4EZ9A

Bacillus dna polymerase i large fragment complex 2
Total Genus 197
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
197
sequence length
578
structure length
578
Chain Sequence
KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords DNA polymerase
publication title Structures of a High-fidelity DNA Polymerase
rcsb
source organism Geobacillus kaustophilus
total genus 197
structure length 578
sequence length 578
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4ez9A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4ez9A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ez9A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ez9A01
4PY5A 4KPYA 4GLXA 3RJKA 3ZSXA 3OYMA 1TFRA 4Z4FA 4Z6FA 2HHVA 3C2LA 1HJPA 4TUPA 7ICTA 3LALA 2WONA 4TUSA 1D5AA 3TAEA 7ICOA 4QZ8A 3QIPA 4Q45A 2BCVA 5CA7A 2FMPA 1LW2A 3PO5A 3SZ2A 1NK7A 1FXXA 8ICLA 5HRPA 9ICHA 3TAQA 4FS1A 3SQ1A 4F4KA 5EWFA 1S0MA 1JXLA 3K4GA 4F4WA 2RPIA 4IR1A 3QZ7A 3QINA 1BIUA 4KITB 2YNIA 4DL5A 4MFCA 3HL8A 4K4GA 1O1WA 3H8SA 1WSGA 3V81A 1L3VA 3ETLA 1BPYA 4CHZA 5KG4A 5L1IA 2C2RA 5DDMA 1TL3A 3TAFA 4PQUA 3L2WA 1NK0A 2P51A 2KQ2A 1SV5A 4CESA 3PW7A 4BE1A 1S0NA 2OPPA 4FJGA 1IM4A 3HVRA 1BIZA 4YXMA 4UQGA 3KJVA 1D8YA 3OGUA 4PPXA 4IRCA 3RMAA 4I2EA 9ICVA 1KFTA 2VG5A 2JEJA 3O4NA 4C8LA 2F1JA 4M6WB 3NDKA 1TKTA 2ZTDA 4PHAA 2PZSA 4B3OA 5J0OA 1TV9A 1VSEA 2KTQA 3RJEA 4YP3A 3PV8A 3ZDBA 4FJ5A 2XCPA 2ITGA 3PMNA 1Z25A 3QEAZ 4MEXA 5HMMA 4E3SA 3VQ8A 1RT5A 4DQQA 4JK1A 3KD1E 2OYQA 5CR0A 1NK5A 1J53A 2W9BA 1S6QA 2WOMA 5CZ2A 1QSYA 5KT7A 5EU7A 5KTQA 3S3MA 4DFKA 2PYLA 1ZQXA 3PW0A 1WNSA 1RYRA 1S6PA 4HUGA 3HJFA 2GUIA 5D49A 1CXQA 1WSHA 4F4ZA 4Q8EA 4FCYA 2O4GA 4FZXC 1J5OA 2EHGA 4KLQA 4FO6A 4DQPA 4ECTA 3LP3A 2NUBA 4J9QA 3P83D 3LAMA 5HP4A 1HPZA 1BPDA 4KHWA 5KFYA 1JLAA 3ZSZA 3QEWA 4FLTA 4J2DA 4Y1CA 3IM1A 3OSPA 1Z26A 3GIJA 3C94A 4Q5VA 3L2QA 4O4GA 4EYIB 4ID1A 1ZQJA 2JGUA 4FZZA 4YQWA 2JZBB 2QK9A 3TR8A 1TKXA 4H8KA 2B5JA 3V9WA 1Z00B 5DLGA 5KG1A 7ICVA 3NH2A 2KZ3A 3KHRA 1ZYQA 4DMNA 5JS2A 3LPTA 3RRGA 5I3UA 4DU4A 2FBTA 3C1ZA 1ZQWA 3JPSA 1D9FA 4O3PA 1X1PA 4NYNA 4NCAA 5DQHA 4ZTJA 4F3OA 4HVJA 4EBDA 2YHAA 8ICQA 1Q8IA 4O5EA 2I5JA 1BPXA 4KHYA 4YN4A 3HT3A 1TVAA 5KFZA 1UAXA 5CYMA 1RT1A 2P66A 4DL4A 8ICSA 3V7LA 3PW4A 4BE0A 5J2MA 4CEEA 1RBSA 4CIFA 7ICNA 1NOZA 5J0TA 3VQ9A 4OPKA 1T05A 4NLGA 4M2YA 3ZDCA 3P5JA 4CJQA 2AQ0A 1IKYA 3GV8B 4DO9A 3V1RA 2KN7A 3H40A 2NRVA 4QZ9A 1F21A 2LSNA 1TAQA 5K14A 4ECUA 1UT5A 4DFMA 4DTUA 1VSIA 5KFSA 4J2AA 1NKBA 5KFDA 2D0BA 1T7PA 4KN4A 1RDCA 4CEDA 4IG3A 4ZHRA 2XRIA 5DDYA 1PZNA 4K8XA 3SUQA 3MXIA 5CP2A 2B6AA 4M9LA 4G1QA 2DPIA 1L5UA 1NOMA 4RG8A 3G0ZA 4JUZA 2R8KA 4O55A 4BWMA 5J2NA 1ZQSA 3OYBA 3E2EA 2IA6A 4DOBA 4M3RA 2VG6A 4FLWA 3ZT4A 1KLNA 1X2IA 1WAJA 4M45A 1TK0A 8ICJA 5J0UA 4M3TA 4RW8A 1KFSA 1TVRA 3G10A 4FVMA 3JPQA 1SKSA 2XCAA 4M9GA 4TURA 2Z1GA 5KFJA 4RQ4A 4YCXA 4DF8A 1WSJA 2QKKA 1K1QA 4OGEA 1TKDA 4CIEA 3V72A 3BJYA 4CFAA 1BL3A 3VA3A 4JRQA 4IQUA 2NRWA 3HM9A 1RBVA 3TFSA 1SL0A 4LZGA 3TAMA 3HPGA 4M3WA 4GXJA 1XHXA 1KDHA 4M9JA 3S9HA 4RT2A 2NRZA 1YTUA 1ZQFA 4DU1A 4I28A 4XIUA 1XI1A 5J2KA 4RW6A 1IKVA 4GXKA 2GWSA 1ZQNA 4CJFA 4FJKA 1R0AA 3KLGA 4DU3A 2VG7A 3K58A 2OA8A 4KO0A 4F5OA 3Q8QB 4JV0A 4NXZA 4FBUA 3DLBA 4FM2A 3O4QA 1XS9D 9ICUA 1RTIA 3SQ0A 2BCQA 9ICOA 3IS9A 4O44A 4HHTA 2ZJ5A 4M47A 1DGSA 2ASLA 4TQRA 4NM2A 7ICSA 3M8RA 3U6FA 3V7KA 4KB1A 3LPUA 4KLUA 4KTZA 3U3GA 5HHIA 3UXPA 4MFFA 2Z1JA 4LH5A 4I2IA 3TARA 4F5PA 3V9SA 7ICUA 3NGIA 5KFWA 4JRPA 3KHHA 2HHQA 2PY5A 3ZDEA 3OYCA 3KK2A 3AA4A 2AU0A 4PHEA 3K2PA 2ZTCA 4ECXA 5DBCA 2YNFA 2IBKA 3C23A 4DSJA 3OYHA 3OYKA 4RQ3A 4IR9A 3HP9A 3LP1A 3N97B 5KGWA 4YNQA 4CEBA 4ECSA 2A1RA 3VQ6A 4RNOA 2IOCA 4QZBA 2J6SA 4ED7A 4FJLA 3QIOA 4CF1A 3LAKA 2ETJA 5KFBA 5KFMA 4C8OA 3B6PA 3RB3A 3ULDA 5C42A 2PXIA 3P1GA 1RZTA 5BPCA 3TANA 4CEZA 3Q8PB 4O5KA 1JN3A 4IBNA 2GV9A 4R66A 1L3TA 1MU2A 4O3OA 1KRPA 1RDBA 3ZD9A 4NLKA 3EPGA 2P5OA 1NK6A 2ASDA 3T5LA 4CF9A 1CZBA 2BQ3A 1BVSA 4FJ8A 3QNNA 2G8FA 4AHVA 5DB6A 4RPXA 4ICLA 4ED0A 4ECWA 4DTXA 7ICEA 3H8JA 4R64A 1ZBIA 1MSWD 4FLZA 3V6KA 5J0WA 4P4MA 2BPGA 4W5TA 2GBZA 5JS1A 4DSIA 3GIMA 3SV3A 4KLHA 4DL6A 2UVWA 3OSNA 3RMCA 3NGDA 2FC0A 5KG5A 1UOCA 2DFEA 3GFKB 4YD2A 3RB0A 3OYGA 4CHQA 2DY4A 5JUMA 1BCMA 4FBTA 4CGJA 3SJJA 9ICKA 4CHYA 2G8UA 3U3YA 7ICGA 4E7IA 5SZTA 4CGIA 4EYHB 4MFBA 2W9CA 1B22A 3ZSRA 4I2CA 1S9EA 2HNZA 1JLFA 4DTRA 3DLGA 4YMMA 3ISNC 1RILA 1VRUA 4OKEA 4DEZA 4N47A 5F9NA 3CM6A 2PFQA 1BQMA 4FJ9A 1CLQA 3IRXA 4XA5A 4CHPA 1VSHA 3VA0A 4DQRA 2IMWP 3RB4A 3NAEA 1TV6A 4QZGA 4BE2A 1KVBA 1JLBA 3C95A 3JPNA 4LSLA 2X6SA 2W9BB 3AU2A 3L8BA 4ED3A 3HP6A 4FXDA 1NJZA 2HB5A 4DOCA 3HO1A 1T03A 3OHAA 3SUPA 2YNGA 1HYZA 2P6UA 1RT4A 4CEAA 5C24A 3ZSYA 3CFRA 1KLMA 1T4GA 4M3UA 1WN7A 1BI4A 1ZQBA 5KT3A 1TAUA 3WNGA 1ZETA 2RN2A 4I2GA 1IKXA 3CFOA 3HXMA 3ORYA 2D0AA 4FK2A 1A76A 1WSEA 4DSEA 2D0CA 1IXRA 5CJ7A 1VK0A 5FDLA 4GC6A 2RKIA 8ICGA 3HPOA 3LDAA 5L1LA 3ALYA 2BPCA 2JLEA 1GOAA 3RH5A 4F50A 2XO7A 1LWFA 5KG6A 2AJQA 4DWIA 3DI6A 5FRNA 1J54A 3FYHA 1NKCA 1GOBA 1QSLA 4EBCA 2BE2A 1MQ2A 4FJHA 3RJGA 5IIMA 3MGHA 2BDPA 8ICUA 3T19A 