4NL9C

Crystal structure of the human anks3-sam/anks6-sam heterodimer
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
60
structure length
60
Chain Sequence
ELTGILKKLSLEKYQPIFEEQEVDMEAFLTLTDGDLKELGIKTDGSRQQILAAISELNAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Characterization of the SAM domain of the PKD-related protein ANKS6 and its interaction with ANKS3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords Ankyrin repeat and SAM domain-containing protein 3
total genus 21
structure length 60
sequence length 60
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 4nl9C01
2DL0A 2EANA 2E8PA 3SENA 1SV4A 5J8YA 3BS5A 5KNIA 1F0MA 3K1RB 2LPEA 2QB1A 4RQNA 4IS7A 1Z1VA 2D3DA 2E8NA 1WWUA 1X40A 2EAMA 4NJ8A 1B4FA 2ESEA 2KMDA 1JI7A 1LKYA 2EAOA 2D8CA 4PZOA 2F8KA 2E8OA 1X9XA 2YTUA 2JV3A 1WWVA 3BS5B 2KIVA 2QKQA 1OXJA 2Y9UA 1PK1A 5L1MA 2F44A 3HILA 2DKZA 4NL9A 2L5YA 2QB0A 2K60A 4RQMA 1B0XA 2QARA 2QB0B 2B6GA 1OW5A 3IDWA 2ES6A 5J8YC 1LKYB 1SV0A 1PK3A 4PZNA 3TACB 5JU5A 2GLEA 5JTIA 1SGGA 2F3NA 1SV0C 2DKXA 1V85A 2K4PA 2Y9TA 3KKAC 3TADC 1UCVA 1V38A 1DXSA 1PK1B 1RG6A 4NL9C 1SXDA 2KE7A 5F3XB 4MHVA 3H8MA 3KKAA 3TADA 2FE9A 1UQVA 2KSOA 3BQ7A 1SXEA 5JRTA 2EAPA 2E8MA 2KG5A 3SEIA 2LMRA 2KSOB 2QARB 3BS7A 1KW4A 1COKA 1X66A
chains in the Genus database with same CATH superfamily
3H8SA 1XO1A 5AKZA 2KP7A 1UT8A 4DFKA 4FFDA 2E8PA 3SENA 2W9CA 4ECYA 4RQNA 4RQ0A 2JHDA 5KFYA 1HUOA 3UMGA 4UB3A 5KFVA 1XSLA 3A0HU 4OJPA 1JI7A 2W54A 2AHOB 2RLTA 4Z6EA 4MFFA 1K1QA 4OJOA 3PMLA 4OO1J 1HEKA 4UAWA 3PVXA 2KKVA 1U47A 3AEVA 2NYVA 2JXJA 4KLUA 3HKZC 2KK0A 4KN7A 4EEYA 1A76A 2MA1A 1ZQUA 1AQ6A 3R9KA 4EELA 3IV6A 5ALPA 2Y0SF 2QB0A 2K60A 4C80A 4F4ZA 3GU3A 1B0XA 2HHWA 2KZZA 5TZVA 2HHUA 3RR7A 2G08A 4PL1A 4EENA 2MRLA 4MEXA 3G6YA 1S0VA 4QZAA 5JU5A 1LV5A 5J2KA 5DKWA 5KFGA 2V4QA 1XC9A 4DS4A 3JPOA 2K8AA 3LDAA 2WFAA 5KT6A 5J0PA 4XRHA 2M9NA 2OYYA 3I28A 1NKEA 2H3VA 3BZCA 3PW7A 2ZJ8A 1NK5A 4ECSA 2FPKA 5ALYA 3KKAA 1BNOA 3UMCA 5BPCA 3GIMA 3B9JA 5L1JA 4DCCA 3E58A 2KICA 5KFQA 5JRTA 4KX3A 5J0XA 1XSPA 1SWVA 4ED2A 3MR5A 2LMRA 3RB4A 1ED1A 5DG7A 2LYHA 3VCBA 1RZTA 1L3TA 2ZIWB 3JPTA 4RNMA 4US9A 4O3OA 2WTFA 5ALUA 1NOMA 4I2EA 1DK3A 2HMXA 4GFJA 4M9LA 4OJ5A 1ZQDA 4DSIA 8ICRA 4BWMA 5KFFA 3QU2A 2JH1A 2FI1A 3QZ8A 2XCPA 3QZ7A 2OH2A 2DFLA 4DQPA 4KX5A 5ALLA 4QIWC 1QSSA 5A0LA 1URJA 4F5OA 4J9SA 3F5EA 1QH9A 1X6IA 3UXNA 3H8JA 2KVCA 4FO6A 2E1EA 2CXYA 4X5VA 4Y2QA 4NV0A 4B9TA 4P0QB 1ZD3A 2Y9UA 2M0NA 4ED3A 4NLKA 2DKZA 9ICLA 4ELUA 5HNKA 2B6GA 3IM1A 3FYHA 1SKRA 1LKYB 3HW8A 4I2JA 5KFPA 1D8LA 1PK3A 4BWJA 4PL2A 4R8UB 2VA2A 7ICOA 4GXIA 1PUZA 1YZ7A 4JUZA 5J2AA 1N2XA 4C8NA 4BGDA 2F3NA 2G5IB 3MFIA 8ICIA 4C8OA 2IOFK 2DPJA 3EPIA 1V85A 1A77A 2EH9A 1ZQCA 3KHRA 4RT2A 3AQFA 2J6TA 4UASA 4NL9C 2PFNA 2ZIXA 1V97A 1XWLA 5ALGA 4YR3A 4UAYA 3HT3A 2FE9A 3SYZA 2JH7A 4IQUA 3C1YA 1KFTA 4I2DA 2BCUA 5KFIA 1X2IA 3EPGA 4AYBF 4DEZA 3E2EA 3GIKA 4BXOA 5AK3A 3HKZF 3V7KA 2XC9A 2E8NA 5AM1A 4UAUA 3TARA 1L5UA 5KG7A 2ZJ5A 4BDPA 3HJEA 3PR5B 4GXKA 2LHTA 1T3QA 9ICHA 4DFDA 4KLEA 4QW9A 1NK4A 1PVQA 1T94A 5J2CA 3MABA 5J2GA 2ATLA 5KG6A 3NRZA 3OTQA 5AM2A 8ICEA 3PX0A 5J0UA 2QARA 4QWAA 1JALA 5ALMA 3UXPA 3RH4A 4CCHA 2AGPA 4CRXA 5KG5A 2Q4TA 1ZQWA 1SL1A 1YT3A 4MFCA 4Y2SA 3WK6A 4Q45A 2AQ0A 4YXJA 3GIIA 3C21A 2RDIA 3ZD8A 3JPRA 2HDOA 2ZIUA 2Y9TA 1QLNA 1V38A 3H7IA 2W03A 4FZNA 2NRZA 1WYGA 3OJSA 5AKIA 1P7DA 3G6VA 9ICXA 2ZUCA 3V6KA 4Z6FA 2AQ4A 1F5SA 2OM6A 3QU7A 3TAQA 2IOFA 2ZJAA 4QZHA 3ISCA 3M7DA 1RYSA 3AL0B 1L7OA 1WCLA 5B66U 5J2EA 3BZKA 3C5GA 1BPXA 2W3RA 1NI3A 3WK7A 2R8IA 8ICBA 1M6YA 4FS1A 3FC4A 3Q8LA 5IIMA 3H0MB 4Z6DA 3IG8A 4IQWA 2VJ4A 2G0AA 3C23A 2F8LA 4RQ2A 3RJKA 4GLXA 2KJ5A 4ECXA 4NLGA 2G06A 4MEYA 3EW9A 4ECQA 2W8KA 4PH5A 1X9XA 1TAMA 3FDSA 4G9BA 5IIIA 5KL1B 3MR6A 2HOFA 2F2AB 5IILA 2BKEA 4KLLA 4R66A 3BS5B 4UAVA 1QQ6A 4QJFB 4TQSA 2F44A 4EZ6A 3M6ZA 2BQUA 4Q43A 2KZMA 2LBOA 2BGWA 3D2NA 5ALRA 3LYSA 1HJPA 4PGYA 2QLTA 1WG8A 3ETRA 1FIQA 2HBMA 5GTIU 2FLPA 5KFOA 1S8OA 1MQ3A 5DG9A 4F50A 3QUTA 3SMVA 2HVIA 2KNJA 1SL0A 1S0OA 5KG0A 9ICOA 4F5QA 2UVRA 3BQ1A 4RQ4A 