4C4TA

Structure of beta-phosphoglucomutase in complex with a phosphonate analogue of beta-glucose-1-phosphate and aluminium tetrafluoride
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
217
structure length
217
Chain Sequence
MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-PHOSPHOGLUCOMUTASE
publication title Alpha-Fluorophosphonates Reveal How a Phosphomutase Conserves Transition State Conformation Over Hexose Recognition in its Two-Step Reaction.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
total genus 76
structure length 217
sequence length 217
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2013-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 4c4tA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4c4tA01
2EAUA 3IB6A 1O03A 4DFDA 4HGNA 5AVYA 2ZOSA 4KNWA 1WVIA 2WM8A 2C9MA 2OYCA 1RLMA 2HX1A 4EELA 2B8JA 3MPOA 5AW7A 2P9JA 1SWVA 3E8MA 5ALQA 5ALYA 2EARA 3N28A 3E84A 2B0CA 3VAYA 4RETA 4DW8A 4BBJA 5ALOA 1Z4IA 1ZD4A 5AI0A 3I76A 1TJ4A 3U13A 3ZUPA 5ALDA 4OD0A 1L7MA 3N1UA 5AK3A 5ALKA 4GIBA 5AM5A 1JUDA 4AP9A 4CF4A 4NWIA 4UU0A 4Y2JA 1TJ3A 1O08A 4Y2XA 5ALGA 2ZBDA 2YJ3A 2NYVA 3KBBA 3GYGA 4OHFA 1Z4KA 2R8YA 1TJ5A 2W11A 3NALA 1Z4OA 2Q5EA 3K1ZA 3ZVLA 4GXTA 3QU9A 3AR9A 4I9GA 1KYTA 3N5KA 3OCYA 2CFRA 5AKLA 5A3QA 1L7NA 2GHTA 2I55A 4YCMA 1ZRMA 5E0OA 4KNVA 4CE6A 1XP5A 2YMQA 4C4SA 4MUMA 3AR5A 1QQ6A 5ALWA 2IA5A 2X4DA 2RARA 2YN4A 4BX0A 4UMDA 5AI6A 5AM1A 5ALNA 1XVIA 1NNLA 5T41A 1Z4JA 1U7PA 5AHXA 2RBKA 1ZS9A 3FZQA 3L0CA 4AS3A 4J2TA 1Z4PX 3UMCA 5AVRA 1L8LA 3R9KA 1VFPA 2R8EA 4FYPA 2YMLA 4FFDA 5JJBA 2JARA 4CF5A 4F71A 2HI0A 5AW2A 1RMYA 1Y8AA 4BEWA 2MSNA 3L5KA 4EX7A 1RLOA 2IYEA 5AW1A 3FPBA 3OCZA 1TE2A 3FGOA 4HAIA 3OPXA 5ALFA 3ZX5A 2P27A 3AR8A 5AW4A 4HGQA 4YH1A 4ZEWA 1RC8A 2B8EA 3M1YA 3PDWA 3A1DA 1XPJA 3M9LA 2FUCA 3MN1A 2GMWA 2GO7A 3U26A 3ZW7A 4OCZA 5ALRA 3W5BA 4G63A 4UW9A 4XQ0A 5IT4A 1RQNA 1N9KA 1YV9A 4BEVA 3NAMA 3L1UA 1ZJJA 2W4MA 3I1YA 2AH5A 2FPXA 3KC2A 1SWWA 2C8KA 3WKBA 5AI4A 3QLEA 1L6RA 2ZBFA 4L6CA 1YMQA 3FPSA 3WGVA 5AESA 5AVQA 5AVUA 2WFAA 2RB5A 2G08A 2FDRA 1S8OA 2YFYA 2YJ6A 3EWIA 3R4CA 2C8LA 3QU7A 3L8FA 1J8DA 3AR6A 3A1CA 2WF8A 1Z4QA 5AI9A 3ZX4A 4UARA 2G07A 3IRUA 3AR3A 4L57A 5AI8A 1L7OA 3WK9A 1WPGA 4JDPA 4O8CA 5AW6A 2IOFA 2O2XA 5AKXA 4XPZA 3WKDA 4Y2QA 3SHQA 1SU4A 3L0BA 2HCFA 5AM4A 1Z88A 3NRJA 2HF7A 2D2VA 5A3SA 1ZD3A 3F9RA 3OCXA 3WK6A 3AR2A 4BX2A 2GFHA 3WK7A 2WHEA 1VJ5A 2Q4TA 2NO4A 2QLTA 2W43A 1TA0A 4UAVA 3CNHA 5AVVA 3QNMA 2O9JA 3A1EA 5AKGA 1IWOA 1MH9A 1YDFA 2OA0A 4HGRA 3DAOA 5AIAA 3UMBA 3L1VA 2P11A 1RRCA 4BKMA 3D6JA 4EEKA 3ESRA 3WK8A 3R09A 3U19A 2BY4A 2I54A 3EF0A 1U2SA 2JAUA 1QYIA 4Y3UA 1T5TA 3L0YA 2G09A 3WGUA 1U7OA 4UATA 4AS2A 3L8HA 1CR6A 3OCVA 5AKJA 2QYHA 3KZXA 3QUCA 4EZEA 2FPRA 5AKIA 1U2TA 4ZEVA 4KN8A 5AICA 2YJ5A 2GHQA 2AMYA 5AW3A 5ALSA 3ED5A 5AVTA 2I7DA 5ALIA 4CNQA 1LTQA 1Z4MA 3U7EB 2FPUA 4G9BA 2YBDA 4I9FA 2AUTA 4C4RA 3WKCA 3A3YA 2OBBA 3I6BA 4BX3A 3DV9A 5AK4A 3QX7A 3SF0A 3WK5A 1L8OA 1Z4NA 4C4TA 2BDEA 3SKYA 2OM6A 2EATA 5ALHA 4YIHA 2ZG6A 4YCLA 3PGVA 3QU5A 2AGVA 3N07A 4HGPA 4J03A 2IOFK 3TLMA 3NIWA 4YCNA 5IT0A 3WKEA 1RKVA 3U7HB 3DDHA 5AKEA 1FEZA 2HSZA 2YMPA 2RAVA 1Z5GA 3NUQA 1RPZA 2CFTA 3AR7A 5AVZA 2R8XA 4UMVA 4XE5A 2I6XA 1ZD5A 3KDPA 2WF5A 3OCWA 3ZVMA 2DQSA 4NV0A 5FP0A 1QH9A 2FUEA 4FE3A 4NFLA 5ALJA 4E88A 3CZ4A 3RFUA 3NANA 2CN1A 3RF6A 4Y2VA 4Y2UA 4UASA 1VJRA 1EK2A 3ZWKA 4UMEA 4QJBA 4RESA 1YNSA 2PQ0A 4Y2TA 3I28A 2YMMA 5ALZA 5AM0A 4KX5A 4DCCA 1AQ6A 3QXGA 1RKQA 3BA6A 3B8EA 2B1QA 4HGOA 4IG4A 3ZWDA 4IFTA 4BNDB 1RMTA 3QU2A 3QGMA 1ZOLA 4UMFA 3EF1A 5ALPA 2C88A 5ALUA 2R8ZA 3BWVA 1L7PA 5AVSA 2YY6A 2PR7A 4B6JA 1LVHA 2G06A 3QUQA 4Y2PA 2MU2A 4KYTA 1RMQA 2CFSA 4OFZA 3OTQA 5AW8A 5AM2A 3WKAA 2JAOA 3SD7A 4JB3A 1X42A 3QU4A 3UMGA 3PGLA 2WF7A 1NF2A 2P69A 4F72A 3L7YA 1Q92A 3DNPA 4YGYA 4UU1A 2HEGA 2WF6A 2PKEA 2FPSA 2B30A 1RKUA 3FM9A 3QUBA 5AK6A 2JGAA 1J97A 1RDFA 5AK5A 5AVWA 3W5DA 1T5SA 1NRWA 3OCUA 3W5CA 2NO5A 2G0AA 5AIBA 3B9BA 3EPRA 3ZTYA 4L6AA 5AM3A 2HDOA 2I34A 3AR4A 3MC1A 2ZBGA 2C4NA 2FPWA 1U02A 2HO4A 4Y2SA 3IJ5A 2B82A 3B9RA 2MU1A 4Y2YA 2ZXEA 1S2OA 4BYGA 1T9ZA 2FI1A 3SKXA 5ALEA 1F5SA 2B1RA 3S6JA 2YJ4A 1N8NA 3W5AA 2G80A 3ET5A 2FEAA 1Q91A 1YJ5A 3SMVA 4CF3A 2HF2A 1YS9A 2G1AA 1Z5UA 5AKZA 1ZRNA 1Z4LA 4UM7A 4UM5A 5AI5A 2Q4RA 1PW5A 2BDUA 2IOHA 1QQ7A 3ET4A 3QUTA 3PCTA 3NASA 1QQ5A 3ONNA 5ALVA 4UAUA 2VKQA 5AKHA 3SLRA 3E58A 4DWOA 3P96A 3QYPA 4ZEXA 4EX6A 3ZVNA 2WF9A 3KD3A 5AW0A 5AKKA 4QQFA 3N8GA 4H1WA 4Y2RA 3E81A 5ALLA 2HOQA 2ODAA 4EENA 1CQZA 3U7FB 3UM9A 1WZCA 2HHLA 1K1EA 4YIKA 3HLTA 1RLTA 3ZI4A 4NAVA 3KOOA 2JAWA 4MWOA 2I33A 5ALMA 2ZBEA 3ESQA 3L8EA 5AVXA 3MMZA 5IS2A 1RQLA 4BNDA 4PNHA 1ZD2P 4XOUA 1WR8A 1EK1A 4KX3A 3WK4A 3ZTWA 3FVVA 5AW9A 3ZU6A 4HYTA 5ALXA 5AKYA 5ALTA 3L8GA 3J7TA 4NABA 5AW5A 5A3RA 3U7GA 3HYCA
chains in the Genus database with same CATH superfamily
