4CF5A

Mutagenesis of a rhodobacteraceae l-haloacid dehalogenase
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
223
structure length
222
Chain Sequence
SGILVFVNETLLDLTSLSPLFERVFGDAKVLREWFPELILYSQTLTLTGLYRPFGEIAAAVFEMVAANHQAKVTPDDIAELKTRLTSMPAYPDVAPALTRLQDAGFRLVTLTNSAPSPAPSPLEKAGIASFFEAHLTVHSSQRFKPHPSVYDSTAETLGAKPEELCMIACHIWNTIGAQARGWRGGFVARPHNTPLTLAEVPQPDFIGRDMGELADQLIASL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords L-HALOACID DEHALOGENASE
publication title Mutagenesis of a Rhodobacteraceae L-Haloacid Dehalogenase
rcsb
source organism Rhodobacteraceae
total genus 86
structure length 222
sequence length 223
chains with identical sequence B, C, D
ec nomenclature ec 3.8.1.2: (S)-2-haloacid dehalogenase.
pdb deposition date 2013-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 4cf5A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4cf5A01
2YJ3A 3OCZA 1MH9A 4Y2SA 1LTQA 3QLEA 5AVXA 2JARA 3SKXA 5AKHA 1NNLA 4F71A 2RARA 3QGMA 5AI6A 3KOOA 2I34A 3N07A 5AKYA 2FUEA 3U13A 2PQ0A 5ALGA 5ALLA 3L7YA 2YJ4A 4YH1A 1U2TA 2B30A 4HAIA 2C88A 1YNSA 1XPJA 1NRWA 4PNHA 3ZX5A 3ZWKA 3R9KA 4XOUA 1ZRNA 5AK3A 2ZBGA 5AKLA 2R8YA 5AI5A 5AM5A 3HLTA 3NALA 1Z4OA 3QU7A 1Z5GA 5ALPA 4EEKA 3QNMA 4DCCA 3WK8A 4KNVA 3N1UA 4FE3A 5AKEA 4ZEWA 1RC8A 5AW4A 5E0OA 3QUBA 3PDWA 1RKUA 2OM6A 4YCMA 5ALUA 2I6XA 3SHQA 5ALVA 4NFLA 2FPWA 4FFDA 3L8FA 4YIHA 3A1DA 3IJ5A 4YCLA 3A3YA 3I6BA 3EPRA 1XVIA 4GIBA 3K1ZA 3ZUPA 4CF4A 1YDFA 1RKVA 3VAYA 2W4MA 3FPBA 1WVIA 3L8HA 2WF6A 5AESA 1TE2A 5ALOA 5AK6A 3KZXA 3N28A 3B8EA 1U7OA 2YMLA 1Y8AA 1SWVA 1T5SA 2C8LA 5AKJA 3ESRA 4AP9A 3QU9A 5ALTA 1TJ3A 5IT4A 3L0BA 1AQ6A 1L8OA 2ZOSA 5AW0A 3I28A 3UMGA 1Z4QA 5AW3A 4BX3A 4BEWA 3F9RA 3E8MA 2R8EA 3SD7A 4KX5A 1Z5UA 2NO5A 4BEVA 3OCXA 3M9LA 1L8LA 4IFTA 5A3QA 2EAUA 4JB3A 4I9GA 3EWIA 5T41A 3L8EA 2B82A 1O08A 1S8OA 4RESA 1QH9A 3ED5A 2G08A 1ZD5A 3NRJA 2W43A 4Y2PA 2PKEA 5ALSA 4JDPA 1SWWA 3A1EA 1LVHA 3BWVA 2P27A 2HX1A 3QUCA 3UMBA 2AUTA 2DQSA 2HHLA 4MUMA 1RKQA 5ALIA 4UU1A 1EK2A 2WF7A 4FYPA 1RQNA 1RLOA 1WZCA 2YMMA 2B0CA 2OBBA 3FPSA 2JAOA 2HEGA 1ZD2P 4UMDA 2NO4A 4Y2TA 4ZEVA 3FZQA 4O8CA 3PGVA 3RF6A 4KX3A 4I9FA 5ALJA 2O9JA 1U02A 2YJ5A 3QX7A 4AS3A 3WKEA 4OCZA 1YV9A 2CFRA 2G0AA 2B1QA 4AS2A 3AR9A 2OYCA 3ZWDA 1Z4PX 2YBDA 3RFUA 3MPOA 5AIBA 3PCTA 5ALHA 3DV9A 4C4RA 2MU1A 2Q4RA 5AM0A 3IB6A 3CNHA 2GHQA 3WK5A 3U7HB 1ZRMA 3QU4A 2P11A 5AM3A 2ZG6A 2GMWA 2W11A 3ET5A 5ALQA 3L1VA 2AMYA 3OCUA 1L7PA 1IWOA 3ZVNA 3AR4A 3I1YA 1K1EA 3ZX4A 1T5TA 2R8XA 5ALXA 3DAOA 1L6RA 3E84A 5AI8A 1RLTA 3ZU6A 3U19A 3W5BA 1CQZA 5AI9A 1JUDA 1J8DA 1U7PA 3L5KA 2WFAA 5ALDA 1PW5A 3EF1A 1ZS9A 4EELA 5AVWA 3WKDA 1RPZA 1TJ5A 4Y2JA 4ZEXA 2EARA 5AW5A 2I55A 4DWOA 4C4SA 3WGUA 4G9BA 2GO7A 5AM4A 2FPUA 3OCVA 1TA0A 2ZBEA 5ALFA 3U26A 4KNWA 4IG4A 2ZBFA 5A3RA 1RMQA 2YFYA 4OHFA 1Z4IA 2I33A 4BYGA 4UASA 1Q91A 5AVVA 1Z4NA 3E81A 4HGQA 4BBJA 4HGPA 2HO4A 4YGYA 3BA6A 4UARA 2ZXEA 3B9RA 2B8EA 2JGAA 4Y2RA 2IOFA 5ALWA 2FEAA 2JAUA 1ZD4A 4UU0A 4Y3UA 2YMQA 5AI4A 5A3SA 2B8JA 3AR7A 1YMQA 3OTQA 1ZJJA 3AR3A 3QYPA 2RAVA 3DNPA 2P69A 1Z88A 3ONNA 4L57A 3MN1A 3KBBA 3MC1A 3DDHA 4QQFA 4XQ0A 3U7FB 2BDUA 3D6JA 5AVYA 3UM9A 3NAMA 3J7TA 1L7MA 3KC2A 4KYTA 3R09A 4BX2A 1T9ZA 5AK4A 4NWIA 2MSNA 1Z4KA 4UM7A 1QQ7A 2WHEA 2G07A 2HSZA 1N8NA 3HYCA 5AICA 4CF5A 4EX6A 2VKQA 5AI0A 1RDFA 3M1YA 3NASA 3OCYA 2BDEA 1VJRA 2PR7A 5AW2A 3WK6A 3WGVA 2YN4A 3UMCA 2FDRA 3ZTYA 2FPRA 1RMYA 3AR5A 5FP0A 1X42A 3SMVA 3L0YA 4Y2XA 4UMFA 1Z4LA 4CE6A 1N9KA 4XPZA 2BY4A 2FPSA 2B1RA 4BNDA 2IOHA 2QYHA 5AW8A 3QUQA 4UMVA 3CZ4A 2CFSA 3ZTWA 1RMTA 4EZEA 4Y2QA 1VFPA 4F72A 2HF7A 5AW6A 1SU4A 1J97A 1RQLA 3S6JA 4DW8A 4NAVA 3I76A 4HYTA 3SLRA 3ZI4A 5AVUA 4YIKA 4J2TA 4L6AA 2FUCA 2G09A 2HOQA 4MWOA 3L0CA 4GXTA 5AK5A 5AM2A 4C4TA 5AVSA 1YS9A 3NANA 4UW9A 2GFHA 3KDPA 1KYTA 4DFDA 5ALEA 2RB5A 4BX0A 2I54A 4UMEA 4B6JA 2G1AA 1ZOLA 1WPGA 3ZVMA 5ALMA 2EATA 3W5CA 4OD0A 4RETA 5ALZA 3WKBA 1RLMA 2NYVA 1QQ6A 2ODAA 2IA5A 3W5DA 3E58A 2WF8A 3QXGA 4Y2YA 5AW9A 4L6CA 5ALRA 1ZD3A 4UAUA 5AW1A 5AM1A 2HCFA 2Q4TA 1L7NA 2GHTA 4UM5A 2WF5A 1WR8A 3QUTA 1F5SA 2X4DA 4YCNA 5AIAA 1XP5A 3ZVLA 3L8GA 4J03A 2ZBDA 3NUQA 2C8KA 2FI1A 2HDOA 3FVVA 3QU2A 3SF0A 3TLMA 3WKCA 3WK9A 2AH5A 2C9MA 2OA0A 2AGVA 4Y2VA 5ALYA 3OCWA 3PGLA 3EF0A 5AKGA 5AW7A 3U7GA 1FEZA 2YJ6A 3N8GA 3QU5A 3AR2A 2P9JA 4EX7A 5AVTA 3SKYA 1QYIA 4BNDB 2YY6A 5JJBA 4Y2UA 5ALKA 3L1UA 5AVQA 2RBKA 3W5AA 2D2VA 5AHXA 3FGOA 2WF9A 2WM8A 2IOFK 2I7DA 5AVZA 2IYEA 3ESQA 4KN8A 1EK1A 2R8ZA 1TJ4A 4CF3A 4EENA 1RRCA 4G63A 4OFZA 3IRUA 1Z4MA 3OPXA 3WKAA 4UAVA 3AR8A 1VJ5A 5IT0A 2CN1A 3NIWA 3U7EB 5AVRA 4H1WA 2C4NA 3B9BA 3MMZA 2MU2A 4HGNA 5AKXA 2O2XA 3A1CA 1QQ5A 4XE5A 3WK7A 3GYGA 3WK4A 3ET4A 5IS2A 4NV0A 1CR6A 4HGRA 5AKZA 2Q5EA 4CNQA 2YMPA 1U2SA 3P96A 1YJ5A 1Z4JA 3R4CA 1O03A 4UATA 3AR6A 4NABA 3ZW7A 3N5KA 3FM9A 1NF2A 2G06A 1L7OA 2HI0A 2QLTA 2FPXA 4HGOA 4BKMA 3KD3A 2G80A 2JAWA 2HF2A 2CFTA 5ALNA 1S2OA 5AKIA 5AKKA 1Q92A 4E88A 4QJBA
chains in the Genus database with same CATH superfamily
