4F8RA

Bacillus dna polymerase i large fragment complex 7
Total Genus 204
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
204
sequence length
579
structure length
579
Chain Sequence
KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of a High-fidelity DNA Polymerase
rcsb
source organism Geobacillus kaustophilus
molecule tags Transferase/dna
molecule keywords DNA polymerase
total genus 204
structure length 579
sequence length 579
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4f8rA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4f8rA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4f8rA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4f8rA01
2XGPA 3RMAA 2FBVA 3SQ0A 1TKDA 2IA6A 1B9DA 4YNQA 1WN7A 4ELTA 4EP5A 1L3VA 4RW6A 4ECTA 4DLEA 2P1JA 2OPQA 2RF2A 3AVCA 2C22A 3JPSA 2D0AA 5KFOA 7ICNA 4YFUA 4YG2A 1S9FA 4Z6FA 4KLTA 4BGDA 3PNCA 2ZD1A 5KFHA 8ICZA 3C2KA 1COOA 4DL5A 3M8QA 4UBCA 1R0AA 3NDKA 3V6HA 2IBKA 2ZUCA 2DTUA 5IIOA 1SL2A 2PFNA 1L3SA 2HHUA 4FK0A 9ICUA 3RH4A 4CGHA 3GIJA 4ECRA 2FLLA 2IC3A 1G15A 3SUQA 1TL3A 4FJKA 1JL1A 2BPGA 1BCMA 4J9OA 1XHXA 2LSNA 1KRPA 4ID1A 4I2AA 2RDJA 5J0TA 4CF0A 3SQ4A 1HYSA 1Z26A 5DGBA 2HHQA 4OJRA 1RT4A 3ALYA 4G3IA 4QZAA 1ZJNA 4RUAA 2XY5A 3H7IA 9ICEA 5KT5A 1NOMA 4OVLA 4IFYA 3HK2A 3Q8SB 3S3OA 2IAJA 3I0SA 4W5NA 2LYHA 3MR2A 4DF8A 3SCXA 2QK9A 2QKBA 4PQUA 1HJRA 3VQPA 1ZQTA 1XC9A 4CE9A 4AHCA 3OJUA 3MDAA 4DOBA 3DMJA 5HLFA 3L3UA 1WAFA 3LALA 1B9FA 3NE6A 1VSDA 3UQ2A 4CFAA 1SZPA 3TQ1A 4JWNA 4MFAA 1TFRA 3MEGA 1JLQA 4TUPA 2FBYA 3KTQA 3E2EA 2UVVA 3T5JA 2O4IA 1MC8A 1N48A 3TABA 4QW9A 3SYZA 3MFIA 5TZVA 3RJEA 3SUNA 5J0WA 3HT3A 3V9WA 4KPYA 3RRGA 4GLXA 2HHXA 5CB1A 8ICMA 5J0QA 3OYKA 2NRZA 4EYIB 1RT1A 1QSSA 3TARA 2G8WA 1HJPA 9ICNA 4ECVA 3P83D 3NTUA 4K4HA 3MEDA 4CJWA 2BCQA 3RH5A 5J2CA 4CEAA 2PYJA 1RXWA 8ICWA 4PHDA 3M8SA 4Z6DA 2DY4A 2C28A 2W9MA 1XHZA 1HYZA 3T19A 4M3XA 4Q44A 4ED1A 4RW9A 2YHAA 3V7JA 2HNZA 5J0YA 3D0PA 4FJJA 1ZQJA 2F1JA 8ICFA 4N41A 4W5TA 1ZBHA 4E7KA 4M9GA 4RPXA 4FJ5A 2AGOA 4KN7A 8ICUA 3RTVA 4B9UA 1KDHA 3RB3A 1RDDA 4KLLA 2PFPA 3MXIA 4GC6A 3MXJA 4RU9A 1B92A 1JLCA 4DF4A 2YNHA 1XSNA 2V4QA 3GIKA 2GWSA 3LDAA 7ICKA 3TFSA 2ZJ8A 4UAZA 4UBBA 4I2HA 1S9EA 5CYMA 1RDAA 3HX0A 4DSIA 5J0UA 5JUMA 4ECUA 4I2DA 5KI6A 4HUEA 4QZGA 3GIIA 4NCGA 1DLOA 4Y1CA 4Q8EA 4Z4EA 3P1GA 4QWEA 3V1OA 1WSFA 1QS4A 2D0BA 3BQ2A 4TUQA 4H8KA 1D5AA 4Y1DA 1WSIA 4MFCA 4NLGA 1J53A 3LPUA 3K75D 1LWFA 3SUOA 3RMCA 1UWBA 5KG2A 2B4JA 2VA8A 4M6WB 2ZTDA 5KFNA 1S5JA 4KAZA 3K5LA 3T5HA 1BPXA 4QW8A 5C25A 4RZRA 1RYRA 2ZE2A 4Z4IA 4KB1A 5KFLA 3C5FA 2W8KA 4CF9A 2A1JB 4IKFA 4BXOB 2VG7A 1BL3A 5EWEA 2VANA 1SL1A 3O4QA 3NH0A 1IXRA 3EYZA 1RXVA 3RWUA 3UPQA 3VQ9A 2Z1IA 3C23A 3F9KA 2G8KA 7ICOA 2QKKA 4MQ3A 2YKMA 1Q8IA 3L2QA 3GV8B 4B9NA 3OYLA 3GIMA 3OJSA 4CJEA 5JS1A 2NRVA 2G8IA 4CESA 4CJ3A 1JXLA 4M04A 3QINA 2PFOA 1LB2B 3KKSA 3AVKA 2IMWP 4R8UB 4FM1A 4RQ5A 3OYBA 4KFBA 2C2EA 2KW4A 1UA0A 3G6VA 4FJLA 5DB7A 4KV8A 1VSLA 4ED6A 8ICPA 5CZ2A 5I3UA 3SZ2A 3AO2A 1T4GA 4UB2A 3HVTA 3AU6A 4LH4A 3SI6A 3HP6A 8ICCA 3QNNA 2KN7A 4DLGA 4JS5A 4AHRA 3QNOA 1ZBLA 9ICCA 4FJ8A 4KKOA 4JRPA 3PY8A 4RNMA 4I2GA 2Q0ZX 1IKVA 3RMDA 4E7JA 1NOYA 4J2BA 3AA3A 3CQ8A 2R8JA 2HW3A 1IKXA 4KTZA 3OY9A 3TAGA 5DG7A 3DI6A 5CWRA 2XRIA 1DTTA 2HVIA 4CEOA 4CECA 3C6UA 2FMQA 3LDSA 5J0PA 3MECA 4NCBA 5E41A 3HPOA 4CJUA 2DFFA 8ICOA 9ICLA 4F2SA 9ICFA 1C0MA 4O3NA 4HTUA 1MU2A 1ZQCA 4F3TA 3RBDA 3KLIA 2IGIA 3LPTA 3NBPA 4KO0A 4TSXA 2Q3SA 5DKWA 4P2HA 4HHTA 1ZQBA 4IRCA 8ICVA 4J9SA 3PX6A 4ECSA 3AA2A 2PFQA 4KITB 4CFDA 4FLWA 5J0XA 4ECWA 2PI5A 4HCCA 2D5RA 4CHPA 4BDZA 4I2QA 4BXOA 4RNNA 5KRSA 3V6JA 3HPHA 4LH5A 2R8IA 2BDPA 3V9SA 4F5QA 1I39A 3DM2A 4F92B 4DSEA 2JEJA 3ZT1A 3C5GA 2YHBA 4KHNA 4N5SA 4BE0A 3VQCA 4KREA 2D0CA 3VQ5A 3D45A 2WTFA 1NOZA 5CR0A 4YMMA 5J0OA 4BACA 3H40A 4DSJA 4YXJA 4E7HA 3QE9Y 4QZDA 4QZIA 8ICSA 4KHSA 2I9GA 2OPSA 3ORYA 8ICXA 3KK1A 4M3UA 4DG1A 3Q8KA 3RJKA 5J1EA 4N47A 4RQ4A 3ZT3A 3JPNA 3LWMA 3F73A 2PXIA 4O5CA 9ICVA 5EU7A 4DQSA 3VN5A 3PW7A 4UQGA 2ALZA 2IHNA 2EHGA 4FW2A 2B5JA 2GBZA 8ICKA 4RQ7A 4CJQA 4ED8A 1VSKA 2PZSA 3G6YA 2YNGA 4IRDA 1WSEA 3K58A 4QWAA 1SV5A 3M9OB 2AGQA 1NKCA 2BHNA 3V6DA 1Z3EB 4AH9A 3ISDA 3PV8A 4DFJA 1MQ3A 4DOAA 3T1AA 3B0YA 4ZTFA 1NJYA 3OHAA 1QHTA 5J0RA 1JLEA 2OPPA 4CJSA 3WNHA 4FLZA 5KG5A 1ASUA 4GC7A 1IKYA 2OYQA 5DGAA 2OWOA 2YNIA 4OLAA 2HNDA 4Z6CA 4I2JA 1CUKA 1VSEA 9ICTA 2BCRA 3UQ0A 1ZJMA 4YXMA 3V72A 1KVBA 1TGOA 3BDPA 4ELVA 4NYFA 3RMBA 2I5JA 8ICNA 4YFKA 4CCHA 3L2WA 3ZSVA 4CJRA 4RW8A 2A1RA 4ECXA 1RNHA 1TAQA 5DLGA 4YR2A 1JKHA 4FJ9A 2BANA 3MGHA 1DTQA 3QEXA 4GVMA 2G8UA 4DSLA 4KTWA 2ATQA 1ZQMA 3UXNA 4KLMA 2PY5A 4CEEA 5DBAA 2ZQBA 4CGJA 1VRTA 3LAMA 4CIEA 4KLJA 3KD5E 4IR9A 4K8XA 2ATLA 3PX4A 5HMLA 3QO9A 4RPZA 2C2RA 4NLKA 1U45A 4KLUA 3OYMA 2J6TA 3NF9A 3JPRA 1TVRA 4J2AA 3RJFA 4I7FA 9ICMA 4YP3A 4AHVA 4OLBA 4F4YA 1KEJA 3ISCA 2R8GA 5J2BA 3GQCA 5I42A 1S9GA 3ZSYA 3KHHA 4DQQA 8ICIA 1FKPA 5KFGA 2VA3A 3T5LA 3VA0A 4FJXA 2BQUA 1T8EA 3CG7A 4NCAA 2W9BB 4CJFA 1RTDA 3KK2A 3AVGA 2F1HA 4I27A 4FJNA 4L8RB 3RB6A 1L5UA 3QZ8A 4DL2A 5J2EA 4B9LA 5DMRA 3C2MA 3VQ6A 