4EZ9A

Bacillus dna polymerase i large fragment complex 2
Total Genus 197
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
197
sequence length
578
structure length
578
Chain Sequence
KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of a High-fidelity DNA Polymerase
rcsb
source organism Geobacillus kaustophilus
molecule tags Transferase/dna
molecule keywords DNA polymerase
total genus 197
structure length 578
sequence length 578
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4ez9A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4ez9A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ez9A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ez9A01
3SPZA 8ICZA 3DLRA 2BKEA 4MFCA 5KRSA 3RTVA 5E41A 3RJKA 1JKHA 3AVFA 1ZQMA 3EY1A 4O0JA 4DU4A 1TKXA 3RMDA 1B43A 4FM0A 1BL3A 3HWTA 3NGIA 5J0UA 4MF8A 3PW4A 4DL6A 1RNHA 4QWBA 2PFNA 4KLHA 3OYHA 4TURA 3HPOA 5KG3A 4JK1A 3GV7B 2GBZA 2X78A 3LP3A 5CZ2A 4CEFA 3K75D 2X74A 3SUNA 5DB9A 4Z4EA 1KVAA 3KD1E 4OKJA 3RB0A 5J2PA 4H4OA 7ICIA 1CLQA 3OY9A 4NLZA 4I2PA 4M9LA 3UXNA 3HK2A 4CFAA 4F5PA 4KKOA 3VQ8A 7ICJA 3DOLA 4KAZA 3HYFA 4GMJB 1T3NA 9ICVA 3KLHA 4DSEA 5HP4A 4DTPA 3MABA 3AO1A 3AO3A 1JIHA 4Q8EA 2ZE2A 3AVJA 3HP9A 4DTXA 4B3OA 2RDIA 4OPKA 5D46A 5KG0A 1REVA 4R64A 4DOBA 3LPTA 3OS0A 4CEDA 4Z4GA 3MR2A 3OYKA 4RW7A 1ZQSA 4OLBA 4KI4A 5JS2A 1A77A 3GDXA 3N4MB 1SKWA 1Z00B 5HNKA 4CGHA 4MEYA 9ICEA 4CJFA 4CF9A 3RWUA 1WSHA 4FVMA 4J2BA 1COOA 8ICBA 2BQUA 3VQEA 3GILA 3HT3A 4WE1A 1DTQA 3PW0A 1NK7A 1QSYA 4M9GA 3BDPA 3MXMA 3OVNA 1RTDA 4I2HA 3SQ0A 3VQ6A 2NRVA 4J9LA 3WNFA 5KFMA 1ZQRA 3G6XA 4DSKA 3VQ7A 2XY6A 4FW1A 4KLOA 2YKNA 4CF2A 3ORYA 5KFXA 3NCIA 2ZUDA 3MR3A 2JEGA 3ZT4A 4CGFA 4I2IA 5FRNA 3NGDA 1U4BA 3KJVA 3ZD9A 3TAFA 4JRQA 4JS5A 8ICVA 4KHYA 3LP1A 2H5XA 4MF2A 4GC6A 4F3OA 4QZAA 4BWJA 4QZ8A 1S0VA 3M8RA 4CK3A 2D0AA 1FKPA 1IKWA 4J9SA 4ICLA 9ICKA 2RKIA 5KG6A 3WNHA 1IKXA 4IFYA 5DBCA 4CCHA 5DK5A 4CJKA 1JXLA 2PZSA 2HHWA 4CJ4A 3RJFA 5J0SA 4E1NA 1I39A 3SI6A 2KZMA 4UBCA 4JLHA 3B6OA 1TK0A 5KFDA 2JZBB 3TR8A 4OPJA 3BQ0A 3QZ7A 3GIJA 3QETA 1TL3A 3DM2A 3MDAA 1ZQBA 4OJRA 3NF9A 4RNMA 2F1IA 3F73A 3CFRA 5KFZA 3DLBA 8ICAA 1HMVA 1U9LA 4TUPA 1HUOA 3ETLA 4DU3A 2F8TA 2A1JA 2ZTDA 1QS4A 3CG7A 1RT3A 3T5KA 9ICTA 2P5OA 2BCUA 3V1QA 3S3OA 3TAPA 4GC7A 1BPZA 4J9NA 4PH5A 4J9KA 1RDDA 3OGUA 3O3HA 4PHPA 3AA2A 5J0XA 2WTFA 1SKRA 4ECZA 4UBBA 4OLAA 3RJJA 1VSDA 5CJ7A 3DLEA 1X9WA 1S10A 4KHNA 4LY7A 3SNNA 4NM2A 2W9MA 4IQVA 1JLEA 4M41A 3U3GA 1SV5A 2C2EA 3ISBA 3LZJA 2XY7A 1MU2A 5KFWA 3KLGA 2PYJA 3OSNA 1Q9XA 2OWOA 2G8FA 4K4HA 1B92A 3KKSA 4CIEA 3DLHA 4CF1A 4Q43A 4AHVA 4DFMA 3QNNA 1VSIA 1KLNA 2C22A 3OHBA 1IG9A 3PW2A 3PUFA 5KFRA 1XHXA 1W9HA 4P2HA 1VSFA 4EZ9A 1UT8A 4RW8A 1ZBIA 1V9PA 2DFHA 3QIOA 5DBAA 3AVMA 5CHGA 5CWRA 2UVRA 2W8LA 4EBCA 5DMRA 4DS4A 3U6FA 1L3VA 7ICGA 1S9GA 4F8RA 4LH4A 4YD1A 5KFBA 1KSPA 4CJVA 1RT4A 4NLGA 3T5HA 3GIMA 2PFOA 3TAGA 3AVKA 1VRUA 4QZBA 1VSHA 4UQGA 4DQQA 1JLQA 3HM9A 3NDKA 4HCCA 1ZQIA 4C8KA 4G1QA 2W9CA 1ZQCA 3RH5A 3AU6A 4MFAA 3JPNA 3LWLA 3OS2A 4N76A 4MFFA 1HPZA 2VA2A 4O55A 4K4IA 1UAXA 1VSKA 4B9MA 3VQ4A 4RW9A 2Q0ZX 3THVA 2V9WA 5L1IA 3MFHA 3Q8SB 4TUQA 4EP4A 2PI5A 5FDLA 2YHBA 4OKEA 4FLYA 1JL1A 4UB2A 4QW9A 4CJSA 1EP4A 3M9MB 4BXOB 3MEDA 3DLKA 3OYJA 4KPYA 4P4OA 2QKKA 5DG8A 3Q8QB 7ICPA 4B9TA 1XI1A 2HHXA 1B9DA 5DKWA 3WNGA 5DBBA 5EWFA 1RYRA 4KLMA 4H8KA 2QK9A 2HNDA 1BIUA 4DFKA 2P66A 3SUPA 4O3RA 1B9FA 3MECA 2JEIA 4HUGA 3EYZA 2OZSA 1ZQVA 8ICOA 3T5JA 4UB4A 1BCMA 1JLFA 4RW6A 3UQ2A 4QWEA 3PX4A 3O3FA 3OYDA 1JL2A 3T3FA 5J2BA 1KFTA 3HX0A 1TVRA 5KG5A 3V7JA 4QZHA 8ICRA 7ICOA 4UAZA 5EU7A 5C42A 4LD0A 3RJGA 3V6DA 4QAGA 4AHCA 1LW0A 5I3UA 3DI6A 3QZ8A 3CM6A 3ZT1A 4CJ5A 4O5CA 7ICTA 3NE6A 4IFVA 1SKSA 3ZSYA 3EPIA 4M6WA 3V7KA 1U04A 1Y88A 3LPUA 2JZBA 3RR7A 4JUZA 4DSLA 4FYDA 3C2MA 1AROP 4NM1A 5CB1A 5C5JA 4PY5A 7ICUA 4Z0UA 3HO1A 1J53A 4ED7A 8ICGA 1Z3EB 3OYLA 4CHOA 3SUQA 3AO5A 2BANA 5KGXA 4CK1A 1TAQA 2UVVA 4O0IA 1BCOA 2F8SA 2KTQA 3NGZA 1UT5A 3PO5A 9ICPA 4KFBA 4HUEA 2AU0A 8ICXA 2KFNA 9ICRA 3ZDEA 3TFSA 4DTOA 1TKDA 3KLIA 4JV1A 1D9FA 2B21A 3EZ5A 4KREA 1ZQLA 4RQ5A 2W9CB 1X1PA 1ASWA 5KGWA 1YT3A 4YP3A 4RQ3A 1ASVA 2FPLA 3PR5B 1DOQA 4AHRA 3MGIA 8ICIA 4RW4A 1QSLA 4J9RA 4I7FA 4YN4A 5DG7A 4CEEA 4MFBA 3B6PA 1GOCA 1CEZA 1RCHA 3MEEA 2IDOA 4BXOA 3O3GA 5KFIA 4RQ7A 5HRPA 1YTUA 1NKCA 1BPYA 3LAMA 1C0TA 5J2IA 2A1SA 1MC8A 4K8XA 1L3TA 1JX4A 4PWDA 4CFDA 1RTJA 8ICSA 4FLZA 3G6YA 4PGXA 4ECXA 5KFCA 4F3TA 3AVAA 3PVXA 1U47A 3HVTA 1EXQA 8ICLA 5HRNA 5BOLA 1Z00A 2XC9A 2GUIA 3CFOA 4N47A 4YXMA 5KG4A 3QEBZ 4OGCA 1NOZA 3FDSA 4DL2A 3SQ4A 1CXQA 4N41A 2DPIA 3V9UA 5DDMA 2IHNA 2ISPA 1HQUA 3O4QA 9ICAA 3HVRA 3K57A 4PHAA 4L8RB 3JPTA 4CHNA 1RT7A 3SZ2A 3MXJA 3H8JA 1ZQJA 5EOZA 1NK0A 2HHVA 1XSNA 4ZTFA 2VG6A 2ZD1A 3G10A 4KHWA 4O44A 4RQ4A 4O3SA 1LAWA 4FBUA 1ZQAA 4UB5A 4IG3A 1ZQNA 4E19A 3S3MA 4DL5A 3NF7A 5BOMA 1U49A 4RPZA 2IMWP 1HYSA 3NHGA 3SPYA 3T1AA 4Z6FA 3TI0A 2IA6A 2Z1IA 4FJ7A 3HW8A 4RUCA 4GW6A 3P83D 1TVAA 4I2EA 4Y1DA 3CQ8A 3HPGA 4O9MA 2IGIA 1XHZA 1K1SA 5IIIA 1DLOA 4MQ3A 1S1TA 2ALZA 4W5QA 3V9WA 4C8LA 5J1EA 2MAXA 5J2KA 1ZYQA 3NGYA 