4F8RA

Bacillus dna polymerase i large fragment complex 7
Total Genus 204
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
204
sequence length
579
structure length
579
Chain Sequence
KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase
publication title Structures of a High-fidelity DNA Polymerase
rcsb
source organism Geobacillus kaustophilus
molecule tags Transferase/dna
total genus 204
structure length 579
sequence length 579
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4f8rA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4f8rA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4f8rA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4f8rA01
2D0CA 3KK2A 3LK9A 4O3PA 3SQ4A 3SPZA 2FBXA 4XA5A 1L3SA 3VQDA 4RQ4A 5KFXA 2FBVA 4CECA 3ISDA 4IG0A 3NE6A 3OS1A 2KZZA 9ICCA 4E7KA 3MXJA 3PW0A 2KQ2A 4YR2A 2LSNA 3B6OA 5KT7A 3RB3A 4E3SA 3L8BA 1W0HA 3AO5A 3CFPA 4DU3A 4KLDA 3K5MA 2BKEA 3SUNA 1S6PA 4QAGA 1WSHA 1NJXA 4KB1A 5L1JA 3MR6A 5KFEA 2IAJA 5IIKA 4CJWA 3V6JA 3KTQA 1RT7A 3RJEA 1Q9XA 1QLNA 2DFHA 4NXZA 8ICIA 2OPRA 1QTMA 3LPTA 8ICFA 4DTRA 5L1LA 1MQ2A 4RW8A 3JPQA 3I0RA 3QESA 3V6HA 3PV8A 4CF9A 3TFSA 3OJUA 3D45A 1A5VA 4FLZA 3NFAA 3AVIA 5DB8A 2E4LA 4G1QA 1JLGA 1BI4A 1N48A 1I39A 4KLMA 3ISCA 5J2KA 4RPZA 5J0RA 5J0XA 4CK3A 2PXIA 3PX0A 1EKEA 1V9PA 2W9AA 3ZT3A 5KRTA 3VQBA 4JK1A 4M47A 1C1BA 4ELVA 7ICFA 1NK9A 5F9LA 4RQ3A 4W5QA 2BE2A 1AROP 4R63A 2IA6A 1QE1A 1U48A 1MC8A 7ICLA 3VQ8A 4YVZA 3AA3A 5KT5A 2G8KA 2C22A 4Z4IA 1TK0A 1LWEA 1UOCA 4OGCA 4E7JA 3ZT1A 2HHXA 4DEZA 4PY5A 5J2AA 9ICIA 1SKWA 4M04A 1JXEA 4LH5A 3JPNA 4ELUA 3NGIA 4O3QA 4YMNA 1SKRA 1S10A 4KI6A 4O5KA 4FJNA 3RJKA 3H8WA 4RQ7A 3UPQA 2ZJAA 1SV5A 4DSIA 1RDCA 5C42A 2R7YA 4F5OA 4DLEA 4ZTFA 3LWMA 3RRGA 5J0QA 5KFUA 2P5OA 4DL4A 3ZDAA 1RDDA 3V72A 1LAWA 4KPYA 1BGXT 4JV0A 3K75D 1YTUA 5DBAA 4QZHA 2WONA 1XU4A 3KD1E 1T7PA 9ICKA 4I9LA 8ICPA 5KG0A 1NK4A 1ZQLA 2PY5A 2UVVA 2IBKA 4J9MA 3RMBA 4FK4A 5JUMA 3GILA 3NDKA 3RH6A 2J6UA 2Z1HA 4DMNA 4TSXA 3RJIA 3RB0A 4GXKA 1KCFA 1F21A 1JX4A 3OVNA 1ZJNA 3IAYA 4RUCA 3T5KA 2BGGA 4YNQA 3M9MB 4F5QA 3TARA 4W5OA 3JPSA 4ECQA 2PFQA 4I2BA 3V1QA 2FPKA 4CF8A 3UXPA 2JZBB 3G6YA 4ZTJA 4CCHA 5J2NA 4EP5A 2VA3A 1J53A 3AO1A 1ZBUA 1EXQA 4E1MA 2IOCA 1X1PA 2OYQA 4CJLA 4FLYA 5HMLA 3EYZA 4CK2A 2MUTB 3GIIA 4XRHA 1ZJMA 3RH5A 1VSJA 2YHBA 2OA8A 3RBEA 2G8UA 2W9CA 4DQQA 2JEGA 3PO5A 2XGPA 4KTQA 3G10A 3TAGA 1TFRA 4DO9A 1SL0A 3EPGA 4CJTA 1ZQMA 4QZDA 2XY5A 4CEFA 3Q8LA 1TVRA 1JLFA 4UAWA 3LAKA 4MFFA 3V1OA 4OKKA 4CJKA 1VSMA 8ICHA 1JKHA 4LH4A 2RKIA 1HJPA 4CJQA 2ZE2A 4DTJA 3VQ7A 2KW4A 3SQ0A 3AVBA 5C25A 4M3ZA 1BISA 4OPJA 1BIZA 1IKYA 5HRNA 1VSLA 1RILA 4KLQA 5KG6A 4CGDA 1KFDA 4LZDA 3RJGA 3EWAA 2PI4A 1Z26A 4CFDA 4RNMA 3M8SA 4HHTA 1L5UA 8ICCA 9ICGA 3S3MA 4ECSA 3UXOA 1EX4A 4YFUA 2PYJA 2IC3A 7ICVA 3MGHA 4TUQA 3HX0A 3Q8SB 3T1AA 2YNIA 5J2FA 4ED1A 1RBSA 4ED3A 5FRMA 1WAJA 4FJJA 1KTQA 4DSKA 4IR9A 4Z6FA 4JLHA 1CEZA 4CJPA 4IKFA 2RPIA 1Z25A 4QZEA 5DDMA 3OS0A 4O3RA 3QNOA 4CHYA 3QE9Y 3SJJA 2DTUA 3RR8A 4FZXC 7ICNA 2A1JB 4J2BA 3QEVA 3DYAA 5CZ1A 4AHRA 5D49A 9ICNA 3QIPA 5IIOA 4EZ6A 5J0TA 2HHUA 3SPYA 2F8TA 2X78A 4JUZA 1T05A 3LANA 4HYKA 5BOLA 1K1SA 1S1VA 5KFOA 3ZD9A 2GBZA 5KFPA 2Q3SA 2A1RA 3L3VA 1XSNA 2V4QA 4KLOA 4J2EA 3NHGA 7ICKA 1HNVA 4W5RA 2ISPA 5C24A 1BL3A 3TR8A 3C2LA 9ICBA 5JS1A 3MABA 2BQ3A 2NRZA 3SCXA 4N5SA 7ICEA 1FKPA 4K4HA 4OKJA 5HHIA 1EXNA 3HL8A 3ETLA 1NJYA 2R8KA 3FYHA 3TFRA 1ZQKA 2BANA 3O3HA 1ZQVA 4KN4A 2ZTDA 1A5WA 3Q8RB 3ASMA 2GUIA 5J2IA 9ICLA 4ID5A 1ZBLA 1D9FA 3MR5A 5L1KA 1BVSA 4KMUA 5BPCA 5KT2A 3IM1A 3B6PA 3RJJA 3MEGA 4NCGA 4CJ3A 4RQ5A 4ECXA 4I7FA 3H7IA 3KLFA 1DLOA 4F5RA 2VA2A 3AUOA 3LALA 5J0WA 1VSFA 4J9KA 4F91B 4ECZA 4B3OA 3ZSVA 2J6SA 4KTWA 4O3NA 4M2YA 2QXFA 1WSGA 5KGWA 3WNGA 5KFMA 4KLSA 1KLNA 3K5OA 3LPUA 4C8OA 1L3UA 3V9SA 5KT6A 4I2AA 4BXOA 1TGOA 1WSFA 4RW9A 3K58A 3SZ2A 4CHOA 1S1WA 4ED6A 1RYSA 3TAEA 1B9FA 4ED0A 5J2QA 3JPOA 3QEAZ 1NJZA 1EETA 5DK5A 9ICOA 3PW4A 1FXXA 1LWCA 4F3OA 5J0UA 3AVCA 1X9WA 3LP0A 3K5NA 4FK0A 1FKOA 4DOCA 2UVUA 3CM6A 2FBTA 4F5NA 2ZD1A 4M9HA 3OYEA 3TQ1A 5IIMA 3QEIA 4Q43A 1ZQCA 4O0JA 5FDLA 3NF6A 3TWHA 2BPGA 1TK5A 4FBUA 2FMQA 1S97A 3HM9A 4MEYA 2H5XA 4C8LA 2HMIA 4KHQA 4CJ5A 2F1IA 4E7HA 4K4IA 4OVLA 4I27A 4RU9A 4J9SA 2AU0A 1BQMA 2Y1IA 3ISBA 2F8SA 5CR0A 4CERA 1C7YA 2QK9A 4FJHA 2C28A 3C2KA 1IG9A 4KHWA 2PFOA 5BOMA 2FLNA 4MFCA 3CFRA 4F93B 2BCVA 4CF2A 4BDZA 2ISOA 4M6WB 5DLFA 5DQHA 4PWDA 1CZBA 3JYTA 3C95A 3ZSYA 5KT4A 3Q8MA 3U6FA 3HP6A 2M9NA 4F4YA 4YCXA 4BWJA 4CJ4A 1RXWA 3PMNA 4N56A 3NH0A 4I2IA 3MR3A 2ASLA 2ITGA 4DF4A 1RTIA 5DDYA 1GOCA 4EYHB 4M9JA 3PO4A 5CYQA 4KLEA 4F8RA 1VSEA 4CHZA 1LW2A 3AVLA 3ZT0A 4QWBA 2AGPA 1K6YA 4ECUA 4ECTA 5HP4A 4ID1A 3AU2A 5J1EA 1T3NA 1S9FA 1RT4A 3V6DA 4J9OA 4F4WA 2D0BA 4DG1A 1ASUA 1BPDA 5D4BA 4I2EA 4FJKA 1UWBA 1HUZA 2RF2A 5HHHA 3OGUA 3A2FA 3ZSOA 5KFTA 4ICLA 7ICHA 5HNKA 2C2EA 4E89A 3S3OA 1U9LA 7ICSA 4GC6A 3UQ0A 4RW6A 4N47A 1HQUA 1XHXA 1UT8A 1JLBA 4YFKA 2JGUA 1NKBA 4DFPA 3HPHA 2FBYA 4Q0BA 4B9LA 4IFYA 3HJFA 2B6AA 2I1QA 4G3IA 1NK6A 4ED8A 2PFPA 3GQCA 3VQ6A 4O55A 3QLHA 4ELTA 3DLGA 1ZQYA 2HB5A 