4EZ9A

Bacillus dna polymerase i large fragment complex 2
Total Genus 197
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
197
sequence length
578
structure length
578
Chain Sequence
KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase
publication title Structures of a High-fidelity DNA Polymerase
rcsb
source organism Geobacillus kaustophilus
molecule tags Transferase/dna
total genus 197
structure length 578
sequence length 578
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4ez9A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4ez9A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ez9A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ez9A01
4M3UA 2IBKA 2ZUDA 2E6MA 1IKXA 2R7YA 4AHSA 3PR4A 2Y1IA 3KLHA 3DOKA 3MEDA 3KLFA 4RT2A 2ZTCA 1QQCA 3OYDA 1RBUA 4J9NA 2RPIA 2NRTA 3SNNA 3RBEA 2HHVA 4KLGA 4B3OA 4JRPA 4CF8A 1UA1A 5DBAA 1GOBA 3AVHA 4Q44A 2PFQA 1TAQA 3MABA 2BCQA 1BPXA 1ZQXA 3AA3A 1ITGA 4J2DA 3SQ2A 3OY9A 2ETJA 1HUZA 1B9DA 3V7KA 3Q8KA 1HYSA 4CK2A 4PPXA 4BDPA 3G0ZA 4CGFA 4M6WA 1RDBA 4J9MA 3K5OA 3RRHA 2BDPA 2IS3A 7ICQA 2B4JA 3L3VA 1S0VA 4NM1A 4BWJA 1I39A 2I9GA 3EW9A 1RT7A 3ZT1A 2GV9A 5J0SA 3IG1A 4FLVA 2W9AA 5CYQA 2ZUCA 5DG9A 1T4GA 3DLEA 5D4BA 1EX4A 5HROA 4RPXA 1ZQQA 4YNQA 1TKTA 3Q8QB 4R8UB 4FS2A 1NJZA 3Q8MA 1JXBA 3VA0A 9ICVA 1NOYA 5KT3A 2Y1JA 1LWEA 2W9CB 5DB6A 3MR2A 3WNEA 2A1RA 5HMLA 1HRHA 1L5UA 2O4IA 2AJQA 4DTPA 1JIHA 1S5JA 3HXMA 1TV9A 5J2JA 3V6HA 4CHOA 3DLGA 4R5PA 1JL2A 4FJ8A 3VQQA 3NF6A 5DDMA 1U45A 4I2IA 1VK0A 3T5HA 3AA5X 5F9LA 3C94A 3AVAA 9ICEA 5L1LA 5JUMA 2UVRA 4DSEA 3TAMA 3KD1E 3NHGA 1SZPA 3QEBZ 4N76A 1KEJA 4Z4FA 2XO7A 2G8WA 1S9EA 3ISBA 4CEDA 1MQ3A 3UPQA 7ICHA 3CQ8A 1LWCA 4O3NA 4CEQA 4ECVA 2RKIA 2P6UA 4J9OA 4LD0A 4CGDA 4QWDA 3VN5A 5KG1A 1Q9XA 4UB5A 4NCGA 2HVHA 3PY8A 1BPDA 2WTFA 3LP1A 4CIFA 4RQ1A 5CB1A 3BJYA 4CJEA 4I2PA 4KTQA 4QZAA 3O3GA 4KLLA 1SL1A 4F2RA 3ETLA 4DTSA 4CFDA 2VWKA 3JPOA 4IQTA 9ICLA 1JLBA 3HM9A 8ICOA 4FJLA 1IKWA 4F93B 4YR3A 1NKBA 4FM2A 3TAFA 3AVKA 5I42A 4YG2A 4PHEA 1BI4B 1QE1A 4DTOA 4TQRA 3IHQB 3SPZA 2OZSA 1NK8A 3H7IA 1I3AA 5KFEA 1XI1A 4KHYA 1J9AA 3MEGA 4M9JA 4DSJA 4DG1A 2YNHA 4LSNA 8ICFA 4J2BA 4E7LA 4QW8A 4CJ4A 2ISPA 4FW2A 4AH9A 1NK0A 2YKMA 3C6UA 4Z6EA 3T1AA 3AV9A 3HO1A 3GV7B 2HHXA 3K75D 5J2BA 3T19A 4N56A 2M9NA 3ITHA 3AVFA 4TURA 1MQ2A 4CJKA 7ICUA 1XC9A 4DFJA 3HL8A 2PI5A 4F5NA 8ICGA 4I2FA 1KVAA 4FBUA 1TK8A 4I28A 1U48A 5J0WA 3OJSA 3UIQA 4EZ6A 4UB2A 3AUOA 4DOBA 4CJVA 4HCCA 9ICMA 5KFBA 1VSMA 4F4ZA 4Z4CA 1ZETA 5EWGA 3SUOA 3KD5E 3VQDA 3TARA 5KG6A 3AA2A 4W5QA 4ZH4A 3BQTA 3U6FA 3QNOA 1WSEA 5HLFA 5D3GA 4ED6A 3OVNA 3HPGA 9ICWA 1A5XA 4GLXA 4XUSA 3HK2A 5KG5A 2X78A 5HHIA 1RDCA 2XCPA 2H5XA 1RPLA 2NUBA 4E3SA 1ZQMA 1ZQDA 2YNFA 3C5GA 5D46A 4F4YA 4DL2A 3CFRA 3QETA 4J9SA 3U3YA 3OYGA 3VQCA 4KLJA 4DF4A 3MXIA 1RTJA 4CHYA 1B43A 3VA3A 4J9RA 2ZJAA 2PZSA 4N5SA 9ICSA 4XRHA 3RJHA 3ZSXA 2C2RA 5K14A 3RBDA 1JL1A 4R8UA 4RW8A 3BQ2A 2C28A 2BQUA 4O55A 5SWMA 4DQIA 1ZYQA 2F1IA 2HVIA 5EWFA 1N5YA 5BOMA 2IAJA 8ICRA 2W9CA 1W9HA 4RPYA 3ZDEA 5DLFA 2Q3SA 4CJSA 3V9SA 3O4NA 4P4OA 5KG7A 2XY5A 7ICTA 3EZ5A 1ZQHA 5KRSA 2J6SA 4DLGA 4CF0A 2RN2A 3ZSQA 3RB4A 3L2UA 2HMIA 5L1KA 5EOZA 4KHSA 4I2EA 4M9NA 2NRVA 3HVTA 5KG3A 5HMMA 2PXIA 2C2DA 4M45A 4Q43A 4CFBA 3BDPA 3HP9A 3DLBA 4GMJB 4OGCA 4ED8A 3KJVA 2Z1IA 3OS2A 1MC8A 2P1JA 3ZDBA 3E01A 1TVRA 3RJFA 4CESA 1CEZA 1ZQEA 4ICLA 4PHPA 4QZ9A 4KHUA 4J9KA 3IAYA 3BQ1A 1HYVA 2OZMA 2C22A 1Y97A 4RQ5A 1BGXT 3SUNA 4QZBA 5C5JA 4I2JA 4CIGA 2ZTEA 5J2EA 3NCIA 4F3OA 3TAGA 4B8CA 5KI6A 1JXEA 3V7JA 1ZQWA 4RG8A 1BCMA 3U3GA 1RT4A 2XGPA 3PMNA 1O1WA 2MAXA 1ZQIA 1QSSA 4EBCA 1JLGA 4CECA 2QKBA 3T3FA 4CF1A 7ICEA 4RW6A 1KSPA 4Z6CA 4KTZA 2FMPA 4W5OA 4GXJA 4Q5VA 2R8JA 1KRPA 1CLQA 4IG0A 1VSJA 4KV8A 2GWSA 4O5BA 1C1CA 4UAWA 5EU7A 1VSDA 3P83D 4KRFA 3NH1A 4KN7A 1BI4A 5DMRA 3QEXA 3C95A 1ZBFA 3AVBA 3NGDA 8ICWA 4YMNA 4RW4A 3NF7A 1XS9D 1A76A 4CGHA 1ZQAA 5CJ7A 8ICYA 2LYHA 2KZMA 3HSTB 1YVUA 4BGDA 3TR8A 4IQVA 3ZSVA 5KFKA 2NRZA 4KB1A 3OHBA 4RQ3A 8ICIA 4DTUA 3QEWA 2ITGA 1U9LA 4R65A 3RH4A 3IRXA 1YT3A 3T5JA 3DM2A 2XGQA 9ICXA 3QIOA 4AHTA 7ICOA 1UOCA 4CEEA 3V6JA 2Q0ZX 3HP6A 2X6NA 1RXWA 3V9UA 3OYEA 4RUCA 2JEGA 3KKSA 5KFMA 3C2KA 3RMDA 4UBCA 3OYJA 3QE9Y 1EKEA 5KFHA 2XC9A 4NCAA 2Z1JA 3VQAA 9ICHA 1S0OA 5C24A 5J2AA 3TI0A 4FJJA 4M3RA 4B9SA 4KLHA 3MDCA 5FRNA 2HHQA 3HVRA 4FM0A 1S0NA 3RJKA 4IG3A 3ZCMA 3EPGA 2ASJA 3TABA 3QNNA 1XHXA 2D0AA 4NY8A 3VQ8A 5HRPA 1NK6A 4F8RA 4AILC 1VSLA 1CZ9A 5CP2A 2P51A 3SYZA 4TUPA 2BPFA 2DFFA 3EYZA 2IHNA 2PYLA 4B9LA 4PHAA 8ICSA 2OPRA 4DQSA 3TFSA 5KFUA 4R64A 4RUAA 1ZQCA 4DS5A 3K2PA 1K6YA 3LK9A 4Z4EA 2W8KA 1RXVA 2VA2A 4FCYA 4OKKA 3RMCA 4H4MA 5KFZA 2XY8A 4B9UA 5J0PA 4O3OA 2BHNA 4FJGA 2W42A 3IS9A 3HT3A 3K59A 4M9GA 3T5LA 3MFHA 3H4BA 3K58A 4FLTA 4ED0A 2YNGA 4IRCA 1RILA 5J2KA 1FKPA 1K1SA 2VANA 2MUTB 1KDHA 3OYKA 4BE1A 3GIKA 3PW0A 4DF8A 3DI6A 3RJEA 5HRNA 4KI4A 1BQMA 2OPPA 4M3WA 3G10A 1ZBUA 2BGWA 3ISNC 8ICPA 7ICPA 4EBDA 4XA5A 4I2QA 3KHLA 4IQWA 1L3TA 2R8GA 3NBPA 1ASVA 4ZHRA 4JV0A 3CYMA 4ZTFA 2V9WA 1S1TA 3MGHA 4CERA 2QK9A 5CA7A 1ASUA 3TQ1A 4MF8A 1KCFA 4RQ8A 