4KGXA 3QBTA 3AJ9A 2B8TA 1WVIA 4GKAA 1T2CA 2P4UA 4F1KA 1BS2A 5ALQA 3P2JA 4G1UC 3PC6A 5HW0A 4ROSA 1OYYA 1K8YB 2CF5A 1ECBA 3ZUPA 4HI0E 2VFAA 3HCCA 2B3TA 1FRZA 2OGSA 1DAFA 4WXRA 3TQIA 5BR4A 3GEEA 5F21A 3K96A 2JG3A 1D2CA 3TTSA 3KVYA 2VJDA 1YS6A 5EKXA 2FJUA 2KJ9A 3RFAA 4KTVE 5LFAA 1U04A 1F2TA 2N75A 3T1OA 2X3UA 5IP5A 3T12A 4OI4A 2VS1A 3R74A 1P81A 3HU2A 2FZVA 4BX0A 3SR4A 1I5RA 1L5HB 2W37A 1OBVA 1XSNA 1PWHA 1XG5A 2QN8A 4PHGA 3T5KA 4B2LA 2QTNA 1ZJ6A 4YFKA 1NZPA 3UHPA 3SIXA 1E2GA 2BZ1A 1YDWA 4GXJA 2AN3A 3SSAA 3T7EA 3U4DA 4X20B 1BXKA 2CY0A 1N5KA 4QTXA 2RB4A 3KB1A 5EJAA 4CL8A 4YWJA 1BSVA 1M6HA 3N0WA 4OQQA 1OFVA 2AEFA 1SK8A 2FWPA 5LDHA 2GCNA 3PL5A 2QZ4A 5IDWA 5A05A 5A02A 4HQNA 4NLCA 5H81A 2H3HA 3DAPA 3QRWA 3D6MA 3N6XA 4OQYA 1ZJZA 1RWVA 2C03A 2VAMA 4MVJM 1VBNA 2C4WA 3SVZA 2OO3A 2JHPA 3P0HA 4JP5A 2CHUA 4WN9B 2VWQA 2XQKA 1RJ9A 4Y0VA 3JQFA 3OLYA 2EH9A 3HYRA 2RGUA 4BLRA 4C1BA 4QHYA 4BPBA 1V8FA 2FSPA 2CLIB 1LDEA 2BFAA 4UTNA 5FPHA 2J3EA 1X7DA 4ILKA 4I2CA 2K4HA 1C8LA 1L5HA 4GG1A 3AFHA 3GXBA 5HBGA 1JR4A 1CSEE 1RHMA 1UPXA 2UVDA 3KZXA 1GSHA 2IYRA 4TXMA 3S99A 3RRFA 4IJ5A 4N3GA 3GFQA 3IO5A 4JXKA 4NJMB 1MTOA 2GAAA 3VYUB 1QG4A 3GRUA 4USAA 3RT9A 1KZ7B 3DVSX 2ONCA 1HSOA 4RU1A 5DG8A 2AT1A 3L01A 4B7UA 4RXMA 2X19A 2NTVA 2FLNA 3AHDA 5AK4A 4JBHA 2B4TO 1H2AS 3HX0A 1U0HC 2A8YA 4C4TA 4FS3A 2Z8YA 4CEJA 2X4IA 3EA5A 3ADOA 5DNWA 4I9HA 3IT1A 3MT0A 1XRJA 3TRFA 4L0QA 5D00A 1K7EB 2XXJA 1EQAA 3CH4B 4BZWA 2DZDA 2XWPA 4KFTA 1L1RA 1LZKA 2E18A 3DMGA 3S44A 3KHKA 1A7AA 1L4YA 2G70A 2IU0A 3I2KA 1S9FA 4PXAA 4WN9A 1JHAA 3QWFA 4MGHA 3MXOA 2AQIA 5CA1A 5CPFA 2W2TA 2VUSA 4PZOA 3EGCA 4JDUA 3LS2A 3CUEF 2K4IA 4M1YA 1Y9DA 3N97B 2FW7A 1UEXC 2IVZA 1G38A 1PHRA 1PHPA 3HMKA 1K9VF 3MD0A 2UZ3A 2OFFA 2RI0A 1ADFA 2IYQA 2F4VB 4NJMA 8ICJA 1DC6A 2XB2A 1AA6A 3KFXA 3E7PA 3ZV4A 4FFWA 5KMGB 1NUPA 5BORA 1U65A 3E05A 3LC0A 4YDQA 1X8JA 1VMIA 4MGYR 1JV2B 2PH5A 4EHAA 4U2FA 1S2OA 4R2HA 1W1IA 1GQOA 2X58A 4HX2A 2G80A 2VQFB 1DC7A 2R8GA 4QXAA 3P9RA 2X22A 4LMPA 4QOFA 3VPHA 4DMMA 1VFNA 4F7WA 3VKGA 1GPUA 4K28A 3LIPA 1SXQA 1LPAB 3M3HA 3V8PA 5KSYA 4EENA 2DUUA 4RV5A 2GPWA 3F5SA 2EZ8A 3PXUA 3PY8A 4Q19A 3CNEA 1JI3A 1ZQTA 3HRDD 2Y6VA 4FUTA 3WK4A 1GOTA 1RYHA 3BPSA 3LA6A 2FZ5A 1SKWA 1EVQA 2VT3A 4ITVA 4DVJA 1MA3A 3TNJA 3ORYA 1N2IA 1KQFA 4XGNA 3EGOA 4D6PA 3N7UA 4YXFA 2PWPA 2EQAA 4DUGA 4AZWA 1NQ5A 1U1CA 4G0VA 2DY0A 4Q82A 4A36A 1L9KA 1ZUHA 3I76A 5KMGA 5HE8A 1B22A 2JGRA 3M5PA 5AM5A 4WT7A 1HWYA 2NYVA 1GIAA 2RLTA 4PZNA 1W6RA 2QRVB 3KVOA 1L5QA 1Q3TA 1PR1A 2X4LA 4L4SA 2QJTA 3GFBA 2PA0A 3V4VB 4DCJA 1PRYA 1WOMA 1P4SA 4JQCA 4HDCA 3IQIX 2YJNA 4RFSB 4EF4A 1L8QA 1E9FA 4RXTA 5DEIA 5H7XA 1U63A 1VHJA 4FYPA 3ZZMA 3QLTA 4IQ8A 4DEZA 1FFEA 1L4UA 2H52A 4A2CA 2W7PA 2XUDA 2CXRA 4R9UC 1XLWA 5EKUA 1B0AA 1SUCA 4N18A 1XVUA 1GUDA 2POQX 4QOHA 5K03A 3RTBA 5EJ8A 3G9QA 1H4SA 1EFAA 1CBUA 1S8OA 1T9DA 1YU6A 1N3IA 1CD5A 1VBKA 2H1OA 2FPLA 4UM9B 4O5CA 1RAGA 2VBGA 3RUFA 3V4FA 1Z8NA 1ONPA 2W2MA 1VXOA 4O4JF 3ZG6A 3ZDRA 4Q15A 5ICSA 2PUVA 5CJPA 3IV7A 2QRVA 3F1KA 1JI7A 3O8DA 3N4MB 1EP1B 3QKUA 4EBBA 2CDAA 2QMQA 4IDQA 3KE9A 4BKMA 4TWBA 3WP1B 5BXQC 2W9BB 3ITKA 4RFSA 2BJWA 3DEJA 4RUCA 5I8WA 1DUSA 5CXSA 3DQPA 3NDJA 3TNLA 1MENA 1MQ8B 2FZEA 1XEWY 1HYHA 1WQ4A 2WJJA 1EX7A 3H2JA 2ZXIA 4UQOA 3OM9A 2A5DA 4CLDA 1Z5WA 4TS9A 3TEMA 1QZUA 4DQLA 3R0QA 2R5FA 1Z16A 4H16A 4FJ0A 1DJMA 2VRCD 5KNLA 4ZARA 5CHYA 1BG6A 5LXTF 3HCWA 2I66A 2W70A 4K6MA 1QH0A 5ILOA 4Y1FA 4BLOA 3AVXA 2G4VA 5BYAA 2XW6A 1UQRA 4IF4A 4RIIA 3R3VA 2X1HA 2PSDA 5H02A 2ZRGA 2BRUC 1BQ4A 3MS7A 1QBKC 1UFOA 2IYLD 2FW0A 2YL2A 1U7UA 3RNOA 1LPPA 3IUEA 1PWZA 1SVMA 4KLIA 3QVVA 3TW0A 3PXEA 4HUQB 4W6QA 2W9BA 3R9IA 2CFSA 1EYZA 3D6UA 1VE7A 1WBBA 1JFLA 4JB3A 2WV9A 4K40A 1NOIA 2L5YA 4KYVA 1TX4B 3FTQA 3AI3A 4E14A 4QJFB 3LQRA 4F7DA 3G02A 2ODWA 1GTJ1 4G0WA 5BN5B 4IIGA 6NULA 1K7SN 2QQFA 3CLSD 2Z3ZA 4Q01A 5CRIA 4MLCA 3EE6A 4D0NA 4LSMA 2OD2A 5FYDA 2QP9X 4XCQA 3ESZA 2IIVA 3UJAA 1BNOA 1DFGA 1CB7A 1N48A 3SMVA 3FIUA 3KJZA 1JZQA 3OD1A 1YZLA 1GR1A 1U0EA 2JEFA 1LH0A 1W1UA 1WDTA 4MEAA 2XE4A 2ETXA 2UDPA 1COWD 1RYYA 2NRXA 1ULTA 5KOHB 3QYPA 2AD1A 2IY8A 1MAVA 1Q21A 2WABA 1MKYA 4BB9A 1ORIA 3L7NA 2VYVA 4IAOA 4LBZA 4DZZA 3VM6A 1U99A 3T5BA 1G7CA 1A1SA 4J9UE 4EJFA 4ES6A 2QT0A 4HUQA 4G1EB 2H1CA 1UBCA 1D2NA 4WZAE 4DMCA 1RQ7A 2XT6A 1IAQA 1ND5A 4J29A 4X85A 1DAGA 1LVGA 3RWMB 1NZJA 3GLTA 1ZR2A 1PQPA 2FF5A 1UQUA 1FRNA 2P75A 4B3IA 4DIEA 4O3FA 1UDBA 4UVGA 1AO3A 1J2NA 3RC7A 1J99A 1GGFA 5BN5A 3VAAA 1ZL2A 2P35A 3QE2A 1L7MA 3GAAA 3K72B 2WHRA 1YH3A 4J9VA 5B1HA 2PMDA 4G07A 1SM4A 4AKSA 4V3BA 2OZKA 3JSXA 4D9GA 4QOSA 3M5CA 4KITB 2IHJA 5IPFA 5JAPA 1T24A 2FPOA 2B4AA 3F2BA 4YJ2B 1XDUA 2DPIA 1RPJA 2HGZA 3UMRA 1IFXA 1NNLA 2JIMA 3C1OA 2HM7A 3VDRA 1AV7A 4H6WA 2KG5A 1V43A 3ETGA 1QO9A 3FDXA 4GECA 4DM4A 1FW8A 3QQ5A 2E3TA 4NLGA 2BFOA 2DX7A 2OCAA 2YNMA 4QQRA 1N6NA 4QUDA 1E2NA 3QW4B 1UDWA 2Q3FA 3HDJA 2ZB2A 1GG5A 4DJJA 2QNBA 4PIVA 1I6LA 2XQJA 3VR5D 3KC2A 1S2GA 3ZUGA 1SB3C 4IPTA 3S2EA 3GWZA 4BKRA 2HHSA 3OFND 4IIUA 2GJ4A 4KLMA 3AY7A 2R6ZA 3HR7A 3CVUA 4PG4A 4EMUA 2Q50A 4EOGA 3OUUA 4TT3D 5K09A 3FWPA 4F9FA 5EOVA 1WU8A 1TKBA 4PFJA 4EZBA 3RBVA 4AJLA 3ULKA 3LCRA 2J5XA 3N0TA 3W34A 3EULA 2DWCA 2WI8A 4I2NA 1URPA 3HJBA 3KWMA 4LMRA 2EG9A 3GJXC 4OHOA 1YFJA 4CNBA 5HK9A 4B34A 4FLMA 1J8QA 3IVMA 3WB2A 2Y27A 3I62A 4YJ2A 3EQZA 3SAHA 3OY7A 1P7YA 4WH0A 2VK8A 3ZU4A 