3NS1A

Crystal structure of bovine xanthine oxidase in complex with 6-mercaptopurine
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
164
structure length
164
Chain Sequence
TADELVFFVNGKKVVEKNADPETTLLAYLRRKLGLRGTKLGCGEGGCGACTVMLSKYDRLQDKIIHFSANACLAPICTLHHVAVTTVEGIGSTKTRLHPVQERIAKSHGSQCGFCTPGIVMSMYTLLRNQPEPTVEEIEDAFQGNLCRCTGYRPILQGFRTFAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Xanthine dehydrogenase/oxidase
publication title Substrate orientation and catalytic specificity in the action of xanthine oxidase: the sequential hydroxylation of hypoxanthine to uric acid.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 39
structure length 164
sequence length 164
chains with identical sequence J
ec nomenclature ec 1.17.1.4: Xanthine dehydrogenase.
pdb deposition date 2010-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 3ns1A02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3ns1A01
1NEKB 1DGJA 4WQMA 4HROA 1WRIA 1E6EB 1L6VA 3L4PA 3AMZA 1ZP0B 4P6VF 3NVZA 4WWMA 1JQ4A 1JW9D 1KFYB 1NENB 1PFDA 1RWSA 1QOAA 1IUEA 3B2GA 3DWGC 4US8A 2L83A 3P4QB 3P63A 5C3JB 3AEBB 3W5VB 2MJ3A 3CWIA 3P1MA 1FFVA 2M19A 2Y5CA 4N59A 5EE1A 3WCQA 2BS3B 1FIQA 2WQYB 2EKIA 2AX5A 1XLPA 2K22A 2H88B 1E10A 3W9CB 1A70A 4N6EB 1RFKA 3BIID 1ZXIA 3ETRA 1L5PA 3AB5A 3HRDD 3CIRB 4YSYB 3B2FA 1JRPA 2ACZB 2MJDA 3AN1A 4C7ZA 1YJIA 1J7AA 4YXDB 1RYJA 3AEGB 1FXIA 5G5HA 3AE4B 5EE3A 1T3QA 3VR8B 2CJNA 1OQRA 3PO0A 1QOFA 4ITKA 1AYFA 1WWTA 1QT9A 2MJEA 1DOYA 4JX1C 3AE2B 1N5WA 1J7BA 2JX5A 1V97A 3P4SB 3HVZA 2WDQB 3SFDB 4C7YA 2PKOA 5H8YE 4ZHPA 1TKYA 2CU3A 1DOXA 1VJKA 1QOGA 5EE0A 3SR6A 1TYGB 3EUB2 1YQ3B 2BS4B 2H89B 4FXCA 4ZOHC 2B76B 3P4RB 3AE9B 1QLBB 4C80A 2WU2B 5H92C 1NI3A 4JWSC 1AWDA 1ROEA 3W5UB 3ABVB 1FRRA 1XLNA 3FC4A 4YTMB 1E7PB 4ZHOA 1PUTA 2W55A 1DOIA 4YTNB 2WS3B 4YSZB 2MH7A 1TJEA 3AEFB 1GPXA 1FFUA 1FO4A 3AE6B 2G1EA 3AE8B 1FMAD 1TKEA 4JWUC 4KX6B 1VLBA 5EE9A 2M56B 1QOBA 2CJOA 3VR9B 4US9A 3VRBB 3RPFC 3NVWA 2WP9B 3DWMA 3KWLA 1FRDA 1XLQA 2PIAA 3ZYYX 1N60A 4USAA 3B9JA 3NRZA 3AH7A 3AEEB 2L52A 2JQRB 5AUIA 3HUIA 3LB8C 2KAJA 1NYQA 3AV8A 5AUKA 1NVID 5G5GA 2KMMA 2W3RA 1RM6C 2OHFA 1QF6A 3AM9A 3NVYA 2FBWB 4N58A 1CJEA 1VDVA 1YQ4B 2K9XA 1L0VB 2N0SB 3FAHA 1R7SA 2WU5B 2W54A 1JALA 1SF0A 2E3TA 1V8CA 2BT6A 3AECB 1WYGA 3NS1A 1N5XA 1JROA 1PDXA 1SB3C 1FM0D 2W3SA 4HRSA 1OFFA 1WGKA 1N61A 1EWYC 1E9MA 1KRHA 1XLOA 1YJJA 2WDVB 1B9RA 2QIEB 1F0ZA 2WLBA 1N63A 1XO3A 2QJLA 1J7CA 1FXAA 2LEKA 2PVOD 3AE5B 3AE1B 3P4PB 1JWAD 3LXFA 5GXGB 3SFEB 2WDRB 2DWQA 4YSXB 1ZUD2 1TKGA 1KF6B 4LTUA 1I7HA 1N62A 1WXQA 1GAQB 4YT0B 1JWBD 1SIJA 3AEAB 5C2TB 3NVVA 1OQQA 2K5PA 4YTPB 1ZOYB 4A9AA 2DBYA 5MPOA 4IDIA 2HTME 1E0ZA 1CZPA 1L6UA 3AE7B 3AE3B 3VRAB 2BS2B 2PVGC 1UWMA 1NYRA 3AEDB 2Q5WD
chains in the Genus database with same CATH superfamily
2WAQC 1PVQA 1TS5A 1BNOA 3HHMA 1ZP0B 3JPTA 3THVA 1D6EC 4IQTA 3ZVVA 2FCNA 3M63B 4K7WA 2FE9A 2LHTA 3SAFA 2WXFA 1FNUA 1SV0A 4DHZE 9ICFA 4LDTD 5ALVA 2PE6B 2XY6A 1ZQBA 2K8BB 4OJ6A 4MJSA 4QZCA 1LGRA 1T0YA 1E10A 5KNIA 3KW5B 5DPWA 2KNJA 1R4NB 3OSNA 4K3CA 1L5PA 2ZPNA 4KLGA 2HMXA 2O2VB 5G5HA 3AE4B 3W1SC 4QZIA 4LLGM 4UB3A 2N9LA 2BF8B 1EXNA 3MR2A 2LVPA 1LKYA 3OHAA 5L1LA 1NKBA 1HUOA 2HJ1A 5H8YE 1PUZA 7ICKA 1SKSA 4DQQA 4HYKA 2KQSA 5E6JA 4Y2XA 1Q1OA 4BVUC 1SV4A 3IV6A 1MQ2A 1ZD3A 5IIOA 4ECXA 4QZBA 3SYZA 3PNCA 1SXDA 2DZKA 4RQMA 2K8CB 2J0KA 5AZGA 4NJCA 4ZHOA 1O08A 3BQ7A 3AEFB 1L7OA 5I4DA 1C9FA 5D49A 5D46A 3V61A 2JH7A 1MQ3A 2BPSA 4EBCA 4OZBA 2VZKD 5AKXA 5DG7A 4OJOA 2EQYA 2MBEA 3DBLB 2PIAA 2FPLA 2RDGA 4J9PA 2C22A 5AUIA 4R8UA 2N1WA 3JPOA 4G0NB 1XQQA 4IC7B 4ZDVA 3IAS1 1C3TA 2D2QA 3PS6A 5FP0A 1ZQLA 5IILA 4DWFA 1KEJA 4ECTA 2M17A 4XA5A 3KHGA 1JWUD 3WKEA 3Q3NC 2G08A 1A5RA 4M0WB 2KICA 3ZKJC 4XC2A 1WGKA 5DLFA 2AU0A 4PPXA 4PGQA 1WG8A 1TIFA 2PI5A 1MJDA 2QB1A 2RLTA 8ICTA 3ZDCA 2XGQA 2JWZA 8ICQA 4YTPB 5KFDA 5ALLA 3G6XA 1E8XA 3QK0A 5LNK1 1WXSA 5CRXA 2A3VA 3AE7B 4U7CA 3GDXA 1BT0A 2WXHA 1ZQQA 1L4ZB 3GFKB 2VJ5A 5ALHA 3UIPB 2L7RA 4ECQA 3RB0A 1HXYD 2XY7A 2WX1A 2EH9A 1L6VA 3PRPB 3CYMA 4CDGA 4WQMA 4GDLA 3VUXA 1KJTA 1NENB 2Y0SC 4IM2A 4E71A 1D5XC 3SAGA 3IRUA 1S1QB 2J52A 4KIKA 3ZNZB 1WGYA 1R4NI 5KFCA 4J9MA 4UAWA 2OWOA 2A1JA 5E6OA 2BB5A 4DBGA 5KFZA 4KSKC 3FKYA 3PSEB 2RRDA 3ZTDA 3R8BA 2N7DA 9ICHA 2WXJA 2BQ3A 1RYJA 3V6KA 3NRWA 1WCLA 1L6NA 1SXTA 2BBCA 2F8KA 1TAMA 1I4PA 1DGSA 1V2YA 4C4VA 3HP6A 9ICAA 2FE8A 5HP4A 3RNGC 4WAFA 2EZZA 1ZQKA 2K4EA 2G4SA 4YR3A 1YX5B 3UXNA 3RR8A 3A9JA 3D2NA 8ICCA 5AZHA 3OJ4B 3BYTB 1Z00B 2QDFA 1VJKA 2H89B 4B9TA 2C5LC 3A4SC 4A55A 2G9HD 4DK5A 3H8SA 1KLNA 1TE2A 3Q3OC 1NK6A 5DGBA 3ABVB 2KTRB 1E8WA 4YR2A 1FD6A 4ED7A 2XK5B 2DYOA 4K1RB 4ECWA 4B0MA 3LJ3A 2W11A 1A0PA 5ALWA 4PHAA 2GRIA 1ZYQA 5D6JB 4BKTA 7ICSA 3DBLI 1TS2A 3ONNA 4DHJD 2UVUA 2J7QB 4A6QA 1KBUA 5KFVA 2V3SA 4GIVA 1C79A 2FJ6A 2GBNA 2D6FC 2NRWA 1NOMA 3Q8BA 3CW2C 5AKHA 7ICIA 3AU4A 4HCNB 7ICGA 2KMMA 1RM6C 9ICBA 4AQ7A 3AEVA 1FEZA 1F9JA 1LV5A 4ZYNA 3URYA 3X23A 4KLLA 4P0QB 3QU4A 3CNHA 1X9SA 4Q2JA 2IY1B 2WDTB 2PFOA 1WYGA 4LVSA 4HLEA 3H0MB 5BOMA 3HWTA 3N9YC 1S10A 2JRIB 3WKBA 4BWMA 1OEYJ 4WJQA 4ZRKA 2NYVA 5F9NA 2AJQA 1PZNA 1MFWA 1YNTE 2KFKA 3LDZE 1E9MA 4Y2RA 3RNAC 2INPE 1L8OA 4MHVA 5KFIA 2ZIXA 2DL0A 2YVCA 1IGDA 1WZ3A 1V80A 1ZQ1C 3I28A 3MGHA 5DGAA 4LTUA 1WIAA 3DEEA 1Z1VA 4P7IA 3OJSA 2FCQA 1XC9A 2Q4TA 3IT4B 2V9HA 5EWFA 3DBRB 1NDDA 2MLBA 1JCKB 3RD2A 4QZFA 2B21A 2JH1A 2AL3A 1N48A 4LJXA 2XBBC 2YLMA 4ELVA 9ICEA 2LJ5A 1E6EB 3AMZA 5D7GA 2YMLA 3GIKA 2K8BA 4QIWC 4J9LA 3ORYA 5ALFA 1NBFC 4P4PA 4WAAA 1QKZA 3QEBZ 2IOFA 1KLGD 2O6KA 3B0YA 2BPCA 4NLNA 2KK8A 2O2VA 1KW4A 2AL6A 2XGPA 1NJZA 7ICFA 2JEJA 3C28A 5KFXA 3R3MA 3AU6A 4W9KA 1H38A 4ZRJA 5JU5A 2ISOA 3GZNI 1ZQMA 2ZJ5A 5KG3A 2OH2A 3GZFA 3RB3A 8ICPA 3U30A 1EM7A 2DENB 1ACCA 8ICGA 3GILA 1E5WA 2Y1JA 3AULA 4FJZA 2VIXA 3Q8QB 2M0AA 5AI9A 1E90A 2JX5A 3AU2A 3SFDB 5AKZA 2WDQB 4C7YA 4M9HA 3Q2AC 1Z3EB 4A20A 1D5MC 2K8CA 2Y9TA 1DOXA 1YQ3B 2KN5A 4RF0A 2AQ3B 5KG6A 3P4RB 2V0GA 3MJ5A 4RNAA 2PI4A 4YTMB 1E7PB 4JPSA 5KFHA 2ASQA 3KHLA 1U49A 3GS2A 3V62A 2MH7A 4UB4A 5AIBA 8ICYA 4GDKB 3PSTA 2JUOA 2BKEA 5AK3A 3DOWA 1PQSA 3HIZA 4GMVA 2KZMA 3MBYA 5DBAA 5F9LA 1K1QA 5KFKA 1Q3UA 1N60A 4USAA 1I4GA 3KUZA 2KOBA 1F2RC 4G9BA 1WGHA 1WX7A 5AZFA 2KN4A 4F5QA 1MSWD 4YN4A 4D2KA 1UT8A 4G3IA 3EFCA 4DOAA 2NBWB 3TKAA 2MQJA 5JXVA 4I2DA 2KK0A 2FBWB 2ZCBA 2QARB 1JMSA 4ED6A 1GUAB 1I42A 2JXXA 4F4YA 2JHDA 2EAPA 3MC1A 4M0WA 2JEFA 4DL2A 4RNMA 3H1UA 1T94A 2LYBA 1RG6A 3ZJUA 2HHUA 2JZ3B 4JIOU 2VA3A 5IN7A 1N5XA 5ALGA 2AYOB 2CHXA 5KFLA 4KGTA 4LNOA 2YB4A 3MABA 1HTQA 4IRKA 3H8MA 2E6XA 4ECSA 1EWYC 4UAZA 1XLOA 3VTWA 5ALTA 1OTRB 3C5GA 2IBKA 3QX1A 2EDUA 4HDOA 3Q3MC 3V60A 2LVOA 1V5TA 4O3OA 2K6DB 3WAMA 1TAQA 1C4CA 3KH0A 3AQFA 3IXSA 3BY4B 2FUG1 2Y5PA 1T3NA 1ZPSA 2D3DA 1BUIC 2I5HA 1CEZA 2L1AA 3RJJA 1AW7A 2C2RA 1S8OA 4ECRA 1KH0A 3BQ0A 3TEZA 1E0ZA 4M2YA 3PZDA 2KJHB 3O13A 4ANXA 2E8MA 1Q8KA 4P6VF 1L3UA 3NZUA 4MH8A 1WWUA 3H40A 1Z19A 2P66A 1T0QC 3PTFC 3DWGC 4ZRPA 2MJ3A 1IM4A 1TFRA 2LYHA 1COKA 3QCAA 1CRXA 1FFVA 4FHJA 2IO3B 2RDHA 3WK4A 2KN7A 4FO6A 4B9SA 3HPOA 2R8KA 1XCQL 3QXGA 4OW0A 4TQ0A 2W9CA 3AB5A 3C29A 4PS8A 2ACZB 3TEXA 4DOBA 3AN1A 2FMSA 4YXDB 4NV0A 5IOIA 3UGBB 3UXOA 3DBHB 4NQLB 5KFOA 2BQRA 3E9SA 2YX8A 1X6JA 1KKXA 2MWSB 5AICA 9ICRA 1Z00A 2ZUCA 5KFGA 1RYRA 2EZYA 2W7PA 4DFKA 1SKRA 1ECWA 1GO3F 1ET9A 3TACB 2LGIA 3NUQA 1HZ5A 2Y5BB 4QWDA 3VQIA 3ZLZA 2KTRA 3OG5A 3F5AA 2XK5A 2LGXA 3M95A 4U6PA 3KVFB 5HHDG 3P42A 4KGRA 3M7DA 5ALYA 4Y2PA 4Z6EA 3ZDEA 2KJ8A 5AKEA 4LZDA 2WS3B 1GPXA 1NKEA 1ZDXA 2BR0A 1RAXA 4QZDA 1LVHA 1SE2A 4JV0A 3SEBA 3HVDA 3U52E 3OSPA 2XVTA 3ICXA 3W1SA 5DPSA 4XZ4A 2LRUA 2WP9B 4K3BA 3WK6A 1UNSA 2PMVA 1JI7A 1TGZB 5LXIB 4AYBC 2LM4A 3D2QA 4KLHA 2ZIWB 4E3CA 5AUKA 5T8IA 2UVRA 5ALDA 4P0QA 4RU9A 1B0XA 4KKJA 4C8MA 3IG8A 4O3NA 1CJEA 5CA7A 2LUEA 3ZNHB 3DVGY 3TQ1A 1L0VB 1WYWB 5KT4A 2DAFA 2WTFA 2CHZA 4ZH4A 3FAHA 3TCAA 1EF5A 1FPYA 3U2SC 5HNKA 1C1YB 1C7YA 2WF9A 4I6NB 4EEKA 2JYEA 3KD3A 1L5UA 2ZVOA 1V1OA 3NHEB 4I2FA 3PX6A 3RJGA 5HG2A 3K1ZA 4FZMA 4I2EA 4KDLB 4UAUA 2WDRB 3TSSA 5D94A 1WE7A 5CJ7A 4DCCA 4B9LA 1V9JA 4F71A 8ICUA 1WCNA 4KV2A 4EENA 2V1YA 1QSSA 7ICPA 3O0FA 3NVVA 4ACOA 2HOQA 4AUQC 5CB1A 5EWEA 5G2NA 1L6UA 1J2MA 2GMIC 1PK3A 3AE3B 4EKUA 4RQ8A 2MA1A 1FXTB 4M6WB 3H0LB 9ICLA 2HI0A 5KL8B 1NK8A 3L4PA 1DK2A 2HBJA 5GTHU 8ICSA 2GI9A 2INDC 1RWSA 1IUEA 4US8A 2AQ4A 4W9DA 1IP9A 4QZGA 4IR1A 4NLGA 1MI0A 2RDJA 1WJUA 3BJYA 3M9OB 2GOWA 4LJPB 4WJPA 3M6ZA 2Y5CA 1NNLA 3GP7A 3T5HA 3P2BA 5D2MB 3BK2A 4O9MA 4RM9A 9ICTA 1SGGA 3BDPA 4M8NA 2PFPA 3NZSA 4WIPA 4R66A 3RNEC 4FJVB 3H7IA 1S0OA 3CIRB 3EZ5A 2MJDA 3L54A 2QSDA 3M62B 2MRPA 3IHPC 4DXGA 3EECA 2R61A 3NS8A 3TANA 2CJNA 5HMMA 3BS5B 3MFHA 4KMUA 2DZMA 4DFDA 1C4AA 3N28A 2FMPA 1J7BA 1Q5WB 3RAXA 3P4SB 5AKIA 7ICMA 3QZ7A 2PKOA 5TZVA 2YB1A 1TKYA 1C77A 4DFJA 4C0ZA 3TADC 1RLFA 4GDLB 2IHMA 5CP2A 3IG3A 2DNFA 1UH6A 4CQNA 2JZZA 3UIOB 2KX3A 4F91B 2I38A 1J97A 2ZJDA 2J0MA 2UYZB 3QEAZ 4A3PA 2R18A 1DOIA 3B0XA 3ENEA 4WURA 1FFUA 2K25A 4JWUC 3N97B 2HHQA 3NY5A 2KIVA 1K5OA 3V7JA 1I4XA 1K50A 2K4PA 5DQGA 1WFYA 3TFRA 1YQBA 8ICFA 2GBKA 4MGKE 2PMZC 