1LKYA

Structure of the wild-type tel-sam polymer
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
77
structure length
77
Chain Sequence
SIRLPAHLRLQPIYWSRDDVAQWLKWAENEFSLRPIDSNTFEMNGKALLLLTKEDFRYRSPHSGDRLYELLQHILKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords TRANSCRIPTION FACTOR ETV6
publication title Native interface of the SAM domain polymer of TEL.
pubmed doi rcsb
source organism Homo sapiens
total genus 24
structure length 77
sequence length 77
chains with identical sequence C, E
ec nomenclature
pdb deposition date 2002-04-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 1lkyA00
1DXSA 4NJ8A 2ESEA 2D3DA 2QARA 2F8KA 2KE7A 2FE9A 5JTIA 1X66A 2Y9UA 3KKAA 2QB0B 4RQNA 2E8NA 3H8MA 5J8YC 2EAOA 1JI7A 2E8MA 2E8OA 2F3NA 3K1RB 4NL9A 2QARB 4RQMA 5F3XB 1OW5A 1X9XA 2QB1A 2K4PA 2LMRA 1OXJA 2DL0A 2DKZA 1PK1A 2YTUA 3BS5B 1B4FA 2ES6A 1LKYB 4PZOA 1PK3A 2JV3A 2F44A 1COKA 3BS7A 1B0XA 2E8PA 3TACB 2D8CA 3BS5A 2KSOB 1PK1B 1SV4A 2KMDA 2L5YA 3TADC 3SEIA 1LKYA 2EAPA 1RG6A 1SV0A 4MHVA 3SENA 1F0MA 1UCVA 2KSOA 5JU5A 1WWUA 5J8YA 3KKAC 2KG5A 2GLEA 1Z1VA 2QKQA 2DKXA 2LPEA 4NL9C 1SXDA 3BQ7A 1KW4A 2K60A 2Y9TA 2EANA 1WWVA 2KIVA 1SV0C 1UQVA 3IDWA 1X40A 4IS7A 2EAMA 3HILA 1SXEA 4PZNA 2QB0A 5KNIA 3TADA 1SGGA 2B6GA 1V38A 5L1MA 5JRTA 1V85A
chains in the Genus database with same CATH superfamily
3WKAA 1ZQRA 1HUOA 1ZQDA 5KFBA 3A0HU 3BZKA 1JXLA 3D6JA 1LV5A 3LWLA 3F2DA 4J9LA 1N61A 1Y88A 2MRLA 4M2YA 4YMNA 4M9HA 3BJYA 5D4BA 5KFRA 1Z3EB 5KFNA 4TURA 4YMOA 2Y0SF 1SL1A 1SKSA 5ALFA 1NK6A 5KT6A 4EEYA 2H3ZA 2XI9A 5AM4A 5AKXA 4M47A 4F3OA 5DBCA 3F53A 3BS5A 2C28A 4Y2UA 3JPOA 7ICJA 4MEXA 2DFLA 4QZ8A 1F0MA 9ICGA 2BCVA 1S5LU 1X6JA 3JPNA 1O08A 4KLIA 4I2DA 2ZXIA 3ORYA 2XO7A 1N2XA 1A0PA 3T3FA 1CRXA 3NVZA 3MDAA 4QZFA 9ICJA 1XWLA 1SXDA 1KW4A 3AQFA 1S97A 2K60A 2BKEA 1A77A 4F2RA 2YMPA 4OJOA 5KG3A 1QQ7A 4Y2VA 1BVSA 4LVSA 3QNMA 5KG1A 5J2HA 3L3FX 1DRGA 3UQ2A 5KAFU 3GIIA 3T5JA 5AI6A 4DWIA 2KVCA 2Y0SC 2KD1A 2W7PA 4ECXA 4JV2A 1F5SA 2HHSA 2A19A 4O0IA 3QZ8A 4MFFA 2UVWA 2Y1JA 5ALZA 1DXSA 2WAQC 2F8KA 3RB4A 3C5FA 4NLBA 2W8KA 3QU4A 3IRUA 2AQ0A 3ETLA 2MU2A 4DFPA 4F2SA 4FE3A 2JH7A 3M9OB 3C1ZA 3FAHA 5IIOA 1L7MA 1BPXA 5KTQA 4M9JA 2F8LA 3HKZF 2QARB 4HAIA 2FLPA 5DB9A 3FC4A 4K4IA 1ZD3A 2LM4A 3QU2A 7ICKA 2FMPA 2KP7A 4UB6U 1NJWA 2FPMA 2KV2A 4FFDA 4RU9A 4RNNA 3SQIA 5AKEA 5IIIA 4C4SA 3BS7A 1BPYA 3OSNA 3TADC 3CNHA 1TAUA 5KT3A 3KHLA 3LVVA 3OPXA 3NS1A 2IOHA 3I28A 8ICJA 3V72A 4DFMA 3C28A 1WCNA 4UBBA 4NLKA 2G5HB 3GQCA 3N7RC 3PX0A 2JRZA 4ECZA 1L8OA 4MFAA 3T5KA 5J2DA 2UVRA 4MFCA 3GILA 4XQ8A 3M8SA 5HMMA 1SV0C 4RZRA 2FPKA 3C2KA 3DV9A 5KG2A 4Y2QA 4JB3A 1YT3A 4F4ZA 2W8LA 2NO5A 5J0RA 3MGVA 3VC8A 4C8MA 3H7IA 5KFZA 5KNIA 4DQPA 1ZQTA 4F93B 1S0NA 1ZQKA 1T3NA 4KLDA 4CF3A 2YX8A 1QCKA 3QU9A 4Y2PA 4B9NA 2LYAA 4BGDA 2AHOB 5KFSA 1IV8A 1K1SA 2GO7A 4J9SA 4J9QA 5ALVA 2KKPA 3E58A 2YMQA 5IIKA 4PL2A 1ZD5A 1FIQA 2XCAA 4DSIA 4YP3A 3RB0A 4RQ7A 3MR6A 4US9A 2LMRA 3J81j 5KFUA 5KFGA 5DB7A 5J2CA 2XY5A 2BDUA 2B21A 9ICSA 2H3QA 2KZZA 3KD3A 2W04A 4QZ9A 4O9MA 1ZQOA 4R8UB 4PGQA 5KFDA 5KFOA 4YMMA 2ISOA 1QSYA 1JIHA 4R65A 5AI9A 3LWMA 1UCVA 2A1AA 4B9SA 2Q0ZX 3UMCA 2DUYA 2ZTDA 3RR8A 2PMZF 2JZBA 2IOFA 1ZQXA 5KL8B 5ALSA 4KLOA 5DDMA 4KLFA 2R8GA 4YN4A 4YCXA 8ICAA 3SV3A 2VA3A 1ZQ1C 7ICQA 1BGXT 3Q8MA 2NO4A 3AU2A 4R63A 4YD1A 1ZQYA 3UXPA 3EZ5A 5AIBA 3I1YA 3TADA 2UVVA 3M8RA 1ZETA 4J9RA 3KZIU 5J0UA 4F8RA 1L3SA 3JPTA 5KAIU 4YR2A 2H3FA 4US8A 3RH5A 4ACOA 4NWIA 5JTIA 5J29A 2V4RA 3RTVA 4DFDA 5AICA 1JX4A 4LZDA 2F2AB 2WF9A 5C5JA 2LYHA 4O5EA 5AKLA 4UASA 4JV0A 1SZPA 1RXWA 2M9NA 2KFNA 8ICFA 1KFDA 1X9MA 2YMLA 5J2FA 2ASJA 5KFQA 3K1ZA 2PMZC 1D8YA 3MGIA 4UB2A 1T4GA 4C4TA 1N5WA 4Y2XA 5A0LA 4I27A 1WCLA 3Q8QB 3MR5A 9ICAA 3LYSA 2PFPA 4DQRA 1SIJA 1NK4A 1Q3UA 4O3PA 4Z6FA 3GDXA 4TUQA 2CPRA 4O3SA 2KMDA 2JH1A 5AI0A 8ICYA 2DWQA 4J03A 4JWNA 3KHHA 8ICWA 3N7PD 1KSPA 3I76A 1VDVA 5KFEA 2FDRA 2XCPA 3IG5A 4RQ2A 4DL3A 5KG6A 3M7DA 1ZQMA 3HW8A 4F5OA 4DOCA 3LK9A 2OWOA 4CGZA 1TK8A 5J2JA 5DLGA 3PR5B 4RQ3A 1KRPA 5CWRA 3IDWA 2E5SA 3SMVA 3AMZA 2OXOA 2HSZA 4BX9C 2W43A 