2O4UX 5H4HA 3QUCA 1L2TA 2ATXA 1QCKA 1L4BA 2DPXA 1OV4A 4EAAA 5AVTA 2EKPA 1DIOB 5K0TA 4JT2A 3L8CA 2Y4OA 4A4DA 4WESB 3M34A 5J2TB 3DBHB 3L4BA 3OQMA 1EPUA 1O96B 3L8DA 3F67A 4C4RA 4PSUA 1Q46A 4TN1A 4D79A 1ZGBA 4ZYVA 4NE2A 1MW8X 4I4LA 4MV7A 1VL2A 2VJYA 3Q7SA 2VJ4A 2ORYA 4HY3A 1FW6A 1EVKA 5F9MA 2OZEA 4TQUS 3UEOA 3MOSA 1N6PA 1NXVA 3WO0A 3PQ3A 1QH9A 3OLZA 2Z1NA 1R3UA 5DTRA 5DZSA 5FBKA 5K6AA 3VUEA 2EIHA 3UENA 1IXSB 2XY5A 4EY8A 1L7QA 1GO3F 3UV3A 3G2JA 2HR1A 5GGXA 4MPJA 3ONWA 5B6JA 3AFMA 3X2FA 1RWXA 1Z5VA 1TL7C 4X92A 3QZ7A 3C6YA 4BFSA 4CEHB 1N1DA 2EFGA 3KK0A 3PMNA 3BF7A 4I81A 4B6JA 4C08A 4Q9DA 1JDUA 4GE3A 1YC5A 2QXYA 4JQOA 5DB8A 3FUUA 4BKUA 1C80A 1R0XA 1NKSA 3E7XA 3N2LA 4RY9A 1FQJA 3GFGA 3QEMB 5E9WA 1C3VA 1L7DA 3ZHUA 5J2TA 2X8WA 3DBHA 3KXIA 1O96A 1SVSA 1SXEA 3AVYA 1J70A 2Z8XA 2XJ9A 3KKLA 1B42A 2J3KA 1J9GA 2WWYA 3DQQA 3EZ2A 3N0XA 2ZDQA 3S29A 4B3DA 3O21A 4EUHA 2YVKA 5I7HA 4R7TA 1XJCA 1DJNA 2BISA 1RXIA 2EVWX 2SKCA 3BXEA 1BDIA 1FNMA 2NTYC 3IR5A 4WMLA 2WUEA 2XH8A 3TFWA 1TFUA 4LWZA 1QZXA 3O31A 3OVMA 4JKIA 1R00A 4CEHA 4QOGA 1GA4A 2A5FA 5AW9A 2LIPA 3UTDA 2XY4A 3RJGA 3DONA 2YOHA 3R3WA 1VCNA 4QASA 3SQNA 4RQ8A 2ZIUB 1ZSNA 1QP8A 3A05A 2VA2A 5C5CA 1QO0A 2Q0QA 3C3JA 4C05A 4MZDA 4MUNA 3O8OB 2NSLA 3RF7A 3NOXA 5F9LA 2HHTA 4I46A 2Q5JA 3TTUA 3OCYA 4ASUA 2IZZA 4HDKB 2NO7A 3MINB 4YACA 4UD2A 3VH3A 4RSHA 4QNRA 3LZ6A 2A4MA 3TQSA 2QUJA 5CLIA 3AUKA 2JRCA 5KZMB 4E2XA 4KDCA 1U0FA 4OLBA 4PHDA 1IC6A 3PW2A 3L0CA 2C42A 4DCOA 3JVDA 4YAWA 4R2MA 1WWVA 4UB1A 4H6VA 2YXDA 2Y9UA 3HNOA 1ZQ1C 2QLMA 2PMZF 5AW4A 1OI2A 2PMEA 3NWPA 2V54A 5E4FA 4F56A 2A1TS 4CXMA 1TTTA 1YIOA 3JQBA 2P2GA 2LI6A 1CR0A 5BMVF 1GPLA 3UMSA 5EC8A 2FPXA 2EGGA 3JD3A 4DMHA 7ICOA 2Y1WA 1QKJA 1M1YE 4QUEA 4JBIA 4UB8U 4OHXA 3MS4A 4YWHA 1XRRA 3M6LA 1W59A 2A3VA 3GIJA 4IQTA 4HYKA 4RA9A 3O7MA 4R54A 4EF5A 1GD1O 3WAGA 3SVTA 1CRZA 1XMVA 5ESXA 3ROTA 3O8OA 3P94A 3M6AA 5D5HA 4DBVO 4TMWA 3EZGA 3LY9A 1Y1RA 2QXUA 1S5PA 5GAJA 2AR0A 5A3SA 3HJHA 1CYDA 1E6MA 2G1PA 4GOXA 4ML3A 1RE0A 4EKNB 1P2UA 2GD6A 5EXXA 5K3CA 3QP9A 1JJFA 2B37A 4AUEA 1TCUA 2PJZA 3ONVA 3ZVRA 2B4YA 1YC2A 4MVJP 5DI3B 2DPMA 2GYVA 1T5TA 2R66A 3PR2B 2IT1A 4ZHSA 4UVDA 2QYSA 1S97A 4Y2HA 9ICWA 3KQWA 3IP6A 5E38A 2ZSUA 4P3YA 2R6R1 1ZM9A 4IW3B 2BGIA 1XTVA 2WKWA 3QLVC 5ARCA 1GHTA 1IJBA 1SCBA 3OZ7A 3ECSA 4NXZA 2IH4A 3TLCA 3PI6A 4JI7B 4LIPD 4OJMX 3B0XA 2HNBA 2DFVA 4AMGA 4DR7B 4PTZA 5C5IA 4JBGA 1R15A 4HFNA 2VTKA 1KSFX 4FR2A 4MVJI 4PPFA 4V39A 4MKFA 4OMCA 5DCLA 3ZYZA 2IRWA 5IM4F 2WF5A 1C7EA 5IVIA 1P4JA 1NWCA 4KR2A 3QVTA 5IJXA 4B6QA 1XZNA 4E2ZA 4EJ0A 3MYYA 5ESRA 5ALZA 3BA6A 1AKNA 4EY6A 2IXFA 1EWRA 3B12A 1Q7GA 1WV0A 3UHJA 1FLNA 2BLLA 3BWVA 4NYMQ 3QEKA 4PXYA 2GCOB 3RFXA 4G8BA 3LQQA 2X0DA 4KYTA 2JC3A 5AM2A 1ZK1A 2IYUA 4BJ1A 4KMSA 1RKUA 4P22A 3TOSA 4K9QA 3HB1A 1QRTA 2G0AA 1KKLA 2ETVA 1TIKA 4EG8A 2QN2A 1T9GR 3N3BC 4IHJB 3SKXA 3IHWA 2IH5A 4O4LB 1E79A 3N6VA 4RDIA 2NGRA 5EHQA 4UM5A 2VBIA 2BFFB 5B1EA 4UC0A 2C5BA 3RUEA 3I8OA 2VQ6A 3ND7A 3LXXA 1E3EA 3ONNA 3GRKA 3QJYA 3HR4A 2R47A 3QMWA 4NLLA 4PPQA 3OFVA 4ZEXA 1C8VB 2C1XA 1VLBA 2DBVO 2FXVA 4RPGA 2P0YA 4QYIB 4OLHA 1DFIA 2X2PA 2I2AA 3TLZA 3FUXA 1WSWA 3GCXA 4MJXA 2GCOA 4LX8A 4OMUA 2HBJA 4DCUA 2D59A 3EVGA 4CUJA 3KPVA 3ZIUA 4AN0A 2PLWA 3MIIA 5BSTA 1A50B 4JS0A 4F5NA 2ES4A 3ZZ0A 3SX4A 1NMZA 4J3JA 1EJ6A 1EUDB 1W6UA 2LPMA 2XTNA 4XAQA 2VDMB 2BL4A 3N1UA 4ZICA 5CB4B 3GA7A 1SU6A 4IHJA 3KQOA 2X86A 2H5IA 3CIOA 5KSPA 2CEAA 1ORTA 4FONA 4O4LA 1GCGA 2HK6A 4ARBA 5EP3A 4BAUA 2AE1A 4F12A 2AG0A 2BFFA 1ZRMA 3DCIA 2YHUA 3WVNA 3UXPA 2VOEA 2XCOA 2ENWA 5F1YA 2M2IA 3UAWA 2I7TA 1BH6A 2RGNC 4QYIA 2QTGA 1SXPA 1J0XO 4G2TA 4GI1A 4IHKA 2Z5VA 2XIQA 4YAJA 4DY6A 4E70A 4D4GA 1G5TA 1QHSA 4AY5A 1Y3IA 3I9NA 2NYRA 1G1MA 1XT6A 3DBLA 2OV6A 2VK4A 3K0HA 1VGVA 1MO6A 5IKEA 2QAIA 4IQUA 2Z43A 3KR2A 1FJGB 2XE8A 3VX4A 4HNUA 2WF8A 2IYPA 1JFTA 2R87A 2AJQA 1EUDA 5JC1A 2GK7A 2ECKA 2FLVA 1VHTA 1TYAE 4LMAA 5CB4A 2HA7A 3RYHB 2EJTA 1CP3A 4ZT3A 1PZNA 2I3ZA 1CY4A 1QG2A 3IDQA 4RMNA 3NRJA 5B4TA 2ON6A 1A8SA 3LHIA 4AN4A 4D46A 1TU3A 2ZR0A 2OZLB 3QNMA 1QLWA 1OH8A 5DGAA 3CKLA 4BGEA 2JFGA 1CY2A 1LPNA 4YQWA 5H3HA 2WG0A 3QX3A 4F96A 4K87A 2J0SA 1YNOA 3F2DA 4DOAA 4H59A 2FLWA 2QN6A 4BUGA 2C0QA 2IH2A 2QLNA 3WC4A 5HZGA 4C21A 1NTOA 3QVLA 5KYWB 3D9QX 2AC7A 3FF1A 2DERA 2XRFA 4ZDWA 3PSIA 2BGRA 2QJRA 3ABIA 5L3SB 2F8LA 5K4GA 3BRSA 5B64A 5ADWA 1IBSA 4L27A 4PSKA 3U49A 1YQ9A 1O6BA 3O84A 3IVCA 4LYDA 4DEVA 1JG3A 4K6OA 1KEEB 1UBOS 4EG7A 1MABB 4DQXA 2PLFA 3PR5B 3RYHA 5EQDA 4B4VA 5CYPA 1XQWA 3AQ4A 4CCWA 1R5JA 2C1EA 3AEVA 3FCOA 3HWSA 1G18A 2EBFX 5C31A 1MX3A 4EO9A 5LYJF 5C51B 3LKDA 2OZLA 3HVUA 4V1CB 2F3UA 1OMOA 5H8WA 4U7CA 2C0CA 1KEJA 1RW4A 3OX2A 3G0GA 5KG5A 1NC1A 1SG0A 1EM6A 1U94A 4QZHA 2X5NA 4NBUA 5CB6A 1R5BA 3SNKA 1WHSA 1HYBA 5KYWA 3KXLA 1JMSA 1JTFA 1XK6A 3VV3A 3WJ1A 3B9BA 5JUMA 1G2PA 5EP1A 4YQEA 3UYLA 1CEEA 8ICHA 2OPBA 5ED4A 4PVDA 4HF7A 4ZYLA 4HDMB 1CDEA 4LGCA 4YQFA 3AM5A 3TD9A 1RXUA 3MUEA 3TUIC 4KPYA 3RW9A 2VJQA 5JALA 5BSVA 2NU6B 1KEEA 4CEIA 1MABA 3K73O 2A84A 3SK0A 3HJCA 1N7HA 1JLKA 2I22A 1ESCA 1X9GA 2I4MA 4IGIA 5BWMA 2HWXA 2O3RA 4I8XA 2OV4A 2PI4A 1ENOA 5ES3A 