3NS1A

Crystal structure of bovine xanthine oxidase in complex with 6-mercaptopurine
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
164
structure length
164
Chain Sequence
TADELVFFVNGKKVVEKNADPETTLLAYLRRKLGLRGTKLGCGEGGCGACTVMLSKYDRLQDKIIHFSANACLAPICTLHHVAVTTVEGIGSTKTRLHPVQERIAKSHGSQCGFCTPGIVMSMYTLLRNQPEPTVEEIEDAFQGNLCRCTGYRPILQGFRTFAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Substrate orientation and catalytic specificity in the action of xanthine oxidase: the sequential hydroxylation of hypoxanthine to uric acid.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Xanthine dehydrogenase/oxidase
total genus 39
structure length 164
sequence length 164
chains with identical sequence J
ec nomenclature ec 1.17.1.4: Xanthine dehydrogenase.
pdb deposition date 2010-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 3ns1A02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3ns1A01
1VLBA 4ZHOA 2E3TA 2HTME 1TYGB 1JW9D 1ZXIA 1N62A 3AN1A 1I7HA 3VR9B 1JWAD 4C7YA 2Q5WD 1AYFA 3BIID 5G5GA 2EKIA 2WDQB 2Y5CA 3WCQA 4JWSC 1FMAD 3VR8B 2QIEB 3P4SB 4YSXB 3AE1B 5G5HA 1E9MA 1L5PA 3VRAB 2WP9B 3P1MA 2K5PA 1FXAA 3SFDB 3NVZA 1JROA 1FXIA 1WGKA 2L83A 3LXFA 3ABVB 2WDRB 1RM6C 2PKOA 3AEGB 3EUB2 1SB3C 3DWMA 1L6VA 2MJ3A 3ETRA 4N6EB 1NENB 1QLBB 1NI3A 1R7SA 1RWSA 1OQRA 1YJJA 1UWMA 2K9XA 2PVOD 2WS3B 3L4PA 2CJOA 3AE3B 3LB8C 3NVYA 2CJNA 4WWMA 4YSYB 1DOXA 4N59A 3VRBB 2H88B 3NS1A 1WWTA 3W5VB 2MJEA 4ITKA 4JWUC 5EE0A 1QOFA 4YTMB 3AMZA 2JQRB 3AEEB 1V97A 4A9AA 3AE5B 2WDVB 3AE7B 2BS2B 1J7BA 3AEBB 2W55A 1DOYA 3AEAB 2L52A 2WLBA 3P4PB 2LEKA 4JX1C 4ZHPA 1A70A 1OFFA 1TKGA 3KWLA 3NRZA 1J7CA 3CWIA 1DOIA 1CJEA 1T3QA 2W54A 1TKYA 1YJIA 2H89B 2WU5B 4C80A 3AECB 3AM9A 4YTNB 2M19A 2FBWB 1FO4A 1XO3A 2QJLA 1QOBA 1FRDA 1FFVA 1JRPA 1ZP0B 4USAA 1WYGA 2W3RA 4ZOHC 1RFKA 1NEKB 3AEFB 1JALA 1PFDA 2KMMA 3B2FA 4P6VF 1N5XA 5EE1A 1N61A 1TKEA 5GXGB 1NVID 5MPOA 1KFYB 3AV8A 3AE4B 1YQ3B 1GAQB 2G1EA 1SIJA 1EWYC 2DWQA 3HUIA 1JWBD 1FIQA 3RPFC 2W3SA 3P63A 2K22A 5EE3A 3ZYYX 1NYQA 2OHFA 3AE6B 2ACZB 4N58A 4US8A 1WXQA 5H8YE 1VDVA 4HROA 1L6UA 1VJKA 1XLPA 3SR6A 1XLQA 3AB5A 3P4QB 1F0ZA 5H92C 3HVZA 1QF6A 1B9RA 1QOGA 3P4RB 4US9A 3W9CB 5EE9A 1CZPA 1ZOYB 4YSZB 1PUTA 1J7AA 3FC4A 1YQ4B 1WRIA 4YXDB 1E6EB 3NVWA 2B76B 1NYRA 2BS3B 1E10A 4YTPB 4HRSA 1GPXA 1N5WA 1TJEA 1XLOA 2AX5A 5AUIA 1E0ZA 1FM0D 5C3JB 1PDXA 1XLNA 3B9JA 1DGJA 2KAJA 1IUEA 3NVVA 1QT9A 1L0VB 1QOAA 1V8CA 2PVGC 3AE9B 3CIRB 3B2GA 3W5UB 2JX5A 3AEDB 1FFUA 1KF6B 2CU3A 1OQQA 1ZUD2 1E7PB 1KRHA 2DBYA 3AH7A 4FXCA 3DWGC 3FAHA 2N0SB 3SFEB 2M56B 4WQMA 2WQYB 3PO0A 2BT6A 4IDIA 1N63A 2BS4B 4KX6B 3HRDD 2WU2B 1ROEA 1RYJA 1JQ4A 4C7ZA 5C2TB 2MJDA 1FRRA 3AE2B 3AE8B 1N60A 1AWDA 2PIAA 4LTUA 4YT0B 1SF0A 2MH7A 5AUKA
chains in the Genus database with same CATH superfamily
4KLIA 1KBUA 4EEKA 4II2B 5D6JB 3F2CA 2J53A 1LM8B 2NR2A 3BIID 5KG7A 2KX0A 4UB2A 1XNSA 4I29A 1F2RC 2M4NA 3LWLA 1M4VA 1UHUA 3MR5A 4HCPB 4JB3A 3PSTA 5JU5A 2KFJA 1KLVA 1Q5WB 3EPIA 4KLFA 1E8WA 2LI5A 1RM6C 1WE7A 4K3CA 2WB1C 1L6VA 4I2HA 1B0XA 3GFKB 3JVZX 2QJLA 2F1HA 1DK2A 2P6UA 3PHWB 4WWMA 4RQ4A 1I35A 1UGJA 3NVYA 2UVVA 1P7EA 5KFJA 3CP8A 2HOFA 2WFAA 3PW7A 2K60A 5KFTA 1SKRA 4L2YA 4N59A 5D94A 3WAPA 1B22A 2ZTDA 1NK6A 1YX6B 4WJNA 5E79U 3UMCA 4P0PB 4CHKA 3GIMA 2O6VD 4BAXA 1G6JA 3RB6A 2W55A 5AI6A 1ZD4A 4IQVA 3GILA 4RNNA 3F5AA 1WMHA 4UBBA 3AU6A 1P0RA 1N6ZA 1X9SA 3RBDA 2FBWB 2V4IB 4NM1A 1XO3A 1QOBA 2LKYA 2W3RA 1LKYB 3VRAB 3T9LA 3FILA 4NY0A 3BWUD 3NOBA 1D8BA 1NVID 1YMHE 1Y56A 2D3CA 4WWPA 2YEPB 2O6VB 2XIDA 4BKGA 3M95A 4F91B 3PX4A 3DHIC 5J2EA 1L8LA 2DL0A 1ZQTA 3CNHA 3C0RB 4FZNA 2NPTA 2JXJA 1LGRA 2D11A 3TAPA 4R65A 2GBKA 1TGZB 4MELA 2HHTA 1JWSD 4YMNA 4OJLA 3QNMA 1KW4A 4ARCA 3CF6E 2R8IA 3VFKA 2D3DA 1OQYA 1V9PA 8ICJA 3V72A 2W11A 4IRCA 2KKCA 4JK1A 1C78A 3BZDB 4NNJB 4YD1A 1BUIC 1XLOA 5AI5A 3BVGA 2G4DB 5HHDG 2MA1A 4RT3A 1X2IA 2BQ3A 2M17A 1LQBA 1PVPA 4KGSA 2CU3A 4JV1A 2JWZA 2RDBC 3TIXA 5JHAA 3A9KB 3ZIMA 5J0YA 4PPXA 4LNOA 5CX3A 2GMIC 2AQ4A 2IZVB 2LJIA 1IBXA 2D3BA 1MG8A 1MQ2A 4KLLA 3TARA 3V3XA 4AP9A 3PO5A 2WF9A 5HMMA 5KFGA 2N7EA 3EW9A 3TAQA 4DXFA 1SF0A 4OZAA 1PK1B 3RNGC 8ICKA 2MBOA 1FNWA 3AQFA 3AN1A 1JI7A 3W1YA 2EKIA 5L95C 7ICKA 2KDEB 3RFZB 4QNLA 3E9SA 1E9MA 1C4CA 4FLHA 4RQ0A 2JR5A 2ICIA 4RGNA 4QIWC 3VCBA 2PEAA 4TV3A 4OHJA 3KHLA 4I2AA 1NI3A 1OQRA 4XX5A 1JXLA 4F8CB 1MSWD 3N4MB 4QZ9A 5KFDA 2CJNA 2EELA 4IQWA 4QW9A 1KN5A 5BPCA 4XE0A 1XC9A 3SEIA 5AK4A 1I4HA 2HDEA 5ALTA 2VANA 4ICAA 1SE2A 2UU7A 4X5VA 3RJEA 1Q3UA 8ICVA 2REXA 3SEBA 1HXYD 2KYWA 2JH7A 3K1RB 4BKTA 2FMQA 3VH3B 2MSNA 2GRIA 1NKBA 1TS5A 4DF4A 1GB4A 2WF7A 4O0IA 3QEBZ 2VIXA 3FDSA 4M2YA 2BWFA 4P7IA 2MBQA 1FFVA 1ZP0B 4A8EA 4A6QA 3KKAA 2WXQA 1DRGA 1WMHB 2FMPA 9ICWA 3VRBB 4KDIC 4RFBA 3I57A 2D3AA 1MHXA 1KJTA 2JVCA 7ICEA 1XT9B 4P4OA 1FIQA 5J0QA 1JWBD 3K9PB 3M3JA 5LXIB 1V2YA 2DUYA 1WJ4A 1I4QA 3ZYYX 2R8HA 4M01A 3ZJTA 4KN4A 4JUZA 4RPYA 1EXNA 2K8AA 7ICJA 2KLCA 2ZJDA 3TL5A 3P4QB 1K1QA 2WF8A 4J9LA 2TSSA 4RNOA 1EM7A 3L17A 4B95A 2YVCA 5C5JA 4OJOA 2FCQA 2JWUA 3RNAC 5CTRC 3BK1A 3DEEA 3RH5A 1X1MA 3BS5B 1J7AA 1YOVB 2IJ0A 1K51A 4I6LB 5HI1A 5J8YC 1WRIA 4DBGA 2MEKA 2ZIUA 3RYTA 3NUQA 4O5KA 5ALJA 3RNEC 8ICLA 4UQGA 3WALA 4F5PA 2HBLA 3IDWA 4WURA 5D2MB 5KG0A 3QU4A 1E0ZA 5C3JB 3U26A 3B9JA 1K53A 2CPRA 4MHVA 3RJFA 2MUTB 1YZ6A 4J03A 3B2GA 8ICWA 4GDKA 8ICCA 1ZUD2 2NBWB 4G3XB 4B9LA 4EZLA 2AGPA 1YX5B 4R63A 4EBEA 1ZQPA 4I2DA 5CWRA 4B9MA 4NL9C 5KFXA 4B9TA 5DG9A 2D2QA 5J0TA 4KLEA 1DK3A 4KX6B 4C8KA 2N9KA 5AKLA 1VJ5A 2PJHA 2D3GA 4C7ZA 3RUIB 3T79A 3FYHA 4HJKA 4NAWA 2KJ6A 7ICUA 5HG2A 5KG2A 3V7JA 1R4MB 1PVRA 3L54A 3GZNI 4PYUA 2NRXA 2NBVB 4ZRPA 3ZDMC 1WM3A 5AEKB 3GP7A 2KVZA 2GB1A 4MJSB 3IG8A 3TQ1A 7ICRA 2I2YA 3F2DA 5G5GA 4DQOC 2DENB 3AE1B 2ZZPB 5KFIA 5J2KA 4GXJA 4W9JA 2HBKA 2L83A 1FXIA 2KJ8A 2AQ0A 4IRDA 2IGGA 4LZDA 4LJXA 2R61A 1NENB 2IMWP 2DZIA 4R8UA 3M1YA 2ASQA 2DFLA 1RYSA 1ZQDA 5IAAC 2V0GA 2LHTA 2UWQA 5AZFA 2NRTA 2WXLA 2E8PA 2LUEA 2PE9A 3M7DA 4GOCA 3ZD8A 3R66C 1EUVB 1UH6A 3ZDCA 4PS3A 3AEAB 4JX1C 1A0PA 4ANWA 1TV9A 1AW7A 2ZG6A 4IR9A 1D6EC 2A19A 4QZDA 4J9KA 3X23A 2XGPA 4P4MA 3SAGA 1IM4A 1ZQRA 4KGTA 2D07B 8ICYA 4ZOHC 5E6NA 4P6VF 3ZDEA 3HIZA 5ALRA 3ZVVA 1QQ5A 2KFNA 1KFYB 3DVGY 3H7PA 3RH6A 2VA8A 4RQ3A 8ICEA 4GSWA 3RJJA 5KFYA 2HDOA 4HJGE 4JWNA 1ED1A 5IN7A 1KFSA 1J2MA 3DBLB 3NY5A 2MP2A 1XO1A 4GC6A 4QZIA 2IBIB 2JZ3B 3MJ5A 1B43A 4ACOA 4UAUA 1VD2A 2KSOA 2YEPF 4MFFA 1TKDA 1X9WA 3ONNA 2JEJA 5CRXA 4UBCA 4W9KA 3E58A 1QOGA 4PH5A 4YSZB 3M9NB 1XXGA 1WH3A 1ZE3D 1NJZA 1F2RI 3MGHA 2FPMA 2Q0ZX 8ICTA 2DNFA 5AKKA 5CB1A 3MR2A 1D5XC 3W1SC 1E7UA 9ICRA 4YMOA 9ICFA 5HR6A 2NVUI 1QOAA 2C7NB 5KFWA 1BPZA 5AHXA 4KLOA 3CYMA 3TKAA 3GV7B 2IOHA 2Z8LA 3N1ZC 3ZNID 2BWES 5JRTA 4LDTD 1X9XA 4EKUA 3VVWB 3ZD9A 4CRXA 1V1OA 1ZD3A 2QHOA 4F50A 1WXVA 2KJ9A 4KLTA 1E8XA 2JF5A 3CSTA 3BY4B 2QCZA 1KH0A 3VXWA 3ZDBA 3DBRB 4YT0B 8ICBA 2KANA 4RQMA 5J2HA 2K8CB 1KSPA 1ZXIA 1K50A 2R8KA 3MGIA 3H6NA 2PMVA 2JEIA 2PFQA 2WXMA 4KVGB 5ALLA 1F77A 2KHVA 1B4FA 4DHJB 2L1AA 4ECWA 2Y5PA 2NTSA 2LYAA 1IV8A 2XNAC 1KFDA 8ICGA 4KSKC 2WTFA 2KP7A 1L0YB 3AE3B 4FS1A 4NAMA 3PR5B 1V1PB 3C8YA 4RF1A 4NXZA 3H0LB 3C2KA 7ICFA 2WXGA 3Q8CA 2BYTA 3QJZA 1S10A 2K1FA 3PRPB 4XRHA 5C0YA 9ICTA 4YWGG 1SV0A 1TK5A 5ALQA 1S76D 3AU2A 1ZGUB 2MRPA 4NLZA 4M0AA 4CF3A 5HNKA 2K8HA 2WDVB 1DOYA 1O03A 3PV1A 1HTQA 4FJZA 3OJUA 9ICMA 1J7CA 1RRBA 4GMVA 4GB9A 5KT3A 4RU9A 3SD5A 3KBBA 2BDUA 2FIDA 3EFUA 2BB6A 4Y2YA 2C2RA 8ICHA 1RFKA 4J9MA 2LGYA 3EZ5A 1PFDA 2KMMA 4OJ6A 1ISNA 2RP5A 5EE1A 5J2RA 4Y2PA 3HM3A 2PFPA 4M9GA 5MPOA 5AK5A 4EYHB 4DL3A 4DFKA 1Y88A 5ALZA 1GAQB 4KIKA 3EWAA 4P16A 4TSSA 4QZ8A 8ICIA 2KTQA 1BVSA 4B9KA 2K22A 5KFPA 2HMXA 2OHFA 2KN5A 1WWVA 3QA8A 2CKHB 4ECRA 3NS8A 4NAWB 1SZHA 4O5CA 1WRDB 1UT5A 2V3SA 2PLPA 3JSVA 3M9OB 1I4XA 2DZKA 1NK4A 2LMCA 1Q3VA 1EU3A 2VJ5A 4B6JA 3V60A 4O3OA 2I9GA 3TFRA 4XWWA 1QF6A 1B9RA 1HIWA 3R3MA 4I2FA 2NMQA 3MR3A 3O0FA 4NQLB 5JZEB 4TURA 4OD0A 3CMMB 5DPTA 3VC8A 3PRMB 7ICOA 2ZEQA 2L32A 3BINA 3NG0A 1N5WA 2W9CB 9ICJA 2KICA 1V86A 2INDC 3N30A 4JE3B 1GC7A 5E6OA 4FA6A 4Y2XA 3TMPB 4QWDA 3EC8A 3NUHB 4DL2A 2HVIA 2L00B 2KDFB 4M9HA 1OXJA 1U47A 1HZ6A 2OXOA 2KMCA 3P2BA 4DF8A 2G5HB 3WKEA 1NK0A 1C79A 1F9JA 2KC2A 3GZNB 2VJ4A 3KUCB 5KG1A 2HI0A 4LCDE 1X6IA 2QKQA 2F3NA 4ARIA 4ED2A 4UAVA 2NV3A 4DL5A 1FCCC 2G07A 5ALXA 5DCNA 5KAFU 4RQ8A 1WXSA 4YR0A 3PLUA 4Q45A 4XDCA 4Z6EA 4XWTA 2Z59B 1JRUA 3N7RC 3Q3OC 3DV9A 4I2JA 2ZJ8A 4MSQB 5AKYA 1WY8A 1UQVA 2KHQA 2QEJC 2ZIVA 4DLGA 2ZXHA 1AROP 2DYMA 1I4GA 2KHWB 4UATA 1VZ6A 2G09A 3KKAC 4YSXB 4R3DA 4C0ZA 1TY2A 4AYBC 3P1MA 4BGDA 1AQ6A 2K5PA 4RT2A 1TAUA 2Z0EB 2XK5A 2J0JA 3C5GA 4ZYNA 5D7GA 3N97B 2GOWA 4BWJA 2W8LA 5ALHA 5IIIA 4IG7B 2LM1A 5H2FU 3UXPA 3MC9A 4Q8EA 4W9HA 3MHSD 4YSYB 4ANUA 2KK0A 3BQ0A 4G0NB 3RB3A 2AH5A 3KHHA 2W9NA 4FBJB 4DFMA 5AK3A 3AEEB 3AEBB 4R64A 3P4PB 3SV3A 2YMLA 3Q3JA 3LDAA 4GDLB 5J29A 4M00A 1KTKA 1ZQJA 4F4XA 3TADA 2ZTEA 2D8CA 3AM9A 4YTNB 3VTWA 5C23A 5K4LA 3HILA 1WFYA 4DSFA 2CHWA 1S97A 4KTQA 2XK5B 4DDID 3ORYA 3JW0X 5F9LA 4GLXA 1N2XA 2DGZA 5J2AA 3IP4B 2KOXA 4MGZE 3Q8LA 4PGYA 2H3ZA 3I9V1 1QQRA 3VHTC 5L1KA 