4JS4A 4QZFA 1TKZA 2FMPA 5KFBA 2WOMA 3KD1E 4I9LA 1ZQGA 3DOLA 5J2NA 3AO5A 4CEBA 1T3NA 4CJKA 1UOCA 4LD0A 4H4OA 5KT7A 2JEGA 3CFPA 1MQ2A 1I3AA 4OPJA 2R7YA 1CXQA 5HHHA 1N56A 1NK9A 5DB9A 2ASDA 4O3RA 4CJLA 3NF8A 4I2BA 1BQMA 4DU4A 5D46A 1MSWD 3SUPA 1RYSA 4RQ0A 3LP1A 1S76D 4Q5VA 1BVSA 1VSHA 4F5NA 4E89A 4RQ3A 7ICUA 4I28A 1ZQXA 3ITHA 5HROA 5IIJA 1UT5A 1RDCA 1WAJA 4FLXA 4N56A 3TFRA 1HPZA 4O4GA 1VRUA 3QIPA 5KGWA 3THVA 2G8HA 3OS1A 4QZCA 4DTOA 1WCNA 3IS9A 1KLMA 2AU0A 4O3OA 2H5XA 3KLFA 4FS2A 1ZQNA 1NJZA 1ZQFA 4MFBA 3O3FA 5KG0A 3CM5A 2P5GA 4FZXC 2NUBA 1BPEA 3OGUA 1NJXA 3SV3A 1ZQRA 1ZQVA 4DTXA 2KZ3A 2NRXA 1TV6A 4JLHA 4O3SA 5DG9A 1LV5A 4FLYA 4HCBA 1KFTA 4KLDA 1ZETA 4F8RA 4RNOA 2XY8A 3DRRA 1RTHA 5J2FA 1U49A 1X9WA 3DLEA 2BGWA 1S0NA 1RBTA 2BGGA 1RT6A 2BCUA 2HHVA 1RCHA 4LZGA 9ICIA 4J9LA 4DQPA 1B22A 2FPKA 5DB6A 3KHGA 7ICVA 5HRRA 5KT2A 4CEDA 1V9PA 4KHYA 4QZ8A 4OGCA 3MR5A 3EPIA 7ICHA 2XCAA 4AHSA 3K5NA 4EZ9A 4F93B 3G6XA 1T03A 4B9TA 4ICLA 4FBTA 5KFDA 4IQWA 3KK3A 3SV4A 4LSLA 4GXJA 1ZBUA 4DSKA 1XWLA 3HXMA 4CGDA 7ICSA 3QEIA 4HYKA 1Y88A 2DFLA 9ICSA 7ICRA 1KFSA 5F9LA 1TKXA 1BGXT 1O1WA 4NYNA 2DFEA 5C5JA 3BQ0A 1D9DA 4G1QA 2Y1JA 3C1YA 5J2DA 4CIGA 3OYNA 2P6RA 4J2EA 4FVMA 4CJVA 1TAUA 1WCLA 2Y1IA 1BIUA 2QXFA 4PHEA 4JV0A 3DRSA 3FFIA 5KFVA 1WSHA 8ICQA 1CZBA 3NAEA 3V9ZA 3QEAZ 3SPYA 3AVAA 1ZQUA 2OZMA 3HYFA 1BPZA 3S3NA 4N76A 2BE2A 4P4PA 1C6VA 9ICBA 1D8LA 4XQ8A 3QETA 1KSPA 1ZQPA 1QLNA 4MFFA 1BHLA 2FMSA 3EZ5A 1QSLA 2R8HA 1U4BA 3HP9A 4M42A 5HMMA 7ICGA 3JPTA 1KLNA 1RILA 1FKOA 1BQNA 3MEEA 4M6WA 1K6YA 1YVUA 3QIOA 5HRSA 3Q8RB 2UVUA 2ZUBA 3RBEA 1LWCA 4CIFA 4AHTA 3H4DA 4ED3A 4FJHA 3PMNA 4RPYA 4K4GA 2FLPA 5KTQA 1KVAA 4AILC 3ULDA 1QQCA 4LSNA 4O9MA 3BGRA 4DS4A 4WE1A 3CFOA 5DQHA 4J9MA 4DL7A 3T5KA 3ZDBA 2JEIA 4YD2A 2O4GA 1RTJA 4F4XA 3RJGA 3UIQA 3KHLA 3VQBA 1C1AA 3G10A 3O4NA 4TQSA 1K1SA 1WSJA 5DDYA 5CHGA 1VK0A 4FZZA 4CFCA 3I8DA 1C7YA 5L1LA 2VWJA 5KT4A 4CF2A 3V1RA 7ICIA 4KHUA 4CK3A 4IQTA 1ZQAA 3ZCMA 4UAYA 5BOMA 4KMUA 1NK5A 1RZTA 7ICLA 4CF8A 4O5KA 4GXKA 4TURA 4ED2A 1ZQOA 2ITGA 3T3FA 1VSFA 1PZNA 3HWTA 4DTJA 2VWKA 3OSPA 3N97B 3VQ4A 4DQIA 3K5MA 4M9NA 3MDCA 1RBVA 3PW5A 4M9LA 1X2IA 1U48A 4XIUA 4NM1A 1ZQZA 4OPKA 1XO1A 2P51A 7ICPA 9ICPA 3AVIA 2KFNA 2JGUA 4R5PA 2E6LA 4E1NA 2XY6A 1JIHA 4F4KA 1BPBA 4E7IA 4UB1A 4H4MA 1Q9XA 4OKJA 4KLOA 3IRXA 3BJYA 3AU2A 7ICFA 3PUFA 4M41A 5T7BA 4IDKA 2X78A 4R66A 5L9XA 3NFAA 3OS2A 4YVZA 3OYIA 3L2RA 2W9CB 1VSMA 4UAWA 1ZQIA 3WNFA 2DPJA 5SZTA 4KLEA 3RR7A 1ITGA 1D8YA 1DGSA 5FROA 3AV9A 3ZDDA 5KFYA 1HQUA 3L2UA 3HW8A 1JN3A 4EBDA 4CHYA 4K8ZA 4YN4A 3MBYA 5EWGA 4OKKA 3C95A 3CM6A 2ZUDA 4IQVA 4NLNA 3ZDEA 4M3WA 1BISA 3ZDAA 4QZBA 1AROP 4ED0A 3B6OA 5DBBA 1TKTA 3PMLA 4IG3A 1W9HA 4FLVA 3DLBA 5IINA 5IILA 1SUQA 5J2JA 2ISOA 5FDLA 1RT3A 3ZT4A 2B21A 2BQRA 3MR6A 3PO5A 5KFQA 4NM2A 3SQ1A 2IDOA 1BPDA 1C1BA 1QE1A 4O0IA 4B9MA 3MFHA 1ZYQA 5CJ7A 1FK9A 3S9HA 1YTUA 2EX3A 3P5JA 5J2HA 5KFUA 2ASJA 3RJHA 3U3YA 4Q43A 3N4MB 3VQEA 1BPYA 1N6QA 1NKBA 1RT7A 1ZQEA 4Z4GA 1RT2A 2XC9A 4B9VA 3U3GA 4O3PA 1JX4A 2VA2A 3RAXA 2BQ3A 3LK9A 4LVSA 4OKEA 1S77D 3ZD8A 4EYHB 4BDPA 4I2IA 3A2FA 3AVHA 2AGPA 3OYGA 4CFBA 4FCYA 4F91B 9ICGA 1X9MA 9ICQA 3AVMA 2OA8A 3AO4A 2B6AA 8ICYA 3MR3A 4DTMA 1J5OA 2AJQA 4KHQA 4O0JA 5KG1A 3ISNC 1F21A 8ICJA 1ZQKA 5DQIA 2ZTEA 1RBUA 3GV7B 3V1QA 3PR5B 3K5OA 3GFKB 1HMVA 4IRKA 4CJTA 9ICXA 4M47A 3EW9A 4Z4CA 4GMJB 3GV5B 4PGXA 4RQ8A 4DL6A 2F8TA 3MXMA 4O44A 4RT2A 4I2PA 3TAPA 4X5VA 3MGIA 3IAYA 3OHBA 9ICHA 3QEPA 3O3HA 4CGGA 3O3GA 3NHGA 4C8KA 1Q9YA 3LP3A 5KFJA 1EP4A 1REVA 2F1IA 4FK2A 4DFMA 4W5OA 4B8AB 3NF6A 3Q8MA 1TV9A 3SNNA 2BCVA 1TK5A 2NRTA 1C0TA 4DFKA 4CHNA 2NRWA 3JPQA 1RBRA 1CZ9A 1K1QA 1H38A 5J2PA 1NKEA 2FC0A 3LWLA 4B8CA 3DLKA 1HYVA 4JV2A 3H8JA 4CGIA 3C1ZA 2KFZA 4J9QA 1JLFA 1JXBA 4OGEA 9ICKA 4FO6A 5K14A 4F4WA 2X74A 4CF1A 3WNGA 2W8LA 3CFRA 2XHBA 4ECQA 4PA1A 5KFFA 4XUSA 4KN4A 5HP4A 1KCFA 7ICMA 2M9NA 3TR8A 3L2VA 4KLIA 4GW6A 5J0SA 5KFSA 8ICLA 2F8SA 3BQTA 1RT5A 4DO9A 3OYEA 3AVFA 4PWDA 4QWCA 2UVRA 1XI1A 4RQ1A 4MF2A 5KFRA 4Z4FA 1T7PA 1A5XA 3NH1A 4DTRA 4FXDA 4CHZA 2UVWA 3H08A 4M3TA 2IHMA 4J9PA 5D49A 3RB0A 2HHTA 3PR4A 4DSFA 7ICJA 3SPZA 3C2LA 1BIZA 1S0VA 3HPGA 5HBMA 3KLEA 2PYLA 3TWHA 4PHPA 4HVJA 4KLSA 4FM2A 3OVNA 3FDSA 2VG6A 2HMIA 7ICQA 3OYAA 3RH6A 4ECZA 1NK7A 2W9BA 3ZSZA 4C8NA 9ICJA 1ZBIA 2JZBB 1XU4A 9ICWA 1XSLA 2IOCA 3ZSRA 3AO3A 1B43A 4BE1A 4F3OA 1ZQWA 2JEFA 2RKIA 1S10A 5F9NA 3ZSWA 1XSPA 3SJJA 5KRTA 3KLHA 3LP2A 4JWMA 1HNVA 1IH7A 3M8RA 3AVLA 1S1UA 3JPOA 2YV0X 3K59A 5KFEA 5HP1A 3CYMA 5J2GA 4FZYA 4B3OA 1C1CA 4I2CA 1NK8A 1X1PA 2X6NA 5IIKA 4YR0A 1U04A 5EWFA 2BCSA 3OYHA 1LAWA 3M9NB 2P6UA 5IIIA 1U47A 2HHSA 1S1VA 1IM4A 2I1QA 4ZTJA 2HNYA 4W5QA 3HL8A 3NGZA 3HJFA 1TK8A 3LAKA 1ZQHA 2V9WA 1X9SA 4DTNA 4DU3A 5D3GA 4PGQA 2ZTCA 3OYDA 2J6UA 2XGQA 1JLAA 4JK1A 2HB5A 2IS3A 3H8WA 2PI4A 5CZ1A 4FJ7A 4J2DA 2OZSA 4DL3A 5SWMA 5DK5A 3RJJA 4QZ9A 3AVNA 4UB5A 1T05A 2FBXA 3M8PA 4KLGA 4DTPA 1JXEA 4E19A 1CEZA 5CY4A 1ZQQA 4HUGA 1SKWA 4RT3A 4BWJA 5FRMA 3DYAA 1LW2A 3NGDA 4FBUA 3GDXA 4IG0A 4QOZB 1HUZA 8ICHA 4F50A 3TAMA 5BPCA 3VQ8A 2FPMA 2GUIA 4ECYA 1ZBFA 5KFMA 