4EZ9A

Bacillus dna polymerase i large fragment complex 2
Total Genus 197
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
197
sequence length
578
structure length
578
Chain Sequence
KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of a High-fidelity DNA Polymerase
rcsb
source organism Geobacillus kaustophilus
molecule tags Transferase/dna
molecule keywords DNA polymerase
total genus 197
structure length 578
sequence length 578
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4ez9A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4ez9A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ez9A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ez9A01
2AQ4A 1J5OA 3H4DA 2FMPA 4J9KA 1ZQIA 4OVLA 4FK2A 4ECZA 2IOCA 1BCOA 4CGHA 4YMNA 3OHBA 3C23A 1S0MA 2D0CA 4UB4A 3GFKB 1NKBA 1UT5A 2AGOA 1S5JA 3C2MA 2JZBA 3L2QA 1BCMA 4DLEA 3LWLA 1L3TA 4E19A 4IQTA 5J0SA 4W5TA 4CGFA 4F93B 1ZBIA 3OYCA 4CEAA 3T3FA 4YCXA 5KT6A 3RJIA 4OGEA 1RTJA 4R8UA 1ZQOA 3TQ1A 3F9KA 4Z6FA 1NK6A 3CG7A 4C8OA 4JS5A 3KHGA 1NK4A 7ICLA 3L2VA 4CHPA 1LB2B 9ICQA 4KLEA 2PI4A 3TWHA 4UB1A 4KI6A 4Z6CA 4ECVA 4DTUA 1ZQNA 1S1TA 1KFDA 5HHHA 4YFUA 3EY1A 4FZYA 4KHSA 2HHXA 2HHVA 3BGRA 4GC6A 1XHXA 4FK4A 1RBTA 3NFAA 1RBVA 5EWGA 2E6LA 2FLPA 3PUFA 4DTNA 1R0AA 3PX0A 4JK1A 5DBCA 1Z26A 2XGQA 1VK0A 4I2QA 3S3OA 3PW5A 1N48A 5DBAA 4CK3A 4ECUA 4MF8A 3MR3A 2ZUCA 3L3VA 5DGBA 2B6AA 4OKJA 5EWFA 4CF8A 3T5HA 3AVCA 1BPEA 5J2NA 4DSEA 3OYAA 4N76A 5J0TA 2F8TA 1HYSA 1WNSA 5HNKA 1BQMA 1S1UA 2FBTA 3DM2A 4M9HA 3PVXA 5DQGA 4P4OA 5KGXA 5KFZA 3ZDAA 9ICWA 4O0IA 4KRFA 4DOBA 9ICEA 4IR9A 1I3AA 3TAFA 1A77A 4HCCA 2RN2A 5CYMA 4M42A 4FZZA 1N6QA 5KFOA 2ZJAA 3JPRA 4GLXA 2R8KA 2FBVA 4E89A 3NF9A 3H8WA 2RKIA 3ZT2A 4KFBA 1ZQWA 1D5AA 3LP1A 4KHNA 3PNCA 5KFAA 2KN7A 2AQ0A 2GUIA 4I2EA 4KLQA 3QEAZ 4J9SA 3ZSXA 4FZXC 1X9MA 4ECXA 2X74A 4FO6A 2YNIA 8ICCA 1ZQMA 1IXRA 5CB1A 2ETJA 4B8CA 1DOQA 4F8RA 3K59A 5JS2A 7ICUA 5KFRA 4KV8A 4DOAA 3MABA 4B3OA 1IG9A 1ZQAA 2QK9A 3IRXA 1HUOA 4CE9A 1HRHA 4CEOA 2BQRA 3HP6A 2FBXA 1L3UA 3KLHA 1ASWA 3RJHA 4RT2A 2XRIA 4F5PA 1ZJMA 1KDHA 4CFAA 1DGSA 5IIKA 3BQ1A 7ICOA 3RMAA 1WSGA 1C0MA 5KFNA 4DL6A 2X6NA 4MFCA 3GV7B 8ICZA 2UVRA 4E7JA 2Y1JA 3JPQA 3HX0A 3HP9A 4HHTA 3CM5A 1LWEA 1D9FA 3ZSYA 1YVUA 3IG1A 4CK1A 3I8DA 4O5BA 8ICPA 4JRPA 2BCUA 3PW4A 5HRNA 3VQ7A 4ZHRA 1C0TA 1YT3A 4DL5A 2HVIA 1REVA 2G8KA 2LSNA 4Z6EA 3TANA 4J9OA 2FPKA 7ICMA 4EBEA 2FPLA 1UAXA 2A1JA 3WNEA 4IKFA 1FKOA 4FJ7A 5EWEA 4O3QA 3TAGA 3QINA 7ICTA 1RBSA 1IKXA 4BE2A 4LZDA 1C1CA 4DSJA 3JPNA 4N5SA 4F4YA 2WONA 9ICTA 1U4BA 3ZD9A 2ISPA 1VSLA 1DTQA 3FDSA 4TSXA 5FDLA 5KT5A 3OYDA 5D4BA 3S9HA 3PW0A 1ZJNA 1KVCA 5DB8A 4BACA 4CF0A 3AVLA 3H08A 1LW0A 4J9LA 3RRGA 2AJQA 3NHGA 3M8QA 4JLHA 4R8UB 4FJMA 4BXOB 1S9FA 3SJJA 2XO7A 1VRTA 1UOCA 3RB0A 1MQ2A 4O55A 4CHZA 4O3SA 4E7KA 3KLGA 2BGGA 4ELUA 2RF2A 2ASLA 3HT3A 4FJKA 1KEJA 1JLCA 1T3NA 3RJGA 5IIOA 3NF8A 5J2AA 3NGYA 4OKEA 4ED8A 4KHYA 4NM2A 2P1JA 3V9SA 3LP0A 2BE2A 5HP4A 7ICNA 8ICSA 3MECA 3AVGA 3HXMA 4CGIA 1TGOA 4DOCA 3WNGA 3CYMA 3ZT0A 3UIQA 5C24A 2KQ2A 4M9JA 3HL8A 4KLFA 1RDBA 4HYKA 1KVAA 3L2RA 5CZ2A 5HMLA 2HB5A 2VA2A 1A5XA 4DL4A 4RW6A 1ZQYA 4UB5A 3N4MB 3PMLA 1BPZA 3LP2A 5DK5A 5IIMA 4QAGA 5J0XA 2W8KA 2KW4A 4AHSA 1IH7A 3C21A 2GBZA 1QTMA 2KFNA 3HJFA 5HBMA 3O4NA 3IS9A 4J9NA 3LDAA 3MDAA 2DPIA 4NCAA 1TFRA 2ATLA 3VQQA 2ISOA 4Z4CA 2JGUA 4J2EA 5J0QA 1LAWA 3AO1A 3QESA 1ZQGA 4RQ5A 3RR8A 4DTSA 1NOYA 4IQUA 8ICKA 1JLBA 3HPGA 1BPYA 2DFEA 4FLYA 1Y97A 2ZJ8A 5DB6A 3HK2A 3C5FA 2B5JA 8ICVA 5DG9A 5DB7A 7ICPA 5HLFA 5IIIA 2HNZA 3V9UA 8ICOA 5KFHA 3OSNA 3FFIA 3V6DA 4KITB 2ZUDA 4F2RA 3PO5A 8ICRA 3K2PA 2QXFA 4K4IA 4KO0A 5DQIA 4O44A 4DEZA 3KKSA 4FJ8A 4PH5A 4M45A 4M41A 4JV0A 4FS2A 4EYHB 2PYJA 2PFPA 4DU4A 3OS0A 2FLLA 3UQ2A 1L3SA 4Y1DA 1IKYA 2XY7A 4E1MA 1HQUA 2KZZA 4GMJB 3JSMA 2F96A 3GV5B 4P4MA 3VN5A 4P2HA 4CJRA 3AU2A 5DLFA 3RBEA 3CFRA 4E7IA 3LWMA 4TUPA 1N5YA 4MFBA 2I1QA 4BDPA 1C1AA 2VWJA 1WLJA 4FCYA 4CHNA 3QERA 4RQ6A 3RRHA 3ZDEA 4FK0A 3NAEA 1MU2A 2C2RA 3VA3A 4I9QA 4M3TA 4XQ8A 5KFEA 4BWMA 2OPRA 4YXJA 3KLIA 1ASVA 4CHQA 4KLMA 2HHUA 3TAMA 1S1VA 4ID5A 3LP3A 1VSMA 4CGGA 4PWDA 4KLIA 1EP4A 4Y1CA 4DLGA 3EPIA 2UVUA 1QLNA 5IILA 5KFMA 1A76A 4N47A 1ZBFA 2D0BA 1TK0A 4RW8A 4JV1A 5FROA 2UVVA 7ICGA 3SUNA 4QZBA 4RQ1A 4EP5A 1RTDA 3GIJA 3AA3A 4WE1A 1GOAA 2XHBA 2VWKA 3EYZA 1T7PA 3ISCA 4IFYA 3AUOA 4CERA 4E7LA 3GV8B 3KD5E 1ZBHA 4I2CA 1JXLA 4Z4EA 4M6WB 4CJPA 3KIOA 3Q8KA 1RT3A 5CA7A 1B9DA 4ECTA 1WAFA 1ZQVA 5DBBA 3VQDA 1Q8IA 3C95A 2I9GA 1RT1A 3LAKA 4LSLA 4AHTA 4YG2A 3OS2A 5HRPA 2G8WA 4FXDA 4DS4A 4LVSA 4M3UA 4I27A 4NYFA 2HMIA 3DLBA 1B22A 4M3RA 4LH4A 2OYQA 2D0AA 1XU4A 4DFPA 3M8SA 4E3SA 1D8LA 4M3WA 1VRUA 4FS1A 4NLGA 3M9OB 3C2KA 1ITGA 3GILA 4AH9A 4KPYA 2KZMA 4CJUA 2VG6A 1TKXA 1HYVA 4F5RA 3OYBA 4I2HA 3VA0A 9ICCA 4Q8EA 4PPXA 2P51A 3H40A 3K4GA 4DWIA 3OGUA 2UVWA 3VQAA 4RG8A 1S0NA 3Q8PB 3SQ2A 8ICLA 1G15A 2V9WA 8ICNA 3V9WA 5KG4A 4IQVA 1KLNA 3RJJA 2PZSA 4B8AB 1MQ3A 3ALYA 1TVRA 3KK2A 9ICGA 1IO2A 4F3OA 4PQUA 4RPZA 1TVAA 2HNDA 2O4IA 4RUCA 2XY5A 1ZQTA 3L8BA 4FW2A 2W42A 7ICSA 3RB3A 4J9MA 1JXEA 4QWBA 3D0PA 