4CJ4A 9ICWA 1B9FA 5SWMA 2VA2A 4RT3A 1JX4A 1JMSA 4Z4GA 1RNHA 4FLVA 3AVKA 4E7LA 4R63A 5KFCA 4O5BA 3L2RA 5T7BA 2FMSA 7ICMA 3D45A 2KW4A 4I7FA 4F8RA 3E01A 5FROA 4G3IA 3AO3A 4P4OA 1QS4A 3DRSA 4IQVA 3M9MB 3MBYA 3A2FA 5IIIA 4Z4IA 3ISCA 2BCUA 1MQ3A 3L2UA 4QZIA 4AHUA 4PGQA 2BHNA 5DMRA 5J0QA 3PX4A 1HRHA 3HW8A 4IG0A 1RBUA 5CYQA 3KK3A 3KLHA 3M8SA 3B6OA 3EYZA 1S0VA 3CQ8A 4UB3A 4DLEA 1HUZA 3RJFA 2YKNA 1VSKA 5J2IA 3MDAA 4EEYA 4F93B 3SI6A 4IFVA 5J2QA 4DSLA 4E7KA 2G8KA 4CJLA 4TUQA 3RTVA 3AA3A 3RAXA 5J2GA 4CE9A 3LK9A 5HROA 2HW3A 4I29A 3MEDA 3SQ4A 3AVGA 4AILC 9ICFA 4KREA 2P1JA 1A77A 4NM1A 1HNVA 3T5HA 2RF2A 1RPLA 3CYMA 5BOMA 4XUSA 1XWLA 4E7JA 4Y1DA 1ZQAA 1NK9A 4M9NA 3ZSOA 3DOKA 2H5XA 4B9VA 4TSXA 4CHOA 4RW9A 7ICKA 3CG7A 3AA5X 3L2VA 1ZQEA 3CFPA 2EX3A 2PFOA 4PA1A 3PNCA 2QKBA 4W5QA 5EOZA 2A1SA 4DG1A 3RR7A 2HVHA 3JSMA 4IDKA 4RQ1A 4QZDA 5DG9A 4B9MA 2BGWA 1T3NA 2I9GA 4AHRA 1TK8A 5DB9A 8ICBA 4X5VA 4UB5A 9ICJA 3QEVA 3ZD8A 4K8ZA 4N56A 1ZJMA 3C2MA 9ICXA 3Q8SB 4IRDA 3FDSA 1ZQCA 3OYEA 3DLKA 5J0SA 1V9PA 4QCLA 2Y1IA 4B9LA 5DBAA 4FK0A 4UBBA 1WSIA 3SUOA 3HWTA 3GIKA 4KI4A 4FK4A 3PW2A 3BQTA 1C6VA 1AROP 5KG7A 3F9KA 3DOLA 4I2JA 3RH4A 2HVIA 4HCCA 3PR4A 1VSMA 1IG9A 4Z4CA 3NGYA 4BACA 3AVHA 2YHBA 4Q8FA 2W42A 4QWDA 1RYSA 2DFLA 4K4HA 5DGAA 5KT5A 3TI0A 2R7YA 3V4IA 4FJMA 1YTAA 3BDPA 5KI6A 1ZQQA 1NJWA 2C2DA 1BGXT 5J29A 4GVMA 4PGYA 4GMJB 3DMJA 4OKJA 1UA1A 4CEOA 3QEXA 1S9FA 1COOA 4FJJA 4J9OA 4DL3A 3SUNA 3NF8A 4EZ6A 5C5JA 4Z0UA 2ATLA 3NGZA 4RNMA 3K5LA 3SQ2A 4CJRA 3PR5B 2VA3A 9ICMA 3WNEA 3DYAA 4ELVA 4TQSA 1BCOA 4KMUA 4NY8A 4KN7A 2BR0A 4B8CA 1X9SA 5DBBA 3GV5B 1TKZA 1S10A 5J2CA 1S5JA 4M6WA 3H08A 3ZSWA 3PY8A 2Q0ZX 2BQRA 1NOYA 2WTFA 1RT3A 3Q8MA 2G8HA 1EXQA 4J9MA 3KLIA 4EP4A 4CGDA 3I0RA 1KVAA 3VQ4A 1JLCA 3EPIA 7ICJA 4AHSA 1C0MA 1TGOA 4HTUA 4R65A 3T5KA 2PFPA 1XU4A 5D3GA 3ITHA 5KFNA 1BPBA 3AVIA 4YVZA 3NTUA 5KFEA 4JWMA 4FW1A 4F5RA 4KHQA 1ZBFA 1NK4A 1ZQTA 4YR0A 4KKOA 4F5QA 5HHHA 3PW5A 1BISA 4I9QA 4IKFA 3SV4A 2C2EA 3K57A 3RR8A 1IH7A 4M04A 4O3SA 3DLRA 2HNDA 1XHZA 1EX4A 3QERA 9ICLA 3MEEA 5DKWA 3V6JA 3VN5A 2BPFA 5IIKA 1A5VA 4QOZB 4OPJA 5E41A 1DTTA 5BOLA 3G6YA 4ELUA 3SYZA 3K59A 4FJXA 4MF8A 5KRSA 4CK3A 5L1KA 4J9KA 1YT3A 5KFQA 1WAFA 5KG0A 3AO1A 4I2FA 3OYNA 4FYDA 1UA0A 1KFDA 1N5YA 4CF0A 1EETA 1ZBHA 5KFOA 3BQ1A 1Y88A 4CHNA 1RTDA 2IC3A 1ZQKA 3VQPA 2PYJA 1S0OA 3AVBA 3MDCA 4DFPA 1ZJNA 4YMOA 3JPTA 3FFIA 2F96A 1KEJA 4F2SA 2JZBA 1C1CA 4CJKA 4FLYA 3ISDA 5HNKA 1ASUA 2E6LA 3K5OA 4ECQA 4KV8A 4FM0A 5IINA 3NHGA 2OZSA 1RXVA 3OHBA 1C7YA 1ZBLA 4PUOA 1JL1A 2ZUCA 4M3YA 2F1IA 1N56A 2OPRA 3PO4A 3AA2A 4CFCA 4ED2A 1U47A 1HNIA 1S1XA 2ZJ8A 3NBPA 3GDXA 4OKKA 3OJUA 2W9CB 3S3OA 8ICYA 4N76A 2RDJA 4CK2A 2QXFA 4DOAA 1BQNA 9ICBA 4W5RA 3KLFA 7ICLA 4KLOA 5KT2A 7ICRA 2I1QA 4OLAA 2FBYA 3AO5A 5KFGA 1HQUA 1W9HA 4H4MA 2R8HA 4AHTA 2HHSA 3HVTA 2D5RA 3OVNA 5L9XA 4M0AA 3LWLA 3QZ8A 1D8LA 3JPRA 3DLHA 2VWJA 4KHNA 1KSPA 2AGPA 4C8MA 4YD1A 1W0HA 4O3RA 1JLQA 2P5GA 3L3VA 2W9MA 4F3TA 4DTJA 3THVA 1JIHA 2Z1IA 2X6NA 4QAGA 3VQAA 3ZCMA 4CGFA 3O3GA 2HHTA 3QEIA 4NLNA 1BI4B 3VQQA 2JEGA 9ICQA 3UPQA 3RB6A 2R8GA 1LB2B 4R8UA 4J9NA 2VANA 1VSFA 3RWUA 5DB7A 2MUTA 1RT7A 3C6TA 3KLEA 5TZVA 4Z6EA 1SUQA 3RBDA 3HSTB 4CGHA 4Z6CA 3UQ2A 3C6UA 3LWMA 4Q0BA 1REVA 3PX0A 2AGQA 4YR3A 3MR2A 5IIJA 4KHSA 3OY9A 1ZQRA 3EWAA 1WLJA 5D46A 1U49A 4KLTA 2HHUA 2F8TA 4AH9A 3I8DA 4FLUA 4DSFA 4ZH4A 1VSLA 1SKWA 4RQ2A 3KHLA 3UXOA 1A5WA 2W8LA 9ICIA 3RJIA 2BCRA 3UQ0A 5DK5A 3O3FA 3AO4A 2M9NA 4YFKA 3ASMA 4BGDA 5KFFA 2FLPA 4CGGA 4LY7A 3OYAA 4CJPA 3NF7A 3MXJA 3KIOA 2HNYA 4RNNA 1JLGA 3VQBA 1QLNA 5DLFA 3MEGA 4F2RA 4Z4HA 3ZT0A 2X78A 2XGQA 4KHUA 5KGXA 2W9AA 1KVCA 3AVAA 5HP1A 2V4RA 2ASJA 2UVUA 3VQ5A 5D4BA 1H38A 4N41A 1S97A 2FLNA 3G6XA 7ICHA 8ICTA 3NF9A 4KRFA 3V7JA 4O0IA 8ICEA 4QZFA 4DL7A 2IHMA 1UWBA 5DQIA 3T5JA 1XSPA 1C0TA 4O3QA 2X74A 9ICTA 3MXMA 4QZAA 4IFYA 3PX6A 4F4YA 3VQDA 5J2BA 4DL2A 3AVFA 1SZPA 4ECVA 4OLBA 4BXOA 2PI5A 1K1SA 1SL2A 3V1OA 1S9GA 4DSKA 8ICOA 3TFRA 1QHTA 4DF4A 5J0YA 3JPOA 4UB2A 4JS4A 2J6UA 2ZD1A 4NLZA 4CIGA 1ITGA 4KAZA 3MGIA 1SL1A 1EP4A 4W5OA 1ZBUA 4JWNA 2IS3A 3KKRA 4L8RB 2O4IA 5HRRA 1JKHA 4RW4A 3IHQB 5C25A 1J9AA 1MC8A 4J9PA 3GQCA 3UXNA 4NCGA 3AVNA 3C5GA 3M8PA 4UBCA 1N48A 3RRHA 3K5NA 2E4LA 4Z4EA 5DG8A 3VQCA 1EXNA 2DTUA 1SKRA 5KFTA 5CWRA 2OZMA 4PHDA 3OS2A 4EP5A 2FPLA 1K6YA 4LZDA 8ICPA 2BANA 2OWOA 3KKSA 1Y97A 1XO1A 2Q3SA 1CUKA 3AVLA 4IQTA 7ICQA 3QO9A 1N6QA 5J2PA 4DTOA 2BQUA 1LW0A 4PWDA 3ZDAA 1RT2A 3VQ7A 4QZHA 4I2BA 4B9TA 4R5PA 2BGGA 2E6MA 3RMBA 4E0DA 4BDPA 1DTQA 5HRSA 1CZ9A 4FZYA 2B4JA 3V1QA 5CB1A 4YFUA 4QWBA 2PFNA 3MFHA 1QQCA 3SCXA 4DS4A 4QZCA 2ALZA 4FJIA 5KFLA 3CM5A 4CFBA 3C5FA 4UAWA 3KK1A 1XC9A 9ICAA 5J0RA 7ICFA 4B08A 1S1WA 3LANA 1U45A 4YXJA 7ICIA 1WCLA 1TK5A 3L3UA 4CEQA 5KFAA 3H4BA 4QW8A 9ICNA 3LP2A 3C1YA 4HYKA 3MAQA 1S1UA 1KCFA 8ICRA 4KLDA 4CJSA 3H4DA 5CZ1A 3H7IA 3ZSVA 8ICWA 1I39A 3TQ1A 4LSNA 4CK1A 1FK9A 4ECZA 4MF2A 3UIQA 4FM1A 4MFAA 1D9DA 3QEBZ 3QETA 5IIOA 4I2AA 1LAVA 4WE1A 3VQEA 3IAYA 2A1JA 4ECYA 5L1JA 3DRPA 3B0YA 4B8AB 4KLMA 4FS2A 2JEFA 3SNNA 1LWCA 4NCBA 4J9LA 1ZQLA 1S1VA 4ED6A 9ICCA 9ICEA 