4C4TA

Structure of beta-phosphoglucomutase in complex with a phosphonate analogue of beta-glucose-1-phosphate and aluminium tetrafluoride
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
217
structure length
217
Chain Sequence
b'MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-PHOSPHOGLUCOMUTASE
molecule tags Isomerase
source organism Lactococcus lactis
publication title Alpha-Fluorophosphonates Reveal How a Phosphomutase Conserves Transition State Conformation Over Hexose Recognition in its Two-Step Reaction.
pubmed doi rcsb
total genus 76
structure length 217
sequence length 217
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2013-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 4c4tA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4c4tA01
5ALXA 4EX6A 1U7PA 5AESA 4FYPA 3QU2A 1RLMA 4G9BA 4F71A 4Y2UA 5AM2A 3N5KA 3S6JA 1J97A 5AW9A 4ZEXA 4QJBA 3FM9A 1T5SA 3EPRA 4NFLA 1K1EA 1FEZA 4O8CA 5ALJA 1WVIA 1L7OA 2FPRA 1SWWA 3U26A 3WKBA 2C4NA 2R8ZA 3U13A 3I6BA 2CFSA 2JGAA 4BKMA 2R8XA 4J03A 3I1YA 3OTQA 1U2TA 1PW5A 3WK4A 5AK6A 1NRWA 1VJRA 2I33A 1XPJA 3OCVA 4NABA 1T9ZA 4HGNA 3NRJA 1RDFA 1WR8A 3KDPA 1Q92A 2B82A 3A3YA 5AKJA 3DDHA 5A3QA 5AICA 1RQLA 1RLOA 3BA6A 3OCUA 2JAOA 2FDRA 3UMBA 3U7GA 5AVTA 3SKXA 3NANA 4XE5A 3D6JA 3R09A 1L8LA 4L57A 1RC8A 3SF0A 4CF3A 5AVXA 2WM8A 3SMVA 3A1EA 4BNDB 2YN4A 3AR2A 1RQNA 4B6JA 4HGRA 3E8MA 2CFRA 2HSZA 3UM9A 1NNLA 4OFZA 3E84A 3E58A 3QUBA 5ALNA 3N28A 3AR3A 4AP9A 3U7FB 2YMQA 3AR6A 3DAOA 3RF6A 5AVRA 2OA0A 4YIKA 3WK9A 2YMLA 2Q4RA 2X4DA 4YCMA 3M9LA 1Y8AA 3L0YA 2BY4A 4EZEA 3TLMA 4OD0A 2W43A 5AKGA 4UM5A 4BYGA 5ALTA 3NASA 4KYTA 3B8EA 2CFTA 3ESRA 3SKYA 1Z4QA 3I28A 3QU9A 4YIHA 1U02A 2W4MA 3WKCA 2G07A 3PGVA 4G63A 3WKAA 1ZRMA 3B9RA 1TJ5A 2HF2A 1Q91A 1TJ3A 1Z5UA 4Y2JA 2PR7A 3AR8A 4EENA 4HGOA 4HGQA 5ALPA 5ALKA 2WHEA 3KBBA 2PQ0A 2JAUA 2NYVA 3W5AA 3ZTWA 3WGUA 1Z4NA 2ZBEA 4C4SA 3L8HA 3P96A 4JDPA 1Z88A 4NWIA 2I7DA 1TA0A 1WPGA 3OCXA 1O08A 3UMGA 4UAUA 5AM4A 3WKDA 3A1DA 3AR4A 4HAIA 1QYIA 3SHQA 2IYEA 3L1UA 3OCYA 5AKHA 4UU1A 5ALVA 2HCFA 1CQZA 4UW9A 4UASA 2G09A 1TE2A 4PNHA 3PGLA 3J7TA 2B1QA 3A1CA 4J2TA 5AVVA 3QXGA 2GHTA 5ALWA 4CNQA 4JB3A 4BBJA 4HYTA 1MH9A 2EAUA 2RARA 1NF2A 1SU4A 5AI9A 1YMQA 3HLTA 3EWIA 5ALZA 2YJ4A 1ZOLA 5AW1A 4EX7A 1ZD2P 1Z5GA 4C4RA 2MSNA 3EF1A 4NV0A 1J8DA 3ZX5A 5ALFA 1CR6A 3L7YA 5AKEA 1QQ6A 3WK7A 4MUMA 4C4TA 2C8KA 3QU4A 3QUCA 3FPBA 5IT0A 4CE6A 1L8OA 5ALEA 2AGVA 4YCLA 3F9RA 4YGYA 5AVSA 4E88A 4UU0A 3RFUA 5JJBA 4OCZA 3UMCA 1Z4MA 3ET5A 5AVYA 5AK5A 3ONNA 1L7NA 3W5DA 2GFHA 2GHQA 2FUEA 4NAVA 2I54A 5IS2A 2QLTA 5AM1A 1Z4JA 3VAYA 2YY6A 1YNSA 3FPSA 1RKQA 3QX7A 2ZOSA 4BX0A 1L6RA 5AIBA 3WK6A 5ALDA 3CZ4A 4DW8A 2D2VA 4AS3A 2PKEA 4Y2XA 5AM3A 3ZVMA 2BDEA 4RESA 2FPWA 4ZEVA 2OBBA 1U2SA 1O03A 1RMQA 2B8EA 4EELA 4FE3A 3FGOA 4BX2A 3NALA 1TJ4A 1S8OA 1RMYA 4UAVA 1QQ5A 2IA5A 5AKKA 2AH5A 2G08A 3L1VA 3M1YA 3IRUA 3NIWA 1L7MA 1Z4PX 4HGPA 2YFYA 1XVIA 1RPZA 5AW4A 1EK2A 1QQ7A 3WK5A 4MWOA 4Y2RA 2Q4TA 1LVHA 5ALSA 2EARA 2MU1A 2QYHA 1ZS9A 2JAWA 5AVUA 5AK4A 2NO5A 3L8FA 3R9KA 3QGMA 2B30A 5AM5A 3W5BA 2I6XA 5A3SA 3ZTYA 1XP5A 1LTQA 3ED5A 1ZD3A 5FP0A 4DFDA 4KNVA 3ZWKA 5AKZA 3MN1A 5AW3A 3KZXA 1YV9A 5ALMA 3BWVA 2WF8A 4L6AA 2YJ6A 3OCWA 5AHXA 3W5CA 2R8YA 3ZVNA 3QU7A 3L8EA 2GMWA 4XQ0A 4I9FA 2HDOA 5ALRA 4KN8A 3GYGA 1JUDA 2O2XA 2I55A 2MU2A 3ZVLA 3KOOA 4H1WA 5AW2A 4FFDA 4BNDA 3FVVA 2C88A 3R4CA 2HI0A 3ZWDA 2G80A 4YH1A 2ZBGA 4DCCA 3QYPA 5AI8A 2I34A 4IFTA 1T5TA 1RKUA 3PCTA 3KC2A 2WF6A 2AMYA 1YDFA 3HYCA 2P11A 1RKVA 5AW5A 2YMPA 2C8LA 5AI0A 3U7EB 2P27A 5T41A 5ALQA 4DWOA 2G0AA 2HOQA 2OM6A 5ALLA 3NUQA 3EF0A 4EEKA 2DQSA 1Z4IA 3AR7A 4XOUA 2HHLA 1RMTA 2Q5EA 1ZD4A 5AKXA 5ALIA 2ZG6A 3QUTA 3WGVA 3MPOA 2G1AA 1VFPA 2FUCA 2WFAA 4CF5A 2B0CA 2G06A 5AM0A 4Y2YA 1QH9A 2YMMA 3E81A 2IOFA 4IG4A 4BX3A 4Y2QA 5AVWA 2JARA 4YCNA 2P9JA 2ODAA 4QQFA 2YJ3A 2HEGA 2FPSA 1YJ5A 3SD7A 3QLEA 1WZCA 3KD3A 5AW8A 4GIBA 2FEAA 3MMZA 3N8GA 5AVZA 2FI1A 4Y3UA 4BEVA 2BDUA 4RETA 3FZQA 5ALUA 2VKQA 3AR5A 1RRCA 3N07A 3N1UA 3U19A 1S2OA 2ZBDA 5AW7A 5AI5A 4Y2SA 1F5SA 5ALYA 4UATA 5A3RA 5AIAA 3ZI4A 3AR9A 1RLTA 1Z4OA 1Z4LA 4UMFA 3ZX4A 2GO7A 3L0CA 5IT4A 1N9KA 1ZRNA 3K1ZA 3I76A 5ALGA 5AI4A 1EK1A 2RAVA 4AS2A 4UMEA 3IB6A 3ET4A 2AUTA 2IOHA 3DNPA 3SLRA 3QNMA 5AKIA 3QU5A 5AKLA 2O9JA 2CN1A 4KNWA 3ZW7A 1X42A 1N8NA 2HF7A 4KX5A 4OHFA 4Y2PA 2R8EA 2NO4A 2HX1A 3ZU6A 5AKYA 2B1RA 3OCZA 4KX3A 4I9GA 3OPXA 1ZD5A 2FPXA 4ZEWA 2RB5A 5AW0A 4UM7A 2YJ5A 4L6CA 3CNHA 3L0BA 5ALHA 3WKEA 3DV9A 3NAMA 3ESQA 2HO4A 4UMDA 3L8GA 2OYCA 2P69A 2C9MA 3L5KA 2WF9A 5AI6A 3PDWA 1AQ6A 1L7PA 2YBDA 3MC1A 5E0OA 5AK3A 3B9BA 4UARA 4Y2VA 4CF4A 4GXTA 2ZBFA 2B8JA 4BEWA 2EATA 1U7OA 1Z4KA 3QUQA 2WF5A 4Y2TA 4UMVA 1SWVA 1YS9A 2FPUA 3WK8A 2RBKA 2W11A 2ZXEA 4XPZA 5AW6A 1ZJJA 1KYTA 2IOFK 4F72A 5AVQA 2WF7A 1IWOA 3U7HB 3ZUPA 3IJ5A 1VJ5A 5ALOA
chains in the Genus database with same CATH superfamily
