4F8RA

Bacillus dna polymerase i large fragment complex 7
Total Genus 204
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
204
sequence length
579
structure length
579
Chain Sequence
KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of a High-fidelity DNA Polymerase
rcsb
source organism Geobacillus kaustophilus
molecule tags Transferase/dna
molecule keywords DNA polymerase
total genus 204
structure length 579
sequence length 579
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4f8rA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4f8rA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4f8rA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4f8rA01
1HYZA 1D9FA 4DS4A 4M3ZA 4M45A 1C1BA 3MABA 5KFFA 5EU7A 1WN7A 4M9NA 2AQ4A 3B0XA 4AHUA 3B6OA 2C22A 1TL3A 4I28A 4RQ8A 4YXJA 1ZJNA 2UVVA 1NOZA 2DTUA 1BCOA 4HVJA 2FBXA 2JEFA 5DDYA 7ICQA 1TGOA 4FLWA 4C8OA 1L5UA 1BPZA 5DKWA 4QWEA 3AVKA 3Q8PB 4I2GA 3M8QA 5BOMA 3VQ4A 1BISA 5J2JA 4CGDA 4W5RA 3OYNA 8ICSA 4QZDA 2E4LA 4FM1A 3KK1A 1TKDA 5KRSA 4XQ8A 1H38A 1X9WA 4RNOA 3V9WA 3KD5E 3PNCA 4KN4A 4O3RA 1CXUA 5KFUA 4RPYA 4AHSA 2LSNA 1WSGA 4FYDA 2BDPA 4RQ4A 1QTMA 3TAMA 3LDSA 4HUGA 1TK0A 4M3WA 2O4IA 3NGDA 5SWMA 3OYGA 5BOLA 1CLQA 1ZQCA 4I9LA 3L2UA 1YVUA 3RR7A 3OYKA 2G8IA 4PHDA 4O9MA 4DSKA 4F2RA 1D8YA 4RQ5A 2D5RA 3QIPA 8ICLA 3AO2A 2AU0A 4DFPA 4CJQA 4KAZA 4R63A 1HQUA 4DG1A 8ICBA 4CF8A 4NCAA 4UB2A 1PZNA 1RDAA 4QW9A 2X74A 4N76A 4E3SA 2ZUBA 1UA0A 5C25A 1QLNA 4CEBA 4IBNA 4R65A 1K6YA 4EP4A 4HUFA 2Z1JA 2IAJA 9ICCA 4JRPA 2G8KA 4E7IA 2IS3A 5CYMA 4RG8A 4YP3A 3ULDA 7ICRA 3RJKA 4H8KA 4E7LA 5KT2A 1TKZA 5C5JA 9ICTA 3H40A 1QQCA 2BPGA 1VRTA 4JUZA 1KRPA 2P6RA 1SKSA 3QEBZ 3V9UA 3QEPA 3NH0A 2PYLA 3VQ9A 3NH2A 3KLHA 3S3MA 5JS1A 5J0OA 4YD1A 9ICIA 1RT7A 4CFAA 4CF1A 4DU3A 3TABA 4M9LA 1HUOA 4GXJA 1SUQA 4Q8EA 2MAXA 7ICKA 1BCMA 3NGYA 4I2CA 4R8UB 2HB5A 2PI5A 2D0AA 5J2EA 5DLFA 4ED6A 4YFUA 3DLHA 2UVWA 1RPLA 3QLHA 4CEOA 4Z4GA 8ICGA 1IG9A 1ASVA 1LAWA 4O3OA 9ICKA 1MU2A 3SJJA 1C0TA 3QESA 3OYCA 3TFSA 3VQ5A 4FZXC 2VANA 4RUCA 4O3SA 3Q8SB 4TUSA 3UXPA 5J0UA 1ITGA 1NK9A 1GOAA 2BANA 3V4IA 1LWEA 2FLPA 4YMNA 4W5QA 3QEWA 4RNMA 3GIJA 3RMBA 3T5KA 4GC7A 1FKOA 4FZYA 3WNFA 3E2EA 4CHOA 5EWFA 3ZDAA 3K5LA 3OSNA 4QW8A 4YN4A 4W5OA 2RN2A 3IAYA 1XC9A 2ZTEA 4CCHA 4CGJA 3G0ZA 3P83D 4EYIB 3SUNA 3UQ2A 3AV9A 1JKHA 1SL1A 2QKKA 3PR5B 5HP4A 5J2QA 3QEVA 4W5NA 4UBBA 5J0SA 3ZDBA 4ELTA 4LH4A 5K14A 2D0BA 5IINA 3UQ0A 5KT4A 4E19A 4FZZA 2ZJ5A 3RH5A 5BPCA 4RUAA 3SQ0A 4CJTA 1NK4A 4Q5VA 5KFPA 4EBCA 1RXWA 2Y1IA 1KSPA 1JXEA 2ISPA 1S76D 1XS9D 1NK5A 1TKXA 2A1RA 8ICOA 2HNZA 5DK5A 2BCRA 4ZTJA 4JLHA 1VSLA 3A2FA 4O44A 5KFHA 3N97B 3ZSXA 4AH9A 1YTAA 3MGHA 4E0DA 5KI6A 5F9NA 4H4MA 1VSKA 3JYTA 3ZT2A 4HTUA 4N41A 5DLGA 4M2YA 3KK3A 1JLCA 2PFNA 1ZBHA 4J2AA 4J9SA 3RB6A 1VSDA 1S9EA 3SUQA 5F9LA 2EHGA 1J5OA 4DL2A 3G6YA 4BE1A 1LV5A 1JXLA 4QOZB 1Z00A 3HVTA 4FW2A 1KLNA 4LVSA 4O3NA 4O4GA 4CF2A 4ECVA 1RBUA 5KFKA 1QSSA 3FYHA 3HPHA 4CJEA 2GBZA 3KLGA 1X1PA 4CIGA 4J2BA 1Y88A 4DTOA 2JEIA 2ETJA 4IG0A 2FPLA 3EW9A 4B9UA 3ZD8A 3C2LA 3LPTA 3OHAA 2R8JA 3MECA 4KI4A 5DG7A 1IXRA 3C95A 4WE1A 3ZT0A 4CFDA 4NLKA 1VSHA 3PW0A 4KLUA 3DI6A 3WNEA 2HHQA 1WSHA 2M9NA 4JRQA 5T7BA 3LWMA 3NF7A 2QK9A 5CY4A 3I8DA 2ISOA 4CF0A 3CFOA 4RNNA 1X9SA 1XHXA 4UB5A 1CUKA 2X78A 3HK2A 3T5HA 3RH6A 1RT1A 5KFXA 3AO3A 3DM2A 4ED2A 3QZ7A 5I42A 4CK1A 3RMCA 3JPPA 2KZZA 1NJYA 1Z00B 1Z3EB 1S6PA 1JLFA 2RDIA 1S1WA 4BWMA 3U6FA 2HHUA 3K5NA 3UXNA 4M0AA 1B22A 2Z1HA 5DDMA 2BCQA 2O4GA 4BGDA 4ECZA 1X9MA 5KFGA 5TZVA 5J2HA 3RJFA 1NJWA 1ZQEA 3RJEA 1VSEA 5DQGA 2R8HA 4J9PA 4DOAA 4BWJA 3QERA 2FC0A 5J2MA 4B9LA 3SQ1A 3LP2A 4LY7A 4M6WB 5HHHA 1RYSA 2DPJA 1ZQUA 4DQIA 2FLLA 3C21A 1W0HA 3OJUA 2KZ3A 3RH4A 1TFRA 1C1CA 3DYAA 5HRNA 1L3SA 2ZTCA 4CHQA 3MAQA 2OPPA 2KQ2A 3T1AA 2JEGA 3L2VA 5KG0A 4DWIA 1U47A 1BQMA 1EETA 2XHBA 2PFQA 1NK6A 3G6VA 1G15A 4FJXA 2FBTA 4OKKA 1ZBLA 3AU2A 2H5XA 2BKEA 3LANA 5HLFA 3HL8A 3OJSA 2DFHA 3D0PA 4JS4A 7ICTA 4O0IA 1UOCA 2IBKA 8ICWA 3MEEA 4E7HA 4KV8A 4AHTA 1K1QA 3AO1A 1NKBA 3V6HA 1DOQA 7ICUA 4KLOA 1S1VA 2KN7A 1REVA 4GC6A 3ZSZA 4F5OA 3RWUA 2HHTA 3NE6A 5KFAA 2YHAA 3VA3A 3LWLA 4B3OA 2BHNA 4AHVA 4FBTA 4M47A 2YV0X 4DQQA 3RMDA 4QWBA 3VQQA 3ZSYA 4O5CA 4NM2A 1GOBA 3AVJA 4DTPA 3RB3A 2Q3SA 3MXJA 3V9SA 1R0AA 3FDSA 1ZQQA 1ZBFA 1N48A 1XI1A 5L1LA 3QINA 2WOMA 3VQBA 1N5YA 2PXIA 1XSPA 2I1QA 4YR2A 4N47A 4F2SA 4W5TA 4QWDA 4MFFA 1S10A 4DSJA 3RRHA 1HQEA 2RF2A 3K4GA 3AU6A 2IA6A 4RW7A 1TKTA 3RBEA 4DL4A 2A1JA 4H4OA 4GXIA 8ICPA 9ICGA 1I3AA 2W9AA 3NCIA 5KTQA 4BXOB 2BQ3A 4F3TA 4ED1A 3V1RA 4DL5A 1VSIA 4IFYA 5CZ2A 5L1IA 3LP3A 5J2AA 4Z6EA 3HP9A 2ZUCA 4KLGA 2V4QA 1VK0A 2YKMA 3MFHA 9ICUA 4Z4CA 1S0MA 1C0UA 4EBDA 2C2DA 4DSIA 4FJHA 3OS1A 3V7LA 3KIOA 5J2BA 4FK2A 4DQPA 3PW7A 2IDOA 2W9CA 2W9CB 1RDCA 7ICOA 4P4MA 1RXVA 1WNSA 4YNQA 4IQTA 4FM2A 2J6SA 4Z4EA 4FJJA 3LDAA 3V1OA 9ICJA 1DGSA 4FLUA 1WCNA 3M9OB 4E1NA 1IM4A 2PY5A 3KK2A 1BIZA 3L2RA 2P5OA 4OPKA 4JS5A 1TVRA 4BDYA 2R8GA 3K5OA 4FXDA 2XY8A 1IKVA 5KFQA 4CESA 2ATQA 5HMMA 3ZSOA 4AILC 3LK9A 4YG2A 1WSJA 3BJYA 1UT5A 4DTSA 2P51A 3MXMA 3O4NA 4J9QA 4B9SA 