3NS1A

Crystal structure of bovine xanthine oxidase in complex with 6-mercaptopurine
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
164
structure length
164
Chain Sequence
TADELVFFVNGKKVVEKNADPETTLLAYLRRKLGLRGTKLGCGEGGCGACTVMLSKYDRLQDKIIHFSANACLAPICTLHHVAVTTVEGIGSTKTRLHPVQERIAKSHGSQCGFCTPGIVMSMYTLLRNQPEPTVEEIEDAFQGNLCRCTGYRPILQGFRTFAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Substrate orientation and catalytic specificity in the action of xanthine oxidase: the sequential hydroxylation of hypoxanthine to uric acid.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Xanthine dehydrogenase/oxidase
total genus 39
structure length 164
sequence length 164
chains with identical sequence J
ec nomenclature ec 1.17.1.4: Xanthine dehydrogenase.
pdb deposition date 2010-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 3ns1A02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3ns1A01
1WGKA 4IDIA 3NS1A 2PVOD 1JQ4A 1JROA 1FFVA 1N5XA 1ZP0B 2PVGC 4WWMA 1NYQA 2WU5B 3AE5B 4FXCA 1AWDA 4N6EB 5C2TB 3LB8C 1SF0A 2K22A 4YXDB 2JQRB 3AN1A 4YTPB 1R7SA 1N60A 4ZOHC 1E9MA 1FMAD 1QOBA 1QOGA 3HUIA 4C7ZA 1XLNA 3HRDD 3DWGC 1NI3A 1FRRA 2EKIA 2WP9B 2WU2B 4C80A 4LTUA 5EE1A 1TKEA 2N0SB 5H92C 4YT0B 3SFEB 1ROEA 1J7AA 2K9XA 2DWQA 3P4PB 3VRAB 3KWLA 3FC4A 1IUEA 1YQ3B 2WDRB 3P4QB 1J7BA 2BS3B 2PIAA 4HROA 1XLQA 1B9RA 1JALA 3P4RB 3AE9B 1EWYC 4JX1C 1FRDA 3AE4B 1NYRA 1QT9A 5MPOA 1F0ZA 3AH7A 3AE7B 2W55A 1KF6B 1V97A 2M56B 2MJ3A 5EE3A 1ZXIA 3AEFB 3W9CB 1AYFA 4US9A 4WQMA 4ZHPA 1QF6A 2DBYA 1YJIA 1OFFA 3AB5A 1TJEA 2AX5A 1XLOA 1YQ4B 2FBWB 5GXGB 3AM9A 5G5HA 1DOIA 2WS3B 1RWSA 4ZHOA 1DOYA 1A70A 1PFDA 2E3TA 1WRIA 3AEGB 3DWMA 1CJEA 1FM0D 3AEAB 5EE9A 3AE6B 1L6UA 2H88B 4YSZB 1FO4A 2M19A 2MH7A 1WYGA 1UWMA 1XO3A 1XLPA 2OHFA 3VR8B 3NRZA 1QOAA 1L5PA 1NVID 4C7YA 3LXFA 1CZPA 3NVWA 2JX5A 3B2FA 1JRPA 3AEEB 4YTNB 1VLBA 1N5WA 2BT6A 2H89B 3L4PA 4JWSC 4JWUC 4YSXB 1FXIA 1I7HA 1KFYB 2B76B 3AEDB 2L52A 1QLBB 2L83A 2MJDA 3B2GA 2K5PA 5AUIA 1VJKA 4ITKA 3PO0A 3W5VB 2WLBA 4A9AA 2W3SA 2QIEB 1E7PB 1L6VA 3P1MA 3CIRB 3CWIA 2Q5WD 3AE2B 1DGJA 4YTMB 2CJOA 1E10A 2HTME 1FXAA 5G5GA 1TKYA 4P6VF 3ZYYX 1E0ZA 1L0VB 3ABVB 3SFDB 4KX6B 2Y5CA 1WWTA 3SR6A 3BIID 3WCQA 3AECB 1ZUD2 1J7CA 1SB3C 1T3QA 1PDXA 3VRBB 2ACZB 2MJEA 3B9JA 3AV8A 1SIJA 2W3RA 4YSYB 2LEKA 3NVYA 3NVZA 4USAA 2WDVB 3VR9B 3W5UB 2BS4B 3AE8B 1TKGA 3P4SB 4N59A 2WQYB 4US8A 2QJLA 2KAJA 1RFKA 1RYJA 3AEBB 3AE3B 3EUB2 3HVZA 3AE1B 1RM6C 1NEKB 1JWAD 2KMMA 2WDQB 1FIQA 1N62A 5H8YE 1JWBD 2W54A 4HRSA 2CJNA 3FAHA 1OQQA 1ZOYB 1DOXA 2G1EA 1GPXA 1JW9D 5C3JB 1QOFA 1VDVA 1OQRA 1YJJA 1V8CA 1WXQA 1N61A 2CU3A 4N58A 3NVVA 3ETRA 1E6EB 1FFUA 1GAQB 5EE0A 5AUKA 3P63A 2PKOA 3RPFC 1N63A 2BS2B 3AMZA 1NENB 1PUTA 1KRHA 1TYGB
chains in the Genus database with same CATH superfamily
1MJDA 3ONNA 1UBIA 2ONQA 4OJLA 4J6IA 1T0YA 4W9KA 4M8MA 8ICCA 4F2SA 1V81A 3QUCA 1A77A 4IRKA 2FPLA 5CP2A 4ACOA 3VHTC 3AI5A 4M9JA 4K1RB 2FCMA 4ICAA 3RAQA 3GV8B 1SE9A 2W9NA 2XEWA 2VANA 4G3IA 2KC1A 2G5HB 4NL9C 4DSEA 1YQ3B 1XO1A 9ICIA 3M9NB 3JPPA 2EAOA 1DK2A 1SXTA 5FK9C 5IA7A 1NYRA 2LMRA 1F0ZA 2MP2B 3AE7B 2DF4B 3KZIU 1GO3F 1ZQKA 3OGUA 4ZHPA 1ZQGA 4DO9A 2LPEA 4U6PA 1HA5A 5IOIA 4HK2A 1HE8A 4FADA 3IXSA 4O3QA 3H7IA 3PSIA 1D8LA 3FDSA 2QCZA 3DBSA 2GOLA 1S10A 3AE6B 4CF5A 2B21A 2B3AA 4ANWA 5J0XA 4R63A 3BK1A 2KDFB 3MFGA 1WXSA 4KV2A 3LJ3A 2J6TA 1ZJNA 3NVWA 3EHVA 4FS1A 2VH2A 3UMBA 2A4ZA 3ETLA 1Z5SB 2H89B 5KT5A 3MR6A 3KUCB 2EQYA 2HHXA 2G07A 3G6XA 1I7HA 2KWVB 1QLBB 1UPHA 3B08A 3QUTA 1L7YA 1ZQNA 1F1HA 4F4XA 1C3TA 3F53A 2WAQF 2IJ0A 1TS5A 4MGIE 4J9LA 1DGJA 4CYEA 5TISU 1X6IA 1FXAA 2EZXA 4UB2A 2HBKA 4MT5A 4AUQC 1TV9A 4YVZA 4DL7A 2DUYA 4IRDA 4RQ3A 3HIZA 3NUHB 1IBXA 1ZQXA 2E8PA 4BBNF 2AJQA 1WF9A 1X1MA 2NBWB 1LGRA 4I2FA 4TMAB 3WK5A 3I9V1 3WKCA 4C00A 4KZ0A 4R65A 2W7PA 4ED6A 1MG8A 1XD3B 4O3NA 4W9GA 4YXMA 3IP4B 4JK1A 3P2BA 1QTMA 1T5XD 4O3MA 3GZFA 5C5JA 1ZQQA 2WXHA 3AE3B 4B9TA 1ZQVA 2QARB 4Z6DA 2EANA 2IOFK 2ATLA 1N62A 3KD3A 2KG5A 4LNFA 3PO5A 3H8HA 3FAHA 4M9NA 3WK7A 2WF7A 1WXQA 4N58A 2INDC 3SV4A 1WCNA 2KD1A 3M1YA 2BCRA 2LVOA 3ZNID 2F1IA 1U45A 4C4VA 2TSSA 2A1AA 3NS1A 2VH1A 1K52A 2E5SA 2OH2A 3AU5A 5D7GA 2MWSB 2EAPA 4YTPB 4FHKA 1DK3A 3ZDAA 4F4WA 9ICBA 3IN5A 1KLVA 2C60A 8ICBA 5D4BA 4C8KA 4C80A 2IPKD 1XT9B 3Q8FA 4PYZA 4JGHB 3DVGX 4UASA 1E8WA 3VRAB 2MU2A 2FCSA 1HEZE 4GDKA 2FIDA 2XGQA 4IWQA 4ANXA 2BS3B 5L1MA 5J2JA 1XLQA 4KDIC 3SEIA 2EAMA 3RFZB 7ICRA 4PJ0U 2X38A 4MF8A 5D94A 2Y5PA 2FCNA 1TBEA 2DBYA 5HP4A 2GI9A 4QIWF 4I28A 5L1JA 1C7YA 5HMMA 5AK3A 2ZIXA 4FZLA 1D9FA 1OXJA 1MI0A 3ZDCA 4HCNB 1WX8A 5E6PA 4X57B 1B0XA 9ICWA 1NVID 2HI0A 3EW9A 4MFAA 2FLPA 2OJRA 4TKNA 4NM2A 2ZIWB 3BJYA 3TEYA 3IM1A 4FHJA 4EFOA 4NPNA 1EO6A 3WK4A 3LWMA 2DYMA 4IM2A 3VDZA 3PZ7A 3ZLZA 3W1SA 2CHZA 2EKEC 1NOMA 2YX8A 3M9OB 2M0NA 4A20A 1YX5B 2KFJA 3M8SA 3WU2U 2NRVA 4J9MA 3QIJA 3C2MA 2RD0A 4P1CC 3CP8A 2ZVOA 3VQIA 1NNLA 1C79A 4XWTA 1E10A 3ZNGC 2PKEA 4ECTA 1H4RA 3RR7A 1MQ2A 4M6WA 5KFWA 5DPSA 5AIBA 2ACZB 3U7ZA 2HE7A 3DCGA 3AV8A 3DPDA 4IOIE 4P4PA 3Q3NC 4KX5A 1KN5A 4RPXA 4ZYSA 4QW8A 4HLEA 3RRHA 1X66A 2BWFA 2LEKA 2WDVB 3NVZA 4I2AA 5ALFA 1SZHA 2HVIA 1B4FA 3AXCA 2LGXA 2LI6A 2LM4A 4R8UB 4PHPA 1ZQHA 3DEEA 3ZDDA 5KHOA 3V05A 3UF8A 4DSKA 5AI6A 1JW9D 3V6HA 3SHQA 2PJHA 1K1SA 1YJJA 2JV3A 2ZJ5A 3FM9A 3OTQA 2WHEA 3GQCA 3CSTA 2WXGA 4J3OD 5CHFA 2GMIC 1KRHA 3T9LA 3KKAC 3KYDD 4F5NA 1V1OA 2PVGC 3VH4B 2JEIA 2RGFA 4KGTA 1IV8A 3GOEA 3Q2AC 1SF0A 2V4LA 1SJED 1FMAD 5J2GA 1RYSA 1R4NI 4LVSA 1XLNA 5IKCM 5HHHA 1LO5D 1G6JA 1FRRA 3TANA 2JT4B 7ICKA 5KNIA 4K7WA 3DBHB 2OWOA 1K50A 2MUTB 4LCDE 4F4KA 1IUEA 2WDRB 3QQ8B 2RHFA 1KL9A 4F3OA 9ICGA 1HZ6A 3BWUD 4IM3A 3Q8LA 1KBUA 2H5XA 1D4BA 4YWGG 2M56B 3K4GA 2FUHB 1E5WA 1ZJMA 1WE6A 4D2KA 2FUG1 3V61A 4RQNA 2BKEA 2V1YA 1ET9A 2AQ0A 4I2HA 5GXGB 4C8LA 4HWIB 4ARIA 1WZ0A 1PGXA 3DBRB 3PREA 1K1QA 1Q10A 2KZRA 5ALRA 1QQ7A 2JUOA 8ICKA 1V5OA 5ALQA 5KFTA 4DOAA 2KJ6A 4OZBA 1XO3A 3U30A 5JZEB 1L5PA 3Q8KA 2DNFA 5E6NA 1ZQOA 4I6PA 1JRPA 3KOOA 4JB3A 7ICTA 3MTNB 1J97A 2BGFA 4HDQA 3H7PA 1C20A 5TZVA 5T14A 4KLIA 1Z19A 2L52A 3ZO5B 3N4MB 2KSOB 3N97B 2K4IA 3DBLB 3QK0A 4OVUA 3C23A 3VTUA 2W3SA 3AU2A 7ICSA 2HHTA 2QIEB 9ICXA 4UAUA 3CWIA 2WTFA 2HTME 2KVZA 1TKYA 2W9CB 4MEXA 2NRZA 2D07B 3WA0A 5HHIA 3CW2C 5J0UA 5KG7A 3M3JA 4U7CA 3NJTA 1L6NA 4XZ4A 4HPPA 2Y9TA 2MJEA 2QILA 1SKWA 1PQSA 3GU3A 1T4GA 2BQ3A 3UXOA 1XO0A 4IQUA 4BVUC 5J17A 2L3ZA 2DKZA 2LKYA 1NK9A 4KLQA 5AKYA 3VR9B 3TARA 3AQFA 3KKAA 1RYJA 3A9KA 1C4AA 1NEKB 1R4MI 4KLSA 3RI7C 7ICQA 2A5UA 1XC9A 2OJWA 3GILA 3MGIA 3QJZA 4NJ8A 2RRDA 5DLGA 2PI4A 2CU3A 1NZPA 1AQ6A 3NVVA 1D5MC 2N9LA 2LD9A 4RQ6A 3MP9A 1FCCC 4O9MA 2H3FA 2A3VA 1WGKA 5JRTA 3NZUA 1ZQBA 4M00A 3AE5B 3N9YC 3R2IA 2RDIA 5ALGA 1EM7A 1WRDB 2KLCA 4TUUA 4XDDA 3I63C 3B0YA 5AK6A 1TIFA 2CKHB 1OQYA 5CB1A 2WF5A 2JQRB 3AN1A 4FJYA 2N9PC 1E9MA 4AP4C 1QOGA 2MRPA 3S6JA 4KSKC 1E8YA 4QZIA 2WU2B 3PZPA 3A9JB 3BVGA 3VFKA 4O3PA 2K9XA 3TEXA 1URJA 3PLVA 4QW9A 4C8MA 3QC8B 1L4ZB 4F4YA 2JEJA 4IRCA 3VVWB 5KFRA 2F8KA 1LXDA 3PV1A 3ALBA 2MHJA 1ZQUA 3MR5A 2QEJC 1P7DA 1KLGD 4BZAA 1BVSA 2QKQA 8ICEA 1RFAA 2DHZA 3IFWB 9ICUA 1ZXIA 2M8SA 1AYFA 1OEYJ 3W1SC 2MUTA 2JYTA 3PY8A 4GDLA 2FBWB 3A1QA 1F44A 2PLPA 4BWJA 1E7UA 1TK0A 4LLGM 1UCVA 2H3VA 5KG4A 3L3FX 3T8MA 5D3IB 5T8IA 2FJ6A 4YXJA 1DRGA 4PHDA 3ZDTA 3T3OA 4K81A 4DFMA 1PYWD 4KLJA 1ZQ1C 2KJ5A 5KFAA 2KZMA 1MC8A 1FXIA 5IIJA 1Q1OA 5DBCA 1KW4A 2ON8A 1D3ZA 3NS8A 4I2EA 3KQ4A 4DS4A 1SGHA 4OJ6A 5KG0A 4GXKA 1L6VA 2M1MA 4GIVA 4A9AA 5JH5C 1Q3VA 2W9BA 1X6JA 4G11A 2BYFA 4II3B 1I35A 3ED5A 5AKEA 4PHEA 1YN3A 3OHBA 4L2YA 3ZYYX 4FA6A 1L0VB 1V9JA 4OJOA 4QZ9A 2V4IB 1WH3A 2FMPA 2Y5CA 2N1RA 5AK5A 4F5PA 1L3SA 4O5KA 2BYEA 4DK5A 3RNFC 4B6WA 3D6JA 2NMQA 2ZG6A 1KFTA 3ALRA 3ZTCA 4C4RA 3PLUA 2AH5A 3NVYA 3EFCA 3OJUA 3R2TA 4CF4A 1TKGA 1PVPA 4Y2PA 3RCZA 3O65B 4KLOA 3AULA 5LNK1 1J8CA 3KHLA 2KDEB 3H4DA 4JV1A 2WFAA 3BYYB 3ZUNA 4EBEA 2JHDA 3H6NA 5HI1A 1MSWD 5KFYA 4GSWA 2JY6A 3A0BU 2AGOA 2Z8LA 2G0AA 3R66C 4JE3B 5GTHU 5KT3A 4DL5A 1UF0A 5G2NA 4RQ7A 4EBCA 4FFDA 1S8OA 4EX6A 4W9LA 4W9EA 2FMSA 3H0MB 3ECIA 2XIDA 1RZTA 1BPXA 2GWSA 1U9LA 1X40A 8ICVA 2PVOD 2XNAC 3PRMB 1YQBA 2IBIB 2BQUA 2UVVA 3SV3A 2WYQA 1S0VA 1VRAB 2EELA 1U48A 2K4HA 5JHAA 3T3FA 2O2VB 1IBXB 2LXAA 2AQ3B 2WWZA 2YEPF 3HUIA 5CHWA 3JYUA 5J2RA 4Y2RA 2IO2B 2WXKA 4CGZA 4O1NA 4AYBC 2GBMA 4BOZB 4LTUA 5KFKA 2N0SB 4KSLC 3V72A 2DWQA 1UD7A 3SYZA 3I3TB 3KWLA 1UH6A 1N48A 3L5KA 1ZPSA 4M0AA 1Z4OA 1HUZA 1H38A 2G09A 4IR1A 3AE4B 2JSVX 1JWSD 3GZNB 1L5UA 3W9CB 1VD2A 3EA6A 4EYHB 4BKSA 2KNJA 4WWPA 4DSJA 2RPQA 5J2EA 3GIMA 1YQ4B 2K39A 3PX0A 2ASLA 5F9NA 8ICIA 8ICUA 1EUVB 2AQ1B 1XSNA 4FJVB 4J9RA 4ZHOA 2KJ8A 4OO1J 4F5OA 1WI0A 4X5VA 3TUOA 4A3OA 2BPGA 1L6UA 4Y2YA 4DF8A 2LGSA 4NJ6A 2KDBA 4WJNA 5DBBA 4UBCA 2AHOB 4IQTA 2JRHA 4F8CB 1SV0C 4IS7A 2F77X 2AL6A 3B2FA 1HIWA 4ECUA 4RF0A 4BKSD 1VLBA 3EFUA 2KD0A 4WJ3B 2K60A 1HTQA 4YSXB 2LJ5A 5DB7A 2J0MA 2X8XX 1CUKA 1AROP 5KFZA 2XICA 4ITKA 3QE9Y 5DDYA 3Q8BA 2J0JA 5AICA 3LYYA 1V86A 2R18A 1U47A 5GTIU 1JRUA 3Q3JA 4JL9A 2YMPA 1SE3A 4P6VF 1WG8A 2I38A 4QZ8A 3BINA 4KX6B 4ASWC 2WDTB 4UAWA 2PE9A 1SV0A 