3NS1A

Crystal structure of bovine xanthine oxidase in complex with 6-mercaptopurine
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
164
structure length
164
Chain Sequence
TADELVFFVNGKKVVEKNADPETTLLAYLRRKLGLRGTKLGCGEGGCGACTVMLSKYDRLQDKIIHFSANACLAPICTLHHVAVTTVEGIGSTKTRLHPVQERIAKSHGSQCGFCTPGIVMSMYTLLRNQPEPTVEEIEDAFQGNLCRCTGYRPILQGFRTFAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Xanthine dehydrogenase/oxidase
publication title Substrate orientation and catalytic specificity in the action of xanthine oxidase: the sequential hydroxylation of hypoxanthine to uric acid.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 39
structure length 164
sequence length 164
chains with identical sequence J
ec nomenclature ec 1.17.1.4: Xanthine dehydrogenase.
pdb deposition date 2010-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 3ns1A02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3ns1A01
2K9XA 1E10A 2KAJA 1E0ZA 3FAHA 1GAQB 4C80A 4US9A 1OFFA 2HTME 4US8A 2MJDA 1RM6C 1WGKA 2PKOA 1NEKB 1TKYA 1FO4A 1VLBA 2WS3B 3AE6B 1SF0A 1JWBD 2W3SA 1V8CA 4USAA 1CJEA 3KWLA 5EE9A 1L5PA 1GPXA 1NI3A 1DOXA 1N61A 3NS1A 1ROEA 3PO0A 1IUEA 5G5HA 1E6EB 3P4PB 1ZOYB 1DGJA 3CIRB 3P1MA 4FXCA 3AN1A 1L6VA 3SFDB 1ZXIA 4LTUA 2W54A 3AB5A 3AE2B 2M19A 4HRSA 2WDRB 1XO3A 3B9JA 1QOBA 2JQRB 4N59A 4WWMA 1N63A 1N62A 1QLBB 3B2FA 2H88B 4YTNB 5C2TB 1NVID 4P6VF 2BT6A 1NYRA 2AX5A 4YT0B 2WU2B 2BS2B 1DOIA 1PDXA 2B76B 3NVYA 3L4PA 2QJLA 3FC4A 1N5XA 2DBYA 3W5UB 4ZHOA 2EKIA 3VR9B 5C3JB 2JX5A 3ABVB 3AEAB 4KX6B 1E9MA 1JQ4A 1VDVA 2WDQB 3AE4B 3AE7B 5EE1A 3AECB 3CWIA 5AUKA 3RPFC 4A9AA 1J7AA 3VRBB 1N5WA 1FXAA 1ZP0B 1WXQA 3HUIA 2MH7A 1L6UA 2WQYB 1VJKA 4YSXB 3AV8A 2LEKA 4ZHPA 1XLNA 3NVWA 3NVVA 1NYQA 1OQRA 3AEBB 3EUB2 3P4RB 1T3QA 1WYGA 1YQ3B 1QOAA 2ACZB 2FBWB 3DWMA 2BS3B 1E7PB 1ZUD2 1FXIA 2L83A 1FRDA 1I7HA 1FM0D 1R7SA 3AE1B 3HRDD 3SR6A 3AE9B 3AE3B 1KRHA 3ETRA 5G5GA 3W9CB 1FRRA 1KF6B 2PVGC 4ITKA 2WLBA 3BIID 1KFYB 1YJIA 1QOFA 4YSZB 2G1EA 2L52A 1JW9D 4N58A 4IDIA 4WQMA 2KMMA 3NVZA 5EE0A 1JALA 2PVOD 3P4SB 1FIQA 2BS4B 3AEFB 1AYFA 1V97A 1XLPA 2CU3A 2PIAA 2OHFA 3AE8B 3AEEB 1TJEA 1EWYC 3B2GA 4JX1C 5AUIA 1TKEA 3WCQA 1TYGB 1SB3C 4JWUC 1RFKA 1SIJA 4C7YA 2K5PA 4HROA 2H89B 3SFEB 3VRAB 2DWQA 2CJOA 2N0SB 3DWGC 3AH7A 1AWDA 2QIEB 3LB8C 3AEDB 5GXGB 1FFUA 3AM9A 1PFDA 4YXDB 2W55A 2CJNA 1WWTA 2M56B 1QT9A 2Q5WD 3VR8B 1L0VB 5MPOA 1QF6A 1DOYA 1JROA 1N60A 3HVZA 1JWAD 1OQQA 1FFVA 1FMAD 2WU5B 1PUTA 1J7BA 1WRIA 2K22A 1YJJA 2MJEA 3AEGB 5EE3A 1TKGA 1F0ZA 2W3RA 4N6EB 1NENB 1YQ4B 1RYJA 1UWMA 4JWSC 1XLOA 4YSYB 4YTPB 5H8YE 2WP9B 2MJ3A 4C7ZA 1CZPA 1B9RA 4ZOHC 1QOGA 1RWSA 1XLQA 4YTMB 3NRZA 1J7CA 1A70A 3P4QB 2Y5CA 1JRPA 3AE5B 3P63A 5H92C 2E3TA 3ZYYX 3W5VB 3LXFA 2WDVB 3AMZA
chains in the Genus database with same CATH superfamily
4Y2UA 4PGXA 3RB4A 4YR0A 1YD8U 1NK9A 1D4BA 3KUZA 2EKEC 3GFKB 3W1SC 3LVWA 4JUZA 1A6SA 3L16A 1I4PA 1BGXT 4CCHA 1ZQKA 4FJZA 4ELVA 3ZDEA 2N1RA 2Y3AA 2XY7A 2MBEA 3T3FA 4F1SA 1KOTA 1E6EB 2ZW0A 2J6UA 2IPKD 2H3QA 3WK7A 3WANA 5DBAA 3AB5A 2ZXIA 1KFTA 2PI5A 3N97B 4M8NA 1XD3B 2DYMA 4KLOA 2LVPA 2ZNVB 4FJVB 1SIFA 1S0MA 2JEFA 1KDHA 1JWMD 3C8YA 4RH6A 3UIOB 7ICVA 3PX4A 2KKVA 2A4ZA 9ICUA 4WWPA 3V6EB 3RAXA 2B76B 4F8CB 3PZPA 3IT4B 5J2DA 4JQWC 2HW3A 4Z6FA 3PW4A 1C4CA 1JCKB 4R66A 4BDPA 4M47A 2G5HB 3SYZA 3ONSA 2WXNA 4CYEA 4QZHA 3VRBB 4TUQA 1I4QA 4HCNB 2XICA 4RPYA 1NJXA 2KJHB 3AI5A 4C8MA 2GOWA 5ALJA 3ZRFA 4EZKA 3QHTA 1LKYA 3SV4A 2KFJA 3H40A 1K53A 1IIPA 5F9LA 1O03A 1TV9A 4M9LA 1Z4NA 1E7VA 2BYVE 3GS2A 5DB9A 5DCNA 4TUPA 3TIXA 2NRWA 1D9FA 3GV8B 1BMLC 1FRRA 2KDIA 1SV4A 3OJ4B 2KWUB 2INPE 3RJEA 3B1LX 3OAWA 2MWSB 1C7YA 5FR6A 9ICBA 8ICYA 1ZQXA 5JXVA 1S9FA 5KFSA 1TE2A 3V7LA 1BXTA 2C7HA 1WZ0A 3EFCA 3X23A 2MLBA 3P2BA 2ZCCA 4GDLA 3M8RA 2PIAA 3V05A 3WAMA 1R4MI 1MQ3A 1TJEA 2NBUA 5I4DA 4OCZA 2OM6A 4C7YA 3V6HA 2ZTDA 5L95C 1IV8A 1C4PA 3ISCA 4O5KA 5KFAA 2MUTA 2V4RA 1S10A 1OGWA 4EE2A 4IS7A 2ICIA 1FFUA 3E0FA 3RNFC 1Y8RC 2WX0A 3VR8B 4M02A 3BVGA 1FNVA 1ZRMA 1FFVA 4PGQA 5D49A 1PUTA 2KICA 1V85A 1RFAA 2LUMA 2NRVA 4UAVA 3LWLA 2KKCA 3FILA 3M7DA 4DOBA 2FAZA 2MJ3A 4PHAA 1I4HA 1YNTE 4I29A 3H0LB 2KC1A 2WNMA 4N9F4 1SV0C 3V60A 2KQSA 3EWAA 4P16A 3AUOA 2WF8A 2FE8A 3ZQ4A 1KTQA 4LNNA 3AE5B 3P63A 5H92C 2E3TA 1T0QC 2WXGA 3TCAA 2REXA 2YLMA 2K9XA 1E10A 4Y2RA 3WK6A 3CP8A 1V6EA 3UIPB 1U4BA 3H7IA 4WURA 1OQYA 4AJWA 3EW9A 4US8A 4O1NA 2ZUBA 1N56A 4TMAB 1SKWA 1KQQA 4UBBA 4FBTA 1SF0A 2RPQA 3VXWA 4LNIA 1RYUA 2AXTU 1NI3A 2DKXA 2WXRA 3A9KA 4IWPA 1DOXA 1ROEA 4ZYNA 3BYYB 1L2NA 3GB1A 4U7CA 3NZUA 3MBYA 2WXKA 3UQAA 4ZRIA 5LNK1 3BVMA 5ALIA 1TS2A 2FUHB 1QOBA 2IDYA 5HKHA 2IOHA 2D2QA 2W9NA 1NVID 4P6VF 2BDUA 3ZXRA 2INNE 5ALUA 2JWUA 1VD2A 3ZKJC 3VH4B 3NVYA 2YB4A 1MSWD 1MFWA 1WMHA 4WJQA 2DBYA 2PMZC 3G6VA 2EKIA 1JMLA 2LWPA 3PO5A 1NKBA 1ED1A 4AP4C 4UAYA 5J2CA 2VKQA 2PE6B 5AUKA 2IZVB 1CRXA 1L8LA 4LNOA 1GC6A 2L0FA 4WWNA 3QU9A 3KHHA 2WXIA 4W9DA 4KN4A 2EAMA 3PY8A 5AK5A 3PLVA 1I42A 5DPTA 3D2SA 1WGDA 3RCZA 5J17A 1WH3A 3HT3A 4DL4A 2NRTA 4II3B 4KGSA 3OJUA 5AKIA 3VH3B 2BKRB 5DLFA 4LNFA 2RDGA 3DVNU 2BPFA 1TIFA 2G4SA 1TAMA 1KF6B 1AROP 1RDFA 8ICFA 1X9WA 1QOFA 4K7UA 3Q8BA 4NAMA 4IW0A 4LVSA 3H8WA 2RGFA 3OJ3A 2LFIA 3RYTA 4B9NA 4ZDVA 2YMMA 3Q69A 3GQCA 3F2CA 2BS4B 3M9MB 1I4XA 3MDAA 1L0YB 4ZRKA 3I9V1 2XK5B 3T5LA 1E7UA 1SBBB 1QKZA 1EU4A 5KG1A 5ALYA 4ECQA 4NQLB 2RSUA 2AWTA 5CX3A 2WAQF 3PR4A 1PZNA 1U47A 4RMAA 1I35A 1SL2A 1ZW7A 4QW9A 2DQNB 2MJEA 3U4EG 2PJHA 2A1JB 3KZIU 4GXJA 1NI2A 4F5RA 4G9BA 4Z6DA 2KT7A 3THVA 2WP9B 1U49A 1PGBA 3AU4A 1RWSA 5AKYA 5AZHA 3CRXA 2G06A 4QZFA 2KTQA 2MBQA 3ISBA 3DHIC 3T3NA 4PS8A 3JPRA 1Q10A 3HX0A 4C80A 1SWVA 2M0XA 4RGNA 4F92B 3M63B 5J0XA 4PGYA 2WXJA 3PS6A 3SDLC 5IIMA 3MR2A 3R7QA 1Q3UA 2N7JA 4DFMA 4A55A 1E5WA 5HNKA 2AL6A 2KHVA 3P4RB 2W3SA 3IG3A 4OZCA 3RTVA 4KLLA 4EENA 1KLVA 3PO0A 5G5HA 3PHXB 5ALHA 4HDOA 1UPHA 1ZQIA 4YWGG 3HK0A 4HPPA 3UMCA 2W54A 1PQSA 2O2VA 3KHRA 2KANA 2I2YA 5C2TB 2XBBC 4DOCA 5AM1A 3QZ8A 1HQRD 1P7EA 1ISNA 2NPTB 2JRIB 2LYAA 1F1HA 5HHHA 2UYZB 1I4GA 1G6JA 3FC4A 1N5XA 3ENEA 3R66C 4NM1A 4RQMA 1S97A 5DDMA 2JX5A 1D5XC 1ZQ1C 1ZQHA 2KLCA 5L1JA 2XN9C 3GOEA 2ZPNA 4JGHB 4JB3A 5EE1A 1JQ4A 5L1MA 3AECB 3RPFC 5J8YC 3F53A 1N5WA 5ALRA 3PW7A 1ZQDA 4C8NA 2W9BB 2WQYB 3B0XA 2BW2A 3RFZB 3HM3A 3H7PB 1T3NA 3L3FX 2NRZA 4Z6EA 2OYYA 4KKJA 4LZDA 2KTFA 2LMCA 2E8MA 4NJ6A 4XQ8A 1QOAA 5EWGA 1ZUD2 2D3CA 4IQTA 3HRDD 3WKAA 2M8SA 3AE3B 2IGGA 4MGZE 3ETRA 2INCC 2XC9A 3WK4A 5HI1A 2KK8A 3N1XC 2ODGA 4PYZA 4BUGA 1JX4A 3PVXA 1UZXB 4KDIC 1MVKA 1P7FA 4L23A 4IDIA 2KJ6A 3A0BU 3F5EA 3B0YA 1SE2A 1MHHE 2BZFA 3AE8B 5C1ZA 1GUAB 3QAQA 2KJ5A 4JWUC 2NO4A 2OCEA 4RQ2A 1SKSA 7ICUA 3FKYA 2FI1A 4KLHA 3SZ2A 2LASA 2CJOA 3NOBA 2E8PA 2ZTCA 4IM3A 4HCPB 1GG3A 4PH5A 2WF5A 3QARA 1DOYA 1JROA 2CXYA 3RJJA 4UAWA 1OQQA 3N20C 7ICOA 5EDSA 1BPXA 2PI4A 4YTPB 4NL9A 2HHQA 2OJRA 3QU5A 4ZOHC 5JH5C 9ICOA 2J6SA 3TEXA 3N32A 2KXJA 1JRPA 2D3DA 4OJLA 3APCA 5HHDG 4A90A 2NRXA 2BGWA 2NMQA 4OVUA 2LHDA 1AARA 4RPZA 1TBEA 1YJ1A 1D6EC 4ED7A 4F2RA 1J19A 3TBLD 2EMSA 3JYUA 5DG8A 4P0QA 2MW5A 5ALMA 4YFKA 2LYHA 5EE9A 2V9WA 2KVCA 2XGPA 5KT6A 2XCAA 3SENA 4FXCA 1DGJA 1E8YA 4WIPA 3GIJA 2LGDA 2W7OA 2HOFA 5C0YA 2Y1JA 4C4VB 3DBSA 2C7MB 2QB0B 1EU3A 4RQ8A 1QLBB 5KFMA 1X6JA 2VIXA 3JPNA 1ZDVA 2ISOA 1L4ZB 2ATLA 3PVLA 2WU2B 2NR2A 3K4GA 4LZGA 2F1HA 2WF7A 3L4PA 4YR2A 2KHWB 4HEA1 3SAGA 1YIWA 4GIVA 4CO7A 1E90A 4BOSC 3ABVB 3AEAB 3ZNGC 2ISPA 4FS1A 3ONNA 3SD7A 3OG5A 1UD7A 1NOMA 4NLGA 2FCQA 3KHLA 3HP6A 4DFPA 2ZVNA 1Z00B 4PL2A 1VJKA 4ZHPA 5TZVA 3NUQA 4O5EA 2KMAA 1A5RA 4XA5A 1V2YA 4RGOS 3C1ZA 3MGVA 2V4IB 1L7YA 4FBJB 1IGDA 4EUTA 4DHZB 1Q46A 4I6LB 2FDRA 3BQ7A 4DSIA 1L0XB 4TQSA 1PK3A 1X9SA 8ICAA 3H0RB 2NO5A 4XWTA 1NDDA 3SHQA 2D07B 3L5KA 4E71A 2MX2A 5JUMA 2KMMA 1Q1OA 4RT2A 5AKJA 4B9TA 2DKZA 2DUYA 2JGAA 2K60A 5CRXA 1Z1BA 5J0RA 1T0YA 1X1MA 2HE7A 1IBXB 4TUUA 1K1QA 2DF4B 9ICSA 1SB3C 3RJGA 5ALDA 2IY0B 1JXLA 2G45B 4HWIB 2M17A 3PT2B 4P1BC 3MHSD 4YXDB 1PFDA 1Y56A 2CJNA 1X42A 1I4RA 4HYKA 4PK1A 4X57B 3KD3A 5MPOA 2QDFA 5AIAA 1ZQSA 5BOMA 3WU2U 1J7BA 3ZW3A 3S6JA 1TKGA 1NENB 1RYJA 1J8CA 2BQRA 2HVHA 3PMNA 2R8HA 1PGAA 3DVNV 3RH6A 1ZQTA 4F4WA 2Y5CA 4ECYA 2R18A 4NY0A 2EMTA 3QCAA 4DL5A 5AKXA 4RUAA 3C2LA 3OJSA 2FPMA 4DL2A 3EC8A 2ESEA 3PSEB 4PS3A 5KHOA 4DOAA 2KAJA 3T9LA 3GV5B 1FD6A 1GAQB 1RPLA 4QZAA 5CB1A 3ZJTA 3M6ZA 5C5JA 1KLUD 4J9PA 5EWEA 1WR1A 4O0IA 3A1QB 4KLUA 3A4RA 1SGHA 3LJ3A 2JYEA 3ZDMC 4NLKA 1NEKB 2OWOA 4K3BA 4ACFA 3TSSA 4ANWA 3C2MA 4G3XB 3RRGA 5HMMA 3PX6A 5AICA 2W11A 4F8RA 1NJWA 1WXVA 3CIRB 1ZOLA 2A19A 5AKEA 4RU9A 4OJPA 1XO3A 2ZW1A 2W8LA 4KSKC 1L8OA 5J0QA 2H88B 2NTTA 2ZIVA 5DBBA 5E79U 1ECWA 1KRPA 4M00A 4DSLA 4WH4A 1TT5B 2OH2A 4KIKA 2ZJ5A 4ACOA 5CHVC 1KLGD 1AN8A 5CA7A 3OPXA 2RQ5A 4XC2A 3BZKA 3UM9A 3T3OA 2WXLA 3VTVA 3H8JA 3PHWB 3IG5A 4RNMA 2Z7JA 2Y1IA 4Y2VA 1PUZA 1LXDA 4YMOA 2PKEA 3ZDAA 3CMMB 2E6XA 5L9XA 2I9GA 4CRXA 3U2SC 2LEKA 4BZAA 2RHFA 2L5YA 4AYBF 5EWFA 3IRUA 1X9XA 2KX0A 5A0LA 2PFPA 3BDPA 2F2AB 5GTIU 4DQIA 1EM7A 1TZ1A 2DPIA 1ZYQA 2H3FA 2E8NA 4GLXA 4EYHB 2JU6X 1JI7A 5AIBA 1E7PB 5AHXA 3UINB 1R7SA 3PLUA 3PZ7A 3WKBA 2MSED 