4C4TA

Structure of beta-phosphoglucomutase in complex with a phosphonate analogue of beta-glucose-1-phosphate and aluminium tetrafluoride
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
217
structure length
217
Chain Sequence
MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords BETA-PHOSPHOGLUCOMUTASE
publication title Alpha-Fluorophosphonates Reveal How a Phosphomutase Conserves Transition State Conformation Over Hexose Recognition in its Two-Step Reaction.
pubmed doi rcsb
source organism Lactococcus lactis
total genus 76
structure length 217
sequence length 217
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2013-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 4c4tA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4c4tA01
5IS2A 3EPRA 2WF9A 4Y2UA 2JAUA 2B1RA 5ALYA 4C4TA 5ALLA 3W5CA 2IOHA 1RRCA 3ZWKA 2YMPA 3HYCA 2FUCA 3QU4A 1S8OA 4BBJA 2I33A 3ZX4A 3QUBA 5AICA 4EX6A 3WGUA 1NF2A 4DCCA 1EK2A 5AM2A 3KBBA 3F9RA 1JUDA 1U02A 4J2TA 2OA0A 4HGNA 1YJ5A 3QUCA 3UMBA 4FE3A 2G06A 1Z4PX 3DDHA 2WF6A 4J03A 1T9ZA 4KN8A 4UM5A 4DFDA 1WZCA 5T41A 2YN4A 3OCXA 1TJ4A 2OBBA 3AR9A 4F72A 3WK4A 4PNHA 4HGRA 1L7NA 3E8MA 2B30A 5AVQA 3J7TA 2B0CA 2ZBFA 5AK4A 1RQNA 3FGOA 3W5BA 3L1UA 5ALZA 1CQZA 3PGLA 3SD7A 2BY4A 1ZD5A 5ALRA 2HF2A 4EELA 1T5SA 1Z4IA 4CF3A 2ZBEA 4UMFA 2FPSA 2JAWA 3AR5A 2G80A 5ALOA 3IJ5A 4UAUA 1L7MA 4XE5A 4Y2SA 4UU1A 5AVXA 3PGVA 2YMMA 3WKAA 4O8CA 3U7EB 4BEVA 4OFZA 5ALHA 2P27A 1S2OA 4KNWA 4YH1A 5AVVA 4ZEXA 2GO7A 2YY6A 3QXGA 2FI1A 4CF5A 2G1AA 2G07A 3L8FA 3N5KA 1YNSA 3DAOA 4NAVA 2YJ6A 1YS9A 2OM6A 2R8YA 2HSZA 5AM1A 2WF7A 3OPXA 5AK3A 2ODAA 1YMQA 5ALFA 3ESRA 2YMQA 4HAIA 3WKBA 2IYEA 3ZWDA 2NO4A 4BKMA 1Z88A 1RLTA 2Q5EA 3N8GA 4CNQA 2P69A 2HCFA 5ALWA 4HGQA 1QYIA 4Y3UA 2ZBGA 4Y2JA 2MU2A 5ALEA 1ZD3A 5AW4A 3ZVLA 5AW3A 4OD0A 4UASA 5AHXA 4FYPA 3ONNA 5AK6A 1ZJJA 4Y2QA 4AP9A 1NRWA 5AVRA 3AR4A 3E58A 1WVIA 2AH5A 3QU9A 2O2XA 3ED5A 5ALJA 2X4DA 2ZXEA 4Y2PA 2FEAA 2QYHA 1IWOA 2RAVA 2P9JA 3AR3A 3M1YA 4UMVA 2JAOA 5AKHA 4L57A 3I1YA 2RB5A 3ZX5A 4BX0A 3PDWA 3QU5A 1Y8AA 2W11A 3QU7A 3AR8A 3FPBA 1MH9A 5AW1A 3L7YA 1L8LA 3MPOA 3QX7A 4E88A 2YFYA 2CN1A 2W4MA 3A1CA 1XP5A 1TJ3A 2BDUA 1RKQA 2NYVA 2I7DA 1Z4KA 5ALUA 3A3YA 3I76A 1U2SA 3L8EA 3KDPA 2P11A 4CF4A 5A3QA 4MWOA 4UM7A 3WKEA 5AIBA 4RETA 3N1UA 4RESA 3SLRA 1J8DA 3MMZA 3L0CA 2HEGA 1T5TA 1RMYA 1XVIA 1U2TA 4NWIA 2GHQA 2HOQA 1RDFA 1NNLA 1RLMA 1FEZA 2HHLA 3N28A 3ZUPA 3ZI4A 3ZW7A 5AKIA 2ZBDA 3R9KA 3ESQA 5ALIA 3L1VA 4QJBA 3UM9A 2WHEA 3U7GA 2FPWA 5ALQA 4BYGA 2FPXA 4UMEA 5AM5A 3AR6A 5IT4A 2MSNA 1RLOA 5AW9A 2C9MA 2CFSA 3VAYA 2B82A 3QUTA 4NFLA 3UMCA 2CFRA 3QYPA 3NALA 4AS2A 1Z4MA 3U7FB 1K1EA 4EEKA 4MUMA 4F71A 1ZOLA 2FPUA 3ZVMA 3FM9A 5ALVA 2Q4RA 1L8OA 4KX5A 4AS3A 5AKZA 4ZEVA 3TLMA 1PW5A 4BX2A 3SF0A 2DQSA 1L7PA 1SU4A 3KOOA 1ZRNA 3HLTA 3NAMA 1LTQA 3RF6A 5AVTA 2ZG6A 5AKJA 4FFDA 2GFHA 3L8GA 1ZS9A 2G0AA 1VJRA 2W43A 2G08A 4JB3A 1XPJA 2C8LA 2RBKA 4Y2TA 1QQ7A 3NASA 4Y2YA 3EF0A 5AKXA 5AKKA 2YJ4A 2IOFA 3E81A 1Z4JA 1ZD4A 5AIAA 3AR7A 3EWIA 3U26A 3WK7A 2AUTA 2I6XA 3NRJA 5A3RA 1YDFA 1TA0A 2D2VA 4KX3A 2RARA 3L0BA 3WK6A 2IA5A 3OCZA 4UMDA 3ZU6A 1RC8A 5AK5A 2IOFK 2BDEA 3D6JA 2EATA 2EARA 3ZTYA 1Z5UA 4YCLA 1L7OA 2B8EA 2FPRA 3SHQA 5ALDA 3L5KA 5AI5A 5AVWA 3CZ4A 1Z4LA 5AKEA 1RKUA 1KYTA 2C4NA 4IFTA 2R8XA 2VKQA 4EX7A 4G63A 2AMYA 5AI6A 3WK8A 5AI9A 3L8HA 4C4RA 3GYGA 5AVYA 1EK1A 2WFAA 3E84A 2YBDA 1RQLA 1SWWA 4I9FA 4BNDA 3OCUA 1O08A 5AW0A 1TJ5A 2R8ZA 1TE2A 2PQ0A 4ZEWA 2MU1A 3NANA 3IRUA 4G9BA 5AM0A 1RMQA 4BNDB 3MN1A 5AI8A 3UMGA 2NO5A 1RMTA 4BX3A 2FUEA 4OCZA 4NV0A 3NUQA 1J97A 5AVUA 3WK9A 4C4SA 2PR7A 5AW7A 2I34A 2HI0A 5AKGA 2GHTA 3DNPA 3SMVA 2WF8A 2OYCA 5AESA 4IG4A 3CNHA 2HX1A 3BA6A 3U13A 2YJ5A 5AVZA 4EENA 2I54A 3FPSA 3WKDA 3A1EA 4XQ0A 2I55A 4YIKA 3SKYA 3ET5A 4HGOA 4HYTA 3QNMA 2FDRA 3EF1A 1AQ6A 1Z4OA 5AM4A 3B9RA 3ET4A 2YJ3A 2GMWA 3R09A 4YCNA 2B8JA 4OHFA 4UATA 4Y2RA 1L6RA 1N8NA 2G09A 2WM8A 3OCWA 5ALXA 1QH9A 1F5SA 3OCYA 2HF7A 5ALSA 1LVHA 5ALNA 1VJ5A 3B9BA 2ZOSA 3K1ZA 4H1WA 2R8EA 3NIWA 5FP0A 1X42A 5AI4A 3U19A 3OTQA 4KNVA 5ALGA 4Y2XA 3QGMA 1VFPA 1WR8A 3P96A 5AW6A 1CR6A 3KD3A 3KZXA 3KC2A 4EZEA 3DV9A 1N9KA 4UW9A 4DW8A 1SWVA 3QLEA 4GXTA 2CFTA 2C88A 4QQFA 5AW5A 5AKYA 3W5DA 1Z5GA 5IT0A 2HO4A 3I6BA 5ALKA 4KYTA 4I9GA 4L6CA 4UU0A 5E0OA 4YCMA 3U7HB 2O9JA 4NABA 2HDOA 3B8EA 5AI0A 3S6JA 5AM3A 3QU2A 4Y2VA 1ZD2P 2QLTA 1RPZA 4XPZA 2PKEA 4B6JA 5A3SA 3WKCA 1RKVA 4XOUA 4L6AA 5AW2A 5AKLA 3L0YA 3FZQA 1Q91A 3PCTA 2YMLA 1O03A 3SKXA 4BEWA 3FVVA 2WF5A 1QQ5A 1U7PA 4HGPA 4UAVA 1U7OA 3QUQA 4YIHA 1ZRMA 5ALMA 3IB6A 2JARA 3W5AA 3AR2A 3M9LA 2B1QA 4JDPA 5AVSA 2AGVA 1QQ6A 3R4CA 4YGYA 1Q92A 4GIBA 3WK5A 5ALPA 1Z4QA 3I28A 3WGVA 3N07A 3ZTWA 4UARA 4DWOA 2C8KA 3A1DA 2Q4TA 3OCVA 5ALTA 3ZVNA 3BWVA 4CE6A 3RFUA 1Z4NA 2EAUA 5AW8A 3MC1A 5JJBA 2JGAA 1WPGA 1YV9A
chains in the Genus database with same CATH superfamily
