2HSZA

Crystal structure of a predicted phosphoglycolate phosphatase (hs_0176) from haemophilus somnus 129pt at 1.90 a resolution
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
225
structure length
225
Chain Sequence
GMTQFKLIGFDLDGTLVNSLPDLALSINSALKDVNLPQASENLVMTWIGNGADVLSQRAVDWACKQAEKELTEDEFKYFKRQFGFYYGENLCNISRLYPNVKETLEALKAQGYILAVVTNKPTKHVQPILTAFGIDHLFSEMLGGQSLPEIKPHPAPFYYLCGKFGLYPKQILFVGDSQNDIFAAHSAGCAVVGLTYGYNYNIPIAQSKPDWIFDDFADILKITQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords novel predicted phosphatase
publication title Crystal structure of novel predicted phosphatase from Haemophilus somnus 129PT at 1.90 A resolution
rcsb
source organism Haemophilus somnus 129pt
total genus 84
structure length 225
sequence length 225
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2hszA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2hszA01
4UMVA 4FE3A 2ZOSA 5AK5A 1TJ4A 2P69A 2FUEA 3OCXA 2HOQA 3ZVNA 2WF7A 5AVXA 1T5SA 2I55A 1Y8AA 2G0AA 2FPWA 1N8NA 3L1UA 4YH1A 1WR8A 3KDPA 1ZD2P 4XQ0A 2C8KA 3ET5A 4Y2PA 3QXGA 2HDOA 4XOUA 1T5TA 3L8FA 2HF2A 2CN1A 3QX7A 5ALNA 1L8LA 4BX2A 3QUQA 2B1RA 3L8EA 2G80A 3EF0A 5AI9A 3WKDA 5ALDA 5AKJA 4HAIA 1U2SA 2W4MA 4GXTA 2FI1A 3AR3A 2VKQA 3FPSA 1U7PA 1XP5A 1RPZA 2WF9A 3BWVA 2FPUA 3L7YA 5ALJA 1Z4PX 2BY4A 1J97A 2B1QA 5AI6A 2FPXA 2R8EA 5AW0A 3MMZA 4YGYA 2C88A 5JJBA 4GIBA 2GO7A 1IWOA 5AKHA 4B6JA 4IG4A 2AGVA 3EWIA 4YCLA 3N1UA 5FP0A 3ZUPA 3QNMA 3ZTYA 2AH5A 3R4CA 2QLTA 3ED5A 2W43A 3MN1A 3ZTWA 1VJRA 1RLOA 4XPZA 1Z4QA 5ALHA 5ALPA 1J8DA 3QU7A 2WM8A 2MU1A 3VAYA 3SF0A 4NV0A 3DNPA 4YCMA 3IRUA 4ZEXA 3L5KA 3ZW7A 4MUMA 2W11A 5ALRA 4UMDA 2IA5A 4UU1A 3ONNA 2R8XA 5AVWA 1L7PA 1YMQA 3NASA 2B8EA 3J7TA 3E58A 3ZU6A 2YN4A 4EEKA 1L7MA 1RMTA 2P9JA 1F5SA 4KX5A 1Z4OA 2BDEA 2IYEA 4UM5A 5AW7A 2C8LA 2YJ4A 4OCZA 3NAMA 2O2XA 4BYGA 4C4RA 2D2VA 4G9BA 5AVQA 5AW1A 2CFSA 5AVRA 2I33A 2JGAA 4BX0A 4XE5A 2B8JA 4J2TA 1WVIA 2GMWA 3ESQA 5AVSA 2JARA 4CE6A 3NIWA 2IOHA 1QH9A 3N5KA 4Y2SA 5AM5A 1RQLA 3OCZA 1QYIA 2O9JA 3QU9A 2FPSA 4AS3A 2G09A 1Q92A 1L8OA 3ZVMA 4YIHA 2PQ0A 4L6AA 1Z4KA 2OYCA 5ALTA 2RB5A 3WKCA 1TA0A 4BNDB 4L57A 5ALOA 2YMMA 3L8GA 3SHQA 4Y2QA 1Z4NA 1ZOLA 3WK9A 1YNSA 2GHTA 1CR6A 3I1YA 5AW9A 5AIAA 2YY6A 4QQFA 1AQ6A 1TJ5A 3AR8A 3L8HA 3NUQA 2GFHA 1VJ5A 4EENA 2CFTA 2OBBA 4DCCA 2CFRA 1Z4IA 1Q91A 2ZG6A 3L0BA 2I34A 3OCWA 2HSZA 1Z4LA 4Y2TA 3WK8A 3A1CA 4JB3A 2G1AA 3AR5A 3DV9A 5ALMA 4HGOA 1TE2A 5ALVA 3WKAA 3ZWKA 1ZRNA 2HX1A 2YFYA 5A3RA 4CNQA 5AW8A 5ALGA 2FEAA 3I76A 4YCNA 4KYTA 2HEGA 1NF2A 4MWOA 5AW4A 4DW8A 4NAVA 5AESA 3B8EA 1YV9A 2G08A 4UM7A 5ALIA 3ESRA 2HO4A 1RLTA 4E88A 2IOFA 2RAVA 4O8CA 3GYGA 2WF6A 5AI5A 2ZBDA 2YBDA 2YMLA 2AMYA 2AUTA 3FVVA 1NNLA 3QU4A 5AI8A 3I28A 2HI0A 5ALKA 5IT4A 1RMQA 3ZX4A 3DAOA 1U02A 2NO5A 4UARA 1EK1A 2C9MA 4OD0A 4AS2A 5AKGA 3CNHA 3SLRA 3A1DA 4HYTA 3WK7A 5ALSA 3UMCA 4UAVA 2Q4RA 5AW5A 4OFZA 3R9KA 3TLMA 2MU2A 2Q5EA 3M9LA 2FDRA 2I6XA 3QLEA 5AM1A 4Y3UA 5AVVA 4NWIA 4UASA 4CF3A 2RARA 2ODAA 4BNDA 1L7OA 3L0CA 4BEVA 1L7NA 2Q4TA 5AVYA 3QUCA 4Y2YA 5IS2A 2EARA 2BDUA 3W5CA 2ZBFA 1XVIA 2G06A 2EATA 5AIBA 3KD3A 3E84A 4OHFA 5AKIA 2MSNA 1N9KA 3HLTA 4Y2RA 3E8MA 1Z5UA 4IFTA 3U19A 3QUTA 1S2OA 3OPXA 3RF6A 1QQ7A 3KC2A 1X42A 1O03A 4UMFA 3IB6A 4F72A 2DQSA 3RFUA 4G63A 3U26A 2R8YA 3WK6A 1ZRMA 1SWVA 3WKBA 2HF7A 3QGMA 4I9FA 3QUBA 2YJ6A 4DWOA 3WK4A 4ZEVA 3WGVA 5ALFA 3K1ZA 4HGPA 3W5AA 5AW3A 3NANA 1XPJA 5AKZA 3U13A 5AI4A 3A3YA 5AM4A 5ALYA 5ALZA 5AM0A 2ZXEA 2PR7A 4Y2VA 4UMEA 4KNWA 3AR9A 5AKKA 3U7HB 3EF1A 3M1YA 2JAOA 2WHEA 1WZCA 2I54A 3SKXA 3W5BA 3N07A 3PGLA 1Z5GA 3L1VA 3QU5A 5IT0A 3KOOA 1ZD4A 1RRCA 4Y2UA 1VFPA 3AR2A 1FEZA 4CF4A 1WPGA 3ZVLA 2G07A 4FFDA 1RQNA 5AK3A 4RESA 3W5DA 4DFDA 3NRJA 2B0CA 3AR4A 4BKMA 2X4DA 1YDFA 1LVHA 3U7GA 5T41A 5AVTA 3MC1A 3R09A 3PDWA 1T9ZA 2HCFA 1U7OA 1ZD3A 4EX7A 3D6JA 4L6CA 4NABA 3SKYA 4KX3A 5AW6A 2JAUA 3FM9A 2RBKA 2FPRA 3N28A 3NALA 1SU4A 3OCUA 3CZ4A 5AKXA 5A3SA 3U7FB 3OTQA 3E81A 1PW5A 2WF5A 4PNHA 1ZD5A 3FZQA 5AKYA 4UATA 5AICA 3WK5A 4KN8A 4KNVA 3OCYA 3QU2A 3FPBA 4BBJA 4BEWA 5AKLA 1Z4MA 4H1WA 1YJ5A 3FGOA 2I7DA 2IOFK 3ZX5A 2YJ5A 4F71A 2WF8A 3KBBA 5AM2A 2R8ZA 4EELA 1RLMA 3P96A 2OA0A 1TJ3A 4C4SA 1JUDA 2EAUA 3DDHA 4J03A 3AR6A 5ALUA 4UAUA 3S6JA 1O08A 1EK2A 1L6RA 2B30A 2OM6A 3F9RA 1RC8A 3B9RA 5AK6A 2JAWA 4C4TA 3BA6A 3EPRA 1ZJJA 3A1EA 4QJBA 3UMBA 1LTQA 5E0OA 4CF5A 1RKVA 1RKUA 3ZI4A 1MH9A 1CQZA 5AVUA 1QQ5A 2FUCA 2YJ3A 4JDPA 3I6BA 5ALXA 1RMYA 2YMPA 5ALLA 1K1EA 3AR7A 4HGNA 2ZBEA 2WFAA 1U2TA 1Z88A 1RKQA 3QYPA 4ZEWA 4UW9A 4NFLA 1NRWA 3B9BA 1Z4JA 3WKEA 2QYHA 2NYVA 4Y2JA 1KYTA 3IJ5A 4I9GA 3MPOA 3SD7A 3L0YA 4UU0A 5ALEA 3PGVA 3U7EB 4HGQA 4Y2XA 4RETA 5A3QA 1QQ6A 5AK4A 1S8OA 2YMQA 4AP9A 3PCTA 3SMVA 5AI0A 2PKEA 3UM9A 5ALWA 2HHLA 4FYPA 5AM3A 5ALQA 2P27A 3N8GA 2ZBGA 4HGRA 4BX3A 5AKEA 1SWWA 3HYCA 1ZS9A 3ET4A 3WGUA 2P11A 5AW2A 2NO4A 1RDFA 1YS9A 4EX6A 2GHQA 2B82A 4YIKA 4EZEA 3OCVA 3KZXA 3ZWDA 5AVZA 5AHXA 2C4NA 3UMGA
chains in the Genus database with same CATH superfamily