4MGZE 2HW3A 2QB0B 1WZ0A 3QA8A 2F8LA 3EHVA 4CE6A 4ICAA 2QARA 5KFUA 2DZJA 2FLNA 4G50A 4J6IA 4P1CC 3GIJA 5DPTA 5BYSA 4QW9A 1NZPA 3IP4B 4JL9A 2L32A 3BK1A 3R66C 2HBMA 2D07B 1WXVA 1V5OA 1V81A 2QEJC 3U7DA 4P0PB 2OXOA 4C4SA 7ICEA 4HXDA 3C2MA 1V9PA 3QNMA 1D8LA 1JALA 4UATA 2E3TA 2BKFA 2OM6A 3V6JA 8ICHA 3UQ0A 4DSIA 4FBTA 4HJGE 1JXLA 1WI0A 1TY2A 1G6JA 1V38A 4OHJA 1TKDA 2KHVA 2I9GA 1XEEA 2KWCA 2WB1F 1N61A 3SV4A 1IXRA 4IL6U 3E56A 2ZXHA 2BDUA 4YSXB 2YMMA 1X42A 2F3NA 1D8YA 2DWQA 2KFJA 1XSLA 1XF5L 2WHIA 5J0UA 1D4BA 3L3FX 2TSSA 1F2RI 1GB1A 3QX7A 5ALJA 4WJ3B 4OJPA 3ISBA 3C0RB 4WJOA 2BGWA 5L1MA 2FNJB 3PV1A 4B95A 2H3VA 4BAXA 4Q43A 2KD0A 1BPYA 3I9V1 1PK1B 3GV7B 2J6TA 1UBQA 2KANA 5ALIA 4P4OA 5J2KA 3HKZC 4QWCA 2J6UA 5JUMA 1PFDA 3I5JC 1BPZA 4RNOA 1X9MA 2L83A 4NY8A 3QIJA 1ZQAA 1EO6A 2RGFA 3X0WA 4DEZA 2WXMA 3P1MA 1KOTA 2ESEA 5AK5A 3ZDDA 1ENFA 1MG8A 4DXAB 1L2NA 1MN8A 1QQ5A 4MEYA 1HA5A 2WXPA 2WYQA 3JPNA 4MGIE 3RJFA 4NWIA 4DS4A 4EEYA 4DLGA 4EZJA 5BYRA 1Z1BA 1OGWA 3H8HA 3JSVB 4B9KA 4P2HA 4NQKE 1Z5SB 4O3RA 1OQRA 2KMCA 4ITKA 3MDAA 1JX4A 1X9WA 5AKJA 4F4WA 4I29A 3AE2B 7ICJA 2L8JA 3HVZA 3V05A 3WK7A 2HSZA 4PGXA 5A0LA 5CHGA 1TTNA 3DVNV 3UMCA 2HHXA 5FK9C 1L7NA 1V85A 1NI3A 4F8CB 4KLFA 4GXKA 4PH5A 3KQ4A 4O1NA 4NJ8A 2C2EA 2KJ5A 9ICNA 1FRRA 1VZ7A 3Q14C 1MHXA 4BKSD 3SHQA 3RULA 2Z59B 2D11A 1WX8A 2NO5A 3T5KA 3RB6A 1NZBA 1P98A 1DXSA 1A6SA 4EZ9A 4W9LA 2PXIA 2M56B 1CMXB 3UF8A 1NK0A 4US9A 7ICRA 2CR5A 4ED8A 1WJ6A 2ZIWA 3VXWA 2A1AA 4NLZA 4O3QA 2BCUA 2W9AA 1U47A 3W2DA 1KTQA 2JQRB 2AGPA 4K4IA 5KFFA 2HDEA 3LK9A 3NZ3A 3KKAC 4L23A 3Q8MA 1RDFA 4NL9A 4J9KA 2LWPA 2PFNA 4HPMB 1QSLA 1YZ7A 1PGBA 5IIJA 3HM6X 4II3B 2WXOA 3L10B 5B66U 2R8IA 4LNIA 1U4AA 1F44A 2EZXA 3M9MB 1SL2A 2D3GA 1XNSA 4YXMA 2MA9B 3NS1A 3NTUA 3J81j 4KN7A 3BQ2A 1FM0D 4QZ8A 4XX5A 1RYUA 3QUQA 1B9RA 3KWVA 2QJLA 4M47A 2F1HA 1TV9A 2KSOB 2JVCA 5BMIA 4MSQB 2LZ6A 4B9MA 2ON8A 3L08A 3LDAA 4BUGA 1WXQA 2C7MB 5KAIU 4II2B 4M01A 2K5PA 4M6WA 1ZOYB 3N1YC 4TQ1A 3E0FA 3Q69A 2BDPA 1UA1A 5AI5A 2G4DB 5L1KA 4AWJA 2IA6A 2JZPA 1L3VA 1Q10A 2BVCA 3RAQA 4M00A 2JXTA 4WWOA 5TSSA 1DGJA 5HHHA 2LI5A 3TEWA 3CF6E 1QQ6A 3OJ3A 2D5GA 4C4TA 1NI2A 4RGNA 3GIMA 1GC7A 3P4QB 8ICLA 5KG0A 4RQ1A 2RD0A 5ALZA 5HFYA 2KDMA 3IVFA 1YN4A 4FJYA 2N9PC 3EFUA 3SZ2A 1ET6A 8ICEA 2KKVA 2AX5A 3I63C 4KLUA 2HBKA 2LASA 2F2AB 3M9NB 1BPDA 3KUDB 2BYTA 1F5SA 1KFTA 2FIDA 1U9LA 3BS5A 2IZVB 4DQSA 3SI8A 1FXIA 2L3ZA 3A0BU 4QJFB 1OQYA 5C5JA 2KD1A 3UXPA 4BFRA 4TV3A 5HR7A 2M0NA 2DAJA 2O6VB 2KVSA 4QNLA 3DHGC 3WIMA 3HILA 2ZG6A 4REZA 1D8BA 3CMMB 4JX1C 5J2IA 1BGXT 2ZTCA 4MSMB 1BNPA 2MCNB 1TS4A 1QOGA 3PLVA 3ZIMA 4RQ0A 4F4XA 2MUTB 3QARA 2CHWA 5IKCM 1UBIA 5KHOA 2JRHA 1LO5D 3V6CB 3N7SC 3RJHA 1TJEA 2WXRA 2MBHA 2LHEA 4BWJA 4Y2TA 2W9CB 4KX6B 4QW8A 2KWUB 2AQ2B 2ICIA 2QB0A 4A3OA 1ZQCA 2ASJA 3PZ8A 1E8YA 2BB6A 4A8XC 3DWMA 3GZNB 4ZRIA 1RXWA 4IW0A 2WF6A 7ICOA 2FLLA 2I1KA 3ED5A 3MFGA 4IWPA 4P0PA 5KFTA 2G09A 5LXHA 2IO2B 4KVGB 1ZQOA 3Q8SB 2JGAA 4EFOA 4KDIC 1ZRNA 2WF8A 3RNCC 2ODGA 3G6VA 4BX9C 2N4FA 2ZZPB 5AKGA 4KN4A 5DG9A 4E74A 4BBNF 4O3MA 2HHWA 5J0WA 1WM2A 3CRXA 2LI6A 1WR1A 2OCEA 2WWZA 4L1BA 1GB4A 2KTFA 1P7DA 3WKCA 4I2JA 2BKRB 4TQRA 2MW5A 2V4IB 1JN3A 2DUYA 1Z2MA 3ZJTA 2LKYA 4HJKA 1XO1A 3SFEB 1SL1A 2KHQA 2J53A 1U4BA 2HD5B 3H6NA 3R9KA 3MC8A 2EAMA 1ZUD2 4HPLB 2EKEC 2KC2A 3APDA 4GLSC 2F44A 2F1IA 2OYYA 3ZW3A 3IT6B 4YCXA 3ALRA 3ZXRA 5IINA 2KVCA 2K4HA 2BCRA 3L5KA 1PK1A 4Y2VA 2ZUDA 4EE2A 4PT5A 5DB6A 3SENA 2KZ3A 2XIDA 2DBYA 3ETLA 1KRPA 5ALXA 4ELTA 1VD2A 2HTME 2NR2A 1TVAA 3OLMD 2C7HA 4HPPA 4IDIA 1CZPA 2LXAA 3VRAB 3CP8A 2L76A 1ZQXA 1KQQA 5J2CA 4KLOA 1NEKB 2J42A 3IFWB 3RT3B 1I35A 1P1AA 1KLVA 2BYVE 2CKHB 1LM8B 1LXDA 5AHXA 3KLSX 1FCLA 3ZNID 5C3JB 4C8LA 1ZXHA 2B6GA 1M4VA 2WFAA 3BZDB 2MHJA 4RPZA 4TUQA 3WCQA 3F2BA 3ZO5B 2RDIA 5AM5A 3ZJVA 2EKIA 4EYIB 3BWUD 3JSVA 4M8MA 5BPCA 1UZXB 2IY0B 1RQLA 3ISDA 3HRDD 3RJEA 3PX4A 5AKKA 3HK0A 1OW5A 4JUZA 4P4MA 4FA6A 3V6HA 1E7UA 3PGEA 1NKCA 3IHQB 5DB7A 3APCA 3DDCB 2H3FA 3T5LA 2K89A 2OJWA 7ICHA 1WWTA 4HK2A 5GTIU 4NPNA 4TUSA 3VCBA 4I27A 1JWMD 2CU3A 1I4RA 4W9CA 1AROP 4PGYA 1P7FA 1QLNA 2WU2B 2G06A 2JU6X 2EELA 3JVZX 3RRHA 2JR5A 4GXIA 1OEYA 3QQ8B 4NLCA 3J9CA 2W55A 5DB8A 1N6ZA 1Q3VA 3AQEA 2XCPA 4BXOB 1WGGA 1KSPA 3TL5A 5KFPA 3F2DA 3RBDA 2NBVB 1Z4NA 4K7UA 4WWNA 1SV0C 1D3ZA 2XC9A 3JPRA 1NK9A 5E6PA 1SIFA 9ICVA 5TR5A 5KFQA 2G3QB 5KTQA 1JXEA 3WK8A 3KWLA 4HKQA 4EBEA 3VUWA 1ZQZA 1IV8A 4QWBA 5HR6A 2FUHB 3ZDMC 5ALNA 1SWVA 2MX2A 2UVWA 4DSKA 2E5SA 3NVYA 3TADA 2FPMA 3RH4A 2K9XA 5HKHA 3ZGZA 3SQIA 1S0NA 2LD9A 4PZNA 4GXJA 2YMQA 1IBXB 3LYYA 4CCHA 4AP4C 2W54A 1V1PB 4RQNA 5L95C 3PSPA 8ICJA 3E58A 4W9HA 1WRDB 2KSOA 5AM3A 1FCCC 5ALPA 2LGSA 2NMQA 4RM8A 2A4ZA 1FXAA 3ZDAA 2IYDB 1B1ZA 1JWAD 3DHHC 3JW0X 3QC8B 5CHFA 4EZKA 2ZIUB 3QUCA 3T79A 3CSFA 2Y1IA 4JLCA 4KSLC 4W9EA 3VFKA 3EPIA 2JPHA 3H0RB 2RHFA 3WANA 1ISNA 5HI1A 1ZQNA 1X6IA 1U45A 3H9DA 5MPOA 2LGDA 4PZOA 3Q8PB 2KX0A 2YEPB 3M8SA 1VR9A 1VZ6A 4RNNA 1ZQEA 3WA0A 2RDBC 3E2EA 3WKAA 3KTQA 4EBDA 4OZCA 2W9BB 1KN5A 3MDCA 3RR7A 4DL5A 2HHVA 5CTRC 1KL9A 3Q8EA 4W9FA 4NJ7A 4XUSA 3NG0A 2KKCA 1WY8A 4BZAA 1YN3A 1FIQA 2WQYB 4KGSA 4YXJA 4GC7A 1ZKHA 3M1YA 3LWMA 5L83A 1XT9B 3LVVA 2CS4A 2R2QA 4EEWA 2L05A 3B2FA 4YL8A 4LDTB 2XCAA 1V6EA 2C7NB 2L5YA 3KYCD 1J7AA 2JT4B 3KOOA 2O6VA 4IQUA 5CHVC 4ANUA 5FR3A 1S5LU 3V7KA 2REXA 1WM3A 4C00A 4JE3B 5KG2A 3S2AA 3M8RA 4IUMB 3U26A 4J9NA 8ICMA 1R4MB 5D4BA 1PVPA 2HOFA 4MACA 1OUQA 5J0PA 3K9OB 2M8SA 3RYTA 1B43A 4IQVA 1N5WA 3RN9C 3AUOA 2MUTA 3LYSA 1DRGA 2M4NA 1XSPA 3IM1A 2GWSA 4OVZA 5AM2A 5CWRA 2BS4B 4LCDE 4ZOHC 1TZ1A 1SSNA 5KFBA 4IRDA 2RPQA 4PYUA 1A76A 3EGRA 2IGHA 3MHZA 3KHRA 1WXAA 1C78A 2Z8LA 1L7YA 4RPYA 2WX0A 3TMPB 1E8ZA 4KLSA 4F72A 3RH6A 5ALOA 3M6KA 3ZDTA 1SE3A 1QOBA 3D32A 2CXYA 2PJHA 2F76X 3L16A 2LVQA 4O3PA 3ZYYX 2ZW0A 3AH7A 3ZRFA 3HUIA 1UPHA 2QCZA 1WXMA 2VZKB 5G5GA 2GLSA 2AGOA 2OHFA 1Q0WB 4M9LA 5J0YA 4UBCA 4G11A 1WGDA 2MU2A 2PFQA 2R8GA 1SF0A 4IWQA 7ICUA 4KLDA 3SEIA 1WR6E 1JROA 3RTVA 3H4BA 4UDUC 1SB3C 5AI4A 2EMTA 1CUKA 1KRHA 2V3PA 4KMOB 3T3FA 3IN5A 3TBLD 4ACFA 4ANVA 3N32A 2LEKA 4ECUA 1UELA 2YY6A 1MPEA 2RSUA 2A5UA 3VH4B 5ALEA 2KJ9A 1S76D 2OEDA 4KKIA 1SE9A 2BQQA 2V4LA 2WXKA 2RP5A 2KFNA 4DHZB 3KKAA 1SIJA 1YJ1A 4HVBA 2IOFK 2WXNA 4HWIB 1AQ6A 3ML9A 4DFPA 2WXGA 3EA6A 2BS2B 2L00B 2HOIA 2K0PA 1WRIA 2H3IA 1URJA 2K8AA 3B2GA 3P63A 4MF2A 3AU5A 2PTLA 5EWGA 3R7RA 1Z4OA 4PHPA 4OCZA 4CF5A 4RT3A 4NXZA 2WHEA 2FIFA 3I57A 2BS3B 2BZFA 4Y2YA 3RRGA 4I6LB 3VTVA 4DL3A 1YD8U 1JIHA 1WF9A 1TZOA 4YSYB 4B9NA 1R4MI 3PW2A 1T0RC 3RJKA 4GN1A 1ZQPA 2GH1A 2ZJAA 2HJ8A 3AEGB 4ASWC 4JB3A 3VR8B 2WAQF 5IAAC 1K1SA 1WH3A 4DXFA 9ICQA 2LUMA 1QOFA 2IOHA 4XDDA 1QT9A 1IYFA 3DBSA 3R7QA 4FZLA 3V7LA 1H4RA 3PY8A 5HMLA 4F5NA 5KFEA 3RJIA 3T5JA 5KT3A 2KDEB 4AJWA 4GSWA 4RCOA 3QU9A 2V4QA 3GU3A 5J0XA 1I4QA 1P7EA 2N7EA 2XEWA 3NJTA 2HDOA 1T4GA 3A4RA 2MRLA 4BXOA 4KLJA 4HKZE 4XE0A 5J0TA 4R65A 3C19A 1T8EA 4FLHA 2HVHA 2ATLA 5J2HA 2KIWA 7ICLA 3VUYA 2G5HB 4YTNB 1ED1A 3AE6B 3MR3A 3UPQA 4LNFA 1VLBA 3N1XC 4DSJA 3PLUA 4Z6FA 5AI0A 3GV8B 1DOQA 3C8YA 4FBJB 4MT5A 9ICGA 5L1IA 3RMKC 1S0MA 3NRZA 2DYBA 2L52A 3LB8C 4DHJB 9ICXA 1ZRMA 1QILA 4IR9A 2K1FA 4F3OA 1F52A 2KZZA 1IBXA 4QWEA 2KTQA 3MR5A 2HHTA 4NLBA 3RB4A 1V1PA 3Q8RB 2WXQA 1WWVA 8ICZA 8ICXA 3OPXA 4FFDA 1ZQTA 2NV3A 1X1MA 2PEAA 1XS9D 2OEHA 3VC8A 1S3SG 5AKLA 4QZ9A 1HUZA 2VH1A 4DF8A 5BOLA 3TEYA 1O03A 3NUHB 3QAQA 3ZRCA 2NRTA 4R63A 4F92B 2ZIUA 2ZIVB 3VVWB 4NM2A 1VZ8A 3LXFA 1GJZA 4PHDA 4YQWA 1U48A 3DHIC 2HCFA 1WE6A 4C56C 4NLKA 2KWVB 1FNWA 2SAKA 1PVRA 5AIAA 3PW5A 3AEAB 3L17A 4AP9A 1Q46A 2W43A 3AXCA 3TARA 4N9F4 5C0YA 4Y2JA 1SZPA 2M0XA 2W9BA 3PO4A 2YQEA 1E7VA 3BVMA 1SBBB 5F3XB 2CPRA 2D8CA 3QUTA 3C21A 4S17A 3NVZA 1UHUA 2DLBA 4EOYA 3MC9A 5JHBA 2DPIA 2IGGA 4ICUA 4FBUA 4YWGG 3MTNB 3CWIA 4RGTA 4ANWA 3V3XA 2P6UA 2BCQA 5KT6A 2MP2B 1L3SA 4FS1A 5ALSA 2M1MA 3PO5A 1RZTA 2KDFB 5BMGA 4XWTA 3BS7A 1WJNA 2FAZA 4EYHB 4ECVA 2RMMA 2JY6A 5KFWA 2N7JA 2XICA 2W04A 1JRPA 2MAXA 3FYHA 1KLUD 2JZBB 2X38A 4QZAA 7ICNA 1EU3A 1T0SC 2ONQA 1EF1A 2WF5A 4MFCA 3QHTA 3OHBA 2AHOB 5AEKB 3QU7A 1LQBA 5EDSA 1PGAA 2N1VA 4UB8U 3PO0A 3IDWA 2NRZA 5C1ZA 2Y0SF 1NJWA 2DFLA 4RFBA 4CRXA 3ISCA 2JF5A 2I6XA 4DL4A 2AXTU 4F50A 4ZHPA 3UM9A 3PR4A 3EYZA 1GOZA 4DDID 4RUCA 1MC8A 3EPGA 4UB1A 1QLBB 1CK1A 2AH5A 4MDKE 4DFMA 4DQRA 1ZQFA 3N7PD 4F2SA 3I76A 7ICVA 8ICKA 1PUTA 2P35A 2DQNB 1SGHA 4XGAB 4QZHA 4C8KA 2G1EA 1FMAD 3Q8CA 2ZJ8A 5BO4B 4MELA 2MSED 4AOFA 3ZUNA 2VA8A 2J0JA 5J2DA 4F7ZA 4QAYA 1L7PA 2Y3AA 2E1FA 1XLQA 2RQ5A 4KLIA 5FR6A 4QWAA 3WK5A 3BINA 4Z6DA 2XN9C 2KAJA 1NYQA 3AV8A 2K3UA 2BYFA 2KV2A 3RUIB 3KZIU 2RR9A 3PVLA 1QF6A 9ICMA 1WJ4A 1VDVA 2ZTEA 4AJYB 2W9MA 1NK7A 4K81A 1TBEA 4RQ2A 1ZQHA 2KZRA 4F5OA 1V8CA 2W03A 3UQAA 1Y56A 3BQTA 5J8YC 3HT3A 8ICBA 1YMHE 4A90A 1TS3A 4O0IA 3QU5A 4YMOA 1S9FA 4TUPA 2W3SA 4KX3A 4BGDA 1JUDA 2WGSA 3ALBA 3DVNU 3PHWB 5BYQA 4H2AA 3HX0A 2D3BA 3V72A 4IM0A 4I28A 1KF6B 1WMHB 5B5EU 2MBOA 3TFSA 1PYWD 2JRZA 2JYTA 5AK6A 3UMGA 4KLMA 8ICAA 1ZW7A 3EW9A 4WWPA 2KNBA 2OOBB 1D9DA 3ZD9A 3A1QB 2VA2A 1WSPA 2WXLA 3T9LA 2NS5A 3TUOA 1SJED 4KTQA 2JSVX 1YJJA 4RF1A 3AEDB 4A8EA 1F0ZA 4UB2A 2W82A 2ZEQA 