1XS9D

A model of the ternary complex formed between mara, the alpha-ctd of rna polymerase and dna
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
81
structure length
81
Chain Sequence
FDPILLRPVDDLELTVRSANCLKAEAIHYIGDLVQRTEVELLKTPNLGKKSLTEIKDVLASRGLSLGMRLENWPPASIADE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/dna
molecule keywords 5'-D(P*GP*AP*TP*TP*TP*AP*GP*CP*AP*AP*AP*AP*CP*GP*TP*GP*GP*CP
publication title Versatility of the carboxy-terminal domain of the alpha subunit of RNA polymerase in transcriptional activation: use of the DNA contact site as a protein contact site for MarA.
pubmed doi rcsb
source organism Escherichia coli
total genus 19
structure length 81
sequence length 81
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2004-10-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1xs9D00
2NRWA 2LYHA 4UAYA 3OSNA 5L1KA 4EBEA 4R64A 1Z00A 4KLGA 4DWIA 5CA7A 1ZQAA 5KFTA 4EBCA 1RXWA 4RT3A 4BGDA 4PGXA 5TZVA 4YXMA 4GXKA 4DQPA 8ICKA 4Z6EA 4UAZA 8ICQA 3K75D 4RPXA 3RH4A 1K1QA 3GV7B 4C8MA 2R8KA 2KFNA 9ICMA 9ICSA 1D8LA 4TQSA 3GIMA 4ED6A 5KFOA 4DFJA 1TVAA 3MR5A 3PX0A 4J9QA 4B9LA 4NLGA 8ICCA 3PX6A 2XY5A 3MR3A 4R8UA 4TQRA 4M47A 4R63A 4J9MA 3PW4A 1RZTA 2AGQA 2ALZA 9ICGA 3Q8SB 4DFPA 5KG1A 4RQ8A 4J9KA 2FPLA 4ED8A 3M8SA 2BDPA 1KLNA 4ED3A 1X9SA 3BJYA 5KFZA 5J2IA 4DOCA 5JUMA 3Q8PB 4DOAA 4FO6A 2ISOA 4O9MA 1XO1A 9ICRA 3PY8A 1LV5A 4M9JA 2JEGA 3MR2A 1D8YA 2HHTA 5DQGA 4ECXA 2ZUBA 3TI0A 4I2AA 4IQWA 3RH6A 1NJYA 7ICQA 4QZIA 3V6KA 4KLUA 4RU9A 3PW7A 2AQ0A 3PW0A 2JEFA 4KLOA 1MSWD 9ICAA 3AU2A 3M9MB 3HPOA 1NJXA 5KFRA 2R8IA 4Q8FA 2PI4A 8ICAA 1ZQTA 3MABA 7ICPA 1ZQWA 1KEJA 2IA6A 4ELVA 1XSPA 4DLEA 4UB1A 1WCNA 1EXNA 2OWOA 4DLGA 1NK9A 1S76D 3RB3A 1T3NA 4KLEA 3RJFA 4DSJA 4C8KA 7ICSA 4IRKA 4I27A 4RT2A 2FPMA 5J2KA 3NGDA 2ZTCA 1S0VA 4I29A 1BPDA 4ECUA 2BCVA 1BPYA 3EZ5A 4QZCA 4ELTA 3H8JA 5J2AA 4RQ6A 3G6VA 3N4MB 2M9NA 2BQ3A 4P4PA 3JPTA 3TQ1A 1ZQIA 7ICVA 9ICPA 3MDCA 5DQHA 8ICPA 5BPCA 2ASDA 1BPZA 5DG7A 3BQ1A 3SYZA 4IR1A 4GC7A 4EYHB 4O0IA 4YCXA 4EBDA 5CR0A 3BQ2A 3FDSA 4RQ0A 1C7YA 1TK0A 3BDPA 2XCAA 5KFBA 3KHLA 2XY7A 9ICLA 2I1QA 8ICVA 1L5UA 8ICWA 1ZQHA 4O3OA 4RNMA 8ICSA 2PFPA 2VA3A 1QSLA 4PHEA 2BGWA 4M9LA 4F92B 4RUAA 5KFEA 2ZJAA 1B22A 3T5LA 5F9LA 3JPRA 4GC6A 3EW9A 8ICUA 2XGQA 2BPGA 4QW8A 5KT2A 4MF8A 2R8HA 4B9NA 2HHXA 1RYSA 5KFYA 3T3FA 4DFMA 1QTMA 3PMNA 3KHHA 3QEAZ 1TAUA 1SKWA 2IMWP 4PHDA 3ZDCA 1ZQBA 9ICEA 5EWFA 3C21A 4QW9A 4Q43A 4BXOA 5BOMA 1ZQYA 2NRZA 4QZHA 2BHNA 4MEYA 4RNOA 1JXEA 3HW8A 3C5FA 4O5CA 3ZDEA 1ZYQA 4QZGA 5KT5A 4DQQA 3ISCA 1KDHA 5J0XA 3PR4A 5DB8A 1NK0A 3UQ2A 5DGAA 5KG7A 3PR5B 4R65A 5KFNA 1U49A 1CUKA 4PHPA 1ZQOA 3MFIA 3RTVA 3MGHA 3Q8LA 5KFXA 2Q0ZX 1TKDA 4YMNA 4IQUA 7ICIA 5DB9A 2FPKA 7ICTA 8ICOA 4KLIA 7ICOA 5KFLA 4ZH4A 5KT7A 4UQGA 3V72A 4EZ9A 5J0PA 1TK5A 4KN4A 2RDJA 2HVHA 9ICXA 5CHGA 2PFNA 1AROP 8ICMA 4UB2A 4UB5A 2Y1JA 3T5KA 1KFSA 2NRVA 4DS4A 2ASLA 2I9GA 1ZQSA 4ED1A 2R8JA 5DG9A 7ICLA 5KFIA 3G6XA 5EOZA 2PI5A 3JPSA 3Q8MA 4I2EA 2RDIA 8ICRA 5KG3A 2DPJA 3ZD8A 1KSPA 5KFMA 2DPIA 4DF8A 2BCSA 5DB7A 4FS2A 1HJPA 5L1LA 3V6JA 4C8NA 2JEJA 2P6RA 4YG2A 8ICTA 3TANA 3C5GA 4B9VA 9ICUA 4F2SA 3RB0A 1DGSA 2A1JB 3UXPA 4YR2A 2GWSA 4DQSA 3RJJA 3KTQA 5C5JA 4YQWA 7ICHA 2FMSA 5KFFA 4C8OA 3EPGA 7ICMA 4J9PA 4YN4A 3V7JA 4DOBA 1RXVA 4ECRA 4KMUA 5HP4A 2FLNA 5HMMA 9ICFA 2BCUA 1ZQQA 4MFFA 1BGXT 3C23A 3M9NB 3RRGA 5KG6A 3EPIA 5J2HA 4QWAA 3G6YA 2J6UA 4NM1A 8ICBA 3T5HA 3RRHA 9ICWA 5DDMA 2C28A 4I2GA 3PW2A 5HNKA 3C1YA 4DS5A 4DQRA 5KFJA 1X2IA 4NLKA 2ASJA 4QWBA 2P66A 4ELUA 4ECYA 4YXJA 2W9CB 5IILA 1SZPA 3C2KA 1S0NA 1S0OA 3EWAA 4ECQA 5KFDA 2NRXA 1PZNA 3HWTA 1TV9A 4TURA 5EWGA 1NK7A 3BQTA 3RBDA 4O5KA 3LWMA 4M04A 5CB1A 2A1JA 3KHRA 4M9HA 4MF2A 1KTQA 3K4GA 4KLLA 2AJQA 4I2JA 1Y88A 9ICJA 4RPYA 3QE9Y 2VA8A 3SI8A 3SZ2A 4M9NA 4YR3A 4GXIA 2BR0A 1NK5A 8ICYA 3OGUA 5CP2A 5J0RA 4F91B 5DLGA 4Z6CA 4O3NA 2KN7A 3MGIA 3TFSA 1NK6A 4QZ8A 5CWRA 1QSYA 2HHQA 2WTFA 1MQ3A 2FLLA 4IR9A 3BQ0A 5KT6A 4RQ3A 4KTQA 4F5NA 4BWJA 1UA1A 5KFPA 5DBBA 4QWCA 2XCPA 3HP6A 1RYRA 3KHGA 4BXOB 4UBCA 2C2DA 1LB2B 4JWMA 3PNCA 3T5JA 1NJWA 3Q8KA 1L3UA 2XC9A 2MUTB 4DO9A 5CJ7A 1RPLA 4ECSA 5J2BA 2W9CA 3RJEA 2JEIA 1KFTA 2ZJ5A 7ICEA 3GIIA 4PH5A 1NOMA 3ZDDA 3AU6A 2BCRA 4GXJA 5DKWA 1S9FA 9ICTA 3C2MA 5KT3A 4M0AA 2UVVA 4P2HA 5L1IA 4ED7A 4DFKA 2C2RA 1KFDA 2C2EA 3THVA 4RUCA 3UXOA 3M8RA 3GDXA 1ZQVA 4FBTA 1L3VA 1A76A 1ZJNA 2AGOA 4M2YA 2V4RA 4F4XA 2W9BB 4F4ZA 1U45A 3TAPA 1ZETA 1B43A 3FYHA 5L9XA 5KFVA 5BOLA 4GLXA 3TFRA 1ZQNA 1ZQEA 4PPXA 3TAQA 4B9TA 3RJGA 4RQ1A 3RR7A 4C8LA 1X9MA 8ICIA 2ZUCA 5DQIA 5L1JA 4RNNA 4M9GA 2C22A 9ICBA 4F4KA 7ICGA 1SL1A 4PHAA 5D46A 4MFAA 3AUOA 1BVSA 1SKSA 1T7PA 4EYIB 4G3IA 2MUTA 4Z6FA 4IQTA 4RZRA 5J2FA 3TARA 2HHUA 3MDAA 4KN7A 4LZDA 3GV8B 2J6TA 8ICZA 4IRDA 9ICCA 1BPEA 5DG8A 4QWEA 4TUPA 4O3QA 4QZAA 1DOQA 2ZTEA 4ECVA 3RJKA 2HHSA 5IIJA 4ED0A 1COOA 4F5PA 9ICNA 3OJSA 3ZDAA 2XGPA 5J0YA 4QZBA 2F1JA 1N56A 3MFHA 4MFCA 3PX4A 3HX0A 1K1SA 2W9BA 2BQUA 1NKBA 1ZQLA 3RJHA 9ICVA 7ICJA 4KLJA 4DSIA 1ZQUA 2BKEA 1JMSA 1T8EA 3LDAA 5KFGA 4JUZA 2IBKA 3ZDBA 4FS1A 1HUZA 4J9SA 2VA2A 2V4QA 4ECWA 4DQIA 4FBUA 3H40A 1ZQCA 4DL7A 8ICJA 5D4BA 3ISBA 4X5VA 4RPZA 2KZZA 4Z6DA 1H38A 2ZUDA 3OHAA 4F4YA 5DLFA 2HVIA 1BPXA 4F5RA 4B9UA 1NK8A 4KLQA 3RAXA 4I2DA 4NM2A 1BPBA 4J9LA 1ZQZA 3ZD9A 5HHIA 1JX4A 9ICOA 1X9WA 2BPFA 4KLFA 3QZ7A 4F3OA 1MC8A 5J0OA 4XQ8A 5J0UA 4DL3A 5J0SA 2BCQA 3RH5A 4M6WB 1XS9D 1XSLA 3UQ0A 3JPNA 1TK8A 4Q45A 1ZQKA 2B21A 3QZ8A 5J2CA 2W8KA 5KTQA 2R8GA 7ICFA 4F2RA 4O3SA 2AQ4A 3LWLA 1WCLA 4ECTA 3GIJA 1ZQJA 3UPQA 8ICNA 1ZQFA 1JN3A 4RQ4A 4JV0A 2KFZA 4QWDA 1HUOA 4YMOA 4RQ2A 3UXNA 1U4BA 5EWEA 2IHNA 3JPOA 4B9SA 4Q8EA 8ICGA 1ZQRA 4CCHA 4RQ7A 4UBBA 3H4DA 4O3RA 4TUQA 2P6UA 3ISDA 4IQVA 4I2IA 2AU0A 2IHMA 1UT5A 1NJZA 4I28A 4I2FA 4F50A 4O5EA 4NY8A 5IIKA 3MR6A 1KRPA 5KFAA 5KG4A 5J2DA 4EEYA 1SL2A 1S10A 4I2BA 3RBEA 2V9WA 4NLNA 1QLNA 7ICKA 2KTQA 2ATLA 4YMMA 2BQRA 1S77D 4XA5A 2JZBB 1JXLA 5IIMA 1ZQPA 5IINA 4F8RA 5F9NA 3IM1A 4DEZA 3ORYA 5J0TA 1ZQMA 1ZQDA 4M6WA 5J29A 1NK4A 4K4HA 3OSPA 2F1HA 4P4OA 4UB3A 4P4MA 1U47A 4MEXA 9ICHA 3GV5B 1U48A 8ICXA 1TFRA 4XRHA 4LZGA 2HHVA 1D9DA 1D9FA 3OJUA 2DFLA 5KG5A 5J2EA 3GQCA 4DSLA 4JV2A 4YD1A 1V9PA 1A77A 3RB4A 9ICKA 1NKCA 4YP3A 3B0YA 4QZDA 5D49A 4I2CA 2ZJ8A 4QZFA 3QEBZ 2NRTA 5KT4A 4KLTA 1ZJMA 1UT8A 5DB6A 4Q44A 3M9OB 3RAQA 3C1ZA 3IHQB 5HMLA 1L3SA 3NTUA 2PFQA 4DSEA 4UB4A 3V7LA 4NLZA 4ED2A 4HYKA 1T4GA 4J9RA 1IXRA 5KFWA 2JZBA 5DBCA 2HHWA 3SV4A 4K4IA 3Q8QB 8ICFA 4DF4A 5KFHA 4EZ6A 4YFKA 3SV3A 1NKEA 4DSFA 2FMQA 4J9OA 3GIKA 3RB6A 3PW5A 2J6SA 1L3TA 3MBYA 1SL0A 2KZMA 3E2EA 2XO7A 5DGBA 4YR0A 4DSKA 4PGQA 4TUSA 3V7KA 7ICRA 2PFOA 4KLSA 3LK9A 1S97A 8ICHA 4QZ9A 2F1IA 4KLDA 1TAQA 3JPQA 3JPPA 1IM4A 8ICEA 2ZTDA 5DDYA 4DL5A 1CEZA 4I2HA 4UAWA 2FLPA 4R66A 4F5QA 4LVSA 4BDPA 2W9MA 1N48A 2UVWA 4IRCA 2VANA 3H8WA 5KFQA 1Z00B 2H5XA 2Y1IA 1QSSA 2KZ3A 5KFKA 3HT3A 2MAXA 2PXIA 4ECZA 5J0WA 4F5OA 2UVRA 4YD2A 4J9NA 1Z3EB 4PGYA 9ICIA 1MQ2A 5J2JA 3ETLA 7ICNA 5DBAA 1JIHA 5KFCA 2W9AA 5KFSA 3PV8A 1ZQXA 4NXZA 3PO4A 4JK1A 4QZEA 5KFUA 5IIOA 1U9LA 1XWLA 3B0XA 2AGPA 4YVZA 9ICQA 5J0QA 1XSNA 4KLMA 3GILA 1UA0A 1XC9A 4K4GA 7ICUA 4R8UB 4F93B 4O3PA 3H8SA 4XUSA 3OHBA 3H4BA 2W8LA 3RJIA 3PVXA 1SKRA 4JV1A 5IIIA 4KITB 5HHHA 2BPCA 1S0MA 2XY6A 2ISPA 4RQ5A 4BWMA 1ZQGA 5KG0A 3N97B 4JWNA 4KLHA 3V6HA 4B9MA 3Q8RB 4DL4A 3C2LA 4F4WA 2UVUA 1XU4A 4DL6A 4E0DA 4DL2A 8ICLA 3RR8A 2HW3A 3H7IA 3PO5A 5J2GA 3GFKB 3EYZA 3PMLA 5KG2A 2FMPA
chains in the Genus database with same CATH superfamily