1S1XA 4NLGA 1T3NA 5TZVA 3GFKB 3NTUA 1J53A 3PX0A 1TKXA 1RNHA 2I1QA 1WCLA 1RBTA 3EY1A 8ICAA 5HP4A 5HP1A 5DQGA 2VG7A 1ZQZA 3TAPA 1VSIA 5KFYA 3ZD8A 3K57A 1KVCA 5KG2A 4OPJA 3QZ7A 9ICOA 1ASWA 1VRUA 4I9QA 4EZ9A 2W8LA 9ICQA 3M8RA 1SKWA 3JPSA 3RAXA 1ZQYA 3OYBA 5KGXA 4LZDA 4Y1CA 4DLEA 4YQWA 4DSFA 4YXMA 3GDXA 1S76D 1G15A 3K5LA 4MFFA 8ICQA 1VSHA 1VSFA 4I2BA 4DTXA 4P2HA 4ELUA 1TAUA 4QWAA 1XSNA 2NRXA 2IGIA 3FDSA 4RW7A 4PUOA 2B6AA 4CEOA 1RT1A 2KZ3A 1VSEA 3ZSYA 2G8FA 3RH6A 5JS1A 5J0QA 3GILA 3T5KA 1S6PA 4CF9A 4I27A 1HJPA 1EXQA 4BWMA 4KREA 7ICGA 4N47A 4O9MA 3V9ZA 5L1IA 2F1HA 4KLDA 4I9LA 1DOQA 1TKZA 2AGOA 4FJMA 3ZDAA 4E89A 5IIIA 1WN7A 4KN4A 3SV4A 9ICCA 1WCNA 3AU2A 3V6KA 2FBYA 4FJXA 4DQRA 3MXJA 4O4GA 4BDZA 2ZJ5A 4MEXA 3F9KA 3DLRA 1RDDA 4KMUA 3OSPA 2VA3A 1ZBIA 3MBYA 3AVIA 1BPZA 3ZDDA 3GV5B 1NJYA 4ID1A 3VQPA 1X1PA 3K4GA 2PFPA 4RNNA 7ICNA 3B0XA 4DTJA 2AGPA 4DFPA 3SUQA 4NCBA 3MECA 1Y88A 4IFVA 3MR5A 4LY7A 2HB5A 1S0MA 5J2DA 3EPIA 1KFSA 4E7IA 1UAXA 2WOMA 4W5NA 5FRMA 3AVNA 3OYIA 3NDKA 4JK1A 3MFIA 4JWMA 3HJFA 2F1JA 4YR0A 3I0RA 3NF9A 3KK3A 2AQ4A 1JLQA 3KTQA 1KVBA 1UA0A 4EYIB 3K5MA 1ZBLA 1Z25A 4CJWA 3RB6A 2BCSA 3QEAZ 4RZRA 2PYJA 8ICVA 2HW3A 1HQEA 4P4MA 4DTNA 8ICTA 9ICKA 1RT5A 3TAEA 3LAMA 4F50A 2VG6A 3V72A 3DLKA 4OVLA 1IKYA 2F8TA 4CGGA 2UVWA 4KPYA 1XWLA 3B6PA 1LW2A 3AVLA 3DMJA 4OKJA 3AO1A 4C8LA 3RJIA 3AVCA 1Q9YA 5CR0A 3K5NA 2PFOA 2KFZA 4KKOA 1TL1A 1A77A 2IHMA 1S1UA 5KG0A 3ZSZA 4OLBA 2MUTA 4FLUA 3RB3A 1EXNA 3M9OB 1RTDA 2AGQA 4I2GA 5HBMA 5KT2A 2FLPA 9ICGA 2G8UA 3LDAA 2XRIA 3P5JA 4CJQA 2BCVA 2FC0A 4O5EA 5KT7A 4M2YA 2P5OA 4QCLA 2E6LA 4PA1A 5DB9A 4QZFA 3O4QA 3BGRA 3RMBA 9ICUA 4O0JA 4GC6A 1IH7A 3PR5B 1FK9A 3B6OA 2DY4A 1R0AA 4QW9A 4QZCA 4LSLA 3KHHA 5J2IA 3SPYA 8ICMA 2FLNA 3PW5A 2OPSA 3MR6A 4TQSA 1COOA 4F2SA 5KFFA 4M9HA 1ZQKA 3AVMA 1V9PA 5KFRA 1U4BA 1PZNA 4L8RB 4ZTJA 1K1QA 4J9PA 1RYRA 4O3QA 4KLOA 7ICIA 4O5KA 3VQ7A 4F4KA 1KFDA 4UAYA 4CGJA 3KKRA 4LVSA 3V6DA 5DB8A 4ECWA 3PVXA 4PGYA 3NGIA 3HWTA 7ICSA 2BCRA 7ICKA 3SJJA 3C2MA 4DQPA 4UQGA 3SI8A 5FDLA 1QS4A 4LH5A 4E0DA 3PW7A 1D8LA 9ICIA 1S1VA 1TFRA 4IR9A 4QWCA 3M8QA 1XU4A 8ICKA 4FM1A 3NE6A 2GUIA 4O3SA 1RYSA 3EWAA 4NM2A 1YTAA 3SCXA 1XO1A 1TL3A 4FS1A 4ECUA 4DU4A 4OLAA 1J5OA 4TUQA 3QIPA 5J2GA 4RQ6A 2JEFA 5IIKA 3MAQA 5IINA 2R8IA 3BQ0A 1DLOA 2FMQA 1JX4A 1HNIA 3AO5A 3ZSWA 4KITB 3UXPA 3LP2A 4DL7A 5DGAA 1BQNA 1SUQA 5KFIA 5KFPA 5DKWA 3TFRA 1NOZA 3DRPA 3O3HA 4FJIA 5BOLA 1YTUA 3QESA 2BR0A 3E2EA 3SQ4A 4RW9A 3JSMA 2UVVA 1CXQA 3CFPA 3LDSA 2ZTDA 2D5RA 4PHDA 3ZSOA 3SI6A 5DG8A 4FZYA 4RNOA 3JPPA 4ECSA 4B9MA 4ID5A 4CJFA 4JRQA 5J2NA 2Z1GA 4KHQA 3H8JA 4O3PA 5KG4A 4KLQA 2DFHA 1S9GA 2RDJA 1XHZA 2KTQA 3QINA 1BHLA 4YFUA 1S97A 2R8HA 3VQBA 4Z4HA 4C8NA 2HHSA 4Z0UA 4FVMA 3PX4A 3HX0A 3AVGA 9ICNA 1VSKA 5CWRA 2P6RA 5KFXA 4CJTA 3HPHA 2FPKA 4E19A 4ED1A 3GIJA 4CJRA 1GOCA 3TAQA 1SKRA 3MDAA 4TSXA 1X9SA 4BXOB 1RBSA 4IQUA 3ZT2A 3SQ1A 1NK5A 3L2RA 3V9XA 2WONA 5J2QA 4CJLA 2J6TA 4ECZA 4OPKA 5IILA 5DDYA 3NH0A 5KFVA 1BPBA 3ZT0A 3PW2A 4NYFA 4ECQA 1IG9A 3ZT3A 1A5WA 2G8HA 5BPCA 4FJ7A 2BE2A 4QZDA 4FYDA 4W5TA 2JEIA 3S3NA 4M3TA 4JV1A 1C1BA 3KIOA 2F8SA 1Z00B 4DL3A 5SZTA 1BPEA 3PO4A 4OGEA 1U04A 2PFNA 4E7KA 1RBRA 1T7PA 4KHWA 4MQ3A 4RPZA 4K8XA 5KT6A 4JUZA 3S3OA 4M42A 3RWUA 4F4XA 4FZXC 4R63A 2VWJA 2XHBA 3D0PA 4FK2A 1SKSA 3UQ0A 3HPOA 4I2HA 3NF8A 4J9QA 3LWLA 3RMAA 3WNHA 5J1EA 1NKCA 5CZ1A 1T05A 1TVAA 4IRKA 3NGYA 4FLYA 2KW4A 4KI6A 1NJXA 1NK4A 4O5CA 3H08A 5KFAA 5C25A 3VQ4A 4C8KA 5J0UA 1ZQTA 2IMWP 3CM5A 4QOZB 2A1JB 2KFNA 3N97B 3B0YA 1U49A 1FKOA 2HNZA 3VQ6A 2ISOA 1W0HA 5HRRA 1JXLA 4RNMA 4KFBA 5D49A 4G3IA 4TUSA 1S10A 4B9VA 4CFAA 1IKVA 4PGXA 5KFDA 3THVA 4KLUA 1ZQUA 3ASMA 1BVSA 2BPGA 4G1QA 4NYNA 1HMVA 5KFTA 5J29A 2YKNA 3LZIA 4M3ZA 2B21A 3UQ2A 5CYMA 2D0CA 1LAWA 3SQ0A 2PY5A 3RJJA 4XIUA 4H8KA 4KLIA 2AQ0A 1BCOA 4J2AA 3C2LA 1TK0A 4YMMA 2BPCA 3OS1A 1BIUA 1KTQA 4DSIA 4B08A 3H40A 5DLGA 2DPJA 1D9FA 3PMLA 4YP3A 2YNIA 1X9WA 3OJUA 1WSFA 4M41A 4YXJA 3HYFA 4XQ8A 4RQ0A 8ICCA 3OYAA 1NK9A 3VQ5A 4RQ4A 2ALZA 4J2EA 5DK5A 3I8DA 3KLGA 4QZIA 1D9DA 4KLSA 4BE2A 4JV2A 3WNFA 1BISA 4ECRA 1T03A 3KLEA 2E4LA 3RH5A 5I3UA 3PV8A 4H4OA 1CZBA 4KB0A 2HHUA 1X9MA 2IOCA 1JN3A 1IM4A 4RQ7A 4YR2A 2OPQA 3QEPA 4FW1A 4M47A 1F21A 9ICJA 1IO2A 5KFJA 4X5VA 3ORYA 4MFAA 1REVA 4ED7A 4KLMA 2HNDA 2OYQA 1S77D 1RT2A 5DG7A 3LPTA 3SV3A 5KTQA 4OKEA 5KFWA 5HHHA 4ECYA 4DFKA 3KK2A 4YN4A 3H8WA 1BL3A 1ZJMA 4QZHA 3NAEA 5DGBA 1LW0A 3ZT4A 1ZQNA 3V1OA 3HW8A 2NRWA 4NLZA 3RTVA 3ZD9A 1SL0A 4UB3A 4QZ8A 4EP4A 1WAJA 3NFAA 4FJNA 4FLXA 3Q8SB 5KT4A 2JGUA 3F73A 3AO3A 2Z1HA 8ICEA 4BXOA 4MFCA 1ZQLA 1T8EA 3ISDA 2RF2A 1XSPA 2EHGA 2ASLA 4CF2A 9ICFA 2R8KA 4B9TA 4O3RA 2AU0A 4CK1A 5DBCA 1WSJA 4F91B 4PWDA 4C8OA 4M9LA 3QO9A 2BQ3A 2BCUA 2V4QA 5KGWA 4I7FA 1S1WA 3CM6A 2D0BA 3ULDA 4AHRA 5IIOA 1NKEA 3VQEA 1DGSA 2BKEA 1HPZA 1D5AA 2DTUA 3JYTA 5HRSA 2ZJ8A 3LPUA 1QTMA 1ZQGA 4W5RA 1LB2B 3DYAA 3C21A 1EP4A 4CEZA 5JS2A 2HNYA 4YVZA 1SV5A 1Z00A 4YMOA 4AHVA 4HCBA 7ICJA 8ICZA 2JZBA 4GVMA 3KK1A 2P5GA 4KLFA 3DLHA 2XY7A 3RR8A 4P4PA 4BDYA 4HHTA 1KLMA 5J0OA 2C2EA 2G8VA 2FBVA 4DWIA 1FXXA 3L2VA 2GBZA 4KO0A 