4NL9C

Crystal structure of the human anks3-sam/anks6-sam heterodimer
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
60
structure length
60
Chain Sequence
b'ELTGILKKLSLEKYQPIFEEQEVDMEAFLTLTDGDLKELGIKTDGSRQQILAAISELNAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ankyrin repeat and SAM domain-containing protein 3
publication title Characterization of the SAM domain of the PKD-related protein ANKS6 and its interaction with ANKS3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 21
structure length 60
sequence length 60
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 4nl9C01
3BS5A 3BQ7A 1DXSA 5L1MA 1OXJA 2KSOB 2D8CA 5J8YC 1Z1VA 3BS7A 5JRTA 2QARA 2QB0A 4MHVA 2D3DA 1WWVA 1SGGA 2EAMA 1COKA 3HILA 2F8KA 2E8NA 2KIVA 2K4PA 1WWUA 1UCVA 4RQNA 2KSOA 3KKAA 5F3XB 2KG5A 1SV4A 2L5YA 3TACB 1X40A 1SXEA 2E8OA 2Y9UA 3TADC 1LKYB 2ESEA 1LKYA 4PZNA 1JI7A 2FE9A 1SV0C 2YTUA 2K60A 2E8PA 1V38A 1V85A 5J8YA 1SXDA 1X66A 2KMDA 3K1RB 2E8MA 2GLEA 3IDWA 2LMRA 4NJ8A 3SENA 2KE7A 2LPEA 3SEIA 1PK3A 2EAPA 2B6GA 2EAOA 4RQMA 1F0MA 3H8MA 4NL9C 1KW4A 2EANA 1X9XA 1OW5A 2JV3A 2DL0A 1PK1B 1B0XA 1PK1A 2ES6A 5JU5A 1RG6A 5JTIA 5KNIA 2F44A 3KKAC 2F3NA 2QARB 2QKQA 2QB0B 4PZOA 2Y9TA 2DKZA 3TADA 1B4FA 4NL9A 4IS7A 2DKXA 1SV0A 3BS5B 1UQVA 2QB1A
chains in the Genus database with same CATH superfamily
2KN7A 4B6JA 5J8YC 1L7NA 5AM4A 1CI4A 4QIWC 1FFUA 3CP8A 4C8MA 4DFPA 1TV9A 5KFQA 4M9JA 1J97A 2BCRA 4I27A 1ZQYA 3HILA 2BPGA 3LWMA 2HSZA 4RQ4A 5KG4A 1WCNA 3ZD8A 2BQRA 1WWUA 4ELUA 3WK7A 4BJQA 2XICA 1ECWA 9ICTA 5ALHA 4Y2TA 2Y1JA 1SKWA 3C23A 5ALVA 4Q8FA 2F8LA 2PI5A 4IRKA 4F71A 3N28A 3ICXA 1XU4A 4NLKA 3HT3A 1S77D 3MDAA 5CEHA 1YZ7A 2MU2A 4RZRA 1NNLA 3PMNA 5J8YA 4MEYA 2JGAA 5DKWA 1IM4A 5DBAA 5KG7A 1ZRNA 2E8MA 3ISCA 4BXOB 4XA5A 4M47A 3SENA 4DL2A 4O3MA 4GLXA 1J2MA 3R9KA 4OJPA 1BPXA 3BZCA 1KW4A 3QUQA 5AICA 1PK1B 4O5EA 3IV6A 1TE2A 2EZZA 1FO4A 5J0OA 3NTUA 1JN3A 3RAXA 2BPCA 4UAWA 7ICTA 2W43A 1KKXA 4QWDA 4QWCA 4NL9A 1ZQGA 2PMZF 4DLGA 1XS9D 1TK5A 3JPPA 4RQ6A 3KTQA 1S0MA 5KFRA 3BS5A 8ICLA 1KRPA 1L5UA 1S5LU 4EYHB 3IHQB 1QQ7A 3PW4A 4DF8A 3KHLA 4FS1A 2KHVA 2R8HA 1S0VA 1RDFA 2D3DA 2FPLA 2AQ0A 5ALKA 4QIWF 3RJEA 3RBEA 4I2AA 4KMOB 4EX7A 2E8NA 1URJA 2ISPA 1UCVA 5AM2A 5KT5A 4ECXA 5ALDA 4ED6A 5KG2A 3NASA 4CF4A 4F5QA 4DSIA 5HMMA 2BPFA 2JZBB 4BWMA 1XWLA 3M6ZA 1SB3C 4EELA 3N7SC 4MF2A 5AM3A 4BUGA 4QW9A 1NKCA 4I2JA 5HHHA 2W03A 4U6PA 7ICHA 4TUPA 5KFHA 3QZ7A 4NM2A 2Z7JA 4UBCA 1SIJA 3GFKB 4KITB 2EQYA 1U48A 3E0FA 4QNLA 2NRZA 4F72A 2ZJAA 4Y2QA 4RPZA 1ZJNA 2F1HA 3CNHA 3H8MA 4Y2VA 3T5JA 2XO7A 4ECRA 4F91B 4J9OA 1RQNA 3IN5A 4UB2A 4O5KA 2HCFA 3H4BA 2EDUA 4QZEA 2GOLA 1B0XA 3G6VA 1TAQA 8ICTA 4TURA 4Q44A 4AYBC 5J0SA 5AIAA 3KHRA 1PVPA 9ICWA 4KTQA 3ZDEA 3ISBA 3V7LA 8ICJA 1B4FA 2G09A 5G5GA 4DOCA 4ECZA 2K4IA 2HOFA 5AHXA 2GO7A 4BX9C 3AU6A 4KX5A 7ICLA 1ZD3A 2B21A 2FLLA 4KN4A 4Y2YA 4G3IA 5AKKA 3AEVA 5J2BA 3SYZA 5IINA 8ICXA 2QB0A 1L3VA 4MHVA 2ODGA 1WWVA 5E79U 4F4XA 5HNKA 3IP4B 4QZAA 1V97A 2PKEA 3MR3A 1JXEA 4F5NA 1O08A 5A0LA 3WKAA 2P6RA 5F3XB 3C2KA 1JXLA 2RQ5A 5KAFU 2ESEA 2I1QA 3BDPA 5ALPA 2AGQA 5DBBA 3EPGA 2C2RA 3UXOA 5J2HA 1RYSA 2BDPA 5EWEA 3AUOA 1P7DA 3C2LA 1SL1A 1X66A 2HMXA 1ZQJA 4DQRA 3IDWA 2MUTB 5KFVA 4M6WA 3RB0A 2XY5A 3PSFA 3V6HA 3C1YA 3N4MB 1S10A 3ETLA 4QZ8A 2BZFA 4YD2A 4TUQA 3L5KA 2K4EA 3V7KA 3OGUA 1F5SA 4RT2A 4I2BA 2YMLA 4F5RA 2DPJA 2W55A 3PY8A 3F5AA 1MA7A 4OD0A 1X2IA 3PW7A 2AGPA 4R8UB 2W3RA 4AYBF 1HUOA 5KFZA 4CCHA 3WKDA 5AKJA 2MSNA 4J9KA 2EZYA 5EE3A 1NKBA 1BNOA 1OXJA 2JEFA 4JUZA 4NM1A 3GV5B 2RDJA 1NJYA 1JMSA 1S76D 1TK0A 4J9PA 5JRTA 4EX6A 5AKLA 2OCEA 3ZDCA 3NVZA 3PSIA 1DK3A 1VLBA 1ED1A 2NRXA 2HBMA 2KVSA 9ICIA 5DQIA 1NK9A 3MR5A 4X5VA 5J2JA 4QZDA 1IXRA 4FZLA 1K1SA 4QZFA 3T3FA 2FLPA 3QU7A 4O5CA 2KICA 5J2FA 1PUZA 2I6XA 2H3QA 1PVQA 4UB1A 4ED2A 3OTQA 5KFSA 4BWJA 4F93B 5KG6A 2PI4A 4NLGA 3UMBA 4J9LA 2JR5A 3RB3A 1ZQEA 2GLEA 3JPQA 3QEBZ 5ALZA 3IG5A 1N5WA 2EZXA 2R8GA 9ICRA 4RNMA 3SAGA 5KT7A 4DOAA 4O3PA 5KT3A 5KFOA 2RDIA 3ETRA 2WF9A 2OEHA 8ICIA 1L3SA 2D6FC 4UB8U 2ES6A 2VJ4A 3UMCA 4YXJA 4ECVA 2UVVA 