2KE7A 1IIPA 5AKGA 1ZQVA 2H3FA 3S6JA 5CRXA 2YMMA 2J6UA 4E0DA 3AUOA 5HMMA 2GH1A 3F53A 5KFRA 3SQIA 1YZ6A 4IC9A 2H3IA 3V6JA 5EWEA 8ICCA 4WJ3B 5KG2A 3GILA 3T5HA 3E0FA 5DGAA 1A6SA 1UA0A 1X66A 2FMSA 4M9GA 2YB4A 1ZQIA 2KIWA 4IL6U 5D46A 3ZD9A 1ZYQA 3RTVA 4DF4A 3PW0A 3OSNA 1F0MA 3K1RB 1N5XA 2I1QA 5AHXA 3M9MB 3NTUA 2BPFA 1X40A 8ICZA 2EAOA 2D8CA 3PY8A 5CR0A 5KAFU 2ISOA 5KFCA 5CHGA 1RYUA 2KEYA 3PZPA 1DGJA 4CF5A 3PW4A 1KRPA 5AKHA 8ICUA 3PO4A 4KLGA 3PR4A 4JV0A 1DRGA 3UM9A 5G5HA 4F4WA 1RM6C 2FMQA 3C28A 2NRXA 4O0IA 8ICMA 1MQ2A 3AMZA 4F5NA 7ICNA 2ZIUB 2PFQA 4P4PA 2KJ9A 4C4RA 4DWIA 3H0LB 2P6RA 9ICBA 4JV1A 5B5EU 2ZTEA 3QNMA 3HX0A 2EQYA 2KFZA 9ICMA 1U49A 3HWTA 1SV0C 7ICQA 2C2EA 4Y2VA 1TK5A 3BJYA 4PHAA 4K4IA 4KLIA 3TADC 5AM5A 4XQ8A 2MSNA 4RNNA 4J9NA 5L1LA 3SV3A 2AGOA 1BPBA 3MGVA 3QUCA 2KSOA 5DB7A 1SXEA 4OJLA 4ED8A 4FBUA 5TISU 3RAXA 2P35A 1FEZA 2VKQA 3MFHA 8ICJA 4YG2A 3TFSA 2LM4A 2ZG6A 2C2DA 2F1IA 5J0QA 1MA7A 4Y2TA 9ICUA 2YMPA 2C2RA 2LPEA 2MAXA 5AK6A 4RQ3A 5J0SA 5AK4A 5J0YA 3NGDA 4I27A 8ICPA 4NJ8A 1B4FA 4O3QA 3JPNA 2LM1A 5KG3A 1N60A 2ZTDA 4YFKA 2KJ8A 2OWOA 3JPSA 4M04A 4AYBC 4NLZA 4PHDA 1U45A 1WWVA 3RJEA 1SL2A 2KIVA 2LYBA 4NLCA 2CPRA 4C0ZA 2IHNA 4ED0A 2L5YA 5KFKA 4KLTA 2W8LA 4FZMA 5AK5A 3QU9A 3ALRA 5C0YA 3ORYA 8ICWA 2JMGA 5EWGA 4LZDA 5J2FA 3AU2A 3T5KA 3L5KA 8ICNA 2GLEA 1JIHA 3M9NB 4R8UA 4ZOHC 5AM3A 5BOMA 2IOHA 3V7LA 1JRPA 4QZCA 3BDPA 1AROP 1DK2A 4EYHB 2A19A 1UCVA 1PK1B 3D2SA 2NV3A 4M9NA 1KBUA 2HBJA 4M9HA 3HRDD 2JRZA 2BDPA 3VC8A 3PO5A 1TFRA 3EZ5A 2WF8A 5DLGA 4DLEA 4I2CA 8ICSA 4DL2A 5D49A 1ZQXA 1KEJA 2LKYA 2I6XA 1KW4A 4RPXA 5KFLA 4DS5A 3RJHA 1ZD4A 1ZQNA 4F4KA 3ZI4A 2C28A 5EE9A 4U7CA 4F71A 4ELTA 1PZNA 4IR9A 1Z19A 4FS2A 4B9SA 2DF4B 4KLDA 8ICLA 2OXOA 4QWCA 4RZRA 2HHXA 3QX7A 2D3DA 1Q3VA 4A8EA 1JN3A 5J0WA 1BVSA 1D9FA 4FBTA 4F4XA 8ICFA 4YCXA 1ZETA 4PZOA 2EZZA 3ZDEA 2K8CB 4C4TA 1NK7A 1TE2A 3OJUA 2WAQF 5KFMA 1S9FA 1JMSA 2FPMA 2WF5A 4DL5A 3B0XA 2YN4A 5AKJA 3PW2A 5L1MA 9ICJA 4P2HA 4YMOA 1IXRA 1T8EA 3F2CA 4KLJA 3QUQA 4DOBA 5DBAA 5ALWA 2W9MA 3TI0A 1OW5A 4Y2RA 1RQLA 3GZFA 4CF4A 1FO4A 5KFXA 5AI9A 4UB2A 2ZXHA 2XY6A 1DOQA 4YVZA 5AKLA 1ZD2P 3N4MB 3FAHA 4ED6A 2R18A 5KT7A 1MSWD 5FP0A 3DEEA 1Q3UA 3GV7B 3NVZA 1V9PA 1H38A 1OUQA 3TFRA 3LWMA 4QZ9A 3KHHA 1UQVA 2F76X 3RRGA 1ZOLA 3AU6A 5J29A 2KOBA 5KFZA 1VDVA 3NASA 4DOAA 3IP4B 4DQSA 4DFJA 1KTQA 3RB3A 3C2KA 5AKYA 4R65A 4RQ5A 2KKPA 3H4BA 3RAQA 4Q8EA 1X9MA 3C1ZA 4UB6U 5AIAA 2AGQA 4CF3A 1SWWA 2WB1F 4J9KA 1NKCA 9ICNA 2XICA 3A0BU 3KHGA 8ICYA 8ICAA 2ZTCA 3RJFA 1HUZA 2F1JA 2K8BB 4XA5A 3KD3A 2H3ZA 2GWSA 2ZIVB 1UPHA 7ICTA 2FLLA 3L4PA 9ICQA 1N48A 2W3SA 4UQGA 2F8KA 4J9MA 1N56A 3KBBA 4ECTA 2YX8A 3T5JA 4UBCA 9ICVA 3V72A 3SR6A 2BPGA 3TQ1A 3WKAA 5K4LA 4Y2XA 1X9WA 5HHIA 4RQMA 8ICKA 4BJQA 5AI5A 3ISDA 3RR8A 1NZPA 5KAIU 2JEJA 2PI4A 5DB8A 2ZUBA 4B9UA 4K4HA 5AI0A 2R8JA 1C20A 1CUKA 4DQRA 1ZQMA 3WU2U 5DDMA 1D9DA 2K4PA 3OHBA 1KLNA 2RQ5A 1L3SA 4YXMA 2P6UA 2BHNA 2I5HA 2HI0A 4YMMA 2BQ3A 2LYAA 3CNHA 5KFBA 1SZHA 5EOZA 1TKDA 1GO3F 2RHFA 5ALKA 1L7NA 2KV2A 4RT3A 3C2MA 4IQTA 3N7RC 5AKEA 3QE9Y 2XCAA 2KG5A 3SEIA 2QARB 5IIKA 3OHAA 4F8RA 3PX6A 4EX6A 5ALQA 2BCSA 1NJXA 5KT4A 2OHFA 1B22A 9ICCA 2Y1JA 3NVWA 4LZGA 2QB1A 5KFHA 8ICGA 3I1YA 5ALEA 4YMNA 2PXIA 3WK5A 4J9QA 1NK8A 1ZQHA 3H40A 1QCKA 3PNCA 5HR6A 3PSFA 1K5OA 1ZQBA 4JMUA 1S0NA 2J6SA 1VJ5A 2HOQA 4J9PA 4NXZA 4DQQA 2NRWA 2E3TA 2W9AA 2NRTA 4C8MA 3KZXA 3BQTA 3KTQA 4F92B 5J2IA 1PK1A 4IRKA 4QZIA 3AM9A 1ZQFA 5J0RA 4CNQA 2PKEA 1Z3EB 1FFVA 1CEZA 5CP2A 4NM2A 2V9WA 1ZD5A 1ZQTA 1J97A 4ECZA 4ZH4A 3NRWA 1RDFA 3QEAZ 7ICLA 7ICFA 4R64A 1S0MA 3M6KA 5KFAA 5AM0A 4KLOA 4RPZA 1BPYA 2KTQA 4RUAA 1J2NA 3Q8PB 4KLMA 4YD1A 1ZJMA 4O3RA 1QQ5A 2UVVA 4C8LA 2E5SA 4EZ9A 4DSJA 4Y2UA 2HW3A 4JWMA 1QSLA 4MF8A 1VLBA 2HOIA 1COOA 4GC7A 2KVSA 9ICKA 3ISBA 2G5HB 1O03A 3DDHA 1JXLA 4QZ8A 5J0OA 5C5JA 3L3FX 2PI5A 4IS7A 4B9VA 2FPLA 5L1IA 4DOCA 3ICXA 1NJYA 5HR7A 1NKBA 1XSNA 2KMDA 1DGSA 3N97B 5AIBA 4KITB 3H4DA 5ALVA 2XO7A 2HHVA 8ICHA 1X42A 2YTUA 3MDCA 3GQCA 3UQ2A 3WK8A 4DLGA 1TV9A 4PPXA 1NK6A 2W9BA 3MC1A 3GFKB 4DFPA 1ZQKA 1RQNA 1KFSA 2R8KA 3PV8A 