4EZ9A

Bacillus dna polymerase i large fragment complex 2
Total Genus 197
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
197
sequence length
578
structure length
578
Chain Sequence
KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of a High-fidelity DNA Polymerase
rcsb
source organism Geobacillus kaustophilus
molecule tags Transferase/dna
molecule keywords DNA polymerase
total genus 197
structure length 578
sequence length 578
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4ez9A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4ez9A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ez9A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ez9A01
2OPQA 2BPGA 3H4BA 4B9NA 3QNNA 1SKRA 4LD0A 3RB0A 3QESA 1KVAA 3PNCA 3P5JA 1SUQA 1CEZA 3DLKA 4FVMA 3L2WA 4KITB 3EWAA 3HXMA 1WAJA 1WCLA 3JYTA 4MF8A 5C42A 4CEAA 4CJSA 3LDAA 1ZQXA 4CFCA 4RPZA 1LW2A 4M9HA 4KHNA 1IH7A 4O44A 2NRZA 4RQ3A 4M3YA 1JLFA 1TAQA 4QZDA 2BGWA 4M0AA 3RB6A 3K5MA 3HVRA 2ZTCA 2C2RA 5HRPA 4O5BA 8ICUA 5HRSA 1S0OA 3ULDA 3MR3A 4PGQA 3V9SA 3OY9A 1AROP 4NY8A 1ITGA 9ICUA 5E41A 2W9AA 4I2EA 1XWLA 4PA1A 1RT7A 1BVSA 3ZSZA 4RPXA 2OA8A 4M3TA 3HL8A 3ZSWA 4CF0A 3O4QA 1A76A 3CFRA 5KFBA 1CXQA 5HROA 9ICVA 4R5PA 3NGYA 4CESA 1WSGA 4BWJA 4K4HA 7ICMA 5C5JA 2PFPA 7ICLA 2YNFA 5J2QA 4RT2A 2IA6A 5J2MA 4YNQA 2R8IA 4DTUA 1BPYA 1DTQA 3PX4A 2JEIA 3QIOA 4MFFA 3KK1A 4P4PA 4UBBA 1K1QA 4FO6A 1K1SA 4ECWA 4B8CA 1ZQYA 3RMDA 4O3QA 1C6VA 3OYLA 1LAWA 4FJ9A 4PH5A 4CJTA 2A1RA 1BPEA 4TUSA 1JLEA 1B9FA 3BDPA 1SL0A 4I2FA 3TI0A 5HP1A 2W9BB 3NF7A 5DDMA 1L3TA 4ED3A 4M3WA 4RQ1A 4KB0A 3THVA 2KW4A 1RTJA 4FLWA 3F9KA 4DQRA 3OYGA 1SKSA 4F4WA 3Q8KA 7ICTA 5DB6A 3VQ9A 3KTQA 1VRTA 3V9XA 4YR0A 2W8LA 3JPQA 3PX6A 7ICIA 4DL2A 3DOKA 3KHHA 3EYZA 4MEXA 2BCQA 2P1JA 3ZSOA 4KLJA 3KD5E 3MDAA 3ZT3A 3OYFA 5CA7A 7ICPA 2C2DA 1IXRA 5J2NA 1KCFA 2ZTEA 4JK1A 3C6UA 4H4MA 1HNIA 3RJJA 5FROA 4J9OA 5CZ1A 5KT5A 1DOQA 4QWAA 3AU2A 1ZQTA 3OJUA 4C8NA 1C0TA 4EP4A 1J5OA 2W8KA 4AHVA 4K8ZA 1V9PA 1S1UA 3AVNA 2X6SA 1U4BA 1QHTA 2FMPA 5CWRA 4EBDA 4GVMA 4FW1A 4FJJA 4Z6DA 3T5LA 3QLHA 4F2RA 4E1MA 2NRVA 4MFCA 3ZT0A 4OPKA 3RMCA 3H40A 3M8SA 3S3OA 1RTDA 1HUZA 5IIIA 1T4GA 4ED6A 4HCBA 4J2AA 3UQ2A 4YMOA 1RT4A 3V1OA 2OPSA 4KV8A 4OKJA 1KDHA 3O4NA 1GOAA 4M47A 1NOYA 1XSLA 5KG6A 1BPZA 4J9RA 4KHWA 4E7HA 1S5JA 3HSTB 4BXOA 1VK0A 3QE9Y 4Q5VA 4CECA 1WSEA 5J2GA 2DFHA 4FXDA 4UQGA 5DBBA 3K2PA 2VA3A 3K4GA 4BGDA 1JL2A 5F9NA 3SQ2A 5HMMA 4FBTA 1J53A 2GUIA 3AVHA 4DOAA 3TAQA 3AVMA 1NK9A 2OWOA 5KFTA 2G8VA 4O3OA 4PGXA 3K57A 4EBEA 5J0SA 4DU4A 4CIEA 1EETA 4AHSA 3ZDDA 3AUOA 4IBNA 4KTWA 4AILC 4KLSA 2VWKA 3CFOA 3TAGA 3RAXA 1ASVA 1YVUA 1BGXT 5C24A 4J2BA 2XO7A 1ZBUA 3L3VA 1ZQFA 2HHQA 5DQHA 1ZQOA 5DB8A 4AHCA 4PHPA 4Q8FA 4GMJB 4JRPA 4UB1A 4B3OA 3DLBA 3KLEA 3VA0A 1HQEA 4DEZA 3M8QA 3AVFA 3LPTA 4RW9A 3AA3A 3BGRA 2JZBB 3LWMA 2OPRA 4C8MA 5KFKA 1VSMA 3K58A 2JEFA 1RDAA 1N6QA 2E4LA 3P83D 4LSLA 1IKVA 3RJIA 4F91B 1ZBFA 2BE2A 4DQIA 4F5OA 3KK2A 1S1VA 1VRUA 4CJQA 3IS9A 3UIQA 4RQ0A 2NRWA 4F4YA 4NCGA 1HNVA 1ZQNA 2FPMA 3ZD8A 3NAEA 4LH4A 4YR3A 4KHUA 1QLNA 3AVGA 4CGGA 2OYQA 4Z0UA 1SZPA 2XRIA 4R8UB 1RT2A 3OS2A 3V7KA 1XO1A 4I7FA 8ICZA 1FK9A 4CGIA 1TKZA 2IDOA 4DU3A 3ALYA 4CJKA 3C94A 3PMLA 3SZ2A 2A1JB 2B6AA 2X74A 4KLFA 2Z1JA 4KMUA 4KAZA 3ZT4A 1RCHA 4KHQA 3KJVA 4XQ8A 4DFMA 4OKKA 3SQ0A 3ISBA 4YFUA 3PY8A 1MC8A 4AHRA 4ELUA 2IBKA 4E7LA 3JPSA 2DFLA 4P4OA 5C25A 9ICIA 2IC3A 2QXFA 1BCMA 5K14A 3AO4A 1A5WA 4GLXA 2FBVA 4Y1DA 4M41A 1TFRA 4CHZA 3T5KA 4CFAA 1TVAA 4H4OA 4M9GA 1IKYA 4B9TA 2R8KA 1WSFA 1QTMA 1VSFA 4DSKA 2AJQA 4KLUA 3GV7B 1COOA 9ICTA 2BKEA 2V4RA 5KFNA 3C5FA 5KI6A 4DSLA 5DB7A 2HHVA 1LW0A 2UVRA 5J2HA 4CK3A 7ICSA 4I2AA 3AVAA 1ZETA 4Q8EA 3V1QA 4RW7A 1J54A 2NUBA 2YNHA 4UB2A 3KIOA 3S3NA 3LP3A 5KGXA 4DL4A 1F21A 1BIZA 2FPLA 4KN4A 1HRHA 1SKWA 3B0YA 2PZSA 1UAXA 3VN5A 4QZEA 5CYQA 4M3RA 4F4XA 5KGWA 3LDSA 2IHNA 4CJ5A 1ZBHA 1B9DA 3AO3A 4PHAA 2W9CA 1K6YA 2ATLA 1JX4A 5KG0A 3V4IA 1TV6A 3JPTA 8ICHA 1LB2B 2HHXA 8ICLA 1G15A 2OZSA 1CXUA 1U45A 1EXQA 4ELVA 1RT6A 1SL1A 1RYSA 4IRDA 2D0AA 2D5RA 4IR1A 1A77A 3P1GA 2UVWA 2ISOA 4J9QA 4DTXA 3ORYA 1HYVA 5SWMA 4O9MA 1RT5A 1EX4A 3C21A 5KG4A 2IHMA 3RB3A 2ITGA 4N41A 1C1AA 4N5SA 1KVCA 5HMLA 4OPJA 1Z3EB 4UAZA 2XY8A 1BPXA 2P66A 2YHAA 8ICOA 3LANA 4KLHA 3PV8A 5KFEA 3OYIA 1Q9XA 3T19A 1ASWA 4J9PA 1JMSA 5J2JA 3RTVA 4UB5A 3L2VA 3HPOA 3ZT1A 2VA2A 4YP3A 5JS1A 5KFYA 5DG9A 5EOZA 7ICHA 4KREA 3AVBA 4KLIA 1KFTA 2VG7A 4NLKA 3ZCMA 4CEQA 3RJKA 8ICXA 7ICKA 4RUAA 1UT5A 3F73A 1CLQA 1Z26A 5KFFA 4AHUA 3K75D 2ZJAA 4M42A 2VA8A 5KFHA 3JSMA 5HLFA 1FXXA 2AQ0A 3QEVA 4KFBA 5KG5A 5IILA 5HBMA 4CJ4A 1QQCA 2RDIA 7ICJA 3MXMA 4DU1A 4N47A 1JXEA 2MAXA 4LZDA 4RQ2A 3MFIA 4IRCA 1ZQCA 9ICOA 4FJNA 8ICQA 1NOZA 1JL1A 4ECRA 1BL3A 3LP0A 3AO1A 4Y1CA 4F5QA 2BQ3A 4N56A 8ICCA 1MU2A 4F5PA 2GWSA 4J9LA 2HHWA 3RJGA 4E3SA 1WSHA 9ICRA 4NYFA 3SYZA 2BR0A 3UQ0A 2F8TA 5KFVA 3C1YA 4F50A 2F96A 3SQ1A 2BCVA 4RW8A 4CF1A 4UAYA 2ALZA 4EZ9A 2D0BA 1KFDA 4TQSA 3VQ5A 3OHAA 1NJXA 5IIJA 4LVSA 3T3FA 4DTNA 3MGIA 2FLPA 2YKMA 4QCLA 5CP2A 2HVHA 1U49A 4FJHA 4YQWA 2VWJA 3B6PA 4CHNA 4CEFA 