3V81A 2HVHA 4LSNA 3G6VA 2BPFA 2G8WA 4BE1A 4NYNA 4DTMA 2BHNA 1K1QA 3KLEA 2BDPA 2O4IA 4YD2A 3GFKB 5J2DA 4GXJA 4I28A 3RRHA 3HSTB 4FZZA 5F9LA 3TAMA 5JS1A 1NK4A 1RT1A 4R8UA 2LYHA 1A5VA 2DFEA 5KFKA 1NKEA 4DG1A 3M8QA 3MAQA 3ZCMA 5KRTA 2ZJAA 4KN7A 9ICHA 3DYAA 4F4WA 3QE9Y 1CZBA 2GV9A 4XQ8A 4M3TA 2ITGA 3P5JA 3OYFA 3OYMA 2DFFA 5I42A 1DTTA 4FJXA 4KHUA 8ICQA 4ED1A 4FJLA 2ASJA 2YV0X 3L3VA 4ED8A 4QCLA 1HYVA 2R8HA 4ED0A 2B4JA 4UAWA 2Q3SA 4CEBA 5KFTA 4Z4CA 4GXKA 1C1AA 2G8HA 3KIOA 4O5KA 2FBTA 3KHLA 5IIOA 5HLFA 4ZHRA 5HROA 4E7KA 1RDCA 2C28A 1T7PA 3PY8A 4CIFA 1JMSA 2EHGA 2PFQA 1BPEA 1VSEA 3RR8A 4ELUA 4RZRA 3RAQA 5L1JA 1WSEA 1HRHA 1C7YA 5KFSA 2FPMA 2P6RA 2PY5A 2EX3A 3OSPA 4KMUA 4O3PA 4Z4FA 1SUQA 5J2EA 3C1ZA 4CEQA 1WSIA 4Z4HA 3WNEA 3NH1A 3OYIA 2Z1HA 4CJTA 3JPOA 4Y1CA 1ZETA 1S1UA 4KLDA 1NK9A 3QIPA 4FLTA 1A5WA 2FBVA 2XO7A 2PXIA 4I2AA 1S9FA 5KG1A 1ZQEA 5J0TA 2Y1IA 4JWNA 3OHAA 3HPHA 4CHPA 4KB0A 3VQ9A 9ICCA 4XUSA 3H40A 3PW5A 3L2WA 5KFOA 5CZ1A 3VN5A 4FLWA 1ZQZA 4I2FA 2BQRA 1ZQHA 4I2JA 3PX6A 1TGOA 5KT7A 3C6TA 1MQ3A 2DFLA 4FJMA 3DMJA 1JLGA 2AGPA 3RB6A 2RN2A 1S0NA 3RJIA 2C2DA 3ITHA 4PHDA 3MR6A 4FJJA 5TZVA 4QZEA 4I29A 3PMNA 1D5AA 4DLEA 2VWJA 4M3YA 5DQHA 4F91B 5L1LA 4J9PA 3GV5B 3H4DA 2OYQA 1C6VA 2R8JA 1ZJNA 4BACA 9ICWA 3JYTA 5KG7A 2YNIA 4KLUA 4YXJA 1F21A 1SL1A 3OYCA 2HHQA 4FK4A 3KHHA 4W5RA 2QKBA 4UB1A 2WONA 2HMIA 4O3NA 4F5OA 4B08A 2J6UA 5DB8A 3VQQA 2IS3A 5KT2A 1ZQYA 3TARA 5HMLA 2FMQA 3QEVA 3I0SA 1NJZA 2YKMA 3QEAZ 1FXXA 4CGDA 4LZDA 2W8KA 3C23A 4FLUA 3I8DA 4KB1A 1WSFA 4O4GA 2XCAA 4KRFA 4I9QA 4EYHB 5J0YA 2E4LA 2G8KA 4B8AB 4N5SA 4F2RA 4NLKA 3LP2A 5DQIA 4Z4IA 2ETJA 3Q8KA 3NF6A 5HMMA 3IAYA 5J0WA 3ZT2A 3M8SA 3OS1A 4J2AA 2ISOA 4HTUA 1NJXA 3SV4A 1QSSA 3L2RA 1N5YA 5KI6A 3C1YA 1N56A 3EW9A 1TK8A 1RXVA 4BE0A 3T19A 3QESA 4CEAA 1RDAA 4ECSA 1JLBA 5D49A 1K6YA 3IG1A 2GWSA 5KFPA 2AGQA 4FXDA 3ZSQA 2HHSA 4F5NA 4RQ1A 1SL2A 5KG2A 1T05A 3LAKA 1XWLA 1C1CA 2HW3A 4ECTA 3SYZA 4C8MA 3H7IA 2OPRA 5DG9A 5IIMA 1Z25A 1BHLA 3RAXA 1ZQTA 3ZT0A 3M9NB 1D8YA 1VK0A 4M9JA 3A2FA 1S5JA 2HB5A 3FFIA 2P6UA 3TAQA 4ELTA 2D0CA 8ICJA 4KN4A 2FPKA 3D0PA 3IRXA 5CP2A 3QEIA 2OPSA 4YQWA 4BE2A 3UQ0A 2ATLA 1XS9D 1JXBA 1S1XA 4PQUA 3SI8A 1BPXA 4PA1A 3S9HA 1KRPA 1YVUA 4ZTJA 4YMNA 4YG2A 3LWMA 4TQRA 5D3GA 1XU4A 1HUZA 1O1WA 4FM1A 1ZQPA 3NF8A 3G0ZA 2YNGA 4XRHA 1WSJA 1TFRA 4KTQA 4DQRA 4CESA 5KT3A 3VA0A 3DOKA 3V9XA 3MFIA 4F5QA 4CHYA 3MXIA 1G15A 5IILA 3TAEA 3ZDAA 3RRGA 5T7BA 4ED6A 3AVCA 4ID1A 3ZSWA 4CJQA 4FW2A 2OPPA 4HCBA 1KVBA 3V6JA 3P1GA 2RPIA 5D4BA 4KLFA 4KLEA 2FBYA 4KHQA 4ECRA 2VANA 3ULDA 1C0UA 3ZSOA 4FLXA 3ZSRA 8ICEA 2OZMA 1TAUA 9ICGA 5K14A 5J2MA 1SZPA 3C95A 1T8EA 2VA3A 7ICNA 3CM5A 1VRTA 8ICKA 5J2HA 4JS4A 4RQ2A 9ICLA 5J2QA 4C8NA 1Y97A 3C94A 1YTAA 3DRRA 3O4NA 2AGOA 1A5XA 4XA5A 1I3AA 2KZZA 7ICLA 4M3RA 2Y1JA 2FMPA 3ISCA 3ISNC 4BDZA 4Z6CA 5J2FA 4FJGA 1KEJA 3Q8LA 9ICNA 4J9MA 4F5RA 3LDSA 4YMMA 4M3XA 4FBTA 4CE9A 1KCFA 1XSLA 1DGSA 1U45A 4FZXC 3LALA 4B9NA 4KLJA 5DQGA 4OKKA 4M2YA 1HNVA 3C6UA 3LANA 5KT4A 1ZQKA 4Z6EA 9ICUA 3LK9A 4IDKA 4HVJA 3AA4A 2W42A 1JN3A 4M42A 2YNHA 3KK2A 3Q8PB 3BQTA 5IIJA 5JUMA 1RBVA 4B8CA 1BIZA 4LZGA 8ICTA 3T5LA 2FC0A 3IS9A 1BVSA 2ZJ8A 2WOMA 2XHBA 4ECUA 1ITGA 4YR2A 4CJ3A 5J0OA 2W9BB 4Q8FA 1CZ9A 2ZQBA 4N56A 4TQSA 4CF8A 1IH7A 4QZFA 2FLNA 4FCYA 1MQ2A 3MR5A 4HYKA 3BQ1A 5KFVA 4M3UA 3OYAA 3HL8A 2JLEA 3C21A 5J29A 1J9AA 1KFDA 1UA0A 4KLGA 5FROA 2ASDA 4R63A 5F9NA 4CFBA 4CHQA 4DSJA 4IQUA 4CGIA 4B9UA 1N6QA 3B0YA 2ZTCA 1RPLA 4ID5A 4E0DA 1NK6A 2KW4A 4EYIB 7ICVA 1HQEA 4UB3A 4RQ6A 3OJSA 3MDCA 3VQ5A 3HXMA 4IRDA 2FLLA 2R7YA 4LH5A 1XSPA 4YFUA 5HRSA 2QXFA 2BE2A 1EXNA 5SWMA 7ICHA 1S1VA 1HJRA 3SQ2A 5C25A 4DQSA 1CUKA 1FKOA 2HHUA 2A1JB 4CECA 4CJEA 1FK9A 2PFPA 3RH4A 2P1JA 5DLFA 4CIGA 1KTQA 2BGWA 3V7LA 4NYFA 4NY8A 4DMNA 3CYMA 3SUOA 5CA7A 4RU9A 3DRSA 4RPYA 3QEPA 2G8VA 3C2LA 4DTNA 4M3ZA 1W0HA 1BQNA 4K8ZA 4JRPA 1RZTA 1U48A 4M3WA 1KVCA 2Z1GA 8ICUA 4K4GA 2PYLA 4DSFA 3RBDA 4IBNA 2BGGA 3OYEA 4CJWA 2HHTA 5DB6A 4PPXA 1NK5A 4C8OA 4FK2A 1ZQWA 4MEXA 4M9NA 3JPQA 1T4GA 3E2EA 1ZQFA 3S3NA 4Q0BA 1WAFA 3ZDBA 8ICNA 4DS5A 3IHQB 4PUOA 1D8LA 4FM2A 4IQWA 3GV8B 3RBEA 4LVSA 3E01A 2V4RA 3OYBA 4FS1A 1EETA 4W5OA 5DGBA 1L3SA 4KTWA 3ZT3A 1X9MA 1ZBUA 3PV8A 1SL0A 5HHIA 3V1RA 4RT3A 4W5NA 4CGJA 2VA8A 2KQ2A 3JSMA 4CHZA 3KLFA 3JPSA 1ZBFA 5L1KA 3CFPA 5CYMA 4M0AA 2HNZA 1KLMA 4YNQA 3NH2A 7ICQA 4I2CA 2XCPA 5FRMA 3LDAA 1S6PA 1QTMA 3JPRA 9ICSA 4E7JA 4DSIA 5J0QA 4DL7A 2IBKA 1S6QA 5KFJA 1ZQOA 3K5NA 1TL1A 4ZH4A 8ICMA 4QOZB 2XGPA 4NXZA 1R0AA 3PNCA 9ICFA 1VSJA 2BPGA 3LZIA 4ECVA 1LW2A 1LWEA 4LSLA 1ZBHA 2O4GA 3NH0A 8ICYA 4GXIA 1A76A 3UXPA 1Q8IA 1GOBA 4I2BA 9ICMA 4CJRA 3BGRA 1BISA 5KFUA 1RYSA 1BQMA 2UVWA 4EBEA 3EWAA 3H8WA 3ALYA 3V9SA 3RMBA 4AILC 2P5GA 4E7LA 4FJ8A 3HP6A 3V4IA 4E7HA 3L2QA 4CJUA 1JLCA 3MEGA 1WCLA 3KK3A 4FJKA 4RT2A 2NRTA 1S0MA 5IIKA 4QWDA 2D0BA 4DOCA 4IKFA 4DFJA 1WLJA 1H38A 5KFHA 1HYZA 4AHTA 3ISDA 4F93B 2BCRA 2J6SA 3F9KA 1LWCA 4Q5VA 3V6HA 5J2GA 2JGUA 2BCSA 3FYHA 4DEZA 3ZD8A 1Q9YA 2XY5A 3SV3A 2NRWA 2E6MA 4AHSA 1LB2B 4IR9A 1ZQUA 5KFGA 1S9EA 1JXEA 3L8BA 4ED2A 2JEJA 3AA3A 1TKZA 2W9BA 