4LJXA 1KN5A 3BJYA 4QWDA 3M9NB 4B6WA 1WRDB 4R8UA 4EX6A 4PHPA 5KAFU 3NVZA 3RR7A 2J53A 1LKYB 4KV2A 1GNUA 7ICIA 3PV8A 2UVUA 5KFVA 3ZI4A 1V97A 4NM2A 2BR0A 2FMQA 3H6NA 1B0XA 3DEEA 4YXMA 4NJ8A 1MHXA 2LRWA 5KFYA 1V81A 3WK5A 2I38A 4FADA 4FFDA 3NG0A 3D6JA 2FMPA 2JF5A 2DAFA 2VZKB 1S77D 2QIEB 4IC7B 4M0WA 3C29A 5GXGB 1DK3A 1YMHE 3ZLZA 3PO4A 1WWTA 3N1YC 5GMVA 4EYIB 5BO4B 7ICGA 4RNOA 1WJ4A 2L76A 1QF6A 2K6DB 5E6OA 2LI6A 4GDLB 2HDOA 5TSSA 4UDUC 3URYA 1RZTA 1QSLA 2MHJA 2D6FC 1X6IA 4I2JA 2BPCA 1CZPA 2JXTA 3D32A 2MUTB 3C1YA 3Q8RB 4QZGA 2NTSA 3K9PB 3RB3A 2QMTA 1S0NA 4AS1A 1Z4OA 1UELA 5KHQA 2LXCA 8ICOA 2LVOA 4KN7A 3UMGA 2WX1A 4Z6CA 3G6XA 5KTQA 1YOVB 3FILB 4R3DA 1VZ6A 1F5SA 2WXHA 4FULA 1FO4A 4R65A 2H3IA 3W2DA 3HILA 2KVZA 2LKYA 2MBHA 4GC6A 2ZG6A 2GI9A 3BYTB 1IXRA 3SFDB 4B95A 2AL3A 2BCUA 8ICIA 4UAUA 2WDRB 5FR3A 5AM0A 2LGIA 1UQVA 3EECA 1SXEA 4ICUA 4RM9A 2VJ5A 2BF8B 3UQ0A 3MR3A 3ZNHB 4C8LA 3Q8CA 2KN7A 4NJ7A 4BKGA 3A9KB 2BYTA 1FNUA 2ONQA 1H4RA 1S0VA 2BPGA 3KYCD 2KZZA 2CHZA 3K9OB 3VR9B 4L2YA 2AJQA 1NK0A 3UGBB 1B43A 2GBNA 3PZ8A 3RRHA 1J97A 1VDVA 1DOQA 1YX6B 4FN2A 3H8SA 1FXAA 1ZP0B 5HHIA 2KWCA 4YSXB 4REZA 3UXOA 4B6JA 4HLEA 2VZKD 5DPWA 4NL9C 9ICIA 5L1KA 1WE6A 2JWZA 1WMHB 3DPDA 3EUB2 2PE9A 2J4XA 3Q8EA 4OVZA 1K1SA 2NCNA 3DCGA 5TR5A 4YD2A 1I7HA 2LJ5A 4GOCA 1Q3VA 4OJOA 4GFJA 2AQ1B 2ZJ8A 3CYMA 4PPXA 4OW0A 1YJIA 5JTIA 4OZBA 9ICVA 1JIHA 1PYWD 3H4DA 2JUOA 2KOBA 3GZNI 4TQRA 1JALA 2PVOD 1FIQA 5H2FU 2YX8A 1UH6A 2J6TA 1RFKA 2B3AA 1MG8A 1AW7A 3JSVA 4O3RA 3DWGC 4DL6A 2JT4B 4UB8U 2W03A 1OTRB 2KYWA 2M1MA 3MJ5A 3TACB 1S3SG 1HZ6A 2M56B 2H5XA 1P98A 2HHTA 1QT9A 1BPBA 2L1AA 4DQRA 3L54A 5ALSA 4BXOA 4B9LA 2F8LA 7ICMA 2WU5B 3QUCA 2E5SA 4YTMB 3M95A 1T0RC 2BGFA 4JWSC 3ZRCA 1SE4A 2YTUA 3RAQA 4I2HA 8ICQA 1QOGA 5JHBA 3ZDTA 3AQEA 4UAZA 2WXPA 4HK2A 2BYFA 4KMOB 3E56A 2EAPA 1WI0A 4KLGA 3Q8AA 4F5OA 4F91B 3BZCA 4W9FA 1L5UA 2IGDA 5J2AA 1PK1A 4UASA 1WJUA 1XSLA 4JWMA 2QSDA 2SEBD 1K52A 2L32A 4LK0M 1WWUA 3ETLA 1Q5WB 8ICKA 1XCQL 9ICKA 2KJ9A 3LVVA 2IY1B 2LD9A 4RGTA 2QC8A 5J2IA 3TEYA 1UUPA 3P4PB 1KL9A 1T94A 1DK2A 1L6VA 3KW5B 1WCNA 5KFLA 1DGSA 2N9KA 2KIVA 1F2RI 2M0NA 4WWMA 1TAQA 1TGZB 2EH9A 1XCTL 3RNGC 2W9AA 1B22A 3LDAA 1SZPA 2WAQC 2WXFA 3IAM1 5AM4A 4J9SA 4O9MA 1WFYA 3HKZF 5FKAC 2DZJA 2P6UA 2G4DB 4PHDA 2BCVA 1SWWA 4ECZA 1DRGA 4ASWC 1BVSA 2YEPF 1B4FA 1X9MA 5G2NA 2O2VB 4KGTA 4EEWA 2ASQA 4HPMB 3R3MA 4PYUA 1XS9D 3U8ZA 3VTUA 2WTFA 3WALA 3KTQA 3HWTA 5J0SA 2HMXA 2N9PC 3O65B 4DEZA 3C5FA 2ZIUA 5AM5A 4G50A 1BPDA 4DQQA 5JRTA 5D6JB 3FYHA 2DLBA 4KX3A 3EGRA 4GDKA 4DO9A 8ICBA 5CP2A 4PHEA 2F8KA 2KDEB 4YQWA 1FCLA 4RUCA 1Z2MA 4XWWA 1ZE3D 2AQ0A 1WX7A 2FBWB 2BS3B 2M9NA 3RNEC 4ECTA 3DVGY 4CGZA 1FM0D 4EBCA 3SR6A 3WKEA 2IYDB 4QZBA 2KP7A 2FCMA 2QARA 3MC0B 2KQ7A 1ZD3A 4GC7A 2PVGC 2WLBA 1TS3A 9ICLA 3SV3A 4BBNC 9ICJA 2ZUCA 2J7QB 1WSPA 1UBQA 4F5NA 3T5KA 3CNHA 4TQ0A 3FDSA 3PZDA 5HG2A 4DL7A 3UQBA 3E2EA 2HHSA 1BNPA 3C28A 4CHKA 3CSTA 4PL1A 3RJHA 4DHJB 2N1WA 3QUQA 2GRIA 3MHZA 1VJ5A 2C5LC 2KSOB 4JL9A 1TK8A 1RYRA 4KLQA 5IO9A 5KFIA 4F5QA 2RDBC 4MGIE 4IM0A 1QTMA 4O3MA 4YD1A 3M6KA 4DQSA 2OEHA 4EELA 1BUIC 2KV2A 2YMQA 2KHQA 3ECIA 2BKEA 2PFOA 4P4MA 4BWMA 5KFJA 1LO5D 2DZKA 4UB4A 2V3PA 2PXIA 1PVQA 1F0ZA 4M9NA 5AI9A 1UWMA 2N9EB 1IGCA 5D3DA 5B66U 4F72A 2LMRA 3L08A 4IRDA 8ICSA 5BMIA 1ZD5A 1TAUA 4NWIA 3W5VB 1SSNA 5DPSA 1C79A 2UWQA 5D94A 4KLDA 2MP2A 1JWSD 1QQ7A 3U52E 3JW0X 2HTME 4DS5A 2GBRA 2RLTA 4MHVA 3ZTCA 1TKYA 2KDFB 1WX9A 4K7SA 4A3OA 5ALQA 2QILA 1L6NA 1NZPA 2E1EA 4ECWA 2IJ0A 3N4MB 2HBJA 1L7PA 1XU4A 3UQ2A 1MI0A 3RI7C 2YEPB 4A8XC 4NQKE 5ALOA 1KKXA 3WKCA 5TISU 1ZXIA 4NXZA 4FBUA 3TUOA 2M19A 4GMVA 2CRXA 5ALVA 3RN9C 3F2DA 2K8BA 4P0QB 2Y5BB 4YTNB 8ICRA 7ICEA 4W9GA 2ZZPB 1YT3A 3SQIA 2JZPA 2Z0DB 2ZVOA 4UB5A 4HDQA 5ALNA 1ZQYA 3MFGA 4JK1A 2GB1A 4ZHOA 5C3JB 3V6KA 5DG9A 2P66A 7ICSA 2OJWA 1NBFC 3NUHB 4YP3A 2GMIC 5AKLA 8ICZA 3EHVA 3QA8A 4DHJD 5AKGA 1K8RB 4DXFA 4BBNF 4EX7A 1VRAB 1RQNA 4BX9C 4L1BA 3OLMD 1NK5A 2KMDA 5E6PA 5ALFA 3DBHB 1NYQA 3O13A 4OVVA 5IKCM 1QCKA 3AEBB 3RFAA 1STEA 2M4NA 3ZGZA 3DHHC 2BTEA 2J42A 2FLNA 1Z5SB 1S5LU 2G9HD 4JIOU 2JVCA 2K39A 1F9JA 5HFYA 4UW9A 1LQBA 2KDBA 3A9JA 2ZTEA 5G5GA 3PX0A 4QZ9A 5KG0A 4J6IA 1WXMA 3QZ7A 3DBRI 1O08A 1ZQWA 2WF6A 3HHMA 1WR6E 3K1RB 3GP7A 3I3TB 3I1YA 2KACA 4OHJA 5EE0A 3MR6A 2B21A 4IWQA 3V7KA 4Q43A 3BQTA 3N28A 5AKKA 3LK9A 4K4GA 1XLPA 2V1YA 3AEEB 3Q3OC 1NJZA 4DBGA 2PEAA 2UVVA 3A4SC 1KW4A 1SIJA 4G11A 3NRWA 3EZ5A 5DGAA 2HHUA 4YG2A 2OEDA 3Q3JA 3RBEA 1ZQLA 2JY6A 1VZ7A 2ZJAA 3PRPB 4EZ9A 3CW2C 1UT8A 5AI8A 1YX5B 2CR5A 5FP0A 2KSOA 1JWAD 1TZOA 1B1ZA 2UU7A 1WE7A 4MM3A 4IQVA 2P35A 3Q6BA 1QZEA 5KNIA 5H8YE 3QE9Y 1BNOA 2AGQA 3V7JA 2Y5PA 4HKQA 1QQ5A 1F0MA 4GLSC 2C2RA 3IXSA 5DLGA 5ALGA 2RDIA 5BMGA 2MRPA 7ICTA 3MTNB 3NS8A 3UPQA 4MDKE 2CN1A 2KNJA 3BY4B 1P0RA 4W9CA 3KVFB 5AZGA 3L17A 3QIJA 4PS7A 5F9NA 2LGXA 4MH8A 3TEZA 3DVGX 1F2RC 1YQBA 3ML8A 2L0TA 2N7DA 4J9MA 2K8CA 2ALZA 3PW0A 2W43A 3V6CB 3RZWC 2PTLA 3OHAA 5KAIU 2EANA 2HHXA 1KJTA 3EPGA 1EF5A 2FPLA 1WJ6A 2DX5B 4MELA 4M6WA 4DSEA 2PFQA 1RLFA 1QSSA 4R63A 2MSNA 5J2HA 4J9RA 3B2FA 1T7PA 2INDC 3QUBA 2BT6A 3BS5A 3NGDA 1C78A 2AX5A 4QZEA 4XDCA 3IP4B 5KT2A 4M9GA 3SEBA 1SKRA 3DQVA 4PZOA 5KG2A 1QQRA 1HA5A 2G07A 7ICFA 4J9LA 2D8CA 5BYSA 1NKEA 1WYWB 4RQNA 2W8KA 2WDQB 3AE7B 3PREA 2JRHA 4FZNA 2O6KA 2WHEA 2ZIVB 2CHWA 2GBMA 3ZJUA 1UNSA 4IKGA 8ICPA 4EZ6A 8ICVA 2H3VA 1VR9A 1D8LA 2JZ3B 4KIKB 4MGYE 4A20A 2JZBA 2MRLA 2VJ4A 2XGQA 1YN5A 2MAXA 1SE9A 4I2EA 1UWXA 1HE8A 4W9IA 2X38A 4J9OA 2IGHA 1MQ2A 3AE1B 3P42A 1SJHD 1SZHA 1HTQA 4ED1A 4O3SA 2NBWB 2JEGA 5D7GA 4YR3A 4EBEA 4HAIA 2JZZA 2KTRA 3NZ3A 1HZ5A 4QZ8A 3TKAA 2IHMA 5J0YA 2O6VA 4KVGB 2Q4TA 3BINA 1UHUA 2IO3B 2EZYA 4Y2SA 2LBOA 1KTKA 4UARA 3TANA 2RR9A 2SAKA 1ZD2P 1MN8A 3BK1A 3SI8A 2K5PA 3WA0A 4EKUA 5D4BA 4FZMA 2I6XA 1EXNA 2JRZA 4O3OA 3PRZA 3UI3A 4GXIA 4ZH4A 3LB8C 2WXMA 3R2TA 4G3IA 4RT3A 1UA1A 4K4IA 4R8UB 4BVUC 3PSPA 1WJNA 4KGRA 2BB6A 3C19A 5DDYA 2WF9A 5EE3A 5KG6A 4F4KA 1HTOA 1WRIA 3RH4A 2KN5A 2GOLA 4ECVA 9ICRA 3Q8MA 2NS5A 3T5JA 1YQ4B 2GLEA 4O3PA 4PT5A 1TS5A 4W9EA 2EZXA 4AYBC 5J2JA 4M0WB 4MFFA 1B9RA 5KFCA 1J7CA 5T14A 3ZO5B 4MFAA 1UF0A 4TSSA 4KSLC 4KX5A 4PZNA 3DBLB 1TTNA 4RQ3A 1ZQQA 1L7MA 5ALKA 3KLSX 5IIOA 1BPEA 1HEKA 3MABA 4RNNA 4AWJA 2F3NA 2EELA 4EZLA 1E8XA 3KYDD 1VLBA 1RYSA 4NV0A 3KHGA 2I1KA 4KLSA 3TQ1A 3JPPA 1GC7A 3VDZA 4XUSA 1MJDA 3C5GA 3GZNB 2IBKA 1SXTA 3Q8KA 3Q3MC 5DQGA 4P0PA 2VA8A 3VAWA 3B9JA 4DXAB 2JQRB 1WG8A 3DBHI 3IDWA 4ICVA 4IC9A 2BWES 2I5HA 5AI5A 4F4YA 2KFNA 2Q0ZX 2DHZA 1DOIA 4UB2A 4YVZA 4XX5A 2K4HA 4F71A 3AULA 1BPYA 3JPTA 2IO0B 2HJ8A 1OEYJ 3QK0A 2R8IA 2DFLA 4WWOA 4IQWA 4A9AA 2ES6A 1ZQVA 2LM1A 3QU4A 4WJOA 3AV8A 3QWZB 3QU7A 4NNJB 5IOIA 4UB1A 4JV2A 4ED3A 5IA7A 2R2OA 4BAXA 4ZRPA 2AEHA 2KG5A 1KSPA 2ACZB 2QCZA 3DWMA 2BQQA 3PV1A 3IT6B 9ICFA 4NLZA 1WXSA 1A0PA 3HIZA 2JR5A 2C60A 2ZPYA 1OXJA 4NY8A 4P4PA 1KFYB 2YMLA 1L7NA 4K4HA 4NLBA 2XI9A 1EO6A 3C0RB 4UQGA 3Q3NC 2FE9A 4RF0A 3JPQA 3JVZX 2G0AA 3TJPA 8ICNA 1QSYA 4KLMA 8ICXA 3WCQA 1RG6A 3KKAA 4KLEA 1EWYC 2C9WB 2K25A 3HJEA 4NLCA 9ICEA 3DDCB 1TY2A 4HROA 3KWVA 3BWUD 2VH2A 1WM2A 5KG7A 3EPIA 1R4NI 1AWDA 3AH7A 4YL8A 3BQ0A 3VC8A 4CNQA 3LWMA 1UCVA 1ZRNA 4JLCA 1V1PA 3AEVA 1N60A 2AQ4A 3HVZA 2KK0A 2FJ6A 3GIIA 7ICLA 4IG7B 3QJZA 2LGYA 1YJJA 4DHZE 4GXKA 4FE3A 1WWVA 1NK4A 4KTQA 1XQQA 5IAAC 4YSYB 3IAS1 4B9MA 3JSVB 4C7ZA 8ICMA 4D2KA 4M0AA 3GE3C 5AKHA 2PLPA 4XDDA 9ICWA 2DYOA 4TUSA 4NJCA 2RD0A 3RJKA 1NKCA 3ZYYX 4C56C 2KKPA 3VFKA 3OSPA 2WDVB 2WXQA 4QWCA 3T8MA 5ALWA 4BXOB 2W04A 8ICLA 1K50A 4W9HA 4KLJA 4ED6A 4S0RA 3BZDB 2PKOA 4A3PA 4ELUA 3ZNZB 4K1RB 3VQIA 2R61A 2KN4A 3GZFA 2JEJA 1L5PA 4ECXA 3IFWB 1IUEA 1MG4A 3ZD9A 2IO2B 2MEKA 1FEHA 4JV0A 1ZOYB 3AN1A 5KFPA 1TVAA 4O5CA 5CHFA 4HRSA 2P6RA 1PK1B 2FLPA 4IRKA 2WFAA 1EF1A 1FCCC 1V5TA 2LUEA 4P1CC 1IG6A 3M62B 4NLNA 3DHGC 2N9XA 4LCDE 2F1JA 2W9CB 1C9FA 3Q8FA 3X0WA 4YT0B 3O0FA 5J0WA 3ORYA 2BVCA 2KJRA 2J0JA 9ICXA 4ARCA 2KMCA 4WQOB 2LGSA 2N4FA 1COOA 3TFRA 3ZDCA 2DPJA 2QLTA 4E0DA 4BGDA 4JMUA 2BCRA 1XT9B 5KFFA 2VA3A 3E9SA 1TFRA 1E9MA 5IN7A 1ZGUB 2ASJA 4NAWA 3AE4B 2D10A 1ZDXA 3CWIA 3NZSA 3M3JA 3MC1A 2KJ8A 2QB1A 3PW2A 3CSFA 4GSWA 4ARIA 2MH7A 1Z19A 2JV3A 4UB6U 2LJIA 3ZDBA 3NTUA 5KFEA 5AK6A 4B0EA 3FM9A 3RMKC 1KFDA 1F52A 2K8HA 1T3QA 2JXXA 3ZIMA 5G55A 3JPSA 1TS4A 1FXIA 4BKSA 4BKTA 4DSJA 4ED2A 3PMLA 2RRDA 2ZIXA 4U6PA 5J8YA 5J0UA 2KIWA 1ZJMA 4G0NB 2UVRA 2ZIUB 4Q2JA 4LDTB 4FS2A 3AXCA 4GDKB 1NNLA 2L52A 3QXGA 3ML9A 4BOZB 1RQLA 4MEMA 2HD5B 1KLNA 4Q45A 1AYFA 2C7NB 3AEFB 3B2GA 1M94A 4ANUA 3KUCB 1T5XD 1TY0A 1MPEA 2HCFA 2NBVB 2QARB 4ANVA 3RUIB 4O3NA 2FMSA 2AGPA 3V3XA 3DBLI 1WGGA 4DFJA 3BS7A 3F5AA 3HKZC 2C2DA 3AEDB 4MJSA 2UVWA 4FO6A 1UT5A 1E8ZA 4Y2QA 1L0VB 2B6GA 1P9DU 2LZ6A 4TURA 1ZQNA 2LXAA 3AEGB 1C20A 5LXHA 3V61A 5KFBA 4RQ5A 2HOIA 4RF1A 4RGMA 3ZD8A 2MA1A 5JZEB 5CR0A 4I2DA 3DDHA 2G3QB 1M4VA 1F44A 1V80A 3L0WB 4JPSA 4MGKE 2DGZA 3RH5A 4C8KA 1M6YA 4KITB 4DF4A 1WGYA 3SMVA 4QIWF 3RNCC 1RM6C 4I2BA 1IM4A 7ICJA 2NYVA 1KBUA 2E1FA 3N7SC 1WCLA 4J03A 2D3AA 3DBRB 2AH5A 3OTQA 3N1ZC 4RFBA 3MGHA 1V38A 4C4TA 4BJQA 2AGOA 2FNJB 4FA6A 1C3TA 2MP2B 3TARA 4DWIA 4OJ5A 4QWBA 2WDTB 