1LKYA

Structure of the wild-type tel-sam polymer
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
77
structure length
77
Chain Sequence
b'SIRLPAHLRLQPIYWSRDDVAQWLKWAENEFSLRPIDSNTFEMNGKALLLLTKEDFRYRSPHSGDRLYELLQHILKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTION FACTOR ETV6
publication title Native interface of the SAM domain polymer of TEL.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 24
structure length 77
sequence length 77
chains with identical sequence C, E
ec nomenclature
pdb deposition date 2002-04-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 1lkyA00
2ESEA 4RQMA 2F44A 2D3DA 3BQ7A 1JI7A 1UQVA 2DKZA 1SV0A 2Y9UA 2DL0A 4IS7A 1PK1A 3IDWA 2K4PA 1SGGA 1UCVA 4RQNA 5JRTA 1V38A 1DXSA 2ES6A 2QKQA 4NL9C 2QB0B 1SV4A 2QARB 1V85A 1F0MA 2L5YA 2KSOA 1COKA 1B4FA 3TADA 5JU5A 4NJ8A 1OXJA 2DKXA 1WWVA 1SXEA 2KMDA 1SXDA 3BS7A 2KG5A 1WWUA 2E8MA 3SENA 2QB1A 4PZOA 2EAOA 2Y9TA 2JV3A 2EAPA 5JTIA 1RG6A 2E8PA 2KE7A 1X40A 1B0XA 3KKAC 1PK1B 5J8YC 1LKYA 2LMRA 2LPEA 3BS5A 2YTUA 5KNIA 2FE9A 4PZNA 2B6GA 4NL9A 2F8KA 1Z1VA 2EAMA 2KSOB 5F3XB 1X9XA 5L1MA 1SV0C 2E8NA 3TACB 3K1RB 2K60A 1X66A 2EANA 2GLEA 2QB0A 3H8MA 2QARA 2E8OA 2F3NA 1KW4A 3SEIA 3TADC 2D8CA 1OW5A 1LKYB 3KKAA 4MHVA 2KIVA 1PK3A 5J8YA 3BS5B 3HILA
chains in the Genus database with same CATH superfamily
4NLGA 1H38A 4RUCA 4AYBF 3GDXA 5IIJA 2ZIXB 2W9AA 1N56A 3PR4A 5ALXA 2HBKA 4IQTA 4OO1J 2HHXA 2HCFA 2ZTDA 1FO4A 1L3UA 3MR2A 1SWVA 8ICCA 2HHTA 7ICUA 4NY8A 2W11A 5L9XA 3VC8A 3E2EA 3AM9A 1HUOA 4RPYA 1KRPA 2Y0SF 3NVVA 1A76A 3T5JA 3JPOA 3CNHA 1Z3EB 3RF9A 4ECWA 4JUZA 5KFTA 3PZPA 1ZQHA 1QTMA 1XNSA 4I2HA 2KG5A 5J2DA 5D46A 5D49A 2MAXA 2QB1A 4BJQA 4ELVA 2JV3A 5CA7A 1NKEA 2BPCA 2YN4A 4QJFB 1X40A 1T4GA 3C2MA 2MSNA 4GFJA 3CRXA 5J8YC 2LMRA 3RB4A 7ICRA 3MDCA 1DGJA 1BVSA 1WCNA 2W9MA 3KTQA 4KITB 9ICQA 4OJOA 2ISPA 1JMSA 2IA6A 5ALEA 5CR0A 2BPGA 1L5UA 3NRWA 3L5KA 8ICFA 5J2EA 4O9MA 4Y2PA 3BQTA 3K1RB 4NXZA 2OM6A 4O5KA 2E1EA 4JB3A 2AU0A 5J2HA 1VDVA 2ATLA 4I28A 3JPNA 2FPMA 1L7MA 2LHTA 4M9GA 4C4SA 4J9MA 1KDHA 3OHAA 4BWJA 5J2AA 3WKAA 3OTQA 1ZQQA 4NLKA 3BQ7A 3L3FX 4QWBA 4Y2UA 4KLUA 5AK6A 5D4BA 3QUQA 3LWLA 1ZQLA 4Y2VA 4F5QA 5ALHA 3QXGA 4DL3A 2ZUDA 2VA3A 4O3PA 2NRWA 5ALDA 1IM4A 3GILA 1L3TA 2BPFA 4IQWA 5DB7A 4RT2A 1ZJMA 1FEZA 4J9NA 1K5OA 2A3VA 3M1YA 1BPEA 2KMDA 3A0BU 5EWEA 3F5EA 3BZKA 4TUSA 2AJQA 9ICLA 2VKQA 2WF5A 3PW4A 4LZGA 2HI0A 3RR7A 1QLNA 2KKPA 4O5EA 4DSLA 2W9CB 4B9LA 4J03A 5KFJA 5KFXA 5T14A 3PW0A 1HIWA 2E8NA 3RH4A 1ZYQA 1HJPA 3Q8QB 4F8RA 2GOLA 2PFNA 1MC8A 5C5JA 3G6XA 1S5LU 4EBDA 3DDHA 4UASA 2DPIA 4F5OA 1RPLA 5HNKA 1L8OA 2B21A 5AM0A 7ICKA 2ZTEA 4YMOA 1O03A 4P0QA 5AKHA 3UQ2A 2LM4A 5L1IA 2WB1F 5ALGA 1RYRA 3D2SA 2BCQA 1ZETA 4DL5A 4BX9C 3RB6A 1YZ6A 1ZQFA 3E0FA 2CXYA 3H4DA 5AKIA 5KFBA 4YXJA 2V4RA 3F53A 3WK9A 3PX0A 2K4IA 4IQVA 4YMNA 4Y2SA 2YMPA 4KLHA 4WJ3B 4KLLA 2XI9A 2YMQA 2EZXA 4AYBC 3TAPA 4DFJA 2FLPA 5KT6A 4UAYA 4EBCA 5DG7A 5ALWA 1QSLA 3GFKB 2HW3A 3OSPA 4TUQA 1AROP 5AI4A 2VANA 4M6WB 3KHGA 4I2GA 2Y0SC 1ZD2P 3MR3A 3G6YA 2DQNB 2AH5A 1NK8A 5AICA 2LPEA 2H3ZA 3Q8MA 2CRXA 1MN8A 4DQQA 1D9DA 5DQIA 5KT2A 3UXPA 3NVWA 2Q0ZX 3EZ5A 4C7YA 3C29A 1ZQEA 1D8LA 3RJHA 5J0XA 4GXKA 5H2FU 2HVIA 5G5HA 1Q3UA 9ICCA 4ED7A 2IOFA 4P4OA 4JV1A 5KFGA 2KJ9A 4ED8A 3BDPA 2F2AB 7ICNA 2MUTA 2QARA 2RLTA 1RZTA 4B9MA 3N28A 2OHFA 4DF8A 3WKBA 1BPDA 3RAXA 1NK4A 5KFHA 3HT3A 3NS1A 3V72A 1D8BA 1NK5A 2JZBB 2BCSA 3V7LA 5EOZA 3MC1A 4DOCA 5ALJA 3T5KA 5KFKA 3QU2A 2MU2A 4LJXA 5EE1A 1N5WA 3M9MB 1RYSA 3DV9A 4NM1A 4YD1A 5AKXA 2ZIWA 3V6KA 2H3IA 5JRTA 2KFZA 1SKRA 4USAA 1KBUA 2LYAA 9ICRA 4F93B 4DL4A 3WK6A 2I6XA 1WWVA 1YZ7A 3KD3A 4CRXA 3OPXA 1ECWA 2XICA 5CP2A 3Q8KA 4C8NA 2ZXIA 4F72A 2EAOA 1ZD3A 4PL2A 4LZDA 1Z00A 4KLGA 1S9FA 3WU2U 3K1ZA 5CEHA 4ED6A 5KL1B 9ICKA 4DSKA 4QZAA 2F1IA 1U4BA 2CN1A 4TQSA 3MDAA 2KSOB 5K4LA 2AGOA 3C21A 3G6VA 3ZDAA 3GIIA 5BOMA 4ED0A 5ALLA 2XY5A 2YB1A 4CF3A 4PGXA 4M9LA 3ED5A 9ICBA 3WK5A 5CHGA 1C7YA 1AQ6A 2LI6A 1QH9A 1D8YA 2DFLA 3H8MA 3FC4A 4QW9A 1NK0A 1Z19A 8ICOA 3D2NA 4I2JA 2M0NA 2A19A 3PO4A 3RTVA 2GO7A 5EE3A 3C2KA 