4F8RA

Bacillus dna polymerase i large fragment complex 7
Total Genus 204
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
204
sequence length
579
structure length
579
Chain Sequence
KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase
publication title Structures of a High-fidelity DNA Polymerase
rcsb
source organism Geobacillus kaustophilus
molecule tags Transferase/dna
total genus 204
structure length 579
sequence length 579
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4f8rA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4f8rA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4f8rA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4f8rA01
4OPKA 5CYMA 2ZJAA 4KLJA 2QK9A 4OKEA 2AGOA 4RPXA 3OHAA 1S9GA 1BI4B 4AHRA 2JEJA 4XRHA 2YHBA 2OA8A 4OKKA 4O5CA 4CERA 5J0TA 4W5NA 4QWDA 4NY8A 3M9NB 3JPTA 4EBDA 3NGIA 2R8HA 4M9GA 9ICRA 5L1LA 2KZMA 3ZT1A 4G1QA 5DLFA 2ZTCA 3RJJA 4ZTFA 9ICVA 1U47A 3QNOA 3VQ6A 3O3HA 3E01A 3DI6A 1NOYA 2ZTEA 1U45A 2XHBA 5KFVA 4J9KA 4AHVA 4KHWA 1K1SA 3TI0A 1Y97A 1FKOA 2BQUA 2HVIA 5HMLA 4O0IA 9ICKA 4H8KA 1T05A 4Q43A 4ECQA 4NLGA 2RF2A 1UAXA 1QTMA 3PR4A 3RH4A 2VWJA 3V6HA 4UAYA 4B9TA 2PYJA 7ICHA 4ED2A 2ZE2A 4QZCA 3TFRA 4CJLA 3OYFA 4IKFA 1XSNA 7ICQA 2ZUBA 3GIIA 9ICSA 4DFKA 1WLJA 4R64A 4MFAA 4FJNA 1EP4A 4P2HA 4I7FA 4YQWA 3RB6A 1S1XA 4FZZA 4JWMA 3TQ1A 4YNQA 1NJZA 9ICFA 3QE9Y 3T5KA 3I8DA 5KFMA 4N47A 4Z4GA 1ZYQA 4MFCA 5HRSA 3S9HA 3RBEA 1A5XA 3U3YA 1KEJA 4GMJB 1RDDA 3KLEA 4RUAA 4KLTA 4FJIA 3VN5A 4KMUA 3LP0A 4BGDA 4DS4A 2I9GA 3AO4A 2Y1IA 5KG6A 2Q3SA 4HUFA 3SPZA 3RRGA 4HVJA 1VSKA 3CG7A 1H38A 5J0RA 4B8CA 3GV5B 5CJ7A 3OYKA 3MGHA 4KLIA 5D46A 3TARA 4C8KA 2F1HA 4DTNA 2DY4A 3QEIA 2XC9A 2JZBB 4F5NA 4B9MA 5I42A 4E19A 1Z00B 3NF8A 2BHNA 4EP4A 4DU1A 1J54A 3F73A 1S0VA 2IHNA 4RZRA 4RW8A 1ZQBA 4DTUA 2FPKA 4N5SA 1VSIA 5DBCA 4F5QA 2C28A 2FBVA 3TAFA 1FXXA 2NUBA 3QIOA 1REVA 4QWCA 4UB5A 4DQQA 4FJGA 4KTQA 4LY7A 3BJYA 3IM1A 3HSTB 4M9HA 4M3UA 5J0QA 2FC0A 1KVCA 2BCRA 4IFVA 1L3SA 5HBMA 2KTQA 3AVKA 2ZJ5A 3K2PA 3UQ0A 1J5OA 1BPBA 1U48A 2VG7A 3M8QA 3V72A 4M45A 2AGPA 4E7KA 1ZQPA 1B9DA 4CGFA 4DQIA 2FBYA 2A1JA 1UWBA 3G6VA 1JXEA 4Q5VA 2FLLA 1RBRA 2XGQA 5C25A 3OJSA 4R8UA 1IXRA 4CJQA 5KT6A 4C8MA 1RPLA 4RQ7A 4J9RA 3RJIA 3B6OA 2HVHA 4QZ9A 4W5RA 4FK2A 5DGBA 3AU2A 4HCBA 1BIZA 4JLHA 3HVRA 2XCAA 5L1KA 3ZSWA 4CEQA 2R8KA 5KFGA 3V1OA 4KLGA 4NLKA 5JS1A 4ID5A 4I2GA 1C0UA 4IRDA 5J0XA 5EOZA 3QO9A 3H08A 3PUFA 3HYFA 4IQTA 3ZT3A 3Q8MA 2IDOA 7ICFA 2F8TA 4KLEA 3V7JA 4XIUA 1SKWA 1HNVA 4KTZA 5KT4A 4M41A 3SV4A 3N97B 3ISDA 2BQRA 3V9WA 9ICLA 4KLHA 4GW6A 4P4MA 3RMDA 4KHSA 1HUZA 2FPLA 1BPYA 4DSJA 5CB1A 1KTQA 3CFRA 2XO7A 8ICSA 1C0TA 4C8OA 4NXZA 5DB8A 2GBZA 1W0HA 1TKZA 8ICBA 3NE6A 5J0OA 4Q8EA 1FKPA 2OPSA 4N76A 4FS2A 1IKYA 3ZSZA 3NTUA 3NH2A 4BWJA 4J9PA 7ICJA 4CHOA 2C2DA 3SI6A 4TUQA 4PHEA 2VA3A 4CJPA 4F3OA 3C21A 3ZDDA 4DSEA 1I3AA 1BISA 4AHUA 3HXMA 1ASUA 3ISCA 2YNHA 4CJVA 4I9QA 5KFYA 1LWCA 3TAMA 5KFLA 4E1NA 1KSPA 5KFRA 3TR8A 3A2FA 1HYVA 4F2RA 4FW2A 1C1CA 4E3SA 2F1JA 2H5XA 2Z1GA 5DG7A 4HHTA 1FK9A 5J0PA 3DMJA 4TUPA 2F96A 4DOAA 1BQNA 2W9CA 4MF8A 2ETJA 4O3RA 4DFJA 3JPSA 4QZDA 3M8SA 3SV3A 2J6UA 3P5JA 4RW7A 4JV2A 4HCCA 2IHMA 4DLEA 3PR5B 1ITGA 1ZQXA 1XHXA 2BE2A 9ICQA 2IOCA 2X6NA 4L8RB 1NJYA 3ZSOA 4G3IA 4TURA 4M3XA 3V9ZA 3SUOA 3AVIA 1DLOA 4HYKA 1S1TA 2YHAA 4ID1A 1DTTA 3G10A 2AQ4A 3CQ8A 1HPZA 5DB9A 4YD2A 4KLDA 4FLYA 1HRHA 4CECA 1TAQA 3KJVA 4CF8A 2BCVA 4ECUA 2QXFA 1S5JA 2DFLA 1HQEA 3OYJA 3MDCA 4CGDA 4CF2A 4FJHA 4ZH4A 4ED8A 4IQWA 4CJUA 4BDZA 4DSLA 5DDMA 8ICYA 3JPQA 1U4BA 4CJ3A 2QKBA 4KLQA 4DL5A 4M3TA 5KI6A 4I2IA 4UB2A 5DDYA 2D0BA 4FYDA 8ICXA 4F5RA 1WSHA 4M6WA 2UVVA 3LP2A 2DFFA 3OYLA 4J9QA 2YKMA 1ZQTA 9ICXA 1WSJA 5D49A 3PY8A 1CXUA 4CEAA 5KFHA 1KFDA 2QKKA 1ZBHA 1LV5A 5IIIA 4CIFA 5BOLA 4DL2A 3LAKA 4YR2A 2IMWP 2J6SA 3PO4A 3RMAA 1VSEA 4J2DA 4H4MA 2NRXA 5CP2A 4B8AB 3LPUA 1UA0A 3AVGA 3KHGA 3RJGA 1UOCA 4O3PA 4RW9A 5KFFA 9ICEA 1CUKA 1ZQAA 5HMMA 1TK8A 2IBKA 1VSLA 1NOZA 3DRSA 3ZSQA 1NKCA 2DFEA 3K75D 3ZSRA 3ZSXA 1SKSA 4RQ3A 2Z1HA 3PV8A 3V7LA 3EPIA 3MR2A 5KFAA 1WAFA 3MXIA 5EU7A 2VWKA 8ICUA 3LZJA 2ZD1A 3S3OA 3ZSVA 2ISPA 5TZVA 5KG1A 1U9LA 4OGEA 5J2NA 2ASLA 1IKVA 3AVJA 3SNNA 5K14A 1BCOA 3C2MA 3GIMA 5KFJA 1J53A 8ICOA 1ZQRA 3SYZA 1ZQLA 2ISOA 4TSXA 1SKRA 3NH1A 5KT7A 1ZQYA 3AVCA 5J29A 3M9OB 1BQMA 3QEVA 3VQBA 1HYZA 8ICIA 4Z0UA 2B21A 3JYTA 2BCUA 5KG5A 4CHPA 1RT2A 3S3MA 3HP6A 3KK2A 3QNNA 3BQTA 1HUOA 5CWRA 1RYRA 3VQ9A 1L3UA 5D4BA 4DF4A 1A5WA 1LB2B 5J2BA 2RPIA 2BDPA 3ZDBA 5KT3A 4F5PA 4LSLA 1ZJNA 3SPYA 1MQ2A 3DLEA 4UB4A 2G8UA 1TGOA 3WNFA 1L3VA 1F21A 4JRPA 3GV8B 4F2SA 4CEOA 5FRNA 2HMIA 3QETA 2WONA 3VQDA 5KG0A 3NFAA 2ITGA 3LDSA 1COOA 1YT3A 2P6RA 1N5YA 3KHLA 3EPGA 3RRHA 3T19A 1XWLA 5D3GA 4F5OA 3HK2A 3AVLA 3PW7A 3ASMA 5KG2A 2IS3A 4CJKA 4EBEA 1UA1A 3RB4A 4O5KA 9ICIA 3MFHA 2C22A 7ICGA 1HYSA 2IGIA 4RPZA 4EZ6A 4I2PA 5DQHA 3WNHA 3CM6A 4E7LA 3AV9A 3MXJA 3V9XA 3T1AA 3JPNA 2W9BA 5IILA 7ICKA 3L8BA 4LD0A 4KLFA 4BDYA 3BGRA 3K5OA 3SQ0A 4CHYA 4ED7A 2MUTA 5E41A 1BPXA 2HB5A 3EWAA 4DMNA 1ZQNA 1RBUA 4DSKA 3VQ5A 1ZQIA 3C1ZA 3Q8RB 3VQAA 