4DQSA

Binary complex of bacillus dna polymerase i large fragment and duplex dna with rc in primer terminus paired with dg of template
Total Genus 211
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
211
sequence length
579
structure length
573
Chain Sequence
KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural factors that determine selectivity of a high fidelity DNA polymerase for deoxy-, dideoxy-, and ribonucleotides.
pubmed doi rcsb
source organism Geobacillus kaustophilus
molecule tags Transferase/dna
molecule keywords DNA polymerase
total genus 211
structure length 573
sequence length 579
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4dqsA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4dqsA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4dqsA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4dqsA01
9ICKA 1B9FA 4M3XA 3DLGA 3V6KA 1F21A 5JUMA 3K58A 2BQRA 4YD2A 4JUZA 4Y1DA 5HP1A 4CEOA 4OVLA 1TKZA 3ZT4A 5KT2A 1RDAA 2W9CB 1A5XA 4O55A 2ATQA 5KT7A 4B8CA 3L2QA 2D5RA 1JX4A 4J9QA 3NE6A 2R8JA 5KFEA 3Q8LA 5DBCA 4M3WA 1KFSA 1MC8A 3CM5A 4Z6DA 1UWBA 5C25A 2FBXA 4F3TA 3VQ6A 4DTSA 3Q8KA 1U9LA 4CGFA 4I2GA 1RT7A 4PUOA 1KSPA 1S6PA 5KT5A 2JEFA 3PO5A 4P4OA 3CG7A 2WONA 2PXIA 8ICBA 2G8KA 3C94A 4CHYA 4FYDA 1ZQBA 1ZQAA 3GFKB 3SI6A 5J2KA 4F5NA 4B9LA 3ORYA 2XRIA 1UA1A 4NCBA 4DLGA 3K57A 3HL8A 8ICVA 1UT8A 3ZT1A 2DPIA 4LD0A 4QZDA 4CJKA 4ZTFA 1Q9XA 2AGPA 3TAEA 4CEQA 2Z1JA 3RMDA 3DRSA 1L3SA 1J5OA 2GWSA 9ICIA 5HMMA 3GIMA 3G0ZA 4AHSA 4O3SA 4CHOA 5KFCA 3L2RA 7ICTA 5EOZA 5KFYA 2AJQA 4HCCA 3WNGA 3UIQA 9ICVA 2BPFA 3VQ7A 3A2FA 3AO4A 1HNVA 4M3ZA 5HRNA 2F8TA 3KKSA 2AGOA 4BXOA 3HO1A 4MFAA 4J9SA 5DMRA 4RQ4A 3GILA 3K5MA 4I2FA 4E7KA 4B9SA 2BDPA 4IQUA 5CA7A 1S1VA 4QZGA 1TK5A 2RF2A 4PPXA 2IHNA 1S0VA 4I2AA 4F5RA 3MBYA 4FJHA 1NJZA 2KFNA 2D0CA 3HVTA 3K59A 4KN4A 3PX6A 3ZDEA 3C5FA 4KLIA 1Q9YA 4J9MA 4KB1A 4F93B 4I2PA 4RU9A 5J2QA 3I8DA 1D5AA 3NGYA 4DTJA 4AILC 3ZSRA 4FO6A 9ICUA 5KG3A 5DBBA 3Q8SB 5CZ2A 1BQMA 2EX3A 1GOBA 3QZ7A 2BPCA 3QEBZ 3OY9A 2KN7A 1ZYQA 4YFUA 4ED0A 3ZSXA 3PO4A 1KRPA 3Q8QB 1RBVA 5KFMA 5F9NA 2Q3SA 2OPSA 3QLHA 2FPKA 5SZTA 3QNOA 4CCHA 2YV0X 1TK8A 4M3YA 4E19A 1HJRA 1JMSA 3OYFA 3PMLA 3CYMA 4FJ8A 2V4RA 4YR3A 4N47A 3ZT3A 4Z4EA 5C42A 3MR5A 5J0RA 4TUQA 1CXQA 4YR0A 5J0OA 1BIUA 4FJKA 1FKPA 4NLZA 1ASUA 2X74A 7ICJA 3RH4A 4YG2A 3IHQB 1K1SA 4BDPA 4DS4A 1TVRA 1VSEA 1HUZA 3ZDCA 1KFTA 5FDLA 1Y97A 4Z4CA 4KHYA 4KLUA 4QZEA 4KLSA 3ULDA 5L1KA 1TKDA 1RT4A 3RJHA 1RDBA 3NH0A 4DEZA 4R64A 3OYMA 4F5PA 1Z00B 1XHZA 4M3UA 1W0HA 2HHQA 4J9PA 3LP1A 4O4GA 4TSXA 4J2DA 2J6SA 4QW8A 5I3UA 2GV9A 3SYZA 4Z4GA 4OGEA 5J2BA 2YKMA 4I2QA 4CJUA 2UVVA 4Z6EA 4RW6A 4JLHA 4CJ3A 1C7YA 3AVLA 2LYHA 4QZFA 1BISA 3HYFA 2W42A 3U6FA 3NBPA 1ZQIA 5KFGA 5JS2A 8ICNA 4QZIA 4O3OA 4IFYA 2O4GA 4DS5A 1XWLA 2FC0A 4EBDA 5KFXA 1G15A 4EBEA 7ICRA 3AVGA 4RQ6A 2XC9A 4AHVA 4FLZA 2F1HA 1RCHA 4O44A 4YCXA 2M9NA 4R63A 4O0IA 5J2PA 4DOCA 1ZQFA 2LSNA 4JV1A 1RT3A 3S3MA 4O5EA 4ED8A 5DQIA 2IAJA 4KV8A 4FS2A 1Z00A 4DOAA 4E7HA 1WSEA 4RW9A 3M9NB 4ECSA 1C1CA 1VRUA 5EWGA 4JV0A 3GV7B 4CHZA 3AO5A 2C28A 4DF8A 1I39A 1ZBFA 5J0WA 4TUPA 3RJEA 5KGXA 1XC9A 3LK9A 3H40A 2FLNA 3ZDBA 8ICJA 4CJ5A 4RQ2A 5EWFA 2VWKA 3KHHA 2PFQA 1S5JA 3EY1A 2YNFA 2XY6A 9ICMA 2VA8A 1BHLA 4XRHA 4DQSA 1EXQA 5L1IA 9ICBA 3OJSA 2RKIA 5KG6A 4YFKA 3MEEA 8ICMA 4ICLA 3KHGA 1SV5A 3PW2A 4FM2A 4CE9A 5C24A 3NF8A 2ZD1A 1SKRA 3K5NA 3T5HA 4M9JA 3VN5A 5L1JA 2HHSA 4MF2A 4CJWA 4C8MA 3RH6A 4FLYA 1RTJA 4ZTJA 2ZJ5A 2ISPA 3EPGA 4DSKA 3JYTA 2Y1IA 3O4QA 3L3VA 4BDZA 4FLUA 4BACA 2OA8A 3KD5E 3CQ8A 2FPMA 5J0PA 3PMNA 4CEDA 3KLGA 4ELTA 3MGHA 3LPTA 3V6JA 3JPNA 1PZNA 5KFOA 4YD1A 3C1YA 8ICLA 2NRTA 5CY4A 1TV9A 1RT1A 4YXJA 3TAMA 3RWUA 4UB1A 3L8BA 1VSDA 2QKKA 4JV2A 3EYZA 1KTQA 3MXIA 4CK1A 4I29A 1X9WA 1CXUA 3PR4A 5EWEA 4DU1A 4IRCA 3NGZA 2G8WA 1XSNA 2X6SA 2DFHA 2AQ4A 3B6PA 3PX0A 3B6OA 4JRPA 8ICHA 1VRTA 2Y1JA 5J0UA 3HSTB 3HJFA 4NYNA 3LANA 2X6NA 2FPLA 1A5VA 3MDCA 5DLFA 3H7IA 9ICTA 3VQ5A 2KQ2A 4HYKA 3OYGA 3I0RA 4CK2A 1BL3A 3RJIA 4DLEA 4N41A 2BCVA 3AVNA 1D8LA 1D9DA 4E7LA 3GIIA 3OYAA 4FS1A 2VG6A 1XHXA 2JEGA 5K14A 4Z0UA 4CJFA 4MFBA 3RMBA 5KFHA 5KG5A 1BQNA 5JS1A 5HBMA 3ZSQA 4DL4A 1JIHA 3L2VA 2A1JA 4JS4A 1LAVA 4RUCA 5HLFA 1ZQPA 2AGQA 2ALZA 3BGRA 2B6AA 7ICUA 4NCAA 5HHIA 4O3RA 1IO2A 3E01A 1JL2A 1Z3EB 4QZBA 1C1BA 3VA0A 1WNSA 3OSNA 2JZBB 5J0QA 3AU6A 1HMVA 4CF9A 4DL3A 4N5SA 2PFPA 2Q0ZX 3F73A 2Z1HA 3TFRA 4CF8A 2RPIA 1DLOA 4DTUA 3ZT0A 4CJ4A 3VA3A 4O3NA 3QINA 4M2YA 1TAQA 4HUGA 4NYFA 4B9TA 2P51A 2W8KA 1VSMA 2QK9A 3QEAZ 3AUOA 3VQ8A 2XGPA 4M9GA 4J9OA 4I9QA 3H08A 3MABA 5HP4A 3EWAA 1REVA 2RDJA 1WSJA 4J9NA 3C95A 2MAXA 4QAGA 7ICEA 3EW9A 3RR8A 9ICAA 5CYMA 3HP6A 3RTVA 3QE9Y 2W9BB 3BQ2A 3H8WA 3AA5X 4CJRA 3K5LA 1ZQWA 5KT6A 3JPSA 4QWAA 2ZTDA 4CJPA 4R5PA 4EYIB 3T5JA 1IM4A 4TQSA 4I28A 2ZTCA 1RT6A 3F9KA 4KTQA 1UAXA 3V1QA 3AVJA 4RW8A 3QIPA 4DOBA 1D9FA 4JRQA 2BPGA 5J0TA 1BPXA 2UVRA 4GXJA 1VSJA 4NLGA 3NHGA 1JKHA 4YN4A 1J53A 4KITB 8ICXA 4R8UB 3C23A 1JN3A 4FZYA 2DPJA 1KVCA 2IC3A 2FBYA 1TGOA 3ITHA 4YNQA 1HQEA 4FLXA 5CZ1A 4KREA 5KFKA 5KT3A 3RJFA 3QEWA 4O5CA 3SUQA 