2JEGA 2R18A 3BS5B 5KT4A 3HILA 3UMBA 4M9HA 1KQQA 2EZYA 1PVPA 3AU2A 8ICYA 3IM1A 3EUB2 2H3FA 3TFRA 2V4QA 4OCZA 1SIJA 5DDYA 3BQ1A 1PK1A 3SZ2A 3C28A 7ICGA 4EZ9A 1UCVA 1J2NA 2WB1C 8ICWA 2ES6A 4YCXA 5CB1A 1X9SA 4YXMA 2ZIUB 2ALZA 4FZLA 4F50A 2R8JA 2VJ5A 5AIAA 5EWFA 2C2RA 5ALZA 1WUDA 4O3MA 2BR0A 2A1JA 2ZJ5A 4F4WA 3GIJA 5DLGA 3J81j 2ZG6A 5AKGA 4NLNA 2IMWP 4R63A 5KG2A 7ICQA 5KNIA 4I2EA 3LK9A 1ZRNA 4U7CA 4R66A 2F8LA 7ICHA 1T3QA 2HBJA 4KLSA 1NOMA 2OXOA 5J2GA 3D2QA 3RBDA 2ZIVB 1T3NA 5DGAA 9ICXA 2M9NA 4Q45A 1S0MA 5DG9A 2KP7A 2F3NA 5HMMA 3M9NB 5FP0A 1RXWA 1UA1A 5A0LA 3PW5A 1X9WA 4DL7A 3ZDCA 3PW2A 5ALOA 4UB4A 3B9JA 4ED2A 3TARA 1A77A 2XO7A 5KFYA 3PO5A 3ONNA 4P0PA 2XCPA 4B9TA 3PY8A 3MABA 1BGXT 4EX6A 4DQRA 4PHDA 1JIHA 8ICXA 2QLTA 9ICGA 5GTIU 5EWGA 2DL0A 1S97A 2K4PA 5IIOA 5ALVA 5AK3A 3HX0A 5KFSA 4DCCA 3RH6A 2QB0B 1RYUA 2JGAA 1ZD4A 1CUKA 1NKCA 3TI0A 2W04A 3KHLA 4JV2A 2BDPA 1QSYA 3H0MB 3MFHA 4KMOB 3Q8SB 4EZ6A 4Z6EA 1PUZA 1UT8A 4DO9A 3H0RB 5ALYA 3M8SA 3HP6A 3C23A 5F9NA 3SAHA 3Q8RB 3A0HU 4DSEA 4RNNA 1S8OA 4MEYA 4QW8A 3MFIA 4PL1A 1NKBA 3WKDA 2P6RA 1GO3F 1MA7A 4F5RA 2HHUA 3KOOA 4OJ5A 3KZXA 2KKVA 4KX3A 8ICPA 5AI5A 2C2EA 1NK7A 4NL9A 4R64A 1NK6A 1COOA 4F91B 1L3VA 2PXIA 4Z6FA 3RJEA 1ZQUA 3UMGA 4JWMA 1O08A 1JROA 4UAWA 2LKYA 4C7ZA 4J9LA 4ELUA 2BKEA 3TACB 5AKKA 4C0ZA 3QU4A 7ICPA 4DQSA 2LYHA 1FFVA 4EYHB 3R9KA 2GLEA 2KVSA 4DSFA 4RQ0A 4BXOA 4XA5A 2DWQA 1JXEA 3M9OB 9ICAA 2RDIA 4IR1A 1ZQOA 4JV0A 2ZXHA 4RQ2A 3AUOA 8ICTA 4MHVA 1L7PA 1F5SA 1ZQTA 1URJA 1XO0A 4KLDA 2LYBA 3UXOA 7ICMA 4RQ3A 4Q8EA 4UW9A 5J0SA 5KFDA 1PVQA 4ACOA 2W55A 1XC9A 3HPOA 4RT3A 4IL6U 9ICMA 1SV0A 2Y9UA 5DBCA 3UQ0A 3N7RC 4IS7A 1NNLA 2PI4A 2W54A 3QU9A 5KAIU 1DXSA 2HSZA 1VLBA 3QZ8A 2K8AA 2F76X 5CWRA 4M9NA 1F44A 7ICVA 4EENA 4Q8FA 2GWSA 3B0XA 1YT3A 3TADA 2YX8A 5ALMA 4BWMA 5KFNA 1BPXA 4G3IA 2DKXA 4MFFA 3SI8A 3D6JA 3BS7A 3V7JA 4GC7A 2WAQF 4R65A 2KJ5A 3ISBA 4IC9A 3ZDDA 2ZUCA 5ALNA 4A8EA 3QZ7A 5J2FA 4Z6DA 2LM1A 3N7SC 3AQEA 3IN5A 1UA0A 1N5XA 1PZNA 3PMNA 2KK0A 1B43A 4UB6U 5KFCA 3UXNA 4EX7A 4YR2A 1SZHA 2FLLA 4GC6A 4NLBA 3PMLA 2AGPA 2K4HA 1TAQA 3B0YA 4I2BA 4OJ6A 4J9PA 3T3FA 4UQGA 1X6JA 2E8OA 1C20A 1KFTA 2Q4TA 4YR0A 3QUBA 3H8SA 5KFMA 4IRCA 2K8BB 1KL9A 5KFWA 2ESEA 5J0OA 5KFQA 1SB3C 1TKDA 2G5IB 4AP9A 1BPZA 1UQVA 4UAVA 2BQRA 3ISDA 3ORYA 1DK2A 2G07A 5J0UA 1WCLA 4MFAA 2J6UA 4QZFA 9ICJA 3PSFA 1SKSA 3I28A 2F1JA 3BQ0A 1TVAA 9ICUA 4NL9C 4YP3A 9ICEA 4UBCA 2WF9A 1ZRMA 3GV5B 7ICLA 4QIWF 3EW9A 2HHWA 4NJ8A 3MGHA 3BZCA 1KEJA 1DGSA 4P0QB 3FYHA 4RNOA 5BOLA 4Z6CA 3WK4A 4CCHA 4UARA 5KG6A 1V9PA 1ZD5A 3AL0B 1MQ2A 2W9BA 2OEHA 5AM5A 3SENA 2W7OA 4F71A 1RXVA 1TV9A 2Y9TA 4Y2QA 1S0NA 2UVUA 4Y2XA 2E8PA 2XY6A 1TAUA 8ICHA 1B0XA 4TQRA 4Y2RA 2KIWA 2I5HA 2HOIA 5F9LA 2HVHA 1MQ3A 1HEKA 1QCKA 3GU3A 4QWCA 4F92B 2JMGA 3AMZA 3M6ZA 2FPKA 5KFIA 5L1MA 1SV0C 4EBEA 3PSPA 1ZQZA 2K60A 4GXIA 4QWDA 3SAGA 5HHIA 2JH1A 3KZIU 1KW4A 3SEIA 1IG6A 3TADC 2W3RA 9ICVA 2GH1A 9ICHA 5ALRA 3KKAA 2G5HB 1JXLA 2HHQA 1BNPA 4DQIA 3SR6A 2O6KA 3C2LA 2C22A 2K4EA 4I2DA 1JI7A 3NVYA 7ICFA 3KBBA 4O3OA 3N7PD 4QZ9A 4M47A 4R8UA 2ZJ8A 2FMQA 3ZDBA 3AEVA 4CDGA 3CP8A 5KT5A 8ICZA 3SAFA 2MUTB 1U48A 2QARB 4DL6A 4DOAA 3DEEA 2BDUA 4DEZA 3NTUA 4ZH4A 5KT3A 8ICRA 3OJSA 7ICTA 2A1AA 2FMSA 2XVTA 2BCUA 4RPXA 3H40A 2MRLA 5DQHA 2UVRA 5KFZA 2WHEA 3S6JA 2VA8A 3T79A 2ZIWB 1FIQA 2YTUA 1ZQDA 1L6NA 2KOBA 5KFEA 3ISCA 8ICLA 3PX6A 5AK5A 2WAQC 1U45A 4NLZA 1SL1A 2W3SA 2WTFA 5JUMA 5ALUA 4B9VA 3OGUA 1DOQA 2YQEA 3FDSA 2DPJA 1BPYA 5J2KA 3SMVA 4Q44A 3GIMA 4ECXA 3FAHA 5DLFA 5KG4A 3I76A 3SQIA 2FDRA 1S77D 1SZPA 2OH2A 1Z00B 7ICIA 2D8CA 4KLIA 4ICAA 5L1JA 4FS1A 1PK3A 4OJLA 5L1KA 3KFUF 3RR8A 4CF4A 5ALTA 2PFOA 3Q8PB 4NLCA 4C4RA 3JPPA 8ICGA 1CI4A 1ZQVA 4YVZA 2BQ3A 4M2YA 3PSTA 3C5FA 4YFKA 3K75D 1XU4A 4DS5A 5J2JA 1S0VA 4TURA 2LBOA 2NYVA 1K1SA 4UB3A 3RH5A 2WFAA 4BGDA 8ICVA 2R8HA 5L1LA 1RQNA 1P7DA 3GV8B 1ZQRA 2EDUA 4MEXA 3C1YA 4J9KA 4RQ6A 1SV4A 1V85A 1N60A 2JRZA 5ALSA 1NJZA 1LB2B 7ICJA 5KFFA 5DG8A 1ZQBA 1SL0A 2H3VA 4FZNA 4B6JA 5J0PA 1ZQPA 1EXNA 1S76D 5HR6A 4LVSA 4P2HA 2AHOB 2BCVA 3OHBA 4DFPA 2KD1A 4RPZA 5DQGA 1NJWA 