4PZ0A 5L51A 4Y2UA 2EDAA 1KAOA 3C3XA 1DAKA 1NBOA 5JS7A 1NI3A 5JYBA 3NJRA 4R8RA 4PC6A 1NW6A 1XSNA 1MB3A 3KQTA 3EZGA 4RY2A 4TSRA 5A3JA 1HZZC 5KTNA 1QGYA 1JUDA 1QZUA 4EQ6A 1KR2A 3UMBA 3DNMA 2FCRA 3MD0A 3UK6A 2OV1A 3V8BA 1WMEA 2UVQA 2JAPA 3EH1A 2JAQA 3L3BA 5FUYA 3DO8A 1Q1GA 1FRFS 4LBYA 3HDTA 3I0ZA 4QM6A 3IBCA 2X3YA 4QDJA 2Y0CA 2C2GA 1KOJA 2H5IA 1SIUA 2R5NA 5DWDA 1T6XA 2OV4A 5DDIP 3Q40A 3H9QA 2HA4A 3X1JA 1RACA 2VH5R 2UZAA 2H1RA 2Q2WA 3EQ8A 3GOQA 1R8SA 1U3CA 1BPYA 1ORWA 3W3AD 2X4DA 1EP9A 2PGAA 5IIOA 5T3YA 3GLHE 3MOIA 2X0IA 2GESA 1C8VB 4F8RA 4E88A 4I27A 1G8GA 4EMSA 2DAPA 3CG0A 2WW8A 2JLAA 3HWTA 2NTYC 3PFKA 4O3MA 1CUGA 2IXAA 2XA9A 3TI7A 4RESA 4ZTBA 5B2ZA 3PJDA 1S2DA 3H1AA 3D2NA 1XPRA 3FMVA 2DQ4A 5IAAA 1ISSA 3EWAA 3RNOA 5D49A 4PLCA 3ENZA 2O5CA 4OXXA 1Z00B 2FRDC 3JYLA 4G5FA 3WLJA 4BPBA 5JSQA 4Z3DA 4E2WA 2CFSA 5DKWA 4LJ9A 2GJAA 4ESEA 5DTRA 4C43A 1UEIA 1SKAA 5LYJF 3DCYA 1DUVG 5B3LA 4OJQA 5EGSA 4YCAA 3KRTA 5LCXA 4MRNA 5KS2A 4Q7KA 1RWNA 4CG1A 5FNVA 5I9LA 4HXGA 3GRZA 3UG7A 4M98A 1ZA2A 1QDUA 8ICAA 1MAWA 4WBNF 1BA3A 1USGA 4U7CA 3AUXA 3EB9A 1RQRA 1MJGA 1EJBA 2NW6A 3MUEA 1BX0A 2DE0X 2IX3A 1YZVA 1DP4A 1T9BA 2E3TA 3L6CA 4JWNA 3R6WA 1UKCA 3BS4A 1L7OA 1J09A 3IBGA 3RYCB 5GIPE 1NJFA 1SBNE 2DJ5A 3EZXA 2VEDA 1X2EA 3WK8A 1G3MA 4TRNA 4CKCA 1ID1A 1D9XA 4RLQA 3RSFA 3GLSA 1PZFA 1I1OA 1AKRA 3WWCA 2AGQA 1QKIA 4ZIRA 4JR0A 1QP0A 1KEPA 1Q3TA 4QFBA 1OC4A 4I5GA 4FB5A 3WB0A 2Y77A 4OQDA 3HDGA 2JFXA 2HX1A 4NMWA 3SSAA 2J9YB 1N62A 1EFLA 5K3OA 2H5XA 1HX7A 2OZVA 3ZQ6A 4TRRA 3CNBA 3KEOA 4JX9A 3FOAA 3H87A 1NOIA 3MTQA 1G38A 2F8SA 4H16A 4JLBA 4TN1A 4LRQA 5KC9A 4B5KA 1DIGA 4V0RA 4V24A 2ZPAA 1FYDA 4BRWA 3LU1A 4CLHA 3OJXA 2XT6A 1PEKE 4N40A 2GEKA 4L9WA 3HDVA 3P2MA 4DF3A 1R6TA 2V55B 4DCGA 3EIUA 1KE2A 4F96A 3PFIA 5JBNA 2MSWA 2HMUA 2O6LA 2HO4A 1H1DA 1R8QA 2DFLA 4U7TB 2FE4A 2FZWA 1IZ9A 4G67A 1ZI8A 1P1HA 4YAUA 3NU1A 1MAAA 1CUJA 1WMSA 3SC3A 2PZEA 4MINA 1D2EA 2E8MA 3TNFA 7ICIA 1MFZA 4CIXA 2XXJA 1V5EA 2F43B 3ZY5A 4L27A 1M5TA 3OOYA 4GO1A 4MPDA 2QEQA 1QZ3A 1NYLA 4I3FA 5ARDA 3USES 4IWNA 5IF9A 4D41A 3E1SA 3KELA 3L1KA 3G8AA 3DTVD 2ZI9A 3UKOA 2QE7D 3KCQA 1N5LA 2L19A 1GZDA 4NCAA 1PJQA 4IWYA 4LMAA 2HNBA 4J0JA 4Q7JB 3FYCA 3HYNA 1W87A 4X1YA 3UPTA 2X0KA 2OD7A 1ZSNA 3AY3A 4XA5A 4RW0A 3U56A 2BFOA 1RKXA 2IQ5A 4F4UA 3W5SA 1N1EA 3WE7A 3DVQX 2LM1A 5IKMA 2A9KA 2C2BA 3FWYA 2PGNA 4KFUA 3GAZA 1P75A 1VBFA 2Q6VA 1D7OA 1N33B 2IYNA 1NNEA 2GLEA 2RHJA 3BILA 1QRUA 2V4MA 1CUEA 1TCUA 7REQA 4NAVA 5MGNA 4OFXA 4LYHA 1KBOA 1Z15A 1Z0AA 4NSNA 3AMVA 4YMTA 1CZLA 5LQSA 4BE4A 1QBGA 4QEZA 5LIPA 4JLKA 1D03A 4L15A 1Z0JA 2CNDA 4FYPA 1N8SA 5LQNA 3IDZA 2OXOA 4ZYLA 1JSCA 4S35A 2BFEB 4JR1A 2DWOA 4KLJA 2EHJA 4UMVA 2JZBA 1DK2A 3DLIA 1FBNA 4FD3A 3V5NA 3ANLA 5JC8A 3G9ZA 1GNTA 3MWLA 1GGJA 4BFUA 2LCQA 3A1CA 2L17A 3VNQA 2WUWE 5JQGA 3RBDA 4QPCA 4BOYA 3A3YA 4RPZA 5E8JA 1Y8RB 3E3NA 3IVXA 2O7NA 4PR0A 2XMGA 2QTAA 5AUNB 1C20A 3UANA 2M32A 3UWPA 4E1VA 2YIMA 4UREA 3MGBA 4W5JA 5LN1A 1L5KA 3E9CA 3FFTA 3BXXA 4RTMA 3T3EA 3IOEA 1P7WA 4GQIA 2UZIR 2H4HA 4X1KA 4OLBA 1ZBQA 2W7OA 4ELVA 3AYZB 3LVVA 1N2XA 4MPPA 2OP1A 5IH7A 2B2XA 3KQQA 5CVTA 1UK9A 1DRVA 5EHNA 4Y1RA 4RQ1A 4J90A 4W99A 4EP1A 4A23A 5HP4A 3HKDA 2FY8A 2O06A 4UM9B 3THYB 1E18A 4O2RA 3MJDA 4XXHA 1NN0A 1J99A 1RCFA 4YRAA 3EFOB 1YDMA 3TPZA 4BB0A 4RTPA 1HNZB 3C5FA 4UPVA 1ZGBA 5DLFA 2WWRA 1SUBA 5DYGA 4MPRA 1D6NA 1Q6ZA 3OAAA 4YRJA 1Z12A 1L3BA 4WZBB 2XECA 3LV8A 2I1WA 3BJIC 3OQIB 4PGHA 3LI2A 4KIFA 3IIIA 4R7TA 4W1QA 5L3QB 4ZT7A 3HCOA 1Q7BA 2HW3A 4NU8X 2A2ZA 1LCIA 1TT7A 1VBNA 1HG1A 3G88A 2HCRA 3OHSX 3HJRA 4NXMB 4E3WA 3AY0A 3TPCA 3EDOA 1VBKA 5JCOA 3M6VA 1WPRA 1BRTA 3DDCA 3CV3A 1YR3A 3CBGA 3A9TA 3AU8A 2O50A 3DAYA 2H4FA 3O4FA 1RXEA 3NIFB 3BK7A 1VG8A 1BPEA 1UA0A 5AI4A 5BQXA 3BEOA 4ZVQA 2ZE6A 2XCLA 4E30A 1C4OA 4RTSA 4ZT3A 3OPQA 1IXRA 4I50F 3ZY2A 2BN4A 4BO5A 4B3RB 2HN9A 1LSJA 3RI3A 2FOLA 3AHIA 1SRQA 4IH1A 1NOKA 1ZD2P 2XDYA 3FVRA 1CP3A 4WKBA 3BTVA 2TMYA 4TQUS 1JIIA 3FOEC 3CZPA 2R1VB 4HRYA 4R8UB 3S3TA 3VTZA 2VNKA 2VXCA 3EMDA 4ESVA 1LXCA 3JZDA 4RNMA 1FUYB 4E5NA 4A27A 1D5CA 2XA2A 4TYMA 3MCAA 1YU9A 4JKYA 4P5PA 2Q4TA 3EULA 4OXQA 4FR5A 1N48A 2YV2A 4DS5A 3T1HB 3PFCA 5IABA 3MWEA 1IH8A 3PFNA 3CEJA 4XDZA 4QRIA 2DFPA 3BWMA 4IGAA 2QLFA 1QIKA 3PTAA 5JVDF 3M5CA 3X3HA 3K6KA 3X1ZA 1A9RA 3WIEA 2ECFA 5C2JB 2QT1A 3PUVA 3H0EA 3LLCA 4AD8A 4U3JB 4RYDA 2UU9B 1KAGA 4JUIA 1C3LA 1SKUA 3O6VA 4QXPA 1L4UA 3F2DA 3IJ5A 4ZK2A 1WMBA 4BEVA 4GOJA 3PO5A 4OO3A 4WMLA 3GD7A 1MH1A 4CZ2A 2IEYA 1NMXA 2XNCA 3JTEA 4MLZA 1HTWA 1N36B 2YMQA 2RAFA 1MLDA 4P22A 1WXDA 3OM8A 3NJ4A 3CNQS 2EZXA 3T5GA 2DKZA 4ZC8A 4D8XA 1D04A 4YAFA 1YZ6A 2K4EA 1K8RA 1GU0A 4L4UA 3OJEA 1KJYA 2QVBA 2BCGY 3DBOB 4HAXA 1UEJA 4YD2A 1TC2A 3EW9A 4OGGA 3OSNA 1I3CA 1HQDA 4E32A 1CJBA 1TCBA 3D43A 4GECA 4BZZA 1YNOA 3I6YA 1H8HA 2WVGA 2V03A 5FYQA 3OJOA 1GVNB 3T94A 1CYDA 4RPXA 2P6OA 4F3KA 2FOXA 2BDUA 8ICSA 3TACB 1EGAA 2P3QA 4EITA 3PR2B 2GJSA 3P9PA 5KQSA 3VNUA 3D7LA 2WNIA 4KMRA 3QEMA 5FBHA 2JH9A 3AJEA 4Q1EA 5M2QA 1E9FA 2SCUB 5CWRA 2BCVA 2XITA 2NSHA 5EP4A 1OAAA 4YRPA 2CPRA 3CRRA 4L7VA 1Z37A 1CFZA 4PZOA 1SC9A 4AZ0A 4JV1A 3PU6A 1OXBB 1SVOA 3ZG6A 1ZS9A 2G08A 1GITA 3E5MA 2CKDA 1SN7A 3IT0A 3E2PA 2NYUA 5E7QA 2FUNB 2HBZA 4PHDA 3HFGA 2ZIEA 1Q2XA 3LOUA 1HE1C 2ZUEA 5B4UA 5LYYA 1QG4A 4BNKA 3B6ZA 4YALA 4K8OA 4WY2A 2DULA 5LXTA 3DBRB 4OB6A 4PFKA 1S01A 2W9CA 1ZEMA 