3Q8KA 2BQUA 4IM3A 4FE3A 5DQHA 1JQ4A 2LHDA 3JPSA 2D10A 3SAHA 1H8CA 3C1YA 4KZ0A 2K4IA 4UB5A 5JRTA 7ICQA 2KXJA 3N30A 2AEHA 2M19A 4EZ6A 4XWWA 2KLCA 5E79U 1WUDA 4NAMA 4ELUA 4PL1A 4QZEA 1A70A 4N6EB 3ETRA 1YT3A 4C7ZA 4F4ZA 4RGOS 1KFDA 5EE3A 4OJ5A 4YR0A 3N7RC 5J2RA 3RCZA 2NRVA 3GB1A 3K9PB 3F2CA 4ARCA 1AYFA 4Y2UA 1COOA 1HTOA 4QIWF 5IP4D 1KFSA 1TAUA 3WU2U 1K52A 1V97A 2IBIB 2BWFA 2KEYA 3FILB 5JHAA 4RGMA 1L0YB 2LFIA 3APFA 5KT2A 1L8LA 4DS5A 4M02A 4HAIA 2PLPA 2JEGA 3T3OA 2ZXIA 1T5XD 5J0OA 3QE9Y 4O5KA 2ISPA 5JH5C 1UF0A 3SU8X 4I2BA 2I2YA 1YN5A 4K4HA 4ED3A 2LRWA 2WB1C 4G3XB 2G07A 2BW2A 2B0CA 1ZD5A 1QSYA 3B9JA 5K4LA 3K1RB 3SD7A 3BVGA 4KLQA 3JPQA 4OVUA 2DYMA 3PVXA 1ZQDA 4BKGA 1M94A 3PREA 4J3OD 3W1YA 3ZNGC 1RRBA 2ZNVC 2N0SB 3FDSA 1R7SA 2W9NA 2BT6A 2ZIVA 2OJRA 2NRXA 2E1EA 1PDXA 5KT5A 1QQ7A 9ICOA 3VTUA 4LZGA 3L0WB 3EWAA 5CR0A 3HJEA 2J6SA 3RFZB 3AE1B 3A9KB 1RYSA 2H3QA 7ICTA 2KFZA 3Q8LA 1T7PA 4MM3B 1HQRD 3TI0A 3PRZA 1IG6A 2KOXA 2Z0DB 4FN2A 2L0TA 1DYQA 2NCNA 2H5XA 4DSLA 1JWBD 1I4HA 3DCGA 3NOBA 4MF8A 4F5RA 4I2HA 2AQ1B 4YVZA 2RPVA 5G55A 5ALUA 5KFAA 5L9XA 4DWIA 2KYWA 2N9XA 2Q5WD 1BMLC 2QHOA 4JQWC 3WAOA 2HE7A 2FI1A 4TURA 2YTUA 4FS2A 2MP2A 4RMAA 4CYEA 3ZD8A 3LWLA 2DGZA 1AN8A 4CF3A 3QYPA 2GOLA 1YIWA 3W5VB 3TIXA 5ALQA 5EE1A 1S77D 2GBMA 4ZYSA 2IMWP 3SMVA 2JZBA 1XLPA 5ALRA 3W9CB 5IIIA 1ZXIA 3D2SA 4B9VA 1YJIA 3ECIA 1EU4A 1UUPA 2FPKA 4M9GA 2DF4B 4PJ0U 1ZQSA 1K53A 1JMLA 3PW4A 3U8ZA 3K75D 4URKA 4XDCA 3RF9A 3T3NA 4UB6U 2BHNA 1SKWA 3UINB 2Y9UA 9ICSA 4F5PA 4ED1A 2K60A 3DPDA 5EE0A 2W8LA 3Q8AA 4IWOA 4JV2A 3A0HU 3AE9B 1VJ5A 2IHNA 4C80A 5H92C 5E6NA 2FLPA 2XNAC 9ICIA 1ZDVA 2GO7A 1GC6A 4RH6A 3W5UB 5J18A 3GE8C 4Q44A 1UWXA 1XLNA 8ICOA 3BVZA 1XWLA 3OAWA 2QC8A 3GE3C 5AI8A 3G6YA 5DDYA 1BPEA 1UT5A 3AE8B 5KFSA 3PR5B 4GC6A 2CJOA 2HHSA 3AI5A 3VR9B 3VRBB 4RUAA 3NVWA 2PPHA 5T14A 3D6JA 4KLEA 4PS7A 1ZD4A 4RT2A 1S0VA 1HJPA 2KVZA 4NY0A 2V3NA 5KFNA 4DQOC 2G5IB 1GNUA 4DQIA 1ZQVA 1ZQWA 5IIMA 1SZHA 2CU1A 3WKDA 4K7SA 4NAWB 3ZTCA 2Q0ZX 5J0SA 2C9WB 1J8CA 2KVRA 5ALMA 1LB2B 2DX5B 4EUTA 2DKZA 3AECB 1B4FA 3RFAA 2VH2A 1UQVA 1TK8A 2ASDA 3ZI4A 2IO0B 3GOEA 3QJZA 3RNBC 1L4DB 4YFKA 2XO7A 3T8MA 2A19A 2DZIA 1XU4A 1L7MA 3CSTA 1FNVA 4UAVA 4EELA 2XI9A 2FMQA 1WMHA 4AYBF 2PVOD 4X57B 2G45B 5BMHA 3PX0A 2BCSA 3UI3A 2YMPA 1X9XA 2UVVA 2LM1A 2JEIA 2AWTA 2IO1B 2KACA 1TKGA 3PHXB 4YMMA 2J4XA 1XO0A 3F5EA 3A1QA 3NASA 4JK1A 2NPTB 5KG7A 1F1HA 4E0DA 4R64A 3O65B 2PE9A 1C20A 3RZFA 1P9DU 3BQ1A 3PRMB 2DHZA 4RZRA 3GQCA 1SWWA 3GIIA 4IRCA 2KC1A 3FM9A 3M3JA 2BGFA 1ZJMA 2ZW1A 3R2IA 5TISU 1NJXA 4BDPA 1XD3B 4W9IA 1YOVB 5D3DA 1BPBA 2JV3A 1KFYB 8ICVA 4IOIE 3TAQA 4N59A 1HE8A 1QOAA 2E8NA 5J17A 2KLGA 2ZNVB 4GU2A 5KFMA 3PW0A 4C4RA 4NL9C 5AKYA 1BXTA 3BZCA 3NGDA 5IIKA 1UGJA 3UQ2A 4F2RA 4ARIA 1JRUA 4L2YA 3UQBA 3HW8A 2BWES 4HEA1 2H88B 4F93B 4KX5A 4KZCA 3BIID 5DQIA 1ZQYA 4M0AA 1HZ6A 4LNNA 2MBQA 2KQ4X 2E8PA 3H8JA 2INCC 3OJUA 1ZJNA 4O5CA 3DV9A 3KFUF 4GB9A 4WH4A 1KM7A 2K8HA 5JTIA 4K4GA 4XYCA 2JXJA 3FILA 2MJEA 4EZLA 9ICKA 3EC8A 1Y8RC 3ONSA 4J9RA 3RI7C 2UU7A 4PK1A 3N20C 2I1JA 5ALKA 4EX6A 1QZEA 5IO9A 3SR6A 1TYGB 4OVVA 2BYEA 2R8HA 2HBLA 4GIBA 1ZQUA 4DQPA 1FEHA 3VAWA 3TAPA 4Q8EA 3U4EG 1AWDA 1ROEA 3MR6A 5AI6A 2QMTA 2Z7JA 3FC4A 1TK5A 3B1LX 1BVSA 1X40A 4J03A 5KL1B 3PMNA 3PZPA 2CRXA 4PHEA 1UGMA 3B0AA 1ZETA 1V49A 4AS1A 3OGUA 2MSNA 1FO4A 1TKEA 4BBNC 5EE9A 3IG5A 4O3SA 3QZ8A 2AGQA 1ZQJA 4M9NA 2I1QA 5J2JA 3Q3JA 2M9NA 4YD2A 4ZRQA 3VHTC 3HM3A 3VDZA 3RBEA 1FRDA 4YG2A 4GLXA 4NZLB 1M6YA 3LVWA 3MGVA 1SE4A 2LYAA 3DBRI 5CX3A 2EANA 1NVID 1X66A 2INNE 3PMLA 9ICCA 4Q8FA 3AM9A 2BTEA 1JWSD 1Y88A 4RQ7A 4N58A 4P16A 1J2NA 4FHKA 2F1JA 4UQGA 4RQ4A 2HTHA 4RQ3A 2KWDA 3JYUA 1ZD2P 4S0RA 2ZUBA 4TQSA 4MGYE 4IS7A 3WALA 5KFYA 3A9KA 1TY0A 4HRSA 2WDVB 2LJIA 2WF7A 4MM3A 1MHHE 1IPGA 2PMZF 1N63A 2EMSA 3P4PB 3RZWC 5GXGB 1K8RB 5J2AA 5CHWA 3BYYB 3ZQ4A 4LNKA 1ZQGA 1HEZE 4UARA 2XY5A 4TSSA 1I7HA 2KQ7A 2D3AA 4YT0B 3N1ZC 1OQQA 2VKQA 4W9JA 5GMVA 4PL2A 9ICJA 3H7PB 3K4GA 2BPGA 2KKPA 1NYRA 3KYDD 1ZOLA 2E8OA 1XCTL 4BOZB 4YSZB 3MGIA 4WWMA 4FULA 2ALZA 4IQWA 1N2XA 5J8YA 4JV1A 3I1YA 3AEBB 4MH0E 4DSEA 3PT2B 1HIWA 4RPXA 5LLIA 1HEKA 2G0AA 3QUBA 2K6QA 3MHSD 5C23A 4M04A 5D3IB 2VJ4A 3ML8A 1ZQRA 2K22A 2PKEA 3V6EB 1RFKA 2O6VD 3C23A 2GB1A 1SXEA 1XSNA 4MJSB 4DOCA 4EX7A 1SEBD 4FADA 4GGQA 2HVIA 1ESFA 1T3QA 2KJRA 1KTKA 4Y2SA 4Z6CA 3HKZF 5DG8A 2QILA 2IJ0A 1QH9A 4DLEA 1T6BX 5AM0A 5KG4A 1F0MA 4UBBA 4B9UA 2KP7A 2ASLA 1NK4A 1J19A 4KITB 5J0RA 2FCSA 1LKYB 4GOCA 1P0RA 3QU2A 3EUB2 4FXCA 2B76B 1QCKA 1TT5B 5KFJA 4JWSC 3I3TB 4IG7B 2B3AA 4DL7A 2GLEA 1WX9A 2AQ0A 1PGXA 4PYZA 4F8RA 3OWEB 3SDLC 3DQVA 3TJPA 5KHQA 2VRRB 1MA7A 1N56A 5DBCA 3PZ7A 3U7ZA 5H2FU 5J2EA 1IIPA 1D9FA 4ED2A 4GXBA 2N1RA 2JMGA 1XXGA 1IGCA 2QLTA 4B6JA 1X2IA 4W9GA 4MFAA 3PSIA 5DBBA 2R8JA 4I6PA 1RQNA 4NAWA 4CNQA 5L1JA 9ICWA 1L0XB 2NBUA 2UWQA 2Z0EB 4NNJB 1RXVA 4CGZA 8ICWA 2MEKA 3DDHA 4J9SA 4TMAB 3PV8A 2ZPYA 4IC9A 2W3RA 1QQRA 4MFFA 2VANA 4CO7A 4R8UB 4ECYA 1OXJA 1V86A 3SV3A 2PW9A 1CI4A 3L13A 2KJ6A 4TUUA 4UAYA 3S6JA 4JWNA 3RNFC 4ED0A 3RH5A 4Q45A 5KAFU 3H4DA 3JPPA 5DDMA 2H3ZA 2QIEB 4YD1A 5KG1A 1XO3A 2LGYA 2NPTA 1J7CA 4ECZA 2WLBA 3AE5B 4LK0M 3N4MB 2DKXA 2W7OA 2WXIA 3SD5A 2KT7A 5JZEB 1BPXA 4WQOB 1CQVA 3DBHI 4WJNA 4B6WA 5C2TB 3PSFA 3F53A 2JWUA 1AARA 4JMUA 2LMCA 3QWZB 5HHIA 4KLTA 2NO4A 3KBBA 4DDGD 2PVGC 1UWMA 5DLGA 1RFAA 4A9AA 5J2BA 4O5EA 5DPRA 4TKNA 4HROA 4DF4A 2KMDA 4YMNA 1SL0A 3GV5B 2IDYA 2NVUI 1L3TA 3IBEA 1JW9D 1NJYA 4RQ5A 2D3CA 4DL6A 2LXCA 2NTSA 3R2TA 1GG3A 3Q8FA 4NM1A 3WK9A 5AM4A 4JWMA 4M9JA 4OJLA 5DKWA 1D5ZC 2N9KA 3VH3B 4B0EA 1VRAB 2ZTDA 4J9QA 2K39A 4UW9A 2F77X 4XQ8A 5DB9A 1ZQIA 4KIKB 2KE7A 4BJQA 1NK5A 2C60A 2SEBD 1DK3A 1MVKA 3Q6BA 4GDKA 2A1JB 3B08A 4DO9A 1WGRA 1B22A 1YZ6A 1MG4A 2WNMA 1ZE3D 5FKAC 2V9WA 2N9EB 3MC0B 4IKGA 5J29A 3AL0B 4PS3A 4GFJA 3A33B 2ZCCA 5KT7A 2LBOA 4BOSC 1EUVB 3PW7A 2IPKD 1DOYA 2IGDA 4C4VB 1ZGUB 2EAOA 2KDIA 4P1BC 2GBRA 2LPEA 8ICRA 5EOZA 1EWCA 1UD7A 2MBBB 2KMAA 3WAPA 1KDHA 2LMRA 9ICPA 2KO3A 3A9JB 4CF4A 1UCVA 1QTMA 4XRHA 8ICIA 3H8WA 1SJHD 3C1ZA 2YN4A 3MFIA 4HDQA 4C8OA 2ZVNA 4OZAA 2L0FA 3OTQA 4BKSA 1A77A 2KHWB 5KG5A 2DPJA 3UMBA 4F1SA 1RPLA 2V4RA 3RPFC 1C76A 2GBJA 4F4KA 4MEMA 1YX6B 4C8NA 3AEEB 2P6RA 3KUCB 5CEHA 4I2IA 3C2LA 2KDBA 4RQ6A 4YP3A 9ICUA 3PPAA 2NTTA 4LJOB 1YQ4B 3H7SA 4R3DA 3ZXVA 1J0GA 3ZDBA 4MEXA 5IA7A 5AK4A 3N3KB 2WU5B 4HCPB 5KFRA 2X8XX 1TK0A 3MJWA 2BPFA 1OFFA 1VCBA 4OD0A 2ES6A 4CHKA 1LFDA 2FCMA 3MP9A 1UA0A 2KFKB 1C4PA 4X5VA 2KG5A 2YEPF 1STEA 4UASA 4I2GA 1S97A 5DCNA 3KZXA 4OO1J 5J0QA 4DSFA 2BCVA 2ZIXB 1N62A 1P3QU 1GAQB 3KHHA 4J9OA 2W8KA 3H7PA 1K51A 2C2DA 3IAM1 5J2FA 3BZKA 2FDRA 4I2AA 2QKQA 3Q3FA 4I2CA 5AM1A 2C28A 3DVGX 3C2KA 4FZNA 2R2OA 4JGHB 4NJ6A 2CN1A 4Y2QA 5J2GA 1F77A 4ICVA 8ICNA 3C5FA
chains in the Genus database with same CATH topology
1TS5A 1ZP0B 3L4PA 1D6EC 4OZCA 2GI9A 1AN8A 1RWSA 1IUEA 4US8A 2WXFA 1FNUA 3Q8EA 1MI0A 3W5VB 2Y5CA 3GP7A 5EE1A 1YN3A 1FIQA 2WQYB 3BK2A 4KGSA 4ZYSA 1XLPA 1E10A 3W9CB 4WIPA 1ZXIA 1L5PA 3CIRB 3B2FA 2MJDA 1YJIA 1J7AA 1EU4A 2QSDA 1UUPA 5FR3A 5G5HA 3AE4B 4DXGA 2R61A 4JE3B 4LLGM 1K53A 2CJNA 2N9LA 1JMLA 4MACA 1C4AA 4XDCA 3T3NA 1N5WA 1J7BA 3P4SB 2PKOA 5H8YE 1TKYA 1C77A 4OVZA 5E6JA 5EE0A 4GDLB 2BS4B 3Q8AA 4ZOHC 1SSNA 3AE9B 4C80A 5H92C 4CQNA 2XNAC 3EGRA 2IGHA 1ZDVA 3MHZA 4RH6A 3W5UB 2I38A 1C78A 1UWXA 1XLNA 2Z8LA 3BVZA 4NJCA 4ZHOA 1DOIA 3AEFB 5I4DA 1C9FA 4WURA 1FFUA 3AE8B 4JWUC 1SE3A 4OZBA 2VZKD 1QOBA 2CJOA 3VR9B 1I4XA 1K50A 3VRBB 3NVWA 2PIAA 3ZYYX 2ZW0A 2RDGA 3AH7A 2V3NA 5AUIA 3HUIA 4DQOC 2VZKB 5G5GA 5BYSA 2OHFA 4NAWB 3IAS1 2L32A 3BK1A 2QEJC 1JALA 1SF0A 3AECB 2E3TA 1JWUD 4HJGE 1JROA 4UDUC 1TY2A 1SB3C 4OHJA 1L4DB 1XEEA 1WGKA 1N61A 1KRHA 2V3PA 1FNVA 3E56A 2LEKA 2PVOD 5BMHA 4YSXB 3UI3A 2DWQA 2KACA 1MPEA 1TKGA 1XF5L 2J4XA 1D4BA 2OEDA 2TSSA 4KKIA 1F2RI 1GB1A 2WXKA 1SIJA 4YTPB 5LNK1 2WXNA 3AE7B 3I9V1 2WXGA 2WXHA 3EA6A 2BS2B 1L4ZB 2ZW1A 3R2IA 1HXYD 2K0PA 4WQMA 1WRIA 5D3DA 1L6VA 5C3JB 1KFYB 1NENB 4IOIE 1PFDA 3B2GA 1QOAA 3P63A 1D5XC 2PTLA 4N59A 2L83A 2J52A 2WXMA 1BXTA 3P1MA 3I57A 4ARIA 1UGJA 2BS3B 1ENFA 2BB5A 4L2YA 4HEA1 2H88B 1HA5A 2WXPA 3BIID 1TZOA 3R8BA 1HZ6A 4YSYB 2WXJA 2KQ4X 5BYRA 3H8HA 1RYJA 1SXTA 2BBCA 3AEGB 1I4PA 4WH4A 3VR8B 4DXFA 1OQRA 2LUMA 1QOFA 4ITKA 2FE8A 3FILA 4XDDA 1QT9A 2MJEA 4WAFA 3AE2B 3HVZA 3V05A 3BYTB 1VJKA 3SR6A 2H89B 1TYGB 4RCOA 5FK9C 1FEHA 1P7EA 1I4QA 4A55A 2G9HD 1NI3A 4HKZE 4XE0A 3U4EG 3KQ4A 4O1NA 1AWDA 1ROEA 3ABVB 1FRRA 1VZ7A 2QMTA 1FD6A 3FC4A 1MHXA 2DYOA 4B0MA 4YTNB 4AS1A 2GRIA 1FO4A 3AE6B 1TKEA 1TS2A 1VLBA 5EE9A 4A6QA 2M56B 4US9A 1C79A 4ZRQA 3C8YA 1FRDA 4MT5A 4NZLB 3W2DA 3NRZA 2L52A 2JQRB 3Q8BA 1SE4A 3LB8C 4L23A 2HDEA 1NVID 1QILA 2INNE 3NZ3A 1IBXA 2KMMA 1RM6C 4AQ7A 3AM9A 2BTEA 1JWSD 4P16A 4N58A 1PGBA 1V1PA 3URYA 2WXOA 2WXQA 4Q2JA 2KWDA 1WYGA 3NS1A 3N9YC 3TEYA 1FM0D 1TY0A 4HRSA 1YNTE 3NUHB 2WDVB 2LJIA 1E9MA 1B9RA 1MHHE 2INPE 3KWVA 1N63A 2QJLA 3P4PB 1VZ8A 5GXGB 3LXFA 1IGDA 3BYYB 3ZQ4A 5BMIA 1HEZE 4LTUA 4TSSA 1I7HA 2ON8A 4C56C 1WXQA 1FNWA 2SAKA 4YT0B 3AEAB 3IT4B 2K5PA 1OQQA 1ZOYB 4TQ1A 1JCKB 3Q69A 2JZPA 3BVMA 1SBBB 1Q10A 1NYRA 1XCTL 2JXTA 