2EZYA 1IG6A 2EZXA 1Z4NA 1Z4OA 3N7SC 3T5LA 4P0PB 4K4GA 3IG5A 3IDWA 3IHQB 3UMBA 9ICFA 5DDYA 5H2FU 5AKKA 4B9LA 2AJQA 2FLNA 2F77X 1SGGA 7ICGA 1JX4A 2YB1A 4QIWF 1JROA 2DWQA 4C7YA 1C7YA 1ZXIA 4QWDA 1ZQSA 3H0RB 4IQVA 3Q8MA 3RF9A 3SAFA 4I28A 3RJIA 2XY7A 3NUQA 3TADA 4QZEA 2W43A 3JPPA 3RBDA 5G5GA 5J0TA 2F1HA 2WB1C 1K1SA 4F2SA 1U9LA 1JXEA 2KSOB 1SIJA 4EX7A 4C8KA 3ZDDA 1SZPA 4GXJA 2AH5A 2DGZA 3MDAA 1L7PA 3WKEA 2DQNB 3G6XA 2DL0A 1ECWA 2VA3A 9ICEA 4DL6A 3Q8RB 1ZQZA 5HHHA 1Y88A 2O6KA 4YD2A 3Q8QB 2ASDA 4Y2YA 2D6FC 1A0PA 5KFSA 2E1FA 5DQGA 4EBEA 2ESEA 2PMZC 1BPZA 1TK0A 3V7JA 5CA7A 1FFUA 2NRVA 8ICVA 4F2RA 2LI6A 2HHSA 4TUSA 1QSYA 3MGIA 2Q0ZX 4EBCA 4O3MA 2IBKA 3F5AA 2JR5A 5HMLA 5ALSA 1U4BA 1ZQRA 1OXJA 3K4GA 5AI8A 7ICUA 4M6WA 4NL9A 4NM1A 9ICPA 4QWBA 4TQRA 1ZQPA 2JEGA 1QQ7A 1Z00B 1SKWA 3CP8A 3FM9A 4CE6A 3KOOA 1T3NA 1N61A 3M9OB 2FMPA 2XY5A 5J8YC 2HBKA 3GIJA 2HVHA 4OJ6A 2IHMA 3CW2C 3N7PD 2VANA 1L7MA 2YMLA 1D8BA 4IR1A 2YQEA 1KSPA 1IM4A 4MFAA 2WF7A 4NLNA 4RQ7A 4J9OA 5KG4A 5IIOA 1ZRMA 2DKXA 5DBBA 3SZ2A 1UA1A 4NWIA 4F91B 4DL4A 2BCQA 1DXSA 2IMWP 3ZDAA 4F93B 4ECRA 5DQIA 2W9BB 2N1RA 3H8MA 1IV8A 4YP3A 3AN1A 1XS9D 5KFJA 1KFDA 3ED5A 2MUTA 3RJGA 3MBYA 8ICOA 5CEHA 4DL7A 4UATA 4ECWA 2Y1IA 2K4IA 4JWNA 3RBEA 1WUDA 5L9XA 1XO0A 1KN5A 1ZRNA 4PHEA 2C22A 1TAUA 4TUPA 4KMUA 2AXTU 4KN4A 3SV4A 2XGQA 5KG1A 2RDJA 5EWFA 2GO7A 5AKXA 2V4RA 4I2AA 3MR3A 5ALNA 1RPLA 4R63A 5KFTA 4TUQA 3ETLA 4I2HA 4O3PA 2NO5A 1ZQ1C 3F2BA 5KT5A 4RU9A 2JV3A 5EE1A 1MN8A 5ALDA 1BPEA 1ZQEA 4I2GA 2W04A 3PW5A 8ICXA 2G09A 3HILA 9ICRA 1ZJNA 1NJZA 4CDGA 3KFUF 4PJ0U 9ICIA 3B0YA 3PSTA 1NK9A 4C7ZA 2CRXA 4KLHA 5ALFA 5J2BA 3Q8KA 4F72A 5KL8B 3QXGA 3SAGA 2KZ3A 3UPQA 5EE0A 1S76D 3KKAC 2FDRA 5DB6A 4CGZA 4MHVA 3LVWA 2BR0A 5T14A 2Z7JA 4DF8A 3RFAA 1ZQAA 2P66A 2E8MA 5KTQA 4O3SA 3EUB2 4KLQA 2JEIA 4Z6CA 3HP6A 4US8A 4DSEA 4BXOB 4FE3A 2VA8A 1N62A 4ECUA 3O0FA 3T3FA 3GV5B 4M47A 2H3QA 1Z00A 3QEBZ 4M6WB 2EAMA 3ONNA 4HAIA 2PFOA 5KT2A 1X6JA 4YR0A 3J81j 3GV8B 4DFMA 2AU0A 2W7OA 4UBBA 2DPIA 9ICTA 3T79A 1NK0A 5DQHA 3IN5A 3SI8A 5ALXA 2BPCA 4Y2PA 4G3IA 5KFNA 5KFUA 3HPOA 3PSPA 2DBYA 1CI4A 3IRUA 3M8RA 1ZQYA 5DLFA 3WKBA 3BQ2A 3OGUA 4O5EA 2YMQA 1XU4A 4PZNA 3TAPA 3N28A 4P0QA 1S97A 4PGQA 5AICA 1L8OA 2A1JB 5F9LA 3OSPA 4F4YA 5GTHU 1HIWA 4BUGA 4EYIB 7ICKA 2DUYA 2W55A 4EEKA 3MR2A 1JUDA 5CWRA 2RP5A 1ZQOA 4AP9A 3K1ZA 4O5KA 2K4EA 5EE3A 4UB4A 5DG8A 4J03A 3THVA 3RRHA 3GDXA 1RXVA 1ZQLA 5ALIA 2KHVA 2XVTA 2ZIVA 5KFEA 4M9JA 3DV9A 1QTMA 4ED1A 7ICIA 2PMZF 3M8SA 2VIXA 3QUBA 4LJXA 4O3NA 5J8YA 8ICQA 3BS5A 2MUTB 4P0PA 3Q8SB 2BCVA 1Q8KA 4M0AA 7ICPA 5D4BA 2OCEA 3F2DA 3ZDBA 1L6NA 4J9RA 2Y0SC 5BOLA 5ALZA 2NO4A 1LKYA 2R8HA 1RYRA 1ZQGA 4ELVA 5ALHA 3BQ0A 9ICWA 1KL9A 1KKXA 2ISPA 4DSLA 4NY8A 4RUCA 9ICSA 1F44A 4Y2JA 2UVUA 4B9MA 4PGXA 1TVAA 4B9NA 4GC6A 4I2BA 3RH6A 3ZDCA 4FZLA 4QZFA 2QB0B 5J2HA 4F5PA 1SB3C 3D2QA 1S5LU 4DSFA 4PHPA 5DBCA 5JTIA 3PSIA 5KFWA 1S77D 4Q44A 3LVVA 5AM4A 3H8WA 4O5CA 1B43A 1SXDA 4DSKA 2HSZA 2A1JA 2H5XA 3KHLA 2A1AA 1TK8A 3BQ7A 4ICAA 1J2MA 1PVRA 2EAPA 3QU4A 3I76A 4QZGA 4QWEA 4YN4A 3D6JA 1L3VA 3EYZA 3MGHA 1NZBA 4DL3A 4IRCA 5J2DA 2A3VA 1Z1BA 7ICEA 1WCNA 2CN1A 2RRDA 1SKSA 4UW9A 7ICJA 1T7PA 1UT5A 3SD7A 3NVVA 3V6HA 4KLFA 1Z1VA 4UB5A 2W9CB 2GOLA 4U6PA 2W7PA 4P4OA 3RH5A 1KQQA 2ASLA 1WWUA 3RB6A 3RJJA 9ICAA 2E8OA 3EWAA 4M2YA 2XIDA 5DB9A 2XGPA 1ZQQA 2YY6A 2HBLA 1Q46A 5J2JA 4UB8U 3CYMA 1U48A 2G07A 4QZDA 2B21A 1LB2B 1BNPA 5KFDA 5AI6A 5JUMA 2JZBB 5CJ7A 1N5WA 4XUSA 3WK4A 4KLSA 3C2LA 1CRXA 8ICTA 4USAA 2K4HA 2JEFA 2UVWA 7ICRA 1NJWA 4BX9C 3LWLA 3RB0A 4LVSA 2KFNA 2ASJA 2FJ6A 2OEHA 4YR2A 3LK9A 2ODGA 4OCZA 2PFPA 2HCFA 3U26A 1MC8A 4RPYA 4I2IA 3QU5A 4UAZA 2JZBA 4I29A 3C29A 2ZUDA 4NLBA 2KN7A 2W11A 2BCRA 4TURA 5ALOA 2WF9A 4C4SA 5HP4A 4DO9A 2WHEA 3QYPA 3C5FA 3WKCA 3UQ0A 2EANA 4EBDA 2HHQA 4QNLA 4KTQA 1BPDA 1SV4A 2K89A 5KNIA 4QW8A 3JPQA 4J9LA 1LVHA 4JV2A 4OD0A 1XNSA 3SAHA 4JK1A 1N63A 1X9SA 1EXNA 4Q8FA 3K75D 7ICMA 4MF2A 2VJ5A 4I2FA 1D8YA 4RQ8A 4UB1A 2WF6A 3UXOA 3NVYA 3AQEA 1NNLA 2BQRA 7ICVA 3WKDA 2I9GA 1L8LA 2JGAA 1TAQA 2WAQC 3NS1A 9ICGA 5IIJA 2KD1A 1L3UA 2QKQA 2B0CA 4JB3A 1O08A 5KT3A 4ED7A 5AI4A 3TKAA 1T4GA 3WK9A 2KHQA 4ECVA 5ALTA 2ZIXB 2ZIWA 4DQIA 1BGXT 3M1YA 2BZFA 4YQWA 4HYKA 1RXWA 4UARA 4P4MA 3CRXA 2ES6A 7ICHA 4O9MA 4IRDA 1SV0A 4ACOA 3TACB 5DGBA 3PX4A 3KZIU 3PMNA 4GIBA 5IINA 1UHUA 5CB1A 2IA6A 2ALZA 4F5RA 5L1KA 4KMOB 1RG6A 4QZBA 5F9NA 2HHTA 3OPXA 5ALJA 4RQ1A 4RNOA 5F3XB 4B6JA 2R8GA 2ZXIA 1KDHA 2EDUA 4F3OA 3TANA 2MU2A 2XI9A 1S10A 1PVPA 1ZQJA 3BS7A 5E79U 2BDUA 1COKA 7ICSA 4RQ6A