3AU6A 2RKIA 4KLEA 3LALA 4DQQA 2XY6A 3VQ6A 3NTUA 3NDKA 1QSLA 4FCYA 1DGSA 3BQ1A 1C1BA 2YNGA 4DMNA 3E01A 3HP9A 4B9LA 4M9NA 1TKXA 5JUMA 5CZ2A 3RRHA 2PFNA 4K8XA 2HB5A 1TK5A 4LZGA 3PR5B 3KLFA 5KFZA 4ZHRA 4RNOA 4F4KA 4HUFA 5L1LA 1DLOA 4I2QA 3V6DA 3TFRA 3H8JA 1MQ2A 1JXLA 4FLVA 4YVZA 5DK5A 3QEAZ 3QETA 4E7JA 2ISPA 4R64A 2BDPA 3C5GA 9ICKA 1VSJA 3TR8A 3SUNA 4O3NA 4KLLA 3L8BA 4TQRA 2ZJ8A 5KT2A 1TVRA 4DS5A 5KFDA 2BQRA 3VQ8A 4F3OA 5J2BA 3N4MB 3OS0A 2ZUBA 4RQ4A 4Q43A 4NYNA 5KFQA 5D4BA 2ASDA 5KFMA 4Q44A 1NJYA 2AGQA 1DTTA 2PI4A 5DBCA 9ICHA 3TAPA 1ZQDA 1X2IA 5KFSA 3HT3A 5J29A 4I9LA 3GIMA 4O0JA 4DS4A 2ZQBA 3Q8LA 3AVKA 4KRFA 1IKWA 4DL5A 4TUPA 2NRXA 4M2YA 8ICSA 4EBCA 1ZQAA 3BQTA 4JWMA 1D5AA 7ICNA 3RJHA 2EX3A 1JLCA 3NH2A 3T1AA 1ZQMA 4F2SA 3ZSVA 3SQ4A 4W5RA 4E19A 9ICJA 3V6HA 5J0PA 1B43A 1ZQQA 4ZTFA 1JXBA 1L5UA 1TL1A 4XRHA 4F5RA 4ED2A 3MECA 4FBUA 1BIUA 3KLIA 4HTUA 3UPQA 1T7PA 2ASLA 1H38A 2YHBA 3NE6A 1RZTA 3OYBA 3OHBA 4CEBA 3EPIA 3QEIA 1WAFA 3QZ8A 4FZXC 2M9NA 3G10A 1J9AA 1SL2A 4RZRA 2W9CB 2P51A 1RTHA 4UBCA 2I9GA 2E6MA 4ED7A 5L1IA 1BHLA 5J1EA 3MFHA 5DGAA 4CIFA 3C95A 1O1WA 4EYIB 3AO2A 4RNMA 3HPGA 5HRNA 1RBSA 3JPPA 3H7IA 3C2LA 5KFOA 5J2AA 3RJEA 1BI4A 2DFFA 3SNNA 4R63A 2HW3A 5I42A 3HX0A 5HNKA 4GXJA 4BDZA 4HUEA 8ICRA 3DLGA 3IRXA 1ZJMA 4Q0BA 1S97A 3KHLA 4XIUA 5BOLA 3MXIA 1EXNA 5DGBA 4ED0A 1FKPA 2KZMA 3VQ4A 1HUOA 5KRTA 2XC9A 3M9OB 3PW5A 3TQ1A 4KLQA 3E2EA 4C8OA 3IAYA 3PUFA 5FRNA 5KT3A 1ZYQA 3K59A 3RMBA 3Q8MA 3LP2A 4KHSA 5KRSA 2AU0A 4JS4A 3RR8A 3PW2A 4PHDA 2EHGA 1U47A 1ZQEA 4NM1A 2BPFA 1NKEA 4FJ8A 3ETLA 3G0ZA 4M3UA 4FLUA 4ZTJA 4FS2A 2QKBA 1KLMA 1TKDA 3MEDA 5KT7A 4CGJA 2R8HA 3DLRA 4Z4CA 5J2KA 2F1IA 2HHUA 4QW8A 2IAJA 1D8LA 3I0SA 1KTQA 5DKWA 4TURA 2P6UA 1UA0A 2FPKA 1ZQUA 4NLNA 1C0UA 4LSNA 1C7YA 2D0CA 3DOLA 4I2BA 1S9FA 5J2DA 4O0IA 2O4IA 1RTIA 3HM9A 4J9NA 4YCXA 1GOBA 5KFUA 2JEJA 4CGHA 2XHBA 1IM4A 4GC6A 4HVJA 8ICWA 1U9LA 3OSNA 4DOCA 4DFKA 1HJRA 4CFBA 4DG1A 4DQPA 4G3IA 3T5HA 4ECXA 4IRKA 3SI8A 3I8DA 4I9QA 4ECQA 1RPLA 4J9MA 1N48A 3RRGA 3VA3A 4BWMA 1XSNA 1RDDA 1JIHA 5KFIA 1A5VA 3LZJA 4QZHA 1L3VA 1S1WA 5CB1A 4FJKA 3DRRA 3U3GA 2KFZA 3QEXA 4MF2A 2W9MA 2RN2A 1L3UA 4KI6A 1D8YA 4GC7A 2JGUA 3NF9A 2YV0X 3LAMA 5KG3A 2GV9A 1KEJA 4CJUA 1ZQZA 4CJLA 4ECUA 4Z4IA 4OVLA 4E1NA 3RB4A 2PFOA 4RQ6A 2ZD1A 1QSSA 4RUCA 3MDCA 4FJGA 2AGPA 5IIOA 5J0WA 4I2HA 1ZBIA 7ICRA 1Q9YA 1BISA 4QZIA 5IINA 5IIMA 3NGIA 4Z6EA 4F92B 1TAUA 4YD1A 1S1XA 4I2PA 1TGOA 1S6QA 2HNDA 4FJ7A 4F93B 3AVIA 1ZQVA 4B8AB 2FBYA 3CFPA 5CJ7A 1ZJNA 4DO9A 4KLOA 4M6WB 1NK8A 2VG5A 1S9EA 4CEEA 4Z6FA 1ZQKA 1GOCA 3CYMA 4NCBA 4O4GA 3B6OA 1SV5A 4F4ZA 9ICXA 4I2JA 1NKBA 3ZDBA 4UAWA 3MAQA 3D0PA 1RBRA 2B5JA 5BPCA 4JS5A 4JLHA 4BE2A 4RW6A 7ICUA 1HYSA 3HVTA 4LY7A 2BANA 1REVA 4I28A 4WE1A 2G8KA 1X9MA 2Z1HA 3SUPA 4F5NA 1Y97A 5KFCA 3IM1A 3MGHA 4O3SA 4XUSA 3PR4A 5IIKA 3C2MA 2BHNA 5J2IA 2PYJA 3V72A 1ZQHA 2KQ2A 3VQBA 2J6TA 2R7YA 2WTFA 3NCIA 4C8KA 4QW9A 4YG2A 4CHQA 1ZQWA 2QKKA 3KHRA 4IR9A 1LWEA 4CEOA 5T7BA 1ZQRA 4ELTA 2Z1IA 5DB9A 2Z1GA 3OYCA 4FZZA 2G8IA 4MEYA 4DTSA 5J2FA 3M8PA 2XY5A 4FK4A 2HHTA 3QEWA 3OYMA 1CUKA 5FDLA 2GBZA 3NH0A 1VSLA 7ICVA 2OZMA 4BE1A 1S0VA 3ZSXA 8ICTA 3ZDCA 5DDYA 2PI5A 2HNZA 1RBVA 3NHGA 1X9SA 4X5VA 4R65A 5TZVA 7ICQA 8ICJA 1A5XA 1NK0A 4CJVA 4IQTA 3UXNA 4KTZA 8ICGA 3QEBZ 2H5XA 1HYZA 1D9DA 1IKXA 1RT1A 4Z4EA 3SV3A 2AQ4A 4RT3A 4QAGA 3ZSQA 9ICQA 2HHSA 3EZ5A 4DSJA 3GIJA 4KLDA 1XS9D 4TSXA 3JPRA 3Q8QB 1TK8A 2FLLA 2V4QA 2ZJ5A 2P5GA 4DTPA 2WOMA 3WNFA 2LYHA 3VQCA 4AH9A 7ICOA 5KFLA 1LAVA 2G8UA 4E89A 4QWCA 4F8RA 1ZQGA 2FBXA 1RT3A 2RDJA 3TWHA 3M8RA 4HCCA 2HMIA 3SV4A 2IMWP 5D3GA 3DLEA 5DLFA 2BQUA 3VQPA 4DSIA 8ICKA 1UOCA 1NK4A 2PY5A 2G8FA 1YTUA 2BGGA 2B4JA 4DFPA 4OKEA 3S9HA 3H08A 1HJPA 4DWIA 4KI4A 4PHEA 3MEGA 4B9UA 3PX0A 1JLBA 4FW2A 1T05A 4KKOA 5F9LA 2DTUA 3EW9A 4W5OA 3DM2A 3V7LA 4EYHB 3C2KA 3SJJA 3A2FA 4JV1A 4CE9A 9ICSA 1ZQPA 3NGDA 3PW4A 3CM6A 4IQUA 4HYKA 2XGPA 2FC0A 5KFPA 3ZDEA 5J0YA 3U6FA 9ICFA 2W9BA 3TAMA 2F1HA 5HHHA 1W9HA 3TABA 2ASJA 1Z00A 8ICEA 1R0AA 5KFAA 4L8RB 3UXPA 9ICCA 3GV8B 4FLZA 1QE1A 1X9WA 3K5OA 3NGZA 2VANA 3D45A 4I2CA 2R8GA 2X78A 3VQQA 2PYLA 5HHIA 3SPYA 1ZQIA 4R8UA 4Z4HA 4Z4FA 2YNIA 1YTAA 3U3YA 4J9KA 2FBTA 4CGFA 2BCUA 2X6NA 4IG3A 4XA5A 4ECZA 4W5TA 3H8SA 3ZD9A 4QZBA 3FDSA 1NK6A 7ICEA 4KO0A 4KLMA 5KG2A 1CZ9A 9ICEA 3AO5A 3BQ0A 4PY5A 3L3UA 8ICFA 4JRQA 1BPDA 3M9NB 1S1TA 4CK1A 4CEZA 4MFAA 3HWTA 3LAKA 5D49A 2JZBA 5L9XA 4NCAA 5KG1A 4ED1A 5DQIA 1FKOA 1N5YA 4DL6A 5EWGA 4CEDA 2VG6A 5HRRA 4AHTA 3HW8A 4ECVA 4B08A 4RQ8A 2G8HA 1JLGA 2Q0ZX 4YFKA 1XU4A 1KFSA 3ITHA 2WONA 3HJFA 2UVUA 3C6TA 1S9GA 4YD2A 1BQMA 3PMNA 4FK0A 2FLNA 3RWUA 1I39A 1MSWD 2IS3A 2ZTDA 3IHQB 1MQ3A 4Z4GA 2RPIA 3ISCA 2Y1IA 3OVNA 2W42A 8ICYA 1T8EA 5KFXA 3VQAA 3LPUA 5L1JA 4DSEA 3KD1E 3MABA 4BDYA 1RBTA 1UT8A 3QIPA 1S6PA 4O5EA 2BPCA 1TK0A 4KB1A 1KLNA 5CR0A 2UVVA 5J0UA 1LWFA 3ISNC 4CF8A 4RW4A 1D9FA 3AA4A 2YKNA 1ZQLA 3IG1A 9ICNA 4FJMA 5KG7A 3AV9A 4QOZB 3Q8SB 1KSPA 4F3TA 1BI4B 4UB3A 1WLJA 3DLHA 5BOMA 4EP5A 2I1QA 4QZ9A 4IDKA 5KT6A 4R66A 4DLEA 3V1RA 4OJRA 2MUTA 4YXJA 3OYKA 8ICVA 2G8WA 3MEEA 2KTQA 4FLYA 2C2EA 