5TSSA 1DGJA 4YSZB 4WWMA 1E6EB 3TEWA 3AMZA 2D5GA 5D7GA 3NVZA 4RGNA 2DLBA 3P4QB 2IGGA 4YWGG 3AEBB 3CWIA 4RGTA 3V3XA 1QKZA 5HFYA 2KDMA 1YN4A 1KLGD 1ET6A 5D3IB 2AX5A 2K22A 4XWTA 5BMGA 1RFKA 2RMMA 2BYTA 2GB1A 2N7JA 1JRPA 1KLUD 2X38A 1EU3A 1SEBD 2ONQA 1FXIA 1ESFA 1T3QA 1KTKA 1PGAA 2QILA 3PO0A 2IJ0A 1EM7A 1T6BX 1ACCA 4REZA 4RFBA 2M0AA 4JX1C 2JX5A 3SFDB 2WDQB 4C7YA 4ZHPA 1D5MC 1GOZA 1TS4A 1QOGA 1DOXA 1YQ3B 3EUB2 4RF0A 4FXCA 2B76B 2AQ3B 3P4RB 2V0GA 1QLBB 1CK1A 3MJ5A 4RNAA 4JWSC 1LO5D 4YTMB 1E7PB 1PGXA 3OWEB 4JPSA 1PUTA 3GS2A 2MH7A 1TJEA 3PZ7A 2WXRA 3U7ZA 2G1EA 2LHEA 1FMAD 3Q8CA 4GDKB 4KX6B 2AQ2B 2ICIA 1XXGA 1IGCA 3PZ8A 2BB6A 4A8XC 3DWMA 2Y3AA 1XLQA 1I4GA 1N60A 4USAA 1L0XB 1F2RC 3MFGA 2MEKA 2XN9C 2KAJA 1NYQA 4TMAB 3AV8A 2KN4A 2K3UA 4D2KA 2W3RA 1QF6A 5JXVA 1QQRA 2FBWB 1VDVA 2PW9A 4M0WA 1V8CA 3ZJUA 1Y56A 1YMHE 1N5XA 4A90A 1TS3A 4KGTA 4L1BA 1GB4A 2W3SA 2E6XA 2V4IB 1EWYC 1XLOA 2QIEB 2WLBA 3ZJTA 1XO3A 3AE5B 1J7CA 5BYQA 4LK0M 4H2AA 3SFEB 2J53A 2WXIA 1ZUD2 4GLSC 1KF6B 3IT6B 1PYWD 1C4CA 2JYTA 3IXSA 1CQVA 2FUG1 2Y5PA 4EE2A 1ZPSA 5C2TB 1BUIC 2JWUA 2L1AA 4PT5A 1AW7A 2DBYA 1WSPA 2WXLA 4IDIA 2HTME 2LMCA 1KH0A 3TEZA 1CZPA 3VRAB 1E0ZA 3TUOA 1SJED 2JSVX 1UWMA 1YJJA 2PVGC 3AEDB 2J42A 2W82A 1NEKB 3O13A 4RF1A 4A9AA 4HROA 1F0ZA 4P6VF 2IDYA 1JQ4A 2LHDA 1JW9D 4MH8A 2NTSA 1FCLA 3KLSX 3R2TA 3DWGC 3Q8FA 4ZRPA 1ZXHA 2MJ3A 1M4VA 1FFVA 2M19A 3BZDB 2RDHA 4XWWA 1D5ZC 3WCQA 2N9KA 4NAMA 4B0EA 1VRAB 3ZJVA 2EKIA 3BWUD 1XCQL 1A70A 4OW0A 4N6EB 4TQ0A 2SEBD 3ETRA 1MVKA 3AB5A 3HRDD 2ACZB 3TEXA 3AN1A 4C7ZA 4YXDB 4RGOS 2WNMA 1ZE3D 5EE3A 5FKAC 3MC0B 3E9SA 4IKGA 3GB1A 4ARCA 1AYFA 1WWTA 1DOYA 2IPKD 2IGDA 1K52A 1V97A 1ET9A 2LGIA 1HZ5A 3FILB 1JWMD 1L0YB 2CU3A 1EWCA 1I4RA 4RGMA 2LFIA 3VQIA 1P7FA 2WU2B 1SJHD 2PLPA 5HHDG 3P42A 2JU6X 2EELA 4KGRA 1T5XD 3T3OA 4OZAA 3J9CA 2W55A 2WS3B 2I2YA 1ZDXA 1GPXA 1YN5A 1SE2A 3SEBA 3HVDA 3U52E 3W1SA 3RPFC 1C76A 2WP9B 2PMVA 1UNSA 3KWLA 2BW2A 3B9JA 4HKQA 3AEEB 3BVGA 5AUKA 5T8IA 4KKJA 2DYMA 2NTTA 3NVYA 1CJEA 1YQ4B 4J3OD 2K9XA 4R3DA 3ZGZA 1IBXB 1L0VB 3LYYA 2N0SB 3FAHA 1R7SA 2WU5B 2W54A 3U2SC 2BT6A 1V1PB 1PDXA 2JYEA 1OFFA 1FCCC 1V1OA 2NMQA 3MP9A 5HG2A 1FXAA 3RFZB 1B1ZA 3AE1B 1JWAD 2WDRB 3TSSA 1C4PA 2YEPF 1STEA 4MM3B 1HQRD 1N62A 1GAQB 1DYQA 3IAM1 1K51A 5HI1A 1JWBD 1I4HA 3NVVA 5MPOA 2AQ1B 2RPVA 1L6UA 2YEPB 1F77A 3AE3B 1VR9A 2Q5WD 1VZ6A 1BMLC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NEK B;  1DGJ A;  4WQM A;  4HRO A;  1WRI A;  1E6E B;  1L6V A;  3L4P A;  3AMZ A;  1ZP0 B;  4P6V F;  3NVZ A;  4WWM A;  1JQ4 A;  1JW9 D;  1KFY B;  1NEN B;  1PFD A;  1RWS A;  1QOA A;  1IUE A;  3B2G A;  3DWG C;  4US8 A;  2L83 A;  3P4Q B;  3P63 A;  5C3J B;  3AEB B;  3W5V B;  2MJ3 A;  3CWI A;  3P1M A;  1FFV A;  2M19 A;  2Y5C A;  4N59 A;  5EE1 A;  3WCQ A;  2BS3 B;  1FIQ A;  2WQY B;  2EKI A;  2AX5 A;  1XLP A;  2K22 A;  2H88 B;  1E10 A;  3W9C B;  1A70 A;  4N6E B;  1RFK A;  3BII D;  1ZXI A;  3ETR A;  1L5P A;  3AB5 A;  3HRD D;  3CIR B;  4YSY B;  3B2F A;  1JRP A;  2ACZ B;  2MJD A;  3AN1 A;  4C7Z A;  1YJI A;  1J7A A;  4YXD B;  1RYJ A;  3AEG B;  1FXI A;  5G5H A;  3AE4 B;  5EE3 A;  1T3Q A;  3VR8 B;  2CJN A;  1OQR A;  3PO0 A;  1QOF A;  4ITK A;  1AYF A;  1WWT A;  1QT9 A;  2MJE A;  1DOY A;  4JX1 C;  3AE2 B;  1N5W A;  1J7B A;  2JX5 A;  1V97 A;  3P4S B;  3HVZ A;  2WDQ B;  3SFD B;  4C7Y A;  2PKO A;  5H8Y E;  4ZHP A;  1TKY A;  2CU3 A;  1DOX A;  1VJK A;  1QOG A;  5EE0 A;  3SR6 A;  1TYG B;  3EUB 2;  1YQ3 B;  2BS4 B;  2H89 B;  4FXC A;  4ZOH C;  2B76 B;  3P4R B;  3AE9 B;  1QLB B;  4C80 A;  2WU2 B;  5H92 C;  1NI3 A;  4JWS C;  1AWD A;  1ROE A;  3W5U B;  3ABV B;  1FRR A;  1XLN A;  3FC4 A;  4YTM B;  1E7P B;  4ZHO A;  1PUT A;  2W55 A;  1DOI A;  4YTN B;  2WS3 B;  4YSZ B;  2MH7 A;  1TJE A;  3AEF B;  1GPX A;  1FFU A;  1FO4 A;  3AE6 B;  2G1E A;  3AE8 B;  1FMA D;  1TKE A;  4JWU C;  4KX6 B;  1VLB A;  5EE9 A;  2M56 B;  1QOB A;  2CJO A;  3VR9 B;  4US9 A;  3VRB B;  3RPF C;  3NVW A;  2WP9 B;  3DWM A;  3KWL A;  1FRD A;  1XLQ A;  2PIA A;  3ZYY X;  1N60 A;  4USA A;  3B9J A;  3NRZ A;  3AH7 A;  3AEE B;  2L52 A;  2JQR B;  5AUI A;  3HUI A;  3LB8 C;  2KAJ A;  1NYQ A;  3AV8 A;  5AUK A;  1NVI D;  5G5G A;  2KMM A;  2W3R A;  1RM6 C;  2OHF A;  1QF6 A;  3AM9 A;  3NVY A;  2FBW B;  4N58 A;  1CJE A;  1VDV A;  1YQ4 B;  2K9X A;  1L0V B;  2N0S B;  3FAH A;  1R7S A;  2WU5 B;  2W54 A;  1JAL A;  1SF0 A;  2E3T A;  1V8C A;  2BT6 A;  3AEC B;  1WYG A;  3NS1 A;  1N5X A;  1JRO A;  1PDX A;  1SB3 C;  1FM0 D;  2W3S A;  4HRS A;  1OFF A;  1WGK A;  1N61 A;  1EWY C;  1E9M A;  1KRH A;  1XLO A;  1YJJ A;  2WDV B;  1B9R A;  2QIE B;  1F0Z A;  2WLB A;  1N63 A;  1XO3 A;  2QJL A;  1J7C A;  1FXA A;  2LEK A;  2PVO D;  3AE5 B;  3AE1 B;  3P4P B;  1JWA D;  3LXF A;  5GXG B;  3SFE B;  2WDR B;  2DWQ A;  4YSX B;  1ZUD 2;  1TKG A;  1KF6 B;  4LTU A;  1I7H A;  1N62 A;  1WXQ A;  1GAQ B;  4YT0 B;  1JWB D;  1SIJ A;  3AEA B;  5C2T B;  3NVV A;  1OQQ A;  2K5P A;  4YTP B;  1ZOY B;  4A9A A;  2DBY A;  5MPO A;  4IDI A;  2HTM E;  1E0Z A;  1CZP A;  1L6U A;  3AE7 B;  3AE3 B;  3VRA B;  2BS2 B;  2PVG C;  1UWM A;  1NYR A;  3AED B;  2Q5W D; 
#chains in the Genus database with same CATH topology
 2WAQ C;  1PVQ A;  1TS5 A;  1BNO A;  3HHM A;  1ZP0 B;  3JPT A;  3THV A;  1D6E C;  4IQT A;  3ZVV A;  2FCN A;  3M63 B;  4K7W A;  2FE9 A;  2LHT A;  3SAF A;  2WXF A;  1FNU A;  1SV0 A;  4DHZ E;  9ICF A;  4LDT D;  5ALV A;  2PE6 B;  2XY6 A;  1ZQB A;  2K8B B;  4OJ6 A;  4MJS A;  4QZC A;  1LGR A;  1T0Y A;  1E10 A;  5KNI A;  3KW5 B;  5DPW A;  2KNJ A;  1R4N B;  3OSN A;  4K3C A;  1L5P A;  2ZPN A;  4KLG A;  2HMX A;  2O2V B;  5G5H A;  3AE4 B;  3W1S C;  4QZI A;  4LLG M;  4UB3 A;  2N9L A;  2BF8 B;  1EXN A;  3MR2 A;  2LVP A;  1LKY A;  3OHA A;  5L1L A;  1NKB A;  1HUO A;  2HJ1 A;  5H8Y E;  1PUZ A;  7ICK A;  1SKS A;  4DQQ A;  4HYK A;  2KQS A;  5E6J A;  4Y2X A;  1Q1O A;  4BVU C;  1SV4 A;  3IV6 A;  1MQ2 A;  1ZD3 A;  5IIO A;  4ECX A;  4QZB A;  3SYZ A;  3PNC A;  1SXD A;  2DZK A;  4RQM A;  2K8C B;  2J0K A;  5AZG A;  4NJC A;  4ZHO A;  1O08 A;  3BQ7 A;  3AEF B;  1L7O A;  5I4D A;  1C9F A;  5D49 A;  5D46 A;  3V61 A;  2JH7 A;  1MQ3 A;  2BPS A;  4EBC A;  4OZB A;  2VZK D;  5AKX A;  5DG7 A;  4OJO A;  2EQY A;  2MBE A;  3DBL B;  2PIA A;  2FPL A;  2RDG A;  4J9P A;  2C22 A;  5AUI A;  4R8U A;  2N1W A;  3JPO A;  4G0N B;  1XQQ A;  4IC7 B;  4ZDV A;  3IAS 1;  1C3T A;  2D2Q A;  3PS6 A;  5FP0 A;  1ZQL A;  5IIL A;  4DWF A;  1KEJ A;  4ECT A;  2M17 A;  4XA5 A;  3KHG A;  1JWU D;  3WKE A;  3Q3N C;  2G08 A;  1A5R A;  4M0W B;  2KIC A;  3ZKJ C;  4XC2 A;  1WGK A;  5DLF A;  2AU0 A;  4PPX A;  4PGQ A;  1WG8 A;  1TIF A;  2PI5 A;  1MJD A;  2QB1 A;  2RLT A;  8ICT A;  3ZDC A;  2XGQ A;  2JWZ A;  8ICQ A;  4YTP B;  5KFD A;  5ALL A;  3G6X A;  1E8X A;  3QK0 A;  5LNK 1;  1WXS A;  5CRX A;  2A3V A;  3AE7 B;  4U7C A;  3GDX A;  1BT0 A;  2WXH A;  1ZQQ A;  1L4Z B;  3GFK B;  2VJ5 A;  5ALH A;  3UIP B;  2L7R A;  4ECQ A;  3RB0 A;  1HXY D;  2XY7 A;  2WX1 A;  2EH9 A;  1L6V A;  3PRP B;  3CYM A;  4CDG A;  4WQM A;  4GDL A;  3VUX A;  1KJT A;  1NEN B;  2Y0S C;  4IM2 A;  4E71 A;  1D5X C;  3SAG A;  3IRU A;  1S1Q B;  2J52 A;  4KIK A;  3ZNZ B;  1WGY A;  1R4N I;  5KFC A;  4J9M A;  4UAW A;  2OWO A;  2A1J A;  5E6O A;  2BB5 A;  4DBG A;  5KFZ A;  4KSK C;  3FKY A;  3PSE B;  2RRD A;  3ZTD A;  3R8B A;  2N7D A;  9ICH A;  2WXJ A;  2BQ3 A;  1RYJ A;  3V6K A;  3NRW A;  1WCL A;  1L6N A;  1SXT A;  2BBC A;  2F8K A;  1TAM A;  1I4P A;  1DGS A;  1V2Y A;  4C4V A;  3HP6 A;  9ICA A;  2FE8 A;  5HP4 A;  3RNG C;  4WAF A;  2EZZ A;  1ZQK A;  2K4E A;  2G4S A;  4YR3 A;  1YX5 B;  3UXN A;  3RR8 A;  3A9J A;  3D2N A;  8ICC A;  5AZH A;  3OJ4 B;  3BYT B;  1Z00 B;  2QDF A;  1VJK A;  2H89 B;  4B9T A;  2C5L C;  3A4S C;  4A55 A;  2G9H D;  4DK5 A;  3H8S A;  1KLN A;  1TE2 A;  3Q3O C;  1NK6 A;  5DGB A;  3ABV B;  2KTR B;  1E8W A;  4YR2 A;  1FD6 A;  4ED7 A;  2XK5 B;  2DYO A;  4K1R B;  4ECW A;  4B0M A;  3LJ3 A;  2W11 A;  1A0P A;  5ALW A;  4PHA A;  2GRI A;  1ZYQ A;  5D6J B;  4BKT A;  7ICS A;  3DBL I;  1TS2 A;  3ONN A;  4DHJ D;  2UVU A;  2J7Q B;  4A6Q A;  1KBU A;  5KFV A;  2V3S A;  4GIV A;  1C79 A;  2FJ6 A;  2GBN A;  2D6F C;  2NRW A;  1NOM A;  3Q8B A;  3CW2 C;  5AKH A;  7ICI A;  3AU4 A;  4HCN B;  7ICG A;  2KMM A;  1RM6 C;  9ICB A;  4AQ7 A;  3AEV A;  1FEZ A;  1F9J A;  1LV5 A;  4ZYN A;  3URY A;  3X23 A;  4KLL A;  4P0Q B;  3QU4 A;  3CNH A;  1X9S A;  4Q2J A;  2IY1 B;  2WDT B;  2PFO A;  1WYG A;  4LVS A;  4HLE A;  3H0M B;  5BOM A;  3HWT A;  3N9Y C;  1S10 A;  2JRI B;  3WKB A;  4BWM A;  1OEY J;  4WJQ A;  4ZRK A;  2NYV A;  5F9N A;  2AJQ A;  1PZN A;  1MFW A;  1YNT E;  2KFK A;  3LDZ E;  1E9M A;  4Y2R A;  3RNA C;  2INP E;  1L8O A;  4MHV A;  5KFI A;  2ZIX A;  2DL0 A;  2YVC A;  1IGD A;  1WZ3 A;  1V80 A;  1ZQ1 C;  3I28 A;  3MGH A;  5DGA A;  4LTU A;  1WIA A;  3DEE A;  1Z1V A;  4P7I A;  3OJS A;  2FCQ A;  1XC9 A;  2Q4T A;  3IT4 B;  2V9H A;  5EWF A;  3DBR B;  1NDD A;  2MLB A;  1JCK B;  3RD2 A;  4QZF A;  2B21 A;  2JH1 A;  2AL3 A;  1N48 A;  4LJX A;  2XBB C;  2YLM A;  