4DQSA

Binary complex of bacillus dna polymerase i large fragment and duplex dna with rc in primer terminus paired with dg of template
Total Genus 211
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
211
sequence length
579
structure length
573
Chain Sequence
b'KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase
publication title Structural factors that determine selectivity of a high fidelity DNA polymerase for deoxy-, dideoxy-, and ribonucleotides.
pubmed doi rcsb
source organism Geobacillus kaustophilus
molecule tags Transferase/dna
total genus 211
structure length 573
sequence length 579
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4dqsA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4dqsA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4dqsA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4dqsA01
5DMRA 4J9QA 3UQ0A 1SUQA 1ITGA 3DYAA 1TV9A 1JL1A 4GXKA 2FPMA 2ASDA 2BGGA 7ICQA 9ICMA 4TUPA 2IDOA 5FDLA 3JPRA 2ZUCA 4M6WA 4NLNA 4FS1A 1ZQBA 3Q8MA 9ICVA 9ICAA 4YD1A 3CG7A 5J2HA 1VRTA 3V7JA 2Z1IA 3ZSQA 4I2IA 1T03A 4CJSA 7ICKA 5J2MA 3DRPA 5KRSA 4UB3A 2PY5A 2BQRA 5J0TA 3LZJA 2W8KA 3OYCA 5DGBA 1GOAA 1RNHA 4YFUA 4QZDA 3RJFA 3PX0A 9ICFA 3GIJA 1NKCA 4KTZA 4Z4CA 4MFBA 4DL3A 5KFQA 2J6UA 2HHTA 3QEAZ 3PW0A 3AVKA 4RW9A 2AQ0A 1ZBFA 1XSLA 4XUSA 4ED1A 4UAWA 3MEDA 3RWUA 3T1AA 1MU2A 5J29A 4AHTA 2R8JA 3NGZA 4DL5A 4FZZA 4O3NA 4KLQA 4J9MA 2RN2A 4LH5A 4IQVA 4FJGA 3AA2A 2PFNA 4QWDA 3NFAA 1Q8IA 3PX6A 3GDXA 1BPYA 2ZJAA 4O3SA 5KFXA 3ZSXA 3NGIA 1JLGA 3AVGA 7ICMA 4DTXA 5CA7A 4J9PA 5IIKA 4DSIA 3OVNA 1TK8A 1S9FA 5KG2A 5C25A 4F91B 1NKEA 1EETA 4YG2A 1ZQMA 1ZBUA 7ICOA 5DQGA 4LZDA 1QTMA 4CIFA 5HP4A 1TAQA 4CGHA 4AH9A 4DTRA 3KJVA 3PW4A 4RPYA 2B4JA 5IIJA 3I0RA 3AVHA 3ZDAA 1J53A 1S10A 3THVA 5J0OA 2F1IA 2FBTA 2QKKA 2HHQA 3F9KA 5IIMA 1Q9XA 3O3GA 4ECQA 3KHRA 8ICKA 3DLRA 3L3VA 9ICBA 2BGWA 2ITGA 4J9SA 1UT5A 1NJWA 3G6VA 2Z1HA 2HHUA 4M9HA 1K6YA 1BPDA 2OPPA 2LSNA 3RBDA 4E0DA 2Z1GA 5DG7A 4DSEA 1S1WA 2P6RA 3EWAA 3T5KA 4CJRA 4FLWA 4RPZA 2VA2A 4JUZA 4E19A 3H4BA 1B9FA 3U3YA 3RRGA 3IHQB 2JZBA 4DFPA 3F73A 1LAVA 5KG0A 1EXQA 3ZT4A 5HHIA 3GV5B 3SI6A 4F4WA 9ICGA 3SPYA 4KLDA 1U49A 1JLBA 4CF2A 4KN7A 1WCNA 3OYFA 3K4GA 4I27A 4Z4FA 1DLOA 4DTPA 4FM2A 4J9OA 3P5JA 3JSMA 3M8QA 2D0CA 3KLIA 3TR8A 4K8ZA 3KTQA 2BANA 2VA8A 2YHBA 1ZYQA 4EP5A 4M41A 3H8JA 1BCMA 2PZSA 4MFCA 4I2BA 2AU0A 4HCBA 1C1AA 4PGQA 4Z6CA 4M9GA 1HJRA 4AHUA 4RQ6A 4M3YA 4FLTA 4B9SA 4CGJA 2DPIA 4ECUA 1A5WA 3SQ1A 5BOLA 5KFRA 2KTQA 4M42A 5KG7A 5C24A 5KFGA 1DGSA 3K5NA 3HVRA 2GWSA 1K1QA 1MSWD 3QEIA 2FMQA 8ICHA 3LANA 4W5RA 3RB0A 2BPGA 4YFKA 3AVAA 4MF8A 3SI8A 4FM1A 2R8IA 1QHTA 5CJ7A 3EPIA 4IKFA 1LWFA 5DKWA 5KT6A 2I9GA 4JWNA 4DMNA 3V6JA 4AILC 3ZDBA 4CEQA 2MUTB 4UBBA 3MDCA 3RB4A 2KZMA 1CZ9A 4M47A 4KLSA 4DQPA 4K8XA 3C5GA 1VSMA 4FJJA 1RBRA 4N5SA 3EY1A 5DLFA 2EX3A 4B9TA 4KPYA 1ZQWA 1XS9D 4CJTA 3AVBA 1ZQRA 1ZQVA 4NY8A 4I9QA 4QZFA 1SL2A 1U48A 3H8WA 4GVMA 5DBAA 4NM1A 4FLVA 4IBNA 4H8KA 5CR0A 3Q8KA 3QIPA 1RDAA 4E7HA 1UOCA 4BE2A 8ICUA 1AROP 1XHZA 5KT4A 1KSPA 3C2KA 1ZQJA 2Y1JA 1Z00B 1X2IA 3RMCA 4CE9A 3VQDA 4QZBA 4RQ5A 3OYKA 1KDHA 2FLNA 5KFOA 3O4NA 4PQUA 3TABA 1HMVA 1JLQA 2HNDA 3SUNA 3L8BA 3ZSOA 4R8UA 2A1JB 1FXXA 4JV0A 2J6TA 5KFFA 4PH5A 3V7KA 3TANA 1TAUA 1HYSA 3I8DA 1TKTA 1IG9A 4Z4GA 4KFBA 3P1GA 1T4GA 8ICTA 2WOMA 3ASMA 4UAZA 4CCHA 4O3PA 3KLEA 3IG1A 4BDYA 3OJUA 1ZQPA 4KHSA 2BCQA 4E3SA 2D5RA 5KFTA 1D8LA 1WSHA 4ED2A 4F5PA 4RUCA 4F3TA 3OGUA 5KG4A 4QW9A 2BPCA 5KFJA 4RNNA 4ED3A 1NOYA 3LP3A 3M8SA 2RKIA 4FXDA 4CHQA 1NK9A 4DTNA 4B9VA 1S5JA 1ZQTA 1UT8A 4JS5A 3L2WA 4L8RB 5L1LA 2ZTEA 4G3IA 3CFPA 1VSLA 4LH4A 4TQRA 2J6SA 4FZXC 4ED8A 4WE1A 3ZSYA 3L2UA 5IILA 5KFSA 3PMNA 1RT5A 2NUBA 2A1RA 3HPHA 1TL1A 1ZQZA 3RJGA 4J2DA 1RYSA 1JXLA 3IRXA 5DGAA 1X9MA 1T05A 5I3UA 4DF8A 4ECWA 1RCHA 3AO2A 1ZQUA 3MGIA 2UVVA 2HVIA 5DG9A 4O5CA 3A2FA 2OPRA 2IS3A 7ICLA 4BE1A 3C2LA 3OYAA 2JEJA 3FYHA 4CK2A 4BDZA 1ZBHA 3B6OA 4IRDA 4O44A 3C1YA 3S3NA 3V1RA 2QK9A 3HW8A 3RR7A 1XO1A 4DL6A 5J2PA 4FJMA 4QZAA 4B9MA 3ETLA 1S0NA 3K5MA 4FW1A 1BHLA 1S1VA 5DBCA 1REVA 4CESA 1U45A 4FJ7A 2P51A 3V9XA 3RH4A 4DG1A 2YNHA 3JPSA 1U47A 4M3RA 4B3OA 4JK1A 2LYHA 4FBUA 3NAEA 3LP0A 4FYDA 5DBBA 3MEGA 1HJPA 4FK4A 4DQRA 2PYJA 5CZ2A 1RPLA 4E7IA 1RT2A 1TFRA 2OPQA 8ICIA 2KZZA 1XHXA 2W9CB 7ICGA 1BIZA 3OS0A 3RAQA 3PVXA 1LV5A 1UWBA 1BPZA 5JS2A 3MEEA 1L5UA 3DOKA 3HSTB 8ICGA 4Z6EA 5FRNA 4F50A 3C5FA 4OKKA 4YNQA 5IIOA 3M9MB 5DK5A 1U04A 3VQQA 1IO2A 1QLNA 5HBMA 1BQNA 4PY5A 4Q0BA 3UXNA 3VQ4A 3V9WA 1BPXA 1ASUA 4MEYA 3OYNA 4J2AA 1DTQA 1ZQYA 2Q0ZX 4IQUA 4ED0A 1GOCA 2FBYA 4QWCA 5D49A 1FKOA 1KTQA 3DLBA 3C2MA 3JPNA 4BXOA 3SPZA 5J0WA 3HO1A 4RQ4A 2VG5A 4IRCA 2R8KA 3UQ2A 2FMPA 4AHCA 2BCUA 4Q45A 4RNMA 4RT3A 4ECXA 2Q3SA 3H40A 1S1XA 4DS5A 1B22A 1QSLA 4CGIA 2ZJ5A 4DTJA 2BKEA 4I29A 4I2FA 4IG3A 3KIOA 4I2DA 5FRMA 4GMJB 1VSFA 4UB4A 5J0UA 4DQQA 2IBKA 1NOZA 4M3ZA 1IH7A 3DLKA 4OGEA 4B8AB 3KHLA 4AHVA 3T5HA 7ICTA 5DLGA 1X9WA 8ICFA 3GV7B 5KFLA 4F5OA 1ZJMA 2ISPA 4DFJA 3PO4A 3TI0A 2YHAA 3LP2A 1S97A 2BPFA 1C0MA 5J0QA 2GBZA 4DU1A 4M9LA 4PA1A 2XCAA 1KLNA 4HUEA 4FBTA 4NCAA 