4F7ZA 4BWJA 1XC9A 1D5MC 3AU2A 3VCBA 3GE8C 4LDTD 2K4IA 3EYZA 4MFCA 5DB8A 2QJLA 4DL3A 2RPVA 5KFWA 5ALLA 1Z3EB 5BYRA 3N7RC 3J81j 2W9CA 5IINA 1ZQFA 4B9KA 2FCNA 4KDLB 2KDMA 1XSPA 2HDEA 2YVCA 3GDXA 3IBEA 2K8BB 3VHTC 3ZJVA 1WXQA 2C22A 3NASA 1D3ZA 3WK8A 1JUDA 3UXNA 3TEWA 3IN5A 3ALBA 4TKNA 4MH0E 1P3QU 3RB0A 2I1QA 2MU2A 4P2HA 4QWAA 2FCSA 4FHJA 3TFSA 2H3ZA 2IA6A 2KVSA 1ZQCA 3RZFA 3AE9B 3IVFA 1L4DB 4ZRQA 1ZPSA 3TAQA 4DSFA 1QH9A 7ICKA 5J0PA 2ZIWA 4J9NA 2Z0EB 4HXDA 5EOZA 3BK2A 2GBKA 1OEYA 4QAYA 2V0GA 3SAHA 1H8CA 1A77A 1U45A 4QJFB 4JX1C 3A9JB 1TKDA 5CHGA 4RPXA 4I6NB 3MDCA 2IHNA 2ASLA 1ZQGA 5KFTA 2KFKA 3VRAB 1P7DA 5KG5A 3ZVVA 1JMSA 2HHWA 3AM9A 3PNCA 2AQ2B 4DWFA 3PGEA 3IHQB 1FNWA 1J2NA 2CPRA 4GU2A 3TADA 4DDGD 4MF2A 5J2GA 3L13A 2W7PA 2AQ3B 1WGHA 2AYOB 3R8BA 4F4ZA 4UB3A 4B9SA 2BYEA 1L3SA 3NRZA 1E8WA 3T5HA 2QEJC 4EEKA 5KT7A 2FLLA 3PW5A 3LXFA 1URJA 2KNBA 4Y2YA 3AMZA 1RXVA 4WAFA 3SU8X 3S2AA 8ICUA 4RZRA 3A33B 4MM3B 4US9A 1WUDA 5JHAA 3L10B 5HMLA 2PMVA 3OSNA 3PRMB 2Z8LA 1HXYD 4I28A 8ICJA 1VCBA 2HBLA 1NK6A 3GU3A 1ZQJA 4WJNA 2JSVX 2EQYA 4DDID 1U48A 4XE0A 4OZAA 4Q8EA 1CK1A 3JPOA 4MEYA 2I1JA 3VVWB 1N61A 2G08A 3H7SA 4W9KA 4DLEA 3ZTDA 4F50A 3UMBA 3V72A 5DPRA 3T79A 5JU5A 2CU1A 5BOLA 1HEZE 4N59A 5CHWA 1N63A 1N62A 5B5EU 2RDJA 2LYBA 3MJWA 2BCQA 3Q3FA 3KKAC 5E6JA 1XSNA 4ICAA 2IOFA 2FIDA 1PDXA 1SGGA 2K8CB 2VA2A 4EBDA 1WZ3A 7ICPA 5KFKA 1LGRA 4FLHA 3H4BA 3W5UB 1RAXA 4OJ6A 3PPAA 3I28A 4KX6B 2MA9B 4M6WB 1T4GA 5J2BA 4DXGA 3V6JA 1UA0A 4E3CA 3BS5B 1NK7A 1MC8A 3IM1A 3F2BA 1L6UA 2X8XX 2ZEQA 3H0MB 1Z1VA 2ZJDA 5KFGA 1CMXB 2NVUI 3EA6A 3NVVA 4AQ7A 4MT5A 1WGRA 4I2GA 1WYGA 5ALPA 4ED8A 5DQIA 2VANA 1ZQAA 1ENFA 3KQ4A 2YY6A 2Y9TA 2A5UA 3TAPA 1C76A 3D2NA 4GB9A 4RQ1A 1ZQZA 4MF8A 2C2EA 2WYQA 3RJFA 4F2SA 3BIID 5L1LA 4IR9A 5J29A 4Q44A 2JYTA 1JN3A 3M1YA 3APFA 4QWEA 9ICTA 1F77A 2JZBB 3KZXA 1WXAA 3QC8B 2OXOA 2DNFA 3QU2A 2HSZA 2A3VA 4DSKA 4KLTA 2BHNA 3ICXA 1ZQBA 1WF9A 2CU3A 1DXSA 1S76D 3N7PD 3MC8A 5AUIA 1TKEA 4WJPA 4ECSA 2MQJA 2AHOB 4KLFA 2ASDA 2H89B 2K4PA 7ICQA 1YN3A 4GXBA 3AU6A 1EWCA 2KTRB 2V3SA 3BQ2A 5DBCA 2C28A 2E8OA 2CHXA 2DZMA 4QW8A 2VRRB 4C4RA 3VUWA 2O6VB 2BB5A 4MEXA 1V9PA 2KX3A 3R7RA 2G09A 1ZQRA 5IP4D 1OW5A 2PMZF 3OWEB 1S8OA 2NV3A 1SL1A 1FMAD 2W82A 2BPSA 1XO1A 3H8HA 2YB1A 2EZZA 1PVRA 1ZQMA 4B9UA 3SD5A 4HVBA 3GV7B 5KFOA 2JEIA 1TK0A 5CWRA 2V4LA 1CI4A 4KZCA 1JXEA 3QNMA 2K89A 2YQEA 2KEYA 5AKZA 2XO7A 5J2FA 5KFHA 4ED0A 3QEBZ 2L05A 3Q8QB 1GB4A 2KE7A 2MJDA 1QQ6A 1X40A 5HR7A 5HR6A 1GO3F 2WS3B 1KFSA 1N6ZA 4HKZE 1V8CA 9ICAA 4KLIA 2D11A 2K1FA 1C4AA 2BBCA 1D9DA 3Q8LA 2N9LA 4I27A 4LTUA 3ZUNA 7ICNA 3AU5A 2HBMA 2IBIB 1S0OA 2HOQA 5AI6A 4AUQC 2B0CA 3TMPB 9ICNA 3NY5A 2XY5A 1NJYA 4I6PA 2K0PA 4A8EA 1JRUA 1S1QB 4LJOB 3V62A 3I57A 5BPCA 1R4NB 3RR8A 2MCNB 3ZXVA 4M2YA 3KUDB 3TL5A 5J0OA 1H38A 4ELTA 4IQUA 1A76A 1K51A 2DL0A 4IL6U 1BT0A 2KOXA 2BKFA 4TQ1A 1IYFA 5KFQA 4J9QA 2FPKA 4P0PB 4MSMB 3GIMA 2KWDA 2PW9A 5KFXA 3MP9A 2V3NA 1J7AA 4C8OA 4DLGA 2KC2A 3HUIA 4OD0A 3U7DA 1YZ6A 3KOOA 2HBKA 5KL8B 2J0MA 2V9HA 4CF3A 1ZQPA 4HJKA 1XLNA 3NVWA 4S17A 5AEKB 3HM6X 3RT3B 1AQ6A 2O6VD 1V49A 3W1SA 3QUTA 2N7EA 1YQ3B 5L83A 2EAOA 2HJ1A 5KFUA 2L83A 5L1IA 4J9KA 1FRDA 4XGAB 4JWNA 3H1UA 2XK5A 4P4OA 1IPGA 4II2B 5AI0A 4FJYA 2F76X 3W9CB 2J0KA 4W9LA 1SJED 3ED5A 1PGXA 1T0SC 1FEZA 4YMNA 3Q14C 2JH7A 3IG8A 1ET9A 4ANXA 1YN4A 5AK3A 2BQUA 2A1AA 1XF5L 5ALXA 5BMHA 2LVQA 2N1VA 1HUZA 2HI0A 2ZXHA 4F3OA 2OHFA 3TI0A 2A1JA 4KZ0A 2K4EA 4C4SA 5J2KA 3GILA 1XWLA 1RXWA 4RNAA 2JXJA 1P1AA 1C77A 1LVHA 2KZRA 3SFEB 2DYBA 2DWQA 2XCPA 5J18A 3SAFA 3NJTA 4NZLB 1SE3A 5C23A 2W55A 1GB1A 1CQVA 3J9CA 4K3CA 2W9MA 5DB7A 3NHEB 8ICEA 3H9DA 9ICQA 5AM2A 1V86A 1GPXA 2K22A 5KT3A 2FUG1 1NZBA 4O3QA 4EZJA 4UATA 1XLOA 5DQHA 3KBBA 4QZCA 1XLQA 2JHDA 5KG3A 3P4QB 4YXJA 1COKA 1Q0WB 1L3VA 2K3UA 1N2XA 4RQ6A 2KZMA 1V1PB 4I2IA 2M0AA 4H2AA 1PVPA 1U9LA 2TSSA 3FAHA 1L7OA 4WJ3B 1UGMA 1OFFA 2LHEA 3K1ZA 4FZLA 5DG7A 2QKQA 1WGKA 4QNLA 2D3GA 5E6NA 5KT4A 2GBJA 4IWOA 1JWBD 2NPTA 3RULA 3PR5B 1UGJA 1GOZA 5AZFA 2YN4A 3KFUF 2Y9UA 3RNBC 1T8EA 1ZKHA 3I63C 5AM3A 2LM4A 2KVRA 4XYCA 1K5OA 4RQ0A 5KT5A 4DCCA 1OUQA 4MSQB 5LLIA 2CS4A 1ESFA 1V9JA 9ICHA 3DOWA 1NYRA 5KFDA 4CF4A 2W9BA 2V4QA 1X2IA 2BS2B 5KG4A 3N3KB 4WAAA 3VTWA 1FPYA 2OOBB 3H7PA 1J2MA 4X5VA 2JH1A 2JMGA 3WKDA 2HTHA 2IO1B 4KKIA 2XY6A 4MACA 3A0HU 5HP4A 4E74A 3ALRA 3PSTA 3HPOA 1SV0A 2ON8A 1HJPA 2DZIA 2R8KA 4JV1A 3TADC 1SL0A 1XXGA 4IR1A 9ICCA 2BDPA 1UBIA 1FXTB 3PSFA 3E58A 2J52A 3PTFC 2BWFA 1Y88A 3K75D 4XZ4A 2R8GA 1X66A 1IP9A 3BVZA 3QX1A 4KMUA 2LRUA 4RM8A 3HVDA 4NAWB 1ZXHA 4K7WA 1KRHA 2R2QA 1LFDA 2KFZA 5T8IA 1SEBD 1WIAA 4LJPB 3G6YA 3LYSA 5DB6A 2CKHB 4EFOA 2QHOA 4YSZB 1J0GA 3DV9A 2IOFK 8ICGA 1DYQA 1NK8A 4FHKA 1LM8B 4DK5A 8ICTA 2RMMA 4IUMB 3UXPA 2L8JA 2ZNVC 5ALTA 4C0ZA 4QZIA 4WQMA 3QQ8B 5ALZA 3WAPA 3RJIA 4M8MA 3P4SB 1GJZA 5J2RA 4M04A 5AK4A 5J0TA 2GO7A 1CEZA 1V5OA 2RDHA 4I2CA 4B9VA 1TYGB 2DENB 4M9JA 2ZIXB 4LLGM 2AU0A 4DQPA 5LXIB 1HIWA 4URKA 1ZJNA 1KM7A 2N0SB 3HW8A 2EDUA 1MA7A 2KZ3A 2Q5WD 4CDGA 3D2QA 2LPEA 2PFNA 2YMPA 3AE2B 4BFRA 1N48A 3WK9A 2WB1C 4JE3B 2HHVA 3IV6A 2BQ3A 8ICCA 2WXOA 3U7ZA 5KFNA 1ACCA 5ALEA 3MGIA 3R2IA 2LHTA 7ICHA 4J3OD 1L3TA 7ICRA 1R4MB 8ICHA 2D3BA 1YZ7A 1ET6A 4MJSB 4ECRA 4QZDA 3ZDDA 4GGQA 2XNAC 1SXDA 5FK9C 4Q8FA 3N9YC 4PJ0U 5CTRC 5CEHA 2Y0SC 5KFRA 4RQ7A 3QEAZ 1E0ZA 1BPZA 3CF6E 5AI4A 1Q8KA 4AOFA 4C4VA 3APDA 2QB0A 4P7IA 3W1YA 3LDZE 4B0MA 3AQFA 2F44A 3GIKA 1JWUD 2JPHA 3AE6B 3KWLA 3LYYA 4USAA 3RF9A 1CJEA 3I76A 3KH0A 5IILA 2KWVB 4A6QA 4CQNA 5D2MB 3RD2A 3RBDA 3NS1A 2F1IA 2IMWP 1WY8A 4IOIE 8ICWA 4AJYB 4IRCA 4RCOA 1ZQEA 3P1MA 1XEEA 4Y2TA 3C23A 2HVIA 4DFKA 1KEJA 2Z59B 3MR5A 1U4AA 1LB2B 4M9HA 4ECUA 4F4XA 1Z00A 3B0AA 4K81A 4ZYSA 4HPLB 3ISDA 2R8JA 4YN4A 2RP5A 1D8YA 2VH1A 5IIKA 2XEWA 4GN1A 3MFHA 4DFDA 2XVTA 3MFIA 1EUVB 4ZRJA 5KFZA 5J2EA 4Y2JA 4BKSD 2GLSA 4DQOC 1ZETA 1V1OA 4HJGE 2L00B 3MC9A 4EOYA 1XNSA 3OGUA 2MBOA 2ZCBA 3R9KA 5IIIA 3Q8PB 3M8SA 3C2KA 4LNKA 4I2AA 1RRBA 1OQRA 3B08A 3BQ1A 5F3XB 3QYPA 3Q8SB 1IBXA 4QIWC 2KD0A 2LI5A 1ZD4A 9ICMA 2KD1A 4IM2A 5D3IB 1KH0A 3VUXA 2F77X 5CJ7A 1WM3A 4RQ4A 4NPNA 4TV3A 2PPHA 3M9OB 4ITKA 2D5GA 2K6QA 4M01A 3U30A 4YMMA 1LV5A 2G1EA 5K4LA 4XRHA 1JW9D 2WWZA 4N58A 2WB1F 2DAJA 2GWSA 2XIDA 3C21A 4GIBA 2L3ZA 3N30A 9ICPA 4R64A 4OO1J 2KO3A 5D46A 2K8AA 4Y2PA 3I5JC 5DKWA 4UBCA 2WHIA 1ZQOA 1WX8A 1D8BA 3SEIA 3PSIA 4CF5A 1XO0A 3UF8A 1L3UA 1TK5A 3U26A 4EEYA 5KL1B 4DS4A 3ZNID 1CUKA 2ZIWB 1VZ8A 5IIJA 3AL0B 2Y0SF 3IHPC 2GH1A 2WGSA 4W9JA 3EFUA 3WIMA 4C00A 3OHBA 5DGBA 3RB6A 3H8MA 1QILA 3QX7A 1C1YB 2W3RA 4N6EB 1D5ZC 1T6BX 3A1QA 1ZQUA 2MBBB 3Q2AC 2KFKB 2BCSA 3RNAC 4I2FA 2FIFA 1HUOA 1QLNA 9ICGA 4YCXA 4AP9A 1A70A 4DF8A 2KQ4X 3VUYA 3WAOA 5BYQA 2L7RA 5GTHU 4CE6A 2KLGA 4F5PA 2G5IB 4Y2XA 4F93B 2ZUDA
chains in the Genus database with same CATH topology
2KAJA 1GAQB 4MM3B 3ZJTA 4US9A 1D4BA 1KLUD 2PMVA 2Z8LA 1HXYD 1I4PA 2JYEA 1NEKB 4MH8A 3TSSA 3TEZA 2JSVX 2Y3AA 1F2RC 4XE0A 4OZAA 1CK1A 1N61A 1E6EB 2ZW0A 2IPKD 2PTLA 3CIRB 3AB5A 1XO3A 2ZW1A 4N59A 1HEZE 1N63A 1N62A 3B2FA 2DYMA 2H88B 2NTTA 2BT6A 1C78A 2AX5A 1JWMD 3C8YA 4RH6A 4XDCA 5E6JA 4WH4A 1PDXA 2B76B 3SEBA 1KLGD 3IT4B 1AN8A 1QQRA 1HA5A 1C4CA 3W5UB 1JCKB 2WXLA 3T3OA 4KX6B 5BYSA 2WXNA 2WDQB 3AE7B 4DXGA 3VRBB 2E6XA 3ZJUA 1L6UA 1I4QA 1UNSA 4IKGA 3U2SC 2LEKA 1VR9A 3EA6A 3NVVA 4AQ7A 1EM7A 4MT5A 1YN5A 1WYGA 1UWXA 2JU6X 1K53A 1ENFA 3KQ4A 1E7PB 2X38A 2IGHA 3GS2A 1R7SA 3AE1B 3P42A 1C76A 3PZ7A 1SJHD 1BMLC 1FRRA 3BIID 5D7GA 2INPE 3NZ3A 1HZ5A 2JYTA 1F77A 2J53A 3NVZA 5JXVA 1BXTA 3V05A 2PIAA 1V97A 1KTKA 2CU3A 2SAKA 1TJEA 5AUIA 1TKEA 3BK1A 1MHXA 5I4DA 2K5PA 4C7YA 2I38A 2H89B 1YN3A 1C4PA 4M0WA 3UI3A 1EWCA 2VZKB 2QIEB 3LB8C 4EE2A 2WXMA 2ICIA 3R2TA 1FFUA 5GXGB 1YMHE 2BB5A 1WWTA 3VR8B 4KGRA 3BVGA 2BB6A 1FNVA 1QF6A 4GDLB 3OWEB 1FFVA 1FMAD 2W82A 1PUTA 5EE3A 1WRIA 5TSSA 2LUMA 4UDUC 3H8HA 3URYA 1YQ4B 3FILA 4PT5A 1TS5A 2MJ3A 1I4HA 1YNTE 1CZPA 2WNMA 1B9RA 2JXTA 1J7CA 4P16A 2FE8A 3ZQ4A 2NTSA 3AE5B 3P63A 5H92C 2E3TA 4TSSA 2QMTA 2WXGA 4AS1A 2K9XA 1E10A 3KLSX 1GB4A 4WURA 2EELA 4US8A 4O1NA 2MJDA 3FILB 4R3DA 1VZ6A 4TMAB 2WXHA 1FO4A 1VLBA 2WS3B 1SF0A 4HKZE 1V8CA 3W2DA 1NI3A 2WXRA 1DOXA 1ROEA 3BYYB 3GB1A 1C4AA 2BBCA 2GI9A 3BYTB 2WXKA 2N9LA 3SFDB 1SXTA 5LNK1 4LTUA 3BVMA 2WDRB 1TS2A 5FR3A 3B9JA 1QOBA 2IDYA 2JQRB 2LGIA 1NVID 4P6VF 2K0PA 2INNE 3I57A 3Q8CA 1DOIA 2JWUA 2BYTA 1FNUA 2ONQA 3NVYA 1K51A 2DBYA 2EKIA 1JMLA 3VR9B 4L2YA 4TQ1A 3PZ8A 1VDVA 2KWDA 2PW9A 5AUKA 4A9AA 3MP9A 2V3NA 1J7AA 1FXAA 1ZP0B 3HUIA 4YSXB 3AV8A 2WXIA 4REZA 1XLNA 3NVWA 2VZKD 3W1SA 3EUB2 1YQ3B 2J4XA 4ZRPA 3Q8EA 2ACZB 4OVZA 3DWMA 3IT6B 2L83A 1FRDA 1I7HA 4KGSA 2RDGA 3W9CB 2AQ1B 1KF6B 4OW0A 1KFYB 1YJIA 1QOFA 1SJED 4NAMA 3Q8BA 1PGXA 4RF0A 1ET9A 4OZBA 1YN4A 1PYWD 2LFIA 1XF5L 5BMHA 1JALA 2PVOD 3Q69A 1FIQA 2BS4B 1I4XA 2OHFA 1L0YB 3WCQA 1EWYC 3I9V1 1SBBB 1TY2A 1RFKA 4HROA 1QKZA 3KWVA 1EU4A 3BWUD 4RNAA 1AW7A 1C77A 3SFEB 2DWQA 3DWGC 3AH7A 1AWDA 4NZLB 3MJ5A 1SE3A 2W55A 1GB1A 1HZ6A 2M56B 1QT9A 1CQVA 3J9CA 2L1AA 1V1PA 1N60A 3HVZA 2WU5B 4YTMB 1GPXA 2MJEA 2K22A 3U4EG 1YJJA 2FUG1 4JWSC 4YSYB 1XLOA 1SE4A 3IAS1 2WP9B 1PGBA 