2HSZA

Crystal structure of a predicted phosphoglycolate phosphatase (hs_0176) from haemophilus somnus 129pt at 1.90 a resolution
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
225
structure length
225
Chain Sequence
GMTQFKLIGFDLDGTLVNSLPDLALSINSALKDVNLPQASENLVMTWIGNGADVLSQRAVDWACKQAEKELTEDEFKYFKRQFGFYYGENLCNISRLYPNVKETLEALKAQGYILAVVTNKPTKHVQPILTAFGIDHLFSEMLGGQSLPEIKPHPAPFYYLCGKFGLYPKQILFVGDSQNDIFAAHSAGCAVVGLTYGYNYNIPIAQSKPDWIFDDFADILKITQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords novel predicted phosphatase
publication title Crystal structure of novel predicted phosphatase from Haemophilus somnus 129PT at 1.90 A resolution
rcsb
source organism Haemophilus somnus 129pt
molecule tags Hydrolase
total genus 84
structure length 225
sequence length 225
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2hszA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2hszA01
4KX5A 4DCCA 4EENA 1RMQA 2RAVA 3IJ5A 3M9LA 2RBKA 1QQ5A 3I76A 5AIAA 2YBDA 1KYTA 4G63A 3OCUA 2HO4A 1YMQA 3KZXA 3FGOA 1CQZA 2GHQA 4EX7A 4UMFA 3U7HB 1Z4MA 3OCWA 2YMQA 4Y2RA 2I6XA 5AKYA 5AI0A 2AUTA 1SWWA 1L8OA 2YMPA 3D6JA 4O8CA 2FPSA 2FPRA 2FI1A 1FEZA 4RETA 3ZUPA 4AS2A 1Z4QA 4I9FA 4H1WA 3WK4A 3UM9A 4I9GA 5ALRA 2P11A 2G80A 3AR4A 3E81A 3QU7A 1YV9A 3SMVA 3ZTWA 1YNSA 4UAUA 5ALZA 4C4TA 5AI8A 5AK3A 2WHEA 2FEAA 3AR7A 3E8MA 5ALXA 1IWOA 2ZBEA 4BX3A 3QU9A 4UM7A 3ESQA 1XVIA 2HCFA 1YS9A 4L6CA 4NAVA 1Q91A 2OM6A 1S8OA 2CFSA 2JAUA 3A1CA 2MU2A 4L57A 2R8YA 5AM5A 3WK6A 3EF1A 3L5KA 2WFAA 3N8GA 4OFZA 3SHQA 3WK5A 2G1AA 5AVZA 2HOQA 2BDUA 3PGVA 4FFDA 4CNQA 3AR6A 5AKLA 3WGUA 5AIBA 4C4SA 3FPSA 4UMDA 2EATA 5AK4A 3AR3A 2DQSA 2ZBFA 5AVSA 5ALIA 1L6RA 3HYCA 2O2XA 5AW1A 2OBBA 1RMYA 4UASA 4HGQA 5IT4A 4Y2VA 1EK1A 4FE3A 4BKMA 1ZD3A 5AKEA 5AKXA 3L0YA 4IFTA 1U7OA 4Y2UA 1QQ7A 5ALJA 1RMTA 1S2OA 1XP5A 2RB5A 4BNDA 1RLTA 4Y2PA 3ZW7A 1K1EA 3AR8A 4UW9A 3A3YA 3IRUA 2JGAA 3I1YA 1YJ5A 4EX6A 2YJ3A 5AVXA 3BWVA 4UM5A 1VFPA 3ZVLA 2HX1A 5FP0A 5AKGA 2B1RA 1YDFA 4YGYA 2Q4TA 2AH5A 3ET5A 1O03A 2QLTA 4Y2TA 2IA5A 5ALQA 1L7PA 4PNHA 1NNLA 5ALGA 3QGMA 1Z4IA 2BY4A 4NWIA 3DNPA 1MH9A 1U7PA 3QUTA 5AM4A 3NANA 5T41A 2GO7A 4J03A 3KD3A 3W5DA 3N1UA 2HI0A 3S6JA 3NRJA 3W5AA 4BEVA 3ZVMA 2GMWA 4KX3A 3WK9A 4HYTA 4NV0A 3ED5A 3ZI4A 2VKQA 5AI9A 2NYVA 1WPGA 2WM8A 2CFRA 4CF3A 3W5CA 2YMLA 2AMYA 2C88A 4KNWA 3ZX5A 4Y2QA 4RESA 2PKEA 3OTQA 2G07A 2YFYA 3QYPA 4UMEA 3SF0A 1TJ5A 4UAVA 1Z4LA 3E58A 3ET4A 3IB6A 3QX7A 1T5TA 1RKQA 3L8GA 4UARA 4MUMA 2I7DA 3UMCA 1U2SA 3MN1A 5AI4A 2IOHA 3MPOA 3AR5A 4GIBA 2OYCA 3WKEA 3L0BA 3ZU6A 1L7MA 1XPJA 2G08A 3NALA 2W4MA 5ALKA 3L8EA 2FDRA 3DAOA 4CF4A 3U13A 4NFLA 3QU2A 4JB3A 3E84A 4GXTA 4NABA 2I34A 1L7NA 2WF8A 3OCVA 4BX2A 4BYGA 1ZD5A 2ZXEA 3U7EB 4EZEA 3I6BA 3N5KA 2R8XA 3PGLA 4DWOA 5AW2A 3NUQA 2IOFK 5AM0A 4YCMA 4XE5A 5AM2A 5A3QA 1RLMA 5AVWA 3W5BA 3KOOA 3HLTA 4HGOA 3QUCA 5AKZA 2B82A 3KC2A 2CFTA 4OCZA 4Y2YA 2JAOA 2JARA 3U7FB 3U7GA 5ALVA 3K1ZA 1ZRMA 2ZBDA 4OHFA 4IG4A 2G0AA 3FZQA 3EWIA 4OD0A 4YCLA 2AGVA 1RKUA 1TA0A 3QNMA 1JUDA 4ZEVA 2P9JA 2WF5A 5AK5A 4Y2SA 3L1UA 2B1QA 3P96A 2PR7A 3QUBA 3QXGA 1RQNA 4BBJA 2W43A 4HGNA 3DV9A 2PQ0A 4J2TA 5AVVA 5ALDA 3N28A 1AQ6A 5ALOA 3A1DA 3WGVA 2MSNA 3U19A 1VJRA 1RKVA 2C8LA 1LVHA 2NO4A 5ALUA 2B30A 4QJBA 3R4CA 2P69A 5AVRA 4CF5A 3AR2A 3ONNA 3FPBA 5ALNA 4Y2JA 2EAUA 4Y3UA 1CR6A 5AI5A 5ALHA 3CZ4A 5AW3A 1L7OA 5IS2A 1SU4A 1Z4OA 5AICA 1TJ4A 4HGPA 3OPXA 5AW0A 3NIWA 1TJ3A 2EARA 2W11A 2QYHA 4QQFA 3ZVNA 1ZD4A 4EEKA 1U02A 1T5SA 3R9KA 4KYTA 4AS3A 5AI6A 5JJBA 2IYEA 3AR9A 2YY6A 1QQ6A 3SKXA 2FUEA 1WR8A 3ZX4A 1N8NA 4HGRA 1TE2A 3WK7A 3BA6A 5AW8A 5AVQA 2FPXA 4F71A 5AM3A 2WF6A 3SKYA 2HHLA 2JAWA 2NO5A 5AKHA 2HF7A 3PDWA 1J8DA 3QLEA 5AKJA 4XOUA 2G09A 1N9KA 2YJ4A 1RPZA 4YCNA 4KNVA 5AW7A 5AVTA 1ZS9A 3PCTA 2WF7A 2B8JA 2P27A 4UMVA 1Y8AA 3EF0A 3F9RA 4AP9A 5AM1A 3SD7A 4UU1A 5AW9A 4F72A 1VJ5A 4BEWA 1NRWA 5AW5A 2YJ6A 2C8KA 3RF6A 5AESA 5ALFA 2GFHA 2ZOSA 1RC8A 2FUCA 4BX0A 3UMBA 5AVUA 3I28A 4EELA 3OCXA 5ALLA 1F5SA 4XPZA 1ZD2P 1Z5UA 3WK8A 1Z4KA 1WVIA 1QYIA 3KBBA 4YIKA 5AW6A 3UMGA 3EPRA 3ZWDA 4G9BA 3A1EA 2O9JA 3WKBA 5AW4A 2MU1A 3WKAA 4YIHA 2HF2A 5A3RA 1RQLA 1Q92A 1Z4PX 3QU4A 4CE6A 1J97A 2CN1A 5ALYA 2FPWA 5AKIA 1Z4NA 2G06A 1ZRNA 1LTQA 2I55A 4HAIA 2B0CA 4L6AA 5AVYA 4C4RA 1Z4JA 3OCZA 3SLRA 3MC1A 3FM9A 4ZEXA 1RRCA 4UU0A 4BNDB 4Y2XA 4XQ0A 3ZTYA 2HSZA 2B8EA 1EK2A 2C9MA 3OCYA 3U26A 3ESRA 3MMZA 4B6JA 2GHTA 3TLMA 4DFDA 2C4NA 2ZG6A 3B9RA 2YN4A 3QU5A 1WZCA 2HDOA 1QH9A 1O08A 2D2VA 3VAYA 2OA0A 3ZWKA 1PW5A 5AK6A 3NASA 1NF2A 3L7YA 3KDPA 3NAMA 3L8FA 4E88A 3CNHA 4FYPA 4YH1A 4ZEWA 5ALSA 5ALEA 3GYGA 3L8HA 2I33A 5IT0A 3R09A 1ZJJA 2RARA 1Z5GA 2FPUA 3WKDA 5ALTA 2BDEA 5ALWA 2X4DA 3B8EA 3N07A 1ZOLA 2Q4RA 4DW8A 3L1VA 2IOFA 5A3SA 4KN8A 3J7TA 2I54A 4JDPA 3L0CA 5E0OA 1RDFA 3QUQA 2HEGA 2R8ZA 2YMMA 2ODAA 3FVVA 1L8LA 1T9ZA 3RFUA 5AHXA 2R8EA 3B9BA 2Q5EA 5ALPA 3WKCA 1U2TA 1Z88A 4UATA 2WF9A 3DDHA 5AKKA 2ZBGA 1SWVA 1RLOA 1X42A 3M1YA 2YJ5A 5ALMA 4MWOA
chains in the Genus database with same CATH superfamily