4FJHA 4AHVA 3V7LA 5J1EA 1JLEA 4EYIB 2DPJA 3MXJA 3SUQA 2BGWA 1CZ9A 4F4ZA 2BPCA 3CFPA 2Z1JA 4QWDA 3LK9A 1WSEA 4CJFA 5D46A 2G8IA 1EKEA 1RYRA 4O5CA 2ITGA 5DLGA 3SV4A 4DL2A 1TKTA 4YD2A 2PYLA 2M9NA 4DTOA 9ICIA 4CF1A 1KFTA 3SUPA 2DFHA 1WN7A 1SL0A 5HMMA 3QIPA 3RR7A 3ORYA 3K75D 9ICPA 2F1IA 5J2EA 3AA2A 2ASDA 1RCHA 9ICBA 9ICVA 2Y1IA 2J6UA 4JWMA 2X78A 4CFCA 4DMNA 3RJKA 1RNHA 5DG8A 1NKCA 2PFNA 2V4RA 1JLAA 3PX6A 2IC3A 4R66A 3ISBA 1VSDA 2XCAA 3ITHA 3UXNA 1Q9XA 4OGCA 4QZGA 4RQ0A 4CIFA 3OYMA 3DLEA 4QW8A 4I9LA 4RW9A 3KJVA 1U47A 3OHAA 4EBCA 1TAQA 4X5VA 2NRTA 4W5QA 1PZNA 3V72A 3VQCA 4DS5A 2YNHA 4CJ3A 5KT4A 1C6VA 3V1RA 2YHAA 3B0YA 4CECA 4B9MA 4LSNA 4DU3A 4GC7A 1JN3A 3KLEA 1Z25A 2JZBB 2IBKA 1HUZA 3OVNA 5EOZA 5IIJA 4QCLA 2ZTCA 2EHGA 4I2BA 4J2BA 3VQEA 2IHMA 3NGDA 4GW6A 4KN4A 4RPYA 2NUBA 1SKRA 1ASUA 4CJVA 1RT5A 2C28A 1ZQQA 3DRPA 1ZQSA 1Z00A 5DQHA 3MGIA 3AO3A 5J2JA 7ICIA 2ALZA 4CHYA 1C0UA 1KTQA 3V4IA 4UAWA 2P6UA 1S97A 2G8UA 3L2WA 4TQSA 2AGQA 5BOMA 5DGAA 1YTAA 4ED7A 1EX4A 2IAJA 1C1BA 1IKVA 1VSHA 5CJ7A 1B43A 4MEYA 3RJFA 5J2HA 4AILC 1J9AA 1ZQZA 4DTPA 4UQGA 1QHTA 2ZQBA 1LV5A 1ZQCA 4MQ3A 1EXQA 2J6TA 4UAZA 5KG1A 3NH0A 1Z3EB 3QEVA 4CJTA 4M2YA 1U49A 4DFMA 3DRSA 4Z0UA 3DLGA 2HHQA 2O4GA 3ZSZA 4GVMA 4RQ3A 1AROP 4PHDA 3MGHA 8ICHA 3HW8A 3MFHA 1RT6A 3ZDBA 4CJ5A 1WAJA 9ICUA 4M6WA 1WSHA 1S9EA 4BXOA 2QKBA 4DSKA 3VQ4A 4FW1A 4FLUA 3VQPA 5L1LA 5E41A 4C8LA 4R63A 4RQ2A 4AHCA 1X2IA 3LZIA 4IRCA 4UB2A 4JRQA 9ICKA 3QEIA 4KLJA 4ECSA 2J6SA 4OPJA 1WSJA 4I2FA 5KTQA 2FC0A 2Q0ZX 1NKEA 4ECQA 1RPLA 1TK5A 1D9DA 3BQ0A 3DMJA 2P66A 4CIGA 1QSSA 3NE6A 3PX4A 1NOZA 2V4QA 4B9LA 4RU9A 4FBUA 3MXMA 4Q5VA 4FJ5A 1K1QA 2E6MA 3P83D 1HYZA 1BIZA 3B6PA 1L5UA 4J2DA 5J2IA 4RPXA 3E01A 3T5JA 1BQNA 5L1IA 2BKEA 9ICHA 3PMNA 3OY9A 4PHPA 1T03A 1SL1A 3M9NB 3DRRA 4YP3A 4B9NA 4OLAA 1DTTA 1BVSA 4GXIA 5KI6A 2LYHA 2VA8A 2RDIA 2NRZA 2MAXA 4DQQA 8ICGA 1CEZA 3WNFA 3OJUA 1W0HA 1KCFA 4IRDA 9ICRA 5KFIA 5TZVA 1CUKA 2WTFA 2F1HA 2IHNA 3OYFA 4R65A 5J2FA 2E4LA 4FVMA 9ICAA 1ZBLA 4J9RA 1ZQEA 1ZBUA 4FM0A 2A1RA 4CGJA 4FLXA 2EX3A 2Z1HA 5BPCA 5KFTA 1HJPA 4O3OA 3U3GA 3AVJA 3RB4A 4EZ6A 4CF2A 5KG5A 4C8KA 2A1SA 3OYGA 1BPDA 4I2IA 3RWUA 4ED2A 1NK9A 2B4JA 3LZJA 5CZ1A 3RAQA 2FPMA 3PR5B 4IR1A 8ICQA 3OYNA 3NF7A 3UPQA 3G6XA 4I2PA 3TFRA 5L1JA 4Z4HA 5KFQA 1SL2A 3TR8A 5L1KA 4ELVA 2OZSA 4FJNA 3DLRA 1TK8A 4ECRA 4CFDA 4EZ9A 5D3GA 4ELTA 4KB0A 4F2SA 2OZMA 4JV2A 4KHQA 3RB6A 4F5OA 3ZSWA 2ZD1A 3DLKA 2OPSA 3GDXA 1TKZA 2R7YA 2VA3A 4YR0A 2G8FA 2G8VA 1CLQA 4CJSA 3HPOA 3FYHA 4M04A 1TL1A 3HVTA 4RQ8A 4O3PA 4YMOA 5DMRA 2C22A 3H8SA 3OYJA 1QQCA 4TURA 3SCXA 2RPIA 1RDDA 1QS4A 3NF6A 3B6OA 3G0ZA 1VSKA 3JYTA 4EEYA 4XRHA 4GXJA 2IMWP 8ICXA 3G6YA 1MC8A 5KT2A 3QNOA 5J0YA 3D45A 3NCIA 3ZSVA 1WSIA 3OJSA 4CGDA 3OYIA 3E2EA 4ED3A 3RBDA 1S10A 7ICRA 5J0OA 5SWMA 4FM2A 3TI0A 1BHLA 1XC9A 1LWFA 4FLWA 5HHIA 1FK9A 3NH1A 4M9LA 3BQTA 4M0AA 3MR2A 3SNNA 3ISNC 3ETLA 5KFXA 3HVRA 3IHQB 1ZQDA 1JMSA 5L9XA 1BI4A 4CEEA 3GIIA 3NBPA 2BPFA 4BE1A 4KLSA 3AA4A 4OKKA 1GOCA 3U6FA 3DOLA 1RZTA 4QZ8A 4QZIA 4KTQA 3MXIA 5CHGA 4IDKA 3M8RA 4N56A 4F4WA 4M9NA 4F3TA 5KFVA 1SKSA 1FXXA 4ZTJA 2HW3A 4MFAA 4JUZA 2C2DA 4CJQA 1S1WA 1VSIA 7ICKA 3C5GA 1T4GA 3HPHA 2Z1IA 1IKWA 4H4MA 4F50A 8ICAA 3SPZA 3T5LA 1KLMA 2W9BB 4ED1A 3GIKA 4DSFA 4AHUA 1S9GA 2BHNA 3PW2A 1CXQA 1XO1A 1UA0A 3ZCMA 1RT7A 4CJ4A 1YTUA 5KFFA 4KLUA 3V1OA 3F73A 1S76D 3O3GA 5KFSA 3ZDDA 4I2JA 5F9LA 7ICQA 3P1GA 3G10A 4BE0A 2XY8A 1NK7A 1Q9YA 2W9AA 4QZCA 2BCVA 4FLTA 3WNHA 4RNOA 4RW4A 5CR0A 1RYSA 1ZQLA 4CK2A 4O5EA 3RMCA 1JKHA 1NK5A 4M3ZA 5KFKA 1JLQA 3S3NA 3UQ0A 3L2UA 4W5NA 4O3NA 3CM6A 8ICYA 4KTWA 2H5XA 3K58A 3OS1A 4HUEA 3I0SA 4F5QA 1U48A 4KAZA 2BANA 5J0RA 3AVIA 5EU7A 3T5KA 3B0XA 2YKMA 1WCLA 1Z00B 2HVHA 3I0RA 4BWJA 3V7KA 4XUSA 5KT3A 2PXIA 4ECWA 4RQ4A 3HYFA 5KFBA 4K8XA 4PY5A 3S3MA 3QIOA 1CZBA 1NJXA 7ICEA 4E0DA 1FKPA 2VG5A 4ZTFA 2JEFA 5KFJA 3DI6A 1XSPA 3SQ4A 3QEPA 1L3VA 4Q8FA 2F8SA 4FJXA 4O3RA 2W9BA 4FYDA 2JLEA 2BCRA 4TUQA 4F91B 2GWSA 4YNQA 8ICJA 3MBYA 5KRSA 3BQ2A 1K6YA 2YNFA 4OLBA 4CFBA 1U45A 3VQ8A 3PV8A 4DQRA 4ID1A 3ZT3A 3SV3A 5SZTA 4Z4GA 1RDCA 5HP1A 2ATQA 4K4GA 4R5PA 3DLHA 4DFKA 5J0WA 4ED0A 4NXZA 3KK3A 4I2AA 2W9CA 3AA5X 2FLNA 4QOZB 3QLHA 1BPBA 4R64A 1HQEA 4Z4FA 4B9UA 5J2BA 5KFLA 3RH4A 3U3YA 4DQIA 4YFKA 2C2EA 4DL3A 4W5OA 3EPGA 2D5RA 5KGWA 5KG7A 3BJYA 4IFVA 5J29A 3EW9A 2ZTDA 4PHAA 4O0JA 1MSWD 1N56A 1UWBA 2IDOA 3C1YA 4PGQA 4IRKA 3LAMA 1K1SA 1B92A 3MEEA 2JEJA 3MEGA 3QZ7A 2F1JA 3LALA 4NLNA 5J2GA 4DTJA 1V9PA 4KN7A 3H8JA 1XSNA 1X9SA 3QETA 1S0OA 1EETA 3V81A 4CEDA 4F4KA 5HRRA 4MFFA 4B08A 3O4QA 1W9HA 3N97B 1NJYA 3V9ZA 5KRTA 5CY4A 5KG6A 1KVBA 4QZAA 9ICJA 4C8MA 3C94A 4G1QA 1LWCA 2IS3A 2JEGA 2ZE2A 2IGIA 4G3IA 3ULDA 4BDZA 8ICEA 2ZJ5A 3HM9A 4RNNA 3C6UA 4Z6DA 3NGIA 5BOLA 4JS4A 1RILA 4J9PA 1RDAA 4UBCA 2KTQA 4CEZA 8ICUA 2YKNA 3JPPA 4QZEA 3GQCA 3TAPA 1BI4B 1B9FA 4XA5A 2ZUBA 4UB3A 9ICOA 4FBTA 4TUSA 2Z1GA 3AVKA 1NJWA 2OPQA 2B21A 3MEDA 3ZSRA 4KHWA 3EWAA 3HWTA 4FM1A 2G8HA 1LAVA 3ZSOA 3T1AA 4MF2A 4Z4IA 4KB1A 9ICLA 5KFUA 1ZQPA 5DDYA 3TFSA 3A2FA 8ICIA 4H4OA 2DFLA 3HO1A 3V6JA 3KLFA 3RTVA 1ZQUA 1RT2A 3KHRA 