4DLZA 1CBUA 5J2HA 1O4VA 1HQYE 3F2VA 2HCJB 5LDGA 2NVOA 2DQZA 3IUJA 4TKUA 1KSPA 4RTLA 3JD1A 4LF9B 4DSOA 2A1JB 1XQWA 3DM5A 1J6UA 1ABBA 4XUGB 5GTDA 3IEXA 4OUDB 1T2UA 3DOUA 2KMDA 4M46A 3ISDA 4XWTA 1R5BA 4F4KA 4RDCA 2OC9A 3Q9SA 3KWJA 4J6EA 3FFXA 1BGVA 3KAQA 2AQKA 3LBYA 2H54A 1PU2A 2CHFA 2BHRA 3QE4A 1XB2A 3C8MA 4H7JA 4B75A 4INAA 3KJNA 3ISTA 1PAUA 2IEIA 1TAGA 5FWYA 3SOPA 1KQ3A 2LP4Y 4QFMA 2AC2A 5BVGB 3FGZA 1HLFA 3UB4A 3PW2A 1PV2A 5DQGA 1RPAA 3TM5A 2F3UA 4NU5A 5KL1B 4UVIA 3EPPA 3JARA 1Y1QA 3B1WA 3EQ2A 4HZUA 1DRWA 1EE1A 1EA7A 4UXIA 1A8UA 1HE8B 1L5SA 3MELA 3SIWA 5AJZA 1Y7PA 3HM9A 4N0PA 3RJ5A 4AXBA 1I4EB 3C3YA 1Q3UA 2PZKA 5JE8A 2R8JA 1SXGA 1AUOA 3IUSA 4DV7B 3THWB 5JAMA 3NOOA 2DY1A 4FYKA 1EX7A 4TV9B 1N9ZA 2DECA 4PAMA 3IUMA 1NY6A 3BG5A 3KT6A 3AIIA 2O5EA 3T99A 1A9XB 3U44B 3L1HA 4D46A 1D9ZA 2AFIE 2CY0A 1JAZA 2UYQA 4C4YA 1QONA 4QYMA 4KMSA 4LWZA 4KC0A 5BVHA 5IWCA 3PV0A 4GI5A 4IJUA 3FNBA 3OHPA 1R5JA 3ST7A 1GPBA 1FMTA 3HV2A 3Q7SA 2W6JA 2GO1A 4Q1AA 3HU2A 5DNYB 4EKYA 3ELYA 3PC6A 5KX5A 1NVFA 1TYDE 1VLVA 4FQ8A 2X41A 5E6UA 3A70A 4FOSA 1A5SB 5EKUA 1XELA 1KRWA 4R8VA 4ZYWA 4B44A 1P61B 3IAAA 4JB0A 7AT1A 4GUDA 1A5BB 3HLKA 3BAFA 4HMOA 1Y8ZA 3A25A 2FUKA 1E99A 1LBQA 5ALFA 4L5BA 3SWWA 2O23A 3OG9A 1DELA 2VQ6A 3PGKA 5AT1A 2ZIUA 4KWHA 4HGQA 3T5TA 3K1JA 4JB2A 3ZVLA 2J5QA 2AQ4A 1CJKC 3SHWA 3P9YA 1WUYA 4O4LA 3MGVA 1K7SN 1IRIA 2HRDA 2HTEA 1T1GA 3W4JA 3HJNA 3C1ZA 1IVNA 2WWFA 4AJJA 3ZWBA 4QD3A 2QNIA 4RTKA 4R41A 3TOCA 1Q1BA 1I1NA 2AJDA 1IG0A 1NKSA 1WL8A 5KAMA 5FDFA 4F4JA 4GQBA 2NXWA 1OKKA 3D4IA 1N9GB 2EGHA 3CNEA 4D3XA 2P6NA 2ILVA 3VC3A 5GVSA 4W5NA 2WHEA 3RAQA 4RE5A 1T13A 5JZSA 2B82A 3ZGOA 1DCTA 2MAXA 3IVCA 1QGAA 4YASA 4QYIB 4NCXA 5KYYB 1NBAA 3NV9A 5LQCA 4F4YA 3D6TB 1XYGA 3RODA 4D97A 3EXEA 2E82A 2IYZA 1SU4A 3CH4B 2W6NA 4ONEA 5J47A 2G0AA 2WFLB 3D3JA 3FWHA 2YJ4A 1L5RA 2MIIA 3WV5A 1EB8A 3NX4A 2UYCA 1F2DA 4R2WA 2QHXA 1EJ6A 1PGNA 5EMMA 3IDFA 4TV9F 2J30A 1SJ9A 1I7PA 2ECQA 2PSDA 2BFDB 3HPQA 2GOLA 2REOA 1RXVA 2A9QA 2AQHA 1GQFA 1OFGA 4DIDA 1KEWA 1UXGA 3TSOA 3VZRA 1VXOA 1X2IA 2Q3FA 2NV2B 3WB2A 2Q1YA 2GFIA 5F3DA 1ENZA 3E84A 3LCMA 1C2YA 3AF4A 4DUYB 1NN3A 4JEIA 2J9FB 4N82A 1WB4A 4MF2A 3OHBA 2BGRA 2PX5A 4DL5A 3R40A 4O4JA 1P18A 1TXGA 3TQHA 4ZU1X 3SLKA 3GR6A 1TNDA 4URFA 2X3UA 16PKA 4JIGA 3CCCA 2Q21A 4WV3A 2DEUA 3W5JA 4ZCQA 1P2BA 3HCCA 4PR3A 2QX4A 2G36A 1VMEA 4EPWA 1BSVA 4GM1A 2GMWA 4W9NA 2ZJ4A 3MHTA 3RYIB 2I1VB 1JAXA 3AQIA 3OF3A 4NYMR 1RPTA 2V3CC 1GYRA 1B6SA 4FUQA 5DIFA 2ALJA 2X2OA 4RCYA 3U19A 1AA9A 1EFTA 5J0RA 4Y2XA 3NATA 3RHZA 1R10A 1YK1A 2P90A 3U3JA 2ZYGA 5E0OA 4FYYA 1JMYA 2DRIA 3RIMA 2A92A 3M0EA 1FJXA 3M9NB 1F51E 4DFKA 3KB6A 5AW2A 3HKBA 3SKXA 3LKDA 1JJ7A 3SXUB 1JEYA 5HA5A 2N75A 2XMSA 1SV0C 3URMA 3B6EA 4DSEA 1CIVA 4QJ5A 4A8JA 2F1JA 4IX9A 3DMRA 3DHEA 4NKRA 4DARA 4YVZA 4UARA 4EJ0A 5IJ9A 4BECA 1ZY2A 2QZ9A 2HA3A 2KSOA 4FM9A 2RJ3A 5HR6A 1PGQA 3V6KA 4GSLA 3PYLA 1FFYA 3GT3A 1J70A 4U2BA 5DF1A 3QBTA 3WBFA 4NBUA 1XWLA 4F6RA 3RFAA 5BWOA 3C74A 2VSFA 5HFAA 2AYZA 4ELTA 4MLPA 5JWOA 4XZ3A 1ESMA 2HBYA 3K5HA 3UJAA 1PQWA 1O0BA 1O6GA 4PONA 4X5OA 1WULS 4QDUA 4L3OA 2WV7A 1HWYA 3NNNA 3E8MA 1LDNA 2WVHA 3N70A 3SS7X 1NNI1 3Q0IA 5KVVA 1ZK2A 3TCNA 1FOEB 2XEXA 2O5RA 2F67A 1KKXA 5EUMA 1I30A 1FTSA 4CLOA 4N8DA 2JIQA 4F2SA 2VP2A 3HEBA 4GEGA 2RHRA 2I1LA 5MFPA 4CEHA 1ZQ1C 2GK4A 1TGVA 3ESXA 3V1LA 4BIIA 3OAAD 1QIMA 4HK4A 3EQZA 1VLQA 4KN6A 4YP7A 1MEOA 4W8GA 4AP9A 4N49A 5FLEX 3ZI7A 3HK2A 1W581 2FW1A 3U1TA 1I3KA 2ZJAA 3W5VA 2YVUA 4DCTA 5A5GA 1XTRA 5A4KA 4HWKA 3K1TA 3K1AA 4O4HB 1EP1B 2M9NA 1PFQA 3BHMA 4LOLA 1SL1A 3SVLA 1TMYA 3NJ8A 2WKSA 2C7PA 2I4TA 1VDZA 1YOVA 2PUTA 1SVNA 3TQQA 4FZ5A 4KN5A 2R8KA 1SIWA 4ZPJA 1SKRA 3JQEA 3IL2A 2HK9A 4PNPA 1EIZA 5KHAA 3OP4A 2GM9A 2V54A 4FOOA 3CGGA 2HRQA 3LOPA 3EZLA 1RJEA 4EKIA 2CJWA 3RYFA 5EL0A 3GNTA 1NT4A 4KLGA 1G8JA 2YNMD 2OP0A 1DK3A 4NNPA 5FBWB 1NE7A 4LX0A 3C8UA 2ACVA 3QPVA 1NR5A 5LDDC 3IKTA 3O38A 1M2OB 3WTBA 4IGFA 3G5AA 4FT4A 2AR9A 1QRAA 3GZ4A 3LK7A 2B83A 5KYXA 3IVMA 4RY9A 3ZGLA 2CLFB 3Q41A 2WWVD 4GR9A 2J6TA 2B61A 1OH6A 4RBNA 1GZ4A 1G8HA 1N2CA 3THVA 2IUEA 3CU5A 3AKEA 3PDJA 3ZU6A 1I6WA 4ED6A 1TD1A 2JNWA 1Z2EA 2ZSHA 4IILA 8ICCA 2P4QA 5G3ZA 1C3OA 5CW2A 5JH7A 4XX0B 1PWYE 5AW0A 2FMFA 3BE6A 1MN8A 5EWJB 3GIMA 1FFGA 1AMNA 2J3QA 1J23A 4F50A 3CUUA 4UOZA 1HFKA 3QFHA 4QTZA 2Q2VA 1EGHA 2WIJA 5H80A 4TMVA 5K7SA 4KLLA 2GA8A 3OIUA 2C9BA 4Q9DA 1FC0A 1HQCA 3IJEB 3I8OA 3UBMA 5J2JA 1H2WA 5ERXA 1M7GA 1GTL1 2YUIA 4A3SA 3IS3A 3WIBA 4YPVA 1NVVR 3PDHA 3FJYA 1W29A 3LC1O 4A2CA 3LW8A 3R9WA 1K8ZB 2QNRA 2QM8A 1Z0UA 2IGTA 3KEFA 1S5LU 2PX6A 2VT3A 2VJAA 1KDHA 3KJIA 1UMCA 3U7QA 4MHSA 3QVGB 1G5TA 4G56A 2CCKA 4RVCA 4MDFA 1WU8A 4EDHA 1SUCA 1ZN2A 3SHFA 2ZM5A 3GJZA 2JS7A 1WD5A 3C7DB 3RE1A 1B1AA 4GI3A 1UKYA 2C31A 3BWEA 7ICVA 4O4HF 3BD8A 1M1YB 4BZWA 2DH5A 5TSDA 4B9UA 4EMBA 1GKLA 4XWAA 2V0NA 3F9CA 3FZQA 3KQOA 1XTQA 3PX4A 1J22A 3OEWA 2A94A 5DWQA 3TUJC 1KYYA 5CHYA 4JH0A 1YZGA 2A0FA 4CEIB 1JX6A 3FFWA 4DV2B 3RRNA 1B8NA 3CPJB 5KNCH 1K0FA 2A0WA 2MSCB 2VQSA 3O4JA 3L6RA 3ICPA 1JKFA 2BFBB 3N7RC 1GTRA 1HE5A 3AM3A 3K30A 1A88A 5H3HA 1NFRA 4DDMA 5KFHA 2XH8A 1RXUA 4PYKA 