2NRWA 2LYHA 3OSNA 4EBEA 1Z00A 2YN4A 5EE0A 1RM6C 1N5WA 4RT3A 4GXKA 5G5GA 4UAZA 3RH4A 3CP8A 1Z1BA 2KJ9A 5AI9A 2Z7JA 5JTIA 3MR5A 1YT3A 3H8MA 3M6KA 1L7NA 8ICCA 2XY5A 4M47A 1RZTA 1SIJA 4DFPA 4ED8A 4C4TA 3DV9A 1KLNA 1WWVA 1X9SA 5JUMA 2ISOA 4O9MA 9ICRA 2F8LA 3MR2A 1D8YA 4OJ6A 3RFAA 3TADC 4QZIA 4RU9A 3L3FX 2AQ0A 2K4PA 5E79U 1MSWD 5KFRA 4HAIA 8ICAA 1WWUA 1ZQTA 2KSOA 5AM4A 4UB1A 1EXNA 1NK9A 3RB3A 4KLEA 3SAHA 4I27A 2FPMA 2ZTCA 1ZQIA 2YB4A 5DQHA 4UASA 5DG7A 1L6NA 4EYHB 4YCXA 4EBDA 2LBOA 8ICVA 2G06A 1ZQHA 8ICSA 4RNMA 1SWVA 1QSLA 4PHEA 2BGWA 5KFEA 3K1RB 5JU5A 2BPGA 4DFMA 1QTMA 3PMNA 3QEAZ 1M6YA 4PHDA 2IMWP 4AYBF 3C21A 4QW9A 2BDUA 4Q43A 2WF5A 1NZPA 1RG6A 2NRZA 4QZHA 4MEYA 3HW8A 4O5CA 1XNSA 2QKQA 1ZYQA 4QZGA 1KDHA 4NL9A 3PR4A 1PK1A 1NK0A 5DGAA 1U49A 5KFNA 4PHPA 3RTVA 1T3QA 5ALMA 5DB9A 4KLIA 4UQGA 3V72A 1TK5A 1VDVA 2KEYA 5GTHU 1AROP 2ZIUB 4DS4A 2ASLA 1ZQSA 4ED1A 2R8JA 2HSZA 2DQNB 5DG9A 7ICLA 3QU4A 2W7OA 4RQNA 5KG3A 4DF8A 5DB7A 1Z1VA 2H3FA 2KE7A 4B9VA 3C5GA 3ALRA 1WUDA 4F2SA 9ICUA 3QU7A 3QX7A 2GWSA 3WU2U 2FMSA 2KMDA 4J9PA 4YN4A 4KMUA 9ICFA 2KIVA 4O3MA 3RRGA 4QWAA 3NVWA 2J6UA 4NM1A 3UM9A 2E8MA 4I2GA 3PW2A 1OXJA 2HCFA 4PZOA 2P66A 2KHVA 1SZPA 3C2KA 5AKZA 3MGVA 1X42A 5KFDA 2NRXA 1PZNA 3A0HU 4O5KA 3ED5A 3LWMA 2A1JA 4M9HA 4MF2A 3KD3A 2AJQA 9ICJA 3SI8A 2K4EA 2A1AA 3MGIA 4F91B 2KKPA 5AK3A 4IR9A 3BQ0A 4UB6U 4RQ3A 5ALWA 4KTQA 4BWJA 4A8EA 2XCPA 4QWCA 1UA1A 4Y2JA 3HP6A 1RYRA 3KHGA 1YZ7A 1N63A 3BQ7A 1SXDA 3Q8KA 4DO9A 5J2BA 3HKZF 3WK4A 4PH5A 1NOMA 4Y2QA 2BCRA 9ICTA 5KT3A 4M0AA 3AN1A 1RQNA 5H2FU 2C2EA 3THVA 4FBTA 5ALNA 4Y2RA 1HIWA 4BUGA 2K4IA 3FYHA 5L9XA 1ZQNA 4GLXA 2MA1A 2YQEA 1FO4A 5AKXA 1Q3VA 5L1JA 5HR6A 3OTQA 1JI7A 1SL1A 5D46A 4MFAA 3AUOA 1BVSA 1T7PA 4EYIB 2MUTA 1TE2A 3TARA 2HHUA 3MDAA 4LZDA 1V97A 2VJ5A 3GV8B 4CGZA 5AM3A 5ALEA 1UQVA 9ICCA 5DG8A 4TUPA 4ECVA 4QZAA 2D3DA 3PSFA 3ZDAA 3F2BA 4QZBA 2F1JA 2NO5A 1K1SA 3BZKA 2M0NA 9ICVA 4CF4A 3LDAA 5L1MA 4FS1A 1HUZA 1UPHA 5AHXA 3KZIU 1ZQZA 4IS7A 3ZD9A 9ICOA 4KLFA 3QZ7A 3UQ0A 1TK8A 5J2CA 4PL1A 5KTQA 2AQ4A 2OYYA 2KFZA 4RQ4A 4QWDA 2GH1A 4YMOA 1SWWA 4RQ2A 5EWEA 1ZQRA 5CEHA 4RQ7A 3H4DA 4C4RA 4I28A 5AICA 4NV0A 3IG8A 1QLNA 2V9WA 2Y9UA 2ATLA 5IIMA 1S5LU 2I5HA 5AK4A 1ED1A 5J0TA 5J29A 2K8CB 4AYBC 1QQ7A 4P4OA 1U47A 2KHQA 1Z19A 8ICXA 1J2NA 4LZGA 4BJQA 3OJUA 3RB4A 3OPXA 4FZMA 4QZDA 4I2CA 2JXJA 3QEBZ 1ZJMA 3RAQA 2QB1A 3NTUA 4UB4A 1T4GA 1S8OA 1WG8A 8ICFA 1NNLA 1ZOLA 4USAA 5F3XB 2FMQA 2KZMA 3MBYA 1SL0A 4PGQA 3V7KA 3LK9A 2WF7A 2F1IA 4CF5A 3JPQA 3JPPA 8ICEA 5DDYA 4UAWA 4F5QA 1JALA 2B0CA 2W3RA 2W9MA 3M7DA 4CDGA 5KFKA 2UVRA 4PGYA 5J2JA 5KFSA 3PV8A 2LYAA 4NXZA 4JK1A 5IIOA 1ZD3A 3B0XA 3OHBA 1KQQA 5HHHA 3K1ZA 2ISPA 4RQ5A 1ZQGA 3N97B 4KLHA 1OW5A 3Q8RB 2DF4B 2H3QA 2G08A 3PO5A 2EQYA 3EYZA 2FMPA 4QJFB 4UAYA 5L1KA 4FZLA 4KX3A 4DWIA 5KFTA 1RXWA 2KVSA 4YXMA 1VJ5A 3N7PD 4Z6EA 8ICQA 3SAGA 1LKYB 2E8NA 2KFNA 9ICMA 5KFOA 4DFJA 1TVAA 3PX0A 5ALFA 4NLGA 4R8UA 3HKZC 4J9MA 1N60A 2ALZA 2DKXA 3FC4A 2BDPA 2RRDA 4FE3A 5ALVA 5AKIA 5KFZA 3BS5B 4DOCA 4PL2A 2YMQA 1NJYA 7ICQA 3V6KA 1FEZA 5GTIU 4KLOA 3T79A 1NJXA 1Z4OA 1ZQWA 3VC8A 5AKGA 2IA6A 4ELVA 1S76D 3RJFA 3R9KA 4DSJA 2H3IA 1V38A 2EAOA 3HRDD 1CI4A 1BPDA 4ECUA 2BCVA 5ALTA 4QZCA 4ELTA 5J2AA 1SZHA 7ICVA 9ICPA 3MDCA 8ICPA 4GC7A 4EEKA 4O0IA 4DFDA 5CR0A 3QUTA 3KBBA 1TK0A 2PFPA 3AQEA 5ALZA 4M9LA 1FFUA 4RUAA 2EH9A 4GC6A 1RYSA 5KFYA 3T3FA 2HMXA 2E1FA 2HBJA 5AI5A 1JROA 4EX6A 3PZPA 4RNOA 3ZDEA 4LJXA 1L7OA 4DQQA 5J0XA 5DB8A 1F44A 3FAHA 5KG7A 4MHVA 3WK9A 2KD1A 3MFIA 3Q8LA 1ZRNA 2MRLA 2EZZA 7ICOA 4ZH4A 2NYVA 4EZ9A 2EANA 3T5KA 4C7ZA 2NRVA 2I9GA 5KFIA 5EOZA 4KMOB 2LM4A 3CW2C 3L5KA 4Y2UA 1JUDA 2D8CA 3ZD8A 3WKAA 2JEJA 4OO1J 2BZFA 2HOQA 3RB0A 1DGJA 4YR2A 3RJJA 4YQWA 3KFUF 4C8OA 3EPGA 7ICMA 3NS1A 3V7JA 2OH2A 2GO7A 4ECRA 5HP4A 5HMMA 2BCUA 1ZQQA 4MFFA 3HJEA 5KG6A 5J2HA 4J03A 5AM1A 3T5HA 3RRHA 1NI3A 5JRTA 5KFJA 5AKJA 4YXJA 2W9CB 2ZIVA 1S0NA 4ECQA 3D6JA 1KTQA 4I2JA 1ECWA 3QE9Y 2VA8A 4GXIA 2BR0A 1NK5A 5J0RA 4O3NA 1QSYA 4QZ8A 4GFJA 2JMGA 2WTFA 2FLLA 2W3SA 5KT6A 2EZYA 4F5NA 5TISU 4BXOB 5KFPA 5DBBA 3KKAC 4JWMA 4Y2YA 3T5JA 2JHDA 3RJEA 1KFTA 2JEIA 4UB8U 3IRUA 1X6JA 5DKWA 3WKEA 1YZ6A 2QB0B 2OM6A 4P2HA 4ED7A 4DFKA 2C2RA 3M8RA 3GDXA 2AGOA 2V4RA 4F4ZA 2W9BB 1U45A 2F8KA 1F0MA 1B43A 3TFRA 5AK5A 3PSIA 3RR7A 1X9MA 8ICIA 5AKYA 4ICAA 2ZUCA 5HR7A 4RNNA 2A19A 2ZIXB 4M9GA 9ICBA 4F4KA 7ICGA 2KP7A 5AM0A 2ZIWA 1SKSA 4IQTA 5AI8A 5J2FA 3I1YA 2HBKA 5ALRA 2KNJA 8ICZA 2XI9A 1BPEA 4QWEA 1DOQA 2ZTEA 3RJKA 1KN5A 2Q4TA 4C80A 4BX9C 2OXOA 4P0QB 1N56A 2F2AB 5AKEA 4MFCA 1ZD4A 1ZQLA 1VLBA 3E58A 4DSIA 1ZQUA 1JMSA 1T8EA 2IBKA 4Y2TA 3LVVA 5AKHA 2V4QA 4DQIA 3H40A 1ZQCA 4DL7A 8ICJA 2RP5A 3ISBA 4X5VA 3VCBA 4RPZA 2KZZA 3QU9A 2W55A 4Z6DA 1H38A 3OHAA 5DLFA 2HVIA 3UMGA 4B9UA 3QU5A 4NM2A 1BPBA 2WF6A 1X9WA 2Y0SF 1MC8A 2L5YA 5J0UA 3RH5A 3H0LB 1XSLA 4Q45A 1ZQKA 3S6JA 7ICFA 4F2RA 3D2NA 4OJLA 3LWLA 1WCLA 5AI4A 3UPQA 1JN3A 4JV0A 2IOHA 2OEHA 4B9SA 3QUCA 2RQ5A 3SAFA 4O3RA 2P6UA 9ICWA 2K4HA 1UT5A 1NJZA 2QARB 2E8PA 1KRPA 5KFAA 5KG4A 2VJ4A 7ICKA 5KL1B 2JZBB 1JXLA 4C7YA 1ZQPA 3TACB 3CNHA 4M6WA 4K4HA 5AI0A 4XRHA 1D9DA 1D9FA 5J2EA 3GQCA 4YD1A 1V9PA 9ICKA 2NO4A 4YP3A 2F77X 2HOIA 5D49A 2GOLA 5J8YC 4RQMA 3WK5A 4Q44A 2H3VA 1L3SA 4DSEA 4CF3A 3BS5A 4HYKA 4J9RA 2G0AA 4YFKA 3SV3A 3KOOA 2J6SA 3PW5A 1UCVA 3M6ZA 1L7PA 4Y2SA 3E2EA 4YR0A 4DSKA 4TUSA 2CPRA 2YMMA 4KLSA 1V85A 1S97A 4KLDA 1CEZA 2ZTDA 2FLPA 4LVSA 1X66A 2UVWA 2VANA 5KFQA 1Z00B 2Y1IA 1QSSA 2KZ3A 2W54A 2PXIA 4F5OA 1F5SA 5ALPA 3AEVA 1UHUA 3ETLA 7ICNA 5DBAA 1JIHA 5KFCA 2W9AA 4QZEA 2AGPA 9ICQA 1XSNA 4KLMA 3TKAA 3GILA 7ICUA 4O3PA 3A0BU 3RJIA 2CRXA 4JV1A 5IIIA 4KITB 2BPCA 1K5OA 2XY6A 2G07A 3RR8A 2HW3A 2KIWA 5KG2A 3QUBA 2AH5A 2Y9TA 4KLGA 4EELA 5CA7A 1ZQAA 4EBCA 1L8LA 3WK6A 4BGDA 5TZVA 1IV8A 5ALHA 3K75D 4RPXA 3GV7B 4C8MA 2R8KA 4TQSA 3GIMA 4ED6A 3E0FA 2I6XA 5ALGA 2KSOB 1X40A 4B9LA 3MR3A 2DL0A 4TQRA 4R63A 2AGQA 9ICGA 3Q8SB 4RQ8A 4J9KA 1JRPA 2YMPA 2FPLA 4UAUA 3SD7A 4B6JA 3Q8PB 4DOAA 1QH9A 2H3ZA 1DXSA 1LV5A 4M9JA 2F44A 3IG5A 4ECXA 2ZUBA 4IQWA 4I2AA 1L7MA 2W7PA 4UAVA 4KLUA 2AHOB 3PW0A 3AU2A 3M9MB 3HPOA 4Q8FA 3FM9A 5KAFU 2N1RA 1KEJA 1WCNA 5FP0A 4DLGA 2PKEA 4C8KA 3QYPA 4IRKA 2LKYA 3NGDA 2ODGA 3ICXA 1BPYA 3EZ5A 3H8JA 3N4MB 2BQ3A 3TADA 3TQ1A 5BPCA 3F2DA 1QCKA 3BQ1A 4IR1A 3BS7A 3FDSA 1C7YA 3BDPA 4UARA 2XCAA 5KFBA 2I1QA 4CNQA 1L5UA 1AQ6A 4O3OA 3WKDA 2ZG6A 5ALKA 1A0PA 3T5LA 5F9LA 3JPRA 3EW9A 4QW8A 5KT2A 4MF8A 2R8HA 2HHXA 2Y0SC 3KHHA 1GO3F 1J97A 9ICEA 3KKAA 4ZOHC 4BXOA 1N2XA 2BHNA 1JXEA 2WF9A 3UQ2A 4R65A 1ZQOA 4UW9A 1TKDA 4IQUA 3IV6A 7ICIA 2FPKA 3C28A 7ICTA 8ICOA 5KFLA 5KT7A 9ICXA 4KN4A 2AXTU 5CRXA 2LMRA 4QNLA 2HDOA 2PFNA 4UB2A 4UB5A 2Y1JA 1KFSA 2ZXIA 2JGAA 2RHFA 1XO0A 3C29A 2PI5A 1X9XA 2W03A 2RDIA 8ICRA 5AIAA 5ALIA 2DPIA 2BCSA 5KL8B 4P0PB 1P7DA 1HJPA 2ZIXA 2P6RA 3TANA 4IL6U 3SR6A 2A1JB 3UXPA 2OHFA 3N7RC 2KV2A 4NJ8A 3M1YA 1FFVA 2O6KA 4JB3A 4DOBA 1RXVA 2FLNA 3C23A 3M9NB 2ZIUA 4C4SA 8ICBA 5DDMA 2C28A 1RYUA 1BNOA 4NLKA 2ASJA 4QWBA 4ELUA 4ECYA 5IILA 3EWAA 2OCEA 3BQTA 3B9JA 4KLLA 3KHRA 3K4GA 2LM1A 3PSTA 1PVRA 4YR3A 8ICYA 3OGUA 5CP2A 5DLGA 4Z6CA 3TFSA 1X6IA 8ICKA 2NV3A 3IN5A 5KNIA 1LB2B 2A3VA 1NJWA 1L3UA 2XC9A 2MUTB 5CJ7A 1RPLA 2HI0A 1N5XA 2EAMA 4ECSA 4WJ3B 2KICA 3N28A 3ZDDA 1IIPA 4GXJA 2KOBA 2UVVA 2W43A 1L3VA 1A76A 2MU2A 3TAPA 2WB1F 1ZETA 5KFVA 5BOLA 1ZQEA 5ALOA 2KG5A 1MN8A 4C8LA 2G09A 4F72A 1D8BA 2W04A 4Z6FA 4RZRA 1O08A 4KN7A 2J6TA 5G5HA 2K89A 2HHSA 1OUQA 2E1EA 5J0YA 5B5EU 3HX0A 2BQUA 2CXYA 7ICJA 2BKEA 4JUZA 3ZDBA 4J9SA 2LYBA 5D4BA 2WF8A 4EENA 1J2MA 3AMZA 1T94A 1NK8A 2PMZF 4I2DA 5HHIA 1JX4A 2FDRA 4F3OA 5J0OA 4XQ8A 2BCQA 5AKKA 4Y2VA 2W8KA 2R8GA 3KZXA 1FIQA 4ECTA 3GIJA 1ZQJA 1A6SA 1HUOA 4U6PA 3UXNA 8ICGA 3ISDA 2LI6A 4I2IA 4IQVA 2IHMA 2B6GA 4NY8A 3MR6A 1SL2A 5J2DA 4I2BA 2VIXA 1S10A 3RBEA 2KTQA 2BQRA 4XA5A 3DEEA 4F8RA 2DWQA 2G5HB 3ORYA 2EDUA 1ZQDA 3WKCA 1NK4A 3OSPA 2F1HA 2F3NA 4UB3A 3L4PA 2JR5A 2HHVA 2YX8A 2DFLA 5KG5A 4JV2A 4DSLA 1NKCA 3B0YA 1NZBA 1Z4NA 2ZJ8A 2FJ6A 4QIWF 2NRTA 3HILA 5KT4A 4KLTA 5ALSA 5DB6A 3C1ZA 3IHQB 2HOFA 2XVTA 4ED2A 1ZRMA 5KFWA 5DBCA 4K4IA 3Q8QB 3O0FA 1RDFA 2KJ8A 1NKEA 4DSFA 