chains in the Genus database with same CATH topology
2DL0A 2EANA 2E8PA 3SENA 1SV4A 5J8YA 3BS5A 5KNIA 1F0MA 3K1RB 2LPEA 2QB1A 4RQNA 4IS7A 1Z1VA 2D3DA 2E8NA 1WWUA 1X40A 2EAMA 4NJ8A 1B4FA 2ESEA 2KMDA 1JI7A 1LKYA 2EAOA 2D8CA 4PZOA 2F8KA 2E8OA 1X9XA 2YTUA 2JV3A 1WWVA 3BS5B 2KIVA 2QKQA 1OXJA 2Y9UA 1PK1A 5L1MA 2F44A 3HILA 2DKZA 4NL9A 2L5YA 2QB0A 2K60A 4RQMA 1B0XA 2QARA 2QB0B 2B6GA 1OW5A 3IDWA 2ES6A 5J8YC 1LKYB 1SV0A 1PK3A 4PZNA 3TACB 5JU5A 2GLEA 5JTIA 1SGGA 2F3NA 1SV0C 2DKXA 1V85A 2K4PA 2Y9TA 3KKAC 3TADC 1UCVA 1V38A 1DXSA 1PK1B 1RG6A 4NL9C 1SXDA 2KE7A 5F3XB 4MHVA 3H8MA 3KKAA 3TADA 2FE9A 1UQVA 2KSOA 3BQ7A 1SXEA 5JRTA 2EAPA 2E8MA 2KG5A 3SEIA 2LMRA 2KSOB 2QARB 3BS7A 1KW4A 1COKA 1X66A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DL0 A;  2EAN A;  2E8P A;  3SEN A;  1SV4 A;  5J8Y A;  3BS5 A;  5KNI A;  1F0M A;  3K1R B;  2LPE A;  2QB1 A;  4RQN A;  4IS7 A;  1Z1V A;  2D3D A;  2E8N A;  1WWU A;  1X40 A;  2EAM A;  4NJ8 A;  1B4F A;  2ESE A;  2KMD A;  1JI7 A;  1LKY A;  2EAO A;  2D8C A;  4PZO A;  2F8K A;  2E8O A;  1X9X A;  2YTU A;  2JV3 A;  1WWV A;  3BS5 B;  2KIV A;  2QKQ A;  1OXJ A;  2Y9U A;  1PK1 A;  5L1M A;  2F44 A;  3HIL A;  2DKZ A;  4NL9 A;  2L5Y A;  2QB0 A;  2K60 A;  4RQM A;  1B0X A;  2QAR A;  2QB0 B;  2B6G A;  1OW5 A;  3IDW A;  2ES6 A;  5J8Y C;  1LKY B;  1SV0 A;  1PK3 A;  4PZN A;  3TAC B;  5JU5 A;  2GLE A;  5JTI A;  1SGG A;  2F3N A;  1SV0 C;  2DKX A;  1V85 A;  2K4P A;  2Y9T A;  3KKA C;  3TAD C;  1UCV A;  1V38 A;  1DXS A;  1PK1 B;  1RG6 A;  4NL9 C;  1SXD A;  2KE7 A;  5F3X B;  4MHV A;  3H8M A;  3KKA A;  3TAD A;  2FE9 A;  1UQV A;  2KSO A;  3BQ7 A;  1SXE A;  5JRT A;  2EAP A;  2E8M A;  2KG5 A;  3SEI A;  2LMR A;  2KSO B;  2QAR B;  3BS7 A;  1KW4 A;  1COK A;  1X66 A; 
#chains in the Genus database with same CATH topology
 3H8S A;  1XO1 A;  5AKZ A;  2KP7 A;  1UT8 A;  4DFK A;  4FFD A;  2E8P A;  3SEN A;  2W9C A;  4ECY A;  4RQN A;  4RQ0 A;  2JHD A;  5KFY A;  1HUO A;  3UMG A;  4UB3 A;  5KFV A;  1XSL A;  3A0H U;  4OJP A;  1JI7 A;  2W54 A;  2AHO B;  2RLT A;  4Z6E A;  4MFF A;  1K1Q A;  4OJO A;  3PML A;  4OO1 J;  1HEK A;  4UAW A;  3PVX A;  2KKV A;  1U47 A;  3AEV A;  2NYV A;  2JXJ A;  4KLU A;  3HKZ C;  2KK0 A;  4KN7 A;  4EEY A;  1A76 A;  2MA1 A;  1ZQU A;  1AQ6 A;  3R9K A;  4EEL A;  3IV6 A;  5ALP A;  2Y0S F;  2QB0 A;  2K60 A;  4C80 A;  4F4Z A;  3GU3 A;  1B0X A;  2HHW A;  2KZZ A;  5TZV A;  2HHU A;  3RR7 A;  2G08 A;  4PL1 A;  4EEN A;  2MRL A;  4MEX A;  3G6Y A;  1S0V A;  4QZA A;  5JU5 A;  1LV5 A;  5J2K A;  5DKW A;  5KFG A;  2V4Q A;  1XC9 A;  4DS4 A;  3JPO A;  2K8A A;  3LDA A;  2WFA A;  5KT6 A;  5J0P A;  4XRH A;  2M9N A;  2OYY A;  3I28 A;  1NKE A;  2H3V A;  3BZC A;  3PW7 A;  2ZJ8 A;  1NK5 A;  4ECS A;  2FPK A;  5ALY A;  3KKA A;  1BNO A;  3UMC A;  5BPC A;  3GIM A;  3B9J A;  5L1J A;  4DCC A;  3E58 A;  2KIC A;  5KFQ A;  5JRT A;  4KX3 A;  5J0X A;  1XSP A;  1SWV A;  4ED2 A;  3MR5 A;  2LMR A;  3RB4 A;  1ED1 A;  5DG7 A;  2LYH A;  3VCB A;  1RZT A;  1L3T A;  2ZIW B;  3JPT A;  4RNM A;  4US9 A;  4O3O A;  2WTF A;  5ALU A;  1NOM A;  4I2E A;  1DK3 A;  2HMX A;  4GFJ A;  4M9L A;  4OJ5 A;  1ZQD A;  4DSI A;  8ICR A;  4BWM A;  5KFF A;  3QU2 A;  2JH1 A;  2FI1 A;  3QZ8 A;  2XCP A;  3QZ7 A;  2OH2 A;  2DFL A;  4DQP A;  4KX5 A;  5ALL A;  4QIW C;  1QSS A;  5A0L A;  1URJ A;  4F5O A;  4J9S A;  3F5E A;  1QH9 A;  1X6I A;  3UXN A;  3H8J A;  2KVC A;  4FO6 A;  2E1E A;  2CXY A;  4X5V A;  4Y2Q A;  4NV0 A;  4B9T A;  4P0Q B;  1ZD3 A;  2Y9U A;  2M0N A;  4ED3 A;  4NLK A;  2DKZ A;  9ICL A;  4ELU A;  5HNK A;  2B6G A;  3IM1 A;  3FYH A;  1SKR A;  1LKY B;  