2HSZA

Crystal structure of a predicted phosphoglycolate phosphatase (hs_0176) from haemophilus somnus 129pt at 1.90 a resolution
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
225
structure length
225
Chain Sequence
GMTQFKLIGFDLDGTLVNSLPDLALSINSALKDVNLPQASENLVMTWIGNGADVLSQRAVDWACKQAEKELTEDEFKYFKRQFGFYYGENLCNISRLYPNVKETLEALKAQGYILAVVTNKPTKHVQPILTAFGIDHLFSEMLGGQSLPEIKPHPAPFYYLCGKFGLYPKQILFVGDSQNDIFAAHSAGCAVVGLTYGYNYNIPIAQSKPDWIFDDFADILKITQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of novel predicted phosphatase from Haemophilus somnus 129PT at 1.90 A resolution
rcsb
source organism Haemophilus somnus 129pt
molecule tags Hydrolase
molecule keywords novel predicted phosphatase
total genus 84
structure length 225
sequence length 225
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2hszA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2hszA01
3N28A 4EELA 1Y8AA 3QXGA 3OCYA 5ALZA 1YS9A 3ZI4A 4CF4A 3ZWKA 1VFPA 3AR3A 5AK6A 2GMWA 2C8KA 2DQSA 3B8EA 3W5AA 2HOQA 3ZVLA 1RRCA 3B9RA 2P69A 3AR8A 3K1ZA 3SLRA 5ALFA 5ALDA 4BX0A 1YV9A 2YJ4A 3A3YA 1QH9A 5AVVA 2ZBEA 2G06A 1J97A 4AS3A 4UMVA 2OA0A 5AI5A 2YFYA 3OCWA 1RQLA 2FPUA 5AW6A 1LTQA 5ALPA 2GFHA 1QQ7A 2G80A 3WKEA 3MN1A 3WK5A 3HYCA 4G63A 1J8DA 1CQZA 2I34A 2ODAA 1EK1A 2G07A 3AR4A 2FPSA 5AK3A 5AKGA 2AMYA 5AVTA 5AM3A 3QUQA 3EF0A 1Z5UA 3M1YA 4BEVA 2OM6A 4HYTA 3I76A 4BX3A 4EZEA 4JB3A 3QU7A 4H1WA 1IWOA 3W5DA 3L5KA 4Y2RA 5ALKA 3L0CA 2YN4A 2P11A 1JUDA 1F5SA 5AI0A 3TLMA 4KN8A 3WGVA 3UM9A 3WK6A 2W43A 4RESA 3KDPA 1TJ4A 3E58A 1XVIA 5ALWA 1RKVA 2B8EA 2C8LA 2JAUA 3AR2A 5FP0A 5AI4A 4Y2UA 2CFTA 5IS2A 1TJ3A 2AUTA 3NASA 3DDHA 4XPZA 1ZD3A 1RMYA 5AVUA 1O03A 1Z4NA 4CF3A 2EATA 2FEAA 2YMPA 2W4MA 5ALGA 3L7YA 1Z5GA 5ALUA 4UU0A 5ALLA 3IB6A 1QQ5A 3J7TA 3WKAA 4UATA 4Y2TA 1WZCA 5ALIA 3UMGA 4C4RA 4OCZA 1NF2A 4RETA 4F71A 1YJ5A 5AM1A 4AS2A 3ZVNA 3IJ5A 5AW0A 1L8LA 2FDRA 1PW5A 2ZBGA 3U7HB 2C9MA 3DAOA 4BYGA 3P96A 2Q4TA 2BDUA 2P27A 3VAYA 4UARA 3UMCA 5ALTA 2HF7A 4ZEXA 2FUCA 3UMBA 2NYVA 3CZ4A 5AVWA 1Z4IA 1U2SA 3L1VA 4L6CA 1T9ZA 2HHLA 4OD0A 1WR8A 5AW2A 4JDPA 3F9RA 3ESRA 5AW1A 1EK2A 2WF7A 2O9JA 4BBJA 4KNWA 2IOFK 1L7MA 2EARA 1RMTA 1K1EA 1VJRA 1SU4A 2PQ0A 3OTQA 5ALEA 5A3QA 3ZU6A 2B1QA 1L7OA 4KNVA 5AW9A 2G09A 3L8FA 3WKBA 2WF9A 4ZEVA 1QQ6A 2HI0A 4UASA 5AKHA 3N5KA 4UM7A 2QYHA 3QU2A 5AI9A 2ZOSA 1N8NA 3QX7A 1Z4MA 4G9BA 3ED5A 1CR6A 3N07A 4UW9A 5AKIA 4O8CA 4AP9A 5AM2A 3FM9A 5AW4A 2I6XA 3NAMA 3SF0A 4B6JA 3N1UA 4KYTA 5AVYA 4FFDA 2MSNA 4IFTA 3BA6A 4NAVA 1Z4LA 4BX2A 1ZS9A 3WGUA 4MUMA 2HCFA 3WK9A 1S2OA 2G1AA 2X4DA 3L8GA 4YCLA 3QYPA 4Y2VA 5AVZA 2R8YA 4YIKA 1T5TA 4NWIA 3NANA 1SWVA 3WKDA 1X42A 3QU5A 5AIAA 2YY6A 5ALXA 1L7PA 4UM5A 3SD7A 1RLOA 3PDWA 3ZVMA 2AGVA 1XP5A 3A1EA 1XPJA 1Z4OA 2OYCA 4Y2QA 2B82A 3SKXA 3W5BA 2BDEA 3ZTYA 2IYEA 3S6JA 2ZXEA 4FE3A 3KC2A 2YJ5A 1TJ5A 1RQNA 3R09A 3R4CA 4MWOA 2FUEA 3EPRA 2HEGA 1Q91A 5AI6A 4DFDA 5AHXA 2WHEA 3FPBA 2RARA 1QYIA 4UMDA 2G08A 3W5CA 2HO4A 2P9JA 3WKCA 5AKLA 3DNPA 4J2TA 1Z4PX 4PNHA 4EX7A 3AR7A 3SKYA 1RLTA 3ONNA 1NRWA 5AKXA 3AR5A 5AM5A 1L7NA 2WF8A 4YGYA 5AM4A 1O08A 2FPRA 3AR6A 3R9KA 1RMQA 2B0CA 5AKJA 2I55A 3ET4A 5ALMA 4UAUA 3PGVA 3NUQA 5E0OA 2MU1A 4UAVA 4XQ0A 3I6BA 2I33A 3PCTA 4GXTA 2WFAA 2YJ3A 1S8OA 1YMQA 1FEZA 3L1UA 2NO4A 2JARA 3OCXA 2R8ZA 2HDOA 2GO7A 1WVIA 3SHQA 5AIBA 1Q92A 3FGOA 4FYPA 3KBBA 3QUTA 1RC8A 3EF1A 2OBBA 3ZUPA 5ALOA 3OCUA 4DCCA 2IA5A 5IT4A 3L0YA 4CE6A 1ZRNA 2YMLA 4HGQA 1Z88A 3ZX4A 3QUBA 2GHTA 3FZQA 3NIWA 1ZD5A 4QQFA 3U26A 4BNDA 3PGLA 4HGOA 2IOHA 4HAIA 3B9BA 2RB5A 3I1YA 4BKMA 1LVHA 4OHFA 2G0AA 2MU2A 1ZD2P 3L0BA 1AQ6A 3U7EB 3E84A 5AW5A 1U2TA 3MMZA 2WF6A 5ALQA 4DWOA 3OPXA 2ZBFA 3L8EA 3QUCA 3CNHA 2ZBDA 5AK4A 4C4SA 1L6RA 4J03A 4L6AA 2I54A 3N8GA 4EEKA 5AKYA 2HF2A 4OFZA 3ZTWA 4YIHA 4YH1A 2C88A 4HGNA 3DV9A 2EAUA 2WM8A 2RAVA 3RF6A 2YJ6A 3KOOA 2FPWA 1ZD4A 2B1RA 2GHQA 3QNMA 3QU9A 3OCZA 4KX5A 5JJBA 1WPGA 5AW8A 1RLMA 2BY4A 1MH9A 4Y2XA 2HX1A 4IG4A 5IT0A 5ALJA 3I28A 5AKZA 1YNSA 2R8EA 4UMEA 3U7GA 1Z4JA 2ZG6A 2B30A 1U7OA 3QLEA 2CFRA 4F72A 1RKQA 2CFSA 1N9KA 3GYGA 4L57A 5T41A 4HGPA 3WK7A 2Q5EA 1ZJJA 3E81A 3RFUA 5AKKA 5AKEA 1NNLA 2PR7A 3MPOA 2C4NA 4XE5A 4ZEWA 2HSZA 4EX6A 2IOFA 3MC1A 4NABA 4HGRA 3L8HA 5AESA 4XOUA 3BWVA 3NALA 3WK4A 2JAOA 2O2XA 1RPZA 4Y2JA 1VJ5A 3U19A 4QJBA 1SWWA 3QU4A 2YBDA 2JAWA 5AVQA 3A1CA 3SMVA 3ZW7A 4KX3A 4CF5A 3ZX5A 2NO5A 4Y2SA 5A3SA 5AI8A 2YMQA 3FPSA 4GIBA 2WF5A 2CN1A 3ZWDA 4Y2PA 3A1DA 4I9FA 5AICA 5ALHA 4C4TA 3HLTA 3FVVA 1T5SA 3KD3A 2W11A 4YCNA 2I7DA 4UMFA 2R8XA 2QLTA 4I9GA 3WK8A 4NFLA 4E88A 5AK5A 2D2VA 3EWIA 5AVXA 1TA0A 5A3RA 4NV0A 3ESQA 2VKQA 2AH5A 3IRUA 5ALNA 3QGMA 3NRJA 2B8JA 4BNDB 3D6JA 2JGAA 1RKUA 2Q4RA 5AM0A 1ZRMA 1Z4QA 4BEWA 1U7PA 5AW7A 4Y3UA 1YDFA 1RDFA 5AVSA 3AR9A 2FPXA 5ALYA 3U13A 4Y2YA 4YCMA 1KYTA 5AW3A 3KZXA 3M9LA 4DW8A 5ALRA 5AVRA 5ALVA 2RBKA 2PKEA 1Z4KA 3ET5A 4CNQA 3OCVA 4EENA 1ZOLA 1TE2A 5ALSA 3E8MA 4UU1A 1L8OA 1U02A 2FI1A 3U7FB 2YMMA
chains in the Genus database with same CATH superfamily