3MC1A 3NRWA 3GIKA 1L3TA 3WK8A 7ICRA 2PFOA 1KL9A 1ZD2P 3QU2A 1TAQA 1IM4A 4R66A 2E5SA 2F76X 4BDPA 3AL0B 4IRCA 3H8WA 5EE3A 3LYSA 3F53A 4ECZA 4J9NA 1Z3EB 1MQ2A 2E3TA 4PZNA 4OD0A 3PO4A 5ALXA 5KFUA 1U9LA 1XWLA 3GU3A 5J0QA 1DRGA 1XC9A 3H0MB 4K4GA 4R8UB 4F93B 3H4BA 2XIDA 4BWMA 1COKA 1PVPA 3DDHA 3V6HA 4DL4A 3C2LA 4F4WA 3UMCA 2UVUA 1XU4A 3LVWA 3SQIA 4KX5A 5J2GA 2JH7A 1CRXA 4R64A 5C0YA 3WKBA 4PGXA 4DQPA 1SV0C 2HBLA 4Y2XA 3NASA 4CE6A 1K1QA 9ICSA 1D8LA 2ZXHA 3BZCA 5ALDA 2RLTA 2G5IB 5AM2A 4J9QA 2JV3A 3PX6A 3PSPA 3PW4A 5KG1A 2WAQF 3QUQA 3SEIA 3M8SA 4ED3A 5T14A 3BJYA 5J2IA 4FO6A 1XO1A 3PY8A 2JEGA 2HHTA 5DQGA 4IC9A 3TI0A 3QXGA 2WB1C 3RH6A 1LKYA 3PW7A 4P0PA 2D6FC 2JEFA 2ESEA 9ICAA 3AQFA 2DBYA 2R8IA 2PI4A 2QLTA 3MABA 7ICPA 3NUQA 1XSPA 3IDWA 4DLEA 2EZXA 2OWOA 4NWIA 1T3NA 4ACOA 7ICSA 4RT2A 2WHEA 5J2KA 1S0VA 4I29A 3EUB2 4DCCA 4RQ6A 3G6VA 2M9NA 5EE1A 4P4PA 2CN1A 3JPTA 3U26A 2ASDA 1BPZA 3SYZA 3BQ2A 4RQ0A 3KHLA 2XY7A 9ICLA 8ICWA 2VA3A 2K8AA 4FZNA 4F92B 2K60A 4FFDA 3SMVA 2ZJAA 1B22A 2PMZC 8ICUA 2XGQA 4B9NA 1TAUA 1SKWA 3ZDCA 4NLCA 1ZQBA 5EWFA 3AM9A 5BOMA 1ZQYA 3C5FA 5KT5A 1KW4A 3ISCA 3PR5B 1CUKA 3MGHA 5KFXA 2Q0ZX 4YMNA 1ZXIA 5K4LA 2HVHA 5J0PA 2RDJA 4C0ZA 5CHGA 5ALJA 5A0LA 4OJOA 4U7CA 8ICMA 4OJPA 1PVQA 3G6XA 3JPSA 3Q8MA 3CYMA 4F71A 4I2EA 2DPJA 1KSPA 2ZIVB 5KFMA 4FS2A 5L1LA 3V6JA 4C8NA 8ICTA 4YG2A 3ONNA 1B0XA 1DGSA 4DQSA 3KTQA 5C5JA 7ICHA 1L8OA 5KFFA 1DK3A 4Y2PA 4QIWC 3ZI4A 5ALQA 5KAIU 3D2QA 4JMUA 1BGXT 2MSNA 3EPIA 1KBUA 4US9A 3G6YA 1N62A 5HNKA 3C1YA 4DS5A 1IG6A 4DQRA 1X2IA 2IOFA 4G9BA 1S0OA 1TV9A 3HWTA 2IOFK 4TURA 5EWGA 2DKZA 3RBDA 1NK7A 4M04A 5CB1A 2LPEA 1C20A 1Y88A 2JH1A 4RPYA 1QQ6A 2KK0A 5AIBA 3SZ2A 3I76A 4M9NA 2GLEA 2KN7A 1NK6A 3D2SA 2W11A 5EE9A 5CWRA 2HHQA 3ETRA 1MQ3A 4NLBA 2YY6A 4UBCA 2C2DA 4US8A 3PNCA 2ZIWB 1PK1B 1WYGA 4CRXA 5AI6A 2W9CA 2ZJ5A 7ICEA 3GIIA 4NL9C 3AU6A 3UMBA 1S9FA 3C2MA 3CRXA 1KKXA 5L1IA 1KFDA 4RUCA 3UXOA 1ZQVA 1ZJNA 2YB1A 4OCZA 3H0RB 3NVYA 4F4XA 4M2YA 4PPXA 3TAQA 4B9TA 3F2CA 3RJGA 4RQ1A 5DQIA 2KVCA 1URJA 3F5EA 2E8OA 2C22A 4PHAA 3NVVA 4G3IA 2K8BB 5B66U 4IRDA 4O3QA 5IIJA 4ED0A 1COOA 2WAQC 2QB0A 4F5PA 9ICNA 3OJSA 1SV4A 2XGPA 4EX7A 1TAMA 3MFHA 3PX4A 5AM5A 2W9BA 1NKBA 1RQLA 3RJHA 1MA7A 4KLJA 5ALYA 5KFGA 2VA2A 4ECWA 4FBUA 2KJ5A 3NRZA 3WK7A 2ZUDA 4F4YA 1BPXA 4F5RA 3NVZA 4KLQA 3RAXA 2FI1A 4J9LA 1BNPA 2BPFA 2YMLA 4DL3A 3GZFA 5J0SA 4M6WB 1XS9D 3JPNA 4P0QA 2B21A 3QZ8A 1SXEA 4O3SA 2KKVA 1QQ5A 1Q46A 2YTUA 3J81j 8ICNA 1ZQFA 3RF9A 1HEKA 3IP4B 2P35A 1U4BA 2IHNA 4Q8EA 3JPOA 4CCHA 4UBBA 4TUQA 2AU0A 4I2FA 1O03A 4F50A 4O5EA 5IIKA 4EEYA 3N7SC 4NLNA 4YMMA 1S77D 4UATA 1SV0A 5IINA 5F9NA 3IM1A 4DEZA 2EAPA 1ZQMA 4MEXA 4P4MA 9ICHA 1PK3A 2LHTA 3GV5B 5ALLA 1U48A 1TFRA 1A77A 1PUZA 4QZFA 2VKQA 1UT8A 5AKLA 3I28A 3M9OB 2QARA 1Q3UA 5HMLA 2PFQA 1DK2A 3V7LA 4NLZA 1SB3C 3SENA 1IXRA 2XICA 2JZBA 2HHWA 3SV4A 4DF4A 5KFHA 4EZ6A 4GIBA 4J9OA 3RB6A 4OJ5A 1N61A 2FE9A 2XO7A 5DGBA 2JRZA 8ICHA 4QZ9A 4PJ0U 4DL5A 5J8YA 4I2HA 1N48A 2H5XA 2R18A 5ALUA 3HT3A 2MAXA 5J0WA 1ZD5A 3F5AA 4YD2A 5AK6A 1LVHA 2HBMA 9ICIA 4AP9A 2WFAA 1ZQXA 1ZQ1C 1B4FA 4YVZA 3QNMA 1UA0A 3H8SA 4XUSA 2W8LA 1SGGA 3PVXA 1SKRA 1S0MA 4JWNA 5KG0A 2DGZA 4B9MA 4DL6A 4E0DA 8ICLA 4DL2A 3H7IA 1Q8KA 3GFKB 2DUYA 2ES6A 3PMLA
chains in the Genus database with same CATH topology
2NRWA 2LYHA 4UAYA 3OSNA 5L1KA 4EBEA 4R64A 1Z00A 4KLGA 4DWIA 5CA7A 1ZQAA 5KFTA 4EBCA 1RXWA 4RT3A 4BGDA 4PGXA 5TZVA 4YXMA 4GXKA 4DQPA 8ICKA 4Z6EA 4UAZA 8ICQA 3K75D 4RPXA 3RH4A 1K1QA 3GV7B 4C8MA 2R8KA 2KFNA 9ICMA 9ICSA 1D8LA 4TQSA 3GIMA 4ED6A 5KFOA 4DFJA 1TVAA 3MR5A 3PX0A 4J9QA 4B9LA 4NLGA 8ICCA 3PX6A 2XY5A 3MR3A 4R8UA 4TQRA 4M47A 4R63A 4J9MA 3PW4A 1RZTA 2AGQA 2ALZA 9ICGA 3Q8SB 4DFPA 5KG1A 4RQ8A 4J9KA 2FPLA 4ED8A 3M8SA 2BDPA 1KLNA 4ED3A 1X9SA 3BJYA 5KFZA 5J2IA 4DOCA 5JUMA 3Q8PB 4DOAA 4FO6A 2ISOA 4O9MA 1XO1A 9ICRA 3PY8A 1LV5A 4M9JA 2JEGA 3MR2A 1D8YA 2HHTA 5DQGA 4ECXA 2ZUBA 3TI0A 4I2AA 4IQWA 3RH6A 1NJYA 7ICQA 4QZIA 3V6KA 4KLUA 4RU9A 3PW7A 2AQ0A 3PW0A 2JEFA 4KLOA 1MSWD 9ICAA 3AU2A 3M9MB 3HPOA 1NJXA 5KFRA 2R8IA 4Q8FA 2PI4A 8ICAA 1ZQTA 3MABA 7ICPA 1ZQWA 1KEJA 2IA6A 4ELVA 1XSPA 4DLEA 4UB1A 1WCNA 1EXNA 2OWOA 4DLGA 1NK9A 1S76D 3RB3A 1T3NA 4KLEA 3RJFA 4DSJA 4C8KA 7ICSA 4IRKA 4I27A 4RT2A 2FPMA 5J2KA 3NGDA 2ZTCA 1S0VA 4I29A 1BPDA 4ECUA 2BCVA 1BPYA 3EZ5A 4QZCA 4ELTA 3H8JA 5J2AA 4RQ6A 3G6VA 3N4MB 2M9NA 2BQ3A 4P4PA 3JPTA 3TQ1A 1ZQIA 7ICVA 9ICPA 3MDCA 5DQHA 8ICPA 5BPCA 2ASDA 1BPZA 5DG7A 3BQ1A 3SYZA 4IR1A 4GC7A 4EYHB 4O0IA 4YCXA 4EBDA 5CR0A 3BQ2A 3FDSA 4RQ0A 1C7YA 1TK0A 3BDPA 2XCAA 5KFBA 3KHLA 2XY7A 9ICLA 2I1QA 8ICVA 1L5UA 8ICWA 1ZQHA 4O3OA 4RNMA 8ICSA 2PFPA 2VA3A 1QSLA 4PHEA 2BGWA 4M9LA 4F92B 4RUAA 5KFEA 2ZJAA 1B22A 3T5LA 5F9LA 3JPRA 4GC6A 3EW9A 8ICUA 2XGQA 2BPGA 4QW8A 5KT2A 4MF8A 2R8HA 4B9NA 2HHXA 1RYSA 5KFYA 3T3FA 4DFMA 1QTMA 3PMNA 3KHHA 3QEAZ 1TAUA 1SKWA 2IMWP 4PHDA 3ZDCA 1ZQBA 9ICEA 5EWFA 3C21A 4QW9A 4Q43A 4BXOA 5BOMA 1ZQYA 2NRZA 4QZHA 2BHNA 4MEYA 4RNOA 1JXEA 3HW8A 3C5FA 4O5CA 3ZDEA 1ZYQA 4QZGA 5KT5A 4DQQA 3ISCA 1KDHA 5J0XA 3PR4A 5DB8A 1NK0A 3UQ2A 5DGAA 5KG7A 3PR5B 4R65A 5KFNA 1U49A 1CUKA 4PHPA 1ZQOA 3MFIA 3RTVA 3MGHA 3Q8LA 5KFXA 2Q0ZX 1TKDA 4YMNA 4IQUA 7ICIA 5DB9A 2FPKA 7ICTA 8ICOA 4KLIA 7ICOA 5KFLA 4ZH4A 5KT7A 4UQGA 3V72A 4EZ9A 5J0PA 1TK5A 4KN4A 2RDJA 2HVHA 9ICXA 5CHGA 2PFNA 1AROP 8ICMA 4UB2A 4UB5A 2Y1JA 3T5KA 1KFSA 2NRVA 4DS4A 2ASLA 2I9GA 1ZQSA 4ED1A 2R8JA 5DG9A 7ICLA 5KFIA 3G6XA 5EOZA 2PI5A 3JPSA 3Q8MA 4I2EA 2RDIA 8ICRA 5KG3A 2DPJA 3ZD8A 1KSPA 5KFMA 2DPIA 4DF8A 2BCSA 5DB7A 4FS2A 1HJPA 5L1LA 3V6JA 4C8NA 2JEJA 2P6RA 4YG2A 8ICTA 3TANA 3C5GA 4B9VA 9ICUA 4F2SA 3RB0A 1DGSA 2A1JB 3UXPA 4YR2A 2GWSA 4DQSA 3RJJA 3KTQA 5C5JA 4YQWA 7ICHA 2FMSA 5KFFA 4C8OA 3EPGA 7ICMA 4J9PA 4YN4A 3V7JA 4DOBA 1RXVA 4ECRA 4KMUA 5HP4A 2FLNA 5HMMA 9ICFA 2BCUA 1ZQQA 4MFFA 1BGXT 3C23A 3M9NB 3RRGA 5KG6A 3EPIA 5J2HA 4QWAA 3G6YA 2J6UA 4NM1A 8ICBA 3T5HA 3RRHA 9ICWA 5DDMA 2C28A 4I2GA 3PW2A 5HNKA 3C1YA 4DS5A 4DQRA 5KFJA 1X2IA 4NLKA 2ASJA 4QWBA 2P66A 4ELUA 4ECYA 4YXJA 2W9CB 5IILA 1SZPA 3C2KA 1S0NA 1S0OA 3EWAA 4ECQA 5KFDA 2NRXA 1PZNA 3HWTA 1TV9A 4TURA 5EWGA 1NK7A 3BQTA 3RBDA 4O5KA 3LWMA 4M04A 5CB1A 2A1JA 3KHRA 4M9HA 4MF2A 1KTQA 3K4GA 4KLLA 2AJQA 4I2JA 1Y88A 9ICJA 4RPYA 3QE9Y 2VA8A 3SI8A 3SZ2A 4M9NA 4YR3A 4GXIA 2BR0A 1NK5A 8ICYA 3OGUA 5CP2A 5J0RA 4F91B 5DLGA 4Z6CA 4O3NA 2KN7A 3MGIA 3TFSA 1NK6A 4QZ8A 5CWRA 1QSYA 2HHQA 2WTFA 1MQ3A 2FLLA 4IR9A 3BQ0A 5KT6A 4RQ3A 4KTQA 4F5NA 4BWJA 1UA1A 5KFPA 5DBBA 4QWCA 2XCPA 3HP6A 1RYRA 3KHGA 4BXOB 4UBCA 2C2DA 1LB2B 4JWMA 3PNCA 3T5JA 1NJWA 3Q8KA 1L3UA 2XC9A 2MUTB 4DO9A 5CJ7A 1RPLA 4ECSA 5J2BA 2W9CA 3RJEA 2JEIA 1KFTA 2ZJ5A 7ICEA 3GIIA 4PH5A 1NOMA 3ZDDA 3AU6A 2BCRA 4GXJA 5DKWA 1S9FA 9ICTA 3C2MA 5KT3A 4M0AA 2UVVA 4P2HA 5L1IA 4ED7A 4DFKA 2C2RA 1KFDA 2C2EA 3THVA 4RUCA 3UXOA 3M8RA 3GDXA 1ZQVA 4FBTA 1L3VA 1A76A 1ZJNA 2AGOA 4M2YA 2V4RA 4F4XA 2W9BB 4F4ZA 1U45A 3TAPA 1ZETA 1B43A 3FYHA 5L9XA 5KFVA 5BOLA 4GLXA 3TFRA 1ZQNA 1ZQEA 4PPXA 3TAQA 4B9TA 3RJGA 4RQ1A 3RR7A 4C8LA 1X9MA 8ICIA 2ZUCA 5DQIA 5L1JA 4RNNA 4M9GA 2C22A 9ICBA 4F4KA 7ICGA 1SL1A 4PHAA 5D46A 4MFAA 3AUOA 1BVSA 1SKSA 1T7PA 4EYIB 4G3IA 2MUTA 4Z6FA 4IQTA 4RZRA 5J2FA 3TARA 2HHUA 3MDAA 4KN7A 4LZDA 3GV8B 2J6TA 8ICZA 4IRDA 9ICCA 1BPEA 5DG8A 4QWEA 4TUPA 4O3QA 4QZAA 1DOQA 2ZTEA 4ECVA 3RJKA 2HHSA 5IIJA 4ED0A 1COOA 4F5PA 9ICNA 3OJSA 3ZDAA 2XGPA 5J0YA 4QZBA 2F1JA 1N56A 3MFHA 4MFCA 3PX4A 3HX0A 1K1SA 2W9BA 2BQUA 1NKBA 1ZQLA 3RJHA 9ICVA 7ICJA 4KLJA 4DSIA 1ZQUA 2BKEA 1JMSA 1T8EA 3LDAA 5KFGA 4JUZA 2IBKA 3ZDBA 4FS1A 1HUZA 4J9SA 2VA2A 2V4QA 4ECWA 4DQIA 4FBUA 3H40A 1ZQCA 4DL7A 8ICJA 5D4BA 3ISBA 4X5VA 4RPZA 2KZZA 4Z6DA 1H38A 2ZUDA 3OHAA 4F4YA 5DLFA 2HVIA 1BPXA 4F5RA 4B9UA 1NK8A 4KLQA 3RAXA 4I2DA 4NM2A 1BPBA 4J9LA 1ZQZA 3ZD9A 5HHIA 1JX4A 9ICOA 1X9WA 2BPFA 4KLFA 3QZ7A 4F3OA 1MC8A 5J0OA 4XQ8A 5J0UA 4DL3A 