4RQ5A 5J2GA 3ZDAA 3NGDA 1FEZA 1ZQIA 3B9JA 9ICRA 4Y2SA 1B43A 1V38A 5F9NA 5L1IA 4GXKA 5AKJA 5DKWA 2ESEA 2D3DA 1U49A 4RUAA 4IRCA 2FE9A 2ZTCA 4NLZA 8ICZA 4EBDA 2BGWA 5ALHA 3ED5A 3KFUF 4ZH4A 3MC1A 4I2JA 2V9WA 3K1RB 3ZDEA 4UAVA 5ALIA 2YB1A 4DFJA 2HVIA 3ALRA 4JV1A 4EX7A 3GIMA 3PZPA 1V97A 1JRPA 1RYSA 2KJ9A 7ICPA 1IXRA 2HBMA 4J9MA 4KMOB 3MBYA 9ICIA 1KQQA 3UXOA 3RJJA 4DF8A 1Q3VA 4NV0A 1S77D 4U6PA 4QWBA 9ICNA 8ICLA 5C0YA 2KNJA 4WJ3B 5KFAA 3AL0B 2K8BB 2WF5A 3H0RB 3ISDA 2DKXA 3IM1A 5KFVA 5DBBA 3BQTA 4IRDA 4OJPA 1XO1A 4QZDA 3JPRA 4R66A 4QZBA 2GH1A 1SWWA 4R64A 2K4EA 4UQGA 2EZXA 8ICBA 4RUCA 2HBJA 4GXJA 4CCHA 3PNCA 2P6UA 4RPXA 4DS5A 4RQ1A 4F71A 3MFHA 1N62A 2PFNA 2AU0A 4PPXA 2JR5A 3DEEA 5JRTA 5J2AA 3QUQA 8ICHA 4EELA 8ICXA 3QUBA 2R8JA 1KLNA 4ICAA 5BOMA 2IOFK 4Q43A 2Y9UA 2PFOA 3Q8SB 2H3IA 4YQWA 5KFHA 1AROP 2NRZA 5EWGA 5ALGA 7ICRA 4DSEA 3ZI4A 5KG4A 2F3NA 1U48A 2HCFA 3C21A 3M9MB 2B0CA 3V7JA 5J2IA 5J0XA 4C4RA 2LHTA 4KLLA 1ED1A 5AHXA 4YFKA 5TISU 9ICQA 5AM0A 1RM6C 4P2HA 1L5UA 8ICPA 2E1FA 1Q46A 2PXIA 4CF5A 4O3RA 1AQ6A 1QLNA 3RBEA 4BUGA 2K4HA 1D9DA 3ZDBA 5J0SA 2E8PA 4ED7A 4YR0A 4KLQA 8ICKA 3B0YA 5K4LA 2QLTA 3C2MA 5TZVA 2O6KA 2CXYA 4DLEA 4I2EA 2E3TA 2VKQA 8ICEA 5KFXA 4LZGA 1LVHA 1J2MA 4UB8U 7ICGA 2F77X 2M0NA 4PHPA 8ICSA 2ZUCA 9ICEA 3RJIA 3MGHA 1ZQWA 1ZD2P 2JZBB 7ICUA 2LKYA 3WKEA 1Z1BA 2RRDA 3QU5A 2KTQA 3WK4A 2I6XA 1C20A 4Y2TA 1XSNA 4EX6A 3GIKA 3NRZA 3PMLA 4DFKA 1ZD4A 3E0FA 4QZGA 1FFVA 1HIWA 4I2AA 4TUSA 3IP4B 1PZNA 2OHFA 4DQSA 4QZIA 2Q4TA 4UAUA 2ZJAA 2AJQA 1N48A 1NK0A 3GV5B 4EYIB 2R18A 3M9NB 3UMGA 2ZUBA 4IQTA 1U9LA 4P4OA 1QSSA 3C23A 1PK1A 1ZQVA 1KTQA 3NRWA 3TFRA 2CN1A 4GFJA 1HEKA 1B4FA 4M04A 3PSFA 4YD2A 5ALJA 4PZOA 5JUMA 2W03A 3AN1A 1DGJA 3C2LA 2JV3A 1B0XA 2D8CA 4GC6A 1X9WA 1NJZA 4ELUA 4FS1A 3MR3A 3SENA 4X5VA 1ZQJA 3PSIA 1HUZA 3SAGA 1DOQA 2JEFA 3KKAC 3F5AA 4EZ9A 3EYZA 5AK3A 4YR3A 8ICTA 1DGSA 5H2FU 4RPZA 1M6YA 1NK9A 2HOQA 5EE3A 4UB4A 4DL2A 4O3MA 1NNLA 1UQVA 5ALUA 5DLFA 4DOBA 1X42A 4IS7A 4P0QB 1S0OA 1UT8A 2ALZA 1RXVA 2FLNA 5F9LA 5AK6A 2MUTB 4J9NA 4KN4A 2BPGA 3TAPA 3WKCA 3ZD8A 4F4XA 4A8EA 1PUZA 1NK7A 2VANA 4OO1J 2HHQA 4ED2A 3HKZC 1MSWD 4KLGA 5ALDA 4RQNA 3RRHA 4I2GA 4C8KA 2EAOA 2BCSA 3M6ZA 3PY8A 1S0MA 1JALA 4I29A 1XC9A 2P66A 2Z7JA 5J0OA 8ICQA 1TAQA 1ZQFA 2K4PA 4F50A 2KKVA 2OM6A 4M6WB 3O0FA 1L3VA 5HR6A 2DKZA 3GV7B 2JEJA 4ZOHC 3MABA 2KZ3A 5BPCA 1IIPA 3GV8B 1NKEA 5DB8A 2F44A 4Y2RA 7ICSA 7ICEA 2WFAA 3SAFA 2VA2A 3EUB2 5ALWA 2JXJA 3F5EA 1WUDA 2ASDA 3EW9A 8ICMA 5D46A 4F5PA 3UXNA 4AYBF 5HNKA 5KFLA 3R9KA 1ZQAA 4RQ6A 4DF4A 1Z1VA 4OCZA 5J0TA 3TFSA 3SV4A 2W9CB 1ZRNA 5T14A 2H3VA 3Q8LA 1TAMA 1BPEA 4KX5A 2RDIA 2BQUA 3PW4A 4NY8A 3CRXA 1ZRMA 4J9PA 2HMXA 4ECSA 5D49A 2HDOA 2BR0A 4KTQA 4C80A 2KICA 4M0AA 5ALMA 2OH2A 3IG8A 1PVRA 2IMWP 3F2CA 3PW7A 2QB0A 5ALEA 3U26A 3GZFA 1UPHA 2HI0A 3KTQA 1ZQUA 3N4MB 1V85A 4Q44A 3OHBA 4CF4A 2WB1F 2G09A 4NLNA 9ICVA 3WKDA 5KT4A 7ICNA 4K4HA 2P6RA 3T5LA 3RAXA 2A1JB 3KKAA 9ICPA 5EE9A 4UW9A 5CA7A 9ICKA 3THVA 2E8NA 1JROA 2HHVA 2HBKA 2E8MA 4YVZA 4UAWA 3WK6A 3NVVA 1T3QA 5F3XB 3LDAA 4KITB 4AYBC 3OJSA 2PFQA 9ICBA 2AXTU 4ECWA 2NRVA 5CEHA 1Q8KA 3M1YA 4FZLA 4QJFB 7ICOA 2R8KA 1LKYB 3ICXA 4F4YA 2VJ4A 3RJHA 5KT2A 4PGXA 4Q45A 3UMBA 3C29A 4EYHB 1UA0A 4M9LA 1P7DA 1UT5A 3RRGA 4UARA 5J0QA 2IHMA 2DPIA 2DBYA 2G07A 1SV0A 4MHVA 4TUPA 3OSPA 1MN8A 3RJGA 1L7PA 5KFYA 3ETRA 1NI3A 2WB1C 3HX0A 2FMSA 5J0PA 2WF6A 3QUCA 2LPEA 2ZIUA 4C7YA 1NZPA 3GFKB 3C5GA 4ECTA 3QU7A 2Y9TA 2EANA 3EPGA 2ZJ5A 3SYZA 4DSLA 4UB3A 2BQ3A 4DL5A 3BQ0A 2R8IA 1KFSA 3HILA 4Y2YA 4J9KA 1TK5A 2W11A 2K89A 2XC9A 5ALKA 4CE6A 1JN3A 4P0PB 4P0QA 1XSLA 5DQGA 1SKRA 1YZ6A 2MUTA 4B9MA 4B9UA 1N63A 1T94A 1X66A 4DQIA 5CHGA 4GXIA 4QZCA 3UPQA 5DG9A 5ALRA 3GU3A 4IQWA 2ASLA 2MA1A 4F5QA 2VJ5A 3V6JA 2KHQA 1QTMA 4PL1A 5KG0A 4DCCA 2C22A 4I2CA 9ICTA 5ALNA 4DSJA 1JMSA 1IG6A 1OXJA 1ZYQA 4C0ZA 2KJ8A 2XGQA 2YTUA 3GIJA 1N56A 3KOOA 4BJQA 4M6WA 1KBUA 3MDCA 8ICOA 2F1HA 5EWEA 2IHNA 1PK1B 3RB6A 2L5YA 2W9BB 7ICHA 3M6KA 4P4MA 2YQEA 1MQ2A 2HOIA 4UAYA 4M9NA 2WHEA 5G5GA 3RF9A 5GTIU 4TQRA 5IINA 1VLBA 4F72A 4MF2A 5KG5A 2ZJ8A 5EE0A 