4C4TA

Structure of beta-phosphoglucomutase in complex with a phosphonate analogue of beta-glucose-1-phosphate and aluminium tetrafluoride
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
217
structure length
217
Chain Sequence
MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Alpha-Fluorophosphonates Reveal How a Phosphomutase Conserves Transition State Conformation Over Hexose Recognition in its Two-Step Reaction.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
molecule keywords BETA-PHOSPHOGLUCOMUTASE
total genus 76
structure length 217
sequence length 217
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2013-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 4c4tA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4c4tA01
1ZJJA 1PW5A 1WZCA 1YDFA 3IJ5A 3SKYA 1Q91A 4C4RA 2FPUA 1QYIA 4HGNA 5AVUA 1Z4NA 5AM0A 5AW9A 3NASA 2R8EA 2WF9A 2G1AA 3U19A 2WF8A 3WKEA 1U2SA 4CNQA 1N9KA 4G63A 3ET5A 4ZEXA 1U02A 1L8OA 2CN1A 1NRWA 5ALJA 1Z5GA 4BX2A 4BEWA 4UU1A 3E84A 2ZBGA 2RARA 3UMCA 2C9MA 3I76A 1SWWA 2ZXEA 3ZTYA 4CF5A 2YMPA 5AI0A 3QLEA 3UMGA 2YN4A 2YY6A 4OFZA 2GO7A 4UAVA 3WK8A 4Y2PA 3ED5A 3K1ZA 1J97A 5AVRA 1RC8A 4Y2XA 5AKIA 4F72A 1L7MA 2YMQA 4Y2VA 2PR7A 2HI0A 5A3RA 1RDFA 5AW3A 2OM6A 5AW0A 3D6JA 3RFUA 5AICA 3L8EA 4IFTA 1N8NA 5AW1A 4FYPA 3E8MA 4QJBA 4J03A 5AM4A 3UM9A 2YJ5A 4L57A 3AR2A 3MPOA 2GHTA 1Z5UA 4BNDA 1WR8A 2YMMA 2W4MA 4E88A 3KZXA 3OPXA 1RMTA 3R9KA 4OD0A 2I34A 4ZEVA 3AR9A 3PDWA 2HHLA 2WM8A 3M9LA 3BA6A 4PNHA 4JDPA 4RESA 3A1DA 2I54A 2G09A 2MSNA 2ODAA 3IB6A 3L8HA 2FPRA 5AVTA 2HEGA 3HLTA 5AKHA 5ALRA 3OCVA 4AS3A 2HO4A 1T5SA 1T5TA 5ALGA 4ZEWA 4RETA 5AW7A 1EK2A 1RKUA 3MN1A 1RMYA 3DNPA 3L0YA 3J7TA 5FP0A 3L8FA 3SLRA 3ZWKA 5ALOA 2PQ0A 3OCWA 3GYGA 5IT4A 1TJ4A 4C4TA 1L7PA 4UM5A 4BX3A 3B8EA 3WGUA 1Z4OA 3HYCA 1VFPA 2I7DA 1TE2A 3CZ4A 3N8GA 4CF4A 1FEZA 1KYTA 3WKAA 3ZWDA 2YJ6A 5ALXA 3E81A 2BY4A 1XPJA 4L6CA 4KX3A 3PGVA 2R8YA 1ZD3A 2FUCA 1TJ5A 1NNLA 2ZG6A 1RLOA 4KNWA 4OHFA 5AVZA 5AVWA 5IS2A 2RAVA 1K1EA 1Q92A 4Y2TA 1RLTA 3B9BA 4I9GA 4BNDB 4KNVA 4YH1A 4GIBA 3AR6A 3QGMA 5AESA 4AS2A 2P69A 2G0AA 2ZBFA 2W43A 5AW4A 1U2TA 1WVIA 4UW9A 1RKQA 2C8KA 2DQSA 2MU1A 1QQ5A 4NABA 3QXGA 3ESQA 1EK1A 2C4NA 2AGVA 1ZD5A 2O9JA 5IT0A 1ZRNA 3F9RA 3FGOA 3PCTA 3L1UA 3N07A 3ZTWA 1CQZA 5ALPA 2JAUA 3A1CA 3QUQA 2G80A 1SWVA 3L8GA 2FPXA 3KC2A 1YNSA 4UMDA 1T9ZA 2YJ4A 1U7OA 1LTQA 3WK4A 3QNMA 3WK5A 3BWVA 5AKLA 3W5DA 1SU4A 5AKKA 1Z4LA 3WK9A 3QUTA 2R8ZA 4HGQA 3EF1A 1JUDA 2WF5A 3QYPA 5ALHA 4KX5A 3IRUA 3FVVA 5AVYA 1YV9A 3KDPA 2WHEA 3SKXA 3AR3A 4EX6A 1YS9A 3KD3A 1L8LA 2IYEA 5AW2A 2HCFA 5AI5A 4J2TA 1J8DA 3L0CA 5AK3A 2RB5A 2X4DA 3W5AA 3QUCA 2PKEA 2G06A 2C8LA 5ALWA 5AKZA 4HGOA 5AW5A 2IOFK 2FEAA 4Y2SA 2EAUA 3QU4A 1Z4PX 4UM7A 2B8JA 1ZD2P 2EARA 1Z4MA 4YCLA 1ZRMA 5AM5A 1TJ3A 1U7PA 4YGYA 3QX7A 5AM3A 2FPSA 4C4SA 3L5KA 2CFSA 3OCUA 3ZVNA 3MC1A 5AKGA 3MMZA 1VJRA 2AUTA 3P96A 1F5SA 5A3QA 2BDEA 2B30A 4MUMA 5ALVA 2BDUA 3OCXA 3L7YA 3WKBA 4YIKA 2FDRA 4EEKA 3AR7A 3ZX4A 2P27A 1S2OA 3R09A 5ALIA 5AI4A 4BEVA 2I55A 2QYHA 2W11A 4DWOA 3W5CA 3ZX5A 2YFYA 3OCYA 2AH5A 5AM2A 3NANA 5AW8A 5ALUA 1ZOLA 2JAOA 2P9JA 1X42A 2I6XA 2ZBEA 5E0OA 1LVHA 5AIBA 2AMYA 1Z4KA 5JJBA 3M1YA 4I9FA 4B6JA 5AVSA 1L7NA 3QU9A 4QQFA 2B8EA 3EF0A 3SHQA 1Z4IA 2ZOSA 5ALMA 1YJ5A 4BBJA 3ZVMA 3AR8A 4CF3A 4NWIA 2VKQA 3KOOA 1NF2A 3OTQA 4DFDA 2B0CA 5AKXA 1RMQA 5ALLA 1Z88A 3I28A 4YCNA 4EENA 3SMVA 4HYTA 3ZU6A 4CE6A 3ZVLA 2JAWA 2WF7A 5ALSA 2IA5A 1VJ5A 1YMQA 3DDHA 2CFRA 2GMWA 2NYVA 2RBKA 4EELA 3DAOA 3NRJA 3W5BA 3WK6A 3ONNA 3RF6A 5ALZA 1ZS9A 5AIAA 2B82A 3ZUPA 5ALQA 4BYGA 2D2VA 1RKVA 1WPGA 4G9BA 4UMEA 3I1YA 4UU0A 4MWOA 2GFHA 3WKDA 2Q4RA 4XE5A 5AVXA 5AKYA 2NO5A 4DCCA 1RRCA 5ALYA 3PGLA 5AI8A 2JARA 5AVQA 1TA0A 3QUBA 2JGAA 3B9RA 2CFTA 2B1QA 2IOFA 4UMVA 3UMBA 1L6RA 1L7OA 1ZD4A 3AR5A 4FE3A 4Y2UA 4Y2YA 4O8CA 4HGRA 3FPSA 2OYCA 1XP5A 3FZQA 3OCZA 4Y2RA 5ALFA 2HX1A 5AKEA 3DV9A 1QQ7A 3ZI4A 5ALKA 2G08A 4YIHA 1Z4JA 2Q5EA 3U7EB 4OCZA 5AW6A 3QU7A 5T41A 3KBBA 4EZEA 4XQ0A 2WFAA 2WF6A 2MU2A 5AVVA 2HOQA 5ALTA 4BX0A 4FFDA 4Y2JA 2Q4TA 2YMLA 4AP9A 2EATA 5A3SA 4UASA 3FPBA 5AK4A 4L6AA 5ALDA 3QU5A 1IWOA 5ALEA 3U7GA 3U13A 4NV0A 2QLTA 1Y8AA 2YBDA 3ZW7A 4Y2QA 2FUEA 4XPZA 4F71A 5AK6A 3L1VA 3N1UA 3WGVA 1AQ6A 3R4CA 1QH9A 3ET4A 3ESRA 3QU2A 3SF0A 2IOHA 2OA0A 5AI9A 5AKJA 2GHQA 4DW8A 4XOUA 3EWIA 4H1WA 3S6JA 4EX7A 1Z4QA 3A1EA 3EPRA 3U7FB 3N28A 4HGPA 3WK7A 2G07A 2P11A 5ALNA 2OBBA 5AK5A 5AI6A 3NIWA 2HSZA 2ZBDA 3I6BA 3N5KA 2R8XA 2B1RA 3AR4A 4GXTA 1RPZA 2HF2A 1CR6A 3A3YA 3NALA 2FI1A 2C88A 2I33A 1RQNA 2HF7A 1RLMA 4UAUA 4IG4A 3CNHA 4UMFA 1RQLA 4YCMA 1S8OA 4UARA 1QQ6A 4NFLA 1O03A 3U26A 1O08A 4KN8A 3NAMA 4BKMA 5AM1A 3E58A 3SD7A 4KYTA 5AHXA 3TLMA 3U7HB 4HAIA 4JB3A 3VAYA 3FM9A 3L0BA 4Y3UA 3NUQA 2NO4A 2HDOA 2FPWA 4NAVA 2O2XA 3WKCA 2YJ3A 4UATA 1XVIA 1MH9A
chains in the Genus database with same CATH superfamily
