4C4TA

Structure of beta-phosphoglucomutase in complex with a phosphonate analogue of beta-glucose-1-phosphate and aluminium tetrafluoride
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
217
structure length
217
Chain Sequence
MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Alpha-Fluorophosphonates Reveal How a Phosphomutase Conserves Transition State Conformation Over Hexose Recognition in its Two-Step Reaction.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
molecule keywords BETA-PHOSPHOGLUCOMUTASE
total genus 76
structure length 217
sequence length 217
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2013-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 4c4tA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4c4tA01
3DAOA 5AKIA 5ALDA 3TLMA 3P96A 3WGVA 3HYCA 1O03A 1L7PA 3KDPA 1EK2A 2PR7A 3QU7A 4BEVA 1RMYA 3A1EA 4YIKA 3OTQA 4HGOA 4G63A 1RMTA 2WHEA 1RLMA 4UATA 2JAUA 3WKAA 5ALIA 1U2TA 3I76A 4UMDA 1Z4NA 2FPSA 3OCWA 3N1UA 4UU0A 2WF8A 3OCZA 5AM1A 4BX3A 2YN4A 1Z88A 3WK6A 1LTQA 4UM5A 5ALQA 2W11A 4C4TA 2ZBEA 1MH9A 1ZD2P 3NAMA 5AKHA 3L7YA 3ZWKA 4BX2A 1QQ6A 4B6JA 5ALKA 3ZI4A 4CF5A 2YMLA 4FE3A 3B8EA 1L7MA 2P27A 3W5AA 3WK9A 2IOFK 3SF0A 3B9RA 1RQLA 2W43A 3QU5A 5FP0A 2QLTA 2OA0A 5JJBA 1CQZA 2HF7A 5ALGA 1U7OA 3E8MA 5ALPA 5AW2A 5AKJA 3R9KA 2Q4TA 1RLTA 1YMQA 5AVWA 1SWVA 5AKLA 3M9LA 1U7PA 3AR8A 1LVHA 4Y2UA 4YH1A 3EF0A 2RB5A 2B30A 4HGPA 5AICA 1WVIA 1L6RA 3SHQA 5IT0A 2PQ0A 4CE6A 5AK6A 1Y8AA 2ZOSA 1NRWA 3PCTA 1N8NA 5AKEA 4BBJA 4L6CA 3L8GA 3UMGA 1WPGA 1ZJJA 2FPRA 4C4RA 4CNQA 1Z4OA 5AKGA 2EAUA 4NABA 4BYGA 1RLOA 4MUMA 2MU2A 2B0CA 2JAOA 3QLEA 4KX3A 2B8EA 2EARA 1X42A 5ALHA 3WK5A 3AR2A 4QQFA 3ESRA 1L8LA 4UMVA 1ZD5A 4OD0A 1YS9A 4HGRA 3OCUA 4Y2QA 1RRCA 4IFTA 4FYPA 2I55A 2MU1A 3QGMA 4C4SA 3FPSA 3SKYA 3E58A 1Q91A 1SU4A 1Z4QA 3U26A 4QJBA 3U19A 3FZQA 4EELA 2YJ5A 1L7NA 3QYPA 1QYIA 4F72A 5AKYA 3KZXA 2EATA 1YDFA 3CZ4A 3L0YA 4EX6A 2AGVA 3QUCA 3M1YA 5ALXA 3PGVA 1VJRA 2Q5EA 1QQ5A 2YMQA 4RESA 3L8EA 4YIHA 3QU9A 3ET4A 2OYCA 1VJ5A 5AVSA 5ALEA 3EF1A 3N28A 5A3SA 1TJ5A 4YCMA 2DQSA 2CFSA 3E81A 5AW6A 2NO4A 4UAUA 5AW5A 4IG4A 4JB3A 4L57A 2I6XA 5AI5A 2CFRA 3MPOA 3ZWDA 1PW5A 2G07A 2BY4A 3HLTA 3A3YA 1ZS9A 3W5CA 3QX7A 2IA5A 2G80A 5AESA 4DCCA 2WF9A 2R8EA 3OCVA 4NV0A 1WZCA 3QUTA 5ALUA 4JDPA 3OCXA 4EZEA 2IOFA 4HAIA 2CFTA 3DNPA 3L1VA 2AH5A 5AM3A 5ALTA 3BWVA 2C8LA 2NYVA 3QUQA 4ZEXA 3FGOA 2YBDA 3ZVMA 4BKMA 4BNDB 4MWOA 2YY6A 1NF2A 3GYGA 2G1AA 4GXTA 3FM9A 2HSZA 5ALYA 3K1ZA 3SKXA 5AI9A 3WKBA 4UW9A 4YCLA 3KOOA 5ALFA 4G9BA 3QXGA 2FUEA 3WK7A 5AVZA 5AI0A 3EWIA 4DFDA 2P11A 3J7TA 5ALZA 4Y2XA 1K1EA 3PDWA 2FPUA 3N5KA 3U7EB 2HDOA 5ALMA 4EX7A 3ZTYA 4RETA 4UU1A 3DDHA 3FPBA 2NO5A 3I6BA 3W5DA 1T9ZA 4Y2VA 2R8YA 2ODAA 4BX0A 2VKQA 3ZU6A 2HEGA 2I34A 1YNSA 2FUCA 3NALA 3ZVLA 1VFPA 5AVYA 3B9BA 2D2VA 3A1DA 3N8GA 5AI4A 4ZEWA 2WM8A 4HYTA 4OHFA 3RFUA 2GHQA 3I28A 5AW3A 1RC8A 2AUTA 5AKZA 4BNDA 3NIWA 3L8HA 5AM2A 1AQ6A 2ZXEA 1SWWA 1ZRMA 1T5TA 3U7GA 5AVQA 2RAVA 4CF3A 4CF4A 2IOHA 2JGAA 2O2XA 1Z4MA 3AR9A 1F5SA 1Z4IA 4PNHA 2HI0A 1TJ3A 5AIAA 5AW9A 2WF7A 4UASA 3ZX4A 2I33A 3S6JA 4XQ0A 4OCZA 2CN1A 4I9FA 4KNWA 5IS2A 5AM5A 5AHXA 4YCNA 2C4NA 1XP5A 3CNHA 1RKUA 3ET5A 1Z4JA 3WKDA 2YFYA 2G0AA 3PGLA 4FFDA 2ZG6A 3UMCA 1Q92A 2G06A 1TE2A 2YMPA 2B8JA 2W4MA 3MMZA 1NNLA 4Y2TA 3WKCA 3R4CA 3QNMA 3QU4A 2I54A 2OM6A 2R8ZA 2P9JA 3ED5A 1S8OA 4Y2RA 5AW8A 2YJ6A 3AR5A 1ZOLA 1L8OA 2IYEA 5AKXA 1Z5GA 2BDEA 3N07A 2GO7A 4NWIA 5ALJA 5AW7A 1TA0A 4EENA 2HHLA 1S2OA 1RKQA 3NANA 1J97A 4YGYA 5AVXA 1Z4PX 2G09A 3L8FA 3SD7A 1T5SA 1RPZA 2Q4RA 1RKVA 3QUBA 5T41A 1U02A 1RDFA 5A3RA 4OFZA 3RF6A 3WGUA 1QQ7A 5AK3A 5ALSA 5AI8A 1KYTA 2ZBDA 4I9GA 2PKEA 4Y2SA 3A1CA 3SLRA 2HO4A 4XE5A 5AKKA 3W5BA 4UARA 4AS2A 3MN1A 4UMEA 5ALNA 3U7FB 2C9MA 3OPXA 4UMFA 2GFHA 3MC1A 3KC2A 2HOQA 2C88A 1U2SA 4UAVA 1ZRNA 1YJ5A 5AW4A 2JARA 1Z4LA 2G08A 2HX1A 5AM4A 2ZBGA 4L6AA 3L1UA 3ONNA 3L0BA 3KBBA 3D6JA 3ZW7A 5ALVA 4DW8A 5ALWA 3WKEA 4BEWA 3DV9A 3BA6A 2YMMA 1CR6A 1RMQA 2FEAA 1Z4KA 2ZBFA 4KNVA 4H1WA 3SMVA 2RBKA 4AS3A 3QU2A 5AK4A 2R8XA 2WF6A 4EEKA 1TJ4A 5A3QA 3UMBA 3FVVA 1ZD3A 2WF5A 3IJ5A 2BDUA 3L5KA 2FI1A 1J8DA 4J2TA 3ZX5A 4UM7A 3L0CA 3AR3A 5ALOA 4J03A 1RQNA 4NFLA 4HGNA 2I7DA 4GIBA 2X4DA 3IRUA 2O9JA 2FPWA 3KD3A 1ZD4A 5AW1A 1O08A 4DWOA 4KYTA 1N9KA 5AVVA 5ALLA 3R09A 2JAWA 3ZTWA 3ZVNA 2MSNA 4Y3UA 1Z5UA 3ZUPA 2RARA 3NUQA 4Y2YA 2C8KA 4XOUA 3AR7A 2YJ3A 5E0OA 1WR8A 2FDRA 2AMYA 3ESQA 4NAVA 3VAYA 2B82A 1IWOA 3AR6A 3F9RA 1XPJA 4ZEVA 3WK4A 4Y2PA 1YV9A 2QYHA 3NRJA 5AM0A 2B1QA 4AP9A 3U7HB 4Y2JA 3E84A 5AVRA 2HCFA 4KX5A 4HGQA 5AVTA 3UM9A 5AVUA 5IT4A 4O8CA 1QH9A 1FEZA 5AI6A 2B1RA 4F71A 4E88A 1XVIA 1L7OA 5AW0A 2GMWA 3NASA 2HF2A 3EPRA 5AIBA 2GHTA 5ALRA 5AK5A 3IB6A 3OCYA 2OBBA 3WK8A 1JUDA 2WFAA 1EK1A 2P69A 3AR4A 3I1YA 2YJ4A 4KN8A 3U13A 2FPXA 4XPZA
chains in the Genus database with same CATH superfamily