4CJ3A 1HYSA 5L1KA 5J1EA 1EXQA 2P1JA 2VA2A 4DSFA 4KREA 4I27A 3QEAZ 4GMJB 4PH5A 5L1JA 2W9BA 3RJJA 2JLEA 1JXBA 3PUFA 4DTUA 4KITB 4BACA 5HROA 5CB1A 3IM1A 5DB7A 4F92B 1ZQDA 7ICLA 2FBVA 3OVNA 4F4KA 1WSEA 1T05A 5HRSA 2DFLA 3C5FA 1KEJA 3H8SA 2BCVA 3N4MB 1ZQMA 3L2QA 2R8IA 3SNNA 4FK0A 8ICCA 1TK5A 3HX0A 1S0OA 2X6NA 1A5VA 1FXXA 3CM6A 1JMSA 4Q45A 1XHZA 1ZBUA 4B8CA 1NKEA 3LPUA 5HMLA 1ZQJA 4NLZA 3SCXA 4FJIA 1D5AA 3HYFA 4PY5A 1JL1A 2WTFA 2JZBA 4CJSA 4I2IA 3ZDCA 3GFKB 3KHLA 3VQ7A 3AO5A 3D45A 2Y1JA 2NRXA 1ZQRA 2R8KA 3JPRA 1LWFA 1B9FA 2HHWA 3T5LA 3GV8B 4KKOA 2PFOA 3SUPA 4TQSA 3C23A 4L8RB 2R7YA 2OPSA 4XIUA 3MR3A 4ELVA 2UVRA 4ICLA 2HHVA 3AO4A 4RZRA 1W9HA 3DRSA 3KHHA 3ISCA 3NGIA 1V9PA 5DBAA 1QSLA 4Q0BA 2G8VA 4QWCA 4DLGA 3TARA 3O3FA 5KGWA 2F1JA 4M41A 3RAQA 2VWKA 4K8XA 1HJPA 1T3NA 5KFCA 1RT2A 4J2EA 3PW4A 3RJGA 2YKNA 3HJFA 1BPBA 5DG9A 5CA7A 2VA3A 3DLBA 4P4OA 3GV5B 9ICWA 1KVCA 1T03A 4ECRA 1ZQPA 1CZBA 4DO9A 2BGWA 2KZMA 3DRRA 4OVLA 3EPGA 3PY8A 5L9XA 1ZQGA 4TUQA 5IIMA 3PW2A 4KLJA 3IG1A 9ICXA 4CGHA 4CGIA 4Z6FA 3TAGA 8ICFA 2HVHA 5D3GA 2LYHA 3SUOA 5KG7A 4CJUA 2W9BB 4DSLA 4I29A 4ECQA 2QXFA 4OGEA 3QEXA 3SQ4A 4I9QA 5I3UA 3H8JA 3H7IA 1BL3A 1L3VA 1EX4A 1RBSA 2I9GA 4MEYA 3PMNA 4PHEA 2XO7A 4Z4HA 1KFSA 1L3UA 1BGXT 1BIUA 2YNIA 4DLEA 4IR1A 3SZ2A 3NF9A 4ECWA 1IH7A 4ZTFA 3VQ8A 3RB0A 4KHUA 3LP0A 4DL6A 3SV4A 4Y1DA 2F8TA 7ICJA 5JS2A 4ECUA 3OYHA 4G3IA 5IIJA 4OJRA 3RBDA 3PR4A 3RR8A 4FJ8A 1U45A 2ASDA 4ID1A 1TV9A 1RTJA 1RT4A 1SL0A 1ZYQA 4YR3A 4EEYA 2BE2A 3HW8A 4FLXA 4OKEA 4KLHA 7ICPA 3NF6A 4O5EA 9ICQA 5KFOA 1MQ3A 4FM0A 2KTQA 3RJIA 3V1QA 4CK3A 1MC8A 5KFNA 1RTIA 5EWEA 2P66A 3IS9A 7ICVA 4F4YA 7ICSA 2JZBB 9ICHA 5HP1A 1XWLA 5KFYA 3L2WA 4NCBA 4MEXA 4FVMA 2XRIA 1BPYA 9ICSA 1ZQZA 1O1WA 3AVNA 3U3GA 3Q8RB 3LP1A 4OKJA 4KLDA 2ZQBA 2G8HA 3EY1A 3ASMA 5HBMA 1C6VA 3K2PA 3F9KA 1NKCA 1ZQBA 3HPOA 1N6QA 3U3YA 4F5NA 2FMPA 3QEIA 4OLBA 4EP5A 7ICGA 3MR6A 5JUMA 3OY9A 5KFEA 4NY8A 3OYDA 1MQ2A 3SQ2A 1S1UA 1BVSA 4UAYA 5J2CA 4NLNA 5KFRA 1S77D 3NGZA 3C2KA 1JLBA 4OGCA 3H08A 1ZQSA 1BQNA 3AA5X 8ICZA 3RB4A 1UA1A 4X5VA 3AA2A 3KKSA 3V9XA 2XC9A 4QAGA 3ISDA 5DQIA 3BQ0A 4PUOA 3CYMA 7ICIA 3MBYA 4Z4FA 4Q8FA 5KFSA 4DL3A 3DLEA 7ICFA 2B4JA 4FLVA 1JIHA 4IQVA 4CF9A 4FLTA 4ECXA 2HW3A 5J0RA 3NF8A 2W8LA 1RTDA 2ZE2A 4HHTA 5EOZA 4Z6CA 5DBBA 4F5PA 3VQAA 5J2DA 3JPQA 1S0NA 3PO4A 4YFKA 4BDPA 5KRTA 8ICHA 1CZ9A 3TFRA 4CJ5A 1TV6A 4RU9A 4F8RA 3MEDA 4M3RA 4ECTA 2HVIA 4NYNA 9ICPA 4DFMA 4KLMA 3IHQB 1HRHA 3V7KA 2IGIA 2VWJA 4QZ9A 2FLNA 4CECA 4UQGA 4F91B 3IRXA 3OYIA 1WSFA 3UXOA 3KJVA 1S1TA 4OLAA 4M6WA 4O5BA 4JV2A 3DLRA 2B6AA 3SYZA 3QIOA 3ZSRA 2FPKA 4DS5A 5J2KA 2XGPA 5KFBA 4Z0UA 2AGQA 2EX3A 4B9MA 2C2EA 3OGUA 4MFAA 1NJXA 4ZHRA 4PWDA 4I2HA 3DOLA 1UT8A 1J9AA 1HMVA 4KHWA 4Y1CA 4CEQA 2J6TA 8ICIA 4XA5A 2HHXA 1GOCA 4DTXA 1RDDA 7ICMA 1DTTA 1XO1A 5D46A 1VSFA 4IKFA 2BQRA 3ZSWA 2ALZA 1ZQVA 4CHZA 2Z1IA 4NM1A 3VQCA 4JWMA 1DLOA 3HP6A 7ICHA 1A76A 4IRDA 4KLSA 4CFCA 4J9RA 3SI8A 2B21A 9ICEA 3L8BA 2ATLA 4F93B 4MF8A 5KFWA 4TSXA 4QZIA 4QZBA 1ZQIA 4FJ5A 3HWTA 4DOBA 2F96A 2I5JA 1RT3A 2XCAA 2DFEA 4K4HA 3JPNA 2IOCA 4G1QA 4P2HA 4HYKA 4CK2A 4UAZA 2YNHA 7ICEA 4KHYA 2DY4A 3VA0A 4PHPA 1RYRA 3EZ5A 3T19A 1C0MA 4M9JA 1S0VA 3H4DA 3PV8A 1KVBA 2OZSA 4I2QA 4DMNA 5KT6A 1S97A 4RQ2A 4ECSA 1LW0A 2ZUDA 1QHTA 3DLKA 4CERA 3LZIA 1CXQA 4CJLA 2RKIA 5KFJA 1RDBA 4I7FA 4RPXA 1Q9YA 1J53A 3S3OA 1XU4A 3OHBA 2F1IA 5J0WA 4JK1A 3SV3A 2G8WA 5KG6A 1TAUA 4OPJA 1ZQHA 1VRUA 2GV9A 4E7JA 3EWAA 4QCLA 2ZJAA 4LH5A 5CZ1A 3VQDA 3PW5A 1Z26A 3JPOA 8ICMA 3G6XA 1UWBA 4I2FA 2V9WA 2PI4A 3RMAA 2Q0ZX 3S9HA 4KMUA 5KFIA 3NDKA 2KFNA 1KLMA 1J54A 3OYJA 4RW6A 1KFTA 2OPRA 4DTNA 1EP4A 4C8NA 4CEDA 1XSNA 4LZGA 5FRMA 1Z25A 1IKYA 4C8LA 4B08A 4YXMA 2OYQA 3ISBA 4PQUA 3TQ1A 3LAMA 3G10A 3MEGA 3VN5A 3QE9Y 3E01A 2XY7A 5HRPA 4MQ3A 3V9ZA 2G8FA 1RCHA 1DTQA 4I2DA 2HHSA 4RQ6A 1S9FA 3I0SA 1JLAA 4CEFA 2NRZA 3AVHA 4B9NA 4FS2A 4DTRA 3KTQA 4CEAA 1SV5A 5KT7A 4PGYA 1T8EA 4BE0A 4M3UA 1ZQXA 3NFAA 4PPXA 3ZSVA 5J2FA 4CIFA 2FMSA 1S6QA 3BQTA 5J0TA 2XY5A 2BCSA 4RW4A 5J2IA 4DU4A 3TAEA 1RZTA 2AGOA 2BQUA 4M3XA 2JEJA 3Q8KA 3C94A 2W8KA 1FKPA 4CE9A 8ICXA 4PA1A 4PGQA 4I2EA 8ICAA 2C28A 4E7KA 3M9MB 4ED3A 2F8SA 5J0YA 4N5SA 1BI4A 3KHGA 4QZCA 1WSIA 4AHRA 1IO2A 4IFVA 1A5XA 4RT3A 3AVMA 4M3TA 4YMOA 2BPCA 4F5RA 1RBRA 1BPXA 2ZD1A 2AQ0A 3M9NB 3WNGA 1L3TA 1QSYA 4CGGA 4J9KA 4CJFA 9ICBA 1ASUA 3K75D 9ICMA 1BI4B 3OYAA 3BQ2A 9ICVA 4CHNA 4MFCA 4KLIA 3PX6A 2C2RA 3ZDDA 4Z6DA 4RPZA 3HO1A 4TQRA 3MFIA 1BPDA 1HYVA 4YQWA 3T5JA 3OSPA 5DB9A 5DBCA 3TI0A 3PO5A 4B8AB 3UIQA 2BR0A 1LB2B 4J9NA 3WNHA 2B5JA 5IIKA 3K57A 1Q9XA 4NYFA 4FJLA 4K4GA 1VSJA 5CP2A 3HSTB 1HJRA 4HUEA 1B43A 9ICFA 2XY6A 4KLLA 3HPGA 4GXKA 5KFMA 4CGFA 1VSMA 5KT5A 4ED0A 4JV1A 3MR2A 4KTZA 3UPQA 3KLEA 4ED7A 5CHGA 5FROA 8ICKA 1ZQYA 3GQCA 3TR8A 2GWSA 1EKEA 4M42A 1KFDA 4F50A 3AVFA 4ID5A 2W9MA 5J2GA 3DRPA 4R5PA 5C42A 3SPZA 2ZJ8A 4O3QA 1A77A 1F21A 2IC3A 4J2DA 4CFBA 1SKWA 3KLIA 2VG5A 1COOA 4AHCA 5KG5A 5IILA 4DFKA 1ZQWA 2XCPA 3MDAA 5HRRA 4BDZA 3CG7A 1JLGA 5KFLA 3LZJA 1LWCA 4M9HA 4FJGA 1KTQA 5IIIA 1Q8IA 1Y97A 4K4IA 4N56A 3JPSA 5CR0A 4FO6A 5KG4A 