3AVKA 4E0DA 3H08A 4M9NA 9ICXA 5KFDA 1NK0A 3B0YA 4O3OA 2KFZA 2Q0ZX 1ZQTA 3DRSA 1NK7A 2HHQA 1RDBA 2EX3A 1KFTA 1ZBHA 1ZQAA 3OYHA 2HNDA 3V7KA 4KHSA 3OSPA 4JWNA 2E6LA 4B8CA 2C2RA 1BPEA 1SKSA 3OHBA 1UAXA 1B22A 3O3FA 4H4MA 5FRNA 7ICMA 4R65A 3K5LA 4DSLA 1C0UA 5D3GA 3BDPA 2KZMA 1HPZA 3GDXA 3IS9A 3NH1A 7ICRA 3N97B 4M41A 5T7BA 1RZTA 3LAMA 4QWDA 1S1UA 2Z1GA 1X2IA 4TUSA 3KKSA 4Z4CA 8ICKA 3QEXA 4UAZA 1HNIA 1HMVA 5KFBA 3S3NA 4B9TA 4DTPA 1NKCA 3DMJA 8ICUA 2XHBA 3HVTA 1VRTA 1YT3A 4EZ9A 4PHAA 1W9HA 4EBDA 1B92A 2UVWA 4DQSA 2UVRA 1QSSA 1J9AA 7ICTA 5HLFA 4TUPA 4B9MA 3E01A 4YD1A 4O5CA 3AVMA 1UA1A 4OLAA 3C5FA 4DFMA 1VSDA 4O9MA 2JEIA 4KHYA 4ZHRA 4BE2A 8ICSA 3ZSWA 2P6UA 3OYCA 4J9QA 4DL3A 8ICBA 1RT6A 1HJRA 4CIGA 4FJ7A 1JL1A 4LSNA 3EPIA 1CXQA 8ICGA 4KAZA 2HNZA 3KLEA 3NGZA 7ICIA 3OYAA 8ICRA 4CJFA 4QWAA 3JPPA 4PHEA 1IKVA 2GV9A 5J2CA 1S0OA 2ZQBA 4DTSA 4DTXA 5KFGA 4DWIA 1X9MA 1MQ3A 2JZBA 1KVBA 4KB0A 2JEJA 4HTUA 4M3WA 3GV5B 3OJSA 3VA0A 2BPFA 1VSKA 3QERA 1RTDA 4F2RA 2MUTA 5DMRA 3H40A 4FVMA 4ECRA 4JS5A 3JPTA 3MBYA 4P2HA 2D5RA 1BCMA 1RT1A 5C5JA 4DSEA 2ZUBA 4I2JA 3ZSZA 1U49A 2ZTCA 4DL5A 4FLWA 5D46A 3KLHA 4J2AA 2FLLA 5L9XA 1KVCA 7ICPA 1RTJA 1JLCA 5HRRA 2BPCA 3F9KA 4CFAA 4RPXA 4GXJA 3ISNC 4IFVA 4PUOA 4Q45A 2ALZA 4QOZB 5J2MA 4M45A 3ZSRA 2HVIA 1WNSA 5J29A 2O4GA 5KG7A 5EWEA 4MFAA 1IO2A 2OPQA 2DFEA 3HPOA 4JRQA 4FO6A 1KSPA 3GIKA 4FJGA 3ZD8A 4HUGA 3QIOA 5KT3A 4NLKA 4FW2A 1RNHA 3Q8KA 2XCAA 3SI8A 3SYZA 3PW5A 4KLLA 3KKRA 1NK8A 2G8FA 2YKMA 4DTUA 3L3UA 3KHLA 1DOQA 1BQNA 4IG3A 5J0PA 4FJ5A 4CE9A 4M42A 3RB6A 4TURA 5SZTA 4RT2A 3H4DA 4GW6A 5HRPA 2WOMA 9ICVA 2HVHA 3LP2A 2W8LA 1S6QA 2A1JA 3Q8PB 3WNFA 3AO3A 2DPIA 5KFLA 3KHGA 3PW7A 4DSJA 3OSNA 4IBNA 4FLXA 3RTVA 1NK5A 3RH4A 4UB4A 4QZFA 3AO2A 4J9RA 4JV1A 1IKWA 9ICFA 1IH7A 4FM0A 4CGJA 4CJRA 3ZDBA 5IINA 3TAMA 3DLHA 4Q8FA 4HCBA 4F2SA 2BHNA 1S76D 4IRDA 2XY7A 4UBCA 4CEQA 4FZZA 3C23A 5J2DA 4C8NA 1JMSA 2XC9A 1CLQA 5EOZA 3DOLA 4YXMA 4O44A 1FK9A 2B4JA 4M3TA 4PHDA 3U3GA 4JS4A 3VA3A 4RT3A 1QS4A 4ECWA 3OYJA 3PR5B 5EWFA 5KFCA 4NM1A 5DB9A 2JLEA 1XO1A 1JLQA 3QZ8A 3TAPA 3AVAA 3RMCA 2PYLA 5DLGA 3AVFA 1WSIA 3BGRA 3V4IA 3QEWA 4HUFA 3ZSQA 4Y1DA 3NH2A 4NCAA 1XHZA 3BQ1A 3MXIA 2XRIA 3DI6A 3SUOA 2R8HA 3RWUA 4CEDA 4LVSA 4CHNA 4CF1A 4XUSA 3DRPA 3PNCA 4LY7A 1MSWD 1KRPA 1ZQPA 9ICJA 1I3AA 1QQCA 3MDCA 4FJLA 4K8ZA 4YR0A 3LDSA 3TANA 4B8AB 1KEJA 1RXVA 5CB1A 3SQ2A 1UA0A 4KLTA 1ZQQA 4M0AA 4PA1A 2PI5A 4IRCA 4PPXA 3K4GA 2W8KA 4CF0A 3VQQA 2I5JA 4B9VA 3UIQA 4FJIA 1HYZA 4FJXA 4NY8A 1DTQA 4JV2A 3BQ0A 1RTHA 4QWEA 4AHUA 1XC9A 1RT3A 3OYKA 1SL2A 4NM2A 2RDJA 4PH5A 1YVUA 9ICAA 1HRHA 1TKTA 1Y97A 5L1IA 3M8RA 1Z00B 4QZCA 2BQRA 2F1HA 1B43A 1TVAA 1VK0A 2ZTEA 4DQRA 1RBTA 2KTQA 1ZQXA 3T5HA 3OYGA 2IHMA 4I9QA 1SUQA 3HPGA 3OYMA 1ZQIA 3QZ7A 1NKEA 1ZQHA 1C0TA 5J2EA 4ECYA 1RBRA 1C6VA 2IMWP 2AGOA 1ZQSA 3PR4A 4M3XA 3FDSA 3AVNA 3B0XA 9ICSA 4RQ1A 4I29A 1ZQGA 2YKNA 1ZQJA 1T4GA 4Z4HA 4F92B 2W9BB 4YR3A 1N6QA 4QWCA 4H4OA 2BDPA 3VQPA 4I2CA 4YN4A 3C6UA 4IQVA 1N5YA 1U4BA 5I42A 3QNNA 8ICWA 4J9NA 2ZJ8A 2OZSA 4CESA 3KK3A 2QKBA 5K14A 2ASJA 4RUAA 5CHGA 3L2RA 8ICOA 2BGWA 4M6WA 2HNYA 2VG7A 2HHSA 3DLBA 4R8UB 4FCYA 3RBDA 1REVA 5DB7A 5CZ2A 2GWSA 4KLGA 2G8WA 4Z4GA 1BIUA 1NJWA 4CGFA 1WAFA 2P6RA 1WCNA 4MFBA 3QEPA 2ATQA 3BQ2A 4CJSA 4P4PA 4P4OA 4FJMA 9ICRA 3L2QA 4Y1CA 2OPSA 3DLEA 1JXLA 1U04A 1MU2A 2OPPA 2RN2A 4FS1A 4IQUA 3CYMA 2ASDA 1CZ9A 1IM4A 3BJYA 4HUEA 3UQ2A 2G8IA 4I28A 4F4KA 8ICZA 2NRXA 4Z4EA 2R8GA 2Y1JA 5DG9A 5J2JA 4Q5VA 5KFZA 4LSLA 4CFBA 3G0ZA 5KFIA 1YTAA 5DBBA 3E2EA 1SZPA 2C2DA 1G15A 4EYIB 1DTTA 4QZ9A 2DFLA 1RDAA 4YG2A 1EP4A 4I2HA 4AHVA 2ZUCA 1ASVA 1U47A 4I2FA 5KGXA 4DU4A 1NOZA 1GOAA 1O1WA 3P1GA 4J9PA 2HHTA 3ZT4A 4W5TA 1NOYA 1HYSA 4CEEA 3GV8B 7ICJA 4GXIA 1BPZA 1RCHA 5KFYA 4BACA 4PHPA 4O3SA 4RW7A 4NCBA 5KG1A 3T5JA 2ZJ5A 2BCSA 3PY8A 1N56A 3HT3A 4KLIA 4FM2A 5KFJA 4O5EA 2KN7A 1A76A 2FMSA 1LWFA 3RRHA 1ITGA 2G8HA 3HYFA 2YNFA 4LZGA 4CIEA 9ICTA 1QHTA 9ICPA 7ICGA 3LP1A 3T3FA 3DOKA 1D8LA 4DFJA 9ICEA 5EWGA 3ZSXA 4N76A 4C8KA 4FS2A 3KIOA 3HVRA 4EP4A 3ALYA 4I2DA 2QKKA 1KLMA 3HO1A 3RR7A 1HYVA 1ZQWA 4QW8A 2BQUA 4PGQA 5J0SA 2YHAA 3JPRA 9ICHA 4NLNA 3MDAA 1JN3A 3KLGA 2NRWA 5J2BA 1TV6A 5DBCA 3AV9A 2ETJA 4H8KA 4F3TA 3F73A 9ICQA 4XQ8A 2HHWA 3DLKA 4DU1A 4KLJA 3PW2A 1IXRA 3HWTA 5CY4A 4CEAA 4YQWA 4MF2A 1B9DA 3CFOA 4YMMA 3VQEA 1KDHA 4CHQA 4ECVA 4RNNA 1ZQEA 1ZQFA 5CYMA 1S77D 1H38A 4BDPA 2X6SA 1BHLA 4OGEA 5KFWA 2FLPA 1VSIA 5KFSA 2R8IA 1RBVA 5E41A 4Z6CA 3L2WA 5KFVA 2XY6A 4MEXA 3K59A 1PZNA 4MQ3A 2DFFA 3V9ZA 5CJ7A 4O5BA 1RT2A 4UBBA 5DB6A 4BGDA 4X5VA 1WN7A 1C1CA 1QSLA 3K57A 1TAUA 1ZQUA 4RPYA 4AHSA 2G8VA 8ICTA 4KN7A 3M9NB 1WLJA 1WSEA 5EU7A 3L2VA 4CJVA 4QW9A 1TL1A 3GIMA 1TK8A 2IHNA 5KFRA 4CGGA 4B9SA 3GFKB 2XCPA 3GV7B 4IR1A 2IS3A 3NGYA 3DM2A 1ZQOA 3NF7A 3RB4A 4KV8A 4BE0A 1BI4B 5I3UA 2FPLA 1KFSA 1ZQBA 1TKXA 3OS2A 3NCIA 3S9HA 4WE1A 4AILC 3ZT2A 1ZQNA 1JLEA 3OYDA 2F96A 4L8RB 8ICQA 4DL6A 2FC0A 5F9NA 2D0AA 4O4GA 5KFFA 3AA5X 3VQ4A 2BR0A 4CFCA 3V9XA 4JWMA 1TKDA 1CXUA 1NOMA 1KVAA 4CJUA 3PUFA 3TAFA 4KREA 5KFHA 4MF8A 3VQ9A 1T03A 4QZ8A 4J2DA 1A77A 4UAYA 3V1RA 3IRXA 