4DQSA

Binary complex of bacillus dna polymerase i large fragment and duplex dna with rc in primer terminus paired with dg of template
Total Genus 211
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
211
sequence length
579
structure length
573
Chain Sequence
KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase
publication title Structural factors that determine selectivity of a high fidelity DNA polymerase for deoxy-, dideoxy-, and ribonucleotides.
pubmed doi rcsb
source organism Geobacillus kaustophilus
molecule tags Transferase/dna
total genus 211
structure length 573
sequence length 579
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4dqsA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4dqsA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4dqsA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4dqsA01
2B21A 4ID1A 4M3ZA 4MF2A 2FMSA 4Q5VA 2A1JA 2NRTA 5EWEA 2YNGA 4Z4CA 3P1GA 4IFYA 3T19A 5C25A 9ICTA 3OHAA 2FLLA 3AO3A 3VQPA 5KGXA 1BPYA 4F91B 3V9WA 3K59A 3GV5B 4I2BA 1BPDA 5KT3A 2HVHA 5HNKA 1T3NA 4CEQA 4ED6A 4DSIA 1EETA 1WN7A 4CJ3A 4W5RA 4FLZA 4J9SA 8ICAA 2Z1GA 1A5XA 4YR2A 4MFBA 3AVKA 3RB4A 4KHYA 1D8YA 1MU2A 8ICIA 4GW6A 2XY6A 1GOBA 3LAKA 1JLCA 4TSXA 4KHSA 1YTUA 1GOCA 5DDYA 4DFJA 4JLHA 3NTUA 4DS4A 4DL7A 4FLXA 4Z6EA 3RWUA 1DOQA 3ASMA 5J2EA 5DG9A 4I2DA 4YXJA 1X2IA 3H08A 3L8BA 3VQDA 5J2AA 4E7LA 1FK9A 4B9TA 4LH5A 3RAXA 3K57A 3C6TA 1JX4A 5J0YA 1CXQA 1XHZA 4G3IA 2HHUA 4O3RA 1A5VA 4OPJA 2V4QA 1BISA 3M8PA 5KG7A 3PW0A 4QZFA 3LZJA 4B8CA 5J2PA 3AO1A 3NH2A 1LWEA 1QS4A 4YMMA 2OWOA 3ORYA 5J0RA 9ICXA 1LAVA 4C8MA 2ZQBA 3BQTA 2V9WA 5KFKA 4DU1A 4CJ4A 3TI0A 1C0MA 4KLMA 4CF8A 1HYZA 2F8TA 4IG3A 5KFRA 1QE1A 1RT3A 4DL2A 4XRHA 2A1SA 3SV4A 3IS9A 1BPXA 4PUOA 5KFEA 4M3TA 2KTQA 1KCFA 1GOAA 2KZ3A 4DEZA 2R8HA 2C2DA 1UA0A 2FLPA 1QLNA 2DTUA 5DBBA 3UQ2A 4Z6DA 1DGSA 2IOCA 9ICEA 4RQ7A 1TL3A 3TARA 1B9FA 1U45A 1C0TA 4YNQA 3OYFA 3ZDDA 3PR4A 3JPRA 1ZQZA 4J9KA 4J2BA 1UA1A 1N5YA 1HPZA 5KFVA 4YR3A 1ZBLA 3OHBA 4KPYA 1VRUA 2W9BA 4BE2A 4RQ4A 2RF2A 1N56A 4GXIA 5KFFA 3Q8PB 2A1RA 3ZSWA 3LP1A 2W42A 4N76A 4J9PA 4EBDA 3LALA 3SQ4A 3WNGA 4RQ6A 3S9HA 3L2UA 5J2CA 3ZDEA 4CHOA 1A77A 2YHBA 1QTMA 1D9FA 4MFAA 4CHNA 5D3GA 4N56A 3JPTA 5KG1A 5KT5A 4AH9A 2JZBB 1VRTA 1WSIA 2UVRA 4J9RA 3CQ8A 3QNOA 3HPOA 5F9LA 4M6WB 3Q8MA 3RJHA 4Q8EA 3DRSA 4PGQA 1J54A 4CHZA 3WNEA 3C1ZA 5D4BA 4O9MA 3H4BA 2BQUA 3DLEA 4E0DA 3V7JA 3GDXA 5L1IA 1D5AA 1NK4A 1HQEA 4FO6A 1XS9D 7ICVA 1Q8IA 4IQVA 1SV5A 4LD0A 4CFDA 1ZQFA 1JLAA 3HVTA 4JRQA 4RW7A 3Q8RB 2AGOA 1IKVA 4M3UA 3DYAA 4FW1A 1Q9XA 4QZEA 5HRSA 2GBZA 3OYMA 1LW0A 8ICJA 4P4OA 3UQ0A 4CJVA 4C8OA 2PFQA 2YV0X 3HW8A 2DPIA 1DTQA 4CJSA 2NRWA 5J1EA 3SQ0A 4O0IA 4F5QA 3K5OA 1NJXA 1BIUA 1L3VA 4EP4A 3B6OA 3G6YA 5J2FA 1S0NA 4NLZA 3M8RA 1KEJA 3O4QA 7ICSA 1JMSA 3RJKA 2XY8A 4CGIA 4M9NA 1F21A 1ZBFA 5KFSA 3UXOA 2VA8A 1ZQKA 1IH7A 1X9MA 4FM1A 1C7YA 2ZUCA 4B08A 4CEZA 4E1MA 3SYZA 4M9GA 3VQ8A 5DLGA 4FCYA 2J6TA 2EHGA 3EW9A 4Y1DA 4HCBA 3MR3A 2RKIA 4NCBA 3PV8A 8ICOA 7ICNA 3TWHA 1IKYA 8ICGA 4M42A 4PHAA 4ECXA 4BDPA 5BOMA 4JRPA 4ELUA 4ZTFA 3G0ZA 3S3MA 9ICPA 4F4XA 2B6AA 3IG1A 2LSNA 3NGIA 5KFIA 4O5BA 2VG7A 4IBNA 3CFRA 4E7HA 5EWFA 5DB7A 3HJFA 3NE6A 2B5JA 5KT7A 2JEFA 4M41A 3KLFA 3RB3A 5DQIA 3M8QA 3I0SA 3TQ1A 3RRGA 4O5CA 5J2JA 8ICXA 2Z1IA 3O3GA 3OYNA 4QWCA 1MSWD 4RQ8A 1B22A 4CJLA 4FK4A 2VA3A 3ZT3A 1ZQQA 5CB1A 3N97B 4R5PA 1T03A 4FJGA 1NKEA 4MFFA 4KLHA 4DQPA 1KDHA 1S1XA 1NOYA 2BCQA 4KN4A 2RDJA 4KLOA 2GV9A 4BE0A 4MFCA 3GV8B 4DSLA 4O3PA 2AU0A 5KFCA 1RXVA 4DSKA 3B6PA 4CE9A 2P5OA 4F50A 3AVFA 5KTQA 4RQ0A 4AHVA 4M3YA 4CHYA 3BJYA 3QETA 4LVSA 3UIQA 1BIZA 2RDIA 3FYHA 3SPZA 1LWFA 4KMUA 4F5OA 1NK0A 4OGEA 4DMNA 1ZQNA 1LW2A 2PYLA 3NBPA 4FJ9A 2P6RA 4ED1A 4FJNA 5JS1A 3K2PA 1ZQSA 1NK5A 2E6LA 1CEZA 4FLWA 3QESA 3O3HA 1U9LA 3ZD9A 4J2AA 1SL1A 4CF0A 1TK5A 4DTSA 1KFDA 4QZCA 3RBEA 4HTUA 5KT6A 4F93B 2W9AA 2PI5A 4CJKA 3C23A 4QOZB 4RG8A 5KG3A 3UPQA 2G8HA 2NRVA 4ECZA 3T5LA 3SUQA 3G10A 4FJIA 2RPIA 3L2VA 3SCXA 5CR0A 3SPYA 3U3YA 1BL3A 4RW4A 4ECWA 2G8WA 3TANA 4YFUA 1HJPA 4CGHA 5L1JA 4GMJB 3H8SA 2NUBA 5CWRA 9ICJA 1K1QA 4Z4IA 5SZTA 3ZSYA 2KQ2A 5DQHA 4M2YA 4R8UB 4DFPA 5KFMA 1VSHA 3DLGA 2B4JA 4QWDA 3ZCMA 1HRHA 4QWAA 4RT3A 3VQEA 5J2NA 2ISOA 2O4GA 4M9LA 9ICNA 3PO4A 5KFDA 3KLIA 1Y97A 3RAQA 3RBDA 2HW3A 1ZQOA 1ZQLA 4TQRA 1BVSA 1C1AA 4JWNA 3LDAA 4NCAA 3PUFA 1QSYA 4EBEA 4RNOA 1ZQBA 7ICRA 2W9CB 2LYHA 3I0RA 2PFOA 1WSGA 1S0OA 1KLMA 1B9DA 8ICNA 3K5LA 2WOMA 3DI6A 3T5JA 3MEDA 5EOZA 4FM0A 4AHSA 3PY8A 3RJEA 1AROP 1ZQYA 4OVLA 3HM9A 3KKSA 3NHGA 2BKEA 2HHQA 2FC0A 1U4BA 3K75D 3SUPA 3LP0A 9ICRA 1S5JA 1VSKA 3MABA 4Q44A 3DLRA 3V4IA 4B9LA 1UWBA 4CGJA 1NOMA 2MAXA 2JZBA 2MUTB 1VSJA 4M6WA 3TAFA 1WSFA 4CJWA 3GIJA 4GC6A 3V6KA 1VSIA 4J9LA 4XA5A 5J0WA 2ASLA 2FPMA 4ICLA 4JV0A 2FMPA 1RXWA 3U3GA 5HP4A 1VSEA 4KV8A 3RRHA 1WCNA 1JLGA 1TKTA 4PGXA 2VWKA 3EY1A 3GIIA 4DTJA 5CYMA 2I5JA 2IAJA 1S9EA 4RW9A 4PQUA 3EYZA 1TKDA 3MECA 3QO9A 3DM2A 1BQNA 1ASUA 2R8GA 4UBBA 3BQ2A 1TL1A 2ZE2A 3E01A 4GLXA 3BQ1A 2R8IA 2EX3A 5D49A 1S6QA 4F3TA 1IG9A 4PA1A 3TAMA 1RDAA 4KI4A 2FBYA 2FMQA 3SUNA 3Q8QB 3RTVA 