5C51B 3A1SA 1R64A 3WYEA 3DPIA 1GUAA 1Y9JA 3TRJA 1DO0A 2A30A 2FEXA 5ILOA 2HIAA 3EPGA 4GX1A 2IPXA 1YUNA 4W9RA 1I2DA 3AHCA 2QLLA 2HOFA 4I55A 1CUVA 2XCQA 2GBPA 4V38A 4LOHA 4KUGA 1T0BA 3BHJA 3CM0A 3NM4A 4L8GA 4QPPA 3BXGA 4GXIA 3IDOA 4LYAA 4P2HA 5CLLA 1XKLA 3QXGA 2ID9A 3VR3A 2IHZA 3NHRA 4PGYA 4NDZA 8ICQA 1UL1X 4RKWA 4TWZA 3TF5A 3K9WA 2Y1OA 3LY5A 3AI7A 2DHRA 4DM7A 2W3SA 3WOVA 2XGJA 3VPHA 1KFDA 3TZQA 2MA1A 1K4KA 4G8JA 1JIVA 2ZSBA 3PEYA 2F59A 5C80A 5JYDA 2BEKA 1U7WA 3X2EA 1IBKB 3QU5A 1Q3KA 2AG8A 4EPTA 2NAFA 2VNJA 2HV8A 3UAYA 4KVZA 3KT8A 2GDZA 3AP1A 4OAPA 4BDSA 1N0WA 3C5HA 5A0LA 3FPFA 4PTLA 3OU2A 3I0MA 3LX6A 1ST3A 4MVJH 2C2EA 3E23A 2W93A 4EG7A 5FYDA 4UQOA 2WRZA 3ZQJA 3VJMA 3EVBA 4GXQA 3CT6A 2ZR7A 4DBLE 2UAGA 4B4UA 3EXG1 1A69A 1E61A 4MQ6A 1JR3D 1S1CA 2ZYHA 4JBGA 4LK3A 1U8EA 3FYUC 4P0PA 4QU8A 1HDYA 2ZTHA 2CVQA 1Y9AA 3SX4A 4CMJA 2A1UA 5C7OO 5EEHA 1ZQEA 2R6R1 2W9BB 5T64A 4O2BA 3TD2A 1GWNA 3BMNB 4L4XA 4UJ5A 1V5IA 1ZW6A 4DMRA 4BMXA 1POWA 3WK6A 5KG6A 4W5RA 2VYFA 3ILSA 1IPFA 2JBWA 1PLLA 4O4IB 4EO4A 3RK1A 2VK2A 2P0EA 1G5RA 2PEYA 4I29A 1JXEA 4ELUA 1HNNA 1BFKA 2BGUA 4B7AA 1FXWF 1Q19A 3SNKA 2R8ZA 2P0YA 5DH9A 1ZQBA 5HIIA 3W1EA 2O0LA 2YVLA 4OMDA 2GJ4A 2FFHA 1PL0A 1UBUS 1TVCA 1ZI9A 2X8BA 4LPKA 4HYYA 1R0WA 4R2MA 4IG4A 4PQGA 5FTNA 2RLTA 2YJ5A 2G82A 1MOZA 3MTGA 1LU9A 3GN1A 2BL4A 4HNTA 5I9NA 2W6JD 4NMHA 3CTMA 4KRFA 4H4CA 4Q12A 1ESNA 3TBHA 3RSOA 2F3PA 3ZH2A 4LAFA 4X24A 3VVCA 7MHTA 1H6CA 1ZISA 2HDNB 3TS1A 4EOGA 4OIFA 1ZFNA 1P81A 2PA3A 4JUCA 1E2JA 1JQJC 1SCUB 2H9IA 5C5EA 1A4XA 2R6HA 1E3IA 3QXXA 3FF4A 4URVR 4OKIA 1DG1G 2W6OA 3K71B 2GZ2A 1BXZA 2W0SA 4ZO8A 1I4OA 1SZDA 3WP0A 2QXYA 3QHPA 1JJFA 2BCRA 1SB3C 4RFSA 4AVYA 2C20A 1FQOA 2X5KO 1DQPA 3F7MA 3N2ZB 3HYRA 4DS4A 5BT9A 1LDYA 3QENA 4F12A 1T91A 3TKAA 2YOGA 4F9FA 2JD1A 1M1XB 1GEGA 1Z6GA 1B0PA 4PO8A 3M2PA 5DGHA 2PVPA 4KR6A 4DA8A 4QRHA 4HATA 2C96A 1ZHFA 2WINI 5AXAA 3ZNQA 5EJ5A 4KOEC 1DAEA 1NR7A 3HVJA 1YMUA 3GF4A 1QP8A 2J6UA 3D8HA 1NATA 5EUCA 3VOSA 4HAYA 5JO0A 2N1BA 3FNQA 3L92A 4OP3A 4IZHA 4L5AA 2P9ZA 2W2VA 3S2UA 4ARZA 4Q4AA 2OOKA 5M7EA 2VSOA 2XNJA 2QRQA 1WMFA 4DEYA 3ZX4A 4R0NA 4EX6A 1NF2A 1L7VC 3DZGA 5HF6A 4XR4A 2QX8A 2QIPA 1G3IA 2CJXA 4DPMA 4XCXA 3IVGA 1YOBA 4BV3A 4GOMD 4S1PA 3ABQB 1KIFA 1DQYA 1QPZA 2WD7B 3VZCA 2I7CA 3OOJA 4EWLA 3J81j 2ODPA 4O4IF 1CS0B 3IKJA 3LY8A 4RT3A 2NQ2C 2VDKB 4DG9A 3FHTA 1BMQA 3TLEA 1P4JA 3HBJA 3GPLA 2EGUA 3E1GA 2XWBF 5KKNB 2IL1A 3K4HA 4MDYA 3BSSA 2JFZA 3AV3A 5CHGA 4B74A 2H3ZA 2XIQA 4OD0A 1QDEA 1FFWA 1FNNA 1NRWA 4TZ6A 1IRXA 2OMKA 1KIMA 2ZFUA 5G2OA 1UWLA 4RYLA 4WOPA 2NGRA 1X1BA 2R3SA 3RM3A 3OE1A 4RENA 1A2QA 1D1QA 3VSCA 3BQTA 3FR7A 3EH2A 3KHUA 5AOVA 3ZU4A 3L8EA 4EY7A 4B8YA 2JGJA 4C9BA 4AS1A 3T35A 5DTMA 4CMIA 5ULLA 4OX9Y 3MERA 4ILEA 4JLOA 2ZJ0A 2LV8A 5KFSA 1JDZA 4D56A 2BGIA 4Q15A 1NZBA 3QSYA 3Q5DA 1CXZA 4YP1A 2I9GA 3VH4A 3IOCA 5IVIA 3HCAA 4FHZA 1VYUA 2QSYA 3I92A 5BSFA 1E5QA 2XUHA 2X0JA 5E7IA 2GCNA 4DSIA 4HC4A 1Q57A 4F5OA 3KT3A 4AWAA 5EJIA 1R66A 3RUPA 3PXAA 3IELA 2GN0A 4HFNA 2V4UA 2XBMA 3CF6R 5KFRA 1JECA 4ZANA 4ARVA 2A3RA 1ZD1A 2RBKA 2NP6A 1BMDA 1BMTA 2AK3A 2FRXA 1UR5A 4JODA 4AMBA 4CLRA 1OB5A 3EWIA 5CYPA 2C3UA 1I3LA 4KLAA 5JD5A 2ZI7A 3L7JA 1UZNA 2ZWIA 3CONA 2DKXA 2RAUA 4L5YA 3N2NA 4OJNA 4H7DA 4AJ1A 4CL8A 3QYFA 1X0XA 2IXDA 5LP6B 5EE5B 2V7TA 3EXHB 1GQOA 4QZEA 3GIWA 3LBFA 4REQA 2VHWA 3TQTA 1WG8A 1GDHA 4DAEA 4RPLA 2JIOA 5CP2A 3T79A 2WYVA 3AV0B 1AHHA 2AOWA 1GXSB 2ZIAA 3P9CA 1JWLA 2YHIA 4MV1A 4P31A 3HZHA 5DNWA 4DM4A 1TLTA 2VPXA 1YTUA 5H4HA 2CBGA 5CB4A 4URWR 4UUBA 1E6KA 2KX7A 5HMMA 4AN0A 3SC2A 3QLUC 5TNXA 4OHBA 1TKDA 3ZCVA 3U6KA 5ALXA 4ND4A 2M9MA 4YECA 3W8RA 1LVHA 5TLSA 2FQYA 1E7RA 4LCJA 1BA2A 3FNIA 2OHFA 4Y7CA 2D5CA 1ZC4A 2IHYA 2Q46A 1HT3A 3BL8A 5KG1A 4OAOA 3RREA 3PDIA 1VPEA 2E55A 1VB3A 5DGXA 1JU4A 3BWCA 5TJHA 4UW9A 4RE6A 1US8B 1E0SA 3MWDA 1P7CA 1TQ2A 2BZ0A 4ND8A 2ZZMA 1OWNA 2ERCA 4D9FA 3I58A 1KVSA 1QYDA 2Y9PB 5DDMA 1UOPA 3RJKA 2V45A 3CSSA 1Q0HA 2B92A 1E3LA 3PIDA 1YIDA 3O73A 1JKMA 2HGSA 2XICA 2DBQA 4NAUA 5JQWA 2O7SA 3P9ZA 1T9GR 5DBBA 1R9JA 3OQBA 3V55A 1RPLA 1GUDA 2BIFA 3JVDA 1WA5A 4CDMA 1BC5A 4C6TB 1VPDA 3WJAA 1XHEA 1F4PA 2PJDA 2PFGA 5FUWA 1BEUB 2R60A 3U4CA 5ICFA 3E9EA 4KIJA 2Q0XA 3B78A 3IT1A 3AIKA 3TOVA 3TAHA 1FBTA 1WOMA 3DOJA 1V4VA 4WOBA 2D54A 2IHUA 3GEGA 3NBYC 3O1JC 2QN9A 3Q8MA 4B40A 3D2AA 3OE7A 3WFZA 1MRZA 1IPHA 2BPCA 4M2YA 5ALZA 2NU6A 1SCDA 4G1FA 4YCDA 1JIHA 3NCTA 1FU4A 2FWPA 1WB6A 3OHMA 1KSGA 3E7XA 1Z0IA 4FN5A 4D82A 4DNQA 1E2GA 3W2FA 2QW8A 1E1KA 3CVJA 4II3A 4LX8A 4N7MA 1IIRA 4GZ5A 1QR6A 1XZCA 2PKRA 2D8CA 3UPUA 1E62A 3PD0A 3DYVA 1AV6A 1T0IA 4TT8A 3BUSA 5G0SA 5FAXA 2VI5A 2AVNA 5IHPA 3UAWA 2G0TA 2HMAA 4BMVA 1BNCA 1PT5A 5A5EA 5LOVA 2HC9A 4DR4B 4CT0A 4NJEA 3E9RA 1C1XA 4LQ4A 1D2NA 1NJWA 2PKYX 2FEAA 3WIUA 1WB9A 3CNOA 5EN4A 4ZOLB 3SM3A 1B14A 4U0JA 3ZE6A 1P0IA 2FX3A 3LHDA 3MB8A 4LPSA 4QUIA 5EEGA 4RKEA 1V25A 5DDYA 4DL9A 4U2FA 3I76A 3HDJA 4UTNA 2FSIA 2SHKA 4H35A 4AKSA 3S40A 4FGWA 1X7WA 1Q46A 4FKZA 1YQTA 4MQEA 1RDFA 1CZOA 1N6RA 2IW3A 2QTFA 2JH3A 1W85A 2B4YA 4RA6A 4NV1A 2IV7A 4K6KA 1IATA 2IYLD 4D25A 2UYOA 3KUXA 2V4ZA 2KV2A 3EUFA 1PW5A 