5LYJB 3A04A 4ZT2A 1GT6A 1ZI9A 2C0PA 5TJHA 5EIBC 1B8UA 1E2IA 2C00A 2H48A 2H2AA 2DBRA 1YVRA 1W94A 2OUKA 2E55A 2B2CA 2Q5FA 1I8TA 1R0BA 3K72B 2V5AA 3LUDA 4OAPA 3D2AA 1IL0A 1JR3D 2O0LA 4L15A 3A1WA 3IDSA 4UUAA 2FLPA 2JI4A 4CEHA 4NCAA 4TV8A 1TYEB 2GTIA 1N6KA 2FF5A 3E03A 5AP9A 1QORA 4R2XA 1AF4A 1G59A 4PG8A 3RKSA 1P1JA 1JHOA 3T3EA 2VDMB 3WL6A 3N6VA 1T2CA 1JIUA 5C18A 4FR2A 3SI8A 2XW6A 3NHZA 3RTAA 4QXAA 3QWIA 1N57A 3Q9SA 4NM2A 4AX4A 2IYEA 4DJDC 4H4EA 3ZLVA 4RQMA 3IODA 1TCAA 2GF2A 1JVSA 1EEHA 2BGJA 4JT8A 4NU0A 1A5BB 1NXVA 5MHTA 4DLNA 4U3JA 4B4OA 2Y76A 2M6KA 1ZETA 4ZHQA 3M0EA 4KH0A 1Z8HA 3DEZA 4CKCA 4F1WA 3GGCA 1R50A 4MR8B 2GPWA 1BXZA 4QBKA 1WG8A 3TKYA 2CLKB 1RQRA 3MTQA 4LNHA 3G2IA 2FKAA 3M9WA 1EUZA 4BUZA 1WZIA 1XZCA 4IMPA 3FCXA 3BCUA 3OSUA 1Q91A 5I47A 1SKUA 3ABRB 2E5SA 3I04M 3X43A 1ONSA 3GA5A 1ZQMA 3GLQA 2WYOA 2FEAA 1WUKS 1F9AA 1DUVG 3SMQA 4XGRA 5KYVA 1JIIA 3TJZA 4OTZA 5DH9A 2PZFA 5E1MA 3GRYA 4DSKA 2XXJA 2A1AA 3D6FA 4XW2A 1X1CA 3RIGA 1D5CA 4N8SA 3WHLA 4FBGA 1QC5A 2XC9A 4XSGA 1H4SA 4B74A 3E35A 4W7HA 2OXTA 2HQBA 4GXIA 5T8KC 1U5AA 3QX3A 4UARA 3MK31 3A1DA 5EVJA 2XNJA 5EZYA 3ABOB 2V3WA 3QLEA 1LPAB 1HMPA 2EJCA 4PQYA 4JI2B 1Z18A 3CEJA 1TZCA 3KZVA 4B4UA 3K0BA 4M53A 4B79A 1K8RA 4MUNA 5EWMA 3U3KA 3PR5B 1I1OA 1CTQA 1E0KA 3M4YA 3S2EA 4QWEA 4ESHA 1ILEA 4K6OA 1ZJYA 5T4EA 1F8XA 4JOQA 3K94A 1IE3A 3UHFA 3H1GA 2NM0A 3CEPB 5FWYA 5DLQC 1PAUA 4RZSA 3O7WA 1JNYA 5CDHA 1SL2A 3AJAA 5IM5A 3C2LA 1DIOB 1P5FA 1TNDA 4I1IA 4P0TA 2HF8A 3ZIAD 4ZVOA 2DKFA 1FDOA 3CUUA 5EPUA 5H8WA 1WABA 2YXNA 1LSUA 3F67A 2HJGA 8ICUA 4L78A 1LLCA 2I3DA 1S0VA 3LGAA 2X0RA 2ZJYA 3DPIA 1BRTA 3UG6A 4S05A 3IE0A 1U3GA 2YV3A 3CX6A 2A5LA 5BMVA 4LHWA 4PYNA 3BHIA 1SB8A 1LX6A 2KKPA 3WLRA 4HH3C 1WXQA 2DWQA 4KLNA 2XYRA 1KQFA 2O5EA 1E3TA 3QSYA 4DQDA 3EA5A 3A4MA 3U4AA 3ZX5A 2Q29A 3H1BA 3QK7A 1PWXA 1I4DD 3FHTA 1Y42X 2V6MA 4DJAA 1UOPA 1SK8A 3BXGA 1I94B 5GVSA 5EJ2A 3PWZA 1JL3A 1ZQYA 1UK7A 4Q9DA 5HE9A 2EL7A 2XMRA 5ICMA 1AIPA 4S35A 1C7QA 4TYWA 2Z8YM 1SU8A 4BRZA 1CLEA 3KQVA 3CG0A 1DC7A 3NHJA 1Y5LA 4P1ZA 1R64A 2D62A 5BSTA 4QREA 2IK8A 4A16A 1IXZA 1B15A 3QHQA 1MJNA 3N2NA 4KUGA 1C9EA 5HG0A 2F3PA 3PVCA 1NLMA 2C1EA 1H9CA 2WHPA 4RZ2A 2PQ2A 1R6UA 1CUAA 4MDEA 1CEYA 3IHKA 5IHXA 3TLKA 4MR9B 3D4IA 3WL8A 3LRPA 3HUUA 3TR6A 2W58A 3ZE2B 1O57A 1NURA 4Y9TA 5CB4B 1T6XA 4XH9B 5HF6A 1SXEA 1LJ8A 4WN9A 3KETA 4MFAA 4ZI5A 3CRW1 4PHEA 4HBGA 3QTBA 2GGSA 3FYDA 3F6YA 5CITA 1QHSA 2Z3ZA 4UM9D 3PO4A 4Q45A 1TM4E 1LLFA 3LSYA 5CW1A 4KRFA 1WULS 4NCXA 4PYLA 4D43A 4KO4S 1A4IA 4YCMA 5IMBA 2HVHA 1TV9A 1RZUA 1RFLA 2RHRA 1U5CA 1W1IA 5A4DA 2A57A 4ARCA 4W1PA 2QN6A 1P5JA 4M1SA 4UBOA 2C2ZA 1D2EA 4M9UA 2BLNA 4Z6DA 2OTCA 1OI7A 2UAGA 2V59A 2RI0A 2C3UA 3CNLA 4BMZA 4B83A 5JRZA 4R3UC 2R5WA 4OUDB 5LL6P 4JI1B 4UBIA 1FDRA 3FJYA 2AOUB 2ISCA 4EYGA 3D3NA 4BKPA 3VPHA 5HPYB 4L57A 4JBIA 4A0FA 5KSPA 4K9NA 4S1TA 4AJOA 1Y6QA 1ARZA 5JROA 3S8EA 2JLZA 1JW9B 3N7RC 1JAYA 3JTEA 4Q5IA 3A25A 1UQUA 3LX4A 3LUJA 2JGKA 4Q9LA 3RJGA 2IZ6A 1U0RA 1SXIA 2D0OB 3LFHA 2YTUA 4F3NA 3GDOA 4P3XA 4XX1A 3FKSD 5IC6A 1FVFA 5A5EA 2QQ5A 4KYTA 1E2DA 3SQLA 1T1JA 4V0LA 4O4IF 4GNKA 1Q1BA 2GDZA 3B8EA 1MVOA 4H2DA 4EHDA 1XEFA 3FUVA 1TJNA 7ICPA 5CIYA 5AKGA 4CKWB 1ECCA 5EJEA 3PGXA 2DULA 3T5MA 2YWEA 1BGVA 2IYOA 1XRSB 4OAQA 3VQTA 3AY0A 1EUDA 4JP1A 4W8HA 3CHYA 4HN4B 3QRWA 5JSZA 3TAQA 4EHFA 2WJ6A 4DJJA 4EW3A 2BGRA 1JYFA 2XSZA 3IAS1 3AUTA 2ZSDA 3MWEA 2CXQA 1R66A 4EY4A 2O07A 1JILA 3JPRA 2X5XA 2Q1SA 3WGVA 5KYXB 1RYRA 3IE1A 4Q1VA 1KYYA 4DKJA 1ZNWA 4N5NA 3LP5A 3SEQA 3HKDB 2IZ0A 3TO5A 4D9JA 2HU8A 5FDFA 4ODIA 1BPZA 1OTHA 4YCSA 3D6VA 3SIXA 4FFDA 5KNIA 5KO2A 4W7IA 2UZAA 4DNFA 4CQMB 2AQIA 3KR0A 5CNIA 3D6JA 4TV9F 2ZDHA 3F5FA 4FD3A 2PBRA 2CKDA 1VKNA 4HPWA 1NG1A 4ZVRA 3W7VA 4BZWA 4I9NA 3OPYA 1CP3A 3RYTC 1NJ8A 1DEHA 4KLRA 2YYSA 1T9HA 3FYSA 4JNKA 3O4RA 2OV6A 4YUVA 2BQUA 4NJMB 1ZVVA 2A8YA 3L0SA 2OFFA 1SC9A 2OZEA 2J5BA 4CI0B 4TS4A 1KXJA 3MB8A 4HB4A 4YROA 2VWPA 2GWHA 1FMLA 1J2RA 2ZROA 2DHEA 1T6ZA 4M1YA 1IBKB 1VLHA 5ESRA 1P33A 1USIA 4GNRA 1GCAA 4R2WA 1DWQA 4BB9A 3QEOA 5JC8A 3PXCX 1XTVA 5CT8A 1CUKA 3C1AA 1TQ4A 3VYRB 2Q5QA 4Z7NB 3H2IA 3Q88A 3UJ8A 1GSOA 2ZRAA 1W581 2QEQA 4CKBA 3ZI7A 1WMAA 3B70A 1FTQA 3DJYA 2M6SA 4R8SA 2YV5A 2CDAA 3KZIU 2XTNA 3PQ7A 5BPCA 1OHHD 1NRXA 3CLUD 1P1IA 4ZT7A 1YNOA 4UEWA 3S4YA 1UMDB 4IR7A 4OU5A 5IJAA 2BBSA 1DIHA 3THRA 3FYUB 3D8SA 1NUPA 5EMLA 3B6JA 4L8GA 4DDMA 1SK9A 1ZRHA 3EPHA 4YUXA 4A5SA 3ILSA 3M81A 2ATIA 4WGFA 1AU9A 1YB4A 3RIMA 4CCAA 3ZDEA 4WY8A 2JI6A 4DL5A 3A14A 4K9SA 2AGVA 1V9LA 4DMFA 3LDHA 4F3OA 4IJQA 1G19A 1XYGA 2YRXA 4F1KA 3HKBB 3ED5A 3VNSA 3ICVA 1ZM9A 3WDSA 4IJ5A 2A5YB 5IIJA 3W5JA 3WLFA 5EXXA 2NRTA 1NVGA 2Z9CA 3E9RA 2RG1A 1HLPA 1XAGA 4PX5A 1PG0A 4TKVB 1S0UA 1WA5A 1Q19A 4FE4A 1MRNA 5E1OA 3N3AC 1CB0A 4P4NA 5EE5B 4FWTA 1RI1A 3PF8A 1RRVA 2IHMA 2FWJA 1QGOA 4DZZA 4OJOA 5C35A 5CB1A 4PRZA 5JATA 3LM8A 2R87A 3EZNA 1OBCA 2VYVD 1DINA 5B55A 2V7EA 5A71A 1G38A 3KK0A 1Z1VA 2Y8EA 1XYVA 2W2MA 2A0FA 5JYDA 4A92A 2R8RA 3DXFA 1PHRA 4II2A 3M1IA 4OOFA 4ACAA 1I7NA 1K4KA 1LBTA 2BI4A 2O2ZA 5L3QB 1SO8A 3RKUA 1ZGAA 4JBWA 1JB9A 4D56A 2ATCA 1RKXA 1JSRA 4PSVA 3OSPA 4YFVA 1GDTA 3IYLW 4A8TA 3V72A 4L50A 4FFPA 4LQ4A 5CVUA 5AI8A 3MJCA 2Q27A 4HUQB 1BFKA 1KDTA 3ANYB 3IXMA 2J87A 4CKZA 5EJGA 3P2KA 2CZGA 