4CF5A

Mutagenesis of a rhodobacteraceae l-haloacid dehalogenase
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
223
structure length
222
Chain Sequence
SGILVFVNETLLDLTSLSPLFERVFGDAKVLREWFPELILYSQTLTLTGLYRPFGEIAAAVFEMVAANHQAKVTPDDIAELKTRLTSMPAYPDVAPALTRLQDAGFRLVTLTNSAPSPAPSPLEKAGIASFFEAHLTVHSSQRFKPHPSVYDSTAETLGAKPEELCMIACHIWNTIGAQARGWRGGFVARPHNTPLTLAEVPQPDFIGRDMGELADQLIASL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-HALOACID DEHALOGENASE
publication title Mutagenesis of a Rhodobacteraceae L-Haloacid Dehalogenase
rcsb
source organism Rhodobacteraceae
molecule tags Hydrolase
total genus 86
structure length 222
sequence length 223
chains with identical sequence B, C, D
ec nomenclature ec 3.8.1.2: (S)-2-haloacid dehalogenase.
pdb deposition date 2013-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 4cf5A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4cf5A01
3U26A 1VJRA 3ZWKA 5A3SA 2MU2A 2R8XA 2GHTA 5AW6A 1YV9A 4BYGA 2WF8A 1TA0A 5AKXA 2CFRA 4YCMA 2B82A 2G08A 4MUMA 1RRCA 2HI0A 4ZEWA 5ALJA 2FEAA 4FFDA 4YCLA 3NAMA 1RPZA 3I1YA 3WK6A 3HLTA 2AUTA 3E8MA 3M1YA 4L57A 4UAUA 1L7MA 3ZI4A 3OCXA 2W4MA 3OPXA 2GMWA 5AW9A 1Z4NA 1LVHA 3FPBA 3VAYA 2RB5A 3AR3A 3ZX5A 2B0CA 2WM8A 3AR2A 3R09A 4C4SA 2IOHA 3AR4A 5AM0A 2G0AA 4IG4A 2HHLA 3NALA 3QU7A 2B1RA 2ZXEA 1RKUA 3R9KA 2QLTA 2WF5A 1K1EA 1IWOA 2JGAA 1EK1A 4BNDA 3W5AA 1ZD4A 2NYVA 4OCZA 4HGQA 3SMVA 1FEZA 3MPOA 5A3RA 1XVIA 1NNLA 3WKDA 1XP5A 3MN1A 1Z4MA 1Z4JA 5AI4A 4CF3A 3L8HA 3N1UA 5ALMA 5ALQA 1Z4IA 3I28A 1RLOA 3A1DA 4CNQA 4BNDB 5ALGA 5AESA 3ZTWA 4YH1A 1RQNA 5ALVA 2R8YA 2YN4A 5AVTA 3OCUA 3NUQA 5AI8A 1QQ6A 1VJ5A 1RMTA 2ZOSA 4L6CA 1L8OA 1NRWA 4HGRA 4O8CA 3ZTYA 1YMQA 3MC1A 2WHEA 3WK4A 1RLMA 3ESQA 3U7EB 1Z88A 4Y2XA 3ET4A 5AVRA 3KOOA 4KX3A 2PKEA 5AM3A 4XPZA 3CNHA 5AI0A 5AW7A 1WZCA 1Z5GA 5AW2A 4IFTA 5AIAA 2YJ5A 4I9GA 5A3QA 1T5SA 2OA0A 2W11A 5ALEA 5FP0A 5AVQA 1YDFA 1ZJJA 3UMGA 2IOFK 5AW8A 1KYTA 5ALPA 3U7FB 2FUEA 1ZRMA 3KBBA 4UASA 3QUBA 1QH9A 3NASA 4UMDA 3F9RA 2AH5A 3OCZA 5AI5A 5AW0A 2C4NA 1Q91A 2I33A 1S8OA 5AKHA 1L7NA 2C88A 2R8ZA 3NRJA 4H1WA 3A1EA 3CZ4A 3I6BA 2O9JA 3TLMA 4QJBA 2PQ0A 3WGUA 4UM5A 3KZXA 2NO4A 1YNSA 2I7DA 2HDOA 3WK7A 2ZBGA 4NWIA 5AW4A 2C8LA 4RESA 1SWVA 4YCNA 1ZRNA 2RAVA 4JB3A 2BDUA 3L8FA 2P27A 5IT0A 5AKEA 3QU4A 3FPSA 5ALTA 1YS9A 2W43A 3FVVA 2HSZA 3WKEA 2C8KA 1EK2A 2FUCA 5AM2A 3IJ5A 3FZQA 1T9ZA 1Z4OA 1RDFA 1RMYA 4BEVA 4UATA 1T5TA 2YMPA 1LTQA 2Q5EA 2NO5A 4GXTA 5AW3A 5AVXA 3N8GA 3ZVNA 4CF4A 2CFSA 3D6JA 3UM9A 3PDWA 3PGVA 1Q92A 2YFYA 1O03A 3ZVLA 4AP9A 1QQ7A 2HOQA 3A1CA 5AM5A 4PNHA 1ZD2P 3UMCA 5AW5A 5ALLA 2GFHA 3ZWDA 3OCWA 3U13A 3OCYA 2CFTA 3ED5A 4NV0A 1L6RA 2OM6A 4HYTA 4B6JA 1XPJA 2C9MA 4KYTA 1PW5A 1S2OA 3N28A 2MSNA 3QU9A 3L7YA 3I76A 5ALRA 4UAVA 5ALWA 1WPGA 4Y2TA 3A3YA 4YIKA 4HGOA 2B1QA 1CR6A 5ALXA 1RKQA 3QLEA 4DWOA 2JAOA 2FI1A 3DAOA 4Y2SA 5AKLA 4I9FA 2Q4TA 2RARA 3EF1A 2ZBDA 1RLTA 3WK8A 2WF9A 2YBDA 4UU0A 4HGPA 4UMVA 1SWWA 1ZS9A 2ZG6A 1WR8A 4JDPA 5AI6A 4Y3UA 3EF0A 3EPRA 5AK4A 1Y8AA 3SLRA 4BKMA 5IS2A 1TJ3A 2AGVA 1TJ5A 4AS2A 3AR8A 3QUCA 4OHFA 4Y2QA 4EENA 2HEGA 3ESRA 3QGMA 3ZVMA 5AM1A 1U2SA 3BWVA 3AR6A 4F72A 3SD7A 2P11A 4XOUA 5IT4A 1NF2A 3GYGA 3FM9A 3IRUA 2GO7A 3QXGA 3WKBA 2X4DA 5AKGA 2G06A 2RBKA 2G80A 1N8NA 4NABA 5AKJA 2G07A 4UU1A 1RKVA 3DNPA 2I34A 3E84A 1O08A 5AKIA 1WVIA 2HO4A 4YGYA 3SKXA 5JJBA 2YJ4A 3WKCA 2BY4A 2GHQA 4C4RA 3L8EA 3DV9A 5ALKA 2HF7A 5ALSA 2DQSA 2FPWA 3WGVA 2B8JA 2OBBA 3L0CA 3RFUA 5AKYA 1QQ5A 3SKYA 1RQLA 3IB6A 2YMMA 1ZD3A 1U2TA 1RMQA 4QQFA 5ALFA 4BEWA 5AKZA 5AIBA 2JAWA 4F71A 5AK6A 4Y2YA 2WF6A 3L8GA 3L1VA 4FYPA 2O2XA 2WF7A 2YJ6A 3J7TA 1Z4PX 3W5BA 3B9BA 2VKQA 4Y2JA 5AHXA 4ZEXA 4EZEA 5AICA 1N9KA 4KNWA 1U7OA 4E88A 2EARA 2YJ3A 2FDRA 3QUQA 2I6XA 2AMYA 5ALIA 4Y2UA 2CN1A 1SU4A 5ALDA 3SF0A 5AK5A 1Z4LA 1Z4QA 4GIBA 3OTQA 5ALHA 3B8EA 3N5KA 2B30A 1QYIA 3U7GA 2D2VA 2HX1A 2YY6A 3WKAA 5AI9A 4Y2PA 3MMZA 3KD3A 2ZBEA 2HF2A 1RC8A 2IOFA 3L5KA 4HAIA 3ET5A 2FPRA 2Q4RA 3K1ZA 4NFLA 2FPSA 4XE5A 3L0YA 2MU1A 2G09A 3ONNA 3SHQA 4UMEA 5ALOA 2YMQA 1F5SA 4DW8A 3L0BA 3M9LA 3L1UA 4RETA 1L7PA 4C4TA 2JARA 3AR5A 3ZX4A 4BX3A 1ZOLA 4FE3A 3QX7A 3UMBA 4CE6A 2PR7A 4EX7A 2EAUA 2WFAA 5AM4A 2IA5A 5E0OA 3QUTA 3ZW7A 4G63A 3WK9A 4MWOA 5AKKA 1Z5UA 1J8DA 4UW9A 2ZBFA 3U7HB 3QU5A 2FPXA 2IYEA 3QYPA 3DDHA 4OD0A 4Y2VA 4BX2A 3ZU6A 5ALNA 4AS3A 3S6JA 3B9RA 1L7OA 5AVSA 5AVUA 2BDEA 2ODAA 4ZEVA 4OFZA 1JUDA 5ALYA 4UMFA 2OYCA 1U7PA 3P96A 3QNMA 1ZD5A 4DCCA 3OCVA 4EX6A 2FPUA 3AR9A 4EEKA 4UARA 4J03A 3HYCA 2YMLA 3E58A 1CQZA 4XQ0A 4BBJA 1TE2A 2R8EA 3ZUPA 5AVYA 1MH9A 3KC2A 5AK3A 2P9JA 2HCFA 4KX5A 4L6AA 3WK5A 1YJ5A 4KNVA 2QYHA 5ALZA 5ALUA 1J97A 4Y2RA 3AR7A 3E81A 4HGNA 2JAUA 4CF5A 2G1AA 3PCTA 4J2TA 3U19A 1Z4KA 3NANA 5AVWA 3KDPA 3W5DA 1VFPA 3PGLA 2P69A 3EWIA 3NIWA 5T41A 3QU2A 5AW1A 4KN8A 1TJ4A 4EELA 1U02A 4DFDA 4NAVA 2EATA 5AVVA 5AVZA 2I54A 1X42A 4BX0A 4G9BA 4YIHA 2B8EA 3RF6A 2I55A 1L8LA 3BA6A 3FGOA 1AQ6A 4UM7A 3N07A 3R4CA 3W5CA
chains in the Genus database with same CATH superfamily