3GGGA 3EXHC 4XDHA 1QORA 3OX1A 3M8SA 1XZGA 4IIYA 4MRMB 4UXJA 3LLMA 3LXXA 2C92A 4BBAA 1E3SA 4ZVUA 4O1MA 1A5AB 1V2GA 3SV4A 9ICAA 4JS0A 1D1SA 3SSOA 3N2IA 3NW9A 3BB3A 5DBAA 3DTNA 5A7GA 4RK6A 1W6RA 2FCAA 4EYKA 3FDIA 5DGAA 1VZ3A 2R8XA 4EX7A 2F17A 2GAIA 3QELA 3PEVA 5CMLA 3W4KA 4CRXA 4PBSA 3LVWA 1XDWA 1VLBA 2AZ4A 3QEOA 4IIUA 1WPXA 5EIBC 2C8JA 2N1RA 3KK0A 4OFBA 3G8YA 4OP2A 5DG9A 4JLWA 4JQSA 5FOUA 1WKBA 2Y27A 4HTFB 3LAWA 1UFKA 2HMTA 4D2IA 3N53A 1RRKA 3HVRA 2HI0A 4YFYA 5A4JA 4XLLA 1P39A 1RYNA 1JR3E 3CHYA 1DPFA 4L0DA 3B89A 2ZIVA 2Q0HA 3OLWA 4AJKA 1N5XA 1VG0B 1WUJS 4RZQA 3EF1A 2OKGA 1JQLB 2FR8A 3B9RA 1XTZA 3P0FA 3NG1A 2VYNA 3DO5A 1CKEA 4TTVA 2GKGA 3V2UA 2RD2A 3ZD8A 2IODA 1JFVA 4Q05A 1TQDA 3VR3D 1X42A 1MRSA 1ENYA 3LQFA 1SBZA 2NAPA 2BKXA 2I4NA 5D6NA 4FSHA 3H4DA 1XEFA 2YXPX 3NOXA 4ZOLF 4L2IB 4XFJA 5DB8A 3F5EA 2HU7A 3RFXA 1YJXA 3OM1A 1D4FA 2M6SA 5K99A 5F9FA 5C7YA 1CDZA 4XARA 5DTQA 4LNUA 1NXSA 3LQ1A 2F4NA 1PG0A 4NRDA 2COKA 3K0AB 2PGIA 1Q7CA 4XWOA 4R8MA 3NHBA 4ENPA 2GCIA 4KYUA 1BCRA 4QT0A 4Q1CA 2HMSA 1UPUA 5LNK6 3FE2A 1OXXK 1N0UA 4J4BA 1SNYA 1R9NA 3F3YA 3KZCA 2WLSA 3WWZA 1LJ8A 3HYCA 2XYHA 3OZDA 4JIMA 4RV9A 6GPBA 3Q9UA 1ESZA 1KJNA 3IX7A 3FTNA 4C7BA 4H0NA 1N2EA 4B2IA 4BP1A 2OO5A 4RMJA 3AJDA 1WZCA 3IO3A 3NXKA 4BZQA 3QA9A 5AVQA 2CV0A 2JFUA 1H1LA 4H6VA 1ZPDA 1XU9A 4ROSA 4PQYA 2BMAA 3AKYA 1ML4A 3NMUF 1X6JA 1E94E 4DGQA 4UAUA 4M1MA 4W8HA 4I28A 4WPGA 1AURA 1GZ3A 5LL6P 5AVOA 2CMDA 4E5YA 1QRDA 2LYHA 3W2IA 2AJQA 1KO8A 2IHMA 5TGDA 1OFVA 1HF3A 4I4TA 3D8BA 3I9KA 2VP5A 1DWOA 5EJFA 3TN7A 3K2EA 4AQYB 3UWKA 4MIKA 5EIXA 1QYIA 3BHNA 1YVPA 4UASA 5J4YA 1P3Y1 1TK0A 1PV4A 5FADA 1GVHA 3NIDB 1RABA 3C5CA 4XB1A 1HA3A 5AKHA 3E3MA 3RAXA 3ZX5A 2XF8A 4BKPA 1RW4A 3KYJB 5AOAA 2R87A 3T1NA 1WCYA 4YRNA 1T5DX 3I5MA 4ACAA 1RI1A 3VOBA 5AIBA 3SI8A 2X4LA 3C7AA 4AG6A 3AERA 3K4QA 1MJFA 5G41A 4W6ZA 3SDZA 5LFAA 1KNQA 3TMAA 3HUFA 1YCFA 3PX3A 4NR0A 1EDBA 4H2DA 3HBMA 4WXPA 5L40A 2QUKA 3W7BA 3VTKA 1V8PA 3KHKA 2ORVA 4KWIA 3UG6A 3THXB 3HUEA 2O8BA 3SE0A 3PC7A 3OX2A 5LQRA 1T4BA 3LVRE 5AVTA 4DLLA 1MC5A 3W3ZB 3A6KA 4K26A 2J41A 1U9IC 1FX0A 4OK5A 2V6MA 3R6LA 2FN9A 5T8KA 4FDMA 1L5MA 2Z9DA 3DE1X 3NYRA 1PWEA 4GPD1 1T5OA 2FEKA 1USVA 2I2CA 3RK4A 1SBQA 1U9ZA 2MR6A 3RLIA 2EWVA 4X60A 4EYOA 5JNUA 1XXHB 1RSZA 4OHYA 2NU9A 3R7LA 5DLPA 1RRMA 1RAAA 3SGLA 3RH5A 1EX1A 1F0MA 5IBQA 5T14A 1DGQA 4A8EA 1SZHA 5F5NA 5CGQB 3P4XA 1P7VA 4HWOA 1M2NA 2R96A 2DKNA 2IDKA 5AI8A 3FSGD 1JG3A 2ZAMA 3I9MA 4B2YA 5BN5A 3DM9B 2GHTA 5JNRA 1AZWA 2P2SA 2J3LA 5EWLB 2YC2C 1AO3A 3N8DA 1R7RA 4H1HA 1S4QA 1SO8A 1YZNA 4E07A 2ZITA 5ICMA 2K4PA 3IP5A 2JCYA 3BRSA 9ICWA 4EABA 3ZD9A 3FB4A 3CR7A 2E4YA 4XX1A 1MVLA 3MTJA 4FSDA 1U48A 1XD9A 4ATNA 1Q1AA 1C7EA 4GPAA 1QS0A 1N7JA 4DEVA 1W73A 3QVXA 1JFFA 1S8AA 1ADYA 1UOEA 3VSBA 3V4RA 3PXBA 1XPUA 1R00A 4K9SA 5IT0A 1E9DA 2FFQA 1TPYA 4RL4A 3ZHUA 3KAKA 1YFZA 3U80A 1QZXA 1EWQA 3NT4A 4P5DA 1CUCA 3BHIA 3RSSA 1XVTA 2X9VA 4TMTA 3PW5A 1UZLA 3QKRB 2I8AA 5JS2A 1IQPA 2C4UA 4DC0A 2TSYB 5ALMA 1MDBA 3D81A 4JUZA 2NVWA 1FDRA 1I32A 1JVNA 5CEEA 3ENVA 1IN4A 3F5SA 4BQNA 1TDJA 3WGOA 5ADHA 3WK5A 3DMNA 4Z53A 5KOYA 3BXOA 1TGYA 1NTRA 1TTHA 1F7VA 1Z4NA 3NETA 2JV3A 2GRUA 4WLOA 4NOKA 4R66A 1QIFA 4P54A 2KK0A 4AKEA 2FLWA 1T24A 4ZXFA 2I33A 3CUEF 1EP2B 1TTPB 4C22A 1GQ2A 1V7CA 2HBMA 1XZFA 2VO1A 2B1IA 1IG6A 3OZTA 1G20A 3U16A 2BQ3A 1CRQA 1Q3HA 1A9PA 5AR1A 3RTVA 4EELA 2XNSA 5HPYB 5J2CA 1YQWA 5J2TB 2FPSA 4RQNA 4HDMB 3D7KA 4DIUA 3OKAA 8ABPA 3U62A 1OBOA 1CZHA 4F3NA 3LMKA 1WXQA 3K0KA 3BF8A 4TXMA 1L1EA 4KFCA 4UQGA 3T7JA 5C1PA 2Q9AA 3UXYA 3B3QA 4ITUA 1VJ0A 1Z38A 2J67A 3G8CA 3KT0A 3TRKA 4BAGA 2VK1A 1OY1A 3N3BC 3H0KA 1GEEA 3WLLA 3V1KA 1OJ7A 5JO9A 1EFUA 2P9TA 2W2TA 2EJVA 4CMGA 4PC1A 3ESYA 3AJAA 4DRYA 3ZBQA 1MENA 3W8EA 3ENWA 1N0HA 3WGJA 1O7JA 3F4LA 3QY9A 1VB5A 4V39A 1OIVA 1P1IA 2Q1WA 2B4RO 3DLTA 2PMFA 2HA2A 4ZOEA 2C4WA 4R0MA 4MF8A 1CLEA 4FOTA 4RLSA 5LMNB 4I5IA 2XMZA 2JFOA 2Y0DA 3KS9A 5DOZA 5BYJA 4JWTA 1A2BA 1IUOA 1BYUA 1MR3F 4ARIA 4HMQA 1IY1A 3FCEA 4ZYTA 1BEEA 1NVTA 2KE7A 4EBEA 3W5UA 3FM9A 5EHQA 3JPQA 5HS6A 2DERA 5K0JA 1UINA 2AHOB 3RVPA 1HFWA 2GBGA 2B1GA 3CVUA 4DBVO 3EYAA 3O21A 2OZEA 2C5BA 3NEPX 3O3NB 1WWKA 3JQPA 4IDPA 1XLTA 4PCAA 1I7LA 2WP0A 5FPSA 5CVVA 4AM8A 4FW9A 5ALDA 3O2JA 3H1PA 1NU6A 2RHMA 1FZQA 2PT9A 1SQ6A 4J7XA 3ASYA 3Q2IA 2ZTEA 4KQ2A 3L8HA 2C95A 2UZ4A 2XUAA 3GJ6A 2YZMA 2ET6A 1UBJS 5KHOC 4O9MA 3TMYA 5BXQC 3ACCA 4S0ZA 4K9NA 1HYQA 1BXGB 2P40A 5ARBA 3ADDA 3GK3A 1OBVA 4DMCA 1GO2A 3ROXA 1NJ6A 4C7VA 1ONNA 3GVXA 5HF8A 4J76A 3LUCA 1X9HA 5NLLA 4BV2A 4P4SA 5FOVA 4FBTA 3UJPA 1M6HA 2DUUA 1PHPA 1OI7A 1K7XB 3EA5A 2H11A 1I6LA 1DBRA 2L2QA 2EC5A 5KL8B 3C3DA 4K9DA 2JI7A 2DPYA 3OFKA 4P0QA 3PQEA 4M1YA 1JLRA 4LJKA 1SUDA 4OSOA 4C88A 3I6QA 1X8XA 4BRZA 3FLAA 4A36A 3ISCA 1VHDA 2NUTA 3O8QB 3WL5A 1L8AA 3SICE 4HNRA 3WL7A 2C88A 1LBEA 3OUTA 4BKQA 1XRRA 2ZSJA 1FIQA 1FUUA 5DU2A 3WGMA 2DCUA 1PFUA 1GGEA 2EF0A 4Q4JB 5IM4F 3AEYA 3HFRA 2FMSA 2BT4A 4RQMA 2JFNA 4QLAA 5E3HA 5FOXA 3KSAC 2XNKA 1LI5A 2YRXA 2RGRA 1WDKA 3SEAA 2H1FA 1VLMA 2VRWA 3NVAA 1EXDA 1SVWA 1Z4QA 4ZD6A 3K9GA 3RO7A 1EINA 1BW9A 1PK1B 1AX9A 4RJTA 4BB9A 3WNQA 