4F8RA

Bacillus dna polymerase i large fragment complex 7
Total Genus 204
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
204
sequence length
579
structure length
579
Chain Sequence
KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords DNA polymerase
publication title Structures of a High-fidelity DNA Polymerase
rcsb
source organism Geobacillus kaustophilus
total genus 204
structure length 579
sequence length 579
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4f8rA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4f8rA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4f8rA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4f8rA01
3H8JA 4DSIA 3L2VA 1BGXT 4ECWA 5HLFA 4OPJA 2B6AA 1LWEA 4OVLA 4RW7A 4LH5A 4RQ2A 1KLNA 1V9PA 2PFQA 2ATLA 3EWAA 4I2IA 3BQ0A 2ZUBA 1ZQJA 4W5OA 4I2CA 3HP6A 3H4BA 1RXVA 2WONA 3V9WA 4FJIA 3TAMA 3V1RA 4O9MA 2G8IA 4O3SA 3RR8A 4FLVA 1HMVA 4E19A 4CGIA 4Z6FA 5F9LA 4CJUA 4KLUA 4CIGA 1ZQFA 3KHHA 4X5VA 4MFBA 1UOCA 3HVRA 3H8WA 4B3OA 4J9OA 7ICOA 4BE0A 3ISDA 4FK4A 4FW2A 1ZQIA 1S77D 2BCUA 3S3NA 3SUNA 5CZ1A 4KHYA 5IINA 5J0OA 2D0CA 1GOCA 5SWMA 7ICNA 1ZBFA 3H7IA 3OYBA 4RZRA 3DM2A 1ZBHA 3AUOA 3T1AA 4F4WA 3LP1A 4Z4CA 1HRHA 3SQ4A 2BE2A 5JS2A 8ICPA 3KHRA 2KFZA 3M9OB 4DQPA 5HRSA 1NJXA 4M42A 1KRPA 4OKJA 2R8JA 4B9NA 3H08A 2KZMA 3QLHA 3SPZA 1UA1A 4AHSA 4LY7A 3JPRA 4DOCA 5KFXA 3EZ5A 2PI4A 3O4NA 2IGIA 4IDKA 3T5HA 1NK7A 4QWAA 3VQ9A 4CK3A 1HUOA 2BANA 4M9LA 4CF8A 1J54A 1WSJA 4GXJA 2ASJA 4ID5A 5HP1A 4Z4EA 1L3SA 1B92A 3OYAA 4NCGA 3KHLA 1LV5A 4IQUA 3AO3A 2XRIA 4FJNA 4RNMA 2OPRA 8ICVA 1TGOA 4YR2A 4I7FA 3RBEA 3DLGA 4W5TA 4BXOA 2J6UA 3DYAA 4CJSA 3KD1E 4M9NA 1MSWD 3RMAA 4P4MA 5EWFA 4DTOA 4AHUA 4KN4A 4CJ4A 8ICBA 5KFMA 3AVLA 1YVUA 5CJ7A 5KT5A 4N76A 4RG8A 3SYZA 1RBTA 3HP9A 4DOAA 4YN4A 4QZFA 4H8KA 4GC6A 1S1WA 3C95A 2D5RA 2IC3A 1WCNA 1SV5A 4CFBA 2BHNA 4I2BA 4KHNA 2RKIA 4CEEA 1VSFA 3QEBZ 1J9AA 5KFIA 5J1EA 1C7YA 3MR6A 3ITHA 3VA3A 1QE1A 2F96A 1WSFA 1RBVA 3OYNA 2C2DA 4C8KA 4E1NA 4XIUA 5DQGA 5CYQA 1JXEA 5J0TA 4M0AA 4IRDA 1U9LA 4FVMA 2Q3SA 4P4PA 1ZBIA 5D49A 3NBPA 3LZIA 5HHHA 4UBCA 4YNQA 4RQ8A 4E7HA 5F9NA 1VSHA 1PZNA 2IA6A 4CCHA 3PW2A 2FLNA 3AO4A 3C6UA 1JLFA 2ISOA 4J2BA 2KFNA 3O3HA 1T3NA 3S3OA 3KK3A 5CHGA 4JV1A 3PR4A 3TARA 1FK9A 1RTJA 1KLMA 5HRRA 5KFZA 4LZGA 1NJYA 4NLZA 1IKVA 1RNHA 4UAYA 5EWEA 5DLGA 3AVFA 3C2MA 1JKHA 1L3TA 5KGXA 4RQ3A 1HYSA 4LSNA 3K5MA 3E01A 3UQ2A 2R7YA 1SKSA 1A76A 3VQBA 1XU4A 4B9VA 3QEIA 3UIQA 3VQ5A 1UA0A 2A1RA 3T3FA 2R8GA 4LH4A 1ZBLA 1X9WA 8ICJA 1B9FA 5KFUA 9ICKA 2UVRA 5KG5A 2IOCA 5KFEA 4ECQA 2JZBA 4QZAA 3KIOA 4F4YA 5KFVA 4FBUA 3BQ1A 2W9BA 1JXLA 4KO0A 2F8TA 5J2PA 2OPQA 3HW8A 4KHQA 2DPJA 2C28A 5IIJA 3C1ZA 2O4IA 1RBRA 4KLGA 5FROA 2FBXA 2NRWA 3NGIA 1U45A 3RJFA 2P6UA 3TANA 4CF9A 2P66A 3TFSA 3V9XA 4F2RA 1XS9D 3OYGA 4DOBA 4Q44A 4PUOA 1UT8A 3SUPA 1B9DA 1NOMA 1IKWA 1DTQA 1XO1A 3ISBA 5DKWA 5KFYA 4UB5A 4HCBA 5DQIA 4KI6A 5DG8A 4QWBA 2FBVA 3KHGA 4O44A 2XC9A 4PHPA 4DFKA 1MU2A 3SJJA 2VWJA 2P6RA 4F2SA 8ICTA 3MR3A 5KI6A 2NRZA 1RDBA 3QZ7A 2NRXA 4IRKA 2QKBA 4H4MA 3RAQA 4IBNA 5KFNA 4Z4HA 5CA7A 3VQ4A 4FM1A 1VSDA 4DF8A 5EOZA 4DG1A 2ZUDA 1S1UA 4FJ9A 3HK2A 4QOZB 1S10A 3DMJA 4CJ5A 4KLSA 2AGPA 3L2UA 4HYKA 1CZ9A 1ZQBA 2IHMA 4CF2A 4AHRA 5K14A 5KT4A 2HVIA 1X9SA 1BI4A 3C1YA 2W9AA 1ASUA 3LZJA 2PYLA 4F3TA 3I0SA 3DRRA 2ALZA 3LK9A 4DSLA 3VQ8A 1IH7A 4J9MA 5D46A 4QW9A 4Z4FA 4KTZA 5KFAA 1GOAA 3OS1A 4O5BA 9ICQA 4BDPA 5KT2A 1J53A 1TV6A 5HRNA 4RQ5A 4F4XA 1QQCA 4F5RA 5L1LA 1KVAA 3HPHA 4DSFA 3DOLA 1ASVA 4ZTFA 3U3GA 3U6FA 5J2CA 4UBBA 8ICYA 3AO5A 4K8ZA 4Y1CA 4Q43A 3BJYA 5HBMA 5J2EA 8ICFA 3L3VA 3K4GA 4CJRA 1IXRA 5C25A 4CGFA 1W9HA 1W0HA 4O3QA 3ISCA 3PY8A 3SQ0A 2W9MA 1KTQA 4E7LA 4Z0UA 1S1VA 9ICPA 3DRSA 3OGUA 4DO9A 2XY7A 5KG0A 2AU0A 9ICCA 4YMOA 4EP5A 4CGJA 1BPEA 1JLBA 2G8WA 3MABA 4B8CA 4RNNA 4QZIA 1BVSA 5KFLA 4FLWA 5KRSA 1ZQGA 4GMJB 4B9UA 1I39A 3MGHA 3ZDBA 2V4QA 4QZ8A 1UWBA 2XO7A 3M8PA 5KFKA 5KG3A 1O1WA 1YTAA 4CEZA 3C5GA 1TK8A 1K1QA 1U47A 3RB3A 4P4OA 2XGPA 4CJ3A 4W5QA 4PGQA 1KCFA 5KFWA 4M2YA 1TL1A 1B43A 1BISA 4O5CA 4E0DA 3MDCA 4CHNA 4ECVA 3K57A 4ECYA 3QEVA 3KK1A 4NLGA 3G6YA 2C2EA 1NKBA 3OYFA 2BCRA 2BCQA 4AHTA 3AU6A 3HSTB 3GIIA 3F73A 3PW4A 4ID1A 2IDOA 2C2RA 4CIFA 2WTFA 2ZJ5A 2W9CB 3T19A 3GIJA 3H4DA 5KG7A 3AVHA 1RYRA 5HROA 3NGZA 2MUTB 4UQGA 3DLRA 1IM4A 3AVIA 4M3YA 3V7LA 1Z26A 2BGWA 3C2LA 2HW3A 8ICSA 4L8RB 3LWMA 4F5PA 2RDIA 1CZBA 3QEXA 3V1OA 4AHVA 3SPYA 1TAQA 4J2EA 4MEXA 3VQEA 1AROP 2IBKA 1JX4A 4J9SA 4AILC 3WNGA 2IHNA 1ZQKA 4KTQA 1NKCA 4ED7A 2XCPA 3M9NB 3HL8A 3O4QA 4IR1A 2A1JA 4YP3A 2X78A 1S0VA 4IFVA 3OYIA 5KFSA 8ICKA 2MUTA 4F5QA 1VK0A 2I9GA 2P1JA 4M3XA 4Q8EA 1NOYA 4CK2A 3TAQA 4QW8A 4DTNA 3V6KA 1Y97A 4JK1A 1N56A 2NUBA 3PW7A 2PFOA 2HNZA 3EPGA 1EX4A 2OA8A 4RT2A 3HO1A 2BQ3A 1S9GA 3EW9A 3PW0A 1F21A 3PO5A 4YMNA 3TWHA 4GLXA 4KMUA 1ITGA 1BL3A 3OYEA 4HTUA 2PFPA 2ETJA 3LANA 2XY6A 3ZSVA 1ZQTA 9ICRA 3NFAA 3SZ2A 9ICNA 1SUQA 1BPDA 2XY8A 5J0RA 4RW6A 5KG2A 1SL0A 4FJGA 4J9QA 3KJVA 3MXMA 5DBCA 1EXNA 3OYHA 1EETA 4JRPA 3JYTA 9ICUA 3UPQA 4ELVA 4ECUA 3TAGA 4MF2A 2X6NA 1RXWA 1IG9A 1ZQQA 2Z1IA 