1LBIA 1O97D 4LDJA 3T7EA 4I2CA 4BDPA 4HQ6A 3PXBA 3TLMA 3BT7A 4Q44A 3G6XA 3BMOB 4FQ8A 5D49A 3OJLA 1EG7A 1Z74A 4GBJA 2HLPA 3OBIA 1K08A 4B4DA 4BEVA 2DWCA 8LDHA 3NDBB 2PWPA 2CXTA 2DKZA 1SD5A 1IHOA 1U47A 2QORA 2FPPB 4GSKA 3V2GA 5T6MA 4IR9A 4PAOA 1QGUA 2GZMA 5AJYA 1OBHA 1U2TA 4ZJPA 3C3DA 3WC4A 4D0SA 4U3JB 4ZCSA 3K09A 3BQ2A 3MFIA 1A5ZA 3IOMA 3K0FA 3T6KA 4CN8A 4DDHA 1QZXA 4DBLE 2CUZA 4Z4HA 2P8SA 3EQZA 5KL8B 1NKSA 2IA6A 1XRQA 3KYBA 5D00A 3HU1A 1RXVA 3A11A 3ME5A 3NYQA 1OI4A 5FB3A 3WK6A 3AU6A 1ESMA 4WGGA 5FOWA 3RREA 1GNTA 3MTJA 5KFHA 3TZHA 5ALQA 4MB6A 3HMQA 2J85A 3M2PA 1HSZA 4DOMA 3A26A 1X1BA 5G02A 5F1YA 4AMVA 5TX7A 2NTEA 2Q7XA 5CA1A 2HOFA 3UGTA 4FE3A 1F0KA 2M9NA 1NJ1A 3CLRC 4QEDA 1N6RA 2X19A 4WNAB 2AXPA 2C9CA 1KERA 3Q2KA 1MVOA 1POWA 3K94A 3QV1A 4BWJA 1C3EA 3ORSA 2C9ZA 4BLVA 1WQ4A 1XJ0A 4OKNA 2HCBA 3JPPA 1NM5C 1XZKA 1SBHA 1E63A 3BDPA 4EQZA 5FUYA 3BXZA 1NKBA 3S70A 2JW5A 3O7MA 4A5OA 4KXUA 1U0FA 3VGPA 4RTLA 1J24A 1O96B 3CZ9A 4KGDA 2Q6VA 4YXMA 1EQAA 4Q9DA 1T3QA 2FQWA 2I9PA 3T54A 2J5XA 4QLBA 4JI1B 5CDGA 2HHTA 1U81A 3DE6X 2L2QA 2VSYA 3QYJA 3VSCA 5KFPA 2H2DA 3KM0A 3S8YA 1H4QA 2CT8A 4M54A 2AI2A 1LEHA 1Y8QB 3U3JA 3Q7QA 1LVHA 4YEDA 5JJCA 4JODA 2VJBA 5KFNA 1S97A 2OL4A 2WMOB 1LW6E 5H7XA 4HWKA 3TLCA 1FXWA 1ZK1A 2Q5FA 2X5OA 3G2QA 2GK6A 1AX9A 2QN1A 1EUDA 1MOZA 2HMAA 4ECTA 3DBHB 3NU1A 5LQUA 3I12A 1A7KA 2O3TA 4YQFA 1T24A 1U9IA 1D9FA 3HCRA 4EJSA 1KVUA 2G28A 2IY7A 2VOJA 2XHZA 4MH0R 1DRGA 4JC4A 5CDFA 1NVWQ 1NASA 4ARSA 3QWIA 1JFTA 1G7RA 4C8KA 1CC1S 2B4AA 3GLSA 4Q4AA 2EZ8A 3DEHA 4R3WA 5EA2A 3L8GA 3DBIA 4R8UB 1F2UA 1QK3A 4QSHA 4HDSA 2WAOA 3EC2A 3JD4A 3N0VA 1J39A 4RZIA 2R8OA 3FROA 3ZR4B 2R8RA 5A6SA 4FZRA 4QZGA 3CWQA 4DQUA 1T4GA 2GN8A 3PDJA 2HSEA 2O57A 2QG9A 2OMKA 5IM4F 4KAJA 3LHIA 1VG0B 2P5SA 2VAWA 3L0ZA 2OWOA 3H2JA 2AK2A 4MR7B 2WUFA 3BMOA 1FFWA 1L8LA 2I6UA 3HV2A 4Q9NA 3DEEA 4ZEMA 1SKMA 1ECLA 3PFKA 4DSZA 3LQFA 5K0EA 1FB5A 2JRLA 2NXWA 1UMDB 4UHBA 4MQMA 4Y2QA 3T4PA 1ENPA 1EXMA 2DE0X 2X15A 1GL9B 2X7JA 2XWJI 1VIAA 3CGWA 4GVPA 5EJIA 4F2DA 3IOYA 5ER9A 3OJCA 5AO9A 1U45A 4K2AA 1FYWA 4OH7A 3GRVA 1P5JA 3AQEA 7ICTA 1E92A 1JHDA 1WTAA 4NLCA 1GNVA 3HWWA 4IL5A 5AJZA 1RU3A 1QLJA 1U1IA 5D3QA 2XI9A 1SXJA 2H17A 4KSBA 5L7YA 2CJWB 3KHGA 3GRAA 3LUJA 1S10A 3PCXA 3S7TA 2HCRA 3AJ8A 4TUQA 2ZGVA 6REQA 1PFYA 3B1VA 3SI8A 4M1EA 4NZYA 1S0MA 3VH3A 1VJRA 421PA 1I5EA 3LPLA 4YP5A 5E9AA 2VXBA 2QIOA 4WN9A 5H81A 3WGYA 4AKTA 1P5RA 1HM5A 2FOXA 5K3BA 4UPEA 3OCCA 5DHQA 1LCIA 5IJZA 1NULA 4GG1A 4TVBA 3AMZA 1NI4B 4DCNA 1NK5A 4B7ZA 3A7EA 2MTBA 2V55B 4QHSA 3T5HA 2W4IA 4QOFA 5C31A 4OXRA 4QWBA 3SHFA 4Z9AA 2NO4A 4FP9A 1K98A 1JLHA 2R1UA 1DRUA 4JBYA 2ISQA 2OP0A 4JQCA 1NXWA 3RC1A 4CU2A 2AQIA 2Q5CA 3ZWDA 2DR0A 4J29A 2QTLA 1ISSA 2XUKA 4ZOCA 3Q7SA 3OQIB 4AY4A 2X0JA 2X0KA 4FDAA 3R5HA 1Z1VA 4OQXA 1ZQDA 4PZEA 5F33A 2G80A 4W7IA 4DCCA 1UUFA 1APBA 4W5NA 3UK0A 4YX9A 4X00A 3IGFA 3RF7A 2FDCA 1KDZA 3G6YA 4JDPA 4JQYA 4QDZA 3TLAA 3RKUA 4PW0A 4DJTA 1NBMA 5K4AA 4EMBA 4WAUA 1HFEL 1KJZA 3DXZA 2NM0A 1UM8A 3UYLA 3L6EA 4K87A 1YFLA 1XZIA 2JFQA 3B3GA 4RUKA 5I47A 3U4MA 5I7OA 2G71A 2AEJA 1K27A 3PC8C 4KO1S 4Q12A 5DSZA 3RJ9A 4AICA 3H2HA 2B4TO 5EQJB 3TAPA 3B6KA 4IV5A 1T6NA 4X93A 2FE1A 1RQ7A 2F48A 5E7QA 1XU4A 2BSXA 3V3KA 2J6UA 1EFAA 4OB6A 1Z5VA 4OGWA 3KZCA 1S5PA 4C8MA 1ZQIA 2BBTA 4XI9A 1BPYA 1YQTA 2JLRA 3OI7A 4MRAA 3VTKA 3ZHRA 1FSFA 3G13A 4HPWA 4GFJA 3VR6D 1FDIA 1O58A 4YCSA 3K1ZA 1YAJA 2BDPA 1EM8B 2HV9A 2JHAA 2PXHA 3K92A 4QBKA 3RSFA 2ZYDA 2PH5A 2I65A 3QI7A 2XR1A 4RHEA 3UCXA 3I9LA 5EWLA 2GAOA 4G2TA 5LUAA 2HPZA 2M9MA 1KH2A 4KLDA 1YZKA 2B20A 2ENWA 1J1IA 3KQOA 4XIGS 1V5WA 2QTHA 2VJMB 3S8MA 4EGCB 3UMYA 1FYEA 3NC4A 2Q0ZX 2JAHA 4I1PA 1XQ1A 4FSXA 2LRHA 1UXKA 4J3NA 2NRZA 4LXGA 2AA3A 2QRGA 2I8AA 1Y81A 3TXYA 3UV3A 4CF7A 2NYUA 4S1VA 2H9AA 4ZGWA 4TSRA 2WKWA 5ALMA 2O2DA 2YRFA 1Z2CA 1OOEA 1WNFA 3OPYB 2VVTA 4AUNA 1FLDA 1N6PA 5EZYB 4M87A 4DXAA 4A0GA 2BZGA 3DA8A 2FQYA 3UXNA 1QANA 3OX2A 3DULA 2GDJA 3UW1A 2W9CA 2OOSA 3C87A 4PX9A 1HA3A 1CRXA 1TQ2A 1F4PA 3ORFA 4RLSA 1YH3A 1YASA 5BQFA 3SDSA 2O8DA 4KQGA 2I34A 4GM0A 3K70C 1IATA 3GMSA 5A9SB 4XGNA 2OD9A 4BU0A 2J45A 1OGIA 1JAXA 4UTRA 721PA 2PNJA 5CFLA 2VAPA 2I71A 1E4OA 2WP0A 5EVCA 1OZAA 1ED1A 4Y1FA 4ZWNA 3RYIA 8ICMA 5J2TA 5CDTA 4I4TF 2XT0A 1T9DA 1USGA 4X97A 4QUBA 1TM1E 4PH5A 4HDAA 2V8OA 3NFRA 5E3HA 3HUUA 1G8AA 4RVFA 4CCYB 2JLQA 4RLFA 1UJ4A 3KJXA 3VX3A 4R9SA 1YO6A 5EN4A 1K2WA 1U9ZA 2A8YA 2PO7A 1IXSB 3H9BA 4EUSA 5FBKA 2J48A 1MB4A 3PFFA 3ZJYA 2QYOA 3PP8A 1X7YB 2H4ZA 4TUYA 3MLEA 5KJ6A 3GLHE 2FEMA 2DTDA 3E1GA 2W6IA 2FYTA 3GCGA 1S2DA 4I19A 1B8UA 2E4ZA 1OZHA 2P9CA 2DPMA 3CF0A 4M21A 1SCUA 3SX4A 3UPDA 3VYSB 5T4HA 1KMMA 2JASA 4Z3OA 1P91A 4JFAA 1F7VA 1AROP 4ZYTA 3V8PA 3MGAA 3K32A 4UZSA 2FSSA 3FFAA 1NDHA 1UMCB 2BR4A 4OJLA 2WVHA 3CKMA 3HADA 2XCAA 3P2JA 4N6GA 1W7AA 1M6VB 1D7OA 4RFSB 5EWJA 2F8LA 1TUGA 1HF3A 2AMFA 2IUYA 4MQ4A 4N18A 4IR1A 2VT7A 3WQQA 3M0EA 5KQRA 3HXQA 3SPXA 2IL1A 4FFDA 2JGIA 3Q98A 4XVQA 5ITVA 4OHKA 2I2AA 3PYLA 4B4OA 1JRLA 4Q4HB 1JEQA 1P0PA 2B8JA 3CR3C 4HNSA 1H1LB 3NI2A 3UGQA 5KNDD 1YR6A 3MMXA 1DTWA 3VR6H 3QG5A 4MKHA 1H4SA 5J0SA 1A1SA 3HGMA 3N58A 1WB4A 3ILXA 1WHSA 2PQ6A 4TROA 1CEZA 1A95A 2IYTA 1IEQA 4Q6WA 4IOKA 3HU5A 4M8LA 3VNBA 1ZOLA 2V0GA 2VRNA 1C8BA 4XWKA 2EW2A 2IYEA 2XWBF 4FYKA 4L9AA 1ZINA 4FGWA 5G40A 1R9MA 2C3UA 3ISCA 1ACLA 1MTZA 1RWOA 1SM4A 2IXEA 2VATA 