3GIKA 1BCOA 1UA1A 2HVIA 4B9SA 3OYAA 3RR7A 4RPYA 1ZQBA 4O5KA 4O3RA 4GW6A 1HQUA 4DTJA 4I29A 2BCSA 5KTQA 1RDCA 3PO4A 3JPOA 8ICBA 4ID1A 2DPIA 3KHGA 4M6WA 4CHYA 3MR6A 1RYRA 5I3UA 3OJSA 2ZE2A 3DRSA 1BQNA 4FYDA 4PUOA 3SI6A 1S0MA 4JV0A 1QSYA 1W0HA 3MR2A 3PVXA 4GXIA 4ED8A 4CJWA 4QWBA 3EY1A 2LSNA 1RDBA 2DY4A 4JUZA 4RQ7A 4QZCA 1JLAA 5KT4A 3MBYA 4DLGA 1ZQSA 9ICMA 3C23A 4ECTA 1RBUA 2ATQA 8ICNA 4B9VA 3V81A 3LP1A 1RXVA 3KKRA 1XHZA 3S3MA 4KTQA 3KK3A 3BJYA 3B0XA 3MR5A 4IKFA 3LK9A 2IGIA 3I0RA 3G6YA 2Y1JA 2FMQA 4DFJA 3HPHA 3RH4A 3Q8RB 4FLTA 2NRTA 3PW7A 3V6KA 4I27A 1ZQJA 4DTRA 4OLAA 3QZ7A 5DQGA 1NK7A 4RU9A 3NFAA 3V9UA 4O55A 3L2RA 3VQ7A 4I2IA 4M04A 4CCHA 4E0DA 1WN7A 3OYJA 3O3GA 1B92A 4NXZA 4ECSA 4QZGA 1Q8IA 4K4IA 1LWCA 3HO1A 4CJFA 4NLZA 4CF2A 4FLXA 4QWDA 1VSKA 4OLBA 3K5NA 4FS1A 3JPNA 4K4GA 4ID5A 1NOMA 3OGUA 1TKTA 4W5NA 2MUTB 5DBAA 3AA5X 3GIIA 2BCRA 2E6LA 9ICGA 4CGDA 3QNOA 3DRPA 5L1KA 8ICAA 1ZBLA 5J2EA 4O5CA 4DTMA 4RNNA 4IQVA 1RNHA 4DL3A 4ECYA 4IG0A 2J6SA 4BXOB 1XI1A 4PQUA 4M3XA 3KLHA 2KN7A 3RBEA 3UXOA 3H4DA 1KRPA 3SUQA 4QWEA 2FMSA 4DQSA 1LV5A 5J2CA 2P6RA 3V9WA 4QZAA 3TAEA 4NM2A 3QERA 1PZNA 1CZBA 4FZYA 4RG8A 4BACA 3QO9A 2OPPA 3ASMA 3OYNA 3OYHA 4W5QA 2KFNA 1T03A 3ZSRA 3DI6A 3G6XA 4ZH4A 5J0XA 1C1CA 4YR2A 3N97B 2XY7A 4C8LA 5DG8A 4J9SA 9ICAA 3T5JA 3L2QA 3GQCA 4EEYA 4KHYA 4M9JA 3OYDA 1TL3A 9ICLA 2J6UA 3FFIA 3HP6A 4P2HA 1S77D 4CJRA 4CF9A 5J0RA 3MXJA 1VSIA 4KLGA 3SCXA 2XCAA 5KFGA 4FK2A 3TFSA 1XC9A 5CY4A 2P5OA 4KN7A 3GILA 3AA2A 1S10A 4DTOA 4FJLA 3LWLA 1VSEA 1NJZA 3VQEA 3HK2A 2Q3SA 2XCPA 2F8SA 5D46A 2XGQA 4IFYA 4CIGA 2F1JA 3V9ZA 2KZZA 3Q8PB 3KLGA 3QINA 3FYHA 3NBPA 2V9WA 2DPJA 4FM1A 4QZFA 1WSIA 1JN3A 3BQ2A 3HYFA 3WNEA 4MFBA 1VSHA 3RH6A 4DL7A 7ICFA 3NF6A 1NJWA 1QS4A 1T3NA 3RJFA 5J0OA 4CK2A 4J2DA 3ZDAA 1WSJA 9ICWA 1L3SA 3L2UA 1RXWA 3LZIA 5J0QA 3GDXA 3AVLA 5KFWA 4E7IA 3NF8A 5CYMA 1X1PA 2JEGA 2ZUDA 4FJXA 4B9MA 3V7JA 4ICLA 5KFRA 2ZUCA 4PPXA 3TARA 1N56A 3ZSYA 1Z00B 4Q45A 1NK5A 3K5LA 1HPZA 4E7KA 3O3FA 2R8JA 8ICMA 1ASUA 3V6JA 3OYEA 3CM5A 4FJ5A 4IFVA 2I5JA 5JS2A 2HNYA 5SZTA 4I2DA 4FM2A 4IQWA 5J2PA 5EWFA 2B21A 1C0MA 4OGCA 4BDPA 1U04A 3DMJA 4MQ3A 5FRMA 1I3AA 4O3PA 3ZT2A 4JWNA 4M9LA 3OS1A 4YN4A 3GV5B 1UWBA 3H8WA 2A1JA 5KFJA 3DYAA 5DMRA 4CJEA 3KKSA 1B22A 2C28A 3WNHA 3OSPA 1TV9A 3WNGA 1Z25A 4CFDA 1YT3A 3RBDA 2DFEA 2PXIA 4CERA 3CQ8A 4BE0A 4DOBA 3G6VA 8ICPA 1VSDA 3RAQA 3NH1A 4CHPA 5CHGA 2RF2A 4RQ5A 4P4MA 8ICIA 4PGYA 1Y88A 3SUOA 9ICPA 3TAFA 2O4GA 4M3ZA 1KVBA 1WNSA 4LH5A 2C22A 4CJ3A 3M9MB 4KLTA 4DF4A 3PO5A 5EWEA 4Z6CA 1XHXA 4TUQA 2JLEA 4G1QA 1IO2A 4H8KA 4YMNA 5DLGA 1EKEA 4NLGA 4I2GA 1RILA 4KPYA 3AVJA 4EZ6A 4OGEA 2QK9A 3O3HA 3RMAA 3TANA 2A1SA 3ISDA 4CJPA 4QZ8A 5HP4A 4PWDA 2IOCA 3CG7A 2KZ3A 3SPZA 2AGOA 5EU7A 4FM0A 1NKCA 1WCNA 1HMVA 1BPBA 3EPGA 4YMMA 4CHOA 4DSFA 3QEPA 3VQDA 5J0TA 4UB4A 4M45A 5DG7A 1JLQA 4N76A 4DF8A 2PFQA 4FJIA 1IG9A 4HUGA 4GXKA 3C1ZA 1S0NA 1S76D 3RH5A 3AVCA 1XSPA 9ICBA 1JKHA 4JV2A 7ICGA 1U48A 1EP4A 4YXMA 4J2EA 4HHTA 3GFKB 3PW0A 2ETJA
chains in the Genus database with same CATH superfamily
3FUYA 4M63C 3QNNA 2JC1A 3M30A 3CCMS 4LD0A 3PNCA 1SUQA 4YOVA 3A0HU 4NA2A 2KOBA 4MF8A 5C42A 4CEAA 2HOIA 4WXOA 1ZQXA 4CFCA 4O44B 3HJEA 5C2CA 4P2FA 1LW2A 4EWTA 1YK9A 3HCXA 4O44A 5LXRA 2NRZA 1Q4RA 2CDQA 1H2TZ 4M3YA 1FWLA 5HATA 1TAQA 5BN9A 3WKAA 4M0AA 3FBFA 4NLDA 4QU6A 2YI1A 5HRPA 4ZIVA 1P9QC 3CE8A 1SCJB 3ULDA 2NV3A 2E1FA 3N7RC 3HTVA 3MR3A 5D78A 2EZYA 3MEEB 3F2BA 2QL7B 2BRLA 5BXIA 1TE2A 5LSLA 2R7VA 2BEFA 5D4NA 4OX9J 2JR5A 2C42A 1FDNA 1RT7A 3SFUA 3ZETB 5ALYA 3O4QA 5A8KB 2MLYA 9ICVA 5ITHA 4R5PA 3NGYA 1LKYA 4FF3A 2PFPA 1TKTB 3VR1A 5J2QA 2R8IA 5BYSA 2ZWPA 4IJAA 3ETRA 1JCGA 1CZAN 3SMSA 3K5PA 3AAWB 4UBBA 2HIQA 4FO6A 1FVQA 3BYPA 4AFFA 4B8CA 3CJ2A 4O3QA 3B8AX 1C6VA 4ISFA 3OYLA 4CJTA 4MKAA 5ETTA 2F9WA 1JLEA 2JVOA 1B9FA 3NF7A 4RQ1A 1PC4A 3FZKA 4P0QB 3OYGA 4DQRA 4HDGA 5EX0A 1J5OB 3UMBA 4F4WA 1XNSA 3BS9A 3QBCA 4PRFA 3D2FA 3S6EA 1J5EK 4Y2PA 3PIPQ 4TY8B 3WIVA 4CO2A 3KHHA 2BCQA 3BPSP 2J0SD 3H8MA 2DGUA 3B4MA 3KD5E 3BH6B 3BZCA 5I3PA 5B09A 1M5OC 3HZGA 3OYFA 2EBGA 1B0TA 4X62J 4YOEA 1F3VA 1WC3A 1X6IA 1HNIA 4J9OA 3OTOK 1N5XA 4B1ZA 5I9EB 3EXYA 4C8NA 4QIFA 4NL9A 4RW6B 6FD1A 1AZSB 5CA5A 4G65A 2HFVA 4GVMA 1SKUB 4EK2A 4Z6DA 3DEEA 4MN4C 1SI9A 4MFCA 5IS2A 3RMCA 2Y0SF 2QT7A 1RTDA 3O9QA 5IIIA 1T4GA 4ED6A 3AJDA 3BYRA 4HCBA 3UQ2A 4LF7J 3G87A 3V1OA 2OPSA 1Q1KA 4OKJA 1KDHA 4M47A 2EI5A 3MAHA 2DL0A 8RUCA 2FDRA 3DMJB 4OYBA 1C1CB 2HRYA 2XMAA 3UR3C 3VV2B 1JB0C 5F3XB 1Q86T 3F5TA 4OL8A 2CN1A 4U8VA 2NYIA 3KJFB 1VK0A 1IIPA 1WSEA 5J2GA 2G1DA 1W7AA 1OH7A 2BJDA 4WQ5A 3HX9A 1QCKA 4ED4A 4P0PB 1UCVA 4BHQA 3G82B 3HHLA 5AKZA 5F9NA 3SQ2A 3IG8A 2XSJA 1WOPA 1ZPWX 4FBTA 3PRVA 1J53A 1I3OB 1RT7B 2OWOA 1A0OB 2U2FA 2HIYA 3EDQB 2G8VA 4O3OA 1PVQA 4IG3B 4DX7A 4RW4B 1EETA 5CD4H 2K89A 3J7YU 2B56A 4IBNA 4KTWA 1L8OA 4KLSA 2VWKA 3D7EO 4B9QA 2PEHA 3THPA 4YDDB 3IRUA 3IFRA 3AXKA 1ZQFA 2HG4A 2HHQA 4XAKA 1H0HB 1CJVA 1N2XA 4OCZA 5DB8A 1VQ7N 4WIQA 2AJFE 3TZXA 3S41A 5BYQA 4WCEQ 1NGAA 3CETA 4GMJB 3SLCA 4QS8A 3ZC4A 4B3OA 1VI7A 3I32A 3KKAC 4DEZA 1FEHA 1QUVA 2J0XA 3S01A 