4OJRA 4W5RA 4FK0A 4EBCA 1TKTA 8ICOA 4QZ9A 1JN3A 1KVCA 4GXKA 5T7BA 1IKXA 3AA3A 5KFJA 4F91B 4RPXA 4XQ8A 1HYZA 2Y1JA 3V7JA 4BXOB 8ICQA 1RBUA 4XA5A 2DFHA 3GQCA 1NK6A 1U48A 5CZ2A 1SZPA 1NK8A 1HYVA 1ZQAA 1L3UA 4PHEA 4DL5A 5J2BA 4KLDA 1D8YA 4RQ1A 4G1QA 1XSNA 3RTVA 2ZJAA 4JWMA 1BPZA 3QZ8A 4TSXA 3VQPA 4UAZA 1XI1A 2ISPA 5DK5A 4YVZA 5J0WA 3NHGA 3L2RA 5J2AA 1ZQUA 5HHIA 2RN2A 3LP2A 4TURA 3NE6A 1KDHA 1SL1A 4IQTA 4M3ZA 4YXMA 1D8LA 4CJQA 4ELUA 5J2GA 4BE1A 4JWNA 1LWCA 5J0QA 5KT7A 1TFRA 1WCLA 1D5AA 4FS2A 4N41A 3RMCA 2FPMA 1QS4A 1ZQYA 3THVA 3Q8QB 4CJTA 2ASLA 1BPYA 2BCSA 1KSPA 1JLEA 1B22A 5DQHA 4HUFA 3LAKA 4ED3A 2H5XA 2VANA 4B8AB 9ICWA 3N97B 1C1BA 3V7KA 1WSEA 2BQUA 3RJKA 1C0UA 4I27A 2O4GA 3B0XA 2AQ0A 4RU9A 1K6YA 4I2DA 1HPZA 3HX0A 4DTSA 4DU4A 1DOQA 3MEGA 2M9NA 4M6WA 4DLEA 4CEOA 1XSPA 1HUZA 5HNKA 2VG6A 3ETLA 2F1HA 3JSMA 4DLGA 1RT4A 1HJRA 1K1SA 1S9FA 1NKEA 7ICRA 4DL2A 4R66A 7ICKA 3OY9A 3TR8A 3ZSQA 4KHSA 5BPCA 1GOBA 4IQWA 4CK1A 4CEFA 3MFHA 3VQCA 4JUZA 3IS9A 5KT6A 2HVHA 1ZQPA 4ED8A 3ZT3A 4EYHB 3BDPA 4KTWA 4F50A 3ZDAA 4HCCA 2KTQA 1QSSA 3V9SA 3TAFA 2ZJ8A 4KPYA 2JZBB 3N4MB 3V6DA 8ICMA 4FXDA 2W9BB 4KLMA 1RTIA 5IIOA 5CB1A 4G3IA 1ZQNA 3M8RA 5KFRA 3S9HA 2R8HA 1D9DA 9ICBA 3KKSA 1QTMA 3K2PA 3OHBA 1Z00B 1JLGA 4NXZA 3EYZA 3HVTA 5HMMA 1HJPA 4BACA 1WAJA 4MFFA 2PXIA 2DFEA 3NCIA 4BWJA 5KFFA 3Q8KA 3UXPA 3TQ1A 5C42A 3L2QA 2HHTA 1VRUA 2I5JA 2F1IA 4I2JA 4TUPA 1LWFA 4DQIA 4R8UA 5J0XA 4FZYA 4DWIA 4F93B 3DLKA 4OGEA 1ZQRA 4CGGA 3NTUA 4ECRA 1RDAA 7ICQA 1DLOA 3NF6A 5J2HA 9ICVA 3V72A 3Q8PB 2XHBA 2BGGA 5KFDA 4O55A 4W5NA 4CFDA 2FLLA 1C1AA 4DTJA 8ICUA 4FJ5A 2BPFA 3B0YA 1CEZA 8ICCA 4EBEA 3PX4A 3UQ0A 1Z25A 4HUGA 2J6TA 4M04A 4O4GA 3EPIA 1C6VA 2W8KA 3GV8B 2IMWP 3K5NA 1Z00A 1RILA 3M9MB 3AA2A 2E6MA 1LAVA 2Z1JA 3DLHA 1DGSA 3AVMA 1ZQHA 3SUOA 5J2KA 5DG9A 1JL2A 1ZQSA 4YD1A 3RJGA 4IR9A 4DTUA 1T7PA 5KFHA 3T5JA 5KFTA 1RT1A 2YNFA 1ZYQA 5DB6A 1VSLA 4LZDA 2B21A 4C8LA 1EXQA 4CHYA 2C22A 1BI4B 3CFOA 3HT3A 3Q8MA 2EHGA 3FFIA 4GXIA 1ZQVA 2HHSA 1CLQA 2BR0A 4KRFA 3GILA 1FXXA 4RW8A 4DEZA 2Q0ZX 3D0PA 1QSYA 2AGQA 1NK4A 4RW4A 1TV9A 2VA3A 5JUMA 1QHTA 4Y1DA 2OZMA 1RZTA 1HQEA 3L3UA 4ECSA 2ZD1A 2EX3A 4CHQA 4DQRA 1RT2A 1RDDA 1ZJNA 3H8SA 4Z6EA 4KHUA 2R8KA 3G6XA 3OYDA 3VQAA 3OHAA 3MBYA 3QE9Y 1JXBA 5KFOA 1IKYA 4FW1A 3OYMA 4OGCA 5IIKA 3GIMA 5D3GA 4PPXA 4E7JA 4DTPA 5J0YA 4CEDA 5DB8A 3V6JA 1RTHA 5HP4A 4AHCA 3LPTA 3C21A 1S97A 2G8HA 2V9WA 9ICAA 3RJJA 3OSNA 8ICHA 1WSIA 3TABA 4KREA 3KD5E 2Y1IA 4YMMA 3QEWA 4DS4A 7ICSA 4OPKA 3PV8A 3CFPA 3ZSZA 4RNOA 3NF8A 1NOZA 4FZZA 3HWTA 4FZXC 4CJEA 4YR0A 4J2AA 2F8SA 4KLOA 4O3PA 1U4BA 5FRNA 3RMDA 4I9QA 3KKRA 3NH0A 2RDJA 4CGHA 3QNNA 3DLBA 4DU3A 2OPSA 4DMNA 2HNYA 3P83D 1TVAA 9ICHA 9ICLA 4O5EA 4FJLA 3QIPA 3V4IA 3IAYA 4RQ7A 4CECA 4Z4IA 1LB2B 5KFGA 4ECZA 4FJKA 3OYCA 4CJLA 1VSKA 4BE2A 3VQ6A 1ZQWA 2ZTEA 4DTRA 4I2EA 1SKRA 3KLFA 3MR5A 3MR2A 3SI8A 3RH5A 1NK5A 4OKKA 1VSIA 3NDKA 4PHDA 4CF0A 4C8NA 4UB1A 3KLIA 5I3UA 3ZSOA 7ICPA 1I3AA 4UB3A 3UXOA 1Y88A 5KFCA 2YNIA 1ZQXA 4DL3A 1KFSA 3PO4A 1WSGA 4K4IA 3TI0A 1JIHA 3CYMA 4CJVA 4YCXA 3TAEA 4QWEA 4M47A 1T4GA 2YKMA 4K4GA 3GV7B 1TK0A 1ZQLA 1BQNA 4FCYA 2A1JB 4Z6CA 3OJSA 3RJHA 2V4RA 2PI5A 3F9KA 1S0OA 4FJJA 9ICGA 5J2FA 2W42A 5J29A 4I2HA 5KT3A 1A5XA 4QAGA 4DQQA 2VG5A 8ICEA 1IO2A 3HXMA 3RH4A 4IQVA 3ZDCA 3MAQA 1TKXA 3T5LA 4OKEA 4RW9A 4C8MA 4GC7A 1XHXA 4YR3A 3ORYA 1G15A 4HVJA 1KFTA 7ICTA 1H38A 4PGYA 2F1JA 3Q8SB 3IG1A 4CJWA 4MQ3A 4IG3A 4DSEA 3SQ2A 4EZ9A 4KLLA 5J0SA 1ZQMA 1HNIA 1ZQZA 9ICMA 4CFAA 2JEGA 1C0TA 5SZTA 4I2AA 4FLXA 2DTUA 4F5OA 7ICUA 3VN5A 2PY5A 3SV3A 4F3OA 2YHBA 4FJHA 3JPPA 3KLEA 3RB6A 5CYMA 4CJPA 3RRGA 3LDSA 5KTQA 1HQUA 2FMQA 4KLFA 3QINA 2GWSA 2KW4A 1XSLA 1T05A 4TUQA 3C94A 1CUKA 5IIMA 4ICLA 3OYLA 3HJFA 4NY8A 3KLHA 4HUEA 3WNHA 4KLHA 4JV0A 4O5KA 4QZGA 3OSPA 1WSHA 4QWCA 9ICXA 5J2MA 4J9PA 3DOKA 2FC0A 3EY1A 1BPBA 1NK0A 4IKFA 3MGIA 3QNOA 4M9HA 4PH5A 3V9UA 4XRHA 4EBDA 3MFIA 7ICFA 1LW0A 1SL2A 4ZTJA 5KG6A 1TKDA 1TAUA 3AVAA 3NH1A 3CG7A 9ICEA 4RQ6A 4CHZA 4IRCA 4DU1A 1S0MA 4QWDA 5C5JA 2G8FA 4Q8FA 2OYQA 4B08A 4KN7A 2BKEA 3I8DA 9ICJA 3GV5B 5L1KA 2AGOA 5KFPA 2YNHA 5J2NA 3B6OA 5DDYA 3KTQA 4M41A 1R0AA 3WNFA 3LP0A 4CGDA 2YNGA 4O0JA 8ICAA 3LDAA 3DI6A 4NLNA 4RUCA 1ASWA 4DQSA 1A5WA 1RDCA 3QERA 1S76D 4ELTA 3RWUA 2IS3A 1LAWA 2VA2A 2LSNA 3RB0A 2AQ4A 5J2DA 3JPOA 3Q8LA 2D0BA 4N56A 4J9RA 4B9TA 7ICMA 2I1QA 2YHAA 3K59A 3VQDA 4KB0A 9ICOA 1VSJA 7ICGA 2JGUA 3ZSYA 4LSLA 2RPIA 1UAXA 8ICNA 5D4BA 4KV8A 1RYSA 2JEIA 5CY4A 2BPGA 2VA8A 4DF4A 3ISNC 3VQQA 4RT3A 3QEAZ 3AV9A 3SQ1A 1VSEA 7ICHA 3PR5B 1RT7A 3ZT2A 2YKNA 3MXJA 1LW2A 2JLEA 3NH2A 1L5UA 1WN7A 4GW6A 4M6WB 8ICRA 4CEBA 4FJ8A 3PX6A 4KB1A 4M9GA 4F4ZA 1BPXA 2DPIA 7ICLA 1SKWA 1BHLA 4B9LA 3GIKA 1S1TA 4RUAA 1Q9YA 1ZJMA 1RT3A 4PY5A 5DLFA 5C24A 4CESA 8ICIA 3IRXA 3RR7A 4R63A 2G8KA 4FLYA 4J2DA 5CWRA 3PVXA 4UAWA 1U04A 1XC9A 3IHQB 2ZTDA 2ZQBA 3DLEA 1REVA 2KN7A 4FJMA 4ZHRA 4NYFA 4M3WA 3IM1A 1ZBUA 4M9JA 3ZT1A 2IAJA 3RJEA 3SNNA 4R65A 2B4JA 2HB5A 3M8QA 4QZEA 1YTUA 4NM2A 1S6PA 1RT5A 3ZDEA 1MC8A 5JS1A 3U3YA 3ZSXA 3MXIA 3QIOA 4FJXA 5J2IA 3RJIA 4FLTA 3TFRA 2D0AA 4R8UB 2HHVA 