5TZVA 3SV3A 3HP9A 4KHNA 4CGIA 4GLXA 4GC7A 3CG7A 3I0SA 5J0YA 4YMOA 4Q44A 4KRFA 4N41A 3MECA 7ICQA 3ZCMA 4FJ9A 3AU6A 4E7IA 3ULDA 5IIJA 4KLUA 8ICJA 2HHVA 5FROA 4AHTA 2VANA 1Q8IA 1VSHA 5J2HA 2DPJA 4CHPA 4JRPA 3CM5A 1J5OA 1XSLA 1X9SA 4RQ6A 2NRVA 3PX6A 3RMDA 1TL3A 3MEEA 4Z4FA 4KLHA 2X6NA 8ICLA 3KD5E 4B08A 1S1TA 5KG4A 1XSPA 4KKOA 3V9WA 3BQTA 4F4XA 5J0OA 4Z6DA 4EEYA 3P5JA 2IGIA 3MEDA 3ZDDA 3AA2A 2AQ4A 1JL2A 7ICOA 2VG5A 2VWKA 2P5GA 8ICXA 4F50A 3K2PA 4DTOA 5KRSA 1BCOA 4DLGA 1SL1A 2BCQA 1BPXA 3OHAA 4YP3A 2VG6A 5HP1A 1Z3EB 4M3YA 2I9GA 4KTZA 9ICWA 5HBMA 3RAQA 3O4QA 2AGQA 3SNNA 4UB3A 4RW4A 2AQ0A 3VQCA 3C21A 3KJVA 2X74A 1ZQRA 1COOA 3V6KA 2LYHA 3O3GA 4RQ2A 2V4RA 3CQ8A 4FBTA 9ICUA 4FXDA 2MAXA 4BE1A 3RJFA 4OPKA 5KFAA 3JSMA 2W42A 2DY4A 3C1ZA 4NYFA 5KG3A 4J9LA 2XY8A 3T5LA 2RDIA 2FMPA 3T19A 5CP2A 4XIUA 5DGAA 3THVA 4CEOA 3EZ5A 4R64A 3PX4A 4DL2A 3QO9A 5DQGA 2W9CB 1WSJA 1ZYQA 5IILA 3ORYA 3MR2A 1Y88A 3IHQB 4DQPA 3NF8A 4OJRA 4IRKA 1S9GA 4DSFA 3RJHA 4FK2A 1WCLA 3Q8QB 5HROA 9ICMA 4KI4A 3KHHA 5KFQA 2F1JA 4YD2A 3I8DA 4BWMA 4FJ8A 4R66A 3WNEA 8ICVA 3NAEA 3D0PA 1TKZA 4DS5A 4NYNA 2IDOA 4IQTA 4EBEA 4KO0A 1S0VA 3C94A 4I2PA 4NLGA 2VA8A 7ICUA 3OYIA 3LWLA 4W5NA 4UB1A 4PQUA 2W9MA 3HXMA 2PFNA 2ZUDA 5HRSA 1UT5A 4M3RA 5CA7A 3UXNA 4FLTA 4E19A 3SV4A 3C1YA 2WTFA 2AJQA 1HQEA 4DOAA 3G6VA 3H4BA 1D9DA 5JS2A 3VN5A 5J2PA 2A1SA 3MAQA 4QCLA 1S0NA 3LZIA 3AVJA 1Z00A 1RBUA 5KTQA 3NGDA 3V9UA 4PGYA 3M8PA 2XO7A 1L3VA 8ICEA 4QZBA 1ASWA 5KG5A 1D5AA 4KLFA 4CK1A 3AO4A 4FYDA 4CIFA 4OLBA 2OWOA 4YXJA 3MXMA 2BCUA 2J6TA 3MFHA 1LV5A 3C6TA 4QZAA 4E1NA 4HCCA 3EY1A 4DTMA 4RQ0A 2KZ3A 1CUKA 3M9OB 1LB2B 5CWRA 4RQ8A 3GIJA 1IKXA 2P1JA 4IDKA 2OZMA 4FLVA 4DTNA 1TV9A 1RPLA 4UB2A 4AHCA 3VQ5A 2O4IA 3H8SA 3HW8A 8ICNA 3QINA 2W9BA 4OKEA 3OYBA 3V7LA 1S9EA 2BCRA 4B9NA 4M9GA 2P51A 3SI6A 3MFIA 5SWMA 3TI0A 4I2QA 3TABA 3U3YA 1JIHA 3LP3A 3NTUA 3WNHA 4K8XA 5KG2A 4DF8A 1VRUA 3PMLA 4LD0A 5KFNA 3N4MB 3PVXA 4M9LA 3L2UA 4IQWA 1BPBA 4R8UA 3HK2A 3H8JA 3NF9A 1R0AA 1A5XA 3KLIA 4QZIA 8ICMA 2KFNA 3LDAA 1K1QA 1TAQA 1DGSA 5J2GA 1XI1A 2YNGA 1ZQDA 3ZDCA 3M8QA 5DGBA 1ZBFA 2VWJA 4CGHA 3EW9A 4HVJA 5KFKA 4FM1A 1RT5A 1D8YA 4R5PA 4P4MA 3V7JA 4DFKA 1RYRA 3O4NA 3OY9A 3OYLA 1JXBA 1S5JA 3QETA 3RAXA 1QSYA 2XGQA 3KK1A 4E7LA 4TQRA 3LZJA 2FPMA 2E6MA 4BDYA 4RG8A 4FLUA 1C0MA 5IIIA 4DL7A 4BXOB 5DG8A 2JEFA 4UQGA 8ICAA 4O0IA 4DOBA 3ZDEA 4ZH4A 4QZGA 3MGIA 3HSTB 3AVHA 4RNOA 4C8MA 2Z1IA 4I2GA 4CEZA 1S0MA 4RZRA 1ZETA 4AH9A 4Z0UA 2V9WA 5DG7A 4CJEA 4GMJB 1U45A 1HUOA 4Q8EA 3SUPA 1Q9YA 3DLRA 2YNHA 4PGXA 4K4GA 2NUBA 4GVMA 2ATLA 2P66A 2B5JA 4F4ZA 1LAVA 3RMAA 3QEBZ 1ZBIA 3KHRA 5HMMA 1XS9D 4KHUA 4DQIA 3C5GA 2NRTA 3TAQA 8ICYA 1BPYA 3ITHA 4ED7A 1LW0A 1L3TA 1T8EA 4UB5A 3OYNA 5DKWA 2R8JA 1S1XA 4B9UA 3C2MA 1JLAA 4DS4A 2HW3A 4KITB 3AVGA 1ZQZA 4CEBA 5DQIA 3SUQA 4FZYA 2PZSA 1J54A 1XWLA 3V81A 4F5PA 5KI6A 4KFBA 4Z6EA 4EBCA 3SQ1A 2B21A 4NLZA 1C1AA 3AA4A 3FFIA 3G6XA 3P83D 4M3UA 3DRRA 3IG1A 2Z1JA 4FW1A 3OYFA 4ED2A 3NBPA 3VQAA 2YV0X 2EHGA 1GOBA 4TQSA
chains in the Genus database with same CATH superfamily
2W25A 2K60A 3P96A 3D2QA 3FCWA 4O3PA 2XMTA 3ZLJA 2CNOB 2Y9UA 2W03A 3TSUA 2KN4A 1NGDA 4KH4A 4LREA 4WFAL 4NXMK 1NHUA 4CO3A 3OS1A 1LW2B 4NLBA 3CIMA 3Q2TC 4NI2A 2XO6A 3OTCA 4P0PA 4YR2A 1W26A 5I3PA 1IBLF 1EARA 4P6QA 3CFPA 2YX6A 4FO0A 4KLDA 3K5MA 3NNAA 3SUNA 1RT4B 4RWWA 2A3VA 3V6DB 3CCMN 4KB1A 2CIMA 1XNRK 2UUCK 3BH7B 2O8DA 4DG1B 4C11B 2QA4N 2VDHA 2FI1A 2V7ZA 3KTQA 3C7NA 4MK8A 1Q9XA 2ZIUB 3FM9A 1XNQF 2HOIA 3GOIA 2OPRA 3D2EB 2NO4A 1WC5A 4XH5A 4UUXA 2V8PA 2Q3PA 4DTRA 2X3GA 4DUZJ 4L3QA 4U7BA 3MPUB 3J7A1 4CF9A 1GTHA 1WDTA 5F0UA 4FLZA 3NFAA 5ETTA 3AVIA 2E4LA 2E5LJ 4DZ6A 1N48A 4HEA9 2WF5A 4HACB 3DLGB 3AY9A 5J2KA 4RPZA 3L7UA 5J0RA 3BBBA 4LFBF 1N32K 1V9PA 3N9UC 2NQPA 3CUNA 1VI7A 1HI8A 3W8GA 4W5QA 4BRNA 1KN6A 4R63A 1NM2A 2Z2LA 3GR0A 3VQ8A 3A1YG 5BR8J 4PYDA 3AA3A 5KT5A 5AZIB 5B08A 3ATVA 3AQFA 2NS1B 1UOCA 1F0XA 5D77A 4JI3J 2W4DA 3BGOP 5D3GB 3A4TA 2HHXA 3CPEA 4DEZA 5AQQA 3IS9B 5B8HA 2L5YA 5J2AA 2MKCA 2BZ2A 3CD7A 3A13A 2R18A 3M6KA 4LH5A 1CJVB 4ELUA 4NL9A 3N79A 2BM0A 4K2XA 3POTB 1RKIA 3CD6N 1XR7A 4RQ7A 3AAQA 3UPQA 2ZJAA 2JJ4D 3FGUA 3I56N 2R7YA 4ZVPB 4DLEA 1RSCA 1GEHA 3ZDAA 1VK8A 1RDDA 1Y64A 3TA2A 5AKLA 3FEYB 1Z05A 1ATRA 1YTUA 1RTZA 4QZHA 3MUTP 1HD0A 1XU4A 2COLA 2F7VA 3ZC4A 3PFOA 4ZHRB 1OXJA 3R6GB 4FL9A 1IR0A 3QSYB 1S12A 1PGZA 1ZQLA 3FSIA 3QBCA 4J9MA 4M5KA 1Y11A 4WP8A 3WIUA 3HKWA 3RH6A 3H5YA 3BP8A 2Z1HA 1GX5A 4DV3J 4GXKA 1KCFA 5B09A 1KVJA 3IAYA 2PKEA 2AP1A 1KKHA 2BGGA 2G2ZA 4IO1A 5HN0A 3MM7B 2F8MA 2ZGYA 4I2BA 3FCHA 5HI7A 3ZNJ1 3V1QA 3H3NO 1KC8O 1F5CA 5K8NA 3G6YA 4ZTJA 4EP5A 3HD1A 1J53A 3AO1A 4QIVA 3DLLQ 1OPZA 3H0LB 4W4MA 2DGUA 2R2RA 1HKBA 3RU0A 4MK9A 3FEZA 5HMWA 3RH5A 4UUWA 2FJAB 2OA8A 4OZ0A 4G9BA 4WYLA 2FSKA 1VK3A 1RT1B 4DQQA 4ZA1A 4NA1A 2HRUA 1CSJA 2Z7JA 2WK4A 1LOTB 3EPGA 1RTJB 2IVOA 2UXBF 2C3OA 3P3DA 4GO7X 4UAWA 2CN1A 3LAKA 3W3DA 3V1OA 3VVTA 1JKHA 2CAJA 4Y3CA 1CJKA 4PUOB 1SQFA 2DYAA 4M5DA 4RWTA 3MM5B 1HJPA 3CCSS 4I56A 5K8MA 1UWAA 3SQ0A 4DHVA 2OMOA 2DGQA 4CGDA 4KLQA 2KOBA 3T6BA 3NS1A 4CFDA 4P72A 4RNMA 3SCIE 