3KTQA 4KHSA 4KO0A 3L2VA 1RBTA 5KFYA 4I27A 3K2PA 3UIQA 4KV8A 4GVMA 1NOMA 4I2GA 4FJ9A 1BI4A 4KLIA 9ICBA 4B9LA 3TQ1A 3B0XA 1UA1A 5KFLA 4I2DA 4IRCA 1IXRA 4IRKA 8ICWA 4PGYA 3V6KA 4TUSA 3SCXA 1T03A 2X6NA 4DQPA 4NCBA 2KZ3A 4G3IA 4RUAA 3GIIA 4M45A 3C5FA 3AVNA 3HJFA 3K58A 4RQ8A 4F2SA 2IAJA 2BPCA 3AA5X 3RB4A 1NJWA 3PR4A 4IQTA 5DLGA 1RBUA 3VA3A 3NAEA 2ATQA 4RQ0A 1BPBA 2ASLA 7ICMA 3KHGA 2B6AA 2AQ0A 1WCNA 4DTUA 1IO2A 4DOAA 2Z1JA 3KK1A 3ZSZA 4P4MA 2VWKA 2AQ4A 5DGAA 4TSXA 2R8IA 5KT6A 5CYQA 3OJUA 1WNSA 1QE1A 4E89A 3L2UA 4DWIA 4R65A 1NOYA 4YMOA 3SJJA 4DL3A 1WAJA 1IM4A 4BGDA 2XRIA 5J2CA 5BPCA 1XC9A 3EPGA 2KFZA 2OA8A 4IG0A 4M47A 2ZUBA 1ZQXA 4RNOA 3LP0A 3QO9A 2BR0A 4KLTA 4KLQA 4KLSA 7ICSA 4F4ZA 9ICQA 1S76D 3GQCA 4F4KA 9ICOA 4ECYA 1S1WA 3QEXA 2KN7A 1QLNA 3RB3A 4O3OA 1X9SA 2XGQA 2YNFA 4DU1A 4B9SA 1EKEA 1RDBA 4QZGA 4FO6A 3SQ1A 2F96A 5HHHA 1TKTA 3NBPA 8ICPA 5CY4A 2IOCA 3AVLA 3TWHA 4CJPA 1X2IA 1L3UA 4R8UB 3ZSXA 1BPDA 9ICJA 4GLXA 4W5TA 5EWGA 3DLGA 5HBMA 3K5LA 3AVHA 3RJHA 1VSMA 3ZDCA 3KHRA 2J6TA 1J54A 1LWFA 1Z26A 3QLHA 5KFEA 1NJYA 2RDJA 4OVLA 4Q45A 3TFRA 4IR1A 4Z6DA 3ZDDA 4UAYA 4KI6A 1VSLA 4YR0A 4P4PA 1C0MA 4OGEA 2A1RA 4EBDA 4R5PA 3AU2A 5L9XA 2BCQA 4M9HA 1BI4B 2X6SA 4E1MA 1B22A 5J2AA 4PHEA 2AJQA 3IM1A 9ICXA 4O3QA 2V4QA 2FLPA 4E3SA 4M04A 4CEZA 1QHTA 4Q44A 4DO9A 3OYGA 2YHAA 4F50A 1JLAA 3PMLA 2ZTEA 3AUOA 4RPXA 4YVZA 5HRRA 3OYNA 1ZQQA 2DY4A 3M8PA 1ZQGA 3UXOA 4DL4A 2E6LA 5KFAA 3UPQA 4CJLA 4CK2A 3C5GA 1LAVA 3K4GA 2FBXA 2MUTA 2B5JA 4KITB 3K5OA 2RF2A 1ZBLA 5HP1A 3GIKA 3RMAA 4BWMA 2NRZA 3H8SA 7ICRA 2F1JA 4FJ5A 2ZUCA 4X5VA 1ZJMA 3VQAA 4HHTA 2UVUA 4HUFA 3RMCA 1RT5A 4QWAA 2HVIA 3MGHA 3V1OA 4CERA 1XO1A 3VQBA 3AO2A 5J0PA 5J0RA 4KLLA 2FMSA 1RT6A 3QEWA 3VQDA 4DQIA 2M9NA 1IKVA 2C2RA 3BJYA 4AHUA 1KDHA 4FJHA 2ZJ5A 2VG7A 4QW8A 3TABA 1IKYA 4RG8A 4DTRA 3U3YA 3JPPA 2JEFA 1D9DA 1RBSA 1TV9A 1ZQDA 4FJIA 2DPJA 4F4XA 3VQCA 4DF4A 1BGXT 2D5RA 3N97B 1RTHA 1WN7A 3QERA 3TANA 3QNOA 3AV9A 4NCAA 4CF0A 8ICCA 1J5OA 3RJEA 1RBRA 4JV2A 4EP5A 3KD5E 3Q8RB 4H4MA 3DRPA 2XY8A 1TV6A 4BDPA 2DTUA 1GOAA 4CGGA 1UWBA 2G8UA 2BQ3A 4AH9A 5KFNA 3V9ZA 2VG5A 3NTUA 2NRXA 4ED3A 9ICIA 5CR0A 3K5MA 4YFKA 3PO4A 4FLVA 3MBYA 4O5BA 4DF8A 5IINA 3H08A 3V72A 1S97A 5KFQA 4YR3A 3PW7A 1TK5A 4YCXA 5KTQA 2NUBA 4I2QA 1HNIA 3D45A 4QWCA 4JWMA 2G8IA 4XIUA 1CXUA 7ICFA 4EZ6A 2F1HA 3M9OB 2I1QA 4O5EA 8ICHA 4E7IA 4DLGA 4JV0A 2R8GA 1RT2A 2HNYA 3PX0A 4F92B 2IHMA 3NFAA 1KFSA 1RTIA 2P51A 3Q8MA 4FJNA 2IC3A 4J9QA 5C24A 4QZCA 3AVIA 8ICFA 7ICKA 5J2JA 1QQCA 1RILA 4DFPA 2I9GA 4R66A 4ELVA 5DDYA 3L3UA 4QZIA 1NKBA 5SZTA 3QINA 3C2KA 5KFFA 2BCVA 1ASUA 1LV5A 1NK8A 4J9OA 5DB7A 4ECQA 3VQPA 1HJPA 3KKRA 3AVBA 2R8KA 4FZYA 2MUTB 3K59A 2W9AA 2OPQA 4CFCA 4RNNA 1S0OA 1EX4A 4PGQA 4QZDA 4NCGA 4ECWA 3AVGA 2LSNA 1L5UA 5KT5A 1N48A 1S77D 3I0RA 4FK0A 1UOCA 2I5JA 4J2EA 3AO4A 2PI4A 3ZSVA 1WSGA 1C1BA 1PZNA 4B9VA 4DTJA 1RXWA 3ASMA 4I9LA 4BDYA 4M6WB 4KTZA 4F4YA 4CEOA 5J2NA 3RH6A 4EEYA 3BQ2A 4J2DA 4QZ9A 1MSWD 7ICEA 4FS2A 4NLNA 4DTSA 5EWEA 3H4BA
chains in the Genus database with same CATH superfamily
2DISA 8ICZA 3SPZA 1YAGA 1Q81T 3H6EA 5GAGU 1KONA 3AVFA 4GRSA 3EY1A 2XMWA 4X62J 1LXNA 3WUHA 3WK6A 4DU4A 1M5PC 1BL3A 2KLAA 3WHIA 3RJMB 3NGIA 2K7KA 5J0UA 4MF8A 1BDGA 2D9PA 3P38A 1RNHA 2PFNA 4KLHA 3ZZOA 3TUPA 3OYHA 4HKQA 3T41A 1UETA 3LP3A 2X1AA 2X74A 3D66A 2WB1D 4ALZA 4Z4EA 4TNOA 1WNEA 3DEEA 3VEZA 2FY1A 2G5IB 2QLTA 1FRMA 2P9CA 3DXKB 4C80A 3UXNA 3ATVA 4Y65A 3I32A 9ICVA 4H0PA 3KLHA 4DV6K 1VBXA 3DRRB 3DLLL 2WB4A 2Y9UA 3MTJA 3NRZA 1JIHA 4RUBA 1X4EA 3ZZUA 4WQ5A 4DTXA 3MEDB 3QJLA 4DX6A 3CW2C 4DOBA 4GKJK 2CNOB 3OS0A 3MR2A 3OYKA 1QVGM 4RW7A 3ICLA 4FWQA 4OLBA 4KI4A 2OEHA 2ZF5O 3N4MB 3M8WA 1AT1B 1KQFB 1XMQK 1S59A 1YIJS 4MEYA 4H5NA 3RWUA 3UKRA 8ICBA 2E8MA 1SZ2A 3KUGA 3UMBA 1N36K 4PQUB 4U67L 3D1QA 1QSYA 1F2HA 1RG6A 4X64K 1QQ5A 2DK2A 1CC7A 4I2HA 4JKGA 3B4MA 1QVFR 3ZZYA 3HBTA 1ZQRA 4DSKA 2I5JB 4MKAA 3CT9A 3EGNA 3DC2A 3VQ7A 2XY6A 3QRRA 2CPRA 4KPCA 2XB2D 3MR3A 2JEGA 1C20A 4FNHA 3ZT4A 1APSA 2IY5B 3MECB 2UP1A 1U4BA 3E1YA 2ZD1B 2AKWB 1LCUA 4JRQA 4U7CA 2H5XA 3QNWB 1SAZA 2Q66A 5DM7Q 4QZ8A 1S0VA 3E3XA 4N7TA 1QCKA 2NLXA 3SENA 5FLXY 1FKPA 1IKWA 3MURP 4ICLA 9ICKA 1OY8A 3MN5A 4NLSA 5CQGA 2ZZNA 3AL0B 5AM4A 3ZNUA 5DBCA 3Q22A 3J81O 3H3NO 2VFVA 2YX4A 5GAEU 3JS9A 2HHWA 1ZD2P 4CJ4A 2NRHA 3LDPA 1XNRJ 4JLHA 4K2XA 2HZCA 3NRWA 3EDQB 4FPIA 1TK0A 4OPJA 3TR8A 3AJ2A 3A5NC 1IJEB 1KD1O 2DNHA 3SMSA 3MDAA 2QWLA 2HWTA 5JVGQ 3BP8A 3G8TA 4Z7CA 1QH9A 2FI1A 4Y28C 3QUTA 2PIIA 4B3SJ 1U9LA 2QEXN 2BMBA 4DU3A 2ZIUB 2F8TA 2A1JA 1CJVB 2ZTDA 2AF6A 4USUA 3W2WA 1QS4A 2UV8A 3VAKA 3U9ZA 2V9KA 3OV7A 5AJ3K 3F44A 5AJ3F 3S3OA 1I3OB 1YGYA 1M1KT 4PKDB 2A19A 3OBYA 4J9NA 3FZFA 1H74A 1KC8O 1IIPA 4Y2JA 1RDDA 3OGUA 3IGVA 3AA2A 5J0XA 2WTFA 1L7MA 4UBBA 2PO4A 4WQ4A 1DQ9A 2E1PA 2Z2MA 3VEYA 4NZ0A 4OI4A 4RL1A 1VYAA 3TP2A 3E58A 2CQHA 4LY7A 3HHLD 2V52B 1FCAA 3BEXA 2RJZA 3THPA 3OFHA 2J0XA 1T6CA 1T94A 4QPTA 2EAPA 3ISBA 4LREA 1FFWB 1RE1B 3KLGA 3C16A 1CQMA 1VQKN 5AQFA 4K4HA 4CF4A 3GJRB 4GKKK 1B92A 4DCCA 4KQZA 4WFAL 3ENAA 3MCSA 3VMFB 2P9SA 2YX7A 3QNNA 1VSIA 5CA5A 1IG9A 2VG7B 