8ICCA 1ZQOA 4KLEA 3WNHA 3NH1A 4MEYA 1B92A 5EWGA 5DG7A 3V9ZA 4ECRA 5I42A 3HX0A 2FMQA 4CFDA 8ICIA 4CF8A 3OS0A 1UT8A 8ICKA 3AVCA 2FLLA 4IRKA 2FPMA 3GV7B 1U9LA 1JL2A 3RBEA 4IQWA 2ZUDA 3BQ0A 4EBEA 4F4XA 1XSNA 4RQ5A 1A5XA 3NFAA 3BGRA 1RTHA 1ZQIA 4FJNA 1ZQYA 2AQ4A 3OS1A 1C0UA 3K5MA 3ZDDA 4E1MA 3MR6A 1CXUA 5DGBA 4LH4A 4P4PA 4CECA 4CJEA 5KFRA 4HUEA 1TL1A 3MFIA 2FBXA 3H8WA 2MAXA 4FJ7A 4DS5A 4CJUA 9ICRA 4OVLA 2W8KA 1T8EA 3Q8RB 3HK2A 4KLFA 4FW2A 4CJTA 5KFHA 1KTQA 3TABA 3NE6A 5EWEA 4ED1A 1JXEA 4OJRA 4DTNA 2XY5A 3MABA 1Q9XA 2UVRA 4LVSA 1GOCA 4QWEA 1S77D 5KFIA 3DM2A 1QSSA 2ZE2A 1L3SA 2KZZA 4UB4A 1LV5A 1NJYA 1EKEA 4Q44A 2DFFA 4DQSA 4B9SA 3NCIA 1RBRA 2RDIA 3RMDA 1IKWA 3TAGA 3PMLA 4KLJA 4C8KA 2DFHA 1HYSA 5HMLA 3RAQA 5KFVA 4J2BA 4KI6A 3DRRA 1QE1A 3PUFA 4YG2A 5F9LA 1RBTA 4RU9A 3I0SA 2VA8A 5KG2A 1ASVA 3TWHA 4I2PA 3T3FA 4UAYA 1DOQA 3AU6A 4Z6DA 4M3XA 2XC9A 3D0PA 4GC7A 3AUOA 5J2JA 4CJWA 4YMNA 2HMIA 3OYLA 2ZUBA 4UAZA 3DLEA 3M9NB 2R8JA 4I27A 4BDYA 3C2KA 3MR5A 4UB1A 5FRMA 3EW9A 3LP0A 4JLHA 1U04A 2OPSA 1YVUA 4C8NA 3KTQA 4AHCA 1G15A 8ICVA 4R8UB 4RZRA 4CJ3A 5KFUA 2MUTB 4DTMA 4DQIA 4O5CA 1NK8A 1NJXA 2Z1HA 3C21A 1VRTA 1ZQVA 2HHXA 3G6VA 4I2QA 1JLEA 1BHLA 1ZQUA 4XQ8A 1RCHA 1HYVA 2BKEA 4KB0A 4PHPA 2NRXA 3ZSQA 8ICFA 2LYHA 5J2EA 4K4IA 1DLOA 3QNOA 3OYDA 4RQ7A 1LWEA 1Z00A 4E1NA 4GXIA 1BPZA 4HUFA 3IG1A 2C22A 4DTSA 8ICZA 1RT6A 1VSJA 2V4QA 4BWJA 4M41A 1HUOA 1FKOA 1ZQZA 9ICGA 3K75D 3JYTA 5J2FA 5KFXA 4O0JA 4DFJA 3T1AA 3V6DA 2ZJAA 2BCSA 3SI8A 1S76D 3SPZA 3LZJA 3AVJA 5J0XA 1HQEA 1X9WA 2AGOA 2DPJA 4HCBA 3NF6A 2XGPA 2F1HA 3JPPA 2HHWA 3ISBA 2YKMA 5CY4A 5KFPA 1S1TA 3SPYA 3RJJA 2YV0X 3PVXA 5J2DA 4J9SA 4OGCA 2PI4A 1ZQHA 1ZQGA 3S3NA 2UVVA 4BDZA 5DQGA 4E7HA 2IAJA 1L3UA 3Q8LA 5KFKA 3M9OB 4YR2A 4B9NA 2ATQA 5HBMA 5KRTA 1ZQPA 1VSDA 1ZQMA 1B9DA 4BXOB 3TAPA 1U4BA 1RDAA 3F73A 5HLFA 4CEFA 2ISPA 2XY8A 2KFNA 4P2HA 4I2DA 2YNHA 1RDDA 8ICAA 3O3HA 3AO2A 4H4OA 3HPHA 2NRTA 1WCNA 4B9UA 4E19A 2OPQA 3NH0A 1Z3EB 2G8VA 4J2EA 4I2HA 1BPEA 3V9XA 5J2HA 2IHNA 2XHBA 4LD0A 4JS5A 3MR3A 1ZQDA 4QWAA 1QTMA 4ELTA 4XRHA 4CJVA 8ICMA 2JEIA 3M8QA 2FPKA 3KHGA 4QZEA 5KT4A 4RUCA 2ZTEA 4F5NA 2VWKA 4MQ3A 5DB8A 4PH5A 4NYFA 3GILA 4RPYA 4CJ5A 4Q43A 4M3ZA 4ID5A 4CCHA 3EZ5A 4KLSA 3QEPA 3ZT3A 2P6RA 5J1EA 2G8WA 2G8IA 3WNFA 3ZT1A 4GW6A 1HJRA 3LZIA 4J9RA 2F8SA 4QWCA 1LAWA 3QESA 3Q8KA 5IILA 2V9WA 3OJSA 4ED8A 7ICPA 2Y1JA 4EZ9A 4KLGA 2KFZA 3AV9A 9ICPA 4O3NA 4QW9A 4RQ6A 3GIIA 4RQ0A 4N5SA 2R8IA 1RTJA 4F91B 1U48A 5KT6A 2ISOA 1B43A 2XY7A 4ZTFA 8ICXA 1I3AA 2KZMA 4KTQA 4JV1A 4RPZA 4JV2A 4M42A 5CHGA 5HRNA 3MECA 5KG3A 4PGXA 2IGIA 3HYFA 2B21A 3OYIA 3V9UA 1X9MA 3ZT2A 4RW7A 8ICNA 3QE9Y 1IO2A 4F92B 2C28A 3BQ2A 4E89A 1JXBA 2FBVA 4O9MA 4KTWA 4KLIA 1ASWA 1FKPA 1NKEA 3AVMA 5J2AA 1WSFA 4CERA 4W5NA 5J0PA 4FLXA 1C1AA 3KD5E 2J6TA 3V6HA 2A1JB 1C1BA 4CF2A 4KFBA 4KLLA 3LDSA 4DTPA 3OYJA 2XY6A 1HMVA 4RUAA 2ZQBA 1RXWA 4I9LA 3B0XA 4M9HA 3N4MB 8ICHA 3QLHA 3EY1A 4RQ8A 1Q9YA 1CEZA 3RH6A 4DLGA 2IDOA 3OYFA 1XSLA 3RJHA 9ICSA
chains in the Genus database with same CATH superfamily
2QWLA 4KPYA 5BJRA 3OYMA 2F4VK 3W66A 3FRYA 3W2WB 4MIBA 4JKCA 1C0UB 1FDAA 2B43A 3OHRA 3VALA 4BRLA 2WONA 4EHUA 2XLJA 7ICOA 2JWLA 2V51B 3AXKA 1HA1A 2ZF5O 5E3AA 1J6ZA 3FC4A 3DOLB 4WCEQ 4L76A 3SIPB 4FZMA 5HQLA 9ICHA 3SQ1A 3P3DA 2QIFA 5EWFA 1JXLA 1VBZA 4IOCQ 4EENA 3RF9A 2UUWA 3F56A 2YNIA 4DL5A 3P38A 3IAS9 3G87A 4K4GA 1O1WA 4IOXA 2K3KA 1A9NB 1L3VA 4ZLPA 2CNLB 5KG4A 3D2EA 2QMWA 1TL3A 1NNDA 3PFEA 4PQUA 2E7VA 3L2WA 3M6WA 2FDNA 1NK0A 2E5JA 4A5AA 3BSNA 2BOPA 4ILRA 3EUNA 3UKRA 4M5HA 4YXMA 2K7KA 2DY1A 4WWSA 3OFGA 1UPHA 3KJVA 3OGUA 4PPXA 9ICVA 2VG5A 1NB7A 5FIIA 3DRRB 1BMQB 1QE1B 2F1JA 1LVHA 3VAMA 3A0BU 4PHAA 5FPNA 3ATUA 5J0OA 2NQPA 2MJUA 2BABA 1NNEA 4LF8F 3ZDBA 3H2UB 2ZEJA 2ITGA 4DUZF 2WF7A 5GMKa 5HMMA 2AJFE 3DLEB 2UU9J 1IWGA 1FESA 3KD1E 5B0GA 1NK5A 1RXOB 5CZ2A 2W9BA 1FX2A 2AD9A 4DFKA 1ZQXA 3QRPA 3G8SA 4OHZA 4CGZA 5LJ3Y 4ANEA 3VGUA 1VDHA 4Q8EA 4FCYA 2O4GA 4CYUA 4NRTA 4FO6A 2VHGA 5HR7A 1E6YA 4ECTA 3VF0B 5HP4A 2Z30B 2A42A 4DUYF 1FEHA 1KQKA 3VEZA 3MD1A 4Y1CA 5C10A 3FQLA 5K8OA 3NL0A 1Z26A 3C94A 3R9LA 3L2QA 2IVOA 5AQPA 1IN0A 2RHKA 4EYIB 1KS2A 3AQEA 2MY8A 4WF9Q 3BZQA 3N9UC 5JXSA 4OJ1A 5KOWA 4JI6F 1T6CA 2JZBB 4KHMA 1IV8A 2OMOA 1TKXA 1TUWA 1LWEB 3P45B 4OV6A 3NEKA 2FJXA 2YHXA 4CVNE 3IFEA 2LM1A 5JS2A 1L3KA 2JXJA 3RRGA 4RPFA 3C1ZA 2MSTA 1RT6B 3KNAA 5E26A 4ZP8A 2HFZA 2RUSA 3A5OC 2QRRA 1QZ5A 2LQ9A 1X1PA 1HBNA 1S72S 5GAHP 5C2DA 2KHOA 1EZZB 3TU5A 5J8YA 1P1LA 3GYNA 3N7PD 2J0SD 5KFZA 4OQJA 1UAXA 3U1MA 1NHUA 1RT1A 5C0YA 4DPYA 3N0VA 1HQUB 3K1RB 2GAHC 1RBSA 4XTTA 1I6JA 1FDNA 2EK1A 4UTGA 2GS8A 5G0RB 4OPKA 1IJEB 5BYSA 3A8YA 3CF5Q 3FFKB 3HF5A 3GV8B 3V1RA 5D77A 4OMFG 1AB8A 1UZHA 3POTB 4ZCIA 1FO1A 1VSIA 5KFDA 4JI2K 4IG3A 1RISA 3D0IE 5DDYA 1R6VA 5HLFB 1URJA 1LQ9A 2C3UA 5CAAA 3Q2TC 3ZTOA 2B9XA 3C7NB 2QLXA 1SJ3P 1V4TA 5J2NA 4AYBF 4A8MP 1B99A 2RHQB 3HI9A 2QB0B 3UMBA 2FZCB 2Z2LA 2GVZA 5IQQA 2B3TB 3T41A 3ZT4A 4LF8K 3TO8A 4M45A 4DU8A 3M6ZA 2R7VA 4RW8A 3VAHA 4HWIA 4DOZA 1SKSA 1WHVA 5KFJA 2ZJPL 3R6MA 1K1QA 3NUQA 4IH5A 4NZ7A 4LFCF 5M1OA 4LFBJ 