3BWEA 3A0UA 1U7PA 2JHGA 3C7CB 2F8KA 3KVYA 2XT9A 2R2GA 1E98A 2JFXA 2X4IA 1VLVA 3WGQA 5F21A 3NGLA 3OVMA 4CMEC 4CTOA 1Z9BA 5J5VA 3GLIE 4DMFA 2VQSA 4XWTA 5BQ3A 2HQOA 1QR6A 1N36B 1UODA 4EF4A 5ED4A 4QZ8A 2A0WA 1KKMA 1T4CB 1DXQA 3K2QA 4P86A 5CVEA 4GLJA 4BJ5A 2F3QA 3IAM6 2NU7B 3RDPA 2BCVA 2DHRA 1CJBA 2FSHA 2VAWA 2HSDA 3NYRA 5AJWA 4GWGA 1WLYA 3WWDA 3ZN2A 4ZCIA 2C1XA 2JH1A 2LTAA 1JQAA 1IK6A 1ZU4A 3IMKA 2DFDA 1KFDA 3LKDA 4G81A 4AY2A 3QVGB 2AIRA 2LKCA 2OLEA 1V8OA 2HJWA 2A9VA 4FGZA 1U0GA 4I1RA 1A8IA 4ECEA 3AEUA 4WNCA 4ZU6X 5BN5B 1BMDA 2OR3A 3OD5A 4XWKA 2EANA 4QIWF 1WDLA 1RC1A 2ZSAA 4MWZA 3WS7A 3G2JA 3WK4A 1GU7A 2SKEA 4L8WB 4MV7A 4MYDA 4QREA 5TMBA 1O97C 3RWMB 2HVIA 1E0DA 3PGJA 5LZ4A 4B45A 1X9IA 2BD0A 2OENG 3HBFA 2P6UA 4NG4A 3NRJA 5AJXA 1JT9A 5HTOA 3Q8XB 2Q5IA 5KTKA 1RT9A 1CERA 4HNGA 2VDLB 5AOAA 4NU6A 3DL7A 3SC2B 5AYVA 1G3IA 2ZTUA 3SHWA 5A3QA 3RVMA 1NQUA 4UAYA 4Q9IA 3ZDAA 1WSWA 5TRTA 1TAMA 4US0R 1H6CA 1NXQA 4L4RA 4NONA 3RUHA 3T0IA 2YY7A 1SD2A 3LVBA 4RV4A 3KSBC 4P31A 1YOBA 1KQFA 3A3KA 4RM3A 3T3PB 1VE5A 4U6PA 2FAXA 3T5PA 3V6LA 3WRVA 2LDXA 2P1DA 1IB6A 3KDSE 4HRVA 1T25A 1AOXA 5JC8A 4CF3A 3Q40A 3WADA 3FCUB 2DL0A 4ECXA 1PFUA 3EARA 2XB6A 4WW0A 4G1VA 4EAAA 2F67A 2ZREA 4ARUA 2LD4A 1Z7YA 2BYTA 2H59A 4FOSA 3V8PA 2HD4A 2ZXHA 1IQ0A 2CCJA 4I2EA 1H66A 1Z6GA 3GPCA 3L7CA 3H4MA 3DEZA 3SENA 2ZCUA 4PLFA 4G5GA 2OMEA 3UUWA 1UPAA 2QM7A 5EUBA 2I87A 2CFRA 3C6YA 4H77A 4L16A 4V3CA 1VLJA 1LK7A 5G0UA 5HW0A 4LJ8A 4KIFA 4IDNA 4E03A 5BV1A 3L1JA 3WOHA 7ADHA 3BKXA 2WWGA 3H5LA 5A6VA 5HILA 1P81A 4DBLC 2R3SA 5F77A 1U2QA 4IHJF 1SUEA 5JRJA 4CETA 3RSLA 5K3OA 3RU7A 4MEYA 1IOLA 1THMA 4ODIA 3QE9Y 4OG2A 4ADSG 4D2IA 1H1TA 1G7RA 2BZSA 2X4DA 2NQTA 2L2QA 4BLSA 1JHOA 2QQ5A 4POAA 4YJ2F 3GZNB 3IVXA 4KLSA 1JQEA 2CPRA 5LQKA 2Q49A 3WWEA 4DEYA 4ZIRB 1GNQA 1E2UA 1QLJA 3GFGA 4LVSA 5JCOA 2QDKA 1HTTA 3FGPA 4KYTA 2XX3A 1IBLB 1Z4QA 5JSKA 1FYEA 5DEIA 3BMQB 2GF2A 3WYDA 4DA6A 1NU6A 4GM4A 4PH5A 4QPCA 2GM3A 1U0NA 5F78A 2H16A 5KQLA 2C04A 1HDOA 3EZ7A 1I6LA 2JGMA 2JGIA 5TJ9A 1X8JA 1W44A 2PMWB 3H19A 2CUKA 3QWIA 3FVWA 2PKQO 3MWGA 3OOJA 1V71A 3QI7A 1P33A 4F9TA 2EWMA 2KBFA 4W9RA 4HDKB 1JVSA 4I4TA 4OY3A 3IAFA 1UFKA 4ZJZA 4P4LA 4FOOA 1NLZA 4F9EA 4C4SA 2OE2A 2PJRA 1LDYA 3PX7A 4HRXA 5D6NA 3U6KA 1Z88A 4F5RA 4KLIA 3NHRA 2I9PA 3MWFA 4PL1A 4FYVA 1O94A 4ZDIA 3LKBA 4PY2A 3B7WA 4PG5A 4MHSA 2ASLA 4EB6B 2X0NA 2IIQA 3L40A 4HAIA 4H0FA 2YHIA 4DCVA 3AUAA 4D0NA 4IDBA 1PG5A 2AS0A 3VMMA 2HLDA 1E94E 2O3RA 4HK4A 1I7DA 4IV0A 4ZEOA 3H40A 1QXSA 1YR8A 4WD3A 2R6FA 5CM2Z 3KEQA 5AOCA 1G21A 3AJ8A 3DCYA 3N59A 4HYYA 5LMZA 4F5DA 1PCXA 3OTHA 2BFPA 3FBGA 4O2AA 4I1PA 2FKNA 2PXHA 4DUGD 1K6EA 3IO3A 5T64A 2J3HA 1WEKA 3K0HA 1NUSA 4PYNA 4YCSA 1SIJA 1KMNA 4RTSA 1KVTA 3BL5A 4DSNA 4JXXA 2IIVA 1F6DA 3ORHA 4G0QA 1QUEA 4KR0A 4M1ZA 1MH9A 1UXKA 1XU7A 1NULA 3O1IC 1T4MA 1R6DA 4RAQA 2ZDHA 1MNAA 1N7GA 4GDFA 5FAXA 3ETLA 3E5MA 4ZRDA 1T7PA 1BC5A 4EY5A 1NRXA 1V4NA 3IVCA 4P4OA 2NYRA 4ENWA 1PBTA 1X94A 1XXHE 1ZNXA 2SKDA 1CUVA 2WR8A 3RE1A 3HYNA 3MMXA 1KZ4A 4JUDX 1EGMB 4NATA 4P84A 3SSNA 3PO5A 1UQRA 2EH9A 1YZVA 3EUFA 3P5BA 3TQFA 3U9TA 4RX1A 5CCXA 1T26A 4YRQA 3H99A 2JFUA 4LGMA 3RTVA 1D9XA 5EZ5A 2BR3A 3LDAA 1G8MA 2VJCA 2FX2A 1Z8FA 4O3QA 1K9VF 2DPYA 2QR2A 2WVJA 3ZJ4A 4BP3A 3IALA 1NMYA 4H4CA 3PPXA 1T5LA 2VDRB 5FYQA 2FN8A 2HWWA 2ZVDA 4E7PA 4QZVA 5IDVA 5GJBA 3K35A 3FTEA 1UFVA 1ULHA 4IIXA 4KRFA 3D2SA 4DC9A 5K8JB 1OPXA 5CLFA 1NPYA 1BE8A 1HT3A 3AKCA 3HVKA 3BBLA 4K9LA 5ULLA 4F4FA 4YRFA 5DI3A 1JVNA 1CUXA 1JRPA 1V2GA 1DKUA 1HDIA 1GZ3A 1XDDA 4ED6A 2GZSA 4QQ8A 4YECA 2A0UA 4B4OA 4CVNA 4M3NA 4OVKA 3EODA 5J0YA 3AINA 4QUHA 2XUJA 4ZVUA 1SV4A 1NBWB 4FBLA 4Z4IA 1M54A 1E89A 5IC5A 2GFHA 2W2QA 4XYBA 4Y6PA 2WWWA 3I9LA 3H4BA 1L4MA 1NWHA 3PF8A 4RFVA 3RS5A 2F1HA 3T6KA 4EHKA 5BSGA 4MK4A 2DT5A 1B8PA 2CDCA 3SM3A 3QKUA 1F7VA 2Q5FA 1I7QB 1TU4A 1IXYA 1UMBB 4JWMA 3ILSA 3D64A 3VOAA 5ALDA 2EZYA 2E9SA 3CZ4A 3G2NA 4RPCA 5BPFA 4PRKA 5B58C 5MFPA 2PSDA 4K3VA 4Z86A 5A2QA 5D87A 4WCDA 3H2BA 5GZ6A 4R1MA 1L2TA 1PSWA 2FWRA 4HAXA 2BDEA 4HPXB 3VHQA 5IASA 1U2DA 1ODTC 4RSHA 3GLFA 4ZOLF 5J2AA 2CLEB 1YJXA 2VCYA 1AX9A 2Q07A 3LS2A 4WY5A 5IFLA 3FIUA 3EPPA 1T9BA 3NS1A 3INYA 5FIUA 3WOVA 1KH1A 3DD1A 4QSHA 2IPNA 4KMOA 1DZIA 1S8OA 3CRRA 4AAYA 2Z30A 3OC6A 3AUOA 4ZYZA 2Y1KA 4ZT7A 2IDZA 1QOZA 4KTTE 2CWWA 1XDZA 4BE9A 2DXIA 1KOFA 1WZ2A 3C2KA 5FJJA 4J43A 1VMIA 1NI4A 5BRAA 3QRWA 1EGVB 2AVNA 1QX3A 3WNCA 4Y2RA 4FNOA 5CB1A 3PD7A 3PQ6A 1ZCFA 4FFMA 1L6NA 4UHFA 4XX0A 1GT91 4KMSA 3O4IA 5F23A 4JEHA 6Q21A 3USCS 2XY6A 2YWRA 1JKIA 1JDPA 4E4RA 2AU0A 2AFIB 1GZ5A 1LF0A 1NDQA 1A50B 2WOJA 2XGSA 1CKEA 3KJEA 4D3SA 4ZCTA 3W8NA 3SXPA 4F6LA 4KW7A 3ZXYA 3A6JA 4XEUA 1CRXA 3QLVC 3CURA 3EIQA 2I3GA 3ED5A 3T8YA 4C7XA 1PJQA 5A4MS 1YONA 4RF3A 2KD1A 1X9MA 3AUFA 3GY0A 2GBPA 4LXUA 1XN4A 1VBMA 3A3PA 3ZUGA 2IH4A 3HY4A 1H4TA 1AKEA 1Y34E 2UDPA 1PW7A 3DDUA 4IIGA 3HT3A 2R8GA 4Z2YA 2JD0A 1IY9A 2VTEA 4A3SA 3FNBA 2BEWA 1NOJA 1E1RA 1HFEL 4MHOA 2DQNB 4DL4A 1L4HA 2MUTA 4R4JA 3BE6A 5B3JA 3RVNA 4I5DA 4YAFA 2XLCA 4Q1BA 3DWGA 4L3OA 3ZVLA 4IFIA 4KV9A 4QAQA 1G7CA 1TJPB 5J0TA 5KT7A 1PBNA 2YBEA 1OGIA 1QHXA 4HLUC 2XTMA 3PI6A 3OMXA 2C88A 2MDTA 3PICA 3W6UA 5EL0A 2W2PA 5FPTA 1NYRA 1G4UR 2A5FA 4BB0A 4V1CB 2IPAB 3LT2A 3LX4A 1TT5A 4JK3A 4N8DA 4OFXA 2MIIA 3QYPA 3EFOB 4AQ7A 3OY7A 4EGFA 4EVQA 3PCTA 1HE3A 2IHBA 5ERGB 5KNCH 4FFPA 