1KN5A 2ZUBA 2ASLA 1N2XA 4QIWC 2EAPA 2W03A 4B9SA 1RDFA 5AKYA 5HMLA 1T7PA 3KKAC 4ECVA 1PK1B 1LKYA 2XGPA 2AQ4A 1CEZA 3C1ZA 3QUCA 2EQYA 4UATA 1L3SA 1XO1A 4UAUA 5AM1A 3HW8A 1J97A 1ZQSA 3QU7A 4I27A 3T5LA 2PMZF 2Y1IA 4JWNA 7ICOA 3HJEA 2A1JB 3RFAA 1TK0A 4IRDA 3BQ2A 1X66A 2P35A 4C80A 5CRXA 1ZQYA 4G9BA 5J0YA 4KLTA 1TAMA 4DFDA 1JALA 9ICWA 2XCAA 5ALKA 4ECTA 5AKZA 1IV8A 1NJYA 3Q8LA 5KFLA 4NV0A 5TISU 5HHHA 3M8RA 5AKLA 1OUQA 4F5PA 3ZI4A 1ZQMA 4UAZA 3FM9A 2W8LA 2BGWA 4I2AA 3OSNA 4RQNA 1V38A 1JUDA 3MBYA 3RRHA 4F4KA 2QKQA 4QZHA 1WYGA 3IG8A 3ZDEA 5IINA 4J9RA 2FI1A 4I2FA 1COKA 1ZQJA 1B4FA 2IBKA 2N1RA 3PNCA 2C28A 2DBYA 1ZJNA 2KZ3A 2KFNA 1X6IA 4PGQA 3SYZA 1ZQNA 1SWWA 4P0PB 5J2IA 4UBBA 3HRDD 1Z4OA 3JPRA 1IIPA 4KLOA 2IHNA 4QZEA 2HBLA 4ELTA 1ED1A 1Y88A 4K4HA 9ICPA 5JTIA 2I1QA 1VJ5A 4QWEA 5IIIA 2J6SA 1U9LA 2RRDA 4I2CA 1Z4NA 5ALPA 4DFKA 4RQ4A 9ICIA 3QU5A 4EEKA 4C4TA 4EYIB 2ZIXA 1L8LA 4KX5A 2G09A 2NRZA 4DFMA 4DLGA 2AXTU 4YD2A 2FPLA 2KHQA 2FLNA 4RUAA 2EANA 1BPBA 1JRPA 2V9WA 3H0LB 2YB4A 5AKJA 1T94A 3T5HA 4GIBA 2BCRA 3OJUA 2ZTCA 1LV5A 3ALRA 3WKEA 4OD0A 4PPXA 2Y1JA 2ASDA 4FE3A 4NWIA 3KHRA 3SD7A 4EEYA 4KMUA 1Q46A 3V6HA 2F44A 3LYSA 1S10A 1DK3A 2D3DA 2DF4B 3SV3A 7ICEA 3C5GA 3U26A 2VJ4A 3RJFA 3NVZA 4KTQA 4KLFA 2NRXA 4DS4A 4B9NA 9ICNA 2XIDA 1UHUA 2KTQA 2F77X 2XGQA 3AN1A 4O5CA 4NM2A 2G06A 4BXOB 1TE2A 4DSJA 5AI0A 4RNMA 3TAQA 3ZD8A 1SXEA 8ICBA 2ASJA 3PV8A 4UB8U 2E5SA 3GQCA 1ZQKA 1A0PA 2IHMA 3RAQA 3TFSA 5J2BA 1X2IA 2VIXA 2JEJA 2E1FA 4QNLA 1Q8KA 1KKXA 4PZNA 2WF8A 1IXRA 3WKCA 3LWMA 4DL2A 3IG5A 1QQ5A 5F3XB 4ECZA 3KHHA 1TFRA 5DKWA 1Q3VA 2BQUA 3RJGA 5KG3A 3PR5B 3NRZA 5AHXA 2KN7A 3RRGA 4EELA 4QZDA 3H7IA 1X9MA 5KT7A 4ZOHC 3I1YA 2PMZC 5ALIA 3HKZF 1DRGA 2J6TA 2WF7A 1X42A 4YQWA 2YMMA 1U49A 4TUPA 3EYZA 4PJ0U 4RQ7A 3PX4A 3QYPA 1L7NA 3IDWA 2KEYA 4XUSA 2OCEA 4FBUA 4CGZA 4DLEA 1LVHA 7ICSA 3GZFA 3RJJA 2KV2A 4O3QA 2W9CA 1D9FA 1ZQ1C 4IR9A 3ETRA 4Q43A 5GTHU 5TZVA 5KL8B 4F2SA 9ICFA 1N62A 1OXJA 3IRUA 5ALQA 4J9SA 2HHVA 1ZQAA 3RB0A 2P66A 2R8GA 8ICSA 1ZQWA 3H8JA 4FBTA 5KAFU 5CJ7A 1WWUA 4GLXA 3ZD9A 4P4MA 3NASA 5KFRA 1N48A 2KE7A 1JN3A 3IV6A 5KG5A 5DB9A 4BDPA 2FMPA 4CF5A 3NUQA 4QZIA 2W7PA 5BPCA 4Y2JA 1XWLA 1ZXIA 5J0WA 2NO4A 1Z1VA 3TKAA 4C8KA 2D6FC 2DGZA 5IIMA 1A6SA 3H8WA 4DWIA 1KSPA 5AK4A 2BZFA 3WK7A 3RB3A 8ICQA 4CNQA 5AI6A 8ICUA 5J29A 2HOQA 4FO6A 2JHDA 2W9BB 5AI9A 1J2MA 2HMXA 5HR7A 4F4ZA 4QZ8A 3CYMA 1OW5A 1UPHA 4KLMA 1NZPA 2KIVA 2IOFK 4I29A 8ICEA 1ZQXA 2KZMA 4I2IA 1TK5A 4U6PA 3PSIA 3EPIA 2VA2A 2RQ5A 8ICNA 1NJXA 1U47A 4M6WA 2K8CB 2BHNA 5AIBA 4ECRA 4F2RA 5EE9A 4MF8A 3IHQB 4K4GA 2JEIA 2AGQA 2E3TA 3MR6A 4PGYA 4UB1A 3RBEA 1F0MA 1RQLA 2RDJA 2KVCA 1XS9D 4DSIA 2P6UA 3EPGA 4C8MA 3BJYA 4C8OA 3LVVA 2DUYA 5DGBA 4ECQA 5HP4A 1TK8A 3ICXA 1SKWA 8ICMA 5AM3A 3V7KA 1NI3A 4IRKA 2E8MA 1RM6C 4PZOA 1KFDA 4O3RA 4R8UB 4KN7A 4DOBA 2KHVA 4ED3A 4YG2A 2JZBA 3F2BA 3MGIA 2B6GA 4QZGA 5J2CA 1SL2A 3AQFA 2WF6A 3N97B 3MGVA 5J0QA 2JEFA 4UB2A 5KFAA 3O0FA 3JPQA 3V6JA 3M7DA 5IIKA 2R8IA 3RJIA 3M6KA 1KLNA 4RZRA 4P4PA 4DQPA 3QEBZ 1XSPA 5DBAA 5IILA 4PHPA 2H5XA 5AM2A 3UM9A 3PVXA 2XC9A 4FFDA 2KZZA 2EZZA 4FS2A 3LDAA 2JR5A 3AU6A 5AI8A 5DB8A 5J0RA 2F1HA 4B9UA 4RQMA 2NRTA 4PHAA 4ECYA 2H3QA 2W43A 8ICJA 4HAIA 4M9JA 1KFSA 2HOFA 1K1QA 1QQ7A 3PW7A 3HKZC 2HBMA 1SGGA 5C0YA 1N63A 4KLJA 4GXJA 1JX4A 2L5YA 2KSOA 1XSLA 4Y2TA 1QQ6A 8ICAA 2KNJA 1HUZA 1N61A 2ODGA 1NK9A 4K4IA 5E79U 4PH5A 1SXDA 2NO5A 4OJPA 4F4XA 1XSNA 2KICA 3SV4A 4J9QA 4Y2YA 4HYKA 4FZMA 2PFPA 3WK8A 2W8KA 3QNMA 5KFPA 4M0AA 9ICSA 4F3OA 3BS5A 3UMCA 4F5NA 5ALFA 1MSWD 1KTQA 4ECSA 3L4PA 4F4YA 2EAMA 1ZQGA 2PI5A 2YMLA 3N4MB 1T8EA 5AKEA 1WG8A 4US8A 2ISOA 2OYYA 2K89A 3K4GA 5KFVA 5KFUA 4UB5A 2CPRA 2OWOA 3CW2C 4YR3A 2PFQA 2ZIUA 4MF2A 4XQ8A 8ICKA 1NZBA 3RJKA 5KG1A 4KLEA 1LKYB 5J8YA 4MFCA 3QEAZ 2XY7A 3EWAA 4O0IA 2ZJAA 2UVWA 4RQ8A 3THVA 3HWTA 2PKEA 3TANA 3QE9Y 4PHEA 1FFUA 2DKZA 5KG7A 2IOHA 1L7OA 3UPQA 4BUGA 5B5EU 4O3SA 2C2DA 5AM4A 2I9GA 4US9A 3TQ1A 5DBBA 2HDOA 5KG0A 5DB6A 3H4BA 4J9OA 5JU5A 3F5AA 2MA1A 2ZIVA 2Z7JA 2EH9A 3JPTA 1QSSA 4C8LA 2UVVA 2KJ8A 5B66U 8ICIA 1V97A 3VCBA 2R8KA 4ECUA 2AQ0A 5J0TA 5KTQA 2HHSA 1ZOLA 4RQ1A 1RG6A 4RQ5A 4KLQA 3GIKA 3LVWA 2JXJA 2JH7A 3GV7B 4X5VA 3MR5A 4DF4A 4YN4A 9ICTA 2B0CA 2FE9A 4O3NA 2NRVA 4QZBA 3QX7A 2YY6A 2F8KA 1UT5A 2FJ6A 5KFOA 5G5GA 3QUTA 2RP5A 3NGDA 1X9XA 3JPSA 5EE0A 4IQUA 1B22A 4JK1A 4XRHA 1Z1BA 4CE6A 4E0DA 1ZQIA 1ZQCA 1BNOA 3ETLA 3F2DA 4ED1A 2G0AA 2QB0A 1CRXA 2G08A 1S0OA 1M6YA 1PVRA 4KN4A 3IP4B 2NV3A 9ICOA 4YMMA 4QZCA 3F2CA 4M04A 4QWAA 5DDMA 2RHFA 4RU9A 4JMUA 3E58A