3IJPA 4ZXFA 5I48A 3H40A 4A8HA 2QXTA 5CP2A 2H5EA 3EXIB 3EZNA 3IJ5A 3NAZA 1VOTA 4ER0A 1Z83A 2Y1IA 2FPUA 3AEZA 1V37A 1RI3A 4FFOA 3OPVA 4PG7A 1KVSA 4Z9YA 4CMEA 3PQDA 2IYAA 5JNVA 4P36A 4X1IB 5B2ZA 4E5VA 4FZ5A 2BMVA 5EVJA 4JJGA 1V8OA 3S5UA 4DYDA 1WX1A 3D2BA 3D4IA 3NH9A 2VRNA 4KOEC 5BMOA 1UFQA 2RGEA 3GMSA 3QYJA 4L50A 1Z5VA 2JVIA 3PFCA 4RKYA 1UDRA 3DVRX 2F3UA 3ET5A 2BGRA 3RUIA 1DK3A 4Q3KA 1MB0A 2DPYA 3MGKA 1R64A 1ML4A 1F4LA 1IXKA 1KU6A 1UDAA 1YQWA 2O5RA 2XMZA 3I5MA 3QELB 2JV3A 2ID7A 2Y77A 2JAQA 1OILA 3PDHA 4FUQA 4MRSA 2WUVA 1ONNA 3FHLA 4LOIA 1GTG1 2I4MA 3T52A 4LJ6A 4B17A 3CSDA 3ZGZA 1LSSA 1ZJ6A 5D84A 4IHJF 4CF5A 3GT4A 4Q4HB 3TS1A 5KT6A 4BMNA 4C7KA 5JZ9A 2XLBA 4ZCSA 1QZXA 2GEBA 4TUQA 2P78A 3IKVA 1H65A 3LOUA 4HD8A 1NVVR 2Z2YA 4ECXA 1OLXA 1Z15A 1QU3A 1O5TA 3KKOA 3SZ3A 2QJOA 3PX4A 3KQWA 5JMWA 1Y3FE 3ED5A 1QDLB 2Y2VA 2D6FC 4MCJA 3KQPA 5EZ5A 2QN6A 2R7LA 1L5UA 1PJLA 3LP5A 4D80A 5LLSA 4A0FA 1ZL0A 3HM2A 1B6SA 3C45A 2EKBA 5AUPB 3GG9A 4N82A 2D2IA 4E22A 2CMDA 5HYVA 2GEKA 1VCIA 1V9LA 1Y9AA 3OFVA 3TLYA 2ZAIA 4YR2A 1XV5A 4PRKA 3H2GA 2O5VA 3E8MA 3UMFA 1ITZA 4M60A 3OJCA 2CMKA 1UKVY 1AQYA 3JRNA 3NKLA 2YJ5A 4W5JA 2PMFA 1IZ0A 2D0DA 2VDKB 2XVZA 1C7ZA 3PT9A 4I2NA 5DNWA 4BP3A 1RW4A 4ALJA 4XA5A 4D44A 2QL9A 3LBAA 2YMMA 2E48A 4BVJA 2XCOA 4GX2A 3TNLA 2PLNA 5MN5A 2R1TA 1P91A 3ZS8A 1N8KA 2BV3A 3EMVA 3NJ4A 5LJIA 3R7WA 4EZ9A 2NYRA 1PSDA 1UT8A 1W0JD 2NPOA 3AR9A 3WAJA 2GA8A 4XKJA 1KK1A 3TRIA 1ISHA 2GCNA 3T3HA 4IL6U 4K03A 3W1EA 1QRTA 3TQ1A 1W36D 5FPYA 4CL2A 4WEQA 1AV6A 3DB2A 5KT4A 1EX6A 5FWXB 2CJWB 1F5NA 3IVCA 1VRVA 4GW3A 4WY5A 3RH5A 1PR0A 1GKYA 4BTLA 1QP0A 1QBKC 4BO2A 1CUGA 3OA0A 3IT1A 4I2HA 5K3BA 5EJFA 2AC2A 2O1WA 1ES9A 2VYCA 4G1BA 3IOEA 2H54A 2OHXA 3PUHA 4I1PA 2HRCA 1WD5A 3ORFA 5AW7A 4MA5A 4ALLA 1GTJ1 2PH5A 4JJ6A 1Q74A 2RI6A 3IBYA 1X8LA 4BDPA 4MGHA 1CQIB 4TL8A 1E3LA 1FA9A 3DB1A 2BF4A 5JO9A 1TD9A 5JECA 4DDUA 5BSHA 2OO5A 5KNCA 4N1AA 2PZFA 4MRRA 1OX4B 4C4TA 1I80A 2QJTA 3HDGA 1IOZA 5DULA 2K4PA 4KO3S 4AQDA 1E7RA 3JD2A 1C7FA 3PWSA 3HYCA 1NJYA 5KAPA 1P9WA 3RS4A 4EW6A 1BAPA 4R8LA 4NLKA 1N9GB 2NOAA 4KP7A 3ZWNA 1C7RA 4J0IA 4P83A 4C0ZA 1FEZA 1KYTA 1SOVA 3K1AA 1SD1A 4BIIA 2PBLA 2UXCB 4MFCA 1M6EX 3KQYA 2Z8XA 4ZVQA 2XE4A 1G21A 3ZYCA 5FO0A 4Z2YA 4MH0R 4EK9A 4MV8A 2B4KA 1SZCA 2F44A 1M73E 3ND7A 3BHJA 4R6WA 2BMDA 2G17A 4JY7A 2ZIXA 5AOCA 3JD4A 5JD3A 4D8TA 2G25A 4F9FA 5HMLA 4WVLA 4LF6B 2FZ4A 5KC9A 8ICCA 1BDBA 4PZZA 2JJ1D 1N5MA 4OYYA 3BZWA 3JASA 1R0WA 1XTZA 3KJHA 4QO8A 1ZMRA 3B9BA 1HKHA 5F64A 4BNDB 3N59A 1LNSA 3D3QA 5TQJA 3IQDB 5JRDS 3JV7A 2QMHA 2YX1A 4KQXA 4OHVA 1DX4A 4BBAA 2CL6X 3X2EA 1R4MA 4DIUA 1E3DA 1WVIA 4E0DA 4A27A 2HTFA 4H9GA 2PU7A 1JLKA 4MUNA 4M89A 3RK4A 4DWJA 1X9SA 4RGYA 4NNOA 4ZA2A 3DXFA 3UMSA 1LZKA 4U8GA 4NE2A 2C4NA 5FQNA 5HS4A 2Q9CA 2J3HA 1T9GS 1SUSA 2KG5A 1SBZA 5BN4B 2BPFA 5E6SA 1QRRA 2B34A 3DEJA 3OICA 3VR3A 2IGBA 2C3MA 1XTIA 2KSOB 1MNAA 2OMEA 2VXOA 2ZIGA 3HVHA 3MCZA 3OZUA 4HJXA 4HS4A 3ZU5A 3LUAA 1W5EA 3PEFA 3SQWA 4CIVA 4X6XA 3LF1A 3DOEA 3BWMA 5ECGC 4KO1S 5BOLA 1MN6A 5L95A 1T9ZA 1XRNA 3ZLJA 1N3LA 2C97A 2Q46A 2HMVA 1ZAYA 1DNPA 4R8VA 1MABB 4V02A 4G1FA 1G55A 4KV7A 5A6SB 2FGKA 4JS0A 1WCLA 2JCYA 4FC7A 2EAOA 1C9JA 3QX9A 4KBGA 5TF0A 2PUWA 1NI3A 3X1MA 3GQCA 3KQOA 1D07A 1EAMA 1YKGA 3C7DB 4WNYA 1NXPA 5GJWC 2BKUA 1IEWA 3KL2A 5G53C 3MWEA 3JWGA 4EQ6A 1KWGA 2GF0A 3W6UA 3W2HA 3LRXA 1CJBA 4ACOA 5AI5A 1B42A 1BVSA 3V6JA 3CJRA 3WO0A 1O96B 2GLTA 3I1IA 1P45A 3L1JA 4Q48A 2WV9A 2Y1GA 4WJZA 4XH9B 2G06A 2C8LA 5TRTA 1PW7A 3B9QA 3WLIA 1TUBA 1H42A 2YOGA 3JWJA 1LDYA 3KJIA 4FMBB 2FEAA 1TK8A 4KQGA 4LI3X 4YTEA 3IEVA 1E4VA 1N2GA 3JD0A 1KJJA 1W96A 5DU2A 2XWPA 4UTZA 3KYDB 1T8TA 1YHYA 1PK1A 4GEGA 2JJ8A 4ALMA 3X43A 2ISSD 2HA3A 3G6VA 1BFDA 4LBYA 5TARA 2AC4A 3KIPA 1NMEA 1MEJA 2NO6A 1Z6AA 2PZGA 3IR6A 3VNAA 4YAJA 3GP8A 1XU9A 8ICUA 3PS9A 5A5GA 5KFYA 5J29A 5LDDC 4US2R 1WCIB 3HGTA 4V2IA 2EDCA 3K8OE 1Y5IA 2H0QA 1F2UA 5HQJA 2A3VA 4HH0A 4A6DA 3EXFA 2PUTA 4MRMB 2RDJA 5A6SA 1IC6A 1DQPA 4M0DA 1JIJA 4GXIA 1YIOA 3O4RA 4EEZA 4HXFB 2WB2A 1Y81A 3WBJA 1VYTA 3GGCA 5FA8A 5JI2E 4R31A 2R8PA 1IB0A 2EEPA 4ECYA 1LLCA 3H6GA 2J5RA 3R6TA 2O8FA 1FX0B 1E3WB 1PJQA 2DJIA 4N5NA 2FOXA 2JIZA 3FVTA 1C29B 2NRWA 1ZICA 4Q3NA 5EKSA 3O7MA 1GGJA 2QUJA 3AR7A 3NOVA 4X65B 5IAKA 1OZGA 2CBZA 2P27A 4EPXA 2HH9A 2WHYA 4KRGA 2XBLA 2JNWA 2BUCA 2Y0SC 2H1LA 2I2FA 3K9WA 4LQDA 3UGTA 5KMGB 1FFSA 3RS0A 1M2GA 5HUJA 4OHUA 2WFMA 3FCEA 5C46F 4HG2A 4B0OA 1PR5A 2VI5A 4P58A 4R8UB 3KT8A 1NM5C 5ANRB 5FJIA 1F0YA 4FS2A 1EUCA 2Q3FA 4IO1A 1Z3CA 5E7MA 2J9FB 1K5HA 1ARZA 1IRXA 2F3QA 2NUTA 1LVHA 3GN2A 2IEYA 5GM1A 5KT5A 1G8AA 1JVBA 4DQSA 1QG0A 4ZHQB 1S0VA 4ITVA 4MCAA 3MMSA 1ZY2A 1UANA 2V1UA 4LDAA 4B74A 1BROA 1DG3A 2AN1A 1QG2A 3ASVA 2H7VA 5IEBA 5CLQA 5KYWA 3T94A 4MQUA 1ZQXA 1QF9A 2J3MA 1E2EA 3P9RA 4EJ2A 1WCNA 4D9CA 2QD3A 5BSGA 5AMXA 4OAQA 3EMBA 3K20A 4YONB 4E08A 1Z5WA 4D6PA 3UQ0A 3E3AA 3QLTA 2BEKA 2PTHA 5CDSA 3PX6A 4OU5A 4IUDS 1JV2B 1CS4C 2QQ0A 5KFBA 1FUIA 1B4DA 1ZGBA 5KVVA 1FDSA 4R3NA 4BGDA 4JV1A 4A73A 2NMVA 1UXOA 2JGIA 3I92A 4ZCLA 2IFTA 2WF7A 2OB2A 3QJ5A 4CIWA 1YZGA 2YQEA 4K9MA 1ZVMA 3W3ZB 4C0WA 3IPAA 1OVMA 1E98A 4LRXA 1T6XA 3W8DA 1HYHA 1V7CA 1RRMA 3V32A 1NQWA 4BWVA 3WGOA 3I42A 3CMCO 4B2YA 3U49A 1DAHA 2EH9A 3QUSA 3JPNA 1T3NA 1HO3A 2RBKA 4GDMA 2J07A 3PHGA 2J3JA 4R8RA 2VSFA 1HSZA 4H1TA 4Q9LA 1HI9A 3S3TA 5KYUB 4O59O 1L9XA 