4ELV A;  9ICE A;  2LJ5 A;  1E6E B;  3AMZ A;  5D7G A;  2YML A;  3GIK A;  2K8B A;  4QIW C;  4J9L A;  3ORY A;  5ALF A;  1NBF C;  4P4P A;  4WAA A;  1QKZ A;  3QEB Z;  2IOF A;  1KLG D;  2O6K A;  3B0Y A;  2BPC A;  4NLN A;  2KK8 A;  2O2V A;  1KW4 A;  2AL6 A;  2XGP A;  1NJZ A;  7ICF A;  2JEJ A;  3C28 A;  5KFX A;  3R3M A;  3AU6 A;  4W9K A;  1H38 A;  4ZRJ A;  5JU5 A;  2ISO A;  3GZN I;  1ZQM A;  2ZJ5 A;  5KG3 A;  2OH2 A;  3GZF A;  3RB3 A;  8ICP A;  3U30 A;  1EM7 A;  2DEN B;  1ACC A;  8ICG A;  3GIL A;  1E5W A;  2Y1J A;  3AUL A;  4FJZ A;  2VIX A;  3Q8Q B;  2M0A A;  5AI9 A;  1E90 A;  2JX5 A;  3AU2 A;  3SFD B;  5AKZ A;  2WDQ B;  4C7Y A;  4M9H A;  3Q2A C;  1Z3E B;  4A20 A;  1D5M C;  2K8C A;  2Y9T A;  1DOX A;  1YQ3 B;  2KN5 A;  4RF0 A;  2AQ3 B;  5KG6 A;  3P4R B;  2V0G A;  3MJ5 A;  4RNA A;  2PI4 A;  4YTM B;  1E7P B;  4JPS A;  5KFH A;  2ASQ A;  3KHL A;  1U49 A;  3GS2 A;  3V62 A;  2MH7 A;  4UB4 A;  5AIB A;  8ICY A;  4GDK B;  3PST A;  2JUO A;  2BKE A;  5AK3 A;  3DOW A;  1PQS A;  3HIZ A;  4GMV A;  2KZM A;  3MBY A;  5DBA A;  5F9L A;  1K1Q A;  5KFK A;  1Q3U A;  1N60 A;  4USA A;  1I4G A;  3KUZ A;  2KOB A;  1F2R C;  4G9B A;  1WGH A;  1WX7 A;  5AZF A;  2KN4 A;  4F5Q A;  1MSW D;  4YN4 A;  4D2K A;  1UT8 A;  4G3I A;  3EFC A;  4DOA A;  2NBW B;  3TKA A;  2MQJ A;  5JXV A;  4I2D A;  2KK0 A;  2FBW B;  2ZCB A;  2QAR B;  1JMS A;  4ED6 A;  1GUA B;  1I42 A;  2JXX A;  4F4Y A;  2JHD A;  2EAP A;  3MC1 A;  4M0W A;  2JEF A;  4DL2 A;  4RNM A;  3H1U A;  1T94 A;  2LYB A;  1RG6 A;  3ZJU A;  2HHU A;  2JZ3 B;  4JIO U;  2VA3 A;  5IN7 A;  1N5X A;  5ALG A;  2AYO B;  2CHX A;  5KFL A;  4KGT A;  4LNO A;  2YB4 A;  3MAB A;  1HTQ A;  4IRK A;  3H8M A;  2E6X A;  4ECS A;  1EWY C;  4UAZ A;  1XLO A;  3VTW A;  5ALT A;  1OTR B;  3C5G A;  2IBK A;  3QX1 A;  2EDU A;  4HDO A;  3Q3M C;  3V60 A;  2LVO A;  1V5T A;  4O3O A;  2K6D B;  3WAM A;  1TAQ A;  1C4C A;  3KH0 A;  3AQF A;  3IXS A;  3BY4 B;  2FUG 1;  2Y5P A;  1T3N A;  1ZPS A;  2D3D A;  1BUI C;  2I5H A;  1CEZ A;  2L1A A;  3RJJ A;  1AW7 A;  2C2R A;  1S8O A;  4ECR A;  1KH0 A;  3BQ0 A;  3TEZ A;  1E0Z A;  4M2Y A;  3PZD A;  2KJH B;  3O13 A;  4ANX A;  2E8M A;  1Q8K A;  4P6V F;  1L3U A;  3NZU A;  4MH8 A;  1WWU A;  3H40 A;  1Z19 A;  2P66 A;  1T0Q C;  3PTF C;  3DWG C;  4ZRP A;  2MJ3 A;  1IM4 A;  1TFR A;  2LYH A;  1COK A;  3QCA A;  1CRX A;  1FFV A;  4FHJ A;  2IO3 B;  2RDH A;  3WK4 A;  2KN7 A;  4FO6 A;  4B9S A;  3HPO A;  2R8K A;  1XCQ L;  3QXG A;  4OW0 A;  4TQ0 A;  2W9C A;  3AB5 A;  3C29 A;  4PS8 A;  2ACZ B;  3TEX A;  4DOB A;  3AN1 A;  2FMS A;  4YXD B;  4NV0 A;  5IOI A;  3UGB B;  3UXO A;  3DBH B;  4NQL B;  5KFO A;  2BQR A;  3E9S A;  2YX8 A;  1X6J A;  1KKX A;  2MWS B;  5AIC A;  9ICR A;  1Z00 A;  2ZUC A;  5KFG A;  1RYR A;  2EZY A;  2W7P A;  4DFK A;  1SKR A;  1ECW A;  1GO3 F;  1ET9 A;  3TAC B;  2LGI A;  3NUQ A;  1HZ5 A;  2Y5B B;  4QWD A;  3VQI A;  3ZLZ A;  2KTR A;  3OG5 A;  3F5A A;  2XK5 A;  2LGX A;  3M95 A;  4U6P A;  3KVF B;  5HHD G;  3P42 A;  4KGR A;  3M7D A;  5ALY A;  4Y2P A;  4Z6E A;  3ZDE A;  2KJ8 A;  5AKE A;  4LZD A;  2WS3 B;  1GPX A;  1NKE A;  1ZDX A;  2BR0 A;  1RAX A;  4QZD A;  1LVH A;  1SE2 A;  4JV0 A;  3SEB A;  3HVD A;  3U52 E;  3OSP A;  2XVT A;  3ICX A;  3W1S A;  5DPS A;  4XZ4 A;  2LRU A;  2WP9 B;  4K3B A;  3WK6 A;  1UNS A;  2PMV A;  1JI7 A;  1TGZ B;  5LXI B;  4AYB C;  2LM4 A;  3D2Q A;  4KLH A;  2ZIW B;  4E3C A;  5AUK A;  5T8I A;  2UVR A;  5ALD A;  4P0Q A;  4RU9 A;  1B0X A;  4KKJ A;  4C8M A;  3IG8 A;  4O3N A;  1CJE A;  5CA7 A;  2LUE A;  3ZNH B;  3DVG Y;  3TQ1 A;  1L0V B;  1WYW B;  5KT4 A;  2DAF A;  2WTF A;  2CHZ A;  4ZH4 A;  3FAH A;  3TCA A;  1EF5 A;  1FPY A;  3U2S C;  5HNK A;  1C1Y B;  1C7Y A;  2WF9 A;  4I6N B;  4EEK A;  2JYE A;  3KD3 A;  1L5U A;  2ZVO A;  1V1O A;  3NHE B;  4I2F A;  3PX6 A;  3RJG A;  5HG2 A;  3K1Z A;  4FZM A;  4I2E A;  4KDL B;  4UAU A;  2WDR B;  3TSS A;  5D94 A;  1WE7 A;  5CJ7 A;  4DCC A;  4B9L A;  1V9J A;  4F71 A;  8ICU A;  1WCN A;  4KV2 A;  4EEN A;  2V1Y A;  1QSS A;  7ICP A;  3O0F A;  3NVV A;  4ACO A;  2HOQ A;  4AUQ C;  5CB1 A;  5EWE A;  5G2N A;  1L6U A;  1J2M A;  2GMI C;  1PK3 A;  3AE3 B;  4EKU A;  4RQ8 A;  2MA1 A;  1FXT B;  4M6W B;  3H0L B;  9ICL A;  2HI0 A;  5KL8 B;  1NK8 A;  3L4P A;  1DK2 A;  2HBJ A;  5GTH U;  8ICS A;  2GI9 A;  2IND C;  1RWS A;  1IUE A;  4US8 A;  2AQ4 A;  4W9D A;  1IP9 A;  4QZG A;  4IR1 A;  4NLG A;  1MI0 A;  2RDJ A;  1WJU A;  3BJY A;  3M9O B;  2GOW A;  4LJP B;  4WJP A;  3M6Z A;  2Y5C A;  1NNL A;  3GP7 A;  3T5H A;  3P2B A;  5D2M B;  3BK2 A;  4O9M A;  4RM9 A;  9ICT A;  1SGG A;  3BDP A;  4M8N A;  2PFP A;  3NZS A;  4WIP A;  4R66 A;  3RNE C;  4FJV B;  3H7I A;  1S0O A;  3CIR B;  3EZ5 A;  2MJD A;  3L54 A;  2QSD A;  3M62 B;  2MRP A;  3IHP C;  4DXG A;  3EEC A;  2R61 A;  3NS8 A;  3TAN A;  2CJN A;  5HMM A;  3BS5 B;  3MFH A;  4KMU A;  2DZM A;  4DFD A;  1C4A A;  3N28 A;  2FMP A;  1J7B A;  1Q5W B;  3RAX A;  3P4S B;  5AKI A;  7ICM A;  3QZ7 A;  2PKO A;  5TZV A;  2YB1 A;  1TKY A;  1C77 A;  4DFJ A;  4C0Z A;  3TAD C;  1RLF A;  4GDL B;  2IHM A;  5CP2 A;  3IG3 A;  2DNF A;  1UH6 A;  4CQN A;  2JZZ A;  3UIO B;  2KX3 A;  4F91 B;  2I38 A;  1J97 A;  2ZJD A;  2J0M A;  2UYZ B;  3QEA Z;  4A3P A;  2R18 A;  1DOI A;  3B0X A;  3ENE A;  4WUR A;  1FFU A;  2K25 A;  4JWU C;  3N97 B;  2HHQ A;  3NY5 A;  2KIV A;  1K5O A;  3V7J A;  1I4X A;  1K50 A;  2K4P A;  5DQG A;  1WFY A;  3TFR A;  1YQB A;  8ICF A;  2GBK A;  4MGK E;  2PMZ C;  4MGZ E;  2HW3 A;  2QB0 B;  1WZ0 A;  3QA8 A;  2F8L A;  3EHV A;  4CE6 A;  4ICA A;  2QAR A;  5KFU A;  2DZJ A;  2FLN A;  4G50 A;  4J6I A;  4P1C C;  3GIJ A;  5DPT A;  5BYS A;  4QW9 A;  1NZP A;  3IP4 B;  4JL9 A;  2L32 A;  3BK1 A;  3R66 C;  2HBM A;  2D07 B;  1WXV A;  1V5O A;  1V81 A;  2QEJ C;  3U7D A;  4P0P B;  2OXO A;  4C4S A;  7ICE A;  4HXD A;  3C2M A;  1V9P A;  3QNM A;  1D8L A;  1JAL A;  4UAT A;  2E3T A;  2BKF A;  2OM6 A;  3V6J A;  8ICH A;  3UQ0 A;  4DSI A;  4FBT A;  4HJG E;  1JXL A;  1WI0 A;  1TY2 A;  1G6J A;  1V38 A;  4OHJ A;  1TKD A;  2KHV A;  2I9G A;  1XEE A;  2KWC A;  2WB1 F;  1N61 A;  3SV4 A;  1IXR A;  4IL6 U;  3E56 A;  2ZXH A;  2BDU A;  4YSX B;  2YMM A;  1X42 A;  2F3N A;  1D8Y A;  2DWQ A;  2KFJ A;  1XSL A;  1XF5 L;  2WHI A;  5J0U A;  1D4B A;  3L3F X;  2TSS A;  1F2R I;  1GB1 A;  3QX7 A;  5ALJ A;  4WJ3 B;  4OJP A;  3ISB A;  3C0R B;  4WJO A;  2BGW A;  5L1M A;  2FNJ B;  3PV1 A;  4B95 A;  2H3V A;  4BAX A;  4Q43 A;  2KD0 A;  1BPY A;  3I9V 1;  1PK1 B;  3GV7 B;  2J6T A;  1UBQ A;  2KAN A;  5ALI A;  4P4O A;  5J2K A;  3HKZ C;  4QWC A;  2J6U A;  5JUM A;  1PFD A;  3I5J C;  1BPZ A;  4RNO A;  1X9M A;  2L83 A;  4NY8 A;  3QIJ A;  1ZQA A;  1EO6 A;  2RGF A;  3X0W A;  4DEZ A;  2WXM A;  3P1M A;  1KOT A;  2ESE A;  5AK5 A;  3ZDD A;  1ENF A;  1MG8 A;  4DXA B;  1L2N A;  1MN8 A;  1QQ5 A;  4MEY A;  1HA5 A;  2WXP A;  2WYQ A;  3JPN A;  4MGI E;  3RJF A;  4NWI A;  4DS4 A;  4EEY A;  4DLG A;  4EZJ A;  5BYR A;  1Z1B A;  1OGW A;  3H8H A;  3JSV B;  4B9K A;  4P2H A;  4NQK E;  1Z5S B;  4O3R A;  1OQR A;  2KMC A;  4ITK A;  3MDA A;  1JX4 A;  1X9W A;  5AKJ A;  4F4W A;  4I29 A;  3AE2 B;  7ICJ A;  2L8J A;  3HVZ A;  3V05 A;  3WK7 A;  2HSZ A;  4PGX A;  5A0L A;  5CHG A;  1TTN A;  3DVN V;  3UMC A;  2HHX A;  5FK9 C;  1L7N A;  1V85 A;  1NI3 A;  4F8C B;  4KLF A;  4GXK A;  4PH5 A;  3KQ4 A;  4O1N A;  4NJ8 A;  2C2E A;  2KJ5 A;  9ICN A;  1FRR A;  1VZ7 A;  3Q14 C;  1MHX A;  4BKS D;  3SHQ A;  3RUL A;  2Z59 B;  2D11 A;  1WX8 A;  2NO5 A;  3T5K A;  3RB6 A;  1NZB A;  1P98 A;  1DXS A;  1A6S A;  4EZ9 A;  4W9L A;  2PXI A;  2M56 B;  1CMX B;  3UF8 A;  1NK0 A;  4US9 A;  7ICR A;  2CR5 A;  4ED8 A;  1WJ6 A;  2ZIW A;  3VXW A;  2A1A A;  4NLZ A;  4O3Q A;  2BCU A;  2W9A A;  1U47 A;  3W2D A;  1KTQ A;  2JQR B;  2AGP A;  4K4I A;  5KFF A;  2HDE A;  3LK9 A;  3NZ3 A;  3KKA C;  4L23 A;  3Q8M A;  1RDF A;  4NL9 A;  4J9K A;  2LWP A;  2PFN A;  4HPM B;  1QSL A;  1YZ7 A;  1PGB A;  5IIJ A;  3HM6 X;  4II3 B;  2WXO A;  3L10 B;  5B66 U;  2R8I A;  4LNI A;  1U4A A;  1F44 A;  2EZX A;  3M9M B;  1SL2 A;  2D3G A;  1XNS A;  4YXM A;  2MA9 B;  3NS1 A;  3NTU A;  3J81 j;  4KN7 A;  3BQ2 A;  1FM0 D;  4QZ8 A;  4XX5 A;  1RYU A;  3QUQ A;  1B9R A;  3KWV A;  2QJL A;  4M47 A;  2F1H A;  1TV9 A;  2KSO B;  2JVC A;  5BMI A;  4MSQ B;  2LZ6 A;  4B9M A;  2ON8 A;  3L08 A;  3LDA A;  4BUG A;  1WXQ A;  2C7M B;  5KAI U;  4II2 B;  4M01 A;  2K5P A;  4M6W A;  1ZOY B;  3N1Y C;  4TQ1 A;  3E0F A;  3Q69 A;  2BDP A;  1UA1 A;  5AI5 A;  2G4D B;  5L1K A;  4AWJ A;  2IA6 A;  2JZP A;  1L3V A;  1Q10 A;  2BVC A;  3RAQ A;  4M00 A;  2JXT A;  4WWO A;  5TSS A;  1DGJ A;  5HHH A;  2LI5 A;  3TEW A;  3CF6 E;  1QQ6 A;  3OJ3 A;  2D5G A;  4C4T A;  1NI2 A;  4RGN A;  3GIM A;  1GC7 A;  3P4Q B;  8ICL A;  5KG0 A;  4RQ1 A;  2RD0 A;  5ALZ A;  5HFY A;  2KDM A;  3IVF A;  1YN4 A;  4FJY A;  2N9P C;  3EFU A;  3SZ2 A;  1ET6 A;  8ICE A;  2KKV A;  2AX5 A;  3I63 C;  4KLU A;  2HBK A;  2LAS A;  2F2A B;  3M9N B;  1BPD A;  3KUD B;  2BYT A;  1F5S A;  1KFT A;  2FID A;  1U9L A;  3BS5 A;  2IZV B;  4DQS A;  3SI8 A;  