1IUPA 2LDBA 3U7QA 4V1CA 5CITA 2SNIE 5FOSA 4YMNA 1KETA 2FMUA 2BYTA 3GA5A 2VVTA 4BUJA 2W0MA 4X90A 3EIUA 4HB3A 4ZGBA 3HY4A 4WCFB 4ZI7B 1QLNA 4OB6A 3EVCA 4UVEA 1YB7A 1V97A 1LBHA 2O2EA 4KMUA 3BTVA 3WHIA 4MULA 4AF7A 3DEKA 1WLSA 1P8AA 3AT1A 3FR8A 2WJVA 1HE4A 1L5WA 4KXXA 4MV8A 5MDHA 3R3SA 3U13A 1X2IA 3GH3A 2ADFA 5EIFA 4HDMA 3VHRA 4KO2S 4ZQHA 5JD4A 2W8BB 1MZPA 2BCRA 2Q49A 5EPEA 1ZQZA 1A9PA 1KH1A 2VHQA 3ASZA 2I55A 2QGZA 2NU6A 3HFJA 3H2ZA 1LLDA 1S4MA 4RMHA 2AZXA 1ZQFA 3TIFA 4BFCA 2CB9A 4BO8A 1E6WA 3E8SA 1G7TA 1X7YA 1XVIA 5CWRA 3GEMA 2OB2A 1IH8A 4ZCQA 1CR2A 1EUQA 1U2GA 1II9A 4F71A 1BO6A 1IPFA 3LPDA 2Z8YM 1FS5A 4YPVA 5DM0A 1A8UA 2ZRLA 3AF1A 2R60A 4K0RA 3PW4A 2OD7A 4ZI7A 4OPMA 1IM5A 4QE3A 4D44A 4DQSA 2K4EA 3JD4A 1YHNA 1GJRA 5TT1A 3VPGA 2JPDA 4LFAB 4EB8A 1HORA 5HEKA 1Z36A 4ZT6A 4ELVA 5JNSA 4EGQA 3BX1A 1IVSA 1JIUA 3KT3A 1LSJA 4UARA 4MICA 1FF9A 2VA3A 2AYZA 4P2BA 4IR9A 1T9HA 4UHKA 3E1SA 1U4SA 1W5SA 1SU4A 3A4NA 5AM4A 1PJSA 1W25A 1YD7A 4GOLD 2IW1A 1XKXA 2W8BA 3E23A 1GITA 5JISA 3WK7A 1F2UA 5DYTA 3K1RB 1TAHA 4TTRA 2GZRA 4ALJA 1IN8A 3COYA 3IQWA 5EEHA 1Q0UA 2HJ9A 3FB1A 5J2JA 4QTYA 3MTJA 4U63A 4TSFD 2CLKB 2N1BA 1RRKA 2HPVA 4OV6B 1GL6A 5BRAA 2E5LB 3EQ2A 4N12A 3U4GA 3HVIA 4MV9A 2JCGA 1TYZA 4G1BA 2DLDA 4JODA 2MDTA 5K4LA 4CCAA 3A3YA 4DXDA 4MARA 4OQNA 4K46A 3LRPA 1FXUA 1N2OA 1Z4NA 1Y6RA 2Y0PA 5H83A 3GRZA 1E4VA 4PN3A 3GAMA 2QVXX 1E99A 3QEAZ 3PNLA 5ALHA 2D6FA 1XTUA 1IHOA 3RUIA 3AF0A 3IEPA 5CLQA 2NQ8A 4YAUA 5IRCD 1TI7A 2I6XA 4FSHA 5FP0A 3E9NA 4TXNA 4HX5A 4Y2VA 4GQAA 2XDQB 5F2EA 4XW2A 3WYBA 4Z2YA 1YQWA 1QU2A 1QXSA 5CVVA 2I76A 1KL9A 4IFTA 2VNAA 2HQ1A 4JSYA 4NLBA 4MAAA 2J3QA 4ZOQI 3PQCA 4JCCA 1I3OA 1WB4A 1FBTA 1X77A 3CGWA 1AT1A 2H8GA 1G9SA 3OG9A 4RENA 3LUBA 2OOKA 2V0NA 4FWTA 1TUBB 1BWQA 3UMGA 2SECE 4IXTA 1NUSA 3H8JA 2V45A 4KLLA 3BWBA 3TTTA 1LBEA 5DTIA 1W30A 5BT9A 4PYMA 2VO1A 1B4FA 4XB6B 13PKA 3K9WA 5CLFA 2XTZA 4G4SO 3GRPA 3RB4A 1NF8A 1W47A 5KQPA 1P2SA 1YZHA 1XELA 2ZJ3A 4AYBC 4C4XA 2YV3A 5FUBA 2CVPA 2NU7A 1FDIA 3OH8A 3STVA 1EDOA 3ORFA 4YDHB 2J1LA 5EP4A 3BWEA 3R5FA 1ZHHA 5EMNA 4ER3A 4LUCA 4ED6A 5AKKA 3D3EA 3BCUA 3CVJA 3TACB 2XDQA 4HEHA 4B48A 4QOEA 5CFPA 3JWJA 4L9WA 1EXVA 4O3RA 2ICAA 2JAWA 1X40A 1OROA 3W3AH 2BHSA 1E0AA 2QTAA 1II0A 3MJ4A 4M1OA 3KVRA 3AJAA 4JYAB 1JDBC 3ICPA 2VDLB 2O6LA 2P0AA 1TUIA 3HYCA 3L6CA 1G66A 2H3EA 4Z49A 1Q3VA 4I99A 1PK1B 1OIXA 4RQUA 4YHHB 3KU1A 2B0CA 2C7RA 4B8WA 3MXTA 4OD0A 4R2WA 1G19A 3OQNA 1I2CA 1G1AA 5EVJA 3JZMA 2BE7A 2P9ZA 3WLHA 4DA9A 5FIUA 4L78A 4JHXA 1Y5RA 4EVIA 2R6CA 3FVQA 4EBCA 4YCMA 2HJWA 3TVYA 1PT8A 2G6TA 1DRGA 3QWBA 2D13A 3PLNA 4S04A 3BQ0A 3TZHA 5B1YA 4ZOLB 4WEQA 2GERA 3DBRA 4UUAA 1IMJA 3DZCA 3AOEA 3BKWA 3W6OA 1C9EA 1YSCA 5JRZA 2NPOA 3GV0A 4GR5A 3LW7A 3BXOA 2C4HA 2JH1A 1ZGJA 2ROQA 3P9QA 4DRZA 3SWWA 1FOEB 3CA8A 2COEA 3VNRA 1ZQRA 1PK1A 5KEIA 3DLTA 5F4ZA 1R3DA 4JYBA 4MUJA 3T3PB 3OESA 1ZOIA 3K94A 3Q40A 1SVNA 4F3TA 3EMDA 1T35A 4QDUA 2ZRHA 2VLBA 1H6CA 2B78A 3LPAA 2IYAA 3SNHA 5DB9A 2VNHA 2GFHA 4LZAA 2YFHA 1DWOA 4I5EA 3LTNC 3LIIA 1MB3A 3TTXA 1MORA 2A9OA 5AYVA 3P52A 4NPAA 3A6EA 2KPOA 2PSHA 1Q3HA 2XVAA 3ZW8A 3NJ4A 2KJ8A 4LOHA 1F6WA 2XLCA 1L7RA 1XCLA 2AFVA 4HNVA 2C83A 2JBHA 4ZOLA 1GPYA 4N0PA 1PTJC 4A0SA 1HT1E 1PK9A 4LZGA 3VPCA 1D9FA 4CTJA 5SYMA 2F8MA 1QWOA 4EIWA 3TQ1A 3KV1A 1TPYA 3WRXC 1D4ZA 4DCGA 2ACWA 4D9MA 3X1DA 2Z57A 2WJ3A 2EIXA 3WKCA 5KNCD 3I8XA 2QAGB 2ZKIA 3O26A 3RVNA 4FMCB 4FO6A 2E89A 5DLPA 2IUYA 1ODCA 1E1MA 4K9MA 1BH2A 4F5PA 3P9PA 2WKRA 2XMPA 2QZJA 5IH3A 2EKZA 4HAOA 1YUMA 2HHJA 1VJGA 3NVYA 3PVXA 3TARA 3VPDA 5FUYA 1ZJWA 4F5RA 4JYCA 4O1HA 2CVOA 2PK3A 3PMLA 4II3A 4DIKA 5KCMA 5ARBA 3O3OB 1CNFA 1RBZA 2E4AA 3NVMB 4F46A 5SV2A 3OD5A 3P9ZA 4PSVA 1C7YA 5CA0F 4WVFA 5KAFU 1QSSA 1A9YA 1WMEA 4M49A 1V3TA 3S1SA 5BSHA 2RH8A 1KH3A 3TZEA 1X7XB 4F72A 4LC0A 3A1TA 2E3JA 3WP0A 4YYEA 1KOLA 4O6VA 1HLDA 3BIJA 3NHWA 4CR6A 3DMHA 5LQMA 2WKQA 2YJZA 1KR5A 3LK7A 1A5ZA 3MWYW 4LGVA 1A4RA 1K27A 1QDLB 4Y7CA 2QAGA 4NAHA 3EJWA 4WNYA 4C4OA 1Z5NA 5J0XA 4V0SA 1DCFA 2K4MA 3TIVA 5EMLA 3Q6NA 1ZWLA 4AB1A 4RFVA 1QQ7A 5K0LA 1Z7GA 2FKAA 5K99A 4JWNA 4I6JA 1TUGA 1JQKA 4CKZA 5FBLB 1ZQSA 1TU0A 3O94A 4OK6A 3PEEA 2M6RA 2F1JA 1K2WA 4EA7A 1A72A 1PYOA 4BNYA 5JXWA 4HMQA 1JB1A 1UPFA 4FYWA 1U48A 3IV9A 1DV2A 3LLSA 5E95A 4NMXB 4EABA 4Q93A 2C29D 2V4RA 2FCRA 1JYSA 3EGVA 1O58A 3LCUA 1KYXA 2J9GA 5BV7A 1WS6A 3KELA 1KVQA 1MO5A 4NLNA 4LN1A 1X7XA 4PHHA 3ZWVA 4H08A 1Q0PA 4ITUA 1CV2A 1MJHA 4DQQA 2IXTA 5A0VA 1II8B 4PFKA 3K0EA 1YVUA 3DE5X 2OXRA 1VKZA 4E46A 2HIGA 4P7JA 3A4IA 1KGDA 1P29A 4R6WA 5DDYA 3JWHA 1SKSA 2EFEB 2FZ4A 3D0OA 3LNCA 1USUA 1A6SA 2AFRA 4QZDA 4ZAVA 1WP9A 3MUOA 5K8TA 2IXBA 3NHMA 1ZP6A 3QITA 5JS1A 4R2LA 1CDOA 4ZCSA 5FTMA 4X3OA 2FX2A 1ADGA 1Z4JA 2F8TA 1TTQB 4Z6DA 3GZTB 1NU6A 3C6QA 3BXZA 1D3AA 3R23A 3S3TA 3V6LA 4X20A 4YX9A 3KLNA 2RG7A 4XJTA 1B93A 3EB9A 4JUDX 4GXKA 4M9HA 5FL7A 3T38A 2NYAA 1FVOA 2IXGA 2JK1A 3M1YA 2VZLA 1YR7A 2KMDA 2R65A 4AUMA 2FX5A 4HYEA 4QWAA 2WWWA 5DBGA 1XEWX 4R8LA 3IXLA 1R9MA 2VI5A 1K4KA 4A3SA 2AJTA 4CLOB 1II8A 3OX3A 2BPOA 4CKYA 1PKXA 3B36A 1JZTA 3I04A 5J2KA 3E82A 3LOQA 3WLSA 3MWEB 3RDPA 1U0SY 5ER9A 3IAAA 