1HBOB 1O13A 4IQUA 1YK9A 3HM9A 1IJFB 2K3IA 3A12A 4YHHF 5ADXA 4M3WA 2JGAA 4KE5A 1WF1A 4RT2A 3TZWA 4DU1A 1RDWX 2GJIA 4FZLA 4XIUA 5AE3A 1NI3A 3VGTA 1IKVA 4A8SA 4GXKA 3R2CJ 5BREA 2FE9A 1R0AA 2XMUA 4DUYK 3EWGA 4F5OA 4NXNJ 4NXZA 1AYEA 4M7YA 2VFVA 2P9LB 1RTIA 3KKFA 4BRAA 3CJTA 5MLCV 2GQQA 2QFJA 4HHTA 5A0YA 1RBAA 4ZLJA 2ASLA 4O4RA 2QJ3A 1HNWJ 4JI6K 5ALYA 2A6MA 2OM6A 4CLKA 1RCOB 1W2BR 3UXPA 4MFFA 3TQEA 3IR5B 1KBUA 2EFQA 2AP1A 1R3NA 4YDDB 4OD0A 5JU5A 3O9UA 1T9YA 4ZKAA 2IJFA 4JRPA 5B0AA 1FRKA 1FJCA 2PY5A 3ZDEA 3KK2A 4ECXA 1IV0A 5DBCA 2VIHA 1OO0B 4NPOA 5SUHA 3NCQA 2BUNA 4MYTA 4GO7X 2P9SA 3LP1A 2O67A 3IC1A 3VQ6A 1K8KB 4RNOA 3VGSA 2IOCA 3QDKA 4DV4F 1UETA 5C25B 1HKBA 3THXB 4KBOA 3M8PB 3VZHA 1RZTA 4ZPDA 5BR9A 3CJCA 3Q8PB 3SQIA 4Y0FA 3GE1A 4AXJA 2DGSA 4GVBA 1GLBG 4E1JA 2MZRA 2D3OR 1RDBA 5CZVA 2FF3B 3OPKA 4A48A 2WONB 5AQKA 3BV8A 2YHYA 2RRDA 1FRXA 2UUAJ 1CZBA 2KXNB 1TUGB 1T02A 4CM0A 4ICLA 4DTXA 1QH9A 2RH3A 4OHXA 4FPIA 3OL6A 4FLZA 1F9HA 3V6KA 5J0WA 2BPGA 4W5TA 2GFFA 3GIMA 2YNIB 3OSNA 1H2TZ 4CZFA 5CA5A 1TL3B 3OYGA 5B0FA 2XS5A 4WXWA 1BCMA 3OTQA 4I6MA 3ZEUB 2ZNZA 5C12A 4LFCK 9ICKA 2YX8A 4CHYA 2XYPB 3QBWA 7ICGA 4KH1B 3UKRB 1PCAA 1M5KC 2RB7A 2BJ3A 2F40A 2LEPA 1VQ8N 2WB1C 3DOMA 3KJVB 4MFBA 2VG5B 4DV7J 4Q2LA 4DZ6A 1JLFA 4DTRA 5LM7E 4IEEA 4UOGA 3ISNC 2G5HB 3TYTA 4OKEA 1UAWA 3SEIA 3CM6A 1KDNA 3FZ2A 1LNQA 2AEMA 2B7CB 2DNYA 1VC6A 3IRXA 3AN1A 3GJSB 4BC9A 1WDDA 1H3DA 3G6EN 1S5ZA 3EE9A 1UL3A 1N54B 3CD6N 2VKQA 3FKBA 3F9MA 2XZDB 2XO6A 2GIFA 1KVBA 1X5TA 3C95A 1H2UX 3IGNA 5K20B 2X6SA 2W9BB 2Q1NA 3LPYA 3AU2A 4OJ5A 4DV5J 4URGA 4X4UA 4FXDA 1NJZA 1B64A 3LPEA 5GAEU 4J9UE 4CH1A 2W25A 4CEAA 4LF5F 1IQZA 1WI8A 1VQKN 4UT4A 1T4GA 2XI3A 2JH1A 3DDKA 4CYUB 3IRUA 4EWTA 1ZQBA 1DFDA 3CC2S 2VFUA 3BGRB 3WNGA 5AK3A 1ZETA 3Q83A 1RTHB 2RN2A 4I2GA 1K0VA 1E6YB 3IG8A 3NY0A 2BJDA 4FK2A 1YRUA 3QJPA 4DSEA 1E3MA 4YY3J 5AQRA 2W3SA 3HPOA 2BUPA 3R7SB 3LDAA 5L1LA 3TUJC 3ALYA 3DRYA 5LL6Z 5I9EB 2H3QA 3JAMY 4Z94A 1JXVA 3DI6A 1NKCA 2IVYA 4DV4K 3TR5A 4QPXA 2ZH6A 2GMHA 2BE2A 1MQ2A 1TKXB 4OI3A 2CPJA 3AGRA 3MGHA 8ICUA 3T19A 2JWNA 5IZHA 4X4OA 1N33F 4CO4A 3UFCX 2OEHA 4Z4GA 4JBCA 2XB2D 1GLCG 2B0CA 4FLVA 2ESEA 2D41A 3QUBA 5AZIB 4X4RA 4U96A 4HH1A 4I7FA 2GMJA 3MMVA 5LL6d 5IC4B 4G3IA 1FE4A 2JC1A 1RT1B 1CJVA 4V19J 4UZCA 2HQFA 1SAZA 5FJ4A 2QL5B 4AHUA 1QAIA 5J0QA 3I87A 3PX4A 3SENA 1N5TA 4BRKA 1BA0A 1GNKA 3KLHA 3KK3A 2M70A 4UY8T 5A8KA 2E1CA 3ILLA 2CRLA 2B4OA 4LQ3A 3TX8A 1DRZA 1HUZA 2ILYA 1FFUA 3GB0A 2IY5B 2IOFA 5AKYA 3O9TA 1K8AT 2HS4A 3NNCA 2XSJA 2G2YA 4IG3B 1Q79A 1IBMF 4CJLA 2H4WB 2VPZB 5J2GA 5C15A 5AQMA 2GNKA 5HROA 5M1KA 3PM9A 5AQZA 4I29A 4BRHA 4XPCA 4KREA 3GMGA 2E88A 1NU0A 1A77A 2NRHA 4CBXA 1HNVA 1RPLA 5J2NB 2FLOA 5IT4A 4K25A 3FUYA 2GVZB 2H5XA 4B9VA 2O3DA 4USTA 5GAGP 4RO0A 2OP5A 1EARA 3F2BA 1G1XA 3DEEA 3HSGA 4NLRA 4DG1A 1NG9A 4EX7A 1LK5A 1SJQA 1XUPO 2HVHA 4DHVA 3F44A 4RQ1A 2CYYA 3KUHA 2BGWA 1CJTA 3K1ZA 4B6JA 2DR9A 4AHRA 4K5RA 2OFHX 4F9OA 2F9DA 1DLOB 2KXFA 1F0MA 9ICXA 2XI2A 4IRDA 5J0SA 2JHDA 1NMEB 4LF5K 4QS9A 4B9LA 4LBIA 3HWTA 3GIKA 4KI4A 2WVEA 3PW2A 4K0KF 1C6VA 1AROP 2IM2A 5AM5A 4MDAA 2HVIA 4HCCA 4OJLA 3PR4A 1R0AB 4DHYA 3HT0A 1A0OB 4UASA 2W24A 4WFNQ 4Y0WA 2YHBA 3OL7A 4HHHA 4BROA 3EXYA 2I6XA 1RTIB 1RDFA 2AJ1A 2ZH5A 2R7YA 3BDPA 2RLTA 1BGXT 4IKAA 1LXJA 5A8WA 3DMJA 4OKJA 3OBYA 3RFAA 2EG1A 1KXPA 2WF5A 2WFAA 4DL3A 4OI2A 4B3TF 1ZD2P 5KAFU 4ANCA 1WSRA 4Z0UA 1Y5LB 1NM1A 5J8YC 4X4TA 4IO9Q 1HJOA 2XICA 3PR5B 2PEBA 4V19X 1NH8A 2BR0A 4MIWA 4OZ2A 3GV5B 3B8AX 5J2CA 3HKZC 4USKA 2DCLA 2PSZA 1SXLA 3KK2B 3H08A 4UOCA 2FJEB 3PY8A 2Q0ZX 2BQRA 3W2VA 2G8HA 3A0HU 1EXQA 4CZKA 1WOPA 1FA0A 2V94A 3VQ4A 1JLCA 2YNHB 4XDCA 4X4NA 2P9SB 1PILA 2WF6A 3LP1B 3BN4A 4H4OB 4GRSA 5LXYA 3CMES 3L4QA 4JI5J 1GMWA 4DKWA 3JXOA 2P9KB 1BPBA 1EX8A 2N3LA 3J7YI 1WHWA 4LF6F 3CDAA 3GL1A 2K8BB 1V4SA 4YR0A 2OYYA 1MA9B 5K8MA 4KGMA 1NHKL 1LOUA 5HHHA 1KTVA 2ZHOA 3RR8A 5AQUA 4AQYF 2HNDA 5F0WA 2A2DA 1W97L 4PKDB 2MLZA 1I51B 1IBMK 1BOTO 5E41A 4WU3A 1ESVA 2E29A 5AHXA 2H65B 2ZUGA 4FJXA 4DV3K 5L1KA 3S6JA 4EX6A 3M1VA 4ICLB 2N1RA 2IPOB 3EVOA 2W4CA 4H4KA 2DKXA 1UA0A 3H90A 1Y88A 2DVIA 3T7ZA 3TJ9A 4CHNA 1ZQKA 1K8AO 2H54B 1HHSA 2F96A 3GYGA 2DBYA 4F2SA 3ETRA 1C1CA 2U2FA 3ISDA 2HHHF 2PT0A 1SJ1A 4F3QA 1FNOA 3JS9A 2EC2A 2LQ5A 2NREA 4I6MB 5LT5A 2ZUCA 1N56A 2EWHA 2EVZA 4BVPA 3AA2A 4CFCA 1T9XA 2CVEA 1S1XA 1FD8A 2GJ2A 3NBPA 3GDXA 3DOMB 3OJUA 1C2PA 1T9TA 4JKEA 1XO0A 3CGIA 2O8DA 5CD4H 3S3OA 1JQGA 2Z2MA 2E1RA 4RQMA 5AE2A 1C4AA 5KPTA 4DOAA 1JLFB 3VGLA 2YPYA 2QA4G 1KVKA 7ICLA 4KLOA 1XK8A 4K0KK 3I8BA 3N5BA 3RBZA 3AO5A 1W9HA 4H4MA 2K60A 4AHTA 3HSJA 2HHSA 4KFBB 3IRXB 5E84A 4OI4A 2X1GA 3NAHA 2A0FB 1IBKF 1YBUA 3OBIA 2Z2YB 4OYOA 1D8LA 3JPRA 2BE7D 2CQBA 2VWJA 2XLIA 3CCJS 1KSPA 2O8BB 4UW9A 2AGPA 5GADU 2CQ1A 3ISZA 2HOEA 3RU0A 2P5GA 2E7WA 1U8WA 2KM8B 4DTJA 3THVA 3NP5A 4ZPCA 1YUWA 1JIHA 3BGUA 4B3TK 4X62J 2X6NA 4QAGA 3EGWB 4X4SA 3ZCMA 5IC6B 2IRYA 2YJFA 4NLCA 4Z37A 3AA8A 2VYPA 4DR7F 3N28A 3VQQA 2JEGA 2ZWPA 1ACMB 3ENHA 4QOTA 1W7WA 3QPIA 5K9FA 3DLLQ 2HBJA 4R8UA 1IBCB 1DAXA 3WK5A 3CW2C 1IBLF 2GV1A 4B1WB 4HEA9 5IM0A 3KLEA 