4NL9C

Crystal structure of the human anks3-sam/anks6-sam heterodimer
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
60
structure length
60
Chain Sequence
b'ELTGILKKLSLEKYQPIFEEQEVDMEAFLTLTDGDLKELGIKTDGSRQQILAAISELNAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ankyrin repeat and SAM domain-containing protein 3
publication title Characterization of the SAM domain of the PKD-related protein ANKS6 and its interaction with ANKS3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 21
structure length 60
sequence length 60
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 4nl9C01
1SGGA 2QB1A 3SEIA 3KKAC 3TADC 1SXEA 1PK3A 2Y9TA 1X66A 1RG6A 3KKAA 2F44A 1LKYB 1PK1B 1SV4A 5JU5A 5J8YA 1PK1A 1X40A 1X9XA 2QB0B 3BQ7A 1V38A 2EAMA 2E8OA 4NJ8A 3K1RB 2E8NA 1B4FA 1WWUA 1UQVA 2EAPA 2QB0A 2EANA 1OW5A 1WWVA 4MHVA 5JRTA 2EAOA 3SENA 5J8YC 3IDWA 2QKQA 2E8PA 2LMRA 3HILA 2ES6A 5JTIA 2ESEA 4PZOA 2KMDA 2F3NA 2DKZA 2D3DA 1COKA 1SV0A 4RQNA 2LPEA 1V85A 2B6GA 3H8MA 1F0MA 2FE9A 4PZNA 4RQMA 2DKXA 2KIVA 2QARB 1OXJA 5KNIA 2YTUA 2D8CA 2F8KA 1SXDA 2K60A 2QARA 1SV0C 1Z1VA 2DL0A 4IS7A 4NL9C 2GLEA 2KSOB 2L5YA 1B0XA 2KG5A 3BS5B 4NL9A 2Y9UA 2KSOA 2E8MA 5L1MA 3BS7A 2K4PA 3BS5A 3TADA 5F3XB 1JI7A 1UCVA 3TACB 1KW4A 2JV3A 2KE7A 1LKYA 1DXSA
chains in the Genus database with same CATH superfamily
1T4GA 1KEJA 4MFCA 2R8KA 4P0QA 4G9BA 4B9UA 3MC1A 4ICAA 3BDPA 8ICPA 1ZQKA 1Z4OA 5JU5A 2FJ6A 1ZQYA 2JH7A 5AKYA 3J81j 4ZH4A 1V38A 5KL1B 1BPZA 3K1RB 4OJ6A 1TE2A 2EAPA 1OW5A 2HOFA 2Q4TA 1Z00A 1PZNA 2B0CA 3D2QA 3V7JA 4NLBA 1RQNA 2AHOB 2V4QA 3IP4B 2YB1A 2Y0SF 5TISU 1XO1A 2FPLA 4QWEA 4Q45A 5HMLA 2BHNA 3JPQA 2R8GA 4PGXA 3VCBA 1UT8A 5KAIU 3C23A 3LVWA 3ONNA 3LWLA 4I29A 3PX4A 4O3NA 2PFOA 1XNSA 2YTUA 4I2BA 4NM1A 3OJSA 2J6UA 1DK3A 3LVVA 3C2MA 2K60A 3Q8QB 3ZD8A 4KX3A 4DS4A 3GIIA 2F1HA 4FZLA 5J2BA 2EZZA 2YY6A 5KT3A 3TQ1A 4O5CA 2HHXA 5J0YA 3ZDDA 3FC4A 2K8BB 4QZCA 2BCVA 4YD2A 1U48A 1BVSA 1KL9A 4K4GA 5L1MA 3OPXA 2ZJ8A 2ZTCA 3SZ2A 4DWIA 3C29A 4RPXA 1SL2A 4ELTA 4UB6U 2K8AA 2AJQA 2F2AB 2W9CB 3EWAA 5F9LA 3QUCA 4O3OA 2CN1A 3GV7B 3O0FA 1RDFA 3HX0A 3RJJA 1O08A 1ZQVA 5EE9A 2MSNA 4JB3A 4RQ2A 5ALDA 4F3OA 5HMMA 3NRWA 5A0LA 4Q44A 2XGQA 5KFUA 1TK5A 1QSSA 2E8OA 1QQ5A 3HKZC 1SL1A 1UQVA 2K89A 3CNHA 5HR7A 9ICTA 2UVRA 2JZBA 4Z6FA 4QIWC 4F2RA 5JUMA 2FLNA 4KLGA 1NI3A 4QZGA 2QKQA 1ZQ1C 3T5LA 2ES6A 5KG0A 2LYHA 4XUSA 3MR5A 2D3DA 4FS2A 5IIJA 1K5OA 4YR2A 2V9WA 2MUTB 4PZNA 5KG1A 5AI9A 2PXIA 2KVSA 3RRGA 4C0ZA 4UAVA 2AXTU 1S0NA 5KFXA 4DL3A 4NY8A 1U9LA 4ECQA 4B9LA 3H4BA 4RU9A 4UB3A 1KBUA 4FZNA 2L5YA 4OJPA 1U45A 5J2EA 1TFRA 3H0LB 5EE0A 2F8LA 3ED5A 1L3UA 1NK4A 5DG9A 4O0IA 4DCCA 5B5EU 4UB1A 5DGBA 3BQTA 1A76A 4ED6A 4R8UA 1N5XA 3RTVA 1X42A 4HAIA 2WF7A 2Y1JA 2ZG6A 4RNNA 4I28A 9ICWA 2NYVA 5B66U 7ICNA 3SAGA 3KKAC 4I2JA 2HBLA 4J9MA 2AQ4A 3RJGA 3RFAA 1X66A 7ICPA 5DQIA 3WK6A 1PVPA 3EZ5A 2LBOA 1ZQNA 1P7DA 5ALKA 3PY8A 7ICTA 3D6JA 2H3FA 2ZIXB 2YN4A 4DFDA 1SIJA 3EPIA 4B9VA 2K4IA 4AYBC 4KX5A 1T7PA 3PO4A 2BCRA 1Z1BA 3IHQB 4DOBA 4EBDA 3MGIA 2EAOA 1L3VA 3LDAA 1JXEA 4KN4A 3HILA 2A1JA 4M6WB 1Q46A 4RUAA 3ZI4A 1VDVA 2AQ0A 5AM5A 5CRXA 2OH2A 5IINA 5J2FA 2DFLA 1D9DA 4QZEA 2LHTA 1MA7A 2IOFA 4PGYA 3MFHA 4BWJA 3T5JA 5DKWA 3G6YA 4DEZA 5J0WA 2E3TA 2VIXA 4YMMA 1YT3A 4NLKA 4YFKA 1ZETA 3C2KA 1PVRA 4R66A 1RZTA 2GLEA 2KSOB 2BPCA 3RJFA 1NKEA 9ICKA 5DBAA 3H4DA 1L7NA 5KFZA 3PVXA 5AI4A 3V6JA 3QU9A 3NVZA 4F5QA 4YD1A 1F5SA 4EELA 1WUDA 2VJ5A 2KTQA 1DGJA 5ALTA 4I2AA 3N7PD 4OJOA 2A3VA 2F44A 2YB4A 4QZDA 2H3ZA 4CNQA 4RQ4A 4J9SA 1X9XA 1VJ5A 4ECZA 2RLTA 2E8NA 1B4FA 1JN3A 1L5UA 5DB9A 3PSPA 1C20A 2R8HA 2M0NA 4I27A 5KFHA 3WK9A 1WCNA 3QU7A 1A6SA 4DSIA 4UAZA 4QZIA 3M7DA 3WKDA 5AM0A 5DQGA 5TZVA 4RQ3A 4GLXA 4PH5A 4NLZA 3RJKA 3UXOA 3N4MB 4O3PA 7ICFA 1B22A 1UT5A 5DDMA 5ALQA 5CWRA 4U7CA 3SQIA 5AM1A 3QUQA 5DBCA 1RQLA 4UAWA 1NK5A 1N5WA 5EOZA 2PFQA 1ZRNA 2DL0A 3WK8A 4YCXA 4BJQA 2AGQA 7ICOA 1IV8A 1TAMA 3M1YA 3WK4A 4GXIA 3QUTA 3T5HA 8ICUA 3SAFA 2Y9UA 3ETLA 2OM6A 3GIMA 1Q3UA 9ICVA 1ZQBA 2JRZA 2KP7A 3TACB 7ICUA 3OHBA 2FMPA 2W11A 2FPKA 4FFDA 4O5KA 2W9MA 