4C7ZA 1QOGA 1XLQA 1RWSA 4D2KA 2WXPA 2PLPA 4XDDA 3E56A 3P4QB 2DYOA 4NJCA 2K3UA 3Q8AA 3ZYYX 4C56C 2WDVB 2WXQA 1V1PB 2M0AA 4H2AA 3T3NA 1Q10A 2IGDA 2TSSA 3FAHA 1K50A 4C80A 3BZDB 4RGNA 1OFFA 2QSDA 2WXJA 2LHEA 1K52A 2SEBD 1WGKA 2PKOA 2L32A 2N7JA 3VQIA 4LK0M 4A55A 3P4RB 2R61A 1XCQL 1JWBD 2W3SA 2KN4A 4OZCA 1L5PA 1UGJA 1GOZA 3PO0A 1IUEA 4RGTA 5G5HA 3TEYA 1UUPA 2MEKA 1FEHA 3P4PB 1ZOYB 4YWGG 3AN1A 1L6VA 2W54A 2N9KA 4HRSA 1F2RI 1ESFA 1FCCC 4WWMA 2I2YA 5C2TB 1C9FA 1NYRA 1XCTL 3Q8FA 4YT0B 1HQRD 2BS2B 4ARCA 1P7EA 2WXFA 3IAM1 5FKAC 1I4GA 3FC4A 1N5XA 4KKIA 4MACA 2JX5A 1D5XC 3E9SA 2YEPF 1E9MA 4KGTA 2XN9C 2ON8A 5EE1A 1JQ4A 3AE4B 1ZDXA 3AECB 3CWIA 3RPFC 4ARIA 1N5WA 2MH7A 2WQYB 1XXGA 2LJIA 2BW2A 3RFZB 4B0EA 2DLBA 3EGRA 4KKJA 2J52A 2LMCA 1FCLA 1T3QA 4XWWA 1ZE3D 3BVZA 1QOAA 2FBWB 1TS4A 2BS3B 1ZUD2 1FXIA 3HVDA 4NAWB 1FM0D 1ZXHA 3HRDD 3SR6A 3AE3B 1KRHA 2IGGA 3ETRA 5T8IA 1SEBD 3MC0B 5HI1A 2PVGC 2WLBA 4YSZB 1TS3A 4Q2JA 1DYQA 1MVKA 1P7FA 2RMMA 1WSPA 2L52A 4GDKB 4L23A 4IDIA 4WQMA 4TQ0A 5HG2A 3P4SB 3AEFB 1SE2A 1AYFA 3B2GA 1MHHE 3AE8B 2RDHA 1T5XD 1TYGB 1TY0A 4JWUC 1MPEA 4LLGM 2GRIA 3MHZA 3V3XA 2CJOA 2N0SB 3AEDB 1BUIC 2Q5WD 1L0VB 1DOYA 1JROA 1LO5D 3AE2B 1OQQA 3AEGB 4JE3B 2V3PA 2WXOA 3U7ZA 1F0ZA 1ACCA 4YTPB 1UWMA 4RF1A 4RGMA 1IGCA 3R2IA 5D3DA 4J3OD 4ZOHC 1ET6A 1M4VA 3TEXA 4JPSA 1JRPA 5BMIA 2XNAC 5HHDG 3W5VB 4A90A 2NMQA 3N9YC 2LHDA 1SSNA 1C79A 1E0ZA 1D6EC 1JWSD 3U52E 2HTME 1RM6C 4B0MA 1TKYA 1JWUD 3AE6B 3KWLA 3LYYA 4USAA 1CJEA 5EE9A 4RFBA 4A6QA 4CQNA 2QILA 3NS1A 2IJ0A 4IOIE 4RCOA 1MI0A 4FXCA 2YEPB 1DGJA 3P1MA 4WIPA 4A8XC 1XEEA 1ZXIA 3TUOA 2M19A 1EU3A 1QLBB 4YTNB 1ZDVA 1L4ZB 1D5MC 2JZPA 2WU2B 4ZYSA 3L4PA 4HEA1 2QJLA 3MFGA 2RPVA 2GB1A 4ZHOA 5C3JB 5BYRA 3ABVB 3AEAB 3NUHB 2KDMA 2HDEA 4DQOC 4DXFA 3ZJVA 1V1OA 1WXQA 4HJGE 1VJKA 1VRAB 4L1BA 4ZHPA 3TEWA 4RGOS 1NYQA 1OQRA 2V4IB 3O13A 3AEBB 1STEA 3ZGZA 1IGDA 2BTEA 2J42A 1IBXA 2G9HD 1L0XB 5HFYA 5D3IB 1KH0A 3AE9B 1L4DB 4ZRQA 1ZPSA 5G5GA 4XWTA 4ITKA 2D5GA 2G1EA 3GP7A 1JW9D 4N58A 2KMMA 3BK2A 2KACA 4OHJA 5EE0A 2V0GA 1IBXB 1XLPA 3AEEB 4JX1C 1SB3C 1SIJA 2OEDA 3VRAB 3AM9A 1VZ7A 1PFDA 1VZ8A 2CJNA 1Y56A 4YXDB 1I4RA 2AQ2B 5MPOA 1FNWA 1JWAD 1TZOA 1B1ZA 1J7BA 1QILA 1TKGA 2W3RA 2AQ3B 4N6EB 1NENB 1D5ZC 1RYJA 1T6BX 5H8YE 3R8BA 1PGAA 4HKQA 2Y5PA 4GLSC 3NRZA 2KQ4X 1A70A 2Y5CA 5BYQA 2QEJC 3IXSA 5BMGA 3LXFA 4WAFA 3AMZA 5FK9C 1FD6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K9X A;  1E10 A;  2KAJ A;  1E0Z A;  3FAH A;  1GAQ B;  4C80 A;  4US9 A;  1OFF A;  2HTM E;  4US8 A;  2MJD A;  1RM6 C;  1WGK A;  2PKO A;  1NEK B;  1TKY A;  1FO4 A;  1VLB A;  2WS3 B;  3AE6 B;  1SF0 A;  1JWB D;  2W3S A;  1V8C A;  4USA A;  1CJE A;  3KWL A;  5EE9 A;  1L5P A;  1GPX A;  1NI3 A;  1DOX A;  1N61 A;  3NS1 A;  1ROE A;  3PO0 A;  1IUE A;  5G5H A;  1E6E B;  3P4P B;  1ZOY B;  1DGJ A;  3CIR B;  3P1M A;  4FXC A;  3AN1 A;  1L6V A;  3SFD B;  1ZXI A;  4LTU A;  2W54 A;  3AB5 A;  3AE2 B;  2M19 A;  4HRS A;  2WDR B;  1XO3 A;  3B9J A;  1QOB A;  2JQR B;  4N59 A;  4WWM A;  1N63 A;  1N62 A;  1QLB B;  3B2F A;  2H88 B;  4YTN B;  5C2T B;  1NVI D;  4P6V F;  2BT6 A;  1NYR A;  2AX5 A;  4YT0 B;  2WU2 B;  2BS2 B;  1DOI A;  1PDX A;  2B76 B;  3NVY A;  3L4P A;  2QJL A;  3FC4 A;  1N5X A;  2DBY A;  3W5U B;  4ZHO A;  2EKI A;  3VR9 B;  5C3J B;  2JX5 A;  3ABV B;  3AEA B;  4KX6 B;  1E9M A;  1JQ4 A;  1VDV A;  2WDQ B;  3AE4 B;  3AE7 B;  5EE1 A;  3AEC B;  3CWI A;  5AUK A;  3RPF C;  4A9A A;  1J7A A;  3VRB B;  1N5W A;  1FXA A;  1ZP0 B;  1WXQ A;  3HUI A;  2MH7 A;  1L6U A;  2WQY B;  1VJK A;  4YSX B;  3AV8 A;  2LEK A;  4ZHP A;  1XLN A;  3NVW A;  3NVV A;  1NYQ A;  1OQR A;  3AEB B;  3EUB 2;  3P4R B;  1T3Q A;  1WYG A;  1YQ3 B;  1QOA A;  2ACZ B;  2FBW B;  3DWM A;  2BS3 B;  1E7P B;  1ZUD 2;  1FXI A;  2L83 A;  1FRD A;  1I7H A;  1FM0 D;  1R7S A;  3AE1 B;  3HRD D;  3SR6 A;  3AE9 B;  3AE3 B;  1KRH A;  3ETR A;  5G5G A;  3W9C B;  1FRR A;  1KF6 B;  2PVG C;  4ITK A;  2WLB A;  3BII D;  1KFY B;  1YJI A;  1QOF A;  4YSZ B;  2G1E A;  2L52 A;  1JW9 D;  4N58 A;  4IDI A;  4WQM A;  2KMM A;  3NVZ A;  5EE0 A;  1JAL A;  2PVO D;  3P4S B;  1FIQ A;  2BS4 B;  3AEF B;  1AYF A;  1V97 A;  1XLP A;  2CU3 A;  2PIA A;  2OHF A;  3AE8 B;  3AEE B;  1TJE A;  1EWY C;  3B2G A;  4JX1 C;  5AUI A;  1TKE A;  3WCQ A;  1TYG B;  1SB3 C;  4JWU C;  1RFK A;  1SIJ A;  4C7Y A;  2K5P A;  4HRO A;  2H89 B;  3SFE B;  3VRA B;  2DWQ A;  2CJO A;  2N0S B;  3DWG C;  3AH7 A;  1AWD A;  2QIE B;  3LB8 C;  3AED B;  5GXG B;  1FFU A;  3AM9 A;  1PFD A;  4YXD B;  2W55 A;  2CJN A;  1WWT A;  2M56 B;  1QT9 A;  2Q5W D;  3VR8 B;  1L0V B;  5MPO A;  1QF6 A;  1DOY A;  1JRO A;  1N60 A;  3HVZ A;  1JWA D;  1OQQ A;  1FFV A;  1FMA D;  2WU5 B;  1PUT A;  1J7B A;  1WRI A;  2K22 A;  1YJJ A;  2MJE A;  3AEG B;  5EE3 A;  1TKG A;  1F0Z A;  2W3R A;  4N6E B;  1NEN B;  1YQ4 B;  1RYJ A;  1UWM A;  4JWS C;  1XLO A;  4YSY B;  4YTP B;  5H8Y E;  2WP9 B;  2MJ3 A;  4C7Z A;  1CZP A;  1B9R A;  4ZOH C;  1QOG A;  1RWS A;  1XLQ A;  4YTM B;  3NRZ A;  1J7C A;  1A70 A;  3P4Q B;  2Y5C A;  1JRP A;  3AE5 B;  3P63 A;  5H92 C;  2E3T A;  3ZYY X;  3W5V B;  3LXF A;  2WDV B;  3AMZ A; 
#chains in the Genus database with same CATH topology
 4Y2U A;  4PGX A;  3RB4 A;  4YR0 A;  1YD8 U;  1NK9 A;  1D4B A;  3KUZ A;  2EKE C;  3GFK B;  3W1S C;  3LVW A;  4JUZ A;  1A6S A;  3L16 A;  1I4P A;  1BGX T;  4CCH A;  1ZQK A;  4FJZ A;  4ELV A;  3ZDE A;  2N1R A;  2Y3A A;  2XY7 A;  2MBE A;  3T3F A;  4F1S A;  1KOT A;  1E6E B;  2ZW0 A;  2J6U A;  2IPK D;  2H3Q A;  3WK7 A;  3WAN A;  5DBA A;  3AB5 A;  2ZXI A;  1KFT A;  2PI5 A;  3N97 B;  4M8N A;  1XD3 B;  2DYM A;  4KLO A;  2LVP A;  2ZNV B;  4FJV B;  1SIF A;  1S0M A;  2JEF A;  1KDH A;  1JWM D;  3C8Y A;  4RH6 A;  3UIO B;  7ICV A;  3PX4 A;  2KKV A;  2A4Z A;  9ICU A;  4WWP A;  3V6E B;  3RAX A;  2B76 B;  4F8C B;  3PZP A;  3IT4 B;  5J2D A;  4JQW C;  2HW3 A;  4Z6F A;  3PW4 A;  1C4C A;  1JCK B;  4R66 A;  4BDP A;  4M47 A;  2G5H B;  3SYZ A;  3ONS A;  2WXN A;  4CYE A;  4QZH A;  3VRB B;  4TUQ A;  1I4Q A;  4HCN B;  2XIC A;  4RPY A;  1NJX A;  2KJH B;  3AI5 A;  4C8M A;  2GOW A;  5ALJ A;  3ZRF A;  4EZK A;  3QHT A;  1LKY A;  3SV4 A;  2KFJ A;  3H40 A;  1K53 A;  1IIP A;  5F9L A;  1O03 A;  1TV9 A;  4M9L A;  1Z4N A;  1E7V A;  2BYV E;  3GS2 A;  5DB9 A;  5DCN A;  4TUP A;  3TIX A;  2NRW A;  1D9F A;  3GV8 B;  1BML C;  1FRR A;  2KDI A;  1SV4 A;  3OJ4 B;  2KWU B;  2INP E;  3RJE A;  3B1L X;  3OAW A;  2MWS B;  1C7Y A;  5FR6 A;  9ICB A;  8ICY A;  1ZQX A;  5JXV A;  1S9F A;  5KFS A;  1TE2 A;  3V7L A;  1BXT A;  2C7H A;  1WZ0 A;  3EFC A;  3X23 A;  2MLB A;  3P2B A;  2ZCC A;  4GDL A;  3M8R A;  2PIA A;  3V05 A;  3WAM A;  1R4M I;  1MQ3 A;  1TJE A;  2NBU A;  5I4D A;  4OCZ A;  2OM6 A;  4C7Y A;  3V6H A;  2ZTD A;  5L95 C;  1IV8 A;  1C4P A;  3ISC A;  4O5K A;  5KFA A;  2MUT A;  2V4R A;  1S10 A;  1OGW A;  4EE2 A;  4IS7 A;  2ICI A;  1FFU A;  3E0F A;  3RNF C;  1Y8R C;  2WX0 A;  3VR8 B;  4M02 A;  3BVG A;  1FNV A;  1ZRM A;  1FFV A;  4PGQ A;  5D49 A;  1PUT A;  2KIC A;  1V85 A;  1RFA A;  2LUM A;  2NRV A;  4UAV A;  3LWL A;  2KKC A;  3FIL A;  3M7D A;  4DOB A;  2FAZ A;  2MJ3 A;  4PHA A;  1I4H A;  1YNT E;  4I29 A;  3H0L B;  2KC1 A;  2WNM A;  4N9F 4;  1SV0 C;  3V60 A;  2KQS A;  3EWA A;  4P16 A;  3AUO A;  2WF8 A;  2FE8 A;  3ZQ4 A;  1KTQ A;  4LNN A;  3AE5 B;  3P63 A;  5H92 C;  2E3T A;  1T0Q C;  2WXG A;  3TCA A;  2REX A;  2YLM A;  2K9X A;  1E10 A;  4Y2R A;  3WK6 A;  3CP8 A;  1V6E A;  3UIP B;  1U4B A;  3H7I A;  4WUR A;  1OQY A;  4AJW A;  3EW9 A;  4US8 A;  4O1N A;  2ZUB A;  1N56 A;  4TMA B;  1SKW A;  1KQQ A;  4UBB A;  4FBT A;  1SF0 A;  2RPQ A;  3VXW A;  4LNI A;  1RYU A;  2AXT U;  1NI3 A;  2DKX A;  2WXR A;  3A9K A;  4IWP A;  1DOX A;  1ROE A;  4ZYN A;  3BYY B;  1L2N A;  3GB1 A;  4U7C A;  3NZU A;  3MBY A;  2WXK A;  3UQA A;  4ZRI A;  5LNK 1;  3BVM A;  5ALI A;  1TS2 A;  2FUH B;  1QOB A;  2IDY A;  5HKH A;  2IOH A;  2D2Q A;  2W9N A;  1NVI D;  4P6V F;  2BDU A;  3ZXR A;  2INN E;  5ALU A;  2JWU A;  1VD2 A;  3ZKJ C;  3VH4 B;  3NVY A;  2YB4 A;  1MSW D;  1MFW A;  1WMH A;  4WJQ A;  2DBY A;  2PMZ C;  3G6V A;  2EKI A;  1JML A;  2LWP A;  3PO5 A;  1NKB A;  1ED1 A;  4AP4 C;  4UAY A;  5J2C A;  2VKQ A;  2PE6 B;  5AUK A;  2IZV B;  1CRX A;  1L8L A;  4LNO A;  1GC6 A;  2L0F A;  4WWN A;  3QU9 A;  3KHH A;  2WXI A;  4W9D A;  4KN4 A;  2EAM A;  3PY8 A;  5AK5 A;  3PLV A;  1I42 A;  5DPT A;  3D2S A;  1WGD A;  3RCZ A;  5J17 A;  1WH3 A;  3HT3 A;  4DL4 A;  2NRT A;  4II3 B;  4KGS A;  3OJU A;  5AKI A;  3VH3 B;  2BKR B;  5DLF A;  4LNF A;  2RDG A;  3DVN U;  2BPF A;  1TIF A;  2G4S A;  1TAM A;  1KF6 B;  1ARO P;  1RDF A;  8ICF A;  1X9W A;  1QOF A;  4K7U A;  3Q8B A;  4NAM A;  4IW0 A;  4LVS A;  3H8W A;  2RGF A;  3OJ3 A;  2LFI A;  3RYT A;  4B9N A;  4ZDV A;  2YMM A;  3Q69 A;  3GQC A;  3F2C A;  2BS4 B;  3M9M B;  1I4X A;  3MDA A;  1L0Y B;  4ZRK A;  3I9V 1;  2XK5 B;  3T5L A;  1E7U A;  1SBB B;  1QKZ A;  1EU4 A;  5KG1 A;  5ALY A;  4ECQ A;  4NQL B;  2RSU A;  2AWT A;  5CX3 A;  2WAQ F;  3PR4 A;  1PZN A;  1U47 A;  4RMA A;  1I35 A;  1SL2 A;  