4EZ9A

Bacillus dna polymerase i large fragment complex 2
Total Genus 197
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
197
sequence length
578
structure length
578
Chain Sequence
b'KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase
publication title Structures of a High-fidelity DNA Polymerase
rcsb
source organism Geobacillus kaustophilus
molecule tags Transferase/dna
total genus 197
structure length 578
sequence length 578
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4ez9A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4ez9A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ez9A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ez9A01
4FBTA 2J6SA 4CF8A 3GV5B 3RB6A 3KLIA 1J9AA 2XC9A 1C1CA 1REVA 3RJHA 5CYMA 5EOZA 4AHRA 5JUMA 1S6PA 3SQ1A 4Y1DA 4J9NA 2O4IA 4W5TA 4YD1A 1RILA 3RH5A 5HRNA 1DOQA 4DS5A 3MGHA 4CFAA 4F5OA 1NJYA 3MXJA 1SL1A 1B9DA 5J0PA 3MAQA 9ICGA 4CESA 4J2EA 4ECQA 4C8LA 2JEIA 2HB5A 2XCPA 5KFCA 2D0CA 3KK2A 4PHAA 3RJIA 2AGOA 2A1SA 2PI5A 4ID1A 3SCXA 1V9PA 3V9XA 2YHBA 4CEBA 2OPRA 4RU9A 4FM0A 4HCCA 1VRUA 2LSNA 3U6FA 4YFUA 3ZSOA 4C8MA 3UXNA 3ZSWA 2P5GA 3GV7B 3I0RA 1NK7A 1ZQLA 4Q0BA 2M9NA 5KFVA 5DGBA 3A2FA 5L1IA 3MFIA 9ICMA 8ICIA 2A1JA 2Y1JA 3MR2A 1B43A 3UQ0A 5DGAA 1KVCA 2ZUDA 4FYDA 9ICSA 5EWFA 3ZDBA 3RJEA 2KZZA 4YN4A 1SV5A 2E6LA 1XO1A 4Q43A 5DG7A 4UAWA 4P4OA 3AVIA 5DK5A 3NF6A 2W9BA 3QLHA 4JK1A 3T3FA 4FJHA 7ICPA 4DSEA 2BKEA 4B08A 4KLUA 2OYQA 1D9DA 4HUEA 2HVIA 5J0QA 2ZUBA 1B92A 2JEJA 4CJUA 5J2KA 2KTQA 9ICXA 4I2CA 4R65A 4DTXA 2A1JB 3RJFA 3U3GA 3ZDDA 3PW7A 4K4HA 4R63A 1YTUA 4DL4A 3ULDA 3L2RA 8ICQA 4J2DA 1S10A 4X5VA 3ZSXA 1NKCA 1ZBFA 5BOLA 3HW8A 4FJ9A 1KLNA 3DRRA 7ICOA 4FM2A 1FKPA 1JL2A 3ISCA 3RH4A 4M9LA 2BE2A 3AVJA 4CHOA 3LAMA 4Q44A 4MEYA 1LAWA 4FJ7A 1BPZA 5DB8A 3V81A 3G6XA 1BPDA 4JV2A 4CEZA 2W42A 3VA3A 5CWRA 2F96A 4F4KA 2PFPA 4LZDA 1DTTA 1XC9A 3RH6A 1SKSA 3AO2A 1J5OA 3EPIA 2Q0ZX 4ZH4A 1MQ3A 4C8NA 5KT7A 9ICAA 2H5XA 1RXWA 5KT5A 4DU4A 3CM5A 5KG5A 3BGRA 1VSLA 4E19A 2C28A 2BQUA 1U4BA 3AVAA 4AHTA 5CJ7A 3FDSA 4CK3A 1BCOA 5KG2A 1HYZA 4DOAA 5KT2A 4FW1A 4RW7A 4QWCA 4K8XA 4RZRA 4CEDA 4F5NA 1NK0A 8ICHA 1PZNA 7ICVA 5CY4A 3QEAZ 1VSKA 2B4JA 4IQVA 5KFPA 3H4DA 1JLQA 4LH5A 4BE2A 9ICJA 4FM1A 4NY8A 4HHTA 3F73A 4KHUA 3OYDA 3HVTA 4P4PA 1S76D 2OWOA 3V1RA 7ICSA 3B0YA 1HUOA 3ISBA 4YMOA 1D5AA 3BJYA 3Q8LA 4F5PA 4E1MA 3K58A 3RB3A 3HPGA 1ASWA 3ZCMA 1TAQA 3RAQA 2EX3A 3SUOA 2LYHA 3T5KA 3RTVA 2IBKA 2WOMA 5L9XA 1RDDA 4O4GA 2OZSA 4QZFA 2OPQA 3QIOA 4I2FA 4Z4EA 9ICFA 2V9WA 4NLZA 1ZQSA 3C6UA 1NOYA 3NDKA 4M3YA 4RQ4A 3EYZA 3HP9A 2FPMA 3PO5A 3D45A 1KFSA 4J2AA 4XIUA 1S0OA 3JPOA 5KFGA 2FPLA 1COOA 3B0XA 4O5CA 3K5NA 2BGWA 1F21A 2VWKA 2IHMA 1SKWA 3HVRA 5DKWA 1C0UA 4CEAA 1VSMA 3UQ2A 4E7IA 4B9NA 1YVUA 4O3OA 2YHAA 4BE0A 2E4LA 4IBNA 4W5QA 3Q8SB 1Y97A 5IIMA 1HJRA 4NCGA 5CYQA 2DTUA 2MUTA 2R8GA 1CEZA 4KTZA 3AVLA 3ORYA 3K5MA 3EY1A 4PGQA 4DU3A 2KZ3A 1ZQGA 2W9AA 3NH0A 3BQTA 1KRPA 7ICUA 2HNZA 3LZIA 2V4QA 4CE9A 3C2LA 1A5XA 4H4OA 1EXQA 2RF2A 1TL1A 3OYBA 4ED0A 3NH2A 1N5YA 3AV9A 2XY6A 3V1QA 3QNNA 2IHNA 3JPPA 4DOCA 5DG8A 4AHSA 3MR6A 4M6WB 1C0MA 1CXQA 1BHLA 3VQQA 4M3UA 4Z4HA 3TR8A 3H7IA 2J6UA 1JXBA 3NAEA 2P51A 3KHRA 1BL3A 1L3UA 5KFYA 4BGDA 9ICBA 2R8HA 4UB5A 4LY7A 4F4WA 4MQ3A 3KLEA 4O0JA 1ZQYA 4OGEA 4KAZA 2BR0A 4YFKA 8ICGA 4UQGA 1WAFA 2WONA 4E89A 1LW0A 4E7KA 1RDCA 4QWDA 5KRSA 1B22A 1LWCA 1UAXA 3NF7A 4I2HA 3EW9A 1YTAA 8ICCA 3EPGA 3FFIA 4B8AB 2HHVA 3DLGA 2BCUA 1SL0A 1NKEA 5J0RA 4DTPA 3IHQB 3AA3A 5KFBA 3AVBA 4YP3A 2UVUA 7ICEA 1BPYA 2X78A 1KVAA 1NKBA 3KLGA 4BXOA 2FMQA 3PR5B 5D3GA 2O4GA 4RNNA 3UPQA 2HHUA 3TAEA 4OLAA 4KHSA 1A5VA 3LWMA 4CCHA 1QE1A 3M9MB 4Z0UA 1HNIA 4RPZA 4J9QA 1ZQEA 4RG8A 3T5JA 1J54A 1G15A 3MXIA 4JWMA 3LK9A 3ZT3A 9ICVA 4YVZA 4M3RA 3M8QA 1W0HA 4R5PA 1S0NA 1EX4A 3L2VA 1U47A 5DDYA 3RWUA 4MFCA 5J0SA 3L3UA 4I2PA 5J1EA 1IO2A 4F4XA 1HNVA 2JEGA 1ASVA 3AVFA 4W5OA 2VA8A 4E7LA 3SZ2A 4BXOB 4CJWA 1CZ9A 4FJ5A 5L1LA 3P5JA 1N6QA 1BI4A 4Z4FA 1WN7A 1R0AA 4F3TA 3DLKA 3ZSQA 1TKXA 5DMRA 2AU0A 1RT5A 4R66A 1IM4A 2OPPA 4I2AA 4PUOA 2Y1IA 3CYMA 4O3PA 3ZSVA 4KKOA 3ZD8A 5DQGA 4QZBA 3GFKB 1ZYQA 1ZQNA 1HYVA 4TQRA 4CGIA 1EP4A 4DSLA 4DQPA 1VRTA 4EZ9A 5J2GA 1HQEA 1NJZA 4KREA 3LP1A 4ECYA 3SQ2A 4FJJA 5CHGA 5CP2A 5KFJA 3VQPA 4KLGA 4GMJB 8ICAA 3QIPA 2DPJA 5DLFA 4CHYA 1ZJNA 4Q5VA 4FJ8A 2IC3A 3RB4A 2ZJ8A 4F93B 2HHQA 3DLEA 2DY4A 4OVLA 2PI4A 2XHBA 2HHSA 5I42A 4CGHA 1NOMA 3TAPA 4FLUA 5KRTA 1Z26A 3M9OB 2R8KA 1TKTA 1ZQZA 7ICTA 2QKKA 3NH1A 1ZQAA 3OJUA 4FLVA 4UB3A 2QXFA 2ITGA 3CFPA 1QS4A 3HM9A 5E41A 5J0XA 3BQ0A 4J9KA 4ED8A 3AA5X 4MF8A 3NGYA 3HT3A 4LVSA 4PH5A 3SUPA 3E2EA 3ZDEA 3LAKA 4IRDA 1VSFA 2YNFA 4NLKA 4CHQA 3AVCA 4CJLA 2YNGA 1CLQA 1IG9A 3I0SA 1NK9A 4E3SA 3Q8KA 5EWGA 4AHUA 5J2AA 3SUQA 2P6UA 1T7PA 2PY5A 1VSDA 2VG5A 1UA0A 3RBDA 3H40A 4JRPA 7ICIA 4FCYA 2BCQA 2DFLA 4XUSA 9ICTA 2D5RA 4P2HA 5K14A 1RCHA 7ICKA 4YNQA 3IM1A 4YR3A 5J0WA 9ICPA 4CEFA 3OYCA 5C5JA 4BE1A 8ICLA 4JLHA 5KGWA 2NRZA 1GOBA 1XI1A 3V7JA 5KI6A 4GC6A 4DMNA 2G8UA 3VQ5A 5J2QA 4F5QA 8ICVA 2P1JA 4JUZA 2FLLA 1ZJMA 3NF9A 3V9ZA 1SL2A 3KKSA 1KLMA 