2OPPA 3RR8A 3M9MB 2OPRA 4Z6FA 3GILA 1WAJA 3QEXA 1RDDA 1RCHA 1RBVA 3V7LA 3OYJA 3ISDA 2Q3SA 1SL0A 1J5OA 3SNNA 2F1JA 4IQWA 4UB3A 3ZT2A 4DU3A 2HHTA 1LV5A 4DQRA 4J2DA 4RW8A 1T8EA 4M45A 3QIOA 2QK9A 2PI4A 4E89A 4KHWA 2ZD1A 4XIUA 1Z25A 1RNHA 3VQCA 3KTQA 1NK6A 8ICMA 2XC9A 2VG6A 4TUPA 3JYTA 1TK0A 2ETJA 3AV9A 2BCVA 3HYFA 3OYLA 1D8LA 4DTPA 3NFAA 3VQ4A 3EWAA 2IS3A 3AO5A 5KFXA 8ICWA 4YXMA 4B3OA 2YKMA 3QEAZ 4M0AA 8ICSA 3CM6A 2FBVA 4RPYA 3V1QA 3WNHA 3VQQA 4OLBA 3RMDA 2IGIA 4YD2A 3KHRA 2FBTA 4ECSA 4RNNA 1ITGA 1I39A 4E7JA 4DTNA 4RNMA 3AA5X 1TV6A 4F8RA 4L8RB 3ZSQA 5KRTA 2UVUA 3V6DA 3VQ9A 5J2IA 5DDMA 3DOKA 4BDYA 1B92A 1JLQA 5J2GA 4BWMA 3MDAA 1S0MA 2BDPA 2I1QA 2KN7A 4F5NA 2Z1JA 1TAQA 3LAMA 1SKSA 4M3XA 1NJZA 1X9WA 4JWMA 5KFYA 2D0CA 3AA4A 3F73A 3Q8KA 1ZETA 3LWMA 3NGDA 3ZSRA 4CESA 4JK1A 5BPCA 4BXOB 2VWJA 2C28A 5HRNA 1LB2B 4FZYA 1A5WA 2PYJA 4M47A 4YN4A 1S1WA 4BDZA 3RMBA 5DMRA 4M9HA 7ICUA 3FDSA 1ZQGA 2Y1JA 1RTIA 3NCIA 4DL5A 1X1PA 8ICRA 2XRIA 1UAXA 4RUAA 5KFZA 4KO0A 2DFLA 3ZSZA 1RZTA 2F1HA 4IRCA 4F4KA 1S1VA 5KFJA 3AUOA 3H7IA 3GQCA 3TR8A 3C6UA 4UB4A 3MEEA 3K4GA 1WSEA 4FLTA 1ZQJA 1ZQUA 1XSLA 1MC8A 8ICVA 3KKRA 1C1CA 1RDBA 1XO1A 3T5HA 1C6VA 3NF7A 3P83D 3VQBA 8ICPA 5HLFA 1ZQEA 4R64A 4DQSA 4I2HA 4KLFA 7ICPA 4E1NA 2PY5A 3QZ8A 1U49A 3L2WA 1LWCA 3QEIA 3KD5E 4Q45A 4Z4GA 4F92B 4K4HA 2DY4A 3CYMA 4HVJA 7ICEA 3NDKA 4CEEA 4H8KA 3OJSA 3T3FA 4QWEA 4HYKA 9ICAA 1ZQTA 4O3NA 4R8UA 4DF4A 4FLVA 4UAZA 5IIKA 5KFBA 2JEJA 4IDKA 1JL2A 4E3SA 4KI6A 3U6FA 2Q0ZX 1JIHA 4Z0UA 2XGQA 3L3VA 3DLHA 4J9MA 2D5RA 5IIJA 4QZAA 2QKBA 1JLEA 3NF8A 4ED3A 3V9XA 2W9CA 4KLTA 4W5TA 1L3TA 2JGUA 5J2HA 2OPSA 1YT3A 2IBKA 3HSTB 4CEDA 4ECUA 3ISNC 7ICJA 3OY9A 4FS1A 5T7BA 1CUKA 4YG2A 4DO9A 2QKKA 1WLJA 4FM2A 2HNZA 4RZRA 7ICQA 4CECA 4P4PA 1EKEA 4HUGA 1RBTA 1RT6A 1KFSA 2F1IA 4FJHA 4IRDA 3K5NA 4B9VA 3GIMA 3G6VA 3PO5A 2P5GA 2KFZA 3S3OA 2ZTEA 5KFHA 2MUTA 4PY5A 5HMLA 3I8DA 3AU2A 3AO2A 3V81A 4CK2A 3BGRA 2X6SA 4MF8A 2BPFA 4CERA 3DRRA 3PVXA 3Q8LA 4DU4A 4YFKA 3HK2A 3ETLA 1TKXA 4CJUA 1X9SA 1BCOA 4QZDA 3DLKA 2NRXA 4DSEA 2X74A 3TAQA 5K14A 4F5PA 1VSFA 4FBTA 4YCXA 3HWTA 3OS1A 4FJLA 3JPSA 4I2CA 1NKCA 4N5SA 3ISCA 1BI4B 3SQ1A 1Y88A 5HBMA 2C2EA 5CYQA 2ASJA 5J2QA 4YP3A 1S1UA 1S6PA 4NYNA 5J0QA 1Z26A 3THVA 4EZ6A 4F2SA 3QEBZ 3B0XA 1UOCA 3MXJA 4KTZA 4EZ9A 4MQ3A 2YNFA 2ATQA 4NCGA 4HUFA 1NK7A 2D0BA 2HMIA 3D45A 4P2HA 3KLEA 3OYBA 2BE2A 4YD1A 5KFLA 1N48A 2PFNA 4ED0A 4OKEA 4OJRA 3QEVA 2OA8A 9ICOA 1A76A 4LH4A 4FLYA 1O1WA 4Z4FA 3ZDCA 4M9JA 5J0OA 3RH4A 3DMJA 4OGCA 5J0XA 3E2EA 1ZQIA 1ZQXA 4IQUA 2P66A 4TUQA 2YHAA 4KLJA 4CF9A 1QSSA 2AGQA 8ICQA 3T1AA 4NY8A 3LWLA 5KRSA 4ECVA 3C2KA 4FJKA 3KK3A 5L1KA 4YQWA 3P5JA 1EP4A 4I27A 5J0PA 2BCUA 4DOBA 3HX0A 1ZQAA 3ALYA 4CFCA 3LANA 2Y1IA 1IXRA 4F3OA 2DPJA 1KFTA 1DTTA 2Z1HA 3TFRA 2XCPA 3TAPA 1XI1A 1HQUA 4C8NA 4N47A 4O5KA 3CFPA 4MEYA 1ASWA 4CIEA 4UB5A 2AGPA 7ICHA 9ICBA 4KLDA 3CG7A 3O4NA 2W9MA 5C24A 4K8XA 4PPXA 1U47A 5CA7A 3MGHA 4X5VA 1TKZA 3KHHA 3C5GA 2X6NA 4CJFA 1UT5A 3QIPA 2G8KA 5KI6A 2VA2A 1EXNA 3H8WA 1XWLA 3AVBA 7ICGA 3VQ7A 4AHCA 3KHLA 3JPOA 1RT4A 5L9XA 4Q8FA 2ZUBA 2W8LA 1U04A 2BQRA 3HP6A 1S76D 3OYGA 1SKRA 3RR7A 2BQ3A 2E4LA 5IINA 3H40A 1S0VA 4BXOA 4LSNA 3DLBA 4KLEA 4CF1A 2UVVA 1WNSA 3IHQB 1XU4A 5BOLA 1RBSA 1JKHA 3AVIA 4DS5A 1PZNA 1ZQDA 5FDLA 4XUSA 5FRMA 3OYCA 4RQ2A 4CFBA 4Z4HA 2G8FA 3RJJA 4CF2A 3QERA 4Z4EA 2GWSA 1ASVA 3A2FA 1YTAA 3V6JA 2F8SA 3UXPA 8ICCA 1R0AA 4IQTA 3OSPA 5C5JA 4GXJA 4NLKA 4HCCA 4DWIA 4TUSA 2J6SA 1DLOA 3VQ5A 5KGWA 3RH5A 4DF8A 3ITHA 4B8AB 1HNVA 2VG5A 4YR0A 4I2QA 1ZQCA 3L3UA 2XY5A 5J2BA 1IKXA 4DTRA 3PR5B 4ID5A 3NH1A 4RUCA 4B9SA 4F4YA 4CEBA 4CEAA 2BGGA 5J0UA 8ICHA 5DK5A 2QXFA 1CZ9A 4W5QA 4DQQA 3VQAA 2BPGA 4K8ZA 4FZZA 4I9LA 4BE1A 3F9KA 1TV9A 4FYDA 3VN5A 2BGWA 4LZDA 2KZZA 4CEFA 4QZ8A 3KLHA 4CJEA 3S3NA 5KG6A 4PGYA 4RPXA 4RT2A 2JEGA 3QEPA 1T05A 4FS2A 4FW2A 4PH5A 5DGAA 4I2IA 4M3WA 4E7IA 5J0SA 5I3UA 1S1TA 4O0JA 3LPTA 2ZJ5A 4DL4A 3NF9A 4DSFA 4KAZA 3D0PA 5KFWA 1ZQHA 1MQ2A 4YMNA 3DOLA 3ZT0A 3PW2A 2AQ4A 4YVZA 4RQ1A 2ZTCA 5KFUA 5KG0A 4K4IA 1U48A 3L2QA 4IR9A 1ZQWA 3KHGA 2HHWA 1HNIA 5HMMA 3AO4A 1FKPA 2HB5A 3AVNA 4KLUA 2HVIA 4QZIA 3HP9A 2PZSA 5HRRA 8ICUA 4ELTA 3PMLA 3MXIA 2PXIA 1REVA 4HHTA 4F2RA 1CXUA 1B43A 4I2FA 3B0YA 1ZBIA 4CJ5A 2J6UA 4DQIA 1RDCA 4KHUA 4NYFA 5CP2A 2FPLA 2HNDA 3HPGA 4OKKA 5J2DA 2XO7A 1QHTA 3O3FA 3V9ZA 5J2KA 1D9DA 4R63A 9ICKA 5DBCA 1WCLA 1NJWA 1IO2A 2P6UA 1EXQA 4RU9A 1C1BA 1NJYA 8ICEA 2BCSA 1Z00B 1JLFA 5KFAA 4UB1A 3TFSA 1BPZA 3OYIA 3Q8SB 2IMWP 1IM4A 3H4DA 2ZJAA 4KLLA 1TK8A 2E6MA 4CEOA 3SI8A 3OVNA 3ZDAA 2HHSA 1J9AA 4I9QA 4GC7A 2BHNA 3BDPA 4I28A 4OKJA 5EU7A 4UB2A 1RT5A 2D0AA 4CFAA 4CJPA 5HROA 4KKOA 3PMNA 5JS2A 1BI4A 4EYIB 3MFIA 1TFRA 1V9PA 3AVJA 5I42A 3K5MA 4O3QA 4ECTA 4EYHB 4UAWA 4KLQA 4MEXA 3C2MA 1COOA 4GXKA 3SI6A 1ZJMA 3ZSXA 1JXLA 3RH6A 8ICLA 3SQ2A 1K1SA 4G1QA 4CK3A 4B9MA 3H8JA 1VK0A 1JLBA 4KHNA 5KG2A 4DFKA 1KSPA 2ZUDA 4RW6A 3EPIA 4JV2A 4NLNA 2O4IA 1RYSA 4J9QA 4EBCA 5DLFA 4KLSA 2OZSA 4NM1A 1UT8A 4I7FA 4UQGA 3OYDA 3HXMA 4B9UA 2BANA 2KZMA 3JPNA 3AVLA 3PX6A 2JLEA 4IG0A 4J9OA 4KLGA 2IHMA 1L3UA 4FJXA 3OYAA 4F5RA 3OYHA 4ED2A 4N41A 