1XS9D

A model of the ternary complex formed between mara, the alpha-ctd of rna polymerase and dna
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
81
structure length
81
Chain Sequence
FDPILLRPVDDLELTVRSANCLKAEAIHYIGDLVQRTEVELLKTPNLGKKSLTEIKDVLASRGLSLGMRLENWPPASIADE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-D(P*GP*AP*TP*TP*TP*AP*GP*CP*AP*AP*AP*AP*CP*GP*TP*GP*GP*CP
publication title Versatility of the carboxy-terminal domain of the alpha subunit of RNA polymerase in transcriptional activation: use of the DNA contact site as a protein contact site for MarA.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription/dna
total genus 19
structure length 81
sequence length 81
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2004-10-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1xs9D00
9ICJA 9ICFA 2XGPA 3V7LA 2AU0A 4LZGA 1KFSA 4UAWA 4QWDA 3RBEA 4I29A 3N97B 4J9PA 3G6VA 1ZQVA 4NM2A 2BKEA 2BCUA 7ICQA 5DBAA 2ISOA 4B9SA 2FLNA 4ELUA 4TUQA 5KFZA 3FYHA 5L1LA 4I2AA 2HHXA 3JPOA 1S97A 2HHWA 2C2RA 1LB2B 2PFQA 2ZTCA 4YN4A 3NGDA 3MGIA 2VA8A 2JEIA 5KTQA 4P2HA 2MAXA 5DG9A 9ICBA 3PNCA 4DF4A 2BCRA 2ZJ5A 5KG5A 2ASJA 4QZBA 3OHBA 2BQ3A 4EEYA 3C1ZA 3V6KA 4DFKA 3T5KA 3PMLA 2BQRA 1SKWA 4IQTA 3C23A 3KTQA 3C5GA 4YR3A 2JEGA 2VANA 1ZQDA 4M9HA 7ICIA 1ZQTA 3RJKA 1JMSA 1ZQGA 3HP6A 2XY5A 5J2CA 3SI8A 4RZRA 4C8NA 4RQ6A 4ECWA 1S0OA 2R8HA 3GV5B 7ICSA 4DS4A 4M6WB 1ZQEA 4NLNA 2C2DA 2J6SA 3RJIA 1CUKA 4QWAA 5L1JA 2BGWA 3GDXA 8ICNA 2W9CB 1SKSA 2XCPA 4DSEA 1XSPA 3H40A 7ICTA 5DLGA 3JPTA 5KFLA 3NTUA 1BPDA 5BOMA 4I2BA 5J0TA 5F9LA 4IR1A 2ZTDA 7ICRA 5DKWA 2C2EA 2C22A 3MR6A 3RRGA 2ZJ8A 4K4IA 2W9AA 5HP4A 4F93B 1KDHA 4E0DA 1T4GA 5D4BA 1WCNA 3M9NB 2UVUA 3MR2A 4ECTA 3MBYA 3ETLA 5J0QA 3RB0A 2BQUA 4RUCA 1NKCA 4M9JA 1T3NA 3RBDA 3TAQA 4BXOA 3GQCA 1BPZA 4O3PA 2ALZA 1TKDA 4UBBA 4KLEA 3N4MB 4O3QA 1XWLA 4XA5A 9ICIA 1ZQPA 1KTQA 9ICVA 4EYIB 4O3SA 8ICBA 4MEXA 1ZQIA 1ZQUA 3QE9Y 1H38A 1NK7A 2PI4A 4JV2A 2IA6A 3RJJA 3KHRA 1U47A 4QWEA 4DLEA 2HHTA 1BVSA 1NK8A 4O3OA 4YXJA 8ICPA 4RNMA 3SYZA 4ED3A 4DL2A 4F3OA 5J0PA 5J0RA 4FS2A 5KT6A 5D49A 5KFPA 4YMNA 5C5JA 3Q8KA 1ZQRA 5J0WA 1Z00B 4ED6A 3OGUA 3PX4A 2V9WA 2XY7A 3RB6A 3RH6A 2UVWA 2BCSA 1S76D 2AGPA 4I2GA 3PMNA 1NJYA 4QZDA 4Z6EA 4QZCA 3SZ2A 2WTFA 4RPZA 4IRDA 4J9OA 4FO6A 4G3IA 3HW8A 3C1YA 5KFOA 4YFKA 5HHHA 5KG1A 2RDIA 3SV3A 1L3VA 1ZQFA 4KLJA 1XS9D 2VA3A 3H7IA 2XO7A 4K4GA 4DQPA 1QTMA 4Z6CA 3EW9A 1NKBA 2IMWP 1QSSA 2Y1JA 2HHUA 1ZJMA 5J2KA 2VA2A 4K4HA 1SL2A 9ICMA 2AGOA 1D8LA 4QZ8A 3RR8A 4QW8A 4RQ3A 4IRCA 4F8RA 2ZJAA 4PGQA 2NRVA 4YMMA 4TQRA 4QZEA 5KFCA 8ICHA 4DOAA 3LWLA 4IQVA 3V7KA 3T5JA 4Q8EA 2ZUBA 4M6WA 4EBDA 4X5VA 4B9NA 3PV8A 4YD2A 4ED2A 2NRTA 1NOMA 4MEYA 4J9LA 4EBCA 3V6HA 1A76A 3PR5B 2FLLA 4KLMA 4B9UA 4YG2A 1DOQA 7ICMA 4FS1A 4PHPA 3M9OB 4RQ7A 1ZQXA 3ZDEA 4R8UB 5J0YA 5J2FA 3UQ2A 2KTQA 4DF8A 2HHQA 7ICNA 1HUZA 3ISDA 5J2HA 2BPFA 3PW2A 3G6XA 4J9KA 4TUPA 4I2DA 3IM1A 4Z6FA 4PHDA 1K1QA 3GIKA 5KFRA 5KFHA 5EWEA 3Q8MA 1LV5A 1ZQWA 4QZAA 2FPMA 4BGDA 5KG7A 5J2AA 3OSPA 2OWOA 5KFWA 4F4KA 5J29A 3PW0A 5J2BA 4RQ5A 2KZMA 2R8KA 2V4QA 4KLDA 4UAZA 3T3FA 3Q8PB 4DL3A 2BR0A 2J6UA 8ICYA 2PFPA 5KT2A 2AQ0A 4DL5A 4Z6DA 1BPXA 4XQ8A 4TQSA 3RJFA 2A1JB 5KFDA 4RQ0A 4I2HA 1ZQJA 1DGSA 1SL0A 4I2IA 4RQ1A 2ISPA 4KTQA 1QSYA 8ICKA 5KFMA 3RJGA 5CB1A 4DO9A 4I2FA 9ICEA 4QW9A 5KG6A 3MFHA 1BPYA 9ICSA 1ZQCA 3MABA 4DSLA 9ICUA 1KSPA 1KFDA 1AROP 3JPSA 4KLHA 3PO4A 4NLGA 4UQGA 2ZUCA 4DL6A 4QZGA 4PGXA 3H8JA 2W8LA 1MQ3A 2JEJA 5EOZA 3THVA 1Z00A 5KFJA 4P4MA 1XC9A 1TK0A 3ISCA 4TURA 7ICEA 3PO5A 4R65A 2FPKA 1NK9A 5HMMA 5BPCA 2ATLA 2Q0ZX 1HJPA 5KFYA 4M47A 4RT2A 3PY8A 2HVIA 3QZ7A 4GC7A 4EBEA 2P6UA 3TFRA 3T5LA 4IR9A 5DQGA 3E2EA 7ICHA 8ICZA 1RXWA 1Z3EB 1U45A 4P4PA 2KN7A 4RQ8A 3PW5A 4PPXA 3JPRA 4F92B 1QSLA 4RQ4A 4J9SA 4QZFA 4YR0A 4LVSA 4B9MA 4KLSA 7ICVA 4LZDA 3HX0A 1MQ2A 3LDAA 2NRWA 9ICWA 1L3TA 3LWMA 2HHVA 5DDYA 5KG0A 2FMPA 5L1IA 4CCHA 5KG4A 5KT3A 3M8SA 3PX6A 1ZQBA 3V72A 1N48A 4JUZA 4RPYA 3UXNA 1ZETA 5DB7A 4BWMA 1ZQNA 5KFBA 8ICRA 4YXMA 3BQTA 1KFTA 5IIOA 5IIJA 4I2EA 4O5CA 1ZQOA 1ZJNA 1XSLA 3V7JA 5IILA 1RZTA 5IIMA 8ICTA 3UXPA 5DGAA 4ELVA 4P4OA 5DDMA 4KN7A 2PXIA 2H5XA 2KZ3A 1JN3A 2DPIA 2FLPA 4R8UA 2XC9A 4KLUA 2IHMA 2GWSA 1JIHA 2JZBB 3H8SA 2ZUDA 4M9NA 5J2EA 4GXKA 4F91B 5DGBA 2PFOA 2BHNA 5D46A 1EXNA 1XU4A 4GXIA 9ICAA 4PGYA 3M9MB 4F5RA 4DS5A 5DQIA 3TI0A 4UAYA 3AUOA 3MFIA 1S0VA 1U48A 5KFQA 3GIIA 1D9FA 3B0XA 4C8OA 4F4YA 3H8WA 1COOA 8ICWA 3H4BA 1HUOA 5J0SA 8ICEA 4QZIA 2A1JA 1PZNA 5IIIA 5J0XA 4UB3A 1ZQAA 4O0IA 4YD1A 3TQ1A 2MUTB 4Q45A 4F4WA 4I28A 4YR2A 4PHAA 4DOCA 2J6TA 4PH5A 4O3RA 1JX4A 3C2LA 4BDPA 3JPPA 8ICIA 4DSJA 3TARA 4GC6A 3HPOA 3HT3A 5DG7A 1TK8A 2XY6A 4F50A 2R8IA 4YCXA 4YVZA 4XRHA 3JPQA 3RAXA 5J2JA 3KHGA 9ICQA 4XUSA 3T5HA 7ICLA 1UA1A 4I2JA 4ECZA 4ECSA 2AGQA 1T8EA 2PI5A 5J0OA 1BPBA 4UB2A 3MR5A 3MGHA 4ECUA 1NK5A 4KLOA 3ZDDA 4NM1A 2R8GA 3M8RA 7ICKA 5HHIA 3GV8B 1XSNA 4GLXA 4C8MA 3RAQA 8ICVA 3PW7A 8ICJA 5KFFA 2F1HA 1UT5A 2DPJA 4PHEA 2FMQA 8ICXA 4HYKA 2ZTEA 1NKEA 1SL1A 4F5NA 4MFAA 4F4XA 5F9NA 5KG3A 3PR4A 3K75D 4C8LA 9ICNA 3MR3A 3UPQA 5KG2A 5DBBA 5JUMA 4R63A 3RRHA 1T7PA 2FPLA 4F2SA 1S10A 4KLLA 8ICGA 4ECRA 3SV4A 5CHGA 1KEJA 4GXJA 4M0AA 9ICKA 3ISBA 1S0MA 4DQIA 4EZ9A 1U49A 1ZQZA 4DL4A 3ZDAA 1X2IA 5DB8A 1TAUA 5IIKA 1U9LA 4RQ2A 2W9MA 3PW4A 4IRKA 5EWGA 4Q8FA 7ICGA 4ECYA 4F5OA 5DQHA 4R66A 2XCAA 4C8KA 5HNKA 3JPNA 4FBUA 1TFRA 3AU6A 9ICPA 1S77D 2M9NA 7ICPA 4MF2A 2BCVA 4QZHA 1IM4A 7ICJA 1JXEA 4F2RA 4UB4A 2B21A 2AQ4A 5DLFA 1U4BA 1NK6A 4JV0A 2I1QA 4UB5A 4DSKA 2BPGA 4ECQA 3QEBZ 1CEZA 4KMUA 1Y88A 4DQSA 5CJ7A 1S0NA 3G6YA 1ZQYA 3AU2A 3EWAA 4ED7A 2JEFA 4RNNA 3GILA 4NLZA 1XO1A 4DL7A 2HVHA 5KFKA 5BOLA 2JZBA 5KFXA 4DSFA 1MSWD 4ED0A 3EYZA 1ZYQA 4MFCA 1ZQHA 4KLGA 5KFGA 4IQWA 1KRPA 4J9NA 2BPCA 3BJYA 4J9MA 4M04A 4NLKA 4DQQA 2W9BB 1L3UA 2F1IA 2BCQA 1NJZA 4ZH4A 3HWTA 9ICLA 2RDJA 1TK5A 5J0UA 1ZQLA 3PVXA 4DSIA 3Q8QB 4YMOA 4IQUA 3PX0A 2Y1IA 2R8JA 2NRXA 3C5FA 4M9LA 3BDPA 9ICHA 9ICOA 4KITB 5DB6A 3Q8SB 3ZDCA 4DQRA 2MUTA 2XGQA 4B9TA 4KLQA 4KLTA 4O9MA 4DFJA 2P66A 4QWCA 3K4GA 5KFTA 7ICUA 5DG8A 3Q8RB 2I9GA 4KLFA 3QEAZ 7ICOA 3MDCA 3RB3A 1JXLA 4KLIA 3IHQB 1RXVA 1X9MA 1C7YA 3UXOA 1RYRA 2AJQA 1NK4A 3ZD9A 4ECVA 3GIJA 4RPXA 2FMSA 1UT8A 3RH4A 3H4DA 4TUSA 4M2YA 3V6JA 5CR0A 3C21A 4EZ6A 4BWJA 4JK1A 4F5PA 4ED8A 5J2DA 4NY8A 1SZPA 3MDAA 4R64A 3QZ8A 4FBTA 4JWMA 9ICGA 5CP2A 3GIMA 1A77A 1X9WA 5CWRA 5KFEA 5DB9A 2BDPA 4J9RA 3EPGA 8ICOA 3BQ0A 1RYSA 3RB4A 4I27A 5L1KA 4QZ9A 5L9XA 1MC8A 4O5KA 4RUAA 5J2GA 1WCLA 3LK9A 3ZDBA 5KFUA 4ED1A 2P6RA 5IINA 1NK0A 1B22A 5EWFA 5KT4A 2F1JA 4DLGA 1S9FA 1X9SA 8ICFA 1IXRA 4J9QA 1QLNA 3OJUA 4Q43A 4YP3A 4UBCA 3OJSA 1UA0A 3C2MA 3RJEA 4JWNA 4QWBA 1BPEA 4NXZA 2C28A 1ZQMA 4O5EA 2DFLA 3TANA 1N56A 1ZQSA 8ICMA 3OHAA 3EZ5A 2LYHA 3TFSA 1KLNA 2HHSA 3FDSA 3GFKB 1L3SA 4JV1A 4ECXA 5J2IA 2KZZA 9ICRA 5HMLA 3RTVA 3BQ1A 2UVVA 4I2CA 4RNOA 4B9LA 4MF8A 8ICAA 5KT7A 1V9PA 3KHHA 4UB1A 1NJWA 3RH5A 4EYHB 2KFNA 5TZVA 1ZQKA 2PFNA 8ICSA 5CA7A 5KT5A 5KFNA 2IHNA 7ICFA 1K1SA 9ICXA 4Q44A 1D9DA 5KFVA 3EPIA 5KFIA 1L5UA 4BXOB 5KFAA 4YQWA 2W9BA 4F4ZA 8ICUA 4DFPA 8ICCA 3ORYA 9ICTA 3Q8LA 1TV9A 4KN4A 2IBKA 4DFMA 4DWIA 4M9GA 3ZD8A 9ICCA 4DEZA 4RT3A 4DOBA 3GV7B 1D8YA 3C2KA 3BQ2A 2UVRA 2KFZA 1ZQQA 3B0YA 1SKRA 3KHLA 3RR7A 2V4RA 4F5QA 5DBCA 3TAPA 2ASDA 2ASLA 5KFSA 4RU9A 4B9VA 2W9CA 1NJXA 4ELTA 2HW3A 2NRZA 3UQ0A 1TVAA 8ICQA 1BGXT 4MFFA 1B43A 1TAQA 1RPLA 2W8KA 4O3NA 3OSNA 3RJHA 8ICLA
chains in the Genus database with same CATH superfamily