7ICLA 1KFTA 8ICCA 5AKYA 2KN7A 2W9CA 3H4BA 3V6HA 5DG7A 1ZJMA 3IN5A 4B9LA 4DSFA 4I28A 2LYBA 1SXEA 5AM2A 4B9TA 2YB4A 3RFAA 1CI4A 4ED3A 1OUQA 3WK7A 1NZBA 1SWVA 1U4BA 3FYHA 8ICRA 2P35A 3CYMA 3PR4A 4QZEA 1ZQEA 1F44A 3RJFA 1ZQBA 3WK5A 1JI7A 1RQLA 2ZUDA 4CDGA 2A1JA 4RQMA 4C8NA 5DB6A 4I2IA 4DSKA 4KN7A 4XUSA 2QB1A 3HWTA 2BPFA 3TQ1A 1S9FA 4CRXA 2ATLA 1QH9A 3HP6A 5ALPA 3QEAZ 4RPYA 4KMUA 1K1QA 4RNOA 2EQYA 5KFCA 2D6FC 2K8AA 1TK0A 4GLXA 1HJPA 1Z4OA 1JUDA 2JHDA 3D2QA 4PHDA 2RHFA 3RBDA 3Q8KA 5G5HA 4Z6EA 4NM2A 3JPQA 1J2NA 1LKYA 4OD0A 4ED1A 4BXOB 1X2IA 4FZMA 4HYKA 5IIMA 5CRXA 1NK8A 3V7LA 4BWJA 3LVWA 1RPLA 3NVWA 3Q8RB 1N5XA 1C7YA 8ICUA 3D2NA 4ECYA 2PKEA 4EZ6A 5FP0A 5EOZA 3EPIA 3MR2A 3SR6A 1WWVA 2OCEA 5CR0A 3N97B 4K4GA 1URJA 3K4GA 5AKKA 5AI4A 5AM5A 3N7SC 1X9SA 3PMNA 3ONNA 2I1QA 4NLCA 2EDUA 2LM1A 3TI0A 7ICVA 1ECWA 3HRDD 2I5HA 2FLLA 2WTFA 3PVXA 4BDPA 1UHUA 4ELVA 2LI6A 2XVTA 5DDYA 4P0PA 1ZQHA 2QB0B 1QQ5A 5AIAA 2WAQF 2ZG6A 7ICFA 4Q8EA 4IR9A 4B6JA 3V6KA 1SL0A 2HHUA 3QYPA 2NRWA 2I9GA 1PVQA 2OEHA 5KL1B 4Z6CA 2DGZA 5AM3A 2V4QA 1ZOLA 2AGOA 1Z00B 3NTUA 5J0YA 4F5NA 2HOFA 2W3SA 1MQ3A 2YMMA 2KOBA 1D8LA 3DDHA 5DGBA 3OHAA 3RJKA 1BPDA 1A6SA 4MEYA 1PK3A 3WK8A 1COKA 3FDSA 3QX7A 1XO0A 3BQ2A 2DQNB 1MC8A 2KSOB 4DL7A 4RNMA 1N60A 9ICCA 1RQNA 5GTHU 2OYYA 4IQUA 5L1KA 4O3NA 1MA7A 3S6JA 1ZQLA 1Z19A 3SZ2A 2W9BA 2FJ6A 4F91B 3WK9A 2QKQA 2RP5A 3TAQA 5DQIA 1U45A 4IC9A 1CEZA 3HPOA 2F1JA 3PV8A 4KX3A 3WU2U 5KFWA 3N28A 3KHRA 1JXEA 1QSLA 4QWCA 2W9MA 1O03A 1TVAA 5ALXA 1X40A 4PHAA 3ZDDA 2G5IB 2ZIUB 4ED8A 4C8OA 2HHTA 2RLTA 2K8CB 3L4PA 3QUTA 4KLMA 3KHGA 1TFRA 4KLEA 1KDHA 3UQ0A 3TARA 3RH4A 4UBCA 3EWAA 1S0VA 4KLJA 5J8YC 2YN4A 2BZFA 2ZIVB 2E1EA 4PJ0U 1L3TA 3QXGA 2XICA 2KHVA 4ED6A 3JPPA 3V7KA 4F92B 2IA6A 1OW5A 3IHQB 4F5RA 2KIWA 2XY6A 2DL0A 5KT5A 2XY7A 4JUZA 3H40A 4IQVA 1XNSA 3AQEA 4QZHA 2HBLA 8ICIA 4E0DA 5DG8A 3F2BA 2J6SA 5KT7A 1BPZA 1X6IA 3ISBA 4PGYA 3PO4A 9ICXA 3SEIA 3ISCA 1RG6A 4UB1A 4DO9A 2Y1IA 5DGAA 2VIXA 3CW2C 3H8WA 5L1LA 3NASA 2W54A 5J0WA 2PI5A 1CUKA 4RT2A 4FO6A 5KFTA 4B9VA 1NKCA 4QZAA 3PX6A 4CNQA 4I2HA 4BXOA 1SZHA 2W7OA 9ICOA 4O5KA 5KFMA 4Z6DA 5HHIA 4M9GA 4FBTA 4UAZA 4NLGA 1L8LA 1NKBA 2NYVA 4QWAA 1BPBA 2XIDA 2YY6A 1TV9A 3ZDCA 3PSPA 3RH6A 2N1RA 3QZ7A 3AU6A 3B0XA 4OJ6A 3PW5A 4F4KA 2JEIA 3H0MB 1L3UA 2GWSA 2UVUA 4Q8FA 1KL9A 1SKWA 2AQ4A 1BNPA 4MF8A 5KFJA 5AI8A 7ICMA 2F76X 2B6GA 2ZIWB 5L1MA 4ECRA 4EBEA 3PW2A 3RB3A 4FS2A 1KKXA 1WG8A 4QIWF 2KK0A 1U47A 3SAHA 2R8HA 4KLHA 4QWDA 4QW9A 1RYRA 3RAQA 3H8MA 3PSTA 1RYUA 5IILA 2E8OA 4YXMA 5ALYA 2C2EA 4OJ5A 1D9FA 4QNLA 2ZIXB 2ODGA 2MSNA 4DS4A 2EZYA 4IL6U 1RZTA 2BCUA 4JK1A 2G06A 3E2EA 1L7NA 5KG7A 5DQHA 4KLUA 1Z00A 2VA8A 5KFPA 3RR7A 2AH5A 4G3IA 5KFFA 3CP8A 2NRXA 2WF7A 3H8JA 4YXJA 3TACB 3H8SA 4EENA 2HHXA 2EAPA 2WF8A 1SB3C 2BQRA 2FMQA 2KSOA 3PO5A 2F1IA 3T5HA 9ICWA 5J8YA 1S10A 1ZQGA 1NOMA 9ICMA 5ALOA 4OJLA 5J2KA 1TKDA 5B66U 4QIWC 4O5CA 1H38A 5AKHA 1ZQCA 5ALTA 4NL9C 3BQ7A 3PW0A 5CB1A 3A0BU 4ELTA 2K4IA 3UM9A 4IRKA 5CJ7A 3WKBA 2KEYA 5KFIA 2A3VA 5IIJA 2W3RA 4PHEA 3G6XA 4LJXA 2BHNA 2J6UA 3G6VA 3PX4A 4ECQA 5AKGA 5HMLA 4UATA 1QQ6A 1SGGA 5AI5A 2KJ5A 3BQ1A 1XS9D 2QARA 1NJYA 2KE7A 1GO3F 1ZJNA 2BPCA 4BWMA 2W55A 2HHWA 1ZXIA 4ECVA 4RQ0A 2JEGA 4Y2JA 5AM1A 4XA5A 4DLGA 5B5EU 2RDJA 3VCBA 4DEZA 2ZIVA 2JGAA 5ALQA 3SD7A 4P4PA 1RDFA 3QE9Y 1ZQSA 1ZQPA 4JMUA 2BCQA 5HP4A 3BS5B 2KFZA 1WYGA 2BDPA 8ICGA 3JPSA 4GC7A 5HR7A 2KVSA 1SV4A 1IM4A 2EH9A 5ALLA 4AP9A 3AM9A 2HW3A 4F4WA 4DOAA 5AK5A 5JU5A 1NK5A 1WWUA 2KG5A 5BOLA 2IBKA 3SI8A 5EE1A 3D2SA 1ZQZA 5EWFA 2JMGA 4USAA 1DK3A 2ZXHA 4YG2A 2FI1A 4EBCA 4XRHA 4JWMA 1FFUA 3HJEA 2AGQA 3IV6A 1BNOA 4QW8A 2KZMA 2XGPA 2KIVA 1TE2A 1Z4NA 5AK4A 3ZD9A 4PH5A 4GIBA 3KZXA 9ICHA 4RQ4A 3FM9A 2EAMA 3C1YA 4NXZA 5AKIA 1J97A 1S8OA 1S76D 2CRXA 5DBAA 3RJEA 4NM1A 1L7OA 3H0LB 1L6NA 3G6YA 4FBUA 1B22A 1FO4A 2DF4B 4NJ8A 3MFIA 7ICTA 2G08A 3BDPA 7ICIA 3OGUA 2NRTA 4DL6A 2ZIWA 1ZQQA 1T7PA 3OJUA 2C2RA 4C8LA 4G9BA 4NL9A 1XSPA 1D8BA 3L5KA 2FPLA 1NJXA 1XU4A 1X9XA 2AGPA 4O3QA 4J9OA 4R8UA 2ISPA 8ICNA 3BZCA 2H5XA 3K75D 2NV3A 2ZIXA 1UA1A 2ES6A 9ICFA 1K5OA 3NVYA 1VJ5A 5HHHA 4ED0A 4KLSA 4I2BA 9ICLA 4RQ8A 1LB2B 3OTQA 4C7ZA 3QEBZ 5AKZA 1EXNA 5J2BA 2DPJA 4I2FA 3AEVA 2BCRA 3NUQA 2LBOA 8ICVA 1T8EA 4RT3A 1V9PA 2G0AA 3TANA 5E79U 5J2EA 2GLEA 2ZTEA 4KLTA 2MAXA 2J6TA 4EEKA 4QWEA 2HVHA 5L1JA 3TKAA 4TQSA 5L9XA 4DL4A 1SL2A 5KFKA 3KBBA 1PVPA 1ZQNA 9ICUA 4DQQA 2RQ5A 1KEJA 1COOA 1DK2A 1YZ7A 2PI4A 1KN5A 2EZZA 1A76A 3HT3A 3Q8PB 4ECUA 3AUOA 4IR1A 4PZNA 4UB5A 4U7CA 4O3OA 2C2DA 3H4DA 4FZNA 5CP2A 3T79A 2W9AA 2GOLA