1ZQSA 2R8KA 1JLGA 3ZDCA 5KFWA 4C8LA 4IBNA 3RRHA 3DLHA 1NK6A 1S0MA 4FJMA 1D9FA 4Q45A 2AQ4A 2P66A 3PO4A 4F5RA 5BOLA 8ICBA 3ZSQA 4RW7A 3RB4A 4PGYA 3IHQB 4NLZA 5L1JA 4W5RA 3U6FA 3VQQA 2X6SA 1SKSA 1BCOA 3VQDA 4CJ4A 1RPLA 5J2IA 4QZEA 1NK4A 5J2KA 9ICRA 5KG3A 3QZ7A 8ICAA 3B6PA 5FRNA 4EP4A 1IO2A 3EWAA 1QTMA 1BI4B 4KLFA 2ISPA 1UA1A 3ZSOA 1GOCA 4E1MA 3LZIA 4R8UA 4JV1A 4RQ6A 1A77A 5IIMA 4FK4A 4O3QA 1JL2A 3AVBA 4DFPA 1SL0A 1EKEA 4CEQA 4ELUA 2W9CA 5KFIA 4RQ2A 1VSJA 2YKNA 3H4BA 2AQ0A 3IM1A 3NGIA 5KFTA 1Z00A 3Q8QB 1RTIA 1IKWA 4EBEA 3OYFA 3DLGA 4I29A 4RW4A 1ZQDA 1Y97A 3NF7A 4E7LA 5HRNA 4Q0BA 4YMOA 1JLBA 1LAVA 1C0UA 1J9AA 1HNIA 3QEWA 2FBTA 4I2FA 5KFKA 5HRPA 1QSYA 4DS5A 3DOKA 3AA5X 1S0OA 4KB0A 3EPGA 4J9NA 3JSMA 1CLQA 3PVXA 4YMNA 3KHRA 4FLUA 4QZHA 1NK0A 3E01A 3V9UA 5KG7A 1WLJA 4F2RA 5CA7A 4RG8A 5J2MA 3ZSXA 1TL1A 2A1JA 5L1IA 7ICEA 4DWIA 3S3MA 1ASWA 8ICEA 8ICGA 2ZJ5A 3NCIA 5DG8A 2MUTA 2KTQA 4DL4A 4DTUA 1L3TA 3K57A 1S1WA 3TAEA 2HHWA 4ED7A 5J29A 5KFAA 1EETA 3OYCA 5KG4A 4F5PA 4F5OA 3OYJA 4QAGA 3I0RA 2BKEA 1GOAA 1W0HA 2VG5A 3HSTB 3RR8A 4J9KA 3TANA 5KT6A 1UT8A 3V9XA 4YCXA 5DLFA 3C94A 4YR3A 3OS0A 3UXOA 4CGFA 5KFXA 3QEBZ 3G0ZA 3RAQA 2RN2A 1GOBA 3HM9A 2FLNA 8ICTA 3QLHA 1NJWA 5HHIA 4CEZA 2XY7A 3V81A 4FJIA 3AVJA 3C21A 2GV9A 4KTQA 5KG6A 5J2QA 2V4RA 1HRHA 2JLEA 4CK1A 4C8MA 4M45A 1U9LA 3OSNA 4P4MA 3RJIA 1ZQLA 5C24A 2XO7A 4B9SA 2F96A 4Z0UA 3L8BA 2RPIA 1ZQYA 2J6SA 4CHOA 8ICRA 3WNEA 1LWEA 4ZH4A 3JPPA 3GILA 3KKRA 4F4ZA 3JYTA 7ICTA 3FYHA 1EX4A 3LP0A 4ZHRA 4KLQA 3L3VA 5KFZA 4DMNA 2XCPA 3B0XA 3AO1A 4LZDA 2G8VA 4FLTA 9ICAA 2E4LA 4ID5A 4JUZA 4M3ZA 2KQ2A 3Q8LA 4M0AA 1WNSA 3V7KA 4CJPA 2RDIA 5KFCA 4J9RA 4UB3A 1A5VA 5DDMA 3PW4A 1YTAA 3ASMA 4FYDA 5D4BA 1J54A 4RUCA 3V6KA 4BDYA 4CHQA 5KT3A 2W42A 4MF8A 4KRFA 3Q8PB 3EY1A 1A5WA 2A1SA 4JRQA 4XRHA 1BI4A 1WSGA 4EEYA 2Z1JA 1N5YA 3NH2A 3ZT0A 2ETJA 4CJ5A 1SKRA 1TVAA 1EXQA 5C42A 4DTSA 4EBCA 2C2DA 3K2PA 4KHWA 3QESA 3ZT2A 1YT3A 1S6QA 2FPLA 4E3SA 2Z1GA 4QWDA 4O5BA 4M9HA 1HUOA 1Z00B 3LANA 4PHAA 3PX0A 2BR0A 4NY8A 4TUSA 3M9MB 1S97A 4B08A 3SQ2A 9ICOA 1DOQA 1JMSA 2HVHA 2OPRA 4IFVA 3PW0A 4Z6EA 1CXUA 2G8FA 2DPIA 4MEYA 1LW0A 1RBSA 4CEFA 1XS9D 1Z25A 3TI0A 1L3UA 3DLRA 3TAQA 4TQRA 3DRPA 2MUTB 4DEZA 1ASVA 4BWMA 4KI4A 3HVRA 1FXXA 5KFPA 2BPCA 4EZ6A 1KVCA 3V7LA 1S1XA 3VQAA 4K4IA 3V4IA 1VSIA 4IR1A 5JS2A 4YQWA 1S6PA 3AA4A 2KZMA 3BQ1A 3MABA 3NGYA 4BE2A 4QWBA 5HNKA 3VQ7A 3IG1A 2ASLA 4M3RA 5KGXA 4KI6A 2MAXA 3HO1A 4PY5A 5DQGA 3SI8A 3C6TA 5DB8A 4R63A 4PUOA 4IQUA 3LZJA 4FW1A 1HQEA 4UB4A 4O55A 5CP2A 4XA5A 4YD1A 4R65A 3QERA 3PW2A 5L1KA 4I2EA 4CERA 4GXIA 4P4OA 3KJVA 2BPFA 4O5EA 2E6MA 5DBCA 1TK0A 4DQRA 2ZJAA 4FS1A 3K4GA 3ISBA 1A76A 3KLGA 3VA3A 2YNFA 4FM0A 4LY7A 2W9AA 1RDBA 4CK2A 1IG9A 3MAQA 5CYQA 4I9QA 4KLHA 3TAFA 1KFDA 1S1TA 2DFHA 3QEVA 2P5OA 4M2YA 3KIOA 1UAXA 4NXZA 4DU1A 4Z4HA 4MEXA 3ZD9A 2Z1HA 4M9JA 3UXPA 4PH5A 2JZBA 3H8SA 4R64A 1KTQA 4DOCA 3AUOA 4AHUA 2KZZA 1EXNA 4C8OA 4Q8FA 4QCLA 3ETLA 5J2AA 4PPXA 4E0DA 4M3YA 4FJGA 5EOZA 4HUFA 2WONA
chains in the Genus database with same CATH superfamily
3EVWA 2W2OP 3J81O 3QU7A 2FBVA 4JI3J 1TKDA 1V5IB 2KXHA 3NLCA 3T1HJ 5AM5A 3LVWA 5JLHA 3NASA 1F3VA 2P1JA 1X4GA 5AKYA 2OPQA 2RF2A 3AVCA 4JKGA 1HHTP 1RA7A 2E1MC 3JPSA 3I56S 7ICNA 4Z6FA 2LU1A 4DX7A 4BGDA 1VQKS 3BGUA 2ZEJA 3C2KA 2QWRA 1VDHA 2LDYA 3M8QA 1R0AA 2IBKA 1UVKA 3DXKB 1SL2A 2PFNA 1EETB 1KD1O 3RH4A 3GIJA 2NZ4A 2DHAA 2QO3A 4JI5J 5AQVA 4CT8A 3ZO7A 2RUGA 1HNWK 2Y0SF 2WW8A 4ICLB 1X6IA 3FKBA 2DB1A 2QWLA 1EO1A 1C1CB 3SQ4A 2YHXA 4YOTA 3GU3A 3JS6A 4OJRA 1P9YA 2V8GA 4G6VB 4OI1A 4QZAA 1ZJNA 3SMVA 5KAIU 1N0UA 2G2OA 9ICEA 3J81Y 5H9EK 1FRXA 1NOMA 3CXCM 4IFYA 2Z2ZA 2VODA 1O0PA 2ZC3A 3Q8SB 3S3OA 2QL9B 4W5NA 3WQPA 1RTHB 2LYHA 2QK9A 4B3TF 2YQ0A 1XR6A 3VQPA 1ZQTA 3KJQB 1WC3A 3FJ2A 4AHCA 3OJUA 1O13A 3DMJA 1B9FA 3Q8YA 3CIZA 3CD0A 5T7LB 3FQKA 3OR2A 4LF9J 2X1GA 3T79A 3K8VA 2YWHA 2ZZNA 5HQ8A 1T9XA 1AFJA 3MEGA 4TUPA 3E2EA 3QIDA 4C97A 3MAAB 3CCQS 5MLCV 9ATCB 3UFCX 3SYZA 5TZVA 1UEKA 5J0WA 2BRKA 3GJSB 4CBXA 3I76A 2VG6B 4OYBA 2Q36A 4P7TA 1TZ0A 1FRMA 1RXOB 2HHXA 1NMEB 3ZTOA 1FKOB 4JI3K 3ZZTA 4CM2A 3OYKA 2NRZA 1RT1A 4NV0A 5GAHU 4IZ9A 3TARA 3AEVA 5M1KA 4NL5A 4DPTA 3NTUA 2I0XA 3P3DA 3MEDA 4CJWA 1RAEB 3ED5A 3F2KA 5J2CA 2DK2A 3ETRA 5IT9U 1U24A 2XICA 2BJ9A 4C80A 4CZFA 1XHZA 1N88A 2IVYA 1FRKA 4ED1A 3W3DA 4A46A 1MWKA 1OIAA 4RW9A 1VFJA 1GEHA 3PSTA 4Y2CA 5AFUH 3V7JA 3D0PA 2CVIA 3DLLQ 3M1FA 3NRWA 1ZQJA 2F1JA 2M8DB 3VHQA 4W5TA 4HAIA 4M9GA 1NEEA 4FJ5A 4KN7A 8ICUA 5EE0A 3JSYA 1RM6C 4FVCA 4ZPAA 1RDDA 4KLLA 3QMQA 2PFPA 5D78A 2L41A 3LDLA 5LSOA 4GC6A 5A8KA 1JLCA 1S5LU 2V4QA 3GIKA 1BQMB 1MWZA 4P2MA 4UBBA 2Z2YB 5JLFA 4HHUA 5JUMA 1H0HB 3QT5A 4HUEA 5KI6A 4QZGA 1FEEA 3QU2A 3POTA 4DV2J 5IM0B 4G9ZA 4USHA 3FQLA 1QS4A 3IAS9 2YJFA 4TUQA 4H8KA 1D5AA 1XERA 4NLGA 1J2VA 3K75D 4DV0J 2EFPA 1UWBA 3RMCA 7FDRA 4RW9B 5KG2A 3MAAA 4FPRA 2B4JA 4M6WB 2W25A 4O44B 2ZTDA 2DIVA 4KAZA 2VG5B 4EU0A 4NLOA 4OZ3A 4QW8A 4IH7A 5E3RA 4YUDA 5KFLA 1FE0A 3C5FA 2W8KA 1L7NA 4DU8A 1Y11A 2ZJPQ 1TUGB 2VG7A 1BL3A 2LMIA 1JLCB 3O4QA 4QS7A 2DY1A 2R42A 4QZVB 1SZ2A 3VQ9A 4PG8A 2KSOB 