1BPYA 1HJRA 2OA8A 4HUFA 3OS0A 4CIEA 3RB0A 3LAKA 1XSLA 3SZ2A 4KHNA 4ED3A 2XCAA 4IKFA 1WNSA 3OYFA 1NK7A 1RZTA 4RT3A 5J0YA 4PY5A 3Q8RB 2A1JA 1JKHA 4K8ZA 4LH4A 2O4GA 4CJPA 4UAZA 3ZDCA 3TANA 1BIZA 4NLKA 4CEAA 2W9BB 3M8PA 1LWFA 2ATLA 4CE9A 4FJ9A 4FJHA 3RR7A 4QZGA 2PI4A 7ICMA 2ZQBA 4DU1A 5J2MA 1NOMA 5DQIA 4IFYA 3ISCA 4N41A 3C1YA 1TV6A 2KQ2A 5J2CA 3OGUA 3NH2A 3OSNA 1QLNA 4E1MA 4F3TA 2JEJA 5DQHA 4DU3A 3I0SA 4Q8EA 7ICVA 3MR3A 4I2AA 1A5VA 5L1JA 2YV0X 4R66A 2YHAA 1B9FA 3MXMA 3N4MB 4FLZA 1Z26A 4DEZA 3CG7A 2HHWA 4ELTA 2B5JA 4YFKA 3L2WA 4QZEA 3PX6A 4WE1A 4F4WA 4Q8FA 2BGGA 4M04A 4UBBA 1MU2A 5T7BA 4DO9A 1MSWD 2OWOA 1HNVA 3O3FA 2KN7A 4EYHB 2ASDA 4Z6DA 3L2QA 2UVUA 4HTUA 1ZQRA 3V9WA 4E7JA 3S3MA 3LZJA 4KTWA 4DTRA 3P1GA 3TWHA 4EP5A 3C23A 4UB1A 1Z3EB 4ECXA 4AHUA 3ALYA 1ZQOA 2IDOA 3DRSA 5DBBA 3QLHA 5J2HA 1AROP 3C1ZA 5KFGA 4HYKA 1C6VA 1RDAA 5C42A 4K4IA 4FJKA 4I29A 1ZQVA 2FBXA 1C7YA 3JPTA 2X6SA 3LP3A 3M9NB 4YD2A 1HQUA 2G8IA 4DS4A 8ICUA 2XY6A 1EETA 4MF2A 7ICRA 1RT3A 4IBNA 3V81A 5KFCA 2ZD1A 1J54A 4KLTA 3DOLA 1SL2A 4FO6A 3A2FA 3RRGA 3S9HA 1RCHA 4CHQA 1B22A 4CHNA 4C8MA 4EEYA 4O44A 1JLEA 3GIMA 1QHTA 4J9LA 1N6QA 4DQQA 1Q8IA 4DL5A 4CJUA 3V1QA 3V7LA 2YHBA 3FFIA 3JPRA 3Q8LA 3G6XA 3IM1A 5KFOA 3LP0A 2DFEA 5KFLA 4ELVA 2X74A 1JLCA 2J6UA 4FK4A 4DTMA 4GW6A 4FBTA 1UT8A 4DL4A 4F5PA 4E7HA 1LV5A 2P66A 4FJ5A 1DTTA 4UB4A 9ICBA 5J0TA 4MEYA 1LAVA 4QWBA 3H4DA 4GXKA 3MEEA 4CGIA 3LWMA 7ICFA 4GXIA 3QZ8A 4RU9A 4FZZA 1C0UA 3FYHA 2KZZA 2ATQA 3C5FA 1N56A 4DOCA 1NJWA 1C1AA 1D8YA 4PH5A 3V1RA 4F5QA 3OHAA 4Z6FA 4IDKA 4Z4GA 1JLAA 3M8SA 2VG5A 3C6TA 5KFNA 4M0AA 4MFBA 5HNKA 4K4GA 1ZBHA 3QEVA 1GOAA 5KFQA 3G6VA 4M6WB 4B9NA 5FROA 1IXRA 4F92B 5L9XA 2I5JA 3VQ9A 1VRTA 3PW4A 3PUFA 4ECTA 2FMSA 4PGQA 4IRDA 3Q8PB 1ZJNA 1JLFA 2G8KA 3OYMA 2F96A 1KFTA 5CZ2A 8ICJA 3OYCA 5J2PA 8ICNA 4YCXA 4DL6A 3H8SA 3AO2A 8ICBA 4LZGA 4CHPA 1ZQSA 4Y1DA 4CEFA 4HVJA 2JLEA 4M3XA 5IIMA 1RTHA 4KLEA 9ICPA 4BACA 1RBVA 4CHZA 2FPLA 4I2CA 4HUEA 4IR1A 3JPNA 2FLLA 5KRTA 4NXZA 3CFOA 2ZUBA 3JPQA 2W9BA 3LALA 1C0TA 1RTIA 4JWNA 3NGZA 9ICAA 1C0MA 1S6QA 1ZQFA 4M3YA 3L8BA 1WSGA 4DSKA 5J2FA 4CFCA 4FLWA 2DFLA 3SUPA 4NLNA 3GIIA 2IC3A 8ICHA 2V4RA 4DSLA 4DOAA 3KLIA 4Z4IA 3KHRA 3GV8B 5J0XA 1CUKA 4RQ2A 1S9FA 1JMSA 4CJ3A 1CXUA 4QAGA 2JZBB 4HUGA 4BE0A 1L3SA 2LSNA 1HYZA 5CY4A 3KHGA 4Q0BA 7ICLA 1N48A 3AO4A 1B92A 4DMNA 3OYNA 2W9MA 3MGIA 2BQRA 2RDIA 3DRRA 1WSHA 9ICRA 4B8AB 1TK5A 4OJRA 3WNGA 2QXFA 3LANA 4O0IA 3PO5A 1WLJA 1QSLA 3GQCA 4Q45A 1L3UA 2BANA 4GC7A 4KAZA 2ZE2A 4CEBA 9ICTA 4CK3A 3QEIA 5CHGA 2HHTA 2QKKA 1WSIA 3PNCA 3AVJA 3RJGA 1DTQA 3UXOA 4PQUA 1ZQBA 1KLNA 4K4HA 1U47A 4JS5A 4QWEA 3ZSRA 4FXDA 5KT5A 2DPIA 2FBTA 4F5OA 1L3VA 4F5RA 3D45A 4DFMA 3M9MB 3AA4A 4JLHA 4JS4A 3RAQA 4CCHA 4E1NA 1TKDA 1WAFA 3QERA 5J0RA 5F9NA 3UXNA 5KFSA 3G6YA 2FPMA 5IIJA 1TGOA 3OYHA 1HUOA 4EBEA 2IA6A 8ICXA 1ZQPA 4AHCA 5E41A 3V4IA 1UT5A 8ICLA 3OYLA 1X2IA 4FK0A 1RT6A 1UWBA 3AU6A 5DB7A 2VA8A 1H38A 4CJ5A 3L3UA 2EX3A 1ZQJA 1QSYA 4I2DA 4ED2A 5EWEA 4YD1A 2A1SA
chains in the Genus database with same CATH superfamily
4KR0B 4NLQA 2IBKA 2XWXA 2BJDA 2R7YA 2ASOA 2ZH4A 2ZNZA 3LQVA 1WOSA 3VAFA 3EWGA 5C7PA 1UVNA 5EE0A 3OYDA 3CPWM 4MO4A 3A13A 3FEZA 1RBUA 4MN4C 2B3TB 5ALDA 3HLUA 2KFYA 4C8ZA 2HHVA 3O1LA 4KLGA 2ZXHA 3POTA 4B3OA 2W2QP 4DKWA 2MKSA 1L7PA 3IBWA 2PFQA 2A1BA 3MABA 1U1OA 3F2KA 2G5IB 4IXCA 4Y2VA 4BRKA 1BY9A 4MIAA 4ETXA 3CSKA 1B9DA 3Q8KA 5AZIB 2JH7A 1XJWB 4C0BA 4M6WA 2WB1D 4F72A 3RRHA 7ICQA 1J97A 1HQUB 1QAXA 3L7UA 2QB0A 4XTTA 1Y5IB 1PCAA 4UZBA 1XNQJ 3D2EB 4CLSA 3OTEA 3LM9A 3CJKB 2W9AA 4J5OA 4S0MA 1VBKA 5ALPA 3MMAA 3PDNA 3DLEA 1TP7A 3I8BA 2LMRA 5LSOA 2ZJRL 2CQIA 1RLCL 4BY9C 2Q66A 3MEKA 3ZNUA 3BS7A 1ATNA 2V5HG 1KR4A 4RW8B 3QNWB 4N7TA 2CQCA 4QZVB 4KH4A 1GLEG 1YJVA 1V4SA 3RSEB 4UOHA 3C15A 3QUTA 3EGWB 2HLUA 3WNEA 1OYEA 1HRHA 1YDLA 2AJQA 1S48A 3ZX0A 4WFZA 4JI8F 5J2JA 4R5PA 2W40A 4FJ8A 2OEJA 5DDMA 4CM2A 3PG9A 4ICAA 5B8HA 2C3YA 3AA5X 4ZLLA 3MPVA 5ALIA 2LI6A 9ICEA 3R2DJ 3CD6N 3RAMA 4DFDA 4DSEA 1WC4A 5DM6Q 3NHGA 1SZPA 4C4RA 2LP4A 3OTOJ 1RI7A 4GKJJ 1KEJA 4Z4FA 3WQPA 1JJCB 2QM1A 2B51A 1PUZA 4CEDA 2VPXB 4XH4A 3CJSA 3ULEB 4O3NA 4BRNA 3EGZA 4LD0A 2KKPA 4QWDA 3DEEA 4PYAA 1Q9XA 2DGOA 3D7SB 1FESA 5HN0A 2K06A 5LXYA 1JLFB 3BJYA 2OTJS 3FE1A 4I2PA 4DN0A 3GP9A 4E8UA 2HGNA 2ACMA 2QL9B 3AHPA 4MKAA 4M95A 2WVCA 3O9UA 3ZEUA 2VBWA 4Y2XA 4Y2KA 4IUFA 2X1BA 2W2PP 2ES6A 3F53A 4B3TJ 4C97A 1IWAA 3JPOA 2CGKA 2OKQA 3M1VB 4LFBF 4YR3A 4NI2B 1X5PA 3UM9A 2ZGYA 1I94F 3TAFA 1QE1A 4WYLA 4YDUA 3MM7A 3UMCA 3I55S 5D4PA 3H7IA 4IO9L 5KFEA 2GVZB 1XI1A 3MMBA 1T6DA 4DV0K 4RW4B 4M9JA 4CNQA 5HL7Q 3MOZA 4YOWA 2F9WA 4BRFA 1RBOB 2IC3B 5AQRA 1NU0A 2AJFE 2LEBA 3DWLA 2WW8A 4CJ4A 4G9ZA 5KL1B 3UVJB 4AH9A 2JRSA 2RQMA 2YKMA 1KVIA 1VQ8N 4AF1A 5ETPA 1FD8A 1FJGJ 4AXJA 3GV7B 1BU6O 2FVCA 2IM1A 2EEYA 5J2BA 2ZZNA 2G9OA 1Q4RA 2FJDB 3DM2B 3ITHA 4TURA 4BCAA 1U2VA 1HBMB 7ICUA 2N82B 4JP8A 5DETA 4F5NA 1WF2A 2M9KA 2M8HA 2V4JB 2ABYA 1H2UX 4I28A 1Q8LA 3MCOA 3PKMA 4XO0A 2H5JB 3SR6A 4P0QB 3VF4A 2RAQA 4EZ6A 5BRHA 2VPZB 4HCCA 4JI4F 9ICMA 2ERRA 4ZDNA 3OLBA 3PTWA 3KD5E 3BPSP 2WTUA 2WVDA 