7ICVA 5KTQA 5DK5A 4AHRA 3TAPA 3LDSA 1HNIA 2IBKA 1ASVA 5KFQA 3THVA 1Z26A 4P4MA 4DTNA 4FBUA 3NDKA 2I5JA 4Y1CA 5IIIA 4DL7A 1KCFA 2DY4A 4YP3A 8ICEA 7ICSA 4IG3A 4RW4A 1NK9A 1LB2B 1VK0A 3GIJA 2FMPA 5KT4A 3V7KA 7ICGA 1XSLA 2P5OA 4DF4A 3PR5B 4DQRA 3C2MA 1S0NA 2KZ3A 4PGQA 1RTHA 3EPIA 4ECVA 4JWMA 4ECWA 3PW4A 1SL2A 3NGDA 2XGQA 3BQ0A 8ICUA 4XQ8A 3RB0A 2W8LA 3SPYA 8ICWA 8ICRA 1IKYA 4DSIA 1S77D 2D0AA 9ICSA 3BJYA 1S0MA 2IA6A 3Q8RB 4YMOA 1IXRA 5HNKA 1JXLA 2VG7A 4I2CA 1ZQGA 4DQPA 4M9LA 3SQ4A 1KFDA 9ICCA 4CJTA 5HROA 5D3GA 5IIJA 3MR2A 2BR0A 4ECRA 2G8VA 5DLGA 3KTQA 8ICIA 3E2EA 1EKEA 3S3OA 4ZH4A 4KRFA 3QEVA 3D45A 4OKJA 3OYCA 4KB0A 4DO9A 4M6WA 3JPOA 3SUPA 3ZSWA 1L3VA 1S10A 3PVXA 4J9LA 2J6UA 2ITGA 4AHTA 3OHBA 1TL3A 4B08A 3DOKA 4ECTA 3QEXA 3LWMA 9ICJA 4CEBA 2BGWA 4ECZA 3M8PA 1XSPA 4DL5A 8ICOA 5KFIA 1BI4A 5HRSA 4BDYA 4RNNA 1RBRA 4KMUA 2IHMA 1TL1A 3AVAA 4FJ9A 1KLNA 4Q0BA 5DQGA 4W5TA 1IH7A 4GW6A 1Z25A 4QZCA 2HHUA 2YNHA 4KLGA 1ZJNA 4BGDA 1JLFA 4AHCA 1T03A 1ZQJA 1Q8IA 3RBDA 2VA2A 4ZHRA 4IQVA 5BOMA 2C2DA 1BVSA 3AVCA 3ETLA 4PH5A 4B9MA 5SWMA 4MEYA 4J9KA 3ALYA 4Z6CA 3ZDDA 4PWDA 1HYSA 4DQIA 1J54A 4BWMA 1RYRA 2F1IA 2F8SA 8ICGA 1AROP 1RDCA 3NH1A 1RPLA 4C8KA 4E7IA 1BPYA 3IS9A 3M8RA 2FMQA 4IRDA 5KFFA 1U04A 4YXMA 3O3FA 9ICFA 3ISNC 5KRSA 3SQ1A 3HWTA 2A1SA 3V7LA 4M47A 4J2AA 4QWDA 4IR9A 4ED3A 4PHDA 4DG1A 4DSLA 2B5JA 3L2UA 9ICHA 1LWEA 4PA1A 1H38A 9ICLA 4GMJB 4JS5A 5DQHA 3OYIA 2B4JA 3SQ2A 1ZETA 4KLLA 2VWJA 4QWEA 1DTTA 1FKOA 4ID1A 2OYQA 3AU2A 2ZJ8A 4TUSA 1U4BA 4IQWA 3UXOA 1ZQZA 1S1TA 1ZQLA 1MSWD 2V4QA 1KEJA 5KRTA 4ELUA 1N48A 3U3GA 3AVKA 3QNNA 5DB7A 2HVHA 4EP5A 3ZD8A 4DL2A 2HHVA 5J2EA 4Z6FA 2P6UA 1IKXA 4LZDA 5CB1A 2PFNA 1N56A 4CFCA 4BE0A 3KK2A 1EXNA 5DDYA 2BANA 4IG0A 5KG0A 4GXIA 4IDKA 2BKEA 1HYZA 4C8LA 3TANA 1ASWA 3FYHA 5J2HA 2E6LA 1ZBIA 3KIOA 3LWLA 1U45A 3VQDA 4UBCA 3LALA 3G6XA 2ZE2A 7ICOA 2A1RA 2NRVA 1WAFA 5J2GA 1TFRA 4FK2A 4DTOA 4RPZA 3TWHA 4CECA 3M9MB 5C5JA 1RILA 1WAJA 1XS9D 4OLBA 4DFMA 8ICAA 1T05A 3RRGA 4K4GA 4RQ7A 4FK4A 4ID5A 2JEIA 2P66A 3MXMA 1BIZA 1CZ9A 4Q8EA 3KD1E 3C21A 2HNZA 4KI4A 4HTUA 8ICCA 3RRHA 9ICOA 4NM2A 1QLNA 3M8QA 4UBBA 4M41A 1IKWA 2HHXA 3QEIA 2XO7A 4I2JA 1ZQOA 3HPOA 5KI6A 4W5OA 1J9AA 5CR0A 3SNNA 4EZ9A 1ZQSA 3OYDA 3L3UA 1SUQA 4YVZA 8ICYA 4KLHA 4O5BA 4M3TA 4I2BA 1S6QA 2RN2A 2NRWA 1T7PA 4F2RA 5HMLA 1XO1A 1U47A 5KG2A 3LP3A 1XU4A 3N4MB 2BCQA 2KW4A 1RBSA 4R66A 3OYLA 5KFAA 1ZBUA 4F4YA 1W9HA 1LW0A 3ISDA 2WOMA 3AVIA 4FVMA 3OVNA 1R0AA 4HCBA 4KHQA 5J0YA 1ZQVA 2UVWA 4Q43A 1YVUA 1NKCA 3KKRA 2BCSA 3AO3A 2DFLA 3JPQA 3PX4A 1BPZA 1ZQMA 4M6WB 3PW5A 1O1WA 7ICIA 4CFAA 1HUOA 5IIKA 3VQQA 1GOAA 3SI8A 2DFFA 3VQCA 2QKBA 3VQ9A 3HW8A 1VSKA 5CHGA 2UVUA 1NJWA 4B3OA 4W5QA 1QSSA 2V9WA 5KG1A 4RPXA 1BPBA 2W9CA 4UAZA 3OYEA 4ED6A 1WSFA 7ICKA 3ISCA 4FJLA 1NOMA 1FXXA 5FRMA 2X78A 4RNMA 4GXKA 5FROA 3VQAA 1JLAA 4LZGA 4F50A 2XY8A 4NM1A 3NFAA 5DB6A 8ICTA 2NUBA 3OYJA 3PV8A 2ISOA 4O0JA 2NRXA 3MAQA 4XA5A 3ZSVA 2OPPA 4CIGA 4QWCA 1ZQYA 4NY8A 4DFKA 3N97B 4DTPA 1LAWA 3QETA 1KDHA 4HHTA 1RXWA 7ICPA 3MFHA 3S3NA 1JL1A 1X2IA 2P1JA 4I2IA 3M9OB 4PQUA 1U48A 4QZAA 3T19A 4CHQA 4Z4IA 3V9SA 3K5OA 5J2JA 4R65A 1CLQA 2W9BA 1RBUA 5IIMA 5EU7A 4FLVA 2W9AA 5D4BA 9ICPA 1S1XA 4CFBA 3BDPA 4M04A 8ICFA 4KLMA 4G1QA 4CF0A 4F4WA 4RQ0A 3U3YA 3ZD9A 4QZHA 1CEZA 1DOQA 2YNIA 3VQ4A 2BQ3A 4O5KA 3UQ0A 1WCNA 5J2CA 4CIFA 4C8NA 1T3NA 3V9ZA 2F96A 3DLEA 4JWNA 4AHUA 3ZSYA 3AO2A 5F9LA 1TK0A 4M9HA 2OZSA 3SJJA 4YQWA 2OPRA 4UB3A 9ICNA 1ZQTA 1ZBHA 3AA3A 5J2AA 2PYLA 3C2LA 2C2EA 4KN7A 4H8KA 3NF7A 2BCRA 3KLEA 2C22A 1NOZA 1Y88A 2IDOA 5BOLA 1JLQA 2GUIA 4CEEA 8ICQA 3OYHA 2ZUCA 1YT3A 4LVSA 4HUEA 4DTXA 4GLXA 2I9GA 1C0MA 3KLHA 4KLQA 3G6YA 4CK3A 3H8JA 4EYHB 5J2DA 3RJJA 4DTMA 3G10A 1S76D 5T7BA 4F4XA 3S9HA 4H4OA 3TABA 3LZIA 1NJXA 1ZQUA 3RAQA 3HP9A 2PZSA 8ICPA 1B92A 3HX0A 4B8AB 4CHNA 2G8UA 3QERA 3TQ1A 4J2BA 4XUSA 3UPQA 1B43A 4CGIA 4QCLA 3KLIA 3OGUA 2WTFA 4K4IA 3HVRA 4FJ7A 4DSFA 4Q5VA 3DLBA 4PHPA 4QOZB 5J2FA 1X9SA 2ASDA 1JLCA 5KFWA 3MR6A 3HPGA 2HW3A 3MECA 1UOCA 4Q45A 4CJVA 3M8SA 3HXMA 3SUNA 3H4BA 4DU3A 1LV5A 2OPQA 2AU0A 4EBCA 2XHBA 4B9NA 4QW9A 3P5JA 2VANA 1C0UA 3LDAA 1ZQCA 3TAQA 5J2MA 3FDSA 4F3OA 3C1ZA 1QSYA 1RT5A 2ZJAA 4J9RA 1NK6A 3SV3A 4FJGA 1NJYA 2FLLA 4RQ8A 3MR3A 2HNDA 5TZVA 1ZQEA 3MEGA 3OYKA 4UB5A 3RMAA 4KKOA 4DQQA 1ZQRA 1NK4A 3AV9A 2C2RA 2R8GA 2QXFA 3V81A 4CIEA 4UAWA 1CZBA 5DG7A 3AA4A 3H4DA 4I2EA 1RYSA 4M42A 3DRRA 2E4LA 2YHAA 1SKWA 3ASMA 5DDMA 1S9FA 4PHAA 3KLFA 4KO0A 4QZ9A 4KLOA 4I7FA 3B0YA 9ICEA 4CFDA 3JSMA 1ZQXA 5DB8A 1A77A 3AO1A 4IFVA 1EP4A 4F4KA 4Z4HA 5J0XA 3ZSOA 4FLWA 5KFVA 4UB4A 3TAGA 4RPYA 1LWFA 4G3IA 2BHNA 5KFRA 3C6UA 4N76A 3AVFA 2MUTA 2H5XA 3AA2A 5CJ7A 1RT2A 1NK0A 3KK3A 3O4NA 2XCPA 1X1PA 1N5YA 3MDAA 3RJKA 4HVJA 4AH9A 4F5QA 2F1JA 4KTWA 2ZTEA 3T3FA 3KHRA 4F5OA 3CM6A 3NCIA 4FLTA 5DB9A 4LH4A 3NTUA 3PNCA 4CERA 3QIOA 1C6VA 3DI6A 5KGWA 4DSEA 3I0SA 1TAUA 3GIKA 3WNHA 4FW1A 3NAEA 4FM1A 2ZUDA 5KFPA 4DSJA 3DM2A 2FMSA 1NKBA 2IS3A 4ED7A 3TI0A 3CFOA 5DGBA 2IOCA 4LSNA 3RJGA 3RH5A 2FBVA 3P1GA 1WSGA 2YNGA 4DWIA 4E3SA 3V6DA 3PY8A 3TAFA 1NK7A 4O9MA 3NF9A 4OKKA 3RBEA 2J6TA 4RQ5A 4GC7A 4P4PA 1EX4A 