4EYHB 1S0MA 5HRNA 1B22A 4Z6EA 3TWHA 4YD1A 4CJWA 3IRXA 2NRWA 4GXKA 5J2CA 4FBUA 1JLQA 1S1WA 8ICVA 2IC3A 4PHAA 3HPHA 4PPXA 3OS2A 3MR6A 2P6UA 1IKXA 4E89A 5J2JA 3PW5A 4RQ1A 1ZQMA 3L2WA 1BPDA 1JX4A 2OWOA 3JPPA 1KCFA 2ATQA 5HLFA 1S10A 3V6KA 3NH0A 4DOBA 7ICUA 7ICVA 4CEBA 2AQ0A 3RR8A 5HHIA 3OYCA 4FW1A 4MEYA 3RB0A 2Z1IA 2PFOA 1B43A 3MBYA 4CF9A 3MEGA 4GC6A 4ICLA 4KN4A 7ICSA 1D9FA 4I9LA 3NCIA 2Q0ZX 4GLXA 4Z4FA 1Z25A 4CEEA 4XUSA 4B08A 3NHGA 4CIGA 4OVLA 4DTJA 4KLLA 3PO5A 4BE1A 4KKOA 4DSFA 2O4IA 4P4OA 3ITHA 4I27A 3C5FA 3V81A 2ASJA 1RZTA 1MSWD 3VQ7A 3OYAA 4UAWA 3RJHA 4CGJA 1QLNA 3T5JA 3HPGA 2RDJA 3VQ4A 1T7PA 5KFWA 4CFDA 1G15A 4E1MA 9ICPA 4IFYA 1A5VA 1TFRA 4FZYA 1JL2A 1TKXA 1C6VA 2HHQA 4Z4EA 3B0YA 1TV6A 4NM2A 4DTOA 5HNKA 3NGDA 3IHQB 1BPEA 2BANA 4NLNA 5KG3A 5DBAA 3VA0A 5J2MA 2HNYA 4CESA 2GV9A 3RAXA 4J2AA 3PNCA 2I5JA 4O3OA 2G8WA 2FMPA 2AGQA 7ICNA 3LAMA 3DRRA 4DQSA 3HVTA 3GV7B 4FM1A 3KLFA 1RXVA 2EX3A 1XC9A 3KLIA 4KI6A 3RBDA 3G6XA 1N6QA 4DFPA 4B9LA 1ZQDA 4JV0A 3C1YA 4ED0A 3B0XA 4YN4A 3KHRA 2R8JA 2ZTDA 5KFTA 4Q45A 4J2EA 3Q8PB 4CJTA 4NCAA 3AVHA 4I2QA 4DU4A 5KGWA 4PA1A 4CGHA 3FYHA 3DYAA 1ZJMA 3AVAA 4F50A 1XI1A 2W8LA 2XY8A 3QERA 4TQSA 1S6PA 3SJJA 3LALA 4M6WB 1ZQGA 5KFOA 2IAJA 3AVFA 1QSLA 3B6PA 1EXQA 4PH5A 1TK0A 1MQ3A 4K8XA 4Y1DA 3M9MB 2HHXA 3C6UA 8ICJA 1ZQQA 4I2CA 3OYGA 5J2AA 4GVMA 4ECRA 2G8KA 4QZ8A 4GXJA 3FFIA 4AHTA 4RT2A 4QW8A 3H4BA 3CFPA 1CEZA 1EXNA 3HJFA 4QZEA 5DQGA 2XY7A 4AILC 1KVBA 4TQRA 3GIKA 7ICEA 1N56A 3U3GA 1BGXT 1S0NA 2X78A 3KLGA 3DOKA 3P83D 5FROA 1ZQWA 3H4DA 5C24A 4C8NA 3TABA 3QEPA 4R65A 2M9NA 2JEIA 5J0WA 1D5AA 4OGCA 9ICOA 3H7IA 1KFSA 3LK9A 4KLOA 2G8VA 1ZQZA 4O0JA 3V1QA 4QZHA 4CJEA 4DTMA 3DLGA 4YG2A 4YR3A 4FLUA 4M2YA 1GOAA 4F92B 3OSPA 2NRZA 8ICMA 3MR3A 4JS4A 2B6AA 3LDAA 4YMOA 4WE1A 2UVRA 4KFBA 4IG0A 1BVSA 5L1IA 4IRKA 4RQ2A 2W8KA 2FMQA 4CK1A 4NM1A 1JMSA 2KZZA 3SUNA 3JPRA 3KK3A 4CJRA 4CGIA 3HWTA 3K5LA 4FJJA 2C2EA 1K6YA 8ICQA 3C23A 3ZSYA 1ZQVA 5FRMA 1QS4A 5HHHA 2KN7A 3AU6A 2D5RA 2BPGA 5EWEA 5HRPA 3V6JA 1KLNA 3C6TA 8ICEA 4KLUA 4E0DA 5KRSA 3GIJA 5CR0A 3CFOA 4DG1A 1VK0A 3BQ0A 3THVA 3G0ZA 3L2RA 4BXOB 1TL1A 1KRPA 4YXJA 2W9MA 1DGSA 4YMNA 5J1EA 4E7JA 1JN3A 4O5EA 2KQ2A 4YP3A 1ASVA 4DTPA 5C5JA 3ETLA 4XQ8A 5KFCA 5IIMA 3PW2A 1XSLA 2OZSA 1C7YA 5BOMA 4K4GA 9ICAA 2YNGA 1PZNA 5KFQA 3L2UA 5DQIA 3O3FA 4JWNA 3O4NA 3AO1A 2R8IA 2RN2A 1SL1A 1Z00A 2ASDA 8ICWA 1CLQA 4B9SA 3UPQA 1RT5A 9ICWA 3PW4A 2G8HA 4DQPA 3QEWA 4EP5A 4I2BA 4PHPA 4EBCA 2GUIA 5DB6A 4YVZA 4JS5A 2MUTB 3IG1A 2W9AA 1SL0A 4KHNA 1T3NA 9ICMA 3RJEA 4TUSA 3HT3A 4DTSA 2D0CA 4BWMA 3QIPA 4EEYA 4JUZA 1JLCA 3HPOA 1ZBFA 4F4ZA 4MFFA 4F4XA 4IDKA 1CZBA 1X2IA 1T8EA 3HP9A 1S6QA 4KHUA 3JPOA 1S0OA 4KLMA 1HNIA 4ZTJA 1DOQA 5KFSA 4ECYA 3LZIA 4CJFA 5DBBA 4FJ8A 4GXIA 2YNIA 4X5VA 1X1PA 8ICCA 3O4QA 4AHCA 1S9FA 4ECZA 2JEGA 5KFKA 3KK1A 2XY6A 4GC7A 4KAZA 3DLBA 4FJMA 9ICCA 3OYBA 4FZXC 3ZCMA 3OS1A 1JIHA 1N48A 3PMNA 4RU9A 4UB3A 3OS0A 2A1SA 4IQVA 2FBTA 1TVAA 4N56A 4J9LA 3VQPA 2PZSA 4QCLA 2HHSA 4RUCA 3RJKA 7ICTA 3ISNC 1ZBUA 5FDLA 3I0RA 4I28A 1IO2A 2AJQA 4O55A 3V9SA 1ZQEA 4UBBA 3QZ7A 2ZUDA 3AO3A 5I3UA 4YFKA 4B9UA 1RTIA 4DL3A 3MEEA 4F4WA 2P66A 4NCBA 1WAJA 2E6MA 4QZIA 4IR1A 1EX4A 3TFSA 4M04A 3EZ5A 2ZQBA 4F8RA 1RDAA 3NBPA 1BCMA 1ZQUA 4RPYA 5KGXA 2WTFA 3L3UA 3RR7A 4CJ4A 3K5NA 1CXQA 3S3NA 2P1JA 3PX6A 3K57A 2BGGA 3NF7A 3SUPA 1T03A 4KREA 4Z6CA 4CEDA 4JRQA 3MDAA 5KTQA 4OJRA 1Y88A 4PGYA 1ZQSA 4IG3A 3BDPA 3SQ4A 4M42A 1IKWA 1B92A 3P1GA 3E2EA 1RT7A 1TKTA 2OZMA 1KFTA 4UAZA 4PHDA 3ZT4A 2BQ3A 1TVRA 3O3GA 2Z1JA 4DEZA 4BE2A 2DPIA 3MEDA 2G8IA 5IINA 3RH5A 4CF1A 2R7YA 2BPFA 3KD5E 4CFCA 2O4GA 9ICHA 1NJXA 1TAUA 4YCXA 2G8FA 4E7IA 2HHTA 3H8SA 3C5GA 3QEXA 1A77A 5CZ1A 4ED3A 1XHZA 5KFEA 2BR0A 1NKBA 1NK6A 1JKHA 1TKDA 5DMRA 2FPMA 2X74A 1SL2A 4KRFA 5DB7A 2PXIA 5J2HA 9ICUA 5KFUA 1S97A 1WSGA 2X6SA 4ECXA 2AU0A 5KT2A 1Q8IA 4H4OA 4Z4CA 2C2RA 3HX0A 1S76D 2NRTA 4RQ0A 2JLEA 1VSMA 3LWLA 2E6LA 4NCGA 3ZT2A 3PX0A 1RT4A 1U49A 2LYHA 2KFZA 4I2AA 3D0PA 3VQEA 4DF8A 1LW2A 5SWMA 4Z4IA 1DTQA 2ATLA 3AO5A 3IAYA 2FLPA 2A1JB 4FLZA 1WSIA 1ZQHA 1VSFA 4R8UB 8ICPA 4R63A 1BPZA 2Y1JA 4QOZB 4LH4A 3H8WA 1ZBLA 4M47A 4M3YA 2PI5A 7ICPA 4E7HA 3MABA 3V4IA 4DLGA 3AVBA 4Y1CA 4DU3A 3RAQA 3HM9A 4DL4A 3SZ2A 3SQ1A 2V4QA 4KI4A 3NAEA 2GWSA 2ZJ8A 2RDIA 2XY5A 1VRUA 3GDXA 2VA2A 4B9VA 4BE0A 4QWEA 1HJPA 3ISBA 4KV8A 8ICTA 4KTWA 4FVMA 2W42A 1K1QA 3GFKB 5EWFA 8ICLA 1RT1A 5HROA 4O9MA 3OSNA 3WNGA 1ZQOA 2BCQA 4QAGA 4I2EA 7ICOA 9ICBA 4O44A 4KB0A 1WSEA 2PI4A 4QW9A 3ZDAA 1LW0A 4I2DA 5L1JA 8ICNA 3NDKA 5J0SA 4BDPA 1RT6A 3H40A 3Q8KA 4DS5A 2HNDA 1UT5A 4I2FA 4FJKA 4RQ8A 1U04A 4W5TA 5IIJA 3L3VA 4M9JA 4XA5A 5KFPA 1KDHA 3QZ8A 7ICMA 3ALYA 3PX4A 1S1UA 3DRPA 1ZQFA 3V6DA 4JK1A 4R5PA 4CGGA 1XSPA 4FCYA 1KLMA 5KFBA 2LSNA 1RBVA 3AA4A 1Q9XA 2J6TA 3LP1A 4O4GA 1ZBIA 3UIQA 2VA8A 4LSNA 3HO1A 4IRCA 3H8JA 1AROP 3KKRA 1LWEA 3OVNA 3AA3A 3PVXA 3PW0A 4M9LA 3TAPA 3D45A 1XS9D 1UT8A 3OHBA 9ICGA 4W5QA 1TL3A 3AA5X 1NOMA 3EY1A 3AVMA 3OYNA 2OPRA 2KZ3A 3JSMA 1NJWA 2JGUA 1RTJA 4Q8FA 4MQ3A 3ZD8A 4K4IA 2W9CB 5SZTA 1ZQCA 4AHSA 1ASWA 1R0AA 3ZDEA 3CM5A 3AA2A 4F4KA 4NLZA 