4BNWA 2B1IA 3NIFB 3RBAA 2ZJ5A 3JAWA 1M72A 3SYZA 3J7AC 5D8DA 3QNUA 3JWIA 2LYBA 2JKVA 2MYPA 5B1DA 3IXMA 4Z6EA 4J94A 3E22A 1BCRA 1C8LA 4CF4A 2BH9A 2W2PA 3BF7A 3OD5A 5IMSA 2JFWA 2XOEA 2I4RA 3ZWQA 1E8DA 4U7JA 3AR3A 4C8LA 3MZ0A 3KSBC 4HXGA 4BMVA 4NQRA 3NJ4A 3JASA 1CR0A 5HQTA 2A3VA 4GOLD 2XE6A 4JJ4A 1GTRA 3WLPA 4NL4H 3LXXA 2XNDA 3OLWA 1KGSA 4GBED 5K3OA 4R8UB 4FS2A 1OKKD 2IYWA 3PXAA 3Q12A 1FDWA 1OV6A 2B98A 3K09A 4HUQA 5ANRB 5BQOA 2ZJ6A 1TQ4A 3G79A 2VWHA 2C0CA 4E1AA 1PYOA 4MR9A 4EJFA 1R12A 1RWPA 4X7RA 2RHTA 2ZYDA 4EJSC 3TFWA 4OXQA 4BFCA 1RQLA 3DZKA 3G1TA 1IN1A 2GS9A 1HG1A 1U80A 2E5FA 2GFHA 3EZYA 2AR7A 5KFYA 5ILQA 1F4LA 3D5QA 4Y6RA 5IC4A 4FCTA 3LFUA 2OZLA 3H16A 3HVIA 3NUZA 3WZMA 3MWDA 3PLAE 1QF7A 4BO6A 2JEFA 2RCNA 2NXJA 1SC9A 3ICXA 3UA3A 3HKEB 1QFYA 1LX7A 4FHCA 4ESEA 1RWBA 4M0FA 4GYKA 1E1NA 1GGNA 2QQEA 3L6CA 3WAKA 1JXEA 1JECA 1N6IA 1V9LA 1X70A 2AMYA 2FMUA 2ILTA 3BD8A 4MHSA 3BT7A 2OV6A 3M1YA 5ENVA 2ZR0A 1H69A 4FHDA 2UXDB 1J0DA 1JAZA 3KT0A 4LMAA 2KEYA 1CR4A 3EY9A 4W8HA 1RI2A 1SG6A 1UWVA 4BNTA 2DH5A 5BPHA 3ETLA 2B6HA 1L3UA 4PC7A 3T3DA 1VSVA 2E4AA 3MWJA 1LNSA 1H0RA 4DUGD 1CR1A 4IGAA 1IWOA 3KJQA 1Q0UA 2JJMA 1Y63A 3Q15C 4KH0A 5FLEX 2QJOA 1HE4A 2AIRA 2VWQA 2O3UA 4LF4B 3RC8A 1D2CA 2YC4C 4JBHA 1A2KC 1OYVA 3IPXA 3QBTA 3W6PA 3X44A 3HXOA 1BVHA 1IRXA 3LWLA 1KPGA 1P4HA 1YJBA 4A0SA 4RVHA 3GFTA 4BOYA 1Z37A 3ISDA 5G3YA 3OURA 3RHSA 3VR6H 1Z0KA 3EZLA 3JQ6A 5G02A 4BNUA 2E8MA 5FHRA 1ZQYA 4EABA 3IVXA 1QIMA 7ICTA 2OAEA 5KYTA 4LDJA 1P1IA 2X15A 5JSQA 3NASA 1U1DA 2DBVO 2FX3A 4IG9A 5GOTA 3A6ZA 4JOBA 5EVCA 1T6BY 5SV2A 1ZD3A 4WY5A 2FG7C 4AQ7A 1JYEA 5AVUA 4DV2B 3WHPA 4UHHA 5K3FA 1Z4NA 1YZ3A 3TGPA 2WJJA 2NSHA 4IZHA 4B73A 2AXNA 1ZQMA 4HFNA 1P9OA 3KYDB 3FCUB 1KSJA 4DCTA 3GV8B 2CCJA 4MFAA 1BXGB 1WPXA 4OEHA 5KNDA 1JSRA 4IPTA 4YUAA 4DR3B 1C7FA 3DOJA 1I3CA 5DLEA 4UM9D 1UPHA 2JCGA 3Q7TA 5JRDS 4UBNA 1TUIA 5AM1A 2C07A 3L40A 3WGLA 4IDQA 1ECFA 1G8HA 2O7SA 4XVRA 3SPXA 5DNVA 3EPHA 2W71A 1E6EA 1P60A 1DLJA 4FEGA 1T8YA 1ISSA 4Q1FA 5IJ0B 4H31A 1KVRA 1U5AA 1R15A 2JGNA 4KE9A 4CKCB 3DVQX 4REQB 3DZBA 4WWHA 2VTVA 3H86A 3VAYA 5LZ9A 2L5YA 1N32B 1P1JA 3Q2IA 4BMDA 1ULAA 3FFXA 1GPKA 2C2XA 4R5HA 5IWCA 2QLFA 2QX9A 2VDQB 3R7AA 1O6FA 2QI9C 2ZVQX 3H3FA 4TZKA 1Q0ZA 1CFZA 1PHPA 4IS7A 2BQRA 2A78A 2IQ5A 3NPAA 3U3ZA 4D9GA 5AW2A 1NW5A 4FMDB 1YS4A 2G4VA 3TLEA 2OXCA 2YS6A 4E12A 3W8DA 4F2DA 1FS4A 4URVR 5GAJA 3IKJA 3BQ2A 1OU4A 2DSNA 3MOGA 4RANA 4RIHA 3MXTA 1YVEI 3A1TA 2LBOA 2EARA 3ISVA 5IAJA 5G5GA 2KN7A 3PFCA 5CDFE 1M54A 1V8ZA 5GJCA 1HNZB 1J33A 4F5PA 2I8CA 4R2KA 5KT6A 2DY0A 4A8JB 4TZ6A 1Y7HA 2ZYHA 2H2GA 2AFHB 1BE8A 5ECWA 3UXEA 2PZBA 4KGZA 4R71A 1EHCA 3L7DA 5KPDA 2I6FA 3SC2B 3ZV7A 2H2IA 5AVJA 1NT4A 4MITA 4UUBA 4E31A 4M99A 4ER3A 5C3MA 1P31A 5IF9A 3HVHA 5JMPA 2IBMA 5HZKA 1QYRA 1KC3A 1VPDA 4L95C 1MSWD 2EJVA 4F2GA 1ST2A 4N3AA 1FNMA 4K1XA 5KNBA 4PZZA 2EV9A 2IYYA 4X97A 5IMBA 3KOMA 1B2RA 1S2GA 4DIDA 3AF2A 3W1WA 4Z49A 3KHHA 1X7WB 2M6KA 5K20A 2AOTB 1B76A 4MVJM 3HU3A 4AVYA 3KZOA 5K45A 4JLDA 1DEHA 2XMGA 3EIXA 2XF8A 1U9IA 2XMSA 2P8SA 2XCTB 3HWSA 4AWBA 4QYSA 5J3JA 1MX9A 3C7DB 3JAWB 2Q2QA 3ZWPA 1VBNA 2O0MA 3DV0A 4MV1A 3EF3A 4BDPA 2I1LA 1ZAKA 1KI3A 4QBGB 2NPOA 2ZTVA 5BV7A 3GCZA 1FTGA 1U9ZA 4FFWA 5EYPA 4BUGA 3LPAA 2GYWA 1UDCA 5F23A 3GOQA 3GHHA 1ZVKA 4RD3A 4WCDA 4GPTA 3FCEA 5KEIA 2BFWA 2NVWA 3CGWA 1P61B 4TKVA 1M2VB 2PSJA 4CL8A 2P4QA 3KQLA 1Y3CE 3KPYA 5BUCA 1R66A 4QHTA 3ZZ0A 1P1KA 3QU5A 5AIAA 2YY6A 4QLOA 3WP0A 5IF3A 4C06A 4QOFA 4I3HA 1QORA 1UPFA 3KTFA 3OJSA 4L5IA 5LBTA 3RYHB 5M2QA 5DM70 2VYNA 1ECCA 2XWJI 3BC1A 3OQIA 4GE0A 3V8EA 5KOJA 1E6MA 1WDWB 2BMEA 2VFAA 2J5QA 3JATA 2JFHA 3H8VA 7ICNA 3PI7A 4I1OA 1YD7A 4WOPA 5TMBA 4UQGA 1W1WA 2C99A 1X7GA 2X7HA 1PR2A 4X7BA 5JNVA 4E33A 1RTTA 2GA9A 4JQYA 1NQTA 1IEVA 5IVPA 1ZOOA 5FTKA 2RAUA 1L8XA 4WT7A 2IYEA 3MWDB 4DC9A 5J0SA 1IIBA 2FLLA 1AKMA 3C4QA 3DFMA 3OPYI 3W9YA 5ESXA 2AEJA 2CLEB 3RK1A 2QMEA 4D8WA 1P7PA 4D99A 4RULA 1D6NA 3H9BA 1BN7A 2AC4A 2BR4A 1AM4D 3H3JA 1UUFA 2KOBA 4D3FA 1TU4A 3LCRA 1FSZA 2R1VB 4CTOA 2PS3A 3F6RA 2VT7A 2Y0PA 3A6JA 2MAXA 3NM4A 4AZ0A 3IR7A 4OSOA 3I0MA 3UCEA 1EPUA 4IIXA 3DHWC 4C30A 4ZARA 3ADBA 3PTLA 5KFLA 2BSQA 4QDXA 4ZQIA 2IYAA 1JAXA 4R1SA 3IQFA 4QAQA 1E8NA 1N6LA 3KV1A 4C7ZA 4LOIA 4IDAA 2NTVA 4LZWA 4OATA 2ZWAA 4QFBA 4W7HA 3QA9A 2WY2D 5AM5A 2EOAA 1J8QA 2XH8A 1DRKA 1QH0A 5F4BA 1Q2XA 1HEYA 3KXPA 3OY2A 1X9HA 2G40A 2HYIC 5DNCA 4XCVA 4ADSG 2VSXA 2JEJA 1CJTC 1OBCA 3G5MA 5EXSA 3RLIA 4BC0A 1AB5A 3HLKA 5CLQA 1UFOA 3K32A 2BP7B 4MEBA 1THZA 2FE9A 3UN1A 3RJKA 4L5JA 3M9XA 1R10A 4Q02A 2I55A 4NNPA 4EB3A 5K4AA 3S8MA 5J4HA 3FAKA 3OQIB 1HQKA 1R6XA 4KAAA 5KX5F 1A9OA 1KQFA 1IG3A 1HLGA 3WLOA 1MC8A 2FW9A 3FFAA 3AY3A 1K63A 3GFOA 3FD8A 4HDKA 4F85A 5DLGA 4P3XA 5EEGA 1I14A 1JX4A 3KALA 4IXWA 4LY6A 3ZDRA 4DAEA 1RADA 2CXRA 3ZU5A 4DDHA 1H3NA 4N47A 1M1ZA 1C1DB 1T35A 2GD0A 2O48X 3M8KA 5FA8A 1SHKA 2GAOA 1I36A 2R3SA 2YWFA 3ZU3A 1LGYA 2VQ6A 2QIPA 4XARA 2R8OA 5CBPB 5A0VA 1Y34E 1WVGA 4DSUA 2YZMA 1E7RA 3F6PA 2CK3A 1F1BA 1LWOA 2VTEA 4I50A 2WVJA 4XQGA 3T0GA 2WWWA 1PQUA 5EJ4A 3NC1C 3KR0A 4UBOA 2OK7A 1EUZA 1EFPA 3DS8A 3AFHA 4CM9A 3THYA 1BEUB 3DG9A 5FOWA 2JI7A 2W54A 1Z7GA 1S3GA 1XCOA 3B0XA 2J3DA 3JYLA 1P3DA 1CS0A 4GC6A 4HGQA 3SBOA 3TLAA 9ICIA 3H5VA 4XGRA 4BEBA 5IABA 2ZBQA 