4ZHRA 4NCBA 3QINA 4F50A 3PR4A 3DLBA 2E6MA 4FS2A 5J29A 5IINA 4G1QA 3S3OA 4CF2A 4CJEA 3SI8A 4PY5A 1MC8A 3M8RA 3QETA 4G3IA 3NHGA 5HHHA 1JLBA 4CJ5A 4W5RA 5HBMA 3C23A 4ECZA 1TL3A 2B5JA 2ZUCA 4B8CA 3H08A 2B6AA 1O1WA 3V9WA 2V4RA 4IG0A 2I1QA 2HHTA 3PNCA 2HHWA 1Q9XA 4ECUA 1JLGA 1BPEA 3ZSYA 1MU2A 8ICEA 4I29A 1ZBIA 3DOKA 2BANA 4RQ7A 4QZ8A 3QEIA 2R8JA 5D46A 2FMSA 1NJWA 7ICHA 2BHNA 5KFKA 2BCRA 3FYHA 2W8LA 2JZBA 1CZBA 4J9OA 3Q8QB 4BACA 2KFZA 4FLXA 5J2EA 3IRXA 8ICKA 4EYHB 1ZBLA 1KFDA 4YG2A 3HP6A 2W9CA 4M0AA 1ZQTA 3C5FA 4EP5A 3DI6A 3C1YA 3RR8A 4WE1A 1XSPA 1T03A 4I9QA 4F2SA 5FDLA 2GV9A 3V9UA 4CJVA 4DTRA 2ZTEA 5CA7A 5J0OA 5KFIA 3ZDCA 4B9MA 1JXEA 4KMUA 4ECTA 1TK5A 4UBBA 3ZT0A 1ZQIA 3KIOA 4CIGA 3OYMA 2W9BB 3ISDA 4PA1A 1L3VA 1RBVA 4E0DA 1HYSA 4RQ6A 3PW5A 5J2BA 4CJFA 1XSLA 4JWNA 2D0BA 3HPHA 3PV8A 5IIKA 9ICKA 4HUFA 1RT6A 2WTFA 4CGJA 3SQ4A 1BISA 3MBYA 4FLWA 1BGXT 3UIQA 2F1HA 2X74A 9ICIA 2XY5A 3T5LA 5KFFA 4OKEA 4OGCA 8ICOA 1LB2B 2BPFA 2BGGA 3RJGA 4KLLA 3LALA 3PX4A 2BPGA 4EP4A 4OPJA 3RMBA 2HNDA 5CZ2A 5KG3A 5IILA 1TFRA 3K5LA 4HUGA 1Z00A 4DQRA 4YMMA 1VSIA 1S97A 4NLNA 1ITGA 8ICSA 3KLHA 4ECSA 3KJVA 2P6RA 3KLFA 3QERA 3OYNA 3RMDA 1H38A 3JPSA 1UOCA 2RDIA 4FVMA 5KFWA 3NBPA 1QTMA 2HHXA 5KG7A 3OY9A 2ALZA 4LD0A 5EU7A 3O3GA 3GILA 1BIUA 4Q8FA 3P83D 4M3WA 1C6VA 2Z1GA 4CJTA 1B9FA 1S6QA 4M45A 2OZMA 3JPNA 1WCLA 2QKBA 2W8KA 3LPTA 2ATQA 4MFBA 4CIFA 2FPKA 1WSGA 3I8DA 1RTIA 4BWJA 4CGGA 3M8SA 3TAGA 4PWDA 4KLEA 3MDAA 7ICQA 5J2JA 1LAVA 1N56A 3L2QA 2KN7A 1XHZA 1X2IA 5KT3A 4CHNA 5KFUA 3VQ8A 5F9LA 4Z4CA 1RNHA 4FK0A 4CF9A 3OYJA 3AVMA 2G8VA 3S3NA 4O3QA 4PHEA 5EWEA 2R8IA 5IIJA 3L2UA 4JS5A 5KFEA 2DPIA 4RQ2A 1I3AA 3SI6A 4F2RA 3C21A 4KTQA 3Q8PB 8ICFA 1JX4A 3PW2A 1RBSA 3K75D 4DSKA 3SJJA 4RPYA 1VSHA 3CFOA 1VSEA 2VA2A 1UT5A 4I2GA 1DLOA 2RN2A 5KFLA 4ECXA 3ASMA 9ICUA 5SZTA 5KGXA 1S1TA 3CFRA 2Z1JA 4C8KA 2XGPA 4RNMA 3M8PA 4F4YA 4O0IA 4UB2A 1XSNA 4ECRA 1ZQMA 2GWSA 4O55A 4QW9A 1D8YA 1RBUA 4CK1A 1JMSA 3VQAA 4TUPA 3WNHA 3KHGA 1U49A 3MR5A 4I2QA 3GDXA 4ELUA 3ZT1A 4DOBA 4YD2A 3OVNA 4KLOA 1RBTA 1I39A 4QW8A 1T3NA 4W5NA 5KFHA 2FMPA 4UAZA 3V6DA 5KG6A 4FLYA 3DMJA 2ZJ5A 1BIZA 2MUTB 3OSNA 4DTNA 5F9NA 3VQ6A 3HJFA 1RT4A 3IG1A 4KN4A 4DFMA 1S9FA 4FLZA 3QNOA 1TK0A 1X9WA 3F9KA 3EWAA 4HCBA 1LWFA 4O5EA 3HWTA 1QHTA 5C25A 4OLBA 3V9SA 1XHXA 4TQSA 4K4GA 2D0AA 4FZYA 4DL6A 4M3XA 2ISOA 3MEDA 5J0TA 4KFBA 4KLSA 4DSFA 3TABA 3O3HA 1JXLA 4F92B 3V6JA 1RXVA 3VQEA 8ICNA 3BQ1A 1U45A 4H8KA 4CIEA 3SQ0A 5KFZA 1KSPA 3OYHA 3OYIA 2FC0A 4XQ8A 1L3TA 4KB0A 1Q9YA 3P1GA 3C1ZA 3G6YA 1QLNA 1S1UA 3LDAA 1ZQVA 8ICZA 3DM2A 4QAGA 2ISPA 3S9HA 3JPTA 3VQCA 1T05A 3HSTB 1TAUA 3DOLA 4JS4A 2PFNA 8ICYA 4ELTA 3RBEA 1RPLA 1ZQDA 4KN7A 4LZGA 4CFCA 4PQUA 2NRXA 2C2DA 1BQNA 3QEBZ 5HP1A 4DU1A 1RTDA 4IRCA 3LP0A 4TUQA 4QZCA 9ICRA 3MGIA 4EZ6A 3GIJA 4FW2A 4OJRA 4KLQA 1S9GA 4IFVA 4I2EA 4JRQA 4ID5A 4CJRA 4TSXA 2XY8A 4ZTFA 4B9LA 4ZTJA 3E01A 1FKOA 4KLDA 3TWHA 4FXDA 4Z6DA 2VANA 3B6OA 4RT2A 3KHHA 1X9MA 1S5JA 1KEJA 5DBAA 2Q3SA 4DTJA 3NCIA 3G0ZA 5HMMA 5KFSA 3DLRA 1AROP 3RJJA 1JL1A 2C2RA 3JPQA 4DSIA 4DTMA 7ICMA 1RTJA 4M04A 2UVVA 1QSYA 4GLXA 4CK2A 3NGDA 2IGIA 2NRVA 4M9HA 1ZBUA 1HMVA 4XRHA 4P4MA 4ED7A 4FJKA 1Z3EB 3K4GA 1BI4B 3G10A 4O5BA 3AO5A 4J9RA 1CUKA 3QESA 3B6PA 3G6VA 1X9SA 4Z6FA 5KFQA 2AGQA 5KFAA 1ZQPA 1HJPA 4B9UA 3TANA 1QSSA 4EBDA 3EZ5A 5J0UA 3U3YA 4J9PA 3HPOA 4HYKA 4FBUA 4I2DA 1WSJA 9ICWA 4GW6A 5KT6A 1EETA 2KW4A 3AO1A 4EBCA 1BCMA 1JLAA 2IOCA 2ZD1A 2F8SA 4BDYA 3L8BA 5CB1A 3SNNA 4M42A 1S0MA 3VA0A 4I2BA 3QZ7A 1TVAA 1GOCA 1KCFA 4QZHA 5FROA 3NGZA 9ICNA 1CXUA 1LWEA 3AVNA 4O44A 3CM6A 3AVGA 5BPCA 3O3FA 3H8JA 2AJQA 4F91B 3Q8RB 3V4IA 2FLNA 3LWLA 4CJSA 4FO6A 8ICBA 1WNSA 4IR9A 1TV9A 3GIKA 1Y88A 5KFXA 4FJLA 4BDPA 4UB1A 4QZIA 4RNOA 1ZQHA 7ICNA 1RBRA 2XY7A 3KD1E 5L1KA 4DL2A 5KG0A 2DFFA 3N97B 1WLJA 9ICCA 5C24A 4E7JA 4QWBA 4IR1A 4M9GA 2FBYA 1JN3A 3OS2A 1BQMA 3GQCA 1ZQXA 4DF4A 1A77A 3ITHA 1S0VA 3RMCA 1IKWA 3DRPA 5HNKA 3TQ1A 2Z1IA 3QEWA 4K8ZA 5DG9A 4DTUA 3CG7A 1NK8A 3KD5E 2P5OA 4DFPA 3PO4A 3GIMA 2IS3A 4Z6EA 5DDMA 2DFHA 2IAJA 8ICUA 3CQ8A 2VA3A 2ZE2A 3KHLA 1KFTA 1ZETA 4DWIA 3V1OA 4QZDA 4N41A 4B9VA 5SWMA 3L3VA 3K2PA 1MQ2A 2G8WA 2IMWP 2ZTDA 5KFMA 4Z4GA 4L8RB 1RZTA 2UVRA 3VQ9A 3O4QA 2IA6A 4KO0A 4FK2A 3AVHA 9ICEA 1ASUA 3QEVA 4CGDA 1SUQA 3LP2A 2BQ3A 2C22A 3SPZA 2X6SA 4FJIA 1WSIA 4DL7A 5J2IA 9ICLA 7ICJA 4OPKA 4M9JA 2FBTA 4XA5A 4DQQA 2ZJAA 4AILC 1NK6A 2VG7A 1S9EA 3THVA 1RYSA 1LV5A 3IAYA 3SUNA 4CJKA 1J53A 1RT7A 4Z4IA 2XRIA 5D49A 4QWAA 5HLFA 3OYEA 4LSLA 3LP3A 4CFDA 4UBCA 3DLHA 3SV4A 2QK9A 4QCLA 2YNIA 2W9MA 3V7LA 1S1WA 1C1BA 2GBZA 4DEZA 4IG3A 3V6KA 1U9LA 2BCSA 3TAQA 4FJMA 4RW6A 1DGSA 4OKJA 1RTHA 4ECVA 1KDHA 4KV8A 3ZSRA 5L1JA 3TARA 3C95A 1RT3A 4NXZA 2NRTA 4RT3A 4CJ3A 3L2WA 4FK4A 5J2PA 4UAYA 4E1NA 4E7HA 2OPSA 1XU4A 1RT1A 3H8SA 4ED6A 2BDPA 9ICOA 3JYTA 2JZBB 3MR3A 5BOMA 2RDJA 3WNFA 4Q45A 1ZBHA 2PXIA 2YKMA 1ZQBA 1A5WA 3QEXA 2JLEA 3O4NA 4DTSA 2PYLA 3C6TA 3HYFA 2W9CB 4IQWA 4KI4A 1A76A 4ED3A 4IFYA 2UVWA 3DYAA 3N4MB 1IKVA 1BPXA 3OS1A 1D8LA 3C2MA 3AUOA 1S1XA 4GC7A 4NYFA 3M9NB 3H8WA 3T5HA 4DLEA 5KFOA 4CERA 5HHIA 4R8UA 2ASJA 