3GLJA 1DURA 3QU4A 3CF5L 1V4TA 1W9HA 2E44A 5A0YA 2FJDB 3MUVP 2C1EB 1ZM3A 5A2QO 4BUGA 2DFHA 5D6GA 4PR6A 5DBAA 1XMOF 2VG5B 3D3BJ 2VOPA 2E1MC 4ZDNA 3A8IA 3ULHA 4X64F 1GX5A 3EO3A 4YD1A 3SEIA 5KFBA 1KSPA 3KLFB 3ETRA 2JZ5A 2CPEA 3VTIA 4HTLA 4UQGA 2KICA 3AT1B 3HM9A 1OPZA 4G1QA 2W9CA 1R0AB 3RH5A 3MMAA 2I6WA 3FK4A 1DBDA 2UU9J 3OS2A 5JVGL 1WF1A 1WC0A 5TKYA 1RDRA 2O66A 3IR7B 2Q0ZX 4WWSA 2F65A 4LFCJ 1F5SA 4TUQA 3CPWR 2YHBA 4K4UA 2DIUA 4QW9A 4CNZA 3VF4A 1EP4A 3MWBA 1SQKA 2L9DA 4BXOB 4KPYA 3HI9A 5ETPA 3Q8QB 2BXJA 3C6TB 4WK1A 1BQMB 2OJ3A 2N4DA 5AKLA 2CFXA 1B9DA 1PSDA 2V67A 3C28A 1RYRA 4ZCKA 2BJ9A 3MF5A 1H1VA 2HNDA 2IDLA 2FC8A 2E7XA 4NYZA 1MMLA 4DFKA 1K9MT 4O3RA 1B9FA 3MECA 2LMRA 1S9EB 2H3QA 5J1PA 2UXDK 1WC3A 1Y3KA 1EETB 3UQ2A 3OYDA 4BG9A 3QGIA 4IH6A 1N32J 1KFTA 2MZ1A 5KG5A 2FC9A 4QZHA 3QAEA 4DV1K 5G0RA 4X64J 4WPAA 3RJGA 3JQMA 4QAGA 5HATA 2ACMA 4NZ6A 5F3XB 4IFVA 3Q23A 4M6WA 5BYRA 3HTVA 2JZBA 2LLZA 3JS6A 5B0BA 4DSLA 1Q3UA 3RUBL 5C5JA 2EBEA 4PY5A 5BR8J 3PKYA 3L3FX 2XYGB 5F0UA 4FPRA 1Z3EB 2F7VA 3IBPA 3O8MA 4CHOA 3KD3A 4ILMA 4NXMJ 5AE1A 2GHVC 4LRDA 4H5VA 1KHWA 2D3OR 3QU5A 1TAQA 5AM2A 3SJHA 4DPUA 1JCGA 1UT5A 4HUEA 5ETQA 1WWHA 8ICXA 1WHXA 1TKDA 5M1QA 3JQKA 3M6UA 3KWIA 4DR5K 2HPUA 3AAQA 1JNRB 2P9LB 1I94F 5KGWA 1YT3A 4KX5A 3CJ0A 4YHHK 3PR5B 4QIVA 3HI0A 4Y2SA 3MGIA 1O0PA 2CVEA 1RT6B 2A3ZA 3IMQJ 4ZJOA 5G5HA 2GNKA 5GINA 4DU8A 4KRWA 3FZHA 2AZ1A 5KFIA 4RQ7A 4U9RA 1MW7A 5HRPA 3I8BA 2NPIA 3UE5A 4UTGA 5J2IA 2A1SA 1MC8A 3M7VA 1RTJA 4JI6J 4ECXA 5KFCA 3B82A 3G96A 2B4OA 1XMQF 4FWRA 3SSSA 2XC9A 3CFOA 1U0HB 3DDHA 3FSXA 2Q31A 1NOZA 2YNGB 1XK8A 4MKVA 2WC9A 2MKIA 3VERA 3PNIA 4N41A 4U7UD 1FWLA 5DDMA 2RRBA 2ISPA 4IQXA 3CJRA 3CPWM 5BR8F 2DB1A 5HMYA 4WE1B 2WFAA 4FE3A 3MXJA 4NXMF 3H8JA 1ZQJA 4GO7X 5EOZA 5AKKA 1NK0A 1R8CA 1XSNA 3IG8A 2HHHJ 2BYCA 2VG6A 3CC2N 2YXLA 4O44A 4JKEA 3PRDA 3VHQA 2BZFA 1SV4A 1OH6A 2A6OA 3IWNC 3MM5B 3CCLS 2QI2A 2Y8WA 3U8XA 4IKAA 2ZIWA 5AQTA 1ZQNA 2P9KA 4RBVA 5JRTA 4E19A 3TSPA 4PKHA 3BS5B 1IKXB 3NHGA 3MPVA 3FEZA 4RPFA 5HL7L 2X1FA 3TI0A 1RWUA 4W90B 2A41A 3THYB 1S72S 1S6OA 3NG8A 2KYZA 1NJIO 2VBYA 1NH8A 4LRBA 4C2MA 5I9EB 3TTDA 1XHZA 1YJ7A 5IIIA 3LP2B 1DLOA 2B56A 4CO4A 2X7IA 4BGAA 3V9WA 3H5SA 4O8UA 2E1CA 3I56N 1Q8KA 4BRNA 3NGYA 4G65A 4TLQA 2HVHA 4LFCK 2OELA 3L09A 2BPFA 4A5BA 4JI6F 2HK3A 4DJBA 3MPUB 1FX4A 1T11A 3LH2S 4BE1A 3GG4A 2H3FA 1KKHA 3J7Z5 2BHNA 3LDQA 4WBFA 2J9EA 4YD2A 3GFKB 4I28A 3QMLA 2KVSA 2DY9A 3GZFA 2PDAA 3RF9A 3GB0A 3SEOA 2OCEA 3W8PA 2J9CA 1VK8A 2A18A 5KFKA 4V19J 5CZXA 5CE3A 3MAQA 3ZCMA 2VBWA 2KT5A 4DR4J 2ZJAA 2WFBA 2HMIB 3R9LA 3H1VX 3OL9A 3FZKA 2LQ9A 2UXCJ 2C3OA 3UD3P 4M3TA 4LF5J 3AOAA 2XSJB 3DLEB 1IBMF 3OYFA 2DFFA 1DTTA 4E98A 3EKSA 3ZX2A 3GE1A 1TZ0A 1GK8A 3CC2S 3L4BC 1IKYB 1H7XA 3QBCA 3TZWA 1N32K 1V4SA 2PA3A 2ZC4A 4FJLA 4JKFA 4CLPA 4NL9C 2YQEA 1JLEB 1E4FT 3CCLN 4QCLA 1AFJA 3L3VA 1Q18A 4NASA 6FD1A 2CGKA 4UAWA 4CEBA 5KFTA 2LI6A 4GXKA 1C1AA 2ZH1A 5IM0A 3KIOA 1NHUA 2M9KA 3WC2A 3FLCO 4E7KA 2NO5A 2C28A 3PY8A 2HWIA 1JMSA 5C25B 2B0CA 2QE5A 1UEVA 2EHGA 2PFQA 4BRQA 1YVFA 1KQGB 1WSEA 4NYOA 2GW8A 1C7YA 2G2YA 4LF7F 2H3ZA 4ITSA 4C0HA 2VJUA 4O3PA 1RISA 3J80U 3O6WA 4CEQA 1JB0C 3VAHA 1WSIA 3WNEA 3DOLB 3NH1A 3PSIA 5GMEA 2Y0BB 3AQEA 4YOVA 1JCFA 3SMZA 3QIPA 1FA0A 4FLTA 1URNA 2CH6A 5BRDA 2LYVA 3S01A 3KJQB 3CNQP 1JLQB 5BPLA 1FTRA 1FIQA 4JWNA 4M8LA 3HPHA 1FE4A 4CHPA 3OR1A 1VQ9S 2F8KA 2MGZA 3CPEA 3HHNB 4FLWA 3R1HA 4TXSA 4RX6A 3CCEN 1Q82O 2E2NA 3PX6A 3C6TA 3R8YA 2VFRA 3DMJA 1FFSB 2H3EB 1CRXA 3OQ2A 4JAXA 4LVNP 2XLKA 4CDIA 1S0NA 4BRIA 5A8RA 1MWZA 4I29A 4KBOA 1D5AA 1U0HA 2FQQB 3UDEA 2LMIA 1MDUB 1K44A 2L5YA 1V3ZA 2O8BA 5L1LA 4J9PA 4OI0A 3P49B 1C6VA 4EHUA 4LFAF 2GUPA 3UCUP 5HQLA 4GO5X 4KLUA 3O6QA 1F21A 4Y2RA 3OYCA 3L7PA 3T69A 2HHQA 2N1RA 1N5XA 2WONA 3CXCM 4RTFD 2R7RA 3KKFA 4BX9C 1U2RA 4ZLNA 1VHXA 1ESVA 4NMXA 3RSEB 1YHQN 2ZUAA 1G1XA 4LF8F 4IWVA 3QEVA 4CM0A 3QEAZ 4JV5K 1FFVA 4LZDA 2W8KA 3IAM9 1MA7A 3NVWA 4KB1A 3WX8A 4NXNK 4O4GA 4I9QA 3NVZA 4NXMK 1IBLF 4NLKA 4JI3K 5DQIA 1WEXA 2M0GB 2NREA 2W6KA 2UUBK 4DHYA 3M8SA 3OS1A 1ACMB 2XHCA 1NJXA 2EFOA 3SV4A 4LSNB 1FNMA 1YWXA 4IO9L 3UMCA 1QAJA 1TK8A 3QESA 2IC3B 1QQNA 3NY0A 4CEAA 3BGFA 4H03B 5D49A 3IG1A 2DGTA 4GKJJ 4G9BA 1VQ9N 2GWSA 2AGQA 3CD7A 3BUZB 4ZA1A 4JI3F 2CQ2A 4Q2LA 5CHCB 3HZGA 3OFGA 1T05A 2HW3A 4KHMA 4EELA 4ECTA 4L3NA 5M1OA 2MZSA 1S1VB 4C8MA 5KPTA 2XNQA 3BPDA 1P7DA 3EE9A 5IIMA 4DN0A 1BHLA 3T1YF 4TKTA 1ZQTA 3ZT0A 3R8EA 3AN1A 3NWGA 5AI0A 2HFVA 1XR5A 4M9JA 1RTZA 2DGSA 4CRJA 5AZJA 2MYFA 3CD6N 1ZA1B 2FPKA 2XI3A 1W2BM 2E2OA 4OJOA 4DCOB 2OPSA 1FFGB 3NS5A 1NGCA 1XS9D 3BF1A 1UAWA 1I94K 2R7SA 1EQ0A 1L7PA 3S9HA 4K59A 4FYYB 2OD4A 3SCIE 2DHXA 4LFAK 5B66U 2D69A 1KRPA 4ZTJA 4Z7YA 3MD1A 4YMNA 3LWMA 3F56A 3HULA 5D0EA 3QAUA 3TSQA 3CC4N 1ZQPA 3I5BA 4LF5K 3UDVA 4ZS6A 3AFGA 4XRHA 3MTKA 2ZIVA 3HFZB 3A5OC 2J7KA 4C4TA 2ILYA 4DR2F 4TYAA 1GTHA 4OYWA 3TUJC 3MXIA 5IILA 1N36J 2JOQA 5CR4A 3TUIC 3ZSWA 4CGZA 1M90O 1KQQA 3CIPA 2VASA 1WJ9A 2YB4A 2DR8A 2DNYA 2XMUA 5IT4A 4KLFA 3D2NA 3NL0A 5KAFU 2HKEA 2DEIA 4BC9A 3DV9A 4ECRA 1BC6A 2FHJA 2VANA 4CWBA 1JUDA 1T3VA 3ZSRA 2OZMA 