3OZGA 1SVWA 3PI6A 4EENA 4A92A 1P31A 2XNKA 1G8FA 2QXTA 3B2EA 4PEVA 1RPTA 2J08A 3VR0A 4E0DA 1HURA 1XU9A 2O7RA 4NQZA 2F3QA 2YINC 3H11B 3I3SR 2FMXA 3E23A 4CV0A 5F2KA 4DIOA 1XCLA 1A2QA 3PD1A 4BLSA 3OZFA 2CNLA 2C96A 3S40A 4GL2A 1ADYA 1XZDA 5K3FB 1XTJA 4AWAA 1QKJA 1YS7A 2L5YA 3Q41A 4MV1A 5T4BA 1NUAA 2R84A 621PA 5IF3A 1A5SB 3RF6A 1Y4UA 1SCNE 4LVUA 4LAFA 5KFWA 4GKKB 1VGRA 3T5JA 5HTKA 1DKQA 4I9GA 1OPRA 4PHHA 3KYCB 1SUWA 1VIDA 4HEQA 5AOVA 2TS1A 2FZVA 4EB6B 5KQMA 3B70A 5BMOA 4CRXA 1JS1X 1CUUA 3BDIA 3TW8B 4W5QA 2D6FA 4TOIA 3TADC 2XGOA 3G2OA 2GF0A 3C14C 5C80A 1AU9A 1PQUA 3LE8A 2QR2A 1NKEA 2CLCX 1CB0A 4EYGA 5BW5A 1NBME 3F2IA 4EJ2A 5IKEA 2VHTA 3WGLA 4OI4A 1J2TA 3V1LA 2IJGX 2KVSA 3AFGA 3UAGA 5LBTA 2OXIA 4EWLA 1TEZA 4KLCA 4XX0A 5FOQA 3M81A 1WXHA 2VHZA 3PVCA 2FG7C 3I9MA 4FX5A 1UBKS 4RKEA 5ESRA 1LBEA 1XVVA 3H4VA 1S1MA 3ZGLA 3L1UA 2QX7A 5AT1A 1YJXA 3BF7A 1CZNA 3KBBA 2AB0A 4I1SA 5J0OA 1PG5A 1UPCA 3IAS1 4HX9A 4JGIA 1AKWA 5E1DA 5H5JA 2D8AA 1K97A 4Y7DA 4Q3OA 2CE2X 1UH5A 1KBZA 2JGDB 3PZRA 4KITB 5FFMA 4BO8A 1KO7A 1CR1A 1IAVA 1V2HE 2FTKE 2ZWIA 4NQRA 5G3YA 2XMRA 4MV6A 5LVAA 2C28A 2EZTA 2FW8A 3RRZA 5KYYA 2W8BB 1Z4KA 2ZWAA 2HHUA 2Q2VA 3MTGA 3N2EA 4XARA 1VYUA 3VX4A 4D4HA 2O8FA 4PHFA 5DTIA 4OMDA 2R7NA 5T7BA 2OR3A 3TECE 2WT9A 4KMSA 3T7CA 3D0RA 4KLJA 5JDCC 4EI2A 2VZ0A 3VZDA 2FI1A 4HYQA 4RVSA 2XQJA 1WUYA 4Y1EA 4TLAA 2VQSA 2P0YA 4M8SA 1GA1A 2OAP1 2Q0XA 3F6RA 5IM5A 1VCMA 1PLJA 4DY6A 5KVAA 4CIDA 1R12A 5D3MB 3RS9A 5CCXA 4Q4LA 4I2DA 1FU4A 2EZYA 1HLPA 1LS6A 2FSVA 4GBGA 4REOA 4RHUA 5JAIA 1N77A 1F0PA 2X4DA 2QRQA 1FUUA 4M53A 4I2BA 2O9JA 4YAUA 2G8LA 2GX6A 2RSLA 5FPKA 3PR5B 1HETA 2FP4A 3JYHA 5TMBA 3IP3A 2WJPA 2XC9A 2EG9A 3K15A 4AN0A 4CQLA 3O8NA 5JYEA 3L92A 4PQGA 1W4ZA 1O57A 4D6YA 4R64A 2PIDA 1F6DA 3RG8A 3ZQ6A 3D4LA 1MD9A 4HC4A 1Q20A 3QVMA 3ZXUB 4DMKA 4GKJB 1NI3A 1FUEA 5IHXA 1T3ZA 1QWOA 5TJHA 3SVZA 2C8KA 3Q3VA 4RVNA 1VLBA 4UB2A 1EFDN 3GWGA 4YUWA 1NJ6A 1HUOA 1W5EA 1MP0A 3OQHA 5ELMA 2NPIA 2QX6A 4JIGA 3LZCA 3MINA 5BSUA 5CLLA 5BXQC 5DNYB 3PX3A 3D6FA 5FA5A 2ZRHA 4A03A 4EZ6A 4IQUA 2WT8A 3ORHA 3JYNA 4ITVA 4A73A 2CWWA 2PFQA 4AG5A 1SUIA 1JE0A 3DDUA 3JAWA 3LJKA 1A98A 2PZBA 3AHIA 1XOIA 2Y1CA 1NUPA 3KHHA 5H3LA 4CXMA 5LM3A 3OGUA 4P7BA 1Q7BA 4JUAA 5CUQA 5HOQA 3E8XA 2B1QA 1NJZA 5G1NA 4DCJA 2DQYA 5AVRA 3I32A 2V74B 2W03A 2WNSA 5LYYA 4YBZA 1W8DA 3FHJA 1KYXA 4IV8A 1RWWA 2G9UA 2ZT8A 5H02A 1X6IA 5TEWA 4E5UA 3H7IA 1D2MA 2GGSA 3DLHA 3A6EA 4V0QA 5ESDA 4YFKA 1P33A 4LZOA 3UK1A 2GTHA 3TSWA 4D02A 4DLBA 5DG7A 1T13A 3H7AA 3OPYA 3DZCA 3U4HA 1OW3B 2AMJA 1Q46A 3C1YA 3K6RA 1UBOS 3KB8A 4IJKA 4QXOA 3U4CA 4A2PA 1ZIPA 3WZMA 2XTZA 3H0MB 4RV4A 5GAJA 1Y3DE 1ZNQO 2JFGA 4NX2A 5MN5A 3G6VA 4JL5A 1MQ9A 4P9NA 2B4QA 3G89A 3HJEA 2QD2A 3PNVA 4ECZA 1SUSA 3I23A 3OZBA 4CTNA 3IEIA 3M6WA 2XUOA 2QRNA 4F2HA 2VF7A 3AV3A 2DM6A 2A1AA 3CRXA 2VBFA 4O0MA 2EXXA 2ADMA 4PYOA 4MV4A 4R05A 1M1NA 1VIMA 3IIKA 1PZXA 1PSDA 1KMHA 3EEBA 3EOBI 4HFJA 4U7HA 2GKOA 4GC6A 3HDJA 4KIGA 2UU9B 4ARCA 1WV0A 3PGMA 3AEKB 1Q14A 3PUHA 1GG5A 2GAIA 1UBNA 2VKTA 3RYTC 3DZGA 2P6OA 3JALA 2AQ4A 3ND6A 4DT1B 4ZP1A 4UATA 1JV2B 1FQOA 5TARA 2OEHA 1V47A 1ZJYA 3MRXA 4RQUA 2VA2A 1KYWA 2KB0A 3IR6A 3PBKA 2BQ3A 3FDIA 4H7DA 4JVMA 4F3RA 2AU0A 3S1SA 5KFKA 1C4XA 5EJ2A 2FPSA 2FVXA 1OFGA 3HBMA 1CJSA 5H16A 1NMQA 1HLFA 2ERYA 2DPIA 4B8YA 8ADHA 4WK2B 5IT5A 1AO0A 1PT9A 4QQNA 3A14A 4QPDA 1Z2NX 4QDTA 2YYSA 2J7PA 5CP2A 4RD6A 4WOBA 4P35A 4HNAB 3EF3A 4BTEA 3PIRA 5KAIU 3AUKA 5HUJA 4WH0A 3O2NA 4IIJA 2ONKA 3RPEA 2Q3FA 2QS9A 3AUOA 2PBFA 4Y1RA 3DXXA 3GFBA 4RD2A 5CTJA 3QFSA 1A69A 1G3MA 4F91B 4FFBB 4G3XA 4N0PA 3X1JA 4MS4A 3SBXA 2XCLA 5BN5B 1SN7A 1OH6A 3H3FA 3WK9A 1SXPA 4L4XA 3BQ9A 3QBDA 1CUFA 4W7SA 2GJAA 2HF9A 1TEXA 3RABA 4CR6A 5KMGA 1UZUA 4EF4A 1QIKA 3KPVA 3GUYA 1RRKA 2WM3A 2FQXA 2HF7A 4FBLA 5LKRA 4BNXA 4BZQA 4L15A 3CNBA 4MUHA 4UBJA 1O2DA 3QEOA 1BD3A 1ABFA 2GPAA 2R7MA 1TMKA 2QN8A 4QRDA 2CVQA 4A2CA 3I64A 4I1OA 2PUGA 2DKOA 5I4IA 3VI4B 1E9VA 4HSEA 4MW4A 4RZXA 1TK0A 4FFNA 4Y2UA 1P9WA 1R5OA 3ABZA 4DV4B 1BG6A 1VE5A 3EHEA 3HSSA 5IIMA 2VPPA 4L7QA 4DZTA 4Q15A 4IJ5A 2UXCB 3DVLA 1M66A 1DCFA 4YVFA 4MJXA 1JDJA 1SHLA 4TWZA 4YA6A 3T5MA 4V0RA 1XRNA 2M0NA 2BEVA 2GARA 2ZOSA 3MJSA 3RLIA 2D7CA 3FVRA 3MT9A 5CG2A 4DHWA 3UO8B 3TMKA 1YUNA 1ZNZA 2J09A 3GNSA 5KFDA 1LKZA 1B26A 3QX8A 2YQEA 1M0WA 4TKUB 4Z54A 4ZV4A 2KSOB 3KTQA 5JC8A 5C52B 4WCFC 2BPFA 1L3VA 1NW5A 3C6MA 3LO5A 4NP6A 4R1QA 5FBRB 2JRCA 3HXMA 3A6DA 3MWEB 2XLBA 4U7JA 3UT6A 2WE8A 1OQAA 3L18A 1CR2A 2C00A 5SZHB 4QU8A 1PJLA 4JUBA 3VU0A 3WB1A 5F3XB 1YL6A 5IANA 1A2BA 1VPEA 3C74A 5H9VA 1WXDA 2QTMA 1U0TA 1O0BA 4Z53A 1E5QA 3MWEA 5DBHX 1FTYA 5IJ9A 4EKEA 3KETA 3W77A 2UKDA 2XNCA 4LC0A 1ORWA 2WHPA 3ZE0B 3SYRA 3C3BA 5KFUA 1BW9B 4QGHA 5J1TB 2HRBA 1IXYA 2H4XA 3I9V6 2XZOA 4N65A 2EIXA 5LYJB 5J40A 1B6RA 2OG1A 1NW7A 3C6YA 3EK2A 3HA5A 1CX9B 2H2IA 1YB5A 2UYCA 2CBZA 3FYTA 1N1MA 3V4OA 3NUGA 2HBRA 2N0SA 3CXUA 1ZEMA 1U2EA 3F5FA 3PFGA 4IIDA 3ROMA 3WWOA 1PL8A 1SU4A 1YS4A 2FNAA 1DK2A 1G0OA 2W2TA 4I08A 4KVAA 3ZTTA 1U8ZA 1M76A 3Q8KA 3QWFA 4EEZA 2F7SA 1I94B 4R2XA 2X9QA 1KQFA 1Z0DA 2LI6A 3LKZA 3R3YA 1CUKA 4F72A 2GVNA 3O3MB 3RUEA 1RWNA 