3HW8 A;  4I2J A;  5KFP A;  1D8L A;  1PK3 A;  4BWJ A;  4PL2 A;  4R8U B;  2VA2 A;  7ICO A;  4GXI A;  1PUZ A;  1YZ7 A;  4JUZ A;  5J2A A;  1N2X A;  4C8N A;  4BGD A;  2F3N A;  2G5I B;  3MFI A;  8ICI A;  4C8O A;  2IOF K;  2DPJ A;  3EPI A;  1V85 A;  1A77 A;  2EH9 A;  1ZQC A;  3KHR A;  4RT2 A;  3AQF A;  2J6T A;  4UAS A;  4NL9 C;  2PFN A;  2ZIX A;  1V97 A;  1XWL A;  5ALG A;  4YR3 A;  4UAY A;  3HT3 A;  2FE9 A;  3SYZ A;  2JH7 A;  4IQU A;  3C1Y A;  1KFT A;  4I2D A;  2BCU A;  5KFI A;  1X2I A;  3EPG A;  4AYB F;  4DEZ A;  3E2E A;  3GIK A;  4BXO A;  5AK3 A;  3HKZ F;  3V7K A;  2XC9 A;  2E8N A;  5AM1 A;  4UAU A;  3TAR A;  1L5U A;  5KG7 A;  2ZJ5 A;  4BDP A;  3HJE A;  3PR5 B;  4GXK A;  2LHT A;  1T3Q A;  9ICH A;  4DFD A;  4KLE A;  4QW9 A;  1NK4 A;  1PVQ A;  1T94 A;  5J2C A;  3MAB A;  5J2G A;  2ATL A;  5KG6 A;  3NRZ A;  3OTQ A;  5AM2 A;  8ICE A;  3PX0 A;  5J0U A;  2QAR A;  4QWA A;  1JAL A;  5ALM A;  3UXP A;  3RH4 A;  4CCH A;  2AGP A;  4CRX A;  5KG5 A;  2Q4T A;  1ZQW A;  1SL1 A;  1YT3 A;  4MFC A;  4Y2S A;  3WK6 A;  4Q45 A;  2AQ0 A;  4YXJ A;  3GII A;  3C21 A;  2RDI A;  3ZD8 A;  3JPR A;  2HDO A;  2ZIU A;  2Y9T A;  1QLN A;  1V38 A;  3H7I A;  2W03 A;  4FZN A;  2NRZ A;  1WYG A;  3OJS A;  5AKI A;  1P7D A;  3G6V A;  9ICX A;  2ZUC A;  3V6K A;  4Z6F A;  2AQ4 A;  1F5S A;  2OM6 A;  3QU7 A;  3TAQ A;  2IOF A;  2ZJA A;  4QZH A;  3ISC A;  3M7D A;  1RYS A;  3AL0 B;  1L7O A;  1WCL A;  5B66 U;  5J2E A;  3BZK A;  3C5G A;  1BPX A;  2W3R A;  1NI3 A;  3WK7 A;  2R8I A;  8ICB A;  1M6Y A;  4FS1 A;  3FC4 A;  3Q8L A;  5IIM A;  3H0M B;  4Z6D A;  3IG8 A;  4IQW A;  2VJ4 A;  2G0A A;  3C23 A;  2F8L A;  4RQ2 A;  3RJK A;  4GLX A;  2KJ5 A;  4ECX A;  4NLG A;  2G06 A;  4MEY A;  3EW9 A;  4ECQ A;  2W8K A;  4PH5 A;  1X9X A;  1TAM A;  3FDS A;  4G9B A;  5III A;  5KL1 B;  3MR6 A;  2HOF A;  2F2A B;  5IIL A;  2BKE A;  4KLL A;  4R66 A;  3BS5 B;  4UAV A;  1QQ6 A;  4QJF B;  4TQS A;  2F44 A;  4EZ6 A;  3M6Z A;  2BQU A;  4Q43 A;  2KZM A;  2LBO A;  2BGW A;  3D2N A;  5ALR A;  3LYS A;  1HJP A;  4PGY A;  2QLT A;  1WG8 A;  3ETR A;  1FIQ A;  2HBM A;  5GTI U;  2FLP A;  5KFO A;  1S8O A;  1MQ3 A;  5DG9 A;  4F50 A;  3QUT A;  3SMV A;  2HVI A;  2KNJ A;  1SL0 A;  1S0O A;  5KG0 A;  9ICO A;  4F5Q A;  2UVR A;  3BQ1 A;  4RQ4 A;  2KE7 A;  1IIP A;  5AKG A;  1ZQV A;  2H3F A;  3S6J A;  5CRX A;  2YMM A;  2J6U A;  4E0D A;  3AUO A;  5HMM A;  2GH1 A;  3F53 A;  5KFR A;  3SQI A;  1YZ6 A;  4IC9 A;  2H3I A;  3V6J A;  5EWE A;  8ICC A;  4WJ3 B;  5KG2 A;  3GIL A;  3T5H A;  3E0F A;  5DGA A;  1A6S A;  1UA0 A;  1X66 A;  2FMS A;  4M9G A;  2YB4 A;  1ZQI A;  2KIW A;  4IL6 U;  5D46 A;  3ZD9 A;  1ZYQ A;  3RTV A;  4DF4 A;  3PW0 A;  3OSN A;  1F0M A;  3K1R B;  1N5X A;  2I1Q A;  5AHX A;  3M9M B;  3NTU A;  2BPF A;  1X40 A;  8ICZ A;  2EAO A;  2D8C A;  3PY8 A;  5CR0 A;  5KAF U;  2ISO A;  5KFC A;  5CHG A;  1RYU A;  2KEY A;  3PZP A;  1DGJ A;  4CF5 A;  3PW4 A;  1KRP A;  5AKH A;  8ICU A;  3PO4 A;  4KLG A;  3PR4 A;  4JV0 A;  1DRG A;  3UM9 A;  5G5H A;  4F4W A;  1RM6 C;  2FMQ A;  3C28 A;  2NRX A;  4O0I A;  8ICM A;  1MQ2 A;  3AMZ A;  4F5N A;  7ICN A;  2ZIU B;  2PFQ A;  4P4P A;  2KJ9 A;  4C4R A;  4DWI A;  3H0L B;  2P6R A;  9ICB A;  4JV1 A;  5B5E U;  2ZTE A;  3QNM A;  3HX0 A;  2EQY A;  2KFZ A;  9ICM A;  1U49 A;  3HWT A;  1SV0 C;  7ICQ A;  2C2E A;  4Y2V A;  1TK5 A;  3BJY A;  4PHA A;  4K4I A;  4KLI A;  3TAD C;  5AM5 A;  4XQ8 A;  2MSN A;  4RNN A;  4J9N A;  5L1L A;  3SV3 A;  2AGO A;  1BPB A;  3MGV A;  3QUC A;  2KSO A;  5DB7 A;  1SXE A;  4OJL A;  4ED8 A;  4FBU A;  5TIS U;  3RAX A;  2P35 A;  1FEZ A;  2VKQ A;  3MFH A;  8ICJ A;  4YG2 A;  3TFS A;  2LM4 A;  2ZG6 A;  2C2D A;  2F1I A;  5J0Q A;  1MA7 A;  4Y2T A;  9ICU A;  2YMP A;  2C2R A;  2LPE A;  2MAX A;  5AK6 A;  4RQ3 A;  5J0S A;  5AK4 A;  5J0Y A;  3NGD A;  4I27 A;  8ICP A;  4NJ8 A;  1B4F A;  4O3Q A;  3JPN A;  2LM1 A;  5KG3 A;  1N60 A;  2ZTD A;  4YFK A;  2KJ8 A;  2OWO A;  3JPS A;  4M04 A;  4AYB C;  4NLZ A;  4PHD A;  1U45 A;  1WWV A;  3RJE A;  1SL2 A;  2KIV A;  2LYB A;  4NLC A;  2CPR A;  4C0Z