4NLKA 2VG7A 3AV9A 4CESA 1BISA 3KHLA 2NRXA 4LY7A 3C6TA 4BGDA 1KSPA 4J9QA 4ECYA 3KD1E 4PGYA 4YMMA 5DB9A 4DTXA 1VSJA 3T19A 4CJWA 2VANA 4CEQA 1TL3A 1ZQHA 3QNNA 5KFYA 1C7YA 1WSFA 4FJLA 4DF8A 2KFZA 3QEWA 4KREA 4F4XA 2BQ3A 4IQWA 2YV0X 3SI8A 5K14A 1HPZA 3V1QA 4F92B 9ICSA 1TV6A 3SYZA 2X6SA 2NRWA 4HTUA 3RH6A 2BR0A 1Y88A 1WCNA 4RZRA 5CYQA 3TARA 4OPKA 8ICFA 4Q44A 1TAUA 3K5NA 3RMBA 2NRVA 1NOMA 4NY8A 3SZ2A 1S6PA 4MEXA 2DFFA 4Q0BA 4CCHA 2XCPA 1QSYA 3KTQA 3OYKA 3K5LA 1RBUA 4KMUA 4RNMA 4DSLA 8ICWA 4DU1A 1J54A 1JLFA 1A5WA 3VQ9A 3AO4A 1BGXT 3NGZA 2MUTB 4YR2A 5J0UA 1KRPA 1X9WA 3C2LA 5F9NA 4UAYA 3L3UA 3OYLA 4B9SA 4I28A 2XC9A 5JS1A 2W9CB 3ZD8A 4J2AA 1TKDA 1T05A 2RDJA 3SQ0A 1I39A 1VSEA 4ED6A 2AU0A 3UXPA 1F21A 3QEBZ 2R8GA 2JEIA 1S0VA 4ZH4A 4DL7A 4GXKA 3LDSA 1U04A 1COOA 3G6VA 4EP4A 2DTUA 4BDYA 4I29A 2XY6A 3DYAA 4YR3A 4DQSA 4QW9A 5J2QA 3KHHA 3UXOA 3Q8MA 4QWEA 4RUAA 4IBNA 2PI5A 1J53A 3THVA 4O9MA 4CJLA 1HNIA 4P4PA 1HMVA 5KFWA 3GIMA 1VSFA 4YN4A 3IM1A 1NK8A 1DLOA 3AU6A 4CJKA 3AVMA 3SPYA 1S77D 4DF4A 5C42A 2BDPA 2WOMA 3CFOA 4O5KA 2R8HA 4DSIA 4FJGA 1UT8A 4KLTA 3V7JA 3TABA 4F5NA 7ICFA 1XS9D 3ISDA 2ASJA 4KLOA 1JX4A 1S6QA 3K5MA 5C5JA 4YVZA 4CIEA 1NK0A 1ZQJA 2IA6A 1SV5A 3ZDCA 3Q8RB 1TV9A 3MFIA 3P5JA 3QEXA 4QZHA 5J2MA 5KFPA 3NDKA 1A5VA 1GOBA 4HUFA 4QWAA 4PHEA 4HVJA 1JL1A 4QZDA 1SZPA 1JL2A 2GV9A 1BIUA 3VQBA 3V9XA 5KFDA 2P6RA 1RXVA 1CXUA 3C1ZA 4KKOA 4KLHA 3TAEA 4M9GA 4FLZA 5FRMA 2YNGA 2FMSA 9ICMA 4LZGA 5KT7A 2FMQA 4M3YA 3RH5A 4KLDA 5T7BA 5J2CA 1ZYQA 4DQPA 1EXNA 1HJRA 4N41A 4JWNA 4M3XA 3SUOA 1QSLA 2HHSA 4HUGA 4E7HA 4B9VA 2W9MA 3BDPA 3O3HA 4KLLA 5HROA 4UBBA 3EZ5A 1XSLA 7ICHA 3Q8QB 2BCQA 3MR6A 1H38A 2PFOA 3VQ6A 4FJJA 4NCBA 3PY8A 2HHTA 7ICJA 2I5JA 3JPTA 3KKRA 4LH5A 1SKWA 1RT4A 4Q45A 4K8ZA 2QKKA 3ZT1A 5KG0A 4B9TA 4C8NA 4RW7A 3OYHA 7ICVA 4Q43A 4CF9A 4PGXA 1JLGA 4XIUA 4ICLA 4O4GA 4I7FA 5J2PA 3CQ8A 4DTRA 1KFSA 5IINA 3ZT4A 1ZQFA 3PR4A 4KI4A 4YXMA 1XWLA 3PO4A 2PY5A 5D49A 1BL3A 4RT3A 5FRNA 1XI1A 3M9MB 3ASMA 5KFCA 5KG3A 1ZQBA 4TQRA 2OWOA 1SUQA 3NH2A 2FBYA 5DG7A 3SQ1A 1O1WA 2YHBA 3DOKA 3LANA 3JPSA 4CEFA 2HHWA 5J2DA 3AVNA 5DKWA 4KHUA 4W5RA 1ZQXA 2BPGA 1ZETA 3AVHA 4OJRA 4HCBA 2OA8A 3RJEA 4FLVA 3AVBA 4QZFA 3Q8LA 4KLGA 3V6HA 1LW2A 5JUMA 1QE1A 5I42A 4CJEA 3O3FA 4AHRA 3JPOA 3AVAA 2BCSA 5KFGA 5HRSA 4KTZA 2Q3SA 4M47A 3QE9Y 4YQWA 1UA1A 3Q8SB 3OYEA 3RMDA 4RQ7A 4PUOA 2HNYA 9ICFA 1RTIA 3QO9A 2MUTA 3M8PA 1BPXA 4YD1A 4QWCA 3OSPA 3H4BA 4E1NA 1HNVA 4IG0A 3AVFA 1S1XA 4I2DA 2BQUA 2OPPA 3RAXA 4CHOA 4FJ9A 3ZSQA 1RXWA 5CP2A 2W8LA 1NJZA 3MR5A 4K4HA 3KK1A 3K57A 4L8RB 2P5GA 4NCGA 3V6KA 2R8JA 3PW7A 4NYNA 8ICMA 5C25A 4EBDA 3IAYA 3MDCA 2R8IA 4LD0A 9ICXA 3HSTB 4DO9A 8ICBA 3VQ5A 3AO2A 1ZQRA 1IM4A 4DFJA 9ICNA 3LPTA 3K5OA 3LPUA 1U9LA 4I2GA 1RTHA 8ICTA 4NLZA 3AO5A 4PA1A 3NTUA 2A1JB 4QZ9A 3TAQA 3QZ8A 3H7IA 2KZ3A 1T8EA 5J2KA 4NM1A 4IG3A 1JXBA 3MAQA 1JIHA 1X1PA 3SI6A 1XHZA 2P5OA 2ZTEA 4H8KA 4CEBA 5CWRA 5KG2A 2PFQA 2XGPA 5I3UA 4FJIA 1RBRA 1ZQKA 4DTMA 2AGPA 2DY4A 5DDMA 4DG1A 5J0PA 1D8YA
chains in the Genus database with same CATH superfamily
4UT4A 1WBBA 2KXNB 1GX6A 2F44A 3MGJA 5C15A 3A3NB 4EHUA 1J5OA 2XMMA 3VQTA 4FK2A 2QA4G 4LF4K 1R8PA 3DGPB 1WHYA 1BA0A 1NBWA 1V3SA 3WT0A 1WUAA 2OEKA 4Q0BB 3BGLA 3FCVA 2RF2B 1S0MA 1G7CB 2OUGA 1UT5A 2AGOA 3GE1A 3C2MA 2RHQB 3L2QA 3ILLA 1BCMA 3H45C 3EKUA 1L3TA 1RSCA 4IQTA 3FJ2A 2DH8A 2RKIB 2E1EA 3EGNA 3VTIA 4CLFA 2ZM6K 2MSSA 4KFBB 2HHHK 1ZBIA 2KB2A 2CA9A 3J81j 2LXFA 1PJ5A 3CCQS 2LU1A 2NXEA 3RJIA 4OGEA 3O4WA 1PKUA 3F9KA 4OYOA 1FFSB 3KHGA 2FHJD 4JS5A 3SSQA 1LB2B 3NNAA 4KLEA 3AY9A 4UB1A 3EX7B 4JN4A 2LQBA 3UDCA 3CPEA 2K2PA 4O4GB 4C7YA 4DTUA 4MK9A 4OD0A 1ZRNA 1WG4A 2R7XA 1YDLA 1KQGB 5HHHA 4ZHRB 2Q4TA 5C2DA 2ZZTA 4ZPDA 3BGRA 3EUB2 3N7RC 2YHXA 4KT0C 4FK4A 2FLPA 1Z4UA 2ITMA 4DTNA 3NKYA 2X1AA 2XYGB 1WDDA 1FKOB 3PX0A 2OKQA 3TTDA 5F8MA 1VK0A 2OPPB 3PW5A 1KDNA 2WF7A 2HK3A 4MF8A 4OJLA 3SBMA 4Y2AA 3Q7BA 4QIWD 3QU7A 1IN0A 5HAOA 3AVCA 2WFBA 4K4XA 4DSEA 2GGPA 4Q2MA 1GMWD 5J0TA 3OL7A 2YVSA 1WNSA 3MD1A 3TNVA 1BQMA 2FBTA 2ZXIA 3GL1A 3VEOA 4OZ0A 1B7FA 4P4OA 3ZDAA 3L3FX 5DZ7A 9ICWA 3HF5A 2IRYA 4LSLB 1AQ6A 1OH5A 9ICEA 2A0FB 1HBMB 2R2RA 5CYMA 4HCCA 4M42A 3QAEA 5FD1A 1N6QA 3UO0A 3TPQA 3JPRA 4XK8C 3MM7A 1WWUA 2YX8A 4LT6A 4FZLA 2J9DE 1N34J 4PHTX 3IWNC 1RABB 1D5AA 4BRGA 4KHNA 4NLQA 1YJNN 3V81B 1HIWA 3HFZB 3OFEA 4XH5A 4I2EA 3R3LA 4KLQA 3QEAZ 1QQ6A 1RHMB 2LEBA 1X9MA 4X64F 1W7AA 1NGAA 2E8PA 5I42B 2C2NA 3VAMA 2ETJA 4B8CA 3HOSA 4OZ2A 2UUAK 5JS2A 2DRDA 2XNRA 4DL0C 3QT7A 1URNA 3MPDA 4JEPA 2DITA 1DTTB 2MMYA 3MABA 1VYAA 2EG1A 3C66A 5LMNJ 3IKMA 4UY8T 3EDRB 4WFNQ 1J97A 4CE9A 3PM9A 1HRHA 3DAWA 4CEOA 2BQRA 3C16B 3KLHA 5E3QA 3SAHA 3NRZA 5B0DA 3MUMP 4TN2A 1ZJMA 3WKCA 1DGSA 3U4LA 3RMAA 3VOVA 5LXYA 2LKYA 3O2IA 5M1PA 4JP8A 4E7JA 2MQOA 3JPQA 5ETOA 2CQ2A 4HHTA 2K3KA 1LWEA 3N6NA 3IG1A 4CK1A 3LW5C 3I8DA 4LFBJ 5B0BA 8ICPA 2P9NB 4JRPA 2CGJA 3KNAA 1C0TA 5D78A 1YT3A 2B9EA 1Q8KA 2LI6A 4Z6EA 3TANA 5T7LA 2AIRB 5ALOA 5CRXA 3CPWR 1NMNA 2OSQA 5AM0A 4ZVEA 2BJ8A 4WCEQ 1IKXA 1RDFA 4ZVUB 4CO3A 4OPHA 1IKXB 2D1CA 2BKOA 2MXYA 2Z30B 3WK6A 9ICTA 2H3IA 1DTQA 2GVZA 