9LA 3LK9A 1X6IA 5ALDA 1FO4A 4CF4A 4DL4A 1MQ2A 2KZMA 8ICLA 4O5CA 4K4HA 1KQQA 4MF8A 3LWMA 4C7ZA 2E5SA 5KFUA 5GTIU 5ALYA 2PFNA 3FM9A 1CRXA 1Z1BA 1O08A 3WK8A 4UBBA 2HSZA 3H7IA 5L1IA 3CNHA 3B0YA 5JTIA 3SAFA 2DWQA 4NM2A 5F3XB 5KFFA 4DQIA 4ED7A 5IIOA 5EWFA 5BOMA 4C8LA 4OJOA 4I2CA 2JMGA 1AQ6A 4RQ3A 2M0NA 3BS5B 4LJXA 2KP7A 2XY5A 1MN8A 3AL0B 8ICUA 2ES6A 4ELVA 3D2NA 2E3TA 5B66U 4QZIA 3T5LA 4IQTA 3E58A 3HILA 5KFWA 2H3VA 4Y2JA 3PO5A 4DSEA 5JUMA 2RP5A 5AM5A 4KITB 1RM6C 4RT2A 3TAQA 8ICYA 1OUQA 1V97A 5EE9A 2ZTDA 3K4GA 4M6WA 2E8NA 3RB6A 2ZJ8A 5ALFA 4XUSA 4J9MA 4RQ1A 4DL6A 1IM4A 4DSLA 3LVWA 5CRXA 1ZQCA 4ED8A 4C8OA 1N60A 3F2DA 3UMCA 3K1ZA 2AJQA 4RQMA 4KLGA 1AROP 2Q0ZX 4M9HA 9ICVA 3E0FA 5KFGA 2YMMA 3ISDA 2N1RA 1ZQWA 3NRWA 3MR2A 1UHUA 5DB6A 5J0TA 2MUTA 2BPFA 2KG5A 1SKWA 4BXOA 4Y2VA 5AK4A 2W55A 5KFAA 1XSLA 1K1SA 4FBUA 5ALEA 4LZDA 5B5EU 2WF9A 4OCZA 3WKDA 2H3FA 1PVRA 4QWEA 3M9MB 9ICJA 2F77X 2PFOA 3R9KA 1C7YA 5EWEA 2M9NA 4DL7A 1XC9A 1B4FA 3PX6A 4QWCA 3N7SC 2HVIA 4IR9A 2V4RA 1KRPA 3ZDBA 2FMPA 3IDWA 1SL2A 2W8LA 4KX3A 4NLKA 3SAGA 1SXDA 1P7DA 2ZUDA 4NLGA 2VA3A 1F0MA 4RQ7A 2C22A 1QLNA 4P4OA 1NZBA 1UT8A 4ECSA 8ICMA 3MFIA 4I2AA 4UBCA 5ALPA 3IRUA 4ECTA 3S6JA 1SIJA 4TUSA 1T8EA 5KFQA 5KFKA 4IRCA 1Q3UA 1SL1A 8ICXA 2ZJAA 4M04A 3E2EA 3B0XA 5EE0A 3PSIA 3QNMA 4PGXA 3BQTA 2EAPA 1D9DA 1MSWD 4QZDA 2BKEA 2G09A 3GQCA 1ZQSA 3BZCA 5KFSA 3C28A 4NL9A 3Q8SB 5GTHU 4Q8FA 2I6XA 5AKZA 4CE6A 4GC6A 7ICVA 3JPPA 2FLNA 4DLEA 1K5OA 5AM1A 4GLXA 3Q8QB 9ICIA 2VANA 2Y9UA 5G5HA 4YR2A 2ZIUA 3N97B 2NYVA 3CW2C 4RQ0A 2FE9A 1UQVA 3SV4A 1DGSA 3EPGA 2XGPA 3ISCA 4IQUA 7ICQA 3RBDA 4P2HA 4QWAA 2C28A 4C8MA 2WF8A 4Q45A 2EZYA 3GV5B 7ICNA 4RQ4A 3GIMA 4FBTA 2VA2A 2QB1A 3K75D 1JXLA 4Z6EA 2LYBA 1SV0A 2D3DA 2F76X 1RZTA 2ZIXA 3IP4B 2HW3A 3T5HA 3H8JA 4Y2UA 1KKXA 3RH4A 3F53A 4Y2TA 1NK7A 4EBEA 2KV2A 1ECWA 2F1IA 3PZPA 2LYHA 9ICOA 1HUZA 1TFRA 2BQ3A 4UATA 5J29A 1L8OA 3HX0A 2HHWA 4C8KA 1NK9A 3HP6A 5CP2A 1L7NA 1X66A 2KD1A 4UB5A 3UQ2A 2DGZA 5KFIA 4RU9A 2BCVA 2CN1A 3I1YA 2DFLA 3H8MA 2GO7A 1S76D 5AI5A 3PSFA 1KTQA 1U9LA 3ZDAA 2BCRA 4UAUA 2QARA 3V6HA 1LKYA 5JRTA 1QTMA 1QSYA 5DG9A 3Q8LA 4IR1A 1TAUA 3M6ZA 1NJZA 1JN3A 4KMUA 1K1QA 2KSOB 4YD2A 4RPXA 2JHDA 1F5SA 2HOIA 3PO4A 4ECQA 4DS5A 2EQYA 4O3MA 1SWVA 3ZDEA 2DL0A 5J2BA 3PX0A 8ICAA 4JWNA 1Z00B 4OJPA 4FE3A 3KOOA 3AQFA 4PHAA 4O3NA 4GC7A 4C4RA 2KN7A 2XIDA 3Q8RB 4ECRA 1X6JA 5HR7A 4RPYA 2W7OA 3GU3A 3PV8A 2NRXA 4DOAA 2H3QA 2Y1IA 1N5XA 3IG5A 3G6VA 9ICMA 4R63A 2KZ3A 3RBEA 1BGXT 2FPKA 2K8BB 3QYPA 3I76A 2KHQA 1QQ5A 5TISU 3JPSA 1ZOLA 7ICEA 3ZDCA 4QNLA 4I2EA 1ZQZA 3QU5A 4PZOA 3MDCA 1NKCA 1Q46A 3PW5A 5AI4A 3RJKA 1N62A 3WK9A 2NRWA 3MGVA 4I2GA 2W7PA 9ICBA 5AK6A 5KG3A 3KD3A 1S10A 8ICHA 2W8KA 4YD1A 1ZYQA 4O3RA 4ED2A 2ZUBA 4XRHA 5BOLA 2Y0SF 3BDPA 2DPJA 5KFHA 3BS5A 4I2HA 1M6YA 4Y2YA 4KN4A 4UB4A 4YN4A 1BNOA 2IOFK 1L3TA 4DSIA 1SKRA 1FFVA 4UARA 2W9MA 2OEHA 5G5GA 5HNKA 2K4IA 2W43A 3RRGA 3JPQA 2KJ5A 4I2FA 2D6FC 3L5KA 2WB1F 3PX4A 2K89A 4RQNA 4YXJA 1ZQAA 7ICGA 4DSJA 4P0QB 2I1QA 3ICXA 1BPZA 4P0PA 1ZQNA 2BQRA 3OSNA 2JEFA 3PMNA 3C5GA 5AK5A 3H0LB 3PW0A 4X5VA 1N61A 3TFRA 4OD0A 1BPBA 4J03A 3C21A 5KT3A 5DGAA 3BQ2A 5KFNA 1C20A 4CDGA 9ICUA 3M9OB 1QH9A 3LVVA 5AKHA 2HI0A 2VKQA 4YR0A 1BPYA 1ZRNA 3H40A 1GO3F 4QZ9A 4F3OA 3VC8A 4QZCA 2C2EA 4C4SA 3IM1A 4UAYA 2ZXIA 2ZIVB 1Z4OA 2EAMA 2EDUA 3RJFA 5ALUA 1XSNA 2BZFA 2PFPA 5KT4A 1NNLA 5AI6A 2KVCA 1RG6A 3JPNA 5DG7A 4O3OA 4ED0A 3OPXA 1QSLA 1A77A 1IV8A 1WUDA 4YMMA 1L8LA 4B9SA 4NLNA 4QJFB 4US9A 4IQVA 4QZEA 4I2DA 3UQ0A 3K1RB 5KG2A 2F1JA 4JV2A 3PMLA 4QZAA 4F5RA 3RF9A 5DBCA 3DDHA 4DSFA 2YN4A 1ZQGA 1COKA 5KG1A 2AGOA 4XQ8A 7ICIA 1JMSA 1CI4A 2G5HB 5AIBA 1WWUA 2P6UA 5KFJA 1Z1VA 