4RW6A 1I39A 4KPYA 4QWAA 4OLBA 4DO9A 3RMCA 4IBNA 8ICHA 3OYHA 4RNNA 1NKEA 4M3RA 4UBCA 1JLGA 2OPQA 4YR0A 4KO0A 1VRTA 4OPJA 3LPTA 1WCNA 2UVUA 9ICNA 4OLAA 5T7BA 4CHNA 1EETA 4RNMA 4M0AA 3TAGA 5J2EA 1IH7A 3K5MA 3K59A 4FBTA 1JL1A 3KD1E 4P4PA 3PMLA 4CEZA 4O3SA 4ELVA 4R66A 4DTRA 3VA3A 7ICRA 1X9WA 2PFPA 4CE9A 3MXMA 5J2PA 3NGZA 2KW4A 4FJ7A 1YTUA 4M9NA 4FLTA 4CFAA 1JLBA 1Z26A 1MU2A 3NF9A 5J2KA 1LWFA 3M8PA 3QINA 1BI4A 5L9XA 5KFNA 4FM0A 3OYMA 4O5BA 1SUQA 1X9MA 3DLKA 3RJFA 3Q8LA 4FLXA 4M3WA 5JS2A 4QZAA 1IM4A 2ZUCA 2HHVA 4F4YA 5KG7A 4FS1A 1RTDA 4FJ5A 1WN7A 1C1AA 4F93B 2P51A 3AUOA 1RDCA 2YV0X 5DK5A 9ICJA 4DL6A 4ELUA 3Q8QB 4F91B 4ELTA 4DWIA 3T3FA 1J9AA 4FJ9A 4RQ6A 3DLHA 4NYNA 3OYDA 8ICGA 2MAXA 3ZDCA 1MC8A 3MAQA 4Z6DA 5J2DA 4ECWA 1TV9A 3G6YA 1LAVA 2VG6A 5J2QA 2F8SA 2XGPA 4QZGA 4K4HA 5CA7A 5KFDA 5KT5A 2VANA 3DOLA 3V1RA 5CZ2A 3TANA 1XO1A 3KKSA 4FLVA 3QESA 2E4LA 4CHQA 4W5OA 4FK0A 3UQ2A 3M8RA 4I2JA 4UB1A 3HL8A 4PGXA 4NYFA 1S9EA 2R8GA 2PFNA 1D8LA 1RXWA 2PYLA 1BHLA 4EZ9A 4F3TA 5DG9A 2DFHA 4J9MA 1WNSA 4IR9A 3GILA 2V4RA 2ALZA 3C2KA 3AVNA 3IS9A 2NRVA 2A1RA 5DG8A 4RQ5A 2FLNA 4CHZA 5CY4A 4DL7A 1NK4A 4YFUA 4K8ZA 4KHYA 4FO6A 3UXPA 3KTQA 4KB1A 4C8LA 2F1IA 1QSSA 4RW4A 3SI8A 4CF0A 3OGUA 7ICLA 1JLEA 3WNEA 4BACA 3OJUA 1GOCA 2EHGA 3OYIA 1JXLA 4RG8A 4HUGA 4CFBA 1SV5A 2JEFA 4PWDA 1ZETA 2PFQA 4DQRA 2UVWA 4CK3A 4KN7A 1W9HA 2V9WA 3RWUA 5KFZA 1D8YA 4ED6A 4CCHA 2BGWA 3MECA 5F9LA 1HJRA 4B3OA 5J0YA 2JZBA 4QWBA 2OPPA 3OY9A 3U6FA 4LZGA 4CEFA 1KVAA 1BIUA 3EW9A 9ICTA 3UXNA 3KHHA 2DPJA 1LAWA 1RBSA 2HW3A 4MF2A 1RYSA 2DTUA 4LZDA 5KFIA 2W9BB 3V9UA 2OYQA 5HP1A 5DLGA 4MFBA 1VSDA 2PY5A 1O1WA 2BCSA 2RKIA 3GQCA 4Q0BA 3EYZA 1NK7A 3K58A 1RDBA 1B9FA 4DOCA 1NK5A 1RCHA 4ED1A 1RNHA 4RT3A 3DLRA 4B9NA 3N4MB 4I2HA 5KFXA 3MR5A 4DSIA 3CYMA 3MGIA 4PUOA 4CIEA 3TAQA 3I0SA 3C2LA 4AH9A 4J2BA 4QZBA 8ICAA 3ORYA 1GOBA 1NK8A 3DM2A 5KG4A 3V7KA 4LH5A 4KLSA 2XCPA 3AO2A 3ULDA 8ICZA 4FXDA 1QE1A 4M3ZA 3SCXA 2KFNA 1CZ9A 4DTXA 1WCLA 5F9NA 1X9SA 5HP4A 1L3TA 2WOMA 4FK4A 4JV1A 1BL3A 2YNFA 3NGYA 1RTHA 2D0AA 2P5GA 1Q9YA 2P5OA 1NK9A 4FJXA 1VSJA 5CHGA 8ICKA 3C95A 4O3QA 1HMVA 8ICRA 4HUEA 4FLWA 1S77D 5J2GA 1IG9A 4J9NA 2HHUA 4Q44A 4OKJA 4J9OA 3KIOA 3NF6A 4DFMA 5DKWA 3T5HA 3VQ8A 4YXMA 3F9KA 4Z6FA 3MFIA 4O3NA 1L5UA 1RT3A 2BKEA 4N41A 3VQCA 3QLHA 3QEBZ 3OYEA 3L2QA 1S1VA 4ECVA 1SZPA 5BPCA 8ICFA 4PQUA 3BQ1A 3SQ2A 3BQ2A 3RTVA 4QZFA 4EYIB 2VG5A 2B4JA 5C42A 5J2IA 2IA6A 3RH6A 4RQ4A 4ECTA 3RB3A 1HQUA 2BPCA 1D9DA 4ECSA 1ZQJA 4KITB 2XRIA 3RMBA 1QSYA 3K4GA 2FMSA 4CK2A 1C1BA 5J0UA 5EWGA 4LVSA 5IIKA 5CYQA 1JLAA 3ZD9A 1VSHA 4KHQA 4Z4HA 4ZHRA 1JLFA 4UQGA 1NK0A 1A76A 4YMMA 3QEAZ 2FBXA 4J9SA 3T5LA 1ZQKA 1YVUA 4FJLA 5DGAA 4HTUA 4RNOA 4I29A 3LANA 3LP3A 1EKEA 3C94A 2YKNA 1TK5A 4BXOA 3FDSA 3HW8A 3VQQA 1JXBA 5J2FA 1YTAA 1QHTA 5HRRA 5KRTA 2I1QA 4CJSA 2HHWA 1C0MA 3ZT0A 2B5JA 5JUMA 3TAEA 1RILA 3SUQA 3UXOA 4IQUA 3LWMA 1QQCA 4CJ5A 1WSFA 4PY5A 4MEXA 4FM2A 4PGQA 1RBTA 7ICIA 1V9PA 3Q8SB 3KLHA 1T4GA 3L2VA 5IIOA 2HNZA 1XU4A 1Z3EB
chains in the Genus database with same CATH superfamily
4OPKA 2QK9A 4OKEA 1RAOA 2W11A 2QB0B 1OS5A 2K7KA 1S9GA 3K7RA 2IAJB 1PC4A 5CE3A 4ZOSA 4XRHA 4FYVB 4OKKA 4EEKA 4CERA 1V4SA 4OZLA 1U2RA 1FRHA 2DYAA 3FFIB 2FSJA 5FPNA 4U67L 2Y9UA 1FJGK 3U9DA 1NB7A 3CJBA 5ALPA 1N8RO 3N9UC 2ZTCA 4OYOA 4ZTFA 9ICVA 1RU2A 1XR5A 3QNOA 3O3HA 2C3MA 5GADU 2YY3A 3O5BA 5H9FK 2ZBQA 2CN1A 3BR8A 4J9KA 2F7VA 2BMBA 5CABA 3LO3A 4AHVA 4XDDA 4X4NA 1Y97A 5JVGQ 2BQUA 4M5JA 3S41A 3KWGA 4O0IA 1QVFM 4H8KA 1ITPA 1HL6A 2ITMA 2HAFA 1UQVA 2LVWA 3L4BC 2L41A 2N4DA 2VWJA 4PWUA 2RHSB 4IJNA 1QZ5A 4B9TA 1Y9OA 2EQYA 2GNKA 1CJUB 3AXMA 3N01A 4KGXB 3EM1A 7ICHA 4ED2A 2ZE2A 4K4WA 3OYFA 4IKFA 3NVKA 1XSNA 1HWKA 3GIIA 4WFXA 3TW0A 3PSPA 3VOVA 1MROB 1RWWB 2ACMA 2E8OA 3UMCA 4I7FA 4KJIA 4YQWA 3RB6A 2KE7A 2KM8B 2KG1A 1D8ZA 3A13A 5JLHA 5ETNA 3C6TB 3P5BP 4RW4B 1UFLA 2C3PA 4P73A 5AQKA 3I8DA 3W8PA 2D7SA 2K1RA 1YDLA 1NGGA 4MFCA 3S9HA 3RBEA 1A5XA 4LFCF 3U3YA 1KVIA 5AI9A 1KEJA 3EL2A 3H0LB 4M1KA 4LF5F 1S6UA 4XH1A 4RUAA 4KLTA 3PZPA 4C2MA 3VQTA 3LP0A 3ENWA 1ZM4A 4DS4A 3L0QA 2Q3SA 5HATA 5J1EB 3SPZA 2NPIA 4AL5A 3RVCA 2A10A 2DWQA 3H5SA 1VSKA 1NNLA 1H38A 5J0RA 1GT8A 4WPAA 3GV5B 5CJ7A 2RMLA 1PIEA 2K2PA 1MN9A 4LF5J 4DV0K 2HK3A 2EVZA 2JX2A 2DIVA 4PEOA 2DY4A 2G5HB 3U8XA 3H5XA 5I42A 5THWA 1NLVA 4DPTA 1S57A 5CZXA 4EP4A 3H46O 2FHKA 2DKXA 1OY8A 1YTYA 1ZQBA 4DTUA 4WYWA 5AK5A 1VSIA 2GMLA 1FXXA 3QIOA 3S7RA 4FF1A 1GTHA 2GX9A 4QWCA 3VHQA 1VGYA 4FJGA 4O8UA 2DNHA 3EVMA 2XNRA 4KTQA 3RSEA 3TVZA 2KIWA 3TVYA 3Q0AA 1ZAVA 1U2VA 4M3UA 1JLCB 2FC0A 2QRRA 1K8AO 2BCRA 5C2DA 2DGSA 2H3ZA 2ZJ5A 2C3YA 3K2PA 2F4FA 1U48A 1CJVA 3IRWP 3VZIA 2FHMA 1P6TA 1Q86T 3N4PA 1UWBA 3I55S 1JXEA 3DWLA 4A47A 1MWZA 2XGQA 4LF2A 3CTRA 4Y2AA 4RCHA 4R8UA 1UPMB 4CJQA 4BC5A 3F5TA 2AF6A 5CQGA 1VC5A 2FF3B 1Q7YT 1WEYA 4FK2A 4BR7A 2CQDA 2KMDA 1BIZA 1JI7A 4JLHA 2RQ5A 2QWRA 2O8FB 1NLKL 2AJ0A 1CBKA 1IBKK 1VQLN 4PAAA 3ZSWA 3NL0A 5ALTA 3RFAA 2R2SA 4UW9A 5H2FU 4ID5A 1OH8A 2NXNA 4JI3F 3G2XA 4I2GA 1C0UA 1OW5A 4FPRA 1U6FA 4UOCA 1RGIA 4Y0WA 1UKUA 1KC8O 4GKJK 5EOZA 3A5OC 3H08A 4Y65A 1RAGB 