3V8VA 1Y9EA 3KWJA 2ZM6B 1OLXA 2OBYA 1IXRA 2UVPA 3NBAA 3F6YA 4JEUA 2ASLA 5A4MS 1S9HA 2J87A 2J45A 4KQWA 3PYXA 2PSDA 5DK4A 2UYOA 2FKAA 5F52A 1QGOA 5AQ1A 5DB7A 4LHWA 5B5EU 4V1CI 5KOHB 4YHHB 1WM1A 3O82A 2QM8A 2QYTA 5JH7B 3PXXA 1MIOA 4BRUA 2EZ8A 2VAXA 1B42A 3QZUA 2NW6A 1ISIA 3BMOA 3L0BA 1VKJA 4IDHA 4Q9JA 1VCMA 3GWGA 1T6NA 4NP6A 3HRDD 4WLVA 4B8WA 3LVQE 1MF7A 1EHIA 4NPAA 1Z12A 5A4DA 2GEFA 3B1JA 2YNMA 2O8EA 3GF4A 4FZ5A 4MVJA 3VU3A 3C5WP 2KKVA 3CNHA 1YE8A 5FWDA 1H8EA 4DL7A 1M10A 3IUQA 4KEAA 4EJSB 1Q0SA 4M0EA 4WZBB 3NBMA 1YA4A 1KSPA 2ZJ0A 4AYBC 4EEKA 1CUIA 2B1GA 1GNVA 1NJWA 3SI8A 1P45A 2F3QA 4V03A 5BNFA 4CZ2A 2ZI6A 1A9ZA 3S2UA 1UM9B 3MW8A 3THXB 3S70A 5HIJA 2FMPA 3LT4A 2OC9A 4OYRA 4DDMA 1QOZA 4DJAA 3E9NA 3EIFA 1JHQA 3R6LA 2B8WA 3ORSA 4IHAA 4AK9A 1W87A 2GYVA 1I2MA 1T1RA 2RAVA 3AONB 1NTRA 3L06A 4YECA 1IY9A 4QJ4A 2ZRGA 1L8AA 2N9UA 3HX0A 1H0HA 3I9JA 2J6SA 1WPGA 2IUFA 3E7WA 3LPDA 3O8DA 3PLNA 4O4LB 1RLMA 3CEMA 3RGWS 3CR3C 5F3WB 2G7ZA 3AHGA 3MMXA 5BW4A 1HH4A 2R5WA 1BMDA 4ILEA 3OQVA 4IIFA 1KORA 1O9HA 3I4CA 4EY7A 1KEWA 3C1AA 4YFKA 2I66A 4A6DA 3I83A 1RKQA 1SCQA 4HZUA 3FUXA 5DN6A 3W04A 3FIJA 5L4NA 3STTA 5TY0A 1YZKA 1Y4DE 1QYCA 1MB3A 1P73A 4JVMA 5J2KA 1JEOA 2ZBUA 5H82A 4LDRA 2AFIA 5BW8A 3TSOA 3KOWA 2VXBA 4EF4A 3RR7A 1X74A 1H2YA 1TCUA 1O95C 1PVDA 2QN2A 4O3QA 2BBTA 4TKZA 1JQAA 3RUDA 1WUIS 5B2EA 2EL9A 5JQWA 3UB4A 5I51A 1LDYA 1KO1A 3EIUA 4ARCA 4LHEA 1UFKA 5JROA 2VN8A 1P33A 3B3AA 1TCBA 4JMLA 1F20A 3UWSA 2I62A 3V80A 4ED6A 4YXWA 3WQBA 1F2TB 1FDSA 3LKBA 4NOLA 3B3FA 4Q3BA 4RC9A 3H8JA 3NNDA 5ECYA 1OFUX 2P66A 3I8XA 3K4QA 4KQGA 5ILGA 1ULZA 2RGYA 3ZW7A 4HZIA 4UU7A 2Z8XA 2BDTA 3MK31 3NG1A 4MJXA 4DILA 5BSKA 2VRNA 2VQ3A 3IUJA 4K9QA 3CUWA 4EI2A 1HEUA 2H1OA 3O8LA 2GBGA 3GEHA 4FJ1A 4L3VA 4MZXA 3V7WA 1NDUA 4YRGA 4WVFA 3FPSA 1U3UA 2CN1A 5TMEA 1BPXA 5K3BA 1I9CA 2C5SA 1EGVB 1IAQA 1JV2B 1RYFA 3EDOA 1ODTC 2ZE6A 5AICA 3LUCA 4YN4A 4I9FA 4I8DA 2WE8A 4EMUA 5HRCA 4OUKX 4EG3A 2XMCA 5JECA 1WZEA 3DBLA 4OXYA 1E5VA 2G77B 1Q14A 3EVFA 4KQKA 4XFJA 1L4KA 1WF6A 1Z5VA 5ERGB 5I3CA 2H48A 1IY0A 4GXRA 2Z8ZA 3AP2A 1TA0A 3O73A 1ZYQA 3PT5A 2FPPB 2IEAA 4XFKA 4IWXA 5DN9A 2O3TA 1CUGA 2IYVA 2OBFA 1F4PA 1VKOA 2W2VA 3H05A 3IQDB 4PRYA 2EKPA 5TQJA 5C7OO 3MBYA 3IODA 3MRTA 2BHNA 1YOVB 2HVHA 1CZKA 3H4MA 3I9KA 4GP6A 4QEKA 1KE2A 1WWKA 1GNRA 5I7WA 1TW2A 2BLNA 3DOHA 4MDFA 2P9GA 2Q5IA 3A4MA 1RKBA 3I9FA 3JVIA 4ML3A 4TRMA 5K51A 1MOZA 5KSYA 3COSA 3LL4A 1E6LA 2BCGY 2ZITA 4YK7A 4KAJA 2OAGA 4CETA 4O08A 4F3NA 2VJBA 3EVZA 2PQ2A 3HI6A 5THQA 2QJRA 4YCAA 3MT0A 2X6QA 3B48A 4C7OB 4FDAA 2VP6A 4M7RA 1PTJA 7ICGA 3K92A 3JZMA 5JSKA 4QATA 3WTCA 2O0HA 3CZPA 1MC1A 3JCZA 1GHTA 2BZGA 2IU6A 2FMFA 2H3ZA 4QWCA 2HJGA 2WYIA 5A4KA 4ED7A 2W3SA 3PR3A 3TPCA 4RQ1A 3UMRA 1Q7EA 3V2UA 2YHAA 3K1TA 4PBSA 2YYZA 2TMKA 1AQNA 1JHAA 4PC2A 1UA1A 3I04M 4DQQA 1COKA 1XZPA 2Q9BA 4FEYA 4QEZA 4LI3X 2KHZA 4LJKA 4CIBA 4C0ZA 3NCTA 4U7DA 2R6FA 2ZRQA 5ALZA 2PUCA 2AW5A 4HEHA 1CIPA 2IPNA 5TPWB 1GJRA 2MSKA 4Q3CA 3WIUA 1Y89A 2P6PA 5COAA 5BXYA 5EMMA 3ZWNA 1KF0A 5E2BA 1R6AA 4LZJA 3DZ8A 1C80A 1QG0A 3VYWA 2HOQA 5LDDC 4LC9A 4JJIA 1FSFA 1MKYA 3OIYA 5FL3A 1WABA 4C4PA 1QP4A 1IV8A 2DYKA 1L5KA 5DW3A 4LX8A 3TL3A 1JVBA 1RC1A 2BOVA 4JNKA 5JZ9A 2I9KA 3BD6A 3V1KA 3K9GA 4PANA 5KFEA 2YV4A 3DEIA 4L1KA 1XMJA 1U7WA 2RG7A 4XZ3A 3EFBA 5F2OA 1T2NA 4RYDA 4EGAA 1R50A 1RRKA 4D8UA 3W1EA 3G7UA 3MTEA 3UAWA 6CHYA 1J9ZA 2EFGA 3OO1A 5DP2A 4MP3A 2Q5FA 2W90A 2BAGA 3M82A 2G80A 3LYUA 4UQOA 3I1IA 5KFVA 4BNFA 2YNMD 2C7BA 2IT1A 2M2IA 3FVWA 1CY8A 2QRUA 4FCCA 4D3ZA 4K26A 3KZKA 3VFDA 5BVGA 4U4AA 4Z2YA 3ABRB 4INPA 3COYA 4RA9A 4RQBA 5IM5A 1J1UA 5J5AA 4X65B 4MV6A 4NYIR 4Z3DA 1N48A 1T6YA 1WXEA 4YUWA 4PY2A 2IVFA 1FX1A 2NUTB 2FG5A 4HDSA 1BS9A 4UAJA 1PWZA 2ODEA 3KBOA 2RB4A 4XVCA 5DYWA 3D7LA 3VU1A 3OZIA 4LYGA 1IQPA 4WK2B 4JWNA 2XB4A 1NM5C 4EZEA 1UJCA 3ZCQA 2R4TA 4OJKA 4JB3A 1X9MA 3C85A 2GAFA 1WUTA 1D4ZA 1TUGA 2QE7D 1C9JA 4OOFA 3THOA 4KXYA 1RPLA 1E2FA 1EXMA 3HFRA 1UBGA 1G3IA 5CYGA 4NLLA 4N1AA 4Y2RA 4I4CA 4KFSA 2CBXA 3FSJX 5G1PA 3DQZA 1M2FA 4LF9B 4P0QB 1F5SA 3WGVA 1NMQA 3UM9A 3WA6A 3RH6A 2O5VA 4Y8VA 1WB5A 4BJ5A 4DEXA 2H3EA 4PLPA 3V9AA 4XUGB 2NXCA 4RCZA 4IEEA 4D0SA 2D06A 1CUEA 4TYNA 4LZNA 3LQRA 1VZ2A 3AIOA 2NZUG 1K0FA 3BWDD 3OA2A 4D57A 3N2KB 4ZZ0A 1TJ3A 1WUHS 2GPYA 4G36A 3EFOB 2ZRJA 4TV9A 1V4BA 4QDOA 4YYEA 3CRXA 1FYEA 3ITEA 2HBQA 3LVBA 4S2EA 3SR4A 1T34A 4QNLA 3UXMA 3FZYA 1NF9A 4C8MA 2QY6A 3CGGA 2Q1YA 3OOJA 3QOYA 5JE8A 5KB3A 4CQMB 5LR6A 3B1KA 5ALGA 2VYVA 1UDXA 2D7JA 4IR9A 2HBKA 2ZI7A 3M34A 4QPPA 5JZBA 5MF6A 4J9SA 5DKFA 3RAXA 3J7TA 2HNKA 5COQA 1JLHA 3I45A 5ALIA 1GUBA 2H1CA 3VNBA 5FWNA 1INLA 1CC1S 3IEUA 4AS2A 3IJ5A 3ZVNA 4DFKA 1RRGA 2QN7A 2WLTA 2R1VA 3KQOA 4GC9A 4OGKA 4TLCA 4KO4S 4RF5A 4KPFC 5GGYA 3HJUA 1KO8A 4HLQB 1T36A 2A30A 5JUWA 3I53A 2P27A 1C5KA 2VHJA 3JR3A 1YU6A 4P6VF 3AU6A 3B6JA 3BTUA 1C50A 1IBKB 3BMQA 5KG6A 3FGNA 2HPZA 5ED0A 4I4TB 5L1KA 4R8LA 3OZUA 4DNQA 4TQAA 3OX4A 2QARB 1HUZA 2I22A 2NU7A 4MQBA 2OXTA 4JI3B 4QZCA 1E7YA 4WN9B 3RU9A 1P2GA 4F4HA 3NP7A 2N1MA 1QO0A 2QN6A 4CT5A 2FSVA 3L7NA 3NVWA 4LMRA 5A04A 5B5SA 1QF6A 1RBYA 4HYEA 4HNGA 2JIBA 3L43A 1U4BA 5DQIA 1VI2A 