3PZPA 2F44A 3MBYA 2QB0B 2W9CA 4DL6A 1X9MA 1QSLA 1XSLA 2A1AA 5ALIA 2V4RA 4YXMA 4DO9A 2W9MA 4PGXA 3BQ7A 4GIBA 4CRXA 1Z4NA 5DLFA 3RBDA 5CWRA 3RH6A 4M04A 2JH1A 5AKXA 4IQUA 2BQUA 3F2BA 2QARA 1B43A 3UXPA 4FO6A 2DWQA 1TK8A 4CNQA 3MGHA 3LWLA 5IIJA 1KTQA 2E1EA 4RQ1A 4B9MA 4XRHA 3OHAA 2BKEA 5KFXA 2KG5A 4YCXA 4UAUA 5C0YA 1ZQDA 1X40A 4EBDA 5AM1A 2ALZA 2Y1IA 2YB1A 2Y0SC 3C28A 3FYHA 3RTVA 2A1JB 3UQ0A 1LKYA 1BPYA 1JI7A 2KZZA 2A19A 3GZFA 3PSPA 2ZIWA 4NLZA 2J6TA 1V38A 1V85A 3RRGA 4DCCA 7ICFA 2PFQA 5EE9A 2YX8A 3BQ0A 3NUQA 3K1RB 4OJLA 8ICGA 3F53A 1D8BA 5J2IA 2AHOB 1OUQA 2FI1A 1MC8A 3SEIA 3BJYA 4O3SA 1S0OA 3PV8A 1ZQSA 3RJGA 1RPLA 3KOOA 1SZHA 1S0NA 2XCPA 4NV0A 4KLJA 1RZTA 1U49A 1NK0A 4C4RA 5FP0A 4I2IA 5KFCA 5JTIA 4C8KA 4Q45A 4GFJA 4Y2XA 4UARA 1RXVA 3TAPA 3AQFA 4CE6A 3MC1A 4M9GA 4KLHA 3RJFA 9ICMA 2FMSA 2Q0ZX 2ZIUA 2A3VA 4KLEA 2E1FA 2G07A 2WAQC 4DWIA 2H3VA 4C0ZA 1UA0A 2BDUA 1D9FA 5AI5A 7ICSA 2CRXA 2IOFA 3H0MB 2UVUA 1WCLA 3QZ8A 3C1ZA 1ZYQA 9ICLA 2NO4A 4RU9A 4K4GA 4DFJA 3RFAA 3E2EA 4R63A 3UQ2A 1TFRA 2LYBA 1GO3F 4ECUA 4I2CA 4XUSA 4I2GA 5KG3A 2G5HB 2LI6A 1XNSA 2F77X 3NGDA 5J2CA 5ALNA 2LYHA 3ED5A 4C7ZA 3WK9A 1NJZA 2Y0SF 2AH5A 3M8RA 4DQQA 2HHWA 1QSSA 1KL9A 2ZXHA 4MFCA 5DG8A 5KFNA 5IIOA 3M6KA 1BPDA 4AP9A 2XIDA 4M9LA 4RQMA 1ZQFA 1ZQRA 3ZDBA 4NL9C 3GILA 8ICBA 3PW5A 3TQ1A 2BHNA 1KFTA 3JPOA 3V7JA 1ZQHA 5ALUA 2F3NA 2W8KA 2QARB 3QUCA 4DQPA 1X42A 2YMMA 3K1ZA 1ZQLA 1SKRA 2G5IB 4UAYA 2YB4A 1UA1A 1T3QA 4KLUA 2DQNB 4GC6A 4DL7A 2C22A 3F2DA 1DXSA 2KEYA 5AK3A 1V9PA 2WAQF 1XC9A 3RB6A 4RUCA 5KT6A 4Y2PA 3ZD9A 8ICYA 1COKA 4ECYA 5AK6A 2ZJ5A 4CF5A 2C2DA 1UHUA 5DDYA 4C7YA 3WK6A 3L3FX 3T5LA 3SD7A 2VANA 3OPXA 4TQSA 1L7OA 3LYSA 9ICHA 7ICNA 1JIHA 5L9XA 1BPBA 2MA1A 4PL1A 1NZBA 4I2EA 4EEYA 1SZPA 4OCZA 2HHTA 2OXOA 2M9NA 3ZDDA 4RQ8A 3QX7A 1JROA 3D2QA 3WKBA 4PL2A 2LM1A 4R64A 1DOQA 2K8BB 3MGVA 3N7RC 5AI9A 4KLDA 1MQ2A 5KFJA 2W9BB 4DSJA 4DF4A 1BPZA 4NJ8A 5DQHA 3PO5A 1K5OA 1ZQPA 4QZHA 8ICVA 1RYUA 5EWGA 3B0XA 3KZXA 2KOBA 4F3OA 4RT3A 4QZBA 4KLTA 1PVRA 2NV3A 2JV3A 5DB9A 4RQ0A 2KJ5A 2E5SA 5ALOA 3WU2U 3KFUF 2XGPA 8ICFA 3HRDD 3HX0A 3GDXA 4UB6U 4EBEA 2HVHA 3OJSA 4F50A 1ZJMA 2N1RA 3O0FA 3WK8A 9ICSA 1ZQWA 3M1YA 1T7PA 1UQVA 5EWFA 3ONNA 4MFAA 4PHAA 4NLBA 9ICGA 4I2FA 4Z6FA 1QQ5A 1ZETA 1Q46A 2BCUA 4F4YA 2XY6A 1Z1VA 3ALRA 2W3SA 1S97A 1QLNA 3THVA 1PZNA 3KZIU 2KFNA 5ALJA 4EYIB 2F8KA 2HBKA 1COOA 9ICNA 4RQ3A 2LHTA 4QWAA 2ISOA 5KFLA 3V72A 4C80A 1Z19A 1JUDA 2BR0A 5ALFA 3SMVA 5J2GA 3MR2A 2I5HA 3DEEA 3QXGA 4PHPA 4J03A 3D2SA 2HBLA 4FZMA 3QUTA 4UQGA 3RRHA 4K4IA 4OJ6A 4DSKA 4YVZA 4IQVA 3NRWA 1TAMA 4M0AA 9ICFA 1UT8A 1NK4A 2YTUA 2HHXA 4GXIA 1SXDA 8ICZA 2HOQA 1XO0A 1NJXA 4UB5A 8ICHA 4UASA 1U47A 4YMNA 1VDVA 1F0MA 2KTQA 1IIPA 2EANA 4IQTA 3RR7A 8ICQA 2H5XA 2ZIXA 3RR8A 3C29A 3KKAC 4IC9A 2JEJA 4F8RA 5DB8A 2QKQA 3QUBA 4JV2A 2Y9TA 2ZIVA 4UB4A 1HUZA 4P2HA 3TKAA 2DUYA 5C5JA 3BS5B 3SAHA 5KFWA 4RNOA 5GTIU 1CRXA 3IM1A 1WUDA 2D8CA 3KHGA 2FJ6A 1C20A 1RXWA 3RJKA 2BGWA 1Z00A 1HJPA 4F5PA 1TVAA 3EYZA 5KTQA 3PR4A 1F44A 2NRTA 1ZQXA 3D2NA 3SV4A 4DSEA 5TISU 5TZVA 2IA6A 2UVWA 2JEGA 5AKHA 2XVTA 3KKAA 5CA7A 3RAQA 1SV4A 2ASJA 1Q3VA 4FFDA 3PW2A 5IIKA 2KJ9A 1SXEA 2K8AA 3MDCA 2H3ZA 2LYAA 2WB1C 2RHFA 2VA3A 3EWAA 1ZQMA 3F5EA 5BPCA 2BCSA 4C4SA 5J2AA 3C2MA 2ZUCA 5B66U 5EOZA 3QU5A 4YR3A 5J0YA 4F4WA 4KLQA 2JMGA 4DL5A 5G5HA 1SKSA 3BZKA 3RB4A 1ZQUA 2BCVA 3K75D 3HWTA 2KFZA 1HIWA 2RRDA 1KDHA 2KE7A 5F9LA 3WKCA 5ALLA 2GH1A 1ZQCA 4ED7A 3LVVA 2HDOA 2W11A 1Q3UA 2H3FA 4DEZA 5JU5A 1MN8A 8ICRA 5ALYA 5J0WA 4C8LA 1TAUA 5ALEA 2FLNA 7ICMA 3AU2A 1L8OA 3H40A 4DQIA 4DLEA 2VIXA 8ICMA 4GXJA 4OO1J 5AI8A 3HKZC 4KLMA 2J6SA 2V9WA 3J81j 1UPHA 3QU4A 5HP4A 2WHEA 4CGZA 2G08A 2DFLA 4F4KA 1YT3A 1L7PA 5HMLA 1X9WA 4KLOA 1NI3A 5DLGA 1LV5A 4LJXA 3H0LB 5AK5A 3D6JA 3AM9A 3FAHA 9ICUA 4JWNA 5AI6A 4Y2RA 3FC4A 2K4PA 2W9AA 3NRZA 5HHIA 3ZDAA 3ISDA 9ICQA 4MF8A 1AROP 2KSOA 7ICJA 4NWIA 4C8OA 2RP5A 5J0PA 2JRZA 2E8OA 4JK1A 2YMPA 2NRVA 3GV7B 2XI9A 1KN5A 2WB1F 2IHNA 2WTFA 1HEKA 1L3UA 4U7CA 1FFVA 3TAQA 4M6WB 4UAZA 3HW8A 3PX6A 2ZIVB 4BXOA 4YFKA 2YN4A 4DS5A 2J6UA 2DBYA 1N60A 4YG2A 