4RQ6A 2LPEA 1KEJA 1WWVA 3JPOA 2VA8A 3MGIA 4KLDA 3QU4A 1KBUA 4PHDA 1NJXA 1QSSA 2A1JB 7ICOA 4ED6A 2GOLA 3C1YA 2W9AA 8ICVA 3AN1A 5EWGA 7ICHA 1N48A 2YMLA 3CRXA 4DF4A 5KG6A 5ALRA 2YMQA 2FLLA 2ZG6A 1ZQBA 3EWAA 4M9JA 2D8CA 1TE2A 3SD7A 4F5QA 2F2AB 4G3IA 4JV1A 5AKGA 3NTUA 4QW8A 2UVUA 2FJ6A 4KLSA 4IQWA 2JZBB 4UAVA 3M9NB 1ZQIA 5HP4A 2B0CA 5AKJA 1TAQA 2FMSA 3LDAA 2BHNA 3H4BA 4DQPA 3V7JA 3HRDD 4J9OA 2OM6A 8ICZA 3AQEA 1DGJA 4F72A 1D8LA 3C5FA 1Z3EB 9ICCA 3F5AA 3NVYA 2QB0B 2FLPA 3WK6A 4RNNA 1L7PA 4DOCA 5CR0A 4K4IA 4U7CA 3SQIA 2MU2A 2ASJA 5HMLA 9ICQA 2JEJA 1JUDA 3BQ1A 3C23A 3SMVA 5L1LA 2AQ0A 3BS7A 2ESEA 3WU2U 3ZD8A 5J0YA 4QZHA 2IBKA 3KHGA 5ALXA 2RDIA 4I27A 4B9TA 1J97A 5L1MA 1NKEA 4B9NA 3WK5A 4JUZA 7ICFA 1IIPA 5ALGA 4KX5A 1S8OA 5DBBA 4R66A 3GV8B 3SENA 1PK3A 4PHEA 3UPQA 5ALZA 3HT3A 3WKCA 4NL9C 5ALLA 1X2IA 1S0OA 2LKYA 3VCBA 2KFZA 2GWSA 1S5LU 4DOBA 5AKKA 5KG5A 5ALWA 3RB3A 2P35A 4IL6U 2V9WA 5AIAA 2VIXA 5J2FA 4QZGA 5KG0A 5J8YA 3KBBA 2K8AA 1T7PA 4EZ6A 1T3NA 4ACOA 2YB4A 2J6TA 4O5KA 1NJWA 5BPCA 2FDRA 2HHUA 2LI6A 2KSOA 5AKIA 3ORYA 4NJ8A 3SI8A 4QIWF 4QW9A 1RYRA 5HHIA 8ICCA 1JXEA 1F44A 1SV0C 1NK8A 8ICEA 2BPGA 3PR4A 1NI3A 2IA6A 3GILA 5EOZA 2DPIA 1NK0A 2Y0SC 5CJ7A 1NK5A 3GIIA 2NO5A 4UB8U 4EX7A 2HHQA 4J9PA 4DLGA 4EX6A 4FO6A 4M9NA 3QUTA 4M0AA 3GIKA 4RT3A 2NV3A 4OO1J 3QX7A 4KLMA 3OSPA 1RYUA 2WB1C 3D2SA 3CYMA 3RTVA 5DKWA 5H2FU 4YR3A 4LVSA 4FZNA 4J9RA 1U45A 3UXNA 3IN5A 4DQRA 5DG8A 5DB9A 1L7MA 2JV3A 5IIIA 2HBLA 4PL1A 2ZUCA 1QCKA 1PZNA 1Q3VA 2XCAA 4Y2XA 3H8WA 3AMZA 3KZIU 3G6XA 8ICWA 1UCVA 2H5XA 3LWLA 5AM4A 2DKZA 4ECZA 2ALZA 3AU2A 1X42A 1D9FA 5ALVA 4ECVA 1QQ6A 3WKBA 2IOFA 4FS1A 5CHGA 4M6WB 3TAPA 3RH5A 1ZQXA 4KLIA 4K4GA 4OJ6A 9ICAA 3TKAA 2JH7A 4RQ2A 5KFEA 3OGUA 2EANA 3GZFA 3SAHA 3L4PA 4JWMA 7ICUA 1X40A 3A0BU 2R8JA 3ZDDA 7ICJA 4Y2RA 4B9MA 1PVQA 3T3FA 4DEZA 3GFKB 2A1AA 8ICIA 5D4BA 3V6JA 5KFDA 1JROA 1NK4A 2ZXHA 2NRVA 2HMXA 5ALOA 2BCUA 4ZOHC 1HIWA 1X9SA 3EW9A 2PKEA 1HJPA 4HYKA 5KNIA 2ATLA 1ZQKA 4BXOB 2HOFA 3PR5B 2GH1A 2DF4B 4NWIA 2RQ5A 5J2DA 3UMGA 4ECUA 2BGWA 1JI7A 2BPCA 3KHLA 4YVZA 4GIBA 4CNQA 3SZ2A 1VLBA 1QQ7A 2CXYA 2XY7A 2HVHA 1ZD3A 1ZQUA 3KZXA 3TI0A 1ZQFA 8ICRA 3KHRA 8ICPA 3BZKA 4F92B 4CF5A 3NUQA 4AP9A 3WKEA 3NVZA 4YFKA 4YCXA 3SV3A 5KT5A 3PW7A 4DCCA 4TUQA 2ZTEA 2K60A 3OTQA 1CEZA 1ZQLA 4Y2QA 5HMMA 1KFTA 2W54A 4MFFA 2FI1A 1NKBA 1V85A 2F8LA 4F4YA 1J2MA 9ICPA 2R18A 4DL2A 3RFAA 4EBCA 1XO0A 5L1JA 2Z7JA 5IILA 5KFVA 2PI4A 3SYZA 2XGQA 5KL1B 2ZIWB 1DRGA 4DFJA 2AHOB 1KL9A 2V4QA 4ECWA 2ISOA 1COOA 2KMDA 5D46A 2BCQA 1BVSA 3C2KA 4O9MA 4JK1A 2BDUA 2C2RA 3AUOA 3ETRA 9ICLA 2W9CB 1PK1B 3QEBZ 4R8UA 4KMOB 4YMNA 3ONNA 1UA1A 1WCNA 2A3VA 4BUGA 2IHMA 3N7PD 4Z6DA 4USAA 1O03A 2JEIA 2W9BB 3M1YA 2BQUA 2IMWP 2EH9A 3WK7A 2O6KA 4EENA 3TADA 3UM9A 4Z6FA 5L9XA 2LYAA 4C8NA 1KW4A 2A1JA 2YTUA 1RPLA 3QUQA 4OJ5A 4PJ0U 3GDXA 3EPIA 2YB1A 5IIJA 5AI9A 4QWDA 9ICFA 3RH6A 2J6UA 4E0DA 3J81j 4F8RA 3ALRA 3MBYA 2ASLA 2MAXA 4UB3A 5DBAA 2DUYA 4CCHA 4DS4A 3MR6A 1WCLA 2KJ9A 5DLGA 3FYHA 2E1EA 5J2EA 3Q8MA 5J2KA 4ELUA 3NS1A 1OW5A 4DL3A 1ZXIA 2PFQA 2JZBA 4IRKA 3RR8A 1SGGA 4LZGA 2KIVA 3MC1A 1V38A 4KN7A 4BWMA 4UAZA 2UVWA 4I29A 2DKXA 2FMQA 2KKVA 4U6PA 5J2AA 4Y2SA 4RNMA 3EYZA 4F5NA 3WK4A 1ZQVA 5AM2A 3MGHA 2QB0A 2AQ4A 1XSPA 4C4TA 4BX9C 2LM4A 1TV9A 4F93B 2GLEA 5HHHA 2G07A 2JRZA 2G0AA 5L1KA 4NM1A 3FC4A 2KJ8A 1PVPA 4HAIA 2AGQA 2WF6A 2A19A 4IC9A 1S0VA 3QUCA 3U26A 5DB7A 3N4MB 2CRXA 2JEGA 5KT7A 4QIWC 4QZFA 3RB0A 5DQGA 1ZD4A 5DQHA 8ICQA 2KE7A 3QEAZ 1ZQTA 4DFPA 1A6SA 1U47A 1L5UA 2KKPA 8ICOA 2LBOA 3T5KA 8ICGA 7ICTA 9ICXA 5ALSA 2H3IA 4EYIB 1TVAA 4MEXA 2G08A 3OJUA 5KFPA 1N2XA 9ICEA 4PL2A 4RUAA 4RZRA 1HEKA 1IXRA 3PW4A 8ICKA 5ALHA 