4NL9C

Crystal structure of the human anks3-sam/anks6-sam heterodimer
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
60
structure length
60
Chain Sequence
ELTGILKKLSLEKYQPIFEEQEVDMEAFLTLTDGDLKELGIKTDGSRQQILAAISELNAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Ankyrin repeat and SAM domain-containing protein 3
publication title Characterization of the SAM domain of the PKD-related protein ANKS6 and its interaction with ANKS3.
pubmed doi rcsb
source organism Homo sapiens
total genus 21
structure length 60
sequence length 60
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 4nl9C01
2E8MA 1V85A 1SGGA 2KIVA 2DKXA 1X40A 3TADC 1SV0C 2KG5A 4RQNA 3TADA 2QKQA 4PZNA 1SV0A 2F44A 1RG6A 5J8YC 1PK1A 1KW4A 1Z1VA 1SXEA 2EANA 5JTIA 1LKYA 3TACB 2F8KA 2K60A 4IS7A 5J8YA 4MHVA 2E8OA 2EAOA 4PZOA 2DL0A 1X66A 2DKZA 2E8PA 2E8NA 2LPEA 1PK1B 1B4FA 2Y9TA 4RQMA 5L1MA 2ES6A 1LKYB 5KNIA 1COKA 1X9XA 1SXDA 5JU5A 3IDWA 2KMDA 1OW5A 3SEIA 4NJ8A 3BS5A 1DXSA 2ESEA 3HILA 5F3XB 2EAMA 1UCVA 2D3DA 3BS7A 2QB0A 2B6GA 2L5YA 3KKAC 3H8MA 2JV3A 3SENA 2FE9A 1OXJA 3BS5B 3KKAA 1UQVA 2QARB 2K4PA 2EAPA 2KSOA 3K1RB 2D8CA 1PK3A 2GLEA 4NL9C 1WWVA 2QARA 1B0XA 5JRTA 2QB0B 2Y9UA 2LMRA 1JI7A 4NL9A 2KE7A 1V38A 2F3NA 1F0MA 2QB1A 2YTUA 1SV4A 1WWUA 3BQ7A 2KSOB
chains in the Genus database with same CATH superfamily
4R64A 3V6KA 2YN4A 4USAA 9ICRA 4B9MA 1SV0C 2JEGA 2BHNA 2KG5A 3RH4A 4IRCA 2W8LA 5ALDA 5J0RA 1ECWA 1N62A 3B0XA 2LYBA 3A0BU 3QUQA 1ZQDA 2FDRA 1UPHA 5AK6A 3C1ZA 2LYHA 3TACB 8ICSA 3WKDA 4DL2A 1KFSA 3IP4B 4F5QA 4YXJA 4DSIA 2K8CB 9ICOA 4P0QA 2NO5A 1ZYQA 5ALWA 2ASDA 3PNCA 2LPEA 2MRLA 1PK1B 1OUQA 4EYIB 4UAYA 4RQ3A 3WK5A 2ZJ8A 1X9XA 4FS2A 1SXDA 1WUDA 4NLKA 1SZPA 5KAIU 4Y2PA 4MEXA 1QQ5A 3K75D 4OJ5A 1N61A 1X9SA 5KT3A 4F91B 1FFVA 3IM1A 3MR3A 3KHGA 4M0AA 7ICHA 4R66A 4Z6DA 4FZNA 3ZDBA 8ICBA 5J2FA 3EUB2 3Q8MA 1N60A 3ISCA 5DG9A 3THVA 5F9LA 3Q8LA 5H2FU 1NK5A 4IRDA 1NJYA 1S77D 4IR9A 2D8CA 1VLBA 5EWEA 4QWDA 4Y2SA 1B0XA 4RQ0A 4UB2A 2YB1A 2ZIVB 2FMPA 4UBBA 4ECYA 4RPXA 1BPBA 2ZJ5A 3UPQA 4QIWF 3GV5B 2M0NA 2E1EA 4DQSA 4M9NA 1N63A 1L7MA 4UARA 4F8RA 7ICFA 4RQNA 5ALHA 1RG6A 3PSPA 1BPYA 4Y2JA 2IOFK 8ICFA 1NK0A 3ZDCA 3E58A 3UQ0A 3F5EA 1GO3F 4FFDA 5E79U 4FBUA 5HMLA 4I2GA 2BKEA 1S8OA 1TK8A 3ICXA 4C7YA 2AGQA 3WKEA 4B9NA 5C0YA 1A76A 2ISPA 2KD1A 4KLJA 5J2HA 1SL0A 2H3QA 3CRXA 9ICWA 3CP8A 5JU5A 2LM4A 1D9FA 1U9LA 3TQ1A 4YMOA 3RH5A 5ALPA 4JV0A 2ASJA 2OHFA 8ICUA 1O08A 1B22A 4QJFB 1UT5A 5KG7A 5DB7A 3IHQB 3Q8KA 1UCVA 3GFKB 5J2CA 2CXYA 1XNSA 3RBEA 1U45A 5AI9A 1Z00A 4UQGA 4F4ZA 2AGOA 5IINA 4QWCA 2A3VA 2K4PA 4IR1A 4QZHA 1Z19A 3RAQA 4I2IA 5J0TA 4OJOA 1A0PA 5ALSA 2W03A 4EZ9A 2EDUA 2H3VA 2VA2A 1EXNA 2C28A 2V4QA 4RU9A 1RQLA 5KFEA 4Y2VA 1RPLA 3OSPA 4KLUA 2KN7A 3BJYA 3NVWA 4NWIA 3TADC 1MSWD 2DF4B 5HMMA 4P0PA 2F1IA 2NV3A 5IIOA 4EX6A 3RJKA 9ICVA 1ZRNA 4ECTA 1ZQVA 2WFAA 4FS1A 3TFRA 5KFUA 1KN5A 3ZDEA 3PSIA 2XIDA 1S0OA 1ZQUA 4DL5A 4JV2A 4OJLA 4ELTA 7ICPA 4ED8A 5CWRA 4JV1A 4HYKA 2KICA 4UB8U 2W9MA 4BGDA 2CN1A 5J0PA 3RJJA 4FZMA 3RJEA 4NLGA 5KT6A 1ZQBA 4ED7A 4DCCA 3PW5A 2OYYA 5AKHA 5IIIA 4YCXA 2WF9A 3KZIU 1Z1BA 4O3RA 1A77A 3IG8A 4NLNA 3UXOA 3MGIA 4LZGA 7ICQA 3RFAA 2KFZA 4KLTA 5KG4A 2HHQA 3SD7A 2EZYA 4QW9A 4Z6CA 3PV8A 4P4PA 3V7KA 2V4RA 3HP6A 1WCNA 2BQ3A 4DFDA 3MFIA 4EELA 5C5JA 2GWSA 5EE1A 1YZ6A 3GIKA 2ZIWB 2HOIA 1XS9D 2KEYA 4Q45A 7ICNA 4XUSA 4FZLA 8ICOA 5KFSA 2BQUA 4UB3A 3MGVA 2ZTDA 5TISU 2HOQA 1CI4A 1F0MA 4FO6A 4F4KA 4C8OA 5A0LA 2ZUBA 4G9BA 2R18A 1SWWA 8ICHA 5KFMA 3DV9A 1H38A 1SL1A 4RPYA 1S0NA 3ALRA 1LV5A 4LJXA 1T94A 1IM4A 4YMMA 1D9DA 5AKXA 4O5EA 5HR6A 1JMSA 4YQWA 3BQ0A 4TURA 4DO9A 4PL1A 2UVRA 3PO4A 2DL0A 5IIKA 1ZD3A 2IOFA 4QWBA 4RQMA 1Q8KA 3WK8A 1NZPA 2HSZA 2KJ5A 2BZFA 1IG6A 2WHEA 5AIBA 4BDPA 3EYZA 4M04A 2H3ZA 3BQ2A 3RJIA 1Q46A 4DQRA 2MSNA 3BZKA 5KFIA 5KG1A 1LB2B 4I2FA 2XGPA 8ICQA 3LYSA 3RJGA 4KMUA 3MFHA 3M7DA 2HHVA 2R8HA 4OO1J 4B6JA 3BS5B 1ZQEA 4JUZA 5L1JA 4F5RA 2FLPA 4QZIA 4KTQA 2KV2A 3H8WA 4PHEA 4US9A 1T3QA 7ICGA 4YR0A 2QB1A 4ZH4A 5KFQA 2WF8A 2HHUA 2KSOB 4I27A 5HR7A 4C4SA 5KTQA 4Q43A 2ZUDA 1ZQIA 