2WF5A 1C7YA 1BGXT 2VA3A 1LVHA 4DF4A 3Q8SB 2W9CA 1SGGA 2QB1A 1RYRA 4KLTA 3RAQA 4GIBA 3ZDEA 2HMXA 2OHFA 2WTFA 3GV5B 1KN5A 4M9GA 4KLOA 1QSYA 4F91B 4PHPA 4QZBA 1XWLA 1PK1B 4TUQA 4KLIA 2ISPA 3B0XA 1K1QA 1QLNA 1X9MA 5KFVA 3UMGA 1X6IA 3C2LA 3PMNA 2J6TA 2EZXA 1KQQA 1MQ3A 4Q8EA 3I76A 2XC9A 2XY7A 2C2RA 1XSPA 3T5KA 1KFSA 1BNPA 5E79U 1TAQA 5D46A 1NK9A 2BPFA 4EZ9A 3PW2A 1HIWA 4DLGA 4M9JA 7ICHA 2E8PA 1KFTA 3WK7A 2ESEA 4UB2A 5CP2A 1L3TA 3BQ1A 4MEXA 8ICWA 5F9NA 8ICMA 4X5VA 3H8MA 1F0MA 1NK8A 1SKWA 1M6YA 4J03A 2DKXA 5AK6A 2KIVA 2QARB 3H8JA 2MUTA 3C21A 2WAQF 2G06A 4BUGA 2KJ5A 1RYUA 3F53A 5J2AA 5AK3A 1SWVA 1J2NA 3TAPA 3F2BA 2KVCA 3OSPA 3QE9Y 5DGAA 2PFPA 5EE1A 2IMWP 4F5NA 1BPEA 4Y2PA 4OCZA 3KHGA 3MR2A 2VA2A 3L5KA 3PSFA 5ALPA 3M9MB 2BQUA 8ICKA 1UCVA 1D9FA 4DFKA 1BPYA 5KAFU 1RG6A 5KG7A 2LYAA 1KSPA 4UQGA 8ICVA 4RPYA 4DQPA 3Q8MA 3C5FA 3CP8A 4QZAA 3MFIA 2NRZA 1Y88A 3V6HA 2W9BB 8ICOA 4GC6A 5ALGA 2OYYA 4CRXA 4G3IA 1X40A 2YMLA 4ECRA 4NJ8A 2PFNA 4EX7A 2UVVA 4BGDA 2ZIXA 2H3IA 3MGVA 9ICOA 4MEYA 2JEJA 2DQNB 1Z19A 3KFUF 1ZQXA 3ISDA 8ICAA 5EE3A 3BQ2A 1VLBA 2EH9A 2ZUBA 1X9WA 2KMDA 4M6WA 4M9LA 5KFEA 7ICSA 5AM2A 2GOLA 3F5AA 2BPGA 3IG5A 9ICNA 4IQUA 4U6PA 5KFGA 2WFAA 1N62A 4JWMA 4QZ9A 2KV2A 4ECWA 4F4KA 1L7PA 3SYZA 3OGUA 4TUPA 4IS7A 1MC8A 2BDUA 2KOBA 4EEYA 3KZIU 1ED1A 3M9OB 3AM9A 5ALFA 5J0TA 2HHVA 2KK0A 5K4LA 2H3QA 1BPBA 2HOIA 1IIPA 4BX9C 4O9MA 8ICFA 3B9JA 3QNMA 7ICQA 2KSOA 4ELVA 3IV6A 3TARA 4QW8A 4YQWA 4C80A 4C8KA 4DFJA 3Q8PB 5AK5A 2I5HA 1JXLA 2F76X 3NTUA 5IIMA 4B9SA 3D2SA 8ICGA 5J0RA 1QQ6A 4DQSA 2FDRA 3MABA 5J0SA 4GFJA 5KG6A 3K1ZA 4YP3A 2F1IA 1SXEA 1ZQMA 2LM4A 2ZUCA 1CEZA 4Y2QA 2IA6A 5DG7A 4ED7A 3KKAA 5J0OA 2IHNA 4ELUA 3QU4A 1COOA 3PNCA 2YMPA 5BOLA 1T8EA 2EDUA 3CW2C 1ZQCA 5AI8A 3LWMA 3D2NA 1FIQA 3TI0A 4I2DA 2KZ3A 1K1SA 5KFMA 4P0PB 2CPRA 2EANA 3ISCA 2DWQA 3JPOA 2XY5A 1UHUA 5ALYA 9ICQA 1UPHA 4JUZA 4P4MA 5KFWA 4MFFA 1JMSA 1B43A 1CRXA 3H7IA 3KOOA 5DG8A 3AL0B 1RXVA 5CA7A 5ALRA 4RQNA 3L4PA 4DSKA 5HHHA 3EW9A 1KRPA 5HNKA 2VKQA 3AEVA 3FAHA 8ICNA 1ZD5A 3WKBA 2GO7A 3NUQA 5L1LA 1XSLA 2K8CB 3HJEA 1BPXA 5DBBA 3TANA 4LZDA 5AKGA 3SD7A 9ICHA 4NL9C 2FMSA 4OO1J 4I2IA 9ICLA 4HYKA 3QEAZ 1L7OA 4DOAA 3T3FA 3THVA 2AH5A 1JUDA 2B21A 3AU2A 1NNLA 5FP0A 2WF8A 2ZIUB 4XA5A 3RR7A 2W7PA 1L8LA 1ZD2P 3F5EA 9ICIA 1DXSA 3QU5A 1S97A 4CF3A 3ICXA 4RQ7A 2XCPA 3JPNA 2WHEA 1MSWD 1PK3A 4OJLA 3K4GA 1NK6A 4F5PA 4P4PA 1Z4NA 4PGQA 3BJYA 4OJ5A 2BZFA 1ZQLA 2NO5A 5KFAA 1PK1A 5ALVA 3EYZA 4Q8FA 4R65A 3QZ8A 4M9HA 4JMUA 2W04A 4I2HA 1ZJNA 2OWOA 2DUYA 2LI6A 3RH4A 1MQ2A 3AU6A 2HSZA 4C8OA 3UXNA 4RQ6A 1ZQQA 9ICMA 1QH9A 3M9NB 5GTHU 3GIJA 5ALUA 2DKZA 2KHVA 1ZQWA 1SV0A 3TAQA 2VANA 5DB8A 2WF6A 5AI5A 1T3NA 4ACOA 2H3VA 1DK2A 4E0DA 8ICIA 3G6XA 3V72A 8ICCA 3AQFA 4DQIA 2BQ3A 2PMZF 1WG8A 5J2CA 2QARA 3BQ0A 3IM1A 4Q43A 1Z1VA 5AI0A 4KTQA 4BWMA 2W8LA 1S0OA 2XY6A 4Y2UA 3AN1A 1RPLA 1ZD4A 3MDAA 2JXJA 3ZD9A 4CCHA 8ICSA 2JMGA 1S76D 3PX6A 2KJ9A 1IG6A 4FBUA 4KLUA 2OCEA 2FI1A 5AKKA 2KD1A 5KFJA 4J9RA 3PO5A 2R8IA 4Z6DA 1ZQTA 3M6KA 1NK0A 5KFYA 5ALNA 1NZBA 3RAXA 5KG3A 5DLGA 4MF8A 4DL5A 4M04A 5ALJA 4LJXA 4DFMA 4M9NA 2Z7JA 4F4WA 1S5LU 4C4TA 1NKBA 1JROA 2W9BA 4YXJA 2W7OA 4US8A 5CHGA 4UB5A 9ICEA 1WWVA 4MHVA 3M8SA 4QWCA 4DQRA 3RJEA 4B6JA 3PW0A 5L1IA 4PHEA 5KG5A 1PUZA 1QTMA 5J0PA 2CRXA 7ICEA 5EWFA 8ICLA 2ASJA 4KLLA 4XRHA 2JEIA 5IIKA 3MR6A 1D8YA 4O5EA 1NZPA 2MRLA 1ZD3A 3RRHA 4C8LA 1ZJMA 4US9A 5L1KA 4QWBA 2F8KA 2LM1A 4PHAA 2NRWA 1SV0C 1XS9D 4I2GA 3GILA 3N7SC 1QCKA 3QUBA 4J9LA 2W3SA 4F71A 1QQ7A 1KFDA 4MF2A 1DOQA 2K4PA 3PSIA 1HUOA 7ICIA 5J2DA 5T14A 2G08A 4UAUA 4DL2A 5HHIA 2KFZA 3B0YA 1KW4A 5AI6A 4Y2YA 2HOQA 1YZ7A 8ICXA 5J0QA 2HVHA 1TAUA 1S77D 1NJZA 2CXYA 4TUSA 3FDSA 2V4RA 4BXOB 3MR3A 2OXOA 3N7RC 2P35A 4QZFA 3T79A 2C2DA 3LYSA 4NXZA 5KT4A 5ALZA 4ED3A 4EBEA 1SV4A 4C4RA 3ORYA 9ICCA 4JV1A 4YR3A 4F72A 3LK9A 1Q8KA 3WKEA 2KIWA 8ICRA 1N56A 4UW9A 5KFNA 2BCSA 1FFVA 5KFTA 1JX4A 2IHMA 2KJ8A 9ICGA 4P0PA 1S9FA 4IQWA 2ODGA 3IDWA 2ATLA 3E2EA 3KBBA 2LPEA 1V85A 4C8NA 2DBYA 1TKDA 4IL6U 4KLSA 4RQMA 2ZIVB 3MDCA 5AKXA 4PJ0U 1L6NA 4RT3A 4M0AA 2RDJA 1ZQPA 3C28A 