2C5LA 1Y6GA 4F9FA 1P2SA 4YJDA 3HKZF 2E89A 3E2EA 9ICAA 2DUYA 4O4LF 1FDIA 4N6OA 5ESDA 3Q72A 5A0VA 1T2FA 2BEWA 1KS9A 1ZUNA 1SVNA 2Y2VA 3QBTA 2LRHA 2QMYA 1QVAA 3EXHA 3QELA 4NCHA 1MQAA 2P3LA 3G02A 3EEFA 3QVKA 2QA5A 1NW9B 1VTKA 3PNCA 3HP4A 3PTAA 2L5YA 5BOLA 5AESA 4W8GA 3A27A 4DV0B 1JPVA 4YUVA 4YI5A 2E5FA 4KB5A 5EJGA 2BLNA 2W2OA 3TW6A 1LY1A 3RK1A 4KZKA 1K6IA 1BJKA 3K8ZA 2CVQA 1OLOA 1SRQA 1DUVG 5KJ1A 3INYA 2FB9A 3EUFA 1JKIA 1JR3E 2DBQA 2JATA 1OY1A 2PD3A 4TV9F 1XWIA 1WZUA 2MSKA 1QYDA 4CEIA 1K4YA 4I4TB 1T24A 2FGJA 4FMCB 2DQSA 3BWXA 4BVKA 1BYIA 3GO4A 4CG1A 4RELA 1YRWA 2PPLA 1K8QA 2G28A 3NBXX 2VDMB 2WJIA 5DKWA 4UTVA 1AKYA 2FAXA 3G2KA 4PR0A 3HQ4O 2VWQA 3T99A 2YRWA 1IHYA 2PZKA 1V6SA 1IEVA 3O75A 4NTZA 4INJA 4DLNA 4EY5A 1T3HA 3OEHD 3HL4A 3LCUA 3ME5A 4W99A 3CM0A 3O2SB 4NLNA 3VSCA 2C3PA 3TBFA 2IUFA 2D62A 1NK9A 3C5VA 4UUMA 1ZQBA 4FMDB 4QX6A 3IA2A 4PZEA 5IJ9B 1V9SA 2BFNA 3DCIA 2Z98A 3FTPA 4M4SA 4GSKA 1T5OA 2A7QA 4RZ2A 2Q6VA 2Y67A 1Z4IA 4G0QA 2YFKA 4K26A 4JXZA 4G89A 1ODKA 4NH4A 3AFIA 3FNHA 2ZT7A 5IJZA 1EX6A 2Z0MA 2QD2A 1T0UA 3RT9A 4WLNA 3REQA 4X54A 3HY4A 4JYZA 1XX6A 4HBZA 4US9A 2XCPA 1NHWA 4YAUA 5HGXA 4KYTA 2KEYA 2CKMA 4LF6B 1KK0A 3IM1A 1JQDA 3DTTA 2Z08A 2UVQA 4ZVQA 4MQEA 4DSNA 4YRPA 1U8FO 2OWOA 3IBFA 1KO1A 4KMOB 1QBKC 1KXJA 4E07A 1I3OA 2JJYA 3A9UA 2ECOA 4PC6A 2ZJ3A 2DFNA 1BG6A 3TGPA 2X0JA 1LQ2A 1RZUA 3IPYA 4URFA 2NUPA 3SCZA 4MRNA 5KREA 1FDWA 2WMNB 1EBBA 4KLTA 1KQNA 2IHKA 1IUNA 1GT6A 3PLRA 4IHJB 3SP1A 4Q00A 4XGKA 3UAXA 5T7BA 3GGCA 2IBKA 2OYYA 1RWNA 2DKZA 3NM5A 4J2TA 4CETA 3IAM6 1LJLA 4XLZA 2OK7A 2JHCA 5H8WA 1UIMA 4BNHA 3FRIA 3DEEA 3SR4A 2CLDX 4R3NA 3ZDAA 1V96A 5EP1A 1PX2A 3O38A 3LXUX 5DNYB 4UAUA 1CCWA 1I13A 2DC1A 1NK5A 1XTZA 2NP6A 2YRXA 4GXJA 3FG9A 2PJRA 1USUA 4RMNA 4C5CA 1R15A 3ESXA 3JWGA 4G1CA 2NT3A 4YWJA 3RBAA 5AOBA 1J2TA 1TLTA 1GGMA 5AVZA 5ED4A 3B38A 2FPIA 2FWPA 3DJYA 5BOSA 5FTNA 2UUCB 2AJQA 4E11A 1PW7A 1B4DA 5IS2A 2KLHA 4HGRA 4PZOA 4U7FA 2G1JA 5KFWA 1L1QA 5K8TA 4I4TF 2QK4A 2VUTA 3NWOA 3FHLA 1XCPA 5CLFA 1EWQA 2B5VA 4TUPA 5D1NA 4H7IA 5JAQA 5FX2A 1IM5A 4H1UA 1RI3A 3S2IA 2C2KA 3WIBA 4OF4A 3AY7A 1KL7A 3RRGA 1XDWA 1FYWA 3T7SA 3QFFA 3REGA 3CF4G 3Q3VA 3Q2OA 1JWBB 1V1JA 5DJ5A 2GHIA 5AW4A 5BN5B 2LPMA 2A0WA 1JLRA 1UJ4A 1PEDA 5TGDA 3U4AA 1JE1A 4GE0A 4E5NA 2HMWA 1TE2A 3WB1A 4NPCA 5JISA 4FMDF 2C4WA 3SXJA 1JDVA 5K3DA 2FWBA 3D8NA 2XUQA 1ID1A 4JH0A 2AEFA 4NV1A 2DFVA 3U1VA 3PFIA 4G8DA 3UIEA 3L0ZA 3SY8A 4V0NA 4OL9A 2RSLA 1B6TA 3X2FA 1NK8A 1Y63A 1FNBA 1JMYA 1EXNA 4U00A 4XI9A 1PZNA 3PGXA 4N47A 3NH6A 1TK0A 2SNIE 4KAXA 1UKEA 2DP4E 2QRNA 1XWWA 3P94A 4BPRA 2CNOA 1UK6A 3SFZA 4ABYA 3P9CA 2FP4B 1J2MA 1U28C 3RC9A 1THTA 4FDLA 5KAMA 2QM0A 4AY4A 3RFUA 1SR8A 1GNQA 4PZDA 1Q46A 4KZPA 2B7LA 3KZVA 2QTGA 4H16A 4C1NA 1J23A 3WIVA 4LVCA 3B6ZA 4R9UC 4DQRA 1RU3A 3IYLW 1PGQA 3A2KA 1IJFA 3BOSA 1W5TA 2GZ3A 3CB4A 1IQRA 4TYWA 2XGJA 4WTOA 5J2KA 4PYKA 3Q9NA 4C4SA 3DAHA 5FOWA 3LRXA 1EJBA 2D0OB 2D2XA 2NO0A 1GITA 3GT7A 1CDOA 2V4MA 2AG1A 6REQB 1DADA 5KL8B 3AEKB 3U09A 2EOAA 3GWZA 4KWHA 1NBHA 1MX1A 2OC4A 1OH7A 2PCLA 3PKJA 5F9MA 2GXSA 3CEAA 4DSFA 3DHEA 3AB8A 3SYZA 4EOGA 1ZD1A 2B2CA 3GLTA 3GA7A 4JLMA 3DHVA 2I9KA 3JRWA 3HPRA 4HUQA 4KLZA 1RABA 3UCXA 5KMGA 1YKSA 1BXGB 3CKMA 5JAZA 4R7ZA 2NTNA 2QMUA 2WM9B 1URPA 2BWJA 4C7ZA 1RXIA 2OEPA 1JA0A 4CF5A 5DLFA 2ZM5A 4DFMA 3EUEA 2AGQA 4L2IB 3HKCA 2FX5A 1OT3A 4QVGA 1HDYA 4ZRNA 2C96A 3GVHA 2KZZA 1QCKA 2PVCA 3OFND 4RPJA 3K6SB 3Q40A 1JRPA 3TMYA 4BASA 5GM1A 5KFPA 2R8OA 3MMXA 4KBFA 3BWBA 3TANA 2IU4A 2W7PA 3EG9B 1DIBA 2L82A 1KDOA 2J59A 5B64A 4GXKA 1D4FA 3U81A 2R6ZA 2VJAA 1LBIA 1QMPA 3I37X 1YQUA 3U4HA 1NKCA 1JJ7A 4GYWA 1XSNA 3TLXA 1N62A 2GZ1A 3GARA 2QRLA 3HPOA 3QVJA 1Q7CA 3UOAB 2BTOA 4JLWA 1FIQA 2JMGA 1HE1C 2W9MA 3ZQ4A 3PUHA 1DKRA 1MEJA 3BG5A 2Y1KA 4MVJP 1BYUA 1AZSC 3RSQA 5TSDA 3EZLA 5DT9A 3QEKA 5ULLA 2ZT8A 2O54A 1XLVA 2DUWA 3THYB 4QU0A 3OHAA 4BE4A 3NTVA 3BE4A 3MWLA 1XDZA 3L0IB 4LY3A 3M3DA 1NN1A 1Q22A 3ZWCA 3UG7A 3UXNA 4R2HA 5JSYA 4BRUA 4J6EA 2JVKA 3GLSA 4C80A 1J21A 3VUFA 3KKAA 3RT7A 1YC2A 3HCFA 2ID7A 2ATEA 1QVRA 5JW6A 3T1NA 2JRCA 3MFHA 1V43A 4EJSA 3DQPA 1FQWA 2XY7A 2G4CA 4OJ5A 4KR3A 3CXUA 2W6ZA 5JZ9A 4M1KA 4QBKA 4J1TA 4COKA 4AXBA 2IFTA 2FQXA 5HIJA 5CVUA 5K4GA 2O8BB 2EFGA 1WP4A 1NAIA 1SOVA 2E8PA 3CLTD 4FE7A 4JC8A 1U2TA 1TM2A 3HFJA 821PA 1PUXA 3ZQUA 3JQ6A 1U0TA 3ZWBA 1J07A 1EFVB 2FSGA 1QRAA 2IYPA 2GEJA 1BPYA 4OXYA 2ZXHA 4DSEA 4GW3A 3UK0A 4BB9A 2VA3A 3QBVA 2F8TA 4KGXA 1BE8A 1YZVA 2JLQA 1NOKA 4L72A 1XF1A 4HWTA 4XW2A 1M2WA 2BFWA 3U3XA 1NW4A 5FUQA 1BSVA 3QF4A 2HSDA 3UYKA 1DB3A 2AFHA 3S5UA 1N5DA 4GC5A 4I0WB 5K3CA 3IP4B 4DEXA 1R5OA 1FUYB 1SN7A 4J0CA 1ZGJA 3RIGA 1GPWB 4YV1A 1W35A 4QZBA 2CCJA 5E6RA 1GTZA 4R65A 1AMOA 1VYHA 3FPSA 4FZ5A 5GIOE 5JS1A 2VXOA 1XHFA 4DS4A 4YCXA 4IDDA 2P2CA 1M5RA 3LQFA 1DUIA 1S0NA 3BBLA 4RU1A 1RPLA 4GBED 4ND8B 2DFDA 2R25B 2D06A 3IKLA 1S01A 2PKQO 3FMOB 2HCTA 2VDRB 3DKPA 4MGEA 3OZVA 3Q3JB 5DBBA 2IEIA 4RA6B 4K9SA 4OXXA 5DNCA 3ET5A 3AL3A 5EJ7A 2ZYWX 4Q7LA 3RI3A 5IVKA 4I2HA 2FCRA 1GO3F 3HCBA 1ESEA 3H04A 3SDZA 1MMFB 3I2FA 4MSUA 4ALIA 4K9DA 3TSYA 1YZYA 1UPCA 1IXZA 3VU1A 2M2IA 4BVEA 1KSJA 3OT4A 1SIJA 1CQIA 2W90A 2Z5LA 1TQ8A 1MSWD 5DMXA 4WFJA 4WXHA 1ZR4A 4TMVA 3KHGA 1FFCA 3RRYA 1B14A 9ICXA 1HUOA 2ROQA 3EZNA 5C3MA 3MTDA 