1RQLA 4UASA 3N97B 4J9PA 2W43A 2CN1A 4Y2YA 1SXEA 2QARB 5KFZA 3FYHA 1Q3UA 4I2AA 3JPOA 1S97A 2C2RA 1LB2B 1SZHA 1SXDA 2PFQA 1J97A 3NGDA 2JEIA 5KTQA 3VCBA 9ICBA 5H2FU 1JUDA 2ZJ5A 2ASJA 3OHBA 4EEYA 5AKLA 1X66A 3I76A 4FZLA 3T5KA 1SKWA 3KTQA 4M9HA 7ICIA 3C5GA 2K4HA 2MRLA 3KKAA 2JEGA 3RJKA 1JMSA 1RG6A 5J2CA 3SI8A 2YB1A 4RZRA 4FFDA 3H8MA 4C8NA 3GV5B 4OJLA 1ZQEA 2J6SA 3RJIA 5L1JA 2XCPA 4DSEA 2F8KA 3H40A 2WAQF 2YX8A 5DLGA 3JPTA 5ALJA 5KFLA 2HI0A 3NTUA 4I2BA 4Y2SA 5AM5A 2C22A 2ZJ8A 1S5LU 5HP4A 2H3FA 3RF9A 1AQ6A 4U6PA 2XI9A 1L7MA 4JB3A 4ZOHC 4ECTA 3MBYA 3ETLA 5J0QA 3RB0A 4RUCA 3TAQA 1RM6C 3GQCA 1BPZA 3NUQA 1KTQA 2YY6A 4EYIB 4ICAA 2LM1A 1VDVA 1B4FA 1U47A 4QWEA 4DLEA 3ETRA 8ICPA 4ED3A 2FI1A 2YB4A 4Y2UA 5KT6A 1LVHA 5J0WA 1Z00B 3OGUA 3RH6A 4QZCA 2O6KA 4FO6A 4B6JA 5JU5A 5AM4A 3SMVA 1QTMA 5AK4A 1ZJMA 1SL2A 4OJ5A 4IRCA 2K4IA 3E0FA 4TQRA 1X9XA 3N7PD 4IQVA 3CYMA 2H3ZA 2ZUBA 4M6WA 4B9NA 2NRTA 4MEYA 1A76A 4PHPA 2EH9A 2HHQA 2KTQA 4DF8A 1T94A 3IG8A 1HUZA 5AK5A 2K8AA 5J2HA 4J9KA 4TUPA 4NY8A 5KFRA 4BGDA 2OWOA 4RQ5A 2KZMA 2ODGA 4UAZA 3D2NA 3Q8PB 4DL3A 2BR0A 5KT2A 2AQ0A 2LYBA 3RJFA 1ZQJA 2DF4B 3F53A 9ICSA 2AH5A 3C28A 4DL6A 3H8JA 1MQ3A 5KFJA 4P4MA 1F5SA 3ISCA 2QB1A 7ICEA 5HMMA 2BZFA 4M47A 2Q4TA 3PY8A 1J2NA 5ALXA 2D8CA 1OW5A 3T5LA 1RXWA 1Z3EB 2CPRA 2DQNB 2JH7A 4PPXA 3PSIA 2EZYA 3D2QA 4J9SA 4QZFA 5AI6A 4LZDA 3QUCA 2NRWA 2KJ9A 3LWMA 5DDYA 1LKYB 5ALSA 2FMPA 3PX6A 4RPYA 1QQ6A 1N2XA 5KFBA 8ICRA 3BS5B 3WU2U 1ZQOA 4C7ZA 1RZTA 5IIMA 5EE9A 4USAA 4R8UA 4KLUA 2IHMA 2W04A 5ALMA 2JZBB 1ZQ1C 4M9NA 1C20A 1L7NA 4F91B 2PFOA 1XU4A 2WF8A 5ALZA 4PGYA 4F5RA 3D2SA 4DS5A 1U48A 5KFQA 4UAUA 3GIIA 3B0XA 4C8OA 4Y2VA 2Y9TA 2NO4A 2G0AA 5ALLA 1PZNA 3IG5A 2A1AA 4F4WA 4I28A 4YR2A 2L5YA 2J6TA 4PH5A 4O3RA 3JPPA 4DSJA 2XY6A 4C4SA 4F50A 9ICQA 3KHGA 4XUSA 7ICLA 4I2JA 1URJA 4ECZA 5J0OA 4UB2A 1NZPA 5HR6A 1F0MA 2F2AB 5KFFA 2NYVA 2DPJA 2FMQA 3AN1A 1NKEA 4MFAA 3PR4A 1BNOA 1ZOLA 4F2SA 8ICGA 1S10A 4ECRA 4GXJA 1KEJA 9ICKA 3ISBA 4EZ9A 3WKAA 1ZQZA 1TAUA 5IIKA 4RQ2A 3PZPA 5EWGA 2HOIA 5DQHA 3JPNA 1S77D 2M9NA 2G06A 1JXEA 3WK5A 5ALUA 4DSKA 2BPGA 4ECQA 3N7RC 3K1RB 2W11A 5CJ7A 4AYBC 2KOBA 5JTIA 5KFKA 4NLBA 4DSFA 4KLGA 4J9NA 2BPCA 3BJYA 4J9MA 4NLKA 1L3UA 5KNIA 1NJZA 3HWTA 2NO5A 4M9LA 2NRXA 2YMLA 3C5FA 3F2BA 4UB6U 2MUTA 4KLQA 2RP5A 3QU7A 4DFJA 2P66A 2F44A 5KFTA 3WKEA 7ICUA 2QB0A 2WB1F 1KN5A 4Y2QA 4ECVA 3GIJA 2ZIWB 1K5OA 4OD0A 3V6JA 2D3DA 1XNSA 4EZ6A 4BWJA 4RQMA 4F5PA 1QQ7A 1PUZA 2ZXIA 3MDAA 3QZ8A 9ICGA 5CP2A 1X9WA 5CWRA 5KFEA 1SWVA 5GTIU 1UHUA 4QZ9A 4O5KA 5J2GA 1WCLA 3LK9A 2P6RA 5IINA 1CI4A 1KL9A 8ICFA 1IXRA 4EEKA 2H3IA 2PMZC 1QLNA 1ED1A 3OJUA 4YP3A 3RJEA 4IL6U 2LI6A 1BPEA 4NXZA 2DFLA 2KV2A 1F44A 3ED5A 3OHAA 2LYHA 4GFJA 2E3TA 5HMLA 3RTVA 3PSFA 4RNOA 1YT3A 3KHHA 1NJWA 4BJQA 3RH5A 4EYHB 1ZQKA 2KKPA 3SD7A 2PFNA 5AKGA 5AKHA 5KT5A 2IHNA 1K1SA 1NZBA 1QH9A 4Q44A 5KFVA 2Y9UA 5KAFU 4DFPA 5AI4A 3Q8LA 2B0CA 3A0HU 3BZCA 5AM3A 4DFMA 4DWIA 2JXJA 1D8YA 3C2KA 1N5WA 4CF4A 3BQ2A 3KFUF 1ZQQA 2V4RA 4F5QA 1V38A 3TAPA 2ASLA 2HW3A 4MFFA 4O3NA 1T3NA 8ICLA 9ICJA 3J81j 3V7LA 4LZGA 4UAWA 2EAOA 3RBEA 3G6VA 2BCUA 2KEYA 4ELUA 4TUQA 5L1LA 3AQEA 4Y2RA 4HAIA 2JHDA 2MAXA 3L4PA 4QZBA 2BQ3A 3V6KA 4IQTA 2DBYA 1ZQTA 2OH2A 4RQ6A 1Q8KA 4NLNA 4O3MA 3FM9A 1SKSA 1XSPA 1Z4NA 3NRWA 1BPDA 1B0XA 5JRTA 2DKXA 5ALFA 4IR1A 2E8PA 2ZTDA 2YMMA 5DKWA 2C2EA 4F93B 1KDHA 4E0DA 2Y0SF 3M9NB 2UVUA 1NKCA 4PZOA 4BXOA 4O3PA 2ALZA 4KLEA 3N4MB 4BX9C 1XWLA 4XA5A 2HBMA 5KL1B 2EAPA 4MEXA 1ZQUA 2KD1A 1NK7A 2PI4A 2IA6A 3RJJA 2W54A 2HHTA 1BVSA 5AM2A 1BNPA 4O3OA 4F3OA 1RQNA 3LVWA 5J0RA 4FS2A 2KP7A 4YMNA 5KFPA 1FFVA 4ED6A 1FFUA 1S76D 2MA1A 3PMNA 3SZ2A 2WTFA 4IRDA 4J9OA 5ALRA 3C1YA 2ZIVB 5KFOA 5HHHA 2RDIA 3EUB2 1L3VA 1X40A 3TADC 1XS9D 2XO7A 2KICA 3EW9A 1QSSA 5J2KA 9ICMA 4CRXA 4QW8A 2WFAA 1QQ5A 3KZXA 4DOAA 3LWLA 3V7KA 4Q8EA 4EBDA 4GIBA 3ALRA 4EBCA 3V6HA 5AKZA 4B9UA 4YG2A 1DOQA 7ICMA 2ZIUA 3M9OB 1ZQXA 2FJ6A 4CF5A 5AI8A 3ISDA 2BPFA 3PW2A 5ALEA 4I2DA 4I27A 7ICTA 3Q8MA 5KFHA 5EWEA 4P0PB 1T3QA 3PW0A 2AHOB 5J2BA 1DXSA 2PFPA 1ZD2P 2A1JB 5KFDA 8ICKA 3RJGA 2EAMA 2HDOA 3MFHA 1KSPA 1AROP 3JPSA 4KLHA 3PO4A 4UQGA 2ZUCA 3WK6A 4NV0A 4OJOA 4PGXA 2JEJA 3AMZA 1TK0A 4PJ0U 3KZIU 1JROA 1ZRNA 2I5HA 4R65A 2FPKA 3SEIA 1ZD5A 2Q0ZX 1HJPA 3FC4A 5KFYA 2GO7A 2HVIA 3UMCA 3M1YA 3I28A 4P4PA 2K4PA 4US9A 3JPRA 4RQ4A 4YR0A 4LVSA 4B9MA 1MQ2A 9ICWA 2F76X 1PK1B 4IC9A 5AKJA 5L1IA 4CCHA 5KG4A 5KT3A 3M8SA 1ZQBA 2OYYA 3V72A 5DB7A 4BWMA 1A0PA 5IIJA 3F2DA 1XSLA 2IOFA 3UXPA 4P4OA 2DPIA 2KZ3A 1JN3A 4FE3A 3AEVA 5HR7A 2OXOA 5AKIA 4QJFB 5J2EA 2ZXHA 3MFIA 1L7OA 3H8WA 1VJ5A 4DFDA 2WF7A 5J0XA 1L7PA 4O0IA 4Q45A 4DOCA 4FZNA 4GC6A 2R8IA 4YCXA 3IDWA 5J2JA 3LYSA 5GTHU 2I6XA 2GOLA 4P0QB 5FP0A 8ICJA 8ICXA 2F1HA 2F8LA 4PHEA 4F5NA 5F9NA 2K60A 3K75D 4C8LA 9ICNA 5KG2A 3N7SC 2G09A 1U49A 2Z7JA 1X2IA 5DB8A 1FEZA 5B66U 3PW4A 4F72A 4ECYA 4F5OA 4R66A 5AK3A 4FBUA 1SB3C 3AU6A 4MF2A 2YN4A 4QZHA 4F2RA 2B21A 3R9KA 2W7PA 2XVTA 1NK6A 4JV0A 2I1QA 3D6JA 2KHVA 2HOQA 2DL0A 3G6YA 5B5EU 4NL9C 2HVHA 1XO1A 2R18A 5BOLA 3QX7A 5KFXA 5E79U 3EYZA 1ZYQA 1PVPA 4MFCA 1COKA 5KFGA 4NLCA 2LYAA 2F1IA 1A6SA 9ICLA 2RDJA 1ZQLA 3IV6A 1P7DA 4WJ3B 3PX0A 9ICHA 3BDPA 4KITB 3ZDCA 1ZD3A 4QWCA 3GZFA 4NJ8A 3MDCA 3RB3A 4KLIA 1RXVA 1X9MA 2KSOA 2B6GA 1RYRA 1NK4A 2FMSA 1UT8A 3OPXA 3RH4A 2IOHA 1RDFA 3HJEA 4UARA 3GU3A 3GIMA 4J9RA 3BQ0A 5L1KA 1MC8A 3ZDBA 1NK0A 2OEHA 1S9FA 1X9SA 2OM6A 2W3RA 4J9QA 2CRXA 3OJSA 2H3QA 3C2MA 4QWBA 4O5EA 3EZ5A 1KLNA 5AI0A 1L3SA 4ECXA 5J8YC 9ICRA 3F5EA 1GO3F 2UVVA 3DV9A 3ONNA 2K89A 5TISU 5TZVA 4FZMA 5CA7A 7ICFA 5KFNA 2QKQA 2EDUA 3EPIA 4YQWA 2W9BA 2JGAA 9ICTA 3ORYA 1TV9A 3SAFA 2IBKA 3SR6A 3ZD8A 1ECWA 4DOBA 3QU4A 1UCVA 2VIXA 2YTUA 3NVVA 4ACOA 2VKQA 3SQIA 4MHVA 5EE3A 4KX3A 2KIWA 5AK6A 2ASDA 1SV4A 3IP4B 4ELTA 2NRZA 1B43A 3OSNA 9ICFA 2XGPA 2AU0A 1KFSA 3HKZC 4QWDA 1ZQVA 4PL2A 4NM2A 7ICQA 5DBAA 1OUQA 2FLNA 2HHXA 2HHWA 4F71A 3F2CA 3MGIA 2RHFA 4UW9A 5DG9A 3PNCA 5KG5A 2DGZA 4DFKA 5AHXA 3PMLA 2BQRA 7ICKA 4YR3A 2VANA 1ZQDA 3HP6A 3DEEA 1X42A 4ECWA 2R8HA 7ICSA 4DS4A 4M6WB 2WF9A 2BGWA 3ICXA 4PL1A 3GDXA 8ICNA 2W9CB 3WKDA 1N61A 3UMBA 5J0TA 2BDUA 2ZIVA 3MR6A 4K4IA 2W9AA 2RLTA 1T4GA 1WCNA 2BQUA 4M9JA 2PMZF 2P35A 1ZQPA 5ALHA 9ICVA 4O3SA 1ZQIA 2WF6A 4UATA 4JV2A 3KD3A 4YXJA 4RNMA 3SYZA 5J0PA 2ES6A 2QLTA 2ZIXA 3PX4A 2V9WA 2XY7A 3RB6A 2UVWA 2AGPA 5AKXA 4QZDA 4Z6EA 2QARA 4G3IA 3HW8A 4YFKA 5KG1A 4KLJA 2KNJA 4Z6CA 1Z1VA 1NKBA 2IMWP 2Y1JA 2HHUA 1HIWA 3S6JA 2VA2A 1IV8A 1S8OA 5CEHA 1D8LA 4QZ8A 4F8RA 2ZJAA 1O08A 4PGQA 2NRVA 2E1FA 4QZEA 5KFCA 8ICHA 3M6ZA 3DDHA 2E8MA 3IRUA 4X5VA 3PV8A 4YD2A 1NOMA 4J9LA 2E8NA 3PR5B 1L6NA 5ALKA 4RQ7A 4BUGA 3ZDEA 4R8UB 7ICNA 3QU2A 2PKEA 3KBBA 3G6XA 5KL8B 3GIKA 4B9SA 1ZQWA 5J2AA 3OSPA 4C4RA 2R8KA 8ICYA 4KLDA 3T3FA 2J6UA 4DL5A 4Z6DA 4XQ8A 4TQSA 1DGSA 3PSTA 1J2MA 2NV3A 4RQ1A 2ISPA 4KTQA 1VLBA 5CB1A 4DO9A 4I2FA 9ICEA 4QNLA 3H0RB 1ZQCA 4NLGA 4KX5A 4J03A 2KE7A 4QZGA 5EOZA 1Z00A 3CW2C 1D8BA 4U7CA 4TURA 3NVWA 2HBLA 2F77X 1NK9A 5BPCA 2ATLA 3QZ7A 3TFRA 5AM0A 4IR9A 5DQGA 3E2EA 8ICZA 5G5HA 2KN7A 3NVYA 1IIPA 1NNLA 2W03A 7ICVA 3NASA 3LDAA 1OXJA 1WUDA 1L3TA 1KBUA 2HHVA 3T79A 4JUZA 1JI7A 1ZETA 5ALNA 4YXMA 1KFTA 4O5CA 1JRPA 3V7JA 5IILA 4AP9A 5DGAA 5DDMA 2FLPA 3QUQA 1DRGA 2E1EA 3H8SA 1HEKA 2ZUDA 1MA7A 5ALTA 5DGBA 5D46A 4GXIA 1EXNA 3QXGA 3M9MB 5DQIA 3TI0A 4UAYA 3AUOA 1S0VA 2KKVA 3H4BA 8ICEA 2KJ8A 5IIIA 1ZQAA 1WWVA 4YD1A 2MUTB 1YZ7A 2VJ5A 2QB0B 1JX4A 3C2LA 2IOFK 4QIWC 3HT3A 5DG7A 1TK8A 3SAGA 3H0LB 2KVCA 3JPQA 2LHTA 1T8EA 4KLOA 2OCEA 3QNMA 3MR5A 3IN5A 3ZDDA 2R8GA 3M8RA 5ALYA 4C8MA 3PW7A 1UT5A 2ZTEA 3C29A 1SL1A 3OTQA 4CE6A 5DBBA 2DKZA 4R63A 4UAVA 3RRHA 1T7PA 4KLLA 2YMPA 4M0AA 1S0MA 3E58A 3U26A 3ZDAA 5L1MA 3ZI4A 1UQVA 1LKYA 2W9MA 3AM9A 4IRKA 4EENA 4C8KA 1KQQA 1TFRA 3QU5A 1DGJA 2BCVA 7ICJA 3BS5A 2AQ4A 2W55A 5G5GA 3UMGA 2WF5A 1CEZA 1Y88A 4DQSA 1ZQYA 5ALOA 4RNNA 3GILA 2JZBA 4ED0A 3NVZA 1ZQHA 1KRPA 2K8CB 4DQQA 5AM1A 1O03A 4ZH4A 2KHQA 3PVXA 1IG6A 3Q8QB 2R8JA 5KAIU 5DB6A 3HRDD 2XGQA 4KLTA 3QYPA 4O9MA 3K4GA 5DG8A 7ICOA 3IHQB 1C7YA 3UXOA 3VC8A 4NWIA 3ZD9A 4A8EA 3H4DA 4TUSA 3C21A 4JK1A 4ED8A 5J2DA 1SZPA 4R64A 1YZ6A 4FBTA 2LM4A 1N63A 4JWMA 