4NL9C

Crystal structure of the human anks3-sam/anks6-sam heterodimer
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
60
structure length
60
Chain Sequence
ELTGILKKLSLEKYQPIFEEQEVDMEAFLTLTDGDLKELGIKTDGSRQQILAAISELNAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ankyrin repeat and SAM domain-containing protein 3
publication title Characterization of the SAM domain of the PKD-related protein ANKS6 and its interaction with ANKS3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 21
structure length 60
sequence length 60
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 4nl9C01
2QARA 1WWUA 1UCVA 2D3DA 1X9XA 2E8PA 2LMRA 2E8NA 5L1MA 2YTUA 2QARB 2QB1A 4RQNA 3TADC 4PZNA 1F0MA 2E8OA 5KNIA 2KSOA 3KKAA 2EAMA 4PZOA 5J8YA 5JTIA 1B4FA 2F44A 1B0XA 1RG6A 2Y9TA 2L5YA 1LKYA 3TADA 2EANA 2JV3A 1SGGA 5JU5A 3SEIA 2E8MA 1V85A 1PK3A 1COKA 1X40A 2FE9A 3TACB 4NL9C 3SENA 2KSOB 1Z1VA 1PK1A 2QKQA 4MHVA 3BQ7A 1SV0C 2K60A 2KE7A 2EAPA 2KIVA 1X66A 4NJ8A 2KG5A 2QB0A 2ES6A 1UQVA 1PK1B 1LKYB 3HILA 1SXEA 2Y9UA 2B6GA 2K4PA 2DKXA 2QB0B 3KKAC 1JI7A 1DXSA 2D8CA 2EAOA 2DL0A 1SV4A 5J8YC 5JRTA 4IS7A 4RQMA 1OW5A 1KW4A 1WWVA 5F3XB 2KMDA 2F3NA 1OXJA 3K1RB 3BS7A 2GLEA 1SXDA 1V38A 3BS5A 2LPEA 4NL9A 3H8MA 2ESEA 2DKZA 2F8KA 3BS5B 1SV0A 3IDWA
chains in the Genus database with same CATH superfamily
3I1YA 1WWUA 3AMZA 1ZD2P 2EDUA 2J6UA 5CJ7A 3HP6A 2BDUA 2A19A 5CRXA 9ICNA 4FS2A 2C28A 1S10A 2P6UA 4RQNA 2KJ9A 3H4BA 1ZQOA 5J8YA 3SV4A 1NKCA 1D8YA 3F5EA 3TFRA 1DOQA 2W11A 4YVZA 3OTQA 2W9MA 2DQNB 3RJIA 4M04A 3UQ2A 5KFLA 3RF9A 4USAA 5IIKA 4QZ9A 4J9NA 1N2XA 7ICTA 1PK1A 1SL1A 4XQ8A 5ALOA 4UW9A 4QW8A 2H3IA 2HMXA 4RQ7A 2HCFA 5DBAA 4QW9A 1VDVA 5DKWA 3HILA 2YMPA 5DLFA 5KFMA 3AN1A 4XRHA 3PW7A 2AQ4A 2ZIWB 5EWEA 1SV4A 4FZNA 3FM9A 5D49A 5ALNA 4DLGA 2KTQA 2DF4B 1X6IA 2AGPA 2ODGA 4NLZA 1B43A 4NLCA 4NL9A 1T3QA 2JMGA 5J0XA 5J0UA 3T3FA 4ED2A 5ALLA 4TUQA 1RYSA 5AKYA 2WF6A 4F4KA 3GILA 2FPKA 4MEXA 5AI0A 1P7DA 3RJFA 5J2EA 5AHXA 3UXNA 1ZQXA 3AU6A 4M47A 4UB6U 5L1IA 1HIWA 8ICEA 4GXIA 4BDPA 7ICHA 4PZOA 1KFDA 3T5KA 2W55A 5HHHA 1BPYA 3M7DA 3PR4A 8ICHA 4P4MA 1BGXT 2QLTA 5AKIA 2P66A 1UT5A 9ICVA 2BKEA 1Q46A 4ZH4A 4UASA 5KG0A 2AU0A 5KAFU 8ICFA 4YCXA 2IBKA 5HR6A 3GZFA 1Z00B 3ETRA 4AYBF 3V6JA 4AYBC 5HMLA 3M1YA 2HSZA 1QSLA 4PHDA 4R63A 7ICLA 3SAGA 1U47A 1X66A 7ICUA 3GU3A 4EYHB 5HHIA 3GIJA 5J0PA 1KEJA 1ZOLA 1QCKA 3FAHA 1N5WA 1HEKA 2NO4A 3ETLA 1Z3EB 5IIIA 1ZQHA 5KFSA 1KW4A 1A0PA 2I6XA 5CB1A 4J9QA 1J2NA 3LYSA 2KN7A 7ICVA 5EWFA 5KFUA 2FMPA 2HHQA 4DEZA 5AI6A 1JALA 3M9NB 4IL6U 4M9GA 5KFYA 4DL3A 3OJSA 4J9KA 1NJYA 4QZCA 1TKDA 4DSKA 3IDWA 2F77X 2KVSA 3I76A 3V6KA 2JXJA 2N1RA 3QU9A 1ZQDA 2FLNA 3U26A 4EX6A 1HUZA 4ECSA 4C0ZA 5C5JA 1LB2B 4DO9A 5EE9A 2UVVA 3N7PD 1ZJMA 4R8UB 1NZBA 2NV3A 4FFDA 2XO7A 3ICXA 2L5YA 5AM3A 5J2KA 5J2BA 1Z00A 2EQYA 3JPNA 1NJZA 4UAWA 2V9WA 4RQ3A 4Y2YA 1PUZA 2DPIA 1MA7A 1X40A 2PI4A 3RJEA 4DQPA 2VJ5A 2W7OA 3ZI4A 2JGAA 4GLXA 3M9OB 1BNOA 4ECQA 3JPOA 4QZGA 2ES6A 1B22A 3QUQA 4DLEA 1LKYB 1NK8A 1ZQUA 3AL0B 5H2FU 2DBYA 8ICWA 2DKXA 4M6WB 3KKAC 1JMSA 2WF8A 2HHXA 2HW3A 4Z6FA 4NY8A 1WYGA 2ZIVA 9ICFA 4RQMA 2YX8A 7ICIA 1A77A 1AQ6A 2ZJAA 2LM1A 4Y2XA 1N48A 1SXDA 4ECRA 4YR0A 1N61A 3HPOA 4F8RA 8ICKA 3PX6A 5ALRA 3AUOA 4M2YA 2CRXA 1N63A 2AXTU 3OHAA 3QEAZ 1CEZA 1SKWA 1WG8A 2IHNA 1Q3UA 2E8PA 1NZPA 3H0LB 1ZYQA 5L1MA 1SZPA 3MR3A 4US8A 3QU5A 4R8UA 3IP4B 1RDFA 2W03A 4KLFA 3AU2A 4ED3A 1AROP 1B4FA 1B0XA 3NASA 4I28A 2F8LA 1N62A 2YMMA 3UPQA 2HOIA 3ZDAA 2ZTEA 1Z4NA 4I2FA 2W43A 3HWTA 1J2MA 3QE9Y 4UB8U 2GOLA 3L4PA 5AM2A 4F2SA 1UT8A 3QZ7A 2IOHA 3Q8PB 4O5KA 2IOFA 2HDOA 4ECUA 2C2DA 4RU9A 3FC4A 2ASDA 3F2DA 4TUPA 4YXJA 4P0PB 1NOMA 3JPPA 4GXJA 2BHNA 1QQ5A 2IA6A 4M6WA 4IQWA 4I2EA 3D2SA 3D2NA 2HBJA 4UB1A 2IMWP 1NK6A 2Y9UA 4QZFA 4O3RA 3H8JA 5AM0A 2QB0B 7ICRA 2ZUCA 2ISPA 1NKEA 2FDRA 1XS9D 4CCHA 2HBLA 4JWMA 4I2BA 5AM4A 1L7OA 3SAHA 1SZHA 1YZ6A 4C8OA 4Y2PA 3DEEA 5L1JA 4PGXA 1SV0A 2AH5A 4JMUA 3V7JA 2LMRA 2PFQA 1QQ6A 3ZDCA 2R8IA 4TURA 4HAIA 5KFXA 7ICFA 5KFEA 3ZD8A 1L3UA 8ICVA 2HHWA 5ALQA 4O3PA 3UMBA 1ZQNA 3IM1A 2BPGA 4EBDA 