1FBTA 2P9TA 4OHUA 2C2MA 1F0YA 3IBCA 4MUKA 2FYTA 4WNAA 3KQYA 2P2YA 5B5EU 1G8FA 2WA1A 5FOVA 7ICKA 3C3WA 3SEZA 3SQMA 4PV7A 4KLQA 3FFBA 2UYYA 5EWFA 2O3QA 3MXTA 3EC7A 1A8QA 4Y1GA 4DUPA 3BGOS 1SB3C 2H3HA 2HMYB 4DWOA 5DVZA 1GIAA 2QT9A 3AF4A 2HBMA 1Y3FE 2XUKA 3BB1A 5DTRA 2EZXA 2EJCA 4LCEA 3OPQA 4B9UA 4ALKA 1LQ2A 4EO9A 3RIYA 2GDZA 3KKKA 3K09C 4M0AA 1Q84A 3ZBPA 2EGGA 5CG2A 4QQRA 1Q83A 3CZ9A 1QGDA 2VSQA 3TRFA 4Q9AA 5BWBA 3A6GA 3Q0TA 2DQYA 2GBLC 1E1RD 2XXAA 2ASDA 4QXMA 3WSTA 2D1QA 1ZGGA 3PC7A 5DCUA 1Y4ZA 4Q03A 2XAAA 1PJSA 2FF7A 4NMLA 1MO6A 1VFNA 2Q1SA 3K0CC 3ZWPA 1E99A 9ICXA 9ICQA 1ECLA 1EJ2A 2QD3A 3M9OB 2F44A 2G1AA 2YZKA 4KMRA 2OAQ1 3SXUB 1YQEA 1RHMA 1H9BA 1C1DA 2JFVA 4RHEA 1ECJA 1SXJC 3A14A 4UCQA 2YMMA 4TRMA 1AB6A 3DH0A 4LYHA 5FTJA 4YV1A 4MINA 1U9YA 4N0QA 3WYFA 5JY1A 4FONA 4PZ0A 1ULZA 1CVIA 3HI4A 3PL1A 1UEXC 4BQQA 4EL0A 4NMWA 2PRZA 5HJ2A 3T5DA 3WLHA 2C03A 2R8IA 3ZZUA 4D4MA 4HAZA 4EKGA 4EVIA 4JLKA 4YFYA 4JBLA 2XXAB 4RETA 3FA2A 1EJBA 3G1TA 1F8XA 3QVOA 1DKNA 3IP3A 3LH5A 1NN5A 4DDMA 5KOJB 3NETA 2GVZC 4P3OA 5J43A 2IS6A 1KS2A 5HK9A 3TAHA 4C04A 2OY0A 5EXTA 1ZZEA 4B6QA 1CXZA 1UAYA 5C52B 4R8RA 2WJGA 4JS0A 3ENZA 1Q8KA 1ZU5A 2O48X 4ELUA 1BEEA 1PEKE 4HTFA 4J9LA 5D1HA 1L7EA 3TO5A 3VR5D 3E35A 1ECWA 5IUJC 5I3ZA 4F2SA 1ISSA 2J32A 4UMFA 2PRSA 3HSYA 4GNRA 3RW9A 4C2BA 2GXUA 3SGLA 4W5OA 1Q1QA 1QJ4A 5KTPA 1PS9A 2PM8A 1FDOA 3VHXB 3RC9A 1QH8A 4RULA 4KHPB 3V7JA 4TMWA 1S97A 1N9KA 2VDWB 3FWHA 3LCVB 5I9MA 1RPJA 4KFRA 1UKAA 2WE7A 1SG6A 5GTDA 2QDXA 2ZTSA 1VLQA 4W9NC 4E4TA 4POOA 2F1KA 3QE2A 3RC3A 3SVTA 2YL2A 2PDAA 1R6XA 3H0EA 4KO8A 3GLHB 4Y0AA 4F8YA 3PNVA 4NYMR 4DTCA 1QRSA 4DE5A 2Y1IA 2FSGA 2GPTA 4KK3A 4WK2B 1IN4A 4URHA 3JVEA 1GM5A 4RQNA 4UQLA 1HC7A 1HK7A 1TUEA 3JD2A 1JR3D 3ZW7A 2Q41A 2WZCA 5ICEA 4BIIA 3K8QA 4F5OA 4TZKA 2B1RA 3ESDA 4J9PA 2IYTA 3FZNA 3HN2A 1LKYB 4XTRA 5IKXA 3KK0A 5BOMA 3BS7A 2ZJ7A 2OL4A 3AC0A 1GAXA 1J1ZA 2O5EA 1EUZA 3D3NA 1PVQA 2MR6A 3E9ZA 3BXGA 1VGQA 3WLLA 2PUFA 4S1NA 4AJ2A 1CQIB 4BVBA 4MXDA 3RIXA 5CHGA 2DPGA 1LEHA 2WRZA 1Q3UA 3L5OA 1E3SA 4L6CA 3MTAA 5GM2A 5J2EA 1M1ZA 4WK0B 2D62A 1EUCA 3S2UA 3MQ4A 3WKEA 2GBGA 4QHSA 4YALA 3QVGA 5ESRA 4GXKA 4MJLA 4ONEA 4D4GA 2K4HA 1P4JA 5JAMA 4C6TB 3ESQA 1N25A 3QPWA 5DOVA 3L8GA 1G21E 3I34X 5M04A 1VG8A 2IEBA 4HDNB 2BGTA 4X85A 5JAOA 1V7ZA 2ENUA 1KMCA 5EXPA 4G0YA 5KTRA 3CM0A 1R0XA 1YR3A 1SHKA 3CKYA 5TT0A 4KLEA 1RABA 4YT8A 1E6EA 4QG7A 4RVSA 2GTPA 3JR3A 4E5NA 1ZXBA 1KVUA 4Y30A 1K2VN 3ZNNA 3RV4A 4JSTA 1O96A 3KT3A 5JO9A 3DT8A 3FYUC 1N2ZA 3RBZA 3VTZA 2KK0A 2WF5A 4JB8A 1JQ3A 1XQ1A 3FTCA 3DBIA 2OZKA 2VJ5A 1LDNA 1SOVA 4LRYA 4QUIA 3W77A 1W1UA 3MM4A 5E38A 4LHXA 3A0HU 2O57A 5CBPB 1Z0SA 3GIKA 1ZJJA 4M0CA 3DZIA 4D57A 2QL6A 1C3LA 1R0BA 4GYYA 2NSYA 2N46A 3EIXA 4PHPA 5FV4A 4HH3C 4G89A 1PSZA 2V4MA 3HXQA 5IZCC 1SCBA 2B5VA 1WDWB 3CZCA 3LY7A 2DWUA 4X62B 3QU2A 1XVAA 1NTOA 2Q7XA 2WWIA 3BD8A 3PFBA 1AIPA 2ZYSA 1N2CB 4X95A 3NCHA 2JD2A 1PT5A 4FLMA 3L84A 5ICSA 2IKQA 3SG0A 2JFNA 4D25A 4QJBA 4OO3A 1GAEO 1L5MA 2QUAA 4MWGA 3UJ9A 3GIMA 4H6WA 1BJTA 5IXYA 3KSMA 1SQ6A 2PMZC 4PPFA 1ILWA 1JXOA 1TYZA 4B6PA 3SPXA 3JYHA 2BGIA 4AYTA 3GNTA 3INNA 1VJ0A 1FMLA 4A0SA 1OR8A 1G4AE 3M6AA 3G8YA 4NF2A 2BM1A 2R1VA 1DAIA 1XNRB 3SQOA 3KOZA 2BFFB 4QZHA 3WTCA 5HRAA 3ICOA 2ZYHA 3P27A 2ZRPA 5JPDA 1DFGA 4KO2S 4NXNB 5L7WA 1X74A 1NK5A 2OWDA 3N2GB 5C34B 2XMGA 1XYGA 2L5YA 3H65A 1P74A 2Q4OA 3PLNA 4JIMA 3RKUA 4DV3B 1GLVA 1HOTA 2FN7A 5KB3A 3VDRA 3MJDA 2J9FA 3DSRA 2XUFA 1E60A 4CKCB 1Z5OA 3WXBA 5BR4A 5KG6A 2ZS7A 3IESA 2Q29A 4MP6A 4DRXA 4DS5A 2P9YA 3OJFA 4UB6U 1TYEB 3AUSA 4TVKA 4A0HA 4FI3F 4GZMA 2VDKB 1KERA 3I73A 3ZNPA 4UTNA 3JWPA 2GNOA 3TW4A 5DGXA 5JSHA 2B9VA 2GPWA 5J2KA 4K03A 3SP1A 3W5BA 1NUHA 3BIJA 4CRWB 4D42A 1K5HA 3BMCB 3AI1A 3DR5A 1JS1X 5ES3A 1BD3A 4YAKA 2AJCA 1XPUA 4RK4A 3TZCA 2IQIA 2Y8EA 3OPVA 3ZQ6A 1T8PA 4BWJA 1BAPA 1BS2A 4UB2A 4S35A 1E5DA 1SBCA 2C3PA 3IHWA 1IHYA 3LXMA 4IOJA 3NOXA 4YMGA 3KD2A 4C7OA 3F0TA 2WHQA 4XIJA 1IIPA 4L75A 4BNMA 2OBYA 1FY2A 2WZDA 2PYDA 4OSPA 4ZCSA 3Q2IA 2YZ7A 4EY3A 4US1R 4US9A 5L1KA 4Z1MA 3LYSA 5IF3A 3NEYA 4C1BA 5JJIA 1L5VA 3RRZA 4E70A 4ZCRA 5C7OO 2J5XA 1ZCAA 5EMHA 1U4OA 1M8PA 4DQDA 1U6IA 1FSFA 1K6JA 2E1RA 4XRHA 3F2VA 2ZYWX 2CHFA 1J1UA 1A76A 4AN4A 3IUNA 3RHZA 1L5QA 2AMLA 5EJMA 1LV5A 1KIMA 4NFYA 1PZMA 3VC7A 1CF9A 3AUXA 2CLDX 3C5CA 5AJUA 1ZQRA 1LPMA 3BYZA 2R6AA 4OX9Y 3LP6A 1ORWA 4O1HA 3OBBA 4JLWA 2WAQC 1O95D 3IMCA 2H17A 1EUCB 4E2FA 4TQGA 2A9JA 3HKZC 3V1KA 4IJQA 2YXBA 3MTDA 4JWKA 1T6NA 4MR9B 4PLZA 4HCJA 1DV2A 3X0DA 1V1JA 5B3KA 1HNWB 4JWTA 4M55A 2LP4Y 1WL8A 2X41A 5SZJA 1PGNA 3ESRA 5KVCA 2Q3BA 4JOCA 4RHXA 5KYTA 4GUAA 2CLSA 4DDVA 1PJBA 3CUEF 3P9CA 4TYYA 3EAQA 1XDGA 3PDUA 2E85A 3ILVA 4B75A 3RIEA 4BN5A 2BMWA 4MWTA 4DNXA 2CSXA 2G07A 4K4HA 2XMRA 4I2GA 2OZLB 3UENA 1Z5UA 2NXJA 4UE6A 3QKIA 1TLLA 2P2DA 3WNQA 4DF8A 2E3JA 3GPIA 1E7YA 2HHVA 1NT2A 3B1XA 1NW7A 4J8PA 3OT5A 2Y1JA 1VSBA 4TLLB 3HB1A 4U2FA 3ICXA 2LKDA 1E3QA 1TLFA 2VPPA 1I94B 3PYLA 1EVEA 1YDMA 3KU1A 5SYMA 3WE7A 3ZTWA 4I2FA 2O7VA 1KMQA 4ZICA 3L8HA 4P08A 4QG3A 4XCQA 4WECA 1RE0A 2BE9A 3KBOA 5JCJA 4EDFA 1C3XA 4JSRA 4Z0HO 4Y2HA 3FSRA 4TUYA 5JSQA 