4IRCA 9ICAA 3CQ8A 7ICNA 2BPFA 3OS2A 5KFTA 8ICNA 4FJMA 3OYMA 3EPIA 4O5KA 5KG1A 3NAEA 2HNDA 8ICEA 2IMWP 3C6UA 2OWOA 3AA4A 3OYEA 3GIMA 2VG6A 2FMQA 3AVBA 3KD1E 4TURA 1LW2A 2P6UA 3OYLA 3L3UA 3O4QA 1TL1A 2W42A 1HPZA 2ASJA 4E89A 4EBEA 3NHGA 2VA8A 1KDHA 1JN3A 4ZH4A 2DFFA 2IHMA 3QNNA 4FJNA 1U9LA 2P5GA 1ZJMA 1A5WA 4M04A 1LAVA 3F73A 4KLQA 4UB1A 3CM5A 2HNYA 2ASLA 3QETA 4Q44A 1JX4A 4B9VA 4RQ0A 9ICNA 2NUBA 4YR0A 4J9OA 3PX4A 1WLJA 1NK8A 1ZETA 3V6KA 1RT6A 3ZSQA 2BCUA 4YCXA 4CHYA 1D9DA 3MGIA 2F1HA 2PZSA 5HHIA 5CJ7A 3AA3A 3NTUA 2GUIA 4DFJA 4CJKA 4YD2A 2V4RA 5SZTA 4I2AA 1U49A 4IR9A 5KFZA 5J0PA 2G8UA 1NK7A 3GIIA 3M8RA 3KLFA 3I0RA 3GV7B 3DMJA 1SZPA 1U48A 5HNKA 1RBVA 3HT3A 4FW1A 2WONA 4RQ7A 3ISNC 5J2NA 1TVAA 4QZEA 3Q8LA 4EZ9A 2UVUA 4CHPA 3ORYA 4E1MA 4IDKA 3DOKA 4FLYA 3AVIA 1C1AA 1EXNA 4PHAA 3TAPA 1ZQOA 4HCBA 2RDJA 3JSMA 4DF4A 2NRVA 1ZQTA 1JLEA 4R8UA 4R64A 4RQ3A 4DQRA 3EYZA 2D0CA 3ZDEA 5J29A 4QZ8A 3HM9A 4CEEA 4R66A 3HVRA 1YTUA 4TUPA 5J0QA 4LZDA 5KFVA 1X2IA 4K8ZA 4KI6A 4DL7A 2E6MA 3ZCMA 3GDXA 2YHBA 4M9GA 1KCFA 1T4GA 4NLGA 3GILA 3OYBA 4Q43A 8ICRA 4DQSA 5E41A 4XUSA 1NJZA 4DTJA 4NCGA 1UAXA 3BDPA 4KN7A 1ZQAA 5FDLA 3OS0A 3TAQA 4CJRA 2A1JB 4ED8A 1SL2A 1IKWA 1NK0A 4LSLA 2XGQA 1ZBIA 4MFBA 3V72A 1N56A 1YT3A 3C1ZA 4ECYA 4RT2A 3S3NA 5DG8A 8ICVA 1QE1A 1S5JA 4J9MA 1ASWA 2NRTA 4KTQA 4F5QA 3PMLA 3ZT3A 1RBTA 1ZQKA 4FJKA 2VG7A 5J0XA 3C1YA 3P5JA 1ZQNA 2J6UA 4IQWA 1D8LA 2NRWA 3JPTA 3C5GA 2YNGA 1XSLA 3M8SA 8ICTA 5D4BA 3RRGA 4CJ4A 5KT3A 4GW6A 3K5MA 3MR5A 3TWHA 3TANA 3ZD9A 2AJQA 4DEZA 4XRHA 3V81A 5C24A 3SI6A 4KB0A 4ELUA 4KHSA 3THVA 4BXOA 4CIEA 3V6JA 5FRNA 1HNIA 1RILA 4C8MA 3TAFA 3M8PA 3HXMA 2FPMA 3AVCA 3V6DA 2OZMA 4QZHA 2KFZA 4EYHB 1NOMA 4PGXA 4FBUA 4IRKA 4DF8A 4FLZA 3C6TA 3ALYA 3AVGA 3CFRA 3ETLA 2OA8A 4C8KA 3AVAA 5KGXA 3CFPA 4CJVA 4CJPA 4MF2A 1NOYA 4YMMA 4Z4IA 1WAJA 4UBCA 4GVMA 4DU1A 3LAKA 5D49A 4JWNA 4F4XA 9ICLA 2ZTDA 4DOCA 5IIOA 5CWRA 4KLTA 4QZGA 1AROP 5KFDA 4O0JA 4QZFA 1K1SA 4F3OA 1JLQA 5EWGA 4KPYA 1TK8A 1QS4A 4F4WA 4P4PA 1I39A 4O55A 4BE2A 4I2JA 4LD0A 3DLGA 3PX0A 1ZQLA 4J9LA 4QWAA 1HUZA 1FK9A 3LALA 4IQUA 4CJWA 1HNVA 4KB1A 2DPIA 2OPQA 1S1XA 4KRFA 1U04A 3BQ1A 3KKRA 3VQ6A 8ICQA 3VQPA 4KHNA 3QNOA 3Q8QB 4F4ZA 5DGBA 4JV0A 2ITGA 3MXIA 1IKXA 3ZT1A 1WCLA 2IHNA 4FS1A 4RW8A 3QO9A 2RPIA 4O3PA 3ZT4A 2KW4A 3VQEA 1MSWD 3P1GA 4RQ1A 3AVLA 4B9TA 4KLFA 1KVAA 3T3FA 3ITHA 4FK4A 2BGGA 2MUTA 3K59A 1C7YA 2PFPA 5DB6A 5KG2A 1S9GA 4EZ6A 4FJ9A 5KG3A 3B0YA 4KFBA 4CEZA 2JGUA 4DTMA 8ICUA 4NXZA 1SKRA 1ZQFA 3RTVA 4IG3A 4FJ7A 3O3HA 1B9DA 1B92A 3RJHA 4DSEA 9ICOA 2QKBA 2AGPA 4KTWA 1BHLA 4UAWA 4UB3A 5DB8A 2FBYA 4LSNA 3NBPA 4QZAA 4M3YA 5DQHA 3C2MA 5DGAA 3L3VA 3H4BA 3AUOA 4RW9A 1RT5A 1CEZA 2E6LA 1JL2A 4KO0A 2HMIA 1RTHA 3BGRA 1U4BA 3FFIA 4FCYA 5DMRA 4I2BA 3QZ8A 4GLXA 4HCCA 4YVZA 4I2PA 1TAQA 3H8WA 5J2PA 3K58A 3B6PA 8ICJA 3PVXA 9ICRA 3OYFA 4UB4A 3KHRA 3NH1A 1RNHA 1BPEA 4KHQA 4KLEA 2PYJA 2Z1GA 1T7PA 3O3GA 3SPYA 3RAXA 8ICYA 3MDCA 1WAFA 2X6SA 2A1SA 5CYQA 2YNFA 3Q8MA 2MUTB 3GIKA 3V7JA
chains in the Genus database with same CATH superfamily
4K25A 1FTRA 4RJVA 3D54A 3AQEA 4FF4A 3ETRA 4Y2CA 5EU7A 4UZBA 3G96A 4M7YA 8ATCB 1X7VA 2FSNA 1HW9A 3B0XA 4AHUA 4IL6U 1ACMB 4CLSA 2FHKA 1UVMA 2DR8A 2C22A 3A8KA 4I28A 2H3FA 4HVJA 2XI9A 1C0GA 5IM0A 3OFGA 3CJ1A 3HHKA 4BC7A 3GJSB 2GELA 4JB3A 4F0MA 1OO0B 2AW0A 2E4LA 2KOBA 1HI8A 5U47A 3UQSA 2F3JA 4JKHA 3KDNA 4IH6A 4U6PA 1IXKA 3CPEA 1H38A 4BRKA 3TA1A 5AM5A 3V9WA 3T79A 4CZJA 4C48A 5EVZA 2IJFA 4KV8B 4QYRA 2LSNA 1GTEA 3O6QA 5H9EJ 1QDUB 2V94A 3TAMA 2O4IA 3NGDA 3OYGA 4NL9A 4WBFA 5F8JA 4LF6F 1ZQCA 1WUAA 3L2UA 3OYKA 5HVGA 2G8IA 4X62J 1A9NB 5J1EB 4RQ5A 3J80U 5HROB 4IO9L 2AU0A 1CZAN 4N8OA 4R63A 5ALPA 1HQUA 2FGCA 3LP0B 2H5IB 1XMOF 3EGVA 4R0JA 1NGGA 3J81j 4H5WA 2X74A 3SSQA 4N76A 2JH1A 4LF8F 5BR8K 1DZ5A 4BR9A 4DV4F 2WVBA 4OV6A 2C3UA 4NO7A 2Z1JA 2IAJA 4GO7X 4JRPA 2G8KA 2EWSA 2DNMA 1KKHA 4YP3A 4ID5B 2CNLB 2CG8A 7ICRA 4H8KA 3H40A 4I2PB 1P8ZA 1VRTA 1IKVB 1UFKA 2XMWA 2P6RA 3QEBZ 4LC9B 1X0PA 2K8AA 1Q79A 2EWHA 1YG0A 1NGDA 3NH2A 5J0OA 4YD1A 1RT7B 4NXNJ 2LVWA 4CF1A 4DI6A 1Q95G 5AKLA 4USVA 1DLOB 3ZETA 2RRDA 1CJKA 3UNGC 2UXDK 3MN7A 1IBLJ 5D0EA 2HB5A 2D0AA 5HK4A 1EX8A 4I56A 2UVWA 4Z4GA 4A5AA 1NM2A 3CJ0A 3BZKA 1SB3C 8ICGA 2ZZTA 2K4EA 4O3OA 1X4AA 2I5HA 4X64F 1UVKA 2VANA 1K8KB 4RUCA 4YOEA 3TJAA 1LOTB 5H9FK 3L4BC 5FD1A 1YLXA 4RU2A 4FPRA 3IUCA 3M2UA 4MK8A 3BGOP 4HI2A 4W5QA 2BE7D 4GC7A 3VEVA 3KLFB 3QXGA 3CE8A 4CHOA 5EWFA 1WNEA 3DGPA 3MOZA 1DKGD 1RBLA 4BG9A 2FJVA 3OSNA 1S9EB 4W5OA 2Q36A 3E9LA 1XC9A 2ZTEA 5AQQA 4CGJA 2YKMB 4EYIB 3SUNA 3IG1B 2DNYA 2P9UB 3AV9A 1HNXJ 2DT9A 1EQ0A 1DRZA 3CCEN 2P9NA 4UBBA 5TKWA 4CI0B 2VPYB 3WZ0A 5KT4A 4FZZA 3HHLB 1N88A 4L3QA 1EO1A 4PZNA 4RUAA 1NK4A 2HNDB 3WIUA 4JN4A 4EBCA 2QWPA 4BC9A 2Y1IA 2MQOA 4WFBL 5CHCB 1JXEA 5ALTA 3D2FA 3WUHA 1WSVA 2CJQA 2A0FB 2HNZA 1YJ9N 2BCRA 4OX6A 4OZNA 4JLHA 2AP1A 1GXTA 2A10A 4LF7J 4YB5A 1S5ZA 2A40A 2GFFA 2V2VA 3MGHA 4E0DA 2JC1A 3WQPA 1HWJA 1WJ9A 4WIIA 1Q8LA 2CYYA 1ZBHA 1ZD5A 4CVNE 4J2AA 3HI0A 1PSDA 3VGLA 1XMOJ 1RLCL 5D4LA 3SUQA 3IS9B 3QUQA 5ETPA 1LV5A 3P45B 2C2NA 3KD3A 2NREA 