1FXI A;  2L3Z A;  3A0B U;  4QJF B;  1OQY A;  5C5J A;  2KD1 A;  3UXP A;  4BFR A;  4TV3 A;  5HR7 A;  2M0N A;  2DAJ A;  2O6V B;  2KVS A;  4QNL A;  3DHG C;  3WIM A;  3HIL A;  2ZG6 A;  4REZ A;  1D8B A;  3CMM B;  4JX1 C;  5J2I A;  1BGX T;  2ZTC A;  4MSM B;  1BNP A;  2MCN B;  1TS4 A;  1QOG A;  3PLV A;  3ZIM A;  4RQ0 A;  4F4X A;  2MUT B;  3QAR A;  2CHW A;  5IKC M;  1UBI A;  5KHO A;  2JRH A;  1LO5 D;  3V6C B;  3N7S C;  3RJH A;  1TJE A;  2WXR A;  2MBH A;  2LHE A;  4BWJ A;  4Y2T A;  2W9C B;  4KX6 B;  4QW8 A;  2KWU B;  2AQ2 B;  2ICI A;  2QB0 A;  4A3O A;  1ZQC A;  2ASJ A;  3PZ8 A;  1E8Y A;  2BB6 A;  4A8X C;  3DWM A;  3GZN B;  4ZRI A;  1RXW A;  4IW0 A;  2WF6 A;  7ICO A;  2FLL A;  2I1K A;  3ED5 A;  3MFG A;  4IWP A;  4P0P A;  5KFT A;  2G09 A;  5LXH A;  2IO2 B;  4KVG B;  1ZQO A;  3Q8S B;  2JGA A;  4EFO A;  4KDI C;  1ZRN A;  2WF8 A;  3RNC C;  2ODG A;  3G6V A;  4BX9 C;  2N4F A;  2ZZP B;  5AKG A;  4KN4 A;  5DG9 A;  4E74 A;  4BBN F;  4O3M A;  2HHW A;  5J0W A;  1WM2 A;  3CRX A;  2LI6 A;  1WR1 A;  2OCE A;  2WWZ A;  4L1B A;  1GB4 A;  2KTF A;  1P7D A;  3WKC A;  4I2J A;  2BKR B;  4TQR A;  2MW5 A;  2V4I B;  1JN3 A;  2DUY A;  1Z2M A;  3ZJT A;  2LKY A;  4HJK A;  1XO1 A;  3SFE B;  1SL1 A;  2KHQ A;  2J53 A;  1U4B A;  2HD5 B;  3H6N A;  3R9K A;  3MC8 A;  2EAM A;  1ZUD 2;  4HPL B;  2EKE C;  2KC2 A;  3APD A;  4GLS C;  2F44 A;  2F1I A;  2OYY A;  3ZW3 A;  3IT6 B;  4YCX A;  3ALR A;  3ZXR A;  5IIN A;  2KVC A;  2K4H A;  2BCR A;  3L5K A;  1PK1 A;  4Y2V A;  2ZUD A;  4EE2 A;  4PT5 A;  5DB6 A;  3SEN A;  2KZ3 A;  2XID A;  2DBY A;  3ETL A;  1KRP A;  5ALX A;  4ELT A;  1VD2 A;  2HTM E;  2NR2 A;  1TVA A;  3OLM D;  2C7H A;  4HPP A;  4IDI A;  1CZP A;  2LXA A;  3VRA B;  3CP8 A;  2L76 A;  1ZQX A;  1KQQ A;  5J2C A;  4KLO A;  1NEK B;  2J42 A;  3IFW B;  3RT3 B;  1I35 A;  1P1A A;  1KLV A;  2BYV E;  2CKH B;  1LM8 B;  1LXD A;  5AHX A;  3KLS X;  1FCL A;  3ZNI D;  5C3J B;  4C8L A;  1ZXH A;  2B6G A;  1M4V A;  2WFA A;  3BZD B;  2MHJ A;  4RPZ A;  4TUQ A;  3WCQ A;  3F2B A;  3ZO5 B;  2RDI A;  5AM5 A;  3ZJV A;  2EKI A;  4EYI B;  3BWU D;  3JSV A;  4M8M A;  5BPC A;  1UZX B;  2IY0 B;  1RQL A;  3ISD A;  3HRD D;  3RJE A;  3PX4 A;  5AKK A;  3HK0 A;  1OW5 A;  4JUZ A;  4P4M A;  4FA6 A;  3V6H A;  1E7U A;  3PGE A;  1NKC A;  3IHQ B;  5DB7 A;  3APC A;  3DDC B;  2H3F A;  3T5L A;  2K89 A;  2OJW A;  7ICH A;  1WWT A;  4HK2 A;  5GTI U;  4NPN A;  4TUS A;  3VCB A;  4I27 A;  1JWM D;  2CU3 A;  1I4R A;  4W9C A;  1ARO P;  4PGY A;  1P7F A;  1QLN A;  2WU2 B;  2G06 A;  2JU6 X;  2EEL A;  3JVZ X;  3RRH A;  2JR5 A;  4GXI A;  1OEY A;  3QQ8 B;  4NLC A;  3J9C A;  2W55 A;  5DB8 A;  1N6Z A;  1Q3V A;  3AQE A;  2XCP A;  4BXO B;  1WGG A;  1KSP A;  3TL5 A;  5KFP A;  3F2D A;  3RBD A;  2NBV B;  1Z4N A;  4K7U A;  4WWN A;  1SV0 C;  1D3Z A;  2XC9 A;  3JPR A;  1NK9 A;  5E6P A;  1SIF A;  9ICV A;  5TR5 A;  5KFQ A;  2G3Q B;  5KTQ A;  1JXE A;  3WK8 A;  3KWL A;  4HKQ A;  4EBE A;  3VUW A;  1ZQZ A;  1IV8 A;  4QWB A;  5HR6 A;  2FUH B;  3ZDM C;  5ALN A;  1SWV A;  2MX2 A;  2UVW A;  4DSK A;  2E5S A;  3NVY A;  3TAD A;  2FPM A;  3RH4 A;  2K9X A;  5HKH A;  3ZGZ A;  3SQI A;  1S0N A;  2LD9 A;  4PZN A;  4GXJ A;  2YMQ A;  1IBX B;  3LYY A;  4CCH A;  4AP4 C;  2W54 A;  1V1P B;  4RQN A;  5L95 C;  3PSP A;  8ICJ A;  3E58 A;  4W9H A;  1WRD B;  2KSO A;  5AM3 A;  1FCC C;  5ALP A;  2LGS A;  2NMQ A;  4RM8 A;  2A4Z A;  1FXA A;  3ZDA A;  2IYD B;  1B1Z A;  1JWA D;  3DHH C;  3JW0 X;  3QC8 B;  5CHF A;  4EZK A;  2ZIU B;  3QUC A;  3T79 A;  3CSF A;  2Y1I A;  4JLC A;  4KSL C;  4W9E A;  3VFK A;  3EPI A;  2JPH A;  3H0R B;  2RHF A;  3WAN A;  1ISN A;  5HI1 A;  1ZQN A;  1X6I A;  1U45 A;  3H9D A;  5MPO A;  2LGD A;  4PZO A;  3Q8P B;  2KX0 A;  2YEP B;  3M8S A;  1VR9 A;  1VZ6 A;  4RNN A;  1ZQE A;  3WA0 A;  2RDB C;  3E2E A;  3WKA A;  3KTQ A;  4EBD A;  4OZC A;  2W9B B;  1KN5 A;  3MDC A;  3RR7 A;  4DL5 A;  2HHV A;  5CTR C;  1KL9 A;  3Q8E A;  4W9F A;  4NJ7 A;  4XUS A;  3NG0 A;  2KKC A;  1WY8 A;  4BZA A;  1YN3 A;  1FIQ A;  2WQY B;  4KGS A;  4YXJ A;  4GC7 A;  1ZKH A;  3M1Y A;  3LWM A;  5L83 A;  1XT9 B;  3LVV A;  2CS4 A;  2R2Q A;  4EEW A;  2L05 A;  3B2F A;  4YL8 A;  4LDT B;  2XCA A;  1V6E A;  2C7N B;  2L5Y A;  3KYC D;  1J7A A;  2JT4 B;  3KOO A;  2O6V A;  4IQU A;  5CHV C;  4ANU A;  5FR3 A;  1S5L U;  3V7K A;  2REX A;  1WM3 A;  4C00 A;  4JE3 B;  5KG2 A;  3S2A A;  3M8R A;  4IUM B;  3U26 A;  4J9N A;  8ICM A;  1R4M B;  5D4B A;  1PVP A;  2HOF A;  4MAC A;  1OUQ A;  5J0P A;  3K9O B;  2M8S A;  3RYT A;  1B43 A;  4IQV A;  1N5W A;  3RN9 C;  3AUO A;  2MUT A;  3LYS A;  1DRG A;  2M4N A;  1XSP A;  3IM1 A;  2GWS A;  4OVZ A;  5AM2 A;  5CWR A;  2BS4 B;  4LCD E;  4ZOH C;  1TZ1 A;  1SSN A;  5KFB A;  4IRD A;  2RPQ A;  4PYU A;  1A76 A;  3EGR A;  2IGH A;  3MHZ A;  3KHR A;  1WXA A;  1C78 A;  2Z8L A;  1L7Y A;  4RPY A;  2WX0 A;  3TMP B;  1E8Z A;  4KLS A;  4F72 A;  3RH6 A;  5ALO A;  3M6K A;  3ZDT A;  1SE3 A;  1QOB A;  3D32 A;  2CXY A;  2PJH A;  2F76 X;  3L16 A;  2LVQ A;  4O3P A;  3ZYY X;  2ZW0 A;  3AH7 A;  3ZRF A;  3HUI A;  1UPH A;  2QCZ A;  1WXM A;  2VZK B;  5G5G A;  2GLS A;  2AGO A;  2OHF A;  1Q0W B;  4M9L A;  5J0Y A;  4UBC A;  4G11 A;  1WGD A;  2MU2 A;  2PFQ A;  2R8G A;  1SF0 A;  4IWQ A;  7ICU A;  4KLD A;  3SEI A;  1WR6 E;  1JRO A;  3RTV A;  3H4B A;  4UDU C;  1SB3 C;  5AI4 A;  2EMT A;  1CUK A;  1KRH A;  2V3P A;  4KMO B;  3T3F A;  3IN5 A;  3TBL D;  4ACF A;  4ANV A;  3N32 A;  2LEK A;  4ECU A;  1UEL A;  2YY6 A;  1MPE A;  2RSU A;  2A5U A;  3VH4 B;  5ALE A;  2KJ9 A;  1S76 D;  2OED A;  4KKI A;  1SE9 A;  2BQQ A;  2V4L A;  2WXK A;  2RP5 A;  2KFN A;  4DHZ B;  3KKA A;  1SIJ A;  1YJ1 A;  4HVB A;  2IOF K;  2WXN A;  4HWI B;  1AQ6 A;  3ML9 A;  4DFP A;  2WXG A;  3EA6 A;  2BS2 B;  2L00 B;  2HOI A;  2K0P A;  1WRI A;  2H3I A;  1URJ A;  2K8A A;  3B2G A;  3P63 A;  4MF2 A;  3AU5 A;  2PTL A;  5EWG A;  3R7R A;  1Z4O A;  4PHP A;  4OCZ A;  4CF5 A;  4RT3 A;  4NXZ A;  2WHE A;  2FIF A;  3I57 A;  2BS3 B;  2BZF A;  4Y2Y A;  3RRG A;  4I6L B;  3VTV A;  4DL3 A;  1YD8 U;  1JIH A;  1WF9 A;  1TZO A;  4YSY B;  4B9N A;  1R4M I;  3PW2 A;  1T0R C;  3RJK A;  4GN1 A;  1ZQP A;  2GH1 A;  2ZJA A;  2HJ8 A;  3AEG B;  4ASW C;  4JB3 A;  3VR8 B;  2WAQ F;  5IAA C;  1K1S A;  1WH3 A;  4DXF A;  9ICQ A;  2LUM A;  1QOF A;  2IOH A;  4XDD A;  1QT9 A;  1IYF A;  3DBS A;  3R7Q A;  4FZL A;  3V7L A;  1H4R A;  3PY8 A;  5HML A;  4F5N A;  5KFE A;  3RJI A;  3T5J A;  5KT3 A;  2KDE B;  4AJW A;  4GSW A;  4RCO A;  3QU9 A;  2V4Q A;  3GU3 A;  5J0X A;  1I4Q A;  1P7E A;  2N7E A;  2XEW A;  3NJT A;  2HDO A;  1T4G A;  3A4R A;  2MRL A;  4BXO A;  4KLJ A;  4HKZ E;  4XE0 A;  5J0T A;  4R65 A;  3C19 A;  1T8E A;  4FLH A;  2HVH A;  2ATL A;  5J2H A;  2KIW A;  7ICL A;  3VUY A;  2G5H B;  4YTN B;  1ED1 A;  3AE6 B;  3MR3 A;  3UPQ A;  4LNF A;  1VLB A;  3N1X C;  4DSJ A;  3PLU A;  4Z6F A;  5AI0 A;  3GV8 B;  1DOQ A;  3C8Y A;  4FBJ B;  4MT5 A;  9ICG A;  5L1I A;  3RMK C;  1S0M A;  3NRZ A;  2DYB A;  2L52 A;  3LB8 C;  4DHJ B;  9ICX A;  1ZRM A;  1QIL A;  4IR9 A;  2K1F A;  4F3O A;  1F52 A;  2KZZ A;  1IBX A;  4QWE A;  2KTQ A;  3MR5 A;  2HHT A;  4NLB A;  3RB4 A;  1V1P A;  3Q8R B;  2WXQ A;  1WWV A;  8ICZ A;  8ICX A;  3OPX A;  4FFD A;  1ZQT A;  2NV3 A;  1X1M A;  2PEA A;  1XS9 D;  2OEH A;  3VC8 A;  1S3S G;  5AKL A;  4QZ9 A;  1HUZ A;  2VH1 A;  4DF8 A;  5BOL A;  3TEY A;  1O03 A;  3NUH B;  3QAQ A;  3ZRC A;  2NRT A;  4R63 A;  4F92 B;  2ZIU A;  2ZIV B;  3VVW B;  4NM2 A;  1VZ8 A;  3LXF A;  1GJZ A;  4PHD A;  4YQW A;  1U48 A;  3DHI C;  2HCF A;  1WE6 A;  4C56 C;  4NLK A;  2KWV B;  1FNW A;  2SAK A;  1PVR A;  5AIA A;  3PW5 A;  3AEA B;  3L17 A;  4AP9 A;  1Q46 A;  2W43 A;  3AXC A;  3TAR A;  4N9F 4;  5C0Y A;  4Y2J A;  1SZP A;  2M0X A;  2W9B A;  3PO4 A;  2YQE A;  1E7V A;  3BVM A;  1SBB B;  5F3X B;  2CPR A;  2D8C A;  3QUT A;  3C21 A;  4S17 A;  3NVZ A;  1UHU A;  2DLB A;  4EOY A;  3MC9 A;  5JHB A;  2DPI A;  2IGG A;  4ICU A;  4FBU A;  4YWG G;  3MTN B;  3CWI A;  4RGT A;  4ANW A;  3V3X A;  2P6U A;  2BCQ A;  5KT6 A;  2MP2 B;  1L3S A;  4FS1 A;  5ALS A;  2M1M A;  3PO5 A;  1RZT A;  2KDF B;  5BMG A;  4XWT A;  3BS7 A;  1WJN A;  2FAZ A;  4EYH B;  4ECV A;  2RMM A;  2JY6 A;  5KFW A;  2N7J A;  2XIC A;  2W04 A;  1JRP A;  2MAX A;  3FYH A;  1KLU D;  2JZB B;  2X38 A;  4QZA A;  7ICN A;  1EU3 A;  1T0S C;  2ONQ A;  1EF1 A;  2WF5 A;  4MFC A;  3QHT A;  3OHB A;  2AHO B;  5AEK B;  3QU7 A;  1LQB A;  5EDS A;  1PGA A;  2N1V A;  4UB8 U;  3PO0 A;  3IDW A;  2NRZ A;  5C1Z A;  2Y0S F;  1NJW A;  2DFL A;  4RFB A;  4CRX A;  3ISC A;  2JF5 A;  2I6X A;  4DL4 A;  2AXT U;  4F50 A;  4ZHP A;  3UM9 A;  3PR4 A;  3EYZ A;  1GOZ A;  4DDI D;  4RUC A;  1MC8 A;  3EPG A;  4UB1 A;  1QLB B;  1CK1 A;  2AH5 A;  4MDK E;  4DFM A;  4DQR A;  1ZQF A;  3N7P D;  4F2S A;  3I76 A;  7ICV A;  8ICK A;  1PUT A;  2P35 A;  2DQN B;  1SGH A;  4XGA B;  4QZH A;  4C8K A;  2G1E A;  1FMA D;  3Q8C A;  2ZJ8 A;  5BO4 B;  4MEL A;  2MSE D;  4AOF A;  3ZUN A;  2VA8 A;  2J0J A;  5J2D A;  4F7Z A;  4QAY A;  1L7P A;  2Y3A A;  2E1F A;  1XLQ A;  