3AM1A 1V85A 2NYRA 4WBXC 2LDBA 2WF9A 3GAFA 4WA8A 3O3CA 2YWXA 3GIDA 1JLMA 3JAKB 3D8NA 3RWMB 4DXAA 2B37A 2PR2A 2BFFB 5IXJA 2OHIA 4EKGA 3U60B 1E2FA 2V8OA 4MQFA 3QUCA 3LVQE 3FRJA 4ECWA 5EMJA 4O5EA 3GMTA 4ZVVA 4HGRA 1F3OA 4KMOA 2K4IA 3AI1A 3UTDA 3J7AC 1N75A 1ZGGA 5JYCA 1SR8A 1XZMA 4JITA 1W88B 2B5OA 1A6SA 3PKJA 5DNVA 1H3NA 2EOAA 3MWJA 1BVYF 5TZVA 2ZR8A 2POCA 1RFLA 3V34A 1VLZA 1GPLA 1YB2A 2BQUA 5C0YA 4LJ6A 4GKKB 5AHXA 2RG7A 1P19A 2QTRA 1SC1A 3SR0A 4D3SA 4DQVA 2IBSA 4DJJA 4DEZA 3HM2A 1VE1A 3DPUA 4IIXA 2ZCVA 3U40A 3L7CA 1JXLA 5I7VA 4JDUA 4S1VA 5K45A 5LPNA 4K81B 1AIPA 5L3SA 2F8LA 4BO4A 3F74A 4MVJA 4RQ4A 4B4DA 2ZS7A 2Q28A 1RQ7A 3O8BA 4OHVA 5FLXA 1VGRA 3AEKA 1ZGCA 1NF9A 1PZHA 2HHCA 2QRJA 1VDMA 4MKIA 4R7GA 5IUNC 3A6LA 2DF4B 3I73A 4LMBA 4RVDA 3SZUA 3HO1A 2GGSA 1R4AA 3OIFA 4JT2A 1NK0A 1MTOA 4IV5A 1K06A 2W48A 4FS1A 3RRJA 2J9XB 4B9VA 3KZ1E 3HPOA 3ZVMA 2OFPA 2Q0SA 5JDCC 1SZCA 3OC0A 2A9VA 4DA4A 1ANKA 3OEEA 1PVDA 3UA4A 3DEHA 2XHEA 2E89A 4YMMA 1HIWA 3KTAA 4GLLA 3LUFA 4ND7A 2FJPA 3DE3X 2VHYA 3IQHX 1SXPA 2X0FA 1KXZA 1ZQIA 3HP7A 4F9EA 1YCHA 5DK6A 4RIEA 2FDCA 2EARA 1XAGA 1P2GA 2BZGA 1NK5A 1ZCJA 5KOJB 5B1IA 1QKJA 2WFMA 2QR2A 3D5QA 1RT9A 3P27A 4YMOA 2GPTA 3COVA 2EP5A 2O3TA 2Q5OA 2NZ8A 4HNQA 3FAZA 4J07A 4NBSA 3AZQA 1ZJNA 4B81A 4ALJA 1TPZA 3DWIA 1XDDA 5AESA 1SXEA 4XQ0A 1DG9A 1O97C 1JKJA 3LSTA 4PHCA 2JFYA 3M5WA 3PX2A 4YCNA 5CD1A 5T4FA 4S24A 3B13B 1HOXA 3QKSA 1DMSA 2H0QA 1NUQA 1WV1A 1OWMA 3RGWS 5KFKA 1N77A 2GNAA 3OTQA 3FDZB 1G4UR 2I9PA 1AKVA 2FVYA 4BKUA 1D2HA 1ZN7A 3ZLJA 1CT9A 2CDBA 4DW8A 3IOYA 2DFTA 4NJ8A 3CRW1 4J1TC 1DE0A 5IBCA 4LV8B 4BASA 4UAGA 1N6LA 4B6GA 3C24A 3PEWA 5AI0A 3GA7A 2GILA 4Q3EA 4J0FA 4N54A 1WBJB 1ZJWA 4QC2A 2PT5A 2ZS8A 3LCVB 4P2BA 5EWEA 4P5EA 5F1PA 4N8EA 4MUYA 4BCDA 3ITDA 4BB5A 4RQTA 1R37A 3EEBA 1KXJA 2DETA 1AXGA 3CURA 3CUYA 4DA6A 3IMKA 2VPPA 4QUKA 2Q9BA 3EG9B 2VLIA 5CNKA 3B1JA 2NXNA 2I91A 4C8OA 2AJCA 4DLWA 5CA1A 3LPMA 5FHQA 4EPRA 3RSGA 4EZBA 1UAGA 1XI2A 1Z36A 4HNAA 2XMCA 3SZGA 5JZOA 3IPCA 3NOQA 3VPSA 4PG7A 4H3KB 2NO0A 2HXGA 4I2GA 2X8JA 1GGHA 4ND3A 2HF9A 4K9OA 5AK4A 4UFPA 1QJCA 4EY5A 1OXMA 1CV2A 1JLHA 1XFDA 1YJCA 1OU4A 1U9LA 2RH9B 4UMFA 3MRXA 3I5XA 3RKUA 2Q6OA 2QGFA 4O02B 1T8SA 4EF4A 5K4GA 3D9QX 4A9AA 2J32A 4M0EA 1JQEA 4FDVA 3N5KA 1J90A 5GAJA 4EATA 2XYRA 1O94C 4ES6A 5FWNA 3EWSA 2XC9A 3JU3A 3G6XA 2HIMA 3DCNA 2EQ5A 4XPIB 1XRJA 2QJOA 2PNJA 1EGMB 4AWXA 5COQA 5JZMA 4DT1B 1M2GA 5HGJA 3MGIA 1DDIA 1DJMA 2YYSA 3KR1A 1ORIA 1DCKA 4Q21A 1N32B 3OT5A 2ZT8A 1CHDA 3STTA 4WDQA 1PE0A 4OYRA 5BYAA 1Y1PA 1XALA 2C28A 1UXKA 4IVRA 5KMGB 4HP8A 1ZC3A 5BR7A 2R8HA 2FTKE 4H3SA 1IBSA 1X7ZA 1TF7A 3G2HA 4MZXA 4HQRA 1UPBA 3ZUPA 1AKEA 5J5CA 1DRJA 4EA9A 5FL3A 4GI2A 3AOEC 4A0QA 4U2GA 1ZINA 1TQHA 3ONWA 4UAWA 5J5VA 4AX8A 3KSUA 1GSAA 4RLFA 3NAMA 1VCMA 1GZSA 5L1LA 2HKIA 5AKKA 3PR4A 3COYA 2XVTA 4PNZA 4NENB 5H82A 4HI0E 2YX8A 2CFCA 5FEMA 2EYQA 2BDEA 3IHKA 3CRVA 4OVKA 4CM4B 1TF5A 4B73A 4FEAA 2M6RA 1KYTA 4DMKA 2NXJA 3TIFA 1H8HD 4IDEA 5AVYA 2WFAA 3F4KA 4N5MA 1FFEA 3DMPA 4PG4A 2Y99A 2EH9A 2LUOA 1VKRA 4GI7A 3MJEA 5HIJA 3UK0A 4JV2A 3UJNA 5CX4A 1VPLA 3MN1A 1P7PA 1J25A 4RVSA 1C41A 4RMGA 2WC1A 2PR7A 3L0DA 4G4SO 4DYVA 3ZXIA 1IM5A 2AYXA 3KOXA 4LK2A 1G63A 3L7BA 3CNHA 4PZEA 4GZLA 3T95A 3WRXC 2FSVA 3LK9A 5DI3B 2H2HA 4BP9A 2PUFA 3AG6A 3HU5A 1Z8DA 4MV4A 2OBYA 4YJ2B 2R2AA 2RGWA 3S2EA 2H6EA 4C2BA 2ZM6B 9ICUA 1U2ZA 3WNBA 2IE8A 2QY6A 3HHEA 4DQPA 3GEBA 3ODGA 3WADA 1WD7A 3GO4A 5B4TA 3EFHA 5CCDA 2VBGA 3PIIA 5JCZA 3K20A 3EAFA 2AXNA 5CDYA 4I1IA 4PZZA 3V7FA 1HEKA 2F77X 4FCVA 5L95A 4WFKA 2G77B 1CTQA 1U3UA 1XTIA 1FP6A 4DF4A 4QBIA 4J7UA 1S1MA 4E5UA 2OK7A 3G9UA 3AF1A 3IUEA 1NMQA 4H31A 1A04A 2P9EA 3FVVA 5KYKA 1IY0A 3TG2A 2FQXA 4YIHA 3U6BA 5DHPA 2AXEA 3UHPA 3TW8A 3HILA 3L4KA 1QQ6A 2HTFA 9ICJA 2WM9B 2JH7A 2X42A 3ETGA 1E4YA 2QMEA 2YTZA 4ILKA 3FTFA 5FOSA 1Y4SA 1YV9A 4MUKA 3TGWA 1DX6A 1WP9A 4YC7A 5A6SB 4GSKA 1TJYA 2GZMA 2QS9A 2F8TA 1EVIA 1YE5A 3T06B 3GHHA 3GJ4A 4FYMA 1ICEA 4V02A 4LHEA 5T57A 1OXJA 5CVEA 4C2UA 4YWHA 4W1RA 1JSZA 1MAUA 3DKPA 4LJXA 1LK7A 4CM8B 4B87A 2OCLA 1NL3A 3VKGA 4MEBA 3ZUGA 1T94A 1KRHA 1L5QA 3EF3A 5E1DA 3D6FA 4NDNE 4OTZA 3VYTB 3FWNA 3C1YA 3F3KA 1SKYB 1DAGA 3HCDA 2RG1A 4RQ2A 1KOGA 4TYPA 2IMWP 2AT1A 5HKAA 1X74A 3IEPA 2XVMA 2NPIA 5B58T 4C0HA 2EKDA 4I5FA 2HT1A 3NUZA 1JYFA 2PFQA 1KOFA 2D13A 5CJ7A 3KJFA 2AYYA 3HRKA 3GZNB 4HCJA 3H2GA 2JIBA 2GWRA 4R69A 2FG5A 4L57A 1D8AA 1WF6A 1EDDA 2ZQ5A 1GZ7A 1JHMA 2GJKA 2I4IA 4INJA 4TTAA 4ZHQB 2VJMB 2N1MA 1ONOA 4ETIA 4E13A 2YFYA 3HABA 1SXJA 2AOTA 4ZODA 4M7WA 1U28C 1JJVA 4KXVA 3UJ8A 4KUHA 2RRDA 5K2OA 1MV8A 4LDZA 2HEGA 4IPTA 1U0EA 3PVXA 2ZWMA 3QKIA 3PD1A 4LRWA 2KW5A 2JGFA 5HKBA 3VPFA 2WWHA 2GXQA 4JHXA 4WEQA 3F6BX 2GDJA 5AM5A 5COAA 2Z04A 4F06A 4RHXA 2IBTA 2FHPA 1XMIA 4OOEA 8ICXA 1ZVJA 1UH5A 3HWWA 3EZ6A 1SC6A 3AO0B 4TMZA 4YREA 3P2IA 4F8JA 2Q4RA 3JV7A 4AZSA 1D2CA 1HYBA 2DPMA 3KYIB 3EPKA 3ZJUA 2YWBA 1UCVA 1EX9A 3WB9A 4DYDA 5JADA 2C22A 3WLIA 3GCGA 3K09A 2ETVA 4UTZA 1RAIA 4M8IA 1J8MF 3PHIA 2A9RA 2GK7A 4ZMRA 1TD9A 5B6JA 4IUYA 3KJXA 1F8GA 1I3OA 3DZIA 3JZMA 5CDGA 1V1MB 2BM1A 1ENOA 5EMHA 3COPA 1DAOA 1DG3A 4B5LA 4ZQIA 