4Z2XA 4O4GA 4BR0A 1EAYC 3DGPB 4ECVA 1PYOB 1RBUA 3CC2N 1DFDA 2KSOA 2G0IA 3KLGA 4EEKA 3DDIA 4J2BA 1Y88A 4DTOA 2ESEA 2JEIA 2ETJA 2ZGZA 1U0SA 1G6BA 3R5BA 5A2QY 1FX4A 3F0NA 1Y0HA 2BM1A 1WC3A 1NMDA 2F5GA 1RFQA 3MECA 3JSYA 2MA1A 1NU0A 4KI4A 3UKUB 1IXRA 2CA9A 5AR0A 2OFHX 2I5JB 3PW0A 2QWLA 3HSGA 1U1QA 1N34J 3R7NB 4JRQA 3LWMA 3VAMA 5D8HB 2XYGB 1X0FA 4UOFA 3DWLA 4CF0A 3CFOA 1A0OB 2L5YA 1R8AA 4UB5A 1CLFA 2WVEA 3ZZ0A 4FYWB 1M1HA 3QUTA 3HK2A 1YHQN 3RH6A 1RT1A 1Q7YT 5KFXA 3DM2A 1RDRA 5FLXU 4DR1J 3ZZTA 3M8ZA 3CJKA 3QU4A 1Z00B 3O8MA 4C11A 1S6PA 2YQ0A 1BXNA 3FFIB 1Z6RA 3LQVA 2EZZA 2XS7A 3U6FA 3L5KA 3ZX3A 4M0AA 5DDMA 1ED1A 5D4OA 2LFVA 3O0FA 3K0SA 4WYBA 4NXMJ 2XS5A 3MM6B 1FKPB 2R8HA 4H4MB 4DOAA 3H2VE 4OI0A 4BWJA 2F9WA 2FC0A 3QWPA 4Y2MA 1FK9B 3ZO7A 2KIVA 4DV1K 2ZDOA 2IM3A 2DPJA 2W3SA 4FYVB 2FLLA 3C21A 3W9JA 2AP6A 2E7XA 3L7OA 2AJ4A 3DYAA 3KMSA 3C16B 2O8DB 1TL4A 1L3SA 3LW5C 2XICA 3MAQA 1HIWA 3P3DA 2OPPA 4Y2PA 3QNMA 3T1AA 4M5HA 3H3NO 3K8VA 4DWIA 4RW4B 1HR0K 1XO0A 2G13A 2CJBA 3G6VA 2MSTA 4URQU 2V63A 1HLWA 3A3PB 1G15A 4B9QA 1F6TA 4OKKA 3AU2A 2E5JA 2QLJB 2V8GA 2CUYA 3HL8A 2DFHA 1HHQA 3FCVA 3GYGA 2YHXA 4JS4A 3I76A 2IBKA 4IOBA 3NG8A 8ICWA 3BS7A 4E7HA 5CHIA 3Q8UA 3NNHA 1I94K 1S1VA 2KN7A 4L73A 3QAUA 3SBTA 3ZSZA 4F5OA 1NGBA 2A18A 2Y9UA 1N34K 2ZIUB 1IV8A 4B1UB 1OQ3A 2BHNA 4FBTA 4M47A 4BR2A 4YOWA 3VQQA 3MI7X 5ADZA 2F8MA 2LDYA 1YJWN 3CETA 1PYSB 2YY3A 1Q3VA 3FBCA 2HYIB 2D3ZA 4OX9F 2YKOA 4JI3F 4AM7A 2VBXA 4JMUA 4ZITA 2KKVA 1XNQK 1R0AA 3PTWA 1ZQQA 2YMPA 3CCJN 5L1LA 3ZZOA 2EAPA 1VQYA 3UE2A 5CRXA 5HBMB 3GE9A 1JJ4A 4UAUA 1QE1B 2PXIA 2OUGA 2D3OR 3I6PA 1S1VB 5JVHQ 4N47A 4MFFA 1S10A 2OFGX 4JI2F 3KG0A 2RF2A 4X4QA 3OT9A 1FHTA 3MN5A 3AA9A 4RW7A 2Y0SC 4XPCA 1TKTA 2ZNZA 1SH3A 2J7WA 4H4OA 4P9SA 2DRBA 2YQEA 3VF6A 3AQFA 2XYHB 2AJFE 3PFEA 2BQ3A 1QQ5A 3ET6B 2CQ3A 4G65A 4ED1A 3OA9A 3V1RA 1UPHA 4KFBB 4ZPVR 4DL5A 4P2FA 1RI7A 5L1IA 1PJ6A 1VK0A 2WVFA 3MWPA 1C0UA 4MN4C 2C2DA 3PACA 2ZIWA 4DSIA 2ZZNA 5MLCQ 2DEIA 1X42A 1TMMA 1RT1B 2ZVIA 3U1MA 2FY1A 2CGJA 4P4MA 3JSMB 3ENOA 1AUSL 3W2VA 4EAHD 1N36K 2HKEA 4BQLA 4H4KC 4U96A 1IBLK 2Q6CA 4GKJK 2J6SA 3LDAA 3V1OA 4FLUA 1DGSA 1QHAA 1WCNA 3SBGA 2HF4A 4E1NA 1A6LA 1FDNA 1BIZA 2P5OA 4JS5A 4F25A 2FJBB 4FXDA 2XY8A 3L4IA 5HMMA 5J8YA 3LK9A 2E3TA 2E5LJ 4IFVB 4J8FA 3MM8A 4Y2TA 4GRSA 3L0QA 4F36A 5HR7A 3AQPA 3O4NA 4B9SA 2KYZA 5GADI 2APOA 3H8MA 5IOLA 4DSFA 2DKZA 3CUNA 1O0PA 1AZSA 3TTDA 1YVFA 5L1JA 1KTVA 2ES6A 1R8BA 3TAMB 4X4NA 3B78A 3HBTA 3PUFA 4KITB 4Y3CA 1F60B 3ZZYA 5HROA 1ZQDA 7ICLA 3ZZZA 1C0UB 1SJ3P 5D4NA 1T05A 1YXQA 5AQSA 1KEJA 4Q2LA 2BX6A 3N4MB 2R8IA 5GAHI 3ENWA 4Q7AA 1H74A 1NNLA 1S0OA 4JI4F 4B6JA 1ZBUA 4DV3J 3KOAA 1NKEA 4B8CA 5HMLA 1ZQJA 1D5AA 5M1PA 3MMAB 4LF5J 1S1UB 2QL5B 1FFWB 3FZHA 5AT1B 5HVHA 1OUQA 4NXNK 3AO5A 4Y2SA 1VQ6S 1ZQRA 2EH9A 3OBIA 3JPRA 1RDWX 1UFWA 1EIYB 3KK3B 4KKOA 3SUPA 3QBCA 4RBUA 4ZVOB 5IV3A 3M1YA 4BCAA 4OX9J 2UVRA 4IWVA 3AO4A 4P74A 5LY3A 2WHOA 2BTFA 1V85A 3NGIA 2C2ZB 4P2SA 5DBAA 1HWUA 3OTDA 4QWCA 4ES2A 3TARA 3MC1A 3E3XA 4M41A 4D3HA 5EN1A 1NWKA 1YZ6A 1LNQA 4JI8J 2ZOFA 3D66A 1XEZA 3D0GE 5CA7A 1KVCA 2DH9A 2VIXA 1L8LA 3KLIB 5IS2A 4GVBA 4DO9A 3DRRA 5ALUA 1BY9A 2W04A 5L9XA 2DIVA 2MZSA 1EWQA 2DNOA 1HYSB 5FPNA 2HHHF 2HBYB 4KLJA 3CVKA 1SXEA 4CGHA 3DLLQ 4F04B 4CGIA 3GMGA 2ODGA 3TAGA 3WK4A 2BBEA 2E20A 2HVHA 2GWKA 3NLCA 2LYHA 2GAGC 3SUOA 4ZLPA 5AQVA 1Q8BA 4JV5K 5FDLB 4EX6A 4I29A 4BC5A 2QXFA 3R3TA 5I3UA 1QD1A 3AAQA 2QARA 2FHJA 1KQKA 1EX4A 2M70A 2JSXA 3BM7A 1V38A 5AM0A 3RF9A 2P9CA 4QR1A 1BGXT 2VIHA 2MLXA 5AKGA 1BIUA 2AEFA 2W4PA 1SZHA 3ZTRA 1C1CB 2EW9A 2E5GA 1EKRA 3J7AP 7ICJA 2ZG6A 5JS2A 3QO9B 4FN5A 5FLXY 2P9LB 3VAHA 4G3IA 2QT7A 1U1RA 4BBYA 4FE3A 4EU0A 1HI1A 2A42A 3J7AN 3HCXA 1WF1A 2ASDA 3QAEA 1RTJA 3JTOA 3IC1A 4FLXA 4OKEA 4PXBA 4KHMA 1S6QB 2IVNA 4U7UD 2KL8A 3NF6A 4B1XB 9ICQA 2XHCA 3FVYA 2KTQA 2JJ4D 5KFNA 1RTIA 4ZN1A 3EMTA 4AM6A 2P66A 3IS9A 1YF5L 1F2GA 1JLAB 5HP1A 4BRAA 5KFYA 4MEXA 1WI6A 3QFWA 4FVMA 3O9QA 4ZVEA 4WFZA 3J81O 4GKKF 2CRLA 3AVNA 3LTOA 3Q8RB 2LKZA 5BREA 3N5BA 1B7YB 4LSZB 2G8HA 2BZ2A 3I56S 4UY8T 9RUBA 2DNGA 1H73A 3H5SA 1Z4OA 3THYA 3LOUA 1ZQBA 1N6QA 2DGQA 3U3YA 4K59A 5EDWA 5AIBA 1N8RT 3PKMA 4DL0C 3MR6A 4IH5A 4Y2XA 1BVSA 1SCJB 4JI4J 4OGCA 2X1GA 1JCEA 4J5OA 1BQNA 1ZBTA 4V19J 3BP8A 1AFIA 4TU7A 4DR4K 3AA2A 3KKSA 1T9VA 1BLUA 1UEVA 4EFAC 3V9XA 4WCEL 3OR2A 2NSBA 3MMJA 2QA1A 1S3XA 5BXIA 2YNHB 1BC6A 4TY8B 4MDBA 4A62A 7ICIA 3SBMA 3MM5B 2AIRB 3MBYA 4OI3A 1M1KO 5KFSA 3I28A 3DLEA 7ICFA 1EQMA 3UD4P 1DTQB 1KWMA 3FZBA 4A2BA 1U2FA 2HW3A 1SC1B 3CCTA 4B3TJ 1WD6A 4B3SF 1RTDA 4OYZA 5EOZA 3CB4A 2DGSA 1K8AT 5J2DA 1JCGA 4CJ7A 3CIZA 3D9BA 4HWIA 4RWTA 2E8MA 1S0NA 4YFKA 8ICHA 1T05B 3VOVA 2HMXA 5J8YC 4F8RA 4M3RA 3R6GB 2HVIA 2DF4B 4TY9A 3CCES 1SZ2A 2FZGB 4CLWA 4NYNA 2ITMA 2OEMA 4DV2F 2NPIA 3SK3A 3V7KA 3EKUA 1S6UA 2VJVA 4UQGA 4F91B 2ZIWB 3UXOA 2FDNA 2CDRB 2H51B 2F9DA 4M6WA 3UKRA 1FDBA 2B6AA 3CPWM 2Q31A 2I0XA 2XGPA 2QIFA 4DR1F 2IHR1 3OGUA 1NJXA 4I2HA 2LXIA 4DR3F 4KHWA 4CEQA 1RAJA 8ICIA 4KGKA 3LGHA 3ZYYX 1S59A 4ZLLA 4PXCA 3W5ZA 7ICMA 4JAXA 1DTTA 1NBEB 3BUZB 1N32K 4CHZA 3IR5B 4NM1A 2ZH9A 