1T15A 1QYWA 4HTAA 5AI4A 4LHYA 5C4IA 5JCXA 3WZ2A 1XQVA 1CJMA 2ZB8A 4DEYA 1CT9A 3UT6A 1GGJA 1RTKA 3D7MA 2KHZA 3LXMA 1HOXA 5I9TA 4JEUA 3CH4B 4NARA 1TM3E 3R0JA 3WDSA 1C7FA 2XUKA 2ODTX 2B4YA 2RK4A 1P3DA 2VK2A 1QQBA 2J0VA 3BPSA 2P9GA 4QOFA 4HDRB 1Y6QA 1SXJA 2NSYA 4CE6A 4BFXA 1E2JA 3WL6A 5C2JB 5AJYA 5HQJA 5J3JA 1LQTA 4K9KA 4HYTA 2G77B 5LZ5A 1NZBA 1TZMA 3DE2X 2FMFA 5AVSA 1HDZA 4BFCA 3LCRA 2WTUA 4LY6A 3ZVMA 2Z1DA 2JIOA 4EI2A 1QORA 3E58A 4G0MA 2NQ8A 1ECLA 2CUNA 1ECPA 3ZZTA 1G0OA 3VC8A 1XJ0A 3L8GA 3O7WA 4KH0A 4Y2VA 1L5VA 1DC3A 5AKGA 3MHPA 2HWKA 2R2AA 2FLPA 4IF6A 4RQUA 3USCS 4RD0A 5DBCA 2G4VA 2NZJA 4KK4A 5JJBA 3M8SA 2ZSFA 4XJXA 3NVWA 1CJCA 2JFGA 2QAGB 7MHTA 4OQZA 2PGAA 2H29A 2Q9BA 4PQFA 1MC4A 3M6LA 4BS9A 5IX8A 4XDZA 5I7AA 3CYFA 4V3CA 4YC7A 1XV5A 4JJEA 3P4XA 3GNLA 2V0GA 5CLGA 3GP3A 2C2RA 3ZW7A 2XUZA 3MABA 1RJ9B 3OWXA 3DGFC 4G0YA 3GCZA 5H3HA 4AFNA 3KSMA 1S2OA 2Q3DA 3WGQA 2MDTA 3IAFA 3UT0A 5JCJA 8ICOA 3ESAA 5GQSA 4RFVA 2P4QA 2E4ZA 1LI5A 1ZJWA 1F17A 1CJBA 4Z0TA 2C88A 1XD9A 5KQRA 4RMJA 4NLKA 2OAP1 3TNFA 4BRZA 2D00A 2AQIA 2IYSA 1ILEA 4KLLA 5LIRA 1FQJA 2GJSA 4M9XA 3L4EA 2W8BA 5JTTA 5B7GA 2P67A 4N39A 4Q1VA 4IUYA 2O5VA 1ONOA 1F8YA 4NPHA 3M4YA 1SB9A 3F5DA 1ZSYA 3HNPA 2JI8A 1F6DA 5AW0A 4U3JB 1VMIA 3CEHA 3MGKA 2CMKA 3W5JA 3VISA 3A3NA 2ETXA 3BIXA 2H63A 4IFTA 4EMSA 1DC5A 1OIXA 1U98A 1SCJA 5G5GA 3Q5GA 3W2TA 3KR9A 1GZ5A 3K15A 2LGJA 2CSUA 3DG9A 1GG8A 4OHUA 3A10A 3HE3A 3DV2A 4P7FA 4O3QA 3WQBA 1WCV1 2ZJ2A 3D02A 1WZCA 4P5EA 2Q5HA 4L9SA 2L69A 1WV0A 4IFIA 4RJ2A 4A1FA 4BP3A 1NXSA 3QI7A 3DO8A 5KKNB 1RP7A 2YV2A 3ZCUA 3ZBUA 4K6GA 5DB6A 2ANBA 3GGJA 3TTWA 1BW9A 4LZAA 2X4IA 4BAGA 1UZUA 2XPCA 3T1VA 3GIMA 3D4IA 4RVOA 4ENSA 4UBIA 3UTDA 3Q8QB 2NX2A 2W83A 4M88A 1EP9A 4FKMA 3SSOA 5ICSA 1IXRA 5HUJA 1FBNA 4TYNA 1AN9A 1CVLA 6NULA 4PJ0U 1YCHA 3A6JA 4IG4A 1Z74A 4AG3A 4JMLA 4IVQA 1EUDB 2E4AA 1H8EA 1ZVKA 4M7OA 4BBJA 4YAIA 4Y0NA 1NYTA 2XWBF 1U47A 4QM6A 4XGQA 4E5SA 5JBIA 3T35A 4CI0B 4PN7A 5KFRA 5L1LA 3RREA 2YWHA 1EBFA 5BV1A 4OHOA 1WMEA 4DQXA 4AQ7A 3VPGA 2WE7A 3B51X 1EDBA 4DZRA 4I1YA 2NG1A 3PC4A 1L7MA 1NW3A 1BPEA 4O8ZA 3HCWA 4B1FA 2VHYA 1CHDA 1D1QA 2P66A 3Q8XB 3IERA 1RBQA 4MOWA 5JZOA 2W2KA 2YN4A 2V59A 1K1SA 1FP1D 3U6KA 2F77X 2GOLA 3AESA 1IOWA 1KI6B 3GUCA 4HL6A 1YZUA 4D26A 4RVHA 5KINB 2GJAA 1NVKA 2D2FA 2IU3A 1M33A 5B1SA 3WMRA 1E9DA 4NAVA 3QBEA 2Q5JA 4J9UE 3OZFA 1CK4A 2HA0A 2Q4OA 1DAHA 1IVSA 4C4TA 2H2FA 2J3DA 3V00A 2M1ZA 5ECYA 1CUHA 2P65A 3HBNA 2F9LA 2C29D 4YG2A 2GB4A 4MA4A 4QE3A 2E21A 1S5LU 4G36A 2I65A 2EKQA 2VHCA 3QVXA 1S8FA 2Y9MB 4O3RA 2IUYA 2NIPA 3H99A 3VR3D 4IOJA 3RW9A 2UUOA 3TLZA 3HP1A 4P7GA 3OX3A 4HJRA 4KLDA 3SHWA 3M3HA 1TUBB 3JY6A 1NWCA 4K9LA 3GGPA 3AUJB 3VYTB 2FMXA 3RUCA 4HMOA 1G64A 3CT6A 2CV1A 2GDJA 4U6PA 2Q1WA 3TUIC 4US8A 4G97A 5AKZA 2PMBA 3GQCA 1ZJ4A 4GZ6A 1M0WA 1C8VB 4MHTA 3LKDA 1ZRSA 2BEUB 1YGYA 3SKXA 3PD0A 1QG4A 4AYBF 4N7MA 3K32A 4PQYA 2DFPA 1A69A 1W0JD 9ICVA 1R7RA 2C83A 2BM9A 2QM3A 3B6JA 2L18A 4ND4A 3BMOB 4X66B 5DGBA 3M1AA 1NC3A 2BP7A 4RM2A 5LR6A 2BT4A 3ESCA 5K8CA 3OPYI 3CUWA 2XUDA 1JRLA 1QH8B 4GKJB 4GIBA 2QRMA 5F64A 4OJ6A 1YDFA 1VJGA 2JLXA 1HLFA 1DOQA 4NBUA 3M5DA 5HKOA 1UA1A 2JJ1A 4D81A 3RT1A 1EGQA 2AYZA 3X1DA 5K3FA 1KVUA 3IVCA 3AJ9A 3RF9A 4YMGA 3E7XA 2XQJA 1WWUA 1DE0A 3NYQA 2H1VA 1Z5UA 4GO1A 1XA0A 2JGIA 2V0NA 1WOMA 2I2WA 3KHUA 1WUTA 1S8OA 1U2PA 2H4HA 4WK4B 1K6XA 2GCPA 3QIAA 4R01A 2PKEA 4ARBA 1KL9A 2CUZA 1WIWA 1TMOA 5EJEA 3WLTA 1JZQA 4L4ZA 4PRLA 5MN6A 2ZIXA 5CGZA 3L4JA 2OKCA 4PFSA 3SEIA 3E7FA 5ISMA 1WMDA 3PFNA 4OSOA 4CM8B 1VG0B 4G5SA 4L0MA 1OLUA 3BFJA 4NNPA 1I30A 2ZAYA 3D31A 4J0QA 1RAAA 2FMSA 4ECEA 5AM3A 1G3QA 3DUWA 5HUHA 3X1MA 2OD9A 4S04A 2PXXA 5A9SA 3PGKA 1U2QA 3I1YA 5KNDA 2JFWA 2I2XB 4F3KA 1RWXA 3TOCA 2GCGA 4RJKA 5KFAA 2ZJAA 3TTVA 3ZWXA 5AVJA 5FULA 3CCCA 2PBLA 3THSA 1MAVA 3W1WA 4IMRA 4B3JA 4UUPA 1NVGA 2ZREA 2OB2A 3ORHA 5JY6A 3H2YA 7ICVA 1KKUA 1PNRA 5DBAA 5JD3A 4RHFA 1R9JA 3QVMA 2WMDA 2CLMB 1Y37A 2CDCA 1NUAA 1EB8A 2HCBA 1TYDE 4MQ4A 4GNKA 3DM9B 2DHCA 4OEHA 3NWPA 4L8WB 1SCUA 3QK7A 5F78A 3UM9A 2XV1A 1G9TA 4GL4A 1NNI1 4XFDA 3ZK7A 3SC3A 3KHKA 5HR5A 2PFNA 1UOEA 4HH4A 3IP8A 1OFUX 1QHYA 5CK5A 3EMBA 3L82B 4MDFA 5CFMA 3R9XA 3OKCA 2ZJBA 5KYYB 4C8KA 1HRDA 4JP1A 2VK4A 1XYVA 4GSLA 4O1MA 2XB8A 4D79A 3G9TA 2QT1A 5IVPA 1M2GA 4HG2A 2XRZA 1HA3A 4JB2A 4ZAYA 5I47A 1GVNB 3AEQA 3RGWS 2ID8A 3CG4A 2NXEA 1NJ5A 4Z1MD 2VNKA 2FQQA 4R1OA 3DO6A 5M04A 3T52A 3GCXA 1CNFA 1XMQB 4BLOA 3OOEA 3TNDA 3AI3A 2O07A 4L08A 4B7ZA 2BHRA 1T43A 5DN6D 1BDIA 4H3SA 4PX9A 3VTZA 1KR2A 3OLXA 4WWHA 2WSSA 2RBKA 3W5AA 5JYEA 5CVDA 3RRZA 2WVGA 5B12A 4IINA 3JR3A 2ODWA 4ESHA 2FW9A 2WIAA 3D2NA 1KO7A 5I7RA 1ZQOA 4OSPA 2KJQA 1RHQA 4DG5A 4B46A 3E53A 1A2OA 2H7CA 1X7WB 3IEKA 1ND5A 4DUGD 4F45A 5AHKA 4PG8A 4FFSA 3GJZA 2CHEA 1IIPA 3TIGA 3A9SA 1QHSA 1KEKA 1QDUA 1JYFA 4MAMA 3DYIA 3BH7A 4Z8YA 3RTDA 1N7GA 2CB0A 3AYZB 1II8B 4K6MA 1U7TA 4XLTA 3BKWA 4KG7A 1MRNA 4IRDA 5CPFA 4JYBA 1YJQA 2ZIZA 2YN0A 4DG9A 4JUCA 1REQA 4D44A 5DSXA 4GPIB 4TQGA 4W7IA 3EDYA 1NULA 1AUXA 3AUAA 1RT9A 4FZVA 4NQZA 4QLAA 4W1RA 3TLAA 1QTIA 3FLEA 1BEUB 3P0JA 2KN7A 3V9AA 4AWBA 3CW2C 4WCVA 1JW9B 9ICKA 1FFSA 1W0KD 