4EWTA 4HHTA 5CZXA 8ICCA 4NL5A 3KVGA 9ICGA 1NGJA 4ECSA 3M3ZA 2NUHA 5LOQA 7ICVA 3PZPA 2E5GA 1HWUA 1O51A 4IG3B 4DR2J 1RAEB 2UUAJ 3EGVA 3QFWA 4Z6FA 2C3YA 1CEZA 4JI2K 3MOZA 3LP2B 4K4XA 4CHYA 5ETRA 3RR8A 4DPTA 3HM8A 2MDAA 2DIVA 3PYEA 2E1EA 4QYRA 4DN9A 3HX9A 3CDEA 2B4OA 3PIPL 1SC4B 1U8SA 4EHUA 3FK4A 2HHHJ 3O9SA 3KLVA 1T9TA 4IOXA 3SPYA 2X78A 2UUBJ 1Q18A 3TAMB 4Y6IA 2B6GA 1UTAA 4MAKA 5KFPA 3M30B 4A48A 1XMBA 2E29A 3HFVA 3R1XA 1FDAA 3CETA 3Q24A 2HFSA 2VWBA 1VQSA 5D4LA 3KZBA 2ISPA 4X4VA 2J9DE 3O8MA 2ALYB 3OFFA 3VGTA 9ICBA 5JS1A 3MABA 1S7IA 1VFJA 2BQ3A 1JJCB 4V19J 4US9A 1JLQB 1U6ZA 1RDFA 4J8FA 2A5XA 7ICEA 3BB5A 4P2XA 4OKJA 4CO5A 3N6LA 2MZSA 3V4IB 3TEHB 3BQ7A 2R7TA 2GVDA 3Q8YA 4L72B 3M5RA 1TR0A 2QA4G 2BANA 3O3HA 1SAZA 2VJ5A 3Q8RB 4CLYA 2DGXA 5A2QO 1ZBLA 2E2OA 3IC1A 5L1KA 3NRBA 5L1MA 4R25A 2W1BA 3WK7A 2AYBA 4ZPCA 3MEGA 2LEPA 3SDEB 4KSEB 2VODA 5F8MA 1YJNS 3AUOA 2G2YA 3HF5A 4NLUA 4QR0A 5J0WA 1O0PA 2EFNA 1PBUA 4J9KA 3TO8A 3WKEA 4F91B 4B3OA 3ZSVA 2J6SA 3GSDA 3ID6A 1L3UA 4DV5J 4UOCA 4I2AA 3EZUA 2LMRA 3BBCA 2XZWA 2YHXA 3WEEB 3E58A 1NUEA 2VPXB 2CPDA 4LQ9A 2XICA 4JNEA 3TAEA 1I51B 1NZBA 1S6UA 9ICOA 3VF4A 1SI9A 3PW4A 2WSEC 5J0UA 3AVCA 1JQGA 1HNXF 4U7UD 2VASA 3QATA 3LP0A 3DDIA 3K5NA 2UVUA 4I6WA 5CZVA 2FBTA 3QGIA 2ZD1A 4M9HA 2ZH3A 4Q43A 2BPGA 1TK5A 3HM9A 5EE1A 4CJ5A 4RX6A 5KAKA 4B3MF 2F1IA 1GH8A 2DGZA 4RU9A 2ZBCA 3W5ZA 1N6QB 5H1SQ 2F8SA 4CERA 5CD4A 4OHWA 3C2KA 3WKDA 4UAVA 1IG9A 1IM6A 4KHWA 1QH9A 2YKQA 2L41A 2QLJB 3CFRA 2YN4A 1K8AT 2BCVA 5ALDA 1R6VA 2G1HA 4CF2A 4IL6U 2HS3A 5B0DA 4X66J 4ZPDA 2G1DA 2ISOA 4M6WB 5DLFA 2W54A 1SQEA 3I55N 2VD3A 2DJWA 4K4ZA 1CZBA 3C95A 5D0EA 5KT4A 4FF2A 1DT9A 1E3MA 2M9NA 1VQ4S 4JKEA 4CJ4A 2ZDPA 3OBYA 3PMNA 4I2IA 3IAS9 5B5EU 3VTIA 5DDYA 1HI0P 1GOCA 1OYDA 4K59A 2NZCA 5ALJA 5CYQA 5HR6A 3AVLA 4FNIA 1GXTA 4QWBA 3O8WA 4BC7A 4CLKA 2OPPB 5BPNA 3OVAA 5AK6A 2AJFE 3NVZA 1GQEA 3GP9A 3WZ0A 4ID1A 2H4WB 3E9PA 4DR7J 5J8YC 3BZQA 2ZVIA 4H0YB 2E9TA 3FC4A 2BJDA 2X1AA 3MCAB 4F4WA 2D0BA 1XBWA 4AP9A 5GAEU 1UWBA 1HUZA 3R5CA 3RW6A 1L7NA 1FERA 1J97A 5KFTA 4ICLA 3VAMA 1FA0A 2WCXA 3E9LA 2H3VA 2G0AA 2NNWA 2FIUA 4E89A 3S3OA 1U9LA 7ICSA 3ZX0A 3R1HA 1XHXA 1JLBA 3W5XA 2RRNA 1N5XA 2YWKA 2Q79A 2HWIA 1RK8A 4IFYA 4HHHA 4WFZA 1N33F 1JROA 2PFDA 4GVLA 1ZAXA 2B6AA 3KG0A 4G3IA 3U1MA 2PFPA 4RW7B 2ITMA 2IRXA 1U0HB 4O55A 3QLHA 5CAAA 2C2KB 1VBKA 3GZ7A 4M9NA 5KFDA 1FIQA 3FZLA 2QWRA 2DHXA 1ZQTA 3DRSA 3FC9A 2HHQA 3EDQB 1KFTA 3OYHA 2HNDA 3V7KA 2KI2A 2BH1A 3OSPA 4IH7A 1UFLA 1N61A 4NLTA 4HR2A 2A41A 2C2RA 1SKSA 2KVQE 3LP1B 7ICMA 4HH0A 5ALPA 4HAIA 1K9MT 2F4FA 1KLMB 3GDXA 3DU5A 3KD3A 3D9BA 1SIZA 4QWDA 5AR0A 3CXCM 3F41A 4Z4CA 3QEXA 4UAZA 1HMVA 4DTPA 1NKCA 3DMJA 1XUPO 2Z8QA 2RU3A 3HVTA 4ZVEA 2YQEA 5KPRA 1MN7A 3DLKB 3AOCA 3WKCA 2A10A 4EZ9A 4PHAA 1U2VB 4EBDA 4C4RA 1RHJB 4IQMA 2QWNA 2CRXA 1VISA 1LKYA 4JI0K 4JI1K 2YMQA 2BACA 3MN9A 7ICTA 4X64J 4WK3A 1NSAA 2WHOA 4OX9J 3B6BA 1Q8KA 2A19A 3OR1B 1K5OA 2IOHA 1RABB 5IT0A 2FVCA 4FPRA 3OUYB 5JXSA 4WYWA 2MTLA 3PRVA 2PSZA 1VGYA 2P6UA 5BREA 4J9QA 4DL3A 8ICBA 1RT2B 3F0NA 1HJRA 2Z2MA 3CCJS 4CIGA 4WCEQ 1IN0A 5F41A 5ALMA 1CXQA 3S8SA 2ZOFA 3K1RB 3KLEA 2BJ1A 2AA4A 5ETPA 1RGVA 2BV3A 1IKVA 3UN5A 2MSNA 1H2UX 2ZQBA 1X9MA 3PLAA 5ETKA 2JZBA 4KV8B 1KVBA 1P90A 3RSEA 4KB0A 3ULHA 5I3UB 4FPBA 2E1RA 3SSQA 1TKXB 1IUJA 2WC9A 1M5VC 4WE1B 2IIHA 1QVFR 3EUB2 4ZJOA 4E1JA 2F4VK 4JI5K 4KT0C 4WF9Q 2MUTA 5KPZA 3R3LA 3EZOA 2UUWA 3JPTA 2JDJA 2XMMA 1RZMA 3HD2A 5ADZA 5AM1A 4BC4A 4P2HA 2CQGA 3AH6A 2QB0B 2D5RA 4M5GA 5BPMA 3LVWA 5C5JA 3CCEN 1U49A 2ZTCA 4DL5A 5D46A 4KIAA 3O9TA 3O9UA 1UEUA 1N36K 1UVMA 2GOLA 3I0SB 1YRTA 5L8RC 3A8IA 2I6WA 1V38A 3PFEA 1A9NB 2BPCA 3HJEA 3MCNA 1YRUA 2L08A 4CFAA 4RPXA 5BJRA 2VQFJ 1J2NA 2LVWA 4B1WB 2VBZA 4Q45A 4J91A 3M6WA 4QOZB 1OH5A 5J2MA 2PIIA 3CJ1A 4M45A 2HVIA 5J29A 3DXBA 2O4GA 5EWEA 5LMNK 3HPOA 3GZFA 5FD1A 2QTDA 3CGIA 2GMHA 3MEEB 4HUGA 5KT3A 4PWWA 3AM9A 4FW2A 4Z2XA 1HKCA 3SFUA 1RNHA 5GIPA 3TZXA 4NXMJ 3KKRA 2JFKA 4M63C 3FFKB 1NK8A 3NS7B 4IOCQ 3KHLA 3TVKA 1WC0A 1ZD2P 2QSFA 3ILJA 4MO5A 2ZDOA 3DCAA 4W92B 4M42A 2PMHA 1SIJA 1L7MA 5BRHA 2NXNA 3H4DA 4GW6A 5DJBA 2H9ZA 2WOMA 2Z57B 1XNRJ 1ATSA 2UUCJ 1T6DA 2AX0A 1X5PA 3VGUA 2HCFA 3IO1A 5HBMB 3DXSX 3MMBB 2K1RB 3RTVA 2XHWA 3CCVN 5ETMA 3D6TB 3AO2A 3KJVB 1IKWA 1JB0C 3RW7A 4FM0A 4CJRA 2P9UA 1RU1A 1D3WA 2K4PA 4Q8FA 1CULA 2CH5A 2CPXA 2EW9A 4PG4A 4NLSA 4FZZA 2FVPA 2CJXB 1YIJN 2FQQB 5CR4A 4C8NA 3KJNB 1FWLA 2XC9A 1AZSB 4J9UE 1FK9A 1I5OB 3P5BP 2AEMA 4XAKA 3VA3A 3HBTA 1N32J 2DT9A 1FD8A 4IXCA 5DB9A 1MWZA 2JLEA 5KAFU 4R0EA 3CF5Q 1XO1A 1IV8A 1DBDA 3AVAA 4I6AA 4NJ8A 2OFGX 5IC4B 5DLGA 3ILIA 1T9YA 2DGTA 4I6MA 4Y1DA 3NH2A 3BQ1A 3FBFA 2R8HA 2WSCC 3RWUA 2IM0A 4CEDA 2Q66A 1HKGA 2I38A 5HQMA 4HI2A 4U9RA 4Y2QA 5HOOA 3MDCA 3GU0A 3TANA 1TKZB 3BS7A 1PCAA 4I2PB 5CB1A 2IIRA 4JV5F 4Y2PA 1KHVA 3HOTA 5GMDA 4M0AA 4PA1A 1PAEX 4IRCA 2DEJA 1HR0F 2KP7A 3QU5A 5HVHA 4B9VA 2QE5A 3UIQA 3R7BB 3OXFA 4PXDA 3PIOQ 3BEXA 4CLUA 4TU7A 3J80Y 1ZBTA 4DCOB 1RTHA 1SL2A 4NM2A 2QIFA 5J2PB 4NRUA 9RUBA 3THXB 1HA1A 5K5MA 3EE8A 4QZCA 2BQRA 3DGVA 1B43A 3I31A 1VK0A 3UKUB 1B64A 3VETA 2KTQA 