4C4TA

Structure of beta-phosphoglucomutase in complex with a phosphonate analogue of beta-glucose-1-phosphate and aluminium tetrafluoride
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
217
structure length
217
Chain Sequence
MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-PHOSPHOGLUCOMUTASE
publication title Alpha-Fluorophosphonates Reveal How a Phosphomutase Conserves Transition State Conformation Over Hexose Recognition in its Two-Step Reaction.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
total genus 76
structure length 217
sequence length 217
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2013-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 4c4tA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4c4tA01
3KDPA 3QXGA 3OCYA 5AW6A 1Z4QA 3RF6A 1U7PA 2CFTA 2HSZA 5AW4A 2AGVA 4UM7A 5AVTA 5IT4A 4EX7A 1YNSA 5AK6A 3CZ4A 5A3RA 3WK7A 5ALHA 4HYTA 5ALKA 3QU4A 2G07A 3L7YA 3L5KA 3NAMA 2YJ5A 2I54A 4UU1A 4H1WA 2W4MA 3L8GA 4YGYA 4UARA 2B8EA 3AR3A 2GHTA 1EK2A 2FI1A 4CE6A 1XP5A 2WF9A 4BNDB 3U7EB 2JGAA 2B1RA 4MUMA 3WKEA 2YN4A 4G9BA 5ALGA 4J03A 3HLTA 4L6AA 3PGLA 2EAUA 4YIHA 5ALXA 5AIBA 3FZQA 1QYIA 5ALWA 5ALRA 2P9JA 1ZD4A 3AR9A 3WK6A 2WF5A 2I34A 3I6BA 4UMFA 3ZWDA 5ALYA 4HGOA 1QH9A 2ZOSA 5AKEA 5AICA 3N28A 1L8LA 4JB3A 4UM5A 3L8HA 2YMPA 1ZOLA 3N07A 2OBBA 5ALJA 4EX6A 5AKLA 5AK5A 3A3YA 2GO7A 4CF3A 1NNLA 4EZEA 4ZEXA 2GFHA 4XE5A 4CF5A 2PQ0A 2HF7A 4XQ0A 2FPSA 1ZJJA 2P69A 4KYTA 3K1ZA 2FPWA 3MPOA 3FGOA 2QYHA 3ZVLA 1Z4NA 2YMLA 2IYEA 2HI0A 2C9MA 2HHLA 3EF0A 5AESA 5ALFA 1YV9A 1RKUA 2Q5EA 5ALZA 3N1UA 2ZG6A 3QX7A 3SKYA 5T41A 3AR2A 3MC1A 5AKXA 1Z4PX 4Y2XA 5AKJA 1TJ4A 5AW8A 3ET4A 4C4SA 3L8FA 4UMEA 1YJ5A 2DQSA 1SWVA 3AR4A 2RB5A 1JUDA 2C88A 5AW1A 4F72A 1L7MA 1Q91A 1VFPA 3B9BA 3QUQA 1K1EA 2HCFA 3P96A 3OCUA 4BEVA 2IOHA 1Z4LA 4DW8A 3SHQA 1TE2A 5IS2A 3U26A 2Q4TA 2R8XA 5AK3A 5AI9A 4F71A 3BA6A 2FPXA 2OYCA 2WF8A 2FEAA 1RQNA 2I33A 4C4RA 4PNHA 3VAYA 2HOQA 1RRCA 3SMVA 5A3SA 1FEZA 1ZRNA 3QU5A 3ZVNA 1VJRA 1Z4MA 2NO5A 5AHXA 3L0BA 2B82A 3OTQA 1F5SA 2BDEA 3WGUA 1RDFA 3N5KA 3WKDA 3B9RA 1QQ5A 3QLEA 3FM9A 2AMYA 1L7NA 4L6CA 1ZRMA 1WR8A 5AW7A 3ESRA 2G09A 4AS2A 1WVIA 3L0YA 5AVSA 2HDOA 2EATA 1N9KA 3W5DA 4NABA 4BX0A 1Q92A 4HGPA 4MWOA 5AKHA 2QLTA 1Z4OA 5AI6A 2O9JA 5AM1A 5E0OA 3HYCA 2RBKA 4C4TA 3ZX5A 3SLRA 4RETA 5AKIA 4XOUA 3DAOA 1Z4KA 4NFLA 2HEGA 4KNWA 2ZBDA 3W5AA 5ALPA 1MH9A 2C8KA 3QUCA 1T5SA 1WZCA 3AR6A 1AQ6A 5ALVA 4G63A 2HF2A 4KNVA 3ZTWA 2YJ6A 5AVRA 2NYVA 1S2OA 2HX1A 2FUEA 5AM4A 4EEKA 2G0AA 2G08A 3OCXA 5AVYA 4OCZA 3PGVA 2CFSA 3WK5A 4GIBA 1KYTA 4DCCA 3U7HB 2I55A 2JARA 2WF6A 1J8DA 5ALDA 3NIWA 2YFYA 3KBBA 3EF1A 1RMTA 5ALUA 3ET5A 5AVQA 5AW5A 1N8NA 3F9RA 4KN8A 3SKXA 1O03A 2YJ4A 2ZBEA 5ALOA 4OFZA 1L7PA 2I6XA 3RFUA 1J97A 2FUCA 5AIAA 2YBDA 2YJ3A 5AKKA 2W11A 1RLOA 1TA0A 2BDUA 2Q4RA 4J2TA 2B1QA 1CQZA 3ONNA 1NRWA 4CF4A 4Y2JA 2ZXEA 2FPUA 3MMZA 1RPZA 3KOOA 3BWVA 4DWOA 3KZXA 4BKMA 3IRUA 1Y8AA 3ZWKA 3R4CA 2PR7A 1CR6A 3QUTA 2JAOA 1LVHA 1U2TA 2MU2A 3E84A 2R8YA 2IOFK 2JAWA 4IFTA 4L57A 3U13A 4BNDA 1Z4IA 4FE3A 2AUTA 4KX3A 5AW0A 2WHEA 3I1YA 3IB6A 3WK8A 3L1UA 1Z5GA 2YMQA 4OHFA 3B8EA 2MU1A 3WKAA 5ALLA 2HO4A 2CN1A 3ED5A 1RLMA 1ZD3A 4DFDA 1VJ5A 1SU4A 2G06A 3ZU6A 2B0CA 4NV0A 4UU0A 5AI0A 1QQ7A 2GHQA 3OPXA 5JJBA 2B8JA 5IT0A 2FPRA 4BEWA 4Y2TA 4FFDA 1IWOA 4B6JA 1RMQA 3M9LA 1WPGA 3KC2A 2NO4A 1RLTA 4QJBA 3ZW7A 1LTQA 3A1DA 4Y2QA 1EK1A 1RQLA 3FVVA 5AW2A 5AI4A 4CNQA 2RAVA 3E8MA 4YCNA 1Z88A 3EWIA 5AM0A 3NANA 3I28A 5FP0A 3QU2A 5AVXA 4AS3A 2G80A 4EENA 4UAUA 5ALEA 2RARA 2G1AA 1RMYA 3IJ5A 4AP9A 5ALIA 5ALQA 3A1CA 4HAIA 4Y2VA 3NRJA 3M1YA 5AVWA 4BX2A 3UMCA 1RC8A 4Y2RA 1TJ5A 3SF0A 2WF7A 1U7OA 3MN1A 4UASA 5ALTA 5AW9A 3UMBA 1NF2A 3NASA 1RKQA 3U7FB 2WFAA 3KD3A 2I7DA 4EELA 5AKZA 4YCMA 3L8EA 3OCVA 3SD7A 3L0CA 4HGQA 1Z5UA 2WM8A 3ZX4A 1SWWA 3FPSA 2X4DA 4HGNA 1XVIA 3QU7A 3UMGA 5A3QA 2YY6A 2W43A 4QQFA 5AK4A 2OA0A 4I9FA 1RKVA 3TLMA 3U7GA 4UMVA 2P11A 4E88A 3AR5A 4YCLA 2FDRA 2ZBFA 3DV9A 5AKYA 4NWIA 2GMWA 1L7OA 4NAVA 5AKGA 4JDPA 5AM2A 3NUQA 2IA5A 4ZEVA 3W5BA 1TJ3A 4UMDA 4Y2UA 3QNMA 1S8OA 2ODAA 1Z4JA 4Y3UA 3EPRA 4O8CA 4HGRA 2EARA 2ZBGA 2VKQA 4ZEWA 1YDFA 2R8EA 3N8GA 4YH1A 3QGMA 4FYPA 4KX5A 5ALSA 2C4NA 1YMQA 3ESQA 3A1EA 3WK4A 3QUBA 3D6JA 5AM3A 2JAUA 1L6RA 2D2VA 1YS9A 4XPZA 3QU9A 3R9KA 3CNHA 5AM5A 4BYGA 3AR7A 3L1VA 3DDHA 5AI5A 1O08A 3WK9A 5AVVA 2P27A 3E81A 4BBJA 4IG4A 1T9ZA 3U19A 4Y2YA 3J7TA 3WKCA 5AVZA 1QQ6A 1L8OA 4Y2PA 2YMMA 4UW9A 3PDWA 3ZTYA 2CFRA 2MSNA 2OM6A 1T5TA 4UATA 3I76A 1XPJA 2R8ZA 4UAVA 3FPBA 3S6JA 1ZS9A 2IOFA 3UM9A 1PW5A 3GYGA 1U02A 3OCZA 3ZI4A 1ZD2P 3WKBA 2B30A 1U2SA 1X42A 4OD0A 3QYPA 3WGVA 2AH5A 4RESA 3ZUPA 4Y2SA 5AVUA 4BX3A 2C8LA 5AI8A 3OCWA 4I9GA 4YIKA 3W5CA 3AR8A 3NALA 3R09A 4GXTA 3ZVMA 5AW3A 5ALMA 2O2XA 1ZD5A 3DNPA 2BY4A 3PCTA 3E58A 2PKEA 5ALNA
chains in the Genus database with same CATH superfamily