1EIYB 4RBVA 1NM2A 4DR2K 5HLFA 3OVNA 1XMQF 3BGUA 2FE9A 4RLEA 5LJVA 3M32A 1A5XA 2QL5B 4XUSA 2AXTU 1OVQA 3IM8A 5KG5A 4HEA9 1MROA 4NLSA 3CCEN 2X78A 5AKIA 1RDCA 4E3SA 4C0HA 2C42A 5D46A 4ZVFA 1WUAA 4F4YA 3CFRA 3T79A 2DHHA 3NNCA 2KKZA 4RO0A 4U9RA 2OPRB 3OUYA 1N5QA 4J9RA 5G0RA 2ZJAA 2WVFA 3NG8A 2CQHA 2HFZA 1W2BM 3H5UA 3R7BB 4XRHA 1URNA 1Y11A 2AP1A 5K14A 5IWAJ 4R8UA 2BQUA 1HBUA 1M1GA 4O55A 4DQIA 4TU9A 2F1IA 2HVIA 4DR4K 3KG4A 8ICRA 2K4HA 2E2OA 2W9CA 4E2FB 1LOUA 1NPKA 3UDLA 4RPYA 3DGPA 3Q86A 2K60A 4GVLA 4ILJA 1ZQHA 2J6SA 4ZK7M 4ZPAA 1SC6A 3JTOA 2K89A 3MGVA 3WK6A 3ZSQA 3RB4A 1WOOA 1GLLO 4NXMF 2RNEA 1HNWK 2DHSA 5EOZA 4KHSA 4I2EA 2NRVA 4IL6U 3HVTA 1Y00A 4M45A 1P8ZA 1BQMB 4CFBA 3BDPA 2KN4A 3N5FA 4OJ1A 5AKGA 3GFXA 3KJVA 4BJQA 2ZJQQ 2PC6A 4RWTA 2H3ZA 4NX9A 3E01A 3J7YU 2FYXA 3WZ0A 4ES1A 2ALYB 3S6JA 3PXGa 4KHUA 4ZHRB 1FDNA 4J9KA 4F9OA 2OZMA 4BG9A 1Y97A 4WFBL 3SUNA 1ZD3A 1S1XB 2ZTEA 2V2QA 1X8DA 3W61A 3AJ1A 2ASMA 5KI6A 1JXEA 1B3TA 4EU0A 1FNMA 2NPIA 1N60A 4RG8A 3ZI4A 1O1WA 4DR5F 1ZQIA 1QSSA 4EBCA 3PHEA 1JLGA 4CECA 2JSXA 3EXYA 7ICEA 1N63A 1X9XA 4A5AA 5LMNK 2IDLA 4KV8A 2GWSA 3T1YF 3O2IA 2Z0GA 4OX8A 2PFDA 1FRJA 3NH1A 1BI4A 1UJ6A 3J7ZO 3VGVA 1UL3A 1ZBFA 5AQZA 3NGDA 1U1MA 4A2AA 4OJOA 4YMNA 5AZJA 4DX7A 1A76A 1QTNB 2KD1A 2WW4A 3BKTA 4K8RA 4ERDA 5FIIA 3C8YA 2LYHA 2J0WA 2J9CA 4ZN3A 1MLAA 3G8TA 3P39A 2YQ1A 2IVPA 3G25A 4KB1A 4PKGA 2D3DA 1HPMA 3ZX3A 2VGNA 2KJ9A 5ALEA 3QEWA 2D41A 2P9GA 5GADP 4PZNA 1M5KC 3RH4A 2OIHA 3T5JA 3CQXA 7ICOA 3KKFA 1BO5O 4MK7A 2Z8QA 3TO8A 4CEEA 2RRDA 4TVAB 3VGUA 1CJUB 1N33F 1KNZA 5MLCQ 4RUCA 2QMWA 2JEGA 3L7OA 2DNYA 1KQGB 1QVFM 2MQ8A 5B09A 2MQPA 4BROA 5THWA 5AI8A 3SQGA 3QE9Y 1EKEA 5KFHA 1R59O 3MM5B 2UZAA 2VASA 3GFYA 1WG4A 1R31A 1Q1KA 4O4GB 1FXDA 4ISEA 2DR8A 3FSIA 4KLHA 3SMVA 3L95X 1KD1O 4DUTA 1D8ZA 3HVRA 2Y8WA 1S0NA 3RJKA 2JH3A 5A8RB 3EPGA 2ASJA 2KM8B 3CCTA 1AZSB 4LF6K 1XHXA 2D0AA 4CW7B 2NSCA 3IG8A 4OX9K 1LQ9A 5HRPA 1NK6A 2KMDA 2WOMB 2G2ZA 3PIPQ 1CZ9A 1VSLA 3R3LA 5CP2A 3QICA 3HKZD 4DCOB 2XHWA 2OCEA 3KK3B 1VIXA 4WFNQ 4OPAA 1VQPS 1U1PA 3IV6A 4DQSA 3NAIA 2HQFA 3GDQA 1K6YA 2W8KA 1RXVA 1Z2ZA 2VKQA 4FCYA 2FJWA 2E2QA 2GGPB 4UATA 2E7WA 1RT5B 2B8QA 3JXOA 3DLKB 3WC0A 4OQJA 5A8KA 3E58A 3DMJB 4M5KA 4U67Q 3MFHA 3I5AA 4CD3A 2QT7A 4FDFA 4IRCA 2ZDPA 3CCJN 4A8FA 3HHLD 3MOJB 3OYKA 3VHQA 3GIKA 2E5GA 1RTDB 1YHQN 4DF8A 2ZC3A 2CPJA 3DC2A 5M1NA 5HRNA 3N5BA 3SXLA 3ZTQA 3DLLL 1NO8A 5GAHU 4OD0A 4AYBF 3G4SN 1BLUA 5FPDA 4QPTA 4RNHA 3KHLA 3H1QA 4Y2YA 2R8GA 3NBPA 3ZZUA 4ED4A 4JV0A 3TOQA 1LFWA 3CJ3A 5CA7A 1VJWA 3IO1A 4JEPA 3QT6A 4F02A 3BO4A 1NG9A 2F4VF 2WFBA 4YB6A 3HKWA 3BBBA 1J53A 1MMLA 2BTFA 4LF4K 5HJXA 1TKXA 6FDRA 3CJAA 3NS6A 1A6LA 2V9KA 5J1NA 3EY1A 4J91A 5HP1A 2IOFA 2MHEA 2VG7A 2ZJPL 1ZQZA 2EKYA 2VKZG 1PVQA 3V6DB 3CULA 1YXQA 4NO7A 3HSJA 3AY9A 3AM9A 4EZ9A 1RAJA 3M8RA 4K4WA 2IIHA 1S1VB 4DSFA 1TAMA 3GDXA 5HVHA 2XS7A 2M70A 1G15A 4DPOA 2WSCC 4U7UD 2LKYA 4MFFA 4I2BA 3HJEA 2NR0A 1D8BA 4DTXA 4P2HA 2BJ7A 3M4XA 4OI3A 1TAUA 2O8DA 1TL3B 5EE1A 4C6AA 1RJJA 2DNNA 2WHOA 4CEOA 2KZ3A 4CZFA 1X6IA 2A2DA 2FHOB 1VSEA 5GAGP 5CHIA 4UZCA 1R0BG 3R3TA 2FZCB 3ENWA 1S6PA 5M1FA 2GWKA 4DI6A 3CMAN 5L1IA 1SJFA 3OXGA 2ZHOA 1MMDA 4NXNF 2AGOA 2YKQA 3M5RA 4AQYJ 4USTA 3RFAA 4FJMA 1QQ7A 1IN0A 4MYUA 3QBCA 3AOAA 2A18A 5IIIA 5B0AA 2CYYA 4HLBA 3VWSA 4YHHF 4CH7A 2GHWA 4AYBC 3K89A 4DQRA 1XR6A 4F0HA 4C8YA 2G5HB 3MXJA 1RT4B 4MEXA 4X66K 1X4FA 3DU5A 4G6VB 4LRDA 1RDDA 5IXUA 2KNJA 3C19A 5J2NB 1IBLK 1Y5LB 3ZDDA 3H20A 2YX4A 2RHKA 4ID1A 1KOHA 2F76X 3K4GA 2PFPA 4RNNA 1KS2A 4DV1K 1B70B 4DTJA 1ZAXA 3KOOA 4DFPA 3NGUA 1IBKF 4NCBA 4DV7K 2WAQC 1FE0A 3GPAA 3MR5A 1HI8A 2MTLA 1S0MA 3HHLB 2HB5A 5K8PA 4GO7X 1TYQA 4JI7F 2QA4G 2HWHA 5ALMA 1NH8A 3MFIA 4JWMA 5JTIA 3K17A 1FEZA 2F1JA 3NF9A 4ZIVA 1JLQA 2DR5A 1DZ5A 2O8CA 3O44A 1KVBA 1UA0A 1FDDA 5ITHA 5ALSA 1DK2A 3N4WA 3CB4A 2WONB 2AIRB 3TEHB 5A2QO 3RB6A 2D6FC 2CPXA 4KE5A 3QEAZ 4RZRA 4OL8A 8ICVA 1U1RA 4WF9Q 4WKRA 2PYJA 4ILHA 1HQEA 1NRKA 4EHUA 3TAEA 4F50A 1X4HA 1IKYA 4CGGA 1OIAA 5FPNA 3AVLA 3CJTA 3RJIA 2JFDA 2PFOA 3AL0B 2HSEB 1FVQA 2DBBA 3PKYA 4KKOA 2IHMA 5AKZA 2OD6A 4OLBA 4FLUA 3PYGA 4CLTA 1T6CA 2BVZA 1TL7A 3ENBA 4DR7J 2KJ5A 1RZMA 5HBMA 2WBNA 2FLPA 1VQ5S 1V5VA 2GVDB 3D54A 4Q2MA 2XRIA 3PJXA 3MCAB 4CJQA 2UUTA 1RGVA 2MGZB 5KT7A 2J4RA 4QCLA 1RAFB 1UETA 4IOAQ 3LDLA 3RMBA 2KKVA 1OY9A 4EMDA 3FBBA 1IH7A 4K4VA 1T3QA 1YJTA 2DY4A 4NLWA 2XBPA 1Y7PA 3MM8B 3KHHA 1DGKN 2M3DA 3US5A 5T41A 4DUZF 2HVDA 2OPSA 1ZRMA 4JMUA 2HPUA 1TL5A 5D8HB 4BRAA 3GYGA 3J7AN 4HH1A 1COOA 1XR7A 4F2SA 2E1RA 2LDIA 1B0PA 1Q5YA 4M9HA 1ZQKA 3MMCB 4C0OC 3QU5A 4BR5A 1YVFA 4YMEA 4JI5F 2CWXA 3JQJA 1EB0A 4L8RB 4B1VA 1WG5A 4MKYA 3ZLJA 2WSEC 1R0CB 3G86A 1KFDA 2DRBA 2O8EA 2DHXA 4LVSA 3A5NC 3MX5A 5M2PA 1YK9A 4QJVA 2N3OA 4ZCKA 3HWTA 2LXFA 3I33A 5AI5A 4KAIA 3SJJA 2H3IA 5SUHA 3X1LB 3C2MA 4DQPA 4LH5A 4E0DA 9ICIA 2Q2RA 1VQLS 2NCKL 3J80Y 4ETZA 4QWCA 2GQ2A 1XU4A 3M8QA 2E1FA 2BOAA 2F8MA 4C80A 1UZDA 2E5HA 1B64A 3EWAA 3W65A 4FS1A 3NRBA 1EZZB 4KQZA 1R8AA 4TUQA 3I76A 2HS3A 3QIPA 3EEQA 4RBTA 4GV9A 2YNIB 2GZOA 2KKHA 5EE3A 3GFZA 5AM1A 4P0PA 2HQIA 1ZTWA 4NWBA 2XNRA 