4R65A 1S0VA 3HYFA 3K2PA 3OYDA 4Z4IA 1RT4A 1LB2B 1A5VA 1S77D 5J2FA 1BPEA 3VQ9A 3V7LA 3SQ4A 4Z4EA 1MC8A 3TAQA 4NYNA 2RDJA 5EWEA 1TKXA 4E7LA 4MQ3A 1BQMA 5J2QA 3TARA 3MR2A 4PGXA 3HM9A 5KFAA 3OY9A 3VQEA 4FJHA 4OGCA 8ICVA 5DDMA 3WNHA 4PHEA 9ICTA 1S9GA 4F3OA 4QZIA 3OS1A 4Y1DA 1S6QA 2HHWA 3C1ZA 3HWTA 5KFDA 2R8GA 4ZTFA 2ZJ8A 1VSIA 4Q8FA 1SV5A 4OJRA 3K5LA 4RZRA 1JXEA 4FLZA 4O5EA 2FPLA 3JPPA 1YVUA 3T19A 4CFAA 3RBEA 3UXPA 4M3TA 5L1JA 5FROA 4N76A 9ICWA 2FBXA 5DB7A 1C1BA 1L3SA 2UVRA 5J2IA 3ZT3A 2X74A 4KHQA 9ICIA 1JN3A 4F5QA 3KKSA 3C95A 3HVTA 4UQGA 4CF0A 3SQ0A 3ZDDA 1ZQEA 2FLPA 1JLAA 5J0YA 2RDIA 4IQTA 4PHPA 2IOCA 4ID5A 2PYLA 1ASVA 1N6QA 4Q5VA 1NK5A 1TKZA 3ULDA 4QWAA 2FLLA 2YNIA 4CHNA 4JS4A 3O3HA 3L2RA 4HTUA 4M9JA 4O3RA 2P5GA 4PHAA 4CJQA 5HMMA 1KVCA 4ZTJA 2PFQA 2KN7A 9ICOA 2XHBA 2G8WA 4M0AA 4KLIA 3JPTA 2HHVA 1ZQIA 2OYQA 3AO5A 4CGDA 5KG1A 3GIMA 5L9XA 5DG8A 4MFAA 2JLEA 3V9SA 1G15A 4F2RA 2E6LA 2JZBB 2W42A 3NF8A 1D9DA 3GILA 4DSFA 4QW8A 1PZNA 3ZDCA 3OYJA 1DTTA 1ASWA 1O1WA 3QINA 2BQUA 2PXIA 2ZUBA 5KT3A 4CJ4A 2M9NA 1TVRA 5KFYA 1ZQLA 2B21A 1XC9A 3ZSZA 5IINA 2NRVA 9ICQA 2XY5A 2AJQA 4FVMA 1U4BA 4DU3A 2XO7A 3CFRA 3MGHA 2AGQA 4M3UA 2DFLA 8ICJA 7ICPA 4B9NA 4NXZA 3QIOA 3S3MA 3OS2A 5KG6A 2X6NA 4BDPA 3RTVA 4G1QA 3DMJA 4DL2A 8ICRA 5HHHA 2V9WA 1BPBA 3C6UA 4TSXA 1EX4A 1RDCA 2XGPA 4CJKA 9ICJA 5KT2A 3OSNA 4ICLA 2C2EA 3G6YA 3AVNA 1TK0A 1RTHA 4RG8A 1BI4A 4ED6A 5KGWA 3HK2A 3M9NB 4QZCA 1EP4A 4KI6A 4GXIA 4K4GA 4CEEA 1TV6A 5CWRA 4KREA 4DOCA 4ECTA 4ECRA 3C23A 4GLXA 3NF7A 5J2AA 3TAPA 5KFKA 4F4ZA 2ALZA 4KHUA 3MAQA 4H4OA 5BPCA 2OZSA 3B0YA 5J2GA 1JLCA 3ISNC 4F93B 1VRUA 3H4DA 3QETA 3BQ2A 8ICLA 3GIKA 4MEXA 3V4IA 3AV9A 3V72A 5CP2A 1KLMA 8ICPA 3LDAA 2OPSA 2W9BA 3KD5E 4MF2A 2A1SA 3IAYA 1WSGA 2ISOA 4N41A 2NRXA 5DB9A 3PW2A 3HP9A 1BISA 3AVMA 4KKOA 4YCXA 3KK1A 4HUGA 3SZ2A 4OPJA 4M45A 4YP3A 5KG3A 3SUOA 4FK2A 4Q8EA 3DM2A 1Z25A 4ID1A 3HL8A 4FJNA 2H5XA 2HNZA 4DTMA 4K4IA 3AO4A 2C22A 5KRTA 2MUTA 2IA6A 1S9EA 3RMDA 4R64A 4KLLA 1KFTA 5KT5A 3LAMA 2VANA 1KVBA 1ZQKA 4OVLA 1JIHA 5J2NA 3LAKA 4RQ0A 4JV1A 4JRQA 5KFHA 1UA0A 1ZQHA 4P4MA 3K75D 2KFZA 4R8UB 4P4PA 4YXJA 5T7BA 5HRPA 3PR4A 1CUKA 4OLAA 3H8SA 1J9AA 4CEDA 4UB2A 4ECZA 3EZ5A 2XY6A 3AA3A 7ICFA 4CHYA 4B9LA 3GV8B 2EHGA 1NK4A 3SJJA 4TUQA 2E4LA 1FKPA 4KLUA 1ZJNA 5K14A 1BCOA 4CFDA 1NK8A 2YKNA 1IKVA 4EYIB 2D0BA 5CYQA 2P66A 1N48A 3CM5A 1CLQA 5J2CA 5I42A 5CZ1A 4FM0A 3O3FA 3TAGA 2ZQBA 1WCLA 5HLFA 5HNKA 4I2HA 3VQPA 4IDKA 3RAXA 3RR8A 2C2RA 3QEPA 1RBSA 2FBVA 2BCSA 1N56A 3U6FA 4KMUA 3C21A 1JX4A 4LZGA 4FJ5A 4E7KA 3MXMA 4FJKA 1I3AA 3AVFA 2IHNA 8ICWA 3CFOA 4KTWA 3VA3A 1LWEA 8ICSA 1RILA 4CEAA 4CK3A 4J2BA 1ZETA 3EW9A 3HPOA 3PNCA 2B6AA 4C8MA 4FW2A 1HQUA 4DSKA 2AQ4A 3OYHA 1QQCA 1K1SA 4OPKA 4DTOA 1MQ2A 4C8KA 1LWCA 2XCPA 2XRIA 3LK9A 4DOBA 4CJ3A 2BE2A 1ZQXA 3K58A 2ZD1A 3ZD8A 4OLBA 5J2KA 1A76A 3AU2A 4KB1A 3Q8QB 3LDSA 2DY4A 7ICJA 3MECA 3P83D 4F8RA 5KFCA 4NLGA 2O4IA 3M8RA 3TWHA 4CGFA 5BOMA 4FS2A 3NCIA 3KD1E 3H7IA 1S0MA 1NK6A 1KCFA 3Q8PB 3KK3A 4GC7A 4Q43A 3WNEA 1SZPA 1SL1A 4O5BA 4BE0A 4KLTA 4YR0A 3KK2A 1HYVA 3VQ5A 1R0AA 4FJLA 5HRNA 1HUOA 2BR0A 4DEZA 2I1QA 3ISCA 4DL4A 3PY8A 4O0IA 3WNFA 3OYLA 1RT3A 2ATQA 2YNGA 2JEFA 1S76D 3MABA 7ICSA 4BWJA 2F1JA 2IMWP 1NK7A 4CJFA 4DWIA 4KLMA 3ZD9A 3NF6A 8ICBA 1ZBLA 2DFFA 4E7JA 3SCXA 4NCBA 2NRWA 4ECVA 1L3UA 4YN4A 3RH6A 2G8KA 8ICNA 4LY7A 5D3GA 1I39A 2GUIA 4J2EA 4FJ8A 2HB5A 4GXJA 1RXVA 3QNNA 2HNYA 5DB6A 4RW4A 4RQ2A 3T5LA 4DU4A 4KLEA 4Z4HA 4HYKA 5CHGA 4Z6FA 5KFUA 3T5JA 3VN5A 2JEIA 3LWMA 3N4MB 3RJEA 4YD2A 3FDSA 4RW8A 1IKXA 2WTFA 7ICEA 2PI5A 1NKBA 5HMLA 4LSLA 2MAXA 4QZGA 1ZQOA 1RBUA 2FC0A 1X1PA 1S0OA 1NOMA 4BXOB 3PR5B 4P2HA 5J0PA 4FO6A 4B9UA 1TVAA 4Z6DA 4DSLA 1QS4A 3TQ1A 3NTUA 5KGXA 3TFRA 5E41A 4OKJA 4KN4A 4F5NA 1CXQA 4FLXA 8ICOA 3NF9A 2D0AA 4CK1A 3DLHA 5KFWA 4BACA 4DLGA 4LSNA 1RDDA 9ICSA 3ITHA 3RJIA 3I0SA 4FJ9A 4QZ9A 4CHZA 3JYTA 1Y97A 4GW6A 3NBPA 3LWLA 1KFDA 7ICNA 4NCGA 5KFNA 2Z1JA 4YVZA 4RUAA 3TAMA 3NH2A 4NLKA 4KLHA 1IKWA 3OYBA 1BGXT 2C28A 4YXMA 4IFVA 3DRSA 1B43A 1RDBA 5KFMA 4C8LA 4M6WB 1RTJA 1J54A 5TZVA 4RU9A 4W5NA 4KTQA 4XQ8A 2BCRA 4JWMA 5F9NA 3MR3A 3M8PA 4YMNA 3RB3A 4B08A 2ATLA 8ICZA 1X9SA 3MFIA 1HQEA 9ICXA 1CXUA 3MXIA 1WLJA 1A77A 5KFIA 3VQ6A 3VQ8A 5EWGA 3HXMA 4I2JA 1UAXA 5C42A 4XA5A 4Q44A 4RT2A 4F5RA 4NM2A 1RBTA 3HPGA 9ICPA 2W9MA 3QE9Y 1C0UA 4CJVA 3VQCA 1XSNA 4EBCA 3V6HA 2P6UA 2NRTA 1EXNA 2HW3A 5J2DA 1W9HA 1Z26A 2ASJA 1IXRA 2ASLA 3LZIA 1ZQGA 4KHWA 1S1TA 1KFSA 4EZ9A 4RQ3A 4P4OA 3C6TA 4DTSA 3CYMA 1HNIA 2ETJA 1Q9YA 2G8IA 1RXWA 1V9PA 5EOZA 1D9FA 1EKEA 4CGGA 2O4GA 2OWOA 1RT7A 4I7FA 4DO9A 2BHNA 8ICYA 3V1OA 1LAWA 1DOQA 3UPQA 4PPXA 4LVSA 4O4GA 1SL0A 3IM1A 1BL3A 1Z3EB 4QOZB 2F8SA 2XGQA 4X5VA 4JRPA 8ICQA 2B5JA 5J0SA 5KFZA 3UIQA 4I2CA 5J2BA 9ICHA 4O55A 4CIGA 3PO5A 5KT7A 1ZQSA 1RYRA 3RJJA 4EZ6A 4EBEA 1ZQDA 4XRHA 3GQCA 1ZQFA 1RTIA 1T7PA 1RTDA 3KLHA 3SUPA 4KRFA 4I2QA 5C5JA 8ICCA 4KV8A 3V81A 3NE6A 4CEBA 4CFCA 1IM4A 1WSEA 3HX0A 9ICCA 8ICEA 1JLEA 2G8FA 1KRPA 3B0XA 2YNFA 1Y88A 4GC6A 1XU4A 4KLFA 4F4YA 3PW7A 2KZ3A 5KFVA 3G6XA 4ZHRA 3PMLA 3RJHA 1YT3A 2W9AA 4W5TA 4E1NA 1YTAA 4ECSA 2OA8A 1JLFA 