1Z83A 1EESA 2F67A 2GOLA 4OHKA 2P9YA 5JJIA 3U9SA 2OAP1 4DFMA 3UYKA 4DSTA 1R3DA 1A2OA 3BUSA 1SQFA 3B1YA 3EZNA 2ADMA 4ZAYA 1YASA 3PEUA 1VCIA 3W2HA 5IIKA 4YMGA 1GCAA 3N59A 4BO9A 1DC3A 2SNIE 2XBUA 1GN8A 1CUCA 2DZDA 4P3NA 3VPGA 1KZ6A 3IQGX 2H7XA 4C22A 4Q7QA 2UZ4A 3MLEA 4W8GA 2FF5A 3D1JA 3VHQA 4ZEVA 3LT1A 2G5GX 4HJXA 4YCXA 2I1VB 3E6AA 3VU9A 3WADA 1A2BA 2VHZA 4H1UA 4FYHA 5B30A 5BR4A 1H4QA 2J3IA 4YUXA 2QYHA 3NR2A 3TQTA 4ZVKA 4KN4A 2J3LA 1PW7A 4TGLA 1H2HA 1ZC4A 5L53A 1XRPA 3A1FA 1K2WA 1KZYC 1N9GA 2O2CA 3QP9A 1ONBA 4PRLA 2HF9A 4FVTA 2CE7A 3RFTA 1AKVA 5JPDA 1WNTA 3WISA 4ERXA 1XNRB 3G8DA 3MMNA 3OMLA 1HTTA 3IMKA 1X7HA 1W5SA 4HRAA 4MUYA 4OFBA 4XASA 3SF8A 4KLEA 5DHUA 5AW4A 3GAAA 3PFIA 4U2GA 5DQGA 3A3OA 5EWMA 2PMCA 5K8CA 1OB5A 2XA9A 1PN3A 1YA8A 4J1SA 1DAEA 4ED3A 2VPWA 4IDFA 4KYTA 5ICSA 4F56A 2VJAA 2ODQA 4TLBA 2R7AA 4OP2A 5L7YA 1GTMA 1YSCA 3IHLA 4MV4A 3UGQA 4AJ2A 5FLXA 3TRDA 2GN1A 2WM3A 5HF6A 2HT1A 4PO1A 2J0SA 1PQWA 2IE0A 3ESZA 2RGNC 1GTVA 3RIGA 3DT6A 2Q6KA 1WG8A 3ZKWA 2VF5X 4F6RA 2WP0A 4H2DA 5KVQA 3UAYA 2IUYA 2HCFA 3DAYA 1NXXA 3SC2A 3L8GA 1SMKA 4RYLA 1JKJB 5IASA 2E9SA 3IUNA 4K3UA 3WLAA 5DLDA 4EQZA 1E61A 3HCDA 3TSZA 4FO6A 4KXWA 3QEBZ 1SWVA 3LQKA 1T2CA 1AGNA 4X1YB 3IILA 3FMVA 3SD7A 1LRKA 1RXUA 4EFDA 4DRZA 2AGVA 1V4VA 1YS6A 5IJ9B 3DM9B 4RKWA 5GTHU 1N3LA 4IUCS 3ZHVA 2WFLB 3IBGA 4RVOA 4ACBA 4P7GA 5IHPA 1AK9A 2JRCA 2RGUA 1B0AA 4I28A 1WQ4A 3IPYA 3PSAA 6ABPA 5E1MA 3AI1A 4EARA 3BMXA 2OKCA 1W73A 4BFLA 3U80A 5FUMA 1Q6YA 4D46A 4HWOA 1KEPA 3D3NA 3R09A 2H7CA 4OXNA 2FMQA 2E6KA 2GB4A 4WD3A 5GPBA 2XCRB 4I7EA 4WEQA 1G6Q1 3GLFB 4HFJA 1ZGZA 3LBIA 3SN6A 4IHJA 4WXMA 2G17A 4E5VA 2FWIA 2JGMA 3DV2A 5J8YC 1A50B 1HC7A 1E4EA 3NAZA 1QYIA 3V8NA 2AFVA 2QG4A 1DOAA 3MBIA 4PZYA 3PXGA 2Z57A 3P0RA 4MUEA 3UG7A 3Q3EA 5HF5A 5FTNA 2P68A 1RVV1 4R68A 4JQSA 5BSMA 3ITNA 4ECZA 2ZRCA 2VPTA 1DQNA 2B7LA 5JS6A 4UB2A 3ELYA 2E55A 4QG7A 1JHDA 4LBVA 5CT6A 1ODFA 1GU7A 3D4LA 1HDIA 2BFFA 2GQ0A 2WICA 1RWWA 2H1WA 5LB4A 3U3DA 2VQDA 8ICIA 3JXEA 3L02A 2FW8A 1N7HA 3LBYA 3MQ2A 4K9NA 4OB7A 3D0RA 1XKQA 1NN1A 2PRIA 4B75A 2F8KA 1CE8B 821PA 2NMVA 1XRQA 5JS1A 2FPRA 1NLFA 4G8BA 1RMQA 5D2CA 4P2GA 2LR0A 2XB8A 4D80A 1I6LA 4C08A 1P0QA 3O21A 1A72A 1PL0A 5ALMA 4ENSA 4ND5A 3O84A 2IH5A 3VI3B 3DAGA 1UHUA 5J40A 3U17A 1WQ3A 2FUKA 2BGWA 4XQ0A 5CX1B 1TAGA 1GFSA 1MQ9A 1N8SA 2MSDB 1GPDG 3HL4A 4HDAA 1EINA 1V45E 1Z6AA 3CNOA 3MUFA 3PFBA 2Y2VA 1M34E 4HPJB 2R2AA 3I39X 4ZT3A 1ZGCA 2QRNA 3B6KA 2Y9UA 4X94A 4C29A 5ITZA 3FKSA 2FEPA 3DQQA 4G0WA 1K7SN 5IAAA 1KFSA 1TM5E 1DKRA 5D87A 1HBJA 1Y3HA 1ADYA 2IXAA 3FHOA 1Z2CA 2QT9A 2VJMA 2YJZA 3P2MA 1PT7A 5FOVA 3UJNA 3FNHA 3QEKA 1Q92A 2FMSA 3PV0A 4M1SA 1XHEA 4CU2A 5IKEA 2DEUA 2QX4A 1QHHA 5CCXA 3A1SA 1HL3A 4F5EA 2R86A 1VL1A 1NUTA 1RZUA 4PNPA 2BFAA 5B36A 1BO6A 3GFRA 1R0ZA 1EXVA 3TW8A 4YGXB 4QZHA 5JXHA 1ZQPA 3IPLA 4R3NA 1H3EA 4OL0A 5FPKA 3RVSA 3EGDB 1NLZA 4V0OA 2KNJA 3UFXB 3TCXB 3BGIA 3DEYX 2R1TA 3QPWA 4F1KA 2NYRA 2JLZA 3IIEA 1WDKA 2EFDB 4BNDA 3HM2A 4I4TA 5GTIU 4V0SA 2QORA 5CLIA 5JZVA 1JFLA 2EF1A 4B3DA 5FR1A 2VJ5A 3B6EA 1FX0A 1D07A 1LC0A 2JBAB 5JVDA 4D9BA 4DIEA 1WL8A 4FMDF 1UAYA 4NDAA 1UIMA 4TLEA 4UNQA 3H1EA 4NZMA 1Q7GA 2OMEA 1V97A 4TUYA 3WHLA 1WLYA 1PG0A 4D9FA 4IXNA 1LLUA 1XNQB 1CYEA 1PZFA 3RODA 1G60A 2TECE 3GVIA 5D86A 4O1IA 3OPXA 5J2UA 1LJUA 2PMZC 8ICPA 1GUZA 4D98A 4JFAA 2A1UA 1XDDA 3ZCUA 1LDEA 2ILVA 5HS6A 3R9XB 4ZDIA 4F97A 4YAJA 4KP7A 4N7MA 3NAGA 4CNBA 4HN9A 1YCFA 4OG2A 3IJEB 3UGJA 5L7WA 3LI2A 1TM4E 3GT7A 4D45A 2Q3DA 4PGMA 3D0KA 1ZOSA 2ERCA 4M0UA 8ICXA 4KK3A 2YB4A 4CKBB 1YXMA 2V54A 5AO9A 3VUEA 3FOAA 4NC9A 2V4UA 3UTCA 3M3DA 1J09A 3MGCA 3RKRA 1VA4A 1DCTA 1MX3A 3A3NA 3ZE7A 4YRFA 4J9PA 3LV8A 3MILA 2Q3EA 4RS3A 3SFVA 5IT0A 1UPXA 1N9ZA 2ID7A 3T0IA 3HU1A 4TMFA 5LQNA 1R5OA 2W2LD 1KVSA 4CV3A 4UBKA 4B4OA 2ZYTX 3ND6A 1O3YA 3ZJ4A 2IEIA 1ZXLA 3SHFA 4YAUA 4FOTA 3WI7A 1DFHA 5LYJA 2ISSD 3R20A 3GZNA 1VE7A 2PZ8A 4B7XA 4UBIA 3LOPA 4C7VA 3OQ6A 5BN4B 3U56A 5FUVA 2DPIA 1G66A 5DV9A 2YZNA 4Z0NA 1AA6A 3KSAC 1MOPA 1ECWA 2XB6A 4ZJUA 1PZGA 2C4NA 5ENZA 5L4LA 1CK4A 3QEAZ 1B00A 1Z19A 2IOFA 1Z8DA 4M76B 1GG5A 4RZUA 5J63A 1QE0A 3HFJA 3R6WA 4HGRA 4G1FA 4I4LA 4BAGA 3DZIA 5KUTA 2NO0A 8ICZA 3C4VA 3JPYA 3L8MA 4YY3B 1Q74A 4Q1VA 3ZWYA 3T1NA 5DM1A 1NSTA 3FWPA 3ZNOA 4PQYA 1HXHA 1JXMA 1V35A 3TLBA 4CHGA 3I9V1 3ZE9A 1KKLA 2ATCA 2FWAA 3F96A 2L69A 4ZN6A 4ZOQI 1JXQA 1H4SA 2ACKA 2KMLA 3UPDA 5JANA 4KX3A 3JD4A 2FLVA 3S40A 2NZJA 1P9NA 3A8TA 1A77A 3USES 4OKNA 2LDXA 3HPOA 1CULC 3JAKB 3ANMA 4C0SA 2AF3C 4HNVA 3AEVA 3VPBA 1P6UA 3ILHA 4KR6A 1YZ7A 4NH4A 1KHHA 3VO1A 7YASA 3W7VA 3O9ZA 4QTZA 1ZCJA 3RANA 4DIBA 1FPQA 4UMFA 3JWEA 1WDTA 1PV4A 1QK5A 3QKSA 3F78A 1EDOA 2WE7A 3TVYA 1M6VB 4UCQA 4J0QA 3SYTA 4ZYLA 5JR3A 1Q0QA 4NTZA 5T6BA 2X8BA 3H0LB 4IFEA 4TMXA 4UUQA 1KMIY 5CRXA 3B9JA 2JLQA 1JDSA 4C6TA 5EJ6A 2B8JA 1KRHA 1LZLA 4BNDB 3UQZA 3VKVA 5J43A 3GT3A 1XQ1A 3R3YA 1GO3F 3L4PA 1CB7A 3O83A 3OZGA 5TPWA 1PJ8A 3LP5A 1M8FA 1G5PA 4CQLA 4PH5A 4WAUA 1U7PA 3T5LA 3IVGA 2VJQA 2ZYGA 2GO1A 5FFFA 2GESA 2DPYA 1SGGA 4JUAA 3W6OA 3ISTA 1OAKA 5GGXA 1DKOA 1RDFA 4O3PA 1ZITA 5K03A 3FH0A 3EXFA 4C78A 2OECA 2J4FA 5ALYA 2KIWA 2NU9A 3NS1A 