2WAQF 2YMPA 3C2MA 2I5HA 2LM1A 5ALIA 4J9NA 4Q8EA 3BQ7A 4F91B 1J2NA 3C2LA 1S97A 1X9XA 8ICTA 5AKXA 5F9LA 9ICWA 2FPMA 5KTQA 1Q8KA 1D8BA 2KVSA 4KLTA 1Z19A 1H38A 3OJSA 3G6YA 5J0QA 3M8RA 4JV0A 1KFDA 3QE9Y 2BDPA 1TK8A 2UVRA 3F2CA 4M47A 4I2JA 1ZD5A 2Y9TA 3QU9A 1DOQA 1L6NA 2OH2A 5AICA 3C1ZA 1A76A 4DSKA 2K4PA 2W04A 2HHSA 4ED1A 4P4PA 2BR0A 2K4HA 5KFXA 1MA7A 2HHVA 3TANA 5KFYA 5J2HA 4EELA 2F44A 3MR5A 4EEKA 3CP8A 1BPDA 2E8MA 4DFMA 1N56A 1T4GA 1RXWA 1ZJMA 1BPEA 3ISBA 1KN5A 2OYYA 4I2BA 2W11A 3JPTA 4KLEA 9ICKA 3KFUF 4MEYA 4F4KA 1FIQA 3V6KA 3NGDA 3WKAA 5CWRA 1ZD2P 5KFRA 2QKQA 5KFMA 9ICGA 3KKAA 2Q4TA 2VJ4A 2PXIA 2KNJA 1U48A 4KLHA 2XVTA 5J8YC 1A0PA 1YZ6A 9ICRA 1L3UA 3A0HU 1SWWA 4DF8A 2EZXA 4P0PB 4KLFA 7ICPA 5J0RA 2RLTA 1B22A 3THVA 1SKSA 3KHHA 5DDYA 5DDMA 4F4WA 1RQNA 1KFSA 2KICA 1LVHA 3RJHA 4UASA 5JU5A 4UAWA 2ISPA 3TACB 2MA1A 2R8IA 5ALNA 5TZVA 3O0FA 5DLFA 4RNOA 5AI0A 1TK5A 2XY6A 1ZQRA 3HKZF 5IIKA 5AK3A 3MFHA 1UA0A 5KFTA 4TQRA 4ECXA 3IHQB 5J0SA 2ZTCA 4O5EA 4FZMA 4US8A 2PMZF 2HBKA 5J0XA 5DQIA 3M6KA 1VDVA 4J9KA 5ALKA 2MRLA 4DL5A 1ZQ1C 1ZQOA 4JMUA 4NLCA 5KAFU 3QXGA 2QLTA 3QZ7A 5KFZA 4RQ8A 2PI5A 5IINA 4KLLA 1Z4NA 4DQSA 4AYBF 2JGAA 1IG6A 2OHFA 4F5PA 1KSPA 2E1FA 3QU2A 1S77D 4DFDA 1Y88A 2KK0A 3SEIA 4KLUA 2OWOA 1RXVA 5FP0A 2NRTA 3D2QA 4EEYA 3JPRA 1HUOA 4RPZA 3RAXA 2AU0A 4TQSA 4QWBA 3PY8A 2KTQA 3PSTA 1Z00A 5T14A 2J6SA 4KLOA 1SL0A 5AKLA 2WTFA 2I9GA 3UXPA 1N5WA 1T94A 1ZQHA 1ZRMA 4ZH4A 1SXEA 4DFKA 2XCPA 3RRHA 2WHEA 1DXSA 3OHAA 2ZIWA 2XO7A 3ZI4A 1XU4A 4C7YA 3GV7B 4PZNA 4C80A 3C29A 1N63A 3MR3A 2WF7A 2DBYA 1TAMA 3ZD9A 9ICHA 1X9MA 2YQEA 4GXKA 3RR7A 2Y1JA 2W9CA 1PK1A 7ICLA 4NY8A 1TKDA 1SB3C 9ICSA 8ICFA 3HWTA 4YMOA 5D49A 4NXZA 5F9NA 2W9BA 4UB1A 1NZPA 2G5IB 1ZQJA 2AGPA 1SZHA 1U4BA 2AH5A 3T5JA 2E8PA 2R8HA 1URJA 4EYHB 1MQ3A 4I2IA 2HBMA 4MHVA 2XICA 4BGDA 1ZQMA 3UXOA 3OHBA 2UVVA 5J2IA 2ODGA 2HOQA 2G06A 2HBJA 4YXMA 2IOHA 4IRDA 4EZ9A 2EZZA 4UB2A 3H0RB 3BQ0A 3GIJA 2F3NA 2WAQC 7ICRA 4GFJA 3LYSA 1BNPA 5ALMA 1U49A 4CRXA 3PW2A 5C5JA 3QZ8A 3DV9A 2BCSA 2MUTB 2B21A 3AM9A
chains in the Genus database with same CATH topology
2QB1A 4RQNA 1B0XA 3SENA 2L5YA 1PK3A 3BS5B 1SV0A 2D3DA 3IDWA 1SXEA 2JV3A 2ES6A 4NL9C 1SXDA 2K60A 1F0MA 1OW5A 1DXSA 5JU5A 3HILA 1SGGA 4PZNA 1UCVA 2KIVA 1V85A 3TACB 2D8CA 2DKZA 1V38A 2Y9TA 1OXJA 2DKXA 3TADC 4IS7A 1PK1A 1X66A 5J8YA 2QB0A 2E8NA 2K4PA 2E8OA 2GLEA 2EANA 1X40A 2EAPA 3KKAC 3H8MA 2KMDA 2B6GA 4RQMA 4NL9A 2KSOA 4PZOA 2E8PA 2EAMA 2F44A 4NJ8A 1PK1B 2KE7A 1SV4A 2QB0B 4MHVA 1RG6A 1SV0C 2E8MA 2QARA 1LKYA 5JRTA 5KNIA 2Y9UA 3TADA 2KG5A 3K1RB 2LMRA 2KSOB 2F8KA 1KW4A 3BS7A 2F3NA 2FE9A 1UQVA 2ESEA 3BS5A 2YTUA 1JI7A 3SEIA 1COKA 2QKQA 3KKAA 5JTIA 2QARB 5F3XB 1LKYB 1WWUA 2DL0A 5L1MA 1Z1VA 5J8YC 3BQ7A 2LPEA 1WWVA 2EAOA 1B4FA 1X9XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QB1 A;  4RQN A;  1B0X A;  3SEN A;  2L5Y A;  1PK3 A;  3BS5 B;  1SV0 A;  2D3D A;  3IDW A;  1SXE A;  2JV3 A;  2ES6 A;  4NL9 C;  1SXD A;  2K60 A;  1F0M A;  1OW5 A;  1DXS A;  5JU5 A;  3HIL A;  1SGG A;  4PZN A;  1UCV A;  2KIV A;  1V85 A;  3TAC B;  2D8C A;  2DKZ A;  1V38 A;  2Y9T A;  1OXJ A;  2DKX A;  3TAD C;  4IS7 A;  1PK1 A;  1X66 A;  5J8Y A;  2QB0 A;  2E8N A;  2K4P A;  2E8O A;  2GLE A;  2EAN A;  1X40 A;  2EAP A;  3KKA C;  3H8M A;  2KMD A;  2B6G A;  4RQM A;  4NL9 A;  2KSO A;  4PZO A;  2E8P A;  2EAM A;  2F44 A;  4NJ8 A;  1PK1 B;  2KE7 A;  1SV4 A;  2QB0 B;  4MHV A;  1RG6 A;  1SV0 C;  2E8M A;  2QAR A;  1LKY A;  5JRT A;  5KNI A;  2Y9U A;  3TAD A;  2KG5 A;  3K1R B;  2LMR A;  2KSO B;  2F8K A;  1KW4 A;  3BS7 A;  2F3N A;  2FE9 A;  1UQV A;  2ESE A;  3BS5 A;  2YTU A;  1JI7 A;  3SEI A;  1COK A;  2QKQ A;  3KKA A;  5JTI A;  2QAR B;  5F3X B;  1LKY B;  1WWU A;  2DL0 A;  5L1M A;  1Z1V A;  5J8Y C;  3BQ7 A;  2LPE A;  1WWV A;  2EAO A;  1B4F A;  1X9X A; 