4LMBA 2O52A 1J1IA 2YL2A 1COWA 2QTGA 3H5TA 1QYXA 2YZ2A 5AIAA 3HS3A 3TBHA 2NP7A 4PZEA 2VK2A 2H18A 4WJZA 5DDYA 1ZIYA 4ONEA 4GL2A 3IYLW 4OA8A 3AJAA 3AOEC 3KE9A 3M9MB 4KTQA 3O4IA 1JKMA 1UA0A 5IK2D 2QVYX 2A4KA 2O8DA 2H2FA 1LH0A 1TAQA 3E9QA 4F5YA 1WW2A 4L95C 5TQ0A 3ZDZB 5GJBA 2KSOB 3UQZA 4MIKA 2ZWAA 2Y9TA 3X1JA 4IS2A 1EGHA 3FFXA 3T7SA 1C8BA 3FLEA 2ZUTA 2WVJA 3WK5A 5CH3A 3EYAA 4KQJA 4MR7A 1P77A 4F3TA 2WT4A 1HYEA 5EZYA 5EOZA 2PGIA 4AN4A 2ZXIA 4BTEA 2AJ8A 3Q5DA 3AB7A 4NDNE 4LF9B 4YDSA 3URKA 2LKCA 4UW9A 2Y77A 4FYHA 3I1JA 1WVMA 4D02A 5KNBH 1CUXA 1BE0A 2BKAA 1YDFA 2IPXA 3FHCB 4RH1A 3Q1LA 1ADFA 3ME5A 2ZEJA 2GEDA 1RRGA 3TR6A 3K2EA 2QRGA 3WDLA 3V8BA 2X6QA 1SL0A 3IDFA 4D82A 4AYBF 1WNTA 1SM4A 2GZMA 1N7IA 5ICCA 3GLTA 4WFQA 2YMLA 4KNWA 4IGFA 2WAOA 4ZZ0A 1V5WA 5JI2E 4QOEA 5FWYA 2A1UB 3BB1A 4QZGA 1VYVA 3D0OA 4R5MA 4JJ4A 4FMBB 3HY3A 1NPDA 1QHYA 4HDKB 4OI4A 4NYMR 2OGUA 3GGSA 5F2OA 4QU9A 1HR0B 3QE4A 3D7SA 2H9IA 2LZ0A 2I34A 1CY4A 4FR5A 4KO4S 3D4IA 3SJZA 2I2DA 2XTMA 1A76A 1D8TA 2O2CA 4UJ3A 4DLRA 3H11A 4ZMBA 1OB5A 3OJEA 3OZCA 4V1CI 1U8EA 2BFCB 4DZTA 4EB0A 4WZZA 2ZTMA 5KMGB 1CLUA 1F06A 2JAOA 4B8ZA 4IGKA 4MQUA 1SV4A 3B1VA 3EWIA 2C00A 4DA7A 1I3KA 3PSAA 2LUOA 1Z6TA 1II8A 4NCKA 2WB4A 4L4YA 2NU6B 1O94C 3G2QA 3D0KA 1L3CA 3DV9A 2QZPA 2H1LA 4KO3S 2PZKA 1J70A 4EGCB 3MSXA 4RPHA 1UZUA 3HCOA 1XWFA 3MTQA 3WLFA 1U0EA 4PC3A 5FWAA 2C4TA 3UPTA 1C7JA 4O4JF 1XZQA 1POWA 7GPBA 5HKAA 2Z3VA 1B6RA 5TDHA 4TTJA 4RBNA 1DARA 3JWEA 4GSKA 5FYQA 4BMZA 1SVKA 4FXPA 4BV8A 4YR7A 1I32A 4OF4A 2PZJA 3UHOA 1CNEA 3GQBA 1JPNA 1QS0B 4FW9A 5B30A 2HHLA 9ICNA 4TL9A 4AMBA 1KU6A 3DHYA 4E5UA 3L4BC 4Z0TA 3SG0A 1XMIA 1ULHA 5HS6A 3M4ZA 1JFLA 1CQIA 1WSDA 3KQUA 3RAEC 1BGVA 3D0QA 1GFSA 1M7BA 3ILSA 4B6QA 1NQVA 4U7DA 3KZVA 4K87A 3WQRA 4F6LA 4IMJB 4B2IA 2YWXA 4QFCA 3ILYA 1DJLA 2V4UA 4DUGD 4V0ME 4EFDA 4CKBA 1PS0A 1OX5A 4ZT5A 4W1RA 3EQ7A 4C0JA 5EYPB 2H7XA 5LZ7A 3FRIA 5JLJA 3FLAA 3HUUA 2XXAB 2L82A 1OX4B 1TW3A 3G1TA 1WF6A 2X0KA 3T94A 3T4UA 2O1SA 5A9TA 1M2GA 3MTGA 5ERYA 3BQNB 4C21A 2DB3A 4F5ZA 3QEMB 3NTOA 3MQFA 4JC0A 4MVJF 1NLUA 4MULA 1JG3A 2CXXA 3M6FA 5FI5A 3KYCA 1N78A 3ZZUA 1ZCZA 1HEKA 4MS4B 2HHJA 3UO8B 4MYCA 2WA1A 4M0DA 2BDEA 3HYLA 1UK9A 1Z75A 5KG2A 3AUUA 4O59O 3WWYA 3WWOA 3Q9UA 5F7XA 1TJYA 3CCBA 3THWB 4BB6A 1PJCA 2DBZA 3I2HA 3N74A 2AFRA 1VTKA 2YJ5A 5BYJA 3OHPA 2AW5A 3CURA 5FB3A 1BWSA 4AURA 1T3ZA 4HKTA 4CQMA 2IS2A 1W85A 3T1VA 4GW3A 3COYA 3PR4A 4YS6A 5HZGA 2WWRA 5HKBA 5ECDA 4JC5A 2WT9A 1JWLA 1LKYA 5EHIA 2JFHA 2J3LA 1J99A 3G0OA 4F4WA 4JJ6A 2FPSA 1X7DA 3RVNA 3R9WA 3TNJA 1L1EA 3BM5A 3T1QA 2HRZA 3NT2A 1P1CA 4K86A 1UPHA 1C3OA 5FTLA 5I48A 3LDGA 2KEYA 3PZRA 1ZK1A 3GVPA 3ZHVA 5KQMA 4E94A 1V37A 1JQKA 3WK6A 1FDUA 3A2KA 5IINA 4CMCA 2B5VA 3TCNA 3ZZTA 1EAYA 2VDKB 2ZCVA 3NCTA 3TEFA 2P2ZA 3AYXB 4H6WA 2H5IA 4KNYA 4FE3A 1V11B 1QOQB 3HKZF 5KHLB 1Z28A 4QW9A 1MABB 1HG0A 4HDQB 1XMOB 2E1FA 1W9HA 2BEJA 3M6AA 1ZQTA 4X20A 1CUAA 3GRVA 3DBOB 2IITA 3MWJA 1MH1A 4DDUA 4D46A 4RU1A 5IJ9A 3NNDA 1I51A 4ZIRB 3MRTA 4WBXC 1RJGA 1FSSA 4ICAA 4D8UA 3FTNA 1E61A 2IRWA 3A9CA 3AMVA 1JU9A 3TTUA 4XQ9A 2CXUA 3WA7A 5ES3A 1Z5PA 2YFYA 2PUFA 3H2IA 3QX7A 1AS2A 4RZHA 1E94E 1OREA 2CWWA 4ZXPA 2ETXA 1LV8A 1NQWA 5TJHA 1QOZA 3PRJA 5CGQB 1J2RA 3MTBA 3O1HB 3IXQA 3WXBA 1WXIA 3VO2A 4L78A 3BULA 2GZRA 3H6GA 3DR5A 3HCRA 4IHQA 3LP5A 3JVIA 4ZQCB 1JB9A 1XCJA 1X39A 2D7DA 4OK6A 2V0GA 1BPBA 2VHYA 5LA6F 2IYWA 4KQ1A 5IZ4A 2ASVA 1YJAA 4FFMA 1U65A 1K4YA 3R4CA 1Q1EA 3L7KA 5CDGA 4YA6A 1UT6A 2DT5A 2QY9A 5KVAA 4MA5A 5J0RA 3V8RA 5I4CA 4ELUA 4MQBA 3TWOA 4TS1A 4ZOLA 4EGSA 4AICA 1HUZA 3QE0A 1LJLA 3VU9B 4YCAA 1R6AA 1SQ0A 2J33A 1Q21A 2HMTA 3Q8PB 5A4KA 3NVKI 1DEKA 4DYDA 3EGXA 5REQA 2IXAA 1R0YA 4GVLA 2WIKA 2ZR7A 4HK4A 3RTBA 3KPVA 1G21B 2AN4A 1BD4A 2PUJA 4ED6A 3SEAA 2X8JA 1D2RA 1BPYA 1ZM4A 4J7CA 2HIMA 5EIBC 1T2FA 3IQIX 3DEYX 3OT1A 1ZD2P 1QZUA 3U4QB 2Z5FA 4I4TA 1YZ3A 3SJ7A 4OHVA 3DE7X 4WADA 4PE5B 3UBTA 3WLLA 2GBCA 4M9ZA 2VYCA 2CF5A 2WAYA 2ZSKA 3B5EA 1G0OA 4OU4A 4YXFA 2AG0A 2VP6A 4WNYA 1SHTX 5A6VA 2ATEA 1P5RA 3JYPA 3ZGXA 2ZRLA 1CUJA 1UMCB 3NOOA 3WIOA 3PFKA 5GGXA 1ZQGA 2PGAA 5C4MA 5AFSA 2X23A 1NKVA 3JYOA 5FR1A 4BX8A 3NTUA 4IOKA 3X3HA 4HO1X 4NL9A 3GPBA 1MO6A 2X3FA 1PWHA 5ALWA 1JDBC 2DKZA 3WI7A 4YRQA 4EIWA 4DUPA 2X5KO 3RB4A 1YL5A 1AF7A 4YRTA 2JEIA 3WXMA 1RYHA 2UU9B 1ECFA 3BRSA 2IYQA 2V97A 4MGYR 4A6EA 2JGMA 3YASA 1OZHA 2VOEA 8ICWA 4HMPA 3ADPA 3DO6A 4GICA 1Z5WA 2V55B 1T2DA 1M34A 2V6MA 4OQMA 4JT8A 1J07A 1CNFA 4N3AA 4I2DA 3RVSA 2ODBA 2XHEA 4QEDA 1B8PA 4ZVSA 2V1UA 5CB0A 5IU6A 2HU2A 4RW0A 4JEHA 2C9ZA 3LPDA 4IHJA 5L1JA 2DTEA 4RNDB 3S44A 4ZXFA 4D92A 2PX8A 1FTGA 4EA6A 4Q9DA 5HJEA 1MENA 2CYCA 3KJIA 2BCVA 1ZBDA 3LVRE 1HNWB 3BJEA 5JYCA 4W1QA 4ZRMA 4J76A 4Z6CA 4CKZA 2XB6A 2WDPA 5AXCA 3RC8A 2O2XA 1P2TA 3ZXYA 1LDEA 2D6FC 3S27A 4BKMA 4PHCA 1Z3IX 3RUIA 1P9WA 3HJFA 4CW7A 2FPLA 3VR6H 8ICXA 4X1YA 2DPIA 3H0KA 4RNMA 4EFMA 2NXWA 1A8UA 2SKCA 2R00A 2ZJFA 5HQTA 1HSOA 3P71T 2F3RA 1KP2A 1A4XA 2IH5A 4LF7B 2WFMA 2R86A 4IIUA 3ISDA 2XWPA 4LC1A 2ZYAA 2XNSA 5LXTF 1FW8A 1RFGE 4L9AA 4BO3A 4EHDA 1XWWA 4LOLA 3A14A 4RE5A 3AF6A 4AJJA 1SOVA 3QEBZ 3QUSA 1CJKC 3FTQA 3DHEA 1S2LA 4XWTA 3V6HA 3OHAA 5DIFA 3KT3A 1GT6A 4EFKA 1K89A 3JRWA 2A9VA 9ICOA 4QZFA 1Z6ZA 3AONB 3IH5A 4D96A 5KDLA 4F2PA 4K9LA 