4DQSA

Binary complex of bacillus dna polymerase i large fragment and duplex dna with rc in primer terminus paired with dg of template
Total Genus 211
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
211
sequence length
579
structure length
573
Chain Sequence
KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords DNA polymerase
publication title Structural factors that determine selectivity of a high fidelity DNA polymerase for deoxy-, dideoxy-, and ribonucleotides.
pubmed doi rcsb
source organism Geobacillus kaustophilus
total genus 211
structure length 573
sequence length 579
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4dqsA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4dqsA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4dqsA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4dqsA01
3GIJA 1SZPA 4PH5A 1ZQFA 1T7PA 4QZHA 3H7IA 4EBEA 3PX6A 4O0IA 3G10A 1H38A 5DDMA 4MFCA 5DQHA 4FO6A 3MR6A 1TK8A 8ICPA 3BQ1A 3KLGA 4ID1A 4M3YA 1WNSA 1Y88A 3C21A 4KI6A 1QSLA 4IDKA 1SL2A 1ITGA 3H40A 3LPTA 5J0WA 1ASUA 3OJUA 4N56A 2G8KA 5CZ1A 2H5XA 9ICCA 3VQ8A 4FJMA 2IDOA 4DSJA 3QZ8A 4NLZA 4J2AA 1JLQA 1ASVA 2DPJA 3G0ZA 1BL3A 1S76D 1IKXA 2B4JA 1I3AA 3PMLA 4YXMA 4RW9A 4FJ8A 3O3HA 4Y1CA 2BGWA 4JWNA 2VG6A 4F4ZA 4RNMA 4J9RA 4IQUA 3V9XA 5KFWA 3M8RA 5IIMA 3C5GA 4OKKA 4CFDA 2NUBA 3OS1A 4IFVA 5KFAA 5L1KA 5KFOA 4F4YA 4DL7A 1S9GA 4J9MA 4CGDA 2WTFA 2W8KA 4KTWA 4C8OA 4UAZA 3ZD8A 2OPQA 2P5OA 2P6UA 1VSEA 3FFIA 1YVUA 4CJRA 5J2KA 4ZTJA 4CERA 3OYAA 3S3NA 2UVVA 4I2FA 3LDSA 2FBVA 3LPUA 1S9EA 3ZSRA 3HSTB 3MECA 3SI6A 5JUMA 1S97A 4DL6A 4O5CA 4ED1A 2HHWA 5KFSA 3LP0A 2OYQA 4B9NA 4QZ9A 4ED2A 4KITB 1VRTA 5JS2A 4CJQA 3GIIA 1U9LA 2F96A 4KMUA 4M6WB 2R8GA 9ICGA 4LH4A 4FK4A 4HCBA 1IKVA 4O55A 3SCXA 4DQQA 1KLMA 2PFPA 1U48A 4BE2A 3KHGA 3T5KA 2G8WA 4J9LA 3DRSA 3DMJA 5J2IA 1KDHA 2UVWA 1RBUA 3RRGA 3SI8A 1J53A 2GV9A 3PUFA 1ZQXA 3K5MA 4R8UB 2BKEA 8ICUA 1FK9A 3DM2A 3HM9A 4CJ5A 3GV8B 4DL4A 4QZGA 3SV4A 4ECSA 4QZCA 1HQEA 3KD5E 4CIGA 1CZ9A 4KAZA 1L3UA 1ZQOA 1QSSA 1S0NA 2BCQA 1LW2A 2V4RA 4F5RA 2RDJA 2I1QA 4EZ9A 1S0OA 3P83D 2BHNA 4B9SA 3LP1A 3CM5A 2VA8A 2WOMA 4DU1A 4H4MA 4RQ8A 3UQ0A 3K58A 3IHQB 4DU4A 1HYVA 1SL1A 5KG7A 5HHHA 4BE0A 4CF9A 4CEBA 3VQ9A 3AVAA 1D8YA 5KT6A 3VQEA 4YR3A 2ASJA 5J2QA 4QZDA 4ELUA 4B9TA 4CJPA 4YCXA 3SPYA 3AU6A 4BDPA 2ISPA 4DSFA 3UXOA 3SNNA 1IM4A 1RT3A 3MAQA 4CFCA 4CE9A 1DGSA 4M9GA 1F21A 8ICLA 2KFNA 1LV5A 4XUSA 4FCYA 4J9OA 5DLGA 2HMIA 4QWCA 4CF1A 3RTVA 2NRZA 4G3IA 2RKIA 2AGOA 3HYFA 3C5FA 8ICIA 3P5JA 2F1HA 1EKEA 1BI4B 4F3TA 1RT1A 4PA1A 2KW4A 3OYMA 1ZQTA 1BVSA 1QTMA 3S3OA 3LAKA 