3JATB 4ISBA 1TX4B 5TNXA 1IU9A 4PC3A 1ZJMA 2I91A 3BIOA 5HJ5A 1G5QA 3PZPA 4LTDA 4BO6A 3TLEA 2OHIA 3TSAA 3E1GA 1D5CA 4BY9E 2QMEA 5B1SA 5HF8A 4Y9DA 2BGGA 2FSVC 4EATA 3PIDA 1OW5A 2DFNA 1E2FA 3UH1A 3K4QA 2XLBA 2OBLA 3C8MA 3GDFA 5G0SA 1XB2A 1JHZA 2IEYA 1GYQA 1T8RA 1YUNA 2Q8QA 1WQ4A 3L06A 3LUBA 1VOTA 2OO5C 4PHTA 3UXMA 5LP1A 1VBNA 4C0KA 4YP7A 3NHKA 1XJ5A 1E2EA 1G20A 1K89A 3GUCA 2IEGA 3IMEA 4J94A 4YRJA 3RAGA 2HMUA 2YVAA 3AUJB 3NB0A 4PINA 4OIMA 4L9SA 1CQIA 2D0PB 4UREA 5CHYA 4D81A 1ZK2A 1OFIA 1N2IA 3D59A 3RG2A 1YULA 1MTZA 1C4WA 1MJGM 1U3VA 2GNAA 5GTIU 4Q05A 2UU9B 1SU4A 1X87A 2YFQA 3HCPA 7REQB 3AXSA 4B40A 3TOZA 2PNJA 3L82B 4BUJA 3C3DA 2C9OA 3DVSX 5SYAA 3HV2A 2QZ4A 3LK6A 4AY5A 1CHDA 2CUTA 3IQHX 5DTIA 4D9BA 2A0KA 4ER5A 4EUSA 3BXZA 2VPZA 3HWWA 5FPYA 4XDYA 1P2TA 3U1VA 2C1ZA 4L5YA 5GTHU 5CDGA 2I3ZA 1FVHA 1SIOA 4UUPA 4MICA 3TQRA 3UHOA 1YF3A 3L7YA 1K5OA 4RNOA 2DE0X 2GA9A 3ONEA 3UIEA 5HFNA 3GBVA 3UV6A 5KJ1A 4FO6A 1ZOPA 4DIFA 3E1KA 3WK7A 2E1FA 3GA0A 3LQRA 1XQ6A 2IPOA 2EHJA 3BSFA 4MUMA 3T1VA 4Z7JA 5IAJA 5EUCA 4BKQA 3ANXA 4I08A 1LPPA 3GGOA 1UIMA 3DV0A 2NLOA 5IT0A 1MEJA 3J81A 3EVNA 1HZZA 4R83A 1FJ2A 2A0XA 5EXEA 1KDVA 3DVAA 1P44A 2QX8A 2ACVA 3GEPA 3IAUA 4JCCA 5GGYA 3ICQB 4E88A 5BV2P 2FZEA 3EXIA 1U2PA 4IHJB 3AEQA 2H9AA 1PUZA 3SIRA 4W7HA 3T52A 3UMCA 4C7JA 4ICIA 2EJBA 1YDHA 2YRFA 3C48A 3K3PA 3ND9A 2WIDA 1AZTA 5AK5A 2FTKE 4ME6A 4C0HA 2HCRA 2O52A 2W8ZA 3NOOA 2CYAA 3NV9A 1U8TA 4FUTA 2GHQA 1OUMA 1J24A 3BDAA 3C24A 3R9XA 4IQ4A 1R5JA 3KYDB 3MWDB 1EXVA 4L7QA 5AM1A 2WIGA 2R1ZA 2ZULA 1FXUA 4FFLA 4Y6SA 2Q9AA 3VR2D 3NVKI 1HBJA 1V38A 1PEDA 2COKA 2RH8A 3CVUA 3E7WA 2XZLA 4M88A 5CIQA 2CRXA 4S2EA 3KAPA 4ZVOA 1JA0A 2PMBA 3BCHA 2KMDA 5EIXA 1VB5A 3WQBA 4MQEA 4O2AF 2JLZA 3CP8A 1R7RA 1ZH4A 3DXXA 3MJSA 1URJA 3FF1A 4ZQGA 3RYHA 3TB6A 2H65A 3A1SA 1N2CA 4RIHA 5BQOA 1W2WB 3DZCA 4DA7A 5FHQA 1S3GA 5JO0A 8ICGA 3EUB2 3BH0A 3A4LA 1W8DA 2FSUA 3DDZX 5EP2A 3IBSA 3P0FA 1D4AA 1N1GA 4RE6A 3T3EA 3T4EA 3WR5A 4AJHA 4ARZB 4JQSA 3JARB 2AD5A 5CHEA 2QRGA 1DC5A 4GNKA 5LZ7A 4EELA 1LLUA 2QKYA 2QSYA 3DHVA 3IP5A 1H5UA 5AO9A 1W4CA 1OC4A 1DBWA 1PE0A 5LL6P 1UA1A 2G08A 1HSOA 2B5OA 1M10A 4OOEA 4LBZA 2JJ2D 3OKFA 1KVSA 4J0EA 4DV1B 3I2GA 2VHQA 1UQTA 2BFBA 1MC1A 4ILKA 1F6WA 1M34A 1DK2A 4LX8A 2Q4TA 4ZV9A 5A7GA 5EPOA 4PS1A 4ENPA 4C5CA 4EPYA 2FDCA 4GPEA 4KGDA 1E0JA 1IATA 4DCMA 4HUTA 3VU0A 2W9CA 3F46A 5TR9A 3RRXA 4YASA 3REGA 4RNMA 4F1KA 3QGMA 4CZ2A 1I32A 5AM5A 4CM1A 2FZGA 3HFSA 2EZUA 5KSPA 5C5IA 5JVDA 1UFRA 3RO7A 3EPLA 1WUIS 1OI3A 4ROTA 2EP7A 4G0XA 5TIIA 3PCRB 3NT2A 3BTOA 2P9HA 1GGVA 1CW2B 3CU5A 4YUWA 1P6XA 4B9LA 2VT2A 3TQ1A 4ZYUA 5HX7A 4IILA 3FHLA 4Z3DA 1GTRA 1S76D 2JIBA 4PYQA 2COEA 1PR3A 4CQLA 1JU4A 5KZMB 1DDOA 3UA4A 4X5VA 3QPVA 8ICAA 2JATA 3IDOA 2NUTB 4JJAA 4ZARA 3WIEA 2GYYA 2RONA 3RADC 4MGKR 1W4BA 4YJ2A 3WIDA 2MMGA 3L05A 4NENB 4RVDA 4NY8A 4FR2A 4KN8A 1Q5PA 3KPJA 2R62A 3ICWA 2O4CA 3CR7A 3VR0A 1P4RA 4MVJG 1MEEA 3EXHB 4NU8X 4MF2A 3GT4A 5DXJA 5TZVA 1QO9A 1T3SA 3Q9NA 8ICVA 4NH4A 4JI8B 4P0TA 1NQVA 2MA1A 1HT0A 4BAUA 4DCCA 1KEEB 2CBZA 2PKRA 4D0SA 1RYZA 1X3LA 3M5WA 4UQPA 1KQNA 1THGA 2JGLA 3JAWB 3N8IA 4CMCA 1PHPA 3EDQA 1EGQA 1QVZA 1FNNA 4FN4A 4HNSA 4MLZA 4OP2A 2ZW9A 1ZIDA 2YIJA 2QOEA 1Q7GA 1Z28A 1ZVKA 5T4EA 4YA6A 2VTBA 2P11A 2ISQA 4ID9A 1JHQA 4NBNA 1QQBA 4Y9RA 4GXIA 2WT4A 3D81A 2ZK7A 4WASA 4NXMB 1Y1TA 5SY4A 3EZXA 4TMFA 3CUSA 3EF0A 3VJRA 3PEEA 4BPRA 1XRRA 1VKZA 3AR7A 3GCXA 2D5BA 3E4DA 2NUAB 4GMHA 1WMAA 1ZC4A 1M0EA 2MSWA 5BMVA 1PT7A 1HY3A 1FVFA 2J5RA 1ZH6A 1ZD4A 5LQDA 4ERXA 4KE7A 3KTDA 2VLIA 4O4JB 3VU9B 5EJ9A 4RQ2A 1XPOA 2ZYVX 1VLBA 3HJGA 3RH6A 1VIVA 3OZAA 3QX9A 4XCVA 4DM3A 4ARSA 4RQ6A 2XUHA 3PVSA 2Z0MA 3M4ZA 4D3FA 5FBVB 3PLAE 3PMLA 2HMSA 5FT9A 3MFIA 5J2UF 1V5WA 3M8RA 3EGWA 3AIOA 2ZS8A 4PXYA 3F47A 1H42A 1M2JA 4AF6A 3FWZA 5E7MA 3FG9A 3VH3A 4Q4CA 3M81A 1SURA 1X0XA 4G07A 2GN1A 2P0YA 4LZPA 1CB0A 1ENZA 1ZICA 2GILA 3FYUB 3ZHRA 3SHFA 3DEEA 2PUEA 3H1AA 1CNEA 2XVYA 2PWYA 3DFZA 4ZKEA 4ZU1X 4QQKA 2JVJA 4HFJA 3AQ4A 2MSEB 4EEXA 1ZXLA 1Z5ZA 4RTOA 2X6TA 4AUMA 3IV6A 1XO0A 4NOMA 3AR5A 2BR5A 4CIWA 3TQOA 1I4EB 2D3TA 1F5SA 1QTMA 4ZP1A 5DULA 4EJSA 4O4LF 1VL0A 5HKKA 4I28A 5AOVA 1ZGBA 3L6UA 3VKGA 1GQYA 3ZOKA 1FNCA 5DNYB 1UMBA 4EW3A 3CW9A 1ZMRA 3C3JA 1SXHA 4HFMA 1WB6A 2FW0A 2JR5A 1JFRA 4IUCS 4UDXX 5DTJA 5D5HA 1A9YA 5KUTA 5L3SB 1FQOA 2OCBA 2J59A 4IXNA 1JXAA 3ASVA 2YX8A 2Z6UA 1OX6A 2NPIA 4IKPA 3A1FA 1BW9A 4FZJA 3IT3A 3H9EO 5GIOE 1EXDA 1QHNA 4OI4A 3AV3A 5D3MB 3WLEA 4XM2A 3UFXB 4NL4H 4W1QA 5BUZA 1WXEA 1RWQA 1T0JB 1BE1A 3ESBA 1DEOA 1JJVA 1FCJA 2FCAA 2IDMA 2XD4A 1G5HA 4NAHA 2O07A 3BZWA 4O4LA 4QDZA 4RNDB 2HXGA 3MWLA 3ACDA 1UWKA 2C9BA 5DIFA 4U9UA 2ZWOA 4Z9BA 1IEWA 4AXXA 1N7IA 1NKSA 2VNKA 2F4VB 1N5WA 3BTVA 5HQ3A 4PPYA 3L1HA 3CZQA 2Y9MB 3G0GA 1UJ2A 3Q87B 3QOYA 3BHIA 3N0XA 2JAXA 5C8DA 2BMEA 4JP3A 4XQCA 2IP1A 2VNHA 4U2KA 2E1PA 3OCZA 4B4WA 1CUCA 3BZBA 2QMYA 6ABPA 4DMHA 2O8FA 1LS1A 1YA4A 1ORVA 3RBDA 2C58A 1TRHA 2WFZA 3TLAA 3ADDA 2LHTA 3SAHA 1H2XA 1BSVA 1GEGA 4UHBA 1ZD5A 2JL1A 2VFAA 4R9VA 1GTG1 1J49A 1E20A 2I80A 2QV7A 3MS2A 4MULA 3GHHA 3VNAA 1KQQA 1XAIA 5JPCA 3OJEA 4EJSB 4DJFC 3AUYA 1NBMD 3BB3A 