1X9XA 2K8CB 1NK5A 3OHBA 3Q8SB 2FDRA 3OSPA 5ALTA 4QWBA 1SWVA 1PK1A 1Z1BA 5KFIA 3MFHA 1Z00B 3M9MB 2HW3A 5KNIA 1H38A 7ICGA 1QSYA 3MABA 2R8JA 2P6UA 4UW9A 3FDSA 2DKZA 3UMGA 1L7MA 3QNMA 1KLNA 3M9NB 3M8SA 4IRDA 1CEZA 4K4HA 1EXNA 3CYMA 1ZD4A 4ACOA 2JH7A 3HKZF 5ALGA 5BOMA 2JXJA 2KHQA 5DDMA 1ZD5A 4QZ9A 8ICEA 2WF7A 5DG9A 5J2KA 4KX3A 1SL2A 1L8LA 4P0PA 1T8EA 9ICKA 1MQ3A 2BQ3A 4QZIA 5JUMA 3C5FA 5D49A 3B9JA 2F76X 2P66A 4JB3A 5KFUA 3RF9A 2ZTDA 4O3RA 3Q8KA 2KV2A 3GIIA 1SL0A 5AIBA 2FPKA 5J0UA 1KFSA 2Y9UA 4KN7A 5AM5A 3AL0B 4YMOA 2LBOA 2QLTA 4B9NA 4PZNA 2NRWA 1ZQZA 3QU9A 4IR9A 3GQCA 1X6JA 4E0DA 2E8PA 1ZRMA 3QEAZ 1QCKA 5J0QA 2MAXA 2HOIA 9ICJA 3Q8LA 2W7OA 4HAIA 5D4BA 4P0QA 2LPEA 4QW8A 5KFEA 3RH5A 5AKZA 3TFRA 3EZ5A 2B6GA 5AK4A 2G06A 2R8IA 2KZ3A 3SR6A 4Z6EA 4QWEA 1OW5A 1T94A 4ED3A 2XGQA 3PSTA 3QU2A 2W9CB 5L1IA 5HR6A 2NYVA 1T4GA 2PFNA 2O6KA 3WK4A 3F2CA 2OHFA 2WFAA 1ZQQA 3I1YA 4PJ0U 1NZPA 4ICAA 3RJHA 4DFMA 3HJEA 4YN4A 2KSOB 3UM9A 4US8A 2EH9A 2XY7A 4I2DA 2F2AB 3BS7A 2W04A 2ASLA 3QYPA 3G6YA 5J29A 1VJ5A 4R65A 2EAMA 4B9SA 4B9VA 5L1JA 2HI0A 4FBTA 2KIVA 5T14A 1TKDA 5EE1A 4MEXA 1Z4OA 4Y2JA 1QQ6A 2C2EA 2IBKA 2KZMA 2L5YA 3TACB 9ICOA 4O0IA 7ICQA 3MFIA 5IIMA 2P35A 3TADC 1LKYB 3CW2C 3UXNA 4P4PA 4QZCA 2ZIWB 2FE9A 3M9OB 4DL3A 5L1KA 3GU3A 2YMQA 3FM9A 2FPMA 1ZQKA 5IILA 2PFOA 2IMWP 2KMDA 1MSWD 4F92B 5KG1A 4CF3A 3GIKA 2MUTA 2ZG6A 3K4GA 1BGXT 3VCBA 4EZ9A 1CUKA 2OH2A 5CB1A 2KK0A 8ICOA 5KFMA 4PGYA 8ICAA 5KFFA 3TARA 4DS4A 8ICWA 2RLTA 5KFYA 5ALRA 3LDAA 4Y2SA 4DL4A 2ZJ8A 4P0PB 4FBUA 3IRUA 4O3QA 4ED1A 5GTHU 3TADA 5CP2A 3PVXA 3NVYA 4R8UA 4TQRA 2ZIUB 2KD1A 3U26A 4GXKA 4B9LA 5DG7A 3WK5A 4JWMA 4IL6U 1BVSA 7ICEA 4J9QA 2WF5A 2ATLA 3SAFA 3KD3A 1J2NA 4YP3A 3HPOA 4RQ2A 3EUB2 4RQ5A 2AQ4A 5KT4A 3AQEA 3BQTA 1ZQTA 1D8YA 2VKQA 4BDPA 1JRPA 7ICVA 3AN1A 3ZI4A 4EZ6A 2ASDA 4P0QB 4RPXA 5ALSA 3H7IA 2LM4A 2KNJA 3PX0A 4YR2A 2NO5A 3H8WA 1N61A 1XO1A 1ZQBA 2AGOA 3L4PA 4FZNA 4DFDA 3PMLA 2ZUDA 4M9HA 1SV0C 3SV3A 3JPSA 4I28A 3PX4A 2AJQA 1L3TA 2UVRA 4IR1A 3C21A 4ED0A 3CRXA 1KFDA 1ZOLA 4KLFA 1DGJA 8ICKA 1XSPA 2H3IA 1PK3A 1ZQAA 1D8LA 5ALMA 2M0NA 1QH9A 2PFPA 3PR5B 2CXYA 1Z3EB 5KFAA 5CRXA 1X6IA 1O03A 2G0AA 2HBJA 2FMPA 4HYKA 7ICKA 2OM6A 4NLCA 2IOHA 1K1QA 1NJWA 1UT5A 5DB7A 2DPIA 4USAA 4F2SA 2OWOA 5AKYA 1NK8A 3S6JA 4EEKA 5J2EA 3RJJA 3DV9A 3JPTA 4P4OA 1RQLA 1SV0A 5CJ7A 4NY8A 1FIQA 3H0RB 1NK6A 3NS1A 3VC8A 3G6XA 1S9FA 4KLLA 2HHSA 7ICUA 3TFSA 4J9NA 3SZ2A 2K4HA 3T5HA 2KKPA 4LZGA 3Q8PB 3QE9Y 2OYYA 5KG5A 4Y2UA 1AQ6A 3V6KA 9ICVA 4TUSA 4RPYA 2JHDA 5ALQA 3T79A 5DGAA 8ICSA 9ICBA 1YZ6A 3ORYA 3PO4A 9ICAA 1IG6A 3KHHA 5KG0A 4RQ7A 5J0XA 4GC7A 4O3NA 5KFPA 1X9SA 1L6NA 2YY6A 2A1JA 4ELVA 2DGZA 3A0HU 3GIMA 1U4BA 2HHQA 4QZGA 2AXTU 4RNNA 3LVWA 4UATA 5IIIA 1Y88A 2KIWA 3HP6A 1DGSA 1ZD2P 2F1IA 2CPRA 1XSNA 1M6YA 2PXIA 2ZTCA 2HHUA 2EAOA 2KVCA 3H4DA 3EW9A 3OSNA 1WYGA 1LB2B 2MRLA 4KLGA 4Z6CA 1RG6A 4DSFA 3N7PD 5KT2A 4F5OA 3TANA 2YQEA 3RJIA 4PHDA 2XC9A 2GWSA 4US9A 5B5EU 3PW0A 4C4TA 2JEIA 1Q8KA 2HVIA 4P4MA 4F2RA 9ICXA 4JV0A 1NOMA 4KLIA 4J9SA 4NLNA 1ZQOA 5HR7A 2HHVA 5L1MA 1DRGA 5DQGA 7ICPA 2ZUBA 4BGDA 2B0CA 5BOLA 4KLSA 1BPEA 2VJ5A 5KFGA 4DSLA 4PGQA 1IV8A 5AI4A 3NVVA 1SGGA 4J9MA 3TI0A 4FS2A 5KFKA 4PH5A 4DQSA 1T3NA 4DFKA 3UPQA 4OJ5A 1KQQA 1C7YA 3PNCA 4JV1A 3AMZA 5L1LA 5D46A 4LVSA 9ICPA 5KFTA 3KBBA 2IHMA 4B9TA 4Q8EA 4ZOHC 4R66A 4KMUA 2W54A 2KJ8A 4C8NA 5J2DA 3BQ2A 8ICPA 4UB3A 4MFFA 4ECQA 1NK7A 1N5XA 4ECSA 4FE3A 4O9MA 2KKVA 5J0RA 2XCAA 3IG8A 2DF4B 2LMRA 1N48A 4RUAA 4DOBA 2ZTEA 5DGBA 2LKYA 5ALWA 1U45A 2EAPA 3SQIA 3WKEA 4EBCA 2FMQA 2W8LA 1N62A 2WF8A 2ZXIA 7ICRA 2DL0A 3NVWA 5KL1B 4ZH4A 2ZIXB 3GV8B 3T5KA 5AKGA 2E3TA 4J9RA 1N56A 4WJ3B 2W7PA 5KFDA 1RYRA 4XQ8A 1NKEA 1KBUA 1RM6C 3JPNA 4I29A 3A0BU 1LVHA 3V6JA 4UBBA 1A0PA 4M2YA 4IS7A 4QJFB 1KEJA 2F1JA 3N97B 5EE0A 5KAIU 4ED8A 2R8KA 4IRCA 3GIJA 8ICNA 2AU0A 4Q43A 2C28A 1ZQNA 4YD1A 3I76A 1ZQVA 5KFBA 1ZQ1C 4EENA 4JMUA 8ICUA 9ICEA 5F9NA 5AKEA 1U9LA 1JALA 3H8JA 4RQNA 3SI8A 3Q8QB 3E58A 1N2XA 4NXZA 2KP7A 3H8SA 1BNPA 4B9UA 3B0YA 4G9BA 5DB6A 2Q4TA 3Q8RB 4UAVA 4LZDA 4ECWA 1JX4A 4YMMA 1FEZA 5ALXA 1B22A 2K89A 1N63A 4F4ZA 1SWWA 2K60A 4CDGA 7ICIA 4ECTA 1ZQIA 2BCQA 2I9GA 2VA8A 5DBCA 5H2FU 2IOFK 3MGIA 5CR0A 2W9BA 3RH4A 5AM0A 8ICCA 1ZXIA 1D9DA 4OJOA 1WG8A 1KSPA 1A6SA 5AI0A 1S8OA 2JZBA 3OJUA 2R18A 5AKIA 4I2HA 3M7DA 5KL8B 4YQWA 3JPRA 4IQWA 5K4LA 5CHGA 3DDHA 4M9NA 4PPXA 3EPIA 4Z6DA 9ICCA 5J0TA 3Q8MA 7ICOA 4A8EA 2CN1A 2PMZC 3MR6A 2V4QA 3C5GA 3I28A 1DK2A 4O3OA 4PZOA 1A77A 4ELTA 4PHEA 1A76A 2WF6A 3BQ1A 2VA2A 2DKXA 3LK9A 1QTMA 4YR0A 2QB1A