4GVMA 5J0OA 3OSNA 5F9NA 4F2SA 5KG2A 9ICAA 2ITGA 4CJ4A 3V9SA 4N41A 8ICTA 7ICGA 4AHUA 5DB6A 3NDKA 4M9LA 3VQBA 4CGGA 3C1ZA 4BDZA 5J1EA 5IIIA 4Z4GA 3Q8LA 4EBCA 2VA3A 4RW7A 3V1RA 1NK6A 1ZQQA 3QIPA 1BPZA 4DTMA 4Q5VA 4DS5A 1JX4A 9ICLA 3NF9A 5J2AA 4ECZA 3DYAA 1K1SA 4M42A 4TQRA 3MGHA 2MUTB 2YHBA 2VWJA 4RPYA 2F8SA 4UAWA 5L1IA 5J2JA 4O5KA 3H8SA 3ZT1A 2YNHA 1CZBA 2ASDA 3ZDCA 3ASMA 5KGWA 1DOQA 4ED0A 2F8TA 3JYTA 1Q8IA 4IQTA 1NK7A 4EP5A 2FBYA 4ED7A 3LZIA 4FLYA 4UB4A 4TUQA 4PPXA 1ZQVA 1UT8A 5EWGA 3SQ0A 1JKHA 3ZT4A 2W42A 3RB0A 4IG3A 3TAMA 2ASLA 3QNNA 5KFDA 3KTQA 2BQ3A 3T3FA 4YFUA 3AVCA 2HVHA 4I2BA 9ICEA 1C0MA 5D3GA 3DLRA 1W9HA 2D0CA 3C2MA 3AVLA 2Z1IA 1VSMA 3ZSYA 4FW2A 1XC9A 4FVMA 4OLAA 4E1MA 5D46A 4QW9A 4KLFA 4BE1A 4O9MA 4E3SA 4RT3A 3EWAA 3TARA 3RRHA 2OA8A 1RYRA 1MQ3A 4KLUA 4DFMA 5J2CA 1WSEA 3AVFA 2B6AA 4ICLA 4MFFA 5KFPA 3B0YA 2I5JA 3MR3A 5IILA 1X9WA 3M8SA 4EEYA 3PV8A 4CEDA 5KFKA 2XRIA 4CFBA 3D45A 3QEPA 4O5EA 2KTQA 3KK3A 1UA1A 4J2EA 1N6QA 3N97B 4E1NA 5KRTA 1S10A 4W5TA 3SQ4A 4K8ZA 2AQ0A 3KHLA 3K75D 1U4BA 4KO0A 3NF6A 1LWFA 3RJHA 7ICMA 3EW9A 5DG7A 1BHLA 3MEGA 4P4PA 8ICGA 1WCLA 2AJQA 4FJJA 5CWRA 1ZQHA 3V9UA 4CHZA 8ICYA 4DSLA 1S6QA 4BWJA 5KT7A 3B6OA 2GUIA 8ICJA 1XSPA 9ICHA 2FMPA 3NH0A 2A1RA 2ZD1A 3U3YA 3MXMA 5CJ7A 5KG6A 2IGIA 1TKZA 1CLQA 2PZSA 3HPHA 3RB3A 4F5PA 4CGFA 3MDCA 3RH5A 3RB6A 4QWAA 4FW1A 1ZETA 3E01A 2XGQA 4J2DA 1WSJA 3OYLA 2C28A 4N5SA 4KLSA 5KFZA 9ICRA 4DFPA 3M8QA 3ETLA 4O44A 5J2GA 1RDBA 4Z6EA 1K6YA 5J2HA 4RW6A 4KLEA 9ICIA 3KJVA 4KLMA 1ZQWA 1TKTA 4Z4FA 4DSKA 1IO2A 4EP4A 4QZ8A 2BCSA 5DGAA 1TAUA 3TFSA 5KFQA 3T5HA 1NK4A 5IINA 4F2RA 1GOBA 4CJEA 5DDYA 4E7KA 4K4HA 2G8HA 5KFGA 1COOA 4Q43A 3PR4A 1RTHA 3ISDA 5J0SA 4P4OA 3C94A 4RNNA 1IKWA 3TAEA 3OYEA 2P6RA 4ELTA 3RB4A 4FLVA 3K2PA 4GXJA 4ECXA 1JMSA 3CFOA 1BPEA 4ECRA 2Z1JA 4DTOA 4K4GA 4CGIA 2XO7A 1V9PA 2BPFA 4F91B 4FJIA 4J9PA 2BQRA 3TAFA 4GXKA 2DFEA 4DOAA 2OWOA 3IRXA 4R5PA 2G8VA 3RJEA 2PY5A 1B92A 2R8IA 2AGQA 8ICWA 4LVSA 4C8LA 2O4IA 4DS4A 5DMRA 2OPSA 4JV2A 1J5OA 4FLUA 1WSFA 3HO1A 2FMSA 2P51A 4M3RA 1RBSA 4HHTA 5KFTA 3AO4A 1U47A 3OYIA 3K5NA 1BPDA 4RZRA 3NFAA 9ICQA 4J9QA 3BJYA 5K14A 4CJ3A 2FLPA 2AGPA 4M3ZA 4EYIB 1JLAA 4Z4EA 3O4NA 2JZBB 2X78A 2BPGA 4KV8A 4KHYA 3ITHA 1G15A 2HB5A 4M3UA 1KTQA 4M6WA 1RT7A 4KHWA 2R8KA 4C8NA 1SKWA 3DLEA 3QNOA 4OKEA 1Z26A 4OGEA 2ALZA 5J2NA 1RILA 1BQNA 8ICHA 3WNFA 1ZBLA 1RTDA 4FYDA 3UPQA 3RAXA 1TKDA 4CK2A 4DQRA 3FYHA 5FDLA 5E41A 2NRWA 5J0PA 2DY4A 3G6YA 2IA6A 2JEIA 2B5JA 4R8UA 5J2DA 3UXPA 4FZYA 4FLXA 5KG4A 5HMLA 1RTIA 4CHPA 1EXQA 3QE9Y 3QLHA 4I2DA 3TR8A 4KLDA 4PGYA 1HYSA 4P2HA 2IOCA 3AVJA 1ZQPA 5TZVA 