1ILYA 3IM8A 3Q8MA 2KKHA 4RPFA 4KLEA 3V7JA 4JKGB 4XIUA 3QU4A 3UFCX 1NG9A 2UXCF 4M41A 5FIIA 1RTIB 2LCWA 4CW7B 5AQYA 3MEEB 1N5TA 2OCEA 4KLHA 1VDHA 2AEJA 2P9KB 1HUZA 1BPYA 3UE2A 1KOHA 3DLLQ 1UPPA 2VG5B 1TKZA 4ES1A 2CRLA 1YJVA 2X7IA 3DU6A 1QJHA 3IBWA 3D2EB 2E7WA 2UXCJ 1IG6A 2WF9A 5LT5A 5KPRA 3NTUA 1IKWB 2EC2A 7ICJA 2QM1A 1PBAA 4CLTA 1FESA 2VOPA 4PHEA 3O1WA 4QR0A 5CYQB 3ISZA 4CJPA 4DCHA 1JLAB 4F3OA 2PD1A 4RR5A 3ZDDA 1I3AA 4AHUA 1ASUA 1IQZA 3ISCA 2W4CA 3FEYB 2YNHA 4CJVA 4Y2VA 1RBAA 1CQMA 1DK2A 1LWCA 4MIWA 4J9VA 1FVSA 2FY8A 3MR7A 4FW2A 3QWPA 1XQIA 4O23A 2JL9A 2PEBA 5DG7A 4OL8A 4BRFA 2CGKA 4HHTA 4TUPA 3I76A 4FWOA 2OTJN 1IXKA 2ETJA 3CF5L 3CMES 3JPSA 3SV3A 2JMGA 5M2RA 2HZVA 4OZ1A 1ITGA 2BE2A 3PRVA 3AA9A 1FFWB 4L8RB 4G3IA 1NMDA 3I5CA 4W4MA 3VEYA 1U24A 2AXTU 1S1TA 3IDWA 1FRLA 4ID8A 3DDNA 5AQOA 1HEKA 3G10A 2HF4A 5DB9A 2BM1A 4NCGB 4QIGA 1L7NA 1SC6A 4WP3A 4CECA 5ALQA 4ECUA 3WX8A 3OYJA 3UQSA 1IBLK 2E9TA 4R0EA 4JI2F 2NO4A 1DTQB 4FZVA 3CQXA 5AKKA 4ED8A 1DY3A 2KI2A 8ICYA 2EC0A 2RAQA 4XO0A 4KLQA 3FSXA 2M70A 4DL5A 5AQZA 2VODA 5KI6A 2E1EA 3VPZA 3DHXA 8ICXA 1H2VZ 2ZBCA 3OA9A 3BZCA 3JS9A 1ICEB 3CCWA 3M6WA 2V2ZA 4J9QA 4JI2J 1ATNA 2YKMA 1GQEA 1FD2A 3P4IA 9ICXA 5AQGA 3THPA 1NGIA 2D69A 5BOLA 4DL2A 6AT1B 3HBTA 4M5MA 4YB5A 2FJBB 3M1VB 3L09A 3A0BU 1VSEA 2O3DA 3FZBA 2A1AA 2B7CB 4JKCA 2MDAA 1YIJS 1VCTA 2OEJA 3KHGA 3RJGA 3QGGA 2VGNA 4CDGA 1TUVA 2P9IA 2JC1A 1FD8A 2KN4A 1HBNB 2NUHA 3GZFA 1JJCB 2QWMA 5HMMA 2CYYA 4L73A 2IBKA 2FZKB 1NOZA 4OIXA 1KOOA 3K75D 1F2HA 3ZSRA 3H2VE 3O6QA 1SKSA 1I51B 2Z1HA 3PV8A 2A6AA 2OSRA 2HQIA 3VGSA 3JQKA 1UL3A 2NV3A 1F0XA 2LFVA 2JWKA 3ZSVA 4DZDA 1NMNA 4B3SJ 1S1UB 3OR1B 3WQTA 5J2NA 1N33F 1X4EA 1IKVA 3V6DB 3HRGA 3C6HA 5A8KB 1KQFB 2ZNYA 5CHCB 3C2MA 3A8KA 3GIMA 1J53A 4O4GB 8ICOA 3G86A 4C1NI 2GFFA 3NH1A 4EMDA 3CQYA 5J29A 1BQMA 3ONQA 3VQBA 1LWEB 1IBKJ 3PXGa 4Z0UA 4QIWF 2AX1A 1N33J 4YDUC 1FW6A 4X65J 2YX4A 1YBTA 1CS4A 3KLEB 3ZX0A 3VQ9A 1L3UA 1A5WA 1NH8A 4GKJJ 4LF7K 1KQSM 1L7PA 2BDPA 4NV0A 2F3JA 1LFWA 2EFVA 1Q8BA 3WEEA 1F21A 2HMIA 2HS3A 1T44A 2ITGA 3R5AA 2Q31A 2HFZA 2YQ0A 2WVEA 2P6RA 1KP6A 2V4JB 3FZLA 4AYBD 3DEEA 3KHLA 5D8HB 3EMTA 5D3GA 4F5OA 5ETTA 3PW7A 1JJHA 4RW8B 5AQFA 4CJKA 2V0NA 3RB4A 4ZP7A 3MFHA 1YHQN 1LK5A 5IXUA 1SV0A 4UY8T 3DGVA 4RPZA 2IGIA 4Z94A 2RRNA 2PE8A 3AV9A 3JPNA 5F3TA 3D2WA 3BP8A 1Y7PA 2QFJA 7ICKA 3L8BA 3CO0P 3TADC 5C15A 2OLWA 4CHYA 3SQ0A 1G6BA 2DCLA 2MUTA 2Z8QA 1RBLA 2YHWA 3TSPA 1HNXJ 3EWAA 3VERA 4FF4A 3IR6B 3M8QB 3ILJA 4M5IA 3DLKB 2KVIA 3Q8RB 1S0MA 4NXNK 4ANCA 2QARB 2J9EA 2XBPA 4YD1A 3MN6A 1RTDB 1LVHA 2NRWA 2PT0A 1R59O 3CJRA 5LJ3Y 1TAMA 2VBWA 4XDCA 4KHPJ 4PHAA 4NLBA 3B8HA 3OS2A 4PYDA 3IDHA 1TL7A 5L38A 3KG0A 1W97L 1OJ4A 2GVZA 2OWOA 2CQ1A 4CF3A 2E1FA 3B4DA 3IWLA 3V6KA 2DNRA 2V2QA 7ICUA 4LF4F 4CEBA 4H0OA 2CQPA 4YOUA 2B7BB 1FEHA 4M95A 2QLFB 3CMAN 3U7JA 4C8ZA 3E3XA 7AT1B 2CXYA 4BRGA 3FMWA 2HZCA 3VAJA 1NWKA 4FXWA 2J0WA 2HAIA 2J9DA 3MEGA 2JVOA 4KN4A 2CIMA 3NCIA 4BGAA 2B6GA 1EQMA 3K1RB 1Z25A 1GLFO 3UD3P 1GLJO 2V2VA 2PBDA 5FLXY 4CZHA 3PO5A 1RZMA 2OPSB 3ITHA 4I27A 3C5FA 3BPDA 2ATCB 4V19S 2XMTA 4TN2A 2A19A 5LMNF 5H9EK 4UAWA 3RJHA 4F3MA 3OVSA 4C97A 5E3RA 3D3BJ 5KL1B 1RA6A 5KFWA 1Y00A 1G15A 2Z2YB 1SIZA 9ICPA 5EOYA 2F5GA 2R2UA 2W43A 3EGVA 1A5VA 2OO4A 1SV5B 2X1GA 2D4WA 3F56A 2DJWA 4CM2A 3NNAA 3WUHA 3C6AA 1C6VA 1U0SA 2HHQA 4ZDNA 5A6WA 4FP9A 4DTOA 3NGDA 2NUUG 5LMNJ 3CMQA 3BKUA 5DBAA 1HWIA 1RA7A 2BYCA 2HNYA 2WB1D 3OFFA 2KYZA 2E1PA 5IOLA 3CD6S 2E7VA 2XZWA 4DCJB 4PQAA 2VHGA 2I5JA 1KAZA 2G8WA 1NZBA 7ICNA 4C23A 3DRRA 4DQSA 5T7LB 3ULHA 4L75A 4OHYA 2HKEA 2EX3A 3MPYA 3J7ZO 3KLIA 4KI6A 3RBDA 4TLRA 2VU5A 3H98A 4JI0F 2MKIA 4PKGA 4ISEA 4JV0A 3QAUA 1YBUA 4WKYA 2OGUA 3B0XA 4YN4A 2Y0BB 3KHRA 3BV8A 2RRAA 3N0VA 2VQEF 3RZAA 3Q24A 5KFTA 3KXDA 5E79U 1T6DA 4FZLA 3MGJA 2ZNZA 3O44A 4JI0J 3MAAA 2WF8A 3DDIA 2OYYA 1UVLA 3QRRA 1ZJMA 2IYGA 5BPNA 4F50A 3IFRA 2LA4A 2VQEJ 5AKEA 1XI1A 1S99A 3OTDA 2ACYA 1PVQA 1QE1B 3J80Y 2QB0A 1KQKA 1QQ5A 2IAJA 2I7PA 3CDEA 2Z30B 1TK0A 4USJC 2CGLA 3AGKA 3MXHP 5GAEP 3H0RB 3DNCA 1RTHB 2DPNA 1YBAA 3Q2TC 3FFIA 2W24A 3CCRS 1PG5B 3PEHA 4ZLNA 3LDQA 4RT2A 4DR2F 2FJDB 2CDRB 1JB0C 3J81U 5DQGA 2XY7A 3C7NB 3QJLA 4TQRA 2ROPA 5HJXA 1N56A 1S49A 3U3GA 5BR8K 3P96A 4B1XB 1BNOA 2MMYA 2W7PA 3HI9A 2JV3A 3DOKA 3OUYB 1NEEA 1ZM2A 3SENA 3H4DA 4P2SA 4DU8A 1NZAA 4NX9A 1NGDA 3QEPA 5ALIA 3SLCA 4GKKK 3QIDA 1KFSA 4X62J 3LK9A 3NVYA 4DV4F 2G8VA 3OTOF 1F6TA 4O0JA 1XMQF 2UXDK 1RDWX 4YR3A 4F92B 3OSPA 4DX5A 4DHVA 3K17A 3T6JA 2UVRA 1FNMA 4FWPA 1HQUB 1CJUA 2K3KA 2W8KA 1H7WA 5DDPC 2BUPA 4DV4J 2R18A 4K7QA 3AB4B 1XMQJ 1MROA 1SXEA 4CO2A 1K6YA 1K8KA 3C23A 2PMZD 3TZYA 1ZQVA 3ZSYA 2FVQA 1QS4A 1LCUA 2DGWA 5HRPA 1X5PA 3V6JA 3ILOA 3C6TA 8ICEA 1UCVA 1X4FA 1Y5LB 4KLUA 4ZP8A 4E0DA 5F0XA 2AJ2A 3GIJA 2IVNA 4PL7A 3J7AP 3P4UB 4Y3CA 2KDOA 3VAIA 2A1BA 2Q66A 2EEYA 4F36A 3IA0A 2CWXA 1DGSA 4DV5K 5J1EA 4L72B 1TYQA 4I4BA 1WNEA 1ASVA 1RLCL 2GA7A 2U1AA 3CIZA 3NP5A 4XQ8A 2DEIA 3QBXA 1C7YA 4K4GA 4H5VA 1WF2A 2B5JB 2E29A 2F3NA 3D6MB 2O67A 2RN2A 1SL1A 8ICWA 4EX6A 3NAHA 3BYRA 4NLXA 9ICWA 3N4WA 4KGZB 3SMVA 2G8HA 2AW0A 4ZPDA 