7ICEA 1YOVB 1TY2A 2O6VA 4HJGE 5CJ7A 3NHEB 3V7LA 3S2AA 3RFAA 1HXYD 3ORYA 1NJZA 2I1JA 4OVZA 2BS4B 2KZ3A 1S9FA 3R9KA 4I2GA 2K0PA 1WGHA 5I4DA 2ICIA 3U7DA 2JMGA 1I42A 1JWAD 2FLNA 4FZNA 2ZTDA 1GPXA 1QOFA 4ECWA 1OQRA 3ZJVA 2YVCA 3KVFB 3QX1A 5BMGA 3Q6BA 1RYRA 4NXZA 3QU4A 3H8JA 2KLGA 3ZDBA 2JZZA 4I6NB 3JSVB 2KX3A 2WGSA 4NLCA 5F3XB 1ZQMA 4ZRJA 2WB1F 5CWRA 4AJWA 1ZKHA 2AGQA 2KHVA 1UGJA 4URKA 3N28A 5HFYA 3OSNA 5J2HA 3TI0A 3HRDD 2MX2A 3KBBA 2LMCA 2KN7A 5L1LA 3O13A 5ALVA 4RGNA 4FE3A 1GG3A 4YMNA 3ZQ4A 3JPRA 2EMSA 3Q8AA 1ZOLA 3IG3A 5G55A 3Q8QB 1SIFA 4NLKA 1IGCA 3QA8A 3WAMA 1I4HA 2QDFA 2RP5A 4KLTA 4L1BA 4LNIA 5EE3A 3O0FA 1ET6A 2D3DA 3RAXA 4US9A 2EMTA 4AS1A 4EZ9A 1TJEA 4ECVA 1WJ6A 1CK1A 2IY0B 3ML9A 4MJSA 1ZQFA 1ZYQA 3EZ5A 3QHTA 3FILB 3H8MA 3PW0A 1FNVA 4KX3A 4NQLB 3W1YA 1SL0A 1F2RI 4K4IA 3DWMA 1M4VA 4WJPA 5EE9A 3H7PB 2GBJA 2MH7A 1OGWA 4DQIA 2GOWA 1KDHA 4O5EA 1Q3UA 2BQQA 2BKRB 3GV5B 2NTTA 3LXFA 4J9PA 4AWJA 4DXFA 2NV3A 1PK1B 1IIPA 3C8YA 4XGAB 9ICTA 2BT6A 2BW2A 3HM3A 3QZ8A 4KIKB 3G6VA 3OSPA 1YJ1A 1UA0A 1SSNA 2UU7A 3M95A 9ICLA 4IC7B 3HJEA 1CEZA 5ALXA 3GE3C 4UW9A 1H8CA 3GE8C 1DYQA 4DXAB 2K6QA 3CRXA 2MSED 2YMMA 4ZRIA 5JTIA 3AE2B 3WALA 5J0OA 1V49A 3RZWC 2NRTA 4GLXA 4ECYA 5G5GA 4MF2A 2YMLA 1F0MA 2XY5A 2HHQA 2KNBA 1N2XA 1SJHD 2K3UA 4GN1A 4E3CA 3SZ2A 3BIID 3Q8SB 1NK0A 1ZQZA 1IPGA 2J6UA 2VA3A 3IBEA 2E8MA 4XRHA 1IP9A 4BDPA 2C7HA 1TS2A 3HW8A 3QWZB 3ENEA 3LVVA 2CR5A 2IHMA 3QCAA 5BYRA 3AQEA 3E56A 2MBBB 3K1RB 3TADC 4FULA 2FDRA 3MFHA 2N1VA 2DYBA 3RB0A 2IHNA 3P42A 4DFDA 5J8YA 5KTQA 1NKEA 2J53A 5AM2A 3RH5A 2ZZPB 3EWAA 4XA5A 5J0TA 3CF6E 3IG8A 5E6JA 2ZXIA 4TURA 3DHGC 1WJ4A 2INPE 2LZ6A 1QLNA 5IP4D 1E6EB 4OCZA 3UMCA 2JWUA 5BO4B 3PSFA 1PVQA 1U4BA 3WAPA 4C56C 3MGVA 1J19A 1UT8A 2HDEA 2MAXA 4P4MA 4F8RA 3KHHA 3QARA 1WR6E 1L8LA 4O0IA 2Y5BB 3WANA 3UI3A 4F72A 1NJWA 4M8NA 2C2DA 3RJHA 4ZOHC 2VIXA 3M63B 5HKHA 4C7ZA 4B95A 5IIMA 2J7QB 4RGMA 3M62B 5ALNA 8ICQA 4QZGA 4F71A 2VA2A 5ALPA 1N6ZA 8ICMA 1PGAA 1BT0A 3CSFA 4KKJA 3UQBA 2NS5A 3AL0B 3GB1A 4F5RA 4F92B 3BDPA 1SL1A 2ZW1A 4R64A 2JEFA 1CRXA 2JF5A 4UAVA 1KF6B 2D5GA 4UB8U 3J81j 2J42A 2MBQA 3ISDA 2RDGA 2PFNA 2NRWA 5KFSA 4W9DA 4OHJA 3LK9A 2R2QA 4IUMB 1WRIA 2L5YA 2EDUA 2NPTA 5FP0A 5KFGA 3UPQA 1BUIC 4MH0E 5KFIA 2WF6A 5J2BA 4NLGA 3NRZA 2L05A 1CZPA 3C19A 5L1KA 4IWOA 3QUQA 8ICGA 1JI7A 4UAYA 3AEEB 3DBLI 4YTNB 4JLCA 2BQRA 3ZW3A 5KFVA 2DYOA 4WJOA 3AEDB 1ZQEA 4CDGA 1QSLA 4ECQA 2MBEA 4LNKA 4BKTA 4BJQA 2Y9UA 4ICUA 1V9PA 3T5LA 4NM1A 1ZQPA 1TAMA 4A8EA 2V0GA 2JXXA 3G6YA 1LB2B 4RF1A 1D9DA 4HKZE 4OZAA 4C8NA 2ASDA 5DLFA 3SFDB 1L0YB 3VTVA 3RJKA 2G45B 4PS8A 2B0CA 5J29A 1SB3C 2I5HA 2UYZB 5IAAC 2AEHA 3PVXA 4R8UA 4HEA1 4JQWC 4DXGA 2KT7A 7ICIA 2HOIA 4G3XB 2YEPB 1WGYA 2KO3A 4HJKA 2KWUB 3PRPB 2NCNA 5AKKA 2KE7A 2GBNA 4TUSA 4GB9A 2YQEA 3AE1B 2G9HD 4NQKE 3DBHI 1FIQA 3RR8A 1TS4A 3RT3B 3OJ4B 3PVLA 2BVCA 3IV6A 3WK6A 3N3KB 4S17A 1ZOYB 2BPSA 4LZDA 5KT6A 1V1PB 3WKAA 4HDOA 1WUDA 3ZTDA 4M47A 2J0KA 4NNJB 3F5AA 1QZEA 4LNOA 4DL6A 2NBUA 2OCEA 3C1ZA 2R61A 2D11A 5KFXA 4O3OA 1V6EA 4S0RA 1NYQA 3APFA 3ZJUA 1T0SC 4A55A 3SAHA 1WFYA 3C2KA 2N1WA 2Y0SF 3TFSA 2L32A 4MH8A 1SE2A 5AM0A 2K22A 5H92C 1F5SA 1P7FA 2QARA 1SXDA 1EXNA 4F91B 1DXSA 2RR9A 1E8XA 1PUZA 4GC7A 4KGRA 4YP3A 1JMLA 1L2NA 4AJYB 2KC2A 1ROEA 4ZRPA 1A6SA 3H40A 1WX9A 2GB1A 3P4PB 4UB1A 4J9OA 2PE6B 1NK6A 5D46A 1EWYC 1Z1VA 2JGAA 2LYHA 2ZUCA 3L13A 3UQAA 2I2YA 2MJ3A 4ARCA 2RDHA 4ZRKA 1ZD2P 2ZCCA 4FO6A 4KKIA 3V62A 3AB5A 5L9XA 2WXMA 3T5HA 3L0WB 5BYQA 3TQ1A 2KHWB 4FBTA 2D3CA 5DDMA 1JXEA 3QU7A 2VZKD 4LJXA 4Z6CA 3APDA 1NBFC 2BCVA 5DGAA 3L10B 2PMZC 4B9NA 4FJZA 1WYGA 1WWVA 5HNKA 1UGMA 2I6XA 2J6SA 4C7YA 2V4RA 1TKDA 3RBDA 4M9HA 4NWIA 5AKXA 4RNOA 2ZPNA 4C4VB 3L4PA 2N7DA 5J2DA 1L4DB 3HVZA 1KFDA 1RQLA 5AUIA 5KFHA 5KFBA 2ZIVA 2L0FA 1RPLA 4EZKA 1TGZB 1C77A 3U52E 5C1ZA 5BYSA 2YMQA 3NG0A 4EZLA 1HZ5A 8ICHA 5CHGA 3VH3B 3PRZA 1XU4A 3EGRA 2MP2A 4XE0A 2D2QA 2QSDA 3PR4A 4K3BA 4P4OA 2N7JA 5CA7A 1WWTA 4GC6A 2YB1A 3A1QB 3BQ0A 2E6XA 1I4GA 4UAZA 3B9JA 1NJXA 1ZRNA 3MGHA 1F52A 3JPTA 1AW7A 4W9IA 4XX5A 3L17A 5AM3A 3MDCA 2BPCA 9ICNA 2NVUI 5KFCA 3PO4A 4YR2A 3GP7A 3W5UB 4N59A 2QJLA 1RXVA 5KAFU 3UXPA 1S0MA 3TSSA 4RUCA 3MC8A 2FPMA 4DL4A 2FCQA 3N1ZC 4B0MA 3JSVA 9ICRA 3Q3OC 5AI0A 2V4QA 1D5ZC 3Q8MA 2B6GA 1KEJA 5ALLA 1UELA 5ALWA 2A19A 4A3PA 4OD0A 5KL1B 3H0RB 1CI4A 2BDUA 3OPXA 3T79A 2BS2B 1YX6B 5TR5A 4M0WA 4KLHA 4WAAA 1PUTA 1TYGB 2LVQA 1QKZA 1STEA 1XSPA 4FXCA 1SL2A 2K89A 1TK5A 5KG6A 1WMHB 2M0AA 4KLFA 2ZEQA 1QOBA 4OZCA 1TAUA 2HBLA 2UVWA 3E0FA 2JPHA 3QXGA 5ALMA 1LKYA 4QWCA 2HSZA 1A5RA 5DPTA 4IL6U 2J4XA 2V3NA 5C23A 2N9KA 4BX9C 3PR5B 2IY1B 3V6CB 1WE7A 3RF9A 3FC4A 4J9NA 3P4QB 3PTFC 2KACA 3WK9A 5A0LA 1RG6A 1I4PA 3C0RB 1X9XA 3IHQB 2KEYA 2FAZA 2DFLA 4GMVA 1S3SG 1SE4A 2KWDA 3TACB 3WKBA 3PW2A 1NK8A 1EF1A 2W04A 3TBLD 7ICOA 2CHWA 4CHKA 2C28A 4TSSA 3RNBC 2ZTEA 3NASA 1BMLC 1NZBA 4E0DA 1WX7A 2DZJA 2VRRB 1XEEA 2E3TA 3PMLA 5AM4A 5ALJA 2KTRA 5DGBA 2BB6A 4RM9A 4TV3A 4DL2A 3JW0X 3QU5A 2RSUA 1UWMA 3RNEC 3VUWA 4B0EA 3KUZA 2KIVA 2ZW0A 1SXEA 4HXDA 4YN4A 3Q3MC 4ELUA 5KG1A 3EYZA 2BF8B 3TEWA 4JWSC 4KMOB 5E6OA 3K1ZA 2PEAA 3RZFA 5KFEA 4DLGA 2LHEA 5IIOA 3ZJTA 2LGYA 3PO0A 2Q0ZX 2WLBA 5EOZA 3CIRB 9ICVA 2F1HA 5KFOA 2ALZA 4PYUA 4DEZA 5KT2A 1BXTA 1NI2A 2MRLA 2DL0A 7ICHA 3ABVB 7ICVA 1KOTA 4YR0A 3IHPC 1KTKA 4EBDA 2C2EA 2KMCA 1VR9A 3HVDA 3FYHA 4ICVA 3VRBB 4TQ1A 3DV9A 2O6VB 3C29A 1NDDA 4RH6A 1MHHE 2LM1A 4DLEA 2LRUA 3HKZF 2LJIA 3B0AA 5F9LA 5DQGA 1L7NA 3EC8A 3PHWB 3SD5A 3A9KB 4KDLB 3PSEB 3N20C 3IRUA 3RNCC 3KLSX 2NYVA 3D32A 1SWWA 2ZIWA 4RM8A 3V60A 2CU1A 4EEWA 9ICKA 2W54A 2L76A 4QZCA 3RD2A 3QZ7A 4F2RA 2KN5A 4E71A 4ZRQA 1KSPA 2ZIVB 1FXTB 1GUAB 7ICPA 1N61A 4I2DA 3I5JC 1JX4A 3GIJA 2DZMA 4RGOS 1MVKA 1V80A 3ZNZB 2NRXA 4I27A 2DPJA 4JMUA 3SD7A 2HBMA 2W03A 3RJJA 1MG4A 2ZCBA 8ICXA 3RPFC 5MPOA 2ZJAA 1YT3A 4NLNA 3A4SC 4QWAA 4ED0A 3A9JA 3C2LA 3KZXA 1ZP0B 5AI4A 1T8EA 5KL8B 5JXVA 1Z00A 3CNHA 3HP6A 2IBKA 3HK0A 1S76D 3Q69A 3ZXVA 2ZJ8A 2WXRA 2PXIA 1X9MA 5ALDA 3NUQA 4Q8EA 1UBQA 3QU9A 3UIOB 3IAM1 2JXJA 2XCPA 3L08A 4BGDA 3X0WA 1B9RA 3AU6A 3C5FA 1JALA 2QB0A 4ED8A 1Z3EB 1ZQRA 4EOYA 3PHXB 4DF4A 5AZFA 1QT9A 4UATA 3OG5A 2W55A 2KKVA 1GC6A 4MSMB 3BS5A 3DDHA 5L1IA 4B9UA 3AEFB 4DWFA 2JWZA 5D2MB 1QF6A 5TSSA 3NGDA 2KMDA 3ZRCA 1Z00B 2K1FA 4R66A 1ENFA 2LUMA 5H2FU 4EZ6A 4NJ7A 1ZQYA 1LQBA 5FR6A 1ZQTA 1QQ5A 4NY0A 2W9MA 5D49A 3U4EG 4QNLA 3H1UA 4QJFB 3J9CA 3KTQA 3B0XA 4KN4A 2MQJA 4PHAA 4F7ZA 2CXYA 5IIKA 1JIHA 2AGPA 3K9OB 4WURA 2AQ4A 5DBAA 5AKIA 1R4MB 1JUDA 2L7RA 4JPSA 4PT5A 2JR5A 2F2AB 4NAMA 4RQ5A 2G08A 1EU4A 5KFQA 4DS5A 1IYFA 4CRXA 4IG7B 2M0XA 4Y2TA 4OJPA 4Y2XA 1V1PA 4JIOU 4Y2UA 2K8CB 2JYEA 1Q5WB 2HHSA 2CPRA 3DOWA 3JPQA 2WXNA 5AK4A 1X2IA 3T5JA 2Q5WD 1KLUD 3SAGA 2W9AA 2XK5A 3DHHC 5IIIA 2FI1A 5ALSA 3MABA 2KSOA 4M9LA 3DDCB 4DFJA 4EELA 3SQIA 3AECB 1ZUD2 5J2IA 1VZ8A 2D10A 2VJ4A 5ALKA 1OUQA 2BBCA 2JZ3B 5IILA 1MA7A 2W3RA 1ZGUB 2KQ7A 2KQSA 4PGQA 3ZRFA 8ICPA 5J18A 2R8GA 2LASA 1WGRA 1C1YB 2LWPA 5J0QA 1E8ZA 3AU4A 3SI8A 5AZGA 2FE9A 2LYAA 1WXVA 5BMHA 3BVMA 4EKUA 4KITB 3MJ5A 3OJSA 1L3VA 3BVZA 1HQRD 4KGSA 3U8ZA 4DWIA 3E9SA 4K4HA 1UWXA 2FPKA 5KFFA 4JV2A 4I2JA 3BQ7A 3N1XC 1UUPA 3SEBA 2LI5A 4YMOA 4ED7A 9ICPA 2G4DB 2KICA 3RJFA 2P66A 2WX0A 2MA1A 1Y88A 1YZ7A 1ESFA 2V3SA 4JUZA 3P63A 5KFUA 2ZVNA 4EENA 1FD6A 1P98A 1P9DU 4IC9A 4YD1A 1HUOA 4ZH4A 3VAWA 3ZI4A 2CS4A 3U26A 2RQ5A 5KG5A 2KJRA 5BPCA 4RQMA 5J0PA 5IINA 4J9SA 1WXMA 2KDMA 5J0WA 2LHDA 2WU5B 4P1BC 2KFKB 1YN5A 2D3GA 2N9XA 4K3CA 2ZTCA 5JU5A 3QUBA 5KG2A 4N6EB 5J2KA 3H8WA 4DHJD 1ZDXA 5FR3A 1RYUA 2D6FC 1R7SA 1N60A 1GOZA 4DQRA 5LLIA 2J52A 4P0QB 2AL3A 4RU9A 2O6VD 2WP9B 5EE1A 4RFBA 3BK2A 3JVZX 5HR7A 9ICSA 5AKZA 3THVA 1ACCA 4BUGA 3PW7A 3A0HU 4HROA 4UB4A 4HPMB 4MFCA 3GV7B 4MGKE 4MM3A 1R4NB 4B6JA 4KMUA 3IT6B 1FEHA 4B9SA 3R7QA 2M4NA 3RJIA 3TMPB 4EEKA 4WJQA 4GXIA 2Y1IA 1YJIA 1T7PA 5DPRA 2KIWA 5ALIA 1XLOA 4M02A 5ALTA 5G5HA 1FNUA 1XCTL 1TE2A 4RQ4A 3DBRI 4M0WB 1DOYA 3D2SA 1A70A 2BDPA 1WR1A 3WKDA 1ZQCA 2GRIA 3Q14C 2JRZA 4DHZB 1ZRMA 4B9KA 3ZD8A 1CJEA 3OAWA 3RN9C 4W9HA 4DHJB 2K8AA 1LM8B 2DENB 3X23A 2F1JA 3L16A 3WKEA 4ANVA 3C28A 4I2BA 4PZNA 4YD2A 2F44A 3PV8A 1D5XC 3TEZA 4PZOA 2INCC 2G06A 1COOA 1CMXB 4M9GA 2JU6X 3LYSA 1VJ5A 4G0NB 4C4TA 2KOBA 2MBHA 1IGDA 4DQSA 2KVRA 1E90A 1GB4A 1GNUA 3PW5A 1UNSA 3QEBZ 4LDTD 4MJSB 4MDKE 2O2VA 4PGXA 5CRXA 4AP9A 4DFPA 2NO5A 5AM1A 2DPIA 4DOBA 1ZXHA 4OJ5A 2WXOA 4LJOB 4I2IA 2K8BB 3HM6X 1O03A 4P2HA 4MHVA 4BBNC 4ANUA 1BPYA 5AKLA 4UARA 1RAXA 1K8RB 3MC1A 7ICJA 9ICQA 2G5IB 1QQRA 1PDXA 1JWMD 1RDFA 2C5LC 4DDID 9ICCA 2E8OA 5EWGA 5CTRC 1PZNA 5AZHA 4FBUA 4O3SA 4PPXA 3FKYA 4H2AA 4WWOA 4Y2SA 5KAIU 2MA9B 2SAKA 2KKCA 4GDLB 4US8A 3M7DA 2D8CA 1BPZA 1TZOA 3Q8CA 1S77D 2C22A 1C9FA 2ZIUB 5ALHA 2ZIXB 3ONSA 1L0XB 2WDQB 2XN9C 3TAQA 5H8YE 2KJ9A 4F1SA 3SENA 4LNNA 2CJNA 1DOXA 2IMWP 4RCOA 2E8NA 4GU2A 4M01A 3JPOA 3PNCA 2KN4A 3K75D 1GAQB 5DQIA 4A8XC 2KXJA 2F3NA 5DG7A 4L23A 2WXLA 1N63A 4J9KA 5AEKB 5DB6A 5JUMA 2YLMA 2NR2A 2KKPA 3M8RA 3RYTA 4HAIA 3RBEA 2BCSA 2BWES 4WWMA 2WHIA 4MFFA 5AHXA 1AWDA 4YL8A 3WAOA 1P3QU 2IYDB 2HD5B 3MHZA 9ICEA 3V6JA 1NI3A 3BY4B 1TS3A 1SKRA 2ZPYA 5KT4A 