2ATLA 4TUSA 4LH4A 4Q8EA 1WSHA 1VK0A 2XGQA 9ICQA 3RB0A 4EBEA 4QZ9A 4ED2A 2X6NA 3ZDAA 7ICGA 3T1AA 4ICLA 4J9LA 2P66A 5DBBA 4TURA 4RQ5A 2VWJA 7ICRA 1TK8A 3ZD9A 4I7FA 2G8HA 1ZQJA 4N5SA 2RKIA 1HQUA 3PMNA 5C42A 1TV6A 4DTOA 3V7KA 4N76A 2RPIA 4CECA 1KVBA 1XWLA 3QZ8A 3K59A 1FK9A 4PHDA 5HMLA 4R8UB 1YT3A 2BCVA 5FRMA 4DFKA 4BDZA 1LW2A 5HRSA 4NCAA 3QO9A 2FLPA 3V72A 1VSJA 3AVKA 5T7BA 3BQ2A 1JIHA 1RDBA 3TFRA 4LSNA 4DO9A 3JPRA 1S77D 3RR7A 1Z00B 3HK2A 3RRHA 4DG1A 3KK1A 4CEOA 3OSPA 5DB9A 1K1SA 4KHNA 2HNYA 2FBXA 4Z6CA 2NUBA 1IXRA 5J2CA 1EXNA 4O9MA 3Q8MA 2AGPA 2PFOA 1L5UA 3MEEA 4KPYA 1N48A 4PPXA 3OGUA 2NRWA 4FJNA 4K4IA 4F5RA 4CF0A 3OYKA 3C94A 5J2FA 2I5JA 3PUFA 3JSMA 5D4BA 3NE6A 1TVRA 2JGUA 4I27A 1QSLA 3MDCA 3H4BA 1ZQRA 1U48A 3OJSA 1ZQCA 3HX0A 4DFJA 1K1QA 3QE9Y 3RMAA 4YR2A 3LANA 5DBCA 1ZQQA 3PMLA 2HVHA 5HROA 5CZ1A 4FJGA 5J2HA 1HUZA 1T8EA 3MEGA 5JS1A 3OHBA 3S3MA 4OKKA 3AU2A 5KG1A 1JLFA 5KG4A 4DSJA 5IIOA 9ICHA 2I9GA 4M6WA 4C8OA 4RQ0A 4ECWA 3KK3A 2DFEA 3SPYA 8ICTA 3OHAA 4CJQA 3ZT2A 1HRHA 1U04A 3OYFA 4O5KA 2KZMA 4IRKA 3HO1A 5HP4A 1XS9D 2HMIA 4IKFA 3K57A 4KLHA 4CHZA 3D0PA 4CGFA 5J2NA 1FXXA 3ZT4A 4M3TA 1UWBA 4O3RA 3C5GA 2IDOA 1EKEA 3NF8A 4I9LA 3LZJA 1D9FA 1TGOA 4M9NA 2BQRA 4IQUA 3PW0A 4RUAA 1NK5A 1WAJA 2Z1HA 2XO7A 4FLTA 3TFSA 1HPZA 1ZQUA 3C2KA 4RQ1A 4KLMA 1W9HA 1KTQA 2C2EA 4AHCA 8ICMA 2ASLA 4RW8A 5DB7A 4KI6A 5KFTA 1C0TA 1NOZA 1ZQOA 3AA2A 3PX6A 4NM2A 4IQTA 4IDKA 1S1VA 4CJ4A 3BDPA 2KQ2A 4KLIA 8ICRA 3MABA 4PGXA 4MFFA 5JS2A 4O3NA 5KFDA 3AO4A 5I3UA 1IKXA 3ALYA 1GOAA 4M3ZA 5J0YA 3RJKA 4B9SA 4JV0A 4M41A 5HRPA 4CF1A 4JV1A 4KHWA 3SYZA 4KLTA 4I2IA 3GIIA 4AHVA 5DQIA 4EYIB 4GXJA 5TZVA 1Z25A 1BPBA 4YR0A 5DLGA 3LPUA 3GV8B 4KHQA 2OA8A 2KFNA 4Y1CA 3OS0A 3OYGA 4PGYA 3ISNC 4KTWA 3TI0A 3WNEA 4NM1A 2PYJA 4PHPA 4QOZB 4N56A 3MXMA 1L3SA 1SKRA 4YCXA 2PZSA 1WSFA 3VQ7A 4FZZA 4NYNA 3KKRA 4M47A 2A1RA 4N47A 3AU6A 1JKHA 3DRSA 1IKYA 3VN5A 3ETLA 2YV0X 2G8IA 4YMNA 4RQ8A 1UA1A 4B3OA 3NGIA 4KRFA 1UT8A 4I28A 4FZXC 4R64A 4HVJA 4F8RA 1WCNA 4DQSA 1K6YA 2EHGA 1MSWD 5KTQA 4QZEA 5KFNA 3RAXA 4RW9A 1NJXA 5J2DA 4QZGA 3OYAA 4KB1A 2PFQA 3V6HA 2J6TA 3AA4A 1T4GA 4GVMA 1SZPA 4QZAA 4EEYA 5DQHA 2XCAA 4RQ3A 4FJXA 4GXKA 2ETJA 4DL5A 4QWEA 3OYLA 1ZQKA 4DS4A 3HXMA 4RW4A 3RRGA 2BPCA 4BWMA 1RYRA 1C7YA 3ZSZA 4CFBA 8ICJA 1QQCA 1BVSA 2G8FA 3MFHA 4GXIA 2R7YA 4FS1A 4MFAA 4DL3A 1X1PA 2G8KA 2AQ0A 4DLGA 2ASDA 2VG6A 1TKDA 4I2JA 4J9MA 4F4ZA 3VQ4A 4YXJA 1NK4A 4KITB 5KT4A 4HTUA 7ICFA 4H4MA 4CEEA 3TAMA 3NFAA 1C1AA 4CEQA 4UB4A 4MF2A 3NTUA 3KTQA 8ICXA 1IH7A 4MEXA 3WNGA 1DTQA 3MECA 2F8TA 4DQIA 8ICWA 4J2BA 3UXPA 3UXOA 3VQBA 2F1IA 5IIIA 2FBVA 8ICPA 1TKZA 2ZTCA 4F3OA 4B9TA 3SV3A 2F1JA 4AH9A 5FRNA 3K5OA 3VQDA 1JLCA 3QEPA 1ZQFA 3HL8A 2YNHA 4DF8A 5KFRA 1RT2A 3T19A 4ELVA 3AO3A 1WSEA 3LDSA 4RPXA 2B21A 2MAXA 2ZQBA 3PX0A 4RUCA 4M2YA 5CR0A 1ZQWA 3IS9A 3PVXA 3TAFA 4KHYA 1RDAA 1JLEA 4NLGA 4O3SA 1Q8IA 5J2MA 5DB6A 4CHPA 5HRRA 4YXMA 3PW4A 4YQWA 4ED1A 2AQ4A 4CJPA 2JEFA 2YKNA 4KLJA 7ICLA 4J9SA 3PY8A 2HW3A 4KLFA 2GUIA
chains in the Genus database with same CATH superfamily
4MJKA 2J6SA 5IOLA 2E1FA 4OJPA 2VQFJ 4JKBA 4LIRA 3HRGA 4PXDA 3CCRN 1C1CA 1JCEA 1K8KB 5CYMA 2E2OA 5F8IA 5GIPA 5B08A 4CD1A 3DRPB 3FZFA 4PQAA 2CVIA 4JKHA 3M05A 5JUMA 1H7XA 1WC3A 3D7SB 2O4IA 4W5TA 4DR3K 2GOLA 4J8FA 3SFUA 5HRNA 2QMWA 2ZH5A 4DV2F 4X66K 2CRXA 5F8LA 1YKWA 1GAOA 3MI7X 2QLWA 5C0YA 1NJYA 3H59A 1SL1A 4P0QA 3CJKB 2QGFB 3BS5B 9ICGA 2DT9A 2FLOA 4ECQA 5THWA 1FD2A 2HB5A 2D0CA 3X1LB 3BY5A 4USJC 3CJ5A 1WOSA 4UQTA 4ID1A 1F3VA 1VFJA 1RDRA 2OD4A 4JN4A 2EFNA 3LM9A 4U67L 1YQHA 1PJ6A 1RE1B 4HCCA 2N4CA 4TU9A 5ETNA 4YFUA 2X3DA 4KO0B 2V0NA 1QM9A 3MMAA 3CIPA 2M9NA 5H1SQ 2A40A 2UXCK 2ROEA 5L1IA 1KD1O 2A1JA 2O8BA 4CH1A 1NMDA 5E84A 4CZHA 3C16B 2RQCA 4ZIWA 1SV5A 5DG7A 2VQFF 2VG7B 2W9BA 1QVGR 1C20A 3PYGA 1GMWA 4FE3A 3T3FA 1NZBA 4PPDA 4EUVA 2O8CB 4JYAK 4B08A 1QUVA 4KLUA 5M1FA 2OYQA 5EE0A 1ULRA 4RWXA 2MSTA 2ZUBA 2BRLA 2JEJA 2HSZA 3NCQA 5J2KA 3DN9A 2KTQA 4Q0BB 1GO3F 2ZBCA 2YWHA 3NVMA 2UXBK 3JS6A 2OEMA 1VC6A 3ZDDA 4K4HA 1UZHA 1U0HB 4R63A 3TZXA 4DL4A 3JB9k 2DH9A 1NKCA 5AI4A 4MDAA 2OCEA 4L72B 2R4FA 2X1AA 4XPCA 1JL2A 3ISCA 3WKDA 3QLHB 3AVJA 3FQKA 4DL0C 2GHVC 5U47A 3UDEA 4MEYA 3FSIA 2KJ5A 2O67A 4FJ7A 1XMOK 1YJ9S 2LYAA 5DB8A 3FE1A 3G6XA 2FVCA 1BPDA 3ZTSA 4EAHD 1Z6RA 1NBWA 1DQ8A 2J0QD 1SKSA 4U7CA 4TVAB 2ZH4A 2Q0ZX 4ZH4A 1MQ3A 5AXMA 5CCLA 5AKYA 4AQYJ 2I5HA 1NB2A 3WDOA 3CM5A 4IFYB 4V19J 3DYAB 4TU7A 3BGRA 2C28A 3UO0A 3R9KA 3AVAA 1DAXA 4AHTA 2BE2B 2CUYA 1BCOA 3CPWM 3G4SS 1S5ZA 4IYQA 3ILLA 4K8XA 2GC8A 2JVOA 1R0CB 1WD6A 5IWAJ 3QEAZ 2E1CA 2B4JA 4FPBA 5B0FA 5KFPA 3H4DA 3FNNA 3MAAB 4CDIA 2Q4TA 2LEAA 4BE2A 4FM1A 1FDBA 1R27B 1YX2A 3S41A 1S72N 1RDUA 4CI6A 7ICSA 3ISBA 1HQUB 3MPDA 2CGJA 5ALDA 5C42B 1D5AA 3SMPA 3BJYA 3Q8LA 4E1MA 2PMHA 3RB3A 3HPGA 1WUAA 4A48A 1TAQA 2EX3A 2ADBA 4C1NI 2LYHA 1D8ZA 4OZ0A 1FK9B 3CJ0A 5GAEP 3D0HE 3NVZA 3NGRA 4LFAK 1E4GT 1LW2B 3QIOA 3U1MA 2HHHJ 3TUZC 2A41A 3K9KA 4UARA 3UM9A 2ZWOA 1NOYA 3NDKA 5GMKa 3O0FA 2P9IB 3HRDD 4QYZK 1X4GA 4PRFA 4AQYF 2G0CA 3PO5A 2HNYB 2W2QP 2VQEK 4BRMA 1T9YA 3WX8A 2HBRB 4XIUA 4J2AA 