3F9KA 2BOPA 3N01A 2G8KA 2J5AA 2HSZA 3UE2A 7ICOA 2W7PA 1C1BB 1BNOA 3QYYA 1FNOA 5F2RA 4FN5A 2RS8A 5JS1A 2CGJA 1JXLA 2EVZA 1T94A 2MXYA 1W2BM 3KKSA 3MM8A 3CDEA 5D4PA 3H5UA 3OYBA 4KFBA 4FF4A 2JXJA 2KW4A 2BKPA 5G5GA 2CWKA 2R18A 2O3DA 1SGGA 3CJ4A 4Y2UA 2J9EA 4ETZA 2CPXA 1X4AA 5I3UA 3D6FB 2E8MA 5D4NA 4LH4A 4UB2A 8ICCA 1X4EA 4Y6IA 3BDEA 4I1TA 5AQOA 1Q95G 5A76A 3NOGA 4NB4A 1M90O 1VJQA 3DN9A 4KKOA 2GHWA 4USVA 1NNEA 3JSBA 4C4SA 4JRPA 2DH7A 1T6CA 2ZIVA 3CJCA 4PL7A 5MAOA 4OFZA 4WK3A 3F9MA 3WXKA 4E7JA 1NOYA 2UU9F 3CQ8A 2ZNYA 2R8JA 1IKXA 3TAGA 3CQYA 3QT8A 2XRIA 3JAMO 2HFVA 3LDPA 1CJUB 4O5FA 4ILLA 3N6MA 3A8EA 3AJ1A 1HKBA 2DFFA 3QMLA 3T1HF 1Q8KA 2YWEA 2DRAA 3F5TA 2XSJB 2EANA 5C7PA 9ICFA 5IT9O 1C0MA 4O3NA 1MU2A 4F3TA 3NBPA 1RABB 4PG7A 4CNQA 5DKWA 3UVJB 4BG8A 3U26A 4DPOA 1HBNB 1Q81T 4KBOA 2XEXA 3W62A 4OZ5A 1WC1A 2GVZA 1SIJA 4KITB 4FLWA 2WHEA 3I6PA 4HCCA 2FGCA 4ZHRB 1RGVA 3CETA 5HP1B 5LJVA 4OJ3A 2HLUA 2MQNA 4DUYK 2R8IA 3RSEB 3ZT1A 1RTDB 4OIXA 4N5SA 1N32K 2CQCA 1F0MA 3CCTA 1NOZA 2AJ2A 3NS1A 5CR0A 2CNKB 5DM7Q 3H40A 1ICEB 4F71A 4YXJA 3VQSA 1N32J 4E7HA 5LY3A 4ZMMA 4OX9J 1PC5A 2WF5A 3HTVA 2VUGA 3BGFA 2QL7B 4OX8A 2OPSA 4M3UA 4DG1A 4DL0C 2VFTA 4RQ4A 1HR0J 3ZT3A 3JPNA 3LWMA 3F73A 4O5CA 1J5EF 1D8BA 1HNWF 2IHNA 1FEZA 1MMLA 1QVFM 1KLMB 2NCKL 4FW2A 2M88A 2B5JA 3SFGA 1NRKA 1VJWA 2DR6A 5J1NA 4AYBC 4CF4A 3MXHP 2WFAA 5AM4A 1RG6A 4DU7A 2UUCF 4IRDA 1WSEA 6FD1A 2ILZA 5HROB 3ICLA 1T9TA 3BYPA 3EE8A 2UUAF 1ZQ1C 3J8AA 4F4AA 1Z3EB 2UUCJ 3FE1A 2CZ9A 3PV8A 1WOQA 1X0FA 1NJYA 5K8PA 4KH6A 1WHXA 1JLEA 4ETXA 4FWRA 3MM8B 3UE5A 2FHJD 2W2MP 5HOOA 2O8FB 2YNIA 2M0GB 4FPBA 4IUFA 4BR4A 4Z6CA 9ICTA 4FZLA 1IWAA 3I28A 3D6MB 4YXMA 3V72A 5EUHA 5LMNJ 1KVBA 1TGOA 4NYFA 4GVEA 4R0JA 1O8BA 3QXGA 1ZZFA 3QRQA 2QFJA 4CJRA 3M3ZA 5C15A 1AYEA 1I6JA 4PWDB 4OJ1A 2EZYA 4FXVA 4BR9A 2XIDA 4UZBA 5IZHA 4ZLNA 1U09A 3QEXA 3TSPA 4DSLA 4KTWA 2ATQA 2M8HA 1ZQMA 4NMXA 4KLMA 1LWFB 1B3TA 4CEEA 5DBAA 4OYAA 3SCJE 1VRTA 4DX8H 2KICA 1N52B 4F7VA 1V3RA 2RMLA 4H4KC 1RWUA 4IOBA 1IQZA 2C2RA 4NLKA 2UUWA 3WHIA 3ILLA 3JPRA 5RUBA 5CRXA 1KEJA 5L9NA 1XEZA 3GQCA 2DRDA 3R3LA 2Y3YA 1SC6A 2NS1B 3GR0A 3KHHA 4ZPWR 2DUYA 5KFGA 1BWEA 4NRTA 1TAMA 4AUKA 1AUDA 1SWWA 5ETSA 2QMWA 3H0PA 1TTHB 1G2EA 2IM2A 3OTOF 1RB0A 3NNHA 3CG7A 1BWFO 4NCAA 2W9BB 4ILHA 2OTLN 3D2NA 4CJFA 2B51A 3ALRA 3VETA 1SWVA 4CZEA 3TEGA 4I27A 3QGGA 4FJNA 3RB6A 4CZKA 3BS9A 4K41A 1LOUA 4M63A 4QZFA 2WOMA 2KHVA 3M8WA 4WYWA 3ZEUA 3BM7A 2CNLB 3DOLA 1QQOA 2HURA 2OIHA 1TUUA 4CEBA 3MI7X 4ZVQB 3KUEA 1UOCA 3E58A 4OV6A 1HR0F 2ASYA 4FZMA 1MQ2A 1RT5B 1I3AA 1JLAB 4DR7F 5DB9A 3EZUA 4N8OA 4I2BA 3K7RA 1ZM9A 1BQMA 4ZVEA 1UWAA 2AP1A 3BZCA 3C8YA 2BW7A 1X60A 5AJ3F 3K89A 1K0VA 1RYSA 2M0NA 4BR2A 1BVSA 3C66A 4E89A 4PWWA 1IJJA 4CF5A 4AFFA 4I28A 2V2ZA 3TRGA 5HROA 3UM9A 2C3YA 2BX6A 4IH5A 1DZ5A 1UT5A 4RBTA 3JTOA 2IOFK 1R43A 5BR8K 3H46O 4N56A 3H20A 2HVEA 4ENOA 5KGWA 3I9V9 1J5EJ 4DV6F 2HQIA 4DTOA 3KLFA 3O3FA 1P6TA 4M5DB 2GX9A 5KG0A 4JEPA 1BPEA 1GO3F 3SV3A 1VLYA 4K0KF 1M5KC 1N5TA 2QG9B 2KZ3A 2ITMA 1LV5A 1HWIA 4OYOA 2IJNA 2FVQA 3VAHA 2B43A 3H0RB 2XY8A 4P2XA 1U49A 3B8AX 3W8PA 3IDWA 2XS2A 1X9WA 3DLEA 1RBTA 4JKGB 1Q79A 2BCUA 4UAUA 3AQOA 4O8UA 4LZGA 4ZOHC 3E01B 2EZXA 9ICIA 2FPKA 4LRCA 1XNRF 4DN9A 7ICVA 4KHYA 4HHHA 2ZKUA 1A6LA 3A4TA 3ITHB 5CA5A 3D1OA 2W3SA 3EPIA 7ICHA 2XCAA 5D0RA 2X7IA 2JL9A 3CJ3A 3D0GE 1K8AO 1TUVA 2BUNA 3ZNJ1 2MHEA 4ICLA 4FBTA 4N8NA 4C98A 4GXJA 3HXMA 2K89A 4CGDA 4EMDA 2L5YA 7ICSA 1BHNA 3QEIA 2A3JA 4WQ4A 1RHUB 4QOTA 2OEMA 4BS2A 4HI2A 1N5VA 2ZVSA 2WUSA 3UCUP 5F9LA 1VQ8N 4B3RF 1BGXT 2H5IB 3SJHA 3VEZA 3NKYA 5C5JA 1ZD3A 3BQ0A 5AQIA 3I0SB 4CIGA 4LSNB 3CJAA 3THXA 3RAMA 3M7DA 3Q83A 3MN9A 1WCLA 3Q8VA 4PHEA 2GIRA 1C0TB 4JV0A 4OLPA 3FFIA 4ZPTR 3UI3A 2YKQA 2R7QA 1NXIA 2D74B 1U1MA 2GNKA 3DOLB 4PG4A 4WXOA 3UCGA 3T69A 2CQHA 1IR0A 4IO8A 1EARA 2GH1A 3WK7A 3OTCA 3E1YA 2QJ3A 1BPZA 1FERA 2FXUA 1VAZA 4PL1A 3VF0B 2KHCA 4WTYA 1ZQPA 1VHFA 1Q82O 2FMSA 1NO8A 1U4BA 3CPWM 3CCSN 5HMMA 7ICGA 4A57A 3MM9A 4JMUA 3GFZA 4MK7A 4ILJA 4NJ8A 2BMBA 2EI5A 4M6WA 2MSNA 1YVUA 3QIOA 2NSCA 4M5NA 5TKWA 1FK9B 4YOEA 2UVUA 5AQJA 5IQQA 2K8AA 2LA4A 2W43A 3KBBA 3RBEA 1LWCA 1LWEB 1TFWA 2CPHA 4FJHA 1KOOA 3CD6N 4KV8B 4QIWD 3QJPA 4WKYA 4LSNA 1T0TV 5JICA 3M6WA 3BGRA 4ZN3A 4NLYA 3CFOA 4DL7A 2D69A 3POTB 4W98A 2M7SA 4YD2A 2WB1C 2RS2A 4GKJK 4KGVB 5CAAA 2H3VA 4F4XA 3G10A 1T6DA 3QBCA 3EWGA 5AJ3K 4MIWA 1WORA 3PJWA 3H3OB 4FZZA 4PYAA 3SBGA 1SVDA 4UB8U 2XMWA 2JV3A 3ELHA 4CF2A 3V1RA 7ICIA 1WC0A 2Z8QA 3BO4A 1ZQAA 1CQMA 3GYGA 1PJ5A 3LDNA 3SCLE 5BOMA 1VC5A 1NK5A 1TU0B 3GOIA 1CLFA 5B08A 3CCVN 3FNNA 3TTCA 3T3FA 1IWGA 1VLBA 5AKGA 4JV5J 1KD1T 3VQ4A 4DQIA 3BKFA 2Y0BB 1RBVA 3CO0P 2VF3A 3R1XA 1JLEB 2C2KB 2H5EA 4OPKA 3OFGA 2R7TA 2P51A 3D3CJ 5AQQA 3LH2S 4JV5K 1WG4A 2ZNZA 1V6HA 2KFNA 1J5OB 2LP4A 2E6LA 3KXDA 4WK1A 2XY6A 1JIHA 3PYEA 4E7IA 4LF9F 3A13A 4WWSA 2EFVA 4UB1A 3IM9A 4H4MA 1QTNB 3M1YA 3NCPA 4OKJA 4OYWA 1KP6A 1X8DA 3AAPA 2ZOMA 3T7ZA 3OYIA 5ALSA 2W9CB 2DYAA 2ZIXA 5C0YA 1MU2B 4UW2A 1UW9A 1U2CA 5B0FA 3ENQA 1H74A 5SZTA 1PYSB 4ZCIA 3A8JA 1BA0A 1PIEA 5A6WA 3JAMY 4EBDA 4CHYA 5EWGA 4OKKA 3C95A 