3R1LA 3MN5A 5LMUK 3M8PB 3NLCA 5GADP 1JK9B 1UAWA 1ZQIA 5E5NA 2JH3A 2YHWA 3M2VA 1ZQHA 2GMLA 1MN8A 1TUWA 1RBRA 3D2SA 5F3XB 1I94F 2R4FA 1MA7A 2GJFA 2HBQB 2J0WA 2AGOA 2HBMA 3PR4A 1FRLA 3JAMU 3FDSA 4ATNA 2HSZA 1ZQGA 5AK5A 1OWXA 1T4GA 5E26A 2EBGA 3NVKA 4NLRA 2WF9A 2A3ZA 4LRBA 3CCRN 4RNFA 1EB0A 4QIEA 1S9EB 4QWCA 5AKZA 2QV6A 2BDPA 2OHFA 1NHVA 2J8AA 3C6UA 2OHDA 3NNHA 3TTDA 2F1FA 1ZPWX 5HMYA 5AICA 3M6ZA 5K14A 4X65F 3WQPA 8ICOA 2HNYA 2VG7A 1RDWX 4R8UB 1Y0HA 2KL8A 3A5OC 3RBDA 2IVNA 3KK7A 1REVA 2KVSA 3A5NC 2AP6A 4KLGA 3L4QA 4H5TA 2YNGB 2QW9A 4CGFA 1WAFA 3M8QB 1GLBG 3VAFA 4MFBA 5C10A 3QEPA 2FJBB 5AQIA 2MJNA 1A7GE 2JRSA 5TKWA 4P4PA 2QLXA 2BZFA 3OLBA 2ZH6A 3F2BA 1RHUB 4GKJF 3UFCX 3CYMA 4IQUA 4FS1A 2CKWA 1IM4A 1VQLS 1XC3A 1SZHA 3L09A 2G8IA 4I28A 4NMXA 2NRXA 2KLAA 1CC8A 2W6KA 4FYXB 4HTJA 1O8BA 3RVCA 2DUYA 4JI8F 1YTAA 3E2EA 1IWGA 3X1LB 5IM0A 4JI2J 3O9QA 4ACOA 4ZPAA 4IJAA 1G15A 1BA0A 1DTTA 2VFSA 2CGLA 3Q7CA 4YG2A 5ETQA 3CC7S 4I2HA 4AHVA 1YVFA 4FSVA 1NOZA 3P1GA 3DJCA 4DV7F 3PRBA 4EUVA 1HYSA 2K8CB 3MN7A 2XBPA 4GXIA 1BPZA 4GRSA 3G8TA 2B5JB 5HQ8A 3KKAA 4ZCMA 4BACA 3UPFA 3G71N 3T5JA 2KHVA 3ITHB 4DZDA 2B51A 5DM7L 4ETXA 4XH4A 2FTRA 1EQYA 1XMQJ 2HRTA 1FFGB 2Y8WA 5EDWA 1ITGA 1ATNA 2AKWB 4UTGA 3T6JA 3V81B 2JWNA 1VC0A 2NRHA 3L9ZA 1WWUA 3SSSA 3T3FA 1X5TA 9ICEA 4FVCA 1RE1B 1BMQB 1HHSA 3WIVA 2X51A 4P7TA 3HVRA 4BRKA 3CCMS 4I2DA 3HO1A 3GG0A 2YHYA 3KFUF 4RR5A 1JJ2M 4KMOB 2DRAA 9ICHA 3FJ2A 4ZPWR 2JWLA 3R5DA 4NEZA 3KK2B 2F9JA 3U9DA 5J2BA 3FMBA 5E2QA 5A2QY 3QT6A 3MX5A 3PKMA 2HIQA 3AV9A 2CJBA 2MQMA 4BLGA 4L74A 3E9OA 5HANA 4QYZK 1GK8A 1RAGB 2K3IA 4XQ8A 1NBEB 2RH3A 1IXRA 4WFBQ 3BGLA 2V2ZA 2YMLA 1B9DA 3FZ2A 4P0QA 2PAVA 1KDHA 2FGOA 1ZS6A 4MTPA 1S77D 3AJDA 4BDPA 4Q7AA 3VEXA 4JK9A 1S6PB 4XDDA 5AQRA 3DXMA 3L2WA 5KFVA 7AT1B 3QNWB 2J76E 2IAJB 1H7WA 4CZIA 5ALYA 3S6EA 1RT7B 4BGDA 2OUGA 3LGNA 1ZQUA 4FF1A 2G8VA 3AMZA 4KN7A 3NVYA 2DVIA 5BRDA 3L2VA 4CJVA 4QW9A 4DV6K 3QT7A 1VBXA 2LP4A 1R8CA 4CGGA 3RJMB 4B9SA 3GFKB 2XCPA 2V8GA 3I0RB 3GV7B 1NGFA 2C2NA 3W9HA 4F3MA 2QX0A 3B82A 4DU7A 4IR1A 1ZQOA 1U2CA 2ZJPQ 4G1QB 3RB4A 3KUGA 1JLGB 2NYHA 3L4IA 4KY3A 2FPLA 3CD6S 2FD2A 1ZQBA 3NCIA 3QQCD 4CI6A 4KBIA 4AILC 5JICA 1JLEA 1WG8A 2U1AA 1FDNA 2DH7A 1C1BB 1WORA 4L8RB 4DL6A 2CQ4A 4O4GA 2D0AA 2ZM6F 1QE1B 2BR0A 4JWMA 1TKDA 1ZXOA 4PXEA 4NASA 5AJ3K 1FJGK 1KVAA 2GVZA 3PUFA 1LWEB 4CJUA 4KREA 2ZOGA 3IDHA 4J2DA 5F8JA 1BHNA 2IOFA 2MQPA 4X62F 5J0YA 2A2DA 4Q44A 2JZ5A 2OXOA 3OQ2A 1IBKK 3AU6A 5TISU 2OO4A 3H45C 4KLUA 4HI1A 4JKCA 1HI1A 3UKRA 1LFWA 4ED5A 2VANA 2GS8A 2A6MA 1VSHA 1SV5B 1U1RA 3DXKA 1S7HA 3EVWA 4DV0F 1XSLA 2E66A 1TL3A 3P45B 2QL5B 3JXOA 3G2XA 3KD5E 4B08A 3PG9A 1XSPA 4KKOA 1F6TA 1Y4ZB 4F4XA 4FN5A 4OYMA 2CPHA 4Z6DA 3MEDA 2HOQA 1XJWB 2V8VA 2DNQA 2AQ4A 2UXDF 5HAOA 1SB6A 2CPJA 2VG5A 3SCLE 2P5GA 5EVZA 8ICXA 3D7SB 3IP0A 4LFCK 1WUUA 4WTYA 5KRSA 1BPXA 4C7YA 2ABYA 3HVAA 2D6FC 1NEEA 1MWKA 2LA6A 2H5IB 1UW4A 1XEZA 3W62A 1C20A 2K4EA 4MK7A 2I9GA 2P8IA 3CSKA 3O4QA 4HL9A 2ZBQA 3A5MC 4OCZA 3QJPA 1RHMB 2D3DA 1T0TV 4PG7A 4RW4A 2AXTU 1HWIA 1K47A 2KFYA 2ATCB 3EL2A 3C21A 1RQ0A 2L9NA 1F44A 1SJRA 1WF1A 2X74A 1COOA 2RQMA 2LYHA 4RQ2A 3NL0A 1R6YA 6FD1A 4HT7A 2AZ1A 1ULRA 2W42A 2DY4A 2FC8A 4J9LA 1VLYA 2O5DA 3T5LA 2RDIA 1Y10A 3VGVA 5CP2A 4KH1B 3DEEA 5DGAA 2I0XA 3THVA 1UMJA 4JBCA 3EZ5A 2GMJA 4DL2A 2F8KA 2HGNA 3ISZA 2KNJA 1WSJA 3IWNC 3MTKA 5JVHQ 1Y88A 1NU0A 2D1KA 4OJRA 3AT1B 5B0AA 4IRKA 3I87A 5GAEP 1F5SA 3HHLD 4WPAA 3MWPA 5JTIA 4FK2A 3M8ZA 2I8EA 9ICMA 1AA1B 3I9V9 5HSPA 4LMZA 5K4LA 4IDHA 2RKIB 2ES6A 3CJ4A 4R66A 3KWIA 4A8OA 2ZKTA 4JHDB 4KO0A 1Y7PA 3HRGA 4M8LA 2NXJA 5AM3A 1YQHA 1DZ5A 3LWLA 3EE3A 5G0RB 2QC3A 1BWEA 5B0BA 3HXMA 2QKQA 4JI0J 1NO8A 1RHQB 4JI1J 1QAYA 5AM4A 2VFTA 2YNIB 1NSPA 4ILHA 4FLTA 3KHYA 2RHKA 1B0PA 1DK3A 3C1YA 2KJ9A 4DOAA 3G6VA 3HLUA 3H4BA 1D9DA 1NZ8A 4PWUA 3MEKA 2NREA 2A1SA 4BR7A 1S0NA 2C2MB 3AVJA 1XNSA 2FGCA 1T95A 2XB2D 3NGDA 4PGYA 2LXUA 3KDOA 3QIPB 4QIGA 5AI5A 2CNNB 4XEIA 1WF0A 3K1ZA 4QZBA 3BF1A 2DR6A 4JI6F 1D5AA 1QD1A 3AO4A 1S1VB 4OLBA 3CJKB 5M1FA 5F3ZA 2BCUA 2W2NP 4OJ5A 3ZZYA 4UW9A 1RJJA 5FPMA 4RQ0A 1RGIA 4UY8T 3SAGA 2QMWA 3AODA 3M9OB 2I7PA 2CPZA 1HNVB 3GIJA 4IDKA 4FLVA 1TV9A 3W9IA 2F3NA 5KQ8A 2E8OA 2O4IA 3QINA 8ICNA 4OKEA 3U26A 4B9NA 2F4VJ 1VHFA 3QX7A 2GQQA 3SJHA 3H5UA 2G07A 3TI0A 1OVYA 3TABA 1GMUA 4ZJLA 2CPEA 2CQ2A 3AFGA 4LIWA 3N0VA 3Q23A 4LD0A 4FYYB 5KFNA 1AUSL 3N4MB 1N36J 1M1KT 5ITHA 1OH6A 4IQWA 1BPBA 3HK2A 2VBXA 3H8JA 1VQ5N 2B4VA 3WK6A 1BA1A 3UN3A 4BRCA 4ID5B 3C6HA 3LDAA 1K1QA 2FJDB 3C6AA 4WQ5C 1RA6A 5J2GA 2JR5A 5G4DA 2CQDA 5DGBA 2NXEA 2VWJA 2VFUA 4CGHA 2QFJA 4FM1A 1RT5A 1RG6A 3KLFB 1DLOB 2FJEB 4ZLPA 5LMNJ 2SXLA 4LFAF 1RYRA 3OYLA 2LFVA 2YPZA 2HI0A 1FFVA 1JXBA 2O01C 3LPEA 3RAXA 2XGQA 4QIFA 1HW8A 4P74A 1T9UA 4L3NA 4E7LA 2L9DA 4Y2TA 4ZP9A 4RBVA 4B3SF 4IOBA 2GJIA 2XMAA 4QBUA 3ZDEA 1EKRA 3HHDA 1HL6A 4LIRA 1QHAA 3J8AA 4RNOA 1HNZK 2M8HA 1X9XA 4QU7A 2V2QA 4RZRA 2VOPA 4GMJB 1Q46A 3D2FA 1HUOA 1U8WA 3I55S 4YOUA 2BOAA 3DLRA 5M1OA 2NUBA 3L3FX 1QM9A 2RE2A 5FDLB 4F4ZA 3QEBZ 1KD1O 1ZBIA 3KHRA 3FVYA 2YKPA 3DRYA 3C5GA 3TJ8A 8ICYA 4Y2KA 3DFEA 1BPYA 