9ICGA 1HBMB 4EFAC 5K14A 3C95A 1RHRB 4DN9A 2LFVA 3I6PA 1KLMB 1VRTA 2VONA 3C94A 3CJ2A 3O4NA 3I4HX 2FSKA 2EWHA 5HVHA 3QIPB 2GMJA 5K8NA 2DEJA 2W7AA 4Y0FA 3J81U 2E5LK 1VAZA 2Y1JA 1Q7YO 2X1BA 3AD7C 4K25A 1J27A 2ZWHA 2H3GX 3FBCA 4YMEA 3Q8LA 4Z94A 4F5RA 2Y1LB 1H2VZ 4FBTA 4CE9A 1KCFA 2KIVA 1Q81O 4FZXC 3R5DA 4IEEA 3Q24A 3NCPA 4HACA 2ZUGA 4TYBA 2AD9A 1OVQA 1ZQKA 1OPIA 2P5VA 3MR7A 3LK9A 1DT9A 1N5VA 1KW4A 2QT7A 5ETVA 5FD1A 1JJCB 2YNHA 3TU5A 2ZZMA 2ZDOA 2A5XA 1NBEB 1GQEA 1F9FA 1PAEX 4C48A 3CCZA 3GIRA 1F0XA 4FF2A 4V1Ak 3QT8A 2MKSA 2FC0A 1NDCA 3IS9A 4DR4K 4DG1B 4F3MA 2PBDA 5JU5A 3A5MC 3M1YA 2BOAA 2KXFA 4CRXA 4H0XB 5ADXA 2O6KA 4G1PA 2JV3A 2DY1A 1TR0A 3IAS9 4CF5A 1SV5B 4M3UA 4R0EA 5I42B 2WVCA 2UU9F 3LP1B 3ZXWA 1UA0A 5IC6B 3DYAB 3VAIA 4BR0A 2QX0A 4B9UA 2GH1A 1N34J 2ZTCA 2IIHA 4ID5A 1N5SA 3K89A 4E0DA 4AXIA 1NK6A 1Q46A 3QSYB 3EGVA 7ICVA 3EWGA 1HQEA 4UB3A 3QUQA 1FWPA 3HXMA 4KX3A 4OX9J 4LH5A 1TQLA 1NCLA 1Z4UA 4P9SA 2QXFA 1UTAA 1JNZB 1ZOTA 4CLWA 5DZ6A 1FRXA 4ID8A 3KZBA 2H51B 3ENWA 3R2CJ 5AQUA 1X7VA 1CUKA 3U9DA 2RHSB 1FK9A 4LIWA 4CIGA 1YITS 2BGWA 3MX5A 4H4OB 4NY8A 3BV8A 1RU2A 2OTJS 4RNHA 1RWMB 1SVDA 2E7VA 1YSJA 3CF5Q 4CBWA 4EMDA 4KGXB 3BF3A 2M4MA 1OQ6A 3FZLA 2K89A 2QO3A 4ZPCA 4DSFA 4IBNA 1VQ6N 1A0PA 3OYEA 4OD0A 1PC5A 4L3KA 2F8HA 4OI3A 2CJQA 5MAOA 3J81j 1BWEA 1RAHB 3JPQA 3E2EA 3L4PA 2A42A 4Q0BA 3S3NA 4WP8A 4K5SA 3L9ZA 1F44A 3MCPA 4IQWA 1TL7B 2QLBB 3UD4P 4LVSA 2V4RA 4KBIA 3WXMB 3NVYA 1T9UA 3J80O 1EETA 2COLA 4BROA 3HJVA 1RCOB 5ALVA 2AV5A 2XHWA 1X9MA 2CRXA 1N34F 1YTYA 4Y0WA 5C2FA 1SL0A 1VJ5A 1A7GE 2EVZA 3JYTB 2KVIA 4PKGA 3M1VA 4CGJA 3EXYA 5ITHA 3GZ7A 4OX7A 5J8YA 5CYMA 4M0AA 1GLJO 1KLMA 2WUSA 4I2CA 2QSWA 5C42B 1S6PA 4LF6F 2XYHB 3VVTA 3JPRA 3M3ZA 4USAA 2H54B 1VQPS 1HR0J 2IBKA 3GYXB 5AFUA 8ICMA 3ED5A 2RIJA 4GVEA 1YITN 3UR0A 4K0KF 2Z2ZA 2BPGA 3J7YP 3QB0A 3NVVA 1U6ZA 3IXQA 3LZIA 1KVJA 1LW2A 4O0NA 3VGTA 1ZBHA 3PDNA 5EN1A 4CO3A 1P8ZA 3Q8VA 1A76A 4BLGA 1GOBA 2KSOB 4CJRA 3BGRA 2KFYA 4MYTA 4JP8A 4P74A 3H8WA 2MJUA 1PYTA 3IBWA 2WBNA 2O5DA 2U1AA 2QXLA 2LQ8A 3UB5A 4USMA 2P5GA 4HWIA 4I64A 2E1AA 3N79A 3E9OA 3D7EO 4JI8J 4JI7J 1WCLA 3KK3A 4FO0A 2NRTA 2KMDA 5IIKA 3OVBA 5B09A 3M7DA 1X4GA 2E9ZA 2J5AA 3J7ZT 1WLJA 1H38A 1SWWA 5KFHA 4FWLA 4F93B 2J6SA 3O5TB 5G4DA 3IS9B 2W4DA 4DR3F 2V8GA 2E6MA 3GYNA 2RMLA 3TR5A 1W2IA 3BR9A 1ZQUA 3ZX0A 4IYQA 3L8BA 3TTCA 3VENA 2V51B 3E8OA 2ZNZA 1Q3VA 1P6TA 2Y9HA 4KHPK 2FYXA 2D0PA 1DRGA 3K2PA 1N60A 3KDNA 2RP5A 3UIQA 4KV8A 4OX8A 1PO6A 1RTJB 1GXTA 4E2FB 2RNEA 4FJ9A 1BI4A 9ICBA 2GX9A 1ATSA 2RRDA 2WW4A 1FVSA 3LM9A 1Q7LB 4YOYA 4BR7A 5LMNK 4IRCA 1A0OB 3FRYA 4PGYA 1EX8A 5DM7L 2IRYA 3NVKA 4TUSA 2W7PA 2CN1A 2X6NA 3NNCA 4DQPA 2NUHA 1L7OA 4NA3A 3GIIA 4OJPA 4H0YB 3AVNA 4RQ8A 1OYEA 2QA4G 2XZTB 5DLGA 5DDQC 4N77A 4DR6J 3VA3A 2YHWA 5ETRA 3NAEA 2ATQA 1GMVA 2ASLA 2B4VA 1T9TA 3KHGA 4HDGA 2XLJA 3D6JA 4K4VA 3N4QA 4DTUA 4CW7B 2Z1JA 4JYAJ 3ZSZA 2CG8A 3UN3A 4KH5A 2GJFA 2AQ4A 5DGAA 4TSXA 2RHQB 4ES1A 3WK4A 5EE1A 3OJUA 1WNSA 1QE1A 1GXUA 2XO6A 4DWIA 4R65A 1NOYA 4YMOA 4RR5A 2DPNA 1QD1A 1WAJA 1TUUA 4BGDA 1NBWA 3ZFVA 3PRVA 1HNIB 3EXCX 1RWWB 2OA8A 4IG0A 3RG6A 4YDUA 3MX2A 3RAMA 2QZ8A 3CJKB 4B3OB 4KGVB 7ICSA 3TEHB 4F4ZA 4JKBA 4ZIWA 4F4KA 1RLDA 3HM8A 4ECYA 3T1HJ 2KN7A 1X9SA 1LWXA 1X5TA 1IBMJ 3MMJA 4DU1A 2HBRB 1RDBA 1MWQA 3U27A 4NA1A 4C6AA 4QZGA 3SQ1A 3NBPA 5CY4A 4TVAB 4QR0A 3NKYA 1OSDA 5F8GA 1Q16B 1CJTB 2Y0SD 4HTJA 2O8BB 1VRQC 3PSPA 3RRKA 4ED5A 2YMPA 5GADU 4BQLA 5EWGA 4DUYF 2O8EA 3K5LA 3AVHA 2XQCA 1KN6A 4GFJA 3ZDCA 1VSMA 3VEVA 3UNYA 2MEWA 2C3MA 2ZXHA 4WFAQ 3QLHA 3JXOA 2KG1A 1X4FA 3B6BA 2RDJA 4NLBA 4OVLA 4Q45A 1EO1A 4CDGA 5T41A 4JI0K 3M6KA 4LF7J 4URSA 4I6AA 4DR6F 2OD6A 4YR0A 1C0MA 4MO4A 3NVMA 5IWAK 5IQ6A 1ZD4A 1CJUA 4FF4A 4PEOA 5AKHA 1HYSB 2MQPA 3L7OA 1BI4B 4PYDA 3BSNA 2AJQA 2FLPA 3N7SC 3VEWA 3EGZA 5LJ3Y 4Q44A 4BREA 4JI7K 2YHAA 4F50A 1XQSC 3AUOA 4U8YA 4OHZA 2I7NA 2E3TA 2DY4A 3BZQA 5AIBA 4DL4A 4GVLA 3NLCA 3MM8A 5JTIA 4KY3A 4PXEA 2OSRA 4ZPAA 2PMZD 3J8AA 3BH6B 1Y10A 1KL9A 2MKYA 5K4LA 2YWWA 3MC1A 1SUQB 3OHRA 3GIKA 3RMAA 3CNHA 1BA0A 3KG0A 4BWMA 3VGVA 4BCAA 3N6MA 4HDHA 3ZETB 4FJ5A 4UOCA 4X5VA 2D3ZA 2DJWA 2VWBA 2BX6A 2Y9TA 4HUFA 3RMCA 4B1UB 1RJJA 1XO1A 3VQBA 5K5MA 3D6RA 5J0PA 4AYBC 5J0RA 2PFFB 4FWOA 2F40A 1UL3A 2N82B 4KGMA 2F5GA 1IKVA 2CQ0A 2C2RA 3BJYA 2NZ4A 3WK9A 3M2RB 3TABA 1KOHA 1NPPA 2JEFA 2K60A 1D9DA 1FXRA 2VBXA 4FJIA 2HYIB 4JI2J 2VQEK 2D5RA 4CT9A 3H25A 4LFBF 5ALXA 3TANA 2LECA 5D4NA 3AV9A 3EE8A 8ICCA 2HZVA 5IT9Y 4JV2A 4NWIA 3I9V9 2B9EA 1BQXA 3Q8RB 5AI5A 1NZPA 1IBLJ 2NXUA 5KAIU 2CQCA 2MY8A 2DTUA 3OUYB 5BPNA 2G8UA 3V9ZA 4CZIA 3HSCA 4CZCA 1F9HA 5D4PA 5HLFB 1HKCA 2PMZF 5CR0A 1YJ9S 3I55N 1UFWA 3JQJA 3MBYA 4GKJF 4O5BA 2AYEA 3US5A 1HBMA 3EMTA 2V8HA 1Y11A 3PW7A 2HRTA 4JI3J 3K8VA 1J2VA 1VBYA 4JWMA 5FDLB 1CXUA 3OTCA 4XO0A 4IG0B 2F1HA 3O9RA 4DLGA 1XIQA 2R8GA 2CXEA 2HNYA 1FW6A 4CLSA 5GTHU 1KFSA 3UDLA 3QXGA 3THXA 1RTIA 3IN5A 3THWA 3H5UA 3VVUA 4AE5A 3ATUA 3MI7X 2IC3A 3MM6B 5C24A 1CC8A 2M3DA 2ZDPA 3OBIA 1RHMB 5J2JA 1H3DA 1RILA 4DFPA 4R66A 2KSOA 5DDYA 2JDJA 1R3NA 3QINA 3C2KA 2CAJA 5KFFA 2DO0A 2J76E 2LBOA 3R7BB 