2ZE2A 4KN7A 5IIKA 4UQGA 1A5XA 7ICVA 1EETA 4NYNA 1ZQMA 1CUKA 5L1LA 3JPSA 2IMWP 2JEJA 4YQWA 3M9MB 2HNZA 3RAQA 3AVGA 4PQUA 3DLKA 1VSLA 1HPZA 1NKBA 1VK0A 3GV7B 1SKRA 4XQ8A 2E6MA 3SZ2A 3AO5A 4O3RA 3JPNA 3ZSXA 4CF8A 3MBYA 1Y97A 2BE2A 4CIFA 4JRPA 3RMCA 2NRVA 2KZMA 1HNVA 4HUGA 1ZQJA 3Q8PB 4HTUA 3RJIA 3ZD9A 3SV3A 3AUOA 3AA3A 4F5NA 8ICSA 3SUQA 1RPLA 5J0YA 3V6KA 1X9MA 3CFPA 4I28A 3JSMA 1ZQBA 1RNHA 4N47A 3L8BA 4YMMA 8ICAA 2ETJA 1CEZA 5HHIA 1HMVA 5DG9A 4W5OA 3HK2A 4IR1A 1JIHA 4O3OA 3GDXA 4AHCA 1B9FA 1BI4A 1C1BA 2J6UA 1L3VA 5J0UA 2AQ4A 3VQPA 3MXJA 2JEFA 2FBTA 2EHGA 3B6PA 5KI6A 3H4BA 1T03A 4JUZA 4QOZB 4MFBA 3TQ1A 1C1AA 1ZQAA 3CYMA 4P4MA 2D5RA 4ELVA 4FLZA 3V6HA 4CGJA 4EYHB 3RH4A 3RR7A 3NBPA 1ZBIA 1NKCA 1WSGA 4JS4A 3HJFA 2OZSA 3TAGA 5DGBA 5FRMA 4RU9A 4KLHA 1EX4A 1A77A 2MUTA 2Z1HA 5BOLA 1W0HA 3B0XA 5KFIA 1KFSA 3KD1E 4AHRA 7ICPA 4DG1A 4F92B 3MFIA 3V9WA 4RQ5A 7ICKA 4KHUA 3LP2A 3UXNA 4BACA 1RXWA 2FC0A 7ICSA 4IKFA 4CHQA 3AO2A 3HP9A 4AHSA 1LAWA 1HYZA 2PFQA 1WAFA 2PFNA 1T05A 5JS1A 2R8JA 4GXIA 3Q8MA 3LK9A 2JLEA 1D8LA 4Z4CA 3KHHA 4FBTA 4ED3A 1MSWD 5D4BA 1X2IA 2KZZA 1JLEA 3K59A 5KFNA 4FK2A 4F5QA 1XSLA 4J9NA 4DTNA 1RBVA 5J0TA 5C25A 2XHBA 2RPIA 1D9DA 1R0AA 3U6FA 4K8XA 2VA2A 3VQ5A 1LW0A 1T8EA 2VWKA 1GOCA 1VSHA 4DMNA 4NCGA 4Z6DA 4FLTA 8ICKA 3SPZA 4F8RA 2NRTA 1ZQNA 3QO9A 5KFHA 1ZQKA 1TL3A 4IFYA 1D5AA 1KLNA 3RJGA 2YKMA 9ICMA 3DLGA 3IS9A 3JPRA 4KLQA 4I27A 3UQ2A 2XY8A 1HJPA 4UB1A 1UOCA 3ZDAA 4FS1A 2PI5A 5EWEA 4XA5A 1ZQUA 1YT3A 4DLGA 4DWIA 1RT5A 4AH9A 3SUPA 2KQ2A 1BIZA 4YMOA 1IH7A 4OLBA 4CF0A 4G1QA 3LWMA 5EU7A 2FPLA 1D9FA 3KLHA 2J6SA 5SWMA 2FLNA 4ID5A 4MEXA 1NK8A 1S77D 4C8KA 4M2YA 1C0UA 3P1GA 4KHQA 5J2PA 2O4GA 4CJTA 3LDAA 7ICTA 3RBDA 3WNEA 5CA7A 4IQWA 4Q0BA 1JLBA 3JPTA 1SV5A 3NH2A 2HHQA 3NGIA 3MGIA 3ORYA 3HVTA 3ISCA 1L5UA 3OYCA 4FK0A 4JV0A 3C2KA 2IBKA 5DK5A 4FJNA 4ED6A 3SYZA 2HHSA 8ICXA 4OVLA 4FLWA 2YHAA 2W9AA 1ZQDA 4CGHA 4JK1A 1TFRA 3PR5B 2KZ3A 4PHDA 1NOYA 4DQPA 4RW8A 4R64A 2HNYA 4QCLA 1RDDA 3OVNA 1EXNA 5J2MA 4FM0A 3OYGA 4PUOA 4ZHRA 1ZQZA 1T3NA 3EPIA 4HUFA 1VSJA 1IG9A 1RT4A 4IQVA 4DL2A 4B8AB 4O5BA 1JLGA 4DTUA 2WONA 5HRSA 3GIMA 4ECUA 3ZT3A 4RUAA 5KG3A 3T5LA 2XCAA 1N48A 4YR0A 1RDCA 1VSIA 4Z0UA 2ZJ8A 1ZJMA 5HRNA 4YXJA 3JPQA 3VQAA 2YKNA 4CF2A 4I29A 3AVKA 5DB8A 4NM2A 3ZSVA 3HPOA 4KTZA 1HRHA 4GC6A 8ICRA 5HMMA 5KFRA 1TAQA 3OYFA 4ECQA 9ICSA 1J9AA 1XHXA 3PO5A 4JLHA 3ZT0A 1JL1A 1A5VA 3M8PA 1LB2B 3AVNA 2RF2A 1NJXA 3ULDA 3RMAA 2LSNA 1RT6A 4M45A 3DRPA 4F4XA 3DOKA 1VSKA 3GFKB 5J2BA 3M9NB 3OJSA 4I2PA 5KFMA 4FZXC 5KFBA 1ZBFA 3ALYA 8ICEA 4KB0A 3TWHA 2R8HA 3ZDDA 1ZYQA 1TL1A 3NF7A 2E4LA 4OKJA 4DL5A 3ISBA 