#chains in the Genus database with same CATH topology
 5KFL A;  7ICK A;  3Q8K A;  5ALJ A;  3H8S A;  4P0Q A;  4ELT A;  5E79 U;  5K4L A;  1UPH A;  4R65 A;  5J0O A;  3RJE A;  3N28 A;  5J0U A;  3HPO A;  3M7D A;  1XS9 D;  3L3F X;  3B9J A;  5AKE A;  2KEY A;  3NVW A;  3TAD C;  4R64 A;  3DEE A;  5EE3 A;  3MAB A;  2HHX A;  1RDF A;  4NLB A;  3MDA A;  3RB4 A;  4QZB A;  2C2D A;  1JIH A;  1KLN A;  4NV0 A;  8ICN A;  2RRD A;  2OCE A;  2K8C B;  1TK0 A;  4B9V A;  5KAI U;  2KHV A;  2CPR A;  4B9U A;  4YG2 A;  2W3R A;  1MC8 A;  5KT2 A;  1FEZ A;  2ZIV A;  4M2Y A;  1NOM A;  3FDS A;  5J0P A;  4UQG A;  2NRZ A;  1JX4 A;  2F1H A;  3TAR A;  1SV4 A;  5CA7 A;  1WYG A;  4JB3 A;  4O3S A;  4F4X A;  4DO9 A;  5KT6 A;  3ED5 A;  4B9L A;  4KTQ A;  4M9L A;  4MFA A;  4MF2 A;  1KDH A;  4M9G A;  3NVV A;  1FFU A;  4F2S A;  2HHT A;  2LMR A;  1V9P A;  5EE1 A;  2F8K A;  2AXT U;  2VJ5 A;  1YT3 A;  5CB1 A;  4J9Q A;  3H4D A;  3ETL A;  4FFD A;  5CEH A;  2RHF A;  5HR6 A;  5J2J A;  5KL8 B;  3EUB 2;  1NK6 A;  1UT5 A;  4C0Z A;  2ZJ5 A;  3RJJ A;  1XWL A;  4WJ3 B;  8ICB A;  2ZIU B;  4A8E A;  4YQW A;  1CUK A;  4BDP A;  4O3Q A;  3HW8 A;  8ICS A;  1L3V A;  1B43 A;  4O0I A;  4UB6 U;  5KFB A;  1ZQQ A;  2P66 A;  2W03 A;  4B6J A;  1JAL A;  4UW9 A;  3Q8P B;  4F5O A;  3IV6 A;  3QU7 A;  3PVX A;  4PGY A;  1RQL A;  4G9B A;  3PSP A;  3HKZ C;  4FZL A;  5J0W A;  5KFO A;  1OXJ A;  3PNC A;  5KFC A;  3RAQ A;  1L7O A;  5ALQ A;  4RUC A;  1X9W A;  4IS7 A;  3V7L A;  4ICA A;  2ZIX B;  5AM3 A;  1ED1 A;  1WG8 A;  1XNS A;  4CGZ A;  5AI8 A;  5AHX A;  1LV5 A;  1BPX A;  3D6J A;  2NO4 A;  4O3P A;  2E8O A;  8ICJ A;  3T79 A;  3KTQ A;  1YZ7 A;  2FPL A;  5AKY A;  2PMZ C;  2WFA A;  4FS2 A;  1RYS A;  2B6G A;  3EZ5 A;  3I28 A;  1D8Y A;  2KIW A;  4DQQ A;  4CF3 A;  3V7K A;  1ZQY A;  5AM0 A;  3F5E A;  1DK2 A;  5KG7 A;  3QUB A;  1L3S A;  3UMB A;  3BJY A;  3SR6 A;  2KOB A;  4GXJ A;  2P6R A;  2DQN B;  4AYB C;  3NAS A;  3TFS A;  2OXO A;  2RDJ A;  4EBD A;  2YY6 A;  2MSN A;  4Z6C A;  3F2B A;  4KLQ A;  1S9F A;  3H0M B;  5ALT A;  4OJL A;  4PHP A;  3AU6 A;  2JXJ A;  4F4Z A;  5C0Y A;  4P4M A;  3M8S A;  4YP3 A;  2QAR B;  3TQ1 A;  1LKY B;  2HCF A;  2H3Z A;  4F2R A;  2KZZ A;  2EAO A;  1S0M A;  4NLZ A;  2ASD A;  2R8K A;  1S0N A;  1ZQD A;  4ECY A;  1DK3 A;  1T3Q A;  4TUP A;  5KG4 A;  1B0X A;  2L5Y A;  5DGB A;  5J2C A;  3IG8 A;  4MFC A;  4ED3 A;  4GXI A;  2JH1 A;  4RQ5 A;  1XO1 A;  4I28 A;  4BJQ A;  4TUR A;  2XC9 A;  2HDO A;  4J9S A;  4KLJ A;  4PPX A;  4Q44 A;  1SZP A;  4QZ8 A;  2KFN A;  1NJY A;  9ICT A;  1ZET A;  7ICS A;  4F71 A;  2R8G A;  4XA5 A;  4PH5 A;  3RJG A;  4F50 A;  3AEV A;  1JRP A;  3RJI A;  4Q43 A;  3NRZ A;  5J2G A;  1ZJN A;  2XI9 A;  7ICM A;  5DB8 A;  4PGQ A;  2W3S A;  5A0L A;  5IIM A;  1ZQE A;  9ICN A;  4Y2P A;  1ZQP A;  1EXN A;  1PUZ A;  3HJE A;  2JR5 A;  2LHT A;  2IHN A;  3KKA C;  4DWI A;  3V72 A;  3N7R C;  2WF5 A;  3FAH A;  2K4E A;  4BWJ A;  2YX8 A;  1VJ5 A;  1LB2 B;  4R8U B;  4J9L A;  3LK9 A;  1X6I A;  5ALD A;  1FO4 A;  4CF4 A;  4DL4 A;  1MQ2 A;  2KZM A;  8ICL A;  4O5C A;  4K4H A;  1KQQ A;  4MF8 A;  3LWM A;  4C7Z A;  2E5S A;  5KFU A;  5GTI U;  5ALY A;  2PFN A;  3FM9 A;  1CRX A;  1Z1B A;  1O08 A;  3WK8 A;  4UBB A;  2HSZ A;  3H7I A;  5L1I A;  3CNH A;  3B0Y A;  5JTI A;  3SAF A;  2DWQ A;  4NM2 A;  5F3X B;  5KFF A;  4DQI A;  4ED7 A;  5IIO A;  5EWF A;  5BOM A;  4C8L A;  4OJO A;  4I2C A;  2JMG A;  1AQ6 A;  4RQ3 A;  2M0N A;  3BS5 B;  4LJX A;  2KP7 A;  2XY5 A;  1MN8 A;  3AL0 