1ZW7 A;  4QW9 A;  2DQN B;  2MJE A;  3U4E G;  2PJH A;  2A1J B;  3KZI U;  4GXJ A;  1NI2 A;  4F5R A;  4G9B A;  4Z6D A;  2KT7 A;  3THV A;  2WP9 B;  1U49 A;  1PGB A;  3AU4 A;  1RWS A;  5AKY A;  5AZH A;  3CRX A;  2G06 A;  4QZF A;  2KTQ A;  2MBQ A;  3ISB A;  3DHI C;  3T3N A;  4PS8 A;  3JPR A;  1Q10 A;  3HX0 A;  4C80 A;  1SWV A;  2M0X A;  4RGN A;  4F92 B;  3M63 B;  5J0X A;  4PGY A;  2WXJ A;  3PS6 A;  3SDL C;  5IIM A;  3MR2 A;  3R7Q A;  1Q3U A;  2N7J A;  4DFM A;  4A55 A;  1E5W A;  5HNK A;  2AL6 A;  2KHV A;  3P4R B;  2W3S A;  3IG3 A;  4OZC A;  3RTV A;  4KLL A;  4EEN A;  1KLV A;  3PO0 A;  5G5H A;  3PHX B;  5ALH A;  4HDO A;  1UPH A;  1ZQI A;  4YWG G;  3HK0 A;  4HPP A;  3UMC A;  2W54 A;  1PQS A;  2O2V A;  3KHR A;  2KAN A;  2I2Y A;  5C2T B;  2XBB C;  4DOC A;  5AM1 A;  3QZ8 A;  1HQR D;  1P7E A;  1ISN A;  2NPT B;  2JRI B;  2LYA A;  1F1H A;  5HHH A;  2UYZ B;  1I4G A;  1G6J A;  3FC4 A;  1N5X A;  3ENE A;  3R66 C;  4NM1 A;  4RQM A;  1S97 A;  5DDM A;  2JX5 A;  1D5X C;  1ZQ1 C;  1ZQH A;  2KLC A;  5L1J A;  2XN9 C;  3GOE A;  2ZPN A;  4JGH B;  4JB3 A;  5EE1 A;  1JQ4 A;  5L1M A;  3AEC B;  3RPF C;  5J8Y C;  3F53 A;  1N5W A;  5ALR A;  3PW7 A;  1ZQD A;  4C8N A;  2W9B B;  2WQY B;  3B0X A;  2BW2 A;  3RFZ B;  3HM3 A;  3H7P B;  1T3N A;  3L3F X;  2NRZ A;  4Z6E A;  2OYY A;  4KKJ A;  4LZD A;  2KTF A;  2LMC A;  2E8M A;  4NJ6 A;  4XQ8 A;  1QOA A;  5EWG A;  1ZUD 2;  2D3C A;  4IQT A;  3HRD D;  3WKA A;  2M8S A;  3AE3 B;  2IGG A;  4MGZ E;  3ETR A;  2INC C;  2XC9 A;  3WK4 A;  5HI1 A;  2KK8 A;  3N1X C;  2ODG A;  4PYZ A;  4BUG A;  1JX4 A;  3PVX A;  1UZX B;  4KDI C;  1MVK A;  1P7F A;  4L23 A;  4IDI A;  2KJ6 A;  3A0B U;  3F5E A;  3B0Y A;  1SE2 A;  1MHH E;  2BZF A;  3AE8 B;  5C1Z A;  1GUA B;  3QAQ A;  2KJ5 A;  4JWU C;  2NO4 A;  2OCE A;  4RQ2 A;  1SKS A;  7ICU A;  3FKY A;  2FI1 A;  4KLH A;  3SZ2 A;  2LAS A;  2CJO A;  3NOB A;  2E8P A;  2ZTC A;  4IM3 A;  4HCP B;  1GG3 A;  4PH5 A;  2WF5 A;  3QAR A;  1DOY A;  1JRO A;  2CXY A;  3RJJ A;  4UAW A;  1OQQ A;  3N20 C;  7ICO A;  5EDS A;  1BPX A;  2PI4 A;  4YTP B;  4NL9 A;  2HHQ A;  2OJR A;  3QU5 A;  4ZOH C;  5JH5 C;  9ICO A;  2J6S A;  3TEX A;  3N32 A;  2KXJ A;  1JRP A;  2D3D A;  4OJL A;  3APC A;  5HHD G;  4A90 A;  2NRX A;  2BGW A;  2NMQ A;  4OVU A;  2LHD A;  1AAR A;  4RPZ A;  1TBE A;  1YJ1 A;  1D6E C;  4ED7 A;  4F2R A;  1J19 A;  3TBL D;  2EMS A;  3JYU A;  5DG8 A;  4P0Q A;  2MW5 A;  5ALM A;  4YFK A;  2LYH A;  5EE9 A;  2V9W A;  2KVC A;  2XGP A;  5KT6 A;  2XCA A;  3SEN A;  4FXC A;  1DGJ A;  1E8Y A;  4WIP A;  3GIJ A;  2LGD A;  2W7O A;  2HOF A;  5C0Y A;  2Y1J A;  4C4V B;  3DBS A;  2C7M B;  2QB0 B;  1EU3 A;  4RQ8 A;  1QLB B;  5KFM A;  1X6J A;  2VIX A;  3JPN A;  1ZDV A;  2ISO A;  1L4Z B;  2ATL A;  3PVL A;  2WU2 B;  2NR2 A;  3K4G A;  4LZG A;  2F1H A;  2WF7 A;  3L4P A;  4YR2 A;  2KHW B;  4HEA 1;  3SAG A;  1YIW A;  4GIV A;  4CO7 A;  1E90 A;  4BOS C;  3ABV B;  3AEA B;  3ZNG C;  2ISP A;  4FS1 A;  3ONN A;  3SD7 A;  3OG5 A;  1UD7 A;  1NOM A;  4NLG A;  2FCQ A;  3KHL A;  3HP6 A;  4DFP A;  2ZVN A;  1Z00 B;  4PL2 A;  1VJK A;  4ZHP A;  5TZV A;  3NUQ A;  4O5E A;  2KMA A;  1A5R A;  4XA5 A;  1V2Y A;  4RGO S;  3C1Z A;  3MGV A;  2V4I B;  1L7Y A;  4FBJ B;  1IGD A;  4EUT A;  4DHZ B;  1Q46 A;  4I6L B;  2FDR A;  3BQ7 A;  4DSI A;  1L0X B;  4TQS A;  1PK3 A;  1X9S A;  8ICA A;  3H0R B;  2NO5 A;  4XWT A;  1NDD A;  3SHQ A;  2D07 B;  3L5K A;  4E71 A;  2MX2 A;  5JUM A;  2KMM A;  1Q1O A;  4RT2 A;  5AKJ A;  4B9T A;  2DKZ A;  2DUY A;  2JGA A;  2K60 A;  5CRX A;  1Z1B A;  5J0R A;  1T0Y A;  1X1M A;  2HE7 A;  1IBX B;  4TUU A;  1K1Q A;  2DF4 B;  9ICS A;  1SB3 C;  3RJG A;  5ALD A;  2IY0 B;  1JXL A;  2G45 B;  4HWI B;  2M17 A;  3PT2 B;  4P1B C;  3MHS D;  4YXD B;  1PFD A;  1Y56 A;  2CJN A;  1X42 A;  1I4R A;  4HYK A;  4PK1 A;  4X57 B;  3KD3 A;  5MPO A;  2QDF A;  5AIA A;  1ZQS A;  5BOM A;  3WU2 U;  1J7B A;  3ZW3 A;  3S6J A;  1TKG A;  1NEN B;  1RYJ A;  1J8C A;  2BQR A;  2HVH A;  3PMN A;  2R8H A;  1PGA A;  3DVN V;  3RH6 A;  1ZQT A;  4F4W A;  2Y5C A;  4ECY A;  2R18 A;  4NY0 A;  2EMT A;  3QCA A;  4DL5 A;  5AKX A;  4RUA A;  3C2L A;  3OJS A;  2FPM A;  4DL2 A;  3EC8 A;  2ESE A;  3PSE B;  4PS3 A;  5KHO A;  4DOA A;  2KAJ A;  3T9L A;  3GV5 B;  1FD6 A;  1GAQ B;  1RPL A;  4QZA A;  5CB1 A;  3ZJT A;  3M6Z A;  5C5J A;  1KLU D;  4J9P A;  5EWE A;  1WR1 A;  4O0I A;  3A1Q B;  4KLU A;  3A4R A;  1SGH A;  3LJ3 A;  2JYE A;  3ZDM C;  4NLK A;  1NEK B;  2OWO A;  4K3B A;  4ACF A;  3TSS A;  4ANW A;  3C2M A;  4G3X B;  3RRG A;  5HMM A;  3PX6 A;  5AIC A;  2W11 A;  4F8R A;  1NJW A;  1WXV A;  3CIR B;  1ZOL A;  2A19 A;  5AKE A;  4RU9 A;  4OJP A;  1XO3 A;  2ZW1 A;  2W8L A;  4KSK C;  1L8O A;  5J0Q A;  2H88 B;  2NTT A;  2ZIV A;  5DBB A;  5E79 U;  1ECW A;  1KRP A;  4M00 A;  4DSL A;  4WH4 A;  1TT5 B;  2OH2 A;  4KIK A;  2ZJ5 A;  4ACO A;  5CHV C;  1KLG D;  1AN8 A;  5CA7 A;  3OPX A;  2RQ5 A;  4XC2 A;  3BZK A;  3UM9 A;  3T3O A;  2WXL A;  3VTV A;  3H8J A;  3PHW B;  3IG5 A;  4RNM A;  2Z7J A;  2Y1I A;  4Y2V A;  1PUZ A;  1LXD A;  4YMO A;  2PKE A;  3ZDA A;  3CMM B;  2E6X A;  5L9X A;  2I9G A;  4CRX A;  3U2S C;  2LEK A;  4BZA A;  2RHF A;  2L5Y A;  4AYB F;  5EWF A;  3IRU A;  1X9X A;  2KX0 A;  5A0L A;  2PFP A;  3BDP A;  2F2A B;  5GTI U;  4DQI A;  1EM7 A;  1TZ1 A;  2DPI A;  1ZYQ A;  2H3F A;  2E8N A;  4GLX A;  4EYH B;  2JU6 X;  1JI7 A;  5AIB A;  1E7P B;  5AHX A;  3UIN B;  1R7S A;  3PLU A;  3PZ7 A;  3WKB A;  2MSE D;  4LJX A;  1KN5 A;  3BJY A;  4QWD A;  3M9N B;  4B6W A;  1WRD B;  4R8U A;  4EX6 A;  4PHP A;  5KAF U;  3NVZ A;  3RR7 A;  2J53 A;  1LKY B;  4KV2 A;  1GNU A;  7ICI A;  3PV8 A;  2UVU A;  5KFV A;  3ZI4 A;  1V97 A;  4NM2 A;  2BR0 A;  2FMQ A;  3H6N A;  1B0X A;  3DEE A;  4YXM A;  4NJ8 A;  1MHX A;  2LRW A;  5KFY A;  1V81 A;  3WK5 A;  2I38 A;  4FAD A;  4FFD A;  3NG0 A;  3D6J A;  2FMP A;  2JF5 A;  2DAF A;  2VZK B;  1S77 D;  2QIE B;  4IC7 B;  4M0W A;  3C29 A;  5GXG B;  1DK3 A;  1YMH E;  3ZLZ A;  3PO4 A;  1WWT A;  3N1Y C;  5GMV A;  4EYI B;  5BO4 B;  7ICG A;  4RNO A;  1WJ4 A;  2L76 A;  1QF6 A;  2K6D B;  5E6O A;  2LI6 A;  4GDL B;  2HDO A;  5TSS A;  4UDU C;  3URY A;  1RZT A;  1QSL A;  2MHJ A;  2D6F C;  1X6I A;  4I2J A;  2BPC A;  1CZP A;  2JXT A;  3D32 A;  2MUT B;  3C1Y A;  3Q8R B;  4QZG A;  2NTS A;  3K9P B;  3RB3 A;  2QMT A;  1S0N A;  4AS1 A;  1Z4O A;  1UEL A;  5KHQ A;  2LXC A;  8ICO A;  2LVO A;  4KN7 A;  3UMG A;  2WX1 A;  4Z6C A;  3G6X A;  5KTQ A;  1YOV B;  3FIL B;  4R3D A;  1VZ6 A;  1F5S A;  2WXH A;  4FUL A;  1FO4 A;  4R65 A;  2H3I A;  3W2D A;  3HIL A;  2KVZ A;  2LKY A;  2MBH A;  4GC6 A;  2ZG6 A;  2GI9 A;  3BYT B;  1IXR A;  3SFD B;  4B95 A;  2AL3 A;  2BCU A;  8ICI A;  4UAU A;  2WDR B;  5FR3 A;  5AM0 A;  2LGI A;  1UQV A;  3EEC A;  1SXE A;  4ICU A;  4RM9 A;  2VJ5 A;  2BF8 B;  3UQ0 A;  3MR3 A;  3ZNH B;  4C8L A;  3Q8C A;  2KN7 A;  4NJ7 A;  4BKG A;  3A9K B;  2BYT A;  1FNU A;  2ONQ A;  1H4R A;  1S0V A;  2BPG A;  3KYC D;  2KZZ A;  2CHZ A;  3K9O B;  3VR9 B;  4L2Y A;  2AJQ A;  1NK0 A;  3UGB B;  1B43 A;  2GBN A;  3PZ8 A;  3RRH A;  1J97 A;  1VDV A;  1DOQ A;  1YX6 B;  4FN2 A;  3H8S A;  1FXA A;  1ZP0 B;  5HHI A;  2KWC A;  4YSX B;  4REZ A;  3UXO A;  4B6J A;  4HLE A;  2VZK D;  5DPW A;  4NL9 C;  9ICI A;  5L1K A;  1WE6 A;  2JWZ A;  1WMH B;  3DPD A;  3EUB 2;  2PE9 A;  2J4X A;  3Q8E A;  4OVZ A;  1K1S A;  2NCN A;  3DCG A;  5TR5 A;  4YD2 A;  1I7H A;  2LJ5 A;  4GOC A;  1Q3V A;  4OJO A;  4GFJ A;  2AQ1 B;  2ZJ8 A;  3CYM A;  4PPX A;  4OW0 A;  1YJI A;  5JTI A;  4OZB A;  9ICV A;  1JIH A;  1PYW D;  3H4D A;  2JUO A;  2KOB A;  3GZN I;  4TQR A;  1JAL A;  2PVO D;  1FIQ A;  5H2F U;  2YX8 A;  1UH6 A;  2J6T A;  1RFK A;  2B3A A;  1MG8 A;  1AW7 A;  3JSV A;  4O3R A;  3DWG C;  4DL6 A;  2JT4 B;  4UB8 U;  2W03 A;  1OTR B;  2KYW A;  2M1M A;  3MJ5 A;  3TAC B;  1S3S G;  1HZ6 A;  2M56 B;  2H5X A;  1P98 A;  2HHT A;  1QT9 A;  1BPB A;  2L1A A;  4DQR A;  3L54 A;  5ALS A;  4BXO A;  4B9L A;  2F8L A;  7ICM A;  2WU5 B;  3QUC A;  2E5S A;  4YTM B;  3M95 A;  1T0R C;  2BGF A;  4JWS C;  3ZRC A;  1SE4 A;  2YTU A;  3RAQ A;  4I2H A;  8ICQ A;  1QOG A;  5JHB A;  3ZDT A;  3AQE A;  4UAZ A;  2WXP A;  4HK2 A;  2BYF A;  4KMO B;  3E56 A;  2EAP A;  1WI0 A;  4KLG A;  3Q8A A;  4F5O A;  4F91 B;  3BZC A;  4W9F A;  1L5U A;  2IGD A;  5J2A A;  1PK1 A;  4UAS A;  1WJU A;  1XSL A;  4JWM A;  2QSD A;  2SEB D;  1K52 A;  2L32 A;  4LK0 M;  1WWU A;  3ETL A;  1Q5W B;  8ICK A;  1XCQ L;  9ICK A;  2KJ9 A;  3LVV A;  2IY1 B;  2LD9 A;  4RGT A;  2QC8 A;  5J2I A;  3TEY A;  1UUP A;  3P4P B;  1KL9 A;  1T94 A;  1DK2 A;  1L6V A;  3KW5 B;  1WCN A;  5KFL A;  1DGS A;  2N9K A;  2KIV A;  1F2R I;  2M0N A;  4WWM A;  1TAQ A;  1TGZ B;  2EH9 A;  1XCT L;  3RNG C;  2W9A A;  1B22 A;  3LDA A;  1SZP A;  2WAQ C;  2WXF A;  3IAM 1;  5AM4 A;  4J9S A;  4O9M A;  1WFY A;  3HKZ F;  5FKA C;  2DZJ A;  2P6U A;  2G4D B;  4PHD A;  2BCV A;  1SWW A;  4ECZ A;  1DRG A;  4ASW C;  1BVS A;  2YEP F;  1B4F A;  1X9M A;  5G2N A;  2O2V B;  4KGT A;  4EEW A;  2ASQ A;  4HPM B;  3R3M A;  4PYU A;  1XS9 D;  