2K4HA 5J2JA 1C7YA 1BMLC 5BO4B 3PMLA 4DOBA 3QUBA 4YG2A 1F44A 2IO0B 4K1RB 3O13A 2ASJA 1F0ZA 5JTIA 3V6JA 2RDGA 4BX9C 3DBRI 2WDTB 3SMVA 2WHEA 2MSED 1ZQYA 5AM4A 3ICXA 4PT5A 4HKZE 3E2EA 5EE9A 2GH1A 2WB1F 3S6JA 2MLBA 5EWGA 2XO7A 4C56C 4W9FA 3IAS1 4KITB 1OEYJ 2WF6A 1EO6A 3SDLC 1XCTL 5DB8A 1FNUA 5KFBA 4EZ9A 2AYOB 3PTFC 4RNAA 9ICPA 3QE9Y 4YMMA 4K7UA 4NJ7A 1CI4A 2J6UA 4A3PA 2LRUA 5FR6A 1LV5A 2BVCA 2L3ZA 4DFDA 4TQ0A 8ICXA 2RR9A 5LXHA 2ZIUB 2N7DA 4OW0A 1NJXA 4DLEA 2YMQA 1NK9A 4WQMA 2BTEA 3WK4A 3TCAA 9ICUA 2C7HA 5AI9A 5J2CA 1KFTA 1L3TA 4ECTA 2XI9A 1SKSA 1ZQBA 4MF2A 3MDAA 4HYKA 2KWDA 2AL3A 2F8KA 2KOBA 3H8WA 3B0AA 3RZFA 3A0HU 3H8SA 3K1ZA 3KUDB 3BS7A 4TUUA 2W04A 3PGEA 2A1JB 4UW9A 2EAOA 2BCRA 1COOA 4F4WA 3TACB 2PI5A 3BVMA 1ZQVA 2D5GA 3HVDA 2PMZF 1WGKA 3VUWA 4L23A 3AEGB 3UM9A 5J2BA 3KUZA 1FEZA 4DXAB 3BQ2A 2K4IA 4C4VB 3WK9A 1DOXA 5AM5A 1CK1A 3MC0B 1XQQA 2KZ3A 3Q8SB 3ML8A 5ALDA 3RF9A 2ZIXB 2V4LA 3R9KA 3IN5A 3KOOA 1P1AA 4GXBA 3WU2U 3KQ4A 2IOFK 1A70A 4JLCA 2HHXA 3JPOA 3AXCA 3I3TB 1TKYA 1WX8A 2H89B 2PE6B 1TBEA 3QWZB 1HEKA 1FO4A 1BNOA 4MH8A 3HKZC 2KIWA 2ZNVC 4UB5A 3D2NA 4ECXA 5CHGA 4YP3A 4O3RA 2HHUA 4NQKE 1NNLA 3TI0A 3IHPC 4FE3A 1R4NB 3QXGA 5L83A 1KTQA 3D2SA 3OJ3A 5ALEA 1WIAA 2BB5A 4QWBA 3RN9C 5KHOA 3LVVA 2KK8A 4US8A 1S3SG 1HQRD 4YFKA 2YB4A 1XLQA 4IM3A 4K4HA 3L16A 2IPKD 2NO4A 1T7PA 1QSYA 4LNKA 1KLNA 2G45B 3QU7A 2M8SA 1BPBA 4RPZA 4A3OA 5AKEA 2PFOA 2A1AA 3B08A 5AZHA 4EOYA 4YXDB 3NVWA 2Z0DB 2YX8A 7ICNA 9ICKA 3PZ8A 2V3NA 5AUIA 2AX5A 1GPXA 2LM4A 4ZRKA 3GIIA 1DXSA 2JV3A 2IO2B 2HOQA 2NS5A 4Y2VA 1K5OA 5D3IB 3KVFB 1EWCA 3JPTA 3L5KA 5KFEA 1KF6B 2NCNA 4P2HA 1KM7A 2W8KA 1R4NI 1ZKHA 3IG5A 3QU9A 4P0PA 2Y5BB 3QCAA 4O3SA 1ZQ1C 3H8JA 3DWGC 3Q8BA 4A90A 3THVA 5J2FA 4ANXA 4I6NB 5DG8A 5BMIA 2PTLA 3H0RB 4DK5A 5KNIA 2KO3A 2JZBB 1SJED 1EU4A 4K7WA 2EANA 3AE8B 3PR4A 2JZZA 2MBEA 4IC7B 4F5RA 4JGHB 3MC1A 1ZXHA 3ISCA 4P1CC 4PL1A 1KLGD 3KZXA 4QAYA 3IT4B 4RM9A 4LZGA 3RTVA 2JRIB 1D4BA 3OSNA 1MVKA 4KN7A 4G11A 2CS4A 4EYIB 2BDPA 1IIPA 4MSMB 3JPSA 5DB9A 1Z00A 1MC8A 1N56A 1MQ3A 3BQTA 1BT0A 3U8ZA 3LXFA 7ICVA 4BBNC 3FILB 5KFCA 2N9LA 5KT7A 4EE2A 3TEZA 4M04A 1QLBB 5E6JA 1R7SA 1ZQNA 2PVOD 1YN4A 4HEA1 2BKEA 1NI2A 3RAXA 1C4PA 4DCCA 4TQRA 5EE0A 2DF4B 4NZLB 2KFKA 3C5FA 2FUG1 3A9JB 1ZQIA 4DSKA 4D2KA 2E1FA 4Q2JA 5IIJA 4Y2JA 1GC6A 4ZDVA 4FJYA 1WCLA 4C8NA 4NV0A 2EMSA 2VA2A 2P6RA 3PNCA 3Q8PB 4NY8A 4ZRIA 2BBCA 1BPDA 2JXTA 4W9LA 3DVNV 1GG3A 1FRDA 2WXJA 1JRPA 3ZKJC 1SWWA 1WYGA 1XD3B 1SL1A 1N5XA 4FHJA 1N61A 5J0RA 5DB6A 2IY1B 1JMLA 5KFZA 1Z4OA 2KSOB 2QC8A 1YQ3B 2G1EA 2ZUCA 1L3VA 1EWYC 3NRWA 2W3SA 4DFJA 2N9XA 2ZJ5A 4CDGA 1D9FA 1GNUA 2WX1A 4K4IA 4W9DA 1WXQA 2ZVOA 2RRDA 5ALUA 5DBCA 3I1YA 3IM1A 1VCBA 3PZ7A 1V85A 4HAIA 2H3IA 1BPXA 2BCQA 2L05A 4YVZA 3P4RB 2J52A 3TEXA 3DCGA 3N3KB 5FKAC 2O6KA 1U49A 3RCZA 2EZYA 4AUQC 3PW2A 1OUQA 3IV6A 2PW9A 2DPJA 2W7PA 4YTPB 4ED3A 4PL2A 4ED1A 1J19A 2MWSB 1WGDA 1DOQA 3R7RA 1KEJA 3T5LA 3AL0B 2LGIA 1ZQXA 1WJUA 5ALMA 4E71A 1Z2MA 3W5UB 2FLPA 5EDSA 3RNCC 4O3PA 1VRAB 1OQQA 5F9NA 4JV0A 2LVQA 2J4XA 1WM2A 3LDZE 2UVUA 4OJPA 2FIFA 4FXCA 4IWOA 3U30A 3ECIA 1SJHD 3UQAA 4LNNA 3WK5A 2KDBA 4KX3A 2K39A 3PHXB 5DLFA 4O5EA 1XSPA 7ICLA 3AEVA 3M9MB 4G9BA 4YN4A 3PMNA 2IGHA 2F1JA 5L1JA 2WX0A 1PYWD 3LB8C 2KN4A 3N1YC 3N7PD 4GC7A 4PHAA 4P0QB 4NJ6A 2E8OA 1HE8A 3QIJA 3RD2A 3DHHC 1ZW7A 1S0NA 3DPDA 2R18A 5J2GA 5KHQA 2K3UA 2C28A 1T0YA 3OG5A 2NYVA 5BOMA 2RGFA 8ICSA 5T8IA 2BKRB 3ABVB 1D5MC 2C7MB 3I28A 2F8LA 2JT4B 3W2DA 2I38A 1WXMA 3GIJA 2FLNA 2L8JA 1RXVA 1YJJA 3EA6A 2K9XA 3H9DA 2ASLA 5J18A 2H88B 1QTMA 4XDDA 1E7VA 5IIOA 3ZTCA 2JU6X 2FAZA 2LPEA 1ZQLA 3PW0A 4F5OA 2BHNA 2N1VA 2IGDA 1URJA 3OTQA 4IR1A 4WH4A 2H3QA 4UAZA 1HEZE 1LVHA 2Y9UA 3CWIA 2W9AA 1RLFA 2LGDA 4IWPA 9ICEA 3HKZF 5KFRA 2FJ6A 2INCC 5KTQA 3BS5A 1MFWA 1P9DU 4GU2A 1UF0A 4OO1J 4ECQA 3VQIA 4A55A 4RQ6A 4MM3B 1S9FA 1BPEA 3RJIA 1P7FA 3V7LA 2R8GA 3WKCA 3Q8MA 4ECSA 4DL7A 2QARA 5DB7A 1NOMA 3N20C 2RQ5A 4Y2UA 3IAM1 1WX7A 2K6DB 2MRLA 1KOTA 4Q44A 1RQNA 5KFHA 1RQLA 3IRUA 1NK8A 4FBTA 1IG6A 4QZGA 2KVRA 1ENFA 4IM0A 1SZPA 7ICIA 2GO7A 8ICMA 2KWUB 1SE4A 4B9NA 4M0WB 4O3NA 5J2IA 1XLPA 4REZA 2QLTA 3V62A 1ZRMA 1JCKB 3QK0A 3TUOA 3GE3C 4C4VA 4ZRJA 3RT3B 1OW5A 1ZJMA 4HPMB 2OYYA 3OSPA 5HP4A 3CSFA 3BZKA 5KFKA 3Q3FA 2G5IB 5CJ7A 3B0XA 7ICGA 4BZAA 4JL9A 1U4AA 3QZ7A 3H7SA 3JPQA 4IRKA 1L7NA 4KLHA 2DAJA 3NASA 4KLJA 1HJPA 4HRSA 2QILA 9ICHA 4GXIA 3A1QB 2BKFA 3RMKC 3ZDDA 5DPSA 4DSJA 1V81A 4AOFA 3PSIA 5J0SA 4WJ3B 2JX5A 3RB0A 4CYEA 3QUCA 1ET6A 3OJ4B 3OLMD 3KD3A 4K7SA 2CN1A 4Q43A 1CMXB 4RGTA 1XSLA 2KQSA 2QB0A 1E8YA 2W03A 5AKGA 4NJ8A 1KKXA 2PPHA 1L7YA 1HUZA 2FE9A 3HM6X 2FPLA 2WQYB 1J97A 4EX6A 2Y3AA 9ICIA 2DYBA 2WU2B 3V7KA 3DQVA 3ZGZA 4Z6DA 4TUQA 3AU4A 3AE2B 2YTUA 1ET9A 1L3UA 3V6CB 3C21A 3T5JA 3T3FA 2VKQA 4JIOU 9ICOA 3DBSA 3KWVA 3VUXA 4CO7A 3RJGA 5IINA 2D6FC 4ZH4A 4KLDA 7ICQA 1I7HA 1NBFC 4C7YA 5G55A 1RPLA 2NBUA 1COKA 1ZJNA 3P4SB 4ED7A 2JXXA 5G5HA 3PSEB 2ZIXA 3MR6A 1FXAA 4DSEA 1GB1A 2D10A 5LLIA 2FUHB 5DQHA 3OAWA 2L7RA 3DWMA 1SB3C 2XCPA 2HBMA 4M47A 2OEHA 2K0PA 3APCA 4WAFA 4A20A 3ZRFA 4N6EB 5HR7A 4X57B 3M6ZA 2WS3B 5DBAA 1UWMA 4XUSA 5KFVA 4P0QA 2FMSA 1QILA 2XN9C 3L10B 4FHKA 4M8MA 2RPQA 4B0MA 5ALPA 2QSDA 4K81A 4M0WA 2ZNVB 1KLUD 2E5SA 2Y9TA 1YD8U 4YTMB 1A5RA 3DHGC 2BYVE 3ZNHB 1D3ZA 5TISU 1VZ7A 4ED8A 5CHFA 2LEKA 1UCVA 2GLEA 3QX1A 5KL1B 4P1BC 4UB1A 2GI9A 3U52E 4UAWA 2AQ2B 4HKQA 2KIVA 4KMOB 4WJOA 5KG3A 2WU5B 1QCKA 1SIFA 4I2CA 2RD0A 2YY6A 3RJKA 4BOZB 4KSLC 4PGQA 1HA5A 4OCZA 3KZIU 4QZHA 2GLSA 4F2RA 1ZQSA 1P98A 2KNJA 2JGAA 2OM6A 4QZCA 2AHOB 2V9WA 4UARA 2KZZA 5KAIU 4HPPA 2KFKB 2C2DA 2BQUA 1V38A 2XCAA 1UD7A 2LGSA 2EDUA 1A6SA 5KFAA 2G4SA 2XEWA 1Z19A 3JYUA 2W9CA 1NK5A 4EFOA 3GV8B 2XC9A 1I4PA 1KQQA 5H92C 4O1NA 2BCSA 3HVZA 5HHHA 1ZQQA 1ZQKA 4BXOA 1YN5A 3GZFA 4HWIB 8ICZA 2BPCA 4DQQA 2FCSA 2KVCA 2DZMA 3UIOB 4HK2A 1E6EB 1F5SA 1Z1VA 4F4KA 3PW5A 1Q46A 5ALYA 1ZQZA 4II3B 5DPRA 4JMUA 2ALZA 1DGJA 4ASWC 5ALWA 5KL8B 3AEDB 3ZI4A 4HDOA 1MI0A 1J8CA 3Q8AA 3QX7A 2YB1A 3A4SC 5DLGA 4M8NA 1STEA 4KV2A 2JEFA 1CEZA 1MPEA 3OWEB 2OCEA 4DSLA 1TIFA 1WE6A 4DSIA 2KWCA 2N0SB 3D32A 3SFEB 2KLGA 1PUZA 2EKEC 4OZCA 1ROEA 4DS5A 2J6TA 3IVFA 1N60A 1Z3EB 1AWDA 4AJYB 2K4PA 4E0DA 3SYZA 1SE9A 4ED0A 1YQBA 4DL6A 2LRWA 3JPRA 3URYA 3SD7A 2Y5CA 4NLCA 2WDQB 3PX6A 3H4BA 3VR8B 2JPHA 4BOSC 2ZPYA 2I1KA 4IKGA 2LHDA 3C2MA 2R2OA 2NRWA 2BQQA 4UB8U 4B0EA 3U2SC 1E8ZA 1IGDA 4KLSA 3EUB2 3C1YA 1WF9A 4QWCA 1KL9A 1ZDVA 4LNFA 4URKA 4QZFA 3H8HA 3ETRA 1YT3A 2J7QB 1Z5SB 1ZQOA 1FEHA 1MHHE 3L4PA 4ICVA 3LK9A 1RYRA 4TQ1A 4RMAA 1QSSA 2DKXA 2Q4TA 3NS1A 1UELA 4R66A 4IWQA 1QOFA 1ZD5A 4DDGD 1B1ZA 1P7DA 1FCLA 3G6YA 2IBKA 1Z4NA 3FKYA 4TMAB 5IIKA 3ZNGC 1OTRB 1K1SA 4GIVA 5DQGA 4IQUA 4TUPA 2CRXA 9ICSA 2WAQC 2O2VA 4M6WB 5J0PA 1SE3A 2F77X 5EWEA 5KT6A 1NJYA 3ZUNA 2RLTA 5KFMA 4MEYA 5C1ZA 5GXGB 1VR9A 5L1IA 4N9F4 2KV2A 1H8CA 1E90A 8ICFA 3M8RA 4FADA 1SIJA 3KW5B 3M6KA 3GU3A 1BPYA 1WWUA 3ISBA 3RULA 3DDHA 5J0XA 1XS9D 5ALGA 1ESFA 2N1WA 3L3FX 1WJ6A 3SR6A 3RFAA 2NTTA 1SEBD 1T3NA 2HHWA 3ZRCA 1X42A 2Y0SF 4S17A 5B66U 1L7MA 3HX0A 1UNSA 3IXSA 4F4ZA 4DFPA 3VUYA 4F3OA 4NM2A 3H7IA 1ACCA 2LASA 3EHVA 3VH4B 2KT7A 1E10A 1HZ5A 2AXTU 3QUQA 3RR7A 1U48A 1DYQA 2XBBC 2JHDA 2K8CA 1YNTE 2OJRA 4YR2A 4I28A 2N9PC 1RG6A 2ZW1A 4TKNA 3JSVB 3P42A 4XYCA 4U6PA 2KWVB 4ACFA 3OJSA 1T6BX 3ALBA 4W9IA 1A77A 1S0MA 3L0WB 3KHRA 4PGXA 3PS6A 2K8BB 1D8LA 2M56B 4C00A 2HSZA 4AS1A 4I2GA 2PMZC 5D4BA 1RXWA 1XSNA 3QAQA 4BKSD 1XCQL 4MH0E 1XO0A 4HVBA 3Q8KA 5AUKA 4NWIA 1LB2B 2M9NA 4YXMA 2HTME 1PZNA 1JW9D 2VH2A 3A1QA 3VR9B 2I1JA 1YN3A 2QIEB 3PVLA 8ICRA 2WXOA 3UGBB 4B6WA 1ZQUA 2CU1A 3QUTA 3MHZA 3KFUF 2AL6A 1QQ7A 2V1YA 1JROA 4GLSC 3H1UA 5DKWA 3HP6A 4MT5A 2MJ3A 5AZGA 2K6QA 1EF5A 5AKZA 5AM0A 3QZ8A 3H8MA 2N7JA 3VTUA 4DQRA 2G0AA 5AIAA 3L13A 3EFCA 4C4TA 4J9QA 2B6GA 3JPPA 2CXYA 3B0YA 1KRPA 1WGHA 3T8MA 5J0OA 2A1JA 4DWIA 5G2NA 3AMZA 4A9AA 3NZSA 3M62B 4KZCA 3Q8RB 3KTQA 2IO1B 5J0UA 4HLEA 1RAXA 4IC9A 4EX7A 4PK1A 2HD5B 5AIBA 4MF8A 3F2BA 1Q1OA 2MA9B 4OJ5A 2I5HA 3TJPA 1WYWB 3N1XC 3DOWA 5AKXA 1V5TA 3PW4A 2JRZA 3WA0A 3OHBA 2EAPA 1L6NA 3PSFA 3NZUA 1BNPA 4WIPA 3WKAA 2P66A 1ZQFA 2MUTA 1Y8RC 3P63A 4GDKB 1QLNA 2LZ6A 1BXTA 1D8YA 1TS4A 4MGYE 7ICSA 4LK0M 1XWLA 1UA1A 1E5WA 2ZIWA 2KTRA 3N32A 3HT3A 3R2IA 4XC2A 1ZQEA 2N9EB 2KACA 1GOZA 3KH0A 4US9A 5BYSA 1T5XD 1PGAA 1LO5D 1CZPA 4KX5A 1YQ4B 1QQ6A 1C1YB 2B76B 2KVSA 5AKJA 4G3IA 2BS3B 2E6XA 4J9PA 1MA7A 2WXKA 2XICA 2QDFA 1EF1A 3FM9A 2YLMA 1FM0D 2HHQA 4EEYA 2KC1A 3LYYA 2KAJA 1QT9A 2L76A 3R2TA 3V61A 4KLUA 3AE9B 3SZ2A 2M1MA 1WGRA 2JRHA 2Y1JA 2J42A 3UQ0A 2KDMA 3AH7A 5HHIA 2OH2A 4WJQA 1X9MA 4DHZE 5ALIA 2LUMA 2AGQA 4EUTA 1FXTB 2ZXIA 3PSPA 4KDLB 2BPGA 5BMHA 2DYOA 3A33B 1RYJA 3V6EB 1FRRA 4AYBF 3ZJVA 4RUCA 3RI7C 4RPXA 1SL2A 2ZCBA 2LWPA 4GDLA 3NTUA 9ICCA 3RZWC 4TQSA 1Z1BA 2HBJA 1JWAD 2Q5WD 1A76A 2MCNB 4EBDA 1V80A 4OVUA 4FO6A 4DQIA 4AJWA 4C8LA 5DGBA 1L7OA 3HHMA 1PGXA 2WXPA 3NZ3A 4M02A 4E74A 5B5EU 1TTNA 4BDPA 2DX5B 3BYTB 4EZ6A 3EYZA 1GUAB 3MJWA 4W9CA 1PGBA 2FE8A 5GMVA 2KMAA 3PX0A 5CP2A 1Q0WB 4UB6U 2OJWA 3IT6B 1RWSA 3CIRB 1JWMD 4KKJA 4BVUC 4O3MA 3V05A 1UT8A 3MBYA 1L2NA 2X8XX 4JQWC 1ECWA 