3UE2A 1LW0A 4OJLA 1N34F 2VFVA 2L9WA 1BQMB 4J03A 2P9LA 2I2YA 2ZZNA 4QR1A 3THYA 4YY3J 4DS4A 2ZBIA 1NAQA 3AVGA 5H2FU 2AIRB 3G8SA 1XWLA 5F1XA 2YJEA 5AZJA 4FZLA 3HZEA 4KFBA 1RLCL 4EBCA 5AQOA 1UVNA 3W2VA 3FFIA 3G6XA 2VYPA 3P83D 3DRRA 3NBPA 1BD6A 2MGZB 2ZH8A 4DQ8A 2OFHX 2FJWA 2A40A 4GY2B 4QS8A 4TQSA 1X4DA 1PJ6A 1SWVA 2YWEA 1GXLA 2APOA 3LK9A 4NWIA 1FFSB 3SQ4A 4DUYF 3SPZA 4JYAK 3FLCO 2FBXA 4XA5A 1T3QA 2YWGA 4RQ4A 5KFXA 3D5MA 3VQTA 3UR3C 5FLXU 2DHGA 2XI2A 4BROA 9ICCA 3UVJA 3MXJA 3C16B 2YKAA 1X40A 3PW0A 5KT7A 2C3PA 4MHVA 1YJUA 4KGMA 5F8HA 2DITA 3L8BA 1W0HA 4DU3A 2LQBA 3NCPA 4X4OA 1W25A 2NPFA 2BKEA 5J1EB 2CA9A 3MAHA 5KQDA 1YTYA 3MR6A 4FWLA 4P2SA 4PKHA 5IIKA 3UDVA 4C9DA 2DHAA 2RF2B 4TU9A 3DV9A 4DV2K 3WU2U 1HKAA 1FFUA 3BH6B 2DFHA 1YJVA 2UZAA 4OJPA 4U67L 1WKLA 1KL9A 4RW6B 2WTUA 1QTMA 2CPIA 1HEKA 5LMUJ 3GCWP 3JPQA 4DR5F 3QESA 1ILYA 3N7PD 2CQBA 3P4UB 3TFSA 2Q2RA 5DB8A 3HDSA 4OJ6A 3S6JA 4KC5A 1EWRA 3QUBA 1Q4RA 5EY4A 5J0XA 3W2WA 1FO1A 5DDQC 5A0LA 2PXIA 3CMQA 2GX8A 2RRBA 1BO5O 4DV4K 3ONNA 3VVUA 3K8VA 5KRTA 5DO2A 3BDEA 3R9KA 1B0VA 1AROP 1W97L 2IA6A 2PD1A 2Z0GA 1U48A 4YVZA 4Z4IA 1TK0A 4H4MB 1DQAA 1JXVA 4E7JA 4YB1P 2HYIB 1EHWA 1HPZB 3A0BU 3IM9A 4CLPA 3SQGB 3H2UB 2QLFB 4M04A 3QNMA 1S1UB 2PA8D 3JPNA 4YMNA 1HNIB 1S10A 4X4TA 4ILMA 2E20A 4O5KA 1RAOA 4CLSA 4ZP8A 4YHHJ 1OKJA 2J9EA 5DZ6A 4LF6K 5M2UA 4BG8A 2MKYA 3WK9A 1XMOJ 5KFUA 2P5OA 1RBOB 1F3FA 4USIA 3FAHA 1QQOA 3K75D 2N4DA 3DLLL 5IV4A 2WONA 2QXLA 3KD1E 1T7PA 4MKBA 9ICKA 2HQ3A 4QPXA 1RUSA 3BO3A 3KJFB 1PIEA 1KONA 2BYCA 2Y3YA 2IBKA 2WVEA 5IQ6A 5D4PA 2ZIXA 3SMPA 4CTAB 3NVMA 2W2MP 4DMNA 2FHKA 3BZKA 3CCES 3MDFA 1F21A 3OVNA 1VQNN 4RUCA 3LF0A 1FW6A 2H3GX 4NXNK 3CP8A 4O4RA 1NH7A 5AQLA 3M9MB 4F5QA 4NLOA 5EX0A 2LEBA 2W41A 4CBWA 1O6XA 2EANA 2PFQA 4ZP7A 3W1YC 1IQTA 3UXPA 4CCHA 4DR4K 2ZIWA 3M6UA 1R3NA 5AE2A 2JHDA 2W01A 4BR0A 1NJIO 3WDOA 4JKGB 4YB7A 2HOFA 1SV0C 2PMWA 4FLYA 2Z4PA 1T9WA 1NXIA 2B7CB 2FHJA 4P75A 3EYZA 4CQ1A 4XRHA 1Q95G 3CPWM 5E3CA 3MM6A 3SBGA 1VMBA 3OW2M 3W8PA 2IVYA 1SC1B 2C42A 3KLHB 2POKA 1KQFB 2FSJA 1FX4A 3I82A 4ITSA 1RAIB 2PN6A 1V3SA 1JLCB 4AQYK 1JLFA 1TL4A 4MFFA 4A8KA 4PL8A 4OKKA 3OTOK 3MMAA 1VSMA 2MKKA 1Q79A 3I76A 1Z2LA 4ZLJA 3AVBA 2OPQB 4PZOA 4UZBA 4OPJA 1BIZA 3CCVS 4XPCA 3FGVA 1V3RA 3FNNA 2NXUA 3VAJA 2PI4A 4QYZJ 1UCNA 1EX4A 3UD3P 4DV1K 2MLXA 2E44A 2YQ1A 4GVBB 1VQ7N 3IGVA 1YIJS 2LDIA 1IBMF 5J2FA 1RBSA 3HHLC 3U1NA 3IGNA 4CBUA 4FJJA 1GXUA 1KTQA 3LTOA 1EKSA 4IR9A 2DWQA 4IKFA 2VKZG 1B3TA 4QZEA 5DDMA 1VJWA 4DUZF 3QNOA 2EAMA 2DTUA 3SJJA 7ICNA 2A1JB 1FEHA 4DX8H 3DYAA 4ZCIA 1KTVA 3ILOA 2GIFA 3CTRA 2RE1A 5D49A 4CLZA 2E5LF 4IZ9A 3PYGA 3CCUN 5IIOA 4EZ6A 4C3MA 3FQLA 5J0TA 1X31C 1T05A 4DV6J 1SKUB 2XLKA 1K1SA 2AJ2A 4CZEA 1MROA 2GBZA 1WC6A 2A1RA 2KVCA 3US5A 1RWMB 4F26A 5BR8F 5KAIU 4AFFA 1F2HA 3AD7C 2Q4TA 3WXMB 3NHGA 3LPYA 4ILRA 2CVEA 3F44A 3ONQA 5C24A 4Y0WA 4US8A 1BL3A 4JI3F 2I9SA 4DU8A 1HBOB 3C2LA 2MQLA 1P7DA 2HBRB 2NRZA 3KMSA 2LPEA 3O3LA 5E79U 2DCLA 4USJC 1FKPA 4K4HA 2Z56B 3VEOA 2E8MA 4QS9A 2JX2A 2RU9A 1QVGR 2EC2A 5AJ3J 1FJGJ 3EX7B 4AF1A 1UEKA 1NJYA 2F8EX 3U7JA 3WK5A 1QJHA 2IVMA 1FO4A 3OV7A 1ZQKA 2CXEA 2IYIA 1ZQVA 4KN4A 2YQ3A 3DRPB 2XMUA 3JTPA 3CNHA 3ASMA 2GUIA 4DCPB 1Y5NB 1IBKJ 1Q3VA 1YITN 4OZ3A 2AT1B 4Q2LA 1BVSA 1WKJA 2W3RA 5BPCA 4OQJA 3IM1A 2V67A 3B6PA 4CJ3A 4NCGA 4B1YB 3QXGA 3H7IA 3SEOA 4LVNP 2AEFA 4K2JA 2HBLA 1YSJA 3N28A 4WP9A 1I3OB 4KTWA 4O3NA 4M2YA 4DV3F 4FXWA 3OPKA 1DTQB 4WBFA 1U6FA 1N8RT 3G82A 1K8KB 5CRXA 3FSYA 3CCRS 2OGUA 1KDNA 4BXOA 4KGXB 1X4BA 4V1Ak 3SZ2A 1KWMA 3TUZC 4LFCJ 4YDUA 1O5JA 3M1YA 1K44A 2KXFA 4Y28C 4WP3A 5HMXA 1KQSR 1UW9A 5AK3A 1B9FA 4ED0A 1EZZB 2GAGC 5EE0A 3QEAZ 3W9JA 2UYTA 3MURP 1SUQB 1Z4NA 1Q3UA 2ODGA 1X9WA 1C0TB 3NGKA 4Y2JA 2CFXA 4RO0A 4RNHA 1FKOA 3SMZA 3KKFA 1LXNA 5BYQA 5IIMA 1HJOA 3QEIA 4ZVFA 4O0JA 2QI2A 2YI1A 4FBUA 2FMQA 2P9KB 1NGHA 1S97A 4D3GA 4C8LA 2H5XA 2HMIA 3AOBA 4KHQA 4K4IA 4OVLA 4I27A 1R8BA 5ALWA 2WVDA 5AKEA 2P5VA 3W3SA 4ILGB 4DR3K 2Y1IA 4H4OB 3ISBA 3CI5A 4KJIA 1C7YA 1G4CA 2QK9A 5I42B 2PFOA 2A1AA 3KK3B 4F93B 3M2RA 4DI6A 2GGPB 1X5OA 4BDZA 1FTRA 5JMNA 2CJAA 2BJ3A 1OY8A 4AT1B 5AKKA 4JKDA 3C3LA 3IRUA 3HMJG 3EICA 4ERDA 4A8YA 3A5LC 3FZKA 2VKQA 3VAKA 5BYRA 3IXQA 4YCXA 4C4TA 4ILLA 4EX6A 2ASLA 2ITGA 3P6YC 4DR2F 2UUAF 4DF4A 2IDEA 3HSDA 4EYHB 4X84A 2O8CB 3OL6A 4F8RA 4GV3A 1LW2A 3BY5A 2OPSB 3DLEB 5KNIA 4B6JA 1GLFO 1MU2B 5H1SV 4ECTA 3G71S 3T9ZA 3AU2A 5AXNA 2N3LA 3D3BJ 2IM1A 4ZVTB 1S9FA 2HHHF 1JCFA 1RT4A 3VERA 1GAOA 3V6DA 5JJBA 4A8FA 2RSQA 2IYGA 2RVJA 4C11A 4DG1A 2P9NB 1RHRB 2UXBJ 5D4BA 1KQGB 2KDOA 3GYXB 2F9TA 3K7RA 3OGUA 2ZIUA 1MWQA 3AOAA 1NMNA 4KAIA 4C48A 2IM3A 5ALQA 2C2EA 1HWJA 1JI7A 4ZMMA 3GSIA 3D2EA 3OFGA 4NE9C 4YDXA 2HG4A 1M5KC 2BUNA 4IH6A 2JGUA 4YFKA 3IAM9 4DFPA 3HPHA 3AD9C 2MZTA 1MN9A 4ID8A 1IV0A 1Q5VA 2RP5A 2ACYA 3VQ6A 4ENOA 1X0FA 2FUG9 2NYVA 1ZTWA 4IOAQ 4HACA 3DLGA 2ZIVB 2NYIA 4LRCA 4NO7A 2VJ4A 4EO8A 2KFZA 3P39A 1VQMN 2Q0ZX 2P9SB 5GAHI 1LWFB 3M8WA 2KHOA 5CCLA 4CM0A 2YCHA 1ZA2B 4JWNA 3AQEA 1TE2A 5E3QA 5AZIA 3O3FA 4WXWA 4WFAQ 3DOKB 4R65A 2OKQA 3BPDA 1FHTA 3K5LA 4FF4A 5D3GA 4Y2AA 5EHHA 2ZOMA 