1Q5PA 4RTRA 3O8NA 1CUIA 2DTDA 2PT7A 2Z5LA 2WHEA 7ICMA 2FR0A 3D6FA 3JXEA 1HDEA 4CWAA 4J43A 4NCNA 1SC6A 3A0RB 3GUUA 2CCGA 3WK8A 2NUAB 4B71A 3VDXA 1HUOA 4IJ6A 1VA4A 4MMZB 5IC5A 3O2QB 4IOKA 4BMOB 4ELTA 2H7VA 1NPYA 2GHQA 4EKIA 3VBCA 3X43A 2AXTU 5E7IA 4I50B 4INJA 4RHCA 1Y8ZA 1MC8A 4IQVA 3PW0A 1NW6A 2LYAA 1Z26A 4RNMA 2J7PD 2RCNA 3T3DA 1D8BA 5BSKA 4E3WA 3PFGA 4ZU1X 4GWKA 4UE2A 4FGJA 4CLOA 4LPKA 3UAZA 4RZSA 4Y0NA 4TRMA 5AVZA 2HT1A 2FSIA 2RDIA 3H5TA 1OT5A 4JLDA 3HJFA 3MWEA 3WLEA 3QUAA 3G2HA 2P2NA 4EYSA 3DFIA 2NAPA 3LC7O 2RQ5A 4EB0A 3FNHA 2Y0SF 3RV4A 1BEUB 4OREX 1XZBA 1LSOA 1T1RA 4LHYA 2DY1A 2NUAA 4CJXA 1Z6TA 2XXBA 4RPLA 4V0NA 3I4FA 1L8XA 4YO8A 3U3ZA 2YIDA 4LQDA 4QVIA 2VG8A 5DHUA 1CVLA 2Z2IA 2P69A 2PTHA 2HA3A 1Q92A 4FMPA 1UH5A 5JJCA 4KQEA 3GCGA 1WQ3A 2JGAA 3UAXA 3F2IA 4RDCA 5KFVA 1L5SA 3PSAA 4LGMA 4ECWA 1LVUA 4UHDA 4F38A 2JV3A 2MIIA 4I50A 1I6WA 1NSYA 4OOFA 3OZTA 5DX8A 3JZFA 1OQAA 2LDXA 1K06A 3SEIA 2YYZA 3OT1B 1SPBS 3IX7A 2BKXA 2BCGY 5HDBB 3M2TA 5CA7A 2M1XA 2I8LA 2FWNA 1JMKC 4N7MA 2VR1A 4LE2A 1BD4A 2NTEA 1OASA 1AGRA 4B31A 3UJCA 3BGWA 1UBEA 1WZNA 4EDHA 3O6VA 1DIBA 1IK6A 3HB0A 1Q2XA 2HHXA 4L0DA 3H2YA 4AKGA 2ZUEA 9ICCA 2C9DA 3G9UA 4I4TB 1HYGA 2ZOSA 4YAFA 4RCYA 3PE3A 4OJQA 2MUTB 4RHYA 1RPLA 4EL0A 1RWWA 1NXPA 4CYMA 2OHXA 1G6KA 4RTOA 4WK6A 4W5NA 3V8EA 3VYRB 4RJKA 3CVXA 1NBIA 1T15A 4C0JA 2ZP1A 1KJQA 1V35A 2G82A 3R8XA 4XWYA 5HJ2A 1VCOA 3HB7A 3OE1A 1E5XA 2VP2A 4F5EA 4S1WA 1ACMA 4BQQA 1WXIA 3OT1A 1QIMA 2ZUUA 3QXJA 2GM9A 4U3JB 1E5TA 2V7XA 5FO1A 2VSQA 3M81A 3U4IA 1Z73A 2H54A 1UBGA 1YQUA 3GN1A 4C4SA 1MN8A 1CNMA 3BQ1A 2JCYA 1ZN7A 3AUJB 2MCFA 1SIUA 4FZRA 5KFAA 2NSHA 1CF4A 3M70A 5KDDA 3FYDA 3DR5A 1QP7A 3HJUA 4KXYA 1C4XA 1KL7A 1H1TA 2WAQC 2JRZA 1SCIA 2XODA 3DW1X 3GJ0A 4J16C 2VJMB 3LDUA 1OW3B 4KWTA 3EDCA 2H7YA 3PDWA 4I4TA 2ISSD 3R20A 2GDZA 3CE6A 4JWKA 4C04A 1YV9A 2MUTA 4PLPA 1QHGA 2B3DA 4XYEA 1P0IA 1T13A 3ECCA 2PZFA 4NQRA 1JDJA 2ZR8A 4BEJA 3KXKA 4V0ME 5KCZA 2VQEB 4M60A 3TVTA 4CQLB 4OGFA 3BG5A 4OQEA 2PUJA 3H0KA 4H18A 1VG9B 2A57A 4U3JA 1LK0A 5BQ3A 1ZC4A 2VNJA 3UWMA 1KAHA 4F3RA 1DRWA 4UAJA 4I1RA 3LUGA 4FINA 1QH1B 3GJYA 5L6LB 3RADC 1U2DC 4DDTA 1HFEL 1PUIA 1QF7A 4NM2A 1X74A 3O4HA 4QXQA 3MTDA 8LDHA 1R0CA 2JA2A 5HIKA 3A2NA 4DQ0A 1KI8A 4F2DA 4U4AA 2VJMA 4J75A 5F3XB 3D5TA 1ZVMA 1C4KA 2OHHA 1YRWA 1SUPA 4Z6EA 4YJHB 4HQRA 1OF1A 3DD5A 5A1JA 4Y6OA 1V9LA 4LKRA 2GKOA 2VDVE 3GPLA 2HXGA 1F8XA 4FFRA 4YAOA 1RCUA 4LZOA 2AQ8A 1J8VA 3OSUA 4QQNA 4NFLA 4CQLA 4IQWA 1C7IA 4JVLA 1O5IA 2DSTA 2WE8A 3AUXA 1YNSA 1NDUA 4ZCLA 1TVAA 2B1QA 2F1OA 3H99A 4MV6A 4GO1A 3B3QA 1IUNA 5DI9A 1P2FA 1IEQA 4MPPA 2E5WA 2F4NA 5T6MA 1V6CA 1QH1A 1XDGA 2DBRA 3E9QA 4M9XA 4G0OA 1H38A 3ZDXB 2VYQA 2C77A 1RRPA 3NYQA 2HL6A 3SAFA 1SB9A 1SXIA 4KDFA 1X0XA 4JOCA 1U9CA 1VIMA 1VOTA 5HNKA 3LWMA 2PWAA 5JCOC 2EFYA 3TSCA 1USGA 2EX4A 1QMGA 4EMSA 3VVBA 5LA6F 3DLPX 1N1EA 2JIBA 4YJHA 4Z8XA 2ZIXB 4S1PA 3L18A 1JBKA 4O5KA 5B30A 3EH2A 1MAUA 3MAGA 1VDMA 1EESA 5KOHA 3CNOA 4DJ5X 3BHMA 1NW7A 5T67A 2R86A 3RIHA 4OQMA 4PQYA 4JL5A 1EDBA 4B3BA 4RLQA 2G3YA 2ONYA 1GV0A 2H2AA 4OQFA 1DAOA 4RQTA 5IX8A 5ALLA 2VN8A 2ID8A 3E15A 3HSSA 4X44A 1RIIA 1XP8A 4EJMA 4OEHA 2HFKA 4U0KA 3EPLA 8ICOA 3U4QB 1U28C 4J7CA 1CZLA 3ROQA 2QVCA 5AW5A 1JHDA 3B1YA 3AOGA 4ZVPA 3IC5A 1N2CB 4P3XA 1EG7A 1E9DA 5EL0A 3A6LA 3B48A 1HZJA 4TYNA 3WBKA 4F21A 2ZQZA 1SZHA 1I5EA 2Y71A 1V7ZA 2ZSKA 4EK9A 1COOA 4WNAB 2CUZA 4UNIA 3NJ8A 4QX6A 4KK4A 3AK4A 5L7YA 5FI3A 2ZIXA 3WMFA 1JDVA 3D5EA 3AR9A 4PU0A 4RIHA 2QKQA 1YIAA 4MUYA 5GM2A 3COPA 2R6JA 4JC4A 2J59A 1VB5A 3I9OA 1W87A 3NVZA 4TROA 2P30A 4I55F 1ZQKA 3OMLA 5MN5A 2W6QA 5AM1A 3ZY2A 3FCEA 3KLMX 4CMKA 3UMCA 2B35A 3JYNA 4QDTA 4YDSA 2YMLA 3QFSA 2ECOA 1MIHA 1M0TA 4EX7A 4JV2A 1ZESA 3V6JA 4RYLA 4LCJA 4FB5A 3U4QA 1XLUA 2H00A 4KI0A 1XPJA 2ZAIA 1X19A 3OFKA 1WMFA 1N2CA 3H4DA 1NKCA 3EGDB 1L6RA 3OZXA 4U2BA 3T3NA 4HDNB 2XNDD 3KALA 4TL8A 3AL0B 3HCNA 3UCFA 3FWKA 3O3NB 2VDUE 4WNAA 4BQSA 3AHGA 3ZLTA 1XRSB 4F4JA 3GPIA 2B7LA 3A1SA 4I2BA 2J8ZA 4JEMA 1EXMA 3DCJA 3UGTA 2PX2A 4GWLA 2I0FA 2YH2A 3WMXA 3GFVA 2ECQA 1FUUA 2BMFA 2N46A 1QORA 5IAOA 4INPA 3MILA 5F51A 1P1JA 3VYVA 2RKBA 1MRZA 4PN7A 2HH9A 3ZV6A 4N7RA 5IUNC 3BQMB 1MLDA 4WESA 3T4UA 4AZSA 1SURA 4MP8A 1M7BA 1USIA 4G9BA 5G4KB 2XMBA 3SF0A 3EGDA 2MOKA 3E5RA 1WUYA 4DEYA 1K8QA 3DKKA 3T79A 5JY6A 3U7HB 1N6RA 1GQ2A 4NBLA 5C35A 3ZVMA 5A62A 1E58A 4OFWA 4ND7A 4CMEC 2CJPA 4F3CA 1BKYA 5ULLA 4QT4A 4QJBA 3PFNA 1H66A 1IIBA 2CLDX 5JAZA 3PVCA 1G42A 1NKBA 3G2IA 1V1JA 2ZWAA 4JOQA 4J9PA 4BNDB 4F4XA 1M2WA 2WVJA 4GMGA 4RHEA 5EUQB 5ALUA 1JT9A 4L75A 1IN1A 4MRAA 5K4HA 4US2R 4RKQA 3P9IA 1BKDR 2W83A 3FA2A 5FOXA 4MWSA 3QEMA 5FOQA 4G65A 3W9BA 3OO1A 1WB6A 2P6OA 1DC3A 3F7TA 5TJ9A 4EEZA 5AM3A 1ZJ4A 5CFNA 3DH0A 5DYIA 4JLKA 1VP9A 5G4KA 1BC5A 4BC0A 3OU6A 1BDHA 5EUMA 2WICA 3G9TA 3HA3A 2HF8A 4B4UA 2B7CA 4ELUA 4JUFA 3C4QA 2IYNA 1A76A 1HQCA 3D3NA 2BGGA 2BPCA 4M1QA 4JB0A 2O57A 1V5IA 4Z9FA 5CPBA 1HSZA 1H8HA 3UY4A 3WNQA 1ZVJA 4ZYYA 2EV9A 1YGPA 2WIFA 4BBPA 5DIZA 1XNJA 4V0OA 5DW0A 1OHHD 1K1EA 3IDOA 1R0LA 4IRCA 1ZRSA 1QRSA 2LMRA 1KK3A 1Z45A 3EVDA 5AVXA 3EZLA 2PZLA 4BNDA 3HUEA 3LYHA 1FXWA 