2JEJA 4JK1A 4KLDA 2O4IA 2IGIA 3V9UA 3IM1A 4M45A 1BI4B 3WNEA 2KFZA 2OWOA 5DKWA 1C1AA 1C0TA 5KFNA 4LH5A 1FK9A 1ZQKA 1HRHA 1WSHA 1BGXT 2R7YA 4CHPA 4W5NA 4GC6A 2XY7A 1NK8A 1K6YA 3UXPA 3V7JA 4ELVA 3OS0A 4E7JA 1COOA 1RZTA 7ICQA 5IINA 4ED1A 1WCLA 4ECUA 4R8UA 4FJ5A 3OHAA 1UT5A 4KPYA 4L8RB 4I2HA 5J0SA 1BPEA 2KZZA 4FJIA 1S1UA 3V1OA 1VSLA 3T5LA 4CGHA 4FJJA 4MFCA 1QSLA 1B22A 3NH2A 5FRNA 3NF6A 1B9DA 1HPZA 4K8XA 3ZCMA 3JPTA 1BCOA 3C6TA 4E1NA 4IKFA 4X5VA 5E41A 4RG8A 9ICQA 1U49A 7ICMA 1MU2A 3K75D 3C2KA 2JGUA 2ATLA 4K4HA 1RXVA 3LPUA 3HPHA 4CEAA 4YR2A 4KLTA 2BGGA 1LW2A 3SZ2A 1JLGA 3DLKA 3B0XA 4YMNA 4RQ3A 3RMCA 4F2SA 4F4ZA 1QTMA 4B9VA 3DMJA 4BXOB 3Q8PB 2GBZA 3OJUA 2Z1IA 3SPZA 1JXEA 4EEYA 5KFBA 3SV4A 3SCXA 3HM9A 4UB2A 4FJNA 3RB3A 1RTIA 5L9XA 5KFDA 2R8HA 4LSLA 4LY7A 3H8SA 4DU4A 3ISBA 2B21A 4OKEA 4KHUA 3VQEA 2I1QA 1A76A 3P83D 1NK5A 2HVIA 1QQCA 1RBTA 4RUAA 1DTQA 3GQCA 5KFUA 2YKNA 4FK0A 1YTUA 4CF1A 2AQ0A 3RAXA 1UA0A 3OS1A 8ICKA 3CFPA 1V9PA 5J2NA 3T5KA 1BCMA 3IAYA 2DTUA 3PW7A 4RZRA 4H4MA 3LP0A 3DYAA 1JXBA 3MFIA 4M0AA 3RR7A 3DOLA 4DTRA 4MF8A 1LWCA 2P5GA 4CJQA 4PGXA 1WSIA 2JZBA 4C8OA 4NXZA 3V72A 4FJXA 1HQUA 4CJEA 3GV5B 1ZQNA 2G8HA 3TR8A 4OLAA 2W9MA 3UXNA 4KHWA 2HHTA 4Q8FA 5KG4A 1L3UA 1JLEA 2PFOA 3AVBA 4N56A 3D0PA 1S9EA 2R8IA 1ZJMA 3BQTA 3NGIA 4IRKA 3BQ1A 2BQUA 4IBNA 2PI5A 3PW0A 5DG9A 1SL1A 3T1AA 3ZDAA 4NLKA 4TURA 2FBTA 4QZ8A 3SUOA 4KHNA 3VQPA 5HHHA 5D49A 1L3TA 1T4GA 1TVAA 4KFBA 4QWBA 4M3RA 2E6MA 2XCAA 1EETA 3QO9A 3KJVA 4KI6A 3VQBA 4F91B 8ICZA 3O3GA 4OPKA 4KTZA 4RT2A 5CWRA 7ICFA 3HT3A 2BE2A 5DBAA 4Z4FA 5DGAA 3ZSZA 2PYJA 4FCYA 2D0BA 4YMMA 7ICNA 2BCUA 5HRPA 2XY5A 4KLFA 3QEPA 5J29A 1S9GA 1KVAA 1ZQDA 1S1WA 4MEXA 2EHGA 4FM0A 3OYNA 4W5RA 7ICLA 4CGJA 3MGIA 2KZMA 4BE2A 4NLNA 3QESA 1TKXA 4ECXA 3PUFA 2HMIA 4DMNA 2ETJA 4ECQA 3GDXA 2JLEA 4I27A 4CEFA 1NKEA 4GVMA 2A1JB 4FW2A 3C5GA 4XIUA 3K2PA 2IMWP 2KTQA 4K8ZA 4OJRA 4BE1A 4RW7A 3DLHA 4WE1A 3OYBA 3KK1A 2G8IA 1RNHA 4OGCA 3CFRA 1YTAA 3LAKA 2RDIA 3GV8B 1VSFA 8ICSA 2NRZA 2DFEA 5IIOA 4O3QA 9ICGA 2HNYA 1HJPA 4PHEA 1TV6A 3O3HA 2ASJA 3AVMA 3TARA 4CGDA 9ICWA 5BPCA 1S97A 3DLRA 4E89A 1BPDA 4MFFA 3AVHA 4Q44A 4HUFA 3OSPA 1L5UA 1I3AA 5CYQA 4KLEA 4FBTA 2ASLA 2G8FA 4P2HA 2MUTB 5KG7A 2PY5A 1QE1A 1DGSA 3FFIA 1S0OA 3RB4A 4PY5A 4BWJA 3TFSA 3MEDA 1KLMA 2HB5A 4OPJA 2OZMA 1A5WA 1SL0A 5KFSA 1ZQQA 1SZPA 5J2IA 4MQ3A 3UQ2A 4NCGA 1ITGA 2HHWA 5KFTA 4UAYA 1QHTA 5J1EA 3LZJA 4CESA 4KHSA 1MQ3A 3KHLA 1VSIA 4PGYA 4J2EA 1JLBA 3LAMA 2ZQBA 1GOCA 4FXDA 1RTDA 3JPPA 3L2WA 3MXJA 4F8RA 2VG5A 3V6HA 7ICHA 2Z1GA 3V9XA 4O3PA 4DFJA 3DRPA 4E0DA 4FZZA 4F92B 3HK2A 1TKTA 4CF2A 2ZUBA 3LP2A 5CP2A 5I42A 4B9UA 5HRRA 2R8KA 1K1QA 4IR1A 3V1RA 1RDDA 4CJSA 4CGGA 3SQ0A 1WLJA 5DG8A 4FJMA 4ED2A 4DL6A 3JPRA 4DFPA 4I9LA 9ICRA 3QZ8A 3IG1A 3IRXA 9ICXA 4FZXC 1N6QA 3Q8MA 2YHBA 1SKSA 3ZT2A 3WNFA 1D8YA 1CUKA 1IKVA 3K4GA 4KAZA 4TQRA 4I2DA 2PI4A 1MQ2A 1NOYA 5L1LA 5IILA 4E1MA 4RNOA 4RT3A 4KLJA 1HYVA 1X9MA 2VA3A 1WN7A 4M9NA 3V9WA 4EZ6A 1VSHA 1XI1A 4CJLA 3V4IA 1QS4A 3RB6A 4CEZA 4UQGA 5KFZA 1ZQHA 3EZ5A 4RQ1A 4ECYA 2FLPA 4EP4A 5D46A 5KFLA 2P6RA 1ZBLA 4IQTA 1KVBA 3G6VA 1T8EA 5KFJA 3OS2A 1IG9A
chains in the Genus database with same CATH superfamily
3PSTA 2HBJA 3ZXWA 1RP5A 2MGZA 4DPYA 5A8KB 4B3OB 4RBVA 3PM9A 1QQ6A 2RSQA 4LC9B 1E6YA 1RM6C 2BQRA 1SCJB 2VZ9A 3EXYA 5HMWA 4Y1DA 2MQMA 1V5IB 4OVLA 1F5BA 2QYCA 2MSNA 5DM6Q 1RDAA 4DCPB 4DV4K 1LKYA 1HHQA 4O55A 3NS5A 4IG0B 4J9UE 4PZNA 2HF4A 4B8CA 2CPYA 4J9QA 2LYAA 4DV6K 3Q83A 2R8JA 2YX4A 2X3DA 2UUBJ 3GU0A 3GDQA 3CQYA 4JEPA 3WKAA 4FKYA 2MB0B 3I56N 4O44B 4A61A 4F3TA 4FYVB 1FEEA 3GG4A 4CGFA 5EX3A 2PSZA 4PUOA 2HIQA 4IKAA 1N61A 2WAQD 3MMCB 2PXIA 1P6TA 4DCJB 4LFBJ 5C24B 2BUPA 3C94A 2JWKA 1IKVB 3PYDA 2DNKA 1ZQBA 3THXB 2YWWA 3TZYA 3CJ4A 1JJCB 1UA1A 3CJKB 3CUNA 1WOSA 8ICVA 3BGOP 3O8MA 1AB8A 4K2JA 3TAEA 3N28A 4CEQA 1HIYA 5AE2A 2DBYA 1L3SA 2VJVA 2GWSA 3GIMA 5KAIU 3EWGA 3QU7A 7ICTA 2IHR1 5KFYA 2AJQA 3SMPA 1S5ZA 2A3JA 4UTGA 5BPLA 1HNVA 1N88A 5HRNA 3CCMS 2V50A 4JI4F 3O6WA 5IXUA 2H4YB 4MFAA 4J9SA 3EVWA 4I2FA 2G9OA 2HRTA 1WNEA 1WG1A 3D2EB 1S1VA 1TK5A 3H8YA 4AD6A 2ZVIA 2RF2A 5AK3A 4C80A 5AM0A 2IHNA 5GAEI 4Y2AA 1UVMA 3EGWB 3MBYA 2D0CA 4KN4A 1HD0A 4KLIA 3QRQA 4FOIA 3PNIA 3CXCM 3EZUA 3BP8A 1ZPVA 4C3LA 3BSNA 3R3TA 1HNZK 2KT3A 1IBMJ 5GAGP 4AILC 2KYXA 4IO9L 3HRDD 3QUCA 1WHWA 5KG3A 1W7AA 1O13A 3QRPA 5CZ2A 3W7BA 3CHWA 2EX3A 1GOBA 3L0QA 1CULB 4J90A 5IT0A 3R1HA 4GVBA 2KN7A 1HKBA 1RBVA 1Q5YA 5EY4A 4NRTA 5AFUH 1FK9B 3QNOA 4U7UK 4CCHA 4M3YA 2O8FA 2A19A 1T3VA 5D4PA 5IM0A 1PVRA 1H2VZ 3PMLA 3CYMA 5M1NA 4CM0A 4N7TA 5D77A 2GHPA 5DRKA 1B4FA 2AJFE 5CABA 1RZMA 4TUQA 3J7YI 5J0OA 3CJ9A 4I6MB 4ILJA 4WYWA 2ZDOA 4JI5J 1ASUA 2X74A 2B43A 2NXNA 7ICJA 4NA2A 3TJAA 4ZLJA 2Q1LA 4XDCA 5DJBA 2PT0A 4CLYA 3ZETB 2GGPA 1RWOB 3LP2B 2UXDF 2UUCK 2XMWA 1TVRA 3P3DA 4A8OA 4LF6J 2FLOA 1VSEA 2QW9A 1NGBA 1Y97A 4PABA 4KHYA 8ATCB 4QZEA 4KLSA 3QT8A 5L1KA 1RT4A 1NPRA 4WU3A 2IA0A 4GMKA 3S7RA 2KVCA 4DV7K 4LSZB 1WELA 2E1FA 3CCJS 5AXNA 3MUMP 4M8LA 4ILRA 2LEAA 1U1MA 1Z00B 2V2KA 3VR1A 2YQ1A 1HW9A 1JLGB 3TZXA 1W0HA 2MYFA 2HHQA 4RW9B 5LMUK 2J6SA 2B7CB 4LVNP 4JI0K 