4CF5A

Mutagenesis of a rhodobacteraceae l-haloacid dehalogenase
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
223
structure length
222
Chain Sequence
b'SGILVFVNETLLDLTSLSPLFERVFGDAKVLREWFPELILYSQTLTLTGLYRPFGEIAAAVFEMVAANHQAKVTPDDIAELKTRLTSMPAYPDVAPALTRLQDAGFRLVTLTNSAPSPAPSPLEKAGIASFFEAHLTVHSSQRFKPHPSVYDSTAETLGAKPEELCMIACHIWNTIGAQARGWRGGFVARPHNTPLTLAEVPQPDFIGRDMGELADQLIASL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-HALOACID DEHALOGENASE
publication title Mutagenesis of a Rhodobacteraceae L-Haloacid Dehalogenase
rcsb
source organism Rhodobacteraceae
molecule tags Hydrolase
total genus 86
structure length 222
sequence length 223
chains with identical sequence B, C, D
ec nomenclature ec 3.8.1.2: (S)-2-haloacid dehalogenase.
pdb deposition date 2013-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 4cf5A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4cf5A01
2HEGA 4EEKA 2X4DA 3UMGA 2Q4TA 2FPSA 3L7YA 1Z4NA 3BWVA 3N8GA 2GHQA 5T41A 2FDRA 1Z4MA 2O2XA 4UU0A 3MPOA 2HI0A 1Z5GA 2B1QA 4I9GA 3S6JA 3PGLA 3FM9A 2HF2A 5AM3A 4O8CA 5AVRA 3B8EA 1RKVA 1FEZA 4XE5A 1RRCA 1S2OA 1U2SA 2G0AA 2R8EA 5ALKA 4J03A 1QYIA 4ZEVA 2NO4A 1Q91A 1YDFA 2BDEA 5AVWA 1RKQA 4IG4A 1TA0A 1ZD5A 4BX0A 5AM4A 1RLMA 5AHXA 1YNSA 2YJ3A 2I34A 2VKQA 4YCMA 4EZEA 4HAIA 1CQZA 1YS9A 5AW8A 4H1WA 3KOOA 2I55A 5E0OA 5AI8A 4KNWA 4Y2RA 2QYHA 3HYCA 1Y8AA 4XOUA 2CFTA 1RC8A 2ZXEA 4OHFA 5ALYA 3FPSA 4KYTA 4EELA 2GFHA 1NF2A 1WVIA 2WF9A 1EK1A 4EX6A 3QX7A 5ALLA 1QQ5A 5AK6A 3WK9A 4UMFA 2B30A 3A1CA 1Z5UA 1O08A 4BYGA 1X42A 5A3RA 4F72A 2G09A 2RARA 3VAYA 1RDFA 1ZRMA 1N9KA 2OM6A 1J8DA 2C8LA 3L8EA 1QQ7A 3B9BA 3OCVA 1ZD3A 4Y2TA 3IJ5A 1JUDA 5AW3A 2FUEA 5AVUA 4OFZA 5AM2A 3EF0A 2B82A 5ALDA 1Z4KA 4MWOA 2YJ6A 2ZBDA 4G9BA 4GIBA 3B9RA 1T5TA 3W5BA 2B8JA 2YMPA 3AR3A 4UASA 3NIWA 2WHEA 4KN8A 2HHLA 2C88A 1RKUA 1U7OA 4AS2A 4DW8A 4UAUA 3L0YA 1EK2A 3U7HB 3WK8A 2JAWA 4UW9A 5AVZA 2ZBFA 3I6BA 4UARA 5ALHA 2HOQA 5AVSA 4F71A 1U02A 2HCFA 3EPRA 5ALMA 3N1UA 3L8HA 2BDUA 1NRWA 4UMVA 2YJ5A 1Z4QA 3A1DA 3ET4A 2B1RA 2JARA 4GXTA 3CNHA 1ZJJA 4CF4A 2AH5A 3MN1A 1Z88A 4JB3A 5AICA 5ALRA 2CFSA 3EWIA 5AVTA 3QLEA 3L8GA 1QQ6A 5AW9A 1F5SA 4L6CA 3AR2A 4G63A 3KZXA 4NWIA 3KDPA 2MU2A 2R8YA 1KYTA 1SWVA 3ZTWA 3WKBA 3E84A 1Q92A 3DAOA 5ALZA 3UM9A 3PGVA 4Y2SA 3A1EA 2ZBEA 5AI6A 3L5KA 2AUTA 3L0BA 4KNVA 1Z4LA 2P69A 2HO4A 5AIAA 3D6JA 1RPZA 3WK4A 5A3SA 3OCUA 4NABA 2AMYA 2AGVA 3J7TA 3ESQA 4FYPA 3FVVA 1YJ5A 2YJ4A 5AVVA 3OCWA 3U19A 2MU1A 3EF1A 1MH9A 4Y2VA 3OPXA 3E8MA 5ALNA 1AQ6A 3WK5A 3R09A 3ZTYA 5AKXA 3MC1A 2G07A 3HLTA 3U7EB 2ZOSA 3WGVA 1XP5A 4IFTA 2G08A 2HX1A 3I1YA 5AI9A 2FPXA 4QQFA 3AR9A 3N28A 3CZ4A 5AKHA 3AR4A 1NNLA 2DQSA 3MMZA 2B8EA 2FEAA 4OD0A 2C8KA 4DCCA 4JDPA 5AESA 3QUBA 4NAVA 4E88A 4YGYA 4PNHA 3OCYA 3P96A 5AVXA 1U7PA 3DNPA 3RF6A 4L6AA 3R4CA 1T5SA 5IS2A 2G06A 2ZBGA 3L0CA 1RLTA 3SF0A 1ZS9A 2YBDA 5AW6A 4Y2UA 4C4RA 3UMCA 1L6RA 4I9FA 3QU7A 4KX3A 1ZD2P 3NAMA 5AIBA 5AM0A 5IT0A 3ZX4A 5ALUA 2WM8A 5AKJA 1Z4PX 1ZD4A 2WF6A 5AVQA 5AW2A 2YN4A 2HSZA 1TE2A 1ZRNA 2YFYA 3WKAA 3ZVLA 4Y2YA 1ZOLA 3QU4A 4UM5A 1S8OA 2JAOA 4L57A 1VJ5A 4KX5A 3QUTA 5AW7A 2OA0A 1TJ5A 4BNDA 5A3QA 3R9KA 3OTQA 1L7MA 5AKKA 2GO7A 3FZQA 5AW1A 2W43A 2C9MA 5AW0A 2W11A 4HGNA 2IOHA 3KBBA 4AP9A 3W5AA 1SU4A 4HGQA 3GYGA 2Q4RA 5ALPA 2JAUA 3ZI4A 3F9RA 5AVYA 5AK5A 4RETA 1QH9A 2BY4A 2YY6A 4ZEXA 2HDOA 4B6JA 3E81A 4XPZA 5AKZA 4HGRA 2IA5A 4NFLA 3AR5A 3M9LA 1VJRA 2EATA 4MUMA 4FFDA 3K1ZA 5ALJA 3NASA 3ZWDA 5JJBA 1L7PA 4YIKA 3OCXA 2RB5A 3U13A 5ALIA 2D2VA 3SMVA 1Z4JA 2B0CA 3I76A 2EAUA 2FPRA 4UMEA 2ODAA 5IT4A 5AW5A 1RMQA 5AM1A 4Y2JA 5ALXA 1PW5A 2FPWA 4UAVA 3BA6A 3W5CA 3WK6A 3NALA 3ZX5A 1O03A 2I54A 1L8LA 4UMDA 2CFRA 4C4SA 2I7DA 2W4MA 2WF5A 3IRUA 2OBBA 3QGMA 5ALSA 1WZCA 4NV0A 2CN1A 3SLRA 3QU5A 3SD7A 3M1YA 4YH1A 3QNMA 1TJ4A 3NUQA 4BNDB 2RAVA 3N5KA 3WGUA 2P27A 3RFUA 1XVIA 1RLOA 2RBKA 3FPBA 4YIHA 4XQ0A 3UMBA 2MSNA 5AKGA 3PCTA 5AKEA 1N8NA 2EARA 5ALEA 2WF8A 3QU9A 3ZU6A 3L1UA 4UATA 2PQ0A 3AR6A 4YCNA 3W5DA 2WFAA 4HGPA 4Y2QA 2R8XA 3I28A 3ESRA 1RQNA 2P9JA 3SHQA 1IWOA 3ZVNA 3QYPA 4CE6A 4OCZA 4Y2XA 3SKXA 2JGAA 4FE3A 2FI1A 4HYTA 3NANA 1XPJA 3A3YA 1L8OA 4ZEWA 5ALFA 4YCLA 2I6XA 4BEWA 3U7GA 2FUCA 3L8FA 2IYEA 5ALTA 4HGOA 4DWOA 3N07A 1L7NA 4BBJA 2QLTA 3KC2A 4RESA 3WKCA 1T9ZA 4J2TA 3ONNA 2PKEA 5ALGA 4CF5A 3ZW7A 4BX3A 2ZG6A 3QU2A 1YV9A 5AK4A 3U26A 1TJ3A 4CNQA 2R8ZA 5ALQA 4Y3UA 3ZVMA 1L7OA 5AKIA 1WR8A 2FPUA 3FGOA 1LVHA 5AM5A 3OCZA 3U7FB 4UM7A 1WPGA 4Y2PA 2NO5A 1U2TA 2HF7A 3WKEA 2I33A 1YMQA 4UU1A 2Q5EA 3AR8A 3SKYA 4BKMA 4C4TA 3KD3A 4DFDA 2NYVA 2WF7A 5AI4A 3L1VA 4BEVA 3ZWKA 3QUCA 1J97A 4AS3A 4QJBA 2YMMA 2GHTA 1RMTA 2P11A 3QUQA 1Z4IA 2O9JA 3WK7A 2G1AA 3AR7A 3ZUPA 4CF3A 1K1EA 1LTQA 3DDHA 3ET5A 4BX2A 2IOFK 5AKYA 5AI5A 2GMWA 4EX7A 5AK3A 3WKDA 3ED5A 3TLMA 2OYCA 3E58A 5AI0A 5ALWA 1VFPA 3DV9A 5ALOA 2YMLA 2IOFA 1Z4OA 1RMYA 3IB6A 5ALVA 5AKLA 2C4NA 1SWWA 5FP0A 2G80A 4EENA 3NRJA 2YMQA 3QXGA 3PDWA 5AW4A 2PR7A 1CR6A 1RQLA
chains in the Genus database with same CATH superfamily