2CKWA 4AXJA 3H0MB 3O1LA 2NO5A 3HD1A 3B0XA 4O5CA 2BGWA 3G71S 1E4FT 1X9JA 1RI7A 2IHMA 1SKWA 1N5TA 1YJNS 4CLFA 2F7TA 2LPEA 3C3LA 5IWAF 2HOFA 2FJDB 1VSMA 2VFVA 2HBLA 4CNQA 3UQ2A 4E7IA 4W90B 2P9NA 4BE0A 2ZHBA 2H9ZA 5IIMA 1HJRA 1RAOA 5CYQA 4A46A 2KN4A 1CEZA 4PGQA 4DCHA 4FKXA 1NI3A 2HK2A 1ZQGA 3NH0A 2W9AA 1RBLA 4IOAL 4LF8J 3O1WA 3VGVA 2V4QA 2X51A 1Z05A 1A5XA 4H4OA 3C46A 1TL1A 3AT1B 2YMMA 3E0FA 3NH2A 1N5YA 3HM8A 2I6XA 3V1QA 2WVFA 1SBRA 3QNNA 4LF5J 1Q0NA 3ZYYX 4LF6K 5DG8A 4CT8A 1C0UB 2POKA 3MR6A 3O5TB 3A5OC 3VQQA 4Z4HA 3TR8A 3H7IA 1JXBA 2DNQA 2JGAA 5LJ5Y 1QAJA 2G07A 4BGDA 1JK9B 3G2XA 9ICBA 2R8HA 4LJXA 2IVFB 4L3NA 4ZVQB 2XMMA 4MQ3A 4YY3K 4O0JA 5HOOA 3S8SA 1L6NA 3TTFA 3CMQA 2BR0A 2XS2A 5AM5A 2WONA 4WU2A 4E89A 4OI2A 1Y7PA 4BS2A 4QWDA 2FXUA 1UAXA 2E8PA 4I2HA 3EW9A 3MN6A 2JXJA 1YTAA 1NBEB 5D0HA 3EPGA 4DV3J 5KL1B 4FNIA 3ATVA 4B8AB 2YKPA 2HSTA 4NI2B 1Q82O 5J0RA 3A5NC 3IHQB 1SQFA 4RU2A 3D4JA 2UVUA 2KG1A 4B1WB 5T7LB 1KVAA 3U26A 1NKBA 5IXUA 4DCJB 1N34J 3SCIE 1ZTTA 3MM6A 4UB6U 4LF8F 4JKGB 1Y3JA 4OIXA 1HD0A 2HHUA 4KHSA 1A5VA 1LWXA 3PFOA 2RUGA 4LRDA 4Z0UA 4BY9C 1HNIA 3MMBB 1ZQEA 5LMUJ 3MXIA 2LA4A 2RJZA 4OHWA 3CETA 4M3RA 2J8SA 4R5PA 1G7CB 3LGNA 3FSXA 4A8XA 4U67Q 1UVKA 4USVA 1IO2A 4F4XA 3BYRA 4IEIA 3LDOA 1YZ7A 3KLGB 2FHJA 4E7LA 5A2QY 3SZ2A 5AK4A 4O5FA 1L7NA 4FJ5A 5D3GB 1APSA 4ZVGA 2M8HA 3K9JA 1WN7A 2F8MA 3O3LA 1R0AA 3BKTA 1IG6A 3DLKA 1SC1B 2DRBA 3IR7B 1XBWA 1Y5LB 5DMRA 1R8HA 2AJ4A 2A3ZA 4R66A 2OPPA 4I2AA 4BLGA 4DV3F 4NO7A 2ZM6K 4K0KJ 4QIEA 3CYMA 1KOOA 4K4WA 4O3PA 2YQ1A 1KHVA 3ZSVA 4BR0A 3IR5B 5DQGA 4J5OA 1HYVA 1AW0A 4PZVA 3ET6A 3NCRA 5J2GA 1HQEA 5HK4A 1R8AA 2VC1A 1N34F 2VHGA 4DR4J 1JKHB 2PMZD 3VQPA 2ZIWA 1CJVA 4ZMMA 4KLGA 1RU2A 4GMJB 1N6QB 3L95X 1IWAA 4M5DB 2DPJA 3A13A 1ZJNA 3C15A 4B3OB 1AUSL 2AZ3A 4LF2A 1KOHA 2XO6A 2ZJ8A 2HHQA 3HJVA 2BM0A 1JJ2R 2OHDA 4MTPA 1NOMA 3LDQA 3Q0AA 4LSZB 1Z26A 2R8KA 5AKZA 1AXQA 3R7SB 4C4TA 4WTYA 7ICTA 3EUNA 4ES1A 2K1RA 4UB3A 3CFPA 4X4SA 4A47A 2MQPA 4ZCLA 3G8SA 3MM7B 4OLOA 2B56A 3OBWA 4HTJA 1ZRNA 4PH5A 3W1YC 4H0TB 3LAKA 3DJCA 1HNXK 1QQ5A 3IFRA 5JTIA 3CC7S 2EZXA 4K0KF 4I6MA 2QARB 1SC3B 2RHFA 4NLKA 3ED5A 4CHQA 1CLQA 3ATUA 2MZQA 1IG9A 1NK9A 1T6CA 4E3SA 4C4WA 2NYIA 2AHOB 5KOXA 4C80A 3D54A 1HHTP 5AXNA 4B3SJ 3NS6A 4DR4F 1ZM3A 1VSDA 3M1VA 5AQNA 2AMCB 4ZCIA 6FDRA 2YHXA 2DFLA 2IHR1 1PGZA 1F5BA 3EJMA 1JLCB 2KVIA 3IM1A 4YR3A 5J0WA 1RT2B 4BE1A 2YNFB 2VDIA 2E5JA 2AJFE 7FD1A 2I1RA 4DPOA 4GC6A 2ZHAA 3MDQA 3H1QA 2FE9A 2HVEA 3VQ5A 3SXLA 5J2QA 4IS7A 1R31A 3H3OB 2HDOA 2YX8A 2FSKA 3KKSA 4X4VA 2EVZA 3W9IA 2E1PA 4NCBA 1VBYA 1HKCA 3PR4A 1GXTA 4FS2A 5J29A 5KPZA 2QLXA 3D2NA 3OLBA 2EAMA 2JFDA 3SI8A 1HPMA 1MDUB 2G1DA 1MWQA 1AQ6A 3HHLA 2CZVC 4G3IA 1MWYA 3QBCA 3Q86A 2YHWA 3ZNUA 2G2ZA 3O9UA 3VEWA 4J9VA 1FFSB 5HBMA 4B1YB 5CYMB 1YJTA 2HHPA 2B5JA 4M5KA 2ZUCA 2R2RA 1NNDA 4B8CA 1NPRA 2O3DA 4LC9B 1KLMB 2WB1C 4B3SF 2V4RA 1B99A 2LXIA 4IG0A 1Q9XA 3A12A 4ECUA 3JSBA 5FIIA 4JKDA 4BVOA 3SK3A 1N33F 3SEOA 2PBDA 4P0QB 2KL8A 3QEIA 3FZLA 2F8HA 2R8JA 5D46A 3KOAA 4QS7A 2LXFA 4IOAQ 3DKDA 2BHNA 5KFKA 4ZLNA 2K8BB 2CPXA 1B4SA 2DKZA 2GLEA 1FRKA 3MR7A 3FYHA 2W8LA 3TJAA 4J9OA 1X40A 2FIUA 3Q8QB 1P90A 2KFZA 3VCDA 4FLXA 4FSVA 8ICKA 2AYBA 4EYHB 4ZLLA 3SJHA 4BR4A 2CDQA 2CN1A 3M6UA 3TJ9A 4M0AA 3UR0A 1ZQTA 1PIEA 4F2SA 4DTRA 5HVFA 2GV9A 1RU1A 4USMA 2W4PA 5KFIA 3Q22A 2QA4N 3WXKA 3GR1A 4OPAA 3R3TA 1TL7A 1RWXB 2NS1B 1VQ5N 1SV5B 2DPNA 2GNKA 1XR6A 2W9BB 1Q8KA 3ISDA 3B4DA 3PIOL 1WC4A 3R27A 5GAHU 4RQ6A 3QGHA 3VAJA 1CC7A 2FY8A 4EIAA 2WHEA 1F0XA 2D0BA 1FJGJ 2UV8G 3HPHA 1ZAXA 3QB0A 2CVEA 2WF7A 3SQ4A 4NZ0A 4DR1K 1BGXT 1QCKA 1IWGA 1U1OA 2X74A 9ICIA 6AT1B 1MLAA 1SB3C 4KAIA 1LCUA 2XZTB 4AM7A 2B51A 5DS7A 4PG7A 5KG3A 5CZ2A 4HUGA 3K8WA 1HYSB 4YMMA 1IR0A 1UTAA 1S4EA 3RU0A 1I5OB 3MF5A 4NLNA 1ITGA 4BC3A 2P6RA 2RRNA 1H38A 4PXBA 3ZTOA 1N8RO 3QWUA 2QTDA 4JOUA 1KXPA 5CAAA 2P9KA 3C6AA 3EO3A 1RJJA 2Q3PA 4RLEA 1C6VA 1RQ0A 2Z1GA 4CJTA 5IT4A 4CO2A 2YBVA 3LPTA 5D4LA 2ATQA 4JB3A 5A8RB 2IRXA 1WSGA 3TEHB 1RTIA 3UPFA 2HIQA 2GWKA 1YGYA 3QMQA 5EDWA 5CYJA 4PWDA 4KLEA 3AQFA 3KJVB 1FJGF 2ZDOA 4YB1P 5FP0A 3OXGA 2ZH1A 1EWQA 1YWXA 4QIGA 1KQFB 3ALRA 2ACMA 4Z4CA 3TSQA 4FK0A 2PO4A 4PHEA 5IIJA 5E2QA 3L2UA 1FVQA 1NM2A 2H3FA 4BQZA 1RA7A 2RRBA 3QICA 2NR0A 1DY3A 1P1LA 3ZZTA 3QSIA 4KTQA 3Q8PB 4DV5K 8ICFA 1JX4A 3SJJA 1BY9A 2ZGZA 2CXEA 4RPYA 4PJ0U 3KWIA 2VIHA 4LF4J 2WTUA 1UT5A 3OVBA 3OA9A 1DLOA 1VQ7S 4JHDA 2P9SA 1HR0J 2LMIA 2O66A 3FFKB 2ILZA 3CCSN 4EELA 2G08A 4JI6J 2HLTA 4IQXA 3HKZF 3M8PA 4O0IA 1XSNA 2YX4A 1ZQMA 2EPIA 1U25A 2DHSA 3IMQJ 4O55A 1Z4NA 1D8YA 2YPYA 3VQAA 5HVGA 3WNHA 1WWVA 3GDXA 1ATRA 4K4UA 1JNRB 3P31A 4JI8K 4QW8A 1T3NA 2E66A 4LFCJ 2P9NB 5E3RA 3IRUA 4UAZA 3V6DA 5AFUH 5KG6A 1L7MA 5CYQB 4QIWC 3RZAA 4JI4J 3HJFA 5E26A 4KN4A 5LMNK 1LFPA 3QNOA 1TK0A 1X9WA 1RHMB 1U1KA 4O5EA 3W0LA 3HWTA 2CQHA 3V9SA 3PSIA 1XHXA 4BC4A 4H4OB 2HS3A 2B43A 1TL1B 3HHKA 1N5YB 3L6QA 2XZWA 2QWMA 3G6EN 4DPXA 3TABA 2RP5A 3O3HA 3VQEA 2UXDJ 4H8KA 4CIEA 4HI1A 2CRLA 3BV8A 4YOEA 4ZOHC 3GJRB 4LF4F 5GMEA 3MGJA 3OYHA 2VOPA 2FC0A 4XQ8A 1L3TA 1QVFR 2DKXA 2MXYA 1HR0F 3P38A 3NVYA 1Q9YA 