2NR0A 3V2UC 1S79A 3HSZA 3QBXA 5KFKA 1YX2A 2GWJA 1VSMA 4M1KA 3P83D 4IXCA 4LSLA 1ZBFA 2BE2A 3QSYB 1WG8A 4Y28C 3VGUA 3UB5A 2LA4A 3KK2A 4ZITA 1VRUA 4CJQA 2A5XA 5A8RB 4CDIA 2YQEA 5D4PA 2BZFA 3BSAA 3ZD8A 1S1TB 4LH4A 4YR3A 1IKWB 3HVWA 2VZ9A 3AVGA 2RAQA 1K73O 4H0OA 4A5BA 5ALDA 5IM0A 3IWLA 2UUWA 1XO1A 4MMOA 1FK9A 2CQHA 3OL8A 3D1OA 4USJC 1XNRF 3C94A 2YNHB 2XI3A 1S5LU 4C11A 1GX6A 3NGSA 2A19A 4F3QA 4KMUA 1WOOA 4OKKA 2FI1A 2Z56B 2Q97A 2P9NB 2ACMA 2A0FB 3J81O 4C7ZA 3PY8A 2ZM6J 3C6HA 3CJ8A 1V4SA 5ALLA 2GMHA 4AP9A 3M2VA 4ELUA 4E7LA 2HOFA 4JI2J 3JPSA 2DFLA 9ICIA 5AQGA 3TUZC 4JI2K 2Q31A 2A42A 4NXNK 4JI3K 1RWKB 4NRUA 5K14A 5AE1A 4GKJK 2IY5B 2MY7A 2Q6BA 4Y1DA 3RBZA 4DI6A 3J7A1 1TVAA 2CRXA 5AKXA 5IV4A 3VGKA 4M9GA 4B9TA 2PGCA 2AJQA 3DJCA 1IJEB 1VQNS 4DR6J 3GV7B 1COOA 4TU9A 1CQMA 4DR2J 3A8JA 2K06A 2BKEA 1S59A 1GTHA 4NLVA 2KSOA 1ZOLA 2VJ5A 1PVRA 2HHVA 3AD8C 3W64A 3MM7A 5DS7A 2UVRA 1HPMA 4DV7F 7ICSA 5GADU 3UW1A 3GFXA 3R5JB 2IRXA 4B02A 5HQ8A 4YS2A 1ZD4A 2YNHA 4O0NA 5LMNK 2OM6A 4GO7X 2ZBCA 5KGXA 3HVTB 2ZIXB 1RWNB 2PZSA 2UU9F 5AQIA 4CQ1A 4F4XA 5KGWA 4CJ5A 4AUKA 3I4HX 4LF9K 4PHAA 2W9CA 4I6YA 5AFUH 3UNYA 3KMQA 1YRUA 3V4IA 4DDFA 4B17A 4US9A 4CM0A 3EL2A 3JPTA 4Y6IA 1IWAA 1WD6A 4TLQA 1U45A 1YJUA 4DX5A 4TU7A 4HHJA 2PA8D 4X4RA 3BO2A 3W2WA 3EZWA 3H7HB 2MKJA 2FY1A 5LJ3Y 4IR1A 1F9EB 1ED1A 3RGIA 2ISOA 1HLUA 3HHLC 3ORYA 2FF3B 4BS2A 2CKWA 1RT5A 3MGVA 1FDAA 5KG4A 3WU2U 2IHMA 7FD1A 4JK8A 4N41A 2H51B 5HMLA 2B8QA 2LMRA 1HNWF 2NUUG 1TELA 4OPJA 2MKCA 4UAZA 3CQXA 4IH6A 4ZJQA 4KLHA 4BG8A 5KFEA 4P0QA 1P6TA 3HF5A 4DV5F 1Q9XA 3T19A 4J9PA 3NRBA 4UB5A 3L2VA 4KHPK 3HPOA 4ENOA 4L74A 3ZT1A 2R18A 2VA2A 4CLFA 3UCGA 2ES6A 4B3SK 3AVBA 3I33A 3DDHA 3ZZOA 2ZBQA 1KFTA 2DNLA 2VG7A 4DR3J 4CEQA 3RJKA 4YY3F 3N6NA 1CLQA 4F7VA 5ADZA 2VA8A 3JSMA 4KH5A 1FO1A 1MA9B 1KW4A 2DGZA 1JI7A 3QEVA 1CBKA 1RGVA 4KFBA 2NXNA 5GAGI 4WFNQ 1M90O 2G9OA 5HBMA 2RT3A 2QYCA 4CJ4A 1QQCA 3U9DA 3KHYA 7ICJA 3U26A 1JXEA 2MAXA 4LZDA 1DQAA 3MFIA 4CT9A 4F36A 2DO0A 9ICOA 5AE3A 5AR0A 5BRHA 2L3MA 1N0UA 3HSGA 3C28A 4D3GA 1VIXA 5AQKA 3LP0A 1WELA 2R42A 4F5QA 1RAHB 1IXKA 2BM0A 3D3CJ 5EX3A 2GWSA 2HHWA 2YPYA 4ES1A 2MU2A 3IKMA 4NYFA 2FHJD 2DB1A 2W7OA 1RAIB 5EE0A 4Y2IA 1JLAB 2W40A 2EQYA 2G13A 2G4BA 3F5AA 2QX0A 3C2PA 3SQ1A 3W8PA 4CF1A 4UAYA 2ALZA 2D0BA 2V6AA 1NJXA 3ICLA 1AUDA 1NMNA 2H5JB 3OR2B 1HBMA 2HFSA 5DDOC 3IS9B 1VRUB 4FJHA 2KYZA 2VBWA 4CHNA 4JKGA 4CM2A 2HMIB 4DQQA 3IC1A 1VQ8S 3LPEA 4HI2A 2V4JB 1UAWA 2V51B 3OQ2A 4QPTA 3PRBA 4FCYA 1S12A 1C1BA 2YNGA 4DMNA 5FP0A 4FWQA 1N33J 4PXEA 4QS7A 1VLOA 1N33K 1TKXA 4Z7YA 1YDLA 3H20A 2PFNA 4ETZA 2HB5A 2F4FA 4Y2VA 4LZGA 3PR5B 1R0BG 3KLFA 5KFZA 2LHTA 4RNOA 4CO0A 4I2QA 1IV0A 4JHDA 3H8JA 1MQ2A 1JXLA 2HZCA 3T7ZA 5DK5A 2E9ZA 3QETA 4ZPTR 3C5GA 9ICKA 3GE1A 3L8BA 4M5DA 1TVRA 4RUBA 3DLLL 1ZC6A 2W43A 4UAVA 4BR9A 2ZUBA 4F4AA 7AT1B 2NZ4A 1DTTA 1SXDA 2RMLA 4DR1K 1YBAA 4MKBA 2QM1A 4DR7J 4NLSA 4KKOB 5LJVA 3GMGA 3A8YA 3HKZD 4DR2F 3OL6A 3BSNA 3HT3A 3JSRA 4O0JA 3GIMA 3CJCA 2ROGA 3AB4B 3AAPA 3AVKA 4OJ5A 1N33F 2ZC4A 4YEAA 5IM0B 4JWMA 3W5XA 1DXSA 1LFWA 3AAQA 5AQLA 3CCES 3T1AA 1I94F 4K4TA 3TA2A 3UI3A 3CQYA 1OYEA 3BUZB 1VQLS 1HBNA 1DQ9A 1NSKL 4XH1A 1NBEB 4PL8A 3V6HA 2BUNA 2C3PA 1FJGF 1XQIA 1ZQQA 2K4IA 5ALUA 2KVCA 1L5UA 1RACB 2XHWA 4IS7A 4C7QA 4F5RA 4ED2A 1BIUA 3TUPA 2HBZB 3NL0A 2ASLA 2XMVA 1HHTP 1H38A 4B3MF 2WFAA 2H1YA 4HEA9 2KN4A 2G5IB 3OFEA 2K2PA 3QEIA 1JLFB 3E66A 3QZ8A 4FZXC 2XWXA 3H0RB 2EXUA 3G10A 1J9AA 2WC9A 3DRXA 5AZJA 5T14A 3ILLA 1V38A 3THWA 4BX9C 5ALJA 1UEKA 4KH6A 1HKGA 1WEXA 3QMLA 5J1EA 2OGUA 4ZVOB 3BGOP 4CIFA 3G6ES 3C95A 4IOCQ 2RQ4A 1DEJA 3SCJE 5JMNA 3HPGA 3BDEA 4FXVA 1VQ4S 1FXRA 4QZVB 1TYQB 2YJEA 1ZBTA 1URNA 2ZM6K 3DRYA 2DFFA 6AT1B 4L3QA 2M70A 3HX0A 4BDZA 3AGKA 2ZFHA 4LR8A 1UKUA 2B4VA 3L09A 3SQGA 1QTNB 4IFYB 4XIUA 4ZLLA 3A5OC 4PG5A 3CMES 4ED0A 3QRQA 3VQ4A 3V6DB 3PTWA 5AM4A 2OTLS 2ZBIA 1L7OA 3QIDA 3CJQA 2LFVA 3BPDA 1X5PA 4JS4A 3RR8A 3OTCA 3PW2A 4PHDA 5DO2A 5FLXY 2EHGA 2QB0A 2VONA 2B4PA 1EKSA 3ULHA 3DXKA 3OVSA 4K0KJ 4FJ8A 2YX1A 3G0ZA 2XHCA 4I4BA 1WNEA 2L9WA 3ENOA 5E3PA 4NXNJ 2O66A 4F0MA 4YOTA 1WTBA 2HHUA 2IAJA 1D8LA 1RQ0A 2P5VA 5DKWA 1RA6A 1UJ5A 2V34A 4FWPA 2X3GA 3ED5A 2P6UA 1KN6A 1UA0A 2FPKA 4PPZA 2H3GX 1ZQUA 4NLNA 1C0UA 2UV8A 2B9XA 1C7YA 3DOLA 4I64A 1QVFM 2K8CB 1GMWA 2QA1A 3CJSA 4O0IA 1B4FA 4J9NA 3J81U 4CGHA 4BRQA 2XHBA 4GC6A 3VEZA 2GIFA 4HVJA 5KAFU 2UUTA 8ICWA 1EJ7L 1YSJA 4BC2A 1IG8A 2FPHX 3CJ7A 1U9LA 1P27B 2ABYA 3IR7B 2R9LA 1WOSA 2IJNA 4DOCA 4DFKA 3KBBA 1JLQB 3MCSA 1HJRA 2H5IB 3CCSS 2F40A 2GO8A 4HACA 4CTAB 4G3IA 3BR8A 2H4YB 4ECXA 2C3OA 4ZPBA 3I4PA 2E7WA 1N48A 1Y9OA 3C16B 1DT9A 3IFEA 1S1WA 2JLFA 1TL7B 4CIOA 4L3NA 2W9MA 1ZRNA 1OQ3A 2BVZA 2LYBA 1RUSA 2XMJA 3JQMA 5K9FA 5AI6A 2YV0X 2O8DB 1CJTA 2ASMA 5HP1B 3LPYA 4DV1F 5KG3A 3IXQA 5CH7B 3D0HE 4DV0K 1RHKB 4E1NA 4A57A 5BPNA 3V81B 4ZPDA 2V0NA 1QSSA 4RUCA 3LOUA 3MDCA 4M5KA 4Z7CA 4WKRA 2VQFF 1QUPA 4OJLA 5HK4A 2ZIUA 1P7DA 4CRXA 1ZBIA 1S3XA 2F3JA 4DX6A 5IINA 3BEGB 3Q7BA 4Z6EA 4YD1A 4RX6A 1S1XA 4BROA 5ADXA 4I2PA 3EUB2 5KOXA 4JI4F 2HNDA 4F93B 1UVJA 3KFWX 5F2RA 3AVIA 3K8VA 4X66F 1ZJNA 