2PSSA 2W5UA 3QG1A 4I6EA 3ZGYA 3ZD9A 1RKVA 1ZZGA 5ECWA 3HBAA 3WLKX 1INLA 4R2IA 4WCFC 3RBXA 5CK4A 3WYBA 5FYDA 3UFXB 1Z28A 1TVKB 1KPGA 4UMEA 4W9NA 2XA1A 2Y6VA 4JBYA 1O97D 4WZAA 4EVIA 5GONF 1QZ3A 1ZCBA 3DL4A 3RVPA 1VG9B 3IAXA 2IX9A 3NYIA 4Q82A 2RI1A 4PHAA 3MRXA 4WLOA 5KU7A 1RRCA 3LDUA 2NQ2C 3HA7A 3W8RA 4W5WA 3DMDA 3EZ7A 4DNXA 2R6GA 4Q7LA 4E5KA 1FFXA 2DBYA 5J4YA 3H4BA 9ICMA 7YASA 4KN7A 3HB5X 4I1VA 2DEUA 4UULA 2OCPA 4NENB 4D98A 2H3QA 3ILVA 3C29A 3A9CA 4M54A 2J3IA 4MWBA 4WJKB 4FE3A 1S9DA 2H1HA 4DHWA 3UPTA 1YRQA 4MIEA 3GEGA 2QT9A 4ZHQF 4KQCA 2YXPX 4EF5A 5HSGA 1C3VA 4HDNB 5IG2A 4Q45A 4OQZA 3R7WB 5DI3B 4KR6A 2BCGY 5E79U 1CUEA 2F1KA 3TF5A 1I14A 5K2MA 2CCKA 4CKYA 5CCXA 5IILA 1HT3A 1I2AA 2ZZKA 5C52B 2FR0A 2NT3A 5T4HA 1B15A 3DPIA 3ND5A 3KYCB 4XFJA 4E4YA 1XMQB 1ZUWA 3CPSA 4G84A 4P93A 5LBUA 4LZOA 4PSDA 4OXXA 1J5XA 5FLXA 2BFDB 3DXXA 3RDPA 4M6WB 4F2GA 4R0MA 3JRXA 1R8YA 1CR0A 4MKIA 2PUJA 4FILA 3GCZA 3BDPA 1IE3A 2WPDD 3DE5X 3UAXA 5G5GA 1Q2UA 5KTQA 1NQUA 2HF8A 2LGJA 1XRQA 3EVGA 1PK7A 2POQX 4ND8A 4MZXA 3TI9A 4QYXA 5HR7A 1N7IA 4DAEA 3D02A 1ZH4A 1W85B 1GUYA 2VHUA 4J43A 1V8PA 3K4GA 4CKWB 3LPLA 4NXZA 3K9NA 3ZDDA 8ICBA 3DZIA 1OWOA 1TJPB 1IHOA 3F4LA 4OHXA 3Q5EA 1H2FA 1W36B 4OA5A 5H9WA 1MEEA 1NWHA 2PZ8A 2W55A 2Q2WA 4OA8A 4LV5B 3WGTA 4GWLA 2W8BB 4D3YA 1OAOA 1Z2OX 2COEA 2NU6A 3F8SA 1UBRS 4U2FA 1RHMA 4RA6A 2RGYA 4QWCA 2FHPA 5TS2A 1RT9A 1FB5A 4YAOA 4UM9B 4TZ0A 4WCFB 1TM5E 4BNWA 4NK4A 2CYAA 1GGFA 4NXMB 1Q1ZA 2OCYC 3FWKA 4HMQA 4WAUA 5DBEX 3ZU3A 1ECCA 2IXGA 2ZYVX 3K0FB 1FNDA 3K15A 1GG5A 4O2BA 1HLGA 1NJWA 1C0LA 1J90A 1RP7A 2VCYA 1N1MA 1ISIA 2HHSA 2G3YA 2V5VA 4N12A 2A30A 5CVTA 1SBHA 1XK7A 3UANA 1K2WA 1ZW1A 1HETA 3T1QA 2IE8A 3CR3C 3QH4A 3I6YA 3UJ3X 3ZHBA 3N86A 4B7CA 5CB6A 3CVXA 4LJRA 1YJAA 2Q9AA 2WQ6A 1XX6A 4RV5A 4ZEMA 3T5CA 1VKHA 1YQ9A 3FMVA 4HAYA 1P3DA 3S6JA 1W5SA 3ESCA 4QYIA 2R1VA 1L5GB 1TMOA 1MX3A 3TVTA 3TRDA 1E5LA 2ZI7A 2HT6A 1TKRA 5ED4A 2JJ2A 3CNLA 4Y6RA 4RT3A 4Q9JA 9ICKA 1Q15A 1G2IA 2I7VA 3C5CA 5TPZA 1GKIA 3HB7A 1KW4A 3FCUB 4WK2B 3OECA 1VI2A 4DVJA 3RRJA 2VJMB 5DN6A 2Z7JA 4P4MA 1YQXA 3AX6A 3GBVA 3MB5A 4MR9A 4PHTA 5BPHA 4LHEA 2X0EA 2DGDA 2ZS7A 3EZLA 3IH5A 1XXLA 1E92A 4REQA 2HSZA 2HWUA 2Q2QA 4EI7A 2AOWA 1Y5NA 2O2JA 3NBQA 5A05A 2WB4A 4IIYA 1T15A 4L5BA 5FJJA 3EZYA 4JWKA 3UG7A 1XAJA 5LZ7A 4E5MA 2PRZA 1YO6A 1PJRA 3V00A 3SZMA 3RAQA 3C7CB 1XDUA 4DXHA 3WGGA 1CRXA 3RT7A 1VMDA 1Z6TA 4DV6B 1AUQA 3PPWA 4I8DA 3HILA 1G5IA 3FBWA 4FZLA 1LS1A 4GSYA 1S8OA 2B21A 4FGUA 3RYFB 2HJSA 3S1LA 2D54A 3HN6A 4ZCPA 5A4JA 1BO6A 1GTRA 1D2NA 1MG5A 2AJLI 4N3BA 2C4HA 3W2IA 4YUWA 1P33A 1PEDA 3UHFA 1X7DA 3HJHA 3RSSA 2BEWA 1DO8A 1GL6A 4YV7A 1PFVA 2ENWA 3B38A 1XQWA 3MUNA 1C30A 3DL2A 3OZIA 4MVJE 4C2UA 4MDEA 1LXCA 2VPZA 4J9OA 8ICHA 2V1XA 4PO8A 3D54D 3IO3A 2XLCA 1QTNA 4YYZA 1OB2A 1PWEA 3LQ2A 3OQIB 5TY0A 4F06A 3NUQA 16PKA 1RPJA 4MINA 5B5SA 5BW5A 1RZTA 3OX1A 4JT4A 4KI0A 5JE8A 3AEYA 4TT3D 3K6SB 4JLJA 3L7KA 5BUQA 3UJ6A 3ZHCA 5DDMA 1FVOA 3PFHA 4JLSA 3OJFA 1J42A 3SOPA 1J0XO 2ZVJA 3A9SA 2HHAA 4FZMA 1K3TA 1VYVA 2HSEA 3DVAA 1Y5MA 3DBRA 1M2NA 4HEHA 1F1JA 2XMDA 1BWPA 3H8VA 2B8WA 5LZ8A 3OQVA 4Y1RA 5HP4A 1T8PA 2WTMA 3S7TA 4CFYA 2I1VB 4TMXA 3USZA 3B6KA 3RIXA 2SNIE 1ULAA 2K4IA 2PSJA 1ZD1A 2YASA 5FOXA 1QH8A 3SNHA 4DG8A 3H1AA 3SHTA 1MAAA 2PO5A 4EFDA 3QFCA 4QJ5A 4AC9A 4M88A 5BW8A 5K4LA 3CCCA 5J4LA 3DR3A 3EXG2 3ZU4A 2HCRA 5CT9A 5DBBA 4JL5A 3U19A 3A05A 3SIXA 3QVTA 2GARA 1OBFO 3NTUA 1PZEA 3SSAA 2P4QA 4V03A 3GWZA 5ISMA 3TAQA 3MOIA 5AVKA 1OZAA 4OYHA 5HOQA 4UEJA 3EISA 2FPPB 1RCFA 3GB9A 5CBKA 2KBEA 1HE3A 2KD1A 1NAHA 1RXUA 5EHZA 4YJKA 3ES9A 1OXKB 3QLEA 3UMGA 4RIIA 5ECYA 2YY6A 4ND1A 3EIQA 1JHXA 4QGAA 1TYDE 2UUPA 1Y8QA 5DEIA 4DY6A 1E69A 4KXYA 4F2WA 1JDBB 2QZPA 4C5BA 1LVUA 5TT1A 1S01A 4US0R 4EQ6B 5DM60 4QASA 3MTEA 5FRDA 4DUYB 5C3MA 2NRXA 3QQ5A 4Y2VA 2B61A 3DVQX 2OD2A 4RBNA 5SZIA 4WRRA 3KXPA 3HUEA 4C4AA 2EKQA 1VHTA 1IY2A 3IDFA 2UV8A 3DPUA 4BU1A 1HX7A 1CG6A 4XGNA 2OEPA 5ENZA 3LT2A 3OPYB 4HS9A 3UYKA 1XSLA 3UM9A 1G2PA 3B7GA 3G7SA 3ZZUA 1EIWA 2HUPA 2I87A 2W7TA 1E9RA 1FXWF 1TUGA 4L85A 1E79A 1PDOA 4Q3BA 4DLTA 3EG9A 3ZZMA 2W4MA 8ICJA 1YRBA 3FCXA 4WEOA 3VYTB 4G0UA 1KH3A 3TMKA 1XCBA 1SQ5A 1A8QA 4Y6SA 4MEJA 3GNQA 2HLDA 1SHZA 2WP0A 1HDEA 4BS9A 2WU0A 4BMCA 1KOGA 1N6RA 1ZMBA 3B8HA 3CNOA 4UKDA 5SV2A 5TMEA 2VP3A 2DU8A 1X7YB 3BH7A 3TAHA 5LZ2A 4GP6A 3P2JA 4M0EA 3F9CA 5CNJA 3V2UA 2VZEA 3QTBA 4WLVA 1TB4A 2AQ4A 5CIWA 3W5IA 3RTEA 3ZWMA 1Q12A 1NXXA 2WQ7A 3IEMA 4HWOA 2OUKA 2CVHA 1ZM3A 3IVRA 1I2DA 4M0MA 1ZGJA 4PCAA 4YJ2B 4B33A 2GXSA 2AN4A 3FYUC 2Q5HA 5CVEA 4AS3A 4C0XA 4BIMA 4PZAA 4HNRA 4D02A 4KR7A 1RVV1 3I52A 3R41A 1VIMA 4YCXA 1U2PA 1H1DA 2JLBA 5DTRA 2IZ1A 1KZ4A 1KI9A 3E0FA 1VI5A 2C5HA 2ID4A 4C7OA 1ZGHA 3O38A 3BTUA 5FADA 1JR2A 3OC6A 4DQDA 4DQUA 4XPIB 5FBLB 4B9UA 3BRWD 2ZI9A 2R8IA 1VPDA 4N47A 5KO2A 1RTKA 2AD1A 2CKDA 1JU4A 4MW1A 1JXLA 4DUGD 2ZXHA 1H2RS 2F62A 4AN1A 4B7XA 5P21A 4DLBA 2IS1A 4IV8A 5DYTA 4B5KA 3T4PA 2D2FA 4WZ6A 3W4JA 1Z8HA 1QGOA 1YBVA 2XY4A 1G4HA 2POCA 5SZJA 5CB1A 3WADA 4DILA 4B31A 4C6SA 2OOKA 2QJFA 1PKXA 2XAAA 3H4IA 1BX3A 1JU3A 1Q7RA 2V7QD 3OY7A 3PUXA 3ZGXA 3SQDA 4UEOA 2Q3DA 