3BHIA 3V7UA 5JYBA 4MOWA 1M1ZA 4P3KA 2FKNA 5IIIA 1X9WA 3HACA 5K3SA 3VU1A 3WHLA 2GNAA 4C4XA 5C18A 1C80A 4ZI3A 2VTBA 2B5WA 1QWSA 2BFWA 2ECQA 2WJYA 3L4BA 3NGXA 4NU0A 3RHFA 1GAEO 4OOFA 1PE0A 3DHNA 3SSMA 2KVCA 4EUKA 4M9SA 4I2EA 2IHMA 3OJWA 1L8XA 1R18A 4D3YA 5JZMA 1QAMA 4ID9A 2NVUA 4B45A 4ZQFA 3CTMA 5JCXA 1KP3A 4I55F 5BRAA 3PKZA 3TMYA 5BN5A 1QK4A 4PHGA 1KK3A 3II6X 1LBSA 1WDTA 1XVTA 1X2BA 2BELA 1LX6A 2CB0A 2FLKA 3KVNA 4MO2A 3CW2C 2DT8A 3EIHA 1OLXA 2BMFA 5ELXA 4A8PA 1GSHA 4DXDA 5MDHA 3MT7A 1QU2A 2XKKA 1E3IA 3PMLA 4XW2A 5L3VA 1BXRB 1K92A 5AW6A 3U0BA 3VAAA 4Q93A 2XV1A 1T0JB 2CFRA 5DRYA 4AO6A 4K0KB 4FD2A 1HX7A 1VHDA 2W5UA 2HMSA 5DK4A 4OQZA 1SU7A 5AJTA 1NNEA 1VTKA 3PQ4A 4UFPA 4NOLA 1T0BA 4AJ9A 1PJ2A 1T4BA 4IHKA 3KL2A 4ZDKA 4BS9A 1DEHA 2J9YB 2V7VA 2W6JD 4LECA 3ZLUA 2PN1A 1TKDA 1H5NA 3QMWA 3QZ8A 2ODWA 4JDUA 3V7YA 3P2OA 3I4FA 1KO5A 2RONA 2V5AA 1IIPA 2ZVQX 3MJFA 3DV0A 4LJ8A 3EW9A 1KU6A 1BHJA 3DKPA 3MERA 4R6XA 4X8HA 1CDEA 3C6QA 3I01A 5KT7A 1R8XA 2DMRA 2VA9A 2F9FA 4HK4A 4M88A 4ZAGA 4BZWA 4LFBB 4S2UA 3V4SA 5ALTA 2ZAYA 3CC8A 3JWJA 5EJ7A 3QUQA 3IUSA 3LY5A 3TTWA 1U2DC 3HBLA 2NAFA 1NTRA 2I22A 2QXUA 3IT2A 3IX7A 2AE2A 1BKSB 4FEYA 2H63A 5EFZA 1UT5A 5BOVA 4BRUA 9ICLA 4Z2AA 2ZSJA 3IP6A 1FFDA 4JXKA 2LR0A 2VTBB 2JR5A 2X9NA 5C32A 2Y99A 5D5QA 3U7RA 3WYFA 3MNFA 1T94A 2M98A 3CUKA 2BJVA 4TQ9A 3SN6A 4BQPA 4G5OA 5LXTA 4HZUA 2ZT5A 1UJMA 3S81A 9ICOA 2VQFB 2X9VA 1R3DA 3LP8A 3LOQA 3R7NA 1ACJA 3O3NB 3PHHA 2FZ5A 2IY8A 3IUYA 4FMCB 2O8EB 5BN1A 5BOMA 1EDZA 1QUFA 4X20B 4MF8A 4IHAA 2JG3A 2PLFA 4EMSA 5HZMA 1WPQA 3ADPA 3ELUA 3TDMA 2J59A 4Q7EA 3NLLA 1B8OA 3HU3A 2RGCA 1AQNA 4I2GA 1K1EA 3KEQA 5FORA 1IJKA 1J70A 3PDWA 5IJ0A 4OX9Y 4QYSA 4JP8A 2PI5A 5HKLA 3QEMA 3IDFA 3EDQA 4GYKA 4PZUA 3ZTYA 1OU4A 3EVEA 1X70A 8ICIA 3OHMA 4MW9A 4A6XA 3KB2A 4A0SA 1PGNA 1JQEA 2GBCA 4WQMA 4CCYA 3WMFA 2AK3A 1GV1A 3D3EA 5FBLB 4ENUA 5DLQC 2P75A 2WTNA 3A0UA 4WX2B 4I3HA 2HEGA 3RJGA 4TTRA 3K1YA 4A1FA 2FUCA 3QHAA 4X8OA 5FYQA 3K9QO 4D97A 5C37A 2IODA 1JA0A 1YZUA 3MOGA 4E7OA 1PUZA 5JDIA 1Z82A 1E20A 1SG0A 3MTIA 2LIVA 2ZAMA 1HWYA 1KFBB 1B4DA 5DOVA 3WHPA 2WWYA 5IMSA 3EPJA 2BEVB 4TSKA 3IHLA 4FINA 2VDWA 4YQZA 4EDFA 3SC3A 1VYHA 2H07A 1K7EB 3G6KA 5K3CA 3U31A 3B48A 4NBTA 1ZUNB 2GQ0A 2GCPA 5KNBH 1NVTA 4PWZA 2NZ8A 1DELA 1UIMA 4HTFB 4MAMA 5AM2A 3SHWA 1IPHA 3AHJA 5B2FA 5HE9A 3T1OA 5JTTA 3BB4A 1NR7A 3PF8A 4K9LA 4HVAA 2JAXA 2Z83A 1L5RA 2CV1A 4OATA 4YJ2A 3I0ZA 1N9GA 3I2IA 3KSDO 1Z5PA 1XSEA 3G23A 3RAEC 3BDAA 4YJHA 4KLFA 1G59A 3MS7A 4LVSA 1QONA 3OQ6A 4I1VA 4U7DA 2VCYA 1N5JA 3VR2A 3F4BA 4RH0A 4CVNA 5FHQA 2N75A 4HVLA 3A1SA 4W5RA 4HXGA 4WK4B 2G5GX 4Z51A 2UVPB 1OLUB 4JT9A 5CK5A 1J0DA 4LCBA 3ND9A 1BQ4A 1OVGA 2OLKA 2C2ZA 4S0ZA 4U7FA 4XJXA 1L5QA 4I5DA 4IIHA 3FGPA 2GZRA 2UXDB 2BR5A 4NXZA 1E2JA 1I36A 2OB2A 4FMBB 2OOKA 4RQ3A 2WUGA 3LTEA 4B4WA 4F3YA 3VDXA 4F92B 1T91A 2JGDA 2H4FA 2V6GA 3P9IA 4LJ7A 2G06A 4P34A 4QFDA 3SBDA 3UJAA 4DQLA 4NYMR 1XKTA 1AKTA 3LUPA 2YWDA 4NICA 3NVVA 1MO6A 1ZI8A 2L42A 1G6KA 2WABA 1KDYA 1MV8A 1MC4A 1W6RA 3UAXA 1KQOA 4J7UA 5JASA 3QNMA 4JKYA 5BW4A 4MVJE 3TSCA 2WQ6A 4RS4A 1OA0A 1NBIA 2R00C 3KQYA 3M89A 5KWSA 1PGQA 4U2GA 3DFFA 3TI9A 5BT9A 5HSGA 1NOJA 4QUGA 3ESZA 3QXXA 3SJBA 5KNBD 1Q6YA 4ELUA 1XV5A 2G25A 4U2KA 3OPQA 2WAQF 5AW7A 1FSZA 5ABPA 1MC8A 3A4IA 1FRZA 3V6JA 3UAOA 1RADA 1CUBA 2PKQO 2XUDA 3FIUA 3FSGD 4PSCA 4OLBA 1NVVR 4PZNA 2C1ZA 2R5FA 1KYYA 1GGKA 4JK3A 3ZGNA 3RC9A 4LF4B 4NZ9A 4ENSA 3QXSA 2AHOB 2Q41A 5DI3B 3SSOA 3BHNA 1Z45A 4AJEA 2XXAA 2VP9A 2AOUB 3JW8A 4NHEA 4NE7A 4OM8A 3L8FA 1E1NA 4JC5A 4XD2A 1RPZA 1LC0A 4N48A 1LSJA 2FPKA 1ZX1A 1RDFA 4R63A 4CQMD 4KWCA 2BTOA 5JR3A 2RHHA 1HT0A 3W4JA 2V7BA 1LGYA 4QU5A 4TZ0A 4C04A 1FCJA 2F64A 1RVV1 1MN6A 4M1QA 4RY9A 4XLZA 4XVRA 5BVHA 1F0NA 2WHXA 4IP0A 1RZ3A 4IFIA 4YRGA 1NNUA 4NLKA 3M8KA 2AG5A 5J0PA 3O1HB 2QAIA 2RCYA 3EEYA 1FP2A 4UMEA 2JFWA 3AINA 1EDEA 4XTCS 1QPZA 1J1UA 1GV0A 1UP6A 3MR5A 2PEZA 2JA1A 3AVPA 3OE7A 3H8SA 2YZKA 2CXSA 3H4IA 3UKOA 3ZZ1A 1BN7A 3A9WA 3EIWA 2LD4A 1IWBB 3R0JA 4KACA 3RB0A 4H7JA 4RPJA 4MB0A 4EAAA 4FQ5A 1QFSA 1U2SA 3MTDA 5LQNA 3EZ5A 1KDHA 4C7XA 5IC4A 5JQGA 5K4LA 3EY4A 2HWXA 1AKMA 2VP5A 2VTVA 2XT6A 4YAGA 3UXMA 2WRZA 4L6AA 3LXMA 4TN1A 3KEMA 5B53A 3D6JA 1PIWA 3RAPR 1JLLA 4S3MA 1W6UA 3CF4G 1U4BA 1XA0A 3DEJA 1IHYA 4HYYA 4U2EA 1SPXA 5LBUA 1JI3A 1UDAA 3KJIA 2YYYA 4OP1A 5T5QA 1WXFA 4JR2A 1NLYA 3VC3A 1FS5A 5JATA 1JT9A 2VHWA 3FPKA 3Q7PA 1XE3A 5KCMA 1JSCA 2HSJA 2NV3A 1WXQA 1S3FA 2A9VA 1GTG1 4RFSA 5AK4A 3HKBB 4EEKA 2FHPA 2HREA 5EWMA 3DZJA 5HHHA 1UFQA 1ZCBA 3QFHA 2ZIXA 4M9UA 5BO5A 2WF5A 4FNGA 3LGAA 1LVGA 3V4RA 1H9BA 1OXSC 1ZJWA 4BAUA 4BJ3A 4WJ3B 2W2KA 3SM3A 4H0CA 4LE0A 1FFBA 4NK4A 2ESRA 1A9PA 1Y88A 3CCFA 3EQ2A 3MW8A 4ZXPA 1CB7A 1V8PA 3T35A 3FAHA 1Q6ZA 4BMSA 4CLHA 2I7DA 3EASA 5ILGA 2O8CA 1S89A 1YOVA 2QYSA 3KQTA 5FWXA 1GAWA 1DT5A 2ZI3A 2I2CA 5L1KA 4KE7A 1ZD4A 1I9GA 3BRCA 2V0CA 3FVTA 1EJ0A 5CXUA 4C03A 1HQCA 4L75A 1OV6A 2FSPA 4MCHA 3GP8A 1EX9A 1QZZA 4LOAA 4DLWA 1OI2A 3W9YA 3ZZUA 1JDTA 1UQTA 3NJ8A 1UCVA 3PUWA 3UWPA 4MDYA 5I45A 3OOYA 4BBZA 4ER3A 1M8GA 3AQIA 2MYPA 1O6CA 3DTYA 1FZQA 3B12A 1N4AA 2A78A 3OWXA 3K71B 4OJPA 