4M3XA 3TFSA 3ZT1A 1RBVA 3MR6A 2HHXA 1T3NA 4O9MA 1NJZA 5SWMA 1WAFA 4KAZA 4DF4A 3AVLA 3ZCMA 2VG6A 1FK9A 3NHGA 4RPXA 4CJEA 4NLZA 4CJPA 3ALYA 4AHRA 3KLGA 1VSKA 4ELTA 4DOAA 1VK0A 9ICRA 2IAJA 4ECYA 1N5YA 2VA3A 4EP4A 4FLYA 3ZT0A 4IRKA 1XWLA 4CEOA 2PFOA 4EYHB 4K4HA 4CECA 4JV2A 4HHTA 3U3GA 3EPGA 2RF2A 4E1MA 2F1HA 1WSIA 4QZ8A 4CEFA 1YTUA 2UVUA 5KFPA 4F92B 5J0RA 5DQHA 5J2EA 4O3OA 3RH5A 3QEVA 2ZTDA 3RJKA 2XY8A 1W0HA 3NDKA 4FLUA 3NGYA 3JPQA 5L1KA 1BI4B 2PFPA 3QLHA 4PHDA 4DLEA 3CM6A 2Y1IA 1SKSA 3VQ7A 3SV4A 2E6MA 5KI6A 3DOLA 3ORYA 5HRRA 2BQ3A 4R63A 3L3UA 3OHBA 5J0XA 3KHHA 3QEWA 1HRHA 3TAEA 5HROA 4FZYA 4J9LA 3RB6A 1B9DA 5SZTA 1ZQQA 4Y1CA 4O3QA 5CY4A 4DL7A 9ICUA 4KB0A 4IQWA 2W9BB 3NH0A 4N47A 1RT6A 5JS1A 1SKRA 3TAFA 1C7YA 4N56A 1A5XA 1VSDA 2VWJA 1WSJA 2I5JA 4QCLA 4EBDA 2BCVA 4CFBA 1GOBA 1KEJA 3AA5X 4CERA 2IHMA 3E2EA 2R7YA 3LPTA 4F4KA 4QWEA 3QZ8A 5IIIA 4OKEA 3VA0A 4YR3A 3GIIA 3DLEA 4H4MA 3MR5A 3OYGA 3L2VA 4XIUA 1J5OA 3MBYA 2KFNA 3DLGA 3BQ1A 4KHYA 3SQ2A 1WAJA 1HPZA 2VG7A 3AU6A 1TGOA 3ZT2A 2GV9A 2JEGA 3S3OA 1NJXA 1CEZA 2YKMA 2R8HA 2QKBA 4E89A 1VSJA 2X78A 3VQAA 1S6PA 1L3VA 5KG5A 4FCYA 3PUFA 3DI6A 2W8LA 4F4XA 2AGPA 2KQ2A 2FPKA 3ZDEA 4IR9A 3N97B 3OSPA 4YMMA 3OYEA 3DRRA 3JPOA 1QSSA 3KKRA 3MDAA 9ICNA 3ZSWA 4IR1A 2XC9A 2OZMA 4I28A 8ICAA 4UB5A 4TURA 4R5PA 1Z00A 4DSJA 4YQWA 1BVSA 3RMAA 3LPUA 3KLFA 1SKWA 4RW6A 1NK0A 3LALA 4LD0A 3BQTA 4DFMA 3OJSA 3KHGA 4HCCA 3PW5A 1C0TA 1VSEA 5D46A 1VSHA 2G8VA 2DFHA 3Q8LA 4Z0UA 4QAGA 4FJXA 4CJWA 1JMSA 3V9ZA 4UBCA 2G8HA 1H38A 8ICXA 2A1JA 3BGRA 3ISBA 5JUMA 2X6SA 4J9NA 3Q8SB 3O4QA 7ICIA 3QEXA 3LP1A 5L1IA 2KW4A 4I2PA 4DS4A 4CF9A 1HNVA 4CF8A 3SV3A 3SNNA 4TQSA 3BDPA 3OYMA 4KLOA 2P1JA 2DFEA 3L2QA 3Q8RB 2ZE2A 5EWFA 2HHSA 4DTUA 2XY7A 3H08A 2PI4A 5DDYA 2HVHA 4IG0A 4R66A 4I9LA 4EEYA 4MFFA 4IFYA 3QZ7A 3EYZA 4UAYA 3RRHA 2DTUA 1CZBA 3K5OA 3QERA 3OYIA 2P5OA 2WONA 4KLJA 4HUFA 2JGUA 4I2GA 3E01A 4W5OA 4DQIA 1KVAA 3OHAA 7ICRA 1RT1A 3UXOA 2UVWA 4NYFA 1L3TA 3S9HA 3BJYA 4TUSA 1C6VA 3AVIA 3AUOA 3CQ8A 3V6KA 3PX4A 2G8UA 1JL2A 2F8TA 4W5QA 5DB8A 3BQ0A 5EU7A 2F96A 4I2AA 1UA1A 4C8OA 2RPIA 4RNOA 1WSFA 4PGYA 1COOA 7ICVA 4B8CA 4KHNA 3V1QA 3NH1A 3QEBZ 2YV0X 3RMBA 4CJLA 4ELUA 2IGIA 4CJUA 4J9KA 3K57A 3SUQA 3ZSRA 4F2SA 4I2EA 2V4QA 1F21A 5KTQA 2IC3A 3B6PA 3AVJA 3C94A 4QZHA 3ISDA 4M2YA 4O0JA 4RQ8A 3HT3A 1HYZA 4PUOA 4FK0A 1LW2A 4M04A 4YMOA 1JXBA 4CF1A 3HP6A 3G0ZA 3HJFA 3G10A 4KI4A 3K59A 3IS9A 4YR2A 2BDPA 3NGDA 1S1UA 4RQ1A 2ZUDA 3PV8A 1ZQCA 3MFHA 9ICLA 3AVCA 1ZQNA 1XI1A 1ZBIA 1TK5A 3VQBA 3GFKB 5CB1A 1TKDA 4PWDA 4CEZA 3SYZA 2VWKA 4FJIA 4QWBA 3T3FA 9ICEA 8ICMA 1WNSA 5J2JA 1JKHA 4M3WA 2V4RA 4RW7A 4JLHA 4UB1A 2DPJA 4AHSA 4RQ7A 7ICUA 2W9CA 5KFEA 4C8NA 2NRZA 4CHPA 5DQIA 3AA4A 1MQ3A 4ED7A 1D8YA 4BWMA 3V6DA 9ICKA 1LW0A 4ELVA 3AO1A 3M9OB 5CYMA 1D5AA 4KITB 1C1CA 1ZQAA 7ICHA 1TL3A 1U9LA 2QXFA 3QNOA 2HMIA 1IKYA 1WN7A 5J1EA 4M9NA 4DFKA 1B92A 1XSPA 4ZH4A 2ZTCA 4CIEA 3D45A 3D0PA 1NJYA 4J9RA 1QSYA 3FFIA 3ZSVA 3MXJA 4O5KA 1BIUA 3QESA 1T8EA 3QO9A 1HUZA 5F9LA 5D4BA 4BGDA 1RZTA 4KLGA 5HRSA 4DQSA 1QE1A 2AGOA 3WNGA 3AO3A 4QZEA 4CJ5A 5HP1A 2FMSA 4CHOA 4HVJA 2C2DA 4KO0A 5KFBA 3V9UA
chains in the Genus database with same CATH superfamily
3UQ0A 1SUQA 3PSFA 4URSA 2FPMA 3QUQA 2ASDA 1RWNB 4F0KA 4WFBL 1QHAA 2ZDPA 3SMSA 2EFVA 4TUPA 5FDLA 1LKYB 2IDOA 4OYIA 1AYEA 4NLNA 2F65A 4K0KF 4JK9A 3BZKA 2C2MB 4P10A 1WI6A 9ICVA 4NLPA 4YD1A 5HR7A 2N82B 3CG7A 2V63A 1PJ7A 3ZSQA 3LQVA 2E7VA 4AXIA 2A1AA 3Q83A 5J2MA 1KW4A 3DRPA 4UB3A 4KGVB 2AT1B 3C6TB 5AQOA 4AFFA 1K0VA 4FNHA 2R2RA 2BQRA 5G0RA 2CJKA 2PKEA 1WG5A 3KLVA 2AHOB 4KH5A 1N33K 2F4FA 2Z2ZA 1GOAA 1RNHA 4YFUA 3KVGA 2Y0SC 2J0WA 4GRSA 2DT9A 4KTZA 4L72B 2N7YA 2A6OA 5AIAA 3QB0A 3BZQA 4RW9A 1XSLA 3IBFB 3CC7S 4UAWA 2WZ1A 3PJ9A 2BE7D 4YDUC 3LH2S 2N3LA 3O6WA 3HVAA 1EKRA 2ZUGA 4DJBA 4J9MA 2CJAA 2V50A 1WOOA 1K44A 5AKKA 4ID5B 4FJGA 4OV6A 2H5EA 4J37A 3V81B 5DM6Q 5AXLA 4ZPDA 3R9LA 3TSPA 2YWWA 3GDXA 3NGIA 1T9WA 2WK4A 1S79A 3ZZUA 3AVGA 2GW8A 4ZHRB 1SWWA 3BP8A 1VQOS 5CA7A 4J9PA 1CG2A 2CQIA 4LFAJ 1SC6A 3SAFA 1J27A 1TK8A 2E2NA 4MHVA 2LVWA 1NKEA 4YG2A 4LR7A 4GO7X 3BS5B 1ZBUA 4KJIA 1KAYA 3GCXP 3EXYA 1QTMA 3B54A 4CGHA 4DTRA 3PW4A 4RPYA 5AJ3F 4H0VB 4PWUA 2QWPA 3IXQA 2HG4A 4B3MJ 4K41A 3IP0A 2C2KB 2GHVC 3KHRA 4KY3A 8ICKA 5B0EA 3PKMA 2LFVA 9ICBA 1RAEB 4DQ8A 4OO1J 2VONA 4IS7A 4EHUA 3G6VA 1ILYA 1HLWA 2LU2A 4M9HA 2OD6A 3EDRB 2LSNA 3H6EA 3RBDA 4UARA 4E0DA 4JI2K 5DG7A 4DSEA 2XS7A 2P6RA 4OYMA 1XR7A 3WKEA 2PN6A 2IM2A 1LWXA 3EZOA 1B9FA 3U3YA 1K73T 3IHQB 3MM7B 4ILGB 4GVLA 4UW9A 4YOYA 2QJ3A 2QLWA 1LAVA 1ATSA 1T44A 4LQ3A 2I7PA 3SPYA 2DHHA 3Q7BA 4KN7A 1X5TA 3QWUA 4MLHA 1WD6A 1IR2A 2FVRA 3UKRB 4F3MA 2C3MA 4GV3A 3UQSA 4DTPA 5F1XA 4FM2A 4HKQA 5AKEA 3M6WA 2RQ5A 3THWA 2D0CA 3KLIA 4FPIA 1X9XA 2YHBA 3E9LA 2OXOA 1ZYQA 3H8JA 3KUHA 1Z2LA 3RAMA 2VQFJ 4PGQA 4Z6CA 4M9GA 1HJRA 1NO8A 2BUNA 2DPIA 3EICA 4HT7A 3D6MB 1A5WA 5BOLA 7AT1B 1DQ8A 1F44A 4GO5X 3ADAC 5HN0A 4AQYJ 1YIJS 3FLCO 1DGSA 3I8BA 1K1QA 1MSWD 1YVFA 4DU8A 3NVWA 4W5RA 4PPDA 4OI0A 3DNCA 1M5HA 3KK1B 5MLCV 1O13A 4MF8A 3U26A 1QHTA 1R43A 3WQTA 3EPIA 1WWHA 4IKFA 1LWFA 4NZ6A 1S7IA 1YBAA 