4XGAB 5BYQA 5ALNA 2ES6A 2A4ZA 5HKHA 1WWTA 1V49A 4ITKA 3QARA 3AUOA 4RM8A 2JQRB 5JXVA 2BW2A 1J7BA 3C28A 2UVWA 4K3BA 2ZIVB 2KQ4X 1IXRA 4LJOB 4S0RA 3QEAZ 2DQNB 2GBRA 4DL4A 3R7QA 4EELA 1UBIA 1P3QU 4C80A 3APFA 1S0VA 2ESEA 3APDA 5DDMA 3ZO5B 3M8SA 3ZLZA 4FBUA 3B2FA 4CE6A 4FFDA 3UINB 3AV8A 4GFJA 4GIBA 4F7ZA 4MEMA 4WAAA 3RNBC 3MP9A 2F2AB 3A0BU 1WZ0A 5AI4A 4GN1A 1WCNA 2LBOA 4CGZA 4CNQA 1JMSA 2OEDA 2C22A 1V1PA 1C20A 4RQNA 4N58A 2IO3B 1S8OA 5BOLA 1XU4A 4DHZB 5JH5C 1L6UA 2KTFA 2A5UA 4AP4C 1L5UA 2GBNA 3L08A 5KFOA 3D2QA 2WGSA 2KJRA 2LFIA 3ETLA 3FC4A 2UVRA 4IS7A 2LI6A 3J9CA 2PI4A 1ZQMA 4PZOA 4Q8FA 2NPTB 4QZBA 4TUSA 2JUOA 2AQ1B 2MX2A 2LGXA 2YQEA 8ICAA 2M0NA 1FNVA 4F5QA 2INNE 4O3QA 4BJQA 3H40A 3BZCA 5DDYA 3LVWA 1WR6E 3WAMA 2AGOA 3SV4A 2L0TA 4XZ4A 2LMRA 2XY6A 1E7PB 2WXIA 2X38A 2BYFA 2RMMA 4CF5A 5J17A 1TFRA 1F0MA 2DBYA 4BUGA 5KFSA 7ICHA 4C8OA 2ON8A 4RGOS 3G6VA 3Q8QB 3UXNA 1D5ZC 4O9MA 2QB1A 1DGSA 3SENA 4KLMA 2ZUBA 5AI8A 2FNJB 3A9KA 1N63A 4IM2A 4CF4A 2DPIA 1ZRNA 3TFSA 3ZXVA 1T4GA 2KD1A 2JY6A 1C77A 5T14A 3M63B 2A3VA 2VA3A 1VLBA 3TSSA 4AWJA 5KT5A 2BCVA 1UBQA 3WK7A 1TYGB 3WK6A 4QZEA 1RYUA 1GJZA 3GQCA 1N62A 4I2IA 5D3DA 1IGCA 4LNIA 1UA0A 4JWSC 5BYRA 3UPQA 4MGIE 1ZQHA 5CR0A 1XF5L 3F53A 1TK8A 1SSNA 3PPAA 4UB4A 2W9BB 2AJQA 2Z7JA 1NZBA 2FLLA 8ICOA 2KD0A 1IYFA 5DQIA 3GB1A 3V6HA 1KDHA 4F71A 4Y2QA 4RQ1A 4YQWA 4JPSA 5LNK1 4F93B 5I4DA 5GTIU 2YMPA 2ISPA 1C9FA 2G3QB 2MJEA 3QHTA 4JWUC 3IFWB 2KE7A 1V97A 3CW2C 3KYDD 2O6VA 3AE7B 2G06A 1TT5B 2L52A 3T5HA 1TVAA 4I2BA 5J8YA 3WKBA 1N48A 2ONQA 3NRZA 1TAQA 3RB4A 3MFGA 1LKYA 4I27A 5KFLA 1DOIA 1Q10A 1SXTA 4ZRQA 1YJIA 2VH1A 4ECVA 3MFHA 4BBNF 9ICQA 1U4BA 4FN2A 4PHPA 2MBHA 5KT2A 1AARA 2WHIA 3AEFB 1JALA 2BZFA 2QMTA 1UGMA 1NKCA 1TKEA 2V4RA 3ZDTA 5KG5A 1WGGA 4FZLA 3C23A 1IBXB 3GOEA 2KXJA 2LJ5A 1R4MI 3RR8A 1S0OA 4YCXA 4NL9A 9ICBA 2EH9A 3AE6B 3EPGA 2RDIA 2INPE 4H2AA 4PYZA 4UB3A 3ED5A 4J9OA 1U9LA 4BWMA 2ATLA 3I5JC 3S2AA 3UF8A 2H3FA 3IHQB 4M6WA 2HE7A 2OOBB 9ICLA 3MFIA 3D6JA 1T0SC 1WI0A 1SV0C 4GXKA 1H4RA 5F3XB 2L5YA 4RF0A 1CUKA 3ZW3A 1LXDA 2PXIA 9ICXA 4MGKE 3GDXA 3RRGA 2MP2B 2CHXA 4RCOA 4PS8A 3V6KA 2DAFA 2B21A 2KX3A 2KNBA 3DVGX 1PDXA 4OVZA 1JWUD 2YN4A 1L0VB 1ZQGA 4PHEA 2N4FA 2KJ5A 4ANVA 4CQNA 1GO3F 1KRHA 4QWAA 4IL6U 2HHVA 2HOIA 3BVZA 2B0CA 4PJ0U 1QZEA 4IUMB 4A8XC 3H7PB 3N9YC 3ENEA 2XGQA 2W9BA 1TAMA 5JHBA 4C4SA 1L4ZB 4HDQA 4IOIE 4E3CA 1T0QC 4C4RA 2I1QA 5C2TB 1MG4A 3N7SC 5IA7A 1WXAA 4FULA 4LTUA 2MH7A 4HXDA 3PZPA 5FK9C 3EECA 4R8UB 2BR0A 3BJYA 3MABA 2VZKB 1L4DB 1X6JA 1J0GA 3WK8A 1AYFA 1C76A 2E8MA 3OGUA 1X40A 3BYYB 3NHEB 2EQYA 4F5NA 5TZVA 1L5PA 3UI3A 2Y1IA 2AWTA 3T3NA 2IY0B 3SFDB 4LJPB 3NVZA 1S1QB 4OZBA 4GGQA 1IPGA 4RGMA 2PKOA 2G08A 2J6SA 2Y0SC 1X66A 9ICAA 3MC8A 5J0WA 3RRHA 3NGDA 2IA6A 3MTNB 3IG3A 3WKDA 2CJOA 4MJSA 4RH6A 5TR5A 5IP4D 2N1RA 3Q14C 3Q69A 2KKVA 2J0KA 4Z6CA 2J0MA 4DOAA 3DBHI 5CA7A 5AICA 1PK3A 3AE5B 2BCUA 5DG7A 2WLBA 3VTVA 8ICNA 5AM2A 3WIMA 1OFFA 2JYEA 4RNMA 1SXEA 4F92B 2W7OA 1C4AA 3Q3NC 2IOFA 2I6XA 2W82A 3AECB 4MACA 1QH9A 2AQ3B 5IIMA 2M19A 2MAXA 2ZIWB 2KTRB 1SWVA 1J2NA 2ZPNA 3RPFC 4ZHOA 1JN3A 2E1EA 4USAA 2GBMA 7ICPA 3KYCD 3UIPB 4NLGA 1NDDA 5L9XA 2ZCCA 3F5EA 4KMUA 1WX9A 1JIHA 1S77D 3AE4B 4L1BA 1MJDA 3UQBA 2PKEA 2DWQA 2V9HA 4RUAA 2AU0A 2KJHB 2WF5A 5ALKA 1U45A 1M94A 5EE3A 2LXAA 1NYQA 1NJWA 3ZJUA 5H8YE 3HW8A 1VDVA 2HHSA 1VJKA 2FCNA 3AB5A 5AM3A 4MEXA 2KFZA 5ALFA 4ICUA 2BQRA 2WXRA 2EZXA 4C8MA 3UXOA 2IDYA 5EOZA 1L8OA 1L3SA 3W9CB 2FDRA 4EBCA 5ALSA 2QB0B 1I4RA 4HPLB 3Q8EA 5ALOA 3T5KA 5KFFA 4NLBA 2JH1A 5KG6A 7ICTA 4EZJA 1TZ1A 5FR3A 4RQ5A 4K4GA 1Q8KA 2BYEA 4FS2A 2HJ1A 3E56A 3VAWA 2PFNA 4NJCA 2ASDA 3KHGA 1IUEA 1WUDA 3NVVA 2PVGC 5TSSA 2F76X 5IILA 1FFUA 3ZDAA 2LD9A 4NPNA 1XEEA 2C2EA 4JV2A 3QU5A 4B9VA 2LXCA 2NRVA 3HK0A 4WJPA 3PY8A 2E8NA 2RDHA 3O65B 1HUOA 4IQTA 1UPHA 1YZ7A 4W9EA 2EAMA 4F4YA 3SI8A 3ZXRA 8ICQA 4EZKA 4QIWF 5IKCM 3PZDA 3T3OA 1ZPSA 2BT6A 3Q3MC 4QZAA 1WG8A 3ML9A 3SHQA 3HRDD 1V9JA 5KG4A 4Y2SA 4RQ2A 2FPKA 2C60A 1WJNA 3K75D 4PHDA 4LVSA 4G50A 3A4RA 2KEYA 1S5LU 4ELVA 2BPSA 2E3TA 4J9RA 4EENA 1UWXA 3OHAA 1FD6A 2RPVA 1AN8A 4F8RA 5AI0A 1CQVA 3WCQA 1WZ3A 3KLSX 2KZMA 2WXNA 1JX4A 1UUPA 4WWOA 5CHVC 2LHEA 4ELUA 2R2QA 5FP0A 1WGYA 1L0XB 2WDRB 4FJVB 1WR1A 2G9HD 3PRZA 3AQEA 2ZJAA 3BK2A 3C29A 1QKZA 4UAYA 4YXJA 3SAHA 1V5OA 4RQ7A 2XY7A 4ECUA 2RSUA 3W1SA 2MU2A 3SQIA 2MHJA 4KIKB 5DPWA 1TY0A 3Q6BA 4F72A 2HTHA 1TKGA 1SGGA 2XY5A 2V4QA 4BFRA 4P4PA 4M9NA 2KQ7A 2KMDA 2C5LC 3RH4A 2F1IA 2FCMA 1MN8A 2W9MA 3X0WA 1IP9A 5IOIA 1NEKB 1PVQA 2MW5A 1UZXB 3N28A 1JXEA 3QU2A 3GIKA 3MGVA 3SU8X 2WWZA 1K8RB 3IBEA 1D9DA 4ELTA 2GWSA 4M9JA 3OPXA 5D49A 1H38A 2W43A 3MDCA 4J6IA 1TE2A 2QARB 4MFCA 2RHFA 1PQSA 3TBLD 2MQJA 4ZYSA 3TEYA 4KGRA 4QW8A 4HROA 1T8EA 2O2VB 9ICVA 3ONSA 1T0RC 2VRRB 5KT4A 9ICNA 1WSPA 1L7PA 3K4GA 1YIWA 1ZOYB 5GTHU 1PUTA 4PZNA 4DEZA 4QWEA 2DHZA 2RDJA 3PT2B 3NJTA 3Q8FA 4J9SA 4M9LA 4DQPA 5CHWA 4OVVA 4MM3A 3LWMA 2DZJA 3WAOA 1RFAA 2KZRA 4DOCA 3U4EG 4YL8A 1JUDA 3H4DA 1K52A 1OGWA 2JMGA 4RZRA 1TJEA 1TS3A 1C3TA 1ZD2P 2ZUDA 4DHJD 1RDFA 3VDZA 4Y2TA 3AULA 1V8CA 3ZNZB 1PK1A 3DVNU 4U7CA 2LVOA 4BKSA 5BMGA 3WANA 1SXDA 5ALVA 5AKHA 3C19A 5A0LA 2KDIA 2L0FA 3DDCB 1OEYA 2K25A 2DLBA 4KLQA 3U7DA 3TANA 2NO5A 2B3AA 3GS2A 2FI1A 8ICUA 2BS4B 4KZ0A 2SEBD 2MJDA 2HJ8A 4LLGM 3B1LX 2H5XA 3ISDA 5KFNA 2VZKD 3RJHA 2MBBB 4HCNB 4B9UA 4LDTB 3DBHB 3R8BA 2BPFA 5IO9A 2JSVX 2JZPA 3RBEA 3BQ1A 1I42A 1FMAD 2CR5A 1SKWA 3G6XA 4I6PA 2WYQA 2WP9B 5HMLA 3ZQ4A 5JUMA 3BQ7A 4EEWA 2HCFA 2K8BA 2C9WB 4IW0A 1T94A 1NZPA 2EZZA 2H3VA 3GV5B 1HTOA 2IYDB 4DQSA 3E0FA 3EGRA 2EMTA 4J9NA 3K9OB 2WXHA 4I2EA 1TZOA 2ZTCA 2BGWA 5L1LA 2OWOA 1VZ8A 4MDKE 2YMMA 4JWMA 3DBLI 4ECYA 2DKZA 3W5VB 5HFYA 1FPYA 4XQ8A 4F2SA 2V3PA 3LYSA 2WXFA 3QYPA 3AI5A 2BS2B 3Q2AC 3UMGA 1NKEA 2IHNA 2HVHA 4ZHPA 3KWLA 3CRXA 4BXOB 2GBJA 4MFAA 1CJEA 1T3QA 2W54A 5J2DA 9ICGA 1LFDA 2JEGA 3PV8A 3RAQA 3C1ZA 5AM1A 4Y2RA 2BGFA 1SBBB 5D46A 5EWFA 2NRZA 4DS4A 1ZYQA 2LVPA 1Z00B 1SGHA 3J81j 2LYHA 3ZTDA 2R8JA 3UQ2A 1RZTA 3PO4A 1TK0A 3TEWA 3AU5A 3GE8C 2SAKA 3LJ3A 2ZW0A 1F1HA 5KFUA 3QC8B 3HUIA 1ZDXA 4DXGA 5AK6A 1ZQAA 5E6PA 2XVTA 3UMBA 4KLGA 2F44A 2KKPA 2KN7A 1ZQCA 4DWFA 2ACZB 4B9SA 3RNFC 1ZOLA 4Z6FA 4ECZA 4ED6A 4YR3A 1BGXT 2JZBA 4DO9A 2ZVNA 2K89A 1F52A 8ICPA 2GOLA 4XA5A 3QQ8B 2P35A 1QSLA 5DGAA 4F1SA 4KKIA 2WAQF 2KG5A 4QJFB 3C2LA 5KFQA 1NYRA 1ZETA 3A9JA 1M6YA 2ODGA 4WWNA 1NK7A 3U7ZA 3HPOA 4NLNA 2WNMA 4J3OD 2ISOA 3H0MB 3HJEA 1XLNA 2AEHA 3HWTA 4CCHA 2HW3A 4FZMA 1SL0A 1YJ1A 3I76A 3ALRA 3PLVA 3SAFA 1CRXA 5DBBA 5L1MA 2M0AA 4UDUC 1SV4A 1ZQWA 5AKIA 3JPNA 1O08A 1V6EA 3FAHA 2BF8B 3I63C 4WQOB 2LYBA 5CEHA 3TADC 4AQ7A 3BDPA 2IHMA 4NLKA 2M0XA 3PO0A 4YD2A 7ICMA 4IDIA 3PREA 4W9GA 2UYZB 1JQ4A 2CHZA 3PVXA 2K4EA 4PS7A 2PIAA 4UASA 1TS2A 2JYTA
chains in the Genus database with same CATH topology
1VLBA 3TSSA 2QEJC 3KWVA 1TYGB 2J53A 1N62A 1I7HA 2DYMA 1I4GA 4C7YA 5D3DA 1IGCA 3BIID 1VZ6A 4JWSC 5BYRA 3P4SB 4YSXB 1F2RC 4R3DA 5G5HA 1M4VA 1TY2A 1XF5L 3P1MA 1SSNA 2K5PA 1FXAA 1GB1A 1RM6C 3DWMA 1SB3C 2K0PA 1L6VA 4WAFA 5D7GA 4N6EB 2QJLA 3GB1A 2WS3B 1UWMA 4WWMA 1UGJA 3NVYA 1P7EA 1QILA 2XN9C 4L2YA 4N59A 4JPSA 4YSYB 5LNK1 5I4DA 4B0MA 2QSDA 4M0WA 1C9FA 1KLUD 2MJEA 4JWUC 4YTMB 3AEEB 1V97A 3AE7B 1VZ7A 3AEBB 2W55A 3P4PB 2L52A 2LEKA 2ONQA 4GDLB 3NRZA 3MFGA 1Q10A 1DOIA 1KTKA 1SXTA 2GI9A 4ZRQA 3U52E 2AQ2B 4HKQA 1YJIA 2WU5B 3AM9A 4YTNB 2FBWB 2V4IB 1XO3A 1QOBA 1HA5A 2W3RA 3AEFB 3VRAB 1JALA 3FILA 2QMTA 1TKEA 3BWUD 1NVID 1YMHE 1Y56A 1IBXB 2YEPB 3I9V1 1QQRA 3AE6B 1BMLC 2INPE 4H2AA 3O13A 1I4PA 1F0ZA 2RDGA 5H92C 4O1NA 1JWSD 3HVZA 1YN5A 4ARCA 4PT5A 4HKZE 5EE9A 4RF0A 4C56C 1E6EB 3IAS1 1C78A 3BZDB 4RCOA 1XCTL 1BUIC 1XLOA 1FNUA 3BVGA 1PDXA 4RNAA 4OVZA 1DGJA 1JWUD 5HHDG 1L0VB 3AEDB 4KGSA 1MI0A 2CU3A 4CQNA 3Q8AA 1KRHA 3BVZA 1STEA 1MPEA 4A8XC 3N9YC 4TQ0A 2LJIA 2N0SB 3OWEB 1IBXA 4OW0A 3SFEB 2BTEA 4WQMA 4OZCA 1L4ZB 3V3XA 4IOIE 1ROEA 5C2TB 1N60A 1AWDA 4DXFA 4LTUA 1SF0A 2MH7A 2KWDA 4OZAA 5FK9C 1FNWA 3AN1A 2VZKB 1L4DB 3URYA 1AYFA 1C76A 2EKIA 2WDQB 2Y5CA 3VR8B 3BYYB 3RFZB 3E9SA 4IKGA 1E9MA 3UI3A 1C4CA 1L5PA 2LHDA 3BVMA 3T3NA 2D5GA 4B0EA 3SFDB 3U2SC 3NVZA 2ICIA 1WGKA 3HVDA 1IGDA 4OZBA 4L23A 4RGMA 2PKOA 3AEGB 3EUB2 4RGNA 1ZDVA 3H8HA 3ETRA 4OHJA 1NI3A 1OQRA 1FEHA 1MHHE 3L4PA 2CJOA 4RH6A 1DOXA 2CJNA 2EELA 4TQ1A 1CK1A 3MC0B 3Q69A 3NS1A 4XE0A 1I4HA 1QOFA 2HDEA 3SEBA 1SE2A 3AE5B 1B1ZA 1HXYD 3KQ4A 2WLBA 1FCLA 1A70A 1OFFA 2JYEA 4TMAB 2GRIA 1C4AA 1TS5A 1GB4A 1TKYA 2W82A 2H89B 3AECB 4MACA 2AQ3B 2M19A 1FO4A 4MH8A 1SE3A 3RPFC 1ZP0B 1FFVA 4ZHOA 4USAA 4A6QA 2WXQA 3VRBB 5GXGB 1VR9A 4RFBA 3I57A 1MHXA 3AE4B 4L1BA 1SIJA 2DWQA 1FIQA 1JWBD 2BB5A 1I4QA 5EE3A 3ZYYX 1NYQA 3ZJUA 3ZJTA 4US8A 5H8YE 1HQRD 1VDVA 1ESFA 1VJKA 3SR6A 1XLQA 3AB5A 2NTTA 1SEBD 3P4QB 2TSSA 1EM7A 2IPKD 2WXRA 2JWUA 1UNSA 2IDYA 3IXSA 3BK1A 3W9CB 1J7AA 1ACCA 1K51A 2IJ0A 5HI1A 1WRIA 1I4RA 3Q8EA 4YXDB 2MEKA 3NVWA 1E10A 1HZ5A 1DYQA 3PZ8A 4WURA 2V3NA 5AUIA 2AX5A 1YNTE 5FR3A 1E0ZA 1GPXA 5C3JB 3E56A 1K53A 3B9JA 4NJCA 2PVGC 1IUEA 3NVVA 2ZW1A 3P42A 5D3IB 5TSSA 3B2GA 1EWCA 1FFUA 1KF6B 1ZUD2 1XEEA 1T6BX 3DWGC 4A90A 3Q8BA 2RDHA 3T3OA 5BMIA 