3RJIA 1AQ6A 3GU3A 2JHDA 4DQQA 5KFSA 5KFOA 2ALZA 2DPIA 2FLPA 3C5GA 3FM9A 4UAYA 3PR5B 4O3MA 3RJHA 2JEFA 4NLCA 1QSLA 3BS5B 9ICPA 2BDPA 3HWTA 3C1YA 9ICUA 3S6JA 4EEKA 2WAQC 4J9KA 3PX0A 2UVUA 2WB1C 4C8MA 4RT2A 4F8RA 2JR5A 8ICJA 3RR8A 1FO4A 5KFFA 2ZIUA 3GDXA 4Y2SA 5ALOA 2LKYA 2RRDA 5ALMA 3I1YA 1YZ6A 3GFKB 3SEIA 2GH1A 2BR0A 2O6KA 3Q8KA 4NLGA 2Y9TA 1ZQAA 3NVWA 2F77X 1XSNA 3GV8B 2W8KA 4J9NA 3RB6A 4KLEA 2ASDA 3C1ZA 3PV8A 3RBEA 2QB0B 3NGDA 4Y2RA 5AM3A 4GXKA 4PL2A 3UXPA 3HT3A 4QWDA 3EUB2 2PI5A 4IRDA 2P6UA 2HVIA 5CB1A 2AGPA 1JIHA 2QLTA 3NRZA 5JTIA 4K4IA 4UATA 9ICBA 5ALIA 1V9PA 3BZKA 4DF8A 4KN7A 3KHRA 2BCQA 2RHFA 4DFPA 2HHQA 2IOHA 3ETRA 2HBKA 9ICXA 2XGPA 5KFLA 3OHAA 5AM4A 2N1RA 5J29A 1N48A 4RQ0A 7ICJA 8ICTA 3H0RB 4F92B 3Q8LA 5ALSA 2Q0ZX 4UBBA 2KNJA 5DLFA 1L8OA 4K4HA 3A0HU 3GIKA 8ICEA 3V7KA 5ALWA 3ZDBA 4NL9A 2MA1A 4AP9A 2H5XA 2E8MA 2R18A 5AK4A 4EENA 1UA1A 3E0FA 2C28A 4IR9A 1JI7A 2HHUA 1RXWA 4FZMA 2Y0SC 2BKEA 4UB8U 4ED2A 2IOFK 2I9GA 5GTIU 3NVVA 4EBCA 1D8LA 3AMZA 4DLEA 2A19A 4JV2A 2G5HB 4C4SA 1X6JA 2F1JA 2ZTDA 3H0MB 1D8BA 1SWWA 2NO4A 4P4OA 4RQ1A 3OJUA 5J2GA 3N97B 1FEZA 2XIDA 2HCFA 8ICZA 1JRPA 2A1AA 1PVQA 4BDPA 3BQ7A 2W03A 4J9PA 5IIOA 1ZQDA 2HHSA 8ICQA 3EPGA 4KLHA 2ZTEA 3WKCA 3MBYA 1XU4A 1ZXIA 4ECTA 4FO6A 3VC8A 3SENA 1JALA 5CEHA 1U4BA 3NS1A 3I28A 1ZQOA 4IQTA 4RQ5A 2KFNA 5KFRA 5ALHA 5G5HA 2ZUDA 5L9XA 2FE9A 5KFPA 1KLNA 3NVYA 4WJ3B 2ISOA 4Y2VA 1OXJA 4KLQA 1L3SA 3ZDCA 1N2XA 2D8CA 4YXMA 4NLNA 4FBTA 3H8SA 1NJYA 3QYPA 2FPMA 4NWIA 2VA8A 4QW9A 1NOMA 7ICVA 2ZIWB 4KMOB 3SMVA 1XC9A 1SZHA 3TADA 5KFQA 4ECUA 4Y2XA 2I1QA 2YX8A 4O3QA 2XI9A 4YMOA 3ISBA 5KFIA 4KLFA 1OUQA 4DSFA 2KE7A 3N28A 3SI8A 1J2MA 5AKJA 2HI0A 4C7YA 2RP5A 5KFBA 5KTQA 3HKZF 2AU0A 4RPZA 4CF5A 4UBCA 3DV9A 5ALLA 4KLJA 5ALXA 5BPCA 4RUCA 4BXOA 3UQ2A 4QIWF 2MU2A 1LV5A 4I2EA 3FYHA 3UM9A 5HR6A 4IC9A 4I2FA 9ICAA 4JWNA 1CUKA 2BQRA 4RNOA 1V97A 3SAHA 1HEKA 4DSJA 2YMMA 1ZQSA 2HDOA 2G0AA 1TV9A 4FS1A 1ZQZA 2DPJA 5AKIA 2I6XA 1ZQHA 1IXRA 2C22A 1KKXA 4CDGA 4DOCA 2WF9A 4QNLA 3CRXA 1TK0A 4DO9A 5H2FU 2XVTA 4YR0A 1ZRMA 5C0YA 3E58A 5KNIA 5DDYA 3A0BU 1F44A 4DS5A 2ZIVA 3PMLA 4RNMA 7ICMA 2DGZA 2W55A 3F2DA 2AGOA 4CGZA 3CYMA 1WYGA 3JPSA 4QZ8A 1B0XA 4GC7A 2KG5A 1EXNA 4KMUA 4USAA 3AQEA 1ZQFA 5J0UA 4KLMA 3V7LA 4M2YA 3BS7A 2PMZC 2K4EA 3BS5A 5AHXA 4ECXA 5AIBA 4DL4A 3OTQA 3UQ0A 3GZFA 5G5GA 1DRGA 2LYBA 2W54A 5D49A 1LKYA 4UARA 5DQHA 4P0QB 3IRUA 1NJXA 2KKPA 3MGHA 3TADC 2G5IB 1A77A 5AKZA 4AYBF 2XICA 2P66A 2C2EA 4F4ZA 4DSLA 3TFSA 4PL1A 7ICKA 2KN7A 5KT7A 2D6FC 3IG8A 1S8OA 2P6RA 5KFKA 4RZRA 1Q3VA 3G6VA 1KTQA 4EYIB 8ICBA 4DSEA 1SL0A 2KICA 3IN5A 4EX6A 3WU2U 1Z00B 1UA0A 3PR4A 4OD0A 2QB0A 4TQRA 2ZJAA 4LVSA 2W3RA 4F2SA 3F2CA 4J9QA 5JRTA 3DEEA 4JK1A 4XQ8A 3AUOA 4B9NA 1U49A 2LMRA 2E1EA 4ECVA 1SZPA 4GXJA 1SKSA 2F3NA 5EWGA 4O3RA 3L3FX 2B6GA 3SV3A 4M47A 9ICRA 5KFCA 1TK8A 2YMQA 3WK5A 2KHQA 4ED1A 3RB3A 4KLDA 3V6KA 3PW5A 2BGWA 1ZQJA 1RM6C 4ED8A 4EYHB 5J2JA 3QX7A 3K75D 4PHDA 3DDHA 4IRKA 5KG2A 2XO7A 4FE3A 1J97A 2EQYA 9ICFA 3HW8A 2KEYA 3TKAA 4QJFB 1U47A 1T94A 4ZOHC 3H40A 3HPOA 2HW3A 3HP6A 5KT6A 1IM4A 3JPPA 3JPRA 4F50A 5L1JA 8ICHA 2OEHA 4CE6A 2NV3A 2NRVA 9ICSA 4B9MA 5IILA 5DB6A 1KDHA 5AKEA 3ZDAA 1S0VA 1ZYQA 4C7ZA 4JV0A 2FLLA 1SKRA 4Y2TA 4ECSA 3BZCA 4Y2JA 4EZ6A 4F4XA 2E5SA 4A8EA 5J8YA 5C5JA 4F5OA 2IBKA 3RBDA 3QXGA 4YN4A 4NV0A 2JZBB 1S10A 2XCAA 1WWUA 3PW4A 5BOMA 2J6SA 5DB7A 1T3QA 3NASA 4I2CA 1L7MA 2YQEA 5KL8B 1ZOLA 3HRDD 5AIAA 3OSNA 3M8RA 4PZOA 4UB4A 2KZMA 3RH6A 2JEGA 1RYSA 2JGAA 3KD3A 3PW7A 1ZQRA 4R63A 1NK7A 5CJ7A 5IIIA 2NRXA 5AKHA 4IR1A 3TFRA 2ZXIA 1LB2B 4IRCA 4P2HA 4YG2A 3M6ZA 1URJA 1A0PA 1MN8A 4PPXA 5J0XA 5AICA 2UVWA 3RB4A 1DGSA 2KZZA 3SV4A 2NRTA 4KITB 4ECYA 1FFUA 4CF4A 1Z3EB 5CR0A 3KTQA 4TURA 2ZIWA 1HUZA 4R8UB 4RQ8A 4LZGA 1ZQGA 5ALEA 5J2IA 1N63A 3SR6A 2BCUA 4F4YA 2EZYA 1ECWA 3PZPA 3UMBA 3R9KA 5KFDA 1BPDA 2JV3A 5KT2A 1S0MA 3QU2A 2Y1IA 2RQ5A 4NM2A 1ZQEA 4B9TA 1N60A 4IQVA 1H38A 5EWEA 5J2KA 3H8WA 9ICJA 2R8JA 3JPTA 4Z6CA 4J9OA 3KZXA 3KHHA 4F5RA 1TVAA 3RH5A 1O03A 1LKYB 4ED0A 4O3SA 2HBJA 3UMCA 2K4HA 1ZQIA 8ICYA 2EAMA 1SB3C 1WCLA 2MAXA 1ZQUA 1X9SA 4R64A 1NKCA 1AROP 2A1JB 3GQCA 5J8YC 5KG4A 5KT5A 1BNOA 2HHWA 4UASA 2WB1F 1NJWA 1XO0A 3WKAA 3RF9A 2E1FA 2W43A 1COKA 4QWAA 7ICLA 2RDIA 3Q8RB 4YVZA 2G07A 2KKVA 3ALRA 4DL6A 2JH1A 3PSTA 1X2IA 1CI4A 5AKLA 4QZHA 1SXDA 7ICGA 3QZ7A 4YMNA 3U26A 2ZXHA 1HJPA 3UPQA 4MFAA 1N61A 2PI4A 3QEBZ 3RB0A 2HBMA 2VJ4A 4Z6EA 2PKEA 2FMQA 2DF4B 4F93B 4TQSA 5J2HA 4DL7A 2GWSA 2G09A 2ZJ5A 3KHLA 2ASLA 2M9NA 1GO3F 5F3XB 5HP4A 5D4BA 2W9AA 2HHTA 7ICRA