A;  2IHN A;  4ED0 A;  2L5Y A;  5KFK A;  4KLT A;  2W8L A;  4FZM A;  5AK5 A;  3QU9 A;  3ALR A;  5C0Y A;  3ORY A;  8ICW A;  2JMG A;  5EWG A;  4LZD A;  5J2F A;  3AU2 A;  3T5K A;  3L5K A;  8ICN A;  2GLE A;  1JIH A;  3M9N B;  4R8U A;  4ZOH C;  5AM3 A;  5BOM A;  2IOH A;  3V7L A;  1JRP A;  4QZC A;  3BDP A;  1ARO P;  1DK2 A;  4EYH B;  2A19 A;  1UCV A;  1PK1 B;  3D2S A;  2NV3 A;  4M9N A;  1KBU A;  2HBJ A;  4M9H A;  3HRD D;  2JRZ A;  2BDP A;  3VC8 A;  3PO5 A;  1TFR A;  3EZ5 A;  2WF8 A;  5DLG A;  4DLE A;  4I2C A;  8ICS A;  4DL2 A;  5D49 A;  1ZQX A;  1KEJ A;  2LKY A;  2I6X A;  1KW4 A;  4RPX A;  5KFL A;  4DS5 A;  3RJH A;  1ZD4 A;  1ZQN A;  4F4K A;  3ZI4 A;  2C28 A;  5EE9 A;  4U7C A;  4F71 A;  4ELT A;  1PZN A;  4IR9 A;  1Z19 A;  4FS2 A;  4B9S A;  2DF4 B;  4KLD A;  8ICL A;  2OXO A;  4QWC A;  4RZR A;  2HHX A;  3QX7 A;  2D3D A;  1Q3V A;  4A8E A;  1JN3 A;  5J0W A;  1BVS A;  1D9F A;  4FBT A;  4F4X A;  8ICF A;  4YCX A;  1ZET A;  4PZO A;  2EZZ A;  3ZDE A;  2K8C B;  4C4T A;  1NK7 A;  1TE2 A;  3OJU A;  2WAQ F;  5KFM A;  1S9F A;  1JMS A;  2FPM A;  2WF5 A;  4DL5 A;  3B0X A;  2YN4 A;  5AKJ A;  3PW2 A;  5L1M A;  9ICJ A;  4P2H A;  4YMO A;  1IXR A;  1T8E A;  3F2C A;  4KLJ A;  3QUQ A;  4DOB A;  5DBA A;  5ALW A;  2W9M A;  3TI0 A;  1OW5 A;  4Y2R A;  1RQL A;  3GZF A;  4CF4 A;  1FO4 A;  5KFX A;  5AI9 A;  4UB2 A;  2ZXH A;  2XY6 A;  1DOQ A;  4YVZ A;  5AKL A;  1ZD2 P;  3N4M B;  3FAH A;  4ED6 A;  2R18 A;  5KT7 A;  1MSW D;  5FP0 A;  3DEE A;  1Q3U A;  3GV7 B;  3NVZ A;  1V9P A;  1H38 A;  1OUQ A;  3TFR A;  3LWM A;  4QZ9 A;  3KHH A;  1UQV A;  2F76 X;  3RRG A;  1ZOL A;  3AU6 A;  5J29 A;  2KOB A;  5KFZ A;  1VDV A;  3NAS A;  4DOA A;  3IP4 B;  4DQS A;  4DFJ A;  1KTQ A;  3RB3 A;  3C2K A;  5AKY A;  4R65 A;  4RQ5 A;  2KKP A;  3H4B A;  3RAQ A;  4Q8E A;  1X9M A;  3C1Z A;  4UB6 U;  5AIA A;  2AGQ A;  4CF3 A;  1SWW A;  2WB1 F;  4J9K A;  1NKC A;  9ICN A;  2XIC A;  3A0B U;  3KHG A;  8ICY A;  8ICA A;  2ZTC A;  3RJF A;  1HUZ A;  2F1J A;  2K8B B;  4XA5 A;  3KD3 A;  2H3Z A;  2GWS A;  2ZIV B;  1UPH A;  7ICT A;  2FLL A;  3L4P A;  9ICQ A;  1N48 A;  2W3S A;  4UQG A;  2F8K A;  4J9M A;  1N56 A;  3KBB A;  4ECT A;  2YX8 A;  3T5J A;  4UBC A;  9ICV A;  3V72 A;  3SR6 A;  2BPG A;  3TQ1 A;  3WKA A;  5K4L A;  4Y2X A;  1X9W A;  5HHI A;  4RQM A;  8ICK A;  4BJQ A;  5AI5 A;  3ISD A;  3RR8 A;  1NZP A;  5KAI U;  2JEJ A;  2PI4 A;  5DB8 A;  2ZUB A;  4B9U A;  4K4H A;  5AI0 A;  2R8J A;  1C20 A;  1CUK A;  4DQR A;  1ZQM A;  3WU2 U;  5DDM A;  1D9D A;  2K4P A;  3OHB A;  1KLN A;  2RQ5 A;  1L3S A;  4YXM A;  2P6U A;  2BHN A;  2I5H A;  2HI0 A;  4YMM A;  2BQ3 A;  2LYA A;  3CNH A;  5KFB A;  1SZH A;  5EOZ A;  1TKD A;  1GO3 F;  2RHF A;  5ALK A;  1L7N A;  2KV2 A;  4RT3 A;  3C2M A;  4IQT A;  3N7R C;  5AKE A;  3QE9 Y;  2XCA A;  2KG5 A;  3SEI A;  2QAR B;  5IIK A;  3OHA A;  4F8R A;  3PX6 A;  4EX6 A;  5ALQ A;  2BCS A;  1NJX A;  5KT4 A;  2OHF A;  1B22 A;  9ICC A;  2Y1J A;  3NVW A;  4LZG A;  2QB1 A;  5KFH A;  8ICG A;  3I1Y A;  5ALE A;  4YMN A;  2PXI A;  3WK5 A;  4J9Q A;  1NK8 A;  1ZQH A;  3H40 A;  1QCK A;  3PNC A;  5HR6 A;  3PSF A;  1K5O A;  1ZQB A;  4JMU A;  1S0N A;  2J6S A;  1VJ5 A;  2HOQ A;  4J9P A;  4NXZ A;  4DQQ A;  2NRW A;  2E3T A;  2W9A A;  2NRT A;  4C8M A;  3KZX A;  3BQT A;  3KTQ A;  4F92 B;  5J2I A;  1PK1 A;  4IRK A;  4QZI A;  3AM9 A;  1ZQF A;  5J0R A;  4CNQ A;  2PKE A;  1Z3E B;  1FFV A;  1CEZ A;  5CP2 A;  4NM2 A;  2V9W A;  1ZD5 A;  1ZQT A;  1J97 A;  4ECZ A;  4ZH4 A;  3NRW A;  1RDF A;  3QEA Z;  7ICL A;  7ICF A;  4R64 A;  1S0M A;  3M6K A;  5KFA A;  5AM0 A;  4KLO A;  4RPZ A;  1BPY A;  2KTQ A;  4RUA A;  1J2N A;  3Q8P B;  4KLM A;  4YD1 A;  1ZJM A;  4O3R A;  1QQ5 A;  2UVV A;  4C8L A;  2E5S A;  4EZ9 A;  4DSJ A;  4Y2U A;  2HW3 A;  4JWM A;  1QSL A;  4MF8 A;  1VLB A;  2HOI A;  1COO A;  4GC7 A;  2KVS A;  9ICK A;  3ISB A;  2G5H B;  1O03 A;  3DDH A;  1JXL A;  4QZ8 A;  5J0O A;  5C5J A;  3L3F X;  2PI5 A;  4IS7 A;  4B9V A;  2FPL A;  5L1I A;  4DOC A;  3ICX A;  1NJY A;  5HR7 A;  1NKB A;  1XSN A;  2KMD A;  1DGS A;  