2PTLA 2M56B 4AS1A 1ZPSA 2BT6A 1SJED 1EU4A 4KX6B 2N9KA 3HRDD 1XCQL 4C7ZA 3AE8B 5HG2A 5AUKA 4ZRPA 1ZXHA 2E3TA 2HTME 3GP7A 2GB1A 1JW9D 1UWXA 1KLGD 1FD6A 3VR9B 2RPVA 3IT4B 1AN8A 2I2YA 5G5GA 1CQVA 1YN3A 1D4BA 3WCQA 4DQOC 3KLSX 2QIEB 2WXNA 1MVKA 2WXOA 3AE1B 1UUPA 2LHEA 3MHZA 1JROA 1FXIA 2L83A 3LXFA 4GLSC 1L0XB 2WDRB 2IGGA 2G9HD 3FILB 2MJ3A 4MT5A 2N9LA 2R61A 3BK2A 4EE2A 3TEZA 1QKZA 1NENB 1QLBB 5E6JA 1R7SA 2N7JA 2PVOD 1YN4A 4HEA1 2V0GA 1C4PA 2WXLA 5EE0A 4NZLB 3AMZA 4A9AA 2FUG1 3W1SA 4D2KA 3AEAB 4JX1C 1TY0A 4Q2JA 1AW7A 1TKGA 1D6EC 2BBCA 2JXTA 4KGTA 1FRDA 2WXJA 1JRPA 1WYGA 4ZOHC 4P6VF 1NEKB 1N5XA 1N61A 1KFYB 1JMLA 4WIPA 4HJGE 1YQ3B 2G1EA 1EWYC 2W3SA 3P63A 4GDKB 1BXTA 1TS4A 3MJ5A 4LK0M 4ZYSA 3TEYA 1WXQA 4KGRA 2YEPF 4HROA 3PZ7A 3R2IA 2KACA 1GOZA 1WSPA 1QOGA 3P4RB 4US9A 2J52A 5BYSA 1T5XD 3TEXA 1PGAA 1LO5D 4YSZB 1CZPA 1XXGA 1ZOYB 1PUTA 5FKAC 1ZE3D 1YQ4B 3Q8FA 1F2RI 2PW9A 2B76B 2BS3B 2E6XA 4YTPB 3U4EG 2WXKA 1D5XC 1K52A 1TS3A 1TJEA 1FM0D 2LGIA 3LYYA 2KAJA 1V8CA 1QT9A 1QOAA 3R2TA 3W5UB 3AE9B 2Z8LA 1VRAB 1OQQA 2J4XA 5BMGA 2J42A 2KDMA 3AH7A 4FXCA 1V1OA 2LUMA 2DLBA 1SJHD 3GS2A 5BMHA 2BS4B 2DYOA 2SEBD 1RYJA 2MJDA 1FRRA 1KH0A 3ZJVA 2IGHA 4LLGM 4YT0B 1PYWD 3LB8C 2VZKD 2KN4A 3R8BA 1ZXIA 1K50A 1JWAD 2JSVX 2Q5WD 2JZPA 1FMAD 2PMVA 2K3UA 2WXMA 1PGXA 2WXPA 3NZ3A 2WP9B 1F77A 3BYTB 3ZQ4A 2L1AA 5T8IA 2Y5PA 2NTSA 3ABVB 1D5MC 1PGBA 2FE8A 2XNAC 3W2DA 3EGRA 2I38A 3IT6B 1RWSA 1YJJA 2WXHA 1L0YB 1TZOA 1JWMD 2K9XA 3AE3B 3CIRB 3EA6A 4KKJA 4NAMA 3V05A 1V1PB 1VZ8A 3C8YA 2H88B 4RF1A 4XDDA 5BYQA 2WXGA 3Q8CA 2JU6X 2BYTA 1WWTA 3W5VB 4ITKA 5HFYA 4YWGG 2V3PA 2JQRB 2WXFA 2IGDA 4WH4A 5JXVA 2WDVB 2BS2B 1J7BA 1HEZE 2BW2A 1DOYA 2KQ4X 4ZHPA 3KWLA 1J7CA 3CWIA 1CJEA 1T3QA 2W54A 2BB6A 4C80A 1SBBB 3VQIA 4A55A 4MM3B 1RFKA 1P7FA 3B2FA 1PFDA 2KMMA 3TEWA 5EE1A 5MPOA 3AV8A 2SAKA 2ZW0A 3IAM1 1GAQB 3MP9A 4P16A 4TSSA 3HUIA 1ZDXA 4DXGA 1ENFA 2K22A 2OEDA 2OHFA 1V1PA 2ACZB 4N58A 4NAWB 1SE4A 2PLPA 1L6UA 4REZA 1I4XA 1XLPA 2LMCA 1JCKB 1EU3A 3TUOA 4XWWA 1QF6A 1B9RA 2NMQA 2LFIA 4KKIA 3FC4A 3J9CA 1NYRA 3U7ZA 2WNMA 2L32A 4HRSA 1N5WA 2QILA 2AQ1B 4J3OD 1XLNA 4JE3B 1FNVA 2INNE 3NUHB 2JX5A 1ET6A 2M0AA 4UDUC 1E7PB 2WXIA 1HZ6A 2X38A 2RMMA 4RGTA 2DBYA 1C79A 4ARIA 3FAHA 2ON8A 4RGOS 1D5ZC 1FCCC 4AQ7A 2WQYB 2Y3AA 3PO0A 4IDIA 1N63A 2WU2B 4XDCA 3ZGZA 4XWTA 1JQ4A 3AE2B 1ET9A 2PIAA 1C77A 1TS2A 2JYTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VLB A;  4ZHO A;  2E3T A;  2HTM E;  1TYG B;  1JW9 D;  1ZXI A;  1N62 A;  3AN1 A;  1I7H A;  3VR9 B;  1JWA D;  4C7Y A;  2Q5W D;  1AYF A;  3BII D;  5G5G A;  2EKI A;  2WDQ B;  2Y5C A;  3WCQ A;  4JWS C;  1FMA D;  3VR8 B;  2QIE B;  3P4S B;  4YSX B;  3AE1 B;  5G5H A;  1E9M A;  1L5P A;  3VRA B;  2WP9 B;  3P1M A;  2K5P A;  1FXA A;  3SFD B;  3NVZ A;  1JRO A;  1FXI A;  1WGK A;  2L83 A;  3LXF A;  3ABV B;  2WDR B;  1RM6 C;  2PKO A;  3AEG B;  3EUB 2;  1SB3 C;  3DWM A;  1L6V A;  2MJ3 A;  3ETR A;  4N6E B;  1NEN B;  1QLB B;  1NI3 A;  1R7S A;  1RWS A;  1OQR A;  1YJJ A;  1UWM A;  2K9X A;  2PVO D;  2WS3 B;  3L4P A;  2CJO A;  3AE3 B;  3LB8 C;  3NVY A;  2CJN A;  4WWM A;  4YSY B;  1DOX A;  4N59 A;  3VRB B;  2H88 B;  3NS1 A;  1WWT A;  3W5V B;  2MJE A;  4ITK A;  4JWU C;  5EE0 A;  1QOF A;  4YTM B;  3AMZ A;  2JQR B;  3AEE B;  1V97 A;  4A9A A;  3AE5 B;  2WDV B;  3AE7 B;  2BS2 B;  1J7B A;  3AEB B;  2W55 A;  1DOY A;  3AEA B;  2L52 A;  2WLB A;  3P4P B;  2LEK A;  4JX1 C;  4ZHP A;  1A70 A;  1OFF A;  1TKG A;  3KWL A;  3NRZ A;  1J7C A;  3CWI A;  1DOI A;  1CJE A;  1T3Q A;  2W54 A;  1TKY A;  1YJI A;  2H89 B;  2WU5 B;  4C80 A;  3AEC B;  3AM9 A;  4YTN B;  2M19 A;  2FBW B;  1FO4 A;  1XO3 A;  2QJL A;  1QOB A;  1FRD A;  1FFV A;  1JRP A;  1ZP0 B;  4USA A;  1WYG A;  2W3R A;  4ZOH C;  1RFK A;  1NEK B;  3AEF B;  1JAL A;  1PFD A;  2KMM A;  3B2F A;  4P6V F;  1N5X A;  5EE1 A;  1N61 A;  1TKE A;  5GXG B;  1NVI D;  5MPO A;  1KFY B;  3AV8 A;  3AE4 B;  1YQ3 B;  1GAQ B;  2G1E A;  1SIJ A;  1EWY C;  2DWQ A;  3HUI A;  1JWB D;  1FIQ A;  3RPF C;  2W3S A;  3P63 A;  2K22 A;  5EE3 A;  3ZYY X;  1NYQ A;  2OHF A;  3AE6 B;  2ACZ B;  4N58 A;  4US8 A;  1WXQ A;  5H8Y E;  1VDV A;  4HRO A;  1L6U A;  1VJK A;  1XLP A;  3SR6 A;  1XLQ A;  3AB5 A;  3P4Q B;  1F0Z A;  5H92 C;  3HVZ A;  1QF6 A;  1B9R A;  1QOG A;  3P4R B;  4US9 A;  3W9C B;  5EE9 A;  1CZP A;  1ZOY B;  4YSZ B;  1PUT A;  1J7A A;  3FC4 A;  1YQ4 B;  1WRI A;  4YXD B;  1E6E B;  3NVW A;  2B76 B;  1NYR A;  2BS3 B;  1E10 A;  4YTP B;  4HRS A;  1GPX A;  1N5W A;  1TJE A;  1XLO A;  2AX5 A;  5AUI A;  1E0Z A;  1FM0 D;  5C3J B;  1PDX A;  1XLN A;  3B9J A;  1DGJ A;  2KAJ A;  1IUE A;  3NVV A;  1QT9 A;  1L0V B;  1QOA A;  1V8C A;  2PVG C;  3AE9 B;  3CIR B;  3B2G A;  3W5U B;  2JX5 A;  3AED B;  1FFU A;  1KF6 B;  2CU3 A;  1OQQ A;  1ZUD 2;  1E7P B;  1KRH A;  2DBY A;  3AH7 A;  4FXC A;  3DWG C;  3FAH A;  2N0S B;  3SFE B;  2M56 B;  4WQM A;  2WQY B;  3PO0 A;  2BT6 A;  4IDI A;  1N63 A;  2BS4 B;  4KX6 B;  3HRD D;  2WU2 B;  1ROE A;  1RYJ A;  1JQ4 A;  4C7Z A;  5C2T B;  2MJD A;  1FRR A;  3AE2 B;  3AE8 B;  1N60 A;  1AWD A;  2PIA A;  4LTU A;  4YT0 B;  1SF0 A;  2MH7 A;  5AUK A; 
#chains in the Genus database with same CATH topology
 4KLI A;  1KBU A;  4EEK A;  4II2 B;  5D6J B;  3F2C A;  2J53 A;  1LM8 B;  2NR2 A;  3BII D;  5KG7 A;  2KX0 A;  4UB2 A;  1XNS A;  4I29 A;  1F2R C;  2M4N A;  3LWL A;  1M4V A;  1UHU A;  3MR5 A;  4HCP B;  4JB3 A;  3PST A;  5JU5 A;  2KFJ A;  1KLV A;  1Q5W B;  3EPI A;  4KLF A;  1E8W A;  2LI5 A;  1RM6 C;  1WE7 A;  4K3C A;  2WB1 C;  1L6V A;  4I2H A;  1B0X A;  3GFK B;  3JVZ X;  2QJL A;  2F1H A;  1DK2 A;  2P6U A;  3PHW B;  4WWM A;  4RQ4 A;  1I35 A;  1UGJ A;  3NVY A;  2UVV A;  1P7E A;  5KFJ A;  3CP8 A;  2HOF A;  2WFA A;  3PW7 A;  2K60 A;  5KFT A;  1SKR A;  4L2Y A;  4N59 A;  5D94 A;  3WAP A;  1B22 A;  2ZTD A;  1NK6 A;  1YX6 B;  4WJN A;  5E79 U;  3UMC A;  4P0P B;  4CHK A;  3GIM A;  2O6V D;  4BAX A;  1G6J A;  3RB6 A;  2W55 A;  5AI6 A;  1ZD4 A;  4IQV A;  3GIL A;  4RNN A;  3F5A A;  1WMH A;  4UBB A;  3AU6 A;  1P0R A;  1N6Z A;  1X9S A;  3RBD A;  2FBW B;  2V4I B;  4NM1 A;  1XO3 A;  1QOB A;  2LKY A;  2W3R A;  1LKY B;  3VRA B;  3T9L A;  3FIL A;  4NY0 A;  3BWU D;  3NOB A;  1D8B A;  1NVI D;  1YMH E;  1Y56 A;  2D3C A;  4WWP A;  2YEP B;  2O6V B;  2XID A;  4BKG A;  3M95 A;  4F91 B;  3PX4 A;  3DHI C;  5J2E A;  1L8L A;  2DL0 A;  1ZQT A;  3CNH A;  3C0R B;  4FZN A;  2NPT A;  2JXJ A;  1LGR A;  2D11 A;  3TAP A;  4R65 A;  2GBK A;  1TGZ B;  4MEL A;  2HHT A;  1JWS D;  4YMN A;  4OJL A;  3QNM A;  1KW4 A;  4ARC A;  3CF6 E;  2R8I A;  3VFK A;  2D3D A;  1OQY A;  1V9P A;  8ICJ A;  3V72 A;  2W11 A;  4IRC A;  2KKC A;  4JK1 A;  1C78 A;  3BZD B;  4NNJ B;  4YD1 A;  1BUI C;  1XLO A;  5AI5 A;  3BVG A;  2G4D B;  5HHD G;  2MA1 A;  4RT3 A;  1X2I A;  2BQ3 A;  2M17 A;  1LQB A;  1PVP A;  4KGS A;  2CU3 A;  4JV1 A;  2JWZ A;  2RDB C;  3TIX A;  5JHA A;  3A9K B;  3ZIM A;  5J0Y A;  4PPX A;  4LNO A;  5CX3 A;  2GMI C;  2AQ4 A;  2IZV B;  2LJI A;  1IBX A;  2D3B A;  1MG8 A;  1MQ2 A;  4KLL A;  3TAR A;  3V3X A;  4AP9 A;  3PO5 A;  2WF9 A;  5HMM A;  5KFG A;  2N7E A;  3EW9 A;  3TAQ A;  4DXF A;  1SF0 A;  4OZA A;  1PK1 B;  3RNG C;  8ICK A;  2MBO A;  1FNW A;  3AQF A;  3AN1 A;  1JI7 A;  3W1Y A;  2EKI A;  5L95 C;  7ICK A;  2KDE B;  3RFZ B;  4QNL A;  3E9S A;  1E9M A;  1C4C A;  4FLH A;  4RQ0 A;  2JR5 A;  2ICI A;  4RGN A;  4QIW C;  3VCB A;  2PEA A;  4TV3 A;  4OHJ A;  3KHL A;  4I2A A;  1NI3 A;  1OQR A;  4XX5 A;  1JXL A;  4F8C B;  1MSW D;  3N4M B;  4QZ9 A;  5KFD A;  2CJN A;  2EEL A;  4IQW A;  4QW9 A;  1KN5 A;  5BPC A;  4XE0 A;  1XC9 A;  3SEI A;  5AK4 A;  1I4H A;  2HDE A;  5ALT A;  2VAN A;  4ICA A;  1SE2 A;  2UU7 A;  4X5V A;  3RJE A;  1Q3U A;  8ICV A;  2REX A;  3SEB A;  1HXY D;  2KYW A;  2JH7 A;  3K1R B;  4BKT A;  2FMQ A;  3VH3 B;  2MSN A;  2GRI A;  1NKB A;  1TS5 A;  4DF4 A;  1GB4 A;  2WF7 A;  4O0I A;  3QEB Z;  2VIX A;  3FDS A;  4M2Y A;  2BWF A;  4P7I A;  2MBQ A;  1FFV A;  1ZP0 B;  4A8E A;  4A6Q A;  3KKA A;  2WXQ A;  1DRG A;  1WMH B;  2FMP A;  9ICW A;  3VRB B;  4KDI C;  4RFB A;  3I57 A;  2D3A A;  1MHX A;  1KJT A;  2JVC A;  7ICE A;  1XT9 B;  4P4O A;  1FIQ A;  5J0Q A;  1JWB D;  3K9P B;  3M3J A;  5LXI B;  1V2Y A;  2DUY A;  1WJ4 A;  1I4Q A;  3ZYY X;  2R8H A;  4M01 A;  3ZJT A;  4KN4 A;  4JUZ A;  4RPY A;  1EXN A;  2K8A A;  7ICJ A;  2KLC A;  2ZJD A;  3TL5 A;  3P4Q B;  1K1Q A;  2WF8 A;  4J9L A;  2TSS A;  4RNO A;  1EM7 A;  3L17 A;  4B95 A;  2YVC A;  5C5J A;  4OJO A;  2FCQ A;  2JWU A;  3RNA C;  5CTR C;  3BK1 A;  3DEE A;  3RH5 A;  1X1M A;  3BS5 B;  1J7A A;  1YOV B;  2IJ0 A;  1K51 A;  4I6L B;  5HI1 A;  5J8Y C;  1WRI A;  4DBG A;  2MEK A;  2ZIU A;  3RYT A;  3NUQ A;  4O5K A;  5ALJ A;  3RNE C;  8ICL A;  4UQG A;  3WAL A;  4F5P A;  2HBL A;  3IDW A;  4WUR A;  5D2M B;  5KG0 A;  3QU4 A;  1E0Z A;  5C3J B;  3U26 A;  3B9J A;  1K53 A;  2CPR A;  4MHV A;  3RJF A;  2MUT B;  1YZ6 A;  4J03 A;  3B2G A;  8ICW A;  4GDK A;  8ICC A;  1ZUD 2;  2NBW B;  4G3X B;  4B9L A;  4EZL A;  2AGP A;  1YX5 B;  4R63 A;  4EBE A;  1ZQP A;  4I2D A;  5CWR