4KB0A 4ZVOB 4YUDA 3LDAA 8ICZA 4Z7CA 5AZIB 2QWNA 2WONB 1T05A 4OI1A 3VQCA 2W24A 3DXSX 3DOLA 2ILYA 8ICYA 3TADA 2JWLA 2H3GX 1CQMA 2GMLA 5DM7L 4LFCF 2CPYA 4JI0J 1N32J 2YQ0A 2N3OA 4JI4F 1OIAA 3IGNA 2WB1F 3C65A 2IM2A 4H0YB 3D2FA 1P9YA 4KLQA 2BJEA 1S9GA 1S1UB 3MM6B 4DUZJ 3IKMA 1FFVA 4C7YA 3AAQA 4BG9A 4B9LA 2FJXA 2V7YA 3GPAA 1FKOA 2E20A 3D1QA 3TWHA 4Z6DA 2VANA 1X60A 2ZC4A 1S5JA 3BR8A 4ILRA 3OUYB 3CCVN 1X4CA 2E5GA 1H7WA 4HL9A 4WP3A 5KFSA 2UXDF 1JL1A 4R5PB 2KDOA 1WACA 1IUJA 4M04A 1XR5A 3EKSA 2AYMA 2ZGYA 2CFXA 2YMPA 4OJ6A 1ZBUA 1T9WA 3SSQA 5A76A 5AQZA 2BE9B 2L9NA 4UUWA 3RBXA 3K4GA 3FCHA 4O5BA 4J9RA 2IJRA 3EDQB 3DLKB 5DDRC 3G6VA 2EFGA 4ZKAA 1HJPA 4MKAA 4U8YA 1NU0A 2GA7A 4LT6A 2XSFA 5K20B 2W6LA 2DXFA 2OPPB 2W25A 3WC2A 3EZ5A 2ZKUA 4J9PA 5K8OA 2BJ9A 5D4PA 2UYTA 4OL8A 3PIOQ 4Q2LA 4JI0F 1TQLA 1IBCB 5KT6A 3G9CA 2VL1A 1N32F 4QJVA 4EBCA 2LCWA 2F8SA 1HQEB 2J7KA 3JQJA 4JEPA 4KMOB 3N7RC 1RWOB 1TVAA 1PSDA 1KCFA 5FROA 4DUZF 2ZIWB 1CJVB 1CXUA 4OX9K 4PG6A 2CXYA 3H8JA 2AJQA 1HWUA 3D3BJ 3Q8RB 2JMGA 4CJSA 2EEYA 4DV4J 4FO6A 4FNHA 1WNSA 1RHQB 3CJBA 3GIKA 2Y0SD 1BQXA 2V68A 3VQTA 1V97A 5CD4H 2H4WB 4DL2A 3CXCR 2RQ5A 3N97B 2P9LB 4OZNA 2K1RB 2RD5C 1JLAB 1YG0A 4E7JA 4M5NA 4M9GA 3MOJB 3RVCA 1JN3A 3CD0A 3GQCA 3EICA 1A77A 3NVWA 1IR2A 4NEZA 2FZCB 5AIBA 1S0VA 1KQGB 3HOTA 1IKWA 4C3KA 4ER8A 3ZC4A 3V4IB 2A2CA 2BKNA 2V7ZA 2MKCA 1B0VA 2C2KB 2HMPA 2G9OA 3PO4A 4LMZA 4CDGA 5DDMA 4K7QA 1AA1B 8ICUA 4KPCA 1Z1ZA 2VA3A 3SENA 2ZE2A 5I4MA 3Q8VA 1VQ5S 2XI3A 1F5SA 1ZETA 3CO9A 1WUUA 2H3QA 2GFFA 4KH1B 5SWMA 3SQIA 4ZVUB 2DITA 3OTCA 4WQ5A 1X7VA 1F2HA 4B3MK 1RAGB 5KFMA 5A2QU 4Z4GA 1NM1A 3OPXA 1RZTA 4B1VA 3P39A 2YTCA 4DV4F 3UE2A 2ZIXA 2HQGA 5AJ3J 3D68A 3AVHA 3LGHA 1XO0A 2EFOA 2B9YA 1XIQA 1GT8A 2GVDA 3QEVA 1VHXA 3LP2A 1R43A 2NREA 5J1PA 9ICLA 1FX4A 4KH6A 3L4BC 2FBTA 4XA5A 4C7QA 5BRFA 1FE4A 2LM1A 1RYSA 2VPYB 4HH0A 4F7VA 2ABYA 2KXNB 3D67A 4AXIA 2E5LJ 1T44A 2C3MA 2E1YA 1NNLA 2MTLA 4WZMA 5AQOA 1X4AA 4FWNA 3OYEA 3A4TA 4CFDA 4QCLA 1U2RA 3L5KA 3V7LA 5HBMB 2UUBK 2KHVA 3QWPA 3O9SA 1C1BA 2GBZA 3K17A 3OQ2A 1XUPO 4IG3A 1BUPA 4TY8A 2I38A 4KBOA 2BCSA 4H0OA 2HWHA 4RW6A 4OKJA 4KB7A 3BPDA 2QYGA 1RTHA 1R8BA 2HFZA 4IG0B 5C2GA 1MNEA 3DXMA 4YHHK 1N5QA 4KV8A 3TARA 1X0PA 3GFHA 1GEHA 2CJ9A 1KVIA 4CJ3A 5M1OA 2F3NA 2OPSA 1XU4A 2WHOA 2GIFA 1V5VA 4WQ4C 9ICOA 4PABA 5AJ3F 4AYBF 1NLVA 3CE8A 1S1WB 5BOMA 1ZBHA 4Y0WA 3PZPA 1A5WA 2VGMA 3QGIA 4CLKA 2HBQB 3C6TA 1AFJA 3N6MA 3WK7A 4ED3A 4DV1K 4O8KA 4W4MA 5JJBA 5EE3A 1IKVA 1BPXA 1JB0C 3C2MA 1S1XA 1RT3B 3CJSA 2OTJN 2E5LF 1ZS6A 3QFHA 4DLEA 1RWUA 5HHIA 4R8UA 4Q8EA 1WSHA 1VK0A 2XGQA 1Q81O 5M1QA 1XMQK 4QZ9A 1YBAA 4P2MA 1GK8A 3NMUA 2P66A 1X4FA 3WQPA 5DBBA 1X6IA 3TACB 3HI9A 3VPZA 3M30A 1YIJN 1TK8A 3RG6A 3S1TA 2G8HA 3TJ8A 5GADU 5DM7Q 4IH6A 5D77A 2FJBB 2RKIA 2G09A 3R6LB 1SPBP 2EBEA 4JV5J 2VB6A 3J7AP 3TVKA 3V7KA 2BJ8A 3UFCX 1H2TZ 1ZA2B 4RNFA 2W7OA 1XWLA 3QZ8A 1RWPB 3K59A 1PAUB 1UFWA 2A3VA 3WX4A 4JKFA 4HH1A 2NRRA 5HMLA 4F67A 2BCVA 4DFKA 1FF2A 4UB8U 2ASYA 5T7BA 1RDBA 2H3IA 1W97L 4LSNA 1G6BA 4WTOB 2PIIA 3DC2A 1TFYA 4FWLA 4DG1A 4CLTA 3KK1A 3UDLA 3AQPA 1RG6A 2ZH6A 4H0VB 4X4RA 4ITSA 5AT1B 2FYXA 1FNMA 3WU2U 2LLZA 2BUPA 4K4VA 4C11A 3NUQA 3Q2TC 5IT9O 1HI1A 2GX9A 4C3MA 3R97A 4KPYA 2V8HA 1N48A 4PPXA 2CH6A 1VR6A 1SH2A 2GQCA 4K4IA 5AK6A 3Q89A 5AQTA 4X66J 2P9KB 2P6TA 4F5RA 4CF0A 4MK7A 5HMYA 3HTVA 3PJWA 5D4BA 3NE6A 3O9QA 1TVRA 1RAAB 4I27A 3MDCA 1GLBG 3H4BA 3OJSA 1RTIB 3A3OB 2O8EB 2Z2YB 1EX8A 1K1QA 3KWMA 3QE9Y 2PSZA 4YR2A 1TL4A 3NKYA 3UDCA 4JV5F 2E5IA 4OI0A 5CZ1A 2MSNA 3F41A 1KVJA 2KVSA 4BRIA 5J2HA 3MEEB 2FC8A 9ATCB 4YOWA 3UKUA 3OHBA 4M63C 2A18A 2HZAA 5KG4A 4DSJA 5IIOA 4GRSA 9ICHA 2UXCJ 5EOYA 2B6GA 4GMKA 2I5JB 4C8OA 1OO0B 3PG9A 1REGX 3UDVA 5M1NA 3OHAA 3H90A 1WG1A 4MN4C 2BXJA 4UW9A 4BGAA 1WELA 4RO0A 4N77A 4RQNA 3CCMN 1SIJA 3C0BA 3HO1A 4RCHA 5HP4A 3RFAA 1XS9D 4IKFA 1JNZB 5AIAA 4CGFA 1NEEA 4EFAC 5K8PA 3BSAA 4JYAJ 5CQGA 3P6YC 4NX9A 1H6KX 4I9LA 2J5AA 4OCZA 5AQUA 1TGOA 1BC6A 1SQKA 1DLOB 4IQUA 3PW0A 2CGLA 3QFWA 4X66F 4JHDB 2P9SB 1WAJA 3TFSA 2W3RA 2UXBJ 3IO1A 3CNHA 3P3DA 2H65B 3WEEA 2ZBPA 5ALNA 1KTQA 1DRGA 2Y9HA 3Q8YA 3PYFA 4KI6A 3L3FX 1ZQOA 3AA2A 3JQKA 4NM2A 1S1VA 4FXVA 3J7YU 4ZPBA 2VKRA 1CSJA 3BDPA 2XS7A 2C1EB 1E6VB 2AX1A 4IDHA 2AJ1A 3AN1A 2L9DA 4PGXA 3MM8B 5DO2A 3IBCB 3V6DB 2LQBA 2RQMA 4DX7A 2VBYA 1K0TA 4C8YA 2QT7A 3P4IA 1Q46A 2VWBA 2UXCF 3MXHP 5M2PA 3OTOJ 3BYPA 1VQ8N 3ENQA 3B54A 3M1YA 1B0TA 2JWNA 3HI0A 4RW8B 2KSOA 3MPUB 3QYYA 5C7PA 1YI2N 2VQFK 1YJ7A 4BRAA 2M88A 3IRWP 4AHVA 1RA6A 3S7RA 2QI2A 5DQIA 5TZVA 1NZPA 2L9WA 5DLGA 4JYAF 3F2CA 2E3TA 3I56N 5HQ8A 2CJKA 1IKXB 5AI9A 4FPAA 2JZ5A 3ISNC 4Y28C 2PC6A 2UXBF 4CT9A 3M7DA 1G3OA 5ALMA 5GAEU 4PHPA 4PKHA 1T05B 4N56A 3IWNC 1VC5A 4BR7A 2HSEB 1BD6A 1ZD2P 1WSFA 4NYNA 1A6LA 3KKRA 3BBBA 1KONA 2IRYA 1ZTWA 3DRSA 3IUCA 1VK3A 3ETLA 1K9MT 2YV0X 4YMNA 1XMOF 3H6EA 2PFUA 4LFAJ 3U9DA 4KRFA 1UT8A 4FZXC 4YMEA 3VVTA 3QUQA 2G06A 4A8YA 4HHUA 3R1LA 2V34A 3HFKA 1MSWD 1S9GB 4QZEA 2E5SA 3H42A 4K59A 3OW2M 2J6TA 4QYZJ 2G2YA 3MURP 2VQEJ 1HI0P 1FKOB 3UE5A 4QZAA 1IN0A 4X64K 2YWWA 5KAIU 5ALKA 4MIWA 1HBOA 2DNGA 