2WAQC 1WG8A 1WWUA 1A77A 2BDPA 3EPGA 8ICOA 5T14A 3WK7A 4C0ZA 5KFUA 4ED1A 3RFAA 3TADA 4UBCA 3M6KA 1M6YA 1ZQMA 3TFSA 4JV1A 1NI3A 2HBKA 2A3VA 5F3XB 4I2CA 4B9LA 4MF8A 3CNHA 8ICAA 5KT7A 1V9PA 2KFNA 4OO1J 2EQYA 9ICXA 3QU9A 4C4TA 4BXOB 4F4ZA 8ICUA 8ICCA 4Y2JA 1DK2A 4KN4A 4M9GA 5ALIA 9ICCA 4JMUA 3GV7B 2KFZA 3B0YA 1SKRA 3KHLA 3KOOA 5DBCA 3NS1A 5KFSA 2W9CA 1NJXA 1BGXT 1SWWA 1RPLA 5DLFA 2ZIWA 4I29A 2BKEA 2ISOA 2ZTCA 4YN4A 2XIDA 2VA8A 4P2HA 1V97A 3CP8A 4DF4A 2BCRA 3C1ZA 1MN8A 3BZKA 1SIJA 3C23A 2LMRA 1ZQGA 2HMXA 4US8A 2XY5A 1S0OA 3A0BU 2FE9A 2C2DA 1CUKA 2A19A 5ALQA 4QWAA 1DK3A 3O0FA 2ZIUB 2LPEA 2XICA 5BOMA 3F5AA 5F9LA 7ICRA 3RRGA 2ESEA 4PZNA 5D4BA 3MC1A 3MR2A 3RBDA 2G5HB 1TKDA 4UBBA 4O3QA 9ICIA 4CF3A 2DWQA 8ICBA 2JRZA 3QE9Y 2HSZA 1H38A 3KHRA 2EZXA 1NK8A 2LKYA 4DL2A 4C7YA 5D49A 5AICA 4IS7A 5C5JA 3Q8KA 1ZQRA 5AIBA 3M7DA 2BCSA 4I2GA 1NJYA 4C80A 3WKCA 4RPZA 1FO4A 5K4LA 3SV3A 1ZQFA 4UB8U 2VA3A 3H7IA 4K4GA 3WK8A 4DQPA 2HBJA 1CRXA 2G5IB 2EANA 5EE0A 3WK9A 4K4HA 2D6FC 2AGOA 3RR8A 3QUTA 4RQ3A 3QUBA 2RRDA 5C0YA 4YMMA 3HKZF 2VJ4A 4OCZA 4CGZA 3T5JA 2ZG6A 1N5XA 1Z1BA 1FIQA 5ALPA 4ED2A 4AYBF 4KLMA 2FLLA 4FS1A 5ALVA 5J0YA 5J2FA 3UQ2A 2CXYA 3WK4A 5AI5A 5CRXA 3IM1A 4Z6FA 4PHDA 1K1QA 1LV5A 4QZAA 2FPMA 5KG7A 5KFWA 2KK0A 5J29A 4F4KA 2V4QA 3L3FX 3H0MB 1BPXA 4NL9A 4RQ0A 4I2HA 1SL0A 4I2IA 4Y2TA 2JH1A 1QSYA 5KFMA 3TACB 4QW9A 5KG6A 2JR5A 1BPYA 3MABA 4DSLA 9ICUA 1KFDA 1JALA 2KVSA 2W8LA 3THVA 1XC9A 1N60A 3PO5A 1TE2A 4RT2A 4EBEA 4GC7A 2P6UA 3SAHA 7ICHA 1U45A 4RQ8A 3PW5A 4F92B 1QSLA 4KLSA 3HX0A 3AL0B 5KG0A 4EX6A 2YMQA 4LJXA 1N48A 3UXNA 5ALDA 4G9BA 1L8LA 1ZQNA 3SENA 2E8OA 5A0LA 3BQTA 5IIOA 3BQ7A 4I2EA 1Z4OA 1ZJNA 3HILA 2GLEA 3MGVA 8ICTA 4ELVA 4KN7A 2WB1C 2H5XA 2PXIA 2XC9A 5ALGA 2GWSA 1JIHA 1QCKA 5AI9A 1V85A 4GXKA 2BHNA 3L5KA 9ICAA 2YQEA 4P0PA 3PSPA 5J8YA 1D9FA 3CRXA 4F4YA 1COOA 8ICWA 1HUOA 1X6JA 5J0SA 4QZIA 3UM9A 2A1JA 4UB3A 1SV0C 2W3SA 3TQ1A 4OJ6A 1PK3A 4PHAA 1ZD4A 1XO0A 4BDPA 8ICIA 3TARA 3HPOA 4DCCA 2KSOB 2JMGA 2KJ5A 4YVZA 4XRHA 3RAXA 2FDRA 3T5HA 1UA1A 4ECSA 2AGQA 2PI5A 1NK5A 1BPBA 4CNQA 4ECUA 3MGHA 4NM1A 5AIAA 5HHIA 3GV8B 1XSNA 3I1YA 4GLXA 3RAQA 8ICVA 3K1ZA 2K8BB 4HYKA 4F4XA 5KG3A 3MR3A 3UPQA 5JUMA 5AKYA 2FPLA 3SV4A 5CHGA 1ZXIA 2W7OA 4DQIA 4DL4A 2MU2A 1U9LA 3N28A 1SGGA 1PK1A 1KW4A 4Q8FA 7ICGA 2GH1A 9ICPA 2XCAA 5HNKA 4RQNA 1RYUA 7ICPA 3WKBA 2K4EA 1KKXA 1IM4A 4UB4A 1U4BA 2LBOA 4UB5A 3QEBZ 4KMUA 1UPHA 3B9JA 2N1RA 1S0NA 3EWAA 3AU2A 4ED7A 2JEFA 4NLZA 2F3NA 4DL7A 1MSWD 2OHFA 4IQWA 3KKAC 5AKKA 4M04A 2W9BB 2BCQA 1X6IA 2E5SA 1TK5A 5J0UA 5EE1A 4DSIA 4YMOA 4IQUA 2Y1IA 9ICOA 3BS7A 3LVVA 3Q8SB 5AKEA 4DQRA 2H3VA 4B9TA 1Q3VA 3Q8RB 4KLFA 2I9GA 3QEAZ 1JXLA 2DUYA 2AJQA 4RPXA 4M2YA 2KIVA 2KG5A 5CR0A 1ZRMA 4P0QA 5DB9A 1RYSA 4KMOB 3RB4A 2RQ5A 2Y0SC 5L9XA 2WHEA 4RUAA 4QIWF 5ALWA 2KMDA 1B22A 5EWFA 5KT4A 2F1JA 4DLGA 2M0NA 4Q43A 1UA0A 4JWNA 1Z19A 2C28A 1Q46A 2G08A 3TANA 1N56A 1ZQSA 8ICMA 1SV0A 2HHSA 3FDSA 3GFKB 1N62A 2KZZA 5J2IA 3AQFA 3NRZA 3BQ1A 2HOFA 4EELA 4UB1A 2MSNA 1WYGA 4Y2XA 1PVQA 8ICSA 1D9DA 3FAHA 5KFIA 4CDGA 1L5UA 5KFAA 3TKAA 1L8OA 2EZZA 2AXTU 4DEZA 4RT3A 2JV3A 2G07A 2UVRA 4EX7A 4Y2PA 1TAMA 2HCFA 3RR7A 4OJPA 1PVRA 4RU9A 4B9VA 3UQ0A 1TVAA 8ICQA 1TAQA 2W8KA 3RJHA 2ZIXB
chains in the Genus database with same CATH topology
9ICJA 9ICFA 2XGPA 3V7LA 2AU0A 4LZGA 1KFSA 4UAWA 4QWDA 3RBEA 4I29A 3N97B 4J9PA 3G6VA 1ZQVA 4NM2A 2BKEA 2BCUA 7ICQA 5DBAA 2ISOA 4B9SA 2FLNA 4ELUA 4TUQA 5KFZA 3FYHA 5L1LA 4I2AA 2HHXA 3JPOA 1S97A 2HHWA 2C2RA 1LB2B 2PFQA 2ZTCA 4YN4A 3NGDA 3MGIA 2VA8A 2JEIA 5KTQA 4P2HA 2MAXA 5DG9A 9ICBA 3PNCA 4DF4A 2BCRA 2ZJ5A 5KG5A 2ASJA 4QZBA 3OHBA 2BQ3A 4EEYA 3C1ZA 3V6KA 4DFKA 3T5KA 3PMLA 2BQRA 1SKWA 4IQTA 3C23A 3KTQA 3C5GA 4YR3A 2JEGA 2VANA 1ZQDA 4M9HA 7ICIA 1ZQTA 3RJKA 1JMSA 1ZQGA 3HP6A 2XY5A 5J2CA 3SI8A 4RZRA 4C8NA 4RQ6A 4ECWA 1S0OA 2R8HA 3GV5B 7ICSA 4DS4A 4M6WB 1ZQEA 4NLNA 2C2DA 2J6SA 3RJIA 1CUKA 4QWAA 5L1JA 2BGWA 3GDXA 8ICNA 2W9CB 1SKSA 2XCPA 4DSEA 1XSPA 3H40A 7ICTA 5DLGA 3JPTA 5KFLA 3NTUA 1BPDA 5BOMA 4I2BA 5J0TA 5F9LA 4IR1A 2ZTDA 7ICRA 5DKWA 2C2EA 2C22A 3MR6A 3RRGA 2ZJ8A 4K4IA 2W9AA 5HP4A 4F93B 1KDHA 4E0DA 1T4GA 5D4BA 1WCNA 3M9NB 2UVUA 3MR2A 4ECTA 3MBYA 3ETLA 5J0QA 3RB0A 2BQUA 4RUCA 1NKCA 4M9JA 1T3NA 3RBDA 3TAQA 4BXOA 3GQCA 1BPZA 4O3PA 2ALZA 1TKDA 4UBBA 4KLEA 3N4MB 4O3QA 1XWLA 4XA5A 9ICIA 1ZQPA 1KTQA 9ICVA 4EYIB 4O3SA 8ICBA 4MEXA 1ZQIA 1ZQUA 3QE9Y 1H38A 1NK7A 2PI4A 4JV2A 2IA6A 3RJJA 3KHRA 1U47A 4QWEA 4DLEA 2HHTA 1BVSA 1NK8A 4O3OA 4YXJA 8ICPA 4RNMA 3SYZA 4ED3A 4DL2A 4F3OA 5J0PA 5J0RA 4FS2A 5KT6A 5D49A 5KFPA 4YMNA 5C5JA 3Q8KA 1ZQRA 5J0WA 1Z00B 4ED6A 3OGUA 3PX4A 2V9WA 2XY7A 3RB6A 3RH6A 2UVWA 2BCSA 1S76D 2AGPA 4I2GA 3PMNA 1NJYA 4QZDA 4Z6EA 4QZCA 3SZ2A 2WTFA 4RPZA 4IRDA 4J9OA 4FO6A 4G3IA 3HW8A 3C1YA 5KFOA 4YFKA 5HHHA 5KG1A 2RDIA 3SV3A 1L3VA 1ZQFA 4KLJA 1XS9D 2VA3A 3H7IA 2XO7A 4K4GA 4DQPA 1QTMA 4Z6CA 3EW9A 1NKBA 2IMWP 1QSSA 2Y1JA 2HHUA 1ZJMA 5J2KA 2VA2A 4K4HA 1SL2A 9ICMA 2AGOA 1D8LA 4QZ8A 3RR8A 4QW8A 4RQ3A 4IRCA 4F8RA 2ZJAA 4PGQA 2NRVA 4YMMA 4TQRA 4QZEA 5KFCA 8ICHA 4DOAA 3LWLA 4IQVA 3V7KA 3T5JA 4Q8EA 2ZUBA 4M6WA 4EBDA 4X5VA 4B9NA 3PV8A 4YD2A 4ED2A 2NRTA 1NOMA 4MEYA 4J9LA 4EBCA 3V6HA 1A76A 3PR5B 2FLLA 4KLMA 4B9UA 4YG2A 1DOQA 7ICMA 4FS1A 4PHPA 3M9OB 4RQ7A 1ZQXA 3ZDEA 4R8UB 5J0YA 5J2FA 3UQ2A 2KTQA 4DF8A 2HHQA 7ICNA 1HUZA 3ISDA 5J2HA 2BPFA 3PW2A 3G6XA 4J9KA 4TUPA 4I2DA 3IM1A 4Z6FA 4PHDA 1K1QA 3GIKA 5KFRA 5KFHA 5EWEA 3Q8MA 1LV5A 1ZQWA 4QZAA 2FPMA 4BGDA 5KG7A 5J2AA 3OSPA 2OWOA 5KFWA 4F4KA 5J29A 3PW0A 5J2BA 4RQ5A 2KZMA 2R8KA 2V4QA 4KLDA 4UAZA 3T3FA 3Q8PB 4DL3A 2BR0A 2J6UA 8ICYA 2PFPA 5KT2A 2AQ0A 4DL5A 4Z6DA 1BPXA 4XQ8A 4TQSA 3RJFA 2A1JB 5KFDA 4RQ0A 4I2HA 1ZQJA 1DGSA 1SL0A 4I2IA 4RQ1A 2ISPA 4KTQA 1QSYA 8ICKA 5KFMA 3RJGA 5CB1A 4DO9A 4I2FA 9ICEA 4QW9A 5KG6A 3MFHA 1BPYA 9ICSA 1ZQCA 3MABA 4DSLA 9ICUA 1KSPA 1KFDA 1AROP 3JPSA 4KLHA 3PO4A 4NLGA 4UQGA 2ZUCA 4DL6A 4QZGA 4PGXA 3H8JA 2W8LA 1MQ3A 2JEJA 5EOZA 3THVA 1Z00A 5KFJA 4P4MA 1XC9A 1TK0A 3ISCA 4TURA 7ICEA 3PO5A 4R65A 2FPKA 1NK9A 5HMMA 5BPCA 2ATLA 2Q0ZX 1HJPA 5KFYA 4M47A 4RT2A 3PY8A 2HVIA 3QZ7A 4GC7A 4EBEA 2P6UA 3TFRA 3T5LA 4IR9A 5DQGA 3E2EA 7ICHA 8ICZA 1RXWA 1Z3EB 1U45A 4P4PA 2KN7A 4RQ8A 3PW5A 4PPXA 3JPRA 4F92B 1QSLA 4RQ4A 4J9SA 4QZFA 4YR0A 4LVSA 4B9MA 4KLSA 7ICVA 4LZDA 3HX0A 1MQ2A 3LDAA 2NRWA 9ICWA 1L3TA 3LWMA 2HHVA 5DDYA 5KG0A 2FMPA 5L1IA 4CCHA 5KG4A 5KT3A 3M8SA 3PX6A 1ZQBA 3V72A 1N48A 4JUZA 4RPYA 3UXNA 1ZETA 5DB7A 4BWMA 1ZQNA 5KFBA 8ICRA 4YXMA 3BQTA 1KFTA 5IIOA 5IIJA 4I2EA 4O5CA 1ZQOA 1ZJNA 1XSLA 3V7JA 5IILA 1RZTA 5IIMA 8ICTA 3UXPA 5DGAA 4ELVA 4P4OA 5DDMA 4KN7A 2PXIA 2H5XA 2KZ3A 1JN3A 2DPIA 2FLPA 4R8UA 2XC9A 4KLUA 2IHMA 2GWSA 1JIHA 2JZBB 3H8SA 2ZUDA 4M9NA 5J2EA 4GXKA 4F91B 5DGBA 2PFOA 2BHNA 5D46A 1EXNA 1XU4A 4GXIA 9ICAA 4PGYA 3M9MB 4F5RA 4DS5A 5DQIA 3TI0A 4UAYA 3AUOA 3MFIA 1S0VA 1U48A 5KFQA 3GIIA 1D9FA 3B0XA 4C8OA 4F4YA 3H8WA 1COOA 8ICWA 3H4BA 1HUOA 5J0SA 8ICEA 4QZIA 2A1JA 1PZNA 5IIIA 5J0XA 4UB3A 1ZQAA 4O0IA 4YD1A 3TQ1A 2MUTB 4Q45A 4F4WA 4I28A 4YR2A 4PHAA 4DOCA 2J6TA 4PH5A 4O3RA 1JX4A 3C2LA 4BDPA 3JPPA 8ICIA 4DSJA 3TARA 4GC6A 3HPOA 3HT3A 5DG7A 1TK8A 2XY6A 4F50A 2R8IA 4YCXA 4YVZA 4XRHA 3JPQA 3RAXA 5J2JA 3KHGA 9ICQA 4XUSA 3T5HA 7ICLA 1UA1A 4I2JA 4ECZA 4ECSA 2AGQA 1T8EA 2PI5A 5J0OA 1BPBA 4UB2A 3MR5A 3MGHA 4ECUA 1NK5A 4KLOA 3ZDDA 4NM1A 2R8GA 3M8RA 7ICKA 5HHIA 3GV8B 1XSNA 4GLXA 4C8MA 3RAQA 8ICVA 3PW7A 8ICJA 5KFFA 2F1HA 1UT5A 2DPJA 4PHEA 2FMQA 8ICXA 4HYKA 2ZTEA 1NKEA 1SL1A 4F5NA 4MFAA 4F4XA 5F9NA 5KG3A 3PR4A 3K75D 4C8LA 9ICNA 3MR3A 3UPQA 5KG2A 5DBBA 5JUMA 4R63A 3RRHA 1T7PA 2FPLA 4F2SA 1S10A 4KLLA 8ICGA 4ECRA 3SV4A 5CHGA 1KEJA 4GXJA 4M0AA 9ICKA 3ISBA 1S0MA 4DQIA 4EZ9A 1U49A 1ZQZA 4DL4A 3ZDAA 1X2IA 5DB8A 1TAUA 5IIKA 1U9LA 4RQ2A 2W9MA 3PW4A 4IRKA 5EWGA 4Q8FA 7ICGA 4ECYA 4F5OA 5DQHA 4R66A 2XCAA 4C8KA 