2J0SD 3CHWA 4DMNA 2MGZB 3QU7A 4CEQA 1HEKA 1C0FA 3MDCA 4UBBA 1KQSM 2WAQD 1FERA 3M32B 3THXA 2XMJA 4NXMK 3BV8A 1S6PB 4DV0J 4Y2CA 3EY1A 5BPLA 2EX3A 2W4DA 4KPYA 3BR9A 1XBWA 4G6VB 1ZQVA 4NY8A 3HX9A 1U48A 2CPZA 3HM8A 5DBAA 1ITPA 4CE6A 1KQGB 1GQEA 4IBNA 1UVIA 1CS4B 2D3ZA 1RDAA 1RYUA 4C1NI 1HNXJ 1Z4UA 1VQMS 8ICUA 2QO3A 1AB8A 1RG6A 5DDQC 2O8CA 3HHLD 4TYAA 5FPEA 3RMCA 3P49B 3OTDA 2HFZA 3VQDA 3VF0B 4QZBA 4RQ5A 1PUZA 2A2CA 1GMWD 2VFUA 5CYQB 1C0TB 4NXNK 1FE4A 1BA0A 4PQUA 2LBOA 3D2WA 1HMVA 2DO4A 3DXKB 2K4PA 3D68A 2DRBA 2HNDA 2BM0A 3L8BA 4U7UD 4R8UA 4JI6J 1URJA 4YOXA 2J6TA 1SV4A 2B0CA 3DLLQ 4PH5A 3D6FB 1RHMB 3EJMA 2IFXA 4NYPA 5AQMA 3TANA 1TAUA 1HBOA 1TKTA 3KG1A 3CJ4A 3KWMA 2B4OA 3IG8A 1HNVB 2WOMA 1G7CB 5E0OA 4LF5F 2ZH1A 4UAZA 3PJXA 1HNZJ 4OZ5A 4Z94A 4CCHA 2OEMA 2PSZA 2QEXS 3FBFA 4LF6J 1ZQPA 3UKUB 1RKIA 2EPIA 1F9EB 2F76X 3FMBA 5KFTA 4CZEA 3ETOA 4LVNP 3GU3A 3F2DA 1WSHA 1P6TA 5ETTA 4ED2A 4RUCA 3OGUA 2WSCC 3QU2A 2BPCA 3W62A 3KUGA 2UYTA 5KFJA 4IG0B 3NVKA 3CIZA 2RKIA 4FXDA 3HFVA 4CHQA 3CCLN 1FW6A 2YJFA 1ZQTA 1UT8A 2ZJPQ 2XI2A 4L8RB 2ZTEA 2HZCA 3K1ZA 4LF9J 3Q23A 4TQRA 4WF9L 2J6SA 4JI5J 4WE1A 3ZSYA 3QU4A 4CLPA 1SQEA 2GO8A 1FX2A 2QB0A 2J4RA 4CIOA 2X1BA 3PMNA 4C7ZA 3HPHA 4NWIA 2P9EA 4J2DA 4U7BA 1OSCA 5AK6A 3CIPA 2F8HA 4URGA 5ALKA 1PVQA 3ZLJA 2DNGA 2XZDB 3AO2A 1ZQUA 1GFWB 2HVIA 4ILMA 3AQEA 3NMAA 3UW1A 4PHTX 4C0ZA 3AGKA 1UHUA 3MMBB 4CK2A 1TL4A 1U8WA 4BDZA 1YJ7A 1ZOLA 4OX8A 1L3KA 1ATRA 5B0AA 5B0BA 5J2PA 1X42A 2YH0A 3IS9B 4CDGA 1O6XA 1S0NA 2W2OP 3K5MA 4FW1A 4X64J 2R7WA 4RW4B 4CESA 5A8RB 5AQLA 3RH4A 2HQDA 4OZ3A 4DG1A 2X3DA 5K8MA 1QVGR 4E2FB 3KJNB 4M3RA 4JK1A 1A9NB 4FBUA 4JD2B 2CQ4A 3MGVA 3NMRA 2ZIVB 1HHQA 4FK4A 4DUTA 2Q66A 4E7IA 2N4DA 4ZVPB 1S4EA 5GADI 1Y5LB 3NWGA 1TFWA 1S57A 1XHXA 4F7VA 2W9CB 7ICGA 2I6XA 3OS0A 1P9QC 2EWSA 1LV5A 1UWBA 3SEIA 5H1SQ 5C2GA 2VICA 2G4BA 3DOKA 2BEFA 4ZOHC 5ALPA 3I4HX 4DV6K 3VQQA 1IO2A 4TLQA 1DZ5A 3UXNA 4OYAA 5HVGA 3KHYA 1BPXA 1ASUA 1NSKL 4AE5A 2M8DB 3BM7A 3OYNA 1DTQA 3HHEA 1IQZA 1Q8BA 3TAMB 4JKHA 2RQ4A 1G2EA 5D49A 1FKOA 2UXBK 1ZBTA 1Z1BA 2FJWA 3G71N 4C7YA 3FZ2A 3VTIA 1WHXA 2VG5A 4DR6K 1WSRA 3M1FA 3FCHA 2BCUA 1RTJB 1V97A 1S1XA 5G5HA 2CVEA 4D3HA 1XNQK 1UMJA 5ETOA 2WF5A 1N61A 1B3TA 3N7RC 3QQCD 3KIOA 2IDEA 5FRMA 1VSFA 3SDEB 2BKNA 4M3ZA 3VAKA 1B99A 4HHHA 4Y65A 1WOPA 2HVDA 1X9WA 8ICFA 4FF1A 3GV7B 3T1HJ 3BGLA 3A5OC 4C8YA 2ISPA 5HQMA 4PKGA 3LP2A 4JI0J 2NV3A 4FSVA 1C2PA 1RISA 2LQJA 3D7EO 3RW6A 2KSOB 1C0MA 2CJXB 3DCAA 1N5TA 2GOLA 2FZGB 1K73O 3O3LA 3HZ6A 4PA1A 2MU2A 5GVQA 1HKBA 3D6RA 4R65A 2FJVA 3K2PA 5ADXA 2AYEA 3CGIA 1S77D 2HKEA 3VQ9A 3A8YA 3TADC 2KHCA 3TU5A 2KT5A 3DDKA 4M63C 4QR0A 4E7LA 5J2QA 3MR2A 2F9TA 3OY9A 3CDEA 1NXIA 4B3MF 2QT7A 1REGX 3VAJA 1SAZA 2FHJD 4OGCA 1S59A 4YOWA 1MU2B 4F3OA 2HHWA 4CJ7A 5KOXA 4DHVA 3C1ZA 2LKZA 3PEHA 1KD1T 4F0HA 4QIGA 2DXDA 2R8GA 1RE1B 3GYXB 1PK3A 1VISA 2J9EA 4KE5A 4P6QA 2KYXA 3HMJG 2W03A 1N32J 2ZH9A 3K5LA 3L6QA 1JXEA 4FLZA 2FPLA 2XWXA 1YVUA 4CFAA 3CJRA 4YN3B 3UXPA 4M3TA 5FROA 3MMCA 9ICWA 2FBXA 4ZLLA 3CE8A 5D0RA 2X74A 9ICIA 1JN3A 4F5QA 4DBQA 2R2TA 1SXLA 2Q3PA 3HVTA 1YJRA 1JLFB 3KJVB 1DQAA 5J0YA 1CULA 3MAAA 1VQPS 4FP9A 2A3VA 3E9PA 1YI2N 3IFRA 2UP1A 1B4FA 4QWAA 2YNIA 4CHNA 5D0HA 3H1VX 4JS4A 3O3HA 2GJFA 4O3RA 5HOOA 4USVA 1PJ6A 4OZ0A 2B8QA 3LOUA 2XHBA 1YF5L 2G08A 4AQYF 3FUYA 1ZQIA 5KG1A 2ZGYA 3G4SN 2A42A 3US5A 4IXCA 2CA9A 3SSRA 2QYCA 3G6ES 3V9SA 4U6PA 2W42A 2G06A 1YRUA 1D9DA 4DSFA 4QW8A 2RS8A 1VCTA 4ILHA 1DTTA 1ASWA 3AODA 4BX9C 1X4AA 3KJFB 5BYRA 3EKUA 2B56A 1JLBB 1F2GA 5G5GA 3KMQA 5KFYA 1ZQLA 3D7SB 3ZSZA 5IINA 2PT0A 4BR0A 4LQ9A 5GAEI 3CJ9A 1OVYA 1V38A 2K7JA 2PO4A 4DV0F 1PC4A 4M3UA 5AQHA 4RX6A 2CPJA 3MPWA 4B9NA 3OS2A 1UEKA 5ALDA 2DK2A 3POTB 5LSLA 3BKUA 4QU7A 5E3CA 1UJ6A 2K8BB 3ELHA 3TO8A 5HHHA 2ZH7A 3IBCB 1BPBA 2ZIWB 1EX4A 5C24B 5CHCB 1KAZA 1IWGA 3M2VB 9ICJA 2P35A 4ICLA 2HHHF 3M9NB 3DGPA 4GXIA 1TV6A 4CVNE 4KREA 4ECRA 3MN9A 3C23A 2VH7A 3ENWA 1RHJB 1TMMA 3J7AN 4UF4A 4IUFA 1GEHA 2WFBA 2ALZA 2DHAA 2Q1LA 3D28A 4UZBA 1TR0A 1HR0J 3QFPA 2GQ2A 4MYUA 1JLCA 3L4BC 3QETA 2KU7A 3BQ2A 3V72A 3LDAA 2OPSA 4DR4K 1NMDA 2W9BA 3KD5E 3X1LB 4MF2A 4XTTA 4AT1B 2B51A 4J9VA 3MPDA 1HNZF 3T9ZA 2HLUA 3ENOA 2PE8A 2VU5A 4LF6F 1F5SA 4YCXA 3CULA 1RBAA 2P6SA 3FK4A 1S3XA 5KG3A 1Q95G 1WBDA 1Q53A 3VENA 1WHWA 1RK8A 1CC7A 3R6GB 1YGYA 3BH7B 4ACOA 1WJ9A 3O44A 4K5SA 3UD5A 3GG1A 5KRTA 2ZKUA 1S9EA 4X62K 1FF2A 3RMDA 5KT5A 4LF9F 4H5TA 1KVBA 3KLFB 4JI7J 4CNQA 4JI5F 1JIHA 3CJ5A 1SXDA 3LAKA 2VHGA 4JRQA 3EZWA 1YUWA 3K75D 1YJVA 2HBMA 2KFZA 2A2DA 4KPCA 1FESA 1T9YA 4YB7A 4YXJA 4OLAA 1N5XA 3OR2B 1NGEA 3H8SA 3A5LC 4UB2A 2CFXA 1PAEX 5JVGQ 1ZBSA 2QM1A 4KFBB 4B9LA 2EHGA 2YTCA 4TUQA 2BE9B 1ZOTA 4KLUA 2AJ0A 2XWYA 1TUVA 3FZLA 3LP1B 3KLEB 5FP0A 4CFDA 4HDGA 4P9SA 3SEOA 2OHFA 2ZM6F 5JXSA 4EYIB 2NXUA 3KWGA 4WU2A 2C3UA 1EB0A 2P66A 1TYQA 1KR4A 2OEKA 4MTPA 1CLQA 4HH0A 4GY2B 4JK8A 4FM0A 2W04A 4P73A 5HLFA 2E5IA 4I2HA 3SCIE 1SJ4P 4IDKA 3RR8A 2C2RA 1P8ZA 5AT1B 4KMUA 3G71S 3C21A 1HJOA 1HL6A 2HZVA 3O9UA 4LZGA 4FJKA 3AVFA 4IFYB 3TP2A 3IWLA 3EVOA 4KTWA 4HL9A 4J2BA 5HQLA 1WNEA 5ETKA 2B6AA 2QA2A 4FW2A 4ZN3A 4K0KK 4H0TB 4CZCA 