1VLBA 4KTQA 3N7RC 3E2EA 5KFHA 5B5EU 1SGGA 3IHQB 2ZTCA 9ICJA 3EUB2 1A6SA 5ALYA 2XVTA 1ZQMA 4UARA 4ED6A 3RBDA 2ATLA 3JPRA 3C2MA 1F5SA 3LWLA 8ICAA 4DL6A 4P0PA 4DS4A 3CW2C 1X9SA 4ED8A 3TAQA 3IV6A 2W9BB 1TFRA 2DUYA 2K8AA 3N28A 3L3FX 1JUDA 3D6JA 5D4BA 2QB0A 4B9LA 4Z6EA 1BPDA 2ISOA 5IINA 3KHLA 4YMNA 3TQ1A 2VIXA 4J9OA 3I28A 5AKKA 2DL0A 5JRTA 4IS7A 1ZQVA 4TQSA 2YB4A 4DOAA 1IM4A 1U9LA 1S76D 3T5JA 4Y2VA 2FI1A 1KFTA 4EZ9A 4IR9A 4QZDA 4NM2A 5KFBA 3H8MA 5DG7A 4ECWA 8ICXA 4KMOB 4I2JA 2R8HA 2WTFA 5KFKA 2JH1A 2KFZA 1X6JA 2UVWA 3WKBA 2HBMA 4Y2RA 2E8OA 4C7YA 3OPXA 3RRHA 2RDJA 1MSWD 5TZVA 3O0FA 9ICEA 1NI3A 1N60A 3ALRA 2I1QA 1ZQWA 3LK9A 3PNCA 4OJ5A 2R18A 2LYAA 4O3QA 4BXOB 1CRXA 4LZGA 1ZQIA 2W9BA 3AM9A 4DFJA 2ZXHA 4X5VA 3SENA 5FP0A 5EWGA 9ICHA 1QH9A 4RPZA 4HYKA 2F1JA 3QZ8A 4XA5A 4QWAA 2KIVA 3QNMA 4O5CA 2YY6A 2KFNA 4IQUA 1K5OA 4KLTA 3AQEA 3ONNA 1ZQKA 3F2BA 4DFKA 1S5LU 4GXKA 1SL2A 2R8KA 1JI7A 1UHUA 2LYBA 3CP8A 3NS1A 2FMQA 9ICBA 4RT3A 2KJ8A 3GV8B 3PW0A 3THVA 1ZQBA 4R65A 4NV0A 3F53A 2Q0ZX 2WHEA 1BNPA 5ALZA 3BQ2A 2KOBA 4C8NA 7ICGA 3Q8RB 4O3SA 5KFJA 3GIMA 2F8KA 3KHHA 1XO0A 5C0YA 7ICQA 4PH5A 2H5XA 5E79U 5ALUA 3IRUA 2JEFA 2K8CB 4DFMA 3NVZA 5IIMA 4MFAA 4ELVA 1ZQ1C 2DWQA 2A1JB 2EAMA 1SKSA 1QQ7A 5EE1A 3EPIA 4DOCA 2XCAA 5DQHA 1SB3C 4BXOA 3LDAA 3R9KA 1X9WA 1RYRA 5IILA 5EOZA 4C4RA 1GO3F 4DS5A 5J0RA 3RJKA 5CP2A 3WU2U 2JV3A 5T14A 3HW8A 4DQQA 1S8OA 1MQ3A 2OEHA 3ED5A 8ICBA 8ICSA 7ICKA 3RH4A 5KFCA 2R8GA 4O3MA 2E3TA 1PVPA 3SQIA 3SI8A 1L3TA 1TVAA 3NVVA 3PY8A 3NUQA 3C5GA 4ZOHC 1YZ7A 5K4LA 1MQ2A 3BQTA 5AKJA 4RQ5A 4J03A 4QWCA 1K1SA 3MGIA 1L7PA 1NK0A 2ZIXB 3PW4A 5KFGA 2VANA 2I9GA 3WKAA 4DSJA 3LVVA 9ICGA 4IC9A 4DF8A 4Q45A 3GFKB 4F72A 1D8BA 3BDPA 4ECTA 2F3NA 1KQQA 2JR5A 3K1RB 8ICIA 4PHPA 3JPSA 5J2HA 2GH1A 3PX0A 5BOMA 4E0DA 5KFFA 2W04A 4UB5A 4UB4A 5ALHA 3C23A 3C29A 3SV3A 2E1EA 1M6YA 2G09A 2V4QA 5KFOA 2KIWA 1IXRA 2A1JA 4OJOA 1QTMA 2FLLA 3C1YA 2RP5A 3WK7A 2ZIVB 5KG1A 2HHUA 1F0MA 4PGYA 3WK4A 3WK5A 3EYZA 2HHTA 2AHOB 8ICNA 4PL1A 4QJFB 2Y9TA 4CNQA 2KD1A 4EYIB 5AKXA 2RHFA 2C22A 1ZQCA 1KFSA 2BZFA 4GC6A 2KVCA 3QYPA 4UAUA 4Y2QA 9ICCA 2Q4TA 1DGJA 2YMLA 4RNNA 4B9NA 3KZXA 1XC9A 4C8MA 2BPFA 2W9AA 5DBCA 9ICLA 3HKZF 2BCRA 5CR0A 4I29A 2ZIXA 1UQVA 2HBKA 1S77D 4WJ3B 3ZD9A 2XIDA 1KTQA 5AKZA 3UMCA 1UA0A 1D9DA 1WCLA 3T5HA 1O03A 5J2DA 3RAQA 8ICYA 4UQGA 1L6NA 1RYUA 4BJQA 3C28A 3G6YA 4GC7A 2DPJA 4KLIA 4Y2TA 3OJUA 1Z19A 2JEIA 4B9SA 3RH5A 4UATA 5EE3A 5B66U 4FBUA 3A0BU 4CF5A 3IG5A 5J29A 8ICMA 4O3NA 5ALDA 2XY6A 4I2CA 2C2RA 1X42A 4O3OA 4ECVA 5AK3A 2OM6A 2G08A 2XGPA 5KG6A 2KP7A 1TK5A 1S0OA 9ICAA 2QARB 3C5FA 4BGDA 5KNIA 1ZQGA 2KSOA 4R66A 5KFVA 4M9JA 4PJ0U 2KV2A 1JX4A 3VCBA 1TAUA 3NVYA 3HX0A 4F5RA 4Q8EA 2OWOA 4DF4A 1N56A 2ZJ5A 3T79A 1L8OA 1ZQZA 1COKA 4J9LA 2P35A 3RJJA 5AK5A 1JN3A 3QU2A 4F5PA 2BQRA 3IN5A 1ZJNA 2EZXA 3EW9A 2PFNA 2QKQA 1ZETA 5ALWA 5L1LA 2FLPA 4RT2A 1ZQPA 2PFPA 2F1HA 2MAXA 4EBEA 1DK2A 2Y1IA 4KLHA 3PSTA 3KOOA 3B0YA 3PO4A 5DB6A 2VA2A 1BVSA 4QZAA 4M9NA 1DRGA 2BCVA 2K4PA 2M0NA 3V6HA 2JEJA 5G5GA 5CA7A 4F4ZA 1J97A 4YMOA 1OW5A 1XNSA 1TAMA 2B21A 2W3SA 3S6JA 5BOLA 1KL9A 2CPRA 1JIHA 5ALEA 1LV5A 3MGVA 3MR5A 2BCSA 2DKZA 1D9FA 1FFVA 2C2EA 3OGUA 2PMZF 2LI6A 2QARA 5GTIU 2W8LA 2PMZC 1X9XA 3JPTA 4B9VA 4MFFA 1ZQJA 4OD0A 2KNJA 2YTUA 4FBTA 4M9LA 2ASLA 1SKRA 3C1ZA 3KKAA 3HJEA 1V97A 4RNMA 9ICTA 3RJHA 3DDHA 4RQ2A 3HRDD 5AI5A 3MR2A 4DL4A 4RQ6A 1DGSA 1U45A 4DFPA 4KMUA 3RTVA 4ED1A 2J6SA 1L3VA 2RQ5A 4EEYA 4F4XA 1X2IA 2ZUBA 1T94A 4CF4A 3QU4A 3NRZA 4C8LA 9ICRA 3BQ7A 2KK0A 5J2AA 4DCCA 4F92B 3QX7A 4KLGA 1ZQRA 3GDXA 1T7PA 4PHAA 2F76X 5KFIA 3BZKA 1JXLA 2B6GA 3V72A 3Q8MA 1RQNA 1U49A 2NRXA 5ALKA 4YD2A 4FZMA 4Z6CA 3WKEA 1KRPA 3RR7A 3JPQA 5J8YC 2EZZA 4DOBA 3EZ5A 4I2DA 4EBCA 2WFAA 4US9A 1ZQQA 3RB0A 4UB2A 2LPEA 1K1QA 5KFQA 1PZNA 5KG3A 3H40A 8ICPA 3B9JA 5ALMA 4KLUA 5DGBA 4P0QB 2ZIUA 5KFWA 3UXPA 1JRPA 8ICOA 3FYHA 4FS1A 2KZ3A 1A76A 1JXEA 9ICKA 1QSSA 9ICMA 5KFTA 4KLLA 4LZDA 1IG6A 2OYYA 4MF2A 3QEBZ 3MDAA 2OHFA 2JHDA 2KZZA 1ZD5A 2K4IA 5DDYA 5J0TA 1D8LA 2HOQA 5ALJA 1SIJA 3MABA 5KG4A 4RQ1A 1ZQEA 8ICCA 4KN7A 2W7PA 