chains in the Genus database with same CATH topology
2ESEA 4RQMA 2F44A 2D3DA 3BQ7A 1JI7A 1UQVA 2DKZA 1SV0A 2Y9UA 2DL0A 4IS7A 1PK1A 3IDWA 2K4PA 1SGGA 1UCVA 4RQNA 5JRTA 1V38A 1DXSA 2ES6A 2QKQA 4NL9C 2QB0B 1SV4A 2QARB 1V85A 1F0MA 2L5YA 2KSOA 1COKA 1B4FA 3TADA 5JU5A 4NJ8A 1OXJA 2DKXA 1WWVA 1SXEA 2KMDA 1SXDA 3BS7A 2KG5A 1WWUA 2E8MA 3SENA 2QB1A 4PZOA 2EAOA 2Y9TA 2JV3A 2EAPA 5JTIA 1RG6A 2E8PA 2KE7A 1X40A 1B0XA 3KKAC 1PK1B 5J8YC 1LKYA 2LMRA 2LPEA 3BS5A 2YTUA 5KNIA 2FE9A 4PZNA 2B6GA 4NL9A 2F8KA 1Z1VA 2EAMA 2KSOB 5F3XB 1X9XA 5L1MA 1SV0C 2E8NA 3TACB 3K1RB 2K60A 1X66A 2EANA 2GLEA 2QB0A 3H8MA 2QARA 2E8OA 2F3NA 1KW4A 3SEIA 3TADC 2D8CA 1OW5A 1LKYB 3KKAA 4MHVA 2KIVA 1PK3A 5J8YA 3BS5B 3HILA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ESE A;  4RQM A;  2F44 A;  2D3D A;  3BQ7 A;  1JI7 A;  1UQV A;  2DKZ A;  1SV0 A;  2Y9U A;  2DL0 A;  4IS7 A;  1PK1 A;  3IDW A;  2K4P A;  1SGG A;  1UCV A;  4RQN A;  5JRT A;  1V38 A;  1DXS A;  2ES6 A;  2QKQ A;  4NL9 C;  2QB0 B;  1SV4 A;  2QAR B;  1V85 A;  1F0M A;  2L5Y A;  2KSO A;  1COK A;  1B4F A;  3TAD A;  5JU5 A;  4NJ8 A;  1OXJ A;  2DKX A;  1WWV A;  1SXE A;  2KMD A;  1SXD A;  3BS7 A;  2KG5 A;  1WWU A;  2E8M A;  3SEN A;  2QB1 A;  4PZO A;  2EAO A;  2Y9T A;  2JV3 A;  2EAP A;  5JTI A;  1RG6 A;  2E8P A;  2KE7 A;  1X40 A;  1B0X A;  3KKA C;  1PK1 B;  5J8Y C;  1LKY A;  2LMR A;  2LPE A;  3BS5 A;  2YTU A;  5KNI A;  2FE9 A;  4PZN A;  2B6G A;  4NL9 A;  2F8K A;  1Z1V A;  2EAM A;  2KSO B;  5F3X B;  1X9X A;  5L1M A;  1SV0 C;  2E8N A;  3TAC B;  3K1R B;  2K60 A;  1X66 A;  2EAN A;  2GLE A;  2QB0 A;  3H8M A;  2QAR A;  2E8O A;  2F3N A;  1KW4 A;  3SEI A;  3TAD C;  2D8C A;  1OW5 A;  1LKY B;  3KKA A;  4MHV A;  2KIV A;  1PK3 A;  5J8Y A;  3BS5 B;  3HIL A; 
#chains in the Genus database with same CATH topology
 4NLG A;  1H38 A;  4RUC A;  4AYB F;  3GDX A;  5IIJ A;  2ZIX B;  2W9A A;  1N56 A;  3PR4 A;  5ALX A;  2HBK A;  4IQT A;  4OO1 J;  2HHX A;  2HCF A;  2ZTD A;  1FO4 A;  1L3U A;  3MR2 A;  1SWV A;  8ICC A;  2HHT A;  7ICU A;  4NY8 A;  2W11 A;  5L9X A;  3VC8 A;  3E2E A;  3AM9 A;  1HUO A;  4RPY A;  1KRP A;  2Y0S F;  3NVV A;  1A76 A;  3T5J A;  3JPO A;  3CNH A;  1Z3E B;  3RF9 A;  4ECW A;  4JUZ A;  5KFT A;  3PZP A;  1ZQH A;  1QTM A;  1XNS A;  4I2H A;  2KG5 A;  5J2D A;  5D46 A;  5D49 A;  2MAX A;  2QB1 A;  4BJQ A;  4ELV A;  2JV3 A;  5CA7 A;  1NKE A;  2BPC A;  2YN4 A;  4QJF B;  1X40 A;  1T4G A;  3C2M A;  2MSN A;  4GFJ A;  3CRX A;  5J8Y C;  2LMR A;  3RB4 A;  7ICR A;  3MDC A;  1DGJ A;  1BVS A;  1WCN A;  2W9M A;  3KTQ A;  4KIT B;  9ICQ A;  4OJO A;  2ISP A;  1JMS A;  2IA6 A;  5ALE A;  5CR0 A;  2BPG A;  1L5U A;  3NRW A;  3L5K A;  8ICF A;  5J2E A;  4O9M A;  4Y2P A;  3BQT A;  3K1R B;  4NXZ A;  2OM6 A;  4O5K A;  2E1E A;  4JB3 A;  2AU0 A;  5J2H A;  1VDV A;  2ATL A;  4I28 A;  3JPN A;  2FPM A;  1L7M A;  2LHT A;  4M9G A;  4C4S A;  4J9M A;  1KDH A;  3OHA A;  4BWJ A;  5J2A A;  3WKA A;  3OTQ A;  1ZQQ A;  4NLK A;  3BQ7 A;  3L3F X;  4QWB A;  4Y2U A;  4KLU A;  5AK6 A;  5D4B A;  3QUQ A;  3LWL A;  1ZQL A;  4Y2V A;  4F5Q A;  5ALH A;  3QXG A;  4DL3 A;  2ZUD A;  2VA3 A;  4O3P A;  2NRW A;  5ALD A;  1IM4 A;  3GIL A;  1L3T A;  2BPF A;  4IQW A;  5DB7 A;  4RT2 A;  1ZJM A;  1FEZ A;  4J9N A;  1K5O A;  2A3V A;  3M1Y A;  1BPE A;  2KMD A;  3A0B U;  5EWE A;  3F5E A;  3BZK A;  4TUS A;  2AJQ A;  9ICL A;  2VKQ A;  2WF5 A;  3PW4 A;  4LZG A;  2HI0 A;  3RR7 A;  1QLN A;  2KKP A;  4O5E A;  4DSL A;  2W9C B;  4B9L A;  4J03 A;  5KFJ A;  5KFX A;  5T14 A;  3PW0 A;  1HIW A;  2E8N A;  3RH4 A;  1ZYQ A;  1HJP A;  3Q8Q B;  4F8R A;  2GOL A;  2PFN A;  