4BR9A 1JX4A 4JI8K 3AO5A 4PRFA 4FOEA 1KKXA 3CC7N 2B4UA 3QMQA 2VJUA 3FAHA 1RHUB 5E5NA 1X5OA 1BQNA 1SUQA 2E1MC 3D6HB 5E7OB 4MIWA 1T3VA 5A6PA 1NOZA 4QIWF 2OPQB 1KDNA 5BOLA 2BR0A 4A5BA 2R7TA 2N1RA 3PFOA 3BSNA 2E1ZA 3SI6A 4FZYA 1A0OB 3JPPA 1RT2B 4JK7A 4O5FA 4MAKA 3TZZA 5TKWA 3ILLA 2F8EX 4DV0J 2RLTA 1X0PA 3U9DA 4RWWA 1X40A 3EDQB 2ZIWA 1FF2A 4KLQA 2DFHA 1S9GA 1RAOA 4D3HA 3FRZA 2QMUB 1J5EK 3VQBA 4UAVA 3OV7A 4FF4A 2BA9A 2KRBA 1ECWA 4FVMA 1NNDA 2LQBA 1E4GT 2LXIA 3Q89A 1G3OA 3TZWA 5KFXA 2DRAA 3W9IA 3CD0A 1Z1VA 3HPHA 1SIZA 4ED1A 1GOCA 4TSXA 1RISA 4V19X 4QS7A 4BXOB 3SLCA 3ZT2A 3SQ1A 3KLVA 4HL9A 3V9XA 2YKAA 1I94K 4CJLA 2J6TA 2Z58B 3GCXP 5IILA 4WJBA 3H59A 1Q0NA 3PIOL 5C2GA 3ZT0A 4NYFA 4PWDB 3QO9B 5ALHA 4ILGB 1S1WB 4K42A 4NA2A 2QG9B 4FJ7A 5AK6A 2KJVA 2E8PA 1F44A 5FJ4A 2G07A 4DR2J 1SH3A 3A5OC 2HI0A 4URGA 1EP4B 4ZITA 4C1NK 4CD1A 3DFEA 1Z00B 2DR9A 5SZTA 3MM6A 2E29A 3G82B 4OGEA 3HX9A 2PFNA 4HT7A 5EDWA 2HS0A 4K8XA 5KT6A 4OHZA 3WBZA 4M42A 2BW2A 3UKRB 4EUVA 5HJYA 2XHBA 2A6MA 1WG8A 5K20B 3HPOA 4OX7A 4DL0C 2ZH3A 3P45B 1VQKN 4J9QA 2JHDA 4JI4K 4A2BA 3WNHA 4QIWC 3LH2S 4M1KA 2X3GA 4KIAA 1RFQA 5AQOA 1EQYA 1FEEA 1NJXA 5FPEA 2GQQA 3H08A 4C4SA 4ZLNA 4YOXA 1QQ5A 5C25A 4DR4J 2WB1F 1Z05A 2VC0A 1TE2A 1KOOA 3D3BJ 3J81U 1FKOA 2HNZA 3TW0A 5E79U 3VCDA 4BR0A 1XMQK 1GTEA 2AYMA 2ZC4A 1JXLA 1JCEA 4B6JA 5D49A 2BOPA 4G3IA 1S6OA 3NCQA 3OR2B 4LSZB 3BKUA 3RZAA 1IG8A 1HNWJ 1S10A 4B9VA 4FPAA 4AXIA 2YX1A 3T1HJ 1WF0A 2JV3A 2XIDA 1TV6B 1B0TA 5T7LA 5KFTA 2PN6A 1AW0A 4RU2A 2YKNA 2CN1A 3LZIA 4M3ZA 3PLAA 4O4RA 5CYMA 3I0SB 4BC9A 5ALNA 1PSDA 4P2MA 1ULRA 3UB5A 2AQ0A 3C2LA 1P9YA 2DKXA 2BPCA 5CR4A 4FF2A 1YVNA 5ALFA 5LMUF 1Q95G 5DLGA 1PYOB 3GSIA 3I56N 1W2BR 3PMLA 4YP3A 2GAHC 1WSFA 3P96A 4RQ0A 4WE1B 4EO6A 2BRLA 1F1BB 1HI0P 5CCMA 2HHHJ 1WI8A 5ALQA 1NZAA 2XO6A 1IM6A 4NYZA 4FYWB 4ZPWR 1FK9B 3QJLA 2P9NB 1D9DA 2H48B 1VHXA 4BE2A 2QEXN 4LSLB 2ILZA 1TUVA 4ECRA 1T03A 3TSPA 3RH5A 3ILJA 5I3UA 3QB0A 5LMNJ 4RQ7A 3QRRA 4OCZA 4YOVA 4F0MA 4B3RJ 1U8SA 3LGMA 3UE2A 9ICJA 1RQNA 3OT9A 4WCEL 4X5VA 3ORYA 4MFAA 4BG8A 1REVA 4KLMA 3AB2B 3FKBA 4TU8A 1S77D 5DG7A 1RHKB 4O23A 3OBYA 1YBAA 3H7HB 4ECYA 3KK2A 3J7Z5 3WKBA 4YN4A 3H8WA 3CRXA 4QZHA 5DGBA 2ZD1B 2BJ9A 2CPRA 3D0HE 2GV1A 3V1OA 2P9LA 1M0SA 2YCHA 4A47A 2LM4A 1SL0A 3QATA 4UB3A 1VFJA 2VL1A 1WAJA 2P9KB 2WB1C 4PL2A 3CCJS 2RDDA 5KT4A 1YHQS 3F73A 1IG6A 1VC6A 3WQUA 5IM0A 2J7UA 2A40A 1Z19A 3LP0B 4X64J 3CD5A 3VGSA 4ZVPB 3V5RA 4OJ5A 4LQ9A 1JLCB 3IAS9 1RWKB 1XSPA 1ZD5A 1A6SA 2RF2A 2EHGA 3MN5A 4K43A 2AZ3A 4UW2A 4F3MA 2CA9A 4CK1A 4IOXA 2JVOA 4M9LA 2BCUA 1Z2LA 4I7FA 3CM6A 2LEPA 2D0BA 2HOFA 4GMKA 1N0UA 5JMVA 4LIWA 3GL1A 4OHYA 3IGNA 4UB6U 4W5RA 4QPXA 4UW9A 3DYAA 4DV2F 3C21A 1H98A 2NZTA 4CEZA 5JS2A 2HNYA 4YVZA 4LF6J 1RAIB 4PL1A 2JDJA 1XN9A 4OX9J 1CI4A 4MFBB 1ZS6A 5AICA 2YBVA 3KK1A 2YH0A 4ID5B 3RR8A 4P4PA 2NV3A 5J0OA 2C2EA 1R8HA 2Y1RI 1N33K 3W5XA 2KHVA 3JAMO 2YWFA 2FBVA 2YKPA 3L2VA 2QA1A 1BPYA 2XYPB 2CJKA 2LDYA 3SZ2A 1QCKA 3ILOA 3EZUA 2DNZA 5DDQC 1QVFR 4ZCIA 3MCMA 1NK7A 1RZTA 3HVWA 3K0JA 2QARA 3G9CA 4PY5A 3AA8A 3F5TA 5HR6A 3NNAA 3UR3C 4XK8C 3NVWA 4CJPA 4UAZA 3MUVP 3WK5A 1BG3A 4CEAA 2PA8D 4OYMA 1FJCA 1IV0A 3KZIU 2PI4A 3E9LA 2M88A 4C11A 1NOMA 3U02A 4N41A 2G1DA 3FCWA 4RCHA 2KQ2A 5J2CA 3CMAS 1RCXB 3NH2A 1QLNA 1U1LA 4E1MA 4Y2CA 2BJ8A 3QUCA 7ICVA 2AD9A 2UXDF 3B8AX 5L1JA 1P6TA 2YV0X 1B9FA 3CQYA 1M5OC 3ETOA 3N4MB 4OJPA 4DEZA 2HGLA 4WBFA 2QC3A 2CZ9A 3IBPA 2BABA 5GTHU 2B5JA 4FWMA 4K50A 3P8BB 4AE5A 4M5IA 4LF4J 3PX6A 1PG5B 4NYOA 4CLLA 5F8GA 2NXNA 2XZDB 3R1XA 1UEKA 3CCUN 4C23A 3R5JB 2ASDA 1ZQRA 1KVJA 3S3MA 4DTRA 1WBDA 3JTPA 1P7DA 3M6ZA 3HTVA 1AB8A 2IDOA 2NXEA 3DRSA 2V8GA 3ISZA 5J2HA 1F9FA 2VV5A 4WP8A 5KFGA 1XK8A 1HARA 3DGVA 2KG0A 3P31A 3OTDA 4P10A 4K4IA 1BXNA 4PQUB 2M0GB 2QI2A 5AZIA 1N5SA 2FBXA 4Y2QA 2EPIA 2UV8A 2KT5A 4YD2A 1HQUA 2YMPA 4DCJB 8ICUA 1EETA 3JQKA 2F4VK 7ICRA 4P72A 4PEOA 4OMFG 4FWQA 1U02A 1SL2A 3SMSA 1HBNB 2FF6A 2EANA 3A2FA 3RRGA 4KB7A 3AAWB 3CJKA 4FF3A 1B22A 3LTOA 3ZX2A 2RSQA 1JALA 1O5JA 3CO0P 3GIMA 4FVUA 1U0SA 3V4IB 2A6OA 1JQGA 3FBCA 3FFIA 2U2FA 2CPEA 1RT6B 3QT8A 4DU7A 5KFOA 2DFEA 4K25A 2X74A 4CVNE 4JI0F 2OEHA 4DV3F 2WB4A 4GKKF 3L4QA 1UT8A 3OFGA 4WIIA 1X4GA 4F5PA 2BYCA 1LV5A 2P66A 4FJ5A 4UB4A 5J0TA 4KGXB 2FVRA 4X66J 3AQEA 3H4DA 4CGIA 3DDNA 3FLCO 1VQNS 1X31C 2DGTA 1WC0A 7ICFA 2DB1A 2C2OB 2VFVA 1IBLJ 4FZZA 1VC5A 3LO3A 4RPFA 2KZZA 3POTB 3C5FA 2ZWOA 4B3OB 1N56A 1NJWA 3R97A 4PH5A 3V1RA 4Z6FA 4DV1J 5HMXA 3N28A 1JLAA 4Z4GA 1KKHA 3M8SA 2VG5A 1X5SA 4DV7J 3NUQA 1ZH5A 1FNOA 5IQQA 2CPYA 3ULEA 2MEWA 3ETRA 4N8OA 1NBEB 2EFOA 4M6WB 2MPUA 3GLJA 2IVFB 4B9NA 4PZVA 5FROA 5ALKA 2NQPA 4JD2A 3VQ9A 4QBUA 1CJTA 4KHRA 2N4DA 4OYXA 4PGQA 3TRGA 5ALJA 2CNNB 4QIGA 1ZJNA 1MWMA 1JLFA 3OYMA 1KFTA 2FY8A 5CZ2A 8ICNA 2D69A 2M52A 4DV5K 3MMAB 4LZGA 3DLEB 4CLZA 1L6NA 4CHPA 1ZQSA 5F8NA 1X60A 2GIQA 1SH2A 3N4PA 2KHOA 1JJ2M 9ICPA 1RBVA 2YWWA 2BH1A 4HUEA 4IR1A 2FLLA 3HKZF 2EZZA 3BREA 3C15B 3WXKA 4USAA 3U8XA 1IBKK 2IRXA 1S6QA 3T9NA 5HQMA 5IT9U 4K0KF 1VCTA 3CC7S 2VDHA 4JI7K 1WF1A 3TP2A 4M3YA 3IBFB 9RUBA 2VQFF 4YB1P 4ZLPA 4R5PB 3L8BA 3BGOP 