chains in the Genus database with same CATH topology
1SGGA 2QB1A 3SEIA 3KKAC 3TADC 1SXEA 1PK3A 2Y9TA 1X66A 1RG6A 3KKAA 2F44A 1LKYB 1PK1B 1SV4A 5JU5A 5J8YA 1PK1A 1X40A 1X9XA 2QB0B 3BQ7A 1V38A 2EAMA 2E8OA 4NJ8A 3K1RB 2E8NA 1B4FA 1WWUA 1UQVA 2EAPA 2QB0A 2EANA 1OW5A 1WWVA 4MHVA 5JRTA 2EAOA 3SENA 5J8YC 3IDWA 2QKQA 2E8PA 2LMRA 3HILA 2ES6A 5JTIA 2ESEA 4PZOA 2KMDA 2F3NA 2DKZA 2D3DA 1COKA 1SV0A 4RQNA 2LPEA 1V85A 2B6GA 3H8MA 1F0MA 2FE9A 4PZNA 4RQMA 2DKXA 2KIVA 2QARB 1OXJA 5KNIA 2YTUA 2D8CA 2F8KA 1SXDA 2K60A 2QARA 1SV0C 1Z1VA 2DL0A 4IS7A 4NL9C 2GLEA 2KSOB 2L5YA 1B0XA 2KG5A 3BS5B 4NL9A 2Y9UA 2KSOA 2E8MA 5L1MA 3BS7A 2K4PA 3BS5A 3TADA 5F3XB 1JI7A 1UCVA 3TACB 1KW4A 2JV3A 2KE7A 1LKYA 1DXSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SGG A;  2QB1 A;  3SEI A;  3KKA C;  3TAD C;  1SXE A;  1PK3 A;  2Y9T A;  1X66 A;  1RG6 A;  3KKA A;  2F44 A;  1LKY B;  1PK1 B;  1SV4 A;  5JU5 A;  5J8Y A;  1PK1 A;  1X40 A;  1X9X A;  2QB0 B;  3BQ7 A;  1V38 A;  2EAM A;  2E8O A;  4NJ8 A;  3K1R B;  2E8N A;  1B4F A;  1WWU A;  1UQV A;  2EAP A;  2QB0 A;  2EAN A;  1OW5 A;  1WWV A;  4MHV A;  5JRT A;  2EAO A;  3SEN A;  5J8Y C;  3IDW A;  2QKQ A;  2E8P A;  2LMR A;  3HIL A;  2ES6 A;  5JTI A;  2ESE A;  4PZO A;  2KMD A;  2F3N A;  2DKZ A;  2D3D A;  1COK A;  1SV0 A;  4RQN A;  2LPE A;  1V85 A;  2B6G A;  3H8M A;  1F0M A;  2FE9 A;  4PZN A;  4RQM A;  2DKX A;  2KIV A;  2QAR B;  1OXJ A;  5KNI A;  2YTU A;  2D8C A;  2F8K A;  1SXD A;  2K60 A;  2QAR A;  1SV0 C;  1Z1V A;  2DL0 A;  4IS7 A;  4NL9 C;  2GLE A;  2KSO B;  2L5Y A;  1B0X A;  2KG5 A;  3BS5 B;  4NL9 A;  2Y9U A;  2KSO A;  2E8M A;  5L1M A;  3BS7 A;  2K4P A;  3BS5 A;  3TAD A;  5F3X B;  1JI7 A;  1UCV A;  3TAC B;  1KW4 A;  2JV3 A;  2KE7 A;  1LKY A;  1DXS A; 
#chains in the Genus database with same CATH topology
 1T4G A;  1KEJ A;  4MFC A;  2R8K A;  4P0Q A;  4G9B A;  4B9U A;  3MC1 A;  4ICA A;  3BDP A;  8ICP A;  1ZQK A;  1Z4O A;  5JU5 A;  2FJ6 A;  1ZQY A;  2JH7 A;  5AKY A;  3J81 j;  4ZH4 A;  1V38 A;  5KL1 B;  1BPZ A;  3K1R B;  4OJ6 A;  1TE2 A;  2EAP A;  1OW5 A;  2HOF A;  2Q4T A;  1Z00 A;  1PZN A;  2B0C A;  3D2Q A;  3V7J A;  4NLB A;  1RQN A;  2AHO B;  2V4Q A;  3IP4 B;  2YB1 A;  2Y0S F;  5TIS U;  1XO1 A;  2FPL A;  4QWE A;  4Q45 A;  5HML A;  2BHN A;  3JPQ A;  2R8G A;  4PGX A;  3VCB A;  1UT8 A;  5KAI U;  3C23 A;  3LVW A;  3ONN A;  3LWL A;  4I29 A;  3PX4 A;  4O3N A;  2PFO A;  1XNS A;  2YTU A;  4I2B A;  4NM1 A;  3OJS A;  2J6U A;  1DK3 A;  3LVV A;  3C2M A;  2K60 A;  3Q8Q B;  3ZD8 A;  4KX3 A;  4DS4 A;  3GII A;  2F1H A;  4FZL A;  5J2B A;  2EZZ A;  2YY6 A;  5KT3 A;  3TQ1 A;  4O5C A;  2HHX A;  5J0Y A;  3ZDD A;  3FC4 A;  2K8B B;  4QZC A;  2BCV A;  4YD2 A;  1U48 A;  1BVS A;  1KL9 A;  4K4G A;  5L1M A;  3OPX A;  2ZJ8 A;  2ZTC A;  3SZ2 A;  4DWI A;  3C29 A;  4RPX A;  1SL2 A;  4ELT A;  4UB6 U;  2K8A A;  2AJQ A;  2F2A B;  2W9C B;  3EWA A;  5F9L A;  3QUC A;  4O3O A;  2CN1 A;  3GV7 B;  3O0F A;  1RDF A;  3HX0 A;  3RJJ A;  1O08 A;  1ZQV A;  5EE9 A;  2MSN A;  4JB3 A;  4RQ2 A;  5ALD A;  4F3O A;  5HMM A;  3NRW A;  5A0L A;  4Q44 A;  2XGQ A;  5KFU A;  1TK5 A;  1QSS A;  2E8O A;  1QQ5 A;  3HKZ C;  1SL1 A;  1UQV A;  2K89 A;  3CNH A;  5HR7 A;  9ICT A;  2UVR A;  2JZB A;  4Z6F A;  4QIW C;  4F2R A;  5JUM A;  2FLN A;  4KLG A;  1NI3 A;  4QZG A;  2QKQ A;  1ZQ1 C;  3T5L A;  2ES6 A;  5KG0 A;  2LYH A;  4XUS A;  3MR5 A;  2D3D A;  4FS2 A;  5IIJ A;  1K5O A;  4YR2 A;  2V9W A;  2MUT B;  4PZN A;  5KG1 A;  5AI9 A;  2PXI A;  2KVS A;  3RRG A;  4C0Z A;  4UAV A;  2AXT U;  1S0N A;  5KFX A;  4DL3 A;  4NY8 A;  1U9L A;  4ECQ A;  4B9L A;  3H4B