2MEKA 1X9SA 1JXLA 3N7RC 2UWQA 2FNJB 3DQVA 2EZYA 3WK8A 9ICJA 3AE9B 3IT4B 3PGEA 4N9F4 4WIPA 4PS7A 8ICAA 3BQ2A 4XC2A 2Z59B 3I76A 3ML8A 2KTRB 1ZQWA 4K7UA 1U4AA 2V3PA 1BPDA 1OFFA 2DLBA 4MGYE 2OEHA 4NAWA 1FNWA 9ICHA 3PSTA 1MQ3A 4PL1A 1RWSA 2RMMA 3RH6A 2WS3B 4P0QA 1B43A 2LFIA 5DB8A 3AEAB 1WJUA 3BZDB 4ED2A 4YSZB 2HHWA 2L1AA 1C4PA 4G50A 5HG2A 2HOFA 1XLPA 1FPYA 1SEBD 1Y56A 4GXJA 2KZZA 4DFKA 2WXPA 2L8JA 2JX5A 3NY5A 3NTUA 5J0RA 3LVWA 3V7JA 4ECRA 1XWLA 2KVCA 3ZXRA 1L7PA 1C4CA 2GO7A 3BS5B 2JZPA 1TAQA 3BQ1A 5AI8A 1JMSA 4TQSA 1XSLA 2QB0B 2MSNA 4CF3A 3PS6A 2NO4A 1A76A 1KQQA 2V9HA 5DG8A 4RQ1A 4QZDA 3BQTA 1HEKA 2GBRA 2PW9A 2W82A 4NLZA 4BXOB 1SV4A 1NK7A 1ZD3A 2FIFA 3WCQA 1OW5A 1WM3A 1T3QA 5DKWA 3KYCD 9ICMA 2PFOA 3JPNA 1HJPA 2EZZA 5IO9A 4NL9A 1UQVA 2KK8A 2AQ2B 2WXFA 1JWUD 2C7MB 2I1KA 4ELVA 2XY7A 1EWCA 1K5OA 1ZQJA 1KLNA 4Q44A 2PI5A 1T94A 3BZCA 4MACA 2XVTA 1SWVA 2K4EA 2IDYA 4IR9A 2KMMA 5CEHA 2BCUA 2VJ5A 4PL2A 2HJ1A 2WXIA 4FBJB 1S0OA 3UM9A 1OQQA 3QX7A 1OEYA 5JHBA 3I1YA 3GIIA 3KFUF 3M6ZA 5EE0A 1KKXA 1TY0A 3V6KA 2R8IA 1RLFA 4KVGB 4A90A 1WIAA 1BGXT 2AYOB 4Q43A 4DQOC 3AMZA 1KFSA 1S1QB 1SBBB 4QWDA 3ZGZA 3H7SA 2QHOA 4A6QA 1SGGA 7ICUA 1P7EA 2K8BA 2R2OA 5EWFA 3PMNA 2KTQA 3MDAA 4AYBF 3GFKB 4B9LA 3OWEB 4IW0A 5ALUA 1WMHA 3HILA 4PK1A 3H0LB 4NLBA 3PW4A 3R3MA 4RPYA 3EPGA 3BYTB 2KFNA 4ELTA 4ECZA 1WGGA 2R8JA 1T6BX 3SFEB 2BR0A 8ICYA 3F2BA 2DGZA 9ICAA 1TKEA 1WJNA 2ES6A 8ICNA 2FE8A 3Q8EA 4YT0B 1NJYA 3AUOA 4JWNA 2HCFA 5DB9A 3HX0A 1J7BA 2WB1C 4G9BA 2UVRA 1K51A 3MFIA 3VC8A 1QILA 1D6EC 2XO7A 1ISNA 4E74A 5AKJA 1NKCA 3AH7A 3ZD9A 1D8BA 4GLSC 4WAFA 8ICJA 2ESEA 1QH9A 3NZ3A 3OHAA 2O6KA 2K4PA 2F8LA 4BWMA 2IA6A 1I4XA 5D3DA 2HHUA 4HVBA 4QZBA 9ICOA 5J2FA 2ZXHA 3LWLA 3IVFA 1FM0D 1RRBA 3MR2A 1FEZA 2RLTA 3HWTA 4EYIB 4F50A 1UT5A 4RNMA 3GZNI 4DHZE 4KN7A 1BNPA 4GFJA 1N5WA 3F2DA 1ZW7A 1L3UA 2G4SA 2QMTA 1VZ7A 2HHVA 1KFYB 1CQVA 2B76B 2DAFA 4QZEA 2MW5A 5DQHA 4KLGA 3DHIC 2JEGA 2LYBA 4CCHA 1KJTA 5CHVC 3SAFA 2VZKB 2JZBA 2XBBC 4J9QA 2CJOA 1LFDA 8ICTA 1E0ZA 4MEMA 1M94A 2JRIB 2KFKA 3RJGA 1S0NA 1Q46A 3SR6A 3A4RA 4IKGA 1Q8KA 2P6UA 3ICXA 3UXNA 2QLTA 5KFMA 2RPVA 4BFRA 2YB4A 4DQQA 4RGTA 2JVCA 1ZD5A 2VA8A 4RT3A 1Q0WB 2OM6A 4MEYA 4PGYA 2BB5A 2RDBC 2MCNB 3JPSA 1GB1A 2C7NB 3V6EB 2HTHA 4CNQA 2IGHA 3AE8B 2DZIA 1YN4A 3R8BA 4F93B 5KFDA 1YMHE 1D8YA 4KLEA 1B22A 2W7OA 3C5GA 3V7KA 3BZKA 4DOCA 8ICRA 2XI9A 2WF8A 1ZE3D 1BNOA 2Z7JA 5LXHA 5AI9A 3RB3A 2LXCA 1A0PA 4BXOA 2D3AA 3NOBA 4OW0A 3N7PD 1ZQDA 4XYCA 1WY8A 3ETRA 5AUKA 4AQ7A 1I4QA 4XDCA 1PK1A 2PKOA 2HDOA 4K4GA 3PPAA 2R8HA 1C78A 1Y8RC 4WQOB 3RNAC 1L8OA 3I57A 2H3ZA 2IGGA 1XF5L 1FFVA 2ASJA 3ZKJC 2KANA 2FMQA 3SU8X 2K25A 2KV2A 3MBYA 5DG9A 1E7VA 4WWNA 1SZPA 3VUYA 2DZKA 4XQ8A 1ZQSA 3RUIB 2JH7A 1XNSA 3F5EA 2BYVE 1PK3A 1BPEA 1ZD4A 3W2DA 5CX3A 1B1ZA 4CQNA 3EPIA 2BHNA 4YCXA 8ICOA 2K6DB 1AN8A 3R7RA 3LDAA 2N9EB 2KTFA 2KOXA 1WWUA 4M04A 3P4RB 4F4ZA 5ALYA 2BPFA 3RNGC 1F77A 4FZMA 1HTOA 2KX0A 9ICFA 4IQWA 1TFRA 5ALZA 4WQMA 2NTSA 3ZVVA 1QSYA 2AX5A 4MGZE 4ECSA 3KUDB 4IM0A 5KFLA 4Z6EA 5C0YA 4WH4A 1DOQA 4YMMA 3DVGY 1DOIA 3KWVA 1QSSA 4KTQA 4CO7A 4QIWC 3V3XA 1Z4NA 3IAS1 1KRPA 2KHQA 1QQ6A 2M19A 4QZFA 1K53A 4LK0M 4W9CA 2OHFA 1QOAA 3RTVA 1WCLA 4GOCA 4QAYA 5J0YA 4YG2A 2GH1A 2PMZF 2KFZA 4NJCA 2OXOA 4GGQA 4P7IA 1F2RC 2KJHB 2SEBD 4KIKA 2VKQA 3B2GA 4JWMA 2L83A 2K5PA 3GS2A 4ACFA 2C9WB 1VJKA 4UB5A 2Z0DB 3W5VB 5HR6A 2GLEA 2AXTU 2NBVB 3UINB 3RB4A 4XUSA 2N4FA 2KP7A 1P1AA 3N1YC 4RQ0A 4P0PB 3MR3A 2RDJA 5E79U 4J03A 2QC8A 4EX7A 1PGBA 3N7SC 2XGPA 5KFNA 4RNNA 7ICNA 5HHDG 2D3BA 1VCBA 4MSQB 3OJ3A 2HMXA 4GXBA 4MM3B 4PH5A 2IO1B 1X42A 2A1JA 2ZUBA 2JZBB 1MHXA 1SIJA 1UHUA 4Q45A 3EECA 4C4SA 3U2SC 2UVUA 2E1EA 2LBOA 2L0TA 4RZRA 4USAA 2K8HA 5IN7A 4RNAA 4KLDA 2Q4TA 3P4SB 1YD8U 2MBOA 4UDUC 1YIWA 2WQYB 8ICFA 2HBJA 5KFPA 2GLSA 4NZLB 1O08A 5DPWA 4HKQA 2KWCA 4ED3A 3EUB2 4DQPA 2N7EA 2F76X 3PX4A 2AU0A 1RM6C 2OEDA 3D2NA 4REZA 1U49A 7ICFA 3E2EA 3RJEA 1DGSA 5EWEA 8ICZA 3BS7A 2MLBA 4CE6A 2W43A 2Z0EB 3TCAA 1VDVA 4I2CA 1V8CA 2YN4A 2M9NA 1PVRA 4BOSC 2JH1A 1WYWB 4PS3A 1LKYB 5KG3A 1NENB 5J2AA 4DSFA 7ICLA 3QAQA 3L54A 1JQ4A 3T5KA 5AIAA 2R8KA 5GMVA 1N5XA 2PTLA 1EU3A 1XQQA 2E1FA 1I4RA 3I28A 1LV5A 3UGBB 1ZETA 7ICGA 3UQ2A 3LB8C 4EE2A 3QU2A 4JV0A 4QWEA 1XCQL 3URYA 1ZQIA 3WIMA 4NY8A 2Y1JA 2HVHA 3Q3FA 1N56A 1NKBA 4YXDB 4KLLA 1QCKA 1V2YA 3VTWA 1MFWA 3PT2B 2EH9A 1XS9D 1WXAA 4FS2A 3APCA 2I1QA 4M6WB 1GC7A 3QYPA 2IO0B 2KQ4X 2WXJA 1FRDA 3LDZE 3ZDMC 4M2YA 2HOQA 2CN1A 2WNMA 3T3NA 2BYTA 2H3QA 1TVAA 3AEVA 4LZGA 4MELA 3C21A 1IXRA 2WX1A 3HHMA 4QWBA 2PFPA 3TAPA 5ALOA 1UA1A 1PFDA 2L00B 3TKAA 2ASQA 3AEGB 4ED1A 2DQNB 2NPTB 2IOHA 5BOMA 1FO4A 4UQGA 4I6LB 1KM7A 1TK8A 3PSPA 1Z2MA 1ZDVA 3VR8B 1FCLA 4LJPB 5BMIA 3NRWA 8ICSA 4Y2QA 8ICWA 8ICLA 4RMAA 3TJPA 4AOFA 4P16A 4KZCA 4YR3A 1JN3A 1T0QC 2V9WA 3IG5A 3A33B 3MHSD 2WAQC 4C8OA 4K7SA 2FLLA 2KVSA 1L7MA 4EZJA 1UZXB 4TUQA 4B9VA 5J2CA 2LUEA 3F2CA 2LRWA 4XWWA 2REXA 2WF9A 4DSLA 1C76A 1E7PB 3RB6A 1V85A 3P1MA 1ED1A 2INNE 3MJWA 2JXTA 2PMVA 4B9MA 2M17A 3UQ0A 1KTQA 3TFRA 2ODGA 4RQ8A 3RULA 3CMMB 1J7CA 3VCBA 5B5EU 3B1LX 1YZ6A 4RQ2A 2W9BB 3TADA 4DL3A 2BGWA 3H8SA 4EUTA 5KFJA 1L7OA 1X9WA 4O5CA 4UB6U 3OLMD 2CHXA 3GIKA 1T0RC 1NK5A 4GDKB 5L83A 5K4LA 1MPEA 1IM4A 1IG6A 3ZNHB 3HPOA 3AEBB 5CR0A 2P35A 4ECXA 1JCKB 4ZYNA 2P6RA 2ZIUA 3IDWA 2LVPA 4OVVA 1JWBD 3KW5B 2BCQA 2AWTA 2HJ8A 2YTUA 4DBGA 5L95C 3CYMA 2G1EA 3ZIMA 2QB1A 3H9DA 4EEYA 5J0SA 3DVNU 4KLMA 1WSPA 5KHQA 4TUPA 2OOBB 3ZDEA 3GDXA 2Y3AA 2Y0SC 2ZUDA 4C0ZA 1YNTE 4YQWA 4IDIA 4UBBA 1SKSA 1JROA 2DX5B 5LXIB 3N32A 2BKFA 2IGDA 2W11A 5AM5A 5C2TB 5EDSA 5KT7A 3UIPB 2XCAA 4Z6FA 2W8LA 3DWGC 2EKIA 1Z1BA 1RQNA 2W9CA 4ZDVA 1J7AA 5HMLA 2GBKA 2LHTA 1XXGA 2PPHA 1RXWA 3SDLC 2PIAA 3PX6A 3KHGA 3QNMA 3Q8PB 1TZ1A 2XY6A 2KYWA 3MC0B 2WXQA 4JX1C 2PFQA 3RRGA 1P0RA 4TQ0A 7ICMA 1V97A 4DDGD 2IO3B 3SMVA 1NK4A 5D6JB 1J2MA 2W8KA 2DAJA 4DCCA 5DCNA 4DSIA 5BOLA 3AM9A 1M6YA 3UMGA 1T3NA 4Y2VA 2YY6A 4RUAA 2DKXA 1ECWA 4IWPA 4YFKA 4Q8FA 1ZQAA 3D2QA 4TQRA 3RH4A 2H88B 4FLHA 1S5LU 4W9FA 5ALEA 1COKA 4FN2A 5AKHA 3Q8RB 1GJZA 3FILA 2ZJDA 3KH0A 2I9GA 1VZ6A 2XK5B 3NZSA 4JWUC 4KLUA 1S97A 4HPLB 2C2RA 2MJDA 4W9JA 1BPBA 4RPZA 2K8CA 2XC9A 3RMKC 2LGDA 3TL5A 5J8YC 1WGDA 2G3QB 3VUXA 5AKGA 5B66U 1J0GA 4O3RA 3C1YA 4YTMB 4II2B 3M9MB 4Q2JA 2ISOA 4NV0A 1ZQLA 2IZVB 1TT5B 2OYYA 1WM2A 4NAWB 3TIXA 4RT2A 3VXWA 2A1JB 4R3DA 1AARA 1WZ3A 3ISBA 3K9PB 3DVNV 4QZHA 4YSYB 4IQVA 1V38A 1L3TA 2H3IA 1V5TA 2ISPA 3E58A 1TTNA 1EF5A 3H4BA 2IOFA 2BTEA 2KAJA 3M6KA 4LDTB 1RFKA 3MC9A 1F9JA 3QEAZ 4QZAA 4I29A 4P0PA 4BAXA 4BKGA 3ISCA 3N30A 4F5QA 1J2NA 4HRSA 1MN8A 2KMAA 2BZFA 4HCPB 3KHRA 4Y2JA 3PZDA 2KDIA 5FKAC 3HKZC 2KK0A 2ZNVB 3HT3A 2HW3A 1KH0A 3PZ8A 1FFUA 2LGIA 4UB3A 5AI5A 4HYKA 2CRXA 1LVHA 5C3JB 2ZNVC 1OTRB 4GIBA
chains in the Genus database with same CATH topology
4A6QA 1QKZA 1STEA 2PVOD 2XNAC 1P7EA 2ONQA 4FXCA 1VRAB 2EELA 3OWEB 2M0AA 1IBXB 2AQ3B 1QOBA 2YEPF 4OZCA 3HUIA 3BYTB 4O1NA 2WXKA 1T6BX 4LTUA 3SFEB 5H92C 1TKEA 2J4XA 2N0SB 3Q8EA 4YT0B 2FE8A 2V3NA 2N9KA 2DWQA 4M0WA 3KWLA 3FC4A 1YQ3B 3P4QB 2KACA 1J7BA 1I4PA 1ZPSA 1K51A 1QILA 1SXTA 1D6EC 5FK9C 3AE4B 1NYRA 1F0ZA 2JSVX 3AH7A 3AE7B 1JWSD 1SE4A 2KWDA 4GLSC 4WAFA 3W9CB 3EA6A 3NZ3A 4ZHPA 1YQ4B 1HA5A 1I4XA 5D3DA 4TSSA 1BMLC 2AQ1B 3IXSA 4ZHOA 1XEEA 2E3TA 1FM0D 3TUOA 2BB6A 3AE6B 1L6UA 4B0EA 1UWMA 3BK1A 3MFGA 2ZW0A 3NVWA 3B2FA 4RF0A 1VLBA 1N5WA 2H89B 3TEWA 4JWSC 4YSXB 2QMTA 1VZ7A 1I7HA 1KFYB 1CQVA 2B76B 1QLBB 2LHEA 3ZJTA 4ITKA 3PO0A 3Q8BA 2WLBA 3LYYA 2IJ0A 3CIRB 1TS5A 2VZKB 1DGJA 2CJOA 1BXTA 1FXAA 1SE3A 4P6VF 1E0ZA 2I38A 3ABVB 4KX6B 4MT5A 3SR6A 4IKGA 1KTKA 3HVDA 2RPVA 1VR9A 3VRBB 3NUHB 4TQ1A 1TY2A 4HJGE 1IBXA 4RGTA 4RH6A 2BB5A 4TMAB 1MHHE 3I9V1 1GB1A 1HXYD 4OVZA 2LJIA 2IGHA 2BS4B 3AE8B 1YN4A 3R8BA 1T5XD 1YMHE 2K0PA 5I4DA 2ICIA 2WXHA 3AE3B 3KLSX 1JWAD 1N62A 1ZE3D 2W54A 3H8HA 3FAHA 1GPXA 1QOFA 4ZRQA 4OW0A 1OQRA 3ZJVA 1WXQA 1N61A 4N58A 4AQ7A 3ETRA 5AUKA 4RGOS 1I4QA 1MVKA 4XDCA 5BMGA 2PKOA 3RPFC 1C78A 5MPOA 3I57A 2IGGA 2TSSA 3NS1A 1XF5L 1FFVA 1K52A 1ZP0B 5D7GA 5JXVA 1UGJA 4YTPB 5HFYA 3Q69A 3HRDD 3W2DA 1B1ZA 2IPKD 2WXRA 4CQNA 4C80A 2LMCA 3Q8FA 3O13A 4RGNA 1AN8A 3VRAB 3IAM1 1HEZE 3ZQ4A 2BS3B 1B9RA 3Q8AA 1XLQA 3RFZB 1JALA 3P4RB 1IGCA 1I4HA 1F77A 1QT9A 2X38A 4L1BA 2W55A 5EE3A 1ET6A 2Y5PA 3AEFB 4US9A 4WQMA 1QF6A 2NTSA 2DBYA 2GI9A 5TSSA 1TJEA 2AX5A 4AS1A 1CK1A 1ENFA 3FILB 4WH4A 2LUMA 1DOIA 3KWVA 1FNVA 3V3XA 1F2RI 3DWMA 1M4VA 3IAS1 3U4EG 5EE9A 1MI0A 3J9CA 2M19A 1K53A 4LK0M 2MH7A 2OHFA 1QOAA 2NTTA 4DXFA 1NVID 3LXFA 4WURA 4NJCA 4JPSA 4PT5A 3C8YA 2BT6A 2BW2A 4NAMA 3TEYA 1F2RC 2SEBD 1EU4A 2DYMA 3B2GA 3PZ7A 2L83A 3W1SA 1SSNA 2K5PA 3GS2A 1V1PA 1VJKA 3W5VB 2JYEA 1DYQA 2WXNA 2Q5WD 3AE2B 1KLUD 3VQIA 1C79A 4XWTA 1E10A 1PGBA 5G5GA 1SJHD 2K3UA 3BIID 5HHDG 3AECB 1ZUD2 1VZ8A 4MM3B 2ACZB 3U7ZA 2BBCA 1MHXA 3AV8A 1SIJA 2W3RA 4IOIE 4ZYSA 1TS2A 3U2SC 5BYRA 2LEKA 4USAA 3NVZA 2WDVB 4RNAA 4UDUC 3E56A 3P4SB 2WQYB 5BMHA 3BVMA 4NZLB 3MJ5A 3P42A 4HKQA 3EUB2 3BVZA 1HQRD 4KGSA 2J53A 3E9SA 1RM6C 2OEDA 1UWXA 4REZA 3SEBA 3V05A 1UUPA 5E6JA 1JW9D 2INPE 1VDVA 1YJJA 1V8CA 1ESFA 1E6EB 2JWUA 3P63A 2WXGA 