3UQ2A 2JXJA 4DSFA 1P7DA 8ICAA 4DSKA 1N56A 1ZQAA 2E1FA 5KFFA 4I2EA 3F2BA 5JUMA 1X9WA 2W55A 4O0IA 1ZQYA 2MUTA 4KMOB 2FLLA 2ISOA 2BDUA 8ICIA 1VDVA 1LKYA 4OJPA 3BQ1A 2IOHA 3GIMA 4IS7A 2KOBA 3NRZA 4EBDA 1L7NA 2W43A 2DUYA 2ZUCA 3CYMA 4PZOA 4KLEA 4DLEA 5L1IA 1ZQTA 2Y9TA 4PL2A 3RJFA 9ICKA 2WTFA 4YP3A 4MFFA 3EWAA 4DL6A 4EYHB 4DF4A 4F71A 2IHMA 4TUPA 3IDWA 2AU0A 5ALRA 5DQHA 3WKBA 5AKLA 3ETRA 3H8JA 3PSTA 4M6WB 1XU4A 5KFVA 7ICKA 2WF5A 3HILA 1T3NA 4BWMA 5G5GA 2G06A 4RQ5A 5DLFA 4UAZA 1NJZA 1VJ5A 5KFGA 2JV3A 1ZQNA 1NI3A 4K4GA 5BOLA 4IL6U 3HJEA 3GDXA 8ICKA 4ED2A 9ICCA 4KITB 5HHHA 1NK9A 1FFUA 3NGDA 4B9UA 2HHSA 5EOZA 3C29A 1JUDA 1V97A 1V38A 3AU6A 2JZBB 3OGUA 4KLMA 2KZMA 2YTUA 1JXEA 2NO4A 2HVHA 4ED6A 2BQRA 5EWGA 1SGGA 4EX7A 1F44A 2VIXA 4F4WA 2Y1JA 4P2HA 3ETLA 3S6JA 3TI0A 5ALGA 3KD3A 4DQPA 1L8OA 1N5WA 2I1QA 5J8YC 2LYAA 1KW4A 4DFMA 1ZQSA 4EEYA 4C8LA 3R9KA 4IQUA 2I9GA 1ZQRA 1N2XA 4NM2A 2RHFA 1RQNA 4DSEA 4RUCA 2RDJA 5DBAA 1DK2A 4CF3A 4NV0A 3ISBA 3SI8A 4C8KA 5DB9A 3D6JA 3QZ7A 1QSSA 3M6KA 1XSNA 4J9PA 1LVHA 7ICRA 1TVAA 1COOA 2JMGA 2Y0SC 4F50A 4MF8A 4DL3A 3FC4A 4MFCA 2XI9A 3NVZA 1KSPA 4O3MA 5TZVA 1S10A 7ICTA 4KLDA 4UB6U 4LZDA 2FPKA 2PKEA 1L8LA 2R8IA 5ALUA 2YQEA 1OXJA 2PFQA 4PGXA 5KFLA 2W8KA 3T79A 8ICMA 1PK3A 2QARA 1KFTA 1URJA 4DS4A 3C21A 3KHHA 2QLTA 2GO7A 1D8BA 4GLXA 3M9OB 2HBKA 3C5FA 4ED0A 3AUOA 5AI5A 1ZJNA 2OWOA 7ICIA 5J0UA 4QZAA 2W11A 2DKXA 1X42A 3BDPA 5AM1A 8ICVA 4PGYA 4J9MA 3SAHA 2RRDA 3MDAA 4QZ8A 1PVPA 3A0HU 1PK1A 3Q8PB 4MEYA 3HPOA 1Z1VA 1MA7A 2NRWA 1J2NA 3QEAZ 1SKWA 4DSJA 2A1AA 2DPIA 4CGZA 2CPRA 4BWJA 4M9LA 1HIWA 9ICBA 5L1MA 5KFJA 3MBYA 5DQGA 5DDYA 4E0DA 4M9GA 5ALJA 5ALKA 4Y2QA 5AKGA 1COKA 1NKBA 1NKEA 2YX8A 3NS1A 5AM4A 4KLSA 1Z4NA 1X6JA 1OW5A 3SEIA 4JB3A 1NK4A 4KN4A 2XCAA 2ZJAA 4CDGA 4F2RA 3QNMA 2W9BB 1X9MA 1WG8A 4RQ1A 5IIMA 2KIWA 1ZJMA 2B6GA 1MQ3A 9ICFA 3TAPA 2ZIVA 2G09A 5D4BA 8ICLA 4J9LA 4KLHA 2LM1A 1Z3EB 3ORYA 4Y2RA 4M2YA 3QU7A 5DBBA 1NOMA 2HBMA 3RR8A 5ALNA 4BJQA 8ICNA 4RQ2A 3Q8RB 2KE7A 3RRGA 3RR7A 2LI6A 2WF7A 5KFHA 4PGQA 3ZD8A 1T7PA 1L6NA 4GC7A 1RM6C 3PX6A 9ICXA 4U6PA 2G07A 2HHWA 1RDFA 5CRXA 1BPZA 2NRXA 2HCFA 1SV0A 9ICHA 1ZQMA 5J0YA 1L7OA 1CEZA 3TARA 5JTIA 1RYSA 1AQ6A 7ICJA 4DFPA 3V6JA 5CP2A 2XICA 3PW0A 2ZG6A 3MR6A 4DLGA 1QH9A 2JR5A 2EAOA 5J2JA 2LKYA 2ZTCA 5AKEA 5DLGA 3EPIA 4IQTA 2KHQA 4O3SA 2ES6A 4KLIA 4UB5A 3OHBA 5EE0A 5CHGA 4WJ3B 2FLNA 3E0FA 4YD1A 4DQQA 8ICGA 2WB1F 2AQ4A 3V7JA 5HNKA 9ICMA 1ZQ1C 5KFRA 5KL1B 4HAIA 5KG2A 1MQ2A 2NRTA 3C2KA 3PW2A 1ZQOA 2F76X 3V7LA 2PI5A 2D3DA 1ED1A 3KKAC 4PHAA 4DS5A 4QIWC 3M9MB 3T5HA 2NRZA 2KVCA 2OH2A 2A1JB 1S0MA 3BZCA 3C28A 1DGJA 2H5XA 3PO5A 3KZXA 3H4DA 2YMMA 1KLNA 4NLBA 4NL9C 4XQ8A 8ICEA 4K4IA 2QB0B 2W54A 2Y9UA 4C8NA 1UT8A 1JI7A 2YMQA 2ASLA 5KAFU 5KFNA 5DGAA 2BCQA 3AMZA 2YY6A 4DEZA 5KG0A 1WCLA 2P35A 3GV7B 4KX3A 4R8UB 3T5LA 2K4EA 2F1JA 3G6YA 3T5KA 3PMNA 5AI8A 1BPDA 2DQNB 2M9NA 4PPXA 2FI1A 2G0AA 1ZQXA 4F5OA 2FPMA 2MAXA 2EANA 3MR5A 2YMLA 4UAVA 4RPZA 2IHNA 3OJSA 4MHVA 4MFAA 2XY5A 2HVIA 2BCRA 3PY8A 3ZDAA 4JWNA 3QUTA 5J2EA 5CR0A 5K4LA 5AM5A 3L4PA 1SWVA 4Z6FA 4J9QA 9ICNA 5J2KA 1K5OA 2W7PA 4GXJA 1MC8A 1SIJA 2H3IA 5T14A 2IBKA 3HRDD 9ICEA 3RTVA 2ZIWA 5DBCA 4YVZA 5KT7A 1Q3UA 5ALQA 4O3PA 1S0VA 1NK7A 2JEFA 3SYZA 4R65A 3FM9A 3MR2A 4QNLA 3LWLA 1XC9A 3QU4A 2I6XA 3AU2A 5EE9A 2EZZA 4XRHA 2BR0A 4CF4A 2BPCA 3PR4A 4Q8EA 3EZ5A 5DGBA 3QX7A 5J2GA 1BVSA 1QCKA 3QUCA 1J2MA 2WB1C 1F5SA 4AYBF 4O5KA 5DQIA 2W3RA 5ALOA 4K4HA 3BQ7A 3U26A 4DOAA 4C4RA 4B9LA 5KFPA 3Q8QB 4YR2A 1M6YA 4BXOB 3AQEA 1T4GA 1X40A 2DPJA 3C23A 4UATA 2RP5A 2K89A 3GQCA 1QLNA 5KFDA 4QZGA 5ALYA 3TADA 2W9CB 2KZ3A 1ZD4A 2Q4TA 1U49A 1JRPA 3TKAA 2EQYA 2PFPA 5AKYA 1JXLA 4AP9A 2BDPA 1HJPA 1Q3VA 1ZQCA 2BCSA 3OSNA 4ICAA 2KNJA 4NLCA 3N7SC 5DG8A 7ICMA 3QU5A 4RNOA 2CRXA 5KT5A 3KOOA 2GH1A 3OPXA 2E8NA 4B9VA 1L3VA 2IA6A 5AKZA 4RQ4A 3F53A 4YG2A 5J2BA 4J9NA 5KG5A 1ZETA 4UAWA 1KRPA 9ICPA 4F2SA 2ZTEA 4EENA 2OM6A 2J6UA 3AN1A 1BNPA 3WU2U 4YR3A 3BS5A 2A19A 2LHTA 4RQ7A 2IMWP 2KKVA 4YMNA 3IRUA 2ODGA 1L3UA 3RAXA 2KHVA 1NKCA 5KFWA 4RUAA 1N48A 9ICTA 2WAQF 2KVSA 4IQWA 3DEEA 3PMLA 