5I3UA 2F4FA 3SYZA 6FDRA 2ASPA 4K4XA 4LQ9A 3LGMA 1NCLA 4I2PB 3KWMA 1GNKA 3T7ZA 2D9PA 2F1FA 4RW6A 2JH3A 1M90T 5AQXA 3NMAA 3U26A 4BRFA 4KQZA 4DBQA 3HSJA 3NGTA 2G0AA 1B0PA 4QZFA 4OX9J 4DPWA 2YKOA 3K8VA 5KFGA 4TU8A 3W2WB 4O3OA 1NGFA 2O4GA 1XWLA 3IM9A 4EBDA 1G15A 2FC0A 2GZOA 3UW1A 5F8HA 2HG4A 3CMES 4DMZA 4AHVA 1U2VA 2F1HA 4FLZA 4M5IA 5HVHA 2D69A 2F40A 3CDWA 4MHVA 4JB3A 3MEDB 2M5YA 4TY8B 5J2PA 4F02A 3D0GE 1PYOB 2LSNA 4JV1A 4ED8A 5HR6A 4FS2A 1Z00A 4RJVA 4RW9A 1FWLA 2HLUA 2LQ9A 2YHYA 3HZGA 4ERDA 4JV0A 4C4WA 2ASMA 3RBZA 1YKWA 5J0WA 3FZ2A 1ZBFA 1FT8A 4O4GB 1XC9A 4H5RA 2WB1F 3ZDBA 3BSAA 2D3UA 4CJ5A 2MKJA 1U8WA 2PFQA 1T44A 3EY1A 1VQPS 9ICMA 3RYLA 4UB8U 3PIPL 4DQSA 1EXQA 3L7UA 2KKPA 3MM9B 1ULRA 2CPFA 3C2PA 4RQNA 8ICMA 4ICLA 2HEKA 1SV5A 3N4PA 4CE9A 5CHCB 2ZD1A 1SKRA 3K5NA 1C4AA 3T5HA 3TUJC 1CQNA 2NPIA 5IQ6A 4FWSA 4X4UA 3MMBA 3FBBA 3C29A 4MFBB 4B3TK 4CJWA 5A0YA 3G9CA 2ISPA 2Q36A 1VQON 4BACA 2OA8A 3KD5E 2VOOA 3UCUP 4L3QA 2QWNA 3CQ8A 3KFWX 3KLGA 4CEDA 2LM4A 1HNXK 3PTWA 2DGZA 3JPNA 2IAJB 2KXFA 2CJKA 2QFIA 2H3FA 1SXDA 4YXJA 4UB1A 3VF2A 3MXIA 1X9WA 3GJSB 2PMZD 4IJNA 3C6TB 4IRCA 1HLUA 4CZLA 3GZFA 2DO0A 4UY8T 2MPUA 2FJBB 2BANB 4CH1A 1HNWF 2LEBA 2W1BA 4WXOA 4XEIA 4IS7A 2MLYA 3VEOA 1FWPA 4DR4F 1YAGA 4NO7A 3M1VA 1KN5A 3DN9A 4CRXA 3AOBA 2W3SA 3CMAN 2X6NA 2FPLA 4GKKJ 3SCLE 2F8HA 1PYTA 4QPXA 2LP4A 3N4WA 1MU2B 4JI5F 4TLRA 4RKUC 4CLPA 2AWZA 3RJIA 4DLEA 3BZQA 4HI2A 1ATRA 2GCFA 4YB5A 1WC4A 3AVNA 3T79A 1NSQA 3FRYA 2EG1A 2HOEA 1WTFA 4F36A 4HTIA 3GIIA 3OYAA 4DB3A 3TADC 1F1BB 1RQNA 3FVYA 1YJWS 1HI0P 2DT9A 3WX8A 2VV5A 1LW0B 5KG5A 1FI4A 1PCAA 2A1JA 1SUQB 1FJGF 4JS4A 4RUCA 2OHFA 4KY3A 2HS0A 3LO3A 2E44A 2Z2YB 2B6AA 3MDFA 1TL4A 1HYSB 1N33J 4BRPA 4FWKA 4P0QA 2QA4S 1Z3EB 4QZBA 3PKMA 3TRGA 4NL5A 3OSNA 2JZBB 5J0QA 4O8KA 4DQ8A 2CKWA 5GVQA 4GKKK 3I55S 4PZVA 1RHMB 3QGGA 1ZAXA 2PFPA 1RWUA 4BROA 2K4IA 2MZTA 3QU9A 2FJVA 4CF8A 3PSPA 4JI4J 1KQQA 2E5JA 3ZT0A 2ZGZA 5I42B 3QINA 1OW5A 5GIPA 4HUGA 2HURA 4DR1J 2ROEA 3HBTA 2W8KA 1VSMA 2QK9A 1WF0A 3QEAZ 2GIQA 3AUOA 2XGPA 4QS7A 4J9OA 4PL7A 4C4SA 5EXWA 2UXCK 1VQMN 4J9NA 4QAGA 2PGCA 1JLAB 4DV6J 4TU9A 3RTVA 5AQUA 3TWZA 3AA5X 4CJRA 4PR6A 2MJNA 4QWAA 4EYIB 4WIIA 4TQSA 2ZTCA 1RT6A 4Z94A 4LFAJ 1UAXA 3V1QA 2OSRA 4DOBA 1HNVB 2DGOA 4C6AA 1ESVA 4JRQA 5J0TA 4GXJA 1GLCG 4Z7CA 3JSMB 2EKYA 2QB0A 1FXLA 3VGKA 3WXKA 3CJ0A 3EO3A 2V7ZA 1EARA 2DHGA 2Q1NA 2Q6CA 3ZLJA 1CJTA 3ITHA 4YNQA 4GVLA 3MOZA 2AH5A 1Z4OA 1DLOB 1S57A 2UUBF 3QEWA 4DV1J 1ZS6A 4FYXB 3I28A 2GIRA 2I7NA 5DK5A 2J7KA 3NUQA 2WSCC 4OI1A 3S1TA 4P4MA 2WB1D 3WXIA 2LI6A 2I5JA 3WKEA 2YMPA 1PAEX 4Y1CA 5IIIA 4DL7A 1KCFA 4DUYF 1U6BA 4WQ4C 3AT1B 1WC1A 1N5QA 1HHSA 1VFJA 3D67A 3FSXA 2PA3A 3ZFVA 1NK9A 1LB2B 2HQGA 3GIJA 2FMPA 4Y2YA 5KT4A 2HFVA 2XI2A 2MQPA 4NLPA 4C9DA 3PR5B 2QV6A 2HAFA 4PGQA 3EPIA 4OI0A 1Z2ZA 3D6TB 3Q22A 1OJ4A 4DL0C 4ECWA 2Q3PA 4L75A 1SL2A 2XGQA 3UMCA 3CCWA 1BC6A 5F0WA 3J80U 2W8LA 1QZ5A 1IKYA 4F0HA 1S77D 5GADI 1R0BG 4YMOA 5IC4B 1Q3VA 1NLKL 1VHIA 2E20A 4FPBA 3TEGA 4CI6A 1TAMA 3TX0A 1FXDA 4G65A 4DV0J 4Y2PA 4K0KJ 9ICCA 3D2FA 4JI2F 2EK1A 3MR2A 2G8VA 5A6WA 4I6WA 5L46A 2ZF5O 3CCVN 8ICIA 4C4TA 1VK8A 3BV8A 2RU3A 4HAIA 4KB0A 3SAGA 3JPOA 3L5KA 1ROFA 3LDOA 4J9LA 2J6UA 1ZRNA 4B08A 4XK8C 3DOKA 4CLUA 4ECTA 3M2RB 4B6JA 3E8OA 4P72A 2VB6A 1RXOB 2DNZA 3KDNA 3M32A 2HBYB 4OYBA 4JI7F 1R0AB 1QE1B 4DL5A 8ICOA 2P9NB 2V63A 4NOHA 3BN4A 4RNNA 3CNQP 1RBRA 3TX8A 4FPIA 4RL1A 2HBLA 5DQGA 3EXCX 4PL8A 4GW6A 4UZBA 2HHUA 4KLGA 1JLFA 3BREA 3U9DA 2CDRB 4LR8A 4WYBA 1BUXA 3O6QA 4X65K 1VQ8N 1BVSA 1QM9A 4PH5A 3DLJA 4B9MA 5F8LA 3HLUA 1N36J 5HQ8A 4KHMA 3X3UA 3TSUA 1I94J 4J9KA 4KKOB 2KVIA 5FLXO 3ZDDA 4PWDA 2H51B 1J54A 3MWBA 2OEMA 3IXQA 2XO6A 2YJFA 4D3HA 2F1IA 2F8SA 2PMZC 2QL9B 3MD1A 2ZIXA 3I9V9 4E7IA 5HATA 1C0GA 3M8RA 4CVNE 1BU6O 3JTNA 2LHTA 2QX0A 1U04A 3LGNA 1X40A 3CETA 2A1SA 3UR0A 3NGKA 3K0SA 4FNHA 4MMOA 1L7PA 1P1TA 4WE1B 4QWDA 2QL7B 2A0FB 1VS3A 1XJWB 3VESA 2L5YA 4AL7A 4OJLA 2AXTU 3C16B 1TL1B 9ICLA 3CRXA 2VQFF 2AZ3A 4YY3K 1H73A 1DHMA 1XBWA 3J7ZO 2CZ9A 3ULHA 4QWEA 3T69A 1U4BA 1QTNB 1WDTA 1GLLO 3R7SB 2CQBA 1S1TA 4QYRA 1HJOA 1KEJA 1WOOA 1V3ZA 2RKIB 4DV7J 2HBMA 2W3RA 3WK6A 3AVKA 3LDNA 5DB7A 1RACB 4NI2A 1T9VA 3ZD8A 4DL2A 3NCRA 2HKEA 3D0HE 4CLFA 2PDAA 2X1FA 2F8EX 2YY3A 4BE0A 4KMOB 3KK2A 1EXNA 5AICA 3CF5Q 3OR2A 4X84A 2BKEA 4C8LA 1ASWA 2E6LA 5ALDA 2JV3A 2CUYA 1VJQA 3KIOA 1U45A 1QQMA 3WBZA 4UBCA 3VETA 7ICOA 4QQBA 2A1RA 2NRVA 3OTOF 1S79A 4FK2A 4FZVA 4CECA 1DQ8A 1RILA 1KAZA 5B8HA 1C0FA 4CO2A 4OLBA 2FE9A 4DFMA 4HR2A 1UPHA 8ICAA 1LOTB 3BBFA 4RQ7A 2KLAA 1IWGA 4A8QA 4ID5A 2JEIA 2P66A 3OVBA 1DTTB 4LF7J 5K9FA 4OI3A 2M52A 4LFCK 2K4EA 4PKHA 4LRDA 4CIOA 5A2QY 4K4SA 4HTUA 1G6BA 3G8QA 3H2VE 2P9KB 1RT5B 1IKWA 5AM5A 4B02A 4F4AA 5GMEA 1TUUA 4YEAA 4M95A 3F53A 2H3VA 5KI6A 4QYZJ 1J9AA 4K42A 4ICAA 4EZ9A 3CCSS 2OFHX 2IIHA 3L3UA 2KE7A 1SUQA 3A5LC 4KLHA 4QIWF 3AOCA 4O5BA 4M3TA 2RN2A 3IRXB 4NLSA 2NRWA 1T7PA 4F2RA 1VQ6N 3UCGA 2ZM6F 3H2UB 2MQLA 1U47A 3OXGA 3AMZA 2HLTA 1NM2A 2RD5C 2QA4N 2YNIB 3M30A 1RBSA 2F7TA 4ZS6A 4F4YA 4KGKA 4ID5B 5BN8A 3QBXA 3NWGA 1NU0A 4KHQA 3ILLA 1ZQVA 2UVWA 3WXJA 2RU9A 3T6JA 1NKCA 