4H17A 4Z9BA 3MJEA 2DPIA 4I8IA 3RYIB 1JQDA 1AQJA 3HU1A 1PX0A 4PVCA 4Q12A 3NRCA 4OPMA 5A71A 4IIFA 3DHEA 2IXAA 4LA4A 4CT4B 2R85A 2BF4A 4TVBA 4NL4H 4MUBA 4LF4B 3EUFA 5KFLA 4MF8A 5AVWA 4YROA 3WGGA 4XD7A 1NVKA 3K2BA 4PR3A 4Z4QA 4PLYA 4UEQA 1YR3A 1Z62A 1WXDA 3RABA 4IC9A 1ESMA 5BURA 4LF5B 2H0RA 5T57A 3IDSA 2ZJ0A 4GZ6A 5LQUA 1XF9A 3Q7EA 2HMXA 3V46A 4F8JA 5EIOA 2I7CA 5BSRA 2X76A 2YX1A 3PQ7A 5E4FA 1ZRMA 2LR0A 2RAPA 5FWXA 3NVVA 1JIKA 3L4EA 4LYHA 3OQMA 4X94A 1CY0A 1G5IA 3DXYA 4GYWA 1B1CA 2C3PA 3DOFA 3Q87B 4KQHA 2GYWA 3TLGA 1U6KA 2O7VA 1UXIA 421PA 3RWOA 1E2JA 3ME5A 2VWPA 5FUVA 5EWLA 5TVKA 3SJAA 1T0UA 1JFVA 3UAXA 3T12A 4K86A 3MRXA 4R8SA 3R4VA 4WOKA 4N41A 1IK6A 2VANA 1A5BB 2RI0A 2XIDA 4BHTA 3NX4A 4BP8A 4HRXA 2AWNA 1XQ1A 4EQZA 5J2AA 4DCUA 1UK8A 1G4HA 2RHRA 1Y9AA 5KFJA 7YASA 1IUKA 4G0PA 2JEIA 2ZOSA 3NHFA 1EVEA 2HVHA 1XLTA 4W9NC 1E9AA 5HQTA 2BI7A 5CVTA 1YASA 3UYKA 4DDMA 3K6SB 4MMYB 1PL7A 4ZAXA 1PTKA 4ZVMA 3WISA 1SXQA 2NLOA 2I4LA 2VJPA 4UQLA 1QSYA 4R98A 5HQ3B 4QNNA 2UV8A 3TNLA 1PV1A 4RKQA 2P5YA 4JITA 2XECA 1GLNA 1C9MA 1Z4PX 2QU8A 4E94A 5K0JA 3D6UA 3F6BX 3A6DA 5CWRA 2GI4A 121PA 2XY4A 5KFTA 2D1YA 3CW8X 4DQRA 1WJGA 2HWUA 3T7DA 3K0FB 4D74A 1PHRA 3KJXA 2E1PA 3FFWA 5B7GA 3D4BA 3LQKA 4WPGA 2ASDA 3NU1A 4KIJA 4QDKA 1PT9A 5BNFA 1FVOA 3QE2A 1NMZA 1M34A 4BQNA 1P9WA 1TVMA 3DL2A 4WN3A 3SBOA 3KUKA 2A5DA 4J2HA 4F45A 5EHZA 4GP6A 5JUMA 4YJGB 3O90A 3STWA 3GIJA 1DBSA 1RWPA 3RBVA 1RMQA 1L6IA 5K8CA 4ZOAA 1YO6A 4OHXA 2WZCA 4EKEA 1JDPA 3O0FA 4JYZA 4XM1A 3KEMA 1YL7A 1PTJC 2HTEA 4U7JA 2XQGA 2JFOA 2NX2A 4KQEA 2C54A 2AOTB 3QU9A 4EYKA 1WKBA 4OI1A 5CFMA 3B3FA 2PAFA 4C07A 4C88A 5K0TA 3B1ZA 2YBEA 4XUEA 2WD7A 4OBWA 3AP3A 4DKJA 3GLVA 1W2WB 5ALTA 1T29A 3IHTA 2QB0B 1BN7A 2AOVA 5LZ8A 1YE5A 3Q4GA 1JIVA 4F60A 9ICAA 8ICQA 4AJ4A 2IK8A 2Q4DA 3QFSA 3IFSA 1YGPA 2A2ZA 4CLXA 4P36A 3CNLA 4QQNA 3GZNB 3WKEA 2GA8A 2VHTA 4DFDA 2PWAA 1L7AA 3BE5A 1HO3A 3AB8A 2NZ8A 1RWBA 3TD6A 1ZGBA 4HEA6 1H4TA 2P9CA 4DZTA 1E79D 1RI4A 4XIYA 2O20A 4B5KA 2JXJA 1UJ2A 4H08A 1I8TA 5AKLA 5GP1A 4TWZA 1KFEB 2H3HA 4D3YA 2XT9A 2OLEA 3VNUA 1MT3A 2YNMA 1JIXA 1I33A 4S12A 2ILVA 1C30B 1N2HA 5JO9A 4I8DA 1R88A 1E3JA 4F5NA 2HBMA 4H6XA 1DUSA 1R0LA 3OZBA 3BZCA 3RGWS 4HBGA 3UQYS 1VKNA 3MSXA 5HQJA 1Z36A 1J2EA 4NNPA 4ZCTA 4B9UA 4PCLA 3HCDA 3ILXA 3I64A 1GVNB 1WDMA 4FXOA 4B81A 4R5HA 3WNBA 1K08A 1P45A 3UTDA 1OFUA 1YH3A 4Y1FA 3TTUA 1OBOA 2KV2A 2C7QA 3VR3A 3HK2A 2EV9A 2DWOA 1L3UA 3WGQA 2O7NA 5ESRA 4BQQA 4RDCA 4XGRA 1CYDA 4JOQA 2J3QA 8ICXA 1MG0A 2II6A 3O3OB 2H5LA 3GQVA 5DK6A 4HQ0A 1E7SA 5H81A 1JG2A 1XC7A 4KLEA 2YHIA 4PIMA 2PM8A 3PBKA 4YRDA 4KN8A 1WB9A 3VHRA 1LFAA 1YJQA 3IEXA 3C3XA 4R8VA 1SKMA 1CUAA 4TYNA 2HF9A 2GPSA 5CLFA 2P0AA 5BSGA 5JDCA 3AL0C 4GXTA 2YB4A 3TQFA 1ZJJA 3PT9A 3UUWA 3L8GA 1BRMA 1R8QA 4E1AA 2CKMA 3RNLA 1T3GA 2R5NA 4Y6GB 4MRAA 2BBSA 4D4GA 3VU0A 4HN4B 3KZKA 5AIAA 3SBEA 1KY3A 3MTAA 1LBHA 1B4FA 1C5KA 1BXRB 1YZFA 3G2KA 1V1MA 1A97A 3WYAA 3KB2A 3AV3A 3AILA 4DXDA 5HE8A 1OKKD 1IEWA 4DM3A 2P40A 1JLHA 3I1YA 2PXCA 1M5UA 2PKRA 2XGJA 2XZTA 3TQOA 4KIFA 5DJ5A 2HJSA 1N57A 2PH1A 2YV5A 2XR1A 4RPYA 2W8LA 2O19A 4YPFA 2VQSA 2DKOA 5DT9A 4FDVA 2G9QA 5I9BA 4QEKA 1UDWA 1MSWD 3EA4A 2Q3FA 3GZTB 4EMTA 1DO8A 3CNOA 4PRZA 2VUIB 1DBQA 1ENOA 5BORA 1AKEA 2LUOA 3S2SA 1ZQJA 4B2LA 2IZ1A 3BT7A 1O95C 1A7JA 2K4HA 5HDBB 3HCRA 2VN8A 2QY9A 2Y0SF 3QEMA 2ZIWA 1U5AA 2JFVA 3HXQA 1DKUA 4B6PA 5ALJA 3ZWDA 3K9LA 2R62A 1DC8A 4L76A 1OH5A 2GSDA 2D2VA 1EFPB 3UBMA 5KFIA 3JS5A 2GB4A 1WUIS 5EP1A 1K7EB 2WTFA 1D8AA 4NCHA 2LYAA 2QTLA 3AF4A 3U6KA 2PTHA 1V97A 1SU8A 1EGVB 4MV0A 4YHHB 4OXRA 4IDAA 2PY6A 5LUBA 2BSXA 4TYWA 2GN6A 1NONA 2Z2IA 4HGPA 3GUZA 2KZZA 4UD2A 2IX3A 2OYYA 1GQQA 4MVJP 4K46A 1RFGE 4DA7A 2KNJA 4REMA 3G6YA 5JC8A 3Q1LA 1X13A 2FWJA 3THOA 4X8LA 3OQ6A 3BX1A 4KPEC 5CMLA 1Z2CA 3IBYA 3NM5A 1QG6A 1N2EA 1P6XA 3WIOA 4ZJYA 4QNRA 5E9QA 1A8UA 3H4DA 3QPVA 4FDAA 1XLUA 1OPXA 2GLEA 4ABYA 4MUJA 4WUTA 1JE0A 2ZJYA 3V1MA 3UQ2A 4F3RA 3PVCA 4ZQCB 3KBOA 1QTMA 1CB0A 3Q3EA 3JPWA 5DHFA 1WQ1R 4JR1A 1COZA 3O8OB 3HL4A 5J0PA 1QANA 4DYVA 2JHGA 4X62B 1JXMA 3ZE1B 2W7TA 3BS5B 4JLMA 4C5AA 2V6IA 2VTKA 2HNBA 3QXGA 4N3BA 4HJRA 4EEKA 2Q4TA 4F12A 4YEDA 4NESA 1R4ZA 3BWVA 1OBVA 2OD7A 2V7VA 1JDJA 5B4TA 3W3AD 3CLHA 4L0DA 1IXYA 4CIBA 9ICXA 2XWBF 4LJ7A 2Y0PA 3GI1A 1JT9A 1M1YE 2BTOA 1ZPDA 1BCRB 4PGHA 3L6RA 1M0SA 3G2QA 1XZFA 3OX4A 2X8BA 2VP2A 4CM1A 1CF4A 2IBKA 1Z0IA 2H0AA 4DA8A 5JW6A 3Q8QB 1ZUNB 1G1MA 3DOJA 2Z5FA 2ZTMA 1Y9ZA 2NNWB 5DSXA 5C53B 3G6KA 5T6BA 4MW2A 1G64A 4CG3A 1ZMRA 4CMAA 4QTXA 4CM6A 2YFKA 1EFVA 3G0OA 5CCXA 1P7CA 2Q0SA 2Q5LA 4MAAA 5DYWA 1YONA 1XV5A 3DTNA 2FDXA 1JAIA 3W0LB 2X0JA 2YOHA 3P97A 1GGEA 3HWWA 2XRFA 3BFJA 4V1CA 1QKKA 3BQ1A 3PHJA 2QTVA 1Q44A 2X22A 2HSWA 3AEUA 3ZCSA 1R0WA 3I4FA 1XROA 1C9JA 2QP9X 2VSQA 4F71A 2OCXA 1W29A 1CUVA 1M1YB 5KPDA 1NBAA 2FZEA 1RQ7A 3IP9A 3DDCA 3ZDZB 3TOXA 1TM4E 2E82A 3IQXA 5ADUS 4F4ZA 2Q3DA 4EA7A 3DVAB 1IEXA 4HFNA 3ZCUA 4RAOA 2ZITA 5CDFA 3JZDA 4HO1X 3ELDA 4PO8A 1F8GA 4GMKA 3ZDQA 1EU1A 3DBHA 1JEOA 4BNKA 1R0KA 1ZUHA 4D3FA 1V71A 1GKYA 2AMYA 4L3WA 5H3CA 5H02A 4A8PA 4L78A 1R0BA 1WTCA 3ADCA 3L6BA 4IJUA 5J59A 2KEYA 1DLJA 1A5AB 2QAGC 1E3QA 4ILEA 4HD8A 621PA 4DLPA 1ZQ1C 4CL8A 3P1JA 4IYRA 3DTTA 3LTEA 1KQPA 1WXHA 2PZMA 1C7JA 4U2FA 1C4KA 