1V25A 2SBTA 5LP6A 3P0JA 1PK9A 1FX1A 3ESQA 1U9LA 1L5SA 4KRYA 3NBKA 1JQJC 1OR8A 2D2IA 1FS6A 4BFYA 1I24A 4F4IA 4RKQA 1EESA 4K8RB 4C7JA 4PS1A 2K4IA 2ZXUA 1RE0A 2A9FA 3GLIE 1RFLA 1VYVA 1QVZA 1LV5A 1AUPA 4WFKA 3DMFA 3VUFA 2WVAA 2J3JA 2Z8YM 4PZ9A 3WGZA 4UPDA 5I7FA 5K0CA 4V0OA 1WU7A 2KS6A 3PPWA 4R7GA 1Q12A 4DYVA 1DG1G 1ONOA 4E12A 4YI3A 2F8SA 3RT9A 2HCJB 2JJ1A 3JZMA 4KIFA 5KL1B 2VF4X 1M73E 1HOTA 2QKQA 5DMHA 5FOVA 1G7CA 5CFQA 2XRZA 1VB3A 2NXCA 1PW7A 3H5LA 2HT1A 1N6OA 4IV0A 1FNNA 4IAOA 2YJNA 5DG9A 3BKWA 4G4SO 1Y1KE 3TD9A 5KFLA 1G4AE 2EFEB 2MSDB 1L7OA 1VL8A 2YICA 3CB4A 5J2KA 4RQ8A 2GMWA 2WAAA 1P4AA 1DO2A 1YK0A 1V7QA 1KSGA 4C6TB 3TIVA 4RE5A 4TTIA 4EJSC 2OG2A 121PA 3WV4A 1AKVA 1HUQA 2F1HA 3WK8A 4EP1A 3GA0A 1SXQA 2DQ4A 3H5NA 3KQMA 3PQFA 4KN8A 1W93A 4P7GA 4RZSA 4YQYA 3DJFA 3FDZA 1F3OA 2RHFA 3ZVKA 3E5HA 2NGRA 3NIDB 3OUUA 3TDNA 1O03A 1YZGA 1GTZA 3EYAA 3D4IA 1TYDE 1AB5A 2WFZA 5DGXA 5FPTA 4CI0B 2Y0PA 4HGOA 3G9XA 3A06A 1Y3IA 2BR3A 5J2UA 3OJEA 1G8KA 1HORA 4I2JA 2FSIA 2Z2YA 1V85A 2VZEA 4F4DA 5JSFA 1Z2EA 1Y33E 1FY2A 3NOQA 4EGAA 5HCNA 2VSXA 2YXNA 1OYYA 4M7PA 5KHLB 4EG8A 2QKYA 3TSOA 3K70D 3B1WA 4GGPA 5JNVA 2R5WA 2QR5A 3NXKA 4NU8X 3FTQA 3KXPA 2YXDA 3MWYW 1TUBA 4MQEB 5FBZA 3PEWA 2QD5A 4J6EA 2EFCB 4L5JA 4R68A 1J0CA 2FSGA 1V5FA 2PYZA 3DKRA 3FNFA 2Y77A 1QNFA 3NAMA 5AKHA 3L7YA 4RIGA 3ZWPA 3EWAA 1L4UA 3KQUA 3R5TA 1GYQA 2PGDA 1I0IA 4NDAA 5E1MA 5E4YA 2QGNA 4LBYA 4YMMA 1NFFA 1JFFA 1KAMA 3DUFB 3DVSX 3AY7A 2BEWA 1KR5A 4CMHA 1Y8RA 3KWMA 1NY6A 1UMCA 4U39A 1F9EA 1YQXA 5TGTA 5ADVA 3X1KA 5IK2D 3P9RA 9ICSA 2W43A 3FMIA 2QLTA 4G1MB 3MJHA 3DAYA 3CJRA 4PE5B 3ODPA 4E3ZA 4WCVA 2V59A 3M1AA 4EHNA 4F0JA 2Y0SC 5KDLA 3DMGA 1W49A 3JQFC 4TKLA 1M2VB 3RJFA 1SQ5A 5DQHA 1E96A 1JSZA 1I7LA 3EEFA 2MYUA 3EQ8A 3HKEB 4PFKA 4RY0A 4BV9A 4RTRA 3TGPA 4NE9A 1WLSA 5HF6A 1A82A 5B1SA 2DKNA 1A5AB 3ZHTA 4F9EA 1W1IA 4MEAA 4L4RA 1HRKA 3GUZA 4LXUA 3AWDA 4C30A 2JJ2D 5F35A 3ER9A 1PNRA 4TMTA 2ODPA 1DVRA 2NNLD 3WLOA 2VDKB 3TADA 4ND8B 5HA5A 1W2HA 4NMLA 3OJUA 1QCCA 1U7DA 2CVPA 4FOLA 2R79A 2Z3VA 2A19A 1P75A 2BGLA 5AKEA 3FXAA 4PZCA 5BVHB 4PLZA 3TH5A 1ZJMA 2KMLA 4BFZA 2VC2B 3LDUA 3ZKWA 4ABTA 1FJHA 1WPGA 2KN7A 1P1IA 1R0LA 5DHFA 4BQRA 4AN1A 1FJXA 3PR1A 1XB2A 3NTQA 4ZVSA 1A2OA 4CKWA 1UC8A 1UBUS 1K75A 2BV3A 3H8VA 2NN3C 3CW2A 3DMPA 2WV9A 4KQXA 4C7OA 5DLGA 1O3YA 2PT9A 4R8UA 2AEEA 1ZLXA 4GXIA 1WB6A 2O2CA 4MITA 5CVJA 5DW3A 1P1FA 2HUNA 4LUCA 1PWEA 1W96A 4X54A 4GR5A 3H2KA 4EJMA 4FNMA 4CQMA 2PRJA 5B58T 2PL3A 3O4IA 1YS9A 3BWDD 1E9CA 1OWNA 2OBXA 2QT0A 4IHJB 4AJ4A 4YDQA 4KLQA 1SXIA 4BO6A 1SC4A 1VDMA 3WGTA 1TKRA 4NZPA 1ZEJA 5A4JA 3X2SA 2R2GA 4IXTA 4EARA 2JEYA 3KOUA 4PBSA 3S68A 2YS6A 1LD3A 2GEDA 2O59A 3BMNB 1IHDA 4KO3S 3MBKA 3GVHA 4AZ3A 5K8UA 3PJDA 4HHEA 4DYHA 5J43A 5DWVA 3RSZA 5BUQA 1C0IA 1KJQA 3F4KA 2BAGA 5JY6A 1KKLA 1KYIA 3THSA 2VQ6A 1NBEA 4DUGA 4JLAA 2JGNA 5LP6B 1XPRA 3QF4B 3ZC3A 1D2RA 2AGVA 4HVTA 4PYKA 2ETXA 1NYRA 1YB6A 2BM8A 2F43A 2O2YA 5ESXA 5CB4F 5K20A 3L7LA 5KG1A 2XJ4A 1VIYA 3PHJA 4FMCF 1QO0D 5G5GA 1H2BA 1P1JA 3HRIA 1U2RA 3ROGA 2NWQA 2LCIA 3EZNA 4RELA 4BLPA 4E70A 1TUEA 2AXEA 1J2EA 1O4VA 5KEIA 1KC3A 4YROA 2CFSA 3K72B 3NGLA 2ONJA 2C8VA 3M9MB 4TMYA 3VSDA 4Z6CA 2AW3A 2DPLA 3LT0A 2OORA 3U3KA 3IUBA 4OREX 4OXKA 2DHQA 2FR1A 1JHUA 2R6HA 4DWIA 2J6TA 1BCSA 3ZDDA 2C7RA 5FR2A 1HEYA 3FOWA 4I7EA 3S5UA 2BW0A 3FSEA 3GLTA 2W8LA 2DF4B 1X7ZB 1WCIA 2FB9A 4YREA 1BMQA 3W5CA 3FETA 5GM2A 1LK0A 3OEED 3W2HA 3R7FA 4BO3A 4QG7A 1QGUB 3SMQA 3DE2X 2QUKA 2R8EA 3EVNA 3OCJA 4NCHA 4Y2GA 3GZNB 1MW8X 2W2KB 5ICCA 4ETNA 4Q1EA 1GZ6A 3MJTA 2OVBA 4EZEA 4DV5B 2RIPA 3LL7A 1C29B 3L7JA 1DRWA 3EFOB 4G1UC 2PGIA 4WMLA 2QTGA 3SZUA 4W6ZA 1NVAA 3EH2A 2H18A 4M9GA 3JQCA 2PFSA 4BUCA 2CUKA 1B6TA 1W4BA 2QROA 3OX1A 2UUOA 3ZWQA 4L08A 3QVGA 5B36A 3U9SA 2P5UA 2L0XA 4CKXA 1WU8A 1Q0PA 1HKHA 5JJIA 4X71A 1FSPA 2DC1A 1Y5NA 2C4WA 4QGGA 2OBNA 4DMUB 1Z3EB 4FNAA 1QLHA 2HY7A 3WLTA 3M82A 1T3TA 3EH1A 2CLKB 1AKQA 4FN5A 5JCOA 1N3LA 3BRWD 4TT3A 4EM6A 1N8SA 2GWSA 1QC5B 5FWYA 4B2IA 1M6NA 2Q9BA 2FWMX 4UB6U 1NN1A 3LU1A 2V97A 4MMXB 1YR1A 1WKCA 1PUXA 3C5EA 3IDQA 2J4CA 3EMKA 3RC2A 3KXDA 4R9UC 1DGQA 3FE2A 4MINA 2XMGA 1L1FA 2YBEA 1EJ6A 4LVCA 2OV4A 1IBMB 1VKOA 1LQ2A 1ZMBA 3S29A 2FP3A 5HXAA 3NEPX 3CZPA 1AQUA 1JG1A 5BVGB 4H6WA 4PGQA 5HTOA 3JQBA 3OP1A 4I2IA 1B3BA 2ZJFA 1YGYA 3AILA 3EY9A 5K3DA 2C5AA 2BHNA 2O2SA 2PT5A 2GEUA 2BGTA 2JHGA 3U1TA 2NVUB 2JFZA 2F17A 1A8IA 3JQ6A 1PL7A 4EX7A 3KTOA 4LI0A 1L4GA 1W5SA 1Y8CA 4DNXA 3RLFA 2D0DA 5JU6A 1PV1A 1OIWA 2JZCA 2Y1LA 1L7RA 2RRDA 1YVEI 4NXMB 3W5DA 8ICNA 2P3OA 2YQ5A 4KLTA 1ULZA 4D8XA 4IIGA 4AJPA 4BYMA 3IVMA 4MDFA 1N5IA 2KEYA 1PSWA 2GFQA 1T6BY 2REXB 2JCSA 3BS4A 3OLQA 3H3XA 1GUYA 3DAHA 3OZUA 4R5MA 1TKAA 5AHRA 2GO1A 3MHPA 1D5WA 4J7CA 4UNQA 5AXAA 3GFQA 2ZITA 1G42A 2GBLC 3BIFA 1K63A 2GPSA 4UB1A 3KO8A 3RKSA 3K5HA 3SNHA 2AYZA 3DD1A 4WY2A 4F7DA 4U1RA 3FYHA 3MAAC 5L3ZA 1TA9A 2A9RA 4FILA 2Y1KA 2IYXA 3U4AA 3NAQA 4RU9A 3V6KA 5TISU 1R6TA 5PNTA 3ZD6A 3TKAA 3DDNA 5THQA 3EXFA 1MENA 4HQFA 4YAEA 4ALJA 5DF1A 3SEIA 1GDDA 1GTL1 2OTCA 3FZNA 2G5IB 3NP9A 3Q3IA 4RF2A 1E1RA 4RHTA 1HDEA 3WLAA 1BZYA 3NYWA 4ENWA 1TC2A 4LJ4A 