5HNKA 3JPNA 4FBUA 1TFRA 3AU6A 9ICPA 1S77D 2M9NA 7ICPA 4MF2A 2BCVA 4QZHA 1IM4A 7ICJA 1JXEA 4F2RA 4UB4A 2B21A 2AQ4A 5DLFA 1U4BA 1NK6A 4JV0A 2I1QA 4UB5A 4DSKA 2BPGA 4ECQA 3QEBZ 1CEZA 4KMUA 1Y88A 4DQSA 5CJ7A 1S0NA 3G6YA 1ZQYA 3AU2A 3EWAA 4ED7A 2JEFA 4RNNA 3GILA 4NLZA 1XO1A 4DL7A 2HVHA 5KFKA 5BOLA 2JZBA 5KFXA 4DSFA 1MSWD 4ED0A 3EYZA 1ZYQA 4MFCA 1ZQHA 4KLGA 5KFGA 4IQWA 1KRPA 4J9NA 2BPCA 3BJYA 4J9MA 4M04A 4NLKA 4DQQA 2W9BB 1L3UA 2F1IA 2BCQA 1NJZA 4ZH4A 3HWTA 9ICLA 2RDJA 1TK5A 5J0UA 1ZQLA 3PVXA 4DSIA 3Q8QB 4YMOA 4IQUA 3PX0A 2Y1IA 2R8JA 2NRXA 3C5FA 4M9LA 3BDPA 9ICHA 9ICOA 4KITB 5DB6A 3Q8SB 3ZDCA 4DQRA 2MUTA 2XGQA 4B9TA 4KLQA 4KLTA 4O9MA 4DFJA 2P66A 4QWCA 3K4GA 5KFTA 7ICUA 5DG8A 3Q8RB 2I9GA 4KLFA 3QEAZ 7ICOA 3MDCA 3RB3A 1JXLA 4KLIA 3IHQB 1RXVA 1X9MA 1C7YA 3UXOA 1RYRA 2AJQA 1NK4A 3ZD9A 4ECVA 3GIJA 4RPXA 2FMSA 1UT8A 3RH4A 3H4DA 4TUSA 4M2YA 3V6JA 5CR0A 3C21A 4EZ6A 4BWJA 4JK1A 4F5PA 4ED8A 5J2DA 4NY8A 1SZPA 3MDAA 4R64A 3QZ8A 4FBTA 4JWMA 9ICGA 5CP2A 3GIMA 1A77A 1X9WA 5CWRA 5KFEA 5DB9A 2BDPA 4J9RA 3EPGA 8ICOA 3BQ0A 1RYSA 3RB4A 4I27A 5L1KA 4QZ9A 5L9XA 1MC8A 4O5KA 4RUAA 5J2GA 1WCLA 3LK9A 3ZDBA 5KFUA 4ED1A 2P6RA 5IINA 1NK0A 1B22A 5EWFA 5KT4A 2F1JA 4DLGA 1S9FA 1X9SA 8ICFA 1IXRA 4J9QA 1QLNA 3OJUA 4Q43A 4YP3A 4UBCA 3OJSA 1UA0A 3C2MA 3RJEA 4JWNA 4QWBA 1BPEA 4NXZA 2C28A 1ZQMA 4O5EA 2DFLA 3TANA 1N56A 1ZQSA 8ICMA 3OHAA 3EZ5A 2LYHA 3TFSA 1KLNA 2HHSA 3FDSA 3GFKB 1L3SA 4JV1A 4ECXA 5J2IA 2KZZA 9ICRA 5HMLA 3RTVA 3BQ1A 2UVVA 4I2CA 4RNOA 4B9LA 4MF8A 8ICAA 5KT7A 1V9PA 3KHHA 4UB1A 1NJWA 3RH5A 4EYHB 2KFNA 5TZVA 1ZQKA 2PFNA 8ICSA 5CA7A 5KT5A 5KFNA 2IHNA 7ICFA 1K1SA 9ICXA 4Q44A 1D9DA 5KFVA 3EPIA 5KFIA 1L5UA 4BXOB 5KFAA 4YQWA 2W9BA 4F4ZA 8ICUA 4DFPA 8ICCA 3ORYA 9ICTA 3Q8LA 1TV9A 4KN4A 2IBKA 4DFMA 4DWIA 4M9GA 3ZD8A 9ICCA 4DEZA 4RT3A 4DOBA 3GV7B 1D8YA 3C2KA 3BQ2A 2UVRA 2KFZA 1ZQQA 3B0YA 1SKRA 3KHLA 3RR7A 2V4RA 4F5QA 5DBCA 3TAPA 2ASDA 2ASLA 5KFSA 4RU9A 4B9VA 2W9CA 1NJXA 4ELTA 2HW3A 2NRZA 3UQ0A 1TVAA 8ICQA 1BGXT 4MFFA 1B43A 1TAQA 1RPLA 2W8KA 4O3NA 3OSNA 3RJHA 8ICLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 9ICJ A;  9ICF A;  2XGP A;  3V7L A;  2AU0 A;  4LZG A;  1KFS A;  4UAW A;  4QWD A;  3RBE A;  4I29 A;  3N97 B;  4J9P A;  3G6V A;  1ZQV A;  4NM2 A;  2BKE A;  2BCU A;  7ICQ A;  5DBA A;  2ISO A;  4B9S A;  2FLN A;  4ELU A;  4TUQ A;  5KFZ A;  3FYH A;  5L1L A;  4I2A A;  2HHX A;  3JPO A;  1S97 A;  2HHW A;  2C2R A;  1LB2 B;  2PFQ A;  2ZTC A;  4YN4 A;  3NGD A;  3MGI A;  2VA8 A;  2JEI A;  5KTQ A;  4P2H A;  2MAX A;  5DG9 A;  9ICB A;  3PNC A;  4DF4 A;  2BCR A;  2ZJ5 A;  5KG5 A;  2ASJ A;  4QZB A;  3OHB A;  2BQ3 A;  4EEY A;  3C1Z A;  3V6K A;  4DFK A;  3T5K A;  3PML A;  2BQR A;  1SKW A;  4IQT A;  3C23 A;  3KTQ A;  3C5G A;  4YR3 A;  2JEG A;  2VAN A;  1ZQD A;  4M9H A;  7ICI A;  1ZQT A;  3RJK A;  1JMS A;  1ZQG A;  3HP6 A;  2XY5 A;  5J2C A;  3SI8 A;  4RZR A;  4C8N A;  4RQ6 A;  4ECW A;  1S0O A;  2R8H A;  3GV5 B;  7ICS A;  4DS4 A;  4M6W B;  1ZQE A;  4NLN A;  2C2D A;  2J6S A;  3RJI A;  1CUK A;  4QWA A;  5L1J A;  2BGW A;  3GDX A;  8ICN A;  2W9C B;  1SKS A;  2XCP A;  4DSE A;  1XSP A;  3H40 A;  7ICT A;  5DLG A;  3JPT A;  5KFL A;  3NTU A;  1BPD A;  5BOM A;  4I2B A;  5J0T A;  5F9L A;  4IR1 A;  2ZTD A;  7ICR A;  5DKW A;  2C2E A;  2C22 A;  3MR6 A;  3RRG A;  2ZJ8 A;  4K4I A;  2W9A A;  5HP4 A;  4F93 B;  1KDH A;  4E0D A;  1T4G A;  5D4B A;  1WCN A;  3M9N B;  2UVU A;  3MR2 A;  4ECT A;  3MBY A;  3ETL A;  5J0Q A;  3RB0 A;  2BQU A;  4RUC A;  1NKC A;  4M9J A;  1T3N A;  3RBD A;  3TAQ A;  4BXO A;  3GQC A;  1BPZ A;  4O3P A;  2ALZ A;  1TKD A;  4UBB A;  4KLE A;  3N4M B;  4O3Q A;  1XWL A;  4XA5 A;  9ICI A;  1ZQP A;  1KTQ A;  9ICV A;  4EYI B;  4O3S A;  8ICB A;  4MEX A;  1ZQI A;  1ZQU A;  3QE9 Y;  1H38 A;  1NK7 A;  2PI4 A;  4JV2 A;  2IA6 A;  3RJJ A;  3KHR A;  1U47 A;  4QWE A;  4DLE A;  2HHT A;  1BVS A;  1NK8 A;  4O3O A;  4YXJ A;  8ICP A;  4RNM A;  3SYZ A;  4ED3 A;  4DL2 A;  4F3O A;  5J0P A;  5J0R A;  4FS2 A;  5KT6 A;  5D49 A;  5KFP A;  4YMN A;  5C5J A;  3Q8K A;  1ZQR A;  5J0W A;  1Z00 B;  4ED6 A;  3OGU A;  3PX4 A;  2V9W A;  2XY7 A;  3RB6 A;  3RH6 A;  2UVW A;  2BCS A;  1S76 D;  2AGP A;  4I2G A;  3PMN A;  1NJY A;  4QZD A;  4Z6E A;  4QZC A;  3SZ2 A;  2WTF A;  4RPZ A;  4IRD A;  4J9O A;  4FO6 A;  4G3I A;  3HW8 A;  3C1Y A;  5KFO A;  4YFK A;  5HHH A;  5KG1 A;  2RDI A;  3SV3 A;  1L3V A;  1ZQF A;  4KLJ A;  1XS9 D;  2VA3 A;  3H7I A;  2XO7 A;  4K4G A;  4DQP A;  1QTM A;  4Z6C A;  3EW9 A;  1NKB A;  2IMW P;  1QSS A;  2Y1J A;  2HHU A;  1ZJM A;  5J2K A;  2VA2 A;  4K4H A;  1SL2 A;  9ICM A;  2AGO A;  1D8L A;  4QZ8 A;  3RR8 A;  4QW8 A;  4RQ3 A;  4IRC A;  4F8R A;  2ZJA A;  4PGQ A;  2NRV A;  4YMM A;  4TQR A;  4QZE A;  5KFC A;  8ICH A;  4DOA A;  3LWL A;  4IQV A;  3V7K A;  3T5J A;  4Q8E A;  2ZUB A;  4M6W A;  4EBD A;  4X5V A;  4B9N A;  3PV8 A;  4YD2 A;  4ED2 A;  2NRT A;  1NOM A;  4MEY A;  4J9L A;  4EBC A;  3V6H A;  1A76 A;  3PR5 B;  2FLL A;  4KLM A;  4B9U A;  4YG2 A;  1DOQ A;  7ICM A;  4FS1 A;  4PHP A;  3M9O B;  4RQ7 A;  1ZQX A;  3ZDE A;  4R8U B;  5J0Y A;  5J2F A;  3UQ2 A;  2KTQ A;  4DF8 A;  2HHQ A;  7ICN A;  1HUZ A;  3ISD A;  5J2H A;  2BPF A;  3PW2 A;  3G6X A;  4J9K A;  4TUP A;  4I2D A;  3IM1 A;  4Z6F A;  4PHD A;  1K1Q A;  3GIK A;  5KFR A;  5KFH A;  5EWE A;  3Q8M A;  1LV5 A;  1ZQW A;  4QZA A;  2FPM A;  4BGD A;  5KG7 A;  5J2A A;  3OSP A;  2OWO A;  5KFW A;  4F4K A;  5J29 A;  3PW0 A;  5J2B A;  4RQ5 A;  2KZM A;  2R8K A;  2V4Q A;  4KLD A;  4UAZ A;  3T3F A;  3Q8P B;  4DL3 A;  2BR0 A;  2J6U A;  8ICY A;  2PFP A;  5KT2 A;  2AQ0 A;  4DL5 A;  4Z6D A;  1BPX A;  4XQ8 A;  4TQS A;  3RJF A;  2A1J B;  5KFD A;  4RQ0 A;  4I2H A;  1ZQJ A;  1DGS A;  1SL0 A;  4I2I A;  4RQ1 A;  2ISP A;  4KTQ A;  1QSY A;  8ICK A;  5KFM A;  3RJG A;  5CB1 A;  4DO9 A;  4I2F A;  9ICE A;  4QW9 A;  5KG6 A;  3MFH A;  1BPY A;  9ICS A;  1ZQC A;  3MAB A;  4DSL A;  9ICU A;  1KSP A;  1KFD A;  1ARO P;  3JPS A;  4KLH A;  3PO4 A;  4NLG A;  4UQG A;  2ZUC A;  4DL6 A;  4QZG A;  4PGX A;  3H8J A;  2W8L A;  1MQ3 A;  2JEJ A;  5EOZ A;  3THV A;  1Z00 A;  5KFJ A;  4P4M A;  1XC9 A;  1TK0 A;  3ISC A;  4TUR A;  7ICE A;  3PO5 A;  4R65 A;  2FPK A;  1NK9 A;  5HMM A;  5BPC A;  2ATL A;  2Q0Z X;  1HJP A;  5KFY A;  4M47 A;  4RT2 A;  3PY8 A;  2HVI A;  3QZ7 A;  4GC7 A;  4EBE A;  2P6U A;  3TFR A;  3T5L A;  4IR9 A;  5DQG A;  3E2E A;  7ICH A;  8ICZ A;  1RXW A;  1Z3E B;  1U45 A;  4P4P A;  2KN7 A;  4RQ8 A;  3PW5 A;  4PPX A;  3JPR A;  4F92 B;  1QSL A;  4RQ4 A;  4J9S A;  4QZF A;  4YR0 A;  4LVS A;  4B9M A;  4KLS A;  7ICV A;  4LZD A;  3HX0 A;  1MQ2 A;  3LDA A;  2NRW A;  9ICW A;  1L3T A;  3LWM A;  2HHV A;  5DDY A;  5KG0 A;  2FMP A;  5L1I A;  4CCH A;  5KG4 A;  5KT3 A;  3M8S A;  3PX6 A;  1ZQB A;  3V72 A;  1N48 A;  4JUZ A;  4RPY A;  3UXN A;  1ZET A;  5DB7 A;  4BWM A;  1ZQN A;  5KFB A;  8ICR A;  4YXM A;  3BQT A;  1KFT A;  5IIO A;  5IIJ A;  4I2E A;  4O5C A;  1ZQO A;  1ZJN A;  1XSL A;  3V7J A;  5IIL A;  1RZT A;  5IIM A;  8ICT A;  3UXP A;  5DGA A;  4ELV A;  4P4O A;  5DDM A;  4KN7 A;  2PXI A;  2H5X A;  2KZ3 A;  1JN3 A;  2DPI A;  2FLP A;  4R8U A;  2XC9 A;  4KLU A;  2IHM A;  2GWS A;  1JIH A;  2JZB B;  3H8S A;  2ZUD A;  4M9N A;  5J2E A;  4GXK A;  4F91 B;  5DGB A;  2PFO A;  2BHN A;  5D46 A;  1EXN A;  1XU4 A;  4GXI A;  9ICA A;  4PGY A;  3M9M B;  4F5R A;  4DS5 A;  5DQI A;  3TI0 A;  4UAY A;  3AUO A;  3MFI A;  1S0V A;  1U48 A;  5KFQ A;  3GII A;  1D9F A;  3B0X A;  4C8O A;  4F4Y A;  3H8W A;  1COO A;  8ICW A;  3H4B A;  1HUO A;  5J0S A;  8ICE A;  4QZI A;  2A1J A;  1PZN A;  5III A;  5J0X A;  4UB3 A;  1ZQA A;  4O0I A;  4YD1 A;  3TQ1 A;  2MUT B;  4Q45 A;  4F4W A;  4I28 A;  4YR2 A;  4PHA A;  4DOC A;  2J6T A;  4PH5 A;  4O3R A;  1JX4 A;  3C2L A;  4BDP A;  3JPP A;  8ICI A;  4DSJ A;  3TAR