chains in the Genus database with same CATH topology
3BS5A 3BQ7A 1DXSA 5L1MA 1OXJA 2KSOB 2D8CA 5J8YC 1Z1VA 3BS7A 5JRTA 2QARA 2QB0A 4MHVA 2D3DA 1WWVA 1SGGA 2EAMA 1COKA 3HILA 2F8KA 2E8NA 2KIVA 2K4PA 1WWUA 1UCVA 4RQNA 2KSOA 3KKAA 5F3XB 2KG5A 1SV4A 2L5YA 3TACB 1X40A 1SXEA 2E8OA 2Y9UA 3TADC 1LKYB 2ESEA 1LKYA 4PZNA 1JI7A 2FE9A 1SV0C 2YTUA 2K60A 2E8PA 1V38A 1V85A 5J8YA 1SXDA 1X66A 2KMDA 3K1RB 2E8MA 2GLEA 3IDWA 2LMRA 4NJ8A 3SENA 2KE7A 2LPEA 3SEIA 1PK3A 2EAPA 2B6GA 2EAOA 4RQMA 1F0MA 3H8MA 4NL9C 1KW4A 2EANA 1X9XA 1OW5A 2JV3A 2DL0A 1PK1B 1B0XA 1PK1A 2ES6A 5JU5A 1RG6A 5JTIA 5KNIA 2F44A 3KKAC 2F3NA 2QARB 2QKQA 2QB0B 4PZOA 2Y9TA 2DKZA 3TADA 1B4FA 4NL9A 4IS7A 2DKXA 1SV0A 3BS5B 1UQVA 2QB1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BS5 A;  3BQ7 A;  1DXS A;  5L1M A;  1OXJ A;  2KSO B;  2D8C A;  5J8Y C;  1Z1V A;  3BS7 A;  5JRT A;  2QAR A;  2QB0 A;  4MHV A;  2D3D A;  1WWV A;  1SGG A;  2EAM A;  1COK A;  3HIL A;  2F8K A;  2E8N A;  2KIV A;  2K4P A;  1WWU A;  1UCV A;  4RQN A;  2KSO A;  3KKA A;  5F3X B;  2KG5 A;  1SV4 A;  2L5Y A;  3TAC B;  1X40 A;  1SXE A;  2E8O A;  2Y9U A;  3TAD C;  1LKY B;  2ESE A;  1LKY A;  4PZN A;  1JI7 A;  2FE9 A;  1SV0 C;  2YTU A;  2K60 A;  2E8P A;  1V38 A;  1V85 A;  5J8Y A;  1SXD A;  1X66 A;  2KMD A;  3K1R B;  2E8M A;  2GLE A;  3IDW A;  2LMR A;  4NJ8 A;  3SEN A;  2KE7 A;  2LPE A;  3SEI A;  1PK3 A;  2EAP A;  2B6G A;  2EAO A;  4RQM A;  1F0M A;  3H8M A;  4NL9 C;  1KW4 A;  2EAN A;  1X9X A;  1OW5 A;  2JV3 A;  2DL0 A;  1PK1 B;  1B0X A;  1PK1 A;  2ES6 A;  5JU5 A;  1RG6 A;  5JTI A;  5KNI A;  2F44 A;  3KKA C;  2F3N A;  2QAR B;  2QKQ A;  2QB0 B;  4PZO A;  2Y9T A;  2DKZ A;  3TAD A;  1B4F A;  4NL9 A;  4IS7 A;  2DKX A;  1SV0 A;  3BS5 B;  1UQV A;  2QB1 A; 
#chains in the Genus database with same CATH topology
 2KN7 A;  4B6J A;  5J8Y C;  1L7N A;  5AM4 A;  1CI4 A;  4QIW C;  1FFU A;  3CP8 A;  4C8M A;  4DFP A;  1TV9 A;  5KFQ A;  4M9J A;  1J97 A;  2BCR A;  4I27 A;  1ZQY A;  3HIL A;  2BPG A;  3LWM A;  2HSZ A;  4RQ4 A;  5KG4 A;  1WCN A;  3ZD8 A;  2BQR A;  1WWU A;  4ELU A;  3WK7 A;  4BJQ A;  2XIC A;  1ECW A;  9ICT A;  5ALH A;  4Y2T A;  2Y1J A;  1SKW A;  3C23 A;  5ALV A;  4Q8F A;  2F8L A;  2PI5 A;  4IRK A;  4F71 A;  3N28 A;  3ICX A;  1XU4 A;  4NLK A;  3HT3 A;  1S77 D;  3MDA A;  5CEH A;  1YZ7 A;  2MU2 A;  4RZR A;  1NNL A;  3PMN A;  5J8Y A;  4MEY A;  2JGA A;  5DKW A;  1IM4 A;  5DBA A;  5KG7 A;  1ZRN A;  2E8M A;  3ISC A;  4BXO B;  4XA5 A;  4M47 A;  3SEN A;  4DL2 A;  4O3M A;  4GLX A;  1J2M A;  3R9K A;  4OJP A;  1BPX A;  3BZC A;  1KW4 A;  3QUQ A;  5AIC A;  1PK1 B;  4O5E A;  3IV6 A;  1TE2 A;  2EZZ A;  1FO4 A;  5J0O A;  3NTU A;  1JN3 A;  3RAX A;  2BPC A;  4UAW A;  7ICT A;  2W43 A;  1KKX A;  4QWD A;  4QWC A;  4NL9 A;  1ZQG A;  2PMZ F;  4DLG A;  1XS9 D;  1TK5 A;  3JPP A;  4RQ6 A;  3KTQ A;  1S0M A;  5KFR A;  3BS5 A;  8ICL A;  1KRP A;  1L5U A;  1S5L U;  4EYH B;  3IHQ B;  1QQ7 A;  3PW4 A;  4DF8 A;  3KHL A;  4FS1 A;  2KHV A;  2R8H A;  1S0V A;  1RDF A;  2D3D A;  2FPL A;  2AQ0 A;  5ALK A;  4QIW F;  3RJE A;  3RBE A;  4I2A A;  4KMO B;  4EX7 A;  2E8N A;  1URJ A;  2ISP A;  1UCV A;  5AM2 A;  5KT5 A;  4ECX A;  5ALD A;  4ED6 A;  5KG2 A;  3NAS A;  4CF4 A;  4F5Q A;  4DSI A;  5HMM A;  2BPF A;  2JZB B;  4BWM A;  1XWL A;  3M6Z A;  1SB3 C;  4EEL A;  3N7S C;  4MF2 A;  5AM3 A;  4BUG A;  4QW9 A;  1NKC A;  4I2J A;  5HHH A;  2W03 A;  4U6P A;  7ICH A;  4TUP A;  5KFH A;  3QZ7 A;  4NM2 A;  2Z7J A;  4UBC A;  1SIJ A;  3GFK B;  4KIT B;  2EQY A;  1U48 A;  3E0F A;  4QNL A;  2NRZ A;  4F72 A;  2ZJA A;  4Y2Q A;  4RPZ A;  1ZJN A;  2F1H