4DQSA

Binary complex of bacillus dna polymerase i large fragment and duplex dna with rc in primer terminus paired with dg of template
Total Genus 211
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
211
sequence length
579
structure length
573
Chain Sequence
b'KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase
molecule tags Transferase/dna
source organism Geobacillus kaustophilus
publication title Structural factors that determine selectivity of a high fidelity DNA polymerase for deoxy-, dideoxy-, and ribonucleotides.
pubmed doi rcsb
total genus 211
structure length 573
sequence length 579
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4dqsA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4dqsA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4dqsA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4dqsA01
3K5LA 2VG5A 2G8HA 4OGCA 3RRHA 4JLHA 5HRNA 1VSLA 5KFUA 1HYVA 9ICHA 1ZQLA 5EOZA 1X1PA 4KN4A 4FBTA 3H08A 3VQPA 4DTSA 4TQRA 3C6TA 4DMNA 3V6DA 3SUPA 2J6UA 2HVIA 4H4MA 2B6AA 3UQ2A 2V4RA 2JGUA 3M9NB 1B22A 1L3VA 2XY6A 4AHCA 2W9CB 4QZHA 3FFIA 1IM4A 4CJ3A 1HMVA 5KG3A 3C5GA 5KFFA 4F2SA 2FLPA 4RU9A 2ZUDA 4I2QA 3HVRA 2ZTCA 5KFAA 3HO1A 1F21A 4DWIA 4OKJA 4CGFA 1SKWA 3T19A 3SUQA 4RQ5A 5J2HA 3SQ0A 1VSHA 1NOYA 3G6VA 1D9FA 2FPKA 4FJKA 5TZVA 4RQ7A 2DFHA 4LSLA 2Q3SA 2HB5A 4CFBA 1UWBA 5K14A 3K4GA 1C6VA 4J9QA 1WSFA 3T5JA 4J9KA 4N41A 4KFBA 5KGXA 4OLAA 3SI8A 4LD0A 1HJPA 3TAPA 4OLBA 1ZQNA 2ZJAA 1BPZA 4HVJA 1BISA 2IAJA 5JUMA 3KLEA 4CJTA 4CJEA 4PGXA 3HL8A 3P83D 2W8KA 5KFMA 9ICMA 4JV2A 3PVXA 1D8YA 4IR1A 4HUGA 3VQ8A 2W9BB 4DU3A 1BVSA 1KFTA 3SZ2A 3MR2A 3RRGA 3V72A 3ASMA 4KLOA 8ICCA 2C28A 3VQAA 2A1RA 4M45A 7ICNA 1XI1A 5CJ7A 4CJLA 4CHZA 5T7BA 2J6TA 3KIOA 3JPQA 1VSDA 3LZIA 2R8KA 2YV0X 2ZJ5A 4I2AA 3OY9A 4OVLA 4FJJA 8ICRA 3ZD8A 1HUZA 5BPCA 3HYFA 1KLNA 3K5OA 2QKBA 4Z0UA 5HNKA 3UQ0A 4W5QA 4W5NA 1L3SA 1SKSA 3GIMA 4Z4CA 3H8JA 3C5FA 1WSGA 1HRHA 5KFKA 5HBMA 3C2MA 3RJHA 4YFUA 1DTQA 3KHGA 4BDYA 1SL2A 1X2IA 5DB6A 8ICFA 2MUTB 5DQIA 5KFBA 4UAYA 4FK2A 2XCAA 2P5OA 3AVMA 3RR8A 1TVRA 4F2RA 1X9MA 8ICIA 3H8WA 2R8GA 9ICLA 1BI4B 2RF2A 1RBVA 4B9SA 5HRRA 3BQTA 3A2FA 4DU1A 3BJYA 3TAMA 5KFVA 4GXJA 3VQEA 1U49A 2HHXA 3O4QA 4MFCA 3RB0A 2Z1JA 3LANA 4CEBA 4DTXA 2ASDA 3RB3A 4ED0A 5DLFA 3DM2A 4KLMA 4YR0A 2H5XA 1WNSA 8ICJA 3C94A 5KG6A 3UPQA 3JPPA 4NCBA 1U04A 4LH4A 4M2YA 3TFSA 3V9XA 1WCNA 5KFOA 5DB8A 2ASJA 9ICPA 4FBUA 1IG9A 2KW4A 3KLFA 4CEEA 1RPLA 1ZQAA 9ICBA 1NJWA 3OYDA 8ICBA 1VSEA 4KI4A 5L1IA 2LYHA 3QZ7A 1DGSA 3RMDA 4X5VA 3LP0A 2Z1IA 2LSNA 1C0TA 2RPIA 4JRQA 4YR3A 3V9SA 1UT5A 4F5NA 1K1QA 2B4JA 1XSLA 1SUQA 3L2RA 4DTOA 1NK4A 3ZDAA 1TK8A 4M9HA 1LW2A 4BE2A 2WTFA 4E7JA 7ICRA 1ZBIA 3LP1A 1IKWA 5HMLA 1RDCA 4DQRA 3EPGA 8ICOA 1ZQWA 1A5WA 2DFFA 1BPBA 4J2AA 1WAJA 1WSEA 2VG7A 9ICTA 4N56A 4UBBA 4DSEA 4NM2A 2EHGA 3H4DA 2XHBA 3ZSZA 5FROA 1XSPA 4RW8A 3KLHA 3OYGA 4DSKA 3ZD9A 3PW4A 1T4GA 5KFXA 1T03A 4O3PA 4I2HA 2FPLA 1T7PA 3JPNA 1QQCA 4KO0A 1WCLA 2J6SA 1EX4A 3PR5B 1TKXA 3IAYA 4YFKA 4M0AA 1HUOA 4I9QA 4RW4A 5DG7A 4Q8FA 2BGGA 2WONA 1ZQPA 8ICWA 4FYDA 8ICSA 4DTRA 4F5RA 4IRCA 5J29A 3AO4A 3H7IA 4DL3A 4NY8A 1T05A 4DG1A 5J2MA 4F5PA 4DS5A 1NK5A 3C1ZA 1CZ9A 4DQQA 2PYLA 4ECTA 3SPYA 4FS2A 1QSSA 4PQUA 4LZDA 4QZ9A 3SI6A 1VRUA 5F9NA 2G8KA 1X9SA 1V9PA 3SNNA 3RMCA 4PHDA 3OJUA 4J9MA 3PW2A 1LAVA 4ED2A 4RW6A 4B9MA 4B8AB 3LAMA 3I8DA 1D5AA 4FLXA 1S0OA 4CF1A 4MFAA 2OPRA 4M9NA 2OYQA 2JEFA 4B9NA 4K4GA 4LZGA 2R8JA 3LAKA 3LZJA 3Q8LA 1RBUA 4QZ8A 4GXIA 4B8CA 1D9DA 4XRHA 4FW2A 4O3NA 4QZCA 1BI4A 1FK9A 3AO2A 3ZT3A 4XUSA 2FBTA 9ICQA 4YN4A 2PFNA 3IRXA 1GOBA 4I28A 2F1JA 2BE2A 1ASUA 3V1RA 2XGPA 3KKRA 5KT6A 4QWEA 1D8LA 3AVJA 4ID1A 4CEZA 3H8SA 1SL1A 2WOMA 4QWDA 5SZTA 1FKOA 3ZT0A 5DK5A 2FMQA 1AROP 3MR3A 4CGHA 2QKKA 2ZTEA 4CJKA 1UAXA 3OYLA 3KK3A 4Z6FA 3V9ZA 1WSHA 4FJGA 2VA3A 1NKEA 3HT3A 3AVIA 3WNEA 1XSNA 4CEQA 4YXJA 3RB6A 3VQDA 4CGGA 1ZQDA 1T8EA 4BE1A 2P5GA 4BGDA 4E7IA 3AVKA 4KI6A 1RZTA 4NM1A 3H4BA 1S0NA 3HJFA 3RBEA 5J0QA 3QE9Y 1KDHA 1ZQEA 4DSJA 4CCHA 1EKEA 1NJXA 3E01A 4ECYA 2DPIA 4JUZA 4Q45A 4I7FA 1VSIA 3RJKA 2C22A 1ZQYA 5DBCA 3KHLA 4KN7A 3K75D 2HHWA 3AO5A 4Q44A 3GIJA 2KFZA 4YQWA 3K5MA 4B9TA 1MC8A 4I2EA 3ZSYA 1RBSA 5I3UA 3EY1A 3NH0A 2X6SA 3BQ1A 2FMSA 2JEIA 2AGPA 3CFOA 4O5BA 3OHAA 3QLHA 2F96A 3PW5A 1IKXA 1BPXA 3OVNA 4Z4FA 4FM0A 3MEGA 3MABA 3AVAA 1Z25A 4F4WA 4O44A 5J2FA 4NYNA 3RBDA 4CJQA 4KKOA 4M9GA 3NGIA 2ATLA 3LWLA 2W9CA 4ECWA 3QESA 2KZ3A 4IBNA 2OA8A 1L5UA 3TR8A 1ZQVA 3M9MB 5J2QA 3EW9A 2ISPA 4CHPA 3NCIA 2Z1GA 1EETA 2FBXA 3T1AA 2R8HA 3ZSWA 2GBZA 4IQWA 1I3AA 4KHNA 1HYZA 5SWMA 2ISOA 2KZZA 5HROA 1BL3A 1VRTA 5KFZA 5J0YA 2OPQA 3I0RA 2BPCA 4UAZA 1QE1A 3I0SA 4CK2A 2DFEA 5J2CA 3CFPA 5C5JA 5CY4A 4CEDA 4ECXA 3AVNA 4CJVA 4H4OA 5DG9A 4YD1A 4UBCA 1ZJMA 1XHXA 2G8VA 3SQ1A 4BWMA 4TUQA 2ZUCA 3AUOA 1RTJA 4RNNA 5HHIA 1RT6A 2BGWA 4CEFA 4QWAA 4NCGA 3MEDA 1S9GA 3V9UA 3L2QA 2FPMA 5KFCA 1BHLA 3RH6A 3ZSVA 4CHNA 4TURA 2MUTA 3L2WA 4RW7A 3MAQA 4YCXA 1MQ3A 3M8PA 2BCRA 4KLUA 3OYAA 4FLVA 3OJSA 1JKHA 3GIKA 4AHSA 3PMNA 1KVAA 4EYIB 3MECA 4CGJA 1J5OA 3ZDEA 2ALZA 4YD2A 3KKSA 5FDLA 1CEZA 