1FD6A 4C56C 4J3OD 1NENB 1KRHA 2HDEA 1JQ4A 1V1OA 1N5XA 2KDMA 2LHDA 2PTLA 2PVGC 2WU5B 1EU3A 1YN5A 1I4RA 4N6EB 4KGTA 3UI3A 1ZDXA 1SF0A 3LB8C 4EE2A 1XCQL 3URYA 5FR3A 1SJED 1R7SA 1N60A 4ZOHC 1GOZA 1FMAD 4C7ZA 2J52A 1XLNA 1LO5D 4RGMA 1FRRA 2WP9B 4YXDB 5EE1A 4RFBA 3BK2A 1ACCA 1K50A 1IUEA 2WDRB 4HROA 1PGAA 4KKJA 1HZ6A 3BWUD 3GB1A 2KQ4X 2WXJA 1FRDA 2ZW1A 3IT6B 1FEHA 1D4BA 4YWGG 1KF6B 2M56B 2D5GA 2WNMA 3T3NA 4D2KA 2BYTA 2FUG1 2J42A 1YJIA 2RDGA 1XLOA 1ET9A 4OHJA 5GXGB 5G5HA 1FNUA 1XCTL 4ARIA 1PGXA 1DOYA 1A70A 1Q10A 1PFDA 1WRIA 2GRIA 3AEGB 1CJEA 1FO4A 1BUIC 4OZBA 1XO3A 1ZDVA 3VR8B 1FCLA 3NRZA 1L5PA 5BMIA 1CZPA 3TEZA 1D5XC 1JRPA 3AEEB 4P16A 4YTNB 2JU6X 2DYOA 3AEDB 1IGDA 2L52A 1GB4A 1UNSA 4XWWA 2W3SA 2QIEB 1C76A 1E7PB 2V0GA 3P1MA 3CWIA 1ZXHA 2WXOA 2INNE 4RF1A 2HTME 4HKZE 1TKYA 2JXTA 2PMVA 4OZAA 3SFDB 1L0YB 1J7CA 1SB3C 1QQRA 1PDXA 2MJEA 1JWMD 2QILA 4HEA1 4DXGA 2YEPB 4H2AA 3VR9B 2SAKA 4GDLB 4GDKB 4US8A 1MPEA 1TZOA 3Q8CA 1RYJA 3AEBB 1C4AA 1C9FA 1JCKB 3AE1B 2G9HD 1L0XB 1NEKB 2WDQB 2XN9C 1FIQA 5H8YE 1JWBD 1TS4A 2CJNA 1DOXA 1ZOYB 2G1EA 5C3JB 4RCOA 1V1PB 2CU3A 2KN4A 1D5MC 3NVVA 1GAQB 4A8XC 2N9LA 1WSPA 3MP9A 4L23A 2WXLA 1N63A 1FCCC 2Y3AA 2R61A 1YNTE 1WGKA 4IDIA 1JROA 4WWMA 1NYQA 3AE5B 3N9YC 3R2IA 2IGDA 1EM7A 4XDDA 3ZJUA 1AWDA 4A55A 5C2TB 2L32A 4MH8A 2K22A 1SE2A 2JQRB 3AN1A 1P7FA 1E9MA 3MHZA 1QOGA 4KGRA 3DWGC 1NI3A 2EKIA 2WU2B 1JMLA 1TS3A 3BVGA 1ROEA 1J7AA 2K9XA 2MEKA 2GB1A 4ZRPA 3TEXA 3P4PB 1L4ZB 1XXGA 2PIAA 3AE9B 3IT4B 4WIPA 3MC0B 2WXQA 1EWYC 4JX1C 2QEJC 2I2YA 1KLGD 4TQ0A 2MJ3A 1V97A 4ARCA 2RDHA 1ZXIA 1AYFA 4KKIA 2JYTA 2V3PA 3AB5A 1OFFA 2DLBA 2WXMA 5BYQA 2FBWB 2PLPA 3AM9A 1FNWA 4LLGM 2WS3B 1RWSA 2RMMA 2VZKD 2LFIA 5D3IB 3AEAB 5T8IA 3BZDB 2H88B 4YSZB 2L1AA 1C4PA 1WYGA 5HG2A 3T3OA 1XLPA 4C7YA 1SEBD 1Y56A 1PYWD 2WXPA 3FILA 2JX5A 1VZ6A 3L4PA 4JWUC 1C4CA 1L4DB 1FXIA 2JZPA 3HVZA 5AUIA 2MJDA 2ON8A 1C77A 3KQ4A 3U52E 5BYSA 4A9AA 1HZ5A 1L6VA 3EGRA 4YTMB 4XE0A 4Q2JA 1YN3A 2W82A 4L2YA 3ZYYX 2PW9A 1L0VB 2QSDA 2N7JA 2V4IB 2Y5CA 1WWTA 3WCQA 4NAWB 1T3QA 2E6XA 1I4GA 4R3DA 2NMQA 3B9JA 1AW7A 2AQ2B 2WXFA 4YSYB 1JWUD 3NVYA 3GP7A 3R2TA 3W5UB 1TKGA 4N59A 1EWCA 2QJLA 2BTEA 2KAJA 5LNK1 1RFKA 4MACA 3TSSA 3BYYB 2IDYA 5HI1A 2KMMA 2Z8LA 2WXIA 4B0MA 4JE3B 4HRSA 1D5ZC 1OQQA 5FKAC 1TY0A 1KH0A 5EE0A 3PZ8A 1FFUA 2LGIA 4A90A 2BS2B 4DQOC 3AMZA 1SBBB 3ZGZA 1PUTA 1TYGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WGK A;  4IDI A;  3NS1 A;  2PVO D;  1JQ4 A;  1JRO A;  1FFV A;  1N5X A;  1ZP0 B;  2PVG C;  4WWM A;  1NYQ A;  2WU5 B;  3AE5 B;  4FXC A;  1AWD A;  4N6E B;  5C2T B;  3LB8 C;  1SF0 A;  2K22 A;  4YXD B;  2JQR B;  3AN1 A;  4YTP B;  1R7S A;  1N60 A;  4ZOH C;  1E9M A;  1FMA D;  1QOB A;  1QOG A;  3HUI A;  4C7Z A;  1XLN A;  3HRD D;  3DWG C;  1NI3 A;  1FRR A;  2EKI A;  2WP9 B;  2WU2 B;  4C80 A;  4LTU A;  5EE1 A;  1TKE A;  2N0S B;  5H92 C;  4YT0 B;  3SFE B;  1ROE A;  1J7A A;  2K9X A;  2DWQ A;  3P4P B;  3VRA B;  3KWL A;  3FC4 A;  1IUE A;  1YQ3 B;  2WDR B;  3P4Q B;  1J7B A;  2BS3 B;  2PIA A;  4HRO A;  1XLQ A;  1B9R A;  1JAL A;  3P4R B;  3AE9 B;  1EWY C;  4JX1 C;  1FRD A;  3AE4 B;  1NYR A;  1QT9 A;  5MPO A;  1F0Z A;  3AH7 A;  3AE7 B;  2W55 A;  1KF6 B;  1V97 A;  2M56 B;  2MJ3 A;  5EE3 A;  1ZXI A;  3AEF B;  3W9C B;  1AYF A;  4US9 A;  4WQM A;  4ZHP A;  1QF6 A;  2DBY A;  1YJI A;  1OFF A;  3AB5 A;  1TJE A;  2AX5 A;  1XLO A;  1YQ4 B;  2FBW B;  5GXG B;  3AM9 A;  5G5H A;  1DOI A;  2WS3 B;  1RWS A;  4ZHO A;  1DOY A;  1A70 A;  1PFD A;  2E3T A;  1WRI A;  3AEG B;  3DWM A;  1CJE A;  1FM0 D;  3AEA B;  5EE9 A;  3AE6 B;  1L6U A;  2H88 B;  4YSZ B;  1FO4 A;  2M19 A;  2MH7 A;  1WYG A;  1UWM A;  1XO3 A;  1XLP A;  2OHF A;  3VR8 B;  3NRZ A;  1QOA A;  1L5P A;  1NVI D;  4C7Y A;  3LXF A;  1CZP A;  3NVW A;  2JX5 A;  3B2F A;  1JRP A;  3AEE B;  4YTN B;  1VLB A;  1N5W A;  2BT6 A;  2H89 B;  3L4P A;  4JWS C;  4JWU C;  4YSX B;  1FXI A;  1I7H A;  1KFY B;  2B76 B;  3AED B;  2L52 A;  1QLB B;  2L83 A;  2MJD A;  3B2G A;  2K5P A;  5AUI A;  1VJK A;  4ITK A;  3PO0 A;  3W5V B;  2WLB A;  4A9A A;  2W3S A;  2QIE B;  1E7P B;  1L6V A;  3P1M A;  3CIR B;  3CWI A;  2Q5W D;  3AE2 B;  1DGJ A;  4YTM B;  2CJO A;  1E10 A;  2HTM E;  1FXA A;  5G5G A;  1TKY A;  4P6V F;  3ZYY X;  1E0Z A;  1L0V B;  3ABV B;  3SFD B;  4KX6 B;  2Y5C A;  1WWT A;  3SR6 A;  3BII D;  3WCQ A;  3AEC B;  1ZUD 2;  1J7C A;  1SB3 C;  1T3Q A;  1PDX A;  3VRB B;  2ACZ B;  2MJE A;  3B9J A;  3AV8 A;  1SIJ A;  2W3R A;  4YSY B;  2LEK A;  3NVY A;  3NVZ A;  4USA A;  2WDV B;  3VR9 B;  3W5U B;  2BS4 B;  3AE8 B;  1TKG A;  3P4S B;  4N59 A;  2WQY B;  4US8 A;  2QJL A;  2KAJ A;  1RFK A;  1RYJ A;  3AEB B;  3AE3 B;  3EUB 2;  3HVZ A;  3AE1 B;  1RM6 C;  1NEK B;  1JWA D;  2KMM A;  2WDQ B;  1FIQ A;  1N62 A;  5H8Y E;  1JWB D;  2W54 A;  4HRS A;  2CJN A;  3FAH A;  1OQQ A;  1ZOY B;  1DOX A;  2G1E A;  1GPX A;  1JW9 D;  5C3J B;  1QOF A;  1VDV A;  1OQR A;  1YJJ A;  1V8C A;  1WXQ A;  1N61 A;  2CU3 A;  4N58 A;  3NVV A;  3ETR A;  1E6E B;  1FFU A;  1GAQ B;  5EE0 A;  5AUK A;  3P63 A;  2PKO A;  3RPF C;  1N63 A;  2BS2 B;  3AMZ A;  1NEN B;  1PUT A;  1KRH A;  1TYG B; 
#chains in the Genus database with same CATH topology
 1MJD A;  3ONN A;  1UBI A;  2ONQ A;  4OJL A;  4J6I A;  1T0Y A;  4W9K A;  4M8M A;  8ICC A;  4F2S A;  1V81 A;  3QUC A;  1A77 A;  4IRK A;  2FPL A;  5CP2 A;  4ACO A;  3VHT C;  3AI5 A;  4M9J A;  4K1R B;  2FCM A;  4ICA A;  3RAQ A;  3GV8 B;  1SE9 A;  2W9N A;  2XEW A;  2VAN A;  4G3I A;  2KC1 A;  2G5H B;  4NL9 C;  4DSE A;  1YQ3 B;  1XO1 A;  9ICI A;  3M9N B;  3JPP A;  2EAO A;  1DK2 A;  1SXT A;  5FK9 C;  5IA7 A;  1NYR A;  2LMR A;  1F0Z A;  2MP2 B;  3AE7 B;  2DF4 B;  3KZI U;  1GO3 F;  1ZQK A;  3OGU A;  4ZHP A;  1ZQG A;  4DO9 A;  2LPE A;  4U6P A;  1HA5 A;  5IOI A;  4HK2 A;  1HE8 A;  4FAD A;  3IXS A;  4O3Q A;  3H7I A;  3PSI A;  1D8L A;  3FDS A;  2QCZ A;  3DBS A;  2GOL A;  1S10 A;  3AE6 B;  4CF5 A;  2B21 A;  2B3A A;  4ANW A;  5J0X A;  4R63 A;  3BK1 A;  2KDF B;  3MFG A;  1WXS A;  4KV2 A;  3LJ3 A;  2J6T A;  1ZJN A;  3NVW A;  3EHV A;  4FS1 A;  2VH2 A;  3UMB A;  2A4Z A;  3ETL A;  1Z5S B;  2H89 B;  5KT5 A;  3MR6 A;  3KUC B;  2EQY A;  2HHX A;  2G07 A;  3G6X A;  1I7H A;  2KWV B;  1QLB B;  1UPH A;  3B08 A;  3QUT A;  1L7Y A;  1ZQN A;  1F1H A;  4F4X A;  1C3T A;  3F53 A;  2WAQ F;  2IJ0 A;  1TS5 A;  4MGI E;  4J9L A;  1DGJ A;  4CYE A;  5TIS U;  1X6I A;  1FXA A;  2EZX A;  4UB2 A;  2HBK A;  4MT5 A;  4AUQ C;  1TV9 A;  4YVZ A;  4DL7 A;  2DUY A;  4IRD A;  4RQ3 A;  3HIZ A;  3NUH B;  1IBX A;  1ZQX A;  2E8P A;  4BBN F;  2AJQ A;  1WF9 A;  1X1M A;  2NBW B;  1LGR A;  4I2F A;  4TMA B;  3WK5 A;  3I9V 1;  3WKC A;  4C00 A;  4KZ0 A;  4R65 A;  2W7P A;  4ED6 A;  1MG8 A;  1XD3 B;  4O3N A;  4W9G A;  4YXM A;  3IP4 B;  4JK1 A;  3P2B A;  1QTM A;  1T5X D;  4O3M A;  3GZF A;  5C5J A;  1ZQQ A;  2WXH A;  3AE3 B;  4B9T A;  1ZQV A;  2QAR B;  4Z6D A;  2EAN A;  2IOF K;  2ATL A;  1N62 A;  3KD3 A;  2KG5 A;  4LNF A;  3PO5 A;  3H8H A;  3FAH A;  4M9N A;  3WK7 A;  2WF7 A;  1WXQ A;  4N58 A;  2IND C;  3SV4 A;  1WCN A;  2KD1 A;  3M1Y A;  2BCR A;  2LVO A;  3ZNI D;  2F1I A;  1U45 A;  4C4V A;  2TSS A;  2A1A A;  3NS1 A;  2VH1 A;  1K52 A;  2E5S A;  2OH2 A;  3AU5 A;  5D7G A;  2MWS B;  2EAP A;  4YTP B;  4FHK A;  1DK3 A;  3ZDA A;  4F4W A;  9ICB A;  3IN5 A;  1KLV A;  2C60 A;  8ICB A;  5D4B A;  4C8K A;  4C80 A;  2IPK D;  1XT9 B;  3Q8F A;  4PYZ A;  4JGH B;  3DVG X;  4UAS A;  1E8W A;  3VRA B;  2MU2 A;  2FCS A;  1HEZ E;  4GDK A;  2FID A;  2XGQ A;  4IWQ A;  4ANX A;  2BS3 B;  5L1M A;  5J2J A;  1XLQ A;  4KDI C;  3SEI A;  2EAM A;  3RFZ B;  7ICR A;  4PJ0 U;  2X38 A;  4MF8 A;  5D94 A;  2Y5P A;  2FCN A;  1TBE A;  2DBY A;  5HP4 A;  2GI9 A;  4QIW F;  4I28 A;  5L1J A;  1C7Y A;  5HMM A;  5AK3 A;  2ZIX A;  4FZL A;  1D9F A;  1OXJ A;  1MI0 A;  3ZDC A;  4HCN B;  1WX8 A;  5E6P A;  4X57 B;  1B0X A;  9ICW A;  1NVI D;  2HI0 A;  3EW9 A;  4MFA A;  2FLP A;  2OJR A;  4TKN A;  4NM2 A;  2ZIW B;  3BJY A;  3TEY A;  3IM1 A;  4FHJ A;  4EFO A;  4NPN A;  1EO6 A;  3WK4 A;  3LWM A;  2DYM A;  4IM2 A;  3VDZ A;  3PZ7 A;  3ZLZ A;  3W1S A;  2CHZ A;  2EKE C;  1NOM A;  2YX8 A;  3M9O B;  2M0N A;  4A20 A;  1YX5 B;  2KFJ A;  3M8S A;  3WU2 U;  2NRV A;  4J9M A;  3QIJ A;  3C2M A;  2RD0 A;  4P1C C;  3CP8 A;  2ZVO A;  3VQI A;  1NNL A;  1C79 A;  4XWT A;  1E10 A;  3ZNG C;  2PKE A;  4ECT A;  1H4R A;  3RR7 A;  1MQ2 A;  4M6W A;  5KFW A;  5DPS A;  5AIB A;  2ACZ B;  3U7Z A;  2HE7 A;  3DCG A;  3AV8 A;  3DPD A;  4IOI E;  4P4P A;  3Q3N C;  4KX5 A;  1KN5 A;  4RPX A;  4ZYS A;  4QW8 A;  4HLE A;  3RRH A;  1X66 A;  2BWF A;  2LEK A;  2WDV B;  3NVZ A;  4I2A A;  5ALF A;  1SZH A;  2HVI A;  1B4F A;  3AXC A;  2LGX A;  2LI6 A;  2LM4 A;  4R8U B;  4PHP A;  1ZQH A;  3DEE A;  3ZDD A;  5KHO A;  3V05 A;  3UF8 A;  4DSK A;  5AI6 A;  1JW9 D;  3V6H A;  3SHQ A;  2PJH A;  1K1S A;  1YJJ A;  2JV3 A;  2ZJ5 A;  3FM9 A;  3OTQ A;  2WHE A;  3GQC A;  3CST A;  2WXG A;  4J3O D;  5CHF A;  2GMI C;  1KRH A;  3T9L A;  3KKA C;  3KYD D;  4F5N A;  1V1O A;  2PVG C;  3VH4 B;  2JEI A;  2RGF A;  4KGT