1QZ6A 1TFWA 3KJQB 1KW4A 3TPQA 4CM2A 3LWMA 1LXNA 3KXDA 4C3KA 3TADA 3PX0A 4KHSA 4KT0C 2DHHA 1RACB 3EO3A 1T94A 3DI6B 2B9WA 2HHUA 3L9ZA 3RGIA 2F8TA 4AH9A 2VASA 3I8DA 1YITS 3NCPA 4FLUA 3D0HE 5G4DA 1J5EF 4LF6K 2F9WA 2HSZA 2BE2B 1P6TA 3S7RA 3PLAA 3UQ0A 1W2IA 1URNA 5DK5A 3IWLA 2MZTA 2RHFA 2OJ3A 5KPRA 4GFJA 3VPZA 4AQYK 1X3NA 3MMCA 5HVHA 2FLPA 2ALYB 2RHSB 3UW1A 2LYBA 1ZXIA 3A13A 4OHWA 4BRPA 4I7FB 3TA2A 1HBMA 1QLNA 2DIVA 4F2RA 2ZBCA 1S57A 4HI1A 3MM9B 4WKRA 3L7PA 3RRKA 1CJVB 3MWPA 1Q3UA 5IT9U 2CGLA 3MDFA 3NS1A 4US8A 4BC7A 1Z1ZA 1T9UA 3KK3B 3KLHB 5A8KB 1APSA 2IHMA 5DQIA 2HHHK 1CVJA 4OLOA 4ID8A 3W1YC 1WKLA 4ZP9A 2QG9B 3CD7A 1W7AA 1GXTA 2A2CA 3N7RC 2XSJB 2NNWA 1R8PA 4ZJOA 2PI5A 3QT6A 3JPOA 2E20A 1EO1A 5T7LA 3F5EA 2VQEK 4ILGB 3I1YA 1HNVB 2JFDA 1VYAA 4NLZA 1SL1A 2DKOB 3PRBA 1J5OB 2Q36A 3EEQA 4OYZA 1L7PA 3ULHA 2PFFB 2F9TA 2IS3A 3KKRA 2EG2A 1JKHA 4DUTA 4PXBA 1S6OA 4J9PA 1VIXA 1OSDA 1HPZB 2BBEA 4U7BA 5AKZA 1FFWB 1ZQ1C 3UXNA 3CCVS 1N48A 4F3MA 3RRHA 1V97A 2E4LA 1CJTB 4WFYA 3OBWA 1EXNA 1JNZB 4NWBA 4UQTA 5DDQC 4PHDA 2YY3A 1KVJA 4EP5A 3LO3A 2FPLA 2BANA 1MWZA 3QATA 3KG1A 2CQ4A 1Y97A 1XO1A 2KJ9A 4IQTA 1N6QA 4IH6A 2QEXN 2BQUA 3GFYA 4ZP7A 5AM2A 2X3DA 3VQ7A 2DRDA 2DO4A 3V2UC 2Q66A 3KFUF 1WWHA 3RZAA 2OEMA 2AH5A 3P39A 3DGVA 5AICA 3F2CA 3Q86A 1U8SA 2LXFA 4QWBA 1QQCA 4FJIA 2FYXA 4WK3A 4QS7A 3C5FA 2YH1A 3KK1A 5A8WB 4OI0A 2GHPA 4DR6K 1J5EK 9ICAA 1S1WA 3TP2A 4YXJA 3L3UA 3I9V9 2GLEA 1T05B 2WF9A 1IJJA 1HEKA 1FWLA 1EKRA 2KJ8A 4FE3A 4CJSA 2Q6BA 3WKEA 1HWJA 2YI1A 1QQ7A 2EZYA 2YQ1A 1FK9A 2KHQA 2ZFHA 2F8LA 4MFAA 3AJDA 1BUPA 5DO2A 4LF7F 4I2AA 4H0PA 1Q53A 5ELZA 3W2VB 2RQ5A 4OYIA 3IAYA 2A1JA 3WEEB 3DRPA 4NZ6A 2B6AB 4WQ5A 5B08A 1Q7LB 2JEFA 2ZC3A 3SNNA 4GKJK 4KLEA 4MEYA 2CNKB 3UWTA 5EWGA 3CCUS 2CPRA 4CFDA 4M5IA 2QKQA 4KQZA 1LKZA 2HURA 3OS0A 3ZNJ1 1UT8A 2JNJA 2ZH8A 5GINA 3U7JA 2Z58B 5LJ5Y 2DEJA 2Z8QA 3R1HA 2Y9HA 2F2AB 1JL2A 2XMTA 3RBEA 4J7CA 4M1KA 2KIWA 5AQNA 1PVRA 1U6FA 2ASYA 3V5RA 3NFAA 3BZCA 2YMQA 1TL7A 3MMBA 4FJNA 2AQ4A 3BREA 1YI2S 1B70B 3I55S 4FXVA 3LUYA 3OR2B 3MWBA 2V67A 4CJEA 3M1VB 2V68A 3BYPA 4IOAQ 4KH5A 2RUGA 3H8WA 2MAXA 2G9OA 5KL8B 2LM4A 4CJUA 1VGYA 2P6TA 3MURP 1X60A 3HULA 3HK2A 4KLFA 3R5GA 1KQGB 2UUCF 1FDBA 5LOQA 4DTNA 3H5SA 4BHQA 2IDLA 4UW2A 2ZBRA 2MLXA 4X64J 1TU0B 2JOQA 3DM2A 1QSSA 2ZE2A 1YJNS 1L3SA 3TSPA 1NJYA 1EKEA 1HLUA 1V6HA 2KT5A 5ETVA 4B9SA 2ZVIA 4MH8A 1S1XB 5ALNA 3NBPB 1RBRA 2RDIA 1IKWA 1OSCA 3RBXA 4K59A 2HBMA 4O8UA 3PACA 1NPPA 4H5WA 2KICA 5DETA 5HMLA 3RAQA 4NXMJ 4KI6A 4H4MB 4LF9J 4C0OC 2VBWA 2VA8A 5KG2A 3IKMA 3AU6A 5HMWA 2YNFB 2HEKA 1N36F 3DXKA 3AUOA 3CJ0A 3TVYA 4CJWA 5EE0A 2HMIA 4I6AA 1PK3A 2I38A 2D3O1 2DNMA 1YX2A 1RQLA 3OL9A 3K9JA 3I56S 1HWKA 2NYVA 1VIOA 4V1Ak 1UWAA 2FGOA 3C2KA 5C42B 4UB1A 4JLHA 3UD5A 2PA8D 4C8NA 3VTHA 2XYGB 1PC5A 5F8LA 4R8UB 4LF7K 3WDOA 4RZRA 4DPUA 4BRMA 4P9SA 5IM0B 1NK8A 3KLEB 2QTDA 2YTCA 2VFRA 1XR7A 4ZPWR 5H9EJ 2RQCA 3M30A 4I2QA 4Y2VA 1WDTA 4UB8U 1QY7A 5HAOA 2UV8A 2J9CA 1BHLA 3CC4N 4ZCLA 1BNOA 2DHAA 3HRDD 1N32K 2WW4A 3OTEA 3WIUA 1FXDA 2BKEA 3VEWA 2NRXA 2ASMA 2LYHA 3K7RA 3A3PB 2CPIA 2AHOB 2E1FA 5KOXA 3SMPA 2KL8A 2ZIWA 3M32A 2YWKA 3MMCB 2RRAA 3IG1A 2ACMA 1RWXB 2D4WA 4URSA 1VSJA 2V4QA 3VEVA 2KNJA 2X1FA 5CZXA 1HBMB 9ICGA 2PDAA 4JI1J 3JYTA 4DFJA 2DXEA 4RJVA 4ZVOB 1HQEA 2AGOA 1YJTA 3H42A 2YWWA 4HCBA 5F3TA 1ECWA 3JPPA 3BKFA 2YKMA 5CY4A 4FWRA 2EQYA 5KFPA 1S1TA 3SBGA 2UUCK 3GOIA 3HSZA 2CG8A 4NWIA 2HAIA 3UO0A 3EE3A 4OHVA 2LCWA 4M94A 2MKHA 2F1FA 4W90B 1L3UA 1H6KX 4LRBA 3Q8LA 2LEBA 2RU9A 4YR2A 4B9NA 1ZQPA 1VSDA 1ZQMA 3NRBA 1XNRF 3UR0A 4OX9J 3TAPA 1RAIB 4YOVA 3CNQP 4U8VA 5BRHA 1M5HA 3CJ9A 5T7LB 4CEFA 1FD2A 2ISPA 3BS7A 2KFNA 2OEJA 4DV7F 3SBTA 2ILZA 5BPLA 3BS5A 2NRTA 2ZH2A 1WCNA 3MN6A 5LSRA 2OPQA 1GO3F 1RWNB 4WZMA 3FCWA 1U2FA 3MOZA 4LD0A 4JS5A 2OKQA 4WYWA 2R7XA 4BLGA 4ELTA 1N36K 5DZ6A 1K47A 2EFGA 4JB8B 3BY5A 2JEIA 3BEXA 1YJWS 3EZWA 2ZTEA 4F5NA 2VWKA 1VQ9S 4ZVPB 4J91A 4NYFA 2OEKA 3H8MA 3GILA 4DV5F 2HHPA 6AT1B 2BANB 2OAUA 1RE1B 3KYLA 4Q43A 3CJQA 1OH5A 4BRIA 2VDHA 4U8YA 4RCHA 4HHUA 4OJGA 3C16B 2G8WA 2G8IA 3EZUA 1A6LA 3ZT1A 1NDPA 4J9RA 3ILJA 4ED8A 7ICPA 2Y1JA 4ISFA 5GAEI 2KFZA 2W40A 4JI3F 2F76X 3HZ6A 5HOOA 2A18A 2J0WA 3CMAS 3CTRA 4RQ6A 1RTJA 2VFTA 4F91B 2ISOA 3LA0A 1AW0A 4U6PA 2DWQA 2BRKA 2A6OA 1S1WB 1GMUA 1VQYA 2KZMA 4K5SA 3MCNA 5CHGA 2E5LJ 2VIXA 5LJVA 3NGSA 4NI2A 5DS7A 3O5TB 3EE8A 2R2SA 1XMQF 2K4PA 1RHMB 3AQFA 1GX6A 3V9UA 4EHTA 3SFGA 4JI0K 4O9MA 2NXCA 1FK9B 1YXQA 1FKPA 5J2AA 4B1XB 2R7OA 3GP9A 1Q0NA 1VR6A 5J2QB 3CCES 2VQFK 2A1JB 1C1BA 1NXIA 3VF6A 4EGLA 3DRPB 3OA9A 2FPHX 3LTOA 3NMAA 2ATCB 3EDQB 1KEKA 4DTPA 4J9VA 3AAPA 2F8MA 1RKJA 4C3MA 1HMVA 1WBDA 4JKFA 1ULRA 4I9LA 2UYTA 3N4MB 8ICHA 3B82A 2BVZA 3G82A 3UB5A 1Q9YA 1BU6O 2CQCA 5AQIA 1YAGA 4DLGA 3Q8VA 4U95A 2MQOA 2IDOA 4IJNA 2XMVA 2NLWA 5IT9Y 2K1RA 2Y0SC 4PYAA 2G2OA 3RJHA 3CC7S 1CPZA 4PY5A 1N34K 3UPFA 4C4RA 3F53A 5F1XA 5LMUJ 5HK4A 5ALDA 4OYAA 3ZSXA 5AZJA 1CJUA 1TFRA 2CDQA 1GXLA 2P8IA 2B0GA 4Z4FA 1NSQA 3GWCA 1XNRK 1TL7B 3MMBB 4ZVSB 3FRZA 4LMZA 2DGUA 2MQPA 2V2ZA 2HHVA 1P27B 3M6VA 4TUPA 2F3JA 4I68A 2NZ4A 4TUSA 4L6V3 