5HR7A 3Q8SB 3AEVA 5HP4A 2NRTA 2FE9A 1L7NA 2MRLA 4NL9C 4O0IA 1DK3A 1LVHA 7ICNA 4DSEA 2Z7JA 2KHVA 4MHVA 1BPEA 4ELUA 5ALTA 2XI9A 1XWLA 3GIIA 2BPCA 4CE6A 2WB1F 1NK7A 3PMLA 2PFOA 1QLNA 2WB1C 5F9LA 2K89A 3SR6A 4PHEA 1S0NA 4JV2A 8ICUA 4EEKA 4I2IA 3E0FA 9ICUA 1CI4A 3C2LA 4OJLA 1X9MA 1UA1A 5KFZA 4A8EA 3SZ2A 1S0VA 5L9XA 1OXJA 1ED1A 4QWEA 4MF8A 1COOA 2CN1A 1C20A 3C21A 5CEHA 3QUBA 8ICQA 1XSPA 4J9RA 3QU7A 2MA1A 4Q8FA 1SWVA 5AIBA 3KFUF 4ACOA 1U48A 4P0QA 1NJWA 2LYHA 2OXOA 4RQ4A 1SWWA 4OJPA 1C7YA 2BQ3A 4I2GA 2KKVA 3KZIU 4CF3A 3F5AA 3M9MB 5J0WA 1L5UA 2HHSA 2G06A 2QB1A 3TADC 4DFDA 2NRZA 3KHGA 1S9FA 2J6TA 1QSYA 2H3VA 3ZDDA 2LHTA 2AGOA 4O9MA 3ISBA 4BWMA 3SMVA 1RM6C 2JZBB 2PKEA 5ALVA 1YT3A 1T3NA 5HMMA 5ALPA 3NRWA 3PV8A 1MN8A 5G5HA 3PW5A 3K1ZA 3PSIA 5IIOA 1PK3A 4F91B 8ICLA 4XUSA 4FZLA 5KFAA 2HI0A 3N7SC 3ORYA 4J9MA 4PL2A 2F1IA 2FPMA 4BWJA 2K60A 2EAPA 4IR1A 5BPCA 2KG5A 5KTQA 5GTHU 4TQRA 4NLKA 4ECXA 4KLMA 8ICZA 8ICJA 5D46A 4NWIA 4U6PA 4C80A 4JV1A 2K4HA 2WF5A 3RB4A 4B6JA 2MUTB 5AI9A 5F9NA 2D6FC 2D8CA 3BZCA 3SYZA 3UM9A 2A3VA 5J0YA 3UXOA 4YP3A 4QWDA 1S97A 2XY5A 4YR3A 4EX7A 4Y2SA 4DWIA 1ZXIA 3PX4A 1JROA 4YFKA 4UBBA 2UVRA 3TKAA 3T5LA 2K4EA 1L3SA 1ZRMA 3H7IA 1URJA 2PXIA 3N97B 2KJ5A 4RQ8A 2ESEA 1KLNA 2UVUA 2BCUA 4O5EA 3BS5B 4QZEA 4Y2JA 5KT4A 3EPGA 3NVWA 3LWMA 2KHQA 5ALXA 2WF7A 5AICA 3N4MB 3IG8A 2E8NA 2FMSA 2YQEA 4I2AA 2HHVA 5AK6A 5DB7A 2XGQA 4B9TA 3CNHA 3WK9A 4DL2A 3HT3A 1XSNA 2JZBA 5J2JA 4R64A 5JTIA 2GWSA 4PPXA 5DG9A 1Q3VA 2BCQA 3TADA 2EANA 5J2GA 3ISCA 4I2HA 3K75D 3V7KA 3RRGA 5JU5A 4YMMA 4F5OA 4DSIA 1TV9A 2ZIWA 3SEIA 2RLTA 4C8KA 1V85A 5DG8A 3ZDEA 4NXZA 3MGHA 1RPLA 4DQRA 3PSPA 1FEZA 2A1AA 3TACB 2G0AA 2KSOB 4RUAA 4RNOA 4QNLA 3H4DA 1H38A 2G07A 4F4YA 4YQWA 5KG5A 2VKQA 3GV7B 1N5XA 4KLJA 2MUTA 3H0RB 3H0MB 1SXEA 4MEYA 5KT3A 2XC9A 2M9NA 1HUOA 2HOFA 2V4RA 4TUSA 3MDCA 1CUKA 5J0OA 4F5NA 2MSNA 1IIPA 5DB8A 4F71A 1ZQLA 3QXGA 1RZTA 4J9PA 7ICJA 3HKZC 3PSFA 7ICOA 1T4GA 2H3ZA 5AI8A 3BS5A 2ASJA 5KT2A 5A0LA 1PVQA 9ICIA 1T8EA 3TARA 1NJXA 3WK6A 2CXYA 3TANA 5KL1B 1TAQA 4OJ6A 5KFDA 4KLSA 3M8SA 5KG2A 2R8JA 2JRZA 4GIBA 3UQ0A 2WAQF 2RDIA 3AQFA 3QUTA 2O6KA 2WAQC 4OO1J 3SAFA 5AM1A 2K8BB 3NGDA 2YN4A 3LVWA 5DQIA 3M6KA 4YXMA 5AKLA 1RXWA 4B9MA 4BUGA 5AIAA 5AI4A 1O08A 4IQTA 4UB3A 9ICPA 2DGZA 3VC8A 2XCPA 2E8MA 2VA3A 4CDGA 2G5IB 2GO7A 4NM1A 2W3RA 4FE3A 1WUDA 5TISU 2OH2A 3SD7A 4QWBA 1Z1VA 2HVIA 3TAPA 5J0SA 3K4GA 4KLDA 1SV0C 2AQ0A 5JUMA 3PW2A 2W8KA 2KEYA 3MC1A 9ICXA 3E58A 3PO5A 4K4IA 4UAVA 4DL5A 2WF9A 4K4HA 3G6VA 4DQSA 4QIWF 2LBOA 5CHGA 3WKDA 4PGQA 1PVRA 1NK9A 4QIWC 4DL7A 2XY7A 3L5KA 3C2KA 3RBEA 1FIQA 3RJGA 4MFCA 5DQGA 5ALSA 3GV5B 1MC8A 1TK8A 2KZMA 3V7LA 3ZDBA 4C4TA 2W9CB 5DDMA 4K4GA 2KMDA 5ALIA 1NKBA 4DQIA 4IQVA 2EH9A 2XICA 1V38A 2W54A 3RB6A 4B9UA 5ALFA 4M0AA 2VJ4A 3MR6A 3WK8A 4JUZA 3KBBA 4KLOA 2Y1JA 2BQUA 3RFAA 4YD1A 3BQ1A 4F50A 4U7CA 3EWAA 1Z4OA 3H8SA 4LJXA 1TK0A 4GFJA 4RZRA 4I27A 5KL8B 1NK5A 4NLGA 5ALGA 3Q8LA 2NRVA 3M6ZA 1KSPA 3TFSA 4KX5A 1RQLA 4JK1A 1ZQAA 2VA8A 4Q44A 1S0MA 9ICQA 3MBYA 2B0CA 3DV9A 2H3FA 5CWRA 5KFNA 2BDPA 4QZBA 3BJYA 1SL0A 3TI0A 1ZD3A 1LKYA 4UAYA 4G3IA 2PI5A 2AJQA 4NLBA 5J0QA 4KLQA 7ICPA 2F2AB 3PVXA 2BR0A 2ZIUB 2G5HB 3FDSA 4F3OA 4RPXA 3GQCA 4UAZA 2IHMA 1OUQA 4KLEA 3Q8KA 1BPXA 4C7ZA 3KTQA 2ZJ8A 1KN5A 3GIKA 4EZ6A 4UBCA 3KD3A 2AGQA 4ICAA 2E1FA 4LVSA 2KE7A 5EE0A 1ZD4A 2ZG6A 2LKYA 4RUCA 1KBUA 1XO1A 2I5HA 2P6RA 2LM4A 4YN4A 3Q8QB 4OCZA 3A0HU 5KFPA 9ICWA 1IV8A 3MFHA 3D2QA 3PZPA 5L1KA 2W9CA 2JEGA 1U4BA 1WCNA 2EAOA 3B0XA 1F44A 1NNLA 4QZ8A 1WWVA 5J2IA 5F3XB 4KX3A 1TE2A 2YMQA 4ED7A 1BPBA 3G6XA 4IRDA 3BS7A 4NLNA 2GLEA 4IRCA 4YG2A 2OCEA 4ECYA 3RH6A 4DSLA 5KAIU 5AM5A 4CGZA 1RXVA 3NTUA 4FO6A 1XU4A 5AKEA 2FPLA 5AKGA 2ZXIA 2KKPA 1UCVA 1L7MA 1Y88A 1UPHA 5KG7A 2D3DA 7ICSA 5HNKA 1FO4A 3RR8A 3CRXA 2YB1A 5AK4A 3UMGA 4JWNA 5J2CA 1VJ5A 3M8RA 3ISDA 4KN4A 4PZNA 9ICSA 2NYVA 5DLGA 9ICOA 2ALZA 4QZIA 1EXNA 3QUCA 4C4SA 2F44A 1RG6A 4Q43A 8ICGA 4JV0A 4BX9C 3OHBA 7ICEA 5KT7A 3RAXA 5DB9A 2MU2A 8ICRA 5KT6A 3F2CA 1L8LA 1V9PA 1HJPA 1ZRNA 2NO5A 4CRXA 2HVHA 4M9HA 5KT5A 4RQ0A 3H8WA 2RRDA 1KDHA 1FFUA 5DGAA 3MFIA 2Y0SF 4ECZA 2Y0SC 5AKHA 5J2FA 1BPZA 2E5SA 2KICA 4P2HA 2JH7A 4G9BA 4NJ8A 4DSFA 4RPYA 3BQ0A 2NRWA 2ZTDA 1NK4A 1PK1B 4KITB 4F4WA 4ELTA 2ZUDA 4F2RA 2DFLA 3RB3A 4F93B 2BGWA 1DXSA 1ZQYA 5IIJA 1Z1BA 4Z6DA 3OSNA 4EENA 3OSPA 1KKXA 1Q8KA 3WKCA 8ICTA 3PR5B 4IRKA 2IOFK 4Y2UA 4QZHA 3J81j 7ICMA 5KFRA 1XSLA 4F5QA 1ZQFA 4ED0A 1ZQSA 2H3QA 4P4PA 3KHRA 1ZQTA 2FJ6A 4AP9A 5DBBA 1ECWA 3PMNA 4EELA 4J9SA 3CYMA 4P4OA 2EZYA 4JB3A 4YR2A
