3NS1A

Crystal structure of bovine xanthine oxidase in complex with 6-mercaptopurine
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
164
structure length
164
Chain Sequence
TADELVFFVNGKKVVEKNADPETTLLAYLRRKLGLRGTKLGCGEGGCGACTVMLSKYDRLQDKIIHFSANACLAPICTLHHVAVTTVEGIGSTKTRLHPVQERIAKSHGSQCGFCTPGIVMSMYTLLRNQPEPTVEEIEDAFQGNLCRCTGYRPILQGFRTFAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Xanthine dehydrogenase/oxidase
publication title Substrate orientation and catalytic specificity in the action of xanthine oxidase: the sequential hydroxylation of hypoxanthine to uric acid.
pubmed doi rcsb
total genus 39
structure length 164
sequence length 164
chains with identical sequence J
ec nomenclature ec 1.17.1.4: Xanthine dehydrogenase.
pdb deposition date 2010-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 3ns1A02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3ns1A01
4USAA 3AEDB 4C7ZA 3L4PA 1OFFA 1RYJA 1ZUD2 3HVZA 1FXAA 2BS4B 1J7BA 1J7CA 1AYFA 2AX5A 2CJNA 4N59A 4YTNB 1JW9D 3LXFA 1KF6B 3AEEB 3AMZA 3CWIA 3P4QB 1E10A 5G5HA 3DWMA 1YJIA 1WRIA 3ABVB 1V97A 1JRPA 2W55A 1SIJA 2WLBA 2WU5B 1ZP0B 4P6VF 1L0VB 2CU3A 3KWLA 3B9JA 1QOFA 1J7AA 4N6EB 4YSYB 2DWQA 1JWBD 3AE8B 3W5VB 2QIEB 1JROA 1N5XA 3HRDD 5AUKA 1XLPA 1CJEA 3EUB2 4ZHPA 1YJJA 4WWMA 1UWMA 4JWSC 2DBYA 1KRHA 2BS3B 2MJDA 1TJEA 1QOGA 1VJKA 4YTMB 1T3QA 3AM9A 3AB5A 5EE9A 1EWYC 2W3RA 1NVID 3NS1A 1N62A 2H88B 2KAJA 4FXCA 2Y5CA 3VRAB 2W54A 5G5GA 4IDIA 2MJEA 2OHFA 3VR9B 3LB8C 1N5WA 3SR6A 1I7HA 3W5UB 1FXIA 3AE6B 2WP9B 1IUEA 5C3JB 1OQRA 1ZXIA 3NRZA 5H92C 1JALA 1E0ZA 1JQ4A 4HRSA 4N58A 2G1EA 2WDRB 4C80A 1RFKA 3B2GA 2PIAA 3NVWA 1FRDA 3FAHA 1XLNA 2K5PA 2WDQB 3ZYYX 2H89B 4YSXB 1VLBA 1QT9A 2BT6A 1TKYA 2BS2B 5H8YE 1KFYB 2L52A 2N0SB 1DOXA 4WQMA 1PUTA 1TKEA 2PVGC 1L6VA 1N61A 3P4PB 1NYQA 3NVYA 1RWSA 2CJOA 1WWTA 3P1MA 2MH7A 1L6UA 4C7YA 3P63A 1RM6C 3AE1B 3PO0A 1GPXA 2K9XA 2FBWB 1XO3A 1QF6A 1B9RA 1V8CA 3AEFB 1FO4A 1R7SA 5MPOA 1TYGB 4US9A 3AEGB 1SF0A 1YQ3B 3NVZA 2HTME 2PVOD 2MJ3A 1ZOYB 2EKIA 2K22A 1XLQA 1FM0D 3ETRA 2W3SA 3AECB 3SFEB 1QOAA 3VRBB 1N60A 3AEBB 3B2FA 2WDVB 3AH7A 3BIID 5EE1A 3AE4B 4US8A 1NI3A 4YSZB 3FC4A 1L5PA 1E9MA 1ROEA 2QJLA 4YTPB 5C2TB 1NEKB 3AE5B 1XLOA 5EE3A 1SB3C 2E3TA 3AE9B 3AE2B 2WS3B 1DOYA 3AE7B 3HUIA 3AE3B 1TKGA 2JQRB 3DWGC 1FIQA 4ZOHC 1CZPA 1GAQB 3AN1A 2L83A 3AV8A 4YXDB 1WXQA 3P4RB 4ZHOA 1FRRA 1E7PB 2JX5A 5AUIA 1PDXA 3WCQA 2B76B 3VR8B 1OQQA 3NVVA 3CIRB 3W9CB 2M56B 4LTUA 1AWDA 1FFUA 2Q5WD 3P4SB 4HROA 1DGJA 1FMAD 2WQYB 4KX6B 3AEAB 5EE0A 1E6EB 1NYRA 1YQ4B 1DOIA 3SFDB 1PFDA 1WGKA 2PKOA 2ACZB 1JWAD 5GXGB 4ITKA 1NENB 2WU2B 2KMMA 2LEKA 2M19A 4JX1C 1WYGA 4YT0B 3RPFC 1N63A 1VDVA 1F0ZA 1QOBA 4JWUC 1FFVA 1QLBB 1A70A 4A9AA
chains in the Genus database with same CATH superfamily
2K4IA 2GBJA 2KJ5A 4EBDA 5AI4A 1BPBA 4B9TA 2ZIUB 4KLDA 2BB6A 3RJKA 2HBKA 1NK0A 3DQVA 1YJIA 2LXCA 3PZ8A 1XS9D 4PS8A 2NRTA 4RQ2A 3KHRA 5T8IA 3V6HA 4A55A 2W7OA 4B9SA 4RPXA 4LNFA 2YMMA 3JSVB 1ISNA 1TGZB 1JROA 4QZDA 1ZW7A 5BO4B 5AM4A 2MSED 4RUCA 4I29A 1M4VA 2BWFA 5KFFA 2RPVA 4PZNA 1JCKB 4JQWC 7ICUA 4P0QA 1WX7A 1J8CA 2B21A 2KMAA 2YB4A 4F5PA 3UM9A 3VRAB 4RQ4A 3VR9B 4IDIA 3EYZA 4GDLA 3NZSA 1WJUA 3VHTC 2ASDA 3OLMD 4ICUA 4MJSB 2DNFA 9ICEA 1I42A 3VTUA 1MQ2A 4MM3B 3WKCA 3M9MB 3G6XA 4YMMA 4PL1A 1E0ZA 5ALTA 4RH6A 4DF4A 5DPSA 4DS5A 4RNOA 4JLCA 4HCNB 4M02A 1C4CA 2K4HA 5IP4D 1VLBA 1X42A 3KKAC 4A3OA 3UQBA 9ICPA 1L8OA 5AI8A 5J0SA 1E90A 4AWJA 1ZD3A 3IN5A 4TSSA 3VAWA 4N9F4 2ASQA 2AXTU 2IGGA 4UDUC 3BZCA 1XSNA 2EZZA 3AE1B 3P2BA 4ECUA 2IMWP 4Y2RA 2L05A 1QF6A 3BYYB 5MPOA 2FPKA 4EZKA 2BQUA 2X8XX 1ZGUB 3HKZC 3AUOA 3JW0X 3AH7A 2MUTB 4US8A 4W9DA 4W9CA 2QJLA 2BYEA 1P7DA 2K6DB 3RAXA 4DHZE 4QWCA 3IG3A 3QWZB 3LDAA 1RLFA 2KN5A 3DBRI 3OG5A 3T5LA 5ALJA 4FA6A 1TKGA 3H1UA 3M6KA 3PR4A 2NO5A 4QZCA 2BW2A 4YVZA 4LNIA 3PHWB 1NBFC 3P4RB 1L8LA 1UH6A 3Q3JA 1PDXA 1KLNA 1OQQA 1UBIA 1X9XA 3OJUA 1NK9A 2LUEA 4CDGA 4EX6A 5BYRA 2O6KA 1V49A 2FIFA 3HKZF 2KVCA 1SL0A 1SL2A 3IBEA 4HLEA 2MBEA 3IXSA 3RMKC 4F91B 2AYOB 1G6JA 2FAZA 4A3PA 3HM6X 1XO1A 4M6WB 3SZ2A 2JRZA 3VVWB 1HIWA 2ZIXA 1DOQA 3ML9A 2DFLA 2PE6B 2DZJA 1NZBA 3ZDAA 3RR8A 3B0YA 1J7BA 3BQ2A 3C19A 4IG7B 4KIKA 4Q8EA 4WJNA 2MRLA 3LXFA 3ZIMA 5CB1A 4F4YA 2WAQC 4DSFA 2K3UA 2GOLA 4GC7A 1WJ6A 5JU5A 2FPMA 3C2LA 4DXFA 4QWBA 4GIVA 2WB1C 2Y5PA 3GU3A 2KQ4X 2G06A 4P6VF 1NKEA 9ICHA 1CK1A 2JHDA 9ICRA 2J6TA 1ZQCA 4KLUA 3PSTA 3V7JA 3H7PA 5IINA 4XX5A 1CJEA 3TIXA 1YD8U 3HIZA 4JV1A 5AKHA 2BR0A 1NK5A 2NCNA 3TAQA 4F2SA 2MA1A 4ELUA 1ACCA 2WAQF 2FJ6A 8ICSA 4B95A 1WI0A 2M0AA 1PVPA 4IC9A 5KFAA 5D4BA 3PLVA 3D6JA 3IDWA 7ICQA 3Q8RB 2AGPA 3VXWA 1MSWD 1JUDA 2MEKA 5CRXA 3EWAA 8ICVA 3L13A 1QILA 2KKPA 2ESEA 2DLBA 3B2GA 3NVWA 3MDCA 2R8KA 3ZYYX 3PW2A 5KT2A 3WA0A 4F8RA 2PI4A 1E5WA 3BY4B 2Z7JA 3C5GA 3T8MA 4PH5A 3T5JA 3UIOB 4MGYE 4ARIA 2M0XA 1ZJMA 1ZRNA 4PZOA 2JXTA 4QWEA 4FJZA 1WMHA 4HJKA 1YX6B 4RU9A 1WE7A 2WXRA 2L7RA 2DYMA 2KOXA 1ZQVA 3PRMB 1YQ3B 4LZGA 2FE8A 2UVUA 1UWXA 4MACA 2K8AA 1EU4A 2QEJC 2MHJA 2KK8A 5CHVC 2Y1JA 4M9HA 1ROEA 4YTPB 1B1ZA 2KVRA 1T0QC 3PT2B 4NM1A 2KZRA 3C29A 3ZDCA 3JPTA 5ALMA 1V9JA 2NMQA 3URYA 1DOYA 4NLKA 1SE9A 4KKIA 4F93B 4OJOA 2Q0ZX 2BPSA 3AQFA 3WAMA 4LDTB 1TK8A 4F8CB 2LHEA 1SKWA 5DB9A 4GB9A 1SWVA 1WUDA 1L7YA 5AM3A 1Q0WB 1E6EB 1NNLA 2ZIVA 3UMGA 1WYWB 4Y2XA 3THVA 4K81A 4LK0M 3ZNZB 3UIPB 3K1ZA 4WH4A 3N9YC 3TL5A 1N63A 2JT4B 3KBBA 4R8UA 4O0IA 1X1MA 3QX7A 4C7ZA 1JN3A 3E2EA 4J9PA 4IR9A 2FLLA 4IWPA 2FLPA 4AQ7A 4I2HA 1QH9A 2NPTA 2DZIA 1LM8B 2RDGA 2V4IB 2KDIA 5TISU 4J9SA 1MN8A 5AKZA 1L0VB 4NLNA 3KWLA 5ALSA 1AW7A 4KDLB 3B0AA 3U8ZA 5BMHA 2D8CA 2RDJA 3IV6A 5IIMA 4O5CA 1Z4OA 4CF5A 1V6EA 3V60A 2A1AA 3WK5A 2QARA 1WGHA 4HPMB 5TR5A 1UWMA 4R65A 4XYCA 4DQPA 3B08A 2IPKD 3NZUA 3AL0B 8ICXA 4GXBA 2WXMA 1HJPA 1WM2A 2LGIA 5G5GA 3ZNGC 2KFZA 2DYBA 2EDUA 1SBBB 5KFIA 1VZ7A 1GJZA 4CHKA 1DGSA 1K50A 1XWLA 5AKYA 2JEIA 3HPOA 2G5IB 2SEBD 5E6OA 1RFKA 4YMNA 2LKYA 3JPNA 4IR1A 3T5HA 2BYFA 4DL2A 5KFHA 2AGQA 4KLGA 1TT5B 4AYBC 3ZNHB 3PSPA 1KRPA 1DOXA 5DQHA 4EELA 5AI6A 4GXIA 3Q8BA 3Q14C 2QSDA 1ZQSA 1WXSA 4IQVA 2ODGA 5ALVA 2ZIUA 4UAZA 5IOIA 3CP8A 1WJNA 1L6UA 3ED5A 4L2YA 4FLHA 4DFMA 4MGKE 3QCAA 2K9XA 2KQ7A 3H8SA 2ZW1A 5ALZA 3QNMA 1L4ZB 3GIJA 1P7FA 5G2NA 4I2AA 2L1AA 3AI5A 5FP0A 2K8BB 3F5EA 1HEKA 2C7MB 3M1YA 1DK2A 2XC9A 1WM3A 4EYIB 4AYBF 3R2TA 1J0GA 3WKAA 4CQNA 1TK0A 3W1SA 1S1QB 1FNUA 1T0SC 1SB3C 2CU1A 3N4MB 7ICFA 3AE7B 3HUIA 4QZ8A 2XK5B 3UMCA 2XGQA 1X9WA 2LGDA 1LKYB 1U47A 1CZPA 1ZXHA 5J0PA 4GDKA 5AUIA 4ZRKA 4ZRIA 3GS2A 2M56B 2W9MA 1SE4A 4MJSA 3TJPA 1FMAD 5AZHA 2FUHB 1TS4A 2PJHA 3KZXA 4DSKA 4EZ6A 1SE2A 2ZVOA 5GTIU 4YCXA 2PFPA 2ACZB 4C4SA 2KNBA 2CS4A 5KG4A 1SXTA 2F2AB 4GLXA 1PUZA 2KMMA 5E79U 3APDA 4YT0B 5C0YA 2ZEQA 5AI5A 2OJRA 4EBEA 3RH5A 3QA8A 5LLIA 3R3MA 1QTMA 4XWWA 2ZG6A 4GU2A 2N7DA 3BYTB 3S2AA 4ED8A 2GBRA 1WGYA 3QAQA 4QW8A 2LZ6A 2IGDA 1JW9D 2HD5B 3AEEB 4DOBA 1I4QA 3DWMA 5DBAA 2RR9A 3H4BA 3RJEA 8ICYA 2OOBB 5IIJA 1E8ZA 2FMQA 2BDPA 4O3MA 1WXAA 1RRBA 1XCQL 2JYTA 1QOFA 1XNSA 5KG0A 3A9KB 1KTQA 4RQ1A 5CHFA 3DDHA 3HRDD 1ZQYA 3N1YC 2MUTA 2D5GA 2JRIB 3KUZA 3ZVVA 3EZ5A 2PFOA 1L0XB 3QARA 3DVGX 4PT5A 4RZRA 4KLMA 1Z19A 4IS7A 1YX5B 3H8HA 2LYAA 1VJKA 1ZPSA 3D2QA 4QW9A 4M9JA 1PVRA 4PHDA 3DOWA 1COKA 2W54A 4B6JA 3N97B 1F9JA 1ZDXA 3FDSA 2IBIB 2IY0B 2MBOA 4DWFA 3JPRA 4BXOB 4IM0A 3RI7C 5KFNA 4TUSA 5L95C 1IIPA 4QZEA 1TY2A 4P2HA 4GSWA 1BMLC 1QSSA 1ZXIA 4C8KA 1K1QA 1JALA 2OEDA 4JE3B 4PHEA 2BCRA 3RFZB 2WXPA 3SENA 4MFAA 2K5PA 2QC8A 3N7SC 2BYTA 4M6WA 1NK4A 4LVSA 1VCBA 2ON8A 9ICXA 4RGNA 3IG5A 2YEPB 2KJRA 2LJ5A 2RHFA 4DDGD 2YTUA 2J6UA 3HHMA 1S5LU 2KMDA 4NY8A 3H0MB 3Q8SB 8ICZA 2JZ3B 4UAWA 2KICA 1BPEA 4PJ0U 2I1KA 4OO1J 3MR6A 2KOBA 2KFKA 4ZH4A 2E6XA 5LNK1 5EOZA 3ZRCA 3ALRA 2INNE 2BYVE 1NI3A 5AM5A 2YQEA 5KFOA 2W9BB 3R7QA 4IL6U 2YLMA 2EQYA 2VKQA 1L7OA 2HVHA 2HTHA 1FIQA 2L83A 5CP2A 1C77A 4NNJB 4X5VA 2XEWA 3PW0A 2WXQA 4EENA 3IAS1 4B9MA 2C2RA 1P9DU 2ZIWB 1GNUA 2X38A 4LTUA 3P4SB 1EU3A 2LYBA 3TADA 1HA5A 1ET6A 1VZ6A 3F5AA 1Z2MA 1Q46A 3OPXA 1JIHA 4RQMA 3H7IA 3G6VA 3V72A 2I38A 2KANA 3A4RA 2KJ6A 4UATA 4W9GA 5J0XA 2DPJA 2AU0A 1R4NI 4RUAA 1F0ZA 4OJLA 4YN4A 1QSYA 4NLGA 3N1XC 4WAFA 2L0FA 4P0PB 5KFDA 3A0BU 1YOVB 2ES6A 1ZQIA 1FPYA 4Q2JA 4CRXA 1IYFA 3ZW3A 4KMUA 2CJNA 1L3VA 3LWLA 1O03A 3RRGA 5ALHA 5D46A 3WKDA 4DQIA 1GUAB 3TANA 3L5KA 3NHEB 3CW2C 4P4MA 3OSPA 2CKHB 1J2NA 5CHGA 2RMMA 4NV0A 2JZZA 1TZ1A 1PYWD 1L0YB 2KD1A 4LDTD 5J0UA 4L23A 5J2CA 2XGPA 3N28A 3W5VB 3RH6A 1WGDA 5HNKA 5LXIB 5AICA 3KYDD 8ICBA 3C1YA 2K8HA 2KJ9A 2ZW0A 2XCPA 1WX9A 1S97A 1WG8A 4O3OA 3TFSA 4M9LA 1TFRA 1K52A 1R4MI 2MBHA 3T5KA 3TEXA 1XT9B 3TMPB 4W9JA 4YTMB 2LVPA 3PVLA 2LWPA 4FBTA 2HCFA 3S6JA 4KLOA 2Y0SC 4AJWA 3DBHB 2DPIA 1ZOLA 2KZZA 4C4VB 4DHZB 2KKVA 3GV7B 2IZVB 2FDRA 5KFTA 1Q1OA 3A4SC 4CYEA 1ZQRA 3QK0A 2FI1A 2V9WA 1XQQA 5KAFU 5J2EA 4I2EA 4II2B 1F5SA 3GIMA 3VCBA 5AEKB 4DQRA 1DXSA 2H89B 1HE8A 1NOMA 1KFDA 2FIDA 1QCKA 5KFXA 3ZTDA 4R64A 4I2FA 5DGAA 3EA6A 5DBBA 1SGHA 4O5EA 2OH2A 2Y0SF 4YXMA 1KLUD 4XGAB 2XICA 1NKBA 4Z6DA 2FBWB 5ALYA 2JMGA 2VZKD 2V0GA 4ECVA 4NLCA 1HQRD 2HE7A 2KTFA 3I63C 5HHIA 