3H4IA 2G40A 2OB1A 4G01B 4YO7A 1NKEA 2Z9DA 5TB5A 1VXRA 2R7NA 4AC9A 4LDPA 3A9CA 2HBQA 2NU9A 4O4HF 1CWUA 2WNSA 3DFFA 3E1SA 4PYKA 4WSOA 4Y9SA 4FC6A 4I3FA 3FSJX 1Q7EA 3BDIA 4PANA 3G23A 2Q5OA 3CG4A 4MYHA 3OJCA 3NVDA 3TYXA 3VC1A 3AEYA 1V6CA 3L5KA 4PHDA 5KNBD 4Q8FA 1D5WA 1XZKA 3QOFA 4QSMA 4UNPA 2YBDA 4JP5A 1GNSA 3HKZF 2H1LA 2OQIA 4BN4A 2RG7A 1QUFA 3GWZA 4Q7MB 1JZQA 2H92A 4JI5B 2A57A 4BEWA 3FUUA 2RAUA 1X38A 4C29A 1SRQA 4C05A 3IAS1 2PTHA 3EIEA 4PF1A 3RAQA 4DANA 4A0QA 1JSZA 2G9UA 1NX6A 2W9BB 3KYCB 1YMUA 2YWJA 1QBGA 4O2BA 2YJNA 2O5VA 2JASA 4GPD1 4OQYA 2ZSBA 1MA7A 4ZOCA 2UV8A 3TZEA 4H7JA 5AVQA 3UJ8A 4KKXB 1BHSA 1F6BA 1TCUA 1JLLB 4I50F 3TMKA 4EQZA 2GJ9A 4ZVTA 3Q7RA 2BM0A 2W6ZA 2NSHA 4LKRA 1R4NB 4LK2A 3W2GA 2VSFA 4BWYA 3RB6A 3UA3A 2Z6QA 2R84A 4IHQA 3KYBA 2GD0A 3TPFA 1RWMA 2AB0A 3DF7A 4EBDA 1OXTA 4D1YA 4YFVA 1IM8A 2R4QA 4TV8F 2WTNA 3I4FA 4U9HS 2OGZA 2PZ8A 3TQTA 1U5BA 2D59A 3GAZA 4MSUA 4ZZIA 4M9GA 1MIOB 2DBZA 4EB6A 4R9SA 3B2EA 2BP7A 4M1SA 1AZLA 3DPSA 3M34A 2R4UA 2PUTA 2ZUWA 1GN8A 5L4NA 4OMUA 3SAFA 2XC9A 3ABIA 1KFEB 3RH4A 5JAPA 1F3OA 1CUAA 1K3TA 1MABB 2PFPA 4NFLA 2A67A 1K1EA 1JZSA 1O6BA 3U44A 4YR7A 2NPFA 3EDMA 3QVXA 3LHIA 2AJTA 4B2PA 4CQLB 3OKPA 4WL0A 4CV0A 1R8SA 1SWWA 4ZN6A 1OV4A 3ETHA 4KXWA 1AS0A 3GD5A 4R2MA 4Z2AA 1V8FA 3WL3A 4Z51A 2Y66A 2Z04A 1JHAA 3OTOB 2X8LA 1KE2A 2W2OA 3GEMA 2EBFX 1YE5A 3KWFA 1OBCA 1QKJA 1UP6A 2QHXA 2FQWA 3IIIA 4L72A 3TACB 3RSCA 2BGRA 3VUEA 2E37A 2VAVA 3CNNA 2JHPA 3H18A 3N75A 1MBZA 2BDPA 1H9AA 1TVCA 2AFHE 2ANBA 3JU3A 3RUPA 4AMGA 2PMFA 5FWXB 2Q9CA 3GFBA 2EEZA 2XBLA 3T5LA 4RTQA 1Q1BA 3P9PA 4U2EA 3VO2A 1K06A 3N3BC 5CB4A 1A98A 1OD6A 4LJXA 5KT2A 1M6WA 1JSXA 1NVWQ 3P45A 5CEHA 4OJYA 3T12A 1NF3A 3VKVA 5MDHA 5M3BA 3IL2A 3MT8A 3TTWA 5LOVF 1GZ7A 2O7SA 2QM8A 4RPXA 2FXIA 1JTVA 3K2IA 1YS1X 2PFKA 3QENA 5KTOA 3JWGA 1ORDA 1EAYA 1H23A 1NE7A 2F1OA 3ITDA 1QYRA 4RKEA 1AM4D 2RGXA 5DT9A 3U7GA 2W7PA 4MUHA 1XZAA 5JARA 3QV1A 5ENVA 2QMQA 3HUTA 4FFBA 1RXEA 4U2BA 3SYKA 4BN0A 1YQ9A 2FETA 3O8LA 5BR1A 3QKSA 2OCXA 1CIJA 4JVLA 1UJ5A 3O4GA 4MX8A 1I10A 1MDFA 1D07A 4BZZA 2CKDA 2PU5A 1N6HA 1S8FA 4PO8A 2BMFA 2Q3LA 1L4KA 3CWCA 1AA6A 3UMYA 2L17A 4JCOA 3GLGA 4CRXA 1GYRA 5KSWB 2G1KA 1PS0A 3WLKX 5EZYF 1KAHA 2KLBA 2BLLA 3DBRB 1HQCA 3Q8MA 3PXUA 5C80A 5LZ2A 4LRXA 2YB4A 4UUOA 5CTJA 2R6CA 4MVJA 4P4UA 4YMSA 2HJHA 1X77A 1N2HA 3EZ9A 1M3SA 5FOQA 5ICMA 4M7WA 1QG4A 4QDUA 4B17A 3A3OA 2ZQZA 2J85A 1EDEA 4KKVA 3DZGA 5B2ZA 3H2KA 5ER9A 3STUA 2O20A 2YMLA 3BHMA 4JGBA 4HX2A 1XALA 1Q0RA 4ABTA 3R0IA 1REQB 1E79D 3IOYA 3M6VA 4TUSA 1GG5A 1YKFA 5J59A 4BATA 5I7UA 3G8AA 3AERB 1F17A 2C4TA 4CT5A 5CFPA 4KREA 2E48A 3TNFA 4BGDA 4BP9A 4WCFC 1I7SB 3P52A 4H1VA 2DSTA 4UM5A 3D0RA 2A35A 4IYRA 4JOBA 5IIMA 4C20A 2P6NA 3F3YA 4Q44A 3QU9A 5FBZA 5BNZA 1X15A 4FFBB 1ADCA 1DAMA 1YBVA 2XYQA 3OLYA 4PEVA 4RZ3A 2CDAA 3K0EA 4NCBA 2B37A 1SXQA 2QRJA 3PGVA 4BTVA 4QNLA 2IZ7A 4Z3KA 4EB3A 3R41A 4M1OA 1A8UA 1TJ3A 3C14C 4OHMA 5EKDA 2CD7A 3VZPA 1X8KA 4TUPA 3TDKA 4B0OA 5TJHA 3FOFC 2RMKA 2HLPA 4DSKA 5COQA 4AL4A 3WV4A 5BSEA 1M6VA 4O3RA 3D6TB 2VZLA 3IAXA 2OT3B 1O4VA 1AU9A 4FYIA 1W581 1W6UA 2DJ5A 3FMIA 1G1MA 1QGZA 2E8NA 2ZBEA 3MPUA 3QWHA 2BMDA 1VPTA 2P91A 5KAIU 2R86A 2X9QA 4YO8A 3RQSA 2XOKD 1Y80A 1AZWA 1P4SA 2PLWA 4AF7A 5B2FA 1PV4A 7ICTA 4YMUA 1XRJA 5FORA 4BX9C 3ZD6A 2NZ2A 4MKGA 1NI3A 1R18A 5I45A 3U4AA 4FS1A 1UBRS 4A8PA 4BNNA 3S2YA 5AUPB 4W5TA 1FNDA 4L3WA 2QPOA 3C4JA 5CW1A 3NXSA 5E6UB 3JASA 3PGA1 1U0LA 1UOOA 5KNIA 3FWNA 3Q85A 1C9MA 3GJ6A 4FFRA 4NICA 5FOUA 3ZCSA 3N7UA 4N7JA 4C22A 1NRJB 3G0DA 1EU1A 1LBIA 2IYEA 3BG5A 2AG0A 5KIAA 2CL5A 3G7SA 1GARA 2JPDA 4AN0A 4UM9B 3HBMA 4F97A 2BCRA 3CTMA 4CPDA 3GP8A 3BORA 5AQEA 3W4KA 2G09A 4PNHA 3EWNA 1V3VA 1S2MA 5ITZB 2C2BA 2BF4A 3EW9A 2EKDA 1GJRA 2IHYA 4Q0MA 2A9PA 2WPDD 5A2GA 2Z95A 1XCBA 2A19A 1GKKA 3VPHA 1OX4A 1SBYA 5ALWA 1YGPA 3PR4A 2CVFA 2HSJA 1LXCA 4MIOA 5BOSB 4IOKA 4DQPA 2KFNA 1WXIA 2HUPA 3PLRA 4GPIB 4MWBA 4XYEA 4YQYA 2RARA 3T9EA 5HEKA 4A6EA 4ENUA 1ECPA 1J9GA 5ELLA 3RAEC 1PX2A 4BQIA 4EAQA 2YYZA 3UGQA 4EKYA 1C4KA 4YD1A 1KI4A 3NCTA 3OPNA 2HRZA 2PBRA 1JDBC 3B6KA 3EVFA 3JQAD 4HBGA 3S4YA 4PGXA 3PFHA 3ZE7A 2VYQA 1ZQUA 5C3MA 1PLJA 1O5TA 4AZ0B 4EJ0A 3WGZA 3ZZTA 7ICRA 5FI0B 4XUCA 3F8TA 5L9XA 4UBNA 1ITZA 4YK7A 1FDUA 3BICA 4M2LA 1EB8A 1UDXA 3FDZB 2K5UA 1Y3DE 7ICPA 4F3RA 1AS3A 1KP3A 4HQRA 3WBFA 1EUDA 1GAWA 4XDGA 4YRTA 2FP3A 1VKNA 3QU4A 2YZMA 3LU1A 3N0VA 4GF5A 4K8RB 4IDHA 4OKIA 5EMMA 5CD1A 2EF0A 2EG5A 1KI9A 1NMEA 2R79A 2V59A 4AW9A 1VC2A 2CYBA 4YAOA 2WD9A 2BFWA 3TTTA 1M1YE 2FW1A 3GDOA 4L02A 2VKTA 4PNPA 4EG0A 4YAUA 1ND5A 5MGNA 3OLCX 4HJXA 2QE6A 3W3AA 2ZIVA 4NKRA 3SSOA 4XSGA 2XTJA 5DBGA 4EA6A 2C7RA 1VPEA 3BB4A 4E12A 5K4AA 4WI1A 2Q3DA 3L02A 4O63O 2BONA 1CNFA 2ZIEA 3DVQX 1A8PA 1Y4SA 2HF8A 4EYQA 2QU8A 5CX4A 2VYCA 4B8WA 2VJMB 2RGUA 3ZHCA 4Z99A 2ROQA 1DQZA 1S3FA 1J00A 1T4CA 1Z39A 3HJTA 2ZATA 3HQ4O 3PQFA 2VHVA 2IY9A 5CXSA 3VNQA 1D2EA 2Z5VA 4NS4A 3ZHSA 3DHWC 2I8AA 3DAHA 3NTXA 2LI6A 3QK7A 1SPXA 4ZVKA 4A10A 5H59A 3TSZA 4H16A 2WP8J 4IH9A 1NY6A 1Y81A 5A0FA 2CNWD 3E9QA 4IWYA 3UXNA 3R8FA 1LBHA 1CE8A 2Q50A 4LZAA 3WYCA 3IS3A 4KC0A 2ZYUX 5EPUA 1BHJA 