chains in the Genus database with same CATH topology
2QARA 1WWUA 1UCVA 2D3DA 1X9XA 2E8PA 2LMRA 2E8NA 5L1MA 2YTUA 2QARB 2QB1A 4RQNA 3TADC 4PZNA 1F0MA 2E8OA 5KNIA 2KSOA 3KKAA 2EAMA 4PZOA 5J8YA 5JTIA 1B4FA 2F44A 1B0XA 1RG6A 2Y9TA 2L5YA 1LKYA 3TADA 2EANA 2JV3A 1SGGA 5JU5A 3SEIA 2E8MA 1V85A 1PK3A 1COKA 1X40A 2FE9A 3TACB 4NL9C 3SENA 2KSOB 1Z1VA 1PK1A 2QKQA 4MHVA 3BQ7A 1SV0C 2K60A 2KE7A 2EAPA 2KIVA 1X66A 4NJ8A 2KG5A 2QB0A 2ES6A 1UQVA 1PK1B 1LKYB 3HILA 1SXEA 2Y9UA 2B6GA 2K4PA 2DKXA 2QB0B 3KKAC 1JI7A 1DXSA 2D8CA 2EAOA 2DL0A 1SV4A 5J8YC 5JRTA 4IS7A 4RQMA 1OW5A 1KW4A 1WWVA 5F3XB 2KMDA 2F3NA 1OXJA 3K1RB 3BS7A 2GLEA 1SXDA 1V38A 3BS5A 2LPEA 4NL9A 3H8MA 2ESEA 2DKZA 2F8KA 3BS5B 1SV0A 3IDWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QAR A;  1WWU A;  1UCV A;  2D3D A;  1X9X A;  2E8P A;  2LMR A;  2E8N A;  5L1M A;  2YTU A;  2QAR B;  2QB1 A;  4RQN A;  3TAD C;  4PZN A;  1F0M A;  2E8O A;  5KNI A;  2KSO A;  3KKA A;  2EAM A;  4PZO A;  5J8Y A;  5JTI A;  1B4F A;  2F44 A;  1B0X A;  1RG6 A;  2Y9T A;  2L5Y A;  1LKY A;  3TAD A;  2EAN A;  2JV3 A;  1SGG A;  5JU5 A;  3SEI A;  2E8M A;  1V85 A;  1PK3 A;  1COK A;  1X40 A;  2FE9 A;  3TAC B;  4NL9 C;  3SEN A;  2KSO B;  1Z1V A;  1PK1 A;  2QKQ A;  4MHV A;  3BQ7 A;  1SV0 C;  2K60 A;  2KE7 A;  2EAP A;  2KIV A;  1X66 A;  4NJ8 A;  2KG5 A;  2QB0 A;  2ES6 A;  1UQV A;  1PK1 B;  1LKY B;  3HIL A;  1SXE A;  2Y9U A;  2B6G A;  2K4P A;  2DKX A;  2QB0 B;  3KKA C;  1JI7 A;  1DXS A;  2D8C A;  2EAO A;  2DL0 A;  1SV4 A;  5J8Y C;  5JRT A;  4IS7 A;  4RQM A;  1OW5 A;  1KW4 A;  1WWV A;  5F3X B;  2KMD A;  2F3N A;  1OXJ A;  3K1R B;  3BS7 A;  2GLE A;  1SXD A;  1V38 A;  3BS5 A;  2LPE A;  4NL9 A;  3H8M A;  2ESE A;  2DKZ A;  2F8K A;  3BS5 B;  1SV0 A;  3IDW A; 
#chains in the Genus database with same CATH topology
 3I1Y A;  1WWU A;  3AMZ A;  1ZD2 P;  2EDU A;  2J6U A;  5CJ7 A;  3HP6 A;  2BDU A;  2A19 A;  5CRX A;  9ICN A;  4FS2 A;  2C28 A;  1S10 A;  2P6U A;  4RQN A;  2KJ9 A;  3H4B A;  1ZQO A;  5J8Y A;  3SV4 A;  1NKC A;  1D8Y A;  3F5E A;  3TFR A;  1DOQ A;  2W11 A;  4YVZ A;  3OTQ A;  2W9M A;  2DQN B;  3RJI A;  4M04 A;  3UQ2 A;  5KFL A;  3RF9 A;  4USA A;  5IIK A;  4QZ9 A;  4J9N A;  1N2X A;  7ICT A;  1PK1 A;  1SL1 A;  4XQ8 A;  5ALO A;  4UW9 A;  4QW8 A;  2H3I A;  2HMX A;  4RQ7 A;  2HCF A;  5DBA A;  4QW9 A;  1VDV A;  5DKW A;  3HIL A;  2YMP A;  5DLF A;  5KFM A;  3AN1 A;  4XRH A;  3PW7 A;  2AQ4 A;  2ZIW B;  5EWE A;  1SV4 A;  4FZN A;  3FM9 A;  5D49 A;  5ALN A;  4DLG A;  2KTQ A;  2DF4 B;  1X6I A;  2AGP A;  2ODG A;  4NLZ A;  1B43 A;  4NLC A;  4NL9 A;  1T3Q A;  2JMG A;  5J0X A;  5J0U A;  3T3F A;  4ED2 A;  5ALL A;  4TUQ A;  1RYS A;  5AKY A;  2WF6 A;  4F4K A;  3GIL A;  2FPK A;  4MEX A;  5AI0 A;  1P7D A;  3RJF A;  5J2E A;  5AHX A;  3UXN A;  1ZQX A;  3AU6 A;  4M47 A;  4UB6 U;  5L1I A;  1HIW A;  8ICE A;  4GXI A;  4BDP A;  7ICH A;  4PZO A;  1KFD A;  3T5K A;  2W55 A;  5HHH A;  1BPY A;  3M7D A;  3PR4 A;  8ICH A;  4P4M A;  1BGX T;  2QLT A;  5AKI A;  2P66 A;  1UT5 A;  9ICV A;  2BKE A;  1Q46 A;  4ZH4 A;  4UAS A;  5KG0 A;  2AU0 A;  5KAF U;  8ICF A;  4YCX A;  2IBK A;  5HR6 A;  3GZF A;  1Z00 B;  3ETR A;  4AYB F;  3V6J A;  4AYB C;  5HML A;  3M1Y A;  2HSZ A;  1QSL A;  4PHD A;  4R63 A;  7ICL A;  3SAG A;  1U47 A;  1X66 A;  7ICU A;  3GU3 A;  4EYH B;  5HHI A;  3GIJ A;  5J0P A;  1KEJ A;  1ZOL A;  1QCK A;  3FAH A;  1N5W A;  1HEK A;  2NO4 A;  3ETL A;  1Z3E B;  5III A;  1ZQH A;  5KFS A;  1KW4 A;  1A0P A;  2I6X A;  5CB1 A;  4J9Q A;  1J2N A;  3LYS A;  2KN7 A;  7ICV A;  5EWF A;  5KFU A;  2FMP A;  2HHQ A;  4DEZ A;  5AI6 A;  1JAL A;  