1WUAA 4LF4F 4C23A 2DFLA 3JPQA 5A8WB 2ZOMA 1S12A 2J7UA 3G25A 3N9UC 7ICIA 1HUOA 3HF5A 1GOAA 3SI8A 1QQOA 3VQCA 2QKBA 4B3OA 1QSSA 2V9WA 3D6JA 4CNQA 3OYEA 4UAZA 1RU1A 3L3FX 4ED6A 4BVOA 2IRYA 2EFQA 1KD1O 5FRMA 1NWKA 4CLLA 4RNMA 4UB6U 1DFDA 1R8CA 4ZCIA 1JLAA 3VQSA 4LZGA 5FD1A 4F50A 2H48B 5E79U 3PV8A 4YN3B 3BY5A 2BMBA 2JRSA 4O0JA 3ZSVA 2IVFB 4DFKA 5LJWA 3FBFA 3OQ2A 3AAPA 1MWKA 4DUYJ 1N62A 3E51A 3HTVA 1RLCL 4DR7J 4PQUA 1RGVA 2VBXA 5HQMA 4R65A 5J2JA 4A57A 3AQPA 4GY2B 5EU7A 1IM6A 8RUCA 4US9A 2QG9B 2QIFA 2YB4A 1NNLA 3BDPA 1VISA 2JH7A 4JN4A 3LVWA 1CEZA 4U67L 3VQ4A 4HACB 2BQ3A 3GLJA 3UQ0A 1WCNA 5GMDA 2OMLA 4JI1F 4C8NA 3HJEA 3DLEA 1OMSA 4JWNA 4AHUA 5K8OA 5DS7A 3Q2TC 1XK8A 5M1QA 5GTIU 2CAJA 4RWWA 2DTJA 2OZSA 4YQWA 5ADZA 3K2YA 4PG6A 1ZBHA 2XYHB 3AA3A 1U2CA 2EVZA 3ZO7A 4IXCA 1F0XA 4BS2A 2O8BB 3UI3A 3H42A 2DNLA 2BCRA 1UFKA 3FBCA 1Y88A 1FRJA 1M5VC 2QGFB 1I51B 3J7YU 4NLXA 4A8WA 2MEWA 3MECB 1JNZB 2ZUCA 4CNYA 5HJYA 2W54A 4HH0A 1VQ4S 2B4VA 3KLHA 5HVFA 2FVRA 2W43A 3DGPB 2KKZA 1R31A 4LR7A 2ZH1A 2UUCF 3QSYB 5D4OA 2C3UA 4DJBA 4KC5A 2CQHA 4F4XA 3AXKA 3L3CA 4H4OA 3LZIA 4GVEA 4MH8A 1IG9A 1NJXA 1ZQUA 8ICPA 1MROA 3HX0A 1B92A 4CHNA 1AFIA 3QERA 3W3DA 4XUSA 4CGIA 3KLIA 3POTB 2K3KA 2WTFA 4JV5F 2WF9A 2GO7A 3HVRA 1HI1A 5ETSA 3ZNJ1 2F9JA 5J2FA 4ANDA 1X9SA 2OAUA 3FM9A 1JLCA 1HBUA 1F5AA 5AIBA 2HW3A 2VIXA 2DXDA 3MECA 3R3LA 3SSQA 2ZDPA 1SZ2A 2V4JA 3CCEN 2EWHA 3W5ZA 4Q45A 1H6KX 3CE8A 5FIIA 3BO3A 2MZ1A 1KQFB 2OPQA 2FSNA 4EBCA 2JVOA 3QWPA 5J2MA 4NZ7A 3KOOA 4F3OA 1QSYA 4AQYF 4DV5F 1SQFA 3OTDA 4TKTA 2ZJAA 3NRBA 4J9RA 2K3IA 3SV3A 2GMJA 3AA8A 4CT8A 1WKJA 5C2CA 2WFAA 1IBCB 1WB9A 1UFWA 4YY3F 5C42B 1NG9A 2QO3A 2HFSA 4DQQA 2BE7D 4ILHA 3AV9A 4UAWA 3AA4A 1H3DA 2DNPA 1HBUB 2F4VF 3DRRA 2R2RA 4CLWA 4CNZA 1L3KA 3F41A 2YHAA 1GLFO 1SKWA 2DL0A 3VPZA 3DI6B 5CRXA 2KP7A 4I7FA 3B0YA 4RX6A 3BZCA 2GEMA 4CFDA 2PA8D 3JSMA 2K2PA 3ENHA 1WKKA 2W11A 2NSBA 3FFIB 3THYA 4WF9L 1VJWA 5J2MB 2OM6A 1HWKA 4FF1A 5BXIA 3TTFA 1T95A 2CQPA 3ILJA 3F2KA 3ZSOA 1UFLA 5KFVA 4O8UA 3TAGA 5KQ8A 4AP9A 4LF4J 2AEMA 2LU2A 4ZPAA 3C6UA 5AQMA 4N76A 1YVFA 1VIXA 2HK2A 2IYGA 5AQHA 2H5XA 3RRKA 1NDLA 1RABB 2J9EA 4DR3J 4M5GA 2IM0A 2A3VA 3WEEA 2LA6A 4F9OA 4TY8A 5J2PB 1YHQN 5AZJB 3CCES 5LMNK 1LNQA 3WK8A 4BX9C 3AAQA 2YWKA 3KHRA 4JHDA 1EO1A 3M2RA 5GAGI 4LH4A 4JI4K 3QJLA 4OYXA 3CC7S 4I56A 1FFVA 1W2BM 3SQOP 2ZUDA 5KFPA 3BGRB 5GAEP 2ZXIA 4DR5J 6AT1B 1T9YA 2Z30B 2K7JA 2VPXB 4WXWA 4LSNA 4TNOA 2IVNA 2OXOA 4JI2K 2FBVA 4B3RJ 1AYEA 1JJ2M 3FJ2A 4YOYA 1DGKN 3V6DA 3PY8A 5GAEU 5M1KA 1LOUA 3GOIA 5EUHA 3NF9A 2KL8A 3JS9A 3RBEA 3OL8A 4GC7A 4A2BA 2V0NA 4KLDA 4WWSA 4KIAA 1I94F 2EC0A 2WHOA 4M45A 4CTAB 1UVKA 1V3RA 4LR9A 2LPEA 1O8BA 1TUWA 4A47A 4DX6A 1C0TA 1C1AA 4LH5A 4CO0A 3VC8A 1FK9A 3MAHA 4FXVA 3J81j 4B1WB 3VAIA 1S1XB 1X4FA 3UKUA 1IKWB 4ES1A 1NK8A 1K6YA 4OL8A 4CLKA 2O6KA 4DR3K 4ZHRB 2NYIA 1RZTA 1RTIB 2R7SA 7ICQA 2FSJA 1L8LA 3OHAA 3K17A 1UT5A 3CCSN 4C1NI 2I0XA 4I2HA 1IR1A 2UP1A 3AB4B 1X6IA 2Q0RA 3L7PA 5B7WA 1S1UA 3V1OA 4FXWA 3TYTA 1VSLA 2OP5A 2PFFB 2DKZA 2FGCA 3C3LA 2WAQF 2E8MA 3C14A 4OHWA 1VAZA 2B51A 4NLYA 5EE0A 2WFBA 1LXJA 1BCOA 4E1NA 3C65A 1KN6A 4RG8A 5AM4A 1MU2A 5THWA 3HSCA 1ECWA 3CXCR 1OXJA 2K89A 1RXVA 3LPUA 5BR8F 5CD4A 1YF5L 5IFMA 1JKHB 2DGXA 4KLTA 2HBQB 1JLGA 1R43A 4ANEA 3CGIA 3DFEA 1RAIB 3UKUB 1NPPA 4RQ3A 3LOUA 3J7AP 5C15A 3OFFA 3KDOA 5LL6Z 4F2SA 4F4ZA 1QTMA 1O03A 3DEEA 2Z1IA 1JXEA 5KFBA 3PEJA 2XSJA 2YQ0A 1LK5A 3SCXA 3MM6B 3C0BA 3R8EA 4FJNA 2HZAA 3RB3A 3HFZB 3RG6A 2FF6A 3L4PA 3EE8A 2MRLA 2MZJA 4LY7A 3V81B 1YJ7A 5T41A 4DU4A 2B21A 1V9OA 3R6MA 2ZBQA 4H4KC 5KOWA 3J81Y 2QWQA 3M8YA 2QTWA 4PG7A 2VBYA 2VG7B 2GW8A 1Q78A 2YKNA 4Y2RA 2LEPA 1YTUA 3ID8A 1WEZA 1UA0A 4DV2F 4LBPA 1YJ9S 8ICKA 4TLQA 3W2VB 3CFPA 1A6LA 1PK1B 2OEKA 5J2NA 2OELA 4MK9A 1EETB 2P9KA 3FZHA 2GV1A 4NX9A 1JXBA 1S5LU 3MFIA 4M0AA 5AJ3K 4DUTA 2E1AA 4MF8A 2P5GA 4CJQA 1WSIA 4C8OA 4NXZA 2Q79A 1FD2A 4LFBF 3NMUA 1KC8T 1L6NA 5DM7Q 3BSCA 1HLWA 2V8GA 4KHWA 2HHTA 2E9TA 1YG0A 4Q8FA 1T6CA 1L3UA 1KQSR 1NJIO 1S6UA 2PFOA 4OQJA 1LW2B 2JLFA 3NXZA 2XMKA 1S9EA 4M94A 2AP6A 3IBCB 1WSVA 3G71N 1X60A 2UV8A 2AYEA 4IRKA 1QHAA 2BQUA 4B3TJ 2CJQA 2PI5A 1RT6B 3PW0A 3Q0AA 4DFDA 3T1AA 5HL7Q 2ASOA 2IOFA 4CP5A 2KI2A 3Q8UA 4IO8A 4O23A 3C7NA 3FEZA 4KHNA 3BF1A 1KEKA 4IFVB 2EPIA 4M3RA 4U7CA 2EBGA 2FY1A 1ZA1B 4FPAA 4KI6A 1KBUA 3VQBA 3R8YA 3CIMA 1M6YA 5CWRA 2NZ4A 2IMOA 4QR1A 1JLQB 3ZSZA 2PYJA 2D0BA 1RAJA 2E5SA 2ZOFA 1FRXA 4B3SK 2FJ6A 2K7KA 5CCLA 4J5OA 1YHQS 1OKJA 2ERRA 3CD7A 1CBKA 1ITPA 2NCKL 2XY5A 2WONB 2BJDA 4US8A 5DDQC 2XULA 3QFUA 1KVAA 2VKQA 4ZVQB 1GXLA 3NOCA 3OYNA 4W5RA 2KZMA 4BE2A 1S99A 4ECXA 1TKXA 1P8ZA 2QWMA 3IS9B 2DRAA 4I27A 2EI5A 2CXEA 3VF6A 4WJBA 4FW2A 1I94K 1UP1A 2VFTA 5T7LA 2LXUA 1URJA 2NXUA 3HMJG 5CE3A 3CFRA 3F56A 1JI7A 4WFNL 3LAKA 4OX7A 1VSFA 1KQKA 2Y0BB 4LT6A 5CH7B 1YK9A 4YHHK 2ABYA 3O8WA 4O3QA 2Y3YA 5ALGA 3VEXA 2FI1A 4PHEA 1S48A 4JI7K 2B6AB 2WK4A 2WSFC 4U8VA 2P9UA 4CGDA 2VQEF 1S97A 3DCAA 1XMBA 4MFFA 3P39A 4Q44A 1ZOTA 2CPJA 4CYUA 3ALRA 1L5UA 1R6YA 3F5AA 3L9ZA 3QO9B 3CDUA 1Y7PA 1HPZB 1DRGA 1QAYA 4ES3A 2G8FA 2MUTB 2EQYA 2JWLA 4IZ9A 1V97A 5ALPA 4Y2VA 2FY8A 