2RQ5 A;  4KLI A;  5FR6 A;  4QWA A;  3WK5 A;  3BIN A;  4Z6D A;  2XN9 C;  2KAJ A;  1NYQ A;  3AV8 A;  2K3U A;  2BYF A;  2KV2 A;  3RUI B;  3KZI U;  2RR9 A;  3PVL A;  1QF6 A;  9ICM A;  1WJ4 A;  1VDV A;  2ZTE A;  4AJY B;  2W9M A;  1NK7 A;  4K81 A;  1TBE A;  4RQ2 A;  1ZQH A;  2KZR A;  4F5O A;  1V8C A;  2W03 A;  3UQA A;  1Y56 A;  3BQT A;  5J8Y C;  3HT3 A;  8ICB A;  1YMH E;  4A90 A;  1TS3 A;  4O0I A;  3QU5 A;  4YMO A;  1S9F A;  4TUP A;  2W3S A;  4KX3 A;  4BGD A;  1JUD A;  2WGS A;  3ALB A;  3DVN U;  3PHW B;  5BYQ A;  4H2A A;  3HX0 A;  2D3B A;  3V72 A;  4IM0 A;  4I28 A;  1KF6 B;  1WMH B;  5B5E U;  2MBO A;  3TFS A;  1PYW D;  2JRZ A;  2JYT A;  5AK6 A;  3UMG A;  4KLM A;  8ICA A;  1ZW7 A;  3EW9 A;  4WWP A;  2KNB A;  2OOB B;  1D9D A;  3ZD9 A;  3A1Q B;  2VA2 A;  1WSP A;  2WXL A;  3T9L A;  2NS5 A;  3TUO A;  1SJE D;  4KTQ A;  2JSV X;  1YJJ A;  4RF1 A;  3AED B;  4A8E A;  1F0Z A;  4UB2 A;  2W82 A;  2ZEQ A;  3Q8K A;  2BQU A;  4IM3 A;  4FE3 A;  5DQH A;  1JQ4 A;  2LHD A;  3JPS A;  2D10 A;  3SAH A;  1H8C A;  3C1Y A;  4KZ0 A;  2K4I A;  4UB5 A;  5JRT A;  7ICQ A;  2KXJ A;  3N30 A;  2AEH A;  2M19 A;  4EZ6 A;  4XWW A;  2KLC A;  5E79 U;  1WUD A;  4NAM A;  4ELU A;  4PL1 A;  4QZE A;  1A70 A;  4N6E B;  3ETR A;  1YT3 A;  4C7Z A;  4F4Z A;  4RGO S;  1KFD A;  5EE3 A;  4OJ5 A;  4YR0 A;  3N7R C;  5J2R A;  3RCZ A;  2NRV A;  3GB1 A;  3K9P B;  3F2C A;  4ARC A;  1AYF A;  4Y2U A;  1COO A;  1HTO A;  4QIW F;  5IP4 D;  1KFS A;  1TAU A;  3WU2 U;  1K52 A;  1V97 A;  2IBI B;  2BWF A;  2KEY A;  3FIL B;  5JHA A;  4RGM A;  1L0Y B;  2LFI A;  3APF A;  5KT2 A;  1L8L A;  4DS5 A;  4M02 A;  4HAI A;  2PLP A;  2JEG A;  3T3O A;  2ZXI A;  1T5X D;  5J0O A;  3QE9 Y;  4O5K A;  2ISP A;  5JH5 C;  1UF0 A;  3SU8 X;  4I2B A;  2I2Y A;  1YN5 A;  4K4H A;  4ED3 A;  2LRW A;  2WB1 C;  4G3X B;  2G07 A;  2BW2 A;  2B0C A;  1ZD5 A;  1QSY A;  3B9J A;  5K4L A;  3K1R B;  3SD7 A;  3BVG A;  4KLQ A;  3JPQ A;  4OVU A;  2DYM A;  3PVX A;  1ZQD A;  4BKG A;  1M94 A;  3PRE A;  4J3O D;  3W1Y A;  3ZNG C;  1RRB A;  2ZNV C;  2N0S B;  3FDS A;  1R7S A;  2W9N A;  2BT6 A;  2ZIV A;  2OJR A;  2NRX A;  2E1E A;  1PDX A;  5KT5 A;  1QQ7 A;  9ICO A;  3VTU A;  4LZG A;  3L0W B;  3EWA A;  5CR0 A;  3HJE A;  2J6S A;  3RFZ B;  3AE1 B;  3A9K B;  1RYS A;  2H3Q A;  7ICT A;  2KFZ A;  3Q8L A;  1T7P A;  4MM3 B;  1HQR D;  3TI0 A;  3PRZ A;  1IG6 A;  2KOX A;  2Z0D B;  4FN2 A;  2L0T A;  1DYQ A;  2NCN A;  2H5X A;  4DSL A;  1JWB D;  1I4H A;  3DCG A;  3NOB A;  4MF8 A;  4F5R A;  4I2H A;  2AQ1 B;  4YVZ A;  2RPV A;  5G55 A;  5ALU A;  5KFA A;  5L9X A;  4DWI A;  2KYW A;  2N9X A;  2Q5W D;  1BML C;  2QHO A;  4JQW C;  3WAO A;  2HE7 A;  2FI1 A;  4TUR A;  2YTU A;  4FS2 A;  2MP2 A;  4RMA A;  4CYE A;  3ZD8 A;  3LWL A;  2DGZ A;  1AN8 A;  4CF3 A;  3QYP A;  2GOL A;  1YIW A;  3W5V B;  3TIX A;  5ALQ A;  5EE1 A;  1S77 D;  2GBM A;  4ZYS A;  2IMW P;  3SMV A;  2JZB A;  1XLP A;  5ALR A;  3W9C B;  5III A;  1ZXI A;  3D2S A;  4B9V A;  1YJI A;  3ECI A;  1EU4 A;  1UUP A;  2FPK A;  4M9G A;  2DF4 B;  4PJ0 U;  1ZQS A;  1K53 A;  1JML A;  3PW4 A;  3U8Z A;  3K75 D;  4URK A;  4XDC A;  3RF9 A;  3T3N A;  4UB6 U;  2BHN A;  1SKW A;  3UIN B;  2Y9U A;  9ICS A;  4F5P A;  4ED1 A;  2K60 A;  3DPD A;  5EE0 A;  2W8L A;  3Q8A A;  4IWO A;  4JV2 A;  3A0H U;  3AE9 B;  1VJ5 A;  2IHN A;  4C80 A;  5H92 C;  5E6N A;  2FLP A;  2XNA C;  9ICI A;  1ZDV A;  2GO7 A;  1GC6 A;  4RH6 A;  3W5U B;  5J18 A;  3GE8 C;  4Q44 A;  1UWX A;  1XLN A;  8ICO A;  3BVZ A;  1XWL A;  3OAW A;  2QC8 A;  3GE3 C;  5AI8 A;  3G6Y A;  5DDY A;  1BPE A;  1UT5 A;  3AE8 B;  5KFS A;  3PR5 B;  4GC6 A;  2CJO A;  2HHS A;  3AI5 A;  3VR9 B;  3VRB B;  4RUA A;  3NVW A;  2PPH A;  5T14 A;  3D6J A;  4KLE A;  4PS7 A;  1ZD4 A;  4RT2 A;  1S0V A;  1HJP A;  2KVZ A;  4NY0 A;  2V3N A;  5KFN A;  4DQO C;  2G5I B;  1GNU A;  4DQI A;  1ZQV A;  1ZQW A;  5IIM A;  1SZH A;  2CU1 A;  3WKD A;  4K7S A;  4NAW B;  3ZTC A;  2Q0Z X;  5J0S A;  2C9W B;  1J8C A;  2KVR A;  5ALM A;  1LB2 B;  2DX5 B;  4EUT A;  2DKZ A;  3AEC B;  1B4F A;  3RFA A;  2VH2 A;  1UQV A;  1TK8 A;  2ASD A;  3ZI4 A;  2IO0 B;  3GOE A;  3QJZ A;  3RNB C;  1L4D B;  4YFK A;  2XO7 A;  3T8M A;  2A19 A;  2DZI A;  1XU4 A;  1L7M A;  3CST A;  1FNV A;  4UAV A;  4EEL A;  2XI9 A;  2FMQ A;  1WMH A;  4AYB F;  2PVO D;  4X57 B;  2G45 B;  5BMH A;  3PX0 A;  2BCS A;  3UI3 A;  2YMP A;  1X9X A;  2UVV A;  2LM1 A;  2JEI A;  2AWT A;  2IO1 B;  2KAC A;  1TKG A;  3PHX B;  4YMM A;  2J4X A;  1XO0 A;  3F5E A;  3A1Q A;  3NAS A;  4JK1 A;  2NPT B;  5KG7 A;  1F1H A;  4E0D A;  4R64 A;  3O65 B;  2PE9 A;  1C20 A;  3RZF A;  1P9D U;  3BQ1 A;  3PRM B;  2DHZ A;  4RZR A;  3GQC A;  1SWW A;  3GII A;  4IRC A;  2KC1 A;  3FM9 A;  3M3J A;  2BGF A;  1ZJM A;  2ZW1 A;  3R2I A;  5TIS U;  1NJX A;  4BDP A;  1XD3 B;  4W9I A;  1YOV B;  5D3D A;  1BPB A;  2JV3 A;  1KFY B;  8ICV A;  4IOI E;  3TAQ A;  4N59 A;  1HE8 A;  1QOA A;  2E8N A;  5J17 A;  2KLG A;  2ZNV B;  4GU2 A;  5KFM A;  3PW0 A;  4C4R A;  4NL9 C;  5AKY A;  1BXT A;  3BZC A;  3NGD A;  5IIK A;  1UGJ A;  3UQ2 A;  4F2R A;  4ARI A;  1JRU A;  4L2Y A;  3UQB A;  3HW8 A;  2BWE S;  4HEA 1;  2H88 B;  4F93 B;  4KX5 A;  4KZC A;  3BII D;  5DQI A;  1ZQY A;  4M0A A;  1HZ6 A;  4LNN A;  2MBQ A;  2KQ4 X;  2E8P A;  3H8J A;  2INC C;  3OJU A;  1ZJN A;  4O5C A;  3DV9 A;  3KFU F;  4GB9 A;  4WH4 A;  1KM7 A;  2K8H A;  5JTI A;  4K4G A;  4XYC A;  2JXJ A;  3FIL A;  2MJE A;  4EZL A;  9ICK A;  3EC8 A;  1Y8R C;  3ONS A;  4J9R A;  3RI7 C;  2UU7 A;  4PK1 A;  3N20 C;  2I1J A;  5ALK A;  4EX6 A;  1QZE A;  5IO9 A;  3SR6 A;  1TYG B;  4OVV A;  2BYE A;  2R8H A;  2HBL A;  4GIB A;  1ZQU A;  4DQP A;  1FEH A;  3VAW A;  3TAP A;  4Q8E A;  3U4E G;  1AWD A;  1ROE A;  3MR6 A;  5AI6 A;  2QMT A;  2Z7J A;  3FC4 A;  1TK5 A;  3B1L X;  1BVS A;  1X40 A;  4J03 A;  5KL1 B;  3PMN A;  3PZP A;  2CRX A;  4PHE A;  1UGM A;  3B0A A;  1ZET A;  1V49 A;  4AS1 A;  3OGU A;  2MSN A;  1FO4 A;  1TKE A;  4BBN C;  5EE9 A;  3IG5 A;  4O3S A;  3QZ8 A;  2AGQ A;  1ZQJ A;  4M9N A;  2I1Q A;  5J2J A;  3Q3J A;  2M9N A;  4YD2 A;  4ZRQ A;  3VHT C;  3HM3 A;  3VDZ A;  3RBE A;  1FRD A;  4YG2 A;  4GLX A;  4NZL B;  1M6Y A;  3LVW A;  3MGV A;  1SE4 A;  2LYA A;  3DBR I;  5CX3 A;  2EAN A;  1NVI D;  1X66 A;  2INN E;  3PML A;  9ICC A;  4Q8F A;  3AM9 A;  2BTE A;  1JWS D;  1Y88 A;  4RQ7 A;  4N58 A;  4P16 A;  1J2N A;  4FHK A;  2F1J A;  4UQG A;  4RQ4 A;  2HTH A;  4RQ3 A;  2KWD A;  3JYU A;  1ZD2 P;  4S0R A;  2ZUB A;  4TQS A;  4MGY E;  4IS7 A;  3WAL A;  5KFY A;  3A9K A;  1TY0 A;  4HRS A;  2WDV B;  2LJI A;  2WF7 A;  4MM3 A;  1MHH E;  1IPG A;  2PMZ F;  1N63 A;  2EMS A;  3P4P B;  3RZW C;  5GXG B;  1K8R B;  5J2A A;  5CHW A;  3BYY B;  3ZQ4 A;  4LNK A;  1ZQG A;  1HEZ E;  4UAR A;  2XY5 A;  4TSS A;  1I7H A;  2KQ7 A;  2D3A A;  4YT0 B;  3N1Z C;  1OQQ A;  2VKQ A;  4W9J A;  5GMV A;  4PL2 A;  9ICJ A;  3H7P B;  3K4G A;  2BPG A;  2KKP A;  1NYR A;  3KYD D;  1ZOL A;  2E8O A;  1XCT L;  4BOZ B;  4YSZ B;  3MGI A;  4WWM A;  4FUL A;  2ALZ A;  4IQW A;  1N2X A;  5J8Y A;  4JV1 A;  3I1Y A;  3AEB B;  4MH0 E;  4DSE A;  3PT2 B;  1HIW A;  4RPX A;  5LLI A;  1HEK A;  2G0A A;  3QUB A;  2K6Q A;  3MHS D;  5C23 A;  4M04 A;  5D3I B;  2VJ4 A;  3ML8 A;  1ZQR A;  2K22 A;  2PKE A;  3V6E B;  1RFK A;  2O6V D;  3C23 A;  2GB1 A;  1SXE A;  1XSN A;  4MJS B;  4DOC A;  4EX7 A;  1SEB D;  4FAD A;  4GGQ A;  2HVI A;  1ESF A;  1T3Q A;  2KJR A;  1KTK A;  4Y2S A;  4Z6C A;  3HKZ F;  5DG8 A;  2QIL A;  2IJ0 A;  1QH9 A;  4DLE A;  1T6B X;  5AM0 A;  5KG4 A;  1F0M A;  4UBB A;  4B9U A;  2KP7 A;  2ASL A;  1NK4 A;  1J19 A;  4KIT B;  5J0R A;  2FCS A;  1LKY B;  4GOC A;  1P0R A;  3QU2 A;  3EUB 2;  4FXC A;  2B76 B;  1QCK A;  1TT5 B;  5KFJ A;  4JWS C;  3I3T B;  4IG7 B;  2B3A A;  4DL7 A;  2GLE A;  1WX9 A;  2AQ0 A;  1PGX A;  4PYZ A;  4F8R A;  3OWE B;  3SDL C;  3DQV A;  3TJP A;  5KHQ A;  2VRR B;  1MA7 A;  1N56 A;  5DBC A;  3PZ7 A;  3U7Z A;  5H2F U;  5J2E A;  1IIP A;  1D9F A;  4ED2 A;  4GXB A;  2N1R A;  2JMG A;  1XXG A;  1IGC A;  2QLT A;  4B6J A;  1X2I A;  4W9G A;  4MFA A;  3PSI A;  5DBB A;  2R8J A;  4I6P A;  1RQN A;  4NAW A;  4CNQ A;  5L1J A;  9ICW A;  1L0X B;  2NBU A;  2UWQ A;  2Z0E B;  4NNJ B;  1RXV A;  4CGZ A;  8ICW A;  2MEK A;  3DDH A;  4J9S A;  4TMA B;  3PV8 A;  2ZPY A;  4IC9 A;  2W3R A;  1QQR A;  4MFF A;  2VAN A;  4CO7 A;  4R8U B;  4ECY A;  1OXJ A;  1V86 A;  3SV3 A;  2PW9 A;  1CI4 A;  3L13 A;  2KJ6 A;  4TUU A;  4UAY A;  3S6J A;  4JWN A;  3RNF C;  4ED0 A;  3RH5 A;  4Q45 A;  5KAF U;  3H4D A;  3JPP A;  5DDM A;  2H3Z A;  2QIE B;  4YD1 A;  5KG1 A;  1XO3 A;  2LGY A;  2NPT A;  1J7C A;  4ECZ A;  2WLB A;  3AE5 B;  4LK0 M;  3N4M B;  2DKX A;  2W7O A;  2WXI A;  3SD5 A;  2KT7 A;  5JZE B;  1BPX A;  4WQO B;  1CQV A;  3DBH I;  4WJN A;  4B6W A;  5C2T B;  3PSF A;  3F53 A;  2JWU A;  1AAR A;  4JMU A;  2LMC A;  3QWZ B;  5HHI A;  4KLT A;  2NO4 A;  3KBB A;  4DDG D;  2PVG C;  1UWM A;  5DLG A;  1RFA A;  4A9A A;  5J2B A;  4O5E A;  5DPR A;  4TKN A;  4HRO A;  4DF4 A;  2KMD A;  4YMN A;  1SL0 A;  3GV5 B;  2IDY A;  2NVU I;  1L3T A;  