4DL9A 1JEYB 4BNUA 2E2WA 2F9FA 3WNVA 3EA5A 1JBQA 2WU1A 4PSVA 3K70D 4P3OA 4WASA 5K3EA 3QHQA 4O5AA 4F4XA 2QRQA 2IYYA 2VVTA 2FUCA 4NLCA 1IAQA 4XI9A 2XUZA 3GMIA 3NRWA 4MW5A 4CZ2A 4N7RA 3HWTA 3GFGA 4U00A 1VFNA 2AXQA 2V7VA 2X2FA 3HA2A 3C8ZA 3TQOA 3ZGLA 3UWOA 2EFDB 2QV0A 3F3YA 4FWIB 1Y8RA 3A32A 1KNQA 3NT2A 2J0QA 2RC5A 5HM8A 2ZVDA 1KBZA 1BPBA 3LK9A 3HCPA 2H3IA 2GOYA 4KR9A 1NUUA 2V8OA 3IEIA 7ICIA 1IL0A 1CYDA 4INOA 4EB3A 4UE2A 1GPLA 2ZBVA 1U2RA 2D2XA 3G8AA 3KOMA 4ND5A 3KEOA 5JARA 2MMCA 5C8YB 1I4EB 1ZLYA 1ZRNA 2R9VA 1T4DA 4ED3A 2P2SA 4EG6A 5H2FU 2WTBA 4BVFA 1AQJA 3A7DA 5LCXA 5KKAA 4I2DA 2SBTA 1NZFA 3QUQA 3CUKA 4DJDC 1JEYA 3PNSA 1FW6A 3EAFA 3JQBC 5A7FA 1E6EA 1RADA 2YXNA 4JELA 2D06A 4RMJA 2IXFA 2OAQ1 4A2QA 1U7OA 4LTDA 4BN5A 3MIZA 5ENDA 4P4SA 1EWTA 4N8DA 2OO5C 2Z57A 3N2NA 3FPFA 2CWWA 3MLEA 4B3DA 4TKUA 1V43A 1XRJA 1FBNA 3ZE6A 4KE6A 5JLAA 4KWHA 2BAGA 4OHPA 1ZUNB 6YASA 4UU8A 3CT6A 1DBQA 1DOZA 2OGZA 3QX8A 3U31A 4HAOA 3SKXA 1EJ6A 3NVMB 4RS3A 4IFIA 1K6XA 2XQKA 1QFMA 4DR7B 2XOXA 3K9GA 5DW3A 1Z45A 2XVMA 1H6CA 3QPCA 2WWGA 2ZIVB 3WYFA 4HVCA 2AEEA 3E0XA 2CZQA 3GILA 2RB4A 3CUSA 3NV7A 4NLLA 4UEQA 1G59A 3PLAE 3WLFA 1X77A 4KMOA 4YV1A 1HDCA 2ZM5A 3B0XA 3RFXA 1C1XA 1XMXA 3WX0A 4YUYA 1AX9A 3U6BA 2CJFA 3FGZA 5AW5A 5CA1B 5K8CA 2A1JB 5I8ZA 1CVRA 3BZBA 4BWGA 1QO0D 2BR4A 1T10A 3IP1A 1Z4PX 2WTEA 3GLFA 3AB7A 4S1PA 1CUYA 4TV8B 5LLDA 1CIJA 1P77A 5INTA 3EPLA 4QGFA 1U28A 9ICWA 5LYJA 1QOQB 2LDXA 2WSBA 5JSKA 1FU4A 1QQBA 2HPHA 3KJNA 4RWEA 2ASLA 2HFJA 4YRMA 1DRKA 4HI0E 2TMDA 2VA9A 5EY5B 2V6FA 4L4ZA 5EPUA 3P8ZA 4C4SA 3EPJA 2O2GA 5EI5A 1Z63A 1P0IA 1SVOA 5CIQA 4AW9A 5JAUA 3FUTA 1KMMA 1UR5A 5LQCA 4BXOA 4P0PB 4OH1A 2W6PA 4MW7A 4PZEA 4MEAA 5CT6A 3VPDA 2CNOA 3RRNA 4AULA 4DG5A 4QXOA 4JVLA 5IHPA 5JVDA 3NNDA 4ZOLA 5LQKA 1CI4A 1ESEA 2QTVA 4FTWA 3UOWA 1JAHA 1R1DA 1NY6A 2Y93A 9ICOA 4EYQA 4GC5A 5J2CA 1VP3A 3I01A 2ZKIA 1JS1X 1GOTA 4H6XA 1ZETA 5FI3A 4B8ZA 1IFXA 3CRZA 4PC2A 3KXKA 5J2TF 3GLSA 3VU9A 4E3ZA 3W7VA 3FAHA 4E33A 2JFGA 2VF5X 2PKCA 1RP1A 1VZ3A 1KZ6A 4MV5A 3W2EA 5JEDA 5JD6A 2R48A 4YS6A 4MLZA 2BMAA 2XYVA 3IQGX 4CQMB 4KRFA 2YJTD 3MJTA 1ZOLA 1N6OA 4MWTA 4QUDA 1JGTA 1IIBA 4ML3A 3SJBA 3IUNA 3OP4A 3E1GA 3EDCA 1EM6A 5AIBA 4CKEA 1PNVA 2FMTA 1I51A 4MHOA 4EKNB 3KU1A 1ZKDA 3TJMA 3TW0A 3H05A 1A1VA 2VL7A 2GN1A 2UVQA 1DWUA 3FDSA 2ZRAA 4IGAA 2J9ZB 3D8NA 2WSSA 3PDUA 1BNPA 3PKJA 2GBGA 1SG9A 3KL4A 2ZJ5A 1E9CA 1O5OA 1RFGE 2RK6A 4R1UA 1V35A 4XTCS 1AO3A 1DQRA 1WE2A 2AG5A 3VOAA 2ZRFA 1S97A 5LB2A 2RH4A 1KEZA 2P4HX 4UTNA 3VNBA 1NF2A 4GR4A 4D96A 4J0HA 3OO1A 1PGOA 1WTCA 3VSAA 3MERA 2B0CA 1K9VF 1JIIA 2BI8A 2Q1WA 4I4TA 5CH8A 3D8SA 4XGQA 1V39A 3ITNA 4NM1A 3R3UA 4HV4A 4QD3A 5KTRA 2J7PA 2Q3LA 2OQRA 1XZIA 4PIPA 3AM9A 2Z6VA 2GKOA 1E9VA 3MLAA 3UJAA 3ZE7A 3LK6A 3VI4B 1JHUA 4IQTA 5TB5A 1Q3HA 4EHHA 5I9LA 5KX5B 3BQTA 1L4FA 1ZH6A 5BR8B 2ZIWB 1L3TA 1JDNA 1G7SA 1I1HA 2MT9A 3UMYA 4C1NA 4Q3AA 5AOAA 1DAKA 1QYCA 1YMQA 4I81A 5BWCA 2OT3B 4RJKA 1BDIA 3FYHA 1GPWB 4EUKA 1D2AA 4C8NA 1EP9A 1K9SA 3HXTA 3I5AA 3OQ6A 1XQYA 3AUFA 2D7JA 2EBUA 4JKOA 3BWEA 1Z7WA 1Z2CA 4WBNF 4L4XA 3WHPA 3SDZA 4POAA 4I55B 4OJPA 1WHSB 1AK1A 2FMKA 3H17A 4BYGA 2KVSA 3WWZA 2XD4A 3NWEA 3BMXA 3WOHA 1NK9A 5B1EA 4FYKA 2FUNB 1KFDA 1DZ3A 2FSVA 4FZRA 1U7UA 2JEIA 1DG9A 1NXTA 2PRYA 4U5QA 3ZK9A 3GHYA 4P4TA 4YMTA 2F3RA 4B9NA 2PKYX 3FDFA 4P0PA 4HMPA 4NHOA 2HO5A 3K71B 2L19A 2A0KA 1HNZB 3KYJB 3A10A 3QXSA 2CNKA 2DHRA 2I67A 3AKEA 3C3JA 3OM1A 2O7VA 3IXQA 3R76A 1F9EA 1Z00A 2NSYA 3IQWA 4U0KA 1K6MA 4UCQA 4OJ6A 4UZSA 5KX5A 4RPIA 3AJ8A 1SG6A 5GZ6A 2N1BA 3VVCA 3GDFA 2KMLA 3G0OA 4CFZA 1SCAA 3UB3A 2JA1A 3KZKA 3RF9A 5K9ZA 4NEHB 3H1FA 2WJGA 2W71A 1MQAA 4KRXA 3H16A 1WB6A 2C7BA 1WWUA 3IBFA 4PG5A 4RTMA 5HVNA 4ID3A 2VUHB 2O23A 5J43A 3RB0A 2IDZA 1OBOA 2W22A 2X4IA 2C54A 2YW9A 4QPJC 1Z26A 4RAOA 5K0JA 2H65A 4PLGA 1GRNA 3TGPA 4TMFA 1C2YA 3O4FA 4M0FA 4YRAA 4MR9B 4WXYB 1DCKA 4Q1DA 3QBEA 4GOLD 2E55A 3N2ZB 2YWCA 4BJ1A 5CGZA 8ICPA 2DCUA 2HA5A 4YP5A 5J2AA 1EI9A 1H6BA 3TQCA 2YC2C 3OGUA 3AHEA 5BVGA 1IU9A 4U6PA 2WICA 2DP4E 2XJ9A 3SC4A 4CCHA 3W5VA 5I45A 1N8SA 2MU2A 4P0QB 3A1TA 4FVTA 3DZHA 1KO8A 4NJMB 1NI5A 4L0CA 3WRWA 4FBMA 2X0KA 4YCJA 2CNBA 1IN7A 1UJ4A 4QYIB 4TTIA 5LKRA 1Y8CA 3EEBA 3MWDB 3OPYI 1LDMA 1DXHA 4KJZA 2FKAA 4V0RA 1NVVQ 1UZUA 2Z8ZA 5FPSA 3ZUGA 4JXXA 1F51E 1E2LA 3FPBA 3ZDZB 3ZXSA 3CMMA 1Z29A 3IHTA 4Y9RA 5FUMA 2B4RO 1IVSA 2R6HA 2P5YA 3LPAA 1PFQA 5EZYA 1E8DA 2JLUA 2J0UA 1R9GA 2B7BA 2WQZA 4PHHA 3HKEA 3GBPA 2AX4A 4K4HA 4O63O 2QYTA 1G8SA 1V2GA 5KFDA 2YBDA 2JXJA 3B51X 3MUFA 1EK6A 2FWIA 2VSOA 1W19A 3EVNA 3R1IA 4PXSA 2C7QA 4TX1A 5M3BA 2J7PD 1I2ZA 4F9TA 4F4DA 1J7KA 1YQGA 4L8VA 5EZYF 4UAWA 1JEOA 2QVXX 3KQMA 4LUCA 1EHYA 5D5PA 2HV9A 4ECVA 3E5MA 1AVTA 3PGXA 3V42A 1LVGA 1HIWA 1KHHA 2NSDA 4JJ4A 4RK7A 4TMWA 1BWSA 3A6GA 3MF4A 3IA2A 4OKNA 3CX3A 5I8WA 5AI9A 4B9AA 1E1QD 2BHRA 4YDRA 3FOCA 3AINA 1PZFA 2V5AA 5CWRA 1EE1A 1X8XA 1ZU5A 1WS6A 1B2RA 2O7RA 4UNQA 4G0VA 2BFBA 5J2EA 3M7DA 1J1IA 3OZAA 5L4SA 3OTIA 4TS1A 4CIBA 2P2YA 3E23A 3BXHA 4B6PA 1UPXA 3GLIB 2EWMA 4OXQA 3FMIA 2XMSA 1ECPA 2R2GA 4XJSA 4WBNA 4KLJA 4FHEA 1M1YB 1Z7EA 4N5LA 1I4LD 3L4SO 5CVDA 3V4FA 