2GAAA 2CEKA 1I4LD 4OYLA 2IE0A 4P3PA 3HCRA 2O7QA 3FSJX 2PS1A 2E4UA 1SQ0A 1P1IA 1U0JA 5ELXA 1NASA 3ORYA 1RZ3A 1PKXA 1W6RA 4OH1A 1NW3A 2V0CA 4IHAA 3SR6A 4LVNA 4L5YA 4BNTA 2B5OA 4BMSA 2CJWA 5KG4A 2YFKA 3E03A 2JK0A 4P22A 5FV7A 3LU1A 2VJPA 2WINI 1NZJA 4DLRA 2Y0SF 1IBKB 1SCDA 1IXSB 5AVOA 2OXCA 4Z4CA 5ULLA 5L3QA 3QVWA 3KXKA 1XNJA 1UPFA 2GO7A 2PFPA 2YXEA 5GIPE 4QW8A 1BMTA 1A9PA 3UQ2A 4MYTA 1IIRA 3PGKA 4BC1A 1ZJJA 1I3KA 1X6JA 4F2PA 1UK9A 5DLQC 4WWHA 2AQKA 3IUJA 2G1PA 5JAHA 3N1UA 1JWBB 3PKZA 3GLIA 1BIFA 2IYOA 4KGZA 3CTPA 2ZP1A 4LSWA 2RK3A 4NSNA 5F2OA 2TRSB 1Z00B 4EARA 4FHDA 1SFRA 2ZDHA 5HUHA 2GR9A 3PE4A 3DE0X 1JR4A 3NT2A 5DM60 2H9AA 3LK7A 2RLTA 2Q3CA 3A0UA 4RTMA 1RRCA 3U16A 2CJFA 1U49A 3ED1A 5CP2A 1SZDA 1MO5A 2ZS7A 1NVMB 4HVLA 1R8JA 2XJ9A 4MUKA 3G8AA 3BT7A 1IZYA 3FVQA 3OZEA 1TK2A 3W2GA 4P2HA 1O6CA 2AQIA 2HK8A 1FRFS 4ZO7A 3TACB 3RK0A 4QBIA 1THTA 3HN6A 3SLRA 4NOJA 4YR2A 1GY8A 1C3OB 1SUBA 1HNXB 1H1LB 3JQFA 4KNWA 1NV8A 1A5SB 4MDYA 3PF9A 3HBLA 5AVYA 3PGVA 2UYOA 3B52X 1O5TA 2DPLA 3EZ7A 1I0LA 4ZCLA 3C8MA 5CVUA 4Q8EA 5C8YB 1VI5A 6CHYA 3OLVA 3ESDA 2J6TA 1V7ZA 2IZ7A 1PNTA 1DAEA 5FTNA 4CZ2A 1ZSNA 3ITNA 5K45A 1LB1B 2JGNA 3TG8A 1XXHB 1PI3A 1UWLA 1E7WA 5E1OA 2FOXA 1BRMA 3YASA 4QTUB 3O75A 5T6MA 2BR4A 1HDXA 1WNFA 3VKUA 2BRUA 3CG0A 5KFHA 4ZANA 4TV8F 4OKNA 5BV8A 1E2LA 3ZC3A 2FPGB 1WV0A 2F43B 4MR8A 4RGBA 1TZJA 3AL0C 3BULA 1BQ4A 3EX7C 4QODA 5K3AA 1HFEL 1KY5A 5A5GA 2GM9A 1QJCA 5CM9C 1QLHA 1T4DA 3IMEA 1Z62A 2ZYVX 3ZDBA 2I22A 3LBYA 3IAFA 4N7MA 3B20A 1US8A 3D6UA 1TYZA 4UREA 2ZM5A 3CX4A 3G85A 1KSJA 1DJLA 4DNFA 4FCWA 3NNSA 5LZ2A 1WL8A 1DJMA 5JATA 2FJUA 1V9LA 2H3VA 1NP7A 8ICIA 3KU1A 1CR0A 2OVBA 4TVSA 2HXSA 1M0EA 4X95A 2AFRA 5G0SA 4HRXA 1VE1A 3BB3A 3CLTD 3R6WA 1YO6A 1J0AA 1IB0A 1UBHS 4D4JA 3F8SA 3KPYA 3FJYA 3PLAE 1S8OA 5DF1A 2AFIA 5LA6F 3VCBA 2GFQA 2Y0CA 3RANA 2PSSA 1CB7A 3IVCA 5DGCA 3EVTA 2C4NA 4O1MA 4IFBA 4GWGA 3R9KA 2I5PO 4JUFA 2R4QA 1ODSA 4A8JC 1NE7A 1CTQA 4HFJA 3UATA 1OXVA 2JJ8A 2R6FA 4QQKA 1QQBA 4OAOA 2GBLC 2FH5B 4PPYA 4N48A 4HS9A 4M9SA 3RHFA 5L7WA 4E1VA 5IBPA 4Q3OA 3LC1O 4BJ5A 3AHIA 3U1BA 1X7XB 3QPDA 4Q4AB 4LJYA 2HPVA 5I9TA 1R9NA 4IDNA 1IZ0A 4MGEA 3GRKA 4BAUA 2MOKA 2GWHA 4DV1B 5B1DA 1TA9A 2YICA 2W4MA 5ITZB 1RXYA 1GPUA 1JR6A 1YZGA 4MQEB 5DLPA 2X0IA 4IMIB 4BMDA 4B74A 2B2XA 4MQMA 4J03A 4YN4A 3HLTA 3T1VA 2ZE6A 2C1ZA 3WI7A 3ZCXA 3E3OA 4MYHA 5HMMA 5KVVA 3WK6A 5KREA 2VF8A 3ZXIA 2Q4BA 1DK2A 1M0SA 1UMBA 16PKA 4KAJA 1YUBA 2VO1A 4CF3A 3OFNA 2HQSA 2HD4A 3N0WA 1PAUA 1TU0A 4UAJA 3WNCA 2WP0A 1FA9A 3STVA 4XD2A 4Z9AA 3RE1A 2HLNA 1A0PA 1J9EA 1PJRA 2YS6A 4UZFA 5IM4F 2CF6A 2EZYA 2GYUA 1R4NA 3I9V1 5K8LA 4RA9B 1XDZA 5KVAA 5EJ2A 3VV3A 3U6KA 4YGXB 1KZHA 4A8EA 3KK0A 3QPWA 4EIWA 4ZVKA 1WCNA 2FSSA 4A4DA 5EMKA 3RVMA 4BEVA 2W4QA 4ILKA 2CHGA 5CFMA 2GTHA 2QMEA 4YB8A 2NXEA 2P6UA 5DHFA 4MVJD 7ICVA 4R0NA 3OECA 5H5JA 4OOFA 2WTFA 1NJ8A 3WYBA 3WGUA 5TB5A 1DU4A 5EEGA 1FJHA 3I5YA 1FDRA 4RQ6A 5T4BA 4AS2A 5EKTA 5U9CA 3IALA 3I9MA 1TW2A 2XE7A 3DOFA 2NT3A 1A2QA 3KZIU 2Z8XA 2VYCA 5KVQA 4QDOA 3SS7X 2ZBUA 3AIKA 7ICQA 2QMQA 3RLIA 4S35A 1S9HA 2RGDA 5BUZA 3MMNA 4WXEA 5LZ4A 3DM5A 2P65A 2WM3A 3V8RA 3EXG1 1WETA 3PQEA 4D5EA 4M1MA 2AOVA 4NENB 4OCZA 4YXWA 1U28A 3NIDB 1VYVA 2AVDA 5DYGA 5J0YA 2ZIXB 4TM7A 3B38A 1YCGA 1WXHA 3K0FA 1SCAA 2EBWA 3DE7X 1GCUA 1T6NA 3GILA 3PNKA 5LOVA 1KF0A 5ESXA 2DLNA 3PC4A 4H0FA 4E11A 3IAUA 1EX9A 3UJNA 1LBSA 2QN2A 4L6IA 2ZJAA 1O94C 1T25A 3KHSA 4GGPA 3L06A 3WHIA 2O8BA 3DVLA 3FWYA 2BH9A 3SYTA 1DS6A 1QAOA 3HN7A 4E33A 2KYRA 3IUQA 2Y66A 1CDDA 4MP8A 1FFGA 4MCJA 4V1CA 1FFVA 2PSEA 1C41A 4WCFC 1VJDA 2Q1SA 1Y1SA 4X54A 4J7CA 4V0RA 1MB9A 4XWYA 3WGHA 1D5WA 5B1IA 2FLNA 3ZY6A 4C07A 3LFTA 1MUUA 3QLUA 8ICSA 3EFHA 5CDUA 1V8DA 5ILQA 3OQVA 1ZR4A 4LJSA 2XY5A 4G36A 1JQEA 5L3RA 4HJXA 4Q1CA 2AEMA 3ISBA 2WAMA 1DL5A 4GR9A 5AXAA 2W2QA 4DLYA 5LMNB 1T9DA 4B4WA 4E6PA 3HHEA 5GPBA 3NT5A 4EMSA 3PUWA 3U3DA 1RKVA 3KQUA 2WIFA 2GZSA 4DT1B 1D6SA 4J3NA 2BFCA 3C4QA 1X70A 1NPDA 3EMDA 1OZFA 4QGHA 5FNVF 4NDZA 2OQRA 4F4YA 3NRWA 1I36A 4HDSA 1W4BA 1CNEA 2R6DA 3DUFA 4RT2A 4TXMA 3KYIB 2WV9A 5TC4A 1DAPA 1JDVA 4MVYA 3WGYA 1Q15A 1R8XA 4U3JB 4BBJA 3PR4A 2WSMA 2W9BA 1Z6ZA 4CKZA 3FYUA 3A6DA 4MB6A 1TZKA 1EFKA 3QOXA 4R84A 1KZ6A 3WQBA 3GYGA 3R0XA 2KHVA 3L92A 1G2IA 3K4GA 1YONA 3PITA 4ZOLF 2E48A 3G9XA 1APBA 4X1IA 1J0XO 5HE8A 2O2JA 1VGQA 3LT4A 2Y2UA 4UXHA 4ND6A 1KH3A 3NIFB 1UPHA 4PSKA 4HYTA 3WLOA 1OBCA 3Q12A 4C04A 3V72A 3L5KA 4I1UA 3L8GA 1D2HA 2PVCA 4KOAA 2E5LB 3TNLA 4N03A 2ZWPA 3IT1A 4AW9A 4XARA 4LCJA 2AIRA 2X22A 3C7AA 1GLGA 1GTJ1 2C59A 2ZITA 3T1HB 4Q15A 2ZRKA 2NV3A 1KE2A 2F1KA 4JP3A 3OSZA 3KDSE 3UT6A 5JTTA 4JWMA 4KXFB 2RP5A 3G82C 3RFXA 5KX5B 1EXDA 3F49S 2W7OA 2VN8A 3JXEA 1MAVA 5HE9A 5KNIA 2M6KA 5BVHB 5DNEA 2Z4SA 1Q0ZA 4ED0A 3ZZMA 4QQRA 1JHMA 4JMUA 5J8YA 1CRZA 3DE5X 2P9YA 1PT6A 1PVDA 4RQAA 1U90A 2J3QA 3A9UA 3HR8A 1GAWA 3V3TA 1ULUA 1TJ4A 2PKYX 2W2OA 3T79A 3HO8A 4TKVB 1W4ZA 1Q91A 5KFVA 1E9SA 2O1XA 1F3OA 2P8JA 3W2HA 2KMLA 2KV2A 3S7TA 2P9BA 3MUFA 1NJWA 3B6MA 4EJ0A 2Y92A 4EGSA 2O14A 4OHUA 4YV1A 1T2CA 3B8HA 2P2GA 4GFDA 4RIGA 3EUEA 2YUIA 1J22A 4JQCA 3NLLA 1IM8A 2CMGA 1HE8B 1PBNA 4L22A 4BMPB 1KJQA 4DCTA 3V8NA 4J6EA 4YPOA 4CHTA 1V1MB 4RHTA 2HQBA 4A2WA 3H2YA 1K8XB 1YCHA 1NGSA 4FYHA 4KLSA 5ALDA 4O4HB 4C30A 2Y3IA 4IDDA 1ODCA 2V6JA 1VIDA 4OH7A 2A5FA 3WFJA 4PCAA 5JBQA 1MFPA 2WDPA 3DTTA 5AT1A 5AIAA 3OF5A 