3SV4A 3OYJA 2FPKA 1COOA 4KLEA 3RH6A 1RTDA 3RRHA 4PWDA 4RPZA 3NGDA 3K58A 2A1SA 4LD0A 4RPYA 1QLNA 2E6LA 1S1XA 2HHWA 4TQRA 4MFCA 4DSKA 4K8XA 2MAXA 3OS0A 2Z1GA 3QO9A 2PZSA 4O3RA 2RF2A 2ZUCA 3CQ8A 3ASMA 4PA1A 2ZE2A 2HHXA 7ICEA 3PX0A 4KLJA 4R64A 4PHAA 4CE9A 3ZD9A 3ZSRA 1N5YA 4CJFA 4I2PA 4KI4A 4CHOA 2X6SA 4QZBA 1BCOA 4DL4A 3RAXA 4NLKA 4I2FA 4XUSA 1NJZA 2J6SA 2YV0X 3PMNA 5DGAA 5TZVA 3LPUA 4TQSA 4KFBA 4N47A 4CFCA 3KLGA 2NRVA 3MECA 4EEYA 1JLQA 3PMLA 3VA0A 2B5JA 9ICIA 4WE1A 1ZQEA 4CJKA 4KITB 4IFYA 9ICTA 1S0NA 3CFRA 3ZCMA 4F8RA 1UT5A 5L1JA 2JEFA 5EU7A 3O3GA 5DBBA 3HYFA 4IG0A 5DB9A 1DTTA 5KRTA 1CXQA 1JMSA 2WOMA 7ICIA 5BOLA 4MFAA 3RB4A 1S9EA 4FM0A 1X2IA 2P51A 4RQ4A 3RBDA 4KLIA 4EYIB 3AU2A 1RT6A 1WLJA 5DB7A 2ZTCA 3K5LA 3AVGA 2DFLA 5J2JA 2R8IA 4NCBA 4J9LA 8ICLA 4ED2A 4EP4A 3V1QA 3OYKA 1FKPA 5KG4A 4K4HA 3BGRA 3A2FA 3DRPA 2XGQA 4FLZA 2P5GA 9ICSA 2P5OA 3HPOA 2G8VA 3JPNA 5KGWA 3SI6A 3P5JA 3AVBA 3NF7A 1JL1A 3M8SA 8ICGA 2KZZA 1A5VA 4KHWA 4Q45A 3AVJA 2OPPA 4CIEA 3KK2A 5DDMA 5CR0A 4FYDA 1J5OA 5KFQA 3MEEA 4JRQA 4ED0A 4Z6DA 3GDXA 4MEYA 2G8UA 3V81A 5J2QA 4O3OA 3CM6A 1NK9A 3O3FA 5E41A 4YG2A 3T5KA 1Q9XA 2Z1HA 4EZ6A 2HNDA 4NYNA 1Q8IA 3JPTA 4TUSA 3D45A 3G10A 1WNSA 1TVRA 4Z4GA 4I2GA 2HHUA 2FBYA 3ULDA 4J9NA 1KFDA 4YFUA 5HMLA 4FLUA 3JPSA 4F92B 3HPGA 4FM2A 1KEJA 3QEPA 4R5PA 4JS4A 5I42A 4ECTA 2XCAA 4ZH4A 3AA4A 4E1MA 1T03A 1N6QA 4F4KA 5J0UA 4E3SA 3LWLA 4DTXA 2FBTA 4N5SA 4QZHA 5DG7A 1Z3EB 5CP2A 3B6PA 2DY4A 4FO6A 1ZQDA 2KZ3A 1D9FA 3GFKB 4ED1A 3ZT0A 3ZDDA 4M3TA 4DTMA 5DBAA 4J9KA 3LALA 4BWMA 4FBTA 3AA5X 4I9LA 1L3VA 3LP3A 2ATQA 2BPCA 4NM1A 3BQ2A 2LYHA 1N48A 7ICJA 2QK9A 1C0MA 4AH9A 8ICZA 1RBSA 4FJ7A 1S5JA 2BQRA 4FK2A 4E7IA 3NF9A 2ASDA 4M3RA 2UVUA 3OS2A 4KLQA 2GUIA 3VQ7A 4I29A 1MQ2A 4QZCA 3NGYA 4CHPA 1EKEA 4CF1A 4YQWA 3BQTA 3L8BA 5DMRA 1T8EA 3S3MA 4O0IA 2VWKA 5J0PA 3TAPA 1BCMA 3OVNA 3OJUA 1ZQOA 3MEDA 4DS5A 3HM9A 1TL3A 5L9XA 4HHTA 3H40A 4I2QA 4QCLA 3K75D 1BIUA 4KLTA 3WNEA 4FS1A 1MQ3A 3FDSA 2GV9A 1JLAA 4DFMA 2JEJA 1EP4A 3C5FA 4DSJA 4UB2A 3E2EA 3L2WA 3JPQA 5IIIA 4ECXA 3I0RA 2VG7A 4F5NA 4DFJA 1VRTA 1BIZA 4MF8A 2PFNA 3NAEA 2PYJA 7ICVA 2AJQA 4YXJA 5HRPA 3PNCA 2FLPA 4YD2A 1FKOA 2UVVA 3SCXA 4YFKA 4RQ0A 4UB4A 3C6TA 4CERA 4KAZA 2FMSA 2KQ2A 2FMPA 4JS5A 3ALYA 4CEAA 1CXUA 4C8OA 4E7KA 2E4LA 4JLHA 3UXNA 4Q5VA 4BGDA 3G6VA 4B9MA 3V6HA 4JV2A 1U49A 3AO1A 4BDYA 2OWOA 1KVBA 1NJWA 4H4OA 4KKOA 5FRMA 1RPLA 3SUQA 4DL6A 1VSMA 4B9SA 2QKKA 1YT3A 5IILA 5DGBA 4O3NA 3K5OA 3FYHA 3QETA 8ICWA 4DFPA 1ZQCA 4Q0BA 5KG1A 3LAMA 2HMIA 3Q8RB 3P1GA 4I28A 2W8LA 2X74A 4PQUA 2XY5A 3AO2A 1BQMA 3CM5A 2DFFA 4M3UA 4BDZA 3PW5A 4DL7A 4E89A 4OLBA 3MDAA 3V9ZA 1C1CA 4CEQA 5L1IA 4GVMA 8ICXA 2QXFA 3PUFA 1XWLA 5BOMA 9ICFA 1A77A 3ZD8A 2GBZA 3AVCA 2HHQA 3AVKA 5FDLA 1ZETA 1WAFA 5KFBA 3G0ZA 1XHZA 2OZSA 2ITGA 1QSLA 2BCVA 5EWGA 4PGXA 1TKZA 2BDPA 3ZSWA 4ED6A 3AVNA 4P2HA 2W9CA 2UVWA 2FPLA 1S6QA 1RCHA 3QESA 4LVSA 3C2KA 1X1PA 3C23A 1TK5A 1X9MA 2NRTA 3RMBA 4M45A 4QZDA 3ZT4A 4NCAA 1HNVA 1JLCA 4OLAA
chains in the Genus database with same CATH superfamily
6AT1B 2VKZG 5FD1A 4WIIA 3L2VA 3WC0A 4ECWA 3GJQB 2HYIB 4P0PA 4NZ7A 1N62A 2I38A 1LWEA 2ZH5A 1XMOF 4A2AA 4HKQA 1Q8LA 3SMPA 5LMNJ 3EWAA 1NWKA 1WYGA 3BQ0A 3WXKA 1T6CA 2GX8A 1DRGA 4OO1J 2RRDA 3G25A 5K8PA 2NCKL 2WONA 4QR2A 1W26A 2EANA 4WK3A 4PRFA 3WKEA 4O8UA 4KHPJ 1QD1A 2MA1A 4FLVA 2VFUA 4KV8B 3LVWA 1HMVA 4E19A 4Z6FA 2ZM6K 4CJUA 4P72A 4IO8A 1VJ5A 3ZZPA 5AQZA 5FP0A 1VQKN 4JHDA 1PC5A 1YJWS 1NGAA 3HVRA 1F9HA 1OW5A 2BANB 4J9OA 1VC0A 2H3ZA 4W90B 1TL7A 3FSYA 3VAJA 3S3NA 2CPZA 5CZ1A 4LFAJ 1GOCA 7ICNA 4JI2K 3OYBA 2RRBA 3VGTA 2GJFA 1U0SA 4H0VB 3IFRA 1YG0A 3LP1A 3G8TA 5JS2A 3KHRA 2KFZA 3M9OB 1EJ7L 5GMEA 2R8JA 3KBBA 4B3MJ 2C2MB 2Y8YA 4B9NA 3IMQJ 1NBEB 1VC6A 4QU6A 4AHSA 4DFDA 3EZ5A 1UEUA 2PI4A 3L4PA 3LVVA 3O4NA 1U1RA 2CXEA 3MHYA 1L6NA 4QWAA 3DC2A 5D0EA 4TKTA 1NGCA 3C29A 2MTLA 3GIRA 4ID5A 5HP1A 1L3SA 3KHLA 2LQJA 1LK5A 3AO3A 5ALOA 2XRIA 4RNMA 3NVWA 2R7QA 5KPZA 4I7FA 3R5BA 1QHAA 5KL1B 3W3DA 3RBEA 1CZAN 2DHXA 1ZAXA 3F0NA 2CQIA 2PMZF 3T1HK 4FO0A 1NPRA 3GJTB 2HGMA 1MSWD 3J7YP 4P4MA 1S1XB 4AHUA 1XNSA 8ICBA 3OBIA 1F5SA 5KFMA 2MQOA 4BUGA 3MURP 1YVUA 5KT5A 2DR5A 4X62K 4N76A 4RG8A 4L74A 3QFHA 3CQXA 4OX6A 2I1RA 3E58A 1UPPA 1WACA 2Y9HA 1TU0B 4H8KA 1LKYB 1FRKA 1YJUA 5E2QA 1N5YB 3BEGB 1H1VA 2D5RA 3AGKA 4Y6IA 3MN7A 2JSXA 1SV5A 2BZ2A 1FRHA 2BHNA 3C16A 3THYA 2ALYB 2MGZA 4IOCL 5KFIA 3CXCR 3NVYA 2FIUA 2AH5A 3MR6A 1B0PA 1Q3VA 1WTBA 2W11A 3BS7A 3IR5B 1PO6A 3KLGB 5D15A 2GVDB 3IXQA 4JKBA 1PJ7A 2B5JB 2F96A 4TNOA 1WSFA 1RBVA 3R27A 3OFEA 4BG9A 4RTFD 1WOPA 5CYQA 4O0NA 2HHHF 4CF4A 4CH1A 1UJ5A 1DTTB 2M8HA 3LZIA 3FUYA 1RWPB 2J9DA 4GFJA 3EVMA 2WC9A 4E7HA 1VSHA 3AO4A 2XI3A 4PPDA 2FC9A 3VPZA 3U4LA 2XG8A 4J2BA 2VD3A 3CQYA 2KFNA 3HHNB 2QV6A 8AT1B 3FC9A 3KK3A 4NRUA 3PR4A 4OI2A 4X4NA 1FK9A 1RTJA 2Q0UA 3P5BP 4DX7A 3DRPB 3C6AA 1RNHA 2B3TB 3CC2S 3C2MA 2G2YA 1L3TA 4FWSA 1MDUB 1RDUA 4ED5A 3K9KA 1A76A 4B9VA 1DTQB 1EZZB 5I9EB 3QEIA 3RAMA 3VQ5A 4USJC 4YOVA 4Y65A 3BF4A 3V81B 2B4UA 1R3NA 3CCEN 1ZBLA 1LXNA 3CVKA 3SCJE 5HSPA 4NOHA 3NGSA 1TVRB 4ECQA 3HJEA 3Q0AA 