2JHEA 2VFRA 2XCAA 4FJXA 1WDDA 4QWEA 3OYLA 4WXWA 1RTZA 2R7UA 2ZUGA 4OV1A 1RGIA 1VGYA 2MSSA 4CFBA 8ICJA 4DXLA 4LQ3A 4XAKA 2Z2ZA 2AQ0A 3VQSA 1CVJA 2N82B 1GX5A 2KU7A 1VIOA 4J9MA 4DOZA 1RCXB 1NK4A 4C0ZA 4KITB 2JV3A 1NCLA 4CEQA 4U7BA 2LQJA 4XH5A 8ICXA 3V4MA 1DTQA 4KJIA 2G5HB 3MWPA 2LYBA 3UXOA 2KT5A 4XDDA 1RYUA 3BREA 8ICPA 2EAOA 5KQ8A 2DRDA 1TFWA 3SV3A 4LF6J 3SD7A 4LFAF 1L8LA 2F1JA 1FE0A 3VF2A 5FRNA 1ZBSA 3VQDA 1FD8A 3S6JA 2QB1A 3HL8A 5B09A 3T19A 4ELVA 2VC0A 2BZ2A 3AO3A 3LDSA 4RBUA 3RAMA 3AJ1A 2CQPA 3M6GA 4AQYK 4M2YA 4QNLA 2W2OP 2VQEF 1QZ5A 1Z1BA 2GAHC 3NMAA 3TAFA 4JKAA 3TTDA 3CQXA 1JLEA 1Q8IA 2GWJA 3Q83A 5F8HA 4Y2KA 5HRRA 1RAIB 1QZ6A 2BEFA 5IWAK 3O1BA 2JEFA 2YKNA 3CP8A 3F56A 1NG9A 4KLFA 5AQVA 3IG8A 3R5JB 2YNHB 2JRSA 2W03A 4FBTA 3RB6A 3KLIA 2NYVA 2Q36A 1REVA 3RJHA 1IKWB 2E2NA 1FNOA 3TSUA 3SQ1A 2E9TA 1R6YA 1UL3A 1JWWA 4DS5A 4M94A 3CC4N 5CD4A 4F5OA 1QTNB 4LF6F 2CQ4A 2ZE2B 5L38A 2D3UA 1B9DA 3MAQA 3VV2B 2W40A 2HHHK 4FWKA 4CESA 1C0FA 4J2EA 1V3ZA 5KFCA 3J80Y 4PHAA 1MN8A 2AGOA 1G99A 3DDIA 1V9PA 3D66A 1M5PC 4ZK7M 2YHBA 4CEBA 1RBAA 1LFWA 4RU9A 4K2JA 4FM0A 2DHXA 1YRXA 3ZSWA 3UXNA 4WCEL 4TXSA 1AZSB 2ZIXB 4TKTA 3I0RA 2JWKA 1NK7A 4PG5A 3A2FA 1J27A 7FDRA 2ZM6J 2GVDB 4GVBA 3I1YA 9ICMA 3LP2B 2Y1JA 4O3MA 3KLVA 1VAZA 2L48A 1HIYA 1B43A 4FYDA 3QPIA 3T9ZA 4YN4A 3MCSA 2E6LA 1RM6C 2WMMA 2PMZF 1PBAA 2YY6A 3W62A 4UATA 2MLYA 4E8UA 2G0AA 4KGKA 4FJHA 3PEJA 2FDRA 4K4TA 2BKEA 1VC0A 2HVIA 1SV0A 2YX6A 5ETMA 1FRJA 1FJCA 4DZDA 5SUHA 3IR6B 2VPWB 2K4PA 4N8OA 4F72A 1VQKN 4LF5K 1C1BB 4DTXA 4IG3B 1QQMA 4IO9L 3RJFA 2D0PA 3GBTA 3PW7A 3VWSA 2NXNA 2OKQA 3ULDA 4RW6B 8ICQA 4ANCA 4J2DA 3DU5A 1S10A 4X5VA 3H2UB 3ZSXA 3M6XA 1UVLA 1WOQA 1ZBFA 1KLNA 2B3TB 3MX2A 3NGSA 3DXMB 3LO3A 5JMNA 2DR6A 4FKYA 4KV8B 4C7ZA 4M9LA 4MKBA 3CMES 3GZFA 3LAMA 4Q44A 2IIRA 2OPSB 3AXKA 1BPZA 1C4CA 4CZIA 4CEZA 3UWTA 2LU1A 5AQMA 5CWRA 5JU5A 4F4KA 2PFPA 4DV3K 1HNXJ 1DTTA 3UQSA 1XC9A 2ZM6F 3H5UA 4IL6U 3RH6A 5HL7L 4CLUA 4C8NA 5KT7A 9ICAA 2A1AA 5KT5A 3FMBA 2FVSA 3PKYA 1GX6A 2BW7A 3PJXA 1SH3A 1IKVB 3CCMS 4DPUA 1VSLA 4E19A 5CE3A 2BQUA 1N34K 1S1XB 1T0TV 4CK3A 5ALQA 3Q2SC 1HYZA 3EEQA 5KT2A 1FHTA 4QWCA 4RZRA 1P7DA 4LR9A 4CEDA 1NK0A 8ICHA 5A6WA 3ZTPA 5CY4A 1OMSA 3M2VA 1MWKA 1GXUA 3SBTA 5LMUK 1J2NA 1W25A 3THTA 2AWZA 3M30B 3F73A 1Z1VA 2DEIA 1U1QA 3HVTA 1S76D 3M6KA 2VDHA 3RRKA 2OWOA 4MHVA 3V1RA 3B0YA 1HUOA 3J7ZT 4PZOA 1VYAA 3HDSA 4F5PA 1B3TA 4P52A 4IH7A 5C2CA 2R42A 2DCUB 3HSCA 4RUHA 3BGUA 1SIWB 3T5KA 5JLHA 3IC1A 4OO1J 3HHDA 5L9XA 3EWGA 2OZSA 2YB1A 4NLCA 1QQNA 4I2FA 4ISFA 2I2YA 1WKJA 1R8PA 1E6YA 1HNXF 3O6WA 3MCOA 3MC1A 1VQ8S 1JLQB 4R79A 3NRWA 3KK1B 2W54A 2KYZA 1N52B 5AQYA 1FERA 1KFSA 3JPOA 4ZLPA 2F1FA 2GJ2A 4C11B 2BDUA 1O5JA 4DR4K 2LQ8A 1WTFA 3K5NA 1U6FA 4BCAA 2VWKA 3VAMA 4BJQA 2BACA 2B9XA 5DKWA 5MLCV 4H0PA 3VEZA 1VLBA 4DCCA 3IN5A 4O4GB 1W2BR 1BMQB 2W1BA 4O3OA 2HVDA 4JP8A 4NE9C 5BN8A 1TVRB 4W5QA 1NNEA 2MUTA 3PSPA 3AVLA 4UAVA 4AP9A 3ORYA 1SZHA 4P2FA 5BREA 3T9NA 4DX8H 3V2UC 5M2UA 2CQDA 2J9DA 2IFXA 3OR2A 7ICUA 2JH1A 2HNZA 3LZIA 3MUMP 3HHLC 4CE9A 2I7NA 4FYYB 1FTCA 2RDDA 3E3XA 3UKUB 1N0VC 4DOCA 1A9NB 2F7VA 4BUGA 3PYEA 1CXQA 1BHLA 3O80A 1XERA 2JL9A 3NAEA 1WWHA 5AQJA 3MEKA 1B7YB 4MK9A 3X3UA 4NCGB 1L3UA 1NO8A 1YSJA 3KG0A 1U02A 1KQSR 1M5OC 8ICGA 4AD6A 4UQGA 1UHUA 2NQPA 2YKOA 3NF7A 1JCFA 2BW2A 3K89A 2LEBA 5E3AA 2HHVA 3IM8A 2Z2MA 4DR1J 1J2VA 3VAHA 3ZZOA 2VJ4A 3WEEB 1SJ4P 4QR0A 3RF9A 1NH8A 2CNLB 2IYIA 2Y0SC 3ETOA 1BPYA 2RNEA 3R7NB 1S1VB 3PR5B 1LK5A 4RNNA 2F40A 2K4EA 1ZD5A 1A7GE 3FZBA 2KKVA 3TAEA 2YI1A 2VONA 2XYHB 2XULA 1HLWA 4RPZA 4RG8A 4Y2SA 1EO1A 4CZLA 1TELA 3LK9A 3ZT3A 2DEJA 9ICVA 4NLUA 2J0SD 5IT0A 2PA8D 1QHAA 4IO8A 4JMUA 1EX4A 2KSOB 5J0SA 2CPRA 2DYAA 3UD5A 3L3UA 4H5VA 3TU5A 3LOUA 4I2PA 1SJQA 2RRAA 4BRCA 4WCEQ 1HNVA 2MKKA 3THYB 1RUSA 3EMTA 4BXOB 4P7TA 3BF3A 4OJ1A 1FRHA 3SSSA 1BI4A 2LECA 3ILJA 3KFUF 4F3TA 1CG2A 3FJ2A 2NPIA 5CZVA 2FJEB 2YY3A 3MPVA 5E33A 2Y1IA 4HT7A 4DR1F 4NLOA 4NPOA 4PG8A 4KKOA 3ZD8A 2KKPA 4QZBA 2DNHA 1ZYQA 3L0QA 2KB2A 4M5JA 5B0DA 1VRTA 3JTPA 3SAFA 3H8MA 2VPXB 2RE1A 4KREA 3FC9A 3AB4B 4ECYA 5CEHA 3DRSB 3P4UB 4H5WA 4U7UK 2QLBB 2MZTA 3QIPA 4DV5J 2NYHA 4NLVA 2VBXA 2L08A 4BG8A 4LFBK 2MGZA 4BRNA 3ZZUA 1WG8A 2F44A 1FDDA 3CC4S 1DK3A 4CW7B 1H3DA 4OVLA 1DGKN 1BE4A 2DH7A 3TAPA 2KMDA 3N4QA 1Z2LA 1ZQZA 1J97A 3BSCA 3LL3A 5I9EB 3OJUA 3HF5A 2RHQB 2QWPA 1HBOB 2AF6A 3TX0A 2JSXA 2D1CA 5HL7Q 3AA5X 2QWOA 1MROA 1ED1A 1F44A 1FJGK 4BC9A 5E3CA 2ZEJA 3MK6A 3ZDEA 5GAHI 1AUDA 3DLEB 1XN9A 2OIHA 4IRDA 2N7CA 4H0XB 2R9LA 1V6HA 2F77X 4OZLA 1O13A 1HD1A 1WSRA 2RS8A 1VBZA 4JI7J 4GNIA 4DN0A 2C2MB 2XMTA 5J2AA 1DTQB 4A8MP 2V2QA 1KNZA 1KVKA 3SUQA 1T7PA 2OTLS 2VG5A 4DR5K 1UA0A 3RBDA 3H40A 3J80O 1A0OB 4DV5F 3QT8A 4XUSA 3FCVA 5K14A 3L4QA 1RCHA 4U7UD 1Q53A 4YNQA 2V4JA 1E3MA 5E3PA 5C5JA 8ICLA 2GGPA 2HZCA 2CZ9A 1CLFA 2I9SA 2NRZA 2HRYA 1XI1A 4MO5A 4JNEA 4ILMA 3EN9A 2G8UA 5GIOA 4PL1A 2ZH8A 5JLFA 3NG8A 8ICVA 2W2PP 4JUZA 1ZJMA 1JLEB 2R7QA 2HURA 4KH5A 4ZHRA 3KNGA 2EC2A 1DXSA 3QINA 2HIYA 1D3WA 1RLCL 2QL9B 3HT0A 2QLTA 2E6MA 4UOHA 5KQDA 2DD8S 3S3OA 1BOTO 4JD2A 3CT9A 1B0XA 4JI8F 