B;  8ICU A;  2ES6 A;  4ELV A;  3D2N A;  2E3T A;  5B66 U;  4QZI A;  3T5L A;  4IQT A;  3E58 A;  3HIL A;  5KFW A;  2H3V A;  4Y2J A;  3PO5 A;  4DSE A;  5JUM A;  2RP5 A;  5AM5 A;  4KIT B;  1RM6 C;  4RT2 A;  3TAQ A;  8ICY A;  1OUQ A;  1V97 A;  5EE9 A;  2ZTD A;  3K4G A;  4M6W A;  2E8N A;  3RB6 A;  2ZJ8 A;  5ALF A;  4XUS A;  4J9M A;  4RQ1 A;  4DL6 A;  1IM4 A;  4DSL A;  3LVW A;  5CRX A;  1ZQC A;  4ED8 A;  4C8O A;  1N60 A;  3F2D A;  3UMC A;  3K1Z A;  2AJQ A;  4RQM A;  4KLG A;  1ARO P;  2Q0Z X;  4M9H A;  9ICV A;  3E0F A;  5KFG A;  2YMM A;  3ISD A;  2N1R A;  1ZQW A;  3NRW A;  3MR2 A;  1UHU A;  5DB6 A;  5J0T A;  2MUT A;  2BPF A;  2KG5 A;  1SKW A;  4BXO A;  4Y2V A;  5AK4 A;  2W55 A;  5KFA A;  1XSL A;  1K1S A;  4FBU A;  5ALE A;  4LZD A;  5B5E U;  2WF9 A;  4OCZ A;  3WKD A;  2H3F A;  1PVR A;  4QWE A;  3M9M B;  9ICJ A;  2F77 X;  2PFO A;  3R9K A;  1C7Y A;  5EWE A;  2M9N A;  4DL7 A;  1XC9 A;  1B4F A;  3PX6 A;  4QWC A;  3N7S C;  2HVI A;  4IR9 A;  2V4R A;  1KRP A;  3ZDB A;  2FMP A;  3IDW A;  1SL2 A;  2W8L A;  4KX3 A;  4NLK A;  3SAG A;  1SXD A;  1P7D A;  2ZUD A;  4NLG A;  2VA3 A;  1F0M A;  4RQ7 A;  2C22 A;  1QLN A;  4P4O A;  1NZB A;  1UT8 A;  4ECS A;  8ICM A;  3MFI A;  4I2A A;  4UBC A;  5ALP A;  3IRU A;  4ECT A;  3S6J A;  1SIJ A;  4TUS A;  1T8E A;  5KFQ A;  5KFK A;  4IRC A;  1Q3U A;  1SL1 A;  8ICX A;  2ZJA A;  4M04 A;  3E2E A;  3B0X A;  5EE0 A;  3PSI A;  3QNM A;  4PGX A;  3BQT A;  2EAP A;  1D9D A;  1MSW D;  4QZD A;  2BKE A;  2G09 A;  3GQC A;  1ZQS A;  3BZC A;  5KFS A;  3C28 A;  4NL9 A;  3Q8S B;  5GTH U;  4Q8F A;  2I6X A;  5AKZ A;  4CE6 A;  4GC6 A;  7ICV A;  3JPP A;  2FLN A;  4DLE A;  1K5O A;  5AM1 A;  4GLX A;  3Q8Q B;  9ICI A;  2VAN A;  2Y9U A;  5G5H A;  4YR2 A;  2ZIU A;  3N97 B;  2NYV A;  3CW2 C;  4RQ0 A;  2FE9 A;  1UQV A;  3SV4 A;  1DGS A;  3EPG A;  2XGP A;  3ISC A;  4IQU A;  7ICQ A;  3RBD A;  4P2H A;  4QWA A;  2C28 A;  4C8M A;  2WF8 A;  4Q45 A;  2EZY A;  3GV5 B;  7ICN A;  4RQ4 A;  3GIM A;  4FBT A;  2VA2 A;  2QB1 A;  3K75 D;  1JXL A;  4Z6E A;  2LYB A;  1SV0 A;  2D3D A;  2F76 X;  1RZT A;  2ZIX A;  3IP4 B;  2HW3 A;  3T5H A;  3H8J A;  4Y2U A;  1KKX A;  3RH4 A;  3F53 A;  4Y2T A;  1NK7 A;  4EBE A;  2KV2 A;  1ECW A;  2F1I A;  3PZP A;  2LYH A;  9ICO A;  1HUZ A;  1TFR A;  2BQ3 A;  4UAT A;  5J29 A;  1L8O A;  3HX0 A;  2HHW A;  4C8K A;  1NK9 A;  3HP6 A;  5CP2 A;  1L7N A;  1X66 A;  2KD1 A;  4UB5 A;  3UQ2 A;  2DGZ A;  5KFI A;  4RU9 A;  2BCV A;  2CN1 A;  3I1Y A;  2DFL A;  3H8M A;  2GO7 A;  1S76 D;  5AI5 A;  3PSF A;  1KTQ A;  1U9L A;  3ZDA A;  2BCR A;  4UAU A;  2QAR A;  3V6H A;  1LKY A;  5JRT A;  1QTM A;  1QSY A;  5DG9 A;  3Q8L A;  4IR1 A;  1TAU A;  3M6Z A;  1NJZ A;  1JN3 A;  4KMU A;  1K1Q A;  2KSO B;  4YD2 A;  4RPX A;  2JHD A;  1F5S A;  2HOI A;  3PO4 A;  4ECQ A;  4DS5 A;  2EQY A;  4O3M A;  1SWV A;  3ZDE A;  2DL0 A;  5J2B A;  3PX0 A;  8ICA A;  4JWN A;  1Z00 B;  4OJP A;  4FE3 A;  3KOO A;  3AQF A;  4PHA A;  4O3N A;  4GC7 A;  4C4R A;  2KN7 A;  2XID A;  3Q8R B;  4ECR A;  1X6J A;  5HR7 A;  4RPY A;  2W7O A;  3GU3 A;  3PV8 A;  2NRX A;  4DOA A;  2H3Q A;  2Y1I A;  1N5X A;  3IG5 A;  3G6V A;  9ICM A;  4R63 A;  2KZ3 A;  3RBE A;  1BGX T;  2FPK A;  2K8B B;  3QYP A;  3I76 A;  2KHQ A;  1QQ5 A;  5TIS U;  3JPS A;  1ZOL A;  7ICE A;  3ZDC A;  4QNL A;  4I2E A;  1ZQZ A;  3QU5 A;  4PZO A;  3MDC A;  1NKC A;  1Q46 A;  3PW5 A;  5AI4 A;  3RJK A;  1N62 A;  3WK9 A;  2NRW A;  3MGV A;  4I2G A;  2W7P A;  9ICB A;  5AK6 A;  5KG3 A;  3KD3 A;  1S10 A;  8ICH A;  2W8K A;  4YD1 A;  1ZYQ A;  4O3R A;  4ED2 A;  2ZUB A;  4XRH A;  5BOL A;  2Y0S F;  3BDP A;  2DPJ A;  5KFH A;  3BS5 A;  4I2H A;  