3MWFA 1ISSA 4CM6A 1SUWA 1D4AA 3G6YA 2HLHA 3S68A 3BFKA 2WAAA 3CRMA 2OVFA 1WB4A 3EDCA 4R64A 1GCOA 4EHHA 4P4PA 2ZP1A 2O3JA 5FBWB 3V3TA 1Z68A 2XECA 3JPRA 5T14A 1U0NA 2COEA 1DZIA 4A92A 3S8EA 3ABQB 3NRJA 3THVA 2MAXA 2XXAA 1V8FA 1PF7E 1QANA 3WNZA 2PDAA 3ROQA 1VMAA 2BF7A 2FW0A 3AF2A 3S2ZA 1JZTA 4R7TA 1IRXA 1NP6A 1M7BA 3CO0S 1WB9A 2VJKA 1JSCA 1TJYA 1WXGA 1CUZA 3OD5A 4WZBE 2HLNA 1L8QA 5CU7A 1RR6A 1EVQA 3W8NA 2OR3A 1KY4A 4TV9A 1D9FA 1OWMA 1ATIA 4OAOA 1NJWA 4DILA 2VQSA 2RHBA 3GN1A 3MLBA 5LBUA 2FQWA 2IBTA 1U0RA 1T5BA 4B3BA 1J8DA 5K0ZA 3AI2A 3K0AB 3KTAA 2J7PD 4FDAA 2NPFA 3WKDA 5IDWA 5L3QB 4KLMA 4HRYA 2JH1A 5FTLA 4FNMA 5KFSA 4NMLA 1Y89A 3OM9A 5DIFA 1Z5PA 2R60A 1PVVA 4LUCA 3UA3A 1Q91A 3ZJ4A 3E81A 3D6TB 4Q48A 1JHRA 3DT9A 2QZPA 3BA6A 3F90A 3WQSB 4Y2RA 2IOFA 2HIHA 5LMCA 3CX4A 3SQMA 5IH3A 1PJLA 2OGZA 2WTBA 2FWIA 4MQUA 3JPNA 4EO7A 1YAJA 3OTQA 1SCBA 2J87A 1OIWA 4FMBB 4F3YA 5F12A 3IBTA 3C8MA 3LECA 1UKZA 3UATA 2G9QA 4YLYA 3GZFA 1D2EA 1NQTA 4I2VA 3TAHA 1GPYA 3LBIA 1IB6A 3GPBA 1K8YB 3K35A 4B4DA 2C7QA 3NHPA 4UCFA 5L3ZA 4B9EA 5FPPA 1G5FA 2A6PA 5SYNA 4CN9A 1AGXA 2GN1A 1MGOA 1VCOA 2GD0A 1UXJA 1EXVA 2VNIA 1U0FA 5JAHA 1EPUA 3LPLA 5I5EA 4Q4CA 4BBPA 4LY9A 3NTQA 1LUAA 2ZI4A 3ELBA 1J97A 4D4KA 3UMJA 3ZI4A 3W5VA 3DT6A 3HO8A 3QF7A 1E1LA 1XRSB 4GP9A 1QLNA 5AM2A 5F73A 1XS9D 3FFAA 5EZSA 4XQGA 3BXOA 4BX0A 2LYAA 3EJWA 1D1SA 2BGLA 1EB9A 3DBOB 3FHJA 1VHJA 4KWCA 4KXQA 4CIYA 5EVCA 1OFVA 4UM5A 2P5TB 3FHCB 3NHJA 4KVFA 3E5HA 3MERA 1V7QA 3VR4H 1H85A 3WK9A 1WDMA 1HLPA 3EF0A 3UJ7A 1HQCA 1IHXA 2PV7A 3E70C 4E94A 4QECA 1NZDA 1JKXA 1GOTA 3DMGA 1TJ4A 4HQFA 5CNJA 1IIRA 4TXMA 3GAFA 1L5MA 4D9KA 2QUZA 2BOVA 3FF4A 1P0MA 4I8XA 4GL2A 4TZ0A 3AERB 1YJ5A 4EKYA 1N5OX 1O03A 2HM7A 2VHVA 1I32A 2XMCA 3FM9A 4L4SA 5F52A 4PE5B 5EHQA 5KUTA 3KD3A 2OHFA 1I7LA 2EZ9A 1GVHA 2HY7A 4MV1A 3AJEA 1NNLA 3MVEA 3ZI7A 2FR0A 1M2EA 3PQCA 4IQWA 1Q83A 2Y3IA 3IOBA 4Y18A 5BVHB 3BS7A 2I7TA 5KFJA 4I4TA 2F8MA 3ROXA 5DXAA 5ALVA 3JD2A 4MQLA 4J4TA 1JGTA 5HR7A 1GILA 3VAYA 3FPBA 2QVYX 1LLCA 3T7JA 2BM0A 3RVOA 3EYZA 2QTWB 4J0GA 5JDCA 1ZQMA 2G1PA 3DE3X 3VPDA 3I5XA 4KI0A 2QRHA 1Q21A 3NDJA 3GUHA 1AD2A 3E3AA 4OJPA 3W7VA 2H5IA 1L8LA 1JEEA 1GDHA 1P7CA 5I45A 3UJAA 2WYHA 4NEQA 4TYPA 3AOEA 4KLIA 5ALSA 3AG5A 2P9EA 5JXIA 1RZVA 4CTNA 2Q27A 1GCUA 4O3NA 1D0VA 1U7XA 5IJ9A 4UU1A 2IY9A 1CUDA 3C6XA 2LTAA 2RI1A 3VSBA 1TAQA 1DPFA 3O3NB 3B0XA 3GRKA 4CMGA 5CLJA 4P31A 1YQDA 4NNOA 3ODGA 2WNHA 1MXHA 2RHCA 3K1RB 1UAAA 1UFOA 2P8SA 4FNGA 3K1JA 1SA0B 3I3OA 1I0ZA 2WKSA 2XCIA 4CWAA 2PTHA 5DBGA 3IUQA 2O5EA 3S29A 1AK2A 1WUKS 1JFVA 4RJLA 3OM1A 4ZQCB 2OV3A 3RC8A 8ICHA 3V4RA 4RJJA 4KMOA 2YOFA 5EAIA 2QL6A 4ACOA 4M9CA 1U6IA 3NVZA 2QX4A 2EQYA 4RHUA 2QG9A 4LIPD 1FUIA 2QHXA 2J0QA 4Z1OA 5KX5B 2FQ1A 4A6EA 2XNHA 1NWHA 2QN3A 2Q1TA 4F56A 2MINB 4ND5A 4QW9A 3SNKA 5KWSA 4KE9A 5K8IA 1UPHA 1K5HA 1PWXA 2P1RA 2X3UA 1CRPA 4QOIA 4Q7EA 3EX7C 4JBNA 3WLQA 1KRHA 3TR0A 2BFEB 1XAJA 1J24A 1AY0A 2BZ0A 2HSZA 4LZPA 5ENZA 3DB1A 2PZJA 4RZXA 2G17A 3VM6A 1O57A 2FPRA 3AYXB 3UQYS 3KKLA 1XC7A 4CTMA 3HUDA 1RXEA 4G5HA 3PGMA 5JDIC 3MJHA 3OKAA 1JL3A 1ABFA 5TRTA 1DS6A 3UK1A 2OESA 2B37A 3LYLA 1XZMA 3VFDA 2JEYA 4WIAA 2ZJYA 3DFIA 2JXJA 2OVBA 4A3SA 2P3QA 3OIWA 2AG8A 2RFLA 2ONJA 3UJCA 2YHBA 3ICVA 1Y8CA 3W5DA 5HRUA 3I8XA 4Z4FA 5FUYA 1USGA 3D3NA 2JDID 2ES4A 3H16A 4DBVO 3N8KA 5LQMA 1G9XA 4NI5A 3RYIB 3DWGA 1JJIA 4GR9A 1U1DA 1EVLA 2F2TA 3W5SA 2BIFA 4GC9A 4OOFA 3HJCA 2I7XA 3QXJA 3WJ1A 3ROMA 1IH8A 4CHGA 1QSYA 5JMPA 1PK7A 4RXTA 3AU2A 4C2AA 1QCCA 1SOUA 2ZIWB 5HGJA 1J0XO 5TF4A 1C50A 3A4LA 3HJUA 4TTSA 1KERA 4OFZA 3JVEA 5IUKC 5DZSA 3L0PA 5BN5A 4WFIA 3WK4A 3IIMA 5I4KA 2YB4A 3DDCA 4C78A 3KEOA 2KSOB 1U2SA 3BK7A 2XAUA 5B3JC 2PMKA 4HDNB 5BRJA 2DGZA 3S28A 4MQFB 4PZUA 3E1KA 5K0TA 4FX5A 1ZETA 2H0AA 1U1EA 1T35A 4R1TA 1CP3A 2GPYA 3FUUA 3GRCA 1XZNA 2C99A 4E7OA 8ICPA 4Q7QA 2NRXA 4QHTA 1GIAA 1IBKB 1RWWA 5AKLA 3IRVA 3JZFA 1Q1ZA 2Y9UA 2Q99A 4J1NA 4Y9TA 4KO1S 4BIMA 1NQWA 5KZMB 5DLPA 4DRZA 4WMLA 2FP4A 2Q1SA 2Y1FA 1SEVA 3EA4A 5A1TA 4YAGA 1I3KA 4GLOA 2IYWA 5I7EA 4FLEA 4QDKA 1AQ6A 1JEOA 4CFSA 2SKCA 2EZ4A 4ENUA 5CCEA 1MO2A 2PTGA 2BMAA 2CJFA 2AN1A 5DLYA 3SENA 2X22A 5KX5F 3AU9A 2XE6A 4PAMA 2Y0BA 2W9CB 2VF7A 8ICJA 3K53A 3NS7A 5HHIA 2XCRB 1D2MA 1Q57A 1EFAA 2ZYAA 1SBIA 3MMNA 2OSBA 2DHEA 4W1QA 3AG6A 1KR5A 1MB2A 1VOTA 5LQNA 2WJYA 2PJUA 2QJFA 4LX8A 1EFTA 3IAEA 3ANNA 2B5OA 3GBVA 4DYVA 4K87A 5A0TA 1QS0B 2DT5A 2NAPA 4ME6A 6REQA 1HFKA 1HMPA 2BEKA 3ZDCA 3AEKA 3F97A 1O8BA 4I46A 3WGLA 1BKDR 4DF3A 3BRCA 3FPKA 3GN2A 4AUKA 2VJLA 2AK3A 4ND3A 2QB1A 1BVHA 4QQ8A 1ZRMA 3A4MA 5T4EA 1LTHR 3T8YA 4NS1A 3GIDA 1YZGA 3PL1A 2AA3A 3ELWA 3WYAA 1BXGA 3HUUA 5JJ5A 4DSIA 1DT5A 1IMJA 1OR8A 2W9XA 3ZV7A 4L2IA 3H2BA 5DCWA 4F2SA 3K6SA 3T3MB 2DBYA 4G56A 1H1TA 4YJ3B 3MYRA 1O77A 3EG9A 2O8EB 4FUTA 4IKOA 2BFDB 2KW5A 2PKYX 5BUZA 2HGZA 1ODJA 3QZ8A 1OYOA 4BO4A 3PFHA 3VGPA 4F06A 1S3SA 2PBRA 1P9RA 4X85A 1Y5MA 2YZMA 2PQ2A 4CG0A 5AFSA 4ZRMA 4QUJA 3OZGA 4HWOA 4NWIA 2WJJA 4YRGA 4IYRA 3HBJA 2YUIA 3NJ8A 1FDVA 3OCYA 2WM3A 4O0IA 1WS6A 1OH5A 3AF3A 3NEYA 4A5SA 3W6PA 3DD1A 2IF2A 1NUTA 2RHGB 3EE6A 3KLMX 4FMCF 2A0FA 3PE4A 4GLFA 3THYA 2BY4A 3S8MA 3FPHA 