4RUCA 4EP5A 4ELTA 1TVAA 2C2EA 3C95A 4E89A 3PO5A 4O3OA 5KFNA 1WSJA 2PY5A 4CESA 2G8UA 4IG0A 2UVUA 3SV3A 5KG2A 2A1JA 3OYKA 1ZQZA 5J0UA 3MXIA 2YNHA 3PW7A 4CJPA 3D0PA 4PA1A 5KG7A 4AHUA 4ZHRA 2RDIA 5KRSA 3M8SA 1ZQRA 1DOQA 4DSLA 4FJLA 3OYCA 5IINA 3JPTA 3OS2A 3V6KA 4M04A 2F8SA 4I2FA 4KTZA 1JIHA 1C7YA 4DS4A 1YTUA 4ECZA 1IKVA 3DRRA 4C8MA 3ZDBA 2P51A 3C6UA 5DGAA 1B9FA 4Y1DA 3HWTA 4AH9A 1T3NA 3ORYA 7ICUA 3TAEA 3NF8A 4J2EA 4JWNA 9ICOA 4R66A 1HNIA 1TKZA 3NF6A 3ZDDA 1JXEA 3C23A 3G10A 9ICXA 1JXBA 4ED7A 4CIFA 1ZQCA 8ICGA 4KLTA 2JZBA 1K6YA 9ICSA 3OS0A 5J0SA 1C1BA 5DQGA 1UA0A 4J9OA 2ZD1A 8ICXA 1ZQXA 5KG0A 1ZBFA 2Q0ZX 4ED8A 4EZ6A 2OPSA 2AJQA 1JMSA 1C1AA 4IFYA 3V7KA 1TAQA 4M47A 2BCQA 1Z00A 3FDSA 4F92B 3Q8RB 1TAUA 5I42A 1JLQA 1JLEA 4RQ0A 3NBPA 3HP6A 2HVHA 2KZMA 3RWUA 2G8FA 1KTQA 4M9JA 2IS3A 2P6RA 3RJGA 1HNVA 4CIGA 1S5JA 1Y88A 4QZGA 1S0VA 5J2DA 2OWOA 4BXOA 3CM6A 2YNGA 4OPKA 3OSPA 2ETJA 4DU4A 4FZXC 4E0DA 1KFDA 4CJFA 1RNHA 5EWEA 3VA3A 4K8XA 4Q5VA 1TL3A 5F9LA 3LP2A 5J2EA 4I2BA 4CK3A 1XHZA 4MEXA 3AVHA 2VG6A 1G15A 3VQQA 1GOCA 4RQ1A 5C25A 7ICSA 1ZQIA 1KVBA 2YNIA 3RJEA 3C2KA 4DL2A 3SQ2A 3RAQA 3ISCA 3ISNC 7ICIA 5HRPA 5DB7A 1S76D 1REVA 4JV1A 2I1QA 9ICVA 1A5XA 3LDAA 4RNMA 3RJIA 3AU6A 5CR0A 1S1TA 5DQHA 3S3MA 3BDPA 3AO3A 3RR7A 3NF9A 2JZBB 1KVCA 2HHTA 2HHUA 4W5TA 3OYMA 4GVMA 3L2UA 4E3SA 4KLFA 3SJJA 1XS9D 4KHSA 3OGUA 3DRPA 4R8UA 4KLIA 3MEEA 2C2DA 1S1WA 5J0OA 3MR5A 3QERA 2XGQA 1Z3EB 4ECRA 3SQ4A 2EX3A 5HHHA 4ZTFA 1RT7A 2KN7A 3ZSOA 4PWDA 3AA5X 2NRWA 5KG4A 4CF2A 4TQSA 2F1IA 4XQ8A 2RDJA 2BCVA 4DTJA 1BPDA 4QZEA 2E6LA 5CZ2A 5J2IA 3V6HA 1KSPA 3UIQA 4FVMA 1PZNA 2PXIA 3SYZA 2E4LA 9ICKA 1RYSA 1QSYA 9ICAA 4GW6A 2UVRA 2AQ0A 4ICLA 4MFBA 5JS2A 3KJVA 4KHUA 3GILA 4DL6A 3QEAZ 2W8LA 4BDPA 4F3OA 2X6NA 1RBTA 3ZSXA 3HX0A 4DF4A 3OHBA 3V1OA 2QK9A 4KLDA 1XU4A 4K4HA 2IHNA 1TKTA 4DOBA 1ZQMA 4RPXA 1QLNA 4IG3A 1RDBA 4Z6CA 1JL1A 2G8WA 1S0MA 3QNOA 4KLEA 5KTQA 3MFHA 3QEVA 4M3XA 4UAWA 4GXKA 3FYHA 4I29A 2PI5A 5KFJA 1ZJNA 4C8NA 1TGOA 4B3OA 4RQ3A 4Z4EA 4QCLA 1NK9A 2X78A 2BDPA 7ICMA 2ZQBA 2D0CA 4CJWA 4OKKA 5KFRA 4FLWA 4QZDA 4RUAA 4XIUA 4J9PA 4H8KA 4BE0A 8ICMA 4EP4A 4YNQA 3QEIA 4NYFA 4QZFA 2FBVA 4E1NA 3LPUA 7ICOA 9ICRA 5L1JA 3AU2A 2I9GA 5CP2A 9ICCA 3AA4A 2VA2A 4R5PA 1RDAA 2VWJA 1S6PA 5J2KA 1HQEA 4NLZA 3OYNA 3TI0A 3C2LA 4RZRA 9ICNA 2DY4A 2OZSA 2XO7A 1Z26A 5DMRA 5KFHA 8ICVA 4N76A 5J0RA 2BPFA 2PFOA 5KT7A 3AO1A 1HJRA 4W5OA 3HSTB 4M6WB 7ICTA 1QS4A 3DMJA 3UXOA 5FRNA 1H38A 1LW0A 4QZIA 3JPRA 3O4NA 3GFKB 4M9LA 2YHBA 1LWCA 3DLHA 4O5KA 3E2EA 7ICJA 2AU0A 3AVCA 3MDCA 4I27A 2HW3A 3PX0A 1Q9XA 5DDMA 3RTVA 3VQ4A 1U4BA 1HPZA 1K1SA 4OKEA 3DLGA 3UXNA 1ZQHA 2ITGA 4KLHA 4HCCA 1N56A 3RAXA 4J9SA 3M8QA 4CECA 7ICVA 3H40A 1LB2B 1Q9YA 4KMUA 4DLEA 4QZBA 2FLNA 3ZCMA 2PFPA 3B0XA 3RJFA 5D3GA 1RT2A 5CA7A 3QEWA 3MGHA 4IQVA 4O4GA 3NH2A 4P4PA 2DFLA 1JXLA 2HHSA 4W5RA 1WSIA 1ZQTA 4K8ZA 3DRSA 4J2BA 1YT3A 4I2IA 1RILA 4Q8EA 1C0MA 3M9OB 1JLFA 2XCPA 4M3RA 4FO6A 1ITGA 3VN5A 2OZMA 3VQ7A 3LALA 3ULDA 1S1UA 4R8UB 4FJXA 1ZQJA 1B43A 2RN2A 2PZSA 3CG7A 5KRTA 3RMAA 3WNFA 4IKFA 1ZQQA 3U6FA 5DB9A 3TFRA 9ICUA 1A77A 2YNFA 1BIZA 3HPOA 3T3FA 5HP4A 3HK2A 1RXVA 4K4IA 4MFFA 5KT3A 1J53A 5KT2A 1QHTA 2BPGA 7ICEA 1S77D 5J2NA 4EEYA 2IA6A 3IG1A 3JPOA 8ICTA 3ZSQA 3VQ9A 3NGZA 4OJRA 4GC7A 2HNDA 4RPYA 4QW8A 2VANA 7ICFA 4RG8A 4HHTA 3TWHA 1FXXA 4XA5A 3T5HA 3AVGA 3PR4A 4UB4A 1KEJA 2O4IA 1BPEA 9ICIA 5CWRA 3GDXA 3KHHA 2XY5A 1SKRA 3V4IA 2BQRA 5KFWA 2JEGA 3P5JA 4UB2A 3QO9A 5EU7A 1C0UA 1TV6A 1ZQSA 4FJ5A 4PHPA 3GV5B 5CB1A 4KLLA 1YVUA 4FJMA 1O1WA 4CE9A 4CHYA 3SUNA 4KLGA 1ZQFA 3G0ZA 3ZSRA 4HYKA 3NFAA 5JS1A 4ECQA 4OGEA 4FLUA 4TUPA 3S9HA 1VSFA 1Z00B 4TUSA 4KTQA 2MAXA 3O3HA 3PV8A 5DBBA 4YR2A 2XRIA 4B9LA 1N5YA 4FM2A 2I5JA 3VQCA 4N5SA 3JYTA 3TAFA 1CXUA 4UB1A 2Y1IA 4F4ZA 2ATQA 3NGYA 3V1QA 5KFIA 4QAGA 3GQCA 3LP3A 5EWFA 5IIOA 3KK2A 5KG5A 1DLOA 4RQ8A 5DKWA 1RCHA 1BGXT 2ZE2A 3VQ6A 4EBCA 4RT3A 7ICQA 4FW1A 4F5QA 1L3UA 4MQ3A 4HUFA 2UVVA 2RKIA 4JV0A 3KLGA 4FZZA 1KLMA 4CJ5A 3LDSA 1BIUA 5KFDA 3LK9A 4I2PA 4O5CA 5CHGA 5HMMA 4TSXA 4NCAA 2GUIA 2XY7A 3BQ2A 5KGWA 3TANA 1SL0A 4G1QA 1RDDA 3HPHA 3LWMA 3DI6A 5L1LA 1YTAA 2F8TA 5KFSA 3Q8SB 2QXFA 1W0HA 3GV7B 2A1JB 4YMOA 4FJ8A 4ELUA 3TARA 4AILC 2DTUA 5J0PA 5HLFA 3BQ0A 5HP1A 1VSMA 3QEBZ 4KRFA 2IBKA 2XC9A 4DTUA 4O55A 1J54A 5E41A 2ZUBA 2IOCA 3U3YA 4KLJA 1RT4A 4LH5A 1VSKA 9ICEA 1CLQA 4DQIA 4LY7A 3D45A 5DLGA 3V7LA 5FRMA 4AHRA 7ICGA 3KK1A 4RPZA 5DGBA 3NF7A 4CHOA 3RH5A 1ASWA 1WAFA 4O9MA 3OYJA 5EWGA 3AVFA 4ED3A 2G8IA 1N48A 2R7YA 3OYBA 4PHEA 5L1KA 3NTUA 1NKCA 3AVBA 1TV9A 1EXNA 5J2JA 4IDKA 3OYHA 1NK6A 3CM5A 3DOLA 2DPJA 2NRZA 4E7HA 4QW9A 1RTDA 2HMIA 2KFNA 4FK4A 3DLBA 3PX4A 4KHYA 4CF0A 3MR6A 4M6WA 5HRSA 4CGDA 3TABA 4PH5A 3ZT2A 1QTMA 4CJ4A 4M41A 4CERA 4B9UA 1VSJA 9ICGA 2A1SA 4O5EA 3PX6A 2F1HA 1UA1A 2GV9A 4Q43A 3K58A 2W9MA 3RMBA 4FLYA 1S10A 1MU2A 3K5NA 4M3YA 5DDYA 4UB5A 4E1MA 4FJ9A 2IC3A 1ASVA 1IO2A 2P66A 4YVZA 5BOMA 3PNCA 1ZQKA 2FBYA 4FM1A 3Q8PB 4FJ7A 3OS1A 1RT5A 4CFCA 4DL4A 4MF2A 4DF8A 4ECVA 2C2RA 4JS4A 4RQ4A 3B6OA 1U48A 3EZ5A 4QWCA 2BQUA 1NKBA 3M8RA 4DFPA 5J2BA 4ELVA 3V6JA 2ZJ8A 3THVA 4FJNA 3GIIA 1NJZA 