3POTB 3WK5A 4KLSA 1G4CA 3MCSA 4GY2B 2B21A 2ATLA 5KFWA 4USAA 2RIJA 1ZM9A 1ZQIA 3UDVA 3HWTA 2X3DA 1E4FT 3CO9A 3PKYA 2F96A 4C97A 1VQPN 1RT3A 2XCAA 4C1NI 1TE2A 4P2HA 1S72N 2ZD1B 4CO0A 2KVQE 3HHLD 4YB6A 2F8HA 3QUBA 4UAZA 5CYMB 7ICEA 5CD4A 1MN9A 3S1TA 3EZ5A 4FSVA 1C0MA 1S0VA 3H4DA 2CWKA 5F41A 4J91A 1NM1A 4DMNA 2YX6A 2JLGA 4ECSA 4OJ3A 2ZUDA 4CERA 5IQQA 3LZIA 1QM9A 3GSDA 4ZJQA 3MUMP 4CJLA 3MM9A 1ZS6A 3POTA 1VJWA 1NDKA 2KVSA 1NO8A 1RAHB 4PZVA 3C65A 2YQ3A 3M3ZA 1OSCA 1BO5O 1XU4A 2NO5A 2RHFA 2F1IA 3F5AA 4JK1A 2FXUA 2ZM6K 2JVRA 2G8WA 3CD5A 3QYYA 3A8YA 1TAUA 1ZM3A 1AB8A 1QUPA 1ZQHA 4E7JA 4LH5A 4LFBF 2ZGYA 3PIPL 5AXLA 2OPSB 5CA5A 3CJSA 3G6XA 4MIBA 1KQSM 1IQZA 2L08A 1NGIA 1JJHA 4I2FA 2UUWA 2PI4A 5ALSA 4X4SA 4KMUA 2X7IA 3P8BB 3SQGB 3QYPA 4CW7B 4RW6A 2KG1A 2CXYA 2OPRA 1TUUA 1EP4A 4C8NA 4CEDA 1XSNA 1NHKL 1TYQB 2W55A 4ER8A 4LZGA 3CERA 4M5LA 4C8LA 2KT5A 3B4DA 2E9ZA 4B08A 1TL3B 3J8AA 5AJ3F 5ALGA 4LF2A 1ATRA 2Z57B 3GFYA 3PHEA 4PQUA 1QAYA 1K0VA 3LAMA 1DARA 2JMGA 3KFUF 3G4SS 2HOFA 4ZS6A 1RCHA 2QLBB 5KL1B 1TFWA 3UMGA 1NZPA 4WPAA 4RQ6A 1RJJA 5TISU 3CCWA 3I0SA 5AK3A 1JLAA 4LR8A 3AVHA 4FS2A 4DTRA 1IKWB 3JB9k 3H0MB 1XR5A 1HBOB 2YPZA 3JAMU 2A1BA 1RWOB 4F3MA 1RBAA 2R9LA 1H2VZ 3AEVA 3AY0A 4BE0A 4WKYA 2EG1A 5C24B 2PFUA 5F8MA 2XY5A 1EETB 3D2QA 4DU4A 3TAEA 2BQUA 4I7FB 2MMYA 3AT1B 2QL7B 3VVUA 8ICXA 4PA1A 4PGQA 8ICAA 3M9MB 4ED3A 2OJ3A 4V1Ak 2NS1B 2E2NA 4QZCA 1IV0A 1D0EA 4K4VA 2JC0A 2KT2A 3MMBB 1A5XA 1QY7A 1KVJA 2RMLA 4JI7F 4CTAB 2GNKA 3BBBA 4YMOA 5JJBA 3NGUA 1SIZA 4LFBK 3VAFA 5BRDA 2ZD1A 2AQ0A 2P9SA 4CQ1A 1U0HA 3L6QA 2E1YA 5DM6L 3M9NB 1QSYA 4CJFA 4M7XA 4LF6K 3FMBA 3UB5A 1KAZA 2RILA 4LR9A 5AXMA 1BI4B 3IWNC 2B9YA 4CHNA 4NRUA 2K89A 1AXQA 4XO0A 1ICEB 1RLDA 1DJ0A 3F5EA 4Z6DA 2MJUA 4IFEA 1F5BA 3IR6B 4YQWA 3OTOK 4NLPA 3CJ7A 2DGXA 3G2XA 2P6SA 2J0SD 2M9KA 2BR0A 1LB2B 2Q79A 2BZFA 3A4TA 3WNHA 4PG4A 3MECB 5F8HA 2QLXA 1IM6A 1HJOA 1Q9XA 4FJLA 2IAJB 1UEKA 3K89A 2DBYA 1VSJA 4ZPTR 4HUEA 3THWA 3SMSA 2XY6A 1LXJA 2HS4A 3HPGA 4NYZA 4KX5A 4ZP7A 5DDPC 1S22A 5ADXA 2BM0A 3UPQA 3OUYB 4YOXA 1CVJA 1HNZF 2GWJA 1VJ5A 4DR6K 4UOHA 5HANA 2CQ4A 2GWSA 2W9MA 2BVZA 5J2GA 2HVEA 5C42A 3UMBA 1Q81O 2QXLA 3BBFA 3B54A 1X4BA 1XC3A 2W2NP 2MKCA 3KLIA 1COOA 3C6AA 4AHCA 1SQGA 5IILA 2UZAA 1UMJA 3MDAA 1VGYA 1IR2A 2NXUA 3HRGA 3CG7A 1JLGA 4DV0J 2QB0B 1LWCA 1REGX 5IIIA 1Y97A 3T1HK 4RUBA 5TKYA 3WEEA 9ICAA 3CQ8A 2BPFA 3OS2A 5C7PA 4CH1A 4CO2A 8ICNA 3THYB 4O5KA 2GVZA 2H5JB 5KG1A 1LEOA 3NAEA 3NUQA 2IMWP 1VLOA 3KYLA 1U1MA 2K1RB 1M0SA 2KSOB 3P5BP 2ZHAA 3GIMA 2ACYA 3J80Y 3OYEA 3M32B 4CLKA 4TURA 1M90O 2P6UA 4FZNA 1M6YA 3O4QA 2C2MB 1TL1A 4CZHA 2W42A 3CSKA 4E89A 5AICA 1YK9A 2VA8A 1KDHA 1JN3A 4ZH4A 4CDGA 4JHDB 2BKPA 3A0IX 3MUVP 5HJXA 4JKEA 2YI1A 4BJQA 1A5WA 4PL8A 4M04A 4E8UA 1YJUA 4UB1A 3CM5A 1O8BA 1Q86O 2HNYA 1JX4A 1JCFA 4RQ0A 1H2TZ 3PJ9A 1WLJA 2BJ7A 2K4IA 3KWGA 1AQ6A 3ZSQA 4YCXA 1HPMA 4CHYA 4JP8A 2Y1LB 2NR0A 2ZC3A 4GMKA 2PZSA 1FJGK 2ATCB 2E66A 1H72C 3Q8YA 3NTUA 1R43A 4DFJA 3M2VA 4YD2A 4K7QA 1IVZA 3CI5A 1SJQA 3MK6A 4I2AA 1U49A 5KFZA 2G8UA 3M8RA 1CJUB 3I0RA 1SZPA 5I42B 2VU5A 4AQYK 1U48A 1RBVA 1NSKL 4FW1A 3UD5A 2WONA 4RQ7A 1KOHA 3FUYA 2A41A 1FRKA 3DKDA 1WOSA 4AQYF 4IDKA 2P9UA 4FLYA 3AVIA 1HIYA 5DZ6A 2RDJA 3T1YF 3BS5A 1VHIA 2NRVA 4F9OA 5GVQA 1BUPA 3T9NA 1ZPVA 4Z94A 2YTUA 3ELHA 1ZZFA 5J29A 1EWRA 3MDFA 5KFVA 2ZDPA 2DY1A 1FIQA 4DUYJ 3DI6B 3N0VA 3BF3A 2WFAA 4DL7A 5AQFA 5C0YA 1G1XA 4M9GA 1OYDA 4JK8A 3THXA 3S8SA 2Z2MA 3GSIA 1OKJA 4DQSA 1VBZA 4XUSA 4QJVA 1NJZA 2YY6A 5FDLA 2XYPB 1URRA 1LKYA 4DV4K 4EI2A 2HAFA 3KWMA 4B17A 4CE6A 3FGUA 3VCBA 1H2UX 1YT3A 3HILA 3N28A 3KLHB 1SI9A 2ZJQL 5DG8A 3I56N 8ICVA 2VG6B 4I64A 4LRBA 1U0HB 1NEEA 1ZQKA 2HLTA 4FJKA 2RNEA 2LM4A 4ES3A 3P5JA 1ZQNA 1R0AB 2E1AA 3VEOA 2PBDA 2HFOA 1FXDA 3H0PA 3T1HJ 4RBTA 5LXRA 3N7SC 1XSLA 8ICTA 4X66J 5J1NA 4CJ4A 2AJ0A 2F8EX 1EZZB 2V2ZA 4GW6A 1XBWA 2JDJA 3K5MA 2RQ5A 3MAAB 3TWHA 1JJ2M 3AARA 3SENA 4BXOA 4TVAB 2MRLA 4CIEA 1M5VC 1SH0A 2RQKA 1RILA 4XH1A 3Q22A 2KHOA 2FHOB 1N0VC 4TY8A 1RE1B 1SV5B 2FPMA 3V6DA 2KFZA 4EYHB 1NOMA 2VC1A 4PGXA 2D9PA 4JHDA 4DF8A 4FLZA 3ALYA 2F8LA 4OYXA 2OA8A 2B9WA 1SIJA 3AVAA 1FDDA 2NUUG 2W1BA 3UDEA 1PUZA 1EP4B 3PYGA 4C8YA 2E2OA 3MMCA 5ETMA 5AQYA 3CCVS 5CQGA 1IR1A 2XTJP 2UYTA 2XWYA 1O51A 2FLOA 2VQFK 1YUWA 4CLLA 5IIOA 4CD3A 5CWRA 1YRTA 4KLTA 1NLKL 5KFDA 2CPEA 2GQCA 4QZFA 1NDCA 4WFAL 5CEHA 4F3OA 5ALKA 3KJQB 3N5FA 1FFVA 1TK8A 5HO4A 4LIWA 1VDVA 4F4WA 1YI2N 3AD9C 1I39A 3JAMY 1C0FA 1C1BB 1FO1A 3CF5Q 1DY3A 2VOOA 3WK9A 2KHQA 1ZQLA 1U1NA 2L41A 4J9LA 5A0LA 4NEZA 1HUZA 2LLZA 4HACB 4OHWA 4IQUA 1RG6A 5ALYA 3UW1A 2DPIA 4KB1A 1X4CA 2VZ9A 1P6TA 3VQ6A 4DV3F 4KHNA 2PMZF 3QNOA 2HSZA 2HWHA 2W6LA 3IP4B 4ILHA 3K1ZA 4I4BA 1YGYA 4JV0A 3R5DA 2ITGA 2ZBQA 4JI7K 3MXIA 4CM0A 5J2PB 1XTZA 2IHNA 2AWZA 4BUGA 4OYOA 3ZTSA 3TJ9A 1FRJA 5G5HA 3TSPA 1YJTA 3O8WA 2ZIVA 5CAAA 1KVAA 1HMVB 4FK4A 2A5XA 2PFPA 5LMNF 4MFBB 4C0HA 4B3SK 3TA0A 2LCWA 2HK3A 4IC9A 3B0YA 2RU3A 1FJEB 3NS5A 4L75A 1VQNN 3RRKA 1ZQFA 3JAMO 3NVYA 1W2BR 4FXWA 5AQOA 3PSPA 5GAGP 1JNZB 1B9DA 1B92A 2LXUA 3A8JA 4PKHA 1KOOA 4UB3A 1OPIA 4KHPJ 1NGAA 4PWUA 