3N4MB 4QAGA 2ZJ8A 3VA3A 1T7PA 3QE9Y 1SKWA 4BGDA 1S9FA 4KB0A 1ZQMA 4OPKA 1HYVA 4KFBA 2I9GA 3GV7B 4KREA 2BR0A 4BWJA 4UAYA 3EZ5A 4C8LA 3LDSA 2IHNA 5CHGA 9ICMA 1S97A 5HHIA 4AHUA 4O44A 1KLNA 1RBRA 2DFHA 3MR6A 8ICBA 4QW8A 3EPGA 4O3OA 3AA3A 4Q0BA 3VA0A 4LZGA 5IIIA 4KRFA 2BCRA 2HHXA 2VANA 3JPPA 3V9UA 4JS4A 3TABA 5HHHA 5J2MA 1WSJA 4I2JA 4IR1A 4GVMA 3MAQA 4PHPA 4QZHA 4FJMA 3M8SA 5HRPA 4CIFA 3AU6A 3RB6A 3SJJA 2FBXA 4CGGA 4KB1A 3L2RA 4I2GA 1HJRA 4FJ8A 2JEIA 9ICWA 3C94A 4RQ5A 3PW4A 4EP5A 2IC3A 4DL3A 3C5FA 3ULDA 4NM2A 3C1YA 8ICFA 4DTMA 1K6YA 4DSJA 1NKBA 4O5EA 4AHTA 4ELVA 4FZXC 3ISBA 4LSLA 1KRPA 2ATLA 1SZPA 4M04A 2DFFA 3LP2A 2P1JA 4W5OA 2F96A 3MFHA 4B9NA 1NK8A 4ED8A 1NOZA 7ICIA 4WE1A 1RYRA 3V6HA 5DQGA 3NGZA 3RJGA 5CZ2A 1KVAA 4DOCA 1RTDA 3MXMA 3MR5A 3MGIA 1ZBUA 5CJ7A 1W0HA 1RTHA 4DTOA 2PFPA 3GFKB 2FLNA 1CZBA 5DG7A 8ICZA 1BPBA 4DFMA 4EEYA 2UVWA 8ICTA 1KVCA 4K4GA 2A1JB 1MQ3A 4FBUA 3TAGA 5IILA 2V4RA 2FPKA 5KFOA 5JUMA 1XHXA 4CHQA 3AA2A 4UBCA 2YNHA 2YKNA 4QWBA 3V1RA 3PNCA 3ZSVA 4I29A 3T5KA 1RILA 4ECYA 2BPCA 2W8KA 5KT2A 5CZ1A 2KW4A 4YMOA 3C95A 2XGPA 4KN7A 4FJ5A 3LZIA 2OYQA 4KTQA 2P51A 4KHQA 3GIKA 1VSLA 4DLGA 4CK1A 3SUOA 1HUZA 9ICLA 3QEWA 5FRNA 4DOAA 1RBUA 3K58A 1BPEA 1QQCA 3C21A 3NGYA 1YVUA 1BHLA 5J0TA 2G8IA 3UXNA 3JPQA 5FROA 4FK2A 1L5UA 4J2EA 4O55A 2ASDA 1ZQVA 3AVMA 4AILC 8ICYA 3AVAA 2XY7A 5IIOA 1HUOA 4FVMA 5DB9A 4CCHA 4QZ9A 1BCMA 3QINA 1RT7A 3AVCA 1EX4A 5KFPA 4JS5A 5KFGA 1ZQPA 3RJIA 5KG5A 9ICCA 4BACA 1SUQA 3SZ2A 4O4GA 3ZSOA 2IA6A 4KLIA 5DG8A 3LP3A 1T4GA 4IFVA 3MR2A 7ICOA 1ZQRA 4ECQA 1XSNA 5EWGA 4J9NA 1I3AA 3ZDBA 3MEGA 3RJFA 5IIMA 1Z00A 1Z3EB 3KLGA 4PHEA 2M9NA 4NXZA 2RN2A 3OYEA 1W9HA 2AQ0A 3OS0A 4E19A 4H4OA 2OZMA 4QZGA 2R8KA 5DB6A 4Q43A 1IKWA 3V7KA 4IRKA 4RPZA 4I2EA 3BQ0A 3RMCA 4ZH4A 3CFOA 4JV1A 4R65A 3PW5A 1QSLA 8ICKA 3V1OA 4FJJA 3NH0A 1JXBA 7ICTA 1ZJNA 1TGOA 1LAWA 3OGUA 3IRXA 3NF6A 3QNNA 2W9BB 1TAUA 3ZD8A 4O3SA 3KD1E 1C0UA 1N6QA 4FJ7A 2WONA 2WTFA 9ICQA 5C42A 9ICHA 1VSDA 4M3RA 1L3SA 2NRZA 3ZT1A 2HHVA 4LY7A 1ZYQA 4W5NA 5DGBA 4CGFA 2X78A 9ICIA 4QW9A 3DRPA 1HYSA 4QCLA 3OJUA 3V9SA 5KG4A 4DTXA 4Z6CA 2XCAA 4OLAA 7ICMA 1RPLA 4AHRA 3WNFA 1BGXT 2G8UA 3M9OB 1HMVA 4E7KA 1VSMA 1NK9A 3HL8A 4ZTJA 3RB0A 5KFTA 4KITB 3PW7A 7ICKA 3V72A 5DBAA 3MBYA 4CJTA 4DLEA 5TZVA 1WAFA 3QZ7A 7ICFA 4Y1CA 3QLHA 4IKFA 9ICSA 4PHDA 5E41A 4DG1A 4CHPA 9ICVA 3CM5A 1H38A 5CY4A 1J53A 3C2LA 1S10A 5L1LA 3HPHA 3JSMA 3M9NB 4CJRA 4TQSA 3NAEA 3FFIA 4FXDA 4PWDA 3IM1A 1CLQA 1TVRA 1FXXA 1WSHA 3RMAA 1S77D 4ECRA 1KVBA 2IDOA 3PX0A 4F4ZA 5KFNA 5F9NA 1JL1A 4JUZA 4RQ3A 4R66A 9ICUA 1Q9YA 3TAEA 4DL6A 2AJQA 5SWMA 2KFNA 4CIGA 4H4MA 3HO1A 5DKWA 3G6XA 9ICFA 2C2RA 3OSNA 1XSPA 4ZHRA 4F4WA 3SV3A 3AVHA 4CGDA 3HVRA 4KTWA 4CJQA 4XQ8A 3OS2A 2XHBA 4I2AA 1RTJA 3KJVA 3OYKA 3LK9A 3LPUA 3VQ6A 3MDCA 2R7YA 1TVAA 2ISPA 1S9GA 2H5XA 4ED7A 3AVGA 1SL2A 2R8JA 3HT3A 4P4MA 1ZBHA 1FKOA 3IAYA 5D46A 5KT4A 5J29A 3PX4A 1RT2A 1XC9A 5DB8A 3KK1A 4DTUA 4I2PA 2ZTDA 4TURA 2ALZA 2YNIA 2G8VA 1BQMA 2DFEA 2GUIA 4NLGA 3KK2A 1G15A 4FLUA 1KTQA 2HNYA 1JXEA 7ICLA 3ZT4A 4FK0A 5HP1A 4QZBA 2C22A 5KFQA 2ITGA 1JN3A 3KIOA 2OPQA 1RT1A 4HUEA 9ICGA 4C8KA
chains in the Genus database with same CATH superfamily
4ID1A 2PD1A 5EWEA 4Z4CA 1SV0C 4IFYA 5AJ3J 3KVGA 3AO3A 1S1XB 2VASA 2KT3A 3FEXB 4QR1A 3K59A 3GV5B 2KH9A 4IQXA 3CCMN 2HVHA 5HNKA 4HEA9 1EETA 2YI1A 3W8GA 4CJ3A 1RISA 4TLQA 2VDHA 5E33A 5BRDA 3QUTA 8ICAA 5G4DA 3O0FA 1J27A 4U8VA 4YR2A 4FL9A 2HQGA 3HKZF 4MFBA 2ZBIA 5LJWA 4C3MA 4KHYA 3TUIC 1IKWB 3NVWA 3AA8A 2DF4B 2YKPA 5AQQA 4O5FA 1TFWA 1YTUA 2P9LB 2FDNA 3NP5A 3NBPB 4DFJA 4FXVA 4DS4A 3OA9A 4FLXA 3I4HX 4CH1A 2HWIA 3ASMA 5GAEI 4L76A 5J2EA 4I2DA 4ID8A 1ZAWA 2GEMA 3IG5A 4FF2A 3FZ2A 3H08A 3NEKA 1FFGB 3VQDA 5J2AA 4E7LA 1FK9A 1HA1A 3BGUA 2MPUA 3WEEB 4LH5A 2NZ4A 4KMOB 2LKZA 5J0YA 3HVWA 3G8QA 3M8PA 1YQHA 2P5VA 5KG7A 3M1VA 5J2PA 3LZJA 3U1LA 2EKYA 3AO1A 1RABB 1ILYA 1HI8A 9ICXA 4FWNA 3MMBA 2ZQBA 1T94A 3K89A 3DGPB 3EDRB 3QRPA 4F02A 2GFFA 3ZO7A 1EO1A 2XWXA 2EC2A 1SQGA 4BQLA 2R4FA 5D4NA 3UR3C 5BJRA 1Y9OA 4FKXA 1V97A 4IG3A 4JV5K 4IOXA 3NNHA 2UUAF 2A1SA 2XMJA 1S6OA 3DLGB 1ZAXA 3H42A 2KTQA 3I32A 2CNNB 2F4VF 1NDPA 2ROGA 1RK8A 1Q18A 4FNHA 2KZ3A 2C2DA 3D28A 4E98A 3M6VA 4IJNA 4F04B 4L73A 3TVKA 4RQ7A 1TL3A 2GJFA 2XI2A 4YNQA 4FPRA 1XEZA 4J9KA 4DV2K 3OTBA 1N5YA 2PAVA 2UU9J 4YR3A 2RUSA 1JJ2R 4KPYA 1VRUA 2W9BA 3BGLA 1RWKB 4N76A 4J9PA 3H5SA 4UASA 4ZLPA 1WC6A 4WK3A 1RWUA 3MN7A 3S9HA 4H4KA 3ZDEA 3DEEA 3V4IB 2RU9A 3FBCA 1QTMA 1UWBB 3W60A 3JPTA 4JKEA 5KT5A 4AH9A 1BY9A 4IEEA 3QAUA 3PG9A 3Q8MA 3DRSA 2PFUA 3WNEA 3C1ZA 5D4BA 2WAQD 3GONA 6FDRA 2P9KB 4FO6A 1XS9D 4NXMK 2B4PA 2VFRA 1Q8IA 1SV5A 1JLGB 1U1PA 2YBVA 4O23A 4U95A 2ZWOA 2X3DA 3TA0A 3GU3A 1JLAA 5CYMB 3I6PA 3T6JA 2DBBA 3RJMB 3G4SS 2AGOA 3NS6A 2NQPA 3W2VB 4K5RA 4XK8C 4ZVRB 3TJ8A 3DYAA 2C3YA 1HKGA 1TL1B 4QZEA 2ZE2B 3N28A 1AZSA 3FEZA 3OYMA 3MWTA 4P4OA 3K1RB 2E8PA 3WK7A 5AM4A 3UQ0A 2EK6A 4F25A 2GVZA 2JXJA 4YDUC 3TSUA 2Q1LA 1VQNN 5D0RA 5CAAA 2ZIVB 2DPIA 2QE5A 4CLSA 3TAMB 1DTQA 1X3NA 3THYB 4AYBF 4BRLA 2E7WA 2OPRB 3D0IE 5J2FA 3O4QA 1KEJA 7ICSA 4FWOA 2B43A 3LGMA 1FO1A 3IXQA 1YF5L 2XY8A 