1M6Y A;  4Y2Y A;  4KN4 A;  4UB4 A;  4YN4 A;  1BNO A;  2IOF K;  1L3T A;  4DSI A;  1SKR A;  1FFV A;  4UAR A;  2W9M A;  2OEH A;  5G5G A;  5HNK A;  2K4I A;  2W43 A;  3RRG A;  3JPQ A;  2KJ5 A;  4I2F A;  2D6F C;  3L5K A;  2WB1 F;  3PX4 A;  2K89 A;  4RQN A;  4YXJ A;  1ZQA A;  7ICG A;  4DSJ A;  4P0Q B;  2I1Q A;  3ICX A;  1BPZ A;  4P0P A;  1ZQN A;  2BQR A;  3OSN A;  2JEF A;  3PMN A;  3C5G A;  5AK5 A;  3H0L B;  3PW0 A;  4X5V A;  1N61 A;  3TFR A;  4OD0 A;  1BPB A;  4J03 A;  3C21 A;  5KT3 A;  5DGA A;  3BQ2 A;  5KFN A;  1C20 A;  4CDG A;  9ICU A;  3M9O B;  1QH9 A;  3LVV A;  5AKH A;  2HI0 A;  2VKQ A;  4YR0 A;  1BPY A;  1ZRN A;  3H40 A;  1GO3 F;  4QZ9 A;  4F3O A;  3VC8 A;  4QZC A;  2C2E A;  4C4S A;  3IM1 A;  4UAY A;  2ZXI A;  2ZIV B;  1Z4O A;  2EAM A;  2EDU A;  3RJF A;  5ALU A;  1XSN A;  2BZF A;  2PFP A;  5KT4 A;  1NNL A;  5AI6 A;  2KVC A;  1RG6 A;  3JPN A;  5DG7 A;  4O3O A;  4ED0 A;  3OPX A;  1QSL A;  1A77 A;  1IV8 A;  1WUD A;  4YMM A;  1L8L A;  4B9S A;  4NLN A;  4QJF B;  4US9 A;  4IQV A;  4QZE A;  4I2D A;  3UQ0 A;  3K1R B;  5KG2 A;  2F1J A;  4JV2 A;  3PML A;  4QZA A;  4F5R A;  3RF9 A;  5DBC A;  3DDH A;  4DSF A;  2YN4 A;  1ZQG A;  1COK A;  5KG1 A;  2AGO A;  4XQ8 A;  7ICI A;  1JMS A;  1CI4 A;  2G5H B;  5AIB A;  1WWU A;  2P6U A;  5KFJ A;  1Z1V A;  4RQ6 A;  2LPE A;  1KEJ A;  1WWV A;  3JPO A;  2VA8 A;  3MGI A;  4KLD A;  3QU4 A;  1KBU A;  4PHD A;  1NJX A;  1QSS A;  2A1J B;  7ICO A;  4ED6 A;  2GOL A;  3C1Y A;  2W9A A;  8ICV A;  3AN1 A;  5EWG A;  7ICH A;  1N48 A;  2YML A;  3CRX A;  4DF4 A;  5KG6 A;  5ALR A;  2YMQ A;  2FLL A;  2ZG6 A;  1ZQB A;  3EWA A;  4M9J A;  2D8C A;  1TE2 A;  3SD7 A;  4F5Q A;  2F2A B;  4G3I A;  4JV1 A;  5AKG A;  3NTU A;  4QW8 A;  2UVU A;  2FJ6 A;  4KLS A;  4IQW A;  2JZB B;  4UAV A;  3M9N B;  1ZQI A;  5HP4 A;  2B0C A;  5AKJ A;  1TAQ A;  2FMS A;  3LDA A;  2BHN A;  3H4B A;  4DQP A;  3V7J A;  3HRD D;  4J9O A;  2OM6 A;  8ICZ A;  3AQE A;  1DGJ A;  4F72 A;  1D8L A;  3C5F A;  1Z3E B;  9ICC A;  3F5A A;  3NVY A;  2QB0 B;  2FLP A;  3WK6 A;  4RNN A;  1L7P A;  4DOC A;  5CR0 A;  4K4I A;  4U7C A;  3SQI A;  2MU2 A;  2ASJ A;  5HML A;  9ICQ A;  2JEJ A;  1JUD A;  3BQ1 A;  3C23 A;  3SMV A;  5L1L A;  2AQ0 A;  3BS7 A;  2ESE A;  3WU2 U;  3ZD8 A;  5J0Y A;  4QZH A;  2IBK A;  3KHG A;  5ALX A;  2RDI A;  4I27 A;  4B9T A;  1J97 A;  5L1M A;  1NKE A;  4B9N A;  3WK5 A;  4JUZ A;  7ICF A;  1IIP A;  5ALG A;  4KX5 A;  1S8O A;  5DBB A;  4R66 A;  3GV8 B;  3SEN A;  1PK3 A;  4PHE A;  3UPQ A;  5ALZ A;  3HT3 A;  3WKC A;  4NL9 C;  5ALL A;  1X2I A;  1S0O A;  2LKY A;  3VCB A;  2KFZ A;  2GWS A;  1S5L U;  4DOB A;  5AKK A;  5KG5 A;  5ALW A;  3RB3 A;  2P35 A;  4IL6 U;  2V9W A;  5AIA A;  2VIX A;  5J2F A;  4QZG A;  5KG0 A;  5J8Y A;  3KBB A;  2K8A A;  1T7P A;  4EZ6 A;  1T3N A;  4ACO A;  2YB4 A;  2J6T A;  4O5K A;  1NJW A;  5BPC A;  2FDR A;  2HHU A;  2LI6 A;  2KSO A;  5AKI A;  3ORY A;  4NJ8 A;  3SI8 A;  4QIW F;  4QW9 A;  1RYR A;  5HHI A;  8ICC A;  1JXE A;  1F44 A;  1SV0 C;  1NK8 A;  8ICE A;  2BPG A;  3PR4 A;  1NI3 A;  2IA6 A;  3GIL A;  5EOZ A;  2DPI A;  1NK0 A;  2Y0S C;  5CJ7 A;  1NK5 A;  3GII A;  2NO5 A;  4UB8 U;  4EX7 A;  2HHQ A;  4J9P A;  4DLG A;  4EX6 A;  4FO6 A;  4M9N A;  3QUT A;  4M0A A;  3GIK A;  4RT3 A;  2NV3 A;  4OO1 J;  3QX7 A;  4KLM A;  3OSP A;  1RYU A;  2WB1 C;  3D2S A;  3CYM A;  3RTV A;  5DKW A;  5H2F U;  4YR3 A;  4LVS A;  4FZN A;  4J9R A;  1U45 A;  3UXN A;  3IN5 A;  4DQR A;  5DG8 A;  5DB9 A;  1L7M A;  2JV3 A;  5III A;  2HBL A;  4PL1 A;  2ZUC A;  1QCK A;  1PZN A;  1Q3V A;  2XCA A;  4Y2X A;  3H8W A;  3AMZ A;  3KZI U;  3G6X A;  8ICW A;  1UCV A;  2H5X A;  3LWL A;  