2GBCA 2OBBA 5A4KA 4L73A 5FUMA 1YL6A 1Z34A 1O7JA 3AG5A 1B0ZA 1UKEA 4DJTA 1GNTA 3JRXA 1B7GO 4TLEA 4BE7B 4P34A 2QVXX 2O3TA 4TOIA 2I4NA 1PFVA 2B4AA 3E3LA 2AH5A 2F62A 4H31A 3RJGA 3ZV7A 2PXCA 3BZCA 2VCEA 4LSWA 1H3NA 1LTKA 1Y9JA 2WT9A 3HDGA 4J4TA 4PC7A 3KR2A 2XUQA 1DWPA 4UEOA 4YT5A 3CWQA 5I4BA 4TL7A 1TM1E 4MWOA 5IABA 1AMNA 3R9WA 2IYQA 4FE4A 2IXBA 3P9RA 1ISPA 1NF9A 1KL9A 3NOVA 2VQEB 3RKRA 4DPLA 1XOIA 1WHTA 1ZQMA 4CV3A 2XTNA 2IVZA 2VYVA 3KQHA 1XO1A 1FBNA 1SBZA 2ZUCA 2B3DA 4D3ZA 4K4GA 2GYUA 1C9EA 4FNAA 4CR6A 1J42A 3NDPA 1WZNA 1YH3A 2XKAA 3IP4B 4UBLA 4XXHA 3VR4D 4B6RA 1N33B 4R1PA 4AROA 1J90A 3T3NA 2DBQA 3MN1A 3A6ZA 3IUEA 4MR8B 2AN3A 2WHRA 4RGYA 2GAJA 4ENQA 4OHVA 5JBNA 3KUCA 4LF9B 1O95C 3C7KA 3TTYA 4DFMA 1IXSB 4G8BA 2YVUA 4KN5A 2XF8A 2C99A 3QU7A 3HX0A 1ZYQA 2I7CA 2Q2QA 2WKPA 3F6SA 1ZM4A 2GJSA 3OZWA 3KKOA 4XA8A 1V1MA 4L85A 4H4EA 3IFSA 3VQTA 1L1FA 3AVOA 3OX1A 3Q5EA 1H0SA 4ESEA 2VRNA 5E2IA 5LP6B 1N6IA 1O2DA 4NJEB 4PGFA 4JC5A 4XDHA 1K68A 5FL7A 4GH5A 4K6GA 1H0KA 3IAS6 1E1DA 1C3JA 2B92A 1SB9A 1EXNA 4ZXPA 4V39A 1EE9A 5D3ZA 4KPEC 5T57A 3BQNB 4TLBA 1SKYB 1GGMA 3QUAA 4RANA 1ZMXA 4RGBA 4M37A 4M9QA 4Q4HB 3VR6D 4ZVLA 4XI9A 4WXEA 4B84A 8MHTA 4TYPA 1TQDA 2Z3WA 4LCBA 3LLMA 4R0VA 3FR7A 4TPKA 4ZC8A 5H1YA 1FJGB 3MS7A 3KTOA 4LXYA 5BWLA 2P0AA 4B7CA 4HTFB 3EEOA 3AVYA 4GYJA 2QLMA 2O2ZA 3MAGA 2CMKA 4IMJB 2UVPA 4Q7QA 4J7AA 4DG9A 4PG6A 3M6IA 5L3RA 2ZSJA 2OM6A 4BO5A 4HPWA 2XADA 3DKVA 2O0JA 2L42A 1ZN7A 1VG1A 4XLLA 3M7DA 5IU6A 1WSDA 1JIXA 3FOAA 4RH3A 4BNFA 2JLCA 1OHHA 4LYGA 3EN0A 4FZMA 2V74B 3THYA 2HTFA 2QZJA 4FWTA 2LCIA 1GAQA 1P3JA 2HMVA 2KMLA 1W87A 3I6IA 4JLPA 4L4YA 4R1UA 4WN9A 1Z2PX 5ENZA 1IONA 4L8YA 2II6A 2ZG6A 1QIDA 3BQ1A 5MF6A 3D2NA 2NT3A 1L3IA 2XH8A 1JL3A 3D7RA 4UVDA 4KQMA 5G4KB 3VC2A 4D8YA 4ARIA 3Q7IA 4QRDA 4Y6OA 4W5NA 2J6TA 1AQJA 1HNNA 2CNKA 3DLCA 5CB0A 2GZRA 3V1YA 3JXEA 5IPFA 4QASA 3OE5A 4KRYA 2ISOA 4WZBA 5AXCA 2IIBA 4KIJA 1YAJA 4BUGA 3T7IA 3UXYA 4YC7A 1HEIA 1RBZA 2C78A 2XV1A 2HPHA 3AHEA 4MB2A 4LGYA 5DNAA 1E96A 1QZ3A 3BH7A 3PBKA 3C5EA 3STHA 5KQSA 4NRDA 5AVZA 2KN7A 2CNDA 4MTLA 5LQAA 3D8BA 3I04M 4P93A 1JDVA 2UXCB 3DO6A 2I2BA 3GLGB 2J6HA 2PN1A 1UPTA 4G4GA 2BQRA 1KH2A 4NYMQ 1EJ6A 5KTQA 1E1QA 1HH4A 5F2KA 5TC4A 3I53A 2C5EA 4O3OA 2BTQA 3Q2KA 4XPIB 2BAGA 3KWJA 1R6TA 4K28A 1SBTA 4GZ6A 3A6FA 4MTCA 3X1WA 1M74A 3T41A 3HB5X 4EPRA 5AI5A 3FZEA 4KVFA 2H5XA 4G5HA 3TM4A 2XCTB 4UATA 2ECFA 2NT4A 4U6NA 5K1ZA 5GGXA 3S1SA 2QRHA 3KUDA 5M29A 1RLTA 5EWGA 4XYLA 4E30A 3QPUA 1AF7A 5JEDA 4A15A 1N8SA 1JECA 3W3ZB 5JXWA 3ZGNA 5JNRA 3DVLA 1HETA 3MJRA 4DVGA 3UY4A 2I4RA 3AVXA 4B34A 2JFHA 3PC4A 5IT4A 4QPZA 3IQGX 1T36B 1WXHA 4OQFA 1TU0A 5J4KA 2BH2A 3IP8A 1P7YA 3LVQE 4ZTZB 3EZYA 1ISFA 5FUBA 3GDXA 2X1HA 3CUKA 3HCDA 4ZQBA 3T0FA 1PDOA 2VXOA 1K97A 1QS0B 3L79A 5JIBA 4PN7A 4X1YB 3ZJUA 1KIFA 5CPBA 3FLAA 4G5FA 3ROKA 5A4DA 9MHTA 3MMNA 3SLRA 4MW5A 3OHSX 3JQRA 2VF5X 1GL7A 1UM9A 3DDNA 1R37A 1GQSA 4BMCA 2DPLA 1ZCJA 5U1PA 2C42A 2REXB 1G64A 1K7EB 3D6UA 3FE2A 1WZUA 4OHFA 5CLJA 1OFHA 2Z09A 3A28A 1IBSA 2Q0QA 4KRGA 4Y8VA 3ZU6A 1YUBA 4RPHA 4KX3A 2X3FA 2YQ4A 1VE3A 2YY5A 5C32A 1B15A 1SXJA 2OP0A 3KHLA 2ZRGA 4RHFA 4UB4A 1JSRA 3W2HA 3E82A 1FNMA 3RUEA 1TVKA 2CF5A 2Y1LA 5HIJA 1YVEI 3S2IA 1FYXA 4YUXA 2PIAA 3PGXA 1DRKA 1QE0A 1GFZA 1JR3A 3EEQA 4EHLA 5C1DA 4LY6A 2QTGA 1G55A 4G1EB 4KQCA 3DKKA 5DCWA 4DKJA 4QU5A 4QZEA 4B33A 1U7ZA 1N6OA 4KFSA 5HHIA 2XHEA 2YW2A 1JDTA 3TFRA 2O2JA 3G1UA 3OZGA 5BN4B 3L7KA 2AUMA 2DFVA 4G0WA 3H1TA 2Y1FA 1JEEA 1OV6A 5INTA 1IIRA 4IJ6A 2X86A 4XDZA 5L3SA 1D0VA 1CP3A 3G5AA 4MGIR 4BPBA 2UYOA 3HB9A 4C0LA 1V37A 1U31A 1YVDA 3RIHA 1MKYA 5KC8A 3SFVA 1NZPA 2B8JA 3N5CA 5E7IA 2A3VA 2B7CA 2YRXA 4FZ3A 1WU7A 4F1JA 3C2LA 2NWQA 4YRGA 1DXHA 4RMIA 5IDQA 5KYYB 3ZU5A 4TQRA 4LQCA 4D46A 1DLIA 5CA1A 4HDMB 1QP0A 2W11A 1SG9A 4RMJA 3LVVA 4K86A 1BA2A 4U7WA 5ELMA 3ZQUA 3ON5A 5LIPA 4FBUA 2NO7A 3ZUPA 5ELXA 1SXJB 1R50A 3IJ5A 2EAOA 2GEUA 4DT1A 5ALOA 1UAAA 3FUTA 2ZYIA 3KLOA 4QATA 3ZHBA 2B34A 2FMIA 1JHPA 1GDHA 2Q2NA 4MW2A 4QT4A 2ZGVA 3WRWA 1Q74A 3DE6X 2FA9A 4DR4B 1S3SA 1LSOA 5JNTA 3BZKA 4GOXA 1MDBA 2GLUA 3FXAA 4MZXA 1YQWA 2WMNB 4MYUA 4RCZA 3OQNA 4OHPA 2IS4A 5EN4A 5KHAA 4YRSA 4XB1A 5ALJA 4WVFA 3IR7A 4ENTA 5KYXA 3SNKA 1XZQA 3OPMA 1OKKD 1Z06A 4IDOA 2N3ZA 1Z36A 5DM60 2PXXA 1JAZA 3LK7A 5C0OE 3GLHE 1DKRA 1JHMA 4NTZA 5DQIA 5DBBA 5JPIA 1EFRD 3PWTA 2OFFA 2P4UA 1Q3VA 3LC7O 3HVHA 1WWUA 1Z38A 9ICTA 5AHKA 4KMOB 3MAAC 5DCLA 1ATIA 5IFKA 3NHUA 1T9ZA 2Y0CA 4CEHA 2IXAA 4HZIA 3MW8A 2HTEA 4LJLA 3AVPA 2XDQA 1WR8A 3S99A 5JUMA 1E3WB 4Z5XA 1AHIA 1TEVA 2W6CX 2ZQ5A 2WA2A 1GWNA 1O54A 4O3PA 3UJHA 1EI9A 3QZ7A 2QX7A 1ZQXA 1U0JA 2WKQA 4MYCA 5AICA 2QAGB 4YAGA 2O54A 1RLOA 1TK9A 1NHGA 2I7TA 3K75D 2C9ZA 2ZIGA 3R3VA 4LX0A 4R16A 4S1VA 3VPGA 2Z3VA 2OAEA 2OTCA 4J9UE 1FSGA 2AMVA 1R16A 3WLFA 1S7CA 2A5JA 1BMFA 2R18A 1E63A 2A9RA 2C61A 3HM2A 2ADOA 4G5SA 1PNQA 5EIAA 5FULA 4C0ZA 3UMBA 4NS1A 5KVVA 5KYYA 1DAEA 1HGXA 2BCEA 4MCHA 3MWDA 3D6JA 4PAGA 1EZ4A 3EMKA 3LDHA 4JJ8A 2NU8A 4UQGA 4NJOA 3KZCA 3D2QA 1V4VA 4PLPA 2ZT8A 5D8DA 4TXLA 1R6AA 4ER7A 1ZN8A 4MUAA 7ICHA 1ZK0A 2VPQA 1LVUA 3QYFA 5BVHB 5J0XA 3IR5A 1TCAA 4R2KA 1LSSA 