3M9N B;  4IL6 U;  4M9G A;  5KFY A;  4DL3 A;  3OJS A;  4J9K A;  1NJY A;  4QZC A;  1TKD A;  4DSK A;  3IDW A;  2F77 X;  2KVS A;  3I76 A;  3V6K A;  2JXJ A;  2N1R A;  3QU9 A;  1ZQD A;  2FLN A;  3U26 A;  4EX6 A;  1HUZ A;  4ECS A;  4C0Z A;  5C5J A;  1LB2 B;  4DO9 A;  5EE9 A;  2UVV A;  3N7P D;  1ZJM A;  4R8U B;  1NZB A;  2NV3 A;  4FFD A;  2XO7 A;  3ICX A;  2L5Y A;  5AM3 A;  5J2K A;  5J2B A;  1Z00 A;  2EQY A;  3JPN A;  1NJZ A;  4UAW A;  2V9W A;  4RQ3 A;  4Y2Y A;  1PUZ A;  2DPI A;  1MA7 A;  1X40 A;  2PI4 A;  3RJE A;  4DQP A;  2VJ5 A;  2W7O A;  3ZI4 A;  2JGA A;  4GLX A;  3M9O B;  1BNO A;  4ECQ A;  3JPO A;  4QZG A;  2ES6 A;  1B22 A;  3QUQ A;  4DLE A;  1LKY B;  1NK8 A;  1ZQU A;  3AL0 B;  5H2F U;  2DBY A;  8ICW A;  2DKX A;  4M6W B;  3KKA C;  1JMS A;  2WF8 A;  2HHX A;  2HW3 A;  4Z6F A;  4NY8 A;  1WYG A;  2ZIV A;  9ICF A;  4RQM A;  2YX8 A;  7ICI A;  1A77 A;  1AQ6 A;  2ZJA A;  2LM1 A;  4Y2X A;  1N48 A;  1SXD A;  4ECR A;  4YR0 A;  1N61 A;  3HPO A;  4F8R A;  8ICK A;  3PX6 A;  5ALR A;  3AUO A;  4M2Y A;  2CRX A;  1N63 A;  2AXT U;  3OHA A;  3QEA Z;  1CEZ A;  1SKW A;  1WG8 A;  2IHN A;  1Q3U A;  2E8P A;  1NZP A;  3H0L B;  1ZYQ A;  5L1M A;  1SZP A;  3MR3 A;  4US8 A;  3QU5 A;  4R8U A;  3IP4 B;  1RDF A;  2W03 A;  4KLF A;  3AU2 A;  4ED3 A;  1ARO P;  1B4F A;  1B0X A;  3NAS A;  4I28 A;  2F8L A;  1N62 A;  2YMM A;  3UPQ A;  2HOI A;  3ZDA A;  2ZTE A;  1Z4N A;  4I2F A;  2W43 A;  3HWT A;  1J2M A;  3QE9 Y;  4UB8 U;  2GOL A;  3L4P A;  5AM2 A;  4F2S A;  1UT8 A;  3QZ7 A;  2IOH A;  3Q8P B;  4O5K A;  2IOF A;  2HDO A;  4ECU A;  2C2D A;  4RU9 A;  3FC4 A;  2ASD A;  3F2D A;  4TUP A;  4YXJ A;  4P0P B;  1NOM A;  3JPP A;  4GXJ A;  2BHN A;  1QQ5 A;  2IA6 A;  4M6W A;  4IQW A;  4I2E A;  3D2S A;  3D2N A;  2HBJ A;  4UB1 A;  2IMW P;  1NK6 A;  2Y9U A;  4QZF A;  4O3R A;  3H8J A;  5AM0 A;  2QB0 B;  7ICR A;  2ZUC A;  2ISP A;  1NKE A;  2FDR A;  1XS9 D;  4CCH A;  2HBL A;  4JWM A;  4I2B A;  5AM4 A;  1L7O A;  3SAH A;  1SZH A;  1YZ6 A;  4C8O A;  4Y2P A;  3DEE A;  5L1J A;  4PGX A;  1SV0 A;  2AH5 A;  4JMU A;  3V7J A;  2LMR A;  2PFQ A;  1QQ6 A;  3ZDC A;  2R8I A;  4TUR A;  4HAI A;  5KFX A;  7ICF A;  5KFE A;  3ZD8 A;  1L3U A;  8ICV A;  2HHW A;  5ALQ A;  4O3P A;  3UMB A;  1ZQN A;  3IM1 A;  2BPG A;  4EBD A;  1VLB A;  4KTQ A;  3N7R C;  3E2E A;  5KFH A;  5B5E U;  1SGG A;  3IHQ B;  2ZTC A;  9ICJ A;  3EUB 2;  1A6S A;  5ALY A;  2XVT A;  1ZQM A;  4UAR A;  4ED6 A;  3RBD A;  2ATL A;  3JPR A;  3C2M A;  1F5S A;  3LWL A;  8ICA A;  4DL6 A;  4P0P A;  4DS4 A;  3CW2 C;  1X9S A;  4ED8 A;  3TAQ A;  3IV6 A;  2W9B B;  1TFR A;  2DUY A;  2K8A A;  3N28 A;  3L3F X;  1JUD A;  3D6J A;  5D4B A;  2QB0 A;  4B9L A;  4Z6E A;  1BPD A;  2ISO A;  5IIN A;  3KHL A;  4YMN A;  3TQ1 A;  2VIX A;  4J9O A;  3I28 A;  5AKK A;  2DL0 A;  5JRT A;  4IS7 A;  1ZQV A;  4TQS A;  2YB4 A;  4DOA A;  1IM4 A;  1U9L A;  1S76 D;  3T5J A;  4Y2V A;  2FI1 A;  1KFT A;  4EZ9 A;  4IR9 A;  4QZD A;  4NM2 A;  5KFB A;  3H8M A;  5DG7 A;  4ECW A;  8ICX A;  4KMO B;  4I2J A;  2R8H A;  2WTF A;  5KFK A;  2JH1 A;  2KFZ A;  1X6J A;  2UVW A;  3WKB A;  2HBM A;  4Y2R A;  2E8O A;  4C7Y A;  3OPX A;  3RRH A;  2RDJ A;  1MSW D;  5TZV A;  3O0F A;  9ICE A;  1NI3 A;  1N60 A;  3ALR A;  2I1Q A;  1ZQW A;  3LK9 A;  3PNC A;  4OJ5 A;  2R18 A;  2LYA A;  4O3Q A;  4BXO B;  1CRX A;  4LZG A;  1ZQI A;  2W9B A;  3AM9 A;  4DFJ A;  2ZXH A;  4X5V A;  3SEN A;  5FP0 A;  5EWG A;  9ICH A;  1QH9 A;  4RPZ A;  4HYK A;  2F1J A;  3QZ8 A;  4XA5 A;  4QWA A;  2KIV A;  3QNM A;  4O5C A;  2YY6 A;  2KFN A;  4IQU A;  1K5O A;  4KLT A;  3AQE A;  3ONN A;  1ZQK A;  3F2B A;  4DFK A;  1S5L U;  4GXK A;  1SL2 A;  2R8K A;  1JI7 A;  1UHU A;  2LYB A;  3CP8 A;  3NS1 A;  2FMQ A;  9ICB A;  4RT3 A;  2KJ8 A;  3GV8 B;  3PW0 A;  3THV A;  1ZQB A;  4R65 A;  4NV0 A;  3F53 A;  2Q0Z X;  2WHE A;  1BNP A;  5ALZ A;  3BQ2 A;  2KOB A;  4C8N A;  7ICG A;  3Q8R B;  4O3S A;  5KFJ A;  3GIM A;  2F8K A;  3KHH A;  1XO0 A;  5C0Y A;  7ICQ A;  4PH5 A;  2H5X A;  5E79 U;  5ALU A;  3IRU A;  2JEF A;  2K8C B;  4DFM A;  3NVZ A;  5IIM