3Q5GA 1JS1X 4PYQA 3QUCA 1QPGA 3W78A 2DTDA 2GSDA 4GI2A 1HFWA 2B83A 1QGED 3WO0A 2I2DA 4GI3A 1WZNA 3CURA 5ICFA 3TKLA 1PQWA 3VO8A 3DL0A 3MDAA 3HGTA 1MAVA 3L41A 4U6QA 2OHVA 2G5GX 2KICA 3FW1A 4PYMA 2HUNA 3F2VA 3I5AA 4MF8A 2YUTA 2IYQA 1HO3A 1RWMA 5AM4A 4BJQA 2DH5A 3C23A 4ZXPA 1BFDA 2R48A 3GDHA 4H7PA 1U7UA 1K4MA 3EF1A 4PLTA 3H97A 3PX3A 3O2QB 4KITB 2NUTB 1DC8A 3GT7A 1YKSA 3VJMA 4EHIA 3EQZA 1CJTC 4H0FA 4KBYA 1BXKA 5LLDA 1IYZA 3LH5A 4DV4B 1FNSA 4L4SA 3JD3A 4MI6A 4B3HA 3P27A 3Q8RB 2MSLA 3AEQB 5H1YA 4EY8A 4D3ZA 2D5CA 3PDHA 1KEJA 1JIQA 4BX8A 4QZDA 4RYDA 4ZRDA 5EY5B 3C21A 3FTCA 3A6GA 1G20B 4WBNF 3PPXA 2RG7A 3N74A 5K8JB 3MBYA 1BO6A 2PFKA 2DE0X 2WF8A 1O77A 5I7SA 4N6OA 2BMFA 7ICUA 3N39C 3O6VA 3S81A 2PD6A 2A7XA 1X1RA 2IV3A 1E3WB 1QNLA 3NP7A 2VDOB 3P0HA 3RADC 2PKYX 5K3FB 4LHYA 1LK5A 3BJEA 4OQ4A 4IDFA 5JIBA 4IMIB 1EINA 4QWWA 1SXJE 5ALXA 2ERCA 2IXFA 1RMYA 3SF8B 2IBTA 3RSGA 2X1MA 4ZVQA 4KRGA 1CDOA 2BH9A 2F4NA 1A96A 1RYUA 2CLIB 4AB1A 1WHTB 1P45A 3PICA 4IINA 1NJFA 1SUAA 1ZXLA 2ALJA 1DBPA 2W9AA 5FR1A 1I7QB 2PGIA 2A19A 5L3SB 3CVVA 1HOTA 5AVZA 1C9MA 5T3UA 2HJ9A 4JI6B 2FQ1A 4IHKA 2IXAA 1N8SA 3HFJA 4MLCA 3PXBA 4DOCA 2Z9DA 1EVJA 5D7NA 5T8KA 5DK6A 2QLLA 4NCJA 4IVRA 3M6XA 2WIJA 2W6CX 4AT1A 2ZUDA 1FZQA 5JSUA 4TKZA 1UKYA 1JTEA 4AD8A 1TU4A 2CWWA 2LWIA 1XP5A 4BECA 5AT1A 1ADBA 5I9IA 4HQOA 4O4LA 1E18A 3PGA1 5A4JA 1UHUA 3U4IA 1NYTA 3SZ2A 5BMOA 3UJNA 3JYQA 2DKZA 2HRQA 3SYZA 3H86A 4Z99A 3WGIA 2AV6A 4HNHA 1SN7A 1KK3A 2AK3A 2QTWB 2GJSA 1J0BA 5E6RB 3R5FA 4N3AA 1D4FA 1E1MA 1XEWY 4D4KA 1KO1A 4NESA 2PANA 3KLMX 3C28A 1Q5PA 3C39A 3SKVA 4G0WA 4HAUA 2GMWA 1N63A 2GN1A 5JPDA 2ZIXB 2QVZX 3GH3A 1CIJA 5C3MA 2GQ0A 3GRKA 4MR9A 3BD6A 3P9CA 3H1FA 3KAPA 5CA0A 3F47A 1RWOA 1NM5A 4O3MA 3NWJA 2WLTA 1WDLA 4P22A 1ACMA 1E3EA 4DM7A 3LA8A 2BN4A 1S6YA 1WWKA 2JGNA 1OAKA 2R6HA 5TX7A 3R75A 1NK9A 4AYTA 3ZKWA 1L4LA 1QP4A 4OGWA 2FTKE 3CO0S 3GUYA 2ZIUA 3HVJA 4UAWA 4B43A 1F0MA 3LWZA 1EP2B 3R9WA 4JP2A 3K3PA 1TL7C 5EYPB 1A5TA 2GOYA 3NHBA 3TNFA 1VGVA 2JW5A 2WFLB 5EJIA 1L3CA 2PBZA 4UJ3A 4ZIRB 3HPQA 2VRBA 1A8HA 1E4YA 3CLRD 3ELDA 3CVJA 4EVSA 1GLGA 4R65A 4GR9A 1DBRA 3R3UA 3SLRA 1NN5A 4HDRA 3QBTA 4NMLA 2FLKA 2AMFA 3VHLB 4JJGA 2Q4DA 5FKJA 3COWA 2Y9PB 3FR8A 3C8UA 2PKRA 3ZHBA 2WWXA 4FB4A 4OI4A 1EU1A 2Q3DA 1JFTA 1IHXA 5HKBA 4MS3B 4LEIA 4OP1A 3PD1A 4RNNA 1XKTA 4Q4CA 4RQ4A 5EJ5A 5BSEA 2GPNA 1P5ZB 1HE1C 4CBVA 3I53A 4B1FA 2WG0A 2WOOA 3SEZA 3EIHA 1S4MA 2J3MA 3M3PA 1I5EA 4KO2S 3KLNA 3N8HA 3RROA 2VS1A 2V4QA 3OZGA 4WPGA 5IUNC 2GPBA 4HK4A 4PCUA 5BUCA 3N05A 1UC4B 1WPGA 1T6BY 4ALJA 5H2FU 1RJFA 1UBCA 1CUFA 2PGNA 4TWRA 3VPFA 4FMCF 4EX7A 2YN0A 2C96A 5KT7A 4G9EA 2MYPA 4QUDA 4WFJA 1IY8A 2JEOA 3H3JA 2VJAA 5IDQA 1WB5A 2IKQA 4ECWA 2OAQ1 1JHPA 2VDUE 4NCBA 3D2QA 4Z4GA 2O5CA 4H1WA 2C3OA 3UB3A 2I4NA 5L1LA 5KYXA 4M7WA 1QHFA 2BWJA 4R9VA 3P96A 4B47A 1X9IA 2I7VA 2SCUB 1TK5A 1G8HA 2LUOA 3HKDA 1Y9JA 4R16A 4A36A 3W5IA 4E5KA 5BN3B 3S8MA 4A23A 5A4FS 4C8NA 5G3YA 4KUEA 2V9CA 4L08A 2KS6A 3K9BA 2KYRA 4J3JA 1NXQA 3GFQA 2J0QA 2G04A 3G6VA 3UQ0A 4DMMA 3OF2A 4CEJB 3OLVA 4ZVMA 4Y2JA 5B64A 4ZAXA 5LP6A 4OP2A 1QVWA 3NVMB 5IM4A 2BZ1A 1DEKA 1L4BA 2FHSA 3GDXA 2JGEA 3R7FA 2YHIB 1W96A 1UFVA 1PNTA 2GHQA 4QAJA 1FJGB 2VZ8A 2E8NA 1RXVA 2GEDA 2OO5A 3DW1X 1L5GB 1Q20A 2E5WA 2XQVA 2ID9A 1ZD2P 3STTA 2XV1A 4I2CA 1ZN2A 3NIBA 3NEJA 3TW8B 1L5HB 5CG2A 3JWIA 4ZRNA 3OI7A 4R0VA 2W5UA 4GSKA 3U6KA 2GO7A 4LY9A 4IIGA 4B3XA 4DXHA 1QVRA 3OZWA 1RT9A 4KUHA 4QWAA 4CODB 4KXXA 1H1TA 3IPCA 1U3UA 2HPZA 5EL0A 4QYWA 4QZEA 1NTOA 3FR7A 2ZT5A 2IF0A 4D57A 3UK2A 1US8B 1CZUA 3GBSA 4Q3KA 1P61B 4D25A 1TGYA 4E2XA 4D3FA 3B3QA 2XCIA 1Q3VA 1ZR2A 4TX1A 1W1UA 4DL7A 1U0NA 3VCBA 2ZB3A 4XWAA 1DBSA 3TLEA 1EP9A 2VCYA 2XZLA 5F51A 1DAGA 1UMDA 4DFJA 2F55A 5DX1A 1UBRS 4IZIA 3G9XA 5KQLA 5F4ZA 4LY6A 3H84A 2QL7A 4MAAA 1A5AB 3ONWA 1KKXA 2ASLA 1J8QA 4P4GA 3RSSA 5KWIA 2X5NA 1Z4IA 3EQ8A 2UVPA 1IRIA 4Q24A 5KWVA 1MJGM 2QP4A 1P74A 3DP9A 3QPVA 3URKA 2HX1A 2BBOA 4HNGA 2BVNA 1ZJZA 3M4NA 4OSPA 3RSHA 1JI0A 2R8KA 4PIPA 2DQ4A 1NW3A 3OIDA 5G02A 4TKVA 5IANA 5DU2A 2GEKA 1PK3A 4F5NA 2HT6A 3INRA 3JPWA 2YJGA 3PHCA 4TTIA 4FYYA 5DM2A 3ZX4A 2EZTA 1BKDR 4I3GA 1BDMA 2J4DA 3BE4A 4JLOA 2Q5EA 3F73A 1ZK1A 5BO5A 4IDGA 2XD9A 1C8BA 1L7NA 3D0OA 3ZR4B 5DMHA 3GBPA 1RP1A 2ONJA 2VHCA 2V0GA 1NVAA 3SY8A 2NT3A 1PVOA 3NZEA 3RVPA 3H11A 5DI9A 4MQ4A 2OECA 4NBKA 3U26A 3NDJA 4CEHB 4ZC8A 2JJ1D 3WWEA 4RELA 4EI7A 3KUKA 3OIVA 4K3VA 4R7GA 1MAHA 1ZH0A 4BNWA 1KZ4A 5DSZA 4WT7A 4NLNA 3TUIC 2WIKA 4KV9A 5A4MS 1PN3A 1NJGA 4RHEA 1U65A 4CZ2A 2C7BA 4HUQA 3HBAA 2DJ5A 2WJJA 4KQ6A 5ARDA 4ARVA 1ZC4A 4U3JB 3FYCA 4KX3A 4PVDA 5JWOA 1MTOA 4X41A 3HNRA 5TEVA 4I2DA 1TW3A 4CKCB 3TRJA 3CYFA 3IAEA 2JKYA 3H0MB 9GPBA 3FFBA 2HC9A 4PPQA 4JDUA 4F2DA 4IR1A 3MTJA 5FPQA 2FVXA 1D2CA 1Y3IA 2IUTA 4K9LA 2VRCD 1DI0A 3VVMA 1WSDA 1OA0A 3FAHA 2P2ZA 3ZDRA 4DMLA 1XZDA 2EFHB 4M7OA 1QTRA 3UOAB 3OU6A 1N5JA 3B1ZA 5CG1A 1JMKC 2X9QA 3LGSA 4QL3A 5LMCA 5K3AA 3AVTA 4J1TC 4A2PA 2VQ3A 2OM6A 2E4AA 3H2KA 2NUTA 4YLYA 4XUEA 1N6LA 4W4TA 1B00A 1X1BA 1QC5B 1X9SA 3WJ2A 3AXTA 2GYVA 4W5TA 2AIRA 1U28C 2Q6OA 4P4SA 3JZMA 3CB2A 3OCJA 1FJXA 4BTVA 4MCIA 2HM7A 1BEEA 5EZYB 2JJMA 1D1SA 