5CBPA 1FRVA 1VXRA 1PFQA 1JR6A 2P9GA 4NNOA 2C99A 1J56A 1E2KA 5HK9A 2HSGA 3I64A 4XWWA 3CN7A 1N25A 4ZI7A 4XWYA 2XUGA 1ADCA 3OFSA 2Z9BA 2QNIA 1DBWA 1IG0A 1ECCA 4ARZB 4IAOA 5CFMA 3VUFA 1KO4A 5CVJA 2V7PA 1P2SA 4E2XA 3LL7A 1EQUA 3DOFA 2P4SA 2A1IA 4PTYA 3MHTA 4PPNA 4CMEC 1AV6A 4WK0B 1JHMA 3GLIB 5IILA 4JEIA 4UUBA 5JV5A 2FMTA 1TE2A 5KG6A 1YZNA 4JHXA 3FDIA 1XL0A 3WJ1A 2R7KA 3EMVA 1GXSA 2I99A 2KMLA 4QM7A 1H2ZA 1RWPA 4RNOA 4RPZA 1FP4A 5K9ZA 4EDHA 4GKAA 4CWAA 3GGOA 1BVRA 5JTTA 4TXHA 2IP1A 2OSVA 5AW9A 4R69A 4UDXX 2QK4A 1OLUA 1SHKA 4HLUA 4ALNA 1DSSG 1Z5ZA 1Z06A 2HJRA 4L5AA 3BE8A 4URWR 2O3SA 2XDAA 4ZU3A 1Z4KA 4GLJA 821PA 3ANTA 2O5EA 4GM4A 2FW0A 3EDRA 2EP7A 4RPJA 2A78A 1N0WA 1M2VB 4MIYA 1P7WA 2HBJA 1SVNA 1ZRNA 1C7QA 3GUZA 4FZ5A 2LMRA 3TW0A 2O54A 3K53A 3AIIA 2FDXA 4DQUA 6REQA 3EXIB 4ML3A 5F9LA 3VX3A 5C9ZA 3B38A 3PC4A 2WE7A 5MHTA 3DE6X 1HMYA 2GUWA 2XUJA 3VC3A 3E9DA 3HM9A 4JLWA 1WHSB 1L9KA 1WCXA 2LTAA 4EB3A 2HO5A 1OT3A 2PFNA 2RARA 5HCNA 3GQVA 1S3GA 2WTXA 3P32A 1KY3A 2MSLA 4TXJA 1FIUA 2Z3ZA 1D04A 3DLAA 4OXXA 1QDEA 3P9YA 3U80A 3SV4A 2WW8A 1JSRA 4NY8A 1R8QA 2EJTA 3R3JA 1OV6A 3IVMA 3OP4A 3SOPA 1NY5A 2CNLA 1JZTA 3FTEA 1W44A 5C7YA 4BWJA 4LXTA 4DQQA 5KVCA 3HO1A 5FA6A 3D6JA 2ZYTX 2Y1EA 2A5JA 4U9HS 6PFKA 4H1WA 2OV3A 1TK8A 2OXTA 3L79A 3JYQA 4RA9B 2CLKB 4F4DA 1X8JA 4AU1A 1CY7A 4JJEA 4YAIA 2XLBA 3T5JA 1Q91A 3RRYA 4MRRA 2Z4RA 4TX1A 4KLHA 1NVMB 4MUGA 4YT5A 1ZGGA 1R9JA 2QPLA 3DAGA 5GVSA 4KTVE 2BR5A 3KCNA 1W88A 2OB2A 3CEJA 5CT4A 5BWOA 4XVRA 3RBAA 2E5LB 3DD5A 2I2BA 4UQPA 1B3BA 1AXEA 4B6EA 5E4YA 3N2EA 1CVLA 4DYHA 3CPSA 2OZLB 4E4RA 3JTMA 1K1QA 3ZHRA 4UZFA 1DL5A 2C2GA 4IG9A 1SUBA 3OT4A 4HLNA 1GTZA 4BNYA 3DMTC 5CHEA 3PMLA 2AH5A 1AC5A 3ZW8A 3LO8A 4L5BA 1ZNXA 2X0RA 3Q3VA 3UCEA 2NQ2C 3A9RA 3LTNC 1LRKA 1D2HA 2APJA 1Z0SA 2BFNA 3TW4A 3HJUA 3SNKA 2HZBA 5C1DA 4F9GA 3MFQA 1C3XA 2ZKLA 1GZ5A 2YOHA 3OPYI 4QSMA 5CW2A 4NX2A 4OQFA 3NALA 2PSEA 4OB8A 2BEUA 5LC1A 4NABA 3OZUA 3V32A 3NV7A 1ZD5A 3BMCA 5FWNA 4AP6A 1BN7A 4PQGA 1DPGA 2V3VA 3SBOA 3PFHA 3U5TA 3CF0A 1R27A 3AF2A 4Q5IA 5T8KC 3TRFA 3KFXA 4C4PA 4B4UA 2VHCA 4M9LA 1XFAA 4Y2YA 3GHHA 4QZHA 4EJ6A 1Q1GA 3CNQS 4E1VA 2C9DA 1UBNA 1FYVA 4KH1A 3OTIA 1NBWB 4BMYA 4JUAA 4HFRA 1GCUA 4MWEA 1XDWA 5ARCA 2GD2A 4CFYA 2J3EA 4P38A 4M46A 3HPQA 1RHKA 2H59A 2VNSA 2ORWA 3DTVB 4HT3B 1NE2A 1WEHA 1TT5A 3K73O 3HU5A 3UK0A 4IQTA 3KAJA 1OW5A 5TJ9A 5JQGF 4BO8A 5DXAA 3QSGA 2FFJA 2GGSA 3RGGA 4GX2A 1OJ7A 1XTRA 4BMSA 5KC9A 1D9FA 3NXKA 5FCDA 2C5FA 4X90A 3HKDA 5B4UA 1Q7RA 4TQ9A 3OJCA 2R62A 3HR4A 1KJ9A 2WTBA 4M83A 3R4VA 5AVTA 4AKTA 3SZ2A 2AMVA 2Y0BA 4UMVA 3OY7A 5DTEA 3NBMA 1GTRA 4NONA 2Z08A 2G72A 3HZOA 1GD1O 1PQ4A 1IZ8A 3UGQA 3OOSA 1S7CA 4XPZA 1P31A 2Q3LA 2IHNA 4JGIA 1U9CA 2WTEA 1K5PA 3OJ0A 4RSGA 1OH7A 4E11A 2PI5A 3D8NA 3DDWA 3TB6A 2PKQO 2C5HA 4FW8A 2IIPA 3KXDA 3I0MA 4US8A 1Q3TA 3ZTYA 3FH0A 3IV6A 4N76A 1JQEA 4FBMA 5DVZA 4JKIA 4IQ0A 4EJSB 4BVHA 4RWZA 2R0QC 4ZK6A 4MV3A 1JU3A 3E2EA 1Z0AA 1NN0A 4KP7A 1C2TA 2XGSA 2XE4A 3NDBB 1Y9AA 3T1OA 4ZPXA 2AOUA 3TTTA 4WY5A 5A04A 4GQBA 3GWZA 2VTEA 2M6LA 2ORYA 4HWTA 1IVSA 1WNFA 1UWCA 4DMMA 4RJLA 1A5BB 2Y0CA 4TWIA 3TQFA 1MXHA 1W4RA 1UXGA 1T5OA 1I94B 4D44A 2NUTB 3PZPA 3LK7A 4Q44A 4J0GA 4JC4A 2WLTA 1TEZA 4G9GA 4DXAA 2ZS9A 2ERXA 3NPAA 4U6QA 3ZEIA 2JIZA 4MINA 1Y6JA 1QJ4A 3U1TA 5EWJB 2VR1A 1GARA 4P5PA 1ZSNA 4S04A 3U44A 3VZSA 4TUYA 5KL1B 2P11A 5BVGB 1AUXA 5EZSA 1BKYA 2Z1NA 1XB2A 2DULA 1JR2A 1GL6A 4RL6A 3K4QA 5JFGA 4BLSA 2EH9A 9GPBA 3ZVKA 3SI7A 2H16A 1S8OA 5JS6A 3CJTA 4DS5A 4JVSB 2AG8A 4RO0A 3RIGA 1A95A 4GI5A 1NVKA 4ZEMA 3ZCRA 2O4CA 3CX6A 3E23A 4N3GA 4RF3A 3A28A 1PYOA 5CLGA 3G9TA 5IMBA 1XKQA 1WLSA 2HT6A 1LBSA 3QENA 1PYGA 3RH0A 1UEIA 2LCIA 4ZT4A 4RWEA 4FPXA 1G66A 2NO0A 3KQTA 3BXZA 1ZZEA 5G0UA 4DMRA 1VB3A 2ZROA 3DEHA 2UXDB 1L7PA 3DAPA 2O2IA 3VNBA 4G4SO 3TPCA 1JILA 1CE8A 3RJKA 2IUFA 3BT7A 3GA7A 3JQ9A 1Z4LA 3MGAA 1ZQDA 4BV3A 5DBFA 3K5WA 3JARB 1MSWD 4A8JB 2Y0PA 4NH0A 3NYQA 4F6RB 4DV4B 2AG5A 3UGTA 1V4NA 3ROTA 4YRIA 4UZSA 1HDIA 3ZCSA 7ICGA 1H4VB 3HNOA 2BFOA 5F3RA 1DG3A 1K06A 3BJRA 3CIFA 5C8XA 3G5MA 3Q2KA 2H2WA 2JARA 4CM8B 4LRUA 2QTVB 4KXNA 5D3MA 2ZPTX 3BMQA 1NG9A 5H0IA 4JXZA 4PAGA 3KHRA 4GYWA 1FVFA 1SXEA 3TKLA 4S1WA 3OU2A 1FP1D 3ONNA 4JD5A 1TB4A 4DMLA 3KOYA 2GN2A 1QYRA 1PF7E 1XQYA 1ZGHA 4BB9A 1TVKA 1SVSA 1QO9A 3MT7A 1PUZA 1JG6A 3KKZA 2WPNA 10MHA 1TJ3A 1UBCA 1CZKA 4IY1A 4F5WA 3IOMA 3EDCA 4GKKB 1C9JA 5KC8A 4CIDA 3CHYA 2BZGA 4MITA 3D4PA 1PGQA 1W94A 1BRMA 3N05A 1IQRA 2YJ4A 5K4LA 2UZ1B 3C8DA 4ETWA 1TM7E 5KS2A 1PYDA 2GR9A 2JBAA 3R3SA 4ZRNA 4CF6A 2BM0A 4Q24A 1MVNA 1WDMA 5J5AA 4IXNA 1O57A 5FBRB 2ZOSA 1V96A 1QK5A 3OQIA 4G9EA 5ECGC 3T12A 4FSDA 3O2QB 4NMWA 4LZNA 5KYXB 4DR5B 5I4KA 3PS9A 5EP2A 4IKOA 2Y1GA 3LQRA 2HSEA 3AINA 2EIXA 5FOXA 4FKZA 2X4GA 4II7A 3V7WA 2O0HA 3QFSA 2O0MA 5FPPA 3WB0A 1UJCA 2GF9A 1H38A 3PFBA 2ZG6A 1DFGA 4NCJA 4DSIA 3H7AA 4JZYA 4JKYA 4H7HA 4Q16A 5AJZA 4LYJA 4RK7A 2WTAA 1W76A 1VJCA 1NK0A 1KJNA 3OICA 2I8AA 3G5AA 5JPCA 1WB6A 5IWAB 3LQFA 3VU0A 7ICSA 2ZFUA 3D3WA 3SF8A 3N07A 1N75A 1IN8A 3QVUA 3VH1A 4RJIA 1L6NA 2P41A 4EUSA 4NULA 4LF4B 1W5BA 2M6SA 2IV7A 2HA6A 3URMA 3ML1A 5JAOA 1EHCA 4DAEA 4CL2A 2W22A 