A;  4MFA A;  4ELV A;  1ZQ1 C;  2DWQ A;  2A1J B;  2EAM A;  1SKS A;  1QQ7 A;  5EE1 A;  3EPI A;  4DOC A;  2XCA A;  5DQH A;  1SB3 C;  4BXO A;  3LDA A;  3R9K A;  1X9W A;  1RYR A;  5IIL A;  5EOZ A;  4C4R A;  1GO3 F;  4DS5 A;  5J0R A;  3RJK A;  5CP2 A;  3WU2 U;  2JV3 A;  5T14 A;  3HW8 A;  4DQQ A;  1S8O A;  1MQ3 A;  2OEH A;  3ED5 A;  8ICB A;  8ICS A;  7ICK A;  3RH4 A;  5KFC A;  2R8G A;  4O3M A;  2E3T A;  1PVP A;  3SQI A;  3SI8 A;  1L3T A;  1TVA A;  3NVV A;  3PY8 A;  3NUQ A;  3C5G A;  4ZOH C;  1YZ7 A;  5K4L A;  1MQ2 A;  3BQT A;  5AKJ A;  4RQ5 A;  4J03 A;  4QWC A;  1K1S A;  3MGI A;  1L7P A;  1NK0 A;  2ZIX B;  3PW4 A;  5KFG A;  2VAN A;  2I9G A;  3WKA A;  4DSJ A;  3LVV A;  9ICG A;  4IC9 A;  4DF8 A;  4Q45 A;  3GFK B;  4F72 A;  1D8B A;  3BDP A;  4ECT A;  2F3N A;  1KQQ A;  2JR5 A;  3K1R B;  8ICI A;  4PHP A;  3JPS A;  5J2H A;  2GH1 A;  3PX0 A;  5BOM A;  4E0D A;  5KFF A;  2W04 A;  4UB5 A;  4UB4 A;  5ALH A;  3C23 A;  3C29 A;  3SV3 A;  2E1E A;  1M6Y A;  2G09 A;  2V4Q A;  5KFO A;  2KIW A;  1IXR A;  2A1J A;  4OJO A;  1QTM A;  2FLL A;  3C1Y A;  2RP5 A;  3WK7 A;  2ZIV B;  5KG1 A;  2HHU A;  1F0M A;  4PGY A;  3WK4 A;  3WK5 A;  3EYZ A;  2HHT A;  2AHO B;  8ICN A;  4PL1 A;  4QJF B;  2Y9T A;  4CNQ A;  2KD1 A;  4EYI B;  5AKX A;  2RHF A;  2C22 A;  1ZQC A;  1KFS A;  2BZF A;  4GC6 A;  2KVC A;  3QYP A;  4UAU A;  4Y2Q A;  9ICC A;  2Q4T A;  1DGJ A;  2YML A;  4RNN A;  4B9N A;  3KZX A;  1XC9 A;  4C8M A;  2BPF A;  2W9A A;  5DBC A;  9ICL A;  3HKZ F;  2BCR A;  5CR0 A;  4I29 A;  2ZIX A;  1UQV A;  2HBK A;  1S77 D;  4WJ3 B;  3ZD9 A;  2XID A;  1KTQ A;  5AKZ A;  3UMC A;  1UA0 A;  1D9D A;  1WCL A;  3T5H A;  1O03 A;  5J2D A;  3RAQ A;  8ICY A;  4UQG A;  1L6N A;  1RYU A;  4BJQ A;  3C28 A;  3G6Y A;  4GC7 A;  2DPJ A;  4KLI A;  4Y2T A;  3OJU A;  1Z19 A;  2JEI A;  4B9S A;  3RH5 A;  4UAT A;  5EE3 A;  5B66 U;  4FBU A;  3A0B U;  4CF5 A;  3IG5 A;  5J29 A;  8ICM A;  4O3N A;  5ALD A;  2XY6 A;  4I2C A;  2C2R A;  1X42 A;  4O3O A;  4ECV A;  5AK3 A;  2OM6 A;  2G08 A;  2XGP A;  5KG6 A;  2KP7 A;  1TK5 A;  1S0O A;  9ICA A;  2QAR B;  3C5F A;  4BGD A;  5KNI A;  1ZQG A;  2KSO A;  4R66 A;  5KFV A;  4M9J A;  4PJ0 U;  2KV2 A;  1JX4 A;  3VCB A;  1TAU A;  3NVY A;  3HX0 A;  4F5R A;  4Q8E A;  2OWO A;  4DF4 A;  1N56 A;  2ZJ5 A;  3T79 A;  1L8O A;  1ZQZ A;  1COK A;  4J9L A;  2P35 A;  3RJJ A;  5AK5 A;  1JN3 A;  3QU2 A;  4F5P A;  2BQR A;  3IN5 A;  1ZJN A;  2EZX A;  3EW9 A;  2PFN A;  2QKQ A;  1ZET A;  5ALW A;  5L1L A;  2FLP A;  4RT2 A;  1ZQP A;  2PFP A;  2F1H A;  2MAX A;  4EBE A;  1DK2 A;  2Y1I A;  4KLH A;  3PST A;  3KOO A;  3B0Y A;  3PO4 A;  5DB6 A;  2VA2 A;  1BVS A;  4QZA A;  4M9N A;  1DRG A;  2BCV A;  2K4P A;  2M0N A;  3V6H A;  2JEJ A;  5G5G A;  5CA7 A;  4F4Z A;  1J97 A;  4YMO A;  1OW5 A;  1XNS A;  1TAM A;  2B21 A;  2W3S A;  3S6J A;  5BOL A;  1KL9 A;  2CPR A;  1JIH A;  5ALE A;  1LV5 A;  3MGV A;  3MR5 A;  2BCS A;  2DKZ A;  1D9F A;  1FFV A;  2C2E A;  3OGU A;  2PMZ F;  2LI6 A;  2QAR A;  5GTI U;  2W8L A;  2PMZ C;  1X9X A;  3JPT A;  4B9V A;  4MFF A;  1ZQJ A;  4OD0 A;  2KNJ A;  2YTU A;  4FBT A;  4M9L A;  2ASL A;  1SKR A;  3C1Z A;  3KKA A;  3HJE A;  1V97 A;  4RNM A;  9ICT A;  3RJH A;  3DDH A;  4RQ2 A;  3HRD D;  5AI5 A;  3MR2 A;  4DL4 A;  4RQ6 A;  1DGS A;  1U45 A;  4DFP A;  4KMU A;  3RTV A;  4ED1 A;  2J6S A;  1L3V A;  2RQ5 A;  4EEY A;  4F4X A;  1X2I A;  2ZUB A;  1T94 A;  4CF4 A;  3QU4 A;  3NRZ A;  4C8L A;  9ICR A;  3BQ7 A;  2KK0 A;  5J2A A;  4DCC A;  4F92 B;  3QX7 A;  4KLG A;  1ZQR A;  3GDX A;  1T7P A;  4PHA A;  2F76 X;  5KFI A;  3BZK A;  1JXL A;  2B6G A;  3V72 A;  3Q8M A;  1RQN A;  1U49 A;  2NRX A;  5ALK A;  4YD2 A;  4FZM A;  4Z6C A;  3WKE A;  1KRP A;  3RR7 A;  3JPQ A;  5J8Y C;  2EZZ A;  4DOB A;  3EZ5 A;  4I2D A;  4EBC A;  2WFA A;  4US9 A;  1ZQQ A;  3RB0 A;  4UB2 A;  2LPE A;  1K1Q A;  5KFQ A;  1PZN A;  5KG3 A;  3H40 A;  8ICP A;  3B9J A;  5ALM A;  4KLU A;  5DGB A;  4P0Q B;  2ZIU A;  5KFW A;  3UXP A;  1JRP A;  8ICO A;  3FYH A;  4FS1 A;  2KZ3 A;  1A76 A;  1JXE A;  9ICK A;  1QSS A;  9ICM A;  