4GQAA 3UHAA 4CU2A 3LRXA 3K70C 2X76A 4IILA 1OKKA 4K87A 2AKAB 2ZTEA 4TXMA 1TTTA 4UNIA 4B4DA 1RXVA 3IR5A 4YP1A 4FT2A 3FMGA 1KTVA 2W6JD 1USGA 4HDKB 1MC8A 1Y8CA 2PQMA 1LLQA 2BISA 1AS3A 3MWDB 2WM8A 3D8NA 1X0VA 2OUIA 1MNAA 2FVXA 1NNLA 1N1GA 1KFEB 3L6UA 4DR7B 2WT4A 4EG0A 3O75A 4RKRA 4EVIA 4HRVA 4ICAA 4XZ3A 1L9KA 1EGQA 2GN9A 2WE7A 3EIEA 2BFNA 3DFMA 3G9XA 1IHDA 4WUVA 5DYIA 5HRCA 3KJGA 4I4CA 2FCAA 1RHRA 4US9A 1NJYA 4L6CA 3H2GA 2WFMA 3B12A 3PENA 5JW6A 3C5FA 4EYKA 1PKEA 2G72A 4P9NA 4DE5A 5ICEA 3GK3A 4RORA 1MJFA 3IVRA 3C5WP 2OCYC 4BE7B 1RG6A 2XZPA 3PHCA 2DQNB 4MUHA 1G66A 3IC5A 3FUXA 1H23A 2WYIA 1Y5NA 3AUSA 1M9NA 4DWVA 2HCTA 2FW1A 4AZ3A 4M0PA 1NOJA 3SC3A 3PJRA 4B3TB 3D6UA 3SVTA 1G2PA 2C3MA 5M29A 1CRXA 1L4HA 4QOIA 3FPHA 5AKEA 3L4SO 4MV1A 4YYZA 5ALTA 7ICVA 2X9LA 4IXWA 1USKA 1T5TA 1KQFA 3WHPA 2ZK7A 3AL0C 4MGZR 1O6CA 3L43A 5EJ6A 1IYZA 4Y7CA 2GUWA 4YUXA 2HFKA 2X1VA 5HTKA 1XAHA 4J1TC 1ZD2P 1H2HA 1KETA 1ADBA 3RK1A 1PO7A 2Z9CA 3RS4A 2YIDA 4XTCS 1IK6A 2AN9A 5BW8A 2ID9A 2NU8A 4FNAA 5JXJA 2QN2A 5T8KC 3VU0A 4HUTA 1BWSA 1NLUA 3PA8A 2O3QA 1J0BA 4HGPA 2XV1A 1Y89A 4DT1B 1ELOA 3TWOA 3FLBA 1EZZA 3CGGA 4ZJZA 1RYHA 4ZRMA 1TJ5A 4D25A 2MSDB 4FONA 2XADA 5F1OA 2MUTA 3D8BA 2I9KA 4BNIA 2ETXA 1XWIA 5HVNA 3AIOA 4J94A 2JVIA 1Z06A 2FMIA 1MP0A 5FV7A 4B73A 2QZSA 3A9RA 3HR7A 4GMGA 5ILOA 2LDXA 5BOMA 5DULA 2W9BB 1EFVA 1TPYA 5JNLA 1M2KA 2H1HA 1Q0HA 1QYXA 2IZ0A 4XUEA 4KIJA 1MKYA 3T5PA 2AN3A 3NIDB 4IDNA 2H4FA 1T1IA 3LIIA 2VCEA 1X86B 4WCFA 5PGMA 4TN5A 1BEZA 3VMMA 2IV7A 4UHJA 1NQUA 3HDTA 3OF5A 3KJHA 3QTTA 3THOA 1U8CB 2JRCA 5K8VA 2GBIA 7YASA 4Q05A 3NV9A 3D3EA 3SMQA 2F9MA 2HHHB 3IXMA 4CMAA 3IUJA 3E9QA 1AO3A 1R00A 2HFJA 1DUIA 1LBEA 1DRWA 3K2EA 1AZLA 5D3QA 4MVJH 1DEOA 1J24A 1GDDA 3IAUA 2E2WA 4E5VA 5I48A 5DLYA 4B6FA 1UBLS 3V9AA 3DDHA 3GB9A 2AT1A 2BMDA 2AVDA 1CKEA 1GA6A 3JRWA 2YHIB 3RFTA 3CISA 1N77A 3ROTA 3TR0A 1D2GA 1R10A 4MCJA 2Q4DA 4LQ4A 3N7TA 4Q1CA 3N2GA 2O7RA 1NXSA 4CF5A 5KREA 1QQBA 1MA7A 2H3HA 5J0SA 1VFPA 3T5DA 4DDUA 4AQ7A 2JHDA 3T54A 2ZITA 1I5OA 1TRHA 3HHPA 4G8CA 1Z1BA 4XH9B 3HKEA 4L72A 3U39A 5IF3A 2H3EA 3VAAA 1J2UA 2A19A 3I23A 5EERA 1SQFA 4PBTA 2ZRCA 1FL9A 4H7JA 1Y9EA 4ACAA 2JIZD 2LKCA 2X2EA 2YQ5A 4IS2A 3RU3A 3CW2A 4TWJA 3QOWA 3FDJA 2XIDA 1NURA 2IJGX 3VAYA 4E5YA 2PS3A 3K1TA 4DXDA 2XCLA 2FF5A 2NVUB 2FDCA 2I1VB 2Q5LA 1ICIA 1NKBA 1FMJA 1QRAA 1B23P 1ZR2A 4ZICA 1CYEA 1LSJA 3O4HA 2E8PA 2P9EA 3AY0A 3VPDA 4M83A 5JLJA 3RTBA 4JP2A 1JQEA 4XUDA 2NN3C 3GN1A 4OQPA 4WUTA 1JAYA 1F0MA 4J0GA 4JUZA 2E8OA 2MSEB 5KTYA 3BSSA 1X6VA 2WV7A 3DCJA 3RODA 2E55A 3FB1A 2CUNA 4UCFA 1XELA 1F4PA 3E70C 1G9TA 3UMGA 3MFYA 4QTZA 5LN1A 4CODB 4TYNA 2YCBA 2JLQA 4PC6A 2O6LA 4RJJA 1R0WA 1LLCA 4K4HA 2CXUA 4QEZA 3WGMA 5C5JA 3SPXA 5IDYA 2X14A 4A8JB 3LVWA 2WTXA 2Y1LA 1ZX1A 1JDPA 3OQ1A 3M9XA 4E5MA 5ED0A 2ZRAA 1KZYC 1G5FA 5BUCA 4IINA 1BCSB 2SBTA 4EB8A 2CFIA 3WRVA 2WSSA 4DN6A 2CVPA 3IEIA 1UPAA 1VOTA 2WABA 1C7EA 3NBAA 1P6QA 4ITUA 3A6GA 2W2LA 3HU1A 4JBNA 2C5LA 1G8SA 3GLHB 3OCYA 3V6LA 5HGXA 4TQSA 2UZ1A 4LHEA 1N25A 2PMZF 3D7MA 3EHDA 3U3OA 4LMBA 1P4GA 4XGRA 4CIBA 3PU6A 1ST3A 2DJ5A 1OROA 4Q24A 1I7SB 1E1DA 4TMFA 3ICEA 1N2JA 3AQEA 3M81A 3UA3A 2XE4A 1XD9A 4BB0A 1SIUA 3VSCA 1Z00B 4J3FA 2Z1MA 4G0VA 5JYBA 4ALKA 3MCWA 3UTDA 2CLEB 1VIMA 1BKDR 2Q6LA 4PINA 2DPHA 1P8AA 3NBMA 3MTEA 2BY4A 4KUEA 2VHJA 4QDXA 3TDMA 4UAWA 1Z6ZA 3ZOKA 1TT5B 4NKRA 4PGXA 4L5JA 4EK9A 4Y2YA 4IIYA 3BWCA 3ZHRA 2HMUA 1TJNA 4WQMA 1NUSA 5B58C 5LSAA 4EZEA 3I6QA 1WUDA 1AS0A 3THXB 4AXBA 4XPIA 1WABA 3VSDA 4AMBA 2OECA 3NNSA 5KWSA 2K4MA 3TZHA 2IH2A 1ES9A 2FZ4A 4E11A 4D5GA 3DZIA 4MGKR 1E1RD 1X70A 2NQ8A 1NIPA 1U9ZA 2WYVA 3UBTA 2MWMA 1MJGA 3V55A 1GN9A 2CZQA 4B87A 1EHIA 3RRZA 1P0CA 2QRLA 4BNKA 3G49A 5JS2A 1PJTA 1AXEA 4V0RA 2FLVA 1N3IA 1KQPA 3EVNA 2CMDA 3LX4A 1M2NA 1D5WA 2ZS9A 2IUSA 1GZUA 2BFCA 3KUUA 5J4KA 1A3CA 1TFUA 1ZZGA 3R3XA 4TSFA 1IFXA 2NPOA 5DB9A 3NBYC 4EEKA 2UUCB 2QUIA 4QDZA 1LDGA 2B2NA 4GUAA 2BEWB 1Z2CA 3ZHCA 1QP4A 4L78A 2V6MA 5E95A 2QUAA 3FTCA 5HG0A 4GR9A 1U8YA 2H07A 1KWKA 3UIEA 1JTFA 5TPZA 2B36A 4W1SA 3B6EA 3R5FA 1CWUA 3T5BA 3U19A 2D1TA 1WXHA 3MGKA 4WZBE 4R66A 2BE7A 1AKRA 3OSPA 3OPVA 1YS2X 1WUKS 4ISCA 4RW0A 1JLLA 2JFOA 2RI0A 1GEEA 5E2BA 1JE1A 4KR2A 4X71A 4F0JA 5AW9A 4EM6A 1I36A 1K7YA 5CYPA 5HIKA 4PVDA 3GL9A 2JCXA 3L3FX 3SCZA 2ZIAA 2TECE 4PC3A 3PC6A 2MTBA 1N2HA 2FKAA 3TNYA 3TEFA 4X1IA 4KE6A 3E7PA 3T5GA 2O8FA 4PVCA 3RVLA 1I5RA 1P72A 3UF0A 3TW0A 1J1ZA 4BGUA 1QOZA 1NLYA 4ZVLA 1EESA 1F2TA 5AI4A 1VHWA 3EWAA 2RI6A 3MSXA 2GERA 2QGFA 1KXJA 1AQIA 4G97A 1L5WA 2VHYA 5JNRA 3FPAA 1IUOA 2AK2A 2PKWA 2FR8C 3C3WA 4R2KA 1F3LA 4LJYA 4UHEA 5K5EA 2VF2A 2PXIA 2OP0A 1Z3CA 2G77B 4QWBA 3JATA 3K9GA 5K8CA 1X8JA 2TMDA 1Q0QA 1BMFD 4S1PA 3HJTA 2R1VB 1TM5E 1IZ8A 4N12A 3GAMA 2ERCA 3OFJA 1UKVY 4FGUA 4RV4A 4F3RA 1UJ6A 4JH0A 4V02A 2DQ4A 2ODPA 4B3IA 2IZ7A 4BZQA 1L5NA 5CEHA 3L82B 1OD6A 5KFAA 4B7CA 2VBCA 2BKAA 4I3FA 5IEJA 3UAGA 3TR5A 3DS8A 4DIDA 3T9BA 1B3RA 3RB6A 3EY9A 4OHYA 2PLRA 3P4YA 1NVMB 4U5QA 3WNCA 3KP1A 5MF6A 2GK6A 2FRXA 2QSUA 1S77D 1CW2B 3R75A 1N9GA 2A5GA 4L50A 3RG2A 4YT8A 2HLHA 5B37A 3ORSA 4YCJA 3LX5A 4RLQA 3V1TC 1NZFA 3R0ZA 3IP5A 5FJIA 2PQ2A 4UQLA 4TTSA 4GUDA 2VKTA 3TLAA 2YR0A 2YICA 1FIQA 2KG5A 4PFQA 4HFRA 4OK3A 1QC5B 4JL8A 1YIAA 3RVBA 1XLWA 4YS6A 