2D2IA 2Q6TA 1M2OA 3WLQA 4TUSA 1X7YB 4LV5B 3M6XA 1Q1NA 1G3QA 4BFLA 5KOHA 4QDZA 2IGTA 3GD5A 3STXA 4Y2RA 1BFUA 4QTZA 1PQPA 1FEZA 1RJFA 3E81A 3KSUA 1NKCA 2BCUA 2O0KA 5H82A 2XV1A 1ECBA 2OCLA 2RGEA 3CE6A 2ICAA 4WBNF 1GNLA 3ZE0B 1U2GA 2F00A 2FR1A 3S2IA 3CVXA 5CB8A 5LYYA 3LPLA 5JCJA 2HPZA 4BFZA 5BYBA 1OE0A 2J59A 3B2EA 3ONFA 4GFJA 1PL7A 3EX7C 2DF4B 5DZSA 1R5NA 4FJ2A 4CG2A 4UM8B 2I6TA 1VHTA 1UC5B 1DXSA 1QR2A 3TZQA 2RIRA 3H7IA 3O94A 2CLMB 1TUGA 3Q9SA 1CULC 1TZJA 5BQPA 3NDRA 2VH5R 3FPHA 4P54A 3RHTA 1CF2O 2PGJA 3CZRA 5DBEX 4CEJA 1ZUHA 3I34X 4JV2A 5IKPA 2Y0EA 3WBBA 1JSCA 3I3SR 1HPLA 4DQXA 1XQ1A 4DHWA 3FX2A 7ICNA 1V48A 2V6IA 3WC4A 3EISA 4PEVA 4B45A 3PP8A 1PL6A 3OZGA 2EYQA 1ZD9A 1P75A 5BP7A 5CW1A 3BWBA 3ZHCA 2OB1A 2QD1A 4Y30A 2WU8A 4PC6A 4JBIA 3WNCA 3K8YA 4E32A 3ASZA 4OCZA 3D64A 1G8FA 3F1KA 5G0VA 2DJ5A 5TVGA 2K4MA 3LWDA 3FY4A 4D41A 1U5CA 4IOLA 1PX0A 3RVLA 4XD2A 3A4LA 4PAQA 2H2HA 2IUYA 4ICIA 2W8ZA 3K70D 3LZCA 1JT9A 3R8CA 3PNVA 3C85A 2GD6A 3NXSA 2BCEA 2V98A 1ADGA 3DBHA 1D0VA 3JAWB 2OH2A 1XDBA 3EZXA 4WESB 2ZXUA 3NTRA 2ALJA 1KGDA 3V1UA 2JHPA 4N03A 3DTVD 4Q0MA 4JX9A 3DOIA 3TLZA 5AM3A 1T9AA 1MTZA 4OGWA 1KTVA 4Y9UA 3H8JA 1UA1A 1SCNE 1GYPA 5BXYA 5IMSA 1QO0D 2C61A 3L5OA 3D2SA 3O7WA 3K1AA 2R8KA 5LR6A 3HP7A 2RD2A 2IYAA 5SZJA 5JROA 4IICA 4UOEA 1Y98A 2DTDA 4WECA 4BEWA 4A0QA 2RSLA 3UMBA 3FNGA 5TLSA 4EUHA 4CBVA 4CM9D 2FMQA 3QRWA 5EJAA 3OURA 4BQNA 1XO1A 5JAMA 1B0ZA 1D07A 3U62A 4K0KB 5IC4A 4MR8B 1BS2A 4U8GA 1EWQA 3IQWA 4CT4B 2PJRA 2V4MA 1ZYUA 1O4VA 1ARZA 2YH2A 1RRCA 1CEXA 4N0EA 1Y81A 2E87A 1U9YA 3IT1A 4PGHA 4HMQA 4CV2A 1ISMA 1V41E 2CJPA 1T24A 2M1XA 4P86A 4RX1A 1D4FA 2GFQA 5B1IA 4PQFA 3MCZA 3FKQA 3BWMA 3F6RA 1C20A 4H3SA 1V16B 3D7LA 4M22A 1ZQMA 2XWQA 1MAWA 1L8LA 2E4ZA 3C6XA 2C20A 3I9JA 2Q3EA 3FA2A 5CJ7A 9ICFA 5E1OA 3NT4A 3EGEA 3F5MA 1U7UA 2FWBA 3ZLJA 4AYBC 2QSJA 1YGYA 3TLGA 1Y6ZA 1XDUA 4N5MA 3FGOA 1HT1E 1CUFA 3SXUA 3EPHA 2W93A 4WA7A 2YXNA 1Y34E 4YUAA 5KSPA 5E95A 1DEHA 2RQ5A 3VR2D 5KI6A 1RTTA 3Q0EA 2ZWMA 1G5PA 1IWOA 4I5EA 1QG2A 4UM7A 3GXBA 2QTZA 3JRNA 1XDDA 4ECQA 2JLVA 2JLXA 1IM5A 3KYDB 3ACCA 3FSGA 4G8DA 3LBYA 1OXUA 4FO6A 2PH1A 2GJSA 3TH5A 5FT9A 2HSWA 2QPOA 4C07A 1OZFA 5FORA 3CVUA 4MWSA 1BJTA 3MGGA 4RA6B 4KQFA 1J49A 4U2GA 3V4PB 4JS0A 1D09A 5KFLA 3ES9A 2JFWA 3K09C 1LBTA 5P8WA 4D3XA 3CNOA 1D8YA 3LOQA 1HLFA 1STOA 1N6IA 3ZVMA 1QP0A 4R5HA 3RC3A 3S2SA 4EO9A 8GPBA 3H0MB 5CB4F 1AO3A 4RVHA 4UAVA 2F55A 1J2YA 4MUMA 2QD5A 1JMVA 2DHRA 2K87A 4JFAA 3LDUA 3N3BC 1TLTA 2HPAA 2P7HA 2QD2A 1ENPA 4TL7A 2IEGA 2PS0A 3W2IA 3C5FA 5A4MS 3R7AA 1NVDA 5E7IA 4LWQA 1XSLA 3NVDA 5J29A 1LZLA 1PDOA 3OE1A 3BHIA 2DY1A 1MDFA 4WINA 3ZU2A 4ZC8A 3I04M 1FDOA 2G0AA 4P3YA 5G2OA 2P9JA 5IVKA 3IL2A 2ASLA 1MKYA 2Q41A 1WD5A 1ZISA 3ZE7A 2HHHB 1YA4A 3KZKA 3MJCA 1R0ZA 4BO5A 2Z5LA 2HCTA 5DB4A 3PFCA 2P30A 1YGPA 4DMHA 4XLZA 4QBKA 2W2QA 4W6ZA 4KLIA 5D51S 2DPHA 5B58C 1Z47A 2YW2A 4KDRA 1X1RA 1BH2A 3HA3A 2WF6A 1ULTA 4HDCA 7ICTA 2DU8A 4FINA 1TK0A 2XYPA 4E5KA 2KQUA 1X2IA 5LB4A 3I12A 2KB0A 2WMDA 2E2WA 2IXTA 1ST3A 3K0AB 2Y6VA 3KQPA 5JCOC 3TM4A 1ORHA 4R40A 1EA5A 5KFNA 1SN7A 1YVPA 1ZIOA 4QEKA 1OVGA 2Q4DA 3IBTA 3M2PA 3HWTA 3L43A 1U5BB 2FY8A 4M8IA 3ZLBA 4LTNA 4O5KA 3RIEA 2C8VA 2HMVA 3SJUA 2JLQA 2J9ZB 1V8PA 1THZA 1U3CA 1C9DB 2A88A 1I4EB 3KB2A 1J6UA 3VR4H 2WYIA 4JLSA 4LY0A 3ASUA 4ZTUB 2QRMA 3PFIA 4RD3A 3ADKA 5CFLA 2C9MA 1AB5A 3OCYA 2HPHA 3FCUB 1SC6A 2SKEA 2HBYA 4FFVA 2X7JA 4BFWA 1UKBA 4R1QA 4X6YA 2OESA 4MARA 3BK2A 1F3OA 5IH3A 1NSTA 2ANCA 4DL7A 1VPEA 3VJMA 1F0YA 3IQFA 3U1VA 1JX4A 4WEQA 4MHOA 2WIJA 3HKZC 5A7GA 1T4GA 3H40A 9ICHA 1FPQA 2I54A 3CVJA 3ELWA 4LDPA 2YMMA 4LN1A 4DMGA 4Q7EA 1WUKS 2ZU0C 3KQNA 2JIMA 3D8SA 3E4CA 4CLHA 1SWVA 1JKJA 3BCUA 2E5WA 4YRCA 4LXXA 3C4JA 4C89A 2FN3A 5DBOA 5HRAA 4Y1EA 1UXKA 5GZ1A 2BSQA 3N2LA 2X7HA 4D9FA 3HZZA 1ORTA 5FFFA 1YL6A 1SQ5A 2ZJOA 4I19A 5DLDA 2X0NA 5IZCC 2JXJA 2WMNB 4KLEA 3Q8RB 4JITA 3KETA 5HKKA 2QLBA 4Q47A 1UODA 3DE2X 5D84A 3BEDA 3IUEA 4MVJH 3JTEA 2Z04A 1NJGA 1X1TA 4GKJB 3C8UA 4WJ3B 3E0FA 3KFLA 4A3SA 2ZREA 4EPTA 2ZI5A 5A02A 3EXG1 2BSAA 2EKLA 2RE8A 1RMYA 3TMAA 1EK1A 1MQ2A 4G1BA 3WYDA 5BV0A 1EGAA 3H2BA 2F8SA 4BX9A 1P1HA 1YI8A 3BMXA 3ZJ4A 1OH8A 2ZQYA 3AY0A 1WULS 4RQ3A 2GK6A 1FMJA 5MGBA 4KE7A 2A7XA 2H4XA 5T4FA 4EYIB 5JTIA 3K9FC 3P0JA 4M1EA 1EFDN 1PWZA 4C7VA 2HXGA 2UVRA 3PA6A 4MQFA 1JIXA 1C29B 1NI5A 2XOEA 2AMYA 3O1JC 3FYTA 5A6SB 2EKPA 3RRGA 1MX9A 5HILA 4KIUA 1GDHA 1L3TA 5A4JA 1CZNA 1RQ2A 5FNZA 3KUKA 4PWYA 2NYRA 4OHBA 4ND6A 4PHHA 5J5CA 4J1SA 5J2GA 2C7OA 4KIJA 3IV9A 4Q3NA 1G5FA 1C4KA 3KDSE 1BFKA 4XYGA 2PEYA 3K9WA 2EWMA 2ZM5A 2AGVA 5IP5A 3V7FA 3GZJA 4QXAA 5JYDA 1BOFA 2QXYA 1I4OA 4EY3A 3RJGA 1P2BA 1U8AA 3OESA 2X8LA 2XMGA 3R24A 2KZZA 5KO2A 3TINA 2BPCA 1KEVA 1RVV1 3OEHD 4MEJA 3NIWA 2QYHA 3DV0B 3AUFA 1II0A 1K7SN 3C6MA 4A8HA 2VZEA 3BG5A 4YWHA 1L7RA 2DXIA 3CX8A 5SY4A 5G5HA 2VQSA 1VL1A 1JDJA 2VF2A 3TTXA 5AHOA 1U9IA 1NMEA 1SXJD 3LT1A 3R9XA 1A5ZA 2PV0A 2ET6A 4KZKA 2FWNA 3CVVA 2P5YA 1VJTA 1UPFA 1NRWA 4ZZIA 2QBYB 3LDFA 1QOPB 2ROQA 5F2KA 1AQNA 3CCFA 1X9IA 4AJNA 4XPIB 2PUGA 4QTXA 3B12A 4KAJA 3QKIA 4IBOA 4FDVA 2G7MC 3VZQA 1W5SA 1BD3A 2G83A 4KBFA 4HNAB 4EHNA 1P7VA 