2WONB 1N36J 2VGMA 5FDLA 5KT5A 2XLKA 3TZZA 3OYDA 3UB5A 3W65A 4FOEA 1KN6A 1KVCA 4OJ5A 4HH0A 3VAFA 3DLLL 4WK3A 4KR0B 1KN5A 3B78A 2NV3A 3R7BB 3H08A 4J9LA 2AJQA 2DR8A 3MAAB 3HHLB 4JLHA 3VMFB 4UOHA 2JHEA 4RX6A 2UU9J 4O3SA 4E7KA 4OX9J 1V3RA 4ELUA 3GZ7A 4CP5A 1T3NA 4P2XA 4P10A 3NEKA 2BRKA 3UD4P 2BE2A 3S8SA 2I5HA 1HJOA 3AVGA 1ECWA 2A10A 1L7MA 4CGIA 1RAGB 3ZT0A 4DOCA 2LU2A 5C24A 1T9XA 3D1OA 2YHYA 3HVWA 4NXNF 2AA4A 4HYKA 4MDAA 1JJCB 2GEMA 1A5XA 1VOMA 2ZC4A 4ZCLA 3N4MB 3E01B 2KU7A 1P90A 5J0XA 2W8KA 4RBTA 2KW4A 2NLXA 1IH7A 4M63C 2GBZA 1QTMA 3GSDA 4RNFA 2GGPB 3OTEA 2P35A 1VLBA 2QLWA 3CCSN 3LDAA 3V5RA 3VQQA 4Z4CA 1DJ0A 2JGUA 3S6EA 1GLCG 2GVZB 2VJVA 1NO8A 4UZCA 3TAMB 4LRDA 4OYZA 3FMWA 1FFUA 3HJEA 1F5CA 1NOYA 4IQUA 8ICKA 1HKCA 4ZN1A 3CETA 2QMXA 2DFEA 4ES1A 2F8HA 2KO1A 2RRNA 3HFVA 3ZI4A 3AA9A 4ES3A 4LR7A 3CDAA 4CO4A 5DB6A 3CC4S 4FF3A 3M6KA 4KRWA 2ZXHA 1TKXB 2B5JA 2ZH5A 3A8IA 4DV1J 2XSJB 3C19A 1MROB 2CDQA 1TUYA 1Z05A 1HBMA 5FP0A 5HATA 3QUQA 4KITB 4H0OA 1VBKA 3V6DB 1X4DA 4K4IA 1UFKA 4RW4B 3SDEA 1W2BR 3R6LB 4DEZA 1IG6A 5DDQC 4RJVA 2RUSA 4FJ8A 4PH5A 1C0GA 4CYUA 1BE4A 2PYJA 2GJIA 5GADP 2UXDK 2GFFA 4DX5A 4QIEA 3UQ2A 4KX3A 2G08A 2KZZA 1HL6A 5M1NA 5AQMA 5AKHA 4QS8A 4MFBB 1YVFA 4UASA 4TUPA 1N5YA 1PIEA 4WU3A 3DRRB 4Y2UA 2WHOA 1WLJA 4FCYA 4L73A 1LWEB 3QERA 3LA0A 3PHTA 2A41A 1ZPVA 1P27B 3VA3A 4KHRA 4Z2XA 2W2NP 1RJJA 3Q83A 3R5CA 3DLLQ 1R8HA 2DHGA 1CJVA 4YXJA 4ZP6A 2XS2A 4ZJOA 2PSZA 4PZVA 3GIRA 4KLMA 1T9TA 1S12A 2D7SA 3TAMA 1S1VA 2G0AA 1K0VA 3MECB 3LP3A 2QWNA 2QRRA 8ATCB 4TY9A 1EP4A 5GTHU 4WYWA 1Q8BA 4DLGA 1UFLA 3SQGB 2UVUA 4PEOA 1QLNA 4J90A 5KFMA 4DHYA 3K9JA 4LF6F 1L7NA 2CVEA 1FK9B 1QVFR 3MWBA 3CCUN 3N28A 4Y2KA 2Q66A 1TUUA 4QZBA 4RQ1A 1IM6A 1XTZA 4EP5A 3P39A 2E7VA 1REVB 1GOAA 2VWKA 1XNQK 1N2XA 4JHDA 2QV6A 3ISCA 2R7RA 1JXLA 2CPFA 4Z4EA 3Q8KA 3UNGC 3OUYA 3W0LA 1QTNB 1NBEB 1B9DA 3R3TA 4O44B 2J7UA 3VQDA 4OZNA 1J5EK 3C95A 1VHXA 3D5MA 4AHTA 2RIJA 3OS2A 5HRPA 1Y10A 2HVDA 3W1YC 1RHUB 4WF9L 2UXCF 3VAIA 4I27A 2XZDB 1S6OA 4JI8J 2D0AA 4OI0A 2N3OA 3PSIA 3AJ1A 2DGXA 2IC3B 1DBDA 4KGMA 1VRUA 1RA6A 4NLGA 3M9OB 3CD5A 4AH9A 5IXUA 2EEYA 3PFEA 4B1ZA 3ZYYX 3DRXA 4OZ3A 3K0SA 3VA0A 9ICCA 3MMBA 1EHWA 4PPXA 1RWPB 3ET6B 3H40A 1U1QA 2ZJPQ 4V1Ak 3CCRS 4NMXA 2V67A 3K89A 4JI2K 3LGHA 1KLNA 3MN9A 1XERA 2HDOA 4CLKA 3AAPA 1XUPO 4F3OA 4PQUB 4BREA 4RPZA 1H73A 2O4IA 3U8XA 1Q7YO 2DO4A 4O8KA 1VQ6S 3RB3A 3D0PA 4F02A 2R4FA 2JFDA 1YXQA 4EYIB 4XAKA 2DPJA 3IDWA 3AXKA 3OL9A 1BNOA 3CFPA 2ZIVB 3TZYA 1F5BA 1DURA 2G8IA 2FIUA 1RYRA 4C0OC 3GR0A 2ITGA 1NDCA 4K4UA 3AD7C 3SUPA 4BRNA 5HMMA 3QIPA 3ORYA 3T79A 3M8YA 5J2EA 3D2WA 1K73O 2Y1IA 2HRUA 2J6UA 2N7YA 4JI1F 5ETTA 5AR0A 2KHVA 1IVZA 1PCAA 2DXDA 2V4RA 3BUZB 2X1GA 4JNEA 2KV2A 2GO9A 3CJ4A 4CTAA 3OW2M 1P9QC 2Y0SF 4DR2K 2LLZA 4CLLA 4QZGA 2J0QD 3CCRN 3DLEA 3MI7X 2NR0A 1FVSA 3MM6A 4R5PB 3OHAA 4OX9K 3DNCA 1TAQA 4G1IA 1XO0A 4NASA 1UW9A 2K8CB 3E9LA 4W5QA 3V72A 3FZ2A 3K2YA 3KMQA 3BY5A 2RNEA 1B4SA 5KT4A 2C1EB 4AE5A 3V1RA 4CECA 4B9MA 4MAKA 2QN6B 5F41A 3CO9A 1KAYA 3VEWA 2OPRB 1EZZB 2OAUA 4QCLA 1U1LA 3ENQA 5LMUK 4I2BA 1R43A 2MSNA 3VQEA 1N52B 3NGDA 4HL9A 4RPYA 2BACA 1SKRA 4IO9Q 4ILHA 5I9EB 1NGCA 3WC0A 3DRPA 5J2JA 1UZHA 5AKKA 1VQKS 2L48A 2MZQA 1LVHA 2V4JA 2BVZA 1KTQA 3V4IA 4CHYA 1ZTWA 2W2QP 5IC6B 2YTUA 1EX4A 4ED7A 4OMFG 1SJFA 1BQNB 4MEYA 2BMBA 2PMZD 5J2HA 1X8DA 4AILC 1YRTA 2KMDA 1J9AA 2EWSA 4DTPA 3J80U 1QHTA 4OHWA 4BC4A 3HT0A 2EK1A 3AB2B 4C7ZA 2JXJA 4UAZA 1TL4A 1V6HA 1Z3EB 2FHJA 5IC4B 3HDSA 3T41A 4DFMA 2BW2A 3DRSA 3WXJA 1TFWA 3ZSZA 3FC4A 4O8UA 2DNHA 1AROP 2I1RA 2QYGA 4CLTA 8ICHA 2UXDF 2K60A 4FWSA 1WTFA 5B5EU 2FC8A 2YN4A 4CRXA 5AQYA 3W2WA 4CJ5A 1TKZB 1WAJA 2AX0A 4NLBA 2YHWA 4DSKA 3VQ4A 4Y34A 2W6LA 1BMQB 3OTOF 5H1SV 2KVIA 5M2PA 4R63A 2YPYA 4LFCJ 4AHCA 4JI3F 1X2IA 3LZIA 2EZZA 4IRCA 4X4PA 3N4WA 5ALMA 1EKSA 4RNHA 5AQZA 1X42A 4DV7K 1WSJA 3JSRA 2BXJA 2MZ1A 2Q0ZX 4TYAA 2GHPA 2EBGA 1RPLA 4CQ1A 1WHXA 1UQVA 5F1XA 4ZITA 3DXKB 1VRUB 3J7YU 1VISA 1BOTO 2DNMA 4CH0S 4B9LA 3ZO7A 4DU7A 1X40A 1Y64A 1NDLA 4DCCA 2MKHA 2V9KA 4JKAA 3BF1A 3VHQA 4Q5VA 2GQ2A 3MXMA 4X65K 2E6MA 3MM8A 3NGSA 4CBXA 1AUDA 3FGVA 4RPXA 2RQMA 1L7OA 1RU1A 2XMTA 3E01A 5KPTA 1BQNA 5I4MA 9ICHA 3PMNA 3AJDA 1SL1A 3M9NB 4OLAA 1ZXIA 1WC3A 2FJVA 8ICGA 1JLQB 1CEZA 2KVSA 4JI6K 3HHKA 3ZC4A 9ICRA 5LMUF 3RG6A 2WTFA 2DGVA 2PEBA 2F1HA 2D3ZA 5J2FA 4FVMA 3AA8A 9ICAA 3AB4B 3W5XA 3QRQA 1ZQEA 3K5PA 2ZH3A 1ZBUA 3LTOA 1HKAA 3H8YA 5DM7Q 4JV5F 2V2ZA 5AK6A 2Q6BA 2HRTA 2Z1HA 3SLCA 3V4IB 1HJPA 3M3ZA 3ZZZA 1MNEA 1YJ9S 4DV0J 1SZ2A 5AQSA 1HWUA 1TKTB 3LZJA 4IR1A 8ICQA 4ISEA 4QQBA 1KKHA 4Z4HA 1NDKA 5EN1A 4NZ0A 3TR8A 3UMCA 4NYOA 5L1KA 3CIZA 2OZSA 4JBCA 5F8GA 5JJBA 2FJBB 2ZWPA 4EZ9A 3I55N 3TJAA 5D3GA 1ZAXA 1IKWB 3EZWA 4KB0A 2RUGA 4F2SA 1PO6A 3Q23A 3RB6A 5AXKA 3MDFA 2ZD1A 3DLKA 3EDQB 5AZIB 1X9XA 4X66K 4LVOP 2XICA 3MEGB 2VA3A 4YR0A 4GKKK 5EE0A 1CLQA 2P9IB 4M04A 2XG8A 1HMVB 1YJ7A 1WUUA 4J37A 3RVCA 4RWXA 4O3PA 3R9PA 3OYJA 2QTDA 3CE8A 1NZPA 2W4CA 1RDDA 1S6UA 2YKQA 4K8RA 3VGSA 1ZA2B 4ID8A 3B6OA 3J7ZT 2F9WA 4GXJA 3M2RB 4JYAK 4C8ZA 5AE3A 2O8EA 4DV1F 1RQLA 1DHMA 2HI0A 4OI1A 2HVZA 