4JYAF 2EC0A 2FD2A 1XMBA 3HHLB 5BYQA 3EJMA 3EMTA 2H48B 4M3WA 4PRFA 1T05B 4PUOB 3N9UC 4DPUA 3JXUA 5DBBA 1FRIA 1TKTA 2MQPA 5IINA 4LFCF 3UN3A 2KXFA 5KOXA 4Y3CA 1RT3A 3ZT4A 3LGHA 3PO5A 2AIRB 4DB3A 3GG4A 4NM2A 3UDVA 1KNZA 1BPDA 2MQMA 4O0IA 4B9MA 5CCMA 3HHLD 1NDKA 3CNQP 1YTUA 5EGYA 2F3JA 1J97A 3NVWA 2OFHX 2E5LF 1T3OA 2ZKTA 4WFYA 1BA1A 1OH5A 3CJKA 3MWBA 3QBWA 1IJFB 4RX6A 3HHNB 2QSFA 1PCAA 4O3PA 2VA2A 3U7JA 4K2XA 4LVSA 2VPXB 5L39A 4EYHB 2V7ZA 2F7TA 3ZEUB 4OJLA 2F9TA 4LF5F 2MJNA 1L6NA 3A2FA 2VOOA 4CFBA 3FBFA 3L7UA 2VYPA 9ICGA 4M5HA 4NLUA 3AVMA 3M6KA 3IRUA 5HATA 3CDBA 4DTMA 3J80U 3DRPB 2AJQA 1M90T 3BPSP 2VPWB 3TTFA 3J7AN 4AP9A 2CWXA 2GC8A 1SPBP 2ZBRA 3K5OA 3H98A 2QA4N 1RACB 1PBUA 3EW9A 3TUPA 2FVRA 3GV5B 4PGXA 2H1YA 3MXMA 1IBLK 3TAPA 2DHGA 3OHBA 3T9ZA 4EO8A 2WC9A 3AJ2A 4LFBK 2BEFA 2XS7A 3OLAA 4CGGA 4LRFA 4JI8F 3LP3A 5KFJA 4LF7K 4EFHA 3KUGA 5LJ5Y 4H5VA 4JP8A 4O4GB 1MN9A 4DFMA 4NZ0A 4W5OA 3THXB 4B8AB 3AXMA 3CE8A 4BROA 3MAHA 1TK5A 4M5DA 4ZVPB 1J27A 3CP8A 2FC0A 5AT1B 2G09A 3DNCA 3LDOA 1IBMK 1NZAA 4FYVB 4WCEL 3CQXA 3FMWA 2KFZA 5AQNA 2EAOA 1QM9A 3ZTQA 2QWMA 3WK4A 5BRHA 3AAWB 3PCOB 9ICKA 4WFAQ 1HLUA 2W8LA 2W4DA 2XHBA 4J8FA 4ECQA 4PA1A 4WCEQ 2Q66A 2H3QA 3QUBA 3FBBA 2BKNA 2I5JB 1KCFA 3O9TA 3IO1A 2APOA 4GW6A 1K5OA 3BZKA 1RHKB 2FTRA 3VOVA 3AARA 2HS3A 3D6HB 4PWDA 4QWCA 2UVRA 2OP5A 4K5RA 4DV5J 4CRXA 4B3SK 2IVMA 4Z4FA 3IUCA 1T7PA 3CO9A 1A5XA 4OZ2A 2QEXN 4WIQA 4BR5A 1O03A 4NYOA 4DUZK 2HNYB 3FM9A 2CQ0A 2IHMA 4Y00A 4J9PA 3V5RA 1X40A 1P90A 5ADXH 3C2LA 3CW2C 1U2RA 3HPGA 2NREA 1TL5A 1TL7A 4JHDA 4USAA 2NXCA 3KJFB 2OHFA 2VG6A 5CD4A 4HHJA 7ICQA 2CQ2A 3ZSZA 2XYPB 4C8NA 9ICJA 2DNQA 2M9KA 1XU4A 1UPMB 2QWNA 5A8RA 4HWIA 4P73A 3KLVA 4BE1A 2CJBA 1X4DA 4O0NA 4A5BA 1AZSA 2RKIA 1Q82T 3SJJA 3LP2A 2QE5A 2DNMA 7FD1A 3QO9B 2C1EB 2J7KA 2PA8D 1S1UA 2WK4A 5HP1A 5B0BA 1YQHA 2JR5A 1M5SA 2NO5A 4XH1A 1RA6A 1F5SA 3L9ZA 1NK8A 2GJ2A 3AODA 5CHIA 5EWFA 2BCSA 1E6VA 4ZP9A 2P9SB 4IFEA 3RJMB 5DS7A 4P0QB 2HBZB 3DGPB 2HNYA 4MYTA 4JI6J 1NDPA 4WQ4C 1FFWB 5M1OA 1X9SA 1MWMA 4UOGA 4ILGB 4DU3A 3M6XA 3HM8A 4PGQA 2P9KA 3OYDA 2JWKA 2E29A 2J6UA 2XGQA 3CF5L 2ZJQQ 2ROEA 3H8WA 2D0PA 5CZ1A 4P75A 3BO2A 3FK4A 2OZSA 4DL3A 3DEEA 2BOAA 3RJJA 4I6YA 4CRJA 1APSA 3NVVA 3R2CJ 4OI4A 4DTPA 2I7NA 1MNEA 4CNYA 4IG3B 3UR0A 1HJOA 1HNZK 3WX8A 2FB0A 5ALLA 4RT3A 4BWJA 1L8OA 1F5AA 5ETRA 2ZH7A 1GFWB 3TJ9A 1PYTA 3WEEA 3GDXA 1KQKA 4QOZB 3P96A 2V4JA 3EO3A 3VQ8A 2JRSA 3PACA 3HILA 3HD2A 1JLGA 4CLPA 4IBNA 4OL8A 3O9QA 5JXSA 2RQ4A 1BQXA 1KS2A 3Q2TC 1NHUA 3EXCX 1FX4A 4LUBA 1NNLA 4USWA 1XMQF 3TUIC 5A2QY 2ES6A 1JNRB 3VQDA 2NPIA 4PEOA 1NBEB 1FDBA 3I0RB 2ZD1B 1M0SA 8ICAA 1IO2A 1YAGA 3EWAA 4QYRA 4KLFA 3K17A 3BV8A 2YTUA 3BYRA 4DR1F 3HI9A 4K4YA 4E1MA 3EEQA 3DDHA 4F3MA 2JVOA 2CH5A 2RHQB 4OX6A 4JI3F 1Q4RA 3AVBA 3D66A 4DFPA 1SL0A 3BQ7A 5KFIA 4WBFA 3EGZA 2MKKA 5KFTA 1RWXB 1KWMA 3PXGa 4C7YA 1RTIA 3KKFA 2ACMA 1GXUA 3R5BA 3CC2S 3VGSA 1LW2B 5LM7E 4WZQA 4RW4A 1X3NA 1ZQDA 1Y97A 1VQ9N 4FNHA 3K0SA 5HRNA 2IAJB 3KLGB 2PEHA 1LAVA 4LVOP 1Y00A 1C0UA 2GAHC 1J9AA 3O6WA 1HNIA 2WVCA 2FBTA 3LO3A 2YPZA 2FPHX 3OTDA 5HMZA 5HRPA 4MO4A 1JRPA 4CWBA 4YOXA 1Q86O 5E79U 4KB0A 4K59A 3P38A 2WBNA 3EPGA 4B3TK 5AIBA 1WI6A 2DNNA 3IV6A 4FLUA 4QZHA 1YX2A 2CPZA 4V19X 2RHSB 1Q3VA 4OYMA 1TL1A 3CCLS 4ZVFA 5F8NA 2GV1A 2DR9A 3NL0A 3BF1A 4ZPBA 2A40A 3S3MA 8ICEA 1K47A 1DTQB 1XK8A 5IS2A 4R5PB 5ADXA 2MUTA 2YCHA 3K57A 4C7QA 3CJTA 1SIZA 3HD1A 2OD6A 2OCEA 3CMAS 1IKVB 3U9ZA 1WB9A 3IP0A 3CCVS 5CD4H 3QAEA 3I0RA 3A5OC 2BKEA 1VQ7N 3AQFA 3ZTRA 1PGZA 4J9KA 3TANA 4DX5A 1RU1A 2XB2D 1FWPA 3ZZPA 2QWOA 3SIPB 3MEKA 2KOBA 1Q46A 4CD1A 4HR2A 4YCXA 1E4FT 1ZAWA 1NB2A 4DI6A 3UXOA 3MMBA 4ZITA 2FE9A 3QEBZ 3M2VA 3MD1A 1KHWA 1NU0A 3VQTA 4KQZA 1NJWA 4KH5A 4KRWA 2XY7A 4LRAA 3V81A 5J2QA 2F7VA 1HRHA 2JLEA 4C8MA 3RJIA 4P4MA 5GIPA 4C8YA 4B9SA 1EKSA 4Z0UA 4X84A 1OVYA 2UXCF 1ZAVA 4PXBA 3U02A 1U2FA 4YOWA 4RU2A 4JI2J 3AY0A 3JYTA 1FRJA 4G1PA 2XSFA 3JQJA 3C0BA 3A12A 2X3GA 3L3VA 1YJ7A 3LP2B 2XCPA 1S6UA 2G8VA 3DV9A 2FZCB 3UN2A 4F67A 2Y1LB 2D6FC 1KAZA 4I64A 3Q8LA 1KQGB 2C3PA 2QIFA 3IKMA 3CC7S 1N2XA 1WOOA 4IJNA 1VJ5A 4CJPA 3M6ZA 2WFBA 5KFCA 3BBBA 4UB3A 2ZHBA 3SDEB 2EAPA 5IQ6A 3OQ2A 1FO4A 1WEYA 4CHQA 1DK2A 2O8DA 5KT3A 4LC9B 3KK3B 1A5WA 3EY1A 4NO7A 1N61A 4X4NA 4CIOA 1N5YA 4UY8T 4DCJB 5FLXU 2ETJA 4DMZA 2E7XA 1H7WA 1TVAA 2V9KA 5C42A 4DTSA 2C2DA 2OLWA 3ZT2A 4OV1A 3BN7A 5TISU 4KC5A 4O4RA 1HI8A 2UZAA 1TP7A 2IRYA 3M5RA 4O5BA 4DV1J 4HTJA 3TNVA 1Z00B 2KV2A 1OYEA 2AJ1A 5EX3A 4YB6A 5K20B 3OL6A 2FLOA 4B08A 2IFXA 4LR9A 2W2PP 3KWIA 1BWVA 2LQBA 4TY8B 4IFVA 5LT5A 2NZCA 1CXUA 4DV4J 4MEYA 1U1NA 3H42A 3DM2B 1Z25A 2H4WB 1L3UA 4I6MB 4GKKK 4CTAB 4JI0F 2FJEB 3DRPA 2MUTB 1ASVA 3HVRA 2F4VF 2W4PA 4NLBA 4L3NA 2G08A 2BPCA 4LF4K 4Y34A 4RBVA 1KVCA 4WU3A 3VQAA 3V4IA 4IR1A 5I42B 1W7WA 1S6PA 3IXQA 1PILA 2F40A 2FHOB 4NL9C 3J80Y 1CI4A 1PG5B 1UVLA 3NGYA 3TEHB 4BE2A 3IG1A 4M3RA 3NOCA 4KI6A 1M1KO 1RISA 3C6TA 4IQUA 3QX7A 2A6OA 5CP2A 2YPYA 1WELA 4YD1A 3QERA 2EBGA 1ZA2B 3H6EA 1HKAA 2GQCA 2VGNA 4GXIA 4ZOSA 2ZM6K 3R1LA 1S9GB 1BUPA 1TK0A 2HRYA 2KIWA 2POKA 2VFRA 2HFOA 1KQQA 4KBIA 1QAIA 