5KFT A;  4KLL A;  4LZD A;  1IG6 A;  2OYY A;  4MF2 A;  3QEB Z;  3MDA A;  2OHF A;  2JHD A;  2KZZ A;  1ZD5 A;  2K4I A;  5DDY A;  5J0T A;  1D8L A;  2HOQ A;  5ALJ A;  1SIJ A;  3MAB A;  5KG4 A;  4RQ1 A;  1ZQE A;  8ICC A;  4KN7 A;  2W7P A;  5HR7 A;  3Q8S B;  3AEV A;  5HP4 A;  2NRT A;  2FE9 A;  1L7N A;  2MRL A;  4NL9 C;  4O0I A;  1DK3 A;  1LVH A;  7ICN A;  4DSE A;  2Z7J A;  2KHV A;  4MHV A;  1BPE A;  4ELU A;  5ALT A;  2XI9 A;  1XWL A;  3GII A;  2BPC A;  4CE6 A;  2WB1 F;  1NK7 A;  3PML A;  2PFO A;  1QLN A;  2WB1 C;  5F9L A;  2K89 A;  3SR6 A;  4PHE A;  1S0N A;  4JV2 A;  8ICU A;  4EEK A;  4I2I A;  3E0F A;  9ICU A;  1CI4 A;  3C2L A;  4OJL A;  1X9M A;  1UA1 A;  5KFZ A;  4A8E A;  3SZ2 A;  1S0V A;  5L9X A;  1OXJ A;  1ED1 A;  4QWE A;  4MF8 A;  1COO A;  2CN1 A;  1C20 A;  3C21 A;  5CEH A;  3QUB A;  8ICQ A;  1XSP A;  4J9R A;  3QU7 A;  2MA1 A;  4Q8F A;  1SWV A;  5AIB A;  3KFU F;  4ACO A;  1U48 A;  4P0Q A;  1NJW A;  2LYH A;  2OXO A;  4RQ4 A;  1SWW A;  4OJP A;  1C7Y A;  2BQ3 A;  4I2G A;  2KKV A;  3KZI U;  4CF3 A;  3F5A A;  3M9M B;  5J0W A;  1L5U A;  2HHS A;  2G06 A;  2QB1 A;  3TAD C;  4DFD A;  2NRZ A;  3KHG A;  1S9F A;  2J6T A;  1QSY A;  2H3V A;  3ZDD A;  2LHT A;  2AGO A;  4O9M A;  3ISB A;  4BWM A;  3SMV A;  1RM6 C;  2JZB B;  2PKE A;  5ALV A;  1YT3 A;  1T3N A;  5HMM A;  5ALP A;  3NRW A;  3PV8 A;  1MN8 A;  5G5H A;  3PW5 A;  3K1Z A;  3PSI A;  5IIO A;  1PK3 A;  4F91 B;  8ICL A;  4XUS A;  4FZL A;  5KFA A;  2HI0 A;  3N7S C;  3ORY A;  4J9M A;  4PL2 A;  2F1I A;  2FPM A;  4BWJ A;  2K60 A;  2EAP A;  4IR1 A;  5BPC A;  2KG5 A;  5KTQ A;  5GTH U;  4TQR A;  4NLK A;  4ECX A;  4KLM A;  8ICZ A;  8ICJ A;  5D46 A;  4NWI A;  4U6P A;  4C80 A;  4JV1 A;  2K4H A;  2WF5 A;  3RB4 A;  4B6J A;  2MUT B;  5AI9 A;  5F9N A;  2D6F C;  2D8C A;  3BZC A;  3SYZ A;  3UM9 A;  2A3V A;  5J0Y A;  3UXO A;  4YP3 A;  4QWD A;  1S97 A;  2XY5 A;  4YR3 A;  4EX7 A;  4Y2S A;  4DWI A;  1ZXI A;  3PX4 A;  1JRO A;  4YFK A;  4UBB A;  2UVR A;  3TKA A;  3T5L A;  2K4E A;  1L3S A;  1ZRM A;  3H7I A;  1URJ A;  2PXI A;  3N97 B;  2KJ5 A;  4RQ8 A;  2ESE A;  1KLN A;  2UVU A;  2BCU A;  4O5E A;  3BS5 B;  4QZE A;  4Y2J A;  5KT4 A;  3EPG A;  3NVW A;  3LWM A;  2KHQ A;  5ALX A;  2WF7 A;  5AIC A;  3N4M B;  3IG8 A;  2E8N A;  2FMS A;  2YQE A;  4I2A A;  2HHV A;  5AK6 A;  5DB7 A;  2XGQ A;  4B9T A;  3CNH A;  3WK9 A;  4DL2 A;  3HT3 A;  1XSN A;  2JZB A;  5J2J A;  4R64 A;  5JTI A;  2GWS A;  4PPX A;  5DG9 A;  1Q3V A;  2BCQ A;  3TAD A;  2EAN A;  5J2G A;  3ISC A;  4I2H A;  3K75 D;  3V7K A;  3RRG A;  5JU5 A;  4YMM A;  4F5O A;  4DSI A;  1TV9 A;  2ZIW A;  3SEI A;  2RLT A;  4C8K A;  1V85 A;  5DG8 A;  3ZDE A;  4NXZ A;  3MGH A;  1RPL A;  4DQR A;  3PSP A;  1FEZ A;  2A1A A;  3TAC B;  2G0A A;  2KSO B;  4RUA A;  4RNO A;  4QNL A;  3H4D A;  1H38 A;  2G07 A;  4F4Y A;  4YQW A;  5KG5 A;  2VKQ A;  3GV7 B;  1N5X A;  4KLJ A;  2MUT A;  3H0R B;  3H0M B;  1SXE A;  4MEY A;  5KT3 A;  2XC9 A;  2M9N A;  1HUO A;  2HOF A;  2V4R A;  4TUS A;  3MDC A;  1CUK A;  5J0O A;  4F5N A;  2MSN A;  1IIP A;  5DB8 A;  4F71 A;  1ZQL A;  3QXG A;  1RZT A;  4J9P A;  7ICJ A;  3HKZ C;  3PSF A;  7ICO A;  1T4G A;  2H3Z A;  5AI8 A;  3BS5 A;  2ASJ A;  5KT2 A;  5A0L A;  1PVQ A;  9ICI A;  1T8E A;  3TAR A;  1NJX A;  3WK6 A;  2CXY A;  3TAN A;  5KL1 B;  1TAQ A;  4OJ6 A;  5KFD A;  4KLS A;  3M8S A;  5KG2 A;  2R8J A;  2JRZ A;  4GIB A;  3UQ0 A;  2WAQ F;  2RDI A;  3AQF A;  3QUT A;  2O6K A;  2WAQ C;  4OO1 J;  3SAF A;  5AM1 A;  2K8B B;  3NGD A;  2YN4 A;  3LVW A;  5DQI A;  3M6K A;  4YXM A;  5AKL A;  1RXW A;  4B9M A;  4BUG A;  5AIA A;  5AI4 A;  1O08 A;  4IQT A;  4UB3 A;  9ICP A;  2DGZ A;  3VC8 A;  2XCP A;  2E8M A;  2VA3 A;  4CDG A;  2G5I B;  2GO7 A;  4NM1 A;  2W3R A;  4FE3 A;  1WUD A;  5TIS U;  2OH2 A;  3SD7 A;  4QWB A;  1Z1V A;  2HVI A;  3TAP A;  5J0S A;  3K4G A;  4KLD A;  1SV0 C;  2AQ0 A;  5JUM A;  3PW2 A;  2W8K A;  2KEY A;  3MC1 A;  9ICX A;  3E58 A;  3PO5 A;  4K4I A;  4UAV A;  4DL5 A;  2WF9 A;  4K4H A;  3G6V A;  4DQS A;  4QIW F;  2LBO A;  5CHG A;  3WKD A;  4PGQ A;  1PVR