2RGCA 2P9EA 1NC3A 3TW6A 4HEA1 2Z2YA 5AJTA 2A86A 3ETHA 4ZVUA 4KLRA 4EJ0A 5BMVA 1MA0A 2PSFA 2O8VA 2DHEA 2RJ3A 4ZHQF 3TKAA 4DLEA 2DHDA 4J9LA 2ZEJA 1WB9A 5CWRA 1CLUA 4MKXA 1E2MA 3BK1A 4CM7A 2XVZA 1A2QA 3ENWA 3KKZA 3Q2OA 4JT2A 3JQBA 4CJXA 2BCSA 2HN9A 2MMGA 1KAMA 4BHTA 2Z9CA 3QIVA 3RM3A 3KCQA 2FI1A 1PR1A 4FOLA 5JBIA 4ID3A 2OVFA 4K2AA 3U7FB 1P9WA 1E9VA 1PJSA 1ZNXA 2GWRA 3DDSA 5BN3A 4KQHA 1TQDA 5F5LA 5F9LA 4PHEA 1HLPA 2UUOA 3FFBA 4LQ4A 1OVGA 2AJBA 2VUUA 4PLHA 4RIEA 4YBRA 4I9HA 5CAEB 1U3FA 1YS9A 4DCUA 4OJMX 5CH5A 2V3CC 3WO0A 1KDPA 5EZQA 1SVIA 2B8NA 1BOFA 4LE1A 3ZD7A 3KZIU 4HFMA 1OAOC 4HDQB 3BDAA 3SAGA 4UNRA 4TOIA 3ED1A 5KL1B 1CHDA 4DLWA 5BWLA 4TUSA 1MQAA 2W55A 2D7CA 2HCTA 4OXIA 4YDSA 4CLOB 3JQEA 4EHDA 3V6HA 2JI4A 1JLKA 3ORRA 3Q72A 4TUPA 4DSNA 5C8YA 1R0LA 2FPIA 1DIGA 3A3YA 4IJUA 2OCBA 2G82A 3VCBA 4Z86A 4NJEA 3IKTA 1E18A 3SAHA 3KCNA 3QMVA 3T1QA 3HRKA 4AS3A 2YYSA 1OA1A 2EKLA 4K3VA 4MUGA 4ZI7A 1V38A 1JMYA 1YAJA 4QIWF 2HRBA 3SS9X 2MSEB 5JH7F 2VJ4A 1Z0SA 5KCMA 1ENZA 5C34B 4FBGA 2P2LA 4IL6U 4RIFA 2BKAA 3TMAA 1A04A 4L73A 3K1RB 4JB8A 3JQFC 5DTIA 3W79A 2W37A 2WG1A 5J2IA 2E5WA 3NBUA 4LHXA 5ELLA 1L4LA 4LJ7A 5CDFA 5HIAA 1DJNA 3G23A 4J0JA 1W4CA 5JNLA 3Q5EA 1YL7A 3P9XA 4TTIA 1AKRA 2Z4RA 3I5MA 4K1LA 2IIQA 4DM7A 1UBTS 3TCNA 5BQFA 1MVLA 1FRZA 2RHWA 3C3JA 5FPTA 2PPVA 1WAMA 2AQHA 1YJQA 2ZQ5A 3JRNA 3OPYA 4Q1EA 2B0JA 1UBKS 4CM3A 2R6HA 2WIGA 2IX3A 4B46A 2JCSA 3NBZC 4OQXA 3BL5A 2NT4A 3RTVA 4M9RA 1KOLA 4YXJA 2FP4A 3TZLA 5EE9A 4BB0A 3FNRA 4YD1A 2E1FA 3IEPA 3RABA 1NAHA 4ABYA 8ATCA 3OKCA 3L5KA 5LIRA 3OE7A 2WWYA 1HT1E 5FWXA 1X8XA 4A15A 4GPAA 1X8KA 4TWBA 4Z2AA 1PT6A 1TTPB 3PQ7A 1J5XA 3AVVA 5AVOA 1PBNA 4L78A 3OZCA 2XGGA 4CV0A 4RZ2A 1BH2A 1KZ4A 1S2LA 3FGZA 2FRXA 9ICEA 2JRLA 1D8LA 4YN3A 4XLZA 4E3WA 2EJCA 4P53A 3RC9A 4J75A 1LBEA 3HN2A 4PZOA 2WHYA 3I52A 2BCUA 4LZLA 4X63A 1IQUA 5F1YA 2Z56A 2YUIA 2QRJA 3M6FA 3P97A 4F5QA 2EJBA 4FC6A 4ZAVA 4BGVA 1M6WA 2INGX 3TKLA 2H3QA 5FRDA 4M1ZA 5A0FA 4B45A 3EH2A 5CHEA 3D7RA 3SFZA 4MP6A 4E2ZA 4FLFA 2X6RA 2F2TA 3PC2A 3RSZA 3TUIC 5KSOA 1Q7RA 1NV9A 1MIHA 1Z13A 2OUIA 3DVRX 4J3JA 4GP9A 1C7YA 13PKA 1XD2A 3BDVA 1WB4A 3IP9A 3NDRA 3Q41A 4G0XA 1T3LA 4R6WA 4TVSA 4AN0A 2ECPA 3ER8A 4UU0A 4ZJZA 2C5HA 1MOSA 1GZDA 2IYLD 2GH1A 3EDQA 3CT6A 4CR8A 4UATA 4DMMA 3EDCA 4CEJA 3KHRA 3LZCA 1G4UR 2DU8A 4HTFB 5DM2A 3RR2A 1GUDA 4ND3A 4OCZA 1C0EA 5D1HA 1RAGA 4C7BA 4HB0A 4MTCA 1OLSA 1Z39A 3BS7A 1ZWKA 1UMDB 3T3MB 3GVCA 3ORFA 3ZPXA 3SEFA 3FRJA 3G1WA 1J5EB 1HG0A 2N1RA 2R87A 1N0IA 3ZXUB 5HVNA 2ZXIA 1R6UA 2ZSHA 2FN7A 1E1RD 1KJZA 3GY0A 1U98A 1KZGB 3KJNA 2VBFA 4LECA 1F9AA 4XVHA 3USCS 4KIWA 4UARA 1Q3TA 4ZEXA 3RVBA 4B8ZA 4LZGA 3L9WA 2AT1A 4ZI7F 1Y8QA 3RE1A 4DV0B 4WQMA 4L6CA 4WSOA 1T9ZA 4D79A 1C9DB 4N0PA 2V3WA 2G88A 4BATA 2XAUA 4Y7CA 3O47A 3R6DA 4MK4A 2DHQA 4XX0A 2Q3BA 4QUBA 1EQUA 1V6CA 2FR8A 5FI3A 4TV9B 5DPMA 2ZRHA 1T4GA 4KR2A 1V7PC 4ZV4A 1E2GA 1IHUA 5FNVF 1SKSA 1ZQ1A 3U48A 4QOGA 2YZGA 1DPGA 4KR9A 2R6DA 1TC1A 1K75A 3NHWA 5FTWA 1TECE 4B3GA 5DULA 1SU4A 2QJWA 1NUUA 2W6PA 3M89A 1SKWA 5REQA 5B1EA 5HOQA 1CETA 3F7NA 1BHO1 3DMHA 5HF9A 3X1XA 4UCFA 3PDIB 4NCIA 1K2VN 3OIVA 3PRJA 3SYKA 5KIAA 3JQQA 5IAEA 3LY5A 4GD3Q 2W2QA 2HUNA 5KMGA 3IERA 1YQUA 2YV5A 4K0KB 2G09A 5JASA 9ICUA 4NYMR 2GAIA 4H3KB 2AUMA 4MQ4A 1MGPA 4TTSA 1QIEA 1YT5A 3P0JA 3QEOA 3PC7A 1X14A 4YR0A 1NHGA 3WFZA 5JADA 2H51A 2VVTA 4MFFA 5AI9A 5LQJA 1WX1A 3DHVA 3QLVC 3R23A 4CT4B 3HHEA 3JSAA 1LLFA 3OZAA 2OYRA 3SDBA 3NH9A 4BNNA 5A7HA 4B9UA 2YNMC 3K6JA 3HZZA 2BFCB 3EAFA 1QCDA 1DGSA 5H5JA 3VR5D 3BCHA 5I8WA 1VSUA 2WD7A 1E1QD 1LH0A 1X94A 2X8WA 2G28A 4N3GA 3ICWA 3KRTA 1X92A 3GH1A 3L1HA 1GUFA 1L4GA 3IG8A 8ICQA 1EFLA 3NTRA 1U3VA 2W9XA 5AJWA 3RAFC 4BX9A 4KREA 2PKWA 4IFTA 4C2TA 2H29A 3PUWA 4IR7A 4F3KA 3EASA 4KBGA 4EPRA 4LY0A 5KQRA 4JUDX 4NAVA 2YVAA 4ZVRA 4ZCSA 1D5WA 4CM9D 3UF0A 4DT1B 1JR6A 3JZIA 4DF8A 1KERA 2OLJA 1EKXA 3JQRA 1NVFA 1ZK3A 2ZCVA 1GSAA 3WRWA 4R2JA 4N76A 3FXAA 3BJIC 2HU5A 5SZIA 4RTKA 2JZCA 3EODA 1KFDA 1SG9A 3CRMA 1JEQB 4FIZA 1M8JA 3NVYA 2AJQA 1RHMA 4J1TA 4WBNF 2R60A 5C8DA 3NCHA 4NE2A 1A8UA 5GJVC 2XGPA 4NLKA 5KFBA 4G2NA 5ALXA 4RENA 3OPVA 4MKFA 4ZRMA 5JFTA 2W6QA 4QUGA 3IMCA 1KY3A 2A4KA 2W6ZA 3TR6A 4CRXA 1W0JA 1Y9JA 5J58A 2ZUBA 1IK6A 3K6KA 5A0TA 1XU7A 2XF2A 3DEFA 5G40A 2Y1XA 3TEFA 3O5AA 1B26A 2JDIA 4RF4A 3STXA 4HDNB 2WTAA 3O1HB 4I2DA 4DANA 1D2AA 1T1IA 3HBLA 4F2WA 3PDJA 1L5ZA 4KVZA 1ZK4A 2BR3A 3RQIA 1ECJA 2Y1EA 4FZRA 1L5YA 4DIUA 4NXNB 4FE3A 1FMLA 2VRCD 4B2PA 4G07A 4BGEA 5C4IA 1R4NB 4NMLA 5TLSA 1G59A 3SP1A 1F44A 4HWGA 1WTCA 4GVXA 5A6SA 2BGJA 2C5BA 4G4IA 3RSQA 1GPH1 3WX0A 4BFXA 2V96A 4I5GA 1E5XA 2YHIA 3FPBA 3ZHQA 1Z2OX 4X7MA 1M2VA 1DGQA 2R6GA 1XC7A 4GXIA 4I2IA 3JQ8B 1JRPA 1J70A 3F74A 3NWOA 4HTFA 4QGBA 4EITA 4F6CA 1IXSB 2A9QA 4UHCA 3ISJA 2VSNA 3LBHA 1WP9A 4FHGA 1OVMA 2IYPA 2J3HA 4J2TA 5E2IA 3VVLA 3AUOA 4CUJA 1JH9A 2B36A 3OGUA 2QL7A 1UMKA 4CTMA 4ZYVA 5BNTA 1OBVA 1Y6JA 4WESB 2V7TA 2LHTA 5KFDA 1WUKS 3MTAA 1K7CA 2WKWA 2D00A 4S2UA 4Z0TA 3V00A 3FDIA 1T9CA 2OGUA 3U31A 3VVBA 5I7EA 2AEMA 2QVLA 3UMSA 3WSTA 1AGPA 3OEEA 5HQ3B 1GCGA 4AKTA 3DBRB 1IY8A 1X87A 1IE3A 1Y82A 4FOSA 4OBBA 3BB3A 2W4QA 5EP3A 