A;  1IV8 A;  3GOE A;  3Q2A C;  1SF0 A;  2V4L A;  1SJE D;  1FMA D;  5J2G A;  1RYS A;  1R4N I;  4LVS A;  1XLN A;  5IKC M;  5HHH A;  1LO5 D;  1G6J A;  1FRR A;  3TAN A;  2JT4 B;  7ICK A;  5KNI A;  4K7W A;  3DBH B;  2OWO A;  1K50 A;  2MUT B;  4LCD E;  4F4K A;  1IUE A;  2WDR B;  3QQ8 B;  2RHF A;  1KL9 A;  4F3O A;  9ICG A;  1HZ6 A;  3BWU D;  4IM3 A;  3Q8L A;  1KBU A;  2H5X A;  1D4B A;  4YWG G;  2M56 B;  3K4G A;  2FUH B;  1E5W A;  1ZJM A;  1WE6 A;  4D2K A;  2FUG 1;  3V61 A;  4RQN A;  2BKE A;  2V1Y A;  1ET9 A;  2AQ0 A;  4I2H A;  5GXG B;  4C8L A;  4HWI B;  4ARI A;  1WZ0 A;  1PGX A;  3DBR B;  3PRE A;  1K1Q A;  1Q10 A;  2KZR A;  5ALR A;  1QQ7 A;  2JUO A;  8ICK A;  1V5O A;  5ALQ A;  5KFT A;  4DOA A;  2KJ6 A;  4OZB A;  1XO3 A;  3U30 A;  5JZE B;  1L5P A;  3Q8K A;  2DNF A;  5E6N A;  1ZQO A;  4I6P A;  1JRP A;  3KOO A;  4JB3 A;  7ICT A;  3MTN B;  1J97 A;  2BGF A;  4HDQ A;  3H7P A;  1C20 A;  5TZV A;  5T14 A;  4KLI A;  1Z19 A;  2L52 A;  3ZO5 B;  3N4M B;  2KSO B;  3N97 B;  2K4I A;  3DBL B;  3QK0 A;  4OVU A;  3C23 A;  3VTU A;  2W3S A;  3AU2 A;  7ICS A;  2HHT A;  2QIE B;  9ICX A;  4UAU A;  3CWI A;  2WTF A;  2HTM E;  2KVZ A;  1TKY A;  2W9C B;  4MEX A;  2NRZ A;  2D07 B;  3WA0 A;  5HHI A;  3CW2 C;  5J0U A;  5KG7 A;  3M3J A;  4U7C A;  3NJT A;  1L6N A;  4XZ4 A;  4HPP A;  2Y9T A;  2MJE A;  2QIL A;  1SKW A;  1PQS A;  3GU3 A;  1T4G A;  2BQ3 A;  3UXO A;  1XO0 A;  4IQU A;  4BVU C;  5J17 A;  2L3Z A;  2DKZ A;  2LKY A;  1NK9 A;  4KLQ A;  5AKY A;  3VR9 B;  3TAR A;  3AQF A;  3KKA A;  1RYJ A;  3A9K A;  1C4A A;  1NEK B;  1R4M I;  4KLS A;  3RI7 C;  7ICQ A;  2A5U A;  1XC9 A;  2OJW A;  3GIL A;  3MGI A;  3QJZ A;  4NJ8 A;  2RRD A;  5DLG A;  2PI4 A;  2CU3 A;  1NZP A;  1AQ6 A;  3NVV A;  1D5M C;  2N9L A;  2LD9 A;  4RQ6 A;  3MP9 A;  1FCC C;  4O9M A;  2H3F A;  2A3V A;  1WGK A;  5JRT A;  3NZU A;  1ZQB A;  4M00 A;  3AE5 B;  3N9Y C;  3R2I A;  2RDI A;  5ALG A;  1EM7 A;  1WRD B;  2KLC A;  4TUU A;  4XDD A;  3I63 C;  3B0Y A;  5AK6 A;  1TIF A;  2CKH B;  1OQY A;  5CB1 A;  2WF5 A;  2JQR B;  3AN1 A;  4FJY A;  2N9P C;  1E9M A;  4AP4 C;  1QOG A;  2MRP A;  3S6J A;  4KSK C;  1E8Y A;  4QZI A;  2WU2 B;  3PZP A;  3A9J B;  3BVG A;  3VFK A;  4O3P A;  2K9X A;  3TEX A;  1URJ A;  3PLV A;  4QW9 A;  4C8M A;  3QC8 B;  1L4Z B;  4F4Y A;  2JEJ A;  4IRC A;  3VVW B;  5KFR A;  2F8K A;  1LXD A;  3PV1 A;  3ALB A;  2MHJ A;  1ZQU A;  3MR5 A;  2QEJ C;  1P7D A;  1KLG D;  4BZA A;  1BVS A;  2QKQ A;  8ICE A;  1RFA A;  2DHZ A;  3IFW B;  9ICU A;  1ZXI A;  2M8S A;  1AYF A;  1OEY J;  3W1S C;  2MUT A;  2JYT A;  3PY8 A;  4GDL A;  2FBW B;  3A1Q A;  1F44 A;  2PLP A;  4BWJ A;  1E7U A;  1TK0 A;  4LLG M;  1UCV A;  2H3V A;  5KG4 A;  3L3F X;  3T8M A;  5D3I B;  5T8I A;  2FJ6 A;  4YXJ A;  1DRG A;  4PHD A;  3ZDT A;  3T3O A;  4K81 A;  4DFM A;  1PYW D;  4KLJ A;  1ZQ1 C;  2KJ5 A;  5KFA A;  2KZM A;  1MC8 A;  1FXI A;  5IIJ A;  1Q1O A;  5DBC A;  1KW4 A;  2ON8 A;  1D3Z A;  3NS8 A;  4I2E A;  3KQ4 A;  4DS4 A;  1SGH A;  4OJ6 A;  5KG0 A;  4GXK A;  1L6V A;  2M1M A;  4GIV A;  4A9A A;  5JH5 C;  1Q3V A;  2W9B A;  1X6J A;  4G11 A;  2BYF A;  4II3 B;  1I35 A;  3ED5 A;  5AKE A;  4PHE A;  1YN3 A;  3OHB A;  4L2Y A;  3ZYY X;  4FA6 A;  1L0V B;  1V9J A;  4OJO A;  4QZ9 A;  2V4I B;  1WH3 A;  2FMP A;  2Y5C A;  2N1R A;  5AK5 A;  4F5P A;  1L3S A;  4O5K A;  2BYE A;  4DK5 A;  3RNF C;  4B6W A;  3D6J A;  2NMQ A;  2ZG6 A;  1KFT A;  3ALR A;  3ZTC A;  4C4R A;  3PLU A;  2AH5 A;  3NVY A;  3EFC A;  3OJU A;  3R2T A;  4CF4 A;  1TKG A;  1PVP A;  4Y2P A;  3RCZ A;  3O65 B;  4KLO A;  3AUL A;  5LNK 1;  1J8C A;  3KHL A;  2KDE B;  3H4D A;  4JV1 A;  2WFA A;  3BYY B;  3ZUN A;  4EBE A;  2JHD A;  3H6N A;  5HI1 A;  1MSW D;  5KFY A;  4GSW A;  2JY6 A;  3A0B U;  2AGO A;  2Z8L A;  2G0A A;  3R66 C;  4JE3 B;  5GTH U;  5KT3 A;  4DL5 A;  1UF0 A;  5G2N A;  4RQ7 A;  4EBC A;  4FFD A;  1S8O A;  4EX6 A;  4W9L A;  4W9E A;  2FMS A;  3H0M B;  3ECI A;  2XID A;  1RZT A;  1BPX A;  2GWS A;  1U9L A;  1X40 A;  8ICV A;  2PVO D;  2XNA C;  3PRM B;  1YQB A;  2IBI B;  2BQU A;  2UVV A;  3SV3 A;  2WYQ A;  1S0V A;  1VRA B;  2EEL A;  1U48 A;  2K4H A;  5JHA A;  3T3F A;  2O2V B;  1IBX B;  2LXA A;  2AQ3 B;  2WWZ A;  2YEP F;  3HUI A;  5CHW A;  3JYU A;  5J2R A;  4Y2R A;  2IO2 B;  2WXK A;  4CGZ A;  4O1N A;  4AYB C;  2GBM A;  4BOZ B;  4LTU A;  5KFK A;  2N0S B;  4KSL C;  3V72 A;  2DWQ A;  1UD7 A;  3SYZ A;  3I3T B;  3KWL A;  1UH6 A;  1N48 A;  3L5K A;  1ZPS A;  4M0A A;  1Z4O A;  1HUZ A;  1H38 A;  2G09 A;  4IR1 A;  3AE4 B;  2JSV X;  1JWS D;  3GZN B;  1L5U A;  3W9C B;  1VD2 A;  3EA6 A;  4EYH B;  4BKS A;  2KNJ A;  4WWP A;  4DSJ A;  2RPQ A;  5J2E A;  3GIM A;  1YQ4 B;  2K39 A;  3PX0 A;  2ASL A;  5F9N A;  8ICI A;  8ICU A;  1EUV B;  2AQ1 B;  1XSN A;  4FJV B;  4J9R A;  4ZHO A;  2KJ8 A;  4OO1 J;  4F5O A;  1WI0 A;  4X5V A;  3TUO A;  4A3O A;  2BPG A;  1L6U A;  4Y2Y A;  4DF8 A;  2LGS A;  4NJ6 A;  2KDB A;  4WJN A;  5DBB A;  4UBC A;  2AHO B;  4IQT A;  2JRH A;  4F8C B;  1SV0 C;  4IS7 A;  2F77 X;  2AL6 A;  3B2F A;  1HIW A;  4ECU A;  4RF0 A;  4BKS D;  1VLB A;  3EFU A;  2KD0 A;  4WJ3 B;  2K60 A;  1HTQ A;  4YSX B;  2LJ5 A;  5DB7 A;  2J0M A;  2X8X X;  1CUK A;  1ARO P;  5KFZ A;  2XIC A;  4ITK A;  3QE9 Y;  5DDY A;  3Q8B A;  2J0J A;  5AIC A;  3LYY A;  1V86 A;  2R18 A;  1U47 A;  5GTI U;  1JRU A;  3Q3J A;  4JL9 A;  2YMP A;  1SE3 A;  4P6V F;  1WG8 A;  2I38 A;  4QZ8 A;  3BIN A;  4KX6 B;  4ASW C;  2WDT B;  4UAW A;  2PE9 A;  1SV0 A;  7ICE A;  1YOV B;  1TY2 A;  2O6V A;  4HJG E;  5CJ7 A;  3NHE B;  3V7L A;  3S2A A;  3RFA A;  1HXY D;  3ORY A;  1NJZ A;  2I1J A;  4OVZ A;  2BS4 B;  2KZ3 A;  1S9F A;  3R9K A;  4I2G A;  2K0P A;  1WGH A;  5I4D A;  2ICI A;  3U7D A;  2JMG A;  1I42 A;  1JWA D;  2FLN A;  4FZN A;  2ZTD A;  1GPX A;  1QOF A;  4ECW A;  1OQR A;  3ZJV A;  2YVC A;  3KVF B;  3QX1 A;  5BMG A;  3Q6B A;  1RYR A;  4NXZ A;  3QU4 A;  3H8J A;  2KLG A;  3ZDB A;  2JZZ A;  4I6N B;  3JSV B;  2KX3 A;  2WGS A;  4NLC A;  5F3X B;  1ZQM A;  4ZRJ A;  2WB1 F;  5CWR A;  4AJW A;  1ZKH A;  2AGQ A;  2KHV A;  1UGJ A;  4URK A;  3N28 A;  5HFY A;  3OSN A;  5J2H A;  3TI0 A;  3HRD D;  2MX2 A;  3KBB A;  2LMC A;  2KN7 A;  5L1L A;  3O13 A;  5ALV A;  4RGN A;  4FE3 A;  1GG3 A;  4YMN A;  3ZQ4 A;  3JPR A;  2EMS A;  3Q8A A;  1ZOL A;  3IG3 A;  5G55 A;  3Q8Q B;  1SIF A;  4NLK A;  1IGC A;  3QA8 A;  3WAM A;  1I4H A;  2QDF A;  2RP5 A;  4KLT A;  4L1B A;  4LNI A;  5EE3 A;  3O0F A;  1ET6 A;  2D3D A;  3RAX A;  4US9 A;  2EMT A;  4AS1 A;  4EZ9 A;  1TJE A;  4ECV A;  1WJ6 A;  1CK1 A;  2IY0 B;  3ML9 A;  4MJS A;  1ZQF A;  1ZYQ A;  3EZ5 A;  3QHT A;  3FIL B;  3H8M A;  3PW0 A;  1FNV A;  4KX3 A;  4NQL B;  3W1Y A;  1SL0 A;  1F2R I;  4K4I A;  3DWM A;  1M4V A;  4WJP A;  5EE9 A;  3H7P B;  2GBJ A;  2MH7 A;  1OGW A;  4DQI A;  2GOW A;  1KDH A;  4O5E A;  1Q3U A;  2BQQ A;  2BKR B;  3GV5 B;  2NTT A;  3LXF A;  4J9P A;  4AWJ A;  4DXF A;  2NV3 A;  1PK1 B;  1IIP A;  3C8Y A;  4XGA B;  9ICT A;  2BT6 A;  2BW2 A;  3HM3 A;  3QZ8 A;  4KIK B;  3G6V A;  3OSP A;  1YJ1 A;  1UA0 A;  1SSN A;  2UU7 A;  3M95 A;  9ICL A;  4IC7 B;  3HJE A;  1CEZ A;  5ALX A;  3GE3 C;  4UW9 A;  1H8C A;  3GE8 C;  1DYQ A;  4DXA B;  2K6Q A;  3CRX A;  2MSE D;  2YMM A;  4ZRI A;  5JTI A;  3AE2 B;  3WAL A;  5J0O A;  1V49 A;  3RZW C;  2NRT A;  4GLX A;  4ECY A;  5G5G A;  4MF2 A;  2YML A;  1F0M A;  2XY5 A;  2HHQ A;  2KNB A;  1N2X A;  1SJH D;  2K3U A;  4GN1 A;  4E3C A;  3SZ2 A;  3BII D;  3Q8S B;  1NK0 A;  1ZQZ A;  1IPG A;  2J6U A;  2VA3 A;  3IBE A;  2E8M A;  4XRH A;  1IP9 A;  4BDP A;  2C7H A;  1TS2 A;  3HW8 A;  3QWZ B;  3ENE A;  3LVV A;  2CR5 A;  2IHM A;  3QCA A;  5BYR A;  3AQE A;  3E56 A;  2MBB B;  3K1R B;  3TAD C;  4FUL A;  2FDR A;  3MFH A;  2N1V A;  2DYB A;  3RB0 A;  2IHN A;  3P42 A;  4DFD A;  5J8Y A;  5KTQ A;  1NKE A;  2J53 A;  5AM2 A;  3RH5 A;  2ZZP B;  3EWA A;  4XA5 A;  5J0T A;  3CF6 E;  3IG8 A;  5E6J A;  2ZXI A;  4TUR A;  3DHG C;  1WJ4 A;  2INP E;  2LZ6 A;  1QLN A;  5IP4 D;  1E6E B;  4OCZ A;  3UMC A;  2JWU A;  5BO4 B;  3PSF A;  1PVQ A;  1U4B A;  3WAP A;  4C56 C;  3MGV A;  1J19 A;  1UT8 A;  2HDE A;  2MAX A;  4P4M A;  4F8R A;  3KHH A;  3QAR A;  1WR6 E;  1L8L A;  4O0I A;  2Y5B B;  3WAN A;  3UI3 A;  4F72 A;  1NJW A;  4M8N A;  2C2D A;  3RJH A;  4ZOH C;  2VIX A;  3M63 B;  5HKH A;  4C7Z A;  4B95 A;  5IIM A;  2J7Q B;  4RGM A;  3M62 B;  5ALN A;  8ICQ A;  4QZG A;  4F71 A;  2VA2 A;  5ALP A;  1N6Z A;  8ICM A;  1PGA A;  1BT0 A;  3CSF A;  4KKJ A;  3UQB A;  2NS5 A;  3AL0 B;  3GB1 A;  4F5R A;  4F92 B;  3BDP A;  1SL1 A;  2ZW1 A;  4R64 A;  2JEF A;  1CRX A;  2JF5 A;  4UAV A;  1KF6 B;  2D5G A;  4UB8 U;  3J81 j;  2J42 A;  2MBQ A;  3ISD A;  2RDG A;  2PFN A;  2NRW A;  5KFS A;  4W9D A;  4OHJ A;  3LK9 A;  2R2Q A;  4IUM B;  1WRI A;  2L5Y A;  2EDU A;  2NPT A;  5FP0 A;  5KFG A;  3UPQ A;  1BUI C;  4MH0 E;  5KFI A;  2WF6 A;  5J2B A;  4NLG A;  3NRZ A;  2L05 A;  1CZP A;  3C19 A;  5L1K A;  4IWO A;  3QUQ A;  8ICG A;  1JI7 A;  4UAY A;  3AEE B;  3DBL I;  4YTN B;  4JLC A;  2BQR A;  3ZW3 A;  5KFV A;  2DYO A;  4WJO A;  