5AM4 A;  2DKZ A;  4ECZ A;  2ALZ A;  3AU2 A;  1X42 A;  1D9F A;  5ALV A;  4ECV A;  1QQ6 A;  3WKB A;  2IOF A;  4FS1 A;  5CHG A;  4M6W B;  3TAP A;  3RH5 A;  1ZQX A;  4KLI A;  4K4G A;  4OJ6 A;  9ICA A;  3TKA A;  2JH7 A;  4RQ2 A;  5KFE A;  3OGU A;  2EAN A;  3GZF A;  3SAH A;  3L4P A;  4JWM A;  7ICU A;  1X40 A;  3A0B U;  2R8J A;  3ZDD A;  7ICJ A;  4Y2R A;  4B9M A;  1PVQ A;  3T3F A;  4DEZ A;  3GFK B;  2A1A A;  8ICI A;  5D4B A;  3V6J A;  5KFD A;  1JRO A;  1NK4 A;  2ZXH A;  2NRV A;  2HMX A;  5ALO A;  2BCU A;  4ZOH C;  1HIW A;  1X9S A;  3EW9 A;  2PKE A;  1HJP A;  4HYK A;  5KNI A;  2ATL A;  1ZQK A;  4BXO B;  2HOF A;  3PR5 B;  2GH1 A;  2DF4 B;  4NWI A;  2RQ5 A;  5J2D A;  3UMG A;  4ECU A;  2BGW A;  1JI7 A;  2BPC A;  3KHL A;  4YVZ A;  4GIB A;  4CNQ A;  3SZ2 A;  1VLB A;  1QQ7 A;  2CXY A;  2XY7 A;  2HVH A;  1ZD3 A;  1ZQU A;  3KZX A;  3TI0 A;  1ZQF A;  8ICR A;  3KHR A;  8ICP A;  3BZK A;  4F92 B;  4CF5 A;  3NUQ A;  4AP9 A;  3WKE A;  3NVZ A;  4YFK A;  4YCX A;  3SV3 A;  5KT5 A;  3PW7 A;  4DCC A;  4TUQ A;  2ZTE A;  2K60 A;  3OTQ A;  1CEZ A;  1ZQL A;  4Y2Q A;  5HMM A;  1KFT A;  2W54 A;  4MFF A;  2FI1 A;  1NKB A;  1V85 A;  2F8L A;  4F4Y A;  1J2M A;  9ICP A;  2R18 A;  4DL2 A;  3RFA A;  4EBC A;  1XO0 A;  5L1J A;  2Z7J A;  5IIL A;  5KFV A;  2PI4 A;  3SYZ A;  2XGQ A;  5KL1 B;  2ZIW B;  1DRG A;  4DFJ A;  2AHO B;  1KL9 A;  2V4Q A;  4ECW A;  2ISO A;  1COO A;  2KMD A;  5D46 A;  2BCQ A;  1BVS A;  3C2K A;  4O9M A;  4JK1 A;  2BDU A;  2C2R A;  3AUO A;  3ETR A;  9ICL A;  2W9C B;  1PK1 B;  3QEB Z;  4R8U A;  4KMO B;  4YMN A;  3ONN A;  1UA1 A;  1WCN A;  2A3V A;  4BUG A;  2IHM A;  3N7P D;  4Z6D A;  4USA A;  1O03 A;  2JEI A;  2W9B B;  3M1Y A;  2BQU A;  2IMW P;  2EH9 A;  3WK7 A;  2O6K A;  4EEN A;  3TAD A;  3UM9 A;  4Z6F A;  5L9X A;  2LYA A;  4C8N A;  1KW4 A;  2A1J A;  2YTU A;  1RPL A;  3QUQ A;  4OJ5 A;  4PJ0 U;  3GDX A;  3EPI A;  2YB1 A;  5IIJ A;  5AI9 A;  4QWD A;  9ICF A;  3RH6 A;  2J6U A;  4E0D A;  3J81 j;  4F8R A;  3ALR A;  3MBY A;  2ASL A;  2MAX A;  4UB3 A;  5DBA A;  2DUY A;  4CCH A;  4DS4 A;  3MR6 A;  1WCL A;  2KJ9 A;  5DLG A;  3FYH A;  2E1E A;  5J2E A;  3Q8M A;  5J2K A;  4ELU A;  3NS1 A;  1OW5 A;  4DL3 A;  1ZXI A;  2PFQ A;  2JZB A;  4IRK A;  3RR8 A;  1SGG A;  4LZG A;  2KIV A;  3MC1 A;  1V38 A;  4KN7 A;  4BWM A;  4UAZ A;  2UVW A;  4I29 A;  2DKX A;  2FMQ A;  2KKV A;  4U6P A;  5J2A A;  4Y2S A;  4RNM A;  3EYZ A;  4F5N A;  3WK4 A;  1ZQV A;  5AM2 A;  3MGH A;  2QB0 A;  2AQ4 A;  1XSP A;  4C4T A;  4BX9 C;  2LM4 A;  1TV9 A;  4F93 B;  2GLE A;  5HHH A;  2G07 A;  2JRZ A;  2G0A A;  5L1K A;  4NM1 A;  3FC4 A;  2KJ8 A;  1PVP A;  4HAI A;  2AGQ A;  2WF6 A;  2A19 A;  4IC9 A;  1S0V A;  3QUC A;  3U26 A;  5DB7 A;  3N4M B;  2CRX A;  2JEG A;  5KT7 A;  4QIW C;  4QZF A;  3RB0 A;  5DQG A;  1ZD4 A;  5DQH A;  8ICQ A;  2KE7 A;  3QEA Z;  1ZQT A;  4DFP A;  1A6S A;  1U47 A;  1L5U A;  2KKP A;  8ICO A;  2LBO A;  3T5K A;  8ICG A;  7ICT A;  9ICX A;  5ALS A;  2H3I A;  4EYI B;  1TVA A;  4MEX A;  2G08 A;  3OJU A;  5KFP A;  1N2X A;  9ICE A;  4PL2 A;  4RUA A;  4RZR A;  1HEK A;  1IXR A;  3PW4 A;  8ICK A;  5ALH A;  2WAQ F;  2YMP A;  3C2M A;  2I5H A;  2LM1 A;  5ALI A;  4J9N A;  4Q8E A;  3BQ7 A;  4F91 B;  1J2N A;  3C2L A;  1S97 A;  1X9X A;  8ICT A;  5AKX A;  5F9L A;  9ICW A;  2FPM A;  5KTQ A;  1Q8K A;  1D8B A;  2KVS A;  4KLT A;  1Z19 A;  1H38 A;  3OJS A;  3G6Y A;  5J0Q A;  3M8R A;  4JV0 A;  1KFD A;  3QE9 Y;  2BDP A;  1TK8 A;  2UVR A;  3F2C A;  4M47 A;  4I2J A;  1ZD5 A;  2Y9T A;  3QU9 A;  1DOQ A;  1L6N A;  2OH2 A;  5AIC A;  3C1Z A;  1A76 A;  4DSK A;  2K4P A;  2W04 A;  2HHS A;  4ED1 A;  4P4P A;  2BR0 A;  