2Y1OA 1JRPA 1EXMA 5DLEA 1Z4JA 5DNYB 3SLRA 1UFQA 4GZLA 4DMCA 2VLBA 2C22A 3U3JA 3U26A 4IILA 3FFWA 4QLOA 4NI5A 3AQFA 4Y6PA 4JQZA 3R5XA 3FDFA 2GVNA 4DBZA 2HGSA 3LKZA 2ST1A 3KCQA 3LSTA 4G0OA 1P7PA 1P73A 4M6WA 3JPSA 3P0HA 1YZQA 4OJPA 1TT7A 4IEFB 4D4GA 5BN3B 5J9FA 1AHIA 1RAAA 4TXMA 3L0CA 3IKTA 3D3JA 2W00A 1I7PA 2VPQA 1B16A 5DQHA 1A2KC 2IEYA 4N54A 2AQ8A 3BIOA 4JLUA 1DAPA 2HLDD 4Z9YA 4EJ2A 1B43A 4YR0A 4R3UC 3JASB 2G5HB 1WV1A 4M1KA 3AI1A 3U31A 1W5AA 3UKJA 3ZQJA 2AZTA 2RCNA 2KFNA 3HZHA 4I2VA 1FP2A 5I7RA 3PXDA 1ACMA 4YJ3A 1ODTC 4Q4JB 4Z3OA 5K05A 2WPDD 1IJBA 2KW5A 3UVEA 2V54A 3OUTA 3AG6A 2R5WA 3SYZA 3TPZA 3LX6A 2VSNA 2DFDA 4DSJA 5J2HA 3EAFA 1KVTA 3GRYA 1N2OA 3O8QB 2F9LA 3RRFA 4F3RA 4HUQA 3L5KA 1W73A 3N8GA 2R6HA 1EBFA 1M8JA 1IHPA 3RJTA 3PGVA 4QODA 4K4IA 5J8YA 2GJAA 4I27A 4NY1A 3PVCA 4OH7A 3VR5D 4HX2A 4QQKA 4ZHQA 4QFDA 5BSWA 2ZDHA 1R64A 4KCGA 2ONKA 1AKNA 1JTVA 5BSHA 2CUTA 4DUZB 1FLDA 1JEQB 4F9TA 3JPRA 1II9A 1QHXA 1Z5NA 4B3FX 4HQFA 5A1JA 4E2FA 1SG6A 1OHHA 1L5GB 3K2BA 4TQAA 4FFBB 4ECTA 2A35A 3ETCA 1O03A 2HMSA 2X15A 3MRVA 2W2KB 1C30A 1XC7A 2QTBA 1RBQA 5GV7A 5FUWA 2D1FA 3R7BA 5M7EA 3OQ1A 3MD9A 3DZCA 4ALKA 2X9NA 1XD2B 2JG3A 2QGFA 1ZY2A 2WZDA 1C0KA 3PDCA 3SIXA 3T7AA 1TXGA 3Q8MA 5ICEA 2II6A 2HQSA 3U4CA 3QBTA 1VSBA 3G8DA 3TOVA 3WO0A 2NZ2A 3IILA 4IO1A 2ZRFA 4KVAA 1XP8A 4JLNA 4HJRA 3P0FA 3U9LA 4I8IA 1GGMA 3VYWA 3CLSD 2RHFA 2ZB8A 1DO2A 5LZ5A 5CNMA 2DT8A 4B32A 4L0MA 5D00A 4AX4A 3I9NA 3QXHA 3INRA 4LWOA 1QRUA 3KB1A 1URJA 2OBYA 4HDNB 4TTTS 3GUYA 3VGJA 1AOXA 4LCBA 2P66A 3C39A 2NUPB 2OC4A 5DWDA 4PRYA 3SIWA 3H05A 1J22A 1QFZA 4WFIA 2PSHA 1L5YA 4U2DA 3TTSA 2V7WA 5JXJA 2CB9A 4YXJA 2FWJA 4CMKA 2A67A 3B51X 4ARAA 4CI0B 4FZLA 2HF9A 3ER9A 3WHLA 5WRFA 2I22A 4YI3A 3DE3X 4OYLA 4AO6A 1AXRA 3I2YX 4KLJA 3KT8A 2BPGA 4K8RB 4KAAA 4D4IA 2ADOA 3UMJA 4BNUA 5B3AA 1JHAA 4KRFA 2Z1MA 2HA0A 5AUPB 4GRIA 4PGXA 2FPXA 5EWMB 4EHFA 3HN7A 4PO3X 3KUUA 4TMZA 4MQ6A 3CUVA 2NTNA 2VJLA 3UAZA 3ORQA 2LV8A 4BO2A 1VLHA 5K20A 3SS7X 2GN0A 2B8WA 2XWJI 2BCJQ 1PJAA 1A5TA 2TRSB 4N0MA 5I5GA 1DJMA 4GX5A 4LRQA 4IRMA 3ACDA 2ZR9A 2O7VA 4QARA 2FFHA 1LC3A 2CNDA 1TEVA 2WC1A 4HVCA 2EFJA 5FOVA 3CF4A 4H59A 1J2MA 1LLFA 3P27A 4WOBA 4GMHA 2ZTVA 1UBMS 3ABRB 4J1QA 4X7BA 4B9AA 1QV7A 5A4IS 3CLUD 4JP2A 2E89A 2B36A 3UMSA 1DP4A 4IJ6A 5DBAA 1QVWA 3B1JA 5IEBA 3J81j 4QGGA 3EQ9A 2JLAA 1E5XA 5E9QA 1S4MA 1FVXA 8ICYA 4MUXA 1C0IA 5CNKA 4X85A 3S70A 1F9AA 4M9RA 4GXKA 1BVHA 2VNAA 1KKLA 1LSOA 5FPTA 1PW5A 3HMKA 3DKKA 2GQ0A 4B5KA 2QE7D 5F76A 3AV0B 1NBAA 6Q21A 2E4VA 3FSRA 1KYWA 3L9WA 5IAGA 2MHCA 1IUOA 4DFPA 1FFAA 3R09A 4C6TA 3CF4G 3HKEA 4PG8A 1OXKB 1I10A 3R3HA 3N6XA 2Q49A 2XQGA 2DGZA 2FFBA 1AX9A 3QKWA 4BEBA 2Q5EA 3WISA 4D98A 2JZCA 2HOIA 5K09A 4TROA 4Y2GA 2LE0A 1N1GA 3IUBA 2PIDA 4RACA 1T9DA 4JXKA 1EX1A 4W8OA 5FUYA 4NXNB 1LNQA 2YBDA 4FS3A 3TXAA 3KKEA 4OP3A 4EPYA 3DM5A 4E33A 2TMKA 3AG5A 1BX0A 2I7TA 4YDQA 4ENWA 3VQTA 3RJJA 3ZWBA 1G16A 3MJDA 4L4ZA 2RKWA 1Q5PA 1ESMA 4Y6SA 1WZEA 1ISIA 2VCYA 5DT9A 3DDUA 3SLKA 2XNDA 2OFPA 4XRRA 2ZZKA 2W2VA 2IIVA 4K9NA 1U5AA 8ICQA 5IC5A 5ED4A 1M1UA 3UAVA 3HP6A 4DL5A 4N7MA 2JFZA 5ALJA 4EKGA 1XQXA 4JUZA 3F6CA 1FYFA 4B2LA 1E9VA 3U9TA 3DTYA 1YE5A 1SFRA 3HHPA 4ECAA 4QICA 4RORA 3DDSA 2VQEB 5CA1A 2R85A 1SV0C 4BZPA 1ZHFA 2FFRA 1SH7A 3TCXB 3E9YA 1X86B 3BL6A 1JMSA 4CQMD 4IFIA 2J41A 2HD4A 3RHSA 1HE3A 1ZH6A 5KPDA 3HXOA 4MPPA 4ZVKA 4K6HA 5E0KB 1DJOA 4RQ4A 2A86A 4G41A 3C7AA 4CQLB 5ICMA 2GM3A 4YXMA 121PA 1D0IA 1FCJA 3N70A 1JQ3A 1TUIA 9ICIA 4UAGA 3RYHA 5JU5A 2GAIA 3GC6A 2QW8A 5CLJA 4KFSA 2QUBA 2PKWA 2IF0A 4P5EA 1KIMA 3FYUA 4A92A 2ZYRA 3ZOZA 1WXWA 3T5BA 1AS3A 3W8FA 8ICAA 2IWHA 2O7NA 4JB2A 5B2FA 1LS1A 4PW0A 5A9SA 4CKXA 3RYIB 1C5KA 2DC1A 4XVUA 5EE0A 3P9NA 2B7BA 4V2UA 3KFVA 4YMSA 1AMUA 1JG2A 2AS0A 2JJ2A 4GPZA 1O9GA 1A4IA 1OFUA 3M6KA 3BMNA 1GFWA 4FE7A 3U7JA 3G6XA 3NATA 4JYZA 2IYFA 8ICKA 3ZZNA 1J0XO 1CC1S 2GX6A 2PI4A 3N7UA 2ZZNA 1VI2A 3ITDA 2W6CX 3NYIA 1Z26A 1U1EA 1E7YA 5JJ5A 3QYJA 1DRKA 4KSBA 5E6SA 3ZCTA 4X8OA 4KJXA 3LS2A 4PU0A 3ALRA 1FMTA 2GTHA 4AZWA 5LZ4A 3C1TA 2OCKA 1AKYA 1CJMA 2X3UA 3PYMA 7YASA 3NBQA 3HNPA 4G0VA 3OCXA 1MD9A 5CU7A 2FKAA 2XZPA 2VYND 4GUAA 5BOVA 2QN9A 4N41A 2BJHA 1RZRA 5FO1A 4EUKA 1S1CA 3Q3IA 1JS1X 4HUJA 3MUEA 3QU4A 4KPYA 3W6OA 2H6EA 3GVHA 4GHWA 3C74A 1TU0A 1TM3E 1ZIDA 3QLJA 5HOEA 2YWRA 3TNFA 2HSZA 4LXIA 3J7AC 1YFLA 1WV0A 3IQZA 4ZVOA 1PL0A 2QB0A 2J4CA 2R6GA 4JT2A 4DOAA 1IXRA 4NQZA 7ICFA 3RS2A 3OQBA 3FUVA 3UWSA 4ON9A 3VKVA 1S2MA 5AD1A 1SK9A 3DEZA 2IU6A 2IY8A 1VE6A 2H63A 5TV2A 4QVIA 2IDZA 1FFYA 3HLKA 3PNPA 2AOXA 4IJVA 2H06A 4DRXB 5JNLA 2X1LA 5AHXA 5JBNA 3ISTA 2FB9A 2WD8A 1HE5A 4HQLA 2WU3A 4RQ5A 5EIEA 3J81k 5P21A 3UKDA 1DUVG 3I76A 3J80A 1QKKA 1DQSA 1ZQZA 3IBSA 4YMWA 4NCBA 2I6FA 3V2GA 4PR3A 4JMPA 5CFPA 3FFAA 2BE9A 4YT4A 2I0FA 4YRMA 3PW4A 1A9PA 1T1RA 3S81A 3ZGVA 3T1TA 4QNRA 5H4GA 2PJUA 2WU4A 2ZBEA 4M36A 4PYRA 1XZIA 4U3JA 2R9VA 4EYGA 4UB1A 1XVIA 3IHLA 1EVZA 5KAMA 2O3TA 1K9VF 1NV8A 1IG6A 2AXEA 1FX0A 5EHNA 4LF6B 4KFRA 1C7RA 1QIDA 5ARBA 4K9DA 3FRJA 3I4LA 3PX2A 4OQDA 4B4DA 4YVFA 3A4VA 3K70B 4BNVA 4KJZA 1JIJA 3H5LA 2J31A 4FB5A 4ZO7A 2WB2A 1A1SA 2RB5A 5EUMA 2AQHA 4Z54A 4MKGA 