6REQB 2ZUBA 1ECJA 3OQ1A 2PMEA 2Q3CA 4HT3B 1HT2E 3PUZA 2VT2A 1V96A 2NP7A 4NZPA 1RQLA 3AQ4A 3BMXA 2B8NA 2D1QA 2J31A 3TX6A 4ZEWA 3C2LA 1YQXA 3M9XA 8ICOA 2VPQA 1VCHA 4ZZ3A 2IF2A 4P3XA 1JAYA 3NHWA 4PYJA 1OKKD 4B1FA 2XTZA 3DEAA 2VKTA 4HB4A 2RKWA 1RWWA 1AJEA 2CRXA 5AVZA 4F4WA 7ICOA 1T4DA 4Z99A 5CDHA 2BFPA 1A1SA 4I6GA 2K87A 2P6UA 4HQNA 5I7SA 3RTCA 1JLLB 3T4PA 1FMLA 3ASZA 5A7HA 1RXYA 4LZPA 2H16A 5IH3A 3C6MA 4YA6A 4GYKA 1YZYA 5A03A 2R8EA 4USAA 3NIWA 1N5MA 1N2SA 1NDHA 5KQGA 1A3CA 1JRPA 2OBNA 4ER6A 1T1SA 3GBPA 4ND6A 4QQFA 1CJCA 1Y4DE 1SUFA 2WHYA 4KLUA 5L3RA 1VA4A 1TKRA 3QX8A 3GH1A 4JR2A 3INRA 3RR2A 3KQPA 1N7HA 4EHIA 1V9PA 2HYDA 3TTSA 4FBUA 3GDGA 3KOMA 3TRHA 1UXOA 5JIBA 4I19A 3CRMA 2V6FA 3AFHA 4E1BA 5E6RB 2XRMA 4KV9A 3N2LA 3V7LA 4XFDA 3O0FA 4M88A 1U6IA 1J42A 3BE8A 3WLMA 4YR2A 3ILXA 3E9QA 2Z2KA 1TV9A 2NXCA 1QH1B 1RJGA 3LDGA 1EM8A 4MCIA 1RPNA 3MUFA 1FE8A 1GT6A 2FWIA 3QJYA 1XVVA 2KVSA 2HJVA 3LZCA 1H4TA 4I5EA 1XAIA 4CG2A 1E5TA 1G21A 4BBJA 4D4KA 5J4HA 2W2NA 2PWPA 2JRZA 1GKIA 2YB4A 4M9XA 3KBBA 5BR1A 3ZC3A 1JEQA 4YJFA 4J0HA 2FQQA 2QUHA 3FJOA 3Q15C 2P9BA 4C8MA 4EA7A 5LZ2A 1ZGAA 1NHGA 4YXJA 4NJOA 5IDWA 2DPIA 3O74A 1YFLA 5IDYA 3WYNA 4O3NA 2GUWA 4YAKA 4I1SA 3IOBA 4PXYA 3UK2A 3UT6A 4S05A 1P1KA 2BMFA 1EXWA 2VATA 3T9AA 4Z6KA 4HH0A 1OYWA 3V1NA 1GRQA 3GJ8A 4ZCPA 5IX8A 1Z18A 3D3KA 1DBQA 3RARA 1RLTA 2INGX 1W5AA 1QJ4A 4ZYUA 1MABB 2QW0X 2VAVA 4UAJA 4UJ3A 1YR9A 4QTUB 3QKWA 2A9JA 3B53X 4YR7A 4QE3A 2X8AA 5J0PA 1E4VA 1T8PA 3CISA 2Y9TA 4BX0A 1G42A 3RADC 4M0FA 2O19A 4CKXA 3DXYA 3NBZC 1P2FA 1IULA 3RS8A 1IY9A 3H9CA 3I83A 4Y9UA 1FP4B 4MKFA 3OIWA 4G0WA 2LRHA 2CDRA 1N2GA 4TTTS 3ZXXA 3LL4A 2ZUUA 1MX9A 2GHIA 2QDKA 2XBLA 1WAMA 2YS6A 3K15A 3GEPA 1C9JA 1QX4A 2UVPB 2CMKA 2XXAB 5CX1B 1CRZA 4XYGA 1EWTA 1M1NB 3TQCA 4WQMA 2AI1A 3ZDBA 3LYHA 1YQUA 3INGA 2V5UA 2Y1DA 3JAWB 2ABWA 4K6MA 2XXBA 1KLNA 1YKFA 1J8VA 5DM0A 4G3IA 4JROA 2N0SA 3HZRA 5B1EA 4M60A 2AKYA 5JBQA 5JAQA 4MYSA 4ZO9A 5A71A 5BPFA 1N92A 3N0VA 1GUBA 1A4RA 2M6LA 1Y3FE 4PO1A 3KTFA 3W0LB 2JK0A 3I0NA 4BV8A 1CX9B 1FYXA 1MDFA 5CAEA 4JJAA 4MP3A 5AVWA 4HXEB 4B76A 2OFWA 2M6KA 4ZI3A 3I1JA 1SC3A 4L9SA 4ZQEA 5JNTA 3Q3VA 1BX1A 5B2FA 5EZ5A 1O08A 2PTHA 2XTNA 1YGYA 4D4MA 3DEJA 5KG7A 1G3UA 2HDHA 2QSJA 1GUZA 1H2ZA 1DFHA 1NURA 2PQMA 3H2ZA 3CX4A 5CLHA 2WJGA 4IO0A 5AKGA 1MTZA 4C3OB 1T5HX 4CCHA 2BJWA 5LLDA 4OQZA 3CLVA 2JIPA 2V4RA 3G68A 1RHUA 1PVPA 1WNTA 3JAMA 3B82A 4Q48A 3KZNA 5FB3A 3C70A 3LW7A 2NT3A 3T5HA 5KNLA 1G9SA 2BEWB 2OV3A 4F3RA 4OLJA 1EHIA 3MR3A 3H5OA 1D0VA 5ALGA 2I8CA 2CV2A 2BTEA 1E69A 3ZXYA 2ODGA 2IXTA 3VTAA 3RV4A 2WTMA 1P4GA 2AQ8A 1II9A 5FOQA 1N5KA 2FR1A 1E4OA 4JMPA 4LGYA 4P6VF 1QGED 3WLAA 2Y2UA 3FCXA 1KIAA 3MK31 2V6IA 5LP6F 4NBLA 3BIFA 4ZOQI 5K03A 5HRUA 3T5AA 1P5HA 1PI3A 2EQYA 1VE7A 3B2EA 4MKHA 1HG0A 3C29A 3IYLW 3OPVA 3MJRA 4WNIA 4JYZA 3VUFA 4CCYA 3OEHA 1K1SA 1ICIA 4DQQA 3IB6A 3HU3A 5CVUA 5BQOA 4UUOA 2QQGA 3E4DA 2OKCA 1CG6A 2ON6A 1V5GA 1H1TA 4F3YA 2L5YA 1SUPA 2CL7X 2QTVB 3WLQA 1H0RA 2XQFA 1NVUQ 3NVKI 1G66A 2NUAB 1V48A 1EVLA 2DWUA 4JI2B 1QVRA 2Z09A 5LC1A 4YP9A 4PYNA 1CQIB 3RVOA 4J2TA 3EGEA 3HA2A 4MR7B 4CG3A 3VPXA 3F9IA 3VR4H 4V1CA 3F7OA 1I4LD 3GJ5A 3TQIA 1QYCA 3FX2A 1JQ3A 4GMKA 3SD7A 1TC1A 3RSCA 1W48A 4WOKA 4RPKA 5LP6C 4X45A 2ASDA 2KLBA 1P4AA 2ZJYA 1JLKA 3OQJA 3EOBI 1YK0A 3WL8A 3AMZA 2OHJA 1S76D 3MJFA 1CQWA 3S2GA 2XRZA 3NNDA 4JKIA 4D42A 5LIRA 2Y05A 4RXTA 2E4XA 1G9XA 2SBTA 3K9BA 3H5AA 2B5VA 3LWLA 1ESCA 2QZJA 4JI8B 5K8IA 5A2QA 3NB0A 2ZXEA 1NQAO 4P1ZA 2VPYA 3EPJA 3M3HA 1SEVA 4QZVA 4OXRA 4QJ4A 2IX9A 5K0BA 4QHSA 1S3GA 1ZQAA 1BX3A 4J0EA 1I2BA 4B3DA 2CHVA 3OTIA 3JQGA 3CR3C 1I4TD 2ZBUA 2ZYRA 3WO0A 4R65A 1RVV1 3A36A 2R6FA 1S02A 1TUGA 1KSFX 1V3VA 4QAJA 2OR3A 1X9XA 2GA9A 5EMKA 4NFHA 3HXPA 4EPYA 5TPWA 1KI4A 2ZUWA 3ENQA 1DIOB 5KT7A 1DHTA 1USUA 5GP1A 3TLGB 3PC4A 5B3JA 3O94A 4BTVA 1VLJA 1SOMA 4U2CA 2JJ8A 3M6MD 1Y6RA 2XI9A 1NLMA 4FWBA 4OHXA 4V3BA 4R7ZA 1SKBA 3H2JA 1VKHA 5DK4A 3I9OA 4M1SA 4N7BA 3VC7A 2BCQA 2PSEA 4HH1A 1A4UA 1R0ZA 1KOLA 3DC7A 5U4XA 3ZGNA 2N42A 5LQDA 5DYWA 2I2FA 2C5HA 2FW9A 1HLGA 3WWOA 4GKBA 3LCRA 3G02A 3RWOA 2P1ZA 3CVOA 4GW3A 4GOKA 3HNRA 4EL0A 3TZBA 1X80B 2PWAA 2FN8A 3R3VA 4G81A 4KYVA 1LLDA 5EJMA 4JP5A 3AM9A 2NRTA 1QOZA 2BKVA 1CUSA 3AVXA 2Z6VA 3OUUA 5LKAA 2CHQA 1TK5A 4D8UA 2VJKA 3MG9A 5DB6A 3UHAA 4MW7A 4Z9YA 1LK0A 3WC4A 1ADCA 1KFKB 2O8CB 2AKEA 1DIRA 3ZKAA 3GFPA 1ZM9A 3PJEA 2R2GA 1I7QB 4CDGA 2JXJA 4QPZA 2PTGA 3QEBZ 1LPAB 4TSFA 2FHSA 3OQ6A 1DEXA 5H68A 2QOEA 4I9NA 3GZTB 4LKOA 3O8DA 5CT4A 2W58A 3UQ2A 1LI7A 5FBVB 5K9ZA 4H1WA 1BD3A 1Y3BE 5IIIA 4BE9A 3IV7A 1TUEA 1XROA 3L0ZA 2H0AA 5JS1A 3EBLA 3S99A 3U4MA 2ZTMA 4NBKA 4KUEA 1IHUA 4B48A 5BO5A 4MRRA 3W5DA 2HZBA 4KQGA 4KLZA 1WCNA 1JVBA 3AUTA 1PUZA 1T9GS 3JYPA 4RD0A 5AMXA 4II2A 4NABA 3B8EA 4ZI7B 1L1QA 1MZPA 1QTQA 3OPMA 1JHDA 1AMUA 2VHCA 3ZEAA 3HXKA 1A97A 1ORRA 2PMZF 1BROA 2IZ5A 1Y8QA 1Z29A 3D5TA 1SXJD 5JZBA 2ZIXB 3H11B 1L4LA 2O7QA 2KZMA 4MR9B 1PFGA 1E1LA 1TAQA 3VDQA 1C81A 3EEFA 3I9V6 4HDQB 4E7PA 2XB2A 3ZTWA 1Z7WA 1VG1A 3I2FA 1Y80A 2V9WA 4MS4B 2VTBA 3SFTA 3UATA 5K3AA 2YHUA 4U4AA 1MZVA 4C4TA 5ALLA 2GPWA 1VSTA 1MX1A 3CNLA 2CLIB 