1V9CA 4PV7A 1XYGA 4J0FA 3HKZC 4Z4QA 3D0RA 4QQNA 1B76A 5KCMA 5LM3A 1G6OA 2ZUUA 4OJLA 3UHPA 4TTIA 4MWOA 1C9MA 3OY7A 2CHUA 4NZYA 4MHVA 1E9SA 2RB5A 2CLCX 1VLZA 2VT2A 1NXOA 1JECA 4ILKA 4JJIA 1ZMXA 3QM1A 5KSYA 3EAFA 3ADOA 2KZ3A 3A28A 4MR8A 2QL9A 2Q3JA 2OKGA 4IXDA 2X4DA 1GPUA 4TKLA 2A0KA 3F7TA 1M34E 1DBSA 5JCPA 4L28A 5U9CA 1RI5A 2ZJ8A 2O8BA 2ZIEA 1FIUA 3UJ8A 3RYCB 2UVUA 2F44A 4WSOA 5BV8A 3UMFA 2UU9B 2ETVA 1EFVA 2P9FA 4NLGA 4HFMA 2D8MA 1Z0KA 1B8PA 1UKAA 3HVUA 5FXMA 3PSHA 3JPOA 5EYPB 2XDAA 3SPXA 2JH7A 2H16A 3P96A 4YRZA 3UWKA 1Y82A 3DHWC 3K2EA 3GR6A 3ICQB 3TW4A 3NHWA 1PUIA 3K7EA 3EZGA 1UBNA 2OORC 4EI7A 4FKBA 1SBYA 1NSTA 1SIOA 5ICCA 4Y67A 3CX6A 3MQFA 2VUUA 3R5KA 4RDCA 4I1UA 1ZNWA 3B9PA 3EFBA 4DMCA 1VDVA 4PN3A 3DZFA 3OG9A 1YMVA 3CZCA 4M9UA 3EPKA 1KKLA 4C4XA 2H92A 4OVKA 4NCKA 5D1HA 1SPXA 4XD7A 3OT5A 4WJKB 4LV6A 1YBMA 4IHJF 3KHSA 1NI5A 4BAZA 1CZHA 9ICJA 2V7WA 4NL9C 1F44A 4GVLA 1U0SY 3U31A 4DSKA 1VLMA 2PSHA 5A0LA 1VIDA 1MAUA 2ZRPA 3O31A 4Q3KA 1IYZA 3AL0C 4QULA 4V2IA 3OJUA 4P34A 4ND8A 3MWEB 3HLKA 4BZZA 3T1TA 4LMPA 3K09A 4QZ8A 1ITZA 1ECFA 4X94A 4X7BA 3ZW9A 4B6SA 5KDLA 4RA6A 1XDUA 3QJ5A 5CGQB 3SGLA 4LRYA 2KFZA 1N1MA 2PZFA 1SY7A 2C2BA 4F8YA 2YINC 1GTVA 4ER7A 1YD7A 2QKQA 3T4UA 5IUJC 3ZWQA 3A3OA 4TWIA 2C8JA 4DSOA 9ICPA 5FFFA 5A05A 3OTIA 3DD5A 5AQ1A 1X40A 1RHKA 4FZJA 5DM1A 2HEGA 5EWFA 2VBGA 2QR2A 2OBMA 4I19A 2ZSHA 2PX4A 3SVLA 3EUB2 3DOCA 2Y71A 3EJ6A 3RU9A 3P9QA 2NSHA 4KITB 1NPYA 5CDGA 4ZYXA 5EKXA 3QYAA 1DELA 2HVHA 1P9OA 3SDSA 4BEBA 3F46A 5B1DA 3EEOA 2KJ5A 2GPBA 2PVSA 4MQ6A 3GBPA 4KMUA 4YYEA 3OZRA 4QUGA 1Y8QA 2HA5A 2YOHA 3R5XA 2D54A 3PYMA 1ZPDA 2YIVX 4W5QA 2HHTA 3PXAA 4HDRA 4PGQA 1E3LA 4LBZA 4ZTBA 1VYTA 3D8SA 2WVHA 1WLSA 5NLLA 4IDBA 3CNLA 4JV2A 3W34A 1GPBA 4QPZA 4BLSA 4W8HA 9ICMA 3L6BA 4JJZA 4V2UA 2XIQA 1PVQA 1NT2A 5LZ2A 2HJVA 3PV8A 4KH1A 1U5BB 3PIDA 4FB4A 1UQRA 4YXWD 2FUNB 1HI9A 1KAOA 3D2AA 4ZN6A 4YEDA 5GJCA 4BGEA 3GWGA 3K0BA 3U80A 2H06A 3KXPA 1A9QA 3VHXB 5GVSA 4JU8A 2B61A 5CEFA 4N0QA 5JWRA 3MFYA 4P0QB 1XQWA 5KBYA 3VV3A 3OPMA 1Z5NA 1OX6A 2CK3D 2WSMA 3ZTYA 1SG6A 1K7CA 3K6RA 4OX9B 2ZR8A 3H3XA 5KFVA 1Z83A 4P4GA 4OHYA 4JBGA 3I1FA 1Y5RA 2HLDA 3GLGB 3T54A 2JJMA 2QAGA 4PCUA 2A9VA 1I5EA 3IKMB 4HDSB 4RQBA 2QV0A 4EHNA 2C3OA 1GR1A 2R7KA 3CF6R 3AB7A 1YS9A 3NZEA 2BKEA 1KYTA 3NRZA 3WLAA 1NZPA 2WV9A 1J9GA 1CIJA 4ZYUA 4MR9B 1ADGA 1RJ9A 2X77A 3GT0A 1RRMA 4FOSA 1XN4A 4DLBA 1NR7A 4ED0A 1OV6A 2FI1A 2DSTA 2YXBA 3CCBA 3UTCA 1MV5A 5ALYA 3LWLA 3K70D 4CCYB 1SQFA 3RTEA 3I32A 1ZN2A 3T5PA 4NBRA 3BA1A 5BSTA 2IYLD 3L7BA 1F0NA 2XDYA 4BY9E 1IWBB 1C8LA 3QLJA 3VC1A 1QF7A 4RQ8A 1YZHA 3O91A 1MJGA 2WM2A 3C29A 1J42A 5K6TA 5IVIA 3OCJA 4FEGA 1H38A 4GWGA 2MJLA 4MW2A 1WTCA 2JFUA 1Q0TA 4UATA 4P4OA 1EDZA 4TMFA 4PPXA 1L7VC 4PXAA 1X2EA 3MD9A 4C3VA 2JIZA 1QB7A 5FBQB 1M66A 4U3JA 1XRQA 3ANXA 3FNRA 4MA0A 2GZRA 5IWCA 3G0DA 3QE0A 5L1MA 4YRNA 1E6WA 4DIDA 1J49A 2PWYA 1LH0A 3RYFB 5IZ4A 2P41A 1IHDA 4UVEA 2FFBA 1XEWY 2GVDC 4FTWA 2FX2A 1NVAA 4KLQA 3C1UA 1EM6A 1HUQA 3PR2B 1V5GA 4RNDB 2IA6A 3OMXA 1X7ZB 4TLBA 4IIBA 1QO0A 1UR5A 2PRZA 1P5ZB 4S1PA 1NJYA 2V96A 4N7BA 2OHIA 4HNQA 4EHLA 1M7HA 4TV8B 4EGAA 2GVNA 2Q0QA 3DKRA 1MDFA 2FPGB 3WHIA 4HPWA 3VNSA 3RJHA 1MEOA 1IE3A 4W6QA 1WPRA 1QDEA 1GL9B 3GEGA 3I6QA 3ADKA 3C1OA 4M55A 1KFBB 4JOSA 3TZCA 2G71A 3KVOA 1P4RA 1E5VA 1EUDA 3H9JA 5ALJA 4HLUA 3P27A 1PU2A 1I2MA 3EXHC 3K9GA 4V0RA 4TQRA 4OKNA 2QTNA 3MLAA 1J0DA 3OCCA 1RXCA 4XQ9A 3SLKA 4ZYYA 2OCEA 1QRRA 1XVVA 2QQFA 3B1WA 1JG1A 3FA2A 3RTVA 4DCMA 5K01A 2QG6A 4CKYA 2HXYA 1WPQA 3OX4A 1N77A 3ICEA 2PFGA 1KU6A 3KUCA 3DT8A 1RPZA 3HUTA 4P3NA 1KYWA 4CLXA 2LM1A 1FYVA 4QTZA 1CYEA 4L8FA 4DCPA 1PZGA 2JV3A 1BWQA 3EOBI 1LZKA 1Y9JA 3RBXA 1SVMA 3ETDA 1E18A 2HK7A 2P68A 4B2YA 1U8YA 5LKAA 4J07A 5DV9A 3RJZA 1XUOA 2NXJA 2QN7A 2H1LA 4BFWA 1KAHA 2FFQA 2ZXIA 4G8JA 1L4KA 1HDEA 4TKVB 4YK7A 4B7CA 5BNWA 1CUCA 2ZUDA 1SXPA 3N75A 1WSBA 1P0CA 1FFYA 1QIJA 3TUJC 4NLZA 4FZ3A 1C9YA 3HDJA 1EA5A 4FXPA 3WK6A 4I6GA 1EFDN 3PXEA 3D8TA 1L2TA 5HUQA 3TADA 1RHMA 4OKIA 1QNLA 4I6JA 1TUBA 5EEGA 3NIBA 3BIJA 3WQHA 1CY4A 5L6MB 2IXGA 4LYFA 3R6GA 4QPJC 1A4XA 2VZLA 4YV2A 3EDQA 3K5HA 4KI7A 2FF5A 1O5TA 1DCMA 1N2JA 3DHYA 2GFHA 4B6FA 4EQZA 3CMMA 4UFNA 5AJTA 2SICE 4MF8A 3G8AA 4CMEA 2ORYA 2UVVA 4FEYA 1R4ZA 1VYUA 3ZJVA 3HDVA 3TVYA 4KV7A 4E09A 1SL2A 1WU8A 2OUKA 5BMVB 2ZBDA 4JUBA 5FWNA 1XTBA 2BEUA 2C9MA 1HNWB 1E89A 4RANA 1SIWA 2GUWA 4MICA 2R11A 1TECE 1IUOA 1QYIA 3HKBB 6ABPA 1VPWA 4Y2UA 1R66A 3BMOA 3T9FA 2VVTA 1IB0A 4BJHB 4BO9A 4UHBA 4JBHA 2AJBA 5DQIA 2YHSA 3NQ41 3X44A 5K3BA 4B74A 2O57A 3PQEA 2FLVA 5EMJA 1QH8A 1MPTA 2DTDA 2WTFA 2F3TA 3GLKA 2HCJB 1C1YA 1GNTA 2B4AA 1PT5A 4M9SA 4XIIA 3RSSA 2NXWA 1DRGA 2FN4A 3WLPA 5KNIA 5I9MA 2WFMA 2AQHA 2LYBA 3BQ7A 1SGWA 2Q46A 3OCZA 4F71A 2VT3A 2EDCA 4ZK6A 5TE9A 3L2OB 5LL6P 3R9WA 5IEJA 5J2BA 4YJGB 1I5OA 4X0EA 2QMOA 4HQRA 4BVFA 3Q3EA 2FXIA 4YAKA 3SAJA 1DLJA 4R5HA 4JBIA 2Z2KA 4MP6A 2R96A 2O20A 1RKVA 4F2DA 2AU0A 1EKXA 1V41E 3QVTA 4CM8A 4UCQA 1M2FA 5J40A 2AR9A 1GTL1 4A4DA 5TB5A 5C8XA 3RNOA 2TMKA 4YYZA 2XEDA 3FWYA 3JQAB 2OFOA 2W6JA 2O05A 2GKSA 3JWHA 3MDCA 2E2WA 1P62B 1UBCA 1MLDA 4CYMA 4RH0A 4QA9A 3MJRA 