5KFPA 2NRXA 4F4YA 4Q0BA 3TAGA 3V7JA 4CF9A 3ISDA 4M42A 1SV5A 4G3IA 4F8RA 4YP3A 4DOCA 5IIIA 4CFAA 4B08A 4JK1A 1ZQOA 3F9KA 4RQ2A 3PO4A 5J2GA 3O3FA 4OPJA 1BCOA 4BACA 4I2JA 5KFQA 3QNNA 4FS1A 4C8OA 2IMWP 4L8RB 1S6QA 1UT8A 5IIMA 1TK5A 4GMJB 2VA8A 8ICYA 3HP9A 5KI6A 4J2DA 3KHRA 3SV4A 3OYFA 4DSFA 1LV5A 2Z1HA 3WNHA 3KTQA 4PUOA 8ICNA 2X74A 1SZPA 3NE6A 4R64A 3TAQA 2W9BA 5D4BA 8ICHA 3AVLA 4F4XA 4IFVA 4CEOA 4J9RA 4PPXA 3JSMA 4IR9A 1Y97A 1GOAA 1EXQA 2D0BA 3LPTA 1RYRA 3K2PA 9ICFA 1MSWD 4Y1CA 1NK0A 5L9XA 4UB3A 5J0TA 1A5VA 3QINA 1TK0A 5KFYA 5IIKA 2NUBA 4GLXA 4FJHA 4O3QA 2XY8A 4E7KA 1HYSA 2YKNA 3L8BA 4WE1A 5DBAA 4P4OA 3IM1A 1ZYQA 1RT1A 1NJYA 1A76A 4PGYA 5J2AA 4I9LA 3SCXA 4F93B 4FK0A 4F50A 1XWLA 3JPSA 2YKMA 3TQ1A 3AA2A 3V9WA 4O0JA 1CUKA 4QZAA 1ZQBA 4F4KA 4Z4HA 3B0YA 4P2HA 1RTHA 4R63A 7ICKA 3ZT1A 1S9EA 4Z6EA 3C1YA 3EPIA 3WNGA 4FCYA 2BQ3A 4KLSA 7ICPA 4RQ6A 2ASLA 2GWSA 1ZBHA 4M3ZA 1ZQGA 4DQSA 4HUEA 4CGIA 4E7LA 3VA0A 3QEXA 4KTWA 2IDOA 4DTMA 3ITHA 4KB1A 4J9NA 4QOZB 5D46A 4I2DA 3CQ8A 3PMLA 3CFRA 3DLEA 4ZH4A 2PI4A 4KB0A 2E6MA 3NHGA 4CJRA 3RH4A 2HNZA 5BOLA 1BQMA 1W9HA 4IQUA 2KQ2A 3B6PA 7ICLA 1NOZA 4PGQA 1S97A 4MEYA 4LVSA 8ICQA 3SUOA 4Z6DA 9ICWA 2PFQA 4IRDA 3G6YA 4EBDA 3VQ5A 1N6QA 3Q8MA 3K59A 3S3NA 7ICHA 2FC0A 1QSLA 4YMNA 2BKEA 4Z4IA 1KRPA 1JX4A 4R65A 4HCBA 4M3UA 4E19A 3MXJA 5KT4A 2V4QA 2AGQA 4ZTJA 1U9LA 4CIEA 4C8KA 2VWKA 2R8IA 4N47A 1IXRA 4IQTA 4KITB 4P4MA 1RT3A 3SPZA 1B92A 1ZETA 3RB4A 4AHVA 1KFSA 3NH1A 1C1CA 3T5KA 4FLZA 4ED1A 4JRPA 1ZBLA 4M3WA 3U3GA 4RW9A 1NK8A 1IH7A 5CYMA 3OYIA 3T5LA 1HQUA 4KHWA 4FXDA 3EWAA 4YMMA 8ICUA 3CYMA 4DFKA 2P6UA 1KCFA 4F91B 5DG8A 1Q8IA 3MDAA 1BPYA 3Q8KA 4JS5A 4O0IA 3Q8QB 4NXZA 3G6XA 4CFDA 3K57A 3P1GA 2BHNA 2ZTDA 4EYHB 3HW8A 3NAEA 4CK1A 4ECUA 4KHQA 4DTPA 3DLRA 8ICKA 4KLQA 1RBRA 4CHQA 1ZBUA 2HHVA 5J0WA 1B9DA 4CJUA 1RTIA 4I2CA 4Z4GA 2KTQA 2JLEA 5IIJA 4QWBA 3O3GA 2IHMA 1MQ2A 1CXQA 3ISBA 3ZT4A 4AHTA 4NLGA 4DLGA 9ICJA 3BGRA 3VQBA 4DSIA 4DEZA 1TL1A 4MF8A 3DOKA 3V81A 4C8LA 3NGDA 4KAZA 4ED6A 4F5OA 4BXOB 1NOMA 5J2PA 3AA3A 2AGOA 3MXMA 3L3UA 5CZ1A 3MGIA 3ZDCA 4DOAA 3HM9A 4O3SA 1XC9A 8ICZA 2YHAA 3QETA 3PW0A 1U45A 4J9LA 3ETLA 8ICLA 2UVWA 4DFJA 4RT2A 2B21A 2Y1JA 4IRKA 4NLNA 4KREA 4F3TA 1BQNA 4DFMA 3HVTA 5J0XA 4ECSA 1J9AA 1IKYA 4FZYA 2IGIA 5KG1A 1U47A 4RNOA 5KFTA 1R0AA 1WN7A 1TFRA 2NRTA 1VK0A 2HHQA 1JLGA 3RJJA 3DYAA 4DQPA 1TKDA 1RXWA 4KPYA 4DO9A 2AQ4A 1FKPA 8ICEA 1LWFA 1COOA 1JN3A 2D0AA 1JLCA 5CYQA 4GC6A 4UQGA 2P1JA 3QZ8A 3S3OA 3N97B 2W9AA 5KFLA 3NDKA 8ICPA 3QEPA 3KD5E 4LSNA 2HNYA 1I39A 3OYEA 2NRVA 1L3TA 5J1EA 3DLKA 4M3TA 3UXPA 3C21A 5KT5A 4CF8A 4PY5A 5KFGA 3HXMA 4CJSA 3ALYA 4EBEA 4HTUA 3KLIA 1CZBA 1S9FA 2BCSA 3IHQB 4NLKA 3GV8B 1S1VA 2FLLA 1LWEA 4KV8A 2BCUA 2V9WA 2B5JA 3KD1E 4DL7A 3L2VA 3IS9A 4FLTA 5IILA 4PHAA 2W42A 5C42A 3MBYA 1NK7A 1EP4A 1UOCA 3QIOA 1XO1A 4O3RA 3MFIA 3L3VA 3QIPA 5C24A 1JL2A 1WLJA 3AV9A 2BANA 4YXMA 2JEJA 1LAWA 1X9WA 4DTNA 2OPPA 4BDZA 4BWJA 3OSNA 3PUFA 5KFEA 2O4GA 4CEAA 4I2GA 1S1XA 4DL5A 2D5RA 1DTTA 5D49A 2PYJA 1BCMA 3HPGA 1ZQUA 2M9NA 3F73A 8ICAA 4JWMA 3N4MB 4EZ9A 4YG2A 1JLAA 2BR0A 1JLBA 4FJIA 4B9VA 3EYZA 4ID5A 2FMPA 3PY8A
chains in the Genus database with same CATH superfamily
3AY0A 2NLXA 5B09A 5C25B 4JLHA 2DH9A 2OD6A 1ZQLA 4OLPA 3H08A 1VAZA 1X1PA 2M52A 3C6TA 1S7HA 2YX6A 3H6EA 2NV3A 5L9NA 3AQOA 1QVFM 2HVIA 3G8TA 3UQ2A 5HK4A 1YI2S 3M9NB 1B22A 2XLKA 4WFBQ 5ALZA 5AE2A 1TFWA 1CJUA 3UCGA 4TVAB 3SDEA 4RWWA 2QXLA 3HVRA 2ZTCA 1X8DA 5AQJA 4HTIA 3DOMB 4OX7A 3L9ZA 3T69A 2EWSA 1VISA 1FX2A 4YEAA 3NBPB 2I1RA 2IVOA 1SKWA 3SUQA 2XB2D 1OO0B 3KXDA 3HJEA 4JI7J 2FPKA 2YH0A 5TZVA 2DFHA 4P0QA 2Q3SA 3FK4A 4YMEA 3P4UB 2M3DA 4O4GB 4J9QA 3ZZ0A 3OBWA 3FZLA 4LF9F 4K2XA 5KGXA 4OLAA 3DDKA 1HJPA 2HDOA 2CXYA 1NH8A 4OLBA 1ZQNA 4JI6K 1VC0A 2NUHA 2RHFA 3N7PD 1BPZA 5F8MA 1Q8LA 2IAJA 3WHIA 4JK9A 4UOHA 5JUMA 2A3JA 4CRXA 2MTLA 4HVZA 3HL8A 3T1YF 1RT3B 2W8KA 4PXDA 5AIBA 1PCAA 3NWGA 1CJVA 1HPZB 4U7CA 1D8YA 4HUGA 3FMBA 3KWGA 1YIJN 1YRXA 3CSKA 1VQON 3CCSN 2OAUA 3T1HF 4QPXA 3SZ2A 3MR2A 3V72A 1VQSA 3BH6B 2VASA 1HD0A 3ILIA 1KEKA 3H3OB 4CO4A 1RBAA 3O8WA 4NLDA 2P9KA 3DFEA 4CHZA 4AE5A 4Y2RA 3KIOA 3JPQA 1VSDA 1KKHA 2R8KA 3DXSX 3OY9A 3P49B 5AR0A 1Q78A 8ICRA 3ADAC 4FJJA 3ZD8A 1Q16B 2HHHK 1JLCB 4LR8A 4JKFA 3UQ0A 5KQ8A 1SKSA 3RUBL 3GIMA 4BROA 2Q6BA 1S6PB 3LA0A 3C5FA 4HTLA 5KFKA 1NAQA 4JI6F 2PAVA 2H3QA 3MN9A 4H4OB 1QVFR 1DTQA 2DNMA 4BDYA 2AEJA 8ICFA 2I38A 7AT1B 2MUTB 4UAYA 2NPFA 4W92B 2AXTU 3K9KA 3DJCA 2DBBA 2KNJA 3SJHA 5T41A 1R31A 1HIWA 2R8GA 2V5HG 1BI4B 3SMSA 1N52B 1RBVA 4B9SA 5HRRA 5I3QA 3D6FB 3ETMA 1KXPA 2R18A 3QICA 2VQFK 2RQ4A 1I94K 3CCWA 5KFVA 4GXJA 2QSFA 3VZHA 5AI6A 1L8OA 2HHXA 3BY5A 2Z1JA 4CEBA 3LANA 1U09A 4ED0A 5DLFA 1RWMB 5LJVA 4MKVA 5AQMA 3D54A 2CRLA 3OXFA 4ISGA 2MKSA 4B3RJ 5ALVA 4ISFA 2C2OB 3UNYA 2G09A 4KE5A 3JTNA 3TFSA 1QQ5A 1YZ6A 2EQYA 2ASJA 9ICPA 3DOLB 1YITS 4DV6K 2KW4A 2DGOA 3DXMA 5GADI 2IVNA 1SV4A 9ICBA 2DXEA 1FNXH 1C4CA 2Q36A 3WXJA 1WF0A 1UPMB 2P9LB 1S4EA 1IWAA 1X60A 1T03B 2UV8A 4KH0B 4MIWA 3HOSA 3RBZA 1TR0A 3EVMA 2RPIA 4CVNE 4ZS6A 1KBRA 1UT5A 3OR1A 4QIVA 4F5NA 4KB7A 1SUQA 5F0XA 5AKZA 5JU5A 