3NRWA 4USIA 4DV4J 1O51A 4NLNA 2DNOA 2IC3A 3UD3P 2KEYA 1K44A 3O5BA 3M05A 3VEVA 4OLPA 1Q81O 3KHRA 1FWPA 4K4ZA 1O6XA 4RQ2A 1S9FA 3EDRB 1J6ZA 1N8RO 3BO3A 2GO9A 4ER8A 1VQ7S 2BE9B 2CQ3A 2GIRA 5BN9A 1CXUA 1SQGA 4BE0A 2RH3A 1TMMA 1HYZA 3KHGA 2BE7D 1TUWA 1F5BA 2CAJA 1HNXF 5C10A 3I9ZA 3OYNA 2YX8A 1VQ6S 3O1WA 9ICRA 5AI0A 4B8AB 2NNWA 4I2PB 1TZ0A 1CJKA 3GQCA 4Q45A 3ZEUB 4CO0A 4CK3A 5AQJA 3QEIA 1UJ4A 2HHTA 3MDFA 5ALUA 3HDSA 2HQGA 4JS5A 4I64A 2DPIA 4F5OA 1WDTA 1QE1B 4FE3A 3MM7B 1YSJA 4X62K 4BVPA 5BR8F 3HSGA 1WAFA 1W7AA 3QERA 3UXNA 2EQYA 4CTAA 2MQOA 4KJIA 3MMBB 4JI5K 3VGTA 1HUOA 3UN3A 1XNRK 3M7DA 5D4OA 4WP3A 5KQ8A 4NOHA 1K8KA 1RWXB 1ZQPA 1E6YB 2DCLA 5E41A 8ICLA 2C1EB 2DISA 2YKMB 1AYEA 3R5CA 3OYLA 4FK0A 3HKZC 2E1AA 5DB7A 2VA8A 1H38A 4O3MA 4GO5X 3ITHB 4USJC 4KSEB 3F0NA 1QSYA 1U2VB 3MPDA 4I2DA 3VETA 1ZAWA 2A1SA 1URJA 1IKXA 2CDRB 3CMQA 1TELA 2Y1IA 3KLHA 3J81j 3MEDA 4BR2A 1VQKS 5FP0A 3WEEA 1RADB 5JVHL 1QQCA 3M1FA 5EVZA 3S8SA 3FEYB 1TFWA 4LIRA 2RPIA 4ES2A 4MLEA 2V63A 3R8EA 3J7YP 3M2RA 2GFFA 3KUEA 2YTUA 1GK8A 1PC4A 2W7AA 2E44A 3HHLC 3TSUA 5G5GA 5K8OA 3EICA 1J5EJ 3BF1A 1CRXA 3W8GA 1R8CA 2G13A 2D1CA 1NLVA 2ETJA 3Q8UA 3M32B 4CK2A 4PPXA 2BX6A 4CGFA 3VVUA 2MDAA 4JK9A 2K4EA 1MROB 5D77A 1S0VA 4NM1A 4C4WA 5AT1B 4CWBA 2F9DA 1I39A 4KBOA 1RT7A 3EW9A 4Y2RA 1GMUA 2P9UA 2E66A 3I28A 3QQCD 3OUYB 5JXSA 3AA9A 5G0RB 1W25A 1TKTA 2KI2A 2PAVA 4A8SA 5CAAA 4UY8T 2ZFHA 5K14B 2PKEA 4R8UB 1W26A 1HBUB 3VA0A 1Z1BA 3I56S 3H5YA 2QN6B 2BW7A 1SI9A 2W9CB 1X3NA 4B9QA 3LGHA 4K4UA 3C65A 2QLFB 3DGPB 4PG8A 4ZVRB 4DR1K 3Q7BA 5LJ5Y 1H72C 4DTPA 3NXZA 1JIHA 4WWSA 1S5JA 3HXMA 2E5SA 1TV9A 2W25A 3V6HA 2EK6A 2VFUA 3DLGA 3ID6A 4CHOA 2I6XA 2QEXS 2KVSA 3R1LA 3NOCA 5H2FU 3NF6A 3HVTB 1NSAA 5AXMA 1FKAF 2IVNA 2R7WA 2P6TA 1VK0A 4IJAA 3KJVB 5JVGL 4BRCA 3ENVA 3E01B 5JUMA 4MTPA 2UVRA 3VF0B 1G99A 3QEBZ 1L7MA 1S9EA 3ISBA 4QS8A 4C1NI 3UPQA 2HFSA 3MCNA 5DO2A 3U1LA 3TADC 1LWCA 3WKEA 3MTKA 4YY3J 2RKIA 2P6UA 4J9OA 5KG1A 4QJFB 4UB5A 2JOQA 4NCGA 3LOUA 1CG2A 1BPDA 3H0LB 2WTFA 4RQ1A 2IJNA 4KTQA 4PG4A 2RRAA 4NZ6A 2IOHA 4L74A 3VEOA 1SL1A 2F7TA 3B54A 1SXLA 3CC2S 1JLGB 4GY2B 2W4PA 3TYTA 3D5MA 3TTDA 1QZ5A 2DNPA 2BBEA 1RTHB 3HM9A 5A8RA 1WUUA 2FHKA 3CDWA 3CJ7A 4KV8B 1NKBA 4FM2A 5IOLA 3NS5A 3ZTOA 3AVKA 4YG2A 4PHEA 1BI4B 4TQRA 3IHQB 2Y0SD 3SPZA 1NK8A 1I3AA 1J9AA 2HDOA 5EN1A 3MEGA 4NMLA 2GW8A 1OQ6A 2MXYA 5AZJB 4CP5A 4DG1A 1NGJA 4Z2XA 5ETMA 4PQAA 4LSNA 8ICFA 2CPDA 2JVRA 4ILLA 2QLBB 4J2BA 1A9NB 1L7NA 1OMSA 2ISPA 4FW2A 1SC3B 1NU4A 3D68A 4LJXA 1NK0A 2GGPA 1U1NA 3MD1A 1OYDA 5DS7A 4B3SF 3AV9A 3GMGA 3HO1A 3S01A 2HHXA 4NL9C 4IYQA 2DUYA 2M9NA 5GADU 1EARA 2F8HA 4TYAA 3KK7A 4F36A 5E3QA 8ICGA 4I2FA 2BV3A 3NGSA 1PVPA 4FBUA 1TK8A 1SV4A 3SQGB 5J0WA 3OJSA 2MKIA 3QSYB 1PK1A 3VEXA 4QU7A 1VSMA 1Y9OA 2LBOA 1EJ7L 5I9EB 3MMJA 5AKHA 3VALA 2BANB 3FNNA 3CCVN 3OL7A 1UW4A 3AA2A 4ZH4A 1N36F 2WF9A 3VQSA 3QNOA 1Q82T 1WSEA 4BRDA 5D3GA 4YOYA 4ED6A 1OJ4A 3HPGA 1MWQA 4FWSA 4JB3A 3UQSA 2YHYA 1YITS 3PSIA 2IPOB 3KMSA 1VR6A 5HHIA 3MPWA 2IHR1 2XCPA 1NGCA 2H5XA 2VJ5A 2OH2A 1ZQDA 2HF4A 1WSRA 1WC1A 2A6AA 4DL2A 3QETA 4J9SA 4U96A 3U3YA 2I0XA 3FBEA 4KLJA 4DF4A 1B43A 3TUPA 1SQKA 2PZSA 2YXLA 5DM6L 1UFWA 4US8A 1IVZA 2C2RA 4KMOB 1XO0A 1RM6C 2XEXA 4HKQA 1ZYQA 1T94A 5A8KB 5EWFA 1XBWA 4PABA 5BOMA 2B4PA 3AMZA 1UQVA 5ALZA 4DR3F 1Y10A 3M6VA 4JI6F 4CJSA 1VAZA 3VERA 4P4OA 2LVWA 5BR9A 5KRSA 2E5LK 4US9A 3DOMA 4CF0A 2FI1A 2RN2A 1DQ9A 1VLOA 1MWKA 2Z2MA 3L2UA 4DPWA 2HMIA 4M9NA 2IIRA 5DM7Q 5HMMA 4NLYA 1XNSA 3N6LA 4BRPA 3HP9A 4OGCA 4ED8A 3MPYA 3QWPA 1X6JA 2QLWA 3RJFA 4BQZA 2HSZA 1CEZA 1EAYC 1ZQEA 2O8FA 4DV6F 3NBPB 1M90T 4QZ9A 2NYHA 1UVMA 3JXUA 3Q0AA 3CC4S 5AM5A 3TWZA 1EWQA 4I2JA 3RBXA 2R7SA 2M8DB 1K8AT 3U26A 3LM2A 2YB1A 1HX1A 4F3OA 5HL7L 1TKXB 3V7JA 5H9EK 3UD5A 3D6RA 3GR0A 3U3GA 5HP1B 2N7CA 1RT4A 3PMNA 2VG7B 3QFUA 1SJ1A 2RHQB 1VQON 4K4XA 3T3FA 3QFWA 2IRUA 4Z6CA 4KTZA 2W41A 2FMPA 1Q8BA 2F4FA 4Q5VA 2R8JA 1CLQA 4AL6A 4CZKA 5LL6Z 2JR5A 1XMOK 3O80A 1C1CA 1VSDA 3P83D 4KRFA 3EVOA 4KN7A 1SIJA 2BJ1A 3TNVA 2AYGA 1VJ5A 3QEXA 3F2DA 3C95A 1Y0HA 1VQSA 3KFWX 8ICWA 4CO2A 2O8DB 4CGHA 4CZLA 5CJ7A 2KZMA 3H2VE 1SVDA 3CXCM 1M5HA 4EO8A 2IVYA 5T14A 1PJ7A 4DTUA 3LPEA 1S6PB 3IRXA 3MZIA 1YT3A 4I1TA 3QIOA 4AHTA 3HSCA 2QW9A 2PBDA 3HP6A 3V9UA 3E51A 4MK8A 3OYEA 2UXDK 3BGLA 3KKSA 2QLXA 1G6BA 2ZH2A 5KFMA 3OYJA 4Z7CA 4WTOB 4NCAA 3KMQA 3VQAA 3PCOB 1OXJA 5C24A 1VK8A 5J2AA 3EL2A 1YKWA 3IR6B 2F4VJ 4QYZJ 5CZVA 3BH6B 5EX5A 4B9SA 1ZA2B 4JAXA 3JSYA 1YJNN 1SXDA 3MDCA 4BQLA 3PACA 3RJMB 1JLBB 1Z4UA 4FSVA 3TABA 3L6QA 3I31A 3SMPA 1KC8T 4M94A 1D09B 1Q3UA 5IS2A 4HHUA 1XQIA 4QYRA 4NY8A 1FRLA 1A7GE 4F8RA 2W3RA 2ZG6A 3MMCA 2P35A 3CF5L 2P51A 4RTFD 1NNEA 3SYZA 4TUPA 2MQNA 2O8CB 3TADA 2EC2A 1NGIA 5ALYA 2ZBIA 2ZJQL 5KFUA 4R64A 3P38A 5CE3A 4DS5A 3QDKA 3K2PA 1XTZA 2DL0A 2VA2A 2XULA 2GMHA 4OKKA 1HQEB 5AKYA 1F0XA 3NS1A 5KFZA 2P9EA 3VMFB 5J0PA 4OZ1A 4O3OA 1IKYB 4HHHA 2MZ1A 1VLBA 5LM7E 1K9MT 2FUG9 3K7RA 1RDWX 3C6AA 3D67A 2VIHA 4M9GA 2HK2A 3T5LA 2HZAA 3ICXA 1RHRB 4KKOB 2YNGA 1RK8A 1K1SA 2FLOA 5ETVA 3TR5A 5D0HA 4BE1A 1TL7B 2NUHA 2BUNA 3D2WA 4BGBA 3FZKA 5HBMB 