A;  4RU9 A;  4UB3 A;  1KBU A;  4FZN A;  2L5Y A;  4OJP A;  1U45 A;  5J2E A;  1TFR A;  3H0L B;  5EE0 A;  2F8L A;  3ED5 A;  1L3U A;  1NK4 A;  5DG9 A;  4O0I A;  4DCC A;  5B5E U;  4UB1 A;  5DGB A;  3BQT A;  1A76 A;  4ED6 A;  4R8U A;  1N5X A;  3RTV A;  1X42 A;  4HAI A;  2WF7 A;  2Y1J A;  2ZG6 A;  4RNN A;  4I28 A;  9ICW A;  2NYV A;  5B66 U;  7ICN A;  3SAG A;  3KKA C;  4I2J A;  2HBL A;  4J9M A;  2AQ4 A;  3RJG A;  3RFA A;  1X66 A;  7ICP A;  5DQI A;  3WK6 A;  1PVP A;  3EZ5 A;  2LBO A;  1ZQN A;  1P7D A;  5ALK A;  3PY8 A;  7ICT A;  3D6J A;  2H3F A;  2ZIX B;  2YN4 A;  4DFD A;  1SIJ A;  3EPI A;  4B9V A;  2K4I A;  4AYB C;  4KX5 A;  1T7P A;  3PO4 A;  2BCR A;  1Z1B A;  3IHQ B;  4DOB A;  4EBD A;  3MGI A;  2EAO A;  1L3V A;  3LDA A;  1JXE A;  4KN4 A;  3HIL A;  2A1J A;  4M6W B;  1Q46 A;  4RUA A;  3ZI4 A;  1VDV A;  2AQ0 A;  5AM5 A;  5CRX A;  2OH2 A;  5IIN A;  5J2F A;  2DFL A;  1D9D A;  4QZE A;  2LHT A;  1MA7 A;  2IOF A;  4PGY A;  3MFH A;  4BWJ A;  3T5J A;  5DKW A;  3G6Y A;  4DEZ A;  5J0W A;  2E3T A;  2VIX A;  4YMM A;  1YT3 A;  4NLK A;  4YFK A;  1ZET A;  3C2K A;  1PVR A;  4R66 A;  1RZT A;  2GLE A;  2KSO B;  2BPC A;  3RJF A;  1NKE A;  9ICK A;  5DBA A;  3H4D A;  1L7N A;  5KFZ A;  3PVX A;  5AI4 A;  3V6J A;  3QU9 A;  3NVZ A;  4F5Q A;  4YD1 A;  1F5S A;  4EEL A;  1WUD A;  2VJ5 A;  2KTQ A;  1DGJ A;  5ALT A;  4I2A A;  3N7P D;  4OJO A;  2A3V A;  2F44 A;  2YB4 A;  4QZD A;  2H3Z A;  4CNQ A;  4RQ4 A;  4J9S A;  1X9X A;  1VJ5 A;  4ECZ A;  2RLT A;  2E8N A;  1B4F A;  1JN3 A;  1L5U A;  5DB9 A;  3PSP A;  1C20 A;  2R8H A;  2M0N A;  4I27 A;  5KFH A;  3WK9 A;  1WCN A;  3QU7 A;  1A6S A;  4DSI A;  4UAZ A;  4QZI A;  3M7D A;  3WKD A;  5AM0 A;  5DQG A;  5TZV A;  4RQ3 A;  4GLX A;  4PH5 A;  4NLZ A;  3RJK A;  3UXO A;  3N4M B;  4O3P A;  7ICF A;  1B22 A;  1UT5 A;  5DDM A;  5ALQ A;  5CWR A;  4U7C A;  3SQI A;  5AM1 A;  3QUQ A;  5DBC A;  1RQL A;  4UAW A;  1NK5 A;  1N5W A;  5EOZ A;  2PFQ A;  1ZRN A;  2DL0 A;  3WK8 A;  4YCX A;  4BJQ A;  2AGQ A;  7ICO A;  1IV8 A;  1TAM A;  3M1Y A;  3WK4 A;  4GXI A;  3QUT A;  3T5H A;  8ICU A;  3SAF A;  2Y9U A;  3ETL A;  2OM6 A;  3GIM A;  1Q3U A;  9ICV A;  1ZQB A;  2JRZ A;  2KP7 A;  3TAC B;  7ICU A;  3OHB A;  2FMP A;  2W11 A;  2FPK A;  4FFD A;  4O5K A;  2W9M A;  2WF5 A;  1C7Y A;  1BGX T;  2VA3 A;  1LVH A;  4DF4 A;  3Q8S B;  2W9C A;  1SGG A;  2QB1 A;  1RYR A;  4KLT A;  3RAQ A;  4GIB A;  3ZDE A;  2HMX A;  2OHF A;  2WTF A;  3GV5 B;  1KN5 A;  4M9G A;  4KLO A;  1QSY A;  4F91 B;  4PHP A;  4QZB A;  1XWL A;  1PK1 B;  4TUQ A;  4KLI A;  2ISP A;  3B0X A;  1K1Q A;  1QLN A;  1X9M A;  5KFV A;  3UMG A;  1X6I A;  3C2L A;  3PMN A;  2J6T A;  2EZX A;  1KQQ A;  1MQ3 A;  4Q8E A;  3I76 A;  2XC9 A;  2XY7 A;  2C2R A;  1XSP A;  3T5K A;  1KFS A;  1BNP A;  5E79 U;  1TAQ A;  5D46 A;  1NK9 A;  2BPF A;  4EZ9 A;  3PW2 A;  1HIW A;  4DLG A;  4M9J A;  7ICH A;  2E8P A;  1KFT A;  3WK7 A;  2ESE A;  4UB2 A;  5CP2 A;  1L3T A;  3BQ1 A;  4MEX A;  8ICW A;  5F9N A;  8ICM A;  4X5V A;  3H8M A;  1F0M A;  1NK8 A;  1SKW A;  1M6Y A;  4J03 A;  2DKX A;  5AK6 A;  2KIV A;  2QAR B;  3H8J A;  2MUT A;  3C21 A;  2WAQ F;  2G06 A;  4BUG A;  2KJ5 A;  1RYU A;  3F53 A;  5J2A A;  5AK3 A;  1SWV A;  1J2N A;  3TAP A;  3F2B A;  2KVC A;  3OSP A;  3QE9 Y;  5DGA A;  2PFP A;  5EE1 A;  2IMW P;  4F5N A;  1BPE A;  4Y2P A;  4OCZ A;  3KHG A;  3MR2 A;  2VA2 A;  3L5K A;  3PSF A;  5ALP A;  3M9M B;  2BQU A;  8ICK A;  1UCV A;  1D9F A;  4DFK A;  1BPY A;  5KAF U;  1RG6 A;  5KG7 A;  2LYA A;  1KSP A;  4UQG A;  8ICV A;  4RPY A;  4DQP A;  3Q8M A;  3C5F A;  3CP8 A;  4QZA A;  3MFI A;  2NRZ A;  1Y88 A;  3V6H A;  2W9B B;  8ICO A;  4GC6 A;  5ALG A;  2OYY A;  4CRX A;  4G3I A;  1X40 A;  2YML A;  4ECR A;  4NJ8 A;  2PFN A;  4EX7 A;  2UVV A;  4BGD A;  2ZIX A;  2H3I A;  3MGV A;  9ICO A;  4MEY A;  2JEJ A;  2DQN B;  1Z19 A;  3KFU F;  1ZQX A;  3ISD A;  8ICA A;  5EE3 A;  3BQ2 A;  1VLB A;  2EH9 A;  2ZUB A;  1X9W A;  2KMD A;  4M6W A;  4M9L A;  5KFE A;  7ICS A;  5AM2 A;  2GOL A;  3F5A A;  2BPG A;  3IG5 A;  9ICN A;  4IQU A;  4U6P A;  