1WDTA 1RHRA 3HNOA 1APBA 1H9CA 1KZ7B 4XLTA 2HZBA 2IHVA 2OPHA 1MRSA 2DG2A 2JLAA 3DTYA 2HOIA 4BUZA 4R7GA 2JEFA 1X1SA 3DOCA 3UWSA 3T7SA 2EFHB 2PVCA 4DIDA 2PH7A 3FWYA 1V11A 2C3MA 3KXDA 4R1NA 1BOOA 1H2AS 3EVBA 1VSUA 3MBIA 3KLBA 2GB4A 3AR6A 3DAOA 3SN6A 1Q46A 1U1EA 3AWDA 3OSUA 2JLUA 1ZSNA 1JE0A 1GILA 1QIHA 1RHUA 3A06A 2ZTMA 1FFDA 1G59A 5DBFA 3JPSA 4B6GA 5CFZA 5BWNA 3UW1A 3SLGA 1YB1A 2OHGA 1KMHB 3FFTA 4C0SA 4I4TF 4DCSA 3IE1A 5AKGA 4DMUB 4CDRA 2MYPA 5JQWA 4TQAA 2FQ1A 3WYBA 2Z58A 3DM9B 3ROXA 1IH8A 5IAEA 4YR3A 1TKAA 3LO5A 1E2QA 2W4MA 3IH5A 4IDAA 4WN3A 2GSWA 4EG7A 1A8HA 4Q93A 5FH9A 1WXWA 1DIHA 1PJLA 4ZAWA 2YHBA 4PYRA 1Q0HA 4L08A 3TTXA 4AI6A 4ND8B 1DAOA 3GEEA 1E2KA 3PITA 3ZU2A 4O1IA 2NVUA 5DM4A 1BJKA 3F3MA 3W5JA 1X86B 4N82A 4FMDB 2IU6A 3W5AA 3U7QB 1J0DA 2LIVA 4PC1A 1AUPA 4RQ3A 2IITA 5DBIA 3ZKWB 1QK4A 2E6KA 4TT3D 1DAPA 4I29A 3VZCA 5KFGA 2QPLA 1NK9A 5IANA 4RDIA 3EUEA 1IZ8A 1YOVA 3FRHA 2HM7A 5CDFE 1J1IA 4BVFA 4Q24A 4UHEA 4RT3A 5F2NA 1UBFA 2YZ2A 3QG1A 4RCVA 3RR2A 2E5LB 4OAOA 2IHJA 4LBVA 2IXEA 4KIUA 4BMXA 3K4HA 4NBUA 3P2OA 4M9HA 3AUKA 3KAJA 5IJAA 3THRA 4PCUA 2Y1DA 2QJFA 1CJTC 2QRVB 1D2HA 3NBUA 1Z63A 4KACA 1PZXA 3S2FA 3FGZA 4PZCA 5EWMB 3BD7A 3Q72A 4DNPA 1XL0A 1I5OA 3S28A 1CQZA 1N9GB 2PIDA 4BQOA 1XLVA 1Y1KE 2F8TA 4LRUA 5J2UA 1ZQ1C 2JHAA 2PL5A 1XDBA 1IAQA 1HURA 1XEAA 2VOJA 1Q0ZA 4PICA 2J6UA 3DM5A 4DCOA 3ZD8A 5DNUA 4FIDA 3VVMA 2O1WA 4CNQA 4QBTA 3G5MA 1EWKA 1QNLA 1SB8A 2PU7A 3K16A 1XVLA 3B3FA 1SVNA 1TECE 2EAUA 1JN3A 4KAFA 5DSXA 2F3PA 4YRAA 4RVHA 2VHTA 1QHEA 4BFXA 2GH1A 4R05A 2QX6A 1JROA 3NWBA 3K15A 3O8NA 4Q15A 1IJFA 1DIRA 3ANMA 3ROTA 4QWWA 4PR3A 1LC3A 4RYDA 2R60A 3G59A 2QD1A 4P7GA 7ICOA 1RJEA 2HHHB 4D0LB 1J8DA 2J41A 3HNPA 1HNXB 1Y82A 2ASVA 2K8BB 3VV3A 1SBNE 1OYYA 1YRWA 4HNQA 4RKFA 4O4IB 1IJKA 1QQ6A 3FPCA 5JAIA 1ZUWA 2VJMA 4PZNA 3I2IA 4RCYA 1GQOA 2Y0SF 3SHTA 1KKLA 2UVPB 1XNHA 3AETA 2YINC 5CXXA 3B5IA 4C21A 1OZAA 1R8QA 1L8OA 2VP3A 3OQHA 3ZQ4A 1XNQB 3I64A 3AJAA 3LXUX 2BTEA 1EYZA 1N2SA 2X0EA 3I0MA 1J8MF 2FWAA 4ND7A 2ORYA 1GZSA 1LLFA 3GILA 1B8NA 4HOYA 4O2AB 1LQUA 2ZWVA 2H4XA 1MU0A 3AI3A 3G0OA 3PTZA 4GFDA 2ZTVA 3AFGA 4NAVA 3WNDA 1VHJA 3MBYA 3B3AA 1BXKA 1Z00B 2OWEA 2P5SA 2YWXA 3D8HA 4CKBB 1GT6A 3H5NA 3LDGA 4GVXA 4IF6A 4HNAB 1H2BA 3RD5A 4NVRA 1OC2A 2PHZA 4ZOQI 1KLNA 1X1EA 4WE3A 2XOEA 2W71A 5H3HA 3VOBA 3HG7A 3K6KA 4GUDA 3PE6A 3WK6A 1E7MA 3AL0C 3CT6A 1PF7E 1UXIA 2C1EA 3IURA 2JDIA 2RGNC 3DR3A 4DLGA 3DV2A 4RW0A 4ZGWA 1YHYA 1KN5A 2O1XA 3UMFA 3IAHA 2Z2KA 3ORQA 1XLTC 3OHPA 2AXEA 1Q0SA 5LP6A 5I9LA 3OHBA 5C8YA 3UJ6A 1SHUX 2ZB4A 5BN3B 5CXUA 2FPWA 2BHRA 1IY8A 2C2KA 1C3OB 1XZIA 1F7UA 2BHTA 3C4VA 1SBHA 4F3KA 3I9V1 1ZK3A 3PHHA 5JXIA 2WWRA 2Z5FA 2XKBA 3D4NA 4IDFA 2XWQA 2BGNA 5J2TB 4PSCA 2IA5A 1I7LA 4L1KA 4JY7A 3L4KA 1L5UA 1OXSC 1C80A 1G7TA 4FEAA 4QLOA 1E5QA 4QUKA 4EMUA 4V1CI 1E6KA 2ZIZA 2XVMA 5IYZB 4ZVPA 2JKYA 4NPHA 2X19A 5BSRA 4BQNA 3UT6A 5ALSA 3UYKA 1P5HA 2EJWA 3LCUA 3SYNA 3WGHA 2TMGA 4TN5A 4OTZA 5K99A 2XA1A 1KO8A 1W4AA 2OD9A 1TO2E 2QS9A 4BO4A 4EKIA 4EQ6B 2B30A 2C5GA 3BMXA 5KKCA 3WSVA 3KFUF 4TVOA 3LQ1A 3O83A 5ARDA 2FSFA 4FOLA 2Z3ZA 1PQYA 3ADKA 4OSEA 4PNZA 4PJ0U 4YV2A 2YVQA 2KIWA 1XCMA 2QJRA 2RAFA 4H0CA 4JV0A 3LE8A 4NARA 4PLYA 4RDCA 5JCPA 4QELA 2EQYA 2QVYX 1R00A 4M0MA 4ZO4A 5K0JA 2J8ZA 3CB4A 2G9NA 2Q6KA 1U6JA 4IJ5A 1T6BY 3ZK7A 5CTAA 1TT7A 2E21A 2I7XA 2W2XA 2OH2A 3A4NA 4QGFA 3FNEA 5K0FA 3L7AA 3LKZA 3Q8QB 1GVHA 3T5MA 3KEFA 3LWBA 1CUGA 1LB2B 1XRMA 1STOA 2ZJ5A 4JYAB 3Q9UA 4JI2B 2EZ8A 3L7LA 9ICVA 4DWIA 1GPJA 3MGAA 3RQIA 2XYPA 4DCTA 5CVVA 4KR6A 1QPBA 3L92A 3PKIA 4S1TA 3VR4H 3OM1A 4WESB 2O3JA 3TI7A 4RK6A 1CUDA 4UB8U 3QZUA 3WGNA 4D0GA 3AP3A 4DEZA 2IK8A 1Q14A 1CNMA 2WP0A 2XGMA 3O1LA 1A7KA 1XVTA 4N47A 5MGBA 1SQGA 5AI8A 2QNBA 3OHAA 2QGFA 4Y1FA 2QRLA 4QBKA 4EJSC 1J5EB 2XWSA 3NTOA 2ZT7A 1ENOA 3DG9A 2XA9A 3D1VA 3K9WA 3OEHD 2FEWB 3N2ZB 1JW9B 3HCWA 2WINI 1XIVA 1JDZA 2IUSA 4B2IA 3FUWA 1FO4A 5AI0A 4GXJA 3JY6A 2RLTA 2R11A 1VKHA 4V3BA 8ICYA 2GKSA 3OG9A 1KJ8A 3CONA 4G37A 5KX5B 1PNOA 5KKAA 4EEKA 3QPDA 5J2GA 1U9IA 2BKEA 3HV0A 2WM3A 5E4JA 3L4PA 5D3MA 5ECYA 2LE0A 1E2DA 3UMRA 1WKBA 3EMBA 4N3BA 2V3WA 1RPNA 1WEHA 2CXPA 1B2LA 3GD7A 1P77A 3E7FA 1U7WA 1Z07A 2QTTA 3P9NA 3KKPA 4P22A 4KAXA 4G36A 4G0NA 5DYIA 4ZYLA 4IZIA 9ICLA 3KLNA 2GZAA 2QKQA 2BP7B 4Y2YA 2IOFA 2J5KA 1OY1A 3AIMA 3OAAA 4YCNA 3WZLA 4A8HA 3DXZA 2GAIA 2EW8A 2J3IA 4G5QA 4GGOA 1PK9A 3H16A 2AC4A 3IVGA 3M1LA 4H2DA 1DX6A 4NESA 9ICIA 4REQB 4EJFA 4O4IF 4JT2A 4OIFA 4TSRA 4C6HA 1AXRA 1L7BA 4A2PA 1QE5A 1SCJA 2JGDB 3CUUA 3DMTC 3IT0A 2G9QA 3MMZA 1T9HA 3NFRA 4Y1EA 3VH1A 4IJMA 4J9SA 1BGVA 5COAA 4YRCA 3X1JA 1YA6A 5LYJF 3B5EA 3HW8A 4JYMA 3LT5A 3SHOA 6LDHA 1P3Y1 4Q3KA 5J2HA 3QEKA 5HE8A 1AQYA 2Q2OA 3R5HA 4KRXA 1NMSA 4PZLA 4RK0A 2KNJA 4Y2GA 3V7YA 1YB6A 2DVMA 4TQUS 4EG4A 2BSXA 3OA0A 3RNLA 3HN7A 5A7HA 2C95A 3ZZ0A 5KSOA 1U6KA 2O8VA 7ICMA 2M1ZA 2G7MC 3KE9A 1A8SA 5J8YC 1IN7A 3NHBA 4QGGA 2SNIE 5FO0A 5AIAA 3GEDA 3MFYA 4PQEA 3LUAA 1S4MA 2CL6X 1BXZA 3MGCA 5CLIA 3WYEA 4XQ8A 4EPXA 1E9AA 1COWD 1UMCB 2NIPA 4N12A 3HJEA 1OXBB 1XQXA 4DV4B 4CN8A 1WUTA 2JGDA 2V3VA 2WD8A 4KLFA 3OM8A 4UCWA 3VU9A 3WGOA 2Q6LA 