3J7A1 4NZ7A 3G10A 4JI0K 1FDBA 4LF8K 4DV3K 2LM1A 1EQMA 2BGWA 2CIMA 1ZBUA 4GKKK 2CJAA 4EBDA 4XA5A 1OSDA 4I2QA 1FFGB 2AEFA 2KE7A 3FCVA 2WC9A 4A8KA 3W64A 3CE8A 2EFNA 1YBTA 1L3TA 2NXUA 1LKYA 1SV0C 1ASVA 2V2VA 3MPUB 5C15A 1KN6A 4CLPA 4DV5J 4ZTFA 3QFHA 1S1TA 4CERA 2QK9A 1SIWB 1YRUA 3CDAA 4OJGA 2OPSB 3FMBA 3UCGA 5HMZA 3A5MC 1ZTTA 5I4MA 3GE1A 4A62A 2FZGB 4NL9A 3X3UA 2I1QA 1KBUA 2D9PA 2WRMA 1YG0A 5D4NA 1IBKJ 1RBTA 4D3GA 4HI2A 5HP4A 3CJ0A 3RVCA 3ICLA 3RRKA 2I7PA 3TAPA 5AQUA 1VSIA 3ZD8A 4ZOSA 1PILA 1YIJN 2O8EB 4H03B 1XC3A 1FE4A 5GTIU 3ZXWA 2F40A 2CJ9A 5AKJA 4JI3F 4I9QA 3TJ9A 1SKWA 3TUZC 3RAXA 2GHPA 2GX9A 5KGXA 4NA3A 4PXDA 4CNZA 1Q53A 1N32F 3K5LA 3H1VX 3TEGA 4Y2IA 2R3VA 3M8QB 1VSHA 3HFVA 3CI5A 3H0PA 1V97A 4NB4A 3IP4B 2RVJA 1XSNA 2JXJA 4K2JA 2KG1A 2LXUA 2IGIA 5AE3A 4WU2A 3HILA 3QIPB 1X5TA 2Z30B 2B6AA 1T02A 4YUDA 1ATRA 4CYUA 3ZSYA 4P0PB 4K0KK 5DDOC 5JS1A 3I55N 2VQFK 1G4CA 4BWMA 4KREA 7ICGA 4WQ5C 3V9ZA 1BQNB 1SUQB 4OLOA 1F5AA 4KLDA 4I9LA 1DOQA 3PIPL 2A2CA 1WI6A 1KWMA 2B4OA 1BWFO 3ZDAA 4FO0A 3SSRA 4H0VB 4WFNL 4B1YB 3SV4A 1WKKA 2CNKB 1WCNA 3V6KA 1JCGA 2FBYA 3VGKA 4FJXA 4H0TB 4X62J 2L5YA 1FTRA 3H45C 2ITMA 2DXEA 3F9KA 4KMUA 4CZGA 2HIYA 3N7SC 4JI5J 1T3OA 4OI4A 2CJBA 1XNRJ 3UKRA 1GLCG 2ZIWB 1HJOA 5FLXY 1NJYA 1S9GB 4IG0B 4DOZA 1HR0F 5AJ3K 2K3KA 2N4CA 1ATSA 4U67L 2XI9A 1XNQF 2AGPA 3K9JA 1I6JA 4PXCA 1FRIA 1Y88A 4IFVA 1CZAN 4QR1A 2DY9A 2XMAA 4R0EA 5LJWA 4HTIA 2B8PA 4WFAQ 3WK8A 1P1TA 5ADXH 3NDKA 1QM9A 4YR0A 3I0RA 2AQ4A 3L4PA 4Y0WA 2Y9UA 1YF5L 3K5MA 1ZBLA 4NA1A 2RE2A 4WXWA 1VGYA 3H46O 1YWXA 4DTNA 8ICTA 1HHQA 3LAMA 1YJUA 2VG6A 1NZBA 2AH5A 1RDRA 4PWWA 1Q86T 2FZKB 4E1JA 1LW2A 1GH8A 3HD2A 4OKJA 5AM0A 4A46A 5C2FA 2NLXA 2KFZA 3HOTA 3BPDA 1TL1A 2ZBQA 5LJ3Y 1EXNA 2AGQA 5B0BA 2HMPA 4KPCA 2AZ1A 1NWKA 3KG0A 3CJ4A 3MM6B 2WBMA 2V7ZA 1FRKA 3K0SA 1MNEA 4J8FA 3OTOF 3P5JA 2FC0A 2I6WA 3UNGC 4QR0A 2B43A 1QQMA 1KQSM 1VQ4N 1GLJO 3N6MA 3NOGA 3PR5B 1I3OB 1LK7A 1FK9A 4UTGA 2AJ0A 2ZH9A 4PWUA 1OH5A 1HKGA 4QZCA 4LSLA 3SPYA 1QVGM 4OPHA 2D1KA 3QYYA 1L8LA 2V69A 5HQ8A 1GLAG 2RS8A 1FEHA 1LNQA 5JJBA 3AVMA 3ULHA 5KFRA 1U4BA 1PZNA 1FKOB 1K1QA 2HNZB 5A0YA 4TY8A 4DR1J 2MY7A 2W43A 5M1QA 4DUYK 3BO2A 5DB8A 3PVXA 2RJZA 3QPIA 3CMES 4BC5A 4UOGA 3NGIA 1IQZA 7ICKA 4WQ4C 1P9QC 4UOFA 5T7LB 1QS4A 3QU2A 2YKNB 2ESEA 5K8MA 1T9TA 5CYMB 5AIAA 2P8IA 1TFRA 4IR9A 2CPHA 3RF9A 2MJNA 5D0EA 4FM1A 3ET6A 4ZPVR 5ETLA 2GUIA 1RYSA 3G71N 4NM2A 1YTAA 1XO1A 2LFVA 4DU4A 2VOPA 3H2UB 3K8VA 2OPPB 3R6MA 3CCVS 4J37A 5HK4A 1V3SA 5IIKA 3MAQA 5IINA 3C46A 3KJFB 4LF7K 3VR1A 1DLOA 2NXCA 2FMQA 5TKYA 1HNIA 5L38A 3UXPA 5GAEI 4CF3A 1S6UA 3ENQA 1YZ7A 1RWPB 3R8YA 5KFIA 1BC6A 3D1QA 4OYBA 3TFRA 3VGLA 4FJIA 2DWQA 2DO0A 4OI0A 5AK5A 3CFPA 2UVVA 1CXQA 3LDSA 2KO1A 2D5RA 2Q3PA 1REVB 1WYGA 4OV1A 4X2BA 4ECSA 2PEBA 4ID5A 3TQEA 5FPMA 4WF9L 4KC5A 2F9JA 3H2LA 4LBPA 3KK2B 2R2SA 3H8JA 1JNZB 2QB1A 4ZCLA 3OFFA 3CCRN 3DXKA 1XHZA 1U8WA 2P9LB 1BHLA 3S6EA 4C8NA 1XQSC 1C2PA 1EX8A 3NP5A 3PX4A 4IJNA 2MYFA 3AOBA 5CWRA 3F2CA 3NWRA 3AEVA 2DIVA 2BM0A 1SV0A 4CJTA 4F7VA 2FPKA 5IM0B 5L1MA 4E19A 3GIJA 1GXTA 4FL9A 3MDAA 2DNGA 2HS4A 2DEJA 2EWHA 4FZMA 4ZCMA 4IQUA 4QIVA 3HFZB 2EAPA 2A10A 1NK5A 1NDCA 2RF2B 4IOAL 1U24A 3NH0A 5KFVA 1N34J 4BC4A 4UAUA 3CERA 3PFEA 5HANA 3NY0A 1A5WA 4BRHA 2ROEA 4I7FB 2MA1A 4M7YA 4QOTA 1FW6A 3SEOA 4X4VA 1NMNA 4QZDA 4FYDA 2V68A 2PMZD 2KXNB 3NCPA 1N5VA 3S3NA 1TQLA 4M3TA 3AOCA 4JV1A 3DYAB 1C1BA 1NDPA 1O03A 2HNYB 2YI1A 4DL3A 4LT6A 3PO4A 3GOIA 3OL9A 4CBWA 4M5HA 2VWBA 3A0BU 3KK1B 4E7KA 4JHDA 2MSTA 4KBIA 4RPZA 3EKSA 4P74A 5F8JA 4DPTA 3RWUA 2EAMA 4F4XA 2HFVA 5ETTA 4ZLJA 4FZXC 2OMLA 2VWJA 1NCLA 3D0PA 3LL3A 1NMEB 3RMAA 4AFFA 1T05A 1TVAA 4I67A 4KH6A 2KW4A 4KI6A 4PR6A 3EXCX 1KQFB 2QARB 5KFAA 1V9OA 3DDKA 3OPXA 1N36K 2KFNA 5CEHA 2G2OA 4TLRA 2ZITA 2FC9A 4WQ5A 1JUDA 2E5LJ 5HRRA 2XG8A 2HBQB 2YMQA 3AQFA 2AKWB 2DHGA 2DNRA 4USWA 3SK3A 4CFAA 1IKVA 3E3XA 4C11B 3EJMA 5KFDA 1MMNA 5K9FA 4G1QA 3J7AP 3H5SA 4GVBA 2NREA 2ROPA 3NGTA 3R7SB 2D0CA 1S8OA 2QX0A 4F0KA 2ZKUA 3FZHA 2X51A 3ISND 4F3QA 3ZTRA 3BY5A 5GMKa 2WF8A 2OI2A 2NRHA 3AD9C 3D0GE 3WXMB 3W63A 3MAHA 1AUSL 4B08A 2DPJA 3RW7A 4DR3K 4JI6K 1YJNS 1X9WA 2CUYA 3ALRA 4M41A 1GO3F 2QA4S 4TXSA 5H9EJ 4V19J 1FRXA 1UPHA 3DV9A 2FGOA 3FRYA 2KJWA 2APOA 5DK5A 3KLGA 5LXRA 4I68A 4QZIA 2QFIA 2QV6A 2QZ8A 4JV2A 3WNFA 1BISA 2EG1A 3KLEA 2E4LA 3DRSB 2HHUA 4TKTA 4KB0A 1X9MA 1JN3A 4YR2A 3KJQB 1XMOJ 2VB6A 2KXFA 1HWJA 4M47A 1SPBP 3VEZA 1RQLA 4DV6K 1NHKL 3JS9A 4FYVB 3L3FX 4EENA 4YB7A 2HNDA 2OYQA 3KUGA 4A8WA 1RGIA 5D0RA 3CJ1A 1ZJMA 3AJDA 1EETB 4CO5A 1AFJA 2OJ3A 1TUUA 2LEAA 3KVGA 2E8AA 4EIAA 1ZQNA 4LFCF 3S7RA 3AT1B 3HW8A 2VYPA 4NLZA 3SSQA 2V8HA 1KONA 4EP4A 3NFAA 2F8LA 1FNXH 4KGZB 3QRQA 4FLXA 3DRXA 2EAOA 3Q8SB 2PGCA 3FFIB 5AE2A 3QBWA 2VBYA 2PA3A 3R5AA 3AO3A 2Z1HA 3ATUA 3CNQP 4ACOA 3TZYA 4R25A 1ZC6A 2YY6A 3I6PA 2ZWPA 4L72B 3U7JA 8ICEA 2AT1B 4I0WA 2UXDJ 2ASLA 2CJQA 2BACA 9ICFA 3KNAA 3O9SA 2HQDA 2AU0A 5KOXA 4JBCA 5DBCA 1WHXA 4F91B 2MZQA 3UDVA 3MK6A 2BQ3A 5KGWA 3WK4A 2HWIA 3C7NA 4AHRA 3VQEA 2BKEA 1ZQGA 2JC0A 3BZQA 1LB2B 3FVYA 1KW4A 4HR2A 4WQ4A 1JLAB 2R2UA 1SV5A 2VG5B 1FD2A 