2WVGA 4EYHB 1EAMA 4KKVA 4QDXA 9MHTA 4YJFB 5B1EA 1RKBA 3AI2A 4LRWA 4BO5A 2OFFA 4XZ3A 1W47A 3AFMA 4K1XA 4Q1CA 3W2FA 4LGVA 4TX1A 2QUZA 3UB4A 3KS9A 1QG2A 4KXMA 4DGQA 2GLUA 3QNUA 5C5JA 4PLGA 4YQEA 2O0MA 2X40A 2HI0A 3E9MA 4Z7JA 1T43A 1Q19A 5J0TA 1GFIA 3LUDA 4LOIA 3BIOA 5LZ7A 1PS0A 3TD2A 1DIOB 1SC1A 3KALA 1OLXB 3S6JA 2CN1A 1TIKA 4ZCPA 3W1VA 2HHXA 2Q6KA 4U4AA 2PJDA 1TZBA 4C7YA 2ORYA 3IQXA 5AHXA 1MJ5A 2O6LA 5IXSA 1LB2B 4JOQA 1JYFA 3FBTA 4DFKA 4WNAA 5CB8A 1Y6JA 4J9MA 3WKDA 1AZSC 4XA5A 1ULHA 2BH9A 2QVZX 4IF4A 1E77A 2HK8A 2VRCA 5LC1A 2ZG6A 5LZ5A 1NXPA 5KWVA 2QZJA 4DJDC 4YJHB 3NW9A 2GZHA 4OUDA 3GIDA 1YZ7A 8ICGA 1Q0ZA 1T9KA 1NNLA 3IQZA 3K09C 4IMPA 1XLWA 4H16A 3EVAA 3KKMA 3LQ2A 4OSEA 3RODA 1XF9A 2IXBA 2FMSA 1VKNA 3EJ6A 4G0VA 1IBCA 2EX4A 5JRTA 1BH6A 2H2FA 3KJFA 4YFVA 5ECGC 3AM4A 2HBJA 2HJRA 1WULS 3EFHA 4MYCA 4Q9JA 4AY5A 4ANFA 4JLPA 1RCFA 3MG9A 2X77A 2V7QD 3GLFB 3PQDA 1Y7LA 3M3PA 1X0XA 4NJEA 3PO5A 2XH8A 3W5HA 3TAXA 4B6RA 4KQ2A 4CIYA 1KU0A 2H0AA 5EIWA 5BW6B 1VE3A 2Z4TA 2CD7A 4FCCA 1Z8DA 3WWEA 1NQXA 2A58A 2JVJA 1IULA 3BTOA 2JEIA 3OZEA 3VVBA 5DSXA 1EFRD 1KDRA 4YCBA 4LZGA 4ZOLB 1C9JA 5L53A 2CLDX 3PKIA 3TFWA 4YJ3F 1ZGHA 3CWCA 4D0LB 1PO7A 1SK8A 2V4RA 3SD7A 1T5SA 2QM7A 5FOSA 3DSRA 3QUBA 3VPCA 4XA8A 1QB8A 2OHJA 4DQXA 4G97A 1NDQA 4QBTA 3UXOA 4RAQA 2Y93A 3RS5A 4J3FA 4OFZA 1RXIA 1SPBS 3G7SA 4RHXA 3Q72A 2IHVA 3QFTA 4AULA 1IVSA 3P9PA 5SY4A 4DLNA 3CE6A 1GPLA 4QOSA 4RO0A 1KK0A 4URVR 1R37A 2HBYA 3EHDA 3ZEIA 4CM8A 1JF8A 2YV3A 3DXFA 3AEZA 2DB3A 3I42A 1N0UA 2OD7A 3ZGVA 3VA7A 4RPHA 4P0PB 4RQMA 3ZJTA 3TANA 1M1YB 4V0SA 1PWHA 3W9SA 3ZYZA 4CF6A 5DYIA 4B3MB 3EVGA 5ED0A 3FCSB 2H2AA 2H3FA 2R5NA 1PJ8A 1WXWA 3PTLA 4J9PA 3EOAI 4OYHA 4X20A 4XGQA 3VC7A 5BOSB 1MX3A 5KU1A 1J00A 3TLKA 3K1AA 1OY1A 1Y98A 1K7CA 3DVAA 5DGTA 1YCGA 5KJ1A 4LY0A 3NMUF 3WFZA 4TXJA 1GO3F 4G81A 3GX1A 1E2KA 2WJ6A 4YB8A 5BPFA 5LQDA 2DWQA 4RJLA 3NS1A 4YALA 1KBOA 4V38A 1S0OA 4JCOA 1E3JA 4H1VA 1Z8NA 1TZCA 3ILSA 4IOMA 4JI6B 1KI7A 1N3BA 3M6XA 2WDPA 4G4SP 1G8JA 3H2YA 5K05A 1LPMA 1RMQA 5BN3A 4FFMA 1GRNA 1NY5A 1P4RA 1T6XA 3E9EA 3KCNA 4KNVA 1EI9A 3C1ZA 5A3QA 2XOKD 3AN1A 2ATVA 2IYUA 3LQ1A 4R7TA 1XZGA 3AH8A 1L3UA 1I3CA 2C57A 2ORWA 1UBJS 4AY6A 3LKBA 1V26A 3GV8B 4PHTA 3MMPA 4R1MA 3RNLA 1GSIA 2OO3A 4EHJA 1DFGA 4MVJD 4YT5A 4DIDA 1LWOA 2I4OA 3RJKA 13PKA 3V7NA 1QQBA 2HHVA 4WDRA 3DUWA 4KLLA 4XB6B 4NJMA 3A04A 3KPYA 4EIWA 5KFZA 4TS1A 3PW4A 2IELA 1LPNA 5CP8A 1RQPA 1XHLA 2R87A 2VS1A 1U6KA 1C7IA 2ARKA 4MWBA 4ECYA 3PV0A 2KPOA 4B9UA 1VZ3A 2O1SA 2YDYA 1N9KA 3VHXB 2ZTCA 3JPYA 4RGYA 4O6VA 4A6EA 4DRXA 4K9DA 2JZBB 4O4LA 4EG1A 3E6AA 3F3SA 1V5EA 3QVKA 2MSNA 2NTYC 1QHGA 3QPVA 3ZHXA 3NUQA 3MS4A 3GV0A 5K1ZA 1V37A 3THYA 3D1VA 4I46A 1JXOA 2EJBA 5DGCA 3TXXA 2ZPTX 3PKJA 1AS3A 2ZUTA 2JFOA 4H3HB 2P7IA 1NUSA 2BC9A 1JJFA 2IPNA 4F97A 3DWEX 4NLGA 3RRHA 2AWNA 2A14A 3KKZA 1P3JA 2A0WA 3AR6A 3NBMA 2E7ZA 4FYMA 3KK0A 3BQTA 1QP4A 2ID4A 3I39X 3GU3A 4OQEA 5FWNA 3HY4A 5EXSA 4Y2PA 1CUHA 5MFPA 3WLNA 2REOA 1NC3A 3GBSA 5KFBA 3NVWA 3ETGA 1V7PC 2DWUA 2R8IA 3NC1C 4DLZA 4G0YA 3EXG2 1VA5A 3SEFA 1Y9DA 4PPXA 4JUZA 4KFSA 4BFLA 4OBBA 1E9FA 3AYXB 3T3EA 3V97A 3S2UA 4GDFA 4RQ7A 1SAYA 5AVTA 4A8JB 4UDYX 4AW9A 1KZ7B 3CE9A 4GI3A 2IIPA 4FGSA 2IYVA 2HA4A 3FMGA 1MVNA 4U8GA 1GG2A 3ZQUA 4HYEA 3RTBA 4N5NA 1GFWA 1K5GA 2EQAA 3DBRA 1ZQOA 2CFOA 3G17A 3RI3A 2A0KA 1CE8A 3LD9A 3MCUA 3OPVA 4L76A 1XTBA 4Q01A 1NUQA 5FYDA 3RGGA 3KOWA 3ZV3A 1V1MA 3UMVA 2F67A 1NFRA 4P8RA 8ICSA 3EGDB 5JU5A 3K6SA 3AO0B 1K8YB 1VPWA 2G5TA 1N2IA 4MRMB 4D42A 1E8MA 4UBBA 4EUHA 4MP3A 3RKRA 2CDRA 1J0BA 1ZGJA 4RF5A 4AY3A 1PYOA 3SYLA 4TMWA 1DC5A 4KUHA 4RZUA 8ICOA 1A7JA 4Q3LA 1FU7A 1XNJA 1XDSA 4QOIA 1CJUC 4U0JA 1LKYB 2PKXA 1WUIS 3OT4A 4UQOA 1JROA 4P2HA 5FKJA 1LFDB 1ZA2A 5GONF 3CLUC 4KPFC 3ZW8A 4ZI7F 1EGAA 4IWXA 4JQZA 3I8OA 3ZG6A 3RC3A 1TCAA 3KJHA 3JSAA 4R3NA 1AN9A 1V6SA 5CNIA 2C5LA 2X3UA 3AIMA 1I3LA 5JO9A 4EA6A 1P1RA 3N0WA 3SOPA 1HFJA 3TRDA 1W76A 3ESYA 4QYWA 2IE8A 5E9QA 1GL7A 1X74A 2AYXA 2GK7A 2VZLA 1K6JA 2B98A 3GGGA 2BZSA 1YFZA 3JVEA 4PXSA 2JI8A 1XDBA 3ELDA 1CHNA 3LA8A 1HEIA 3RTEA 5ES4B 4UTXA 3TPFA 2FN8A 4RA6B 3SM9A 3P9KA 4L0DA 1T3LA 3DL2A 1W5TA 4F84A 7MHTA 2ZIVB 2HWUA 4GI7A 4WNIA 4MSUA 4I50F 3RFCA 2W11A 5A7HA 1DCKA 4Q9KA 1IMOA 1IG6A 1YA8A 1NP6A 1Q8KA 3C29A 4F1KA 1D2EA 2H65A 4B3FX 2XADA 3PL5A 1QQ6A 2Y6UA 3KCQA 2W48A 1TM7E 2DHDA 4ECXA 2QX4A 4HQOA 4CV1A 3EZ2A 2YB1A 4D9IA 3W04A 2FFBA 2Q7DA 3WWDA 1RLUA 5I9LA 5E79U 4MGIR 3WYBA 1YRQA 2P27A 5HBGA 2BGIA 2VYVD 4A23A 4U00A 5CFPA 3OIWA 5CIWA 2C5FA 4LZNA 1V5IA 5SZJA 5KIAA 2H1RA 1LSSA 1SHUX 2NYRA 2ZQYA 1RVDA 1E6EA 4GOKA 4EECA 5JJBA 1RZUA 2GJSA 3PR4A 1XN4A 4A8JA 5DYGA 7ICIA 1F8GA 1EHYA 3FB1A 3PWZA 4YUXA 3E8MA 5ALPA 5NLLA 3WNCA 5DNDA 5AW2A 5GTHU 2ZR7A 2Q3HA 2AX3A 1XCOA 3GVXA 1ZWKA 4JNKA 1J2UA 1T8WA 1PT6A 1XRRA 3IMGA 1WMAA 1YZVA 4A8HA 1FFCA 3OKPA 2DSNA 4RYLA 5L40A 3IKTA 2XA9A 1L5MA 4QA9A 2CCGA 5MN6A 2VHQA 1ML3A 5J2BA 3IXQA 3R9XA 1G6OA 3G0OA 4ZVOA 1U3GA 4E6EA 3BJMA 1XEAA 2AHOA 5AVOA 1UK8A 4W5JA 5JEEA 3HP7A 2OAEA 1E32A 3R6GA 4COKA 2YTUA 2KQUA 4ZO8A 4PVCA 1ILEA 3AU9A 1QYDA 3DTVB 1PS8A 5JT1A 4R9VA 2JIDA 2Z98A 3SC2B 4XPIA 