1QX3A 4B85A 1XTSA 5GP1A 3KVOA 3ZCXA 4UB2A 5EWMB 2F1OA 3UXOA 1KAHA 4S2UA 4Q3AA 4Z3OA 2DUUA 1IN5A 3ICOA 1Y8AA 3L7CA 2FRVA 3ZZNA 1NVUQ 1OGYA 2V7QA 4ARSA 1A2QA 2E3JA 4G1VA 3F9CA 5T7BA 5JAHA 3KPJA 1E3WA 4WA8A 3Q8LA 2V74B 2FJ0A 4X45A 2B4KA 5FWYB 1GTL1 5DF1A 4KN7A 1SCIA 3CSSA 4LISA 2XWBF 4IG4A 2QT1A 3KUDA 2WMNB 1DPFA 5BSFA 7ABPA 1C9KA 5A4KA 4M37A 2OK7A 3SOPA 3TB6A 5DCYA 2J9YB 3FDZA 1GA1A 3L5KA 1I4EB 3NJ8A 1E66A 3NASA 1ZQHA 2Z5GA 1Y6JA 3AUXA 4JJKA 3IKMB 4XRHA 4MVCA 5KWEA 4KTQA 4DHWA 2ENUA 5BMVB 5FLYA 3GLFB 5BV8A 2F8LA 4OBBA 3KQWA 3WLKX 3TGWA 4CCHA 3LOPA 2VNIA 2IRWA 3WIDA 1LPBB 1AUPA 2UDPA 2PAFA 2VJNA 4UREA 3ZCUA 2NVUA 4IOLA 1S2LA 4AY2A 1V3TA 1VHTA 3COPA 4DCCA 4HYKA 1T1SA 2Q3HA 4L72A 4C89A 1QYCA 2UYHA 1EFRA 3R8XA 3FWZA 1ZBDA 4PO8A 4WEOA 2RK6A 3C5WP 1CHDA 4O2BA 1NN3A 1ZK4A 2LKYA 4JLNA 1ECBA 1H8HA 4WXYB 3F2CA 2BCUA 4MUAA 2JZCA 3NHFA 1QG4A 1SUDA 1HDZA 2EP8A 2M1ZA 3INNA 2DB3A 4AWBA 1VHJA 3L8CA 1JPVA 1FQOA 5DISB 2ZIXA 1EGQA 4UUOA 1L5QA 2WHPB 2J3LA 3QKWA 3T3FA 2OENG 3WY9A 3RYHB 2KHZA 3G79A 5LMUB 5BYBA 4GYJA 1OCEA 1WDTA 2OCIA 1SHKA 2RHOA 1XUOA 4BLOA 4QIWF 2QDKA 1KAQA 3ICXA 3H0KA 5AIBA 4ZOEA 3EPKA 3DVLA 2WJHA 4WN9B 3BTSA 2WJIA 4C6HA 2ODPA 1VJ0A 2G83A 3IQFA 1ONNA 4LXQA 4MARA 3ZCQA 1VLJA 3NANA 3RRMA 2W9BA 2H3ZA 2G5IB 3U13A 4FSXA 1P0FA 3RC9A 1UEJA 3H3XA 3KKLA 1RZRD 1BKSB 2NXNA 2Q9BA 3ZHTA 3ZWYA 2VOJA 4PZDA 4EPWA 3TN7A 4OBEA 3AR2A 3K8OE 3KQLA 5KT5A 4L4UA 5EFOA 4YCBA 3IJEB 2P3OA 1TEHA 3CZMA 1NLUA 2WHXA 4OQZA 1HEIA 3GIIA 4F4CA 1BVHA 4ENVA 1ORWA 1DKPA 2RHGB 3TI0A 2XEXA 4GBJA 3E1SA 3E2PA 1W0KA 1W4ZA 4KNVA 1ODCA 4MS3A 5A9SA 4UBKA 4UB5A 3MRXA 2VI5A 3DV2A 2PKXA 4CIWA 1I2CA 1CK4A 3Q3EA 3PXXA 1NBWB 3CLTC 8ICNA 5CM8B 1OZAA 4L5CA 9LDTA 3KHUA 3T5CA 4XSHA 2XUZA 1PJBA 1RM4A 1E6MA 1GUBA 4PAGA 3CCFA 4L5BA 1NC1A 4MGKR 3MWLA 2GF9A 3GVIA 5JISA 5IK2A 2XB9A 1J5PA 2R5NA 3LCVB 1XRLA 4CG1A 3TEFA 3DZIA 4Z4IA 1SEVA 3P4UA 1Y3DE 2VH5R 3WQHA 5KTMA 5DNEA 3FUXA 1EUDB 3N53A 3WGUA 1E1LA 4FDTA 1PEAA 3WLPA 4HWTA 5KG7A 1PVPA 5JSZB 1BYIA 2QE7D 3SZMA 4DLEA 4M0MA 3UMGA 1TI7A 1G3QA 1XL0A 2G88A 5EIFA 4KPGA 4F9EA 2YZ2A 3MWEB 2M0NA 3ESCA 1DEOA 4BXOA 1B0ZA 3EULA 1ZJNA 2JHFA 4ZALA 2WJ4A 5IAEA 3ORSA 3SEAA 1QGYA 3LVBA 1BGWA 5CAEA 1MJFA 4KMSA 1SIJA 3H9CA 4QXRA 1SIUA 3BZKA 4RPXA 4ED3A 4CW7A 1JAIA 1RRPA 1ZH6A 2EZ4A 4DDVA 2CSUA 1Z07A 3AU2A 1IZ0A 3B1FA 4IY1A 5IKOA 3MSCA 4CEJA 1HLFA 4ZQBA 4AWXA 1ODFA 1YULA 4NEGA 5CJ2A 2HVIA 2V58A 4MVJM 4XJVA 5CB0A 4C7VA 2P9JA 1BS2A 1SCNE 3BE8A 3WGHA 1R9MA 3AESB 1OXSC 1I24A 2FUG1 1KS2A 5EKUA 2ZDQA 3OPYB 4KLHA 2Z6VA 1CY2A 1WB9A 5HCNA 2H59A 2GD0A 3F49S 4Q3NA 4EBFA 1JYSA 1JQ5A 3SC2A 3SOZA 7REQA 5ECWA 4ZI7F 3TW8A 1XQWA 5CCBA 4AQ7A 2B3TA 3E05A 2IW1A 5DWDA 5JZOA 2XCRB 4OXIA 1UBJS 5FI1B 5JDIC 4EENA 1DRJA 4ZT5A 1CDEA 1YCDA 4I46A 2BGGA 3CUKA 1CR4A 1FFXB 1UBLS 1RRGA 2OQ2A 1ED1A 1GGFA 3E4CA 3LT0A 3IEKA 2VUIB 4R71A 5LU8A 4IIJA 4WLEA 4EL5A 2BR3A 2WSLA 5J4HA 3O0DA 3VYUB 5ALIA 3N0TA 3PW2A 3VI4B 3TK1A 4MEAA 4ZMSA 3B48A 1W8DA 2ZR7A 4GGOA 3T9CA 1PSWA 3KYCA 1Y8RA 4I4TB 2WUEA 5LA6F 2CLLB 3JX9A 4WNAB 5GJVC 1A9RA 1UFKA 3UOGA 4C88A 5L45A 1G64A 1L7OA 4C01A 1YC5A 1VPDA 1SVWA 2RI1A 1NQ5A 5JXJA 3FFWA 4C07A 3U7RA 3MG9A 3BD7A 5HYVA 5IIMA 3X2EA 1G21E 3B6EA 1KVUA 2OR3A 4UOQA 3ZXSA 3RC7A 1ZCBA 3IAS6 4HNVA 4IIXA 3GXOA 1ZL0A 2HQSA 1GV0A 4LQDA 2I2AA 4XIYA 1Y81A 3CGGA 3TTTA 5EXTA 2PUVA 4MB6A 4BDTA 2QPOA 4D5GA 2B20A 2ADFA 3PQ6A 3UOWA 4U02A 4M99A 4CIVA 7GPBA 4X5VA 4FHGA 2Z56A 1GG2A 4JUIA 2JAOA 2P0YA 4B3MB 2QQGA 2P40A 2GARA 1I9CA 4ER5A 3JRWA 3L1VA 4DIEA 2IITA 3AM1A 4J7XA 3BWBA 4UCQA 4F6CA 4OJKA 1XN1A 2DWUA 1JAHA 4LVOA 3BQ2A 3OUUA 4D4LA 1Z5OA 1PDOA 1P1KA 1HR0B 1Y48E 3NALA 4EMTA 2C2MA 2OOSA 2ZB4A 5DBOA 1WPXA 1W9HA 1KBOA 2FNAA 1OH5A 1FJHA 3IEVA 1RVV1 5IYZA 3OX3A 1KEVA 4PFQA 2FCAA 3BQ0A 3FDXA 1M6YA 1WLSA 5BV1A 1KGSA 5CNKA 1Y6GA 1R0YA 1TKCA 2O14A 3C6BA 5ALUA 4ZFNA 2GN0A 1ML4A 3L0OA 2QYSA 5H0IA 2ZM6B 1D2HA 1Q7RA 5DG7A 2NV6A 3CGWA 1ULTA 1Y63A 3KOXA 3IOBA 5J47A 1WEHA 4YPOA 1XJCA 4EB8A 4URFA 2P9TA 1MC5A 4IGIA 1PQYA 5TMBA 4R81A 2NQ2C 1S8OA 3AJDA 4M0KA 5DEOA 2PNFA 3W3AH 4XVHA 4NMHA 1C50A 4JLSA 3OM9A 3HYCA 5KNCA 2ZULA 1Z2PX 1KAMA 1ZGGA 1H23A 2X4GA 3K1YA 1PNOA 3K05A 4A91A 2CXTA 2UVRA 2Y1GA 3D59A 2O50A 2VHQA 1L4YA 1ECWA 3D8UA 4RNMA 3ZD7A 1YCHA 1XSPA 1G291 1R5NA 3HJAA 4CM9A 1YD7A 2OB2A 1GAWA 4OJLA 1ZY2A 1TVCA 4MRSA 4MULA 5L51A 3PCRB 1JEQA 1XRQA 2CLEB 1HORA 4BU0A 3JWGA 1UIMA 4HQRA 3DQZA 4AZSA 2ODQA 3GA7A 4FVTA 1OGJA 4RY9A 1T5OA 5LMNB 4ZEXA 3C1ZA 5ICGA 3VR6D 1IEXA 1DDOA 5HGXA 1BS1A 2H4YA 4EHKA 1AB5A 1SUWA 4GX2A 1DP4A 2R8GA 3AW8A 3KJGA 3QXXA 4PTYA 2QJFA 2P66A 3DE1X 5E7IA 4KIJA 4Q66C 3PKJA 4UNQA 3EMKA 1Q74A 3GLSA 3M83A 1UDAA 5T6BA 1Y1LA 4Y1GA 4PSAA 1ZQOA 5JEEA 4TMXA 2OO3A 5CFOA 3EW7A 2EDCA 3CG4A 2XUJA 3WGLA 9ICSA 1VBNA 3C6ZA 1BZYA 4G5OA 3T9AA 1HE4A 3H0LB 4EABA 3PT5A 4R3NA 1NM5C 5LM3A 3MQ4A 3TSYA 3LPNA 4BS9A 4FBTA 2PRKA 5G2OA 4M0FA 5JSQA 3KWFA 3ESRA 2JFNA 3DBRA 4J1TA 3LNCA 3GLFA 2GD6A 4D9HA 2QRHA 2NTNA 2QSJA 4IZOA 4I5GA 5B53A 4N18A 1RBMA 1S9HA 1OJLA 1ELOA 3ZC3A 3PCXA 2WSBA 1PVDA 3BRWD 4D82A 4PXAA 1I7PA 1OFIA 4AAYA 1U28A 1QS0A 1WBJB 2QNIA 3GR6A 3VPGA 1EDOA 2OWEA 2H1WA 