1WCIB 4HH0A 4KL8S 1ZJNA 5KREA 1SM4A 4WNAA 3TN7A 4KRXA 3U4CA 4B3JA 3P2IA 4AIIA 4M9XA 1UPAA 4ECSA 4MKZA 3IHLA 4QWMA 4LSGA 3WRYA 4V0OA 2W2LD 4NQRA 1GEEA 2C20A 4LVCA 4O5OA 4ELUA 3A1WA 4WFIA 4LGYA 3CWZA 1NVVR 1ZM3A 3B6MA 4JBYA 1Q7TA 1NE7A 3U2QA 4LSZA 1FUYB 2QE7A 4O3NA 2PWZA 3M8RA 3DLHA 5IANA 4PVDA 2G67A 2JJ1A 1TLTA 3UV6A 3A4IA 2NQ8A 3D7KA 2JEYA 1PFKA 4YMLA 4ZEXA 1XDDA 4ND7A 1SCDA 5G40A 2XY6A 1U8YA 3EX7C 4DQVA 3EA0A 3K1ZA 3FHTA 2YFHA 3QKSB 1G63A 4DL9A 4YD2A 2FPPB 3REQA 1PFUA 5AUPB 5KQLA 1U9LA 2EAUA 1IM4A 3D9QX 1TVCA 4PCAA 5IBPA 721PA 5IC6A 1Z0KA 3C1TA 3VVCA 2A84A 1E2MA 2B21A 2GEKA 1RWNA 3RF7A 5CFZA 6REQB 1TJ4A 3JWEA 4M7OA 1VJ1A 1L3IA 2RBKA 4UNRA 4RTPA 2GZMA 1IMOA 4GLFA 2IYYA 3PD0A 3PXEA 4KSBA 4QD3A 4TTRA 3ROTA 3VJMA 3S27A 4FYXA 3VO1A 1YS1X 1XB2A 2X3YA 3DYIA 2QPAA 4GPD1 4HGYA 2V65A 4KITB 1ZQOA 1VG8A 4PYMA 3QH4A 4WK0B 3S29A 1H6AA 4HI0E 1TYBE 4L5IA 4AKGA 3DSRA 2ZREA 2XCRB 1JF8A 4QDTA 1HTBA 1Z34A 2D0IA 4HATA 5ICSA 5C8YF 2VH1A 1GZ3A 4WBNF 4YMGA 3SF8B 3VSBA 1MO3A 4FZVA 1Q6YA 2AXPA 5BV7A 5FOSA 1Y3IA 3WYCA 3DGEC 3N8KA 2BZSA 1WCNA 1UOEA 2FEKA 2ZRFA 4MB6A 4Q1DA 2GXQA 4B9TA 3SEIA 1EWYA 2YKGA 1QYVA 1QYCA 3TAXA 5IFLA 5EVJA 7ICVA 2HFJA 2VDQB 4OQQA 2LDBA 1BGWA 3F73A 2ZKIA 1EP2B 3BWBA 3DEIA 4ELVA 1TM3E 2P6NA 4YFYA 2QRHA 2QROA 3FYUB 1XZJA 5B2EA 3IMEA 4CBVA 3RVNA 5DWDA 5JPIA 1ND6A 2ADMA 4PHGA 1DIOB 3A4YA 3MB8A 3BE8A 4TQRA 5HILA 4XGNA 5DYGA 2FAXA 3B82A 1V7QA 4AYXA 1BNOA 4GSLA 4ISBA 3SYTA 2JATA 4ND8B 1PAUA 1UMKA 4FZNA 2Q2NA 4DO9A 1MEEA 2PGNA 3GGPA 2NG1A 3FSRA 3IA7A 1ZGGA 3B2QA 1EVYA 4QWWA 2BKLA 3P26A 1SZCA 3HGQA 4C7OA 1KBOA 5EWJA 3FZGA 3ZDDA 1Z8NA 5K9ZA 1NVXQ 4M9JA 1XZBA 2W9XA 1J2UA 4RK5A 3N3AC 3GL9A 1RM5A 1M8JA 3AR3A 4PG4A 5C1IA 3OWOA 2O07A 3ZV5A 3L02A 1U8TA 3C5GA 4OJYA 1O8CA 2BD0A 3EIFA 4NENA 3ZH2A 5KG6A 4KI0A 2B98A 3FMIA 2MHCA 4GRDA 4ALKA 2CLLB 3PX4A 5F7XA 5F76A 5MGBA 4J4TA 4B9EA 1ZRHA 3NDRA 3V7UA 2NYUA 4BTEA 1SUCA 2R1VB 5KFZA 4YCXA 2BR3A 4KVAA 4QTTB 1DV1A 3IHWA 5C8YA 2RGBA 3OZTA 2RAUA 1VRVA 4PX3A 3C5HA 1ADBA 4WBNA 4BN5A 1JB1A 4IEEA 3ZTYA 4Q9NA 1RXCA 3ZV4A 1GAEO 2RFLA 2X0IA 3HKEB 2C78A 5AKHA 1AO3A 2B8EA 5A3JA 2WABA 4I2NA 4P7KA 3MMXA 4LYDA 1BQ3A 2Y0EA 3JSXA 4DVGA 2AHOB 3TANA 1NVEA 1GRVA 3NDBB 1QM5A 2ZBGA 2WMDA 4ESHA 2LDXA 4R8RA 1SIBE 3KWFA 4HOYA 3OBBA 2EHDA 3A1FA 2MR6A 4NTZA 4M54A 1JQ5A 1UP4A 5H1YA 4W5OA 4LDNA 3RB8A 3NRWA 4LJAA 2VP4A 4QEDA 4R71A 3QU4A 1P74A 4HDKB 2JAOA 4FONA 3QMWA 5I7VA 1HM5A 2FN3A 2QM3A 5DV9A 2B4QA 1EMDA 1P1HA 2FP4B 3B7PA 1FFYA 4Y6OA 3QA9A 1E9SA 2EKDA 4GP9A 2ZM6B 1FDTA 3UAWA 4NRDA 3OTIA 2ISOA 3ELWA 3PDIB 7ADHA 2Y1EA 2XUOA 3P9XA 1MABB 1SOWA 1ZI8A 5DWQA 4RY8A 1GRQA 5CIWA 4P31A 1ZWKA 3ND5A 5IT5A 2ORED 5GADl 3AM3A 2JGJA 1TZKA 2K2QB 2IV3A 4YMMA 3LC2O 5HYVA 3WGZA 3I9V6 4FYMA 4IVPA 3NKVA 2RSLA 1IBKB 3AJDA 3G5LA 3IERA 4GI7A 3S40A 2VHYA 3MGBA 3U60B 5L45A 4DXAA 7MDHA 2AU0A 3GFGA 4MCIA 3LY7A 4L4YA 3HA7A 4FBUA 3R6DA 2GXAA 4JXZA 1T2AA 2PCJA 5BQFA 5FUBA 3JU3A 4MUYA 1C9EA 3Q5GA 2M98A 4A92A 3O9VA 4ARCA 4NMHA 2WIKA 1D09A 5K0SA 4XGQA 1F5NA 2EGHA 2LW7A 3U4QA 4QG3A 1TKDA 1RXSA 1UK9A 3U7IA 5GMOA 5HCNA 3I9V1 4DCPA 3DZDA 3MMNA 5LA6F 3U7FB 3H13A 4UM7A 2NZ2A 1U2TA 2ZYHA 4KV9A 2CLCX 5IAGA 2GNOA 3CNBA 3GRPA 1QKJA 1THMA 3AR7A 4G4SP 2OFXA 2GAFA 2PT9A 4B4WA 1F2TA 1H2AS 3U1TA 2FJPA 2NRXA 4FEAA 1D2HA 3LWMA 4U8GA 3ANYB 4PBSA 2GBGA 1N2CE 2YWHA 2A0KA 2HEGA 1ZN2A 1QF9A 2EKZA 1LI7A 3DHWC 5I9MA 1JDBB 4ZAYA 3KZCA 1USWA 3Q88A 3MGIA 1FYFA 1JBKA 1H3NA 5A7HA 1FQWA 3TRDA 2HR1A 4BX0A 1P8JA 3SIXA 2OCGA 2BR4A 4U2CA 3VBEA 2HPHA 2ID8A 4C6HA 2D1TA 2JLBA 2KN7A 1U1GA 2XMDA 1U7ZA 3EQZA 3Q12A 4B85A 3FBWA 3VDNB 3UGJA 4MQ4A 1TK2A 4GVPA 1TCVA 4Z4IA 3TM4A 3ZBTA 5EMKA 1IIBA 4ED9A 3QI7A 1DS6A 4G5OA 2ODEA 3WV5A 2BTQB 3GFTA 1GXSA 2R2AA 4NZZA 1MEJA 1XDBA 1N2CB 3H6GA 4JCOA 1YULA 3EXIA 3QV2A 4K3VA 2B69A 3X1YA 4IV8A 2XQKA 3EZ2A 4BJ1A 2WFZA 5BW5A 4GKBA 1RXUA 2XXAB 4ZQFA 3CVWA 4YWJA 2AZMA 3K2EA 3RU9A 4HMOA 2IEYA 5BWLA 4C03A 4BNWA 3QLEA 3UF0A 2O2EA 3X2SA 4I2HA 4PHPA 4G63A 3AF2A 5IIIA 4YXWA 2YS6A 2GH1A 2EG5A 2XAUA 4YRAA 4Y2GA 4BBPA 2FQXA 1ECFA 1N0IA 4WKCA 3CNQS 4RDXA 5LDHA 4KACA 5LA6A 3PIRA 3KSZO 3BH6A 2ANCA 2VUSA 3KQOA 1TPYA 1QZTA 5PGMA 3H2HA 1HFJA 4Z0PA 3TOVA 3QKTA 2ZUVA 5B57C 4W5RA 3KYJB 4NU5A 1PBNA 1IN8A 3GEDA 5L6MB 1PGPA 4XGIA 1MFPA 4LRQA 1KJIA 2Y1XA 2J3KA 2A9PA 3HJCA 5TQ0A 4ZK2A 3OCCA 1WCWA 2JVIA 4TL6A 3QVOA 5DU2A 1UQTA 3KHLA 1CR2A 1PSDA 5FWYA 1KI6A 5FWNA 1L4EA 2ZB3A 1NUSA 1Q1NA 4IO1A 4RA6A 3H19A 2HW3A 2HSZA 1OHHA 2XDQB 2BEJA 1AN0A 1D0IA 3NJ4A 3G79A 3FR8A 3PUVA 2WSBA 1WABA 5ECDA 4YT4A 2ZYAA 1IRIA 2OHGA 4FI3F 5DHPA 1Y0BA 3DLTA 1SIJA 1M6VB 3II6X 4B2YA 5KYUB 3EVBA 2I6QA 5F9MA 1TOAA 1HLDA 5KFAA 3OKPA 4QWAA 3KHRA 1Z2PX 4QRIA 3GCZA 1JHRA 1ZQHA 1X92A 5EWFA 3G59A 4PL2A 4UBMA 4FGSA 1ZQDA 2OHOA 4NEQA 1UBMS 2MIIA 4G9GA 1KF0A 4XDHA 2WQZA 3CU5A 3BA6A 2WINI 3MQFA 2JJYA 2R6HA 2OBLA 3JAWB 1PGOA 4JLOA 3QGMA 4OI2A 4DMRA 4O5AA 3GD5A 3T7AA 5FO1A 3QNMA 3F7MA 5K01A 5LMNB 1R50A 3RC2A 3RFUA 2BM9A 1QIJA 2XSZD 4K05A 1DP4A 4RL6A 4NS4A 4B75A 3M6IA 2EARA 3NHWA 1P1IA 1FFUA 3I53A 3FGNA 1NDHA 1QVWA 4C29A 4IZOA 4QX6A 2YX8A 5DHSA 2WJ4A 1JNYA 3I3SR 2CJWB 5CFPA 3PNKA 4ICAA 