3QEWA 2NR0A 5F8GA 1YAGA 5CYMB 4PHPA 1J97A 4EBCA 2NNWA 4L3NA 4U7CA 5B0AA 4DR5F 1NI3A 4AL6A 5ALRA 1SL0A 1VQON 9ICMA 4TUSA 4QR1A 1HI0P 1JLCA 4YEAA 2WW4A 3WC2A 2HRYA 4O0NA 3DXMB 4AL7A 4P2XA 5C7PA 2HZAA 3RYLA 4MKYA 1CZBA 1T8EA 3VVUA 4ALZA 4WP8A 2Y0SC 1WEZA 2P6TA 4DR1J 1U09A 4KHUA 1RWPB 2IVYA 5C2GA 4DR5J 1QD1A 2IM1A 3UPFA 5DBBA 3ZX3A 4QYZJ 3QU7A 4GXIA 2IC3B 3E01B 2WTUA 3DI6B 3HDSA 3KNAA 5KFKA 5ITHA 5ALZA 1FRJA 4GC7A 1X4DA 4AE5A 4F04B 1RUSA 1CG2A 4R79A 5JICA 4FJMA 4JI1F 2KD1A 3ZCMA 2DHAA 1FO4A 2O8FA 4UB3A 1FKOB 1V5IB 1IR1A 2FGCA 1FWPA 2A1SA 2GV1A 4CZJA 4FN5A 1TVAA 1Z1ZA 8ATCB 2Y0SF 5IS2A 4NLCA 2RF2B 1V97A 4Y28C 1Q8LA 1EWRA 5K8NA 1YJ7A 4WFAL 2VPYB 5E7OB 1ZBUA 4LFCK 4JI5F 2F9WA 2DR5A 1F5BA 1NU4A 2DNYA 4A61A 1NBWA 4JI1J 3QZ7A 1RWKB 2ZUDA 2VBZA 4JKGA 1WKJA 2PEHA 4YB6A 1WTBA 4OJPA 5HR6A 1RTIA 1VHIA 1VQ9N 3A8YA 3MEEA 1IVZA 3MDFA 2ZJRQ 4F4WA 1TELA 3W66A 1Z05A 1OYEA 1NRKA 2E2PA 4IR1A 2P9KA 1GX6A 3GLJA 3ZZZA 4M04A 2E5HA 4JI8K 3PSFA 1MMDA 1Q18A 1BCMA 4RPYA 5KGXA 2V8PA 4C6AA 2WBNA 4ZPVR 3RR7A 3K5NA 1CXQA 3S3NA 2E5IA 3T9ZA 5DM7Q 3O1BA 4CP5A 1FRKA 3VAKA 1H74A 3D2EA 4GV3A 5ALDA 1WHYA 1N54B 3CCSN 5M2UA 3TACB 1IKWA 3P38A 3ZT4A 2BQ3A 1TKXB 2Z1JA 3D4JA 3PSIA 2EG2A 3WK6A 3CJ8A 4DR3K 4GKKJ 2BH1A 3SBTA 2BKNA 5KAKA 3KD5E 2VB6A 9ICHA 1H3DA 4YCXA 1RAIB 3W63A 4DCCA 3QEXA 2MZRA 1NBEB 2GVDB 4YOYA 4ZVFA 3HVTB 1N63A 4ZITA 1J5EF 5KFEA 2BR0A 1NKBA 5BJRA 1SC3B 3OPKA 2JFDA 1R0BG 2XLIA 2G4BA 4YB7A 5J2HA 2WFAA 1NHVA 1XR7A 9ICUA 1RCOB 1AT1B 3CVKA 1REVB 3MTJA 1LNQA 5K20B 2AU0A 4OJOA 3UE5A 2P2CB 3LQVA 1WI6A 2EFQA 4QS7A 4LUBA 1S76D 3T7ZA 2HI0A 2W03A 1VSMA 4NCGA 1U49A 4HL9A 4I2AA 5GTHU 1J5OB 4DF8A 2KNJA 4L6V3 4Z4IA 1DTQA 4JI3K 3PDNA 4JI6F 2A1JB 1U25A 5B8HA 2Y1JA 4OV1A 3AJ2A 4JEPA 1M5OC 1NNEA 1CRXA 4WJ3B 4DOZA 3DXKB 4Y2JA 2UU9K 1FE0A 4QNLA 2AP1A 4E7HA 2F40A 2DT9A 4DLGA 3OFHA 3V4IA 4Z7CA 1UW9A 2NYIA 2BE7D 1VBYA 4JI6J 4DL4A 3SQ1A 3SMPA 3NAEA 1XERA 2GWSA 2LXIA 3TQEA 1B3TA 3ISBA 1HJPA 2JOQA 3GJRB 3EVOA 1R89A 5EHHA 1R8AA 4KTWA 3M1VA 4XK8C 4OX6A 3VCDA 4A4JA 3KMQA 4O9MA 1HNVB 3WNGA 2CJ9A 2BCQA 1HBNA 4QAGA 2PSZA 2DBYA 2VFRA 9ICBA 5HQLA 2QWNA 3CCES 4CYUB 1WSEA 2LECA 2DH9A 1EIYB 4ZLPA 2GIRA 1ZRNA 5L1JA 3NDKA 4OYWA 3C16B 4IO1A 3DLGB 2UP1A 1UT5A 3OW2R 4PPDA 1U04A 2FSKA 1FKPB 4XA5A 2LA6A 4FWRA 5KFPA 1KDHA 7ICMA 4F9OA 1M5HA 3EUB2 4EELA 1S1UA 3OR1A 2OUGA 3GR0A 4A57A 3WBZA 2Q79A 3V6DA 3D1OA 1XSPA 2ZGYA 5A8KA 1QM9A 2YB4A 2X3GA 1RBVA 1FJ7A 2QG9B 3HHLC 4O4GA 2J6TA 2GWJA 3IP0A 1Q9XA 1X3MA 3D3CJ 3UIQA 1PAEX 3C19A 3HO1A 2MQQA 1LWEA 3OVNA 3PW0A 3D45A 3R8EA 1UT8A 1JROA 3VTIA 3LPEA 9ICGA 1UVJA 1VFJA 5EE3A 2KZ3A 3TOQA 2GQQA 1S5LU 3DMJB 4PKDB 2DH8A 4DZ6A 4K4IA 5BRDA 5FD1A 2B9WA 4NOHA 1RAEB 1TL1B 4RW7B 3AA2A 2KG5A 4F4KA 1CJKB 4B1WB 3N6MA 2UUBF 3RMCA 1G7CB 1NKEA 4ZVOB 4M3RA 4QPTA 5KL8B 2YMQA 4UBCA 1DLOB 3HHKA 1DTTB 1WCNA 1HPZB 2UVUA 1C2PA 2V4JA 4UOFA 1RHMB 1Y4ZB 5T7BA 3M1FA 5KOXA 4A8OA 1F5SA 4JKBA 2OIHA 5KOWA 5GMKa 3TAGA 5J2EA 2ASMA 1U1MA 3KD1E 2Q1LA 2VDHA 3PMLA 3ZZ0A 5GAHP 1XMOK 4O3SA 3MPWA 5AIBA 3KFWX 1MWKA 3ZETB 1NB2A 3NGZA 4OJ6A 3HSJA 1YTUA 3WK5A 4M9NA 5JTIA 1KD1T 4RKUC 4O4RA 4BRLA 1P9QC 3QBCA 2HGNA 3H0MB 2V9KA 4FM0A 4C9DA 1ZOLA 3DLKA 4LRFA 1QAYA 1H73A 4GO7X 5AQPA 4BGBA 4DPWA 2AJFE 1IM4A 2QARA 1URNA 2HHVA 4D3GA 2YNIB 4FS1A 1EB0A 1RTDA 1SJ3P 2MJNA 1WN7A 4LBHA 1Y3KA 5AI8A 1NDLA 1VQLS 2KXFA 5DK5A 4OYIA 4F91B 5GAGI 4DWIA 5JVHQ 4FJ9A 4RQ6A 4WFBQ 3TPQA 4RWWA 2MAXA 2F4VJ 4NO7A 4IC9A 4ECWA 1ECWA 1E6YB 3M1YA 2R42A 1U1LA 3FZFA 3QJJA 1NPKA 5FDLB 3I0RB 5AM0A 4K4HA 1YI2N 2BACA 1F5CA 4QIWD 4UZCA 2VANA 3DOLA 4ZCIA 1NM1A 4A2AA 5CZ2A 3HJVA 3TX0A 4CHQA 2LKZA 3TX8A 4KYZA 2QEXN 3HL8A 1KKXA 4JKAA 2R8GA 4TVAB 5AFUA 2KG0A 2HRTA 5AI0A 4M5LA 2EAPA 1XR6A 1ZH5A 4CBXA 5F2RA 3D54A 4MYUA 2V4RA 4RO0A 2QYGA 2AYBA 4IFEA 2WSEC 2KK0A 3JYTB 4BLGA 4TY8B 4GV9A 3G71N 4DL7A 2LYVA 1NK4A 4IG3B 3UXPA 3SSSA 2F1IA 1TKTB 2M52A 4X4RA 4CF0A 3OGUA 5AQUA 3AMZA 2GJ2A 1XC3A 4LSLB 4DPYA 3OYIA 2PA3A 1UMJA 1JXLA 3FBEA 4HUGA 1SV5A 2JEFA 3M6KA 4U67Q 1RHKB 4DQRA 2WONB 4FYXB 2DQNB 2OTJS 1JCEA 1KBUA 4EO8A 3L7PA 1VC0A 3SFUA 2DKZA 2ZH5A 2VFUA 3WX4A 4RJVA 4ZJLA 2CJKA 2DCUB 2M2BA 1UTAA 2Z2MA 1HJRA 2FHJA 2X1AA 1X4HA 2JZBA 3U6FA 2MZSA 4HI1A 4OLPA 5T7LA 2AA4A 3PIOL 5HSPA 3RGIA 9ICTA 2J9DE 3OBWA 3MM5B 1HYSB 2L48A 1RBSA 1X6JA 1RYSA 2DTUA 5KFIA 3QYYA 4H4OB 2ZH3A 1FEZA 4WJBA 2UUAF 1VSDA 1O6XA 1O1WA 2P9NB 2BCSA 3GQCA 2QWOA 2ZFHA 4AFFA 4CLKA 2H5EA 3K58A 3JXOA 4CNQA 1Z2LA 2CH6A 1U8SA 2QLTA 1RCHA 4RT3A 1TFYA 2KVSA 1UEUA 3RJMB 3MR5A 4DSIA 2UUCF 4NI2B 4LF4K 4Q2LA 1XEZA 2MKSA 3ENAA 3H90A 1L7OA 3WXJA 5ALOA 2DITA 1HIWA 4J2BA 3IRXB 3BN4A 1YZ6A 1SB6A 2JVRA 3V7KA 4ZIWA 4LH5A 2ZUAA 3ULDA 8ICZA 2GO7A 1S1WB 1QE1A 2O8CB 2GOLA 1X9SA 2WOMA 5HP4A 3D67A 4CE6A 2ROGA 2C3UA 2GUPA 2UUCJ 5BXIA 2ZHAA 3BF3A 3LDPA 4GY2B 1RTHA 4YDXA 3TZXA 5HLFB 2XB2D 2P5OA 1NK9A 4FJXA 3TO8A 4FLWA 4HACA 2YHXA 1IG9A 2XG8A 3MWBA 4J9NA 2DD8S 5ALUA 3GCWP 4US9A 1R0CB 3NF6A 3WK4A 2O01C 3OUYA 1B64A 2MY8A 3EZUA 4Z6FA 3ZFVA 3MFIA 5ALLA 5LJVA 4O3NA 1L5UA 3R6LB 1VLYA 3BKFA 2ESEA 4DI6A 5E3AA 3CCVS 4N41A 3VQCA 3QEBZ 3L2QA 2GGPB 4IL6U 8ICFA 