3W3AH 2J3LA 1RI1A 1RQGA 5EZYA 1YRAA 1F60A 1MOSA 3EJWA 2E9SA 4L9WA 4LJ7A 3RUDA 2E4AA 3E9YA 4YRMA 1AVTA 4Z86A 4PZ9A 4N5HX 1JKJA 4ZVPA 5LQDA 3R3HA 2OFOA 2QRZA 4BV2A 2Z4RA 3D2BA 3O3CA 2PK3A 3U4MA 4WCVA 2I4NA 1SD2A 3DOEA 5EIFA 2FN3A 1UKBA 3P9PA 2QVCA 4EGCB 1GQ2A 1H94A 1NOKA 4R2JA 4K9QA 4WK4B 3M4XA 2IXBA 4AUEA 5TGZA 3GUVA 1IH8A 1WQ3A 3B7WA 1EINA 3CCFA 3BRQA 2PVPA 1S1MA 3BE4A 1B1CA 3VKHA 1Z3EB 1XDUA 4OJLA 2EKLA 3QVTA 5AJWA 5G3YA 4GR5A 4EZIA 3QHAA 1E7RA 2R5NA 4DW8A 1OBFO 2R79A 3TRJA 2PX2A 3S1AA 4DNXA 2ORVA 1Z5PA 3TLEA 1K3FA 4G63A 3F4BA 5KTTA 1O8CA 2FSIA 2C58A 2UVPB 2ZVQX 5JQGF 2HVIA 5T3UA 3PE4A 4FFVA 4YAJA 2BDEA 3G79A 4IOKA 3RG8A 1I33A 2BCQA 4O8ZA 4ETIA 3ZZNA 4W7IA 1JHYA 2R8RA 3CLUD 2PUAA 2Z2XA 3OOHA 1QHNA 1EVYA 3JVUA 3G2IA 3SAFA 3T5TA 1THMA 1E3MA 5JZVA 3BQTA 3E22A 3GDHA 3N2IA 2XZOA 4RZRA 3FKJA 3K92A 5HRAA 2CJWA 4CEJA 3ZIUA 2BF7A 5JS1A 4WWHA 2ATLA 3BCSA 4PXYA 2CUTA 3PF9A 1GZHB 2W2NA 1SA0A 5CUQA 4EBBA 3UN1A 5C4MA 1BTOA 2WIAA 3ZWQA 5AKXA 2XH8A 3A2LA 4CG1A 4YRCA 5CXUA 1D8TA 2P68A 3OESA 2F1KA 3OPYI 4UAUA 3CS3A 3LG2A 4MUYA 3QG1A 2H1IA 3ND6A 1FFBA 1DPGA 3SHVA 2PSDA 5HMMA 1HC7A 2Q3DA 3GT7A 3MN1A 5TQ0B 5L40A 3WB9A 3P2IA 1NYRA 1R4MA 1WP4A 3MVEA 1PV1A 2CNNA 4HLQB 1DAIA 3A3KA 1M2WA 2YQEA 1Y5MA 3PNMA 4PZAA 4EPXA 4KEAA 1E9FA 4OREX 1MZVA 1CC1S 2XO7A 3T3EA 4GXJA 4JK3A 5LZ7A 2OGZA 1WSAA 1KO4A 3SLGA 1RJDA 3K2QA 4IW3B 4FZMA 4NLLA 4JI4B 1P2GA 3BXGA 1U6JA 2WQ7A 1NP6A 4Q66C 2FMKA 1SXJE 1K1SA 3ANLA 1PGNA 2A35A 2ID8A 2PBRA 3MS7A 5ESDA 2XOEA 3BD9A 4JIMA 3GMSA 4F4KA 2MT9A 3Q3JB 2JCYA 3I01M 5JD6A 3B82A 3TLCA 5CLHA 1W4ZA 3ILSA 5DBBA 5DEOA 4BHTA 4KGVA 1U9LA 3JQ7A 4NHEA 3GLGE 1JIKA 2J3DA 3H1TA 5JXIA 5TEWA 4EHBA 2PUBA 2HV8A 1SCNE 1G8HA 5DE3A 4PG7A 4C7OA 3QE2A 1U9YA 5G5HA 3F8WA 2JL1A 2IDKA 2PT6A 2YVQA 2X6TA 2OHFA 1WB5A 4YALA 4OG2A 5BRAA 4Z3DA 1QM5A 5BWCA 3Q88A 4MEAA 4F2RA 5HEKA 1IG0A 5EIOA 4BLRA 5ALWA 1G59A 2GLXA 2ZE5A 1FYEA 3G6WA 5DNWA 1ZU4A 3GLQA 1QNLA 1E9BA 1SKRA 3IMFA 4KO2S 3HXPA 5JSFA 4NCNA 3DD5A 1OI4A 2GAIA 3FWZA 4EYGA 1OFVA 1X7ZA 3VTFA 2V9ZA 1TYBE 1QFJA 2CLCX 2EWMA 4HT3B 5DHTA 1EH5A 2EW8A 1BDBA 3HNOA 5ER9A 4GGMX 2IIBA 5B1EA 4EJFA 4MFCA 5HA5A 1N6RA 1MAAA 3HCOA 3CU5A 2XT9A 2V8OA 3D81A 2HF8A 4D41A 4BFUA 4Y6OA 1NAIA 2QTAA 2BWJA 4L22A 2FZGA 5KYNA 1GPLA 1G21E 2I0FA 3DZDA 3M9WA 1PGPA 1HO3A 1Y4SA 4B75A 4EI9A 2AI3A 4MW0A 1TM1E 3GT4A 3AO0B 4IWNA 4IGKA 3FKSD 1OZHA 2PZBA 3RB4A 3EXFA 2ACEA 3FNEA 4Q0MA 4ZXFA 3IVXA 4YMMA 3IL2A 4JEUA 1PSZA 3QIAA 2J4DA 4AURA 3CUYA 3DA8A 2BONA 3HV2A 3FDZA 2XCPA 2YWGA 3NUZA 5J2TF 4KHZA 1NBMD 3DYBA 3JARA 3B89A 4OOEA 4ED9A 2DU8A 4YMNA 4Y2VA 3LUCA 4TS4A 5KYWA 1KK0A 3PGXA 1ZAKA 4R4JA 4MF8A 3W8DA 3NTUA 1IM4A 2H7YA 1N2EA 3DP7A 3I34X 4W1RA 1J5XA 2MR5A 3KKAA 2DFVA 3N0XA 1IWPB 1QIHA 4AYBC 4YGXB 4ZT3A 1PEAA 3L18A 1M2OA 4W4TA 3M6WA 5E1DA 4TRNA 4NSNA 1EFRD 4BZXA 2JRZA 2YXDA 3ZE8A 4GEGA 4JGIA 5C3UA 3GRUA 4D8UA 2EFDB 1RVDA 2AW5A 1AUPA 3AN1A 5K8IA 3R4CA 4PYMA 5KVSA 5U9CA 4FO6A 5H3HA 3ZQ6A 9ICTA 4JBYA 1C3OB 3GXOA 1NK5A 4I4TF 3O8OA 5JVDF 2A59A 3F5QA 4L57A 1PZNA 4DLEA 3O91A 3NTQA 1IQUA 1DJQA 3CTPA 4ZALA 5B36A 5JDCC 1VECA 3OZXA 3PXDA 1K1EA 1G1AA 3PGA1 5THXA 4NPHA 4R0VA 3MFQA 1NT2A 4EHFA 1DKUA 1IJBA 2JHGA 2JLVA 1VBMA 1J23A 2VS1A 3SS8A 3KQSA 2A30A 1ZMOA 4DSTA 5CLLA 2VQ3A 3SYLA 5FBLB 2CLKB 3OQVA 3QE0A 3DAFA 2ZOSA 2P5TB 1W85A 3R7NA 4DCVA 1HDOA 4CR6A 1JFFB 2ZB3A 3EQZA 2YJGA 5LB2A 1ZHFA 4W8HA 3F78A 1ZGGA 3DEYX 4WADA 1UODA 1RSZA 1M1YE 3D1VA 1MH1A 4G5SA 3I5MA 4QOEA 2FP4A 3E9MA 3ELWA 2PZLA 4IY1A 3ZW8A 1EMDA 1M74A 2G6BA 2IU6A 1EXMA 3HKBA 4FCTA 2ZBQA 2PMCA 3TOSA 2OXFA 1H0RA 2ZYUX 4JBHA 2UUPA 3NAQA 2REQB 2NO4A 2HDOA 1TVCA 3DBOB 4YVFA 1X9HA 4YCNA 5F3RA 3L1KA 1IL0A 4RFSB 4E6EA 4RIIA 1ISHA 5K3FA 2EBWA 3WLJA 4ATNA 4CF4A 2PIAA 4V1CB 1OREA 3TBFA 1W7AA 2G0TA 5LPNA 2R8BA 1D04A 2AE1A 5KSYA 2C9CA 4MRPA 2G4VA 2CRXA 2Q3BA 4EA8A 1WOMA 5FNVF 1ODTC 1R8XA 2R18A 1T2EA 1P5FA 5JDIA 1N2CA 1IB0A 2R84A 5JXGA 4WZBA 1T9BA 4XRGA 2CB0A 4KRYA 9ICLA 3QFFA 2V98A 1B0PA 2WHYA 3PRYA 2YWFA 2IHUA 1T9KA 4RHTA 3NHYA 2HO5A 2ZS8A 2KZZA 1S89A 2VNSA 1RM0A 3GAAA 4DL2A 2V7QA 2JEFA 3RUCA 4IGAA 2FPPA 3IKTA 5JU6A 3PRHA 4RMGA 1TLTA 2AHOB 1H2WA 4TZTA 1T3NA 2VUTA 4WLEA 3M1AA 2JATA 5IUJC 1AH2A 1R5JA 3V1NA 3AUFA 2ZJ7A 4N6OA 1MIOB 3MUOA 1U7UA 3S2UA 3OJLA 5JCOA 3NTXA 2PI4A 4YCSA 2ZE7A 2UDPA 1PR3A 3HKDB 1Z5VA 5ALDA 4QDOA 4JUDX 1P7ZA 5DCYA 1NC3A 2OPBA 4J9UE 2PRKA 3CY6A 4AW9A 4DCGA 5J2FA 4ZOEA 3H9QA 1SCDA 4B3CA 2FWJA 1KP9A 3AVYA 2ZE6A 1IBKB 4R40A 5LDDC 3DE5X 2BCJQ 3N97B 3ZHBA 4RHYA 1KH1A 4QPDA 3CNLA 3OLYA 3LECA 3A9CA 3OIVA 3U9LA 5EWFA 4ECUA 3K6JA 1TV9A 1E2PA 4ZREA 3PUIA 4OB8A 3FC4A 2KEYA 3AR9A 5CXQA 4ZKEA 1CE8A 3E5HA 1ZISA 3VR6D 4WZAE 4I2FA 3RLIA 3ROQA 4POAA 4X1OA 3X2SA 2R6JA 1YJ5A 4DNOA 1E7WA 2Y0BA 8MHTA 2M6RA 3CV3A 1EP1B 4KMSA 1E2BA 1F2VA 3QXXA 3HUDA 5KJ1A 3ITNA 2PRZA 3CLVA 4K6KA 3M4NA 4X7BA 1KW4A 2PD3A 3SOZA 3AUAA 3JASA 4D9NA 1UF9A 1SXPA 1CZRA 4KMUA 1ZQNA 1SXEA 4HLNA 4PU0A 3BHNA 1NBEA 4NQZA 4J3NA 1BQEA 3PFFA 1SKYE 2F90A 3TQCA 1PGQA 4KQ1A 3BJYA 3GJ7A 2J45A 4XWAA 2AR7A 3I04M 5JQWA 1PJAA 5ETJA 4I19A 4XDYA 1RVV1 3DXFA 5FLKA 1RW4A 1PG2A 3SV4A 4OCZA 4FJ2A 5FL3A 3IPYA 1RWKA 