4LY7A 4FWKA 3R8EA 3TUZC 4NOHA 1UFLA 1S4FA 4K4ZA 1KBRA 1WSVA 2YI1A 2RSQA 1WDTA 1T9VA 2BJDA 2P9LB 1KBUA 3WT0A 3QEVA 2P5OA 3O9RA 2VPYB 4M2YA 2FHMA 2V50A 3ZD9A 2UXBK 3G71N 5L46A 2UXDJ 1YBAA 4LFAJ 5DDRC 4R64A 2IOHA 4AHUA 3GU0A 2KZZA 4C9DA 3IR5B 5JVGQ 4TXSA 6FDRA 1UJ4A 4FL9A 4QCLA 1B7FA 2XWYA 2DEJA 2J76E 5LMUF 2LDIA 2DT9A 5DDPC 2V67A 3BPDA 4ES3A 4M3YA 2YMQA 3R5GA 1TMJA 1VISA 4M5MA 2MPUA 2BANB 3R5AA 2O6KA 4YNQA 3LA0A 4ELTA 4RW6A 4ECTA 4IOCL 4P0PA 5C42B 1NMNA 2C3UA 5KFOA 4DR4J 2XNQA 4YFUA 3QRRA 4JD2A 1S9FA 4KLTA 1MDUB 2ZD1A 5KFHA 1X66A 4EO6A 1COOA 2ZWOA 2DTUA 4BR7A 2XG8A 5IIOA 4M5GA 4FK0A 9ICUA 2UUTA 4DCOB 2XZTB 4ECRA 4UB6U 2RB7A 1Q5YA 3CJQA 4DX6A 1UEVA 1Z4NA 1BCMA 1YJ9S 1UJ6A 1XHXA 2LSNA 2QLFB 3N4WA 4ID1A 1FTCA 1W26A 4CF0A 1Z26A 5DGBA 4AQYF 4MYUA 1RT4A 3EZOA 5E33A 2K4HA 4NEYA 4RUAA 2VGMA 3ATVA 3H7IA 2HHHF 2RQMA 4OVLA 2H4YB 3OA9A 3ENOA 2RU9A 3SAHA 2IAJA 3QYPA 3I0SA 3SCXA 4DF8A 4CDGA 3M6GA 3GE1A 3PRVA 4DOBA 1YVFA 3U1MA 3O1LA 3LALA 1Q78A 3GBTA 4EK2A 1VSDA 2E5JA 3UQ2A 1SZPA 2MKYA 2P6TA 1QVFR 3KHYA 3TQ1A 4FVUA 2VWBA 1IBKF 1SH2A 4USMA 3D7EO 1RTZA 4U8YA 3KTQA 3WK5A 2UUAJ 4ZJLA 4HDHA 1MC8A 3THYB 3RJEA 4H5NA 4JKHA 1RFQA 3R6GB 3B8HA 3HT3A 4J9UE 1JUDA 3KLHB 2HWIA 3IBFB 3VCBA 5AKKA 1J2NA 5CB1A 4FYXB 4H5TA 1K8AT 3CJBA 3J81U 5J0QA 5HMXA 4EYIB 1DTTB 2M70A 4NCGB 1Q8LA 9ICNA 4K4HA 2DGVA 4IFYB 2G13A 2BCQA 5AI6A 3DWLA 1RXWA 8ICWA 1RWWB 2V69A 5EN1A 4Z6DA 3EGVA 4FO0A 1WG5A 3M8QB 2VOPA 3HKZF 1HYSB 1RP5A 4H5WA 4Q44A 3H1VX 2PKEA 3KZXA 2F9WA 3DRYA 3SAGA 3I4HX 5J0YA 3W65A 4CZIA 4B17A 4FJJA 1S79A 8ICFA 4N41A 4E7KA 2J0WA 3C14B 2IY5B 3MDQA 4GNIA 4RW7B 1YLXA 2XSJA 4BRAA 3U1LA 5A2QU 3RTVA 1VK8A 1KDHA 2BACA 2PSZA 1HI1A 3MXIA 1FKAF 2NLXA 1T3VA 1N33F 3B9JA 1KVKA 5EXWA 4OHVA 5HO4A 2GWSA 4PR6A 3LDAA 1DQ9A 4UAZA 4KHPF 2E2QA 1DGJA 2DR5A 3HX0A 3X3UA 4I2DA 3GWCA 4DR5J 4NCGA 1DLOA 4Y1CA 4HT7A 4Q8EA 4Y2RA 3ADAC 3W9JA 2NSBA 2BJ8A 1ZOTA 1WSFA 1UP1A 2HGMA 3DHXA 2WB4A 4DV1F 2G0IA 5IWAJ 3TVKA 1W25A 5EOYA 5JVHL 4XH5A 1UPPA 3D5MA 3HLUA 1YBUA 3CWJA 3TAMB 1U6BA 3NVYA 4YDUC 4MFCA 2WB1D 2JH7A 1LWFA 3V2UC 3C28A 3SUOA 1BQNB 4DV4K 1VQ5N 2VA8A 1GLFO 1H73A 3HZ6A 4XEIA 4CH1A 4H0YB 2ZE2A 4Z4IA 4C0OC 2AT1B 4IKFA 2WVDA 4BXOB 3TOQA 1B0XA 2VANA 2F9DA 3FRYA 3NH0A 3EYZA 3N7RC 1KKXA 3R9LA 4CO0A 2GZOA 3ENWA 1I5OB 1SH3A 4OZNA 1SXLA 2F8HA 4F26A 2RE2A 1OWXA 3GV8B 5AI9A 3OYLA 3GIMA 1P1TA 2NRVA 2G8IA 4RKUC 5AM3A 4CESA 1RUSA 1VQ7S 4HH1A 4CJ3A 4RNHA 4UATA 5IM0A 5M1FA 2AD9A 1TKTB 4FM1A 3DOMA 4RQ5A 3D2EA 2G2YA 1RDFA 3TSUA 1GT8A 2OMLA 1UA0A 5T7LA 4YY3F 3OTQA 3EVOA 2F5GA 4FJLA 1YRTA 1NMDA 1VSLA 1B64A 3M6UA 4B02A 4NMLA 4X65F 3R7SB 4FXWA 3MDFA 2VC1A 2HPUA 2D41A 4B3MF 3AU6A 5A8KB 3HP6A 3QNNA 4EEKA 1IM6A 2BV3A 2W55A 2NNWA 2BJ1A 2CG4A 3T6JA 3A1YG 3SQIA 5L8RC 3F5AA 3KMQA 2DY9A 1TELA 3IS9B 2KG1A 3H7HB 2ZZMA 2DH9A 1IKVA 1UQVA 1FXDA 5C2FA 4A8EA 5ALUA 4J2BA 4YOYA 1FNXH 5CWRA 1RT1B 4BGBA 3CJ0A 5GAEP 1Z2ZA 4CECA 4NRUA 3HPOA 3C16A 4CJUA 2HK3A 8ICOA 2F65A 4B1WB 5T14A 3CC7N 4HTUA 3RBDA 1YG0A 1TL1B 5KQ8A 1UL3A 4P2HA 1YJNN 8ICVA 4J9SA 3PX6A 3AA2A 4YS2A 5H1SQ 1RWKB 2CRLA 5BYSA 3V81B 2EEYA 4MAKA 2F63A 5J0XA 3VVTA 2IJRA 1R0BG 2HNDB 1DKGD 2P9CA 3CCRS 2K8GA 2ZGZA 3MMAB 3HPHA 5GIOA 2QTDA 2F3NA 3BBFA 4CLZA 2BDPA 5E26A 3CNHA 4F92B 4C2MA 1I39A 3BN4A 4KHNA 2WAQD 1QHAA 1YJWN 5HVFA 4NYPA 3GFXA 3VQ5A 5J0OA 1P8ZA 4KGKA 1SBRA 1NSPA 4WU2A 7AT1B 3FRZA 4DSJA 3HOTA 2JMGA 5AKEA 4IO9L 2AH5A 4PZNA 3H0LB 2F2AB 4RL1A 2W7AA 1EQ0A 5J2QB 3KK1A 2HQCA 3ULEB 3HT0A 2PXIA 9ICVA 1U1KA 4NLCA 1IR1A 2YKAA 2FJAB 4WP3A 3J7YU 5AFUA 4A8QA 2EHGA 3W60A 1S3XA 2G2ZA 2CAJA 2AXTU 4OHWA 5HL7L 3NVMA 3RBXA 4ED8A 1VSKA 3G6YA 4WQ5C 2E44A 1A9NB 2CXYA 5ADZA 4QWAA 1SV5A 5G0RA 1AFIA 2ZH2A 1NKCA 2BHNA 3V6DA 3T6BA 5F0UA 2W03A 4AH9A 1SCJB 3T1AA 4JKEA 3VVUA 2CZVC 3AB4B 3DOMB 1YJRA 4FLZA 1IKYA 2GFFA 2ZJPL 2OYQA 2OWOA 2HRUA 3VAFA 2KM8B 2VASA 4JI6F 1HX1A 1CUKA 1ZJMA 2UV8A 9RUBA 1NSKL 3IMXA 2O8EA 5AZJB 3H5XA 3BDPA 4ELVA 4H0PA 3RMBA 1R8CA 4CCHA 3D6JA 2A2CA 1CJKA 3ZSVA 1OO0B 4UQTA 3WIVA 4ECXA 4K4VA 2NLWA 1JKHA 3C15B 3JXOA 1YRXA 4OPHA 2G8UA 5E0OA 4P7VA 3P4IA 3HFZB 1XNRJ 3D9BA 1M1GA 3KD5E 4IR9A 4K8XA 1FI4A 1E6YB 3G71S 5G0RB 2HI0A 1QCKA 1YJTA 3PX4A 4RPZA 3WXIA 4KLUA 4EWTA 3UO0A 1BMQB 2J6TA 3MOJB 1IQTA 1TVRA 1R0CB 1UFKA 1ZAXA 5ALWA 4F4YA 2FVPA 1CJTA 1KOHA 2VJ4A 1V5VA 2MQQA 1S9GA 1DARA 3A0HU 4JHDB 4LQ9A 3MECB 4BJQA 2JGAA 2JLGA 3T5LA 4I69A 2LKZA 3VA0A 1OKJA 4FJXA 2ZBCA 2P9PA 1XMOK 1T8EA 2B0GA 1RBOB 2Q6CA 4K43A 1JQGA 1UVNA 2F1HA 3E9OA 4P0PB 2HZAA 2FF6A 3EKSA 4DL2A 5IOLA 3C15A 3SFUA 5J2EA 5LJWA 3VQ6A 2V0NA 1SV5B 2A3VA 2XMJA 1HKCA 2FMPA 5KFBA 4U67L 1ZM3A 4USTA 3OR1B 2FI1A 1WACA 4CE6A 3CCWA 2AHOB 1RGIA 2HK2A 2HBYB 1T3NA 3PJ9A 3GSDA 5C12A 4U96A 4IDKB 4CLSA 4LD0A 3Q7CA 4H4OA 2LMRA 4EENA 3TW0A 1CXQA 1N56A 4CO4A 4MKVA 5F8HA 3NF8A 2V4JB 1WUUA 2ROPA 1KN6A 2UUBF 1U02A 3MM9B 5F1XA 1MSWD 4FDFA 1VDVA 2O1PA 4CLWA 2WBRA 1F5BA 2PIIA 3LP1A 1S76D 1VSHA 5DETA 4RQ3A 5E3QA 2P6SA 1OY9A 3QNMA 3QUCA 3VF6A 4V19S 1OH8A 2DNKA 4DR4K 1RDCA 2XI9A 1DGKN 1DURA 4QYZJ 3TFRA 1CPZA 3I56N 3VAJA 1HPZA 4O4GA 2G8HA 3QIPA 1EWQA 3OS1A 3M30B 5LSLA 2AU0A 