5KFG A;  2WFA A;  1N62 A;  4JWM A;  4QZ9 A;  2KV2 A;  4ECW A;  4F4K A;  1L7P A;  3SYZ A;  3OGU A;  4TUP A;  4IS7 A;  1MC8 A;  2BDU A;  2KOB A;  4EEY A;  3KZI U;  1ED1 A;  3M9O B;  3AM9 A;  5ALF A;  5J0T A;  2HHV A;  2KK0 A;  5K4L A;  2H3Q A;  1BPB A;  2HOI A;  1IIP A;  4BX9 C;  4O9M A;  8ICF A;  3B9J A;  3QNM A;  7ICQ A;  2KSO A;  4ELV A;  3IV6 A;  3TAR A;  4QW8 A;  4YQW A;  4C80 A;  4C8K A;  4DFJ A;  3Q8P B;  5AK5 A;  2I5H A;  1JXL A;  2F76 X;  3NTU A;  5IIM A;  4B9S A;  3D2S A;  8ICG A;  5J0R A;  1QQ6 A;  4DQS A;  2FDR A;  3MAB A;  5J0S A;  4GFJ A;  5KG6 A;  3K1Z A;  4YP3 A;  2F1I A;  1SXE A;  1ZQM A;  2LM4 A;  2ZUC A;  1CEZ A;  4Y2Q A;  2IA6 A;  5DG7 A;  4ED7 A;  3KKA A;  5J0O A;  2IHN A;  4ELU A;  3QU4 A;  1COO A;  3PNC A;  2YMP A;  5BOL A;  1T8E A;  2EDU A;  3CW2 C;  1ZQC A;  5AI8 A;  3LWM A;  3D2N A;  1FIQ A;  3TI0 A;  4I2D A;  2KZ3 A;  1K1S A;  5KFM A;  4P0P B;  2CPR A;  2EAN A;  3ISC A;  2DWQ A;  3JPO A;  2XY5 A;  1UHU A;  5ALY A;  9ICQ A;  1UPH A;  4JUZ A;  4P4M A;  5KFW A;  4MFF A;  1JMS A;  1B43 A;  1CRX A;  3H7I A;  3KOO A;  5DG8 A;  3AL0 B;  1RXV A;  5CA7 A;  5ALR A;  4RQN A;  3L4P A;  4DSK A;  5HHH A;  3EW9 A;  1KRP A;  5HNK A;  2VKQ A;  3AEV A;  3FAH A;  8ICN A;  1ZD5 A;  3WKB A;  2GO7 A;  3NUQ A;  5L1L A;  1XSL A;  2K8C B;  3HJE A;  1BPX A;  5DBB A;  3TAN A;  4LZD A;  5AKG A;  3SD7 A;  9ICH A;  4NL9 C;  2FMS A;  4OO1 J;  4I2I A;  9ICL A;  4HYK A;  3QEA Z;  1L7O A;  4DOA A;  3T3F A;  3THV A;  2AH5 A;  1JUD A;  2B21 A;  3AU2 A;  1NNL A;  5FP0 A;  2WF8 A;  2ZIU B;  4XA5 A;  3RR7 A;  2W7P A;  1L8L A;  1ZD2 P;  3F5E A;  9ICI A;  1DXS A;  3QU5 A;  1S97 A;  4CF3 A;  3ICX A;  4RQ7 A;  2XCP A;  3JPN A;  2WHE A;  1MSW D;  1PK3 A;  4OJL A;  3K4G A;  1NK6 A;  4F5P A;  4P4P A;  1Z4N A;  4PGQ A;  3BJY A;  4OJ5 A;  2BZF A;  1ZQL A;  2NO5 A;  5KFA A;  1PK1 A;  5ALV A;  3EYZ A;  4Q8F A;  4R65 A;  3QZ8 A;  4M9H A;  4JMU A;  2W04 A;  4I2H A;  1ZJN A;  2OWO A;  2DUY A;  2LI6 A;  3RH4 A;  1MQ2 A;  3AU6 A;  2HSZ A;  4C8O A;  3UXN A;  4RQ6 A;  1ZQQ A;  9ICM A;  1QH9 A;  3M9N B;  5GTH U;  3GIJ A;  5ALU A;  2DKZ A;  2KHV A;  1ZQW A;  1SV0 A;  3TAQ A;  2VAN A;  5DB8 A;  2WF6 A;  5AI5 A;  1T3N A;  4ACO A;  2H3V A;  1DK2 A;  4E0D A;  8ICI A;  3G6X A;  3V72 A;  8ICC A;  3AQF A;  4DQI A;  2BQ3 A;  2PMZ F;  1WG8 A;  5J2C A;  2QAR A;  3BQ0 A;  3IM1 A;  4Q43 A;  1Z1V A;  5AI0 A;  4KTQ A;  4BWM A;  2W8L A;  1S0O A;  2XY6 A;  4Y2U A;  3AN1 A;  1RPL A;  1ZD4 A;  3MDA A;  2JXJ A;  3ZD9 A;  4CCH A;  8ICS A;  2JMG A;  1S76 D;  3PX6 A;  2KJ9 A;  1IG6 A;  4FBU A;  4KLU A;  2OCE A;  2FI1 A;  5AKK A;  2KD1 A;  5KFJ A;  4J9R A;  3PO5 A;  2R8I A;  4Z6D A;  1ZQT A;  3M6K A;  1NK0 A;  5KFY A;  5ALN A;  1NZB A;  3RAX A;  5KG3 A;  5DLG A;  4MF8 A;  4DL5 A;  4M04 A;  5ALJ A;  4LJX A;  4DFM A;  4M9N A;  2Z7J A;  4F4W A;  1S5L U;  4C4T A;  1NKB A;  1JRO A;  2W9B A;  4YXJ A;  2W7O A;  4US8 A;  5CHG A;  4UB5 A;  9ICE A;  1WWV A;  4MHV A;  3M8S A;  4QWC A;  4DQR A;  3RJE A;  4B6J A;  3PW0 A;  5L1I A;  4PHE A;  5KG5 A;  1PUZ A;  1QTM A;  5J0P A;  2CRX A;  7ICE A;  5EWF A;  8ICL A;  2ASJ A;  4KLL A;  4XRH A;  2JEI A;  5IIK A;  3MR6 A;  1D8Y A;  4O5E A;  1NZP A;  2MRL A;  1ZD3 A;  3RRH A;  4C8L A;  1ZJM A;  4US9 A;  5L1K A;  4QWB A;  2F8K A;  2LM1 A;  4PHA A;  2NRW A;  1SV0 C;  1XS9 D;  4I2G A;  3GIL A;  3N7S C;  1QCK A;  3QUB A;  4J9L A;  2W3S A;  4F71 A;  1QQ7 A;  1KFD A;  4MF2 A;  1DOQ A;  2K4P A;  3PSI A;  1HUO A;  7ICI A;  5J2D A;  5T14 A;  2G08 A;  4UAU A;  4DL2 A;  5HHI A;  2KFZ A;  3B0Y A;  1KW4 A;  5AI6 A;  4Y2Y A;  2HOQ A;  1YZ7 A;  8ICX A;  5J0Q A;  2HVH A;  1TAU A;  1S77 D;  1NJZ A;  2CXY A;  4TUS A;  3FDS A;  2V4R A;  4BXO B;  3MR3 A;  2OXO A;  3N7R C;  2P35 A;  4QZF A;  3T79 A;  2C2D A;  3LYS A;  4NXZ A;  5KT4 A;  5ALZ A;  4ED3 A;  4EBE A;  1SV4 A;  4C4R A;  3ORY A;  9ICC A;  4JV1 A;  4YR3 A;  4F72 A;  3LK9 A;  1Q8K A;  3WKE A;  2KIW A;  8ICR A;  1N56 A;  4UW9 A;  5KFN A;  2BCS A;  1FFV A;  5KFT A;  1JX4 A;  2IHM A;  2KJ8 A;  9ICG