3NRCA 1G21B 5DNEA 1ZQWA 3ED5A 3EC2A 3PLNA 4A9AA 1KEVA 2Z30A 1F38A 4MI6A 2P1ZA 2ZJ0A 2V6FA 1POXA 4JV0A 3EBPA 4ACAA 4IRXA 5JD6A 3A25A 3C98A 1DMRA 3DQQA 1SKQA 5F3RA 3QKSB 1G8GA 4JN6B 3OI7A 1FS5A 1RYNA 1M8PA 5TY0A 2IWHA 1M2VB 3ZZUA 3MTGA 5T3UA 2RG7A 2IYVA 3FMIA 4S1OA 3ICPA 1NJSA 4HLDA 3TZEA 2VDVE 2F43B 3SBDA 2C1XA 3PUKA 4TT8A 1S2DA 2X2FA 1ZICA 1MO4A 3DNMA 4BE7B 1ELOA 3HVHA 1IPEA 3C70A 2EKBA 1B43A 3NCHA 4GOJA 5CDYA 1BTOA 1ZNXA 3M1LA 2QLMA 2ZJ6A 1Q3VA 5IULC 4HDAA 3ZLJA 4RKRA 1NOMA 3IQZA 1PYDA 2BUAA 3D6HA 1KIFA 2XUFA 4KNWA 1TQHA 3Q3CA 1GU1A 2FLNA 2PXIA 5CB1A 3C2LA 4ZREA 5KYYA 4PPYA 3WRXA 3JSAA 1I6LA 2NZ8A 2PE5A 3GQBB 5J2DA 2PO5A 3CG0A 3OF2A 2RGYA 5DB8A 4E70A 2O0HA 5K0EA 3GZ4A 4LSZA 3RWBA 3REOA 1N1EA 4R81A 1ZIXA 3CVYA 2NRZA 3L7DA 3NHYA 3CISA 3BRSA 1DINA 3OHBA 3ESDA 3FKSA 3R09A 4CV0A 3DJFA 3U44B 4TS9A 1IZ8A 1I7SB 3K1AB 4YR0A 4ERNA 4NV3A 5JZVA 4MNTA 3U4IA 3S27A 3UBMA 1VLBA 3TI7A 2OZEA 1P29A 2W93A 4AXXA 3A6PC 1SBNE 4ICAA 2E3TA 1V45E 3KR0A 2XUJA 2WC1A 1NJ2A 1V1RB 2TRSB 3K09C 1NZFA 2FUCA 4CIVA 4FR5A 3LHFA 2NZXA 1P1HA 3NDBB 2ON6A 1E9FA 4U8HA 4WOBA 1X7WA 4DDHA 1NKEA 2W2LA 3ENQA 2FG7C 1NLMA 3HT3A 1ZITA 3DQZA 1FL9A 5F9HA 5CUQA 4RE5A 2IBMA 4J4BA 4AO7A 1RE0A 4GDMA 5CJJA 5C0YA 3BULA 3RSFA 3H8MA 3MOSA 3QMVA 3KYIB 5J0QA 1X9GA 4FW9A 3HJRA 1II8A 1KEWA 4PNZA 3SX2A 4MLCA 4OHCA 5FL3A 1C3XA 2WM8A 4G23A 5HWSA 1GAQA 2IW3A 3VYRB 3BRWA 3KCQA 3F6EX 1BU5A 4XVUA 2HD4A 2HXGA 3RH5A 4EEYA 4X8LA 4BCBA 1X7XB 1KNXA 4JMUA 3L8CA 4MZXA 1CR6A 5A71A 4MAAA 2JEZA 3ZGYA 2VQ3A 4MCIA 4ZTZB 1IEWA 5KVQA 2R97A 3I61A 3WOVA 5KHOC 4RFSB 1XLWA 4ZO8A 3K8YA 1ZC3A 4EPWA 4AK9A 2EEPA 1Y98A 3EVAA 3NVMB 1PYOA 4BMDA 4I3FA 2IF0A 2IYNA 4CCWA 1N6IA 2HUNA 1P7VA 3UJ9A 1E6EA 5F3DA 7ABPA 4ISCA 1ZOOA 3CLUD 2QU7A 4U2EA 1IVYA 3LQ1A 2J30A 4MLDA 1C7ZA 4JB0A 4ESOA 4IWYA 1JEJA 3OSNA 5TEWA 1MABB 2GLTA 3K1ZA 2HHUA 1V3QE 3RQSA 1P2GA 5BSRA 1KH1A 1DFGA 1GUYA 2BQRA 3CIFA 2MSCB 1LB1B 1LK0A 3GV8B 3BZCA 1JALA 2YZ7A 5EIBC 3FNQA 1RS0A 4GXIA 2FZEA 2ZVJA 4R63A 1KYYA 5HKKD 3KKAC 1OHHD 5F7XA 1J0EA 2XTNA 5HHTA 4EJSC 1Z7WA 4I9GA 3DVAB 3QLTA 5HCNA 2XBLA 1TVCA 1PWHA 5IK2A 4J1TC 1XI2A 1PFYA 4Q6WA 3LIIA 4EECA 3RB6A 3VKWA 3K0AA 2HEIA 3I4FA 2A3RA 2C2DA 1VHTA 1S0OA 3MTEA 4ZYVA 2FPKA 4A2PA 8ICRA 5L3QA 1SOMA 1LPMA 1E1QD 1DO0A 1UJ5A 1C0PA 1Y3DE 3ILVA 5F7JA 4I1SA 4RIIA 1X1CA 1T13A 2O9JA 1DQSA 3EXAA 4OCZA 3C5WP 5EQDA 5ED0A 2KHQA 1DX4A 1TCCA 2V7UA 4RQNA 3UK6A 4MKZA 3M4NA 1BXZA 1C7RA 4XR4A 4TZKA 5EE0A 5F1KA 2PKXA 2F3UA 2GZMA 4NESA 3H4MA 3Q1KA 3Q98A 4Q4JB 4LY0A 2QP9X 1ISMA 5LNK1 3ZU6A 1JU4A 2A92A 2VANA 4V0MA 3FROA 4C4PA 2IXBA 4O3MA 2PH1A 2FHSA 4DMGA 4Y2JA 3F9CA 1VBNA 5I7SA 2YXNA 1BFUA 2QW0X 2AC7A 1YHNA 2BKVA 4QZ9A 1OTYA 4TZTA 4C8NA 2VQFB 1DRWA 3D8BA 1W1IA 2R4QA 1Q14A 4M9ZA 4N5DA 3COZA 3FDSA 2ECPA 2R8RA 3B12A 3WZLA 4DLAA 2JHDA 1KLNA 1Q2XA 3AJRA 3Q2KA 3TNLA 4L9WA 2H6EA 3D4PA 2G9VA 2PUJA 4BP1A 1BMTA 1SK9A 3TLBA 4MJLA 1GQSA 2J9FB 2HJGA 5KU7A 1RWVA 2J7KA 2QD5A 5KSOA 4NAUA 2PHZA 2HDWA 1DI0A 5CH3A 1M1XB 1M8KA 2VHXA 4I5GA 4BTVA 1HPLA 3CEPB 4F2WA 2YVLA 1EX1A 1UKCA 3B6KA 4KAAA 4WGGA 5CAEB 3UENA 4Y2XA 4DEVA 5BQOA 3OU6A 2VR1A 2XJ4A 2C2MA 2BLLA 1AU9A 2XXJA 2H11A 1DFHA 4YMUA 4U9IS 1GPJA 3RRMA 4YMNA 2I5PO 1DK2A 4TRJA 1EVJA 2JFXA 3OURA 3TSAA 4LBVA 4MW7A 4PSUA 1CRZA 4BJ5A 2PUGA 1MNAA 3KVNA 5GZ1A 3LRTA 5E95A 4KFSA 3DVRX 3HJBA 2GPTA 2LI6A 2IPNA 1WPGA 3AERA 3OZ7A 1X14A 1MGPA 4DBLE 3RE1A 3PHLA 3C2KA 3GQVA 1MA3A 4MFCA 3UMSA 1PIWA 3L6DA 4AKSA 5K03A 3GAMA 1QSSA 3N7PD 3AU8A 1RLUA 3K16A 2XB9A 1KC3A 1BDBA 3OC0A 4QJ3A 3E15A 2WU0A 4CQNA 3L1UA 1Z3CA 3H0LB 3ELYA 2HRCA 2I6SA 2Z1NA 1E69A 5BVHA 1SXJC 3AONB 4R2LA 1TF7A 5IPFA 1FNNA 4N4AA 3UPUA 1KO4A 4C20A 1ORTA 5CPBA 3RK0A 1X6IA 3F96A 3HJNA 1PL0A 1BE1A 2J3IA 3OOYA 1GT91 4JP3A 3PK0A 1DMSA 4CFZA 1PN3A 4EPXA 3TMAA 3HZZA 4DR5B 1CS0B 4EA6A 4F5NA 4C7XA 8ICKA 3D81A 1N92A 4LAFA 1WKVA 5HCIA 1I7QB 4URYR 4EYQA 1J8YF 2AOXA 1JBQA 4JNKA 1JT9A 4ND1A 1CRXA 3HKDB 5JV5A 4HN2A 1FFDA 1C9DB 4QZEA 3A3YA 4M1WA 2QVBA 4AULA 5DYGA 1WM1A 4W5JA 3K0KA 4EZBA 5CG1A 2RI6A 4JYPA 4UZSA 3B8EA 4FM9A 4P08A 4R2XA 3PHGA 1SA0A 1SCIA 3NBFA 4O4IB 2H0QA 4J9KA 3IHLA 1S0UA 3BJIC 1E3MA 2ZCUA 1ZQZA 4JENA 3BIFA 3TADC 2I1VB 2VHJA 3TOVA 2I8CA 3R20A 1G7CA 1UPXA 4FLMA 1ZN9A 4CIDA 2UVWA 1IK6A 3PRHA 4Q12A 4ZVNA 4KJXA 4G0ZA 1PZFA 3PWTA 3I2JA 2OBBA 2X2EA 3Q6IA 3JPYA 3LY7A 2NN3C 1WOYA 3TI9A 3F49S 3GPLA 5HF9A 4DNXA 2YICA 5AP9A 5KX5A 2Z5FA 3EBLA 4HEA1 3UQZA 2MINA 2HA2A 2BJWA 3BQTA 2QJRA 4BN0A 5ER6A 2L0XA 1QZXA 1R4MB 4HFJA 1DXHA 3WK5A 1BJTA 2IYFA 5DNVA 3SI8A 4FX2A 4FFWA 1AHIA 1XE3A 3LW7A 1H4TA 5AJWA 4DPMA 1CR2A 5D84A 2BFEA 5AI9A 4B6RA 2FG5A 1GGNA 3EVZA 3L79A 3BB3A 3HCCA 5JHHB 1WCNA 3GFQA 4E15A 2QYSA 5IM4F 3HNRA 1RIFA 2Y1GA 2C2XA 1MX3A 1KAMA 5J5CA 4IDFA 1NUPA 1HYEA 1BRTA 4F7WA 1NX9A 1ZA1A 3AKEA 1BGVA 3OT1B 1NJGA 1SU6A 4RF4A 2X40A 2WHXA 1M2NA 3HB4X 4F5DA 1XZAA 3G0IA 2REXB 2HBRA 4YXJA 4GGOA 1E62A 4GP6A 2DF8A 2DOKA 4ECZA 1JJBA 1S4MA 3C5FA 2FMIA 2DZDA 1QQ7A 2BHLA 4PZ0A 5HZHA 1W9HA 2PGIA 1P18A 5HJ7A 3RYIA 1QGZA 3OJCA 3SSAA 4J1SA 1KTQA 3LSYA 1OILA 4OI2A 5KQSA 4PBSA 2P4SA 3O4FA 3D3EA 1QO9A 2R6FA 1AUPA 4LJ4A 4HFRA 2LP4Y 1IXRC 5EJ4A 