3TAEA 2Q0UA 3LM2A 3L3CA 4KIAA 4IH7A 3RUBL 3QIPA 5IT9O 3D6RA 1F60B 2BCVA 5CA7A 1Q86T 1LW2A 3O0FA 1M6YA 2DPNA 3SZ2A 2O6KA 1PVPA 4QIEA 5HRPA 3CCQN 4F4KA 1S0MA 3KNGA 3SLCA 2X1BA 1TL5A 4IR1A 2W04A 3M7DA 1JCGA 1RM6C 2ZE2B 3HL8A 3ETLA 5L1IA 3OVAA 2CJKA 4F0KA 4CLPA 3ZTRA 5EUHA 2GO8A 3PTWA 5ALFA 1IKWB 2CNOB 2UUBF 2ZDOA 1SV5A 4BE1A 5B0BA 2WW8A 4FJGA 1IM4A 1RA6A 5M2RA 3CMEN 3HVRA 4DR3K 2BMBA 1QVFR 4MKAA 1D8YA 4I2EA 2K2PA 4CO3A 3EJMA 1UTAA 4M6WB 3NDKA 1PSDA 5HQMA 4NB4A 1VSEA 4JI3K 2XTJP 3DXKB 4NRUA 3HJEA 3H7HB 2LMRA 2QWRA 4FJ5A 1ATNA 1RHKB 2MHNA 2HMIB 2MHEA 1DZ5A 5EVZA 1RHRB 3GBTA 3DGPB 2EZXA 2GWKA 3AMZA 3QEAZ 4MEXA 3VQ8A 2NXEA 1RT5A 1UFLA 4JK1A 4C0HA 5L38A 2OYQA 5CR0A 4DXLA 2ZVSA 4OIXA 2WOMA 2E66A 1QSYA 3HI0A 3VV2B 3NASA 1IIPA 3Q7BA 3PW0A 4NX9A 3I33A 1S6PA 3MPWA 3HJFA 2BEFA 1RWUA 1VQLS 1CXQA 4WQ5C 4F4ZA 1FEEA 1KAYA 1UEVA 4GY2B 4KLQA 1WEZA 3H1QA 2R7UA 1UCNA 4KHWA 5KFYA 1JLAA 3M30B 3QEWA 2V69A 4CWBA 4I2QB 4BVOA 3D6HB 4UUXA 3IM1A 3ILIA 4RL1A 3H46O 2D1KA 3GIJA 3T1HJ 1YHQN 1SZHA 1DJ0A 3UR3C 4KH6A 5AXLA 3CIZA 2ZDPA 2JGUA 2KVCA 1KAXA 2F8HA 4H8KA 5ALGA 4LVOP 2ZIWB 4ES3A 5KG1A 3GCWP 4JD2A 3RW7A 5MLCQ 2IMOA 3LPTA 5F8GA 4DU4A 2FBTA 1P9YA 5CEHA 4WFBQ 4O3PA 2YWGA 3HRGA 2R3VA 4NYNA 3RVCA 3GG1A 1FEZA 4NCAA 2WB1D 2DRBA 3JYTB 1U1OA 4ZJQA 2O8FA 1ILYA 4HVJA 5AFUH 4EBDA 3JSBA 1Q8IA 4ILMA 2O66A 2IVMA 2DXFA 1NBWA 3K9KA 3GJQB 3HT3A 1HQEB 3OR1A 1TTHB 2KVSA 5CYMA 4DL4A 8ICSA 3PHEA 3PW4A 2AKWB 2YKMB 4BE0A 3AOCA 3WK9A 1S1TB 4CEEA 3BQ7A 2OH2A 3GIRA 3KOAA 3MN9A 3HFVA 3MI7X 3ZDCA 2PA3A 4OX6A 1RWOB 4CJQA 4DO9A 2KN7A 4B9QA 4I6WA 2NRVA 4NJ8A 2UXDF 1F21A 3FAHA 2LSNA 3SAFA 1KKHA 5AI0A 2QN6B 1OS5A 2LLZA 4DFMA 4A59A 2PMHA 5KFSA 2DXDA 1NKBA 2EFNA 1Q86O 1RDCA 2Q97A 4F71A 2UUBK 4ZVTB 3OTBA 5KAIU 3MXIA 1CBKA 2UXBJ 4G1QA 2JJ4D 2DPIA 5AXKA 4B3RJ 2IIRA 4PHTX 3BS5B 3HHEA 3BO4A 4O55A 2OPQB 3J7A1 3MN7A 1ZTWA 1IG8A 3ENWA 3GJTB 1VQ7S 1Y64A 4ZVGA 1XR5A 5DM7Q 1HHQA 2LQBA 5A8RA 4NYOA 4FF2A 4RLEA 2DISA 2CGJA 1NZBA 3FMWA 1KLNA 8ICJA 1YDLA 4M3TA 1KFSA 3G10A 3JPQA 5D0RA 1FNXH 1YJ7A 1PJ7A 2OHDA 4QBUA 1QAJA 3HD2A 5AI6A 1RFQA 1DKGD 1WSJA 2QKKA 1XC3A 3J8AA 2KD1A 2LEAA 3V72A 1JRPA 1UVKA 1UPMB 2HF3A 5DZ7A 2ZH3A 1X6IA 3VA3A 4PZNA 4X62F 4M5GA 3R1XA 1WWVA 4G1IA 1RBVA 4PZOA 1SL0A 2KDOA 2NZCA 4HI2A 4HLBA 1XHXA 1ZD3A 3S9HA 2N7YA 5GAHU 4A8FA 3M6UA 2NRZA 3PSPA 2N4DA 3VVUA 4AXIA 2DKZA 2OTJS 3B6BA 3QB0A 1ZQNA 4CJFA 4FJKA 2HQ3A 1WC1A 4DCPB 4FBUA 1T0TV 1UFWA 4BUGA 1VQOS 2ZIXA 1Y3KA 5IXUA 3O4QA 9ICUA 1D3WA 3MCAB 3QFPA 2WSEC 1VS3A 3IS9A 1HW8A 2H9ZA 3TJ8A 1BO5O 4NI2B 1D8ZA 4TQRA 3U6FA 1RLCL 2G2ZA 2A3JA 4B17A 3GCXP 1Q82T 1HBUA 4OZLA 3OW2M 2HZAA 1IM6A 1ED1A 1FKPB 2Z1JA 3D2SA 4DV1J 1HNXJ 4FPBA 4JEPA 4LH5A 2CPZA 3G86A 4FNHA 4OLPA 3TARA 3V9SA 2QC3A 2EAPA 4ZPAA 5KFWA 5JVGL 9RUBA 2HHQA 4MHVA 1NZPA 2IDEA 2D1CA 4CI0B 2AU0A 1JB0C 2R2RA 4WP9A 1HMVB 3OYKA 3G82B 4RQ3A 4I4BA 3O9SA 3HP9A 3N97B 3R6GB 4ECSA 3NGRA 1ZAVA 4FJLA 3QIOA 1ATSA 2JVRA 4CF1A 3K8VA 2K1RB 3KOOA 5KFMA 5MAOA 4Y2KA 5U47A 3RB3A 2FHOB 2CQGA 4CZLA 2UXDK 5BPCA 3H98A 4DU7A 5AZJB 1CJUB 3QNWB 3TANA 4OZ3A 2EFPA 1HHTP 2FQQB 4R66A 1L3TA 4WP8A 4O3OA 2JDJA 2HBZB 3ZD9A 2EAOA 4NLKA 3PKYA 3QXGA 3QAEA 2KP7A 2MKIA 4CF9A 8AT1B 3QIPB 2BQ3A 5CCLA 1BVSA 3ZZYA 1NGCA 2A1BA 2W1BA 2CJXB 4RPXA 1LW2B 4J90A 4F0MA 2KLAA 1T95A 2CQ3A 1UPPA 2E9ZA 1OPZA 4WJ3B 3GSDA 3BGLA 3M8ZA 3O4WA 2DGWA 1JMTA 5AM1A 4KRWA 5CHIA 4DL6A 3FEXB 3OTOJ 3A5NC 2KKHA 1Z05A 2UVWA 3OTDA 1U6BA 4YD2A 3ATVA 5CR4A 3F5AA 3QJJA 4CGJA 3QU4A 2A40A 4JKAA 2HFUA 5AK5A 3CQYA 2O8EB 5HMZA 3U3YA 4DN0A 4ILJA 4NLPA 4E7IA 4Y2AA 1S6UA 4U67L 5SZTA 1YKWA 1M5PC 3HKZD 4NLTA 4A8EA 1S9EA 2HNZA 2P6SA 1TQLA 2IVNA 3DLGA 1EIYB 4YMMA 4B3MF 3HDSA 3DHWC 1VRUA 1RILA 4DEZA 4N47A 2Y8YA 4FJ9A 2RRBA 4A46A 3QGHA 4CLLA 1CLQA 4DBQA 2HOQA 1FKAF 2QWMA 4ZIVA 3CJBA 1RT5B 3UQSA 2ASPA 4BE2A 3JPNA 5D15A 5ALPA 1RDUA 3L8BA 3HP6A 3LGMA 2YH0A 4B3SF 4HDGA 3HO1A 1T03A 3JTPA 3OHAA 5EX5A 2NYHA 2EPIA 2E1MC 3MX5A 3SUPA 1VQ4N 1HYZA 1BE4A 1DQAA 4CJ7A 5CD4A 5C24A 4USUA 2E5SA 1KLMA 4ES1A 5M2UA 1WOOA 2FUG9 4TKTA 4M3UA 4HKQA 5ETRA 4YB6A 3MEKA 5KT3A 4TY8A 4RNFA 1P90A 2IRXA 1FF2A 2HWHA 2YMMA 1B7YB 2CWXA 4KJIA 3AY0A 3PZPA 3ORYA 2APOA 5B0CA 2D0AA 3W7BA 3GZFA 1S48A 1ZS6A 1NJIT 3DV9A 5BR8F 1RLDA 5IT0A 3W3DA 3GTYX 2E1PA 1WSEA 4KGZB 5CJ7A 5FDLA 1HR0F 1VK0A 3S41A 1KOHA 4WIQA 4NA2A 2PN6A 2D3UA 1FRMA 4DR5J 3GLJA 2CN1A 3RH5A 2FXUA 1Q82O 1RG6A 2XO7A 3VF2A 3D3CJ 3BBFA 1JNRB 3T1YJ 1J54A 1R27B 2JLFA 2V2KA 2DIUA 1HNZK 1XNQJ 1QSLA 1ZM3A 2KK0A 3SSQA 3UDVA 4P0QB 1GT8A 5IIMA 2BDPA 1PVQA 2DNRA 2E2OA 4CJ4A 4CBWA 1PAUB 1B9FA 1W26A 4TLRA 4O0NA 4RT3A 1JX4A 4GV9A 3QICA 4DCCA 1NHVA 1RBLA 3FGVA 4R63A 3MF5A 4O23A 2O8FB 4DR2F 4O5BA 4BR5A 3E1YA 7ICMA 4PWWA 2XULA 5FROA 1N62A 4Y6IA 3BPDA 3ONQA 3KWIA 3QWPA 3MCOA 5IFMA 3OR1B 3IBCB 3CD5A 3DRSA 1QS4A 5LSLA 3W8GA 3O6WA 3MBYA 2W2NP 3ELHA 3OXGA 3A8IA 3D67A 5KPZA 4CO5A 1WI6A 3L2UA 2BZFA 1JI7A 3ET6B 2BHNA 1WOQA 2Q79A 2QL9B 5CYQA 1E4FT 2PMZF 3I32A 3O44A 4R0EA 8RUCA 3MMAB 3EYZA 3SCJE 2QSWA 2DNGA 3H2LA 1QQNA 3FQKA 1KKXA 2DYAA 2L08A 3JQKA 1VSKA 5J2IA 1JWWA 3MDAA 4F93B 3SI6A 4DSLA 4E7KA 