chains in the Genus database with same CATH topology
1DXSA 4NJ8A 2ESEA 2D3DA 2QARA 2F8KA 2KE7A 2FE9A 5JTIA 1X66A 2Y9UA 3KKAA 2QB0B 4RQNA 2E8NA 3H8MA 5J8YC 2EAOA 1JI7A 2E8MA 2E8OA 2F3NA 3K1RB 4NL9A 2QARB 4RQMA 5F3XB 1OW5A 1X9XA 2QB1A 2K4PA 2LMRA 1OXJA 2DL0A 2DKZA 1PK1A 2YTUA 3BS5B 1B4FA 2ES6A 1LKYB 4PZOA 1PK3A 2JV3A 2F44A 1COKA 3BS7A 1B0XA 2E8PA 3TACB 2D8CA 3BS5A 2KSOB 1PK1B 1SV4A 2KMDA 2L5YA 3TADC 3SEIA 1LKYA 2EAPA 1RG6A 1SV0A 4MHVA 3SENA 1F0MA 1UCVA 2KSOA 5JU5A 1WWUA 5J8YA 3KKAC 2KG5A 2GLEA 1Z1VA 2QKQA 2DKXA 2LPEA 4NL9C 1SXDA 3BQ7A 1KW4A 2K60A 2Y9TA 2EANA 1WWVA 2KIVA 1SV0C 1UQVA 3IDWA 1X40A 4IS7A 2EAMA 3HILA 1SXEA 4PZNA 2QB0A 5KNIA 3TADA 1SGGA 2B6GA 1V38A 5L1MA 5JRTA 1V85A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DXS A;  4NJ8 A;  2ESE A;  2D3D A;  2QAR A;  2F8K A;  2KE7 A;  2FE9 A;  5JTI A;  1X66 A;  2Y9U A;  3KKA A;  2QB0 B;  4RQN A;  2E8N A;  3H8M A;  5J8Y C;  2EAO A;  1JI7 A;  2E8M A;  2E8O A;  2F3N A;  3K1R B;  4NL9 A;  2QAR B;  4RQM A;  5F3X B;  1OW5 A;  1X9X A;  2QB1 A;  2K4P A;  2LMR A;  1OXJ A;  2DL0 A;  2DKZ A;  1PK1 A;  2YTU A;  3BS5 B;  1B4F A;  2ES6 A;  1LKY B;  4PZO A;  1PK3 A;  2JV3 A;  2F44 A;  1COK A;  3BS7 A;  1B0X A;  2E8P A;  3TAC B;  2D8C A;  3BS5 A;  2KSO B;  1PK1 B;  1SV4 A;  2KMD A;  2L5Y A;  3TAD C;  3SEI A;  1LKY A;  2EAP A;  1RG6 A;  1SV0 A;  4MHV A;  3SEN A;  1F0M A;  1UCV A;  2KSO A;  5JU5 A;  1WWU A;  5J8Y A;  3KKA C;  2KG5 A;  2GLE A;  1Z1V A;  2QKQ A;  2DKX A;  2LPE A;  4NL9 C;  1SXD A;  3BQ7 A;  1KW4 A;  2K60 A;  2Y9T A;  2EAN A;  1WWV A;  2KIV A;  1SV0 C;  1UQV A;  3IDW A;  1X40 A;  4IS7 A;  2EAM A;  3HIL A;  1SXE A;  4PZN A;  2QB0 A;  5KNI A;  3TAD A;  1SGG A;  2B6G A;  1V38 A;  5L1M A;  5JRT A;  1V85 A; 
#chains in the Genus database with same CATH topology
 3WKA A;  1ZQR A;  1HUO A;  1ZQD A;  5KFB A;  3A0H U;  3BZK A;  1JXL A;  3D6J A;  1LV5 A;  3LWL A;  3F2D A;  4J9L A;  1N61 A;  1Y88 A;  2MRL A;  4M2Y A;  4YMN A;  4M9H A;  3BJY A;  5D4B A;  5KFR A;  1Z3E B;  5KFN A;  4TUR A;  4YMO A;  2Y0S F;  1SL1 A;  1SKS A;  5ALF A;  1NK6 A;  5KT6 A;  4EEY A;  2H3Z A;  2XI9 A;  5AM4 A;  5AKX A;  4M47 A;  4F3O A;  5DBC A;  3F53 A;  3BS5 A;  2C28 A;  4Y2U A;  3JPO A;  7ICJ A;  4MEX A;  2DFL A;  4QZ8 A;  1F0M A;  9ICG A;  2BCV A;  1S5L U;  1X6J A;  3JPN A;  1O08 A;  4KLI A;  4I2D A;  2ZXI A;  3ORY A;  2XO7 A;  1N2X A;  1A0P A;  3T3F A;  1CRX A;  3NVZ A;  3MDA A;  4QZF A;  9ICJ A;  1XWL A;  1SXD A;  1KW4 A;  3AQF A;  1S97 A;  2K60 A;  2BKE A;  1A77 A;  4F2R A;  2YMP A;  4OJO A;  5KG3 A;  1QQ7 A;  4Y2V A;  1BVS A;  4LVS A;  3QNM A;  5KG1 A;  5J2H A;  3L3F X;  1DRG A;  3UQ2 A;  5KAF U;  3GII A;  3T5J A;  5AI6 A;  4DWI A;  2KVC A;  2Y0S C;  2KD1 A;  2W7P A;  4ECX A;  4JV2 A;  1F5S A;  2HHS A;  2A19 A;  4O0I A;  3QZ8 A;  4MFF A;  2UVW A;  2Y1J A;  5ALZ A;  1DXS A;  2WAQ C;  2F8K A;  3RB4 A;  3C5F A;  4NLB A;  2W8K A;  3QU4 A;  3IRU A;  2AQ0 A;  3ETL A;  2MU2 A;  4DFP A;  4F2S A;  4FE3 A;  2JH7 A;  3M9O B;  3C1Z A;  3FAH A;  5IIO A;  1L7M A;  1BPX A;  5KTQ A;  4M9J A;  2F8L A;  3HKZ F;  2QAR B;  4HAI A;  2FLP A;  5DB9 A;  3FC4 A;  4K4I A;  1ZD3 A;  2LM4 A;  3QU2 A;  7ICK A;  2FMP A;  2KP7 A;  4UB6 U;  1NJW A;  2FPM A;  2KV2 A;  4FFD A;  4RU9 A;  4RNN A;  3SQI A;  5AKE A;  5III A;  4C4S A;  3BS7 A;  1BPY A;  3OSN A;  3TAD C;  3CNH A;  1TAU A;  5KT3 A;  3KHL A;  3LVV A;  3OPX A;  3NS1 A;  2IOH A;  3I28 A;  8ICJ A;  3V72 A;  4DFM A;  3C28 A;  1WCN A;  4UBB A;  4NLK A;  2G5H B;  3GQC A;  3N7R C;  3PX0 A;  2JRZ A;  4ECZ A;  1L8O A;  4MFA A;  3T5K A;  