4BY9C 1QQCA 1T02A 3O9TA 1MQ2A 1T9VA 2Q36A 1VAZA 4YY3J 2XRIA 1OMSA 3SMZA 4CJ3A 3P5TL 4CWBA 2H4WB 2ZD1A 2KJ9A 4RUBA 5I3UB 2NSBA 1S6OA 1PG5B 3LDSA 2DY4A 1J2MA 2YY6A 3H5YA 5IT0A 2EC0A 3A3PB 4F8RA 3AJ1A 3H98A 4NLGA 3TWHA 4FS2A 2ZUAA 3KD1E 3H7IA 1NGJA 1RWWB 1NK6A 4L6V3 4PRFA 3PIOQ 1KCFA 1CJTB 4Y0WA 4M5LA 4Q43A 2ZVIA 2G1DA 4BE0A 2A18A 5AQXA 2CQHA 4FJLA 5ALJA 2KT3A 1HUOA 3GR0A 4DEZA 3QT5A 3PY8A 3N4PA 1IJFB 3OYLA 4A4JA 2QX0A 4PXCA 2KHQA 2LI6A 4BRDA 3MABA 1N5QA 4USUA 2HFVA 1S1UB 1UTAA 2VIXA 2IMWP 4OYXA 4DWIA 2FJDB 3D6HB 3F2CA 4NOHA 2H9ZA 2OTJN 2QXLA 8AT1B 3D4JA 8ICBA 1ZBLA 5AQGA 2P9LA 1WORA 3SFUA 2DFFA 4A8XA 5EUHA 2KNJA 2NRWA 3R1LA 2VKQA 3R1HA 3RH6A 2G8KA 4LY7A 4OHVA 2CG4A 5D3GA 3M30B 2EWHA 3PLAA 3T1HF 2ZC4A 4BRMA 4HHUA 3TQEA 3KZBA 1KD1O 2Z58B 5DB6A 2GMJA 1T3VA 3QUTA 4JI0F 2DEIA 3T5JA 1T9UA 5AJ3K 3VAHA 7ICEA 3ZX3A 5HMLA 2NYIA 4LSLA 1GH8A 1KKXA 2VIHA 2J7KA 1RBUA 4UZCA 1TL3B 2EFPA 2XSJB 4BXOB 3NAIA 1X1PA 2V2ZA 1FVSA 2WSFC 3IAS9 4FO6A 4B9UA 4DSLA 4NA3A 3IA0A 4L3NA 4OKJA 4F5NA 3EN9A 3FFIB 4B02A 4LSNA 1YVNA 1RDDA 2XZTB 1S72S 3JYTA 5I9EB 1V5VA 5AQIA 3Q8UA 4KHPJ 1VIOA 4LF4J 4MLEA 5EE1A 3DLKB 2C42A 4OPAA 5KFNA 4RUAA 4NLKA 4KLHA 3W9JA 4RPFA 2W40A 1GLDG 3OYBA 2C28A 2W7PA 1EWRA 4IFVA 4FPBA 2W1BA 3G4SS 3C8YA 1KQKA 5EDWA 2H3QA 1N32F 5T14A 4WQ5A 2F63A 5TZVA 1J54A 3TUIC 1FNMA 1DXSA 3CCQN 4CRJA 4X65F 1IG6A 4JWMA 4L3QA 1UFKA 3NWRA 2OEHA 4YMNA 2UUCF 3MFIA 2ZEJA 3CD7A 1CXUA 3OL7A 1K47A 3QWPA 3VQ6A 1T6DA 2EC2A 2CQGA 1UAXA 5C42A 4RT2A 1IR0A 4M95A 4F5RA 1P27B 3HPGA 1JNZB 9ICPA 4FF2A 3VTHA 4KGZB 1LKYA 3VQCA 1XSNA 4EBCA 1NG9A 2I2YA 2RP5A 1SJ1A 4IYQA 2NRTA 1DFDA 2MQQA 3LF0A 5J2DA 2VB6A 2E5LJ 1GLBG 2ASLA 1BWEA 2EKNA 3LZIA 2OTLN 3FBBA 1KFSA 3JSRA 3C6TA 2K1RB 3CD6S 1LFPA 3CYMA 6AT1B 2G8IA 3TX0A 2M8HA 1D9FA 5AHXA 5BJRA 2MSTA 3I1YA 1NHVA 3C65A 3GYGA 3V1OA 5BRFA 4AM7A 1RWVB 1JLGB 2CNLB 4LVSA 4PCQA 4DR7F 3O80A 3IM1A 1BL3A 4QOZB 8ICQA 5C25B 1OY8A 4BRPA 2VL1A 1EETB 5A0YB 3N01A 4CIGA 1M5OC 2KM8C 5LJWA 1KC8T 5KT7A 4B17A 3CDAA 2HFOA 4EBEA 2ZH8A 3GQCA 2VWBA 2R7OA 1TKZB 2MHNA 4LFCJ 5ALRA 2W2PP 3VZHA 4XDDA 5C5JA 1VHIA 1J97A 3FFKB 4NRUA 3V81A 2R7QA 1VQLS 1IM4A 3BGOP 1WSEA 3HX0A 1ZD5A 3IRUA 1KQFB 1JLEA 1H6KX 1Y88A 3CMEN 5FPDA 2OD4A 4F4YA 2GX9A 4TU8A 4ZHRA 3MN7A 3RJHA 1UVNA 2LEAA 4ZMMA 2W9AA 1Q5VA 5AM4A 2A6AA 3U7JA 2OPPB 1QQ5A 2DNZA 3GLJA 3KZXA 5LM7E 2Q79A 5DZ6A 3OTCA 5A8KA 3H90A 3UCZP 3MR6A 4WP8A 4OJ6A 2W4CA 4K7QA 1Q7YT 3AD7C 1JMTA 3BO3A 1F6TA 1RDRA 4CJPA 2NYHA 4AHRA 2Y9HA 2YPYA 4DR5J 1TVRB 3O5BA 2MMYA 3K8WA 2W01A 9ICRA 3VF4A 2XBPA 3VGKA 4MIWA 5EX0A 2GELA 1N5YA 4PZVA 3SBTA 4NO7A 4CEOA 4EYHB 3M8QB 4K4HA 2HF4A 2B9WA 2D9PA 3V5RA 3CB4A 3R8YA 3MM5A 5LL6Z 4NLYA 1WSIA 2IHR1 2QTDA 1K8KA 4ETZA 4CEFA 1YTUA 3MM7A 4F92B 3FR0A 3UM9A 1T3OA 2JH3A 3RH5A 2XY8A 3MPYA 3JXUA 2WF7A 2RLTA 1W0HA 2KO1A 2VD3A 1BI4B 4AF1A 2PFPA 1SXEA 2MKJA 2ES6A 2WBNA 1VC0A 4KH6A 3DGVA 4DLEA 3UKRA 4JI7F 2XM3A 1VGYA 3DOLA 1IV8A 1YRXA 5HRRA 5J0XA 3THYB 3QEWA 1HRHA 2BJ7A 3D2SA 1ZQQA 1VRUB 4Y1CA 4O3QA 1UL3A 5CY4A 3VPZA 1KLMB 1DK2A 4DV5J 4RQNA 4HTIA 1SZ2A 5KQDA 3CCTA 4N47A 1TELA 3TAFA 4NRTA 4N56A 1VSDA 4WQ5C 4QCLA 2ZH5A 4DZDA 4KKOB 1GOBA 4CERA 5EOYA 2R7YA 1RM6C 5IIIA 3D0IE 4YR3A 4ID8A 1ZTWA 3OVSA 4CT9A 4NV0A 1RAOA 2NLWA 2R7RA 2JNJA 3CQXA 3CJKB 4XIUA 3L2VA 2Y8WA 1WUAA 4KHYA 5LOQA 4GIBA 4RL1A 2MGZA 3ZT2A 2QIFA 1NPKA 2GV9A 1Q7LB 3FMWA 3M32A 1CEZA 1FDNA 3JS6A 1S6PA 5DRKA 1L3VA 2OTJS 3SD7A 3VR1A 3ZDEA 4O4RA 4YY3F 4NLBA 3W3SA 1JLQB 1DJ0A 3LVWA 3QSYB 2FDNA 3UMCA 2OYYA 1QSSA 1CS4A 3ZSWA 2JFDA 1GLFO 3MCPA 4BC3A 4OJ3A 5FPMA 1NNLA 2QMUB 4UB5A 4TURA 1S5LU 1RP5A 4DSJA 3ID6A 1BVSA 3RMAA 2KLAA 4X4SA 4CBUA 2CQ2A 3BBFA 3D54A 5F0XA 4JI4F 4HCCA 2PA8D 2J9CA 1C0TA 2BDUA 4J5OA 2JMGA 5D46A 1K0TA 1KHWA 1VSHA 3AH6A 2DF4B 2G8VA 5CRXA 1HHSA 2WC9A 4EENA 3CDUA 4IEEA 3Q8LA 4FJXA 2MSNA 1JMSA 4NLWA 2IOFA 5JVGL 8ICXA 2M4MA 1LWEB 5JUMA 4CLSA 2X6SA 2V7ZA 4J9NA 4PWWA 4A8MP 4PQAA 7ICIA 2J9DA 3CTRA 2Q4TA 5L1IA 1HNVA 1XR5A 2ZWPA 3CCES 3SV3A 1NGFA 2WB1C 3RJMB 3SNNA 4C3MA 4TQSA 2OCEA 1EWQA 4KLOA 1FRIA 3OW2M 3A4TA 4JN4A 1HWLA 1ACMB 2F40A 3CWJA 2P9PB 2CQCA 1NHUA 3NVVA 3KOAA 2ILZA 1KN6A 1L7PA 1QQOA 3MECB 2LMRA 2I0XA 2DKXA 1X9JA 1FJEB 2DNLA 2HVHA 4IG0A 4R66A 3MK6A 5CCLA 1I5OB 2CADA 4CLFA 3EYZA 4KHMA 2RRNA 4A8FA 1RCOB 1VK3A 1J2NA 2V2KA 2I7NA 3K5OA 5AQTA 1WF2A 2XMVA 3RGIA 3FAHA 4B3MK 3RW7A 1V3ZA 1KVAA 3OHAA 2YB1A 4I1TA 2YN4A 2CJ9A 2KE7A 2BW2A 1R59O 5EE3A 3SFGA 2VQEJ 3AVIA 2YNGB 1GX5A 1KQSR 2L3MA 2G8UA 2FHMA 2WB1F 2F8TA 5DB8A 5EHHA 3DOMA 2CZ4A 4PABA 2F96A 3QMLA 3NNHA 1REVB 3C0BA 1Q82T 3HDSA 3QEBZ 3RMBA 4ELUA 4C4WA 2IGIA 3O4WA 1TUYA 4LSZB 3K0SA 4J9KA 3K57A 4DV1J 3B78A 3PIOL 3N6MA 2G9OA 2V4QA 4LF4F 2CVIA 2O8FB 2N7CA 2QV6A 1NZAA 2EFQA 5AQFA 4RQ8A 3HT3A 2E3TA 4RQMA 2X51A 2AYGA 3ILOA 1HYZA 3ZEUA 4I69A 4FK0A 1N5VA 2ZF5O 4CF1A 1FA0A 2W2QP 1O0PA 3HJFA 3P45B 1L7OA 3IS9A 2ATCB 4P2FA 3CETA 3H0RB 2ZUDA 3PV8A 1SH2A 5A8RA 2VPWB 3I9V9 1ZQNA 1IKXB 3HTVA 1XI1A 3D0HE 5LSOA 1TK5A 5HBMB 1TKDA 2H3GX 4CEZA 2JHEA 1OO0B 2DPNA 3OLAA 1VI7A 2PMWA 4X66J 3SLCA 4Y2XA 5K20B 9ICEA 4BC5A 8ICMA 1RLCL 1WNSA 3LDLA 1OPZA 4MJKA 3GCWP 4JLHA 