3N97 B;  5AIB A;  4KIT B;  3H4D A;  5ALV A;  2XO7 A;  2HHV A;  8ICH A;  1X42 A;  2YTU A;  3MDC A;  3GQC A;  3UQ2 A;  3WK8 A;  4DLG A;  1TV9 A;  4PPX A;  1NK6 A;  2W9B A;  3MC1 A;  3GFK B;  4DFP A;  1ZQK A;  1RQN A;  1KFS A;  2R8K A;  3PV8 A;  2EZY A;  1IG6 A;  2EZX A;  1Z4N A;  1Z4O A;  3N7S C;  3T5L A;  4P0P B;  4K4G A;  3IG5 A;  3IDW A;  3IHQ B;  3UMB A;  9ICF A;  5DDY A;  5H2F U;  5AKK A;  4B9L A;  2AJQ A;  2FLN A;  2F77 X;  1SGG A;  7ICG A;  1JX4 A;  2YB1 A;  4QIW F;  1JRO A;  2DWQ A;  4C7Y A;  1C7Y A;  1ZXI A;  4QWD A;  1ZQS A;  3H0R B;  4IQV A;  3Q8M A;  3RF9 A;  3SAF A;  4I28 A;  3RJI A;  2XY7 A;  3NUQ A;  3TAD A;  4QZE A;  2W43 A;  3JPP A;  3RBD A;  5G5G A;  5J0T A;  2F1H A;  2WB1 C;  1K1S A;  4F2S A;  1U9L A;  1JXE A;  2KSO B;  1SIJ A;  4EX7 A;  4C8K A;  3ZDD A;  1SZP A;  4GXJ A;  2AH5 A;  2DGZ A;  3MDA A;  1L7P A;  3WKE A;  2DQN B;  3G6X A;  2DL0 A;  1ECW A;  2VA3 A;  9ICE A;  4DL6 A;  3Q8R B;  1ZQZ A;  5HHH A;  1Y88 A;  2O6K A;  4YD2 A;  3Q8Q B;  2ASD A;  4Y2Y A;  2D6F C;  1A0P A;  5KFS A;  2E1F A;  5DQG A;  4EBE A;  2ESE A;  2PMZ C;  1BPZ A;  1TK0 A;  3V7J A;  5CA7 A;  1FFU A;  2NRV A;  8ICV A;  4F2R A;  2LI6 A;  2HHS A;  4TUS A;  1QSY A;  3MGI A;  2Q0Z X;  4EBC A;  4O3M A;  2IBK A;  3F5A A;  2JR5 A;  5HML A;  5ALS A;  1U4B A;  1ZQR A;  1OXJ A;  3K4G A;  5AI8 A;  7ICU A;  4M6W A;  4NL9 A;  4NM1 A;  9ICP A;  4QWB A;  4TQR A;  1ZQP A;  2JEG A;  1QQ7 A;  1Z00 B;  1SKW A;  3CP8 A;  3FM9 A;  4CE6 A;  3KOO A;  1T3N A;  1N61 A;  3M9O B;  2FMP A;  2XY5 A;  5J8Y C;  2HBK A;  3GIJ A;  2HVH A;  4OJ6 A;  2IHM A;  3CW2 C;  3N7P D;  2VAN A;  1L7M A;  2YML A;  1D8B A;  4IR1 A;  2YQE A;  1KSP A;  1IM4 A;  4MFA A;  2WF7 A;  4NLN A;  4RQ7 A;  4J9O A;  5KG4 A;  5IIO A;  1ZRM A;  2DKX A;  5DBB A;  3SZ2 A;  1UA1 A;  4NWI A;  4F91 B;  4DL4 A;  2BCQ A;  1DXS A;  2IMW P;  3ZDA A;  4F93 B;  4ECR A;  5DQI A;  2W9B B;  2N1R A;  3H8M A;  1IV8 A;  4YP3 A;  3AN1 A;  1XS9 D;  5KFJ A;  1KFD A;  3ED5 A;  2MUT A;  3RJG A;  3MBY A;  8ICO A;  5CEH A;  4DL7 A;  4UAT A;  4ECW A;  2Y1I A;  2K4I A;  4JWN A;  3RBE A;  1WUD A;  5L9X A;  1XO0 A;  1KN5 A;  1ZRN A;  4PHE A;  2C22 A;  1TAU A;  4TUP A;  4KMU A;  2AXT U;  4KN4 A;  3SV4 A;  2XGQ A;  5KG1 A;  2RDJ A;  5EWF A;  2GO7 A;  5AKX A;  2V4R A;  4I2A A;  3MR3 A;  5ALN A;  1RPL A;  4R63 A;  5KFT A;  4TUQ A;  3ETL A;  4I2H A;  4O3P A;  2NO5 A;  1ZQ1 C;  3F2B A;  5KT5 A;  4RU9 A;  2JV3 A;  5EE1 A;  1MN8 A;  5ALD A;  1BPE A;  1ZQE A;  4I2G A;  2W04 A;  3PW5 A;  8ICX A;  2G09 A;  3HIL A;  9ICR A;  1ZJN A;  1NJZ A;  4CDG A;  3KFU F;  4PJ0 U;  9ICI A;  3B0Y A;  3PST A;  1NK9 A;  4C7Z A;  2CRX A;  4KLH A;  5ALF A;  5J2B A;  3Q8K A;  4F72 A;  5KL8 B;  3QXG A;  3SAG A;  2KZ3 A;  3UPQ A;  5EE0 A;  1S76 D;  3KKA C;  2FDR A;  5DB6 A;  4CGZ A;  4MHV A;  3LVW A;  2BR0 A;  5T14 A;  2Z7J A;  4DF8 A;  3RFA A;  1ZQA A;  2P66 A;  2E8M A;  5KTQ A;  4O3S A;  3EUB 2;  4KLQ A;  2JEI A;  4Z6C A;  3HP6 A;  4US8 A;  4DSE A;  4BXO B;  4FE3 A;  2VA8 A;  1N62 A;  4ECU A;  3O0F A;  3T3F A;  3GV5 B;  4M47 A;  2H3Q A;  1Z00 A;  3QEB Z;  4M6W B;  2EAM A;  3ONN A;  4HAI A;  2PFO A;  5KT2 A;  1X6J A;  4YR0 A;  3J81 j;  3GV8 B;  4DFM A;  2AU0 A;  2W7O A;  4UBB A;  2DPI A;  9ICT A;  3T79 A;  1NK0 A;  5DQH A;  3IN5 A;  3SI8 A;  5ALX A;  2BPC A;  4Y2P A;  4G3I A;  5KFN A;  5KFU A;  3HPO A;  3PSP A;  2DBY A;  1CI4 A;  3IRU A;  3M8R A;  1ZQY A;  5DLF A;  3WKB A;  3BQ2 A;  3OGU A;  4O5E A;  2YMQ A;  1XU4 A;  4PZN A;  3TAP A;  3N28 A;  4P0Q A;  1S97 A;  4PGQ A;  5AIC A;  1L8O A;  2A1J B;  5F9L A;  3OSP A;  4F4Y A;  5GTH U;  1HIW A;  4BUG A;  4EYI B;  7ICK A;  2DUY A;  2W55 A;  4EEK A;  3MR2 A;  1JUD A;  5CWR A;  2RP5 A;  1ZQO A;  4AP9 A;  3K1Z A;  4O5K A;  2K4E A;  5EE3 A;  4UB4 A;  5DG8 A;  4J03 A;  3THV A;  3RRH A;  3GDX A;  1RXV A;  1ZQL A;  5ALI A;  2KHV A;  2XVT A;  2ZIV A;  5KFE A;  4M9J A;  3DV9 A;  1QTM A;  4ED1 A;  7ICI A;  2PMZ F;  3M8S A;  2VIX A;  3QUB A;  4LJX A;  4O3N A;  5J8Y A;  8ICQ A;  3BS5 A;  2MUT B;  4P0P