1M6YA 4BLRA 1D2HA 1WA5A 9ATCA 3V8RA 4HWPA 3ALRA 1QGUB 1XRSB 2A67A 2B8TA 2XODA 3PNLA 3O3CA 4MW0A 1KOJA 2DCUA 5C81A 3F71A 2H4HA 1FFWA 3V3KA 2VHVA 2PIAA 2JW5A 3M4JA 3MIIA 2C3MA 4WH0A 4GXTA 1YQTA 3PU6A 1G6OA 1Z7BA 5DRTA 4I1VA 1TX4B 1DWQA 2ZT6A 3PEVA 3QOWA 3NM6B 4YWJA 4E4YA 1A8PA 4XSGA 2GWHA 2HIGA 1ZQDA 5FNZA 3IE1A 2I03A 2H54A 1MEOA 2FPOA 1E5LA 3GMTA 3L8YA 3COVA 1NHWA 2GO7A 3UYLA 1KQNA 4JNCA 1SKYB 3DOOA 4AXBA 1OMOA 3ADOA 2DR3A 2Y0SF 1MXFA 2NO1A 4JL6A 1KI6B 4RPXA 5KYGA 2HZ7A 5J0YA 9ICHA 1VZ3A 3MWEA 5BMOA 3H4BA 9ICMA 1CX9B 2X0RA 1L6NA 3KYDA 2YWJA 2D5AA 3K9CA 4MB6A 1TYDE 2J0UB 1DIHA 1PGNA 2B5WA 5K3FB 3W3AD 8ICJA 1YU9A 1ZRNA 2AI1A 1U2EA 3BZKA 1Z88A 3C5FA 4ZD6A 3W4IA 4WLEA 3WV5A 1POWA 1BCSB 1E2QA 3GU3A 1OIXA 4IGEA 2QM7A 2ODWA 2XYRA 5BNZA 1W4LA 3E15A 4RSHA 2AU0A 3D7MA 3O94A 3RVJA 3ZEAA 4PAMA 4FDLA 1MPXA 3V7UA 4YO8A 4PN7A 1SXEA 4EG6A 1ZUWA 2QTFA 5K2OA 2NLOA 2NIPA 3I64A 3O75A 1H2AS 4I4TF 4JC4A 3R5FA 4KWHA 4XQ9A 3TZEA 8ADHA 4QNMA 5E6RB 1LVHA 1UDWA 3O9MA 1UAGA 2LYHA 4ZV7A 4QD3A 5DRYA 1R64A 3TLMA 3LX8A 4A91A 4CKCA 3VAAA 1AQ6A 4O3OA 3D31A 3OAAD 2VRBA 3UV3A 1TNDA 2B1JA 4MW4A 2D3TA 2X77A 4BBPA 4YQYA 2OCKA 1G9TA 4EW3A 3FNEA 2GF2A 5HFAA 5EQDA 4RXMA 2WU4A 4LQDA 5C37A 4F3CA 4O0IA 2IYRA 2IW3A 2Q28A 1E1CA 5EWJB 4CMBA 3K2EA 4OHVA 4KHPB 5AK4A 4ZALA 1QR6A 4J03A 1YZFA 1DC4A 3TQHA 4QWDA 4H27A 2FLPA 1MUUA 3W7BA 3QPVA 1Z3CA 3OLYA 4JOCA 3UK2A 3VNQA 3VX4A 4DLSA 4IVNA 4LJSA 4OLJA 4DV6B 1CF4A 3KHSA 3VR3A 1PVRA 1T8SA 3D8UA 1ILWA 1NW4A 3HA2A 1QLJA 1HTWA 4JJKA 4LXTA 1GCIA 2IFTA 5CH3A 1T3TA 3TRHA 2JKYA 1FOEB 4JI0B 4G0VA 2D2EA 2PL1A 4UBJA 1F0KA 3HR7A 5EP2A 2C92A 1ZD4A 3FX2A 2BEWA 3NHAA 1GCUA 2HLDD 4WXYB 5DHSA 2CSXA 2J0UA 1SV0C 3PZRA 4BE7B 2ZZNA 1MH9A 4JI8B 2YR0A 5GONF 3KHLA 3P0EA 2FPMA 4EZ6A 5ALJA 5KTYA 2FSVC 5IKMA 1XJWA 4YRPA 4AMYA 5JU5A 1SQ5A 2WZCA 4NICA 2E5SA 2PO7A 4W99A 4V0MA 2GUGA 5J1TB 3L93A 4IAOA 2BGLA 1QCKA 2HQOA 1B7GO 4UQPA 2ZBPA 3N7AA 3E81A 1NVBA 2YV2A 3IQEA 4Q4JB 1GL6A 2KLHA 5IX8A 2RK4A 3ICPA 1NK8A 1LW7A 1M2NA 1UBEA 1UPUA 4Q43A 1U7HA 2CKDA 3OZEA 1RW4A 3OU7A 4YXFA 3SKXA 3V7FA 4UKDA 5I8ZA 2DC1A 4H18A 2DWQA 1JIJA 3A28A 5FPPA 3JZFA 1NYLA 1U65A 2X5JO 5EWEA 4OLAA 3OX1A 4ZQGA 5CPBA 2HCBA 1SELA 3F1KA 4XOUA 1U1GA 4R1PA 4KJZA 3C70A 4EYKA 2IHTA 3DTVA 5J1SB 3U3KA 1SOAA 1TK2A 2RHGB 4FYVA 1L7RA 4RX1A 3WBKA 4A2QA 4B2LA 4QGAA 4L27A 4C6TB 3EE6A 2WU8A 2F4VB 1OXBB 3KFVA 1CQJA 2RKOA 4WKOA 3G0DA 3OAAA 3KKQA 1H3FA 5HRUA 2IXFA 4JYZA 1X6JA 1HT3A 4YBZA 2O5CA 1BYIA 5A3SA 1OX4A 2CJPA 1HURA 2XOXA 3BXFA 4EY4A 2YDYA 3E9CA 4PHDA 4RHCA 3UOWA 2AA3A 1JKJA 3COWA 3K6SB 4X62B 5BN5B 2OH2A 2UZ1A 1YTUA 1W8DA 4JXKA 1D9FA 4AFNA 3LBFA 2PFQA 1MRNA 5CLJA 1NJ6A 2B69A 4R2LA 4TN1A 4XEHA 3CM0A 4LJ4A 2L2QA 5IYZF 2PMBA 3K0FB 2FMKA 1ONPA 3VAZA 4FMCB 1I4DD 2DLDA 3OOHA 3JX9A 2D2VA 5CIWA 1MIOB 2BONA 4QA9A 3T41A 5CD1A 1M33A 1WLSA 1NASA 1DQRA 1TJYA 1N7JA 2WJIA 1V3UA 2MYNA 4S1WA 4WW0A 1DWUA 1RS0A 3Q6NA 4F3YA 4V1CA 1STOA 1GY8A 3J81k 2GXSA 3LBAA 3QHAA 5KJ6A 1C0KA 3MWFA 3SHOA 2J07A 5CFZA 4LISA 4Q4DA 3KLOA 1JHYA 3C1ZA 4DO9A 4Q6WA 3T9EA 2NSYA 1RKUA 4CM5A 1E4OA 1Z2PX 2I8LA 3Q1LA 4HX5A 2XBLA 4BEWA 2W2KA 4Y0VA 5A9SA 2WYHA 4Q01A 4FMBB 1VPEA 2VNKA 4WLNA 1JDUA 3S2FA 1PEKE 2ID4A 3MGBA 3QE4A 2VHXA 3GT0A 3SE7A 1GR0A 3RC3A 4MDEA 2X14A 4YCMA 1WMFA 1JAYA 2BW0A 1XTZA 3KZXA 2J7PD 4OHOA 4QGFA 3O3MB 1XZBA 4ZMSA 4B3MB 2VHWA 2OTCA 3BJEA 4P98A 5BSHA 2A1TS 3GD5A 2HGZA 3ND5A 4EG4A 2DR0A 4UQLA 4IYRA 4JLPA 5JCPA 3OTWA 5KNCA 3KOZA 2P6MA 5DCWA 5ILOA 3PSPA 1U02A 2GEUA 3EH1A 4JYCA 4KI0A 2CDAA 3ZY3A 4TTTS 5AUPB 1C3XA 1OWPA 5CR0A 1T5OA 3D2CA 1CUWA 4MMXB 4N0EA 4O2BF 1XEAA 4OM7A 2CZGA 5AFSA 1M73E 3H5IA 2C95A 2AHOB 1PP4A 1QTMA 3OCYA 3V2IA 4CKZA 2C7PA 3OBBA 2YQEA 1V1MB 1X15A 3DM5A 3N6RA 2AQ4A 8ICLA 1M6NA 4ECQA 3PE3A 2O52A 3S5JA 2PY6A 2V9CA 3MFQA 4B09A 2AKEA 4IKOA 5DLFA 4UEKA 4K9RA 2FN3A 2LUOA 2JS7A 5LBUA 4E09A 1FSGA 4TT8A 5CJPA 4K6CA 1SKRA 4B6SA 2PAFA 1E2HA 3DZJA 4B9NA 1MW9X 3BDPA 5TPZD 2ZYAA 4UDXX 4GG1A 2QE6A 3NP9A 4R05A 4TL6A 4JI7B 3AR8A 3PE6A 4K9PA 3TXAA 4CKWB 3P4UA 2OO5C 3RVPA 2XVYA 3UCFA 4FKMA 4J0HA 1P6XA 3DWIA 1SXJC 3WE7A 4MUBA 4BB5A 4LJ9A 3JVDA 2LI6A 4B9MA 2XQIA 2BHRA 8ICYA 4FGKA 2PDAA 5DBHX 5E8JA 5P8WA 3RSHA 5J2TA 4L76A 1SUFA 3KKAA 2HHWA 4B9TA 1EMDA 3ZDXB 4V0NA 1Q1EA 3HV0A 3BBLA 1P3Y1 4TL8A 4XIIA 3U9LA 5ICMA 3PHGA 3TINA 3TX2A 1LTQA 4Y6LA 4MH0R 4UBCA 1QV6A 5EZ5A 3WLKX 4A2PA 1S1MA 1NRXA 2I6SA 4I5IA 3QYJA 5E3JA 5G0WA 4E15A 1NATA 2HY7A 2JGIA 3WK5A 3GRCA 3QXJA 4DR1B 1CQZA 3FAHA 1DE0A 3OPNA 3I0NA 3ZKAA 4LFCB 1G2QA 4UUPA 1S9FA 3UOAB 1N8TA 2OBMA 2Q0QA 2G1PA 1KO5A 1KYQA 1PX0A 4IF4A 4R0VA 1Z25A 4BVEA 4LYFA 4BO1A 3CO5A 2XJ9A 1QGDA 1CPYA 2YXLA 4W1QA 3WV4A 4BZPA 4KUEA 2YZKA 3T4XA 1VL8A 3B1ZA 3G8AA 4Q8EA 2OFFA 4BMZA 2BSAA 5KNLA 4TTAA 1CRPA 2JDID 3WGYA 1W96A 3RYCB 3GEEA 4DLAA 2NVOA 1GDDA 2LM1A 1NFFA 4EP1A 3B78A 3GN2A 3CG4A 5EIAA 2YHBA 4FS3A 2P11A 4O4JB 2V03A 1YDGA 2JGJA 5P21A 2PGNA 1DI0A 3W7AA 4DSFA 2GDZA 2QD3A 4DB2A 2GYYA 3AMZA 4RNDB 3FI9A 1S2MA 1YWGO 3SZUA 5A5GA 2EW8A 2RH5A 3BEOA 5HOEA 1NN5A 1J0XO 3QFFA 4DZTA 4TM7A 5FH9A 3C5VA 3LKZA 3ZGXA 1GGMA 3TLJA 3PW2A 4B31A 5AI4A 1U5CA 1C30A 3GJ3A 3SEZA 