3F6SA 2XB2A 2FRDA 1VMDA 3CQ9A 4GC6A 5KYYA 3M9WA 1BS9A 1M1YE 1RI1A 4XB6B 1OGYA 1WX1A 3ZDAA 2VKTA 3OP1A 3F5EA 3UK2A 2W4IA 4FE3A 3EFOA 3GMDA 1RBQA 3DR5A 1WUYA 1GITA 1JTVA 5I3ZA 1P74A 1BDHA 1SBZA 4JNCA 4COOA 1XZLA 1JHXA 3ER8A 1ZQWA 4RZ3A 4B3DA 1KDTA 3ZNPA 3ACDA 5EE9A 4QJFB 3KIPA 2C4MA 2Z3ZA 1LSUA 4IQUA 2BHLA 4IIUA 1COWD 1CY4A 1O96B 1FUKA 3RH0A 5BSUA 4F3CA 5JZ9A 4YRMA 1KO7A 1X80A 1ZQYA 2CD9A 2IYPA 3UENA 4JZKA 2IQIA 1YNOA 4CG3A 2DQNB 2X4DA 2XSZA 1V25A 2WAQF 4B6OA 3HRKA 5JZOA 2I71A 3LJKA 1A9XB 3MLEA 2H31A 3ZOZA 1EBBA 3T9DA 4O1IA 5EHZA 1XSNA 4P7BA 3IKLA 3H0CA 3GLQA 2QLJA 4FCTA 3E1SA 3BMOA 3UC5A 2EGUA 4P33A 4RKEA 5JT1A 1XX6A 2GCOB 3AP1A 3NQ41 2JAUA 3JVUA 3VJRA 3P45A 4TYPA 3FWHA 1XN1A 1JV2B 2ZJ1A 1AROP 3ORHA 4L7QA 4DB2A 1B43A 2OOKA 3BZCA 4J94A 4R0MA 1Q3VA 3ISDA 3OHPA 3LIPA 5F7OA 3S6JA 3R6TA 1ZS9A 5KSWB 1EDOA 2ZSDA 3DR3A 4J91A 3IEMA 2NQ8A 3KVVA 3KSZO 2VUSA 1J2EA 1XN4A 4MARA 1CWUA 4EY5A 3RT1A 4CI0B 4QWAA 3MT9A 3QE2A 4DQXA 4O0IA 2VJMB 1T36A 4M0EA 1XUOA 4JK1A 4KRGA 2UYGA 1RWPA 3CR3C 1ZNYA 2ZRLA 2ZXHA 2G9ZA 4WINA 2AXEA 3O9VA 1FJGB 5KQRA 3L7YA 2LYAA 3F3MA 1KA9H 2II6A 4O2AA 1TUIA 1KJIA 5M29A 4ANFA 1OC4A 3G1TA 4PHPA 2EP5A 3VDMA 2G63A 5E4YA 3D5QA 3GGPA 4F5PA 3CKYA 4ESHA 4LMAA 3UAVA 1ZD4A 2P2NA 2Q41A 1NT4A 2TECE 2ZTUA 1N32B 3U0BA 3L8HA 3ZKAA 4WVLA 2I4TA 3AB8A 3U1VA 2DR2A 5BXYA 4GP9A 4IR9A 1GCIA 1WWVA 4MV5A 2NLOA 1RR6A 4YJDA 1CEZA 4FJ0A 3P9KA 4JV1A 2YYZA 3RVSA 1NN5A 3Q98A 2IV7A 3VNBA 4E14A 2I7CA 4ZH4A 1Y37A 1BMDA 1L3SA 4RTRA 2E3JA 1QMGA 1OLXB 3D4OA 2IU4A 4FOOA 5E3IA 2W2LA 3SKYA 5T41A 3F3SA 3F67A 4RH1A 1USGA 4Y6LA 4BUCA 4J3FA 1MSWD 4BZZA 3QUQA 2AN4A 1JEJA 4ML3A 5FAXA 5CB8A 5TMEA 3VR5A 3AUOA 2QLMA 1VSTA 1E1QD 3F5DA 3D02A 3AW8A 2OC4A 4YRSA 2OBNA 1ZRNA 4BUJA 1YIDA 3NYRA 4DCOA 3WWOA 4RKRA 3CCCA 1ZXXA 3ESZA 4KN4A 3VZBA 1GARA 4ESVA 4LJKA 2O3QA 2XB9A 4OO3A 2BMEA 2P9ZA 2GEFA 5KQLA 1TM5E 3MQ2A 5GOTA 4TX1A 4NR0A 1CY8A 3UT5A 2G9VA 5COBA 2WRZA 3I6ZA 2CV1A 1D8LA 3URKA 4FFBA 2FK8A 4JYZA 4P7JA 3KUUA 3SCZA 1KBQA 5B6PA 1ZGBA 2DPYA 4U9HS 4QAJA 2JLYA 1ILWA 3Q9NA 4X8OA 1X13A 3NHRA 2CFIA 4L76A 4A10A 2NU9A 1F12A 5FNZA 3LSYA 3TTSA 1N6LA 3JQBA 9ICQA 2J48A 2K2QB 4WADA 3UWKA 1JX4A 2WM9B 1K8YB 1F6WA 1O9HA 1W87A 1CUXA 3M8RA 1UXHA 1K5GA 4KX3A 5HHHA 5J2EA 1Z5GA 1LW7A 5IEJA 2D74A 2FUG6 2CN1A 3FROA 2FLKA 2R8GA 4K6FA 3QVGB 3ZHQA 5HWSA 1G5QA 5A5FA 3R5JA 4X45A 5KKCA 3KQMA 2X0KA 4OXRA 5AW2A 2G3YA 5GADl 1E2IA 5EJ8A 2VBGA 4XW2A 3M1YA 4HSEA 4QGGA 4D7AA 2NSJA 5I7VA 3A05A 2ZTEA 1ZW6A 3RODA 4N18A 4KXWA 3DLBA 4WT7A 2H4WA 4JV2A 4F4WA 2DUMA 2BGTA 3I32A 3DZKA 2HRQA 3PW5A 3DVRX 1RYHA 3LD9A 1L8XA 3TW0A 4UUOA 4RPZA 4G01B 4HDCA 4TWBA 5FKJA 1K75A 2B8WA 4BLOA 3AP2A 5JARA 2PMCA 3MBIA 2AHOA 4LN1A 3MTBA 4DG5A 4LSGA 3T5JA 3RYHA 3QU9A 4MUIA 2YY5A 4PSCA 1L6IA 3MM4A 3DDHA 4BQOA 5KT6A 2F4NA 1Z73A 4KLZA 4RBNA 4YR9A 2Z98A 1P4SA 5K03A 2XUAA 5DI3B 1LF0A 3HCBA 1F0MA 1PSZA 4ZMRA 1E96A 5DHQA 1LTKA 4BLPA 3L8MA 3QYAA 4HLQB 1P2UA 4QECA 4MICA 1O0BA 1JG4A 1DC8A 5AW3A 1RYEA 2YJNA 1Y5IA 5JCJD 1O95C 2IT1A 4FOPA 3ECAA 1JDUA 1C8KA 4H2DA 8ICMA 2VXBA 2A9FA 1V45E 3FMPB 3G8BA 5AUOB 3IUBA 4DJAA 4BLQA 4YRAA 3OEWA 5D7NA 5LKRA 3CW2C 4C8OA 1MU0A 3AG5A 1J5PA 4CM9A 3CLSC 4KPFC 1PFVA 1DQPA 4BLWA 3Q72A 4RK6A 4A2PA 3E7FA 1KPGA 3HXPA 1UJBA 1DWUA 4V0LA 4TWZA 1VCHA 2NSHA 1VCIA 2WVGA 3T6KA 2WWWA 4Q7KA 1FC0A 1ESCA 2P90A 2V98A 4G9GA 2P5UA 3EZ2A 1JA0A 4OUKX 4LF5B 1V0JA 1NK8A 4MH0R 4MHSA 2J3EA 2PBFA 4XB2A 4BMCA 5T57A 3WLQA 2EW2A 4HGZA 4F6RA 1GXSB 4J43A 4G4SO 2OCKA 3QW4B 1PWEA 4D8XA 1IY2A 3OZXA 5TY0A 1XMOB 1AV7A 3C16C 1KFKB 4AF8A 1XG5A 1P6QA 2HZBA 3RC3A 2JI6A 5JZMA 3JQQA 1G60A 3RB6A 1QGYA 3RAEC 3CXUA 5JSFA 5F12A 3D4PA 4O3FA 2C0CA 3PNYA 4B2LA 2HBJA 4X62B 1NAIA 4F5QA 2QAIA 1MB4A 4AX8A 3HYCA 1STOA 3LBFA 3KKEA 1U0LA 1QUEA 1KHHA 4UVGA 2HHHB 1E64A 4JDUA 3UCXA 3NTLA 9LDBA 4OQ4A 3NXKA 3EPPA 5E1BA 1NQAO 3GFOA 2NG1A 9ICCA 4MCAA 1GL7A 3ORFA 5EIWA 2OGSA 1JT9A 4YX9A 4MDHA 1GPH1 2FEOA 3NIWA 3ZDCA 1Y34E 1TAGA 3EXIB 1O03A 3RFUA 5HEKA 4MYUA 5JFOA 1GG2A 2H1CA 5E7QA 1CC1S 4ZV9A 3C7TA 1KR5A 2CKMA 2P40A 3KD2A 3LG2A 4RWEA 3ZWKA 3C41J 2P9EA 1E0KA 1GO2A 4KXNA 4KQ1A 4U00A 5AW0A 1XLTA 3KETA 4GS5A 3QEKA 3RQSA 4RHYA 2P4EA 1E3JA 3NDRA 2B8JA 1NBIA 5JQGA 5CVEA 4BEWA 2POCA 4LMRA 3CRMA 4BJ1A 4JBLA 5CK4A 3WLJA 4ENVA 3CUEF 1AUQA 3USZA 1TIPA 4XUSA 4M1EA 3Q9UA 4DIOA 4FR2A 4EP1A 3ROGA 1N33B 3ELWA 1B3BA 2WUGA 2ZVJA 5FWAA 2K8AA 5IDVA 4GSYA 1Z7WA 3GJSA 3KR2A 1I5OA 2Z6UA 3Q5DA 6ABPA 4XWKA 4QZFA 2FLVA 4U63A 2X9GA 5I4KA 1Z5VA 2GEVA 4DRZA 4LIPD 5AKYA 1GQ2A 3EGOA 4OK3A 4DNQA 1CLUA 3LCRA 2YWCA 1DB3A 3CNOA 2Z3VA 1NY5A 7ICIA 2JFYA 1QH1B 2CYCA 4XX0A 4NOLA 1ZH8A 4NCJA 3U62A 3WK4A 4RD2A 3KXIA 2Y1JA 3IIIA 2ZIUA 3JD3A 3FYSA 2WTUA 1P5HA 3RT7A 3FSGA 3L1JA 2J4FA 2PH3A 4QOSA 2H08A 3VKVA 2YMMA 3BUSA 3JZAA 4QDTA 2XXBA 3UWMA 1I7PA 4B7AA 4HAWA 1G2PA 1UJ5A 4G0NA 5ICMA 1V7QA 2PHZA 2XHZA 1GPLA 2AN3A 1KO1A 4D0RA 1CF2O 2BSXA 4BO6A 1S4QA 2QARB 1O54A 2IX3A 4PG7A 3PSPA 5B4UA 3DNPA 3GT4A 2IP1A 1RQ2A 3AOEC 4MRAA 4DQKA 1OW5A 3R24A 2R6AA 1OI3A 3A10A 1NSTA 1G66A 2ZSFA 5AVTA 2R87A 2DFLA 1YBHA 3FPJA 3W3AA 1XK7A 2X42A 2I67A 4IDQA 4B0PA 4DJEC 1XCJA 