1PGXA 4ZRJA 2MCNB 2KDEB 2CHXA 3M95A 5CX3A 3KKAA 1N2XA 4BX9C 5D6JB 3H4DA 7ICKA 1C76A 2OJWA 1D9FA 1YJ1A 3B2FA 2KV2A 4UBCA 5HR6A 3BS5B 3K1RB 4Y2VA 5AKEA 3T79A 2VA3A 4A8EA 8ICUA 2QDFA 4REZA 3QC8B 5KT4A 3HM3A 4RM9A 1SV0C 4RNMA 2FPLA 5F9NA 4RF0A 4NY0A 3PW4A 1OEYA 3M3JA 3ZO5B 2AJQA 2W9AA 4ECQA 3VR8B 1V5OA 3SAGA 2BCQA 1JMSA 1CMXB 2ATLA 1FNVA 1QKZA 3TEZA 1U48A 2JGAA 1AWDA 1ZQWA 3TARA 2NTSA 4IRKA 3H40A 5EE0A 4KZCA 5TZVA 3HWTA 4KLJA 3PX4A 4XQ8A 3JPSA 3PY8A 1KLGD 1V1OA 3OHAA 5KT7A 2DKZA 3ISDA 3J81j 3C2MA 2I9GA 1SKRA 1FXAA 3Q6BA 2MSNA 3QQ8B 4KV2A 4TV3A 1NK8A 3C0RB 4YXDB 3TSSA 2DENB 4BBNC 3RNGC 1PK1B 4JGHB 3UPQA 1BUIC 4NL9A 5DDMA 2BQ3A 1U49A 2HVIA 9ICVA 3K9PB 2WF7A 5AK5A 4LZDA 7ICMA 4XWTA 3KZIU 1ZQJA 2H3ZA 3RNBC 2INDC 3AEVA 4J9LA 5JXVA 3AE8B 2K8BA 1JX4A 2GO7A 4BAXA 1HTOA 5F9LA 3U30A 2WF5A 3AU4A 1JXEA 2J0MA 5JZEB 5IIIA 5B66U 1P7EA 3CSTA 1LFDA 2EELA 3RRHA 1AARA 2LFIA 1WXVA 4MFCA 2IO3B 1ZQQA 3UF8A 2I1JA 4BBNF 2XK5A 5EE9A 4I2CA 1LKYA 2MQJA 1RPLA 1S8OA 3UMBA 5ALXA 4HKZE 4C56C 3QIJA 1FD6A 2V9HA 4FZMA 2NR2A 2WXLA 1JQ4A 4W9EA 2MWSB 1VJ5A 2PLPA 3CMMB 3RUIB 2OWOA 5DPWA 3QEAZ 1WF9A 2WGSA 3VH4B 3MJWA 2R2OA 4XDCA 1V86A 3MC8A 1X9SA 1E7UA 4DSIA 4Y2PA 4OHJA 2FLNA 2GMIC 3BQ1A 1ZKHA 3H8JA 1RZTA 1XO3A 1B9RA 1IGCA 5J8YA 1TK5A 3T3NA 2K8CB 3AEFB 4KLFA 4HWIB 1ZD2P 1CQVA 4B0MA 3RT3B 2DF4B 8ICQA 4GOCA 4NJCA 3PLUA 2A1JB 1ZQFA 3DVNV 3SMVA 4K1RB 1V80A 4RFBA 5J2FA 5EE1A 3A9KA 5CWRA 3V7KA 1HZ6A 2CN1A 2DAJA 5C2TB 1V38A 2D3DA 4JB3A 3KLSX 1XLOA 3LWMA 1VD2A 2E3TA 3AE2B 4IUMB 2CHWA 3KH0A 2JQRB 2UU7A 2KHVA 1RXVA 5J2KA 4ANXA 4QIWF 4O9MA 2PMVA 3A9JB 3L16A 4W9HA 4BXOA 5HI1A 2Q5WD 1EF1A 4XDDA 3N30A 3C21A 5DG8A 4HKQA 3KTQA 2W9CB 2CRXA 4Y2SA 5EWFA 1D5XC 1KEJA 1MQ3A 5ALFA 2E8PA 2G09A 3GE8C 2KDMA 4LCDE 2HMXA 1ZJNA 1JXLA 2OM6A 3D32A 3PPAA 1NJYA 1RYJA 3WK4A 3NY5A 4U6PA 5KFGA 2DAFA 2LMRA 4YG2A 2LVQA 3L17A 3OJSA 3DV9A 2RQ5A 3M9OB 4ANUA 4DS4A 5ALRA 3U26A 2IBKA 4GFJA 3B9JA 3T3FA 4NZLB 5HFYA 1GC6A 1H4RA 2EANA 1SKSA 2JEJA 2NBWB 4BKSD 3PR5B 3SEIA 4F5RA 1D5ZC 3WKBA 1L6NA 2D2QA 3MGIA 4G3IA 4WWMA 3RB6A 5KFEA 2W9BA 2HJ8A 3IFWB 4ARCA 1I35A 5AI9A 2KX3A 3IP4B 1QSLA 1WCLA 4J9OA 3BK2A 3E56A 4JPSA 2BB5A 4KKJA 1WX8A 4HAIA 2XNAC 4EZLA 2KAJA 3MFHA 4PGYA 2WXNA 4QAYA 2MU2A 1VZ8A 4KSKC 3V6KA 5F3XB 2ZIWA 1MPEA 2E8OA 4M9NA 4BKSA 2EMSA 2A4ZA 2YMPA 4KVGB 9ICFA 3RBEA 1EXNA 4WJOA 5J2IA 4C8LA 3LYYA 1WWUA 1C1YB 1A6SA 4ED0A 3RNFC 4Y2TA 4RNNA 5H8YE 3O0FA 2DZKA 2N0SB 4Y2YA 5KG2A 2JU6X 4F5QA 4P0PA 2PVGC 4UB3A 3MFGA 1SXDA 1L6VA 3PX0A 2F3NA 4OJ6A 5CEHA 3JYUA 1WWTA 2MH7A 4C7YA 2AL3A 4I2JA 2KC1A 4WJ3B 3PSEB 4YWGG 5AIAA 2HDOA 3E0FA 4QZGA 1SV4A 4I2IA 2KDBA 2QMTA 2ZCCA 4FULA 3U4EG 3VUWA 2DZMA 4FHKA 3QYPA 4C4RA 4J9QA 3NVZA 2D6FC 4MFFA 2P35A 4F1SA 3IAM1 2WXOA 3H7SA 2GH1A 4F5NA 2KZMA 4KX3A 3SDLC 2GI9A 4ED6A 5CA7A 3FC4A 2HOQA 3DPDA 1DK3A 1NEKB 5DGBA 4PL2A 5EE3A 3GQCA 1WZ0A 2IOHA 3HK0A 3K75D 3QU9A 5J0RA 4S0RA 3RCZA 5BPCA 5AKGA 2DHZA 1RQNA 1NDDA 2N1RA 1SWWA 4M0WB 4DL7A 3Q3NC 1KN5A 2IHNA 4WWNA 4FN2A 4G11A 3ZJVA 4C4VA 1FFUA 4HROA 2UWQA 5KFCA 2SAKA 1Z00B 3SFDB 3QU5A 4ANWA 1PFDA 2C22A 4WAAA 9ICKA 3RR7A 4H2AA 2RPQA 2WXIA 4JMUA 4K7SA 3D2NA 4Y2UA 2H5XA 1RXWA 1FFVA 5AKIA 8ICOA 4OVUA 3BJYA 3WANA 2N9LA 3OSNA 2F77X 3HILA 1YNTE 1X40A 5KT5A 3V6EB 1ZETA 2BS4B 4E0DA 1J7CA 3GE3C 4EZ9A 1P0RA 1U4BA 5DQGA 4DFKA 2KE7A 1FNWA 3NUQA 4OVZA 1JRPA 1RYUA 3KQ4A 3PHXB 4RQ8A 1SIJA 1QZEA 3V7LA 1ZQDA 4P4OA 9ICQA 2HOIA 3WK7A 1D4BA 2KYWA 2QILA 1TY0A 1F0MA 4YMOA 3X0WA 2JSVX 3ZDBA 2XVTA 3BQ7A 1IBXB 3DBRB 4PYUA 2RDIA 3RJFA 3WK9A 3BS5A 4DSEA 2IA6A 2KD0A 1C7YA 2B3AA 2O2VA 3H9DA 5IILA 2AQ0A 4ELTA 4ACFA 5ALUA 1ZQPA 4F50A 5CR0A 2KTRB 1Y88A 2BS3B 3RJHA 4AP4C 3EGRA 3AM9A 2A3VA 1MHXA 1EWYC 4EEKA 1J19A 5ALIA 1T3NA 3IVFA 5DB7A 7ICNA 5KG1A 5ALLA 5KFLA 5DB6A 1V2YA 4LJPB 4WJPA 4G9BA 3MFIA 3QUTA 2WP9B 3O13A 4WIPA 1T4GA 4QZHA 2W43A 5KL1B 3FILB 2JZBA 1P1AA 4C80A 4M9GA 2C7HA 2IJ0A 2KMCA 2KP7A 8ICTA 1UZXB 9ICOA 2R8GA 4C8MA 5KAIU 3TAPA 2GBMA 1C4PA 4FS1A 3Q3FA 4I2BA 4K4GA 4OW0A 2MLBA 2JYEA 4IC7B 2BPGA 2WX1A 2VZKB 2RD0A 2J42A 1T8EA 5HP4A 3IG8A 9ICNA 4QZAA 1CRXA 5J2BA 1L5UA 1MG4A 4FADA 4M8NA 1PK1A 1EF5A 3DDCB 2F1JA 4RQNA 3A33B 5D2MB 3IT6B 1TS3A 4CF3A 2MJ3A 1S0OA 1YMHE 4BKTA 1C3TA 1FM0D 4RQ5A 2BGWA 4OZCA 1N60A 2HHXA 7ICJA 5HG2A 2AH5A 1BT0A 5KL8B 5J2GA 1JI7A 4Y2JA 5L1MA 4J9KA 3AE5B 1OUQA 4DQOC 3U2SC 8ICNA 2LGXA 1S76D 2BKFA 3AE9B 2WS3B 4UB4A 3E9SA 2NS5A 2KWDA 3T3OA 1UA0A 2NRWA 2D11A 1ZQXA 3HP6A 5J0TA 4TMAB 3W9CB 4B9NA 1ZD4A 4ED2A 3BDPA 5JTIA 3C28A 2QCZA 5FK9C 2KO3A 3V3XA 3ZXVA 1WGGA 1SXEA 3KWVA 4O3PA 5JHBA 5KT6A 3JSVA 2D3AA 2JY6A 3PV8A 2NRXA 4UARA 2WXKA 4Q44A 3ENEA 4OVVA 1QOBA 2R2QA 3CSFA 4TQ0A 2VA2A 3RJIA 3W1YA 1UGJA 4UASA 1A70A 1Q5WB 5LXHA 3RB4A 2LGSA 2NBUA 3FKYA 3L4PA 3GZNI 4TQSA 2F8KA 3EW9A 1SSNA 4YTNB 2YY6A 2G45B 1YN5A 1S77D 3Q8MA 3X23A 1ZQEA 7ICHA 2G3QB 3JVZX 3N1ZC 1V97A 3PMLA 5C23A 4KLIA 2L00B 2K8CA 4YP3A 1QQ5A 4DOAA 4IKGA 1CUKA 2PMZC 3N7RC 2W9NA 1K53A 2K6QA 2A1JA 4MM3A 2ZUDA 1Y8RC 2KZ3A 3C2KA 1NJXA 4ZYSA 5GTHU 4O3QA 1S3SG 2N9KA 2REXA 7ICEA 4IWOA 1ZQTA 1CI4A 3ISCA 4ECRA 2RDHA 4X57B 3VDZA 2ASLA 1KQQA 1DYQA 3P42A 5J0YA 2K4PA 1M6YA 3RAQA 3RB3A 3DHIC 4BDPA 2WTFA 2N1WA 4A90A 5HMMA 2WX0A 3NS1A 5KG6A 3I9V1 2LMCA 2FNJB 1XD3B 4JWMA 3DCGA 2PMZF 3A9JA 4J03A 1FXIA 3AE6B 2C9WB 4P1CC 5AKKA 4YR3A 3MGHA 2MBBB 4HRSA 4DQSA 2EZYA 1UUPA 2W9CA 1D8YA 3H0RB 2JWZA 2G5HB 2NYVA 3FAHA 4B6WA 1S0VA 1VRAB 3Q8LA 1JWUD 1STEA 5KG5A 2JEFA 2HHSA 4QWAA 4R63A 3LJ3A 3KD3A 2G4DB 1N61A 4ED1A 3SI8A 4UB1A 1WY8A 3P1MA 4ECTA 4DSLA 2FMSA 1F1HA 1WZ3A 2MA9B 4GDLB 3P63A 1PK3A 3QU7A 3R9KA 4XE0A 3RTVA 4TUPA 2JUOA 5G55A 3GIIA 4GIBA 3SU8X 2KSOB 4P1BC 4RT3A 3AEGB 4HEA1 5IA7A 2V3SA 2WF8A 2L3ZA 2I2YA 4LLGM 3ETRA 1A5RA 3ZJUA 1NJZA 5KFYA 3KUDB 1DRGA 1S0NA 2RRDA 3AE4B 5AKJA 4YSZB 1GB1A 3BVGA 4BZAA 4J9NA 3QUBA 2QB0B 5ALOA 1A0PA 1UT8A 3KHHA 4DXAB 1YIWA 2ZTCA 3PNCA 5J2RA 3Q3MC 1X6JA 2G4SA 1WE6A 2MP2B 4J9MA 2AWTA 1XEEA 2LRUA 2LASA 3A0HU 1I4RA 4NQKE 4IQWA 4EBCA 4DWIA 3PX6A 2KWUB 2WXHA 1E8WA 1WGKA 2QB1A 4C00A 2LPEA 2LGYA 3DVNU 5HHDG 3CYMA 4F92B 1SV0A 5E6NA 3RPFC 5IIOA 2UVRA 1ZQ1C 1RDFA 2K25A 2DYOA 2V3PA 3C8YA 2ALZA 2ZJ8A 3QU2A 3MBYA 3APCA 4USAA 5AM1A 1OFFA 4GXJA 2IDYA 2MAXA 2XCAA 3HX0A 4F7ZA 1WJ4A 4ASWC 4DFJA 4M47A 2JEGA 3AMZA 4KLSA 2H3QA 3QUCA 2W55A 1K51A 3Q8CA 1ZDVA 2L0TA 2WU5B 1QQ6A 2CU3A 3SAFA 3ZDTA 2BCVA 3NTUA 2MW5A 3VH3B 4K7WA 3BS7A 2B6GA 3V6JA 5AUKA 3AU2A 4F4ZA 2HJ1A 3GZNB 2GWSA 3NUHB 5GMVA 3UXOA 3CRXA 1Z3EB 5TSSA 4UW9A 1GO3F 1Z4NA 1KRHA 2EAMA 4OZAA 2BZFA 1PGBA 5KNIA 3BQTA 4UB2A 4K4HA 2L8JA 4EZJA 1C20A 3W1SC 4EE2A 2C2EA 5D7GA 1NVID 4M0AA 2J0KA 1UT5A 4M0WA 2KHQA 3ECIA 3W5UB 1IXRA 4UB8U 2VA8A 1ECWA 5AKXA 1OQRA 3SV4A 1Z00A 3Q8PB 1OW5A 2JV3A 2KG5A 2EMTA 4I6NB 2PIAA 1XLNA 5L9XA 2K1FA 4AJYB 4DL3A 1RG6A 4YXJA 2P6RA 1TKYA 8ICPA 1BPDA 4QZFA 2LUMA 4WQMA 2KK0A 4NXZA 4E74A 1LXDA 3QUQA 1HTQA 2Q4TA 2L32A 5DPTA 5J29A 3LK9A 4ZDVA 3TI0A 2E1FA 2D3BA 2VH1A 1RM6C 5A0LA 2C7NB 2KX0A 1C9FA 2GLSA 2P6UA 2J52A 1FO4A 4MELA 8ICEA 2PEAA 2HTME 1XXGA 4QZBA 4JL9A 1WR1A 5ALDA 3PS6A 3Q8KA 2ZXIA 4NAWB 1IBXA 4RPZA 4BWMA 5D94A 1KLVA 5IO9A 3JPPA 2RGFA 1QLNA 2JRHA 2MBQA 2BBCA 3E58A 2KTRA 1K5OA 1KW4A 1S10A 1KFTA 3AN1A 2JH7A 1GAQB 3QEBZ 1V9PA 2LHTA 3M8RA 1H38A 3QZ8A 2PFQA 4B9KA 4M8MA 2KWVB 1IPGA 5BMGA 2PPHA 1SZPA 3U52E 5AK4A 3NASA 3ZQ4A 1XC9A 4URKA 3M62B 1SJHD 1SE3A 1DOIA 1L7PA 5JHAA 2EAOA 3FILA 1JWAD 2W8KA 3GIKA 4ITKA 5KT3A 1RFAA 4CGZA 4JX1C 2EAPA 2KHWB 4QWDA 3L10B 1KTKA 2YMLA 4MEYA 1MFWA 2PW9A 3OJ3A 1BXTA 3ML8A 4IM3A 3AEDB 3UXPA 4MH8A 2JZPA 4RF1A 4TKNA 2KQSA 4DEZA 4CCHA 3I76A 4N59A 8ICFA 4ICAA 5KFBA 3APFA 3B1LX 3CF6E 2OEHA 5KFPA 4XZ4A 1WRIA 1D8BA 4B9UA 1T0YA 1YQBA 2C2DA 2K4EA 3RFAA 4BFRA 1D8LA 4ZYNA 2LI6A 4DL6A 2KTQA 3IRUA 4YR0A 4ELVA 2M4NA 5L1IA 2WNMA 2N7JA 2QIEB 1N5XA 1C79A 3ONSA 3BWUD 5K4LA 1F2RC 4P4PA 4UAUA 8ICLA 5BOLA 3OHBA 1YJJA 3PSIA 2UYZB 4ACOA 4JWSC 1T6BX 2NRZA 2QKQA 4O3NA 4XRHA 1T0RC 1UHUA 4K3BA 8ICHA 4G0NB 7ICIA 1WGRA 5KG7A 5DBCA 5BOMA 2XN9C 3LB8C 1N5WA 3SR6A 2HW3A 3OTQA 5KFQA 4BUGA 2YB1A 5C3JB 3G6YA 4ECZA 5ALEA 2HHUA 1R4NB 4MDKE 4C8NA 4F4WA 4EUTA 4JIOU 5IIKA 3L08A 1UCVA 1TTNA 4PHPA 3PO5A 3QE9Y 2BT6A 4F5OA 2D3CA 2WYQA 4KDIC 4RNAA 1RAXA 2WWZA 2Y3AA 4YQWA 2ZXHA 1IG6A 4RPYA 1UD7A 1Q3UA 4DF8A 4ANVA 3RN9C 2AGOA 1KFSA 4IM2A 4MH0E 3R2IA 4DHJB 5ALGA 1SEBD 3KHLA 1TYGB 4B0EA 4DK5A 2MRPA 4WURA 1D9DA 2A19A 2KNJA 2JXJA 2W3SA 2ZTDA 3NOBA 2ASJA 2J53A 3VRBB 2A5UA 4C0ZA 4FJYA 1R4MB 3W2DA 3ZDMC 1ZYQA 1F2RI 4PS3A 3H8WA 4EX7A 2V1YA 2EH9A 1WSPA 3F2CA 2ZJDA 3TEWA 4P16A 3L0WB 2ZUCA 3PZPA 2DL0A 1ZQBA 1OQYA 4FBUA 4KLQA 1ZQKA 1JWMD 5IAAC 4TURA 3VTWA 1Z1BA 5C5JA 3QX1A 2C60A 1GC7A 3GB1A 2XI9A 3B0XA 3ETLA 1UPHA 3VUYA 4IRDA 2GB1A 3WCQA 2GBKA 3GP7A 4BOSC 3QHTA 3F2BA 2LI5A 1J2MA 5J0QA 2LM1A 2WXJA 3N7PD 4NLZA 5FR3A 4QIWC 1ET9A 5HMLA 2JH1A 4RQ6A 1V1PB 3EECA 2KJ8A 2PKOA 5J2HA 4PK1A 3U7ZA 1XF5L 1TE2A 3FYHA 2IY1B 2XIDA 5KTQA 3EHVA 4XA5A 5BMIA 4Z6EA 1WFYA 4QZ9A 2BDUA 5EWGA 2OCEA 4GDKB 4YL8A 4JK1A 1AYFA 3MC0B 1KF6B 3P4QB 1PVQA 3IM1A 1BNPA 3H8MA 2W03A 2LRWA 1U9LA 5L83A 2LHDA 2KSOA 4DLEA 1D6EC 3VTVA 3ZJTA 4W9FA 2O6VB 4BGDA 2R61A 