1M2VB 3WLIA 3HKBB 4M89A 4YQYA 3I37X 1WOMA 2C1EA 2FX2A 2EF1A 4NPCA 4QRHA 2OCEA 2D62A 2W5UA 1KP3A 2RIRA 2JFQA 3HRHA 4C4TA 2AN4A 2O7SA 2PL9A 1FZQA 1TM7E 3N6XA 2VTBA 3QHAA 5KWVA 1DXHA 3L7OA 4DMFA 1GQRA 1QWOA 1ZP6A 3T5TA 3I1IA 3W3ZB 2J3DA 3KWMA 4LE1A 4HNTA 4OXNA 4HSGA 1SXGA 3UENA 2W2VA 3LUAA 3SYZA 3LPDA 4NF2A 4DABA 2XJ4A 1NM5A 1S8FA 4B2IA 4ECQA 1IN6A 4GU5A 3ILSA 1BPYA 4IXTA 2RDJA 1CERA 4IWYA 2HF2A 3IDQA 1QR6A 5JAMA 3ZYCA 2LTAA 1GPKA 1Y4SA 4GXJA 4J03A 3O91A 4FYYA 1EXDA 2Q41A 2D5AA 3F5EA 1EGMB 1U8CB 5KTMA 4C76A 2JJ2D 2QTMA 2VPZA 3ROKA 3DDWA 1ZQMA 3DXXA 5DTEA 3T3NA 1Q6ZA 1WZIA 4HYYA 4WTOA 3O31A 3IOMA 3VR4D 1GL9B 5KFGA 5JCOA 3PNPA 1N9KA 1JLLA 1GPH1 2RHTA 1J2RA 5KDDA 4YN4A 2JIPA 5CAEA 2CUKA 3GRUA 4U9UA 1H4QA 2BGWA 4Q82A 1O5IA 2H2HA 1EFAA 1LY1A 3O6VA 2R6FA 3STYA 5B7NA 3N0XA 1J9EA 2REBA 1MQ8B 3O73A 1R0XA 5B3KA 1FYDA 2FSUA 1P1FA 3LF1A 4NG5A 1IC6A 1RP1A 3K1YA 1RJGA 2PXXA 1XNHA 3THVA 3UM9A 1LLFA 2MMGA 1VIAA 3Q15C 3A37A 1TJPB 3LT5A 3AWIA 4ZFNA 1RPZA 3LTNC 1YIDA 3UT6A 3SCZA 1MFZA 3OCWA 1I2CA 2DR0A 4AECA 2E48A 4Z1MD 3L7NA 4O59O 2ZRNA 3TSCA 4M6WA 1GPAA 5TB5A 4J9PA 1BDIA 1MP0A 2V3CC 1S0MA 1D0VA 3DTVB 3I4CA 3T38A 1O89A 1Z63A 3OHBA 2WU0A 1QVAA 3VSCA 3LT2A 2HHCA 4YVZA 3QWHA 4J16C 4A91A 4DCVA 1Y8QA 3V48A 1DXYA 1QAMA 4GPIB 2H9AA 4X61A 1A2QA 4UUBA 3ORSA 2XEDA 4S1VA 3MJRA 3QPUA 4WZAA 2JFYA 3LU1A 3T5LA 1FFCA 4L8FA 2ZB2A 4C01A 1T2CA 3PUIA 2F1IA 3L6DA 2ZRDA 1ADCA 2C28A 4ND4A 4KX5A 2OQ2A 4Q1BA 4BO7A 4DWWA 4JJIA 4C0WA 3SHVA 1Y42X 3LKVA 3I72A 2Z58A 1QIMA 3DTVD 4M9GA 3SC3A 1NV8A 4BZZA 1LF0A 5B5SA 3T1OA 5DT2A 3BWMA 3WGJA 5JJBA 8ICJA 1XSNA 2AEFA 3I5XA 5F1OA 1WAMA 3CISA 4WXRA 3LX6A 2OHVA 2NRTA 3ECCA 4D44A 1XMVA 3HVHA 1SQSA 1V7CA 5H59A 2P7IA 2IS1A 5HHIA 1N25A 4PLZA 4CUKA 4F85A 1UEXC 3TXYA 4FFOA 5IIJA 3F74A 4CMIA 1GZ4A 3OICA 3LWNA 3GGGA 1P80A 4PRYA 3R76A 1JH8A 4TUYF 3IX7A 1NJ8A 4J9NA 4DJFC 2IY8A 4C43A 5CFRA 4ECAA 1A04A 1JAHA 3PTAA 3U7GA 4DL5A 1D8BA 3EXFB 3BEOA 3PZBA 4Q4DA 4C2BA 3WKCA 1A8IA 1BU8A 1O97C 4LHWA 2O5VA 3GEIA 3RYIA 1G9XA 4G0MA 4P34A 2I9KA 2OZVA 2BJHA 3RSCA 3LOQA 2NO1A 2ZAGA 4BPRA 2FX3A 3PYXA 5HA5A 2HN9A 2G0NA 1AQUA 2Q9CA 2H00A 3EFBA 5TEWA 1ZKDA 2EKLA 4R54A 4WY8A 4TRNA 3W05A 4IL5A 1PVRA 4B7XA 4RGQA 7ICUA 1CV2A 3YASA 2GASA 4JGBA 4M8NE 3ESYA 2NXWA 4UBKA 2DFPA 2E4YA 1FUIA 4FKZA 4FS1A 4NEGA 5DTQA 4M9ZA 4ZT2A 2FDRA 3AQFA 1FFVA 1AQLA 3JVVA 3I23A 3RAQA 4N5MA 4DA0A 4KOEC 1Q16A 2XWJI 3NHYA 4PLHA 4O2BB 2W22A 2XODA 1RLMA 2HD4A 1KU6A 4GR4A 4WOCA 2EZUA 5AW8A 2HWWA 3RRHA 2VH2A 1IOLA 7ICKA 1RPJA 1PT8A 1F8UA 4L0QA 3COSA 2M9NA 4JUBA 4KYTA 3ZD8A 4DFPA 2G5TA 1QO9A 2X2PA 1K98A 1M76A 4O1MA 4F2WA 2WNSA 3BJYA 4DQDA 5J2TB 1OZ0A 3IR7A 3H5OA 5LQCA 3F9CA 1ZXXA 5FJIA 1TTPB 3BRQA 4M98A 5ELLA 4RU9A 3HM9A 1VIVA 1S0VA 2Y1OA 2WHEA 4JJ6A 3KOMA 4RXMA 4BX9A 4NYIQ 3WB1A 3DDSA 4UARA 1N78A 3MB5A 4EWLA 4TUYA 2EU8A 2HCFA 4OH7A 3CVXA 3GBSA 3PFWO 3QV1A 1PYDA 2PMZC 2AB0A 1GO2A 5JTUA 5DG8A 2JA2A 1KEVA 4BWVA 2WE7A 1K63A 4C89A 1QLJA 3EULA 2QNRA 1ZMXA 1QS0A 2B4RO 4ROTA 5HQ3A 4KNVA 4RJIA 2AVDA 2ZS8A 5J8YC 4IQTA 1XZNA 1D2GA 4CCAA 3KKKA 4A1OA 4I3GA 1B8OA 4GOXA 4JB2A 1QHIA 3PIDA 4GEKA 2BL4A 3TSAA 1B42A 3ROQA 4FFBB 4EA8A 3PW4A 3SDSA 1ESCA 4B47A 2BN4A 4XIFA 5C80A 2HU2A 4FR0A 4QQFA 4RE5A 5EQJB 2NQ2C 4DFKA 4J3NA 4UXJA 4ED0A 6LDHA 2XRMA 5AESA 2P6PA 4G9EA 4FFPA 2PLRA 3CUSA 1CUWA 4L6AA 5KYTA 4J0FA 3DHNA 2A9RA 4CMCA 2V9ZA 2BKAA 3SXPA 2I4MA 2JI4A 1L5NA 2RK3A 1RI1A 4YJGA 1PJRA 1EX6A 3HCNA 3UMMA 1Q3TA 4BQEA 2WWWA 3ZHZA 3ZWPA 4OHPA 3S28A 4P2GA 2BGGA 3HFSA 1DQZA 3GCDA 4NE2A 1WSBA 3M3PA 4GC6A 4PZPA 3R7WA 1KTVA 2C8JA 4COOA 4HEHA 5GINE 2GK3A 2Q4RA 2H59A 5ALPA 1NNEA 2AOTA 3LGAA 5LU8A 5JOQA 2PLNA 5IXYA 4GLJA 2HBZA 2IVFA 5FHQA 1MN6A 1DL5A 4AQYB 4QOHA 7ICHA 4TLBA 2D5BA 2JFZA 4OOFA 1DEHA 3TFQA 2H17A 2B83A 1CS0B 2XMZA 1K97A 4UMEA 2HSJA 2QB0A 2GRAA 4UAVA 2WE8A 4JD5A 2POQX 3VFDA 4ZZ0A 1RI2A 4H15A 3BJIC 4QXQA 1AM4D 4U8HA 4HRYA 2OXEA 2OBBA 2PS0A 3K4PA 5EEHA 3BQ9A 1QTRA 4JN6B 1UL1X 5JQGB 3GZNA 5KFEA 5ENDA 1OT5A 3T7EA 1WOYA 2JFUA 4B3DA 2OY0A 2XUIA 3GAAA 1B1AA 3O3MB 3G89A 2B3TA 3KR0A 4Y2XA 4LE0A 3SDZA 1QIFA 2RDIA 1LK5A 4QPNA 3CEJA 4FPXA 3I0MA 1R8JA 2Y71A 3FGZA 1K9SA 3HBJA 1M2NA 1OBCA 4DA6A 3U49A 1KI1A 4I5GA 4B3MB 2IYLD 5KC9A 3CH5A 3K96A 2PBRA 4CEJB 2CVPA 4K9MA 2RJ3A 2JS7A 3U3KA 1W46A 1Y1LA 2EQBA 2A8YA 3A28A 1PLJA 4KPFC 4YMUA 4LBVA 4QAQA 3ZUPA 1FFBA 1G2QA 1NBME 1HEUA 1MJFA 4DTCA 2GJAA 2Y1KA 2A7XA 2VJYA 4I81A 3KDAA 5HR6A 4ECRA 3ROEA 4MDFA 2DPMA 3IOBA 2HK7A 3I92A 1NG9A 4YXJA 2HKIA 4OLFA 5KFFA 4ARZA 2EGUA 4QDZA 1CUUA 2Q8PA 1RE1A 3J81A 2PUTA 1TMGE 1XPRA 4QPPA 1JNXX 1Q14A 1VG1A 5KYXB 3NBFA 3PXGA 4W6ZA 2VP0A 3UEOA 3WNDA 7ICOA 3PFIA 4JBLA 3SAFA 2QT0A 4FILA 2JJQA 3E3AA 4YV2A 3VU9A 4RSGA 3G9TA 2J0QA 1QU2A 4MQLA 2W70A 5I5EA 1QV7A 2GESA 3RREA 4GR9A 3RKUA 5C5IA 2R8JA 1VB3A 3I5UA 5AK6A 3BGVA 1Z83A 3GVXA 3AFGA 1T2NA 4V39A 4OI4A 3VAYA 4WAUA 3PYMA 5F21A 2F1RA 1D6MA 2VF2A 3LK9A 3R7FA 4TM7A 4UOQA 2HIGA 5BQ5A 2JDID 1BXRA 1NMEA 5JLAA 4D0GA 3HXLA 3HM2A 3IBGA 3DULA 3WS7A 5KTYA 1WS6A 4AS2A 2V5VA 3LAWA 5LXTF 5FBLB 5REQB 4F1WA 3LS2A 3SSOA 5JSUA 1Z68A 3TI9A 3I9KA 1WUYA 5SV2A 1U80A 4JBNA 1UBFA 1OCEA 1FZTA 