3PX0A 4Q44A 3L3UA 3KK1A 3KK2A 3NHGA 2DPIA 4CJSA 4E7HA 4W5RA 4PHPA 4CECA 5CP2A 3QIOA 5L9XA 3HVRA 1T4GA 4I7FA 5CR0A 2C22A 3PW5A 5FRNA 2ZTEA 5KTQA 4RUCA 3EY1A 4JS5A 4J9SA 3MEEA 5J0XA 4Q8FA 4FM1A 4W5NA 4I2CA 9ICOA 4B9LA 2GBZA 5HP1A 1S6PA 7ICJA 4CIEA 2YNFA 2JZBA 4PGXA 5KFUA 4CJWA 5EWFA 3C6TA 1AROP 1C0TA 4OGCA 4QZEA 5DQIA 7ICNA 4TQSA 3VA0A 5KRSA 4FJHA 4DF4A 4I2EA 3DRRA 3HPGA 5FROA 1MQ2A 3U3GA 4B3OA 3LP3A 4UBBA 3MFHA 4RQ2A 1NJZA 1RXVA 4E7LA 3F73A 4OJRA 3RWUA 4KHSA 4YNQA 4CEQA 2XY7A 4DF8A 2G8UA 2Q0ZX 1RCHA 2BANA 2FMQA 4KRFA 2QKBA 4B9UA 3PW0A 3CM6A 1RZTA 5KT4A 5DLFA 4E89A 4J2BA 4FJ7A 3VQDA 4FXDA 5KFVA 2DTUA 4CK1A 5KG1A 1L3SA 4L8RB 1ZBHA 1S1UA 3V72A 3ZDEA 3LANA 2DFHA 9ICBA 4JRQA 4FJGA 1J54A 3WNGA 4F3OA 9ICVA 1CXUA 1BPXA 3BDPA 4NLGA 2JGUA 2IC3A 5DG8A 5DB7A 4RQ4A 2ATQA 4JV1A 4KFBA 1K1QA 1ZQSA 3C2LA 3NF8A 3SJJA 4O3QA 4MEYA 1Z00B 2W9BB 2F1IA 2W9CA 4E7IA 4CEEA 4Z4IA 4J9KA 3QESA 2ATLA 2Y1IA 1L3TA 4W5QA 1XS9D 4XRHA 4M0AA 1S9FA 2XGPA 1UAXA 5CZ2A 4I9LA 2F1JA 4N76A 2FPKA 4CJLA 1NK0A 4KKOA 3S3MA 4PWDA 8ICOA 1TVRA 1BCOA 2W9MA 3Q8KA 3Q8RB 1BCMA 3L2RA 4YN4A 4MQ3A 3F9KA 4QZBA 4I2GA 3SQ2A 1RYSA 4CJFA 4RQ0A 4ECVA 3SUNA 1REVA 4DTPA 1NKEA 2HHUA 9ICFA 5DBBA 3AVMA 1EP4A 2D0AA 1ZJNA 2AU0A 1KSPA 3TABA 2X6NA 4PHAA 3V9ZA 4CJKA 4ECWA 1O1WA 1JLFA 4PGQA 5CYMA 2R7YA 4YFKA 3NAEA 2QKKA 1X9SA 1HQUA 4DL3A 1ASWA 3PW2A 5C42A 3ZSQA 7ICFA 4BXOB 3V7KA 4DTJA 1XO1A 4O0JA 5J2FA 1LAVA 4DO9A 4RQ7A 3D0PA 3ZDBA 4Z6CA 4UB3A 1Q9YA 3NGZA 4HUEA 5KT3A 4BWMA 4BGDA 3AA5X 5CY4A 5T7BA 2NRXA 1C6VA 4LD0A 2G8FA 1YTAA 3VQ7A 2HHVA 3TAQA 4NM1A 4YD2A 4RPZA 4KLLA 1DTQA 4CHOA 2J6TA 2ZJ5A 4CHNA 1U49A 3L2UA 3SUOA 3K5OA 5KFEA 1S5JA 4Q45A 3AU2A 1U04A 2M9NA 1S1TA 1A76A 2Z1GA 3H8WA 3DLHA 2C2EA 2A1SA 4NLNA 3M9OB 2XY5A 2V9WA 3C6UA 4B9VA 4KLTA 3CFRA 3VN5A 3HXMA 2FPMA 1KFTA 1WSHA 3NGYA 2BCRA 5F9LA 3CQ8A 4HCCA 3OSPA 4KI4A 4MFAA 2ZTCA 2YV0X 1DLOA 3OHBA 3H8JA 3TI0A 4YP3A 3LZJA 2ZUDA 2W9CB 4QAGA 4RQ1A 4UBCA 1N5YA 4RQ3A 4HYKA 2RDIA 4DFKA 3PW7A 4O3PA 4FJLA 3QINA 8ICBA 2A1JB 1QQCA 4CESA 4RT2A 3MABA 1C7YA 3G6VA 3RR8A 1JXBA 1IXRA 1UT5A 4ECTA 2VG7A 4DEZA 4O3SA 1KEJA 8ICFA 4NY8A 3GQCA 3T19A 3BQ0A 3ZCMA 3AA4A 2P66A 2E6LA 3I0SA 2FLLA 4E19A 5J29A 3NTUA 3LAMA 9ICWA 4DQIA 2XCPA 1WN7A 4O3NA 9ICJA 5DBCA 9ICUA 2OPRA 3HP6A 3QETA 3RJJA 5HLFA 4M3TA 1NOMA 3O4QA 3I0RA 3VQ6A 1ZQLA 1WCNA 2ZUBA 4XIUA 1IKYA 2OPPA 4IRDA 3TANA 3NE6A 3HWTA 3OS2A 1DTTA 3H08A 3JPOA 5DB9A 1CXQA 4DTXA 4EZ6A 1ZQRA 4M47A 3IG1A 5HBMA 4HVJA 3TFRA 4ZH4A 1KVAA 3KLEA 3G6XA 4QWDA 5KG0A 2V4QA 2D0BA 4QZFA 3O3GA 9ICXA 3KKSA 1RDAA 2IHNA 3IAYA 1ZBUA 3L3VA 2PYLA 3ISNC 2GWSA 4CEZA 2QXFA 5J0RA 3IM1A 