4GXIA 5DHAA 3BWMA 1F44A 5C53B 1KFDA 2EU8A 3X1DA 4ARZB 5IASA 3P2KA 1Q57A 1XCOA 1XNHA 2GPWA 4HAUA 1V2GA 4DCSA 5DTIA 5K0EA 4RIHA 1CBUA 3CF4G 3JRXA 1WZEA 1XZQA 1QYVA 1HMYA 1PYOA 1WDMA 2H1OA 1T3ZA 3VV2A 1KRHA 2ZJ6A 4HN9A 1EVKA 1BDJA 3F2BA 4RKYA 4L9SA 2EW1A 3SJUA 4IRDA 3IIEA 1KEVA 2ZS9A 3LVBA 3LK9A 3T38A 1RLUA 1QZUA 4TUYB 3E22A 3ISTA 3SIPA 4XPIA 1ZH4A 4RMHA 1Z68A 1O6ZA 2OV1A 2H3ZA 5JH7B 2HIHA 3IBSA 3QK7A 1EI9A 4B4VA 4F5NA 1VJGA 3LYUA 4YT8A 3G5AA 2VLIA 4CM7A 2IIPA 1H6AA 1RQXA 3OT1A 1O8BA 3NYIA 5IKXA 4BGEA 1ZRMA 1WR8A 4K81B 4OMFG 3V8VA 2FFRA 3MWYW 2WSSA 5EMLA 3B3AA 4CQMA 2C2BA 4PGAA 1TLFA 5LU9A 1EP1B 3LHDA 2VHTA 2PY6A 3IHTA 3ZY2A 1D2AA 1NBME 4HQLA 1LS6A 3VHRA 1UZUA 2P3SA 4CEIB 4MWGA 4GYYA 2A78A 4E0DA 2Q6LA 3LUAA 2QYOA 1HM5A 4LVOA 4ZU1X 2E0IA 1SNYA 3L49A 3N0VA 4YA6A 3E9CA 1UP4A 3R3YA 3I30X 1XL0A 4XOIA 4O4IB 1G2OA 3TRIA 4MPPA 3ZWXA 3R6LA 5F1KA 3IP6A 1GKYA 1B0PA 1PR4A 3L4EA 4B3TB 4RLHA 3HBNA 2JJ2A 4ZT6A 2PFNA 2O54A 1Y8AA 3AB7A 2CXUA 2F8TA 4PLWA 3D8TA 4MK4A 2EKZA 4UUBA 1NSFA 3NAQA 3U3JA 3HVIA 4G5GA 1ZAYA 4ASUD 1II8A 4B6JA 1RABA 1WDKA 5HBGA 3TX2A 4ZXPA 1Q22A 5C3MA 4OQZA 4TTVA 3PUYA 1NK5A 2BKVA 1JIKA 1M2HA 3WBFA 3ODGA 4QIWC 2O3SA 5IEBA 1L5MA 2C4KA 1YA4A 4LHWA 3INYA 1RKQA 3O0TA 5BNFA 4CKYA 4KXYA 2R7LA 5KG3A 1E1KA 4A73A 1WE2A 4BKRA 3NRBA 1F51E 5SZHB 3PQFA 3SI7A 3TLMA 3EG9B 2Y1FA 3H1AA 1VXOA 5TISU 4WL0A 4NWIA 4W9MC 3ELYA 1YA6A 3GGDA 1F0KA 3ORRA 3COPA 3ZS8A 2OBYA 4M9XA 4XYLA 2VAMA 5IAJA 4DLXA 5JEEA 1WPXA 4IRMA 3NH6A 4CMAA 2FQXA 4PM4A 1CUEA 4F4XA 3CUYA 5CK5A 5FCDA 4KSBA 5J29A 1OKKD 1BPZA 1RIFA 4YJFA 3F5MA 8ICWA 1CRLA 4D44A 1A50B 5L53A 1NQ5A 3P9IA 5BSGA 1QHYA 2W2VA 2WWIA 1WBDA 1KRWA 2ID4A 3TW8B 4H18A 5M7EA 1Z6TA 1PE0A 2PRYA 5KTOA 3H5AA 4XIJA 4IJVA 5LC1A 1R27A 1EX1A 3OCWA 3DMFA 3ZVMA 3Q8QB 2WMNB 3A06A 4AI6A 1WDTA 2QJRA 4Q00A 3BJMA 2FZ5A 4OYYA 3WNZA 4WNCA 1XELA 1R0CA 2HUNA 2QGFA 4IIBA 2JI9A 3Q3VA 5CVDA 1K5HA 3GD7A 5ISMA 1VYTA 3DXFA 3OKAA 3AHDA 2OHHA 5FOTA 1EK2A 2G1JA 4WKCA 2B6GA 4CKBB 4MVJG 2XZPA 2JLBA 1HQYE 1D1TA 4Z9BA 1AUOA 4ZYWA 4NYMQ 2FMQA 3PNQA 2BONA 1NZPA 4KVZA 3NHUA 3WNBA 3G2MA 3AXSA 1XTUA 1IB6A 4OV6B 2PI5A 4PC2A 1LCIA 3HFSA 4FE4A 4UMFA 4US2R 5AH0A 5BY2A 3PXBA 1YR8A 3WYAA 4EX6A 3DTVB 3WWDA 4OAPA 4YLYA 3PHGA 1E2DA 3H6HA 1U9IC 3MJDA 4RA6B 4CF5A 3T7KA 4NU0A 3QWAA 1ZK2A 2RG7A 3A6PC 4L72A 4IP0A 1IG3A 1UFVA 4YAJA 2BZGA 3H9CA 3GJTA 1R4ZA 3BQ7A 4D9IA 3TDKA 3PDJA 1E8MA 1I1NA 2DKNA 5B6JA 1B8NA 2LPEA 4MRPA 1OZAA 3AR4A 3FFTA 3T7AA 2ODNA 3RB8A 1SBTA 3DLCA 3EEOA 3IB3A 4PXSA 2CVHA 4KLMA 5C1IA 5CEEA 3RRBA 3NX4A 1W34A 7ICTA 2WWFA 3TX6A 3NBAA 3F2CA 4D8VA 1DBWA 1ZVVA 1U4SA 1RDFA 4BCCA 4EYIB 1ZQTA 5CHGA 4ED3A 3AYZB 1SULA 2F1IA 4EYQA 2VDVE 3C14C 5BWCA 4PBSA 4RQ2A 4D74A 2V3WA 1KKXA 4B9NA 8ICKA 1QFXA 1TYAE 4N65A 2O6HA 4TSFD 3CYMA 2AF4C 1FQWA 1MA0A 5EMMA 4N3CA 5JCOA 4FZ5A 4MINA 3IT3A 4L8GA 1CJKC 2C2EA 1ETUA 1XNQB 4UJ5A 4D43A 4AMYA 3LHSA 4BE9A 4BFLA 5TQ0B 2C9BA 4PZZA 1G291 4KAFA 3S1AB 2ZRDA 3OZWA 1SGWA 5FADA 2HJSA 4JASB 1AM4D 2Y9TA 2R3SA 2Z30A 3ZV6A 1VRCA 3FHLA 4LV6A 1W96A 3L43A 4L8FA 4JWTA 3RSQA 9ICKA 3IUEA 3RKUA 1S02A 1V38A 1AGPA 4RD3A 4PINA 2PO5A 3BFJA 1DUVG 3WK8A 2BE7A 2RGYA 3CSDA 3A11A 2RGWA 1X9XA 1P61B 3G5UA 3IKVA 1A2BA 3CISA 4PYNA 2BFAA 1PUJA 5ER6A 2F59A 3UWDA 1T4CA 2XLCA 2WNHA 1UT6A 5AVXA 2G80A 3BFXA 3IJ5A 1MOZA 1DAHA 2BJWA 4MQ6A 4HH4A 2NZVG 3COZA 2BCSA 1GGEA 4KV7A 4HDMA 2JIDA 4IV0A 2O8DA 1V5EA 3V1YA 2BM0A 4R2HA 1VHJA 3RR7A 1PGJA 2FHPA 4QPJC 2DEUA 1GZSA 4HQFA 3BZBA 2AZ4A 3WB0A 1H4VB 3J81j 1QH0A 5M2QA 3EGVA 4HQ0A 2H5XA 2QTBA 2WAOA 5EUMA 5TVKA 4ITRC 3SVLA 1V7PC 1B3RA 5UKDA 3MBYA 4FB4A 3DWGA 8ICGA 1JKJA 2G5PA 4GKKB 4UAGA 3BSSA 1KS2A 2BGWA 2EYUA 5AM3A 2I2AA 3BJIC 3UZUA 2Q8NA 3I4CA 4I50F 4RV9A 5KNBA 4K6OA 3HW8A 2G77B 3E9QA 2ZKIA 1WW2A 2E2WA 2ATCA 4NAHA 2WM2A 1BEUB 2HA5A 3ZDXB 4GF5A 2W2KA 2X76A 4MW5A 9ICXA 5CDHA 4F5ZA 4XXHA 1KMHA 3ZQ6A 4QJ4A 1GGMA 4MVJF 1DBPA 4WZ6A 2X1MA 5KTNA 2JH8A 3NBXX 2BCGY 4BQIA 3Q85A 5ALHA 2YDXA 3CNEA 1MO2A 1GU0A 1FRQA 3FZYA 4M8LA 1CJVC 4R66A 1WKVA 4J0EA 3THSA 1HDOA 2F7SA 1PDVA 3BIWA 4FQ7A 4M22A 3A31A 1Z3EB 3MT7A 4P3KA 4AKIA 4MWTA 1XL1A 3TQFA 3IXLA 1Z16A 3AYXB 4EGAA 2P7IA 2Z8YA 3KKLA 5LXTF 1YOVA 5A4FS 3ZHOA 2D1TA 5JI2E 1JB1A 4I2VA 2X13A 2A9PA 2WWGA 1FVOA 3JASA 1QIEA 5KFKA 3FZGA 4XQ0A 4ZCPA 3D3NA 2Q9BA 2BMFA 3ZHSA 5CR9A 4ZRDA 4UZSA 3GPLA 2QTCA 3IMKA 5DLFA 2P2YA 3ZCPA 5K8IA 3K0CC 1VHWA 1L9KA 2JL1A 1TW3A 4J7UA 5ERXA 4H0CA 1R5NA 2X58A 2CHQA 1N2JA 1KSGA 1SWVA 1SG6A 1MD9A 1PS9A 3RGWS 2JKVA 1R3DA 5LQUA 1HL7A 1Y3AA 1PT9A 1U0FA 1PKEA 4DB4A 2BFMA 3B5IA 4YRJA 1JXAA 1PFWA 1SOVA 1VJ0A 4TQRA 4GI1A 3JQGA 1ZHHA 2W98A 1AGRA 3SZMA 1B6RA 2J6IA 1VCOA 4KXQA 4EMBA 4JUIA 2Y0EA 4JSYA 1A9SA 4PRZA 1OFHA 5K2OA 4PX9A 2KX7A 2KP7A 3QW2A 5E1MA 4CG1A 3N2KA 1M8GA 2I2XB 2XUHA 2AU0A 2ES6A 3A1VA 2IBSA 3N3BC 1PR1A 4RLFA 5KKAA 1W5BA 1DKPA 1GRRA 4R1QA 1P4GA 5K3FB 3VH2A 1ZJ5A 2IKQA 3QKIA 1VE3A 2Q5QA 3CW8X 2VHWA 3BE8A 2XWQA 1GAXA 3SIXA 4GKAA 4MUAA 2W6MA 2V0NA 5KFQA 2MSEB 1P5RA 3LCJA 2XI4A 1SUEA 5AW5A 1QNFA 2FUCA 1T9HA 4D80A 1FXWF 2C3UA 1ED1A 1R0WA 1MOPA 2IELA 1JAHA 5EHIA 2WHEA 1P2BA 1PD0A 5DBEX 1QKIA 4NX2A 