5J2D A;  2UVR A;  4MFC A;  3GIL A;  4XQ8 A;  3M8S A;  5HMM A;  1SV0 C;  4RZR A;  2FPK A;  3C2K A;  3DV9 A;  5KG2 A;  4Y2Q A;  4JB3 A;  1YT3 A;  4F4Z A;  2W8L A;  2NO5 A;  5J0R A;  3MGV A;  3VC8 A;  4C8M A;  3H7I A;  5KFZ A;  5KNI A;  4DQP A;  1ZQT A;  4F93 B;  1S0N A;  1ZQK A;  1T3N A;  4KLD A;  4CF3 A;  2YX8 A;  1QCK A;  3QU9 A;  4Y2P A;  4B9N A;  2LYA A;  4BGD A;  2AHO B;  5KFS A;  1IV8 A;  1K1S A;  2GO7 A;  4J9S A;  4J9Q A;  5ALV A;  2KKP A;  3E58 A;  2YMQ A;  5IIK A;  4PL2 A;  1ZD5 A;  1FIQ A;  2XCA A;  4DSI A;  4YP3 A;  3RB0 A;  4RQ7 A;  3MR6 A;  4US9 A;  2LMR A;  3J81 j;  5KFU A;  5KFG A;  5DB7 A;  5J2C A;  2XY5 A;  2BDU A;  2B21 A;  9ICS A;  2H3Q A;  2KZZ A;  3KD3 A;  2W04 A;  4QZ9 A;  4O9M A;  1ZQO A;  4R8U B;  4PGQ A;  5KFD A;  5KFO A;  4YMM A;  2ISO A;  1QSY A;  1JIH A;  4R65 A;  5AI9 A;  3LWM A;  1UCV A;  2A1A A;  4B9S A;  2Q0Z X;  3UMC A;  2DUY A;  2ZTD A;  3RR8 A;  2PMZ F;  2JZB A;  2IOF A;  1ZQX A;  5KL8 B;  5ALS A;  4KLO A;  5DDM A;  4KLF A;  2R8G A;  4YN4 A;  4YCX A;  8ICA A;  3SV3 A;  2VA3 A;  1ZQ1 C;  7ICQ A;  1BGX T;  3Q8M A;  2NO4 A;  3AU2 A;  4R63 A;  4YD1 A;  1ZQY A;  3UXP A;  3EZ5 A;  5AIB A;  3I1Y A;  3TAD A;  2UVV A;  3M8R A;  1ZET A;  4J9R A;  3KZI U;  5J0U A;  4F8R A;  1L3S A;  3JPT A;  5KAI U;  4YR2 A;  2H3F A;  4US8 A;  3RH5 A;  4ACO A;  4NWI A;  5JTI A;  5J29 A;  2V4R A;  3RTV A;  4DFD A;  5AIC A;  1JX4 A;  4LZD A;  2F2A B;  2WF9 A;  5C5J A;  2LYH A;  4O5E A;  5AKL A;  4UAS A;  4JV0 A;  1SZP A;  1RXW A;  2M9N A;  2KFN A;  8ICF A;  1KFD A;  1X9M A;  2YML A;  5J2F A;  2ASJ A;  5KFQ A;  3K1Z A;  2PMZ C;  1D8Y A;  3MGI A;  4UB2 A;  1T4G A;  4C4T A;  1N5W A;  4Y2X A;  5A0L A;  4I27 A;  1WCL A;  3Q8Q B;  3MR5 A;  9ICA A;  3LYS A;  2PFP A;  4DQR A;  1SIJ A;  1NK4 A;  1Q3U A;  4O3P A;  4Z6F A;  3GDX A;  4TUQ A;  2CPR A;  4O3S A;  2KMD A;  2JH1 A;  5AI0 A;  8ICY A;  2DWQ A;  4J03 A;  4JWN A;  3KHH A;  8ICW A;  3N7P D;  1KSP A;  3I76 A;  1VDV A;  5KFE A;  2FDR A;  2XCP A;  3IG5 A;  4RQ2 A;  4DL3 A;  5KG6 A;  3M7D A;  1ZQM A;  3HW8 A;  4F5O A;  4DOC A;  3LK9 A;  2OWO A;  4CGZ A;  1TK8 A;  5J2J A;  5DLG A;  3PR5 B;  4RQ3 A;  1KRP A;  5CWR A;  3IDW A;  2E5S A;  3SMV A;  3AMZ A;  2OXO A;  2HSZ A;  4BX9 C;  2W43 A;  4RQ5 A;  5J2G A;  3ZDA A;  3NGD A;  1FEZ A;  1ZQI A;  3B9J A;  9ICR A;  4Y2S A;  1B43 A;  1V38 A;  5F9N A;  5L1I A;  4GXK A;  5AKJ A;  5DKW A;  2ESE A;  2D3D A;  1U49 A;  4RUA A;  4IRC A;  2FE9 A;  2ZTC A;  4NLZ A;  8ICZ A;  4EBD A;  2BGW A;  5ALH A;  3ED5 A;  3KFU F;  4ZH4 A;  3MC1 A;  4I2J A;  2V9W A;  3K1R B;  3ZDE A;  4UAV A;  5ALI A;  2YB1 A;  4DFJ A;  2HVI A;  3ALR A;  4JV1 A;  4EX7 A;  3GIM A;  3PZP A;  1V97 A;  1JRP A;  1RYS A;  2KJ9 A;  7ICP A;  1IXR A;  2HBM A;  4J9M A;  4KMO B;  3MBY A;  9ICI A;  1KQQ A;  3UXO A;  3RJJ A;  4DF8 A;  1Q3V A;  4NV0 A;  1S77 D;  4U6P A;  4QWB A;  9ICN A;  8ICL A;  5C0Y A;  2KNJ A;  4WJ3 B;  5KFA A;  3AL0 B;  2K8B B;  2WF5 A;  3H0R B;  3ISD A;  2DKX A;  3IM1 A;  5KFV A;  5DBB A;  3BQT A;  4IRD A;  4OJP A;  1XO1 A;  4QZD A;  3JPR A;  4R66 A;  4QZB A;  2GH1 A;  1SWW A;  4R64 A;  2K4E A;  4UQG A;  2EZX A;  8ICB A;  4RUC A;  2HBJ A;  4GXJ A;  4CCH A;  3PNC A;  2P6U A;  4RPX A;  4DS5 A;  4RQ1 A;  4F71 A;  3MFH A;  1N62 A;  2PFN A;  2AU0 A;  4PPX A;  2JR5 A;  3DEE A;  5JRT A;  5J2A A;  3QUQ A;  8ICH A;  4EEL A;  8ICX A;  3QUB A;  2R8J A;  1KLN A;  4ICA A;  5BOM A;  2IOF K;  4Q43 A;  2Y9U A;  2PFO A;  3Q8S B;  2H3I A;  4YQW A;  5KFH A;  1ARO P;  2NRZ A;  5EWG A;  5ALG A;  7ICR A;  4DSE A;  3ZI4 A;  5KG4 A;  2F3N A;  1U48 A;  2HCF A;  3C21 A;  3M9M B;  2B0C A;  3V7J A;  5J2I A;  5J0X A;  4C4R A;  2LHT A;  4KLL A;  1ED1 A;  5AHX A;  4YFK A;  5TIS U;  9ICQ A;  5AM0 A;  1RM6 C;  4P2H A;  1L5U A;  8ICP A;  2E1F A;  1Q46 A;  2PXI A;  4CF5 A;  4O3R A;  1AQ6 A;  1QLN A;  3RBE A;  4BUG A;  2K4H A;  1D9D A;  3ZDB A;  5J0S A;  2E8P A;  4ED7 A;  4YR0 A;  4KLQ A;  8ICK A;  3B0Y A;  5K4L A;  2QLT A;  3C2M A;  5TZV A;  2O6K A;  2CXY A;  4DLE A;  4I2E A;  2E3T A;  