3AED B;  1ZQE A;  4CDG A;  1QSL A;  4ECQ A;  2MBE A;  4LNK A;  4BKT A;  4BJQ A;  2Y9U A;  4ICU A;  1V9P A;  3T5L A;  4NM1 A;  1ZQP A;  1TAM A;  4A8E A;  2V0G A;  2JXX A;  3G6Y A;  1LB2 B;  4RF1 A;  1D9D A;  4HKZ E;  4OZA A;  4C8N A;  2ASD A;  5DLF A;  3SFD B;  1L0Y B;  3VTV A;  3RJK A;  2G45 B;  4PS8 A;  2B0C A;  5J29 A;  1SB3 C;  2I5H A;  2UYZ B;  5IAA C;  2AEH A;  3PVX A;  4R8U A;  4HEA 1;  4JQW C;  4DXG A;  2KT7 A;  7ICI A;  2HOI A;  4G3X B;  2YEP B;  1WGY A;  2KO3 A;  4HJK A;  2KWU B;  3PRP B;  2NCN A;  5AKK A;  2KE7 A;  2GBN A;  4TUS A;  4GB9 A;  2YQE A;  3AE1 B;  2G9H D;  4NQK E;  3DBH I;  1FIQ A;  3RR8 A;  1TS4 A;  3RT3 B;  3OJ4 B;  3PVL A;  2BVC A;  3IV6 A;  3WK6 A;  3N3K B;  4S17 A;  1ZOY B;  2BPS A;  4LZD A;  5KT6 A;  1V1P B;  3WKA A;  4HDO A;  1WUD A;  3ZTD A;  4M47 A;  2J0K A;  4NNJ B;  3F5A A;  1QZE A;  4LNO A;  4DL6 A;  2NBU A;  2OCE A;  3C1Z A;  2R61 A;  2D11 A;  5KFX A;  4O3O A;  1V6E A;  4S0R A;  1NYQ A;  3APF A;  3ZJU A;  1T0S C;  4A55 A;  3SAH A;  1WFY A;  3C2K A;  2N1W A;  2Y0S F;  3TFS A;  2L32 A;  4MH8 A;  1SE2 A;  5AM0 A;  2K22 A;  5H92 C;  1F5S A;  1P7F A;  2QAR A;  1SXD A;  1EXN A;  4F91 B;  1DXS A;  2RR9 A;  1E8X A;  1PUZ A;  4GC7 A;  4KGR A;  4YP3 A;  1JML A;  1L2N A;  4AJY B;  2KC2 A;  1ROE A;  4ZRP A;  1A6S A;  3H40 A;  1WX9 A;  2GB1 A;  3P4P B;  4UB1 A;  4J9O A;  2PE6 B;  1NK6 A;  5D46 A;  1EWY C;  1Z1V A;  2JGA A;  2LYH A;  2ZUC A;  3L13 A;  3UQA A;  2I2Y A;  2MJ3 A;  4ARC A;  2RDH A;  4ZRK A;  1ZD2 P;  2ZCC A;  4FO6 A;  4KKI A;  3V62 A;  3AB5 A;  5L9X A;  2WXM A;  3T5H A;  3L0W B;  5BYQ A;  3TQ1 A;  2KHW B;  4FBT A;  2D3C A;  5DDM A;  1JXE A;  3QU7 A;  2VZK D;  4LJX A;  4Z6C A;  3APD A;  1NBF C;  2BCV A;  5DGA A;  3L10 B;  2PMZ C;  4B9N A;  4FJZ A;  1WYG A;  1WWV A;  5HNK A;  1UGM A;  2I6X A;  2J6S A;  4C7Y A;  2V4R A;  1TKD A;  3RBD A;  4M9H A;  4NWI A;  5AKX A;  4RNO A;  2ZPN A;  4C4V B;  3L4P A;  2N7D A;  5J2D A;  1L4D B;  3HVZ A;  1KFD A;  1RQL A;  5AUI A;  5KFH A;  5KFB A;  2ZIV A;  2L0F A;  1RPL A;  4EZK A;  1TGZ B;  1C77 A;  3U52 E;  5C1Z A;  5BYS A;  2YMQ A;  3NG0 A;  4EZL A;  1HZ5 A;  8ICH A;  5CHG A;  3VH3 B;  3PRZ A;  1XU4 A;  3EGR A;  2MP2 A;  4XE0 A;  2D2Q A;  2QSD A;  3PR4 A;  4K3B A;  4P4O A;  2N7J A;  5CA7 A;  1WWT A;  4GC6 A;  2YB1 A;  3A1Q B;  3BQ0 A;  2E6X A;  1I4G A;  4UAZ A;  3B9J A;  1NJX A;  1ZRN A;  3MGH A;  1F52 A;  3JPT A;  1AW7 A;  4W9I A;  4XX5 A;  3L17 A;  5AM3 A;  3MDC A;  2BPC A;  9ICN A;  2NVU I;  5KFC A;  3PO4 A;  4YR2 A;  3GP7 A;  3W5U B;  4N59 A;  2QJL A;  1RXV A;  5KAF U;  3UXP A;  1S0M A;  3TSS A;  4RUC A;  3MC8 A;  2FPM A;  4DL4 A;  2FCQ A;  3N1Z C;  4B0M A;  3JSV A;  9ICR A;  3Q3O C;  5AI0 A;  2V4Q A;  1D5Z C;  3Q8M A;  2B6G A;  1KEJ A;  5ALL A;  1UEL A;  5ALW A;  2A19 A;  4A3P A;  4OD0 A;  5KL1 B;  3H0R B;  1CI4 A;  2BDU A;  3OPX A;  3T79 A;  2BS2 B;  1YX6 B;  5TR5 A;  4M0W A;  4KLH A;  4WAA A;  1PUT A;  1TYG B;  2LVQ A;  1QKZ A;  1STE A;  1XSP A;  4FXC A;  1SL2 A;  2K89 A;  1TK5 A;  5KG6 A;  1WMH B;  2M0A A;  4KLF A;  2ZEQ A;  1QOB A;  4OZC A;  1TAU A;  2HBL A;  2UVW A;  3E0F A;  2JPH A;  3QXG A;  5ALM A;  1LKY A;  4QWC A;  2HSZ A;  1A5R A;  5DPT A;  4IL6 U;  2J4X A;  2V3N A;  5C23 A;  2N9K A;  4BX9 C;  3PR5 B;  2IY1 B;  3V6C B;  1WE7 A;  3RF9 A;  3FC4 A;  4J9N A;  3P4Q B;  3PTF C;  2KAC A;  3WK9 A;  5A0L A;  1RG6 A;  1I4P A;  3C0R B;  1X9X A;  3IHQ B;  2KEY A;  2FAZ A;  2DFL A;  4GMV A;  1S3S G;  1SE4 A;  2KWD A;  3TAC B;  3WKB A;  3PW2 A;  1NK8 A;  1EF1 A;  2W04 A;  3TBL D;  7ICO A;  2CHW A;  4CHK A;  2C28 A;  4TSS A;  3RNB C;  2ZTE A;  3NAS A;  1BML C;  1NZB A;  4E0D A;  1WX7 A;  2DZJ A;  2VRR B;  1XEE A;  2E3T A;  3PML A;  5AM4 A;  5ALJ A;  2KTR A;  5DGB A;  2BB6 A;  4RM9 A;  4TV3 A;  4DL2 A;  3JW0 X;  3QU5 A;  2RSU A;  1UWM A;  3RNE C;  3VUW A;  4B0E A;  3KUZ A;  2KIV A;  2ZW0 A;  1SXE A;  4HXD A;  4YN4 A;  3Q3M C;  4ELU A;  5KG1 A;  3EYZ A;  2BF8 B;  3TEW A;  4JWS C;  4KMO B;  5E6O A;  3K1Z A;  2PEA A;  3RZF A;  5KFE A;  4DLG A;  2LHE A;  5IIO A;  3ZJT A;  2LGY A;  3PO0 A;  2Q0Z X;  2WLB A;  5EOZ A;  3CIR B;  9ICV A;  2F1H A;  5KFO A;  2ALZ A;  4PYU A;  4DEZ A;  5KT2 A;  1BXT A;  1NI2 A;  2MRL A;  2DL0 A;  7ICH A;  3ABV B;  7ICV A;  1KOT A;  4YR0 A;  3IHP C;  1KTK A;  4EBD A;  2C2E A;  2KMC A;  1VR9 A;  3HVD A;  3FYH A;  4ICV A;  3VRB B;  4TQ1 A;  3DV9 A;  2O6V B;  3C29 A;  1NDD A;  4RH6 A;  1MHH E;  2LM1 A;  4DLE A;  2LRU A;  3HKZ F;  2LJI A;  3B0A A;  5F9L A;  5DQG A;  1L7N A;  3EC8 A;  3PHW B;  3SD5 A;  3A9K B;  4KDL B;  3PSE B;  3N20 C;  3IRU A;  3RNC C;  3KLS X;  2NYV A;  3D32 A;  1SWW A;  2ZIW A;  4RM8 A;  3V60 A;  2CU1 A;  4EEW A;  9ICK A;  2W54 A;  2L76 A;  4QZC A;  3RD2 A;  3QZ7 A;  4F2R A;  2KN5 A;  4E71 A;  4ZRQ A;  1KSP A;  2ZIV B;  1FXT B;  1GUA B;  7ICP A;  1N61 A;  4I2D A;  3I5J C;  1JX4 A;  3GIJ A;  2DZM A;  4RGO S;  1MVK A;  1V80 A;  3ZNZ B;  2NRX A;  4I27 A;  2DPJ A;  4JMU A;  3SD7 A;  2HBM A;  2W03 A;  3RJJ A;  1MG4 A;  2ZCB A;  8ICX A;  3RPF C;  5MPO A;  2ZJA A;  1YT3 A;  4NLN A;  3A4S C;  4QWA A;  4ED0 A;  3A9J A;  3C2L A;  3KZX A;  1ZP0 B;  5AI4 A;  1T8E A;  5KL8 B;  5JXV A;  1Z00 A;  3CNH A;  3HP6 A;  2IBK A;  3HK0 A;  1S76 D;  3Q69 A;  3ZXV A;  2ZJ8 A;  2WXR A;  2PXI A;  1X9M A;  5ALD A;  3NUQ A;  4Q8E A;  1UBQ A;  3QU9 A;  3UIO B;  3IAM 1;  2JXJ A;  2XCP A;  3L08 A;  4BGD A;  3X0W A;  1B9R A;  3AU6 A;  3C5F A;  1JAL A;  2QB0 A;  4ED8 A;  1Z3E B;  1ZQR A;  4EOY A;  3PHX B;  4DF4 A;  5AZF A;  1QT9 A;  4UAT A;  3OG5 A;  2W55 A;  2KKV A;  1GC6 A;  4MSM B;  3BS5 A;  3DDH A;  5L1I A;  4B9U A;  3AEF B;  4DWF A;  2JWZ A;  5D2M B;  1QF6 A;  5TSS A;  3NGD A;  2KMD A;  3ZRC A;  1Z00 B;  2K1F A;  4R66 A;  1ENF A;  2LUM A;  5H2F U;  4EZ6 A;  4NJ7 A;  1ZQY A;  1LQB A;  5FR6 A;  1ZQT A;  1QQ5 A;  4NY0 A;  2W9M A;  5D49 A;  3U4E G;  4QNL A;  3H1U A;  4QJF B;  3J9C A;  3KTQ A;  3B0X A;  4KN4 A;  2MQJ A;  4PHA A;  4F7Z A;  2CXY A;  5IIK A;  1JIH A;  2AGP A;  3K9O B;  4WUR A;  2AQ4 A;  5DBA A;  5AKI A;  1R4M B;  1JUD A;  2L7R A;  4JPS A;  4PT5 A;  2JR5 A;  2F2A B;  4NAM A;  4RQ5 A;  2G08 A;  1EU4 A;  5KFQ A;  4DS5 A;  1IYF A;  4CRX A;  4IG7 B;  2M0X A;  4Y2T A;  4OJP A;  4Y2X A;  1V1P A;  4JIO U;  4Y2U A;  2K8C B;  2JYE A;  1Q5W B;  2HHS A;  2CPR A;  3DOW A;  3JPQ A;  2WXN A;  5AK4 A;  1X2I A;  3T5J A;  2Q5W D;  1KLU D;  3SAG A;  2W9A A;  2XK5 A;  3DHH C;  5III A;  2FI1 A;  5ALS A;  3MAB A;  2KSO A;  4M9L A;  3DDC B;  4DFJ A;  4EEL A;  3SQI A;  3AEC B;  1ZUD 2;  5J2I A;  1VZ8 A;  2D10 A;  2VJ4 A;  5ALK A;  1OUQ A;  2BBC A;  2JZ3 B;  5IIL A;  1MA7 A;  2W3R A;  1ZGU B;  2KQ7 A;  2KQS A;  4PGQ A;  3ZRF A;  8ICP A;  5J18 A;  2R8G A;  2LAS A;  1WGR A;  1C1Y B;  2LWP A;  5J0Q A;  1E8Z A;  3AU4 A;  3SI8 A;  5AZG A;  2FE9 A;  2LYA A;  1WXV A;  5BMH A;  3BVM A;  4EKU A;  4KIT B;  3MJ5 A;  3OJS A;  1L3V A;  3BVZ A;  1HQR D;  4KGS A;  3U8Z A;  4DWI A;  3E9S A;  4K4H A;  1UWX A;  2FPK A;  5KFF A;  4JV2 A;  4I2J A;  3BQ7 A;  3N1X C;  1UUP A;  3SEB A;  2LI5 A;  4YMO A;  4ED7 A;  9ICP A;  2G4D B;  2KIC A;  3RJF A;  2P66 A;  2WX0 A;  2MA1 A;  1Y88 A;  1YZ7 A;  1ESF A;  2V3S A;  4JUZ A;  3P63 A;  5KFU A;  2ZVN A;  4EEN A;  1FD6 A;  1P98 A;  1P9D U;  4IC9 A;  4YD1 A;  1HUO A;  4ZH4 A;  3VAW A;  3ZI4 A;  2CS4 A;  3U26 A;  2RQ5 A;  5KG5 A;  2KJR A;  5BPC A;  4RQM A;  5J0P A;  5IIN A;  4J9S A;  1WXM A;  2KDM A;  5J0W A;  2LHD A;  2WU5 B;  4P1B C;  2KFK B;  1YN5 A;  2D3G A;  2N9X A;  4K3C A;  2ZTC A;  5JU5 A;  3QUB A;  5KG2 A;  4N6E B;  5J2K A;  3H8W A;  4DHJ D;  1ZDX A;  5FR3 A;  1RYU A;  2D6F C;  1R7S A;  1N60 A;  1GOZ A;  4DQR A;  5LLI A;  2J52 A;  4P0Q B;  2AL3 A;  4RU9 A;  2O6V D;  2WP9 B;  5EE1 A;  4RFB A;  3BK2 A;  3JVZ X;  5HR7 A;  9ICS A;  5AKZ A;  3THV A;  1ACC A;  4BUG A;  3PW7 A;  3A0H U;  4HRO A;  4UB4 A;  4HPM B;  4MFC A;  3GV7 B;  4MGK E;  4MM3 A;  1R4N B;  4B6J A;  4KMU A;  3IT6 B;  1FEH A;  4B9S A;  3R7Q A;  2M4N A;  3RJI A;  3TMP B;  4EEK A;  4WJQ A;  4GXI A;  2Y1I A;  1YJI A;  1T7P A;  5DPR A;  2KIW A;  5ALI A;  1XLO A;  4M02 A;  5ALT A;  5G5H A;  1FNU A;  1XCT L;  1TE2 A;  4RQ4 A;  3DBR I;  4M0W B;  1DOY A;  3D2S A;  1A70 A;  2BDP A;  1WR1 A;  3WKD A;  1ZQC A;  2GRI A;  3Q14 C;  2JRZ A;  4DHZ B;  1ZRM A;  4B9K A;  3ZD8 A;  1CJE A;  3OAW A;  3RN9 C;  4W9H A;  4DHJ B;  2K8A A;  1LM8 B;  2DEN B;  3X23 A;  2F1J A;  3L16 A;  3WKE A;  4ANV A;  3C28 A;  4I2B A;  4PZN A;  4YD2 A;  2F44 A;  3PV8 A;  1D5X C;  3TEZ A;  4PZO A;  2INC C;  2G06 A;  1COO A;  1CMX B;  4M9G A;  2JU6 X;  3LYS A;  1VJ5 A;  4G0N B;  4C4T A;  2KOB A;  2MBH A;  1IGD A;  4DQS A;  2KVR A;  1E90 A;  1GB4 A;  1GNU A;  3PW5 A;  1UNS A;  3QEB Z;  4LDT D;  4MJS B;  4MDK E;  2O2V A;  4PGX A;  5CRX A;  4AP9 A;  4DFP A;  2NO5 A;  5AM1 A;  2DPI A;  4DOB A;  1ZXH A;  4OJ5 A;  2WXO A;  4LJO B;  4I2I A;  2K8B B;  3HM6 X;  1O03 A;  4P2H A;  4MHV A;  4BBN C;  4ANU A;  1BPY A;  5AKL A;  4UAR A;  1RAX A;  1K8R B;  3MC1 A;  