A;  1NK9 A;  4QIW C;  4DL7 A;  2XY7 A;  3L5K A;  3C2K A;  3RBE A;  1FIQ A;  3RJG A;  4MFC A;  5DQG A;  5ALS A;  3GV5 B;  1MC8 A;  1TK8 A;  2KZM A;  3V7L A;  3ZDB A;  4C4T A;  2W9C B;  5DDM A;  4K4G A;  2KMD A;  5ALI A;  1NKB A;  4DQI A;  4IQV A;  2EH9 A;  2XIC A;  1V38 A;  2W54 A;  3RB6 A;  4B9U A;  5ALF A;  4M0A A;  2VJ4 A;  3MR6 A;  3WK8 A;  4JUZ A;  3KBB A;  4KLO A;  2Y1J A;  2BQU A;  3RFA A;  4YD1 A;  3BQ1 A;  4F50 A;  4U7C A;  3EWA A;  1Z4O A;  3H8S A;  4LJX A;  1TK0 A;  4GFJ A;  4RZR A;  4I27 A;  5KL8 B;  1NK5 A;  4NLG A;  5ALG A;  3Q8L A;  2NRV A;  3M6Z A;  1KSP A;  3TFS A;  4KX5 A;  1RQL A;  4JK1 A;  1ZQA A;  2VA8 A;  4Q44 A;  1S0M A;  9ICQ A;  3MBY A;  2B0C A;  3DV9 A;  2H3F A;  5CWR A;  5KFN A;  2BDP A;  4QZB A;  3BJY A;  1SL0 A;  3TI0 A;  1ZD3 A;  1LKY A;  4UAY A;  4G3I A;  2PI5 A;  2AJQ A;  4NLB A;  5J0Q A;  4KLQ A;  7ICP A;  2F2A B;  3PVX A;  2BR0 A;  2ZIU B;  2G5H B;  3FDS A;  4F3O A;  4RPX A;  3GQC A;  4UAZ A;  2IHM A;  1OUQ A;  4KLE A;  3Q8K A;  1BPX A;  4C7Z A;  3KTQ A;  2ZJ8 A;  1KN5 A;  3GIK A;  4EZ6 A;  4UBC A;  3KD3 A;  2AGQ A;  4ICA A;  2E1F A;  4LVS A;  2KE7 A;  5EE0 A;  1ZD4 A;  2ZG6 A;  2LKY A;  4RUC A;  1KBU A;  1XO1 A;  2I5H A;  2P6R A;  2LM4 A;  4YN4 A;  3Q8Q B;  4OCZ A;  3A0H U;  5KFP A;  9ICW A;  1IV8 A;  3MFH A;  3D2Q A;  3PZP A;  5L1K A;  2W9C A;  2JEG A;  1U4B A;  1WCN A;  2EAO A;  3B0X A;  1F44 A;  1NNL A;  4QZ8 A;  1WWV A;  5J2I A;  5F3X B;  4KX3 A;  1TE2 A;  2YMQ A;  4ED7 A;  1BPB A;  3G6X A;  4IRD A;  3BS7 A;  4NLN A;  2GLE A;  4IRC A;  4YG2 A;  2OCE A;  4ECY A;  3RH6 A;  4DSL A;  5KAI U;  5AM5 A;  4CGZ A;  1RXV A;  3NTU A;  4FO6 A;  1XU4 A;  5AKE A;  2FPL A;  5AKG A;  2ZXI A;  2KKP A;  1UCV A;  1L7M A;  1Y88 A;  1UPH A;  5KG7 A;  2D3D A;  7ICS A;  5HNK A;  1FO4 A;  3RR8 A;  3CRX A;  2YB1 A;  5AK4 A;  3UMG A;  4JWN A;  5J2C A;  1VJ5 A;  3M8R A;  3ISD A;  4KN4 A;  4PZN A;  9ICS A;  2NYV A;  5DLG A;  9ICO A;  2ALZ A;  4QZI A;  1EXN A;  3QUC A;  4C4S A;  2F44 A;  1RG6 A;  4Q43 A;  8ICG A;  4JV0 A;  4BX9 C;  3OHB A;  7ICE A;  5KT7 A;  3RAX A;  5DB9 A;  2MU2 A;  8ICR A;  5KT6 A;  3F2C A;  1L8L A;  1V9P A;  1HJP A;  1ZRN A;  2NO5 A;  4CRX A;  2HVH A;  4M9H A;  5KT5 A;  4RQ0 A;  3H8W A;  2RRD A;  1KDH A;  1FFU A;  5DGA A;  3MFI A;  2Y0S F;  4ECZ A;  2Y0S C;  5AKH A;  5J2F A;  1BPZ A;  2E5S A;  2KIC A;  4P2H A;  2JH7 A;  4G9B A;  4NJ8 A;  4DSF A;  4RPY A;  3BQ0 A;  2NRW A;  2ZTD A;  1NK4 A;  1PK1 B;  4KIT B;  4F4W A;  4ELT A;  2ZUD A;  4F2R A;  2DFL A;  3RB3 A;  4F93 B;  2BGW A;  1DXS A;  1ZQY A;  5IIJ A;  1Z1B A;  4Z6D A;  3OSN A;  4EEN A;  3OSP A;  1KKX A;  1Q8K A;  3WKC A;  8ICT A;  3PR5 B;  4IRK A;  2IOF K;  4Y2U A;  4QZH A;  3J81 j;  7ICM A;  5KFR A;  1XSL A;  4F5Q A;  1ZQF A;  4ED0 A;  1ZQS A;  2H3Q A;  4P4P A;  3KHR A;  1ZQT A;  2FJ6 A;  4AP9 A;  5DBB A;  1ECW A;  3PMN A;  4EEL A;  4J9S A;  3CYM A;  4P4O A;  2EZY A;  4JB3 A;  4YR2 A; 
#chains in the Genus database with same CATH homology
 2QAR A;  1WWU A;  1UCV A;  2D3D A;  1X9X A;  2E8P A;  2LMR A;  2E8N A;  5L1M A;  2YTU A;  2QAR B;  2QB1 A;  4RQN A;  3TAD C;  4PZN A;  1F0M A;  2E8O A;  5KNI A;  2KSO A;  3KKA A;  2EAM A;  4PZO A;  5J8Y A;  5JTI A;  1B4F A;  2F44 A;  1B0X A;  1RG6 A;  2Y9T A;  2L5Y A;  1LKY A;  3TAD A;  2EAN A;  2JV3 A;  1SGG A;  5JU5 A;  3SEI A;  2E8M A;  1V85 A;  1PK3 A;  1COK A;  1X40 A;  2FE9 A;  3TAC B;  4NL9 C;  3SEN A;  2KSO B;  1Z1V A;  1PK1 A;  2QKQ A;  4MHV A;  3BQ7 A;  1SV0 C;  2K60 A;  2KE7 A;  2EAP A;  2KIV A;  1X66 A;  4NJ8 A;  2KG5 A;  2QB0 A;  2ES6 A;  1UQV A;  1PK1 B;  1LKY B;  3HIL A;  1SXE A;  2Y9U A;  2B6G A;  2K4P A;  2DKX A;  2QB0 B;  3KKA C;  1JI7 A;  1DXS A;  2D8C A;  2EAO A;  2DL0 A;  1SV4 A;  5J8Y C;  5JRT A;  4IS7 A;  4RQM A;  1OW5 A;  1KW4 A;  1WWV A;  5F3X B;  2KMD A;  2F3N A;  1OXJ A;  3K1R B;  3BS7 A;  2GLE A;  1SXD A;  1V38 A;  3BS5 A;  2LPE A;  4NL9 A;  3H8M A;  2ESE A;  2DKZ A;  2F8K A;  3BS5 B;  1SV0 A;  3IDW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...