5J0SA 2BCQA 3RH5A 4M6WB 1XS9D 1XSLA 3UQ0A 3JPNA 1TK8A 4Q45A 1ZQKA 2B21A 3QZ8A 5J2CA 2W8KA 5KTQA 2R8GA 7ICFA 4F2RA 4O3SA 2AQ4A 3LWLA 1WCLA 4ECTA 3GIJA 1ZQJA 3UPQA 8ICNA 1ZQFA 1JN3A 4RQ4A 4JV0A 2KFZA 4QWDA 1HUOA 4YMOA 4RQ2A 3UXNA 1U4BA 5EWEA 2IHNA 3JPOA 4B9SA 4Q8EA 8ICGA 1ZQRA 4CCHA 4RQ7A 4UBBA 3H4DA 4O3RA 4TUQA 2P6UA 3ISDA 4IQVA 4I2IA 2AU0A 2IHMA 1UT5A 1NJZA 4I28A 4I2FA 4F50A 4O5EA 4NY8A 5IIKA 3MR6A 1KRPA 5KFAA 5KG4A 5J2DA 4EEYA 1SL2A 1S10A 4I2BA 3RBEA 2V9WA 4NLNA 1QLNA 7ICKA 2KTQA 2ATLA 4YMMA 2BQRA 1S77D 4XA5A 2JZBB 1JXLA 5IIMA 1ZQPA 5IINA 4F8RA 5F9NA 3IM1A 4DEZA 3ORYA 5J0TA 1ZQMA 1ZQDA 4M6WA 5J29A 1NK4A 4K4HA 3OSPA 2F1HA 4P4OA 4UB3A 4P4MA 1U47A 4MEXA 9ICHA 3GV5B 1U48A 8ICXA 1TFRA 4XRHA 4LZGA 2HHVA 1D9DA 1D9FA 3OJUA 2DFLA 5KG5A 5J2EA 3GQCA 4DSLA 4JV2A 4YD1A 1V9PA 1A77A 3RB4A 9ICKA 1NKCA 4YP3A 3B0YA 4QZDA 5D49A 4I2CA 2ZJ8A 4QZFA 3QEBZ 2NRTA 5KT4A 4KLTA 1ZJMA 1UT8A 5DB6A 4Q44A 3M9OB 3RAQA 3C1ZA 3IHQB 5HMLA 1L3SA 3NTUA 2PFQA 4DSEA 4UB4A 3V7LA 4NLZA 4ED2A 4HYKA 1T4GA 4J9RA 1IXRA 5KFWA 2JZBA 5DBCA 2HHWA 3SV4A 4K4IA 3Q8QB 8ICFA 4DF4A 5KFHA 4EZ6A 4YFKA 3SV3A 1NKEA 4DSFA 2FMQA 4J9OA 3GIKA 3RB6A 3PW5A 2J6SA 1L3TA 3MBYA 1SL0A 2KZMA 3E2EA 2XO7A 5DGBA 4YR0A 4DSKA 4PGQA 4TUSA 3V7KA 7ICRA 2PFOA 4KLSA 3LK9A 1S97A 8ICHA 4QZ9A 2F1IA 4KLDA 1TAQA 3JPQA 3JPPA 1IM4A 8ICEA 2ZTDA 5DDYA 4DL5A 1CEZA 4I2HA 4UAWA 2FLPA 4R66A 4F5QA 4LVSA 4BDPA 2W9MA 1N48A 2UVWA 4IRCA 2VANA 3H8WA 5KFQA 1Z00B 2H5XA 2Y1IA 1QSSA 2KZ3A 5KFKA 3HT3A 2MAXA 2PXIA 4ECZA 5J0WA 4F5OA 2UVRA 4YD2A 4J9NA 1Z3EB 4PGYA 9ICIA 1MQ2A 5J2JA 3ETLA 7ICNA 5DBAA 1JIHA 5KFCA 2W9AA 5KFSA 3PV8A 1ZQXA 4NXZA 3PO4A 4JK1A 4QZEA 5KFUA 5IIOA 1U9LA 1XWLA 3B0XA 2AGPA 4YVZA 9ICQA 5J0QA 1XSNA 4KLMA 3GILA 1UA0A 1XC9A 4K4GA 7ICUA 4R8UB 4F93B 4O3PA 3H8SA 4XUSA 3OHBA 3H4BA 2W8LA 3RJIA 3PVXA 1SKRA 4JV1A 5IIIA 4KITB 5HHHA 2BPCA 1S0MA 2XY6A 2ISPA 4RQ5A 4BWMA 1ZQGA 5KG0A 3N97B 4JWNA 4KLHA 3V6HA 4B9MA 3Q8RB 4DL4A 3C2LA 4F4WA 2UVUA 1XU4A 4DL6A 4E0DA 4DL2A 8ICLA 3RR8A 2HW3A 3H7IA 3PO5A 5J2GA 3GFKB 3EYZA 3PMLA 5KG2A 2FMPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NRW A;  2LYH A;  4UAY A;  3OSN A;  5L1K A;  4EBE A;  4R64 A;  1Z00 A;  4KLG A;  4DWI A;  5CA7 A;  1ZQA A;  5KFT A;  4EBC A;  1RXW A;  4RT3 A;  4BGD A;  4PGX A;  5TZV A;  4YXM A;  4GXK A;  4DQP A;  8ICK A;  4Z6E A;  4UAZ A;  8ICQ A;  3K75 D;  4RPX A;  3RH4 A;  1K1Q A;  3GV7 B;  4C8M A;  2R8K A;  2KFN A;  9ICM A;  9ICS A;  1D8L A;  4TQS A;  3GIM A;  4ED6 A;  5KFO A;  4DFJ A;  1TVA A;  3MR5 A;  3PX0 A;  4J9Q A;  4B9L A;  4NLG A;  8ICC A;  3PX6 A;  2XY5 A;  3MR3 A;  4R8U A;  4TQR A;  4M47 A;  4R63 A;  4J9M A;  3PW4 A;  1RZT A;  2AGQ A;  2ALZ A;  9ICG A;  3Q8S B;  4DFP A;  5KG1 A;  4RQ8 A;  4J9K A;  2FPL A;  4ED8 A;  3M8S A;  2BDP A;  1KLN A;  4ED3 A;  1X9S A;  3BJY A;  5KFZ A;  5J2I A;  4DOC A;  5JUM A;  3Q8P B;  4DOA A;  4FO6 A;  2ISO A;  4O9M A;  1XO1 A;  9ICR A;  3PY8 A;  1LV5 A;  4M9J A;  2JEG A;  3MR2 A;  1D8Y A;  2HHT A;  5DQG A;  4ECX A;  2ZUB A;  3TI0 A;  4I2A A;  4IQW A;  3RH6 A;  1NJY A;  7ICQ A;  4QZI A;  3V6K A;  4KLU A;  4RU9 A;  3PW7 A;  2AQ0 A;  3PW0 A;  2JEF A;  4KLO A;  1MSW D;  9ICA A;  3AU2 A;  3M9M B;  3HPO A;  1NJX A;  5KFR A;  2R8I A;  4Q8F A;  2PI4 A;  8ICA A;  1ZQT A;  3MAB A;  7ICP A;  1ZQW A;  1KEJ A;  2IA6 A;  4ELV A;  1XSP A;  4DLE A;  4UB1 A;  1WCN A;  1EXN A;  2OWO A;  4DLG A;  1NK9 A;  1S76 D;  3RB3 A;  1T3N A;  4KLE A;  3RJF A;  4DSJ A;  4C8K A;  7ICS A;  4IRK A;  4I27 A;  4RT2 A;  2FPM A;  5J2K A;  3NGD A;  2ZTC A;  1S0V A;  4I29 A;  1BPD A;  4ECU A;  2BCV A;  1BPY A;  3EZ5 A;  4QZC A;  4ELT A;  3H8J A;  5J2A A;  4RQ6 A;  3G6V A;  3N4M B;  2M9N A;  2BQ3 A;  4P4P A;  3JPT A;  3TQ1 A;  1ZQI A;  7ICV A;  9ICP A;  3MDC A;  5DQH A;  8ICP A;  5BPC A;  2ASD A;  1BPZ A;  5DG7 A;  3BQ1 A;  3SYZ A;  4IR1 A;  4GC7 A;  4EYH B;  4O0I A;  4YCX A;  4EBD A;  5CR0 A;  3BQ2 A;  3FDS A;  4RQ0 A;  1C7Y A;  1TK0 A;  3BDP A;  2XCA A;  5KFB A;  3KHL A;  2XY7 A;  9ICL A;  2I1Q A;  8ICV A;  1L5U A;  8ICW A;  1ZQH A;  4O3O A;  4RNM A;  8ICS A;  2PFP A;  2VA3 A;  1QSL A;  4PHE A;  2BGW A;  4M9L A;  4F92 B;  4RUA A;  5KFE A;  2ZJA A;  1B22 A;  3T5L A;  5F9L A;  3JPR A;  4GC6 A;  3EW9 A;  8ICU A;  2XGQ A;  2BPG A;  4QW8 A;  5KT2 A;  4MF8 A;  2R8H A;  4B9N A;  2HHX A;  1RYS A;  5KFY A;  3T3F A;  4DFM A;  1QTM A;  3PMN A;  3KHH A;  3QEA Z;  1TAU A;  1SKW A;  2IMW P;  4PHD A;  3ZDC A;  1ZQB A;  9ICE A;  5EWF A;  3C21 A;  4QW9 A;  4Q43 A;  4BXO A;  5BOM A;  1ZQY A;  2NRZ A;  4QZH A;  2BHN A;  4MEY A;  4RNO A;  1JXE A;  3HW8 A;  3C5F A;  4O5C A;  3ZDE A;  1ZYQ A;  4QZG A;  5KT5 A;  4DQQ A;  3ISC A;  1KDH A;  5J0X A;  3PR4 A;  5DB8 A;  1NK0 A;  3UQ2 A;  5DGA A;  5KG7 A;  3PR5 B;  4R65 A;  5KFN A;  1U49 A;  1CUK A;  4PHP A;  1ZQO A;  3MFI A;  3RTV A;  3MGH A;  3Q8L A;  5KFX A;  2Q0Z X;  1TKD A;  4YMN A;  4IQU A;  7ICI A;  5DB9 A;  2FPK A;  7ICT A;  8ICO A;  4KLI A;  7ICO A;  5KFL A;  4ZH4 A;  5KT7 A;  4UQG A;  3V72 A;  4EZ9 A;  5J0P A;  1TK5 A;  4KN4 A;  2RDJ A;  2HVH A;  9ICX A;  5CHG A;  2PFN A;  1ARO P;  8ICM A;  4UB2 A;  4UB5 A;  2Y1J A;  3T5K A;  1KFS A;  2NRV A;  4DS4 A;  2ASL A;  2I9G A;  1ZQS A;  4ED1 A;  2R8J A;  5DG9 A;  7ICL A;  5KFI A;  3G6X A;  5EOZ A;  2PI5 A;  3JPS A;  3Q8M A;  4I2E A;  2RDI A;  8ICR A;  5KG3 A;  2DPJ A;  3ZD8 A;  1KSP A;  5KFM A;  2DPI A;  4DF8 A;  2BCS A;  5DB7 A;  4FS2 A;  1HJP A;  5L1L A;  3V6J A;  4C8N A;  2JEJ A;  2P6R A;  4YG2 A;  8ICT A;  3TAN A;  3C5G A;  4B9V A;  9ICU A;  4F2S A;  3RB0 A;  1DGS A;  2A1J B;  3UXP A;  4YR2 A;  2GWS A;  4DQS A;  3RJJ A;  3KTQ A;  5C5J A;  4YQW A;  7ICH A;  2FMS A;  5KFF A;  4C8O A;  3EPG A;  7ICM A;  4J9P A;  4YN4 A;  3V7J A;  4DOB A;  1RXV A;  4ECR A;  4KMU A;  5HP4 A;  2FLN A;  5HMM A;  9ICF A;  2BCU A;  1ZQQ A;  4MFF A;  1BGX T;  3C23 A;  3M9N B;  3RRG A;  5KG6 A;  3EPI A;  5J2H A;  4QWA A;  3G6Y A;  2J6U A;  4NM1 A;  8ICB A;  3T5H A;  3RRH A;  9ICW A;  5DDM A;  2C28 A;  4I2G A;  3PW2 A;  5HNK A;  3C1Y A;  4DS5 A;  4DQR A;  5KFJ A;  1X2I A;  4NLK A;  2ASJ A;  4QWB A;  2P66 A;  4ELU A;  4ECY A;  4YXJ A;  2W9C B;  5IIL A;  1SZP A;  3C2K A;  1S0N A;  1S0O A;  3EWA A;  4ECQ A;  5KFD A;  2NRX A;  1PZN A;  3HWT A;  1TV9 A;  4TUR A;  5EWG A;  1NK7 A;  3BQT A;  3RBD A;  4O5K A;  3LWM A;  4M04 A;  5CB1 A;  2A1J A;  3KHR A;  4M9H A;  4MF2 A;  1KTQ A;  3K4G A;  4KLL A;  2AJQ A;  4I2J A;  1Y88 A;  9ICJ A;  4RPY A;  3QE9 Y;  2VA8 A;  3SI8 A;  3SZ2 A;  4M9N A;  4YR3 A;  4GXI A;  2BR0 A;  1NK5 A;  8ICY A;  3OGU A;  5CP2 A;  5J0R A;  4F91 B;  5DLG A;  4Z6C A;  4O3N A;  2KN7 A;  3MGI A;  3TFS A;  1NK6 A;  4QZ8 A;  5CWR A;  1QSY A;  2HHQ A;  2WTF A;  1MQ3 A;  2FLL A;  4IR9 A;  3BQ0 A;  5KT6 A;  4RQ3 A;  4KTQ A;  4F5N A;  4BWJ A;  1UA1 A;  5KFP A;  5DBB A;  4QWC A;  2XCP A;  3HP6 A;  1RYR A;  3KHG A;  4BXO B;  4UBC A;  2C2D A;  1LB2 B;  4JWM A;  3PNC A;  3T5J A;  1NJW A;  3Q8K A;  1L3U A;  2XC9 A;  2MUT B;  4DO9 A;  5CJ7 A;  1RPL A;  4ECS A;  5J2B A;  2W9C A;  3RJE A;  2JEI A;  1KFT A;  2ZJ5 A;  7ICE A;  3GII A;  4PH5 A;  1NOM A;  3ZDD A;  3AU6 A;  2BCR A;  4GXJ A;  5DKW A;  1S9F A;  9ICT A;  3C2M A;  5KT3 A;  4M0A A;  2UVV A;  4P2H A;  5L1I A;  4ED7 A;  4DFK A;  2C2R A;  1KFD A;  2C2E A;  3THV A;  4RUC A;  3UXO A;  3M8R A;  3GDX A;  1ZQV A;  4FBT A;  1L3V A;  1A76 A;  1ZJN A;  2AGO A;  4M2Y A;  2V4R A;  4F4X A;  2W9B B;  4F4Z A;  1U45 A;  3TAP A;  1ZET A;  1B43 A;  3FYH A;  5L9X A;  5KFV A;  5BOL A;  4GLX A;  3TFR A;  1ZQN A;  1ZQE A;  4PPX A;  3TAQ A;  4B9T A;  3RJG A;  4RQ1 A;  3RR7 A;  4C8L A;  1X9M A;  8ICI A;  2ZUC A;  5DQI A;  5L1J A;  4RNN A;  4M9G A;  2C22 A;  9ICB A;  4F4K A;  7ICG A;  1SL1 A;  4PHA A;  5D46 A;  4MFA A;  3AUO A;  1BVS A;  