2H5XA 4UAVA 1KKHA 1ZZNA 1A0PA 2BA9A 3CJ2A 2P5GA 1RWPB 3O3LA 4RO0A 1ZQVA 4BR0A 1CJUA 2DWQA 2R7SA 5DG9A 4FLYA 1QQ6A 3QWPA 1VR6A 3BH6B 1KFTA 4RNOA 2VZ9A 1YWXA 2Z56B 3TX0A 1DXSA 3D6RA 1OQ3A 1RT6A 2MKHA 3W3SA 2BGGA 3M1VA 2HHVA 1RT3B 5G4DA 3OLBA 5M2PA 5AM0A 3RYLA 5HR6A 5DM6L 2FGOA 3THWB 3KHGA 4ER8A 4PXDA 5AE3A 4AYBF 3W5ZA 2J0QD 4DR6J 4RWTA 2KT5A 2ZIWB 3ETOA 3O0FA 1VIXA 3GLJA 3MMAA 4OGCA 1PSDA 2W54A 5AXLA 4LFAF 2EW9A 3O5BA 3K5NA 4AHSA 2PBDA 2DGXA 4DV5K 2JFKA 1HPZB 1NH8A 3G6XA 1T03A 2KYXA 4B9TA 3Q89A 2LYAA 4IQWA 1ZXOA 3FSXA 1XNQF 4LSLA 1Z6RA 1ZBUA 4YORA 1FNMA 5GMEA 1Y88A 1PC4A 2JOQA 3CC2N 1BOTO 2DFLA 3K0JA 2WB1F 4UZCA 1VBZA 2G4BA 4JK9A 3IFEA 3GCWP 3MWTA 4G1QA 2O5DA 3TZXA 3Q8UA 2Y1JA 3C1YA 1VRUB 2ILYA 3VEYA 4K25A 2P6RA 1HW9A 2LQJA 1IV8A 4J2EA 3BEXA 4UOFA 4BRPA 1TAUA 5E3CA 1W7AA 2Y1IA 2QXFA 3DRSA 3E9LA 4OZLA 2HGLA 1KR4A 5KFVA 2W4CA 1RWNB 2A5XA 2LI6A 2IRXA 1CZBA 3P8BB 5F8JA 3FCWA 3CD7A 1ZQUA 5KPZA 3QT7A 1RADB 2MMYA 4BQZA 3MTKA 4U7BA 1KSPA 3DDKA 4GRSA 2HHPA 1S1VB 3M8YA 2R8HA 3H8MA 2BH1A 3HP9A 4M42A 5EY4A 3M05A 1PBAA 3CJ8A 4RJVA 1RILA 4OYIA 3MEEA 4QS9A 1JALA 2ACYA 1RDUA 1AUSL 4CLKA 2IHR1 3FGUA 3CCUS 4AHTA 4KGZB 4FOEA 3H4DA 4LIRA 4CF3A 3PMNA 4RPYA 3SENA 5LMUK 4BC4A 1FFSB 1D1UA 4O9MA 3BZQA 1GK8A 4WE1A 5DQHA 1IR2A 2B8QA 3ZDBA 1DLOB 2CQ1A 3QFWA 4NEZA 3UIQA 5J1PA 4RWWA 4OYXA 2FY1A 3VQBA 4IS7A 1RQLA 4FFDA 1SIWB 1K1SA 4DHVA 4USKA 4IO1A 5CHGA 1VK0A 2RDDA 4CFCA 1DT9A 2QB1A 2AYGA 1C7YA 3I8DA 2QSWA 1R3NA 1YIJS 2VWJA 1WD6A 2EK1A 4KHUA 1SB3C 3VC8A 1RJJA 4CK3A 2M3DA 2W1BA 1VQYA 2KT3A 4FPIA 2LKYA 4N77A 1RZTA 7ICLA 2X1AA 4CLUA 3OTBA 4OX7A 2DGOA 1ZQOA 1VSFA 2V2QA 2F9JA 3B82A 2Z57B 2YY6A 4ZCLA 4DV3F 1HBNA 2Q2RA 2AZ1A 4JI4J 1SC1B 1HD0A 1PUZA 2ZIUB 1K73O 1OUQA 1XO1A 1BE4A 4CZGA 3O5TB 2E2OA 3ID6A 7ICPA 2KT2A 2RT3A 3MM5A 1IG8A 2XZWA 3AVIA 4DCCA 1BPBA 4IFVB 5DJBA 1JNZB 4KE5A 4CLYA 5AQPA 3BS5A 1T44A 4KLOA 3BJYA 1WYGA 3MEGB 2F4VK 4IDKA 1XUPO 1FWLA 3NFAA 3OS2A 3B78A 5JVGL 3L2RA 4JB3A 2F8EX 1FJGJ 1QQNA 1ZQIA 3NBPB 3WNFA 3OW2M 1WF0A 4C4RA 2E1EA 2FUG9 1P8GA 1DGSA 3AV9A 3ZDDA 5KFYA 1JJ2R 3IG8A 1GLCG 2VKZG 2QXLA 1GAOA 4CYUA 1PYOB 3NGTA 2YX1A 4K4TA 4M7XA 2XMVA 3BR8A 1U6ZA 2B6AB 4PKDB 2EG1A 1LWXA 2ZIVB 4EHUA 1HNZJ 2XHWA 3C6TB 2P9NB 1AROP 4ED0A 2DO0A 1HQEB 5ALIA 3HSJA 3MCSA 4IG3A 4ZPVR 4C7ZA 1W9HA 4PPZA 3LVVA 1VQLS 4WQ5A 3I55N 2H3EB 5AKIA 1SUQA 2HFNA 5J2JA 1F9FA 4HL9A 1RHJB 2D4WA 1HHSA 3O8WA 3SQ1A 1MWQA 1FXLA 1C1BA 1ZD4A 4OO1J 3N5BA 4P74A 4C3KA 4IYQA 2EX3A 2E1ZA 1VMBA 3RJHA 1NPRA 3ZFVA 1BNPA 5AK3A 4OI6A 4ZVSB 2QA2A 1NKBA 2DL0A 1RT7A 4Z4GA 1C0FA 2A1BA 5SUHA 1RT6B 2DISA 1FFVA 1XBWA 2HS0A 2NYIA 1K44A 3K9JA 3KD3A 4OI3A 3QBXA 3U3GA 2XHCA 2GMJA 4OKEA 1S77D 3ZD8A 1UMJA 2AYMA 2CJQA 3HHEA 5ALTA 4BDPA 2J4RA 1YSJA 3MCOA 4OYPA 4DR3J 3AVHA 2AGPA 1YITS 1VBYA 4FCYA 2BM1A 9ICQA 1PJ6A 4H4OB 3AO4A 2HBMA 1J5OA 3OXGA 3ISNC 4B3SJ 1LCUA 1ZQKA 2UXCK 4ZJOA 5DQIA 1GXTA 2CPEA 5K8MA 1RBUA 1NZ8A 1S12A 3DGPA 2E1CA 3OHRA 3PR5B 1VK3A 1R0AB 4CJTA 2VIXA 9ICXA 2MY7A 2O8FA 1RAFB 4O44A 4I2PA 3MK6A 4YHHF 1CS4A 9ICHA 1FJEB 1FJGK 2PEBA 3O3HA 4NL9A 5BRDA 3O3GA 3NHGA 1Q9YA 1EP4A 3WUHA 3WK8A 4FK2A 1XNQK 2HBRB 2YHWA 1ZBTA 3Q8MA 1TV9A 3I87A 2IJFA 1AZSB 1ZRNA 1C0TA 4KJIA 3VENA 3JPQA 3RG6A 4NXMJ 1RBRA 3MMJA 5F0XA 1H38A 5J2PA 2G9OA 1NKEA 3F44A 1XMQJ 1N33J 3LWLA 3BEGB 3DLKA 2DCLA 4B8CA 4QPXA 1HYVA 4JV2A 3NRBA 3H8JA 2YNHB 5B0CA 4CGIA 4J9QA 4ISFA 3CJ1A 2YWWA 4BLGA 1LXJA 1WOPA 1IKYB 3A5MC 4FO6A 4A4JA 5AQMA 2D3ZA 3WNGA 3CFRA 2H5JB 1I94F 3UMCA 3NMUA 2D3DA 4A61A 5HP4A 5J0SA 2IM1A 4ZP6A 4ED5A 3BQTA 4DO9A 3OYEA 3AVFA 1WG1A 1FD2A 1QQMA 1FO1A 5KFRA 1KC8O 2PGCA 2F1FA 2H3IA 4P71A 1GX5A 1ZOLA 2WONB 5IV3A 3CCMN 4KKOB 4CHZA 3K1ZA 1B99A 4XPEA 3KOOA 3H08A 2CJ9A 1B0PA 3RB0A 3PR4A 4DSFA 3E51A 3A5LC 1OPZA 1BIZA 3SPZA 4LF6F 4FWPA 1S99A 3VTIA 6AT1B 4U7CA 1R31A 3HKZC 4PHPA 3CCES 2A6MA 4HVJA 4KLSA 3GG1A 2MU2A 3M2UA 4DUZJ 3J80O 1HFEL 4OJ6A 3OYAA 2MEWA 1YJWS 4LF2A 3LOUA 2KIVA 3HHKA 9ICWA 1CRXA 3DXBA 3ZSRA 1VQKN 1PVQA 2V8HA 2JEFA 2JLFA 2P2CB 4IH6A 1XSPA 2CYYA 4P9SA 1HNVA 1CG2A 2WHOA 1L8LA 2OD4A 5AR0A 3AVLA 3JPOA 2YV0X 5KFEA 3PIOL 1U8WA 4MHVA 2ZOFA 1HNIB 1JLQB 2CJAA 4FZYA 3VGLA 5HK4A 2ASOA 2GCFA 1EHWA 5D6GA 4I2CA 1X1PA 4K2JA 4YR0A 3CJKB 1U04A 2FF3B 1VQLN 5ALOA 1LAWA 2GGPA 5F3TA 4LRDA 5IIIA 2DF4B 2JDJA 3AT1B 4KH4A 1S1VA 2EC2A 2ZH8A 1XMQK 3HL8A 4IDHA 3NGZA 1UFWA 1FESA 2OTJS 3EICA 1CJTB 1ZQHA 3R2DJ 3IN5A 5GMKa 1B0TA 4DTNA 4LIWA 3CVKA 2ZTCA 2ZOGA 1S72S 1UAWA 1JLAA 3HULA 4ZCKA 4JK1A 2HB5A 2IS3A 3S6JA 1XNQJ 1S6QB 4DG1B 2PI4A 3T1YF 2NYHA 5D77A 3M8PA 4KLGA 4L73A 4JI5F 1L7PA 3LQVA 1JXEA 2GMLA 1GTEA 4MK8A 4PPDA 2FZKB 3G8TA 5T41A 4HUGA 5FRMA 2PO4A 1LW2A 1O08A 3NGDA 1VQ6N 4Q7AA 4CLLA 4FBUA 4IG0A 1NCLA 3SMSA 1HUZA 1MW7A 4Y2VA 3TAMA 4F50A 5BPCA 3V6DB 2EAMA 1QDUB 1QVGR 2FPMA 1LW0B 3EGNA 1ZBFA 2HMXA 2R8KA 5KFWA 1XMOJ 2EG2A 2Z7JA 1E6VB 4FJMA 4Q45A 3MOZA 3MF5A 5GMDA 3LM9A 2OAUA 3MPYA 2YY3A 3MGJA 4EHTA 4DR2F 3R3TA 1Q0NA 3IHQB 4W5RA 3CGIA 2CH6A 4DXLA 3VTHA 3VQQA 1UEUA 2K06A 1SKSA 3WX4A 1BCOA 2BYCA 4PL8A 4ISGA 3CMEN 2AF6A 4QZEA 3H25A 1S7HA 3A8KA 1NK4A 2NXNA 1HEKA 3CTRA 2Q6BA 