5JZMA 1ZVVA 4UNSA 5D5QA 2PGAA 1ZQNA 1SEPA 2JFWA 1FU8A 1JG6A 1VGRA 4AG3A 3ENVA 2DMRA 4PZDA 3PSTA 3U9SA 5GOZA 4XJSA 3PNKA 4F56A 4RT2A 3LYAA 2RAVA 2E82A 4RBNA 4QDKA 4OQXA 4DSUA 1RWWA 2WDZA 5KNCA 4PTLA 2Y2VA 4EQ6A 3M3HA 4DSAA 2HQRA 3M83A 3QNMA 3H3FA 4C7VA 4IXMA 1VZ2A 4EABA 2WJHA 1Y7TA 3B3GA 1T3QA 4UTXA 1RYEA 1IOZA 3WWOA 1NMQA 2WIKA 2YH2A 3DT9A 3I6MA 4EG5A 1ZD9A 3ITKA 3ICCA 5BUSA 3WLRA 2PKXA 4YN4A 2R8EA 5I4KA 5CIWA 3RR8A 1NVDA 1U9JA 2PV7A 3LHDA 4N03A 3UMJA 3OOHA 2PE5A 3PQ8A 4WACA 1SK8A 1ZJYA 4MV8A 2P9CA 2ZJ2A 4X92A 3KZVA 3K0AB 4I9GA 5DX8A 3VDQA 4NSNA 3UYLA 2XYGA 5B4VA 1XTRA 3GV8B 5DLYA 3KCQA 3C5GA 3QBJA 4LQDA 4OBXA 2DCUA 4RVCA 5JT1A 3ZWVA 3JQ7B 3Q8SB 5H9WA 5IRCD 1NAIA 2M6LA 2QW8A 3QPCA 3HPOA 3C6QA 1BQ4A 3GVCA 5DBHX 1A4XA 1EMDA 3CPSA 3LRPA 1BW9B 4MCJA 4GG1A 1ENPA 3OJSA 3SMQA 4UMDA 8GPBA 3W8FA 5HKAA 1B23P 2O2YA 1H1LA 2GR9A 2PMDA 1QH0A 2BEJA 4OHXA 2PUCA 1A82A 3NNDA 1CB7A 5J0SA 2WJ3A 2Y68A 4BFYA 1SHLA 2WJIA 2G76A 4LRTB 1X7GA 1UJCA 3HADA 3I4CA 4UARA 4D45A 2E8PA 4RU1A 5JSUA 5KVAA 2QTFA 2ZRIA 2J4DA 1XD2B 4IHKA 4NBSA 3V2IA 3C74A 2X58A 3BPSA 4JJ6A 4OXXA 2CLOB 5DGCA 5CFQA 1IEXA 4C88A 4NYIQ 1VIAA 4ZI5A 4Y2TA 4UMVA 2AR9A 4G56A 2QTNA 4MIKA 13PKA 2CV1A 2OV6A 2RBKA 2EDUA 2O6KA 4NNOA 3VXKA 1ISJA 2JLSA 2A9OA 4M9CA 2ZEJA 3UAOA 1L5RA 1LB1B 1RE1A 3O90A 2ZP1A 3K7EA 3LWDA 4QZAA 3LY9A 4LNUA 2P41A 4A16A 1LDEA 1QHHB 4FYHA 2HU2A 1P0MA 4ARAA 4D8WA 2EKZA 4PCLA 3N2IA 4AU1A 4RZXA 4UC0A 3AKYA 2O59A 3RLIA 3NTQA 1T9CA 2JD1A 2MSLA 4NZPA 1LBEA 3QE4A 4JP2A 4Z8XA 3ZD9A 4IVQA 3U2QA 1US8B 4ED8A 2EIXA 2Z98A 3C6KA 5CJ7A 5KL1B 4TS1A 1UMDB 1X7XB 4J0QA 4MGYR 8ICBA 2QRQA 3ETNA 2Q21A 4PONA 5LVAA 2JRZA 4QFDA 3VPFA 1C20A 2AMFA 5DHTA 2H54A 3ZGVA 1YRYE 1WVIA 4IR1A 1USWA 1PQPA 2I78A 4X6UA 3JPQA 1U7UA 3HLYA 3MMPA 5IJ9B 4G9GA 2GTHA 2RGEA 1X2IA 4KJZA 4RKYA 4QU0A 4JXZA 4MPTA 3OZCA 3TTUA 3L01A 1PNVA 2YDYA 3L6EA 5E9AA 3BFPA 3JZDA 1KI2A 4Q1AA 1SKYE 4QVIA 4JV5B 1EWRA 4XM1A 1RKBA 4R69A 2ZYRA 2UKDA 4V0LA 2OV4A 2HREA 1O97D 4LJRA 4MUJA 3Q8LA 1KR2A 3DOOA 3E9CA 5F5NA 4DIOA 1JLLA 3FOEC 1KJ9A 4K8OA 1ZONA 1AXEA 4B3BA 3R3JA 4XASA 4XVHA 1MABA 5TVKA 1AN9A 2ODTX 1FE8A 1A9TA 2FB9A 2OC9A 5CA1B 2GKOA 4H1UA 2JB9A 2NRWA 4QTTB 4X97A 1SZDA 1UZLA 1XXHB 1N5LA 3RTBA 1XWLA 4BJQA 1J8FA 3DDHA 1OI2A 2D1TA 1BXRA 2GA8A 2W83A 3DQQA 1NJ5A 1NVUQ 4QIHA 1I1HA 1WG8A 2W2VA 1G8YA 2HRDA 3BA6A 3QTLA 2IUTA 2W7TA 4AWBA 1D1TA 1FFHA 4KZKA 3OOWA 5CVTA 2AEJA 1YZ3A 1DMRA 1I3KA 2PZAA 3N2KB 3V6KA 3QXXA 4O1MA 5KYNA 3H9CA 4Z4GA 1MJ5A 3D2LA 3FD8A 4N3CA 4G5XA 3EVCA 2KOBA 1MUUA 2X3YA 3SF0A 4GI1A 1Z6TA 3DZFA 3KAKA 3L46A 2YYYA 4ZVNA 1KPIA 3SMVA 4M89A 1KTVA 2QP4A 1QH8B 1S1CA 1E9CA 2AC7A 2IYOA 3CKMA 1E1YA 1N2GA 1U3GA 4GEGA 3BCRA 4R51A 4BNDB 4BP1A 5T7BA 3L6DA 4WZBE 3FDXA 3TZ6A 4TXMA 1KYVA 2A4KA 2VP5A 3F7NA 3WQSB 5TV2A 1AC5A 3LVRE 5KYWB 1G6OA 1DXYA 1E1LA 5BWMA 3ANSA 4K2HA 4UOZA 2QE7D 2UVVA 2VDVE 2JF0A 4ZAYA 5F9HA 3REFA 3E27A 4RWEA 4WLNA 3S27A 4CLOA 4YJGA 4MB0A 1MX9A 2HIAA 1X14A 1PL8A 5G40A 2O8BA 1XDSA 5IVPA 3QY0A 2FLLA 4P7JA 1WUDA 3K96A 1WCV1 2BFCB 3C5WP 2GFIA 2QAIA 2OA0A 4MA0A 2LV8A 1DKPA 4ZO6A 2XYRA 4JKOA 4QHTA 4WOCA 3E9YA 3SS8A 2VYND 3CVOA 1NFQA 2RRDA 2YDXA 3AONB 1M1NA 3K9QO 2VRWA 3M49A 4IGFA 3W1WA 3TK1A 4RAOA 4L5BA 3I3SR 1T3ZA 2P6PA 1TM4E 4OXQA 2OXEA 5BNIA 1QBKC 4P36A 1W52X 3B89A 5HQTA 2W2LD 2B61A 2RI1A 4UNIA 5DG7A 3H87A 1NJXA 1OAOC 4P5EA 2FVXA 3GGDA 1T94A 5BUQA 2CK3D 3EZFA 3PUZA 3E9RA 2XPCA 1QANA 4W99A 3R7BA 1XJCA 2QRVA 2HF2A 1I4TD 2QVCA 3OFSA 5HFAA 4R71A 1WDKA 4Y2JA 2YWHA 3GMDA 1C3VA 4MUGA 5IIJA 4QJ4A 2HBJA 2NU8B 1FX0A 3PWSA 1WP9A 1ZHOA 1QYVA 4NYJQ 4CIXA 3BILA 3V4VB 2P5TB 3AL0B 2YXNA 2W6ID 4URVR 1S01A 1S77D 3LCCA 1K6MA 2C20A 4DQRA 4A5OA 3AOGA 3I9OA 4N65A 4DKXA 2XIJA 4KNYA 1OLOA 3IP7A 3CLSC 3STXA 1CVRA 1TW2A 4WY8A 2AFIE 1QQAA 2LYBA 3HEBA 3A05A 3NHJA 4QYXA 5DBEX 5EWEA 3FLEA 4BLTA 1G8GA 1QWOA 3SYMA 1JFFA 3F97A 5FBQB 5JNLA 2ZROA 3IPLA 5FOWA 2HXSA 2P79A 2BBSA 4W8HA 3VNRA 1CFZA 1GO2A 4EVSA 3W2FA 4MR9A 4M0KA 3E3OA 1TM3E 3CLHA 4N8SA 2YCLA 1GCIA 4RY8A 4ZQEA 4TMZA 3RVDA 3WBJA 5B7GA 1F8UA 3KB1A 4LXTA 3UCEA 1COOA 1GPAA 5HR7A 1AHNA 1ECFA 1TPZA 3O3OB 4IMPA 5BYAA 4JYZA 3DVRX 3VOTA 5LFAA 3E4CA 1ZP6A 2VPIA 4YYEA 2P9QA 3K9BA 4F92B 1WRBA 4BTEA 3H7AA 3LC2O 3QIAA 3CW2A 3SQWA 1U2DC 2WTFA 2J3QA 2HDNB 3JD3A 5EPEA 4RVUA 2WUVA 3JVIA 3UK1A 1HG1A 3IEXA 2C31A 5KNBH 1L8AA 1BA3A 2XMSA 1NXXA 4UAZA 2WG0A 3BFVA 2WIAA 3FOWA 3ZOZA 3V4ZA 1QSSA 3GQBB 2IXDA 4YXWA 4OAQA 3ZS8A 2HH9A 1R0CA 4EYKA 2H06A 1D9ZA 1UBMS 4F4ZA 2WYOA 2ZITA 3NQ41 3R0XA 3B0XA 1RADA 2CLFB 3PNPA 4TS9A 1GSIA 4LVCA 1YR1A 3DF9A 3V8MA 1EQ2A 1GGNA 4TLAA 2V97A 3I45A 1DBRA 4YCJA 5K4HA 3JCZA 4TUYF 1AQNA 3G6KA 2K2WA 1UOQA 3BD9A 3K4GA 1NK0A 3P5SA 1QYWA 3QW2A 1Q0UA 2YR0A 3OFNA 4FLEA 4FSHA 1ZUIA 3IXMA 1PWZA 4IRXA 3DMFA 3SQXA 3E9EA 1SA0B 4TMTA 1P4AA 2AKEA 2C4MA 3FAKA 3BRWA 2W6JD 2PGXA 3FUCA 5F12A 2CVOA 5A3VA 2G28A 1C7JA 1E1MA 2IEDA 4ILEA 1WZEA 4KB5A 5ER6A 5IKOA 1L5LA 3BQ7A 1A7JA 1YE3A 1X2BA 5B7NA 5KFZA 5B58T 1Z1BA 3RYHB 3QLVA 2YJGA 2Z57A 2RKWA 4WZAE 1G66A 3AY3A 1D8YA 1PJRA 2KJ5A 4KPYA 4BWGA 3GG2A 4P92A 3PHBE 4RJ2A 4L95C 2PQ2A 2FQXA 1AA9A 2XYHA 1NN1A 1LCIA