1SKS A;  1T7P A;  4EYI B;  4G3I A;  2MUT A;  4Z6F A;  4IQT A;  4RZR A;  5J2F A;  3TAR A;  2HHU A;  3MDA A;  4KN7 A;  4LZD A;  3GV8 B;  2J6T A;  8ICZ A;  4IRD A;  9ICC A;  1BPE A;  5DG8 A;  4QWE A;  4TUP A;  4O3Q A;  4QZA A;  1DOQ A;  2ZTE A;  4ECV A;  3RJK A;  2HHS A;  5IIJ A;  4ED0 A;  1COO A;  4F5P A;  9ICN A;  3OJS A;  3ZDA A;  2XGP A;  5J0Y A;  4QZB A;  2F1J A;  1N56 A;  3MFH A;  4MFC A;  3PX4 A;  3HX0 A;  1K1S A;  2W9B A;  2BQU A;  1NKB A;  1ZQL A;  3RJH A;  9ICV A;  7ICJ A;  4KLJ A;  4DSI A;  1ZQU A;  2BKE A;  1JMS A;  1T8E A;  3LDA A;  5KFG A;  4JUZ A;  2IBK A;  3ZDB A;  4FS1 A;  1HUZ A;  4J9S A;  2VA2 A;  2V4Q A;  4ECW A;  4DQI A;  4FBU A;  3H40 A;  1ZQC A;  4DL7 A;  8ICJ A;  5D4B A;  3ISB A;  4X5V A;  4RPZ A;  2KZZ A;  4Z6D A;  1H38 A;  2ZUD A;  3OHA A;  4F4Y A;  5DLF A;  2HVI A;  1BPX A;  4F5R A;  4B9U A;  1NK8 A;  4KLQ A;  3RAX A;  4I2D A;  4NM2 A;  1BPB A;  4J9L A;  1ZQZ A;  3ZD9 A;  5HHI A;  1JX4 A;  9ICO A;  1X9W A;  2BPF A;  4KLF A;  3QZ7 A;  4F3O A;  1MC8 A;  5J0O A;  4XQ8 A;  5J0U A;  4DL3 A;  5J0S A;  2BCQ A;  3RH5 A;  4M6W B;  1XS9 D;  1XSL A;  3UQ0 A;  3JPN A;  1TK8 A;  4Q45 A;  1ZQK A;  2B21 A;  3QZ8 A;  5J2C A;  2W8K A;  5KTQ A;  2R8G A;  7ICF A;  4F2R A;  4O3S A;  2AQ4 A;  3LWL A;  1WCL A;  4ECT A;  3GIJ A;  1ZQJ A;  3UPQ A;  8ICN A;  1ZQF A;  1JN3 A;  4RQ4 A;  4JV0 A;  2KFZ A;  4QWD A;  1HUO A;  4YMO A;  4RQ2 A;  3UXN A;  1U4B A;  5EWE A;  2IHN A;  3JPO A;  4B9S A;  4Q8E A;  8ICG A;  1ZQR A;  4CCH A;  4RQ7 A;  4UBB A;  3H4D A;  4O3R A;  4TUQ A;  2P6U A;  3ISD A;  4IQV A;  4I2I A;  2AU0 A;  2IHM A;  1UT5 A;  1NJZ A;  4I28 A;  4I2F A;  4F50 A;  4O5E A;  4NY8 A;  5IIK A;  3MR6 A;  1KRP A;  5KFA A;  5KG4 A;  5J2D A;  4EEY A;  1SL2 A;  1S10 A;  4I2B A;  3RBE A;  2V9W A;  4NLN A;  1QLN A;  7ICK A;  2KTQ A;  2ATL A;  4YMM A;  2BQR A;  1S77 D;  4XA5 A;  2JZB B;  1JXL A;  5IIM A;  1ZQP A;  5IIN A;  4F8R A;  5F9N A;  3IM1 A;  4DEZ A;  3ORY A;  5J0T A;  1ZQM A;  1ZQD A;  4M6W A;  5J29 A;  1NK4 A;  4K4H A;  3OSP A;  2F1H A;  4P4O A;  4UB3 A;  4P4M A;  1U47 A;  4MEX A;  9ICH A;  3GV5 B;  1U48 A;  8ICX A;  1TFR A;  4XRH A;  4LZG A;  2HHV A;  1D9D A;  1D9F A;  3OJU A;  2DFL A;  5KG5 A;  5J2E A;  3GQC A;  4DSL A;  4JV2 A;  4YD1 A;  1V9P A;  1A77 A;  3RB4 A;  9ICK A;  1NKC A;  4YP3 A;  3B0Y A;  4QZD A;  5D49 A;  4I2C A;  2ZJ8 A;  4QZF A;  3QEB Z;  2NRT A;  5KT4 A;  4KLT A;  1ZJM A;  1UT8 A;  5DB6 A;  4Q44 A;  3M9O B;  3RAQ A;  3C1Z A;  3IHQ B;  5HML A;  1L3S A;  3NTU A;  2PFQ A;  4DSE A;  4UB4 A;  3V7L A;  4NLZ A;  4ED2 A;  4HYK A;  1T4G A;  4J9R A;  1IXR A;  5KFW A;  2JZB A;  5DBC A;  2HHW A;  3SV4 A;  4K4I A;  3Q8Q B;  8ICF A;  4DF4 A;  5KFH A;  4EZ6 A;  4YFK A;  3SV3 A;  1NKE A;  4DSF A;  2FMQ A;  4J9O A;  3GIK A;  3RB6 A;  3PW5 A;  2J6S A;  1L3T A;  3MBY A;  1SL0 A;  2KZM A;  3E2E A;  2XO7 A;  5DGB A;  4YR0 A;  4DSK A;  4PGQ A;  4TUS A;  3V7K A;  7ICR A;  2PFO A;  4KLS A;  3LK9 A;  1S97 A;  8ICH A;  4QZ9 A;  2F1I A;  4KLD A;  1TAQ A;  3JPQ A;  3JPP A;  1IM4 A;  8ICE A;  2ZTD A;  5DDY A;  4DL5 A;  1CEZ A;  4I2H A;  4UAW A;  2FLP A;  4R66 A;  4F5Q A;  4LVS A;  4BDP A;  2W9M A;  1N48 A;  2UVW A;  4IRC A;  2VAN A;  3H8W A;  5KFQ A;  1Z00 B;  2H5X A;  2Y1I A;  1QSS A;  2KZ3 A;  5KFK A;  3HT3 A;  2MAX A;  2PXI A;  4ECZ A;  5J0W A;  4F5O A;  2UVR A;  4YD2 A;  4J9N A;  1Z3E B;  4PGY A;  9ICI A;  1MQ2 A;  5J2J A;  3ETL A;  7ICN A;  5DBA A;  1JIH A;  5KFC A;  2W9A A;  5KFS A;  3PV8 A;  1ZQX A;  4NXZ A;  3PO4 A;  4JK1 A;  4QZE A;  5KFU A;  5IIO A;  1U9L A;  1XWL A;  3B0X A;  2AGP A;  4YVZ A;  9ICQ A;  5J0Q A;  1XSN A;  4KLM A;  3GIL A;  1UA0 A;  1XC9 A;  4K4G A;  7ICU A;  4R8U B;  4F93 B;  4O3P A;  3H8S A;  4XUS A;  3OHB A;  3H4B A;  2W8L A;  3RJI A;  3PVX A;  1SKR A;  4JV1 A;  5III A;  4KIT B;  5HHH A;  2BPC A;  1S0M A;  2XY6 A;  2ISP A;  4RQ5 A;  4BWM A;  1ZQG A;  5KG0 A;  3N97 B;  4JWN A;  4KLH A;  3V6H A;  4B9M A;  3Q8R B;  4DL4 A;  3C2L A;  4F4W A;  2UVU A;  1XU4 A;  4DL6 A;  4E0D A;  4DL2 A;  8ICL A;  3RR8 A;  2HW3 A;  3H7I A;  3PO5 A;  5J2G A;  3GFK B;  3EYZ A;  3PML A;  5KG2 A;  2FMP A; 
#chains in the Genus database with same CATH topology
 2NRW A;  2LYH A;  3OSN A;  4EBE A;  1Z00 A;  2YN4 A;  5EE0 A;  1RM6 C;  1N5W A;  4RT3 A;  4GXK A;  5G5G A;  4UAZ A;  3RH4 A;  3CP8 A;  1Z1B A;  2KJ9 A;  5AI9 A;  2Z7J A;  5JTI A;  3MR5 A;  1YT3 A;  3H8M A;  3M6K A;  1L7N A;  8ICC A;  2XY5 A;  4M47 A;  1RZT A;  1SIJ A;  4DFP A;  4ED8 A;  4C4T A;  3DV9 A;  1KLN A;  1WWV A;  1X9S A;  5JUM A;  2ISO A;  4O9M A;  9ICR A;  2F8L A;  3MR2 A;  1D8Y A;  4OJ6 A;  3RFA A;  3TAD C;  4QZI A;  4RU9 A;  3L3F X;  2AQ0 A;  2K4P A;  5E79 U;  1MSW D;  5KFR A;  4HAI A;  8ICA A;  1WWU A;  1ZQT A;  2KSO A;  5AM4 A;  4UB1 A;  1EXN A;  1NK9 A;  3RB3 A;  4KLE A;  3SAH A;  4I27 A;  2FPM A;  2ZTC A;  1ZQI A;  2YB4 A;  5DQH A;  4UAS A;  5DG7 A;  1L6N A;  4EYH B;  4YCX A;  4EBD A;  2LBO A;  8ICV A;  2G06 A;  1ZQH A;  8ICS A;  4RNM A;  1SWV A;  1QSL A;  4PHE A;  2BGW A;  5KFE A;  3K1R B;  5JU5 A;  2BPG A;  4DFM A;  1QTM A;  3PMN A;  3QEA Z;  1M6Y A;  4PHD A;  2IMW P;  4AYB F;  3C21 A;  4QW9 A;  2BDU A;  4Q43 A;  2WF5 A;  1NZP A;  1RG6 A;  2NRZ A;  4QZH A;  4MEY A;  3HW8 A;  4O5C A;  1XNS A;  2QKQ A;  1ZYQ A;  4QZG A;  1KDH A;  4NL9 A;  3PR4 A;  1PK1 A;  1NK0 A;  5DGA A;  1U49 A;  5KFN A;  4PHP A;  3RTV A;  1T3Q A;  5ALM A;  5DB9 A;  4KLI A;  4UQG A;  3V72 A;  1TK5 A;  1VDV A;  2KEY A;  5GTH U;  1ARO P;  2ZIU B;  4DS4 A;  2ASL A;  1ZQS A;  4ED1 A;  2R8J A;  2HSZ A;  2DQN B;  5DG9 A;  7ICL A;  3QU4 A;  2W7O A;  4RQN A;  5KG3 A;  4DF8 A;  5DB7 A;  1Z1V A;  2H3F A;  2KE7 A;  4B9V A;  3C5G A;  3ALR A;  1WUD A;  4F2S A;  9ICU A;  3QU7 A;  3QX7 A;  2GWS A;  3WU2 U;  2FMS A;  2KMD A;  4J9P A;  4YN4 A;  4KMU A;  9ICF A;  2KIV A;  4O3M A;  3RRG A;  4QWA A;  3NVW A;  2J6U A;  4NM1 A;  3UM9 A;  2E8M A;  4I2G A;  3PW2 A;  1OXJ A;  2HCF A;  4PZO A;  2P66 A;  2KHV A;  1SZP A;  3C2K A;  5AKZ A;  3MGV A;  1X42 A;  5KFD A;  2NRX A;  1PZN A;  3A0H U;  4O5K A;  3ED5 A;  3LWM A;  2A1J A;  4M9H A;  4MF2 A;  3KD3 A;  2AJQ A;  9ICJ A;  3SI8 A;  2K4E A;  2A1A A;  3MGI A;  4F91 B;  2KKP A;  5AK3 A;  4IR9 A;  3BQ0 A;  4UB6 U;  4RQ3 A;  5ALW A;  4KTQ A;  4BWJ A;  4A8E A;  2XCP A;  4QWC A;  1UA1 A;  4Y2J A;  3HP6 A;  1RYR A;  3KHG A;  1YZ7 A;  1N63 A;  3BQ7 A;  1SXD A;  3Q8K A;  4DO9 A;  5J2B A;  3HKZ F;  3WK4 A;  4PH5 A;  1NOM A;  4Y2Q A;  2BCR A;  9ICT A;  5KT3 A;  4M0A A;  3AN1 A;  1RQN A;  5H2F U;  2C2E A;  3THV A;  4FBT A;  5ALN A;  4Y2R A;  1HIW A;  4BUG A;  2K4I A;  3FYH A;  5L9X A;  1ZQN A;  4GLX A;  2MA1 A;  2YQE A;  1FO4 A;  5AKX A;  1Q3V A;  5L1J A;  5HR6 A;  3OTQ A;  1JI7 A;  1SL1 A;  5D46 A;  4MFA A;  3AUO A;  1BVS A;  1T7P A;  4EYI B;  2MUT A;  1TE2 A;  3TAR A;  2HHU A;  3MDA A;  4LZD A;  1V97 A;  2VJ5 A;  3GV8 B;  4CGZ A;  5AM3 A;  5ALE A;  1UQV A;  9ICC A;  5DG8 A;  4TUP A;  4ECV A;  4QZA A;  2D3D A;  3PSF A;  3ZDA A;  3F2B A;  4QZB A;  2F1J A;  2NO5 A;  1K1S A;  3BZK A;  2M0N A;  9ICV A;  4CF4 A;  3LDA A;  5L1M A;  4FS1 A;  1HUZ A;  1UPH A;  5AHX A;  3KZI U;  1ZQZ A;  4IS7 A;  3ZD9 A;  9ICO A;  4KLF A;  3QZ7 A;  3UQ0 A;  1TK8 A;  5J2C A;  4PL1 A;  5KTQ A;  2AQ4 A;  2OYY A;  2KFZ A;  4RQ4 A;  4QWD A;  2GH1 A;  4YMO A;  1SWW A;  4RQ2 A;  5EWE A;  1ZQR A;  5CEH A;  4RQ7 A;  3H4D A;  4C4R A;  4I28 A;  5AIC A;  4NV0 A;  3IG8 A;  1QLN A;  2V9W A;  2Y9U A;  2ATL A;  5IIM A;  1S5L U;  2I5H A;  5AK4 A;  1ED1 A;  5J0T A;  5J29 A;  2K8C B;  4AYB C;  1QQ7 A;  4P4O A;  1U47 A;  2KHQ A;  1Z19 A;  8ICX A;  1J2N A;  4LZG A;  4BJQ A;  3OJU A;  3RB4 A;  3OPX A;  4FZM A;  4QZD A;  4I2C A;  2JXJ A;  3QEB Z;  1ZJM A;  3RAQ A;  2QB1 A;  3NTU