4FBUA 3BQ1A 3CJ2A 1HJOA 1U2VA 3GG1A 3N4QA 2HOQA 1T9WA 2NYHA 2DPJA 2KSOA 1UL3A 2MQPA 4Q7AA 5ETKA 4ZITA 4MK9A 2O4IA 3DJCA 4JI1K 2NRWA 5I42B 2PA3A 1PGZA 3RJFA 3W8PA 2C3OA 4CF9A 3N7PD 1Z1BA 5GMKa 3BR8A 3OYGA 4EELA 4BRDA 4PUOA 2HBZB 1NOMA 1IKWA 5AXMA 5LL6d 1XO1A 3ISBA 5DKWA 4BS2A 1VQ4S 1NHKL 1RGIA 1WKKA 4H0XB 4QWBA 2YQ3A 4XDDA 1M5SA 4K41A 1TUUA 2PFDA 5H9EK 2WF9A 2DYAA 4DFKA 4DUZK 3NGTA 4JV5J 3SJJA 2VWJA 1Z1VA 4ID8A 3MR3A 3NS5A 2NRZA 5GAGP 2ZXIA 4IRKA 3GR0A 1DK2A 2HFUA 5KFNA 5ALHA 3MCOA 3HI9A 1WWUA 3O1BA 2CXYA 4M7XA 4FM1A 2DO4A 2DNYA 2RE1A 1XJWB 4DG1A 2JVOA 2PAVA 4GV3A 3FC4A 1S1UA 4FJ9A 2IVFB 4QOZB 5E3CA 3DMJA 5HBMB 1SGGA 3D54A 2E29A 1TUYA 4DBQA 1XMOJ 2IHMA 5AICA 4C8YA 5C25B 5HQLA 1H2VZ 1PVRA 4J03A 3NP5A 1SB3C 1ASUA 1BNOA 4C7YA 2EFGA 1N5QA 4DV6K 2MPUA 3GJSB 2NRHA 1YUWA 5AM1A 5D46A 4QW9A 5AK5A 2PEHA 4IDHA 2QXLA 4DV0J 3MCSA 4P7VA 3ZZUA 4F5RA 3DHXA 2AW0A 5L1LA 1KVAA 4DSFA 3GFZA 3GDQA 4ZTFA 1U1OA 4QPXA 5D6GA 3U6FA 4YOWA 4K8ZA 3D0IE 1X4CA 4CBXA 8ICFA 4PZNA 3VVUA 4F25A 4CJRA 4JI3K 1IXRA 4LFBF 3UN5A 4ZVUB 4CGFA 5ALIA 1KTQA 4NEZA 3BSCA 2MZQA 1VQMN 1W2BM 4E7LA 1V5VA 4O3MA 1TP7A 2J5AA 4ZVSB 2XY7A 5KG0A 2WUSA 4OD0A 3IBPA 4N7TA 5FLXU 1FFVA 4LF1A 3W9JA 4CGJA 1BPEA 2G8WA 4RNNA 3W5YA 2A3JA 4DI6A 4QZIA 1RUSA 4Q0BB 3ZZZA 2UUBK 2QL9B 1A6LA 2HMIB 4FLWA 5KRSA 1HL6A 1WI6A 2GJIA 5IT9Y 3HHKA 3GZFA 1CJVA 4Y2MA 2W2QP 3M8PA 2LMRA 4M94A 5KG3A 5FIIA 3CCVS 3P31A 1TK8A 4CJ3A 3HSGA 5KFWA 4M2YA 3HHLC 1B43A 1BISA 3GE9A 4CHNA 2CQGA 3K57A 4J90A 4QIFA 4ECYA 3RBXA 3M8YA 2G5HB 4FPBA 1NKBA 5L1MA 5FDLB 2BCQA 4AHTA 1REGX 1NEEA 3AU6A 3GIIA 2BBEA 4RNHA 3F73A 1P9QC 2IJRA 2ZC3A 5DM7Q 3MAAA 2IDOA 4GNIA 1TKZB 2ZJ5A 3KZXA 1MLAA 1X4BA 4PPZA 3CJBA 3NVVA 2G1DA 1OPZA 7AT1B 3EJMA 5KG7A 1RYRA 3DDIA 3R1HA 3CCJN 2MUTB 4P0QB 5K4LA 2D3O1 4Y2KA 1NGIA 2BGWA 2EAMA 5HLFB 4IFEA 3QMQA 3QJPA 2B6AB 2DNKA 4L8RB 2FHJA 4RW7B 5H1SQ 2RDIA 2X51A 3BO3A 3SDEB 2IM2A 4DV2F 3V1OA 2QARB 3H0RB 4MEXA 1U7LA 3F41A 3QSYB 2F40A 2IHNA 1ZQKA 3M5RA 2DNZA 2DRAA 1PIEA 1NKCA 1ZZFA 2MZJA 1WC1A 2A1JA 4AFFA 1HKGA 2RE2A 3UE2A 3NMAA 2DCLA 5T7LA 2HHHJ 3OYIA 5KFSA 3E8OA 4F5QA 2I9GA 3DOMB 2QC3A 4Q8EA 4MFBB 4CK2A 4EEKA 3QIDA 1K8KB 3KUHA 4B3OB 2ZJPL 4JMUA 2ZWOA 4JK1A 3TW0A 2HAIA 4G1IA 2BZFA 3CHWA 2QG9B 3EPGA 3HO1A 2BQ3A 3D2EB 1S9GA 2AJ4A 3H8MA 5LJ3Y 1F21A 3G82B 3OTDA 2WW4A 3TWHA 3D3BJ 1DQ9A 2BE2B 1NHVA 2EK6A 3AMZA 5CYJA 4YORA 1KN5A 1NNEA 5GADU 2XY6A 1ZQTA 3WKAA 3JQMA 2F8EX 3NAHA 4QIVA 9ICNA 4I69A 1BPDA 2XY8A 3D1QA 2QI2A 4RW6A 2QE5A 4FJGA 2B0CA 4A8XA 2KK0A 3MXMA 3WUHA 1VI7A 4ATNA 4EWTA 1KVIA 5C2CA 1H0HB 3HVWA 3JYTA 3ATVA 3TUIC 3H45C 1O6XA 4ELVA 4B3SF 1YJWN 5DJBA 3TO8A 4MF2A 3UD5A 2Q31A 1RXWA 1RHMB 1JRPA 4LIWA 4NCGB 5B0DA 3TKAA 2J7KA 4FK0A 1OSDA 1DXSA 2DGOA 1UCNA 2D3DA 4GXKA 2OPRB 3BREA 2LQ5A 5KFJA 1SI9A 4HT7A 4JI6J 2VPYB 3DLGB 5M2RA 3M1FA 2EVZA 3V7JA 4BXOB 2O8DB 1ATRA 5CH7B 1RBUA 4XA5A 1FXDA 1IBMF 1OWXA 2DR9A 1NK6A 1WSRA 3ELHA 1NK8A 1KOOA 3SBGA 2FLOA 3CUNA 3AQFA 2VHGA 3QBXA 3EMTA 4NA2A 4OJGA 2H1YA 4TU7A 4Y2RA 4X64K 2RHFA 3QB0A 1IJJA 3VQPA 2IC3B 4UAZA 3BY5A 4U7UD 1UMJA 1SVDA 1NM1A 2RKIB 1SC1B 3N7SC 3UO0A 5J1EB 3X1LB 3CMAS 4PG6A 1BU6O 3ITHB 1URRA 5B0GA 4JWNA 4B1WB 3IBCB 3H20A 3MX5A 1N32K 1QE1B 4DV7J 4N41A 3LDOA 4DR2K 2LDYA 3FLCO 3EGWB 2XLKA 5KQ8A 3THVA 5IM0A 4LF2A 2YX8A 5ETOA 4B3TK 1F9FA 1EWRA 3EXCX 2A6AA 2OCEA 1RXOB 3MM6B 5EXWA 3UKRB 2RIJA 4C7QA 2Y8WA 3J7A1 5DQHA 1N5VA 3DRXA 1VQ5N 1T11A 2N7CA 3LAKA 5JVHQ 1MROB 2XZDB 9ICWA 2IHR1 2Z2MA 3BH7B 2LBOA 1C1BA 3C6UB 1WSEA 3SJHA 1C0UA 2QX0A 3HZ6A 3NKYA 1HPZA 4J8FA 3HX0A 2MSTA 1RKJA 3MEGA 4M6WA 4DLEA 2DIVA 1CJUB 3PIPQ 2NR0A 2JX2A 4QYZJ 2VG6A 2F1HA 3KLVA 1SXLA 3J7YU 2DGUA 4K4XA 4BHQA 1K1SA 4OX8A 1R6YA 4GO5X 2ZIWA 4KHSA 2LU1A 2JNJA 4K4YA 2QA1A 4CK1A 3EGVA 4OHZA 4LF5K 2HWIA 1UKUA 3MFHA 3T79A 3IAS9 1MWQA 4EYHB 2A2CA 2JC0A 4HCCA 2ZJQQ 4RNFA 1QSSA 3TEHB 2ZJ8A 1I3OB 3IM9A 4KPYA 2WF8A 3M2UB 8ICMA 3ZTPA 4CT8A 4KLMA 4KO0B 1RTIA 1VJQA 3GJRB 1RCOB 2IYGA 3T69A 2HQ3A 2R8HA 1D9DA 1RHKB 3KKSA 1SKUB 3OHBA 1T95A 2NPFA 4DUYF 1AQ6A 3UKUA 3VTHA 3GE1A 4MFFA 1X5OA 4WFNL 5BJRA 3Q8KA 3UXPA 3L2QA 1VRUA 5C10A 2I5JA 4B17A 4U7BA 4DR6K 2DITA 4NYOA 4DQIA 2M8DB 2OTJS 3PIOQ 1NHUA 4WTOB 2BRLA 2YQEA 5F8JA 3J7AP 4BRCA 2FDRA 3IFEA 2XM3A 4HACA 3CEDA 2ITMA 2YMMA 1FDBA 4A48A 3GG0A 1U26A 4O44B 4IOAL 1HLUA 4FJ5A 3CD0A 1MU2B 3B0YA 1N0UA 4HVZA 2LXUA 2OMOA 3Q22A 3V2UC 2CPRA 1KQKA 2J6TA 4KH1B 3S6EA 3EPIA 1B64A 4U7CA 4EHTA 1N33J 2E8MA 1X4GA 2QJ3A 3MMAB 2Z1JA 1FJGK 2YKPA 2HMXA 3AHPA 5J2KA 3GCXP 4CI6A 4IR9A 4QPTA 1U1PA 3T5JA 3D68A 3CJQA 3W1YC 4J5OA 1RT1A 1WC0A 5F8LA 4GV9A 4ENOA 4Y0WA 2B21A 2K4IA 2LXFA 4JYAF 1IXKA 4KAIA 3MTKA 2MKCA 4GXIA 4NA1A 1CLQA 1YHQS 1DURA 2Q1NA 2AF6A 2ZH3A 2L9DA 1HEKA 5SUHA 4OX9F 2PT0A 3DKDA 3VHQA 2JRZA 3MUTP 2XNRA 1FJ7A 2OZMA 2P9IA 4C9DA 1HQEA 3V5RA 1TR0A 2E1YA 2GO9A 1K8AO 2ZD1A 1DARA 2EX3A 1BA0A 1K8AT 4NZ0A 1RDDA 1ZJNA 2DISA 2BW2A 3H8SA 3JQJA 2R8KA 2BX6A 3G6XA 4XEIA 1UVMA 3NOGA 1T3VA 1ZQ1C 4OYXA 2J9EA 3CO9A 1KS2A 3QUCA 4DR7J 4JKHA 3IBWA 5EUHA 3E1YA 4DPWA 3CDWA 1SWWA 3WXIA 5GAGU 2RU3A 5M1OA 1CC7A 4OLOA 4JI5F 2WBNA 4HWIA 3MD3A 