1K97A 5DLDA 1XZGA 4G3IA 3ADDA 3T5BA 4OP3A 2ZRQA 4E4YA 2DTEA 5FOXA 3UMFA 1OHHD 1TU4A 1XALA 4QTYA 4KIGA 4PAQA 1GV1A 3GCWA 3LKDA 5DSXA 1TT7A 1ESNA 4IHJF 2O7RA 5DYWA 1QX3A 3KB2A 1PWZA 3KCNA 1ZU5A 1CY6A 4IIJA 4M54A 3VO1A 3BE5A 4EELA 1V1RB 4LHYA 5AKZA 2QROA 3SD7A 4YUAA 1S2DA 2G5TA 7ICPA 1EHYA 1GQFA 3ICPA 4XA8A 5JJCA 5CXXA 1QGUA 2FVXA 2ZIZA 4Y6RA 1D8AA 4E5YA 2WIAA 1NLUA 4F5YA 3F97A 1NXSA 1JP7A 4HN4B 1K89A 1BDBA 3LX4A 3VNUA 3IDWA 4MRMA 1B6TA 2WYVA 1C9YA 4JU8A 3TCNA 2DF4B 3QUBA 1GP2A 1O94A 4XPZA 4C8MA 2QNBA 1Y82A 3DA8A 1SKWA 1Q3HA 3GQCA 3B89A 3GDXA 1XDWA 4DQVA 4Q4HA 4WCFA 5J23A 4YJ3A 2YWRA 3WICA 1KARA 1RJGA 3IQXA 4CKCB 1T5LA 3JPOA 3RH6A 3L82B 1KIFA 5HYVA 1PGOA 4M9NA 1VA4A 2YCLA 1EFLA 2DH5A 1J06A 5EL0A 2XGGA 3MRXA 3X1XA 2ATXA 4HQRA 5FOSA 3DVSX 2ECKA 2P2LA 3O6VA 2J3KA 2XY6A 1CCWA 1S0NA 3HU3A 3HKEB 4D3FA 2FPPA 5B3JA 5JZSA 1XD8A 1ESMA 2VXCA 5CW2A 1R4MB 2MYNA 5HF6A 2R85A 4HPWA 1K8QA 3PUJA 3F1KA 4X7RA 4JYPA 3VC2A 1XMXA 1W1IA 4B7ZA 4BNFA 3M81A 3BX1A 3UVEA 4GNRA 3VU9A 4YI5A 1PEKE 3DLHA 4NE7A 3O3MB 1D2GA 3GUCA 3IBCA 3KT0A 5D00A 1Z5PA 3U80A 3NC1C 3PYLA 2DE0X 3GT7A 4X9XA 3QLVC 4AKSA 2VUHB 3ZHYA 4MEYA 4M46A 3WZLA 3GAAA 1DKUA 4H9GA 1WSBA 4D5GA 3RBVA 4KTQA 1QO0D 4C0QC 2ZBVA 2PUHA 3IOYA 1TIKA 3PCRB 3W90A 4EBDA 3WZMA 2YHBA 5I48A 4BE7B 3WLEA 1CE8A 4CEJB 1F5SA 2CPRA 3REFA 5JMWA 2G09A 2FP3A 5I9LA 4NS4A 3TXXA 3RC7A 4ZOCA 2VWHA 1RJEA 5FT9A 2HEGA 4RNOA 5A5DA 1L4HA 4YJ2A 2DWOA 2YXDA 3H5VA 1YE5A 1AQ6A 4ZVVA 2CJPA 2GCGA 4W82A 4L4XA 2ECFA 3I6MA 3LC7O 3BDVA 3GZNB 1ZM9A 4JC5A 3U09A 5EWMB 3W5IA 3A7DA 1DUIA 5E95A 1S0UA 1VDZA 3OZAA 4RK7A 4PQFA 4RC9A 9ICAA 4I55F 3ZV7A 4P2BA 4C0KA 3KZMA 4QZHA 1QSSA 3A6HA 4E07A 4YMHA 2PCLA 5JUMA 4KO4S 3GDHA 2O2GA 2R8JA 2MRLA 4OHRA 4BFVA 3VYUB 4ZU6X 4YRQA 4IJ5A 2HR1A 3K73O 2NAPA 1NK6A 3AI7A 3EPHA 4R63A 1N3YA 1JWAB 3SZGA 1B26A 3UMRA 1Y8ZA 3SEAA 3I28A 4HK4A 1EJBA 4L02A 3KVRA 2IEGA 2C7VA 3A25A 4LF6B 4C7MA 5K5EA 4M7OA 3NTVA 2AOUB 3FGPA 4Q7JB 2BFFA 3N53A 2CWWA 1R8QA 4BMNA 3SAGA 4PGHA 3N7SC 3ZLBA 3LY7A 1TYCA 5KYTA 2C5GA 3FWPA 1YQUA 2N46A 3FAKA 2CYAA 1FPMA 3TM5A 4DNXA 3WIDA 2FGKA 4L9AA 4RY9A 3N7RC 4PZNA 1XRPA 4E4RA 3IKMB 1JSZA 5TF4A 2R86A 3BYZA 3KHLA 4WAUA 4G0UA 4JI0B 3ESQA 1X9GA 3JQ9C 2BZSA 5FXMA 1OJ7A 3WDKA 3A3NA 1RM0A 2QYTA 3R3UA 4FINA 5LNK6 4DC9A 2E1EA 1O89A 3P8ZA 1Z0KA 1YHZA 1G6OA 2R5WA 3U3XA 1NVGA 4WY8A 2F1JA 4ER5A 5LP6C 3TZEA 7ICNA 1QAQA 4RUKA 1NZFA 1Y81A 3VR5H 1GFZA 2O2XA 5YASA 3U4DA 2FWBA 2PKEA 5ARDA 5CJ7A 4J16C 4RD1A 1E18A 2BKLA 3P9YA 2QMZA 3P20A 4AY6A 2BLLA 4HS4A 2MSWA 2XUZA 1GL3A 4TXJA 3QU4A 3OX3A 5FOVA 1GGHA 1G8AA 4N5HX 3I58A 4UU1A 3GIJA 3AM9A 3GLRA 3X1YA 4ZZ1A 2K4MA 1VMEA 2IUFA 4ZOBA 4TQUS 1B73A 4RPLA 3NHLA 2Y1OA 5LLTA 4QZGA 4LCEA 3AI2A 3IYLW 1IN6A 3V4OA 3N28A 1Z0UA 4WBNA 4ZFNA 4FI3F 3UWOA 4PFQA 3TQCA 3CR7A 3W6NA 3ROPA 4OMDA 3IVXA 1U2GC 4MV3A 5KBYA 1CY1A 3LX6A 4E5UA 3GI1A 1D8BA 4D0NA 3MPOA 1J4AA 5FTWA 3IG5A 4EVQA 3B6JA 3D2NA 2DBZA 2YHIA 2ZG6A 2EZ9A 1LWOA 3AFNA 3KWMA 4FYWA 1VSVA 1YR1A 1L1EA 2NVBA 1LW6E 3BRSA 2ECOA 4XVCA 5C18A 2DPMA 2EJBA 4DJTA 4DPMA 3BTSA 4XVQA 5EJ5A 3P9QA 5GJWC 3ZVNA 2MJLA 2PSFA 1P17A 4BS9A 1ZQ9A 3UIEA 4U1RA 2G40A 4GUAA 3KSDO 4LC0A 4H7EA 5HR6A 4KE7A 3KKQA 4C4ZA 3U44A 4WZBA 1R7RA 2FE9A 1KL9A 3V4LA 3PIIA 3CNQS 1Q7RA 4X20A 2QVCA 3L7JA 4ECVA 2FWAA 1AX9A 1R6XA 5DB6A 1F0YA 3HBAA 1XVVA 1NF8A 3G7UA 4L5CA 3O9MA 4H7FA 4IGFA 1FFUA 1Z28A 4MA0A 4LZZA 4GXKA 4H7IA 4MQFA 4ED7A 4YAKA 3RJTA 1OLUB 2J6CA 2RBGA 5HBRA 2Z5FA 3L7KA 2OENG 1SV0C 4LZAA 1BE0A 2P30A 4RLSA 4V39A 1S77D 2RI6A 3LQ4A 2DY1A 2XB4A 3OCCA 1R6UA 3MGGA 5TMPA 5CPBA 3OIDA 3CONA 1QFZA 3CLUC 4TROA 1IHXA 2V4RA 1AH2A 4RDIA 4M6WA 4HF7A 4XEHA 3THYA 2Y27A 2QXUA 3T61A 2JCXA 4MI6A 1VI2A 4QUHA 1ZMBA 4KL8S 2HF8A 3WYCA 1NP3A 3GLFA 4HZGA 4AUKA 4TLCA 3OIWA 2FX5A 1OFUA 5AW9A 2IE8A 1SBCA 1E6MA 4FN5A 4PSUA 1J23A 4CNBA 1SHLA 2VDUE 2JBAB 1WSDA 1AG9A 1DXQA 2G8LA 3ONEA 5D5PA 5FO1A 4EB3A 4DRXA 5A4DA 2WHPA 1OZGA 3WL8A 1TB4A 4HWOA 5HA5A 4CQNA 4QATA 2YH2A 3LUKA 4LXIA 2QR2A 1XVUA 4N8SA 1JVNA 2EFCB 2ODAA 4RY2A 4R41A 3Q15C 5FOQA 2VKQA 5IINA 4NZMA 2NGRA 3Q5GA 4KX5A 5DQGA 4GXNA 2XQIA 4HRAA 1OV6A 3TLKA 3PVZA 3MDAA 4G6ZA 4BVHA 1ZDMA 4GU5A 4K8OA 1M6WA 4LQLA 1T6YA 3D8BA 3KP1A 1FDIA 4ZJYA 1WMAA 2ZI5A 3LMKA 3C6YA 4RF5A 3G7SA 3BGIA 2IV2X 1TEHA 1CZNA 1WXGA 2EZTA 3QFRA 1LRLA 4JP2A 1XZPA 2HDNB 4ZIRB 3NGDA 4TZTA 5MGNA 4QARA 1JU4A 1CHNA 1C2YA 1HETA 3O1HB 1UPBA 2B4QA 3H16A 1KK0A 4J1QA 4CLRA 2IV3A 3JYQA 5CD9A 1NQTA 2HSZA 4UBCA 3FETA 3PXXA 4F91B 3FSRA 4LJLA 3AUXA 1SH7A 1IUOA 2ZULA 4R31A 2E4AA 2I54A 4F4KA 4YAGA 3B9PA 5CNJA 3KSAC 1FZTA 1OC2A 1M83A 3KG2A 2WF9A 1AZTA 5LR6A 1SK9A 1HE3A 2X2PA 1RW4A 3DBHB 3E3AA 4OF4A 3SJCA 1C0PA 3LUCA 5AIBA 2IW3A 1P8AA 5H9WA 4JHLA 4MUFA 5L1KA 4EYEA 3PB3A 4B75A 3SICE 1Y1TA 2H6EA 4C89A 3H6GA 1O7JA 5E9AA 3W06A 5IJAA 1GA1A 1SD1A 2YTZA 4K1LA 1VJ1A 1RCTE 4ZI7F 1VB3A 1BCRA 2C2DA 4W5HA 5H80A 2VDWA 2QYHA 4NZOA 5EWGA 2XUQA 1HLFA 3VNQA 3ZNQA 4F1KA 1QFJA 4LBZA 2D0DA 3AR2A 3DFMA 3BXXA 4QZIA 5LN1A 5TS2A 3V4VB 2ZJYA 1A9ZA 2JGLA 4Z3KA 4TTIA 1W0JD 1SZPA 4OATA 3AF1A 3AG6A 4KHZA 3C48A 2OYCA 4FZLA 1HDGO 2OCBA 2NRVA 1KP2A 4I2GA 3B1YA 