A;  3CNH A;  3H8M A;  4Y2V A;  3T5J A;  2XO7 A;  4ECR A;  4F91 B;  4J9O A;  1RQN A;  3IN5 A;  4UB2 A;  4O5K A;  2HCF A;  3H4B A;  2EDU A;  4QZE A;  2GOL A;  1B0X A;  3G6V A;  1TAQ A;  8ICT A;  4TUR A;  4Q44 A;  4AYB C;  5J0S A;  5AIA A;  3KHR A;  1PVP A;  9ICW A;  4KTQ A;  3ZDE A;  3ISB A;  3V7L A;  8ICJ A;  1B4F A;  2G09 A;  5G5G A;  4DOC A;  4ECZ A;  2K4I A;  2HOF A;  5AHX A;  2GO7 A;  4BX9 C;  3AU6 A;  4KX5 A;  7ICL A;  1ZD3 A;  2B21 A;  2FLL A;  4KN4 A;  4Y2Y A;  4G3I A;  5AKK A;  3AEV A;  5J2B A;  3SYZ A;  5IIN A;  8ICX A;  2QB0 A;  1L3V A;  4MHV A;  2ODG A;  1WWV A;  5E79 U;  4F4X A;  5HNK A;  3IP4 B;  4QZA A;  1V97 A;  2PKE A;  3MR3 A;  1JXE A;  4F5N A;  1O08 A;  5A0L A;  3WKA A;  2P6R A;  5F3X B;  3C2K A;  1JXL A;  2RQ5 A;  5KAF U;  2ESE A;  2I1Q A;  3BDP A;  5ALP A;  2AGQ A;  5DBB A;  3EPG A;  2C2R A;  3UXO A;  5J2H A;  1RYS A;  2BDP A;  5EWE A;  3AUO A;  1P7D A;  3C2L A;  1SL1 A;  1X66 A;  2HMX A;  1ZQJ A;  4DQR A;  3IDW A;  2MUT B;  5KFV A;  4M6W A;  3RB0 A;  2XY5 A;  3PSF A;  3V6H A;  3C1Y A;  3N4M B;  1S10 A;  3ETL A;  4QZ8 A;  2BZF A;  4YD2 A;  4TUQ A;  3L5K A;  2K4E A;  3V7K A;  3OGU A;  1F5S A;  4RT2 A;  4I2B A;  2YML A;  4F5R A;  2DPJ A;  2W55 A;  3PY8 A;  3F5A A;  1MA7 A;  4OD0 A;  1X2I A;  3PW7 A;  2AGP A;  4R8U B;  2W3R A;  4AYB F;  1HUO A;  5KFZ A;  4CCH A;  3WKD A;  5AKJ A;  2MSN A;  4J9K A;  2EZY A;  5EE3 A;  1NKB A;  1BNO A;  1OXJ A;  2JEF A;  4JUZ A;  4NM1 A;  3GV5 B;  2RDJ A;  1NJY A;  1JMS A;  1S76 D;  1TK0 A;  4J9P A;  5JRT A;  4EX6 A;  5AKL A;  2OCE A;  3ZDC A;  3NVZ A;  3PSI A;  1DK3 A;  1VLB A;  1ED1 A;  2NRX A;  2HBM A;  2KVS A;  9ICI A;  5DQI A;  1NK9 A;  3MR5 A;  4X5V A;  5J2J A;  4QZD A;  1IXR A;  4FZL A;  1K1S A;  4QZF A;  3T3F A;  2FLP A;  3QU7 A;  4O5C A;  2KIC A;  5J2F A;  1PUZ A;  2I6X A;  2H3Q A;  1PVQ A;  4UB1 A;  4ED2 A;  3OTQ A;  5KFS A;  4BWJ A;  4F93 B;  5KG6 A;  2PI4 A;  4NLG A;  3UMB A;  4J9L A;  2JR5 A;  3RB3 A;  1ZQE A;  2GLE A;  3JPQ A;  3QEB Z;  5ALZ A;  3IG5 A;  1N5W A;  2EZX A;  2R8G A;  9ICR A;  4RNM A;  3SAG A;  5KT7 A;  4DOA A;  4O3P A;  5KT3 A;  5KFO A;  2RDI A;  3ETR A;  2WF9 A;  2OEH A;  8ICI A;  1L3S A;  2D6F C;  4UB8 U;  2ES6 A;  2VJ4 A;  3UMC A;  4YXJ A;  4ECV A;  2UVV A;  3PZP A;  2F44 A;  3MBY A;  2QB0 B;  2W9C A;  4DL6 A;  1X9M A;  1QSL A;  1XSL A;  2A1A A;  5ALI A;  2V4R A;  4YXM A;  4DO9 A;  2W9M A;  4PGX A;  3BQ7 A;  4GIB A;  4CRX A;  1Z4N A;  5DLF A;  3RBD A;  5CWR A;  3RH6 A;  4M04 A;  2JH1 A;  5AKX A;  4IQU A;  2BQU A;  3F2B A;  2QAR A;  1B43 A;  3UXP A;  4FO6 A;  2DWQ A;  1TK8 A;  4CNQ A;  3MGH A;  3LWL A;  5IIJ A;  1KTQ A;  2E1E A;  4RQ1 A;  4B9M A;  4XRH A;  3OHA A;  2BKE A;  5KFX A;  2KG5 A;  4YCX A;  4UAU A;  5C0Y A;  1ZQD A;  1X40 A;  4EBD A;  5AM1 A;  2ALZ A;  2Y1I A;  2YB1 A;  2Y0S C;  3C28 A;  3FYH A;  3RTV A;  2A1J B;  3UQ0 A;  1LKY A;  1BPY A;  1JI7 A;  2KZZ A;  2A19 A;  3GZF A;  3PSP A;  2ZIW A;  4NLZ A;  2J6T A;  1V38 A;  1V85 A;  3RRG A;  4DCC A;  7ICF A;  2PFQ A;  5EE9 A;  2YX8 A;  3BQ0 A;  3NUQ A;  3K1R B;  4OJL A;  8ICG A;  3F53 A;  1D8B A;  5J2I A;  2AHO B;  1OUQ A;  2FI1 A;  1MC8 A;  3SEI A;  3BJY A;  4O3S A;  1S0O A;  3PV8 A;  1ZQS A;  3RJG A;  1RPL A;  3KOO A;  1SZH A;  1S0N A;  2XCP A;  4NV0 A;  4KLJ A;  1RZT A;  1U49 A;  1NK0 A;  4C4R A;  5FP0 A;  4I2I A;  5KFC A;  5JTI A;  4C8K A;  4Q45 A;  4GFJ A;  4Y2X A;  4UAR A;  1RXV A;  3TAP A;  3AQF A;  4CE6 A;  3MC1 A;  4M9G A;  4KLH A;  3RJF A;  9ICM A;  2FMS A;  2Q0Z X;  2ZIU A;  2A3V A;  4KLE A;  2E1F A;  2G07 A;  2WAQ C;  4DWI A;  2H3V A;  4C0Z A;  1UA0 A;  2BDU A;  1D9F A;  5AI5 A;  7ICS A;  2CRX A;  2IOF A;  3H0M B;  2UVU A;  1WCL A;  3QZ8 A;  3C1Z A;  1ZYQ A;  9ICL A;  2NO4 A;  4RU9 A;  4K4G A;  4DFJ A;  3RFA A;  3E2E A;  4R63 A;  3UQ2 A;  1TFR A;  2LYB A;  1GO3 F;  4ECU A;  4I2C A;  4XUS A;  4I2G A;  5KG3 A;  2G5H B;  2LI6 A;  1XNS A;  2F77 X;  3NGD A;  5J2C A;  5ALN A;  2LYH A;  3ED5 A;  4C7Z A;  3WK9 A;  1NJZ A;  2Y0S F;  2AH5 A;  3M8R A;  4DQQ A;  2HHW A;  