A;  4UB4 A;  1T4G A;  1S8O A;  1WG8 A;  8ICF A;  1NNL A;  1ZOL A;  4USA A;  5F3X B;  2FMQ A;  2KZM A;  3MBY A;  1SL0 A;  4PGQ A;  3V7K A;  3LK9 A;  2WF7 A;  2F1I A;  4CF5 A;  3JPQ A;  3JPP A;  8ICE A;  5DDY A;  4UAW A;  4F5Q A;  1JAL A;  2B0C A;  2W3R A;  2W9M A;  3M7D A;  4CDG A;  5KFK A;  2UVR A;  4PGY A;  5J2J A;  5KFS A;  3PV8 A;  2LYA A;  4NXZ A;  4JK1 A;  5IIO A;  1ZD3 A;  3B0X A;  3OHB A;  1KQQ A;  5HHH A;  3K1Z A;  2ISP A;  4RQ5 A;  1ZQG A;  3N97 B;  4KLH A;  1OW5 A;  3Q8R B;  2DF4 B;  2H3Q A;  2G08 A;  3PO5 A;  2EQY A;  3EYZ A;  2FMP A;  4QJF B;  4UAY A;  5L1K A;  4FZL A;  4KX3 A;  4DWI A;  5KFT A;  1RXW A;  2KVS A;  4YXM A;  1VJ5 A;  3N7P D;  4Z6E A;  8ICQ A;  3SAG A;  1LKY B;  2E8N A;  2KFN A;  9ICM A;  5KFO A;  4DFJ A;  1TVA A;  3PX0 A;  5ALF A;  4NLG A;  4R8U A;  3HKZ C;  4J9M A;  1N60 A;  2ALZ A;  2DKX A;  3FC4 A;  2BDP A;  2RRD A;  4FE3 A;  5ALV A;  5AKI A;  5KFZ A;  3BS5 B;  4DOC A;  4PL2 A;  2YMQ A;  1NJY A;  7ICQ A;  3V6K A;  1FEZ A;  5GTI U;  4KLO A;  3T79 A;  1NJX A;  1Z4O A;  1ZQW A;  3VC8 A;  5AKG A;  2IA6 A;  4ELV A;  1S76 D;  3RJF A;  3R9K A;  4DSJ A;  2H3I A;  1V38 A;  2EAO A;  3HRD D;  1CI4 A;  1BPD A;  4ECU A;  2BCV A;  5ALT A;  4QZC A;  4ELT A;  5J2A A;  1SZH A;  7ICV A;  9ICP A;  3MDC A;  8ICP A;  4GC7 A;  4EEK A;  4O0I A;  4DFD A;  5CR0 A;  3QUT A;  3KBB A;  1TK0 A;  2PFP A;  3AQE A;  5ALZ A;  4M9L A;  1FFU A;  4RUA A;  2EH9 A;  4GC6 A;  1RYS A;  5KFY A;  3T3F A;  2HMX A;  2E1F A;  2HBJ A;  5AI5 A;  1JRO A;  4EX6 A;  3PZP A;  4RNO A;  3ZDE A;  4LJX A;  1L7O A;  4DQQ A;  5J0X A;  5DB8 A;  1F44 A;  3FAH A;  5KG7 A;  4MHV A;  3WK9 A;  2KD1 A;  3MFI A;  3Q8L A;  1ZRN A;  2MRL A;  2EZZ A;  7ICO A;  4ZH4 A;  2NYV A;  4EZ9 A;  2EAN A;  3T5K A;  4C7Z A;  2NRV A;  2I9G A;  5KFI A;  5EOZ A;  4KMO B;  2LM4 A;  3CW2 C;  3L5K A;  4Y2U A;  1JUD A;  2D8C A;  3ZD8 A;  3WKA A;  2JEJ A;  4OO1 J;  2BZF A;  2HOQ A;  3RB0 A;  1DGJ A;  4YR2 A;  3RJJ A;  4YQW A;  3KFU F;  4C8O A;  3EPG A;  7ICM A;  3NS1 A;  3V7J A;  2OH2 A;  2GO7 A;  4ECR A;  5HP4 A;  5HMM A;  2BCU A;  1ZQQ A;  4MFF A;  3HJE A;  5KG6 A;  5J2H A;  4J03 A;  5AM1 A;  3T5H A;  3RRH A;  1NI3 A;  5JRT A;  5KFJ A;  5AKJ A;  4YXJ A;  2W9C B;  2ZIV A;  1S0N A;  4ECQ A;  3D6J A;  1KTQ A;  4I2J A;  1ECW A;  3QE9 Y;  2VA8 A;  4GXI A;  2BR0 A;  1NK5 A;  5J0R A;  4O3N A;  1QSY A;  4QZ8 A;  4GFJ A;  2JMG A;  2WTF A;  2FLL A;  2W3S A;  5KT6 A;  2EZY A;  4F5N A;  5TIS U;  4BXO B;  5KFP A;  5DBB A;  3KKA C;  4JWM A;  4Y2Y A;  3T5J A;  2JHD A;  3RJE A;  1KFT A;  2JEI A;  4UB8 U;  3IRU A;  1X6J A;  5DKW A;  3WKE A;  1YZ6 A;  2QB0 B;  2OM6 A;  4P2H A;  4ED7 A;  4DFK A;  2C2R A;  3M8R A;  3GDX A;  2AGO A;  2V4R A;  4F4Z A;  2W9B B;  1U45 A;  2F8K A;  1F0M A;  1B43 A;  3TFR A;  5AK5 A;  3PSI A;  3RR7 A;  1X9M A;  8ICI A;  5AKY A;  4ICA A;  2ZUC A;  5HR7 A;  4RNN A;  2A19 A;  2ZIX B;  4M9G A;  9ICB A;  4F4K A;  7ICG A;  2KP7 A;  5AM0 A;  2ZIW A;  1SKS A;  4IQT A;  5AI8 A;  5J2F A;  3I1Y A;  2HBK A;  5ALR A;  2KNJ A;  8ICZ A;  2XI9 A;  1BPE A;  4QWE A;  1DOQ A;  2ZTE A;  3RJK A;  1KN5 A;  2Q4T A;  4C80 A;  4BX9 C;  2OXO A;  4P0Q B;  1N56 A;  2F2A B;  5AKE A;  4MFC A;  1ZD4 A;  1ZQL A;  1VLB A;  3E58 A;  4DSI A;  1ZQU A;  1JMS A;  1T8E A;  2IBK A;  4Y2T A;  3LVV A;  5AKH A;  2V4Q A;  4DQI A;  3H40 A;  1ZQC A;  4DL7 A;  8ICJ A;  2RP5 A;  3ISB A;  4X5V A;  3VCB A;  4RPZ A;  2KZZ A;  3QU9 A;  2W55 A;  4Z6D A;  1H38 A;  3OHA A;  5DLF A;  2HVI A;  3UMG A;  4B9U A;  3QU5 A;  4NM2 A;  1BPB A;  2WF6 A;  1X9W A;  2Y0S F;  1MC8 A;  2L5Y A;  5J0U A;  3RH5 A;  3H0L B;  1XSL A;  4Q45 A;  1ZQK A;  3S6J A;  7ICF A;  4F2R A;  3D2N A;  4OJL A;  3LWL A;  1WCL A;  5AI4 A;  3UPQ A;  1JN3 A;  4JV0 A;  2IOH A;  2OEH A;  4B9S A;  3QUC A;  2RQ5 A;  3SAF A;  4O3R A;  2P6U A;  9ICW A;  2K4H A;  1UT5 A;  1NJZ A;  2QAR B;  2E8P A;  1KRP A;  5KFA A;  5KG4 A;  2VJ4 A;  7ICK A;  5KL1 B;  2JZB B;  1JXL A;  4C7Y A;  1ZQP A;  3TAC B;  3CNH A;  4M6W A;  4K4H A;  5AI0 A;  4XRH A;  1D9D A;  1D9F A;  5J2E A;  3GQC A;  4YD1 A;  1V9P A;  9ICK A;  2NO4 A;  4YP3 A;  2F77 X;  2HOI A;  5D49 A;  2GOL A;  5J8Y C;  4RQM A;  3WK5 A;  4Q44 A;  2H3V A;  1L3S A;  4DSE A;  4CF3 A;  3BS5 A;  4HYK A;  4J9R A;  2G0A A;  4YFK A;  3SV3 A;  3KOO A;  2J6S A;  3PW5 A;  1UCV A;  3M6Z A;  1L7P A;  4Y2S A;  3E2E A;  4YR0 A;  4DSK A;  4TUS A;  2CPR A;  2YMM A;  4KLS A;  1V85 A;  1S97 A;  4KLD A;  1CEZ A;  2ZTD A;  2FLP A;  4LVS A;  1X66 A;  2UVW A;  2VAN A;  5KFQ A;  1Z00 B;  2Y1I A;  1QSS A;  2KZ3 A;  2W54 A;  2PXI A;  4F5O A;  1F5S A;  5ALP A;  3AEV A;  1UHU A;  3ETL A;  7ICN A;  5DBA A;  1JIH A;  5KFC A;  2W9A A;  4QZE A;  2AGP A;  9ICQ A;  1XSN A;  4KLM A;  3TKA A;  3GIL A;  7ICU A;  4O3P A;  3A0B U;  3RJI A;  2CRX A;  4JV1 A;  5III A;  4KIT B;  2BPC A;  1K5O A;  2XY6 A;  2G07 A;  3RR8 A;  2HW3 A;  2KIW A;  5KG2 A;  3QUB A;  2AH5 A;  2Y9T A;  4KLG A;  4EEL A;  5CA7 A;  1ZQA A;  4EBC A;  1L8L A;  3WK6 A;  4BGD A;  5TZV A;  1IV8 A;  5ALH A;  3K75 D;  4RPX A;  3GV7 B;  4C8M A;  2R8K A;  4TQS A;  3GIM A;  4ED6 A;  3E0F A;  2I6X A;  5ALG A;  2KSO B;  1X40 A;  4B9L A;  3MR3 A;  2DL0 A;  4TQR A;  4R63 A;  2AGQ A;  9ICG A;  3Q8S B;  4RQ8 A;  4J9K A;  1JRP A;  2YMP A;  2FPL A;  4UAU A;  3SD7 A;  4B6J A;  3Q8P B;  4DOA A;  1QH9 A;  2H3Z A;  1DXS A;  1LV5 A;  4M9J A;  2F44 A;  3IG5 A;  4ECX A;  2ZUB A;  4IQW A;  4I2A A;  1L7M A;  2W7P A;  4UAV A;  4KLU A;  2AHO B;  3PW0 A;  3AU2 A;  3M9M B;  3HPO A;  4Q8F A;  3FM9 A;  5KAF U;  2N1R A;  1KEJ A;  1WCN A;  5FP0 A;  4DLG A;  2PKE A;  4C8K A;  3QYP A;  4IRK A;  2LKY A;  3NGD A;  2ODG A;  3ICX A;  1BPY A;  3EZ5 A;  3H8J A;  3N4M B;  2BQ3 A;  3TAD A;  3TQ1 A;  5BPC A;  3F2D A;  1QCK A;  3BQ1 A;  4IR1 A;  3BS7 A;  3FDS A;  1C7Y A;  3BDP A;  4UAR A;  2XCA A;  5KFB A;  2I1Q A;  4CNQ A;  1L5U A;  1AQ6 A;  4O3O A;  3WKD A;  2ZG6 A;  5ALK A;  1A0P A;  3T5L A;  5F9L A;  3JPR A;  3EW9 A;  4QW8 A;  5KT2 A;  4MF8 A;  2R8H A;  2HHX A;  2Y0S C;  3KHH A;  1GO3 F;  1J97 A;  9ICE A;  3KKA A;  4ZOH C;  4BXO A;  1N2X A;  2BHN A;  1JXE A;  2WF9 A;  3UQ2 A;  4R65 A;  1ZQO A;  4UW9 A;  1TKD A;  4IQU A;  3IV6 A;  7ICI A;  2FPK A;  3C28 A;  7ICT A;  8ICO A;  5KFL A;  5KT7 A;  9ICX A;  4KN4 A;  2AXT U;  5CRX A;  2LMR A;  4QNL A;  2HDO A;  2PFN A;  4UB2 A;  4UB5 A;  2Y1J A;  1KFS A;  2ZXI A;  2JGA A;  2RHF A;  1XO0 A;  3C29 A;  2PI5 A;  1X9X A;  2W03 A;  2RDI A;  8ICR A;  5AIA A;  5ALI A;  2DPI A;  2BCS A;  5KL8 B;  4P0P B;  1P7D A;  1HJP A;  2ZIX A;  2P6R A;  3TAN A;  4IL6 U;  3SR6 A;  2A1J B;  3UXP A;  2OHF A;  3N7R C;  2KV2 A;  4NJ8 A;  3M1Y A;  1FFV A;  2O6K A;  4JB3 A;  4DOB A;  1RXV A;  2FLN A;  3C23 A;  3M9N B;  2ZIU A;  4C4S A;  8ICB A;  5DDM A;  2C28 A;  1RYU A;  1BNO A;  4NLK A;  2ASJ A;  4QWB A;  4ELU A;  4ECY A;  5IIL A;  3EWA A;  2OCE A;  3BQT A;  3B9J A;  4KLL A;  3KHR A;  3K4G A;  2LM1 A;  3PST A;  1PVR A;  4YR3 A;  8ICY A;  3OGU A;  5CP2 A;  5DLG A;  4Z6C A;  3TFS A;  1X6I A;  8ICK A;  2NV3 A;  3IN5 A;  5KNI A;  1LB2 B;  2A3V A;  1NJW A;  1L3U A;  2XC9 A;  2MUT B;  5CJ7 A;  1RPL A;  2HI0 A;  1N5X A;  2EAM A;  4ECS A;  4WJ3 B;  2KIC A;  3N28 A;  3ZDD A;  1IIP A;  4GXJ A;  2KOB A;  2UVV A;  2W43 A;  1L3V A;  1A76 A;  2MU2 A;  3TAP A;  2WB1 F;  1ZET A;  5KFV A;  5BOL A;  1ZQE A;  5ALO A;  2KG5 A;  1MN8 A;  4C8L A;  2G09 A;  4F72 A;  1D8B A;  2W04 A;  4Z6F A;  4RZR A;  1O08 A;  4KN7 A;  2J6T A;  5G5H A;  2K89 A;  2HHS A;  1OUQ A;  2E1E A;  5J0Y A;  5B5E U;  3HX0 A;  2BQU A;  2CXY A;  7ICJ A;  2BKE A;  4JUZ A;  3ZDB A;  4J9S A;  2LYB A;  5D4B A;  2WF8 A;  4EEN A;  1J2M A;  3AMZ A;  1T94 A;  1NK8 A;  2PMZ F;  4I2D A;  5HHI A;  1JX4 A;  2FDR A;  4F3O A;  5J0O A;  4XQ8 