8ICZA 2KSOA 3GIJA 2W04A 3QE9Y 2F8LA 3UMBA 2VA8A 1O03A 2HI0A 4RQ8A 5ALXA 1HUOA 2UVWA 1ZQJA 2VJ4A 3SV3A 5DB8A 4JK1A 4TQRA 8ICCA 1ZOLA 1SV4A 3OHAA 4I29A 5KFXA 2BPFA 2F2AB 4Y2TA 3UMGA 2EH9A 4NM1A 1WYGA 1S97A 5GTHU 4F72A 2XY6A 4YFKA 3N4MB 1ZQLA 3TFSA 2ZIUB 3JPRA 5KT2A 2DWQA 2ZIXB 4F3OA 5KFZA 4PHPA 2C2RA 2J6SA 2PFNA 1SXEA 4O3NA 1ZQFA 2PMZF 5AM0A 4ECQA 1UA0A 2KP7A 4QZCA 3AL0B 1KTQA 4DOBA 5J0XA 5AHXA 4G3IA 4M6WA 5KFOA 3HX0A 3KHRA 3RB0A 1U4BA 4F4XA 1RZTA 3ZD9A 3AEVA 2JGAA 2HHTA 1RYUA 5EWFA 5D49A 3D2QA 2PXIA 2XY7A 1ZD5A 2R8JA 3QUBA 4P0QB 4DFJA 4P4OA 1K1QA 5L9XA 1T8EA 1TKDA 4J9RA 3NASA 5KFBA 2ESEA 3GV8B 2DGZA 5ALZA 5BOMA 2EAMA 3IG5A 1ZQPA 5F9NA 8ICTA 8ICYA 3B9JA 3B0YA 4Y2XA 2PI4A 4ED3A 9ICIA 4KLOA 3RB6A 2JZBA 1S9FA 2QARB 2JHDA 4NXZA 1ZQHA 3H8SA 4MF2A 2OXOA 2C2EA 1IXRA 3K1RB 4YD2A 4R63A 4EEKA 4O3QA 5J2IA 2E3TA 4Q44A 3MGHA 4J9SA 1BGXT 4B9SA 3PZPA 1PVQA 5KFCA 4DL4A 1KEJA 1L3TA 2P66A 5KG3A 1L3SA 9ICGA 1S5LU 2W7OA 1QQ6A 7ICSA 4FBTA 3H0RB 3VC8A 1QTMA 2FPLA 2W3SA 3JPTA 1NK8A 4I2JA 3QXGA 4Z6EA 1QQ7A 4BUGA 1TE2A 1ZQQA 1Y88A 2Q0ZX 1TK5A 2WAQC 3JPOA 2K60A 1FO4A 5DKWA 2HHXA 1FEZA 4I2CA 4F5NA 1SZHA 4OJ6A 8ICJA 1X66A 4DSLA 2E8PA 3EPGA 1B4FA 2JH7A 4ECUA 5KNIA 4UAUA 7ICOA 5HHIA 3SAFA 1ZXIA 2VJ5A 4CF5A 2KFNA 2R8GA 1KBUA 3FYHA 3M8SA 3D2SA 3BQTA 2G08A 3IV6A 2OEHA 4UBCA 4NJ8A 3DDHA 3H7IA 5F3XB 9ICAA 2PMZC 3K4GA 1UHUA 2K4IA 1KKXA 4CCHA 5ALEA 4B9TA 1DRGA 5B5EU 3QEBZ 4C4TA 4Y2YA 4X5VA 1YZ7A 3V72A 3H0LB 1U47A 2NYVA 4C8MA 4IRKA 2AQ0A 2JEJA 5CJ7A 2PFOA 4RT3A 5J0SA 1NJWA 2B0CA 2LMRA 4KN7A 2ATLA 1JIHA 4UB1A 1SL2A 5ALLA 2P6RA 1Z00B 2E5SA 3LVWA 1NJXA 1DK3A 4CNQA 5FP0A 2VA3A 3N7PD 2EZXA 1S76D 3N7RC 1V85A 3JPNA 2ZXIA 1A6SA 5KT4A 3FAHA 3F5AA 3M1YA 4UW9A 1DOQA 4PH5A 1KQQA 4C0ZA 4GIBA 4I2HA 2J6TA 3AM9A 3PX4A 3SMVA 4KLGA 2QKQA 4PZNA 2R8KA 1CUKA 2JRZA 2OCEA 4KLFA 4Q8FA 1MN8A 2AH5A 4P0PB 4ECSA 5J8YA 3NRWA 4QZBA 3MDCA 2G5HB 4YN4A 2AJQA 4M9HA 2AHOB 4DQIA 7ICLA 3PR5B 2RQ5A 3PX0A 3L5KA 1QSYA 3QZ8A 3RB4A 3K1ZA 2W9BA 1CRXA 3SV4A 2H3FA 1JROA 4M47A 3RJHA 3T5JA 5D46A 2C22A 9ICJA 1YT3A 1D8YA 1RXVA 1D8LA 2Z7JA 3WK4A 4ACOA 3JPPA 4NY8A 2DBYA 3BS7A 5G5HA 1JALA 1XSPA 1X2IA 1NNLA 5AM3A 2B21A 1C7YA 2HBLA 4ZOHC 4KX5A 3MC1A 4RT2A 5AM2A 3MABA 3GILA 1UQVA 2XO7A 2NRVA 2YMPA 2YB4A 4J9KA 2GOLA 5AKKA 2GLEA 5AK5A 1WWVA 3RB3A 2LBOA 1Z4OA 1AROP 1QSLA 5KG6A 3H0MB 4QZDA 4EBCA 2HBJA 3IN5A 1RXWA 2BPGA 4DFKA 1TK0A 7ICUA 3UMCA 2UVUA 1JN3A 8ICXA 3I28A 4YXMA 1DGSA 5J0OA 4CRXA 2KJ9A 2KKPA 1HEKA 1HUZA 1JX4A 2HDOA 3PW7A 5AI4A 4RQ6A 5CB1A 2KJ8A 4PHDA 4QZFA 3FDSA 3ONNA 4DWIA 5J2AA 1XSLA 3C1YA 3PSFA 1TAMA 3SR6A 3KHLA 3NTUA 4UB4A 4OD0A 1K1SA 5HP4A 1SKRA 1XWLA 3WKAA 3G6VA 3UXPA 2DKZA 4ECRA 4JWMA 4J03A 5KFKA 4F4YA 3I1YA 5BPCA 3GU3A 4TUQA 4U7CA 7ICEA 3OJUA 4I28A 5AKJA 2BCVA 4BX9C 4GC6A 2A1JA 3WK7A 4F93B 1ZD2P 3EW9A 3RBDA 1IV8A 3ZDDA 3WK9A 5CA7A 1B43A 4P4MA 4OCZA 1BNOA 4JMUA 2QB0A 3LDAA 3WKCA 3F2CA 2C2DA 5AKIA 3ZI4A 3SZ2A 4GFJA 3SENA 1ZQZA 2FE9A 3WK6A 4DF8A 2VKQA 1FIQA 3N97B 2MA1A 4UASA 4R8UA 3VCBA 3H4BA 5AI6A 4J9OA 2JH1A 3PVXA 3NVYA 5ALVA 2HW3A 3OTQA 9ICQA 3AQFA 5ALIA 3RH6A 3G6XA 1ZRMA 4IC9A 3UXNA 2K4HA 4C7ZA 3PW4A 3HWTA 3M6ZA 3HW8A 2P6UA 3HKZF 4Y2UA 3JPQA 8ICWA 4QW8A 5ALTA 3TANA 2N1RA 4A8EA 3M9NB 5J2DA 1C20A 2KK0A 1NK6A 5KFAA 3TAQA 2ZXHA 5CEHA 4EBEA 3T3FA 2E8OA 1ZQWA 9ICUA 2MUTB 4DL7A 4RNMA 1N5XA 2WF6A 1SB3C 1LKYB 1U48A 3ED5A 3KTQA 4RZRA 4KLQA 2JEIA 2F1HA 1PUZA 2KMDA 3I76A 3E2EA 5AK4A 2DFLA 1DXSA 3LVVA 2ALZA 2VANA 4I2AA 4F92B 2BGWA 2XGQA 4US8A 9ICSA 1TAUA 3KBBA 3KFUF 1TFRA 1J97A 4CE6A 4XA5A 8ICPA 3V6HA 3CNHA 3LK9A 5AK3A 3C2MA 1SKSA 3KKAA 2FMSA 4GXKA 2K8AA 5AIAA 2EAPA 4ECVA 5DB6A 3GIIA 2RDIA 4BXOA 3RF9A 5J29A 2Y0SF 4I2BA 5KL8B 3N28A 3J81j 4NL9A 3UM9A 2W9CA 2F3NA 4F5PA 4LVSA 4NLZA 3QU9A 2E8MA 5J0QA 2KIVA 5DDMA 5L1KA 2Y1IA 1PZNA 4PJ0U 2K8BB 4QWEA 2AGPA 1TAQA 5ALFA 5ALMA 9ICLA 1V9PA 2F44A 4QZEA 2XVTA 7ICVA 3HT3A 4I2DA 4QWAA 2UVVA 1PVRA 1RYRA 2F8KA 2V9WA 4ECXA 3NUQA 4DOCA 4O9MA 5DG7A 1KDHA 2AXTU 3C5GA 4ELUA 5IIJA 3Q8SB 3L3FX 2O6KA 2BCUA 4O5CA 4ELVA 2XC9A 2HOFA 4KLLA 2D6FC 2MU2A 2FJ6A 4ECZA 5KFTA 3CW2C 3C2LA 1NZBA 2I5HA 3H40A 3SQIA 2XCPA 1L5UA 1L7PA 1KL9A 3HKZC 3RRHA 4ECWA 2KZZA 3QYPA 3F2DA 1IIPA 3ISDA 3D2NA 5B66U 4IQVA 4TUSA 5AICA 4AYBC 2W9AA 2HMXA 5L1LA 4EZ6A 5EE3A 3LWMA 4M9JA 1UA1A 2L5YA 3SAGA 3H8MA 8ICRA 2G5IB 1BPEA 4C80A 1XO0A 4GXIA 3GZFA 1X6IA 5GTIU 3QU2A 2KTQA 1KFDA 5AI0A 2FMQA 4QZ9A 2F77X 1TV9A 1ZQGA 5J0WA 5JRTA 1BPXA 3M8RA 1ZQKA 3JPSA 4O3OA 4RNNA 2ZIUA 2ZIXA 3NVVA 4FE3A 1XO1A 1WWUA 2RLTA 4ED1A 4TQSA 5IILA 5KFYA 3O0FA