1DWPA 4YUWA 4RJTA 4LV5B 1KC1A 4IXWA 1Z6GA 3T3IA 2CKDA 4P58A 3ZTTA 2B8NA 2AN1A 4L6CA 1RJ9A 3C3KA 1YI1A 3INNA 3LT4A 3T1TA 4R2MA 4RUKA 1NBMD 1MTZA 1XMOB 4FGJA 5HMMA 4MV1A 3DOOA 2PZEA 1GPJA 2P4SA 3ESQA 4AYWA 2YJ4A 4I50B 1H8HD 4GSKA 1SXJB 1MUUA 2NSHA 3KXPA 3T95A 2JLXA 1B43A 3H40A 3CLRD 4P9NA 3OQPA 5F9FA 5CTAA 1L5FA 3DJYA 5KKCA 2XV1A 5KFBA 3F7OA 3RV3A 1PSZA 5K8IA 5HGXA 1KETA 4XYEA 1UCVA 4F4KA 3RYTC 4EJ0A 3CRQA 3AF6A 5HIJA 3PV0A 2W2NA 3EXHC 4PGQA 2PD4A 1ZD2P 5C8VA 1NOJA 2AFHE 4RQ8A 3B38A 4OAOA 4EHDA 1WXIA 3BFPA 1V95A 4HMQA 4WBSA 1SY7A 4M38A 4NE9A 1SXJD 4F96A 4IJKA 2B5VA 2DQKA 3T1NA 3ZWQA 4M04A 3KUDA 5A4JA 4AAYA 1GQSA 3WAJA 4DBZA 1Z35A 2V0CA 1PL0A 2QAJA 3WB0A 8ICWA 4B6JA 1L7DA 2QR3A 3RQIA 2CDAA 2WJZB 4D9MA 1XRMA 3KWJA 4EUSA 1RCTE 2EBUA 2PGXA 4RD3A 3K6KA 3O0DA 3W77A 4A0QA 2YQEA 4XRHA 4D8VA 5HOQA 3FFTA 2Z30A 3G2HA 2P6OA 8ATCA 3TLCA 4PPXA 2QOEA 4JL5A 3I12A 4OHWA 4EYQA 3TJRA 4ZC1A 2P0EA 4R65A 2G4CA 1XKQA 3TZEA 4NYIR 5CFLA 5LXTA 4MDYA 3GP8A 2IXGA 2AFHB 1NVVQ 3HVIA 2KOBA 2CC2A 4MW0A 1OROA 2A5LA 1T4CA 3MCZA 4FFRA 1PZNA 4HEA1 4FE3A 5FA6A 3ZR4B 3JYOA 5DFAA 2FUCA 2GRUA 4ICIA 4JGIA 3BS5A 4X92A 5K8JB 2Z9CA 4RKFA 4J2TA 4EKYA 3L8CA 3A2NA 3QG1A 2ZAMA 2X5XA 1NKTA 3F5MA 4PYQA 3KVYA 1RVV1 4RFLA 3V9AA 1HV8A 1M74A 1BCRA 5JY1A 2VIIA 5KKAA 2KVSA 2OGWA 2PI5A 2OAQ1 4AD8A 1J97A 4Y8VA 3FPFA 3PT5A 4AKTA 3H8MA 4QPCA 3SJCA 3W6UA 4K9KA 1V2HE 3THXB 4M0PA 3V33A 2X7JA 1D9DA 1P0FA 5IKEA 3PXCX 1ZUNA 4RVHA 2ZYTX 4PX9A 2XJ9A 5IIMA 4W9RA 4HNSA 3BRWD 5L1MA 3LHDA 3HA3A 4IDBA 4QBKA 1X2BA 3N0TA 4YN3A 1VFNA 2GHQA 3V2IA 4CODB 3WLEA 5JWOA 3CW2A 2B1QA 1QCCA 1XCPA 7ICFA 5H9VA 3H86A 5LFAA 1MDBA 5LB4A 3WBBA 4KH1A 5FOTA 1E6EA 1EBUA 3T41A 4JMUA 1ULHA 5JV5A 3K1RB 4IHKA 2XYPA 2ZVQX 2XYGA 1E18A 3V7FA 4G5QA 1MXHA 2PX0A 1M1YA 1VC2A 8ICEA 3ODPA 2ZS9A 2E0IA 5BNTA 1NYRA 1U9IC 3IVMA 2X19A 1ZK4A 1QH8B 4ZHQB 4D5GA 1H2FA 2XGMA 3BQMB 4TTTS 2W2LA 4B8WA 1UXHA 5HIIA 4MWOA 2X5KO 3Q0IA 1ECGA 3RE1A 3QHPA 3UMSA 4FYHA 2ATCA 3LIPA 2XITA 3NBMA 2PUVA 3KCQA 3HU2A 4O8ZA 4OTZA 2WWTA 5CH3A 3N6VA 4KODA 1Q3UA 5DM4A 3X44A 3PX3A 3GVCA 5LP6C 1WCIA 4TLCA 1KYIA 1TFUA 2FMTA 2UVUA 3OQ1A 3L4BA 3QXJA 4DQKA 1HUZA 3QTTA 5JBNA 5JHHB 4E2WA 5LJIA 2OV6A 3Q0TA 1I5EA 5IJ9B 3E22B 5LZ7A 4PAMA 2P62A 1QYRA 1ZR2A 2OK7A 1YJXA 4QIWC 1XVUA 4MEXA 4KBFA 4CT0A 1ZWLA 2HH9A 3VZQA 1M1XB 3TZCA 3GJRA 2PLWA 2BPOA 2I5HA 2KSQA 4J0IA 1FMFA 3GZ4A 3WMGA 5K05A 5E9WA 3LX8A 5AOVA 4YP5A 1JWBB 1C3OA 5DBBA 1JH9A 2RGNC 3TW8B 1ETUA 3QKSA 1ZQZA 3HB0A 1YA4A 2FPPA 3F3YA 3NPAA 1U5BA 3TQTA 3PGXA 3SFVA 5CFNA 2XMRA 1ZQVA 1WSWA 3WIUA 4LHXA 4YJKA 4RACA 2E5SA 3MJSA 2G6BA 4DEVA 1FTNA 3EPLA 2BFCA 4LJRA 2YN4A 4QG7A 1C81A 1IEQA 2Z08A 4AO8A 1IAQA 2C2HA 3GROA 1O4WA 1XKLA 4GDFA 3IT3A 1Z2AA 2BI4A 3H3FA 1T8PA 3FZQA 3DEKA 4XB2A 3NUZA 3EGVA 3SAJA 1V1JA 5A5FA 4F4CA 3HVKA 4L5CA 3QMMA 3BDVA 4O4LB 3BCRA 4FT4A 1YJBA 3E7WA 4WFQA 1TZCA 5TRTA 4FYIA 1I4TD 5JROA 1R6VA 3H2KA 1XZKA 4BV3A 4M1YA 3GFKB 5FPSA 4BAUA 2XE4A 3WMEA 1IEVA 3RT9A 2GLTA 3RRXA 1XJWA 1O03A 1EQ2A 4UJ3A 5BQOA 2P79A 4UMDA 1CUHA 4FNAA 2VYNA 3BXFA 4A6XA 4EW3A 3WGUA 4ENRA 1FRNA 3PSFA 3TIVA 4ZJZA 1PFGA 2I3ZA 1QP7A 3UG6A 4AMBA 2R8XA 4YV0A 4LXUA 1DT5A 1NN5A 1X74A 2W0MA 1ZMOA 1FQKA 3HQ4O 3FTEA 1BAPA 5CW2A 2YR0A 2OO7A 2VRCA 5D85A 4HUJA 2WSMA 1WMFA 3WL3A 4NLZA 3N8DA 3Q2OA 2BQ3A 5KOHB 1T8RA 2WG2A 4CEIB 3TPFA 3FYUA 2IIPA 1LW7A 1ORTA 5FI0B 3PB3A 5C7LO 1XZEA 4CHGA 3FCXA 1YNOA 2JI6A 5EZ5A 3AY6A 3H83A 4F5WA 3NLLA 1DO0A 4QJBA 5CVUA 2IYOA 1H2BA 2VPPA 3LY5A 4ZJUA 1EFKA 1T9DA 4ND8A 3BN3A 3D2SA 4YLYA 2Y6VA 2UYOA 3UXYA 4D98A 1EK5A 4EVIA 4FMCB 1SVIA 2D7JA 1KFCB 1SVLA 5LBTA 5AHRA 1XU7A 1P7WA 3U3JA 1UT5A 3UMGA 1CD5A 4EW6A 3HNRA 4DANA 2C3YA 1BX3A 2HJWA 5KMGB 3MINA 4Q3KA 5DB7A 1H0SA 4BFXA 3HCEA 4JVMA 4OQPA 5J1SB 3W9UA 1SKYE 1C3JA 1ZN7A 2BFBB 3INTA 3QMVA 1V16A 4BGDA 1AY0A 3K0CC 2CZCA 1JU9A 4ZP1A 5DZSA 4RTKA 4P53A 1X7ZB 3UXOA 2EZTA 3WP0A 3HVJA 3LF2A 1V8FA 4G1MB 1QDUA 3A1NA 5B58T 2R1VA 3L4KA 3BKWA 1HQYE 2I7VA 3QMPA 3KALA 2VPIA 2F8TA 2G28A 3WHPA 3B9RA 3JQBC 1XWLA 1F3OA 2GK6A 1IOVA 1U3UA 4EJ6A 4GXIA 4OQFA 1XA4A 4OA5A 4JP1A 4I1OA 3KKNA 3HKEA 3AU6A 3I61A 2AC4A 1FXWF 4PLCA 2JD1A 3RUCA 1IG6A 1WPRA 3RDPA 4I1PA 1X3LA 2L17A 4EJSB 1SKYB 3ZDEA 4IMRA 3WRXA 3WJAA 4KXVA 2GEJA 3GA5A 2AHOA 3GEEA 3PSHA 2GBCA 1PT6A 1ZOPA 1DBRA 5THQA 4ZRDA 5CVCA 4EY6A 3NKLA 1KK0A 3WA6A 4Q4HB 4B9VA 3R3JA 3EVGA 4IAOA 4WECA 1C7YA 4EB3A 1YU9A 1J8YF 2E21A 1YUNA 1D2RA 4B9MA 4HDKA 4O08A 1ZVQA 2PUAA 2EKPA 1MB3A 2XTZA 1GCIA 2ZYGA 1M1UA 2FMFA 2FP4A 2VZ8A 2YUIA 3VVBA 3CUKA 3QPDA 4G81A 3OCYA 4HQRA 3Q0EA 3PDIA 2HHWA 3RJIA 3E0XA 3JATB 5EWEA 1MABA 3DQQA 2DTXA 2KZ3A 3SF0A 3UH0A 1RLJA 3RVOA 3RIGA 3USES 1JLMA 4L95C 2MA1A 5KC8A 4AJNA 4CM8B 2PZJA 4PL1A 2XVXA 2SNIE 1PK7A 1ULZA 4BVLA 1G6OA 1AURA 1UMCB 1IY0A 4K9RA 4CL2A 1S2IA 1TNDA 1E99A 2N1MA 2NQTA 2Q0ZX 1U2PA 4D41A 3PUHA 2DETA 5BWNA 3HRDD 1FO4A 1W1UA 3O3NB 5DYTA 2L18A 5L4LA 4XPZA 1H2ZA 3BXZA 2OCBA 5EMJA 4FMBB 5BYKA 4X7BA 2Q50A 4YIKA 1MA7A 1VTKA 2YINC 4UNPA 2OOKA 3SXUA 5JUWA 2F43B 4EY8A 1LX6A 3LUCA 1Z2DA 1K8QA 4DG9A 1V96A 4I5DA 1E32A 1GAXA 4HC4A 3MGGA 3TE6A 1HKHA 2ZEJA 5KSPA 1YZQA 2I7DA 3WNQA 5FBQB 3MR6A 