5ETKA 3FFKB 4AUKA 4GVEA 5CYJA 7ICJA 3CXCR 2UUAK 2L3MA 4GVMA 1UP1A 3NMRA 2R18A 1YIJS 2FJBB 2P5GA 4KLFA 3DLHA 2XY7A 4BDYA 4HHTA 1KLMA 2D0PA 4HVZA 2G8VA 4JD2B 1K5OA 4OJLA 1CJTB 2BJEA 4BBYA 2ZBRA 2PE8A 1UJ5A 3OS0A 1OH8A 1XSLA 1Q78A 4DHYA 3KZXA 3QUBA 3P4UB 2HCFA 4ED3A 4H4KC 1Q46A 1FA0A 2RILA 4IKFA 1WNSA 5KAKA 3OYFA 1VQ5N 1D0EA 3BV8A 1NBWA 2CKWA 2W2MP 2A1JA 4C2MA 4OHVA 2M0NA 3ZDCA 1MG7A 1BIZA 2W4DA 1RACB 3OL6A 4ZP8A 4ATNA 3M8PA 4WZMA 4FOIA 1S6QB 3MUMP 4FJ9A 1X4AA 1VBYA 5IT4A 4QZGA 7ICMA 2NO5A 5DQIA 3J80U 4IFYA 4JI1F 3ISCA 2K8AA 1CBKA 2GH1A 3C1YA 4LF8J 2QWQA 3O1BA 3OGUA 4DV3J 4GKKJ 4F3TA 3T9ZA 4DU3A 3HHNB 4Q8EA 2Y0SC 3MR3A 1E6YA 3NEKA 4R66A 4USUA 3ZZOA 1RWMB 3MXMA 3OXLA 2DJWA 4CO4A 4ELTA 1BE4A 3CCLN 4C7QA 3L2WA 4RQNA 3WKAA 2ZZMA 3QGPA 2F5GA 1VQLN 3GFHA 4Q8FA 1L3KA 2BGGA 1HKAA 4UBBA 1MU2A 3P5TL 2YQEA 4CI6A 1BD6A 3BSCA 2K1RA 4DZ6A 3LZJA 3P1GA 1WEXA 5J1EB 4TYBA 1CJKB 3SFUA 4UB1A 1PVRA 5ETNA 5DBBA 3GJRB 1AROP 1GX5A 3O08A 1RDAA 3QRPA 1ZBTA 4MH8A 1S59A 2HBKA 2ASYA 4UUWA 3CP8A 2HAIA 4BX9C 4DS4A 3NCRA 1RT3A 3SEIA 2H4WB 1J54A 2OM6A 1RAEB 1N4LA 3NNHA 4CTAB 3S9HA 2HF3A 1RBAA 3R5GA 1RCHA 4RKUC 3PYEA 5A0LA 4CHQA 1QUVA 2E5IA 4CHNA 1GNKA 5AK4A 4FF1A 2ZDOA 4OZ3A 4K0KJ 3OVBA 1K8KB 3BDEA 3HSZA 2VQFJ 3HHKA 3FC4A 5AQIA 2YHBA 3Q8LA 4JNEA 3G6XA 4A4JA 3IM1A 5KFLA 3QGHA 4CJ7A 3D2QA 2J6UA 1MN9A 3BBCA 4FK4A 5BPLA 1VQ4S 1NNLA 1IKXB 1PAEX 5AHXA 4FBTA 3KLHB 2ZNYA 2HLTA 3MEDB 2F44A 3WEEB 2HRUA 1DTTA 2DNQA 3UNYA 1SC1B 2LLZA 4BVOA 5AFUH 2C3UA 1GEHA 1LAVA 4QWBA 1N88A 1PYTA 3LWMA 3TA0A 3L5KA 1U26A 2EZXA 1Y64A 2R7VA 3U1NA 4DR7F 4RU9A 1UVJA 3M2RB 1JWWA 3FYHA 1GQEA 3CEDA 3JSRA 3BEGB 4DOCA 3T6BA 1C1AA 2O1PA 1U6BA 5AJ3J 4IZ9A 1KXPA 1NGFA 5ALLA 4URSA 3LVVA 3EUNA 4M0AA 3CD7A 2ZH5A 4H0XB 1IV8A 4BUGA 1V3RA 4K4SA 1GOAA 1TTHB 1V5IB 3NRZA 2I5JA 3PW4A 3J81O 3PUFA 4ECTA 2DT9A 2FMSA 4CZHA 1RT7B 2L9DA 2P9UB 2F96A 3OYCA 2MLZA 2JC1A 3H8SA 3IM9A 2Y0BB 3AO2A 2HQ3A 2NS1B 2VJVA 1FJEB 4Y1DA 3CHWA 1TKTB 2CFXA 4CEFA 3G71S 3LGNA 3KKAC 4M63C 1RTHA 5K8NA 4KLEA 2PEHA 3S41A 5KRTA 3THWB 4DR6J 2OEKA 3EM1A 1HR0K 4IO8A 2ZUBA 1Q18A 2KK0A 2W9BA 1C0TA 4NLXA 5LY3A 1IR1A 2YHWA 3JB9k 2YPZA 1VHIA 2VFTA 3WKCA 3DLGB 1WSGA 2YPYA 4H54A 4FLWA 3SUPA 5E3CA 1HW9A 2GEMA 3PJWA 5A2QY 2C3OA 4FZLA 5J0XA 2M2BA 1CUKA 3RG6A 2DHAA 1HEKA 2CJYB 2RS2A 4QAGA 1S9EB 2HBYB 4HUGA 2LSNA 1LWCB 2BMBA 5CY4A 1CQNA 4P6QA 1E6VA 3WU2U 2VQEK 3AO4A 2J9EA 4L73A 3EE8A 2RKIB 3CCRS 1B92A 4DMNA 4KO0B 5M2RA 4NCGB 2V2ZA 3TPQA 5F3ZA 2RDIA 1WSHA 4DUYJ 2JWLA 4ZPTR 1TK5A 2HYIB 4OJRA 3WNGA 3D6MB 4IOCQ 2OHDA 1L3UA 3CETA 4M5JA 2BANA 5HVFA 2GAGC 4LF9F 4CEBA 5AIBA 9ICTA 2AWZA 2ZZTA 4MYTA 2QKKA 4UT4A 3RJGA 2IRYA 1NDLA 1U47A 3W8PA 3SJHA 2HGMA 4M8LA 2PFUA 3D2FA 5ALVA 4F5RA 3D45A 5AM3A 1KQSR 3M9MB 2W6LA 4JLHA 3HHDA 3RAQA 4CCHA 1TKDA 3IA0A 3SCJE 5J0RA 4YDDB 5F9NA 5KFSA 4PPZA 3F56A 3TVYA 2R2RA 2DR6A 3MEGB 1TGOA 1F9EB 1QVGR 4EBEA 4DG1B 2IA6A 2HOIA 4LSNB 5CHCB 4LF7J 2DGQA 3CJ9A 1UT5A 1UEUA 4PHTX 3GR1A 2NRRA 3CCQN 4UY8O 4HWIA 3TA1A 3L3UA 2EX3A 4J9VA 4CLKA 3H6EA 4H4KA 3QAEA 1JCFA 4YN3B 4ED2A 1BNOA 2K7KA 4M3UA 2ZUDA 3BP8A 3PR4A 4ALZA 5AQSA 2YN4A 3KLFA 1K73T 2ZTCA 2QXLA 4DR2F 2J9DE 4XAKA 1PK1B 3N9UC 4J9NA 2NRTA 2AX1A 3UE5A 1VISA 3SNNA 1F60B 2J5AA 4O8KA 3RBEA 2CQPA 3W9JA 2QWRA 1N5TA 2ZH7A 3IBCB 1UA1A 4NLUA 5DBAA 1BUPA 3AVHA 4WU3A 4Q44A 3NASA 1TAQA 3O9TA 3QUQA 3AD8C 1BPXA 5C42B 1ZQXA 2MJUA 3AA3A 5D3GB 3QNMA 3IFEA 4UF4A 3OY9A 3R7NB 4LRFA 1HUZA 3MMVA 4BR7A 3V7KA 2KB2A 2YWEA 4BDPA 3DNCA 2GUPA 3G0ZA 2GHVC 3CGIA 4J9MA 4IH5A 2IS3A 2KIVA 2ADBA 3PSPA 2B4JA 3TZXA 4BWJA 2WAQF 3CTRA 4EK2A 3ZT1A 2VKRA 5D6GA 3A8YA 4PJ0U 2DH9A 2GV9A 3FM9A 1NZ8A 1RWWB 4BRLA 3IG1A 4DR4F 5CYQA 1SH0A 3D28A 3T7ZA 2QWMA 3VCBA 3SMZA 1KVKA 1T4GA 1EX4A 3OL8A 1OS5A 4PXEA 1ZQQA 1YGYA 1DQAA 2O8BA 2FC8A 3KG1A 3N7PD 4NLPA 3Q8MA 4X4PA 1HNWF 1JXBA 2DIUA 2FGCA 9ICVA 1NOYA 1H7XA 2B4VA 2QYCA 3ZZTA 2Z2LA 5KT3A 2Y1JA 2C2KB 3T1HF 2V2KA 2UUCJ 5DB6A 1RQ0A 3MR2A 2F7VA 1RKIA 2A1RA 4H5TA 3DOMB 3BQ7A 5E0OA 3DN9A 5ETRA 2HMIB 4G9BA 4K59A 4B1ZA 5I3PA 3PZPA 4LRCA 3F5EA 1U45A 4LMZA 2B56A 3T5HA 4XPCA 4MHVA 5F9LA 1S5ZA 4PXBA 3QWUA 3H8MA 5HR7A 3GCWP 4TU7A 2Q1LA 1ZPVA 5F41A 2O8FB 3PSFA 3QGGA 5A6WA 4OI6A 2G8WA 2EFPA 2HHHF 3AJ2A 2XM3A 7ICHA 3AD7C 2WVBA 3MX2A 3OFHA 1S79A 5JLFA 4ECVA 3H25A 4CGDA 4JKGA 1VRTB 4TNOA 3VN5A 2HVHA 2EWSA 2GNKA 3PY8A 2QWOA 1H1VA 4CIFA 5LMNF 5CB1A 3C66A 4CJEA 3IN5A 1IJEB 4B3RF 2AEMA 4QZAA 2WZ1A 3A3NB 5E3RA 3O3GA 2OFHX 1MA9B 4FZVA 4RL1A 2VCPA 4DTSA 4CFDA 1JLBA 4IQTA 3H0MB 1SGGA 4PCQA 5AKKA 1DY3A 2LYVA 4FJLA 3SCKE 4CNYA 1IKWA 1Q82O 4F93B 3LW5C 1C1CB 5IZHA 3IKMA 3NVYA 4NZ0A 2X7IA 3WT0A 3RUBL 5I42A 5JMNA 3THTA 3LUYA 1T9UA 3UMGA 3LDPA 4WFXA 1H73A 2OZSA 1RE1B 2CVIA 1JNRB 1FXRA 2CWKA 2IM0A 4OZ0A 2RE1A 1QD1A 4JI6J 4DSJA 3DKDA 2KHQA 5E84A 2XMMA 2DGWA 3N7RC 4X64F 2VBXA 4A48A 1Q16B 4Z6EA 3T1AA 1FFUA 3H5XA 2CZ4A 4LBIA 2EK1A 3B9JA 3QU9A 3T19A 2EKNA 1U25A 2U1AA 3IRXB 4KGKA 3AVFA 2FJEB 3ENHA 4JI2K 1MQ2A 4CJKA 1T9XA 2I2YA 1JJHA 4Q7AA 1WC5A 1XC9A 3HL8A 2PI5A 2KVIA 4DV6J 1KVAA 3OA9A 2LQ8A 2OELA 3KKAA 1ZM9A 2DGUA 4M63A 3VZHA 2VD3A 3O9QA 4QIEA