4LSNA 3NBPA 3C2MA 1B4SA 5DGAA 1SJFA 4PCQA 3EKSA 2AXTU 2DBBA 3PEJA 4LBHA 2E6LA 3H0RB 2ZIVB 1RGVA 2KVCA 3D2WA 3BGRA 2BOAA 1U2VA 3L4QA 3QZ8A 2U1AA 3H90A 2HHHK 4HCCA 1QAJA 1TAQA 1HD0A 3A3NB 3VQTA 3K58A 2B4VA 3HF5A 2FF6A 3PVXA 3LA0A 1ROFA 5IFMA 2DNRA 3KHRA 4DCCA 1ZQ1C 1HBOA 4NLSA 3HJEA 1T7PA 1I94J 1KDNA 3KLGB 3RAXA 1DK3A 2X6SA 3D0HE 2HFVA 2A1SA 1WUDA 2VL1A 4YHHK 1JJ2R 1XNQF 1VLYA 2AYMA 2VPWB 1F2HA 5F3XB 3V7JA 2KO1A 3CQXA 1HYZA 4HTIA 4KB7A 3BREA 2E5IA 4PKIA 3MCAB 3MABA 3R6MA 2K1RA 3BN7A 1WN7A 2G09A 1RWUA 5BPNA 2AQ4A 1RAIB 2UUTA 3CCLN 1TL3A 3SAFA 4YB7A 3LVWA 5LSOA 1NOZA 1KD1T 3FBEA 2DTUA 1KNZA 1BCOA 4IG0B 2JEFA 3LDPA 5EXWA 1JLGB 1N36J 4K4ZA 1L5UA 1BPZA 1EKSA 4QWEA 3Q8PB 5BOMA 3Q83A 4FF3A 3R7BB 3FBFA 3V4IB 2QA4N 4NEYA 2WB4A 2R7SA 4KGXB 5AI0A 4QZDA 3HKZD 3OYNA 3KK1A 1XNRF 2HNZB 3L09A 2CJKA 4XQ8A 1X9WA 3O9TA 2W3RA 5HL7L 1WOPA 4JKGA 4WFNL 4ZJOA 1M5HA 4M5KA 3PNCA 3K0JA 5ETLA 2OCEA 4KN4A 2ZOGA 3TX0A 5KFUA 3CCMN 1N8RO 4RPYA 2KM8B 3NRWA 1WSGA 2BDPA 2QLWA 1Q7LB 1GMWA 3M6VA 4KT0C 5CYQB 2IFXA 4HUGA 1SUQB 3HTVA 1CLQA 4OX8A 1P1LA 3HULA 2J76E 4UARA 2DCUB 5HMWA 3K9KA 1FNXH 2GZOA 1R27B 3HSDA 1D8YA 3S01A 4CJQA 2VH7A 3CJ9A 4C4SA 4NCAA 1UHUA 4P72A 3NCPA 4ZIWA 1GO3F 2KICA 1QQ7A 1TL5A 5A0YB 3KLEB 2ZUBA 5D6GA 4CO5A 3BSNA 4CEBA 4IBNA 3IFEA 1NCLA 5KQ8A 2XLJA 1K9MT 1K6YA 5GIPA 4IUFA 4LSLB 2V67A 1U2RA 2Z0GA 9ICCA 1RHRB 2NXEA 3N6NA 5CYMA 2PN6A 1KQFB 4CZCA 3OTOF 4E7LA 1KD1O 4A4JA 9ICTA 2Z2ZA 1QQCA 4JUZA 1SKSA 3CMQA 1IBMF 3MX5A 2O5DA 3IKMA 2F9TA 3QEPA 2PYLA 3JS9A 3VEYA 5JS1A 2E8PA 1RKJA 1ZXOA 3DOMA 1HUOA 4YOYA 3OLBA 4GXJA 2MY8A 1BCMA 2H3IA 3BEXA 3NGYA 2IVFB 3TVZA 1VQOS 5DLFA 3DLHA 1RPLA 3QLHA 4CEOA 2RP5A 1N5QA 1N5XA 2MY7A 2BOPA 3D6HB 1ASVA 1LAWA 9ICKA 3SJJA 1C0TA 1B0VA 4NLCA 3TFSA 3PXGa 4Y2YA 3D3BJ 2E9TA 2OAUA 4FZXC 2F4VK 2LBOA 4O3SA 4DPOA 1HKAA 5HAOA 3Q8SB 4NLDA 4TUSA 1I5OB 1ITGA 4H0TB 1NK9A 1FWPA 1GOAA 2BANA 3M30B 1LWEA 5CYJA 5AM1A 4CO4A 1FJGJ 4MO4A 2OEJA 3PDNA 2FJWA 2J8SA 3C14B 2J4RA 3GIJA 2DUYA 3WT0A 3G8SA 1FKOA 2NXCA 4OJGA 4DG1B 5D15A 2AYEA 2F65A 2HK2A 3K5LA 1WKKA 3AD7C 4FYXB 2Q4TA 4M94A 4AXIA 2WSCC 3GCXP 3IAYA 3DOKB 3UQ2A 4USJC 2OP5A 3AAWB 2E44A 4EHTA 3RBZA 3PR5B 4W5NA 5AKKA 2FYXA 4NA1A 4S0MA 4LH4A 2D0BA 2EKYA 4X4TA 5IWAJ 3TADA 4M1KA 2QKQA 4PKDB 2ZJ5A 4DZDA 3RH5A 2D4WA 2YH1A 1ZOTA 3SQ0A 4CJTA 2EI5A 1VYAA 3ILLA 3C6UB 2XHWA 4YDXA 1SQFA 3W2WB 2ISPA 3M5RA 2RSQA 3H59A 1NK5A 1TKXA 8ICOA 2BKNA 3N4PA 4BGAA 5I3QA 5DK5A 4ZTJA 3UCGA 2ILYA 1VSLA 1BWVA 2PGCA 3A5OC 1T94A 3ZSXA 3CCVN 4JBCA 1YTAA 2YWWA 5KI6A 5F9NA 2KXHA 3CJAA 3ZT2A 4ZA1A 5IM0B 1W7WA 2XMJA 3BR9A 2OM6A 4M2YA 2YNFB 2PFNA 3CF5L 5K20B 4J9SA 1VSDA 2RJZA 4B1YB 3CXCR 5KAFU 4WJBA 2EHGA 3TUIC 4JI0F 4LF9J 4DL2A 3WBZA 1U6FA 1FKOB 2QJ3A 1GEHA 4BRMA 1KLNA 3VGKA 2HBQB 3GFHA 2GLEA 1RCOB 3EUNA 4CIOA 2ZH6A 5KFKA 3IBPA 4RWXA 4MO5A 4B3OB 3FYHA 4TXSA 3VAKA 3HPHA 2HEKA 5GAEI 4OFZA 4N77A 2VICA 4Y0FA 4DV7K 3ZZRA 4CIGA 4B3TF 2GH1A 4IG0A 3PIOL 2KU7A 3OTEA 3I96A 3ZD8A 1HQ2A 4FZVA 3OHAA 5BN8A 1KN6A 1WTFA 2I38A 2NXJA 3R1LA 1U2VB 1WWHA 4G1QB 1UZDA 4DUYF 3ZT0A 4CFDA 1RQ0A 3WDOA 3EZUA 4NLKA 4H0YB 3DI6A 1S4FA 1P9QC 4LMZA 1WSHA 3EEQA 1D4XA 3WC0A 2QK9A 5CY4A 2ZHOA 3ILJA 3IMXA 3AFGA 1XHXA 3MX2A 1MW7A 1Z2ZA 5KOWA 1U7LA 1JROA 1TFYA 4UUXA 2QLFB 3T1YK 3EXCX 3T5HA 5A8RB 2K3IA 2FVCA 4AL5A 2YMMA 5I42A 5LSLA 3OR1A 4PG8A 2KZZA 2E5SA 1X3MA 3CCRN 1Z3EB 4OZ3A 2RDIA 1F1BB 4BWMA 3MWTA 3K5NA 1B22A 4C0BA 5C2CA 5I4MA 1BNOA 5A2QO 7FD1A 5CE3A 1TU0B 4HEA9 2VBYA 3QERA 4WQ4C 4ILJA 2JWLA 5J2MA 3ALRA 2ZE2B 2V52B 5GMEA 4WF9L 2B5JB 4M6WB 1KXPA 1RYSA 1WYGA 4EELA 5A8WA 4FVCA 2J8AA 4DQIA 4I69A 3VERA 3OJUA 2KZ3A 5DO2A 4KE5A 2FZKB 1M5PC 1G2EA 1NGFA 1T95A 1FDAA 2I2YA 2ZWPA 2EC0A 2HG4A 2WTUA 2E2PA 3VZIA 1F5CA 1RT6B 3L2VA 3TNVA 4JI6F 1NK6A 1W25A 4KY3A 4J37A 2QYCA 3I9ZA 2FBTA 3QATA 1ZBLA 2H5XA 2YVSA 3LANA 5HLFA 3NVZA 2KJ8A 1WDTA 4GV9A 1N2XA 3VR1A 1PVRA 2FIUA 4JV5F 4KV8A 4AHTA 2N82B 4B3RK 5CCLA 4QNLA 3V6HA 2OMOA 3SXLA 7ICUA 3FQLA 4KLOA 1OWXA 4ILLA 5F0WA 3BO4A 1REVA 4GC6A 1KVIA 4ZP9A 3ETMA 2MKIA 2PT0A 3RWUA 1JI7A 3CJ8A 2HHTA 5KFAA 2YHAA 4DQQA 2CQ2A 4QWBA 2HQIA 4USIA 2LMRA 2DGWA 3HFKA 1UFLA 4YS2A 1PG5B 2XMVA 1GK8A 4M5GA 1TP7A 1B99A 5T41A 1R7IA 2P9KB 2W54A 3U7JA 3V9SA 3FDSA 3H0LB 3D6MB 4FZLA 1N48A 4OJOA 1X4HA 4UOCA 2WOMA 2KJVA 3IG8A 2B3TB 1XK8A 2HBLA 4YN3B 4CO1A 1Q5VA 4OHYA 1S7IA 4B1WB 1VOMA 4DSJA 1HQEA 1L7NA 4OJ6A 2LM1A 1UVJA 2IA6A 3BEGB 2NRHA 5E79U 1NH7A 5LJVA 3G4SN 3N6LA 3CJ3A 4BGBA 3SQGA 3NCIA 3AHPA 4B1VA 1HNWF 1CJKB 1WKLA 4WXOA 4QU7A 2ZWOA 5GIOA 2VDHA 3LP3A 3HSCA 5J2AA 3HP9A 2ZUCA 4KLGA 1KVKA 2V4QA 4X65F 3BO3A 2ZH3A 2MB0B 9ICUA 1N54B 1S0MA 3IRWP 3OVBA 4ZLJA 1TR0A 2D6FC 2WF6A 1RHUB 5J2BA 3GG1A 4FK2A 3N01A 1MMLA 1Q46A 3PRDA 7ICOA 3SD7A 3D1HA 3H46O 3W3DA 3QU5A 3TUZC 3RU0A 1VMBA 5EGYA 4Z4EA 3TZWA 2MQQA 4N7TA 3HFZB 2ROGA 5ADXH 2KKPA 4BDYA 2WOMB 2R8GA 1Q81T 3J80O 4DJBA 5KL8B 1T03B 3GONA 3MGVA 5L46A 4AILC 4YG2A 1LFWA 7AT1B 3H1VX 4WK1A 1EB0A 2F77X 4M5NA 2E1FA 3MGJA 1XQIA 3DU6A 3MHYA 3MXMA 4J9QA 4CJ3A 2ZH7A 3AD8C 5B08A 3MURP 2V51B 3GG0A 2WFBA 4PH5A 3BYPA 4TNOA 3UFCX 4U7BA 2C3YA 1SKUB 3TUPA 3IO1A 