1GMUA 4RQ7A 1F5CA 2D0OA 7ICUA 4AQYK 2W9CA 5KFEA 1KC8O 2OAUA 3A0IX 5DQIA 2DGZA 3WIUA 4M94A 5M1NA 3I0SB 1VLBA 4BWMA 3D6JA 1VYAA 3OFHA 4ELVA 4ER8A 3M9OB 1MWKA 4ZOSA 2JZ5A 1D5AA 1QQMA 1WN7A 5J1EA 4BS2A 1B0XA 2OI2A 2FPHX 4H0XB 3MD3A 2XB2D 3D0PA 4CZJA 4J9RA 2E9TA 4DV0K 2XQCA 3HHKA 4DB3A 3ZSVA 3MXJA 2D7SA 4O5KA 1BIUA 4Y00A 4CO2A 2F3JA 1Q7YO 4LT6A 3WNGA 4AYBC 3AO3A 4CJ5A 2C2DA 5KFBA 4NZ7A 2QGFB 1HNXK 1K5OA 5DMRA 5ALLA 3SDEA 1RT4B 1ITGA 1TV9A 3I55N 4JI3J 3MHYA 3RSEB 1JL1A 2BGGA 4N7TA 3A0BU 1FD8A 3NGTA 1C0UB 3JPRA 2E7XA 4FS1A 1ZQBA 3ICLA 2HBLA 2PC6A 1ATNA 4WWSA 3C3LA 1U1OA 4ZVTB 2KSOA 3IM8A 4I2IA 3IR6B 4TU7A 2B0GA 1NRKA 2VKRA 1TL7B 1TE2A 3OTOJ 1HNIB 4OI1A 2LPEA 1H73A 2P9SA 4QS7A 3H7HB 3B9JA 4AYBF 1RT7B 1UW9A 1ZM2A 4I7FB 3PFEA 1IBLJ 1HNZK 4P71A 1IWAA 2AX1A 3M6XA 1NKCA 1S4FA 3P8BB 4DL3A 4LF6K 4DR5F 3PW0A 3NAHA 3NS1A 2R7XA 2B5JB 3NGSA 3AVKA 3AY0A 3T1AA 1MU2A 5IM0B 1XMOJ 1CLFA 4P2MA 4E8UA 4A5AA 5A2QU 4FZZA 4O3NA 1CJVB 4XK8C 3W65A 3OL6A 1TU0B 3EVWA 3M2UA 2EAPA 1FIQA 1TAMA 4IQVA 2IM1A 3AA2A 4KV8B 4LF9K 2XLKA 3ZZRA 3D0GE 3DXMB 4JI5K 4OJ1A 4TKTA 4O3SA 3O9SA 1VMBA 4FXWA 7ICMA 4YEAA 3H2VE 5IIKA 4DSIA 3OVNA 1VDVA 2OIHA 4HVZA 5KG2A 1SWVA 4ILJA 3WKAA 2RHQB 3G8QA 4PZNA 1ZQMA 7ICOA 1ZAXA 2Z56B 1EAYC 4LZDA 5HP4A 1NJIT 1HKCA 3KJVA 1Z4OA 2B4JA 2V9KA 3RRKA 2LU1A 3AVHA 2PEHA 2VUGA 2ZM6K 2BJEA 3JTNA 3ZDAA 1J53A 1S10A 1KBRA 2F1IA 1Q9XA 3OFFA 3T69A 1WUDA 5AXMA 4KMOB 4WFAQ 1D1UA 1AUSL 1QQ7A 4DV5F 1BC6A 2V8GA 1UT5A 2KICA 4B6JA 3SQGB 3VCDA 2Z1HA 4OHZA 2XEXA 2WVBA 3W63A 3DWLA 1U2FA 3VCBA 2Z1GA 5ALIA 3ETMA 2RF2B 1V4TA 4AL7A 4CJRA 2FC9A 4LBHA 3BEGB 2VA2A 4GKKJ 3MTKA 5K5MA 1IN0A 1EXQA 3ZT4A 5HHIA 2LDYA 4IO1A 4RCHA 3SI6A 2W24A 4Y2YA 4L3KA 2HS0A 4RWXA 2XZWA 3T1YF 3D67A 1JLBA 2GEMA 1IQTA 2NS1B 3K4GA 4LRAA 4Y34A 3W2VB 2FSJA 3P5JA 3CVKA 4CNYA 3MN5A 2CPDA 1S8OA 1DY3A 2HVZA 1YJTA 1EP4B 4I6MA 4FWQA 3ULEB 4RWWA 3DEEA 4K8ZA 2LDIA 2VA8A 4EP5A 2PZSA 5KAKA 1SS6A 3WU2U 3POTA 2WVCA 4HR2A 4Y2KA 1MMDA 4I0WA 4RQ6A 1WKKA 3S8SA 3AN1A 4B9SA 2ZIWA 2KTQA 5KG7A 5C24A 4BRIA 5KFGA 4CYUB 1Q4RA 3JS9A 2XMKA 3QEIA 2KXFA 3M2VA 3HHLB 3H0PA 4HEA9 3RB0A 2XLIA 2RU9A 1SCJB 2HOQA 1APSA 5D6GA 4ZPCA 1VQ4N 5HSPA 5AQKA 4G9BA 4ZVQB 3DLGB 4PYDA 2CIMA 5DKWA 4JWNA 3VEXA 3V6JA 1N33F 2G2OA 3ZDBA 3HRDD 2V67A 2KZMA 1CZ9A 3WDOA 1HBNB 3T1HK 4K8XA 3C5GA 2QW9A 4FJJA 3JB9k 1RHUB 1Q82O 1NLVA 5DLFA 1XS9D 4JI0K 5HO4A 4MDBA 1ZQRA 1Q8KA 1SL2A 4FLVA 3DRRB 3OLBA 1WC4A 4E7HA 1WC3A 4DCHA 2PAVA 3WXKA 1KSPA 1VQ9S 3R3TA 4DPXA 2GNKA 4KBIA 3JXOA 4R5PB 1Z00B 3H46O 3R6MA 1DK3A 4RW6B 2FZKB 4CE9A 1R6YA 3GSDA 5HI7A 5K14B 2YKNB 1IKVB 2WRMA 3OYKA 2FLNA 2HFNA 4Y2RA 9ATCB 4XH5A 5D4PA 3TABA 2NRHA 5I42B 2L08A 3CNQP 2V6AA 3MR7A 3ZSOA 2A1JB 2VQEF 2D9OA 5KFFA 2C3PA 1QVFR 4EFHA 2FGOA 3OR2A 5HMZA 1ZRNA 1NZ8A 1T9XA 4KFBA 2HFSA 1WEYA 2XIDA 1RHQB 1N32K 3ATVA 1WOQA 1HQUB 3TW0A 4GKJJ 3AOAA 3KLEA 4W90B 4JKFA 1P8GA 2BCQA 4E3SA 3VAGA 1O51A 2E1PA 2JRZA 1W26A 2HWTA 1NGCA 4F3TA 3HSJA 4QW9A 3CCRN 4RNNA 3W66A 3QGGA 1MN8A 4XEIA 2EAOA 4HWIA 2POKA 3WEEA 3L2WA 5L1LA 1AT1B 4FE3A 2M3DA 2P9IB 4G3IA 2GC8A 1VSLA 4LH4A 4CLWA 2AYBA 3NRWA 4DL0C 1YITN 3KK3B 3E01B 5LT5A 2P9NB 4WFZA 1AZSB 1DGJA 4X66F 5E3AA 2NUBA 4YS2A 2CQBA 3KK2B 1R0AB 4WP9A 1S7HA 3MZIA 4KYZA 3OR1B 4Q2LA 5DGAA 3DLJA 1X9MA 3R6LB 3OXGA 5I3UA 2JFKA 1AW0A 4ECWA 4LR9A 4LF7J 2ADCA 4CP5A 3ZETB 4O5CA 2IS3A 5DO2A 4BE1A 5KPTA 3OYAA 1LCUA 3FYHA 3TJAA 4OPHA 3TACB 3R7NB 2BV3A 3B6OA 4IRDA 1I94F 4FWSA 5AK4A 2CPYA 5D4OA 3S3NA 2H54B 5C12A 1K9MT 2ZJRQ 4PUOB 4DR7K 3V1RA 2QK9A 4U8VA 4FZVA 2RRBA 4DL6A 3QRQA 4OI3A 2E1RA 3ETLA 1GO3F 1BHLA 1S1VA 3FQLA 2KVQE 4FOIA 2Z0GA 5TISU 2E1FA 1NZBA 3ONQA 2AZ1A 4CLKA 2DNKA 1MMLA 5DBBA 4C0HA 3IMQJ 4DQRA 1SZHA 2PYJA 1RPLA 3WK4A 2MQMA 3TR5A 1BIZA 4NJ8A 4NLDA 3RAQA 2QLTA 1SI9A 1SH3A 5JS2A 3M30A 3UMGA 2K8GA 4A2BA 1OYEA 2XS5A 4F50A 2E1ZA 4OKKA 4YNQA 5IIOA 4QIWC 5DK5A 2P9UA 3NOCA 1U04A 3C29A 2DGWA 1F0MA 2ZH6A 2V68A 1UPHA 2EEYA 3WHIA 2E5HA 1C1CB 1VIXA 5IWAF 4QS8A 1HR0K 3G96A 1ZQYA 2Q0ZX 2FBYA 4PKDB 2LP4A 4RKUC 3IP4B 3B4MA 2MZ1A 2XSJA 4BXOA 3DRSB 3TEHB 3O8MA 3C16B 3H25A 3C7NB 5EE9A 2YQ0A 3HO1A 4OYPA 3UQ2A 2FVSA 1R7IA 1IBLF 4Q45A 1RJJA 4RT3A 1LFWA 4ECXA 4USWA 1NJIO 4I4BA 2PFDA 4ZVOB 2E5JA 3M8PB 5ADXH 1B22A 3J81U 4CGIA 1QJHA 2ZJ5A 2FJEB 1AFJA 3OXFA 1NBWA 4DTJA 2BKEA 2KOBA 4I29A 4I2DA 3MM9B 5AQSA 1T94A 5J0UA 1BUPA 2KKHA 3L7PA 4QIWF 4WFBQ 3DLKA 5DM7L 4OGEA 2QI2A 3KHLA 3O1WA 2OSQA 3T5HA 5E2QA 2KVIA 5DLGA 4FVUA 5KFLA 3X3UA 3QT8A 5AKYA 4OI2A 4UOGA 1VLOA 3TI0A 3NCQA 2AIRB 4JI7K 1S97A 2RJZA 2YX6A 3QBCA 1JJ2M 3PYGA 2EFOA 4MMOA 1R0BG 2FYXA 2XMUA 4HUEA 1UFLA 3O6QA 2B9XA 2E1MC 4XPEA 5BN9A 2YQEA 4PL7A 2VBWA 3ZI4A 1EHWA 3W9IA 3SR6A 3V7LA 1YWXA 4UATA 3SQ4A 2DRDA 3TAQA 4NE9C 4MQ3A 1BQMA 3ISND 3GG0A 2R2UA 5KFAA 3QXGA 2E8OA 3JQMA 2Z8QA 4TY9A 4Y6IA 3AMZA 3CCJN 5DDMA 4DU7A 5B0FA 3PRDA 1VS3A 1X4BA 1QQNA 4K4SA 4IL6U 3HWTA 5GIPA 2E1CA 4XH1A 2EAMA 2XYHB 2MPUA 1J5EJ 2K1RA 1VQ5N 4Q8FA 1HKGA 4C0BA 3WKCA 3AAPA 4ZP8A 2AYMA 1WWUA 4O5EA 1RWPB 4GKKF 2Z30B 5L1JA 3W7BA 4P2SA 4CO0A 2OP5A 1Y7PA 4M5MA 1C1BA 1TUUA 2UVRA 4F25A 4YY3K 4FF3A 4KHQA 8RUCA 2UUBJ 3KKSA 2OELA 4PG5A 