7ICJ A;  9ICQ A;  2G5I B;  1QQR A;  1PDX A;  1JWM D;  1RDF A;  2C5L C;  4DDI D;  9ICC A;  2E8O A;  5EWG A;  5CTR C;  1PZN A;  5AZH A;  4FBU A;  4O3S A;  4PPX A;  3FKY A;  4H2A A;  4WWO A;  4Y2S A;  5KAI U;  2MA9 B;  2SAK A;  2KKC A;  4GDL B;  4US8 A;  3M7D A;  2D8C A;  1BPZ A;  1TZO A;  3Q8C A;  1S77 D;  2C22 A;  1C9F A;  2ZIU B;  5ALH A;  2ZIX B;  3ONS A;  1L0X B;  2WDQ B;  2XN9 C;  3TAQ A;  5H8Y E;  2KJ9 A;  4F1S A;  3SEN A;  4LNN A;  2CJN A;  1DOX A;  2IMW P;  4RCO A;  2E8N A;  4GU2 A;  4M01 A;  3JPO A;  3PNC A;  2KN4 A;  3K75 D;  1GAQ B;  5DQI A;  4A8X C;  2KXJ A;  2F3N A;  5DG7 A;  4L23 A;  2WXL A;  1N63 A;  4J9K A;  5AEK B;  5DB6 A;  5JUM A;  2YLM A;  2NR2 A;  2KKP A;  3M8R A;  3RYT A;  4HAI A;  3RBE A;  2BCS A;  2BWE S;  4WWM A;  2WHI A;  4MFF A;  5AHX A;  1AWD A;  4YL8 A;  3WAO A;  1P3Q U;  2IYD B;  2HD5 B;  3MHZ A;  9ICE A;  3V6J A;  1NI3 A;  3BY4 B;  1TS3 A;  1SKR A;  2ZPY A;  5KT4 A;  2MEK A;  1X9S A;  1JXL A;  3N7R C;  2UWQ A;  2FNJ B;  3DQV A;  2EZY A;  3WK8 A;  9ICJ A;  3AE9 B;  3IT4 B;  3PGE A;  4N9F 4;  4WIP A;  4PS7 A;  8ICA A;  3BQ2 A;  4XC2 A;  2Z59 B;  3I76 A;  3ML8 A;  2KTR B;  1ZQW A;  4K7U A;  1U4A A;  2V3P A;  1BPD A;  1OFF A;  2DLB A;  4MGY E;  2OEH A;  4NAW A;  1FNW A;  9ICH A;  3PST A;  1MQ3 A;  4PL1 A;  1RWS A;  2RMM A;  3RH6 A;  2WS3 B;  4P0Q A;  1B43 A;  2LFI A;  5DB8 A;  3AEA B;  1WJU A;  3BZD B;  4ED2 A;  4YSZ B;  2HHW A;  2L1A A;  1C4P A;  4G50 A;  5HG2 A;  2HOF A;  1XLP A;  1FPY A;  1SEB D;  1Y56 A;  4GXJ A;  2KZZ A;  4DFK A;  2WXP A;  2L8J A;  2JX5 A;  3NY5 A;  3NTU A;  5J0R A;  3LVW A;  3V7J A;  4ECR A;  1XWL A;  2KVC A;  3ZXR A;  1L7P A;  1C4C A;  2GO7 A;  3BS5 B;  2JZP A;  1TAQ A;  3BQ1 A;  5AI8 A;  1JMS A;  4TQS A;  1XSL A;  2QB0 B;  2MSN A;  4CF3 A;  3PS6 A;  2NO4 A;  1A76 A;  1KQQ A;  2V9H A;  5DG8 A;  4RQ1 A;  4QZD A;  3BQT A;  1HEK A;  2GBR A;  2PW9 A;  2W82 A;  4NLZ A;  4BXO B;  1SV4 A;  1NK7 A;  1ZD3 A;  2FIF A;  3WCQ A;  1OW5 A;  1WM3 A;  1T3Q A;  5DKW A;  3KYC D;  9ICM A;  2PFO A;  3JPN A;  1HJP A;  2EZZ A;  5IO9 A;  4NL9 A;  1UQV A;  2KK8 A;  2AQ2 B;  2WXF A;  1JWU D;  2C7M B;  2I1K A;  4ELV A;  2XY7 A;  1EWC A;  1K5O A;  1ZQJ A;  1KLN A;  4Q44 A;  2PI5 A;  1T94 A;  3BZC A;  4MAC A;  2XVT A;  1SWV A;  2K4E A;  2IDY A;  4IR9 A;  2KMM A;  5CEH A;  2BCU A;  2VJ5 A;  4PL2 A;  2HJ1 A;  2WXI A;  4FBJ B;  1S0O A;  3UM9 A;  1OQQ A;  3QX7 A;  1OEY A;  5JHB A;  3I1Y A;  3GII A;  3KFU F;  3M6Z A;  5EE0 A;  1KKX A;  1TY0 A;  3V6K A;  2R8I A;  1RLF A;  4KVG B;  4A90 A;  1WIA A;  1BGX T;  2AYO B;  4Q43 A;  4DQO C;  3AMZ A;  1KFS A;  1S1Q B;  1SBB B;  4QWD A;  3ZGZ A;  3H7S A;  2QHO A;  4A6Q A;  1SGG A;  7ICU A;  1P7E A;  2K8B A;  2R2O A;  5EWF A;  3PMN A;  2KTQ A;  3MDA A;  4AYB F;  3GFK B;  4B9L A;  3OWE B;  4IW0 A;  5ALU A;  1WMH A;  3HIL A;  4PK1 A;  3H0L B;  4NLB A;  3PW4 A;  3R3M A;  4RPY A;  3EPG A;  3BYT B;  2KFN A;  4ELT A;  4ECZ A;  1WGG A;  2R8J A;  1T6B X;  3SFE B;  2BR0 A;  8ICY A;  3F2B A;  2DGZ A;  9ICA A;  1TKE A;  1WJN A;  2ES6 A;  8ICN A;  2FE8 A;  3Q8E A;  4YT0 B;  1NJY A;  3AUO A;  4JWN A;  2HCF A;  5DB9 A;  3HX0 A;  1J7B A;  2WB1 C;  4G9B A;  2UVR A;  1K51 A;  3MFI A;  3VC8 A;  1QIL A;  1D6E C;  2XO7 A;  1ISN A;  4E74 A;  5AKJ A;  1NKC A;  3AH7 A;  3ZD9 A;  1D8B A;  4GLS C;  4WAF A;  8ICJ A;  2ESE A;  1QH9 A;  3NZ3 A;  3OHA A;  2O6K A;  2K4P A;  2F8L A;  4BWM A;  2IA6 A;  1I4X A;  5D3D A;  2HHU A;  4HVB A;  4QZB A;  9ICO A;  5J2F A;  2ZXH A;  3LWL A;  3IVF A;  1FM0 D;  1RRB A;  3MR2 A;  1FEZ A;  2RLT A;  3HWT A;  4EYI B;  4F50 A;  1UT5 A;  4RNM A;  3GZN I;  4DHZ E;  4KN7 A;  1BNP A;  4GFJ A;  1N5W A;  3F2D A;  1ZW7 A;  1L3U A;  2G4S A;  2QMT A;  1VZ7 A;  2HHV A;  1KFY B;  1CQV A;  2B76 B;  2DAF A;  4QZE A;  2MW5 A;  5DQH A;  4KLG A;  3DHI C;  2JEG A;  2LYB A;  4CCH A;  1KJT A;  5CHV C;  3SAF A;  2VZK B;  2JZB A;  2XBB C;  4J9Q A;  2CJO A;  1LFD A;  8ICT A;  1E0Z A;  4MEM A;  1M94 A;  2JRI B;  2KFK A;  3RJG A;  1S0N A;  1Q46 A;  3SR6 A;  3A4R A;  4IKG A;  1Q8K A;  2P6U A;  3ICX A;  3UXN A;  2QLT A;  5KFM A;  2RPV A;  4BFR A;  2YB4 A;  4DQQ A;  4RGT A;  2JVC A;  1ZD5 A;  2VA8 A;  4RT3 A;  1Q0W B;  2OM6 A;  4MEY A;  4PGY A;  2BB5 A;  2RDB C;  2MCN B;  3JPS A;  1GB1 A;  2C7N B;  3V6E B;  2HTH A;  4CNQ A;  2IGH A;  3AE8 B;  2DZI A;  1YN4 A;  3R8B A;  4F93 B;  5KFD A;  1YMH E;  1D8Y A;  4KLE A;  1B22 A;  2W7O A;  3C5G A;  3V7K A;  3BZK A;  4DOC A;  8ICR A;  2XI9 A;  2WF8 A;  1ZE3 D;  1BNO A;  2Z7J A;  5LXH A;  5AI9 A;  3RB3 A;  2LXC A;  1A0P A;  4BXO A;  2D3A A;  3NOB A;  4OW0 A;  3N7P D;  1ZQD A;  4XYC A;  1WY8 A;  3ETR A;  5AUK A;  4AQ7 A;  1I4Q A;  4XDC A;  1PK1 A;  2PKO A;  2HDO A;  4K4G A;  3PPA A;  2R8H A;  1C78 A;  1Y8R C;  4WQO B;  3RNA C;  1L8O A;  3I57 A;  2H3Z A;  2IGG A;  1XF5 L;  1FFV A;  2ASJ A;  3ZKJ C;  2KAN A;  2FMQ A;  3SU8 X;  2K25 A;  2KV2 A;  3MBY A;  5DG9 A;  1E7V A;  4WWN A;  1SZP A;  3VUY A;  2DZK A;  4XQ8 A;  1ZQS A;  3RUI B;  2JH7 A;  1XNS A;  3F5E A;  2BYV E;  1PK3 A;  1BPE A;  1ZD4 A;  3W2D A;  5CX3 A;  1B1Z A;  4CQN A;  3EPI A;  2BHN A;  4YCX A;  8ICO A;  2K6D B;  1AN8 A;  3R7R A;  3LDA A;  2N9E B;  2KTF A;  2KOX A;  1WWU A;  4M04 A;  3P4R B;  4F4Z A;  5ALY A;  2BPF A;  3RNG C;  1F77 A;  4FZM A;  1HTO A;  2KX0 A;  9ICF A;  4IQW A;  1TFR A;  5ALZ A;  4WQM A;  2NTS A;  3ZVV A;  1QSY A;  2AX5 A;  4MGZ E;  4ECS A;  3KUD B;  4IM0 A;  5KFL A;  4Z6E A;  5C0Y A;  4WH4 A;  1DOQ A;  4YMM A;  3DVG Y;  1DOI A;  3KWV A;  1QSS A;  4KTQ A;  4CO7 A;  4QIW C;  3V3X A;  1Z4N A;  3IAS 1;  1KRP A;  2KHQ A;  1QQ6 A;  2M19 A;  4QZF A;  1K53 A;  4LK0 M;  4W9C A;  2OHF A;  1QOA A;  3RTV A;  1WCL A;  4GOC A;  4QAY A;  5J0Y A;  4YG2 A;  2GH1 A;  2PMZ F;  2KFZ A;  4NJC A;  2OXO A;  4GGQ A;  4P7I A;  1F2R C;  2KJH B;  2SEB D;  4KIK A;  2VKQ A;  3B2G A;  4JWM A;  2L83 A;  2K5P A;  3GS2 A;  4ACF A;  2C9W B;  1VJK A;  4UB5 A;  2Z0D B;  3W5V B;  5HR6 A;  2GLE A;  2AXT U;  2NBV B;  3UIN B;  3RB4 A;  4XUS A;  2N4F A;  2KP7 A;  1P1A A;  3N1Y C;  4RQ0 A;  4P0P B;  3MR3 A;  2RDJ A;  5E79 U;  4J03 A;  2QC8 A;  4EX7 A;  1PGB A;  3N7S C;  2XGP A;  5KFN A;  4RNN A;  7ICN A;  5HHD G;  2D3B A;  1VCB A;  4MSQ B;  3OJ3 A;  2HMX A;  4GXB A;  4MM3 B;  4PH5 A;  2IO1 B;  1X42 A;  2A1J A;  2ZUB A;  2JZB B;  1MHX A;  1SIJ A;  1UHU A;  4Q45 A;  3EEC A;  4C4S A;  3U2S C;  2UVU A;  2E1E A;  2LBO A;  2L0T A;  4RZR A;  4USA A;  2K8H A;  5IN7 A;  4RNA A;  4KLD A;  2Q4T A;  3P4S B;  1YD8 U;  2MBO A;  4UDU C;  1YIW A;  2WQY B;  8ICF A;  2HBJ A;  5KFP A;  2GLS A;  4NZL B;  1O08 A;  5DPW A;  4HKQ A;  2KWC A;  4ED3 A;  3EUB 2;  4DQP A;  2N7E A;  2F76 X;  3PX4 A;  2AU0 A;  1RM6 C;  2OED A;  3D2N A;  4REZ A;  1U49 A;  7ICF A;  3E2E A;  3RJE A;  1DGS A;  5EWE A;  8ICZ A;  3BS7 A;  2MLB A;  4CE6 A;  2W43 A;  2Z0E B;  3TCA A;  1VDV A;  4I2C A;  1V8C A;  2YN4 A;  2M9N A;  1PVR A;  4BOS C;  2JH1 A;  1WYW B;  4PS3 A;  1LKY B;  5KG3 A;  1NEN B;  5J2A A;  4DSF A;  7ICL A;  3QAQ A;  3L54 A;  1JQ4 A;  3T5K A;  5AIA A;  2R8K A;  5GMV A;  1N5X A;  2PTL A;  1EU3 A;  1XQQ A;  2E1F A;  1I4R A;  3I28 A;  1LV5 A;  3UGB B;  1ZET A;  7ICG A;  3UQ2 A;  3LB8 C;  4EE2 A;  3QU2 A;  4JV0 A;  4QWE A;  1XCQ L;  3URY A;  1ZQI A;  3WIM A;  4NY8 A;  2Y1J A;  2HVH A;  3Q3F A;  1N56 A;  1NKB A;  4YXD B;  4KLL A;  1QCK A;  1V2Y A;  3VTW A;  1MFW A;  3PT2 B;  2EH9 A;  1XS9 D;  1WXA A;  4FS2 A;  3APC A;  2I1Q A;  4M6W B;  1GC7 A;  3QYP A;  2IO0 B;  2KQ4 X;  2WXJ A;  1FRD A;  3LDZ E;  3ZDM C;  4M2Y A;  2HOQ A;  2CN1 A;  2WNM A;  3T3N A;  2BYT A;  2H3Q A;  1TVA A;  3AEV A;  4LZG A;  4MEL A;  3C21 A;  1IXR A;  2WX1 A;  3HHM A;  4QWB A;  2PFP A;  3TAP A;  5ALO A;  1UA1 A;  1PFD A;  2L00 B;  3TKA A;  2ASQ A;  3AEG B;  4ED1 A;  2DQN B;  2NPT B;  2IOH A;  5BOM A;  1FO4 A;  4UQG A;  4I6L B;  1KM7 A;  1TK8 A;  3PSP A;  1Z2M A;  1ZDV A;  3VR8 B;  1FCL A;  4LJP B;  5BMI A;  3NRW A;  8ICS A;  4Y2Q A;  8ICW A;  8ICL A;  4RMA A;  3TJP A;  4AOF A;  4P16 A;  4KZC A;  4YR3 A;  1JN3 A;  1T0Q C;  2V9W A;  3IG5 A;  3A33 B;  3MHS D;  2WAQ C;  4C8O A;  4K7S A;  2FLL A;  2KVS A;  1L7M A;  4EZJ A;  1UZX B;  4TUQ A;  4B9V A;  5J2C A;  2LUE A;  3F2C A;  2LRW A;  4XWW A;  2REX A;  2WF9 A;  4DSL A;  1C76 A;  1E7P B;  3RB6 A;  1V85 A;  3P1M A;  1ED1 A;  2INN E;  3MJW A;  2JXT A;  2PMV A;  4B9M A;  2M17 A;  3UQ0 A;  1KTQ A;  3TFR A;  2ODG A;  4RQ8 A;  3RUL A;  3CMM B;  1J7C A;  3VCB A;  5B5E U;  3B1L X;  1YZ6 A;  4RQ2 A;  2W9B B;  3TAD A;  4DL3 A;  2BGW A;  3H8S A;  4EUT A;  5KFJ A;  1L7O A;  1X9W A;  4O5C A;  4UB6 U;  3OLM D;  2CHX A;  3GIK A;  1T0R C;  1NK5 A;  4GDK B;  5L83 A;  5K4L A;  1MPE A;  1IM4 A;  1IG6 A;  3ZNH B;  3HPO A;  3AEB B;  5CR0 A;  2P35 A;  4ECX A;  1JCK B;  4ZYN A;  2P6R A;  2ZIU A;  3IDW A;  2LVP A;  4OVV A;  1JWB D;  3KW5 B;  2BCQ A;  2AWT A;  2HJ8 A;  2YTU A;  4DBG A;  5L95 C;  3CYM A;  2G1E A;  3ZIM A;  2QB1 A;  3H9D A;  4EEY A;  5J0S A;  3DVN U;  4KLM A;  1WSP A;  5KHQ A;  