4DJBA 3ZZOA 2OSQA 3EGZA 3SQ2A 3V81B 1K9MO 4YY3J 3D1HA 3U27A 3SMZA 1G3OA 2VFVA 4BROA 4ILHA 1FXRA 4NYPA 4H4KA 4CZEA 3RB3A 1HQUA 2BPCA 4X4QA 3Q7BA 2P5VA 1D9DA 3CWJA 1XIQA 4ECSA 3W2VA 4IFYB 5CXTA 3BEXA 4G9BA 3K4GA 2NYHA 2ZM6F 5J0UA 4LVSA 5IIKA 3IFEA 1Q78A 5BRHA 4BG8A 1H6KX 4KHQA 1P90A 3POTB 4WQ5A 4PG7A 3WKBA 3QEAZ 3WKEA 3A3OB 3AH6A 3DHWC 4UT4A 4FJLA 2W2MP 2RSQA 4Y2XA 1PVPA 4GRSA 3MHYA 4CLPA 3LP3A 4DR7K 1H1VA 2MQNA 2KM8C 1ZBSA 2HFOA 1EARA 1CQNA 1ZC6A 3NMAA 3R1XA 5HL7Q 3FSYA 2Q4TA 1NXIA 4OZ0A 4ILGB 4P0PB 3EO3A 2EK6A 1YTAA 2EFNA 2UV8G 1BA1A 3NS6A 2JLGA 4BCAA 1YHQS 3I5AA 4Y6IA 1EETB 2G2ZA 2QL5B 2R2TA 3P31A 2B5JA 2ZHOA 4E8UA 4CJ5A 2CNOB 3IXQA 2QJ3A 4DR2K 3MCMA 2NO5A 3Q8SB 5AQNA 3BQ7A 1T4GA 2HNZA 2DNPA 2QIFA 1A6SA 2ZVIA 4A8QA 3BZKA 4JB8B 5CYMA 4RPXA 3OHAA 3TEHB 1P8ZA 2P6SA 4DV6F 3T1HF 1BI4B 1N32K 3AQPA 2V63A 1B7YB 3ID6A 1SUQB 2HWHA 2OEKA 3DXMA 5ALXA 5IV3A 2DR8A 2AEMA 5J0TA 4W5NA 2G13A 3OTOK 4Y2QA 3EZOA 4NY8A 2CQHA 2V8VA 4DV1J 2ZZMA 1CC8A 5L1LA 2KZMA 2EK1A 4DV6J 3ZT1A 3JQJA 1NAQA 3G6EN 4BVPA 1VRQC 4WQ4A 3THWB 3H7HB 4KT0C 2DF4B 3E01A 2IM3A 3DI6A 2I1RA 1F3VA 4BR2A 1X8DA 1NOYA 3CMAS 2DXEA 1U45A 4KGKA 1YJ9N 2XHBA 2RJZA 3R7NB 4DR4F 1C4CA 3S6EA 1WB9A 3ILIA 2WCXA 3HVAA 1FKOA 4ED5A 1YZ7A 1R6YA 4WZMA 3E9OA 1HR0K 2KHCA 2RF2A 3IAS9 1BO5O 1QTMA 3I87A 4UAYA 1N8RT 3NG8A 1YRUA 1LQ9A 3D7EO 2CPEA 1JRPA 2EWHA 4C3LA 1QUVA 1T9TA 1DRZA 4DR4J 1HBMB 4CJLA 1R3NA 4K50A 4PZOA 1B7FA 3UI3A 4MFAA 3O5TB 4KGMA 3SFGA 5AE1A 4LQ3A 3HX9A 4OJ1A 3SCKE 3O0FA 4EFHA 1M5KC 2XMWA 3QE9Y 4CT9A 1PKUA 3T5KA 2GCFA 5GADP 4Z4GA 1QQ6A 1ZYQA 3IP4B 4XH5A 2BJEA 4DG1B 2NREA 2B9XA 2B51A 2MB0B 4GMJB 1M90O 3LH2S 2HF3A 3R6MA 4FJIA 3VN5A 3MCOA 5M1KA 4BGDA 3A3PB 4F67A 2Y1IA 2BA9A 3IMXA 4IOAL 3R7BB 2KT5A 4HUFA 3IBFB 5I9EB 3RRGA 3MEKA 2M3DA 4MO5A 2YKPA 7FDRA 3B54A 3CG7A 1U2CA 2BTFA 4F0MA 3G8SA 3WXMB 3JTOA 3OYKA 4KLIA 5D46A 3TARA 3I32A 2GVDA 4C8KA 4B3OB 4DTNA 1BWVA 4S0MA 3QSIA 1RM6C 1Z00B 5LSRA 5GAEU 3QUTA 1VQ4N 4KBIA 1EKRA 3TTFA 4N5SA 3KKAA 5DBCA 4F5QA 3TAFA 5ETPA 2NUBA 1REVA 1IM6A 1TL5A 5IC4B 4DDFA 3RW7A 4DX7A 4LY7A 3IM1A 4X4TA 2NYVA 5J0QA 1KVCA 3UCUP 5D4LA 1XBWA 1L3SA 2E8AA 3AVKA 1X5TA 1J5OA 3LDLA 4KH4A 4M45A 2AGPA 3TWZA 3NUQA 2W25A 4US8A 1O13A 1VR6A 1B9DA 2A1JA 3G6VA 2BDUA 4JI5K 2HLTA 4JKEA 2FB0A 5DM6L 1IXRA 1O08A 1FO1A 1B0PA 1SKUB 3T79A 4J9RA 3B6OA 3DXKA 2XS2A 2MQOA 3T6BA 4C0ZA 4LF9K 4JK8A 4BR4A 1PK3A 1HHQA 1K8AT 1HWLA 3MM7B 4CBUA 2CPJA 3AJDA 5KFGA 4KLGA 2N1RA 2R7SA 2YMMA 2CNNB 3ZZRA 4MKBA 5AI5A 2C2MB 1VQKN 5C0YA 2J8SA 4CBWA 3CJ4A 3MMAB 2IDOA 4GIBA 1VOMA 5I3UB 4CDIA 1HNVA 1L7MA 4BRAA 4GFJA 3SMSA 2KKVA 3V9WA 2GIQA 3KZBA 2MSSA 2GHVC 4EGLA 1AYEA 3C16A 4OJ3A 3CFRA 2XO7A 8ICSA 1GTEA 1S72N 4CTAB 1W0HA 2K60A 2RHFA 1FKPA 4I0WA 1BUPA 1J5EK 3OTEA 3UD5A 1KC8T 3NH2A 1D3WA 1FKAF 1IWGA 5ALJA 3EUNA 1AZSB 1SH0A 4GMKA 3C21A 1QDUB 3TZWA 1H98A 3S8SA 5KFYA 5B7WA 2LEAA 4H0XB 2O1PA 5KFLA 4E1NA 2BOPA 1NDPA 3BN7A 5KFRA 1HYVA 4F2RA 1VJWA 4JI7K 2X1FA 2I9SA 3MC1A 5J0PA 3DMJA 1URRA 2E5LK 3NOGA 3CJQA 4O3RA 4DFJA 1R6VA 4QZDA 3M8SA 4H5WA 4RW7A 4RBVA 4HHJA 2QTDA 4HCCA 1CJKA 4DLEA 3NKYA 2LDYA 2XM3A 2G09A 1ZQXA 1ATSA 9ICQA 2IOCA 5F8MA 1YLXA 3JTPA 2EKYA 2B4PA 2W40A 4B3MK 4M3XA 1SH2A 3V9ZA 3I6PA 3CMEN 1VK3A 3SUOA 3AVIA 3SD7A 1DLOA 4USHA 1Q16B 4ID1A 4XTTA 1DTTA 1HPZA 5F8HA 1RT4B 3OT9A 4ILRA 4Y2IA 3FRZA 4FLYA 1TAQA 4O3MA 2C1EB 3UWTA 4YOEA 1VQOS 1FTCA 2BXJA 2BJ9A 2CPXA 2W2NP 1ZAXA 2R2RA 4CJUA 4DSLA 2RRDA 1Z19A 3CERA 2MZJA 2QKBA 3M3ZA 2FHJD 5ETSA 1LKYA 2O66A 3CUNA 4F5RA 4JD2B 4M6WA 2UVVA 4C0HA 3OYLA 2ZH7A 1WHXA 1IBMJ 3OPXA 4I6MB 1ZQTA 2VYPA 1K5OA 3CPEA 2VF3A 1Q81O 2QKKA 5IIIA 4IO8A 3LTOA 4KV8B 2E5GA 4YR2A 2IMWP 2J6SA 3PO4A 5D77A 4H4MA 5CP2A 2HCFA 4CZCA 1V3SA 3AVGA 1SAZA 3K1ZA 1WUAA 4BC9A 2RQCA 3QX7A 9ICEA 3MI7X 5F8LA 1BDGA 4GNIA 4BC4A 3R5CA 1ZQAA 4JMUA 3N28A 1N0VC 4QOTA 4TKTA 3ZSXA 4JN4A 2GJFA 2ZKUA 5CHIA 3V7LA 1E6YA 1R43A 2HK2A 1VQ9S 4LF8F 3UB5A 4MKVA 5TZVA 1U9LA 4OGEA 2K89A 2ASLA 7FD1A 3WU2U 2YWGA 1RDRA 5TKWA 2MTLA 3A5NC 2VGMA 4TY9A 2LEBA 2QMUB 1ZQRA 2UUBK 2ISOA 4LSNB 2D8CA 3NGSA 3PRDA 4Y00A 4TSXA 1OY9A 1SKRA 4P7TA 1ZQYA 4I68A 4LF8J 1ZD5A 3CCSS 5KNIA 2GQ2A 2ZH8A 2H5IB 2B21A 3NRBA 1G99A 3JYTA 5KG5A 5FPDA 3S3MA 4OI4A 3HP6A 4TY8A 2JRSA 4PXCA 2R7WA 1REGX 2OPRB 3QNNA 3FCWA 3JSMB 1HUOA 3HZEA 3CCJS 4A8WA 1RKJA 2ZH1A 4DF4A 3KZIU 2NQPA 1ULRA 4V1Ak 4LSLA 5HMYA 3UDLA 1GXTA 4JAXA 1MQ2A 3CP8A 5C2FA 4A62A 1RK8A 4F72A 2RLTA 1L3VA 2H65B 4JRPA 4CEOA 4RWTA 4EWTA 3QETA 2D1KA 1WWHA 2WONA 1WTFA 5KG0A 3LDSA 2IDLA 2K8BB 4LF1A 4CF4A 1M1KO 3GJSB 3VALA 3HZGA 2EBEA 1SQEA 3HK2A 4I6YA 2F8HA 1N36F 1EWQA 2BE9B 4EBEA 2Z58B 1S22A 3VEZA 2HHHF 1HYSA 2HMXA 3CW2C 3WNHA 3CM6A 3W2WB 1JJ2M 3V9XA 3T1AA 1NJIO 2PDAA 4M5DB 1KAYA 5IWAK 5IILA 4BDYA 4KLFA 1X40A 4H03B 2KH9A 5F8NA 1F2GA 2N4CA 1U2VB 1JLBB 2P9NA 1JXVA 3L4QA 4JYAK 3M8PB 1N36J 5E41A 4OYPA 2H3FA 5E3QA 2FC9A 1BPXA 2RQMA 1CJVB 1VDVA 1ZQIA 5E0OA 2KICA 3FBFA 4R0JA 3VQAA 3O9RA 1B22A 4NI2A 4NLQA 4HKQA 1RWMB 3EE3A 3IRXA 4UOHA 2B4OA 2KO1A 3FZHA 3NVZA 2FTRA 3HULA 2E7XA 1JLQA 1S1WA 2O8CA 3FEXB 3HPHA 4YHHF 3MR6A 2P6UA 2M9KA 1BQXA 4RQ1A 