A;  4P0P A;  1S9F A;  4IQW A;  2ODG A;  3IDW A;  2ATL A;  3E2E A;  3KBB A;  2LPE A;  1V85 A;  4C8N A;  2DBY A;  1TKD A;  4IL6 U;  4KLS A;  4RQM A;  2ZIV B;  3MDC A;  5AKX A;  4PJ0 U;  1L6N A;  4RT3 A;  4M0A A;  2RDJ A;  1ZQP A;  3C28 A;  3RJI A;  1AQ6 A;  3GU3 A;  2JHD A;  4DQQ A;  5KFS A;  5KFO A;  2ALZ A;  2DPI A;  2FLP A;  3C5G A;  3FM9 A;  4UAY A;  3PR5 B;  4O3M A;  3RJH A;  2JEF A;  4NLC A;  1QSL A;  3BS5 B;  9ICP A;  2BDP A;  3HWT A;  3C1Y A;  9ICU A;  3S6J A;  4EEK A;  2WAQ C;  4J9K A;  3PX0 A;  2UVU A;  2WB1 C;  4C8M A;  4RT2 A;  4F8R A;  2JR5 A;  8ICJ A;  3RR8 A;  1FO4 A;  5KFF A;  2ZIU A;  3GDX A;  4Y2S A;  5ALO A;  2LKY A;  2RRD A;  5ALM A;  3I1Y A;  1YZ6 A;  3GFK B;  3SEI A;  2GH1 A;  2BR0 A;  2O6K A;  3Q8K A;  4NLG A;  2Y9T A;  1ZQA A;  3NVW A;  2F77 X;  1XSN A;  3GV8 B;  2W8K A;  4J9N A;  3RB6 A;  4KLE A;  2ASD A;  3C1Z A;  3PV8 A;  3RBE A;  2QB0 B;  3NGD A;  4Y2R A;  5AM3 A;  4GXK A;  4PL2 A;  3UXP A;  3HT3 A;  4QWD A;  3EUB 2;  2PI5 A;  4IRD A;  2P6U A;  2HVI A;  5CB1 A;  2AGP A;  1JIH A;  2QLT A;  3NRZ A;  5JTI A;  4K4I A;  4UAT A;  9ICB A;  5ALI A;  1V9P A;  3BZK A;  4DF8 A;  4KN7 A;  3KHR A;  2BCQ A;  2RHF A;  4DFP A;  2HHQ A;  2IOH A;  3ETR A;  2HBK A;  9ICX A;  2XGP A;  5KFL A;  3OHA A;  5AM4 A;  2N1R A;  5J29 A;  1N48 A;  4RQ0 A;  7ICJ A;  8ICT A;  3H0R B;  4F92 B;  3Q8L A;  5ALS A;  2Q0Z X;  4UBB A;  2KNJ A;  5DLF A;  1L8O A;  4K4H A;  3A0H U;  3GIK A;  8ICE A;  3V7K A;  5ALW A;  3ZDB A;  4NL9 A;  2MA1 A;  4AP9 A;  2H5X A;  2E8M A;  2R18 A;  5AK4 A;  4EEN A;  1UA1 A;  3E0F A;  2C28 A;  4IR9 A;  1JI7 A;  2HHU A;  1RXW A;  4FZM A;  2Y0S C;  2BKE A;  4UB8 U;  4ED2 A;  2IOF K;  2I9G A;  5GTI U;  3NVV A;  4EBC A;  1D8L A;  3AMZ A;  4DLE A;  2A19 A;  4JV2 A;  2G5H B;  4C4S A;  1X6J A;  2F1J A;  2ZTD A;  3H0M B;  1D8B A;  1SWW A;  2NO4 A;  4P4O A;  4RQ1 A;  3OJU A;  5J2G A;  3N97 B;  1FEZ A;  2XID A;  2HCF A;  8ICZ A;  1JRP A;  2A1A A;  1PVQ A;  4BDP A;  3BQ7 A;  2W03 A;  4J9P A;  5IIO A;  1ZQD A;  2HHS A;  8ICQ A;  3EPG A;  4KLH A;  2ZTE A;  3WKC A;  3MBY A;  1XU4 A;  1ZXI A;  4ECT A;  4FO6 A;  3VC8 A;  3SEN A;  1JAL A;  5CEH A;  1U4B A;  3NS1 A;  3I28 A;  1ZQO A;  4IQT A;  4RQ5 A;  2KFN A;  5KFR A;  5ALH A;  5G5H A;  2ZUD A;  5L9X A;  2FE9 A;  5KFP A;  1KLN A;  3NVY A;  4WJ3 B;  2ISO A;  4Y2V A;  1OXJ A;  4KLQ A;  1L3S A;  3ZDC A;  1N2X A;  2D8C A;  4YXM A;  4NLN A;  4FBT A;  3H8S A;  1NJY A;  3QYP A;  2FPM A;  4NWI A;  2VA8 A;  4QW9 A;  1NOM A;  7ICV A;  2ZIW B;  4KMO B;  3SMV A;  1XC9 A;  1SZH A;  3TAD A;  5KFQ A;  4ECU A;  4Y2X A;  2I1Q A;  2YX8 A;  4O3Q A;  2XI9 A;  4YMO A;  3ISB A;  5KFI A;  4KLF A;  1OUQ A;  4DSF A;  2KE7 A;  3N28 A;  3SI8 A;  1J2M A;  5AKJ A;  2HI0 A;  4C7Y A;  2RP5 A;  5KFB A;  5KTQ A;  3HKZ F;  2AU0 A;  4RPZ A;  4CF5 A;  4UBC A;  3DV9 A;  5ALL A;  4KLJ A;  5ALX A;  5BPC A;  4RUC A;  4BXO A;  3UQ2 A;  4QIW F;  2MU2 A;  1LV5 A;  4I2E A;  3FYH A;  3UM9 A;  5HR6 A;  4IC9 A;  4I2F A;  9ICA A;  4JWN A;  1CUK A;  2BQR A;  4RNO A;  1V97 A;  3SAH A;  1HEK A;  4DSJ A;  2YMM A;  1ZQS A;  2HDO A;  2G0A A;  1TV9 A;  4FS1 A;  1ZQZ A;  2DPJ A;  5AKI A;  2I6X A;  1ZQH A;  1IXR A;  2C22 A;  1KKX A;  4CDG A;  4DOC A;  2WF9 A;  4QNL A;  3CRX A;  1TK0 A;  4DO9 A;  5H2F U;  2XVT A;  4YR0 A;  1ZRM A;  5C0Y A;  3E58 A;  5KNI A;  5DDY A;  3A0B U;  1F44 A;  4DS5 A;  2ZIV A;  3PML A;  4RNM A;  7ICM A;  2DGZ A;  2W55 A;  3F2D A;  2AGO A;  4CGZ A;  3CYM A;  1WYG A;  3JPS A;  4QZ8 A;  1B0X A;  4GC7 A;  2KG5 A;  1EXN A;  4KMU A;  4USA A;  3AQE A;  1ZQF A;  5J0U A;  4KLM A;  3V7L A;  4M2Y A;  3BS7 A;  2PMZ C;  2K4E A;  3BS5 A;  5AHX A;  4ECX A;  5AIB A;  4DL4 A;  3OTQ A;  3UQ0 A;  3GZF A;  5G5G A;  1DRG A;  2LYB A;  2W54 A;  5D49 A;  1LKY A;  4UAR A;  5DQH A;  4P0Q B;  3IRU A;  1NJX A;  2KKP A;  3MGH A;  3TAD C;  2G5I B;  1A77 A;  5AKZ A;  4AYB F;  2XIC A;  2P66 A;  2C2E A;  4F4Z A;  4DSL A;  3TFS A;  4PL1 A;  7ICK A;  2KN7 A;  5KT7 A;  2D6F C;  3IG8 A;  1S8O A;  2P6R A;  5KFK A;  4RZR A;  