1FT8A 1R0BG 3KKRA 4AUKA 2BJ8A 2OLWA 2ZVIA 4Y2UA 2OPQA 3K2YA 2V8DA 3T1HK 5A8KA 2Y1RI 5ELZA 4PGQA 1JJ2M 1HD1A 2PC6A 5HK4A 1SJ3P 2EC2A 3AVGA 2LSNA 2R42A 5KT5A 2ZC3A 5BR8K 3R5BA 4FK0A 1QDUB 2I5JA 3AO4A 1T9XA 2DQNB 2PI4A 2MMYA 4KAIA 1WSGA 3ZSVA 3ZYYX 1BG3A 2Y0SF 1ZQ1C 4M6WB 3SR6A 2HSEB 2K7JA 2FB0A 4FYVB 2IVNA 3KLGB 5AQMA 1MSWD 5LJWA 7ICEA 4FS2A 1H7WA 4EIAA 4H5TA 4DTSA 5AQZA 1ILYA 5M2PA 2EK1A 2LA4A 2Z30B 1WSRA 1B0VA 5ALZA 1ZA2B 3DLRA 2BKEA 2GO8A 4MFCA 1NSQA 1WG1A 1WYGA 2FJEB 5AHXA 2DGXA 1JKHA 1ZQMA 1TKZB 3LM2A 4QJVA 4KIAA 1TKXA 3RMDA 1E4GT 2H5IB 3GSIA 1PIEA 3WIVA 2P9UB 5DRKA 3CB4A 4DL6A 4QWBA 4MTPA 3QRPA 1DGKN 2A2CA 4TURA 2YCHA 4JK1A 2BM0A 2C3PA 5IT9O 2GBZA 2QB1A 3K75D 3SUNA 4NRTA 2MQ8A 4OKJA 1W2BR 3EVWA 4C7QA 1T3OA 4IOAQ 5J2PA 2JWKA 4WU3A 7ICIA 1GNKA 3OY9A 3K0SA 4I2PA 5A76A 5BXIA 3HK2A 4CFAA 4LIRA 4F5PA 1JQGA 3VQ8A 1YZ7A 2LA6A 4X65K 5CCLA 4GMJB 2PD1A 4BRLA 5AQLA 5HOOA 2GVDB 2ZITA 3AO1A 5I3QA 4MO5A 4Q8EA 2ZE2A 3GBTA 4ILLA 2DNRA 1VISA 4FPAA 1LKYB 5AQRA 2ZM6K 4NEZA 1ZQSA 4YUDA 5ALTA 1LKZA 1SKWA 2FHJD 4FVUA 5M1PA 1Z00B 4Z37A 1HI8A 9ICEA 4L76A 4CJFA 3LYSA 4FVMA 2BABA 3O1BA 5BREA 2CYYA 1EHWA 1HLWA 3HT3A 4WE1A 3MAHA 1VQLS 2DITA 2KHQA 3PW0A 5AE3A 4M9GA 4B1ZA 4UT4A 2OFHX 1WTBA 3OVNA 1LFWA 1NU0A 4LQ3A 2ZGZA 3VQ6A 2BJ7A 1T02A 4GNIA 2HRUA 4EEKA 5KFMA 3NNHA 3MGVA 3QWPA 1CJTA 4FW1A 4KLOA 5D4LA 5KFXA 3A5LC 4FWSA 2ZUDA 4P0QA 1HNWJ 3WKDA 4ILHA 3ZD9A 5GAGI 2FSNA 4UZCA 4CI0B 8ICVA 1SJFA 4QIWC 3IRUA 3LP1A 1NM1A 4GC6A 4F3OA 4QZAA 2EZYA 4BWJA 2VPXB 5M1NA 4CNQA 1B0XA 4CK3A 4LUBA 3TUZC 1YJVA 2DWQA 5KG6A 2RKIA 4FP9A 2CGJA 1IKXA 1HNXJ 5I3UB 1M0SA 3O3LA 4CJKA 3DHWC 4HHUA 3FZMA 3HX9A 3B6OA 1EQYA 4BC7A 5KFDA 2FVQA 2YY6A 4OHXA 5E3PA 1RAAB 4AT1B 3QETA 3OL7A 1TL3A 3CTRA 4FF1A 2GIQA 3NF9A 2F1IA 2A1AA 3F73A 2O3DA 3CFRA 2Q0RA 2NXEA 2C2KB 1V9OA 4JK7A 1HMVA 1VQ5N 1PILA 3A8EA 1XR7A 3FC9A 2YKOA 1XNSA 2CNKB 3TAMB 2GGPA 2CQ3A 5AT1B 3KNAA 3KYLA 2P9LA 2P5OA 2IRXA 5DO2A 3V1QA 4A47A 5HVGA 2DXDA 5E79U 1KXPA 1S12A 3LPEA 3HHLC 1FVQA 5AM5A 3ZZ0A 4DX5A 3NGSA 3SCKE 2RAQA 2H9ZA 3HCXA 4ZVTB 1SKRA 3OXGA 3KMSA 5DS7A 3BB5A 3N01A 1QM9A 1VK3A 1N4LA 1S10A 3T9NA 5B0CA 4DBQA 4KHNA 4BRCA 3SNNA 1N8RT 2W9MA 4IQVA 1NGAA 5LJ5Y 1NNLA 2E9RX 3D1HA 2OMLA 4DQ8A 3CCSS 4RNFA 5KFWA 2RRNA 3HVTB 3SAFA 4ZVUB 2HF3A 2CPZA 1L8OA 5B08A 2G8FA 2IDEA 4DUZJ 1HR0F 4CF1A 1HA1A 2D8CA 1F60B 1K0TA 4ZN3A 2R7VA 3M4XA 4DI6A 3M2RA 3W64A 1HNXF 1HQ2A 2QTWA 4RBUA 3A0HU 2HFSA 3PUFA 3C15B 3J7YI 2PMHA 4RW8A 5CYMB 3SQGA 5T7LB 3AVMA 2D9OA 2W8LA 4EBCA 3EJMA 3AMZA 4OFZA 5DMRA 3ENVA 4DS4A 4ID5B 3U6FA 1L3VA 7ICGA 1V97A 4F8RA 3D1OA 2K3KA 2FJWA 4UW2A 2YHXA 2PSZA 5EHHA 1RWOB 2F7TA 3MM5A 4NLGA 4IOCQ 5EX5A 3OPXA 4DR1J 1K8AT 1QJHA 2W6LA 3WXJA 2W04A 4DQQA 4JOUA 1LK5A 2W01A 1SPBP 1ZQIA 2FJVA 1EARA 3Q8UA 5AJ3J 1ZQCA 4GVBB 2KK0A 1U1NA 4UAVA 4OJ6A 1HPZA 3AA9A 1VSKA 4B9MA 2LVWA 3CMEN 1QVFM 2V9WA 3THVA 5L1IA 3UKUA 4A8EA 3Q8SB 1KS2A 5FDLA 1JL1A 3M2UB 3M9MB 4TU7A 4J90A 3WZ0A 4FPBA 4GV9A 1UZDA 5JICA 2V7ZA 4JN4A 5ALDA 3KKAC 1IBCB 4P4OA 2QKKA 1G99A 4JI0F 1JRPA 7ICPA 2W3RA 1NHVA 4B9TA 1XQIA 3CWJA 3P6YC 3RGIA 3MM7A 4Y2IA 4K41A 1YQHA 3CCSN 3M32A 3THTA 3WNGA 4BRDA 5DBBA 5EWFA 3E01B 3N28A 4UB8U 4C7ZA 1MN7A 3UVJA 2QK9A 2KV2A 3HOSA 4I6WA 4A8FA 2IBOA 3TVKA 1IR1A 8ICOA 1PAUB 1JLFA 4RW6A 3KNGA 4QWEA 3MAAA 1JL2A 4W4MA 3T3FA 3N5BA 1NSAA 3HX0A 3V7JA 8ICRA 2G07A 4UAZA 4UQTA 3VAMA 5EU7A 3SD7A 4DCPB 5A2QU 3NEKA 4WZQA 2BDUA 1LW0A 5I3UA 3ZT1A 2NLWA 4KO0B 3OTQA 7ICTA 4DR1F 3EZUA 3PRBA 1BWVA 4C1NI 1QAYA 3PHTA 4B1VA 4JUZA 1AZSA 3C2MA 1WUAA 3ONNA 3HF5A 3UO0A 7ICUA 3OFEA 4P7VA 4DV6F 4NYPA 4DX7A 4F0HA 1ZC6A 1NAQA 3SUQA 2RSQA 3S6JA 4CZLA 2QA4S 5ETSA 4CK1A 3M30B 3DGPA 2QL9B 1ZRNA 2F8SA 2KTQA 3N4WA 1HWUA 1YJUA 3ETOA 2AU0A 9ICRA 4A48A 5EVZA 3KLIA 4JV1A 3ZZZA 2J7UA 4MMOA 1F6TA 3MZIA 2W9CB 1ASVA 4PZOA 4JI4K 2ZKTA 2JWLA 1FKOB 1QE1B 3BDEA 4JK8A 1N0VC 1UVLA 3OL8A 4RW4A 4A2AA 1RT1B 4USJC 4I7FA 4ZP7A 4OZ1A 5AXKA 3DXKA 1H72C 4BRMA 5DG7A 4CEEA 3QYYA 5EY4A 1Z1BA 5AKXA 1CI4A 1CEZA 4NRUA 3GFHA 4J37A 4RQNA 3ELHA 5HR7A 1BPYA 3C6HA 4FLZA 3G6YA 3MK6A 3LW5C 2LPEA 4F3TA 1QUVA 3HVTA 1EXQA 8ICLA 5HRNA 2B7CB 5BOLA 1Z00A 2GUIA 2MKJA 1RAEB 4N47A 4YXMA 5KG4A 3QEBZ 5G5GA 4C3KA 7FD1A 1SH0A 4UUXA 5LL6d 4PABA 3IR5B 1RWVB 2NQPA 2CNNB 2O8FB 3D3CJ 1SC1B 1YBUA 2DPIA 3V9UA 4IO1A 4MIBA 4ISFA 4DMZA 5BR9A 3HVRA 4MIAA 1ZAXA 4Y6IA 4S0MA 2R7OA 4CHNA 1U1MA 1GLFO 4X4TA 1SH2A 2XMAA 2LU2A 3W62A 2HHVA 4J9VA 1NMDA 3ZTOA 4KHWA 4M5DB 1X0FA 3N5FA 4FBUA 2CPJA 2QM1A 2FDRA 2NRRA 3UI3A 1TELA 3S3MA 5BOMA 5EOYA 1U49A 2IMWP 3DCAA 4P2XA 2WF6A 2V7YA 4XH5A 5ALRA 4Z6FA 4KR0B 5C0YA 4YN3B 1M90T 3CIZA 3HW8A 3NS1A 1NSKL 3WKBA 2OP5A 2ZZTA 3W65A 4GW6A 3HT0A 4OI1A 3ID6A 3P83D 1TVAA 3CO0P 5H9FK 5AQKA 4OX9K 4D3HA 2RQKA 2EQYA 3K8WA 3ENOA 1IUJA 4O9MA 2IGIA 1R8AA 1K1SA 1S1TA 2UUAK 2ALZA 3NRBA 4ZPVR 1JJHA 4C8LA 5D4OA 5J1EA 3SQIA 5J2KA 3AODA 4JI2F 4XH1A 4WU2A 4LSNA 3BS7A 2PN6A 4PPDA 4LFBJ 1RT3B 4NL9A 3D5MA 4NYNA 2XIDA 4DTMA 4DUTA 2WOMB 3C7NA 4JKHA 3KLEA 4YS2A 1JLCB 5J2DA 2QWNA 3RRHA 2R2TA 4U8VA 1P9QC 3HSTB 4M63A 5AQVA 3A8YA 1NK4A 3OVSA 3G8SA 2Q2RA 3FE1A 1I51B 