4KB7A 3DDHA 1S59A 3JPPA 2NZTA 4TNOA 5HLFA 2ATQA 3W9HA 3R9LA 2RU3A 2VG6B 3NH0A 2GLEA 4DOBA 2VJUA 2OH2A 5AR0A 2YBVA 1SC1B 4B1ZA 2AQ0A 2LYBA 3G96A 2I7NA 2AZ1A 4YHHJ 2G5IB 3RB0A 3CI5A 1I1GA 2Z1IA 3J7YI 1B43A 4Y2YA 3KWIA 2MQLA 5CA5A 4HTLA 2ZIVB 1WF0A 3T1YJ 4Z4FA 2FHOB 1YJTA 3A0IX 4PPZA 3NHGA 1RDUA 2J7KA 4DTJA 1MMLA 1TKZB 4KLLA 2GGPA 1I94F 4DUYK 3ELHA 4KKOA 3TR5A 2P9EA 2RH3A 3IS9B 3QXGA 3VTHA 4P4OA 4LREA 2E20A 2RUSA 3VGLA 4OI2A 3V81A 2ASJA 3N4QA 3LA0A 4ZVUB 3OYAA 3NY0A 2RT3A 4P0QB 4JP8A 1OPZA 5A8WB 2PC6A 3VQ4A 1T7PA 2P9SB 2P9UB 2KSOB 1TUYA 4CFDA 3P49B 2UXBK 4IFYA 3EEQA 2DISA 1I94J 1TFRA 1DHMA 3UO0A 2ILYA 4C98A 4PWDB 2IHR1 3UMGA 2E2QA 3VAHA 3OBYA 3WKCA 2MA1A 4ZLJA 2R7UA 2VV5A 3ZTQA 3VF0B 3R2CJ 5D4PA 2X1BA 3S1TA 3W7BA 3NLCA 4FM1A 4JV5K 3KLFA 4ZCMA 1RXVA 3CD6N 5AQTA 4MMOA 5AQJA 3PHTA 5L46A 5BYRA 4B9LA 5BR9A 1Q86O 1ZQDA 3TA2A 3C1YA 3M30B 3PNIA 1HA1A 3CJSA 4P0PA 4ED0A 4NEZA 1S1TB 4KAIA 2R8JA 3J81O 1RKIA 4WFAQ 3M32A 1XNRF 2ZTDA 1RWOB 1Q7YO 5DO2A 3OL8A 4Q45A 2XMVA 3Q8PB 1FWLA 2KHQA 1UEVA 4ISFA 4C1NK 4NCAA 3AVHA 4DR6K 3HI0A 5BYQA 5CCLA 4PA1A 3I0SB 3SBMA 2WK4A 2WAQD 2HBQB 2JRZA 2ZZNA 4KH1B 1KBRA 2DK2A 3J7ZT 5LY3A 3DM2B 3QERA 1NH7A 2CJQA 2ROEA 5CZVA 1NGEA 2O6KA 3VGUA 2DR9A 1S6PA 2ZKTA 1WG5A 3SJJA 4ZOHC 3TZZA 3L6QA 1WOSA 2DUYA 5AE3A 3NNHA 2PIIA 1MQ3A 4K8XA 2YNFB 8ICJA 1ZQQA 2ZF5O 4I2CA 4GVMA 3EICA 4C0BA 2G8KA 4GXJA 4PABA 5J8YA 1HMVB 3HKWA 5CEHA 3IAM9 2YWKA 3H4BA 1V3RA 4AQYF 2UYTA 1RYUA 4RL1A 1KR4A 4WXWA 2F2AB 3PJXA 4AILC 1QH9A 3CCRN 1YKWA 3K9JA 3ED5A 3THWA 4X4VA 1BGXT 3DGPB 2B0CA 5IT0A 2X78A 3TTDA 4KMOB 2QI2A 3CDWA 3MPDA 1YI2S 2ZM6K 1RT3B 4R65A 2JEIA 4AQYJ 3QLHB 3W64A 4EHUA 1QUPA 4PQUB 2SXLA 1QVFR 3HMJG 4JOUA 5IT9O 2QEXS 3A4TA 3F5AA 2OD4A 3PSTA 1F60B 4FLUA 1GOAA 1IKVB 4YMOA 1C20A 1J2NA 1SJ4P 3KJQB 4K4UA 1IWAA 2FMQA 1HBMA 4MK9A 1BQMB 2R9LA 3A3NB 3JPRA 3THXB 3WKDA 3KK3A 4CGIA 3K5LA 2C2EA 3PACA 3X3UA 2ZWPA 2QWQA 1EX8A 4MKAA 4ILMA 1JLFB 2KN7A 3AU6A 4NLWA 5GAGU 2K06A 3ATUA 3QNWB 4LIRA 2CAJA 2DEJA 4MJKA 5MLCV 1V3ZA 4YS2A 4DG1A 1VIOA 4IH7A 4DBQA 2ZVSA 1KRPA 4YXJA 1XNQJ 2LP4A 4YMNA 2ZGZA 3ETRA 1HKGA 2E3TA 5JJBA 2KQ2A 3RG6A 1T11A 3EXCX 2LHTA 5C5JA 2IM2A 3A1YG 2YI1A 1Y11A 3THTA 4OJLA 5KFCA 5IIMA 2MRLA 1PZNA 4C3MA 1YUWA 4FWLA 3MAHA 4IWVA 4KQZA 4JWNA 2QL9B 1HHTP 5DETA 4NLUA 5C10A 3AO1A 3BO2A 1XQSC 1Z00A 2ASDA 3K9KA 1CLQA 3UPQA 3PYEA 4KY3A 3O6WA 4FKXA 3MCSA 1V85A 3D2FB 3DU5A 3N7SC 5ADZA 3FC9A 2AEFA 2RB7A 4YVZA 3HT0A 4JS5A 4IOXA 2MUTB 2ZIXB 2W9AA 4KHNA 4YOVA 1PJ6A 3HM8A 3H3NO 3RJEA 3E9PA 2HQDA 4Y34A 2D0CA 3QIPA 1VQ5S 4JUZA 3HPOA 2AWZA 3HSZA 1ZBFA 4F4ZA 3EZWA 4MK7A 2GC8A 2HBJA 3HP9A 1OVYA 5AQSA 4FWQA 4YOXA 1MA7A 3D5MA 3WZ0A 1F9FA 4AF1A 1HNIA 4ZTJA 3LZIA 2CPRA 4G1QB 3GL1A 1K0VA 5B5EU 3DC2A 4X5VA 1KW4A 1GMVA 1X1PA 4BY9C 1WUDA 1S9FA 1SIWB 2GHPA 2JEGA 3GG0A 2KXNB 1PUZA 1U0HB 4G1PA 1AUSL 1R8BA 1OO0B 2XVTA 3AEVA 2GVZB 5HJYA 9ICCA 3OYBA 1WORA 4OYXA 2YHYA 3QNMA 5D15A 2I6WA 1JIHA 3OS1A 1SWVA 1Q3UA 1RAFB 1RU1A 2NXCA 3AOCA 2V8GA 5BREA 4JKFA 1ACMB 1T05B 3W0LA 4N56A 1NSQA 2PZSA 2QX0A 4QCLA 4P71A 1JMTA 3R27A 2XMJA 7ICTA 3ISNC 4W92B 3ICLA 1Z4OA 2QSFA 2P9CA 2AD9A 4O55A 5ALWA 3MMAA 1MWYA 1I6JA 3AO3A 5I3UA 5EX5A 5F1XA 4B9UA 4KBOA 4DL3A 3C15B 4UUXA 3F44A 1DQAA 4NCBA 1EP4B 2E6MA 4J91A 4QZIA 3IWNC 1EX4A 3TFSA 2ZQBA 4F8RA 4F25A 2W41A 1S1XB 2WF5A 2DKOB 3OBIA 4CTAA 2DHXA 4YORA 2W2QP 3PX6A 3K57A 2AYMA 2CKWA 1VBKA 3NF7A 1UEKA 1UZHA 3SUPA 4Z6CA 2LMIA 4F3QA 2KHOA 4DV3F 2FLOA 4CT8A 2G2YA 4RLEA 4UATA 4OJRA 2W55A 3SQ4A 4OX9F 1ZRMA 1B92A 2J9CA 1RI7A 3E2EA 1RT7A 1KFTA 3Q8YA 4K4TA 1KHVA 4DEZA 2Z2LA 3FCHA 2DPIA 3MEDA 1YVFA 1U7LA 4UY8O 4OX8A 1AZSA 5IM0A 5IINA 3CIMA 2GAGC 2NS1B 2FDRA 4CF1A 4CLYA 3THYB 2YX8A 1NJXA 3HKZD 2G8FA 4E7IA 2HHTA 3H8SA 4OX9J 1DQ8A 5AKZA 4OFZA 1B70B 2RQKA 1WC5A 1YGYA 5CZ1A 1G2EA 3MF5A 3VENA 2E44A 2KJ5A 1TKDA 5DMRA 1HNZF 3KLIB 2HS0A 1W7WA 3VEVA 4J37A 2PXIA 4OYAA 2HGMA 5GADI 2F1FA 3GG1A 1WSGA 3TTCA 1U1OA 4WF9L 1XUPO 3KBBA 3MX2A 3ZO7A 1Q8IA 4Z4CA 2C2RA 3HX0A 2K8AA 2YKAA 2V68A 4RQ0A 4I6AA 1IJJA 4K2JA 1RT4A 3FMBA 3HD2A 2N82B 2HQFA 4P72A 5MAOA 3FVYA 2ZXIA 5HMZA 1WJ9A 3EGNA 2ATLA 3MK6A 2XO6A 3AO5A 4G65A 4BQZA 2EFOA 2FLPA 5B0EA 2HMPA 4FVCA 1WSIA 2MQMA 1M5PC 3L4PA 4N7TA 4LH4A 4EU0A 3MABA 4JD2A 2MXYA 4Y2RA 4ZPWR 3AVBA 3WKAA 3G6ES 2NRRA 2LBOA 4DU3A 1XTZA 4I6MA 1OMSA 3PKMA 2BKOA 2V4QA 4DV2F 2OEHA 3BGUA 4A8KA 4QWEA 2WF6A 3R5JB 4KV8A 4U7UK 2KJWA 4FVMA 1YJ9S 2BBEA 8ICLA 3QO9B 3DOKB 3BS7A 3PRBA 2DXFA 4U7UD 5CAAA 3C65A 3GOIA 1K47A 4DV2J 3VGVA 1YK9A 2YX7A 1RHQB 2DRAA 1X66A 4OV6A 4F26A 2HFSA 2Y1RI 3PIOQ 2BEFA 4QYRA 2EPIA 5AQMA 1X3NA 3TSUA 2GZOA 3QU2A 1CJTB 4RQ8A 4W5TA 3CCEN 2G1HA 4IOBA 1WHVA 4FPBA 3EVWA 5AI4A 3CDAA 2F65A 2KKZA 2W01A 5F0UA 1IKYB 3MN7A 2F8KA 1T3OA 3H42A 2A0FB 3QGHA 2B56A 5D4NA 3GDQA 2QZ8A 2GO8A 3AA4A 4DN9A 2ZDOA 4DX6A 1ZBIA 2VQFJ 2VA8A 4LSNA 1GNKA 1K8KB 1S3XA 2M8HA 4IRCA 3TAMB 4LBIA 3AA3A 5E3PA 3TAPA 3J7Z5 1XS9D 4KH0B 1V38A 2O8BA 3ZNUA 2OPRA 4B1VA 3JSMA 2FF6A 3PEJA 1FK9B 1U1PA 1FRMA 3BSOA 1TFWA 2R7VA 4ZA1A 2FSNA 3CXCM 3D9BA 4DCOB 1R0AA 3ZDEA 2UUTA 4DV7K 3D0HE 1I39A 4OJHA 4KPYA 3ZC4A 