4USUA 3L2RA 3W64A 2MQQA 3ZDAA 2UV8G 1LW2A 1U0SA 2OLWA 4K4TA 4USJC 1RDCA 3EPGA 8ICOA 2QMXA 2DRDA 2WK4A 1JLGB 2ZBRA 1A5WA 1GNKA 1OH7A 2E9RX 1BPBA 1WSEA 2NRRA 1KOHA 3CF5Q 1QAIA 3VQTA 1X42A 2X1FA 3EICA 1PK3A 1TL5A 2XHBA 2CJ9A 2VBYA 5FROA 1Q7YT 1XSPA 1T9TA 3FR0A 3KLHA 3L95X 3OYGA 2W43A 3AA9A 3TRGA 4FWLA 4OLOA 1VJQA 1T7PA 3E9LA 3IGVA 4LF8K 4G1PA 4WFAL 2CQ0A 1WDDA 1RAGB 2NYHA 1WCLA 1AA1B 3PR5B 2ASYA 5AKGA 4IOXA 4YFKA 4M0AA 4YB6A 3NGUA 2QWMA 5GADP 5CABA 2KH9A 5CHIA 2BGGA 2WONA 1HX1A 4DHVA 3K8WA 4IRCA 3SMPA 5J29A 3FZKA 1P8ZA 1T05A 2HKEA 4PZVA 3TTCA 1YHQN 2DTJA 2W7AA 5IT9Y 3C1ZA 2DQNB 2AW0A 2KYXA 4ECTA 5LMUK 4L3QA 2HWIA 1F0XA 4FS2A 5E7OB 1HI8A 3F2CA 2I7NA 3NRZA 3J7YI 3SI6A 4BRDA 5F9NA 1X9SA 2V8VA 3RMCA 4PHDA 1LAVA 4OCZA 3HSDA 4RW6A 3LVVA 3CCSS 1O08A 4BLGA 4B9MA 3LAMA 1VBZA 1YVFA 4GKKJ 2A0FB 2W7PA 2FE9A 3TUZC 1FE4A 3FRZA 2Q0UA 2K8BB 1U1RA 1N5VA 2C3OA 4M9NA 2B9YA 1VS3A 3M6ZA 4O8KA 2JEFA 4B9NA 4LZGA 3AN1A 1OY9A 3LZJA 1RBUA 3W5YA 4GXIA 1G6BA 3P45B 5AZIB 4B1YB 1D9DA 3TZXA 4B8CA 1SB3C 1JROA 4XRHA 4O3NA 1BI4A 1E6VB 4H0YB 4WQ5C 3IAS9 5AT1B 3JS9A 1RCXB 4IJNA 3EKUA 4I28A 2QC3A 3R7BB 2F1JA 4ZVEA 4JNEA 2OHFA 3M6XA 1N54B 4QWEA 2Z2ZA 3ET6B 3QFUA 4MK8A 3R97A 2WOMA 3QUCA 1UJ5A 3FZHA 1A9NB 4TY8A 2FSJA 1FKOA 2XMUA 1RWXB 2KOBA 1WC1A 1UW4A 5AI5A 2QKKA 3M8WA 3LP1B 3R7NB 2EG1A 4YOVA 2YMPA 1QAYA 3TA0A 1RAAB 4ID8A 2EK6A 1RWPB 3W2WB 4FJGA 1T11A 5K4LA 3HT3A 2HS4A 1XSNA 5HLFB 5KL8B 1W7WA 4CEQA 3W9HA 3C46A 1T8EA 2P5GA 4DU8A 4DR6J 3HKZD 1RZTA 4M5KA 4JD2A 1RUSA 3IR7B 2P9KB 2G13A 4F0KA 5J0QA 3VAGA 1ZQEA 1J5EF 2AJ0A 4DSJA 4CCHA 1NJXA 3CNHA 2F76X 1UZHA 4I7FA 2YWEA 2C22A 3VAKA 2YKQA 1RKIA 2AJ2A 4XDDA 2F3NA 1V5VA 4Q44A 1LK5A 3PHTA 2CPRA 2A41A 4LF4J 3G87A 1C0TB 3EY1A 1OMSA 2GNKA 2X6SA 2BKNA 4C7YA 2HFOA 5GAHI 3I0RB 4CLFA 1ZM9A 2JEIA 2LU2A 2X7IA 4O5BA 4JB3A 1CSJA 2CA9A 1YITN 3PW5A 3SEOA 2V51B 5E3QA 3OVNA 3GZFA 1ZD3A 2Y9UA 4L76A 1CRXA 3AVAA 1Z25A 3F0NA 1X4AA 1YWXA 1HQ2A 3CTRA 2ABYA 3QJLA 1OW5A 4MK9A 1NUEA 3TR8A 2CQBA 1C4AA 5BYSA 4N8OA 1N33J 3TADC 4OYMA 4CQ1A 4FOIA 2DNLA 1EETA 1BE4A 5KAIU 3WXMB 1I3AA 1HYZA 2LECA 3Q0AA 3L7UA 5HROA 2KKHA 1VRTA 4RUHA 1NPRA 3I0RA 4UAZA 3L7OA 3J81U 1VJWA 5AQHA 3CFPA 2BH1A 4RU2A 3AVNA 4H4OA 2YNFB 5DG9A 1SH2A 4ZLNA 2G8VA 1LKZA 2C2ZB 1SC1B 3PLAA 4DZDA 4TUQA 2ZUCA 1WF2A 2ZOFA 5AJ3K 1RT6A 2BGWA 4CEFA 2N4DA 4QWAA 4EWTA 2B56A 3AOBA 3ZNJ1 3WDOA 2WVCA 1BUXA 3IM8A 2KN4A 4JAXA 2MEWA 2OTLN 4WFAQ 4CHNA 4QS7A 5I4MA 1XIQA 4RW7A 3GFXA 3GIKA 3SSSA 2CQGA 2Y8WA 1RHMB 4CGJA 5G0RB 5FDLA 2CPEA 4ELTA 5KPTA 2C2EA 1U26A 4GKJF 5KPRA 3E66A 4E89A 3PO5A 2P9GA 5KFNA 2HHPA 5AE3A 4I4BA 3OTQA 3KJVB 4CNYA 5HMZA 4Y0WA 3SV3A 4NI2A 1IN0A 5KG2A 1TL7B 1WELA 1ZQZA 5J0UA 2NPIA 3PW7A 1IBMK 5KRSA 2RQMA 5IINA 3J7AN 3JPTA 3L4PA 4WCEL 4ZP7A 5LSRA 3FCHA 4X65J 3V6KA 4I2FA 2J7KA 2DBYA 5IM0A 3R5CA 2KE7A 1YTUA 2HQGA 4JYAJ 3UD5A 5DETA 2YTCA 4H4KA 2P51A 4ENOA 5DGAA 4P2XA 3MGJA 3HWTA 1T3NA 4ETZA 1F9HA 2CN1A 3TAEA 3D3BJ 2F2AB 1REVB 3A5NC 1YG0A 4HHUA 3CCEN 4GV3A 4AYBF 3ZDDA 1U1NA 2PC6A 3KK2B 2BJEA 3M30A 3G10A 3GFHA 2Y0SF 4ED7A 1UJ4A 4C2MA 5EN1A 4KLTA 3OS0A 3CMES 3M32B 4S0MA 5AQYA 1VDVA 1L8LA 1DT9A 2ZD1A 1ZQXA 5J2PB 4OI3A 1ZBFA 4MN4C 5C2FA 2Q0ZX 2GOLA 3QDKA 3CC7N 1JMSA 4OZJA 2ZH2A 1C1AA 3V7KA 4PQUB 4M47A 1Z6RA 2N7YA 4KX5A 5JMVA 1YJVA 1TAUA 1NH7A 5AQWA 4RQ0A 3NBPA 2WC9A 3QT7A 1RACB 3QGIA 1S5JA 1SPBP 1IIPA 2XI3A 5JMNA 4BXOA 1FVQA 3CM6A 4D3GA 3OSPA 1EX8A 1BNPA 1G1XA 3A8EA 2QWQA 2XULA 5EWEA 1JQGA 3U1MA 4P10A 2G0JA 2H3IA 3LP2A 1XHZA 1A6LA 1YJRA 1O8BA 3AVHA 2R7SA 3AQPA 3VVTA 4A47A 2K4HA 2EANA 3M6WA 1IG6A 2DHSA 3VGVA 2B7BB 1LOTB 3C2KA 1EETB 3UWTA 3SQ2A 4K2JA 2IM3A 3RAQA 4JI1F 1JLBB 3ISNC 5HJYA 7ICIA 2GHPA 1Q5VA 4GNIA 2I1QA 4ZPBA 1TUUA 2W54A 3M2UB 1X6IA 2VFTA 2GO7A 2EFPA 3D2FA 2YY3A 5DQHA 4IOAQ 5T14A 3BDPA 4RJVA 3RR7A 3T1HJ 2DVIA 4ZVOB 1U1MA 2HHTA 1N33K 3CIPA 3AGRA 1VQMN 1FWLA 4E3SA 3QRQA 1CULA 2WB1C 4GVMA 3W1YC 3AB2B 3OFGA 1XS9D 3Q89A 4I2PB 4QJFB 4KLIA 2VHGA 1WC4A 5CQGA 1KLMB 1NSKL 2O3DA 3ZEUA 3NL0A 2XGQA 4IEIA 2UU9K 1BHNA 1YKWA 4ECRA 3GZ7A 4FE3A 4B3SF 3O4WA 3CCVS 1NHVA 3OXLA 4PWDA 3R9PA 5ETNA 1Q53A 4B6JA 4U8VA 4DR4F 5F3TA 4TQSA 2F1IA 5CYMB 1XTZA 2QGFB 4QZEA 2X51A 5CZ2A 2KHDA 5J2IA 4ICAA 2BUPA 3UIQA 4KFBB 2PXIA 4EX6A 2DPNA 3BZQA 3J81O 4H5NA 5G5HA 4CLLA 9ICKA 2MQPA 4GW6A 2UVRA 5LMNK 3WT0A 1FJGJ 5EUHA 3LDLA 4F3OA 3ZSXA 4DF4A 3OHBA 5DZ7A 3LGNA 1XU4A 1BUPA 2AIRB 3TP2A 2IHNA 1TKTA 3QGPA 4DOBA 3MEDB 1ZQMA 2AEFA 5GMEA 4J9UE 4P7VA 2G8WA 2EVZA 1S0MA 3M2RA 2ZH6A 4KLEA 2R42A 4UY8O 2YJEA 3FFKB 3QAUA 3EZOA 2EC2A 1TGOA 4B3OA 2DNZA 3CQXA 5AQPA 2X78A 2BDPA 4HTJA 2ZQBA 2JWLA 3FC4A 3VAFA 1S48A 1QD1A 2E7VA 2QWNA 2MSSA 3VV2B 4DV0K 5ALXA 2KHCA 1R27B 2GS8A 4BE0A 2FGOA 3NGSA 1IVZA 2GUPA 2AF6A 2FBVA 3GB0A 4E1NA 3DLJA 1GH8A 4XPEA 4K4XA 3PRBA 7ICOA 9ICRA 4ZK7M 4YOXA 3V6DB 2BX6A 2HGLA 4A5BA 4UY85 4NJ8A 2CH5A 1SV0C 2ZJQL 2PIIA 3QBCA 2A42A 5AQIA 5J0RA 1NB2A 2EPIA 1N34J 3IP0A 3FNNA 1P1LA 2KM8C 4W5OA 3LW5C 3HSTB 4M6WB 1WOPA 2CDQA 4ILRA 1BNOA 3H42A 5ETQA 4RQMA 4WK1A 1LW0A 4BC7A 2CJYB 2CNOB 4QU6A 1X40A 3TKAA 1AFJA 3TWZA 4OI1A 1KW4A 4OX6A 4TU7A 4QNLA 5JICA 5LMUF 2OANA 4TXSA 