3QEXA 4CK3A 4PY5A 1A5WA 3V81A 1LWCA 4LSLA 1S0MA 5DBAA 2VANA 2IHMA 3WNHA 3O3FA 3H4DA 5SZTA 4I2HA 4KLIA 1NJYA 1JXEA 1NJWA 4RNOA 1XU4A 3MEDA 1Z25A 5EOZA 3CG7A 7ICRA 4YMNA 3PW4A 7ICQA 4AILC 1YTUA 4X5VA 3UIQA 4NLKA 3BGRA 1HUZA 3T5JA 8ICCA 3BQ2A 4R66A 1FKPA 2OZMA 3V1OA 1ZQIA 2XC9A 1JL2A 1KVCA 2MAXA 5KGXA 4F4KA 3E2EA 1VSFA 5KFXA 2DFFA 7ICOA 1MU2A 4UB2A 3NCIA 2ZUCA 5CYQA 4KREA 3AVIA 4H4OA 3FDSA 4PHEA 1B22A 5D49A 1BGXT 2PFOA 3OS0A 3OYNA 1Q9XA 1RTJA 3OYJA 4LSNA 4R63A 4E7JA 5C24A 3AO3A 4EBDA 4QWEA 2Q3SA 4IR9A 1MC8A 1HUOA 2X74A 3BQTA 3AV9A 8ICQA 7ICUA 1SKSA 4CJUA 3KKRA 1FXXA 3DOLA 1QSYA 1GOAA 4CFAA 1XI1A 4QW8A 3HW8A 5KT5A 9ICPA 4FJ9A 1XSNA 4M04A 1C1CA 1TV9A 3MR2A 3K57A 2ISOA 2VG5A 3ZSOA 3DI6A 7ICIA 1TK5A 4TUSA 1RT2A 4B08A 9ICKA 4IG0A 2LYHA 3OYHA 3RMBA 4I2IA 4IBNA 4YVZA 2HHTA 4M9HA 3KHRA 3OHAA 4C8MA 1N56A 4ED8A 3EYZA 4KPYA 1WLJA 1BPBA 4M9NA 4FJKA 5HROA 4CEOA 3SQ1A 4FJXA 3QEVA 7ICHA 4F50A 4Z4HA 4UAYA 4F5OA 5IIOA 1HNIA 1QE1A 1JN3A 2YNIA 3ZT2A 2ZQBA 3LWLA 4LH5A 4ZTFA 3KLIA 1S1VA 2ZTDA 4M9JA 2RN2A 1SUQA 4I2QA 2EX3A 4OPKA 4RW4A 4KB1A 7ICEA 1KCFA 4FBUA 4GC7A 5L1JA 1VRUA 1RBTA 3MDAA 5KT2A 3T1AA 5KFLA 1KVBA 4IRCA 5HRRA 4YD1A 4QWBA 4JWMA 5J0QA 3VQCA 5HRPA 9ICTA 1XHZA 1XWLA 4E0DA 4Y1DA 3AA2A 3ZSZA 4QZIA 4B8CA 2BDPA 4F4WA 4M3XA 4FS2A 3RJFA 1Z00A 2W9BA 2DFLA 3I8DA 2BCVA 3OY9A 4M41A 3PY8A 3K4GA 4I2JA 4AHTA 4NXZA 5BOMA 3JPPA 2X6SA 4H8KA 3MXIA 1QHTA 4IRKA 1BISA 1JLCA 1JXLA 4KLJA 5KFYA 3QEIA 4BDYA 4LZDA 1NK5A 3OYKA 4RQ6A 5KG5A 5IIJA 3V7JA 1BIUA 3NH1A 4DSEA 4YR2A 2YNGA 3L2WA 1BQMA 5KFJA 2UVUA 4LZGA 3AO1A 4DFJA 4AHVA 3V4IA 5HP4A 4CCHA 5HNKA 2G8IA 3PVXA 8ICMA 1SL0A 3V7LA 8ICNA 1B9DA 3THVA 4I9QA 4NCBA 3QEWA 4DOBA 4KLOA 3DLBA 3EPGA 3GIKA 4NYFA 1WSIA 4CEAA 5C5JA 4Q8EA 5J2EA 1RBRA 3PNCA 3MR5A 3RBEA 1FKOA 4TURA 3V1QA 2P5GA 4GMJB 4LY7A 1S1XA 1TGOA 2BPCA 4KN4A 2KFZA 1WAJA 1VSDA 4ECYA 5DKWA 3AVHA 5KFFA 2BQUA 1LWEA 3OYDA 4BXOA 3GILA 3Q8SB 1HJRA 1QLNA 4DOCA 3QEAZ 2ZJAA 1NOZA 3RH6A 1B43A 1ZQEA 2P1JA 4K4IA 3OGUA 2IS3A 4UB5A 4DQSA 3HL8A 4TUPA 3PMNA 4GLXA 4MF2A 1I39A 1TV6A 1ZQCA 3NGDA 2KN7A 1S0VA 2UVRA 3C1YA 5I42A 2HHXA 1NK9A 4B9MA 9ICNA 2HVIA 2W8LA 5DQGA 1X1PA 1TVAA 3A2FA 5BPCA 1PZNA 3N4MB 1TK0A 4CJVA 1U45A 2PXIA 3HX0A 3RJKA 4WE1A 3K5LA 3PO4A 1Z3EB 4YG2A 3AVBA 1QS4A 2FBXA 3EZ5A 4O4GA 2I9GA 2QK9A 3VQ4A 2PYJA 1ZQGA 4NCAA 3V6DA 3HT3A 3ZSWA 1BPYA 4OPJA 4DU3A 7ICLA 2BGGA 2JEGA 3PX4A 4CEFA 4I2AA 3VQQA 2C2RA 4R65A 4CHYA 4FM2A 3QEBZ 3C95A 8ICVA 2A1JA 5I3UA 4KHNA 4TSXA 4RPXA 5CHGA 4DSIA 1UWBA 4MF8A 2C2DA 2PI4A 2HNDA 3RMDA 4DTSA 3L2VA 2IAJA 3C23A 4M3WA 3OYBA 4RG8A 2BCUA 2XY6A 3L2QA 3KIOA 2HW3A 3KLFA 5KFCA 2Y1JA 3LALA 3S9HA 3GV5B 3VA3A 4FZZA 4QZAA 3Q8QB 3TAPA 4KLGA 8ICZA 1ZQYA 4DTRA 2BR0A 3QERA 4Z6FA 4DLEA 1UA0A 3QZ7A 1KRPA 4KTQA 4F93B 4GW6A 5CB1A 1S1WA 2B21A 4FJ5A 1KFDA 3V6JA 1TKXA