A;  4GC6 A;  3HPO A;  3HT3 A;  5DG7 A;  1TK8 A;  2XY6 A;  4F50 A;  2R8I A;  4YCX A;  4YVZ A;  4XRH A;  3JPQ A;  3RAX A;  5J2J A;  3KHG A;  9ICQ A;  4XUS A;  3T5H A;  7ICL A;  1UA1 A;  4I2J A;  4ECZ A;  4ECS A;  2AGQ A;  1T8E A;  2PI5 A;  5J0O A;  1BPB A;  4UB2 A;  3MR5 A;  3MGH A;  4ECU A;  1NK5 A;  4KLO A;  3ZDD A;  4NM1 A;  2R8G A;  3M8R A;  7ICK A;  5HHI A;  3GV8 B;  1XSN A;  4GLX A;  4C8M A;  3RAQ A;  8ICV A;  3PW7 A;  8ICJ A;  5KFF A;  2F1H A;  1UT5 A;  2DPJ A;  4PHE A;  2FMQ A;  8ICX A;  4HYK A;  2ZTE A;  1NKE A;  1SL1 A;  4F5N A;  4MFA A;  4F4X A;  5F9N A;  5KG3 A;  3PR4 A;  3K75 D;  4C8L A;  9ICN A;  3MR3 A;  3UPQ A;  5KG2 A;  5DBB A;  5JUM A;  4R63 A;  3RRH A;  1T7P A;  2FPL A;  4F2S A;  1S10 A;  4KLL A;  8ICG A;  4ECR A;  3SV4 A;  5CHG A;  1KEJ A;  4GXJ A;  4M0A A;  9ICK A;  3ISB A;  1S0M A;  4DQI A;  4EZ9 A;  1U49 A;  1ZQZ A;  4DL4 A;  3ZDA A;  1X2I A;  5DB8 A;  1TAU A;  5IIK A;  1U9L A;  4RQ2 A;  2W9M A;  3PW4 A;  4IRK A;  5EWG A;  4Q8F A;  7ICG A;  4ECY A;  4F5O A;  5DQH A;  4R66 A;  2XCA A;  4C8K A;  5HNK A;  3JPN A;  4FBU A;  1TFR A;  3AU6 A;  9ICP A;  1S77 D;  2M9N A;  7ICP A;  4MF2 A;  2BCV A;  4QZH A;  1IM4 A;  7ICJ A;  1JXE A;  4F2R A;  4UB4 A;  2B21 A;  2AQ4 A;  5DLF A;  1U4B A;  1NK6 A;  4JV0 A;  2I1Q A;  4UB5 A;  4DSK A;  2BPG A;  4ECQ A;  3QEB Z;  1CEZ A;  4KMU A;  1Y88 A;  4DQS A;  5CJ7 A;  1S0N A;  3G6Y A;  1ZQY A;  3AU2 A;  3EWA A;  4ED7 A;  2JEF A;  4RNN A;  3GIL A;  4NLZ A;  1XO1 A;  4DL7 A;  2HVH A;  5KFK A;  5BOL A;  2JZB A;  5KFX A;  4DSF A;  1MSW D;  4ED0 A;  3EYZ A;  1ZYQ A;  4MFC A;  1ZQH A;  4KLG A;  5KFG A;  4IQW A;  1KRP A;  4J9N A;  2BPC A;  3BJY A;  4J9M A;  4M04 A;  4NLK A;  4DQQ A;  2W9B B;  1L3U A;  2F1I A;  2BCQ A;  1NJZ A;  4ZH4 A;  3HWT A;  9ICL A;  2RDJ A;  1TK5 A;  5J0U A;  1ZQL A;  3PVX A;  4DSI A;  3Q8Q B;  4YMO A;  4IQU A;  3PX0 A;  2Y1I A;  2R8J A;  2NRX A;  3C5F A;  4M9L A;  3BDP A;  9ICH A;  9ICO A;  4KIT B;  5DB6 A;  3Q8S B;  3ZDC A;  4DQR A;  2MUT A;  2XGQ A;  4B9T A;  4KLQ A;  4KLT A;  4O9M A;  4DFJ A;  2P66 A;  4QWC A;  3K4G A;  5KFT A;  7ICU A;  5DG8 A;  3Q8R B;  2I9G A;  4KLF A;  3QEA Z;  7ICO A;  3MDC A;  3RB3 A;  1JXL A;  4KLI A;  3IHQ B;  1RXV A;  1X9M A;  1C7Y A;  3UXO A;  1RYR A;  2AJQ A;  1NK4 A;  3ZD9 A;  4ECV A;  3GIJ A;  4RPX A;  2FMS A;  1UT8 A;  3RH4 A;  3H4D A;  4TUS A;  4M2Y A;  3V6J A;  5CR0 A;  3C21 A;  4EZ6 A;  4BWJ A;  4JK1 A;  4F5P A;  4ED8 A;  5J2D A;  4NY8 A;  1SZP A;  3MDA A;  4R64 A;  3QZ8 A;  4FBT A;  4JWM A;  9ICG A;  5CP2 A;  3GIM A;  1A77 A;  1X9W A;  5CWR A;  5KFE A;  5DB9 A;  2BDP A;  4J9R A;  3EPG A;  8ICO A;  3BQ0 A;  1RYS A;  3RB4 A;  4I27 A;  5L1K A;  4QZ9 A;  5L9X A;  1MC8 A;  4O5K A;  4RUA A;  5J2G A;  1WCL A;  3LK9 A;  3ZDB A;  5KFU A;  4ED1 A;  2P6R A;  5IIN A;  1NK0 A;  1B22 A;  5EWF A;  5KT4 A;  2F1J A;  4DLG A;  1S9F A;  1X9S A;  8ICF A;  1IXR A;  4J9Q A;  1QLN A;  3OJU A;  4Q43 A;  4YP3 A;  4UBC A;  3OJS A;  1UA0 A;  3C2M A;  3RJE A;  4JWN A;  4QWB A;  1BPE A;  4NXZ A;  2C28 A;  1ZQM A;  4O5E A;  2DFL A;  3TAN A;  1N56 A;  1ZQS A;  8ICM A;  3OHA A;  3EZ5 A;  2LYH A;  3TFS A;  1KLN A;  2HHS A;  3FDS A;  3GFK B;  1L3S A;  4JV1 A;  4ECX A;  5J2I A;  2KZZ A;  9ICR A;  5HML A;  3RTV A;  3BQ1 A;  2UVV A;  4I2C A;  4RNO A;  4B9L A;  4MF8 A;  8ICA A;  5KT7 A;  1V9P A;  3KHH A;  4UB1 A;  1NJW A;  3RH5 A;  4EYH B;  2KFN A;  5TZV A;  1ZQK A;  2PFN A;  8ICS A;  5CA7 A;  5KT5 A;  5KFN A;  2IHN A;  7ICF A;  1K1S A;  9ICX A;  4Q44 A;  1D9D A;  5KFV A;  3EPI A;  5KFI A;  1L5U A;  4BXO B;  5KFA A;  4YQW A;  2W9B A;  4F4Z A;  8ICU A;  4DFP A;  8ICC A;  3ORY A;  9ICT A;  3Q8L A;  1TV9 A;  4KN4 A;  2IBK A;  4DFM A;  4DWI A;  4M9G A;  3ZD8 A;  9ICC A;  4DEZ A;  4RT3 A;  4DOB A;  3GV7 B;  1D8Y A;  3C2K A;  3BQ2 A;  2UVR A;  2KFZ A;  1ZQQ A;  3B0Y A;  1SKR A;  3KHL A;  3RR7 A;  2V4R A;  4F5Q A;  5DBC A;  3TAP A;  2ASD A;  2ASL A;  5KFS A;  4RU9 A;  4B9V A;  2W9C A;  1NJX A;  4ELT A;  2HW3 A;  2NRZ A;  3UQ0 A;  1TVA A;  8ICQ A;  1BGX T;  4MFF A;  1B43 A;  1TAQ A;  1RPL A;  2W8K A;  4O3N A;  3OSN A;  3RJH A;  8ICL A; 
#chains in the Genus database with same CATH topology
 1RQL A;  4UAS A;  3N97 B;  4J9P A;  2W43 A;  2CN1 A;  4Y2Y A;  1SXE A;  2QAR B;  5KFZ A;  3FYH A;  1Q3U A;  4I2A A;  3JPO A;  1S97 A;  2C2R A;  1LB2 B;  1SZH A;  1SXD A;  2PFQ A;  1J97 A;  3NGD A;  2JEI A;  5KTQ A;  3VCB A;  9ICB A;  5H2F U;  1JUD A;  2ZJ5 A;  2ASJ A;  3OHB A;  4EEY A;  5AKL A;  1X66 A;  3I76 A;  4FZL A;  3T5K A;  1SKW A;  3KTQ A;  4M9H A;  7ICI A;  3C5G A;  2K4H A;  2MRL A;  3KKA A;  2JEG A;  3RJK A;  1JMS A;  1RG6 A;  5J2C A;  3SI8 A;  2YB1 A;  4RZR A;  4FFD A;  3H8M A;  4C8N A;  3GV5 B;  4OJL A;  1ZQE A;  2J6S A;  3RJI A;  5L1J A;  2XCP A;  4DSE A;  2F8K A;  3H40 A;  2WAQ F;  2YX8 A;  5DLG A;  3JPT A;  5ALJ A;  5KFL A;  2HI0 A;  3NTU A;  4I2B A;  4Y2S A;  5AM5 A;  2C22 A;  2ZJ8 A;  1S5L U;  5HP4 A;  2H3F A;  3RF9 A;  1AQ6 A;  4U6P A;  2XI9 A;  1L7M A;  4JB3 A;  4ZOH C;  4ECT A;  3MBY A;  3ETL A;  5J0Q A;  3RB0 A;  4RUC A;  3TAQ A;  1RM6 C;  3GQC A;  1BPZ A;  3NUQ A;  1KTQ A;  2YY6 A;  4EYI B;  4ICA A;  2LM1 A;  1VDV A;  1B4F A;  1U47 A;  4QWE A;  4DLE A;  3ETR A;  8ICP A;  4ED3 A;  2FI1 A;  2YB4 A;  4Y2U A;  5KT6 A;  1LVH A;  5J0W A;  1Z00 B;  3OGU A;  3RH6 A;  4QZC A;  2O6K A;  4FO6 A;  4B6J A;  5JU5 A;  5AM4 A;  3SMV A;  1QTM A;  5AK4 A;  1ZJM A;  1SL2 A;  4OJ5 A;  4IRC A;  2K4I A;  3E0F A;  4TQR A;  1X9X A;  3N7P D;  4IQV A;  3CYM A;  2H3Z A;  2ZUB A;  4M6W A;  4B9N A;  2NRT A;  4MEY A;  1A76 A;  4PHP A;  2EH9 A;  2HHQ A;  2KTQ A;  4DF8 A;  1T94 A;  3IG8 A;  1HUZ A;  5AK5 A;  2K8A A;  5J2H A;  4J9K A;  4TUP A;  4NY8 A;  5KFR A;  4BGD A;  2OWO A;  4RQ5 A;  2KZM A;  2ODG A;  4UAZ A;  3D2N A;  3Q8P B;  4DL3 A;  2BR0 A;  5KT2 A;  2AQ0 A;  2LYB A;  3RJF A;  1ZQJ A;  2DF4 B;  3F53 A;  9ICS A;  2AH5 A;  3C28 A;  4DL6 A;  3H8J A;  1MQ3 A;  5KFJ A;  4P4M A;  1F5S A;  3ISC A;  2QB1 A;  7ICE A;  5HMM A;  2BZF A;  4M47 A;  2Q4T A;  3PY8 A;  1J2N A;  5ALX A;  2D8C A;  1OW5 A;  3T5L A;  1RXW A;  1Z3E B;  2CPR A;  2DQN B;  2JH7 A;  4PPX A;  3PSI A;  2EZY A;  3D2Q A;  4J9S A;  4QZF A;  5AI6 A;  4LZD A;  3QUC A;  2NRW A;  2KJ9 A;  3LWM A;  5DDY A;  1LKY B;  5ALS A;  2FMP A;  3PX6 A;  4RPY A;  1QQ6 A;  1N2X A;  5KFB A;  8ICR A;  3BS5 B;  3WU2 U;  1ZQO A;  4C7Z A;  1RZT A;  5IIM A;  5EE9 A;  4USA A;  4R8U A;  4KLU A;  2IHM A;  2W04 A;  5ALM A;  2JZB B;  1ZQ1 C;  4M9N A;  1C20 A;  1L7N A;  4F91 B;  2PFO A;  1XU4 A;  2WF8 A;  5ALZ A;  4PGY A;  4F5R A;  3D2S A;  4DS5 A;  1U48 A;  5KFQ A;  4UAU A;  3GII A;  3B0X A;  4C8O A;  4Y2V A;  2Y9T A;  2NO4 A;  2G0A A;  5ALL A;  1PZN A;  3IG5 A;  2A1A A;  4F4W A;  4I28 A;  4YR2 A;  2L5Y A;  2J6T A;  4PH5 A;  4O3R A;  3JPP A;  4DSJ A;  2XY6 A;  4C4S A;  4F50 A;  9ICQ A;  3KHG A;  4XUS A;  7ICL A;  4I2J A;  1URJ A;  4ECZ A;  5J0O A;  4UB2 A;  1NZP A;  5HR6 A;  1F0M A;  2F2A B;  5KFF A;  2NYV A;  2DPJ A;  2FMQ A;  3AN1 A;  1NKE A;  4MFA A;  3PR4 A;  1BNO A;  1ZOL A;  4F2S A;  8ICG A;  1S10 A;  4ECR A;  4GXJ A;  1KEJ A;  9ICK A;  3ISB A;  4EZ9 A;  3WKA A;  1ZQZ A;  1TAU A;  5IIK A;  4RQ2 A;  3PZP A;  5EWG A;  2HOI A;  5DQH A;  3JPN A;  1S77 D;  2M9N A;  2G06 A;  1JXE A;  3WK5 A;  5ALU A;  4DSK A;  2BPG A;  4ECQ A;  3N7R C;  3K1R B;  2W11 A;  5CJ7 A;  4AYB C;  2KOB A;  5JTI A;  5KFK A;  4NLB A;  4DSF A;  4KLG A;  4J9N A;  2BPC A;  3BJY A;  4J9M A;  4NLK A;  1L3U A;  5KNI A;  1NJZ A;  3HWT A;  2NO5 A;  4M9L A;  2NRX A;  2YML A;  3C5F A;  3F2B A;  4UB6 U;  2MUT A;  4KLQ A;  2RP5 A;  3QU7 A;  4DFJ A;  2P66 A;  2F44 A;  5KFT A;  3WKE A;  7ICU A;  2QB0 A;  2WB1 F;  1KN5 A;  4Y2Q A;  4ECV A;  3GIJ A;  