2V45A 3JD2A 2H9YA 5C7LO 4CF7A 2F8LA 1W94A 2MRLA 4RFSA 1DRGA 3KQPA 5L1MA 4ZT6A 4EDHA 4ZT5A 4QZVA 4LXUA 4R3WA 1TU0A 2Y4NA 1D1QA 2P4EA 2JBWA 2WWFA 3FDZB 5EAIA 4NM1A 1KP9A 3P1JA 4NCHA 1Y6GA 2E37A 5JQGF 3K9NA 3G17A 5K9ZA 5HFNA 3U7JA 1T43A 1NXSA 2I2DA 5IDXA 3C74A 5HRAA 5JO9A 3FI0A 4E6EA 2DFKB 1K97A 3H2JA 1NF2A 4MAAA 1QS0A 2MR5A 5DDIP 721PA 1K8YB 3E1SA 3BRSA 2VZ9A 5LC1A 5K0EA 2RDJA 1KU0A 1ULTA 4YJFB 4OJNA 4LOHA 1ZGHA 4KN7A 3P2EA 4PRKA 3WYEA 1CZNA 1ZFNA 1TZBA 3PDIA 2Q4TA 4A2WA 1PNVA 4XIFA 4AMVA 2PCJA 5M5BA 4GXKA 4ZVQA 1UZUA 3ETEA 2VP5A 3CZ4A 3K0KA 1P29A 4MS4A 3L1VA 2MSCB 1PVVA 1IG6A 1P9LA 1CF2O 3HXTA 4MAMA 5DCUA 1KOGA 7ICJA 2O7RA 4F6RB 2QT0A 4ESVA 2X9LA 5EIEA 1QG6A 3WOHA 1AMOA 3IPRA 1BROA 5FX2A 3NWEA 3IOBA 4UTRA 1XZMA 1SXPA 1R6TA 3EY4A 5IIMA 3CIFA 3LWDA 2GM9A 3RU3A 1QQBA 4RD2A 1DDIA 4E46A 2GI4A 3UAVA 3WRYC 3WLHA 1OFIA 2ZTDA 4J7AA 2QAGA 2ZTMA 1UZMA 4LNUA 2G04A 2PPLA 2K60A 4J0IA 3AIKA 3BWYA 4PO3X 2QGFA 7REQB 2CZQA 5IFLA 1GGHA 2QTVB 4GPBA 1G2OA 4C4ZA 3M5DA 1TD9A 2C0QA 2B5OA 4YJFA 1A0PA 1Z0UA 2HIHA 2X8JA 2K89A 2YCLA 1GG8A 1SCJA 2VHYA 4LMPA 3ZJYA 2O8CA 3S1AA 1FFSA 1SQGA 3BICA 1DOQA 1XDBA 2JJ1D 2ZJZA 1A69A 1T3SA 2PA3A 3ANTA 4ECRA 1N2EA 3EXFB 4DKJA 1RWQA 4NJMA 4Q6BA 1NLYA 1OXXK 3V4ZA 2P78A 3FZNA 1P72A 4DLPA 1PJZA 1UMCB 3ZW8A 5DG8A 4KBFA 1ACJA 2AV6A 4Q1CA 4ND8A 3CWZA 3N07A 1S8AA 2ODTX 4JLBA 4XAQA 5B4TA 1ZUNA 2FHSA 3CEAA 3MINB 2EWVA 4Q7LA 4Y9UA 2QGNA 3D6HA 2RI1A 4U6PA 3HG7A 4KXQA 4GQAA 4TQ9A 3C3XA 3FOEC 2JD2A 2VOJA 4DJJA 3EVBA 1ZJ6A 4JJAA 4UPDA 4QZ9A 5JIBA 2ZSFA 5DLPA 2GDJA 2IVZA 4J76A 2WQ7A 3P71T 2BRUC 1A3CA 5E8RA 1KJIA 3BH7A 1L7VC 3EQ8A 3I2KA 3BA6A 3K8OE 3PYLA 3EYWA 2L18A 1ZS9A 4MUMA 3FUVA 2W0SA 2X9QA 3HVJA 4PXYA 3ZHBA 2X5XA 5EXEA 2G1AA 1BDHA 5KZMB 1A98A 3QYPA 1BX3A 4OJLA 1S9DA 1YGPA 2VCEA 4E5YA 3TJMA 2R8YA 4RORA 4YJHA 5HCUA 3JAKA 4KHZA 2RBGA 3ZHRA 1QLNA 1V25A 2D7DA 2R4UA 4ZO4A 1KVTA 3WKDA 2WJWA 1ZNQO 2TSYB 3PVSA 4POAA 3VR4A 4WLFA 1M0SA 4CLOA 1XKLA 10MHA 1BPEA 4RQUA 4A6EA 5H2FU 3G6WA 2YRWA 3FPGA 3L7BA 4NH0A 3VKFA 1DZ3A 8ICKA 5J2JA 5A4FS 4AURA 1GNLA 2CXUA 3GQVA 4WZAE 1T3NA 1QGUA 1TZCA 2R5FA 3FF4A 4WHMA 4D6YA 1G291 1Y33E 1T7PA 4DEVA 3C16C 2WB1C 1JPUA 2H5JA 4JQOA 5IJAA 1OZGA 4CFSA 5B64A 2FX2A 4M46A 1RQNA 4KB5A 2IHJA 2ODGA 4RM2A 5JSZA 3IJPA 4X5OA 1KA9H 2IZZA 3JQGA 5ER9A 1P0MA 3IAHA 2HWWA 1Q91A 3OEHA 4OO3A 2VA9A 1Z3IX 5AI6A 5AHXA 2QNBA 5IH3A 3O7MA 3THRA 4EKIA 5FD8A 1L9KA 1U11A 3K0BA 1V6AA 4HZUB 2HCJB 4NEQA 4XX1A 4C0KA 1DNPA 2G08A 4UOEA 1Q1QA 1WD5A 3IIMA 1XJCA 3MTBA 1MORA 2C84A 2WIKA 2OMKA 4DFJA 2ZSJA 2V7GA 2XLCA 1X3SA 3DTNA 3N70A 4PHHA 4D8VA 4DCVA 5B7QA 2DFLA 1D6MA 3HA5A 3I3OA 2DWUA 3HBFA 1GPWB 2FUNB 3NGLA 3AGQA 4A10A 5FFMA 2VA2A 4BMYA 3D3QA 2D3DA 4Q9KA 4PZLA 3PR4A 3OFND 1UINA 3LCUA 5PGMA 3QX3A 2XWPA 4MWDA 1D4FA 2V4RA 2CK3D 1TK3A 3DEJA 4CHTA 2HW3A 4F3RA 3UPQA 2C5AA 2OFPA 5T3UA 4WI1A 1NZDA 3Q5DA 4JB0A 4WNAB 1J2UA 3VR0A 5FBHA 3R9WA 2Q7XA 1NVTA 3KT6A 3G82C 5CT8A 3IBFA 4EHAA 1NE7A 1NMXA 4GR9A 4JKIA 3D3JA 4IIYA 5EJ9A 1ZQVA 5EOZA 1JHUA 2JAQA 2IBSA 1CTQA 3NIDB 2G9ZA 4QYMA 3R0JA 2CT8A 1I33A 4V0KA 3KO8A 3IE2A 1M6HA 2A1UB 3PCTA 1TM2A 3TDKA 3UHOA 1W36D 5DNAA 3DTYA 2QK4A 1YMQA 1N0UA 2DF8A 3WLIA 3CSDA 4W4TA 4OLHA 4Z4GA 1A76A 4J6FA 4RKEA 3K2BA 1QTNA 2DJIA 4TKUB 2EVWX 3GNQA 5IXYA 4NEHB 1KYZA 4IILA 5KAFU 3PVXA 4XB6B 3GUYA 4US0R 2P40A 4DXHA 1FMJA 2NVUA 2XTJA 4ZAFA 1RJEA 2WT9A 1VE1A 4EW6A 2FEOA 5BR8B 3KBBA 4NAUA 1NK0A 3WSVA 4DT1A 4M6WB 1J0EA 1ZGBA 2G4LA 1Z0JA 2OBBA 2QMZA 3EC7A 1KXJA 2NZ8A 1EGAA 4PNZA 4A8HA 3C2LA 2HW8A 1RD4A 2JR5A 1O94A 1SURA 1W49A 3LCJA 2F1RA 1B73A 3I09A 4AS1A 1HDEA 4AG5A 1PUJA 1L3CA 3R0IA 3NUGA 4F4FA 3L6EA 1EQ2A 2XXBA 2BFCA 4DY6A 1H2BA 4W8OA 5JDCA 3UGKA 3RT7A 3OO0A 3U39A 1CEEA 1J2EA 1VDZA 2JJQA 5JY1A 2EAPA 2CJYA 2W6MA 4BQPA 5MN5A 4Q3DA 2BTQA 2BZ0A 2AG5A 2RB5A 1OWOA 1N0WA 1EFKA 2PMWB 2Z58A 3IS3A 3H99A 3R6TA 4MRMB 4NS1A 4PCAA 4YFYA 1J8FA 3KVYA 4L7VA 1V3TA 3M0EA 4TYPA 2F17A 1B3BA 1NBHA 4FE7A 4L02A 4MUHA 4TV9F 5TB5A 4IF6A 4HGYA 3WGHA 2NZYA 3JYNA 2K8CB 1SXJE 1KJQA 2Q3LA 2V7QD 3M2TA 4H17A 3OTOB 3SIXA 2VT3A 1U0BB 5AW5A 2ZPUA 1SQ6A 2PUVA 4ZMRA 1XEWY 3ORHA 3EQ7A 2GJ4A 4HV4A 4H6VA 3SZOA 2XZTA 3MS2A 4BVLA 2ZB2A 4Z4CA 3KE9A 4DV7B 2KJ5A 4EYQA 2PFOA 4XR4A 1G6KA 1NVMB 4XYEA 4PPGA 4EBEA 2QUAA 5EUMA 3VNVA 3SNKA 1QG4A 2R62A 1BNOA 2WTMA 4QYXA 1VTKA 4U39A 4US1R 4X7PA 1JN3A 2OZEA 5CB4A 1P7VA 4DB4A 2IS2A 1CVLA 3OMXA 4R2MA 5HUQA 4EHLA 1DTSA 3GBSA 4OFZA 1MDBA 4RMHA 5DBGA 2VZEA 4ZODA 3R7LA 4GZ3A 1NR1A 3IVAA 4NZPA 3TUZC 1S3FA 3LD9A 1WXIA 2C88A 4Y1GA 4US2R 3K31A 2ZJ3A 3IUBA 3KZVA 4CV2A 3HJFA 2WMNB 4DEZA 3N2KA 4B6RA 4C7JA 4MKRA 2V3VA 1A5BB 5JV5A 4OJ5A 2B1RA 3D6UA 3NBXX 3SGLA 1KVQA 4N39A 4Y2HA 2N46A 1HE1C 2F1KA 5B1HA 3CU5A 3KQVA 1OW5A 2K4EA 4KDEA 2HX1A 3EARA 1JDVA 5CA1A 1XTSA 2WIFA 1E3WB 1RCTE 2RLTA 1Y6QA 2V9WA 2C42A 4UMEA 3HA7A 3ETGA 5I7AA 3W2GA 2OKGA 4DN6A 3SHVA 1O97C 3AUYA 3ZH9B 4DLVA 3EN0A 3ZUGA 2XXJA 2R1ZA 4E5NA 3DP7A 4TZTA 4PQGA 3T9AA 4EUEA 5A2QA 1JZSA 1EXDA 1DB3A 1Y8RB 4FNOA 1E60A 4JJ6A 4QHSA 2Q7DA 3LDUA 1G4HA 3HB4X 4BNKA 1CF9A 3LDAA 1UR5A 2ECFA 3O2QB 4NENA 3QPBA 3R74A 421PA 8GPBA 3OQPA 2M6SA 3HDVA 2WIBA 3HKCA 