3PW5A 2ZNVC 2QHOA 4XC2A 5J2DA 2TSSA 2BKEA 3PGEA 4E71A 1MC8A 5KFJA 4MF8A 2QB0A 3A1QB 2MJDA 2RLTA 1WCNA 3I28A 2HBMA 4RQ3A 1BPYA 1HUZA 1P3QU 4DDID 4FXCA 1SGGA 1N62A 2HBJA 2GBNA 2MP2A 2DX5B 8ICKA 2MJEA 3ISBA 3GILA 4WWOA 2ZVNA 2YX8A 1IUEA 2VH2A 4DXGA 3Q2AC 4O1NA 1KSPA 1X2IA 5BYQA 3R66C 3Q8EA 1KM7A 3QJZA 4N58A 2G1EA 1TS2A 4I27A 1GOZA 4BJQA 4YSXB 2WDQB 5ALNA 5CHWA 2D07B 4F71A 1LB2B 2J6SA 4EEYA 4FHJA 1TVAA 2WHEA 4I2DA 1L3SA 1PQSA 2LJIA 4GGQA 4BVUC 3DBLI 2FMPA 2BPFA 3P4PB 2E5SA 2K60A 1RWSA 1IP9A 2M9NA 4B9LA 3RNCC 1K1SA 3TQ1A 2HHWA 4KGRA 4O3RA 2J4XA 5DB8A 4R3DA 3GV5B 3C5FA 2NV3A 4HYKA 1B43A 1HZ5A 2V4QA 1OTRB 3ZD9A 4Z6FA 1JWSD 2K22A 4NM2A 2EKIA 1RQLA 1SIFA 4NL9C 4O5KA 2ZPNA 2ZZPB 2ZTEA 4Z6CA 8ICGA 3AEBB 2LVOA 3Q3OC 4WQOB 3BVMA 3KFUF 3M6ZA 2KXJA 4O3SA 4TQ1A 5I4DA 3I5JC 2VJ5A 4XUSA 2KLGA 2IO0B 1Q3VA 1TZOA 3SV3A 3LDZE 2VJ4A 4OCZA 4YR2A 3AV8A 1XCTL 1WRDB 2C5LC 3ZXRA 5H2FU 3ICXA 1MVKA 2JXXA 4UQGA 4E3CA 3IT4B 2WF6A 2NO4A 2F44A 2KFKB 4R66A 1ZQMA 3D2SA 1TAUA 5KHQA 3C1ZA 4MSMB 4MF2A 2VIXA 5D3DA 2W04A 3WKEA 5KFWA 2K39A 1TAQA 1VDVA 4JV2A 1FCLA 1BVSA 3PMNA 2GOWA 1I4XA 4JWUC 3MJ5A 1ZUD2 3PTFC 2W82A 1PZNA 2YN4A 4CNQA 1U4AA 3CWIA 3RBDA 2KN7A 1E10A 2WB1F 2DQNB 3ABVB 2I6XA 5DCNA 1EO6A 2K0PA 4P7IA 3AXCA 1YN3A 5J8YC 1SL1A 5J17A 3NG0A 5CTRC 5KFSA 1JWBD 4NAWA 2WHIA 4HXDA 2KIVA 3SYZA 4A20A 4KN7A 1TS5A 4CO7A 4ZHPA 4FFDA 4ECWA 1LO5D 2KDFB 3SHQA 2H3VA 3J9CA 1V5TA 4M01A 4II3B 4S17A 1UGMA 4IW0A 1TJEA 1UF0A 1YT3A 1BGXT 3GFKB 4NJ6A 2NRVA 2VANA 4YD1A 1L2NA 4KN4A 1ZQNA 1Z5SB 2H88B 2KN4A 4RM8A 3ZRFA 3KW5B 2OHFA 1WXMA 1N56A 2IO2B 3LVVA 3RULA 3Q69A 1I7HA 3SD5A 3N3KB 5JRTA 1UQVA 3EFUA 5KFZA 4TQRA 3RH4A 1KKXA 5DKWA 3NRZA 5J0OA 5H92C 4F4XA 4BWJA 4MGZE 2WDRB 5EWEA 2XY7A 3PREA 3RF9A 2H3IA 3RZFA 4F3OA 3M63B 4RGMA 1SJED 5IKCM 2LM4A 1XO0A 4ED7A 2XY6A 2CJOA 3V62A 2IOFK 4HDOA 2AQ3B 3WK8A 3PZDA 4PGXA 1NZPA 1TAMA 2H3FA 1UELA 3OJ4B 1V8CA 4GN1A 4MGIE 2Y1IA 1SF0A 3WK6A 3EPIA 2PKEA 5DG7A 3RJGA 4ECXA 1XLQA 3BZDB 2G9HD 5HHHA 3SAHA 1RYRA 2RDBC 2OXOA 3DBLB 4HVBA 1L5PA 1E9MA 1C4AA 2AQ2B 4LNOA 4KITB 2MX2A 1B4FA 2CHZA 1T5XD 2V4LA 3AE3B 4ZOHC 1TIFA 2YEPF 7ICPA 1E7PB 4ED3A 2Z59B 4DL4A 2E1EA 1UA1A 1C78A 3U7DA 2UVVA 4OJ5A 9ICWA 3CIRB 4FBJB 5DPRA 2LYHA 1KDHA 2ZNVB 4NJ7A 9ICTA 5ALWA 4EEWA 4MEMA 1LV5A 3TUOA 2R18A 7ICOA 1YQ4B 4KZ0A 1Y56A 3V6CB 1UBQA 4DHJD 4GC6A 5L1JA 3UQAA 4F2RA 5DG9A 3ORYA 1F44A 1LGRA 2WU2B 2KFJA 3Q8FA 3RNEC 1L3TA 2LEKA 1WYGA 3Q8QB 4OZBA 1X9MA 3ALBA 5HKHA 4WJQA 1QLBB 4NPNA 8ICWA 1TV9A 3ZKJC 4LNKA 3QZ7A 1JRUA 9ICJA 2Z0EB 5JUMA 3BVZA 4FE3A 3OGUA 5L1LA 1TBEA 1HEZE 2M8SA 4KLLA 3I57A 1IV8A 1A77A 1ZQZA 4M2YA 5G5HA 2INCC 5J0WA 1ZQGA 2BQQA 5DLGA 2JVCA 4OD0A 2GLEA 1KL9A 2ZJ5A 1V85A 1ENFA 2RSUA 1NJWA 1ZP0B 3IHQB 3ZGZA 3R7RA 2C28A 2GRIA 2IYDB 2JWUA 3L54A 4YSYB 1J7AA 3PV1A 3WAOA 5J18A 2HDEA 1MHHE 4I28A 3EUB2 1Q8KA 1X6IA 2AHOB 5AM0A 4KLTA 1P98A 2DBYA 2KVZA 5AZFA 3VC8A 3EPGA 3QU4A 4J3OD 3EC8A 1KH0A 2PTLA 3MR2A 1ZQOA 1QQRA 1F77A 4M04A 1YZ7A 2HSZA 4UB5A 3JPOA 2WDTB 3R8BA 4EYHB 4UB6U 4IRCA 5KHOA 3NZ3A 1O08A 1V1PA 4LJOB 9ICAA 4DFDA 7ICLA 3V61A 4IWQA 2I5HA 2N9XA 1S9FA 4GXKA 3TFRA 5E6JA 1MA7A 4LNNA 3MC9A 4RQ0A 2HHTA 2O6VD 1J97A 2XO7A 3MDAA 1PUTA 1TKEA 3HJEA 9ICIA 3LVWA 2F1IA 1YN4A 4A8XC 4RGTA 4ZRQA 5KFMA 3LYSA 2BF8B 1IGDA 5KFRA 4GMVA 4Q43A 8ICMA 1R7SA 3RYTA 1MI0A 1ED1A 1ZOYB 1T7PA 4I6PA 4A6QA 2E8MA 3ZNID 2HHQA 1QOAA 1NKCA 4PPXA 3BIID 4DLGA 4PS7A 3K4GA 4RQ7A 1KJTA 2O6VA 2VRRB 2JPHA 1QQ7A 4KLEA 3DVGY 2D3GA 2CXYA 3MHSD 1TKDA 2G0AA 1BPZA 2IGHA 5T14A 3A1QA 7ICVA 2WF9A 4P0QB 3TBLD 5ALPA 3TEYA 2L5YA 4QNLA 2PXIA 3I3TB 2DUYA 1VR9A 1I4GA 2M17A 3DHGC 5KFKA 4ZHOA 1FRRA 3ZDDA 2JF5A 1MG8A 5EDSA 3OAWA 3UXNA 1B22A 1V81A 2YVCA 3C23A 1L4DB 5E6PA 1L7NA 1DGJA 2FE9A 3NJTA 4KX6B 3GOEA 1EWCA 3AEAB 4FZLA 3DBHI 4F4KA 1I4HA 2J0JA 2DKXA 3Q8AA 2DGZA 3PO4A 3ZI4A 1NENB 4AOFA 2M19A 2NTTA 3M8SA 4ECSA 2B0CA 2N9PC 3K9OB 3MTNB 4ICVA 2G07A 2D10A 2KACA 4RGOS 2E8NA 1UNSA 3ZTCA 9ICMA 1X66A 2BPCA 1N6ZA 2HI0A 4G50A 1L3UA 4C8OA 1Q10A 2EZXA 1HXYD 5CJ7A 1WR6E 1CEZA 3VFKA 1ZD5A 3M9NB 4GLSC 3PRZA 4MT5A 5B5EU 4W9LA 3RNAC 5AIBA 3FM9A 2ICIA 4NWIA 4Q45A 2W11A 4QJFB 2G08A 2NBVB 5DDYA 3GDXA 2KC2A 3UQ2A 2BCSA 4N6EB 5AK3A 1I4PA 3ZDEA 1S0MA 4Q8FA 1PGAA 1XLPA 5L1KA 1HUOA 4M00A 4MEXA 2IO1B 3WIMA 1F52A 3MR3A 1NK7A 1H8CA 1COOA 3TKAA 3BINA 3T9LA 1IM4A 1QOGA 1T3QA 4IQUA 4DSJA 2ONQA 4RMAA 2Y5CA 1NK6A 5AM2A 2V4RA 3DEEA 3NGDA 1AROP 5ALKA 4OJPA 4L1BA 2HHVA 4NQLB 3UGBB 1SZHA 1XSLA 3QXGA 4DQQA 4MSQB 1WIAA 3RZWC 1WWVA 2W7PA 2W8LA 1FCCC 4U7CA 1QT9A 2ZIXB 2Z0DB 3KYCD 2BS2B 1KFYB 4J6IA 2L52A 4NLBA 2PI5A 2INPE 4DOCA 7ICGA 5JH5C 4KIKB 1NYQA 4EKUA 3KUCB 2V3NA 2QLTA 8ICIA 2F8LA 4AS1A 3PZ7A 1KBUA 1K8RB 8ICJA 4JWNA 5ALQA 4US9A 4AP9A 1EUVB 2AQ1B 2PVOD 5DLFA 2ISPA 4KLHA 3UINB 3SFEB 3H0LB 2RP5A 2PFNA 2BQRA 3H7PB 1OXJA 1U45A 3N32A 2ZPYA 4HPPA 3VUXA 4BOZB 2M0NA 1ESFA 9ICBA 3NS8A 4HK2A 4AUQC 3ZD8A 4JUZA 3UI3A 4CF4A 5AZGA 3DBSA 2LD9A 4NAMA 1WXQA 8ICCA 2FCQA 2ISOA 1URJA 2F76X 3RD2A 1T94A 1A76A 3KHGA 3ONNA 3SQIA 1ZQAA 4KTQA 1WH3A 2KFNA 3BK1A 2EKEC 2KWCA 4UAVA 1EM7A 1LQBA 1NYRA 4KX5A 5KFVA 4I2GA 4UAYA 5GXGB 4WWPA 5D49A 3RB0A 4ZRPA 5J2AA 4CE6A 3PW7A 2KJHB 4W9IA 1N48A 5KG3A 2XBBC 3KVFB 3KOOA 2Y5BB 2N4FA 3GV8B 4FS2A 2BTEA 4A9AA 4HCPB 3HVZA 3WU2U 3SD7A 3HW8A 1WMHB 2AX5A 5AI0A 4EOYA 2LBOA 4JV0A 3HVDA 4TUQA 1FEHA 2Y9TA 3AULA 2F1HA 1BPXA 1Z1VA 2BGFA 4KSLC 3V05A 4D2KA 2WLBA 4DL5A 4HDQA 4FZNA 3GZFA 2ZCBA 4NJ8A 4F72A 1GB4A 2DWQA 1AQ6A 4C4TA 3PVXA 2FCMA 1MJDA 3ZLZA 3UQ0A 1ZQUA 2KT7A 3O65B 2BWES 1D3ZA 4TUUA 2JR5A 3AU5A 4DO9A 4LJXA 2AL6A 7ICRA 2BKRB 3TACB 2R8JA 4MHVA 3WALA 2I1QA 4RT2A 2AEHA 3TCAA 3EFCA 3VQIA 1JMLA 3AB5A 1ZE3D 4IQTA 2R8HA 2W3RA 4QZIA 3CNHA 2KKCA 5AHXA 8ICAA 2YMQA 4EFOA 2R8IA 2Y9UA 5AK6A 2FUG1 2LXAA 1FXTB 3PSFA 2ZIVB 3NRWA 1D5MC 1E7VA 3H6NA 4DBGA 1NI2A 1ZQHA 4W9KA 4DFPA 3MP9A 4FJVB 2PE9A 1E8XA 2FCSA 2O2VB 4UBBA 3AU6A 2N1VA 4K7UA 1FRDA 3MC1A 5AKLA 4DCCA 4HJGE 4PGQA 4BKGA 5IN7A 1B0XA 2BVCA 1L7MA 4J9RA 9ICSA 1OEYJ 4Y2QA 4R8UB 5J2JA 4K4IA 4IOIE 2K89A 3OWEB 4B9VA 1BNOA 2P66A 4K3CA 4PYZA 3NVYA 8ICRA 3PRPB 5C1ZA 1ZQLA 2M1MA 1AN8A 2NPTB 2Z8LA 2UVWA 3PO0A 1GPXA 2NVUI 3N20C 5FR6A 2KVSA 3MR5A 1XU4A 2KEYA 2ZJAA 4YD2A 3JPQA 2XY5A 3F2DA 5DQIA 1M94A 9ICUA 2KLCA 9ICCA 2WXFA 3ZUNA 3RJJA 7ICTA 2HBLA 2JZBB 1E8YA 3AECB 2ZUBA 3WAPA 3HT3A 2WDVB 3TADC 2QARB 3IHPC 3F53A 3SEBA 1RYSA 3BZKA 2KIWA 2HOFA 4RCOA 2FCNA 4YFKA 1YZ6A 2WXGA 2WFAA 2BHNA 4HPLB 3DHHC 9ICLA 3MHZA 1KOTA 3DWGC 4G3XB 5FKAC 4FO6A 1XSPA 2IHMA 2JX5A 9ICGA 2CPRA 2B76B 5BYSA 1FEZA 2IOFA 3NVVA 2N9EB 1GG3A 4KGSA 2CR5A 3L3FX 2WQYB 4PHAA 2AQ4A 4I6LB 5HR7A 1OGWA 5D3IB 4KMOB 4ECYA 3M7DA 2L76A 3I1YA 2BCUA 3BQ0A 2N7EA 4KGTA 3MABA 1ZRMA 2OYYA 3AQEA 7ICSA 3MGVA 2J7QB 5KFUA 1LVHA
chains in the Genus database with same CATH topology
4Q2JA 3L4PA 1ZUD2 2W82A 2BB6A 1SSNA 4YTNB 2CJNA 1YN5A 3CWIA 1E10A 1YJIA 3ABVB 3PZ8A 1V97A 2RMMA 2K0PA 4IKGA 5T8IA 1PYWD 1L0YB 1YN3A 4A55A 1K53A 4L23A 1JWBD 3W5VB 4ZYSA 1JROA 2N9KA 1TS5A 4ZHPA 2ZW0A 1LO5D 1M4VA 2RDHA 2RPVA 3J9CA 1JCKB 1K52A 1DYQA 3P42A 3TEXA 1TJEA 4YTMB 4A90A 2H88B 3NS1A 2KN4A 3I9V1 2LMCA 3VRAB 3VR9B 4IDIA 2OHFA 3MJ5A 3Q69A 1I7HA 1FXIA 3AE6B 4MM3B 3NRZA 5H92C 1E0ZA 4HRSA 4RH6A 2WDRB 1UUPA 1C4CA 3FAHA 1VRAB 2H89B 1VLBA 1JWUD 4RGMA 1SJED 1STEA 3EA6A 1N61A 4TSSA 2CJOA 3P1MA 2IGGA 1KLUD 4UDUC 4GDLB 2AQ3B 3P63A 3AE1B 2VZKD 2FBWB 4XE0A 1QF6A 1V8CA 3BYYB 2V0GA 5MPOA 1HQRD 3AEGB 4HEA1 1SF0A 1PGXA 3BZDB 2I2YA 4LLGM 1XLQA 2G9HD 3ETRA 3ZJUA 1C76A 3B2FA 3AH7A 3AE4B 4US8A 4YSZB 1GB1A 3BVGA 1L5PA 1E9MA 2QJLA 1C4AA 4REZA 2AQ2B 1T5XD 3AE3B 1TKGA 4RF0A 4ZOHC 2BW2A 2YEPF 3P4RB 1E7PB 1XEEA 1PDXA 1C78A 3VR8B 1OQQA 1FNVA 3CIRB 1I4RA 1QKZA 3TEZA 1AWDA 5BYRA 2NTSA 2WXHA 5EE0A 1YQ4B 3TUOA 1Y56A 1WGKA 3IXSA 3Q8FA 5HHDG 2WU2B 2LEKA 1WYGA 3RPFC 1KLGD 4OZBA 2DYOA 2V3PA 3C8YA 1V1OA 1QLBB 4USAA 1OFFA 2IDYA 1FXAA 3BVZA 1J7BA 3I57A 4YXDB 1HEZE 3LXFA 3TSSA 3AMZA 2K3UA 5G5HA 2W55A 1BUIC 1K51A 4DXFA 3Q8CA 1ZDVA 1ENFA 2Y5PA 2KQ4X 1ZP0B 2WU5B 4P6VF 3ZGZA 2CU3A 4XWTA 2GRIA 2JWUA 1CK1A 4YSYB 1J7AA 5JXVA 3AE8B 2HDEA 1MHHE 5AUKA 3NUHB 1CJEA 3EUB2 5TSSA 1P7EA 2DBYA 2EELA 2LFIA 1KRHA 4OZAA 1PGBA 1ACCA 4J3OD 1KH0A 2PTLA 5EE9A 4EE2A 5D7GA 1NVID 1QQRA 1F77A 2M0AA 4M0WA 4HKZE 3R8BA 4C56C 3W5UB 1FD6A 1OQRA 3NZ3A 2MEKA 1V1PA 2WXLA 1QILA 1JQ4A 2DLBA 2PLPA 3B2GA 2PIAA 3NVWA 1XLNA 3ZYYX 5E6JA 1TKYA 4XDCA 2LUMA 4WQMA 1PUTA 1TKEA 4ARIA 2JXTA 2L32A 4OHJA 1YN4A 4A8XC 4RGTA 4ZRQA 1RM6C 1C9FA 2WXRA 1IGDA 1XO3A 1B9RA 1IGCA 2DYMA 3T3NA 3AEFB 2J52A 1FO4A 1R7SA 1CQVA 4B0MA 2HTME 1YQ3B 1MI0A 4NJCA 1XXGA 1ZOYB 4A6QA 2FE8A 4RFBA 4MACA 1QOAA 1UWXA 3BIID 4NAWB 5EE1A 1EU4A 2QEJC 1IBXA 1HZ6A 5C2TB 1ROEA 4YTPB 1B1ZA 3KLSX 1XLOA 2NMQA 2IGHA 2BBCA 2E3TA 3URYA 3AE2B 1DOYA 3TEYA 2JQRB 4KKIA 3AN1A 1GAQB 1I4GA 1VR9A 4ZHOA 1FRRA 2PMVA 2LHEA 1L4DB 5HI1A 2Q5WD 5BMGA 1DGJA 4KX6B 3U52E 4XDDA 3ZQ4A 1EWCA 3AEAB 1SJHD 1E6EB 4HKQA 1SE3A 1DOIA 1I4HA 3Q8AA 3FILA 1JWAD 4LK0M 4ITKA 1NENB 4JX1C 2M19A 2NTTA 1D5XC 3N9YC 4WH4A 1N63A 1KTKA 2KACA 4RGOS 1UNSA 2PW9A 1BXTA 1Q10A 2KDMA 1HXYD 3AEDB 4C7ZA 4MH8A 2JZPA 1RYJA 4RF1A 4GLSC 