2ZIW B;  1K5O A;  4OD0 A;  3V6J A;  2D3D A;  1XNS A;  4EZ6 A;  4BWJ A;  4RQM A;  4F5P A;  1QQ7 A;  1PUZ A;  2ZXI A;  3MDA A;  3QZ8 A;  9ICG A;  5CP2 A;  1X9W A;  5CWR A;  5KFE A;  1SWV A;  5GTI U;  1UHU A;  4QZ9 A;  4O5K A;  5J2G A;  1WCL A;  3LK9 A;  2P6R A;  5IIN A;  1CI4 A;  1KL9 A;  8ICF A;  1IXR A;  4EEK A;  2H3I A;  2PMZ C;  1QLN A;  1ED1 A;  3OJU A;  4YP3 A;  3RJE A;  4IL6 U;  2LI6 A;  1BPE A;  4NXZ A;  2DFL A;  2KV2 A;  1F44 A;  3ED5 A;  3OHA A;  2LYH A;  4GFJ A;  2E3T A;  5HML A;  3RTV A;  3PSF A;  4RNO A;  1YT3 A;  3KHH A;  1NJW A;  4BJQ A;  3RH5 A;  4EYH B;  1ZQK A;  2KKP A;  3SD7 A;  2PFN A;  5AKG A;  5AKH A;  5KT5 A;  2IHN A;  1K1S A;  1NZB A;  1QH9 A;  4Q44 A;  5KFV A;  2Y9U A;  5KAF U;  4DFP A;  5AI4 A;  3Q8L A;  2B0C A;  3A0H U;  3BZC A;  5AM3 A;  4DFM A;  4DWI A;  2JXJ A;  1D8Y A;  3C2K A;  1N5W A;  4CF4 A;  3BQ2 A;  3KFU F;  1ZQQ A;  2V4R A;  4F5Q A;  1V38 A;  3TAP A;  2ASL A;  2HW3 A;  4MFF A;  4O3N A;  1T3N A;  8ICL A;  9ICJ A;  3J81 j;  3V7L A;  4LZG A;  4UAW A;  2EAO A;  3RBE A;  3G6V A;  2BCU A;  2KEY A;  4ELU A;  4TUQ A;  5L1L A;  3AQE A;  4Y2R A;  4HAI A;  2JHD A;  2MAX A;  3L4P A;  4QZB A;  2BQ3 A;  3V6K A;  4IQT A;  2DBY A;  1ZQT A;  2OH2 A;  4RQ6 A;  1Q8K A;  4NLN A;  4O3M A;  3FM9 A;  1SKS A;  1XSP A;  1Z4N A;  3NRW A;  1BPD A;  1B0X A;  5JRT A;  2DKX A;  5ALF A;  4IR1 A;  2E8P A;  2ZTD A;  2YMM A;  5DKW A;  2C2E A;  4F93 B;  1KDH A;  4E0D A;  2Y0S F;  3M9N B;  2UVU A;  1NKC A;  4PZO A;  4BXO A;  4O3P A;  2ALZ A;  4KLE A;  3N4M B;  4BX9 C;  1XWL A;  4XA5 A;  2HBM A;  5KL1 B;  2EAP A;  4MEX A;  1ZQU A;  2KD1 A;  1NK7 A;  2PI4 A;  2IA6 A;  3RJJ A;  2W54 A;  2HHT A;  1BVS A;  5AM2 A;  1BNP A;  4O3O A;  4F3O A;  1RQN A;  3LVW A;  5J0R A;  4FS2 A;  2KP7 A;  4YMN A;  5KFP A;  1FFV A;  4ED6 A;  1FFU A;  1S76 D;  2MA1 A;  3PMN A;  3SZ2 A;  2WTF A;  4IRD A;  4J9O A;  5ALR A;  3C1Y A;  2ZIV B;  5KFO A;  5HHH A;  2RDI A;  3EUB 2;  1L3V A;  1X40 A;  3TAD C;  1XS9 D;  2XO7 A;  2KIC A;  3EW9 A;  1QSS A;  5J2K A;  9ICM A;  4CRX A;  4QW8 A;  2WFA A;  1QQ5 A;  3KZX A;  4DOA A;  3LWL A;  3V7K A;  4Q8E A;  4EBD A;  4GIB A;  3ALR A;  4EBC A;  3V6H A;  5AKZ A;  4B9U A;  4YG2 A;  1DOQ A;  7ICM A;  2ZIU A;  3M9O B;  1ZQX A;  2FJ6 A;  4CF5 A;  5AI8 A;  3ISD A;  2BPF A;  3PW2 A;  5ALE A;  4I2D A;  4I27 A;  7ICT A;  3Q8M A;  5KFH A;  5EWE A;  4P0P B;  1T3Q A;  3PW0 A;  2AHO B;  5J2B A;  1DXS A;  2PFP A;  1ZD2 P;  2A1J B;  5KFD A;  8ICK A;  3RJG A;  2EAM A;  2HDO A;  3MFH A;  1KSP A;  1ARO P;  3JPS A;  4KLH A;  3PO4 A;  4UQG A;  2ZUC A;  3WK6 A;  4NV0 A;  4OJO A;  4PGX A;  2JEJ A;  3AMZ A;  1TK0 A;  4PJ0 U;  3KZI U;  1JRO A;  1ZRN A;  2I5H A;  4R65 A;  2FPK A;  3SEI A;  1ZD5 A;  2Q0Z X;  1HJP A;  3FC4 A;  5KFY A;  2GO7 A;  2HVI A;  3UMC A;  3M1Y A;  3I28 A;  4P4P A;  2K4P A;  4US9 A;  3JPR A;  4RQ4 A;  4YR0 A;  4LVS A;  4B9M A;  1MQ2 A;  9ICW A;  2F76 X;  1PK1 B;  4IC9 A;  5AKJ A;  5L1I A;  4CCH A;  5KG4 A;  5KT3 A;  3M8S A;  1ZQB A;  2OYY A;  3V72 A;  5DB7 A;  4BWM A;  1A0P A;  5IIJ A;  3F2D A;  1XSL A;  2IOF A;  3UXP A;  4P4O A;  2DPI A;  2KZ3 A;  1JN3 A;  4FE3 A;  3AEV A;  5HR7 A;  2OXO A;  5AKI A;  4QJF B;  5J2E A;  2ZXH A;  3MFI A;  1L7O A;  3H8W A;  1VJ5 A;  4DFD A;  2WF7 A;  5J0X A;  1L7P A;  4O0I A;  4Q45 A;  4DOC A;  4FZN A;  4GC6 A;  2R8I A;  4YCX A;  3IDW A;  5J2J A;  3LYS A;  5GTH U;  2I6X A;  2GOL A;  4P0Q B;  5FP0 A;  8ICJ A;  8ICX A;  2F1H A;  2F8L A;  4PHE A;  4F5N A;  5F9N A;  2K60 A;  3K75 D;  4C8L A;  9ICN A;  5KG2 A;  3N7S C;  2G09 A;  1U49 A;  2Z7J A;  1X2I A;  5DB8 A;  1FEZ A;  5B66 U;  3PW4 A;  4F72 A;  4ECY A;  4F5O A;  4R66 A;  5AK3 A;  4FBU A;  1SB3 C;  3AU6 A;  4MF2 A;  2YN4 A;  4QZH A;  4F2R A;  2B21 A;  3R9K A;  2W7P A;  2XVT A;  1NK6 A;  4JV0 A;  2I1Q A;  3D6J A;  2KHV A;  2HOQ A;  2DL0 A;  3G6Y A;  5B5E U;  4NL9 C;  2HVH A;  1XO1 A;  2R18 A;  5BOL A;  3QX7 A;  5KFX A;  5E79 U;  3EYZ A;  1ZYQ A;  1PVP A;  4MFC A;  1COK A;  5KFG A;  4NLC A;  2LYA A;  2F1I A;  1A6S A;  9ICL A;  2RDJ A;  1ZQL A;  3IV6 A;  1P7D A;  4WJ3 B;  3PX0 A;  9ICH A;  3BDP A;  4KIT B;  3ZDC A;  1ZD3 A;  4QWC A;  3GZF A;  4NJ8 A;  3MDC A;  3RB3 A;  4KLI A;  1RXV A;  1X9M A;  2KSO A;  2B6G A;  1RYR A;  1NK4 A;  2FMS A;  1UT8 A;  3OPX A;  3RH4 A;  2IOH A;  1RDF A;  3HJE A;  4UAR A;  3GU3 A;  3GIM A;  4J9R A;  3BQ0 A;  5L1K A;  1MC8 A;  3ZDB A;  1NK0 A;  2OEH A;  1S9F A;  1X9S A;  2OM6 A;  2W3R A;  4J9Q A;  2CRX A;  3OJS A;  2H3Q A;  3C2M A;  4QWB A;  4O5E A;  3EZ5 A;  1KLN A;  5AI0 A;  1L3S A;  4ECX A;  5J8Y C;  9ICR A;  3F5E A;  1GO3 F;  2UVV A;  3DV9 A;  3ONN A;  2K89 A;  5TIS U;  5TZV A;  4FZM A;  5CA7 A;  7ICF A;  5KFN A;  2QKQ A;  2EDU A;  3EPI A;  4YQW A;  2W9B A;  2JGA A;  9ICT A;  3ORY A;  1TV9 A;  3SAF A;  2IBK A;  3SR6 A;  3ZD8 A;  1ECW A;  4DOB A;  3QU4 A;  1UCV A;  2VIX A;  2YTU A;  3NVV A;  4ACO A;  2VKQ A;  3SQI A;  4MHV A;  5EE3 A;  4KX3 A;  2KIW A;  5AK6 A;  2ASD A;  1SV4 A;  3IP4 B;  4ELT A;  2NRZ A;  1B43 A;  3OSN A;  9ICF A;  2XGP A;  2AU0 A;  1KFS A;  3HKZ C;  4QWD A;  1ZQV A;  4PL2 A;  4NM2 A;  7ICQ A;  5DBA A;  1OUQ A;  2FLN A;  2HHX A;  2HHW A;  4F71 A;  3F2C A;  3MGI A;  2RHF A;  4UW9 A;  5DG9 A;  3PNC A;  5KG5 A;  2DGZ A;  4DFK A;  5AHX A;  3PML A;  2BQR A;  7ICK A;  4YR3 A;  2VAN A;  1ZQD A;  3HP6 A;  3DEE A;  1X42 A;  4ECW A;  2R8H A;  7ICS A;  4DS4 A;  4M6W B;  2WF9 A;  2BGW A;  3ICX A;  4PL1 A;  3GDX A;  8ICN A;  2W9C B;  3WKD A;  1N61 A;  3UMB A;  5J0T A;  2BDU A;  2ZIV A;  3MR6 A;  4K4I A;  2W9A A;  2RLT A;  1T4G A;  1WCN A;  2BQU A;  4M9J A;  2PMZ F;  2P35 A;  1ZQP A;  5ALH A;  9ICV A;  4O3S A;  1ZQI A;  2WF6 A;  4UAT A;  4JV2 A;  3KD3 A;  4YXJ A;  4RNM A;  3SYZ A;  5J0P A;  2ES6 A;  2QLT A;  2ZIX A;  3PX4 A;  2V9W A;  2XY7 A;  3RB6 A;  2UVW A;  2AGP A;  5AKX A;  4QZD A;  4Z6E A;  2QAR A;  4G3I A;  3HW8 A;  4YFK A;  5KG1 A;  4KLJ A;  2KNJ A;  4Z6C A;  1Z1V A;  1NKB A;  2IMW P;  2Y1J A;  2HHU A;  1HIW A;  3S6J A;  2VA2 A;  1IV8 A;  1S8O A;  5CEH A;  1D8L A;  4QZ8 A;  4F8R A;  2ZJA A;  1O08 A;  4PGQ A;  2NRV A;  2E1F A;  4QZE A;  5KFC A;  8ICH A;  3M6Z A;  3DDH A;  2E8M A;  3IRU A;  4X5V A;  3PV8 A;  4YD2 A;  1NOM A;  4J9L A;  2E8N A;  3PR5 B;  1L6N A;  5ALK A;  4RQ7 A;  4BUG A;  3ZDE A;  4R8U B;  7ICN A;  3QU2 A;  2PKE A;  3KBB A;  3G6X A;  5KL8 B;  3GIK A;  4B9S A;  1ZQW A;  5J2A A;  3OSP A;  4C4R A;  2R8K A;  8ICY A;  4KLD A;  3T3F A;  2J6U A;  4DL5 A;  4Z6D A;  4XQ8 A;  4TQS A;  1DGS A;  3PST A;  1J2M A;  2NV3 A;  4RQ1 A;  2ISP A;  4KTQ A;  1VLB A;  5CB1 A;  4DO9 A;  4I2F A;  9ICE A;  4QNL A;  3H0R B;  1ZQC A;  4NLG A;  4KX5 A;  4J03 A;  2KE7 A;  4QZG A;  5EOZ A;  1Z00 A;  3CW2 C;  1D8B A;  4U7C A;  4TUR A;  3NVW A;  2HBL A;  2F77 X;  1NK9 A;  5BPC A;  2ATL A;  3QZ7 A;  3TFR A;  5AM0 A;  4IR9 A;  5DQG A;  3E2E A;  8ICZ A;  5G5H A;  2KN7 A;  3NVY A;  1IIP A;  1NNL A;  2W03 A;  7ICV A;  3NAS A;  3LDA A;  1OXJ A;  1WUD A;  1L3T A;  1KBU A;  2HHV A;  3T79 A;  4JUZ A;  1JI7 A;  1ZET A;  5ALN A;  4YXM A;  1KFT A;  4O5C A;  1JRP A;  3V7J A;  5IIL A;  4AP9 A;  5DGA A;  5DDM A;  2FLP A;  3QUQ A;  1DRG A;  2E1E A;  3H8S A;  1HEK A;  2ZUD A;  1MA7 A;  5ALT A;  5DGB A;  5D46 A;  4GXI A;  1EXN A;  3QXG A;  3M9M B;  5DQI A;  3TI0 A;  4UAY A;  3AUO A;  1S0V A;  2KKV A;  3H4B A;  8ICE A;  2KJ8 A;  5III A;  1ZQA A;  1WWV A;  4YD1 A;  2MUT B;  1YZ7 A;  2VJ5 A;  2QB0 B;  1JX4 A;  3C2L A;  2IOF K;  4QIW C;  3HT3 A;  5DG7 A;  1TK8 A;  3SAG A;  3H0L B;  2KVC A;  3JPQ A;  2LHT A;  1T8E A;  4KLO A;  2OCE A;  3QNM A;  3MR5 A;  3IN5 A;  3ZDD A;  2R8G A;  3M8R A;  5ALY A;  4C8M A;  3PW7 A;  1UT5 A;  2ZTE A;  3C29 A;  1SL1 A;  3OTQ A;  4CE6 A;  5DBB A;  2DKZ A;  4R63 