1B6RA 3V1MA 2J0UA 4YMGA 2J6SA 3ZXSA 3GLUA 2KLBA 3ESDA 1JA0A 2Z6AA 5C5IA 1BXGA 1O97C 2VDOB 4DV5B 3L7LA 1ECPA 1NI4B 3JSXA 1YMQA 5JS7A 2GZMA 3LT2A 2WSIA 3Q8LA 1X9GA 3G8CA 4Y1RB 2VHQA 3AP2A 2XCTB 2JKYA 4RTOA 2K6GA 5F9NA 3GPLA 4LKRA 3DKRA 4KI7A 3JQQA 2C22A 2ZWPA 3DLTA 2YJZA 4UFPA 1EK0A 3TOCA 3NS1A 2UZAA 4KLEA 4WY2A 1QHXA 4OTZA 1X15A 2EW2A 2FPKA 4OHOA 3LDAA 5BURA 1N8KA 4G07A 3W9UA 3KKLA 4DYDA 2Y6VA 4EITA 5LQAA 3BM5A 5BSFA 5CB4B 1ENYA 1GXSB 2PLWA 4UBIA 4P53A 1QONA 2GYWA 3BD7A 3DKVA 3WO1A 4KODA 1J8FA 3NVYA 3EA0A 1CRPA 4NCIA 3OT4A 3CJTA 7ICPA 2OORA 3PR4A 4ZVMA 2OBLA 1PNQA 4BVJA 2DHCA 3WRXA 3PSTA 4TZ6A 3FVRA 3OCWA 4Q4HB 4TWBA 4BWFB 1U3DA 2ZAMA 3CZCA 3T3OA 3RR2A 2WJ3A 3RVNA 4CUJA 1Y9JA 4AJLA 4EY3A 3DBLB 1E5TA 2Q5HA 3VX4A 4J0DA 1BG6A 4EZ9A 1NX6A 2WF9A 2P2GA 1OI3A 2YYSA 2Y0SC 3W5VA 2F1JA 2AXQA 1BW9A 3PC2A 2RSLA 3AR8A 1YZ6A 2B6NA 1B43A 4K03A 5ARCA 1JPNA 1NASA 1MQ3A 1UEIA 3OU2A 2N1BA 2CXSA 4C6TA 3AINA 1LKYB 5LMZA 2GASA 4V39A 4B17A 4MPRA 3OEWA 5MN4A 1MQAA 3Q12A 1N6KA 3SC2B 1IZ9A 3NTLA 1MDBA 2CLFB 4MVJG 3L0CA 3OJ0A 3QLJA 4BQQA 1QB7A 4J75A 2DUWA 3GPIA 4GX2A 3AF6A 3ZYZA 2FFBA 3VU1A 2DT8A 3EFBA 3EVFA 4NM1A 3P4UA 1UDCA 3A6EA 2DKNA 2ESEA 5DGDA 1RYSA 1XYGA 2KWIA 1TYCA 5AK5A 4J07A 2A9JA 3UK0A 1LQ2A 1P0FA 1CDDA 4H7FA 1IIBA 4DDWA 1VLZA 1SXJA 1ECWA 3NPMA 3EVGA 4BRSA 4DCTA 5TARA 3M9LA 1V25A 3H3FA 3ZGOA 4QXAA 4XGKA 3VU9B 1B2LA 5JADA 3SV3A 3VC3A 2QORA 1J2RA 5GVSA 2BCRA 3B1XA 2AOWA 1AQYA 2H08A 9LDTA 3CB4A 1Z5ZA 4HXGA 4HFJA 2IV2X 4EG7A 3L77A 3GLGA 3GHHA 1ZI9A 4WH0A 5EIAA 4B9SA 2R68A 1D7OA 1ZA2A 2YZMA 2Q99A 3K5IA 3PQCA 3KUCA 4K2HA 5C7IO 1OAOC 2JGJA 4PPQA 4DEZA 4WHMA 1SBNE 3RM3A 3W34A 5EJFA 4RGVA 1ZW1A 5CIQA 2QAGB 3IXLA 4UVDA 1XF1A 5F7JA 2WPDD 4WJKB 1Y6JA 2CF6A 3FRJA 5IFLA 2Q4BA 4JA0A 2BJWA 4INZA 2GLTA 5E3HA 4ZHSA 2H2FA 3TI0A 1NXQA 3BE6A 4CKEA 3U5ZB 1OGIA 2I2BA 5JAHA 1MB2A 1ICEA 4KAFA 1P7WA 1VLVA 5DTEA 4HDMB 5KHOC 2OAQ1 2P65A 5FHQA 1JLKA 2XVZA 1CUEA 3ZWWA 2FX5A 1XU9A 2PWZA 5EZSA 3OY2A 1ZQPA 5AOVA 4MWGA 6ADHA 2ZIGA 3LI2A 4OHZA 5LMNB 1GA4A 1NVDA 3BS5B 3R7WA 2PFNA 4HQKA 1VBFA 4ERXA 1UDWA 1G21A 3I28A 4DABA 2P0EA 2A0XA 1JDBB 4FINA 1R0YA 3AM9A 3V1UA 1QIMA 3U48A 1AB6A 1XIVA 2VXBA 2JFQA 1R88A 5JCZA 1UEJA 1EUCB 3QEBZ 1XLUA 4RAOA 1SZDA 1A5ZA 2NSDA 5F3XB 2BP7B 1Z0FA 2QXTA 3FPLA 2OXRA 2MIIA 4PAOA 3HA3A 4H77A 1Y1PA 2II6A 1C9JA 6LDHA 5KFHA 1H1LA 2C0CA 2PH1A 3FDSA 4M3NA 4FQ5A 3TZQA 4KXVA 1JDBC 3B2EA 2J33A 2R8ZA 1I10A 1N3LA 3BEOA 5KFFA 4A92A 2QU7A 2P0YA 2BGKA 4G0XA 4OLHA 1SWVA 2C97A 4O4LA 3EZGA 5FWYB 4LYJA 3PW4A 4E46A 3HO8A 3AG6A 3RE1A 3JYLA 4RZIA 1CY7A 1SOUA 4LWQA 1IAQA 4Z3KA 5CMLA 2C83A 4KCGA 2E4UA 2C31A 3T3DA 1MQ8B 1SC6A 5JEDA 3NTOA 2E3TA 1K3UB 2JFPA 3C3MA 4LE2A 3OUTA 2PPLA 3RHTA 1ZQAA 5JT1A 3AY7A 5I5EA 3MJHA 4BWJA 2VJQA 4FP9A 1XZMA 4I4NA 1K6MA 2P6PA 3KTFA 3LUFA 3I9KA 2XOKD 2H1WA 4F3NA 2F55A 3AJEA 1TLLA 3ZY5A 3QLVC 4J0IA 4TTQA 4JB2A 2WZCA 2HEGA 4F93B 3R6GA 1LV7A 5AM1A 3QITA 1VJGA 3PW5A 1CQJA 1W9MA 4ELTA 4NY1A 1MW8X 2J0SA 5HCNA 2C2OA 1PDOA 1F20A 1Q0RA 3E84A 2FMFA 3Q2IA 3CPHA 2NM0A 4EUFA 2NUTA 4PG8A 2ZJ0A 1XMPA 4MIOA 4QUAA 3ZVKA 1UINA 2XYRA 1N5XA 4FBLA 3F9IA 4C07A 4LYEA 3TIFA 1WVMA 4I1YA 1BFDA 1AF4A 4F12A 4FYPA 1GPYA 4FLFA 2ZUVA 3X3HA 3SM3A 2QEQA 1OZFA 3VR4D 4D8WA 2IYQA 1CUYA 4PHEA 3RSGA 4O3MA 5JMPA 1Z07A 1O1YA 3DTVA 4WZ6A 3H65A 1GKLA 2Q0HA 4AO6A 1CR4A 2DKXA 5DX0A 4J1SA 1E3IA 1M1YA 4NFLA 2FPSA 2REOA 3DZFA 2B9VA 1X7WB 1NW5A 1I2AA 1GYPA 3KHHA 1W6UA 1GL7A 3SJUA 4NVRA 2EZTA 5FOWA 2YQ4A 3HJNA 2J9FB 1QHIA 3BSYA 3BQ7A 4IZHA 1NZDA 3ML1A 1I1HA 2XB2A 1I1NA 2TRSB 3M49A 4NDZA 4I5GA 2YV3A 4ZEMA 4EI7A 4MEXA 4CT0A 1N61A 1U0GA 2ZIWA 4N0MA 3P97A 1ZM4A 4AKEA 3O0TA 5K8UA 1U0TA 3KR9A 1P0QA 5L3SB 3T9EA 4K6CA 4HQFA 4INJA 4G4SP 5A4KA 1CZKA 3W04A 4Q43A 2Q6IA 2QW8A 3C1TA 3KC2A 4XM0A 1NBOA 1RZTA 1J97A 2BDTA 1QIDA 1FMFA 1J07A 1T4CB 3LFTA 1A9XA 1ADCA 3SBDA 1D6MA 2H5JA 4W5OA 2BMEA 4TSKA 5J2GA 3NHBA 1B8PA 2LD4A 3EIWA 4BNNA 3DKKA 5KIAA 3IERA 4I5FA 3RT1A 3H8JA 2FG7C 4KW7A 2XE7A 3TS1A 1MPXA 3EY4A 4MI9A 3GGDA 2P66A 3CKLA 5TXGA 5LQMA 4M1SA 1FX0A 2QDKA 4YXFA 2SKCA 2FWAA 2WB1F 3PZBA 1PUXA 2EC5A 3V4RA 2V4UA 3I5YA 4X8OA 2E8NA 3F7TA 4UHBA 1CUWA 5T7BA 4QFDA 3LFUA 5EJ7A 4OMUA 3AKCA 3KHSA 4L4UA 4TL8A 1EE9A 2GLEA 3VM6A 3K05A 2O0MA 2N3ZA 4MNTA 2V9CA 4O5OA 1P2VA 2IKQA 3THYA 5DG8A 2JCSA 2ATEA 1RTKA 1ZOOA 1Y88A 1O95A 2BFMA 1RMTA 2JJYA 2F3QA 2FWRA 1QFYA 5I51A 3TRIA 1W2GA 1CVIA 2FXVA 3L0IB 2WKWA 5IYZA 2PYZA 1T5SA 1E3QA 2CKDA 2ZETA 4TWZA 3I2JA 4KN5A 3HBFA 2ZCUA 4QXRA 1HEUA 3K8QA 1IN6A 1OILA 3I6BA 3AETA 4BNLA 1HE2A 4W7HA 4ZOHC 3WGTA 2BFDA 5IDQA 3A7EA 5AUQA 3WYNA 2I6GA 2VT3A 3ZE9A 4KDRA 1UFQA 3BWEA 3AI2A 4UAYA 2W9MA 3UJ8A 1QTMA 4Y0AA 2VHEA 2FP3A 5U4QA 2PEYA 4AZTA 3O2QB 1H0KA 4W6QA 3A0UA 1KQ3A 1MB3A 1L4FA 4MVJE 1DAOA 1SKUA 3EXHA 4WZAA 3H5AA 1W8IA 1QNFA 2HU7A 1XZHA 1GWNA 3MWGA 2W6CX 3K72B 3IP9A 4MQEA 2PMDA 3P0RA 1ZSVA 1PYOA 1N60A 2P6MA 4XLTA 5AXCA 1FE8A 3PIIA 2J3KA 1P7YA 4YB8A 5DSZA 3B7GA 5KFSA 3KVNA 2CXTA 4GOLD 2VLBA 3GLFA 1BMTA 2H8GA 4TT3D 4DUGA 1WCIB 3FCXA 3HU3A 1ESDA 3RABA 4INOA 2QTNA 2FQQA 5B1SA 5T6MA 1PK7A 4W9NC 4UNQA 3IJEB 2PH3A 3CLTC 1M5RA 4EQZA 1YZFA 1O87A 