1A88A 1NE2A 4C0LA 3PD7A 3Q5DA 2WU8A 1T3TA 3REOA 3WSTA 3DZIA 4QFCA 2OAEA 2ZIUA 5KOIA 2D0OB 1ESZA 4BE4A 1YCHA 2OCKA 3ZN2A 3RROA 1EGVB 1WF3A 3H18A 3I52A 3ISDA 1FO4A 3FYTA 4Q47A 1ZXIA 3S2IA 1G8SA 1UPAA 4D9KA 5KFQA 1VYTA 3LH5A 4HDKA 3MINA 1BRMA 5CT8A 5K7SA 1D03A 1GT6A 1YZNA 4HOYA 4O3OA 2EW8A 1CUVA 3OPVA 2KZMA 3QPUA 1VIDA 3HCEA 4WZBE 3U2QA 4UDNA 3PQ6A 4RL4A 2VHCA 2F1KA 3AWIA 4PX3A 4POOA 5K1ZA 5DV9A 5ALNA 2OAP1 4DQDA 4A1OA 3VU1A 1MEJA 5FCDA 2WJGA 1RRMA 4PZPA 3FNEA 4C3OB 1QOZA 2Z09A 4QRDA 4YRZA 3ASUA 4AD8A 2NU8B 2JI8A 3I72A 3DV2A 1KI3A 2M6SA 4PO3X 3IUBA 4D45A 3L9XA 3FHJA 3SLGA 2HADA 3RYIB 1Z2DA 4FU0A 4U39A 4QWWA 1UDRA 2JHFA 3TG2A 2JH7A 5JSKA 4DSZA 3DMPA 4AT1A 1ZWKA 3H2BA 1EBUA 1G8MA 3LV8A 3TQHA 4AJNA 1T8SA 4S24A 2F76X 1X1TA 1QNLA 4KE9A 2EZ4A 2P90A 1CZKA 4HADA 3NCTA 4EDFA 3IQDB 2ZIAA 2D7CA 1SJ9A 3ESXA 4CDRA 3GJ4A 5TXGA 2YYYA 1O0BA 4P4PA 1XN1A 5DI3A 4DV0B 4PNZA 2REQB 4S35A 4RTLA 3WQSB 2AXPA 3SHOA 1BVUA 4ZI5A 1FDUA 3N74A 2DR0A 1CR6A 4PR3A 2FOIA 2HLNA 4AKHA 4BBZA 2IPXA 2OY0A 1JDNA 1MO2A 2PT5A 4R4JA 1U2TA 4BRUA 5D49A 1U5AA 1AE1A 3FD8A 1JPUA 5B2ZA 9GPBA 3JPOA 3U61B 4TWAA 5KVCA 4WK0B 3AH8A 1SVKA 2OBBA 3RYIA 2UYQA 2EWWA 1G6Q1 5HYVA 3OQVA 5K01A 5IBCA 1P7WA 2OUIA 3PGVA 2OUKA 2XQVA 1UM9B 3HWWA 2ZPAA 4RGBA 4BRZA 5LQNA 3IDWA 3IGFA 4NV0A 4ZXPA 3IYLW 5E3JA 1E1QA 2M6KA 2YVLA 4DPMA 4ZC1A 4LXTA 1E8MA 2C9OA 2REQA 1XXHB 1OWOA 1TC1A 1X6IA 2YV5A 3A27A 3PNCA 2YN2A 1DP4A 1CEXA 5AJWA 4AQDA 2BGMA 2N42A 3NKVA 2QD5A 3KEOA 1IZZA 4K2HA 2XCAA 4QLOA 3AHFA 1C3XA 3FM9A 4GSLA 1X8LA 5JJIA 1MBZA 3RANA 2R2AA 2JK0A 2WQ6A 3FGNA 2CD9A 4M1WA 2FN9A 1OAOC 1FFSA 2XYVA 2BGUA 3AF5A 4ALNA 1ZJYA 2ONZA 3Q8LA 3ZWMA 2SKDA 2O3UA 3A2KA 2KN7A 3QMVA 3K9HA 3ET5A 2LXNA 5J0TA 1PX0A 4CF3A 1YJAA 2G1AA 2G76A 2ESRA 1NXOA 4MDFA 2CW5A 2V0GA 2ZI9A 1N63A 1V4BA 5A7FA 4CL0A 1UM9A 5DBBA 1M0SA 3AUAA 3QVSA 3IBGA 4CM9D 3ZD7A 3TDNA 1W581 1X15A 4NICA 4HLQB 1SL2A 1DT3A 2VSOA 3NHFA 1TEZA 3GBSA 3P45A 1N5DA 5FTNA 1KQNA 1XXHA 1JAIA 2GJAA 3NT4A 5EIBC 1BXRB 1M34E 3KWFA 2F6RA 1NX6A 5FR1A 3S2GA 1J0CA 2ATCA 1NBMD 1TTPB 3VDMA 3WYFA 4DFDA 1K8RA 4Q3LA 2XA1A 3MMNA 3BVPA 5A71A 2JIZA 1KYQA 4DG5A 3KQPA 2ZJ8A 5C1OA 5C37A 3VR1A 4KODA 3ZQ4A 4LC9A 1U98A 3IEVA 3DDSA 3OC6A 1JW9B 1E77A 4LOLA 4R05A 4X3CA 5DX0A 1RHJA 1Q0SA 2JW5A 4G26A 4V2IA 2W2XA 2IS2A 7AT1A 4MGKR 3TRHA 1Z0DA 3V7UA 2VJAA 5E1OA 2QG4A 4DL4A 3PO4A 5J1TB 4FFMA 3UJ3X 2UZ4A 4R8SA 2QUKA 1K5PA 4OF4A 4EG6A 3C8UA 1VLZA 5KPJA 2WWXA 5IMBA 2GILA 4DG9A 5B55A 5BYKA 4Q6WA 2H1LA 1SHLA 5C4GB 5B7NA 3ZDCA 1M76A 2W2NA 3SZRA 5E6UB 3C1ZA 2P27A 2FJ6A 3ZNQA 5CW2A 1BXRA 3H0MB 4FNMA 4MKZA 3W79A 1G8PA 3JQ9A 1UDCA 2GRJA 3GLIB 2RKOA 1ZGCA 2C8KA 4LC1A 4LSGA 3QLUA 1DG1G 3QMPA 4B3GA 1YMVA 3LUAA 1NJ1A 4GMXA 4B79A 2F1HA 2OQ2A 5MN4A 4UBMA 5SICE 3OA0A 4M7OA 1CIPA 4N76A 2XGSA 1G21B 1QNFA 3ZC3A 1DBPA 1UAAA 4R0NA 9ICUA 4RK6A 1EG2A 1NRIA 3REGA 4NYMR 1U8YA 1XZCA 4B40A 4HRXA 3S28A 3HI4A 4XYGA 1XLTA 3CWQA 2W6JD 2PFNA 2JGFA 2O5VA 2KS6A 3AY0A 2ZYSA 1P72A 2CCJA 4UATA 1H0RA 1W9HA 4PSDA 2JFWA 2QSUA 3VU0A 1GP2A 5L3SA 2QZZA 3FPCA 4UPVA 2AMYA 4ACBA 3KJHA 2P6RA 3ZHZA 2R0QC 5E6UA 5KVQA 4LY0A 1BQ3A 1DC5A 5THXA 3FMGA 5JHHB 3VSBA 2IU4A 5DN6D 1P0MA 1D6SA 2G5PA 4WADA 1OYVA 1V95A 3PWSA 1YTUA 2VPQA 3GLIA 4F5YA 2R7KA 1A2KC 1V9CA 2QRNA 3D8BA 2AGVA 4N01A 4C7JA 1L5VA 3D0RA 2A88A 5B1DA 1P6XA 5KYYB 4DJEC 4K9DA 2FUEA 3LT2A 3A0HU 4OI1A 4X60A 4BQFA 1C7RA 4NL9A 4F92B 2O3QA 5F3WB 2WSIA 5FV4A 3ZOZA 3WGZA 1N5OX 4D3FA 2R6HA 4M89A 4RL6A 1XN4A 1RXCA 9ATCA 3T4XA 2W9XA 3BTSA 3E8XA 5ECYA 4M2YA 2B20A 4XARA 3K0CA 4YRSA 4IDBA 2BEKA 4QBHA 3PRJA 3DCYA 2QD2A 3NYRA 3K70B 4JY7A 1E2UA 2JIRA 4RGYA 4RTKA 3QENA 5CRXA 3E3OA 5ICFA 3NS7A 4O4JB 4Z51A 1XTQA 4JC0A 2PZBA 4F9EA 1J21A 3H4TA 2J6HA 1GUBA 2XJ4A 4XUDA 2XC9A 2Z2YA 2WILA 4HYQA 5D3ZA 1E6EA 2OZVA 5K51A 1V8BA 3GT4A 5FF9A 2EW2A 3VX3A 4CIVA 2BFCB 2OCBA 3W8DA 3DHYA 1ML4A 4KP7A 1H6BA 3D6VA 3DW3X 4WLUA 4OG2A 2QYOA 5C0OE 5F33A 2QL7A 4MA4A 2GJKA 5KYYA 5FR2A 1UJ4A 1KNQA 3RUAA 1A82A 3ZEAA 3D64A 5I9TA 3E7WA 1SUFA 1UBSB 1EZ4A 3OCCA 4ZD6A 1KFKB 4MWOA 4WCFA 2DTXA 5HTOA 4XUGB 3ISCA 5LWQA 1XMPA 2FRDA 2NT4A 4JLPA 1N78A 4PAMA 5HKAA 3VI4B 1OJ7A 3I04M 4OXNA 1HNXB 1ODLA 2QTVB 3H40A 3EFHA 1INLA 2O1XA 3FAZA 3DLAA 4NU0A 2VZ9A 3OEED 3FSEA 3MAJA 1T2VA 5LU9A 1U3DA 2VAXA 3T5DA 3HEBA 4AP9A 1V37A 2P3SA 5FYQA 3RJJA 1DK3A 3GDGA 2H5LA 5AJXA 4IRMA 2BFCA 2D5CA 4MXDA 1T36B 3KG2A 4XCXA 2Q5OA 3LQ1A 1GAWA 1TKAA 5C4MA 2E6UX 1I3MA 1I3NA 2EWMA 1W5FA 4ECAA 4LE1A 3AUTA 5I7AA 3C98A 4ZJYA 2GWHA 3MCUA 1B43A 5D4BA 1NVBA 2CK3D 3VAZA 3T7AA 1E0SA 4BWYA 3MEQA 4S05A 2MSNA 4Y9SA 2EJBA 3RTGA 5IXJA 3CU5A 3VRHA 1NFFA 3M7DA 1MV8A 1LU9A 3BS4A 3N75A 3UQ2A 1E7MA 4J91A 1ZQNA 2QTVA 3DZJA 3D7RA 3ZIDA 3V4ZA 3FETA 4CQMB 2ZBFA 3AMZA 1AHNA 1TGYA 4IVRA 3DM9B 3QV1A 3RIMA 1F6DA 2J4FA 4DUYB 2NXJA 1TADA 5DQGA 3B2QA 4MRVA 1E2JA 3CLRD 2C7VA 4MRRA 4OVKA 4UBKA 3OKCA 4AMUA 1JAYA 5LP6B 3A31A 5DB4A 4F4YA 4ZVSA 3WSWA 5KPDA 1M6VB 2YXPX 3W1VA 5TZVA 4AUKA 1CRXA 5KTSA 3D4BA 2G0NA 2P62A 2ZAOA 1RM5A 3FZYA 3TOZA 4DV6B 5TISU 4Z9YA 5A4DA 3ONDA 4FJ2A 1GQYA 2JFPA 1JR3D 4O33A 2HB6A 4H7KA 3ETRA 4CM5A 3OJUA 2O2HA 4GKBA 2JRLA 