1WXQA 1D6MA 2M2IA 5E2AA 2B8TA 1ID1A 3I04M 1JDBB 3M6VA 3A36A 4L2IA 4MAFA 4X7PA 3QJ5A 2XEDA 4AO7A 2B1JA 4G81A 5ITSA 1ZK1A 4YPVA 2IEZA 4FLFA 2QI9F 1Z08A 4BB6A 3W05A 3SAJA 1QOPB 4C7OA 4NH4A 3CLKA 2W6JD 5KYKA 1MB0A 3ZXUB 1HR0B 1RD4A 3WLIA 3AJRA 4BJHB 4FLMA 1S7CA 2YV1A 2QT9A 2B61A 1YI1A 4P38A 5K99A 3MRTA 2XAAA 5ALUA 3R5HA 5DXAA 3KQHA 4DSEA 3QHPA 4KLAA 2BEUA 1ZQVA 4KLOA 4LXHA 5FUBA 2JEFA 3U3OA 3KZXA 3EGDB 5A7GA 1HEYA 1NW6A 1TK3A 1YC2A 4G5SA 1GQOA 3SGLA 4TUPA 4HEA6 4TYQA 3G9UA 4P7FA 5DIZA 3D0RA 3S70A 1RLMA 4UEJA 4HLUC 5HKKD 2P5TB 1A97A 2FX2A 5IT0A 4KK3A 3ABRB 1S7GA 3GHYA 1NJZA 2P66A 1KBZA 3GJ5A 4QOGA 2QPLA 1OTHA 3UJ8A 2WZDA 2ZS8A 1TVAA 1LX7A 1P62B 5FEMA 1MVOA 5EP2A 4E70A 4O2BB 3W3AH 3T1YB 4RS3A 3DKIA 3EYZA 4JQYA 1BHSA 3ZWPA 3WGQA 3SQDA 1EDDA 3H5WA 3RFTA 4EBBA 2IGTA 2IUYA 1IZZA 4KWCA 1T1IA 4FGSA 1RNLA 4LZLA 5ERGB 4GI2A 2AG1A 2LVBA 3VPFA 4Q43A 3DB2A 1HGXA 3I12A 3L0OA 4NU8X 5K8UA 3EXHC 4AUNA 1L4KA 2BGUA 3SJ7A 4QXMA 1WMDA 5IUKC 1DI0A 3RYCA 1KDZA 4BRZA 3GJ3A 4RPJA 1DC3A 3BS4A 5F5NA 3RAFC 2FR8C 1HQCA 3NGLA 3HKDA 2Z2IA 1CKEA 2FW1A 4DDKA 4XQEA 4EECA 4ZMSA 2FSFA 2C8LA 1JXOA 1PEYA 4IS7A 1F8GA 1ZN8A 3HVJA 1V6AA 3ZU2A 3JARA 3W8EA 1Z45A 5B37A 3FIUA 2QTZA 5LVAA 1C1DA 1KEUA 3F5QA 3MWEA 4P8RA 1TKBA 2VOJA 4TYWA 1G21E 2PANA 1SXJB 3P0JA 1I1OA 3WLKX 4J90A 3PT9A 1WCV1 2NO1A 4ZDIA 2QG6A 2RGAA 5ITWA 2VYND 4KMOB 3JSAA 4BDSA 1DV2A 7ADHA 1V26A 1KNQA 2D59A 1ADFA 4R6WA 2EAMA 1AQIA 5KHAA 3W1EA 3QY9A 1AU9A 4LPKA 2VH5R 2W8ZA 2ZOSA 2AN9A 1UJNA 5IARA 3KQOA 5KFOA 1I3CA 1SVKA 3FA2A 2XTZA 2IZZA 4OJQA 3GBSA 3EN0A 1WXDA 2PKXA 4L8LA 3D6NB 2O8EB 1FUYB 3VZQA 3EAGA 2EIHA 4BQRA 2FDXA 4DOBA 5KYXB 1UXOA 1GEGA 4HVAA 2G9QA 1SURA 1FX0B 1QANA 3GMSA 2Q8PA 4O3NA 2B6NA 4QM7A 4GKBA 3GUHA 5BMVB 2EFYA 4M83A 4UHDA 2DC1A 1Z7YA 2IK8A 5J1SB 1KI6B 1Y3HA 4H4DA 2JIQA 3W3ZB 3AOEA 3TIGA 1XYYA 3R1IA 3L6RA 1JI3A 2H48A 4DTIA 3KSBC 4DXDA 2RHHA 5CP8A 2VF4X 1MFZA 1YS7A 1JR3D 3PKJA 4I1OA 4UUPA 1T1GA 4P4NA 4X8LA 3ZDZB 4KODA 3IAEA 2GPJA 1ZC4A 5EJEA 4IGAA 3VPDA 1FFYA 4H1UA 1ZQIA 5AI6A 3UAYA 1PNRA 5MN6A 3V46A 5DOZA 4LYEA 4LJRA 4EZ9A 1Q0SA 5IYZA 2WSIA 2LIPA 2UUOA 2OG1A 1D2EA 4MTLA 1OPXA 1FYWA 3RIHA 1EFAA 3IP7A 2H7YA 4PZ0A 2KK0A 4OXQA 3MJ4A 1JQLB 2AXPA 5K9ZA 5DYIA 3GP5A 4BB0A 1KDOA 4DIBA 4W7SA 4IICA 5EWFA 1Y33E 5GONB 4ME6A 3K8OE 3L6UA 2W11A 3JAWB 2QPTA 1UZAA 2AC2A 4BKMA 3QV2A 3E4DA 3K92A 5MN4A 3IB6A 4CKEB 4LNHA 3DDOA 3QVKA 1UBMS 3JPNA 1XDSA 1J2YA 2PLFA 2D4HA 2JASA 1HT1E 1YMVA 2C9ZA 1HNWB 3CGWA 5KOYA 2XX3A 3RHSA 1K8ZB 2YW9A 1TMKA 1Z15A 1HE4A 1N5XA 4XFKA 1TUBA 2PJUA 3LM8A 1OXJA 2IPLA 3RU9A 1J42A 1I10A 4QU5A 4JIMA 4INAA 1U5BB 2GVZC 1QHIA 5FJIA 1WXXA 5TF0A 3TKAA 2W43A 2EEZA 1PZGA 5CA1B 2BLNA 5TPWA 4NAVA 4NL9C 1K1SA 4QDKA 5KJCA 2J8ZA 4DLBA 5BO5A 3IQIX 1RADA 2AR9A 3AUUA 2WKWA 4F50A 1YU9A 3TI7A 3O8LA 4XCQA 1SJ9A 1XF1A 3ENVA 1SC3A 4JQZA 8ICJA 3AINA 1O08A 2GCPA 1E3QA 4KRFA 4WJ3B 1HT2E 4UCQA 1PWHA 2D0PB 3CB2A 4B79A 4DZRA 3BVPA 1XYGA 4Q37A 1U8YA 3GN1A 4LSZA 2QW8A 4CDRA 1ORTA 4QWCA 3R6GA 1W4CA 1KRXA 1FMTA 4KJZA 1KU0A 2HJGA 1N5IA 1P7PA 2L2QA 2X15A 3ETNA 1X8JA 5FBRB 2HBLA 1YA8A 1IXYA 3AVUA 1AMUA 3P52A 1UIMA 3ISCA 3N59A 1EFHA 2QV7A 4A2QA 4B31A 3FKQA 3EGXB 4LGYA 4F0JA 4QC2A 2W37A 4ZQHA 4HSGA 4YONB 2CB0A 1GPDG 3LA6A 1W2GA 2ZTDA 5EP3A 2VUTA 3N76A 2CNWA 2K4EA 3QWHA 4GX0A 5K3SA 5TIIA 2B7LA 1DJPA 1LI5A 4QUGA 2ZPAA 2PLRA 3OLWA 2ZZNA 3QF4A 1L7XA 1CD5A 5LYJF 1PR9A 1F6DA 2CV0A 2NQ2C 2YQZA 3UN1A 2R62A 1NX9A 4IIFA 3D6AA 3ESCA 3OX2A 4UNPA 2J32A 3DTNA 2FUKA 4QDZA 2FQWA 1V5GA 5ALJA 1L6NA 4URHA 5J5CA 4DA0A 3RIEA 4G5RA 2E85A 5IVPA 3CNNA 1G0OA 3T1TA 1SB3C 5ADHA 4MIKA 5TEWA 1IZ9A 4F8YA 3MABA 3A70A 1JEYA 4IDHA 1Y88A 5THXA 2H5LA 2YRFA 4GXRA 4K5QA 1FFWA 3ZI0A 3ZU5A 1A76A 1F8UA 4TQSA 2PFOA 3BKWA 3R7SA 4LXQA 1YU6A 2P41A 3AQFA 3GOQA 4RZSA 3LQKA 3DVAB 4PQRA 2Z2JA 1GGKA 4LJXA 3RRJA 2AG6A 3QMPA 3HCAA 2AI2A 3ELDA 1AXGA 1XZEA 1H93A 4CM8B 2KMDA 5B2EA 4P0PA 1IM4A 3DHWC 5DNVA 4OBBA 2J67A 3NRZA 4M0CA 1TM7E 1EDEA 3WAKA 3R5TA 5CAEB 1XTSA 1JQAA 2QN6A 3WYFA 2P79A 1GAJA 5CUQA 5KQMA 2K89A 3HV2A 5JALA 3NR2A 3WL4A 1ZUNB 2KJQA 2G08A 4TT3A 4X85A 5KTTA 4TKUA 3Q0EA 1BA3A 2VDPB 2QRLA 4JP8A 2GRJA 3EZLA 1U9IA 2ZIFA 5J2BA 3O92A 4N4AA 1EWYA 4PTYA 1M2FA 1LKYB 1E7YA 3SKXA 4UTOA 3ZBUA 1TA0A 4J8PA 1YRBA 2FLLA 1G8HA 2AFHA 2E3TA 1BU8A 5KNBH 1S2MA 5A0VA 3OHAA 5HJ2A 5CJ2A 4EAQA 1DVRA 5JVDB 4RHFA 7ICKA 3G6KA 3H1GA 3SSMA 4MGKR 1XQ6A 1ECFA 3ER9A 1Y3IA 2Q7XA 2Q3EA 3HLYA 3D8HA 2YUTA 3HPOA 1A2OA 2MR5A 2OXIA 2O7NA 1EHIA 2H1WA 2CT8A 3V4ZA 5G0UA 5INTA 1PU2A 2Z9DA 2FWIA 3IAM6 3STUA 3TEJA 3K9FC 1GA4A 1EZ1A 3UJ3X 3NASA 3U7FB 1I2BA 3SFZA 5G5GA 3D9QX 2C03A 3CTMA 4MIYA 9ICFA 2YHAA 1K6XA 5FTJA 1J33A 2ODWA 4HGQA 3PGXA 4WA8A 5IDYA 3FPSA 4DJFC 1RM5A 1QB7A 3M70A 4MS1A 3RIGA 4BTEA 3Q8LA 2IBMA 2XNDD 1SPBS 4ND2A 2W6QA 5CU7A 3ZKWB 3GJ7A 2W42A 2QTAA 2IBKA 4UM9B 1JZTA 2YXBA 1V8BA 4MR9A 4I2AA 4PVDA 1UBRS 3V1NA 1N7HA 5DGIA 1OBHA 4JT8A 3N7UA 5F9MA 1RXUA 3GCGA 2CJWB 4WKGA 1CHDA 2DWPA 2BCUA 2H4ZA 2PDAA 3E0XA 3D7NA 5C0OE 4UW9A 3BQMB 3FDXA 1VKNA 4A8HA 3ZJTA 2XYVA 4AUMA 4UAVA 2E5WA 1I7DA 1F17A 2XMGA 1L7EA 4Z9XA 1CUFA 3U6BA 3CZAA 5L3QB 4X1YA 