1QSS A;  1KL9 A;  2ZXH A;  4MFC A;  5DG8 A;  5KFN A;  5IIO A;  3M6K A;  1BPD A;  4AP9 A;  2XID A;  4M9L A;  4RQM A;  1ZQF A;  1ZQR A;  3ZDB A;  4NL9 C;  3GIL A;  8ICB A;  3PW5 A;  3TQ1 A;  2BHN A;  1KFT A;  3JPO A;  3V7J A;  1ZQH A;  5ALU A;  2F3N A;  2W8K A;  2QAR B;  3QUC A;  4DQP A;  1X42 A;  2YMM A;  3K1Z A;  1ZQL A;  1SKR A;  2G5I B;  4UAY A;  2YB4 A;  1UA1 A;  1T3Q A;  4KLU A;  2DQN B;  4GC6 A;  4DL7 A;  2C22 A;  3F2D A;  1DXS A;  2KEY A;  5AK3 A;  1V9P A;  2WAQ F;  1XC9 A;  3RB6 A;  4RUC A;  5KT6 A;  4Y2P A;  3ZD9 A;  8ICY A;  1COK A;  4ECY A;  5AK6 A;  2ZJ5 A;  4CF5 A;  2C2D A;  1UHU A;  5DDY A;  4C7Y A;  3WK6 A;  3L3F X;  3T5L A;  3SD7 A;  2VAN A;  3OPX A;  4TQS A;  1L7O A;  3LYS A;  9ICH A;  7ICN A;  1JIH A;  5L9X A;  1BPB A;  2MA1 A;  4PL1 A;  1NZB A;  4I2E A;  4EEY A;  1SZP A;  4OCZ A;  2HHT A;  2OXO A;  2M9N A;  3ZDD A;  4RQ8 A;  3QX7 A;  1JRO A;  3D2Q A;  3WKB A;  4PL2 A;  2LM1 A;  4R64 A;  1DOQ A;  2K8B B;  3MGV A;  3N7R C;  5AI9 A;  4KLD A;  1MQ2 A;  5KFJ A;  2W9B B;  4DSJ A;  4DF4 A;  1BPZ A;  4NJ8 A;  5DQH A;  3PO5 A;  1K5O A;  1ZQP A;  4QZH A;  8ICV A;  1RYU A;  5EWG A;  3B0X A;  3KZX A;  2KOB A;  4F3O A;  4RT3 A;  4QZB A;  4KLT A;  1PVR A;  2NV3 A;  2JV3 A;  5DB9 A;  4RQ0 A;  2KJ5 A;  2E5S A;  5ALO A;  3WU2 U;  3KFU F;  2XGP A;  8ICF A;  3HRD D;  3HX0 A;  3GDX A;  4UB6 U;  4EBE A;  2HVH A;  3OJS A;  4F50 A;  1ZJM A;  2N1R A;  3O0F A;  3WK8 A;  9ICS A;  1ZQW A;  3M1Y A;  1T7P A;  1UQV A;  5EWF A;  3ONN A;  4MFA A;  4PHA A;  4NLB A;  9ICG A;  4I2F A;  4Z6F A;  1QQ5 A;  1ZET A;  1Q46 A;  2BCU A;  4F4Y A;  2XY6 A;  1Z1V A;  3ALR A;  2W3S A;  1S97 A;  1QLN A;  3THV A;  1PZN A;  3KZI U;  2KFN A;  5ALJ A;  4EYI B;  2F8K A;  2HBK A;  1COO A;  9ICN A;  4RQ3 A;  2LHT A;  4QWA A;  2ISO A;  5KFL A;  3V72 A;  4C80 A;  1Z19 A;  1JUD A;  2BR0 A;  5ALF A;  3SMV A;  5J2G A;  3MR2 A;  2I5H A;  3DEE A;  3QXG A;  4PHP A;  4J03 A;  3D2S A;  2HBL A;  4FZM A;  3QUT A;  4UQG A;  3RRH A;  4K4I A;  4OJ6 A;  4DSK A;  4YVZ A;  4IQV A;  3NRW A;  1TAM A;  4M0A A;  9ICF A;  1UT8 A;  1NK4 A;  2YTU A;  2HHX A;  4GXI A;  1SXD A;  8ICZ A;  2HOQ A;  1XO0 A;  1NJX A;  4UB5 A;  8ICH A;  4UAS A;  1U47 A;  4YMN A;  1VDV A;  1F0M A;  2KTQ A;  1IIP A;  2EAN A;  4IQT A;  3RR7 A;  8ICQ A;  2H5X A;  2ZIX A;  3RR8 A;  3C29 A;  3KKA C;  4IC9 A;  2JEJ A;  4F8R A;  5DB8 A;  2QKQ A;  3QUB A;  4JV2 A;  2Y9T A;  2ZIV A;  4UB4 A;  1HUZ A;  4P2H A;  3TKA A;  2DUY A;  5C5J A;  3BS5 B;  3SAH A;  5KFW A;  4RNO A;  5GTI U;  1CRX A;  3IM1 A;  1WUD A;  2D8C A;  3KHG A;  2FJ6 A;  1C20 A;  1RXW A;  3RJK A;  2BGW A;  1Z00 A;  1HJP A;  4F5P A;  1TVA A;  3EYZ A;  5KTQ A;  3PR4 A;  1F44 A;  2NRT A;  1ZQX A;  3D2N A;  3SV4 A;  4DSE A;  5TIS U;  5TZV A;  2IA6 A;  2UVW A;  2JEG A;  5AKH A;  2XVT A;  3KKA A;  5CA7 A;  3RAQ A;  1SV4 A;  2ASJ A;  1Q3V A;  4FFD A;  3PW2 A;  5IIK A;  2KJ9 A;  1SXE A;  2K8A A;  3MDC A;  2H3Z A;  2LYA A;  2WB1 C;  2RHF A;  2VA3 A;  3EWA A;  1ZQM A;  3F5E A;  5BPC A;  2BCS A;  4C4S A;  5J2A A;  3C2M A;  2ZUC A;  5B66 U;  5EOZ A;  3QU5 A;  4YR3 A;  5J0Y A;  4F4W A;  4KLQ A;  2JMG A;  4DL5 A;  5G5H A;  1SKS A;  3BZK A;  3RB4 A;  1ZQU A;  2BCV A;  3K75 D;  3HWT A;  2KFZ A;  1HIW A;  2RRD A;  1KDH A;  2KE7 A;  5F9L A;  3WKC A;  5ALL A;  2GH1 A;  1ZQC A;  4ED7 A;  3LVV A;  2HDO A;  2W11 A;  1Q3U A;  2H3F A;  4DEZ A;  5JU5 A;  1MN8 A;  8ICR A;  5ALY A;  5J0W A;  4C8L A;  1TAU A;  5ALE A;  2FLN A;  7ICM A;  3AU2 A;  1L8O A;  3H40 A;  4DQI A;  4DLE A;  2VIX A;  8ICM A;  4GXJ A;  4OO1 J;  5AI8 A;  3HKZ C;  4KLM A;  2J6S A;  2V9W A;  3J81 j;  1UPH A;  3QU4 A;  5HP4 A;  2WHE A;  4CGZ A;  2G08 A;  2DFL A;  4F4K A;  1YT3 A;  1L7P A;  5HML A;  1X9W A;  4KLO A;  1NI3 A;  5DLG A;  1LV5 A;  4LJX A;  3H0L B;  5AK5 A;  3D6J A;  3AM9 A;  3FAH A;  9ICU A;  4JWN A;  5AI6 A;  4Y2R A;  3FC4 A;  2K4P A;  2W9A A;  3NRZ A;  5HHI A;  3ZDA A;  3ISD A;  9ICQ A;  4MF8 A;  1ARO P;  2KSO A;  7ICJ A;  4NWI A;  4C8O A;  2RP5 A;  5J0P A;  2JRZ A;  2E8O A;  4JK1 