2OPPB 3MM7A 2OTJN 3MDCA 4I27A 3EMTA 4XEIA 1Z2ZA 2AX0A 1U6BA 3CIMA 1RT7B 1ZQHA 2RQ5A 2OH2A 3IRWP 1N56A 2LYAA 4MO4A 3MN7A 3H0LB 2CG4A 5M1OA 3UN3A 4Y2JA 3BS9A 3EKSA 4QZBA 3AM9A 3ZCMA 2OHDA 3O08A 3SAFA 3DRRB 2ROPA 2NXEA 1HQUB 3ULHA 3OTOK 1R43A 1N62A 1RWWB 1QY7A 4K42A 3SMVA 2QO3A 2HHSA 1X4BA 3GMGA 3L0QA 5ALUA 2GJIA 4JI7F 2QSWA 2PA8D 4BREA 4M3RA 3CC4S 3PTWA 3D0HE 1S1UA 4AYBC 3A0IX 1B43A 4X66J 1COKA 3CG7A 2VDIA 1WI6A 2BJ9A 2BJ8A 4IKFA 2AJ4A 3U4LA 4OJPA 3DLEB 1ZQQA 2NXJA 4NPOA 2YHWA 1PUZA 2J9DE 2NO5A 2MGZA 2YNFA 3BR8A 1ZTTA 3FCVA 5HP4A 3HK2A 1LCUA 3D9BA 1FHTA 3W5XA 5KT3A 3C6TB 2WF5A 3UN5A 5KT2A 4GVEA 2BPGA 7ICEA 4U8YA 5GAEP 5B0EA 5HROB 1NM1A 1LFPA 4HACA 2YNIB 5AKEA 3JPOA 3ZSQA 2LM1A 4OJRA 4DR5J 2YPYA 3GCWP 4RG8A 4BGAA 2Z7JA 4L3NA 3TA2A 4C98A 2KVCA 2BJ7A 1FXXA 3TWHA 3DDNA 4XA5A 3NASA 3T5HA 1PSDA 1IQTA 1J27A 1VQ4S 4MMOA 3TSPA 5CWRA 2NQPA 3KKAA 2XZDB 4RKUC 4HAIA 4OJHA 2CH6A 3GIRA 2GJ2A 5CB1A 3GR0A 4JMUA 3LDNA 2M9KA 1HNVB 2QA4G 4EEKA 2VFVA 1JJ4A 3ICLA 3SUNA 4LFAJ 5E33A 2MHNA 1S9EB 2EFNA 5JS1A 4DCPB 2AYBA 5I42B 4Y65A 3PV8A 5DBBA 4ALZA 1ZOLA 2RDDA 3HULA 1UHUA 4IFYB 4OYZA 3JSMB 3GR1A 3QT6A 4FM2A 2I5JA 3VQCA 4N5SA 4IQXA 3W9IA 1DGKN 3QAEA 4OQJA 1CXUA 2V0NA 4UB1A 3BO4A 3NGYA 4QAGA 3GQCA 4J03A 1WKLA 2QL5B 4RQ8A 3AHPA 4OIXA 3KLIB 4J9VA 3VQ6A 4RT3A 4FW1A 2MLYA 1B3TA 1KBUA 4EO6A 4IQMA 3KZIU 4M8LA 3DLKB 4H4KC 4JV0A 3PHEA 2D3ZA 3HD1A 3KLGA 1YJWS 1VQPS 2VJ4A 5AKYA 2B4PA 4YB1P 3LDSA 5KFDA 3LK9A 4F72A 4IC9A 4O5CA 5AKJA 3DHWC 3KJQB 4JP8A 4L6V3 1HNZJ 3A3OB 4UATA 1RDDA 4K43A 2P5VA 4YB5A 1YTAA 2F8TA 2OTJS 3HKZC 1RLCL 3OUYB 4DU7A 3Q8SB 2A1JB 1N5WA 1M1GA 4FJ8A 1KAXA 4DUYK 2H4WB 4BRGA 3O3LA 4AILC 2Q1LA 1REGX 1N33F 1WKKA 5B8HA 5HLFA 2EW9A 1MWQA 5D3GB 3HFZB 2ZJPL 5E41A 2NXNA 4KLJA 3VQSA 2QN6B 1RTJB 4CWBA 4DQIA 4LY7A 5FRMA 3EL2A 2CXEA 4QZVB 3QU4A 4P9SA 7ICGA 4CHOA 4N77A 3I0SB 2NREA 1BA0A 5CZVA 5EWGA 1SH0A 1VRTB 1S4FA 2BYCA 4PHEA 1OVYA 3NTUA 4LBPA 2FVQA 3AVBA 1TV9A 4IDKA 5D77A 4E7HA 2B4VA 3ZI4A 1E4FT 4PZOA 2Z58B 1MU2B 4KHYA 4BRCA 5M1NA 4WE1B 4X65K 1CI4A 1FDAA 3SBTA 4OZ3A 3F5AA 1I5OB 4DCHA 1VIOA 2X1BA 2R9LA 3NOGA 2F1HA 4Q43A 2YVSA 2W9MA 3AH6A 3VETA 3MMVA 5LJ3Y 2W40A 3KOOA 1B0PA 1BU6O 4UB5A 1NGFA 1ASVA 4G9BA 5K8OA 4YVZA 2UXBK 2JH7A 1YK9A 3K5PA 2BKPA 3Q8PB 5GAHU 2APOA 4JKGA 2FXUA 1IUJA 1VFJA 5AQFA 1ZZFA 2F4VF 2XNRA 2IVPA 3JTOA 4JBCA 4JS4A 4HR2A 2YJFA 2IY5B 3U9DA 1IBCB 1X6JA 4YY3F 4WU3A 1SB6A 4QR2A 3M8RA 3D6RA 4DFPA 5J2BA 2B9XA 3THVA 2DHHA 2HRTA 2RE1A 4Y6IA 2UYTA 1F9EB 4FZNA 3R6LB 4JEPA 3GG4A 1NDLA 4ES1A 3TOQA 4PUOB 3BH7B 4G3IA 1IR1A 1F5SA 2E5HA 3P39A 3K17A 5B5EU 4UT4A 2F1FA 3QPIA 3CJ3A 2CJXB 4RQ2A 4WJ3B 1LQ9A 1VOMA 5C24B 4I2JA 2DR6A 3VHQA 4DV3J 2E88A 4L8RB 1S6QA 5IIMA 3OLBA 3HP9A 4OX9K 1YBAA 4J2DA 1W26A 2G0IA 3SV4A 3OYFA 3QFHA 4DR1J 3MM7B 1MN7A 2HVEA 3QU7A 1KQSR 4XTTA 4F4XA 4CEOA 4Q7AA 2JLGA 4IR9A 3MAHA 4Q2LA 5AZIA 3PJXA 2KSOA 2JRSA 2RRAA 4M5LA 2M0GB 5L9XA 4UB3A 1YJUA 5KFYA 2YQ3A 2BRKA 4GLXA 4CTAB 5BYRA 4ES2A 4AL5A 2Z4PA 2UP1A 1HMVB 4P4OA 1NDPA 1QQ7A 1RT1A 1Y3JA 3C15B 4I9LA 5CXTA 4FK0A 1XWLA 1BQNB 2YKMA 1N4LA 4AXJA 3V9WA 4QZAA 1FEHA 1CZAN 2W4CA 4DG1B 3WNGA 4MAKA 4RQ6A 1KN6A 4JI1J 1W2IA 2FTRA 3MGVA 1D1UA 3K7RA 1BO5O 4NXNK 4LC9B 3VA0A 2JFKA 3KK1B 1XMOF 4KTWA 2IDOA 4EIAA 3BYRA 4PYDA 5D46A 3OFHA 1NCLA 2IDEA 1E4GT 2PI4A 3UD3P 4CH0S 2E6MA 3LM9A 2CQ3A 4USWA 2HNZA 3O1LA 5M2UA 4CZKA 5BR8K 1WACA 4K5RA 2HOQA 4KGKA 2KQ2A 4F02A 3B6PA 1U2RA 1YJ9N 4PGQA 4ZCLA 1FEZA 2K8CB 5C15A 4A48A 1F5BA 5M2PA 3SUOA 2DGWA 3BBCA 4M1KA 2CQ4A 3G6YA 1ESVA 2A3ZA 4OYPA 1N6QA 3QSIA 2G08A 4IH6A 1YDLA 1C1BB 5EX0A 2WB1D 1FVSA 3Q23A 4B3MK 4Z4IA 1QQOA 2K06A 4ZP9A 5KT4A 4AM7A 3HI0A 4CIEA 2VWKA 5CEHA 2R8IA 1IXRA 1NGEA 2VCPA 4IQTA 2BMBA 4KITB 3UDEA 1P6TA 3UKUB 1RT3A 3SPZA 2ILZA 3QT5A 1KFSA 1C1CA 3N0VA 2Q1NA 1PYTA 4ITSA 1ZBLA 5IC4B 2HSTA 1NK8A 4ZOSA 2VPXB 3I32A 3NCQA 3JB9k 2UZAA 4A8WA 4KHWA 3KDOA 2LQBA 4NZ7A 2LDYA 2HBJA 3VCBA 3MMAB 1KCFA 3M2UA 2WF6A 2P35A 3C19A 3BUZB 3K57A 4USHA 4Y2VA 3M4XA 5ALHA 1ED1A 3EN9A 5HAOA 3D68A 4GKJJ 4PPZA 4C7QA 3X3UA 2C3PA 3WIUA 3HSJA 3UDLA 2CKWA 4HDHA 1F5AA 4KHQA 4DTPA 3EGZA 3DLLL 8ICKA 4A62A 1UW9A 4KLQA 4W4MA 3UW1A 1GLCG 4DV7F 4PRFA 2LP4A 1RWOB 4KSEB 1B9DA 3QGGA 2K89A 1G99A 1T9UA 1VQPN 2HQCA 3GJQB 2CPJA 1SAZA 5THWA 5ETVA 5B0GA 5HQLA 2IM0A 2JWNA 3CDEA 1JLEB 1PYSB 3ISBA 4Y2PA 4MK7A 4DLGA 2DEIA 4IOCL 1DURA 1X4CA 1SXEA 1NU0A 2JH1A 1Z05A 3BR9A 1YSJA 3AGKA 4ED6A 3AA3A 2AGOA 5MLCQ 3L3UA 4EX7A 1LK7A 4KO0B 4UW2A 3MGIA 5F0WA 4DOAA 1QVGR 4JI8J 2IIRA 1NB7A 3A3NB 1IBKK 3CCQN 3PW0A 2F65A 1N36K 3OVAA 3MAAA 2D6FC 1PBAA 4DFJA 2G4BA 3S8SA 2I6WA 1SJ1A 4LT6A 4IRKA 1P8GA 1M1HA 4USKA 2HIQA 1HL6A 2OUGA 1CS4A 2WTUA 3CXCM 2IGIA 4JI0J 2KJ8A 2L9DA 3HTVA 1TFRA 5HBMB 3C6UB 5IV3A 2D7SA 3RJJA 2YKNB 2VF3A 3H0MB 2AQ4A 2KJVA 5B0CA 2HOIA 2CRXA 1JN3A 4GC6A 3MX5A 3FSIA 2F4FA 2GGPB 3N97B 2E1PA 2QRRA 3NDKA 3QEPA 3OYEA 2NRVA 3C21A 1UQVA 3HXMA 3VAJA 4EBEA 4HTUA 5AQLA 1DAXA 1QM9A 2IAJB 2K7KA 4NLKA 1U2FA 3GV8B 4HDGA 1ZBTA 1D9AA 5EDWA 2BCUA 2B9WA 1R0AB 2OMOA 3KD1E 3A0BU 5RUBA 3L2VA 3IC1A 4FLTA 5IILA 4DV3F 5HMXA 1U1QA 5BREA 2C2NA 3ZX0A 1U1PA 4OMFG 4CBWA 1XO1A 