5HBMB 3CC7S 2HQFA 4DG1A 3M8QA 5DDRC 4UASA 4A8XA 5KRTA 3DYAA 2JVRA 3OBWA 3QE9Y 1CZBA 2GV9A 1IKVB 2HHHF 3P5JA 1J6ZA 2POKA 3FZ2A 5I42A 2O1PA 3NAHA 1VLBA 4YB5A 4KHUA 5LXRA 2ASJA 1SKUB 1RAFB 2YV0X 5AE2A 4UOFA 2J8AA 2R8HA 5I3PA 5LSOA 2Q3SA 5CHIA 2G8HA 3CCWA 3EDRB 1N33J 5GIOA 4KHRA 3C16B 5HROA 3M8PB 1R7IA 5F1XA 3QGPA 2BRKA 1UPPA 1TFYA 2V34A 3BS9A 4CI6A 5C15A 1BPEA 3QICA 2IAJB 3GR1A 3RAQA 3FSYA 4ATNA 1HRHA 3FR0A 5KFSA 2FPMA 5J2PB 3G6EN 2O8CB 2PY5A 2EX3A 1SH3A 4HR2A 1X31C 3CJ3A 3C0BA 3LQVA 4Z4FA 2FHOB 1OMSA 2C3UA 5IOLA 3C1ZA 1URJA 3IA0A 3OYIA 4CJTA 3JPOA 2HHHK 5KL8B 4KLDA 3WXLA 1RHKB 3G8QA 2RVJA 1IV8A 1A5WA 2FBVA 4M7YA 4EU0A 4YOXA 1LOTB 4ZN1A 4CD1A 4I2AA 1S9FA 4BY9C 2KRBA 1ZQEA 5J0TA 4L3QA 4CZGA 3CCUN 4HHHA 2IA0A 2AHOB 3VQ9A 9ICCA 1IR2A 3H40A 3D2FA 5KFOA 4DV2K 5EX3A 1RHUB 3KXDA 2DF4B 4QIFA 2F3NA 2BQRA 2GIFA 3CJ1A 2LEAA 2QLJB 3QT5A 4FJMA 1SCJB 3D6TB 1JLGA 3EN9A 3A3NB 4FJJA 4Y34A 3AH6A 4QZEA 4X62F 2XSFA 4ES3A 3D0IE 1WUUA 3WX4A 1M5KC 4IDHA 3QBWA 3A8JA 2OIHA 5DQHA 3TX8A 3WIUA 3GV5B 3KJNB 2IVOA 3K1ZA 1FRLA 2OYQA 3KFWX 1DK2A 2M0NA 3H0PA 3CERA 1TE2A 1SQGA 1VOMA 5KG7A 1N33F 2HOEA 2YNIA 4YXJA 4AYBD 4FK4A 1WKLA 3VC8A 1V38A 3HZ6A 1R0CB 4UB1A 2EWSA 2ASPA 4B08A 3SDEA 3PTWA 3SBGA 2K8AA 3ICXA 2OEJA 3CIMA 3I0SA 3A3OB 2DCLA 4URGA 4JBCA 1NJZA 1FXXA 3A0IX 5AKJA 1FDDA 2JRZA 2N3LA 5J0YA 2L08A 3DGVA 3IV6A 4B1YB 2AJ2A 5RUBA 5HMMA 1U8WA 3IWLA 5ALKA 4YDXA 4PPZA 4HTUA 2LDIA 2JWNA 4FYXB 1PVRA 3L2RA 3C1YA 3KMQA 3CUNA 2Z57B 1JLBA 3DKDA 4HH1A 3PACA 3KOAA 1K6YA 3Q2TC 2FJBB 3CXCR 4NZ7A 3UCGA 2LQBA 4RQ1A 4QS7A 4FZVA 4OHYA 1S57A 1NM2A 1XWLA 1C1CA 1L8LA 2CGLA 4AP9A 3SYZA 1KWMA 4CLFA 1CS4B 4JV5J 3H7IA 3VPZA 5DG9A 1Z25A 3KLEB 2PE8A 3G71S 3QJPA 2F4VK 2VGNA 5L38A 1D8YA 4F36A 1FO4A 2MRLA 1Z2LA 2HB5A 2ZGYA 3FFIA 2BOPA 4UY8T 8ICJA 4DUYK 1VQMS 3D0PA 5EE9A 3IRXA 2KT3A 2E20A 4BE2A 3QGHA 3JXUA 3UQ0A 2ATLA 2I8EA 1LNQA 1IXKA 1S1XA 1F2GA 2D3UA 4IL6U 4ZIVA 2K2PA 1S8OA 3Q86A 2MA1A 3KZIU 5MLCV 3BKFA 4KHPJ 1WWVA 1FJGJ 4TQRA 1O1WA 4FM1A 4P75A 5H1SV 4YOEA 2BJDA 3T1YK 2V2VA 5CXTA 1VS3A 1TFRA 4KTQA 4DQRA 4FNIA 4CESA 5KT3A 3W8GA 5JJBA 2GQ2A 1MA9B 3UE2A 2ZH8A 1ZM2A 2BBEA 5CZVA 2DNOA 3LO3A 5T7BA 4HCBA 4CJQA 2OPPA 1YXQA 2KJ8A 3V6JA 2X3GA 3MGJA 4OYMA 3O5BA 4CJ7A 4RKUC 2RPIA 4MKBA 2FBYA 1U6FA 4N8NA 1C0UA 1S22A 1UW9A 4A8QA 1TAUA 1PCAA 2XTJP 1SZPA 1IWAA 3SMPA 1UJ4A 1RT7B 1D9AA 2XS5A 1NPRA 2CQPA 2CPYA 2ASYA 4O5FA 4RQ2A 1LOUA 3M6XA 4C8NA 3H45C 5HR6A 2AGOA 2P9PA 4JV5F 1R8PA 2KZZA 3EUNA 3EZOA 1S6UA 4QIEA 3ISCA 4BDZA 2DYAA 3F9MA 4FJGA 3KWMA 9ICNA 4B9QA 1F9EB 3LDSA 2BRLA 4YMMA 2GWKA 5D0RA 3R97A 4M3XA 3CCMS 3CCJN 1J5EJ 1DGSA 2JHDA 4PG8A 2VJVA 3LALA 3O1WA 3GFYA 4OKKA 3TZXA 5HJXA 3C6UA 3LANA 1U7LA 1S4FA 2XWYA 4USWA 4WFXA 4LR7A 3AA4A 3VGKA 1JWWA 5BRHA 4YEAA 3DWLA 4FXWA 4BR5A 3BQ7A 4KHPF 1FJGF 2QMUB 4CQ1A 7AT1B 5IIJA 2HK2A 1NGGA 2RE1A 1JLFB 2OMOA 4ZOHC 4QR1A 4B8CA 4NMLA 3W1YC 2DGVA 3TZZA 1OQ3A 1TUGB 5ETTA 4IZ9A 4ECUA 1ITGA 2YPYA 2W9BB 4FFDA 3QQCD 2RQCA 4N56A 1IH7A 3OD2A 2FLNA 4FCYA 3PJ9A 3MR5A 3DFEA 4IFVB 1S1XB 3M2VA 3TTFA 3SQOP 1ICEB 2LM1A 1K8KA 2BJ1A 3SCJE 3OYAA 1SV0A 5AM0A 3C21A 5J29A 5AQYA 4XK8C 2ASDA 1HI1A 5IFMA 2R2RA 5F9NA 4CHQA 4IQUA 1IKWB 1RWPB 5C12A 4CGIA 2P35A 3B0YA 4O4GB 3FAHA 1NPKA 4PZVA 2H3VA 4KGZB 3CMAN 4RQ6A 3OJSA 3MDCA 3VQ5A 5A0YB 1CJKA 4PWUA 2FLLA 1VQ6S 3DOMB 4YFUA 2ZBQA 4ED4A 5GAHP 3NUQA 3BBFA 1SGGA 3TJ9A 1PK3A 1X4CA 1IM6A 4R79A 7ICHA 2NSCA 4ZHRB 3S7RA 4OYXA 3CCJS 2VFTA 2ZEJA 2OPRB 4GV3A 1HWKA 3CE8A 1FKOA 4YB7A 1WTFA 1YKWA 3ZLJA 3KK3B 1Q1KA 3RH4A 2CJBA 1ZRMA 3L0QA 3P4UB 3AD9C 4CH1A 4DMNA 4RU9A 5IC4B 4K5RA 3DRSA 3LP0B 4DTNA 2DCUB 1W0HA 4K4SA 4C7YA 5L1MA 2NXJA 1K9MO 4JRPA 1KP6A 1N32F 1P90A 1U48A 4M3WA 5E3QA 3KLHB 1KVCA 2Z1GA 8ICUA 1BNPA 4K4GA 4M5NA 1S1UB 1N5TA 4H5WA 2BGGA 4NV0A 2HHTA 3VGMA 3MN7A 4URQU 3VF2A 2QGFB 3ENBA 4FK2A 1ZQWA 4MEXA 4M9NA 1Z2ZA 1T4GA 2LDYA 1Q86O 2V68A 1WAFA 4CLLA 3E9PA 1FDBA 5ALNA 2JVOA 2UUWA 1J2NA 4Y2KA 2GHPA 2KHCA 3N6LA 1FKAF 5C2GA 3GV8B 3RBEA 2FJAB 2OHDA 5FIIA 1VQYA 4H4MB 1RAGB 1BNOA 1B70B 2F8EX 5LJVA 3ZT3A 2W43A 5CEHA 2BA9A 2M7SA 3CJTA 3SAGA 1UHUA 2LP4A 1Q4RA 5LSLA 5HHIA 2QMXA 4W5NA 1S99A 4USVA 2YMLA 1FJGK 1NGDA 3JPSA 3CMAS 3PFEA 1ZBFA 2G5HB 3FUYA 2HNYB 3VGUA 2FUG9 3T79A 3D7SB 4YNQA 3SDEB 2FTRA 2RILA 2XCPA 1RXOB 4FDFA 3V6DB 3PXGa 2P9PB 1N5QA 4FZMA 2E5SA 4DSIA 3MDFA 5IXUA 4A5AA 5KFJA 1ZQOA 3D6HB 1TL1A 2Q43A 1Q53A 3VOVA 3Q0AA 3VQTA 1R0AA 3PNCA 4I6MB 1VSJA 1NH7A 2ABYA 1BXNA 4ECVA 5ALHA 3OFFA 1LWEA 4LSLA 1U2VA 8ICYA 4U7BA 4ZPWR 4GXIA 3UXPA 1HBNB 9ICMA 1YG0A 3IBCB 1BISA 3FQLA 1IQZA 2UVWA 4WTOB 2HG4A 3M6VA 1NHKL 1XMQJ 3Q7BA 2NPFA 3NBPB 4XH4A 1HI0P 3V4IA 2A1BA 4E7HA 1JLCA 3MM8B 1ATRA 2VB6A 3W2WB 2E1FA 3TADA 4FJKA 4RT2A 4AD6A 5AKEA 1S0MA 3SBMA 3FCVA 1CS4A 2YQ3A 2H65B 3IRWP 5ALFA 2AJ0A 5F8JA 2O8DA 1RLCL 2PEBA 1HYZA 3ISDA 2HEKA 2HSTA 2J0WA 3F9KA 4UF4A 4Q5VA 3FYHA 2KKHA 3ZD8A 3FJ2A 2XY5A 4I7FB 2MQOA 3SV3A 3D54A 2ACYA 4L6V3 3HHEA 3FQKA 3PKMA 1OH7A 1LB2B 2UUAJ 2G4BA 3H8MA 2K3IA 2F44A 1TKZA 2RB7A 3KTQA 4KHSA 2YPZA 3BSAA 1BE4A 4KO0A 3GYGA 4DV0F 1RBTA 5M1FA 1RZMA 4GVMA 4YDUC 1NOMA 2EZZA 3I33A 4EX7A 