A;  4B9M A;  4NL9 C;  5KFX A;  4B9T A;  5DG9 A;  2D2Q A;  5J0T A;  4KLE A;  1DK3 A;  4KX6 B;  4C8K A;  2N9K A;  5AKL A;  1VJ5 A;  2PJH A;  2D3G A;  4C7Z A;  3RUI B;  3T79 A;  3FYH A;  4HJK A;  4NAW A;  2KJ6 A;  7ICU A;  5HG2 A;  5KG2 A;  3V7J A;  1R4M B;  1PVR A;  3L54 A;  3GZN I;  4PYU A;  2NRX A;  2NBV B;  4ZRP A;  3ZDM C;  1WM3 A;  5AEK B;  3GP7 A;  2KVZ A;  2GB1 A;  4MJS B;  3IG8 A;  3TQ1 A;  7ICR A;  2I2Y A;  3F2D A;  5G5G A;  4DQO C;  2DEN B;  3AE1 B;  2ZZP B;  5KFI A;  5J2K A;  4GXJ A;  4W9J A;  2HBK A;  2L83 A;  1FXI A;  2KJ8 A;  2AQ0 A;  4IRD A;  2IGG A;  4LZD A;  4LJX A;  2R61 A;  1NEN B;  2IMW P;  2DZI A;  4R8U A;  3M1Y A;  2ASQ A;  2DFL A;  1RYS A;  1ZQD A;  5IAA C;  2V0G A;  2LHT A;  2UWQ A;  5AZF A;  2NRT A;  2WXL A;  2E8P A;  2LUE A;  2PE9 A;  3M7D A;  4GOC A;  3ZD8 A;  3R66 C;  1EUV B;  1UH6 A;  3ZDC A;  4PS3 A;  3AEA B;  4JX1 C;  1A0P A;  4ANW A;  1TV9 A;  1AW7 A;  2ZG6 A;  4IR9 A;  1D6E C;  2A19 A;  4QZD A;  4J9K A;  3X23 A;  2XGP A;  4P4M A;  3SAG A;  1IM4 A;  1ZQR A;  4KGT A;  2D07 B;  8ICY A;  4ZOH C;  5E6N A;  4P6V F;  3ZDE A;  3HIZ A;  5ALR A;  3ZVV A;  1QQ5 A;  2KFN A;  1KFY B;  3DVG Y;  3H7P A;  3RH6 A;  2VA8 A;  4RQ3 A;  8ICE A;  4GSW A;  3RJJ A;  5KFY A;  2HDO A;  4HJG E;  4JWN A;  1ED1 A;  5IN7 A;  1KFS A;  1J2M A;  3DBL B;  3NY5 A;  2MP2 A;  1XO1 A;  4GC6 A;  4QZI A;  2IBI B;  2JZ3 B;  3MJ5 A;  1B43 A;  4ACO A;  4UAU A;  1VD2 A;  2KSO A;  2YEP F;  4MFF A;  1TKD A;  1X9W A;  3ONN A;  2JEJ A;  5CRX A;  4UBC A;  4W9K A;  3E58 A;  1QOG A;  4PH5 A;  4YSZ B;  3M9N B;  1XXG A;  1WH3 A;  1ZE3 D;  1NJZ A;  1F2R I;  3MGH A;  2FPM A;  2Q0Z X;  8ICT A;  2DNF A;  5AKK A;  5CB1 A;  3MR2 A;  1D5X C;  3W1S C;  1E7U A;  9ICR A;  4YMO A;  9ICF A;  5HR6 A;  2NVU I;  1QOA A;  2C7N B;  5KFW A;  1BPZ A;  5AHX A;  4KLO A;  3CYM A;  3TKA A;  3GV7 B;  2IOH A;  2Z8L A;  3N1Z C;  3ZNI D;  2BWE S;  5JRT A;  4LDT D;  1X9X A;  4EKU A;  3VVW B;  3ZD9 A;  4CRX A;  1V1O A;  1ZD3 A;  2QHO A;  4F50 A;  1WXV A;  2KJ9 A;  4KLT A;  1E8X A;  2JF5 A;  3CST A;  3BY4 B;  2QCZ A;  1KH0 A;  3VXW A;  3ZDB A;  3DBR B;  4YT0 B;  8ICB A;  2KAN A;  4RQM A;  5J2H A;  2K8C B;  1KSP A;  1ZXI A;  1K50 A;  2R8K A;  3MGI A;  3H6N A;  2PMV A;  2JEI A;  2PFQ A;  2WXM A;  4KVG B;  5ALL A;  1F77 A;  2KHV A;  1B4F A;  4DHJ B;  2L1A A;  4ECW A;  2Y5P A;  2NTS A;  2LYA A;  1IV8 A;  2XNA C;  1KFD A;  8ICG A;  4KSK C;  2WTF A;  2KP7 A;  1L0Y B;  3AE3 B;  4FS1 A;  4NAM A;  3PR5 B;  1V1P B;  3C8Y A;  4RF1 A;  4NXZ A;  3H0L B;  3C2K A;  7ICF A;  2WXG A;  3Q8C A;  2BYT A;  3QJZ A;  1S10 A;  2K1F A;  3PRP B;  4XRH A;  5C0Y A;  9ICT A;  4YWG G;  1SV0 A;  1TK5 A;  5ALQ A;  1S76 D;  3AU2 A;  1ZGU B;  2MRP A;  4NLZ A;  4M0A A;  4CF3 A;  5HNK A;  2K8H A;  2WDV B;  1DOY A;  1O03 A;  3PV1 A;  1HTQ A;  4FJZ A;  3OJU A;  9ICM A;  1J7C A;  1RRB A;  4GMV A;  4GB9 A;  5KT3 A;  4RU9 A;  3SD5 A;  3KBB A;  2BDU A;  2FID A;  3EFU A;  2BB6 A;  4Y2Y A;  2C2R A;  8ICH A;  1RFK A;  4J9M A;  2LGY A;  3EZ5 A;  1PFD A;  2KMM A;  4OJ6 A;  1ISN A;  2RP5 A;  5EE1 A;  5J2R A;  4Y2P A;  3HM3 A;  2PFP A;  4M9G A;  5MPO A;  5AK5 A;  4EYH B;  4DL3 A;  4DFK A;  1Y88 A;  5ALZ A;  1GAQ B;  4KIK A;  3EWA A;  4P16 A;  4TSS A;  4QZ8 A;  8ICI A;  2KTQ A;  1BVS A;  4B9K A;  2K22 A;  5KFP A;  2HMX A;  2OHF A;  2KN5 A;  1WWV A;  3QA8 A;  2CKH B;  4ECR A;  3NS8 A;  4NAW B;  1SZH A;  4O5C A;  1WRD B;  1UT5 A;  2V3S A;  2PLP A;  3JSV A;  3M9O B;  1I4X A;  2DZK A;  1NK4 A;  2LMC A;  1Q3V A;  1EU3 A;  2VJ5 A;  4B6J A;  3V60 A;  4O3O A;  2I9G A;  3TFR A;  4XWW A;  1QF6 A;  1B9R A;  1HIW A;  3R3M A;  4I2F A;  2NMQ A;  3MR3 A;  3O0F A;  4NQL B;  5JZE B;  4TUR A;  4OD0 A;  3CMM B;  5DPT A;  3VC8 A;  3PRM B;  7ICO A;  2ZEQ A;  2L32 A;  3BIN A;  3NG0 A;  1N5W A;  2W9C B;  9ICJ A;  2KIC A;  1V86 A;  2IND C;  3N30 A;  4JE3 B;  1GC7 A;  5E6O A;  4FA6 A;  4Y2X A;  3TMP B;  4QWD A;  3EC8 A;  3NUH B;  4DL2 A;  2HVI A;  2L00 B;  2KDF B;  4M9H A;  1OXJ A;  1U47 A;  1HZ6 A;  2OXO A;  2KMC A;  3P2B A;  4DF8 A;  2G5H B;  3WKE A;  1NK0 A;  1C79 A;  1F9J A;  2KC2 A;  3GZN B;  2VJ4 A;  3KUC B;  5KG1 A;  2HI0 A;  4LCD E;  1X6I A;  2QKQ A;  2F3N A;  4ARI A;  4ED2 A;  4UAV A;  2NV3 A;  4DL5 A;  1FCC C;  2G07 A;  5ALX A;  5DCN A;  5KAF U;  4RQ8 A;  1WXS A;  4YR0 A;  3PLU A;  4Q45 A;  4XDC A;  4Z6E A;  4XWT A;  2Z59 B;  1JRU A;  3N7R C;  3Q3O C;  3DV9 A;  4I2J A;  2ZJ8 A;  4MSQ B;  5AKY A;  1WY8 A;  1UQV A;  2KHQ A;  2QEJ C;  2ZIV A;  4DLG A;  2ZXH A;  1ARO P;  2DYM A;  1I4G A;  2KHW B;  4UAT A;  1VZ6 A;  2G09 A;  3KKA C;  4YSX B;  4R3D A;  4C0Z A;  1TY2 A;  4AYB C;  3P1M A;  4BGD A;  1AQ6 A;  2K5P A;  4RT2 A;  1TAU A;  2Z0E B;  2XK5 A;  2J0J A;  3C5G A;  4ZYN A;  5D7G A;  3N97 B;  2GOW A;  4BWJ A;  2W8L A;  5ALH A;  5III A;  4IG7 B;  2LM1 A;  5H2F U;  3UXP A;  3MC9 A;  4Q8E A;  4W9H A;  3MHS D;  4YSY B;  4ANU A;  2KK0 A;  3BQ0 A;  4G0N B;  3RB3 A;  2AH5 A;  3KHH A;  2W9N A;  4FBJ B;  4DFM A;  5AK3 A;  3AEE B;  3AEB B;  4R64 A;  3P4P B;  3SV3 A;  2YML A;  3Q3J A;  3LDA A;  4GDL B;  5J29 A;  4M00 A;  1KTK A;  1ZQJ A;  4F4X A;  3TAD A;  2ZTE A;  2D8C A;  3AM9 A;  4YTN B;  3VTW A;  5C23 A;  5K4L A;  3HIL A;  1WFY A;  4DSF A;  2CHW A;  1S97 A;  4KTQ A;  2XK5 B;  4DDI D;  3ORY A;  3JW0 X;  5F9L A;  4GLX A;  1N2X A;  2DGZ A;  5J2A A;  3IP4 B;  2KOX A;  4MGZ E;  3Q8L A;  4PGY A;  2H3Z A;  3I9V 1;  1QQR A;  3VHT C;  5L1K A;  2K4H A;  5J2J A;  1C7Y A;  1BML C;  5BO4 B;  3PML A;  4DOB A;  3QUB A;  4YG2 A;  1F44 A;  2IO0 B;  4K1R B;  3O13 A;  2ASJ A;  1F0Z A;  5JTI A;  3V6J A;  2RDG A;  4BX9 C;  3DBR I;  2WDT B;  3SMV A;  2WHE A;  2MSE D;  1ZQY A;  5AM4 A;  3ICX A;  4PT5 A;  4HKZ E;  3E2E A;  5EE9 A;  2GH1 A;  2WB1 F;  3S6J A;  2MLB A;  5EWG A;  2XO7 A;  4C56 C;  4W9F A;  3IAS 1;  4KIT B;  1OEY J;  2WF6 A;  1EO6 A;  3SDL C;  1XCT L;  5DB8 A;  1FNU A;  5KFB A;  4EZ9 A;  2AYO B;  3PTF C;  4RNA A;  9ICP A;  3QE9 Y;  4YMM A;  4K7U A;  4NJ7 A;  1CI4 A;  2J6U A;  4A3P A;  2LRU A;  5FR6 A;  1LV5 A;  2BVC A;  2L3Z A;  4DFD A;  4TQ0 A;  8ICX A;  2RR9 A;  5LXH A;  2ZIU B;  2N7D A;  4OW0 A;  1NJX A;  4DLE A;  2YMQ A;  1NK9 A;  4WQM A;  2BTE A;  3WK4 A;  3TCA A;  9ICU A;  2C7H A;  5AI9 A;  5J2C A;  1KFT A;  1L3T A;  4ECT A;  2XI9 A;  1SKS A;  1ZQB A;  4MF2 A;  3MDA A;  4HYK A;  2KWD A;  2AL3 A;  2F8K A;  2KOB A;  3H8W A;  3B0A A;  3RZF A;  3A0H U;  3H8S A;  3K1Z A;  3KUD B;  3BS7 A;  4TUU A;  2W04 A;  3PGE A;  2A1J B;  4UW9 A;  2EAO A;  2BCR A;  1COO A;  4F4W A;  3TAC B;  2PI5 A;  3BVM A;  1ZQV A;  2D5G A;  3HVD A;  2PMZ F;  1WGK A;  3VUW A;  4L23 A;  3AEG B;  3UM9 A;  5J2B A;  3KUZ A;  1FEZ A;  4DXA B;  3BQ2 A;  2K4I A;  4C4V B;  3WK9 A;  1DOX A;  5AM5 A;  1CK1 A;  3MC0 B;  1XQQ A;  2KZ3 A;  3Q8S B;  3ML8 A;  5ALD A;  3RF9 A;  2ZIX B;  2V4L A;  3R9K A;  3IN5 A;  3KOO A;  1P1A A;  4GXB A;  3WU2 U;  3KQ4 A;  2IOF K;  1A70 A;  4JLC A;  2HHX A;  3JPO A;  3AXC A;  3I3T B;  1TKY A;  1WX8 A;  2H89 B;  2PE6 B;  1TBE A;  3QWZ B;  1HEK A;  1FO4 A;  1BNO A;  4MH8 A;  3HKZ C;  2KIW A;  2ZNV C;  4UB5 A;  3D2N A;  4ECX A;  5CHG A;  4YP3 A;  4O3R A;  2HHU A;  4NQK E;  1NNL A;  3TI0 A;  3IHP C;  4FE3 A;  1R4N B;  3QXG A;  5L83 A;  1KTQ A;  3D2S A;  3OJ3 A;  5ALE A;  1WIA A;  2BB5 A;  4QWB A;  3RN9 C;  5KHO A;  3LVV A;  2KK8 A;  4US8 A;  1S3S G;  1HQR D;  4YFK A;  2YB4 A;  1XLQ A;  4IM3 A;  4K4H A;  3L16 A;  2IPK D;  2NO4 A;  1T7P A;  1QSY A;  4LNK A;  1KLN A;  2G45 B;  3QU7 A;  2M8S A;  1BPB A;  4RPZ A;  4A3O A;  5AKE A;  2PFO A;  2A1A A;  3B08 A;  5AZH A;  4EOY A;  4YXD B;  3NVW A;  2Z0D B;  2YX8 A;  7ICN A;  9ICK A;  3PZ8 A;  2V3N A;  5AUI A;  2AX5 A;  1GPX A;  2LM4 A;  4ZRK A;  3GII A;  1DXS A;  2JV3 A;  2IO2 B;  2HOQ A;  2NS5 A;  4Y2V A;  1K5O A;  5D3I B;  3KVF B;  1EWC A;  3JPT A;  3L5K A;  5KFE A;  1KF6 B;  2NCN A;  4P2H A;  1KM7 A;  2W8K A;  1R4N I;  1ZKH A;  3IG5 A;  3QU9 A;  4P0P A;  2Y5B B;  3QCA A;  4O3S A;  1ZQ1 C;  3H8J A;  3DWG C;  3Q8B A;  4A90 A;  3THV A;  5J2F A;  4ANX A;  4I6N B;  5DG8 A;  5BMI A;  2PTL A;  3H0R B;  4DK5 A;  5KNI A;  2KO3 A;  2JZB B;  1SJE D;  1EU4 A;  4K7W A;  2EAN A;  3AE8 B;  3PR4 A;  2JZZ A;  2MBE A;  4IC7 B;  4F5R A;  4JGH B;  3MC1 A;  1ZXH A;  3ISC A;  4P1C C;  4PL1 A;  1KLG D;  3KZX A;  4QAY A;  3IT4 B;  4RM9 A;  4LZG A;  3RTV A;  2JRI B;  1D4B A;  3OSN A;  1MVK A;  4KN7 A;  4G11 A;  2CS4 A;  4EYI B;  2BDP A;  1IIP A;  4MSM B;  3JPS A;  5DB9 A;  1Z00 A;  1MC8 A;  1N56 A;  1MQ3 A;  3BQT A;  1BT0 A;  3U8Z A;  3LXF A;  7ICV A;  4BBN C;  3FIL B;  5KFC A;  2N9L A;  5KT7 A;  4EE2 A;  3TEZ A;  4M04 A;  1QLB B;  5E6J A;  1R7S A;  1ZQN A;  2PVO D;  1YN4 A;  4HEA 1;  2BKE A;  1NI2 A;  3RAX A;  1C4P A;  4DCC A;  4TQR A;  5EE0 A;  2DF4 B;  4NZL B;  2KFK A;  3C5F A;  2FUG 1;  3A9J B;  1ZQI A;  4DSK A;  4D2K A;  2E1F A;  4Q2J A;  5IIJ A;  4Y2J A;  1GC6 A;  4ZDV A;  4FJY A;  1WCL A;  4C8N A;  4NV0 A;  2EMS A;  2VA2 A;  2P6R A;  3PNC A;  3Q8P B;  4NY8 A;  4ZRI A;  