4KLOA 1F2HA 4CZGA 4M6WB 1NK8A 3I55S 3R97A 2B8PA 3H5SA 1SV5A 3MK6A 5GAEI 4F4ZA 1QH9A 3ZDBA 2RJZA 3OUYA 2VPZB 2G0JA 3MAQA 3D0PA 2QA2A 3KLIB 1RBRA 2B5JA 3VEVA 1J5EJ 1BWEA 3CDUA 2BANA 2OMOA 1RT6B 2LM4A 2RRBA 5ETVA 3PR4A 4C0HA 3C2MA 5BR8F 5F8JA 1GLEG 2RE1A 3UD5A 5F0UA 1N88A 3V72A 3VQBA 2R7RA 1K8AO 4FZLA 5D6GA 4F26A 2R7YA 3CDAA 4QW9A 4ZOHC 1RADB 5C24B 2P9PB 4IO8A 2KHVA 1LWEA 2WHOA 4WKYA 2IOFK 2Z1IA 1LQ9A 4LVNP 5HANA 1RHJB 1LWEB 1L8LA 3CJBA 2JMGA 2ZZMA 4ZCIA 4U6PA 5JU5A 3BR9A 2H3EB 4LF6J 3TO8A 3MM5B 2OZMA 2OEMA 4TNOA 3IV6A 2D3DA 4RL1A 1Q0NA 2P9UB 3NHGA 4A4JA 5TZVA 1FTCA 1NK0A 2OEJA 2F63A 3UXNA 3QEBZ 3LDQA 1D9DA 5ALVA 5BR8J 5M1KA 1DGJA 1WSVA 2AQ4A 3O5BA 1EARA 3ZSQA 3PYGA 4YB6A 3GIJA 3EDRB 3U1LA 5AK5A 1H73A 4TSXA 3U8XA 4QOTA 2YCHA 4HT7A 3PG9A 5DJBA 2WAQF 3D2EA 3CJ5A 2P5GA 2E5LF 4RBVA 1V3SA 2YWWA 3VQCA 7ICOA 2K60A 3BGLA 2G8UA 4UY85 3B6BA 3VEXA 1AXQA 3FK4A 1ZQGA 2EZXA 3B9JA 2IM2A 2MZTA 4PWDB 1JQGA 2V2ZA 4HCCA 4R5PB 5GTHU 2I8EA 2ZWOA 4JI6F 1JLBB 1D8BA 3B54A 3W1YC 3RVCA 1PK3A 2CADA 1HNWK 4DSIA 4FOEA 3V4MA 2ZZNA 4BR4A 1NK4A 1F5AA 2EFNA 2PY5A 1Y10A 2DKZA 2V2VA 4MTPA 4EELA 2FQQB 1BG3A 2GGPA 3OFHA 3KK3B 1HJPA 2UXCF 4MKVA 4DV4K 3WX4A 2W11A 2ZJQL 2VYPA 3MEGA 4B9UA 1QE1B 2OEKA 1FJCA 2E2PA 3EW9A 3H3OB 4CJ7A 2YHXA 2VHGA 2P8IA 3OTEA 5A6WA 2HBLA 3SJJA 3CJTA 5IC4B 1HD0A 4JV1A 1XNQK 5JVHQ 2M2BA 4IQUA 5M2PA 2WMMA 3FZFA 3MZIA 4HYKA 1RI7A 1XBWA 3IWNC 3U6FA 2VGMA 3R6LB 9ICFA 5I42B 2W9BA 3TAMA 2LECA 4QYZK 5AQXA 1UVNA 2JXJA 3QYPA 1W9HA 4H4OB 3TABA 1B64A 1Z00A 5KFAA 4GKKF 3KJNB 5CR4A 3P45B 2MKIA 1GLBG 1N60A 1S48A 3JXOA 3QLHB 3UVJA 1DQ8A 2R8GA 1MLAA 3VQQA 4CZJA 3CHWA 4LF6F 1H72C 4IG3A 2KJVA 4OV6A 4ECZA 4ER8A 1OWXA 4W5TA 2DQNB 3ZD9A 2PD1A 1NK6A 4ZK7M 3E9PA 4KLMA 4DR4K 2E1YA 4FVUA 3GE9A 1RTDB 4XPEA 1WC1A 4JOUA 1YQHA 2N7YA 2QARA 9ICEA 2JLGA 2KRRA 3BQ0A 2RHKA 1Q5YA 3L3UA 4FPRA 2J9DA 1BXNA 1VC5A 4FYWB 4MFAA 3HWTA 2HVZA 3LAKA 1DZ5A 5DQIA 1FKOA 2ATCB 3X3UA 5EWGA 5ALKA 3AL0B 4DR4F 1LK7A 5HRRA 3HW8A 4ZS6A 1JLGA 2Q0ZX 5AM2A 1BUPA 3SCLE 4YFKA 1XU4A 4DR6K 1REVB 3ITHA 2ZOMA 3HJFA 3C6TA 3IWXA 5GAHU 2AH5A 4YD2A 3AJ1A 2GQQA 1RBOB 3RWUA 2ZJPQ 2COLA 3LTOA 4DR3F 4FO0A 3HVAA 3K89A 4WU3A 4PKIA 3IHQB 1MQ3A 1JNRB 3J81j 4MYTA 1QY7A 4P6QA 3RW7A 2W42A 4LRAA 4NOHA 2EAPA 1Y4ZB 3I55N 3DV9A 3KD1E 1RBTA 2J7WA 3THYB 3O0FA 4KB1A 3HHKA 3DDIA 4A8OA 5J0UA 5FPDA 4BRIA 5CQGA 4X62F 2I5HA 3K0SA 3ISNC 2DR9A 1YI2N 2F9JA 3NKYA 2I38A 3IG1A 3E3XA 4FJMA 2MPUA 3AV9A 4QOZB 1Z4NA 5HROB 3CI5A 1KHVA 5F8IA 1K44A 3WKEA 4F3TA 1BI4B 2P9EA 1WLJA 2VOPA 5BOMA 4B3SF 4EP5A 4QZ9A 4IDKA 1LW0B 2QFJA 3NNHA 3KMSA 2MUTA 4YXJA 4CO1A 2HVDA 3OYKA 4USVA 3QRPA 2KTQA 1T02A 2MJUA 2JH7A 2C2EA 2HYIB 1UEUA 2HVIA 3OYAA 3HFVA 3RR7A 1MA7A 4DQ8A 2RRAA 4I29A 2FE9A 2BCSA 3JPOA 3I5CA 8ICBA 1FW6A 3VF0B 5HMWA 3KHGA 1HBOA 4M6WA 1RKJA 4OI2A 3CF5Q 2KHCA 1GQEA 3HSDA 3IRWP 2P9IA 3J7YP 3F56A 4ZP8A 2HFNA 2I1RA 3SFGA 1OYDA 3PVXA 5M1NA 1IBMJ 2P9NA 4CZEA 3OUYB 3H1QA 2XYGB 2LSNA 3FR0A 3HKZC 4H5NA 2JJ4D 5D77A 2DY4A 4EMDA 2KEYA 4X62K 3MEKA 2PAVA 4DLGA 4AL5A 4M5LA 4QBUA 2AX1A 5LJ5Y 4B9VA 2W3SA 3KKRA 1XHZA 3S3MA 1OW5A 4KTQA 2B3TB 3RAMA 4IKFA 3LK9A 2J9DE 3G6YA 2Y1JA 3TJ9A 5DM7L 2OP5A 1RU1A 1W2IA 3RH4A 1Z4UA 4FLTA 3CJ3A 1NK7A 2R2UA 4OHVA 1GXUA 3NS6A 3BS5B 3ELHA 2WBNA 4M04A 1TUUA 5GMKa 4E0DA 1WKKA 4WZQA 4QIGA 1RHUB 1FF2A 1FKOB 4ILJA 5EOYA 3A0BU 1JMTA 1KKXA 2WVBA 4K4IA 1LWCA 1F1BB 5AKKA 4CJFA 4NLZA 4UUWA 3VAKA 4FLXA 4QWDA 5ETOA 2XMWA 3ONQA 1VSKA 4OLBA 2O8CB 2VD3A 4PG4A 1B0PA 4ID5A 2V69A 3TJAA 2QZ8A 2RHFA 3MR7A 3AA5X 4LF2A 3GIIA 2V67A 4CGDA 4HI1A 4C1NK 1GLDG 3QNOA 3ZNUA 4JB3A 4DTMA 2E5SA 4IG0A 2AYGA 1ITPA 4WJ3B 1TL4A 4KFBB 4BXOB 4PQUA 4LF8K 5AI8A 3BN7A 3CD6N 1DTQB 1U6BA 5AFUA 2YTUA 3E9LA 1A9NB 1KRPA 1JNZB 3FMBA 1WUAA 2FMSA 3I87A 2P6RA 5ALGA 2HBQB 3NCRA 3ATVA 3BQ7A 3QO9A 2H5EA 3QWPA 3CJKB 2CGLA 2W01A 3ASMA 4M95A 2WVFA 2XI2A 2H3VA 3ZSRA 2Z57B 2Y9TA 3DI6A 3CIMA 5DM7Q 1GX5A 5AZIB 4E2FB 1RWWB 5J0XA 2H4WB 4AYBF 3MECB 1SIJA 2XY7A 1LW2B 3L2QA 2DUYA 3AMZA 2RU9A 1C0UB 4KHYA 3HP6A 2CJ9A 4RR5A 5J0RA 1VSIA 3SCXA 2XCAA 2G0AA 5KFGA 5AHXA 1UP1A 1WC0A 1HJOA 2P5OA 1S9EB 4NMLA 2DY9A 3FZLA 1NJZA 2GH1A 4H4MB 4X4SA 2XCPA 1PK1B 3VAMA 5D46A 2XGQA 1S1UB 2LDYA 3QINA 1RG6A 3R5AA 3NBPA 3G86A 1AW0A 2MRLA 2XI9A 2HCFA 2DPJA 3P5TL 4HWIA 1C20A 1TQLA 1T3QA 3LP1B 4P9SA 4FM1A 1JN3A 3JTNA 3QATA 3PJXA 3LGNA 3RH6A 7ICFA 3QJLA 2E5GA 4MIAA 3KUHA 3QO9B 4OYZA 2UP1A 4CK2A 1KQFB 3ZDAA 1S6QB 3D2WA 5HBMB 3LZIA 3KOOA 2QTWA 5J0QA 4DL0C 3SR6A 3AVLA 2LU1A 4LF7F 1IBCB 4E7IA 4IQMA 4FJXA 2MHEA 2YWEA 4PPXA 1K47A 3SEIA 2D1CA 3MM8A 4CLYA 4TLRA 3AARA 1NK5A 4ACOA 1HPZA 1ASUA 4YOYA 4NLCA 3CM5A 4FJ5A 2L5YA 1NSPA 5AI0A 2I5JA 3CMAS 3CXCR 1SJFA 1AYEA 5KOWA 5G4DA 2B21A 4A8SA 2CJXB 4X64J 1B70B 4OGCA 3DMJA 5FRMA 2H48B 1NMEB 2Y0SD 2W4DA 4W90B 3CDBA 3PACA 4YN4A 2YQ0A 4CO5A 3GV5B 1PYTA 1UWBA 3O44A 2A1JA 1VK8A 3BREA 5HSPA 3ZTOA 4A8MP 1UVIA 2BKNA 5KPRA 2PMZF 1E6YB 4CH1A 3MPYA 5DDPC 3KFUF 1VDVA 2NSCA 2DFEA 5KL1B 4CERA 2ROEA 2Q0RA 2DGXA 5FPNA 8ICPA 2OD4A 3N28A 4CHPA 2RF2A 3WKCA 2BZ2A 5AQHA 2QLJB 3DDNA 3VEYA 2IJFA 4PGYA 1EHWA 2O4GA 4CBUA 2YKQA 