1X4CA 3ZDDA 3BYPA 2KH9A 5A0YA 2FLPA 2WFAA 4IQTA 4BRNA 2PYLA 3DV9A 3KWIA 2LKYA 2NXEA 5H2FU 3QAUA 1NK5A 1TKZA 4DDFA 4ZIWA 5FLXU 2FLLA 2PMZD 4PKIA 2CXYA 4HTUA 4M9JA 4JI4K 2R18A 4M5KA 2MZRA 5AQUA 4AL6A 3EGNA 1B7FA 1KVCA 1EKSA 4CTAB 4EELA 2PFQA 2KN7A 9ICOA 4M0AA 3JPTA 4OYWA 2HVEA 2W2MP 3GIMA 4HLBA 2QA4G 2CRXA 5JVHQ 2JLEA 3QFWA 2LLZA 2E6LA 2FJAB 5EX5A 3VERA 4DV7J 1X4FA 5I4MA 1FJGF 1O1WA 4GMKA 3MD1A 1HPMA 4MKBA 3QINA 3HD2A 1RABB 2ZUBA 4CJ4A 1LK5A 2WF6A 3GFZA 2YB4A 2C3YA 1TVRA 2R7UA 2VBYA 4DXLA 1QAJA 3JSMB 3A0HU 2XY5A 1RAAB 3F5EA 2GAHC 4FVMA 3W8GA 1U4BA 2XO7A 2NYVA 3MGHA 4J7CA 3K0JA 4ZPAA 5D8HB 2DFLA 3O9QA 1ZH5A 1F5AA 3S3MA 2ZHAA 3MN6A 1N34F 3I5BA 4BDPA 5ALOA 3CJ2A 1WHVA 3DMJA 3GE9A 1R6VA 1UETA 4TSXA 2CPXA 4OYOA 5JMNA 2W4PA 1RDCA 2V52B 3TTCA 3MM8B 2C2NA 3UR0A 5ALYA 2GVDB 2KIWA 3ICXA 2DNYA 3N4WA 5KT2A 4CJKA 2I5JB 3AVNA 4Y2SA 2G07A 1TK0A 2DHSA 1BI4A 1BOTO 1G1XA 4QZCA 1H74A 5CWRA 4DOCA 4GLXA 5J2AA 4F4ZA 3PTWA 1M6YA 3THYA 4ZKAA 4ZVEA 2GJIA 3UB5A 2XMMA 4LF4K 3B0YA 3GTYX 5J2GA 4BLGA 3ISNC 1VRUA 4LC9B 2NZTA 5D4NA 4MEXA 4ZLJA 3FE1A 4LFBJ 5AKXA 1KLMA 5AKIA 3NS5A 4DV2F 2DNOA 3CC4S 4ES2A 2UUAF 3AD9C 2ISOA 3LDOA 3U1NA 1M1KT 2NRXA 4RLEA 3PW2A 4B1ZA 4GKJF 3HP9A 2IVNA 2A5XA 3AVMA 4KKOA 1WEXA 1URRA 2CZVC 4OPJA 3QIPB 3VAMA 2NRRA 3E58A 5FPNA 2ACYA 1URNA 2ZH4A 2XI3A 1K9MO 4KGXB 1OQ3A 3KDOA 4IOBA 1U1MA 4WFYA 3CJKA 3J7A1 4DTMA 2AX0A 2MUTA 2IA6A 1OUQA 2V7YA 5GADU 4R64A 4KLLA 1KFTA 3M8WA 3LAMA 2DXFA 3VEVA 4OVLA 4NLQA 5J2NA 4JV1A 1U0SA 1YSJA 1UA0A 1ZQHA 3AM9A 2PMHA 5AM2A 3IG5A 4QYZK 4EFAC 4O8UA 4P4PA 3OUYB 3PR4A 2ZIUB 2FHOB 4CEDA 3IN5A 3DAWA 3BF1A 4KC5A 5IC4B 3NVMA 2XMWA 7ICFA 2AJFE 4AUKA 2RQMA 3WK6A 1LOUA 5TKYA 4BVPA 3TA0A 1E6VB 1XQSC 3IG1B 1NK8A 4M5HA 1QH9A 1OPIA 5GTHU 1Q18A 2D0BA 2GHPA 2LYAA 4JKGB 4USKA 3CM5A 5J2CA 2WW4A 5CZ1A 3TAGA 1WCLA 5HNKA 4UAUA 2ZE2B 1R8AA 2GIQA 3SSSA 3WC2A 5I3QA 4BRHA 1IV0A 3RAXA 4DCOB 2VFRA 4IQXA 3QEPA 3HJVA 1RBSA 2FBVA 1N56A 3U6FA 4CRXA 4C1NK 3GPAA 3GSIA 2EG1A 2BRKA 2QRRA 4WFNQ 2KL8A 4E7KA 3MXMA 3CCMS 3Q8YA 3QT7A 2HSTA 2MZTA 1LWEA 1RILA 4ATNA 1RGIA 4PG4A 2BM1A 4IO8A 1M1GA 2LA4A 1YZ7A 4OX9F 2D4WA 2DR5A 3CIMA 1S5ZA 4C8KA 3TTDA 2XCPA 2DGXA 1HNWF 4UTGA 1M0SA 1RT1B 2BE2A 1ZQXA 4JMUA 2J8AA 3K58A 5B8HA 3ZD8A 2E8AA 2P9PA 1HX1A 4U67L 4O0NA 1D8BA 3F41A 4JP8A 3AAWB 2X7IA 1Z1ZA 3ZC4A 3JTOA 3PXGa 3MECA 3P83D 3R27A 1HW9A 3B8HA 1OQ6A 1WDTA 2DHXA 2KXHA 1J2VA 2P6TA 4LR8A 3M8RA 4CGFA 5BOMA 3IFEA 3QGHA 3KKAC 2V5HG 2FF6A 4O44B 4BHQA 2JOQA 4NLXA 1MMNA 2DYAA 3BB5A 2MJUA 2ASPA 1QUVA 1SZPA 4K4YA 1VOMA 4DR5K 4HAIA 4Y28C 4KLTA 4YR0A 2CG8A 3N7PD 4ZJOA 4FO0A 2I1QA 4DL4A 1U1PA 3WNFA 4I68A 2QMWA 3L09A 2ATQA 4FWMA 2YNGA 1P90A 5JMVA 2AWZA 1S76D 4JI2J 2GWJA 2F1JA 1B4SA 4C3KA 4CJFA 3AL0B 1RLDA 3KK7A 3ZD9A 2N4CA 2IOFK 3NF6A 2EXUA 4E7JA 1ZA2B 1PBAA 1X66A 2VGMA 3EGWB 4ECVA 4YN4A 1YK9A 2CQ0A 2VC1A 4DR4F 2O8FA 3M8ZA 5LJ3Y 1GTHA 1I39A 2GUIA 4J2EA 2HB5A 3MEEB 2GMHA 3T9NA 4P7VA 4OYZA 2YH1A 3FZHA 1VQ5S 3DJCA 4DU4A 4KLEA 5GTIU 1BQNB 3LWMA 3SQIA 3N4MB 4M5IA 4WPAA 3RG6A 3NG8A 1B64A 2WB4A 1OY9A 1IKXA 2DH8A 2LQ5A 1CC8A 2GJ2A 3EUNA 2RUGA 4ZJQA 3AAQA 3MF5A 1ZZFA 1ZQOA 3GU0A 1F60B 4BRCA 5C2FA 4DV5K 4Z6DA 1KXPA 3NTUA 2GIRA 4TY8B 2HRUA 3SK3A 4LIWA 3TFRA 3FCWA 1ZRMA 4HI2A 4H5VA 3VEOA 1RZMA 1XNRJ 4FLXA 8ICOA 2D0AA 4ZITA 3PJWA 2YHWA 9ICSA 1YBUA 3I0SA 4OZ2A 3OW2R 1Y97A 5HP1B 4NCGA 2NO4A 1YRTA 2HQGA 1YJNN 2MTLA 3UDVA 5HAOA 4YVZA 3R97A 1SUQB 3VEYA 3T1YK 2UXDJ 4RBVA 4CW7B 3HKWA 1VQNS 4DKWA 1J5EF 1B43A 5KFMA 3FEZA 1OIAA 5FDLB 3OV7A 2AEMA 1W7WA 4NXMJ 2R9LA 1N0VC 2P2CB 2XNRA 5GAEU 4KTQA 5IOLA 2CJYB 4PG6A 2BCRA 5F9NA 3MR3A 4O3MA 1JI7A 1U1QA 2ATLA 8ICZA 4WIQA 3GL1A 4K43A 4BC9A 2DUYA 2P5VA 5J2MB 3KG4A 2YKPA 2GO9A 4X84A 4BRAA 3VQ8A 4XPCA 2Y1RI 4FFDA 3IBWA 4JI8J 4G1IA 4Q44A 3TPQA 5G0RB 4FXVA 2VGNA 2UZAA 4ZCKA 2FSNA 3RSEA 4Y3CA 5TKWA 2A19A 2EDUA 1SB6A 3TYTA 1RU1A 5IXUA 3QE9Y 1C0UA 1GLLO 3V6HA 2H4YB 2QC3A 3BO4A 4NXNJ 2P6UA 1W2BM 1S9GB 2HW3A 2HMPA 3O9RA 4BBYA 1IXRA 2F9JA 5HMWA 3CCZA 1ZQGA 3CNHA 3HOTA 1N62A 4DPTA 1BMQB 4DN0A 4RQ3A 4DTSA 1X4HA 1SV5B 2E9RX 4CD1A 4ISGA 1HNIA 1RXWA 1EKEA 1X4DA 4S0MA 1RT7A 4I7FA 4QR1A 3KNGA 3FC4A 1A0OB 3VC8A 3S7RA 2YJEA 4YHHF 5ADZA 3OTBA 1SL0A 1LVHA 2B5JA 4N8NA 3CPWM 4NWBA 4I2CA 2ALYB 5J2BA 4O55A 4PZOA 3PO5A 1MG7A 5IM0A 3M6UA 5F2RA 1ZQSA 2VFTA 3RJJA 1ZQDA 3GFYA 4XRHA 1NMEB 2XLJA 1CJVA 4WZQA 4ZCLA 5E33A 3FC9A 1M1KO 1FWKA 4KV8A 4CEBA 1GAOA 5DDPC 9ICCA 8ICEA 2G8FA 4ILLA 4GC6A 4LF2A 1BU6O 2KZ3A 3QYYA 3G6XA 2Y0SF 3PMLA 2VQEK 4E1NA 2IM0A 2UXCJ 3O1LA 5AQZA 3CJ8A 3L7OA 5BRDA 5ETNA 3TFSA 3Q2TC 1RBVA 4OX7A 4BR7A 1T3NA 2MY7A 3UFCX 2SXLA 2DGTA 3QMQA 1WAFA 4JKDA 1XQIA 3ZCMA 4DV1K 1H2VZ 3R2CJ 1FK9A 4RPXA 2KEYA 4UY85 2QARB 4NLZA 1H2TZ 1RAHB 2OKQA 3KLGA 4P0PB 4ELTA 2KT2A 5U47A 3H2UB 4LFBF 4WQ4A 1GMVA 1PO6A 4ICAA 4IRKA 4HH1A 1XWLA 3SQGA 3BBBA 2PFOA 4CECA 3ID8A 4JV2A 5HMXA 5JVHL 3PYDA 3S41A 3D2EA 3U3GA 3OBWA 3OPXA 1QM9A 2RF2A 2JSXA 2HBYB 4QOTA 2UUTA 3WQPA 2PFUA 3AOBA 3E51A 1RACB 5KFPA 4X66K 3ILLA 1JRPA 3ZZTA 3VEZA 1Q3VA 3M05A 2FTRA 2R7VA 3QEVA 4Q7AA 4FLUA 2LXUA 1RTHB 5L1KA 4CLZA 5JLFA 3JTPA 3J80Y 5AR0A 4PHDA 2Y1IA 2MKYA 