3L3VA 3MURP 3AOAA 4YXMA 4MIAA 2JEJA 2MU2A 4A57A 1NMEB 2UUBJ 4LF6J 1X9WA 2OPPA 4BDZA 2JSXA 3R8EA 3TTFA 4BWJA 3PUFA 3HI9A 3JSBA 1S3XA 5CD4A 3MMBB 3DYAB 2LQ8A 4Q0BB 2PYJA 3QWUA 1BXNA 2OJ3A 4IO9L 1H98A 2FB0A 3PCOB 2O8FA 4FYYB 4GRSA 2YNGB 1RCOB 4KC5A 2K1RB 4TU8A 4C0HA 1OIAA 4YG2A 2W3RA 4B9VA 3EYZA 1T3OA 2FMPA 4DR4J 3MM8B 2VG5A 3ALRA 4O3MA 1Z1BA 2V9KA 4LFAF 3FJ2A 2EZYA 2JX2A 4JHDA 3ATVA 4KGXB 3NWRA 1VSLA 5KFUA 2V2QA 1UCNA 1Z4OA 4ZVPB 3VAHA 4KN4A 2HFZA 3ZZUA 4DMNA 3SUPA 4QS8A 4U6PA 1X5PA 3ZX3A 2J6UA 4H4MA 4UAUA 4OI0A 2XY6A 4AHCA 4DN9A 3PRDA 3RSEA 3FFIA 1IM4A 2D3O1 3HFVA 3U27A 4CJ3A 2M70A 4NXMK 2HOFA 5KFFA 2CWXA 4N8NA 1FJGF 4F2SA 4EU0A 4RU9A 2ZUDA 5KFAA 3C2PA 1QZ6A 1F21A 4LFBK 4CZJA 3H1QA 4OKJA 3FBFA 1GLDG 2AT1B 4CGFA 1NSAA 4RQ5A 4PL1A 4PKDB 1OY6A 1FESA 3BGUA 3A5MC 4NLPA 4X4VA 1NOYA 2KEYA 1D9FA 4LF6K 4FJKA 3TR5A 2HB5A 4CFBA 1UWBA 4I6MA 5K14A 1RHRB 2FVSA 3T5JA 2WF9A 1VQ4N 3KZXA 3NS1A 2IPOB 4EO8A 4I6YA 2DO0A 3VEWA 1TQLA 3GWCA 4CJTA 2X1GA 4CLUA 2PFUA 1QHAA 2ROEA 2V2ZA 3NKYA 1XUPO 5KFMA 3I55S 4JV2A 2V8HA 1WBBA 3GFYA 4HKQA 4WYWA 4CBXA 3I31A 4DU3A 1BVSA 1O6XA 1KFTA 3ASMA 4KLOA 1CVJA 2QMWA 2HF3A 4K4YA 3QYYA 3VQAA 2A1RA 1GAOA 3H5YA 4IZ9A 4M45A 3RZAA 2IOHA 3R5JB 4C0ZA 4NB4A 4OZLA 5BPMA 1Q4RA 1NGCA 2A18A 5CJ7A 4M5IA 1HWJA 2KO1A 3LZIA 4LFBJ 2YV0X 4I2AA 2BJ1A 3R2CJ 4DMZA 2CQIA 4OYBA 2ZGYA 2H3ZA 5BPCA 2Z2LA 1U0HA 5F8LA 1N0UA 5AQQA 4DKWA 4Z4CA 2HRYA 3H8JA 1R6VA 4ZVFA 1L7OA 4W90B 1WSGA 2VJVA 1S1TB 1HRHA 2KIVA 2NYIA 3C2MA 1FXLA 3OR1B 2E29A 2QWPA 3THWA 1RWVB 2UXCF 1X2IA 2B0CA 4HHJA 2ZKTA 5ALNA 4L75A 5KFBA 4LRCA 4ZITA 2W1BA 2XCAA 1S59A 4I1TA 4K4ZA 3AVMA 2FF6A 3BYPA 5B66U 3OL9A 2ZWPA 3TX0A 1ATSA 1J2MA 1X31C 1C20A 1FNMA 2AV5A 3QXGA 1JCGA 2J76E 4YY3J 4DU1A 2BZ2A 2B8QA 5IWAK 4LF7F 3CERA 3IBPA 5IWAF 3MEGB 3CHWA 2RUSA 2F4VJ 3DM2A 4KLMA 4ZPAA 5F8NA 1GEHA 3M30B 2LI6A 1DY3A 1QAXA 2HBYB 3S6EA 4ANEA 5M1KA 8ICJA 1Q7LB 3VWSA 1EWRA 5F2RA 4ZVSB 1PILA 1SVDA 2KJWA 1U04A 3V9XA 1YJNS 5DB8A 5HVFA 3KLFA 2UXCK 4DUZK 3FM9A 1ELOA 1VC6A 3F2DA 4WZMA 8ICBA 1VSEA 5IM0B 5DM7L 4AT1B 2LYHA 3CMEN 1DGSA 4F4AA 2A5XA 4FKXA 2F8HA 4CI0B 4X5VA 5CE3A 3HVWA 2UXDJ 3LP0A 1NI3A 2LSNA 2HNYB 3DV9A 4JRQA 4YR3A 4OHYA 5AI4A 1MMLA 3CWJA 1FDDA 1M90T 3VAMA 3Q83A 2B4JA 3E3XA 1R89A 3MEEB 1HPMA 2XYPB 1UEVA 4UAVA 4AFFA 2CZ4A 2WTFA 3J7ZO 1YJWN 2XWYA 1IKWA 5HMLA 1ZQWA 3RF9A 1RG6A 1UETA 1WAJA 3HHLA 9ICTA 4UBBA 4ZLJA 3O6QA 4DSEA 1GMWD 4GFJA 3MWTA 4CGZA 1YLXA 4RW7B 1U2VA 2WHEA 5HATA 1DBDA 1T03A 5KFXA 4O3PA 3LPEA 5BN8A 4IH5A 2W03A 3JPNA 2QV6A 3CPEA 2LU1A 1UVJA 1K0VA 2GIQA 1TKXA 5D4NA 3A13A 4USIA 4BR9A 4MLHA 4OJLA 1EARA 4DTRA 3H5XA 3ZXWA 3C14B 4LF6F 4BRNA 1TP7A 4KGMA 4BR7A 2KMDA 4F5PA 4LMZA 4F67A 3HHDA 4GVLA 4IS7A 2WZ1A 1HNZF 4WU2A 2VIXA 4K0KF 2ZJRQ 2BA9A 1H2TZ 2HZAA 1LWCB 1XMOJ 3P96A 2J4RA 3VAIA 4H5WA 3NUQA 1V9PA 3SNNA 4WJBA 1KVIA 3OJUA 3PW2A 2D9OA 2QE5A 4ED2A 5LJ5Y 3HHKA 1D5AA 4FLXA 4F04B 2BDUA 2OPRB 2JHEA 5HVHA 1EQYA 1KQSM 4ANCA 4A8OA 3UQSA 4K4GA 3LAKA 3H59A 1KQFB 3Q8LA 4DR6F 2KHQA 4QZ8A 2GO9A 3H90A 1JCFA 4K5SA 3FEZA 3IP4B 1QH9A 3B82A 1RAHB 2YPZA 1RWNB 4XUSA 1U6FA 2JWKA 1ZAXA 1YBTA 2FBTA 3M6GA 1GOBA 4Y2QA 1RWUA 4HI2A 3KKRA 5KT6A 3AVJA 4ID1A 2IDLA 3H5UA 1U2VB 2NYVA 1SL1A 4DV1J 1APSA 4MT1A 2DR7A 3O6WA 5DK5A 3PIPQ 3J80O 5CYJA 5HL7Q 3BGLA 4CGHA 2HBRB 2ZTEA 2PMZD 2IA0A 1S1XB 5EXWA 4DV3K 2DB1A 3G2XA 3R9KA 1J5OB 3V9ZA 1N32F 1NJIT 1WSHA 1GXLA 5IT4A 4OJ3A 2KI2A 1IJFB 2RD5C 5A8RB 4JKHA 4BGDA 2DO4A 2KM8B 4ZN3A 3HOTA 4FWPA 1S0NA 4GO5X 3CCES 1K73T 3HJFA 1EJ7L 2DUYA 1MMNA 1DQAA 4ECYA 2B51A 3ILOA 2WAQD 4RWTA 4NCGB 4I67A 4DCOB 2FVCA 2KRBA 3KHLA 4ZPCA 3K75D 4LQ9A 2ACYA 2KFZA 3ZZTA 4NL9A 3K5MA 1XC3A 2E1AA 3BB5A 4I2EA 5I3UA 2C2KB 4A4JA 3QIDA 1M5OC 3NH0A 1UJ6A 1RA6A 2R7WA 2RU9A 5ALWA 3T6BA 1HNWJ 2I0XA 2F96A 2ZXHA 3NNCA 2GWKA 3NVWA 4WZQA 1WC0A 3ULEB 2HBZB 3MABA 4F4WA 3LYSA 2IM2A 4CJQA 2ATLA 2W9CA 2PEHA 3ILJA 2RRBA 3W0LA 3MPUB 3GDQA 1NG9A 2J0WA 2JR5A 1ZQVA 2KT2A 1ICEB 1RHUB 1VLOA 4A2BA 2PMZC 3B4DA 4IQWA 1FE0A 1GXUA 4KHNA 4YB7A 2JMGA 5SWMA 1WHVA 1WUUA 1CBKA 2OPQA 3C28A 3BN7A 3L6QA 5L38A 1Z4NA 1PG5B 1K44A 4NEYA 4K50A 4JI0K 1GLEG 3J7Z5 3SQ1A 3AUOA 2MY8A 5HHIA 4NCGA 1NBEB 2FVPA 1FO1A 2FPMA 5KFCA 2JNJA 3POTA 1HD1A 4M63A 1V9OA 3ZLJA 3IG1B 4H5RA 1VQMS 1TE2A 3TSUA 4WYBA 1PC5A 4KLUA 1JKHA 2IFXA 1N32K 1K47A 1KVAA 4DUYJ 4ZDNA 3DNCA 1LWEB 2FJDB 5DO2A 3KUGA 2UUBF 1CEZA 4ZVGA 2CJBA 2QM1A 4FF1A 2FJ6A 3GOIA 5GMDA 4O3OA 1D0EA 1WSJA 2FVRA 2VOPA 1PBUA 4CESA 4FWSA 4NZ6A 4OPAA 3CD6N 1T9WA 1VQKN 3EE9A 1N8RO 4RNFA 3D6TB 2XIDA 3MXIA 3NLCA 4ANDA 4CJPA 1ZM4A 4PA1A 1PJ6A 5KG7A 1FFGB 2FJAB 3FGVA 2ZH1A 4USMA 3M8SA 2E7WA 4DSLA 4FJLA 4DR3J 2V67A 3U1LA 3RGIA 1IJJA 1UVNA 2Y0SD 1LOUA 2FY1A 3R1LA 1Q8KA 4YUDA 2E8NA 4M04A 3TEGA 5F8GA 4OL8A 1VDHA 1P1TA 4C8MA 2H4YB 3ZDBA 2KT3A 2G2ZA 1YBUA 2KRRA 2R4FA 2MZSA 3IAM9 5KNIA 1MN8A 2YX4A 4Y1DA 2ACMA 4AH9A 2E1ZA 3ORYA 2DR5A 2YBVA 3Q8VA 2ES6A 1JCEA 9ICOA 3I33A 1HNIA 3GFZA 5M1PA 5DRKA 5T7LA 3C23A 5AKHA 3G8SA 1K6YA 9ICSA 3R5BA 1SWWA 2D0PA 1UA0A 4J9OA 1TAMA 1GMWA 3D2FB 4OJ1A 1M5SA 5AJ3J 1RHKB 4EZ6A 2B6AB 2AJQA 2BZFA 1NZBA 4IFYA 3LF0A 3FBCA 4PG5A 2KYZA 1NPKA 1XNQF 