2VKQ A;  8ICE A;  5KFX A;  4LZG A;  1LVH A;  1J2M A;  4UB8 U;  7ICG A;  2F77 X;  2M0N A;  4PHP A;  8ICS A;  2ZUC A;  9ICE A;  3RJI A;  3MGH A;  1ZQW A;  1ZD2 P;  2JZB B;  7ICU A;  2LKY A;  3WKE A;  1Z1B A;  2RRD A;  3QU5 A;  2KTQ A;  3WK4 A;  2I6X A;  1C20 A;  4Y2T A;  1XSN A;  4EX6 A;  3GIK A;  3NRZ A;  3PML A;  4DFK A;  1ZD4 A;  3E0F A;  4QZG A;  1FFV A;  1HIW A;  4I2A A;  4TUS A;  3IP4 B;  1PZN A;  2OHF A;  4DQS A;  4QZI A;  2Q4T A;  4UAU A;  2ZJA A;  2AJQ A;  1N48 A;  1NK0 A;  3GV5 B;  4EYI B;  2R18 A;  3M9N B;  3UMG A;  2ZUB A;  4IQT A;  1U9L A;  4P4O A;  1QSS A;  3C23 A;  1PK1 A;  1ZQV A;  1KTQ A;  3NRW A;  3TFR A;  2CN1 A;  4GFJ A;  1HEK A;  1B4F A;  4M04 A;  3PSF A;  4YD2 A;  5ALJ A;  4PZO A;  5JUM A;  2W03 A;  3AN1 A;  1DGJ A;  3C2L A;  2JV3 A;  1B0X A;  2D8C A;  4GC6 A;  1X9W A;  1NJZ A;  4ELU A;  4FS1 A;  3MR3 A;  3SEN A;  4X5V A;  1ZQJ A;  3PSI A;  1HUZ A;  3SAG A;  1DOQ A;  2JEF A;  3KKA C;  3F5A A;  4EZ9 A;  3EYZ A;  5AK3 A;  4YR3 A;  8ICT A;  1DGS A;  5H2F U;  4RPZ A;  1M6Y A;  1NK9 A;  2HOQ A;  5EE3 A;  4UB4 A;  4DL2 A;  4O3M A;  1NNL A;  1UQV A;  5ALU A;  5DLF A;  4DOB A;  1X42 A;  4IS7 A;  4P0Q B;  1S0O A;  1UT8 A;  2ALZ A;  1RXV A;  2FLN A;  5F9L A;  5AK6 A;  2MUT B;  4J9N A;  4KN4 A;  2BPG A;  3TAP A;  3WKC A;  3ZD8 A;  4F4X A;  4A8E A;  1PUZ A;  1NK7 A;  2VAN A;  4OO1 J;  2HHQ A;  4ED2 A;  3HKZ C;  1MSW D;  4KLG A;  5ALD A;  4RQN A;  3RRH A;  4I2G A;  4C8K A;  2EAO A;  2BCS A;  3M6Z A;  3PY8 A;  1S0M A;  1JAL A;  4I29 A;  1XC9 A;  2P66 A;  2Z7J A;  5J0O A;  8ICQ A;  1TAQ A;  1ZQF A;  2K4P A;  4F50 A;  2KKV A;  2OM6 A;  4M6W B;  3O0F A;  1L3V A;  5HR6 A;  2DKZ A;  3GV7 B;  2JEJ A;  4ZOH C;  3MAB A;  2KZ3 A;  5BPC A;  1IIP A;  3GV8 B;  1NKE A;  5DB8 A;  2F44 A;  4Y2R A;  7ICS A;  7ICE A;  2WFA A;  3SAF A;  2VA2 A;  3EUB 2;  5ALW A;  2JXJ A;  3F5E A;  1WUD A;  2ASD A;  3EW9 A;  8ICM A;  5D46 A;  4F5P A;  3UXN A;  4AYB F;  5HNK A;  5KFL A;  3R9K A;  1ZQA A;  4RQ6 A;  4DF4 A;  1Z1V A;  4OCZ A;  5J0T A;  3TFS A;  3SV4 A;  2W9C B;  1ZRN A;  5T14 A;  2H3V A;  3Q8L A;  1TAM A;  1BPE A;  4KX5 A;  2RDI A;  2BQU A;  3PW4 A;  4NY8 A;  3CRX A;  1ZRM A;  4J9P A;  2HMX A;  4ECS A;  5D49 A;  2HDO A;  2BR0 A;  4KTQ A;  4C80 A;  2KIC A;  4M0A A;  5ALM A;  2OH2 A;  3IG8 A;  1PVR A;  2IMW P;  3F2C A;  3PW7 A;  2QB0 A;  5ALE A;  3U26 A;  3GZF A;  1UPH A;  2HI0 A;  3KTQ A;  1ZQU A;  3N4M B;  1V85 A;  4Q44 A;  3OHB A;  4CF4 A;  2WB1 F;  2G09 A;  4NLN A;  9ICV A;  3WKD A;  5KT4 A;  7ICN A;  4K4H A;  2P6R A;  3T5L A;  3RAX A;  2A1J B;  3KKA A;  9ICP A;  5EE9 A;  4UW9 A;  5CA7 A;  9ICK A;  3THV A;  2E8N A;  1JRO A;  2HHV A;  2HBK A;  2E8M A;  4YVZ A;  4UAW A;  3WK6 A;  3NVV A;  1T3Q A;  5F3X B;  3LDA A;  4KIT B;  4AYB C;  3OJS A;  2PFQ A;  9ICB A;  2AXT U;  4ECW A;  2NRV A;  5CEH A;  1Q8K A;  3M1Y A;  4FZL A;  4QJF B;  7ICO A;  2R8K A;  1LKY B;  3ICX A;  4F4Y A;  2VJ4 A;  3RJH A;  5KT2 A;  4PGX A;  4Q45 A;  3UMB A;  3C29 A;  4EYH B;  1UA0 A;  4M9L A;  1P7D A;  1UT5 A;  3RRG A;  4UAR A;  5J0Q A;  2IHM A;  2DPI A;  2DBY A;  2G07 A;  1SV0 A;  4MHV A;  4TUP A;  3OSP A;  1MN8 A;  3RJG A;  1L7P A;  5KFY A;  3ETR A;  1NI3 A;  2WB1 C;  3HX0 A;  2FMS A;  5J0P A;  2WF6 A;  3QUC A;  2LPE A;  2ZIU A;  4C7Y A;  1NZP A;  3GFK B;  3C5G A;  4ECT A;  3QU7 A;  2Y9T A;  2EAN A;  3EPG A;  2ZJ5 A;  3SYZ A;  4DSL A;  4UB3 A;  2BQ3 A;  4DL5 A;  3BQ0 A;  2R8I A;  1KFS A;  3HIL A;  4Y2Y A;  4J9K A;  1TK5 A;  2W11 A;  2K89 A;  2XC9 A;  5ALK A;  4CE6 A;  1JN3 A;  4P0P B;  4P0Q A;  1XSL A;  5DQG A;  1SKR A;  1YZ6 A;  2MUT A;  4B9M A;  4B9U A;  1N63 A;  1T94 A;  1X66 A;  4DQI A;  5CHG A;  4GXI A;  4QZC A;  3UPQ A;  5DG9 A;  5ALR A;  3GU3 A;  4IQW A;  2ASL A;  2MA1 A;  4F5Q A;  2VJ5 A;  3V6J A;  2KHQ A;  1QTM A;  4PL1 A;  5KG0 A;  4DCC A;  2C22 A;  4I2C A;  9ICT A;  5ALN A;  4DSJ A;  1JMS A;  1IG6 A;  1OXJ A;  1ZYQ A;  4C0Z A;  2KJ8 A;  2XGQ A;  2YTU A;  3GIJ A;  1N56 A;  3KOO A;  4BJQ A;  4M6W A;  1KBU A;  3MDC A;  8ICO A;  2F1H A;  5EWE