3ILJA 3SSQA 1KVBA 3MD1A 2FC9A 2N3LA 4OYOA 4DF4A 3OBYA 4I6AA 3PO5A 5EWEA 2KI2A 1XHXA 2IIHA 4JI3J 1R27B 2VFSA 4A48A 1IO2A 2KJ8A 1VYAA 5DLGA 3A5NC 2WVEA 3DI6B 1HLWA 1EKEA 2IA0A 2GAGC 4KPYA 2QK9A 4EZ6A 2DD8S 3O3HA 4MDAA 2QL5B 2FJBB 4CJPA 2WSFC 1IKVB 2IOCA 1HFEL 4L72B 5K14B 3CG7A 2ILZA 1DKGD 3UO0A 2HNDB 2M9KA 1EZZB 2WFBA 4CHOA 4DSFA 4XDCA 2QB1A 3VENA 3JXUA 2XIDA 2WSCC 1JLQA 4GKKK 4DF8A 2JV3A 4AL7A 2GVDB 1IG9A 4PZVA 4HUGA 3C1ZA 2JFDA 1S0NA 1U1KA 2BXJA 1JKHA 3FFKB 2H3QA 4JV2A 5CYMB 1N61A 2V8VA 3VVUA 2WB1D 4DV0F 1EP4A 4YXMA 4PHTX 5ETPA 2P9LA 2A6OA 1W2BM 1FDDA 1EP4B 2Q43A 2ETJA 1FDBA 2OPQA 1VLYA 2KXNB 3H4BA 5F8NA 4U95A 1SKRA 4HHUA 3RB0A 3QESA 1WJ9A 5CE3A 1KVAA 4P2SA 3P5JA 4YHHF 4DV5J 2KKZA 2ZXIA 1TMJA 1RCOB 4LF9F 3EKSA 1ZD5A 1VQYA 3T6BA 1X42A 4ILMA 2KVSA 4WU2A 1MROB 5AZJB 1U26A 4RWTA 2ITMA 4IO1A 1IH7A 3C7NA 3SBGA 2EZZA 3PDNA 1JLFA 4QZDA 3UD3P 2RQKA 5B0DA 3HVRA 2ZTCA 2LDIA 1NWKA 4LF4J 1SQGA 1XEZA 4O5BA 8ICUA 1N5YB 3TWZA 4MK9A 3OTOJ 1TL3B 5IT9O 2L9NA 3OY9A 4X4UA 2YKOA 9ICUA 4C4SA 2DKXA 3KVGA 2W9AA 4I2EA 4L75A 1BVSA 2DNMA 1FWPA 3F41A 1NJIT 3D68A 4DR5F 2OA8A 4NLQA 4ATNA 3HL8A 4M3TA 3ZEUA 1CXQA 3QUTA 1FRMA 2W6KA 4DCOB 4DPWA 4BWJA 1NSQA 2VIXA 4OZLA 7ICLA 1QZ5A 3ZTRA 2YNFA 1OIAA 3QGIA 1RT3B 2IA6A 4YNQA 1Y5IB 3AOBA 4B3TJ 2F9TA 2FF6A 2FB0A 2ZIWB 1DTQA 4BRMA 2AHOB 3QIOA 2HNYB 4Q7AA 1KONA 4MFFA 3KK1A 4V19J 1F60B 3PEHA 4F0KA 3RMDA 4V19S 2GNKA 1ZAXA 1BPEA 4WYWA 1XMOJ 3CWJA 5HP1A 3GJTB 5DDMA 4ED3A 3DU6A 2W4PA 2MLXA 4KB0A 3THVA 4RNFA 1R6YA 2P2CB 1RTJA 2VQFK 3W9HA 1SKSA 2MGZB 3Q8KA 3J80Y 7ICTA 2YMMA 4B3RJ 1RCXB 2YHYA 3KTQA 2GV1A 1K73T 3PX6A 2QMWA 2ZHOA 1T9UA 2JRSA 3C8YA 2CXYA 4AYBC 4YOXA 2MZJA 5JICA 1UZHA 1VJ5A 3AD7C 1DK3A 4BQLA 1VQ9S 5CA7A 4LF6K 1KC8T 2C2DA 2VL1A 1WHWA 5J2NA 1KCFA 3VESA 3ENQA 4JK1A 1NHVA 2MQNA 2BX6A 2GX8A 1LOTB 3IP0A 3MWBA 1D4XA 3UE2A 4UB8U 1U1PA 1Q78A 5CZ1A 5AKJA 1HBNB 3DCAA 3M7VA 3FQLA 2GHVC 1DOQA 1R8HA 2DGWA 4BRPA 3I28A 1C0TA 2AEJA 4EP4A 2CZ4A 2E8MA 3AFGA 3FZHA 1TUGB 4AHVA 3HZ6A 4C4TA 1HQUB 2MKHA 5ETNA 1VC0A 3GG0A 3THXB 5CWRA 4EBDA 2VICA 4FJJA 1K0TA 2F7TA 3EE8A 2KT2A 2X7IA 4F2RA 2RD5C 2NRVA 2AZ1A 1M0SA 4OPKA 2E2QA 1H7XA 2WW8A 3S3OA 2I5JB 4LUBA 4J2AA 4DR5K 1RT4A 4YMOA 3LQVA 4Z94A 4KV8A 2OFHX 3MMAA 1GOAA 2R7SA 1XSLA 3W9JA 3I5AA 2DNGA 1TUWA 1VQ6S 4J9RA 3VGSA 3N6LA 3LH2S 2R4FA 3BM7A 3QE9Y 3BKFA 3OVAA 1R0CB 2ROPA 4IOAQ 1M5VC 4B3TF 2VA3A 4BGDA 4JI5F 3DC2A 4YN3B 1YIJN 3F53A 3AVHA 5C25B 1NK9A 3C46A 5KFTA 2CXEA 1SV4A 3AQFA 3SENA 4PGXA 1P9YA 2MTLA 1Q8LA 5HMXA 4DU4A 2F8HA 3KLGB 2Z7JA 3AUOA 2DVIA 1ECWA 3CCUS 2BTFA 3D2SA 4LFBJ 3CFOA 3TAGA 1YVUA 3H42A 1BGXT 1S9GB 4USWA 4G9BA 3L3VA 4PZNA 4FNHA 2HQGA 2HS4A 2V8PA 2FZGB 4Q8FA 4JRPA 4UB1A 3J7ZT 4NLYA 1HQEA 2ZH9A 3M8QA 3LPTA 2ZIVB 1GXLA 3MM6A 2OPRA 3CCEN 4C8MA 3OW2R 1ZA2B 2E4LA 2HK3A 3QFPA 1IKVA 1H1VA 2JRZA 3WKBA 1FRXA 5GADI 2ZNYA 2ZITA 4N8OA 3OL7A 1CJVB 2J0QD 2X1GA 1S1VA 2VCPA 3O80A 1Q8KA 3GBTA 2J76E 4H0YB 2ZHAA 3BGUA 3OTBA 4NLPA 1ZQNA 4USHA 2GFFA 3EGWB 3R7SB 1QQ5A 3NAEA 2DH8A 4KHUA 4OI0A 4CGGA 4X4NA 3OS2A 3V7KA 1G6BA 2DR5A 8ICZA 3R1HA 2KK0A 1ACMB 2IDOA 4JBCA 4YB1P 4DN0A 2A1JB 1R6VA 2EBEA 3VQTA 2OI2A 2Z1JA 2MZ1A 3H0PA 3ZT4A 1JJCB 2KG0A 3RRKA 2KP7A 4JI0K 4YFUA 1YI2S 2LXIA 4AHRA 1P8GA 2IBKA 1XN9A 1L7NA 1Y7PA 4I0WA 2W2OP 4FF1A 1RU2A 4MKYA 2HSZA 2JC0A 4Y2RA 4NLRA 4XDDA 1BCMA 3AO4A 1VQ7S 4GVLA 1JROA 1YJWS 3LVVA 3IGVA 4M41A 4OZ5A 3T5KA 4H4OA 2JH3A 1RGIA 5A8WA 2R8KA 2BANB 1WSFA 1QTMA 4DSKA 5EE3A 4JKHA 1VQ5N 4JI5J 4WWSA 2V8HA 2F1FA 2XYPB 4LRDA 4M5JA 2V4RA 5K20B 2VH7A 2W3RA 3GYGA 1LW0A 3TRGA 2KFYA 4CK3A 1JJ2R 3KOAA 4I2AA 1ZZNA 1HNXJ 3M32A 3AVAA 1ZETA 3LA0A 4DFDA 2W2QP 4EFHA 1RT5B 3MEGB 4X84A 1J54A 4PWUA 2YVSA 1BD6A 4UB2A 3S3NA 1BIZA 1CPZA 2KVQE 1SKWA 3H59A 4QZEA 1PILA 2IHNA 3KJVB 1ESVA 3AO3A 4QYZJ 1G4CA 4CF3A 3I56S 3VF4A 2QKQA 3ZEUB 2ATLA 4JNEA 5KG0A 1IWGA 4BRGA 8ICHA 2HS3A 3FEXB 2HHXA 8ICLA 1G15A 4O8KA 1EXQA 1RT6A 1SL1A 4H5TA 1RYSA 4YB7A 2M8HA 1GTEA 1XNRJ 2ZIVA 4USKA 3ZX2A 1FRKA 2RUGA 2D5RA 4OJHA 2D3OR 2CA9A 1HYVA 2YH1A 4ZOSA 3NVMA 2YKAA 1LXJA 2GUPA 3GZ7A 3FQKA 4TYBA 1KVCA 3M4XA 4EHTA 4DCPB 1Z3EB 1BPXA 1QAXA 2IYIA 1YRTA 2XQCA 2W7PA 3ISZA 5ALNA 4DPUA 4FXWA 4ZPAA 1MW7A 1HKAA 1RTJB 3OYIA 1V4TA 1FJ7A 2HZVA 1Q18A 1ASWA 1NLKL 1Y5LB 5J2JA 5AICA 3H1VX 4CGZA 4B1YB 5JS1A 4CLWA 3ZTPA 1NGJA 2CJBA 1GXTA 4M94A 4WQ4C 3F2KA 4LFCJ 3WQUA 3FCWA 3TZZA 1S7IA 3VTIA 3ZCMA 4Y0WA 4K41A 7ICKA 1Z26A 3HT0A 2AEFA 5JVHL 2PFDA 4M5GA 4NWBA 5HLFA 4MJKA 4XK8C 4U7BA 3PEJA 3PJ9A 1BA0A 2DNZA 3O9SA 2CQ1A 2OH2A 2IRYA 3MXMA 2CH5A 4N47A 4IQXA 1VCTA 4CZMA 1RWOB 3MN5A 1ZQCA 2NLXA 4GV3A 2Y9UA 1NOZA 1H7WA 1KOOA 5CCMA 3W3SA 1G2EA 1BL3A 4WFBL 2BQ3A 4XTTA 1WKLA 1FNXH 2HHPA 4TY9A 1JWWA 2XULA 8ICCA 1MU2A 2HLUA 2EC0A 4R25A 4J9LA 3T1HJ 3D54A 4YY3K 4KV8B 3S6JA 3SAGA 4E3SA 4B3OB 3LGMA 3SDEA 1OH6A 3SYZA 2IJRA 3B4DA 5AI9A 4NI2A 3ZZTA 3UQ0A 2DXFA 3P39A 4G1IA 2LLZA 2J8AA 3WK4A 3C1YA 3CNQP 2BCVA 2GMLA 3G25A 3A3NB 5AQZA 4NLWA 3VQ5A 3OHAA 4Z2XA 4LVSA 1TVRB 3MPUB 4MIWA 1D9AA 3O5TB 3T3FA 4DTNA 4QCLA 2HFUA 1JALA 2FGCA 4AF1A 1N5TA 1EQMA 4K59A 2E8OA 1DTTB 2RKIA 4WP3A 3FEZA 2O8BB 