2K4H A;  5KFX A;  1MA7 A;  2HHV A;  3TAN A;  5KFY A;  5J2H A;  4EEL A;  2F44 A;  3MR5 A;  4EEK A;  3CP8 A;  1BPD A;  2E8M A;  4DFM A;  1N56 A;  1T4G A;  1RXW A;  1ZJM A;  1BPE A;  3ISB A;  1KN5 A;  2OYY A;  4I2B A;  2W11 A;  3JPT A;  4KLE A;  9ICK A;  3KFU F;  4MEY A;  4F4K A;  1FIQ A;  3V6K A;  3NGD A;  3WKA A;  5CWR A;  1ZD2 P;  5KFR A;  2QKQ A;  5KFM A;  9ICG A;  3KKA A;  2Q4T A;  2VJ4 A;  2PXI A;  2KNJ A;  1U48 A;  4KLH A;  2XVT A;  5J8Y C;  1A0P A;  1YZ6 A;  9ICR A;  1L3U A;  3A0H U;  1SWW A;  4DF8 A;  2EZX A;  4P0P B;  4KLF A;  7ICP A;  5J0R A;  2RLT A;  1B22 A;  3THV A;  1SKS A;  3KHH A;  5DDY A;  5DDM A;  4F4W A;  1RQN A;  1KFS A;  2KIC A;  1LVH A;  3RJH A;  4UAS A;  5JU5 A;  4UAW A;  2ISP A;  3TAC B;  2MA1 A;  2R8I A;  5ALN A;  5TZV A;  3O0F A;  5DLF A;  4RNO A;  5AI0 A;  1TK5 A;  2XY6 A;  1ZQR A;  3HKZ F;  5IIK A;  5AK3 A;  3MFH A;  1UA0 A;  5KFT A;  4TQR A;  4ECX A;  3IHQ B;  5J0S A;  2ZTC A;  4O5E A;  4FZM A;  4US8 A;  2PMZ F;  2HBK A;  5J0X A;  5DQI A;  3M6K A;  1VDV A;  4J9K A;  5ALK A;  2MRL A;  4DL5 A;  1ZQ1 C;  1ZQO A;  4JMU A;  4NLC A;  5KAF U;  3QXG A;  2QLT A;  3QZ7 A;  5KFZ A;  4RQ8 A;  2PI5 A;  5IIN A;  4KLL A;  1Z4N A;  4DQS A;  4AYB F;  2JGA A;  1IG6 A;  2OHF A;  4F5P A;  1KSP A;  2E1F A;  3QU2 A;  1S77 D;  4DFD A;  1Y88 A;  2KK0 A;  3SEI A;  4KLU A;  2OWO A;  1RXV A;  5FP0 A;  2NRT A;  3D2Q A;  4EEY A;  3JPR A;  1HUO A;  4RPZ A;  3RAX A;  2AU0 A;  4TQS A;  4QWB A;  3PY8 A;  2KTQ A;  3PST A;  1Z00 A;  5T14 A;  2J6S A;  4KLO A;  1SL0 A;  5AKL A;  2WTF A;  2I9G A;  3UXP A;  1N5W A;  1T94 A;  1ZQH A;  1ZRM A;  4ZH4 A;  1SXE A;  4DFK A;  2XCP A;  3RRH A;  2WHE A;  1DXS A;  3OHA A;  2ZIW A;  2XO7 A;  3ZI4 A;  1XU4 A;  4C7Y A;  3GV7 B;  4PZN A;  4C80 A;  3C29 A;  1N63 A;  3MR3 A;  2WF7 A;  2DBY A;  1TAM A;  3ZD9 A;  9ICH A;  1X9M A;  2YQE A;  4GXK A;  3RR7 A;  2Y1J A;  2W9C A;  1PK1 A;  7ICL A;  4NY8 A;  1TKD A;  1SB3 C;  9ICS A;  8ICF A;  3HWT A;  4YMO A;  5D49 A;  4NXZ A;  5F9N A;  2W9B A;  4UB1 A;  1NZP A;  2G5I B;  1ZQJ A;  2AGP A;  1SZH A;  1U4B A;  2AH5 A;  3T5J A;  2E8P A;  2R8H A;  1URJ A;  4EYH B;  1MQ3 A;  4I2I A;  2HBM A;  4MHV A;  2XIC A;  4BGD A;  1ZQM A;  3UXO A;  3OHB A;  2UVV A;  5J2I A;  2ODG A;  2HOQ A;  2G06 A;  2HBJ A;  4YXM A;  2IOH A;  4IRD A;  4EZ9 A;  2EZZ A;  4UB2 A;  3H0R B;  3BQ0 A;  3GIJ A;  2F3N A;  2WAQ C;  7ICR A;  4GFJ A;  3LYS A;  1BNP A;  5ALM A;  1U49 A;  4CRX A;  3PW2 A;  5C5J A;  3QZ8 A;  3DV9 A;  2BCS A;  2MUT B;  2B21 A;  3AM9 A; 
#chains in the Genus database with same CATH homology
 2QB1 A;  4RQN A;  1B0X A;  3SEN A;  2L5Y A;  1PK3 A;  3BS5 B;  1SV0 A;  2D3D A;  3IDW A;  1SXE A;  2JV3 A;  2ES6 A;  4NL9 C;  1SXD A;  2K60 A;  1F0M A;  1OW5 A;  1DXS A;  5JU5 A;  3HIL A;  1SGG A;  4PZN A;  1UCV A;  2KIV A;  1V85 A;  3TAC B;  2D8C A;  2DKZ A;  1V38 A;  2Y9T A;  1OXJ A;  2DKX A;  3TAD C;  4IS7 A;  1PK1 A;  1X66 A;  5J8Y A;  2QB0 A;  2E8N A;  2K4P A;  2E8O A;  2GLE A;  2EAN A;  1X40 A;  2EAP A;  3KKA C;  3H8M A;  2KMD A;  2B6G A;  4RQM A;  4NL9 A;  2KSO A;  4PZO A;  2E8P A;  2EAM A;  2F44 A;  4NJ8 A;  1PK1 B;  2KE7 A;  1SV4 A;  2QB0 B;  4MHV A;  1RG6 A;  1SV0 C;  2E8M A;  2QAR A;  1LKY A;  5JRT A;  5KNI A;  2Y9U A;  3TAD A;  2KG5 A;  3K1R B;  2LMR A;  2KSO B;  2F8K A;  1KW4 A;  3BS7 A;  2F3N A;  2FE9 A;  1UQV A;  2ESE A;  3BS5 A;  2YTU A;  1JI7 A;  3SEI A;  1COK A;  2QKQ A;  3KKA A;  5JTI A;  2QAR B;  5F3X B;  1LKY B;  1WWU A;  2DL0 A;  5L1M A;  1Z1V A;  5J8Y C;  3BQ7 A;  2LPE A;  1WWV A;  2EAO A;  1B4F A;  1X9X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...