3I4FA 2QMHA 1PGQA 7ICNA 2P4SA 4MJ7A 4QC2A 1JLRA 5E38A 4QFBA 1M1UA 4JKIA 4QT0A 1Z5PA 2PGAA 3UF0A 4E5VA 3NHMA 4FQ8A 4O4LB 3QNWA 4ZOAA 5EZQA 4F45A 3ETRA 3GX1A 1ZOPA 1FRNA 1N61A 3VR4H 1E2NA 4X6LA 5LIRA 5DNDA 4U2KA 1AX9A 1SCQA 2UKDA 2WJ3A 1YRHA 3EIFA 1XZFA 4JB0A 1RZTA 3M1AA 2QTLA 1KFDA 1R6DA 1PUXA 4UKDA 2O0JA 2CHFA 4NU5A 3RYHA 3NAZA 3TQRA 2K7FA 3WBJA 2J33A 5CA0B 3I8OA 1K6MA 2DFLA 4ON9A 4UTNA 3IE2A 1QFYA 2GXSA 2J07A 1DMSA 2PV0A 2H5LA 3CNNA 3UQYS 1ZUWA 5BQ3A 2O2GA 2PYIA 2V8OA 3ZKWB 1A04A 2Z2XA 2VPTA 4NXMB 3W1WA 1MPXA 2RH9B 1T2AA 5J0UA 2JLSA 2HIGA 2BEWA 5JTUA 2TS1A 2ZIUB 4CV2A 2X0FA 4OQYA 4F8JA 3F7OA 2JV3A 5KVAA 5D8DA 9LDBA 1TM3E 4JUCA 5L1IA 1UA0A 3QKUA 3KIPA 2FN9A 3SX2A 2FX2A 3ZI4A 1A9PA 4ZMRA 5AVUA 4ER3A 4D9MA 3UXPA 1BDHA 4A0RA 4CRWB 2AYZA 2B37A 2I2BA 2ATEA 2ODGA 3H4MA 4UU0A 3KB8A 3Q6IA 4PHDA 4B5LA 4HDRB 4V2IA 2OZLA 5SY6A 2GERA 2GPJA 2CD7A 5BSRA 3DT9A 2NG1A 1YXMA 3HJUA 1C81A 1KNQA 3ICWA 4IFEA 4JJEA 1YH3A 2D13A 3WLJA 2C3MA 3GU3A 1U9YA 3ZDYB 2ADOA 3VYSB 2VHEA 3D3EA 3SQWA 4AIRA 1R4ZA 4ECQA 1H5NA 5BW6B 1YOVB 2A6PA 5LP6C 1RIIA 4KDEA 1TECE 4LA4A 3A4YA 3A9SA 5EEGA 4MR7A 1L9KA 3TTWA 1U1DA 1EMDA 4X3OA 2ZB7A 2PUFA 4IQ8A 2PJDA 2OO5C 4PGGA 5FUBA 3FGNA 3HY6A 1LNSA 3AEKB 4DG8A 2CVQA 2J3KA 2QLTA 3LWMA 3DYBA 821PA 2A86A 5JYCA 3VOAA 4D4GA 3HDHA 1C4WA 4FCCA 2HT1A 2X19A 4WFQA 3C3YA 5DKFA 1RMTA 5IF3A 3Q11A 9ATCA 1B3RA 3CRMA 5JNVA 2GOLA 4JXJA 5CB8A 2JCYA 3BT7A 3TOCA 4DM3A 1ZNZA 3CEMA 5AVRA 3VXKA 3B89A 4TS3A 4QWBA 1I51A 1EHIA 121PA 1ZITA 4BDPA 1O1YA 3U7JA 1MF7A 3PTAA 2EXXA 4IMRA 5KOYA 1WRBA 1TMYA 3A6FA 4QEZA 2D8AA 1T9GS 1KQGA 2IYUA 3NUQA 2ISQA 1H1DA 3VDQA 2JI9A 3MCZA 1O7JA 1RAFA 2WIGA 1OV4A 2WTXA 1H2XA 4LK3A 4JLAA 3C7DB 1J1IA 1F51E 4MKZA 3T7AA 3G0IA 1KARA 2C1ZA 1GGKA 3RAJA 5G0WA 4ZDKA 1T35A 3GLVA 3GJYA 5LP6B 3VOSA 3A1FA 5GONA 4LBZA 2I4IA 2ET6A 1CPYA 3T79A 3PDIB 1ZUNA 3AESA 3DE3X 1H2YA 1JJFA 3WB0A 4H1TA 1JJVA 1DPGA 2PH5A 2MDTA 5K6TA 2ODAA 3A6KA 3AI3A 4WUVA 2BUCA 2M6LA 3ICEA 4IJUA 4UD2A 3PW7A 1QO9A 1KFSA 3IC5A 2ZIVB 1YQEA 2P8JA 3RG8A 4F72A 2PX4A 4YONB 4NLZA 1O95C 2VHYA 1A8PA 5JPIA 2HF7A 2VN8A 1FFXA 4BB5A 4M22A 1JHVA 4PPNA 1WSBA 3HA3A 4FFLA 3PD0A 1TD9A 3L0DA 1N0UA 3I5MA 3I64A 3VO2A 4Q43A 1J9GA 4ZV7A 5TSDA 4DWJA 4MW9A 1D3AA 3T41A 2B9EA 2QUAA 3OY7A 5K3OA 3WRXA 1MG5A 1V39A 1OXUA 3GY0A 4I4TA 3ZHQA 4WNAA 3U7GA 4TURA 2RDIA 4ZQCB 1DJLA 1WJGA 1LD3A 1J1UA 1C0EA 3DZ8A 4H77A 3N0WA 1XZMA 3WQSB 2WF5A 5DHTA 5B1HA 4YG2A 1C1YA 3DVSX 5FO0A 3IV9A 3VJLA 2AZTA 2V9ZA 2A30A 3DZDA 3RFFA 2UVPB 4K2HA 5HOQA 4F5EA 1H65A 2X6RA 3L4PA 4ENUA 1PTJA 3U4QA 1R0ZA 4JWKA 3K1AB 4UVIA 3Q98A 3O82A 2AN3A 4H16A 3MUFA 4UUQA 3UMBA 1JDUA 2CF5A 4WH0A 3NH6A 4AFNA 3O0FA 4F3RA 4F4KA 2YYYA 1I2ZA 3AR7A 4FP9A 5IARA 2FSPA 5JDIA 1PR3A 3AJRA 1ML3A 4ITVA 3T3PB 2QUIA 2BDPA 4RETA 3R0ZA 2HMAA 3MD9A 4Q4LA 3M7DA 5AK4A 1K8XB 1RC0A 2O2CA 3UXHA 3TINA 3LXMA 4FWBA 1OTXA 4YVFA 3TSOA 1QHEA 3UANA 3KKEA 621PA 1SWWA 4IXNA 2UYCA 3N0XA 2IVZA 1XVVA 1JHAA 4QZ8A 4CL0A 1SG6A 2RHJA 2VT6A 3KEFA 5ULLA 3H11B 1VZ2A 5CVEA 2Y1EA 3AF4A 4ZO6A 4L5YA 1UKBA 3KKNA 4PAQA 5KFMA 2KKVA 5K8LA 4EARA 2EFGA 2IJGX 1D6SA 5DP2A 2PX2A 2VF4X 5IPFA 5F23A 5ALNA 4RF3A 2G80A 2JK1A 2FE1A 1VLZA 5CTAA 3ZLBA 2FI1A 3TQOA 2H11A 2DCUA 2FPUA 1DARA 3AVYA 2HBLA 5SYAA 4GIBA 4YREA 2C5HA 3NBUA 2OBLA 5BSWA 2I29A 2P9CA 3KL4A 2NP6A 2E6UX 1YL7A 3IRUA 2APJA 2DM6A 3PSFA 3AHGA 4RQAA 2B8EA 1QFSA 3E58A 4EB6A 4KK3A 3V1MA 4DQIA 4ED7A 5LIPA 4IO1A 5AW7A 4U7WA 2FP3A 1RC1A 2NRZA 4ERNA 4OJTA 2R3SA 1HPLA 5F1YA 3DCIA 4BP8A 2QJTA 4J2TA 5IEBA 1GN8A 2FG5A 3BE6A 2G0NA 5AM5A 2QPAA 2AKAB 3IT0A 2PQ0A 1QUEA 4J94A 2ZPTX 2DG2A 4QLOA 4QDUA 2FZLA 2OAGA 1EWVA 4L4RA 4MA5A 4J7CA 4MDFA 5JT1A 1HF3A 1A8IA 1ZYUA 3QLTA 1H0RA 2JLUA 1T36B 2O2HA 4UULA 5EHIA 3ZK8A 2H9AA 2O8DA 2BMEA 1ZRNA 1Y82A 1DAOA 4KQHA 1GP2A 2R7AA 4P4SB 4UVDA 3FOWA 1P4RA 2OBFA 4PR0A 3HL4A 4MGIR 2H5EA 5ENZA 4ELTA 4HWOA 2H3HA 4I8IA 2PK3A 1U4BA 4ZTUB 5HJ5A 3S2ZA 3B13B 3LTNC 1UK8A 4EW2A 1Z6YA 8ICCA 3DAFA 3TQHA 4Y3UA 3TQIA 5AVVA 2CF6A 3HCWA 5HDQA 1YZQA 4C2BA 4OEHA 2XMZA 4PG5A 5F2EA 4HQFA 4DCTA 2J32A 4C4YA 5HQTA 5L3ZA 2YS7A 3RF6A 2UYYA 3E9CA 4V39A 4IR9A 4OQNA 4JLKA 1ZRMA 2AFIA 10MHA 1JQKA 2XOXA 4RK5A 2NAFA 3ZIDA 3B9JA 1EXMA 1CUSA 3FDZB 4G5RA 1U5BA 3NHAA 3R6WA 3EDRA 1QIEA 1PWYE 2HO5A 4E7OA 1J9EA 2Z57A 4R1QA 1W4AA 3OOEA 4A73A 3KV1A 9ICGA 1R0XA 1LB2B 4RPJA 2N1RA 5KS2A 1SM4A 5G0UA 4X44A 1UBEA 5CA1F 1N25A 4A5OA 2NVUB 4KU4A 2FR0A 2XWSA 2JHDA 3HU5A 5AOAA 1YTLA 1A98A 2FZCA 5CNJA 1YZNA 1T0UA 4L8FA 2CD9A 3NYRA 5L7WA 5ITSA 4WDRA 1KH2A 2I91A 4BEWA 2HLNA 5MGNA 1M2EA 2G9UA 5HIIA 5ER6A 4N7RA 5TQVA 1E2HA 3QHPA 1U2ZA 1A8SA 1XNJA 2P6UA 2XUOA 2H29A 1Q77A 4B3GA 4UQGA 3VR1A 3ABIA 2C95A 4GX5A 4O2BB 1JFVA 2G17A 4I99A 3P9NA 2HL6A 3L4KA 5DB6A 5THQA 8ICGA 4AQYB 1C9DB 2ZRNA 1MW8X 1RJDA 1ZSYA 1R15A 1G5FA 2WWVD 1U0TA 3VSDA 5J2UF 2OFPA 5HW0A 4LJ9A 2OT3B 5KNDD 3W6PA 3TVYA 2WABA 2O2YA 5AM3A 2ASJA 2PYZA 2YYAA 3ZLUA 1IQPA 3U3DA 2L18A 3CX7A 2NO4A 1QQTA 3OCVA 1E61A 1UZUA 3SEFA 1JT2A 2NU8B 4FFNA 4PHHA 5KG3A 4X66B 5FBKA 3SJBA 1JXEA 1FSPA 2CMHA 1S4QA 4QYXA 3WLMA 4D9CA 2G5TA 1N5LA 1JHUA 2DTXA 3NPMA 5IWCA 5B2EA 4G89A 3IP1A 3JVUA 3KX2A 