2AX3A 4EHKA 3IR6A 3VNAA 1SGWA 1CUKA 1GKIA 3ZU3A 2ZYUX 2M9MA 4ZKDA 3ZWCA 4MUYA 5F2NA 3OWXA 5BNWA 3DNPA 5AM4A 2Q0HA 4EZIA 3QVVA 5HF8A 4R8LA 3RSSA 4M2YA 4ZC1A 3O82A 4S0ZA 4B7UA 4JJ7A 3GFQA 3GUCA 5C31A 1P62B 3RTCA 2ZI3A 3RUDA 4DA8A 4B85A 1E2IA 3P4XA 3L4SO 3GDOA 1RJWA 5GONA 2XF8A 4UQGA 1SD2A 1CV2A 5JSFA 3DW3X 3GRUA 1R6VA 3PR3A 1WBDA 5EIFA 4B3BA 3Q9NA 1DX6A 4N7BA 3FB1A 2FW9A 5LQJA 3NIBA 4DIOA 4MQEB 1L4LA 1G8PA 2GEFA 3PR1A 2G3YA 4I2IA 1FJHA 1QH8A 3ICVA 4V0RA 7ABPA 1XF1A 2FLPA 4URZR 4Y18A 1OU4A 3DQPA 2OV1A 3IUMA 1QIIA 4ED2A 3DZGA 2Z09A 4DR1B 2UVDA 3I45A 2VPIA 3Q2OA 1X15A 4AWAA 3QPBA 4A1FA 1POXA 2XGMA 1SOUA 1ND6A 1EE9A 4K9OA 3FD8A 1T5SA 2IYZA 2XA1A 5AHKA 1LWNA 1WCNA 5JDCC 1VE3A 2CVFA 2CEAA 2XT0A 2RK3A 4Q4HB 2A9RA 1FSFA 3TADA 1SVUA 2J08A 3AFHA 1X3SA 1WLYA 3ZGOA 3V1KA 1E3WA 3JWHA 4MRVA 3TG2A 3FCEA 3UB2A 3JWGA 2H2IA 4FOPA 4EM6A 2Z8YA 1RWOA 3UGKA 1WL8A 4NNPA 3GCGA 3A4TA 3MDCA 2P35A 3ICPA 3W2EA 4CIAA 1MEJA 4X1OA 5BRJA 1FS4A 4A03A 2SCUB 1PW7A 4RMJA 4RQMA 3U7RA 3P94A 1BQ3A 4FFWA 4BNJA 1L4EA 2VXBA 1CUCA 1XRQA 1CDEA 2Z2YA 5KCZA 4ER0A 5IAKA 1BW9A 4LOIA 2F8LA 2QYSA 4ND8A 3VO1A 1FNNA 3A6LA 4MRAA 2ZAGA 5KQLA 1T3NA 2PDAA 5IAAA 1MAAA 4E15A 5BV7A 2DBRA 1NI3A 5DM70 5DX1A 1U9ZA 4QYIA 2TSYB 4WKGA 3EXEA 1ENYA 1ZJ4A 4ZVRA 2E8MA 1PK9A 4JA2A 1P3Y1 2PZMA 3HU3A 1SZCA 4IWXA 1UKAA 4CM4A 4M86A 1UZLA 3OM0A 3TLCA 4MP8A 3EJ6A 1NXVA 4Y1RA 5JIBA 4NPCA 5BR8B 1VRCA 4ZD6A 4RZIA 1ZVMA 4FT4A 4KN8A 1SRQA 1SVMA 5KFSA 1NOKA 1PJTA 3JQBC 3TM5A 3WOVA 2IDKA 3RT7A 1XQ6A 3ZCUA 1Z88A 2NVWA 1JFVA 3ELDA 4PHTA 1RLOA 4AQYB 3T9CA 1NXWA 3VPDA 2QQ5A 4PRLA 1YC5A 2AXQA 3ZXXA 4ZAXA 1NVVQ 4Q8EA 3NKVA 2ZIXB 2W6ZA 2QAJA 4IVNA 1W0CA 4E5YA 2I6XA 1L8OA 4K1XA 2PU7A 1ESEA 4GU5A 4LI0A 4MFAA 1OXMA 5DNCA 2KHZA 5I8PA 5G1NA 2R6JA 1E0AA 1W93A 1HQDA 3TEJA 3AVYA 1WSWA 3RSFA 2QYTA 4M99A 2J3QA 4BCDA 4J9KA 4UAUA 2WKWA 4HZUA 3AL2A 1AT1A 2Y93A 4L75A 5EIHA 2IYTA 2GAAA 4LRTB 3SXPA 2I3DA 2C3OA 3T3EA 2ZCUA 4V3CA 5AW1A 1JQ5A 1OMOA 3CO5A 3PUIA 3ENZA 1E5VA 3KVNA 4Y2VA 5ERGB 4ZU1X 1YR8A 4WWHA 3MVEA 1ZQOA 4ND3A 2JLUA 5HHTA 2BVNA 4KPUA 2QTFA 2Q1YA 5L7TA 3IE1A 2Q1WA 1U7DA 4WA8A 4DLTA 2ID8A 2F43B 4IYJA 4FEAA 4E21A 5J0XA 3SFTA 2QEQA 4JI7B 4DV2B 4MCJA 3S1AA 1S01A 4IZHA 3ZLVA 3UGJA 2HCBA 4P58A 1GP2A 4A82A 3LWNA 3OZEA 2JIQA 2P9CA 1NC3A 1SCUB 3ZD8A 3QYPA 1T4BA 2RK6A 2REBA 2H4WA 3QV1A 3DOCA 1DAMA 1RXUA 5K6AC 4GFDA 2XE7A 5FKJA 4YRPA 3SQIA 4E30A 2GN8A 2WQ6A 1TTQB 3TI7A 3E3NA 4M0AA 1X14A 1Y1SA 1HGXA 4FGUA 4MW2A 3RIMA 2OXCA 3L0DA 5EE9A 1NDHA 1SG9A 1G6KA 4Z4HA 1P7YA 4QTUB 2Y9PB 1TVAA 3RC9A 3DYVA 3EBLA 1GZHB 1GG2A 3O4GA 4QU8A 4WN9B 1RKXA 1FNDA 1NK7A 4HQKA 1M1NB 2X2EA 4ZOQI 2XDQB 1H85A 2IS4A 4TRRA 5B3KA 3BREA 1DKQA 3ZS8A 1C9KA 4LBWA 2C4HA 4Y2SA 3TACB 1J90A 2DFKB 4FKMA 2Q2OA 3EVZA 4HGNA 4JGGA 1R6XA 3LP8A 2W7PA 1XEAA 2RHMA 5AVRA 5ITZB 1F8FA 1EFRD 1NXSA 1QZZA 2W4QA 4EAAA 3OZIA 4FCTA 4QD3A 2A9JA 3BH7A 3NCHA 3ZE8A 4YJGB 2VVTA 3REQA 1DB3A 4DIDA 1UBTS 4GQAA 1YMVA 4M7OA 4ENVA 1MHTA 3IUSA 4EHBA 1SVWA 4MKIA 2IHVA 1YASA 3R44A 4RKYA 2VJBA 1B93A 3HVHA 1XPRA 4TGLA 4WOPA 2V9ZA 2L19A 4BFYA 4O5EA 3NRZA 3O9ZA 3KKLA 5L40A 4X92A 4MKXA 1HFJA 2MSKA 3MJRA 3NI2A 4KLQA 1UJ6A 3LC7O 4FIDA 4JL5A 1ZXIA 4F7DA 2P3OA 2RHRA 1MORA 4FOTA 4BNMA 3QM1A 3MLBA 5JD4A 1Q16A 3FBTA 1ITZA 3C5EA 1EJ0A 1C1HA 3FAHA 4G23A 3ESDA 4YLYA 5U4QA 1ODFA 3CZCA 3Q40A 1G3IA 4P4MA 4FTWA 8ICTA 4Q00A 2AOTA 2PU5A 1L5QA 4IRXA 3QYAA 1BXGA 3I05A 2OGSA 4UEOA 3FWHA 5HGJA 2E18A 2M32A 1FK8A 4P4PA 4HQ6A 5B7NA 4C0WA 4LXQA 2M1ZA 1JDZA 3UMMA 3I5YA 2Z57A 2FZEA 4RPGA 2VSXA 2FZGA 1QCKA 1NASA 4PSAA 4I9NA 4WXMA 1DT3A 4K9QA 2A1TR 1PZGA 5BQXA 1NVWQ 2VHEA 3OVMA 3T8YA 5TX7A 3MOIA 2GA8A 2ZVJA 1KI9A 5EE3A 2O8CB 3Q1KA 4UXHA 1NG1A 4BQPA 2E8OA 4HVTA 5EKUA 1BS1A 4GGMX 3ZKAA 4MWBA 5K03A 2I7VA 2AVNA 1PWEA 4C4TA 3LGSA 1WXDA 4IL5A 4AMGA 4LK2A 4US0R 2YXBA 2OM6A 2GN9A 1PVPA 4XCXA 2X8WA 3LXXA 4NLNA 3BEOA 4DJTA 5AT1A 5C32A 4DQPA 4YP7A 4GWKA 3H19A 4IIBA 1IY0A 4ZDIA 3VPXA 2BE7A 5I7UA 3RI3A 1MOQA 4N65A 2FX3A 4CIYA 3WA6A 3LNTA 1UP4A 1FDSA 1B26A 1G4UR 3OZTA 1Y7TA 5LLDA 2AGPA 2YQEA 4ND7A 4U7GA 2NRZA 2VRWA 2K89A 1F60A 4AUKA 3V8PA 4TV8A 3C16C 3FPKA 3MSCA 4YT2A 2IEDA 1Y5NA 2HJ9A 1NNEA 1XHLA 1PHPA 2V8OA 3GJ0A 3S68A 4ACBA 2BFEB 1D5WA 3V1TC 1ZH4A 3UATA 3TQHA 1SXJB 2CBGA 4MW6A 3GLSA 1V7PC 2DEUA 1VPDA 2JA1A 3ZDRA 1Z22A 1X9XA 1C80A 4KFTA 1G9SA 1TPYA 2DHEA 1XMXA 2YIDA 1Z6AA 2JIZD 5JMOA 4P4SA 4RIHA 4RYLA 4QRDA 3ESBA 3GB9A 4LYHA 3LIIA 3UMCA 2HUNA 1ZN2A 9ICSA 3WKEA 3PHBE 3F6EX 2HBRA 3VTKA 2X9VA 2A0YA 4LRWA 3OECA 4NU5A 1USVA 1W0JA 1LI5A 4K9KA 4XKJA 4BGVA 2HLHA 4I1RA 2WF8A 1W87A 2J9FA 3W2HA 3BA1A 5TMPA 4TVOA 3PXAA 3AB8A 1LSUA 4TTSA 1ZJNA 2AGQA 4BWMA 2I4TA 4K8OA 4EKDA 4M0LA 3R76A 4R66A 2REXB 2VUSA 3EXHA 4LCJA 5AH0A 1JUDA 3F90A 5KKCA 1DK2A 3I5UA 1DAHA 4PG4A 2Q1SA 5ESXA 4PLYA 2Q3BA 1Z2CA 3AETB 3W79A 1Q7CA 3O5AA 5TRTA 1E89A 3MGCA 3D7MA 3PXCX 2NO4A 1OCEA 3OY2A 4WDQA 5CFNA 3Q8WA 3O4HA 1OAAA 3FPBA 1SIWA 3I1FA 1YZ6A 1AN0A 1IPFA 5H7XA 5K3EA 2BN4A 1U0JA 2E21A 2A3RA 5COBA 1HEYA 3DKRA 4G8JA 2NSHA 3RUHA 3WMGA 2VRCD 3STUA 4W82A 3V6MA 3AR9A 3VDRA 2J0EA 2FUEA 2ODWA 4TMXA 5KSYA 4EUFA 3IDZA 1TQ6A 3VKHA 3AZQA 4GM0A 4DSNA 