3M9MB 2IKQA 3WIVA 1T0JB 3KFVA 2CLHB 3FRHA 2ZATA 1V16A 5KYUA 4DJ5X 2CL5A 3EARA 1E6EA 3CSUA 3Q10A 1ZIDA 2IIQA 3BK1A 2FPPB 4EFLA 3AIMA 2FXIA 2OM6A 4C04A 5BW5A 1CEXA 4UXHA 1G7SA 2PMZC 2A0UA 2NVUA 4C2AA 4P2GA 1P60A 2BKUA 3ROQA 5FPKA 1NTOA 4IDDA 1GDTA 1JVSA 4IRUB 1E2HA 5KOHB 3DL7A 3PT9A 4W7IA 1KO4A 4I2VA 2JCBA 2V5VA 2FOIA 4KLNA 2ZB3A 3ABSB 2ASLA 4YMVA 2QYHA 1EB9A 5DSZA 2R68A 3K0FA 4M89A 1H23A 1QUFA 2RB5A 1G5HA 3NTUA 4DXDA 2JVKA 2OILA 2D4HA 2D1YA 5BNWA 1H9BA 2ZYUX 3UK7A 3F1LA 3ABOB 4J0CA 1CUKA 2FPLA 3FUXA 4M0LA 3UH1A 3RSQA 3A9WA 4PZYA 3N2KB 5J4VA 1MEEA 3GLFB 2JAHA 4NEQA 4G5GA 3B12A 3U7RA 4DADA 3D6MA 5EWGA 1XU4A 4HWGA 5KTTA 3PLNA 4BFXA 3VC2A 3RVLA 3CF4A 2YWFA 4AS2A 2BCUA 1K5DA 4CT4B 5ALVA 5KCZA 2DPHA 5TGZA 5BRAA 2O8VA 2X13A 2Z9BA 1Z5ZA 4FFDA 4JI4B 2A19A 4A8PA 3OGUA 3GRRA 3ICCA 3NASA 3EF0A 2NZYA 4YRFA 5BV1A 4ANFA 1NV9A 4BAUA 4EGAA 1BPZA 3A6FA 3ED1A 4RQ0A 2QB0A 3ZTYA 4DLBA 4Y9SA 3TLBA 2QRVA 1NZPA 2H1CA 2FF5A 4MUHA 1WSWA 2COEA 3V2IA 2E8PA 4LIPD 4H1VA 2IF0A 1CUBA 3JQ8B 3S81A 1HL3A 5BWMA 5GGXA 4F2GA 1E4EB 1P6UA 1YZFA 2MU1A 4EA6A 4FUTA 3A0RB 3PMLA 1XZEA 1JN0A 1YO6A 1HV8A 1SU6A 4KEAA 5J2AA 4F5EA 3THOA 1UJ4A 3K2IA 5BSKA 2D8MA 1SVMA 4YJGB 4E3ZA 2I54A 4KE7A 4BY9E 4N3GA 1EGQA 1CY7A 4G4IA 1XT6A 5A02A 5JT1A 2CK3A 4IIHA 3CY6A 3CXUA 4WXEA 3NC4A 3TW0A 4Z5XA 3QWFA 2I2DA 3QGMA 2B98A 4WN9A 2P75A 1SRRA 4EJSA 3C6KA 1CEQA 3M83A 1RCTE 1Z82A 5D5QA 2CFTA 4HVLA 2GAJA 1F7UA 3ICQB 5THQA 4UBNA 1WUHS 3TTTA 4FFPA 1IHYA 3FVTA 3GRAA 4O6VA 2GQ0A 1TIPA 3T9FA 2OPBA 2TRSB 5CYFA 1OMOA 4QUHA 2WTUA 1Z2CA 2I8LA 3V3TA 3H4MA 4C07A 2VJQA 4ZMSA 3KKQA 3R3SA 3QUQA 1YULA 3BERA 1USKA 4AZ3B 2C04A 1PG2A 4ND2A 1Q12A 2B5WA 3Q98A 1P5ZB 4M53A 2IYPA 2FKNA 1AQUA 4XTCS 3STUA 2F3SA 4M7PA 2W04A 3MGCA 3HH8A 3IR6A 3A7EA 2ZT6A 2B69A 5DWVA 3OLYA 5ICSA 3I6MA 4ZT2A 3E2EA 3BVPA 1PEYA 1ZG3A 7ICPA 4HVCA 1XC9A 3KQVA 4FCCA 3RYHB 5HUJA 5HSGA 4C0XA 1AUQA 2XHZA 4R8SA 2XMRA 3MT0A 1ZWLA 1TM2A 4LJAA 2OCDA 3BGIA 1JAIA 3TWOA 4F72A 1N2CE 3PO4A 2A0YA 4PX5A 2D0DA 5C35A 1ZD5A 2GD1O 1Q50A 4EQZA 5AK0A 3WY9A 3JPPA 5U1PA 3ESAA 1V11B 1IOVA 1DAFA 2ALZA 1KL9A 1XEWX 4OQLA 1AZTA 1XYVA 4AO6A 3WU2U 1YZTA 2XMDA 4FBMA 3ZWPA 3LKBA 3L8FA 3MZ0A 1QZTA 3IEKA 4F5NA 2HK7A 1Q7EA 1PW7A 1T2VA 1SD5A 2BR4A 2XMPA 3K9NA 1SVLA 5G5HA 1QNFA 4QZ9A 1E2IA 1VQ1A 1GPYA 4W5WA 2F64A 3KKAC 5DTEA 2P9YA 5ALJA 2CLDX 4EFDA 4UHFA 3MAGA 2FPMA 3MJVA 1F2TB 1MH9A 4FCTA 2E7ZA 2LR0A 2WKRA 3ZCQA 5JJLA 5A9SA 1YASA 3BGDA 1F0YA 3QP9A 4KO2S 4GXKA 3W1WA 2DUNA 5J2TF 3IDQA 2AN3A 4IIDA 1NSYA 1GQQA 3H2IA 3I9LA 1Y9ZA 3OE7D 1QB8A 3D2BA 4QGGA 3L1VA 1XVAA 1W0KA 4K5QA 3UM9A 5F1OA 2Y1JA 1D8BA 4D96A 2FPWA 5JEEA 3WJ2A 4QZCA 4RELA 1Y5NA 2QTBA 3F5AA 1DXYA 1DBPA 3VNBA 3V1UA 1U4SA 3PEFA 4IV0A 4ZFNA 4ON9A 1UOOA 2J0UB 4RK0A 5DULA 3COWA 2IVFA 2ZI4A 2C3PA 1MQ9A 3T1OA 3NAGA 4Z0NA 5FEUA 4LXYA 4CM7A 4R1SA 1EZ4A 4LJSA 2JJQA 3C2QA 3LGSA 4ASUA 1EVKA 3GGDA 1W5BA 1RZTA 4X8LA 1KAMA 2P6MA 4HLUA 4ZVTA 1ZX1A 1P1BA 1NYQA 3NV7A 4YDRA 5GJVC 5KCMA 3JYQA 1X1EA 3ABIA 2Z8YA 4ZOAA 4OHZA 4ECUA 3DMTA 4QRDA 4GOND 2BUCA 3O2NA 1V3UA 5KNCA 5K4LA 5DMXA 3S8YA 5K2MA 2JKVA 2IP1A 4NLNA 1ZYQA 3NEYA 1U0RA 2ZPUA 2FMHA 1NKTA 1WY5A 3JQAA 4ECZA 4L02A 2QKQA 1ONSA 2JZOA 2X2FA 1B74A 3A2NA 5A1JA 3NS7A 3BB1A 4C4SA 4IEFB 1DMRA 4MICA 4OQQA 3DONA 4I6JA 1RYMA 4JLMA 2GNPA 3RR7A 1JEDA 1KMMA 2XODA 3QVKA 2XD9A 3MMPA 3UMVA 4RV4A 1I2MA 1ML3A 3V9AA 3DV0B 4Q9IA 4IIVA 3UWMA 3AHDA 4GFJA 2WHQA 2WM8A 1GNPA 3B52X 1ZVQA 3TZ6A 4RY0A 1KYQA 5H83A 4LZNA 4WCFA 1D07A 3H97A 1LBHA 3RSLA 4K8RB 2IV2X 2XE4A 3T5BA 1P2TA 3DZCA 1NJGA 4C30A 1D3AA 2ODEA 5GINE 1SKQA 5FT9A 1C9EA 2X4GA 1W47A 5ALKA 7ICFA 1M66A 5JAIA 2EX4A 1V8BA 3EDYA 7ICEA 2JLSA 2WB2A 2PXHA 2VXYA 5GQSA 5KYVA 2C9CA 2YXEA 1G55A 2B25A 2J85A 5HBRA 4LTDA 3BSWA 1D2MA 4E6EA 4AW9A 2ZLBA 3R44A 2PRYA 4DR2B 4TS4A 1UDBA 2HBKA 1EWRA 4FDAA 3U1VA 5A4DA 4UU8A 3T9DA 1M0TA 3MNFA 1J0BA 2J9GA 5KG4A 2Y2VA 2YHAA 4H4EA 2YCLA 3BTOA 2Z08A 4K87A 3RFUA 3DOOA 5D3QA 4KB5A 1KERA 2BEUB 1K1QA 3R0VA 4M38A 4FGUA 2QTTA 4HLCA 5BUCA 1OH7A 5BQ3A 3IERA 4ZU6X 4JLUA 2ERXA 4ACBA 2VYND 1E7WA 4HPWA 2ISCA 3C5WP 1SL0A 3I01M 3DE4X 4F6LA 3T3DA 3DW1X 4IQUA 2XWSA 1TOAA 2WSYB 1L1RA 2AJTA 2ZBPA 1WKVA 1O77A 1E2MA 5HX7A 3A8TA 4Y2SA 5EZYA 4BN0A 5LQAA 1ONPA 4HDNB 3IKVA 3PWSA 2UYYA 2WZBA 1C1DB 3ZDYB 5FTLA 4BO1A 3U1BA 4CPDA 2IYEA 5TMDA 3G49A 1UWKA 2WE8A 4WK6A 5DRYA 1EFVB 4Y3UA 4LXGA 4DLAA 2E6KA 4JT4A 1KFSA 4PLPA 1I0LA 3BT7A 2HLDA 4EW1A 5J2GA 3CS3A 2HRCA 3FHJA 4JWMA 3HB7A 4Y2PA 1JPUA 3QOXA 4HH4A 4B7UA 1F9AA 1WV0A 2FPIB 3ZNPA 2PX0A 1QVZA 2PS0A 3LX8A 2WAAA 3L5OA 4Q1FA 4EVSA 4HRXA 1M6YA 1RR6A 2R6GA 2ZXUA 3WLEA 3A0BU 3G2LA 4OA5A 1H85A 3H19A 1RXSA 3N1UA 4YRGA 1N7GA 3DUFA 1ND5A 4YBZA 4MVJI 2R1TA 4OQNA 3T5CA 2C7VA 1WCIB 2ZSAA 4QNMA 3NAZA 4AP5A 2Q1XA 4US1R 4RKFA 5BNFA 2AB0A 2OCEA 1TYEB 5CM2Z 4AMUA 4D3YA 3G2JA 4X7PA 4QQ8A 3L04A 4QUEA 3GGPA 2HR1A 3Q8WA 5DO9A 3GXOA 3K9LA 2QAGA 1Z3IX 2FV8A 4BS9A 3HJGA 4NONA 4E22A 4F2PA 3E22A 1P1CA 3LHIA 5E1OA 2JD2A 1H3FA 3DMFA 2CMFA 4LRXA 2VDQB 3PGA1 1L4YA 3BJZA 1PDWA 4I1UA 3ROGA 3PR5B 4AMVA 3SZLA 1NW5A 2H17A 3L6OO 2QYTA 4WY5A 2BMVA 1DTWA 2OTCA 1EE2A 4XI9A 1WHSB