A;  2YMP A;  2NRV A;  3GV7 B;  2XI9 A;  1KN5 A;  2WB1 F;  2IHN A;  2WTF A;  1HEK A;  1L3U A;  4U7C A;  1FFV A;  3TAQ A;  4M6W B;  4UAZ A;  3HW8 A;  3PX6 A;  2ZIV B;  4BXO A;  4YFK A;  2YN4 A;  4DS5 A;  2J6U A;  2DBY A;  1N60 A;  4YG2 A;  1X9X A;  2K8C B;  1NK5 A;  3OHB A;  3Q8S B;  2FDR A;  3OSP A;  5ALT A;  4QWB A;  1SWV A;  1PK1 A;  1Z1B A;  5KFI A;  3MFH A;  1Z00 B;  3M9M B;  2HW3 A;  5KNI A;  1H38 A;  7ICG A;  1QSY A;  3MAB A;  2R8J A;  2P6U A;  4UW9 A;  3FDS A;  2DKZ A;  3UMG A;  1L7M A;  3QNM A;  1KLN A;  3M9N B;  3M8S A;  4IRD A;  1CEZ A;  4K4H A;  1EXN A;  3CYM A;  1ZD4 A;  4ACO A;  2JH7 A;  3HKZ F;  5ALG A;  5BOM A;  2JXJ A;  2KHQ A;  5DDM A;  1ZD5 A;  4QZ9 A;  8ICE A;  2WF7 A;  5DG9 A;  5J2K A;  4KX3 A;  1SL2 A;  1L8L A;  4P0P A;  1T8E A;  9ICK A;  1MQ3 A;  2BQ3 A;  4QZI A;  5JUM A;  3C5F A;  5D49 A;  3B9J A;  2F76 X;  2P66 A;  4JB3 A;  5KFU A;  3RF9 A;  2ZTD A;  4O3R A;  3Q8K A;  2KV2 A;  3GII A;  1SL0 A;  5AIB A;  2FPK A;  5J0U A;  1KFS A;  2Y9U A;  4KN7 A;  5AM5 A;  3AL0 B;  4YMO A;  2LBO A;  2QLT A;  4B9N A;  4PZN A;  2NRW A;  1ZQZ A;  3QU9 A;  4IR9 A;  3GQC A;  1X6J A;  4E0D A;  2E8P A;  1ZRM A;  3QEA Z;  1QCK A;  5J0Q A;  2MAX A;  2HOI A;  9ICJ A;  3Q8L A;  2W7O A;  4HAI A;  5D4B A;  4P0Q A;  2LPE A;  4QW8 A;  5KFE A;  3RH5 A;  5AKZ A;  3TFR A;  3EZ5 A;  2B6G A;  5AK4 A;  2G06 A;  2R8I A;  2KZ3 A;  3SR6 A;  4Z6E A;  4QWE A;  1OW5 A;  1T94 A;  4ED3 A;  2XGQ A;  3PST A;  3QU2 A;  2W9C B;  5L1I A;  5HR6 A;  2NYV A;  1T4G A;  2PFN A;  2O6K A;  3WK4 A;  3F2C A;  2OHF A;  2WFA A;  1ZQQ A;  3I1Y A;  4PJ0 U;  1NZP A;  4ICA A;  3RJH A;  4DFM A;  3HJE A;  4YN4 A;  2KSO B;  3UM9 A;  4US8 A;  2EH9 A;  2XY7 A;  4I2D A;  2F2A B;  3BS7 A;  2W04 A;  2ASL A;  3QYP A;  3G6Y A;  5J29 A;  1VJ5 A;  4R65 A;  2EAM A;  4B9S A;  4B9V A;  5L1J A;  2HI0 A;  4FBT A;  2KIV A;  5T14 A;  1TKD A;  5EE1 A;  4MEX A;  1Z4O A;  4Y2J A;  1QQ6 A;  2C2E A;  2IBK A;  2KZM A;  2L5Y A;  3TAC B;  9ICO A;  4O0I A;  7ICQ A;  3MFI A;  5IIM A;  2P35 A;  3TAD C;  1LKY B;  3CW2 C;  3UXN A;  4P4P A;  4QZC A;  2ZIW B;  2FE9 A;  3M9O B;  4DL3 A;  5L1K A;  3GU3 A;  2YMQ A;  3FM9 A;  2FPM A;  1ZQK A;  5IIL A;  2PFO A;  2IMW P;  2KMD A;  1MSW D;  4F92 B;  5KG1 A;  4CF3 A;  3GIK A;  2MUT A;  2ZG6 A;  3K4G A;  1BGX T;  3VCB A;  4EZ9 A;  1CUK A;  2OH2 A;  5CB1 A;  2KK0 A;  8ICO A;  5KFM A;  4PGY A;  8ICA A;  5KFF A;  3TAR A;  4DS4 A;  8ICW A;  2RLT A;  5KFY A;  5ALR A;  3LDA A;  4Y2S A;  4DL4 A;  2ZJ8 A;  4P0P B;  4FBU A;  3IRU A;  4O3Q A;  4ED1 A;  5GTH U;  3TAD A;  5CP2 A;  3PVX A;  3NVY A;  4R8U A;  4TQR A;  2ZIU B;  2KD1 A;  3U26 A;  4GXK A;  4B9L A;  5DG7 A;  3WK5 A;  4JWM A;  4IL6 U;  1BVS A;  7ICE A;  4J9Q A;  2WF5 A;  2ATL A;  3SAF A;  3KD3 A;  1J2N A;  4YP3 A;  3HPO A;  4RQ2 A;  3EUB 2;  4RQ5 A;  2AQ4 A;  5KT4 A;  3AQE A;  3BQT A;  1ZQT A;  1D8Y A;  2VKQ A;  4BDP A;  1JRP A;  7ICV A;  3AN1 A;  3ZI4 A;  4EZ6 A;  2ASD A;  4P0Q B;  4RPX A;  5ALS A;  3H7I A;  2LM4 A;  2KNJ A;  3PX0 A;  4YR2 A;  2NO5 A;  3H8W A;  1N61 A;  1XO1 A;  1ZQB A;  2AGO A;  3L4P A;  4FZN A;  4DFD A;  3PML A;  2ZUD A;  4M9H A;  1SV0 C;  3SV3 A;  3JPS A;  4I28 A;  3PX4 A;  2AJQ A;  1L3T A;  2UVR A;  4IR1 A;  3C21 A;  4ED0 A;  3CRX A;  1KFD A;  1ZOL A;  4KLF A;  1DGJ A;  8ICK A;  1XSP A;  2H3I A;  1PK3 A;  1ZQA A;  1D8L A;  5ALM A;  2M0N A;  1QH9 A;  2PFP A;  3PR5 B;  2CXY A;  1Z3E B;  5KFA A;  5CRX A;  1X6I A;  1O03 A;  2G0A A;  2HBJ A;  2FMP A;  4HYK A;  7ICK A;  2OM6 A;  4NLC A;  2IOH A;  1K1Q A;  1NJW A;  1UT5 A;  5DB7 A;  2DPI A;  4USA A;  4F2S A;  2OWO A;  5AKY A;  1NK8 A;  3S6J A;  4EEK A;  5J2E A;  3RJJ A;  3DV9 A;  3JPT A;  4P4O A;  1RQL A;  1SV0 A;  5CJ7 A;  4NY8 A;  1FIQ A;  3H0R B;  1NK6 A;  3NS1 A;  3VC8 A;  3G6X A;  1S9F A;  4KLL A;  2HHS A;  7ICU A;  3TFS A;  4J9N A;  3SZ2 A;  2K4H A;  3T5H A;  2KKP A;  4LZG A;  3Q8P B;  3QE9 Y;  2OYY A;  5KG5 A;  4Y2U A;  1AQ6 A;  3V6K A;  9ICV A;  4TUS A;  4RPY A;  2JHD A;  5ALQ A;  3T79 A;  5DGA A;  8ICS A;  9ICB A;  