A;  4UAV A;  3RRH A;  1T7P A;  4KLL A;  2YMP A;  4M0A A;  1S0M A;  3E58 A;  3U26 A;  3ZDA A;  5L1M A;  3ZI4 A;  1UQV A;  1LKY A;  2W9M A;  3AM9 A;  4IRK A;  4EEN A;  4C8K A;  1KQQ A;  1TFR A;  3QU5 A;  1DGJ A;  2BCV A;  7ICJ A;  3BS5 A;  2AQ4 A;  2W55 A;  5G5G A;  3UMG A;  2WF5 A;  1CEZ A;  1Y88 A;  4DQS A;  1ZQY A;  5ALO A;  4RNN A;  3GIL A;  2JZB A;  4ED0 A;  3NVZ A;  1ZQH A;  1KRP A;  2K8C B;  4DQQ A;  5AM1 A;  1O03 A;  4ZH4 A;  2KHQ A;  3PVX A;  1IG6 A;  3Q8Q B;  2R8J A;  5KAI U;  5DB6 A;  3HRD D;  2XGQ A;  4KLT A;  3QYP A;  4O9M A;  3K4G A;  5DG8 A;  7ICO A;  3IHQ B;  1C7Y A;  3UXO A;  3VC8 A;  4NWI A;  3ZD9 A;  4A8E A;  3H4D A;  4TUS A;  3C21 A;  4JK1 A;  4ED8 A;  5J2D A;  1SZP A;  4R64 A;  1YZ6 A;  4FBT A;  2LM4 A;  1N63 A;  4JWM A;  2WAQ C;  1WG8 A;  1WWU A;  1A77 A;  2BDP A;  3EPG A;  8ICO A;  5T14 A;  3WK7 A;  4C0Z A;  5KFU A;  4ED1 A;  3RFA A;  3TAD A;  4UBC A;  3M6K A;  1M6Y A;  1ZQM A;  3TFS A;  4JV1 A;  1NI3 A;  2HBK A;  2A3V A;  5F3X B;  4I2C A;  4B9L A;  4MF8 A;  3CNH A;  8ICA A;  5KT7 A;  1V9P A;  2KFN A;  4OO1 J;  2EQY A;  9ICX A;  3QU9 A;  4C4T A;  4BXO B;  4F4Z A;  8ICU A;  8ICC A;  4Y2J A;  1DK2 A;  4KN4 A;  4M9G A;  5ALI A;  9ICC A;  4JMU A;  3GV7 B;  2KFZ A;  3B0Y A;  1SKR A;  3KHL A;  3KOO A;  5DBC A;  3NS1 A;  5KFS A;  2W9C A;  1NJX A;  1BGX T;  1SWW A;  1RPL A;  5DLF A;  2ZIW A;  4I29 A;  2BKE A;  2ISO A;  2ZTC A;  4YN4 A;  2XID A;  2VA8 A;  4P2H A;  1V97 A;  3CP8 A;  4DF4 A;  2BCR A;  3C1Z A;  1MN8 A;  3BZK A;  1SIJ A;  3C23 A;  2LMR A;  1ZQG A;  2HMX A;  4US8 A;  2XY5 A;  1S0O A;  3A0B U;  2FE9 A;  2C2D A;  1CUK A;  2A19 A;  5ALQ A;  4QWA A;  1DK3 A;  3O0F A;  2ZIU B;  2LPE A;  2XIC A;  5BOM A;  3F5A A;  5F9L A;  7ICR A;  3RRG A;  2ESE A;  4PZN A;  5D4B A;  3MC1 A;  3MR2 A;  3RBD A;  2G5H B;  1TKD A;  4UBB A;  4O3Q A;  9ICI A;  4CF3 A;  2DWQ A;  8ICB A;  2JRZ A;  3QE9 Y;  2HSZ A;  1H38 A;  3KHR A;  2EZX A;  1NK8 A;  2LKY A;  4DL2 A;  4C7Y A;  5D49 A;  5AIC A;  4IS7 A;  5C5J A;  3Q8K A;  1ZQR A;  5AIB A;  3M7D A;  2BCS A;  4I2G A;  1NJY A;  4C80 A;  3WKC A;  4RPZ A;  1FO4 A;  5K4L A;  3SV3 A;  1ZQF A;  4UB8 U;  2VA3 A;  3H7I A;  4K4G A;  3WK8 A;  4DQP A;  2HBJ A;  1CRX A;  2G5I B;  2EAN A;  5EE0 A;  3WK9 A;  4K4H A;  2D6F C;  2AGO A;  3RR8 A;  3QUT A;  4RQ3 A;  3QUB A;  2RRD A;  5C0Y A;  4YMM A;  3HKZ F;  2VJ4 A;  4OCZ A;  4CGZ A;  3T5J A;  2ZG6 A;  1N5X A;  1Z1B A;  1FIQ A;  5ALP A;  4ED2 A;  4AYB F;  4KLM A;  2FLL A;  4FS1 A;  5ALV A;  5J0Y A;  5J2F A;  3UQ2 A;  2CXY A;  3WK4 A;  5AI5 A;  5CRX A;  3IM1 A;  4Z6F A;  4PHD A;  1K1Q A;  1LV5 A;  4QZA A;  2FPM A;  5KG7 A;  5KFW A;  2KK0 A;  5J29 A;  4F4K A;  2V4Q A;  3L3F X;  3H0M B;  1BPX A;  4NL9 A;  4RQ0 A;  4I2H A;  1SL0 A;  4I2I A;  4Y2T A;  2JH1 A;  1QSY A;  5KFM A;  3TAC B;  4QW9 A;  5KG6 A;  2JR5 A;  1BPY A;  3MAB A;  4DSL A;  9ICU A;  1KFD A;  1JAL A;  2KVS A;  2W8L A;  3THV A;  1XC9 A;  1N60 A;  3PO5 A;  1TE2 A;  4RT2 A;  4EBE A;  4GC7 A;  2P6U A;  3SAH A;  7ICH A;  1U45 A;  4RQ8 A;  3PW5 A;  4F92 B;  1QSL A;  4KLS A;  3HX0 A;  3AL0 B;  5KG0 A;  4EX6 A;  2YMQ A;  4LJX A;  1N48 A;  3UXN A;  5ALD A;  4G9B A;  1L8L A;  1ZQN A;  3SEN A;  2E8O A;  5A0L A;  3BQT A;  5IIO A;  3BQ7 A;  4I2E A;  1Z4O A;  1ZJN A;  3HIL A;  2GLE A;  3MGV A;  8ICT A;  4ELV A;  4KN7 A;  2WB1 C;  2H5X A;  2PXI A;  2XC9 A;  5ALG A;  2GWS A;  1JIH A;  1QCK A;  5AI9 A;  1V85 A;  4GXK A;  2BHN A;  3L5K A;  9ICA A;  2YQE A;  4P0P A;  3PSP A;  5J8Y A;  1D9F A;  3CRX A;  4F4Y A;  1COO A;  8ICW A;  1HUO A;  1X6J A;  5J0S A;  4QZI A;  3UM9 A;  2A1J A;  4UB3 A;  1SV0 C;  2W3S A;  3TQ1 A;  4OJ6 A;  1PK3 A;  4PHA A;  1ZD4 A;  1XO0 A;  4BDP A;  8ICI A;  3TAR A;  3HPO A;  4DCC A;  2KSO B;  2JMG A;  2KJ5 A;  4YVZ A;  4XRH A;  3RAX A;  2FDR A;  3T5H A;  1UA1 A;  4ECS A;  2AGQ A;  2PI5 A;  1NK5 A;  1BPB A;  4CNQ A;  4ECU A;  3MGH A;  4NM1 A;  5AIA A;  5HHI A;  3GV8 B;  1XSN A;  3I1Y A;  4GLX A;  3RAQ A;  8ICV A;  3K1Z A;  2K8B B;  4HYK A;  4F4X A;  5KG3 A;  3MR3 A;  3UPQ A;  5JUM A;  5AKY A;  2FPL A;  3SV4 A;  5CHG A;  1ZXI A;  2W7O A;  4DQI A;  4DL4 A;  2MU2 A;  1U9L A;  3N28 A;  1SGG A;  1PK1 A;  1KW4 A;  4Q8F A;  7ICG A;  2GH1 A;  9ICP A;  2XCA A;  5HNK A;  4RQN A;  1RYU A;  7ICP A;  3WKB A;  2K4E A;  1KKX A;  1IM4 A;  4UB4 A;  1U4B A;  2LBO A;  4UB5 A;  3QEB Z;  4KMU A;  1UPH A;  3B9J A;  2N1R A;  1S0N A;  3EWA A;  3AU2 A;  4ED7 A;  2JEF A;  4NLZ A;  2F3N A;  4DL7 A;  1MSW D;  2OHF A;  4IQW A;  3KKA C;  5AKK A;  4M04 A;  2W9B B;  2BCQ A;  1X6I A;  2E5S A;  1TK5 A;  5J0U A;  5EE1 A;  4DSI A;  4YMO A;  4IQU A;  2Y1I A;  9ICO A;  3BS7 A;  3LVV A;  3Q8S B;  5AKE A;  4DQR A;  2H3V A;  4B9T A;  1Q3V A;  3Q8R B;  4KLF A;  2I9G A;  3QEA Z;  1JXL A;  2DUY A;  2AJQ A;  4RPX A;  4M2Y A;  2KIV A;  2KG5 A;  5CR0 A;  1ZRM A;  4P0Q A;  5DB9 A;  1RYS A;  4KMO B;  3RB4 A;  2RQ5 A;  2Y0S C;  5L9X A;  2WHE A;  4RUA A;  4QIW F;  5ALW A;  2KMD A;  1B22 A;  5EWF A;  5KT4 A;  2F1J A;  4DLG A;  2M0N A;  4Q43 A;  1UA0 A;  4JWN A;  1Z19 A;  2C28 A;  1Q46 A;  2G08 A;  3TAN A;  1N56 A;  1ZQS A;  8ICM A;  1SV0 A;  2HHS A;  3FDS A;  3GFK B;  1N62 A;  2KZZ A;  5J2I A;  3AQF A;  3NRZ A;  3BQ1 A;  2HOF A;  4EEL A;  4UB1 A;  2MSN A;  1WYG A;  4Y2X A;  1PVQ A;  8ICS A;  1D9D A;  3FAH A;  5KFI A;  4CDG A;  1L5U A;  5KFA A;  3TKA A;  1L8O A;  2EZZ A;  2AXT U;  4DEZ A;  4RT3 A;  2JV3 A;  2G07 A;  2UVR A;  4EX7 A;  4Y2P A;  1TAM A;  2HCF A;  3RR7 A;  4OJP A;  1PVR A;  4RU9 A;  4B9V A;  3UQ0 A;  1TVA A;  8ICQ A;  1TAQ A;  2W8K A;  3RJH A;  2ZIX B; 
#chains in the Genus database with same CATH homology
 9ICJ A;  9ICF A;  2XGP A;  3V7L A;  2AU0 A;  4LZG A;  1KFS A;  4UAW A;  4QWD A;  3RBE A;  4I29 A;  3N97 B;  4J9P A;  3G6V A;  1ZQV A;  4NM2 A;  2BKE A;  2BCU A;  7ICQ A;  5DBA A;  2ISO A;  4B9S A;  2FLN A;  4ELU A;  4TUQ A;  5KFZ A;  3FYH A;  5L1L A;  4I2A A;  2HHX A;  3JPO A;  1S97 A;  2HHW A;  2C2R A;  1LB2 B;  2PFQ A;  2ZTC A;  4YN4 A;  3NGD A;  3MGI A;  2VA8 A;  2JEI A;  5KTQ A;  4P2H A;  2MAX A;  5DG9 A;  9ICB A;  3PNC A;  4DF4 A;  2BCR A;  2ZJ5 A;  5KG5 A;  2ASJ A;  4QZB A;  3OHB A;  2BQ3 A;  4EEY A;  3C1Z A;  3V6K A;  4DFK A;  3T5K A;  3PML A;  2BQR A;  1SKW A;  4IQT A;  3C23 A;  3KTQ A;  3C5G A;  4YR3 A;  2JEG A;  2VAN A;  1ZQD A;  4M9H A;  7ICI A;  1ZQT A;  3RJK A;  1JMS A;  1ZQG A;  3HP6 A;  2XY5 A;  5J2C A;  3SI8 A;  4RZR A;  4C8N A;  4RQ6 A;  4ECW A;  1S0O A;  2R8H A;  3GV5 B;  7ICS A;  4DS4 A;  4M6W B;  1ZQE A;  4NLN A;  2C2D A;  2J6S A;  3RJI A;  1CUK A;  4QWA A;  5L1J A;  2BGW A;  3GDX A;  8ICN A;  2W9C B;  1SKS A;  2XCP A;  4DSE A;  1XSP A;  3H40 A;  7ICT A;  5DLG A;  3JPT A;  5KFL A;  3NTU A;  1BPD A;  5BOM A;  4I2B A;  5J0T A;  5F9L A;  4IR1 A;  2ZTD A;  7ICR A;  5DKW A;  2C2E A;  2C22 A;  3MR6 A;  3RRG A;  2ZJ8 A;  4K4I A;  2W9A A;  5HP4 A;  4F93 B;  1KDH A;  4E0D A;  1T4G A;  5D4B A;  1WCN A;  3M9N B;  2UVU A;  3MR2 A;  4ECT A;  3MBY A;  3ETL A;  5J0Q A;  3RB0 A;  2BQU A;  4RUC A;  1NKC A;  4M9J A;  1T3N A;  3RBD A;  3TAQ A;  4BXO A;  3GQC A;  1BPZ A;  4O3P A;  2ALZ A;  1TKD A;  4UBB A;  4KLE A;  3N4M B;  4O3Q A;  1XWL A;  4XA5 A;  9ICI A;  1ZQP A;  1KTQ A;  9ICV A;  4EYI B;  4O3S A;  8ICB A;  4MEX A;  1ZQI A;  1ZQU A;  3QE9 Y;  1H38 A;  1NK7 A;  2PI4 A;  4JV2 A;  2IA6 A;  3RJJ A;  3KHR A;  1U47 A;  4QWE A;  4DLE A;  2HHT A;  1BVS A;  1NK8 A;  4O3O A;  4YXJ A;  8ICP A;  4RNM A;  3SYZ A;  4ED3 A;  4DL2 A;  4F3O A;  5J0P A;  5J0R A;  4FS2 A;  5KT6 A;  5D49 A;  5KFP A;  4YMN A;  5C5J A;  3Q8K A;  1ZQR A;  5J0W A;  1Z00 B;  4ED6 A;  3OGU A;  3PX4 A;  2V9W A;  2XY7 A;  3RB6 A;  3RH6 A;  2UVW A;  2BCS A;  1S76 D;  2AGP A;  4I2G A;  3PMN A;  1NJY A;  4QZD A;  