1MC8 A;  5C5J A;  3G6X A;  1S5L U;  4EBD A;  3DDH A;  4UAS A;  2DPI A;  4F5O A;  1RPL A;  5HNK A;  1L8O A;  2B21 A;  5AM0 A;  7ICK A;  2ZTE A;  4YMO A;  1O03 A;  4P0Q A;  5AKH A;  3UQ2 A;  2LM4 A;  5L1I A;  2WB1 F;  5ALG A;  1RYR A;  3D2S A;  2BCQ A;  1ZET A;  4DL5 A;  4BX9 C;  3RB6 A;  1YZ6 A;  1ZQF A;  3E0F A;  2CXY A;  3H4D A;  5AKI A;  5KFB A;  4YXJ A;  2V4R A;  3F53 A;  3WK9 A;  3PX0 A;  2K4I A;  4IQV A;  4YMN A;  4Y2S A;  2YMP A;  4KLH A;  4WJ3 B;  4KLL A;  2XI9 A;  2YMQ A;  2EZX A;  4AYB C;  3TAP A;  4DFJ A;  2FLP A;  5KT6 A;  4UAY A;  4EBC A;  5DG7 A;  5ALW A;  1QSL A;  3GFK B;  2HW3 A;  3OSP A;  4TUQ A;  1ARO P;  5AI4 A;  2VAN A;  4M6W B;  3KHG A;  4I2G A;  2Y0S C;  1ZD2 P;  3MR3 A;  3G6Y A;  2DQN B;  2AH5 A;  1NK8 A;  5AIC A;  2LPE A;  2H3Z A;  3Q8M A;  2CRX A;  1MN8 A;  4DQQ A;  1D9D A;  5DQI A;  5KT2 A;  3UXP A;  3NVW A;  2Q0Z X;  3EZ5 A;  4C7Y A;  3C29 A;  1ZQE A;  1D8L A;  3RJH A;  5J0X A;  4GXK A;  5H2F U;  2HVI A;  5G5H A;  1Q3U A;  9ICC A;  4ED7 A;  2IOF A;  4P4O A;  4JV1 A;  5KFG A;  2KJ9 A;  4ED8 A;  3BDP A;  2F2A B;  7ICN A;  2MUT A;  2QAR A;  2RLT A;  1RZT A;  4B9M A;  3N28 A;  2OHF A;  4DF8 A;  3WKB A;  1BPD A;  3RAX A;  1NK4 A;  5KFH A;  3HT3 A;  3NS1 A;  3V72 A;  1D8B A;  1NK5 A;  2JZB B;  2BCS A;  3V7L A;  5EOZ A;  3MC1 A;  4DOC A;  5ALJ A;  3T5K A;  5KFK A;  3QU2 A;  2MU2 A;  4LJX A;  5EE1 A;  1N5W A;  3M9M B;  1RYS A;  3DV9 A;  4NM1 A;  4YD1 A;  5AKX A;  2ZIW A;  3V6K A;  2H3I A;  5JRT A;  2KFZ A;  1SKR A;  4USA A;  1KBU A;  2LYA A;  9ICR A;  4F93 B;  4DL4 A;  3WK6 A;  2I6X A;  1WWV A;  1YZ7 A;  3KD3 A;  4CRX A;  3OPX A;  1ECW A;  2XIC A;  5CP2 A;  3Q8K A;  4C8N A;  2ZXI A;  4F72 A;  2EAO A;  1ZD3 A;  4PL2 A;  4LZD A;  1Z00 A;  4KLG A;  1S9F A;  3WU2 U;  3K1Z A;  5CEH A;  4ED6 A;  5KL1 B;  9ICK A;  4DSK A;  4QZA A;  2F1I A;  1U4B A;  2CN1 A;  4TQS A;  3MDA A;  2KSO B;  5K4L A;  2AGO A;  3C21 A;  3G6V A;  3ZDA A;  3GII A;  5BOM A;  4ED0 A;  5ALL A;  2XY5 A;  2YB1 A;  4CF3 A;  4PGX A;  4M9L A;  3ED5 A;  9ICB A;  3WK5 A;  5CHG A;  1C7Y A;  1AQ6 A;  2LI6 A;  1QH9 A;  1D8Y A;  2DFL A;  3H8M A;  3FC4 A;  4QW9 A;  1NK0 A;  1Z19 A;  8ICO A;  3D2N A;  4I2J A;  2M0N A;  2A19 A;  3PO4 A;  3RTV A;  2GO7 A;  5EE3 A;  3C2K A;  2JEG A;  2R18 A;  3BS5 B;  5KT4 A;  3HIL A;  3UMB A;  4M9H A;  1KQQ A;  2EZY A;  1PVP A;  3AU2 A;  8ICY A;  3IM1 A;  3EUB 2;  2H3F A;  3TFR A;  2V4Q A;  4OCZ A;  1SIJ A;  5DDY A;  3BQ1 A;  1PK1 A;  3SZ2 A;  3C28 A;  7ICG A;  4EZ9 A;  1UCV A;  1J2N A;  2WB1 C;  8ICW A;  2ES6 A;  4YCX A;  5CB1 A;  1X9S A;  4YXM A;  2ZIU B;  2ALZ A;  4FZL A;  4F50 A;  2R8J A;  2VJ5 A;  5AIA A;  5EWF A;  2C2R A;  5ALZ A;  1WUD A;  4O3M A;  2BR0 A;  2A1J A;  2ZJ5 A;  4F4W A;  3GIJ A;  5DLG A;  3J81 j;  2ZG6 A;  5AKG A;  4NLN A;  2IMW P;  4R63 A;  5KG2 A;  7ICQ A;  5KNI A;  4I2E A;  3LK9 A;  1ZRN A;  4U7C A;  4R66 A;  2F8L A;  7ICH A;  1T3Q A;  2HBJ A;  4KLS A;  1NOM A;  2OXO A;  5J2G A;  3D2Q A;  3RBD A;  2ZIV B;  1T3N A;  5DGA A;  9ICX A;  2M9N A;  4Q45 A;  1S0M A;  5DG9 A;  2KP7 A;  2F3N A;  5HMM A;  3M9N B;  5FP0 A;  1RXW A;  1UA1 A;  5A0L A;  3PW5 A;  1X9W A;  4DL7 A;  3ZDC A;  3PW2 A;  5ALO A;  4UB4 A;  3B9J A;  4ED2 A;  3TAR A;  1A77 A;  2XO7 A;  5KFY A;  3PO5 A;  3ONN A;  4P0P A;  2XCP A;  4B9T A;  3PY8 A;  3MAB A;  1BGX T;  4EX6 A;  4DQR A;  4PHD A;  1JIH A;  8ICX A;  2QLT A;  9ICG A;  5GTI U;  5EWG A;  2DL0 A;  1S97 A;  2K4P A;  5IIO A;  5ALV A;  5AK3 A;  3HX0 A;  5KFS A;  4DCC A;  3RH6 A;  2QB0 B;  1RYU A;  2JGA A;  1ZD4 A;  1CUK A;  1NKC A;  3TI0 A;  2W04 A;  3KHL A;  4JV2 A;  2BDP A;  1QSY A;  3H0M B;  3MFH A;  4KMO B;  3Q8S B;  4EZ6 A;  4Z6E A;  1PUZ A;  1UT8 A;  4DO9 A;  3H0R B;  5ALY A;  3M8S A;  3HP6 A;  3C23 A;  5F9N A;  3SAH A;  3Q8R B;  3A0H U;  4DSE A;  4RNN A;  1S8O A;  4MEY A;  4QW8 A;  3MFI A;  4PL1 A;  1NKB A;  3WKD A;  2P6R A;  1GO3 F;  1MA7 A;  4F5R A;  2HHU A;  3KOO A;  4OJ5 A;  3KZX A;  2KKV A;  4KX3 A;  8ICP A;  5AI5 A;  2C2E A;  1NK7 A;  4NL9 A;  4R64 A;  1NK6 