chains in the Genus database with same CATH topology
2E8MA 1V85A 1SGGA 2KIVA 2DKXA 1X40A 3TADC 1SV0C 2KG5A 4RQNA 3TADA 2QKQA 4PZNA 1SV0A 2F44A 1RG6A 5J8YC 1PK1A 1KW4A 1Z1VA 1SXEA 2EANA 5JTIA 1LKYA 3TACB 2F8KA 2K60A 4IS7A 5J8YA 4MHVA 2E8OA 2EAOA 4PZOA 2DL0A 1X66A 2DKZA 2E8PA 2E8NA 2LPEA 1PK1B 1B4FA 2Y9TA 4RQMA 5L1MA 2ES6A 1LKYB 5KNIA 1COKA 1X9XA 1SXDA 5JU5A 3IDWA 2KMDA 1OW5A 3SEIA 4NJ8A 3BS5A 1DXSA 2ESEA 3HILA 5F3XB 2EAMA 1UCVA 2D3DA 3BS7A 2QB0A 2B6GA 2L5YA 3KKAC 3H8MA 2JV3A 3SENA 2FE9A 1OXJA 3BS5B 3KKAA 1UQVA 2QARB 2K4PA 2EAPA 2KSOA 3K1RB 2D8CA 1PK3A 2GLEA 4NL9C 1WWVA 2QARA 1B0XA 5JRTA 2QB0B 2Y9UA 2LMRA 1JI7A 4NL9A 2KE7A 1V38A 2F3NA 1F0MA 2QB1A 2YTUA 1SV4A 1WWUA 3BQ7A 2KSOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E8M A;  1V85 A;  1SGG A;  2KIV A;  2DKX A;  1X40 A;  3TAD C;  1SV0 C;  2KG5 A;  4RQN A;  3TAD A;  2QKQ A;  4PZN A;  1SV0 A;  2F44 A;  1RG6 A;  5J8Y C;  1PK1 A;  1KW4 A;  1Z1V A;  1SXE A;  2EAN A;  5JTI A;  1LKY A;  3TAC B;  2F8K A;  2K60 A;  4IS7 A;  5J8Y A;  4MHV A;  2E8O A;  2EAO A;  4PZO A;  2DL0 A;  1X66 A;  2DKZ A;  2E8P A;  2E8N A;  2LPE A;  1PK1 B;  1B4F A;  2Y9T A;  4RQM A;  5L1M A;  2ES6 A;  1LKY B;  5KNI A;  1COK A;  1X9X A;  1SXD A;  5JU5 A;  3IDW A;  2KMD A;  1OW5 A;  3SEI A;  4NJ8 A;  3BS5 A;  1DXS A;  2ESE A;  3HIL A;  5F3X B;  2EAM A;  1UCV A;  2D3D A;  3BS7 A;  2QB0 A;  2B6G A;  2L5Y A;  3KKA C;  3H8M A;  2JV3 A;  3SEN A;  2FE9 A;  1OXJ A;  3BS5 B;  3KKA A;  1UQV A;  2QAR B;  2K4P A;  2EAP A;  2KSO A;  3K1R B;  2D8C A;  1PK3 A;  2GLE A;  4NL9 C;  1WWV A;  2QAR A;  1B0X A;  5JRT A;  2QB0 B;  2Y9U A;  2LMR A;  1JI7 A;  4NL9 A;  2KE7 A;  1V38 A;  2F3N A;  1F0M A;  2QB1 A;  2YTU A;  1SV4 A;  1WWU A;  3BQ7 A;  2KSO B; 
#chains in the Genus database with same CATH topology
 4R64 A;  3V6K A;  2YN4 A;  4USA A;  9ICR A;  4B9M A;  1SV0 C;  2JEG A;  2BHN A;  2KG5 A;  3RH4 A;  4IRC A;  2W8L A;  5ALD A;  5J0R A;  1ECW A;  1N62 A;  3B0X A;  2LYB A;  3A0B U;  3QUQ A;  1ZQD A;  2FDR A;  1UPH A;  5AK6 A;  3C1Z A;  2LYH A;  3TAC B;  8ICS A;  3WKD A;  4DL2 A;  1KFS A;  3IP4 B;  4F5Q A;  4YXJ A;  4DSI A;  2K8C B;  9ICO A;  4P0Q A;  2NO5 A;  1ZYQ A;  5ALW A;  2ASD A;  3PNC A;  2LPE A;  2MRL A;  1PK1 B;  1OUQ A;  4EYI B;  4UAY A;  4RQ3 A;  3WK5 A;  2ZJ8 A;  1X9X A;  4FS2 A;  1SXD A;  1WUD A;  4NLK A;  1SZP A;  5KAI U;  4Y2P A;  4MEX A;  1QQ5 A;  3K75 D;  4OJ5 A;  1N61 A;  1X9S A;  5KT3 A;  4F91 B;  1FFV A;  3IM1 A;  3MR3 A;  3KHG A;  4M0A A;  7ICH A;  4R66 A;  4Z6D A;  4FZN A;  3ZDB A;  8ICB A;  5J2F A;  3EUB 2;  3Q8M A;  1N60 A;  3ISC A;  5DG9 A;  3THV A;  5F9L A;  3Q8L A;  5H2F U;  1NK5 A;  4IRD A;  1NJY A;  1S77 D;  4IR9 A;  2D8C A;  1VLB A;  5EWE A;  4QWD A;  4Y2S A;  1B0X A;  4RQ0 A;  4UB2 A;  2YB1 A;  2ZIV B;  2FMP A;  4UBB A;  4ECY A;  4RPX A;  1BPB A;  2ZJ5 A;  3UPQ A;  4QIW F;  3GV5 B;  2M0N A;  2E1E A;  4DQS A;  4M9N A;  1N63 A;  1L7M A;  4UAR A;  4F8R A;  7ICF A;  4RQN A;  5ALH A;  1RG6 A;  3PSP A;  1BPY A;  4Y2J A;  2IOF K;  8ICF A;  1NK0 A;  3ZDC A;  3E58 A;  3UQ0 A;  3F5E A;  1GO3 F;  4FFD A;  5E79 U;  4FBU A;  5HML A;  4I2G A;  2BKE A;  1S8O A;  1TK8 A;  3ICX A;  4C7Y A;  2AGQ A;  3WKE A;  4B9N A;  5C0Y A;  1A76 A;  2ISP A;  2KD1 A;  4KLJ A;  5J2H A;  1SL0 A;  2H3Q A;  3CRX A;  9ICW A;  3CP8 A;  5JU5 A;  2LM4 A;  1D9F A;  1U9L A;  3TQ1 A;  4YMO A;  3RH5 A;  5ALP A;  4JV0 A;  2ASJ A;  2OHF A;  8ICU A;  1O08 A;  1B22 A;  4QJF B;  1UT5 A;  5KG7 A;  5DB7 A;  3IHQ B;  3Q8K A;  1UCV A;  3GFK B;  5J2C A;  2CXY A;  1XNS A;  3RBE A;  1U45 A;  5AI9 A;  1Z00 