1VSUA 1VG0B 4ZKDA 2ZIXB 1MNQA 4ZXPA 3BE5A 4UQOA 2GN2A 2NU6B 1ZSNA 3TW8A 1Y8RA 5JZMA 2OV1A 3ZCPA 4TTTS 3UUWA 1RACA 1N5KA 2UXCB 5KL1B 4AX4A 4BO5A 1ODSA 3HCAA 5BV1A 2FFQA 3FTNA 1EXVA 4KQEA 3H0CA 4DL3A 1OXKB 1EWQA 1U0RA 4BO1A 2BR3A 2JC3A 4PY2A 1DP4A 1JWLA 5HE9A 4S1WA 4RV5A 5KYXA 1V4VA 1M1NB 4Z9FA 2AG6A 1ENZA 3CF4G 5T6BA 4CFYA 1T8UA 1RJWA 2C4HA 3B3QA 4YV0A 4LNHA 3SIXA 1NHGA 1EFUA 4CG2A 5CW1A 4NG4A 3W8FA 3DMHA 1LI7A 3AEYA 4GPBA 2IHJA 4LXHA 1Z5UA 3QVOA 3KJEA 2B4RO 4G2NA 1EZ4A 1JHPA 2MYUA 1W34A 4ZDWA 4X3OA 4LZOA 4RA9A 4J9OA 5F4BA 4BMOB 1C0EA 4ZEVA 5ALYA 1FDUA 1LF5A 3GH1A 4JGGA 3GP3A 9ICOA 3FPFA 5ILQA 1YH3A 3HYCA 1EVZA 1FDWA 2CLMB 3YASA 3A6ZA 3C97A 1N62A 2VP6A 4KREA 1H2FA 4I2JA 1NF8A 4RMNA 5ALUA 1HF3A 5EZYF 4Z3OA 2JLYA 2QBYA 5KEIA 4A2PA 4MS3B 1NL3A 4M76B 4RFLA 2X8JB 3QU2A 1R0XA 4Z0NA 3EXIB 4N76A 5B7NA 1ML4A 1RYMA 3RU9A 1XPUA 3W8EA 1V0JA 5J2EA 4JBXA 5FWNA 1T91A 4G1UC 4YAEA 3HSSA 4G0QA 2BZSA 3OVMA 4JVMA 4D97A 5L8VA 1V7PC 2WJZB 4Q1BA 1ECGA 1PJQA 3W77A 3GFGA 1XDZA 1SY7A 5KMGB 4MWSA 5J1TB 2C8JA 4NNOA 2ON6A 1SKQA 4NZZA 4UUMA 4JI3B 4A8JC 2QKQA 1NKVA 1UDBA 2IX3A 3HCCA 1F8UA 3FR8A 1DX6A 1X92A 4KITB 4MCIA 2XUHA 1N8TA 1NJ1A 2F2AB 2WNSA 4FOOA 4RL6A 1RQNA 1JLHA 3HL4A 1LK0A 2I1QA 2CNLA 3RTAA 4I2CA 4M9HA 1WMAA 2BFEA 4UBCA 2FZ5A 3T1QA 2RGNA 4LV6A 4MS4B 1NJ6A 1QHSA 3WLKX 3KTAA 3ADOA 3F5FA 1UXGA 2KFNA 1FYXA 2A1JB 1A9ZA 1DV1A 4MOWA 5LMUB 4EPRA 3VO1A 1DOHA 1TMGE 1C8KA 4RT3A 3MAGA 3U4AA 4PO1A 4NZPA 2QRHA 3O0DA 3QF7A 4HK4A 1ZUNB 3CJRA 1HOXA 2C42A 3I92A 1QLWA 3I45A 3IUEA 4Z6EA 2Y0DA 3G8BA 3OZUA 1IUPA 1K75A 3K73O 4G2TA 2ZVDA 3HVRA 1W2WB 3O47A 5IBRA 5JS6A 3FPSA 4DIUA 1LBTA 4D3XA 2P6UA 4TM7A 5F2EA 5DK4A 1R0SA 3PHBE 5HFAA 5A4MS 1XDWA 5JCPA 4NCAA 1LH0A 1NOIA 2R8OA 2BL4A 1JIIA 3IKLA 3TI7A 3MF4A 3GLSA 1T7PA 2WSBA 4NICA 1JI3A 4KVGA 5A0FA 4LCBA 5DCUA 2C2KA 3NATA 5HBRA 5K8TA 2ONCA 3LSYA 1XKLA 1JIJA 3GLIB 3NC1C 2EIXA 1JYEA 2XRMA 2GXSA 4WBNB 4D79A 4WN3A 3DQQA 1L7DA 2R8HA 2W2KA 2YRFA 1O08A 4Q7EA 2Z2IA 2IX9A 5CDUA 2F7SA 1MUUA 5CDYA 5M7EA 4QQ8A 3AVOA 4M8IA 1OUQA 4LXYA 3ZZTA 4X1YA 4GWLA 4X61A 4CQMA 1PK1B 1K7EB 2ZW9A 1LI4A 3OO0A 4Q19A 4DGQA 2FRDA 2Y66A 2H7VA 3CPSA 4ED0A 4PHAA 3EULA 1KQOA 2HK9A 4GKJB 4PN7A 4RVFA 3EVZA 1H9CA 4AY3A 2GBFA 5J3JA 5GGYA 2FFJA 4C80A 4URXR 2YIMA 3DUWA 2Q5IA 4X7RA 5B1HA 3ZHYA 5FPSA 4RENA 3ZV5A 2GSWA 2BTOA 3HP1A 3RRMA 1K7SN 4QVIA 3I32A 3LP8A 4ENRA 1OF1A 4QSMA 3CW8X 1YUNA 3T7JA 3W1EA 4POOA 3BXHA 4LY9A 4PZYA 4C0HA 1DJOA 3GIDA 4G6ZA 5J40A 4IQFA 1KAMA 3PG5A 4M0UA 3GJSA 3H9EO 1AE1A 1SL0A 4B6GA 4DLLA 3T5HA 2OCIA 1P81A 1ZUHA 1ZP6A 1E3EA 3DBRA 4NM2A 4ZAVA 4WXPA 4YMOA 4Y1EA 1JJFA 3ZWPA 5MN5A 3E48A 3RFCA 3V8QA 4AULA 4UXHA 4YJ2A 4MS1A 3LC2O 3K4HA 5K20A 4HWTA 3CVVA 3O8LA 1SHJA 1XEAA 3SQLA 2I67A 3H4MA 4H35A 3H2YA 4NU0A 2ORWA 1XCOA 1PQWA 4B3HA 3AJDA 1T6ZA 5CEEA 3N76A 3G6YA 1P45A 5CVUA 1XRRA 5GVRA 5E8JA 4BPRA 3CPEA 3DC2A 4KPUA 4Q18A 3BTUA 5HBGA 3UMFA 1LVHA 3R9XB 1SVOA 3NEJA 2WAAA 2H3ZA 3K31A 4XIYA 1SUFA 4GX5A 2E82A 2HPHA 3DE0X 3TFWA 1XVIA 1DQPA 4I36A 4PZUA 3GWGA 1D2CA 2Q8QA 2IL1A 1TK8A 4OMCA 1SVUA 1UBKS 3IP3A 1YB2A 2WUVA 1YASA 5AHWA 2D74A 5AI8A 2Q0QA 1ZXBA 1Z15A 2ADOA 2B2XA 4P1ZA 1TQ6A 3MTBA 1CBUA 1K9SA 4F4HA 1QIJA 2MA1A 1V9CA 2OCDA 2QZZA 4NL9A 1Z88A 2G17A 5GP1A 4J7UA 1L6IA 3DM5A 5JARA 2O52A 1YZVA 4GICA 5EWMA 3RYIA 3PX2A 4QWWA 3IH5A 5FEMA 2VAMA 4B7XA 4QZGA 1HE5A 5CLGA 5FUYA 2CBXA 1AKUA 1Z36A 2KPOA 7ICIA 4KLAA 2GPTA 3S99A 4UDOA 2YZ7A 3H9CA 3QKRB 1NK6A 1IOLA 3EEOA 3A31A 4C01A 2QP3A 2XOXA 3S2SA 4HQ0A 4NDNE 1HBJA 3UWPA 6REQA 2A9RA 3SQOA 3RIXA 2BTEA 1YC5A 3B6IA 5F9FA 1NK4A 2C77A 2J85A 3GP5A 1MQ9A 1L1RA 4NBWA 1KGDA 2CXPA 3D2LA 4TYPA 3JPSA 4QQNA 3QPVA 2JBHA 2J7PD 3T9CA 1Z7WA 5F1YA 5BSUA 2Z8YA 2OHIA 1DWPA 4URFA 1EFTA 3UV7A 2EKZA 1QJ4A 3DDNA 4BGIA 5CYGA 3DGEC 3ETGA 1GLGA 3BDAA 2M1ZA 3H2IA 4UEWA 4LPSA 1WXFA 2IYFA 2DGDA 2VUHB 4LJ8A 2Z98A 4F3YA 4BKMA 1UAAA 4MZDA 3GUHA 4GZ6A 5L9XA 5LDGA 1MAWA 5B3KA 1QH0A 1FRQA 5A1JA 3V32A 5KFXA 1EFKA 1SL2A 3WI7A 1L4NA 1N5IA 3GJQA 4JJIA 3TVTA 2I34A 1FVXA 1A1SA 5EIBD 4JX8A 1UBNA 1R8JA 5ALSA 4BO3A 2OC9A 4QM6A 3EQ9A 1M72A 4DQVA 3SR0A 2WAQF 4J7XA 3DJFA 5IHXA 3F5DA 8ICFA 4DBVO 4AF6A 4R98A 1PUIA 3BXPA 2NUPB 4ECVA 2QNIA 2O8EA 2CN1A 2GF0A 3TM4A 4R9RA 2H0AA 3LIPA 2DHEA 4C43A 3UMSA 1AKWA 3VSEA 1GNSA 2IYAA 4HUQB 1RJFA 1YK1A 4M9RA 2VCYA 2FLKA 3UC9A 2PYDA 3LM8A 4CIAA 4E1BA 3QMMA 3PW7A 3EPGA 4MA4A 4BX3A 2WJYA 1PX0A 3KFUF 3SZMA 4YXWA 2BLNA 3ZG6A 5J5CA 4C0WA 1U4BA 5E7JA 4BGVA 3OD1A 2DGZA 4DGSA 4ETNA 3SIPA 2OBMA 4U2DA 3OZSA 1THZA 5B55A 1IBRA 3JQGB 4BVAA 3GLHE 1T3TA 5J43A 2LYAA 4FBMA 1ID8A 3VZRA 3MJVA 3U56A 5DM60 3DL0A 2EYUA 3HC7A 5D7BA 2HCFA 4UBKA 5CVEA 4MVJA 1WDTA 1U04A 5CHGA 2PMWB 2AB0A 3IV9A 2OCBA 2PQ6A 1ND5A 4Z4IA 4JK1A 4CQLB 1ZVQA 2HBMA 3RH5A 4RGQA 1T0IA 1JN0A 4KXYA 2DBZA 1KEUA 3BXXA 4ARBA 1ND6A 3NHMA 4EAQA 1Z25A 4XUGB 5HQJA 5D87A 4JU9A 4BQEA 3RANA 3I8XA 3E8MA 4X6LA 4UQPA 3VISA 5KNBD 3DBVO 3QBDA 5HFJA 4MV3A 4M6WA 4X60A 3UAWA 2LBOA 2KIVA 5DNDA 3TLGA 4JJZA 1EM6A 4LGCA 3RYCA 3LDGA 3TFSA 5KTMA 4DLPA 2AEEA 3UOGA 1HFJA 3B6MA 3IAM6 4NTZA 1K92A 5AHOA 3SZ3A 3JZFA 3BL5A 3V8RA 2WJWA 3R0XA 4UVIA 1IPEA 1HIWA 2XWBF 