A;  2BCQ A;  5AKK A;  4Y2V A;  2W8K A;  2R8G A;  3KZX A;  1FIQ A;  4ECT A;  3GIJ A;  1ZQJ A;  1A6S A;  1HUO A;  4U6P A;  3UXN A;  8ICG A;  3ISD A;  2LI6 A;  4I2I A;  4IQV A;  2IHM A;  2B6G A;  4NY8 A;  3MR6 A;  1SL2 A;  5J2D A;  4I2B A;  2VIX A;  1S10 A;  3RBE A;  2KTQ A;  2BQR A;  4XA5 A;  3DEE A;  4F8R A;  2DWQ A;  2G5H B;  3ORY A;  2EDU A;  1ZQD A;  3WKC A;  1NK4 A;  3OSP A;  2F1H A;  2F3N A;  4UB3 A;  3L4P A;  2JR5 A;  2HHV A;  2YX8 A;  2DFL A;  5KG5 A;  4JV2 A;  4DSL A;  1NKC A;  3B0Y A;  1NZB A;  1Z4N A;  2ZJ8 A;  2FJ6 A;  4QIW F;  2NRT A;  3HIL A;  5KT4 A;  4KLT A;  5ALS A;  5DB6 A;  3C1Z A;  3IHQ B;  2HOF A;  2XVT A;  4ED2 A;  1ZRM A;  5KFW A;  5DBC A;  4K4I A;  3Q8Q B;  3O0F A;  1RDF A;  2KJ8 A;  1NKE A;  4DSF A;  3MC1 A;  3NRW A;  3GIK A;  1L3T A;  3WK8 A;  7ICR A;  2PFO A;  1KL9 A;  1ZD2 P;  3QU2 A;  1TAQ A;  1IM4 A;  4R66 A;  2E5S A;  2F76 X;  4BDP A;  3AL0 B;  4IRC A;  3H8W A;  5EE3 A;  3LYS A;  3F53 A;  4ECZ A;  4J9N A;  1Z3E B;  1MQ2 A;  2E3T A;  4PZN A;  4OD0 A;  3PO4 A;  5ALX A;  5KFU A;  1U9L A;  1XWL A;  3GU3 A;  5J0Q A;  1DRG A;  1XC9 A;  3H0M B;  4K4G A;  4R8U B;  4F93 B;  3H4B A;  2XID A;  4BWM A;  1COK A;  1PVP A;  3DDH A;  3V6H A;  4DL4 A;  3C2L A;  4F4W A;  3UMC A;  2UVU A;  1XU4 A;  3LVW A;  3SQI A;  4KX5 A;  5J2G A;  2JH7 A;  1CRX A;  4R64 A;  5C0Y A;  3WKB A;  4PGX A;  4DQP A;  1SV0 C;  2HBL A;  4Y2X A;  3NAS A;  4CE6 A;  1K1Q A;  9ICS A;  1D8L A;  2ZXH A;  3BZC A;  5ALD A;  2RLT A;  2G5I B;  5AM2 A;  4J9Q A;  2JV3 A;  3PX6 A;  3PSP A;  3PW4 A;  5KG1 A;  2WAQ F;  3QUQ A;  3SEI A;  3M8S A;  4ED3 A;  5T14 A;  3BJY A;  5J2I A;  4FO6 A;  1XO1 A;  3PY8 A;  2JEG A;  2HHT A;  5DQG A;  4IC9 A;  3TI0 A;  3QXG A;  2WB1 C;  3RH6 A;  1LKY A;  3PW7 A;  4P0P A;  2D6F C;  2JEF A;  2ESE A;  9ICA A;  3AQF A;  2DBY A;  2R8I A;  2PI4 A;  2QLT A;  3MAB A;  7ICP A;  3NUQ A;  1XSP A;  3IDW A;  4DLE A;  2EZX A;  2OWO A;  4NWI A;  1T3N A;  4ACO A;  7ICS A;  4RT2 A;  2WHE A;  5J2K A;  1S0V A;  4I29 A;  3EUB 2;  4DCC A;  4RQ6 A;  3G6V A;  2M9N A;  5EE1 A;  4P4P A;  2CN1 A;  3JPT A;  3U26 A;  2ASD A;  1BPZ A;  3SYZ A;  3BQ2 A;  4RQ0 A;  3KHL A;  2XY7 A;  9ICL A;  8ICW A;  2VA3 A;  2K8A A;  4FZN A;  4F92 B;  2K60 A;  4FFD A;  3SMV A;  2ZJA A;  1B22 A;  2PMZ C;  8ICU A;  2XGQ A;  4B9N A;  1TAU A;  1SKW A;  3ZDC A;  4NLC A;  1ZQB A;  5EWF A;  3AM9 A;  5BOM A;  1ZQY A;  3C5F A;  5KT5 A;  1KW4 A;  3ISC A;  3PR5 B;  1CUK A;  3MGH A;  5KFX A;  2Q0Z X;  4YMN A;  1ZXI A;  5K4L A;  2HVH A;  5J0P A;  2RDJ A;  4C0Z A;  5CHG A;  5ALJ A;  5A0L A;  4OJO A;  4U7C A;  8ICM A;  4OJP A;  1PVQ A;  3G6X A;  3JPS A;  3Q8M A;  3CYM A;  4F71 A;  4I2E A;  2DPJ A;  1KSP A;  2ZIV B;  5KFM A;  4FS2 A;  5L1L A;  3V6J A;  4C8N A;  8ICT A;  4YG2 A;  3ONN A;  1B0X A;  1DGS A;  4DQS A;  3KTQ A;  5C5J A;  7ICH A;  1L8O A;  5KFF A;  1DK3 A;  4Y2P A;  4QIW C;  3ZI4 A;  5ALQ A;  5KAI U;  3D2Q A;  4JMU A;  1BGX T;  2MSN A;  3EPI A;  1KBU A;  4US9 A;  3G6Y A;  1N62 A;  5HNK A;  3C1Y A;  4DS5 A;  1IG6 A;  4DQR A;  1X2I A;  2IOF A;  4G9B A;  1S0O A;  1TV9 A;  3HWT A;  2IOF K;  4TUR A;  5EWG A;  2DKZ A;  3RBD A;  1NK7 A;  4M04 A;  5CB1 A;  2LPE A;  1C20 A;  1Y88 A;  2JH1 A;  4RPY A;  1QQ6 A;  2KK0 A;  5AIB A;  3SZ2 A;  3I76 A;  4M9N A;  2GLE A;  2KN7 A;  1NK6 A;  3D2S A;  2W11 A;  5EE9 A;  5CWR A;  2HHQ A;  3ETR A;  1MQ3 A;  4NLB A;  2YY6 A;  4UBC A;  2C2D A;  4US8 A;  3PNC A;  2ZIW B;  1PK1 B;  1WYG A;  4CRX A;  5AI6 A;  2W9C A;  2ZJ5 A;  7ICE A;  3GII A;  4NL9 C;  3AU6 A;  3UMB A;  1S9F A;  3C2M A;  3CRX A;  1KKX A;  5L1I A;  1KFD A;  4RUC A;  3UXO A;  1ZQV A;  1ZJN A;  2YB1 A;  4OCZ A;  3H0R B;  3NVY A;  4F4X A;  4M2Y A;  4PPX A;  3TAQ A;  4B9T A;  3F2C A;  3RJG A;  4RQ1 A;  5DQI A;  2KVC A;  1URJ A;  3F5E A;  2E8O A;  2C22 A;  4PHA A;  3NVV A;  4G3I A;  2K8B B;  5B66 U;  4IRD A;  4O3Q A;  5IIJ A;  4ED0 A;  1COO A;  2WAQ C;  2QB0 A;  4F5P A;  9ICN A;  3OJS A;  1SV4 A;  2XGP A;  4EX7 A;  1TAM A;  3MFH A;  3PX4 A;  5AM5 A;  2W9B A;  1NKB A;  1RQL A;  3RJH A;  1MA7 A;  4KLJ A;  5ALY A;  5KFG A;  2VA2 A;  4ECW A;  4FBU A;  2KJ5 A;  3NRZ A;  3WK7 A;  2ZUD A;  4F4Y A;  1BPX A;  4F5R A;  3NVZ A;  4KLQ A;  3RAX A;  2FI1 A;  4J9L A;  1BNP A;  2BPF A;  2YML A;  4DL3 A;  3GZF A;  5J0S A;  4M6W B;  1XS9 D;  3JPN A;  4P0Q A;  2B21 A;  3QZ8 A;  1SXE A;  4O3S A;  2KKV A;  1QQ5 A;  1Q46 A;  2YTU A;  3J81 j;  8ICN A;  1ZQF A;  3RF9 A;  1HEK A;  3IP4 B;  2P35 A;  1U4B A;  2IHN A;  4Q8E A;  3JPO A;  4CCH A;  4UBB A;  4TUQ A;  2AU0 A;  4I2F A;  1O03 A;  4F50 A;  4O5E A;  5IIK A;  4EEY A;  3N7S C;  4NLN A;  4YMM A;  1S77 D;  4UAT A;  1SV0 A;  5IIN A;  5F9N A;  3IM1 A;  4DEZ A;  2EAP A;  1ZQM A;  4MEX A;  4P4M A;  9ICH A;  1PK3 A;  2LHT A;  3GV5 B;  5ALL A;  1U48 A;  1TFR A;  1A77 A;  1PUZ A;  4QZF A;  2VKQ A;  1UT8 A;  5AKL A;  3I28 A;  3M9O B;  2QAR A;  1Q3U A;  5HML A;  2PFQ A;  1DK2 A;  3V7L A;  4NLZ A;  1SB3 C;  3SEN A;  1IXR A;  2XIC A;  2JZB A;  2HHW A;  3SV4 A;  4DF4 A;  5KFH A;  4EZ6 A;  4GIB A;  4J9O A;  3RB6 A;  4OJ5 A;  1N61 A;  2FE9 A;  2XO7 A;  5DGB A;  2JRZ A;  8ICH A;  4QZ9 A;  4PJ0 U;  4DL5 A;  5J8Y A;  4I2H A;  1N48 A;  2H5X A;  2R18 A;  5ALU A;  3HT3 A;  2MAX A;  5J0W A;  1ZD5 A;  3F5A A;  4YD2 A;  5AK6 A;  1LVH A;  2HBM A;  9ICI A;  4AP9 A;  2WFA A;  1ZQX A;  1ZQ1 C;  1B4F A;  4YVZ A;  3QNM A;  1UA0 A;  3H8S A;  4XUS A;  2W8L A;  1SGG A;  3PVX A;  1SKR A;  1S0M A;  4JWN A;  5KG0 A;  2DGZ A;  4B9M A;  4DL6 A;  4E0D A;  8ICL A;  4DL2 A;  3H7I A;  1Q8K A;  3GFK B;  2DUY A;  2ES6 A;  3PML A; 
#chains in the Genus database with same CATH homology
 2NRW A;  2LYH A;  4UAY A;  3OSN A;  5L1K A;  4EBE A;  4R64 A;  1Z00 A;  4KLG A;  4DWI A;  5CA7 A;  1ZQA A;  5KFT A;  4EBC A;  1RXW A;  4RT3 A;  4BGD A;  4PGX A;  5TZV A;  4YXM A;  4GXK A;  4DQP A;  8ICK A;  4Z6E A;  4UAZ A;  8ICQ A;  3K75 D;  4RPX A;  3RH4 A;  1K1Q A;  3GV7 B;  4C8M A;  2R8K A;  2KFN A;  9ICM A;  9ICS A;  1D8L A;  4TQS A;  3GIM A;  4ED6 A;  5KFO A;  4DFJ A;  1TVA A;  3MR5 A;  3PX0 A;  4J9Q A;  4B9L A;  4NLG A;  8ICC A;  3PX6 A;  2XY5 A;  3MR3 A;  4R8U A;  4TQR A;  4M47 A;  4R63 A;  4J9M A;  3PW4 A;  1RZT A;  2AGQ A;  2ALZ A;  9ICG A;  3Q8S B;  4DFP A;  5KG1 A;  4RQ8 A;  4J9K A;  2FPL A;  4ED8 A;  3M8S A;  2BDP A;  1KLN A;  4ED3 A;  1X9S A;  3BJY A;  5KFZ A;  5J2I A;  4DOC A;  5JUM A;  3Q8P B;  4DOA A;  4FO6 A;  2ISO A;  4O9M A;  1XO1 A;  9ICR A;  3PY8 A;  1LV5 A;  4M9J A;  2JEG A;  3MR2 A;  1D8Y A;  2HHT A;  5DQG A;  4ECX A;  2ZUB A;  3TI0 A;  4I2A A;  4IQW A;  3RH6 A;  1NJY A;  7ICQ A;  4QZI A;  3V6K A;  4KLU A;  4RU9 A;  3PW7 A;  2AQ0 A;  3PW0 A;  2JEF A;  4KLO A;  1MSW D;  9ICA A;  3AU2 A;  3M9M B;  3HPO A;  1NJX A;  5KFR A;  2R8I A;  4Q8F A;  2PI4 A;  8ICA A;  1ZQT A;  3MAB A;  7ICP A;  1ZQW A;  1KEJ A;  2IA6 A;  4ELV A;  1XSP A;  4DLE A;  4UB1 A;  1WCN A;  1EXN A;  2OWO A;  4DLG A;  1NK9 A;  1S76 D;  3RB3 A;  1T3N A;  4KLE A;  3RJF A;  4DSJ A;  4C8K A;  7ICS A;  4IRK A;  4I27 A;  4RT2 A;  2FPM A;  5J2K A;  3NGD A;  2ZTC A;  1S0V A;  4I29 A;  1BPD A;  4ECU A;  2BCV A;  1BPY A;  3EZ5 A;  4QZC A;  4ELT A;  3H8J A;  5J2A A;  4RQ6 A;  3G6V A;  3N4M B;  2M9N A;  2BQ3 A;  4P4P A;  3JPT A;  3TQ1 A;  1ZQI A;  7ICV A;  9ICP A;  3MDC A;  5DQH A;  8ICP A;  5BPC A;  2ASD A;  1BPZ A;  5DG7 A;  3BQ1 A;  3SYZ A;  4IR1 A;  4GC7 A;  4EYH B;  4O0I A;  4YCX A;  4EBD A;  5CR0 A;  3BQ2 A;  3FDS A;  4RQ0 A;  1C7Y A;  1TK0 A;  3BDP A;  2XCA A;  5KFB A;  3KHL A;  2XY7 A;  9ICL A;  2I1Q A;  8ICV A;  1L5U A;  8ICW A;  1ZQH A;  4O3O A;  4RNM A;  8ICS A;  2PFP A;  2VA3 A;  1QSL A;  4PHE A;  2BGW A;  4M9L A;  4F92 B;  4RUA A;  5KFE A;  2ZJA A;  1B22 A;  3T5L A;  5F9L A;  3JPR A;  