3THWB 3IS9A 3NH1A 1OVQA 2XWXA 3H6EA 4WCEL 4WQ4A 2DXDA 4KHPK 1WEYA 1RZTA 3EVOA 1WF2A 1X2IA 4UATA 1CJVA 3QPIA 8ICKA 3IG8A 3KLGB 4B9TA 1TV6B 1PSDA 1MW7A 2XHBA 2EDUA 2HSTA 3SFGA 4KE5A 2XYGB 1W9HA 3O1WA 1B92A 2UVWA 1YWXA 4DV5F 1WNEA 4UARA 2F8LA 3S01A 2UUBK 4DBQA 5CYMB 3K89A 3VF2A 1TU0B 1Q5YA 2HBZB 4DHYA 1GMWA 4YD1A 4YORA 2YQ0A 3E1YA 3C5FA 2R7SA 3O80A 4DFMA 4WF9L 5KL8B 4CT9A 3GFXA 5IS2A 3NG8A 1CLFA 5ALGA 4UOHA 4ZHRA 3V2UC 1IR2A 2WF7A 2P9GA 2LEAA 1SC6A 3C0BA 1YBUA 2PFFB 2CJKA 5LSLA 1C1CB 4FJ7A 4XH1A 4WYBA 1Y3KA 3VAGA 2XNQA 3D6RA 4KAZA 5AQZA 3SBTA 3NGZA 3OYAA 2HQFA 4CJFA 1C4CA 2GIQA 3JPPA 1HNZJ 2YTUA 4MIBA 3MM7A 1L7OA 1S0OA 3QU4A 4CDIA 4DWIA 1MQ3A 4C8ZA 4OJGA 5GTIU 1FD2A 2LCWA 3AQPA 4B1ZA 5GMKa 3BREA 4LR8A 4A57A 1MG7A 1VSKA 3BSOA 4I4BA 3UDLA 4X66F 3DAWA 5DMRA 3H40A 2QLWA 4ECRA 4JS5A 3MBYA 1J6ZA 2NLWA 1RCXB 5ALFA 5D0GA 4IOCL 5C0YA 1RT1A 5GINA 3RAMA 1Z4OA 1T03B 1YJRA 2FLLA 3TA1A 2G08A 2W11A 1RTJA 2HKEA 5HRRA 2BE7D 2HWTA 4BUGA 3S1TA 5M1NA 4H5VA 3F9MA 3D6HB 2RAQA 4DL0C 5LT5A 3T1YK 5D15A 4PUOA 2E5HA 3MM5A 2ALZA 2EZXA 1DJ0A 5AI9A 1QQ6A 4NZ6A 1WNSA 2OH2A 3M1VB 4JK7A 5KG7A 1J5OB 1IO2A 2P9EA 2DFEA 4DR7F 5AT1B 4JYAJ 1N62A 3ZD8A 4BGBA 4NLKA 1S1TB 3NOCA 4H5WA 1WC4A 3ZX2A 3Q8KA 3SYZA 2VPWB 3PW5A 3VWSA 4HLBA 4URGA 2XS2A 2HS4A 3M4XA 5CABA 4PPZA 4NLYA 4DR1F 3BR8A 1M5HA 3Q86A 1YUWA 4IG3A 4V19X 1WDDA 2JC1A 4P2MA 3QJLA 1S72S 4ZVUB 4OZLA 3LUYA 4JD2B 4RT2A 2HS0A 2D8CA 2VG6B 1FRMA 5HP1B 3LP2A 2BVZA 3Q8PB 1DFDA 3AO3A 5DM6L 1DAXA 2G9OA 2PGCA 4IBNA 4DV2J 2V52B 1NK5A 1T3OA 3A3PB 5AQWA 2OEJA 2WF6A 4FOIA 4A8EA 1WOQA 2C1EB 1IH7A 4FWNA 3I96A 5IINA 5FPNA 3TAMA 4X66K 1ITPA 2Q0RA 4F2SA 1YLXA 4IRDA 3KG4A 3M30A 2RMLA 5DDRC 3HKZF 1HPMA 2HK2A 2HFZA 1E4GT 1JMSA 4NL9C 2LECA 1RCOB 4OX7A 1CLQA 1KQQA 3FSXA 5E7OB 3R2DJ 4YOXA 1ZD4A 4M3TA 4QZVB 1LK5A 1VCTA 1BWVA 2Z2ZA 2EFQA 1KAXA 3OYJA 2DXEA 3PR5B 1N0VC 4DV4J 1RBLA 3QO9B 3UDEA 3SBMA 4OZJA 1JLQA 3TAPA 2Q1NA 3EZWA 5C2DA 3RMCA 2PYLA 1HHTP 3HI0A 2NCKL 3V4IA 3K9JA 1S9GB 3CJ0A 1KQSM 5AIAA 3ZSQA 4RWXA 1KQKA 4F02A 2XRIA 4F36A 2KMDA 3LDOA 4DR7K 2A6OA 3OXLA 5E3PA 4DFDA 2VHGA 3UW1A 3PNCA 4B3RK 2XMJA 1MSWD 1KRPA 2GAHC 2XSFA 3CVKA 4X64F 4FJLA 4K8ZA 3SIPB 4PG8A 3HSJA 4NLDA 4CNZA 2E1FA 2FVQA 5AKYA 2VV5A 2VICA 1RXVA 4ZN3A 4KLTA 3IWXA 3NGUA 3SDEA 2LMIA 1GLAG 4FOEA 4LF6J 4PQUB 2GO9A 1RM6C 4PPXA 3NCQA 1NHKL 3PIPQ 2IDLA 3K4GA 3L0QA 4CF0A 2H3ZA 2E1PA 2O8BB 3VQQA 3D3CJ 3GMGA 1VRQC 2DY9A 3FKBA 4FWMA 3BQ0A 1B4SA 1D0EA 1N5VA 3SENA 3AJ2A 3UE5A 1KC8T 5BXIA 4X4UA 5CQGA 3WEEA 2EEYA 1TVAA 4DPYA 4DQRA 4O3MA 2IHMA 1DQ9A 4I9QA 1YKWA 2GQ2A 2D74B 4NXNJ 5J2EA 4ECYA 2IMWP 2WHEA 1ZQSA 2YPYA 3L7PA 1FRJA 1SXLA 4M3XA 2LYBA 5IT9U 1K73O 1ZQ1C 4RQ1A 2QEXN 2FHOB 4DR4J 2WB4A 2IRUA 2F2AB 1IKXB 4PZNA 3CRXA 4F3QA 4F92B 1HARA 4YOEA 5L39A 1N6QA 2BJEA 3ENBA 2CQ1A 4I2CA 2B4UA 4I2QB 4KQZA 4C1NK 4IQVA 2VQFF 1YJTA 1U4BA 2DR5A 1J5EK 1H7XA 3QNNA 4J9NA 1TUVA 2OZSA 5T7LB 2ZJRQ 4OX9K 5CHGA 1F3VA 3L2RA 3J81Y 2BGWA 4M6WA 4A4JA 2HHSA 3F5TA 4K7QA 1R0AB 2M52A 3KLIB 5DB7A 4NXMF 3OTOJ 2G8WA 3MAAB 1IJFB 1ZXIA 1NZPA 2ATQA 3BQ2A 4CJSA 1W2IA 5HATA 3R7SB 3DHXA 4CT8A 1ZAVA 4R5PB 1UVJA 5FPDA 4FJMA 3G4SS 4JI4K 4C0OC 2OTLN 1XNRF 2UUCF 3IR5B 1U04A 2XYHB 3AB2B 2OPPA 3UMGA 5AI8A 1P27B 2EXUA 4DV1J 3UQ2A 3ZEUB 4GMKA 4F7VA 4A8QA 2K4HA 5DG9A 1D8ZA 1LFPA 5KFZA 2JL9A 4NX9A 4CFBA 1OIAA 3G0ZA 5KFIA 2O67A 4URSA 1Q7LB 3TSPA 2GJ2A 4X4QA 4EYIB 2FZCB 4QZ9A 2M2BA 4P7VA 1OYEA 4NA3A 4NV0A 4ALZA 1VQKN 2O6KA 3BM7A 3GFHA 3R97A 3MXHP 4DU4A 4CF4A 1P1LA 1EO1A 3ZT4A 1T9VA 1KVKA 2ZF5O 2AJ4A 3GV8B 1N32F 2ZH9A 7ICJA 4I67A 1HLWA 1Q81O 2M88A 3I4PA 5CHCB 5D78A 2ASYA 1UCVA 4O3SA 4RW7A 4ZK7M 2ZJ5A 1U0HA 4KLIA 4WFBL 5AXKA 5KFJA 2DKXA 4EEKA 2ZC4A 1S99A 1N5WA 2FMSA 2QO3A 3B78A 2LKYA 2IJRA 3RRHA 1ZOTA 4KHRA 2UXCK 1KN5A 5HVGA 1Z4UA 3SAFA 2JC0A 2V69A 5A6PA 4C3KA 3K0JA 2V50A 2CQPA 2A3JA 3EJMA 2ZWHA 1ZAWA 2F40A 3PACA 3QFHA 2OSQA 5IQQA 2LA4A 2VOOA 2J7UA 3IBCB 3LP1A 1D8LA 3ZSXA 4Z7YA 5EX3A 4N76A 4C8KA 3KIOA 4EP4A 4H0OA 1KLMA 2NXCA 2E1MC 1ZQWA 2BQUA 3V4MA 1WC1A 5J0SA 4CBXA 3C28A 1YDLA 4NLNA 1PILA 2XG8A 3QSIA 3TZWA 2NRWA 4ZPVR 3D67A 3NOGA 2ETJA 4H8KA 5AHXA 3DLKA 2XS5A 4KLJA 3H46O 5IT4A 1U2VA 1XR6A 4IG0B 5GADI 5CY4A 4YOYA 2ZJPL 4YQWA 3OR2B 1WTBA 3CFOA 4LF8K 3D28A 5EOYA 1SVDA 4ECVA 1ZQEA 4BRMA 4USKA 3OR1A 2X6SA 4KGVB 3M32B 1VSIA 5KFSA 3L5KA 3M7VA 3OUYA 3K17A 2CGJA 2E5SA 5LY3A 1IJJA 2ZC3A 2XY6A 5AXLA 4ZVRB 2DFFA 4HDHA 5CJ7A 1RT2A 4DR6K 3L3CA 3CHWA 1WYGA 5B66U 2F9DA 4NZ7A 3M9NB 4OFZA 2IJFA 3LM2A 4HDGA 1VQ6S 1TK8A 9ATCB 2OEHA 4RW8B 2HFOA 2JSXA 1N4LA 4RPFA 4YB6A 2IS3A 3NGYA 1OJ4A 3GCXP 1GLJO 4JKHA 4KV8A 3P49B 2ILZA 1BI4B 5I3UA 1HR0J 3EN9A 1P6TA 2CXYA 2R7XA 1TKXA 3S9HA 4EAHD 3G86A 3BV8A 2E8PA 2MZ1A 4WE1A 3BS5B 4JMUA 1BUXA 4M5LA 3FCVA 1L6NA 2F96A 4WJBA 1ZA1B 3NS5A 3GONA 4LJMA 2FC0A 2BE2B 2N4CA 2LXIA 4DR3J 3AA5X 4GNIA 2QB0A 5AKIA 1XERA 4A61A 1PK3A 3GB0A 1CXUA 4OI3A 3TAFA 5KFHA 2J9DA 4UAYA 3SV3A 2EBEA 4GLXA 3I0SA 3HHKA 2Y8YA 2LYVA 2OM6A 2EH9A 3UR0A 1KAZA 3J80O 4KRFA 7ICQA 2HURA 1YXQA 3M2UB 4Y2UA 4IH5A 3FZHA 3ULDA 2LM1A 5FROA 2R42A 1VQNS 1FRHA 5C42B 2DPJA 4X4NA 4JRPA 