4B02A 4PYDA 4X4TA 1SJRA 1NGAA 2V8GA 3KLIB 2AA4A 3CJQA 1REVB 1UZDA 3I33A 1TL3A 3U7JA 1UEKA 4JI7F 5AICA 1YJWN 5HN0A 4USHA 3HKWA 2HHWA 4F0MA 4YORA 3FEZA 1JLGA 2WFBA 3ZSYA 2P5VA 1ZBIA 5C15A 3CEDA 1OWXA 3DOKA 4C4SA 3BN7A 3M5RA 4G1QB 5EY4A 2FMSA 5ALZA 2BKOA 5BPLA 3EDRB 5K5MA 3RSEA 3CJCA 2BCRA 4L73A 2ZWHA 2JZBA 1CZBA 4UT4A 1K9MO 4CLWA 4NV0A 2VU5A 2Q1NA 3TADC 4JI6K 5J2EA 2DHGA 1PK3A 1ZBLA 2V6AA 1MMNA 3ENWA 1H2UX 3CWJA 2B4UA 4Y2MA 1VLOA 5AKEA 1KKHA 1X4HA 3KUHA 2CQ3A 4EP5A 3DI6A 3C1YA 3RR8A 1XSPA 5FDLA 1HHSA 3R8YA 4C98A 1MU2B 5CA7A 5J0OA 2RQKA 3IXQA 2WVDA 4GVBB 2BANB 2YVSA 4WFYA 3POTB 2E5HA 3ZDCA 2M70A 2Y0BB 4LFCK 1JXEA 4ECTA 4FDFA 4FOIA 1N5VA 2B7BB 4UBBA 3CPWR 1VQ4S 4JI4K 3SLCA 1R7IA 1JJCB 4CIGA 3BZKA 2SXLA 3IG5A 3QT7A 4NMLA 3BZQA 4X4QA 1RBVA 2G2OA 5E0OA 4CJFA 3GYGA 5H2FU 3TVYA 4A2AA 2RSQA 5IIKA 9ICKA 3PYDA 4JK8A 4DR2J 2Y0SF 1H73A 1SWVA 4HT5A 1BISA 4FLWA 2W55A 1NAQA 2XY5A 1FFGB 3NXZA 4OKEA 4OGCA 2AV5A 3D2QA 2BPFA 1VQON 3RJGA 3G82A 2EK1A 1YJUA 1BUXA 4H5TA 1FXDA 4OPJA 3RMBA 1Y10A 5F0WA 5A0LA 2HNDA 4DQRA 1I94K 2KH9A 1S97A 4IZ9A 4RNHA 5ALEA 4OZJA 4CE6A 2Y1LB 4ECSA 2LDIA 3QERA 2P9PA 3OYNA 5ALFA 3NLCA 4IJNA 1DTTB 4EWTA 4PKGA 5ELZA 1PBUA 3B6BA 2HHXA 3OY9A 4WK1A 4CBWA 4LD0A 5EU7A 2JC1A 3GILA 1T94A 1N32K 4IWVA 4Q8FA 2J9EA 2QRRA 2XICA 1Q8BA 2WBNA 5EN1A 1B9FA 1S6QA 3NEKA 2HOQA 1QJHA 4XTTA 3IP0A 3JPNA 4B3TK 4DUZK 3GYXB 1RAJA 4EO8A 3TTCA 4RL1A 2KIWA 4B3MJ 4BWJA 1UVJA 4CGGA 3TAGA 5ALJA 2M4MA 4RQMA 3KLHB 7ICQA 2HFSA 1LAVA 3HSZA 3KLFB 2DVIA 2QM1A 3M2VB 2A0FB 4DJBA 3L2QA 2KN7A 3NP5A 5H9EJ 1X2IA 1N5WA 5LT5A 1QAXA 4IOBA 1MWMA 5F9LA 2AD9A 2YPZA 3HVTB 3ZETA 2G8VA 2P6SA 5B5EU 4UTGA 2OSQA 2MU2A 4P6QA 3OR1A 5D0GA 3BM7A 2XEXA 2GZOA 1HFEL 2EK6A 3OTEA 1QQOA 1LKYA 1I51B 1I3AA 1D8BA 1FRLA 3SI6A 4F2RA 2JFKA 1HWKA 4QIVA 3UD4P 1IQZA 1VQMS 4DV0K 3ZX2A 2R18A 2CH5A 3SDEB 2JH7A 4QQBA 4KH0B 1VSHA 3CFOA 1E6YB 1VSEA 1PYOB 2Q43A 1UVIA 2FF6A 4Y6IA 4WQ5C 2RN2A 4GV3A 4ECXA 2KNJA 1T11A 2UUBJ 2KVQE 5SZTA 5KGXA 1UMJA 1S1TA 1U8SA 1ZOLA 1CULA 4DPTA 1QAIA 2MKHA 3OVAA 2XGPA 4RNMA 2MZJA 5ADZA 5FLXU 4F4YA 4QU7A 2A19A 3TQEA 4AE5A 4QW9A 4I0WA 4ED4A 2NXUA 3UN5A 5LXRA 2CQ1A 5IFMA 1GLAG 1RBUA 4C23A 4YHHJ 4MH8A 4B3MF 4CK1A 3KHGA 4I2QA 4BRKA 4DOBA 4YD2A 3FZKA 3OVNA 4KLOA 1I39A 2EWHA 4QS8A 3W64A 4FVUA 4DV4K 4R0JA 2D8CA 4CH0S 2LVWA 4FLYA 2MUTB 2OM6A 3OSNA 3VQ6A 4DFMA 3HMJG 3CF5L 2EH9A 3TSPA 1LWFA 3OR2B 5C25A 2OEHA 2HNZB 2KLAA 4NXMK 3KG1A 4CM2A 4K4GA 3WQTA 5ALSA 2ZOMA 4DL6A 3VAIA 4DV1J 2MY7A 3QNWB 4KLSA 4DSFA 1J5EK 4CZMA 4NYZA 4F92B 3V6JA 1RXVA 3R1HA 1WDTA 2RB7A 2PFDA 4WYLA 4NWBA 2F9JA 3BQ1A 4PXCA 1XEZA 4OYPA 3NY0A 3SQ0A 5AHXA 3FMWA 5LL6Z 1XR7A 2UUWA 3U1LA 3FCWA 1RT4B 4PG4A 2C2ZB 1XMQJ 2JHDA 2UUBF 3O6QA 3C1ZA 2BE7D 3G87A 2OO4A 3DM2A 4M7YA 3BSOA 2QEXS 1HHQA 3JPTA 1VMBA 3HSTB 2JX2A 3AQEA 4EI2A 3MM5B 4JS4A 4XO0A 1RPLA 2HK3A 4YHHF 2A6OA 2BA9A 3E1YA 1S4FA 1ZQDA 3R5GA 3TW0A 4FF2A 2RRDA 1FRIA 4CFCA 3J8AA 2D3ZA 1YBTA 4A8KA 4KR0B 1WKLA 2YKAA 4DU1A 3AODA 1RTDA 1U6ZA 4IRCA 3CD7A 3CW2C 4HTLA 1NGIA 3GIJA 4OJRA 2RQ4A 4RKUC 3VHQA 3U4LA 4GV6A 2K4HA 4TSXA 2PT0A 1Q3UA 1VQNN 2XY8A 3MD1A 2ZJRQ 3ULHA 3N5FA 3O08A 2HAFA 5JICA 1U2FA 4DV1F 1RWVB 4KLDA 4FXDA 1D1UA 5DBAA 1X5PA 4DTJA 4BC5A 2KJ8A 3NOGA 3J7ZO 3RJJA 4DTMA 1HIWA 3EZOA 2NXCA 3KDNA 5HP1B 4I2PB 1HNVB 4GLXA 5AQPA 1O08A 2FZGB 3F2BA 1XMQF 1SH0A 2NRVA 2XSJA 3CCJS 4FJKA 4NA1A 1BI4B 3G10A 1M5HA 3AO5A 2GMHA 3CNQP 5KFQA 5GTIU 4H54A 4B9UA 1UFKA 2ZG6A 3FK4A 4BREA 4UOGA 1HBUB 3WC0A 4EBDA 2YWKA 1OY6A 3FUYA 4LQ9A 3HPOA 1HBNA 2WB4A 4FBUA 4KGXB 4KKOB 4I2DA 3SCJE 3EE3A 1F6TA 4QIWD 4I56A 4DCPB 3QNMA 4IOCL 4ILLA 1EETA 2KW4A 3W8PA 5DDQC 2HGNA 3CTRA 3Q7CA 3L8BA 5CB1A 1XTZA 3SNNA 4RTFD 3MPWA 2IOFA 5ALVA 3QZ7A 3W2VB 2BYCA 3HULA 2YMLA 1VCTA 3GIRA 3AVNA 2KG0A 4O44A 5D0EA 5BPCA 3VEVA 2MGZB 4UAUA 2FLNA 1ZXIA 4UY8T 3W60A 4IR9A 1TV9A 4WJ3B 4FJLA 4BDPA 1ZQHA 7ICNA 3CCQN 4IFEA 3ILOA 3AA9A 5KG0A 2P35A 1HNWJ 5C24A 2KIVA 4QWBA 2ZBIA 5TKWA 3BZCA 3OS2A 1BQMA 4URQU 1V38A 3A8EA 1NSKL 3ITHA 2OANA 3OHRA 3PFEA 3R8EA 3EGVA 4H4KA 4K8ZA 1FCAA 3VMFB 5DG9A 4DTUA 3ONQA 1NK8A 3KD5E 2H3VA 2JDJA 1D9AA 5IC4B 1MA9B 3GIMA 2DNNA 1X3NA 3KOOA 2IAJA 4K5SA 4RUBA 1HKGA 1VDVA 1YAGA 1OPZA 3CQ8A 8RUCA 1Q79A 1KFTA 3K8VA 2IVYA 4LUBA 2HF3A 3EL2A 2C3OA 4N41A 2ZZNA 1NGFA 2NSCA 1SCJB 1KKXA 1VJWA 1U1RA 3K2PA 2VG5B 1WOOA 2G8WA 2ZTDA 1RHKB 5K14B 3CQYA 3CMAS 3GWCA 2PEHA 1EWRA 3RYLA 3KBBA 2QO3A 2CJXB 2GGPB 1PK1A 4PEOA 1X6JA 1EZZB 3IFEA 1FEEA 1RHJB 4OMFG 5B0CA 1SUQA 2BQ3A 3NRZA 1HNWF 3D2EA 4OJ3A 1WSIA 4DL7A 2YB4A 3LPYA 5J2IA 7ICJA 1N54B 3CJ1A 2A10A 1M5VC 4XPEA 4ZHRB 3EGZA 3NWRA 4FZLA 1RSCA 4B1ZA 3KK7A 2E2PA 2XWYA 2KJWA 4Z94A 4JD2B 1CJKA 4ZJQA 4EHUA 4CJKA 1J53A 4BX9C 2MEWA 4QIFA 3LVVA 4JKEA 1TU0B 2KRRA 1S8OA 3LP3A 4U96A 2QK9A 2XS5A 2YNIA 4EU0A 4YDUC 4DEZA 1GQEA 5MAOA 3V6KA 1M0SA 3CGIA 1U9LA 1NGBA 3TAQA 2QWRA 1VQ6S 4AL5A 2ZH9A 3A8JA 4URSA 1J2MA 3BEGB 1JLGB 4ZVSB 1KDHA 4X64J 5L1JA 4Y2XA 3PTWA 3DOKB 3KZBA 1M5KC 4BC2A 1NDPA 4RT3A 2AT1B 3KUEA 3CF5Q 5J2PA 4DMZA 2ZIVA 4UAYA 2GIRA 4E7HA 1R3NA 3TNVA 1Z4OA 3R6GB 4ED6A 2NZTA 1PG5B 4OLPA 2BDPA 4CO1A 3RSEB 1X42A 