3QNOA 5J0YA 2IYIA 2DR7A 2MB0B 1NNLA 1BNPA 3TTCA 1I3OB 1RACB 1FESA 3OYIA 1YI2N 3M6XA 2UUBK 3VEVA 3W5ZA 1WOQA 5SWMA 3H25A 2VCPA 4X62J 1JMTA 4ZCKA 5AK3A 5HHIA 1X0PA 2C3UA 4DXLA 5D15A 4M9LA 1NSPA 4M0AA 3MR2A 5KFXA 1ZQDA 4XH4A 4CEEA 2MQNA 2KIWA 3GIIA 1T3QA 3GB0A 3NBPA 5CQGA 2BPFA 5LL6d 3IC1A 1LFWA 4IEIA 4FWOA 4USAA 2A2DA 3MF5A 3DOLA 1GTEA 2DNPA 2W2MP 1QJHA 4QZ8A 2W41A 4QZIA 4KTQA 4IDKA 4JI0F 2YKAA 4F3TA 5GMDA 3LGMA 4MFAA 2CRXA 2E88A 4JUZA 1X3NA 4IOCQ 2C2DA 4CJQA 1VSIA 1RWNB 4OHYA 7ICKA 4DUTA 1KNZA 1FA0A 3O1LA 4OX6A 1T4GA 2Z1IA 2GAHC 1IKWA 8ICAA 1OW5A 1KLMA 3DYAB 4L6V3 3ILOA 1N33K 3PW2A 4C4RA 1AT1B 2NXJA 2HAFA 1RT7B 4CJ4A 1RUSA 1YX2A 1YTUA 3V1OA 5HR6A 2D0OA 2SXLA 3F73A 2P9UB 1S5LU 1IBMF 2KJ8A 2ZKTA 1D8BA 4Y2JA 1UCVA 2ZFHA 3HHLD 2FXUA 3G10A 3HSJA 1SJ4P 1NK7A 3HOTA 1SC4B 4CO5A 1Q9YA 2W9AA 2F4VK 2BCVA 4CI0B 2CH5A 3T9ZA 2W3RA 4RNOA 5CD4H 2LM1A 1E6YB 4NWIA 4HEA9 3C6TB 4O5EA 3A5NC 1NK5A 1RE1B 3R2DJ 2ZH8A 4TNOA 3KYLA 3N5FA 5BR8K 1B0XA 4O3NA 3CM6A 2XYPB 8ICYA 3T69A 3FSXA 4KTWA 2MZTA 5EXWA 2XNQA 4P2FA 3VEZA 3ZZTA 3C6AA 1HEKA 7FD1A 2BANA 2OGUA 4IXCA 3MCAB 2GZOA 2DHHA 1GFWB 4PRFA 1J5EJ 3V7KA 1MWQA 5F0XA 1R6VA 3W60A 1HW8A 3G25A 4USKA 5KFBA 4EENA 5THWA 3S3MA 5EY4A 3QBXA 4E0DA 2VG5A 4E1JA 5CYJA 5LMUJ 1S1WB 1XSPA 3WK8A 4DCOB 3G87A 1ZZFA 1HR0F 2ROGA 1CULB 2DK2A 1OVQA 3MOZA 1AFIA 5HVGA 2OHFA 2BCRA 3NVKA 3CSKA 1KVJA 4CZCA 1C20A 4BG8A 8ICJA 3ITHB 5IM0A 4P52A 3W8PA 4CFBA 2B8QA 1U45A 1PAEX 5H9FK 1U7LA 5AZJB 3SFUA 2ZNZA 1OPIA 4BROA 1WDTA 3AA5X 1RZMA 5IOLA 1ZD5A 1NGBA 4Z4FA 5J2BA 3RH4A 3U3YA 5CE3A 1FRLA 4H0TB 2M88A 2DIUA 4YOYA 5KG7A 3O9UA 2ZOFA 1N33F 1VQMN 4IFVA 2K1RB 4ZCMA 4C4WA 1PYTA 2EXUA 1PK1B 5J2QB 2ZTDA 1HUXA 4O0JA 1MSWD 4BR7A 3BKTA 2NSBA 3C1YA 2ROPA 1TU0B 1K1SA 1B92A 3I56N 2NREA 5BJRA 1IBLJ 2F1JA 3LALA 4NLNA 1UPPA 1S4FA 1XSNA 2IVMA 1X9SA 3TKAA 4HT5A 2V8PA 1X4CA 2GQQA 3UDVA 3OL8A 1UMJA 4B08A 2IVPA 5LJWA 1U8SA 2FHMA 2ZIWB 3BGUA 1KVBA 3IBPA 2RSQA 4CZFA 4A5BA 2WAQC 1LWCA 4FYWB 2JEGA 5EVZA 2ZE2A 2IGIA 3ULDA 1FEHA 2K7KA 3BSNA 3HM9A 3K7RA 1OY6A 1Q0NA 4DZ6A 3DRSB 4EWTA 4AXJA 1RILA 1S57A 3NVZA 4P0QA 5D4PA 3L0QA 4QZEA 1FJGJ 5AK4A 1DAXA 3GE9A 5MAOA 2ZUBA 3HKZC 4RTFD 1I5OB 2VPXB 2B21A 1F0XA 3CO0P 4BR2A 4M5KA 1F3FA 1TL7B 4KHWA 1TL7A 4FM1A 5HL7L 3IM9A 1LAVA 2J9CA 4Z4IA 3D4JA 4C11A 1Z1VA 5F0WA 4LF7F 3N4QA 3PACA 2R2TA 1FFWB 3ZTQA 1FHTA 1WC1A 3F9MA 8ICIA 4H4OA 3T7ZA 3JTOA 5MLCQ 4DUYK 2MPUA 3HO1A 3V6JA 2WBMA 2VKQA 1GQEA 4CESA 2HF3A 2CJYB 2AXTU 4LY7A 2AF6A 3CCZA 1IJJA 3IAS9 4DPUA 3VZIA 3M6GA 5DB9A 1V5IB 3FEYB 4JI0K 4B3TF 1DZ5A 1BC6A 1TL3A 4GV3A 4AYBF 6AT1B 2KXHA 4DF8A 4GKKF 3QEWA 1QZ6A 4F4XA 4IC9A 1IQZA 1VQ4S 3TP2A 2M70A 3FKBA 2BJ7A 1BG3A 1K9MO 2UXDJ 5ADXA 4HTUA 3KJQB 4YOEA 2LBOA 3D2FA 1WCNA 4BQZA 3KLVA 1EIYB 1TAUA 3KK7A 3BO4A 1XNRF 4LSNB 5J1PA 3RSEB 4K0KK 2PBDA 3R7SB 2E3TA 2LVWA 3B8HA 2IM2A 1S6PA 2H54B 1BXNA 2M52A 3DGPA 2OFGX 2F7VA 8RUCA 4UZBA 4JI3J 2DFFA 4HAIA 5ETRA 1Q5VA 3U02A 2E1YA 3OYKA 3GLJA 2MQLA 1D4XA 3J7YI 5J8YA 4DSLA 2KG1A 1W2IA 1FTRA 2VH7A 4ZJLA 1OH8A 5ETQA 1JLFA 2GMLA 3H0PA 4ISGA 1A5WA 1BGXT 3NGZA 1YBUA 5H9EJ 2VFTA 2EFGA 4WK1A 3WX4A 1VQON 3SJHA 4RLEA 1SJQA 2HS4A 2QA4N 3ILJA 2CADA 2E9RX 3Q8VA 1OQ6A 2V2KA 1RCOB 4KH0B 4ZVSB 4TU8A 1TKDA 4CLSA 4ZPWR 3HZ6A 2POKA 1UAWA 5DJBA 1I39A 4NMLA 4QS9A 3AFGA 1VSEA 3PYEA 4DR3F 5ALYA 4A46A 3QEBZ 2JEIA 4ZP8A 2E5LJ 1S0VA 1LFPA 1P8ZA 4ZH4A 1G2EA 4GXKA 3BN7A 4LF9K 2CWXA 2Q36A 1RGIA 1HNXK 4C9DA 4YR3A 3RAMA 3MWTA 3UXOA 3CJCA 2VPWB 2ZUGA 4KH5A 4QWEA 3PRVA 3CPWM 2QLTA 2PI5A 1J53A 3KJNB 2HBKA 1YHQS 1F2GA 2WF9A 1U6ZA 1HNIA 1UEVA 4BR4A 3RJMB 4DV0K 4YN4A 2EZYA 3IGNA 1DLOA 1VQMS 5C42A 1WELA 4LBPA 1RKIA 2WOMA 5GAEI 3CFOA 4O5KA 4KGVB 2QFJA 1Y7PA 5JVHL 4FJGA 2AZ1A 1ED1A 3J7ZO 3I33A 1XS9D 2IOFA 4KLOA 1JX4A 1S6QA 4URSA 2DRBA 5C5JA 4XDCA 3Q8UA 2RHSB 1UJ5A 3T1HK 5ETKA 1ZQJA 1TV9A 3OL6A 3P5JA 2CPEA 3BEGB 4X4TA 4DMZA 4DPOA 3SCIE 1A5VA 1GOBA 5LXRA 3MXHP 1JLFB 4PHEA 1JL1A 2GV9A 3NASA 9RUBA 2FVRA 1BIUA 2FDRA 1TV6B 3EGVA 5FDLB 3HVAA 2P6RA 1RXVA 4A57A 2DGZA 3C1ZA 2OELA 1Y5NB 1BWVA 5I3PA 1KC8O 2K8BB 3AN1A 4PG5A 3MM9A 1UETA 1HNXJ 1N0VC 2YNGA 9ICMA 4KLDA 1Y0HA 2XEXA 2KK0A 2XO6A 4IFEA 2E5LK 2EBEA 4N41A 3W66A 2UU9F 2XMKA 2ZJPL 2HHSA 4HUGA 3TVKA 4E7HA 4B1YB 2W9MA 3BDPA 4P0QB 4DJBA 4P71A 1JLCB 1I1GA 5H9FJ 7ICHA 4CZEA 5AQFA 2KI2A 1SC6A 4BRDA 3VETA 1V3ZA 4OHVA 3W63A 1YJRA 1SB6A 4FJJA 4FWRA 2F76X 4NCBA 3PY8A 5J8YC 4LH5A 3JPTA 2WTUA 4OI4A 2EVZA 2BOPA 4O23A 2QKKA 5KG0A 4OYPA 4Y2QA 4B9TA 3CCLS 4C8NA 5ETSA 3QFPA 2P6SA 3FE1A 1YGYA 3HI9A 3TUIC 1X4EA 4ICLA 1HHSA 3JTNA 4AXIA 4NCGB 4DTRA 4USUA 2QA4S 3VAHA 5AE2A 1FXRA 5AQKA 5CYQB 2Z2MA 2QEXN 2L5YA 1U0HA 1JQGA 2E1PA 1RWVB 4OYXA 3FBCA 2MY8A 3PO4A 4RT3A 1URRA 2OEJA 3M9MB 3ASMA 3H6EA 2ZM6J 1FWKA 2NPIA 4TQRA 1OQ3A 5HMWA 5DDOC 3BYPA 1WACA 4UOCA 1SUQA 1TMJA 4ENOA 1OMSA 1PBAA 2BEFA 2E1AA 3D66A 1MW7A 3IFRA 2IIHA 3LDPA 2AJFE 1OXJA 1HWIA 3JPSA 1UVJA 2B6GA 1NZ8A 3AVNA 1M5KC 3O8MA 4KHUA 1B99A 2BPGA 1ZETA 5H1SQ 1CJTA 4L3QA 3TW0A 2R7TA 2GV1A 2A3JA 3PZPA 5JICA 4WFBQ 4YDUA 4KLGA 4LFAF 3QGIA 4AYBD 3CD6S 1FKAF 3R6GB 3OR1B 1KVKA 3RBZA 4NEZA 2DNZA 