A;  4UQG A;  4F4Z A;  2AGO A;  5IIN A;  4QWC A;  2A3V A;  2K4P A;  4IR1 A;  4QZH A;  1Z19 A;  3RAQ A;  4I2I A;  5J0T A;  4OJO A;  1A0P A;  5ALS A;  2W03 A;  4EZ9 A;  2EDU A;  2H3V A;  2VA2 A;  1EXN A;  2C28 A;  2V4Q A;  4RU9 A;  1RQL A;  5KFE A;  4Y2V A;  1RPL A;  3OSP A;  4KLU A;  2KN7 A;  3BJY A;  3NVW A;  4NWI A;  3TAD C;  1MSW D;  2DF4 B;  5HMM A;  4P0P A;  2F1I A;  2NV3 A;  5IIO A;  4EX6 A;  3RJK A;  9ICV A;  1ZRN A;  4ECT A;  1ZQV A;  2WFA A;  4FS1 A;  3TFR A;  5KFU A;  1KN5 A;  3ZDE A;  3PSI A;  2XID A;  1S0O A;  1ZQU A;  4DL5 A;  4JV2 A;  4OJL A;  4ELT A;  7ICP A;  4ED8 A;  5CWR A;  4JV1 A;  4HYK A;  2KIC A;  4UB8 U;  2W9M A;  4BGD A;  2CN1 A;  5J0P A;  3RJJ A;  4FZM A;  3RJE A;  4NLG A;  5KT6 A;  1ZQB A;  4ED7 A;  4DCC A;  3PW5 A;  2OYY A;  5AKH A;  5III A;  4YCX A;  2WF9 A;  3KZI U;  1Z1B A;  4O3R A;  1A77 A;  3IG8 A;  4NLN A;  3UXO A;  3MGI A;  4LZG A;  7ICQ A;  3RFA A;  2KFZ A;  4KLT A;  5KG4 A;  2HHQ A;  3SD7 A;  2EZY A;  4QW9 A;  4Z6C A;  3PV8 A;  4P4P A;  3V7K A;  2V4R A;  3HP6 A;  1WCN A;  2BQ3 A;  4DFD A;  3MFI A;  4EEL A;  5C5J A;  2GWS A;  5EE1 A;  1YZ6 A;  3GIK A;  2ZIW B;  2HOI A;  1XS9 D;  2KEY A;  4Q45 A;  7ICN A;  4XUS A;  4FZL A;  8ICO A;  5KFS A;  2BQU A;  4UB3 A;  3MGV A;  2ZTD A;  5TIS U;  2HOQ A;  1CI4 A;  1F0M A;  4FO6 A;  4F4K A;  4C8O A;  5A0L A;  2ZUB A;  4G9B A;  2R18 A;  1SWW A;  8ICH A;  5KFM A;  3DV9 A;  1H38 A;  1SL1 A;  4RPY A;  1S0N A;  3ALR A;  1LV5 A;  4LJX A;  1T94 A;  1IM4 A;  4YMM A;  1D9D A;  5AKX A;  4O5E A;  5HR6 A;  1JMS A;  4YQW A;  3BQ0 A;  4TUR A;  4DO9 A;  4PL1 A;  2UVR A;  3PO4 A;  2DL0 A;  5IIK A;  1ZD3 A;  2IOF A;  4QWB A;  4RQM A;  1Q8K A;  3WK8 A;  1NZP A;  2HSZ A;  2KJ5 A;  2BZF A;  1IG6 A;  2WHE A;  5AIB A;  4BDP A;  3EYZ A;  4M04 A;  2H3Z A;  3BQ2 A;  3RJI A;  1Q46 A;  4DQR A;  2MSN A;  3BZK A;  5KFI A;  5KG1 A;  1LB2 B;  4I2F A;  2XGP A;  8ICQ A;  3LYS A;  3RJG A;  4KMU A;  3MFH A;  3M7D A;  2HHV A;  2R8H A;  4OO1 J;  4B6J A;  3BS5 B;  1ZQE A;  4JUZ A;  5L1J A;  4F5R A;  2FLP A;  4QZI A;  4KTQ A;  2KV2 A;  3H8W A;  4PHE A;  4US9 A;  1T3Q A;  7ICG A;  4YR0 A;  2QB1 A;  4ZH4 A;  5KFQ A;  2WF8 A;  2HHU A;  2KSO B;  4I27 A;  5HR7 A;  4C4S A;  5KTQ A;  4Q43 A;  2ZUD A;  1ZQI A;  3UQ2 A;  2JXJ A;  4DSF A;  1P7D A;  8ICA A;  4DSK A;  1N56 A;  1ZQA A;  2E1F A;  5KFF A;  4I2E A;  3F2B A;  5JUM A;  1X9W A;  2W55 A;  4O0I A;  1ZQY A;  2MUT A;  4KMO B;  2FLL A;  2ISO A;  2BDU A;  8ICI A;  1VDV A;  1LKY A;  4OJP A;  3BQ1 A;  2IOH A;  3GIM A;  4IS7 A;  2KOB A;  3NRZ A;  4EBD A;  1L7N A;  2W43 A;  2DUY A;  2ZUC A;  3CYM A;  4PZO A;  4KLE A;  4DLE A;  5L1I A;  1ZQT A;  2Y9T A;  4PL2 A;  3RJF A;  9ICK A;  2WTF A;  4YP3 A;  4MFF A;  3EWA A;  4DL6 A;  4EYH B;  4DF4 A;  4F71 A;  2IHM A;  4TUP A;  3IDW A;  2AU0 A;  5ALR A;  5DQH A;  3WKB A;  5AKL A;  3ETR A;  3H8J A;  3PST A;  4M6W B;  1XU4 A;  5KFV A;  7ICK A;  2WF5 A;  3HIL A;  1T3N A;  4BWM A;  5G5G A;  2G06 A;  4RQ5 A;  5DLF A;  4UAZ A;  1NJZ A;  1VJ5 A;  5KFG A;  2JV3 A;  1ZQN A;  1NI3 A;  4K4G A;  5BOL A;  4IL6 U;  3HJE A;  3GDX A;  8ICK A;  4ED2 A;  9ICC A;  4KIT B;  5HHH A;  1NK9 A;  1FFU A;  3NGD A;  4B9U A;  2HHS A;  5EOZ A;  3C29 A;  1JUD A;  1V97 A;  1V38 A;  3AU6 A;  2JZB B;  3OGU A;  4KLM A;  2KZM A;  2YTU A;  1JXE A;  2NO4 A;  2HVH A;  4ED6 A;  2BQR A;  5EWG A;  1SGG A;  4EX7 A;  1F44 A;  2VIX A;  4F4W A;  2Y1J A;  4P2H A;  3ETL A;  3S6J A;  3TI0 A;  5ALG A;  3KD3 A;  4DQP A;  1L8O A;  1N5W A;  2I1Q A;  5J8Y C;  2LYA A;  1KW4 A;  4DFM A;  1ZQS A;  4EEY A;  4C8L A;  3R9K A;  4IQU A;  2I9G A;  1ZQR A;  1N2X A;  4NM2 A;  2RHF A;  1RQN A;  4DSE A;  4RUC A;  2RDJ A;  5DBA A;  1DK2 A;  4CF3 A;  4NV0 A;  3ISB A;  3SI8 A;  4C8K A;  5DB9 A;  3D6J A;  3QZ7 A;  1QSS A;  3M6K A;  1XSN A;  4J9P A;  1LVH A;  7ICR A;  1TVA A;  1COO A;  2JMG A;  2Y0S C;  4F50 A;  4MF8 A;  4DL3 A;  3FC4 A;  4MFC A;  2XI9 A;  3NVZ A;  1KSP A;  4O3M A;  5TZV A;  1S10 A;  7ICT A;  4KLD A;  4UB6 U;  4LZD A;  2FPK A;  2PKE A;  1L8L A;  