4KACA 5IU6A 4NXZA 2F3NA 4GVPA 1PG5A 3PIRA 4HL6A 4MW7A 3MGIA 3CN9A 1W36D 1XCPA 3HUFA 2EFGA 1RM6C 3V6KA 2YDYA 2PUJA 3BIJA 3BD7A 4JT4A 3QWIA 4JN6B 4BNLA 3PF8A 5ICEA 3RROA 2NACA 2PXXA 4A8TA 2G07A 3LWLA 4FK8A 4JD5A 3ZLTA 3GLIB 3LVQE 2YWDA 1E1NA 2GF2A 3FRJA 3K7EA 3BWDD 2Q0HA 4H77A 3RRXA 2D7DA 4NG4A 3IO5A 5FFNA 2RJ3A 1OYWA 3UJHA 3VKWA 1LPSA 5EP4A 1NXPA 3PPIA 1C9MA 1FRNA 3HYNA 2OHGA 1Y89A 1KI1A 3B60A 4KO2S 4UZEA 4PPQA 5EAIA 1RAFA 2A0WA 1CXZA 2N0SA 3UJPA 1FNMA 4M7RA 2B0JA 1X40A 1H2YA 4GR4A 4FS8A 4OOEA 3B82A 2WWTA 5C8VA 3SJAA 4E09A 1TM2A 2F55A 2VP5A 4WN3A 1PUZA 1RFLA 5KWJA 4PN3A 3C3JA 2WIKA 3NH9A 3NNNA 3L7OA 1F3LA 1OLOA 2DQSA 4CMJA 2YZ7A 1XU4A 4G2NA 1OXBB 3BL6A 1VL2A 4HT3B 4NFYA 2ZAYA 4O2LA 2HLDD 1QIFA 2Q4TA 2IDJA 4NDAA 2F3PA 4MSUA 2UYYA 2VK8A 1JHPA 2H2GA 1BCSA 3HPRA 2HU5A 2A67A 4Z5XA 2HLPA 3WRXC 3NIGB 4HJRA 3GB9A 3AFOA 4XUCA 3MG9A 2IHZA 3OZFA 4CR8A 1OH8A 3NORA 1HUQA 2ZI4A 3U7RA 4R3WA 4F86A 4MUYA 4QUDA 2XRYA 4P0TA 1Z4OA 2YWXA 3BQ9A 4BVAA 5HMLA 4IWNA 1CT9A 3O93A 4DXHA 5FORA 4MR8B 1XKTA 2BTOA 1OREA 4B35A 3IQHX 4U2KA 4FYVA 2K6GA 4TV9F 5T14A 1M2VA 1NBMD 2YVUA 4IVPA 4LF9B 1OR8A 3VHXA 4D4GA 1P2DA 4E32A 1US8B 1K1QA 4RSHA 5B3KA 3I2JA 2V6BA 5HCIA 2H06A 2HKIA 3RASA 2JG3A 1Q3UA 3K0CA 3JU3A 1AK9A 4RWZA 1TGVA 1KGDA 1AZSC 4MRSA 3B85A 4NULA 2ZRGA 4D26A 1LDGA 2ZUBA 4M0KA 2RC5A 2YMQA 3EW9A 4TUQA 4NZPA 2AFIB 3K6SA 1R12A 4EYKA 1UXGA 2OM2A 3G88A 4AN4A 1IOLA 2QTTA 4UAYA 4FYKA 2H4YA 3HGTA 5KFPA 1NW4A 3Q8SB 4Z7NB 3WY9A 5ALQA 3UTCA 1L5NA 4NZNA 5D1NA 1DV1A 2OAGA 5CD1A 4H31A 4V0ME 2DOKA 1H3EA 1MQ2A 1PUXA 3IIKA 4QASA 2O7SA 1YAJA 4WESA 4YFYA 2COUA 4KU4A 1VLQA 1D7AA 4MQLA 4ENWA 3NJ4A 1USIA 3HVUA 1J56A 2OGZA 5BYKA 4YALA 3MXTA 4DDMA 2Z58A 1TZCA 5EXTA 4KLQA 1WW8A 2ID7A 3FKSA 1JHZA 2ZT8A 4ECXA 2VNJA 2Z43A 4BU0A 3TE6A 5T3YA 4EUEA 1EEXB 1H2RS 2ES4A 1Y9JA 1QDLB 2JNWA 2P3OA 2RB4A 1DEHA 4A8JA 2PBRA 4KSYA 4OUDB 3G59A 4DADA 2Y71A 5EKDA 3ZCRA 2XUOA 1HRDA 2GF0A 4MEXA 2HREA 4YDQA 2GBLA 4M7WA 5DBGA 1LF5A 3WKBA 1FVHA 2NO6A 5SYMA 4XD7A 3AUJB 1TEZA 1UMBB 2JHDA 3OQIA 1HA3A 3QITA 9ICVA 2OQVA 1XZDA 3VVLA 3K6RA 4HB2A 3KZCA 3OCYA 4WIAA 2EH9A 2JJYA 5FH9A 2AOXA 5BQFA 1AURA 5J2IA 5JJLA 1H2AS 1FTYA 4D6PA 3MSCA 2YIVX 5CH3A 4DDVA 1AKNA 3DXXA 2X8JA 3MCUA 4YUZA 1R4NB 1XPRA 1UMCA 5DCLA 4H27A 2FA9A 3KEQA 5BP7A 3ZXXA 1T3TA 1N2XA 4XRRA 3OC0A 4WXPA 5IRCD 4XM1A 3IEPA 1Y6FA 3R5KA 4J0CA 3SYNA 3KSUA 4NBVA 4KZKA 4TQAA 1RI4A 5ALRA 1FP6A 3BJEA 1EFUA 4K0RA 4A6DA 1TXGA 2HO5A 3TFOA 1QIJA 3QBJA 1C4KA 4E3ZA 3NTXA 4BV3A 1Q2UA 2V4UA 1XVLA 3MTJA 4OJYA 4L9WA 1L1RA 3I92A 4J9VA 7ICFA 4IJMA 4N5NA 1Q44A 3VH3A 4D4IA 3MJTA 1BMQA 5IZCC 5K0NA 2JCYA 3BK1A 1OZ0A 4EI8A 5TQ2A 4BB9A 1OX5A 3OJSA 3LPAA 3VR6D 3Q7SA 4MUEA 2HEIA 2VHCA 1ZHOA 1NJ1A 2QDXA 3GA7A 5CWRA 5I5GA 3I9LA 1L7MA 3TOCA 2QRMA 1SL2A 3MJCA 1X1TA 3KPWA 1LS1A 5AD1A 3K0FB 3LTNC 2OYYA 4OJPA 5LOVB 1IEQA 1E2JA 4GP7A 1QRDA 1N34B 3IO3A 1DWQA 2WT8A 3ZHCA 1TM4E 3BMQA 3MGVA 4DL5A 4HMQA 3JQAD 1NKVA 5GJCA 2DCUA 1YFLA 2O8BB 3WSVA 1I13A 2EX1A 1OI2A 2YBEA 3NPMA 2C8JA 2R97A 4V1CB 4PS1A 2W03A 1FUUA 3HP7A 3EH1A 2QLTA 2KIWA 4NYIQ 4RU9A 4MW6A 3BRWD 3BMCA 3OPYA 3FTNA 1LLCA 2P4UA 2PUVA 3FF1A 5B7NA 2WJVA 3IPLA 4TMWA 4F1JA 3ABQB 2QD5A 2A33A 3E27A 3FUWA 4GQAA 5KNDA 2PMEA 2J07A 5H4HA 5F1PA 2QOEA 1FP7A 2LHTA 2W0MA 4KLLA 5L1JA 3JV7A 3VR4D 5CT4A 1W59A 8ICOA 4JLUA 5C31A 2WVAA 4NQRA 3QE4A 5JPDA 1ZAKA 1KJZA 3HXOA 2BKEA 3K1AA 2GD2A 1P0CA 4UTVA 2ON6A 4FEGA 3BXZA 4MW2A 3OY2A 2HDHA 3DEFA 2BL4A 4J4TA 2I6UA 4HDSB 3TANA 3CZ5A 4KUHA 3GUUA 3LA8A 3DUFB 3GC6A 2PD3A 3SHFA 3QKSA 1FMFA 1N48A 2XVAA 1PSWA 4Z53A 1F48A 4Q8FA 4UB2A 3EE6A 1F20A 3I8OA 5F52A 3CPSA 2B2NA 5IAOA 1KFCB 3QFTA 5CBKA 4CLOA 2W9BB 4NNPA 2V55B 4REOA 1X87A 4D3DA 2XTNA 5KINB 3HVRA 4H15A 3FYUB 3TFWA 4IXTA 1ISGA 1M6EX 1II9A 3C98A 5EWJA 2C83A 4OPMA 3EOAI 3E9ZA 1BPDA 5I7RA 2E18A 4AICA 5M3BA 4J7XA 4S1TA 4X1IB 3MF4A 1C7YA 1BOFA 3KXPA 4HWGA 5B7PA 2RH5A 2GPNA 4B85A 2QKQA 3SQNA 1N2EA 2KSOA 5AOCA 1FIUA 1THZA 3UOGA 3SK0A 4MMZB 2IP2A 1DC4A 2HA2A 1OB2A 2FMXA 1ULAA 1SRQA 4QU8A 3OBBA 3UAGA 3HCDA 3UO8B 1GPKA 3UMMA 2M6SA 2W9XA 5E6UA 3F5AA 4ZZ3A 3RJMA 3LUHA 1MN6A 4QYMA 2Z2ZA 4K88A 3PFIA 2X5JO 3FWKA 1KTQA 4UATA 1JB9A 4CL8A 2R8HA 1W30A 2NU7A 2Z95A 1WG8A 3CLRC 4OQYA 3OTHA 4CLHA 4BX8A 2HHXA 3ANLA 3O8QA 3ICXA 5BNIA 3GQBA 5K0FA 2BFWA 2FMIA 1P6UA 4JOCA 4ALLA 5I7UA 4EFMA 2WJGA 3RF6A 3NHPA 1HY3A 5ICCA 1E2PA 1IIPA 1FUIA 3DZJA 3R0IA 3AQEA 9LDTA 3SQIA 4H1WA 3WNDA 2N1RA 1QVZA 1RYYA 3OA2A 2G5IB 4ISBA 3TH5A 1Y4UA 3BQ1A 1Y4ZA 4PC6A 2BD0A 2VFAA 4QVIA 3D6HA 3B2NA 1GJRA 1XXHE 3K53A 3AETA 2GZ2A 1VTKA 4GPBA 4REQA 5CXUA 3NV7A 1LJ8A 4PIMA 2OZLA 2VDJA 4C3ZA 4KN7A 4A7PA 3F71A 4R16A 1I01A 1Z29A 2R1VA 4PO8A 4GH5A 4HLDA 1QB8A 2WT4A 3OD5A 4JB3A 3EMBA 3IRVA 3CX7A 3JQ9A 4TM8A 1R50A 4OHCA 2H3IA 2GFHA 1KQPA 4RL4A 4IAOA 1UXJA 1VE9A 2UUBB 4EG7A 1F7UA 2P69A 3U4IA 2FEMA 1X19A 5KFSA 3FPLA 2O23A 4QQ8A 3AKCA 1Z63A 4EUKA 4IQFA 1E2MA 2ESRA 2R2GA 1BQEA 3WO0A 4CCHA 4YAEA 2NU6A 3A37A 5JYBA 5ADUS 3ZE7A 1XDDA 4RJ2A 5LP6A 2NIPA 5CEFA 3B9BA 4O33A 4LE0A 2HSGA 4DN6A 4Q4JA 4YREA 4LYYA 3HKCA 4UB4A 5FBZA 1BGXT 4K0KB 2CNOA 3DULA 2O2HA 4NY1A 5CGQB 