1HNZK 1Y3KA 1S97A 4NXNK 4E8UA 4DV1J 2F44A 3RJJA 8ICHA 2XEXA 3A8KA 4P74A 2Y1IA 3TNVA 4DS4A 5BRHA 5EX5A 2OJ3A 4B3SJ 3ZSZA 3Q2TC 3BKUA 2BH1A 4YMEA 1ELOA 1NOZA 3HKZD 3HWTA 2J7UA 1YBAA 5A76A 2LECA 5ADXA 4H4KA 2I6XA 4LBIA 1TL1B 1CQNA 3A0BU 2ZHBA 2R7VA 2OELA 3RMDA 2M7SA 2JWKA 1WF0A 3KKRA 2RDJA 2CQBA 1TFYA 4CGHA 1DY3A 1W2IA 2HNYA 1IV8A 3P83D 1JK9B 9ICHA 3L4QA 2V63A 2K3IA 1FO4A 4O5EA 1F3VA 3JQKA 3K8WA 1BQXA 4I4BA 4FJLA 4GKKK 2NYVA 3IAYA 4C4SA 4IXCA 4Z4IA 2C3MA 5KFGA 2BM1A 6FD1A 4FJKA 2XBPA 3OYCA 4C8ZA 4JKEA 1YVNA 1VSKA 4BE2A 3CF5L 1RLDA 1SKRA 3K0JA 4USVA 3OL7A 3ONQA 3FCHA 4ZPBA 3RH5A 2AEMA 1R8PA 1S5LU 2VG5B 3NRWA 4PHDA 4L3KA 4C8NA 3KLIA 7ICPA 2MKSA 3NEKA 5AFUA 1HNWJ 4Y2YA 3TTDA 3WIVA 4CP5A 2D1KA 3OXLA 3BSOA 1FDAA 1Y88A 4Y2IA 5AM2A 3QFUA 4DL3A 1S5ZA 2WF7A 3C14B 3QJJA 5CD4H 2Q2RA 1JIHA 3M32B 1V3ZA 4UAUA 2MB0B 1H2UX 2G2OA 4LRCA 5AQMA 2CG4A 5L9NA 3TAEA 1BQNA 2FHKA 1X31C 5EE9A 4P52A 5AJ3K 4Z6CA 3OJSA 1V97A 4JK7A 3CIZA 2PI5A 1AZSB 3FKBA 2W24A 4WP8A 3F5TA 2VFVA 5ALKA 5EOYA 5J2FA 1Y5LB 4J37A 4K2XA 4ZVGA 3D1OA 3R5GA 1GLEG 3NMUA 2P9KB 4K8RA 2D9PA 3U7JA 2CQCA 1IO2A 4IQVA 2VOOA 1FA0A 4OKEA 4C8MA 4USKA 5J1PA 3G9CA 1XHXA 5BPNA 5D77A 4I0WA 5A0YB 5AKLA 2BJ8A 1V4SA 1SXDA 5JXSA 2F1JA 3RVCA 2CYYA 4U67Q 2HHPA 3Q8SB 4U8YA 4DSEA 1Q18A 1SUQB 4F04B 2ZWHA 3QNWB 3I55S 5B08A 4CFAA 4DR1K 3KJVB 1FWPA 2FHOB 5GVQA 3MOZA 3KNAA 7ICUA 4WQ5A 1M5KC 3H3OB 3SV3A 2YHBA 4JD2B 1Y11A 3RB6A 5CYMA 3RRGA 2ZZMA 1Y7PA 2KW4A 2LA4A 5A8KB 1D9AA 2O8CA 1E4GT 1T05A 2Q6BA 1CUKA 3ET6B 4ICLA 4FWNA 3ENVA 1KKXA 2YXLA 3HJFA 3KLHA 1SAZA 3LW5C 3UDCA 4QZGA 3TX8A 1RKIA 1WSHA 4URGA 1SS6A 4J91A 3M2VA 3EY1A 1NK0A 4IKFA 4M9HA 4PH5A 2GZOA 3V9UA 5F0UA 7ICFA 4AQYF 1SL2A 5KG6A 4WF9Q 1W2BR 1QVFM 3MR7A 1HBOB 4Y3CA 4CW7B 2CADA 2CJKA 3GFYA 3ILIA 5C5JA 2FZCB 3DLLL 4Q8FA 2OYQA 4WBFA 2UUCF 2KVCA 5J2NA 1P1TA 2F9JA 1V6HA 2L48A 2AJ1A 3FFKB 2J8AA 3AQPA 4CGDA 8ICAA 2AIRB 3KDNA 1N34K 4NLNA 1ASWA 2Z4PA 4DR5F 1LVHA 4BJQA 4ERDA 3QERA 3M3ZA 1S76D 4ELTA 2I7NA 2F3JA 1YF5L 2LSNA 3P8BB 4TY8A 2W01A 3PKYA 2AQ4A 1YJ9S 3KFWX 3NMRA 4K0KJ 5ALXA 1R59O 3Q8LA 3CCSS 4J9RA 4A8MP 2OEKA 3TOQA 2GHWA 4KB0A 1RHQB 9ICOA 2LHTA 4PR6A 7ICGA 1VSJA 4BR0A 3ZSYA 4LSLA 1R6VA 3VMFB 3I1YA 1ICEB 5AT1B 1UAXA 1RYSA 4RL1A 4X65J 2BPGA 4JYAJ 1CULB 1REVB 5F8HA 3N6MA 2WF5A 4WJBA 3VQQA 3QEAZ 3M6ZA 1EAYC 3AV9A 4IOXA 7ICHA 3FRZA 4ES2A 2MSNA 2JLEA 3NH2A 1WI8A 4Y2AA 2KYZA 2JXJA 1V5IB 4JI8K 4OX9J 4CEBA 3L5KA 3CMAN 1Z2LA 4ZMMA 3O8MA 3WK4A 4M9GA 4F4ZA 5CQGA 3AXKA 5ALRA 2RS2A 3GIKA 2QEXN 1S1TA 4BROA 3BYRA 1ZJMA 1RT3A 1HBMB 1GLDG 2QMXA 2WAQC 1D3WA 2XMUA 2KKVA 2PN6A 4D3HA 3MN6A 2E8PA 4LJMA 1U04A 4UAWA 1MN9A 1VQYA 4DB3A 1MN7A 3DLEA 2ZQBA 4YOYA 3QMLA 1UPHA 2KN7A 4FJMA 4FYVB 4ZHRA 2RD5C 3CCLS 5EE1A 4Y2JA 5AQRA 3IM1A 1GQEA 3ZT1A 4ED4A 2F2AB 2NLWA 1E6VB 4F72A 4R65A 2L9WA 2ZE2B 1JI7A 4G9BA 1YTUA 1JLGB 2IVYA 2EAOA 1X0FA 1MC8A 4F36A 2EQYA 4FFDA 3U3YA 2K1RB 3MXIA 5HMWA 5J2IA 2HLUA 3FMWA 3FEXB 3TFRA 2R4FA 3KYLA 2K2PA 4R8UB 2HRUA 3SV4A 3OYJA 2FPKA 2UU9F 4LF8F 1JLQB 3K58A 1KOHA 2R7WA 3P5TL 3HFVA 1DLOB 2A1SA 4RPYA 5KPTA 5M2PA 4TYBA 1Z05A 5C12A 4MYUA 3ZLJA 4TQRA 4MFCA 4DSKA 4ANCA 2W4DA 2OFHX 4KQZA 4MKYA 3ISND 5FJ4A 4KBIA 2RF2A 3PJWA 3JB9k 3I33A 4R64A 2XVTA 1Q53A 5LSRA 3AARA 4CJFA 1HI8A 2AYMA 1VISA 4CHOA 1X42A 3DXKB 1BCOA 2RQ5A 4DL4A 4I2FA 4ZN3A 3OLBA 2NZ4A 1UETA 3H0LB 3PMNA 3RBZA 3SENA 4J7CA 4MIWA 4N47A 3UDLA 4CFCA 4DCCA 5LJVA 4CDIA 2HQCA 5BPLA 3VA0A 3LOUA 4QNLA 1ZQEA 5EHHA 3QBWA 4CJKA 4F9OA 4KITB 8RUCA 9ICTA 3FBEA 1UT5A 5EU7A 4IG0A 5DB9A 3IN5A 3GLJA 1RQLA 1CXQA 5AM5A 7ICIA 4RW8B 3IUCA 2HAFA 2G0CA 1TFWA 3RB4A 4D3GA 4C11A 3RBDA 2FD2A 4KLIA 3M30B 4FXWA 1U1MA 5HATA 4NX9A 4UATA 1PVPA 3DXBA 1NH8A 3VEYA 2DFLA 2JRSA 3TJ8A 4NCBA 1GLAG 2F8KA 3NG8A 3PHTA 5LT5A 2OD6A 4EP4A 3D2NA 1RT2B 3V1QA 2IM1A 2IJNA 5AQXA 2O6KA 2E1RA 1VQOS 1Q0NA 4JI0K 3F5AA 4CQ1A 4LQ9A 3JPNA 5KGWA 3P5JA 1IKYB 3AVBA 1FTRA 4URQU 2KVSA 3NF7A 3M8SA 1VHFA 8ICGA 2KZZA 2YH0A 4KHWA 4Q45A 2OPPA 5AZJB 3WEEB 5CR0A 1J5OA 5KFQA 2QB0A 3MGJA 2RB7A 1ZC6A 3GDXA 2YMPA 4BC5A 1RTHB 1ZTWA 4A2BA 2XHCA 3T5KA 2Z1HA 4DU8A 3EGNA 2HNDA 2OUGA 4TUSA 2K7JA 2KG0A 3CJ1A 2OTLN 3N0VA 1VQLS 2IPOB 3CETA 3Q8UA 2A6OA 2BJ9A 4DX6A 1KFDA 4YFUA 2BE7D 4F92B 3BM7A 3HPGA 3MWTA 4CF5A 4R5PA 3QEPA 4JS4A 2YWKA 3AA4A 4BR5A 4GKJK 2VFSA 4E1MA 2KB2A 1RTZA 1T03A 3D2FB 3IR7B 4C0ZA 1ZTTA 2ZZNA 4LRFA 4N5SA 3A8IA 2DWQA 1VQ9S 2GMHA 1S57A 1Z3EB 3D6FB 5CP2A 2IIHA 2DY4A 2E2OA 1ZQDA 4FPRA 3HHEA 2KZ3A 1D9FA 3I4PA 1FKAF 1HLWA 2KJWA 2DHAA 4M3TA 5DBAA 3QIPB 2AJ2A 4J9KA 1Y4ZB 1KAYA 3HRDD 2BPCA 4CLLA 4NM1A 2WVDA 4DV5J 5LMUF 2IFXA 3EM1A 3AD7C 3G8SA 7ICJA 1C0MA 3E9OA 4A57A 2P5VA 5I3UB 2R7TA 4FK2A 3I56N 4E7IA 3NF9A 5ALLA 2Q4TA 2HSZA 3QXGA 4KLQA 5ALPA 1E4FT 1EQ0A 1MQ2A 3NGYA 4CHPA 1EKEA 2J0XA 2YNIB 4DR5J 3H1VX 5DMRA 1T8EA 2DH9A 5AQGA 3TAPA 1NSAA 2F63A 3OVNA 3T1HF 4F0MA 3MEDA 2XS2A 4DS5A 2FSNA 4A47A 4HHTA 3K75D 2QTWA 1X4AA 1PUZA 5K9FA 2GV9A 4URSA 1JLAA 2DVIA 2JEJA 3VEOA 3C5FA 2H48B 1GAOA 4ECXA 5HR6A 3PRBA 4YN3B 1F5CA 4F5NA 4ZK7M 4DFJA 1TKXB 1VRTA 3ICXA 4MF8A 3C19A 4CF3A 2HZVA 1R8CA 2PGCA 4WZQA 4YD2A 4DJBA 3SCXA 