2W9BB 1AC5A 3OC0A 1MZPA 3C3KA 2C9ZA 4KFUA 4Q9NA 1TCVA 2CXHA 3W4JA 4ZJPA 2IYYA 1JR6A 2EQAA 2VXCA 1M34E 1U9CA 2C3PA 3FFXA 1ODKA 4BGDA 1HG0A 5FP0A 1QBKC 4I1VA 2OOKA 1J1ZA 1UJCA 4Q82A 3KE9A 3V8NA 3SF0A 1TADA 3U62A 3V6JA 3MQ2A 3DMGA 2J7PA 3D6MA 5IXJA 3RFTA 2WVGA 3T4EA 1I33A 5D87A 4DABA 3C4VA 1SQGA 1N5WA 3WGJA 1ZM2A 1CUDA 2WE7A 4KMUA 4AMGA 4QUBA 5DM4A 3ZU3A 2IP4A 5JCJD 3THXA 2FEWB 5A9SB 3K09C 1YOVA 3OPMA 3O8LA 1Z8NA 3Q9NA 1O4VA 1JKJA 3VR5A 4YEDA 4AS3A 3TJRA 1L8OA 4MS4A 1TA0A 2YMMA 3JQ7B 1ZOLA 2PU5A 3AB8A 4UXIA 3V42A 3PX4A 2EGGA 3GRPA 4NDAA 2XCQA 4N12A 4P7JA 4EB0A 5REQB 1E94E 4EW1A 2CFRA 2F3NA 3AEKA 2FCRA 5CVVA 5CLQA 4Q7EA 2PUHA 5JD5A 3E7FA 1Q84A 4FMDB 4XXHA 3HDQA 3QOFA 4KXYA 1X1SA 4RF4A 1P8JA 1WLYA 1SXJD 1MRSA 4Q9JA 4FNGA 3TF5A 3KV3O 2ZBRA 4KR7A 1CDDA 1E7SA 3TX2A 2KTQA 4MIOA 1T5IA 1PL6A 1U02A 3U31A 4X7BA 2OYSA 2O3QA 3N87A 1PJTA 2XKBA 1IN8A 2OILA 2WQ6A 3ESDA 1X2IA 4RK7A 5ESDA 4UASA 5J2EA 4BXOB 3UAXA 1ZFNA 1GTMA 3PUIA 3SE0A 1WIWA 1NBIA 4OHFA 4QASA 5I01A 2FGKA 4M9QA 1WOYA 5CAEB 1L5UA 4G63A 2CMFA 3A10A 1E8MA 2E49A 1OZGA 3WWDA 2WTAA 3VH2A 4N0MA 5F5NA 2QX7A 4TRMA 2GWSA 1V2GA 2JKVA 5IDXA 2L69A 3VDMA 4W7SA 2DKNA 4KXNA 4ARBA 3NC0C 4RW0A 1H6BA 2XEDA 3PDIA 5DYYA 4FFVA 1WKBA 1JHQA 4QELA 2IYZA 3PNLA 5JXHA 5J0PA 4INOA 4D4HA 4G0YA 5C9ZA 3QYJA 3QSGA 4P0QA 3NU1A 3L93A 1XKXA 1COZA 4HFRA 4K6HA 1U1IA 5DLYA 1NR5A 3KQPA 3U7FB 1GZ5A 4O4HF 1KE2A 5BWCA 3SC2B 7REQB 4NDNE 4UATA 3M5DA 5IFLA 2ZIVA 2XT6A 1FDTA 1M0TA 2QSZA 4Y6QA 4OHBA 1BVYF 4R4JA 1IBLB 4OMFG 2CV2A 1BD4A 3T5JA 4P5PA 3ZZ0A 2I9KA 3AP3A 5AM2A 2VPYA 1AROP 3HNPA 5KFLA 5LR6A 2P1ZA 4CMIA 1R9GA 1V0JA 3KT6A 4ZT6A 1KTIA 2NRXA 4ZVSA 2PFOA 3B9RA 4IIJB 1B42A 5BR1A 1F2VA 2QN8A 1U31A 2BEVA 2H6EA 1CB7A 1ZO8A 3R4VA 3HBJA 1NQUA 4C06A 5C5EA 1DC3A 1NRWA 2C77A 3FMVA 2QRLA 3IP8A 3KYCB 3RNLA 3OPQA 3B3JA 1Y8RB 3D81A 1E5QA 1N2GA 1R16A 3R5SA 1RPTA 4BX3A 2NP7A 3CVWA 1E96A 3KWMA 1YAJA 4TTVA 4KLIA 1ODLA 4U7CA 3OJLA 2YWCA 2EQBA 1VHDA 3G2QA 3PR3A 2IPXA 4R41A 3OKFA 3C3EA 4OP3A 4D9BA 3K1AA 4CRXA 1SULA 1GYRA 4K6FA 2OWDA 2HSWA 4HAIA 4P4PA 4LNUA 2ROQA 2G9QA 3DT8A 1YJCA 3AY3A 4W63A 2ONYA 4BFCA 4JY7A 8ICKA 4DSTA 2NYRA 2PSDA 2UUOA 4S0XA 3I61A 1O95A 3CR3C 1H2WA 3P0RA 2C9OA 2Z95A 1AZWA 3ONNA 1NN0A 3JQ6A 3VAAA 1QLHA 2W2OA 1CQIA 2K4IA 1PGNA 3C48A 2IU6A 2DXIA 1OX5A 3UGQA 3UWMA 4DQQA 1E2EA 1N2XA 1WVIA 3CX3A 2W7TA 2FUG6 3Q7IA 3R6LA 4CG0A 1QH9A 1H6CA 5IYZB 3O75A 3KOYA 2C29D 4K26A 3ROZA 1Z06A 1V5WA 1Z4KA 3IX7A 3EZ6A 3W6ZA 1W6UA 3H65A 4Y2QA 3KLPX 1O89A 3DS8A 2IS6A 1JXLA 4XLTA 5DW0A 1VYHA 4HQNA 2P1RA 3WP0A 1EE1A 1EIZA 2OBBA 1LKZA 1TW2A 3M6MD 5LJIA 3MFIA 4AURA 5A6VA 4NNOA 3WKAA 4EITA 4YCCA 5IP5A 3PI6A 2IPAB 1V5GA 4HAVA 1ICIA 4PLHA 5DYIA 2D0DA 1YV9A 4W9MC 3OUZA 2XUIA 3FETA 5LQAA 1ZM4A 1NK0A 4AXXA 4M2LA 5MDHA 4YDQA 5A6SA 5J9FA 2X7JA 4QRIA 3CKYA 4P2GA 2UUPA 4X00A 1ABEA 2J3EA 4G5HA 5IAKA 3A4IA 2RFLA 1CVIA 1TMGE 1W46A 2FVYA 1TVKA 1JEQB 2PZLA 1W7AA 1OXMA 5BQFA 1OILA 1A0PA 3H0RB 2YFKA 1CHNA 3HMKA 3C6XA 4YD1A 1T36A 1J8MF 4AZ0A 1PS0A 1GPWB 1HZZC 5K8UA 4B81A 1JECA 1UBUS 3ORYA 1KBQA 1YI1A 4TVSA 1XCBA 1O8CA 3AVVA 1NQOA 4GXRA 1HYHA 2WK1A 1FYXA 5CVJA 4YXJA 1NNI1 3TZEA 2KFNA 4GMFA 4OLFA 3GW8A 2REQA 4QFMA 1OY1A 3OE7A 4XUSA 1C3OB 2LNDA 1Y89A 3N7UA 2BM9A 2DLNA 4GZ6A 4DNOA 4JLWA 5A0VA 5AW6A 4EATA 3VC2A 3RKRA 1X74A 1HE3A 1WKVA 1T15A 5B6PA 4C7XA 1HNWB 2YQZA 3N59A 4Z0HO 4MO2A 4RLHA 3OCYA 1BHJA 5A2QA 3Q3JB 4JEUA 1DAIA 1U1CA 1LUAA 2VWGA 3R5JA 4I08A 3DMFA 3LUCA 3WLHA 1SAYA 4EG1A 1OH8A 4H59A 5DRTA 5IW8A 2Z6AA 1H2FA 2W9CA 1CEXA 3ZV4A 2QN2A 4I5IA 3EC2A 1RC8A 1ZYQA 3RUIA 4AMZA 2IXTA 1R5JA 1WU8A 1BTOA 3O4IA 1Q17A 4KVAA 521PA 3IVAA 4ZAYA 1RRFA 3SK0A 3QVLA 3DBRB 3MXTA 3WRYC 4UDNA 1GFSA 3LP8A 1ZAKA 4A2QA 3I1FA 3G0GA 3QOWA 4K86A 1AHNA 3QKSA 3DCJA 2XCLA 3BGDA 1E8NA 4RX1A 1Z3IX 2PE5A 4BGEA 3F6CA 3QBEA 2VPZA 5L3RA 1QS0B 2XE8A 3BIXA 3AKYA 1E64A 1M1YA 4I4CA 1F2DA 1XK6A 1XWWA 3LLVA 4GFDA 3JQFC 1VCNA 1DQRA 4UQLA 3PJGA 5LZ9A 1LS6A 2NYUA 4DF3A 1WR8A 1Y1SA 2P0AA 1QX4A 1EUQA 1OVMA 1OTYA 3FF4A 4YUYA 3L8FA 5TGDA 1J6UA 2JZBA 3A0BU 5ECGC 2HFJA 1YJQA 5AKJA 4QKQA 2ZGVA 2QJOA 3B78A 2JHAA 5A02A 3E22A 1IY0A 5ETJA 1I3MA 3QG5A 1P9WA 4TVBA 4HV4A 4D4IA 1X66A 2QTRA 1FDIA 2KNJA 4B73A 3JWEA 2BUBA 3RUFA 4DDHA 1E92A 3EEYA 4X20B 5BT9A 7ICEA 1EFPA 2VK2A 3D2CA 4YFKA 4LYAA 2C82A 2GKSA 2Y77A 4YRZA 2QXUA 1X15A 2C8JA 3PQ5A 1FL9A 1E1YA 5LQCA 4Q47A 1D0VA 4HADA 4HFMA 2NU8A 5CXSA 3L1IA 3EFBA 2PXHA 4MKXA 2YQ4A 2ABWA 3NWBA 1SU7A 5KFJA 1YRLA 1R9NA 4K8RB 3KJZA 4TUYA 1V3QE 2EWMA 1D4OA 4QZCA 2HPHA 2UZ4A 2G5HB 3SVTA 1A27A 2BEWB 2PCLA 1XNRB 4NG5A 4QJ5A 3ODGA 2GHIA 2PI4A 3HA7A 4ZQHA 2WUWE 1XKLA 2GLEA 4NOMA 3GUUA 5NULA 1JPUA 1O58A 4GLXA 1XMJA 5I7AA 2FPOA 2ZT6A 1TF7A 4BLTA 2F1IA 3IHQB 2I3BA 4E08A 3RS0A 2GBCA 5ILGA 2QMYA 5J0SA 3GHYA 4ITUA 1LBQA 2DR3A 4EY5A 2OZLB 2FG7C 4N0DA 3V9PA 1HYQA 3IOMA 1CUCA 1CR0A 2DJIA 4E30A 3BVPA 2NUBA 4O9MA 3LC2O 4YHHB 4KLCA 1B14A 4TUQA 5ISMA 1GILA 2G9ZA 1JJBA 4IV0A 1RM5A 4DNQA 5IDWA 4WINA 1JH9A 2WZDA 3AOGA 1I30A 2VO1A 4J9QA 2P3QA 2P7HA 4UM8B 5C5JA 3HR7A 4L8YA 4LIPD 7ICSA 3JQ7A 4X8MA 3T5LA 3UV7A 5I7VA 3GP3A 3SU8A 1XVIA 4DJ5X 2P1DA 1OWLA 4MR7B 