4TUP A;  2OOB B;  3ZDE A;  3GDX A;  2Y3A A;  2Y0S C;  2ZUD A;  4C0Z A;  1YNT E;  4YQW A;  4IDI A;  4UBB A;  1SKS A;  1JRO A;  2DX5 B;  5LXI B;  3N32 A;  2BKF A;  2IGD A;  2W11 A;  5AM5 A;  5C2T B;  5EDS A;  5KT7 A;  3UIP B;  2XCA A;  4Z6F A;  2W8L A;  3DWG C;  2EKI A;  1Z1B A;  1RQN A;  2W9C A;  4ZDV A;  1J7A A;  5HML A;  2GBK A;  2LHT A;  1XXG A;  2PPH A;  1RXW A;  3SDL C;  2PIA A;  3PX6 A;  3KHG A;  3QNM A;  3Q8P B;  1TZ1 A;  2XY6 A;  2KYW A;  3MC0 B;  2WXQ A;  4JX1 C;  2PFQ A;  3RRG A;  1P0R A;  4TQ0 A;  7ICM A;  1V97 A;  4DDG D;  2IO3 B;  3SMV A;  1NK4 A;  5D6J B;  1J2M A;  2W8K A;  2DAJ A;  4DCC A;  5DCN A;  4DSI A;  5BOL A;  3AM9 A;  1M6Y A;  3UMG A;  1T3N A;  4Y2V A;  2YY6 A;  4RUA A;  2DKX A;  1ECW A;  4IWP A;  4YFK A;  4Q8F A;  1ZQA A;  3D2Q A;  4TQR A;  3RH4 A;  2H88 B;  4FLH A;  1S5L U;  4W9F A;  5ALE A;  1COK A;  4FN2 A;  5AKH A;  3Q8R B;  1GJZ A;  3FIL A;  2ZJD A;  3KH0 A;  2I9G A;  1VZ6 A;  2XK5 B;  3NZS A;  4JWU C;  4KLU A;  1S97 A;  4HPL B;  2C2R A;  2MJD A;  4W9J A;  1BPB A;  4RPZ A;  2K8C A;  2XC9 A;  3RMK C;  2LGD A;  3TL5 A;  5J8Y C;  1WGD A;  2G3Q B;  3VUX A;  5AKG A;  5B66 U;  1J0G A;  4O3R A;  3C1Y A;  4YTM B;  4II2 B;  3M9M B;  4Q2J A;  2ISO A;  4NV0 A;  1ZQL A;  2IZV B;  1TT5 B;  2OYY A;  1WM2 A;  4NAW B;  3TIX A;  4RT2 A;  3VXW A;  2A1J B;  4R3D A;  1AAR A;  1WZ3 A;  3ISB A;  3K9P B;  3DVN V;  4QZH A;  4YSY B;  4IQV A;  1V38 A;  1L3T A;  2H3I A;  1V5T A;  2ISP A;  3E58 A;  1TTN A;  1EF5 A;  3H4B A;  2IOF A;  2BTE A;  2KAJ A;  3M6K A;  4LDT B;  1RFK A;  3MC9 A;  1F9J A;  3QEA Z;  4QZA A;  4I29 A;  4P0P A;  4BAX A;  4BKG A;  3ISC A;  3N30 A;  4F5Q A;  1J2N A;  4HRS A;  1MN8 A;  2KMA A;  2BZF A;  4HCP B;  3KHR A;  4Y2J A;  3PZD A;  2KDI A;  5FKA C;  3HKZ C;  2KK0 A;  2ZNV B;  3HT3 A;  2HW3 A;  1KH0 A;  3PZ8 A;  1FFU A;  2LGI A;  4UB3 A;  5AI5 A;  4HYK A;  2CRX A;  1LVH A;  5C3J B;  2ZNV C;  1OTR B;  4GIB A; 
#chains in the Genus database with same CATH homology
 4A6Q A;  1QKZ A;  1STE A;  2PVO D;  2XNA C;  1P7E A;  2ONQ A;  4FXC A;  1VRA B;  2EEL A;  3OWE B;  2M0A A;  1IBX B;  2AQ3 B;  1QOB A;  2YEP F;  4OZC A;  3HUI A;  3BYT B;  4O1N A;  2WXK A;  1T6B X;  4LTU A;  3SFE B;  5H92 C;  1TKE A;  2J4X A;  2N0S B;  3Q8E A;  4YT0 B;  2FE8 A;  2V3N A;  2N9K A;  2DWQ A;  4M0W A;  3KWL A;  3FC4 A;  1YQ3 B;  3P4Q B;  2KAC A;  1J7B A;  1I4P A;  1ZPS A;  1K51 A;  1QIL A;  1SXT A;  1D6E C;  5FK9 C;  3AE4 B;  1NYR A;  1F0Z A;  2JSV X;  3AH7 A;  3AE7 B;  1JWS D;  1SE4 A;  2KWD A;  4GLS C;  4WAF A;  3W9C B;  3EA6 A;  3NZ3 A;  4ZHP A;  1YQ4 B;  1HA5 A;  1I4X A;  5D3D A;  4TSS A;  1BML C;  2AQ1 B;  3IXS A;  4ZHO A;  1XEE A;  2E3T A;  1FM0 D;  3TUO A;  2BB6 A;  3AE6 B;  1L6U A;  4B0E A;  1UWM A;  3BK1 A;  3MFG A;  2ZW0 A;  3NVW A;  3B2F A;  4RF0 A;  1VLB A;  1N5W A;  2H89 B;  3TEW A;  4JWS C;  4YSX B;  2QMT A;  1VZ7 A;  1I7H A;  1KFY B;  1CQV A;  2B76 B;  1QLB B;  2LHE A;  3ZJT A;  4ITK A;  3PO0 A;  3Q8B A;  2WLB A;  3LYY A;  2IJ0 A;  3CIR B;  1TS5 A;  2VZK B;  1DGJ A;  2CJO A;  1BXT A;  1FXA A;  1SE3 A;  4P6V F;  1E0Z A;  2I38 A;  3ABV B;  4KX6 B;  4MT5 A;  3SR6 A;  4IKG A;  1KTK A;  3HVD A;  2RPV A;  1VR9 A;  3VRB B;  3NUH B;  4TQ1 A;  1TY2 A;  4HJG E;  1IBX A;  4RGT A;  4RH6 A;  2BB5 A;  4TMA B;  1MHH E;  3I9V 1;  1GB1 A;  1HXY D;  4OVZ A;  2LJI A;  2IGH A;  2BS4 B;  3AE8 B;  1YN4 A;  3R8B A;  1T5X D;  1YMH E;  2K0P A;  5I4D A;  2ICI A;  2WXH A;  3AE3 B;  3KLS X;  1JWA D;  1N62 A;  1ZE3 D;  2W54 A;  3H8H A;  3FAH A;  1GPX A;  1QOF A;  4ZRQ A;  4OW0 A;  1OQR A;  3ZJV A;  1WXQ A;  1N61 A;  4N58 A;  4AQ7 A;  3ETR A;  5AUK A;  4RGO S;  1I4Q A;  1MVK A;  4XDC A;  5BMG A;  2PKO A;  3RPF C;  1C78 A;  5MPO A;  3I57 A;  2IGG A;  2TSS A;  3NS1 A;  1XF5 L;  1FFV A;  1K52 A;  1ZP0 B;  5D7G A;  5JXV A;  1UGJ A;  4YTP B;  5HFY A;  3Q69 A;  3HRD D;  3W2D A;  1B1Z A;  2IPK D;  2WXR A;  4CQN A;  4C80 A;  2LMC A;  3Q8F A;  3O13 A;  4RGN A;  1AN8 A;  3VRA B;  3IAM 1;  1HEZ E;  3ZQ4 A;  2BS3 B;  1B9R A;  3Q8A A;  1XLQ A;  3RFZ B;  1JAL A;  3P4R B;  1IGC A;  1I4H A;  1F77 A;  1QT9 A;  2X38 A;  4L1B A;  2W55 A;  5EE3 A;  1ET6 A;  2Y5P A;  3AEF B;  4US9 A;  4WQM A;  1QF6 A;  2NTS A;  2DBY A;  2GI9 A;  5TSS A;  1TJE A;  2AX5 A;  4AS1 A;  1CK1 A;  1ENF A;  3FIL B;  4WH4 A;  2LUM A;  1DOI A;  3KWV A;  1FNV A;  3V3X A;  1F2R I;  3DWM A;  1M4V A;  3IAS 1;  3U4E G;  5EE9 A;  1MI0 A;  3J9C A;  2M19 A;  1K53 A;  4LK0 M;  2MH7 A;  2OHF A;  1QOA A;  2NTT A;  4DXF A;  1NVI D;  3LXF A;  4WUR A;  4NJC A;  4JPS A;  4PT5 A;  3C8Y A;  2BT6 A;  2BW2 A;  4NAM A;  3TEY A;  1F2R C;  2SEB D;  1EU4 A;  2DYM A;  3B2G A;  3PZ7 A;  2L83 A;  3W1S A;  1SSN A;  2K5P A;  3GS2 A;  1V1P A;  1VJK A;  3W5V B;  2JYE A;  1DYQ A;  2WXN A;  2Q5W D;  3AE2 B;  1KLU D;  3VQI A;  1C79 A;  4XWT A;  1E10 A;  1PGB A;  5G5G A;  1SJH D;  2K3U A;  3BII D;  5HHD G;  3AEC B;  1ZUD 2;  1VZ8 A;  4MM3 B;  2ACZ B;  3U7Z A;  2BBC A;  1MHX A;  3AV8 A;  1SIJ A;  2W3R A;  4IOI E;  4ZYS A;  1TS2 A;  3U2S C;  5BYR A;  2LEK A;  4USA A;  3NVZ A;  2WDV B;  4RNA A;  4UDU C;  3E56 A;  3P4S B;  2WQY B;  5BMH A;  3BVM A;  4NZL B;  3MJ5 A;  3P42 A;  4HKQ A;  3EUB 2;  3BVZ A;  1HQR D;  4KGS A;  2J53 A;  3E9S A;  1RM6 C;  2OED A;  1UWX A;  4REZ A;  3SEB A;  3V05 A;  1UUP A;  5E6J A;  1JW9 D;  2INP E;  1VDV A;  1YJJ A;  1V8C A;  1ESF A;  1E6E B;  2JWU A;  3P63 A;  2WXG A;  1FD6 A;  4C56 C;  4J3O D;  1NEN B;  1KRH A;  2HDE A;  1JQ4 A;  1V1O A;  1N5X A;  2KDM A;  2LHD A;  2PTL A;  2PVG C;  2WU5 B;  1EU3 A;  1YN5 A;  1I4R A;  4N6E B;  4KGT A;  3UI3 A;  1ZDX A;  1SF0 A;  3LB8 C;  4EE2 A;  1XCQ L;  3URY A;  5FR3 A;  1SJE D;  1R7S A;  1N60 A;  4ZOH C;  1GOZ A;  1FMA D;  4C7Z A;  2J52 A;  1XLN A;  1LO5 D;  4RGM A;  1FRR A;  2WP9 B;  4YXD B;  5EE1 A;  4RFB A;  3BK2 A;  1ACC A;  1K50 A;  1IUE A;  2WDR B;  4HRO A;  1PGA A;  4KKJ A;  1HZ6 A;  3BWU D;  3GB1 A;  2KQ4 X;  2WXJ A;  1FRD A;  2ZW1 A;  3IT6 B;  1FEH A;  1D4B A;  4YWG G;  1KF6 B;  2M56 B;  2D5G A;  2WNM A;  3T3N A;  4D2K A;  2BYT A;  2FUG 1;  2J42 A;  1YJI A;  2RDG A;  1XLO A;  1ET9 A;  4OHJ A;  5GXG B;  5G5H A;  1FNU A;  1XCT L;  4ARI A;  1PGX A;  1DOY A;  1A70 A;  1Q10 A;  1PFD A;  1WRI A;  2GRI A;  3AEG B;  1CJE A;  1FO4 A;  1BUI C;  4OZB A;  1XO3 A;  1ZDV A;  3VR8 B;  1FCL A;  3NRZ A;  1L5P A;  5BMI A;  1CZP A;  3TEZ A;  1D5X C;  1JRP A;  3AEE B;  4P16 A;  4YTN B;  2JU6 X;  2DYO A;  3AED B;  1IGD A;  2L52 A;  1GB4 A;  1UNS A;  4XWW A;  2W3S A;  2QIE B;  1C76 A;  1E7P B;  2V0G A;  3P1M A;  3CWI A;  1ZXH A;  2WXO A;  2INN E;  4RF1 A;  2HTM E;  4HKZ E;  1TKY A;  2JXT A;  2PMV A;  4OZA A;  3SFD B;  1L0Y B;  1J7C A;  1SB3 C;  1QQR A;  1PDX A;  2MJE A;  1JWM D;  2QIL A;  4HEA 1;  4DXG A;  2YEP B;  4H2A A;  3VR9 B;  2SAK A;  4GDL B;  4GDK B;  4US8 A;  1MPE A;  1TZO A;  3Q8C A;  1RYJ A;  3AEB B;  1C4A A;  1C9F A;  1JCK B;  3AE1 B;  2G9H D;  1L0X B;  1NEK B;  2WDQ B;  2XN9 C;  1FIQ A;  5H8Y E;  1JWB D;  1TS4 A;  2CJN A;  1DOX A;  1ZOY B;  2G1E A;  5C3J B;  4RCO A;  1V1P B;  2CU3 A;  2KN4 A;  1D5M C;  3NVV A;  1GAQ B;  4A8X C;  2N9L A;  1WSP A;  3MP9 A;  4L23 A;  2WXL A;  1N63 A;  1FCC C;  2Y3A A;  2R61 A;  1YNT E;  1WGK A;  4IDI A;  1JRO A;  4WWM A;  1NYQ A;  3AE5 B;  3N9Y C;  3R2I A;  2IGD A;  1EM7 A;  4XDD A;  3ZJU A;  1AWD A;  4A55 A;  5C2T B;  2L32 A;  4MH8 A;  2K22 A;  1SE2 A;  2JQR B;  3AN1 A;  1P7F A;  1E9M A;  3MHZ A;  1QOG A;  4KGR A;  3DWG C;  1NI3 A;  2EKI A;  2WU2 B;  1JML A;  1TS3 A;  3BVG A;  1ROE A;  1J7A A;  2K9X A;  2MEK A;  2GB1 A;  4ZRP A;  3TEX A;  3P4P B;  1L4Z B;  1XXG A;  2PIA A;  3AE9 B;  3IT4 B;  4WIP A;  3MC0 B;  2WXQ A;  1EWY C;  4JX1 C;  2QEJ C;  2I2Y A;  1KLG D;  4TQ0 A;  2MJ3 A;  1V97 A;  4ARC A;  2RDH A;  1ZXI A;  1AYF A;  4KKI A;  2JYT A;  2V3P A;  3AB5 A;  1OFF A;  2DLB A;  2WXM A;  5BYQ A;  2FBW B;  2PLP A;  3AM9 A;  1FNW A;  4LLG M;  2WS3 B;  1RWS A;  2RMM A;  2VZK D;  2LFI A;  5D3I B;  3AEA B;  5T8I A;  3BZD B;  2H88 B;  4YSZ B;  2L1A A;  1C4P A;  1WYG A;  5HG2 A;  3T3O A;  1XLP A;  4C7Y A;  1SEB D;  1Y56 A;  1PYW D;  2WXP A;  3FIL A;  2JX5 A;  1VZ6 A;  3L4P A;  4JWU C;  1C4C A;  1L4D B;  1FXI A;  2JZP A;  3HVZ A;  5AUI A;  2MJD A;  2ON8 A;  1C77 A;  3KQ4 A;  3U52 E;  5BYS A;  4A9A A;  1HZ5 A;  1L6V A;  3EGR A;  4YTM B;  4XE0 A;  4Q2J A;  1YN3 A;  2W82 A;  4L2Y A;  3ZYY X;  2PW9 A;  1L0V B;  2QSD A;  2N7J A;  2V4I B;  2Y5C A;  1WWT A;  3WCQ A;  4NAW B;  1T3Q A;  2E6X A;  1I4G A;  4R3D A;  2NMQ A;  3B9J A;  1AW7 A;  2AQ2 B;  2WXF A;  4YSY B;  1JWU D;  3NVY A;  3GP7 A;  3R2T A;  3W5U B;  1TKG A;  4N59 A;  1EWC A;  2QJL A;  2BTE A;  2KAJ A;  5LNK 1;  1RFK A;  4MAC A;  3TSS A;  3BYY B;  2IDY A;  5HI1 A;  2KMM A;  2Z8L A;  2WXI A;  4B0M A;  4JE3 B;  4HRS A;  1D5Z C;  1OQQ A;  5FKA C;  1TY0 A;  1KH0 A;  5EE0 A;  3PZ8 A;  1FFU A;  2LGI A;  4A90 A;  2BS2 B;  4DQO C;  3AMZ A;  1SBB B;  3ZGZ A;  1PUT A;  1TYG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...