1Z00A 1D4XA 2QEXN 4F92B 3Q8RB 5I42A 1WG5A 1XMOK 3CD0A 3HP6A 2HVHA 2KZMA 2AD9A 3ENBA 3RWUA 2G8FA 2HLUA 2VD3A 1HNVA 3H98A 4CIGA 1Y88A 3C14A 2VKZG 4ZCIA 3DGPB 2ZHAA 2OWOA 4B3RF 4CLZA 2YNGA 1OUQA 4OPKA 1KTVA 2GMLA 1UFKA 3WU2U 4DFDA 2FI1A 3G25A 1J97A 4B3SJ 4CJFA 1RNHA 1O5JA 4JI3K 4Q5VA 4QIWF 4RUBA 2ZNZA 2ITMA 2ZD1B 4WKYA 3M6VA 2XMKA 3MZIA 3FKBA 3VQQA 2E2OA 2JL9A 3N7RC 1B0TA 4DL2A 3CCUN 1VQ8N 1HBNB 4YDXA 4WQ4A 1TUYA 3ISCA 2F7TA 4HHHA 2YX8A 1W2BR 1KWMA 4Y2IA 2ZDPA 3D28A 2O8FB 2KLAA 4XO0A 4LF4K 2QB0B 3BS5A 4DR7K 4R0EA 3B8AX 3WUHA 4WXOA 3MM9B 4KYZA 2BW7A 2JZBB 2P9NA 1C2PA 2YHYA 1YJ7A 5H1SV 1OKJA 1K8KA 2K3KA 3BKFA 3L2UA 2F9DA 4UF4A 4USVA 3OGUA 3MEEA 2R2TA 4I69A 1S1WA 3AXMA 3D66A 3ZZRA 4KMOB 4A8QA 3LP0B 3MMAA 5HHHA 4ZTFA 2ZH8A 2UXCJ 1F3VA 1JNZB 4NE9C 4D3HA 1QAJA 5FLXO 2BCVA 2JJ4D 4DTJA 1N5XA 1BPDA 1YTYA 3IMQJ 5FDLB 2OM6A 2RNEA 3Q24A 3PSTA 4OJGA 3LM2A 2VYPA 4KPCA 3SQIA 3G96A 3Q2SC 2AJFE 4F3QA 3L3CA 3KMQA 1RYSA 3I4PA 1K5OA 1QSYA 5LM7E 4IH7A 4ICLA 3SR6A 5JS2A 3C65A 5A0LA 4KHUA 3GILA 1HUXA 4OYWA 2Q43A 2H5JB 4JV5K 3V1OA 2FJVA 2QK9A 4UZCA 2XYGB 2EBGA 2QLFB 3ICXA 1QLNA 1RDBA 1YJTA 2F4VK 3LGHA 3UMCA 4NASA 4YOYA 4IWVA 5KTQA 4BR4A 3QEVA 2AZ1A 4UAWA 4FNHA 3AJ1A 2XTJP 1ZJNA 3L3FX 1AFIA 4Z4EA 4X62K 5JVGQ 2YQ0A 2V2KA 4C48A 2Y1LB 4CJWA 2J0QD 2FHMA 4GKKF 2KG1A 4RUAA 4WTOB 4NRTA 1HNXK 4J9PA 2CQ1A 3SQOP 2J8SA 4ID5B 8ICMA 5E3PA 4C9DA 4YNQA 2V63A 1Y64A 3TVYA 2H5EA 4FWNA 9ICCA 4TU9A 2IRYA 2VA2A 2K8AA 3IMXA 1B64A 5J2KA 2EAMA 4NLZA 3OYNA 3TI0A 2P9SB 1R59O 5DMRA 5KFHA 1U8WA 2DHGA 2FGCA 3D5MA 5A6PA 3EO3A 2PFOA 3AO1A 1T9YA 2HK3A 1QS4A 2KHVA 3HRGA 4V1Ak 1LKYB 5HMYA 4NOHA 3UI3A 2U1AA 2FD2A 4ICLB 3GFKB 4M9LA 4CO0A 1TZ0A 4A8MP 4H54A 5U47A 1XMBA 4H5TA 1IKVB 5LL6d 3ZZZA 3E1YA 1N5QA 2DGVA 3U7JA 3RW6A 4H5VA 4LFCK 3TJ9A 1JJHA 2O8BA 3HHLD 1K1SA 1RE1B 2CFXA 2ITGA 3WK9A 3CCMN 2LM4A 3RAXA 1Y5LB 2DNGA 3M8QA 4CECA 3SCIE 1Q9YA 4O5FA 3KMSA 3EUB2 1S1VB 3D6MB 3RJFA 2E5LJ 4X4NA 2N1RA 5CA7A 4BBYA 3QJPA 4DR7J 3MGHA 1PJ5A 1VQKS 2HS0A 1F3FA 2CUYA 2P9NB 4P4PA 4W5RA 4DV5J 3DRSA 4CLWA 4I2IA 1RILA 4Q8EA 4OHZA 4YORA 2R7UA 4FO6A 1ITGA 1VQ7N 3BGOP 3CT9A 2YX7A 4C3LA 1A0OB 1WUAA 4M7XA 4WPAA 3BPDA 2CJKA 4PKIA 5EOYA 3ZYYX 3RMAA 2PN6A 4P6QA 4NXMF 1RBOB 4X84A 4NLXA 1Y10A 1BIZA 4U67L 2BTFA 3T3FA 2CPDA 1UZDA 1YIJS 4UOFA 3VEVA 1J53A 3JAMY 5LT5A 3C0BA 3FEYB 1UPPA 5J2NA 4EEYA 2IA6A 1VQLN 1MG7A 1FCAA 4DV1K 4P52A 3NGZA 5AQKA 1JK9B 4RPYA 3OL6A 5IV4A 4P7TA 4HHTA 1VK8A 4P2FA 2YKMB 1RBLA 4RW6B 1IJEB 5AE1A 2OEJA 1BPEA 9ICIA 3UCUP 3FZFA 1SKRA 3HZ6A 3ZZOA 2BQRA 5H2FU 5KFWA 3QO9A 5EU7A 2WVEA 4J90A 1PK1B 3CI5A 1TV6A 1ZQSA 2A19A 3SEIA 5DDRC 4FJ5A 2MSTA 4KLLA 3R5AA 3CJ9A 1YVUA 4DN0A 1EQ0A 2WW8A 2NZTA 5MAOA 3TSQA 4CHYA 4G6VB 3D0GE 4CRJA 5AM4A 1RM6C 3CO0P 3LGMA 3J80Y 4FLUA 5AK4A 4UTGA 2ZIXA 2V8GA 5ETOA 3OHRA 2RILA 3WEEB 5SUHA 2FDRA 4TUSA 3SCJE 4G1IA 1Y7PA 2UUBK 2XRIA 4B9LA 2O8CA 4H0PA 2ERRA 5FPMA 2LA6A 4C11A 5CH7B 4ETXA 4F4ZA 2ATQA 2FQQB 3BBFA 3HLUA 1VJ5A 4GV6A 5MLCV 5HR7A 2F9WA 1KAYA 4ILHA 3TJ8A 2CDRB 3KK2A 5HP1B 3GL1A 2P2CB 3J80U 4C1NK 5DKWA 1N34F 1BGXT 1I1GA 3TPQA 3VESA 4IXCA 1OS5A 4F5QA 1L3UA 2HIYA 3MCMA 3CC2S 1MLAA 1PJ7A 2RRNA 2HBKA 2RKIA 3CJRA 3UVJA 1X4GA 3A5OC 4OI4A 4QIWD 5GTHU 4CJ5A 4BC3A 2W2PP 4I2PA 2NLWA 4TSXA 4B9QA 2Q2RA 4C8ZA 3AFGA 3OQ2A 4FWMA 4JYAF 4BRHA 3LO3A 3HPHA 3EE8A 2EWHA 2FJBB 1T44A 4PKGA 5KFSA 4AUKA 4NYOA 2IIHA 3HVTB 3A5LC 1S6QB 4ELUA 2ZIWB 3OTOJ 2GWJA 2DTUA 1H0HB 1IBKF 5HP1A 2OD4A 2IBKA 1SJFA 1KP6A 4DTUA 1BQMB 1J54A 4O55A 3I76A 3DXMB 3VGKA 3BM7A 3D45A 3V7LA 4U9RA 2GMJA 4PHTX 4ZPDA 3WXLA 2CPIA 5DGBA 5AM3A 3RH5A 1NGAA 1GMVA 4O9MA 1WEYA 2AP1A 3BDEA 3PZPA 1RU1A 3CMAS 1K0TA 3OYBA 2VPYB 5L1KA 1GLBG 5AXLA 3HKZF 1EXNA 5J2JA 1NK6A 3CGIA 3HX9A 5EVZA 3QO9B 4LSLB 3GCXP 2A6OA 3MOJB 4RNHA 3DLBA 3CJKB 2FHKA 2MPUA 5EX3A 1U8SA 4CZLA 4C4WA 1TTHB 1NMDA 5HRSA 2HF4A 4LIWA 4DBQA 4PH5A 3A4TA 1FRMA 4Y2TA 4DR5F 4CJ4A 1BLUA 4M41A 4CM2A 5F3ZA 5AFUH 3GU3A 4E1JA 1VSJA 4O5EA 3BSOA 3K58A 3P5TL 3H2UB 3A12A 2DKXA 3F44A 3RMBA 1MU2A 3HHLC 2OSQA 4H0TB 1UVKA 3MM5A 1UWAA 1T3QA 4FJ9A 3K0SA 2HQIA 3PACA 1HWIA 1ZQKA 4CO3A 4A8SA 3M6UA 2A6MA 4B3TK 4DL4A 4MF2A 3OL7A 2W6KA 1OYEA 8AT1B 2FPHX 2LYBA 4ZLPA 5HANA 1FRXA 2B3TB 3B6OA 2W55A 1U48A 1FDBA 2ZM6J 1NKBA 2GJFA 2QA4N 2VKQA 4ELVA 3NMRA 3GIIA 4F4YA 2NRXA 4GMKA 3TAGA 1ZTWA 4NA2A 3ISDA 3GE1A 3D2SA 4O0NA 3G4SS 4M42A 1SV5A 3N6MA 4JK1A 1Y9OA 5A2QY 2ZOMA 3IO1A 1X3NA 2BE9B 4BACA 4X4OA 4ED5A 1T9XA 4FS1A 4FPRA 3JAMO 2F8MA 3KFWX 2VBZA 4CZIA 8ICYA 3J7ZT 1Q0NA 4PPDA 2N82B 1D3WA 1LV5A 3QU5A 2E3TA 2LKZA 2LQ9A 3WNHA 3UMGA 1SV0A 1MROA 3W65A 5ALRA 4ZP8A 4DJBA 2X74A 5I3PA 3NE6A 4R64A 3TAQA 3FCWA 2W9BA 5D4BA 8ICHA 1EHWA 2KKVA 2K7JA 1Z19A 3AVLA 4TKTA 2VC0A 4PPXA 5I9EB 4DV1F 1Y97A 1GOAA 1FKOB 3J7YU 1EXQA 1IR2A 2VWBA 2J7UA 3H1VX 3LPTA 1XNQJ 9ICFA 4LSNB 4C3KA 4CLPA 3Q7BA 3K1RB 3IFRA 5J0TA 5KOXA 1TK0A 4R0JA 3ZNUA 3U02A 3GE9A 2NUBA 2MB0B 4E7KA 2KVSA 2XHWA 2OYYA 1OH8A 2J5AA 2D3UA 2HMXA 2ZM6K 1LW0B 4OYIA 2I5JB 1CS4B 4WK3A 3SCXA 4QYRA 3DHXA 4P72A 1B7YB 3OA9A 1R0BG 3MCNA 2MZJA 1LNQA 3TZWA 3B0YA 1ZD4A 4P2HA 1RTHA 7ICKA 3DXKB 3AODA 1S9EA 3TTDA 5J2MB 5ETPA 