4MJLA 4RMJA 2WJZB 4UCXA 2IZOA 1DWOA 4GEKA 2WJWA 4BTVA 1Q1AA 4N7MA 3ZE6A 2ASLA 1U7ZA 1X1RA 4LXYA 2MU2A 3KKQA 1NRXA 2I1VB 2VP6A 4MI3A 1ZOPA 4DBLC 2VH5R 2WTFA 1Q50A 1MB0A 1V3TA 4PZOA 1FLAA 2F3SA 3AB3A 2ATLA 3IPRA 4R8LA 4B6GA 3V8NA 1RCTE 1IRIA 1D1PA 4ZV9A 3DCNA 3RSQA 3RUCA 4EB0A 5LL6P 4ZZ2A 2H48A 4UVHA 2QK4A 2X8AA 3GJRA 5AUNB 4PBTA 2HYDA 4GSLA 2K8AA 4ETMA 4X64B 5BQ3A 3IG8A 4URZR 3B1XA 3GLGA 1OXXK 2CC2A 4KOAA 2B8WA 3L1IA 3QGMA 2IHZA 4IOJA 3NEJA 4N5LA 3FKSD 1YBHA 5EOZA 1YONA 3LLUA 4L4ZA 4F4WA 1CCWA 1TTPB 2RHMA 3A6GA 3R8FA 1WD7A 3F3YA 2BCVA 4QJ5A 2V6FA 3NVAA 1XLVA 3VC8A 1R8QA 4WLNA 1VCNA 2WFLA 3WL4A 3RJHA 2VWPA 4YP3A 4RQ4A 2J9GA 1R4MB 1ZZGA 4LE1A 2UVPA 4WK0B 3D2CA 3TX6A 3KAPA 1PR4A 3KZXA 2EATA 3RUAA 1NMYA 3EUB2 1ZNYA 5EJEA 5KOJA 1IN6A 4AF8A 4Z0NA 4BO7A 1GITA 1JKMA 5C8XA 2FPLA 1CJTC 1DAOA 1PK1B 2W8KA 2TRSB 3H5IA 1GGEA 2PKWA 1OZGA 4YG2A 1WKVA 4A4DA 2JGRA 4G6ZA 1WZ2A 4KYVA 4GPIB 1RHKA 1IY2A 1CQIA 3E9ZA 3K05A 2R1VA 2ZDGA 4GLBA 5CXXA 5DLPA 5EWJB 4TV9A 4ZJYA 2QEQA 3HK2A 1X2EA 3K1AB 2NUTB 2LE0A 3FCYA 3QF7A 2OYCA 2QOEA 2PZGA 3A32A 4HTFA 4EKIA 2CHVA 3Q7RA 3VJKA 1CQJB 2WB4A 2W22A 1ODFA 4PF1A 3A4TA 1TLFA 2XE7A 5EPUA 4G4JA 3TAHA 1UWVA 1B22A 4RGQA 3K6KA 5BPCA 3ANNA 1FK8A 3E9NA 3HYNA 2B25A 2G4VA 3OZTA 4ILEA 1CUGA 1YU9A 3EMDA 4YDRA 3SS7X 1XYYA 3PXUA 3V1UA 3PEYA 3L7OA 1P0QA 1BW9A 4LZDA 1UOOA 5AI5A 1WMSA 2DFPA 3LPCA 4K1LA 4MRSA 1T0IA 2OZKA 4PLWA 5GADl 1EFPA 1BWSA 1GIAA 3N6XA 2RKWA 4ZALA 3D8NA 3HVHA 5IJ9B 1A71A 2PU5A 4YP7A 3D2QA 3DFKA 4F4XA 3WNBA 1NXQA 2OP1A 3SHTA 3NEAA 3OQ1A 3TGWA 1BJTA 1E4EB 4GZ3A 4ELVA 1NP7A 4MFAA 1T2VA 1OWLA 4YWJA 3A6ZA 1TEVA 1W46A 1DXHA 1SVSA 5FQOA 3IN5A 1P2SA 3DBLA 3TBHA 4H0FA 4EW2A 2W2QA 3AEYA 5KTRA 5KVVA 2IOFA 3KT3A 2W7PA 1DE0A 1JFLA 1SO8A 2XF2A 1BGXT 3O9ZA 4ZIRB 4V1CI 3LYSA 4B9SA 1M0TA 2BUCA 4S24A 4RULA 1QBGA 1N2XA 2PL1A 2R47A 2AOXA 3L1VA 3I9NA 3KYJB 4L3VA 1II8B 4U9IS 1FMLA 2ZVPX 4ZRMA 4LFCB 3S2IA 4BP1A 2ZDQA 5A9SA 2NYVA 3F2CA 1KEZA 2HUPA 1T5DX 2YVKA 5K3EA 4IJQA 1D4OA 3Q9SA 1W5FA 3FUTA 3V1TC 3COVA 2IH4A 1UZNA 3QBTA 2ZAOA 2IVZA 2H59A 3AUUA 3BIXA 3CZMA 3I6ZA 4IM7A 3GJXC 4AO8A 3UGJA 1O97C 1SVMA 3BUSA 2AYYA 3PPXA 1KMIY 4DCPA 4KWTA 3M6AA 3PW2A 2X0FA 4HLUC 3PNLA 4R66A 1GLNA 2GN0A 5G0WA 3OZXA 2DVMA 4LZJA 1WW8A 3HSKA 1Z6YA 4RF3A 5LXTB 4P3XA 2GEKA 2ZUVA 4P36A 5CEEA 3BTSA 4GC9A 5I4CA 4UOEA 4JUIA 2WB1F 2OPBA 2XCPA 3T4EA 4I3FA 4MUAA 5IHPA 3F7NA 4ER5A 3EG9B 1I51A 1L5LA 4UJ3A 1UBTS 1KH1A 4IZ6A 4Q02A 2DAPA 1VXRA 1MOSA 1E0KA 1Y1PA 2QRJA 1DKNA 1F0MA 4FJ2A 1PZGA 3S2ZA 4EPRA 4R1TA 5TE9A 3EPHA 4IMIB 2FWBA 1SQFA 4BX0A 2A3NA 1DRVA 4ZC1A 1FFSA 1VI6A 1U4NA 1QHXA 3OOSA 4L50A 4NU6A 4Y67A 5GOTA 4NJMB 4Z4FA 1CKEA 1GGHA 2XTNA 4NIMA 3B9BA 4P7KA 3STYA 1CS0B 3N8GA 3WNVA 3F49S 2VWGA 1CRWG 2HDHA 4L8VA 1ISIA 4YMLA 4P83A 7ICSA 5JV5A 1DUVG 1ID1A 2GHQA 2NUAA 4BB6A 4WRRA 1CHDA 3OFSA 4US0R 2GWHA 5LA6A 5F5NA 4GL4A 3KE8A 3HJRA 4MW1A 2TMDA 1M2OB 3TBFA 5A5VA 3OQIA 4LZZA 3B1ZA 4IC9A 4LMBA 5E4FA 3JR3A 1C7YA 1RAHA 4JX8A 8ICHA 1U3TA 1B7GO 1NYLA 3FPFA 3KT8A 4ON9A 2AJCA 3DT6A 5F51A 4YAFA 5K6AC 1D4FA 3IEVA 5CW1A 1DC8A 3RIYA 5FV7A 3VSBA 1MFPA 1WYGA 4JU8A 4CQJA 1F5SA 5EIAA 4UAGA 2YIVX 1GADO 1NK6A 4WA7A 4F5ZA 4YXWA 2BUAA 3RB4A 3WIUA 4OCZA 1HI9A 1MA0A 1NOKA 7ICQA 4DSJA 1I2MA 2PU7A 3L8ZA 3SIRA 3WLMA 1ZGZA 2I7XA 4WBNF 5F9FA 1OKKD 4CLOA 3P7MA 1T3SA 2OXCA 2ZU0C 3D81A 4FZLA 4R1OA 4J0FA 2P8JA 5CHYA 3OAAA 4HRXA 4E0BA 2PMFA 3AGQA 1MBZA 4RPLA 4IFBA 3ZIAA 3BE8A 3FCUB 3ZDQA 1KZ6A 2G0TA 1L5KA 4TS3A 3PGLA 4QJ4A 2PWBA 2CY0A 4YAWA 1CEEA 3HVIA 1V45E 1D2CA 5DJ5A 2DTEA 1E94E 3PA6A 1M1YA 2GPJA 2V8BA 3PXDA 1TE2A 3AWIA 3K2IA 1Q2UA 4I5GA 4LQLA 3GQBA 4QT0A 4F4UA 3SQWA 2ZI4A 2PLRA 3HKCB 3SEQA 1WUDA 4PHEA 2F3PA 1HE4A 3PW5A 2IW1A 2QTZA 2NU9A 3HCDA 1AKYA 2HMVA 3B7GA 1S8OA 1Q3KA 3D3QA 3HBJA 4TVKA 1XDGA 2JFUA 3DOOA 2ZI6A 4RQ0A 2IKQA 1X0VA 3JAWB 3V1MA 5KVCA 5C51B 5BR8B 3IMCA 4BRWA 5CDSA 4BRZA 1WZIA 2BDEA 2H3VA 1KY4A 3D7MA 3Q0IA 5E2IA 2CMFA 5KT3A 1BDBA 1A04A 1JZQA 1Y4ZA 4LSMA 5J2TB 2YDXA 1E98A 3J81A 1B6GA 2KSOA 1PU2A 5K4HA 4LJXA 2YWJA 3RIXA 3VYTB 4TL9A 5CT8A 3WQBA 1JBKA 4MMZB 1GT6A 4LRUA 4B6PA 1BMFA 4I5EA 4K3VA 5E6SB 4EDHA 3FZEA 2GH1A 1LBTA 2V98A 4G56A 5A4DA 2GM9A 3GZNA 1ITZA 4BEJA 2IYPA 3WX0A 1DZ3A 2FQQA 1IUNA 2P2SA 3O92A 4JOCA 4Z0HO 2Z5VA 2YHUA 4D3SA 4TYQA 1L7QA 1VBMA 4BXOB 2H1SA 3EW7A 3ZWNA 5CBKA 3OM8A 5G0TA 2JI9A 4MTCA 3WGUA 3V6MA 5FV4A 4WVFA 2XY7A 4H59A 3VDMA 2Z30A 3S44A 1QG4A 3WB0A 5J0WA 1ZU5A 1N2SA 4D9GA 5LMNB 1WY7A 4YXJA 1P9NA 3CVJA 4PM4A 4LVNA 3HO8A 4RHYA 4E51A 3ICQB 3IAEA 2KIVA 4TQSA 4RFLA 1EFCA 2Q0HA 4NYJR 4F5QA 1JR3A 1TYBE 2B9VA 4GW3A 4QHYA 1BHSA 4RC9A 2W9BB 3LXXA 4DQVA 2R60A 2REQA 1HYBA 4F4KA 4E2ZA 4L4YA 1BX3A 1JDBC 4MWTA 4BFWA 5JFTA 1Y3HA 2L19A 2VEDA 2ZBUA 1KJIA 1EUYA 4P4OA 1QH1B 1N5LA 3KC2A 3L82B 4H77A 3KV1A 4ZGGA 1AH2A 3FY4A 2CNOA 2F8KA 2PIAA 1JB9A 4N0DA 4YFYA 1Z4LA 2DR3A 3F5SA 4Y1RB 3OQBA 3GJ0A 8AT1A 1KP9A 4O0IA 2BCSA 3ANMA 3OG9A 4YECA 3ZW7A 1L3SA 1YR3A 2BLLA 5EUMA 3ADOA 3KZMA 5LN1A 2VNJA 4IQVA 3LX5A 3RRXA 2HR1A 4M86A 3R0ZA 1ZQEA 4I0WB 2BHRA 1V9CA 3KPWA 4C2BA 4EHLA 1JJIA 1WMBA 1VHJA 3NYIA 4JOBA 4E33A 1P7YA 1P7DA 1KHHA 