4CGIA 1NI3A 1ZXOA 1ZBFA 5AXLA 2HK2A 1UEUA 5IS2A 4J7CA 4RW8B 4YY3F 3EXYA 4IH6A 4CWBA 4E1MA 2ZD1B 4M9GA 4WBFA 2EHGA 4HCBA 4US9A 2RKIA 3DXBA 1N36F 4NCBA 1PCAA 3K8WA 3TWHA 3NY0A 2ZH3A 2VG6B 4NASA 5IT9U 4OI6A 3BP8A 4PHAA 4ECXA 1M5SA 1NHVA 2G09A 1OW5A 3IG1A 2GX9A 3CCQN 1X4CA 3VGTA 3SMVA 4F3QA 3O44A 3HJFA 4B3OB 5D8HB 2R42A 1QAXA 1WWUA 3F2CA 2JEFA 1SH0A 2MHNA 2MY7A 4EO6A 3BBBA 3AQPA 3D2QA 1D09B 4X4OA 3RB3A 3M8QA 5E26A 3SAHA 1RBOB 1YTYA 3QWPA 3Q2SC 2DTJA 3RRGA 5J2JA 4CZKA 4WFZA 4M94A 2JVOA 1SAZA 2EFPA 3OYNA 2CUYA 1ZBSA 2WVEA 2ZC4A 4FK4A 3UN3A 2VA3A 4JKDA 1F3FA 1Z2LA 1NHUA 1T03A 4CLLA 5CB1A 2GWKA 4R5PA 4MFFA 3FR0A 4OYPA 1YIJS 4BJQA 1JUDA 5JMVA 1KDHA 4DV7K 3QX7A 2BCQA 2Y9TA 5FJ4A 1JCFA 1R8AA 1RBAA 2IIRA 4DSKA 3NKYA 2NXNA 1U1OA 2OUGA 3MM6A 3QFUA 3AVFA 4JNEA 4AHVA 1P1LA 3NS5A 3THWB 4NI2A 2DNRA 3QETA 1OPZA 2J8AA 2BM1A 4LVSA 3T1YF 3OBWA 1BIZA 1YITS 2H3GX 5BR8F 3H3OB 3MX5A 1LWFA 4KMUA 4F5OA 2D1CA 2QMXA 1ZQNA 1LOTB 4FJ9A 2DR5A 2CQBA 4ED1A 2O8EA 1QTNB 2JH7A 3I56S 1NK5A 3GE1A 4K0KF 3LVWA 1CEZA 3QESA 2EQYA 1HPZB 2LA4A 1TK5A 3CW2C 1S1VB 2W9AA 2PI5A 3VV2B 4OLPA 4QOZB 4JAXA 2CPIA 4DR2F 1Q81T 2G8HA 4OX9K 4FOIA 3SUQA 3G10A 3PIPQ 4GMKA 3M7DA 4A8XA 2RS2A 4ED5A 4F0KA 2PC6A 4ZLJA 4Y2CA 3SFUA 4JI2K 1K5OA 1HJPA 4ERDA 9ICJA 5EOYA 3WIVA 5IWAJ 1K73O 2EFVA 3ZSYA 3PSFA 5B08A 5D78A 4DFPA 2OTLS 1DURA 5C2FA 5AE1A 5B0BA 4CF3A 4QWAA 4RT3A 2FB0A 5J2NA 3JQJA 2ISOA 3PO4A 3KLIA 2XYHB 3RBDA 4P0QB 3TA2A 1C1AA 4TQRA 3CMEN 4JWNA 1HBUB 1N5WA 5E0OA 1JRPA 3O2IA 2ZWHA 1S3XA 2W9CB 5L1MA 3AH6A 3CDBA 2B7BB 2LECA 2LYHA 1E6YB 2N7CA 5LMUK 4OPAA 1RA6A 1KLMA 1IUJA 4H4KC 3K5LA 3MCAB 2GV1A 2LM4A 1NGIA 4DUZJ 3TKAA 2OSRA 2ZH6A 4LFBK 3D2NA 1ZQYA 1WSRA 3HM9A 4F4AA 3DLLQ 2YWHA 4R0EA 2FC0A 4L3KA 1UVLA 3K75D 2Y0SF 2AEFA 2L9DA 2VV5A 2HS4A 4H5WA 4USVA 4ZDNA 3KG4A 1UVNA 2Q3PA 3DLRA 4B9LA 4U7UK 2HGMA 1GQEA 3A3OB 5F8LA 4M5NA 1K8KA 4JMUA 2V50A 2JZBA 1VSJA 3TEGA 3UM9A 4KBOA 3VAHA 3VCBA 4M6WA 1T3QA 1H2TZ 1WSFA 4CJWA 2L3MA 4GC6A 3V6KA 3NL0A 4OZNA 4J9LA 4ICLA 5J0WA 3C19A 4CBWA 1RE1B 4KV8A 3RRHA 1WCNA 4MKAA 1TKTA 2YY3A 3GIIA 1KBRA 4JI7K 1TKXB 3RGIA 1RHJB 2I5JA 2V51B 4PG7A 2CZ4A 2IAJA 3MPWA 3CP8A 1NDLA 3QO9A 2XNRA 2JJ4D 1BQNA 3CCUS 1ASUA 1FCAA 1SZ2A 3T1HJ 4LQ9A 1OY6A 5E3AA 3C8YA 3RAMA 1HKAA 1Q86T 2R8IA 1UVIA 1NLKL 4BROA 1KAXA 5D49A 1D0EA 2D9OA 2OXOA 1NGCA 1S6PB 1MA7A 4C1NK 1RAGB 1SJ3P 1E4GT 2B6GA 1X3MA 3RTVA 3JB9k 1KONA 4NEYA 5E3CA 2YPZA 1F44A 2DNZA 4LVNP 3QEXA 1LK5A 2KLAA 5FPDA 3V7LA 2GJ2A 5JJBA 5KOWA 2HMIB 3UQSA 3ZT2A 1YJNN 3O9UA 3KLEB 4KH6A 4LF7K 3NASA 1LV5A 1SCJB 4DJBA 1AUDA 2EFQA 3OTOF 2BE2B 3UDLA 2VICA 3QIOA 3P6YC 3FSXA 2GH1A 4IXCA 2QK9A 3SQIA 4E89A 4JI6F 4UATA 4BC9A 3DXMA 5A8RB 1T3OA 1IQZA 3KTQA 3Q23A 1NK6A 1TUYA 1IN0A 8ICMA 3Q83A 1DBDA 3A0HU 4JYAF 2ETJA 3AV9A 2BMBA 2BCVA 4UF4A 3OYLA 4DTPA 3M1FA 3EWAA 3G8TA 4J9VA 2E2NA 2IS3A 4MK7A 5G5GA 4UQTA 1HWJA 4A8FA 5KQ8A 2H3ZA 3THXB 2QSFA 4YXMA 4WFNL 4O3MA 2YVSA 2YKMA 2QL7B 5AI5A 1WEYA 3D6RA 4RPYA 3WNHA 1CS4B 4GKKK 1HNZJ 4PYDA 1YBAA 2QWNA 2K4HA 2N1RA 3CSKA 3PIPL 4ECSA 4DDFA 3OR2B 1FVSA 3AY9A 3MAAB 1GMWD 5CD4A 2P9NA 3ZI4A 5IZHA 3H0RB 3NVYA 4RNMA 1BUPA 1LKYA 1TV6A 2AWZA 4F8RA 5F8NA 4ISGA 3GJSB 2GELA 3BS9A 3VF6A 3DOKA 4WFBL 2IMOA 1B92A 1JLQA 2GA7A 4DR6K 2G06A 4BWMA 2I1QA 3Q8UA 3SMZA 2KN7A 3QIPB 3E9OA 4YMEA 4J37A 3LAMA 2CYYA 3LDQA 4C4RA 4CI0B 5AK6A 1TMJA 4DV4K 1X9WA 2UUCK 1SJQA 3AA4A 3NGSA 2QWQA 3LWMA 5EHHA 3F2DA 4JK1A 2J5AA 4LF6J 5GAHI 4LSNB 3A3PB 2GNKA 3FJ2A 3PDNA 2QLXA 4LFAK 1NH8A 1S7IA 4LF4J 2ZXIA 1RTIA 2DYAA 1X1PA 2O8CB 5FDLB 2XRIA 2U2FA 1UAXA 5KFZA 4KO0A 3CCVN 1RZTA 2WVCA 2EAMA 4AE5A 3DLLL 2MLYA 4IRCA 4F4KA 5LXYA 4YOUA 5KFJA 3AUOA 3KK7A 2R3VA 4X4NA 4LMZA 4WJBA 1NM1A 2V52B 5T7LB 3W7BA 3SJHA 2HIQA 3MEEA 3ITHB 2P8IA 1ZQJA 1ZQUA 1MC8A 1HL6A 2HZVA 1RU1A 4CZLA 4ID5B 1XO1A 3NF7A 5E3PA 1ESVA 2AJ2A 1NB7A 3HJVA 5TISU 3QZ8A 3L2WA 1LWCA 4YHHF 4Z4GA 2DY4A 4UUXA 3RYLA 2YX4A 1I3OB 3OJSA 2NO4A 4O3NA 1R0CB 3QB0A 3L95X 3D66A 2VKQA 5AQIA 4E3SA 3BEGB 3U6FA 4K2XA 2KKPA 5ALYA 3F5EA 4ZVFA 1U2VB 3LDPA 3LO3A 3NOGA 3M1YA 5I3UB 4DV5J 2MQPA 2FSJA 1JLEA 1SC3B 3U4LA 5ALEA 4ED3A 3SEIA 1YHQS 1N33J 2CQPA 5AFUA 2ODGA 1L3TA 2OPSA 5J2HA 4W98A 2JGUA 3K9JA 3N7SC 4FVCA 1S5ZA 2XYPB 3MX2A 2LM1A 7ICJA 2IVFB 3IBCB 2UZAA 4YG2A 1IBLK 2CPYA 2OO4A 5HO4A 2GUPA 5AQYA 2F8LA 1YUWA 2QKKA 4BQZA 1XMQJ 2HBLA 2CQ0A 3G82A 4CH7A 4UOCA 4TN2A 1ZQ1C 1Y64A 3IGVA 2HHHK 1EB0A 2AYBA 3W3DA 4EFAC 5D0GA 3J7AN 1FJGK 4P4PA 1EKEA 1RBTA 5JLFA 5AM5A 1RT6A 2F1IA 1COKA 1UMJA 3M6WA 2KFZA 3H5XA 3S3OA 2ZTEA 3AL0B 2OEMA 4Y0FA 1FXLA 3AU2A 2R7TA 1CQNA 2KK0A 3AO2A 1ACMB 4MF8A 5GAEP 1JCGA 3WQPA 4DX8H 3CVKA 4CERA 1T9VA 3P31A 3Q8LA 3GCXP 2WMMA 1JJCB 3D7EO 4YEAA 1UPHA 3OVSA 3JTPA 5AQHA 3HK2A 1HBMA 4CJUA 1X9SA 1BCOA 2QA4G 1WB9A 4P2SA 2QWLA 3FZFA 4FBTA 3W1YC 1QJHA 3HWTA 1RT5B 1VJQA 2DEJA 2RDDA 5JVGL 1FTRA 2ZC3A 3ISCA 1JQGA 3HSGA 5J2QA 2ASJA 1S1UA 4NYNA 2NXEA 3JQMA 5F3XB 2D4WA 1VQ7N 4C4SA 4F2SA 4ITSA 2K7JA 2E5SA 2CXEA 4F3MA 5IV4A 1NPPA 4C11B 1Y4ZB 2DNQA 4X64K 4GV9A 1NZPA 4EZ9A 4CD3A 3FZLA 2N3LA 1PAUB 1XNRF 2YNFA 4RW6B 1NK7A 2D0BA 3T79A 2NRHA 1X5PA 1YSJA 5HMYA 3ENVA 3OYBA 