3U8Z A;  3VTU A;  2WTF A;  3WAL A;  3KTQ A;  3HWT A;  5J0S A;  2HMX A;  2N9P C;  3O65 B;  4DEZ A;  3C5F A;  2ZIU A;  5AM5 A;  4G50 A;  1BPD A;  4DQQ A;  5JRT A;  5D6J B;  3FYH A;  2DLB A;  4KX3 A;  3EGR A;  4GDK A;  4DO9 A;  8ICB A;  5CP2 A;  4PHE A;  2F8K A;  2KDE B;  4YQW A;  1FCL A;  4RUC A;  1Z2M A;  4XWW A;  1ZE3 D;  2AQ0 A;  1WX7 A;  2FBW B;  2BS3 B;  2M9N A;  3RNE C;  4ECT A;  3DVG Y;  4CGZ A;  1FM0 D;  4EBC A;  3SR6 A;  3WKE A;  2IYD B;  4QZB A;  2KP7 A;  2FCM A;  2QAR A;  3MC0 B;  2KQ7 A;  1ZD3 A;  4GC7 A;  2PVG C;  2WLB A;  1TS3 A;  9ICL A;  3SV3 A;  4BBN C;  9ICJ A;  2ZUC A;  2J7Q B;  1WSP A;  1UBQ A;  4F5N A;  3T5K A;  3CNH A;  4TQ0 A;  3FDS A;  3PZD A;  5HG2 A;  4DL7 A;  3UQB A;  3E2E A;  2HHS A;  1BNP A;  3C28 A;  4CHK A;  3CST A;  4PL1 A;  3RJH A;  4DHJ B;  2N1W A;  3QUQ A;  2GRI A;  3MHZ A;  1VJ5 A;  2C5L C;  2KSO B;  4JL9 A;  1TK8 A;  1RYR A;  4KLQ A;  5IO9 A;  5KFI A;  4F5Q A;  2RDB C;  4MGI E;  4IM0 A;  1QTM A;  4O3M A;  4YD1 A;  3M6K A;  4DQS A;  2OEH A;  4EEL A;  1BUI C;  2KV2 A;  2YMQ A;  2KHQ A;  3ECI A;  2BKE A;  2PFO A;  4P4M A;  4BWM A;  5KFJ A;  1LO5 D;  2DZK A;  4UB4 A;  2V3P A;  2PXI A;  1PVQ A;  1F0Z A;  4M9N A;  5AI9 A;  1UWM A;  2N9E B;  1IGC A;  5D3D A;  5B66 U;  4F72 A;  2LMR A;  3L08 A;  4IRD A;  8ICS A;  5BMI A;  1ZD5 A;  1TAU A;  4NWI A;  3W5V B;  1SSN A;  5DPS A;  1C79 A;  2UWQ A;  5D94 A;  4KLD A;  2MP2 A;  1JWS D;  1QQ7 A;  3U52 E;  3JW0 X;  2HTM E;  4DS5 A;  2GBR A;  2RLT A;  4MHV A;  3ZTC A;  1TKY A;  2KDF B;  1WX9 A;  4K7S A;  4A3O A;  5ALQ A;  2QIL A;  1L6N A;  1NZP A;  2E1E A;  4ECW A;  2IJ0 A;  3N4M B;  2HBJ A;  1L7P A;  1XU4 A;  3UQ2 A;  1MI0 A;  3RI7 C;  2YEP B;  4A8X C;  4NQK E;  5ALO A;  1KKX A;  3WKC A;  5TIS U;  1ZXI A;  4NXZ A;  4FBU A;  3TUO A;  2M19 A;  4GMV A;  2CRX A;  5ALV A;  3RN9 C;  3F2D A;  2K8B A;  4P0Q B;  2Y5B B;  4YTN B;  8ICR A;  7ICE A;  4W9G A;  2ZZP B;  1YT3 A;  3SQI A;  2JZP A;  2Z0D B;  2ZVO A;  4UB5 A;  4HDQ A;  5ALN A;  1ZQY A;  3MFG A;  4JK1 A;  2GB1 A;  4ZHO A;  5C3J B;  3V6K A;  5DG9 A;  2P66 A;  7ICS A;  2OJW A;  1NBF C;  3NUH B;  4YP3 A;  2GMI C;  5AKL A;  8ICZ A;  3EHV A;  3QA8 A;  4DHJ D;  5AKG A;  1K8R B;  4DXF A;  4BBN F;  4EX7 A;  1VRA B;  1RQN A;  4BX9 C;  4L1B A;  3OLM D;  1NK5 A;  2KMD A;  5E6P A;  5ALF A;  3DBH B;  1NYQ A;  3O13 A;  4OVV A;  5IKC M;  1QCK A;  3AEB B;  3RFA A;  1STE A;  2M4N A;  3ZGZ A;  3DHH C;  2BTE A;  2J42 A;  2FLN A;  1Z5S B;  1S5L U;  2G9H D;  4JIO U;  2JVC A;  2K39 A;  1F9J A;  5HFY A;  4UW9 A;  1LQB A;  2KDB A;  3A9J A;  2ZTE A;  5G5G A;  3PX0 A;  4QZ9 A;  5KG0 A;  4J6I A;  1WXM A;  3QZ7 A;  3DBR I;  1O08 A;  1ZQW A;  2WF6 A;  3HHM A;  1WR6 E;  3K1R B;  3GP7 A;  3I3T B;  3I1Y A;  2KAC A;  4OHJ A;  5EE0 A;  3MR6 A;  2B21 A;  4IWQ A;  3V7K A;  4Q43 A;  3BQT A;  3N28 A;  5AKK A;  3LK9 A;  4K4G A;  1XLP A;  2V1Y A;  3AEE B;  3Q3O C;  1NJZ A;  4DBG A;  2PEA A;  2UVV A;  3A4S C;  1KW4 A;  1SIJ A;  4G11 A;  3NRW A;  3EZ5 A;  5DGA A;  2HHU A;  4YG2 A;  2OED A;  3Q3J A;  3RBE A;  1ZQL A;  2JY6 A;  1VZ7 A;  2ZJA A;  3PRP B;  4EZ9 A;  3CW2 C;  1UT8 A;  5AI8 A;  1YX5 B;  2CR5 A;  5FP0 A;  2KSO A;  1JWA D;  1TZO A;  1B1Z A;  2UU7 A;  1WE7 A;  4MM3 A;  4IQV A;  2P35 A;  3Q6B A;  1QZE A;  5KNI A;  5H8Y E;  3QE9 Y;  1BNO A;  2AGQ A;  3V7J A;  2Y5P A;  4HKQ A;  1QQ5 A;  1F0M A;  4GLS C;  2C2R A;  3IXS A;  5DLG A;  5ALG A;  2RDI A;  5BMG A;  2MRP A;  7ICT A;  3MTN B;  3NS8 A;  3UPQ A;  4MDK E;  2CN1 A;  2KNJ A;  3BY4 B;  1P0R A;  4W9C A;  3KVF B;  5AZG A;  3L17 A;  3QIJ A;  4PS7 A;  5F9N A;  2LGX A;  4MH8 A;  3TEZ A;  3DVG X;  1F2R C;  1YQB A;  3ML8 A;  2L0T A;  2N7D A;  4J9M A;  2K8C A;  2ALZ A;  3PW0 A;  2W43 A;  3V6C B;  3RZW C;  2PTL A;  3OHA A;  5KAI U;  2EAN A;  2HHX A;  1KJT A;  3EPG A;  1EF5 A;  2FPL A;  1WJ6 A;  2DX5 B;  4MEL A;  4M6W A;  4DSE A;  2PFQ A;  1RLF A;  1QSS A;  4R63 A;  2MSN A;  5J2H A;  4J9R A;  3B2F A;  1T7P A;  2IND C;  3QUB A;  2BT6 A;  3BS5 A;  3NGD A;  1C78 A;  2AX5 A;  4QZE A;  4XDC A;  3IP4 B;  5KT2 A;  4M9G A;  3SEB A;  1SKR A;  3DQV A;  4PZO A;  5KG2 A;  1QQR A;  1HA5 A;  2G07 A;  7ICF A;  4J9L A;  2D8C A;  5BYS A;  1NKE A;  1WYW B;  4RQN A;  2W8K A;  2WDQ B;  3AE7 B;  3PRE A;  2JRH A;  4FZN A;  2O6K A;  2WHE A;  2ZIV B;  2CHW A;  2GBM A;  3ZJU A;  1UNS A;  4IKG A;  8ICP A;  4EZ6 A;  8ICV A;  2H3V A;  1VR9 A;  1D8L A;  2JZ3 B;  4KIK B;  4MGY E;  4A20 A;  2JZB A;  2MRL A;  2VJ4 A;  2XGQ A;  1YN5 A;  2MAX A;  1SE9 A;  4I2E A;  1UWX A;  1HE8 A;  4W9I A;  2X38 A;  4J9O A;  2IGH A;  1MQ2 A;  3AE1 B;  3P42 A;  1SJH D;  1SZH A;  1HTQ A;  4ED1 A;  4O3S A;  2NBW B;  2JEG A;  5D7G A;  4YR3 A;  4EBE A;  4HAI A;  2JZZ A;  2KTR A;  3NZ3 A;  1HZ5 A;  4QZ8 A;  3TKA A;  2IHM A;  5J0Y A;  2O6V A;  4KVG B;  2Q4T A;  3BIN A;  1UHU A;  2IO3 B;  2EZY A;  4Y2S A;  2LBO A;  1KTK A;  4UAR A;  3TAN A;  2RR9 A;  2SAK A;  1ZD2 P;  1MN8 A;  3BK1 A;  3SI8 A;  2K5P A;  3WA0 A;  4EKU A;  5D4B A;  4FZM A;  2I6X A;  1EXN A;  2JRZ A;  4O3O A;  3PRZ A;  3UI3 A;  4GXI A;  4ZH4 A;  3LB8 C;  2WXM A;  3R2T A;  4G3I A;  4RT3 A;  1UA1 A;  4K4I A;  4R8U B;  4BVU C;  3PSP A;  1WJN A;  4KGR A;  2BB6 A;  3C19 A;  5DDY A;  2WF9 A;  5EE3 A;  5KG6 A;  4F4K A;  1HTO A;  1WRI A;  3RH4 A;  2KN5 A;  2GOL A;  4ECV A;  9ICR A;  3Q8M A;  2NS5 A;  3T5J A;  1YQ4 B;  2GLE A;  4O3P A;  4PT5 A;  1TS5 A;  4W9E A;  2EZX A;  4AYB C;  5J2J A;  4M0W B;  4MFF A;  1B9R A;  5KFC A;  1J7C A;  5T14 A;  3ZO5 B;  4MFA A;  1UF0 A;  4TSS A;  4KSL C;  4KX5 A;  4PZN A;  3DBL B;  1TTN A;  4RQ3 A;  1ZQQ A;  1L7M A;  5ALK A;  3KLS X;  5IIO A;  1BPE A;  1HEK A;  3MAB A;  4RNN A;  4AWJ A;  2F3N A;  2EEL A;  4EZL A;  1E8X A;  3KYD D;  1VLB A;  1RYS A;  4NV0 A;  3KHG A;  2I1K A;  4KLS A;  3TQ1 A;  3JPP A;  1GC7 A;  3VDZ A;  4XUS A;  1MJD A;  3C5G A;  3GZN B;  2IBK A;  1SXT A;  3Q8K A;  3Q3M C;  5DQG A;  4P0P A;  2VA8 A;  3VAW A;  3B9J A;  4DXA B;  2JQR B;  1WG8 A;  3DBH I;  3IDW A;  4ICV A;  4IC9 A;  2BWE S;  2I5H A;  5AI5 A;  4F4Y A;  2KFN A;  2Q0Z X;  2DHZ A;  1DOI A;  4UB2 A;  4YVZ A;  4XX5 A;  2K4H A;  4F71 A;  3AUL A;  1BPY A;  3JPT A;  2IO0 B;  2HJ8 A;  1OEY J;  3QK0 A;  2R8I A;  2DFL A;  4WWO A;  4IQW A;  4A9A A;  2ES6 A;  1ZQV A;  2LM1 A;  3QU4 A;  4WJO A;  3AV8 A;  3QWZ B;  3QU7 A;  4NNJ B;  5IOI A;  4UB1 A;  4JV2 A;  4ED3 A;  5IA7 A;  2R2O A;  4BAX A;  4ZRP A;  2AEH A;  2KG5 A;  1KSP A;  2ACZ B;  2QCZ A;  3DWM A;  2BQQ A;  3PV1 A;  3IT6 B;  9ICF A;  4NLZ A;  1WXS A;  1A0P A;  3HIZ A;  2JR5 A;  2C60 A;  2ZPY A;  1OXJ A;  4NY8 A;  4P4P A;  1KFY B;  2YML A;  1L7N A;  4K4H A;  4NLB A;  2XI9 A;  1EO6 A;  3C0R B;  4UQG A;  3Q3N C;  2FE9 A;  4RF0 A;  3JPQ A;  3JVZ X;  2G0A A;  3TJP A;  8ICN A;  1QSY A;  4KLM A;  8ICX A;  3WCQ A;  1RG6 A;  3KKA A;  4KLE A;  1EWY C;  2C9W B;  2K25 A;  3HJE A;  4NLC A;  9ICE A;  3DDC B;  1TY2 A;  4HRO A;  3KWV A;  3BWU D;  2VH2 A;  1WM2 A;  5KG7 A;  3EPI A;  1R4N I;  1AWD A;  3AH7 A;  4YL8 A;  3BQ0 A;  3VC8 A;  4CNQ A;  3LWM A;  1UCV A;  1ZRN A;  4JLC A;  1V1P A;  3AEV A;  1N60 A;  2AQ4 A;  3HVZ A;  2KK0 A;  2FJ6 A;  3GII A;  7ICL A;  4IG7 B;  3QJZ A;  2LGY A;  1YJJ A;  4DHZ E;  4GXK A;  4FE3 A;  1WWV A;  1NK4 A;  4KTQ A;  1XQQ A;  5IAA C;  4YSY B;  3IAS 1;  4B9M A;  3JSV B;  4C7Z A;  8ICM A;  4D2K A;  4M0A A;  3GE3 C;  5AKH A;  2PLP A;  4XDD A;  9ICW A;  2DYO A;  4TUS A;  4NJC A;  2RD0 A;  3RJK A;  1NKC A;  3ZYY X;  4C56 C;  2KKP A;  3VFK A;  3OSP A;  2WDV B;  2WXQ A;  4QWC A;  3T8M A;  5ALW A;  4BXO B;  2W04 A;  8ICL A;  1K50 A;  4W9H A;  4KLJ A;  4ED6 A;  4S0R A;  3BZD B;  2PKO A;  4A3P A;  4ELU A;  3ZNZ B;  4K1R B;  3VQI A;  2R61 A;  2KN4 A;  3GZF A;  2JEJ A;  1L5P A;  4ECX A;  3IFW B;  1IUE A;  1MG4 A;  3ZD9 A;  2IO2 B;  2MEK A;  1FEH A;  4JV0 A;  1ZOY B;  3AN1 A;  5KFP A;  1TVA A;  4O5C A;  5CHF A;  4HRS A;  2P6R A;  1PK1 B;  2FLP A;  4IRK A;  2WFA A;  1EF1 A;  1FCC C;  1V5T A;  2LUE A;  4P1C C;  1IG6 A;  3M62 B;  4NLN A;  3DHG C;  2N9X A;  4LCD E;  2F1J A;  2W9C B;  1C9F A;  3Q8F A;  3X0W A;  4YT0 B;  3O0F A;  5J0W A;  3ORY A;  2BVC A;  2KJR A;  2J0J A;  9ICX A;  4ARC A;  2KMC A;  4WQO B;  2LGS A;  2N4F A;  1COO A;  3TFR A;  3ZDC A;  2DPJ A;  2QLT A;  4E0D A;  4BGD A;  4JMU A;  2BCR A;  1XT9 B;  5KFF A;  2VA3 A;  3E9S A;  1TFR A;  1E9M A;  5IN7 A;  1ZGU B;  2ASJ A;  4NAW A;  3AE4 B;  2D10 A;  1ZDX A;  3CWI A;  3NZS A;  3M3J A;  3MC1 A;  2KJ8 A;  2QB1 A;  3PW2 A;  3CSF A;  4GSW A;  4ARI A;  2MH7 A;  1Z19 A;  2JV3 A;  4UB6 U;  2LJI A;  3ZDB A;  3NTU A;  5KFE A;  5AK6 A;  4B0E A;  3FM9 A;  3RMK C;  1KFD A;  1F52 A;  2K8H A;  1T3Q A;  2JXX A;  3ZIM A;  5G55 A;  3JPS A;  1TS4 A;  1FXI A;  4BKS A;  4BKT A;  4DSJ A;  4ED2 A;  3PML A;  2RRD A;  2ZIX A;  4U6P A;  5J8Y A;  5J0U A;  2KIW A;  1ZJM A;  4G0N B;  2UVR A;  2ZIU B;  4Q2J A;  4LDT B;  4FS2 A;  3AXC A;  4GDK B;  1NNL A;  2L52 A;  3QXG A;  3ML9 A;  4BOZ B;  1RQL A;  4MEM A;  2HD5 B;  1KLN A;  4Q45 A;  1AYF A;  2C7N B;  