A;  2IHN A;  1PK1 B;  3RB6 A;  2L5Y A;  2W9B B;  7ICH A;  3M6K A;  4P4M A;  2YQE A;  1MQ2 A;  2HOI A;  4UAY A;  4M9N A;  2WHE A;  5G5G A;  3RF9 A;  5GTI U;  4TQR A;  5IIN A;  1VLB A;  4F72 A;  4MF2 A;  5KG5 A;  2ZJ8 A;  5EE0 A;  7ICL A;  1KFT A;  8ICC A;  5AKY A;  2KN7 A;  2W9C A;  3H4B A;  3V6H A;  5DG7 A;  1ZJM A;  3IN5 A;  4B9L A;  4DSF A;  4I28 A;  2LYB A;  1SXE A;  5AM2 A;  4B9T A;  2YB4 A;  3RFA A;  1CI4 A;  4ED3 A;  1OUQ A;  3WK7 A;  1NZB A;  1SWV A;  1U4B A;  3FYH A;  8ICR A;  2P35 A;  3CYM A;  3PR4 A;  4QZE A;  1ZQE A;  1F44 A;  3RJF A;  1ZQB A;  3WK5 A;  1JI7 A;  1RQL A;  2ZUD A;  4CDG A;  2A1J A;  4RQM A;  4C8N A;  5DB6 A;  4I2I A;  4DSK A;  4KN7 A;  4XUS A;  2QB1 A;  3HWT A;  2BPF A;  3TQ1 A;  1S9F A;  4CRX A;  2ATL A;  1QH9 A;  3HP6 A;  5ALP A;  3QEA Z;  4RPY A;  4KMU A;  1K1Q A;  4RNO A;  2EQY A;  5KFC A;  2D6F C;  2K8A A;  1TK0 A;  4GLX A;  1HJP A;  1Z4O A;  1JUD A;  2JHD A;  3D2Q A;  4PHD A;  2RHF A;  3RBD A;  3Q8K A;  5G5H A;  4Z6E A;  4NM2 A;  3JPQ A;  1J2N A;  1LKY A;  4OD0 A;  4ED1 A;  4BXO B;  1X2I A;  4FZM A;  4HYK A;  5IIM A;  5CRX A;  1NK8 A;  3V7L A;  4BWJ A;  3LVW A;  1RPL A;  3NVW A;  3Q8R B;  1N5X A;  1C7Y A;  8ICU A;  3D2N A;  4ECY A;  2PKE A;  4EZ6 A;  5FP0 A;  5EOZ A;  3EPI A;  3MR2 A;  3SR6 A;  1WWV A;  2OCE A;  5CR0 A;  3N97 B;  4K4G A;  1URJ A;  3K4G A;  5AKK A;  5AI4 A;  5AM5 A;  3N7S C;  1X9S A;  3PMN A;  3ONN A;  2I1Q A;  4NLC A;  2EDU A;  2LM1 A;  3TI0 A;  7ICV A;  1ECW A;  3HRD D;  2I5H A;  2FLL A;  2WTF A;  3PVX A;  4BDP A;  1UHU A;  4ELV A;  2LI6 A;  2XVT A;  5DDY A;  4P0P A;  1ZQH A;  2QB0 B;  1QQ5 A;  5AIA A;  2WAQ F;  2ZG6 A;  7ICF A;  4Q8E A;  4IR9 A;  4B6J A;  3V6K A;  1SL0 A;  2HHU A;  3QYP A;  2NRW A;  2I9G A;  1PVQ A;  2OEH A;  5KL1 B;  4Z6C A;  2DGZ A;  5AM3 A;  2V4Q A;  1ZOL A;  2AGO A;  1Z00 B;  3NTU A;  5J0Y A;  4F5N A;  2HOF A;  2W3S A;  1MQ3 A;  2YMM A;  2KOB A;  1D8L A;  3DDH A;  5DGB A;  3OHA A;  3RJK A;  1BPD A;  1A6S A;  4MEY A;  1PK3 A;  3WK8 A;  1COK A;  3FDS A;  3QX7 A;  1XO0 A;  3BQ2 A;  2DQN B;  1MC8 A;  2KSO B;  4DL7 A;  4RNM A;  1N60 A;  9ICC A;  1RQN A;  5GTH U;  2OYY A;  4IQU A;  5L1K A;  4O3N A;  1MA7 A;  3S6J A;  1ZQL A;  1Z19 A;  3SZ2 A;  2W9B A;  2FJ6 A;  4F91 B;  3WK9 A;  2QKQ A;  2RP5 A;  3TAQ A;  5DQI A;  1U45 A;  4IC9 A;  1CEZ A;  3HPO A;  2F1J A;  3PV8 A;  4KX3 A;  3WU2 U;  5KFW A;  3N28 A;  3KHR A;  1JXE A;  1QSL A;  4QWC A;  2W9M A;  1O03 A;  1TVA A;  5ALX A;  1X40 A;  4PHA A;  3ZDD A;  2G5I B;  2ZIU B;  4ED8 A;  4C8O A;  2HHT A;  2RLT A;  2K8C B;  3L4P A;  3QUT A;  4KLM A;  3KHG A;  1TFR A;  4KLE A;  1KDH A;  3UQ0 A;  3TAR A;  3RH4 A;  4UBC A;  3EWA A;  1S0V A;  4KLJ A;  5J8Y C;  2YN4 A;  2BZF A;  2ZIV B;  2E1E A;  4PJ0 U;  1L3T A;  3QXG A;  2XIC A;  2KHV A;  4ED6 A;  3JPP A;  3V7K A;  4F92 B;  2IA6 A;  1OW5 A;  3IHQ B;  4F5R A;  2KIW A;  2XY6 A;  2DL0 A;  5KT5 A;  2XY7 A;  4JUZ A;  3H40 A;  4IQV A;  1XNS A;  3AQE A;  4QZH A;  2HBL A;  8ICI A;  4E0D A;  5DG8 A;  3F2B A;  2J6S A;  5KT7 A;  1BPZ A;  1X6I A;  3ISB A;  4PGY A;  3PO4 A;  9ICX A;  3SEI A;  3ISC A;  1RG6 A;  4UB1 A;  4DO9 A;  2Y1I A;  5DGA A;  2VIX A;  3CW2 C;  3H8W A;  5L1L A;  3NAS A;  2W54 A;  5J0W A;  2PI5 A;  1CUK A;  4RT2 A;  4FO6 A;  5KFT A;  4B9V A;  1NKC A;  4QZA A;  3PX6 A;  4CNQ A;  4I2H A;  4BXO A;  1SZH A;  2W7O A;  9ICO A;  4O5K A;  5KFM A;  4Z6D A;  5HHI A;  4M9G A;  4FBT A;  4UAZ A;  4NLG A;  1L8L A;  1NKB A;  2NYV A;  4QWA A;  1BPB A;  2XID A;  2YY6 A;  1TV9 A;  3ZDC A;  3PSP A;  3RH6 A;  2N1R A;  3QZ7 A;  3AU6 A;  3B0X A;  4OJ6 A;  3PW5 A;  4F4K A;  2JEI A;  3H0M B;  1L3U A;  2GWS A;  2UVU A;  4Q8F A;  1KL9 A;  1SKW A;  2AQ4 A;  1BNP A;  4MF8 A;  5KFJ A;  5AI8 A;  7ICM A;  2F76 X;  2B6G A;  2ZIW B;  5L1M A;  4ECR A;  4EBE A;  3PW2 A;  3RB3 A;  4FS2 A;  1KKX A;  1WG8 A;  4QIW F;  2KK0 A;  1U47 A;  3SAH A;  2R8H A;  4KLH A;  4QWD A;  4QW9 A;  1RYR A;  3RAQ A;  3H8M A;  3PST A;  1RYU A;  5IIL A;  2E8O A;  4YXM A;  5ALY A;  2C2E A;  4OJ5 A;  1D9F A;  