2Y8WA 3J7AP 2XY6A 3VQ6A 1O03A 5EY4A 4IYQA 4DB3A 3NTUA 1FNMA 1I51B 1DGSA 2W04A 2UV8G 2YBVA 4N8NA 3WT0A 3VAJA 5HI7A 3HKWA 4YHHJ 4RU2A 2LXUA 4H4KA 3UVJB 1PKUA 4HACB 4A8QA 3RRHA 4X64F 1NBWA 3P4IA 3DAWA 1CULA 1WUUA 4WCEL 2QLFB 4F4KA 3NMRA 2KIWA 3TFRA 1CULB 3T69A 4FF4A 3JB9k 1BQXA 2CQ2A 2DWQA 1XMBA 2ISPA 1XMOK 3SUNA 4TQRA 2ZJ8A 5KT2A 4DV1K 5KFDA 3M1YA 3VQ8A 1VAZA 5J2BA 3OFGA 3OS0A 2KXFA 3I0RB 1BNOA 4Q43A 4K4WA 4OIXA 5D4BA 1NJYA 2AGQA 1ULRA 3UDCA 2PI4A 4UY8O 4NEYA 2EG2A 4DUTA 5AK6A 5J29A 5A2QO 2ZQBA 4AXJA 4GVEA 1GLJO 4GY2B 2E1MC 1KLMB 2NRXA 3QMQA 2HKEA 4EBCA 5AKYA 7ICNA 1HI1A 3SBMA 3I82A 1JLCA 3NH2A 2G2YA 2LU2A 4IDHA 4ES2A 1RHQB 4DU8A 1E6YA 3QB0A 5HL7Q 5THWA 3HMJG 1DURA 2JNJA 3SQ4A 5HMYA 1VQ8N 4TVAB 4EX7A 4A46A 3C15A 3D2FB 1SB3C 2AP1A 5J0PA 2B4OA 4CLZA 5H9EJ 1YJNN 2DCUB 1QD1A 1TL1A 4XRHA 2YX6A 3D6TB 3KLVA 3KLIA 3WK6A 3P5BP 1CJUB 3N7SC 3J80U 1AFJA 2NS1B 2YHBA 3OYBA 2V2QA 2HRUA 5B0GA 2C3UA 4ANCA 4CEBA 5F8HA 1QM9A 5LMUJ 1HNIB 4IUFA 1KS2A 3AB2B 2BE7D 1SL2A 4RZRA 1UJ6A 4UBCA 3MMBB 2AX0A 1YBTA 2E6MA 4ED7A 4L6V3 3EVOA 5J2PB 2PA3A 4ISGA 5DGAA 4I67A 3GTYX 1S7HA 4ED5A 3D6RA 2DITA 5HRNA 2IPOB 4Y2YA 2VPXB 5AJ3K 3JPPA 2F4VJ 1EB0A 2QW9A 5KFOA 5J2AA 1SUQB 3VEOA 2F3NA 2NO5A 4M63A 1BI4A 4YOUA 4K5RA 1DFDA 3SNNA 5D0EA 4UW2A 4U9RA 1LXNA 4MK7A 2I9SA 1GT8A 1WC4A 5HNKA 2QMXA 4LBIA 3I56N 3KG0A 4JI2F 1NZBA 2YNIB 3SK3A 4U7UD 1S97A 1U8SA 5BOLA 1U2VA 4MYUA 2UXDJ 3O4WA 1RTHB 2CG4A 1HUOA 5KRTA 3GJSB 3PW5A 3M9OB 3RJMB 4MK8A 2NXCA 4DMZA 4DHYA 1KAZA 1RWXB 3K59A 3RMBA 4KHSA 2HGMA 2AU0A 4PKHA 4PXBA 3W60A 1QQNA 1OJ4A 1U47A 3NBPB 4NM1A 2FYXA 4I1TA 3NLCA 2E1PA 2BPFA 1NKEA 1LOUA 1SC6A 2BOAA 4M3UA 4FLUA 4CTAA 2YMQA 4ZTJA 3M2UA 3R7BB 2R8HA 3DLRA 3I0SB 2RP5A 2H3IA 5J2KA 5TKWA 4NLUA 3I0SA 3R9LA 1CLFA 3O1LA 1M5SA 2D0CA 2RE2A 1S9FA 2Z2MA 1APSA 3NVKA 5J2DA 2DNNA 1RTIA 2D0PA 1QVFR 1GOBA 5KFUA 3NWGA 4NJ8A 3EUNA 2RLTA 4CYUB 4BUGA 4BRDA 4K8RA 3IG5A 4UQTA 2CJKA 1SWVA 2E1RA 1I94K 2DR8A 4CFBA 4X66K 4QIEA 2XLIA 1FNOA 3SI8A 1X40A 5HLFB 3RRGA 3D0GE 3VA3A 2RU3A 1A5VA 3LZJA 5CB1A 3DRRA 3MUVP 3P3DA 2FDNA 2B9EA 4K0KK 3ONNA 4MF2A 2F2AB 4X4TA 4JEPA 2PO4A 5LY3A 4NE9C 6FDRA 5J1PA 3TAMB 2RN2A 1PBUA 3A3PB 4KI6A 2YKMB 3ENHA 4EUVA 3EZOA 3MMVA 3WQTA 3NF9A 4RBUA 3LAMA 3G2XA 2GV9A 4IJNA 1VHIA 4CJUA 1YUWA 4CJLA 4ECUA 4A8WA 3RB4A 2PFOA 2ZD1A 1SXEA 5IQQA 3VTHA 4DKWA 3H45C 4KBIA 3PXGa 3KJQB 3FRZA 3P4UB 4B3TK 3HHDA 1BC6A 5T7LA 1Q9YA 5EUHA 4QZIA 2MSTA 3NGIA 2G07A 3OR1A 3QT5A 2ZGYA 1U1QA 2DNKA 2GCFA 4OLOA 1LCUA 4FJ7A 4B8AB 5K8PA 3TZWA 3CFPA 4OJ6A 1IR2A 1S9EA 4JI5K 2R7XA 3M3ZA 4Z6FA 1K8AT 3WK9A 1GOCA 3CYMA 3GFYA 2J9EA 3IBWA 3KNGA 2AF6A 3I5BA 1VQMN 9ICXA 4I2JA 1NKBA 2BJEA 1FI4A 2VU5A 4C4RA 3FFIB 3PSIA 3FKBA 2PSZA 1V5VA 2DPNA 5C0YA 3HVTA 1HI0P 2PMZC 1REVA 1U25A 2N82B 3ITHB 1X9MA 2Z1HA 3SUPA 2KNJA 1V3ZA 1U0HA 3SCKE 5IIKA 5J2IA 3CJ9A 2JSXA 2PYJA 2KQ2A 1X60A 5TKYA 4LF5J 1ZD2P 3U02A 2ZIWA 3KHRA 3DLLQ 1ZQRA 4ELTA 1N5QA 1ZPVA 3H2UB 2O8DA 2IFXA 5KQDA 4MEYA 1HUXA 5J2FA 4Y2SA 3O9RA 4NASA 2XLJA 4RPFA 3NOCA 2HHTA 1CUKA 2GBZA 1VSLA 2N1RA 2L9DA 3P31A 2F7VA 1S0VA 3ZDCA 3SMPA 4P75A 2IC3B 2LQBA 4X5VA 2RVJA 3NS7B 2HRTA 3U27A 4LQ3A 4BC5A 3MCAB 7ICQA 1VK3A 8ICJA 4CJVA 4JI8J 4KTZA 1LWCB 3JS6A 2H5XA 4JN4A 2A1BA 3SV3A 3O08A 1IUJA 1YJNS 1LK5A 4KLDA 1X66A 4ZPWR 1CVJA 3MN6A 2HMXA 3JPRA 3K1ZA 2Y1RI 1TK8A 5ETKA 2GELA 3VHQA 1PSDA 2V4QA 2ZJ5A 1J2VA 2A10A 2WOMA 4AH9A 1N6QB 5KFLA 1LAVA 1C2PA 2CNLB 1F9FA 5IQ6A 4F8RA 5D4OA 2FLOA 4GFJA 1RT3A 1TL1B 5GMDA 1XERA 4G6VB 5LL6Z 4R79A 3M8RA 4B1VA 3NCQA 2KH9A 1OKJA 3M8YA 2KG1A 3KD3A 3SV4A 3HFZB 4OZ1A 5HN0A 4FZVA 5DLFA 3FRYA 1N32J 3NGTA 4B1UB 5J8YC 2KV2A 1M1HA 3X1LB 2KKHA 1SV0A 2KKPA 2BGGA 3IP4B 4IH5A 1TUVA 5AQSA 3MPVA 4PAAA 2OPRB 4DFPA 5AZIA 4OPHA 4PPDA 3LDOA 1VQMS 3DN9A 4DWIA 1M1KO 1HL6A 2EFOA 4C9DA 3ZX3A 4PHEA 1Y3KA 1WG4A 2DEJA 1DRZA 4UAUA 4ZIWA 2FVQA 4KKOA 5F9LA 2ZGZA 1T95A 4FOIA 4W5OA 4HH1A 3DM2A 1RZMA 4BRLA 1COKA 2VUGA 3CCVS 3C2KA 3MD3A 4H0XB 3A2FA 3Q23A 2HQCA 9ICSA 5CEHA 2QE5A 2XGPA 1TMMA 2DO4A 3ZDEA 5J0YA 1TR0A 5F8MA 3NNCA 3KWIA 3I31A 2YY6A 4TN2A 4MO5A 1R0AA 3OTOF 1N34J 3NGZA 2VANA 3FBCA 3D45A 4I2CA 2WF6A 1UEVA 5HHIA 1DGKN 2OELA 3VGVA 1HBMB 1ZQIA 3IRXB 4R8UA 4Z4HA 4RO0A 1YTAA 4CLPA 3T79A 1QQMA 4J9KA 4DR6F 2C2ZB 1X5OA 3CPWR 1LKYB 4OI6A 1B7YB 2WAQC 3M05A 4YHHK 1P1TA 4DV7J 4OHZA 3D6JA 1QAJA 1BOTO 5KG2A 2PE8A 3EE3A 3IDHA 4CRJA 1RTIB 1T0TV 8ICFA 4JRQA 1N63A 1VGYA 4CEZA 2CPRA 2CQCA 3HSJA 4KYZA 5HVGA 4NCAA 4FN5A 1N5YA 4DL6A 4IO9L 1OY9A 1J5EF 2EDUA 4RQ8A 2E1CA 3MDQA 3VMFB 1RWVB 3CB4A 2M3DA 4XPCA 3FLCO 4J37A 2CH6A 5H9EK 3AD9C 4X65J 3T1YJ 4J7CA 1BQMA 1CS4A 2ASPA 4A5AA 2KE7A 1RAFB 4BR2A 2WBMA 3H6EA 1MSWD 3HRDD 2IS3A 1PC5A 1M1KT 2ZTDA 5ADXH 2GHWA 2M8DB 2RPIA 3QWUA 2P6SA 2MXYA 3DDKA 3ISCA 3OVNA 1T8EA 4DSEA 4C8ZA 3MABA 4BDYA 1UT8A 2QFIA 3DLKB 1UPHA 2BPCA 1TK0A 2YKPA 2OHDA 1VOMA 3E9OA 3PFOA 1LWFA 3R5BA 2J9CA 4RW4A 2JWKA 4NRTA 3EKUA 4DR4J 5ALPA 2F4VK 2HNZB 1MWZA 3Q8SB 4H0TB 1D09B 3MX2A 5AJ3J 5A8KA 1SAZA 2B9WA 1RE1B 5JLFA 3LF0A 3BH7B 3DLHA 1JJ4A 4OZNA 2I1QA 4ERDA 1Q8BA 2ZVIA 4H0VB 1H3DA 1R8AA 5D4LA 4KE5A 4FLYA 3D4JA 1CC7A 5LMUK 