4G1CA 1EFKA 2ZCUA 1SBYA 3I92A 3LIIA 4YJFA 5JS8A 4GM4A 2RBKA 1KXZA 1LJLA 2YHIB 2VRWA 4KLNA 4QOEA 1ZQAA 1SY7A 2C5SA 2A9KA 3B13B 3GL9A 5EJ9A 3MCWA 4CKZA 1ECFA 4M9QA 1Y7TA 4QTXA 3OE7D 2FZWA 1CYEA 1LU9A 3FDFA 5HQTA 3B36A 1NJSA 4YNBA 1VDZA 1IK4A 1HSOA 2BM0A 2X8JA 1DRJA 3GCWA 5CH5A 1TK9A 3FMVA 4K03A 4ZT2A 3CHYA 2IYQA 3EA0A 1RWVA 3TSYA 1I7DA 5C5EA 4EB6A 1IIRA 2HRRA 4CT0A 5B4TA 1M1NB 4CMKA 3R3VA 5EL0A 2JIPA 2R85A 2YWXA 5A4KA 1KVRA 4EBBA 1Q0TA 3E8SA 2QD1A 5AH0A 2GWRA 4NJOA 3GARA 3C3JA 1A0OA 4OXQA 4C0ZA 4JN6B 4BL5A 1G8PA 1UJ2A 2OWEA 2Q3CA 2ZI9A 3NTVA 4P32A 5LB2A 1XFDA 5JNSA 3ZN2A 1YB7A 3ZVNA 2WJVA 4GO1A 1E1MA 4JKOA 1NF9A 4NL4H 4XQEA 5GONB 1WW2A 3HB9A 3W9BA 1CK4A 1XHFA 4ILKA 1GNPA 2O3QA 4H1TA 2JJ1D 2MOKA 1XC9A 1GKUB 2VTEA 3OA2A 5JSZB 4AG3A 2QL5A 3UA4A 5EFOA 2WE7A 2F00A 3E0XA 5EP1A 4WBXC 3T38A 5A1JA 4Q82A 2QLBA 3VH1A 3QZUA 3GPCA 4PBRA 5D3KA 2FZ4A 3C98A 4JXJA 4RUAA 1BXZA 4EW3A 4GPTA 1RXCA 1XELA 4IO1A 4L6IA 4KQMA 3REFA 4TYYA 2PVPA 1Q7EA 1PI3A 4DVGA 4MWCA 4Q7MB 1HL7A 1JH9A 5JVDB 3ZOZA 3GFSA 2EX0A 2X9LA 1UQVA 4RJIA 2OFWA 4J0EA 4DLUA 3NKFA 3M9NB 2D2EA 3PSPA 1HE5A 4Q34A 5GTIU 1RG6A 1PBNA 1TQHA 1XZCA 1P9RA 1HOXA 2FEPA 2JDIA 4CHGA 3U3MA 2KMDA 2J3DA 1ZR4A 2BJWA 3ZKAA 1Q2XA 4WJLA 3ZHUA 1ZSYA 4Q8EA 1G2OA 4MVJM 3T5LA 3JAKB 3NIFB 1OFUX 2J0UB 3CUVA 3JQDA 3DGFC 4OSOA 5HF5A 4QTYA 4RJJA 4UAWA 3DW1X 2OCLA 5AVUA 2JH3A 3FMPB 4QEKA 1G2IA 3PIIA 2C58A 1JG2A 4FIDA 4PCUA 5IH3A 4MKGA 1VL2A 1HYQA 2X8LA 2AEFA 3D8UA 4GLJA 2JEGA 1SL2A 4E88A 4PQYA 4CHTA 4HDKB 1GUZA 3QBEA 3VDNB 1DBRA 2ABWA 5AIBA 1II9A 1RJWA 1XK7A 3USZA 4D56A 1RBQA 3INNA 3OIGA 5F7JA 3PITA 2O5RA 3TOZA 5CMLA 4HUQA 4O3SA 5H70A 1ZNXA 1PR2A 4EG7A 3EB9A 3W3AH 1Z33A 4ZQGA 3L93A 2VH2A 3QVOA 5KFGA 3HLKA 3O82A 1AN0A 2YR0A 4ISCA 1WXXA 2X4GA 3F96A 3G79A 2I4RA 4XPZA 4JWTA 3PHCA 3TOVA 4YN3A 2H7CA 3EARA 3HYCA 1L7PA 1PVQA 3QSGA 3JAMA 5J4LA 4ICAA 3IQWA 3QA9A 5J23A 1SKYE 1YRYE 3OTHA 1OZ0A 6AT1A 4NCXA 3M8RA 2WQ7A 4Q7QA 3R40A 4M0LA 5B7NA 1IC6A 1EXWA 1QS0A 2X0EA 3JWHA 3VM6A 1GZHB 4X3CA 2P91A 4DE5A 1F17A 1IVNA 1SGGA 5E8JA 1L7AA 3AVOA 5JAQA 3KIPA 3WYDA 3D1LA 2ZVDA 1NZFA 2IUSA 3C8MA 2EFHB 1D8BA 1X9XA 4NL9A 5AM1A 1Y48E 2HHJA 2H00A 2O23A 3EWNA 4I1UA 1E2EA 4IGAA 1OCEA 3T41A 1NKTA 3LUBA 1RPAA 4ZYUA 1SOMA 3WAKA 2E5SA 4MVCA 3SAHA 5IUJC 1YJAA 3NM5A 1B8PA 5FIUA 3MTAA 1PDVA 4S04A 4AJ2A 4EO4A 5AHKA 4BJ1A 1F12A 2OUKA 4JHXA 1G4HA 4PVDA 3CO0S 3QMMA 2P30A 1ESNA 2E8OA 4O1HA 2HVIA 3PXGA 3VOSA 5KYKA 5FPSA 2Q1XA 2NRVA 4OJOA 5KTMA 3KZNA 2H1CA 4IQFA 4LMPA 4N7BA 1T2NA 1TT5A 4H4DA 4RZ2A 5TR9A 3TQCA 4N7RA 4A16A 3H9JA 3GIIA 3HRHA 3HSYA 2A0FA 2WIFA 4RK0A 4BMCA 2GPBA 1EG2A 1EWTA 4NOJA 4DPLA 1CF4A 2CNWD 3FB4A 1U7OA 4JI3B 2Y1OA 3QENA 5IUNC 4MQFA 1GPUA 4DLSA 3UJNA 4J43A 4YUZA 3QTTA 2DPXA 3IB3A 4BGEA 8ICWA 4NARA 3JARA 3Q7EA 1LS1A 3D4NA 4IICA 2ODQA 2LM1A 3EF0A 1ZETA 2ZETA 2OV1A 3C8DA 2QQ0A 4R8SA 2G40A 2MYNA 3RVRA 1Y1TA 5JD6A 4PSAA 2FV8A 4W5TA 2BGWA 1AK1A 1WVIA 3M4XA 4LWOA 4QIHA 4ALNA 1AJEA 2PQ0A 1PL0A 4PWYA 2P68A 4J9NA 3GAAA 5HR6A 2NRWA 1R8YA 2XF8A 2ZRBA 3LYHA 1Y8AA 2E48A 1BFDA 3DWFA 4OXXA 4ZAZA 5KS2A 3CCCA 2J3QA 1KTQA 3G8CA 3L4BC 3WO1A 1XDDA 1P39A 3F1LA 3OLVA 4LHSA 3U7QA 2D1FA 1QFJA 4GI1A 5IP5A 2JFFA 4BFSA 3P9ZA 3DPUA 3UMGA 4ZPXA 1ZJJA 5DNCA 5FADA 5EYPA 1ORHA 1PR5A 2ZIAA 5FNVF 4OAPA 4NR0A 3RFXA 1ZK3A 2DTXA 2ZRDA 1YJCA 3SSNA 1PR0A 4KYIB 2QZSA 4IDBA 1FUIA 3DOEA 2MMCA 4F96A 2WD9A 3JASA 3ONDA 2UYGA 4H4EA 4RK1A 2Q4DA 5FJJA 2QNIA 1JMSA 3WFIA 2R7KA 3TUJC 4YRCA 4KX3A 2XTMA 1YQWA 3WK5A 1FRFS 2FOIA 5BN3B 3MDAA 3LFHA 2EFGA 4B32A 1BMDA 1Q84A 4AYWA 3V7FA 2IHBA 4URWR 3H1BA 4H35A 3PRYA 4K28A 4I2VA 3HFRA 1ELOA 3N7TA 2QTVA 5B2ZA 1C1XA 3TJRA 1XQVA 2FG6C 1KP2A 5JO0A 3RH6A 3CW8X 5KFSA 3IP9A 2XNJA 1OV4A 4ZAVA 1DKOA 1S3IA 2QV0A 3LGSA 1I5RA 1EWRA 5BSMA 1DT3A 2KBEA 4GM1A 4XJTA 1OXUA 1I2AA 1DIRA 2QY9A 5EP4A 3M70A 3ZXYA 2YJ5A 1P29A 4ND5A 3SBEA 3ILVA 1FNBA 5ENVA 4X3PA 3CZ4A 4PAGA 3ZGXA 1GXSA 1GAJA 4YAOA 3ZWMA 2QAGA 4XWWA 1GU1A 2IU3A 1NUHA 4PS0A 2AT1A 4JV5B 3THWA 1JLLB 2DUMA 2R8HA 2PO5A 5GWXA 3MWDA 2GLEA 1X7YA 3MSXA 2X1VA 4MQEA 4C05A 4RESA 5I7EA 1HDZA 2CLHB 2X13A 3QRWA 3V42A 4DQSA 5FL7A 5BUZA 4LRSB 4WA8A 4IJVA 1ISGA 1M54A 4JNCA 5CA0B 3FR7A 2JRZA 2KZMA 1XCBA 2HQRA 4WE3A 5A3SA 3BEDA 3SSAA 3TD6A 4AKSA 3F67A 3U4QB 3CKLA 2I4MA 4BEBA 5DHPA 3WV5A 4D26A 1V9SA 4C21A 4FI3F 5BQXA 1S96A 1EEXB 3IESA 4CDRA 4N3CA 5A1TA 4UAUA 2IQ5A 4HB0A 3BH6A 4IEEA 4OFWA 3DHEA 4XD7D 4IBOA 2G4CA 3MOIA 2QXYA 4JP2A 2AZXA 3W2IA 4TMZA 2BY4A 4MP6A 4NG4A 1HIWA 4ZAYA 3U80A 2Q5IA 3V2HA 2GHIA 4UOZA 1RI3A 1S2MA 1TPZA 2J41A 1E1CA 1XWWA 2OECA 5JBQA 1I1HA 2OMEA 3SU8A 1LQUA 3GRYA 4G8DA 1UKBA 3TQFA 2FWRA 1AHIA 4LYGA 2NMVA 1NLMA 1YT5A 4S1WA 5FBVB 1A76A 1Z9BA 1E3QA 1G0NA 2QPTA 1ECJA 3N76A 3TLBA 4NMWA 1EB9A 4ZAFA 4BVAA 2FZEA 3V8MA 4YGXB 1J25A 1KBUA 3ER8A 3ROFA 4HCJA 3G9QA 1THGA 3KUKA 4O5OA 1MPTA 2O06A 1A96A 1Z6AA 1CWUA 4RANA 4R54A 2Z2JA 3GLRA 3QKRB 4JJAA 2DUUA 2OO7A 4WXPA 1S5LU 1NX9A 1V5GA 2V96A 4ZOBA 1IN8A 1EUDB 3MMNA 4KC0A 4WZAA 2Y1WA 2ZQZA 5AR1A 1XYGA 4ZARA 1TT5B 4RA9A 1L7BA 2QI9F 1EFVA 2IPXA 2ZE7A 2IVFA 4P33A 2RFLA 4KAAA 5DN6D 5EZ5A 3VNUA 2UZAA 2VDLB 2ZTEA