4KAZA 2KQ2A 3UMGA 4CEAA 4TY9A 2P2CB 1RAIB 2ZFHA 2CNOB 2ZNZA 3UXNA 2M4MA 3IDHA 2DHGA 1A7GE 2LM1A 2N4DA 1RYUA 1HNIB 1NJWA 1S72N 4DV3F 1C0TB 3AB2B 2N82B 1RAGB 4DL6A 2JH3A 3W9HA 2VQFF 2QKKA 1YT3A 4PEOA 3MPDA 3H0MB 2HSTA 2FXUA 3Q86A 3W2VB 3DWLA 5AKIA 2C2KB 8ICWA 1ZQCA 3QPIA 3R7BB 3KLEB 3LAMA 3O9TA 3Q8RB 4I28A 1IBLK 2X74A 4PQUA 2E1FA 1HI1A 3CM5A 2CQ0A 1YJRA 4M3UA 2QLXA 4DL7A 4E89A 1S3XA 3ZFVA 4LMZA 3VETA 5AKHA 4ZP8A 3SAFA 3KDOA 4NI2B 2M0GB 3JTOA 1LW0B 9ICFA 3MDQA 5A2QU 5ALDA 3VC8A 5KFBA 4LF8J 1NCLA 3G0ZA 1VOMA 4BR9A 1FFWB 3B54A 5EWGA 1SC3B 2RHSB 1GLCG 1QAXA 5CCLA 4P2HA 2DD8S 5FLXO 1TYQA 1S6QA 4LVSA 1WDDA 5BPMA 3C23A 4HHJA 3IWNC 1X9MA 2NRTA 3RMBA 5DM7L 4QZDA 2YNGB 4NCAA 1JLCA 1RAJA 1FEHA 3PJXA 3H8JA 1U24A 1BGXT 4GVBA 4B3RJ 1NZAA 3C0BA 3ZEUB 2DGTA 3CTRA 1ZD4A 1F0XA 1S7IA 1KLNA 4JI1F 3N4WA 1V9PA 1X5SA 4LF4K 1FVQA 1U0HA 4I2IA 1RQ0A 3P4UB 1SJ1A 4CRJA 4ISGA 4W5OA 3FSXA 2ZF5O 4I2CA 5ETVA 2Z2YB 3HP6A 4BRLA 3BZKA 3V9WA 4FJIA 3TAMA 1IG6A 3V1RA 2G8IA 4L6V3 2O5DA 5A6WA 5F9LA 3KUEA 3KKAA 4KLUA 5KOXA 3KHHA 2ZIVB 4X5VA 2HFNA 4NLYA 2NUHA 3PXGa 3BO4A 1VBXA 1IBCB 2Z7JA 4M7YA 4DUZF 3SD7A 1YI2N 4CDGA 2YKNB 5DRKA 2V7ZA 4MDBA 1LW2B 2Q1LA 1JCGA 4FW2A 2BCUA 5J0OA 2ZGZA 2MXYA 5SWMA 4ZVTB 1ZBFA 3H7IA 2GMJA 3FAHA 5A6PA 3DM2A 4OJOA 5D4PA 3AUOA 4PXCA 4F4WA 4Z4CA 4BBYA 1KVKA 4DPXA 4M42A 2QN6B 2E8NA 1F3FA 1KRPA 4WP9A 2KMDA 2FVRA 1UA1A 4DOCA 4MJKA 3U27A 5KFXA 2VDHA 2A42A 3QICA 3IM8A 1XEZA 4K5RA 4WFZA 2IMOA 5AIAA 3J7ZT 4IDKA 3T5HA 1MNEA 2M52A 4OJ5A 2DGXA 2BANA 4M9LA 2IAJB 1S1WB 3W62A 1J54A 4GXJA 1M0SA 3HHLA 3FZFA 3M8QB 5HJYA 1S6PB 1KVJA 4KR0B 1OQ6A 2ZM6J 3K17A 3VALA 4MYTA 3BR9A 2RUSA 2B51A 1TGOA 3POTB 2NUUG 4W5TA 4PABA 2J6UA 3DYAA 4LFBK 4OI0A 5E3PA 3KD1E 5G0RA 2RSQA 2KICA 3QT5A 3AD9C 1PK1A 4JI2J 1FDDA 1H6KX 2CJYB 3HSJA 3ZC4A 3B8AX 2AYEA 3BN4A 2UXBK 4XK8C 1YIJN 1T9TA 5E3RA 2QLTA 3HP9A 4QZFA 2V2QA 3OTCA 4LBHA 5EVZA 2EFNA 3B82A 4I2PB 1U6FA 4KHRA 2R7XA 1WKLA 2UUBF 1P1LA 4CEEA 3HD1A 3QEBZ 1VSFA 4P2XA 1J9AA 4ZVHA 3MM7B 2WFAA 4HI2A 1VC5A 1L8OA 1C7YA 1DGKN 3MPYA 4ILLA 3VGSA 3TA1A 4KFBB 3CCZA 5AQOA 1NB2A 3EKSA 4WE1B 4CLPA 1X0PA 3VA3A 2H5EA 3ZZYA 3I8BA 3US5A 3OYNA 4OJLA 4M0AA 5J0TA 2KIWA 1F1BB 4UW2A 2EEYA 4OYWA 3NS1A 2KM8C 1QVFR 4JKAA 2VQEJ 3QU4A 4UBCA 3T1HJ 2UXCK 1X66A 2VPWB 5F9NA 2C42A 1NU4A 2IA6A 1F60B 5HL7Q 3SQGB 4CCHA 1VLYA 2FLNA 4WCEQ 1JLFA 3GWCA 4LRBA 2F9WA 4GY2B 2F8MA 2ZDPA 4FSVA 2F9DA 2HURA 1NPPA 4X62J 5JVHL 5CHGA 3NLCA 3FRYA 4M5DB 4G1PA 5AI0A 3TEGA 2R18A 3BGRB 4ZCIA 4JKGA 2ROGA 1IKVA 4DV2K 3AVFA 5G4DA 3FGVA 3MDFA 4RQ3A 3K5MA 3UQ2A 4P10A 2QA2A 5L46A 1XU4A 2KEYA 3UIQA 2DF4B 4DCOB 1WG8A 3MEEB 4UOFA 2CPYA 1C4CA 5M1NA 4GVLA 3VCDA 2R8GA 4CTAA 3D2WA 3CO0P 4LH4A 2B8PA 1X9WA 1CJKB 2E1EA 8ICJA 9ICKA 2UVRA 1LCUA 2ZITA 5AI5A 3ISZA 2JZBA 4QZAA 2FJAB 5KFVA 3D2QA 2W9BA 2W25A 1VBYA 5J2PA 4DV4K 1O08A 4KHQA 1NMNA 1ATNA 5AQUA 4NLXA 4KLGA 5FROA 2FBXA 3JXOA 3NGIA 3A12A 1E6YB 4YY3F 3D7SB 3M6GA 2P66A 3V9XA 5AQIA 3WDOA 3OTEA 2JWNA 2XWYA 1IR2A 4CO4A 4DOBA 5E26A 1UT8A 4IC9A 1DTQA 5KFYA 2GAHC 1RWKB 9ATCB 4C6AA 2FBVA 3OTOF 1CS4B 3KHGA 2QWRA 4IQXA 2AT1B 2AZ1A 4NV0A 1WUAA 4AXIA 2O67A 3D7EO 1NG9A 3SSQA 4BVPA 1LEOA 2R7SA 2QKBA 2HDOA 4K2JA 4A46A 1UAWA 4LF7F 2G4BA 5CA7A 1HHTP 1X4EA 1CSJA 1KC8O 5TKWA 1NNLA 1KC8T 5EOZA 2ZUDA 4UTGA 4CZHA 3MCMA 3HK2A 1S10A 4U8VA 3W63A 1IBMK 3ULHA 4HYKA 4NLUA 1L3KA 1CZ9A 4CLWA 3UM9A 1VQ9N 1OJ4A 2GC8A 4LT6A 4CF2A 4M63A 1PKUA 1XNQF 2AD9A 4JI1J 1OO0B 1TL3B 1BI4A 5EDWA 2FVQA 3C1YA 2B43A 4I2QB 4A8FA 3F5EA 1HX1A 4TLQA 3SSRA 3DRRA 1B0TA 1AB8A 2CPJA 1I94F 2CRLA 4W92B 3VQ8A 5BYSA 5ETLA 2Q97A 4Z4FA 3EDQB 5M1KA 9ICQA 3OFHA 1TUVA 1TV6A 3G71S 4RQ5A 5U47A 4FDFA 4PKGA 5EE3A 1SJQA 1HKCA 3I0RB 4NLQA 1XTZA 4I6MA 1N2XA 2PE8A 5H9EJ 4DUZJ 5J2CA 4ZVQB 4Y1CA 5HBMA 1KQSM 5GTIU 3C6TB 3WU2U 4C0HA 3HMJG 2QL5B 4LJXA 3T41A 5C25A 4RPFA 2GFFA 3SQ0A 3HRGA 4LUBA 4H4OB 4KH6A 1S1VA 9ICPA 3OGUA 2CZ4A 1FD8A 1ZS6A 4YMOA 1JLBA 2MQLA 4OJPA 1ZM2A 3U1LA 4B8CA 5IT9U 2O8EB 1FRIA 3MMCA 1UVLA 3TZWA 2E5IA 1O03A 3O08A 2GA7A 2XMJA 1FTCA 4DV6J 3ZDBA 1BQMB 3OBYA 4QZ8A 4BC9A 3PSIA 2AV5A 4Y2XA 1IWAA 2H3EB 3BB5A 3D1HA 1YTAA 4N8NA 3C5GA 3RB3A 4LQ3A 1YX2A 3HCXA 1Q7YO 1J2NA 4GO7X 1Q7YT 4LSZB 2N1RA 4F71A 2A3VA 3KK1A 4NLGA 1O5JA 2C2EA 3OYFA 2BCRA 2G2ZA 1N88A 5EX3A 4ZCKA 3PW4A 1MWZA 4JI3J 3B6BA 2C2RA 2WTFA 3SAHA 3H2UB 4PL2A 2LKZA 2W9CB 2K8AA 3T19A 2FJ6A 4IFVB 1R8HA 5HROA 3JS6A 4FKYA 3NGZA 2EW9A 3MMJA 5A8WA 2RHQB 4OJ1A 4WFAL 4ZJOA 2QSFA 4HHUA 2CVEA 1XMQF 5C0YA 4P0PB 2HW3A 1GXLA 1CLFA 4FWKA 4DUYK 2B6GA 2HBYB 3TVZA 1L7NA 1GX6A 3QEXA 2UUBJ 3OVBA 5HVFA 5K8OA 3C2PA 1YBTA 2DNMA 4J9SA 4BCAA 1Q78A 2C1EB 4LBPA 1RDFA 3DV9A 2WONB 2XCPA 1V38A 3HL8A 3P6YC 1NXIA 1C4AA 1HMVB 2X78A 3MCNA 1EIYB 4Y2TA 4DR3K 8ICKA 2MUTA 3G96A 4JHDB 2R2SA 1NBWA 3TAQA 4A61A 4WYBA 3O3LA 4QZVB 1NB7A 3BGFA 2NUBA 2C3YA 1TL7B 2PFOA 5ETTA 4ZLNA 2GUPA 2OA8A 4FOIA 4RT2A 3NNHA 4ZS6A 3PW0A 3SDEA 2QYCA 2D7SA 2FUG9 3BQ7A 4YMNA 3LP1B 4CZKA 2MY7A 1I1GA 3ONNA 1ITGA 1BL3A 3OYEA 3R2DJ 3L9ZA 1Y0HA 3KMSA 4Y2UA 2HS3A 3J80U 4FYYB 4B9QA 2BKOA 1WELA 1O0PA 2R2RA 1FIQA 3L3CA 3UVJA 5DBCA 2J0SD 3TJAA 