3QZ7A 3MM5B 4X64K 2K2PA 3UD4P 1FW6A 4NA2A 2CPIA 2WVEA 5J2MB 2GWJA 1N60A 1S6PB 4KH1B 2EFGA 5K8OA 2HYIB 3DFEA 4JV1A 4RQ6A 1A77A 3MPDA 5HR7A 2M52A 4DN0A 4O3QA 2E5GA 2EWSA 4CEQA 3N28A 4ELUA 2QYCA 2ZBPA 2OM6A 4RQ2A 4WFAL 1Q5VA 3KZIU 2ZJQL 2RIJA 2ZH1A 3ONNA 4QPTA 3Q8QB 5F8IA 2KN4A 5AZIA 4EBEA 2FJWA 4M5IA 1T9UA 4LRBA 4IO9Q 2OXOA 3UDLA 3NF7A 5I3QA 1V85A 1RCOB 2R2UA 2NXEA 1RHRB 4ALZA 4D3HA 1M5OC 4DUZF 3OBIA 2RU3A 1QSYA 3C3LA 4B3SF 3DRSB 3DOKA 3UNGC 4PAAA 2GQQA 3NCQA 1CSJA 1L7MA 3JSMA 3PVXA 4YMNA 3KHRA 1C0GA 4HI1A 1X9XA 1NK0A 3E01A 4QU7A 2B56A 5KG7A 4F2RA 1OVQA 5J2MA 4RG8A 2WCXA 3P4UB 4YHHJ 5AHXA 2K60A 5DZ7A 4H4KA 3D4JA 5L1IA 3TVYA 3HCXA 4BRDA 4A5AA 4DL4A 4QS8A 1S1WA 3TAEA 4ED7A 1T3QA 3HRDD 1Y0HA 4CM0A 2PMZC 3KJVB 3E8OA 3VMFB 4DV0F 4F5PA 2H3ZA 3OYJA 3D2QA 2BE2B 5THWA 2R4FA 3RR8A 2PMZF 2ZXHA 4JD2B 3NVKA 3V9XA 3C94A 5DLFA 2L9NA 5HQLA 3KWGA 3HFKA 4LF7F 1IVZA 1R8PA 1X7VA 4CGFA 3OS0A 5KFXA 4CD3A 4JI8K 3M30A 2RN2A 5ALXA 3HM9A 4LFBF 2OI2A 2DHXA 2FLNA 3QLHA 3R9PA 3DAWA 5E84A 1IBLF 4JKFA 4MO5A 5B0AA 5FIIA 3J7ZO 3PRDA 4B3MK 1ZQLA 5C24A 3PIPL 4H5RA 2XO7A 2N7CA 4LFCJ 3UVJA 2HIQA 2MKSA 1TYQA 2YX6A 2RPIA 1ZQYA 2MB0B 1RTIB 3NCRA 5DDQC 1R8HA 3R6MA 3GTYX 5GINA 3GILA 1HI0P 4F4ZA 3L6QA 4AD6A 2HAIA 1X0PA 2YX8A 4ZHRA 2MQ8A 3HX9A 2V8VA 4JI7F 4ZK7M 3BSCA 2L9DA 2B5JB 5AQSA 2V8PA 4JUZA 1JMTA 2J9DE 4CT9A 2D3O1 2KQ2A 1HLWA 2WAQC 2CXEA 3V7KA 3G82B 2Y0SD 3BSNA 2QT7A 2EFOA 3ZETB 2WF6A 3PZPA 5AXMA 3L4QA 3PW4A 2MKJA 3H5SA 3MCNA 2E5LK 2HF4A 3C46A 4BG9A 1X6JA 2V94A 4WJBA 4KRFA 2PC6A 4EEYA 2LQ8A 4ID8A 1CJKB 1QZ5A 2QARA 4K4XA 1U2VB 1S8OA 4EBCA 1JK9B 3QESA 2LEAA 4AL7A 2G0CA 1RAHB 4TKTA 4E3SA 1OY6A 3QQCD 1QY7A 4AYBD 4F9OA 4OX9K 3HMJG 3LM2A 3LANA 1FDNA 1TR0A 4QYZK 4NY8A 2O66A 3RZAA 3MCPA 3M9MB 1SXEA 4LJMA 3I5AA 4X4TA 1V97A 3SSSA 3PFEA 1DQ8A 1ZTTA 2HVHA 3LPEA 2MKCA 5ALVA 2BDUA 3UPFA 2G8FA 2DPIA 2WBMA 5AKZA 1EQYA 1LW0A 4BRNA 1XS9D 4GV9A 3D2SA 1Y7PA 3DLRA 3TAQA 4OQJA 2U2FA 4TQRA 2QL5B 4YMEA 3P6YC 4X62K 3KWMA 2A42A 5KFPA 1N33K 3F2DA 3QATA 1S1XA 3E9PA 1NSQA 4K4IA 2ZUAA 2XQCA 1FRLA 3ZZYA 1ZD2P 4UY8O 2P9EA 4DUYJ 2BBEA 2KVCA 2ZVIA 3AA4A 2JWLA 3H5YA 4FOIA 4UY85 3BQ1A 4JV5F 3MABA 4B3TJ 2HQDA 4PQAA 5AE1A 1F6TA 4HLBA 1UZHA 4PY5A 5DB8A 1YBTA 1VI7A 2ASPA 1HQEA 2HBJA 5ETKA 1HMVB 3PW2A 5L1KA 3UR3C 1T02A 2E8AA 1C4AA 3QLHB 3Q23A 2WMMA 5ELZA 2BPFA 3THPA 5HSPA 2E6MA 4U9RA 2CQPA 3NMAA 4E8UA 5J2PB 3W9HA 2D3OR 1P9QC 3VA3A 4NXNK 1WKJA 2UXCJ 5FPDA 2B7CB 1RDBA 4LBHA 1OW5A 4YY3J 1D3WA 3DGVA 3CXCR 2E66A 3HSGA 4KLHA 3JQMA 4BRMA 3CULA 2HQGA 2GX8A 3UNYA 1C2PA 2DFHA 2WZ1A 1RT2B 3KIOA 4DU1A 4MEXA 2IBOA 2E1AA 3SLCA 2P9PB 1OSDA 4M9JA 1PJ7A 1HHQA 2MZQA 4CVNE 4DOCA 4TU8A 4X64J 3QFHA 3MD3A 3ETLA 2FJDB 1NGBA 2MZSA 2ADBA 4E0DA 2CQ4A 4FJGA 5JTIA 4X4OA 4ZVGA 5EOZA 4ZVUB 3RMAA 3W64A 4RLEA 1D4XA 4KSEB 1WN7A 4EP5A 3SSQA 1L3VA 3TUJC 2Y9HA 4PKGA 4USJC 1MMDA 3M1VB 4J91A 2D0AA 4YG2A 2D3UA 3TZWA 3PNCA 2XTJP 2DHHA 2Q43A 1K9MO 4DL5A 2CQIA 3OW2R 4UBCA 3NDKA 1M5HA 2DIUA 5D0GA 2HZVA 1TQLA 2BXJA 4MIAA 2KM8C 1PKUA 1RBLA 3T1YJ 4CGHA 4KX3A 4MDBA 2Z58B 2FHKA 2IC3A 4JKAA 3J7Z5 4AQYJ 1G15A 4DPXA 5IWAK 2I5HA 3H8YA 1VLOA 3I5BA 2V7YA 3N4PA 2F77X 4FJKA 2BPGA 2ZIWA 3TKAA 3N7PD 2RDJA 4F04B 2WSEC 1HYSA 3K5PA 3CERA 2AEFA 3ALYA 4FWNA 2X1BA 2JSXA 4G3IA 2F4VJ 1C20A 5HI7A 5ALQA 2F76X 3HRGA 5DZ6A 3CEDA 4OPAA 3J7A1 2OTJN 5KT5A 2IRUA 4PABA 1X4CA 1IBCB 2FVCA 3I5CA 4BC7A 3G6ES 4Y28C 3WKBA 1JCGA 2XMMA 2E2NA 4EX7A 2QKBA 1LOTB 1XC9A 1Q7YO 4ZVTB 3MDAA 2MGZA 3UMBA 2DNHA 5HLFA 3L3UA 1WAFA 1VBXA 4CTAA 2IDEA 1GMWA 4Q2LA 1S49A 4CFAA 4ZLPA 5DRKA 3M8PB 4BGAA 3QSIA 2LM1A 4P2SA 4M5JA 4MFAA 1TFRA 3WKAA 1JLQA 1ZBSA 2UVVA 5E7OB 1HL6A 2O4IA 3FFIB 3TABA 4QW9A 2RF2B 5HMWA 2G5IB 3SUNA 1FX2A 1TKXB 3ZLJA 1F60B 4F0HA 5LL6d 3EDQB 4GLXA 5CYQB 3CUNA 2WSCC 5HAOA 2BRLA 4TNOA 1HQUB 4XK8C 1WWVA 2VBXA 2F8LA 2G8WA 1HJPA 4IOAL 4NLXA 1N5YB 2CUYA 3P83D 3TZZA 3QNWB 2DKZA 2RRBA 2KHQA 4DOZA 1FVSA 3RH5A 2ZM6F 3S01A 4C6AA 4BHQA 4CEAA 4NA1A 4NX9A 5BRFA 1XTZA 1WEXA 2WAQF 5LL6Z 3HHLC 2KH9A 2C28A 1RCXB 3T19A 3UKRA 4M3XA 2PMZD 2R7WA 2FY8A 2YHAA 5CXTA 3NS7B 2ASMA 2HNZA 5K4LA 4FE3A 1XQSC 1S1TB 3L4IA 1ZBHA 3WXMB 2ZWPA 1XO0A 4RPXA 5K8NA 3QUQA 3F56A 1K9MT 3RB3A 1U0HA 2EDUA 4DJBA 4WFNQ 3MXJA 4DF4A 2ZJRL 2KYZA 1CC7A 2OELA 5M1NA 7ICKA 1YVNA 3TFSA 5AKJA 5CYMA 4CW7B 4DSIA 5J0UA 3C6HA 3QJLA 4ECUA 2RH3A 3KZBA 4DV7F 1R27B 1RAAB 1BD6A 3FZFA 4Z4EA 3RGIA 5ALKA 2P9GA 3V1OA 3VGUA 2K3IA 3H0MB 3NS6A 3TZYA 3G25A 1SJ4P 5L38A 4MT1A 4G9BA 4Y1DA 4A8OA 1WSIA 3ZTSA 2C2OB 3ATUA 4DV2F 1ZTWA 1J53A 4DQ8A 4HH0A 4ZVHA 5CE3A 3U4LA 3P49B 4YOUA 2DTJA 4R0EA 1ZM2A 1S5JA 3DXKA 3CC4S 3K5LA 3T5HA 3AD7C 3HVTB 4Y2JA 3SK3A 4DDFA 3CPEA 4DKWA 2QARB 1RYRA 3FSYA 2CQDA 2DITA 3VERA 3KK7A 4UOCA 3M2UB 4CF9A 3KUHA 5GAHP 2IVPA 3M2VB 3DHWC 5EWEA 5M1QA 3W1YC 3RWUA 4ZA1A 1IN0A 2MZ1A 5F41A 3BBCA 3R9KA 2Z1IA 3C23A 5AI8A 4CBWA 5IXUA 4DV7K 5LMNF 3IMQJ 2QKKA 4OZ1A 4MQ3A 2NUUG 2XYHB 2OGUA 1Q8IA 4US9A 2V8DA 3L2QA 2FJXA 4B9NA 2VFUA 3OJSA 2K7JA 4MLHA 2RVJA 3AVKA 2IMWP 2MLYA 5MLCQ 1ZPVA 3L5KA 1NZBA 1E3MA 1ED1A 1QZ6A 2IIHA 5AQHA 4EX6A 4KV8A 4ED6A 1MROB 4YDDB 2ADCA 5CZ2A 3EX7B