4HTFB 4O9MA 5ALNA 1SXEA 1TTQB 2X4LA 3O0TA 4R41A 3U4MA 2H3HA 1UZLA 3N5KA 1SU7A 1TRHA 3HN2A 2KNJA 5K3DA 3MFHA 3C7TA 4UTRA 4KO8A 2LYHA 3BHNA 4YRCA 4ZJYA 3NALA 1WYGA 1GPBA 2SKCA 4L15A 4KK4A 3RE1A 4EJSB 4D6YA 2M32A 4IG4A 1Z56C 1ZONA 4GXJA 1NR5A 3VNQA 1KH2A 1Y4SA 1MKYA 5HZKA 1OLUB 1B6GA 1BMTA 1TZKA 4X1KA 1KLNA 5E4TA 1DIHA 5EGNA 4JA0A 4BVAA 1X80B 2LWIA 4RLFA 3KTQA 1DXQA 4J4HA 5IBRA 4NE9A 5AM1A 3ZZNA 3KB8A 2BJWA 3IP8A 2OP0A 1W87A 3QEMB 4I55F 1WU7A 3RF7A 2XDWA 1W4CA 1XNQB 5IC4A 2V6JA 3NWOA 5AHXA 2JJYA 4WOPA 1FP2A 2ATCA 5IN5A 5JXGA 4LXXA 1VDZA 4JN6B 2DPLA 2B98A 1TT5B 2F48A 1CUHA 2KI5A 5K99A 4GFJA 2JLYA 4NAVA 4MMZB 1TYBE 4KPGA 5KOJA 4B2PA 5TMPA 2XT6A 5JZVA 1MX1A 4JLMA 4DBZA 4N8EA 4CN8A 1A2QA 5DRYA 3OKFA 2PS1A 5DXJA 3V8PA 2RGRA 1U31A 5JCOA 4NS1A 4HDKB 3HCCA 3OZWA 2YW2A 4MV0A 1KOJA 1U8TA 3CWZA 4E1VA 1QTQA 5GP1A 3G7UA 2VSYA 1X6IA 1VMIA 4Z6DA 4DCOA 4RJ2A 1W5TA 4LOLA 4LWQA 5A6VA 1N9KA 1WF3A 3GV5B 3FNRA 1WEHA 1CDZA 4FXOA 1L8OA 4OMFG 1G20E 4PZUA 4XD2A 4AICA 3UJNA 1H2HA 1O8CA 3IT3A 1DC5A 2CNLA 2HRBA 4RTQA 3SVLA 3H5IA 1TD1A 2MRLA 1HA3A 1P1IA 5JS6A 9LDTA 3U4GA 3QZ8A 1OV4A 2BFFA 1GFIA 3LX5A 1UKZA 4LXYA 3VV3A 4C4ZA 5I7FA 5IC6A 3U6KA 2UYYA 1GZ6A 3NHFA 5A9SA 5KWJA 3N2YA 1J0CA 2GTPA 1FDIA 1Z3IX 1Y5RA 3O74A 3N70A 3THXA 5JDCC 4HUQA 2KLBA 1A7KA 1E2NA 1DSSG 3BL8A 1A76A 5KQGA 2AFRA 4JP1A 5KL8B 1EZZA 1YACA 3MJ4A 4PSCA 4TQAA 1GNPA 5AKIA 4E2WA 3FCAA 3AZOA 2MUTB 3G2QA 4L28A 2IUTA 2Y6UA 3W79A 1UZMA 4TN5A 3L2OB 3WJ2A 4DMCA 1KEPA 2XGPA 4F7DA 2OTCA 4Z1OA 3RABA 4LBWA 4R16A 5KYUA 3FRIA 5LQSA 2X5OA 1XJ0A 4KFRA 3TW8A 4ZFNA 5MFPA 1X8KA 2IYWA 5DX0A 1IM8A 1BNCA 1LDNA 5REQA 4DA9A 4MPTA 3I9FA 4RVCA 3FHTA 5DBHX 3A3PA 4OGWA 4WHMA 3RU3A 2C7PA 2P3LA 2PGAA 3D4OA 1K8QA 1T0IA 1UK6A 2X23A 3L5OA 4QZ9A 2MIIA 4ZQEA 1TU4A 4YDHB 1H8HA 2I4IA 3DDSA 3K9CA 1OHHD 5EIOA 3T06B 5L7WA 2A67A 1I6KA 1ZKMA 2AIRA 3OZXA 4MR7B 5IJ0A 1PVOA 4CM1A 1BCRB 2WM8A 3RRMA 1ZQ1A 5HZHA 5LQMA 4XEUA 5BPCA 2UUBB 4FBGA 4G67A 3GVCA 9ICLA 3A1DA 3BA1A 2KX7A 1CUDA 3IR5A 1N2CA 3G9ZA 5COAA 1UC4B 3CLRC 4ZV7A 2EFGA 4CL3A 4YO7A 3IB6A 2ZDQA 3G6KA 2C2WA 3SYNA 3F90A 3FFTA 4ZXPA 1SXJD 4KU4A 2YV5A 4AO8A 4ZAXA 4C01A 4CMGA 1P6QA 4DGQA 2BCRA 5SZKB 1USWA 4NOLA 1ZINA 4RZIA 4XYMA 2WT4A 3THYA 3ESXA 4IILA 5JBQA 3NTVA 1GLVA 1DAEA 1N57A 1M6YA 1JZTA 2ECPA 4TTTS 4A4DA 1VJ1A 4NAUA 1G6OA 4EG8A 2JIPA 5FP0A 1NMXA 2D0OB 1C30B 3KPWA 3O0DA 4QIHA 2CHEA 1KDPA 2R5NA 3FHOA 3O47A 4V0ME 2OHGA 1SCUA 3F6EX 4O4JA 4PG4A 2WU3A 3NHAA 3JQAB 4TQ9A 1VI6A 4XIYA 5B7QA 1U9IC 2QL5A 1PK9A 5L9AA 4ELTA 2H3FA 2FF5A 3CUEF 4YP3A 4JQOA 5AJWA 3VGJA 2CW5A 3W5JA 1AMUA 1WLYA 1JJFA 4C29A 3IP7A 1FP4A 4DOBA 2JBHA 2B8NA 2QTCA 3C3XA 3REQB 2FB9A 3HZOA 1MF7A 1ZITA 2GA9A 2ZQ5A 1KL7A 3STVA 3D8UA 3HY3A 1EZ4A 1T4CA 5BSMA 1RPTA 4BRWA 2F7SA 1SCUB 4PLWA 3ETGA 3MRTA 4S1VA 3GD7A 3H0EA 1ZEMA 4FFWA 3PYMA 1BFKA 5E6SB 3L1IA 4HDQB 4BMSA 3KZIU 5GQSA 1UF9A 4PC3A 3CEHA 4MARA 5CRXA 3MG9A 1NNLA 1Q44A 3AEKA 5GPBA 2ZG6A 3BJEA 4QIWF 4NCBA 1SD5A 1QX4A 3DBVO 1MO4A 3TQHA 4A3SA 2ZR7A 5E3JA 4JJAA 1B22A 2W3SA 1GPKA 1KH1A 3DWFA 1EDDA 4Y2TA 3A4YA 3ENWA 2IYVA 4TV9B 3TW6A 1W93A 4AO7A 4KNVA 5JI3E 1SVNA 3O91A 1YBMA 3MB8A 1WMDA 3BQ7A 2R1VB 4FT4A 4CU5A 4CTJA 5EHQA 5A0VA 2ID9A 2A9PA 4D4JA 2AFHA 1YHZA 2H7YA 4NBRA 4Y6PA 3AESB 2O5CA 4Q1CA 4PYJA 1HTTA 1HJPA 3M5PA 4TKVB 4CL8A 3IKLA 3WRVA 1U0HC 3BWYA 4OFBA 9ICSA 1HOTA 4JSYA 2FPIA 4IOJA 2AGVA 1FRVA 3F2CA 1LB2B 4PC1A 3FGOA 1YGPA 3ZQJA 4EFNA 1H8HD 2QVZX 4Z49A 1AGXA 3OVMA 1AK9A 2OG2A 3STTA 1S2IA 2WJAA 3WOVA 4DRYA 5A62A 1Q1NA 1Q19A 2JMGA 1LLUA 1E9FA 3OAAD 1IRIA 5CYGA 2AGPA 4RNDB 4NVRA 1SIUA 2WHQA 2YHBA 1NMQA 2WRZA 1Z19A 5HJ2A 1CUWA 3K5WA 5TF4A 4HPJB 4ATNA 5LP1A 3UN1A 1BX0A 1LBQA 1YL6A 3HKCA 3I0MA 4KAJA 4TMVA 2XA9A 5LN1A 1K1SA 1EKXA 4V2UA 3FVWA 2ZUDA 1E64A 1T3SA 2RKWA 2VRCD 2WG2A 5CH5A 1T8YA 3FX2A 3I0ZA 3L6CA 1OH6A 3HKZC 3JQQA 3EASA 3MFQA 4EX6A 2VNJA 4V0NA 2Y8EA 1X7HA 5BRAA 2VBFA 3H11B 3V33A 1QOZA 3DM5A 4WINA 4X00A 4PBRA 3W5AA 2A19A 1B0ZA 2HYDA 3MS4A 4KXLA 5IJ9A 1WZUA 1Q17A 3U17A 5ALWA 2AKEA 1OYWA 1JWAB 3X1DA 4Y2SA 5AJVB 3UJBA 5EFZA 1CW2B 1P5RA 4NOKA 1AKTA 3SIPA 2WU8A 3STHA 2Y0EA 3L8ZA 4Z4GA 3E1KA 4OJYA 2XE7A 2QTVB 4M4SA 2B8JA 1A77A 1PWXA 5DGXA 1EVEA 1H0RA 4WPGA 4HAZA 5F51A 3OBBA 3D2QA 4JCOA 5JPDA 3QVGA 4IMIB 1NKCA 1UMCB 1T9BA 1A2BA 1O8BA 2CMFA 1SCIA 4OO1J 2DFLA 1DAPA 3WFIA 4HXEB 4JSRA 2NZJA 4AMZA 5DNUA 4Q03A 1DKQA 1E0DA 2C2GA 3DTTA 3ROXA 4AYBF 3JQ7A 4B6RA 3AERA 2IHBA 4QZAA 3OTHA 4KLEA 5ILGA 1ZZEA 4TQRA 1D9DA 2BUBA 2YHUA 2ZPUA 3LWDA 1GU1A 3PHJA 4BN4A 1G9XA 5EJEA 2GZSA 3STUA 3HVRA 1D2EA 3BSSA 3G5AA 1VMKA 5FL7A 4BO6A 5L45A 4TRMA 5I3ZA 2HHXA 2AXNA 2ODGA 3LUPA 1YZTA 4MUMA 2PMCA 4C0AC 1QO0A 4WCFA 1D03A 4N0PA 5JSYA 2HDHA 3T3MB 2AZDA 2PMDA 4Y18A 2Q6OA 1M1ZA 2YJZA 3EIXA 3INGA 4EDFA 2OD9A 4GO1A 5AVJA 4ZVPA 3ABRB 5DGIA 2E5SA 3H6HA 3LCMA 1DZIA 4KXUA 5B1IA 4ZI2A 5ALIA 3Q12A 2VAWA 4A6XA 3C1ZA 2F2AB 4FOOA 2WZDA 4UHHA 5K0CA 1YMUA 4RMIA 5HKBA 5L4NA 3MINA 4QZIA 1I01A 3B82A 4C4YA 2H2IA 1YZFA 4NH0A 4RK0A 3QEMA 5IKXA 1NE7A 3NC1C 2QW0X 2O8VA 2ZUBA 1GV1A 1PCXA 2C5EA 1G8JA 1P72A 4I99A 1HM5A 5ER9A 4TMZA 2ZJ8A 2BGIA 4UQLA 2ZB7A 4BE7B 