4Z6E A;  4QZC A;  3SZ2 A;  2WTF A;  4RPZ A;  4IRD A;  4J9O A;  4FO6 A;  4G3I A;  3HW8 A;  3C1Y A;  5KFO A;  4YFK A;  5HHH A;  5KG1 A;  2RDI A;  3SV3 A;  1L3V A;  1ZQF A;  4KLJ A;  1XS9 D;  2VA3 A;  3H7I A;  2XO7 A;  4K4G A;  4DQP A;  1QTM A;  4Z6C A;  3EW9 A;  1NKB A;  2IMW P;  1QSS A;  2Y1J A;  2HHU A;  1ZJM A;  5J2K A;  2VA2 A;  4K4H A;  1SL2 A;  9ICM A;  2AGO A;  1D8L A;  4QZ8 A;  3RR8 A;  4QW8 A;  4RQ3 A;  4IRC A;  4F8R A;  2ZJA A;  4PGQ A;  2NRV A;  4YMM A;  4TQR A;  4QZE A;  5KFC A;  8ICH A;  4DOA A;  3LWL A;  4IQV A;  3V7K A;  3T5J A;  4Q8E A;  2ZUB A;  4M6W A;  4EBD A;  4X5V A;  4B9N A;  3PV8 A;  4YD2 A;  4ED2 A;  2NRT A;  1NOM A;  4MEY A;  4J9L A;  4EBC A;  3V6H A;  1A76 A;  3PR5 B;  2FLL A;  4KLM A;  4B9U A;  4YG2 A;  1DOQ A;  7ICM A;  4FS1 A;  4PHP A;  3M9O B;  4RQ7 A;  1ZQX A;  3ZDE A;  4R8U B;  5J0Y A;  5J2F A;  3UQ2 A;  2KTQ A;  4DF8 A;  2HHQ A;  7ICN A;  1HUZ A;  3ISD A;  5J2H A;  2BPF A;  3PW2 A;  3G6X A;  4J9K A;  4TUP A;  4I2D A;  3IM1 A;  4Z6F A;  4PHD A;  1K1Q A;  3GIK A;  5KFR A;  5KFH A;  5EWE A;  3Q8M A;  1LV5 A;  1ZQW A;  4QZA A;  2FPM A;  4BGD A;  5KG7 A;  5J2A A;  3OSP A;  2OWO A;  5KFW A;  4F4K A;  5J29 A;  3PW0 A;  5J2B A;  4RQ5 A;  2KZM A;  2R8K A;  2V4Q A;  4KLD A;  4UAZ A;  3T3F A;  3Q8P B;  4DL3 A;  2BR0 A;  2J6U A;  8ICY A;  2PFP A;  5KT2 A;  2AQ0 A;  4DL5 A;  4Z6D A;  1BPX A;  4XQ8 A;  4TQS A;  3RJF A;  2A1J B;  5KFD A;  4RQ0 A;  4I2H A;  1ZQJ A;  1DGS A;  1SL0 A;  4I2I A;  4RQ1 A;  2ISP A;  4KTQ A;  1QSY A;  8ICK A;  5KFM A;  3RJG A;  5CB1 A;  4DO9 A;  4I2F A;  9ICE A;  4QW9 A;  5KG6 A;  3MFH A;  1BPY A;  9ICS A;  1ZQC A;  3MAB A;  4DSL A;  9ICU A;  1KSP A;  1KFD A;  1ARO P;  3JPS A;  4KLH A;  3PO4 A;  4NLG A;  4UQG A;  2ZUC A;  4DL6 A;  4QZG A;  4PGX A;  3H8J A;  2W8L A;  1MQ3 A;  2JEJ A;  5EOZ A;  3THV A;  1Z00 A;  5KFJ A;  4P4M A;  1XC9 A;  1TK0 A;  3ISC A;  4TUR A;  7ICE A;  3PO5 A;  4R65 A;  2FPK A;  1NK9 A;  5HMM A;  5BPC A;  2ATL A;  2Q0Z X;  1HJP A;  5KFY A;  4M47 A;  4RT2 A;  3PY8 A;  2HVI A;  3QZ7 A;  4GC7 A;  4EBE A;  2P6U A;  3TFR A;  3T5L A;  4IR9 A;  5DQG A;  3E2E A;  7ICH A;  8ICZ A;  1RXW A;  1Z3E B;  1U45 A;  4P4P A;  2KN7 A;  4RQ8 A;  3PW5 A;  4PPX A;  3JPR A;  4F92 B;  1QSL A;  4RQ4 A;  4J9S A;  4QZF A;  4YR0 A;  4LVS A;  4B9M A;  4KLS A;  7ICV A;  4LZD A;  3HX0 A;  1MQ2 A;  3LDA A;  2NRW A;  9ICW A;  1L3T A;  3LWM A;  2HHV A;  5DDY A;  5KG0 A;  2FMP A;  5L1I A;  4CCH A;  5KG4 A;  5KT3 A;  3M8S A;  3PX6 A;  1ZQB A;  3V72 A;  1N48 A;  4JUZ A;  4RPY A;  3UXN A;  1ZET A;  5DB7 A;  4BWM A;  1ZQN A;  5KFB A;  8ICR A;  4YXM A;  3BQT A;  1KFT A;  5IIO A;  5IIJ A;  4I2E A;  4O5C A;  1ZQO A;  1ZJN A;  1XSL A;  3V7J A;  5IIL A;  1RZT A;  5IIM A;  8ICT A;  3UXP A;  5DGA A;  4ELV A;  4P4O A;  5DDM A;  4KN7 A;  2PXI A;  2H5X A;  2KZ3 A;  1JN3 A;  2DPI A;  2FLP A;  4R8U A;  2XC9 A;  4KLU A;  2IHM A;  2GWS A;  1JIH A;  2JZB B;  3H8S A;  2ZUD A;  4M9N A;  5J2E A;  4GXK A;  4F91 B;  5DGB A;  2PFO A;  2BHN A;  5D46 A;  1EXN A;  1XU4 A;  4GXI A;  9ICA A;  4PGY A;  3M9M B;  4F5R A;  4DS5 A;  5DQI A;  3TI0 A;  4UAY A;  3AUO A;  3MFI A;  1S0V A;  1U48 A;  5KFQ A;  3GII A;  1D9F A;  3B0X A;  4C8O A;  4F4Y A;  3H8W A;  1COO A;  8ICW A;  3H4B A;  1HUO A;  5J0S A;  8ICE A;  4QZI A;  2A1J A;  1PZN A;  5III A;  5J0X A;  4UB3 A;  1ZQA A;  4O0I A;  4YD1 A;  3TQ1 A;  2MUT B;  4Q45 A;  4F4W A;  4I28 A;  4YR2 A;  4PHA A;  4DOC A;  2J6T A;  4PH5 A;  4O3R A;  1JX4 A;  3C2L A;  4BDP A;  3JPP A;  8ICI A;  4DSJ A;  3TAR A;  4GC6 A;  3HPO A;  3HT3 A;  5DG7 A;  1TK8 A;  2XY6 A;  4F50 A;  2R8I A;  4YCX A;  4YVZ A;  4XRH A;  3JPQ A;  3RAX A;  5J2J A;  3KHG A;  9ICQ A;  4XUS A;  3T5H A;  7ICL A;  1UA1 A;  4I2J A;  4ECZ A;  4ECS A;  2AGQ A;  1T8E A;  2PI5 A;  5J0O A;  1BPB A;  4UB2 A;  3MR5 A;  3MGH A;  4ECU A;  1NK5 A;  4KLO A;  3ZDD A;  4NM1 A;  2R8G A;  3M8R A;  7ICK A;  5HHI A;  3GV8 B;  1XSN A;  4GLX A;  4C8M A;  3RAQ A;  8ICV A;  3PW7 A;  8ICJ A;  5KFF A;  2F1H A;  1UT5 A;  2DPJ A;  4PHE A;  2FMQ A;  8ICX A;  4HYK A;  2ZTE A;  1NKE A;  1SL1 A;  4F5N A;  4MFA A;  4F4X A;  5F9N A;  5KG3 A;  3PR4 A;  3K75 D;  4C8L A;  9ICN A;  3MR3 A;  3UPQ A;  5KG2 A;  5DBB A;  5JUM A;  4R63 A;  3RRH A;  1T7P A;  2FPL A;  4F2S A;  1S10 A;  4KLL A;  8ICG A;  4ECR A;  3SV4 A;  5CHG A;  1KEJ A;  4GXJ A;  4M0A A;  9ICK A;  3ISB A;  1S0M A;  4DQI A;  4EZ9 A;  1U49 A;  1ZQZ A;  4DL4 A;  3ZDA A;  1X2I A;  5DB8 A;  1TAU A;  5IIK A;  1U9L A;  4RQ2 A;  2W9M A;  3PW4 A;  4IRK A;  5EWG A;  4Q8F A;  7ICG A;  4ECY A;  4F5O A;  5DQH A;  4R66 A;  2XCA A;  4C8K A;  5HNK A;  3JPN A;  4FBU A;  1TFR A;  3AU6 A;  9ICP A;  1S77 D;  2M9N A;  7ICP A;  4MF2 A;  2BCV A;  4QZH A;  1IM4 A;  7ICJ A;  1JXE A;  4F2R A;  4UB4 A;  2B21 A;  2AQ4 A;  5DLF A;  1U4B A;  1NK6 A;  4JV0 A;  2I1Q A;  4UB5 A;  4DSK A;  2BPG A;  4ECQ A;  3QEB Z;  1CEZ A;  4KMU A;  1Y88 A;  4DQS A;  5CJ7 A;  1S0N A;  3G6Y A;  1ZQY A;  3AU2 A;  3EWA A;  4ED7 A;  2JEF A;  4RNN A;  3GIL A;  4NLZ A;  1XO1 A;  4DL7 A;  2HVH A;  5KFK A;  5BOL A;  2JZB A;  5KFX A;  4DSF A;  1MSW D;  4ED0 A;  3EYZ A;  1ZYQ A;  4MFC A;  1ZQH A;  4KLG A;  5KFG A;  4IQW A;  1KRP A;  4J9N A;  2BPC A;  3BJY A;  4J9M A;  4M04 A;  4NLK A;  4DQQ A;  2W9B B;  1L3U A;  2F1I A;  2BCQ A;  1NJZ A;  4ZH4 A;  3HWT A;  9ICL A;  2RDJ A;  1TK5 A;  5J0U A;  1ZQL A;  3PVX A;  4DSI A;  3Q8Q B;  4YMO A;  4IQU A;  3PX0 A;  2Y1I A;  2R8J A;  2NRX A;  3C5F A;  4M9L A;  3BDP A;  9ICH A;  9ICO A;  4KIT B;  5DB6 A;  3Q8S B;  3ZDC A;  4DQR A;  2MUT A;  2XGQ A;  4B9T A;  4KLQ A;  4KLT A;  4O9M A;  4DFJ A;  2P66 A;  4QWC A;  3K4G A;  5KFT A;  7ICU A;  5DG8 A;  3Q8R B;  2I9G A;  4KLF A;  3QEA Z;  7ICO A;  3MDC A;  3RB3 A;  1JXL A;  4KLI A;  3IHQ B;  1RXV A;  1X9M A;  1C7Y A;  3UXO A;  1RYR A;  2AJQ A;  1NK4 A;  3ZD9 A;  4ECV A;  3GIJ A;  4RPX A;  2FMS A;  1UT8 A;  3RH4 A;  3H4D A;  4TUS A;  4M2Y A;  3V6J A;  5CR0 A;  3C21 A;  4EZ6 A;  4BWJ A;  4JK1 A;  4F5P A;  4ED8 A;  5J2D A;  4NY8 A;  1SZP A;  3MDA A;  4R64 A;  3QZ8 A;  4FBT A;  4JWM A;  9ICG A;  5CP2 A;  3GIM A;  1A77 A;  1X9W A;  5CWR A;  5KFE A;  5DB9 A;  2BDP A;  4J9R A;  3EPG A;  8ICO A;  3BQ0 A;  1RYS A;  3RB4 A;  4I27 A;  5L1K A;  4QZ9 A;  5L9X A;  1MC8 A;  4O5K A;  4RUA A;  5J2G A;  1WCL A;  3LK9 A;  3ZDB A;  5KFU A;  4ED1 A;  2P6R A;  5IIN A;  1NK0 A;  1B22 A;  5EWF A;  5KT4 A;  2F1J A;  4DLG A;  1S9F A;  1X9S A;  8ICF A;  1IXR A;  4J9Q A;  1QLN A;  3OJU A;  4Q43 A;  4YP3 A;  4UBC A;  3OJS A;  1UA0 A;  3C2M A;  3RJE A;  4JWN A;  4QWB A;  1BPE A;  4NXZ A;  2C28 A;  1ZQM A;  4O5E A;  2DFL A;  3TAN A;  1N56 A;  1ZQS A;  8ICM A;  3OHA A;  3EZ5 A;  2LYH A;  3TFS A;  1KLN A;  2HHS A;  3FDS A;  3GFK B;  1L3S A;  4JV1 A;  4ECX A;  5J2I A;  2KZZ A;  9ICR A;  5HML A;  3RTV A;  3BQ1 A;  2UVV A;  4I2C A;  4RNO A;  4B9L A;  4MF8 A;  8ICA A;  5KT7 A;  1V9P A;  3KHH A;  4UB1 A;  1NJW A;  3RH5 A;  4EYH B;  2KFN A;  5TZV A;  1ZQK A;  2PFN A;  8ICS A;  5CA7 A;  5KT5 A;  5KFN A;  2IHN A;  7ICF A;  1K1S A;  9ICX A;  4Q44 A;  1D9D A;  5KFV A;  3EPI A;  5KFI A;  1L5U A;  4BXO B;  5KFA A;  4YQW A;  2W9B A;  4F4Z A;  8ICU A;  4DFP A;  8ICC A;  3ORY A;  9ICT A;  3Q8L A;  1TV9 A;  4KN4 A;  2IBK A;  4DFM A;  4DWI A;  4M9G A;  3ZD8 A;  9ICC A;  4DEZ A;  4RT3 A;  4DOB A;  3GV7 B;  1D8Y A;  3C2K A;  3BQ2 A;  2UVR A;  2KFZ A;  1ZQQ A;  3B0Y A;  1SKR A;  3KHL A;  3RR7 A;  2V4R A;  4F5Q A;  5DBC A;  3TAP A;  2ASD A;  2ASL A;  5KFS A;  4RU9 A;  4B9V A;  2W9C A;  1NJX A;  4ELT A;  2HW3 A;  2NRZ A;  3UQ0 A;  1TVA A;  8ICQ A;  1BGX T;  4MFF A;  1B43 A;  1TAQ A;  1RPL A;  2W8K A;  4O3N A;  3OSN A;  3RJH A;  8ICL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...