4MT5A 4N59A 4AQ7A 1WRIA 2RDGA 2V4IB 2ICIA 1L0VB 3KWLA 5BMHA 1AW7A 3B9JA 4NZLB 5HFYA 4N6EB 2WNMA 2N7JA 1I4PA 2QIEB 1N5XA 1C79A 1PGAA 1XLPA 3BWUD 1F2RC 1D5ZC 1YJJA 4WWMA 1UWMA 1T6BX 4JWSC 2IPKD 3BK2A 1QOGA 3E56A 2BB5A 4KKJA 1T3QA 4JPSA 2WXMA 2XNAC 2KAJA 2ONQA 2WXNA 2LGIA 2Y5CA 5G5GA 1SBBB 1VZ8A 1VZ7A 2XN9C 1N5WA 3SR6A 3LB8C 1MPEA 1K50A 5C3JB 4L1BA 2SEBD 1FCCC 1RFKA 3LYYA 1QT9A 2BT6A 2BS2B 5H8YE 1KFYB 2L52A 2N0SB 1DOXA 2INPE 2JU6X 2PVGC 3MFGA 1L6VA 3Q8BA 4RNAA 1NYQA 2QSDA 2Y3AA 1WWTA 2V3NA 2MH7A 4L2YA 1L6UA 4C7YA 4YWGG 4AS1A 2K9XA 3PZ7A 2QMTA 3R2IA 3U4EG 2ZW1A 1SEBD 1TYGB 4B0EA 4US9A 2AQ1B 1L4ZB 2PVOD 3NVZA 4WURA 1P7FA 3IAM1 2WXOA 2L1AA 2W3SA 3SFEB 2J53A 3VRBB 2GI9A 3W2DA 3R2TA 3FC4A 1F2RI 1WSPA 1ESFA 1NEKB 4CQNA 5EE3A 4P16A 3W1SA 3TEWA 1FNUA 1SB3C 3AE7B 1JWMD 3HUIA 3UI3A 1CZPA 1ZXHA 4NAMA 1WXQA 3GB1A 5AUIA 3WCQA 2GB1A 3GP7A 3GS2A 2M56B 3ZJVA 1FFUA 1SE4A 4HROA 3BK1A 1FMAD 2WXJA 2SAKA 1TS4A 1V1PB 1EM7A 1ET9A 5FR3A 1NYRA 1SE2A 3SFDB 1PFDA 2PKOA 2ACZB 5GXGB 3U7ZA 4ZRPA 1SXTA 1XF5L 4H2AA 2KMMA 2WXIA 4YT0B 5BMIA 1FFVA 2BTEA 2N9LA 4A9AA 4XWWA 1YNTE 3HVZA 3BYTB 4GDKB 2BS4B 1J7CA 1AYFA 2AX5A 2IGDA 1JW9D 3MC0B 1KF6B 3AEEB 3HVDA 3P4QB 1FEHA 1FNWA 1I4QA 3DWMA 4OVZA 1JRPA 3KQ4A 3V05A 1SIJA 4D2KA 2WLBA 2LHDA 1D6EC 1XCQL 1D4BA 3ZJTA 2JYTA 2QILA 1TY0A 1QOFA 2JSVX 1GB4A 2DWQA 1IBXB 2R61A 3HRDD 2D5GA 4ARCA 2TSSA 1L0XB 4PT5A 3H8HA 2BS3B 2MJDA 1VJKA 1ZPSA 1JMLA 3AB5A 3AM9A 1ZE3D 3EGRA 1MHXA 3VQIA 1EWYC 2W3RA 4FXCA 1N62A 2W54A 2MJEA 1ZDXA 1TY2A 2FUG1 1IUEA 2WP9B 1BMLC 3O13A 4WIPA 4DXGA 4O1NA 1ZXIA 1D5MC 3FILB 1JALA 5BYQA 2OEDA 3Q8EA 4JE3B 4N58A 2G1EA 3MP9A 1TS2A 2WXPA 3RFZB 4C80A 1GOZA 4YSXB 1FRDA 2K5PA 2IJ0A 2WDQB 4HJGE 2BYTA 1C4PA 2ON8A 2LJIA 4RGNA 2YEPB 4IOIE 4OW0A 2JYEA 3OWEB 3P4PB 2VZKB 3NVYA 1RWSA 2J42A 1AN8A 2Z8LA 3PO0A 1GPXA 4KGRA 2J4XA 4R3DA 1HZ5A 2WXFA 3IT6B 1TS3A 1JWSD 2MJ3A 2K22A 2EKIA 1YMHE 1FM0D 2E6XA 3AECB 5LNK1 4OZCA 1N60A 3AEBB 2INNE 2WDVB 5HG2A 1NI3A 3BVMA 3SEBA 4RCOA 4TQ1A 5I4DA 3AE5B 4DQOC 3U2SC 2WXGA 3AE9B 2WS3B 3MHZA 3E9SA 1TZOA 3DWGC 5FKAC 1FIQA 2KWDA 2L83A 1C77A 3AV8A 1XCTL 3T3OA 1MVKA 2JX5A 2WXQA 2B76B 3IAS1 5BYSA 3NVVA 4TMAB 3W9CB 2X38A 3IT4B 4KGSA 4LTUA 3P4SB 1EU3A 1HA5A 2WQYB 5FK9C 3V3XA 1ET6A 1VZ6A 3KWVA 5D3IB 2I38A 5D3DA 2WXKA 1VDVA 1F0ZA 4KGTA 4WAFA 1FCLA 4TQ0A 1QOBA 1I4XA 4JWUC 1UGJA 1A70A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4USA A;  3AED B;  4C7Z A;  3L4P A;  1OFF A;  1RYJ A;  1ZUD 2;  3HVZ A;  1FXA A;  2BS4 B;  1J7B A;  1J7C A;  1AYF A;  2AX5 A;  2CJN A;  4N59 A;  4YTN B;  1JW9 D;  3LXF A;  1KF6 B;  3AEE B;  3AMZ A;  3CWI A;  3P4Q B;  1E10 A;  5G5H A;  3DWM A;  1YJI A;  1WRI A;  3ABV B;  1V97 A;  1JRP A;  2W55 A;  1SIJ A;  2WLB A;  2WU5 B;  1ZP0 B;  4P6V F;  1L0V B;  2CU3 A;  3KWL A;  3B9J A;  1QOF A;  1J7A A;  4N6E B;  4YSY B;  2DWQ A;  1JWB D;  3AE8 B;  3W5V B;  2QIE B;  1JRO A;  1N5X A;  3HRD D;  5AUK A;  1XLP A;  1CJE A;  3EUB 2;  4ZHP A;  1YJJ A;  4WWM A;  1UWM A;  4JWS C;  2DBY A;  1KRH A;  2BS3 B;  2MJD A;  1TJE A;  1QOG A;  1VJK A;  4YTM B;  1T3Q A;  3AM9 A;  3AB5 A;  5EE9 A;  1EWY C;  2W3R A;  1NVI D;  3NS1 A;  1N62 A;  2H88 B;  2KAJ A;  4FXC A;  2Y5C A;  3VRA B;  2W54 A;  5G5G A;  4IDI A;  2MJE A;  2OHF A;  3VR9 B;  3LB8 C;  1N5W A;  3SR6 A;  1I7H A;  3W5U B;  1FXI A;  3AE6 B;  2WP9 B;  1IUE A;  5C3J B;  1OQR A;  1ZXI A;  3NRZ A;  5H92 C;  1JAL A;  1E0Z A;  1JQ4 A;  4HRS A;  4N58 A;  2G1E A;  2WDR B;  4C80 A;  1RFK A;  3B2G A;  2PIA A;  3NVW A;  1FRD A;  3FAH A;  1XLN A;  2K5P A;  2WDQ B;  3ZYY X;  2H89 B;  4YSX B;  1VLB A;  1QT9 A;  2BT6 A;  1TKY A;  2BS2 B;  5H8Y E;  1KFY B;  2L52 A;  2N0S B;  1DOX A;  4WQM A;  1PUT A;  1TKE A;  2PVG C;  1L6V A;  1N61 A;  3P4P B;  1NYQ A;  3NVY A;  1RWS A;  2CJO A;  1WWT A;  3P1M A;  2MH7 A;  1L6U A;  4C7Y A;  3P63 A;  1RM6 C;  3AE1 B;  3PO0 A;  1GPX A;  2K9X A;  2FBW B;  1XO3 A;  1QF6 A;  1B9R A;  1V8C A;  3AEF B;  1FO4 A;  1R7S A;  5MPO A;  1TYG B;  4US9 A;  3AEG B;  1SF0 A;  1YQ3 B;  3NVZ A;  2HTM E;  2PVO D;  2MJ3 A;  1ZOY B;  2EKI A;  2K22 A;  1XLQ A;  1FM0 D;  3ETR A;  2W3S A;  3AEC B;  3SFE B;  1QOA A;  3VRB B;  1N60 A;  3AEB B;  3B2F A;  2WDV B;  3AH7 A;  3BII D;  5EE1 A;  3AE4 B;  4US8 A;  1NI3 A;  4YSZ B;  3FC4 A;  1L5P A;  1E9M A;  1ROE A;  2QJL A;  4YTP B;  5C2T B;  1NEK B;  3AE5 B;  1XLO A;  5EE3 A;  1SB3 C;  2E3T A;  3AE9 B;  3AE2 B;  2WS3 B;  1DOY A;  3AE7 B;  3HUI A;  3AE3 B;  1TKG A;  2JQR B;  3DWG C;  1FIQ A;  4ZOH C;  1CZP A;  1GAQ B;  3AN1 A;  2L83 A;  3AV8 A;  4YXD B;  1WXQ A;  3P4R B;  4ZHO A;  1FRR A;  1E7P B;  2JX5 A;  5AUI A;  1PDX A;  3WCQ A;  2B76 B;  3VR8 B;  1OQQ A;  3NVV A;  3CIR B;  3W9C B;  2M56 B;  4LTU A;  1AWD A;  1FFU A;  2Q5W D;  3P4S B;  4HRO A;  1DGJ A;  1FMA D;  2WQY B;  4KX6 B;  3AEA B;  5EE0 A;  1E6E B;  1NYR A;  1YQ4 B;  1DOI A;  3SFD B;  1PFD A;  1WGK A;  2PKO A;  2ACZ B;  1JWA D;  5GXG B;  4ITK A;  1NEN B;  2WU2 B;  2KMM A;  2LEK A;  2M19 A;  4JX1 C;  1WYG A;  4YT0 B;  3RPF C;  1N63 A;  1VDV A;  1F0Z A;  1QOB A;  4JWU C;  1FFV A;  1QLB B;  1A70 A;  4A9A A; 
#chains in the Genus database with same CATH topology
 2K4I A;  2GBJ A;  2KJ5 A;  4EBD A;  5AI4 A;  1BPB A;  4B9T A;  2ZIU B;  4KLD A;  2BB6 A;  3RJK A;  2HBK A;  1NK0 A;  3DQV A;  1YJI A;  2LXC A;  3PZ8 A;  1XS9 D;  4PS8 A;  2NRT A;  4RQ2 A;  3KHR A;  5T8I A;  3V6H A;  4A55 A;  2W7O A;  4B9S A;  4RPX A;  4LNF A;  2YMM A;  3JSV B;  1ISN A;  1TGZ B;  1JRO A;  4QZD A;  1ZW7 A;  5BO4 B;  5AM4 A;  2MSE D;  4RUC A;  4I29 A;  1M4V A;  2BWF A;  5KFF A;  2RPV A;  4PZN A;  1JCK B;  4JQW C;  7ICU A;  4P0Q A;  1WX7 A;  1J8C A;  2B21 A;  2KMA A;  2YB4 A;  4F5P A;  3UM9 A;  3VRA B;  4RQ4 A;  3VR9 B;  4IDI A;  3EYZ A;  4GDL A;  3NZS A;  1WJU A;  3VHT C;  2ASD A;  3OLM D;  4ICU A;  4MJS B;  2DNF A;  9ICE A;  1I42 A;  3VTU A;  1MQ2 A;  4MM3 B;  3WKC A;  3M9M B;  3G6X A;  4YMM A;  4PL1 A;  1E0Z A;  5ALT A;  4RH6 A;  4DF4 A;  5DPS A;  4DS5 A;  4RNO A;  4JLC A;  4HCN B;  4M02 A;  1C4C A;  2K4H A;  5IP4 D;  1VLB A;  1X42 A;  3KKA C;  4A3O A;  3UQB A;  9ICP A;  1L8O A;  5AI8 A;  5J0S A;  1E90 A;  4AWJ A;  1ZD3 A;  3IN5 A;  4TSS A;  3VAW A;  4N9F 4;  2ASQ A;  2AXT U;  2IGG A;  4UDU C;  3BZC A;  1XSN A;  2EZZ A;  3AE1 B;  3P2B A;  4ECU A;  2IMW P;  4Y2R A;  2L05 A;  1QF6 A;  3BYY B;  5MPO A;  2FPK A;  4EZK A;  2BQU A;  2X8X X;  1ZGU B;  3HKZ C;  3AUO A;  3JW0 X;  3AH7 A;  2MUT B;  4US8 A;  4W9D A;  4W9C A;  2QJL A;  2BYE A;  1P7D A;  2K6D B;  3RAX A;  4DHZ E;  4QWC A;  3IG3 A;  3QWZ B;  3LDA A;  1RLF A;  2KN5 A;  3DBR I;  3OG5 A;  3T5L A;  5ALJ A;  4FA6 A;  1TKG A;  3H1U A;  3M6K A;  3PR4 A;  2NO5 A;  4QZC A;  2BW2 A;  4YVZ A;  4LNI A;  3PHW B;  1NBF C;  3P4R B;  1L8L A;  1UH6 A;  3Q3J A;  1PDX A;  1KLN A;  1OQQ A;  1UBI A;  1X9X A;  3OJU A;  1NK9 A;  2LUE A;  4CDG A;  4EX6 A;  5BYR A;  2O6K A;  1V49 A;  2FIF A;  3HKZ F;  2KVC A;  1SL0 A;  1SL2 A;  3IBE A;  4HLE A;  2MBE A;  3IXS A;  3RMK C;  4F91 B;  2AYO B;  1G6J A;  2FAZ A;  4A3P A;  3HM6 X;  1XO1 A;  4M6W B;  3SZ2 A;  2JRZ A;  3VVW B;  1HIW A;  2ZIX A;  1DOQ A;  3ML9 A;  2DFL A;  2PE6 B;  2DZJ A;  1NZB A;  3ZDA A;  3RR8 A;  3B0Y A;  1J7B A;  3BQ2 A;  3C19 A;  4IG7 B;  4KIK A;  4Q8E A;  4WJN A;  2MRL A;  3LXF A;  3ZIM A;  5CB1 A;  4F4Y A;  2WAQ C;  4DSF A;  2K3U A;  2GOL A;  4GC7 A;  1WJ6 A;  5JU5 A;  2FPM A;  3C2L A;  4DXF A;  4QWB A;  4GIV A;  2WB1 C;  2Y5P A;  3GU3 A;  2KQ4 X;  2G06 A;  4P6V F;  1NKE A;  9ICH A;  1CK1 A;  2JHD A;  9ICR A;  2J6T A;  1ZQC A;  4KLU A;  3PST A;  3V7J A;  3H7P A;  5IIN A;  4XX5 A;  1CJE A;  3TIX A;  1YD8 U;  3HIZ A;  4JV1 A;  5AKH A;  2BR0 A;  1NK5 A;  2NCN A;  3TAQ A;  4F2S A;  2MA1 A;  4ELU A;  1ACC A;  2WAQ F;  2FJ6 A;  8ICS A;  4B95 A;  1WI0 A;  2M0A A;  1PVP A;  4IC9 A;  5KFA A;  5D4B A;  3PLV A;  3D6J A;  3IDW A;  7ICQ A;  3Q8R B;  2AGP A;  3VXW A;  1MSW D;  1JUD A;  2MEK A;  5CRX A;  3EWA A;  8ICV A;  3L13 A;  1QIL A;  2KKP A;  2ESE A;  2DLB A;  3B2G A;  3NVW A;  3MDC A;  2R8K A;  3ZYY X;  3PW2 A;  5KT2 A;  3WA0 A;  4F8R A;  2PI4 A;  1E5W A;  3BY4 B;  2Z7J A;  3C5G A;  3T8M A;  4PH5 A;  3T5J A;  3UIO B;  4MGY E;  4ARI A;  2M0X A;  1ZJM A;  1ZRN A;  4PZO A;  2JXT A;  4QWE A;  4FJZ A;  1WMH A;  4HJK A;  1YX6 B;  4RU9 A;  1WE7 A;  2WXR A;  2L7R A;  2DYM A;  2KOX A;  1ZQV A;  3PRM B;  1YQ3 B;  4LZG A;  2FE8 A;  2UVU A;  1UWX A;  4MAC A;  2K8A A;  1EU4 A;  2QEJ C;  2MHJ A;  2KK8 A;  5CHV C;  2Y1J A;  4M9H A;  1ROE A;  4YTP B;  1B1Z A;  2KVR A;  1T0Q C;  3PT2 B;  4NM1 A;  2KZR A;  3C29 A;  3ZDC A;  3JPT A;  5ALM A;  1V9J A;  2NMQ A;  3URY A;  1DOY A;  4NLK A;  1SE9 A;  4KKI A;  4F93 B;  4OJO A;  2Q0Z X;  2BPS A;  3AQF A;  3WAM A;  4LDT B;  1TK8 A;  4F8C B;  2LHE A;  1SKW A;  5DB9 A;  4GB9 A;  1SWV A;  1WUD A;  1L7Y A;  5AM3 A;  1Q0W B;  1E6E B;  1NNL A;  2ZIV A;  3UMG A;  1WYW B;  4Y2X A;  3THV A;  4K81 A;  4LK0 M;  3ZNZ B;  3UIP B;  3K1Z A;  4WH4 A;  3N9Y C;  3TL5 A;  1N63 A;  2JT4 B;  3KBB A;  4R8U A;  4O0I A;  