2G8KA 3R7NB 2WB1F 2GEMA 3HHLB 3NVZA 3RAXA 4CE9A 4G1QB 4LIRA 3MEDA 3SQ4A 2QYCA 3SCLE 2QWQA 4AILC 4A8XA 5AJ3F 3C3LA 2P1JA 4B3MK 3BGFA 5LMNF 2V7ZA 2XMAA 1ZQAA 3FCVA 4C98A 3DOKA 5A8RB 4P10A 4RW9A 4G9BA 7ICKA 1X40A 2E5IA 3CFPA 1VLBA 2KG5A 4C4SA 2HVZA 1TUYA 3CCLS 2O8CA 4HTJA 4DV6F 3PNCA 2Y1LB 3CULA 1X0PA 4W5QA 5EOZA 2A1SA 1L8OA 3L0QA 3RR7A 3D1QA 5DG9A 4B9MA 4P7VA 2FTRA 3W2WA 4LFAF 2KH9A 2I9SA 5DB9A 2Q31A 1QVFM 4C4TA 1CZAN 1SBRA 3ZZPA 1T6DA 4B3SK 4JHDA 4UB5A 3WQTA 4K8ZA 2Z7JA 2CZVC 2BA9A 3C46A 1S4EA 1ZQCA 3DLKA 4MAKA 4QCLA 3OFEA 3UDCA 4C0ZA 4ZVEA 2WK4A 3G71S 2W6LA 5AIAA 3SAHA 3THYA 1BWFO 3DOLA 1WHXA 2J0QD 5HATA 1V5VA 1IG9A 5GTIU 1HR0K 4H0TB 3NGYA 1YIJS 2ZIXB 4Q8FA 2YCHA 2DFLA 3GG4A 3QSYB 2IOHA 2VBZA 3TI0A 4H5VA 3V4IA 5KI6A 1O03A 1ZQQA 2C2DA 5J29A 1JALA 4RQNA 1UA1A 3R97A 4MKYA 3DU6A 1DQ9A 1COOA 3QYPA 2XLKA 1TE2A 4KX3A 1Q16B 4MLEA 2LXIA 1HBUB 2KVIA 5C5JA 2FSNA 1NJIO 4RNMA 3K5LA 3SQ2A 4CJRA 1CS4A 3WNEA 3DYAA 4ELVA 4WKYA 4KMUA 4J8FA 5HBMB 3LDOA 1S10A 2IJNA 2XVTA 4DR2K 1YWXA 4XPEA 2FJBB 3C0BA 2RIJA 4JI1F 2HGLA 1NOYA 4TNOA 3J7ZO 3MWTA 4J9MA 1U7LA 4K41A 4EP4A 5EY4A 2W43A 3F2DA 1JJ4A 1WACA 3EPIA 4AHSA 1C0MA 1HI8A 4HH0A 4R65A 2R42A 4A8QA 4K50A 3FNNA 3ITHA 4NLSA 5EDWA 1F2HA 3SCIE 3VQTA 4DV2F 4YVZA 5GAGU 2D0OA 4FW1A 4JWMA 1Q78A 4F5RA 1N8RT 4K42A 5F2RA 1V38A 1NK4A 2WF8A 4KKOA 3Q7CA 4IO1A 4X65F 3PW5A 4CE6A 4IKFA 3HHLC 3DDIA 1T9VA 1J2NA 3DLRA 1XHZA 1EX4A 2CFXA 1CJKA 3MEEA 4ZPTR 2P9UA 5JICA 4E98A 4OX9F 4QOZB 4OPJA 3BKUA 4GO5X 1DTTA 4QYZK 5BOLA 3G6YA 4BCAA 3ZTQA 3OL8A 2AZ1A 2EXUA 5KRSA 1GXUA 5KFQA 1WAFA 5KG0A 5AJ3K 1N5VA 2V9KA 3AO1A 2FJWA 4OYMA 5ADZA 3E51A 5LMNK 4JI8F 1ZBSA 4BS2A 2H3EB 1ZBHA 1XMOF 4MTPA 2K4IA 3NRZA 2IC3A 3AVBA 3MDCA 4DFPA 1ZJNA 5F0XA 1ZTTA 2JZBA 4L74A 4DV6K 4CJKA 1SQFA 4JK9A 5HNKA 4ZVFA 3K5OA 1ASUA 2E6LA 2G0AA 4ECQA 4FM0A 1X6JA 1DARA 4A8OA 2RJZA 2E5HA 3OHBA 1ZBLA 2OZSA 1EWQA 4PUOA 1N5XA 2JZ5A 3G9CA 1JL1A 4LFAK 3AQPA 1JCFA 3WU2U 1VQPN 5JMNA 1BLUA 4YB5A 1FW6A 1UVLA 3DAWA 3HFKA 4JMUA 4OKKA 2HSTA 2E1YA 4Y2UA 1S9EB 2HNZB 2RDJA 1U1KA 4CK2A 1YGYA 4QYRA 1BQNA 3DLGB 3IUCA 3KLFA 5AQSA 4JV5J 5KT2A 5E2QA 1VRUB 2DNQA 3D3BJ 2FBYA 2V8DA 4DV0F 2GMLA 1HQUA 4TXSA 2R8HA 4CNZA 1FJGJ 3D1OA 5AKXA 4CDIA 5D6GA 2D5RA 2EDUA 5L9XA 5F8MA 5AI4A 3W61A 3LWLA 2PEHA 3QZ8A 4EAHD 1AQ6A 4K4XA 4OV1A 4A62A 3QLHB 2HI0A 1ZXOA 2QO3A 3D0GE 2DD8S 4C8MA 1W0HA 2RMLA 4QIWC 2W9MA 3L3VA 4WBFA 3CXCR 4F0HA 2ZWHA 1T03B 2EC0A 2MA1A 2HS0A 2R7QA 4ETXA 1CC8A 1NU4A 2ZM6J 5C24B 1KLMB 4OI6A 2HHTA 1VBXA 1F44A 2GAGC 4M5KA 1RJJA 5ETQA 3RB6A 4TY8B 4OZ1A 1LB2B 4JI7J 3G4SN 5HMXA 2C2KB 4J9NA 1VSFA 3QYYA 3RWUA 3PG9A 4RWWA 2VODA 5FDLB 4Z6EA 1BD6A 4A47A 1BA1A 2Y9UA 5H1SQ 1REVA 2WUSA 2J7UA 1SJFA 2XMKA 5FPEA 1B4SA 4ZVRB 1M5OC 1ZQRA 4J37A 4DV2K 1U49A 4KLTA 1VQ6S 4DSFA 4ZH4A 4RQ2A 1WHYA 1N5WA 1VI7A 1NPKA 3P4IA 1HUXA 4X65K 5JVHL 3A3OB 2H1YA 1Z4OA 2M9NA 3DHXA 3ASMA 5KFFA 2VGMA 1HWUA 2ZH7A 2E2QA 4LY7A 3H3NO 4US9A 3MXJA 5E0OA 4MKVA 4RNNA 2JRZA 2W2OP 2MZ1A 2BM0A 5M1NA 3DRSB 1N8RO 3WK4A 4Z4HA 2NXUA 2KI2A 4U7UK 2C1EB 1PYTA 3ZT0A 2XGQA 2QXLA 3ENVA 5KGXA 2W9AA 2OGUA 3A5LC 4JI8K 2G5IB 3L4BC 2UVUA 5F8NA 2XG8A 1D9AA 1VQNN 4AL5A 1SB3C 3V7JA 4KRFA 4ZIWA 5CYQB 8ICEA 4USMA 4DL7A 2DR6A 3W8PA 2J9EA 3T5JA 3BBBA 1QD1A 4IOCL 1QDUB 3WKAA 4P74A 4O3QA 3RW6A 4YOEA 3VQDA 2COLA 4F4YA 4BC4A 5J2BA 3ZTPA 4ENOA 1F5SA 2VU5A 4ECVA 3TA1A 1I1GA 1S6QB 1Q7YT 1UMJA 4BXOA 1XJWB 3JAMU 3V1OA 4NLOA 3TFRA 2W2PP 5J0YA 4W98A 3C2PA 3CJ3A 3MEDB 3OLBA 2GQ2A 2J6UA 2H51B 2ZD1A 2DH9A 3KMSA 1G4CA 1N0UA 3LW5C 4W5OA 3QGIA 4DV0K 2HPUA 3DOKB 1K8KA 4RW9B 5HRRA 4RW4A 3IHQB 5C25A 1MC8A 2G1DA 3CB4A 3Q23A 4A8YA 4GMKA 3GQCA 1XQIA 1MDUB 2B56A 1R31A 3C5GA 3M8PA 2XBPA 3ENQA 3K5NA 4Z4EA 3LF0A 2FVCA 2DRAA 1WC0A 1U1MA 3OUYA 1A6SA 3C6AA 4BC2A 1O8BA 4JHDB 1XNSA 1HFEL 4LZDA 2C2NA 1WOSA 3KKSA 1DURA 1V3ZA 3DLKB 3FR0A 3QO9A 3SJHA 5J2PA 2YKOA 3PYGA 4B9TA 3THYB 4K4UA 4IQXA 4IQMA 1FRJA 2VKZG 3WXMB 3A5MC 4B1ZA 2HWIA 2ZBPA 3SD7A 1DTQA 2B4JA 2LDYA 3V1QA 3K8WA 3KLVA 2PFNA 2W4DA 3MFHA 4NOHA 3SCXA 2ALZA 3D2QA 5KFLA 1Q8BA 3V4IB 1HLWA 3T1HF 4UAWA 4CRXA 2C3PA 1CULA 3E3XA 5J1NA 3AD8C 4B08A 3QQCD 3LANA 1U45A 1K73T 3ZEUA 1WCLA 1TK5A 4CEQA 5KFAA 2GO7A 5AXMA 4ITSA 1BHNA 1CLFA 4C7QA 3MAQA 4CF5A 3AB2B 1CS4B 8ICRA 3H4DA 3DYAB 4X66F 2W2QP 2POKA 2RSQA 2ZZMA 5K8NA 1YRTA 4CK1A 4ECZA 1SH3A 1VJQA 3UIQA 4BG8A 4FM1A 2VC0A 4G9ZA 4DMZA 3UMGA 2NV3A 4A61A 1ZD4A 4BRGA 3AH6A 4H0YB 4I1TA 1VQ5N 4P71A 1ZOLA 4B8AB 5T14A 1URRA 5ADXH 1ZQLA 1TMMA 9ICCA 3ITHB 1Y11A 3NH1A 3AY9A 4BGBA 4KHPF 4FZVA 3VC8A 3LQVA 1VK8A 3HX0A 1Y3JA 1RGIA 4KKOB 1RAHB 4GKKF 1S7HA 1FJEB 2W11A 1OVYA 2OTLN 3FSIA 1TVRB 3CF5L 2BJ8A 4J03A 2QLBB 2FPMA 3GV7B 4CO1A 1U9LA 3HCXA 1X0FA 3AL0B 1CJKB 2V2VA 4IQWA 4ZN3A 3MEEB 2P9UB 3BQ0A 3CPEA 3CCMS 1XSNA 2M4MA 1A5XA 3BGRA 1RTHA 1DTTB 3OS1A 3AAQA 3K5MA 5AR0A 4E1MA 1RAOA 1RZMA 2KN4A 4JI2J 1D1UA 4K4ZA 5C2GA 4JB3A 4LH4A 1HD0A 2UXBF 4CECA 5KFRA 4HUEA 1TL1A 1SC3B 5AE1A 2FBXA 3TACB 4FJ7A 4DS5A 4OVLA 2W8KA 2D3ZA 4GVLA 2QA4N 2W54A 3H6EA 1BY9A 7FD1A 3QUQA 3PRDA 2IC3B 2O01C 5KFHA 2H3FA 5EWEA 1JXEA 4OJRA 3AARA 1CG2A 1Q7YO 3MABA 