3JQEA 3CYFA 3QYJA 1VKHA 3ZKAA 2HA5A 3BMOB 4I6JA 2BYTA 1E58A 3UGKA 2C04A 3MBYA 2FPLA 4LRTB 1AZWA 1FXWA 4DRYA 1I1HA 2WFAA 4Z9XA 2IF0A 4HWRA 4PHAA 4CE6A 3PE3A 2IA6A 3AF0A 4HYTA 2V5AA 3NANA 2X9LA 1CNFA 3ZC3A 1Y7TA 2CZGA 1AUXA 4REQB 3PUYA 5IJWA 1U9JA 3BIJA 3NONA 2I9GA 2IKSA 2UKDA 4ZOEA 3KZOA 1NXOA 4C8MA 3U3RA 4BVBA 2HMWA 2AQKA 1YV9A 4JKIA 4E6EA 4DM7A 1KTIA 2NO7A 1ZEMA 5KVVA 1J1UA 3MBOA 2R5WA 4L22A 3TLKA 5LLTA 1PNTA 1SVWA 2RP5A 4I1RA 3NIBA 3R41A 3WQQA 2LCFA 5E95A 3AYXB 2YWGA 1SOUA 4DL2A 1QO0D 1Y1TA 3M5PA 4J6FA 1IHUA 1DZ3A 4LXHA 2WRZA 1V35A 1KRXA 3RI3A 4R01A 2PPLA 4GHWA 4RD4A 4ASUA 4RNOA 3A4NA 3IIMA 4CN8A 1RD4A 3GMDA 2I2AA 2F64A 1SCBA 2QGNA 3GEPA 4MTCA 4Q9LA 2LCIA 1PNQA 3S6JA 2BTQA 4I6GA 4WA7A 5DBIA 1C7RA 1N2CA 4RJ2A 3GJ8A 1HT3A 2D0PB 1MIOA 3UICA 3KQYA 1JKJB 2XXAA 1N3LA 3LHSA 4M4SA 3KXLA 1QFYA 3C70A 5GGXA 1IUNA 4AJKA 3DM5A 5A0TA 1NOIA 1JBQA 4Q9AA 5C5DA 3LPNA 4DV0B 3ZS9A 2UUBB 3KL2A 1QQ7A 2I99A 5EJ2A 2XICA 2AMFA 2PMFA 1JHQA 4WN9B 3BD8A 1QCDA 1GFIA 4ACAA 5TLSA 1QB8A 1RNLA 4YRTA 1Y4UA 2PFQA 1JXEA 3QSYA 5H0IA 3G0CA 4QZGA 1M8PA 5DDYA 5K0NA 3AB3A 4JUZA 5AVJA 4P3PA 3CONA 1V6AA 1E7MA 1VLLA 4UDXX 1OX5A 3RIYA 1UK7A 1VP3A 3NHMA 2PFGA 4QOGA 3GIIA 4D7AA 4J9LA 1XKTA 4OYYA 1WBBA 1LBTA 3FKSA 2Z43A 3MT8A 1HTTA 5K8LA 1YRAA 4FKMA 1RBMA 3V1LA 1BWRA 2ZWVA 4HFMA 1QBKC 1V85A 4EF6A 4QXPA 4ER5A 3AJEA 2XDQA 3MCVA 4YP6A 3W79A 3OLVA 4JJGA 3B9PA 3G1UA 3ZHVA 3FUTA 1E9FA 5HVNA 2QIOA 1J70A 4UREA 3B5EA 1GITA 1RYDA 1JZQA 3VJLA 3FKJA 1U7PA 2G9VA 1FJXA 1Y1PA 8ICPA 2HDNB 3ZCVA 3HZOA 2G3YA 1V5EA 3QU7A 4JSTA 1I7NA 4XSHA 1OFTA 2JLCA 3H0MB 5CIYA 4D56A 1P0CA 1TE2A 3JAWA 4QPDA 4IFBA 3GIKA 2TMYA 4RVCA 2O3RA 1L4UA 4QA9A 3NGMA 1DKQA 4FJ1A 2X8WA 2P4UA 3Q3VA 1HH4A 3F9RA 3N2KA 3IM1A 3QK7A 3QBVA 2YVQA 2CJWA 1H6BA 5AJYA 3EQ7A 1M2VA 3HKBA 3RRBA 3PPXA 2X1LA 1OWNA 3IMGA 4LRWA 3GDHA 2TMDA 3DDZX 2REXB 3R6TA 1KVTA 1NC3A 4JVNA 1EFDN 2MYNA 3ITNA 5DGXA 5KNLA 2QYOA 1RLOA 1WWVA 5FL7D 4K6KA 1ZSNA 1ICEA 2H07A 3S8EA 3NWBA 4PNPA 4QUAA 4YCJA 3HS3A 3OZDA 4I1VA 5E7JA 4DWOA 2FWRA 4UAYA 2JAHA 5F3RA 2ZCUA 2OCKA 2KJ8A 5K09A 4MHVA 2ZI3A 4EGJA 3D8SA 1W93A 4X64B 4HLDA 1RFLA 5KU7A 2QTWB 3F3KA 2QVLA 4GMDA 1REQB 4EYIB 2Y3IA 5JSYA 3TKYA 5KS2A 2DVMA 3RUEA 2WDZA 2CCJA 1K6MA 1L3VA 5JSQA 3K70C 3KHHA 4TZ0A 5AI4A 4AXBA 4PN7A 1Z4IA 4ZQHA 2P9GA 5KG3A 3PF8A 5DBFA 2B1IA 3GJ0A 3Q1KA 4O25A 3R5XA 2BRUC 1ZK1A 3S1SA 4DL4A 1YI8A 4G6ZA 2BQRA 4HZUB 5JI2E 4HLUC 3NHLA 2RJOA 4IUCS 3PW0A 2JFXA 3OLZA 3WDSA 1XI2A 2O7QA 2QRZA 4WUVA 4Q7QA 3U0VA 2IYZA 5KTPA 3CZPA 5ENVA 4CMHA 2A57A 4Q9JA 1FJHA 4J7AA 2X9NA 4IPTA 2JKVA 2P75A 4OKSA 4UXHA 1NW9B 2CUTA 1CWUA 3A1TA 1E5DA 1XYGA 2H06A 2K87A 1QLWA 2CVQA 3E15A 4OHKA 2XIJA 1KH1A 4MGKR 3S0JA 4I2EA 4RPXA 2AQ4A 1T1EA 1TKRA 1QORA 3EAFA 1ZQIA 2RAFA 1ZNQO 4OHFA 3Q8MA 1PJ2A 4WGFA 2FVXA 3JQAB 2CVFA 3LYLA 4IJMA 5FEMA 2OZEA 4LZOA 3TTSA 4EF4A 4EO4A 5AM2A 4CLOB 3SYRA 4WXEA 4BCDA 5DG9A 4M7WA 3UT0A 2NIPA 1VPEA 3OZGA 3CZRA 4YB8A 2C88A 2F9MA 4IOMA 2C3MA 2WVJA 4B32A 2HHHB 3N1UA 4OHOA 4WLUA 3RFXA 4A2WA 3KEGA 3T7KA 1AOXA 4H4DA 3DTVA 3U44B 2ZRBA 4LAFA 4LPSA 2GAJA 4F3CA 1ZCJA 4RADA 2XGPA 4UZSA 3JQAD 1NUAA 4YCAA 1PQPA 3BILA 5ITZB 3LY9A 4MQMA 2C1XA 3WYGA 8ICRA 1EDZA 2DTDA 2XA9A 3E4DA 1GKLA 3RS8A 3WGNA 1L7QA 4K6OA 5BMVF 2TMKA 3U1VA 3CSUA 5GIPE 1JDNA 3FRJA 1MH9A 3L46A 1SELA 5H16A 4W1RA 5ESWA 1UZAA 1Y34E 3WHLA 5JYDA 2PI4A 1J0XO 2CXHA 4UTNA 3GAMA 3MLBA 5ECGC 2K4IA 1T6BY 4A2CA 3OQHA 1FTYA 1E60A 1X14A 4DMKA 5EIWA 3OPYB 2XUFA 4IMPA 3WBFA 3UB4A 3MR3A 4UFNA 2RG1A 2YYYA 4F84A 5K20A 4PH5A 3ZVRA 5ITWA 2WWRA 3ZWMA 4EG3A 3QEKA 1UM8A 4Q66C 5J2TF 2VK8A 1LDGA 1N5RA 2IMWP 4JQSA 1XCGB 4C0LA 2IP4A 4ZAWA 4DPKA 2VRWA 2NZUG 1IOZA 3R9KA 1ELOA 2KICA 4BV9A 3T7CA 2VO1A 5IRCD 3ZBQA 3ONFA 3E81A 5KT2A 3QENA 3SQWA 3JV7A 4OAPA 1ORDA 2BJWA 1XAGA 1F6WA 2GF9A 2WV9A 4N47A 2VF4X 3EXFA 3GT4A 3OE5A 1G3QA 3A4LA 1DOQA 4F2GA 4AROA 2ZI6A 1XR3A 2V5UA 4I99A 1R3UA 4OHVA 3DPSA 2DFLA 4TXHA 3OZSA 3ZWOA 3NVZA 1M8KA 5EE1A 3OM9A 4S35A 3T35A 5J2CA 1K6XA 3KAPA 2B2NA 1AUPA 2ONCA 2AN9A 2IV2X 2Q0QA 3V32A 4BFUA 2ALZA 4CL0A 2Y9TA 3FYCA 2P7HA 2OMEA 3NBAA 2WEKA 3QOWA 2BFMA 2XCOA 1B16A 4BEWA 1CUCA 3U17A 3O03A 1JU4A 4KLLA 2HA7A 5BMVA 3PE6A 2V0NA 5KNBD 2J3MA 2ID4A 3PZRA 2FPUA 9ICWA 3NHKA 4DM4A 3ZDBA 2PKQO 4R9VA 4ZOHC 4W8HA 3A10A 2NO5A 1XQYA 4F56A 5CA7A 4BKMA 1RWXA 2VNAA 3KD3A 2BM0A 3IDAA 4O2BA 1AVTA 1LBEA 1I7DA 3RS3A 3GB9A 1BQ4A 1M0TA 4A26A 1K1EA 1XRPA 4DQUA 5H7XA 1D6JA 4MDHA 5IDWA 2ZE8A 3E27A 4EFNA 1LU9A 2CXYA 4O0IA 4P5DA 1THGA 4U7PB 4GX1A 2B6NA 3JQFC 5FP0A 5K3AA 1FDWA 3RG8A 1VL5A 3KSAC 3TVDA 4FOLA 2NW6A 4KQWA 1U9YA 5DIFA 2EW8A 4D9CA 2FZVA 5J2TA 2FWMX 1MC8A 1EA5A 1ZIXA 5TDHA 4X1IA 3LNTA 4L27A 3SHTA 2AJCA 1Z3EB 1L7EA 4EBBA 4F8EA 3GT0A 2NU6B 4IMIB 5EAIA 3C3YA 1JVSA 1QYIA 5J58A 1QHXA 5JNSA 5JQGF 2R7NA 4R3NA 5JSHA 3M70A 4GNRA 1TD1A 5JJIA 2QEQA 1GL3A 3ANSA 3R3WA 4I46A 3HWSA 3E48A 2ZYRA 1Z5NA 3WK9A 3OWHA 1HKUA 4L8GA 4UHJA 1F7VA 1M72A 3H8VA 5TR9A 1TRKA 4RMGA 4UPVA 3UWOA 1WUDA 1DX6A 3QA3E 1QE5A 2OD2A 3ZJYA 3AL3A 3AXTA 1L5RA 3F96A 1O54A 4Q93A 4MWGA 5JPDA 1QCKA 4U1RA 5HF8A 3IQDB 4FFBA 4NL9C 4H3SA 5HBRA 2R60A 4O1IA 4QBIA 5JD5A 4AX8A 1KI7A 