3IBE A;  1JW9 D;  1NJY A;  4RQ5 A;  2D3C A;  4DL6 A;  2LXC A;  2NTS A;  3R2T A;  1GG3 A;  3Q8F A;  4NM1 A;  3WK9 A;  5AM4 A;  4JWM A;  4M9J A;  4OJL A;  5DKW A;  1D5Z C;  2N9K A;  3VH3 B;  4B0E A;  1VRA B;  2ZTD A;  4J9Q A;  2K39 A;  4UW9 A;  2F77 X;  4XQ8 A;  5DB9 A;  1ZQI A;  4KIK B;  2KE7 A;  4BJQ A;  1NK5 A;  2C60 A;  2SEB D;  1DK3 A;  1MVK A;  3Q6B A;  4GDK A;  2A1J B;  3B08 A;  4DO9 A;  1WGR A;  1B22 A;  1YZ6 A;  1MG4 A;  2WNM A;  1ZE3 D;  5FKA C;  2V9W A;  2N9E B;  3MC0 B;  4IKG A;  5J29 A;  3AL0 B;  4PS3 A;  4GFJ A;  3A33 B;  2ZCC A;  5KT7 A;  2LBO A;  4BOS C;  1EUV B;  3PW7 A;  2IPK D;  1DOY A;  2IGD A;  4C4V B;  1ZGU B;  2EAO A;  2KDI A;  4P1B C;  2GBR A;  2LPE A;  8ICR A;  5EOZ A;  1EWC A;  1UD7 A;  2MBB B;  2KMA A;  3WAP A;  1KDH A;  2LMR A;  9ICP A;  2KO3 A;  3A9J B;  4CF4 A;  1UCV A;  1QTM A;  4XRH A;  8ICI A;  3H8W A;  1SJH D;  3C1Z A;  2YN4 A;  3MFI A;  4HDQ A;  4C8O A;  2ZVN A;  4OZA A;  2L0F A;  3OTQ A;  4BKS A;  1A77 A;  2KHW B;  5KG5 A;  2DPJ A;  3UMB A;  4F1S A;  1RPL A;  2V4R A;  3RPF C;  1C76 A;  2GBJ A;  4F4K A;  4MEM A;  1YX6 B;  4C8N A;  3AEE B;  2P6R A;  3KUC B;  5CEH A;  4I2I A;  3C2L A;  2KDB A;  4RQ6 A;  4YP3 A;  9ICU A;  3PPA A;  2NTT A;  4LJO B;  1YQ4 B;  3H7S A;  4R3D A;  3ZXV A;  1J0G A;  3ZDB A;  4MEX A;  5IA7 A;  5AK4 A;  3N3K B;  2WU5 B;  4HCP B;  5KFR A;  2X8X X;  1TK0 A;  3MJW A;  2BPF A;  1OFF A;  1VCB A;  4OD0 A;  2ES6 A;  4CHK A;  1LFD A;  2FCM A;  3MP9 A;  1UA0 A;  2KFK B;  1C4P A;  4X5V A;  2KG5 A;  2YEP F;  1STE A;  4UAS A;  4I2G A;  1S97 A;  5DCN A;  3KZX A;  4OO1 J;  5J0Q A;  4DSF A;  2BCV A;  2ZIX B;  1N62 A;  1P3Q U;  1GAQ B;  3KHH A;  4J9O A;  2W8K A;  3H7P A;  1K51 A;  2C2D A;  3IAM 1;  5J2F A;  3BZK A;  2FDR A;  4I2A A;  2QKQ A;  3Q3F A;  4I2C A;  5AM1 A;  2C28 A;  3DVG X;  3C2K A;  4FZN A;  2R2O A;  4JGH B;  4NJ6 A;  2CN1 A;  4Y2Q A;  5J2G A;  1F77 A;  4ICV A;  8ICN A;  3C5F A; 
#chains in the Genus database with same CATH homology
 1TS5 A;  1ZP0 B;  3L4P A;  1D6E C;  4OZC A;  2GI9 A;  1AN8 A;  1RWS A;  1IUE A;  4US8 A;  2WXF A;  1FNU A;  3Q8E A;  1MI0 A;  3W5V B;  2Y5C A;  3GP7 A;  5EE1 A;  1YN3 A;  1FIQ A;  2WQY B;  3BK2 A;  4KGS A;  4ZYS A;  1XLP A;  1E10 A;  3W9C B;  4WIP A;  1ZXI A;  1L5P A;  3CIR B;  3B2F A;  2MJD A;  1YJI A;  1J7A A;  1EU4 A;  2QSD A;  1UUP A;  5FR3 A;  5G5H A;  3AE4 B;  4DXG A;  2R61 A;  4JE3 B;  4LLG M;  1K53 A;  2CJN A;  2N9L A;  1JML A;  4MAC A;  1C4A A;  4XDC A;  3T3N A;  1N5W A;  1J7B A;  3P4S B;  2PKO A;  5H8Y E;  1TKY A;  1C77 A;  4OVZ A;  5E6J A;  5EE0 A;  4GDL B;  2BS4 B;  3Q8A A;  4ZOH C;  1SSN A;  3AE9 B;  4C80 A;  5H92 C;  4CQN A;  2XNA C;  3EGR A;  2IGH A;  1ZDV A;  3MHZ A;  4RH6 A;  3W5U B;  2I38 A;  1C78 A;  1UWX A;  1XLN A;  2Z8L A;  3BVZ A;  4NJC A;  4ZHO A;  1DOI A;  3AEF B;  5I4D A;  1C9F A;  4WUR A;  1FFU A;  3AE8 B;  4JWU C;  1SE3 A;  4OZB A;  2VZK D;  1QOB A;  2CJO A;  3VR9 B;  1I4X A;  1K50 A;  3VRB B;  3NVW A;  2PIA A;  3ZYY X;  2ZW0 A;  2RDG A;  3AH7 A;  2V3N A;  5AUI A;  3HUI A;  4DQO C;  2VZK B;  5G5G A;  5BYS A;  2OHF A;  4NAW B;  3IAS 1;  2L32 A;  3BK1 A;  2QEJ C;  1JAL A;  1SF0 A;  3AEC B;  2E3T A;  1JWU D;  4HJG E;  1JRO A;  4UDU C;  1TY2 A;  1SB3 C;  4OHJ A;  1L4D B;  1XEE A;  1WGK A;  1N61 A;  1KRH A;  2V3P A;  1FNV A;  3E56 A;  2LEK A;  2PVO D;  5BMH A;  4YSX B;  3UI3 A;  2DWQ A;  2KAC A;  1MPE A;  1TKG A;  1XF5 L;  2J4X A;  1D4B A;  2OED A;  2TSS A;  4KKI A;  1F2R I;  1GB1 A;  2WXK A;  1SIJ A;  4YTP B;  5LNK 1;  2WXN A;  3AE7 B;  3I9V 1;  2WXG A;  2WXH A;  3EA6 A;  2BS2 B;  1L4Z B;  2ZW1 A;  3R2I A;  1HXY D;  2K0P A;  4WQM A;  1WRI A;  5D3D A;  1L6V A;  5C3J B;  1KFY B;  1NEN B;  4IOI E;  1PFD A;  3B2G A;  1QOA A;  3P63 A;  1D5X C;  2PTL A;  4N59 A;  2L83 A;  2J52 A;  2WXM A;  1BXT A;  3P1M A;  3I57 A;  4ARI A;  1UGJ A;  2BS3 B;  1ENF A;  2BB5 A;  4L2Y A;  4HEA 1;  2H88 B;  1HA5 A;  2WXP A;  3BII D;  1TZO A;  3R8B A;  1HZ6 A;  4YSY B;  2WXJ A;  2KQ4 X;  5BYR A;  3H8H A;  1RYJ A;  1SXT A;  2BBC A;  3AEG B;  1I4P A;  4WH4 A;  3VR8 B;  4DXF A;  1OQR A;  2LUM A;  1QOF A;  4ITK A;  2FE8 A;  3FIL A;  4XDD A;  1QT9 A;  2MJE A;  4WAF A;  3AE2 B;  3HVZ A;  3V05 A;  3BYT B;  1VJK A;  3SR6 A;  2H89 B;  1TYG B;  4RCO A;  5FK9 C;  1FEH A;  1P7E A;  1I4Q A;  4A55 A;  2G9H D;  1NI3 A;  4HKZ E;  4XE0 A;  3U4E G;  3KQ4 A;  4O1N A;  1AWD A;  1ROE A;  3ABV B;  1FRR A;  1VZ7 A;  2QMT A;  1FD6 A;  3FC4 A;  1MHX A;  2DYO A;  4B0M A;  4YTN B;  4AS1 A;  2GRI A;  1FO4 A;  3AE6 B;  1TKE A;  1TS2 A;  1VLB A;  5EE9 A;  4A6Q A;  2M56 B;  4US9 A;  1C79 A;  4ZRQ A;  3C8Y A;  1FRD A;  4MT5 A;  4NZL B;  3W2D A;  3NRZ A;  2L52 A;  2JQR B;  3Q8B A;  1SE4 A;  3LB8 C;  4L23 A;  2HDE A;  1NVI D;  1QIL A;  2INN E;  3NZ3 A;  1IBX A;  2KMM A;  1RM6 C;  4AQ7 A;  3AM9 A;  2BTE A;  1JWS D;  4P16 A;  4N58 A;  1PGB A;  1V1P A;  3URY A;  2WXO A;  2WXQ A;  4Q2J A;  2KWD A;  1WYG A;  3NS1 A;  3N9Y C;  3TEY A;  1FM0 D;  1TY0 A;  4HRS A;  1YNT E;  3NUH B;  2WDV B;  2LJI A;  1E9M A;  1B9R A;  1MHH E;  2INP E;  3KWV A;  1N63 A;  2QJL A;  3P4P B;  1VZ8 A;  5GXG B;  3LXF A;  1IGD A;  3BYY B;  3ZQ4 A;  5BMI A;  1HEZ E;  4LTU A;  4TSS A;  1I7H A;  2ON8 A;  4C56 C;  1WXQ A;  1FNW A;  2SAK A;  4YT0 B;  3AEA B;  3IT4 B;  2K5P A;  1OQQ A;  1ZOY B;  4TQ1 A;  1JCK B;  3Q69 A;  2JZP A;  3BVM A;  1SBB B;  1Q10 A;  1NYR A;  1XCT L;  2JXT A;  5TSS A;  1DGJ A;  4YSZ B;  4WWM A;  1E6E B;  3TEW A;  3AMZ A;  2D5G A;  5D7G A;  3NVZ A;  4RGN A;  2DLB A;  3P4Q B;  2IGG A;  4YWG G;  3AEB B;  3CWI A;  4RGT A;  3V3X A;  1QKZ A;  5HFY A;  2KDM A;  1YN4 A;  1KLG D;  1ET6 A;  5D3I B;  2AX5 A;  2K22 A;  4XWT A;  5BMG A;  1RFK A;  2RMM A;  2BYT A;  2GB1 A;  2N7J A;  1JRP A;  1KLU D;  2X38 A;  1EU3 A;  1SEB D;  2ONQ A;  1FXI A;  1ESF A;  1T3Q A;  1KTK A;  1PGA A;  2QIL A;  3PO0 A;  2IJ0 A;  1EM7 A;  1T6B X;  1ACC A;  4REZ A;  4RFB A;  2M0A A;  4JX1 C;  2JX5 A;  3SFD B;  2WDQ B;  4C7Y A;  4ZHP A;  1D5M C;  1GOZ A;  1TS4 A;  1QOG A;  1DOX A;  1YQ3 B;  3EUB 2;  4RF0 A;  4FXC A;  2B76 B;  2AQ3 B;  3P4R B;  2V0G A;  1QLB B;  1CK1 A;  3MJ5 A;  4RNA A;  4JWS C;  1LO5 D;  4YTM B;  1E7P B;  1PGX A;  3OWE B;  4JPS A;  1PUT A;  3GS2 A;  2MH7 A;  1TJE A;  3PZ7 A;  2WXR A;  3U7Z A;  2G1E A;  2LHE A;  1FMA D;  3Q8C A;  4GDK B;  4KX6 B;  2AQ2 B;  2ICI A;  1XXG A;  1IGC A;  3PZ8 A;  2BB6 A;  4A8X C;  3DWM A;  2Y3A A;  1XLQ A;  1I4G A;  1N60 A;  4USA A;  1L0X B;  1F2R C;  3MFG A;  2MEK A;  2XN9 C;  2KAJ A;  1NYQ A;  4TMA B;  3AV8 A;  2KN4 A;  2K3U A;  4D2K A;  2W3R A;  1QF6 A;  5JXV A;  1QQR A;  2FBW B;  1VDV A;  2PW9 A;  4M0W A;  1V8C A;  3ZJU A;  1Y56 A;  1YMH E;  1N5X A;  4A90 A;  1TS3 A;  4KGT A;  4L1B A;  1GB4 A;  2W3S A;  2E6X A;  2V4I B;  1EWY C;  1XLO A;  2QIE B;  2WLB A;  3ZJT A;  1XO3 A;  3AE5 B;  1J7C A;  5BYQ A;  4LK0 M;  4H2A A;  3SFE B;  2J53 A;  2WXI A;  1ZUD 2;  4GLS C;  1KF6 B;  3IT6 B;  1PYW D;  1C4C A;  2JYT A;  3IXS A;  1CQV A;  2FUG 1;  2Y5P A;  4EE2 A;  1ZPS A;  5C2T B;  1BUI C;  2JWU A;  2L1A A;  4PT5 A;  1AW7 A;  2DBY A;  1WSP A;  2WXL A;  4IDI A;  2HTM E;  2LMC A;  1KH0 A;  3TEZ A;  1CZP A;  3VRA B;  1E0Z A;  3TUO A;  1SJE D;  2JSV X;  1UWM A;  1YJJ A;  2PVG C;  3AED B;  2J42 A;  2W82 A;  1NEK B;  3O13 A;  4RF1 A;  4A9A A;  4HRO A;  1F0Z A;  4P6V F;  2IDY A;  1JQ4 A;  2LHD A;  1JW9 D;  4MH8 A;  2NTS A;  1FCL A;  3KLS X;  3R2T A;  3DWG C;  3Q8F A;  4ZRP A;  1ZXH A;  2MJ3 A;  1M4V A;  1FFV A;  2M19 A;  3BZD B;  2RDH A;  4XWW A;  1D5Z C;  3WCQ A;  2N9K A;  4NAM A;  4B0E A;  1VRA B;  3ZJV A;  2EKI A;  3BWU D;  1XCQ L;  1A70 A;  4OW0 A;  4N6E B;  4TQ0 A;  2SEB D;  3ETR A;  1MVK A;  3AB5 A;  3HRD D;  2ACZ B;  3TEX A;  3AN1 A;  4C7Z A;  4YXD B;  4RGO S;  2WNM A;  1ZE3 D;  5EE3 A;  5FKA C;  3MC0 B;  3E9S A;  4IKG A;  3GB1 A;  4ARC A;  1AYF A;  1WWT A;  1DOY A;  2IPK D;  2IGD A;  1K52 A;  1V97 A;  1ET9 A;  2LGI A;  1HZ5 A;  3FIL B;  1JWM D;  1L0Y B;  2CU3 A;  1EWC A;  1I4R A;  4RGM A;  2LFI A;  3VQI A;  1P7F A;  2WU2 B;  1SJH D;  2PLP A;  5HHD G;  3P42 A;  2JU6 X;  2EEL A;  4KGR A;  1T5X D;  3T3O A;  4OZA A;  3J9C A;  2W55 A;  2WS3 B;  2I2Y A;  1ZDX A;  1GPX A;  1YN5 A;  1SE2 A;  3SEB A;  3HVD A;  3U52 E;  3W1S A;  3RPF C;  1C76 A;  2WP9 B;  2PMV A;  1UNS A;  3KWL A;  2BW2 A;  3B9J A;  4HKQ A;  3AEE B;  3BVG A;  5AUK A;  5T8I A;  4KKJ A;  2DYM A;  2NTT A;  3NVY A;  1CJE A;  1YQ4 B;  4J3O D;  2K9X A;  4R3D A;  3ZGZ A;  1IBX B;  1L0V B;  3LYY A;  2N0S B;  3FAH A;  1R7S A;  2WU5 B;  2W54 A;  3U2S C;  2BT6 A;  1V1P B;  1PDX A;  2JYE A;  1OFF A;  1FCC C;  1V1O A;  2NMQ A;  3MP9 A;  5HG2 A;  1FXA A;  3RFZ B;  1B1Z A;  3AE1 B;  1JWA D;  2WDR B;  3TSS A;  1C4P A;  2YEP F;  1STE A;  4MM3 B;  1HQR D;  1N62 A;  1GAQ B;  1DYQ A;  3IAM 1;  1K51 A;  5HI1 A;  1JWB D;  1I4H A;  3NVV A;  5MPO A;  2AQ1 B;  2RPV A;  1L6U A;  2YEP B;  1F77 A;  3AE3 B;  1VR9 A;  2Q5W D;  1VZ6 A;  1BML C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...