3CJ4A 4IYQA 4L76A 3S8SA 1URJA 1EETA 2H3FA 2H3GX 4G1QB 4ECUA 1BD6A 4ZVOB 2F76X 4ID5B 5HP1B 1DEJA 1S8OA 1RG6A 1IG9A 4C4TA 1ZQQA 4AL5A 5F3ZA 1PJ5A 4OJRA 3QJLA 8ICOA 4QZ9A 1JN3A 1CRXA 2UXDF 3AA3A 4I7FB 4RPXA 1HBUB 2UUTA 4K25A 1RCXB 1X6IA 1HYZA 8ICQA 1RI7A 3TSPA 4M5IA 2LQ8A 2DFHA 3GQCA 2E5HA 1U48A 2W2MP 1X4HA 1SZPA 3KFUF 4CYUB 2OGUA 5JVGL 1NGHA 1ZQAA 5D8HB 4PHEA 2MY8A 1DJ0A 2LXIA 4DL5A 5IC4B 5J2BA 1IIPA 3BGLA 4RQ1A 4RBTA 1Q82O 5L38A 5AHXA 1XSNA 5K20B 1Q82T 4JI5K 3LA0A 1XBWA 4UOHA 3QZ8A 2HBLA 2ISPA 4WF9L 1SV5B 5B0FA 4MO4A 4R79A 5J0WA 3AOAA 3C16B 4YDDB 5J2AA 4CZCA 2MGZB 3L2RA 3THYB 3IAM9 1JXVA 3NWRA 1UP1A 3NE6A 2AA4A 3A3NB 4X4UA 4I67A 4BE1A 1Y00A 1LWCA 5J0QA 4IH6A 4EUVA 2EKYA 5ALTA 2PFUA 3PM9A 3TTCA 4FS2A 5AXNA 2FPMA 1MMDA 3GSDA 1QS4A 4MIAA 4NRTA 3IP0A 2GMLA 4ZVRB 4F0KA 4CO5A 2KU7A 1BPYA 2BCSA 4EO8A 3OUYB 4F3QA 1BNPA 3IS9B 1XERA 1MG7A 2QRRA 2F65A 3VGVA 4ILJA 1VQPN 1OY6A 3VF4A 2MZ1A 3V7KA 2BQUA 3RJKA 3C7NA 2O4GA 4I27A 2DR6A 3B0XA 2AQ0A 1K6YA 3NUQA 4UUXA 3KK3B 1FCAA 3GYNA 2M9NA 1FK9B 1RTJB 4X64J 1F0MA 2PD1A 3J7Z5 5HNKA 3GZ7A 1SQFA 1FHTA 1FDNA 1VIXA 2WBRA 1RT4A 2DUYA 4C4RA 1ZM3A 3OY9A 2BEFA 1GOBA 4CEFA 2MKJA 3MM6A 3UKRA 2JOQA 3VQCA 2VH7A 4JUZA 1N63A 2FZKB 4ED8A 4XAKA 3CC4S 1MROA 4KTWA 5GAEI 4F50A 3ZDAA 1N32J 5AJ3F 3NASA 4H4KC 1RZMA 4DR2J 2KHCA 3HKWA 3AA8A 3TAFA 2YJFA 3V6DA 2CJXB 4B3TJ 1VMBA 2NRRA 2Z56B 1P7DA 4M5HA 2RHKA 3VCBA 2V4JA 1U2VB 2YX1A 3S9HA 3F2KA 2DGQA 1YJNN 5AE1A 2KSOB 9ICBA 3O0FA 2OXOA 3UPFA 3K2PA 1CJUA 4NXZA 3EYZA 2DB1A 4CO3A 3HVTA 3BGOP 1WAJA 4Y2SA 4PAAA 3NCIA 2L08A 3AY0A 3TQ1A 1NUEA 1GLLO 5C42A 2HHTA 5ALNA 2IRUA 2HPUA 4TUPA 2JGAA 3DDKA 1LWFA 4PUOB 2V2ZA 3EVWA 4OZ0A 1IKWB 4IEEA 4FZYA 4ZVEA 4F93B 3DLKA 4OGEA 3MXHP 2OP5A 1RWUA 4CZMA 2VU5A 3V72A 3Q8PB 1HARA 2BGGA 4OHXA 5KFDA 4NLVA 4W5NA 2KDOA 4CFDA 3M2UA 1CEZA 4EBEA 3PX4A 3UQ0A 3I32A 2YHYA 3LQVA 3UNGC 2AWZA 4LF5J 4CM2A 2XMMA 2YX7A 3GV8B 3CD7A 3K5NA 4ZLJA 1RILA 3M9MB 3AA2A 1K73O 2E6MA 3DLHA 1K73T 1ZQHA 3NY0A 3RJMB 4DG1B 1VHXA 3RJGA 1S1UB 2IOFA 4Q2LA 5KFHA 3VESA 3HKZC 3DMJB 2HRYA 5IWAJ 1G3OA 2J4RA 2YNFA 1ZYQA 1JMTA 1RAFB 3RFAA 1VSLA 3MMVA 2E1MC 2C22A 4AQYK 3HT3A 3FFIA 3NL0A 1VJWA 1N61A 2P9LB 2WAQF 2W3RA 3R5DA 5HJXA 3W7BA 2FYXA 4DR6J 1FXXA 4YOTA 2DY1A 4DEZA 2UUCK 1Y3JA 2IVNA 2XTJP 1DK3A 2AGQA 1NK4A 3UR3C 2K4HA 2RVJA 4IWVA 1QQNA 2VA3A 3SCIE 1QHTA 4Y1DA 4AUKA 4CLUA 1ZBTA 3L3UA 1TMJA 1X4DA 4C0BA 5AQNA 2P8IA 2KM8B 4ECSA 3D4JA 1N34F 4UY85 4FF3A 3QNMA 4ZLPA 1K5OA 4H0YB 3I9ZA 4Z6EA 4QJVA 1DZ5A 2C3UA 3VQAA 3TZZA 1JXBA 1FJGJ 3ZYYX 3OR1A 4OZNA 2VFRA 4PWWA 1FXLA 1FERA 4M5JA 3GIMA 5D3GA 3WZ0A 3ENAA 5J0YA 5ALYA 5DB8A 4OV1A 2ZJRL 1H72C 2F4FA 3LPTA 3BBFA 3D66A 9ICAA 2CG8A 3KD5E 5GAHI 2WTUA 4YMMA 1CJVB 2Q79A 1VQSA 3PV8A 1UFLA 5AR0A 3NF8A 4FZZA 3M8PB 3TZYA 2R9LA 3R9KA 4JI8F 1F5BA 4A8QA 1R8BA 2HIYA 4KGZB 4LVOP 3R6LB 1F2GA 2LPEA 2XLJA 2KJ5A 3DNCA 4AYBD 3AH6A 5FRNA 4CWBA 3H2VE 4PQAA 1Q4RA 3NH0A 3QRQA 2M2BA 3QNNA 3CCMN 4DU3A 1TVAA 9ICLA 1VQMS 3MAAB 3V4IA 3VGMA 1WEXA 4ANEA 4O5FA 2KKPA 4ECZA 1FD2A 4CJLA 3LTOA 5FLXY 2ZTEA 4DTRA 4YS2A 3MR5A 3MR2A 1H74A 1Q8BA 4J9VA 1WUUA 4NO7A 1NK5A 2K8GA 2V67A 3CNHA 3A4TA 1VSIA 3A5OC 5B66U 3JSYA 4A8KA 3QT6A 4A59A 3HLUA 3EXYA 1HNZJ 5DDRC 4NXNJ 2CPXA 2CVIA 4JB8B 5KFCA 1ZQXA 3M4XA 3NNCA 2UU9K 1KFSA 4BRMA 4K4IA 2G0AA 2GS8A 3TI0A 4CJVA 4YCXA 4QWEA 3O9SA 1ZQLA 3P3DA 3K1ZA 4LR7A 2A1JB 1WUDA 1KHVA 5T7LB 3M05A 2CH6A 4ILMA 3BUZB 1WTFA 2P9NB 4P2SA 2VG5A 4BR4A 8ICEA 4GKKJ 1FFGB 1GXUA 4NMLA 3CCJS 1S9GB 2FB0A 1P8ZA 4FWMA 3MAQA 1EO1A 4KJIA 4M95A 1L8LA 2FSKA 1KEKA 2BOAA 3G6ES 2YX6A 2KVIA 2HZAA 4I1TA 3UE5A 2QMWA 3FBCA 5ETNA 2E2QA 1G1XA 1DFDA 4FOEA 4MQ3A 3BZQA 3OQ2A 1VQNN 1IBKF 4EZ9A 4KLLA 2RQCA 4RW6B 1ZQMA 2ZH2A 3ZTSA 2LVWA 4V19S 2YB1A 2CPHA 4M5LA 2MRLA 4CH0S 2BUNA 4I2AA 3SR6A 2DTUA 4F5OA 2MEWA 4BGAA 1VYAA 3VN5A 4DR4F 2CWKA 2PIIA 4I56A 3E9LA 1NAQA 1RWWB 3JPPA 5D0RA 4CJPA 1HA1A 4YHHK 2XWXA 5KTQA 3CT9A 1IV0A 5BR8F 2V8DA 4HH0A 2VONA 3C94A 5IIMA 5A0YA 1GXTA 4HUEA 4PKHA 2JVRA 2C2OB 1KQSR 4UOCA 3HBTA 9ICXA 4J9PA 3DOKA 3R3TA 2QT7A 3CRXA 4JI0F 4XRHA 4EBDA 4LREA 5E5NA 5C15A 1TKDA 4ZTJA 2CIMA 1OY9A 3AAWB 9ICEA 4I64A 4DU1A 2BDUA 1TQLA 2E5GA 3VV2B 3GPAA 4P6QA 4PG5A 9ICJA 2W6KA 5DDYA 4DR1J 3LDAA 2YQ1A 4RUCA 2PA8D 3CWJA 1A5WA 3LM2A 4WFBL 1RDCA 1OXJA 5IC6B 2QFIA 1LAWA 2VA2A 5A8RA 1J27A 4X4SA 2LEAA 4GKJF 3CMEN 3IKMA 4N56A 4B9TA 1ITPA 1ZM9A 1RDRA 5IM0B 2YHAA 3K59A 4RUBA 3VQDA 3TA0A 1U1LA 4IOCQ 1ZXIA 1X60A 3UCGA 2JGUA 2ZIXA 5LSLA 2F7VA 1IUJA 5D4BA 2JEIA 1L7MA 2VA8A 4DF4A 3A3OB 4JN4A 4US8A 3ISNC 2RRAA 2R2UA 4B1XB 4FWPA 1KR4A 5LMUK 2QGFB 4NLRA 1C0UB 4EFAC 3CPWM 4ZP7A 3SQ1A 1HPZB 1RT7A 3BPDA 1L5UA 1WN7A 5KPRA 4M6WB 4MTPA 3OT9A 4FJ8A 1RT5B 3PX6A 1TZ0A 4OHWA 2NS1B 4FWRA 2KN4A 2W43A 1R31A 2VG6B 4WXWA 4BR2A 1WBDA 5EY4A 2F1FA 2DPIA 7ICLA 1SKWA 1RWNB 3DU6A 1BHLA 4ISEA 2N7YA 1NGDA 2ZIWB 3AOCA 1SV4A 1IG8A 1N34J 4PY5A 4PL8A 5C24A 5F3XB 2LMIA 3DGPA 4FZVA 8ICIA 1RHUB 3IRXA 3RR7A 4R63A 4A8YA 2I5HA 4J2DA 5IOLA 3T6BA 3TSUA 4X66K 3IHQB 3A0HU 1CULA 1REVA 5HQ8A 4NYFA 1NZBA 5LXYA 1VQ5S 4M3WA 4G6VB 1NH7A 4CLFA 1ZBUA 5DZ6A 2GQCA 1RTIB 