2MRLA 3AVAA 5KFGA 3JQJA 4IJAA 1BA1A 2OHDA 2JSXA 2LECA 3BBFA 4PUOA 2N4DA 2HNYA 2RRAA 9ICFA 3CJ0A 2MUTA 3B9JA 1R0AB 1XQSC 4WKYA 4YD1A 3H20A 3OSPA 4DR5F 3TOQA 3H4BA 1NM2A 1S1XA 4I2QB 3RAXA 1F1BB 4CHOA 2G0JA 2FUG9 1RXWA 4JMUA 3CXCR 5T14A 2C3MA 1R6YA 3MR5A 1J27A 2N82B 2KSOB 2IMOA 3WXKA 2CPZA 2YMLA 2P5GA 3FM9A 4WZQA 2JWNA 2F8LA 2DEIA 2V8DA 3THYA 4M95A 2R8IA 4OHXA 2FGOA 4NRUA 3O9TA 3AO2A 3AAWB 4V19X 4DFJA 4YOVA 2QA2A 3BF4A 2IBOA 3OLAA 3LPUA 4AYBC 3TR5A 2HZCA 2WVDA 1OSDA 1RTHA 1PSDA 8ICTA 3DXMA 4PA1A 1KD1O 2P9KB 3Q89A 4GIBA 4QZ9A 3H7IA 2CQHA 2KZ3A 1CC8A 5H2FU 1YBTA 2U2FA 1M5PC 1V4TA 2VC1A 3CHWA 1XHZA 1X1PA 4OO1J 3IR7B 5B0GA 2P5OA 2ZTEA 1SH0A 3GTYX 5A8KB 1Q3UA 2B56A 2G2OA 3S1TA 3HKZD 5I3UA 3H0MB 3KD3A 1FWPA 2AGPA 4K0KF 4ES2A 1TE2A 1WI8A 4F25A 4B3TJ 2AQ4A 3RBXA 3L7PA 4U7BA 3VVTA 4OZJA 2FHKA 5KOXA 4OVLA 1ZQIA 2VICA 1SXLA 3J81U 2FF3B 4ECZA 2HFSA 3MM5A 4CGHA 3OHBA 5LL6Z 3G71N 4J8FA 3GFKB 3VC8A 4LF9F 1NSKL 4I6MA 4DLEA 4E19A 5J0SA 2W03A 1ATNA 2WCXA 1GLBG 2RT3A 2OEMA 3T3FA 1KWMA 5BRFA 1UVKA 4I68A 1RAFB 1RTJA 4JI1K 2QWLA 7ICLA 2CUYA 2KP7A 9ICQA 2FVCA 3JB9k 3ATVA 2PI4A 4CM0A 3NVMA 2BV3A 2CZ9A 3TWHA 4DV7F 4KI6A 4Z6CA 3AM9A 4RW6B 1ZQNA 3G8QA 1S1TA 5F3TA 1KFDA 4YFUA 3EY1A 4KHSA 1AXQA 2QFIA 2QZ8A 1WC4A 4DN0A 4JI8F 1B0PA 5B0CA 1UJ4A 4CH7A 3M8PB 5A2QO 3UWTA 5AICA 5M1KA 3W9JA 3NNHA 4CBUA 3NY0A 4U7UK 1RKJA 4AQYJ 3S3OA 1M0SA 1N48A 4ECUA 4BHQA 4WFZA 3SCLE 3QWUA 4X4QA 4K2XA 5DGBA 1M1KO 2B6AA 4EU0A 4M5DB 3NOGA 4OKJA 5EWFA 4M5LA 4CF8A 1S72N 4LF8J 1XNRK 1BPEA 4ZS6A 4N76A 5BN9A 1PG5B 4BR9A 3CD7A 4OCZA 1HYSA 2GIFA 2MKJA 4KIAA 1S1UA 1OY8A 3DM2A 5CEHA 4OV6A 4M9HA 2RP5A 5KGXA 4EELA 4GKJK 2VJ5A 3KVGA 5F8HA 2B4OA 4C1NK 1A77A 4FZZA 2KKHA 4CRJA 3EXCX 5AIAA 5KFOA 4GLXA 2JX2A 3NF9A 4FF2A 2JRZA 1A6SA 4F0HA 4KFBA 1R0BG 1G1XA 4UAVA 3ZETA 1HI1A 5KFAA 2KN7A 2KJ9A 4WJ3B 3R8EA 5AKJA 1B3TA 3F5EA 3ZTPA 3ZSXA 3CDWA 3HKZF 2QLBB 4RWWA 2X74A 3PG9A 1XMOK 5FIIA 8ICCA 1CSJA 4CNQA 1IXRA 4PJ0U 1UWAA 4DR7K 2GX8A 3IRWP 4ZVFA 5LJVA 3UW1A 2DYAA 4OYMA 5C25B 2M8DB 4J91A 3RZAA 2WB1F 5KFRA 4DOAA 2RRBA 3I6PA 2JC1A 4DV5F 3NUQA 4WQ5C 5EUHA 1GX5A 1MU2B 2FZGB 3FBBA 4KHPK 3F2KA 1ZQAA 4QYZK 3GP9A 3QJPA 4ZIVA 4WQ4A 2CQ1A 1ULRA 2QO3A 5HOOA 1XNQJ 4PL8A 4US8A 3HP6A 1CZAN 4CI6A 2YI1A 2HAIA 2J9DA 3RJHA 4X64J 2IRUA 1KDHA 4HR2A 7ICOA 2ODGA 2HOQA 4ZKAA 1HHTP 5KFNA 2I5JB 3LUYA 3NMRA 5AQJA 4FNHA 1HKGA 8ICZA 2Z57B 2JV3A 4MKVA 1MWYA 4CLUA 4BLGA 1YVUA 5HI7A 5A8KA 1HYSB 4O5BA 4WBFA 4MKAA 3D6RA 2NRRA 2H5JB 1RP5A 5BPNA 4LRAA 2QARA 2KRBA 2A3ZA 3PW4A 3M32B 2CH6A 1S5ZA 1YZ7A 2G8KA 2YTCA 4X65F 2B0CA 3SMZA 1FTCA 4EBEA 2P9KA 2O5DA 2FPLA 1T3VA 2A1JA 2FF6A 3SMSA 2DF4B 1PC4A 2ASYA 1FKOA 4O3QA 4JKGB 4NEYA 1IJFB 3LP1B 3I87A 4HI2A 1RHQB 1U4BA 3ZD9A 1HI0P 1VSLA 2DY1A 3DCAA 5D3GB 3E9OA 5ELZA 2CPRA 5HJYA 2VYPA 3S9HA 1KR4A 3ISND 3DU6A 4NWBA 4A59A 2KXFA 1FCAA 1WG8A 2CQ3A 2XLJA 2V5HG 4CF0A 5EDWA 1LW0A 3D0GE 3NHGA 1NRKA 4IOAL 1S1UB 4R8UB 4CZKA 4FJMA 1VQ9S 2UUBF 3AOCA 1VRTA 4CDIA 4UTGA 1NMDA 2BGGA 4IL6U 1KEJA 3KLEB 5AQTA 5HROB 1S7IA 5IIOA 4F26A 4ED8A 2KRRA 2VASA 4KHYA 4NM2A 1NB2A 1VLYA 4L3KA 2JVOA 4F3MA 3GFXA 3B4DA 3M6VA 1Z2ZA 1IBMK 3NVVA 1CQNA 3UN3A 3WNGA 5HMXA 3EZUA 2GWKA 2DQNB 3OTOJ 3HL8A 2QB1A 2OTLN 4KLFA 4LF7J 3D7EO 1KVAA 1J6ZA 3ENOA 2CXYA 3ZNJ1 4CZJA 2P9GA 2C2OB 1VGYA 1SC1B 5A0LA 3CCTA 4A61A 2KICA 1R59O 4UB5A 2WC9A 3FZFA 1VQ6N 3C21A 3A12A 4L76A 2XWXA 2KFNA 2L9NA 1JJ4A 3HJFA 3U1LA 4CLZA 3O4NA 1B70B 2EANA 2FLOA 3IRXB 3IS9A 4J9NA 3FQKA 3KXDA 1WF2A 1Z1ZA 2G4BA 1ZQ1C 2QL9B 1TFRA 1HR0K 2ISOA 3GYGA 4J2EA 1FERA 5CHIA 5IT0A 1LAWA 2ES6A 3QESA 4OJOA 3D3BJ 1KAZA 4F7VA 2HG4A 4ISFA 2HWIA 3MTKA 3HCXA 5L46A 3QJLA 4GVBA 1JLBA 4WKRA 3HPGA 1JRPA 2RVJA 4FLYA 2H3GX 4FKXA 2ZJ8A 1IV8A 1H7XA 3H90A 1H98A 4PXEA 5K8MA 3VCDA 1OWXA 1YLXA 1HARA 8ICVA 5DG9A 5DB7A 3MR7A 4EX6A 3IBWA 5KFHA 3OSNA 4DR1J 4AL6A 4RBUA 4BC2A 3PO5A 8ICRA 4LFCK 2M0GB 2QXFA 2Q79A 5DQIA 4O44A 3B82A 4X84A 1QDUB 5B08A 2CG4A 4M45A 4QS7A 4EYHB 2X7IA 1I51B 1V9OA 2GQCA 5KAIU 5C24B 2XMJA 3QJJA 3FBEA 4ED5A 4DU4A 3OS0A 2YJFA 2FLLA 1IKYB 1XR6A 4NLYA 5IT9Y 4Y1DA 4E1MA 2XY7A 1KOOA 5GAGU 3Q8YA 3GV5B 4P2HA 4I6WA 2LCWA 4XDDA 5ITHA 3NXZA 5DLFA 4EK2A 5AZIA 3LWMA 4MFBA 3CUNA 2IM1A 5AFUA 1Q95G 3PHEA 4BDPA 4C3LA 2VG6B 4CHNA 3DDIA 2CGKA 1EB0A 3ZDEA 4YOUA 5CABA 4B1VA 3ED5A 5JVGQ 4PKGA 2UP1A 5KFEA 2Y8YA 4DPWA 2I6XA 4A8KA 3M6ZA 2IDLA 3KLIA 1VLOA 1VRQC 1ASVA 2ADBA 4CHQA 2IIRA 4NLSA 2HHUA 1KBRA 2XULA 4ID5A 4CGGA 3VGMA 1RT4B 2V8VA 2EW9A 3NAIA 5AQOA 3UR3C 4NL5A 1DQAA 2MGZA 2AYGA 5IILA 2MGZB 3C29A 2HOIA 4N47A 1VBZA 2UXCK 1YBAA 2D0BA 2DNOA 4RW8A 4JV1A 4ILMA 1H2TZ 4QYRA 4DR2J 1LWXA 3EE3A 1T7PA 5D8HB 3UCZP 2DGWA 3KD5E 3OLBA 4CJPA 1S9EB 4MO4A 3OUYB 2W24A 2Q43A 2GS8A 1JCFA 5DBBA 4ETZA 1Q8IA 2VB6A 2KJ5A 4FNIA 3LAKA 4JI7F 4HLBA 2MJNA 4C97A 2PFUA 3BO3A 4GMKA 4P9SA 2K1RA 4L3NA 4LVSA 4Y2IA 4M3UA 4L75A 2W25A 2HMIA 2HQIA 4LH4A 4XEIA 4WFBL 1CJKA 2OYQA 9ATCB 4JI6J 1XU4A 1HX1A 3M8SA 2P2CB 4E3SA 4USMA 2DNQA 2P9IA 1D8LA 4M3WA 1JUDA 1ITGA 1VQ8N 2YX1A 4KPYA 1TKXA 1HYVA 5AI6A 3OYBA 4I2HA 3CDBA 4NLVA 2DGTA 2XWYA 4DV4J 2P51A 4DWIA 2VBWA 2W4DA 2YQ3A 