5DN9A 2CMFA 3W9BA 2G09A 1NVAA 1Q11A 4OA5A 3SWWA 3HVIA 3C3WA 2V3CC 3KXPA 4LOJA 1QG4A 4MB0A 3E35A 1IQ0A 4CDGA 4RK0A 3CVYA 2W9CA 4Q93A 5DYTA 4D8VA 2YWFA 3TIFA 2V0CA 4PYNA 3HR8A 1CUIA 1UKEA 1XJ0A 4O1HA 3G9XA 4AY5A 4J6EA 5A5EA 4OLHA 3T41A 1IZ9A 2FZ4A 4PTLA 3LH5A 3VVMA 4DC9A 4DDMA 1Z4PX 4AW9A 3GGCA 4GEGA 4HAIA 5BUSA 2O2JA 4I8XA 2WFLA 1NVBA 4RDCA 1R15A 1VIVA 4QZ9A 1V9CA 3QJ5A 2BEWA 2WAAA 4IXDA 2HU8A 2FMHA 2XIQA 4C7OB 3FROA 2I80A 4G56A 3WRXA 3AJDA 3WNBA 2P79A 2QR2A 4WUVA 2FOIA 4YI5A 4P83A 3WWPA 2F1KA 3BXXA 5K3SA 3QKSA 3HI4A 1J2NA 5CVCA 1XTQA 1S8AA 1CYEA 3FZGA 4J91A 2AQKA 1H5UA 2CF6A 4TYYA 4M9GA 2UUBB 1E6MA 2GLUA 1WZUA 1GAWA 4ELVA 4OIFA 1LNSA 1U2TA 4TMKA 4LV8B 4XVHA 2KLBA 5E9WA 4LEIA 1JJIA 1NLYA 1V43A 2HSDA 2O8DB 5KNDH 4CR8A 1E1NA 1JHRA 5TT1A 1I13A 5TQ0B 2G5GX 3MGHA 5FBKA 1CZOA 3SJBA 2A5LA 2QI9F 1JPJA 4QFBA 3WLOA 2HADA 2QZ4A 2GUGA 1GGEA 2AYZA 1DAGA 2XYRA 2P4HX 3ONDA 3W7BA 5IF9A 4MR7B 5J63A 4ZODA 3BH6A 3UAWA 5EZYB 2X77A 3L92A 4QUJA 4NAVA 4ECUA 1GZVA 3QXJA 3IC5A 3NM5A 4G89A 4LJ7A 3N2YA 4FS8A 2WFAA 1VLLA 4AF8A 2E5FA 1SUWA 1TEHA 1HURA 4BQQA 4MWZA 4FGJA 2DHQA 1QQ7A 3N7AA 2XAUA 4J0QA 1T2UA 1IN5A 2A7QA 3QVOA 2EHJA 3V9AA 4Z7JA 1X9GA 3AMZA 3PNQA 1I8TA 5FWYB 5G0WA 1H0RA 2OOKA 2IXEA 2W9BB 4I55A 2GMWA 1KBQA 4O2BA 1G8GA 1IY9A 3RHFA 1S0VA 2WM8A 1RRPA 3OIVA 4Q01A 1L5HB 4P08A 2QRVA 1XU7A 4A23A 2ZB3A 4PONA 2W3RA 2Q3HA 3E3MA 2WTFA 2J3JA 4B4WA 2HF8A 3L84A 1C81A 3RRXA 4O4HA 4C3VA 3H11B 2EFDB 4C2BA 1WWVA 1IHXA 2J6SA 2X1HA 3E84A 2WY2D 4GXTA 1WUIS 3KLPX 1RQRA 1N2GA 4DLVA 1RZTA 1O97D 2RGUA 9ICKA 2OV6A 4EYSA 2ZI9A 4X7PA 1P81A 1DIBA 2ONYA 4QDJA 1W1IA 3OT5A 1XK7A 2ZS7A 1JQDA 4ZEVA 3FCOA 3ZJVA 2QT1A 1UC9A 4MCHA 1GHTA 4EBDA 2I4RA 3VOSA 1XZLA 4ZHSA 2ODGA 1LUAA 1NW3A 3FGPA 3GQBB 3UV6A 3AVTA 1NW9B 3ZDEA 1UDXA 5CM2Z 4H35A 4DADA 2QG6A 3PHLA 3PQ4A 3RYCA 2F1RA 1JT2A 4PX5A 1AJEA 1D0SA 4YQWA 1CQIB 4GPEA 4P7FA 4Q37A 1ZJMA 1H9CA 2VA9A 4IJQA 1V4VA 1H8ED 3GP3A 3VDQA 3KJNA 4QPNA 4UBKA 5LNK6 1ZETA 1JYSA 4JOSA 2GARA 4HGZA 2QKQA 2VK4A 2VP0A 2ZUWA 4X3OA 4FNMA 2PD6A 3RB0A 4V0LA 3BMOA 4M76B 2WWWA 3AEUA 1LK7A 1NVEA 4B48A 4PLGA 2PVSA 1KC3A 2MYPA 4AB1A 3M5CA 1JHUA 3LD9A 1UK8A 2JEFA 1PUIA 3JD4A 3UWPA 4FYMA 1AMOA 4LJ5A 4G9BA 4ZJYA 4NM1A 5IN5A 4OIMA 3EDYA 1OSNA 3WYGA 1XVTA 3RQSA 2ZTDA 4R2KA 1W36D 4UUPA 3HJNA 3E53A 1G5IA 3KYCB 1RYBA 4D4KA 4KR9A 4R8RA 4BZXA 2EVWX 5EMJA 2C4NA 8OHMA 3QIAA 1NAHA 4P4UA 2ZUUA 1X8LA 1FSPA 5GM1A 1LB2B 2AMFA 2VP3A 2UYQA 3N9IA 3BJYA 4FGKA 4CMBA 4FNOA 4ECVA 1ZM7A 2DVMA 3PW0A 2XY4A 1B4FA 1E1KA 4BEJA 3EVGA 4CQMB 1QQTA 1N63A 1VMIA 3HKBB 2RONA 4YLEA 2CUNA 5B53A 1CDDA 1XTUA 5D7NA 2FG5A 1LKYB 5KT5A 3ZJUA 1X42A 3M1YA 2W6ID 2NXNA 1NNSA 4ENTA 3I30X 4KX5A 3UENA 2G0NA 5TQ2A 3NHMA 4J0FA 1GZ4A 3D7KA 2NV6A 4IXWA 1TA9A 1C3OB 4YECA 1BHQ1 2BRUC 1SR8A 3HCNA 5FLKA 2GCOA 2QX4A 1JLRA 4EVSA 4CR6A 1R74A 3VHXA 3UA4A 3H3XA 4HDMA 2W8BA 4RQTA 2NYAA 3EJWA 5TSDA 5CLQA 2YNMD 1P4GA 1D6NA 2MR6A 3IDSA 4FC7A 2P78A 1ACJA 2Y0DA 4KXMA 4DO9A 1HA3A 4RK1A 9ICAA 3W8RA 2JDID 3LI2A 3UPUA 4CNQA 3NBUA 2NN3C 2QRZA 4X20B 2FH5B 3L9XA 1T8RA 4COKA 1KF0A 3CKKA 1H6CA 5KOJA 5IJ9B 3E2IA 1XSEA 5E2AA 1QMGA 3UT0A 4PWZA 1C41A 3COSA 2HDNB 2BELA 1Y8QB 3WU2U 3SAFA 4DF8A 2HBZA 2ZXFA 3D43A 3TKAA 2CVPA 4D6YA 1JLSA 6NULA 3G23A 3VNUA 4ROSA 2ECKA 2NU9A 1CUGA 5I3CA 1YJCA 2DQ4A 3QGMA 2ZTLA 4J0KA 1PGJA 2VKTA 1QQBA 1W48A 2E6UX 5CTAA 4AZTA 3W5AA 2VTDA 4OK3A 2WQ7A 2YWGA 3ND8A 3EQ6A 5L3SA 4OXRA 1SKYB 4N49A 2CSUA 5BN5A 5KWVA 3UC9A 4BBZA 4MH0R 2HV8A 3DXZA 4OQZA 3OM9A 5FLYA 3IB6A 3FKSA 1E2GA 3MMSA 1DBIA 4KQIA 4Q7JB 4PG5A 1TZBA 3ASVA 2NO1A 3OWHA 1GGNA 4NKRA 3AV3A 2XQKA 3CR3C 2BHSA 3MILA 1UJ4A 3DS8A 3GO4A 3CSUA 1PJ4A 1MQ8B 4B74A 1VDVA 2CUKA 1Y88A 1G5TA 1V8BA 3FPJA 3FSGD 4MRMA 3LUJA 4W4TA 1KN5A 2GBLC 4EEYA 4HZIA 2J46A 2PUWA 3G0GA 4IQGA 1IEVA 2I2WA 4PG6A 5JH7B 2M0NA 1QG6A 2ATXA 5IKMA 5AXAA 4LQLA 5IM4F 4D56A 1TIKA 2W4IA 4OMFG 3EZ2A 1D03A 3ZZ0A 3G82C 3KBOA 4WCFA 1USUA 3KOUA 3UXNA 4B82A 3OLYA 5TIIA 3AF5A 5AR1A 1NLFA 1A9QA 1JI3A 4QGFA 4BRSA 4BPBA 3EGXB 5REQB 3HADA 1QP8A 4F5QA 2CXHA 1USGA 3VMFA 2AA3A 1K9SA 4I2GA 2ACVA 1N8NA 3OI7A 2JAXA 3EEOA 2XZTA 1G41A 2QLFA 2NZ8A 1R0LA 1SVLA 1V2HE 1PLJA 2X8JB 4XOUA 4B3DA 5HRCA 4A26A 1E0DA 4UFPA 1JSXA 3OT1B 4TL6A 2QTNA 4J16C 7REQA 4I4TB 1QDUA 4O3OA 1P2FA 4K81B 3OQHA 3RV4A 1K88A 4JYCA 2PXAA 4URFA 1T2CA 1RSZA 2YVLA 3MDAA 1JQAA 1JBKA 4IDPA 1BQEA 1R7RA 4YIHA 3BCHA 4XSHA 1E20A 2QPAA 4R8MA 4R7ZA 2G71A 3PEFA 4DMFA 4LZGA 2UYOA 4C4RA 3Q5EA 2XO7A 1JL3A 1B8UA 2F6RA 2GEUA 2ZSJA 1PNVA 2XVYA 1L7DA 2P9QA 2OBFA 4EHLA 1VBMA 1T0PA 2XNHA 1GRVA 4BNLA 1ZN7A 5CX1A 3U4IA 1OA1A 4R8SA 3SFZA 3ESXA 2PMBA 3UNXA 4L9WA 1YCFA 1B1CA 2FN4A 3RIYA 3E1GA 1R9GA 3KR9A 8ICZA 1ZOLA 2Z2XA 1R16A 2GILA 1U9JA 2AHOA 1OQAA 2PX4A 1M34B 1VYTA 2Y9UA 4P7KA 2KE7A 2H1CA 3NBFA 5KFQA 3UT6A 5IKXA 1E4VA 3F53A 1COWD 2I2AA 4WT7A 2QVGA 4EA8A 2QP4A 9ICMA 5FR2A 4MSUA 4GYKA 3IMGA 2V58A 1XTKA 3C2LA 3K0EA 1RAIA 4IHJB 3H18A 1JDNA 1A96A 3KZXA 1O96B 1OV4A 4XQGA 4L5IA 5BNFA 4O8CA 3RASA 1EP1B 4DDWA 4P22A 3HJRA 1PE0A 5KVQA 2MOKA 2OCIA 1CRPA 1XGKA 4RTPA 1QLJA 1ATIA 3FPGA 3HB1A 3VBCA 3TSWA 1NSYA 2IWRA 2PL5A 4H3KB 2EF0A 1GR0A 4V0KA 