1X1M A;  3QX7 A;  4C7Z A;  1JN3 A;  3E2E A;  4J9P A;  4IR9 A;  2FLL A;  4IWP A;  2FLP A;  4AQ7 A;  4I2H A;  1QH9 A;  2NPT A;  2DZI A;  1LM8 B;  2RDG A;  2V4I B;  2KDI A;  5TIS U;  4J9S A;  1MN8 A;  5AKZ A;  1L0V B;  4NLN A;  3KWL A;  5ALS A;  1AW7 A;  4KDL B;  3B0A A;  3U8Z A;  5BMH A;  2D8C A;  2RDJ A;  3IV6 A;  5IIM A;  4O5C A;  1Z4O A;  4CF5 A;  1V6E A;  3V60 A;  2A1A A;  3WK5 A;  2QAR A;  1WGH A;  4HPM B;  5TR5 A;  1UWM A;  4R65 A;  4XYC A;  4DQP A;  3B08 A;  2IPK D;  3NZU A;  3AL0 B;  8ICX A;  4GXB A;  2WXM A;  1HJP A;  1WM2 A;  2LGI A;  5G5G A;  3ZNG C;  2KFZ A;  2DYB A;  2EDU A;  1SBB B;  5KFI A;  1VZ7 A;  1GJZ A;  4CHK A;  1DGS A;  1K50 A;  1XWL A;  5AKY A;  2JEI A;  3HPO A;  2G5I B;  2SEB D;  5E6O A;  1RFK A;  4YMN A;  2LKY A;  3JPN A;  4IR1 A;  3T5H A;  2BYF A;  4DL2 A;  5KFH A;  2AGQ A;  4KLG A;  1TT5 B;  4AYB C;  3ZNH B;  3PSP A;  1KRP A;  1DOX A;  5DQH A;  4EEL A;  5AI6 A;  4GXI A;  3Q8B A;  3Q14 C;  2QSD A;  1ZQS A;  1WXS A;  4IQV A;  2ODG A;  5ALV A;  2ZIU A;  4UAZ A;  5IOI A;  3CP8 A;  1WJN A;  1L6U A;  3ED5 A;  4L2Y A;  4FLH A;  4DFM A;  4MGK E;  3QCA A;  2K9X A;  2KQ7 A;  3H8S A;  2ZW1 A;  5ALZ A;  3QNM A;  1L4Z B;  3GIJ A;  1P7F A;  5G2N A;  4I2A A;  2L1A A;  3AI5 A;  5FP0 A;  2K8B B;  3F5E A;  1HEK A;  2C7M B;  3M1Y A;  1DK2 A;  2XC9 A;  1WM3 A;  4EYI B;  4AYB F;  3R2T A;  1J0G A;  3WKA A;  4CQN A;  1TK0 A;  3W1S A;  1S1Q B;  1FNU A;  1T0S C;  1SB3 C;  2CU1 A;  3N4M B;  7ICF A;  3AE7 B;  3HUI A;  4QZ8 A;  2XK5 B;  3UMC A;  2XGQ A;  1X9W A;  2LGD A;  1LKY B;  1U47 A;  1CZP A;  1ZXH A;  5J0P A;  4GDK A;  5AUI A;  4ZRK A;  4ZRI A;  3GS2 A;  2M56 B;  2W9M A;  1SE4 A;  4MJS A;  3TJP A;  1FMA D;  5AZH A;  2FUH B;  1TS4 A;  2PJH A;  3KZX A;  4DSK A;  4EZ6 A;  1SE2 A;  2ZVO A;  5GTI U;  4YCX A;  2PFP A;  2ACZ B;  4C4S A;  2KNB A;  2CS4 A;  5KG4 A;  1SXT A;  2F2A B;  4GLX A;  1PUZ A;  2KMM A;  5E79 U;  3APD A;  4YT0 B;  5C0Y A;  2ZEQ A;  5AI5 A;  2OJR A;  4EBE A;  3RH5 A;  3QA8 A;  5LLI A;  3R3M A;  1QTM A;  4XWW A;  2ZG6 A;  4GU2 A;  2N7D A;  3BYT B;  3S2A A;  4ED8 A;  2GBR A;  1WGY A;  3QAQ A;  4QW8 A;  2LZ6 A;  2IGD A;  1JW9 D;  2HD5 B;  3AEE B;  4DOB A;  1I4Q A;  3DWM A;  5DBA A;  2RR9 A;  3H4B A;  3RJE A;  8ICY A;  2OOB B;  5IIJ A;  1E8Z A;  2FMQ A;  2BDP A;  4O3M A;  1WXA A;  1RRB A;  1XCQ L;  2JYT A;  1QOF A;  1XNS A;  5KG0 A;  3A9K B;  1KTQ A;  4RQ1 A;  5CHF A;  3DDH A;  3HRD D;  1ZQY A;  3N1Y C;  2MUT A;  2D5G A;  2JRI B;  3KUZ A;  3ZVV A;  3EZ5 A;  2PFO A;  1L0X B;  3QAR A;  3DVG X;  4PT5 A;  4RZR A;  4KLM A;  1Z19 A;  4IS7 A;  1YX5 B;  3H8H A;  2LYA A;  1VJK A;  1ZPS A;  3D2Q A;  4QW9 A;  4M9J A;  1PVR A;  4PHD A;  3DOW A;  1COK A;  2W54 A;  4B6J A;  3N97 B;  1F9J A;  1ZDX A;  3FDS A;  2IBI B;  2IY0 B;  2MBO A;  4DWF A;  3JPR A;  4BXO B;  4IM0 A;  3RI7 C;  5KFN A;  4TUS A;  5L95 C;  1IIP A;  4QZE A;  1TY2 A;  4P2H A;  4GSW A;  1BML C;  1QSS A;  1ZXI A;  4C8K A;  1K1Q A;  1JAL A;  2OED A;  4JE3 B;  4PHE A;  2BCR A;  3RFZ B;  2WXP A;  3SEN A;  4MFA A;  2K5P A;  2QC8 A;  3N7S C;  2BYT A;  4M6W A;  1NK4 A;  4LVS A;  1VCB A;  2ON8 A;  9ICX A;  4RGN A;  3IG5 A;  2YEP B;  2KJR A;  2LJ5 A;  2RHF A;  4DDG D;  2YTU A;  2J6U A;  3HHM A;  1S5L U;  2KMD A;  4NY8 A;  3H0M B;  3Q8S B;  8ICZ A;  2JZ3 B;  4UAW A;  2KIC A;  1BPE A;  4PJ0 U;  2I1K A;  4OO1 J;  3MR6 A;  2KOB A;  2KFK A;  4ZH4 A;  2E6X A;  5LNK 1;  5EOZ A;  3ZRC A;  3ALR A;  2INN E;  2BYV E;  1NI3 A;  5AM5 A;  2YQE A;  5KFO A;  2W9B B;  3R7Q A;  4IL6 U;  2YLM A;  2EQY A;  2VKQ A;  1L7O A;  2HVH A;  2HTH A;  1FIQ A;  2L83 A;  5CP2 A;  1C77 A;  4NNJ B;  4X5V A;  2XEW A;  3PW0 A;  2WXQ A;  4EEN A;  3IAS 1;  4B9M A;  2C2R A;  1P9D U;  2ZIW B;  1GNU A;  2X38 A;  4LTU A;  3P4S B;  1EU3 A;  2LYB A;  3TAD A;  1HA5 A;  1ET6 A;  1VZ6 A;  3F5A A;  1Z2M A;  1Q46 A;  3OPX A;  1JIH A;  4RQM A;  3H7I A;  3G6V A;  3V72 A;  2I38 A;  2KAN A;  3A4R A;  2KJ6 A;  4UAT A;  4W9G A;  5J0X A;  2DPJ A;  2AU0 A;  1R4N I;  4RUA A;  1F0Z A;  4OJL A;  4YN4 A;  1QSY A;  4NLG A;  3N1X C;  4WAF A;  2L0F A;  4P0P B;  5KFD A;  3A0B U;  1YOV B;  2ES6 A;  1ZQI A;  1FPY A;  4Q2J A;  4CRX A;  1IYF A;  3ZW3 A;  4KMU A;  2CJN A;  1L3V A;  3LWL A;  1O03 A;  3RRG A;  5ALH A;  5D46 A;  3WKD A;  4DQI A;  1GUA B;  3TAN A;  3L5K A;  3NHE B;  3CW2 C;  4P4M A;  3OSP A;  2CKH B;  1J2N A;  5CHG A;  2RMM A;  4NV0 A;  2JZZ A;  1TZ1 A;  1PYW D;  1L0Y B;  2KD1 A;  4LDT D;  5J0U A;  4L23 A;  5J2C A;  2XGP A;  3N28 A;  3W5V B;  3RH6 A;  1WGD A;  5HNK A;  5LXI B;  5AIC A;  3KYD D;  8ICB A;  3C1Y A;  2K8H A;  2KJ9 A;  2ZW0 A;  2XCP A;  1WX9 A;  1S97 A;  1WG8 A;  4O3O A;  3TFS A;  4M9L A;  1TFR A;  1K52 A;  1R4M I;  2MBH A;  3T5K A;  3TEX A;  1XT9 B;  3TMP B;  4W9J A;  4YTM B;  2LVP A;  3PVL A;  2LWP A;  4FBT A;  2HCF A;  3S6J A;  4KLO A;  2Y0S C;  4AJW A;  3DBH B;  2DPI A;  1ZOL A;  2KZZ A;  4C4V B;  4DHZ B;  2KKV A;  3GV7 B;  2IZV B;  2FDR A;  5KFT A;  1Q1O A;  3A4S C;  4CYE A;  1ZQR A;  3QK0 A;  2FI1 A;  2V9W A;  1XQQ A;  5KAF U;  5J2E A;  4I2E A;  4II2 B;  1F5S A;  3GIM A;  3VCB A;  5AEK B;  4DQR A;  1DXS A;  2H89 B;  1HE8 A;  1NOM A;  1KFD A;  2FID A;  1QCK A;  5KFX A;  3ZTD A;  4R64 A;  4I2F A;  5DGA A;  3EA6 A;  5DBB A;  1SGH A;  4O5E A;  2OH2 A;  2Y0S F;  4YXM A;  1KLU D;  4XGA B;  2XIC A;  1NKB A;  4Z6D A;  2FBW B;  5ALY A;  2JMG A;  2VZK D;  2V0G A;  4ECV A;  4NLC A;  1HQR D;  2HE7 A;  2KTF A;  3I63 C;  5HHI A;  1PGX A;  4ZRJ A;  2MCN B;  2KDE B;  2CHX A;  3M95 A;  5CX3 A;  3KKA A;  1N2X A;  4BX9 C;  5D6J B;  3H4D A;  7ICK A;  1C76 A;  2OJW A;  1D9F A;  1YJ1 A;  3B2F A;  2KV2 A;  4UBC A;  5HR6 A;  3BS5 B;  3K1R B;  4Y2V A;  5AKE A;  3T79 A;  2VA3 A;  4A8E A;  8ICU A;  2QDF A;  4REZ A;  3QC8 B;  5KT4 A;  3HM3 A;  4RM9 A;  1SV0 C;  4RNM A;  2FPL A;  5F9N A;  4RF0 A;  4NY0 A;  3PW4 A;  1OEY A;  3M3J A;  3ZO5 B;  2AJQ A;  2W9A A;  4ECQ A;  3VR8 B;  1V5O A;  3SAG A;  2BCQ A;  1JMS A;  1CMX B;  2ATL A;  1FNV A;  1QKZ A;  3TEZ A;  1U48 A;  2JGA A;  1AWD A;  1ZQW A;  3TAR A;  2NTS A;  4IRK A;  3H40 A;  5EE0 A;  4KZC A;  5TZV A;  3HWT A;  4KLJ A;  3PX4 A;  4XQ8 A;  3JPS A;  3PY8 A;  1KLG D;  1V1O A;  3OHA A;  5KT7 A;  2DKZ A;  3ISD A;  3J81 j;  3C2M A;  2I9G A;  1SKR A;  1FXA A;  3Q6B A;  2MSN A;  3QQ8 B;  4KV2 A;  4TV3 A;  1NK8 A;  3C0R B;  4YXD B;  3TSS A;  2DEN B;  4BBN C;  3RNG C;  1PK1 B;  4JGH B;  3UPQ A;  1BUI C;  4NL9 A;  5DDM A;  2BQ3 A;  1U49 A;  2HVI A;  9ICV A;  3K9P B;  2WF7 A;  5AK5 A;  4LZD A;  7ICM A;  4XWT A;  3KZI U;  1ZQJ A;  2H3Z A;  3RNB C;  2IND C;  3AEV A;  4J9L A;  5JXV A;  3AE8 B;  2K8B A;  1JX4 A;  2GO7 A;  4BAX A;  1HTO A;  5F9L A;  3U30 A;  2WF5 A;  3AU4 A;  1JXE A;  2J0M A;  5JZE B;  5III A;  5B66 U;  1P7E A;  3CST A;  1LFD A;  2EEL A;  3RRH A;  1AAR A;  2LFI A;  1WXV A;  4MFC A;  2IO3 B;  1ZQQ A;  3UF8 A;  2I1J A;  4BBN F;  2XK5 A;  5EE9 A;  4I2C A;  1LKY A;  2MQJ A;  1RPL A;  1S8O A;  3UMB A;  5ALX A;  4HKZ E;  4C56 C;  3QIJ A;  1FD6 A;  2V9H A;  4FZM A;  2NR2 A;  2WXL A;  1JQ4 A;  4W9E A;  2MWS B;  1VJ5 A;  2PLP A;  3CMM B;  3RUI B;  2OWO A;  5DPW A;  3QEA Z;  1WF9 A;  2WGS A;  3VH4 B;  3MJW A;  2R2O A;  4XDC A;  1V86 A;  3MC8 A;  1X9S A;  1E7U A;  4DSI A;  4Y2P A;  4OHJ A;  2FLN A;  2GMI C;  3BQ1 A;  1ZKH A;  3H8J A;  1RZT A;  1XO3 A;  1B9R A;  1IGC A;  5J8Y A;  1TK5 A;  3T3N A;  2K8C B;  3AEF B;  4KLF A;  4HWI B;  1ZD2 P;  1CQV A;  4B0M A;  3RT3 B;  2DF4 B;  8ICQ A;  4GOC A;  4NJC A;  3PLU A;  2A1J B;  1ZQF A;  3DVN V;  3SMV A;  4K1R B;  1V80 A;  4RFB A;  5J2F A;  5EE1 A;  3A9K A;  5CWR A;  3V7K A;  1HZ6 A;  2CN1 A;  2DAJ A;  5C2T B;  1V38 A;  2D3D A;  4JB3 A;  3KLS X;  1XLO A;  3LWM A;  1VD2 A;  2E3T A;  3AE2 B;  4IUM B;  2CHW A;  3KH0 A;  2JQR B;  2UU7 A;  2KHV A;  1RXV A;  5J2K A;  4ANX A;  4QIW F;  4O9M A;  2PMV A;  3A9J B;  3L16 A;  4W9H A;  4BXO A;  5HI1 A;  2Q5W D;  1EF1 A;  4XDD A;  3N30 A;  3C21 A;  5DG8 A;  4HKQ A;  3KTQ A;  2W9C B;  2CRX A;  4Y2S A;  5EWF A;  1D5X C;  1KEJ A;  1MQ3 A;  5ALF A;  2E8P A;  2G09 A;  3GE8 C;  2KDM A;  4LCD E;  2HMX A;  1ZJN A;  1JXL A;  2OM6 A;  3D32 A;  3PPA A;  1NJY A;  1RYJ A;  3WK4 A;  3NY5 A;  4U6P A;  5KFG A;  2DAF A;  2LMR A;  4YG2 A;  2LVQ A;  3L17 A;  3OJS A;  3DV9 A;  2RQ5 A;  3M9O B;  4ANU A;  4DS4 A;  5ALR A;  3U26 A;  2IBK A;  4GFJ A;  3B9J A;  3T3F A;  4NZL B;  5HFY A;  1GC6 A;  1H4R A;  2EAN A;  1SKS A;  2JEJ A;  2NBW B;  4BKS D;  3PR5 B;  3SEI A;  4F5R A;  1D5Z C;  3WKB A;  1L6N A;  2D2Q A;  3MGI A;  4G3I A;  4WWM A;  3RB6 A;  5KFE A;  2W9B A;  2HJ8 A;  3IFW B;  4ARC A;  1I35 A;  5AI9 A;  2KX3 A;  3IP4 B;  1QSL A;  1WCL A;  4J9O A;  3BK2 A;  3E56 A;  4JPS A;  2BB5 A;  4KKJ A;  1WX8 A;  4HAI A;  2XNA C;  4EZL A;  2KAJ A;  3MFH A;  4PGY A;  2WXN A;  4QAY A;  2MU2 A;  1VZ8 A;  4KSK C;  3V6K A;  5F3X B;  2ZIW A;  1MPE A;  2E8O A;  4M9N A;  4BKS A;  2EMS A;  2A4Z A;  2YMP A;  4KVG B;  9ICF A;  3RBE A;  1EXN A;  4WJO A;  5J2I A;  4C8L A;  3LYY A;  1WWU A;  