2Y0BB 4LF8J 2IYIA 4QWEA 3AJ1A 3CP8A 3CPWR 4PUOB 4NL5A 2CGKA 1O0PA 4TYBA 3M5RA 5FPMA 2EK6A 3CCSS 2VJUA 1EB0A 4BGAA 4DQSA 3QT8A 4S0MA 1PC4A 4BRQA 5AZIA 5D4LA 2AEJA 1SI9A 3RMDA 3VCBA 3L6QA 1BQNB 4IC9A 4BQLA 2IVFB 3KLFB 5HMYA 5IWAF 1HYSA 3CQXA 5KFVA 4YB7A 3UNGC 3FZFA 2DBBA 4OJ6A 4KYZA 3J80U 2LI6A 5F9LA 1RBTA 4RU9A 3I0SA 1ASVA 4CNQA 2ACYA 3QMLA 1FHTA 2LXUA 2FIUA 1Z19A 4WQ4A 1GLAG 4DUYJ 3HD1A 3SSRA 3VAJA 1SC1B 4BRDA 4YMNA 1VQMN 4CW7B 2M5YA 2J9DA 2Y0SD 3CO9A 4AE5A 3CDUA 1J27A 4EEKA 4JI6J 2D0PA 5E5NA 3LP0A 4X66K 3MHYA 1HPMA 1YJRA 2NO4A 1U04A 5LJWA 4DV1F 2OPSA 1HNXF 2MGZB 3DC2A 2AXTU 2I7PA 1G15A 2J76E 3PYEA 1U26A 5KFUA 4DQIA 3L7OA 3F41A 3IP0A 1D4XA 5KAKA 4PJ0U 1VRTA 1K73O 5TKYA 1REVB 5E3CA 4DUZK 4FZNA 2VJ4A 1U1QA 2BW2A 3AJ2A 2KRBA 2PBDA 1JLEA 3W60A 1VC5A 4KAIA 4FXWA 4KHPK 5KNIA 4KB0A 4DR4F 3QNOA 2QLTA 1DLOA 4AT1B 4ALZA 5ALIA 4FYVB 5IOLA 4UARA 2V34A 3PIOL 2NXNA 5HVFA 1Z00A 4HUFA 1U0HB 3SSSA 8ICZA 2ROPA 3ID8A 3U02A 4Z7YA 3N4QA 1GLJO 2HIYA 2H5JB 4M41A 3WK7A 3MTKA 1YF5L 1FKOA 3OXLA 1N5QA 2E1AA 1ZQZA 3O8MA 4MDBA 1OKJA 4FWNA 1WUAA 4OX8A 4K43A 4PG5A 3T1AA 3BN7A 1Z1VA 2ZJAA 3SI8A 2AF6A 2CQ2A 4FF3A 2H3VA 5JTIA 1NGBA 4NASA 2F1HA 2HHWA 2K4EA 2YXLA 2AYEA 4I56A 3SPYA 3RSEB 2WBNA 4Y00A 2CRXA 1NGIA 3KG4A 3S3NA 4BDZA 1F9FA 3H1VX 1QM9A 5FD1A 1N63A 4CBUA 3IFRA 1TFYA 3MAAB 3M9OB 2ATQA 2CQDA 2FJ6A 3N79A 2IVPA 2AJ0A 3S1TA 4ZVHA 4BXOB 2ODGA 4LFCJ 2VD3A 2MY7A 4ZPVR 5AFUA 4NZ0A 3X1LB 1GFWB 1R43A 3CJ2A 4Q7AA 2ZD1B 4P2HA 4I2DA 2YNHA 2JX2A 5IWAK 3O3HA 2DHGA 2MLYA 4H4OA 3HPHA 2AMCB 1RAFB 4Y2XA 4FVCA 4B9UA 3M4XA 4E19A 3NH0A 1Z3EB 4BBYA 2P9KA 2E8AA 2G8VA 4J2EA 4RW4B 2QA2A 3CJ4A 1NSAA 3ICXA 3V9XA 5J2HA 1PAEX 1EWRA 2IHNA 3MR3A 3BSAA 2CIMA 1QTMA 1HL6A 2F7VA 4CJVA 3D6JA 4FPRA 5ALQA 3R8EA 2L3MA 4ISEA 2K06A 3EKSA 2FPKA 4Y2QA 4RUCA 2DK2A 3PIPQ 5DB8A 3OUYB 5AM4A 3EGZA 3NVKA 2NO5A 2CXYA 2JVOA 4HAIA 3CRXA 2PGCA 3QT5A 3J81U 1PK1A 3MCMA 3HHNB 3QO9B 3VGVA 2P9PB 2J8SA 5J2PB 4ID5A 4I67A 3DCAA 4CCHA 1XMBA 2A10A 4L3QA 4C8YA 1P9QC 5J1EA 5L8RC 5ALMA 2E44A 4O3MA 2F8SA 1OJ4A 3QESA 4BC3A 3GFXA 3MPYA 4EZ9A 1DTQB 2QSFA 3MM7A 3BH6B 3AV9A 3HMJG 2HLTA 3IG5A 3QMQA 4O3NA 3C65A 2IOFK 5A6WA 4LF4F 4DR5F 3ENOA 4IFEA 3CXCM 4P2FA 1B43A 2KT2A 1CULB 3PHTA 1P7DA 1I3AA 4KTQA 3SQGA 4RPZA 3U1NA 4DR4K 3MECA 1XNQF 2YN4A 4DV4J 2IGIA 4C11A 1UVNA 3WXIA 2B21A 1AFJA 1H74A 4YHHK 3ZT2A 3LH2S 3KUEA 3VZIA 2C28A 4E89A 2DITA 4KLIA 1H98A 1L7NA 1WTFA 1S7IA 1C1AA 2JL9A 4WYLA 1A0PA 4CF2A 5A6PA 3L3FX 5ALEA 4KFBA 4KLLA 2OELA 4JI4F 2HRUA 1KWMA 2MDAA 2Y9TA 2AX0A 2GVDA 2K8GA 1FIQA 3U26A 2Y1RI 4RUAA 4RUHA 1BC6A 2ZQBA 4RKUC 3BR8A 2XZTB 4M9HA 1TP7A 1ZA2B 3HBTA 3EY1A 4RQ8A 2O8BA 3RH6A 3EX7B 5FLXY 1BXNA 1U25A 4QIFA 2QWNA 3KDNA 2ZIVB 4RU2A 1XSLA 9ICSA 2B8QA 4GLXA 3L09A 1ZPWX 3E0FA 2N82B 4X84A 3A8JA 3FVYA 4DCOB 2F3NA 1RTZA 3O08A 5M1PA 6FDRA 4Z6FA 2BOAA 2DF4B 3C2LA 1HJPA 7ICTA 1R8CA 2CA9A 2Q6CA 4ZOSA 4FKXA 2E8OA 3I9ZA 1TL1B 1FI4A 2WTUA 4Q45A 1PJ6A 2HBLA 2CNNB 1SV4A 4ED4A 1GX5A 5EX0A 3THTA 1MNEA 1YJ9N 4QJFB 2HYIB 2E2PA 4RWXA 4FS1A 3CCRN 1RKIA 2EH9A 3K4GA 3TNVA 2RPIA 2G08A 1VBKA 3QZ7A 3QINA 1OH8A 2FHJD 3H8SA 4WTOB 3OVSA 1WSGA 4CHZA 2K8AA 2C2RA 2YTUA 1N88A 5DDMA 3TAFA 5F8HA 3JAMO 7FDRA 1FFVA 3D6FB 2DNHA 3NNHA 4R25A 2P51A 2DQNB 2FVPA 3H59A 2RU3A 4CESA 3PW7A 4LBPA 1I94F 1SXEA 1BIZA 3VEYA 3MM9A 3SMZA 4LF5J 2XMMA 1HYSB 4OZ5A 1NZ8A 1RAEB 2LDIA 1WF0A 5F8JA 4CT8A 4C8LA 2HSEB 3I0SB 3T79A 2E1ZA 4UOHA 2PZSA 4B3OA 5EE3A 2BJEA 4K4VA 4ER8A 1RADB 2AYGA 2KTQA 5ETMA 4F04B 4WFNL 4LF4K 4X4PA 2XCPA 2MTLA 4BJQA 3D6MB 3CDBA 1VQ8S 1HIWA 4E3SA 1WKJA 1OPIA 3NOGA 2JLGA 2AP6A 4LUBA 2CUYA 3RAMA 2DNNA 5KT7A 2VF3A 1M1GA 2H3IA 2VPWB 4FDFA 5KTQA 4IOBA 4IUFA 2PYLA 1KQSM 3LP0B 1RYRA 4AFFA 5ALLA 2OPSB 2GUIA 4IO9L 5D49A 1WSHA 3NMUA 1AUSL 1RCXB 3MPDA 3G6ES 5AQXA 4H5TA 5DRKA 1J5OA 3CD6S 2E5GA 3O6QA 2DGTA 5F41A 2RD5C 4KGXB 3QFHA 4ZVUB 4DQPA 1T44A 1VRTB 3LP3A 2NUBA 4JI4K 4J9QA 3AM9A 6FD1A 3UKUB 3LAMA 1HPZA 1OH7A 3CJ8A 3ZSZA 2RQKA 1F1BB 1JLEB 2MSSA 4Q5VA 5AQFA 4ID1A 2OO4A 2ZJRL 1VQKS 2Y0SF 1RTDB 3UM9A 3D66A 3TR8A 3QIDA 2B5JA 1Z00B 5DLGA 2LA4A 3NH2A 2KZ3A 1YG0A 3Q0AA 3KHRA 4KV8B 1RHUB 1ZYQA 4LREA 4DMNA 5IS2A 4QU7A 3KZXA 2BKNA 1Q81T 2DJWA 1YTYA 5A0LA 3GYXB 2UXCF 1FKOB 1V3SA 5DQHA 3M2RA 4QPTA 5EOYA 1IBMJ 4ZTJA 1C4CA 3IBPA 3IMXA 2YHAA 4WJBA 4RBTA 1TVAA 4H0VB 4DV3J 1MLAA 2DGVA 1WG5A 5B0EA 2P66A 1H73A 5J2MA 3D2NA 7ICNA 5AI9A 5J0TA 1T05A 4NLGA 4NLVA 1J97A 3I31A 3CSKA 2OIHA 4KC5A 1N33K 5HL7Q 4OYBA 3GR1A 2HVEA 4QZ9A 3SCKE 2L9DA 1WC6A 1TAQA 2D8CA 5K14A 4ECUA 2XS7A 1UT5A 2HBQB 3CUNA 2WVDA 5D4NA 1FWKA 2D0BA 4CLFA 4KN4A 2QLFB 4JYAF 1IQTA 1TUVA 1MW7A 2FC9A 1Q5VA 3N7SC 2CKWA 5D0HA 3WEEA 1I94K 2B6AA 1JJ2M 2J4RA 2ABYA 1L5UA 1NOMA 1VFJA 2E1EA 2R8KA 4WQ4C 4BWMA 3LDNA 4RWTA 4K0KJ 3OYBA 3E2EA 2I5HA 2VONA 3J81j 4DOBA 3BSCA 4Y28C 4M3RA 3CPWM 2VG6A 2ZJQQ 4FLWA 3B8HA 2G0CA 4EMDA 1WAJA 1TK0A 4Q0BB 5J0UA 5T41A 3J80Y 1VBYA 1WEYA 3HM8A 5AK4A 4FVMA 2Y3YA 3CJRA 2QMXA 1NDLA 2ZNYA 4M9GA 5ALWA 4TURA 4RQ4A 4DF8A 3AD9C 4CD1A 4OGEA 1TKDA 5B8HA 2QX0A 1X4HA 1Q3VA 3BJYA 3IM8A 1PK1B 4LSZB 1Y7PA 2WSCC 4QR2A 4ID5B 4P2SA 4JRQA