4E5SA 2PFPA 4PC3A 421PA 3GDOA 1XDDA 2FPUA 2VAPA 1WXDA 3G8BA 3Q3VA 4HS4A 1F8UA 3ADDA 3QTLA 4JKYA 3DV9A 3PQEA 1W48A 4CQMA 4RK1A 3FOZA 3UJ6A 1Z2NX 2WZCA 4UNNA 1V11B 2RAVA 1I9GA 2CGEA 5FFMA 1SKYE 1W46A 3UH0A 5J4HA 2VP6A 2ZBPA 2PNFA 2Q8NA 1VJRA 1V85A 4UMEA 1LDMA 3D3WB 5LP6A 4TTPA 3PTAA 3ZIAA 1VJ1A 5JMPA 1DE0A 2PSFA 1BKSB 1JE0A 3ZWBA 4J07A 2PBZA 9ICGA 1TUBA 3CCBA 3DFZA 1R9JA 3H17A 2H6EA 1YE8A 3ASVA 3NT5A 4OQPA 2XR1A 4A8HA 3RH5A 2WT4A 1Q77A 3ROXA 1QFZA 3UOAB 4CN8A 4P1ZA 2J32A 4QA9A 4QIHA 5J43A 4DLYA 2N0SA 1YRLA 3GIMA 4G8JA 3T9DA 2XCSB 2HPAA 4JI4B 1U2QA 4XGIA 4Q4HB 5E7JA 2B4QA 4QWEA 3OZCA 3B1ZA 3L0DA 4KK3A 1AU9A 1VLQA 1RYBA 4EKYA 4XASA 4PH5A 5AOCA 3EPGA 1UDXA 3V1YA 1QV6A 4V1CI 3PZRA 3AKZA 1RRGA 2AQ0A 5HF8A 2J6TA 1Z6XA 1M10A 1V11A 2V6JA 3L7JA 1BDJA 2VH2A 1W73A 2VRBA 1CU1A 5DOZA 4ZAZA 4M0MA 3WR5A 4XYBA 1BPXA 3HHPA 4HVLA 3C8HA 3D3WA 1Y3HA 4G0XA 1WZCA 3L0PA 3IAFA 5JXGA 3ZXYA 2XQIA 2F90A 1L3BA 2A3RA 4AY6A 3A9CA 4NS4A 4EB3A 3LK6A 1I36A 1N8SA 3NMUF 1V4VA 3J7TA 1RI3A 5LZ9A 5I8ZA 4WQMA 9ICNA 5G5GA 4RQ0A 5KNDH 5F5LA 3IOEA 3UXHA 4G67A 1TXGA 3HB4X 3CMMA 3X1YA 3ZJYA 3BXHA 4Q4HA 4YR3A 1NY5A 3MM4A 5KNBA 3BKXA 8ICNA 4IH4A 2CXUA 2X40A 1POWA 5FNVB 4EKGA 2XY6A 4P4OA 4GUDA 3GYGA 4PS0A 4QU9A 1RYSA 1JGTA 4LZLA 1S89A 2WWFA 4PL2A 4M1MA 4DANA 3ZS8A 1Z0UA 2NIPA 1GFIA 4CT0A 1SHTX 1VLMA 1F44A 3V4RA 4LDPA 3PNOA 4MEJA 3CH7A 4PLYA 1NVGA 3B3JA 5JNVA 4GLBA 1HOXA 4TVSA 4OJNA 3FPBA 3PUJA 3H7IA 2EXXA 5KYVA 4M76B 2FFBA 3RJIA 3BMOB 1I3LA 1J0BA 1EFCA 2R1VB 1LI4A 3A58B 3WSVA 2IZ5A 1P5RA 2CZCA 3M6VA 3FMFA 2EX1A 3NBMA 5FBZA 3ZE2B 1FLAA 4L6CA 1AGXA 3D2NA 3ZWYA 1OYWA 3IE2A 4C0BA 1XEXB 1ZKMA 1UIRA 3IP5A 4RPYA 1W0KA 3BS5B 3VPAA 1ZK3A 4ERNA 1ZHFA 3CISA 4PYIA 2BPGA 3PICA 3UPQA 2TMGA 2WMOB 4O8CA 2BGWA 2C1ZA 5FNVA 1H1LB 1KR2A 2JBWA 3WWPA 3UAVA 3QX8A 3BQ2A 1B26A 2RC5A 4BX2A 4C3ZA 2IUSA 4BLWA 2AVNA 1AQLA 3HDVA 4FFSA 3LSTA 3V6MA 3DOIA 3TCXB 3NXSA 5SZIA 5LVAA 2XGGA 2ZM5A 4I3HA 2I1LA 2XCTB 1C9DB 3TOXA 1J0EA 5JCJD 1MEOA 1H22A 3V1KA 1YQQA 3HEAA 4MVXA 4BO3A 2GAFA 3GUCA 3BMOA 3CSUA 2HUNA 2R1VA 1QX3A 4F4IA 5GADl 1I14A 4OQXA 3NBUA 4AICA 5DNEA 1WYGA 5TQJA 5JY1A 2XA9A 4UZFA 5KFWA 3UXNA 1MA7A 2PU7A 2P9CA 2WYIA 5KOYA 4B7ZA 4PGGA 3SDBA 5CLHA 3SKYA 5EIBD 2PD3A 3TVDA 1XEXA 4PCUA 2BEJA 3BB3A 3OM0A 3BS5A 4PBTA 1ICEA 5CNJA 3DM5A 5GV7A 3VTZA 1NW9B 1UK7A 1ZITA 4XDYA 2IP4A 4YMSA 1SXJB 2RAUA 4GL2A 5EXDA 3LA8A 2IOYA 3CZMA 3EGWA 4TZ0A 1I4TD 1M2EA 3GFOA 4U2DA 1ECFA 2QXTA 4Q37A 5FNZA 3LQYA 4LF5B 3ETLA 5TMDA 4GDFA 2C99A 4MRNA 3HFRA 4J4TA 3AY6A 4AROA 3OSPA 4OLFA 1P9RA 1NLUA 1J5EB 1THMA 2ACKA 1T2NA 1NOKA 2VYND 1ISJA 2WB4A 4G4GA 1I32A 3IQEA 2QVYX 5FTWA 1BDBA 1JS1X 1YHZA 1IVYA 1DK2A 2MU1A 3VGPA 4JLUA 2HZBA 4EYHB 2H9IA 1NN5A 1IY0A 3PQ5A 2FEAA 3U0BA 3EA4A 2E8MA 3UK7A 4FGSA 1T0JB 2NXNA 4X65B 2RHGB 3R6WA 3QBVA 3DZBA 4EI7A 3HXKA 2BFWA 3EZNA 4IDGA 1FQOA 2E0IA 5JAQA 3RC1A 5ITSA 1ZNXA 1CUGA 4D0RA 4J9NA 5AHRA 2O0MA 2QTTA 4WWHA 3L93A 4YB8A 1T7PA 3S70A 1H2FA 2KI5A 1NP6A 1TQ2A 4BGUA 1VPEA 2GD0A 3F6RA 3BE6A 1Q11A 6ADHA 2G1KA 1D6JA 1P0PA 4W9NA 5A9TA 1GRQA 1HNZB 4LX0A 3WRWA 5A7HA 2F62A 3LJKA 2NZ2A 2JD0A 1J42A 4MPDA 2FWJA 1TK9A 2QARB 5AW7A 3R9XB 3IHLA 3CW2C 2HA0A 3TZKA 1E2PA 3GFPA 3P26A 1OH7A 2XUAA 1Y1LA 1PJRA 5IDYA 3NONA 1C2YA 2ZJAA 1R74A 3OJCA 2J4DA 1RAAA 2A5YB 1U47A 1M3SA 3UB3A 2DKOA 2RC6A 1ESMA 2BCSA 2XUKA 3IUPA 5JECA 8ICVA 1BHO1 4C5CA 4FZ5A 3BORA 2PVCA 2BZFA 5FOVA 3WBJA 3RSHA 5CH5A 2GXSA 4KN5A 2JZBB 1RAFA 3I09A 3ZQJA 1U80A 5HILA 1TE2A 2ZUTA 2V98A 5B57C 3LWNA 1CHDA 3HB9A 4NMWA 4YR0A 2PUBA 4NE9A 4R6XA 4CM7A 1FNSA 3EAQA 3M4YA 1USVA 5AVUA 3FTDA 3LT1A 2R8BA 4KKXB 1GSAA 5ELMA 3HNPA 3WWDA 3R9XA 4R1OA 5ELXA 5DKWA 4DLGA 2J6IA 4JI6B 2CDRA 2P2CA 1QB7A 3L05A 3JQPA 1E2LA 4KYUA 5IAGA 2GZHA 5BWLA 1VL8A 4FDAA 1HBJA 3B1FA 4I2VA 3CLTD 3DWIA 3V1TC 3VPSA 3DAHA 4IV8A 1GZSA 4X1OA 2EBUA 3UIEA 4DLUA 3PW7A 3CNHA 3U60B 5AKGA 2IW3A 4P4TA 2Q7OE 1VB3A 2W2KB 1IU9A 4OQDA 1PEKE 2V7WA 1THGA 5IYZB 3CN7A 3D3KA 4OH7A 4EWLA 4J7UA 3UQ0A 5BSWA 2G40A 2XIDA 2JZBA 2Z58A 2GBCA 3MHTA 3AI2A 3QKTA 3E4CA 4Y9TA 1CUSA 3PF9A 1M1XB 4RULA 4B4KA 4D9CA 4DF4A 3J7AC 2I78A 3B5JA 3NWEA 3R3YA 2JD1A 1SXGA 4E4TA 3NFYA 5JJLA 3CX7A 5IIOA 2IS4A 3ENVA 3GN2A 3B7PA 4LCBA 3ILSA 2Y1GA 1XTPA 3QW2A 5HGXA 1I3CA 3A32A 1B6RA 4KSBA 4G86A 3H3FA 3ZV7A 5IDQA 2QN3A 3QSYA 2A0KA 5KFKA 1Z0ZA 3I9MA 4GX0A 3IEMA 4G5YA 2X7XA 4G4JA 1AS0A 3JATB 3BF8A 4MJ7A 4XWWA 4RVSA 4ZO9A 3TF5A 1XA0A 1H2EA 4PZCA 1LS6A 2W2KA 4LF9B 4IVNA 4DREA 4DV3B 5JZOA 5IYZA 3OOEA 3RRJA 2JLCA 3E2IA 3OTQA 2CC2A 5C8DA 5A4KA 3KWJA 2DGDA 3CVYA 1BFUA 1WA5A 4UXHA 3HDGA 4TWJA 2HMTA 3M82A 4F4UA 4DN6A 3F4LA 1ABBA 3GELA 1E3WB 5I7WA 3U44B 4AKEA 4LQCA 1RDFA 5ERYA 3CYFA 5K2MA 4MDEA 4L6AA 1EIZA 1PG5A 1SBYA 4HJRA 3DE6X 4YALA 1WUTA 4UVHA 3K9NA 2CMDA 2R7NA 1U5CA 1HZZC 1N5RA 1FCJA 3JPWA 1OI7A 3CPHA 1U8AA 4LKOA 4PBSA 2GZ3A 1IPEA 1E7RA 3H2IA 4ZV7A 4A6EA 3QG1A 4C0HA 3KHSA 1W85B 3WYAA 2HK7A 1XAIA 3UG7A 4NULA 3WRYA 1E5QA 4KOEC 1TYBE 3BL6A 4RVUA 4IGKA 3JATA 1HO3A 4F8EA 3SGLA 5KTKA 3L8ZA 2V7QA 4BLSA 2WJ6A 2W04A 4MQFB 3K53A 3ITDA 5FI1B 4W63A 4Q43A 3THSA 5JDIA 2B1IA 4QG3A 5AD1A 4CV1A 2E8PA 2LE0A 