4XSVA 3S2EA 2R96A 3FOWA 1W88B 2VTEA 2YV1A 4KXWA 3TFRA 4LZLA 1LPOA 3UGQA 1ND6A 1GAEO 2VRWA 2EZ9A 4Q3CA 2ZRIA 5FL3A 4C0LA 1GM5A 1I9CA 4M6WA 1G66A 2BFDA 1OQAA 4M1YA 1ZBQA 2O7QA 3P0EA 2QRVB 4IR7A 1GLGA 3EF0A 1ZJWA 5CGQB 4RHEA 1KO5A 3BQ1A 1E58A 1K7SN 3BD6A 3KFXA 1FVXA 4CM4B 1LRLA 2BGKA 3EZ6A 4D8XA 4DDTA 1PEAA 2O8NA 3R4VA 2QUAA 4X62B 2ZR8A 3V5NA 2X42A 1Z82A 4C8MA 1PWZA 2MYUA 3NVYA 1A96A 4DFDA 2WB1F 3QE9Y 4FKBA 4G9GA 3VO2A 1ZQDA 4H7EA 5DX1A 2KBFA 3G88A 1RACA 5AR1A 4YJ2A 4LVCA 1NBME 4HWSA 4XUSA 2JASA 3G13A 4KUHA 4JT8A 5GAJA 2ZTUA 4FDTA 1FC0A 5B1YA 1EUCB 1S9HA 4HN2A 5ALSA 4DA7A 1UK7A 2IDMA 3TO5A 3IRVA 3EVAA 1PWHA 3NRZA 1GRQA 5F52A 4CKBA 5CB0A 4IX9A 4E0BA 1HDRA 3MAAC 4EMSA 3AY0A 5FOUA 1H2ZA 4FC6A 4UHEA 2XMQA 3BRWA 4YGXB 2NYVA 3T3OA 3ZE0B 3HRDD 4LGVA 3RC2A 1N2BA 4DOCA 1RWWA 4GWKA 4J1TA 3VUEA 1CY8A 4LV6A 4CCWA 3SJCA 1JXMA 2QX8A 2X0RA 4IBOA 2B82A 1EGQA 4R5HA 1BMQA 3JPWA 5CD9A 1RYDA 2AOUB 4JI1B 1SBNE 2VOEA 1AZSC 1TI7A 4KWTA 4OB7A 1SEVA 2VO1A 2WEKA 4UU0A 3ZKAA 5CA0B 5LIRA 3QLVA 5D86A 2CV2A 1SZHA 3JZMA 2QKQA 1F0MA 2ASEA 3Q8KA 4TLMB 1PZNA 3EDMA 3SK0A 4HGYA 5BWNA 1QX3A 3QITA 4L27A 2PD6A 4M49A 4P7KA 5EA2A 3ER8A 3QI7A 3LHDA 4TKZA 4JOQA 1U3VA 4BWFB 1HZZC 1SFRA 2A1IA 5CMLA 2LE0A 3I53A 5EWGA 3AR5A 4DABA 2OH2A 3PL1A 1VQ1A 2R62A 4FFNA 8ICSA 1WB4A 3GUVA 1BDHA 4JP2A 1X38A 4HGRA 2R97A 5AT1A 2A8YA 2IHNA 2ISCA 3UQYS 2HW3A 5ALFA 1EDBA 5BOMA 1NQXA 3BAZA 4O4HA 2C22A 3MD9A 1CJUC 2XQFA 2PUHA 2V7EA 2PUVA 1K4YA 1MU0A 2Y1KA 5EWJA 1CUVA 2QD2A 4B75A 4DBVO 4P98A 2Q5EA 5K8UA 1CY1A 2RGAA 1Y33E 3A7EA 1SUIA 2JZBA 1TV9A 5KTYA 4DB2A 3RSQA 1SL2A 4A8TA 1JFSA 2I91A 5J2DA 4MS1B 4YACA 2W3RA 1I4OA 2A9RA 4ZI5A 1GAJA 3OLCX 1TPZA 3KEFA 5LQAA 3RRGA 2I6SA 1SEPA 1GGHA 5SICE 3SV3A 2FV8A 4P4LA 2XCIA 4NU6A 4MNTA 5EIXA 8ICEA 5CM9C 3RROA 1G2OA 4IZHA 3CGWA 4UASA 5ALDA 2CXRA 5L3QB 3TR6A 2E8NA 4RK5A 5HPYB 4JJZA 2CLSA 2BD0A 3VDXA 4WCDA 2GERA 5FPKA 1FSGA 1L5SA 3N2KA 4Y9SA 1EFDN 4FI3F 3R7LA 5JUWA 1Y8AA 3PYLA 3LM8A 4NK5A 4Q15A 4QOFA 2P2GA 5KHAA 1FX0A 2BCEA 2WE7A 4IF6A 4OHCA 1IPFA 1MQ2A 2HMWA 5KU1A 3N1UA 1X7ZB 4RQ0A 1XQ1A 3E05A 3OKAA 2VDWB 2IV3A 3ETRA 2AI3A 3B53X 3AF3A 3BX1A 2CK3A 5EWLB 4TVOA 3W6ZA 3RH4A 4IWNA 1E5TA 3LXRA 2OA0A 2DC1A 1QV9A 3VJKA 4GDFA 4UPDA 2BSAA 2XV1A 4XDGA 2VPWA 4B4KA 4E1BA 1O95A 1FLAA 2DJ5A 1E6WA 3KOZA 4W8HA 2BEWB 4EGSA 2W6ZA 3LUKA 1YBFA 3OZDA 1QGAA 3P9NA 1YBAA 3W2GA 3WMXA 4AZ3B 5G0VA 5F1PA 4HDAA 1EGMB 4TROA 2P79A 5ED0A 3KHRA 2O3QA 3P32A 2CYCA 3RC9A 4K9RA 3T1YB 5A5VA 4M04A 4EKDA 1QMGA 4KC0A 1DWPA 1M0SA 1PGPA 4DLUA 4Y30A 4DS3A 3LQ4A 2EFHB 2DM6A 3RC7A 1MX9A 4LC0A 4CPDA 2G36A 4RVOA 1MZPA 1KFCB 1M1YE 3CRRA 3K32A 2HFKA 2O3JA 1GPJA 2Q50A 3NVZA 3DFUA 3H9UA 3OO0A 4GZ3A 1TM2A 4R9UC 5HGJA 5AHRA 1J99A 3HBLA 4Z0HO 1ISPA 3D1JA 2E89A 4C43A 5ICCA 2OHFA 3F2DA 3PF8A 4EHFA 2NUAA 2XY5A 1DV1A 3AR4A 3HV0A 2X3UA 5AWFC 1ZIOA 1Y4UA 3EEQA 4I5GA 1SU8A 1U48A 1YCDA 4JA2A 2VJ4A 1FFWA 3BK1A 1YE3A 4PCVA 3RU7A 4UAUA 2WC1A 1GR1A 2HREA 3ENKA 4MMXB 3DVSX 4MW6A 5IT5A 4MWDA 3QKIA 4M9NA 5D85A 3B70A 2JJQA 2OBYA 3U26A 1PQUA 4KQJA 4ZT2A 3QSYA 3CTPA 4QU9A 1A2KC 1GARA 2PGXA 1ZCJA 3E58A 3COSA 3VKUA 3QLJA 3NATA 3PDJA 4RM2A 4F1JA 5K6TA 4NXNB 2GDJA 4V0OA 3U7JA 4FFBA 5DO9A 3HFJA 4C6RA 4HAIA 4WZAE 4BYMA 1CSEE 4UAYA 1JG2A 3ZWOA 4W6QA 2E5FA 4OI4A 3NIFB 3NXKA 5THQA 1N78A 2GM4A 1OW5A 4GSKA 1U3FA 5HKKA 4JIMA 1D4FA 5IBQA 3HNOA 4NLZA 1FYWA 1CJVC 3SAHA 5J2TA 1KBUA 5ERYA 2IPMA 1UMBA 2NU9A 5EQDA 2Y1JA 1QSYA 2YJGA 1EG7A 3JW8A 4C4RA 4D4MA 3V1TC 2XA2A 4RTJA 4HEQA 2QMYA 3BFXA 3EHDA 4EUHA 5DTJA 2PM8A 4JOSA 5KJEA 1Y88A 3MMNA 4F85A 1NW3A 3PLRA 3QVSA 2CB0A 4YMNA 3DMPA 4M8SA 3TG2A 1VYUA 4ARBA 1DT3A 1RI5A 3FWNA 3OLVA 4TPKA 4YXWD 3C0KA 1L1FA 3VGPA 5KZMB 2GCOA 1KEWA 2OCGA 2VF7A 1AUVA 3C74A 2FW8A 3ER6A 2XMGA 3P0IA 4MWSA 1XJQA 2JLXA 1CUIA 2XWJI 2DHEA 1TU0A 4I3GA 3AL0B 1Y37A 1NK5A 2YVAA 1L1QA 2XCPA 5IJXA 1RJFA 3TNJA 4CEIB 3EPHA 1YVRA 4ZD6A 3R8XA 1TPYA 4YCSA 2OUIA 1TT7A 3KWMA 3I76A 3PJFA 3LUBA 4Y1RB 4FOPA 2J6SA 3E18A 2PLAA 4L73A 1PFGA 4G89A 2GM5A 4FS1A 3A6EA 4YAFA 3FOZA 3EGXB 5KNBA 1R10A 1Y4ZA 3TL2A 3IG8A 5LD2C 3Q7IA 3GIKA 1RXCA 2QM3A 1PZMA 1S1CA 2LTAA 3K72B 3QV1A 2D6FA 4KAAA 3IHWA 2AYZA 2ZB3A 3JYLA 3K0BA 5H83A 4HOYA 3V1KA 3WIOA 5AVRA 1C3XA 4JWNA 1QPGA 2PMKA 1L7MA 5JNLA 5ES4B 3N0RA 2Q29A 2WKQA 3LHIA 5BNWA 1H4VB 3B1JA 3HNRA 3EODA 2WJ3A 4F4YA 1UFOA 3OEWA 5A4IS 1AZWA 2W6JA 3RFUA 1ILEA 4MDFA 3NEPX 1M8KA 1BHQ1 2AJDA 3AM3A 3DLTA 1AOXA 3OLZA 1M7HA 4G4GA 5B3JA 2WFZA 1ZD8A 1LU9A 2IP2A 4Y7DA 3L07A 1MJ5A 1X8JA 3BBLA 2EJUA 3BIOA 1XZBA 3FF4A 1AROP 5DLQC 2FZKA 1ZU4A 1PVPA 3EIHA 1WR8A 4R3UC 1IH8A 2H16A 4KGDA 2WAQC 3LY9A 1DCFA 3PXEA 3FFBA 4RA6B 5EKUA 3WZ2A 4KACA 1XEFA 4ANFA 4ZI7B 5ILOA 4DSAA 1GKKA 1H9BA 2D8CA 3L82B 4Q19A 4RKFA 4QVIA 3TOCA 1ZGCA 2VBGA 3NP9A 4MDHA 2EF1A 2JHGA 2CEKA 3AUSA 3S1AA 1CERA 1B0PA 4EM6A 1QRUA 2LDBA 2NT4A 3RBZA 3Q7RA 4RSHA 4EIWA 1YA4A 1K5GA 4F4JA 1JVSA 3O84A 3RYCA 9ICFA 1AHNA 4M0CA 3RRYA 1JQKA 3L0PA 4KLOA 3PC6A 2WILA 5ULLA 3SWWA 3HLTA 4PLYA 3UHOA 1B7GO 4Q37A 4EO7A 2G6BA 4GECA 1VA5A 1TNDA 3SBOA 5AJTA 8GPBA 4F84A 5JS7A 4EH1A 2EJBA 1GILA 3RVOA 1TGYA 2J30A 4RETA 3KYIB 2YZ7A 