1RT9A 4OB8A 4OB7A 3PICA 2XDYA 4KO2S 1J0EA 4HQFA 2AYZA 4CFZA 3VZPA 3TEJA 5EQFA 1MA0A 1E3MA 2JHFA 4C80A 3TBKA 4TT3D 2LKDA 3VV2A 6GPBA 4H35A 5KINB 4CIYA 2R66A 1WHSB 1M2FA 1IQUA 2WR8A 3D1LA 1WL8A 5IBCA 1P4HA 1RIIA 3LCJA 5FV4A 4PTYA 5LOVB 1MD9A 2NAFA 4HLQB 3H1EA 1FOEB 2DR3A 3DD5A 1UK6A 3OJFA 4LJYA 3RLIA 3CZ4A 1CVLA 3EFOB 3S99A 3EEBA 1K7FB 2J6UA 4KQKA 3GFFA 2PFKA 3IQWA 4GD3Q 3L3BA 5IS2A 4K9PA 3FI9A 4FDMA 2P5UA 1GPUA 3BD6A 5JY6A 1DSSG 3NAMA 5AIBA 2CYAA 1CS0A 4OX9Y 1TC1A 1TUEA 5LC1A 4S0ZA 3C1OA 3VC7A 1Y4AE 5A4AA 5T14A 4BO3A 3RTAA 4US2R 4C0KA 4KMUA 4P22A 5ITSA 5FNZA 1TQHA 3LVBA 1KI9A 4BWFB 3QLVA 4TS3A 1T15A 1GRCA 1U99A 5JQGA 1JFLA 2Z2YA 2ODBA 3JQPA 1EB9A 1DIHA 3UK1A 5IEBA 2V6JA 4XFJA 4L5BA 5FI1B 5IAEA 4PTZA 4US9A 3N3BC 1JA0A 4GPEA 3ZU2A 5D5QA 4FFSA 3O8BA 3G23A 4F7DA 1X87A 4M1QA 4TWIA 5KG5A 4QLBA 4E11A 2PU5A 2AFIE 1ZJMA 4V0KA 2PMDA 1OX4B 2Q8QA 2QG6A 4I2GA 5JDIA 2X1HA 3CUVA 1QZZA 1CUXA 1N0VC 4D9HA 4CEJA 4I50F 3ZD6A 3JQQA 4BOYA 1JROA 2QL5A 3PKIA 2R6CA 3VX4A 4NHOA 2DHRA 4F5PA 1MNQA 4HZGA 4I0WB 1FDIA 1CJSA 4AN0A 4USAA 5GTHU 3AR6A 3CB4A 2P9JA 5FWAA 1T1SA 1P7DA 3WSWA 5G0VA 5EPEA 3A6PC 1JHDA 5EXEA 4A9AA 3OU6A 5KFDA 1B7GO 2J33A 1PD0A 5IF9A 1ZQAA 1RI5A 2DPHA 2AI3A 2ZCJA 4FJ2A 2ZPUA 3EPPA 1T9ZA 4NU8X 5C8XA 1FU8A 2J3EA 2P65A 5L7YA 4BGUA 1LV7A 3M6LA 2JDIA 2FSVC 2WT4A 4F4DA 4D6YA 3A3KA 1NULA 2W6NA 1NUTA 4CMEA 4YHBA 2AFIB 3ZEAA 2C7RA 3N2IA 2GR9A 2DYKA 1FDVA 4NS1A 3R3ZA 1NNI1 3F5DA 4MFCA 5CUQA 1J1IA 2CY0A 3ESBA 1DRUA 4CCYB 4OGWA 1N34B 2HCTA 4JLSA 1PJAA 5BYAA 4IOJA 1XFAA 2PXAA 3DKIA 3K6SA 1IUOA 1Z6QA 1EB8A 4KFUA 3KTAB 3UA4A 4FFMA 2F55A 1JYFA 4NQZA 1I4EB 3NAZA 1JS1X 3FJOA 1NBMA 2PK3A 4OO3A 4K4GA 4LFAB 5HSGA 5IZCA 3IVXA 3NPMA 3JPQA 4EG4A 3ICXA 4JWMA 4I9GA 1SNYA 1T1IA 1RRCA 3AEKB 1I32A 16PKA 4JEHA 4ZEVA 3R3HA 3MTIA 2DCMA 2EIHA 1R8XA 5REQA 3UAYA 4D4LA 3GPLA 4RJKA 2DE0X 1UXGA 4HFRA 3K0FA 5J2KA 2Z5GA 3FKQA 4YONB 5EIAA 1NJ1A 1VECA 5ER9A 3SYNA 3D0OA 3I2FA 3VPDA 2QPOA 5EGSA 5IXSA 5GM2A 2QVCA 2LM4A 4KK3A 2OM6A 4CWAA 3AO0B 3DC7A 3OCVA 3NT2A 3X1MA 1IZ8A 2EJVA 5J3JA 3PQCA 1XTUA 3UPDA 4I50A 4JP5A 1T94A 1SXJA 1NZDA 4QOSA 1U4BA 1L5UA 4FCVA 4L75A 2HA4A 2E85A 2MYUA 2ACVA 3U4MA 2TMGA 4UAWA 2OECA 5DW0A 4KLTA 1Z2EA 4LMAA 1PJ4A 3TX6A 1XGKA 3V6MA 1E79A 4V0SA 3R8FA 2ZUTA 3T4XA 2IXTA 4FZRA 3VOBA 1ZBQA 4KLIA 4Z0NA 4LTMA 1UDCA 2QTNA 1SWVA 4DCMA 4J4BA 3TVYA 2ZIFA 2X0NA 1FVFA 5AMXA 4XDGA 4DV2B 2BMDA 3BB3A 1L0BA 3SS8A 4RSRA 3M6UA 1CUZA 1Z73A 1CIPA 4R7ZA 1T6XA 1ZLXA 1A3CA 4YUXA 3MC1A 3M81A 3WV4A 1X40A 4YDRA 2MWMA 3B1FA 3RB0A 4FN5A 2AX4A 1R7RA 2N46A 1XN4A 4MYDA 2FUNB 5TT1A 4HADA 3KLNA 3LCCA 2ZIAA 4LNUB 4IIHA 3FUWA 4LMBA 2HHUA 2N42A 3CZCA 1K4KA 4DSZA 1ID8A 3EIHA 2MINB 4ZHQF 3BQTA 4LGMA 3ORYA 2K89A 2I4RA 2H48A 1KDYA 5CFQA 4EHHA 5B64A 5ADHA 4UEWA 3FNHA 1A76A 1CEQA 4WK6A 1C30A 1RYFA 3T5KA 1W5AA 4P7BA 5EJIA 2AFHA 3N7TA 1XZ8A 4RPJA 2VDNB 3GQBB 2AZDA 1X1SA 3Q8KA 1YJ8A 2C2BA 1I2MA 2C9ZA 3ZGLA 3ABZA 3P20A 4DLAA 4EGQA 4X45A 2JLRA 1T8SA 4F3NA 4CMBA 4BNNA 5ISMA 3GCXA 1MKYA 2FLVA 2AA3A 2XOXA 3BRWA 5FLKA 4NV1A 1PU2A 3N2GB 3QFHA 3W1VA 2V7QD 1EEHA 3K4QA 1EEXB 1YTUA 2F2AB 1ZNWA 2WYUA 3B13B 4WOJA 3G68A 3DM9B 3KAQA 1TQ2A 1JSCA 1X6IA 2RAVA 5KNCD 3LIIA 2CMKA 2PPVA 4Q16A 1NUHA 2WA1A 1RHRA 4MJLA 1JDUA 4YK7A 3OEED 3H5NA 1UDRA 4Y2QA 2DBYA 1OKKA 3TADC 5I4KA 1EQUA 3BE4A 5GGYA 4BNTA 3DB1A 3THXA 4BQRA 2VRBA 2DWCA 4DRZA 1LH0A 1S1MA 2I6XA 2IEIA 4RTLA 5CA1B 1NLYA 3K0BA 3S4YA 4J07A 1H69A 5H5JA 1Q1BA 1SXJE 2HRQA 2PA0A 4MYSA 4I2DA 2HRRA 1COKA 4P4GA 3JQ7B 5HZHA 5J4YA 4IVNA 2PX8A 4OQYA 2XA2A 4BMDA 4EIWA 3ZNNA 2RKBA 4MVJD 4YR0A 2P2LA 3RBZA 1IBSA 2Q49A 3VR5D 3ZXYA 4ZQBA 2GK7A 2C2ZA 3VCBA 4XM0A 1GNRA 3D2AA 1Z47A 1P2BA 2V58A 3CWQA 2X15A 3OM8A 2VTDA 4YRLA 1SO8A 2H3EA 2B61A 1Z4OA 1PVQA 2G17A 1VMAA 3MD0A 2AMVA 1VXRA 5JWRA 5DH9A 4YMVA 1QH8A 2YMQA 4ZHQA 3KQVA 3L0DA 4N76A 4KXLA 5IMBA 2BMFA 3BXPA 4EZIA 5D46A 3KFXA 4C0SA 4DQXA 5FX2A 1JRPA 3CA8A 1G8MA 4FGZA 2WJJA 4EPYA 1QCZA 1OXSC 2HI0A 1XKXA 4WEQA 4PLWA 1BWSA 3CGWA 2G82A 3NEJA 3M33A 1LNSA 4ZRNA 4F2RA 1ZGAA 9ICPA 1GGJA 2QMOA 5B1HA 1GILA 3OLQA 3A7DA 1J0CA 4RTNA 4AS1A 3RRFA 1Z56C 5A9RA 1NPYA 2AXNA 4NFHA 1HY3A 1X6VA 1PP4A 2IBTA 1EDEA 3AFMA 4S2EA 5J0OA 2POCA 1T2EA 4ZODA 5T4HA 3B1YA 3VI4B 3TECE 1Z00B 2CNBA 2HUNA 1TQ6A 3AETB 3HWX1 4MV7A 1EFPA 1F0KA 1QHNA 5IJ9A 3E22A 4RFVA 4LF6B 1XZQA 1E63A 2M0NA 1M7GA 1Y3FE 5DGBA 4HXFB 3VYWA 1YUBA 1NRWA 2GN4A 2CV1A 1HDOA 5FR1A 3A6KA 5FI3A 2WZDA 3MGHA 3I6MA 3F67A 5EE0A 4TMZA 3TW8A 4FMCF 4A23A 2HDHA 3IDZA 1RQPA 4KO1S 1JXLA 3K20A 2JFBA 2XE6A 4EYSA 3WDLA 3GP5A 1YHZA 3ZCRA 4GECA 4NLNA 1OT3A 3W3AA 1VRCA 2IS6A 3DT8A 3RS4A 3HLTA 4LW8A 4IFTA 3HNOA 1BJRE 3LFHA 3VYTB 4ID9A 5DOVA 3RS9A 2XDWA 3P4YA 1A9RA 2FMKA 3VKWA 4YGYA 5MHTA 5I7EA 5LLDA 1RC1A 1YZ7A 2ESEA 4K2AA 3O8OA 2Y9MB 4OMDA 2CHFA 4EVRA 1ZCZA 4D2IA 4O2LA 1WXFA 4RCYA 1N92A 4IXNA 1Z75A 1SUBA 3NWOA 3G2JA 4BFYA 2WM8A 4AT1A 2J1LA 4BLVA 4DQLA 1NX6A 1C9YA 5C51B 2HHTA 1KK3A 1P4JA 3BWEA 2QTBA 4KREA 4CZ2A 2GO7A 4ZALA 3T8YA 4FT2A 3VMFA 2WU8A 1ORVA 3SC2B 1VMKA 4LOJA 2ZATA 3UWSA 1NK7A 1S89A 4NM2A 4ALIA 1N32B 4ZVUA 3D3WB 5L1LA 1X1CA 4WIAA 4KG7A 1OLXB 4FYJA 2HMTA 1QO7A 