1VIYA 2QL5A 4R0MA 1WETA 3GNQA 1FY2A 1XRLA 3BAZA 3UA3A 1VDZA 1V3UA 2JB9A 4H15A 1Q7BA 4RH3A 1D1SA 5CVTA 3W8RA 3E70C 3VA7A 1E3WA 3U44A 2HREA 2QG9A 4HD8A 4KWHA 1IN7A 3FCCA 5AI0A 4ATNA 4AL4A 5DWVA 2QU7A 3A6JA 3WLRA 1A69A 2BR0A 3JAKB 2NSJA 3OQJA 2WJWA 3UH1A 4CIBA 5T7BA 1PL7A 3UKJA 1C0IA 4O08A 1VE1A 1I4LD 3MGCA 4EZ6A 1J07A 4MMXB 1JDZA 3SOPA 1FYWA 1W85A 1A95A 2QRQA 3BRCA 4YQZA 4TURA 4J2TA 3IAXA 3TXAA 4NG4A 4BYMA 4MQFA 5H16A 3RKRA 3OCZA 2J67A 1QGDA 5ALFA 4N9QA 3GI1A 1KAOA 1Z8HA 2IHBA 5TLSA 5IZ4A 1RPTA 1BU8A 4PIPA 4WJLA 5DHTA 2R9VA 1GNLA 2AKYA 1W4AA 1ZI8A 4LECA 2HA2A 3P5BA 2QL6A 2IPLA 4K4GA 3WGHA 5AUOB 4MV0A 5BQPA 1KBZA 3QSGA 1VHWA 1EVIA 3EIEA 1RHRA 1US8B 4LG1A 3GT7A 1R37A 1CUDA 2C84A 3WV5A 4BMSA 3RFTA 4JJEA 4J0JA 1EEHA 5BUQA 3M5WA 1VL5A 3JAKA 1BVYF 4ND6A 2JXJA 3IQXA 1IRXA 1PR6A 4OBWA 2ZYGA 3G88A 3EYZA 3QPWA 3B5EA 2QI9C 4LHVA 3BMCB 5HA5A 3KT8A 4IP0A 1FUYB 2X3FA 5L1IA 1PW7A 1GGNA 3JX9A 3MB5A 1T9BA 3EYAA 1H2XA 1XQVA 1NVDA 2QYHA 1T3LA 1Z19A 1FQKA 4MI9A 4M1SA 3AM1A 1DSSG 4V0QA 5FUXA 4KBFA 3TADC 1YZKA 4E5PA 3NQ41 3PE4A 3G2OA 1GL7A 3UB4A 2ZKLA 4JB2A 4EA8A 5FHQA 1M8GA 4GYJA 2Y77A 3HL0A 2OKGA 1D2MA 1ULAA 3SKVA 1S96A 4RQ5A 2OWOA 4RT2A 3NH6A 2P41A 2ZJ7A 3CUSA 4NBTA 1US8A 3EZXA 4RPKA 2C3YA 3K4HA 4KH0A 3ZXUB 3MFHA 4ZVRA 2ZTCA 1TU4A 4L85A 3A0BU 1WW3A 4JT4A 3OIVA 3PE6A 3MTEA 2VYCA 3FTCA 5IT5A 2YMMA 1EB9A 4MTCA 1SBNE 5TPZA 5JAMA 4DLNA 2PUTA 4MS3B 2ZK7A 3BMCA 4TPKA 1YT3A 4EARA 2QX4A 3OLXA 5DWDA 3HWTA 4RPJA 2H5EA 2L69A 4HNSA 3UMVA 5IAJA 1E1RA 4WLVA 4A1FA 5ADVA 2PKEA 5GWXA 4NRDA 4NDZA 1SGWA 2RK6A 1ZDMA 1RZTA 1JIIA 4QJ5A 1HUQA 1J49A 3RC8A 2ZXEA 1N8NA 1X66A 3RSCA 4JLBA 1CUXA 1BD3A 1PLKA 2AYYA 3FPHA 4YRJA 4GM4A 3Q8WA 3DE3X 4UM7A 2RH4A 3MW8A 4EGSA 4A2QA 3DEHA 4CLRB 2JFBA 1UUFA 4BNXA 2PY6A 2ZDHA 4N4AA 4YP1A 1SCKA 4M8LA 3GXOA 2B4KA 3ZPXA 3UQYS 4PV7A 2L42A 3RRMA 3R5TA 3INNA 4MS3A 4LF8B 4KHPB 3T3OA 2GJ8A 5FB3A 2ZRNA 5K3OA 4WY8A 3Q72A 3QZUA 1SBCA 3MFIA 2YRFA 1JPJA 1VI5A 2CV1A 4P08A 4W7IA 1T9AA 2QX6A 5HKKD 3VC7A 5D1NA 5JMOA 4DADA 1CY6A 2L2QA 3PNPA 1NQAO 4KLFA 1EWYA 4ECYA 2JJQA 4M36A 5ITZB 7ICGA 1WD7A 2H16A 1MPTA 1KZYC 1OBFO 4NATA 1NTRA 2XGMA 4W1PA 4BTVA 4H0NA 2XITA 4CODB 3C2KA 4IIVA 2IEDA 4QBGB 3TAQA 1PAUA 3IL2A 3Q15C 1G2QA 8ICLA 4HP8A 3NVAA 4NR0A 3ZTTA 3TTWA 2C2EA 4BKOA 3OOYA 5D3KA 4AFNA 3QKRB 1AKRA 2XCPA 2V65A 4TL7A 1RXVA 4KR3A 1WXQA 4CLRA 4G0PA 3OHAA 1ZOSA 1CZNA 4QTTB 3N2ZB 3TSWA 2FSUA 2NM0A 5EIOA 3KOUA 2ZB3A 4GLFA 4O3QA 2VATA 1GYPA 3C1YA 1LDGA 1FQWA 1KSJA 2HD4A 2W48A 1GPMA 4UQGA 1B74A 2ZJ4A 1KY3A 1UKBA 2JH9A 3G2PA 1TLTA 5DGBA 4PM4A 3DHWC 3C3WA 4HDNA 4CF6A 2EOAA 2CNWD 1E66A 3G0IA 2JJMA 5E4YA 1VPVA 2A58A 4P0QB 3EWIA 2E9SA 4C7MA 4TLBA 1IRIA 4PG5A 5ITZA 2VBCA 2OPHA 1N5WA 1IJEA 1TKRA 1JKIA 5BNZA 3RSQA 1ODSA 4OQLA 2WB1C 1M8PA 2ALJA 1N5JA 5DJ5A 4P58A 3RB6A 4L5JA 1DEXA 5JD6A 3RYCB 1XD8A 3MJSA 4QUJA 1H2HA 1ZR4A 4KR7A 3FMVA 3QKRA 3UJDA 4G37A 3CLRC 2EZTA 2I54A 4R64A 1W75A 3AVWA 5DLQC 3ITEA 1ZH0A 4CIWA 3WGUA 3C3EA 3H2GA 2DWUA 8ICQA 3VH1A 1UR5A 3VO8A 1JVBA 5B37A 5CLJA 3U9TA 1RBQA 4EF6A 3QXCA 3W2HA 1G63A 3JAWB 1RT9A 2G5GX 4ARAA 1DAIA 2GM4A 1Y80A 2J9FB 4WBNB 4FGZA 3M2PA 4X1KB 4CCSA 1GSOA 4TQ9A 3KZNA 1Q8KA 3RBDA 3UBTA 3MSXA 1L4KA 2UU9B 3WKEA 4JI0B 5F98A 4CI9A 3A0UA 1RC1A 3UXMA 2B6NA 1S8FA 5EZ5A 4YT8A 1Q0ZA 2QPOA 4O2AF 2CKDA 2PKYX 4JGIA 3V33A 5L3VA 4QC2A 4A8JB 2ET6A 3RYCA 1U9IC 3BQ7A 4ETWA 2WU3A 4JJZA 3OECA 4C8KA 3LXUX 1U8XX 1H23A 2AN1A 4N41A 4MS1B 5LWHA 3KJFA 4OO1J 1BU5A 4K26A 3EPIA 5J2FA 4DCMA 1CUEA 2ZSHA 2PL1A 3NNSA 4XFDA 4LVNA 4F0JA 1DEHA 4J76A 3M6FA 3ILVA 4NIMA 5CDFE 3PHLA 3JAWA 3AUYA 1E89A 5TNXA 1CF9A 2K89A 2Q46A 2ZBGA 3EPHA 4P3OA 3NHRA 4XQ9A 5U4QA 2I4TA 1FFHA 2EF0A 1T26A 4UFOA 3QE3A 2AGPA 2J9FA 4WBNA 3IBYA 1Y98A 1IHYA 4DSNA 3QWAA 3MTQA 4X1KA 2HF2A 3S8MA 4Z0HO 3KS9A 4RO0A 1QFYA 5TV2A 5AI5A 3K9LA 4GKVA 3URKA 5IXSA 3QBDA 2EZZA 1DRKA 4KJXA 3FPEA 5EXSA 3GLQA 3DMTC 4MW4A 3IEKA 1RQXA 3MF4A 4ID9A 3CRXA 4CM3A 2TRSB 3NT2A 4A8JA 1PU2A 3ZI4A 4XUEA 1RIFA 1JL3A 2FG6C 1EHCA 3U9SA 4WLEA 1WR8A 2P9YA 4MV1A 2WSSD 1UFRA 3KUKA 1YVPA 1GWNA 2PQMA 4B74A 2HJSA 4KXQA 1OBCA 3FJYA 2IHZA 2D0PB 4RYDA 3H4BA 2BM9A 2P68A 4HWSA 5JO9A 1VG1A 3EOZA 2I9KA 4I2JA 2PSJA 1LRJA 4Q4CA 2OYYA 1FNNA 3PX0A 3B6ZA 1ZONA 3PR4A 1UWCA 1WZUA 2HHAA 2IODA 1H94A 4NNPA 3RVBA 3DCNA 3PPWA 1YI1A 3WO1A 3O9MA 4GI5A 5EKDA 4QM6A 4LOKA 5FLYA 1WCV1 2NXWA 5CDYA 4LHEA 1CZRA 5DSTA 3V8NA 5T57A 2PUEA 5I5GA 3W7VA 4PLWA 5EY5B 2QM0A 2X0RA 3IQZA 2WR8A 1ZL0A 1AZTA 1SEVA 1CJBA 2NU8A 8ICWA 4CF5A 4YI3A 3QQPA 3UF0A 2XEXA 3L5KA 1AX9A 4JNKA 3KTOA 2ZSIA 3GIKA 5KFPA 1RE1A 2ZE7A 3G82C 1SC1A 1P8JA 3ZGYA 5CCEA 1MC5A 5DBHX 2CXPA 3KKAA 3IR6A 4QREA 4URYR 3S0JA 2V5VA 3AESB 1PGPA 4UM8B 5AI4A 7ICTA 3WGVA 1NJYA 4XWKA 2FDRA 3VZDA 3GV5B 5FLEX 3R4CA 1GKUB 3UATA 1Z6ZA 3EC1A 2XMDA 1ECPA 4KKVA 4RZIA 4OU5A 2SHKA 5TQ2B 3VVLA 2VIXA 3GZFA 1JZSA 4BTLA 3ZCUA 1YB6A 4RD2A 4XPZA 1Z62A 1EE9A 1D5WA 4YJGB 4A03A 4J9OA 1FTWA 2FOLA 4K2AA 5CVJA 5HF5A 3A9WA 5EE1A 5EJ6A 4A10A 5LD2B 4R3UC 1OR8A 5HE9A 1N1MA 4DSTA 5CT5A 5D5QA 2DUWA 3UUEA 2XNHA 3AL3A 2PRSA 2GBLA 1L4LA 5FBVB 2IC5A 3SMQA 4KQ9A 3FWZA 3SE0A 3OZVA 1K3FA