2BBC A;  1BPD A;  2JXT A;  4W9L A;  3DVN V;  1GG3 A;  1FRD A;  2WXJ A;  1JRP A;  3ZKJ C;  1SWW A;  1WYG A;  1XD3 B;  1SL1 A;  1N5X A;  4FHJ A;  1N61 A;  5J0R A;  5DB6 A;  2IY1 B;  1JML A;  5KFZ A;  1Z4O A;  2KSO B;  2QC8 A;  1YQ3 B;  2G1E A;  2ZUC A;  1L3V A;  1EWY C;  3NRW A;  2W3S A;  4DFJ A;  2N9X A;  2ZJ5 A;  4CDG A;  1D9F A;  1GNU A;  2WX1 A;  4K4I A;  4W9D A;  1WXQ A;  2ZVO A;  2RRD A;  5ALU A;  5DBC A;  3I1Y A;  3IM1 A;  1VCB A;  3PZ7 A;  1V85 A;  4HAI A;  2H3I A;  1BPX A;  2BCQ A;  2L05 A;  4YVZ A;  3P4R B;  2J52 A;  3TEX A;  3DCG A;  3N3K B;  5FKA C;  2O6K A;  1U49 A;  3RCZ A;  2EZY A;  4AUQ C;  3PW2 A;  1OUQ A;  3IV6 A;  2PW9 A;  2DPJ A;  2W7P A;  4YTP B;  4ED3 A;  4PL2 A;  4ED1 A;  1J19 A;  2MWS B;  1WGD A;  1DOQ A;  3R7R A;  1KEJ A;  3T5L A;  3AL0 B;  2LGI A;  1ZQX A;  1WJU A;  5ALM A;  4E71 A;  1Z2M A;  3W5U B;  2FLP A;  5EDS A;  3RNC C;  4O3P A;  1VRA B;  1OQQ A;  5F9N A;  4JV0 A;  2LVQ A;  2J4X A;  1WM2 A;  3LDZ E;  2UVU A;  4OJP A;  2FIF A;  4FXC A;  4IWO A;  3U30 A;  3ECI A;  1SJH D;  3UQA A;  4LNN A;  3WK5 A;  2KDB A;  4KX3 A;  2K39 A;  3PHX B;  5DLF A;  4O5E A;  1XSP A;  7ICL A;  3AEV A;  3M9M B;  4G9B A;  4YN4 A;  3PMN A;  2IGH A;  2F1J A;  5L1J A;  2WX0 A;  1PYW D;  3LB8 C;  2KN4 A;  3N1Y C;  3N7P D;  4GC7 A;  4PHA A;  4P0Q B;  4NJ6 A;  2E8O A;  1HE8 A;  3QIJ A;  3RD2 A;  3DHH C;  1ZW7 A;  1S0N A;  3DPD A;  2R18 A;  5J2G A;  5KHQ A;  2K3U A;  2C28 A;  1T0Y A;  3OG5 A;  2NYV A;  5BOM A;  2RGF A;  8ICS A;  5T8I A;  2BKR B;  3ABV B;  1D5M C;  2C7M B;  3I28 A;  2F8L A;  2JT4 B;  3W2D A;  2I38 A;  1WXM A;  3GIJ A;  2FLN A;  2L8J A;  1RXV A;  1YJJ A;  3EA6 A;  2K9X A;  3H9D A;  2ASL A;  5J18 A;  2H88 B;  1QTM A;  4XDD A;  1E7V A;  5IIO A;  3ZTC A;  2JU6 X;  2FAZ A;  2LPE A;  1ZQL A;  3PW0 A;  4F5O A;  2BHN A;  2N1V A;  2IGD A;  1URJ A;  3OTQ A;  4IR1 A;  4WH4 A;  2H3Q A;  4UAZ A;  1HEZ E;  1LVH A;  2Y9U A;  3CWI A;  2W9A A;  1RLF A;  2LGD A;  4IWP A;  9ICE A;  3HKZ F;  5KFR A;  2FJ6 A;  2INC C;  5KTQ A;  3BS5 A;  1MFW A;  1P9D U;  4GU2 A;  1UF0 A;  4OO1 J;  4ECQ A;  3VQI A;  4A55 A;  4RQ6 A;  4MM3 B;  1S9F A;  1BPE A;  3RJI A;  1P7F A;  3V7L A;  2R8G A;  3WKC A;  3Q8M A;  4ECS A;  4DL7 A;  2QAR A;  5DB7 A;  1NOM A;  3N20 C;  2RQ5 A;  4Y2U A;  3IAM 1;  1WX7 A;  2K6D B;  2MRL A;  1KOT A;  4Q44 A;  1RQN A;  5KFH A;  1RQL A;  3IRU A;  1NK8 A;  4FBT A;  1IG6 A;  4QZG A;  2KVR A;  1ENF A;  4IM0 A;  1SZP A;  7ICI A;  2GO7 A;  8ICM A;  2KWU B;  1SE4 A;  4B9N A;  4M0W B;  4O3N A;  5J2I A;  1XLP A;  4REZ A;  2QLT A;  3V62 A;  1ZRM A;  1JCK B;  3QK0 A;  3TUO A;  3GE3 C;  4C4V A;  4ZRJ A;  3RT3 B;  1OW5 A;  1ZJM A;  4HPM B;  2OYY A;  3OSP A;  5HP4 A;  3CSF A;  3BZK A;  5KFK A;  3Q3F A;  2G5I B;  5CJ7 A;  3B0X A;  7ICG A;  4BZA A;  4JL9 A;  1U4A A;  3QZ7 A;  3H7S A;  3JPQ A;  4IRK A;  1L7N A;  4KLH A;  2DAJ A;  3NAS A;  4KLJ A;  1HJP A;  4HRS A;  2QIL A;  9ICH A;  4GXI A;  3A1Q B;  2BKF A;  3RMK C;  3ZDD A;  5DPS A;  4DSJ A;  1V81 A;  4AOF A;  3PSI A;  5J0S A;  4WJ3 B;  2JX5 A;  3RB0 A;  4CYE A;  3QUC A;  1ET6 A;  3OJ4 B;  3OLM D;  3KD3 A;  4K7S A;  2CN1 A;  4Q43 A;  1CMX B;  4RGT A;  1XSL A;  2KQS A;  2QB0 A;  1E8Y A;  2W03 A;  5AKG A;  4NJ8 A;  1KKX A;  2PPH A;  1L7Y A;  1HUZ A;  2FE9 A;  3HM6 X;  2FPL A;  2WQY B;  1J97 A;  4EX6 A;  2Y3A A;  9ICI A;  2DYB A;  2WU2 B;  3V7K A;  3DQV A;  3ZGZ A;  4Z6D A;  4TUQ A;  3AU4 A;  3AE2 B;  2YTU A;  1ET9 A;  1L3U A;  3V6C B;  3C21 A;  3T5J A;  3T3F A;  2VKQ A;  4JIO U;  9ICO A;  3DBS A;  3KWV A;  3VUX A;  4CO7 A;  3RJG A;  5IIN A;  2D6F C;  4ZH4 A;  4KLD A;  7ICQ A;  1I7H A;  1NBF C;  4C7Y A;  5G55 A;  1RPL A;  2NBU A;  1COK A;  1ZJN A;  3P4S B;  4ED7 A;  2JXX A;  5G5H A;  3PSE B;  2ZIX A;  3MR6 A;  1FXA A;  4DSE A;  1GB1 A;  2D10 A;  5LLI A;  2FUH B;  5DQH A;  3OAW A;  2L7R A;  3DWM A;  1SB3 C;  2XCP A;  2HBM A;  4M47 A;  2OEH A;  2K0P A;  3APC A;  4WAF A;  4A20 A;  3ZRF A;  4N6E B;  5HR7 A;  4X57 B;  3M6Z A;  2WS3 B;  5DBA A;  1UWM A;  4XUS A;  5KFV A;  4P0Q A;  2FMS A;  1QIL A;  2XN9 C;  3L10 B;  4FHK A;  4M8M A;  2RPQ A;  4B0M A;  5ALP A;  2QSD A;  4K81 A;  4M0W A;  2ZNV B;  1KLU D;  2E5S A;  2Y9T A;  1YD8 U;  4YTM B;  1A5R A;  3DHG C;  2BYV E;  3ZNH B;  1D3Z A;  5TIS U;  1VZ7 A;  4ED8 A;  5CHF A;  2LEK A;  1UCV A;  2GLE A;  3QX1 A;  5KL1 B;  4P1B C;  4UB1 A;  2GI9 A;  3U52 E;  4UAW A;  2AQ2 B;  4HKQ A;  2KIV A;  4KMO B;  4WJO A;  5KG3 A;  2WU5 B;  1QCK A;  1SIF A;  4I2C A;  2RD0 A;  2YY6 A;  3RJK A;  4BOZ B;  4KSL C;  4PGQ A;  1HA5 A;  4OCZ A;  3KZI U;  4QZH A;  2GLS A;  4F2R A;  1ZQS A;  1P98 A;  2KNJ A;  2JGA A;  2OM6 A;  4QZC A;  2AHO B;  2V9W A;  4UAR A;  2KZZ A;  5KAI U;  4HPP A;  2KFK B;  2C2D A;  2BQU A;  1V38 A;  2XCA A;  1UD7 A;  2LGS A;  2EDU A;  1A6S A;  5KFA A;  2G4S A;  2XEW A;  1Z19 A;  3JYU A;  2W9C A;  1NK5 A;  4EFO A;  3GV8 B;  2XC9 A;  1I4P A;  1KQQ A;  5H92 C;  4O1N A;  2BCS A;  3HVZ A;  5HHH A;  1ZQQ A;  1ZQK A;  4BXO A;  1YN5 A;  3GZF A;  4HWI B;  8ICZ A;  2BPC A;  4DQQ A;  2FCS A;  2KVC A;  2DZM A;  3UIO B;  4HK2 A;  1E6E B;  1F5S A;  1Z1V A;  4F4K A;  3PW5 A;  1Q46 A;  5ALY A;  1ZQZ A;  4II3 B;  5DPR A;  4JMU A;  2ALZ A;  1DGJ A;  4ASW C;  5ALW A;  5KL8 B;  3AED B;  3ZI4 A;  4HDO A;  1MI0 A;  1J8C A;  3Q8A A;  3QX7 A;  2YB1 A;  3A4S C;  5DLG A;  4M8N A;  1STE A;  4KV2 A;  2JEF A;  1CEZ A;  1MPE A;  3OWE B;  2OCE A;  4DSL A;  1TIF A;  1WE6 A;  4DSI A;  2KWC A;  2N0S B;  3D32 A;  3SFE B;  2KLG A;  1PUZ A;  2EKE C;  4OZC A;  1ROE A;  4DS5 A;  2J6T A;  3IVF A;  1N60 A;  1Z3E B;  1AWD A;  4AJY B;  2K4P A;  4E0D A;  3SYZ A;  1SE9 A;  4ED0 A;  1YQB A;  4DL6 A;  2LRW A;  3JPR A;  3URY A;  3SD7 A;  2Y5C A;  4NLC A;  2WDQ B;  3PX6 A;  3H4B A;  3VR8 B;  2JPH A;  4BOS C;  2ZPY A;  2I1K A;  4IKG A;  2LHD A;  3C2M A;  2R2O A;  2NRW A;  2BQQ A;  4UB8 U;  4B0E A;  3U2S C;  1E8Z A;  1IGD A;  4KLS A;  3EUB 2;  3C1Y A;  1WF9 A;  4QWC A;  1KL9 A;  1ZDV A;  4LNF A;  4URK A;  4QZF A;  3H8H A;  3ETR A;  1YT3 A;  2J7Q B;  1Z5S B;  1ZQO A;  1FEH A;  1MHH E;  3L4P A;  4ICV A;  3LK9 A;  1RYR A;  4TQ1 A;  4RMA A;  1QSS A;  2DKX A;  2Q4T A;  3NS1 A;  1UEL A;  4R66 A;  4IWQ A;  1QOF A;  1ZD5 A;  4DDG D;  1B1Z A;  1P7D A;  1FCL A;  3G6Y A;  2IBK A;  1Z4N A;  3FKY A;  4TMA B;  5IIK A;  3ZNG C;  1OTR B;  1K1S A;  4GIV A;  5DQG A;  4IQU A;  4TUP A;  2CRX A;  9ICS A;  2WAQ C;  2O2V A;  4M6W B;  5J0P A;  1SE3 A;  2F77 X;  5EWE A;  5KT6 A;  1NJY A;  3ZUN A;  2RLT A;  5KFM A;  4MEY A;  5C1Z A;  5GXG B;  1VR9 A;  5L1I A;  4N9F 4;  2KV2 A;  1H8C A;  1E90 A;  8ICF A;  3M8R A;  4FAD A;  1SIJ A;  3KW5 B;  3M6K A;  3GU3 A;  1BPY A;  1WWU A;  3ISB A;  3RUL A;  3DDH A;  5J0X A;  1XS9 D;  5ALG A;  1ESF A;  2N1W A;  3L3F X;  1WJ6 A;  3SR6 A;  3RFA A;  2NTT A;  1SEB D;  1T3N A;  2HHW A;  3ZRC A;  1X42 A;  2Y0S F;  4S17 A;  5B66 U;  1L7M A;  3HX0 A;  1UNS A;  3IXS A;  4F4Z A;  4DFP A;  3VUY A;  4F3O A;  4NM2 A;  3H7I A;  1ACC A;  2LAS A;  3EHV A;  3VH4 B;  2KT7 A;  1E10 A;  1HZ5 A;  2AXT U;  3QUQ A;  3RR7 A;  1U48 A;  1DYQ A;  2XBB C;  2JHD A;  2K8C A;  1YNT E;  2OJR A;  4YR2 A;  4I28 A;  2N9P C;  1RG6 A;  2ZW1 A;  4TKN A;  3JSV B;  3P42 A;  4XYC A;  4U6P A;  2KWV B;  4ACF A;  3OJS A;  1T6B X;  3ALB A;  4W9I A;  1A77 A;  1S0M A;  3L0W B;  3KHR A;  4PGX A;  3PS6 A;  2K8B B;  1D8L A;  2M56 B;  4C00 A;  2HSZ A;  4AS1 A;  4I2G A;  2PMZ C;  5D4B A;  1RXW A;  1XSN A;  3QAQ A;  4BKS D;  1XCQ L;  4MH0 E;  1XO0 A;  4HVB A;  3Q8K A;  5AUK A;  4NWI A;  1LB2 B;  2M9N A;  4YXM A;  2HTM E;  1PZN A;  1JW9 D;  2VH2 A;  3A1Q A;  3VR9 B;  2I1J A;  1YN3 A;  2QIE B;  3PVL A;  8ICR A;  2WXO A;  3UGB B;  4B6W A;  1ZQU A;  2CU1 A;  3QUT A;  3MHZ A;  3KFU F;  2AL6 A;  1QQ7 A;  2V1Y A;  1JRO A;  4GLS C;  3H1U A;  5DKW A;  3HP6 A;  4MT5 A;  2MJ3 A;  5AZG A;  2K6Q A;  1EF5 A;  5AKZ A;  5AM0 A;  3QZ8 A;  3H8M A;  2N7J A;  3VTU A;  4DQR A;  2G0A A;  5AIA A;  3L13 A;  3EFC A;  4C4T A;  4J9Q A;  2B6G A;  3JPP A;  2CXY A;  3B0Y A;  1KRP A;  1WGH A;  3T8M A;  5J0O A;  2A1J A;  4DWI A;  5G2N A;  3AMZ A;  4A9A A;  3NZS A;  3M62 B;  4KZC A;  3Q8R B;  3KTQ A;  2IO1 B;  5J0U A;  4HLE A;  1RAX A;  4IC9 A;  4EX7 A;  4PK1 A;  2HD5 B;  5AIB A;  4MF8 A;  3F2B A;  1Q1O A;  2MA9 B;  4OJ5 A;  2I5H A;  3TJP A;  1WYW B;  3N1X C;  3DOW A;  5AKX A;  1V5T A;  3PW4 A;  2JRZ A;  3WA0 A;  3OHB A;  2EAP A;  1L6N A;  3PSF A;  3NZU A;  1BNP A;  4WIP A;  3WKA A;  2P66 A;  1ZQF A;  2MUT A;  1Y8R C;  3P63 A;  4GDK B;  1QLN A;  2LZ6 A;  1BXT A;  1D8Y A;  1TS4 A;  4MGY E;  7ICS A;  4LK0 M;  1XWL A;  1UA1 A;  1E5W A;  2ZIW A;  2KTR A;  3N32 A;  3HT3 A;  3R2I A;  4XC2 A;  1ZQE A;  2N9E B;  2KAC A;  1GOZ A;  3KH0 A;  4US9 A;  5BYS A;  1T5X D;  1PGA A;  1LO5 D;  1CZP A;  4KX5 A;  1YQ4 B;  1QQ6 A;  1C1Y B;  2B76 B;  2KVS A;  5AKJ A;  4G3I A;  2BS3 B;  2E6X A;  4J9P A;  1MA7 A;  2WXK A;  2XIC A;  2QDF A;  1EF1 A;  3FM9 A;  2YLM A;  1FM0 D;  2HHQ A;  4EEY A;  2KC1 A;  3LYY A;  2KAJ A;  1QT9 A;  