3C16B 4ED0A 3GYNA 2W2PP 4HDGA 4YB1P 9ICOA 5IQ6A 1A76A 4PXCA 1NGEA 2J8SA 1FEZA 3RH4A 3HRGA 4IG0B 4BR2A 5J0XA 5LSRA 2XMTA 3OD2A 2YHAA 1EQYA 3JTNA 4ZLLA 4WF9L 3ETMA 2ZIWA 3CD7A 4BC7A 3I87A 1JWWA 2JHDA 4M95A 4DV0K 1RCXB 4C3LA 4FXWA 2V8GA 2NYVA 4M5MA 4YQWA 2AYMA 2DGTA 2NPIA 2HFUA 2V7YA 3ALYA 4F3OA 1DTTA 2A10A 5AM0A 1HWLA 2R7RA 3GR1A 3TR5A 4TU8A 2XCPA 2XLKA 3VAIA 3B4DA 1GAOA 3UVJA 1QVGM 3GTYX 1QVFM 1FNOA 4KLDA 3FCVA 3M30A 1NSAA 4HVZA 4KPCA 5C24A 5CA7A 3MDFA 5ADZA 4X5VA 3PJ9A 3TZYA 3KHHA 1I5OB 2X6NA 4CJFA 1UT5A 3A13A 3L4QA 3F53A 3D1QA 4BHQA 1M5PC 1RT4A 2WB1C 5L9XA 3A0BU 2W8LA 1MWMA 3OYGA 2IC3B 4WQ5A 3VMFB 5FPNA 5IINA 3OTDA 4AF1A 4BXOA 1EAYC 3ZTSA 4F0HA 1LQ9A 4CF1A 1QZ5A 4X2BA 3L09A 5AHXA 4LSLB 1CJVA 4CBXA 2CJXB 2QWOA 2YKAA 1XU4A 1JKHA 3LP2B 3AVIA 3DFEA 1BWVA 3UI3A 4DS5A 3NAHA 4XUSA 1RCOB 4CT8A 2JC0A 3EUB2 2IPOB 2M0NA 3A2FA 4OJPA 3UXPA 5F8MA 2CKWA 1C4AA 1U6BA 4TUSA 4DPXA 1JALA 2R2SA 3AAQA 2WVDA 1YRTA 4B8AB 4ES3A 1BQXA 1ZQCA 4G1PA 3L3UA 2XY5A 4JKCA 3AGKA 4CVNE 1D4XA 2GAGC 2Y3YA 4B9SA 3KG1A 5AQVA 4CEAA 8ICHA 1SJFA 3CXCM 2KHVA 3CCRN 2ZOGA 2J76E 2BPGA 4YB7A 1IBKJ 4I9LA 2G0IA 3F9KA 3IRWP 3VN5A 2BGWA 4NXNF 4LZDA 1FRIA 2O8FB 3R5CA 2AA4A 1H2VZ 3S3NA 1FXRA 2DCUB 2BOAA 2QEXS 2EXUA 3CCSN 4E7IA 1IXKA 3OVAA 2VZ9A 3NWRA 5KFWA 1ZQHA 3BDEA 4DPOA 4ILHA 4FE3A 3MM7A 3M8WA 2AQ4A 1CBKA 2WUSA 4RQ1A 1N54B 5CCMA 1SC1B 3FKBA 4WWSA 5KG0A 3OW2R 3L2QA 1SBRA 1TUGB 3KHGA 2EFNA 3L7PA 1RWVB 3AVNA 4KLUA 2HVIA 1S7HA 3NXZA 3TJ9A 3IA0A 5HRRA 3MXIA 2PXIA 3K9KA 1RT7B 4HHTA 2V0NA 4YUDA 4I2FA 1VBXA 1FDDA 4CZFA 1ZBIA 2Q79A 4DL0C 3A5OC 1UEKA 1XNQF 2IJNA 3BZKA 3MM8A 5C12A 4KHUA 4NYFA 2FPLA 2P9SA 2QTWA 2DNGA 1SGGA 2C3PA 3M6KA 4PYAA 3BBCA 4IQMA 4R63A 1Q79A 5CE3A 1NEEA 9ICKA 1WCLA 2P6UA 5JVHQ 1LXNA 2KRBA 1C1BA 3MMAB 1Z00B 3SEOA 1M5VC 5HR6A 1OUQA 1PVRA 3B54A 4H4OB 2IMWP 4DBQA 3OTCA 1HNWF 4BGAA 2E6MA 1P90A 2D3OR 3OVNA 3ZDAA 3PHEA 4WXOA 2D0AA 5HROA 2DRDA 1YBUA 5ALGA 4ZP7A 3AQFA 3SSQA 3U27A 2SXLA 1BWFO 5I42A 2FUG9 1FT8A 1OQ3A 1VK3A 4WQ4A 4MKYA 1COOA 3W61A 3SI6A 1ZJMA 3ZSXA 1C0UB 2ZH7A 2IFXA 1K1SA 3R1XA 4CK3A 5CH7B 1E6VA 2A3JA 4ED4A 4BRHA 1WF1A 2V4JA 4YOTA 4KHNA 1H72C 1KQGB 3D2EB 1X4HA 2F5GA 4A8YA 5F0XA 3FMBA 2UUAK 2CPHA 2VB6A 4I7FA 3OYDA 2B4UA 2MEWA 2F4VK 4B9UA 4ZVEA 2C2KB 2BANA 4D3GA 4U7CA 3IWLA 4U6PA 4HACA 1I94F 2JLEA 5HQLA 3WQTA 3W64A 4OI3A 2RRNA 4XPEA 4X4UA 5CXTA 5AQSA 4MK8A 5ALRA 3C14B 3CO0P 3FGUA 4F5RA 2POKA 1HWKA 3OYHA 4ED2A 3DHXA 2IM3A 3N4MB 4WKYA 1R6VA 4C2MA 3IBWA 2C3MA 2QB0A 1ZAVA 1B4SA 3M2VB 4BRIA 4ER8A 5BYRA 4DG1B 3OTEA 1R0AB 5HN0A 1HYVA 2I9GA 1XQSC 4TY8B 4UAYA 3EZ5A 5AQRA 4AXJA 3OXFA 5GADP 5CHGA 1L6NA 1DLOB 1M1GA 2MGZA 2H48B 4QW8A 2KI2A 3W65A 2MB0B 4Q0BA 4LZGA 1RHRB 4H0YB 5IIIA 1TVRB 4NLCA 4ZMMA 1DT9A 4DN9A 3V9UA 3TABA 3TJAA 1HEKA 3EWGA 1WSJA 2E1ZA 1GK8A 1HIWA 4IR1A 3MAQA 4GVMA 4QZHA 1OO0B 2KO1A 3MGVA 4WQ5C 4P2MA 4K2JA 2GGPA 4JI8J 1KEKA 3RB6A 4CGGA 2KSOB 3L2RA 4I2GA 1HJRA 2JEIA 3CJ2A 4IUFA 2BEFA 1SZHA 5J1PA 2CZVC 3KJVB 4EP5A 1YGYA 1RXOB 3U9ZA 4NM2A 4ZVPB 3C1YA 3BS5A 5HR7A 1NKBA 4NO7A 3W5YA 4ELVA 1BXNA 2ZH4A 1HNXJ 2K1RA 2W7PA 1FKOB 2QRRA 1T9UA 3CIPA 3HHLD 2P1JA 4W5OA 1TL7B 4ED8A 3I76A 4C9DA 3P96A 7ICIA 4W4MA 2WTUA 1T6DA 3K2YA 5DQGA 1Y10A 2HNYB 2C3UA 1KVAA 4DOCA 3M6UA 1CC7A 4RBUA 1IWAA 2YX7A 3MOZA 4NLYA 4DR5F 5CJ7A 5ADXA 1VQ5S 2E5JA 2GVDB 3GFKB 2FLNA 5LT5A 4YN3B 1CZBA 4DFMA 4EEYA 2UVWA 1EKRA 1KVCA 4NV0A 4GKJF 3MPYA 5EY4A 5IILA 2EH9A 2FPKA 1IBMF 2JSXA 5KFOA 4YY3K 2XI3A 5M1QA 4DV3F 5JUMA 4BVPA 3CD5A 3C3LA 1N88A 4CHQA 4LSZB 4XH5A 1SQFA 2BJ8A 3QUBA 2YKNA 1X0FA 4I29A 3T5KA 4NMXA 2BPCA 4R0JA 5JVHL 5EUHA 3L5KA 1N36K 2G08A 4U96A 4MDAA 1DGKN 3VGMA 2OD4A 5CZ1A 2KW4A 1Z1ZA 4DX5A 1UCVA 3HULA 2XGPA 1GFWB 1JLFB 3KZXA 5KL1B 4JHDA 3WHIA 3GIKA 1D9AA 1VSLA 4DLGA 4CK1A 9ICLA 2NREA 1NZAA 5ITHA 1RBUA 4GRSA 3C21A 2PBDA 1WOOA 1YVUA 1BHLA 5ALFA 3UE2A 3LH2S 3UXNA 3CJQA 5ALWA 2LP4A 3CC4N 2HVEA 3I55S 3S41A 3H45C 1K0VA 3ILLA 2XY7A 4HTIA 4FVMA 3B82A 3J7YU 4LIRA 5GAGP 1RKIA 4OJLA 1Q81O 2M8HA 1EX4A 3QU2A 1MNEA 4USWA 5KFPA 5ETLA 3N7RC 3A0IX 5G0RB 5KFGA 2KVIA 1ZQPA 1VBYA 5KG5A 3TVZA 9ICCA 4DV6F 1SUQA 3LOUA 4O4GA 3T1YK 4KGXB 5DG8A 3I5BA 5BR8K 4MIBA 1WDTA 4IFVA 5KQDA 1ZQRA 3MM9A 4J9NA 3H0MB 4JKAA 3MEGA 1DJ0A 2VPWB 3AD7C 5HSPA 3WU2U 3PJWA 5THWA 2UV8G 2VQFK 2AQ0A 2HI0A 2OZMA 2AV5A 3EZWA 3BB5A 2YTUA 4DPWA 4DX7A 4WQ4C 3BQ0A 3G25A 4MKVA 3RMCA 2ZM6F 3M6GA 3CDEA 1HQ2A 3H46O 5IM0A 4JV1A 2JRZA 5HMWA 4MIWA 2ZNZA 3TOQA 2E9RX 1S72S 2HWHA 3D6MB 5IWAF 4FJJA 3NH0A 1JXBA 4DR2K 1ZJNA 1TGOA 4A62A 2CWKA 5A0LA 2E8OA 2HBQB 4NYOA 2RD5C 4DCHA 3NF6A 2MZ1A 2QGFB 3ZD8A 1N6QA 2WONA 2RQ5A 4ZS6A 3ZX2A 9ICQA 3DOMB 4DU8A 2VOPA 2ZITA 1VSDA 1L3SA 4ZOSA 4Y2PA 1HJOA 1ZYQA 4JD2B 3IP4B 3ONQA 2QW9A 2ZKUA 9ICIA 3P39A 4NA3A 4Z6CA 1VHXA 2BABA 4AHRA 2YY6A 1OXJA 1HI1A 3LF0A 4QQBA 5CQGA 3DLEB 4E7KA 3CTRA 1U09A 3HHKA 2VFTA 3M3ZA 1OPIA 4DUZF 3PFOA 3UN2A 2QA4N 5B8HA 1RWWB 1NG9A 2DD8S 1Z2ZA 2GMHA 2RE2A 3MMJA 3OT9A 1T3VA 2DHGA 3D67A 3HVTB 3BO2A 3A8EA 5LJVA 3V72A 2KNJA 5DBAA 1SH3A 4DLEA 2OKQA 5TZVA 4JK8A 2BW7A 3ZZRA 7ICFA 4JI1J 1WOPA 1N4LA 3DC2A 1BMQB 1C20A 1GH8A 1LW0B 1AT1B 4CLPA 2KJVA 