2VPIA 1KPIA 4BNHA 1G5TA 3ZGNA 4GBMA 3S2GA 3CF0A 1U8FO 5C80A 2Z3ZA 3ORHA 4WOKA 4PAQA 3UXNA 2GBGA 2BFWA 4NFHA 3KK0A 1I6MA 2XRYA 4X94A 2HWUA 5ADWA 1ZN9A 5E6UB 1ZQFA 1NDUA 4RTJA 3ENZA 4ILEA 3ROEA 4JJ4A 1ADJA 5LBIA 3UJPA 2G3YA 3GDXA 4IOMA 1ZQ1C 4F5ZA 1I7LA 2ODNA 1VCNA 2Z2ZA 1F17A 4O4JB 4L9AA 1YDGA 4WRRA 1GUAA 2EJBA 3H97A 1JG1A 3KWMA 5KYKA 1NPTO 1N5LA 3JZMA 1IC6A 5DBFA 4XWTA 5JIBA 1W0CA 1U0BB 1LK7A 1JPVA 2HXSA 1A9OA 3A1CA 4FXPA 3UMRA 2IYOA 4YAWA 5JO0A 3QOFA 3K16A 2FOIA 1TVKA 1P5JA 1Y6GA 1YB6A 3R0QA 3L6RA 3MJFA 1MOPA 5DHPA 5K0TA 1M7HA 4R6WA 3FGPA 5SICE 2HRCA 1AO0A 4IDBA 2VDJA 3OLVA 3IV7A 3U3MA 2ZBDA 4Z4GA 4CCAA 2H92A 4JT9A 4MVWA 5FD8A 2E4XA 2LPMA 1FSSA 3NVMB 3PQFA 3EPRA 5TPWB 1Z6TA 2Z43A 2APJA 1YBMA 2XWJI 4E1AA 4J9LA 3LTEA 1DUVG 2GAOA 3F67A 1HETA 1N0IA 4R2HA 2WLSA 3GGCA 1T43A 2VF8A 1E3TA 2AZDA 1I7PA 1EX7A 3HN7A 3K1YA 1UBCA 3QVGB 4O4IB 4YN3A 2G9UA 4X84A 4LZZA 2ZE8A 3NFYA 1D2AA 1NSTA 1PP4A 1Y6RA 4U2GA 1ZXIA 1DXQA 1NRXA 2O2CA 2R6FA 2Q3HA 3LVBA 1Z45A 3ETNA 2VAPA 5G0UA 4RUCA 4ARIA 3OURA 4GMXA 2G9ZA 2HA3A 5B6IA 2HMTA 2O8BB 1EVIA 1JQ3A 1GT91 3SF0A 1MN6A 4NYIR 3J80A 3WDKA 2A1IA 3Q0EA 4KUHA 2WWHA 3CT4A 4BNYA 2JH8A 4BRWA 2JFGA 5DZSA 3GEHA 3RH6A 3FUUA 4M38A 4NMLA 3QJ5A 4CI9A 3PEWA 2PLNA 5LLSA 2XB9A 1SK9A 3LDUA 4X1KB 2VDNB 2WFAA 2NZ8A 3QUTA 4NJ8A 5FF9A 4DLVA 2RHFA 1J8DA 4U8GA 1W4CA 2RC5A 2IPNA 4NK5A 3AFHA 1BXRB 1M6WA 3WLAA 3KKPA 4KIWA 4GOKA 4FJ1A 3O2NA 4JHXA 2C4VA 2E0IA 2HQOA 3K5HA 5BSKA 3T0FA 1UA1A 2KSOB 2GF9A 3KOUA 2OXEA 3UXMA 2J07A 2HOIA 1TK5A 1MX3A 2C54A 2AXPA 4AYWA 3WK5A 4OJ6A 3BZWA 5TC4A 4RVSA 3PJGA 1P61B 4K9SA 4R63A 2YWDA 4R1QA 3E5MA 4B32A 1L4LA 4DVJA 5CT4A 1OW3B 1U4SA 1DC7A 4N40A 4QU9A 4DSEA 4G9BA 3UATA 1NVKA 3COSA 1O94A 1PVOA 4EOGA 4UM7A 3HB9A 3A14A 1ZNYA 2VQDA 1KEPA 1U8EA 1UBOS 2GEDA 5B5SA 3MWDA 1E9CA 3L6EA 3GOHA 5TVKA 1P1JA 3WK6A 1ZH0A 3DBIA 4AY4A 1OV4A 4P8RA 1VLBA 3LRTA 5EIXA 3NC0C 5LU9A 1NJZA 1T26A 4NMWA 3KXDA 4YI3A 2NVWA 1HLFA 3RK4A 3BF7A 4URYR 3NHAA 3ZV6A 4H6PA 3DZKA 4BTEA 4JELA 4RABA 1C3EA 2ZBRA 3DYVA 3UQZA 1Q7RA 2NYAA 4RD6A 1RZRD 1UXJA 3GNTA 3G89A 1HM5A 4M0KA 1FDVA 2PNJA 4PWYA 3QEOA 4CCYB 2I2AA 4QWAA 5J4VA 4PL1A 2AYXA 5F78A 3DWGA 1GRRA 3HUUA 5EGSA 3G1WA 1TVMA 2B4YA 2GCPA 1SUWA 1UQUA 3ESQA 2XGOA 5AVRA 2P7HA 4OF4A 2Z6VA 4YPFA 3A6PC 1V1RB 1PK3A 3MPUA 4K9DA 3VC7A 4F8EA 4I14A 1GUDA 2WW8A 3HZZA 4J1TA 4TQAA 1ZM2A 3SQIA 3RJJA 2CNWA 9ATCA 2PT7A 4CMCA 4DIEA 4MV7A 4BBPA 1JIXA 3IB3A 4YRFA 3ZK7A 5AI5A 1M6VB 4ZI2A 1WXQA 1EAYA 1VKHA 3K0FB 5HYVA 1E3WA 3A10A 3CB2A 4HQNA 3PEUA 2JJQA 5BWLA 3RFAA 3HB4X 1UXIA 5T8KA 3QVMA 4RLHA 3SI7A 1ZRNA 5DP2A 3CONA 2NO1A 3AJ9A 4MP8A 3PLRA 4YWJA 2O4UX 4UBLA 3IDQA 5HKKD 4RD1A 1AC5A 1NRJB 2PU7A 1MEEA 3IQFA 4MW1A 3UM9A 3TADC 4W5HA 1UXHA 4IKEA 4PQFA 2PFSA 4O3QA 1EVEA 3ZWMA 2VRWA 2OV8A 2C2RA 1OPXA 2XQVA 1WUHS 1Y7LA 5D2CA 4G0ZA 3V7UA 2DC1A 4KLUA 1ULHA 1B14A 5FT9A 1OW5A 3NP7A 4KPYA 2ISOA 4WLNA 2X77A 5D3MB 2IPMA 4WD3A 4B8ZA 2I1WA 5AQ1A 3DMYA 3RAPR 9ICRA 1HY3A 2ZU6A 3AR6A 2WT9A 3FFTA 1HI9A 2QOEA 3EZ9A 1K0FA 2XNKA 4OYRA 2W9BA 3VVMA 2IIPA 3VPAA 4KU4A 3PD1A 5JLAA 1JR3D 2JJMA 3CUEF 3PDCA 3OT1A 4GBED 2ZRJA 4HNGA 4IDOA 4BLSA 4IFBA 3RFUA 4TLDA 4C89A 5K0LA 3NXSA 3NM4A 4D45A 2C5FA 2MINB 5DH9A 5BR8B 5DW0A 2ZUFA 2Z6QA 1PFYA 3W3AA 2PH5A 2GAJA 1Z2NX 3LCMA 2O2XA 1BFUA 3EIXA 2V7WA 5KG1A 4UB2A 5CAEB 2YXEA 3WSVA 5FWXA 3B6JA 1L3UA 2QSJA 3AWDA 3DTTA 2X1HA 2HCJB 2HF2A 3SZRA 4RZ3A 2A0YA 2P7IA 3CEJA 4O4LF 1DX9A 1HFWA 1J6UA 4NE9A 4GP9A 1YR1A 4HNQA 1M1XB 2JJ1D 1GU1A 2BCEA 1X7DA 4JUFA 4E32A 3F49S 3C1OA 2GXUA 5ENZA 2IS1A 2EP8A 3HY6A 2B0JA 4P5DA 3RGGA 1GUFA 4NZMA 3R5SA 4GRIA 1L5FA 3BIXA 3ON5A 4BKUA 1DFHA 4BMSA 5JHHB 4AX8A 1XQWA 2CDCA 1NFQA 3JQAD 2P5YA 2CJPA 3GQBB 4N48A 1N5OX 1QGED 2AGPA 1BS9A 1YQXA 4FNGA 3ROKA 4BQSA 2PTHA 1C1XB 3CIFA 3L7BA 4G5YA 4HB2A 3NGXA 4B2YA 1AKQA 1R0RE 1OFGA 3UKDA 1E3LA 3NVDA 4Y8VA 3D8HA 4DLUA 3PP8A 4OXNA 3MGAA 2VSFA 2IZOA 4U6PA 2WY2D 4QREA 4WCDA 3SAHA 1KR2A 1CJVC 4E70A 1ZITA 4YCMA 1UBJS 4Z1MA 3X1XA 7MHTA 3CF4A 2C20A 4CMJA 4OXXA 4WL0A 1Y7HA 2O3RA 3E0QA 3FHLA 4C5BA 2WMDA 3RBDA 4JY7A 2ZWOA 1R5OA 1A4IA 5J0QA 3G2JA 3P27A 1YOVB 3FBWA 2YS7A 3VJRA 1X7XA 3LK7A 2BOVA 5C51B 4FX2A 1NJ2A 4BAUA 2Q8PA 2NSJA 4BVFA 2OD7A 2QA5A 1Z4IA 1T5DX 3HKZF 4GH5A 5HQ3A 4FLEA 1FK8A 2QX8A 4N0DA 3PX0A 1KORA 1H4TA 4F86A 3WGZA 3K20A 4ZIRB 5F2OA 2G8LA 3GFSA 4ENQA 2V59A 5BVHB 1KDRA 2Q3JA 2OPHA 3CNHA 5M34A 1WE2A 4A15A 2E1RA 2C57A 3D6TB 2Y9MB 4AT1A 5KJ6A 5CU7A 3AQIA 3ZU4A 1NQ5A 1W25A 3NRBA 1UJ5A 4IHQA 4J9PA 3DXYA 2BMAA 4P81A 3KZXA 1BCSA 4OKNA 3H0EA 3AV0B 3WGYA 4NCBA 2CLIB 1XZDA 3P1JA 3B13B 4RCVA 5J0UA 3SNHA 7ICOA 1T29A 1KI6B 4AG5A 1G7RA 2V3CC 4O2LA 5GV7A 4R2IA 2R6ZA 2X40A 2G1JA 3IN5A 1FUUA 3NLLA 4WA8A 4DVGA 3NBFA 2NPIA 1XNHA 3FAZA 2IHZA 1JKIA 4KC0A 2FFAA 1FJXA 1FRNA 1C29B 3A2MA 3G9QA 5JRTA 1J8YF 1M34B 4BUZA 2YKGA 3KCNA 2XYPA 4LRWA 3V9PA 4GX0A 1BYUA 2RGBA 4WLUA 2FEMA 4U9UA 4Q82A 2EAPA 1AQLA 4DSOA 3DH0A 4FW8A 4L4RA 5KYYB 1EZ1A 2HMXA 1U3UA 2I71A 3PCXA 1E58A 4I2AA 1WXXA 2VA3A 4B6JA 4BBAA 3DCYA 4Q7JB 2VFAA 1SAYA 4YIKA 2C4WA 4TKVB 3RJEA 3FOWA 5FI1B 4AY5A 1L8QA 4MPTA 4HNRA 2YBDA 4TTVA 1EUDB 2XECA 2L19A 4YMVA 3MT9A 