2W3RA 3ENVA 1DUIA 4PZPA 2ZQZA 3PTAA 1TTTA 3GZJA 4IV0A 2ZI4A 3IVRA 5BVHA 4DDKA 4ZEWA 2R48A 4X54A 4K6HA 5HJ7A 1JHMA 3KHGA 2WMDA 1YJCA 1QLHA 1N25A 2FH5B 3SI7A 2Y0EA 1FQOA 1VSTA 5FXMA 3D3WB 4N49A 3PX6A 2ASDA 2QTMA 3D6FA 3INYA 3HJHA 4BCCA 4WBNB 5LZ2A 4LVNA 4YAKA 3VJLA 2JAOA 3WL3A 2LKYA 3V8BA 2OENG 3KJHA 4CR7A 1K6MA 1PGJA 5KTTA 1E64A 4TL9A 3OLQA 4GL4A 3C15C 3GEIA 3MA0A 5AUQA 3M1LA 3IKVA 3SMVA 3RJFA 2D54A 2EF0A 4BASA 3SVTA 5EJFA 1QR2A 4B4KA 1H4TA 1ZSNA 3F9CA 1KC1A 1A27A 1CP2A 3HCNA 3L0DA 3IL2A 2JH7A 1G2PA 3SIPA 2ENUA 4YJHB 1TVMA 5F12A 3QG5A 4KRXA 1L5VA 5EJIA 5GONA 4M7WA 3SZMA 4XPIA 2VDWA 3CYMA 1XQWA 2XB9A 3I5XA 4G86A 1JVNA 1Y9DA 5EHXA 1T5SA 2GX6A 3OEWA 2OORC 3R5KA 1F2UA 4KJXA 1NJ1A 4WX2B 4BGDA 1Y48E 4JUZA 2DKFA 1T5DX 1OX4B 3LGAA 4ZYZA 5C5CA 5K0LA 5CFMA 5DSXA 4D42A 5KS2A 2Z6QA 1P74A 4YJ3A 2P9BA 2Q99A 4YMTA 1TL7C 1DXYA 1K4YA 2DPLA 3F2IA 4Z9YA 5IAKA 5BXQC 3H2IA 4GX1A 2PL3A 1V41E 3EOAI 1SVLA 2DP4E 2O5RA 3E7FA 1ACMA 2IDKA 5CYPA 3ZDYB 4MI6A 2JCBA 4KLAA 4YP9A 1OYOA 2NQ8A 4IJKA 3IQZA 2WNSA 3NGXA 2IP1A 1N9GB 3ROPA 5AW7A 3UT5B 4N6OA 3EWAA 5EZYF 2C2EA 4Z3KA 2VUSA 1SBTA 2F3TA 4J8PA 4QNRA 1RXIA 3OQMA 4P32A 2ZM5A 1ZI6A 4IO0A 2HDNB 2VCHA 3KEQA 2FMIA 1FVOA 4USAA 1XT6A 2JIMA 3LTNC 3H4TA 1DO0A 2X9NA 2XIQA 4MQ6A 2H92A 4O4IB 5IFKA 1JHVA 4JASB 4O4HB 2X7JA 4B3FX 4DLBA 2ISPA 1Z06A 3AXTA 4MRVA 3RREA 5JSUA 1PLJA 3H04A 5JQGA 2XVAA 2IZ0A 5B3JC 3AF4A 4D9EA 1V8DA 3LX6A 4GPEA 4L16A 4MX8A 4R2IA 1GYPA 4W5QA 4IBOA 1T8PA 2QWXA 4TXJA 4YB8A 5JC8A 1OXJA 1MMFB 4QZBA 5ALSA 2A9FA 4UU1A 1C0LA 1E0DA 3PPXA 3JQBC 1QDEA 3MRVA 5CNIA 1HV8A 3P5BA 3F7OA 4KTVE 4QOEA 1EGHA 1E99A 2KZMA 2BV3A 1GSHA 2PE5A 5I9BA 1FW8A 1Z15A 1O5OA 1PQPA 2I78A 5H16A 3DMYA 2VUIB 3HUFA 4XLTA 4UVGA 2ZJBA 1QAMA 5ULLA 1R0XA 4G01B 2EP7A 3TD6A 4CT0A 4JI4B 2WFLA 3DHEA 5AK6A 5M34A 1Q83A 1TO6A 3EZFA 3AVQA 3H8MA 2CC2A 2DQSA 3CH7A 3LAWA 1KBQA 3DKVA 5DHPA 4B3XA 5LP6A 3AHIA 1RRCA 4POOA 4IRDA 4J0DA 2V9ZA 1YC2A 4XH9B 4OYYA 4TT3D 1UWKA 2J85A 2DQYA 4MIEA 4RS4A 4EFNA 1AN9A 3MS7A 1WSWA 4GYWA 5FR2A 2JLUA 2O8CB 2Q2NA 1SN7A 2QRVB 2EW1A 3HH8A 4DQ0A 3ICEA 1LK0A 1L7QA 5FBVB 1L3IA 4RV5A 4ED0A 5FA6A 1PV1A 4Y1RA 1H42A 1E4EB 1ZBDA 2W4IA 2YFYA 3GGDA 3R8XA 1WCYA 4F8RA 5AW6A 2Z30A 4M54A 5KYVA 1USKA 3RNOA 2RRDA 1LS6A 1XDSA 4B3BA 1ZQRA 4XB2A 3WL8A 5CDUA 3HCOA 4H16A 5LA6B 4BVBA 3ROFA 3D6TB 4KIJA 3CUKA 3HYCA 1RM3A 2CUNA 1ADBA 3CF0A 3A26A 5E79U 1PLLA 4A8EA 4OU4A 4PM4A 1FFVA 2GKSA 3TRIA 3Q9NA 4N48A 2G5PA 3BE6A 1S4MA 3KSUA 1SXIA 3MTIA 4PN3A 5BOSA 2M9MA 1T1GA 4J1NA 5AM3A 4PLTA 4TXNA 2HBMA 4XLLA 5ELMA 3AEXA 3GGPA 3TZHA 3ZWOA 1ECLA 3PHLA 3N7RC 1K08A 1HKHA 2ORYA 3HDQA 3C3KA 4Z7QB 2H65A 3NRCA 3Q8WA 5IHXA 1QE3A 3G9UA 2HXYA 1KZ7B 5JD3A 3O4VA 1VDVA 1BDIA 4FYWA 4C4AA 5KT7A 2WJYA 5H3CA 1TK9A 4S1PA 3ZCXA 2B99A 2YWRA 3R1IA 3CIOA 5GONB 4KN8A 1IATA 1S01A 4JHLA 5CVDA 3RJJA 1U48A 1TJ4A 1W47A 4ZAWA 1A1VA 3MXOA 3PIDA 4YTEA 4AF7A 2X0NA 2MT9A 4C0AC 3AR2A 2HHJA 4HDSB 2PO5A 1JNYA 1YR6A 1U3TA 3LQFA 3GFFA 1UT5A 4P0PB 3CUSA 3EEOA 3V46A 4M3NA 1XRMA 3DAHA 2C78A 3ASYA 3BKWA 1B14A 3N7UA 4MCAA 2FMTA 4ZAGA 4U7FA 4IHQA 1DO2A 5JVDB 5LYJF 3V2HA 3CUUA 4YMWA 2HOIA 3THYB 2AYXA 3FF1A 4KUGA 3DUFA 2Q3HA 3VNSA 4UTOA 5AD1A 4H15A 4RJ2A 4JXZA 2JZOA 1N6KA 4BVHA 2A9RA 4YQEA 2GEKA 4Y9RA 5EJ2A 3FHTA 3HXPA 4D25A 1XWFA 5MGBA 1T6ZA 5CXUA 3IUYA 1X9XA 3L8DA 3RJ9A 2V7XA 4LC0A 2P9TA 4RVFA 1UOOA 3OZXA 4TMTA 2GHIA 4LOLA 4KCGA 5F35A 1M2WA 2C9MA 2X1MA 1JZTA 3HN7A 3IE0A 3P96A 3W4JA 2XKBA 1DXHA 2C9ZA 3DE3X 1YFLA 2AK2A 4HS9A 4M0MA 5TEWA 2A0WA 5LOVF 4P82A 3U4HA 1CRWG 1JKIA 4UVDA 1LLDA 1Z68A 2JLBA 3E3OA 2I4TA 4WIAA 3ZZ1A 4HSGA 4M0AA 2BTQB 4GX0A 3M83A 4R9UC 4RD0A 1KJJA 4BKRA 4OD0A 1HDCA 1P19A 2KS6A 3I34X 2XAAA 4JGIA 2A5YB 1AVTA 3LQYA 3PWKA 3PUXA 4PIVA 5KX5B 5JC1A 1TK8A 1FFDA 1WXGA 1V1MA 3OFKA 4FMCF 4R1OA 5I4KA 3KV3O 4EY8A 3UHAA 1IEWA 2BFNA 2XJ4A 4BMSA 2EFEB 4QBFA 1ULSA 5CVEA 4AJPA 1JQ5A 1YBFA 1RMTA 1K1EA 2FHPA 3GUZA 2JFUA 2GCNA 1JDTA 2PRSA 4HT3B 4XUEA 1NW7A 1LV8A 2FOIA 2VBIA 1RWOA 3CMMA 3ELWA 2WPDA 3HXQA 1BXRA 1LI5A 2R4QA 4I5EA 5BOVA 4GDMA 1WBJB 3CLRD 1G18A 1X7YA 1CY4A 3OOEA 4PVCA 2LW7A 3EGOA 3LK9A 4LJYA 3OFJA 4DYHA 4XIGS 5DBEX 3RTBA 3UXPA 2OQ2A 4F11A 3PRYA 1SV0A 2N75A 1OB2A 5AKHA 4RQ6A 1RCUA 1JA0A 1QU3A 3C23A 1OIVA 1DLIA 3T5JA 1XA0A 1VCNA 4Z1MA 4X91A 4N0MA 4WE3A 5LN1A 1WULS 1Z4MA 3IEIA 2CD7A 4JSYA 3I30X 1IJKA 4O8CA 1SPXA 3WRVA 3UICA 2GPBA 1QAOA 2XNSA 8ICUA 1X1SA 2AQ0A 1RQ7A 2ORVA 4L4XA 2AHOA 4X6XA 5T14A 2YIMA 1A8HA 3AKEA 3Q3IA 4O2BB 2XITA 3L79A 4YMHA 4YQWA 2P3LA 2QD5A 1AOXA 2ZIZA 4V0QA 5IK2A 8ICHA 2PUDA 1NW3A 4MA0A 2ADOA 5KHLB 1Q3VA 1DQYA 2OSBA 3S1AB 4CDMA 2A9KA 4IZOA 3NV9A 4MQLA 4N0DA 5JCJD 2XA2A 4C2UA 5KMGB 4I08A 3T3IA 1H1TA 2AG1A 3K5IA 3KKMA 5JDIA 4C7MA 1Q95A 1SNYA 2IHVA 4LQLA 4F45A 3IEVA 4YR3A 4BEJA 1KDTA 4NJOA 4OOEA 4LCEA 2X86A 3C1UA 5DGHA 4FZNA 5EVJA 3DE6X 3G2IA 3D9QX 1E9SA 1DKLA 2YTUA 1QV7A 1S2NA 1ENPA 1U6IA 5A3VA 3IM1A 1GTG1 4ONEA 4RF3A 4CGYA 4DKXA 3ZDZB 3GROA 1JPJA 4AJLA 1YOBA 5DVZA 3VZDA 4HS4A 2PUBA 2EWMA 1ED1A 4EO4A 2QF7A 3A1EA 4CQJA 2ZREA 3AVXA 4CMEC 4QVIA 3NDBB 3AOGA 2CMHA 1G5IA 1LY1A 1HOTA 1PQ4A 2V0CA 3JALB 3N76A 1A4IA 4V1CB 4RPHA 3ZTYA