1H38A 3UNYA 2HYIB 1Q86O 2O8BA 1NUEA 3IR7B 4NLVA 3NGTA 4BRDA 1VQ4N 2WAQC 3AB4B 1Q46A 3R27A 2HRTA 1MROA 2AF6A 3TZZA 3NAEA 4AQYJ 2VPZB 4PWDA 4QIVA 4A48A 3RMAA 2QMWA 1EIYB 1JL1A 3L6QA 2K8AA 1Q9YA 1HHQA 1X5SA 4ZVGA 3RW7A 1ZOLA 2KFNA 3OFGA 4DR4J 5BPLA 1WELA 4PG5A 1TELA 5FD1A 3WK4A 2CJBA 1TYQB 2GQ2A 2C2RA 3RU0A 4ZHRA 4F4WA 1RWXB 2BE7D 4ES2A 4CW7B 1BWEA 3THTA 3DRXA 1RG6A 3AGRA 4KTWA 4XQ8A 3X3UA 2XHBA 4EX6A 4I2AA 1RTJA 4WZQA 1MG7A 4B1UB 3LK9A 2K3KA 3V4MA 3FQKA 3OR1A 3LPUA 3VQ6A 3P4UB 2ZH5A 5DM7Q 2ISPA 2WBMA 3PSPA 2PN6A 2CADA 3UDVA 4ED7A 2HRUA 3AVGA 2R8JA 2P35A 2OH2A 5D46A 1WDDA 5KT4A 1WACA 5J29A 2HGLA 3PX4A 1RT2A 2FSKA 4P7TA 4DTUA 3J7Z5 2ZTDA 4TURA 2ALZA 3CJRA 1BQMA 1RQNA 4NLGA 2W03A 3KK2A 1P6TA 1JXEA 2BXJA 3I0SB 4EELA 2WW8A 3VENA 5HP1A 2XBPA 4Y65A 1G1XA 4FK0A 3FBEA 2R7WA 2VGMA 4K4ZA 4BUGA 1QDUB 1JN3A 3PYEA 1RT1A 5EGYA 5ETSA 2B21A 2CPFA 4DUTA 3SD7A 4MF2A 4Q5VA 2A1JA 2E29A 3CJKB 2YNGA 3RBXA 5C25A 4FSVA 2GC8A 3OHAA 2FLLA 3SMPA 4JI6K 2ROEA 3H20A 4ILMA 4I2BA 2KL8A 2RILA 5KT3A 2DR6A 3Q22A 2O3DA 3RW6A 1Y3JA 2QB1A 5B0AA 2R2TA 1XR6A 4JYAK 4LF8F 2YHWA 2NR0A 1X4BA 5A0YB 1N8RT 2P9UB 3RB4A 2IOHA 1V5IB 1D8YA 1MU2A 4BR0A 2IIHA 8ICIA 4GW6A 3SAFA 2KFYA 3LAKA 4TSXA 2E5LF 5AQZA 2CFXA 5DDYA 4RNHA 4N8NA 4JOUA 4NLSA 3NTUA 2Q31A 2CPRA 4DL7A 3CDUA 3W2WB 2UP1A 3ONNA 3UCUP 3BBFA 2J9EA 2IBOA 2J7WA 2NYIA 2RQKA 2K60A 1URJA 4I4BA 2DH7A 1JX4A 2RH3A 1W2IA 2WVFA 2O1PA 4O3RA 1A5VA 3AJDA 3WKBA 3KDOA 5HJYA 2G13A 4B8CA 3ID8A 3MURP 2PIIA 4BRFA 5KFKA 3D0HE 4ZJQA 3CJ3A 1S59A 3TI0A 1WC5A 1C0MA 4ZPWR 4C0ZA 2XHWA 2YQEA 3RZAA 3IM8A 1JMTA 1QE1A 3W66A 1H1VA 4XRHA 3CPWM 2O5DA 2FTRA 3IS9A 3JSRA 4PUOA 5KFEA 3HTVA 3O08A 4M3TA 4KH5A 1GOAA 3U26A 1QLNA 1FDAA 2K8BB 1HUXA 3UQ2A 1DGSA 3CJAA 4I1TA 3CIMA 2IOCA 2AX0A 3TARA 3RSEA 4Y28C 1B9FA 3I9ZA 4DI6A 2CNOB 1D3WA 4KC5A 2XG8A 1ZQZA 4I64A 1OKJA 1AQ6A 1ZD5A 2WOMB 3DI6B 5KOXA 4BRGA 2B9XA 1ZBLA 3MEDB 1NWKA 2ERRA 4BE2A 1S57A 2F2AB 1N56A 4JV5J 5KFFA 5AKLA 3Q8PB 4NLDA 3OUYB 2JWLA 3ZSWA 2XVTA 4HHHA 2IY5B 2LLZA 4EBDA 2B9WA 3E51A 4HLBA 1DXSA 5ETTA 4RQ6A 3UKUB 5ALHA 4YHHK 3EGZA 1PO6A 4DV5F 2YHBA 1ULRA 4JI0K 4CHNA 4MFAA 2PMHA 4N56A 3ZC4A 2VJVA 2LPEA 3T69A 3MN6A 1WSIA 3CQ8A 3QNOA 1LVHA 5F9LA 4Q8EA 4CLWA 1J54A 1U24A 4WYWA 3H4BA 2KB2A 3GDXA 2OGUA 3PYGA 1FX4A 2DK2A 4IKAA 7ICVA 4DV2J 2QTDA 1OH6A 5AKEA 3IM9A 3BY5A 2VPXB 3LVVA 5EX3A 2O8DB 2YX6A 4QR0A 4U8YA 3CCZA 4J9UE 4RW7A 3Q8RB 4PQUB 2Q36A 1X4FA 1IKVA 3VAFA 3TTDA 3DM2B 3TX0A 2HVDA 4C4TA 2LBOA 3D2WA 5HRSA 4CP5A 1VAZA 2GBZA 3DU6A 3P5BP 4I69A 2YV0X 1QUPA 4YORA 4CYUA 2ADCA 5AQUA 5B0GA 3CERA 1S6QB 4LF9F 4N7TA 4CJSA 2NRWA 5J1EA 3SQ0A 3K5OA 4F5QA 2E20A 2OPPB 4NXMJ 2W43A 3HFVA 1PK1B 3CE8A 3R9KA 4HL9A 1L3VA 3B6OA 4NRTA 4USTA 3FSYA 3U1NA 1JK9B 3BM7A 3FLCO 1KVIA 1U02A 4URGA 1F5SA 3CUNA 2NNWA 3CETA 4M7XA 3UXOA 1ZQKA 4DR1F 2MRLA 4PG6A 1KVJA 2BTFA 4FM1A 2XMWA 1C7YA 2FJXA 4K25A 3Q2TC 1KNZA 4FCYA 1DK2A 4CNYA 1GMUA 2WF8A 4DQ8A 1IKYA 3JYTB 4IOAQ 5BOMA 3K17A 3S3MA 9ICPA 4BRKA 2B6AA 3MEKA 1VLOA 2LSNA 3BF4A 3OVBA 4IBNA 5EWFA 2B5JA 5KT7A 1BNPA 4BGBA 2HOIA 1RHKB 2I6WA 3KLFA 1OQ6A 1FK9B 5DQIA 4BC4A 4LR8A 1ELOA 3TQ1A 3MM5A 2LDYA 2Z1IA 1F9FA 5CEHA 2WSEC 4QWCA 1MSWD 4RQ8A 1XNRK 4LC9B 5ALKA 3SSRA 3KFUF 1HKCA 4OCZA 1ZQQA 3S6JA 3RFAA 4PPDA 1F60B 3VERA 2LHTA 4W92B 3ZYYX 4DQPA 4AUKA 1WUUA 3V6DB 2ZHAA 1J2NA 1S1XA 2GV9A 4BE0A 4KLOA 3NVKA 1CZAN 3N01A 1VC6A 4O3PA 2AU0A 5KFCA 3B6PA 4P73A 4IG3B 5KTQA 1Y5NB 4CRJA 2KVCA 1U25A 1UFLA 3QGGA 3ETRA 4EGLA 3UIQA 3WDOA 2F7VA 3LM9A 1ED1A 2RDIA 4KGVB 2J9DA 4EHTA 1NK0A 5FPEA 1VYAA 4DMNA 2W3RA 2P9LA 3M5RA 2YHXA 1REGX 3NBPA 3EVWA 3GP9A 1IWGA 5HAOA 4FJNA 3K2PA 3H8YA 1FFSB 1UJ5A 1B64A 1UW9A 4DV7J 4UY8T 5E7OB 1H6KX 1R27B 4DOZA 4QZCA 3RBEA 4HTUA 3WEEA 4F93B 4PWWA 5L8RC 3F41A 2ZF5O 4KHRA 2H3EB 1PGZA 4PL7A 2F3NA 1W26A 3UPQA 4ECZA 3JXUA 3P38A 2V8VA 5ALZA 2RPIA 1Q95G 2A3ZA 3L2VA 1NNDA 4NYZA 5KPZA 1C1CB 2ZOFA 2GAHC 5HLFB 4BCAA 1UW4A 4ECWA 3DGPA 3SAGA 1VQPS 3TANA 1KXPA 2DITA 2ZIXB 2FYXA 5L1JA 1Y0HA 5HQ8A 2NUBA 2K8GA 3CGIA 4R25A 4OJHA 2KXNB 4HWIA 1S12A 4IFEA 3SXLA 2KQ2A 1N62A 4M2YA 3Q89A 4R8UB 3DLGA 4WU2A 3G4SN 3OPXA 1RQ0A 1X40A 4IDKB 2NYHA 4M9LA 5AKIA 2ES6A 2QARA 4FYWB 1ZQOA 1FJEB 4OX9J 1IJJA 3UCZP 4NCAA 3PUFA 1AZSB 4TU9A 4EBEA 3FCWA 7ICRA 2BA9A 3BYPA 3C6AA 1Q0NA 3I0RA 1QVGR 2Y8WA 4OX6A 3ULEB 1S0OA 3ENAA 4JI2J 2YWGA 1RHMB 2QLBB 4OPHA 2XIDA 4FM0A 4AHSA 1FDBA 3QICA 1H74A 4B9QA 4IO9L 2DNNA 2HHQA 3QFWA 3J80O 2KKHA 5D4PA 1VQ6S 3H5YA 4RQMA 3LA0A 3V4IA 3VAJA 3GDQA 1UWBA 1NOMA 1J5EF 1Y00A 2HFNA 1YVNA 3CJ8A 4C0HA 4NXNK 1D8ZA 3V81B 5LMUJ 2ASLA 2P9KA 2FPMA 3BGRB 1K73T 1WI6A 3FC9A 2K8CB 4M5KA 2FMPA 1PBAA 2DNHA 2C42A 2KM8B 3CMAS 3U3GA 4IOAL 1VSEA 1Z4UA 3KKFA 1JLGA 3DRRB 2B9EA 2VWKA 3EY1A 4LFBJ 1BC6A 5CYMA 2WSFC 3I5AA 2DGQA 3DLKB 3QT7A 3W2VA 2HIYA 1OVQA 2R8GA 4UBBA 3PSTA 1TL1A 2ZE2A 1HPMA 4CO4A 2HSEB 1MLAA 3MMCA 2W25A 3LTOA 1B70B 5HBMB 2V6AA 3J80Y 3MCOA 1IG9A 3TAMA 2VJ5A 3UCGA 2F9WA 4M63A 2FMQA 4ZVHA 1YI2N 1YIJN 3THYA 1IQTA 1M1HA 2F9TA 4QS7A 1XNQK 1A6SA 3M9MB 2OPRA 4Z6FA 2QWMA 1RCHA 3GCWP 2DO0A 1RBVA 2CQCA 4JI7J 3ZZOA 3OYJA 4LVOP 2Q3SA 1LCUA 3U8XA 4NCGB 3SNNA 2ZIUB 