4R9UC 5REQA 2Z09A 1MGPA 5BSMA 2DQSA 2ZRCA 1ND5A 5I9MA 3SS7X 3QEMB 3QV1A 2NVOA 5C7LO 4IQFA 1SOUA 2P2CA 4RULA 1ITZA 4OXRA 3H9JA 4QRDA 5A7FA 3PC7A 1Z7GA 3BSSA 4MVWA 4EH1A 5F9HA 3OFVA 4QM7A 4CQLA 2DWCA 1DKRA 4ALKA 3CTMA 4YRLA 2FMQA 1AGNA 4A1FA 1WHSB 3JWPA 4RMIA 3ZD8A 3AQIA 1C1DA 1JDSA 1KDHA 3RHSA 1PR5A 2DBYA 3UJ7A 2V6FA 3P8ZA 3R24A 1D8LA 3WRXC 2H3FA 1W29A 1SPBS 3UJDA 5DKWA 3S3TA 1ZLYA 4PV7A 3PV8A 1OUMA 2CT8A 2GNAA 1YQ9A 5CU7A 1LY1A 3K09A 3OVMA 4XIIA 3RAGA 2G1JA 2ENWA 3RS3A 1R3UA 5IUKC 1SH7A 4IVNA 3GWGA 5GONB 2EAMA 2B7CA 5EWFA 4DWVA 2Y0CA 1UT5A 1O9GA 3NQ41 4G5SA 1ZUNB 4DPMA 7ICGA 3GPCA 2XMPA 4M9ZA 2R7NA 1Z4JA 3RBDA 1PTJC 4HWPA 4IRCA 4DIKA 5ELMA 4PFJA 1ADGA 5FWXA 2QTNA 5J5AA 4WASA 3OTGA 2WAAA 1UQRA 2ZOSA 2JB9A 5EKSA 3FYTA 4QVGA 4ESEA 3EB9A 1ZONA 4QFCA 4N0PA 4XR4A 3DAPA 4XVQA 3T1OA 3DR5A 2E1FA 4IAOA 3FKSA 1BJRE 3L8EA 3GBVA 2ZAMA 2ZYGA 1S2GA 4DPLA 3NVAA 2PUCA 1IHOA 5T6MA 4LMAA 2QB0A 3L40A 4RWEA 4AL4A 1T43A 5ESWA 1RXYA 3OPVA 5E1DA 2F64A 2XE7A 5CGZA 3E3MA 3FWHA 4PQRA 4IH9A 5EE0A 4YRSA 1L6NA 5J29A 4B6RA 4QZHA 3FGZA 1KO7A 2IODA 4NMWA 4NMXB 4X0EA 1LS1A 1CCWA 4RZHA 2IZ7A 3V46A 1KEKA 2BKUA 3V34A 2DPGA 1WD7A 5DX0A 2H3EA 5SZIA 8ICWA 2KSQA 5LQKA 3TZKA 2BW0A 1Y4SA 5FL7A 5GOZA 4IIDA 3U4QB 5FH9A 4X3CA 4KB5A 2JASA 1XHEA 3OTHA 2WRZA 1LPPA 3LWNA 1KE1A 2P2SA 3DLIA 2CFTA 4BVEA 4JV2A 4TZTA 4U7PB 3ASVA 1S1MA 3V33A 1NVVR 1VXOA 3JZDA 1KVSA 1NYQA 3CPJB 2MSCB 1GKIA 2QVYX 3Q0EA 5C46F 4FOTA 3D54D 1IN1A 1K08A 3IOYA 4OREX 3CNBA 3LXXA 3TD9A 4BEJA 2J3JA 4ED0A 3O2JA 3VZRA 2X1HA 3I09A 2DFKB 4HJXA 2X5KO 4NFHA 4U8HA 4CL8A 3QE0A 4DG9A 3UPUA 2OBYA 3UPDA 3E53A 4WZ6A 5JUMA 4QPNA 4IX9A 4AYWA 4OHVA 1ZJMA 5IWAB 5D3MA 2R84A 2QKYA 1UBMS 5FOXA 3PSPA 1TM7E 1G3IA 1R0CA 5G53C 1GCIA 4OB7A 3FOCA 1RWVA 5HKOA 3F3KA 2RK3A 5H59A 3CPSA 4EECA 1IBSA 5G1PA 3JXEA 3PX0A 3ACBA 4GI5A 2CEAA 4E0BA 4QZVA 3A3KA 3KU1A 4PSUA 3I72A 4MVXA 2BCGY 1GGVA 2JAQA 3AM5A 4LJYA 4RHUA 5LN1A 4TYMA 1W88B 4G1MB 1AKMA 4WK0B 3CZ5A 1FW8A 3UWKA 3CIFA 3L6RA 1P2UA 4FX5A 3R3VA 4EB6B 3ZDBA 1YVEI 3WXBA 4OQXA 1T13A 3WGQA 4O33A 2JPDA 4F12A 3K0HA 2WJZB 3AZQA 3VMFA 2BBTA 5D49A 2VAWA 1LLDA 3TIXB 1D8BA 1MGOA 1XDZA 3VU1A 4OL9A 4TKLA 3OCUA 1EJBA 3B0XA 4YJ2F 1S10A 5AMXA 2YINC 3MR6A 5BOMA 3HKZC 4A6PA 1ZD5A 1PFYA 3DOFA 4WOBA 3C6YA 3N2GB 2OHIA 2GUGA 5I7EA 4TQUS 2Q2NA 1MB4A 3N4MB 4BBJA 3A6HA 4PVCA 4MWSA 3VM6A 5CCXA 4HLQB 1TC1A 3O74A 2EEZA 4O08A 3KYIB 3L4BC 3PXAA 4CI9A 1KZGB 2ACKA 1ULUA 4CGYA 2O8DB 1MQ8B 3KQYA 3EH1A 3GRFA 5K0FA 4ND6A 1O08A 2QW1A 3C7CB 2HU2A 3RF7A 4MK4A 3GLIA 2HWYA 3ZS8A 3IKJA 3EUFA 4QLAA 1C3OA 5BVGA 1YQWA 4KR6A 4ISBA 3WI7A 4YH1A 3R7DA 1KN5A 1Z2EA 2OLEA 1U49A 1GNPA 3Q8MA 3SE7A 1XTJA 2HGSA 1A6SA 4L9SA 3HRDD 3BFXA 1NXXA 3K0SA 1NF3A 3UAZA 4IUDS 2LM4A 4RHFA 3CBQA 2YDXA 1MKYA 4I0WB 2ZBVA 1E9AA 4YWHA 3KB1A 2MYTA 4GQBA 3DKIA 3K1TA 1KKLA 4Q01A 2AFIB 2WYHA 1W4RA 3KVRA 2OD7A 2Q2QA 3EE6A 2DECA 3AUKA 3QWFA 1IQ0A 1ND6A 4QARA 5KWSA 1EXDA 1CWUA 4Y0AA 4BUJA 4EVRA 1KLNA 3GMIA 3R0IA 3Q8PB 1U5BB 5IINA 2AQKA 5AJXA 3EWIA 1ZH2A 3E0QA 1KJJA 1NPYA 4INJA 2G67A 1ZWKA 5ALHA 1FXUA 3GK3A 1HZZA 3DXYA 2EKDA 3ZW7A 4HS4A 3NHUA 1PF7E 1V26A 4JX8A 1KYVA 2ZSBA 1IWPB 2ZRDA 4HUJA 3FLEA 1QO0A 2QUHA 2JGAA 1CQJA 3D8HA 1NXSA 1GPJA 3PWKA 2O1WA 4DR2B 3HPRA 2OV8A 3RIHA 1HFEL 4NZ9A 3VSCA 2H7YA 4YCDA 3WJ1A 4DR3B 3EVFA 3ES9A 4GKKB 1J8YF 4US9A 3RFCA 1PG2A 2G1KA 3SHFA 4JYPA 3R20A 4YO7A 2LYAA 4R2MA 5DNYB 5A0FA 2Y92A 4RHCA 3DV9A 1AHIA 3U3JA 3TDMA 3PQFA 1L3VA 2R79A 3K92A 2OFWA 3SJ7A 4RY8A 3VC7A 1MC1A 4X20A 5SYMA 2VJ4A 4DARA 2AMYA 2IE8A 3AF6A 4KVZA 4RORA 3IURA 5JE8A 2XA9A 1V16A 1LGYA 3RBAA 4BFXA 1JG3A 2Z04A 3LVRE 5HF9A 4X85A 2YZMA 2YV4A 3CUTA 3WRYA 5K0BA 3I2JA 3QVMA 5CX1A 3L6EA 1W0CA 3UGJA 5CLIA 2YWXA 4II7A 1AOXA 2C5FA 1OW3B 4BJ5A 1EK0A 1EE2A 2R6R1 1EDBA 1S2OA 3BJRA 5AJYA 2MSKA 3HDYA 4YT4A 4J8PA 1F1JA 4LWOA 3TAUA 4DWOA 3R0VA 4O5CA 3TDKA 4P82A 2H17A 5EQDA 1MENA 3JQFA 2PMZC 4MA0A 1M5TA 1YB6A 1T4BA 1TFUA 1NDQA 3QMWA 1EVZA 5EOVA 3ZH9B 1W5TA 2OCEA 5TARA 3F2IA 1YVUA 3K9FC 1X92A 2IPOA 4JI8B 1XCPA 1W49A 4JGGA 3GROA 1FXWF 2AB0A 3DL4A 4K3UA 3THXB 3MC1A 3SAFA 2HCFA 3DWFA 4C05A 1KPGA 4MV7A 2RC6A 1JKJB 3C16C 3IKTA 2BGNA 4CU2A 4MS4B 2G71A 4MUFA 3COJA 4HLDA 1XZBA 2F9LA 1QR2A 4LE2A 3FGPA 1CJKC 4YB8A 4JA0A 1XCLA 3ROFA 5EPEA 2GAJA 2EAPA 3EDOA 2RMKA 2XB2A 1Z1BA 4I2HA 2EBHX 2IPNA 16PKA 4NYJQ 5DE3A 4U2GA 2CHUA 3QEMA 2R18A 4PZOA 3QEKA 2GCGA 3LDFA 1G4AE 3B3AA 5JSYA 2WINI 2QN9A 3DMRA 1WD5A 1QGAA 3UK1A 5JQWA 3EFHA 4XTCS 1ZEJA 3FI9A 2LPMA 5JZSA 3CUWA 4GDFA 3OZTA 4DUGA 4F97A 5D3KA 1RQ2A 3A2NA 3IAM6 1U7WA 3O26A 3SD7A 1H8ED 1WHSA 3L0YA 4V0QA 4JCOA 2J59A 3VPXA 3P2IA 2CYCA 3EVZA 4LTNA 5ALQA 1WBBA 4Q19A 5F7JA 2ZBQA 2A3NA 1EBFA 1TU3A 4MYSA 1LC3A 1ZIXA 2R8OA 2ZUWA 3OZEA 4BVKA 1H2ZA 1AO3A 2I4OA 1NQWA 1T5SA 2R62A 4DQVA 2Y2UA 5L4SA 3FBGA 5D86A 9ICLA 3BGIA 5C1OA 4NSNA 5CUQA 3QX7A 2ZXFA 2W2PA 4HVAA 2BMVA 4M7RA 2E0IA 1T9DA 4YY3B 3SHTA 3HNOA 5DTRA 2IHVA 1JJ7A 2X42A 2NXCA 3E0FA 1ZCJA 2FJUA 2WYIA 4P83A 1FYEA 1Z4QA 1JXOA 1Y1TA 2JH9A 4P0QB 4W6QA 1Q0RA 4MUMA 5FUYA 2IA5A 4UU1A 1B23P 4YRKA 4QOHA 2GCIA 1U6KA 4CF7A 1I1QB 4DSAA 2IIVA 4DMRA 4I4IA 1FRQA 4BYMA 4UTPA 4BE4A 