5B7WA 5E79U 2UXDK 1IM6A 1X9JA 3PSFA 4RPYA 3MCOA 3CD5A 4O5KA 4O3RA 4W4MA 4TYAA 4X65F 3W2VA 3T1YF 1CJKB 4F3MA 2HWTA 1KEKA 4J8FA 5KTQA 4BRKA 2K8AA 2QTDA 3PO4A 4DUYJ 3VAGA 2OPSB 3BF1A 3D6FB 3DRSA 1TZ0A 1U6FA 2YB4A 2CUYA 4KR0B 3CCJS 4FYDA 1S0MA 1VLBA 3E51A 4J5OA 3TVZA 4GXIA 1LFPA 3QDKA 1NH7A 1RDBA 2F76X 4LFAK 4RQ7A 5L46A 3CERA 3HHNB 4QZCA 4X4PA 1NO8A 5KT4A 4PCQA 2HWHA 9ICMA 5AM0A 3C23A 4ECTA 2ATQA 8ICNA 3CTRA 1DRGA 3QU4A 2UXDF 1RXVA 1FRJA 4JI8K 2BM1A 4GMKA 4I7FB 3BJYA 3B0XA 5GINA 1GMVA 2LCWA 3I0RA 1FCAA 2DEIA 3CJ4A 3F9MA 2QB0B 3CUNA 3Q8RB 2NRTA 3DOKB 1ZQJA 4ZN3A 2KT5A 4OLAA 3QZ7A 5DQGA 5IC6B 2KO1A 4RU9A 3EO3A 5C2FA 1RISA 4K42A 3CO9A 3V9UA 3D28A 1KL9A 3L2RA 1UJ4A 3N6MA 4O23A 2Q0UA 3SXLA 2O8FA 5A76A 3QU9A 2MY8A 3OYJA 2CYYA 4NXZA 4ECSA 2DNPA 4QZGA 1I5OB 3LDNA 1O0PA 4JD2B 3NMUA 1TFYA 2YX7A 4CF2A 2DXEA 4FS1A 4PABA 5T41A 2PIIA 2Q6CA 2MUTB 5DBAA 3CDEA 1RBLA 4XH4A 2BCRA 3K1RB 9ICGA 5ALOA 3AEVA 2DGSA 5D15A 5L1KA 1ZBLA 2QL9B 2G09A 4CLTA 5LJWA 4ECYA 2E2OA 3VPZA 2FJAB 3ZZPA 4WTYA 5HJXA 2FHOB 2P9LB 3J7YI 2D69A 1YITS 3H4DA 4A8KA 4DUZF 4DV0J 3RU0A 5J2CA 1XMOF 5E7OB 3TAEA 1PZNA 4ZJOA 3OLAA 1Z2LA 3OYNA 4ZMMA 2M52A 4ISEA 4W5QA 4PG6A 3MXHP 2QLXA 3HDSA 3CGIA 1QQ6A 2RILA 2F8MA 3IGNA 5ALIA 4ZH4A 3FCHA 3TJ8A 4NL5A 2EH9A 2N7CA 4Y2MA 2LI6A 1DK2A 3DGPA 4PXDA 4J9SA 4PUOB 2ZJQQ 1WBDA 1X5TA 3MXJA 4FK2A 3TFSA 3DM2B 8AT1B 5CY4A 3R2CJ 2LQ9A 1KN5A 3GILA 2MKYA 2RS2A 4DZ6A 2E5IA 3AQEA 3C7NB 3QUCA 3H0MB 2WHEA 1CJKA 4GIBA 4MT1A 3Q2TC 4CIGA 3WXIA 3UM9A 2VFTA 3O8MA 1O5JA 2MZSA 3V9ZA 2KZZA 2GGPB 4AT1B 1OSDA 1FIQA 3CIPA 4FDFA 3BBBA 1GNKA 2V9WA 5B0BA 1X4BA 2OLWA 5AQUA 2OPPB 2BW7A 2AXTU 4QZFA 1WHVA 3AY9A 2HBRB 4TU8A 4GVBA 3RYLA 1UVMA 1QS4A 5J0OA 3C14A 3M6ZA 3MOJB 1HEKA 1MWQA 3IA0A 1O08A 1N5VA 1K9MO 5CXTA 2HHHJ 1XC3A 2DRDA 2HBMA 3NF8A 1QJHA 3KUEA 3TR5A 4B9MA 1FRLA 3TARA 4FYYB 1Z00B 1M6YA 3OYEA 2KHDA 4WF9Q 3NGUA 3R8YA 2UUBK 2MDAA 2HNYA 2IBOA 3TSUA 1SH0A 4PL2A 3UCUP 4OJPA 1NEEA 3QT8A 4AQYF 4JD2A 1J6ZA 5J2PA 1C0MA 4BDPA 1UFKA 4MQ3A 2G0IA 1LKZA 1I3AA 3ZT2A 4JWNA 4M9LA 3OS1A 2KHOA 3H8WA 2JVRA 5KFJA 3DYAA 2A3ZA 1PYOB 4NL9C 3S1TA 3WNHA 2NSBA 2HBJA 4G1QB 1FFUA 4WE1B 2XS7A 5BPMA 4WFAL 5AM3A 3PYEA 1JLCB 4CFDA 4Y2JA 2HAIA 2C2KB 3RBDA 3CQ8A 1EX8A 3IBFB 3VAFA 1BU6O 2HQIA 1T11A 4DOBA 1VQNN 2V94A 3A8KA 2KU7A 5CHGA 8ICIA 3SUOA 4X65K 3T1YK 2HZAA 1T6CA 2KM8C 3OR2A 2JOQA 2LQ8A 2B51A 4LH5A 4CJ3A 3M9MB 4WFBQ 3BF3A 3BV8A 2BJ3A 3P96A 5AQRA 4KX5A 5K8NA 4DV2K 3A8EA 4ZLJA 3D6MB 4QIWD 4C23A 2JLEA 2ZWHA 1VMBA 1DHMA 2ZE2B 2Y8YA 2G1HA 3AVJA 4OGEA 2M0GB 1BDGA 4WF9L 5AQOA 3ISDA 1ZXOA 3SBTA 4PWDA 3W66A 1FFGB 5GTIU 3ULEB 2IHR1 1J2NA 1MU2B 3SPZA 2AGOA 5EU7A 3SQOP 1N32F 4HTLA 1OSCA 2CRLA 2D1KA 2R7QA 2RDDA 4M45A 2VKQA 2NO4A 3MMCB 2M88A 4M7YA 2PFQA 2ASYA 4GXKA 1XUPO 4CDGA 3AODA 1SBRA 1N34K 9ICBA 3FZBA 4J90A 1TUYA 3A13A 7ICGA 3BSCA 4PYDA 1U48A 3R3TA 2UUBJ 4ID5B 2OXOA 3GR1A 4KHPF 4YORA 2GOLA 3GFKB 2BPGA 3H90A 3WK5A 3J81Y 1HHQA 2WUSA 3VOVA 2GLEA 4ILHA 2XMUA 1CC8A 4FVMA 4JAXA 3HXMA 4NLBA 4F71A 3HZEA 1SJRA 3TU5A 4CJSA 3LDAA 4RPZA 5H1SQ 4K2JA 4KPCA 4M9HA 2R3VA 1IBLJ 1HNVB 4FSVA 4DV6J 4KHNA 3O3LA 4LF8F 2ZC3A 3D2EB 4RQ3A 1HQEB 2GC8A 2LYVA 4E98A 3OL9A 3UR0A 4PL1A 1B4SA 3QT6A 3I1YA 2BGWA 3RB6A 3K5MA 1O13A 3V4IB 5K5MA 4LSZB 3QU2A 3EN9A 4OHXA 4J9UE 2KLAA 2ZJRL 2E5HA 1RDUA 4Y2KA 3ATUA 1AROP 4NY8A 3W2WB 3BO3A 4Y2AA 4OO1J 2QARB 5E41A 2P9UA 4P73A 5I4MA 4EO8A 3WQPA 4ZCKA 4KO0B 2JHDA 2V7ZA 2EWSA 3OVBA 3BKTA 3CFRA 1QAYA 2B7CB 2G0CA 4DPTA 4DV4F 1WSGA 1R0AB 4K4HA 3NUQA 7ICMA 1N5WA 5C5JA 2V8GA 1F2GA 4RT2A 2Q36A 4ZJLA 4JKAA 4PEOA 2P9KA 3H2LA 3L4IA 1T9VA 3O9UA 2H65B 1K1SA 3HRGA 4ECWA 1OUQA 1ZQYA 3KK7A 1LAWA 1VS3A 2A1RA 1MWMA 1U1LA 3CRXA 4AD6A 4I2FA 2W9BB 1L3TA 4M3WA 4BVOA 1RHMB 2B9YA 1U2CA 2KW4A 1LWXA 4FLWA 4ZN1A 5E3AA 2OSQA 3F9KA 4AM6A 2WF9A 3GLJA 2GZOA 3FEYB 5AXNA 5AQVA 5BREA 2H3ZA 2ZM6F 1KD1T 5ELZA 3JPQA 7ICIA 3MF5A 1IBLK 2FUG9 3O8WA 4DL2A 3DOKA 5H9FK 2EC2A 2ACYA 4C0BA 4ZDNA 4X66J 5H9FJ 4G1PA 3FMWA 1AFIA 3WIUA 3AA8A 3ZSOA 3MDAA 1Q16B 5ETSA 2CQIA 4WJBA 7ICPA 2OCEA 4P52A 1CS4B 2R7TA 3C6UA 4H4MA 1T44A 1Z4OA 2WOMB 3U9ZA 2AEMA 2AP6A 2V9KA 3NVVA 1SC1B 1A7GE 1VQPS 3QX7A 4X4VA 1FK9B 4QWAA 4RQNA 1MG7A 3T9ZA 3AU2A 1ZQTA 2DKOB 4DV2J 2XWYA 1IQZA 4DJBA 1J5OA 1Y0HA 1HWLA 1UWAA 5AXMA 1V9PA 1S1UA 4JI0F 2FMPA 1NM2A 4FW1A 4CW7B 3T5LA 3NRWA 1SXLA 3QLHA 4E1MA 3G4SS 3ZT0A 2R7UA 1HUZA 3NEKA 2V2KA 4K4ZA 3W5ZA 4WIIA 5H1SV 1B7FA 3VF2A 2EFGA 2WZ1A 5L9NA 2EAOA 2FHJA 1GK8A 2KYXA 5U47A 5HMZA 2QJ3A 2D3UA 1BPZA 3M2VB 3LP0B 4KHWA 4E7HA 2QC3A 5JTIA 3HSTB 5TISU 1RAOA 2H54B 4CECA 2DFHA 3JSBA 4C0OC 4L3KA 5DBBA 1XQSC 2EEYA 4OD0A 4H0PA 2WVCA 2XM3A 5HMMA 2HQDA 1P90A 1YJ7A 3WC2A 4U7UK 2APOA 4DOAA 5SUHA 2M0NA 5CZVA 5ALRA 5J0SA 4RUHA 4P71A 4AHSA 3ZDDA 1HI8A 4AILC 1RTZA 4GV9A 5ALXA 3RAXA 5ALZA 3N4WA 1ZBUA 3GYNA 2LMIA 2DYAA 2BRKA 5DQHA 3IAS9 3KNAA 3DLBA 2W2MP 3C16A 2K4PA 3SAFA 3VA0A 2ZUGA 1NB7A 1NU0A 1IQTA 3TACB 1P1LA 3LWMA 5C2DA 2QWMA 1N6QA 1RDAA 3W7BA 1WF1A 1UPPA 2DBBA 4C0ZA 2G5HB 4JMUA 2A3JA 1RXOB 4DQIA 1IBLF 4DR1F 4JI8F 1B3TA 2E8NA 2W41A 3UDLA 2V5HG 3UKUB 1Y11A 1YJRA 1VQ6N 4C7YA