1YZ6 A;  3ORY A;  3PO4 A;  9ICA A;  1IG6 A;  3KHH A;  5KG0 A;  4RQ7 A;  5J0X A;  4GC7 A;  4O3N A;  5KFP A;  1X9S A;  1L6N A;  2YY6 A;  2A1J A;  4ELV A;  2DGZ A;  3A0H U;  3GIM A;  1U4B A;  2HHQ A;  4QZG A;  2AXT U;  4RNN A;  3LVW A;  4UAT A;  5III A;  1Y88 A;  2KIW A;  3HP6 A;  1DGS A;  1ZD2 P;  2F1I A;  2CPR A;  1XSN A;  1M6Y A;  2PXI A;  2ZTC A;  2HHU A;  2EAO A;  2KVC A;  3H4D A;  3EW9 A;  3OSN A;  1WYG A;  1LB2 B;  2MRL A;  4KLG A;  4Z6C A;  1RG6 A;  4DSF A;  3N7P D;  5KT2 A;  4F5O A;  3TAN A;  2YQE A;  3RJI A;  4PHD A;  2XC9 A;  2GWS A;  4US9 A;  5B5E U;  3PW0 A;  4C4T A;  2JEI A;  1Q8K A;  2HVI A;  4P4M A;  4F2R A;  9ICX A;  4JV0 A;  1NOM A;  4KLI A;  4J9S A;  4NLN A;  1ZQO A;  5HR7 A;  2HHV A;  5L1M A;  1DRG A;  5DQG A;  7ICP A;  2ZUB A;  4BGD A;  2B0C A;  5BOL A;  4KLS A;  1BPE A;  2VJ5 A;  5KFG A;  4DSL A;  4PGQ A;  1IV8 A;  5AI4 A;  3NVV A;  1SGG A;  4J9M A;  3TI0 A;  4FS2 A;  5KFK A;  4PH5 A;  4DQS A;  1T3N A;  4DFK A;  3UPQ A;  4OJ5 A;  1KQQ A;  1C7Y A;  3PNC A;  4JV1 A;  3AMZ A;  5L1L A;  5D46 A;  4LVS A;  9ICP A;  5KFT A;  3KBB A;  2IHM A;  4B9T A;  4Q8E A;  4ZOH C;  4R66 A;  4KMU A;  2W54 A;  2KJ8 A;  4C8N A;  5J2D A;  3BQ2 A;  8ICP A;  4UB3 A;  4MFF A;  4ECQ A;  1NK7 A;  1N5X A;  4ECS A;  4FE3 A;  4O9M A;  2KKV A;  5J0R A;  2XCA A;  3IG8 A;  2DF4 B;  2LMR A;  1N48 A;  4RUA A;  4DOB A;  2ZTE A;  5DGB A;  2LKY A;  5ALW A;  1U45 A;  2EAP A;  3SQI A;  3WKE A;  4EBC A;  2FMQ A;  2W8L A;  1N62 A;  2WF8 A;  2ZXI A;  7ICR A;  2DL0 A;  3NVW A;  5KL1 B;  4ZH4 A;  2ZIX B;  3GV8 B;  3T5K A;  5AKG A;  2E3T A;  4J9R A;  1N56 A;  4WJ3 B;  2W7P A;  5KFD A;  1RYR A;  4XQ8 A;  1NKE A;  1KBU A;  1RM6 C;  3JPN A;  4I29 A;  3A0B U;  1LVH A;  3V6J A;  4UBB A;  1A0P A;  4M2Y A;  4IS7 A;  4QJF B;  1KEJ A;  2F1J A;  3N97 B;  5EE0 A;  5KAI U;  4ED8 A;  2R8K A;  4IRC A;  3GIJ A;  8ICN A;  2AU0 A;  4Q43 A;  2C28 A;  1ZQN A;  4YD1 A;  3I76 A;  1ZQV A;  5KFB A;  1ZQ1 C;  4EEN A;  4JMU A;  8ICU A;  9ICE A;  5F9N A;  5AKE A;  1U9L A;  1JAL A;  3H8J A;  4RQN A;  3SI8 A;  3Q8Q B;  3E58 A;  1N2X A;  4NXZ A;  2KP7 A;  3H8S A;  1BNP A;  4B9U A;  3B0Y A;  4G9B A;  5DB6 A;  2Q4T A;  3Q8R B;  4UAV A;  4LZD A;  4ECW A;  1JX4 A;  4YMM A;  1FEZ A;  5ALX A;  1B22 A;  2K89 A;  1N63 A;  4F4Z A;  1SWW A;  2K60 A;  4CDG A;  7ICI A;  4ECT A;  1ZQI A;  2BCQ A;  2I9G A;  2VA8 A;  5DBC A;  5H2F U;  2IOF K;  3MGI A;  5CR0 A;  2W9B A;  3RH4 A;  5AM0 A;  8ICC A;  1ZXI A;  1D9D A;  4OJO A;  1WG8 A;  1KSP A;  1A6S A;  5AI0 A;  1S8O A;  2JZB A;  3OJU A;  2R18 A;  5AKI A;  4I2H A;  3M7D A;  5KL8 B;  4YQW A;  3JPR A;  4IQW A;  5K4L A;  5CHG A;  3DDH A;  4M9N A;  4PPX A;  3EPI A;  4Z6D A;  9ICC A;  5J0T A;  3Q8M A;  7ICO A;  4A8E A;  2CN1 A;  2PMZ C;  3MR6 A;  2V4Q A;  3C5G A;  3I28 A;  1DK2 A;  4O3O A;  4PZO A;  1A77 A;  4ELT A;  4PHE A;  1A76 A;  2WF6 A;  3BQ1 A;  2VA2 A;  2DKX A;  3LK9 A;  1QTM A;  4YR0 A;  2QB1 A; 
#chains in the Genus database with same CATH homology
 3BS5 A;  3BQ7 A;  1DXS A;  5L1M A;  1OXJ A;  2KSO B;  2D8C A;  5J8Y C;  1Z1V A;  3BS7 A;  5JRT A;  2QAR A;  2QB0 A;  4MHV A;  2D3D A;  1WWV A;  1SGG A;  2EAM A;  1COK A;  3HIL A;  2F8K A;  2E8N A;  2KIV A;  2K4P A;  1WWU A;  1UCV A;  4RQN A;  2KSO A;  3KKA A;  5F3X B;  2KG5 A;  1SV4 A;  2L5Y A;  3TAC B;  1X40 A;  1SXE A;  2E8O A;  2Y9U A;  3TAD C;  1LKY B;  2ESE A;  1LKY A;  4PZN A;  1JI7 A;  2FE9 A;  1SV0 C;  2YTU A;  2K60 A;  2E8P A;  1V38 A;  1V85 A;  5J8Y A;  1SXD A;  1X66 A;  2KMD A;  3K1R B;  2E8M A;  2GLE A;  3IDW A;  2LMR A;  4NJ8 A;  3SEN A;  2KE7 A;  2LPE A;  3SEI A;  1PK3 A;  2EAP A;  2B6G A;  2EAO A;  4RQM A;  1F0M A;  3H8M A;  4NL9 C;  1KW4 A;  2EAN A;  1X9X A;  1OW5 A;  2JV3 A;  2DL0 A;  1PK1 B;  1B0X A;  1PK1 A;  2ES6 A;  5JU5 A;  1RG6 A;  5JTI A;  5KNI A;  2F44 A;  3KKA C;  2F3N A;  2QAR B;  2QKQ A;  2QB0 B;  4PZO A;  2Y9T A;  2DKZ A;  3TAD A;  1B4F A;  4NL9 A;  4IS7 A;  2DKX A;  1SV0 A;  3BS5 B;  1UQV A;  2QB1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...