3E9OA 4BACA 3IM1A 3RUBL 2X51A 3OVNA 2Z56B 4F4KA 2LYBA 2DFLA 2XEXA 3C5FA 2QE5A 1ZQMA 1AW0A 2D3O1 4X4RA 1TK5A 4RQNA 3CD6N 4A8MP 1GXUA 5ALXA 2EVZA 1A5VA 3CM6A 1XHZA 4OD0A 2MZJA 1HNWK 2K4HA 3SCXA 3WKDA 3HYFA 1XNRK 1JL1A 4I2IA 3SSRA 1JLQB 3VQ7A 3QRRA 3DCAA 2KT3A 3AXKA 2NXNA 4TYBA 3OHRA 2W43A 4WKRA 2HHWA 1MN7A 2PFOA 3H42A 2AT1B 4NLRA 2QN6B 5AQPA 3OW2M 4TQSA 4CZMA 1GLAG 4J9UE 5AE3A 3VQSA 4ELVA 2VODA 2QTDA 1W9HA 3ISCA 3CTRA 4OHZA 4ED5A 4O8UA 3A5NC 2BYCA 1V3ZA 3ID6A 5AM4A 3KK7A 1WOOA 4CLUA 4A8XA 1B7FA 5C12A 1T3NA 3S7RA 5KFCA 2G5HB 3PW4A 3H5YA 2ASYA 3H45C 2NLWA 4UW9A 3AXMA 3C15A 4P4OA 9ICWA 2WC9A 2YWFA 5F0UA 4CH7A 2IIRA 2W03A 2KZMA 4DR6J 4OVLA 3G6EN 2RRBA 5IIMA 4WK3A 2B9XA 2FC9A 3DXBA 2OGUA 4NE9C 1Q5YA 4Z6FA 3I9V9 8ICFA 3CHWA 5AI4A 1NZAA 4NX9A 4LSNB 3PZPA 5D3GA 3B9JA 3EE9A 2V69A 2UUAF 2GO7A 5BYSA 3Q2TC 3QU9A 4MH8A 4OGEA 3C28A 2J0XA 2MQLA 3SQ4A 4I9QA 3KJFB 3FGVA 1BL3A 2CQGA 4WP8A 4GKJJ 3HFVA 2I9GA 4MEYA 3T6JA 3PMNA 2BJ9A 1RXOB 2NV3A 4OZ1A 4CT9A 1Z2LA 3W7BA 4ZTFA 4E2FB 3IGNA 1SQKA 4HT5A 3H3OB 3VQ8A 3LP0A 4DL6A 1YJWS 4Y1DA 4QYZJ 3QICA 3T41A 3AJDA 4DBQA 5LL6d 1GMVA 2IPOB 3WIVA 2QARB 1U45A 2RH3A 3D2EA 1SWVA 4DV2K 4YR3A 5AI6A 4HHJA 2IVYA 1DRGA 2M0NA 1OS5A 2YKPA 3CMAS 3FQKA 3DRXA 4DHVA 2YKNB 4H0VB 3A5MC 3PHTA 3RJIA 4IEEA 2RF2B 1NB2A 2A3ZA 4CK3A 1CSJA 5EWEA 7ICVA 2J9CA 7ICSA 2JZBB 2R18A 2W2OP 2DEJA 4JI6K 3H20A 2VFUA 2DHXA 5E0OA 3U3GA 4OJHA 3CJ4A 3OL9A 4KLDA 2ZQBA 3EY1A 4K0KK 2L48A 5HQLA 4JK9A 3P5TL 5FLXO 3UKUA 1WG4A 1FO4A 1NKCA 2IRYA 1NNEA 3G8TA 2WBMA 3HPOA 3FK4A 2QSWA 3CIMA 2PKEA 3NRBA 1W7AA 3U9ZA 3MD1A 2CZVC 2DRAA 2EK1A 3W60A 3RW6A 5KFEA 4NY8A 4ZPCA 1MQ2A 3QU2A 2EDUA 4UAYA 5J2CA 5KFRA 4OJ1A 3A12A 4ZVUB 3H08A 3HHEA 2R3VA 3AA5X 3J7YP 3RB4A 2XIDA 1UA1A 2KVIA 2P9PA 1ZA1B 3RFAA 3SDEA 3R1HA 2IDEA 2XC9A 1JKHB 1GLCG 3ISDA 4LFCK 3BQ0A 2QSFA 1J2MA 4WP9A 2W4DA 5FPEA 2EFQA 1VAZA 3KKFA 2PMZC 5L1MA 2V4JA 5IQ6A 4FLTA 4A2AA 5CZXA 4K42A 5J0RA 3NF8A 1VCTA 1U25A 3E01B 2ZITA 2VYPA 1KR4A 5DBBA 3KNAA 1RUSA 4F5PA 3NY0A 3AGKA 3JPQA 1UEUA 2CPYA 1ZRNA 2KFYA 3PO4A 4R5PB 2E8OA 2PMWA 2AX0A 1DGKN 5KRTA 1GLLO 1CZ9A 4CJ5A 5K8PA 5B5EU 4RU9A 1N62A 3MOJB 3VZHA 9ICPA 4YB1P 4DFMA 1U6ZA 2W4CA 1ZM2A 1HRHA 1K47A 2HAIA 2VWJA 4QZ9A 3M7DA 2FLNA 1TKZB 4ZVPB 2HI0A 1XIQA 4ES1A 3KJVA 1S1TA 5M1NA 1WHXA 2MZTA 3DLRA 1ZD2P 1OVYA 4EGLA 1LW0B 5ETVA 3J7ZT 3MM7A 2VUGA 5JTIA 3DHWC 2AGQA 2WONB 3HKZF 1RWNB 1GLDG 5BJRA 4Y1CA 3TW0A 1FTCA 4JI5F 2J6TA 2HHXA 2GUPA 3CCQN 3E51A 1OQ6A 4DTXA 1RDDA 3PSIA 3HDSA 2HVZA 5F8NA 4ISFA 2BE2B 3SAHA 1ZQVA 3M6WA 2Z1IA 3VQCA 4JWMA 1DLOA 4CZLA 4KH4A 7ICHA 1A76A 4PPZA 3H5UA 1Y64A 4FP9A 2N7CA 2DITA 1XNSA 3ITHB 4MF8A 4RPFA 3HZEA 3D6TB 4QZBA 5ETKA 2P9SB 4FJ5A 4HI1A 4PXEA 3GJQB 1N61A 3QSYB 1QQNA 2DFEA 2V6AA 4FWSA 4G1QA 3C46A 2E1ZA 1VK3A 2DY4A 4G1PA 1RYRA 4D3GA 2OZSA 3PV8A 4DV5J 1HWLA 3ZZPA 2CPRA 1NSPA 4Y0WA 3DLKA 3I5CA 1QHTA 1URJA 3J7YU 2RKIA 1RDBA 3I8BA 5I9EB 4I7FA 4RPXA 1Q9YA 1FT8A 1VIOA 5ETTA 4G6VB 3DGVA 4DV3K 2VONA 2QO3A 2HOIA 2GVZB 4NLUA 3OL6A 3Q7BA 3OHBA 2YB1A 4NMXA 5J0WA 3B8AX 1IKXB 5KG6A 4CZKA 4OPJA 3TVYA 2HIYA 2F7VA 4ZVHA 1VRUA 3V6DB 3DXMB 3VQDA 2UXDF 3PW5A 1Z26A 2R42A 1RU1A 3JPOA 1IBKJ 8ICMA 1UWBA 5M2RA 3EWGA 5HJYA 1PGZA 4C98A 2KLAA 1DBDA 4WWSA 4MIWA 4WF9Q 4F71A 5C2GA 1TYQA 3IWXA 2R7OA 4IH7A 4LFAK 3CJ5A 4UATA 4I67A 2V5HG 1TL1B 2OYQA 3M8PB 3ISBA 4Y34A 1SC3B 3C7NB 2KXNB 2EXUA 5AK5A 1UAWA 3G10A 3MEGA 3EVWA 2AZ3A 3E01A 4NLVA 1UTAA 5HRPA 3U4LA 1UPMB 2FJDB 4DCJB 1LK7A 3PEHA 3WKEA 1HKCA 2NRZA 1GX5A 2YNGB 2BABA 4PUOB 2EFNA 2M52A 3O80A 2DHSA 1WWUA 3WC2A 2LI6A 1F44A 2O8DA 1S79A 2CPZA 5KT7A 4HDGA 4RQMA 1T8EA 1PK3A 4M3UA 1UJ4A 4B3MF 3TOQA 3NFAA 4CIFA 2FMSA 3L3CA 1VBYA 3BQTA 3CCZA 4QIVA 5J0TA 4RW4A 1RU2A 1N5TA 1TVRB 3UI3A 2W8KA 1FKPA 1HW8A 4CE9A 5HP1B 2C28A 5E3RA 4LJMA 2DPNA 1RWPB 4EMDA 4C23A 3VWSA 3R1XA 3BZQA 4RT3A 3AVMA 2NYIA 3FZ2A 3WXLA 4BREA 4M3TA 5B66U 1BPXA 3AGRA 3K17A 2NSCA 4QYZK 1U8SA 5E7OB 4PL1A 1Q3UA 1DK2A 1ASUA 3K75D 1EQYA 3BPSP 2ZJRL 4MFCA 5LOQA 5AZJA 5IT0A 2C2RA 1YITS 5HMYA 3ZDDA 4YORA 1L6NA 3MFIA 3ETOA 2YX4A 4DR3K 2GMJA 5A0YA 3N7RC 5DM7Q 2O67A 5E3CA 4J9NA 1O6XA 3BQ7A 5AJ3J 1K0TA 3BH7B 4QZVB 5CP2A 2H65B 1B43A 2G0JA 3KJNB 3MM6A 4KLLA 2BXJA 5KFMA 4CGFA 4ED0A 1WHYA 3MR2A 3DDHA 3Q8VA 1OY6A 3BKUA 5ALMA 4OZLA 4K0KJ 2K8CB 3KLEA 1NGEA 8ICKA 2CDQA 2O1PA 4CO3A 4M42A 2DB1A 5AXNA 4C9DA 3TSQA 2AZ1A 2CKWA 2CZ4A 4BRLA 3CDUA 4LQ9A 3MN6A 1V3RA 2ZJ8A 4O3QA 3KDOA 2IC3A 1F21A 4J2DA 4CFBA 2VGMA 2CJXB 2H5EA 3R6LB 1QQ6A 1KP6A 5B0BA 5KG5A 2HSEB 1ZQWA 2HBMA 3FZKA 5HRRA 1XMQJ 4JI3K 5GAEU 4M9HA 3AJ2A 1KTQA 4QR2A 2OHDA 4N56A 6AT1B 1DT9A 5KG4A 1ITPA 3ZZUA 3C6TB 3G6ES 4HVZA 4ILRA 4LRDA 4FJMA 3LDLA 5J1PA 3K8WA 1IJFB 3MPVA 4UUWA 3SJHA 2YXLA 1IJEB 1QAIA 4RR5A 4EO6A 1U1OA 2K60A 3AVBA 1E6YB 1LW2A 1HNWJ 3OYLA 2V9KA 3MCNA 4OZ0A 1NJIO 4EBEA 4Z37A 4ISEA 2BE9B 4Y2IA 4NRTA 1VQ9S 2K7KA 4C3LA 4ZLNA 2JR5A 3W1YC 2DFFA 2IHMA 4FJNA 5E84A 2W25A 3UMCA 3CCMS 5KQDA 2RHQB 1LAVA 4KLQA 3J7YI 5FPMA 3QETA 4Q44A 4B9VA 5JVHL 4M5IA 2NUBA 4K43A 1YJNN 3CC2S 2HHHJ 4YR0A 2IYIA 1NK8A 2RRNA 2K2PA 2F1HA 4C0ZA 2Q97A 3CT9A 3L9ZA 3EO3A 2GUIA 