2J67A 2IBMA 5KS2A 2GRAA 5D5HA 2HSDA 3CUYA 5KSZA 2K89A 1ZBDA 1W581 3DNPA 4ZU3A 1H69A 3AF0A 3PMNA 2ZI6A 1E7SA 1Y1TA 4MKRA 4QBKA 3RSLA 2NAFA 4CIXA 5A0FA 4BFVA 3FPLA 4BO3A 3VRHA 3SLRA 1CQXA 1VHDA 3AKYA 3QNWA 4KW7A 4Y9UA 3VZRA 4A1FA 4KMMA 1XF9A 4L1KA 3IM1A 3HB0A 3C6QA 3I58A 4HPWA 2QUZA 1XZDA 1U4BA 2AFIE 5J0YA 2P75A 4C0SA 1JJIA 4C88A 5HTOA 4N41A 1ATIA 1JXOA 4AN0A 3ZWQA 2BH9A 3AQEA 1W29A 2FZVA 3PRKE 4UXIA 3UA3A 3N8GA 5EMKA 3ZXUB 2JH1A 5CB4A 2XB9A 4DUGA 3AVVA 1IZ7A 1XJCA 3A1NA 3NT5A 4H60A 1ZHHA 1CP2A 1KEJA 1OFHA 3M33A 2QRZA 3WQRA 2AXTU 3F46A 4PCUA 1RVDA 4WZAB 1TVAA 1RYZA 2ZYIA 3UEOA 2N47A 3SR4A 1IY8A 2WHPB 3FLAA 3N0TA 4OBBA 3A36A 4LQ4A 4MI3A 4ALKA 1E63A 2MR6A 4TMTA 4ED1A 2FPIB 5D6OA 4NJ8A 2GTIA 2HK6A 4II7A 3SC6A 4QODA 4MWCA 1NSTA 3PRHA 4PZNA 4WXEA 2WTUA 3IELA 2ZJ1A 5IFLA 4DV1B 4D41A 4J9NA 1PG0A 1LNZA 4EB6B 1MX5A 2IDKA 5LB4A 1E5XA 2FEXA 1GRCA 5FTWA 3VHXA 2COKA 4JEHA 1XS9D 5FL7D 2P69A 4BQSA 4Q9DA 4BNMA 3IB3A 5KDOA 2KP7A 2Q8QA 5C5EA 4DQLA 4CU2A 3TZ6A 4MLPA 2JCGA 1QO7A 3TTVA 5J3JA 1KE1A 4XWYA 1PL6A 1EK1A 3D64A 1VC2A 4WOJA 3T5PA 2C2XA 3TMAA 2V6GA 4AURA 5DHAA 1R8QA 2FSHA 1FRZA 5CVCA 1TMYA 3EQ9A 3NBKA 3NVWA 1N0VC 3RNOA 2A1TS 4TSFA 4ABYA 3B6MA 4CW7A 1IEVA 1MA7A 2AXPA 5KNCH 2EL7A 3MMPA 5AP9A 2SCUA 3HCRA 4ZODA 2FRDC 4CRXA 4MUEA 5IPFA 4F3KA 4ZHQA 3EGDA 5AKLA 3I2JA 3KD2A 3EMKA 10MHA 1CVIA 2I2BA 3G1UA 4GLFA 5IVPA 4QU0A 2VJYA 4JXZA 5LXTA 1KOLA 4X5VA 3H2IA 4AZ3A 3TRFA 2VPIA 2Y71A 5AVYA 3NIBA 4L8LA 3EWNA 1P1HA 1P5FA 4J1NA 3AR3A 4Q4JA 3TLKA 5LXTB 1WEKA 1ZM7A 4IQ4A 3LY8A 1LV8A 1EJBA 3P9SA 4S3MA 4HP8A 4QBGB 3LS2A 1II9A 1NG1A 2C84A 2PKEA 2MYPA 3M81A 3VAAA 3TUZC 4B85A 1JE0A 1ZQRA 5JJKA 3ZZTA 2Z30A 2FR8A 5F1KA 1NLFA 3F5QA 4DLKA 2EZYA 3AFOA 2AI2A 1WU8A 3K1RB 1QYWA 4XCQA 3MT9A 3UAWA 2OM2A 4GMFA 4TSFD 2QRGA 3GJ5A 1CBUA 4BJ6A 1IQUA 4KQIA 3LBHA 2WAQF 2D13A 3UXPA 3VR5H 2NNLD 2SKDA 3I01M 5DOVA 1NUTA 2FDXA 2BM0A 4PZDA 4K7JA 5AM5A 3D6MA 3EARA 3O4VA 4XQCA 1EESA 4I66A 2VQ3A 1MTZA 1GZVA 2OCLA 3G59A 1CY6A 4QOIA 1ZGGA 5EFOA 1KDYA 2OBMA 3KQLA 2YZMA 1DEOA 3L5KA 2CFSA 2HLNA 3M7IA 3K5HA 1P4SA 2FUKA 3OIVA 3VHXB 2PWAA 5IM4F 1RPLA 1VJRA 3IP9A 4YN3A 1QAQA 4JL8A 3BXEA 3Q7QA 5GJCA 2VUUA 4RQ6A 5I5GA 3ZQUA 4EB6A 4S05A 1Z6QA 1MMFB 1WDLA 2LBOA 2JJ1A 3R0QA 3ZDBA 4YRFA 1ESCA 1E96A 4BE9A 4RTKA 2HJGA 2BDUA 3HJBA 5EC8A 3M49A 4WE3A 3E70C 4YIKA 1JN0A 2FWRA 3TW8B 3K6SA 1XA4A 4JB2A 1HZZA 3QSGA 2ANCA 1JVNA 2Q9BA 1S2OA 1TAQA 4H7KA 5PNTA 3ZQ6A 1N2JA 5KJCA 4GL2A 3R09A 2G82A 1DJPA 3EW9A 4J9UE 3P9IA 4G3XA 1GJRA 2I55A 3V9AA 3ZTTA 1U6IA 2WSSD 4AUEA 1NLUA 1QXSA 3S2ZA 4K8OA 3C8DA 5KNDD 1GZDA 2V54A 2IEGA 3SX4A 3FPGA 4OG2A 5JD4A 4K1XA 3D7SA 3N4MB 2ZE5A 3QOWA 4DV3B 4FFBB 1DIBA 4U7GA 5L40A 1G63A 1T1JA 5JNRA 1YRWA 1NU8A 2BJHA 1DHTA 4JV5B 2W9BB 1OX4A 2WJVA 1V7PC 3JTEA 1W4ZA 1Z4KA 2GBCA 2QP3A 3NM4A 5LU8A 1O0BA 1QKKA 2JFNA 4Q9IA 2NADA 2XCTB 5BY2A 1NONA 3RVNA 2BGGA 2OXFA 3SICE 3EZFA 4KLCA 1K63A 3VC2A 2F4VB 4WKBA 4TS9A 3ITEA 5F2KA 1KQOA 2KJ9A 3R3SA 2AOUA 5ESDA 4DO9A 1OOEA 3ITKA 3OOHA 4Y7CA 2NNWB 2ZIFA 5FKJA 3T38A 4CTKA 5C0YA 3AR8A 4C7ZA 1LPSA 3RSGA 4GZLA 1XTKA 3LECA 1ZR4A 1U6JA 4X3OA 1UBNA 1QSLA 4Q66C 4UQPA 4DSIA 4C3ZA 4Z99A 2FN7A 3EG5A 1MRSA 3AU6A 1N75A 3FGPA 4QEKA 4TZKA 2DKOA 2C2MA 3RBEA 3JARB 3KTDA 3PA6A 5CJPA 2X1LA 4I7EA 2QT0A 1QAOA 2JCXA 1KAGA 4UQGA 2IA5A 3CVUA 5DHFA 1P7ZA 2JFVA 4ED0A 2AF4C 3WYCA 3Q8RB 2WIJA 4X0EA 2QYOA 4ED7A 2BP7A 4EYOA 2WUWE 1K68A 5I7RA 1LK5A 3THRA 1RABA 4NNPA 2VJPA 4PQFA 1DO0A 1XTQA 5K5EA 1UJBA 2PFNA 2X9VA 2CUTA 2JK0A 1JG4A 2H2HA 5ALZA 4MYUA 1IHDA 5BOVA 5TVKA 2ZRBA 2D2VA 4GI2A 1ZVJA 1O94C 1O95C 3NC0C 3RJTA 3RAFC 4G9BA 2PT6A 1K27A 4MWOA 5JT1A 3C85A 1ZQIA 3WRYA 4B3MB 3N2LA 1KYQA 2YOFA 4Q02A 2HSWA 4QRDA 4WGGA 4LKRA 2RRDA 5ALYA 1UWLA 1BCSA 5L7YA 1Q1AA 1M2JA 1NAIA 1Z06A 3BK7A 4FX2A 4JLUA 3TCXB 3TGLA 3A2KA 1QIHA 4IL5A 5EAIA 1CY4A 5G0UA 2IOFA 4MUGA 3KLBA 4QJ3A 3M9MB 2AYYA 4F45A 4Y0NA 4NJOA 4XB6B 3G2IA 1ZW6A 1EFRA 3RV3A 3DBLB 1JLSA 2CHQA 4Y2GA 3EE6A 3T1VA 3V7FA 3U3RA 2ZB8A 2DHDA 3EUAA 3RIYA 1WHTB 1NW8A 1ACMA 1XVAA 2GF2A 3FZQA 4IJ6A 3JR7A 4IICA 3UK2A 3Q41A 1B6RA 1EVKA 5JQWA 1USGA 4GOND 1Y6ZA 5CAEA 5IABA 1BE6A 4FGLA 3LDFA 3VU1A 4JI7B 2ADFA 4GF5A 1UA0A 2C9CA 4B81A 4OCZA 1LJUA 4HWTA 2Q3CA 4B87A 3GLQA 4ZZIA 4GNRA 5KFCA 2RHRA 4DYHA 3NIDB 4UBKA 3U3DA 4Z7QB 1GAQA 3VNUA 2LKCA 1O97C 2AZTA 2HSJA 2VDPB 2LM1A 2VJAA 4HCJA 4PIVA 4YCDA 3SJAA 3GEIA 5DM4A 3WL6A 4ZDKA 2BGTA 9ICRA 5AVVA 3HZRA 1YUMA 3L4PA 1LBHA 4Q1EA 2O0MA 2Q2NA 3TQFA 1B14A 1I0LA 1Y98A 4QZ8A 4K88A 5EE0A 1CTQA 4MYSA 1V16B 1DL5A 3CKKA 1X74A 2NU8A 1RXSA 1WP4A 2SKEA 3AM1A 2XVYA 1IBKB 5BNFA 5JMPA 1UMCA 2P40A 3P0FA 1N6NA 2CDBA 3CF2A 1KY4A 4PTZA 2FY8A 4CG1A 5BUCA 3O3OB 3U7GA 1FDWA 2D1QA 2QY9A 2Q2OA 5BO5A 4UFPA 1BYUA 5CXQA 4DMUB 1R16A 3U1VA 3OLYA 3QPVA 4RJTA 3VR4A 3EPKA 1SK8A 2HL6A 2AJTA 2IK8A 3NUGA 5J1TB 4E14A 3HSKA 4I9NA 2A5JA 1PS8A 1UDCA 1JHZA 1X7WA 4BB0A 4DSEA 1AGNA 1FTYA 4LDNA 4BO5A 3WGVA 4LHXA 3THOA 3HSSA 2ZR9A 4JYCA 5EZYB 1NBMD 2MINB 4JLVA 4N0QA 3I61A 1NT4A 1XQXA 3AUJB 5CA0A 4HN9A 3WA7A 4MR8A 2Q1SA 1A9YA 2TRSB 3GFTA 1RI1A 5F98A 3IALA 3EGWA 1E1RA 2RHBA 2W6QA 3MWDA 3CE9A 3EWIA 