chains in the Genus database with same CATH superfamily
1ZQFA 4ZCIA 2AYBA 3PX6A 2QZ8A 3G10A 5DDMA 3PLAA 2P9NA 4NWBA 2QWNA 3UE2A 2XMUA 2BJ7A 4H0PA 1R0BG 8ICPA 3TP2A 5AQQA 3PSFA 5A0LA 3KLGA 4ID1A 2GIQA 3C21A 3BKTA 5EHHA 3MX5A 4OYMA 4KI6A 3HCXA 5F41A 1SL2A 1NPPA 1ITGA 3KJVB 2VU5A 3I1YA 2DGQA 2V2VA 2ZBPA 4ZJLA 2L9WA 4N56A 5MLCQ 4DR3J 1V85A 1ZM9A 4NLBA 1OQ3A 2R7VA 3UD3P 2DH7A 3MF5A 4Y2YA 2CPDA 1FTCA 1JLQA 2DGSA 5T7LA 2HZCA 4DOZA 4DR7J 1U0HB 5A6WA 1ZPWX 4EO6A 3MM5A 1IKXA 1WDTA 1I3AA 1F3VA 3PMLA 5AQHA 1DXSA 3JSRA 2IY5B 3EGZA 1X60A 3KXDA 1A0OB 5HN0A 2HSZA 5KFWA 3M8RA 4Z7CA 2V7YA 4CFDA 2Z2LA 4H0VB 5E0OA 3TQEA 1DZ5A 4OLOA 3PJ9A 3MPVA 5L1KA 3S7RA 2MQLA 4EFHA 4CGDA 2HHHF 2W43A 2P5OA 1VSEA 4R5PB 4CJRA 3MOJB 2KG1A 4ZOHC 2FB0A 3S3NA 5DDOC 2R2UA 2HLTA 5KAKA 3WQTA 4ILLA 1YJ7A 2Q1NA 3ZSRA 4GKJF 3D1HA 7FDRA 3P6YC 3QFUA 1S97A 4LQ3A 1Z2ZA 4H54A 3L5KA 2DO0A 4FN5A 5K14B 2GO7A 2OYQA 1S1WB 2XWYA 2Y0SF 4C48A 1JLAB 3M32B 1MW7A 5JS2A 1UEKA 4HHHA 4KV8B 4CJQA 2G1DA 2NO5A 2OEHA 2F96A 1KD1T 4WQ5C 4ZVQB 4A8WA 2IYGA 2WAQF 3NCPA 3ZZYA 9ICGA 4FK4A 5A6PA 1IKVA 3SCXA 5AM2A 1WF0A 2F3NA 4CE6A 2JHDA 5J2NB 1I94K 3KHGA 3IDWA 1MN9A 4XDDA 4Y2SA 2D3UA 4J9LA 3DRSA 1RTDB 2MQMA 2P9GA 4LFBF 1XNQK 1X6IA 3A0BU 3WK6A 3D7SB 3M2VA 1J53A 5IWAJ 1ZQXA 3CJBA 2P35A 2J9DA 4R8UB 2BKEA 2EWHA 1ITPA 3HM9A 2QI2A 2D41A 2BRLA 2OEMA 1HQEA 2DBBA 5ETVA 1NAQA 4CIGA 5ETSA 1CZ9A 2B9YA 3OL6A 1ZQOA 1QSSA 3LH2S 4LREA 1HYSB 3Q23A 2BCQA 3O5TB 1T9WA 2I1QA 4ATNA 1YJRA 3P83D 4DV3J 3ED5A 2QTDA 4P2SA 2M4MA 2VA8A 4JI8K 4RQ8A 2E2OA 1Y3JA 3HKZF 2OKQA 1FEEA 5HQ8A 4CLPA 3I5CA 2RU3A 2VCPA 5A8WB 3MAAA 4JI5J 3MXHP 4YR3A 5CR4A 3D2FB 1NLKL 4QZDA 4ELUA 4B9TA 2HZAA 3FFIB 1IIPA 4DSFA 3A12A 4LF4J 3UXOA 3P49B 2EI5A 4CE9A 2D1CA 2KO1A 2X3GA 3LTOA 8ICLA 1F21A 3CCLS 1QJHA 3EGVA 1NMEB 5ETTA 2DR5A 2HMIA 4CF1A 4K4UA 4KGVB 1VQPS 4CYUA 2F1FA 4AYBD 2PO4A 4A8SA 2F1HA 4F3TA 4U7BA 3C14B 4XO0A 5KOXA 2ASPA 3S3OA 4DDFA 1Z4NA 4F2SA 4CJ4A 5BYSA 1GLLO 4NA1A 1EQMA 1Y5NB 7ICGA 4AQYK 2G06A 5DB6A 1E6YB 4K4WA 3Q8LA 4JKGB 3V1RA 1NK6A 3NBPB 5J1PA 3FJ2A 3CJ8A 4DS5A 9ICLA 2M5YA 3C46A 3NF9A 2QLWA 3OLBA 2ZUAA 4M42A 1YX2A 1VI7A 3AM9A 5ALJA 4OHWA 2YHBA 2VWJA 4RPYA 3R2CJ 5L1IA 1KVJA 5IV3A 4O5KA 2YNHA 2ASDA 1ZAXA 4FWNA 3LP2B 4C4TA 3J81j 3C8YA 5D4OA 3L7PA 4ER8A 4OV6A 1NK7A 2W4CA 1UVNA 2CVIA 2V34A 1BNPA 4IH5A 3HM8A 1YK9A 2YKOA 2DYAA 2DNPA 2YXLA 3SQOP 1UT8A 3ZT4A 1P8ZA 2W42A 2E1YA 2BX6A 2MLZA 3O8WA 2QB0B 