1C1Y B;  1A6S A;  4ED0 A;  3RNF C;  4Y2T A;  4RNN A;  5H8Y E;  3O0F A;  2DZK A;  2N0S B;  4Y2Y A;  5KG2 A;  2JU6 X;  4F5Q A;  4P0P A;  2PVG C;  4UB3 A;  3MFG A;  1SXD A;  1L6V A;  3PX0 A;  2F3N A;  4OJ6 A;  5CEH A;  3JYU A;  1WWT A;  2MH7 A;  4C7Y A;  2AL3 A;  4I2J A;  2KC1 A;  4WJ3 B;  3PSE B;  4YWG G;  5AIA A;  2HDO A;  3E0F A;  4QZG A;  1SV4 A;  4I2I A;  2KDB A;  2QMT A;  2ZCC A;  4FUL A;  3U4E G;  3VUW A;  2DZM A;  4FHK A;  3QYP A;  4C4R A;  4J9Q A;  3NVZ A;  2D6F C;  4MFF A;  2P35 A;  4F1S A;  3IAM 1;  2WXO A;  3H7S A;  2GH1 A;  4F5N A;  2KZM A;  4KX3 A;  3SDL C;  2GI9 A;  4ED6 A;  5CA7 A;  3FC4 A;  2HOQ A;  3DPD A;  1DK3 A;  1NEK B;  5DGB A;  4PL2 A;  5EE3 A;  3GQC A;  1WZ0 A;  2IOH A;  3HK0 A;  3K75 D;  3QU9 A;  5J0R A;  4S0R A;  3RCZ A;  5BPC A;  5AKG A;  2DHZ A;  1RQN A;  1NDD A;  2N1R A;  1SWW A;  4M0W B;  4DL7 A;  3Q3N C;  1KN5 A;  2IHN A;  4WWN A;  4FN2 A;  4G11 A;  3ZJV A;  4C4V A;  1FFU A;  4HRO A;  2UWQ A;  5KFC A;  2SAK A;  1Z00 B;  3SFD B;  3QU5 A;  4ANW A;  1PFD A;  2C22 A;  4WAA A;  9ICK A;  3RR7 A;  4H2A A;  2RPQ A;  2WXI A;  4JMU A;  4K7S A;  3D2N A;  4Y2U A;  2H5X A;  1RXW A;  1FFV A;  5AKI A;  8ICO A;  4OVU A;  3BJY A;  3WAN A;  2N9L A;  3OSN A;  2F77 X;  3HIL A;  1YNT E;  1X40 A;  5KT5 A;  3V6E B;  1ZET A;  2BS4 B;  4E0D A;  1J7C A;  3GE3 C;  4EZ9 A;  1P0R A;  1U4B A;  5DQG A;  4DFK A;  2KE7 A;  1FNW A;  3NUQ A;  4OVZ A;  1JRP A;  1RYU A;  3KQ4 A;  3PHX B;  4RQ8 A;  1SIJ A;  1QZE A;  3V7L A;  1ZQD A;  4P4O A;  9ICQ A;  2HOI A;  3WK7 A;  1D4B A;  2KYW A;  2QIL A;  1TY0 A;  1F0M A;  4YMO A;  3X0W A;  2JSV X;  3ZDB A;  2XVT A;  3BQ7 A;  1IBX B;  3DBR B;  4PYU A;  2RDI A;  3RJF A;  3WK9 A;  3BS5 A;  4DSE A;  2IA6 A;  2KD0 A;  1C7Y A;  2B3A A;  2O2V A;  3H9D A;  5IIL A;  2AQ0 A;  4ELT A;  4ACF A;  5ALU A;  1ZQP A;  4F50 A;  5CR0 A;  2KTR B;  1Y88 A;  2BS3 B;  3RJH A;  4AP4 C;  3EGR A;  3AM9 A;  2A3V A;  1MHX A;  1EWY C;  4EEK A;  1J19 A;  5ALI A;  1T3N A;  3IVF A;  5DB7 A;  7ICN A;  5KG1 A;  5ALL A;  5KFL A;  5DB6 A;  1V2Y A;  4LJP B;  4WJP A;  4G9B A;  3MFI A;  3QUT A;  2WP9 B;  3O13 A;  4WIP A;  1T4G A;  4QZH A;  2W43 A;  5KL1 B;  3FIL B;  2JZB A;  1P1A A;  4C80 A;  4M9G A;  2C7H A;  2IJ0 A;  2KMC A;  2KP7 A;  8ICT A;  1UZX B;  9ICO A;  2R8G A;  4C8M A;  5KAI U;  3TAP A;  2GBM A;  1C4P A;  4FS1 A;  3Q3F A;  4I2B A;  4K4G A;  4OW0 A;  2MLB A;  2JYE A;  4IC7 B;  2BPG A;  2WX1 A;  2VZK B;  2RD0 A;  2J42 A;  1T8E A;  5HP4 A;  3IG8 A;  9ICN A;  4QZA A;  1CRX A;  5J2B A;  1L5U A;  1MG4 A;  4FAD A;  4M8N A;  1PK1 A;  1EF5 A;  3DDC B;  2F1J A;  4RQN A;  3A33 B;  5D2M B;  3IT6 B;  1TS3 A;  4CF3 A;  2MJ3 A;  1S0O A;  1YMH E;  4BKT A;  1C3T A;  1FM0 D;  4RQ5 A;  2BGW A;  4OZC A;  1N60 A;  2HHX A;  7ICJ A;  5HG2 A;  2AH5 A;  1BT0 A;  5KL8 B;  5J2G A;  1JI7 A;  4Y2J A;  5L1M A;  4J9K A;  3AE5 B;  1OUQ A;  4DQO C;  3U2S C;  8ICN A;  2LGX A;  1S76 D;  2BKF A;  3AE9 B;  2WS3 B;  4UB4 A;  3E9S A;  2NS5 A;  2KWD A;  3T3O A;  1UA0 A;  2NRW A;  2D11 A;  1ZQX A;  3HP6 A;  5J0T A;  4TMA B;  3W9C B;  4B9N A;  1ZD4 A;  4ED2 A;  3BDP A;  5JTI A;  3C28 A;  2QCZ A;  5FK9 C;  2KO3 A;  3V3X A;  3ZXV A;  1WGG A;  1SXE A;  3KWV A;  4O3P A;  5JHB A;  5KT6 A;  3JSV A;  2D3A A;  2JY6 A;  3PV8 A;  2NRX A;  4UAR A;  2WXK A;  4Q44 A;  3ENE A;  4OVV A;  1QOB A;  2R2Q A;  3CSF A;  4TQ0 A;  2VA2 A;  3RJI A;  3W1Y A;  1UGJ A;  4UAS A;  1A70 A;  1Q5W B;  5LXH A;  3RB4 A;  2LGS A;  2NBU A;  3FKY A;  3L4P A;  3GZN I;  4TQS A;  2F8K A;  3EW9 A;  1SSN A;  4YTN B;  2YY6 A;  2G45 B;  1YN5 A;  1S77 D;  3Q8M A;  3X23 A;  1ZQE A;  7ICH A;  2G3Q B;  3JVZ X;  3N1Z C;  1V97 A;  3PML A;  5C23 A;  4KLI A;  2L00 B;  2K8C A;  4YP3 A;  1QQ5 A;  4DOA A;  4IKG A;  1CUK A;  2PMZ C;  3N7R C;  2W9N A;  1K53 A;  2K6Q A;  2A1J A;  4MM3 A;  2ZUD A;  1Y8R C;  2KZ3 A;  3C2K A;  1NJX A;  4ZYS A;  5GTH U;  4O3Q A;  1S3S G;  2N9K A;  2REX A;  7ICE A;  4IWO A;  1ZQT A;  1CI4 A;  3ISC A;  4ECR A;  2RDH A;  4X57 B;  3VDZ A;  2ASL A;  1KQQ A;  1DYQ A;  3P42 A;  5J0Y A;  2K4P A;  1M6Y A;  3RAQ A;  3RB3 A;  3DHI C;  4BDP A;  2WTF A;  2N1W A;  4A90 A;  5HMM A;  2WX0 A;  3NS1 A;  5KG6 A;  3I9V 1;  2LMC A;  2FNJ B;  1XD3 B;  4JWM A;  3DCG A;  2PMZ F;  3A9J A;  4J03 A;  1FXI A;  3AE6 B;  2C9W B;  4P1C C;  5AKK A;  4YR3 A;  3MGH A;  2MBB B;  4HRS A;  4DQS A;  2EZY A;  1UUP A;  2W9C A;  1D8Y A;  3H0R B;  2JWZ A;  2G5H B;  2NYV A;  3FAH A;  4B6W A;  1S0V A;  1VRA B;  3Q8L A;  1JWU D;  1STE A;  5KG5 A;  2JEF A;  2HHS A;  4QWA A;  4R63 A;  3LJ3 A;  3KD3 A;  2G4D B;  1N61 A;  4ED1 A;  3SI8 A;  4UB1 A;  1WY8 A;  3P1M A;  4ECT A;  4DSL A;  2FMS A;  1F1H A;  1WZ3 A;  2MA9 B;  4GDL B;  3P63 A;  1PK3 A;  3QU7 A;  3R9K A;  4XE0 A;  3RTV A;  4TUP A;  2JUO A;  5G55 A;  3GII A;  4GIB A;  3SU8 X;  2KSO B;  4P1B C;  4RT3 A;  3AEG B;  4HEA 1;  5IA7 A;  2V3S A;  2WF8 A;  2L3Z A;  2I2Y A;  4LLG M;  3ETR A;  1A5R A;  3ZJU A;  1NJZ A;  5KFY A;  3KUD B;  1DRG A;  1S0N A;  2RRD A;  3AE4 B;  5AKJ A;  4YSZ B;  1GB1 A;  3BVG A;  4BZA A;  4J9N A;  3QUB A;  2QB0 B;  5ALO A;  1A0P A;  1UT8 A;  3KHH A;  4DXA B;  1YIW A;  2ZTC A;  3PNC A;  5J2R A;  3Q3M C;  1X6J A;  2G4S A;  1WE6 A;  2MP2 B;  4J9M A;  2AWT A;  1XEE A;  2LRU A;  2LAS A;  3A0H U;  1I4R A;  4NQK E;  4IQW A;  4EBC A;  4DWI A;  3PX6 A;  2KWU B;  2WXH A;  1E8W A;  1WGK A;  2QB1 A;  4C00 A;  2LPE A;  2LGY A;  3DVN U;  5HHD G;  3CYM A;  4F92 B;  1SV0 A;  5E6N A;  3RPF C;  5IIO A;  2UVR A;  1ZQ1 C;  1RDF A;  2K25 A;  2DYO A;  2V3P A;  3C8Y A;  2ALZ A;  2ZJ8 A;  3QU2 A;  3MBY A;  3APC A;  4USA A;  5AM1 A;  1OFF A;  4GXJ A;  2IDY A;  2MAX A;  2XCA A;  3HX0 A;  4F7Z A;  1WJ4 A;  4ASW C;  4DFJ A;  4M47 A;  2JEG A;  3AMZ A;  4KLS A;  2H3Q A;  3QUC A;  2W55 A;  1K51 A;  3Q8C A;  1ZDV A;  2L0T A;  2WU5 B;  1QQ6 A;  2CU3 A;  3SAF A;  3ZDT A;  2BCV A;  3NTU A;  2MW5 A;  3VH3 B;  4K7W A;  3BS7 A;  2B6G A;  3V6J A;  5AUK A;  3AU2 A;  4F4Z A;  2HJ1 A;  3GZN B;  2GWS A;  3NUH B;  5GMV A;  3UXO A;  3CRX A;  1Z3E B;  5TSS A;  4UW9 A;  1GO3 F;  1Z4N A;  1KRH A;  2EAM A;  4OZA A;  2BZF A;  1PGB A;  5KNI A;  3BQT A;  4UB2 A;  4K4H A;  2L8J A;  4EZJ A;  1C20 A;  3W1S C;  4EE2 A;  2C2E A;  5D7G A;  1NVI D;  4M0A A;  2J0K A;  1UT5 A;  4M0W A;  2KHQ A;  3ECI A;  3W5U B;  1IXR A;  4UB8 U;  2VA8 A;  1ECW A;  5AKX A;  1OQR A;  3SV4 A;  1Z00 A;  3Q8P B;  1OW5 A;  2JV3 A;  2KG5 A;  2EMT A;  4I6N B;  2PIA A;  1XLN A;  5L9X A;  2K1F A;  4AJY B;  4DL3 A;  1RG6 A;  4YXJ A;  2P6R A;  1TKY A;  8ICP A;  1BPD A;  4QZF A;  2LUM A;  4WQM A;  2KK0 A;  4NXZ A;  4E74 A;  1LXD A;  3QUQ A;  1HTQ A;  2Q4T A;  2L32 A;  5DPT A;  5J29 A;  3LK9 A;  4ZDV A;  3TI0 A;  2E1F A;  2D3B A;  2VH1 A;  1RM6 C;  5A0L A;  2C7N B;  2KX0 A;  1C9F A;  2GLS A;  2P6U A;  2J52 A;  1FO4 A;  4MEL A;  8ICE A;  2PEA A;  2HTM E;  1XXG A;  4QZB A;  4JL9 A;  1WR1 A;  5ALD A;  3PS6 A;  3Q8K A;  2ZXI A;  4NAW B;  1IBX A;  4RPZ A;  4BWM A;  5D94 A;  1KLV A;  5IO9 A;  3JPP A;  2RGF A;  1QLN A;  2JRH A;  2MBQ A;  2BBC A;  3E58 A;  2KTR A;  1K5O A;  1KW4 A;  1S10 A;  1KFT A;  3AN1 A;  2JH7 A;  1GAQ B;  3QEB Z;  1V9P A;  2LHT A;  3M8R A;  1H38 A;  3QZ8 A;  2PFQ A;  4B9K A;  4M8M A;  2KWV B;  1IPG A;  5BMG A;  2PPH A;  1SZP A;  3U52 E;  5AK4 A;  3NAS A;  3ZQ4 A;  1XC9 A;  4URK A;  3M62 B;  1SJH D;  1SE3 A;  1DOI A;  1L7P A;  5JHA A;  2EAO A;  3FIL A;  1JWA D;  2W8K A;  3GIK A;  4ITK A;  5KT3 A;  1RFA A;  4CGZ A;  4JX1 C;  2EAP A;  2KHW B;  4QWD A;  3L10 B;  1KTK A;  2YML A;  4MEY A;  1MFW A;  2PW9 A;  3OJ3 A;  1BXT A;  3ML8 A;  4IM3 A;  3AED B;  3UXP A;  4MH8 A;  2JZP A;  4RF1 A;  4TKN A;  2KQS A;  4DEZ A;  4CCH A;  3I76 A;  4N59 A;  8ICF A;  4ICA A;  5KFB A;  3APF A;  3B1L X;  3CF6 E;  2OEH A;  5KFP A;  4XZ4 A;  1WRI A;  1D8B A;  4B9U A;  1T0Y A;  1YQB A;  2C2D A;  2K4E A;  3RFA A;  4BFR A;  1D8L A;  4ZYN A;  2LI6 A;  4DL6 A;  2KTQ A;  3IRU A;  4YR0 A;  4ELV A;  2M4N A;  5L1I A;  2WNM A;  2N7J A;  2QIE B;  1N5X A;  1C79 A;  3ONS A;  3BWU D;  5K4L A;  1F2R C;  4P4P A;  4UAU A;  8ICL A;  5BOL A;  3OHB A;  1YJJ A;  3PSI A;  2UYZ B;  4ACO A;  4JWS C;  1T6B X;  2NRZ A;  2QKQ A;  4O3N A;  4XRH A;  1T0R C;  1UHU A;  4K3B A;  8ICH A;  4G0N B;  7ICI A;  1WGR A;  5KG7 A;  5DBC A;  5BOM A;  2XN9 C;  3LB8 C;  1N5W A;  3SR6 A;  2HW3 A;  3OTQ A;  5KFQ A;  4BUG A;  2YB1 A;  5C3J B;  3G6Y A;  4ECZ A;  5ALE A;  2HHU A;  1R4N B;  4MDK E;  4C8N A;  4F4W A;  4EUT A;  4JIO U;  5IIK A;  3L08 A;  1UCV A;  1TTN A;  4PHP A;  3PO5 A;  3QE9 Y;  2BT6 A;  4F5O A;  2D3C A;  2WYQ A;  4KDI C;  4RNA A;  1RAX A;  2WWZ A;  2Y3A A;  4YQW A;  2ZXH A;  1IG6 A;  4RPY A;  1UD7 A;  1Q3U A;  4DF8 A;  4ANV A;  3RN9 C;  2AGO A;  1KFS A;  4IM2 A;  4MH0 E;  3R2I A;  4DHJ B;  5ALG A;  1SEB D;  3KHL A;  1TYG B;  4B0E A;  4DK5 A;  2MRP A;  4WUR A;  1D9D A;  2A19 A;  2KNJ A;  2JXJ A;  2W3S A;  2ZTD A;  3NOB A;  2ASJ A;  2J53 A;  3VRB B;  2A5U A;  4C0Z A;  4FJY A;  1R4M B;  3W2D A;  3ZDM C;  1ZYQ A;  1F2R