3RB4A 2G2ZA 2KSOA 1KLMA 4OPJA 1KQGB 2DGUA 3BF4A 4FYWB 1A5WA 2OTJN 3BUZB 3KJFB 4OHYA 1P9QC 5KFSA 4DV3J 1XMQK 2HGLA 3M6GA 3CCMN 1ZQQA 2ZZTA 2ZWPA 1SZPA 1D9AA 1DZ5A 2CDQA 1J2MA 1B0XA 4Q2MA 1CPZA 2X1BA 3LZJA 2P9EA 1E6YB 1RBLA 3MDQA 4J2EA 1JLBA 4KE5A 1GOCA 1SZHA 3GFXA 1RTDA 2JDJA 2KM8C 3L2WA 3CJ2A 3V6HA 2Z1GA 2R2SA 5AKZA 4O3PA 2QSWA 4E0DA 3CCTA 3HJVA 4F26A 3MM5A 5HN0A 1V5VA 3HK2A 4ZVOB 3H59A 4DV4J 3AGRA 1RCXB 5E3AA 5D8HB 4WQ5C 3CC2S 2E8AA 1IIPA 4JYAF 5ALHA 3CIZA 2GUPA 9ICXA 2C42A 1A6SA 1N6QA 3ZT2A 4ZOSA 2WRMA 1LWXA 3FZBA 1CUKA 1IKVA 4KAZA 4KBIA 4A48A 3NAIA 4MK8A 1NOYA 2YTCA 3J8AA 5B0FA 2XQCA 4KLJA 3DXMA 2VA3A 1KHWA 4HT7A 1UCVA 1VSHA 2W04A 1IBMF 4UQGA 1K73O 2E8OA 5KFLA 2GELA 2P6RA 1WWHA 4UT4A 4DCOB 4IQTA 4ZP7A 4A8EA 3G6VA 3OL7A 4TYBA 1N33K 9ICKA 2DJWA 1MA9B 2CQ1A 2FD2A 1N0VC 3V6KA 4HDGA 1F21A 1U7LA 3NVVA 4YD2A 4JUZA 4RBUA 3B78A 2VCPA 3UFCX 5KT2A 4PAAA 3MAAA 3UNGC 2XS2A 2DQNB 1A5XA 1M5OC 4I69A 2AEFA 2ATQA 4UW9A 2QXLA 4P2MA 4V19S 3D2WA 1SJ3P 2D5RA 4OYZA 3TJ9A 1UQVA 5DZ7A 2FIUA 4OZJA 1CJVA 2DEJA 3FK4A 3QDKA 2ZBCA 1VQSA 3MX5A 1O5JA 2Q97A 2GJ2A 5TISU 1KFSA 3AY9A 2GAHC 1UWBA 2FBXA 4DTSA 1HNZF 5GADU 5AKGA 2AT1B 2IRUA 2OI2A 5L38A 3D2EA 1U9LA 1IXKA 3EJMA 4M5MA 5B08A 4M5DB 2RF2B 3AJDA 2JEFA 2ZIUA 1RBOB 1YIJN 1Q82T 3L7OA 2V69A 1RT1B 2LLZA 5A0LA 1Y64A 2UV8G 2XBPA 4CHYA 1ZQAA 3GFKB 2K06A 2VFSA 1HX1A 1JB0C 5B0GA 4JYAK 3DOMA 4DLGA 2J76E 3HL8A 1UMJA 1FFGB 5EE9A 1YRUA 1UT8A 2JWNA 1T05B 4LD0A 4QZDA 4ZTFA 4OZ3A 2Z1JA 3RMDA 1VQ8S 1J5OA 4USTA 9ICIA 3G0ZA 4O3SA 1KHVA 1ZD5A 2GGPB 3CJ7A 5EOZA 2XHCA 3A8EA 3WNGA 3O5TB 3UIQA 2WB1C 3AOAA 4M3ZA 1W2BR 3PACA 1EHWA 2AGOA 3MUVP 3H0PA 5DMRA 3K5MA 1Q7LB 4IDHA 1VC6A 3S8SA 4IQUA 5CA7A 4MYUA 2KVQE 1WORA 2OJ3A 3CP8A 3ZEUA 1S0VA 2FF3B 3D7EO 4FJHA 1NJZA 2KFNA 3L6QA 3BPSP 4X66K 3C5FA 2IVPA 4DOZA 4J9MA 4KB1A 4F93B 4I2PA 2L48A 4PXCA 4DR4K 1D5AA 4DTJA 2CQCA 4CO4A 2QARA 1W26A 4FO6A 1RAHB 3WQPA 3ZTOA 2D3O1 1VQKS 4YMEA 5ETPA 2RP5A 2NLXA 1BQMA 2CPDA 4DV6F 3W2WA 2ZIWA 3QEBZ 2O8DB 4YFUA 1ZYQA 3A5NC 4BRHA 3ZSXA 2CA9A 4CW7B 3PO4A 1KRPA 3Q8QB 3I8BA 2Q3SA 1FDNA 1RADB 3QLHA 1BY9A 5AK5A 2RAQA 2BVZA 3NVYA 2MSTA 4R79A 4E19A 5BRFA 1JMSA 1M1KT 3I1YA 4BR9A 3J80Y 1SH3A 2H5IB 2V4RA 4YR3A 3ZT3A 4Z4EA 5ALTA 2YPYA 2BZFA 1UVNA 2O1PA 4YR0A 4DR6F 2P9LB 2MSSA 4CTAA 3I82A 3O1WA 2GVDA 1NGHA 3RH4A 4YG2A 1NGGA 2YMQA 4YY3J 1K1SA 3EE3A 4H54A 4DS4A 2A6MA 1WC6A 1L7MA 3ZDCA 1KFTA 5FDLA 4Z4CA 2F3NA 4DV1F 5GAHP 2P35A 1X4GA 1SIWB 4HACA 2GWKA 3ULDA 3OBYA 3SK3A 1WHVA 5ALIA 2KEYA 3MM9A 4DEZA 4LF5F 2VODA 1SV5B 3MGVA 3OYMA 4A5BA 1KDNA 1Y10A 1D1UA 1F2GA 4I67A 4TSXA 4O4GA 4J2DA 3KJVB 2ROGA 2YNHB 4Z4GA 5J2BA 4DPOA 4GIBA 2UVVA 4Z6EA 3IAM9 4MYTA 3TEHB 2PEBA 1C7YA 3OFHA 2LYHA 3FSYA 3HYFA 4FWLA 2O8EA 3U6FA 4FWMA 4ZLLA 1ZQIA 4U9RA 2P9IA 5JS2A 8ICNA 2YH1A 4QZIA 4IFYA 3VEYA 2WMMA 3HKWA 3AVGA 1NZPA 2XC9A 1NJIT 1YVNA 5AR0A 1RU2A 3HHLD 3VAFA 2GNKA 2RE1A 3TKAA 2M9NA 5JLHA 4R63A 4MLHA 4DOCA 4DR7F 3CIPA 3S3MA 5DQIA 2IAJA 4KV8A 4BR2A 4WKYA 3DDKA 2G1DA 3BKTA 3NGRA 3N6MA 3FKBA 2YKQA 1QUVA 3JQJA 4Y2MA 2HVDA 3BS5A 3CWJA 3KK1B 2X3GA 3LP0B 3EZOA 4HVZA 3AO5A 2C28A 4DF8A 4QPTA 4JAXA 2WUSA 3LK9A 2VGNA 5LJ5Y 2FLNA 4RQ2A 5EWFA 2DY1A 3KHHA 1S5JA 3GL1A 1VQLN 2VA8A 1BHLA 2HZVA 4XRHA 3J81U 3OJSA 3VF4A 5AJ3F 3PYFA 3OPXA 3KHGA 5LXYA 4NYPA 3NF8A 3F5TA 2CQIA 2B4PA 2F8LA 5L1JA 2HHSA 1EIYB 4MF2A 1R7IA 4KHPJ 2E8PA 1RTJA 1QVGR 5EOYA 4ZTJA 2BOAA 4WU2A 4DSKA 3JYTA 3O4QA 4UY8O 2WBRA 2LYVA 3U8XA 1JALA 5AIAA 2UXDJ 1VQYA 4ELTA 3MGHA 2SXLA 5EN1A 3AQOA 1PVQA 3QQCD 5C2DA 5KFOA 1MN8A 8ICLA 4QNLA 5CY4A 1TV9A 3TAMA 1VSDA 2W41A 4CK1A 5K14B 4GV6A 1NM1A 5ALVA 2EANA 1FNOA 2LMIA 2W40A 1SV0C 1XSNA 2KJWA 3WDOA 1X0PA 2RUGA 4WZQA 3B6OA 4JRPA 3M1YA 2GQQA 4F25A 3HSTB 1S6OA 1IBMK 2ZE2B 1A5VA 3MDCA 2RQ5A 2XYPB 2Q43A 2ZZNA 3U9ZA 1VLBA 4AL5A 4RPFA 3NNCA 9ICTA 2MA1A 4HYKA 3U1NA 2VPZB 2J7WA 4WJ3B 4E8UA 1FFSB 2H54B 1FDAA 3MN6A 1D8LA 1XN9A 2XHWA 5D15A 4A8XA 4YOTA 3OTEA 3TZZA 1LCUA 1YLXA 4C98A 1TL7A 5K14A 2N3OA 3RMBA 4CBUA 3C15B 1N5TA 5A2QU 5AI8A 1JIHA 3UWTA 4I6YA 1I6JA 2DGSA 2IRXA 3W5XA 1ZQPA 2AGQA 3BGRA 3HD1A 4L74A 7ICUA 4NJ8A 3A8YA 3ZX2A 1GX6A 3QFWA 2RRBA 3Q89A 1N8RO 5A8RA 2PE8A 1NPKA 1S6QB 1C1BA 4Y2JA 3KUGA 5LM7E 2ZH5A 3VA0A 1WNSA 4K5RA 3AU6A 2VC0A 1HMVA 4CF9A 1MNEA 2V2VA 4DL3A 4N5SA 1HR0F 2CJ9A 4P2FA 2BTFA 3BS7A 2IY5B 2EAPA 3I0SB 1RKIA 2IBOA 4IYQA 4K0KK 3TFRA 3POTA 2WTUA 4LUBA 1TL7B 1DLOA 3KLVA 3VA3A 3W8GA 3SFGA 3UCZP 1JWWA 4M5KA 1AUSL 4QIWD 5LT5A 3FCWA 4CM2A 4B9TA 5E2QA 1WG8A 2L9NA 2OHDA 3VQ8A 3CMAS 3MABA 3BH7B 3EWAA 1REVA 4RUHA 4KSEB 3HSGA 2QLTA 2UUAJ 1MMDA 4PUOB 7ICEA 1RT3B 1XMOK 3RR8A 2PMZF 1SS6A 5FPNA 3K5LA 1G99A 2VU5A 1T0TV 2XMUA 1KKHA 4DUZK 4KB7A 4K0KF 5AKHA 2FDRA 5CAAA 3T5JA 1IM4A 2B6GA 1M1HA 3F9KA 3FGVA 3IN5A 4KGXB 4WFBQ 4RW8A 3VAMA 1FESA 3O2IA 2R7RA 1HR0K 2BPGA 1VSJA 2H3ZA 4YN4A 1CULA 1FO1A 4KITB 1C2PA 2D9OA 4H0YB 3WKBA 4R8UB 2YTUA 1KVCA 3WXMB 2FBYA 2APOA 5AI6A 3GCWP 3P4UB 4UF4A 4DN0A 4FLXA 5GIOA 2A6AA 1J97A 4UATA 5KT3A 5JMNA 1QY7A 3SSSA 2GLEA 4A8KA 4CH7A 3O4WA 4U7BA 4AHRA 3SBGA 3TAPA 3VGLA 5KFQA 1HBOB 4DTNA 4YOXA 1S1VB 1J5EJ 3VZIA 2LDYA 2CQ0A 2QLFB 2AD9A 