4JI7K 3DLRA 4LRDA 3C2MA 2B4VA 3HLUA 3W64A 4QJVA 2QARB 5G5HA 1FRMA 4QW9A 2OH2A 5A0YA 4BE1A 4RT3A 3Q89A 3EWAA 4MLHA 5CCLA 4ZPWR 4CF4A 1LW0B 2A42A 1RYRA 1MQ3A 4KLUA 2V8PA 3AVFA 5J2CA 1XMQK 3DEEA 4M5LA 4Y00A 5HK4A 5EX5A 1KVKA 3MR3A 5IILA 4EEYA 4AP9A 1TL3B 4NLOA 4DV4J 3FSYA 3J7AN 4CBUA 5AT1B 4OZ1A 3IS9B 1N6QA 3N97B 5KRTA 4W5TA 3SQ4A 4TVAB 3CPWM 5M2PA 4K8ZA 1OYEA 2NZ4A 1S12A 4PXBA 4KO0A 3RW6A 2QWPA 2WF9A 3FVYA 1DY3A 1RQ0A 3EW9A 3MEGA 2G13A 8ICGA 2AJQA 4NE9C 4FJJA 4C7ZA 2LMIA 1ZAVA 1N5SA 4CHZA 8ICYA 1PK3A 3B6OA 1YHQN 2MTLA 3MM9B 1QHAA 5ETOA 1KW4A 1Y10A 3F2KA 3U3YA 3MXMA 5ETKA 2DKOB 4FP9A 2IGIA 5GIOA 5AI0A 1JLBB 5AZIB 1ZXOA 1N5TA 4F5PA 3RF9A 4ZVSB 3RB6A 3T9NA 4LBPA 3UCZP 2WSEC 1CJTA 2A6AA 4CO2A 1NPKA 4J2DA 1KN5A 3RAMA 1U8SA 1SWVA 5HL7L 4KLSA 9ICRA 5LY3A 3M8QA 1X5OA 3HHLA 1RDBA 4Z6EA 5ALEA 3IC1A 4J7CA 4NLXA 2K4EA 3ZXWA 3N7RC 3KNGA 3OD2A 3ELHA 1ZQWA 2YMMA 2CFXA 5CCMA 1SAZA 2BCSA 2GTDA 3QT8A 3T5HA 3AD8C 3QU7A 4NLPA 4CJEA 5DDYA 1J6ZA 4QIEA 4K4HA 2J0QD 1COOA 1NO8A 2KRRA 3W3SA 1RTHA 3ISDA 2DGUA 3GSDA 4P4OA 1FDDA 5A8RA 3SAHA 2FGOA 2MGZA 2H51B 5AK4A 1VR6A 1RXOB 3D2SA 1HI0P 2I5JB 4GKJK 5ALYA 4ELTA 3TA1A 4FLVA 2AXTU 2FI1A 3K2PA 1RKJA 1NPRA 3BH6B 4GKKJ 3PCOB 1WWVA 1Q0NA 1JMSA 4DR6J 4ECRA 2D74B 3QSIA 4CGIA 1D8BA 3PHTA 4C3KA 4G65A 4RUBA 3PEHA 2A3ZA 1UQVA 2PY5A 1ED1A 4OLPA 5JJBA 4Z7YA 3F5TA 1G1XA 4OHXA 8ICWA 1O51A 4OV1A 4X84A 4LVSA 4CF5A 3KK2B 4C8LA 2O4IA 3UN2A 4GVLA 1FJGF 1VAZA 1JRPA 2V8DA 2NO4A 3M05A 2FJ6A 4LFBK 5MLCV 5AK5A 5F8MA 4U67Q 4ZP9A 4M3RA 2DRDA 1RBSA 2KHOA 2RHKA 3SBTA 1GLJO 5AQPA 4JI3K 3FGUA 2OHDA 1Q18A 2EC0A 4CJ3A 2FLPA 1N34J 4Z4EA 2IM0A 2O3DA 2E5SA 2BPGA 1CPZA 3F0NA 1G15A 3HZEA 3UM9A 2HB5A 1HNZF 2DR6A 2M9KA 5ALXA 1LCUA 4KHWA 4C8NA 1SKWA 3DLEA 4DPWA 1WC0A 4BRPA 2PT0A 1KS2A 2KH9A 2HZVA 4Y2RA 2EFGA 1WKLA 2HQGA 3KHYA 8ICHA 1CLFA 1IVZA 3UPQA 1QAJA 1AQ6A 1X4CA 5BPMA 5FDLA 1TKTB 5E41A 1WI8A 1YSJA 3L95X 3G6YA 2V69A 3UXPA 4KX3A 3DLLL 3B54A 3THWB 4FLXA 5KG4A 5HMLA 1RTIA 4ZN3A 3LOUA 3P31A 3S1TA 3O80A 3QLHA 2KNJA 4CZJA 4KLDA 2OI2A 1CC7A 1SJ3P 4RBTA 2CDQA 4DCJB 3UDLA 4KY3A 2WBRA 2ZE2A 2HS3A 2K7JA 4KN7A 1WORA 3T1HF 4CZKA 1CULA 3QU5A 2BEFA 4F02A 2XG8A 2JEJA 1G6BA 2CQPA 3F5EA 2JNJA 1EKRA 3DLKA 4P0PB 1VQYA 1NKBA 1VK0A 1K73T 3GV7B 4QPTA 5HR6A 2GC8A 3JXUA 3GSIA 3BSNA 3M6KA 2GIFA 2BE2A 1F2GA 3TSPA 1D0EA 2KZMA 4HUGA 2GH1A 3Q8PB 3MGVA 1TU0B 3MCPA 3Q7BA 3AH6A 1SV0C 3V6KA 2ZM6J 2W2MP 3IRXB 1IBKJ 1DJ0A 3FZBA 1ULRA 3G8TA 4I28A 4DV5K 3GJQB 4IKAA 1RNHA 5G0RA 2GAHC 1NHKL 1PJ6A 3HDSA 3OFGA 2LEPA 1R89A 4HT5A 3Q24A 3HK2A 2H48B 3WXIA 2FHJA 1C1BA 3KWGA 3MPDA 1UETA 3P4IA 3D6JA 1L3VA 1HHQA 