A;  1COO A;  4F91 B;  1L3V A;  2PXI A;  4Z6F A;  3RJE A;  1ZQU A;  3UMG A;  4JWM A;  1O08 A;  1JRO A;  4UAW A;  2LKY A;  4C7Z A;  4J9L A;  4ELU A;  2BKE A;  3TAC B;  5AKK A;  4C0Z A;  3QU4 A;  7ICP A;  4DQS A;  2LYH A;  1FFV A;  4EYH B;  3R9K A;  2GLE A;  2KVS A;  4DSF A;  4RQ0 A;  4BXO A;  4XA5 A;  2DWQ A;  1JXE A;  3M9O B;  9ICA A;  2RDI A;  4IR1 A;  1ZQO A;  4JV0 A;  2ZXH A;  4RQ2 A;  3AUO A;  8ICT A;  4MHV A;  1L7P A;  1F5S A;  1ZQT A;  1URJ A;  1XO0 A;  4KLD A;  2LYB A;  3UXO A;  7ICM A;  4RQ3 A;  4Q8E A;  4UW9 A;  5J0S A;  5KFD A;  1PVQ A;  4ACO A;  2W55 A;  1XC9 A;  3HPO A;  4RT3 A;  4IL6 U;  9ICM A;  1SV0 A;  2Y9U A;  5DBC A;  3UQ0 A;  3N7R C;  4IS7 A;  1NNL A;  2PI4 A;  2W54 A;  3QU9 A;  5KAI U;  1DXS A;  2HSZ A;  1VLB A;  3QZ8 A;  2K8A A;  2F76 X;  5CWR A;  4M9N A;  1F44 A;  7ICV A;  4EEN A;  4Q8F A;  2GWS A;  3B0X A;  1YT3 A;  3TAD A;  2YX8 A;  5ALM A;  4BWM A;  5KFN A;  1BPX A;  4G3I A;  2DKX A;  4MFF A;  3SI8 A;  3D6J A;  3BS7 A;  3V7J A;  4GC7 A;  2WAQ F;  4R65 A;  2KJ5 A;  3ISB A;  4IC9 A;  3ZDD A;  2ZUC A;  5ALN A;  4A8E A;  3QZ7 A;  5J2F A;  4Z6D A;  2LM1 A;  3N7S C;  3AQE A;  3IN5 A;  1UA0 A;  1N5X A;  1PZN A;  3PMN A;  2KK0 A;  1B43 A;  4UB6 U;  5KFC A;  3UXN A;  4EX7 A;  4YR2 A;  1SZH A;  2FLL A;  4GC6 A;  4NLB A;  3PML A;  2AGP A;  2K4H A;  1TAQ A;  3B0Y A;  4I2B A;  4OJ6 A;  4J9P A;  3T3F A;  4UQG A;  1X6J A;  2E8O A;  1C20 A;  1KFT A;  2Q4T A;  4YR0 A;  3QUB A;  3H8S A;  5KFM A;  4IRC A;  2K8B B;  1KL9 A;  5KFW A;  2ESE A;  5J0O A;  5KFQ A;  1SB3 C;  1TKD A;  2G5I B;  4AP9 A;  1BPZ A;  1UQV A;  4UAV A;  2BQR A;  3ISD A;  3ORY A;  1DK2 A;  2G07 A;  5J0U A;  1WCL A;  4MFA A;  2J6U A;  4QZF A;  9ICJ A;  3PSF A;  1SKS A;  3I28 A;  2F1J A;  3BQ0 A;  1TVA A;  9ICU A;  4NL9 C;  4YP3 A;  9ICE A;  4UBC A;  2WF9 A;  1ZRM A;  3GV5 B;  7ICL A;  4QIW F;  3EW9 A;  2HHW A;  4NJ8 A;  3MGH A;  3BZC A;  1KEJ A;  1DGS A;  4P0Q B;  3FYH A;  4RNO A;  5BOL A;  4Z6C A;  3WK4 A;  4CCH A;  4UAR A;  5KG6 A;  1V9P A;  1ZD5 A;  3AL0 B;  1MQ2 A;  2W9B A;  2OEH A;  5AM5 A;  3SEN A;  2W7O A;  4F71 A;  1RXV A;  1TV9 A;  2Y9T A;  4Y2Q A;  1S0N A;  2UVU A;  4Y2X A;  2E8P A;  2XY6 A;  1TAU A;  8ICH A;  1B0X A;  4TQR A;  4Y2R A;  2KIW A;  2I5H A;  2HOI A;  5F9L A;  2HVH A;  1MQ3 A;  1HEK A;  1QCK A;  3GU3 A;  4QWC A;  4F92 B;  2JMG A;  3AMZ A;  3M6Z A;  2FPK A;  5KFI A;  5L1M A;  1SV0 C;  4EBE A;  3PSP A;  1ZQZ A;  2K60 A;  4GXI A;  4QWD A;  3SAG A;  5HHI A;  2JH1 A;  3KZI U;  1KW4 A;  3SEI A;  1IG6 A;  3TAD C;  2W3R A;  9ICV A;  2GH1 A;  9ICH A;  5ALR A;  3KKA A;  2G5H B;  1JXL A;  2HHQ A;  1BNP A;  4DQI A;  3SR6 A;  2O6K A;  3C2L A;  2C22 A;  2K4E A;  4I2D A;  1JI7 A;  3NVY A;  7ICF A;  3KBB A;  4O3O A;  3N7P D;  4QZ9 A;  4M47 A;  4R8U A;  2ZJ8 A;  2FMQ A;  3ZDB A;  3AEV A;  4CDG A;  3CP8 A;  5KT5 A;  8ICZ A;  3SAF A;  2MUT B;  1U48 A;  2QAR B;  4DL6 A;  4DOA A;  3DEE A;  2BDU A;  4DEZ A;  3NTU A;  4ZH4 A;  5KT3 A;  8ICR A;  3OJS A;  7ICT A;  2A1A A;  2FMS A;  2XVT A;  2BCU A;  4RPX A;  3H40 A;  2MRL A;  5DQH A;  2UVR A;  5KFZ A;  2WHE A;  3S6J A;  2VA8 A;  3T79 A;  2ZIW B;  1FIQ A;  2YTU A;  1ZQD A;  1L6N A;  2KOB A;  5KFE A;  3ISC A;  8ICL A;  3PX6 A;  5AK5 A;  2WAQ C;  1U45 A;  4NLZ A;  1SL1 A;  2W3S A;  2WTF A;  5JUM A;  5ALU A;  4B9V A;  3OGU A;  1DOQ A;  2YQE A;  3FDS A;  2DPJ A;  1BPY A;  5J2K A;  3SMV A;  4Q44 A;  3GIM A;  4ECX A;  3FAH A;  5DLF A;  5KG4 A;  3I76 A;  3SQI A;  2FDR A;  1S77 D;  1SZP A;  2OH2 A;  1Z00 B;  7ICI A;  2D8C A;  4KLI A;  4ICA A;  5L1J A;  4FS1 A;  1PK3 A;  4OJL A;  5L1K A;  3KFU F;  3RR8 A;  4CF4 A;  5ALT A;  2PFO A;  3Q8P B;  4NLC A;  4C4R A;  3JPP A;  8ICG A;  1CI4 A;  1ZQV A;  4YVZ A;  2BQ3 A;  4M2Y A;  3PST A;  3C5F A;  4YFK A;  3K75 D;  1XU4 A;  4DS5 A;  5J2J A;  1S0V A;  4TUR A;  2LBO A;  2NYV A;  1K1S A;  4UB3 A;  3RH5 A;  2WFA A;  4BGD A;  8ICV A;  2R8H A;  5L1L A;  1RQN A;  1P7D A;  3GV8 B;  1ZQR A;  2EDU A;  4MEX A;  3C1Y A;  4J9K A;  4RQ6 A;  1SV4 A;  1V85 A;  1N60 A;  