3H46O 1AT1B 3SNNA 3ZX3A 1WF2A 3JSBA 1IN0A 2OEHA 5MLCV 4NM2A 5F41A 2MU2A 2DKZA 1Z4OA 3JTPA 5JS1A 2F5GA 1WWHA 3HVAA 2QIFA 1NSQA 3AD8C 1VRUB 2I5JB 3RJIA 5LJ5Y 2EBGA 2D0AA 4US9A 2HHVA 2MMYA 1RTDA 4JI8J 1RWOB 4PWDA 4RPZA 2UP1A 1PJ6A 2Z2LA 4USWA 5C2FA 1N33K 4HACB 2XSFA 4HL9A 2KHOA 2BW7A 5KOWA 3HSZA 4DV3K 2P9SA 3CC4N 2VQFK 2HS0A 3UR0A 3CMQA 4I6YA 2PZSA 4PL1A 4O3RA 2ZUCA 3ASMA 3CIMA 1TUGB 4PA1A 4UT4A 2ZE2A 2F7TA 4CE9A 2MKKA 3ZD9A 1KQQA 2D9OA 1X3MA 3LDPA 2DEJA 4MAKA 2X6SA 4QZBA 3RAXA 3IBFB 4OZJA 4DHYA 2J6SA 2V94A 3DCAA 1S4EA 1IBLF 2YV0X 2W7AA 5LM7E 1DHMA 2XZTB 2VJ4A 4CM0A 3NNAA 2NRVA 3MECA 1RT1B 1JLQA 3CERA 2F8LA 4IH5A 2CQ4A 4NWBA 3NWGA 1NDLA 2NO5A 3ICLA 4IFYA 2D4WA 3CFRA 4RO0A 1RHJB 1NJIO 2Y9UA 3CW2C 1NJIT 5DBBA 3HYFA 2XSJA 2YHWA 4OCZA 5KRTA 1FX2A 3W5XA 4ZJQA 1RU2A 1WORA 2WOMA 5BOLA 4UZBA 1S9EA 1X2IA 4RQ4A 4OX7A 5DETA 3DXKA 3AU2A 1WC6A 2KT2A 3AFGA 5KAKA 2R7UA 1WLJA 5DB7A 5ADXH 1XQSC 2RQKA 4WK1A 4AM7A 2YB4A 4WIQA 3AVGA 5CZVA 5J2JA 2V51B 2R8IA 2V8VA 2P9IB 2PEBA 5JMNA 1HQEB 4DR7K 8ICLA 2ZD1B 4ED2A 4WCEL 1FF2A 2DNOA 5MAOA 2FZGB 3OYKA 1FKPA 4QQBA 4LR8A 2DBYA 2XGQA 1OYDA 4DHVA 9ICSA 2P5OA 1OQ3A 2G8VA 1N6QB 3GSIA 1AYEA 2XMKA 4KRWA 5IXUA 2HMPA 4LF4F 5BRDA 2V9KA 2M88A 2H3QA 1H7WA 5K8MA 3IDWA 4A8WA 3AVJA 3KK2A 4KH0B 4FYDA 5T14A 4HH1A 3RSEB 1Q8KA 1GTHA 4O3OA 3O3FA 5E41A 4JI7K 2LDIA 1Q9XA 2K06A 1WNSA 4WP3A 4ETZA 5AE3A 2PFFB 1S6UA 2OO4A 4Q2MA 1HWKA 5E79U 3L0QA 4NEYA 1HR0K 4PG7A 1B0XA 3GR1A 5HMLA 4FM2A 3DEEA 1BMQB 2BUPA 4ZH4A 3W5ZA 5F2RA 5CAAA 1LK7A 2ROPA 1Q86O 5J0UA 1Q86T 4N77A 4IJNA 3IA0A 5DG7A 2HNYB 2AP1A 3TWZA 3MMBA 1KW4A 2RRNA 2XI2A 2WB1D 1ZOTA 4ED1A 4A8EA 5FPNA 4DTMA 1P27B 4UZCA 3LALA 4I6WA 4FBTA 3AOBA 3DN9A 4JI0J 4I9LA 3QX7A 2W1BA 2LYHA 1JJHA 1UJ6A 2KHDA 3UB5A 1N48A 3BO2A 2E2PA 2R3VA 4ETXA 3VQSA 4AH9A 1RBSA 4NMXA 3KLIB 1S5JA 2BQRA 1YRXA 1N0VC 2GJ2A 2LFVA 5DDOC 4M3RA 2UVUA 3OS2A 1UHUA 4I29A 2A18A 4UASA 3KKAC 4CF1A 2H4YB 3BQTA 1YJTA 3NVZA 3CIPA 3IG8A 3S3MA 4O0IA 2VWKA 1COKA 1BQNB 4PXEA 2I8EA 4UB8U 3JAMU 3QRRA 4M5GA 4GKJJ 3H40A 1B0VA 4KLTA 3WNEA 3D6MB 2KRBA 3QATA 3WT0A 3AAPA 3HF5A 2X1GA 1MQ3A 3FDSA 1S48A 2UXBF 4NLOA 4DFMA 2ZXHA 1EP4A 1IWGA 3R8EA 2FJBB 4V19J 1W7AA 2O01C 5ALVA 5IIIA 4OHYA 1U1NA 2RMLA 3O9UA 4JKCA 2PFNA 3MN9A 3NAEA 3CDBA 2PYJA 1SXEA 5HRPA 3O9RA 3WX4A 1FKOA 4XDCA 5E3QA 2ZH4A 2FMSA 4C8OA 3CJSA 2B7CB 4FYWB 2HFZA 2OANA 4BGDA 4B9MA 3AO1A 3V6HA 3ZTRA 4BDYA 2XYPB 2OWOA 1KVBA 1VFJA 4KKOA 4KYZA 3EDRB 4L72B 5FRMA 3SUQA 2A0FB 3TX0A 1VSMA 4Y2PA 3QUTA 3GB0A 2KH9A 3EZUA 4QU7A 3W2WB 3FYHA 4LF6F 1C20A 1BE4A 2UXCF 5KG1A 1UVKA 5CYMB 2J76E 2MKHA 2FDNA 3J81O 2YN4A 3HFZB 4EIAA 2X1BA 2XY5A 1HNVB 2O8CB 2V7YA 4BDZA 4DX5A 4ICLB 3PW5A 3BDEA 3G6EN 1C1CA 4CEQA 2XICA 8ICXA 1GT8A 4OYOA 1K44A 3KNGA 3BS5A 1QQOA 3M2VB 3CCUN 1RAAB 4P71A 3E0FA 3I5BA 4ICAA 5AK6A 3AVKA 1NMEB 2OZSA 1OYEA 2ITGA 3CJ9A 3P49B 2BDPA 3ZSWA 1RLCL 4B02A 4AM6A 1HI0P 2YCHA 5J2NB 2FPLA 3QESA 2P9CA 3C2KA 3GYXB 1X1PA 1GFWB 3RYLA 1TK5A 3UN2A 2CDQA 2VGNA 3ZT4A 4OLAA 3QU7A 3CJRA 4KGXB 1U2FA 1A9NB 4DSIA 3CCQS 4YOUA 4PXDA 1GMWD 4TXSA 4DV4F 4YY3K 4LH5A 4TY8B 3W66A 1AFIA 2BJDA 3R6MA 5D4OA 2KVQE 2PFQA 2ATLA 4OV6A 4OL8A 2V2KA 2ZUBA 3H4BA 4FVCA 2NXCA 4O8KA 3WQPA 1RXVA 1NGBA 3ATUA 1MN8A 4R0JA 4JI4K 2N4CA 4ZPAA 4F02A 4LSLB 4O3SA 4F7VA 1B70B 2MQNA 3OTOK 1LQ9A 2CJBA 4QIEA 4ZA1A 4CGIA 2N3OA 1CPZA 5HO4A 4CIGA 2NO4A 2YWHA 3H8WA 3W0LA 4BE0A 3ISDA 4FK4A 2CPIA 1RWVB 3M6XA 1JJCB 2ZH8A 1ZQIA 1S77D 2LEBA 4AL6A 4LF7K 4OLPA 2M0NA 3I87A 5IINA 2VBYA 3H6EA 2BJ7A 3I6PA 1ZAWA 2XQCA 2YJEA 3TUZC 2VL1A 1SB6A 3ZETA 1QUPA 1S1TB 5GTHU 3SQ4A 2H3IA 1ESVA 8ICPA 1U25A 4DQPA 4NB4A 5HRSA 1NJXA 1JQGA 3PJ9A 4OKJA 1J97A 1XNQK 3F2BA 3SEIA 3H08A 1OH7A 2RLTA 2KZMA 3QLHA 2H51B 3VR1A 4DQ8A 3DLEB 2DNRA 1I94K 4LF4J 1NK7A 4ZHRB 2CPEA 3VQ9A 2YKOA 3P4IA 4CK3A 2LA6A 5E84A 1OH5A 4CF8A 1WSJA 2NQPA 5AQPA 1X5PA 3OL8A 4Z4EA 1B92A 3ILOA 4IQUA 1ZA1B 2Y0SC 2LEPA 2M70A 4CT9A 1GTEA 8ICVA 1XNRK 1JCFA 1NZPA 1EARA 4Y2QA 4UF4A 2DK2A 2MQQA 2QEXS 3RMAA 5D0GA 2MHEA 4DTOA 4KN4A 5CR4A 3J80O 1SZ2A 3SBTA 2GH1A 2DRBA 4WFNQ 3SYZA 1RBTA 2RF2B 5HI7A 4YN4A 2X3GA 1M1GA 4TVAB 2JR5A 1S1WA 3M1YA 5EN1A 4F4AA 5KL8B 2KKZA 4G65A 3VZIA 2L5YA 2XMVA 1WCNA 4CFBA 2XYHB 3D6TB 4M63C 1L7PA 1ACMB 3OA9A 4CO0A 1ATSA 2E20A 2CGKA 3O6QA 4KT0C 1HD1A 4NXMK 3ZX0A 4BRNA 4LFCK 2FJXA 4IOAQ 1N36F 4IQMA 4IEIA 1FI4A 1R8AA 2NXNA 2E5LF 5GIPA 2FGCA 2C2DA 4C8KA 1FRLA 4XIUA 4GVEA 4E1NA 1JXEA 1U9LA 4ILHA 2CPDA 4FVMA 4IG0B 1ZBIA 5D49A 3NBPA 2ZNYA 3K0SA 5DS7A 5HHHA 1OSCA 4YNQA 4LFBJ 4FF4A 4WWSA 2HBKA 4C11B 4PG8A 1YLXA 1PZNA 2P9PA 1YZ6A 3VAFA 3PW2A 2RS8A 2OHDA 2VJUA 4NYPA 3R6GB 3O3HA 3S3OA 3MTJA 2UXBJ 2CNKB 1LFPA 1XMQK 4YB6A 2CQPA 1KLMA 5KFZA 2YKQA 3VAGA 4LZGA 2HF4A 2XIDA 5LL6Z 3Q83A 3MWBA 1HHSA 4OI4A 1JKHA 1HYSA 4LSNA 2EPIA 3E01A 4EK2A 4OPHA 3T9NA 2FF3B 3C15B 2KT3A 3NVKA 3WHIA 5AM4A 2OPPB 5IT0A 4CZJA 2BMBA 2ZIUA 1J5OB 2QB0B 1UA0A 2H65B 4WYWA 2A1RA 2EWHA 3T3FA 5M2UA 3OR2A 2VC1A 3U02A 5GINA 1B9FA 5KFUA 4WFYA 1T0TV 2HNDB 5KG5A 4H5TA 2CQ1A 4NJ8A 4DR3F 3KIOA 1K0VA 4CNYA 1JXLA 2F8TA 2O66A 2W04A 2OPQA 3CPWR 1KBRA 2C28A 5IIJA 3CB4A