2R8I A;  5ALU A;  2YQE A;  1OXJ A;  2PFQ A;  4PGX A;  5KFL A;  2W8K A;  3T79 A;  8ICM A;  1PK3 A;  2QAR A;  1KFT A;  1URJ A;  4DS4 A;  3C21 A;  3KHH A;  2QLT A;  2GO7 A;  1D8B A;  4GLX A;  3M9O B;  2HBK A;  3C5F A;  4ED0 A;  3AUO A;  5AI5 A;  1ZJN A;  2OWO A;  7ICI A;  5J0U A;  4QZA A;  2W11 A;  2DKX A;  1X42 A;  3BDP A;  5AM1 A;  8ICV A;  4PGY A;  4J9M A;  3SAH A;  2RRD A;  3MDA A;  4QZ8 A;  1PVP A;  3A0H U;  1PK1 A;  3Q8P B;  4MEY A;  3HPO A;  1Z1V A;  1MA7 A;  2NRW A;  1J2N A;  3QEA Z;  1SKW A;  4DSJ A;  2A1A A;  2DPI A;  4CGZ A;  2CPR A;  4BWJ A;  4M9L A;  1HIW A;  9ICB A;  5L1M A;  5KFJ A;  3MBY A;  5DQG A;  5DDY A;  4E0D A;  4M9G A;  5ALJ A;  5ALK A;  4Y2Q A;  5AKG A;  1COK A;  1NKB A;  1NKE A;  2YX8 A;  3NS1 A;  5AM4 A;  4KLS A;  1Z4N A;  1X6J A;  1OW5 A;  3SEI A;  4JB3 A;  1NK4 A;  4KN4 A;  2XCA A;  2ZJA A;  4CDG A;  4F2R A;  3QNM A;  2W9B B;  1X9M A;  1WG8 A;  4RQ1 A;  5IIM A;  2KIW A;  1ZJM A;  2B6G A;  1MQ3 A;  9ICF A;  3TAP A;  2ZIV A;  2G09 A;  5D4B A;  8ICL A;  4J9L A;  4KLH A;  2LM1 A;  1Z3E B;  3ORY A;  4Y2R A;  4M2Y A;  3QU7 A;  5DBB A;  1NOM A;  2HBM A;  3RR8 A;  5ALN A;  4BJQ A;  8ICN A;  4RQ2 A;  3Q8R B;  2KE7 A;  3RRG A;  3RR7 A;  2LI6 A;  2WF7 A;  5KFH A;  4PGQ A;  3ZD8 A;  1T7P A;  1L6N A;  4GC7 A;  1RM6 C;  3PX6 A;  9ICX A;  4U6P A;  2G07 A;  2HHW A;  1RDF A;  5CRX A;  1BPZ A;  2NRX A;  2HCF A;  1SV0 A;  9ICH A;  1ZQM A;  5J0Y A;  1L7O A;  1CEZ A;  3TAR A;  5JTI A;  1RYS A;  1AQ6 A;  7ICJ A;  4DFP A;  3V6J A;  5CP2 A;  2XIC A;  3PW0 A;  2ZG6 A;  3MR6 A;  4DLG A;  1QH9 A;  2JR5 A;  2EAO A;  5J2J A;  2LKY A;  2ZTC A;  5AKE A;  5DLG A;  3EPI A;  4IQT A;  2KHQ A;  4O3S A;  2ES6 A;  4KLI A;  4UB5 A;  3OHB A;  5EE0 A;  5CHG A;  4WJ3 B;  2FLN A;  3E0F A;  4YD1 A;  4DQQ A;  8ICG A;  2WB1 F;  2AQ4 A;  3V7J A;  5HNK A;  9ICM A;  1ZQ1 C;  5KFR A;  5KL1 B;  4HAI A;  5KG2 A;  1MQ2 A;  2NRT A;  3C2K A;  3PW2 A;  1ZQO A;  2F76 X;  3V7L A;  2PI5 A;  2D3D A;  1ED1 A;  3KKA C;  4PHA A;  4DS5 A;  4QIW C;  3M9M B;  3T5H A;  2NRZ A;  2KVC A;  2OH2 A;  2A1J B;  1S0M A;  3BZC A;  3C28 A;  1DGJ A;  2H5X A;  3PO5 A;  3KZX A;  3H4D A;  2YMM A;  1KLN A;  4NLB A;  4NL9 C;  4XQ8 A;  8ICE A;  4K4I A;  2QB0 B;  2W54 A;  2Y9U A;  4C8N A;  1UT8 A;  1JI7 A;  2YMQ A;  2ASL A;  5KAF U;  5KFN A;  5DGA A;  2BCQ A;  3AMZ A;  2YY6 A;  4DEZ A;  5KG0 A;  1WCL A;  2P35 A;  3GV7 B;  4KX3 A;  4R8U B;  3T5L A;  2K4E A;  2F1J A;  3G6Y A;  3T5K A;  3PMN A;  5AI8 A;  1BPD A;  2DQN B;  2M9N A;  4PPX A;  2FI1 A;  2G0A A;  1ZQX A;  4F5O A;  2FPM A;  2MAX A;  2EAN A;  3MR5 A;  2YML A;  4UAV A;  4RPZ A;  2IHN A;  3OJS A;  4MHV A;  4MFA A;  2XY5 A;  2HVI A;  2BCR A;  3PY8 A;  3ZDA A;  4JWN A;  3QUT A;  5J2E A;  5CR0 A;  5K4L A;  5AM5 A;  3L4P A;  1SWV A;  4Z6F A;  4J9Q A;  9ICN A;  5J2K A;  1K5O A;  2W7P A;  4GXJ A;  1MC8 A;  1SIJ A;  2H3I A;  5T14 A;  2IBK A;  3HRD D;  9ICE A;  3RTV A;  2ZIW A;  5DBC A;  4YVZ A;  5KT7 A;  1Q3U A;  5ALQ A;  4O3P A;  1S0V A;  1NK7 A;  2JEF A;  3SYZ A;  4R65 A;  3FM9 A;  3MR2 A;  4QNL A;  3LWL A;  1XC9 A;  3QU4 A;  2I6X A;  3AU2 A;  5EE9 A;  2EZZ A;  4XRH A;  2BR0 A;  4CF4 A;  2BPC A;  3PR4 A;  4Q8E A;  3EZ5 A;  5DGB A;  3QX7 A;  5J2G A;  1BVS A;  1QCK A;  3QUC A;  1J2M A;  2WB1 C;  1F5S A;  4AYB F;  4O5K A;  5DQI A;  2W3R A;  5ALO A;  4K4H A;  3BQ7 A;  3U26 A;  4DOA A;  4C4R A;  4B9L A;  5KFP A;  3Q8Q B;  4YR2 A;  1M6Y A;  4BXO B;  3AQE A;  1T4G A;  1X40 A;  2DPJ A;  3C23 A;  4UAT A;  2RP5 A;  2K89 A;  3GQC A;  1QLN A;  5KFD A;  4QZG A;  5ALY A;  3TAD A;  2W9C B;  2KZ3 A;  1ZD4 A;  2Q4T A;  1U49 A;  1JRP A;  3TKA A;  2EQY A;  2PFP A;  5AKY A;  1JXL A;  4AP9 A;  2BDP A;  1HJP A;  1Q3V A;  1ZQC A;  2BCS A;  3OSN A;  4ICA A;  2KNJ A;  4NLC A;  3N7S C;  5DG8 A;  7ICM A;  3QU5 A;  4RNO A;  2CRX A;  5KT5 A;  3KOO A;  2GH1 A;  3OPX A;  2E8N A;  4B9V A;  1L3V A;  2IA6 A;  5AKZ A;  4RQ4 A;  3F53 A;  4YG2 A;  5J2B A;  4J9N A;  5KG5 A;  1ZET A;  4UAW A;  1KRP A;  9ICP A;  4F2S A;  2ZTE A;  4EEN A;  2OM6 A;  2J6U