4QNL A;  2ZIX B;  2ODG A;  2MSN A;  4DS4 A;  2EZY A;  4IL6 U;  1RZT A;  2BCU A;  4JK1 A;  2G06 A;  3E2E A;  1L7N A;  5KG7 A;  5DQH A;  4KLU A;  1Z00 A;  2VA8 A;  5KFP A;  3RR7 A;  2AH5 A;  4G3I A;  5KFF A;  3CP8 A;  2NRX A;  2WF7 A;  3H8J A;  4YXJ A;  3TAC B;  3H8S A;  4EEN A;  2HHX A;  2EAP A;  2WF8 A;  1SB3 C;  2BQR A;  2FMQ A;  2KSO A;  3PO5 A;  2F1I A;  3T5H A;  9ICW A;  5J8Y A;  1S10 A;  1ZQG A;  1NOM A;  9ICM A;  5ALO A;  4OJL A;  5J2K A;  1TKD A;  5B66 U;  4QIW C;  4O5C A;  1H38 A;  5AKH A;  1ZQC A;  5ALT A;  4NL9 C;  3BQ7 A;  3PW0 A;  5CB1 A;  3A0B U;  4ELT A;  2K4I A;  3UM9 A;  4IRK A;  5CJ7 A;  3WKB A;  2KEY A;  5KFI A;  2A3V A;  5IIJ A;  2W3R A;  4PHE A;  3G6X A;  4LJX A;  2BHN A;  2J6U A;  3G6V A;  3PX4 A;  4ECQ A;  5AKG A;  5HML A;  4UAT A;  1QQ6 A;  1SGG A;  5AI5 A;  2KJ5 A;  3BQ1 A;  1XS9 D;  2QAR A;  1NJY A;  2KE7 A;  1GO3 F;  1ZJN A;  2BPC A;  4BWM A;  2W55 A;  2HHW A;  1ZXI A;  4ECV A;  4RQ0 A;  2JEG A;  4Y2J A;  5AM1 A;  4XA5 A;  4DLG A;  5B5E U;  2RDJ A;  3VCB A;  4DEZ A;  2ZIV A;  2JGA A;  5ALQ A;  3SD7 A;  4P4P A;  1RDF A;  3QE9 Y;  1ZQS A;  1ZQP A;  4JMU A;  2BCQ A;  5HP4 A;  3BS5 B;  2KFZ A;  1WYG A;  2BDP A;  8ICG A;  3JPS A;  4GC7 A;  5HR7 A;  2KVS A;  1SV4 A;  1IM4 A;  2EH9 A;  5ALL A;  4AP9 A;  3AM9 A;  2HW3 A;  4F4W A;  4DOA A;  5AK5 A;  5JU5 A;  1NK5 A;  1WWU A;  2KG5 A;  5BOL A;  2IBK A;  3SI8 A;  5EE1 A;  3D2S A;  1ZQZ A;  5EWF A;  2JMG A;  4USA A;  1DK3 A;  2ZXH A;  4YG2 A;  2FI1 A;  4EBC A;  4XRH A;  4JWM A;  1FFU A;  3HJE A;  2AGQ A;  3IV6 A;  1BNO A;  4QW8 A;  2KZM A;  2XGP A;  2KIV A;  1TE2 A;  1Z4N A;  5AK4 A;  3ZD9 A;  4PH5 A;  4GIB A;  3KZX A;  9ICH A;  4RQ4 A;  3FM9 A;  2EAM A;  3C1Y A;  4NXZ A;  5AKI A;  1J97 A;  1S8O A;  1S76 D;  2CRX A;  5DBA A;  3RJE A;  4NM1 A;  1L7O A;  3H0L B;  1L6N A;  3G6Y A;  4FBU A;  1B22 A;  1FO4 A;  2DF4 B;  4NJ8 A;  3MFI A;  7ICT A;  2G08 A;  3BDP A;  7ICI A;  3OGU A;  2NRT A;  4DL6 A;  2ZIW A;  1ZQQ A;  1T7P A;  3OJU A;  2C2R A;  4C8L A;  4G9B A;  4NL9 A;  1XSP A;  1D8B A;  3L5K A;  2FPL A;  1NJX A;  1XU4 A;  1X9X A;  2AGP A;  4O3Q A;  4J9O A;  4R8U A;  2ISP A;  8ICN A;  3BZC A;  2H5X A;  3K75 D;  2NV3 A;  2ZIX A;  1UA1 A;  2ES6 A;  9ICF A;  1K5O A;  3NVY A;  1VJ5 A;  5HHH A;  4ED0 A;  4KLS A;  4I2B A;  9ICL A;  4RQ8 A;  1LB2 B;  3OTQ A;  4C7Z A;  3QEB Z;  5AKZ A;  1EXN A;  5J2B A;  2DPJ A;  4I2F A;  3AEV A;  2BCR A;  3NUQ A;  2LBO A;  8ICV A;  1T8E A;  4RT3 A;  1V9P A;  2G0A A;  3TAN A;  5E79 U;  5J2E A;  2GLE A;  2ZTE A;  4KLT A;  2MAX A;  2J6T A;  4EEK A;  4QWE A;  2HVH A;  5L1J A;  3TKA A;  4TQS A;  5L9X A;  4DL4 A;  1SL2 A;  5KFK A;  3KBB A;  1PVP A;  1ZQN A;  9ICU A;  4DQQ A;  2RQ5 A;  1KEJ A;  1COO A;  1DK2 A;  1YZ7 A;  2PI4 A;  1KN5 A;  2EZZ A;  1A76 A;  3HT3 A;  3Q8P B;  4ECU A;  3AUO A;  4IR1 A;  4PZN A;  4UB5 A;  4U7C A;  4O3O A;  2C2D A;  3H4D A;  4FZN A;  5CP2 A;  3T79 A;  2W9A A;  2GOL A; 
#chains in the Genus database with same CATH homology
 1DXS A;  4NJ8 A;  2ESE A;  2D3D A;  2QAR A;  2F8K A;  2KE7 A;  2FE9 A;  5JTI A;  1X66 A;  2Y9U A;  3KKA A;  2QB0 B;  4RQN A;  2E8N A;  3H8M A;  5J8Y C;  2EAO A;  1JI7 A;  2E8M A;  2E8O A;  2F3N A;  3K1R B;  4NL9 A;  2QAR B;  4RQM A;  5F3X B;  1OW5 A;  1X9X A;  2QB1 A;  2K4P A;  2LMR A;  1OXJ A;  2DL0 A;  2DKZ A;  1PK1 A;  2YTU A;  3BS5 B;  1B4F A;  2ES6 A;  1LKY B;  4PZO A;  1PK3 A;  2JV3 A;  2F44 A;  1COK A;  3BS7 A;  1B0X A;  2E8P A;  3TAC B;  2D8C A;  3BS5 A;  2KSO B;  1PK1 B;  1SV4 A;  2KMD A;  2L5Y A;  3TAD C;  3SEI A;  1LKY A;  2EAP A;  1RG6 A;  1SV0 A;  4MHV A;  3SEN A;  1F0M A;  1UCV A;  2KSO A;  5JU5 A;  1WWU A;  5J8Y A;  3KKA C;  2KG5 A;  2GLE A;  1Z1V A;  2QKQ A;  2DKX A;  2LPE A;  4NL9 C;  1SXD A;  3BQ7 A;  1KW4 A;  2K60 A;  2Y9T A;  2EAN A;  1WWV A;  2KIV A;  1SV0 C;  1UQV A;  3IDW A;  1X40 A;  4IS7 A;  2EAM A;  3HIL A;  1SXE A;  4PZN A;  2QB0 A;  5KNI A;  3TAD A;  1SGG A;  2B6G A;  1V38 A;  5L1M A;  5JRT A;  1V85 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...