2JRZ A;  5ALS A;  1NJZ A;  1LB2 B;  7ICJ A;  5KFF A;  5DG8 A;  1ZQB A;  1SL0 A;  2H3V A;  4FZN A;  4B6J A;  5J0P A;  1ZQP A;  1EXN A;  1S76 D;  5HR6 A;  4LVS A;  4P2H A;  2AHO B;  2BCV A;  3OHB A;  4DFP A;  2KD1 A;  4RPZ A;  5DQG A;  1NJW A;  1KN5 A;  2ZUB A;  2ASL A;  1N2X A;  4QIW C;  2EAP A;  2W03 A;  4B9S A;  1RDF A;  5AKY A;  5HML A;  1T7P A;  3KKA C;  4ECV A;  1PK1 B;  1LKY A;  2XGP A;  2AQ4 A;  1CEZ A;  3C1Z A;  3QUC A;  2EQY A;  4UAT A;  1L3S A;  1XO1 A;  4UAU A;  5AM1 A;  3HW8 A;  1J97 A;  1ZQS A;  3QU7 A;  4I27 A;  3T5L A;  2PMZ F;  2Y1I A;  4JWN A;  7ICO A;  3HJE A;  2A1J B;  3RFA A;  1TK0 A;  4IRD A;  3BQ2 A;  1X66 A;  2P35 A;  4C80 A;  5CRX A;  1ZQY A;  4G9B A;  5J0Y A;  4KLT A;  1TAM A;  4DFD A;  1JAL A;  9ICW A;  2XCA A;  5ALK A;  4ECT A;  5AKZ A;  1IV8 A;  1NJY A;  3Q8L A;  5KFL A;  4NV0 A;  5TIS U;  5HHH A;  3M8R A;  5AKL A;  1OUQ A;  4F5P A;  3ZI4 A;  1ZQM A;  4UAZ A;  3FM9 A;  2W8L A;  2BGW A;  4I2A A;  3OSN A;  4RQN A;  1V38 A;  1JUD A;  3MBY A;  3RRH A;  4F4K A;  2QKQ A;  4QZH A;  1WYG A;  3IG8 A;  3ZDE A;  5IIN A;  4J9R A;  2FI1 A;  4I2F A;  1COK A;  1ZQJ A;  1B4F A;  2IBK A;  2N1R A;  3PNC A;  2C28 A;  2DBY A;  1ZJN A;  2KZ3 A;  2KFN A;  1X6I A;  4PGQ A;  3SYZ A;  1ZQN A;  1SWW A;  4P0P B;  5J2I A;  4UBB A;  3HRD D;  1Z4O A;  3JPR A;  1IIP A;  4KLO A;  2IHN A;  4QZE A;  2HBL A;  4ELT A;  1ED1 A;  1Y88 A;  4K4H A;  9ICP A;  5JTI A;  2I1Q A;  1VJ5 A;  4QWE A;  5III A;  2J6S A;  1U9L A;  2RRD A;  4I2C A;  1Z4N A;  5ALP A;  4DFK A;  4RQ4 A;  9ICI A;  3QU5 A;  4EEK A;  4C4T A;  4EYI B;  2ZIX A;  1L8L A;  4KX5 A;  2G09 A;  2NRZ A;  4DFM A;  4DLG A;  2AXT U;  4YD2 A;  2FPL A;  2KHQ A;  2FLN A;  4RUA A;  2EAN A;  1BPB A;  1JRP A;  2V9W A;  3H0L B;  2YB4 A;  5AKJ A;  1T94 A;  3T5H A;  4GIB A;  2BCR A;  3OJU A;  2ZTC A;  1LV5 A;  3ALR A;  3WKE A;  4OD0 A;  4PPX A;  2Y1J A;  2ASD A;  4FE3 A;  4NWI A;  3KHR A;  3SD7 A;  4EEY A;  4KMU A;  1Q46 A;  3V6H A;  2F44 A;  3LYS A;  1S10 A;  1DK3 A;  2D3D A;  2DF4 B;  3SV3 A;  7ICE A;  3C5G A;  3U26 A;  2VJ4 A;  3RJF A;  3NVZ A;  4KTQ A;  4KLF A;  2NRX A;  4DS4 A;  4B9N A;  9ICN A;  2XID A;  1UHU A;  2KTQ A;  2F77 X;  2XGQ A;  3AN1 A;  4O5C A;  4NM2 A;  2G06 A;  4BXO B;  1TE2 A;  4DSJ A;  5AI0 A;  4RNM A;  3TAQ A;  3ZD8 A;  1SXE A;  8ICB A;  2ASJ A;  3PV8 A;  4UB8 U;  2E5S A;  3GQC A;  1ZQK A;  1A0P A;  2IHM A;  3RAQ A;  3TFS A;  5J2B A;  1X2I A;  2VIX A;  2JEJ A;  2E1F A;  4QNL A;  1Q8K A;  1KKX A;  4PZN A;  2WF8 A;  1IXR A;  3WKC A;  3LWM A;  4DL2 A;  3IG5 A;  1QQ5 A;  5F3X B;  4ECZ A;  3KHH A;  1TFR A;  5DKW A;  1Q3V A;  2BQU A;  3RJG A;  5KG3 A;  3PR5 B;  3NRZ A;  5AHX A;  2KN7 A;  3RRG A;  4EEL A;  4QZD A;  3H7I A;  1X9M A;  5KT7 A;  4ZOH C;  3I1Y A;  2PMZ C;  5ALI A;  3HKZ F;  1DRG A;  2J6T A;  2WF7 A;  1X42 A;  4YQW A;  2YMM A;  1U49 A;  4TUP A;  3EYZ A;  4PJ0 U;  4RQ7 A;  3PX4 A;  3QYP A;  1L7N A;  3IDW A;  2KEY A;  4XUS A;  2OCE A;  4FBU A;  4CGZ A;  4DLE A;  1LVH A;  7ICS A;  3GZF A;  3RJJ A;  2KV2 A;  4O3Q A;  2W9C A;  1D9F A;  1ZQ1 C;  4IR9 A;  3ETR A;  4Q43 A;  5GTH U;  5TZV A;  5KL8 B;  4F2S A;  9ICF A;  1N62 A;  1OXJ A;  3IRU A;  5ALQ A;  4J9S A;  2HHV A;  1ZQA A;  3RB0 A;  2P66 A;  2R8G A;  8ICS A;  1ZQW A;  3H8J A;  4FBT A;  5KAF U;  5CJ7 A;  1WWU A;  4GLX A;  3ZD9 A;  4P4M A;  3NAS A;  5KFR A;  1N48 A;  2KE7 A;  1JN3 A;  3IV6 A;  5KG5 A;  5DB9 A;  4BDP A;  2FMP A;  4CF5 A;  3NUQ A;  4QZI A;  2W7P A;  5BPC A;  4Y2J A;  1XWL A;  1ZXI A;  5J0W A;  2NO4 A;  1Z1V A;  3TKA A;  4C8K A;  2D6F C;  2DGZ A;  5IIM A;  1A6S A;  3H8W A;  4DWI A;  1KSP A;  5AK4 A;  2BZF A;  3WK7 A;  3RB3 A;  8ICQ A;  4CNQ A;  5AI6 A;  8ICU A;  5J29 A;  2HOQ A;  4FO6 A;  2JHD A;  2W9B B;  5AI9 A;  1J2M A;  2HMX A;  5HR7 A;  4F4Z A;  4QZ8 A;  3CYM A;  1OW5 A;  1UPH A;  4KLM A;  1NZP A;  2KIV A;  2IOF K;  4I29 A;  8ICE A;  1ZQX A;  2KZM A;  4I2I A;  1TK5 A;  4U6P A;  3PSI A;  3EPI A;  2VA2 A;  2RQ5 A;  8ICN A;  1NJX A;  1U47 A;  4M6W A;  2K8C B;  2BHN A;  5AIB A;  4ECR