3AEF B;  3B2G A;  1M94 A;  4ANU A;  3KUC B;  1T5X D;  1TY0 A;  1MPE A;  2HCF A;  2NBV B;  2QAR B;  4ANV A;  3RUI B;  4O3N A;  2FMS A;  2AGP A;  3V3X A;  3DBL I;  1WGG A;  4DFJ A;  3BS7 A;  3F5A A;  3HKZ C;  2C2D A;  3AED B;  4MJS A;  2UVW A;  4FO6 A;  1UT5 A;  1E8Z A;  4Y2Q A;  1L0V B;  2B6G A;  1P9D U;  2LZ6 A;  4TUR A;  1ZQN A;  2LXA A;  3AEG B;  1C20 A;  5LXH A;  3V61 A;  5KFB A;  4RQ5 A;  2HOI A;  4RF1 A;  4RGM A;  3ZD8 A;  2MA1 A;  5JZE B;  5CR0 A;  4I2D A;  3DDH A;  2G3Q B;  1M4V A;  1F44 A;  1V80 A;  3L0W B;  4JPS A;  4MGK E;  2DGZ A;  3RH5 A;  4C8K A;  1M6Y A;  4KIT B;  4DF4 A;  1WGY A;  3SMV A;  4QIW F;  3RNC C;  1RM6 C;  4I2B A;  1IM4 A;  7ICJ A;  2NYV A;  1KBU A;  2E1F A;  3N7S C;  1WCL A;  4J03 A;  2D3A A;  3DBR B;  2AH5 A;  3OTQ A;  3N1Z C;  4RFB A;  3MGH A;  1V38 A;  4C4T A;  4BJQ A;  2AGO A;  2FNJ B;  4FA6 A;  1C3T A;  2MP2 B;  3TAR A;  4DWI A;  4OJ5 A;  4QWB A;  2WDT B;  4F7Z A;  4BWJ A;  1XC9 A;  1D5M C;  3AU2 A;  3VCB A;  3GE8 C;  4LDT D;  2K4I A;  3EYZ A;  4MFC A;  5DB8 A;  2QJL A;  4DL3 A;  2RPV A;  5KFW A;  5ALL A;  1Z3E B;  5BYR A;  3N7R C;  3J81 j;  2W9C A;  5IIN A;  1ZQF A;  4B9K A;  2FCN A;  4KDL B;  2KDM A;  1XSP A;  2HDE A;  2YVC A;  3GDX A;  3IBE A;  2K8B B;  3VHT C;  3ZJV A;  1WXQ A;  2C22 A;  3NAS A;  1D3Z A;  3WK8 A;  1JUD A;  3UXN A;  3TEW A;  3IN5 A;  3ALB A;  4TKN A;  4MH0 E;  1P3Q U;  3RB0 A;  2I1Q A;  2MU2 A;  4P2H A;  4QWA A;  2FCS A;  4FHJ A;  3TFS A;  2H3Z A;  2IA6 A;  2KVS A;  1ZQC A;  3RZF A;  3AE9 B;  3IVF A;  1L4D B;  4ZRQ A;  1ZPS A;  3TAQ A;  4DSF A;  1QH9 A;  7ICK A;  5J0P A;  2ZIW A;  4J9N A;  2Z0E B;  4HXD A;  5EOZ A;  3BK2 A;  2GBK A;  1OEY A;  4QAY A;  2V0G A;  3SAH A;  1H8C A;  1A77 A;  1U45 A;  4QJF B;  4JX1 C;  3A9J B;  1TKD A;  5CHG A;  4RPX A;  4I6N B;  3MDC A;  2IHN A;  2ASL A;  1ZQG A;  5KFT A;  2KFK A;  3VRA B;  1P7D A;  5KG5 A;  3ZVV A;  1JMS A;  2HHW A;  3AM9 A;  3PNC A;  2AQ2 B;  4DWF A;  3PGE A;  3IHQ B;  1FNW A;  1J2N A;  2CPR A;  4GU2 A;  3TAD A;  4DDG D;  4MF2 A;  5J2G A;  3L13 A;  2W7P A;  2AQ3 B;  1WGH A;  2AYO B;  3R8B A;  4F4Z A;  4UB3 A;  4B9S A;  2BYE A;  1L3S A;  3NRZ A;  1E8W A;  3T5H A;  2QEJ C;  4EEK A;  5KT7 A;  2FLL A;  3PW5 A;  3LXF A;  1URJ A;  2KNB A;  4Y2Y A;  3AMZ A;  1RXV A;  4WAF A;  3SU8 X;  3S2A A;  8ICU A;  4RZR A;  3A33 B;  4MM3 B;  4US9 A;  1WUD A;  5JHA A;  3L10 B;  5HML A;  2PMV A;  3OSN A;  3PRM B;  2Z8L A;  1HXY D;  4I28 A;  8ICJ A;  1VCB A;  2HBL A;  1NK6 A;  3GU3 A;  1ZQJ A;  4WJN A;  2JSV X;  2EQY A;  4DDI D;  1U48 A;  4XE0 A;  4OZA A;  4Q8E A;  1CK1 A;  3JPO A;  4MEY A;  2I1J A;  3VVW B;  1N61 A;  2G08 A;  3H7S A;  4W9K A;  4DLE A;  3ZTD A;  4F50 A;  3UMB A;  3V72 A;  5DPR A;  3T79 A;  5JU5 A;  2CU1 A;  5BOL A;  1HEZ E;  4N59 A;  5CHW A;  1N63 A;  1N62 A;  5B5E U;  2RDJ A;  2LYB A;  3MJW A;  2BCQ A;  3Q3F A;  3KKA C;  5E6J A;  1XSN A;  4ICA A;  2IOF A;  2FID A;  1PDX A;  1SGG A;  2K8C B;  2VA2 A;  4EBD A;  1WZ3 A;  7ICP A;  5KFK A;  1LGR A;  4FLH A;  3H4B A;  3W5U B;  1RAX A;  4OJ6 A;  3PPA A;  3I28 A;  4KX6 B;  2MA9 B;  4M6W B;  1T4G A;  5J2B A;  4DXG A;  3V6J A;  1UA0 A;  4E3C A;  3BS5 B;  1NK7 A;  1MC8 A;  3IM1 A;  3F2B A;  1L6U A;  2X8X X;  2ZEQ A;  3H0M B;  1Z1V A;  2ZJD A;  5KFG A;  1CMX B;  2NVU I;  3EA6 A;  3NVV A;  4AQ7 A;  4MT5 A;  1WGR A;  4I2G A;  1WYG A;  5ALP A;  4ED8 A;  5DQI A;  2VAN A;  1ZQA A;  1ENF A;  3KQ4 A;  2YY6 A;  2Y9T A;  2A5U A;  3TAP A;  1C76 A;  3D2N A;  4GB9 A;  4RQ1 A;  1ZQZ A;  4MF8 A;  2C2E A;  2WYQ A;  3RJF A;  4F2S A;  3BII D;  5L1L A;  4IR9 A;  5J29 A;  4Q44 A;  2JYT A;  1JN3 A;  3M1Y A;  3APF A;  4QWE A;  9ICT A;  1F77 A;  2JZB B;  3KZX A;  1WXA A;  3QC8 B;  2OXO A;  2DNF A;  3QU2 A;  2HSZ A;  2A3V A;  4DSK A;  4KLT A;  2BHN A;  3ICX A;  1ZQB A;  1WF9 A;  2CU3 A;  1DXS A;  1S76 D;  3N7P D;  3MC8 A;  5AUI A;  1TKE A;  4WJP A;  4ECS A;  2MQJ A;  2AHO B;  4KLF A;  2ASD A;  2H89 B;  2K4P A;  7ICQ A;  1YN3 A;  4GXB A;  3AU6 A;  1EWC A;  2KTR B;  2V3S A;  3BQ2 A;  5DBC A;  2C28 A;  2E8O A;  2CHX A;  2DZM A;  4QW8 A;  2VRR B;  4C4R A;  3VUW A;  2O6V B;  2BB5 A;  4MEX A;  1V9P A;  2KX3 A;  3R7R A;  2G09 A;  1ZQR A;  5IP4 D;  1OW5 A;  2PMZ F;  3OWE B;  1S8O A;  2NV3 A;  1SL1 A;  1FMA D;  2W82 A;  2BPS A;  1XO1 A;  3H8H A;  2YB1 A;  2EZZ A;  1PVR A;  1ZQM A;  4B9U A;  3SD5 A;  4HVB A;  3GV7 B;  5KFO A;  2JEI A;  1TK0 A;  5CWR A;  2V4L A;  1CI4 A;  4KZC A;  1JXE A;  3QNM A;  2K89 A;  2YQE A;  2KEY A;  5AKZ A;  2XO7 A;  5J2F A;  5KFH A;  4ED0 A;  3QEB Z;  2L05 A;  3Q8Q B;  1GB4 A;  2KE7 A;  2MJD A;  1QQ6 A;  1X40 A;  5HR7 A;  5HR6 A;  1GO3 F;  2WS3 B;  1KFS A;  1N6Z A;  4HKZ E;  1V8C A;  9ICA A;  4KLI A;  2D11 A;  2K1F A;  1C4A A;  2BBC A;  1D9D A;  3Q8L A;  2N9L A;  4I27 A;  4LTU A;  3ZUN A;  7ICN A;  3AU5 A;  2HBM A;  2IBI B;  1S0O A;  2HOQ A;  5AI6 A;  4AUQ C;  2B0C A;  3TMP B;  9ICN A;  3NY5 A;  2XY5 A;  1NJY A;  4I6P A;  2K0P A;  4A8E A;  1JRU A;  1S1Q B;  4LJO B;  3V62 A;  3I57 A;  5BPC A;  1R4N B;  3RR8 A;  2MCN B;  3ZXV A;  4M2Y A;  3KUD B;  3TL5 A;  5J0O A;  1H38 A;  4ELT A;  4IQU A;  1A76 A;  1K51 A;  2DL0 A;  4IL6 U;  1BT0 A;  2KOX A;  2BKF A;  4TQ1 A;  1IYF A;  5KFQ A;  4J9Q A;  2FPK A;  4P0P B;  4MSM B;  3GIM A;  2KWD A;  2PW9 A;  5KFX A;  3MP9 A;  2V3N A;  1J7A A;  4C8O A;  4DLG A;  2KC2 A;  3HUI A;  4OD0 A;  3U7D A;  1YZ6 A;  3KOO A;  2HBK A;  5KL8 B;  2J0M A;  2V9H A;  4CF3 A;  1ZQP A;  4HJK A;  1XLN A;  3NVW A;  4S17 A;  5AEK B;  3HM6 X;  3RT3 B;  1AQ6 A;  2O6V D;  1V49 A;  3W1S A;  3QUT A;  2N7E A;  1YQ3 B;  5L83 A;  2EAO A;  2HJ1 A;  5KFU A;  2L83 A;  5L1I A;  4J9K A;  1FRD A;  4XGA B;  4JWN A;  3H1U A;  2XK5 A;  4P4O A;  1IPG A;  4II2 B;  5AI0 A;  4FJY A;  2F76 X;  3W9C B;  2J0K A;  4W9L A;  1SJE D;  3ED5 A;  1PGX A;  1T0S C;  1FEZ A;  4YMN A;  3Q14 C;  2JH7 A;  3IG8 A;  1ET9 A;  4ANX A;  1YN4 A;  5AK3 A;  2BQU A;  2A1A A;  1XF5 L;  5ALX A;  5BMH A;  2LVQ A;  2N1V A;  1HUZ A;  2HI0 A;  2ZXH A;  4F3O A;  2OHF A;  3TI0 A;  2A1J A;  4KZ0 A;  2K4E A;  4C4S A;  5J2K A;  3GIL A;  1XWL A;  1RXW A;  4RNA A;  2JXJ A;  1P1A A;  1C77 A;  1LVH A;  2KZR A;  3SFE B;  2DYB A;  2DWQ A;  2XCP A;  5J18 A;  3SAF A;  3NJT A;  4NZL B;  1SE3 A;  5C23 A;  2W55 A;  1GB1 A;  1CQV A;  3J9C A;  4K3C A;  2W9M A;  5DB7 A;  3NHE B;  8ICE A;  3H9D A;  9ICQ A;  5AM2 A;  1V86 A;  1GPX A;  2K22 A;  5KT3 A;  2FUG 1;  1NZB A;  4O3Q A;  4EZJ A;  4UAT A;  1XLO A;  5DQH A;  3KBB A;  4QZC A;  1XLQ A;  2JHD A;  5KG3 A;  3P4Q B;  4YXJ A;  1COK A;  1Q0W B;  1L3V A;  2K3U A;  1N2X A;  4RQ6 A;  2KZM A;  1V1P B;  4I2I A;  2M0A A;  4H2A A;  1PVP A;  1U9L A;  2TSS A;  3FAH A;  1L7O A;  4WJ3 B;  1UGM A;  1OFF A;  2LHE A;  3K1Z A;  4FZL A;  5DG7 A;  2QKQ A;  1WGK A;  4QNL A;  2D3G A;  5E6N A;  5KT4 A;  2GBJ A;  4IWO A;  1JWB D;  2NPT A;  3RUL A;  3PR5 B;  1UGJ A;  1GOZ A;  5AZF A;  2YN4 A;  3KFU F;  2Y9U A;  3RNB C;  1T8E A;  1ZKH A;  3I63 C;  5AM3 A;  2LM4 A;  2KVR A;  4XYC A;  1K5O A;  4RQ0 A;  5KT5 A;  4DCC A;  1OUQ A;  4MSQ B;  5LLI A;  2CS4 A;  1ESF A;  1V9J A;  9ICH A;  3DOW A;  1NYR A;  5KFD A;  4CF4 A;  2W9B A;  2V4Q A;  1X2I A;  2BS2 B;  5KG4 A;  3N3K B;  4WAA A;  3VTW A;  1FPY A;  2OOB B;  3H7P A;  1J2M A;  4X5V A;  2JH1 A;  2JMG A;  3WKD A;  2HTH A;  2IO1 B;  4KKI A;  2XY6 A;  4MAC A;  3A0H U;  5HP4 A;  4E74 A;  3ALR A;  3PST A;  3HPO A;  1SV0 A;  2ON8 A;  1HJP A;  2DZI A;  2R8K A;  4JV1 A;  3TAD C;  1SL0 A;  1XXG A;  4IR1 A;  9ICC A;  2BDP A;  1UBI A;  1FXT B;  3PSF A;  3E58 A;  2J52 A;  3PTF C;  2BWF A;  1Y88 A;  3K75 D;  4XZ4 A;  2R8G A;  1X66 A;  1IP9 A;  3BVZ A;  3QX1 A;  4KMU A;  2LRU A;  4RM8 A;  3HVD A;  4NAW B;  1ZXH A;  4K7W A;  1KRH A;  2R2Q A;  1LFD A;  2KFZ A;  5T8I A;  1SEB D;  1WIA A;  4LJP B;  3G6Y A;  3LYS A;  5DB6 A;  2CKH B;  4EFO A;  2QHO A;  4YSZ B;  1J0G A;  3DV9 A;  2IOF K;  8ICG A;  1DYQ A;  1NK8 A;  4FHK A;  1LM8 B;  4DK5 A;  8ICT A;  2RMM A;  4IUM B;  3UXP A;  2L8J A;  2ZNV C;  5ALT A;  4C0Z A;  4QZI A;  4WQM A;  3QQ8 B;  5ALZ A;  3WAP A;  3RJI A;  4M8M A;  3P4S B;  1GJZ A;  5J2R A;  4M04 A;  5AK4 A;  5J0T A;  2GO7 A;  1CEZ A;  1V5O A;  2RDH A;  4I2C A;  4B9V A;  1TYG B;  2DEN B;  4M9J A;  2ZIX B;  4LLG M;  2AU0 A;  4DQP A;  5LXI B;  1HIW A;  4URK A;  1ZJN A;  1KM7 A;  2N0S B;  3HW8 A;  2EDU A;  1MA7 A;  2KZ3 A;  2Q5W D;  4CDG A;  3D2Q A;  2LPE A;  2PFN A;  2YMP A;  3AE2 B;  4BFR A;  1N48 A;  3WK9 A;  2WB1 C;  4JE3 B;  2HHV A;  3IV6 A;  2BQ3 A;  8ICC A;  2WXO A;  3U7Z A;  5KFN A;  1ACC A;  5ALE A;  3MGI A;  3R2I A;  2LHT A;  7ICH A;  4J3O D;  1L3T A;  7ICR A;  1R4M B;  8ICH A;  2D3B A;  1YZ7 A;  1ET6 A;  4MJS B;  4ECR A;  4QZD A;  3ZDD A;  4GGQ A;  2XNA C;  1SXD A;  5FK9 C;  4Q8F A;  3N9Y C;  4PJ0 U;  5CTR C;  5CEH A;  2Y0S C;  5KFR A;  4RQ7 A;  3QEA Z;  1E0Z A;  1BPZ A;  3CF6 E;  5AI4 A;  1Q8K A;  4AOF A;  4C4V A;  3APD A;  2QB0 A;  4P7I A;  3W1Y A;  3LDZ E;  4B0M A;  3AQF A;  2F44 A;  3GIK A;  1JWU D;  2JPH A;  3AE6 B;  