2L76 A;  3R2T A;  3V61 A;  4KLU A;  3AE9 B;  3SZ2 A;  2M1M A;  1WGR A;  2JRH A;  2Y1J A;  2J42 A;  3UQ0 A;  2KDM A;  3AH7 A;  5HHI A;  2OH2 A;  4WJQ A;  1X9M A;  4DHZ E;  5ALI A;  2LUM A;  2AGQ A;  4EUT A;  1FXT B;  2ZXI A;  3PSP A;  4KDL B;  2BPG A;  5BMH A;  2DYO A;  3A33 B;  1RYJ A;  3V6E B;  1FRR A;  4AYB F;  3ZJV A;  4RUC A;  3RI7 C;  4RPX A;  1SL2 A;  2ZCB A;  2LWP A;  4GDL A;  3NTU A;  9ICC A;  3RZW C;  4TQS A;  1Z1B A;  2HBJ A;  1JWA D;  2Q5W D;  1A76 A;  2MCN B;  4EBD A;  1V80 A;  4OVU A;  4FO6 A;  4DQI A;  4AJW A;  4C8L A;  5DGB A;  1L7O A;  3HHM A;  1PGX A;  2WXP A;  3NZ3 A;  4M02 A;  4E74 A;  5B5E U;  1TTN A;  4BDP A;  2DX5 B;  3BYT B;  4EZ6 A;  3EYZ A;  1GUA B;  3MJW A;  4W9C A;  1PGB A;  2FE8 A;  5GMV A;  2KMA A;  3PX0 A;  5CP2 A;  1Q0W B;  4UB6 U;  2OJW A;  3IT6 B;  1RWS A;  3CIR B;  1JWM D;  4KKJ A;  4BVU C;  4O3M A;  3V05 A;  1UT8 A;  3MBY A;  1L2N A;  2X8X X;  4JQW C;  1ECW A;  4XGA B;  5BYQ A;  5ALN A;  2ES6 A;  2A4Z A;  5HKH A;  1WWT A;  1V49 A;  4ITK A;  3QAR A;  3AUO A;  4RM8 A;  2JQR B;  5JXV A;  2BW2 A;  1J7B A;  3C28 A;  2UVW A;  4K3B A;  2ZIV B;  2KQ4 X;  1IXR A;  4LJO B;  4S0R A;  3QEA Z;  2DQN B;  2GBR A;  4DL4 A;  3R7Q A;  4EEL A;  1UBI A;  1P3Q U;  4C80 A;  3APF A;  1S0V A;  2ESE A;  3APD A;  5DDM A;  3ZO5 B;  3M8S A;  3ZLZ A;  4FBU A;  3B2F A;  4CE6 A;  4FFD A;  3UIN B;  3AV8 A;  4GFJ A;  4GIB A;  4F7Z A;  4MEM A;  4WAA A;  3RNB C;  3MP9 A;  2F2A B;  3A0B U;  1WZ0 A;  5AI4 A;  4GN1 A;  1WCN A;  2LBO A;  4CGZ A;  4CNQ A;  1JMS A;  2OED A;  2C22 A;  1V1P A;  1C20 A;  4RQN A;  4N58 A;  2IO3 B;  1S8O A;  5BOL A;  1XU4 A;  4DHZ B;  5JH5 C;  1L6U A;  2KTF A;  2A5U A;  4AP4 C;  1L5U A;  2GBN A;  3L08 A;  5KFO A;  3D2Q A;  2WGS A;  2KJR A;  2LFI A;  3ETL A;  3FC4 A;  2UVR A;  4IS7 A;  2LI6 A;  3J9C A;  2PI4 A;  1ZQM A;  4PZO A;  4Q8F A;  2NPT B;  4QZB A;  4TUS A;  2JUO A;  2AQ1 B;  2MX2 A;  2LGX A;  2YQE A;  8ICA A;  2M0N A;  1FNV A;  4F5Q A;  2INN E;  4O3Q A;  4BJQ A;  3H40 A;  3BZC A;  5DDY A;  3LVW A;  1WR6 E;  3WAM A;  2AGO A;  3SV4 A;  2L0T A;  4XZ4 A;  2LMR A;  2XY6 A;  1E7P B;  2WXI A;  2X38 A;  2BYF A;  2RMM A;  4CF5 A;  5J17 A;  1TFR A;  1F0M A;  2DBY A;  4BUG A;  5KFS A;  7ICH A;  4C8O A;  2ON8 A;  4RGO S;  3G6V A;  3Q8Q B;  3UXN A;  1D5Z C;  4O9M A;  2QB1 A;  1DGS A;  3SEN A;  4KLM A;  2ZUB A;  5AI8 A;  2FNJ B;  3A9K A;  1N63 A;  4IM2 A;  4CF4 A;  2DPI A;  1ZRN A;  3TFS A;  3ZXV A;  1T4G A;  2KD1 A;  2JY6 A;  1C77 A;  5T14 A;  3M63 B;  2A3V A;  2VA3 A;  1VLB A;  3TSS A;  4AWJ A;  5KT5 A;  2BCV A;  1UBQ A;  3WK7 A;  1TYG B;  3WK6 A;  4QZE A;  1RYU A;  1GJZ A;  3GQC A;  1N62 A;  4I2I A;  5D3D A;  1IGC A;  4LNI A;  1UA0 A;  4JWS C;  5BYR A;  3UPQ A;  4MGI E;  1ZQH A;  5CR0 A;  1XF5 L;  3F53 A;  1TK8 A;  1SSN A;  3PPA A;  4UB4 A;  2W9B B;  2AJQ A;  2Z7J A;  1NZB A;  2FLL A;  8ICO A;  2KD0 A;  1IYF A;  5DQI A;  3GB1 A;  3V6H A;  1KDH A;  4F71 A;  4Y2Q A;  4RQ1 A;  4YQW A;  4JPS A;  5LNK 1;  4F93 B;  5I4D A;  5GTI U;  2YMP A;  2ISP A;  1C9F A;  2G3Q B;  2MJE A;  3QHT A;  4JWU C;  3IFW B;  2KE7 A;  1V97 A;  3CW2 C;  3KYD D;  2O6V A;  3AE7 B;  2G06 A;  1TT5 B;  2L52 A;  3T5H A;  1TVA A;  4I2B A;  5J8Y A;  3WKB A;  1N48 A;  2ONQ A;  3NRZ A;  1TAQ A;  3RB4 A;  3MFG A;  1LKY A;  4I27 A;  5KFL A;  1DOI A;  1Q10 A;  1SXT A;  4ZRQ A;  1YJI A;  2VH1 A;  4ECV A;  3MFH A;  4BBN F;  9ICQ A;  1U4B A;  4FN2 A;  4PHP A;  2MBH A;  5KT2 A;  1AAR A;  2WHI A;  3AEF B;  1JAL A;  2BZF A;  2QMT A;  1UGM A;  1NKC A;  1TKE A;  2V4R A;  3ZDT A;  5KG5 A;  1WGG A;  4FZL A;  3C23 A;  1IBX B;  3GOE A;  2KXJ A;  2LJ5 A;  1R4M I;  3RR8 A;  1S0O A;  4YCX A;  4NL9 A;  9ICB A;  2EH9 A;  3AE6 B;  3EPG A;  2RDI A;  2INP E;  4H2A A;  4PYZ A;  4UB3 A;  3ED5 A;  4J9O A;  1U9L A;  4BWM A;  2ATL A;  3I5J C;  3S2A A;  3UF8 A;  2H3F A;  3IHQ B;  4M6W A;  2HE7 A;  2OOB B;  9ICL A;  3MFI A;  3D6J A;  1T0S C;  1WI0 A;  1SV0 C;  4GXK A;  1H4R A;  5F3X B;  2L5Y A;  4RF0 A;  1CUK A;  3ZW3 A;  1LXD A;  2PXI A;  9ICX A;  4MGK E;  3GDX A;  3RRG A;  2MP2 B;  2CHX A;  4RCO A;  4PS8 A;  3V6K A;  2DAF A;  2B21 A;  2KX3 A;  2KNB A;  3DVG X;  1PDX A;  4OVZ A;  1JWU D;  2YN4 A;  1L0V B;  1ZQG A;  4PHE A;  2N4F A;  2KJ5 A;  4ANV A;  4CQN A;  1GO3 F;  1KRH A;  4QWA A;  4IL6 U;  2HHV A;  2HOI A;  3BVZ A;  2B0C A;  4PJ0 U;  1QZE A;  4IUM B;  4A8X C;  3H7P B;  3N9Y C;  3ENE A;  2XGQ A;  2W9B A;  1TAM A;  5JHB A;  4C4S A;  1L4Z B;  4HDQ A;  4IOI E;  4E3C A;  1T0Q C;  4C4R A;  2I1Q A;  5C2T B;  1MG4 A;  3N7S C;  5IA7 A;  1WXA A;  4FUL A;  4LTU A;  2MH7 A;  4HXD A;  3PZP A;  5FK9 C;  3EEC A;  4R8U B;  2BR0 A;  3BJY A;  3MAB A;  2VZK B;  1L4D B;  1X6J A;  1J0G A;  3WK8 A;  1AYF A;  1C76 A;  2E8M A;  3OGU A;  1X40 A;  3BYY B;  3NHE B;  2EQY A;  4F5N A;  5TZV A;  1L5P A;  3UI3 A;  2Y1I A;  2AWT A;  3T3N A;  2IY0 B;  3SFD B;  4LJP B;  3NVZ A;  1S1Q B;  4OZB A;  4GGQ A;  1IPG A;  4RGM A;  2PKO A;  2G08 A;  2J6S A;  2Y0S C;  1X66 A;  9ICA A;  3MC8 A;  5J0W A;  3RRH A;  3NGD A;  2IA6 A;  3MTN B;  3IG3 A;  3WKD A;  2CJO A;  4MJS A;  4RH6 A;  5TR5 A;  5IP4 D;  2N1R A;  3Q14 C;  3Q69 A;  2KKV A;  2J0K A;  4Z6C A;  2J0M A;  4DOA A;  3DBH I;  5CA7 A;  5AIC A;  1PK3 A;  3AE5 B;  2BCU A;  5DG7 A;  2WLB A;  3VTV A;  8ICN A;  5AM2 A;  3WIM A;  1OFF A;  2JYE A;  4RNM A;  1SXE A;  4F92 B;  2W7O A;  1C4A A;  3Q3N C;  2IOF A;  2I6X A;  2W82 A;  3AEC B;  4MAC A;  1QH9 A;  2AQ3 B;  5IIM A;  2M19 A;  2MAX A;  2ZIW B;  2KTR B;  1SWV A;  1J2N A;  2ZPN A;  3RPF C;  4ZHO A;  1JN3 A;  2E1E A;  4USA A;  2GBM A;  7ICP A;  3KYC D;  3UIP B;  4NLG A;  1NDD A;  5L9X A;  2ZCC A;  3F5E A;  4KMU A;  1WX9 A;  1JIH A;  1S77 D;  3AE4 B;  4L1B A;  1MJD A;  3UQB A;  2PKE A;  2DWQ A;  2V9H A;  4RUA A;  2AU0 A;  2KJH B;  2WF5 A;  5ALK A;  1U45 A;  1M94 A;  5EE3 A;  2LXA A;  1NYQ A;  1NJW A;  3ZJU A;  5H8Y E;  3HW8 A;  1VDV A;  2HHS A;  1VJK A;  2FCN A;  3AB5 A;  5AM3 A;  4MEX A;  2KFZ A;  5ALF A;  4ICU A;  2BQR A;  2WXR A;  2EZX A;  4C8M A;  3UXO A;  2IDY A;  5EOZ A;  1L8O A;  1L3S A;  3W9C B;  2FDR A;  4EBC A;  5ALS A;  2QB0 B;  1I4R A;  4HPL B;  3Q8E A;  5ALO A;  3T5K A;  5KFF A;  4NLB A;  2JH1 A;  5KG6 A;  7ICT A;  4EZJ A;  1TZ1 A;  5FR3 A;  4RQ5 A;  4K4G A;  1Q8K A;  2BYE A;  4FS2 A;  2HJ1 A;  3E56 A;  3VAW A;  2PFN A;  4NJC A;  2ASD A;  3KHG A;  1IUE A;  1WUD A;  3NVV A;  2PVG C;  5TSS A;  2F76 X;  5IIL A;  1FFU A;  3ZDA A;  2LD9 A;  4NPN A;  1XEE A;  2C2E A;  4JV2 A;  3QU5 A;  4B9V A;  2LXC A;  2NRV A;  3HK0 A;  4WJP A;  3PY8 A;  2E8N A;  2RDH A;  3O65 B;  1HUO A;  4IQT A;  1UPH A;  1YZ7 A;  4W9E A;  2EAM A;  4F4Y A;  3SI8 A;  3ZXR A;  8ICQ A;  4EZK A;  4QIW F;  5IKC M;  3PZD A;  3T3O A;  1ZPS A;  2BT6 A;  3Q3M C;  4QZA A;  1WG8 A;  3ML9 A;  3SHQ A;  3HRD D;  1V9J A;  5KG4 A;  4Y2S A;  4RQ2 A;  2FPK A;  2C60 A;  1WJN A;  3K75 D;  4PHD A;  4LVS A;  4G50 A;  3A4R A;  2KEY A;  1S5L U;  4ELV A;  2BPS A;  2E3T A;  4J9R A;  4EEN A;  1UWX A;  3OHA A;  1FD6 A;  2RPV A;  1AN8 A;  4F8R A;  5AI0 A;  1CQV A;  3WCQ A;  1WZ3 A;  3KLS X;  2KZM A;  2WXN A;  1JX4 A;  1UUP A;  4WWO A;  5CHV C;  2LHE A;  4ELU A;  2R2Q A;  5FP0 A;  1WGY A;  1L0X B;  2WDR B;  4FJV B;  1WR1 A;  2G9H D;  3PRZ A;  3AQE A;  2ZJA A;  3BK2 A;  3C29 A;  1QKZ A;  4UAY A;  4YXJ A;  3SAH A;  1V5O A;  4RQ7 A;  2XY7 A;  4ECU A;  2RSU A;  3W1S A;  2MU2 A;  3SQI A;  2MHJ A;  4KIK B;  5DPW A;  1TY0 A;  3Q6B A;  4F72 A;  2HTH A;  1TKG A;  1SGG A;  2XY5 A;  2V4Q A;  4BFR A;  4P4P A;  4M9N A;  2KQ7 A;  2KMD A;  2C5L C;  3RH4 A;  2F1I A;  2FCM A;  1MN8 A;  2W9M A;  3X0W A;  1IP9 A;  5IOI A;  1NEK B;  1PVQ A;  2MW5 A;  1UZX B;  3N28 A;  1JXE A;  3QU2 A;  3GIK A;  3MGV A;  3SU8 X;  2WWZ A;  1K8R B;  3IBE A;  1D9D A;  4ELT A;  2GWS A;  4M9J A;  3OPX A;  5D49 A;  1H38 A;  2W43 A;  3MDC A;  4J6I A;  1TE2 A;  2QAR B;  4MFC A;  2RHF A;  1PQS A;  3TBL D;  2MQJ A;  4ZYS A;  3TEY A;  4KGR A;  4QW8 A;  4HRO A;  1T8E A;  2O2V B;  9ICV A;  3ONS A;  1T0R C;  2VRR B;  5KT4 A;  9ICN A;  1WSP A;  1L7P A;  3K4G A;  1YIW A;  1ZOY B;  5GTH U;  1PUT A;  4PZN A;  4DEZ A;  4QWE A;  2DHZ A;  2RDJ A;  3PT2 B;  3NJT A;  3Q8F A;  4J9S A;  4M9L A;  4DQP A;  5CHW A;  4OVV A;  4MM3 A;  3LWM A;  2DZJ A;  3WAO A;  1RFA A;  2KZR A;  4DOC A;  3U4E G;  4YL8 A;  1JUD A;  3H4D A;  1K52 A;  1OGW A;  2JMG A;  4RZR A;  1TJE A;  1TS3 A;  1C3T A;  1ZD2 P;  2ZUD A;  4DHJ D;  1RDF A;  3VDZ A;  4Y2T A;  3AUL A;  1V8C A;  3ZNZ B;  1PK1 A;  3DVN U;  4U7C A;  2LVO A;  4BKS A;  5BMG A;  3WAN A;  1SXD A;  5ALV A;  5AKH A;  3C19 A;  5A0L A;  2KDI A;  2L0F A;  3DDC B;  1OEY A;  2K25 A;  2DLB A;  4KLQ A;  3U7D A;  3TAN A;  2NO5 A;  2B3A A;  3GS2 A;  2FI1 A;  8ICU A;  2BS4 B;  4KZ0 A;  2SEB D;  2MJD A;  2HJ8 A;  4LLG M;  3B1L X;  2H5X A;  3ISD A;  5KFN A;  2VZK D;  3RJH A;  2MBB B;  4HCN B;  4B9U A;  4LDT B;  3DBH B;  3R8B A;  2BPF A;  5IO9 A;  2JSV X;  2JZP A;  3RBE A;  3BQ1 A;  1I42 A;  1FMA D;  2CR5 A;  1SKW A;  3G6X A;  4I6P A;  