A;  4F2R A;  5EE9 A;  4MF8 A;  3IHQ B;  4K4G A;  2JEI A;  2AGQ A;  2E3T A;  3MR6 A;  4PGY A;  4UB1 A;  3RBE A;  1F0M A;  1RQL A;  2RDJ A;  2KVC A;  1XS9 D;  4DSI A;  2P6U A;  3EPG A;  4C8M A;  3BJY A;  4C8O A;  3LVV A;  2DUY A;  5DGB A;  4ECQ A;  5HP4 A;  1TK8 A;  3ICX A;  1SKW A;  8ICM A;  5AM3 A;  3V7K A;  1NI3 A;  4IRK A;  2E8M A;  1RM6 C;  4PZO A;  1KFD A;  4O3R A;  4R8U B;  4KN7 A;  4DOB A;  2KHV A;  4ED3 A;  4YG2 A;  2JZB A;  3F2B A;  3MGI A;  2B6G A;  4QZG A;  5J2C A;  1SL2 A;  3AQF A;  2WF6 A;  3N97 B;  3MGV A;  5J0Q A;  2JEF A;  4UB2 A;  5KFA A;  3O0F A;  3JPQ A;  3V6J A;  3M7D A;  5IIK A;  2R8I A;  3RJI A;  3M6K A;  1KLN A;  4RZR A;  4P4P A;  4DQP A;  3QEB Z;  1XSP A;  5DBA A;  5IIL A;  4PHP A;  2H5X A;  5AM2 A;  3UM9 A;  3PVX A;  2XC9 A;  4FFD A;  2KZZ A;  2EZZ A;  4FS2 A;  3LDA A;  2JR5 A;  3AU6 A;  5AI8 A;  5DB8 A;  5J0R A;  2F1H A;  4B9U A;  4RQM A;  2NRT A;  4PHA A;  4ECY A;  2H3Q A;  2W43 A;  8ICJ A;  4HAI A;  4M9J A;  1KFS A;  2HOF A;  1K1Q A;  1QQ7 A;  3PW7 A;  3HKZ C;  2HBM A;  1SGG A;  5C0Y A;  1N63 A;  4KLJ A;  4GXJ A;  1JX4 A;  2L5Y A;  2KSO A;  1XSL A;  4Y2T A;  1QQ6 A;  8ICA A;  2KNJ A;  1HUZ A;  1N61 A;  2ODG A;  1NK9 A;  4K4I A;  5E79 U;  4PH5 A;  1SXD A;  2NO5 A;  4OJP A;  4F4X A;  1XSN A;  2KIC A;  3SV4 A;  4J9Q A;  4Y2Y A;  4HYK A;  4FZM A;  2PFP A;  3WK8 A;  2W8K A;  3QNM A;  5KFP A;  4M0A A;  9ICS A;  4F3O A;  3BS5 A;  3UMC A;  4F5N A;  5ALF A;  1MSW D;  1KTQ A;  4ECS A;  3L4P A;  4F4Y A;  2EAM A;  1ZQG A;  2PI5 A;  2YML A;  3N4M B;  1T8E A;  5AKE A;  1WG8 A;  4US8 A;  2ISO A;  2OYY A;  2K89 A;  3K4G A;  5KFV A;  5KFU A;  4UB5 A;  2CPR A;  2OWO A;  3CW2 C;  4YR3 A;  2PFQ A;  2ZIU A;  4MF2 A;  4XQ8 A;  8ICK A;  1NZB A;  3RJK A;  5KG1 A;  4KLE A;  1LKY B;  5J8Y A;  4MFC A;  3QEA Z;  2XY7 A;  3EWA A;  4O0I A;  2ZJA A;  2UVW A;  4RQ8 A;  3THV A;  3HWT A;  2PKE A;  3TAN A;  3QE9 Y;  4PHE A;  1FFU A;  2DKZ A;  5KG7 A;  2IOH A;  1L7O A;  3UPQ A;  4BUG A;  5B5E U;  4O3S A;  2C2D A;  5AM4 A;  2I9G A;  4US9 A;  3TQ1 A;  5DBB A;  2HDO A;  5KG0 A;  5DB6 A;  3H4B A;  4J9O A;  5JU5 A;  3F5A A;  2MA1 A;  2ZIV A;  2Z7J A;  2EH9 A;  3JPT A;  1QSS A;  4C8L A;  2UVV A;  2KJ8 A;  5B66 U;  8ICI A;  1V97 A;  3VCB A;  2R8K A;  4ECU A;  2AQ0 A;  5J0T A;  5KTQ A;  2HHS A;  1ZOL A;  4RQ1 A;  1RG6 A;  4RQ5 A;  4KLQ A;  3GIK A;  3LVW A;  2JXJ A;  2JH7 A;  3GV7 B;  4X5V A;  3MR5 A;  4DF4 A;  4YN4 A;  9ICT A;  2B0C A;  2FE9 A;  4O3N A;  2NRV A;  4QZB A;  3QX7 A;  2YY6 A;  2F8K A;  1UT5 A;  2FJ6 A;  5KFO A;  5G5G A;  3QUT A;  2RP5 A;  3NGD A;  1X9X A;  3JPS A;  5EE0 A;  4IQU A;  1B22 A;  4JK1 A;  4XRH A;  1Z1B A;  4CE6 A;  4E0D A;  1ZQI A;  1ZQC A;  1BNO A;  3ETL A;  3F2D A;  4ED1 A;  2G0A A;  2QB0 A;  1CRX A;  2G08 A;  1S0O A;  1M6Y A;  1PVR A;  4KN4 A;  3IP4 B;  2NV3 A;  9ICO A;  4YMM A;  4QZC A;  3F2C A;  4M04 A;  4QWA A;  5DDM A;  2RHF A;  4RU9 A;  4JMU A;  3E58 A; 
#chains in the Genus database with same CATH homology
 2ESE A;  4RQM A;  2F44 A;  2D3D A;  3BQ7 A;  1JI7 A;  1UQV A;  2DKZ A;  1SV0 A;  2Y9U A;  2DL0 A;  4IS7 A;  1PK1 A;  3IDW A;  2K4P A;  1SGG A;  1UCV A;  4RQN A;  5JRT A;  1V38 A;  1DXS A;  2ES6 A;  2QKQ A;  4NL9 C;  2QB0 B;  1SV4 A;  2QAR B;  1V85 A;  1F0M A;  2L5Y A;  2KSO A;  1COK A;  1B4F A;  3TAD A;  5JU5 A;  4NJ8 A;  1OXJ A;  2DKX A;  1WWV A;  1SXE A;  2KMD A;  1SXD A;  3BS7 A;  2KG5 A;  1WWU A;  2E8M A;  3SEN A;  2QB1 A;  4PZO A;  2EAO A;  2Y9T A;  2JV3 A;  2EAP A;  5JTI A;  1RG6 A;  2E8P A;  2KE7 A;  1X40 A;  1B0X A;  3KKA C;  1PK1 B;  5J8Y C;  1LKY A;  2LMR A;  2LPE A;  3BS5 A;  2YTU A;  5KNI A;  2FE9 A;  4PZN A;  2B6G A;  4NL9 A;  2F8K A;  1Z1V A;  2EAM A;  2KSO B;  5F3X B;  1X9X A;  5L1M A;  1SV0 C;  2E8N A;  3TAC B;  3K1R B;  2K60 A;  1X66 A;  2EAN A;  2GLE A;  2QB0 A;  3H8M A;  2QAR A;  2E8O A;  2F3N A;  1KW4 A;  3SEI A;  3TAD C;  2D8C A;  1OW5 A;  1LKY B;  3KKA A;  4MHV A;  2KIV A;  1PK3 A;  5J8Y A;  3BS5 B;  3HIL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...