A;  3AN1 A;  1BNP A;  3WU2 U;  4YR3 A;  3BS5 A;  2A19 A;  2LHT A;  4RQ7 A;  2IMW P;  2KKV A;  4YMN A;  3IRU A;  2ODG A;  1L3U A;  3RAX A;  2KHV A;  1NKC A;  5KFW A;  4RUA A;  1N48 A;  9ICT A;  2WAQ F;  2KVS A;  4IQW A;  3DEE A;  3PML A;  8ICZ A;  2KSO A;  3GIJ A;  2W04 A;  3QE9 Y;  2F8L A;  3UMB A;  2VA8 A;  1O03 A;  2HI0 A;  4RQ8 A;  5ALX A;  1HUO A;  2UVW A;  1ZQJ A;  2VJ4 A;  3SV3 A;  5DB8 A;  4JK1 A;  4TQR A;  8ICC A;  1ZOL A;  1SV4 A;  3OHA A;  4I29 A;  5KFX A;  2BPF A;  2F2A B;  4Y2T A;  3UMG A;  2EH9 A;  4NM1 A;  1WYG A;  1S97 A;  5GTH U;  4F72 A;  2XY6 A;  4YFK A;  3N4M B;  1ZQL A;  3TFS A;  2ZIU B;  3JPR A;  5KT2 A;  2DWQ A;  2ZIX B;  4F3O A;  5KFZ A;  4PHP A;  2C2R A;  2J6S A;  2PFN A;  1SXE A;  4O3N A;  1ZQF A;  2PMZ F;  5AM0 A;  4ECQ A;  1UA0 A;  2KP7 A;  4QZC A;  3AL0 B;  1KTQ A;  4DOB A;  5J0X A;  5AHX A;  4G3I A;  4M6W A;  5KFO A;  3HX0 A;  3KHR A;  3RB0 A;  1U4B A;  4F4X A;  1RZT A;  3ZD9 A;  3AEV A;  2JGA A;  2HHT A;  1RYU A;  5EWF A;  5D49 A;  3D2Q A;  2PXI A;  2XY7 A;  1ZD5 A;  2R8J A;  3QUB A;  4P0Q B;  4DFJ A;  4P4O A;  1K1Q A;  5L9X A;  1T8E A;  1TKD A;  4J9R A;  3NAS A;  5KFB A;  2ESE A;  3GV8 B;  2DGZ A;  5ALZ A;  5BOM A;  2EAM A;  3IG5 A;  1ZQP A;  5F9N A;  8ICT A;  8ICY A;  3B9J A;  3B0Y A;  4Y2X A;  2PI4 A;  4ED3 A;  9ICI A;  4KLO A;  3RB6 A;  2JZB A;  1S9F A;  2QAR B;  2JHD A;  4NXZ A;  1ZQH A;  3H8S A;  4MF2 A;  2OXO A;  2C2E A;  1IXR A;  3K1R B;  4YD2 A;  4R63 A;  4EEK A;  4O3Q A;  5J2I A;  2E3T A;  4Q44 A;  3MGH A;  4J9S A;  1BGX T;  4B9S A;  3PZP A;  1PVQ A;  5KFC A;  4DL4 A;  1KEJ A;  1L3T A;  2P66 A;  5KG3 A;  1L3S A;  9ICG A;  1S5L U;  2W7O A;  1QQ6 A;  7ICS A;  4FBT A;  3H0R B;  3VC8 A;  1QTM A;  2FPL A;  2W3S A;  3JPT A;  1NK8 A;  4I2J A;  3QXG A;  4Z6E A;  1QQ7 A;  4BUG A;  1TE2 A;  1ZQQ A;  1Y88 A;  2Q0Z X;  1TK5 A;  2WAQ C;  3JPO A;  2K60 A;  1FO4 A;  5DKW A;  2HHX A;  1FEZ A;  4I2C A;  4F5N A;  1SZH A;  4OJ6 A;  8ICJ A;  1X66 A;  4DSL A;  2E8P A;  3EPG A;  1B4F A;  2JH7 A;  4ECU A;  5KNI A;  4UAU A;  7ICO A;  5HHI A;  3SAF A;  1ZXI A;  2VJ5 A;  4CF5 A;  2KFN A;  2R8G A;  1KBU A;  3FYH A;  3M8S A;  3D2S A;  3BQT A;  2G08 A;  3IV6 A;  2OEH A;  4UBC A;  4NJ8 A;  3DDH A;  3H7I A;  5F3X B;  9ICA A;  2PMZ C;  3K4G A;  1UHU A;  2K4I A;  1KKX A;  4CCH A;  5ALE A;  4B9T A;  1DRG A;  5B5E U;  3QEB Z;  4C4T A;  4Y2Y A;  4X5V A;  1YZ7 A;  3V72 A;  3H0L B;  1U47 A;  2NYV A;  4C8M A;  4IRK A;  2AQ0 A;  2JEJ A;  5CJ7 A;  2PFO A;  4RT3 A;  5J0S A;  1NJW A;  2B0C A;  2LMR A;  4KN7 A;  2ATL A;  1JIH A;  4UB1 A;  1SL2 A;  5ALL A;  2P6R A;  1Z00 B;  2E5S A;  3LVW A;  1NJX A;  1DK3 A;  4CNQ A;  5FP0 A;  2VA3 A;  3N7P D;  2EZX A;  1S76 D;  3N7R C;  1V85 A;  3JPN A;  2ZXI A;  1A6S A;  5KT4 A;  3FAH A;  3F5A A;  3M1Y A;  4UW9 A;  1DOQ A;  4PH5 A;  1KQQ A;  4C0Z A;  4GIB A;  4I2H A;  2J6T A;  3AM9 A;  3PX4 A;  3SMV A;  4KLG A;  2QKQ A;  4PZN A;  2R8K A;  1CUK A;  2JRZ A;  2OCE A;  4KLF A;  4Q8F A;  1MN8 A;  2AH5 A;  4P0P B;  4ECS A;  5J8Y A;  3NRW A;  4QZB A;  3MDC A;  2G5H B;  4YN4 A;  2AJQ A;  4M9H A;  2AHO B;  4DQI A;  7ICL A;  3PR5 B;  2RQ5 A;  3PX0 A;  3L5K A;  1QSY A;  3QZ8 A;  3RB4 A;  3K1Z A;  2W9B A;  1CRX A;  3SV4 A;  2H3F A;  1JRO A;  4M47 A;  3RJH A;  3T5J A;  5D46 A;  2C22 A;  9ICJ A;  1YT3 A;  1D8Y A;  1RXV A;  1D8L A;  2Z7J A;  3WK4 A;  4ACO A;  3JPP A;  4NY8 A;  2DBY A;  3BS7 A;  5G5H A;  1JAL A;  1XSP A;  1X2I A;  1NNL A;  5AM3 A;  2B21 A;  1C7Y A;  2HBL A;  4ZOH C;  4KX5 A;  3MC1 A;  4RT2 A;  5AM2 A;  3MAB A;  3GIL A;  1UQV A;  2XO7 A;  2NRV A;  2YMP A;  2YB4 A;  4J9K A;  2GOL A;  5AKK A;  2GLE A;  5AK5 A;  1WWV A;  3RB3 A;  2LBO A;  1Z4O A;  1ARO P;  1QSL A;  5KG6 A;  3H0M B;  4QZD A;  4EBC A;  2HBJ A;  3IN5 A;  1RXW A;  2BPG A;  4DFK A;  1TK0 A;  7ICU A;  3UMC A;  2UVU A;  1JN3 A;  8ICX A;  3I28 A;  4YXM A;  1DGS A;  5J0O A;  4CRX A;  2KJ9 A;  2KKP A;  1HEK A;  1HUZ A;  1JX4 A;  2HDO A;  3PW7 A;  5AI4 A;  4RQ6 A;  5CB1 A;  2KJ8 A;  4PHD A;  4QZF A;  3FDS A;  3ONN A;  