2N3LA 4BRIA 3VTIA 7ICSA 1OVYA 1TVRB 1VK0A 5JRTA 4MKAA 3OL6A 4DQRA 1ACMB 2G1HA 1S0NA 4QIGA 1VBXA 3OFEA 2VWBA 4M7XA 1KL9A 3PW4A 2VPWB 4EMDA 2QRRA 3IBFB 3SPYA 2DB1A 4G1PA 1FX2A 3FRZA 3P5BP 1ZZNA 1Q81O 9ICSA 3NCQA 3CJTA 1S0MA 5FP0A 3H5SA 3BR8A 5HNKA 1JXLA 2D41A 5IM0B 3I4PA 2MKIA 2V2ZA 3N0VA 3CPWM 4R0EA 5HMZA 4WBFA 2Z2MA 2QEXN 1NUEA 5JVGL 5BR8J 2ZBPA 1CS4B 1D8BA 2HNYB 2EFNA 1UAWA 2EG2A 3E2EA 1EKEA 3S3OA 2W7PA 3QEVA 3NVKA 1F3FA 4JV5K 1U1NA 3ZTQA 2HDOA 4M6WA 3I96A 2H65B 5J1EB 2W4CA 1BE4A 2AJ1A 3SDEA 3ZSWA 2OEJA 2VIHA 4AFFA 2ITGA 2CQ3A 2P9PB 4JKDA 3M7VA 3QEXA 1P8GA 3J7A1 3I0RB 1XSPA 2WVCA 3PJWA 2XZTB 4QIWC 1BUPA 5KFIA 4CQ1A 5HRSA 3DRSB 5J8YA 2IHMA 1TL1A 2IIRA 7FDRA 3AVAA 1KLNA 4P73A 2P9IB 1OPZA 3ZX3A 4H0VB 1UVJA 1F6TA 1IH7A 4QZCA 4ZVEA 1XR7A 2ESEA 3GPAA 3IWNC 3G4SS 1ZQJA 1R89A 3R5AA 3RBDA 2B8QA 1M0SA 4ZHRA 1U24A 2C3OA 2C2DA 1EKSA 1IN0A 4JI3K 4U7UD 4J8FA 1VBZA 2DGWA 2DO4A 2HF3A 4IJAA 3SSRA 3ALYA 3A0BU 3RJMB 4NL9C 1VQ5S 4OYIA 2HCFA 1N5SA 4JKCA 1RYRA 3A12A 5AQIA 5A0YB 1AROP 1RPLA 3N79A 3OW2R 4AL6A 4IRDA 5KFFA 3DKDA 4YXMA 3G82B 1ZC6A 1RHKB 2X51A 5KRSA 3IG1B 3SQ1A 3HWTA 2BKNA 3V7LA 5MLCV 1HNXF 2O67A 2DGTA 5BR8K 2RS8A 4J2AA 2F3JA 4IR9A 1SJ4P 3NCPA 4ED3A 4PHDA 1A7GE 3THWB 4DR6K 1RQLA 5IS2A 1H38A 4GMJB 4JS5A 5DQHA 4PWUA 3OYIA 3SLCA 2B4JA 2JGAA 2AP1A 3OR1B 1FNMA 3ETMA 2DH9A 4Y00A 2CGKA 1DTTA 2V2QA 4RTFD 3DM2B 3UXOA 2JFKA 3RUBL 2CPEA 1ZQZA 1RSCA 2V4QA 1VQNS 2RJZA 1KD1T 2YWFA 1N48A 2G13A 1CI4A 2JC0A 3QNNA 4RWTA 4L3KA 2HHVA 3BO4A 5J2EA 3BYRA 2UUWA 2P6UA 2GO8A 2ZHBA 3HKZD 4NXMF 5CB1A 2CZVC 1N56A 3ZZ0A 1M1GA 1U6FA 2DCUB 4V19X 1WHYA 2BANA 5CZVA 5KG0A 4GXIA 4IDKA 2E1YA 3TANA 3Q2SC 1ZBIA 3LWLA 1YBTA 3ULEA 3B82A 3VQDA 1QVFM 4P52A 2GQ2A 3ONQA 5CYMB 3DC2A 1TFRA 1BO5O 4JI0J 4DTOA 4RPZA 5AQSA 4F0KA 3M9MB 4ZOHC 1Q5VA 1MG7A 3R1XA 2YKMB 2DNGA 2YX7A 5L39A 1V4TA 2OD4A 4LF9J 1EKRA 3THTA 1L8OA 3MXMA 2I6WA 2XSFA 1YUWA 3KD1E 3OTBA 1CSJA 2RQKA 2VFVA 4BC7A 2HNZA 5I3QA 1N36K 4KI4A 3ETOA 1RWVB 3RRHA 1QLNA 3HZEA 2AMCB 3M8QA 4UBBA 1HNXJ 1Q0NA 2XMJA 1S72N 2RLTA 1Y3JA 3OT9A 2F2AB 4IQXA 4I2JA 1XIQA 4JI3F 3HPOA 3CCRN 4WFAQ 1N34K 5LMNF 3K0JA 3MHYA 1RB0A 4BLGA 2W03A 1RTHB 3MR7A 3PHEA 1UHUA 3D1HA 5D0RA 1S7HA 1U1PA 4P7TA 1KTVA 1YI2N 2DNRA 1XO1A 3FUYA 1XU4A 3N4MB 4YORA 5JXSA 2KW4A 5KAKA 2HS4A 1DQAA 3CI5A 4R66A 3A1YG 1W9HA 1HPMA 1LW0A 3ISDA 2M8DB 3AVIA 3QGHA 3U02A 2M7SA 3W9IA 4BRLA 4Q43A 5F41A 3D2NA 1BOTO 3CQXA 3J7Z5 4JKGA 1AXQA 5CR4A 3DDIA 1GX5A 1FJ7A 3PX4A 2RUSA 2CN1A 2B0GA 1HBMB 3TA0A 1O1WA 2WF6A 3OW2M 4CFAA 4BGBA 3HHLC 3SENA 3THPA 2DFFA 4CLTA 3VQ9A 1T6DA 5CHGA 2UVUA 1NJWA 2CJAA 2KHVA 4W5QA 5ALYA 5ETTA 4RPXA 1IV8A 1BPBA 3ZZPA 4X4TA 3P5TL 4TYAA 4JI0F 1WSFA 2ZUAA 2UUCJ 1N33F 1NOMA 3I33A 1U09A 1REVB 4GXKA 4JOUA 1N34J 3KLHB 3MD3A 3ICLA 2XY8A 3NFAA 5DB6A 2C2KB 2MGZB 2C3YA 4XA5A 1OPIA 1ZQYA 3F44A 2ZHOA 1SQEA 3N97B 4DTPA 4DV5K 3QETA 4J7CA 4HHTA 1WWUA 4QU7A 1RXWA 3DNCA 3TSPA 1SIZA 1TQLA 2UXCJ 1X2IA 3NG8A 1XQSC 1H98A 2MDAA 5E3PA 1HKAA 1J6ZA 3DGVA 4LF9K 4Y28C 2GWJA 2RT3A 2GOLA 3K5OA 3IGVA 1WBBA 4MT1A 1ZM3A 5C10A 3N5FA 4WP8A 1RAFB 3H25A 1FFUA 4JI6J 4CFBA 2K8AA 4M04A 3MPVA 4RQ0A 3C15A 3M6ZA 3ZD9A 1YJTA 1ZXIA 1DOQA 3J7AN 4K4TA 4KX3A 4CIFA 2BM1A 5ETQA 1T3NA 2F96A 3ZSYA 4X64F 2I5JB 3PRVA 3GCXP 2VC1A 2UU9K 3CDBA 1VQ9N 4UB3A 2OANA 2KOBA 2H9ZA 2E5LJ 5J2AA 3AB2B 4KN7A 1UWAA 4JB8B 2LVWA 3NF7A 4UAVA 4Y2TA 1HMVB 4PG4A 2C22A 2DH8A 3PSFA 3F5EA 1YITS 5AQRA 4XH5A 1NOZA 2QFJA 4CLSA 3VAHA 1TTHB 1EWRA 1TP7A 2FUG9 2DCLA 1F0MA 2C2NA 3WK5A 1XMQJ 4DV3K 1XC3A 3P31A 4DTXA 1WF2A 4E98A 4DXLA 2M4MA 3EVMA 3H20A 2E5LF 4UW2A 4V19J 1L7OA 3ID6A 1RHJB 3CC4N 3R97A 2KNJA 2MMYA 4CK3A 2LQJA 5J2DA 2QA2A 5T7BA 3S9HA 2DYAA 3RAQA 2PZSA 3TPQA 4B8AB 1BWEA 2G8UA 3TQ1A 4J2BA 4MKYA 1B43A 3NVZA 4A46A 1WJ9A 1G4CA 4QCLA 1TUYA 3TA1A 1XUPO 2ITMA 1PBAA 3NAHA 2F9TA 1KS2A 1VQPN 3MI7X 4FJ7A 4Q5VA 3DLBA 3R2CJ 3KD3A 3DXMB 2ASDA 3T6BA 1BWVA 5KFWA 3CD6N 3M32B 3QBWA 1TKTB 2NXJA 5AQVA 4MLEA 3THYB 3ATVA 1P1LA 3MCAB 3H5UA 3NNHA 2A2DA 4DU3A 1LV5A 2AU0A 2JX2A 3P5JA 1C0UA 3C1ZA 2ZBRA 2E1MC 1KVIA 1NK6A 5ALXA 3HI0A 5ELZA 1BDGA 1I1GA 1NJYA 4ZVUB 1AFJA 2FVSA 4BY9C 5IT4A 3WIVA 4UUXA 1QQ7A 4EX6A 3HSDA 1AA1B 1ZQEA 1HBOA 3MEGA 1TFWA 2ZOGA 3RMAA 3TR5A 4KKOA 4PWDB 2C2RA 1NU4A 4CIEA 1CZBA 1V4SA 1UL3A 4LBIA 3R9LA 5ALMA 1H2TZ 3P8BB 1AT1B 3Q23A 1R27B 5ALNA 3KLFA 4KO0A 3H45C 4QZ9A 4KLOA 4BC9A 3IR5B 5ALQA 1A9NB 4M5LA 3AQFA 5C7PA 2OIHA 2DKOB 4CZJA 4IH5A 2LM1A 4W90B 3NGUA 3AO1A 1RWPB 1M5HA 5J1NA 4C2MA 2BX6A 5J0XA 4FLWA 3BEXA 4NEZA 2DF4B 1RGIA 4UB4A 4RPYA 2KHOA 3H5YA 4WQ5A 3M3ZA 1XEZA 3EDQB 4RW6B 2AIRB 1U26A 4P2XA 1UW4A 4MIAA 2WOMB 2MQ8A 2XCPA 4HH1A 1N5YA 3MDAA 1X1PA 3NS7B 2VF3A 4JMUA 2PN6A 3SCJE 4F5QA 2F1JA 1F9FA 2G07A 4KTWA 1K9MO 2ZTEA 4RLEA 4F5OA 3CM6A 3I4HX 1OY8A 2DXFA 3FEXB 2MTLA 3C14B 3NTUA 4CD1A 4CERA 2P2CB 4RBTA 2QT7A 2KM8B 3BSOA 4ER8A 2FZCB 3GIKA 3WNHA 4FM1A 2GO9A 2J8AA 4DSJA 5AZIB 2JOQA 1NKBA 2KYZA 2BRLA 2QMUB 5DGBA 2IOCA 2GMHA 1WSGA 2YNGA 4MO5A 4DWIA 4LJMA 4OJHA 5CEHA 5LSLA 1NK7A 1IBLF 4ATNA 4LJXA 3OTOK 2UUTA 4RQ5A 2IJNA 4FF3A 1GLBG 4P4PA 1KWMA 3M7DA 2JEJA 5CYJA 3KLGB 3GIRA 4ISFA 4A62A 2FC8A 