4DU3A 2HHTA 3J81j 4DUYF 2IOFK 4RW8A 1T8EA 3WX4A 2Q6CA 5AQOA 1YITN 3MDQA 1YRUA 4M45A 2PI4A 2MTLA 4KHWA 4ZVOB 5CHIA 2ZD1A 2A18A 2DEIA 2D1KA 2NLXA 1MN8A 1WEZA 2KG5A 4RX6A 1HNWK 3A8KA 2GQQA 1H7XA 2F8KA 3D68A 4QS9A 4A46A 2VG6A 4TUPA 1U1KA 4LR9A 3O1WA 3I56N 1WKJA 4EU0A 2Y1RI 2VCPA 3DXSX 3NFAA 1VQYA 3VALA 2CGKA 2IM2A 5KFXA 5KPRA 3RG6A 4B3OA 1G7CB 3TRGA 2BDUA 3QEAZ 1TL4A 2PSZA 3KK3B 1FESA 3R2DJ 4OLBA 2HLUA 4LF7J 3D5MA 1FKAF 1T9TA 3M2RB 3E66A 2FBTA 2O67A 3D2FB 5LL6Z 3C66A 4H5VA 3CC7S 1OH8A 1CJUA 4NLUA 2ZJPL 3ZZTA 1YJVA 3AD9C 2Z2LA 2MKYA 5AK4A 1HW9A 3ZSQA 2VHGA 4MH8A 2UVUA 1VRQC 2HBZB 1TKZB 5J2GA 5HATA 3MDAA 4WKRA 2Z1JA 1TAQA 3MN9A 2OTLN 2ZBQA 1I94K 4M3XA 5AQFA 3AFGA 4QJVA 5DM6L 3K0SA 1KVKA 4AT1B 2W41A 4ZCLA 4U67Q 4JWMA 3THWA 3R5BA 5KFYA 2XSFA 5D6GA 3Q8KA 4GKKJ 3DN9A 3SCJE 2DXDA 3ZSRA 5BPCA 3BR9A 3SR6A 1NH7A 2DHSA 2H3IA 1F9HA 4M47A 3LGNA 4NLTA 4BDZA 3SCLE 3TVYA 3RMBA 1Z4OA 3FDSA 2Y1JA 2GLEA 1TP7A 2P6TA 3EKUA 4ZP9A 4RUAA 1MN9A 4RBVA 2GHVC 4CLZA 3ZSZA 4DR6J 5IQQA 4FYVB 3DU5A 3LDOA 5AZIB 2J7KA 4LRBA 1S1VA 4FZVA 4I56A 1C0FA 4DV4J 2UUCJ 4OHWA 2X1BA 2DH8A 2WB4A 4FLTA 4I2QB 3N0VA 5LL6d 3E58A 3GG4A 4OJOA 1X4DA 1IKXB 1TUVA 3P83D 4LFAJ 1OYDA 3OL7A 4DQSA 4I2HA 2XLJA 2PY5A 1U49A 1U1RA 3QEIA 3W3SA 2NZCA 3CD0A 4K4HA 4JBCA 1UTAA 4M5DB 3E1YA 3HF5A 4HVJA 7ICEA 4CEEA 4H8KA 2BZFA 9ICAA 2H5EA 3VC8A 3ZZ0A 2ZJQQ 3BO3A 2BBEA 3AOAA 4UAZA 3KLHB 1FD2A 2JEJA 4X4SA 1QQ6A 2LMRA 3IP0A 2D3O1 3WXMB 1JIHA 3WXIA 3CCUN 2JX2A 4CZHA 1UPMB 4P0QA 4NA1A 3L3VA 3DLHA 2OANA 4CZEA 4A61A 2XS2A 1VQLS 2MKIA 5IIJA 1HBUA 4QZAA 2B8PA 3NF8A 1LFPA 3V9XA 2W9CA 4KLTA 3M32B 4DR5K 1SPBP 5AQMA 1YT3A 2RHFA 5D0HA 1E6YA 1KDNA 3DOLB 3CPEA 2E1EA 4KRWA 2XM3A 5BPMA 1CUKA 4GKJK 1TUUA 1O0PA 1JXVA 1HNIB 4DO9A 1IBMK 1HHSA 2AX1A 4OLOA 4DV3K 1WI8A 5I3QA 1WLJA 2LXFA 3OBIA 1NZBA 2KJWA 2QWRA 4ZJOA 4ILJA 2XSJB 4L74A 1F5BA 5EX0A 2AIRB 4B9VA 1URRA 3CDWA 2IRXA 2CZ9A 2IVNA 1P8ZA 3MD1A 4PL1A 1KN6A 1Q53A 3ADAC 3N6NA 3VF4A 1SS6A 2X6SA 1Q5VA 3CJTA 3ENBA 3PVXA 4Y0WA 2N4DA 4DU4A 1SV0A 2LQ8A 2MZJA 3QU7A 1IBLJ 2LKYA 3G6ES 3KHYA 4NLBA 1X6JA 1SJ1A 4PWUA 3ETLA 3WKAA 4WCEL 1TKXA 2VONA 4QZDA 4DSEA 2HHHJ 2LFVA 1X4EA 1VSFA 3CJ4A 4M63C 5D15A 1FJGJ 1GLBG 4YCXA 3OS1A 1RJJA 1WORA 4I2CA 2FJVA 3IWNC 1BI4B 3K7RA 2OHDA 4C98A 2C2EA 2OI2A 1Q78A 2OD6A 3AQOA 2QXLA 5HANA 1S6PA 3ETOA 1Z26A 2W40A 1JNRB 4NRUA 4OYIA 4B6JA 1QZ6A 1W7AA 2HPUA 4G1QB 4DV6K 2M7SA 1R8CA 2HOQA 3B0XA 3MXJA 4IOCQ 1SJRA 4MQ3A 2J0XA 2QN6B 4RPFA 4OX7A 4HUFA 2HMIA 3D45A 5AKYA 3KLEA 2GHPA 3L9ZA 2BE2A 2W2NP 4B1YB 4OKEA 3T7ZA 1X0PA 2BKNA 4LH4A 1HHTP 4FLYA 5A8RA 4Z94A 4DV1F 3ZDCA 4M9JA 2I0XA 4OGCA 1GLFO 3E2EA 2ZM6K 1ZQIA 1RUSA 2HMPA 1W25A 2HSZA 4IQUA 4TUQA 1GO3F 1X5OA 4PQAA 4CF9A 1QSSA 2CIMA 2AGQA 2DH9A 1N32F 5BXIA 3THXA 2HFZA 3UR0A 3T1AA 4X64J 2K06A 2WCXA 4FJKA 4I27A 4LR7A 5J0PA 4OZ5A 4DOBA 2Q2RA 1CS4A 3HX0A 1HD1A 4CFCA 3CB4A 1KFTA 1FRHA 3TFRA 3WK9A 1S79A 5DO2A 3EM1A 3OR2A 1FRXA 3MAAA 1JI7A 3TAPA 1XI1A 5J8YA 2O66A 2MKCA 2W2OP 3KMQA 3TTCA 2WB1F 4MEYA 1ASWA 2DGZA 3UKRB 7ICHA 3O4NA 1W2BM 4IH5A 5JMNA 1XK8A 2W9MA 3O9TA 3MAHA 3HHNB 4PPXA 1U47A 4LFCF 2EKNA 4KIAA 3MGHA 4ZVUB 4V19X 1CPZA 1XNSA 4DV0J 3QIPA 4NLOA 4MLEA 2VA2A 3MCPA 2ZJQL 5GTIU 2C2NA 2FHJA 3H8WA 3IBPA 2RB7A 4AHCA 1ZRMA 3JPOA 1RAFB 1GMVA 4PG8A 4X65J 4Q8FA 2BE9B 2KOBA 5BRHA 3RR7A 2BQ3A 3IGNA 1S0VA 3ZZPA 4LSNA 1LOUA 4C23A 2QX0A 2MQMA 1YHQN 1KL9A 5TKWA 1WNSA 3IHQB 2E8NA 1P8GA 3M7VA 4JKGB 1SIZA 2EFOA 3AT1B 1SJ4P 2XS5A 4ILGB 1NM2A 1UAWA 2FDRA 1DRGA 3PIOL 1PZNA 2O8CA 5FDLA 4R79A 2I7PA 2BV3A 4JKBA 3HI9A 9ATCB 3OYCA 2ALYB 5HK4A 3K8VA 4CF2A 3KFWX 4Z4EA 2GWSA 2UXBF 3FUYA 3V6JA 2F8SA 3OSPA 4C7YA 4NLKA 4HCCA 1LKZA 5LJ5Y 4DWIA 3HT0A 4GFJA 5F2RA 6FD1A 4DF8A 5T7LA 3ITHA 4PEOA 4IJAA 1HNVA 4YR0A 4GVBB 1RT6B 4RWTA 4PZNA 3EMTA 4DPUA 5J2BA 4DTRA 4ID5A 4JI3F 3JSBA 3ENHA 2HAFA 2L5YA 4FWLA 4F4YA 1H7WA 4KHPF 2DO4A 3ISND 2QXFA 1FTCA 3VQAA 3C0BA 4CT9A 3BGFA 3VF2A 4K8ZA 3W9JA 2CPDA 4FZZA 3AN1A 1TV9A 3KDNA 2XLIA 3QRQA 2KZZA 4QZ8A 2HQIA 4CJEA 3U02A 1N8RO 4PGYA 4RPXA 2JEGA 3BO4A 1U2VA 2ASOA 1WBDA 5DGAA 5J0SA 5FLXY 5I3UA 4O0JA 4C1NI 3BUZB 1CG2A 2G9OA 3BSAA 1MQ2A 2QYGA 1V3RA 2CNLB 3TO8A 3G71S 3ZT0A 3PW2A 2RQCA 2RIJA 4OZLA 5KFUA 3GIRA 3C7NB 3QAEA 2F3JA 3A8JA 1IVZA 2HHWA 3AO4A 4C97A 4QU6A 2HURA 4IOCL 4QZIA 3PLAA 2PZSA 1H3DA 3W63A 1DK3A 4H0TB 2F8EX 1YZ6A 3PMLA 4Y3CA 4F2RA 1B3TA 2WHOA 3D6HB 2JWNA 5M2PA 2RRBA 4CJ5A 1LWXA 1T95A 4CTAB 4LF8K 2DUYA 1FNXH 5CP2A 4HTJA 3ZXWA 1F0MA 1CVJA 4OKKA 2XO7A 2OM6A 4B3RF 1QHTA 3O3FA 4PZOA 3V9ZA 5CYJA 4DCCA 3M2UB 4TNOA 4O0NA 3CHWA 1ZOTA 3W5XA 3A4TA 2E5LK 3MGJA 1NJYA 3IKMA 8ICEA 3TUPA 4O8KA 2B4OA 4I6MB 2QLJB 1HBOB 4A8KA 5KFAA 2RLTA 1NGFA 2A6AA 2F63A 2QL9B 3QYPA 2K4IA 4CEOA 3SI8A 1EQMA 2GHWA 3L7UA 4UB2A 1RT5A 4CFAA 2EWSA 2GX8A 3PMNA 3ZETB 1FD8A 4M5IA 2YMMA 5JS2A 1TFYA 1C4CA 4Q7AA 1QAJA 3CQXA 1V9PA 3AVJA 1GT8A 5H2FU 4ECTA 3F0NA 1RZMA 4EYHB 3FEYB 1IIPA 4MEXA 1Y7PA 3GWCA 3GR0A 4GXKA 4URQU 4FNIA 4EIAA 3KWGA 5C42B 3LPYA 2CGJA 3H8JA 1F2GA 1JJHA 1GXTA 1JJ2M 4DFKA 2GIFA 5KAFU 4N8OA 4RW6A 2H5JB 5K5MA 2ZG6A 2HQCA 1HYSB 1RAHB 4Y00A 1P9QC 3HD2A 1I1GA 1QH9A 1CJKB 1EWRA 3R6LB 