1TYQB 4OLBA 1V6HA 4B17A 4LFBK 3CPWM 8ICHA 3MPVA 4RNNA 2XSFA 3H2LA 2BJDA 4FO0A 1VQ4S 4NLYA 2KB2A 2DGQA 4NLRA 3UN3A 1VRTA 2DRDA 3CCQN 3LPTA 3UD4P 9ICNA 4NL9A 3ZYYX 1Z1VA 5AQWA 4PHTX 4BVOA 3ZZPA 2J7UA 1IH7A 1HQEB 3VGKA 4QJVA 3V5RA 1UZDA 4CE9A 3W2WA 3MXMA 1VQ7N 4M5DA 3UM9A 1Y0HA 4ZJOA 1VAZA 2KW4A 1ZA2B 4FVUA 1KWMA 4FJ7A 4U96A 1E4FT 3NVWA 3NVMA 1JLBA 1Z26A 1LWFA 1KQQA 3SEOA 3W5XA 2HOQA 3M8PA 1N34F 5JXSA 5AIAA 1HNWF 4CRXA 3CC4S 4C8YA 4U6PA 4M63C 2NZ4A 4ZN3A 4K0KJ 2ZUGA 3VR1A 3E58A 2RD5C 4B3TF 4QU6A 4F93B 1N34J 1RDCA 2KJ8A 4RW9B 1HNWJ 5TKYA 2A41A 4DL6A 4JKHA 1J9AA 4FF2A 3NGTA 4H5NA 4NYNA 5HL7L 3OYDA 1WI8A 3ZDCA 1MC8A 1HD1A 2CFXA 1VQKS 2H9ZA 4B3TJ 1TV9A 4ENOA 5J2QA 2VG6A 1LAVA 2MYFA 2F8SA 2FD2A 3NS7B 2K7JA 3PYDA 4ZPTR 4QZGA 5LMUK 2O8DB 3EJMA 3TANA 1UVIA 2D1CA 2E4LA 4JK7A 4W5OA 1S72S 1JUDA 3MN9A 2ZIVA 4I2JA 4MDBA 4UB1A 4GVBB 3C14B 4NYFA 1BG3A 3O9TA 2PFNA 2ZBRA 3G87A 1BHLA 1G4CA 5DG9A 1WSVA 2DFHA 4J9MA 3R3TA 2H3GX 4IR9A 2CXEA 1FJGJ 4KGVB 3C2KA 3IS9A 1YG0A 1HBOB 2DO0A 3FK4A 1RT2B 2A1RA 4CHZA 3GTYX 4LF6K 2IJRA 3KTQA 1X6IA 4C8LA 4P0QA 5T14A 3SI8A 5A8WA 7ICLA 2P9SA 2P9UA 4BACA 2KSOA 3OJUA 3CCUN 5H9FJ 2HHHK 2KT2A 4RG8A 5EX3A 2RDDA 1JCFA 2F63A 4PWDA 3A8IA 1ZETA 2PFQA 1QVGM 2ABYA 5HO4A 3R2DJ 5EUHA 2YPYA 4HDHA 2ZITA 4L3QA 1E6VA 2YQEA 1W9HA 1N5YB 3RWUA 5KFZA 1D8YA 2AIRB 1BU6O 4PR6A 4ED6A 4CCHA 2E1AA 3CJ3A 5ALVA 5F9LA 5D0HA 3AQOA 3U9ZA 3OY9A 2MZQA 1KVAA 3WXIA 3MM8B 3BS9A 4LFAK 3UXNA 3OXLA 1HLUA 3VGTA 1LAWA 2PA8D 3O9UA 2HW3A 2W9BB 3M30A 5HP1A 4OLOA 2PY5A 3BGRB 2DGXA 1S48A 3J81Y 1SV4A 1ROFA 3W62A 4M5NA 4BJQA 4RBUA 3FBCA 3MMCB 3M6XA 2BJ8A 4URGA 4DOCA 4DV0F 4C7ZA 5GMDA 4C4SA 1RCXB 4Q7AA 1CZAN 1RNHA 3AD9C 4UOGA 3QU5A 4ICAA 3WK7A 4B9NA 4DUTA 3N4MB 4LR7A 5KFXA 3S01A 4FYYB 1B99A 3IMQJ 4USUA 4ANEA 3I0SA 3RBZA 2Z4PA 3QJPA 3ORYA 1GOBA 1NK8A 3DM2A 2KV2A 2LU1A 3DXSX 3I56N 2XCPA 3BREA 4FXDA 2IJNA 3V4IB 3SCXA 2KFNA 4DV0J 5F9NA 2FVPA 1L3TA 1ZAWA 1BL3A 2JH3A 4RQMA 2YNFA 2MKKA 1HWUA 3NGYA 2ZJPL 1WBDA 2D0AA 2P5GA 3O3LA 4ZVRB 5HQMA 2XHWA 1Q82O 3C95A 1HMVA 8ICRA 3FCVA 4IOAQ 1DRGA 4L76A 3MN5A 1S77D 3L7UA 2MY7A 2VC1A 5AHXA 4OI0A 4Q44A 4J90A 4B3SF 3DGPA 2DBBA 4ICLB 3P3DA 3F5EA 5DKWA 2NLXA 3UN2A 3SXLA 1T9XA 1RT3A 2VJ5A 2BKEA 3WC0A 2FY1A 5HK4A 3RRKA 1I5OB 4BBYA 4URSA 3QLHA 4X64K 4ECVA 1SZPA 5DS7A 1Q53A 4PQUA 3UDEA 3HFVA 5AXKA 1IBKF 3M2VB 1COKA 5B0CA 1UAWA 3CCVN 5J2IA 4X65F 2EZZA 1P1TA 3RH6A 4OI3A 3BY5A 4CVNE 1WG1A 3D6FB 1XN9A 3LUYA 1ZQJA 1UFWA 2LXFA 4KHMA 4GKJF 1WOQA 4Y2TA 4KITB 2XRIA 1LFPA 4R25A 3AHPA 1YWXA 3THXA 3LM9A 2E66A 3HFZB 3LGNA 4CIOA 1XNRK 3HJEA 1JLFA 4OZ5A 3M6VA 2FDNA 1A76A 4YMMA 1K9MT 1NU0A 2FBXA 5DJBA 1Z4UA 5DM6Q 3ATVA 1PVRA 3R5GA 1YVUA 4L74A 5DGAA 4HTUA 3NS5A 3CD5A 4MK8A 3LANA 2XMUA 1SJ1A 3GFXA 1EKEA 3AJ1A 1MN7A 4PZVA 1GAOA 3Q86A 2A2CA 5J2FA 1HKCA 1NSPA 2WBMA 4WTOB 2JHEA 1V9OA 2I1QA 4LR9A 4KR0B 2EZYA 4WYBA 1C0MA 5EY4A 1N5QA 3I82A 5ALYA 3B4MA 3TAEA 3CCTA 2Y8WA 4ILJA 3AAPA 4IQUA 1HNXF 4MEXA 2V5HG 4FM2A 4Y2SA 7ICIA 2K8GA 4HI2A 4HH0A 3M8YA 4CLSA 4B3RK 5IIOA 3SBGA 3D2FA 3QRPA 2GHWA 1Z3EB 3UR0A 2ZJAA 2QT7A 4K2XA 2ZIXA 3Q22A 1EQYA 2FE9A 3E51A 2HBKA 2RU9A 2JEJA 2XMKA 3N6NA 2ERRA 1RB0A 4A8MP 4V19J 2QA4G 4KHPF 2V50A 2YHBA 2OA8A 4O5CA 1KN5A 1UJ4A 2XS7A 4HDGA 2EWSA 2CUYA 4QWDA 2YKQA 3M9NB 4FWMA 3NGIA 1WUUA 2E8PA 2R8HA 9ICRA 2Y3YA 3TVKA 1IBLF 4G1QA 5DLFA 3RJJA 4EENA 3LDOA 2VPWB 1U47A 2RHKA 3VQ6A 1YRTA 1XO0A 4LJXA 1ELOA 4NA1A 1U0HA 3AFGA 2ZTEA 4URQU 3ICXA 5KFVA 1MWMA 2XICA 4U8VA 5DZ6A 4KHWA 1AB8A 1K1SA 3TI0A 1ZTTA 1NUEA 5HMLA 4DUZK 3NGRA 1IBLJ 1VIXA 1T05A 1WKKA 4ECQA 3R5BA 4NLGA 3DOLB 5DRKA 5AJ3K 4JHDA 1UAXA 5E84A 3RH4A 2D41A 2B6AB 1JNRB 2WB4A 2Q6CA 4DPXA 5L8RC 1VMBA 3QPIA 1R8PA 4IS7A 2ZUBA 7ICQA 3CD0A 9ICSA 3C15A 2VWBA 1HW8A 1WLJA 4R64A 5A2QY 4PKIA 4FJNA 1EP4A 3U1NA 3HFKA 4EUVA 1BY9A 3KOOA 3U1LA 3SSRA 4TU8A 1AA1B 3J81j 1S1XA 1M0SA 1MA9B 4HT7A 4JWMA 1UVMA 3BYPA 3IBCB 4YNQA 3W8GA 5ETKA 3UDVA 5KFMA 4N47A 1GH8A 4JNEA 2DY1A 2V94A 1WC3A 4N77A 3G9CA 2IM0A 5EX0A 2RIJA 3KKFA 4JI4K 3TA0A 1UCNA 2I9GA 5HMXA 4ES2A 5KG6A 4HVJA 5AQLA 3GZ7A 1UW4A 4AYBC 2CPDA 2NPFA 4B8CA 4PRFA 3J7YU 3THYA 2Z57B 1VQMN 2HBLA 2QKQA 1WWUA 2F1HA 3QEIA 2XC9A 2JZBB 4KX3A 1SPBP 4E19A 1U6ZA 3NF8A 3VEWA 4DU1A 3GONA 2A40A 1S0VA 2IHNA 3AODA 1M90T 1RT5B 3N7PD 2FBVA 1RWVB 4P6QA 3BB5A 4UB5A 4DQQA 3IG1B 4AYBF 1QTNB 3H6EA 1KTVA 4X66K 1HFEL 1ATRA 3AQFA 2C2KB 3KZXA 4JBCA 2CQ2A 4KX5A 4LF7J 3L4IA 1QAXA 4IDKB 3O8WA 1SJRA 4NL5A 3UQ0A 1S6QB 3ZLJA 1FRIA 3V72A 3EKSA 2K4PA 1WC4A 3C28A 1ZQPA 4DQIA 3W1YC 4NRUA 4Q5VA 2YB1A 4HTIA 5GIOA 3H20A 1S8OA 5C25A 2WOMB 3TRGA 2ZHBA 4EX7A 3SAGA 2DHSA 2JFKA 1RPLA 4QZ9A 4W5RA 5KAIU 4HR2A 1Q0NA 2XCAA 4LRDA 4CEQA 4HACB 3KD3A 4HH1A 3V1OA 1HARA 1BWEA 4X62F 1SZHA 5I3QA 2CGJA 3ULEA 4ZKAA 4IRDA 4NXNF 3HHLB 1M5VC 1MNEA 1VQYA 3QO9A 3HYFA 4PL1A 3ZT3A 3SCIE 3G82B 5AK3A 7ICFA 4LRAA 2F8TA 3OXGA 2UV8A 1SKWA 4NXMK 4H0TB 4KTZA 2ZIUA 5KT4A 3SV4A 2BQRA 4K4YA 1LOUA 9ICLA 4GW6A 4YDUA 2ZH2A 1LXJA 4KHSA 1OH6A 2FPLA 2YX1A 2QGFB 2CJAA 3TJ9A 1Y64A 1U2FA 5CB1A 4ZN1A 3NBPB 1KTQA 4NXNJ 3I28A 4NXZA 2GBZA 1CJTA 1N5XA 3ADAC 3NE6A 2DGZA 5J0OA