1ML4A 2FGKA 2OSVA 4QWMA 3PT9A 2ZIWA 3VDMA 2H8GA 5T64A 1UCFA 3JYNA 2P6OA 3BS4A 2GETA 3D1JA 3ZU5A 4KLCA 2UUPA 1Q17A 4L6AA 1N0VC 2EJWA 1IK4A 2VYNA 4N0EA 2OTCA 2D1RA 1AK9A 3W06A 1TADA 2KSOA 1XQ6A 4I2EA 1H9BA 3OJFA 5T6BA 1TA4A 1XZLA 2OV6A 4HDNA 4U63A 4Y2YA 4IQVA 3VDXA 4MQFA 4ZZIA 5B1EA 2E49A 3KPUA 4QNNA 1PDVA 2YVAA 4LGMA 1GAEO 1SUEA 1R4AA 3FYUB 4AJ2A 1FDSA 1T6BY 3ROGA 1ZOPA 3C7CB 1KE1A 5T4HA 3V8VA 1V7ZA 1WB5A 2YY6A 1O7JA 1DWUA 5AVQA 3QZ7A 3G2IA 3PL5A 1ZQGA 5CJPA 3OZEA 2P2YA 2JLBA 1ZDMA 4O4IF 4UAVA 4BMOB 4BFZA 4L5JA 3WGKA 4KLFA 1YQGA 5KJEA 4AJJA 3A4TA 4LDJA 4UREA 4FHDA 4KRXA 2A1IA 3R3JA 4RDIA 2J3KA 4LJLA 3V7NA 2H18A 5BWLA 3RBZA 4ITRC 4GI7A 1N6OA 4NF2A 2VBCA 4GVXA 3FIJA 3AVTA 1RHJA 1O0CA 3E1SA 3HW8A 1B0UA 3AFOA 3U7QB 1NG9A 2V0CA 2VNAA 4GI1A 2JRZA 1IM4A 4PICA 3CRRA 2PSFA 5CDFA 3Q1LA 2W9CA 4QPPA 5HXAA 4BRSA 2RHRA 4Q9HA 2QN8A 1ISPA 1EFLA 3DKKA 1JEYB 1J7KA 4LJ7A 1ZQFA 4WJLA 2P6UA 3OOSA 4INPA 1QO7A 2R48A 4QYIB 1QS0A 5KFUA 3W90A 2A9PA 2I4MA 1MB0A 3GMSA 1U7OA 1GL3A 1VMDA 3LZ6A 3T7CA 4ZQHA 1RVDA 1HNZB 1O96B 1M3SA 1E4EB 5J0XA 4CDNA 1S7CA 1M1NB 2ZYHA 1BFDA 3T3OA 2Q3MA 3HU2A 4IHJA 2LCQA 4X7RA 4RU9A 1OB2A 2AWNA 1M6WA 5LOVB 4OJTA 3G7UA 3BDVA 1FMFA 2JHAA 5EKDA 4DNPA 1CY2A 3MAGA 1ADJA 2P5UA 2RGBA 3M6WA 1IEXA 4XRHA 1GCIA 1RXWA 1N9ZA 1NMSA 4GR5A 5BT9A 5A4FS 2DR2A 2QZ4A 2UXDB 3GRVA 1XMXA 3T3PB 2DPIA 3PUXA 3IL2A 3QNUA 4PG4A 2AKAB 5BN3B 1OW3B 1R74A 2DY0A 3L6CA 1U1IA 2O6KA 2BFDA 1ZLYA 5ALHA 1HKHA 3OF5A 5BV2P 4GI3A 5JNVA 1JDBC 1FQKA 4D5EA 5LQCA 2FSVA 2FMUA 1JXAA 3F4BA 1GYRA 4DBZA 2LCFA 4I9HA 5LLTA 3UAZA 3A1UA 1L4EA 3GVPA 3IS3A 1XU4A 2X8BA 1SUPA 1NYLA 1NA5A 4IRKA 3AXSA 4OHWA 2P8JA 2FCAA 1ZK3A 2PWAA 1ULUA 3B1JA 4X9XA 4ZAGA 3JZAA 1MIOB 2P2NA 3QKWA 4UHJA 4AO6A 3LPDA 4YP9A 3EWNA 4D3XA 3OUUA 4HGPA 2QVXX 1AUVA 3C6KA 3I9FA 4X5VA 3PF8A 4C07A 2ATIA 1ZJJA 3QYPA 2V03A 4P6VF 3A0HU 4MJ7A 3RGGA 3C7TA 1ZONA 1U5CA 2PLAA 4MW9A 5E1DA 4EO4A 4HZIA 2PL5A 3TG2A 1ENPA 2CNWA 4GZLA 2G72A 2HMAA 4C0KA 4L9AA 4J0JA 3FB4A 2R66A 4OUKX 4V02A 2ZZKA 4F85A 3BDAA 2HBKA 2IBSA 1SKRA 3J81A 3IIIA 4ND2A 1UADA 3WTBA 2QYTA 1WZEA 1XZHA 4LTNA 2EKZA 1I4OA 3DTNA 3O4RA 1T3TA 3RYCA 1Z7GA 3IURA 1U65A 1MOPA 3M89A 4F9EA 1L1FA 1ARZA 4YDSA 3BMQB 4PL2A 5ELXA 2CWWA 3Q7IA 5KQGA 3AHGA 4YRTA 5EYPA 5SYMA 1YGPA 1WO8A 5DDYA 5BQ3A 3Q6MA 3CR7A 1ZH0A 4LPKA 5B5SA 1RPNA 2JASA 3NVYA 1E3EA 3VNUA 1R0ZA 2BMVA 4L0CA 4L8LA 1E9RA 5DNWA 4EJFA 1N5WA 4RD2A 1XKLA 2I3ZA 4F5YA 2GAIA 1U9IA 4AS1A 3PXCX 1E2GA 4JLKA 3CVXA 2FKNA 4X24A 1DVRA 1RM0A 4EG7A 1P7YA 4AB1A 1VGRA 3OZIA 3NC1C 4DG8A 2NZVG 3ILYA 1HQDA 1Q3HA 3AFHA 3L7KA 5LOVF 1GJRA 4RVUA 1KRPA 3PO4A 4YPFA 1GADO 1B42A 4RKQA 4D9EA 2JZBB 2G06A 1ACJA 3D8UA 3MWEA 4NU8X 1WW3A 4O0LA 1WBJB 2XZOA 1F0MA 4ZMRA 4EW2A 4KUEA 1P74A 1KI1A 3PVSA 4QJBA 1E3IA 4YAEA 1M5TA 2HU5A 3Q7TA 4U39A 5CJ7A 2ZE8A 3LQQA 3PQ4A 3ZU2A 4JEIA 3KTFA 3K8QA 4JR2A 4N5NA 2HZ7A 1QKJA 5GGYA 3ZCRA 4CQLB 3QNMA 4FE3A 4HXGA 2CZCA 2WQZA 1JAZA 3LKVA 1RQGA 5H4HA 3A6KA 2JAHA 3KKPA 4CHTA 2GTPA 4XQCA 2VJOA 4MUGA 3FDFA 4WW0A 2NU9B 2FP3A 1I51A 3LG2A 3FSJX 3RU7A 2YMLA 3M0EA 4MV7A 1TCAA 5FFMA 3C4JA 4GLLA 4GP7A 1JIXA 4BEWA 3DEFA 4Z4GA 2RGRA 3NNSA 2I2AA 2YXEA 2XIJA 1ZEMA 4RF3A 4FW8A 2VDUE 2OV8A 2XTZA 4RQ5A 2NUTB 3DHNA 4LBWA 1RYFA 4QUAA 4ZOAA 2PI5A 4PHDA 1R5JA 3U3OA 2C1ZA 1D9ZA 2FFAA 2B6HA 3UMBA 2E0IA 3KR2A 3FRJA 1OFUA 4BVHA 1WE2A 5I9SA 1EUQA 4B3DA 2RD2A 4FC6A 4H0NA 3HZHA 4RTLA 1GKUB 3IVXA 5CP2A 5J5AA 2FN9A 4M76B 4F4UA 1LLQA 1S97A 4R0VA 2CYBA 1QRUA 1U5BA 3SQWA 2EFCB 3ZIAA 5IIIA 1GRCA 4DLUA 1I6MA 1I6KA 5J58A 4LOHA 1N2CE 5A6VA 3VHXA 3C1AA 4TXJA 3CRNA 1SU7A 4P0QA 1XZBA 3DW1X 3EOAI 1T0BA 1KHTA 3N2KB 3QPCA 2Q6KA 3D3WB 1A27A 4F97A 1M6EX 2AVDA 1Z2EA 3TM4A 1GQ2A 4CQMB 2ZUEA 4IVNA 1MT3A 5ILOA 4B47A 1Y4DE 1DV2A 2XR1A 3SN6A 1ODTC 3GLGA 2IKQA 2C8VA 1KDZA 4Q45A 2Q0SA 1G8SA 3DE4X 1H2WA 4YJHB 5AXAA 5ER9A 4HDSA 2X1LA 2X2OA 2C57A 4X61A 3Q7EA 7ICEA 2GRJA 1X3SA 1NR1A 4EF6A 3T6KA 3T4XA 3YASA 3VDNB 3PQDA 5FOUA 4OJQA 1A9XB 1S3FA 1GSOA 5J23A 4DADA 5JS6A 4PGMA 2PLRA 3U39A 4AAYA 2Y4OA 1NFRA 4MR9A 1U6KA 3H5TA 1I0IA 4GFJA 2JK1A 5HFAA 5J0RA 1ZL2A 2LKCA 3W05A 4JODA 4DREA 3K4HA 3OO1A 1NLUA 4CCYA 5AOVA 4QKQA 4H7EA 1UODA 4I5IA 1PLJA 3GVIA 3N2YA 3W3AA 3CXRA 3NX4A 4OMDA 4MRMB 3PJRA 4DSAA 4U0JA 3PZBA 5CRIA 4OQEA 1Y3BE 4OIFA 3FCSB 3WISA 4R1UA 3ASYA 3EZ9A 2FRXA 3R8CA 1ESZA 4JJGA 4LZGA 3ZIUA 3OJOA 1NVUQ 3WKBA 5K8JB 2CCKA 1KI7A 4QEKA 2YNMA 3JVIA 1G3MA 2AT1A 1HOTA 1KOJA 3GUVA 3B0YA 3FWNA 3OUTA 1HJPA 2UXBB 4DB2A 2A5FA 4IZOA 3PVCA 1PO7A 3L4KA 5AVTA 1PI3A 3H97A 1DIRA 1COKA 4TWRA 2CNKA 4LK3A 1X13A 2QTAA 1OOEA 1T2VA 1OMOA 4B4VA 3RYFA 1WCLA 4YJ3F 5HBRA 5D4BA 3NOXA 3LSTA 4E5UA 5KFQA 4N5MA 4RKWA 2PMFA 3GFFA 4FN5A 4EAQA 1EWYA 1ZW6A 2H9AA 2C5GA 3A3PA 1ZQSA 1DRKA 3I9LA 4CV2A 3N5KA 5I7FA 1CG6A 5AO9A 3RKRA 1X7ZA 4I66A 2HF2A 1Q92A 3N05A 3GJ5A 3GLIB 3SKVA 3RODA 2H85A 3BIOA 2NADA 1JPNA 3WC4A 1R3UA 4TV8A 4YH1A 4AN1A 1TYZA 2VPQA 1YU9A 4HSGA 2P9TA 2FPGA 3P2KA 2DXIA 2FX3A 4MRSA 3OJWA 2OYRA 4JUFA 4ZI5A 2LW7A 2W48A 1VKRA 4G86A 1TW2A 3M6KA 3O8CA 3ZGOA 1K89A 1IZ9A 4HNVA 3I6BA 2YYAA 5CDTA 3FPFA 2WD8A 1NI3A 3E3NA 1BRMA 1UT8A 1R6BX 3HCAA 4V1CI 1P6QA 