2ZIEA 1U3FA 1I13A 5CP2A 1V9PA 1KMMA 2PL3A 1Y8QA 3S7TA 2H0AA 2JIRA 5FUWA 1N2CE 1TK3A 3TBKA 4JYAB 2VTVA 2IIPA 4YC7A 5FR2A 5C51B 1RHQA 3KWLA 5JXWA 2RGUA 5AH0A 4CMIB 2WV9A 3KPYA 5HDBB 4YAKA 2PLNA 1EK5A 4OU4A 1NVEA 2C57A 2RHDA 3H04A 4BJHB 4B6EA 2BPFA 5GIPE 3GAAA 4MW4A 5KSOA 5HXAA 4X5OA 1V3VA 5ALMA 2BEVB 1U6IA 1QDLB 3OEHA 2H92A 3Q7PA 1YVDA 3TFRA 4YCNA 1XVLA 3H6HA 2LP4Y 4Q9HA 5J2JA 1Q0PA 4PGAA 2I4LA 1WCNA 1H5UA 1XZIA 3EBOA 2PA0A 2COUA 4MW2A 4B6PA 1Q0TA 1IHYA 5SY9A 2HI0A 1J42A 1Z35A 1XHFA 2O19A 1U7TA 4TRRA 1D8TA 4C6SA 1SUCA 4EPTA 1TCUA 2XMGA 1K0FA 3V8BA 1JDNA 1XZEA 3VSBA 1WMBA 4BEVA 4JMPA 2F3RA 1YMVA 2G06A 2A9JA 2JHPA 2W6ZA 5FFFA 3D43A 4F5ZA 3IVGA 4YQZA 1NMYA 4XYGA 3TVTA 4LNUB 2YXDA 4Q44A 3RFUA 3A06A 4IFIA 4EVIA 1HWYA 3IR5A 1NVDA 3I05A 2GK3A 3H83A 1FFHA 3N8IA 3TNDA 5SICE 2PRIA 1B22A 3H5IA 2O0MA 1CIPA 3I4CA 3OQOA 1CQIB 4E5UA 4ZOLF 2DRIA 5AHWA 1WB6A 3Q5EA 1RRCA 4LE1A 4LOAA 1SGWA 1KJZA 1J09A 3VNUA 4KWEA 1XZQA 3K53A 2GH1A 4MV8A 2I03A 4OXQA 1IJKA 5KYYA 4UHKA 2B78A 5KWJA 4FT2A 4ZDWA 2OV4A 2O8VA 2I6GA 3DZGA 2CZCA 4P5DA 1GUZA 3K5PA 4TYQA 3HJGA 2GM3A 2AOWA 4BV2A 3ZPXA 1PX0A 1DZ3A 4C3OB 4FZJA 4OQDA 1SQ0A 1HM5A 2ZR8A 3LZCA 2VRWA 5I5EA 4G65A 3DKPA 3RRYA 3I6MA 2EWWA 3NHSA 1W88A 1DCTA 2IWHA 5HKAA 4TXHA 1E77A 3QOXA 2PFGA 3ORRA 1LJUA 3KJHA 2YTZA 4P53A 1MP0A 5BPFA 3ZE0B 1ZZEA 2FX3A 4C87A 5E7MA 2PEZA 3OZDA 3CVYA 2XZPA 2BISA 2CXRA 5CDUA 3DDSA 3B9BA 2R8JA 1IZ7A 4B3FX 3TCNA 4QQ8A 4AKGA 3KPWA 5A6SB 1AN9A 4L5JA 2ID7A 1A9OA 1NNUA 5BRNA 3HWRA 3IS3A 1IN7A 2V96A 2YMQA 2R65A 2AQHA 1KSPA 3A27A 1QYDA 4BKUA 3N2GA 1PDVA 2P11A 3NP9A 2Q6KA 2X9VA 2GCNA 1TVKB 2Q4EA 4B2IA 1IBCA 2FQXA 4QT4A 3ADDA 1RCUA 2B4QA 3FB1A 3ROXA 4BNYA 1FTWA 4AZ0B 4LDRA 4HH0A 1JN3A 2A9PA 1F38A 4KQWA 4RE6A 1V7PC 4Y7DA 1G17A 2NW6A 1GRQA 3L0ZA 3HCPA 4DSNA 2YOHA 3R5KA 3MNFA 1EFVA 4OKSA 1FNCA 1H94A 4OXKA 1KY3A 2IC5A 4H1VA 2WWTA 1L5WA 1VB5A 2AJDA 5FA8A 3STWA 2QLMA 3DTNA 5IBPA 3MGHA 3C3DA 3S1SA 4EBDA 2REQB 2R6AA 2CC2A 2W43A 3NWPA 1EWYA 1NKTA 4JP5A 2PRJA 4JOSA 5CRXA 3BILA 3SDZA 3UCXA 3RG2A 1U4SA 3K70D 1UXKA 4QBHA 2HXSA 1GZVA 1P39A 1G8YA 4B9AA 2M32A 2VDJA 3DDOA 3IIJA 4UBCA 1TZMA 4AG5A 3M4ZA 1JIHA 2HBRA 2XUFA 4RLSA 4TXMA 3ZEAA 1NOMA 5KFGA 3F5MA 4RS3A 4ENRA 1W93A 5EUQB 1N0VC 4YV7A 2J4FA 1WPRA 5C7IO 1G8KA 1SC1A 4UHBA 2GZ3A 4I6EA 2V8BA 5U9CA 4JGBA 4M88A 2W9CB 1AHPA 5B5SA 4QNRA 1V85A 2W48A 4GM1A 4ED6A 2F90A 2F43A 1Y8ZA 4AJLA 1K5HA 2C2RA 3OZIA 4QUJA 3DEEA 1KDOA 3UVEA 1SBYA 3L4BA 3QKSB 2HBJA 4DW8A 3DOOA 3DLPX 3THVA 2IYWA 3CRQA 1TMKA 2HK7A 3MXOA 1M1YB 2WFZA 1L2TA 1W8IA 3F6EX 3TCXB 3OX1A 4UXHA 4Z0PA 3NIGB 4D4JA 2OSBA 5DK4A 2MU2A 4M6WA 4Q4JB 2PZJA 3BCRA 3QW2A 4AYBF 5BURA 2SKEA 2KP7A 5H3CA 2JZBB 5K99A 2Q9CA 2HSJA 2K2QB 2KIWA 2Y9MB 1P91A 3K8QA 4DYHA 1GGHA 2RJNA 4M8IA 1PFWA 4XWYA 4QWMA 1E2KA 1PNVA 3RRJA 3E22B 4RLQA 4LE0A 5K0NA 1DCFA 4ND5A 3IAM1 3PVXA 3WK4A 3GDGA 1DGSA 1ESMA 1OB5A 3T5PA 3VPSA 2GLXA 3G8YA 4CTJA 3O73A 2Q07A 2ZUEA 4HMQA 4YMOA 3ZQKA 1EFPB 4F7WA 2VDRB 4YUAA 3CH7A 3HV2A 2B9VA 3LAWA 4Q3OA 3JR3A 1GPMA 1XLUA 3FIJA 4WHMA 1KL9A 4W9RA 3TR5A 2EEPA 3G0DA 4EUKA 1UOQA 4RSMA 3NW9A 1W1WA 1P0QA 2CFCA 2QROA 4TUYB 1RE0A 2NXEA 2YXBA 3QPDA 1E6WA 1T10A 4IUCS 5CCDA 5T64A 4DMUB 3GZTB 3GJ7A 2HW3A 4YT5A 2ZTUA 5TRTA 1MOQA 1E9EA 3OY2A 1LV5A 3CF6R 4IEFB 4CNBA 4UNNA 4NONA 4R0MA 5HKKD 1PZNA 1L6RA 3HP1A 3M5WA 3C4JA 4XWGA 4DB2A 4RHYA 1L4HA 2BSXA 1T8PA 1OI4A 4BKOA 2GLTA 3KL2A 2I71A 2PRYA 1CQZA 1SBNE 5D85A 3IMEA 3C74A 3PZRA 2GYUA 1T9GR 4M86A 2VP2A 5JH7A 5ELLA 1MVNA 4IV5A 3WQRA 3NWOA 3N9IA 4N3NA 3CLSD 4M04A 2V7GA 3VU0A 3G2LA 2W6OA 1FFEA 2D1TA 4N47A 5TPWA 4MUKA 1M2OB 2QRJA 5T5QA 5CD1A 1I1NA 4BNGA 2GR9A 2E1EA 3ADKA 2NTVA 1BQ3A 3SQOA 4ZZ0A 1SV0A 2I22A 1NG9A 3BBLA 3FVQA 2P9ZA 2J0UA 5CT4A 3BMOA 3KLBA 3FZYA 4QPZA 3LUGA 2JDID 2QX8A 1A4UA 5AI9A 3MMXA 4OJ5A 3KP1A 3KJFA 5ES3A 2JH8A 3DAHA 1PBTA 3S68A 4C0ZA 2XZTA 2G7MC 3ZHYA 1FPQA 5EOZA 4QTTB 2HTEA 4E5MA 5JO9A 1ZHOA 1UJNA 1JSCA 3NX4A 4CQLB 1ZW6A 3RJZA 1DOZA 2QN1A 2HREA 4FIDA 2O23A 2IXEA 2H2FA 4MV3A 4E2WA 3E5NA 4PZUA 1VBFA 4EKIA 1C1DB 5HZGA 2EP5A 1SVMA 3G6XA 3U0BA 3PW0A 4YRAA 1ZD8A 1DK3A 1V97A 3WNVA 1HURA 2XMBA 1H3FA 2EBWA 4QODA 1D2RA 2D6FC 3GAFA 5GZ1A 2G9NA 3BC1A 3GVXA 4UM9B 5K6AA 4I5EA 2ZRPA 2HWXA 2X76A 5G41A 4P8RA 4HQKA 2FZGA 4GUAA 2IYAA 3ZGVA 4JK1A 2KSOA 4HYQA 1RZRA 4PCAA 1B1AA 2WM9B 4PZZA 3IEIA 3PR2B 2VC2B 1BQ4A 1GNSA 1DGQA 4BZZA 1XT6A 2W04A 1KDZA 1T8RA 3K9HA 1SHLA 2PUBA 1TYAE 3DHVA 3GPLA 3CS3A 4I1UA 5GTHU 4KGXA 3OKCA 4UTVA 3D2SA 5BRJA 5FWXB 3VNQA 1GUFA 1N5KA 2HIAA 4R1SA 4Q1CA 3SQMA 2L5YA 1FSFA 3WK7A 4OFBA 2XA1A 3GAMA 4K1XA 5IABA 1G16A 2MRLA 4BVAA 4GLJA 2Q4TA 1Z6AA 2OL4A 5A3JA 5K5EA 1KI8A 1O4WA 4OHXA 1M3SA 3DNFA 4P35A 5K8VA 1VE6A 3QUTA 3TD2A 2ZI3A 3OIYA 1LFDB 1FMFA 2QB0B 5FTKA 4MRAA 2L17A 1ESNA 2AN4A 1KI9A 5FFMA 4EY6A 1XRJA 3ZNPA 4F6LA 4U7GA 1PLJA 1T8EA 4QVKA 4NZMA 1EFUA 1G4UR 3PC2A 1YOBA 4HRVA 2KZZA 2OV2A 4LJKA 3GP5A 3MPUA 5ENVA 4MZDA 3PP8A 1SU6A 4NL9A 5K45A 4LY0A 3QU5A 3PUXA 1RRKA 2BTQA 5KU1A 2QE7A 4EO4A 3GPBA 3HEAA 1XAJA 4DLYA 2W98A 3IMKA 1KJIA 4EO9A 5E3HA 5HOEA 4XGKA 3QZ8A 2AC2A 4PANA 1VZ3A 1WCLA 2JI8A 1VBKA 2FSUA 4ZAVA 2OEPA 2Z30A 1BRMA