3PKYA 1R31A 5F3ZA 1SKSA 1FRLA 2EH9A 3OVAA 3W0LA 3EKSA 4FZYA 2YWGA 1TTHB 4H4OB 4YOUA 4BROA 1OYDA 1RA7A 1I94K 4PXDA 2Q0UA 4ISFA 5JJBA 4JBCA 3AQOA 3K7RA 4KB0A 2CPIA 2Y0BB 2RQCA 5JS1A 2CNKB 4BRKA 2GQQA 2VWJA 4A5BA 7FD1A 4EBDA 1IVZA 5GADP 2BCVA 4CFBA 3AA5X 3BN4A 4CYUA 2IHMA 2G2YA 3HHLA 1XNQJ 3MCAB 3DM2B 4QWEA 3QZ8A 4OKEA 2NPFA 3VA0A 2B4UA 1MROA 4UB8U 3MR5A 3Q8VA 2YXLA 4MT1A 1J5OA 1GMWA 1FFVA 5BYQA 2KFNA 3DLGA 2DIUA 1EQMA 4CZLA 3NOGA 2JEGA 3A5MC 2O66A 4IJNA 1LQ9A 4NI2B 2QWOA 2XG8A 4FCYA 3DI6A 2W8LA 1HMVB 4F4XA 2O8DB 1Q81T 3BSAA 4NYZA 2I9SA 4JI1J 3N97B 3R2DJ 3OSPA 3A8JA 3BF3A 3P39A 2J0QD 3DRRA 5IWAK 3KKRA 9ICNA 1TKTB 4QBUA 3RYLA 1Y5NB 3E66A 1P1LA 2VOPA 3IDHA 2GMLA 4R5PA 2HMXA 1Z00A 1RHKB 4RW6A 1NK0A 3MX2A 1IBLK 1RHRB 3LALA 1BNPA 4LD0A 1I1GA 5AI4A 3MDFA 3OJSA 5BPNA 4UOFA 3WQUA 1TZ0A 2V34A 4I6AA 4HHJA 3G82A 4G65A 5AFUH 2DFHA 3FSIA 2MYFA 3CCVN 5BN8A 1VQSA 1Y00A 1J6ZA 1XMOK 1Y4ZB 2A1JA 3ISBA 2HAFA 1NB7A 3TADA 3V4MA 1TP7A 3ILJA 1NWKA 4M63A 4CF9A 4WE1B 4DV3F 1NU0A 1NM1A 1H2UX 5LMUJ 5GMKa 5ALUA 3PHTA 4BVOA 3W2WB 4KH4A 2IRUA 2DFEA 4K2XA 2ZKTA 1YJNS 1X5OA 3NXZA 3M7VA 3SXLA 5EWFA 4A8QA 4DTUA 4IEIA 4JB8B 4B3TF 4M5DB 2HWIA 5DDYA 1Y0HA 1SV0A 4WFNL 4I9LA 4EEYA 2ASOA 4MFFA 1M90T 3UR3C 2EZXA 2E8NA 1IBMJ 1N63A 1DEJA 1V5IB 2P9IA 2DTUA 3BREA 2XSFA 1CZBA 4CO4A 5IT9Y 3H2LA 2JC1A 1Q86T 4A47A 4ED4A 3E01A 3ET6A 1AZSA 3BY5A 2OH2A 3N79A 4IOCL 3HVWA 4NYFA 1L3TA 1FNOA 4DCCA 1SQKA 4WQ4C 1RT3B 3I33A 1C6VA 1E3MA 2JV3A 3V6KA 5AKZA 1GXTA 3DN9A 3KOOA 3BQ0A 5EU7A 4I2AA 4C8OA 2JHDA 3H42A 3L4QA 2K60A 2RPIA 1XNRF 4RNOA 1R27B 3TTFA 1WEZA 2YV0X 3MDQA 4FPRA 5M1KA 3UNYA 4CJUA 4DV4J 3SUQA 3BDEA 3ZSRA 2PD1A 2XICA 1F21A 4GKKK 5KTQA 2IC3A 3TJ8A 4QZHA 2A6MA 4O0JA 2UXDF 4PUOA 2F5GA 3HP6A 4CLUA 3G0ZA 2J7WA 2J7UA 2ITMA 5MAOA 1ZQCA 4RW8B 2CRLA 4MKVA 4KGMA 3AVCA 2WAQC 2MKSA 4FVCA 4A8EA 1HKAA 4MK8A 3T6BA 3VQBA 5LMNJ 5CB1A 2DTJA 1XIQA 3VGVA 3CMQA 2WUSA 4ANEA 3FZBA 2KDOA 5FIIA 5A2QO 2A1BA 1GNKA 1WC1A 4ZVRB 4JI8F 4OHWA 3B8AX 2EFGA 4RW7A 4UB1A 1WWVA 2QWMA 1FDBA 2VG5B 1Q0NA 4C8NA 1S22A 2CQDA 4CHPA 1FRJA 1S1XB 1JUDA 3HHLC 1MQ3A 3NBPB 4MAKA 5GAEP 5F3XB 2HBQB 2VPZB 4CZFA 3QU9A 2DL0A 1FJGK 3RF9A 3NGRA 1XK8A 2O8EB 1WKLA 2CGJA 4WKYA 5CYMA 2QWQA 3D1OA 1C1CA 3QPIA 1U9LA 2QXFA 3QNOA 3TUJC 1RDUA 2L9NA 4DFKA 3LVVA 4A46A 2HIYA 1N36J 4EMDA 4ZH4A 4PPZA 2RD5C 3D45A 2H48B 4EAHD 3C16A 3C7NA 3KBBA 3S6EA 2Q31A 3LP2B 2MKIA 5BRHA 3WK7A 4NMLA 3QESA 1HQEB 3QO9A 2LCWA 4HDHA 1HUZA 4FWOA 5F9LA 4DX7A 5D4BA 1Y11A 5IQ6A 5LJVA 1N34K 3BN7A 1RZTA 1YKWA 1YX2A 5HRSA 4DQSA 4V19S 4OJLA 1FXDA 4QZEA 5GMEA 1OH7A 1SPBP 4CHOA 3UVJA 2UV8A 3WC0A 3MM9A 4J9QA 2FHJA 4GXKA 1Q78A 1V6HA 4EHTA 2AW0A 4L74A 4X62J 2ASMA 3J81j 2AJ4A 4TVAB 1NM2A 4M6WA 4DPWA 1UEUA 2E1AA 2V8DA 1EZZB 3Q8MA 3S01A 9ICAA 1WBBA 5J2HA 2ZHBA 1XMBA 4LFAF 3LO3A 2H3VA 3V7JA 2DNQA 2UV8G 1WKJA 1T03A 3A8EA 1S1TB 1X7VA 1DT9A 2ZBRA 2UXCF 1X6JA 5AICA 1X40A 1PJ5A 1RAIB 4QQBA 2VJ4A 3JAMU 5LY3A 3LZJA 4QNLA 2W8KA 3OYCA 3EZUA 2ZOFA 4B1XB 5DGBA 4DV2K 2UUWA 1YQHA 1NGAA 2UUAK 4QZDA 9ICFA 4DX5A 3BF4A 3OD2A 4O4GB 4GKJK 5KFQA 3L9ZA 2J6UA 2HHTA 2BXJA 2HF3A 4TU9A 1AA1B 2DKZA 1E4GT 3RWUA 4AHTA 4UOCA 4JK7A 3HVTB 1SGGA 2VJ5A 3CXCM 4DL5A 5IS2A 4FYYB 2CH5A 3CJQA 1SV0C 1RTIB 4OQJA 1RBLA 1YDLA 4FDFA 1CULB 1JALA 2RN2A 4LH5A 1UW4A 2PFNA 5CYJA 4UOHA 1O8BA 9RUBA 1C4CA 1I3OB 3PX6A 3ONNA 1BPYA 4KGKA 2ZJAA 3ZSXA 5KFXA 2K4IA 2YMQA 4PG7A 4ZPTR 4C2MA 2QL5B 2GA7A 3A3OB 3GJQB 4PL8A 3CCUN 4WXOA 2BYCA 4F91B 4LRDA 4CF5A 3ZZPA 5ALWA 3R9KA 1TAQA 1F9FA 4X2BA 2HBJA 3Q22A 1SIZA 1X60A 5J1NA 4UQTA 1U2VB 5IIJA 2VQFF 1LK7A 3I0RA 2Z2LA 1VJWA 5A8WA 1OW5A 5J0OA 2HHQA 3F9KA 2IAJB 1Q81O 5IIMA 3O3GA 3CJ0A 3HZGA 4K8RA 5AK5A 2L9DA 3DLRA 1P1TA 3L3VA 2BGWA 2ITGA 2MZSA 4AM6A 2DNMA 1PYSB 4FNIA 4CTAA 2IDLA 2MKHA 4YOEA 1K6YA 1BPDA 2AJ2A 2AKWB 1UFWA 1MWMA 2P9CA 3UN5A 1L7NA 1WOSA 2V51B 4CLYA 3EWAA 3T5KA 2OMOA 5HMYA 2GV1A 2E2OA 4RPZA 1X4EA 3A13A 3H8YA 3SBMA 3BO2A 4JUZA 3H4BA 2WVDA 1EARA 2HURA 5H9FJ 3K9KA 1JJ2R 2DGQA 1QCKA 4NB4A 3F73A 3UE5A 3AA8A 3GV5B 4OX9K 9ICGA 4PG8A 4KLDA 2DWQA 1ZD4A 4C98A 1HNWK 2GTDA 4Y2TA 4CF2A 1QVFM 3TZYA 1WCNA 2L48A 1RUSA 5AQNA 4Z4FA 1DLOA 2ABYA 4KBOA 4J9OA 4F26A 3JSMA 4X4VA 2CXEA 2ILYA 4LUBA 3FSXA 1TV6B 3KTQA 1W97L 2MB0B 4M41A 2BJDA 3NS6A 5AJ3J 1BCMA 4C11B 2ZOMA 4JI1F 1RFQA 1HNXF 4H5WA 4HCBA 2JL9A 4AHUA 2J0XA 4M3YA 5CXTA 2VFVA 3SIPB 5C2DA 2G5IB 1RT6B 4ECUA 5BXIA 4NZ0A 4MIAA 3CC7N 2AZ3A 3SQ1A 3IBPA 3UN3A 3CCLS 5AQJA 2F1FA 4G9ZA 3I4PA 4RJVA 5BR8J 3MM8A 2PA3A 3MPVA 2GWSA 2GVDA 2KRBA 5C15A 5E3PA 1RTZA 1SH0A 3VV2B 1M90O 3RU0A 4ZK7M 1V3RA 3P4IA 3NGKA 2BPGA 4YFKA 3AVAA 3RBZA 2DNRA 4FM1A 2VPXB 4JI6F 3LGHA 2LYVA 4OV1A 1Q86O 2BJ9A 2H3EB 3EGZA 1G3OA 3AHPA 2I9GA 4YDDB 1VQON 3OVBA 3MEKA 2ZDOA 3KZIU 4H4KC 3HT0A 1S9EB 5AZIB 3FNNA 4KLSA 3Q0AA 4ZDNA 3IRWP 1VSMA 3C66A 2XS2A 5A76A 3HKZD 4W92B 3Q86A 5LMUF 2XYGB 3H5UA 4YB6A 2RH3A 4NM1A 2IYGA 5J8YA 1ZZNA 5CR0A 3Q8KA 3QIPA 4V19J 3CC2N 1UVJA 1UOCA 4BE2A 3MGJA 1HIYA 2JLGA 4FKYA 5H9EJ 3F44A 2WVFA 1E6YB 2IOHA 1AROP 2GGPA 1XHZA 5KT4A 3N6LA 3M1VB 5BREA 3C2KA 1ZQJA 3PSPA 2Y1JA 1JNRB 1X2IA 1LXNA 2V2QA 2CYYA 2Y3YA 2P9KB 2DJWA