3VQAA 4DR2F 4RG8A 1S0NA 2ZDPA 4ZCIA 2AJ4A 2ZVIA 5FLXU 1T03B 2YNHB 1OYEA 4KGKA 2G09A 2HURA 1PJ7A 4ID5B 4B3TK 3ZTOA 2PZSA 4B8AB 2LHTA 4KX5A 3OXLA 2CXEA 3ZNUA 1DK3A 4HHHA 2H5EA 3C6UB 3ULEB 4RBVA 4RUCA 1X5TA 3R7NB 3LH2S 3J7Z5 3BV8A 4YY3J 1JXEA 2QLFB 3MEKA 2AZ3A 2IM3A 1XQIA 1CZ9A 3GMGA 3PSFA 2PD1A 5EX0A 2BABA 2EAPA 2CQ0A 1EKEA 5DLGA 4G9BA 3G8SA 4DTOA 3G4SS 2QWOA 2EFVA 1KFTA 3NWGA 1N60A 1SL0A 2XSJA 4F67A 1U1NA 3QIPB 3K75D 5AM1A 2F1IA 1NJIT 2ASDA 5ALJA 1UPMB 2YWWA 4JWMA 4YB5A 4CFCA 4DI6A 5GAEP 1D8ZA 3RJKA 1I94F 2RMLA 2NXCA 2HPUA 4NYZA 3WDOA 4URQU 3R9KA 2KJVA 2O8DB 2PFNA 3PX6A 3OTBA 3ISBA 1EQ0A 3D2EB 1VS3A 2CQ4A 1Q9XA 3PYFA 4CIFA 4DR4F 4HWIA 3OYMA 2UXBJ 1U1OA 5KPRA 3JAMO 3DLEB 1Q82T 4QW8A 2D8CA 2QG9B 2KVQE 4BC5A 4EBCA 5DDRC 3SAGA 3L5KA 4X5VA 4OZLA 2NRTA 4P0PB 1X5SA 2UU9K 4QZVB 5AM4A 3KUHA 1PZNA 1RQ0A 3QLHB 2YX7A 3GJSB 3SDEB 2WW4A 2AP6A 4CJ3A 3A0HU 3U26A 1QH9A 2NLWA 4JYAJ 1BHNA 2VJUA 3KLEA 2JZBB 1QAIA 5D6GA 2ZTCA 3M7VA 1R7IA 2IHMA 4GW6A 3IDHA 2KFYA 4KN4A 1DRZA 4CJVA 4A62A 1N4LA 1NEEA 1Z00A 1I94J 2A40A 5DQHA 4LF5K 7ICIA 2I7NA 2G13A 3ET6A 1S97A 3LYSA 4E2FB 3CDUA 3L2WA 2W01A 2R7QA 4TQSA 1YTAA 5GAGI 3P3DA 2ZWOA 5G5HA 1GO3F 1RI7A 4QR1A 1FRHA 4C8YA 3FK4A 4UQGA 4H54A 1WEYA 1ZQCA 4MQ3A 1EXQA 1GH8A 4OYBA 3HRGA 3OFFA 4B3MJ 4USIA 3DLGB 1K8AT 3DLGA 3ZZUA 3HI0A 1HBUA 2WB1C 2O4GA 2FB0A 1B4FA 4PHDA 3HW8A 1RXOB 1TUGB 1X31C 3TZWA 2RQ4A 2WZ1A 4MKYA 3ZDBA 3D6HB 2OPSB 3NGTA 3VPZA 4M6WA 1N32J 1WKJA 1S9EA 4BXOA 4ZPBA 2QKBA 1X7VA 4G1PA 3VQPA 3D7SB 5L1LA 3EZOA 4JV5K 3UDEA 4W4MA 3O9RA 3MAHA 2Y3YA 4RQ2A 3WIVA 2M2BA 2CPXA 3FZKA 4LFCF 3T6JA 3N4PA 1NLKL 5AQLA 1F2HA 9ICKA 1HR0J 4ECSA 1RQNA 3BSAA 4OI6A 2F9JA 5KTQA 1Y00A 2FC0A 3MUTP 4LRBA 3I4PA 5HR7A 2OJ3A 3CJ7A 1NKEA 1JNZB 4ECQA 1SQFA 1FFGB 1K9MT 1FWLA 2DGUA 3DMJB 3ETOA 2IVNA 3DMJA 1VDVA 2P66A 3MZIA 4AQYF 1MWKA 4RU9A 2O3DA 1R8BA 1C0UB 4FBUA 2CQPA 3G86A 1R0CB 2ZHBA 1EJ7L 3SBGA 2LFVA 5CCMA 1BIZA 3B6PA 4WCEL 3IMXA 4J2DA 1FIQA 4OYIA 3T5JA 3MGVA 1N5YB 5L1IA 4NI2B 2QX0A 2BKEA 1X66A 3MMAB 4PHPA 1E6YA 1ATSA 1DTTA 5SUHA 3EWGA 1BVSA 2LYHA 2MU2A 1A0PA 2YNGB 5KQDA 3WNFA 2LXIA 1Q5YA 2E2PA 4CVNE 1DQ9A 3NWRA 2WFAA 2MEWA 1CUKA 1M1GA 3OYFA 4NLTA 1NU0A 4H03B 1NPKA 1ZBLA 4J9RA 3DRYA 2PGCA 2A1RA 4CGJA 2LM4A 2QWMA 1HA1A 2JRSA 3F2BA 4J9VA 4MMOA 1ZH5A 2DWQA 1XNRJ 4CF2A 5KG5A 3A8KA 4USVA 1NMEB 3OYGA 2MZJA 4QJVA 4QPTA 4I2IA 3RWUA 3M05A 4CDGA 1NK9A 1FJCA 1FEZA 3RAQA 4PG6A 3KOOA 2AYMA 2KYXA 4MN4C 1S49A 3PFOA 3NF7A 1XC3A 3UPQA 1AA1B 1XR5A 4I2PA 4IOBA 3MDQA 3D2NA 1Z2LA 4LRFA 1SL2A 4ICLB 3EVWA 1F6TA 3KKAA 2YMQA 4ELVA 1FVQA 1UZDA 2KDOA 2MQ8A 4FJNA 5BYQA 1TK8A 4ECRA 4JYAF 2YXLA 3TUJC 5G0RB 4HH1A 1U09A 3THWB 1PUZA 2LPEA 4FZMA 1RAEB 5ALFA 3NCQA 3NS7B 2QMUB 1AB8A 2OZMA 4ZVPB 4F5OA 2WF6A 2WVFA 4P7VA 3GDXA 4CF4A 4CJSA 3HPOA 4PXDA 4WPAA 3HVTA 4YMOA 3AXMA 5LT5A 1Y9OA 4LQ3A 1G99A 3QYYA 1QQCA 2DIVA 4DHVA 5HVFA 3ELHA 3SCXA 1Q81O 4JI7J 2ZGYA 2E1RA 5A0YA 4EEKA 2GHVC 3PJXA 2FD2A 3JYTA 4XRHA 3M2RA 4U7UD 2IMWP 3EVMA 1QQMA 4FWMA 1SH3A 3IBFB 2GUPA 4ANDA 1SXEA 2ZHAA 2E5JA 2O8CA 3OJSA 2R42A 4Z7CA 3MMCB 2MA1A 2Z58B 3TI0A 2G5IB 1RBOB 2CAJA 4QIWC 1H2UX 1RISA 1Q8LA 2K4IA 3BQTA 4MIWA 1BUXA 3ETLA 4HVZA 4OZ1A 3IHQB 2C42A 1Q79A 5L9XA 2IAJB 1BU6O 3ENAA 5AQVA 3TTFA 1SV0C 1RU2A 4CZIA 2C3PA 2F8EX 3ZTSA 2V52B 1GOCA 2M5YA 3U6FA 5JU5A 1ZXOA 3LF0A 3R1LA 2KSOA 4MDBA 4QOTA 5CHGA 2YY3A 2WSEC 3H5SA 5KFVA 4ANEA 2X1FA 2HW3A 2YMPA 5GAHU 2QL7B 3N79A 1LKZA 3JAMY 3SQIA 1FDDA 4B3MF 3THPA 2IRXA 3MN7A 1IG8A 4H4MA 2UUCJ 5AKEA 2YKOA 4U96A 3SPZA 1HD0A 4N8OA 4JI4J 3KFUF 3IP0A 3QRPA 2BHNA 1XO1A 4M5JA 5C10A 2KT2A 4DPXA 5KFFA 3R5AA 5CHCB 4WP8A 4DR7J 5KFSA 1OSCA 3ZDDA 5F8NA 1MMLA 4IOXA 3OFHA 3P1GA 1QUVA 1J2MA 3PNIA 5JLFA 2LDYA 3WNHA 4H4KC 5HK4A 2RQ5A 1B64A 2M7SA 5CR0A 2X51A 4GRSA 4CK2A 1N5SA 4NXMF 4NLWA 2D0PA 3BYRA 1JLQA 2V63A 2W2PP 3L2UA 4CBWA 1A0OB 3KG1A 2OXOA 4ICAA 3JSMB 4HUEA 1UW4A 2K8GA 3BR9A 3N7PD 4KAZA 1HPMA 5F2RA 5J0RA 3PRDA 1YK9A 2R7WA 5EU7A 3T5KA 3B0XA 3IO1A 5AI9A 1WCLA 2HVHA 4J03A 2ZIVA 4FPIA 2VGNA 4XUSA 3K9KA 2HGNA 4ECWA 3UNYA 3JSBA 4US9A 3C15A 3OPKA 5C12A 1F3VA 4A8WA 2IOFK 4PY5A 3QIOA 1CZBA 2C3YA 1NJXA 4J9UE 4DX8H 3OD2A 1FKPA 4ZTFA 1IKVB 3PTWA 2ZOMA 1XMQK 3IR5B 4H5TA 3QEPA 2KKVA 2JVRA 3AL0B 2F8SA 3QFUA 4O3RA 1RADB 3D0IE 2BYCA 3N01A 4DUZK 2BA9A 3SQGA 1X5PA 5AM5A 5E0OA 4TUQA 3M1YA 4YNQA 2ZJRQ 3O9SA 4CW7B 3ZZOA 1RAJA 5TISU 2KJWA 4QIGA 4CGZA 1Q16B 2WMMA 5KRSA 3BQ2A 3WIUA 1K6YA 2YNFA 2JH7A 2KEYA 4OLBA 1CPZA 4ID1A 3ZT3A 3AQPA 1UVNA 4GKJF 1BLUA 5HP1A 4K4GA 1M5OC 5GINA 3DLHA 4U8VA 1HWKA 4ED0A 3D6FB 2FLNA 3QLHA 5D0EA 4Y65A 4UQTA 4B9UA 4LF4J 4PZOA 4DR3K 4HACB 3HTVA 4YFKA 4NYPA 4Z7YA 3EPGA 4HTIA 1PVQA 1FD8A 2XZTB 3PJWA 3CJ1A 3MPYA 2HMIB 3MURP 2IDOA 3CIPA 4PGQA 1PVPA 3L7UA 3A0BU 3D28A 1WI6A 2PC6A 4AQYK 3MEEA 2JEJA 3QZ7A 1RT5B 5CZVA 2FY1A 3J7AN 5AKZA 2W54A 1V9PA 3J7YP 3H8JA 5J2MB 1RHKB 2Y0SD 3BZCA 3QETA 1APSA 5AI0A 4DUZJ 4F0MA 4CEDA 2E5IA 4F4KA 5HRRA 1NHVA 3BBBA 1XMQJ 2HWTA 1NJYA 4YN3B 3G71S 5ALEA 1WSVA 2LQ5A 5CY4A 4ZVRB 4AL5A 2NPFA 1WOPA 4NV0A 1IBLF 2IS3A 5AKLA 1NGGA 4BDZA 3MMCA 3AAQA 2R3VA 4P72A 4DDFA 2NUHA 3C6UA 