I;  4PS3 A;  3H8W A;  4EX7 A;  2V1Y A;  2EH9 A;  1WSP A;  3F2C A;  2ZJD A;  3TEW A;  4P16 A;  3L0W B;  2ZUC A;  3PZP A;  2DL0 A;  1ZQB A;  1OQY A;  4FBU A;  4KLQ A;  1ZQK A;  1JWM D;  5IAA C;  4TUR A;  3VTW A;  1Z1B A;  5C5J A;  3QX1 A;  2C60 A;  1GC7 A;  3GB1 A;  2XI9 A;  3B0X A;  3ETL A;  1UPH A;  3VUY A;  4IRD A;  2GB1 A;  3WCQ A;  2GBK A;  3GP7 A;  4BOS C;  3QHT A;  3F2B A;  2LI5 A;  1J2M A;  5J0Q A;  2LM1 A;  2WXJ A;  3N7P D;  4NLZ A;  5FR3 A;  4QIW C;  1ET9 A;  5HML A;  2JH1 A;  4RQ6 A;  1V1P B;  3EEC A;  2KJ8 A;  2PKO A;  5J2H A;  4PK1 A;  3U7Z A;  1XF5 L;  1TE2 A;  3FYH A;  2IY1 B;  2XID A;  5KTQ A;  3EHV A;  4XA5 A;  5BMI A;  4Z6E A;  1WFY A;  4QZ9 A;  2BDU A;  5EWG A;  2OCE A;  4GDK B;  4YL8 A;  4JK1 A;  1AYF A;  3MC0 B;  1KF6 B;  3P4Q B;  1PVQ A;  3IM1 A;  1BNP A;  3H8M A;  2W03 A;  2LRW A;  1U9L A;  5L83 A;  2LHD A;  2KSO A;  4DLE A;  1D6E C;  3VTV A;  3ZJT A;  4W9F A;  2O6V B;  4BGD A;  2R61 A;  3PW5 A;  2ZNV C;  2QHO A;  4XC2 A;  5J2D A;  2TSS A;  2BKE A;  3PGE A;  4E71 A;  1MC8 A;  5KFJ A;  4MF8 A;  2QB0 A;  3A1Q B;  2MJD A;  2RLT A;  1WCN A;  3I28 A;  2HBM A;  4RQ3 A;  1BPY A;  1HUZ A;  1P3Q U;  4DDI D;  4FXC A;  1SGG A;  1N62 A;  2HBJ A;  2GBN A;  2MP2 A;  2DX5 B;  8ICK A;  2MJE A;  3ISB A;  3GIL A;  4WWO A;  2ZVN A;  2YX8 A;  1IUE A;  2VH2 A;  4DXG A;  3Q2A C;  4O1N A;  1KSP A;  1X2I A;  5BYQ A;  3R66 C;  3Q8E A;  1KM7 A;  3QJZ A;  4N58 A;  2G1E A;  1TS2 A;  4I27 A;  1GOZ A;  4BJQ A;  4YSX B;  2WDQ B;  5ALN A;  5CHW A;  2D07 B;  4F71 A;  1LB2 B;  2J6S A;  4EEY A;  4FHJ A;  1TVA A;  2WHE A;  4I2D A;  1L3S A;  1PQS A;  2LJI A;  4GGQ A;  4BVU C;  3DBL I;  2FMP A;  2BPF A;  3P4P B;  2E5S A;  2K60 A;  1RWS A;  1IP9 A;  2M9N A;  4B9L A;  3RNC C;  1K1S A;  3TQ1 A;  2HHW A;  4KGR A;  4O3R A;  2J4X A;  5DB8 A;  4R3D A;  3GV5 B;  3C5F A;  2NV3 A;  4HYK A;  1B43 A;  1HZ5 A;  2V4Q A;  1OTR B;  3ZD9 A;  4Z6F A;  1JWS D;  2K22 A;  4NM2 A;  2EKI A;  1RQL A;  1SIF A;  4NL9 C;  4O5K A;  2ZPN A;  2ZZP B;  2ZTE A;  4Z6C A;  8ICG A;  3AEB B;  2LVO A;  3Q3O C;  4WQO B;  3BVM A;  3KFU F;  3M6Z A;  2KXJ A;  4O3S A;  4TQ1 A;  5I4D A;  3I5J C;  2VJ5 A;  4XUS A;  2KLG A;  2IO0 B;  1Q3V A;  1TZO A;  3SV3 A;  3LDZ E;  2VJ4 A;  4OCZ A;  4YR2 A;  3AV8 A;  1XCT L;  1WRD B;  2C5L C;  3ZXR A;  5H2F U;  3ICX A;  1MVK A;  2JXX A;  4UQG A;  4E3C A;  3IT4 B;  2WF6 A;  2NO4 A;  2F44 A;  2KFK B;  4R66 A;  1ZQM A;  3D2S A;  1TAU A;  5KHQ A;  3C1Z A;  4MSM B;  4MF2 A;  2VIX A;  5D3D A;  2W04 A;  3WKE A;  5KFW A;  2K39 A;  1TAQ A;  1VDV A;  4JV2 A;  1FCL A;  1BVS A;  3PMN A;  2GOW A;  1I4X A;  4JWU C;  3MJ5 A;  1ZUD 2;  3PTF C;  2W82 A;  1PZN A;  2YN4 A;  4CNQ A;  1U4A A;  3CWI A;  3RBD A;  2KN7 A;  1E10 A;  2WB1 F;  2DQN B;  3ABV B;  2I6X A;  5DCN A;  1EO6 A;  2K0P A;  4P7I A;  3AXC A;  1YN3 A;  5J8Y C;  1SL1 A;  5J17 A;  3NG0 A;  5CTR C;  5KFS A;  1JWB D;  4NAW A;  2WHI A;  4HXD A;  2KIV A;  3SYZ A;  4A20 A;  4KN7 A;  1TS5 A;  4CO7 A;  4ZHP A;  4FFD A;  4ECW A;  1LO5 D;  2KDF B;  3SHQ A;  2H3V A;  3J9C A;  1V5T A;  4M01 A;  4II3 B;  4S17 A;  1UGM A;  4IW0 A;  1TJE A;  1UF0 A;  1YT3 A;  1BGX T;  3GFK B;  4NJ6 A;  2NRV A;  2VAN A;  4YD1 A;  1L2N A;  4KN4 A;  1ZQN A;  1Z5S B;  2H88 B;  2KN4 A;  4RM8 A;  3ZRF A;  3KW5 B;  2OHF A;  1WXM A;  1N56 A;  2IO2 B;  3LVV A;  3RUL A;  3Q69 A;  1I7H A;  3SD5 A;  3N3K B;  5JRT A;  1UQV A;  3EFU A;  5KFZ A;  4TQR A;  3RH4 A;  1KKX A;  5DKW A;  3NRZ A;  5J0O A;  5H92 C;  4F4X A;  4BWJ A;  4MGZ E;  2WDR B;  5EWE A;  2XY7 A;  3PRE A;  3RF9 A;  2H3I A;  3RZF A;  4F3O A;  3M63 B;  4RGM A;  1SJE D;  5IKC M;  2LM4 A;  1XO0 A;  4ED7 A;  2XY6 A;  2CJO A;  3V62 A;  2IOF K;  4HDO A;  2AQ3 B;  3WK8 A;  3PZD A;  4PGX A;  1NZP A;  1TAM A;  2H3F A;  1UEL A;  3OJ4 B;  1V8C A;  4GN1 A;  4MGI E;  2Y1I A;  1SF0 A;  3WK6 A;  3EPI A;  2PKE A;  5DG7 A;  3RJG A;  4ECX A;  1XLQ A;  3BZD B;  2G9H D;  5HHH A;  3SAH A;  1RYR A;  2RDB C;  2OXO A;  3DBL B;  4HVB A;  1L5P A;  1E9M A;  1C4A A;  2AQ2 B;  4LNO A;  4KIT B;  2MX2 A;  1B4F A;  2CHZ A;  1T5X D;  2V4L A;  3AE3 B;  4ZOH C;  1TIF A;  2YEP F;  7ICP A;  1E7P B;  4ED3 A;  2Z59 B;  4DL4 A;  2E1E A;  1UA1 A;  1C78 A;  3U7D A;  2UVV A;  4OJ5 A;  9ICW A;  3CIR B;  4FBJ B;  5DPR A;  2LYH A;  1KDH A;  2ZNV B;  4NJ7 A;  9ICT A;  5ALW A;  4EEW A;  4MEM A;  1LV5 A;  3TUO A;  2R18 A;  7ICO A;  1YQ4 B;  4KZ0 A;  1Y56 A;  3V6C B;  1UBQ A;  4DHJ D;  4GC6 A;  5L1J A;  3UQA A;  4F2R A;  5DG9 A;  3ORY A;  1F44 A;  1LGR A;  2WU2 B;  2KFJ A;  3Q8F A;  3RNE C;  1L3T A;  2LEK A;  1WYG A;  3Q8Q B;  4OZB A;  1X9M A;  3ALB A;  5HKH A;  4WJQ A;  1QLB B;  4NPN A;  8ICW A;  1TV9 A;  3ZKJ C;  4LNK A;  3QZ7 A;  1JRU A;  9ICJ A;  2Z0E B;  5JUM A;  3BVZ A;  4FE3 A;  3OGU A;  5L1L A;  1TBE A;  1HEZ E;  2M8S A;  4KLL A;  3I57 A;  1IV8 A;  1A77 A;  1ZQZ A;  4M2Y A;  5G5H A;  2INC C;  5J0W A;  1ZQG A;  2BQQ A;  5DLG A;  2JVC A;  4OD0 A;  2GLE A;  1KL9 A;  2ZJ5 A;  1V85 A;  1ENF A;  2RSU A;  1NJW A;  1ZP0 B;  3IHQ B;  3ZGZ A;  3R7R A;  2C28 A;  2GRI A;  2IYD B;  2JWU A;  3L54 A;  4YSY B;  1J7A A;  3PV1 A;  3WAO A;  5J18 A;  2HDE A;  1MHH E;  4I28 A;  3EUB 2;  1Q8K A;  1X6I A;  2AHO B;  5AM0 A;  4KLT A;  1P98 A;  2DBY A;  2KVZ A;  5AZF A;  3VC8 A;  3EPG A;  3QU4 A;  4J3O D;  3EC8 A;  1KH0 A;  2PTL A;  3MR2 A;  1ZQO A;  1QQR A;  1F77 A;  4M04 A;  1YZ7 A;  2HSZ A;  4UB5 A;  3JPO A;  2WDT B;  3R8B A;  4EYH B;  4UB6 U;  4IRC A;  5KHO A;  3NZ3 A;  1O08 A;  1V1P A;  4LJO B;  9ICA A;  4DFD A;  7ICL A;  3V61 A;  4IWQ A;  2I5H A;  2N9X A;  1S9F A;  4GXK A;  3TFR A;  5E6J A;  1MA7 A;  4LNN A;  3MC9 A;  4RQ0 A;  2HHT A;  2O6V D;  1J97 A;  2XO7 A;  3MDA A;  1PUT A;  1TKE A;  3HJE A;  9ICI A;  3LVW A;  2F1I A;  1YN4 A;  4A8X C;  4RGT A;  4ZRQ A;  5KFM A;  3LYS A;  2BF8 B;  1IGD A;  5KFR A;  4GMV A;  4Q43 A;  8ICM A;  1R7S A;  3RYT A;  1MI0 A;  1ED1 A;  1ZOY B;  1T7P A;  4I6P A;  4A6Q A;  2E8M A;  3ZNI D;  2HHQ A;  1QOA A;  1NKC A;  4PPX A;  3BII D;  4DLG A;  4PS7 A;  3K4G A;  4RQ7 A;  1KJT A;  2O6V A;  2VRR B;  2JPH A;  1QQ7 A;  4KLE A;  3DVG Y;  2D3G A;  2CXY A;  3MHS D;  1TKD A;  2G0A A;  1BPZ A;  2IGH A;  5T14 A;  3A1Q A;  7ICV A;  2WF9 A;  4P0Q B;  3TBL D;  5ALP A;  3TEY A;  2L5Y A;  4QNL A;  2PXI A;  3I3T B;  2DUY A;  1VR9 A;  1I4G A;  2M17 A;  3DHG C;  5KFK A;  4ZHO A;  1FRR A;  3ZDD A;  2JF5 A;  1MG8 A;  5EDS A;  3OAW A;  3UXN A;  1B22 A;  1V81 A;  2YVC A;  3C23 A;  1L4D B;  5E6P A;  1L7N A;  1DGJ A;  2FE9 A;  3NJT A;  4KX6 B;  3GOE A;  1EWC A;  3AEA B;  4FZL A;  3DBH I;  4F4K A;  1I4H A;  2J0J A;  2DKX A;  3Q8A A;  2DGZ A;  3PO4 A;  3ZI4 A;  1NEN B;  4AOF A;  2M19 A;  2NTT A;  3M8S A;  4ECS A;  2B0C A;  2N9P C;  3K9O B;  3MTN B;  4ICV A;  2G07 A;  2D10 A;  2KAC A;  4RGO S;  2E8N A;  1UNS A;  3ZTC A;  9ICM A;  1X66 A;  2BPC A;  1N6Z A;  2HI0 A;  4G50 A;  1L3U A;  4C8O A;  1Q10 A;  2EZX A;  1HXY D;  5CJ7 A;  1WR6 E;  1CEZ A;  3VFK A;  1ZD5 A;  3M9N B;  4GLS C;  3PRZ A;  4MT5 A;  5B5E U;  4W9L A;  3RNA C;  5AIB A;  3FM9 A;  2ICI A;  4NWI A;  4Q45 A;  2W11 A;  4QJF B;  2G08 A;  2NBV B;  5DDY A;  3GDX A;  2KC2 A;  3UQ2 A;  2BCS A;  4N6E B;  5AK3 A;  1I4P A;  3ZDE A;  1S0M A;  4Q8F A;  1PGA A;  1XLP A;  5L1K A;  1HUO A;  4M00 A;  4MEX A;  2IO1 B;  3WIM A;  1F52 A;  3MR3 A;  1NK7 A;  1H8C A;  1COO A;  3TKA A;  3BIN A;  3T9L A;  1IM4 A;  1QOG A;  1T3Q A;  4IQU A;  4DSJ A;  2ONQ A;  4RMA A;  2Y5C A;  1NK6 A;  5AM2 A;  2V4R A;  3DEE A;  3NGD A;  1ARO P;  5ALK A;  4OJP A;  4L1B A;  2HHV A;  4NQL B;  3UGB B;  1SZH A;  1XSL A;  3QXG A;  4DQQ A;  4MSQ B;  1WIA A;  3RZW C;  1WWV A;  2W7P A;  2W8L A;  1FCC C;  4U7C A;  1QT9 A;  2ZIX B;  2Z0D B;  3KYC D;  2BS2 B;  1KFY B;  4J6I A;  2L52 A;  4NLB A;  2PI5 A;  2INP E;  4DOC A;  7ICG A;  5JH5 C;  4KIK B;  1NYQ A;  4EKU A;  3KUC B;  2V3N A;  2QLT A;  8ICI A;  2F8L A;  4AS1 A;  3PZ7 A;  1KBU A;  1K8R B;  8ICJ A;  4JWN A;  5ALQ A;  4US9 A;  4AP9 A;  1EUV B;  2AQ1 B;  2PVO D;  5DLF A;  2ISP A;  4KLH A;  3UIN B;  3SFE B;  3H0L B;  2RP5 A;  2PFN A;  2BQR A;  3H7P B;  1OXJ A;  1U45 A;  3N32 A;  2ZPY A;  4HPP A;  3VUX A;  4BOZ B;  2M0N A;  1ESF A;  9ICB A;  3NS8 A;  4HK2 A;  4AUQ C;  3ZD8 A;  4JUZ A;  3UI3 A;  4CF4 A;  5AZG A;  3DBS A;  2LD9 A;  4NAM A;  1WXQ A;  8ICC A;  2FCQ A;  2ISO A;  1URJ A;  2F76 X;  3RD2 A;  1T94 A;  1A76 A;  3KHG A;  3ONN A;  3SQI A;  1ZQA A;  4KTQ A;  1WH3 A;  2KFN A;  3BK1 A;  2EKE C;  2KWC A;  4UAV A;  1EM7 A;  1LQB A;  1NYR A;  4KX5 A;  5KFV A;  4I2G A;  4UAY A;  5GXG B;  4WWP A;  5D49 A;  3RB0 A;  4ZRP A;  5J2A A;  4CE6 A;  3PW7 A;  2KJH B;  4W9I A;  1N48 A;  5KG3 A;  2XBB C;  3KVF B;  3KOO A;  2Y5B B;  2N4F A;  3GV8 B;  4FS2 A;  2BTE A;  4A9A A;  4HCP B;  3HVZ A;  3WU2 U;  3SD7 A;  3HW8 A;  1WMH B;  2AX5 A;  5AI0 A;  4EOY A;  2LBO A;  4JV0 A;  3HVD A;  4TUQ A;  1FEH A;  2Y9T A;  3AUL A;  2F1H A;  1BPX A;  1Z1V A;  2BGF A;  4KSL C;  3V05 A;  4D2K A;  2WLB A;  4DL5 A;  4HDQ A;  4FZN A;  3GZF A;  