4LKOA 1E4YA 2WAMA 2RB5A 2AS0A 4YRQA 4DSFA 1W4CA 4O6VA 1KI8A 2QUAA 1XD2B 3QVTA 1VZ2A 3F6PA 3Q2IA 3D6NB 5KOHA 2WJPA 4CEIA 3GHHA 3SJZA 3DVSX 2FR8C 5DQGA 1XLWA 4Z6DA 2QQFA 2CNKA 1VDZA 2VP5A 3M2TA 3N2EA 3N5KA 5EJ6A 8ADHA 4KZKA 1KEPA 4JEUA 4JBXA 2BAGA 1QYXA 3EGWA 1RAHA 5DM2A 3D54D 1K89A 1YWGO 4RQ7A 1HQDA 1M2GA 3CUUA 2HY7A 2FI1A 3NHZA 2QHXA 2NT3A 2NWQA 1AXGA 1Z8HA 1PIWA 1FSSA 4BNUA 3WJ7A 3P2KA 2WG0A 1SCAA 4IIJB 4B40A 1CZOA 4JI7B 2W9MA 3CLTC 3DVAA 3HMQA 3PCRB 1PX2A 4YR7A 4Z4EA 2MUTB 1V43A 3BYZA 4RLSA 4NLCA 3FSGD 5KMGA 4GI1A 4XJSA 4IHQA 2KKPA 4YGXB 3F2BA 3QLUA 4DLTA 3KUUA 1VYHA 3CBQA 4WMLA 5HZMA 3MAGA 1BDMA 1MQAA 1O94D 5C31A 5LUAA 2JA1A 1VJCA 5ECYA 3K7EA 1LJUA 2Q46A 4B46A 4KR6A 3WK7A 1GLVA 4JXXA 1MW9X 4Q3NA 4PAOA 1X9XA 4U63A 3ED5A 4WXMA 3DVRX 2PR2A 1NJ6A 4CV1A 4BAZA 4MVJM 2VYQA 1L4LA 3EQ9A 1KAGA 4ESOA 3SC4A 4EUEA 1X7ZA 1KYWA 2PGLA 3PSAA 1UBLS 3TUZC 4O5CA 2HMYB 3MYYA 5JATA 3LVWA 4E15A 4P98A 2EQAA 3SQOA 3DZFA 2OILA 1AMNA 4JQCA 5KAMA 3DE0X 4YR2A 4QJ5A 4QFMA 5I9IA 4Q1AA 4J43A 3N4MB 1FTSA 5FF9A 2CZQA 3FOBA 3WL5A 4G8DA 4AO6A 1G38A 1IHPA 2DCUA 2OXFA 5FBRB 4NOMA 4KW7A 3A6HA 4WNYA 4EJSA 3X2EA 1J24A 5DNDA 2IODA 2M6SA 2PL3A 2IPOA 4YMOA 1AZTA 3FDZB 1RHJA 3M1LA 3DW3X 3G2IA 5DG7A 1R27A 2FJ0A 5ALDA 3M4XA 1P5JA 3BRSA 1MRSA 4CLEA 5IH3A 3LH5A 5E4YA 2J87A 2I03A 2E3JA 3C3MA 3W3AH 3A9TA 4IVQA 3ROXA 6REQA 2JAWA 3OD5A 5KYGA 1GRRA 3MXTA 2PBFA 1PLLA 3MA0A 1Y9DA 4FCWA 3BDAA 3K4GA 4DL7A 1G55A 2VA8A 2HPZA 4ZYLA 3IV9A 3JATA 1EHIA 1D1PA 5EKSA 3ND6A 5I7SA 3ZD7A 1KFKB 1T8UA 4RT3A 4CM8A 4MPPA 2YVUA 2G04A 2R4TA 2IPMA 3SVZA 3ZLUA 4OQEA 3JPOA 3JR3A 5AI9A 4S1OA 3SF8A 2BEWB 4B6SA 3NT4A 1XCMA 2VVTA 1WSAA 4CCWA 1NBOA 2GZ1A 5DULA 2DGZA 1NUUA 4Y1GA 4MHSA 2CXXA 4JL6A 3R4CA 2C2KA 1CY7A 4U2BA 1DGJA 2YBDA 3C2MA 3KETA 2IRWA 2F43A 4L9WA 3RWBA 3IMFA 4RH0A 3ZQUA 3QKRB 4FDLA 4JC8A 2C9BA 1U94A 1CP3A 2IZOA 1BD3A 2V9CA 3JPNA 2YZKA 3BH7A 4PSKA 3BMOA 5JHGB 4ENUA 3MOGA 1QR2A 4RNNA 4UHKA 2I2WA 1JT2A 3R5FA 1KVUA 2GJ9A 1UOQA 4H4EA 3KPUA 5IP5A 1OA1A 5BSEA 3S2UA 3WX0A 3ND7A 4BFCA 3SQMA 4BO9A 1OW5A 3WRVA 4AY5A 4REQA 1C9DB 3LOPA 4DJAA 1BW9B 4MF2A 2XKBA 5IABA 2VJNA 1F38A 1UZUA 1I3OA 1I36A 2M6RA 3GDXA 1NK9A 1RQ2A 4RY2A 3JVDA 3M1YA 2JB9A 4IKEA 4MB2A 1P19A 3L8DA 4AICA 4J49A 4N5DA 4GZMA 5JT1A 3R9XB 4LV8B 4TUQA 2G40A 3TIIA 1CY4A 4PTLA 1Z5ZA 3S3TA 3LW7A 4ZA2A 3B7WA 4D96A 3JPSA 5B5EU 1B0AA 4Q1VA 1WDLA 2IZZA 4UE2A 1DJQA 1F8XA 4GXNA 4CIXA 2IH4A 3TIGA 1M6EX 5A7GA 2QM0A 5DNVA 2VDPB 4BKQA 4U3JB 2PS1A 1TJ3A 4B3TB 4QHSA 4F4WA 2P9ZA 4IILA 2ASLA 4ZO9A 1XTVA 1S9FA 2H51A 3KQMA 2HCRA 7ICIA 3QELB 1TK0A 1Z74A 3CR7A 3ZHQA 2OG2A 1CEXA 1F0YA 3KSRA 2D2IA 2C07A 3JZMA 2IYUA 1DKRA 1ZH4A 3DG9A 3T5PA 1JKJA 3MT7A 1N2IA 1SKWA 3SY8A 4ERXA 2WT8A 1XU9A 3O92A 2A0XA 5GOTA 3M89A 4ZT7A 3Q7IA 3SWWA 4DF3A 2PSJA 3SN6A 2H31A 5CM8B 3QXXA 1HF3A 3R44A 4WN9A 3EZFA 2P2CA 4X44A 3O8NA 4N48A 1M0EA 4U7CA 2VHVA 3IUYA 2ZZMA 1BC5A 3FPJA 4B74A 1MHTA 5C3UA 5IAKA 4C7ZA 4TT8A 1C3VA 4QUDA 1AGRA 4EMBA 3QLTA 1UXOA 1OZFA 1CUSA 1LB2B 4RGYA 1J1ZA 2F62A 3VHXB 4C2UA 1SXHA 4G07A 4GQBA 3PE4A 1H65A 2MSEB 1ZY2A 1O08A 2R8PA 4IH4A 4M37A 2M1XA 2JVJA 4ROSA 3Q7TA 5KT6A 2FUKA 5ARBA 1YIAA 4JVLA 5F5NA 2PN1A 4J9RA 1W36C 4JNCA 4NBVA 1VMIA 1U7OA 4UAUA 1TKAA 5IJ0B 2DUUA 2KMDA 5ALHA 4S2UA 3ZG6A 3Q9UA 2BDUA 2OPHA 3ZXSA 3CF6R 4V2IA 4BC1A 2ZZKA 2CLEB 4BQSA 4AJLA 2R4UA 4W5NA 3C23A 1S77D 4E51A 5ALZA 3D6HA 2Q9UA 2JMGA 4RT2A 4BDPA 3HVRA 3RF9A 1JXAA 2IDKA 2QIPA 3IAHA 1VYVA 3WICA 2ZSEA 1F2UB 5C0YA 3CLVA 3DOUA 3C29A 2X4LA 4R31A 2XVZA 3NZEA 1BJKA 4US0R 1L5WA 2HJRA 1LRKA 1XTZA 5LQKA 4Y7DA 3CVUA 3DMTA 2GYUA 2AQ0A 5JECA 4MRNA 2PGIA 5B53A 2FWAA 2YZNA 1NMSA 2HWYA 5J0XA 2IBMA 3HI6A 1VBMA 3ETEA 1NHWA 1N75A 2GAIA 3W7AA 1MGOA 1A8QA 3DAGA 4PZAA 4A5SA 2IIVA 1OY1A 3EXEB 2V9PA 3G0HA 2O8EB 2R7MA 1N6KA 4B3IA 4RC9A 1XXHB 4NAHA 4D9IA 2AD5A 2ERCA 2W9AA 4M21A 3K9BA 2KLHA 2JFGA 3P71T 1YF3A 3CLSC 3HBAA 3KLPX 3R7DA 4OATA 4WE3A 1UKZA 2BVNA 2DU8A 3F8WA 1L7BA 4Z9AA 3DLBA 1EAMA 4MMXB 2DF4B 1QHFA 3WL6A 4GPTA 4R1PA 4Q3EA 1YFZA 4JUCA 1YCGA 5CG1A 1XCOA 4JA0A 5CB0A 4D9JA 4UHBA 1RCUA 1CFJA 2QKYA 4N0DA 2WAQC 2QYTA 3K9NA 1D9ZA 4OXYA 5J0RA 4GLLA 1GNVA 4R1QA 8ICYA 3PX2A 1CQIB 4CLHA 2GPTA 3NUQA 3MW8A 1REQA 1XRRA 3H87A 2WSIA 5LD2B 3V8VA 1KQNA 5CCDA 2DQYA 4JJ7A 2P3QA 2H9IA 3L1KA 4BVHA 1O1YA 2OZLB 3PHIA 3TJMA 4NBTA 4KXWA 5GQSA 5AQEA 3OTOB 1KZ7B 3F7TA 2XMSA 3TOZA 4BRUA 3NNDA 3V42A 4ZVQA 2SKDA 3OTWA 1PDOA 1PNVA 5M29A 2Z04A 4HZUA 3DBVO 2MRLA 3HRKA 4LCJA 4G0YA 3K9CA 1HDEA 2C94A 4II3A 3O84A 3I6YA 2KB0A 4MVJG 5AHWA 4M7RA 1R74A 4Y2PA 2Y93A 2WA2A 5IC5A 3QX3A 4PGMA 1E92A 5BR7A 1ULBA 3GU3A 3ZWKA 2OMKA 5COBA 4AS3A 5HKAA 4U9IS 2LIVA 3C4JA 4CF3A 5TT0A 5BV1A 3F49S 4UUOA 4L8WB 1EIZA 4PJ0U 4RIIA 3R6LA 5DTIA 3JVEA 1QE3A 4RU1A 5SY9A 2FPOA 3BK7A 2XCTB 2PJZA 4DS4A 2BDPA 4C3ZA 4MARA 3JQAA 4ETIA 1YB2A 4ZEOA 1AB6A 3AINA 4FNOA 1FUEA 1QIGA 3UG7A 5HW0A 4UU8A 4LBYA 4CLOA 2HMVA 2ZYDA 2VNJA 1DK3A 2V55B 1Z2OX 2H2AA 3P9KA 1GGHA 4MRVA 1LNZA 4AUNA 3W9SA 2XSZA 3CIOA 3BTUA 4QYTA 5A1JA 5HK9A 5CLJA 4J0GA 5K3SA 1M6VA 5KYUA 4FKBA 3U44A 1KO5A 3TARA 1NXXA 3UXPA 3V4LA 2H5EA 5JRTA 3LWDA 2SBTA 2LIPA 5DBCA 5ITZA 2VJAA