2QM1A 4RL1A 2CQGA 3I82A 4J9QA 4EBCA 5DLFA 4KLSA 4KSEB 3C16A 1V85A 1UT8A 4UQGA 4OI0A 2K2PA 3NGRA 2VWBA 3WZ0A 1NU4A 1KD1T 5AICA 4DR3F 3JPNA 2CQ4A 4IG0A 4OI1A 2DY1A 3ZZUA 2IHMA 4OYOA 3GPAA 2WVBA 4FJXA 3OYAA 4OYMA 4ANEA 2EFGA 4B3TF 1HR0F 3DXKB 1KQQA 4L3QA 2HVZA 4LF5F 2MKSA 5CCLA 1YLXA 5E79U 3IFRA 3CCJS 1YJ7A 1SXLA 5LSOA 1BDGA 3QLHB 2E66A 1T7PA 5J8YC 1SKWA 2JV3A 1ZTTA 4OPKA 1GLLO 3RUBL 2UUAJ 4KREA 2BR0A 4BWJA 2QL5B 5BPNA 2Z0GA 4C8LA 5LOQA 1G99A 2IHNA 2N7YA 1QAIA 3I1YA 3RF9A 3KJQB 1NHKL 3JSMB 4DV2F 1QQNA 1KLNA 2DFHA 3MR6A 8ICBA 3ISZA 2F4VJ 5AQGA 3AA3A 3VA0A 3R5JB 3R3TA 2ZHOA 4KRFA 1RSCA 3BH7B 3K5PA 3JPPA 1CJTB 2VC1A 3QT6A 3M05A 3DRYA 3F5TA 2UUBF 4I2JA 2LEAA 4FJMA 3M8SA 5GMKa 4H4MB 2ZJRL 3JAMU 4CIFA 2ZH8A 4W90B 2E44A 3E8OA 1C0GA 2ZUGA 2L9NA 3IRUA 2KHDA 1U1MA 2VFVA 2QEXN 3N6MA 5CD4H 2G2OA 2IC3A 1U2CA 1FEHA 4DTMA 1S9GB 2DIUA 2MLZA 4CM2A 2ZDOA 4LSLA 2ATLA 1K47A 3P49B 1S99A 4M04A 3LP2A 3DWLA 5ALQA 4JI5F 3EE9A 3MFHA 3G87A 4I2PB 5F3ZA 1NDCA 4YDXA 3EUNA 4LF9K 2HG4A 1LNQA 2ZNYA 1RYRA 2W2MP 3FVYA 3VGLA 4WU3A 3UMCA 3V2UC 2QZ8A 1W0HA 2CH5A 1RTHA 1UCNA 4U9RA 2OPQB 3I31A 1S8OA 2KG1A 4XEIA 1FA0A 1FWKA 2VU5A 1H98A 5AI8A 4IO8A 3D7SB 1T9YA 2LVWA 4U7UD 2ASPA 5A8KB 1XIQA 4NZ7A 2UV8A 1XHXA 4CNQA 3VTIA 4DR1K 3IAM9 5DDQC 2PFDA 2KICA 3AA2A 1N0VC 5E3RA 1WYGA 4QWBA 3U1MA 3QUCA 5EN1A 1Q3UA 2EZZA 2DRBA 1R8BA 4G6VB 3MCNA 2W8KA 5KT2A 2F76X 3O6QA 3SK3A 3C95A 2ZDPA 3FM9A 2O8FA 2W2QP 4KN7A 4QIFA 3EGVA 1U6FA 1UPPA 2UXDF 2RMLA 2ZBCA 2YMPA 2P51A 4C0OC 4LJXA 1JLCB 2RVJA 3R5GA 2AZ1A 4TVAB 1N60A 1NGGA 4DOAA 3K58A 1QQCA 5GMEA 4YY3J 1XTZA 3QXGA 3TZXA 1SXDA 4FZNA 2KD1A 2RHKA 4FK2A 1L5UA 4J2EA 3I9V9 3J7YI 4UY8O 2VUGA 2ASDA 1N36J 3AVMA 4ZCMA 5IC6B 2KVQE 8ICYA 3C6TB 4XDDA 1HUOA 5L39A 2UXCF 2V4JB 1X9JA 1RT7A 3AVCA 3NVZA 4TU7A 3BQ7A 3GG1A 1IR0A 1L7OA 1LWEB 1ZS6A 3RJIA 3VOVA 4P0PB 2G5HB 2M88A 4BACA 1NAQA 2M52A 2CQDA 2M8DB 1MWKA 4KLIA 3VTHA 2CQHA 2GO8A 4IO1A 1RT3B 3ZDBA 5MLCV 3MMAA 1Z00A 1Z3EB 4F7VA 2V69A 5IXUA 2RN2A 3CCLS 4H4OA 2QWPA 3D6FB 2R8KA 4ES1A 4Q43A 4I2EA 2MMYA 1UJ4A 4ZH4A 5E3QA 3TUJC 2G1HA 3GSDA 2VKRA 3CFOA 1XERA 4EFHA 1C0TB 3CMQA 2P9GA 3EDQB 4M5JA 5AKZA 1ZD4A 3C28A 2CWXA 2KT2A 3QPIA 3T1YJ 4LBPA 1OH5A 5BR8J 2V68A 3ENQA 2BYCA 4WFNQ 3QNNA 4B3MF 2RF2B 1BG3A 3QFPA 4O3SA 3KD1E 4PAAA 2LMIA 1C0UA 3LP1B 1R7IA 4ZPBA 2HHVA 2VQFJ 4W5NA 4OX9F 2QKQA 1UEVA 2E7XA 2FZKB 5D3GB 4QCLA 3D2EA 4KQZA 4FZMA 4CM0A 3CJ7A 1VRTB 1GLAG 1WD6A 2OMLA 2X3GA 4YB5A 4B1XB 2PDAA 2LDIA 1VQOS 1VSMA 3HL8A 1HQEB 3KWIA 2HMXA 4WFBQ 4DR2J 2J0QD 2GIQA 2KXHA 1VQMS 5EE9A 2ZOMA 1NGDA 4HHUA 3O9QA 7ICKA 2WAQF 3C14A 1Q7YT 4EI2A 3HHLB 1D8BA 3PZPA 2RAQA 1QCKA 3PTWA 2CPZA 2VD3A 5M2UA 4Y1CA 1HFEL 3EZOA 4IL6U 3M2VA 4IKFA 9ICSA 2E2OA 4PHDA 5D4LA 4DG1A 4CHPA 9ICVA 3CCES 1VQ5N 1OSDA 4NPOA 5CY4A 1J53A 1KHWA 4TY8A 5B0DA 3ET6B 4CIOA 4LRDA 2IVMA 4DXLA 1S10A 4KGZB 1U7LA 2CRLA 1VQSA 2LYBA 2CG8A 1BA0A 3WK5A 1R59O 1DRZA 3FFIA 4JP8A 1N34F 1V6HA 1CLQA 1TVRA 3OTQA 1SI9A 1J5EK 3KD3A 3PX0A 2FLOA 2D0OA 1XMOF 1B0VA 4JUZA 4RQ3A 9ICUA 1I51B 3NRWA 3WC2A 4CNZA 2KJ5A 5GINA 3ILIA 3HO1A 5DKWA 2BACA 1V3SA 1N61A 5GADI 2KSOA 4YOWA 3OS2A 4QBUA 1VFJA 2RP5A 3KJVA 4OX8A 4FZLA 2J7UA 4ANDA 2R7YA 1HI0P 3IR6B 1M5KC 1NSQA 2NUUG 4DMZA 3OLBA 2BRLA 4OJ6A 1SL2A 3PFEA 3HT3A 3QRRA 1ZBHA 1FKOA 4RQNA 5AKXA 2IVYA 5C15A 1XC9A 1X31C 5DB8A 1TL7A 2VG7B 3H2LA 4H54A 5ALDA 2W4DA 3I55N 4N77A 5CZXA 2XZWA 4KB7A 2HNYA 2BJDA 3ZT4A 1SWVA 2YPYA 2QT7A 1NRKA 4OJ5A 4QZBA 1QQMA 3QYYA 4JI4F 2GVDA 1SIWB 5K9FA 4PXDA 3SSSA 4M3ZA 1V4SA 4WFXA 2NRTA 5ETQA 4DUYK 4ZCIA 4AP9A 4FFDA 2W3SA 5KL8B 1VC0A 3FRZA 4WIQA 3P1GA 4GV3A 9ICTA 3PACA 4IDHA 5HL7Q 1FW6A 2JLGA 2E1CA 3AAPA 2DNKA 4MYTA 2NS1B 5KGXA 4FKYA 2WSCC 4JN4A 4F91B 2AYEA 1ECWA 2PFFB 4CEQA 1AW0A 2ZVSA 4ED6A 4W5RA 4FLZA 3VQTA 4X66K 3GZ7A 2FHOB 1A5XA 2AKWB 4UZCA 5EDWA 1YJWS 3B8HA 2V2VA 1N5VA 1XO0A 1GOBA 4CO0A 1BE4A 4H03B 3TX8A 1LW2B 1S72N 2BJ7A 1NMDA 2B9YA 2PA8D 2QG9B 2KT5A 5AZJB 2WHEA 4EENA 3RWUA 5AKKA 4ZPAA 2XHCA 4JI6J 4ZA1A 1F1BB 3BPDA 5J1NA 4G9ZA 2MLXA 3L8BA 3A8IA 4FWMA 4X4VA 4C48A 4B9TA 2DXEA 2OEKA 3RAXA 4JYAJ 2HHUA 5JVGQ 2V4QA 1BISA 5AM3A 3VVUA 4YB6A 3ILOA 3HHDA 3NH2A 2IJFA 4BC3A 4YMMA 2OWOA 3ORYA 4C8MA 3R2CJ 3BQTA 2V9WA 4RW4B 3JQKA 3KJNB 4M8LA 3A12A 4DU1A 4M5LA 5ALVA 4CZGA 2GTDA 1YJRA 3H0LB 3AD8C 1HYZA 4CF8A 2F8TA 5BYQA 2HGNA 5GAGI 2QFJA 4H0VB 1L7MA 1BPXA 3BF3A 2FD2A 2D6FC 1KCFA 4ZN1A 1U2FA 4LRFA 4DEZA 2DTUA 3CI5A 5DBBA 5AM2A 1KC8T 4CE6A 1NBWA 4K4TA 2WB1D 4FPIA 1U45A 2QLFB 3MXHP 2D0PA 3ZDDA 3CCWA 1N5TA 3R97A 5A6PA 1ZD2P 4DR7F 4WF9Q 4J2BA 3QGIA 3MUVP 4MO5A 3T6BA 1Z19A 2DGUA 2I5HA 3UB5A 4ILLA 3OHBA 2AJ0A 3MCMA 2A1RA 5KNIA 3DOMA 2H5IB 4LRAA 3EE3A 3LP0B 4ZCKA 2FVPA 3WNGA 4JD2A 3L2UA 5J2CA 1A77A 5DDPC 1PVPA 3FZBA 2DR7A 2QI2A 1RA7A 3RJHA 2RS8A 4KT0C 4CHZA 4PGQA 4MYUA 4O9MA 1RYUA 4OO1J 2BQUA 3DLEA 4E0DA 1D5AA 2QMUB 4WFYA 3DDNA 1VQKS 5IC4B 5HJXA 1FF2A 3I8BA 1RI7A 1GXLA 4LD0A 4GV6A 4CFDA 2LQ9A 3HVTA 4JRQA 1S9EB 4RW9B 1IR1A 5M1PA 5AK5A 1W97L 3S6EA 5F8IA 3MECB 2K89A 4YHHJ 1CLFA 4FW1A 4F71A 4JI0J 1NGJA 1Q9XA 4QIWC 4FWKA 3E01B 2H3QA 5ETKA 1YRXA 1PK3A 1LW0A 1F6TA 4CJVA 1RAEB 2Y9UA 3PSIA