2ZCB A;  4NJ8 A;  4F72 A;  1GB4 A;  2DWQ A;  1AQ6 A;  4C4T A;  3PVX A;  2FCM A;  1MJD A;  3ZLZ A;  3UQ0 A;  1ZQU A;  2KT7 A;  3O65 B;  2BWE S;  1D3Z A;  4TUU A;  2JR5 A;  3AU5 A;  4DO9 A;  4LJX A;  2AL6 A;  7ICR A;  2BKR B;  3TAC B;  2R8J A;  4MHV A;  3WAL A;  2I1Q A;  4RT2 A;  2AEH A;  3TCA A;  3EFC A;  3VQI A;  1JML A;  3AB5 A;  1ZE3 D;  4IQT A;  2R8H A;  2W3R A;  4QZI A;  3CNH A;  2KKC A;  5AHX A;  8ICA A;  2YMQ A;  4EFO A;  2R8I A;  2Y9U A;  5AK6 A;  2FUG 1;  2LXA A;  1FXT B;  3PSF A;  2ZIV B;  3NRW A;  1D5M C;  1E7V A;  3H6N A;  4DBG A;  1NI2 A;  1ZQH A;  4W9K A;  4DFP A;  3MP9 A;  4FJV B;  2PE9 A;  1E8X A;  2FCS A;  2O2V B;  4UBB A;  3AU6 A;  2N1V A;  4K7U A;  1FRD A;  3MC1 A;  5AKL A;  4DCC A;  4HJG E;  4PGQ A;  4BKG A;  5IN7 A;  1B0X A;  2BVC A;  1L7M A;  4J9R A;  9ICS A;  1OEY J;  4Y2Q A;  4R8U B;  5J2J A;  4K4I A;  4IOI E;  2K89 A;  3OWE B;  4B9V A;  1BNO A;  2P66 A;  4K3C A;  4PYZ A;  3NVY A;  8ICR A;  3PRP B;  5C1Z A;  1ZQL A;  2M1M A;  1AN8 A;  2NPT B;  2Z8L A;  2UVW A;  3PO0 A;  1GPX A;  2NVU I;  3N20 C;  5FR6 A;  2KVS A;  3MR5 A;  1XU4 A;  2KEY A;  2ZJA A;  4YD2 A;  3JPQ A;  2XY5 A;  3F2D A;  5DQI A;  1M94 A;  9ICU A;  2KLC A;  9ICC A;  2WXF A;  3ZUN A;  3RJJ A;  7ICT A;  2HBL A;  2JZB B;  1E8Y A;  3AEC B;  2ZUB A;  3WAP A;  3HT3 A;  2WDV B;  3TAD C;  2QAR B;  3IHP C;  3F53 A;  3SEB A;  1RYS A;  3BZK A;  2KIW A;  2HOF A;  4RCO A;  2FCN A;  4YFK A;  1YZ6 A;  2WXG A;  2WFA A;  2BHN A;  4HPL B;  3DHH C;  9ICL A;  3MHZ A;  1KOT A;  3DWG C;  4G3X B;  5FKA C;  4FO6 A;  1XSP A;  2IHM A;  2JX5 A;  9ICG A;  2CPR A;  2B76 B;  5BYS A;  1FEZ A;  2IOF A;  3NVV A;  2N9E B;  1GG3 A;  4KGS A;  2CR5 A;  3L3F X;  2WQY B;  4PHA A;  2AQ4 A;  4I6L B;  5HR7 A;  1OGW A;  5D3I B;  4KMO B;  4ECY A;  3M7D A;  2L76 A;  3I1Y A;  2BCU A;  3BQ0 A;  2N7E A;  4KGT A;  3MAB A;  1ZRM A;  2OYY A;  3AQE A;  7ICS A;  3MGV A;  2J7Q B;  5KFU A;  1LVH A; 
#chains in the Genus database with same CATH homology
 4Q2J A;  3L4P A;  1ZUD 2;  2W82 A;  2BB6 A;  1SSN A;  4YTN B;  2CJN A;  1YN5 A;  3CWI A;  1E10 A;  1YJI A;  3ABV B;  3PZ8 A;  1V97 A;  2RMM A;  2K0P A;  4IKG A;  5T8I A;  1PYW D;  1L0Y B;  1YN3 A;  4A55 A;  1K53 A;  4L23 A;  1JWB D;  3W5V B;  4ZYS A;  1JRO A;  2N9K A;  1TS5 A;  4ZHP A;  2ZW0 A;  1LO5 D;  1M4V A;  2RDH A;  2RPV A;  3J9C A;  1JCK B;  1K52 A;  1DYQ A;  3P42 A;  3TEX A;  1TJE A;  4YTM B;  4A90 A;  2H88 B;  3NS1 A;  2KN4 A;  3I9V 1;  2LMC A;  3VRA B;  3VR9 B;  4IDI A;  2OHF A;  3MJ5 A;  3Q69 A;  1I7H A;  1FXI A;  3AE6 B;  4MM3 B;  3NRZ A;  5H92 C;  1E0Z A;  4HRS A;  4RH6 A;  2WDR B;  1UUP A;  1C4C A;  3FAH A;  1VRA B;  2H89 B;  1VLB A;  1JWU D;  4RGM A;  1SJE D;  1STE A;  3EA6 A;  1N61 A;  4TSS A;  2CJO A;  3P1M A;  2IGG A;  1KLU D;  4UDU C;  4GDL B;  2AQ3 B;  3P63 A;  3AE1 B;  2VZK D;  2FBW B;  4XE0 A;  1QF6 A;  1V8C A;  3BYY B;  2V0G A;  5MPO A;  1HQR D;  3AEG B;  4HEA 1;  1SF0 A;  1PGX A;  3BZD B;  2I2Y A;  4LLG M;  1XLQ A;  2G9H D;  3ETR A;  3ZJU A;  1C76 A;  3B2F A;  3AH7 A;  3AE4 B;  4US8 A;  4YSZ B;  1GB1 A;  3BVG A;  1L5P A;  1E9M A;  2QJL A;  1C4A A;  4REZ A;  2AQ2 B;  1T5X D;  3AE3 B;  1TKG A;  4RF0 A;  4ZOH C;  2BW2 A;  2YEP F;  3P4R B;  1E7P B;  1XEE A;  1PDX A;  1C78 A;  3VR8 B;  1OQQ A;  1FNV A;  3CIR B;  1I4R A;  1QKZ A;  3TEZ A;  1AWD A;  5BYR A;  2NTS A;  2WXH A;  5EE0 A;  1YQ4 B;  3TUO A;  1Y56 A;  1WGK A;  3IXS A;  3Q8F A;  5HHD G;  2WU2 B;  2LEK A;  1WYG A;  3RPF C;  1KLG D;  4OZB A;  2DYO A;  2V3P A;  3C8Y A;  1V1O A;  1QLB B;  4USA A;  1OFF A;  2IDY A;  1FXA A;  3BVZ A;  1J7B A;  3I57 A;  4YXD B;  1HEZ E;  3LXF A;  3TSS A;  3AMZ A;  2K3U A;  5G5H A;  2W55 A;  1BUI C;  1K51 A;  4DXF A;  3Q8C A;  1ZDV A;  1ENF A;  2Y5P A;  2KQ4 X;  1ZP0 B;  2WU5 B;  4P6V F;  3ZGZ A;  2CU3 A;  4XWT A;  2GRI A;  2JWU A;  1CK1 A;  4YSY B;  1J7A A;  5JXV A;  3AE8 B;  2HDE A;  1MHH E;  5AUK A;  3NUH B;  1CJE A;  3EUB 2;  5TSS A;  1P7E A;  2DBY A;  2EEL A;  2LFI A;  1KRH A;  4OZA A;  1PGB A;  1ACC A;  4J3O D;  1KH0 A;  2PTL A;  5EE9 A;  4EE2 A;  5D7G A;  1NVI D;  1QQR A;  1F77 A;  2M0A A;  4M0W A;  4HKZ E;  3R8B A;  4C56 C;  3W5U B;  1FD6 A;  1OQR A;  3NZ3 A;  2MEK A;  1V1P A;  2WXL A;  1QIL A;  1JQ4 A;  2DLB A;  2PLP A;  3B2G A;  2PIA A;  3NVW A;  1XLN A;  3ZYY X;  5E6J A;  1TKY A;  4XDC A;  2LUM A;  4WQM A;  1PUT A;  1TKE A;  4ARI A;  2JXT A;  2L32 A;  4OHJ A;  1YN4 A;  4A8X C;  4RGT A;  4ZRQ A;  1RM6 C;  1C9F A;  2WXR A;  1IGD A;  1XO3 A;  1B9R A;  1IGC A;  2DYM A;  3T3N A;  3AEF B;  2J52 A;  1FO4 A;  1R7S A;  1CQV A;  4B0M A;  2HTM E;  1YQ3 B;  1MI0 A;  4NJC A;  1XXG A;  1ZOY B;  4A6Q A;  2FE8 A;  4RFB A;  4MAC A;  1QOA A;  1UWX A;  3BII D;  4NAW B;  5EE1 A;  1EU4 A;  2QEJ C;  1IBX A;  1HZ6 A;  5C2T B;  1ROE A;  4YTP B;  1B1Z A;  3KLS X;  1XLO A;  2NMQ A;  2IGH A;  2BBC A;  2E3T A;  3URY A;  3AE2 B;  1DOY A;  3TEY A;  2JQR B;  4KKI A;  3AN1 A;  1GAQ B;  1I4G A;  1VR9 A;  4ZHO A;  1FRR A;  2PMV A;  2LHE A;  1L4D B;  5HI1 A;  2Q5W D;  5BMG A;  1DGJ A;  4KX6 B;  3U52 E;  4XDD A;  3ZQ4 A;  1EWC A;  3AEA B;  1SJH D;  1E6E B;  4HKQ A;  1SE3 A;  1DOI A;  1I4H A;  3Q8A A;  3FIL A;  1JWA D;  4LK0 M;  4ITK A;  1NEN B;  4JX1 C;  2M19 A;  2NTT A;  1D5X C;  3N9Y C;  4WH4 A;  1N63 A;  1KTK A;  2KAC A;  4RGO S;  1UNS A;  2PW9 A;  1BXT A;  1Q10 A;  2KDM A;  1HXY D;  3AED B;  4C7Z A;  4MH8 A;  2JZP A;  1RYJ A;  4RF1 A;  4GLS C;  4MT5 A;  4N59 A;  4AQ7 A;  1WRI A;  2RDG A;  2V4I B;  2ICI A;  1L0V B;  3KWL A;  5BMH A;  1AW7 A;  3B9J A;  4NZL B;  5HFY A;  4N6E B;  2WNM A;  2N7J A;  1I4P A;  2QIE B;  1N5X A;  1C79 A;  1PGA A;  1XLP A;  3BWU D;  1F2R C;  1D5Z C;  1YJJ A;  4WWM A;  1UWM A;  1T6B X;  4JWS C;  2IPK D;  3BK2 A;  1QOG A;  3E56 A;  2BB5 A;  4KKJ A;  1T3Q A;  4JPS A;  2WXM A;  2XNA C;  2KAJ A;  2ONQ A;  2WXN A;  2LGI A;  2Y5C A;  5G5G A;  1SBB B;  1VZ8 A;  1VZ7 A;  2XN9 C;  1N5W A;  3SR6 A;  3LB8 C;  1MPE A;  1K50 A;  5C3J B;  4L1B A;  2SEB D;  1FCC C;  1RFK A;  3LYY A;  1QT9 A;  2BT6 A;  2BS2 B;  5H8Y E;  1KFY B;  2L52 A;  2N0S B;  1DOX A;  2INP E;  2JU6 X;  2PVG C;  3MFG A;  1L6V A;  3Q8B A;  4RNA A;  1NYQ A;  2QSD A;  2Y3A A;  1WWT A;  2V3N A;  2MH7 A;  4L2Y A;  1L6U A;  4C7Y A;  4YWG G;  4AS1 A;  2K9X A;  3PZ7 A;  2QMT A;  3R2I A;  3U4E G;  2ZW1 A;  1SEB D;  1TYG B;  4B0E A;  4US9 A;  2AQ1 B;  1L4Z B;  2PVO D;  3NVZ A;  4WUR A;  1P7F A;  3IAM 1;  2WXO A;  2L1A A;  2W3S A;  3SFE B;  2J53 A;  3VRB B;  2GI9 A;  3W2D A;  3R2T A;  3FC4 A;  1F2R I;  1WSP A;  1ESF A;  1NEK B;  4CQN A;  5EE3 A;  4P16 A;  3W1S A;  3TEW A;  1FNU A;  1SB3 C;  3AE7 B;  1JWM D;  3HUI A;  3UI3 A;  1CZP A;  1ZXH A;  4NAM A;  1WXQ A;  3GB1 A;  5AUI A;  3WCQ A;  2GB1 A;  3GP7 A;  3GS2 A;  2M56 B;  3ZJV A;  1FFU A;  1SE4 A;  4HRO A;  3BK1 A;  1FMA D;  2WXJ A;  2SAK A;  1TS4 A;  1V1P B;  1EM7 A;  1ET9 A;  5FR3 A;  1NYR A;  1SE2 A;  3SFD B;  1PFD A;  2PKO A;  2ACZ B;  5GXG B;  3U7Z A;  4ZRP A;  1SXT A;  1XF5 L;  4H2A A;  2KMM A;  2WXI A;  4YT0 B;  5BMI A;  1FFV A;  2BTE A;  2N9L A;  4A9A A;  4XWW A;  1YNT E;  3HVZ A;  3BYT B;  4GDK B;  2BS4 B;  1J7C A;  1AYF A;  2AX5 A;  2IGD A;  1JW9 D;  3MC0 B;  1KF6 B;  3AEE B;  3HVD A;  3P4Q B;  1FEH A;  1FNW A;  1I4Q A;  3DWM A;  4OVZ A;  1JRP A;  3KQ4 A;  3V05 A;  1SIJ A;  4D2K A;  2WLB A;  2LHD A;  1D6E C;  1XCQ L;  1D4B A;  3ZJT A;  2JYT A;  2QIL A;  1TY0 A;  1QOF A;  2JSV X;  1GB4 A;  2DWQ A;  1IBX B;  2R61 A;  3HRD D;  2D5G A;  4ARC A;  2TSS A;  1L0X B;  4PT5 A;  3H8H A;  2BS3 B;  2MJD A;  1VJK A;  1ZPS A;  1JML A;  3AB5 A;  3AM9 A;  1ZE3 D;  3EGR A;  1MHX A;  3VQI A;  1EWY C;  2W3R A;  4FXC A;  1N62 A;  2W54 A;  2MJE A;  1ZDX A;  1TY2 A;  2FUG 1;  1IUE A;  2WP9 B;  1BML C;  3O13 A;  4WIP A;  4DXG A;  4O1N A;  1ZXI A;  1D5M C;  3FIL B;  1JAL A;  5BYQ A;  2OED A;  3Q8E A;  4JE3 B;  4N58 A;  2G1E A;  3MP9 A;  1TS2 A;  2WXP A;  3RFZ B;  4C80 A;  1GOZ A;  4YSX B;  1FRD A;  2K5P A;  2IJ0 A;  2WDQ B;  4HJG E;  2BYT A;  1C4P A;  2ON8 A;  2LJI A;  4RGN A;  2YEP B;  4IOI E;  4OW0 A;  2JYE A;  3OWE B;  3P4P B;  2VZK B;  3NVY A;  1RWS A;  2J42 A;  1AN8 A;  2Z8L A;  3PO0 A;  1GPX A;  4KGR A;  2J4X A;  4R3D A;  1HZ5 A;  2WXF A;  3IT6 B;  1TS3 A;  1JWS D;  2MJ3 A;  2K22 A;  2EKI A;  1YMH E;  1FM0 D;  2E6X A;  3AEC B;  5LNK 1;  4OZC A;  1N60 A;  3AEB B;  2INN E;  2WDV B;  5HG2 A;  1NI3 A;  3BVM A;  3SEB A;  4RCO A;  4TQ1 A;  5I4D A;  3AE5 B;  4DQO C;  3U2S C;  2WXG A;  3AE9 B;  2WS3 B;  3MHZ A;  3E9S A;  1TZO A;  3DWG C;  5FKA C;  1FIQ A;  2KWD A;  2L83 A;  1C77 A;  3AV8 A;  1XCT L;  3T3O A;  1MVK A;  2JX5 A;  2WXQ A;  2B76 B;  3IAS 1;  5BYS A;  3NVV A;  4TMA B;  3W9C B;  2X38 A;  3IT4 B;  4KGS A;  4LTU A;  3P4S B;  1EU3 A;  1HA5 A;  2WQY B;  5FK9 C;  3V3X A;  1ET6 A;  1VZ6 A;  3KWV A;  5D3I B;  2I38 A;  5D3D A;  2WXK A;  1VDV A;  1F0Z A;  4KGT A;  4WAF A;  1FCL A;  4TQ0 A;  1QOB A;  1I4X A;  4JWU C;  1UGJ A;  1A70 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...