3PNLA 1XCMA 2IPMA 4YFKA 1A1SA 5CM8B 1F2TB 3C74A 3UMGA 4ZTUB 1C4OA 4UTOA 4GZMA 3RVBA 2VTEA 2FHPA 3CPHA 2WJAA 3AUXA 2DBVO 4GGMX 2GTHA 1IBSA 2YWDA 1CUEA 1V95A 2VP2A 2CL7X 1WQ1R 5E9WA 4EVIA 1CRQA 3CF0A 4B32A 1H9CA 4FI3F 3SIXA 3C5EA 1TCUA 5L1JA 3LUCA 1TCVA 1P77A 2PX3A 2Q0XA 3K9QO 2C07A 3WWPA 2G5TA 1E2BA 2XA2A 1M6NA 1QTNA 2AW5A 3UO8B 4QEZA 4C6HA 2Y0DA 3AHIA 5LP6B 3JQRA 5JDCC 2GBPA 3UKDA 4TKVA 4UCXA 3DOEA 2BR5A 2D5LA 5ERYA 1EHIA 5AHWA 5EUMA 2XCUA 3R23A 4BGUA 1X70A 5TQ2B 3O0FA 2WD9A 1X9SA 3L8ZA 3RAEC 4ZPXA 3M6XA 4PG6A 3D0KA 1Y6JA 5DQHA 2AI3A 3AOEC 5E2IA 2I33A 1WXDA 2O14A 4GQIA 4EHKA 3AQ4A 4IEFB 2YR0A 2UZ1B 5BRAA 4YROA 3TFQA 3D5TA 3TQCA 1HFEL 2HADA 3DV0B 3CLRD 1E94E 3P4YA 5DW0A 4Z7QB 2VIIA 2GM4A 1L3UA 2XGGA 4MWEA 4IVPA 1IY9A 2AJ8A 3R8XA 4UXIA 4RHEA 4E31A 2BTQB 1ZMBA 3DVSX 2IEAA 3C5HA 2XZLA 3SF8B 2W37A 5JVDB 2H00A 1QIDA 4GBGA 3SBXA 1PJZA 1UJBA 1LC3A 1EEXB 3HKBA 1PNTA 2DETA 3CZ4A 4N7JA 5A4JA 4YMSA 4EMBA 4F3NA 2YXDA 4ED6A 5A2GA 1YAHA 5D3KA 3IT3A 3SZ3A 4RCYA 3F4LA 3W5CA 3P9NA 2N1MA 5HZGA 1DWOA 2NRVA 3E9MA 2IZ1A 1WRBA 2JGDB 2X9NA 4YXMA 3IKVA 1C9JA 3Q0TA 1PQWA 2E5SA 2QN9A 1Z73A 3MA0A 1YNOA 4PZCA 1X1BA 4UQOA 4A8JB 3PGLA 4ZGGA 4OHXA 1ONSA 1ECBA 2EZUA 4YJGA 4NMMA 1CZKA 3CRXA 4NEHB 4R5MA 1LX6A 2KVCA 4AJHA 1R10A 1IY8A 4WXYB 1Z37A 5HNKA 1SBZA 2YJNA 2BFBB 2NTVA 1VB3A 2TECE 1TYCA 4HQOA 4HVLA 2ZJOA 1KAGA 1C81A 4RWZA 4I5EA 3DKVA 3AL2A 4HPJB 5DHAA 2JGLA 4MVXA 1J5EB 3JQAA 3EBOA 3OLZA 3ZQ6A 3ZY3A 1IDOA 3GROA 2GZ2A 2JFFA 2GCOB 2XF2A 3M7IA 3LOPA 2BGGA 4NXMB 1G21A 3GJ6A 1PG5A 1CERA 4ZVSA 1KARA 1SELA 3LUKA 1KNQA 3CHYA 1MG5A 3BILA 2HDNB 3X1KA 3L84A 4DTIA 3HCNA 5AXCA 8LDHA 3EIFA 2DPXA 1WDKA 1NW7A 1EESA 2NYAA 5KWVA 4ZCTA 4OQ4A 4TROA 3QEBZ 3WZMA 3L01A 3QKSA 1NXWA 1Q7EA 1M2VA 1DRUA 4E4RA 4TQ9A 1UBTS 4PHFA 1KI6A 5A2QA 2VJNA 3C3YA 2C2GA 3ECAA 2F43A 4X8OA 4DYDA 3OQBA 4I36A 1HGXA 3DTYA 4AJIA 3UB2A 1JTEA 3L0SA 5CW2A 1H6CA 1NSFA 2UUBB 3EPHA 5DNUA 3OQVA 1LVHA 2GRAA 1P0PA 4RPIA 2HMTA 4UBCA 4POAA 2ZPUA 1K0FA 1DEAA 1G3IA 1OBVA 4OU4A 1EK2A 4EAAA 4EY8A 3CGGA 5KTRA 2WYVA 3RK4A 1AB5A 3HLYA 4RSRA 3E7WA 1H6DA 2QX7A 3Q85A 3VKUA 4KX3A 2EF1A 2QSUA 3O7MA 3Q7SA 4KLAA 5FL7A 5E1OA 4TSKA 4EWLA 4GE3A 2REQB 3GQBA 4MPTA 4IWXA 4HR7A 2WV7A 5L3VA 3DLIA 4DRXB 5C35A 1SC1A 3SYNA 3PCRB 3MQ2A 2DRIA 3HWX1 5GPBA 2WIFA 2W03A 1YDHA 4G07A 2WZCA 3TK1A 2OQVA 3PW2A 1JXMA 3VJKA 3U44A 1T9GR 2PCJA 5CM9C 3K1AA 1H5QA 3N58A 1WNFA 2GO7A 4DOAA 2NMVA 2VRCD 3UOGA 3A4NA 2Q1XA 2VHTA 4EL0A 4AKGA 2LMRA 2GVZC 3KKMA 5H9VA 3FUTA 2A94A 4HRXA 4RZUA 3O03A 3N0RA 1PJAA 1SQ0A 4RQ3A 2M6RA 2WW8A 2CPRA 4I3HA 3CVUA 4EBDA 2AX3A 2IYZA 3ADPA 4G0XA 2VUSA 1V1RA 1OPXA 3PC3A 4GOLD 2JAUA 1BPXA 3F5EA 3DLBA 1XNSA 4WECA 4BLTA 3STYA 2VPZA 1RADA 5ENVA 1J2EA 4PAWA 3BTUA 4FDUA 1P39A 4US2R 1O94D 2A0UA 2A84A 3S7ZA 3NEAA 1KYXA 3H1EA 4MVJF 4TV8F 4BNVA 2WHEA 3RB3A 1ZVVA 3M1YA 3ILSA 3QLUA 2QPTA 1ST3A 1IXSB 2BBOA 1VE3A 1KZYC 4QGSA 3FBTA 3HSKA 3WGVA 1E6UA 5COQA 5F9NA 1HG1A 3A14A 1UJNA 1GLNA 5CYPA 1CZNA 4IRCA 1PGJA 3FVQA 3VO1A 2B78A 4ESVA 1T9KA 1D6MA 4ZALA 7ICQA 4RABA 5EL0A 1HV8A 3JS5A 3TGWA 1CJVC 2OZPA 4MLPA 4S1NA 1X7XA 3BWYA 5THQA 1U5AA 3LXRA 3HV0A 2MT9A 4AJOA 1JHZA 3D3JA 3PQ7A 3VPCA 2DWUA 3IDAA 4RFSA 3UWDA 5J0YA 4KVAA 4QGGA 5JS7A 3ZHUA 5HA5A 3HS3A 1YE3A 3X1YA 3I42A 4BIIA 4V3BA 1AT1A 2JZCA 2CLOB 2HHHB 3NKVA 1UBSB 1E32A 3OF3A 4EKEA 4NY8A 2BH2A 2V97A 1ZOSA 5HW0A 3DOOA 5A4KA 1MABA 4HN9A 4D82A 2BR3A 1I1OA 7ICFA 3ECSA 4IV8A 1Z4JA 2CLSA 3VYUB 3OZSA 3CB2A 9ICQA 2PZGA 2WKWA 1K97A 3EYAA 1N3BA 1PCXA 5SY9A 2KS6A 5M2QA 3KJXA 1VE6A 2QTLA 1TRHA 4IEEA 2JJ2D 3IOCA 4LJ6A 3DVAA 3IV7A 4NY1A 4HBGA 2W8LA 1NRWA 1OJLA 4JSRA 2ZJFA 1OXTA 2BGJA 4NG5A 1XNQB 5ICGA 4O5CA 3BSFA 4M1TA 3SHVA 1PJTA 1S89A 3O4HA 4Z9XA 3T7RA 1QHFA 2FWRA 4NFLA 3STXA 3ZWVA 3HR4A 2HC9A 2B7CA 2FEWB 2Z8ZA 2ZZMA 4ER6A 4C7KA 4G24A 4ZH4A 4JKIA 1ST2A 3WDLA 4ZK2A 3SM3A 1CUIA 1TIBA 1FC0A 1O6CA 2IHJA 1G98A 2YS6A 5DTEA 2GLXA 1G63A 2HT6A 4XPIB 5COBA 3OESA 3ONFA 3NP7A 2PXCA 1S96A 2X0FA 2HMVA 2OCYC 3DDNA 4LTMA 3WVNA 1PVPA 2P7HA 1R6DA 1E0KA 2A78A 5E7MA 4RVDA 2ZB2A 3N0WA 3O1IC 5BMVF 1K7XB 4Q4JA 4ECYA 3AETB 2I5HA 1Y9EA 4EZIA 5DH9A 4MARA 2BKUA 2RKBA 1LX7A 1VRCA 3G2HA 4DCUA 5SZKB 4BO8A 2QQ0A 3RFAA 5KTKA 1A8QA 5D51S 5GZ3A 1SUCA 1GL6A 1DG9A 3MGCA 4E0DA 1UH5A 3PGVA 3SYTA 3NHFA 2IHUA 4MDYA 1PFVA 5DHUA 1WNTA 5JTUA 4JEMA 4J9LA 4ZVVA 3I30X 5L4SA 1BN6A 2XB2A 4C3OB 2OY0A 2V45A 3LLSA 4P98A 3RUFA 2C54A 4B09A 1BXRB 3EHEA 4XRGA 1DCKA 3WGMA 4I08A 2QSJA 3VPFA 5IANA 4YLEA 3ZVKA 3V80A 2J9FA 4I9NA 4OV6B 3GLFB 4BRWA 3DWFA 4YUWA 3KOYA 1WD5A 5CX4A 3C3KA 2XHZA 4U0KA 7GPBA 2GPJA 3I62A 2RHWA 3ZD6A 1CLUA 1FX0B 2EWMA 5CAEA 4PGHA 1FTYA 4AZ0B 1MN6A 3C23A 2PGXA 4A5OA 1QZTA 3EZ6A 1KIMA 2WU3A 1W29A 4ZZ3A 4KREA 5F5XA 4F21A 3IXLA 1CQWA 4NCBA 4K03A 2EDAA 1IOLA 2PWZA 4EUKA 2BRUA 3D3QA 2QRJA 3DEJA 1KDVA 3FY4A 1QAMA 5IM4A 3K3PA 2GYVA 2AB0A 1FS4A 3ZJ5A 2AEJA 3ZVRA 4JLVA 1PDWA 3F2CA 1FVFA 4A8TA 1YS1X 2H4FA 1T8TA 1TUEA 3I09A 2ADMA 3PNBA 1XAIA 4GUAA 3F53A 2X1VA 1DDOA 4LJ5A 3L0YA 3RUDA 4RHXA 2J46A 2E1PA 2Q3CA 4K0KB 3FOAA 3AX6A 2E1EA 2RHJA 3OSUA 5TJ9A 1AKWA 3SHFA 4DKJA 3JVDA 3EA0A 1K7YA 3KQTA 2VAVA 3PW0A 2PU7A