4LSLB 1FT8A 3JYTA 2JZBB 3MR3A 1QUPA 4FFDA 3VF0B 1RKJA 3WNFA 4GKKK 4B1UB 5FPDA 2YKMA 1AYEA 1OS5A 3GMGA 4JI3J 2YX7A 4MT1A 4E98A 3WK4A 3QEXA 2JLEA 1GTEA 3DEEA 4KI4A 4NL9C 3DI6B 5FDLB 4F25A 2FPHX 3WKEA 4GC7A 2EKNA 3D0IE 3T5HA 3CCEN 1GXLA 1H72C 1RT1B 4TUSA 3VALA 3DLJA 4KHPJ 2AYEA 9ICQA 4ETXA 3J7YP 4ED2A 4IC9A 2OEJA 3ZDAA 7ICGA 4CO0A 4UW2A 3OTOK 4ICLA 1SJ1A 4J9LA 3UN3A 3T1HJ 2UUCK 3UN2A 4RQ5A 3ZFVA 2VWJA 3UCUP 4EENA 4B6JA 3M8YA 2K4IA 4WU3A 4I7FA 4ZP9A 2OI2A 2V50A 5G0RA 3PMNA 4X64F 1TV6A 3ENHA 4G6VB 2ZF5O 5AI8A 1IJJA 2J0WA 4M5HA 2J4RA 3N4WA 3IMXA 1YT3A 4BDZA 2ITMA 3G82B 2FLPA 3V72A 1LK7A 5L39A 1K8AT 4HACA 1QQ7A 3PLAA 3TFRA 1NXIA 1RACB 2ZITA 3HK2A 1GMVA 4CEOA 4YOXA 3BGOP 3OSPA 2FBXA 2W2MP 3T79A 1IXRA 2JOQA 2A42A 2Q6CA 1QDUB 1EXNA 4PYAA 5GAEI 4KQZA 2CQCA 2NRWA 3J7AN 2PA3A 4FPRA 4ZOSA 1BNOA 2XMVA 2DK2A 1NMEB 5F2RA 3OYKA 3C94A 1TUGB 2NXJA 5J2FA 1U24A 1OH7A 3PUFA 3FBCA 3QO9B 3JSMA 4C48A 1ZM2A 3U27A 5AZJB 4WF9L 3TEGA 1QSLA 1ZQRA 3NRBA 2V8VA 3K1ZA 5IM0B 3QSYB 3MGVA 3LGMA 1W7AA 1FRXA 4BRHA 3OBYA 5F1XA 4IOCQ 5DBCA 3JSRA 3PMLA 5HROA 2BVZA 4NLQA 3RGIA 1U1PA 4CO5A 1TYQA 1T8EA 3MEGA 2ZJQL 2IM3A 3S3MA 3AU2A 2V8PA 5AI0A 4HHJA 4CO3A 5BJRA 3ZETB 2NZCA 1TUVA 4NRTA 5A0YA 4M6WA 3SMVA 3KK3A 4CJ7A 3SPYA 2O6KA 3OR1B 1X66A 4NLPA 3TVZA 1LKYB 4NA2A 3C66A 2IBOA 1U04A 2KZMA 3W5YA 4IRKA 2X1FA 1D09B 1MN9A 3K57A 3MMCA 2A6AA 3D0PA 5F3XB 1WUDA 2N1RA 5AM1A 1BNPA 1VQPS 1FXXA 1UWBA 4O3RA 1D9FA 1SJ3P 2IVNA 2ZH3A 2BQRA 1VBXA 4B9QA 3H20A 3HCXA 1L8OA 3UR3C 3D6HB 1Y3KA 2XO7A 3VZHA 3AEVA 1HPZA 3D1HA 1S1TB 3RW7A 3QGPA 1CULB 3TPQA 2HHHF 4I4BA 1NSAA 3OBIA 2HRTA 4OHZA 2F9WA 5KFTA 4FWSA 1C0TA 2D7SA 5CH7B 5E7OB 4OHYA 5CHIA 3GCWP 5B7WA 4IQTA 2LQ5A 2LBOA 4I2QB 3G25A 3TA1A 4EEKA 8ICRA 1FDAA 2B8QA 5JVGL 3FQLA 1LQ9A 5I3UA 3ADAC 4WIQA 4CTAA 3FGUA 4G1PA 1CPZA 1LWFB 3RJKA 4B9SA 4M41A 4I69A 4JV1A 5EX5A 1SV0C 4F26A 2IM1A 3O8MA 4IDKB 2GJFA 5HR6A 2E8NA 3GIIA 2OEKA 1IR1A 1Z25A 4MIBA 2CQGA 4YR0A 4PAAA 4K41A 2H3EB 5F8GA 1NPPA 2NLXA 2WSFC 3MUVP 2KFNA 2CPIA 1FDNA 2COLA 3AOCA 3THXA 3H0PA 1RCOB 4Y1CA 1Y5NB 1O0PA 5F3TA 2O8DA 4LF5F 4KTWA 3WNEA 2KVCA 4NM1A 3DM2B 3NS1A 2ZDPA 1RZMA 2HGMA 4QOZB 2VYPA 4DR7J 3W8GA 1DJ0A 2DJWA 1O51A 3C14A 2PZSA 4X4NA 4CBXA 3VQ7A 3BBCA 1DKGD 4LJMA 1OSDA 4C0HA 3QBWA 4YOVA 1IKYA 1UEUA 2IY5B 4ILHA 3VN5A 2G8IA 2WAQC 3ZTRA 2YJFA 3IA0A 4X62J 3SCLE 1J6ZA 1UA1A 3NGIA 4I28A 4BVPA 1F1BB 4AFFA 1Y11A 5K8NA 3AD8C 4DQSA 5DDPC 1K6YA 3F5AA 4RW9A 5KFNA 1COKA 4KB1A 3OYAA 2KRBA 4K25A 3CUNA 2PFQA 1XMBA 3V6HA 3M2UA 5CABA 2GCFA 1WEZA 4GVMA 1SZPA 3HFZB 1V4SA 3AB2B 2GELA 3CCRS 4RQ3A 4M95A 2YH1A 4DL5A 4DS4A 4L3KA 4RW4A 2QX0A 4U9RA 5ETTA 4BWMA 2RS2A 1QQCA 5CZXA 3MFHA 2DTJA 1X0FA 4DL3A 2G4BA 1FI4A 1OSCA 2G8KA 5LMUF 2XSJB 5AKIA 4CZGA 2AX0A 2ASOA 3CJAA 4I2JA 3VQ4A 4F4ZA 2D9OA 3AD9C 4HTUA 7ICFA 3BR9A 3NFAA 4UB4A 3V5RA 1KWMA 1IH7A 4MEXA 3R7BB 3LF0A 3WNGA 4P2SA 2K7KA 4CNYA 2YX1A 2KM8C 4DQIA 3VQBA 1ZBTA 4ANEA 2EG1A 1TKZA 4X62F 1EETB 3NCPA 4AM6A 1GMWD 1Y64A 1WC6A 5DDOC 1X5TA 5KFRA 1ZPWX 4Y00A 2EXUA 2F76X 2QN6B 1WTBA 4RPXA 3HZEA 2W43A 2ZQBA 4WK3A 1K8KA 3TAMB 2XNQA 5G5HA 3OFHA 2MYFA 4A4JA 3J7Z5 4WWSA 1U1NA 3SAHA 2XBPA 2OH2A 4NLGA 4PPZA 3N0VA 5J2MA 5DB6A 9RUBA 3GL1A 4YXMA 4GKJK 2GHWA 2V51B 7AT1B 2M5YA 3ISND 2ALYB 4BROA 3EGWB 1VDHA 2Y1RI 5AQKA 1HWJA 5AQXA 1F9EB 1BQMB 3GV5B 4A8WA 1J9AA 2XC9A 3ID8A 4JBCA 5EOZA 1OKJA 2CADA 4AHRA 4Y1DA 3QJPA 2QV6A 4YD1A 3CJ4A 3J81j 2FDNA 4FVCA 2I0XA 3A1YG 4USKA 3MN5A 3RH5A 5HMWA 4X4UA 1DOQA 4Y0FA 4WF9Q 2LMRA 3CCES 2IAJB 4NRUA 3SFGA 4HI2A 5J0PA 3B82A 3ZEUB 2C3PA 4JAXA 1NDCA 1SC6A 2QSFA 1YDLA 2XCPA 3D9BA 3RJIA 2LYVA 1HKBA 3SCXA 1N60A 1GLEG 1WKKA 1C1CB 2ZJQQ 3FZMA 2G13A 2O8CA 1YVFA 2NZ4A 2LSNA 1P8GA 1Q7YT 3J81U 4YB6A 3ZSOA 4E1JA 1KBRA 3W63A 3GV7B 3BKFA 2C3YA 4Q0BA 5KFVA 5DGBA 3SQOP 5BRHA 2KOBA 3P96A 3BEXA 1T9XA 2HPUA 8ICIA 1HW8A 5M2RA 2M8DB 5D4NA 3MR2A 3U1NA 1U2VA 3UQ0A 2ZUDA 5IQQA 5EWFA 2QG9B 3RJEA 4Q43A 2QL5B 2FJWA 3AVIA 3WZ0A 3NF6A 1NH7A 3UD3P 3QLHA 2Z2LA 2MMYA 3KJFB 1T3QA 4CLLA 1FJEB 1S72S 4UOFA 7ICPA 1CJKB 4DSEA 3NNHA 1D9DA 3EM1A 3H3NO 3GFZA 5J0QA 4WIIA 1B92A 4CJUA 4LFBJ 3AH6A 3MCNA 3MMAB 9ICXA 2DUYA 4I2CA 5AXLA 4FPIA 2A1JB 1Z19A 3I9ZA 3U3GA 4NASA 2O8BB 2YWFA 5C12A 3L4PA 5BOLA 3HW8A 4FJ9A 1Q82T 5JVGQ 1M1KO 7ICOA 1FKPA 2KK0A 3BGFA 3RH4A 1WF2A 2BE2A 3ENBA 1SWWA 5J2PB 2D3DA 2FTRA 2ZIVB 4BGBA 1LAWA 2XMUA 4ZPCA 3LA0A 3V81A 4JV2A 1QD1A 3IBFB 2OP5A 4LZDA 5BYSA 3NNAA 2YKMB 4DX6A 3AO2A 1J5OA 3EPIA 2ROGA 3NS5A 4UY8O 1RXWA 2AJ0A 3CCTA 3WUHA 5F8JA 2EZZA 2NV3A 2HQCA 3T41A 5CJ7A 2FGOA 4ICAA 2E1EA 4DOAA 2XHWA 4FW1A 5ALGA 4DR5J 4F5NA 1UETA 4CZCA 2UU9K 4LFBF 3VGSA 1VSKA 4IQVA 3QU9A 4ICLB 9ICJA 3KD3A 4NY8A 3WKBA 1HQ2A 5GTHU 2P9IA 2UV8A 2Q79A 3OYDA 4P4PA 1LOUA 1TMJA 4A62A 4P74A 2A6MA 4YMOA 5G0RB 1TV6B 2R7TA 3BGRB 3WK5A 4Y2PA 3K58A 3GU3A 4L76A 1YVNA 2XZDB 2FC9A 2IVPA 1IV8A 3Q8UA 2BZFA 3RTVA 2WOMA 3B4MA 5C10A 1FXRA 4QZFA 3TZWA 4HACB 4R0EA 4CLZA 4DPWA 3C6UA 4EX6A 1WI6A 2V2KA 2PGCA 1S49A 2FPMA 5ALLA 2E9ZA 2PEBA 2UUAK 2APOA 5CXTA 1S6OA 4NLTA 1A0PA 4TLRA 1RAEB 1GMUA 3KMSA 1NZAA 3WT0A 1F21A 1M6YA 3BSNA 1SJFA 4DR5F