2WYQ A;  2WP9 B;  5HML A;  3ZQ4 A;  5JUM A;  3BQ7 A;  4EEW A;  2HCF A;  2K8B A;  2C9W B;  4IW0 A;  1T94 A;  1NZP A;  2EZZ A;  2H3V A;  3GV5 B;  1HTO A;  2IYD B;  4DQS A;  3E0F A;  3EGR A;  2EMT A;  4J9N A;  3K9O B;  2WXH A;  4I2E A;  1TZO A;  2ZTC A;  2BGW A;  5L1L A;  2OWO A;  1VZ8 A;  4MDK E;  2YMM A;  4JWM A;  3DBL I;  4ECY A;  2DKZ A;  3W5V B;  5HFY A;  1FPY A;  4XQ8 A;  4F2S A;  2V3P A;  3LYS A;  2WXF A;  3QYP A;  3AI5 A;  2BS2 B;  3Q2A C;  3UMG A;  1NKE A;  2IHN A;  2HVH A;  4ZHP A;  3KWL A;  3CRX A;  4BXO B;  2GBJ A;  4MFA A;  1CJE A;  1T3Q A;  2W54 A;  5J2D A;  9ICG A;  1LFD A;  2JEG A;  3PV8 A;  3RAQ A;  3C1Z A;  5AM1 A;  4Y2R A;  2BGF A;  1SBB B;  5D46 A;  5EWF A;  2NRZ A;  4DS4 A;  1ZYQ A;  2LVP A;  1Z00 B;  1SGH A;  3J81 j;  2LYH A;  3ZTD A;  2R8J A;  3UQ2 A;  1RZT A;  3PO4 A;  1TK0 A;  3TEW A;  3AU5 A;  3GE8 C;  2SAK A;  3LJ3 A;  2ZW0 A;  1F1H A;  5KFU A;  3QC8 B;  3HUI A;  1ZDX A;  4DXG A;  5AK6 A;  1ZQA A;  5E6P A;  2XVT A;  3UMB A;  4KLG A;  2F44 A;  2KKP A;  2KN7 A;  1ZQC A;  4DWF A;  2ACZ B;  4B9S A;  3RNF C;  1ZOL A;  4Z6F A;  4ECZ A;  4ED6 A;  4YR3 A;  1BGX T;  2JZB A;  4DO9 A;  2ZVN A;  2K89 A;  1F52 A;  8ICP A;  2GOL A;  4XA5 A;  3QQ8 B;  2P35 A;  1QSL A;  5DGA A;  4F1S A;  4KKI A;  2WAQ F;  2KG5 A;  4QJF B;  3C2L A;  5KFQ A;  1NYR A;  1ZET A;  3A9J A;  1M6Y A;  2ODG A;  4WWN A;  1NK7 A;  3U7Z A;  3HPO A;  4NLN A;  2WNM A;  4J3O D;  2ISO A;  3H0M B;  3HJE A;  1XLN A;  2AEH A;  3HWT A;  4CCH A;  2HW3 A;  4FZM A;  1SL0 A;  1YJ1 A;  3I76 A;  3ALR A;  3PLV A;  3SAF A;  1CRX A;  5DBB A;  5L1M A;  2M0A A;  4UDU C;  1SV4 A;  1ZQW A;  5AKI A;  3JPN A;  1O08 A;  1V6E A;  3FAH A;  2BF8 B;  3I63 C;  4WQO B;  2LYB A;  5CEH A;  3TAD C;  4AQ7 A;  3BDP A;  2IHM A;  4NLK A;  2M0X A;  3PO0 A;  4YD2 A;  7ICM A;  4IDI A;  3PRE A;  4W9G A;  2UYZ B;  1JQ4 A;  2CHZ A;  3PVX A;  2K4E A;  4PS7 A;  2PIA A;  4UAS A;  1TS2 A;  2JYT A; 
#chains in the Genus database with same CATH homology
 1VLB A;  3TSS A;  2QEJ C;  3KWV A;  1TYG B;  2J53 A;  1N62 A;  1I7H A;  2DYM A;  1I4G A;  4C7Y A;  5D3D A;  1IGC A;  3BII D;  1VZ6 A;  4JWS C;  5BYR A;  3P4S B;  4YSX B;  1F2R C;  4R3D A;  5G5H A;  1M4V A;  1TY2 A;  1XF5 L;  3P1M A;  1SSN A;  2K5P A;  1FXA A;  1GB1 A;  1RM6 C;  3DWM A;  1SB3 C;  2K0P A;  1L6V A;  4WAF A;  5D7G A;  4N6E B;  2QJL A;  3GB1 A;  2WS3 B;  1UWM A;  4WWM A;  1UGJ A;  3NVY A;  1P7E A;  1QIL A;  2XN9 C;  4L2Y A;  4N59 A;  4JPS A;  4YSY B;  5LNK 1;  5I4D A;  4B0M A;  2QSD A;  4M0W A;  1C9F A;  1KLU D;  2MJE A;  4JWU C;  4YTM B;  3AEE B;  1V97 A;  3AE7 B;  1VZ7 A;  3AEB B;  2W55 A;  3P4P B;  2L52 A;  2LEK A;  2ONQ A;  4GDL B;  3NRZ A;  3MFG A;  1Q10 A;  1DOI A;  1KTK A;  1SXT A;  2GI9 A;  4ZRQ A;  3U52 E;  2AQ2 B;  4HKQ A;  1YJI A;  2WU5 B;  3AM9 A;  4YTN B;  2FBW B;  2V4I B;  1XO3 A;  1QOB A;  1HA5 A;  2W3R A;  3AEF B;  3VRA B;  1JAL A;  3FIL A;  2QMT A;  1TKE A;  3BWU D;  1NVI D;  1YMH E;  1Y56 A;  1IBX B;  2YEP B;  3I9V 1;  1QQR A;  3AE6 B;  1BML C;  2INP E;  4H2A A;  3O13 A;  1I4P A;  1F0Z A;  2RDG A;  5H92 C;  4O1N A;  1JWS D;  3HVZ A;  1YN5 A;  4ARC A;  4PT5 A;  4HKZ E;  5EE9 A;  4RF0 A;  4C56 C;  1E6E B;  3IAS 1;  1C78 A;  3BZD B;  4RCO A;  1XCT L;  1BUI C;  1XLO A;  1FNU A;  3BVG A;  1PDX A;  4RNA A;  4OVZ A;  1DGJ A;  1JWU D;  5HHD G;  1L0V B;  3AED B;  4KGS A;  1MI0 A;  2CU3 A;  4CQN A;  3Q8A A;  1KRH A;  3BVZ A;  1STE A;  1MPE A;  4A8X C;  3N9Y C;  4TQ0 A;  2LJI A;  2N0S B;  3OWE B;  1IBX A;  4OW0 A;  3SFE B;  2BTE A;  4WQM A;  4OZC A;  1L4Z B;  3V3X A;  4IOI E;  1ROE A;  5C2T B;  1N60 A;  1AWD A;  4DXF A;  4LTU A;  1SF0 A;  2MH7 A;  2KWD A;  4OZA A;  5FK9 C;  1FNW A;  3AN1 A;  2VZK B;  1L4D B;  3URY A;  1AYF A;  1C76 A;  2EKI A;  2WDQ B;  2Y5C A;  3VR8 B;  3BYY B;  3RFZ B;  3E9S A;  4IKG A;  1E9M A;  3UI3 A;  1C4C A;  1L5P A;  2LHD A;  3BVM A;  3T3N A;  2D5G A;  4B0E A;  3SFD B;  3U2S C;  3NVZ A;  2ICI A;  1WGK A;  3HVD A;  1IGD A;  4OZB A;  4L23 A;  4RGM A;  2PKO A;  3AEG B;  3EUB 2;  4RGN A;  1ZDV A;  3H8H A;  3ETR A;  4OHJ A;  1NI3 A;  1OQR A;  1FEH A;  1MHH E;  3L4P A;  2CJO A;  4RH6 A;  1DOX A;  2CJN A;  2EEL A;  4TQ1 A;  1CK1 A;  3MC0 B;  3Q69 A;  3NS1 A;  4XE0 A;  1I4H A;  1QOF A;  2HDE A;  3SEB A;  1SE2 A;  3AE5 B;  1B1Z A;  1HXY D;  3KQ4 A;  2WLB A;  1FCL A;  1A70 A;  1OFF A;  2JYE A;  4TMA B;  2GRI A;  1C4A A;  1TS5 A;  1GB4 A;  1TKY A;  2W82 A;  2H89 B;  3AEC B;  4MAC A;  2AQ3 B;  2M19 A;  1FO4 A;  4MH8 A;  1SE3 A;  3RPF C;  1ZP0 B;  1FFV A;  4ZHO A;  4USA A;  4A6Q A;  2WXQ A;  3VRB B;  5GXG B;  1VR9 A;  4RFB A;  3I57 A;  1MHX A;  3AE4 B;  4L1B A;  1SIJ A;  2DWQ A;  1FIQ A;  1JWB D;  2BB5 A;  1I4Q A;  5EE3 A;  3ZYY X;  1NYQ A;  3ZJU A;  3ZJT A;  4US8 A;  5H8Y E;  1HQR D;  1VDV A;  1ESF A;  1VJK A;  3SR6 A;  1XLQ A;  3AB5 A;  2NTT A;  1SEB D;  3P4Q B;  2TSS A;  1EM7 A;  2IPK D;  2WXR A;  2JWU A;  1UNS A;  2IDY A;  3IXS A;  3BK1 A;  3W9C B;  1J7A A;  1ACC A;  1K51 A;  2IJ0 A;  5HI1 A;  1WRI A;  1I4R A;  3Q8E A;  4YXD B;  2MEK A;  3NVW A;  1E10 A;  1HZ5 A;  1DYQ A;  3PZ8 A;  4WUR A;  2V3N A;  5AUI A;  2AX5 A;  1YNT E;  5FR3 A;  1E0Z A;  1GPX A;  5C3J B;  3E56 A;  1K53 A;  3B9J A;  4NJC A;  2PVG C;  1IUE A;  3NVV A;  2ZW1 A;  3P42 A;  5D3I B;  5TSS A;  3B2G A;  1EWC A;  1FFU A;  1KF6 B;  1ZUD 2;  1XEE A;  1T6B X;  3DWG C;  4A90 A;  3Q8B A;  2RDH A;  3T3O A;  5BMI A;  2PTL A;  2M56 B;  4AS1 A;  1ZPS A;  2BT6 A;  1SJE D;  1EU4 A;  4KX6 B;  2N9K A;  3HRD D;  1XCQ L;  4C7Z A;  3AE8 B;  5HG2 A;  5AUK A;  4ZRP A;  1ZXH A;  2E3T A;  2HTM E;  3GP7 A;  2GB1 A;  1JW9 D;  1UWX A;  1KLG D;  1FD6 A;  3VR9 B;  2RPV A;  3IT4 B;  1AN8 A;  2I2Y A;  5G5G A;  1CQV A;  1YN3 A;  1D4B A;  3WCQ A;  4DQO C;  3KLS X;  2QIE B;  2WXN A;  1MVK A;  2WXO A;  3AE1 B;  1UUP A;  2LHE A;  3MHZ A;  1JRO A;  1FXI A;  2L83 A;  3LXF A;  4GLS C;  1L0X B;  2WDR B;  2IGG A;  2G9H D;  3FIL B;  2MJ3 A;  4MT5 A;  2N9L A;  2R61 A;  3BK2 A;  4EE2 A;  3TEZ A;  1QKZ A;  1NEN B;  1QLB B;  5E6J A;  1R7S A;  2N7J A;  2PVO D;  1YN4 A;  4HEA 1;  2V0G A;  1C4P A;  2WXL A;  5EE0 A;  4NZL B;  3AMZ A;  4A9A A;  2FUG 1;  3W1S A;  4D2K A;  3AEA B;  4JX1 C;  1TY0 A;  4Q2J A;  1AW7 A;  1TKG A;  1D6E C;  2BBC A;  2JXT A;  4KGT A;  1FRD A;  2WXJ A;  1JRP A;  1WYG A;  4ZOH C;  4P6V F;  1NEK B;  1N5X A;  1N61 A;  1KFY B;  1JML A;  4WIP A;  4HJG E;  1YQ3 B;  2G1E A;  1EWY C;  2W3S A;  3P63 A;  4GDK B;  1BXT A;  1TS4 A;  3MJ5 A;  4LK0 M;  4ZYS A;  3TEY A;  1WXQ A;  4KGR A;  2YEP F;  4HRO A;  3PZ7 A;  3R2I A;  2KAC A;  1GOZ A;  1WSP A;  1QOG A;  3P4R B;  4US9 A;  2J52 A;  5BYS A;  1T5X D;  3TEX A;  1PGA A;  1LO5 D;  4YSZ B;  1CZP A;  1XXG A;  1ZOY B;  1PUT A;  5FKA C;  1ZE3 D;  1YQ4 B;  3Q8F A;  1F2R I;  2PW9 A;  2B76 B;  2BS3 B;  2E6X A;  4YTP B;  3U4E G;  2WXK A;  1D5X C;  1K52 A;  1TS3 A;  1TJE A;  1FM0 D;  2LGI A;  3LYY A;  2KAJ A;  1V8C A;  1QT9 A;  1QOA A;  3R2T A;  3W5U B;  3AE9 B;  2Z8L A;  1VRA B;  1OQQ A;  2J4X A;  5BMG A;  2J42 A;  2KDM A;  3AH7 A;  4FXC A;  1V1O A;  2LUM A;  2DLB A;  1SJH D;  3GS2 A;  5BMH A;  2BS4 B;  2DYO A;  2SEB D;  1RYJ A;  2MJD A;  1FRR A;  1KH0 A;  3ZJV A;  2IGH A;  4LLG M;  4YT0 B;  1PYW D;  3LB8 C;  2VZK D;  2KN4 A;  3R8B A;  1ZXI A;  1K50 A;  1JWA D;  2JSV X;  2Q5W D;  2JZP A;  1FMA D;  2PMV A;  2K3U A;  2WXM A;  1PGX A;  2WXP A;  3NZ3 A;  2WP9 B;  1F77 A;  3BYT B;  3ZQ4 A;  2L1A A;  5T8I A;  2Y5P A;  2NTS A;  3ABV B;  1D5M C;  1PGB A;  2FE8 A;  2XNA C;  3W2D A;  3EGR A;  2I38 A;  3IT6 B;  1RWS A;  1YJJ A;  2WXH A;  1L0Y B;  1TZO A;  1JWM D;  2K9X A;  3AE3 B;  3CIR B;  3EA6 A;  4KKJ A;  4NAM A;  3V05 A;  1V1P B;  1VZ8 A;  3C8Y A;  2H88 B;  4RF1 A;  4XDD A;  5BYQ A;  2WXG A;  3Q8C A;  2JU6 X;  2BYT A;  1WWT A;  3W5V B;  4ITK A;  5HFY A;  4YWG G;  2V3P A;  2JQR B;  2WXF A;  2IGD A;  4WH4 A;  5JXV A;  2WDV B;  2BS2 B;  1J7B A;  1HEZ E;  2BW2 A;  1DOY A;  2KQ4 X;  4ZHP A;  3KWL A;  1J7C A;  3CWI A;  1CJE A;  1T3Q A;  2W54 A;  2BB6 A;  4C80 A;  1SBB B;  3VQI A;  4A55 A;  4MM3 B;  1RFK A;  1P7F A;  3B2F A;  1PFD A;  2KMM A;  3TEW A;  5EE1 A;  5MPO A;  3AV8 A;  2SAK A;  2ZW0 A;  3IAM 1;  1GAQ B;  3MP9 A;  4P16 A;  4TSS A;  3HUI A;  1ZDX A;  4DXG A;  1ENF A;  2K22 A;  2OED A;  2OHF A;  1V1P A;  2ACZ B;  4N58 A;  4NAW B;  1SE4 A;  2PLP A;  1L6U A;  4REZ A;  1I4X A;  1XLP A;  2LMC A;  1JCK B;  1EU3 A;  3TUO A;  4XWW A;  1QF6 A;  1B9R A;  2NMQ A;  2LFI A;  4KKI A;  3FC4 A;  3J9C A;  1NYR A;  3U7Z A;  2WNM A;  2L32 A;  4HRS A;  1N5W A;  2QIL A;  2AQ1 B;  4J3O D;  1XLN A;  4JE3 B;  1FNV A;  2INN E;  3NUH B;  2JX5 A;  1ET6 A;  2M0A A;  4UDU C;  1E7P B;  2WXI A;  1HZ6 A;  2X38 A;  2RMM A;  4RGT A;  2DBY A;  1C79 A;  4ARI A;  3FAH A;  2ON8 A;  4RGO S;  1D5Z C;  1FCC C;  4AQ7 A;  2WQY B;  2Y3A A;  3PO0 A;  4IDI A;  1N63 A;  2WU2 B;  4XDC A;  3ZGZ A;  4XWT A;  1JQ4 A;  3AE2 B;  1ET9 A;  2PIA A;  1C77 A;  1TS2 A;  2JYT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...