3BM7A 4CH0S 2R7XA 4C23A 2QWPA 1YJTA 2OTLS 8ICWA 3J7YU 4TLRA 3FMWA 4NCBA 4RUAA 5B0AA 4LR9A 2QARB 5ALMA 1TYQB 3AA5X 3RB4A 1NJWA 4OZ0A 4B02A 2R3VA 1HQUB 4QJFB 5A0LA 2KL8A 5T7LA 4B1XB 4LF1A 4RQ0A 5AFUH 4RBTA 3AD8C 1IJJA 1VHIA 4FWNA 4CZKA 3D2EA 1NO8A 2LXIA 1M5SA 3G2XA 3VV2B 1URRA 2AQ0A 2CPIA 3FMBA 4DOAA 1GX6A 3H46O 1E6VB 1FERA 4J5OA 4P4MA 2L9WA 5AIAA 2R8IA 3NGTA 3QU7A 3HD1A 1WSVA 4E89A 1VC0A 1IJFB 2ZIWB 1XR6A 2QL5B 3QX7A 1YI2N 4DL3A 1IM4A 4QYRA 5GIPA 4JI8K 2OAUA 5J2CA 1YRXA 4OYIA 1XC9A 4F3QA 3W66A 4M47A 3QT7A 3IUCA 2ZUBA 2FDNA 1LW2B 2KHVA 1ZQXA 4RNOA 3NGKA 2N7CA 1F0MA 3NASA 4KLQA 2MGZB 1GLCG 2XS7A 4X65J 3GQCA 2F9JA 4LBHA 1S1WA 2CUYA 5D77A 4LF5F 3H5XA 4IEIA 2XGQA 4OV1A 1R59O 2WAQC 1EKEA 1VQ4S 1H98A 1UPMB 2YX6A 3HHLA 2HBLA 2IOCA 3MEGB 3GU3A 1YDLA 1DTQB 2XI2A 4I0WA 4R8UB 3ZSXA 1ULRA 2F76X 4W5TA 5EXWA 4JI4F 3DLGA 4C3LA 1PC4A 2CH5A 3OLAA 4IH5A 1KDNA 2AEMA 2J6TA 4ZVHA 1Z26A 5AQNA 3L5KA 3CDUA 5KFEA 2YWHA 4EO8A 1SJ4P 3TFRA 3BBBA 3DXMA 3S41A 4IR1A 3ZDDA 3TPQA 4PG4A 1B0TA 4UAYA 1VLYA 4Y2CA 2C3YA 1ZBSA 1YJNN 4KI6A 2MXYA 1JROA 4P4PA 2CZ4A 4XEIA 2R4FA 2E8OA 4ZVSB 2Q6CA 2BUNA 3LGMA 1WG5A 1Q8BA 2BCQA 2DBYA 1NZ8A 1U1RA 4ZCMA 2ZJQL 1WG8A 1XUPO 2CXYA 4O23A 3DI6B 4YOTA 5J2AA 4PHEA 8RUCA 1MLAA 3GPAA 3H90A 2H1YA 4ZCIA 4CEZA 2P9KB 1HHQA 1K8KB 2ZIUA 1YI2S 3PMLA 4B3MK 2W25A 4RPXA 1ZPWX 2HMXA 3MOZA 6FDRA 4YVZA 3OYNA 2Q4TA 4OPAA 1YRUA 3MMCB 3UXOA 5AK4A 4AQYF 4MJKA 2LEBA 3MXHP 2UUBJ 2E6LA 3BF4A 4HI1A 2OTJN 5KFAA 1FE0A 3SIPB 1RAJA 2J4RA 1HNZF 1XMOK 2FBXA 3B4DA 4IUFA 2MUTA 2YH1A 3K5OA 3ET6B 4OCZA 3DOMA 2P6SA 1G2EA 5ADXH 3K9JA 1FRJA 2V4JA 1ZTTA 3H8SA 7ICRA 5E3CA 2AMCB 4ZVFA 4OZ2A 2UUTA 2VUGA 3VQAA 3T6JA 4LBPA 1HUXA 5L39A 3V1OA 4CO5A 3AO2A 2C2MB 4GKKF 4BGBA 2JR5A 2FMSA 3QEWA 4GV6A 3VQDA 4CM2A 2E88A 4LSZB 2M9NA 5HMXA 1YJ9N 1EZZB 1KDHA 1QQMA 3N7RC 4DR5J 2VG7A 4QW8A 3H59A 2MHEA 1IKYA 2QFJA 3EX7B 4NLRA 4QIWD 4LF8J 1TV9A 1WKKA 1QZ6A 2DPJA 4F4XA 4NOHA 3Q7CA 3VQCA 2WAQF 5TISU 4XDDA 2FJ6A 1HKBA 3QNOA 3FEYB 3HKZC 2KXHA 3NGRA 4EP5A 2GEMA 5A6PA 4QBUA 3BGUA 4MYUA 2BACA 3VQSA 3C15A 3G4SS 1UPHA 2XY8A 2EEYA 4OYAA 1TV6A 3C14B 5CCMA 4CGGA 3SQGB 4F4AA 3FBEA 2G0AA 3I4PA 2VF3A 1T95A 3ILIA 3KJVB 2YI1A 1SV0C 3VCBA 3PO4A 4FLVA 2XMJA 5GADP 5J2MB 2K1RA 4B3RJ 4YR3A 4PXCA 3CCQN 2A40A 1Q82T 3D2EB 1TAMA 2VQEJ 4JI2K 3WQUA 3D45A 3H2VE 4DV1J 4P2MA 3M1VB 2G8IA 3O1LA 1WORA 2DRAA 2O8CA 2AYBA 3ILLA 2AT1B 4EI2A 5B0GA 3T1YJ 5GMDA 3ISND 3J7AN 3PX0A 5GAGP 3OW2M 5JLFA 1TL1B 4IOXA 2ROPA 4DXLA 5GVQA 1Z05A 4I6MA 4RCHA 3JSBA 1VGYA 4FJNA 3E66A 5E5NA 2LEPA 3RVCA 2QB0A 3AVIA 8ICFA 4BRKA 4ZVPB 3PSFA 2KG5A 3L3UA 3FZBA 4QOTA 1NKBA 4OI6A 5SZTA 5F3TA 4CBXA 4DR7F 5AQSA 4B3TF 4DX8H 1EAYC 1L6NA 1LV5A 4ECQA 3VQPA 5LOQA 4DR5F 2DO4A 3AVBA 5H9EK 2R8KA 2MSNA 3PZPA 3ZZPA 2MUTB 2LKYA 1WELA 2PMWA 3Q83A 3K59A 1VDVA 3UM9A 1BLUA 5HP1B 1V5VA 4CFCA 4RNNA 2KHOA 2CPFA 3U1MA 4MN4C 2E5HA 2Z56B 4ECWA 1IVZA 1L5UA 1N48A 2WRMA 2DKOB 1S77D 1UOCA 3BEGB 1N36F 2ADBA 1CVJA 2EZXA 4WKRA 5GMKa 3IRXB 1S4EA 4K4XA 4FZLA 4AL5A 4A8SA 2DNKA 1RXWA 2QEXS 1REGX 1RHQB 2D74B 4BDYA 4KTZA 3OTDA 2ASMA 4DB3A 4HVZA 2DTJA 4ZLLA 2JRSA 4EEYA 4H5RA 4J2DA 4QZ9A 4PJ0U 4NLNA 3M6GA 5EWEA 3ENQA 4G6VB 2IJRA 3TEGA 3CJCA 3L4IA 2MZJA 1U6BA 1N62A 4NLWA 2XSJA 5KRSA 2EAMA 4DV1F 2DR5A 3RJKA 4O0JA 2IYGA 1RDWX 4HHJA 5AQWA 2AXTU 3HWTA 4MLEA 4NLQA 2VD3A 2W4CA 4E8UA 2FF3B 1WACA 1RA7A 3I82A 2JH7A 2WF7A 3MHYA 2FHMA 1I1GA 2K8GA 3ULEA 2DNMA 3HPOA 1T6DA 5KG3A 1W97L 1R89A 1VQNS 1HHSA 2X78A 3QFWA 5IT0A 1CQNA 1UP1A 5U47A 1K73O 3KG4A 4DKWA 3AGKA 3RB0A 1VFJA 1DARA 2RS8A 4CZHA 2ZJRQ 4H4OA 5E7OB 2A6AA 3MPYA 3KKAA 3IG1B 3R27A 4GY2B 1VQLN 2ZG6A 2ZKUA 4F7VA 1FJ7A 2D1CA 4KKOA 1M1GA 1U1PA 2JLFA 3DOLA 3HYFA 4F72A 4YY3K 2YKAA 3BN4A 3FKBA 2ATCB 1YZ6A 3QIDA 3RW7A 4DSEA 2HS0A 2YTCA 4OHVA 4DPTA 3UFCX 3AO3A 3B78A 2HFOA 3RBZA 1WHVA 4B3OA 4L75A 4OPKA 2ZM6J 5D46A 5KG0A 1REVA 5ETLA 4R64A 1UW4A 1QY7A 3BY5A 2O67A 2G2OA 4CEDA 2GA7A 2RE2A 1NU4A 2Z0GA 3CO9A 2PMZC 3U02A 3KK2B 3GDXA 2NUUG 3C8YA 1IBLK 4B17A 5HNKA 3F2BA 4LRCA 1COOA 5AXNA 1PGZA 3GILA 2IM2A 1X4BA 2EAOA 1DTQA 4JI5J 1NK7A 3BDPA 2DRDA 3MXMA 3SQ0A 1ATNA 1OKJA 2ES6A 5EDWA 4H4KC 4CLTA 1LVHA 2YKNA 3SXLA 3TOQA 3NCIA 2WB1F 4WJ3B 4A46A 3UCZP 4I2IA 3M6ZA 5AQPA 3KJVA 4NL5A 4JS5A 5A2QY 4KHYA 1S3XA 3WK5A 4MF2A 2UXBJ 1UVJA 3M8RA 2KVCA 4PCQA 2JMGA 4P52A 2F63A 5DDOC 2D0AA 3ZX3A 1PBAA 2VU5A 5F0WA 3OTEA 3PYDA 3WNHA 4IFYA 3DXBA 2V63A 4OJLA 4CCHA 1NDPA 3DU5A 1JXLA 2JFKA 3U26A 1RT2B 3RJFA 1JCEA 4E1NA 1I39A 2WHEA 3SI6A 4MHVA 4UBCA 1VHFA 3NCQA 2JZBB 2BE2B 3VETA 3KJFB 3GIJA 1HWLA 1OO0B 3DM2A 5AR0A 1KTVA 4RNMA 5AKGA 3WBZA 3I96A 3U1NA 4DHVA 3UD5A 4TUPA 1XN9A 3S1TA 2BANB 1VCTA 1QQ7A 3T5KA 2GCFA 2BCUA 3DLLQ 3TAPA 2MQLA 4GC7A 4ISEA 4F0KA 3R9PA 4PH5A 4QYZJ 2WVDA 3MCOA 2YBVA 2ZH2A 2HFZA 3QPIA 3H20A 2JH1A 1Q86T 4OLAA 3RJJA 1VSDA 3DLEA 5K8OA 4M95A 3MCNA 2L9NA 4ZVQB 1B99A 3U4LA 5HO4A 2MTLA 5KPZA 4DR6K 5M2UA 5IZHA 3JAMU 4U67Q 3OA9A 1HNWF 1SV5A 5J2NB 3LZJA 4PQAA 1MU2A 2PYJA 3OSNA 2D3DA 4LF6J 2OWOA 3PYEA 4CIEA 3DLHA 1NB7A 1S48A 4DPYA 4AHVA 1KLNA 1BOTO 1D8BA 3CMES 2VGMA 3TWZA 4P10A 1TKXB 2EW9A 1PK1A