4X65J 3EUNA 2IVYA 4URQU 5C0YA 1UPMB 4OI4A 4BREA 1BI4B 3WNEA 2KFZA 1YRTA 5KFNA 4OD0A 5D4LA 2P9GA 2G0IA 1S1WB 1ZQKA 1WSHA 3DLKB 1QCKA 3ZTRA 4CHPA 2FC9A 4W5NA 4F7VA 2CH5A 2XY7A 2W55A 3CDAA 4AXIA 1QJHA 2D0PA 2DGQA 4DR2K 5AQZA 3TU5A 1COOA 1M90O 4ED1A 4MN4C 1KC8O 4KPYA 1RHRB 2WF7A 4L8RB 3F9MA 2G4BA 4R5PB 2OH2A 1YWXA 3A4TA 3W60A 4DX5A 3T5LA 3VCBA 4MFCA 2GVZB 2E9RX 1B22A 3NH2A 2HHHF 3NF6A 2XMMA 2OPSB 2VKZG 3ENBA 3ZCMA 2YMMA 1RISA 2XEXA 4YUDA 3JPTA 4P6QA 3C6TA 1JMTA 4IKFA 4EO8A 4X5VA 1TKZB 5J1PA 2NPFA 1U49A 4LRFA 2VJ4A 1VQ7N 2OO4A 4NLUA 4ETZA 3HPHA 2OCEA 1KBRA 1RLDA 2EXUA 5EE3A 2FJDB 1H7XA 3SZ2A 1LW2A 3DLKA 3TP2A 4NRUA 4LF6K 1Q86T 1GO3F 1YTYA 3AH6A 4C0OC 2K8CB 4X2BA 1CRXA 5KQDA 4BXOB 4W4MA 1WUUA 3GWCA 3A3NB 3SPZA 5JTIA 3MWTA 4NMXA 5JU5A 4DV1K 4IH7A 3QNMA 4JK7A 1XERA 1HBNB 4USUA 2CNOB 2FSKA 2FXUA 4LSLA 5KFDA 3E58A 2FHMA 3VGUA 4OV1A 3VQEA 2RRNA 3D1QA 1A76A 1NO8A 1RA6A 3TVZA 3FSIA 2HVIA 1RBTA 4MDBA 3ONNA 5M2RA 2P9SB 3UN5A 3GQCA 4DUZF 4DCCA 4FK0A 5KL8B 1NSKL 4CF1A 2AQ0A 3RAXA 5CCMA 2IDLA 4B3SJ 3MTKA 4PQAA 3T5KA 1J5EK 4CZFA 3IAYA 1GMVA 3B4DA 1FIQA 3B54A 3WXLA 3PW7A 1HD1A 3IV6A 1YJRA 4H4MA 4QS8A 3LP0A 1YXQA 3DOLA 1B70B 1MMLA 1SQGA 2JZBA 3A0IX 3V72A 5AI9A 3CCVS 1SC4B 1KKXA 4CJEA 1J2NA 3GV5B 1VMBA 2G8HA 2W9MA 4X62J 5BRHA 2A42A 3A3OB 4KT0C 1JLEA 4C8YA 3A8JA 3AVBA 4N56A 1FTRA 2YCHA 1CG2A 2VOPA 3TTCA 3WHIA 2PEHA 1DEJA 4EUVA 4H4OB 3BQ1A 1GLDG 1ED1A 1MROB 1DXSA 4JI8J 2MZRA 4JKGB 3BGFA 4G1IA 3QMLA 4PRFA 5JMVA 5B5EU 1OH8A 4QZ8A 3R9PA 3VQPA 1LQ9A 2E1ZA 1S72S 2V94A 3DHWC 1L3TA 2P9UB 1N8RT 1FDBA 2E6MA 1VRTB 3M2VA 4RCHA 4CRJA 4KHPK 2VD3A 3QO9A 5F3ZA 4WFNQ 5U47A 4F91B 4OJ5A 3W61A 4KTZA 3BGLA 2W4PA 1GK8A 3CT9A 3IRWP 5MLCQ 3HT3A 1X31C 4WFXA 1SC6A 2HBKA 4FCYA 2LECA 4YMMA 5ALLA 1GTHA 3P49B 2QLJB 3P4IA 5D0HA 5HRPA 2PO4A 2MKCA 1CQMA 5KPZA 3SQGB 5LSOA 2KMDA 5J29A 2ZJQL 1ZQDA 2E5LK 1VR6A 3TADA 4MEXA 2EHGA 2V5HG 4FM0A 5L1MA 7ICLA 3MGIA 1HHTP 5CD4H 3ZZRA 3QESA 4DMNA 4ECQA 4CEFA 1QQNA 2HQFA 4BG8A 3C66A 2L3MA 3K2PA 2KTQA 4K8ZA 1YGYA 2QWLA 2HWTA 1IJFB 1NHUA 1VQ9S 3DLHA 2DNMA 1BMQB 1XNQJ 2J0XA 2ODGA 4N8NA 2H5EA 4H4KA 1ZPWX 1N60A 1YTAA 3NNAA 3D6HB 3RBXA 2RDIA 2YMLA 2YNFB 8ICSA 1SI9A 3AD7C 5LXRA 3V5RA 1T02A 3PJ9A 4BHQA 2EFGA 1TV6A 4FKXA 3NS6A 2CFXA 2YQ3A 2BKOA 4NZ6A 1CS4A 4FVCA 3TZWA 3OSPA 2Z2LA 2DNYA 2M0NA 3GYNA 2CG4A 4KLEA 4FBTA 3J7ZT 2OD6A 5KG7A 1RTZA 3CJCA 2PY5A 3W5YA 1QE1A 1KVJA 3EEQA 1DGSA 3FFIA 1S0OA 1NMNA 4V1Ak 4EU0A 1OUQA 2HB5A 3WK4A 3UKRA 3SXLA 2OZMA 4C1NK 2EZYA 4I6AA 1SL0A 4X4OA 1NNEA 4GVBB 1JJ4A 5J2IA 1Q82O 2RRAA 1ITGA 3NKYA 4CD3A 2HHWA 5KFTA 1QHTA 3GP9A 2XMVA 4P71A 3LAMA 2ZQBA 4FXDA 3I6PA 3JPPA 4XAKA 1HWLA 4BRCA 4PPZA 2HOFA 3I5CA 1F3VA 2WW4A 3V9XA 4DFJA 1E6VB 4QIEA 3O1BA 4F92B 3R5CA 3FEYB 3FZMA 3ENQA 1TKTA 4LF2A 4CF2A 2ZUBA 4JYAJ 3LP2A 3MMAB 2R8KA 5KNIA 4IR1A 3C19A 4NB4A 1RDDA 3FNNA 2G5HB 3SAFA 4NYZA 3SQ0A 1WLJA 4WCEL 2EEYA 3D28A 1NB2A 4DL6A 2XS7A 3QATA 3HVAA 1HNIB 3QZ8A 4A8SA 3IG1A 4K43A 3PJXA 4K4VA 4ZK7M 2MKSA 4USJC 2YHBA 1K9MT 2XZWA 1D8YA 2PFUA 3IFEA 1Q18A 3V6DB 2AV5A 1G3OA 3ET6A 4P10A 1TL5A 1SJFA 2G0JA 1HYVA 4M9NA 2AYMA 1XI1A 3V4IA 4CJLA 1QS4A 5KFZA 1W97L 4RQ1A 1FWKA 4CZCA 2FLPA 1WWVA 1YDLA 4AE5A 1ZBLA 1PC5A 1T8EA 5ETNA 4USMA 4A4JA 3IBPA 2QWRA 4OJ6A 3AD8C 4M3XA 3DLGA 1U0HB 2H3EB 4C11B 3L4IA 4B1YB 4NWIA 2C2ZB 5B09A 5HP1A 2J9DA 2A40A 2HFOA 1HQUB 1RCOB 4L6V3 3QB0A 2W9CB 4C97A 4EI2A 1TMMA 1UEVA 5KT7A 2N1RA 1JX4A 3R5BA 3VAJA 2G08A 1IUJA 4KRWA 4JI8F 3NE6A 3K7RA 1SVDA 3Q8LA 4ZPCA 4M3WA 2ZBIA 4K41A 1FEZA 2FZKB 3VQ6A 1FKAF 3Q8KA 4ZP9A 2EK6A 1RT7A 4CZKA 1S6PA 5KT5A 4XPCA 1X5PA 2E1RA 4ALZA 1I5OB 3UD4P 3DU5A 2G8KA 4HHHA 5TKWA 1T9XA 3TACB 4DV0F 4FYDA 3IBWA 4AM7A 5E5NA 1NGDA 3ORYA 3SEOA 2ZC3A 1PYSB 2XRIA 4PCQA 4NCBA 4X66F 4OZ0A 4ZVTB 3CC2N 3UVJB 4Y34A 2YHXA 3TUIC 1Q9XA 3MN9A 1IV0A 2O8DA 3DRSA 2LQ8A 5G0RA 3GZ7A 2RHSB 3GFZA 4CHOA 3L2RA 1VLOA 2HBZB 4NMLA 3NOGA 4HCCA 4PXEA 3VQ7A 2NR0A 3AO4A 3W62A 4CH0S 3I55N 2M2BA 2F8TA 4RQ4A 5AM2A 2IM1A 3MPYA 3PYEA 4E1JA 3ENOA 2BDPA 4QZGA 3W0LA 2I7PA 3LA0A 4PPXA 1JRPA 3BZKA 4I2AA 2XLKA 4OMFG 4ENOA 2K4HA 3K59A 3KG0A 1RWKB 3M6VA 3ZDEA 2GS8A 3WQUA 4P9SA 2DY9A 1BA1A 4RU9A 3I8DA 4FWRA 3N7RC 2OUGA 3VAGA 3AJ2A 1K8AO 3QIPB 1XNRK 2DRDA 2K1RA 5DBBA 4OZLA 4UZCA 2FVQA 2BPCA 4ED0A 5ETKA 4H0XB 3DAWA 2NSCA 5AQYA 5F9NA 2F76X 2OPSA 2FPKA 5SZTA 5AXMA 2YV0X 1TK8A 5DDRC 3K1RB 1HJRA 5H9FK 5FPMA 1RHQB 4RR5A 2DHAA 3OYFA 4FJ8A 2DD8S 2VDHA 4ES2A 2QSFA 4LMZA 4N47A 4WTOB 1SAZA 4I2QB 4AXJA 5HROB 4DZDA 1NDKA 4NLZA 1QDUB 2BEFA 4Z37A 3FGUA 3SEIA 3V2UC 2MJUA 2MY7A 4BDPA 4PKDB 5BR9A 1U8SA 1QH9A 1HUZA 3OA9A 2PMWA 1CZAN 1TZ0A 3FFKB 1RAOA 4ZVRB 2F44A 1NZ8A 1HA1A 1NGEA 1KQSM 1TKDA 2DR6A 3L95X 3AODA 5AI4A 1RDBA 3JSRA 1P7DA 3FCVA 2XYGB 4ZPDA 2HK3A 2BOPA 5K8PA 1ICEB 2IM2A 3GFYA 3TOQA 3FAHA 4FPRA 4P0QB 1XHZA 1WI6A 2ZWHA 1VQOS 3MCMA 3FCHA 2YKMA 1UKUA 4I2QA 5J2QB 4JLHA 1IKXB 3L09A 1KP6A 4WFYA 3U1MA 5JVGQ 3CJ8A 7AT1B 5BREA 3AVLA 3MMJA 1BISA 3M8PB 2ZH4A 3K8WA 4LF7F 3NBPA 4Q0BB 4B1UB 4JI1J 3GSIA 4DS5A 2OTJS 2E7XA 5AE3A 2UUAK 4EBEA 7ICRA 5H9EJ 4RQ6A 3G4SN 2QL5B 4OYAA 3MK6A 4P75A 1RCHA 2R7OA 1LWFB 1U6ZA 2Z58B 4O44A