1PZHA 4FZ3A 1K6JA 1VE6A 3H0KA 2VUSA 1YQDA 1TU3A 4WFKA 5JWRA 1XEWY 3ESRA 3HX0A 4PAWA 4YMIA 3ROMA 4N9WA 4D42A 3LGXA 4P35A 3R3YA 3S2IA 4JLNA 1TT5A 2XBMA 3FNRA 4UBMA 1W1UA 4ROSA 2ST1A 2C3UA 2QTZA 3HUFA 4ND8A 3LLVA 4HDNB 3THXA 5IYZF 2B7LA 4A5SA 1E5DA 1M73E 1HE1C 5EGNA 4PZDA 4I2EA 2GZDA 4MUKA 2XMZA 4GI3A 1CZLA 1K06A 4MR7B 4X9XA 2QK4A 2BQ3A 3BMNB 1YA4A 1CEZA 2VSOA 4GOJA 4DMFA 1JVNA 9ICGA 1CUGA 4H4EA 4N8EA 2BM1A 3NVKI 1J7JA 1K5OA 2PS1A 5I7WA 1VL8A 2QAGC 4Q39A 4J2OA 5KOJB 1G6KA 4CTKA 3NT5A 1Q19A 2QS9A 2G7MC 4FEGA 1GTVA 5I8WA 3D6FA 1SBHA 2QRMA 1ONPA 1E1MA 4K1XA 3F97A 1O77A 5C37A 1KNXA 2XCRB 4FMCF 4C21A 4I5IA 2IYRA 4DLBA 2C2GA 4E33A 4FHCA 3ZV3A 1VG8A 3CKMA 4ED2A 4YBZA 5LJIA 1SZCA 1UUFA 4HDOB 3LVFO 5L1LA 1XDBA 4RTKA 3RWBA 1YGPA 2L82A 5CG2A 2OMEA 3TL3A 4ZQHA 1ZL0A 4JLVA 3LXRA 3IJRA 3GHYA 4NBLA 1HH4A 621PA 2C28A 4O5AA 2I29A 1AKYA 4QARA 3QH4A 2G5HB 5F52A 1MGOA 4JLAA 1HL7A 5TSDA 2F9FA 2DF4B 4JB8A 3MTDA 1WB4A 2FR8A 2GPWA 4FN5A 3GV7B 4LV5B 1DK3A 2EHJA 4RGBA 1PQ4A 2J30A 3A6JA 3IFSA 5DP1A 4M9LA 3HXMA 2ZROA 3RSCA 4EEZA 1CVLA 2RAFA 1NN1A 5IJ0B 4YV7A 3ZBQA 3FVWA 3C3PA 2A58A 2WF5A 3I04A 4F7WA 2BELA 1UBHS 7ICNA 4YRIA 1GNLA 1RYFA 2R2GA 1N4AA 2EWVA 2HRDA 2GTHA 4HYQA 5FBHA 4QXMA 4Z2YA 5EHXA 4KLRA 1NU8A 1RABA 1Z33A 3M4ZA 3ZNQA 1BWQA 1TEHA 2FE1A 2O7NA 1IEVA 4ZCQA 4Y2XA 1GFIA 1VDZA 3A1VA 2YQZA 3IAAA 2Z83A 4GM0A 1R6UA 2VCHA 1ZJJA 1SBIA 1AMOA 5H3LA 1OX4B 4P4OA 1T9AA 2PV7A 5KT6A 3CZ5A 3EH2A 3PR1A 1MEOA 1M1UA 1N0VC 3AI7A 2I2WA 3Q8WA 1KDYA 2B99A 1JFTA 3DAPA 1PEDA 2C88A 2Z8XA 1M6NA 1TZCA 1HDXA 4Q34A 4NEQA 4GOOD 4A5OA 3OOSA 3I9V6 2E85A 1YS9A 1U90A 4UUBA 3ZIAD 3KV3O 3FZGA 4QO8A 2G5TA 2ILTA 1HSOA 4ER7A 3N9IA 3JAMA 4MYCA 4RK5A 5KVAA 4E5NA 4B2LA 1PR1A 1CUCA 4GXNA 2LIVA 5KI6A 3V7LA 1YQTA 4YI5A 2O0KA 1L6RA 1P31A 4Z99A 1SOAA 5KNCD 1ZBQA 9ABPA 3CURA 1YJXA 4US1R 3TGLA 2G40A 1EUZA 4JP3A 4TWIA 4PQGA 2IK8A 5EWLB 3IG5A 2ORIA 3DZCA 1E2HA 1YK0A 5DEIA 1I7DA 2X9NA 5GONB 4UMVA 2VTBA 3FCAA 2J41A 3R1IA 1OLOA 3EW7A 4IR1A 3B1KA 3INYA 5DWVA 5IC6A 5E6RB 1GZ4A 3PMLA 3EGCA 4F72A 1M67A 2ALZA 2X0EA 5FB3A 1M1ZA 3MR3A 5ILGA 1NK8A 2ZIVB 5FQOA 4KV9A 3DC7A 2B4KA 3UUFA 3JYPA 4QPPA 3PSFA 3V34A 4LHXA 2DQSA 2B8JA 3UKJA 4X44A 5CPBA 5JZSA 3TCXB 3ASVA 5B7PA 2IHYA 3O9MA 4XWKA 2BF4A 1FFVA 9ICAA 4DQ0A 3B1WA 5KPJA 3T12A 5HX7A 1DFIA 1DBSA 5CRXA 2VSQA 4XWWA 1RZVA 1YKGA 3LJKA 5LZ9A 4GIBA 2EDUA 1VG9B 4HLDA 4RXMA 3SR6A 3GPCA 2R0QC 3WL4A 4ARUA 3ETJA 3DVLA 4KXNA 3FLEA 3O8RA 5CB6A 1BRMA 2MCFA 1RIFA 4ZC1A 2UVPA 1VJDA 1N3BA 4RY2A 2R00C 2W00A 3C3YA 1HRKA 4PZNA 2E4YA 4NJOA 1TCVA 1YB1A 3EVEA 1DKOA 3DOFA 4R31A 1FDIA 4DC0A 2WFLA 5JNTA 5LL6P 4M55A 4JENA 1YR2A 2W6ZA 4HN4B 5L9AA 1EX1A 1LJUA 5G0SA 1JSRA 3IHKA 4EVQA 2DKFA 3V3TA 3HS3A 2JCGA 5H9WA 1B6TA 1B41A 3EF3A 4D9MA 2J7KA 4XDGA 3RJKA 2XZTA 4F2DA 1HE8B 2AU0A 5FTMA 1VXRA 2DCUA 2PI5A 4XCXA 1QBGA 2E89A 2FETA 4KFTA 3FB4A 4DA9A 5I9TA 3A27A 4E14A 3SI8A 3E23A 3LUKA 4YIHA 2B8EA 4DJAA 2GAAA 2BFBB 3AHJA 4BIMA 3O8QA 1QRUA 1DC3A 1AN0A 4TV8A 1S5PA 3BXEA 1YIOA 3C8ZA 4B9LA 4V0KA 1X40A 3LGSA 5LZ2A 3GY0A 1PV2A 4NNPA 2Q45A 3FYTA 5TQ0A 3OFVA 1Q7BA 4W8OA 4DM7A 3C29A 1ZI6A 2I5HA 1ZD4A 4TROA 4J9KA 1FEZA 4WT7A 1S4QA 1V45E 3MD9A 3ZH2A 3WAJA 3UYLA 1K88A 2Y71A 4BKPA 4TZ0A 4A0RA 2BI7A 4C0LA 2WTAA 1QG2A 3EC1A 3ICPA 3DEEA 4J9RA 4NZOA 3C2KA 1MAVA 1AX9A 4MINA 1ZVKA 2M32A 3SVZA 3AESB 1PLLA 3OG9A 4RK0A 4N03A 1IQPA 3UCEA 5DLFA 1T5HX 2WFZA 4ZYWA 3KJNA 5D5HA 3NWPA 5J2JA 1ZR4A 5FP0A 4ZZ1A 5HHTA 5K01A 4LC0A 3PEEA 3KQLA 2FUEA 3MAAC 3WLTA 1BQ3A 9ICFA 4C20A 2CL6X 4RZQA 1Z0IA 1KBZA 4EUKA 3PUJA 5FYDA 1K86A 1YO6A 1UKZA 2X0FA 4FFNA 1XMQB 2ZWMA 4PNEA 2O5RA 1TKAA 2C8KA 1W44A 4YJ2F 3FZQA 1VIVA 4UATA 3KDSE 1DE0A 4QSHA 3PX4A 3AMVA 1VE9A 3ER9A 4G4JA 1P2FA 4DO9A 2NZ2A 4L4YA 1V4BA 2XGGA 2E49A 3OFND 4Z9AA 3BA1A 2VNAA 1TUEA 2G63A 1ZUIA 3SX0A 1SBYA 4LNUB 3VR5H 1Z1VA 4D9CA 5EQDA 1LS6A 2KIWA 4WN9A 1ZFNA 4IQ4A 2ZTLA 5JMTA 1GSIA 3GJTA 5EMLA 5DHAA 1GZSA 5TV2A 3ISDA 3A1FA 2C5BA 4R64A 1PG0A 2YUTA 2R6R1 3KOZA 4IRUB 3H5WA 3A70A 3ND5A 5KVVA 3EXEB 4YMSA 3CLRD 1YT5A 1AD2A 4IDEA 4ZU6X 5FAXA 3R40A 2VHTA 2Q9AA 2V97A 3RJIA 3TZ6A 5ABPA 2PJZA 4H6XA 3OQ6A 5TE9A 2BGTA 3R7SA 3OE7D 4DDMA 1WXIA 3M8KA 3H1EA 2GO7A 5H1YA 1H05A 1G64A 4S35A 3SNKA 1UT8A 4ZVQA 3RNOA 4MJ7A 5DG7A 2LZ0A 4V0QA 5JD3A 1T15A 3H8VA 1CQPA 4F4XA 1EQUA 1AHHA 4HX9A 3U61B 3MGHA 1FF9A 2H0QA 2X8AA 4BCBA 1TX4B 4UPEA 3BD6A 1D6SA 3C48A 2JAWA 1A9TA 3W7AA 2YFKA 3LU1A 4MWTA 3BJMA 1BWRA 3E1SA 2W3SA 3EX7C 5KNIA 2WU1A 1ISFA 2F3NA 2Q27A 4US2R 4BP9A 3MGVA 1QPGA 3VO8A 1CNEA 5CBKA 3B8HA 1OBCA 1A72A 1JIHA 4YR0A 4E4YA 2MMGA 2J5RA 4PX3A 5ALOA 1JFSA 2YX1A 5BSVA 4QTUB 1GPMA 1ZGJA 4CLOA 1ISRA 2JI6A 2WG0A 1JAZA 4L0QA 3EHEA 5IASA 2XYVA 4FWBA 4XIGS 1VE3A 3UFXB 1CY4A 1FP1D 3R5JA 5LIPA 3QLTA 4ZVRA 1VBNA 3AJRA 2X2OA 1CZHA 3X2FA 5I47A 5KFDA 1ZWLA 3U4HA 3DV2A 2DAPA 2PL1A 1R0ZA 1ZJ4A 3UJNA 4LYHA 5KJCA 4RPJA 2W8BB 5JDCA 2KHZA 1Y4UA 3E6AA 3NVAA 3NTVA 3RV4A 1U0LA 3E2PA 3GFVA 4KQFA 4FB4A 3ZY3A 4ZVUA 4ZYUA 2H3VA 4LZWA 1KI2A 4MKHA 3GDOA 3V80A 4AMUA 1HT2E 1W9HA 3N8DA 2PS0A 1W5AA 1D8AA 3GJYA 4BLQA 2P2CA 4F06A 1IMOA 1FBNA 4P83A 5C8ZA 4C05A 2CXNA 4LVCA 2BAGA 3G8YA 3WIOA 