4HHUA 5C7PA 4KH6A 3RMDA 4MMOA 3C65A 3MEEA 4JOUA 3A8KA 2X6NA 4DPXA 1NLKL 4FF3A 5KG4A 3NRWA 4NLWA 4GKKK 3BO4A 1YI2N 3VAHA 2C2OB 4DPUA 2IGIA 4JI2F 2FDNA 4CF3A 3CXCR 1JL2A 4QR2A 5ALVA 2WAQF 1RQNA 4NOHA 3Q89A 5EE3A 1BCOA 1SL1A 4OZ5A 2ASPA 3OHAA 5JVHL 2QWQA 1M1KO 1Z3EB 2VPYB 4KTZA 5HBMA 3KDNA 4DXLA 3SNNA 2OAUA 3MMBA 4WXOA 2K1RA 3KJVA 1CS4B 1E6YB 1VQON 2H65B 1ZQRA 4BRIA 3FUYA 3H1VX 2YBVA 2V4RA 5HL7Q 5J2NB 4FBTA 9ICUA 3ZZOA 2MAXA 1KP6A 3RJFA 3JXUA 5KFAA 3BYRA 4ANCA 3C1ZA 2FC9A 4C8YA 1IJEB 2XY8A 3BGUA 2V5HG 1AZSA 2C3UA 3CCSN 1UPMB 2GC8A 2WBMA 4Y2YA 1H3DA 4CEOA 4TLRA 4LQ3A 1FKAF 1R43A 2M70A 2DD8S 1NNLA 2W9CB 4TY8B 1ZYQA 1S79A 2KICA 5IILA 4BGAA 1VQPN 1VJ5A 4BC2A 4JI8J 3PJXA 3JB9k 3TX0A 3IHQB 4DQPA 1X4FA 2LQ5A 3TADC 4RJVA 4LF4K 4K0KK 3T79A 1TVRB 1WCLA 3D6JA 1A0OB 3CULA 4KI4A 4K8RA 3KHHA 4ETZA 1NGEA 5KFQA 1CRXA 3THPA 4FJ8A 3X3UA 4KHPJ 2ZE2B 3D0PA 3MCMA 5C25B 4DCJB 1TKZA 3CCUS 3O9RA 1IKYB 4I2PA 4O8UA 4MDAA 5DETA 7ICUA 4H0TB 2CPRA 2K2PA 3A8YA 1WSRA 2DNZA 2A2CA 1FXLA 3H8YA 3C29A 3TRGA 1D9AA 5JMVA 3J7YP 2IC3B 2RQCA 3ZI4A 5HRSA 1UT5A 4M3RA 3N4QA 3HSCA 2DNHA 4E19A 3SV4A 1T02A 4JB8B 1JWWA 4LF7K 2O1PA 1EJ7L 2RNEA 4NPOA 5JS2A 2MPUA 1EIYB 5J2PA 2HQDA 1PYOB 1AT1B 1VYAA 3THXA 2GW8A 4K43A 1SH3A 2IHR1 3AAPA 4ZPBA 4JP8A 1XMQK 5KTQA 1GT8A 3UKUA 3OTEA 3EGNA 2XM3A 3M8PA 1LNQA 3OL8A 2B9XA 2XO7A 2CJ9A 2V68A 2R7WA 3BO2A 4AXJA 1YAGA 2E7WA 4XPEA 2W7PA 5IWAK 2E9ZA 3SQOP 3ZTQA 4YXJA 3VV2B 4C4WA 2J6TA 3ET6B 4HKQA 1LV5A 2CZ9A 2HGLA 4U7UK 4PL7A 4DTMA 3BKFA 1YITS 3B9JA 2B43A 2MQNA 3AARA 2V0NA 3GTYX 4OD0A 2IVFB 1LB2B 1SS6A 5CWRA 4RQ8A 4DJBA 4L73A 2OZMA 1BNOA 4UB2A 4AHCA 2DNRA 4CRJA 2R3VA 3OYBA 3V7LA 1S9EA 1DARA 1HIYA 4H0VB 3T7ZA 2D69A 1TQLA 3JAMO 1PAUB 4LR9A 3MFIA 5SWMA 2D3ZA 1NSQA 2I6XA 1JIHA 3WNHA 4K8XA 5H9EK 3WBZA 4FE3A 4C0BA 1LQ9A 1W7AA 4B3TK 1FRXA 3A12A 5AQXA 1FCAA 3PVXA 4M9LA 5M2PA 2HMPA 3L2UA 4R8UA 4LF2A 1U6BA 4B1XB 4CZFA 3ADAC 4QZIA 3LH2S 3KXDA 8ICMA 1X8DA 2KG0A 5E84A 1TAQA 1NDKA 3T1YJ 6FDRA 2YNGA 1ZQDA 3ZDCA 3M8QA 4I7FB 1PVQA 1VIXA 1C2PA 3JQJA 3V7JA 2U2FA 4ES3A 3O4NA 3OY9A 2GLEA 5T14A 4TXSA 5HK4A 1K0VA 1S5JA 4PJ0U 4BRLA 3QETA 3ID8A 3ZTPA 2IRYA 3Q8VA 1RHKB 4G65A 1U1OA 4JI7K 2RB7A 2MLYA 2E6MA 4RG8A 3VF6A 1S5LU 2LBOA 1C0MA 4OX6A 1H6KX 3NEKA 2ZG6A 4RW9B 5DG8A 4C0HA 4UB6U 3Q22A 4UQGA 5ALOA 8ICAA 3MM8B 5GMEA 4DOBA 2VIXA 1NB2A 4MLEA 1S1WB 4LF5K 2HRYA 3MGIA 4A8XA 1UFKA 5J2QB 1TYQB 3HSTB 1EETB 4C8MA 1SH2A 2PC6A 3R5GA 1LWCB 1RAHB 1H98A 4Z0UA 4EO6A 3OPXA 2KJ5A 4Q8EA 4ZVSB 2MZRA 4DV0J 2EVZA 1KHWA 4PGXA 1Q8LA 1HNWK 2XVTA 1WD6A 2B5JA 7FD1A 1N2XA 1KEKA 4OI4A 2JV3A 2NRTA 1BOTO 3AGRA 4NRTA 2R2UA 3ITHA 4H0PA 3TA0A 1L3TA 2WRMA 3EGWB 4N77A 3J7Z5 1URNA 1N52B 3OYNA 2P35A 2DK2A 5AQNA 4KITB 4WZMA 2KM8C 1ZQZA 3SUQA 3PSFA 1X4EA 3NRZA 3V81A 4F5PA 4Z6EA 1IXKA 2B21A 4ES1A 3AA4A 1FJCA 4PWDB 1H2VZ 4M3UA 1U02A 3KUHA 4AYBF 3JYTB 4UOGA 3AY0A 4X4PA 1I6JA 2BE9B 2LLZA 3H42A 3VQAA 5D8HB 1DURA 4OHYA 1U2RA 3PSIA 1Q86O 1GOBA 2DNPA 5AM2A 1X6JA 4JI0F 1OW5A 3KK2A 4JI1F 4B3RJ 2E7VA 3VEYA 5GAGI 1RTIB 4K4SA 4JB3A 4CECA 5ELZA 4ZIWA 3TW0A 3UM9A 2KZZA 1HFEL 3GIRA 4FVUA 4E7KA 1RWOB 3D2WA 4WFXA 3G96A 4NLCA 1JJHA 2LM4A 4OV6A 5C12A 2K8AA 3RB3A 1VJQA 4USAA 3TKAA 4M1KA 2F5GA 1S6PA 1FFWB 3CDWA 1RDUA 1WSHA 2ADCA 4Y2XA 2H4YB 1VQMS 1OMSA 5ALHA 2HEKA 3RBXA 2IAJA 3B54A 1VQ8N 3TJ9A 4CJWA 8ATCB 3V6JA 1RT7A 3RJEA 3J7ZO 1PK1B 2OYYA 5DM7Q 1QLNA 1YZ6A 1VS3A 1NDPA 1Y5LB 3IBWA 2J5AA 3D6MB 2AJ1A 1RISA 3CJ5A 1NMDA 4CO1A 8ICIA 4OI6A 4OJOA 1WHYA 4IYQA 1HQUB 3LPTA 8ICFA 1IG6A 4FNHA 4ZJQA 2VPZB 4Q0BB 4A8WA 1NB7A 4ZKAA 3I0RA 5C2GA 3QRPA 2MRLA 4QJFB 3V6HA 3QRRA 2KT5A 2JHEA 3D68A 1UVLA 2F4VF 4JI5F 3D45A 4G1QA 5EN1A 1JLGA 2E3TA 2YWWA 1I39A 2YX4A 3MC1A 3VPZA 3QUCA 2OIHA 1EKEA 2W9AA 1NDLA 3ZT3A 3L4PA 3VQBA 4JK1A 1C1BA 1N36F 1CI4A 4RQ3A 2DNNA 2WVFA 1QE1A 2N7YA 1FT8A 1X4CA 5GAHU 1GMVA 1L8OA 1CJUB 2BM1A 1TZ0A 1LWEA 4LRAA 1J5EJ 2E2QA 1C0UB 3MPWA 3ZT1A 3R5JB 4C98A 3O1LA 4BHQA 4PY5A 2ZJQL 2YY6A 1SKWA 5LMNF 3WQUA 1JXEA 3OL7A 4BR2A 4LF1A 2FF6A 3NGIA 4O3QA 3GBTA 4CF5A 3RJKA 3H8WA 4G6VB 4CD3A 1SV5A 1VRTB 1YVNA 4FDFA 3LWMA 3F53A 3QAUA 3RRGA 1H1VA 1AUDA 2Q36A 4DL4A 5AQMA 1TELA 3V72A 3GYGA 4OHVA 1X4GA 5HLFB 4KPYA 1BGXT 4JV0A 5DBAA 1Q8BA 4JI4J 3E01B 3K5PA 1SXDA 3VENA 1JJ2R 1XN9A 4I9LA 1QCKA 2W55A 3OFEA 2FXUA 3ZTSA 2WUSA 3LL3A 3KNGA 3MGJA 1NK4A 4OI2A 5DDPC 2PY5A 2UVVA 1RT6B 5M2RA 3RMBA 4FK4A 5AKHA 1O13A 2NSBA 3NDKA 3QAEA 2J6UA 4LSNB 3NKYA 1KOOA 3TOQA 4TSXA 3RJIA 3RB0A 1R8PA 2A42A 2HNZB 4K4VA 2HLTA 3HSGA 3UWTA 3TARA 3JPSA 4ECQA 4LBIA 1PVPA 2MSSA 4FPIA 3VC8A 1ZM9A 4CF8A 3ISND 3PKYA 2CQIA 5AQFA 2Q0UA 1Q82O 3O5TB 4LFAJ 3MMCB 3DRXA 2VA3A 3BR9A 1ZBUA 3IFRA 1EXQA 4E1MA 4AL6A 3T1HK 4CNQA 5HMLA 3NGTA 1RTDB 2V4JB 4FWPA 4CK2A 4BR4A 1GNKA 4C97A 3GIIA 4C2MA 3TTFA 4KYZA 1S57A 2GELA 3UB5A 2YHBA 1REGX 3RG6A 1S8OA 2UXCJ 1M1GA 1SPBP 3M6XA 2JEGA 2XGPA 3ALRA 1GLEG 2XQCA 3TAGA 1TFRA 4DO9A 3ZETB 4CI0B 4QZDA 3IN5A 2KHDA 2BABA 4AE5A 3AL0B 1NGBA 1R59O 4IFVB 2YVSA 2VFRA 4RU2A 2KH9A 2RKIA 1SBRA 1YRXA 1BU6O 4LH4A 1CJTB 1RAJA 1V4TA 4NA2A 2KW4A 2WF8A 4M3ZA 3OA9A 4Z37A 4JHDA 1BISA 3L7OA 1VSLA 3ZZ0A