3KWL A;  3LYY A;  4USA A;  3RF9 A;  1CJE A;  3I76 A;  3KH0 A;  5IIL A;  2KWV B;  4A6Q A;  4CQN A;  5D2M B;  3RD2 A;  3RBD A;  3NS1 A;  2F1I A;  2IMW P;  1WY8 A;  4IOI E;  8ICW A;  4AJY B;  4IRC A;  4RCO A;  1ZQE A;  3P1M A;  1XEE A;  4Y2T A;  3C23 A;  2HVI A;  4DFK A;  1KEJ A;  2Z59 B;  3MR5 A;  1U4A A;  1LB2 B;  4M9H A;  4ECU A;  4F4X A;  1Z00 A;  3B0A A;  4K81 A;  4ZYS A;  4HPL B;  3ISD A;  2R8J A;  4YN4 A;  2RP5 A;  1D8Y A;  2VH1 A;  5IIK A;  2XEW A;  4GN1 A;  3MFH A;  4DFD A;  2XVT A;  3MFI A;  1EUV B;  4ZRJ A;  5KFZ A;  5J2E A;  4Y2J A;  4BKS D;  2GLS A;  4DQO C;  1ZET A;  1V1O A;  4HJG E;  2L00 B;  3MC9 A;  4EOY A;  1XNS A;  3OGU A;  2MBO A;  2ZCB A;  3R9K A;  5III A;  3Q8P B;  3M8S A;  3C2K A;  4LNK A;  4I2A A;  1RRB A;  1OQR A;  3B08 A;  3BQ1 A;  5F3X B;  3QYP A;  3Q8S B;  1IBX A;  4QIW C;  2KD0 A;  2LI5 A;  1ZD4 A;  9ICM A;  2KD1 A;  4IM2 A;  5D3I B;  1KH0 A;  3VUX A;  2F77 X;  5CJ7 A;  1WM3 A;  4RQ4 A;  4NPN A;  4TV3 A;  2PPH A;  3M9O B;  4ITK A;  2D5G A;  2K6Q A;  4M01 A;  3U30 A;  4YMM A;  1LV5 A;  2G1E A;  5K4L A;  4XRH A;  1JW9 D;  2WWZ A;  4N58 A;  2WB1 F;  2DAJ A;  2GWS A;  2XID A;  3C21 A;  4GIB A;  2L3Z A;  3N30 A;  9ICP A;  4R64 A;  4OO1 J;  2KO3 A;  5D46 A;  2K8A A;  4Y2P A;  3I5J C;  5DKW A;  4UBC A;  2WHI A;  1ZQO A;  1WX8 A;  1D8B A;  3SEI A;  3PSI A;  4CF5 A;  1XO0 A;  3UF8 A;  1L3U A;  1TK5 A;  3U26 A;  4EEY A;  5KL1 B;  4DS4 A;  3ZNI D;  1CUK A;  2ZIW B;  1VZ8 A;  5IIJ A;  3AL0 B;  2Y0S F;  3IHP C;  2GH1 A;  2WGS A;  4W9J A;  3EFU A;  3WIM A;  4C00 A;  3OHB A;  5DGB A;  3RB6 A;  3H8M A;  1QIL A;  3QX7 A;  1C1Y B;  2W3R A;  4N6E B;  1D5Z C;  1T6B X;  3A1Q A;  1ZQU A;  2MBB B;  3Q2A C;  2KFK B;  2BCS A;  3RNA C;  4I2F A;  2FIF A;  1HUO A;  1QLN A;  9ICG A;  4YCX A;  4AP9 A;  1A70 A;  4DF8 A;  2KQ4 X;  3VUY A;  3WAO A;  5BYQ A;  2L7R A;  5GTH U;  4CE6 A;  2KLG A;  4F5P A;  2G5I B;  4Y2X A;  4F93 B;  2ZUD A; 
#chains in the Genus database with same CATH homology
 2KAJ A;  1GAQ B;  4MM3 B;  3ZJT A;  4US9 A;  1D4B A;  1KLU D;  2PMV A;  2Z8L A;  1HXY D;  1I4P A;  2JYE A;  1NEK B;  4MH8 A;  3TSS A;  3TEZ A;  2JSV X;  2Y3A A;  1F2R C;  4XE0 A;  4OZA A;  1CK1 A;  1N61 A;  1E6E B;  2ZW0 A;  2IPK D;  2PTL A;  3CIR B;  3AB5 A;  1XO3 A;  2ZW1 A;  4N59 A;  1HEZ E;  1N63 A;  1N62 A;  3B2F A;  2DYM A;  2H88 B;  2NTT A;  2BT6 A;  1C78 A;  2AX5 A;  1JWM D;  3C8Y A;  4RH6 A;  4XDC A;  5E6J A;  4WH4 A;  1PDX A;  2B76 B;  3SEB A;  1KLG D;  3IT4 B;  1AN8 A;  1QQR A;  1HA5 A;  1C4C A;  3W5U B;  1JCK B;  2WXL A;  3T3O A;  4KX6 B;  5BYS A;  2WXN A;  2WDQ B;  3AE7 B;  4DXG A;  3VRB B;  2E6X A;  3ZJU A;  1L6U A;  1I4Q A;  1UNS A;  4IKG A;  3U2S C;  2LEK A;  1VR9 A;  3EA6 A;  3NVV A;  4AQ7 A;  1EM7 A;  4MT5 A;  1YN5 A;  1WYG A;  1UWX A;  2JU6 X;  1K53 A;  1ENF A;  3KQ4 A;  1E7P B;  2X38 A;  2IGH A;  3GS2 A;  1R7S A;  3AE1 B;  3P42 A;  1C76 A;  3PZ7 A;  1SJH D;  1BML C;  1FRR A;  3BII D;  5D7G A;  2INP E;  3NZ3 A;  1HZ5 A;  2JYT A;  1F77 A;  2J53 A;  3NVZ A;  5JXV A;  1BXT A;  3V05 A;  2PIA A;  1V97 A;  1KTK A;  2CU3 A;  2SAK A;  1TJE A;  5AUI A;  1TKE A;  3BK1 A;  1MHX A;  5I4D A;  2K5P A;  4C7Y A;  2I38 A;  2H89 B;  1YN3 A;  1C4P A;  4M0W A;  3UI3 A;  1EWC A;  2VZK B;  2QIE B;  3LB8 C;  4EE2 A;  2WXM A;  2ICI A;  3R2T A;  1FFU A;  5GXG B;  1YMH E;  2BB5 A;  1WWT A;  3VR8 B;  4KGR A;  3BVG A;  2BB6 A;  1FNV A;  1QF6 A;  4GDL B;  3OWE B;  1FFV A;  1FMA D;  2W82 A;  1PUT A;  5EE3 A;  1WRI A;  5TSS A;  2LUM A;  4UDU C;  3H8H A;  3URY A;  1YQ4 B;  3FIL A;  4PT5 A;  1TS5 A;  2MJ3 A;  1I4H A;  1YNT E;  1CZP A;  2WNM A;  1B9R A;  2JXT A;  1J7C A;  4P16 A;  2FE8 A;  3ZQ4 A;  2NTS A;  3AE5 B;  3P63 A;  5H92 C;  2E3T A;  4TSS A;  2QMT A;  2WXG A;  4AS1 A;  2K9X A;  1E10 A;  3KLS X;  1GB4 A;  4WUR A;  2EEL A;  4US8 A;  4O1N A;  2MJD A;  3FIL B;  4R3D A;  1VZ6 A;  4TMA B;  2WXH A;  1FO4 A;  1VLB A;  2WS3 B;  1SF0 A;  4HKZ E;  1V8C A;  3W2D A;  1NI3 A;  2WXR A;  1DOX A;  1ROE A;  3BYY B;  3GB1 A;  1C4A A;  2BBC A;  2GI9 A;  3BYT B;  2WXK A;  2N9L A;  3SFD B;  1SXT A;  5LNK 1;  4LTU A;  3BVM A;  2WDR B;  1TS2 A;  5FR3 A;  3B9J A;  1QOB A;  2IDY A;  2JQR B;  2LGI A;  1NVI D;  4P6V F;  2K0P A;  2INN E;  3I57 A;  3Q8C A;  1DOI A;  2JWU A;  2BYT A;  1FNU A;  2ONQ A;  3NVY A;  1K51 A;  2DBY A;  2EKI A;  1JML A;  3VR9 B;  4L2Y A;  4TQ1 A;  3PZ8 A;  1VDV A;  2KWD A;  2PW9 A;  5AUK A;  4A9A A;  3MP9 A;  2V3N A;  1J7A A;  1FXA A;  1ZP0 B;  3HUI A;  4YSX B;  3AV8 A;  2WXI A;  4REZ A;  1XLN A;  3NVW A;  2VZK D;  3W1S A;  3EUB 2;  1YQ3 B;  2J4X A;  4ZRP A;  3Q8E A;  2ACZ B;  4OVZ A;  3DWM A;  3IT6 B;  2L83 A;  1FRD A;  1I7H A;  4KGS A;  2RDG A;  3W9C B;  2AQ1 B;  1KF6 B;  4OW0 A;  1KFY B;  1YJI A;  1QOF A;  1SJE D;  4NAM A;  3Q8B A;  1PGX A;  4RF0 A;  1ET9 A;  4OZB A;  1YN4 A;  1PYW D;  2LFI A;  1XF5 L;  5BMH A;  1JAL A;  2PVO D;  3Q69 A;  1FIQ A;  2BS4 B;  1I4X A;  2OHF A;  1L0Y B;  3WCQ A;  1EWY C;  3I9V 1;  1SBB B;  1TY2 A;  1RFK A;  4HRO A;  1QKZ A;  3KWV A;  1EU4 A;  3BWU D;  4RNA A;  1AW7 A;  1C77 A;  3SFE B;  2DWQ A;  3DWG C;  3AH7 A;  1AWD A;  4NZL B;  3MJ5 A;  1SE3 A;  2W55 A;  1GB1 A;  1HZ6 A;  2M56 B;  1QT9 A;  1CQV A;  3J9C A;  2L1A A;  1V1P A;  1N60 A;  3HVZ A;  2WU5 B;  4YTM B;  1GPX A;  2MJE A;  2K22 A;  3U4E G;  1YJJ A;  2FUG 1;  4JWS C;  4YSY B;  1XLO A;  1SE4 A;  3IAS 1;  2WP9 B;  1PGB A;  4C7Z A;  1QOG A;  1XLQ A;  1RWS A;  4D2K A;  2WXP A;  2PLP A;  4XDD A;  3E56 A;  3P4Q B;  2DYO A;  4NJC A;  2K3U A;  3Q8A A;  3ZYY X;  4C56 C;  2WDV B;  2WXQ A;  1V1P B;  2M0A A;  4H2A A;  3T3N A;  1Q10 A;  2IGD A;  2TSS A;  3FAH A;  1K50 A;  4C80 A;  3BZD B;  4RGN A;  1OFF A;  2QSD A;  2WXJ A;  2LHE A;  1K52 A;  2SEB D;  1WGK A;  2PKO A;  2L32 A;  2N7J A;  3VQI A;  4LK0 M;  4A55 A;  3P4R B;  2R61 A;  1XCQ L;  1JWB D;  2W3S A;  2KN4 A;  4OZC A;  1L5P A;  1UGJ A;  1GOZ A;  3PO0 A;  1IUE A;  4RGT A;  5G5H A;  3TEY A;  1UUP A;  2MEK A;  1FEH A;  3P4P B;  1ZOY B;  4YWG G;  3AN1 A;  1L6V A;  2W54 A;  2N9K A;  4HRS A;  1F2R I;  1ESF A;  1FCC C;  4WWM A;  2I2Y A;  5C2T B;  1C9F A;  1NYR A;  1XCT L;  3Q8F A;  4YT0 B;  1HQR D;  2BS2 B;  4ARC A;  1P7E A;  2WXF A;  3IAM 1;  5FKA C;  1I4G A;  3FC4 A;  1N5X A;  4KKI A;  4MAC A;  2JX5 A;  1D5X C;  3E9S A;  2YEP F;  1E9M A;  4KGT A;  2XN9 C;  2ON8 A;  5EE1 A;  1JQ4 A;  3AE4 B;  1ZDX A;  3AEC B;  3CWI A;  3RPF C;  4ARI A;  1N5W A;  2MH7 A;  2WQY B;  1XXG A;  2LJI A;  2BW2 A;  3RFZ B;  4B0E A;  2DLB A;  3EGR A;  4KKJ A;  2J52 A;  2LMC A;  1FCL A;  1T3Q A;  4XWW A;  1ZE3 D;  3BVZ A;  1QOA A;  2FBW B;  1TS4 A;  2BS3 B;  1ZUD 2;  1FXI A;  3HVD A;  4NAW B;  1FM0 D;  1ZXH A;  3HRD D;  3SR6 A;  3AE3 B;  1KRH A;  2IGG A;  3ETR A;  5T8I A;  1SEB D;  3MC0 B;  5HI1 A;  2PVG C;  2WLB A;  4YSZ B;  1TS3 A;  4Q2J A;  1DYQ A;  1MVK A;  1P7F A;  2RMM A;  1WSP A;  2L52 A;  4GDK B;  4L23 A;  4IDI A;  4WQM A;  4TQ0 A;  5HG2 A;  3P4S B;  3AEF B;  1SE2 A;  1AYF A;  3B2G A;  1MHH E;  3AE8 B;  2RDH A;  1T5X D;  1TYG B;  1TY0 A;  4JWU C;  1MPE A;  4LLG M;  2GRI A;  3MHZ A;  3V3X A;  2CJO A;  2N0S B;  3AED B;  1BUI C;  2Q5W D;  1L0V B;  1DOY A;  1JRO A;  1LO5 D;  3AE2 B;  1OQQ A;  3AEG B;  4JE3 B;  2V3P A;  2WXO A;  3U7Z A;  1F0Z A;  1ACC A;  4YTP B;  1UWM A;  4RF1 A;  4RGM A;  1IGC A;  3R2I A;  5D3D A;  4J3O D;  4ZOH C;  1ET6 A;  1M4V A;  3TEX A;  4JPS A;  1JRP A;  5BMI A;  2XNA C;  5HHD G;  3W5V B;  4A90 A;  2NMQ A;  3N9Y C;  2LHD A;  1SSN A;  1C79 A;  1E0Z A;  1D6E C;  1JWS D;  3U52 E;  2HTM E;  1RM6 C;  4B0M A;  1TKY A;  1JWU D;  3AE6 B;  3KWL A;  3LYY A;  4USA A;  1CJE A;  5EE9 A;  4RFB A;  4A6Q A;  4CQN A;  2QIL A;  3NS1 A;  2IJ0 A;  4IOI E;  4RCO A;  1MI0 A;  4FXC A;  2YEP B;  1DGJ A;  3P1M A;  4WIP A;  4A8X C;  1XEE A;  1ZXI A;  3TUO A;  2M19 A;  1EU3 A;  1QLB B;  4YTN B;  1ZDV A;  1L4Z B;  1D5M C;  2JZP A;  2WU2 B;  4ZYS A;  3L4P A;  4HEA 1;  2QJL A;  3MFG A;  2RPV A;  2GB1 A;  4ZHO A;  5C3J B;  5BYR A;  3ABV B;  3AEA B;  3NUH B;  2KDM A;  2HDE A;  4DQO C;  4DXF A;  3ZJV A;  1V1O A;  1WXQ A;  4HJG E;  1VJK A;  1VRA B;  4L1B A;  4ZHP A;  3TEW A;  4RGO S;  1NYQ A;  1OQR A;  2V4I B;  3O13 A;  3AEB B;  1STE A;  3ZGZ A;  1IGD A;  2BTE A;  2J42 A;  1IBX A;  2G9H D;  1L0X B;  5HFY A;  5D3I B;  1KH0 A;  3AE9 B;  1L4D B;  4ZRQ A;  1ZPS A;  5G5G A;  4XWT A;  4ITK A;  2D5G A;  2G1E A;  3GP7 A;  1JW9 D;  4N58 A;  2KMM A;  3BK2 A;  2KAC A;  4OHJ A;  5EE0 A;  2V0G A;  1IBX B;  1XLP A;  3AEE B;  4JX1 C;  1SB3 C;  1SIJ A;  2OED A;  3VRA B;  3AM9 A;  1VZ7 A;  1PFD A;  1VZ8 A;  2CJN A;  1Y56 A;  4YXD B;  1I4R A;  2AQ2 B;  5MPO A;  1FNW A;  1JWA D;  1TZO A;  1B1Z A;  1J7B A;  1QIL A;  1TKG A;  2W3R A;  2AQ3 B;  4N6E B;  1NEN B;  1D5Z C;  1RYJ A;  1T6B X;  5H8Y E;  3R8B A;  1PGA A;  4HKQ A;  2Y5P A;  4GLS C;  3NRZ A;  2KQ4 X;  1A70 A;  2Y5C A;  5BYQ A;  2QEJ C;  3IXS A;  5BMG A;  3LXF A;  4WAF A;  3AMZ A;  5FK9 C;  1FD6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...