2B7CA 4ZCTA 4M21A 2QNRA 2KJ8A 1XROA 1Z37A 4MRMB 2EERA 3HFGA 2C2BA 4EHJA 5KFEA 1V97A 2Y8EA 1TD9A 1YZGA 1KDVA 1E1CB 1JFFA 4QVKA 4BNJA 2ASVA 2VP2A 4A8PA 2YN4A 2MAXA 4G0OA 3OU6A 5AR1A 5KT2A 4EHIA 2HGSA 1DQZA 4FZLA 5IIMA 3EVCA 3ZEAA 1GV1A 4PLVA 4MJLA 4F1JA 3VKFA 1FFUA 5ALEA 3HVJA 4I55A 4MDFA 5ALPA 1E6UA 1C8BA 1QH9A 4J4HA 4YRTA 4JP5A 3MS2A 5FWDA 1XRQA 3X2EA 3ZTTA 1U9CA 1JMSA 3COWA 3G13A 1W581 3OX1A 4DA0A 4MDEA 3ZQ4A 1TW3A 3FCCA 4MVJF 4V1CA 1X9XA 5IT0A 2Q5CA 5E4JA 2HPAA 2Z56A 1E6CA 1L7QA 1D5CA 4U6SA 3WYAA 2R11A 3CLHA 3C6KA 2OKGA 3RPEA 2OFFA 2NT4A 1C30B 4QC2A 4RPHA 2R4UA 1L4KA 521PA 3GRKA 2R47A 5TT0A 3CO0S 4R84A 2OM6A 1Y3AA 5BWOA 5C8DA 2H1FA 4P7KA 4F4IA 1GNVA 1N2XA 3HRKA 3OZRA 1XTUA 3VJMA 3GAZA 2O1EA 4F97A 3BZUA 4FR0A 3ZHVA 5FBZA 3LMKA 3EGEA 4BVLA 3WLFA 2Q2OA 3CX3A 1Z2EA 2LR0A 3R2JA 1UJ2A 5CHEA 3G0DA 4DFJA 2QL9A 4PPNA 4M87A 2IBSA 3CHYA 5C31A 4YR9A 5JPIA 3AK4A 3M6LA 2WVAA 3H3XA 1JBQA 4CU5A 1DC4A 3AZQA 3IIEA 4RH1A 1TO1E 1A2BA 3PSIA 3TE7A 1EDBA 2FPWA 2HT1A 3NEAA 5KOHA 1GILA 4CDNA 3ENNA 4IVPA 3RTDA 2VTVA 3SQXA 3T1TA 5IZCC 3HKDA 3MB8A 4KTTE 1RXSA 4KO1S 3FPKA 2RBEA 4AJHA 3J7TA 4D0SA 1OB2A 2O5VA 5F35A 1WO8A 2ZRGA 4D8YA 1N7GA 1NNUA 1S8AA 1GGNA 1ZQZA 4I29A 4JNCA 1HL3A 2YHAA 3ND8A 4IF4A 5KVQA 3CZAA 4ARAA 3RRBA 3K8OE 1K4KA 4RKEA 4DFKA 3KQTA 2B21A 1GRVA 3ZQUA 2C9OA 2VSYA 3L0YA 5GIOE 4R2MA 3J7AC 2B69A 1V7ZA 1KS2A 1OH5A 1N1EA 1QWOA 3W9YA 1CUUA 2VL7A 1PS8A 3U5TA 4FEYA 3VPXA 3MT0A 1S0VA 3HI4A 3E03A 3TAHA 3O74A 4EBCA 1V16A 4I2DA 5TRTA 2XUKA 4C3OB 3DOUA 3WYGA 2EG5A 2PTGA 4EX6A 3C7AA 4KGZA 2D5LA 1G42A 3KFVA 1VHTA 2CXYA 1WKVA 1GSAA 2OK7A 4LAFA 5DX1A 4EA6A 2A9FA 2M2IA 3BH0A 3G17A 3DEZA 1KSJA 3PXCX 3TB6A 3GT3A 3LPAA 4M0DA 3OPQA 3NT2A 3DAGA 3HYRA 3H6HA 3PHGA 4NBTA 5JZ9A 1VA4A 2AFVA 4UCWA 3T0IA 4COOA 2W6NA 4QWMA 3PRKE 2PA3A 4D9KA 4PS0A 3ZWAA 3GI1A 4JVNA 4DJ5X 2QNBA 2ZRKA 1XKQA 4PR0A 3PQ7A 3GYBA 3BC1A 4ODIA 1SB3C 4O3PA 4LC9A 2YNMC 5T64A 5FR1A 1SOMA 3QKSB 4O9MA 4ZQFA 4HD8A 4ZI5A 3KQHA 4ID3A 4IC9A 3EH1A 3STHA 3KZCA 1YBHA 5DDMA 4Z6KA 1EDOA 2ZJFA 4O5KA 3NIFB 2QTHA 4Y1RA 1TCBA 2A0UA 2ZVJA 1IBMB 3N53A 2JIDA 1WB6A 2EG9A 5E2IA 4M99A 4KX3A 2HWXA 4NESA 3I8OA 2ZWAA 5JSHA 3F73A 3PO4A 1YMVA 2ODQA 3S70A 1KVSA 2Q21A 4M88A 1NVVR 1OFHA 1EFAA 1FTQA 2HCRA 4C2UA 1Q91A 4XM2A 3EE6A 2JDID 1RYUA 2VDKB 1GXSA 3DHNA 4WJZA 4A1OA 5SYMA 4Y6SA 1D0SA 4BFYA 3G9UA 1E4OA 4NH0A 1WB9A 1X3LA 3NUGA 3DLBA 3PCRB 4ANFA 1YQGA 1FB5A 3H5TA 1QVZA 1JEOA 4L0CA 1WRBA 1ZM7A 4O2AB 2MOKA 1JMYA 3AFNA 2VNJA 3O73A 2O06A 3QVVA 5E8RA 1XQVA 4WFJA 3P9YA 3E7WA 2OXCA 5A7HA 1SKBA 4GU5A 2EX0A 3E3AA 2AQIA 4AP5A 1JXAA 1W5BA 1J09A 5DJ5A 4GF5A 4J9QA 2Q0SA 1DK2A 4H4DA 4FMBB 2ZPTX 3N2YA 2V6IA 4MULA 4OA5A 5BSWA 1FFYA 1PRYA 2B4TO 1LKYA 3KKOA 3JY6A 3NOQA 2IU3A 4HV4A 2JXJA 2FWIA 1V8BA 3MMSA 2QN3A 4GDMA 2XSZD 5JFTA 3FETA 2ISSD 4E03A 3QOXA 3D3NA 3ZCXA 3Q0TA 1T8WA 3TD9A 3AF0A 2L69A 1WKBA 1QP0A 4IGIA 4AJNA 1KEEA 2R1TB 4CCSA 2IIVA 4D96A 3GV8B 4NOLA 2YJ6A 2XX3A 3D5QA 2KP7A 4G86A 4EPTA 3C1AA 1B00A 2WIKA 4PFJA 4N7RA 2CK3D 3T3NA 2CVQA 2X6QA 3AU6A 4BKOA 8ICHA 1JVBA 1E6EA 3QI2A 2VJ4A 5DSXA 4RL4A 3FUTA 4ACOA 8ICGA 1FPMA 3V8VA 5EUCA 2H7XA 3DMNA 1TW2A 3IBTA 4MW5A 1DAFA 1OAOA 2G04A 1YDHA 4D46A 4QPCA 2Q3CA 4DG5A 5CFOA 4B2PA 1F0PA 4ZAWA 3N39C 3AXSA 4UNPA 3HCFA 2WYOA 2WWWA 3ADKA 1GG9A 2Q7XA 2H1VA 1X6IA 2V0NA 3FPEA 2QRQA 4GZ3A 3DF9A 3LUJA 5IFKA 2O14A 4RPIA 3GUCA 3HA7A 1Q1AA 1G3RA 4ZCPA 3K5WA 4IIJB 2QR2A 3O31A 3OHMA 1ONBA 5KFPA 3M6AA 3OZGA 2YS6A 4CL8A 3AEVA 1GVNB 2PGJA 3IEPA 1W2HA 3QNMA 5M2QA 3P2EA 1U99A 2NXEA 2JVJA 2O2SA 4AUMA 2P1ZA 2YRWA 5EFZA 3PPIA 4BLTA 2NV3A 1TO6A 2W70A 3I5XA 4CM9D 1AZWA 3EIUA 4KO3S 4AJJA 4CXMA 3O03A 4MLPA 1WULS 1D1SA 4J9SA 4XB6B 4M1KA 2XXAB 2QW0X 3GLIE 4DMLA 5TS2A 1E66A 1A9PA 1GL6A 2ZFUA 2I62A 2QM8A 1DKLA 3PNYA 4DA6A 5E4TA 4GMFA 2PT9A 3KT8A 4JLSA 4CF7A 2GVNA 5GQSA 4P7JA 3HLTA 4MKXA 2Y1CA 3NKVA 1CDZA 1MABB 1PJ8A 3DBHA 4HAUA 1YZTA 1L7VC 3FPBA 5CTJA 1MEJA 4YJGA 3BS5A 2O54A 4RGYA 1W0JD 4HEHA 1GPH1 1WD5A 1KK1A 1WMSA 1LV8A 2JGAA 1YR9A 1PHRA 1YJAA 2DSTA 3IUYA 1DVRA 3M5WA 3U09A 4FYMA 4IRDA 5IT5A 4DM4A 3OT5A 1H4QA 1I6LA 3BREA 3FDIA 1GOTA 1PK9A 3N7SC 1BKYA 3L4KA 3EYAA 1W59A 1M8GA 1PT9A 2V45A 5GOTA 3V7NA 1DAPA 1OHHA 2KSQA 4G4GA 2C0PA 2DWCA 1Z9BA 5INTA 1FC0A 1VPEA 3GCDA 3LUHA 3ORFA 1ESNA 2IWHA 2YN2A 2DZDA 3F5SA 4I6GA 4WVFA 3QNUA 1N8SA 1XV5A 5DTQA 3E2MA 5IG2A 3BZBA 4EKYA 1KK3A 3PHHA 1J21A 4IHJB 1SKAA 4LBYA 2FPMA 3DJYA 1YULA 2EIHA 3BERA 4ZAFA 3HJUA 3B38A 2I4TA 4K3VA 4QWDA 1MX1A 1W35A 4JI6B 4EF6A 3O95A 3EPLA 4YP5A 5ECGC 1ECBA 4J0EA 1RNLA 1LCIA 2HBZA 2H51A 2Y05A 5DK6A 1QCDA 4RQAA 4EVSA 3QLVA 4N3CA 5FLEX 3IUBA 2BGGA 2C7BA 1Z6PA 1NZBA 2HXYA 1OZAA 3K9QO 1FW8A 1EFPB 4TV9B 5KU7A 2XQGA 1EE1A 5KTOA 2CMKA 3B60A 4Q37A 3OZAA 3F7NA 4JJAA 2NYRA 4YN4A 1KZ9A 1VPWA 4KQ9A 2RGRA 5IJZA 1TAMA 1ZESA 3E8XA 4RZ2A 1XRLA 4HZIA 2C2DA 1XVVA 6NULA 2I6TA 4EIWA 4DMGA 5TMPA 5BQXA 3SR3A 4TVOA 1YB5A 5EMNA 3DMRA 1XL1A 3A4VA 1RWBA 3C3XA 3IVMA 3AFGA 3TI9A 1ZHHA 1GP2A 4QOSA 3WO0A 4PXAA 4FC6A 5AJTA 3F71A 4IO0A 5GINE 3THWB 5B2ZA 3TSCA 4UU7A 5DN6D 4N18A 2HMWA 1N57A 4OHWA 2D2IA 1UL1X 3IRVA 1K97A 3ELYA 4OJTA 2CZGA 1K5DA 1VPTA