3LRPA 4J16A 1UQTA 2HBRA 1NOIA 2P6MA 1PHRA 4R8KA 3H2HA 3PXAA 3TLZA 2EBFX 3V55A 2G67A 3KL2A 4EKEA 5KYYB 2UVQA 3CE9A 2BCQA 1FQKA 1U3TA 6LDHA 3L0YA 4FZ3A 4Q21A 4Y0NA 3H7AA 3EFOB 3GGCA 4N82A 1JXMA 1EGMB 3WLPA 4NECA 1EYZA 4M9RA 4IDGA 2J0VA 1NVTA 4FX2A 3KDAA 3E9MA 1T8TA 3KAKA 2ILVA 3ZTWA 4AYXA 3ZDFA 3Q6NA 2CLOB 1G16A 3PFFA 4EW1A 1U2GA 4ZCQA 4BWMA 1X80B 3FI9A 1EQAA 1X9SA 4XQ9A 2IZ1A 1AJEA 4C43A 4EDHA 2H1LA 1J2NA 1QHSA 1ZQMA 4PE5B 1RJFA 3ME5A 1QDUA 3DBLA 4BVJA 4CIYA 4UAWA 2ZVQX 1RYBA 1P73A 1WY5A 1R0BA 3ZDRA 1IG0A 3OEYA 4CMHA 1YZHA 4JUAA 1XGKA 4A0QA 2CVQA 2ZJ7A 3ZU6A 5AI0A 3BMOB 3VBCA 2JIZA 4KPEC 4BPBA 1QHXA 2PMFA 4Q3AA 3LF2A 1FO4A 4BO2A 2GUWA 4WFJA 1JRPA 3GELA 4JS0A 4IOJA 2W9MA 3KYBA 3C4JA 1UAAA 1IONA 5BT8A 1SVMA 2PQ2A 4OXKA 2HMUA 2QLNA 4ZOQI 3FR7A 5K01A 4ZVTA 4EKIA 1PLKA 1M1NA 3LP6A 4XJXA 3RABA 1XMPA 3NDBB 3K70D 2G5HB 4DL9A 5GQSA 3RS3A 4KMSA 1RHKA 4K3VA 3CEAA 2VP6A 2I2WA 4CF6A 2Q4DA 1O97D 1T36B 3SX2A 1HDYA 2HYDA 2F9MA 3EMVA 4K6GA 1E79D 3DD1A 5HXAA 2N3ZA 1Y7LA 4EB0A 3LL4A 2C4UA 1QV9A 3DWIA 4YQFA 4ELUA 1JSCA 4O2AB 3Q8RB 5DSZA 4R9SA 5GTIU 4CN9A 2AQHA 3EQ2A 5P21A 2IOQA 3BWCA 2EZ4A 2E55A 5EZYB 5K4GA 4HB0A 4R8LA 2WUEA 1U2DC 1LNSA 4LRXA 5B2FA 4NBNA 3IBTA 1ZIPA 4L73A 2HK6A 4QBHA 4MI3A 1P39A 5FUWA 1U2QA 1TTHA 3PMLA 4L75A 1IRXA 1LQTA 4HWPA 5ILOA 1L4NA 4Q1VA 1J0DA 1S2NA 2ENWA 4LQDA 3WLAA 1GPWB 4JLAA 5AHRA 1CG6A 4B76A 5FUXA 3L8YA 3NVDA 4ROTA 4WZAA 1M10A 2W83A 5CB0A 3BREA 4JOSA 4WY2A 4OJKA 2AUNA 2I99A 2G28A 3L0SA 2DR0A 2WU3A 5EUCA 4Q45A 1VBNA 3D3JA 1F38A 5BSEA 5ALGA 8ICVA 1MABA 5DGHA 3ANSA 4PZEA 2XCLA 3WGLA 3L8CA 3C24A 2ODBA 2OCPA 3V8MA 2WU4A 2A5JA 3R3SA 2OKCA 4JSRA 3B6ZA 1ZW1A 4JX9A 4Z51A 4ED2A 3DHYA 3FPFA 4B6EA 3A1TA 3MR2A 4JR2A 3TYXA 2ADFA 2WLSA 2ODQA 4KE8A 4B8YA 2BHSA 3IQWA 3P2OA 2WD7B 3TADC 4ADSG 2WB1C 4RQ4A 1L3CA 1QFSA 1KO5A 2X0JA 1O1YA 5JMOA 1KMNA 4ER0A 4RTQA 3UT5B 2BEWA 1U5CA 4HQ6A 3PIDA 1DO8A 1TMYA 1WXEA 2P78A 3GQVA 2CMFA 4FFBB 4K26A 3Q8MA 4I2HA 3ZYZA 4BASA 1X7WA 1EIZA 3PW4A 4YCCA 4IZOA 4D25A 3DCNA 2HTFA 1Z2OX 4O0MA 4JV0A 3RI3A 1PR2A 1XMVA 4WDQA 2FSPA 4F04A 1WUJS 3G5LA 4OQNA 2REXB 3I4LA 2ESEA 3PWZA 1CU1A 9ICNA 3GPIA 1N9KA 2BM9A 4ZEMA 5J2AA 4O25A 5IT5A 4C4TA 4U7HA 2DSNA 3WBJA 1GVNB 3W7AA 1MDFA 4TVKA 2WKPA 3HBFA 3QKUA 1SXGA 2VUUA 3IUMA 1RPAA 2YNMC 1JIXA 3CUTA 2Q2NA 3U7HB 3A9VA 2IF2A 3QY0A 2YFHA 3H6KA 2JFZA 1XRNA 2WHRA 3O73A 4I6GA 2EJWA 3F5SA 1XRRA 1Z37A 2PRJA 3DMYA 1FBTA 4GPAA 3G9TA 2NZ8A 3H65A 4MVJP 2ROQA 3LO5A 4MWEA 2L5YA 5H68A 1GG8A 2J31A 1I2AA 1PJCA 3NJRA 2AWOA 3MHPA 4BLRA 3AO0B 3DF7A 2FQ1A 2JLXA 4DFMA 2C5SA 4NVRA 2I6TA 1PQWA 1QYRA 1SOUA 1EWVA 1IWOA 2AHOB 2HF9A 3WHLA 2VXYA 4M0LA 1JBQA 4Q9HA 4YO7A 3RYHB 1QFYA 2VRBA 5NLLA 3U31A 1VPEA 3SV3A 3UK6A 1T8PA 3EULA 1M9NA 4FGLA 3ZWNA 4YCMA 2INGX 4ZHQF 2Y6VA 4AJHA 3KEGA 5J2CA 4RQ0A 4BU1A 2JHFA 3QELA 4ZD6A 3SMQA 3OO0A 4UUAA 2Y0SC 1M0TA 1RLJA 3DG9A 3EWNA 1X77A 5L9XA 2OPBA 1JKFA 2ONZA 3VNRA 3WO1A 4BVGA 2X1LA 4YQYA 2ZT6A 4YH1A 2WSLA 1AHIA 2GXAA 5BN4A 1QHHA 4YRTA 4PTZA 2WKRA 4HMPA 4IQWA 3AIIA 3NBYC 9ICJA 4AJIA 3V4PB 3QE9Y 5F76A 2R8IA 1ZXLA 4IEFB 4ZAFA 1UDAA 2EP7A 2A1IA 4G86A 5JD4A 2YOHA 3PPVA 3EIQA 2D5IA 5AP9A 2O48X 3KFLA 1W4RA 4HLUA 1ETHA 4AMZA 3QPBA 2LUOA 3P7MA 2HBKA 2XIQA 1DBVO 9ICEA 1J07A 4BP3A 1M1UA 4AP5A 1O95A 2EXXA 1KOJA 2BY4A 3PCTA 3VI4B 5D3KA 3G5MA 3WVNA 3LXXA 4DC1A 3AEVA 1XSEA 1A98A 3BBPA 1R2QA 3HVKA 1FS6A 3OTGA 2W2PA 3IE0A 1WMEA 1HXHA 3SBEA 4F6RB 2DETA 1SCJA 4QT4A 5ENZA 1UXKA 3CW2A 1BJTA 1T1SA 2ZAIA 1MQ9A 2B1RA 1DIBA 1QR6A 2G6TA 2HPHA 3LUJA 4IXDA 2JRZA 4PEVA 4Z4EA 3E2PA 2CDBA 1JHYA 1QYXA 1KLNA 4RMIA 4OP2A 4I14A 1VBFA 2NTJA 3SFVA 2R6ZA 4GECA 2ZUSA 2ACKA 5KMGA 2Z9BA 2NQTA 1Q0QA 3RS7A 4CM1A 2IBTA 2C57A 3CJQA 4D8UA 4ZHSA 4XJVA 2NMVA 3EXHA 2EQYA 2YV4A 1GTL1 3LWBA 4Q19A 4R54A 3OZGA 2IHYA 3IPRA 5GTHU 3FLEA 2Q5EA 3UH1A 5EZ6B 2FR8A 1AA6A 1DOQA 2CNKA 3IL2A 3KX2A 3NV9A 1Y5RA 5I7OA 3T3IA 5F33A 1ZL2A 2DFDA 2W2TA 5F77A 3HYSA 1JYEA 4MA4A 3AEUA 3HFJA 3MELA 4KWEA 1ZD1A 4BKOA 1WDWB 3OHSX 1IOZA 4RTNA 3KVYA 1KS9A 5DBCA 2PUTA 3I2GA 4X8HA 4O4LF 5LQJA 1ZOIA 4NAUA 2VJCA 3DMGA 2XOKA 2QRGA 3BZKA 4G97A 1KYVA 3ZJ4A 4MGYR 5B12A 2O2SA 3JQ6A 4FQ5A 2D1FA 3E0FA 2R8BA 3Q4GA 5JQGB 1NBOA 2XMZA 4D6XA 2V7TA 1PF7E 1Y1QA 2VDKB 4ALMA 4XDYA 2B78A 2QRKA 2RHRA 1KK2A 1YXMA 1WRBA 1NUAA 3QXXA 2JVIA 1GTSA 2GX6A 1M0WA 1YK0A 3IXQA 3VA7A 3REOA 4YNBA 2ORYA 3ET5A 2FPIA 3X1MA 3HEMA 3KT8A 5F4ZA 4P4LA 2NU8A 1YB2A 2H2AA 4MI9A 4N5MA 1OW3B 4QLBA 4Q44A 3P9NA 4UTNA 4F2RA 4C4YA 1G4UR 5BURA 4M89A 4DIDA 3RIXA 1E69A 1E4VA 2VYQA 3OF2A 2YQ5A 1U1GA 4IJUA 5DO9A 3EVAA 3P97A 1M8PA 5GWXA 3T9BA 4AZWA 2ZIUB 4ETMA 1JX6A 4FJ1A 1K8RA 3OLCX 3KLMX 5CT5A 3PL1A 1NNI1 5KG5A 2EC5A 4C6HA 3ASVA 4Z6DA 2ZRNA 1NMQA 3BFVA 3NOVA 1JAXA 2D2XA 1YJXA 3BK2A 3GAZA 2QF7A 2OAEA 3DBVO 1TA4A 4AULA 3GLGA 1NXVA 1N0WA 5TEVA 3PP8A 1NR1A 5D46A 2CV2A 3KZOA 3A04A 4KKVA 4PU0A 2RGEA 4C4XA 4IDPA 4ZAXA 2Y1KA 3DVQX 2I7VA 1Q6YA 4RVGA 5HVNA 5JJ5A 5BNTA 1UKBA 4PGXA 3L1VA 4A91A 4XWAA 2P8SA 1AUVA 2BF4A 1P0QA 5AVZA 3SLGA 2O1SA 2D1QA 2A9OA 1NIJA 1D4AA 3ZJYA 5DZSA 3GW8A 3MWKA 1NVEA 4GM4A 2J5RA 4M0DA 4R2KA 1XZCA 2V4ZA 2GEDA 2XD4A 3QXGA