4RD1A 4QXOA 2C92A 2CC2A 4D3ZA 3PX7A 4NG5A 4X1YB 2E82A 4YMTA 1PBNA 1M67A 1V35A 4QHTA 1PFVA 1R0BA 1U0BB 2VDVE 4Z7NB 4TKUA 3TJZA 5KJCA 1ZC3A 1DJQA 3V4SA 1T0HB 3GJ3A 3RS4A 1DKRA 4YGYA 2AZDA 5IKEA 4PGGA 2EERA 3GIDA 4Z1MA 2WB1F 1IIPA 4UNSA 5LDGA 1L3SA 2JB9A 1PFWA 1Y8RB 3R20A 1ML4A 1XRPA 2QRLA 1YSCA 1S3SA 1YQQA 1MN6A 2OLKA 4FYWA 2V7UA 3IP1A 4RU9A 2FZWA 1GSAA 3R7NA 2ZJ2A 4F4JA 4RAOA 2XZOA 5T67A 2RBEA 2VYVA 3BAFA 1E18A 5CBPB 1XTSA 4DXDA 2IZ0A 3KOZA 4HFMA 3WWCA 4C4AA 5HKKD 3HJAA 2ZTUA 5EVJA 3LHDA 2QMHA 3F9CA 1LY1A 3ZH2A 1LWOA 2FSIA 4PCAA 2HRRA 2Q7XA 1Q6YA 1RLMA 2I6QA 4QX6A 4RVOA 2CFTA 2NADA 3DD1A 1PK8A 3U7FB 2VDQB 2PG3A 3RVMA 3FF4A 3FJOA 3PTLA 3WGGA 4B7CA 1M8GA 1A72A 1DHTA 3SZOA 4NZ9A 1UEXC 4H6PA 5F3XB 1R9MA 3E0XA 3PW5A 1PVVA 1LW7A 4WVFA 4DPMA 2WUWE 1CZHA 3V1MA 5GZ6A 1OAOC 4KSYA 1J8MF 3TK1A 3EGDA 1GXSB 2YV1A 5BY2A 1FP4B 2Y4NA 1UINA 2IBSA 2C04A 4PCUA 2H5JA 1M5TA 2DKFA 1MFPA 1A8QA 4TOIA 1U3VA 3GAMA 3L18A 3L7DA 5HGXA 3GGPA 1AS0A 1FRNA 3KSRA 5KWSA 3O8OA 3NFRA 2W37A 3RKSA 1FFXA 1XN4A 3N3AC 4UU1A 1T8WA 1RC0A 3OQPA 2K5UA 2RH4A 4QBTA 5M29A 4UCFA 1GU1A 4GRDA 4BWYA 1EAMA 2NU8B 3AY6A 5JZVA 3DAYA 2AMJA 3EMBA 1R5OA 1E0SA 1ENZA 4OX9Y 2D59A 3R5FA 3NYRA 1MXFA 4P35A 5AW4A 2YWJA 1OBCA 2QD4A 2WAQF 4Q15A 3CSDA 4U9UA 4IUBS 3QSYA 1DV1A 3RROA 2V6BA 5C1PA 2JHGA 4M49A 4GWGA 1B76A 1EDBA 3ESAA 5F21A 2HWUA 1TZCA 3R41A 3RSOA 4IKPA 1IXYA 2MR5A 4AUEA 1A2OA 1Y9EA 5CD1A 3KX2A 4QBGB 1J0CA 3M3PA 4OUDA 3TBFA 1Y6QA 3C15C 2I33A 3ODGA 4WJKB 3A1SA 4Y6QA 3V6LA 3GRAA 3P7MA 2IHBA 5B12A 2ZITA 4PXSA 4I5FA 5DI9A 4J9SA 4G3IA 2WF9A 2F3QA 4BVLA 4E5MA 4QEZA 5KT7A 3NT5A 1KI1A 3DOUA 1W19A 1QG0A 1HMPA 4D9KA 1R6BX 4G4SP 3CLRC 1YQEA 2GZSA 3OJUA 1YDGA 2QAGA 4CIWA 1LSSA 1NM5C 1RHQA 2GZDA 1TA4A 3BWDD 2ISPA 1HKHA 1RXIA 1M6NA 4YWJA 2G8NA 1EFPA 3S28A 2HA5A 1L4GA 3AP3A 3AR4A 4HL6A 1JBQA 3I9OA 3ZNPA 3L0PA 4AY2A 3GFPA 4XIIA 3TQRA 1GZDA 4JJ8A 2CFSA 4PLWA 3W2TA 2VSYA 3LCVB 3BQ2A 4EUEA 1PJ3A 2G1AA 4MXDA 4H4EA 1W6RA 3MT9A 3LWMA 4KL8S 2H1HA 1X1EA 2H4ZA 5ESDA 4NICA 1RACA 3L41A 3HCDA 4MVJP 1G0NA 1RLTA 3PSIA 3QEKA 1XXLA 1UM8A 1F2VA 4EX6A 2GPAA 4O3RA 1G8HA 2N1MA 3TE6A 2ODPA 1Z35A 5L1MA 2XLCA 1QHFA 3AVXA 2FPMA 4L8YA 1P6XA 2R7MA 4BFUA 2R87A 5I3ZA 1PNQA 2ZRGA 3HPOA 2BEUB 3HJGA 5JD5A 2UXCB 4OB7A 2YKGA 4KQ2A 5TMBA 3BMCB 1Q1ZA 4J9NA 3THSA 1ORRA 3VBEA 2E4UA 1FTWA 2I71A 1WKBA 5IHPA 3DCNA 3H75A 2GEJA 4HBGA 5KYGA 4B9LA 3BPSA 3K2QA 4YCBA 2BH9A 4PL2A 5BSFA 4DLXA 5IIJA 1BX3A 1L7BA 3EY9A 3H0RB 5IBQA 3N5KA 2BFPA 3SEFA 2ZRDA 1J7KA 3VZBA 3AUTA 1JDUA 5E4FA 5CRIA 2GBIA 5I01A 1SKQA 4OV6B 5CDHA 1Y89A 2ACWA 4JLVA 4I50A 3AUJB 4C4XA 4JL6A 2EQAA 3P4YA 4ER6A 3QNMA 1XDZA 3A36A 3A7EA 5AO9A 5AK5A 1QHGA 1U2RA 3U0VA 1XDSA 1TT5B 1Z83A 3T9FA 4GLXA 3B1XA 4DCNA 1QWOA 2IEBA 1VYUA 3BOSA 4LDNA 4YMGA 4KHPB 4IIYA 4NENA 3HKDB 1PQWA 1L7EA 4R7GA 3USCS 4QQ8A 1OFVA 3CB4A 3RRMA 5JS7A 4GOOD 1YQGA 5KNCA 4AS3A 4F3KA 2CLIB 3S40A 1RHJA 3TECE 3DJYA 3KL2A 3EXFA 1QFSA 3MRSA 1BQ4A 5BOMA 1DPFA 2H1RA 3LHFA 3BICA 4C0SA 1SBIA 4BJ5A 2CXYA 1ODKA 1GGHA 3MM4A 3GRZA 1L1QA 4AO7A 4H6XA 2LIPA 4DUYB 1R1DA 2PPVA 3G88A 2B9EA 2P2SA 2PBFA 1VC2A 2Q0QA 3QLTA 4ZU6X 5GGYA 3QZUA 2O3RA 8ABPA 1K63A 3WGHA 2YINC 5J2KA 2ZR8A 2DHCA 1B15A 4OJ6A 1SKBA 2XMRA 4FYYA 2MT9A 3QBJA 1XRMA 4L02A 5LVAA 2XODA 4TS9A 1Q92A 1ZQSA 5J2AA 1NKEA 3E5NA 3GDXA 4KWTA 4YAGA 4IIJB 2OXRA 1KK1A 4NEQA 4YUVA 2FMFA 1Q17A 3ROGA 2Z2ZA 3CCCA 2HK8A 1HDCA 2O7QA 2JI7A 2WOJA 4OGKA 2VAVA 1UMDA 3KALA 2QQGA 2FPGA 3AM5A 1PG0A 4RM2A 4ZT3A 2AOUB 1Z2OX 2PLFA 2OQ2A 3HB4X 1R0WA 3EG5A 2GERA 1S6YA 2FPPA 2PWZA 4UB4A 1N34B 1SGGA 4I6JA 3T5DA 4AX8A 3RS8A 4KPEC 1SPXA 2BKVA 3L1VA 5J5VA 1US8A 5I7EA 3Q15C 1DADA 2CXNA 1U3DA 2OWOA 1ORDA 1LA2A 1TM2A 4GZ5A 5FBWB 4JWNA 2H2AA 1DBQA 5F3DA 3WAGA 3KPUA 2C28A 3T4XA 1NAIA 2YV3A 5H16A 2XKBA 1WETA 4JYBA 1QVAA 2Q4BA 1DTEA 1Y5IA 3W05A 2IXDA 1V1RA 3U44B 4TUYB 4D57A 3OCUA 3NC4A 3SQOA 1CT9A 3TOZA 5TS3A 3U7HB 4POOA 4CKWA 1ZCJA 1WQ4A 1RVDA 2DWQA 1BMDA 4JZKA 4FZRA 3NVMB 4X60A 3UM9A 4FYXA 1PSDA 3GJXC 4C6HA 5CNJA 4C2UA 1RM5A 3Q87B 5BT9A 4HCJA 4BX3A 4PHPA 3P1JA 2I5PO 3OM8A 4Z9BA 3ZH9B 3EF1A 3LE8A 4MW4A 2E1PA 3CBGA 1BNCA 4CTKA 2YYZA 1PVOA 2C3UA 3R5SA 4C6RA 3B3AA 5CA0A 3FN4A 3T79A 2X6TA 1JWAB 2ZATA 4D26A 2IY7A 5IT4A 2Q5IA 1BZYA 4P3XA 3WQQA 4QAQA 4TWBA 1Z62A 5F7ZA 1TK5A 1NN1A 1CE8B 1X3LA 1J39A 2FEKA 1F0NA 4O2RA 5BPHA 4DM7A 3ZVLA 1F4PA 4YAFA 3KXIA 2VJPA 1NT4A 4JWTA 1OBHA 2CEKA 4H0CA 2HI0A 1EK5A 2B1IA 3HSYA 3B6KA 8ATCA 4LA4A 3BXGA 3WB1A 2GXSA 5CDFA 3CONA 2CXSA 4DV1B 3S1LA 2YXPX 3PX6A 2XYHA 5SICE 1OFHA 5L1KA 1ISFA 4OXNA 3IKJA 1V6SA 4DLGA 2NMVA 1DOHA 4OREX 2D74A 2XNDD 2YQZA 4M7PA 2VO1A 3QE2A 4I1SA 3WRYC 5D3MB 4IDHA 1HXHA 3LL4A 4YUXA 3BMQB 4UTRA 3LUHA 4KFUA 1QVZA 3GMTA 5G4KB 5AW2A 3W3ZB 3QBEA 2ZRMA 3W1VA 1KEWA 1ETUA 3CEPB 1T8UA 2DTXA 4LNUA 2VA3A 4M1MA 1LLDA 4H4DA 2NW6A 2NX2A 3OA0A 1LRLA 3I58A 1TVKB 4CDMA 3OQVA 4BTLA 2NNLD 4AF7A 3T5CA 2J8ZA 2YVUA 3IA7A 3LPAA 1KPGA 5CXSA 4ZYVA 3CUTA 5L6MB 1YZVA 8AT1A 4XCVA 2G5TA 1N77A 3A9VA 4UULA 2OWDA 2GVZC 2G25A 1Z0JA 3ABIA 1H94A 4HEQA 2BR3A 4EI8A 4EPVA 1SUAA 1BDMA 3NW9A 3C3CA 4QHYA 3BWYA 3GJ8A 1O8CA 3RJZA 4CKEB 1ZP6A 2JBAB 3BA6A 3TMKA </