4DWI A;  5J2A A;  1XSL A;  3C1Y A;  3PSF A;  1TAM A;  3SR6 A;  3KHL A;  3NTU A;  4UB4 A;  4OD0 A;  1K1S A;  5HP4 A;  1SKR A;  1XWL A;  3WKA A;  3G6V A;  3UXP A;  2DKZ A;  4ECR A;  4JWM A;  4J03 A;  5KFK A;  4F4Y A;  3I1Y A;  5BPC A;  3GU3 A;  4TUQ A;  4U7C A;  7ICE A;  3OJU A;  4I28 A;  5AKJ A;  2BCV A;  4BX9 C;  4GC6 A;  2A1J A;  3WK7 A;  4F93 B;  1ZD2 P;  3EW9 A;  3RBD A;  1IV8 A;  3ZDD A;  3WK9 A;  5CA7 A;  1B43 A;  4P4M A;  4OCZ A;  1BNO A;  4JMU A;  2QB0 A;  3LDA A;  3WKC A;  3F2C A;  2C2D A;  5AKI A;  3ZI4 A;  3SZ2 A;  4GFJ A;  3SEN A;  1ZQZ A;  2FE9 A;  3WK6 A;  4DF8 A;  2VKQ A;  1FIQ A;  3N97 B;  2MA1 A;  4UAS A;  4R8U A;  3VCB A;  3H4B A;  5AI6 A;  4J9O A;  2JH1 A;  3PVX A;  3NVY A;  5ALV A;  2HW3 A;  3OTQ A;  9ICQ A;  3AQF A;  5ALI A;  3RH6 A;  3G6X A;  1ZRM A;  4IC9 A;  3UXN A;  2K4H A;  4C7Z A;  3PW4 A;  3HWT A;  3M6Z A;  3HW8 A;  2P6U A;  3HKZ F;  4Y2U A;  3JPQ A;  8ICW A;  4QW8 A;  5ALT A;  3TAN A;  2N1R A;  4A8E A;  3M9N B;  5J2D A;  1C20 A;  2KK0 A;  1NK6 A;  5KFA A;  3TAQ A;  2ZXH A;  5CEH A;  4EBE A;  3T3F A;  2E8O A;  1ZQW A;  9ICU A;  2MUT B;  4DL7 A;  4RNM A;  1N5X A;  2WF6 A;  1SB3 C;  1LKY B;  1U48 A;  3ED5 A;  3KTQ A;  4RZR A;  4KLQ A;  2JEI A;  2F1H A;  1PUZ A;  2KMD A;  3I76 A;  3E2E A;  5AK4 A;  2DFL A;  1DXS A;  3LVV A;  2ALZ A;  2VAN A;  4I2A A;  4F92 B;  2BGW A;  2XGQ A;  4US8 A;  9ICS A;  1TAU A;  3KBB A;  3KFU F;  1TFR A;  1J97 A;  4CE6 A;  4XA5 A;  8ICP A;  3V6H A;  3CNH A;  3LK9 A;  5AK3 A;  3C2M A;  1SKS A;  3KKA A;  2FMS A;  4GXK A;  2K8A A;  5AIA A;  2EAP A;  4ECV A;  5DB6 A;  3GII A;  2RDI A;  4BXO A;  3RF9 A;  5J29 A;  2Y0S F;  4I2B A;  5KL8 B;  3N28 A;  3J81 j;  4NL9 A;  3UM9 A;  2W9C A;  2F3N A;  4F5P A;  4LVS A;  4NLZ A;  3QU9 A;  2E8M A;  5J0Q A;  2KIV A;  5DDM A;  5L1K A;  2Y1I A;  1PZN A;  4PJ0 U;  2K8B B;  4QWE A;  2AGP A;  1TAQ A;  5ALF A;  5ALM A;  9ICL A;  1V9P A;  2F44 A;  4QZE A;  2XVT A;  7ICV A;  3HT3 A;  4I2D A;  4QWA A;  2UVV A;  1PVR A;  1RYR A;  2F8K A;  2V9W A;  4ECX A;  3NUQ A;  4DOC A;  4O9M A;  5DG7 A;  1KDH A;  2AXT U;  3C5G A;  4ELU A;  5IIJ A;  3Q8S B;  3L3F X;  2O6K A;  2BCU A;  4O5C A;  4ELV A;  2XC9 A;  2HOF A;  4KLL A;  2D6F C;  2MU2 A;  2FJ6 A;  4ECZ A;  5KFT A;  3CW2 C;  3C2L A;  1NZB A;  2I5H A;  3H40 A;  3SQI A;  2XCP A;  1L5U A;  1L7P A;  1KL9 A;  3HKZ C;  3RRH A;  4ECW A;  2KZZ A;  3QYP A;  3F2D A;  1IIP A;  3ISD A;  3D2N A;  5B66 U;  4IQV A;  4TUS A;  5AIC A;  4AYB C;  2W9A A;  2HMX A;  5L1L A;  4EZ6 A;  5EE3 A;  3LWM A;  4M9J A;  1UA1 A;  2L5Y A;  3SAG A;  3H8M A;  8ICR A;  2G5I B;  1BPE A;  4C80 A;  1XO0 A;  4GXI A;  3GZF A;  1X6I A;  5GTI U;  3QU2 A;  2KTQ A;  1KFD A;  5AI0 A;  2FMQ A;  4QZ9 A;  2F77 X;  1TV9 A;  1ZQG A;  5J0W A;  5JRT A;  1BPX A;  3M8R A;  1ZQK A;  3JPS A;  4O3O A;  4RNN A;  2ZIU A;  2ZIX A;  3NVV A;  4FE3 A;  1XO1 A;  1WWU A;  2RLT A;  4ED1 A;  4TQS A;  5IIL A;  5KFY A;  3O0F A; 
#chains in the Genus database with same CATH homology
 2E8M A;  1V85 A;  1SGG A;  2KIV A;  2DKX A;  1X40 A;  3TAD C;  1SV0 C;  2KG5 A;  4RQN A;  3TAD A;  2QKQ A;  4PZN A;  1SV0 A;  2F44 A;  1RG6 A;  5J8Y C;  1PK1 A;  1KW4 A;  1Z1V A;  1SXE A;  2EAN A;  5JTI A;  1LKY A;  3TAC B;  2F8K A;  2K60 A;  4IS7 A;  5J8Y A;  4MHV A;  2E8O A;  2EAO A;  4PZO A;  2DL0 A;  1X66 A;  2DKZ A;  2E8P A;  2E8N A;  2LPE A;  1PK1 B;  1B4F A;  2Y9T A;  4RQM A;  5L1M A;  2ES6 A;  1LKY B;  5KNI A;  1COK A;  1X9X A;  1SXD A;  5JU5 A;  3IDW A;  2KMD A;  1OW5 A;  3SEI A;  4NJ8 A;  3BS5 A;  1DXS A;  2ESE A;  3HIL A;  5F3X B;  2EAM A;  1UCV A;  2D3D A;  3BS7 A;  2QB0 A;  2B6G A;  2L5Y A;  3KKA C;  3H8M A;  2JV3 A;  3SEN A;  2FE9 A;  1OXJ A;  3BS5 B;  3KKA A;  1UQV A;  2QAR B;  2K4P A;  2EAP A;  2KSO A;  3K1R B;  2D8C A;  1PK3 A;  2GLE A;  4NL9 C;  1WWV A;  2QAR A;  1B0X A;  5JRT A;  2QB0 B;  2Y9U A;  2LMR A;  1JI7 A;  4NL9 A;  2KE7 A;  1V38 A;  2F3N A;  1F0M A;  2QB1 A;  2YTU A;  1SV4 A;  1WWU A;  3BQ7 A;  2KSO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...