4Z6DA 3NGIA 4HI1A 4JS4A 3DWLA 3TO8A 1WKKA 4J9PA 4UBCA 2VQFF 3H3NO 8ICUA 2YKNA 2OMLA 3JPPA 2OSRA 5LJ5Y 4Z37A 1FJGF 4UB3A 1W97L 9ICOA 4TUSA 4I6MB 2PMHA 3AVKA 1NJWA 3H3OB 1GXTA 2CNLB 2OPQA 5IV4A 3DOLB 3MEDA 2HBLA 2X3GA 1X60A 3A8JA 5B0EA 3ONQA 2Y0SC 1IBKF 3ZSOA 3T1AA 2KG0A 4HACA 2E2NA 1ZQPA 5DDYA 2PDAA 3TFSA 4U67Q 4PKIA 4BRMA 4DUZF 2H51B 5EGYA 2D3O1 3NAHA 3IWXA 2DFLA 1P1LA 3QICA 3ENWA 1ZQUA 3OHRA 1BY9A 5ALRA 2Y9TA 1RT2B 1T05B 3KHLA 2NRXA 1XMOF 3DXMB 4ZLLA 4WFXA 4J9QA 2JL9A 4YMMA 2AYBA 2W7AA 3A1YG 1VSJA 3T19A 4KJIA 3SMPA 1ZQHA 4AM7A 1C7YA 4IG3B 1DEJA 1F5SA 4I0WA 4GKKJ 3BZKA 4HDGA 2Y1LB 4WTYA 4IDHA 4IQWA 3HMJG 2YV0X 3QQCD 4JKDA 1LNQA 1QCKA 9ICSA 3SYZA 5JRTA 2QC3A 2BUNA 3KG4A 2NRWA 5EX3A 3RH6A 3QSIA 2BR0A 2H48B 1Y88A 3MCMA 4RZRA 3HLUA 4M8LA 4IS7A 1ZBTA 1CQMA 1U1PA 3BKFA 4WFAQ 3K5NA 1E6VA 2ZITA 5AQPA 4CT9A 3RMBA 3RYLA 1OO0B 4LBIA 2A1BA 4CCHA 2DNLA 5CZXA 1KQQA 1QSYA 3DKDA 5B0FA 5KPZA 3ID6A 2V50A 4KMUA 4RNMA 2QW9A 3R9LA 3OBIA 4DU1A 1BWEA 3VQ9A 2MUTB 3QIDA 4I4BA 3I9ZA 2ZKUA 3I9V9 2UXBF 1NH8A 4X66F 5ALVA 4ZVGA 1ILYA 4C2MA 1QY7A 4ZPVR 4IO1A 5E3PA 3C2LA 1FDNA 4JD2B 3CNHA 5F9NA 4FPBA 4UAYA 3L3UA 3OYLA 5JS1A 2W9CB 5KQ8A 2FDNA 4YUDA 1IJEB 3KZXA 2KHQA 3SQ0A 1S8OA 2OYYA 1ZS6A 1F21A 1N61A 2R8GA 3HD1A 3G8TA 3CC7S 4DV3J 4DL7A 3G6VA 1TFYA 4EP4A 2DTUA 2HBYB 5ALXA 1SVDA 4CD3A 3C7NB 1NB7A 3KHHA 4UF4A 3F41A 3UVJA 3NCRA 1U1KA 4K2JA 2V34A 4GO5X 1RHJB 2LXUA 3M1VB 2CZVC 5L9NA 1HLUA 1VSFA 2O67A 4MO5A 5GAEU 3BS5A 3AU6A 4FE3A 3AVMA 1S77D 4DF4A 1LK7A 4R25A 4JKHA 1MG7A 2BDPA 4K50A 2MDAA 2RU9A 4A8OA 1H0HB 4DSIA 3CMAN 3IG1B 1UT8A 2JLGA 4F5NA 4ZVQB 4LFAJ 2DL0A 5AXMA 2ASJA 2OEHA 1ZM9A 4Y2MA 2CPHA 2J4RA 1LXJA 1WKLA 4CIEA 2WHEA 3WHIA 3AOAA 3GJQB 1CRXA 4QZHA 3T1YJ 1PYOB 2WBNA 4HUFA 4QWAA 2PE8A 3T1HJ 3FZBA 3MM5B 4QZDA 4LIRA 1NWKA 1COKA 2UUAJ 2L41A 3VQBA 3T6BA 3V9XA 2G2YA 4LFAK 2ZH1A 4DZDA 5I3QA 1CXUA 3J7A1 4FLZA 1U2CA 4JK7A 4LZGA 1U02A 5KT7A 3EVOA 1Q18A 5T7BA 3V4MA 5ALPA 2MQMA 3PJ9A 3QT5A 1VJ5A 2HF4A 1U1MA 4M3XA 5HANA 1QSLA 3QGHA 3D0HE 2Z56B 1SPBP 1HI8A 5D4NA 5HROA 1XSLA 3EZ5A 5FLXO 1H38A 3BGRB 4QYZJ 5AQWA 3P6YC 4LRCA 2NQPA 2HHTA 2B9YA 3HRDD 2M4MA 4H5RA 1SKWA 3KZBA 2Y8WA 1S1XB 2LP4A 4BRHA 4RW7A 2VQFK 4XIUA 1KD1T 4F71A 4OJ1A 1NGFA 4O4GA 5K8OA 4IH5A 3CQ8A 1RAIB 4PL1A 4TVAB 2BJ9A 5IINA 3BGOP 3M30A 4RKUC 1SJ3P 3PR4A 3AQOA 4KI4A 3ZXWA 4JKGA 2QA1A 2LYBA 4WIQA 4MK7A 4DR6J 2AH5A 5KFCA 5KG3A 1ZQBA 2EI5A 2OD4A 4DUYJ 2K89A 2OWOA 1Y5IB 3BSCA 5GIPA 3NH2A 5DG7A 4DPTA 4DKWA 5KAFU 1O1WA 4Y6IA 3HBTA 3AT1B 4DX6A 3PLAA 1F9FA 5GADU 4AM6A 4DR5K 4CZHA 2V2VA 4ILRA 3LANA 4CEFA 3NLCA 5DKWA 3KFWX 2FVQA 2GMHA 3ADAC 3DDNA 4FOIA 1SV0A 4JK8A 3FCWA 3AD8C 4FLVA 3PEJA 2UUTA 3CDEA 2LQ8A 5JUMA 3QBCA 2A6OA 5HLFB 2QB0B 3K8WA 3SAFA 4FZVA 4M47A 4RUHA 4BBYA 4JOUA 2DTJA 3EKSA 1UA1A 1V4SA 1T02A 3GU0A 5LM7E 3RMDA 2W04A 2KG5A 3CD0A 1RTIA 3QO9A 3M8PA 3QGGA 2P9LB 4E1NA 3U1NA 3ATUA 1ZM4A 2ZIXA 2BQUA 2ZH4A 5CP2A 4DUYF 1NJZA 4Z94A 2OPQB 4C4TA 4GV9A 3U7JA 1YQHA 3K57A 3CC7N 4OPAA 4NCGA 2PAVA 2R8JA 2YWFA 5ALGA 4EBDA 2Y1RI 3CNQP 3M4XA 4P73A 2RH3A 3VZHA 3U1MA 9ICXA 4QPXA 2HIYA 3ZZYA 9ICNA 3LPTA 1GTHA 1CJUA 3HKWA 3DM2B 2UXBK 1C0TB 2Z4PA 3RRKA 2NZCA 4KBIA 2DO0A 3J80Y 3C6HA 2DNGA 3BS9A 5HJXA 1T8EA 3QU5A 2HBRB 5J2KA 1M5VC 4LQ9A 4WYLA 4ALZA 1JIHA 3B8AX 1ATRA 1GMUA 4JI8K 1WEZA 2EG2A 4LJMA 1GLDG 5LSLA 1HPZB 4LVNP 1RBRA 1BWFO 4FJIA 1H74A 1GMVA 3THXA 4UARA 5AXLA 4WYBA 1UVIA 2FVSA 5J0PA 1FO4A 4OZ5A 1NGHA 4PKDB 1Y4ZB 3H4DA 2YWHA 2FMPA 1A6LA 2G1DA 3K8VA 4DU8A 4TLRA 1M1HA 2G2ZA 1RAHB 4UB4A 3AEVA 3NGUA 2I2YA 1WD6A 3WUHA 4FWQA 3LWLA 2H3ZA 3JTPA 4WTOB 4W5TA 4CGFA 3QGPA 3QBWA 3OYCA 4YCXA 2EFQA 5KT6A 3OVSA 3LDOA 4FYXB 3TQ1A 1RTJB 2HHHJ 1VC6A 4A8EA 4Z6FA 4X66J 1NK4A 3L2VA 4YOTA 4CHPA 3E3XA 2P9EA 2HFZA 4EFHA 4PG4A 4W98A 2HWHA 2RAQA 1UJ6A 2EC0A 4FZYA 1K8KB 3SCJE 4FWKA 4MHVA 3O5BA 1YJWS 1KQSM 3QFHA 2WVCA 2E6LA 1RTIB 1R0AA 2E44A 4JK1A 4K42A 5DBCA 1Z26A 2XGQA 2ZIXB 4BRFA 5HP1B 5DBAA 5HQMA 3CMQA 2YWGA 5E79U 2WF8A 1GLAG 1IR1A 1ELOA 3L3VA 2YPZA 3FQLA 1HQEB 2VFUA 4G6VB 3OYAA 2M0NA 3CJSA 2F8TA 1RT3B 3CF5L 1N33J 3MUVP 2ZC3A 2WVBA 5DQGA 2RRDA 4UOFA 1OH6A 5KFZA 4NLOA 4O0IA 4DOBA 1GMWA 1MROA 3FSYA 4CNYA 4IR9A 3NG8A 1UTAA 3TAFA 2RN2A 2ZJAA 2CJAA 2FBVA 3FSIA 1M5SA 2EPIA 1RFQA 1IR2A 4E89A 2RKIA 3CW2C 3ZT2A 3WKEA 4KQZA 3LP1A 5GTIU 5D0GA 2AQ0A 3CCES 2AEMA 3GCWP 1JCGA 2P9LA 2GUIA 3O1WA 3D2EA 2OLWA 4EHTA 1YTYA 2VONA 3FZLA 2YNIA 5A8WA 1RLCL 3H2UB 2R18A 1RWUA 4B6JA 4AF1A 1VQ7S 1U24A 4C3MA 4LF1A 2XI2A 2A6MA 3VGKA 2F3JA 3UMBA 4X4OA 1P6TA 1AYEA 4BCAA 2J0XA 3L6QA 2VFVA 1U2VA 4ACOA 1IG9A 2GIRA 1XR7A 4B3OB 3IRXA 3H59A 2QK9A 4PR6A 3EGZA 3DC2A 2FBXA 1L3UA 2WF5A 2W43A 2K06A 6FD1A 4BQLA 5ALQA 3FLCO 3MCNA 2P8IA 2XRIA 3LVVA 5IIKA 3BQ1A 3I5AA 1WSGA 4PYAA 4DCPB 2X6NA 3SD7A 3H1QA 2UVRA 4FYYB 1DKGD 2KIVA 3ZSYA 1NZBA 1NH7A 1U26A 2COLA 1SIJA 3O08A 2IOHA 2QT7A 3H0LB 3I1YA 2DXFA 2KHDA 5HRNA 4QIFA 3KBBA 4DL5A 2HVIA 1REVA 3M30B 4DPYA 4NXMJ 3FFIB 4IKFA 3F56A 3W64A 2CJKA 3TAGA 1RWOB 2HGLA 5EOYA 4TY8A 1EARA 4N5SA 3JPNA 2WONA 4IOAQ 3FDSA 2E7XA 4TSXA 1A7GE 1VC5A 4BRQA 1ZTTA 4M5MA 4UATA 1G6BA 3PW0A