1WB9A 2QC3A 3W3SA 4CJKA 2Q6BA 2ZH4A 2MGZB 2V4RA 3ATUA 2XMAA 3K9JA 3GIIA 2UV8G 3DMJA 4RCHA 3TEHB 1ULRA 1E6VA 3C14A 3EDQB 2KKZA 1RTJB 4DN0A 2K4PA 1RT5B 2NNWA 3M6GA 4X66F 3IM8A 4P73A 3ISNC 1WSRA 5J2NA 2FF3B 4QZEA 3QGHA 3ZNUA 1VQ8N 5HR6A 5AI9A 4EZ9A 2R2TA 1D9AA 2UVUA 4CHPA 3DOKA 1C1AA 1EXNA 4PHAA 1ZQOA 4C8ZA 3OR1B 1HFEL 1X4GA 4OV1A 3JSMA 4IG3B 2D0OA 2DR7A 1ZQTA 1V5VA 1JLEB 4R64A 2DRDA 2B51A 5CXTA 2YMLA 5CD4H 3BGRB 3HM9A 4CEEA 3HVRA 2AHOB 1R8HA 4ZN3A 1SGGA 3BGUA 3VCDA 3U02A 1HWKA 4K8ZA 2R4FA 4B02A 4MDAA 4MLEA 3GDXA 4LUBA 4JI1F 4OO1J 3KWIA 1KCFA 1T4GA 2C42A 3BYRA 3LO3A 5AZIA 1FRMA 4Q43A 2X1AA 3FFKB 8ICRA 3F2KA 1ZAXA 3FBBA 1NLVA 3TAQA 4WQ5C 5B0GA 4US9A 5ALWA 1SL2A 2ADCA 2V7YA 1Q78A 3TSUA 3ENBA 2NZCA 4LSLA 3KMQA 2XGQA 1IQTA 3V72A 1N56A 1UJ6A 4U9RA 3C1ZA 2POKA 2GS8A 4R25A 1S5JA 2VWBA 3KKAA 1ASWA 2NRTA 2UXBF 3PMLA 1Y3KA 3KZXA 1RBTA 2LQJA 3AAPA 2YX7A 4CD1A 3C1YA 4J7CA 2HIQA 4LF9F 3A0HU 1D8LA 1AFJA 2KP7A 2QB0A 4XH5A 2LA6A 3C5GA 1P1TA 2YNGA 3HI9A 4BC3A 1A6SA 2XB2D 2RHKA 4NI2B 3FAHA 3D0IE 3MR5A 4DEZA 4XRHA 4FF1A 1GLBG 1BQMB 4WU2A 5FRNA 2YHYA 1RACB 2FVPA 1HA1A 2UUCJ 3TAFA 1ZBSA 3HXMA 3TVKA 2WAQC 2ZEJA 4IRKA 3PFOA 4PEOA 3R5GA 2MGZA 3CFRA 4C8KA 5KGXA 4CJPA 1LWCB 4YMMA 1SXDA 1NRKA 1WAJA 4GVMA 3LAKA 4OYAA 5AQLA 1V6HA 9ICLA 4LJXA 2F3NA 5A8KA 2JGAA 4KX3A 1K9MO 1H1VA 2MPUA 1G3OA 2KG0A 4QZGA 3ICLA 4H5RA 4DX7A 1UVIA 2YH0A 1JLQA 1F9HA 1RTIB 2HFZA 4FWRA 2G5IB 1X8DA 2ZZMA 4P4PA 3LUYA 4LFBJ 2G1HA 4QS8A 4XH4A 4AQYJ 1IBKF 4QWAA 2QB1A 3BN4A 2ZBPA 1FK9A 3KUEA 3LALA 1BQNB 4L76A 1HNVA 4DX8H 5BPLA 1RT4B 1HKGA 4NXMF 4ID8A 2O8FB 2UXBJ 4F4ZA 5DGBA 1YJVA 2A6MA 3S41A 4KMOB 5AKHA 3GE1A 3M6XA 1R8CA 2GEMA 1IKXA 3ZT1A 1Y00A 1WCLA 3MXHP 5ALQA 2EFOA 3LP2B 3CDWA 3WK7A 3ZT4A 3VQEA 3RZAA 1MSWD 1TTHB 2ZJPQ 4RQ1A 2UXDJ 4OMFG 2HMIB 3AVLA 3ITHA 3F41A 1K5OA 2MUTA 1C7YA 2BKOA 5KG2A 2E5HA 4DR4F 3ZLJA 1N4LA 5K9FA 1OIAA 4GKKJ 1VQLN 1GLFO 4EZ6A 4ED4A 4FJ9A 5KG3A 4KFBA 5B7WA 2ZBCA 2WF7A 8ICUA 5HOOA 2YKQA 3RTVA 3LF0A 3AOBA 4EIAA 5ALIA 1F9EB 2UU9J 3O3HA 5AQNA 1FNOA 2E1EA 5D78A 2CPJA 2KD1A 2YCHA 3L3FX 9ICOA 4WQ4A 4BRHA 2AGPA 3RYLA 1TKTB 2I6XA 1JJCB 2AF6A 3BV8A 3ENVA 4OI2A 5JMVA 3AUOA 4RW9A 1JL2A 4KO0A 4OI4A 2HMIA 5AJ3K 1S1XB 5F3ZA 4UY8O 1YX2A 4HR2A 1U4BA 4RLEA 5DMRA 3VV2B 3F2DA 4RW8B 4UASA 4X62F 4I2PA 1PJ7A 1NB7A 3HZ6A 5J2PA 2HGLA 8ICJA 3D28A 3N4QA 4FWKA 3OYFA 3GOIA 4USHA 4DV6J 1RNHA 4KHQA 4K4TA 2Z1GA 3P38A 1S4EA 4PR6A 1J5EK 1WWVA 1Q1KA 2NYHA 4YMEA 3LYSA 5CH7B 4DV4J 3T9ZA 7FDRA 3M05A 3NASA 1ILYA 4DS4A 4M3ZA 2O8EB 1C1BA 2YTCA 5HVFA 1SWWA 3CULA 3TRGA 2P9IB 4CF4A 4M9NA 5KPZA 4JI7J 3B6OA 4WZMA 2CQDA 2CADA 3ZX2A 2OSRA 5D4PA 1PYTA 3DDNA 2MLYA 1LWXA 1TGOA 4FLWA 4C8OA 5EX3A 5BYQA 4LRCA 5DKWA 3NVVA 4NV0A 4I2GA 3M8QA 4KGMA 3VQ4A 1UCVA 5J2JA 5F8LA 1FJ7A 4U7CA 1NDPA 5DDOC 1FRHA 2O8BA 2DH8A 4W5RA 8ICSA 4FM1A 2HZAA 1RBOB 3R5JB 5GMDA 5LMUK 4IS7A 1VLBA 2N3LA 4BR5A 5KRSA 1I6JA 1VQKN 3C29A 5ETSA 4QS7A 2W2QP 2C2OB 4BROA 4RNOA 4C4TA 3KD5E 4KGVB 1UW4A 4NL5A 2WF5A 4O3RA 1CULA 1CXUA 2OEHA 5LL6Z 2IM0A 1FFSB 1NSQA 2MSSA 4HKQA 1IJJA 1VHFA 4M5DA 2CQ0A 2IBOA 4FYDA 2QA2A 4RQ4A 1QTMA 3KKAC 2E88A 2DD8S 4ERDA 2QV6A 5BOLA 4LVOP 5KPTA 4ICAA 1Q82O 5ALNA 4DUZJ 3RR7A 4PHDA 4DSKA 1PK1A 3DNCA 2DHHA 3RAMA 2E8AA 5ALDA 1DQAA 2NO4A 1Z4NA 4KAZA 4DG1A 2IRXA 4EX7A 5GADP 2P9IA 2DGOA 3NNAA 3AA8A 1J5EF 4UB2A 4LFAF 4NCGB 4QW9A 3EICA 4G9ZA 4FF2A 2ZKUA 4E3SA 3Q23A 4FVUA 2GIRA 5C25A 1QLNA 2XG8A 4R65A 2G9OA 4I1TA 3DRYA 2KN4A 4OI1A 4EP4A 2Y9HA 1PVQA 4C3KA 3BPDA 3SEOA 4E7IA 2AD9A 2IS3A 2CGLA 1MU2B 1WEYA 3FCHA 4ILGB 3RJKA 2AJ1A 3IAM9 5KT2A 2FD2A 2B0CA 1WKJA 3VGMA 1WUUA 4BR4A 1B4FA 1KRPA 2QMXA 2UU9F 1SBRA 1N0UA 3G82B 4ZDNA 3NH0A 1MMNA 4BHQA 3MMVA 2RUSA 2EKNA 3S3MA 3KLHA 4CFAA 3SR6A 1AT1B 1U1KA 4M9LA 3TABA 2X3GA 5I3PA 2UV8A 3QGPA 3CC7N 2OYYA 2N3OA 1K8KA 4Q8EA 2MAXA 3W2VB 1W97L 1JXVA 2XMMA 4I2CA 3MPDA 1U1LA 2PI5A 1DTTB 1FE0A 5J2EA 4ED6A 1U6BA 2BV3A 3QX7A 2CVIA 1IG9A 1T3QA 2E8NA 1MU2A 4H0XB 3UNYA 1ELOA 4WFBQ 1WORA 4MT1A 4KH5A 1ZH5A 1H98A 3PSFA 3ISZA 3A5LC 3X3UA 4ZCMA 3SEIA 2VV5A 1RA7A 2DNHA 1Q16B 2C3PA 3D2SA 2FLPA 4RNMA 1J2VA 1HBMB 4K50A 3WNFA 3RSEB 3NS1A 4URGA 1RWXB 4NLYA 3VGSA 1MROA 4NLOA 1DQ8A 5AM2A 4QW8A 5BR8F 4CCHA 3Q2SC 3G0ZA 3P83D 3P96A 3KXDA 3F2BA 1Z1BA 1QZ6A 4HHHA 4P75A 4TLQA 2QKKA 5IXUA 1D3WA 5HP4A 4YHHF 5J2QA 1XNRJ 4ZIVA 4M63A 4ELTA 1TMJA 4MIAA 5K14A 4DPWA 4E19A 2RT3A 5L38A 3NNCA 2QYGA 3SQIA 4NI2A 4ZVGA 3HHNB 1CJUA 3SIPB 4DZ6A 4DR2K 1L8OA 5G0RA 1RZMA 1KHVA 2CNKB 3T7ZA 1S76D 4KHRA 2IRUA 2A1RA 2MHEA 1MROB 3B4MA 5KOXA 3A2FA 4O44A 5HLFB 5KFHA 1DEJA 2Q43A 4AH9A 4R79A 4U67Q 4PAAA 2IOFK 1FKAF 4H4MA 4GV3A 2FC8A 4GKJF 4HTUA 4MYTA 4N41A 2GIQA 1UQVA 1O03A 1QCKA 3R27A 3KK3A 2WRMA 5BR9A 1FERA 4ANDA 1OH6A 2Y8WA 2AX1A 5F9LA 3E66A 2A19A 1Y10A 3I4PA 2LQ8A 5E3AA 2P8IA 3CJRA 1W2BM 3ZX0A 4FW2A 2KHVA 1F0XA 1KQGB 3VEZA 4LVSA 1OYEA 2H54B 3QT5A 4DPXA 2DYAA 1TUWA 2FUG9 5AQRA 1QSSA 4CBXA 1CJTA 4CJEA 2MKKA 1RISA 3NVWA 2YX8A 2XI3A 1X1PA 1T02A 2EK6A 3JQJA 1BWEA 2W7AA 4B9UA 4CH0S 4HT7A 3JTPA 4NA3A 3QQCD 2LEPA 3EZWA 2R8JA 5DDQC 2OELA 1FWLA 1JNRB 4C4WA 3DV9A 5DG7A 4CNYA 2GGPB 1YRUA