4GC6 A;  3EW9 A;  8ICU A;  2XGQ A;  2BPG A;  4QW8 A;  5KT2 A;  4MF8 A;  2R8H A;  4B9N A;  2HHX A;  1RYS A;  5KFY A;  3T3F A;  4DFM A;  1QTM A;  3PMN A;  3KHH A;  3QEA Z;  1TAU A;  1SKW A;  2IMW P;  4PHD A;  3ZDC A;  1ZQB A;  9ICE A;  5EWF A;  3C21 A;  4QW9 A;  4Q43 A;  4BXO A;  5BOM A;  1ZQY A;  2NRZ A;  4QZH A;  2BHN A;  4MEY A;  4RNO A;  1JXE A;  3HW8 A;  3C5F A;  4O5C A;  3ZDE A;  1ZYQ A;  4QZG A;  5KT5 A;  4DQQ A;  3ISC A;  1KDH A;  5J0X A;  3PR4 A;  5DB8 A;  1NK0 A;  3UQ2 A;  5DGA A;  5KG7 A;  3PR5 B;  4R65 A;  5KFN A;  1U49 A;  1CUK A;  4PHP A;  1ZQO A;  3MFI A;  3RTV A;  3MGH A;  3Q8L A;  5KFX A;  2Q0Z X;  1TKD A;  4YMN A;  4IQU A;  7ICI A;  5DB9 A;  2FPK A;  7ICT A;  8ICO A;  4KLI A;  7ICO A;  5KFL A;  4ZH4 A;  5KT7 A;  4UQG A;  3V72 A;  4EZ9 A;  5J0P A;  1TK5 A;  4KN4 A;  2RDJ A;  2HVH A;  9ICX A;  5CHG A;  2PFN A;  1ARO P;  8ICM A;  4UB2 A;  4UB5 A;  2Y1J A;  3T5K A;  1KFS A;  2NRV A;  4DS4 A;  2ASL A;  2I9G A;  1ZQS A;  4ED1 A;  2R8J A;  5DG9 A;  7ICL A;  5KFI A;  3G6X A;  5EOZ A;  2PI5 A;  3JPS A;  3Q8M A;  4I2E A;  2RDI A;  8ICR A;  5KG3 A;  2DPJ A;  3ZD8 A;  1KSP A;  5KFM A;  2DPI A;  4DF8 A;  2BCS A;  5DB7 A;  4FS2 A;  1HJP A;  5L1L A;  3V6J A;  4C8N A;  2JEJ A;  2P6R A;  4YG2 A;  8ICT A;  3TAN A;  3C5G A;  4B9V A;  9ICU A;  4F2S A;  3RB0 A;  1DGS A;  2A1J B;  3UXP A;  4YR2 A;  2GWS A;  4DQS A;  3RJJ A;  3KTQ A;  5C5J A;  4YQW A;  7ICH A;  2FMS A;  5KFF A;  4C8O A;  3EPG A;  7ICM A;  4J9P A;  4YN4 A;  3V7J A;  4DOB A;  1RXV A;  4ECR A;  4KMU A;  5HP4 A;  2FLN A;  5HMM A;  9ICF A;  2BCU A;  1ZQQ A;  4MFF A;  1BGX T;  3C23 A;  3M9N B;  3RRG A;  5KG6 A;  3EPI A;  5J2H A;  4QWA A;  3G6Y A;  2J6U A;  4NM1 A;  8ICB A;  3T5H A;  3RRH A;  9ICW A;  5DDM A;  2C28 A;  4I2G A;  3PW2 A;  5HNK A;  3C1Y A;  4DS5 A;  4DQR A;  5KFJ A;  1X2I A;  4NLK A;  2ASJ A;  4QWB A;  2P66 A;  4ELU A;  4ECY A;  4YXJ A;  2W9C B;  5IIL A;  1SZP A;  3C2K A;  1S0N A;  1S0O A;  3EWA A;  4ECQ A;  5KFD A;  2NRX A;  1PZN A;  3HWT A;  1TV9 A;  4TUR A;  5EWG A;  1NK7 A;  3BQT A;  3RBD A;  4O5K A;  3LWM A;  4M04 A;  5CB1 A;  2A1J A;  3KHR A;  4M9H A;  4MF2 A;  1KTQ A;  3K4G A;  4KLL A;  2AJQ A;  4I2J A;  1Y88 A;  9ICJ A;  4RPY A;  3QE9 Y;  2VA8 A;  3SI8 A;  3SZ2 A;  4M9N A;  4YR3 A;  4GXI A;  2BR0 A;  1NK5 A;  8ICY A;  3OGU A;  5CP2 A;  5J0R A;  4F91 B;  5DLG A;  4Z6C A;  4O3N A;  2KN7 A;  3MGI A;  3TFS A;  1NK6 A;  4QZ8 A;  5CWR A;  1QSY A;  2HHQ A;  2WTF A;  1MQ3 A;  2FLL A;  4IR9 A;  3BQ0 A;  5KT6 A;  4RQ3 A;  4KTQ A;  4F5N A;  4BWJ A;  1UA1 A;  5KFP A;  5DBB A;  4QWC A;  2XCP A;  3HP6 A;  1RYR A;  3KHG A;  4BXO B;  4UBC A;  2C2D A;  1LB2 B;  4JWM A;  3PNC A;  3T5J A;  1NJW A;  3Q8K A;  1L3U A;  2XC9 A;  2MUT B;  4DO9 A;  5CJ7 A;  1RPL A;  4ECS A;  5J2B A;  2W9C A;  3RJE A;  2JEI A;  1KFT A;  2ZJ5 A;  7ICE A;  3GII A;  4PH5 A;  1NOM A;  3ZDD A;  3AU6 A;  2BCR A;  4GXJ A;  5DKW A;  1S9F A;  9ICT A;  3C2M A;  5KT3 A;  4M0A A;  2UVV A;  4P2H A;  5L1I A;  4ED7 A;  4DFK A;  2C2R A;  1KFD A;  2C2E A;  3THV A;  4RUC A;  3UXO A;  3M8R A;  3GDX A;  1ZQV A;  4FBT A;  1L3V A;  1A76 A;  1ZJN A;  2AGO A;  4M2Y A;  2V4R A;  4F4X A;  2W9B B;  4F4Z A;  1U45 A;  3TAP A;  1ZET A;  1B43 A;  3FYH A;  5L9X A;  5KFV A;  5BOL A;  4GLX A;  3TFR A;  1ZQN A;  1ZQE A;  4PPX A;  3TAQ A;  4B9T A;  3RJG A;  4RQ1 A;  3RR7 A;  4C8L A;  1X9M A;  8ICI A;  2ZUC A;  5DQI A;  5L1J A;  4RNN A;  4M9G A;  2C22 A;  9ICB A;  4F4K A;  7ICG A;  1SL1 A;  4PHA A;  5D46 A;  4MFA A;  3AUO A;  1BVS A;  1SKS A;  1T7P A;  4EYI B;  4G3I A;  2MUT A;  4Z6F A;  4IQT A;  4RZR A;  5J2F A;  3TAR A;  2HHU A;  3MDA A;  4KN7 A;  4LZD A;  3GV8 B;  2J6T A;  8ICZ A;  4IRD A;  9ICC A;  1BPE A;  5DG8 A;  4QWE A;  4TUP A;  4O3Q A;  4QZA A;  1DOQ A;  2ZTE A;  4ECV A;  3RJK A;  2HHS A;  5IIJ A;  4ED0 A;  1COO A;  4F5P A;  9ICN A;  3OJS A;  3ZDA A;  2XGP A;  5J0Y A;  4QZB A;  2F1J A;  1N56 A;  3MFH A;  4MFC A;  3PX4 A;  3HX0 A;  1K1S A;  2W9B A;  2BQU A;  1NKB A;  1ZQL A;  3RJH A;  9ICV A;  7ICJ A;  4KLJ A;  4DSI A;  1ZQU A;  2BKE A;  1JMS A;  1T8E A;  3LDA A;  5KFG A;  4JUZ A;  2IBK A;  3ZDB A;  4FS1 A;  1HUZ A;  4J9S A;  2VA2 A;  2V4Q A;  4ECW A;  4DQI A;  4FBU A;  3H40 A;  1ZQC A;  4DL7 A;  8ICJ A;  5D4B A;  3ISB A;  4X5V A;  4RPZ A;  2KZZ A;  4Z6D A;  1H38 A;  2ZUD A;  3OHA A;  4F4Y A;  5DLF A;  2HVI A;  1BPX A;  4F5R A;  4B9U A;  1NK8 A;  4KLQ A;  3RAX A;  4I2D A;  4NM2 A;  1BPB A;  4J9L A;  1ZQZ A;  3ZD9 A;  5HHI A;  1JX4 A;  9ICO A;  1X9W A;  2BPF A;  4KLF A;  3QZ7 A;  4F3O A;  1MC8 A;  5J0O A;  4XQ8 A;  5J0U A;  4DL3 A;  5J0S A;  2BCQ A;  3RH5 A;  4M6W B;  1XS9 D;  1XSL A;  3UQ0 A;  3JPN A;  1TK8 A;  4Q45 A;  1ZQK A;  2B21 A;  3QZ8 A;  5J2C A;  2W8K A;  5KTQ A;  2R8G A;  7ICF A;  4F2R A;  4O3S A;  2AQ4 A;  3LWL A;  1WCL A;  4ECT A;  3GIJ A;  1ZQJ A;  3UPQ A;  8ICN A;  1ZQF A;  1JN3 A;  4RQ4 A;  4JV0 A;  2KFZ A;  4QWD A;  1HUO A;  4YMO A;  4RQ2 A;  3UXN A;  1U4B A;  5EWE A;  2IHN A;  3JPO A;  4B9S A;  4Q8E A;  8ICG A;  1ZQR A;  4CCH A;  4RQ7 A;  4UBB A;  3H4D A;  4O3R A;  4TUQ A;  2P6U A;  3ISD A;  4IQV A;  4I2I A;  2AU0 A;  2IHM A;  1UT5 A;  1NJZ A;  4I28 A;  4I2F A;  4F50 A;  4O5E A;  4NY8 A;  5IIK A;  3MR6 A;  1KRP A;  5KFA A;  5KG4 A;  5J2D A;  4EEY A;  1SL2 A;  1S10 A;  4I2B A;  3RBE A;  2V9W A;  4NLN A;  1QLN A;  7ICK A;  2KTQ A;  2ATL A;  4YMM A;  2BQR A;  1S77 D;  4XA5 A;  2JZB B;  1JXL A;  5IIM A;  1ZQP A;  5IIN A;  4F8R A;  5F9N A;  3IM1 A;  4DEZ A;  3ORY A;  5J0T A;  1ZQM A;  1ZQD A;  4M6W A;  5J29 A;  1NK4 A;  4K4H A;  3OSP A;  2F1H A;  4P4O A;  4UB3 A;  4P4M A;  1U47 A;  4MEX A;  9ICH A;  3GV5 B;  1U48 A;  8ICX A;  1TFR A;  4XRH A;  4LZG A;  2HHV A;  1D9D A;  1D9F A;  3OJU A;  2DFL A;  5KG5 A;  5J2E A;  3GQC A;  4DSL A;  4JV2 A;  4YD1 A;  1V9P A;  1A77 A;  3RB4 A;  9ICK A;  1NKC A;  4YP3 A;  3B0Y A;  4QZD A;  5D49 A;  4I2C A;  2ZJ8 A;  4QZF A;  3QEB Z;  2NRT A;  5KT4 A;  4KLT A;  1ZJM A;  1UT8 A;  5DB6 A;  4Q44 A;  3M9O B;  3RAQ A;  3C1Z A;  3IHQ B;  5HML A;  1L3S A;  3NTU A;  2PFQ A;  4DSE A;  4UB4 A;  3V7L A;  4NLZ A;  4ED2 A;  4HYK A;  1T4G A;  4J9R A;  1IXR A;  5KFW A;  2JZB A;  5DBC A;  2HHW A;  3SV4 A;  4K4I A;  3Q8Q B;  8ICF A;  4DF4 A;  5KFH A;  4EZ6 A;  4YFK A;  3SV3 A;  1NKE A;  4DSF A;  2FMQ A;  4J9O A;  3GIK A;  3RB6 A;  3PW5 A;  2J6S A;  1L3T A;  3MBY A;  1SL0 A;  2KZM A;  3E2E A;  2XO7 A;  5DGB A;  4YR0 A;  4DSK A;  4PGQ A;  4TUS A;  3V7K A;  7ICR A;  2PFO A;  4KLS A;  3LK9 A;  1S97 A;  8ICH A;  4QZ9 A;  2F1I A;  4KLD A;  1TAQ A;  3JPQ A;  3JPP A;  1IM4 A;  8ICE A;  2ZTD A;  5DDY A;  4DL5 A;  1CEZ A;  4I2H A;  4UAW A;  2FLP A;  4R66 A;  4F5Q A;  4LVS A;  4BDP A;  2W9M A;  1N48 A;  2UVW A;  4IRC A;  2VAN A;  3H8W A;  5KFQ A;  1Z00 B;  2H5X A;  2Y1I A;  1QSS A;  2KZ3 A;  5KFK A;  3HT3 A;  2MAX A;  2PXI A;  4ECZ A;  5J0W A;  4F5O A;  2UVR A;  4YD2 A;  4J9N A;  1Z3E B;  4PGY A;  9ICI A;  1MQ2 A;  5J2J A;  3ETL A;  7ICN A;  5DBA A;  1JIH A;  5KFC A;  2W9A A;  5KFS A;  3PV8 A;  1ZQX A;  4NXZ A;  3PO4 A;  4JK1 A;  4QZE A;  5KFU A;  5IIO A;  1U9L A;  1XWL A;  3B0X A;  2AGP A;  4YVZ A;  9ICQ A;  5J0Q A;  1XSN A;  4KLM A;  3GIL A;  1UA0 A;  1XC9 A;  4K4G A;  7ICU A;  4R8U B;  4F93 B;  4O3P A;  3H8S A;  4XUS A;  3OHB A;  3H4B A;  2W8L A;  3RJI A;  3PVX A;  1SKR A;  4JV1 A;  5III A;  4KIT B;  5HHH A;  2BPC A;  1S0M A;  2XY6 A;  2ISP A;  4RQ5 A;  4BWM A;  1ZQG A;  5KG0 A;  3N97 B;  4JWN A;  4KLH A;  3V6H A;  4B9M A;  3Q8R B;  4DL4 A;  3C2L A;  4F4W A;  2UVU A;  1XU4 A;  4DL6 A;  4E0D A;  4DL2 A;  8ICL A;  3RR8 A;  2HW3 A;  3H7I A;  3PO5 A;  5J2G A;  3GFK B;  3EYZ A;  3PML A;  5KG2 A;  2FMP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...