A;  3Q8S B;  2BCV A;  1Q8K A;  4M0A A;  7ICP A;  5D4B A;  2OCE A;  3F2D A;  3ZDB A;  1L6N A;  4J9R A;  2Y0S C;  5BOL A;  5ALZ A;  2NO4 A;  1LKY A;  2R8H A;  1RYR A;  1ZQG A;  4ELV A;  5ALH A;  3BQ0 A;  9ICW A;  1KL9 A;  1KKX A;  2ISP A;  4DSL A;  4NY8 A;  4RUC A;  9ICS A;  1F44 A;  4Y2J A;  2UVU A;  4B9M A;  4PGX A;  1TVA A;  4B9N A;  4GC6 A;  4I2B A;  3RH6 A;  3ZDC A;  4FZL A;  4QZF A;  2QB0 B;  5J2H A;  4F5P A;  1SB3 C;  3D2Q A;  1S5L U;  4DSF A;  4PHP A;  5DBC A;  5JTI A;  3PSI A;  5KFW A;  1S77 D;  4Q44 A;  3LVV A;  5AM4 A;  3H8W A;  4O5C A;  1B43 A;  1SXD A;  4DSK A;  2HSZ A;  2A1J A;  2H5X A;  3KHL A;  2A1A A;  1TK8 A;  3BQ7 A;  4ICA A;  1J2M A;  1PVR A;  2EAP A;  3QU4 A;  3I76 A;  4QZG A;  4QWE A;  4YN4 A;  3D6J A;  1L3V A;  3EYZ A;  3MGH A;  1NZB A;  4DL3 A;  4IRC A;  5J2D A;  2A3V A;  1Z1B A;  7ICE A;  1WCN A;  2CN1 A;  2RRD A;  1SKS A;  4UW9 A;  7ICJ A;  1T7P A;  1UT5 A;  3SD7 A;  3NVV A;  3V6H A;  4KLF A;  1Z1V A;  4UB5 A;  2W9C B;  2GOL A;  4U6P A;  2W7P A;  4P4O A;  3RH5 A;  1KQQ A;  2ASL A;  1WWU A;  3RB6 A;  3RJJ A;  9ICA A;  2E8O A;  3EWA A;  4M2Y A;  2XID A;  5DB9 A;  2XGP A;  1ZQQ A;  2YY6 A;  2HBL A;  1Q46 A;  5J2J A;  4UB8 U;  3CYM A;  1U48 A;  2G07 A;  4QZD A;  2B21 A;  1LB2 B;  1BNP A;  5KFD A;  5AI6 A;  5JUM A;  2JZB B;  5CJ7 A;  1N5W A;  4XUS A;  3WK4 A;  4KLS A;  3C2L A;  1CRX A;  8ICT A;  4USA A;  2K4H A;  2JEF A;  2UVW A;  7ICR A;  1NJW A;  4BX9 C;  3LWL A;  3RB0 A;  4LVS A;  2KFN A;  2ASJ A;  2FJ6 A;  2OEH A;  4YR2 A;  3LK9 A;  2ODG A;  4OCZ A;  2PFP A;  2HCF A;  3U26 A;  1MC8 A;  4RPY A;  4I2I A;  3QU5 A;  4UAZ A;  2JZB A;  4I29 A;  3C29 A;  2ZUD A;  4NLB A;  2KN7 A;  2W11 A;  2BCR A;  4TUR A;  5ALO A;  2WF9 A;  4C4S A;  5HP4 A;  4DO9 A;  2WHE A;  3QYP A;  3C5F A;  3WKC A;  3UQ0 A;  2EAN A;  4EBD A;  2HHQ A;  4QNL A;  4KTQ A;  1BPD A;  1SV4 A;  2K89 A;  5KNI A;  4QW8 A;  3JPQ A;  4J9L A;  1LVH A;  4JV2 A;  4OD0 A;  1XNS A;  3SAH A;  4JK1 A;  1N63 A;  1X9S A;  1EXN A;  4Q8F A;  3K75 D;  7ICM A;  4MF2 A;  2VJ5 A;  4I2F A;  1D8Y A;  4RQ8 A;  4UB1 A;  2WF6 A;  3UXO A;  3NVY A;  3AQE A;  1NNL A;  2BQR A;  7ICV A;  3WKD A;  2I9G A;  1L8L A;  2JGA A;  1TAQ A;  2WAQ C;  3NS1 A;  9ICG A;  5IIJ A;  2KD1 A;  1L3U A;  2QKQ A;  2B0C A;  4JB3 A;  1O08 A;  5KT3 A;  4ED7 A;  5AI4 A;  3TKA A;  1T4G A;  3WK9 A;  2KHQ A;  4ECV A;  5ALT A;  2ZIX B;  2ZIW A;  4DQI A;  1BGX T;  3M1Y A;  2BZF A;  4YQW A;  4HYK A;  1RXW A;  4UAR A;  4P4M A;  3CRX A;  2ES6 A;  7ICH A;  4O9M A;  4IRD A;  1SV0 A;  4ACO A;  3TAC B;  5DGB A;  3PX4 A;  3KZI U;  3PMN A;  4GIB A;  5IIN A;  1UHU A;  5CB1 A;  2IA6 A;  2ALZ A;  4F5R A;  5L1K A;  4KMO B;  1RG6 A;  4QZB A;  5F9N A;  2HHT A;  3OPX A;  5ALJ A;  4RQ1 A;  4RNO A;  5F3X B;  4B6J A;  2R8G A;  2ZXI A;  1KDH A;  2EDU A;  4F3O A;  3TAN A;  2MU2 A;  2XI9 A;  1S10 A;  1PVP A;  1ZQJ A;  3BS7 A;  5E79 U;  2BDU A;  1COK A;  7ICS A;  4RQ6 A; 
#chains in the Genus database with same CATH homology
 2DL0 A;  2EAN A;  2E8P A;  3SEN A;  1SV4 A;  5J8Y A;  3BS5 A;  5KNI A;  1F0M A;  3K1R B;  2LPE A;  2QB1 A;  4RQN A;  4IS7 A;  1Z1V A;  2D3D A;  2E8N A;  1WWU A;  1X40 A;  2EAM A;  4NJ8 A;  1B4F A;  2ESE A;  2KMD A;  1JI7 A;  1LKY A;  2EAO A;  2D8C A;  4PZO A;  2F8K A;  2E8O A;  1X9X A;  2YTU A;  2JV3 A;  1WWV A;  3BS5 B;  2KIV A;  2QKQ A;  1OXJ A;  2Y9U A;  1PK1 A;  5L1M A;  2F44 A;  3HIL A;  2DKZ A;  4NL9 A;  2L5Y A;  2QB0 A;  2K60 A;  4RQM A;  1B0X A;  2QAR A;  2QB0 B;  2B6G A;  1OW5 A;  3IDW A;  2ES6 A;  5J8Y C;  1LKY B;  1SV0 A;  1PK3 A;  4PZN A;  3TAC B;  5JU5 A;  2GLE A;  5JTI A;  1SGG A;  2F3N A;  1SV0 C;  2DKX A;  1V85 A;  2K4P A;  2Y9T A;  3KKA C;  3TAD C;  1UCV A;  1V38 A;  1DXS A;  1PK1 B;  1RG6 A;  4NL9 C;  1SXD A;  2KE7 A;  5F3X B;  4MHV A;  3H8M A;  3KKA A;  3TAD A;  2FE9 A;  1UQV A;  2KSO A;  3BQ7 A;  1SXE A;  5JRT A;  2EAP A;  2E8M A;  2KG5 A;  3SEI A;  2LMR A;  2KSO B;  2QAR B;  3BS7 A;  1KW4 A;  1COK A;  1X66 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...