1CJUB 3EPIA 4Y2KA 2WVFA 4FCYA 3VERA 4WP9A 2E2QA 2GWSA 2K4PA 3EGNA 4M3ZA 4FPIA 1ZQGA 4HUEA 2U2FA 3F2KA 4E7LA 3QEXA 3ONQA 3J81j 5D4LA 4KB1A 2HBLA 1YUWA 4I2DA 2XMWA 3PMLA 3DLEA 1TU0B 3D2EB 4ZH4A 3R5DA 4KB0A 5AXNA 2ZBCA 4CJRA 3A0HU 4FF4A 4IQUA 4P0PA 4OX9F 3P3DA 1NOZA 2VH7A 4MEYA 3WQTA 4LVSA 8ICQA 1Q8BA 2FUG9 5BRFA 4OJOA 2HPUA 4Z6DA 4PCQA 1S99A 2FHJA 4UUXA 3Q8MA 1RT4B 2HVDA 4X64J 2RMLA 4LRBA 4LRFA 1QSLA 4YMNA 5D15A 2BKEA 2ESEA 4R65A 4M3UA 2QT7A 3MXJA 2AGQA 2V4QA 2KVQE 1E6YB 4FZMA 2VV5A 3KLHB 5M1QA 4ZTJA 3WKDA 4EFAC 3DKDA 4N47A 4PAAA 4UOCA 1X4DA 1JLFB 4UASA 3OBIA 3NH1A 4L73A 2QARB 2DGZA 3R2DJ 2C42A 4ED1A 4DI6A 5AXMA 1RT5B 2XZWA 2MXYA 1IH7A 2F5GA 4RQNA 2GLEA 1HQUA 1WHYA 3E0FA 4FXDA 4YMMA 1EZZB 1KNZA 3CYMA 3RBXA 3CD6S 2VQEK 1X9JA 1BWVA 2XHCA 1C1CB 1WOQA 1R3NA 4QJVA 3TO8A 2CNNB 3CCJS 5AKLA 3ZEUB 4JS5A 3Q8QB 4IG0B 1ZM3A 3G6XA 2AWZA 2P9LA 4CFDA 1WG8A 1FKPB 3ETOA 4KBIA 4LJXA 1S6OA 3LUYA 3G86A 1GLLO 1HQEB 4A61A 4A2AA 4EYHB 3OV7A 2D1KA 2HOEA 1LWXA 5GAEU 2MJUA 1RBRA 4CHQA 3KG1A 4J5OA 4PEOA 1ZRNA 2ZUAA 2EFOA 2KXNB 4V19J 4U7UD 4E98A 1K73O 4LF9J 3IRUA 5IQ6A 4IO9Q 2E1RA 4CLYA 2VFSA 1FJ7A 3TEHB 4NLGA 3EDQB 3BGRA 2P9PB 3HT0A 3WKBA 4ATNA 4ZN1A 5LJWA 4TLQA 4DEZA 3HKWA 5JLHA 3V81A 4A8YA 3PNIA 2Y3YA 4KAZA 4BXOB 3D67A 3THWB 1NOMA 4M7YA 1ITPA 4TY9A 3HM9A 8ICZA 1D09B 3QSYB 3N4PA 2UVWA 4ZJOA 1X3MA 1BD6A 4IL6U 1HLUA 2Y1JA 1TKZB 2D3OR 1BQNA 1AB8A 4Y0FA 5ALKA 3OW2M 4ECSA 1RQNA 3KUHA 2AYGA 5M2RA 2ZDOA 5FP0A 1RDUA 1JLGA 3DYAA 2R7TA 4DQPA 4JI4K 2QLBB 2HRUA 4E8UA 1N88A 4KPYA 1NGIA 5BXIA 8ICEA 1V85A 3T6JA 2KKZA 1IKXB 3D1QA 2GAGC 3MTKA 5CYQA 4NXMJ 3QZ8A 3KD5E 8ICPA 3F56A 4WP8A 1I39A 1ZM2A 5J1EA 3DLKA 1SGGA 4M3TA 2QW9A 4ZIWA 4C4RA 3E9OA 4PY5A 3KKAC 1ZXIA 4IFVB 4XK8C 4JI3F 2VL1A 2DHXA 1MA9B 4AL7A 2E5JA 2C3MA 3CDWA 3VVUA 3W8GA 4ACOA 2E8MA 3U8XA 2E8AA 1S1VA 2QFJA 1LWEA 4KV8A 3NGKA 4KQZA 1CJTA 3AAQA 4DL7A 3IS9A 2E1FA 1W25A 3SMZA 5C42A 5A8WB 3MBYA 1TL7A 3PIOL 3HD2A 1UEUA 3UB5A 3MFIA 4RX6A 3CJ0A 1SC3B 2B43A 1JL2A 1WLJA 4IYQA 3V5RA 1IG8A 1DK2A 1WSRA 3KUEA 3POTB 2ZEJA 2RE2A 3ZTQA 5KFEA 2O4GA 4CEAA 1S1XA 4DL5A 4RCHA 3LP2B 1VQ5N 1EQMA 3CDAA 4OHWA 4FVCA 5ADXH 4DV2F 1BCMA 3SAGA 4BRIA 4RBTA 1L6NA 1CLFA 5IS2A 3HPGA 1ZQUA 2NRHA 3F73A 8ICAA 4K25A 1RZMA 2KHOA 5K8NA 3Q86A 3N4MB 1D8BA 4EZ9A 1Y11A 5D4PA 1JLAA 5H9EK 1JLBA 4FJIA 1B4SA 5DS7A 1YRUA 2MZQA 2KFYA 2G8HA 4OGCA 3AAPA 2VG5B 4UUWA 2RQKA 1HYVA 1XR5A 3G82A 2DYAA 2XLJA 4P2MA 5EOZA 3IR6B 4FBTA 4DTSA 4K0KK 4EENA 2B8PA 2BACA 2DD8S 3UCZP 2YKAA 2V4RA 1L3VA 3BEXA 2W9CB 1SZ2A 4DV7J 3C5GA 1XNRK 3SCLE 3M32A 4JI4F 5E26A 3MMBA 2FLPA 4ZPTR 4I2QA 1M1KO 1SC4B 3S01A 1G4CA 5L39A 4JKEA 4DWIA 1HJOA 2RJZA 2XQCA 3CJAA 2YWKA 3T19A 1NXIA 5B7WA 1O03A 4DPUA 3OXGA 5J2HA 3SQ0A 1VSHA 4Y2XA 1J6ZA 3G6VA 2VJ5A 3HHEA 3TJAA 3W62A 1NGBA 1HYSB 2GIFA 3RG6A 1C6VA 4I56A 1WSFA 4J9KA 3O2IA 1Q82O 3GJRB 4LD0A 2NXUA 3TAPA 2YMQA 1RT2B 3BSNA 4WIQA 2D41A 2ZJAA 5LOQA 3CJ7A 4HVJA 1BISA 2BANB 1FRHA 2ZIUB 4ES3A 3ATUA 4OI2A 2G07A 1V6HA 1QCKA 4WF9L 4PGXA 2HQFA 2DEJA 1O51A 5KL1B 4WQ4C 3IS9B 4C3MA 3PVXA 4DX7A 3KD3A 3VQ8A 2W9BB 5A8RA 3CO9A 3EVOA 4EHTA 1JJ2M 2RQCA 3RRGA 1SV5B 3BPSP 2XYHB 2XNQA 2VC1A 8ICCA 2C28A 3M7VA 2WSCC 1T94A 4O23A 3H0RB 5B08A 1XI1A 4CJLA 2IYIA 2J6TA 1M0SA 3U1NA 3DMJB 4ZKAA 1GMUA 2ZJ5A 2YXLA 1YAGA 4DV7K 2UUAK 1GT8A 4K4SA 5JVGL 4G1QB 3K5OA 5HNKA 4QIEA 1WBDA 2I2YA 1U25A 1NZPA 4U95A 4GKKK 3MUMP 2HZCA 3VGTA 2G06A 3KHGA 1AUDA 2UUCK 4UB6U 1URJA 5DQIA 2ASMA 4FK2A 4WFZA 2P5OA 3NMUA 4KGZB 2CQCA 3L09A 4F2RA 3IG8A 5GIPA 2EXUA 3N7SC 1X9MA 8ICIA 5J2QB 3H8WA 1RT6B 3K2YA 2CNKB 3BSCA 5ADZA 1EWQA 2H65B 3A2FA 3DOKB 1TUGB 2V2VA 4DZ6A 1VQOS 1LEOA 2MLXA 4YHHK 3G71S 4CTAA 3HSCA 4MFCA 3RB0A 3MCPA 1HFEL 2ASDA 5ALIA 5C0YA 1HBMA 2GVZB 3GLJA 1HR0J 4LF1A 1WTFA 4PABA 3T9NA 2HSEB 4NLVA 1X66A 2AH5A 3GSDA 2HYIB 2H5XA 2Y1RI 5KOWA 3C94A 5GAGI 3UPQA 1HKBA 4NCBA 4LH4A 5BR9A 4F3MA 4M2YA 1WCNA 5KFOA 2QEXS 4W98A 3I96A 4KH4A 2YN4A 4FDFA 5E2QA 2VB6A 2CPZA 1ZOTA 1JJ2R 3NAHA 2HWHA 2ZH7A 1NJWA 1XNRJ 3OYDA 3M1YA 5TKYA 2EFGA 4US8A 1SIJA 3X1LB 3QZ7A 5K9FA 1ATRA 3CE8A 3R1HA 2D74B 4LF4F 2Z1IA 5GAHP 1C0TA 5KAFU 4ERDA 1YVNA 2DGTA 3FEXB 3V9SA 4CT9A 1RQLA 2H9ZA 3AOCA 1K1QA 3PG9A 3W2VB 2CQHA 1ECWA 1KOOA 5AQXA 3G71N 4CF3A 1TK8A 4M9HA 4DPXA 3KLVA 5HL7L 7ICRA 4K7QA 3LP1A 3UPFA 3FE1A 2DFFA 2XLIA 4A8KA 4B1XB 2F8EX 3O9RA 3EXCX 3FVYA 3JXUA 3FMWA 2EHGA 2OFHX 2ADCA 1XMQJ 5GAEI 2W7OA 3DI6B 2BVZA 2K8GA 4YS2A 1WJ9A 4RW8A 4CD3A 2CWKA 4DSKA 3ZD9A 2RT3A 2OIHA 3PW4A 3LVWA 5D8HB 5AKXA 1X4HA 1SH3A 1LW2B 1I3OB 5IT9U 3JSYA 3UO0A 3UVJB 4HWIA 3O1BA 3IAYA 4F0MA 3JYTB 3MM6A 4RW4A 5DDPC 5DG7A 2PFFB 4XH5A 1UP1A 3GBTA 8ICWA 4FYDA 8ICSA 1KDNA 2P9IB 3AO4A 2WMMA 3H7IA 2DHAA 3G8QA 2QLTA 1QJHA 2WVBA 4DG1A 1NK5A 3LTOA 3R9LA 5ALLA 1CZ9A 4DQQA 3SPYA 2VPZB 1VC5A 4PQUA 7FD1A 4LZDA 4CDGA 5K8PA 1HWUA 1BWEA 2V7YA 1P9YA 4BCAA 2G8KA 3BZKA 1IXKA 1KKXA 2QIFA 3VGMA 4M63C 4NX9A 3HBTA 3LDQA 3I8DA 2XI9A 4KJIA 1HA1A 1N32J 1S0OA 4CF1A 4MFAA 2QJ3A 4LFCJ 3CJ5A 1U6ZA 4I68A 1ZD2P 4L74A 3RSEB 4HT7A 1UVMA 1S5LU 4FW2A 4QZCA 3ZT3A 5I3UB 3AO2A 3PFEA 2DH8A 9ICQA 4YN4A 2PFNA 3MF5A 1SZHA 4UARA 1A0PA 2BE2A 1ASUA