3FFWA 3PD7A 5DTMA 5JISA 1R6VA 1FP7A 2O57A 1J49A 1UKAA 2J4FA 5DYWA 3HK2A 3ICEA 2VJCA 4P0QA 1ZVKA 1HEYA 4Q39A 5C4IA 3OLXA 4D8WA 2Y9MB 1X2IA 1EWKA 2H00A 2J08A 2N75A 3CVOA 5DB7A 1B3BA 3LZDA 5DI9A 5KNBD 5LZ9A 4PAMA 2W2KA 1YS4A 4J7CA 1QHEA 3P9KA 4WFIA 2GEUA 4AJPA 4C8OA 2P11A 2R1UA 4PC6A 4OQEA 3MEQA 1QMPA 2A9VA 2QTAA 5G0WA 5K1ZA 3ID6C 2RH8A 4D1YA 2ECKA 2PWYA 1FQOA 3NQ41 3IEKA 1TZJA 2EKZA 4MB2A 5FPHA 1SBTA 3AHGA 2OV2A 3E27A 4X64B 5TV2A 1U6KA 4QNNA 5LUBA 2HJVA 4UTXA 2W6ID 3IERA 1TOAA 1V3UA 2GCPA 4WUTA 2CHFA 3B2EA 4PQRA 5HFNA 4KIWA 3VX4A 4ZJUA 5JYEA 1Q95A 1MUUA 2JFQA 4QW9A 3G2KA 4UMFA 3CZRA 2UYHA 1JAIA 1A50B 3NNNA 1KAHA 3W3AA 4XGKA 1WZNA 2QRVA 1ZJ5A 2R7AA 4BECA 5KAMA 1CS0A 4UARA 5IBCA 2H1WA 4LY3A 5HBGA 2WSYB 1TK5A 4CGYA 1V45E 3W1VA 2GAIA 3GEMA 1P5HA 4KSCA 1MO2A 4TKMA 3BILA 3R8CA 4CFSA 1DCTA 5C35A 1EFUA 3PNLA 3SG0A 4BBZA 1PGJA 1Y6GA 1CZOA 1GZSA 2Q4DA 3JZIA 4RF5A 3EZGA 4ARZA 4F5YA 4LS3A 5KJFA 1PG5A 3DNFA 4MWGA 1UFKA 5ICFA 3DV2A 4RKEA 4HNQA 5JTTA 2CT8A 3E9QA 4LECA 4M2YA 2FPWA 3LCVB 4ME6A 2KWIA 1RM6C 1DEHA 4MYRA 3U3ZA 2O2XA 4JR2A 3ZJ4A 2G40A 1HBJA 1X1BA 2BI4A 3WKCA 3OOYA 4U7FA 3QJGA 1E79D 2TYSB 4N0DA 3MTQA 5F77A 2M6KA 3WFJA 3CRVA 4F5OA 3I2IA 2FSFA 1PW5A 4ZALA 1WW2A 2EW8A 4CMHA 2D5BA 1WZCA 3DD5A 3LO8A 1YDFA 4OQYA 4YMWA 5KEIA 3H9QA 1P62B 5J23A 2GXAA 4I2IA 4AKTA 3WHIA 1ORWA 1YGYA 1QYIA 1IOWA 3MTGA 4DBLE 4QW8A 1IXRC 4AF8A 3P19A 3L92A 4H7IA 2BTQA 1PVDA 2WA2A 3A0BU 3EQ8A 1W8DA 3HUTA 4PE5B 3BRCA 1HL3A 3EZ5A 4NBUA 4HLCA 1OAAA 5FI1B 2XQGA 4DCPA 5GTHU 2JRLA 2OXRA 4EP1A 5GTDA 3REGA 2Z5VA 5HG0A 4R2HA 2DPIA 1L9KA 2WJPA 1WA5A 5DP2A 3KUKA 3U44B 3WU2U 1XQ6A 1O94A 1KMNA 3A31A 3PEUA 3Q98A 5DBFA 4ESEA 3THWA 2BCUA 4MCIA 1LSUA 3D0OA 1D09A 3O5AA 4XAQA 4HUTA 1ENOA 1MQ8B 4EW3A 3MVEA 1CFJA 3AUAA 3BZCA 1AN9A 1CY7A 1ZDMA 3CB4A 5KYNA 4P35A 2ZXEA 1OJ7A 4KE8A 4X94A 4ZVRA 2X8JA 1YHNA 3RJKA 2X14A 3HCBA 3LVWA 2HHQA 1TCUA 1YDGA 2C5GA 3PUWA 1RTTA 4RV4A 2PKWA 1KBQA 2R66A 2ZIEA 4CM7A 5BVHB 2OYYA 1E2FA 1O4WA 4MQBA 1F12A 1RQ7A 3GV0A 4HVTA 4M8IA 4DQIA 5J59A 2F77X 5CBPA 2DTDA 5CHGA 5FA5A 3AIOA 2A0XA 7ICMA 1DQNA 1WXDA 3OEHA 2QRNA 4O3SA 4PO9A 5BMVB 1CUJA 3UIEA 4QARA 2E3JA 1T0PA 3GUZA 4YXWA 1UPBA 2HGZA 2QRMA 3FA2A 3AEUB 4BE4A 2YOHA 3S81A 3N8NA 1Y1SA 5DGHA 1LD3A 1L7XA 3BT7A 1AH2A 1X9IA 1K75A 3WYGA 1KJIA 4Z7JA 4WT7A 3R9WA 1MO6A 2QRUA 4J03A 2QVYX 3C1OA 1QIEA 4OGLA 3VC8A 2ODBA 1L8QA 2CNWD 2CVQA 3JQAA 1A9QA 3ZNQA 4ZT4A 1R3UA 1TQ8A 1Y3CE 3IUQA 3V4LA 3DAFA 3TLJA 3QEAZ 3D5TA 3LQKA 1PR4A 1A5ZA 1Q16A 1XR3A 4UBIA 4ETWA 3OOEA 2BR5A 5JSFA 5D8DA 1AKMA 5K0SA 5TR9A 2V3WA 3VM6A 2HM7A 2PGJA 4XVUA 3R0XA 3L7NA 1ZQBA 1ZWKA 1DC8A 2PZJA 3SNKA 2G8NA 4L5CA 1EBUA 3CW8X 5KFQA 4MVJI 2ZUEA 2YVQA 1VYHA 2X0NA 4TVBA 1VLHA 5EMHA 1USKA 1YZHA 3OZTA 3OMXA 4RHTA 3E5NA 3V2GA 3G2MA 3VKVA 4ENQA 3Q8QB 2O19A 1Z33A 3D1VA 2UVPB 2OV3A 2CHUA 1C5KA 4JMUA 3V6KA 1WY7A 3OSZA 5CT5A 5DX8A 5C3UA 2JZBB 2QMUA 4RPHA 5I9IA 2DRIA 2BCVA 5JRJA 5AJUA 1VPWA 1A8PA 4OEHA 2AG6A 4MGKR 3ASUA 4TV9A 4F86A 5K51A 1IN8A 3NS1A 3WLRA 2K87A 2XZLA 4C21A 5EJ6A 1KJYA 4PLVA 2PV0A 1OYOA 4X84A 3ZDAA 2PEYA 1F0KA 4D9MA 4DV7B 5EJIA 2BYTA 2VA8A 3SVTA 5LA6B 3ECAA 4HQRA 1PF7E 1Q0RA 3UKDA 1OXBB 3ZWKA 5ALOA 2AGQA 1BE8A 4RQTA 2MSKA 3GYGA 5HS6A 1AA6A 3CM0A 2BOVA 4P7GA 4GI5A 4LDZA 4UHJA 3ST7A 1DGSA 2V0GA 5CT4A 2GTHA 3IQXA 1ONPA 2C4KA 2ZXIA 1TW3A 1TQ4A 4ARVA 4IR1A 1MAWA 3CLRD 1VFPA 3N2KB 4U3JB 3TWOA 4YP7A 1W1WA 3I8OA 4JMLA 2OFXA 3TZEA 2VOJA 4CT0A 1E0KA 1XZJA 3PXUA 4KQFA 3RK0A 4RDCA 4XVCA 5IFKA 1IG0A 4LSZA 3REQA 1NYQA 4R98A 2E5WA 1ZOPA 1AQIA 4Y1GA 3RRFA 1N1EA 2GUGA 2X13A 4Q3OA 3VMMA 4NYJQ 4LZAA 3QY9A 2NXEA 4XWAA 1POWA 2QTFA 2Y67A 4DCJA 1VSVA 3K73O 4EUSA 5U1PA 1B76A 1IBSA 3LWNA 1U49A 3IE0A 1TJ5A 1EGVB 3B1FA 3DA8A 3AL3A 3AQIA 4MI1A 1CC1S 1A5SB 1K1EA 1NX6A 1OBVA 1TYZA 1YR3A 3L8CA 3LVQE 3ZC3A 5C5IA 2XXAA 3RAEC 2PGIA 2VJDA 4J2HA 4PXYA 3FOEC 1L5HB 3D3NA 3TECE 2HYIC 1SC3A 2YVUA 5LYYA 3TEFA 2INGX 1HE1C 5JV5A 2G0AA 4HNHA 3BMCB 3L7BA 4LK3A 2VUIB 3DL7A 4XSHA 5IM4A 3G2OA 5EJMA 5ABPA 4BMVA 1PDWA 3DHWC 1Q77A 4K9QA 1SO8A 3ZD8A 3MR3A 1DUSA 1P18A 1SB8A 1ZJZA 1Q0LA 2B69A 2IZ0A 3TLZA 2ZEJA 3LK7A 4JV0A 2IEZA 4NZNA 1WXHA 4AUMA 1XMVA 1A9TA 5BWOA 5FTJA 2EWVA 2X15A 3PZBA 4KMRA 4KVGA 1UA1A 1AKUA 1K88A 1XRPA 3KKAA 2Q49A 1D0VA 2X1HA 1ULSA 4GUAA 4ECAA 3RSZA 5BSFA 2W2VA 5DFAA 2ADOA 2OC4A 3L8GA 2V3CC 3DQPA 3LGXA 3PKIA 3A3OA 4YUVA 4B4DA 1S02A 5KNCD 4XM1A 3K2IA 1R4NA 2Q7DA 3W3AD 1BD4A 2ID8A 1Z34A 2O05A 3GT3A 3N9IA 3DDOA 5BP7A 1XD2A 2OBNA 1FS4A 2W93A 4FR0A 5DLGA 1TT5A 3OX4A 5CYFA 4BQNA 1MD9A 4C1BA 2BFBB 3GJ7A 1G8PA 2H59A 4X95A 3R75A 2Q5FA 4OP2A 3V6LA 1ADYA 4C6TB 1EH5A 1KEUA 4QJIA 1P9OA 1RAFA 2HCFA 1BPDA 1IMJA 1JLMA 1ORVA 4MO2A 4DPKA 2RB5A 1PJ8A 4DB4A 1IBMB 1TU3A 2UVDA 3VNVA 3LU1A 5JZMA 1GCUA 3CQ9A 2XRYA 1PT9A 4DSLA 2AQHA 4JLKA 1VJTA 1CR1A 2JHCA 3UK7A 8ADHA 3HKDA 2WLSA 4TUYF 2HC9A 2H1CA 3RK1A 1ZD2P 1YULA 4DR3B 2CXUA 3ME5A 2EARA 2GD6A 3IP6A 1VSUA 1SKWA 1QB7A 4BEJA 2K7ZA 3A2LA 1MXHA 1U0LA 3BGIA 4XXHA 1CV2A 1V4BA 3UF0A 3CF0A 4ZCRA 5FTLA 3K31A 4USAA 1H5NA 3THVA 1HYQA 3PFGA 4TXJA 1YDMA 4W9RA 3OE1A 5D00A 2GN8A 1CYEA 4ILEA 5C37A 5DKFA 3DFFA