1Q3V A;  3G6V A;  1KTQ A;  4EYI B;  8ICB A;  4DSE A;  1SL0 A;  2KIC A;  3IN5 A;  4EX6 A;  3WU2 U;  1Z00 B;  1UA0 A;  3PR4 A;  4OD0 A;  2QB0 A;  4TQR A;  2ZJA A;  4LVS A;  2W3R A;  4F2S A;  3F2C A;  4J9Q A;  5JRT A;  3DEE A;  4JK1 A;  4XQ8 A;  3AUO A;  4B9N A;  1U49 A;  2LMR A;  2E1E A;  4ECV A;  1SZP A;  4GXJ A;  1SKS A;  2F3N A;  5EWG A;  4O3R A;  3L3F X;  2B6G A;  3SV3 A;  4M47 A;  9ICR A;  5KFC A;  1TK8 A;  2YMQ A;  3WK5 A;  2KHQ A;  4ED1 A;  3RB3 A;  4KLD A;  3V6K A;  3PW5 A;  2BGW A;  1ZQJ A;  1RM6 C;  4ED8 A;  4EYH B;  5J2J A;  3QX7 A;  3K75 D;  4PHD A;  3DDH A;  4IRK A;  5KG2 A;  2XO7 A;  4FE3 A;  1J97 A;  2EQY A;  9ICF A;  3HW8 A;  2KEY A;  3TKA A;  4QJF B;  1U47 A;  1T94 A;  4ZOH C;  3H40 A;  3HPO A;  2HW3 A;  3HP6 A;  5KT6 A;  1IM4 A;  3JPP A;  3JPR A;  4F50 A;  5L1J A;  8ICH A;  2OEH A;  4CE6 A;  2NV3 A;  2NRV A;  9ICS A;  4B9M A;  5IIL A;  5DB6 A;  1KDH A;  5AKE A;  3ZDA A;  1S0V A;  1ZYQ A;  4C7Z A;  4JV0 A;  2FLL A;  1SKR A;  4Y2T A;  4ECS A;  3BZC A;  4Y2J A;  4EZ6 A;  4F4X A;  2E5S A;  4A8E A;  5J8Y A;  5C5J A;  4F5O A;  2IBK A;  3RBD A;  3QXG A;  4YN4 A;  4NV0 A;  2JZB B;  1S10 A;  2XCA A;  1WWU A;  3PW4 A;  5BOM A;  2J6S A;  5DB7 A;  1T3Q A;  3NAS A;  4I2C A;  1L7M A;  2YQE A;  5KL8 B;  1ZOL A;  3HRD D;  5AIA A;  3OSN A;  3M8R A;  4PZO A;  4UB4 A;  2KZM A;  3RH6 A;  2JEG A;  1RYS A;  2JGA A;  3KD3 A;  3PW7 A;  1ZQR A;  4R63 A;  1NK7 A;  5CJ7 A;  5III A;  2NRX A;  5AKH A;  4IR1 A;  3TFR A;  2ZXI A;  1LB2 B;  4IRC A;  4P2H A;  4YG2 A;  3M6Z A;  1URJ A;  1A0P A;  1MN8 A;  4PPX A;  5J0X A;  5AIC A;  2UVW A;  3RB4 A;  1DGS A;  2KZZ A;  3SV4 A;  2NRT A;  4KIT B;  4ECY A;  1FFU A;  4CF4 A;  1Z3E B;  5CR0 A;  3KTQ A;  4TUR A;  2ZIW A;  1HUZ A;  4R8U B;  4RQ8 A;  4LZG A;  1ZQG A;  5ALE A;  5J2I A;  1N63 A;  3SR6 A;  2BCU A;  4F4Y A;  2EZY A;  1ECW A;  3PZP A;  3UMB A;  3R9K A;  5KFD A;  1BPD A;  2JV3 A;  5KT2 A;  1S0M A;  3QU2 A;  2Y1I A;  2RQ5 A;  4NM2 A;  1ZQE A;  4B9T A;  1N60 A;  4IQV A;  1H38 A;  5EWE A;  5J2K A;  3H8W A;  9ICJ A;  2R8J A;  3JPT A;  4Z6C A;  4J9O A;  3KZX A;  3KHH A;  4F5R A;  1TVA A;  3RH5 A;  1O03 A;  1LKY B;  4ED0 A;  4O3S A;  2HBJ A;  3UMC A;  2K4H A;  1ZQI A;  8ICY A;  2EAM A;  1SB3 C;  1WCL A;  2MAX A;  1ZQU A;  1X9S A;  4R64 A;  1NKC A;  1ARO P;  2A1J B;  3GQC A;  5J8Y C;  5KG4 A;  5KT5 A;  1BNO A;  2HHW A;  4UAS A;  2WB1 F;  1NJW A;  1XO0 A;  3WKA A;  3RF9 A;  2E1F A;  2W43 A;  1COK A;  4QWA A;  7ICL A;  2RDI A;  3Q8R B;  4YVZ A;  2G07 A;  2KKV A;  3ALR A;  4DL6 A;  2JH1 A;  3PST A;  1X2I A;  1CI4 A;  5AKL A;  4QZH A;  1SXD A;  7ICG A;  3QZ7 A;  4YMN A;  3U26 A;  2ZXH A;  1HJP A;  3UPQ A;  4MFA A;  1N61 A;  2PI4 A;  3QEB Z;  3RB0 A;  2HBM A;  2VJ4 A;  4Z6E A;  2PKE A;  2FMQ A;  2DF4 B;  4F93 B;  4TQS A;  5J2H A;  4DL7 A;  2GWS A;  2G09 A;  2ZJ5 A;  3KHL A;  2ASL A;  2M9N A;  1GO3 F;  5F3X B;  5HP4 A;  5D4B A;  2W9A A;  2HHT A;  7ICR A; 
#chains in the Genus database with same CATH homology
 1SGG A;  2QB1 A;  3SEI A;  3KKA C;  3TAD C;  1SXE A;  1PK3 A;  2Y9T A;  1X66 A;  1RG6 A;  3KKA A;  2F44 A;  1LKY B;  1PK1 B;  1SV4 A;  5JU5 A;  5J8Y A;  1PK1 A;  1X40 A;  1X9X A;  2QB0 B;  3BQ7 A;  1V38 A;  2EAM A;  2E8O A;  4NJ8 A;  3K1R B;  2E8N A;  1B4F A;  1WWU A;  1UQV A;  2EAP A;  2QB0 A;  2EAN A;  1OW5 A;  1WWV A;  4MHV A;  5JRT A;  2EAO A;  3SEN A;  5J8Y C;  3IDW A;  2QKQ A;  2E8P A;  2LMR A;  3HIL A;  2ES6 A;  5JTI A;  2ESE A;  4PZO A;  2KMD A;  2F3N A;  2DKZ A;  2D3D A;  1COK A;  1SV0 A;  4RQN A;  2LPE A;  1V85 A;  2B6G A;  3H8M A;  1F0M A;  2FE9 A;  4PZN A;  4RQM A;  2DKX A;  2KIV A;  2QAR B;  1OXJ A;  5KNI A;  2YTU A;  2D8C A;  2F8K A;  1SXD A;  2K60 A;  2QAR A;  1SV0 C;  1Z1V A;  2DL0 A;  4IS7 A;  4NL9 C;  2GLE A;  2KSO B;  2L5Y A;  1B0X A;  2KG5 A;  3BS5 B;  4NL9 A;  2Y9U A;  2KSO A;  2E8M A;  5L1M A;  3BS7 A;  2K4P A;  3BS5 A;  3TAD A;  5F3X B;  1JI7 A;  1UCV A;  3TAC B;  1KW4 A;  2JV3 A;  2KE7 A;  1LKY A;  1DXS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...