1TTHB 3CDUA 3EWGA 2JEFA 4XH4A 5F8HA 3IA0A 2EHGA 5KI6A 5A2QU 1W25A 4YOYA 4MFBA 3TQ1A 1REVB 4O23A 3W5ZA 1FJCA 1C1AA 1ZQAA 3CYMA 1FRHA 3VEVA 1O03A 2KXFA 5HMYA 1KAZA 4EMDA 4EYHB 3RH4A 2NRRA 1OPZA 1ZBIA 1JLFB 2R3VA 2KK0A 2XLKA 1BQNB 2B8PA 2ZJPQ 1TMMA 3PHEA 1VDVA 1WOOA 1Q95G 2AJ0A 4DG1A 4F92B 2F9JA 3MPWA 4FWKA 4Y2TA 3V9WA 1XR5A 3S8SA 3D3BJ 4WQ5A 3R5BA 1VCTA 1RXWA 3FC9A 3DWLA 4NXNJ 2MRLA 1VBZA 2C42A 1S4EA 1HYZA 4KYZA 2PFQA 2CDRB 4UT4A 4LFAJ 1T05A 3GFYA 5BYQA 2H3GX 3LK9A 2JLEA 4P71A 3CCLN 3UKUB 3KHHA 4FBTA 1HIYA 3AD9C 3GFHA 4FK2A 2EZXA 4LRAA 2FJVA 4J9NA 4CI0B 1VQPN 1GAOA 4PQUB 2XHBA 1UAWA 2DNMA 2V8GA 3VZIA 5AE1A 4DKWA 1GOCA 3QGIA 5ALFA 1N54B 4L73A 4NCGA 2YKAA 3Q8UA 5E33A 3DGVA 2Y9UA 2VC1A 3AY0A 2FJAB 4F8RA 2EW9A 3QO9A 1AXQA 1D5AA 2DNZA 3JSYA 3W8PA 5LMUJ 2YMQA 4YY3J 3R97A 4I27A 5H9EK 3GR1A 4CH0S 1HJPA 3HHNB 4X4NA 3ZDAA 4YN3B 2MKJA 1JCEA 4DLGA 4DWIA 2VKZG 4AH9A 3SUPA 2FZGB 2KQ2A 1MWKA 2FD2A 4OLBA 5H2FU 1PG5B 2O01C 1T03B 4JKHA 5K8OA 1SH2A 3L3CA 1MDUB 4NLDA 2FLNA 2B51A 4MEXA 2GHPA 4R0JA 3P1GA 1DQ8A 3LDAA 4K0KF 2VASA 2WTUA 3RBDA 3WNEA 2AYGA 2QB1A 3JPTA 4BX9C 2F8EX 2DB1A 4IO9Q 3CC4N 3SAGA 1M5PC 3OPXA 5ALSA 4OYBA 6FDRA 3MGIA 3AD7C 5AJ3F 3FZ2A 3AJDA 4FK0A 3C2KA 1DTTB 1QY7A 3QIDA 4EX7A 2HHSA 2GHVC 2JR5A 3H5UA 2W9AA 1ZQDA 2O8FB 2ZIWB 4EAHD 4DR4F 3QYYA 4DQPA 3VEWA 4DUTA 3QB0A 2Q97A 4NWIA 1Y00A 1W7AA 1RDDA 2BACA 2K4HA 1RWKB 3WEEB 4BG9A 1T3NA 4PL7A 4HUFA 1VSJA 2CPXA 1RT4A 2OMLA 3MAHA 4O5BA 1JLGA 1LWCB 3HZGA 5LMNF 2WUSA 1DRGA 1UJ4A 2CPJA 3ZT3A 4UAUA 2DR8A 3UNGC 1RK8A 2MZJA 4EU0A 1WDDA 4FO0A 2ZJRL 4M5IA 1N48A 3P3DA 2ZJ8A 3DDIA 3GLJA 5A2QY 4JI1F 1E4FT 3AVKA 3LPEA 3FZMA 4L3KA 2CQ4A 3ZTQA 1FJGK 2RS2A 3D2WA 9ICSA 4IFYB 2XICA 1FKPB 1PK1A 3V2UC 5ETPA 1LB2B 2RF2A 4BRKA 1NJXA 2C3YA 5BRHA 3EZWA 5KAIU 1MU2B 5AQVA 4RX6A 1RBLA 1Y7PA 4I2PA 3GCWP 5GMDA 3CQYA 1ZBFA 2I8EA 1HNZK 2R8HA 2HBMA 3ZDDA 3MMAB 1YXQA 4OKJA 2R18A 3JTOA 5FJ4A 4CF3A 5C24B 3G82B 2XNQA 2ZKUA 1K0TA 4CH7A 2QE5A 1WTFA 2KM8B 2BTFA 2VFSA 3TWZA 5KPTA 5CP2A 3QIOA 3UR0A 4ZIWA 3OTBA 5CR0A 3KUEA 2C22A 4I6WA 5FRNA 2HRYA 4DFDA 3FMBA 1TFWA 3K0SA 3PACA 4JS5A 2QLBB 4J9SA 5J0XA 1RDFA 4Y2MA 4GY2B 4FM1A 4W5NA 2QN6B 3DI6B 1S6PA 1HNXK 2E5IA 2YNFA 4DU7A 5K8PA 3W2WB 3SR6A 5DQIA 1GMVA 1GXTA 2NYHA 4OYZA 3VA0A 5F1XA 4FJHA 5ADZA 3KMQA 3FKBA 3AQEA 4J03A 2VJVA 1MQ2A 3T1HK 4OX9K 2CGKA 1N8RT 3MFHA 4O3MA 1O08A 4RQ2A 1JJ4A 1ZC6A 3RWUA 3R3TA 1E4GT 1N52B 3MM6B 3U27A 1HNIB 2V7ZA 3WQPA 5K8MA 1J2VA 2GVDA 4PG8A 3G4SS 1UP1A 4BR4A 3NXZA 4L8RB 5LXRA 2W03A 5EDWA 5A8KB 1HPMA 1ZBHA 3RGIA 1S1UA 3V72A 4BRAA 3ZDEA 1VRUB 4RCHA 5AFUH 1XIQA 2QM1A 1AYEA 4JRQA 3ILIA 4F3OA 4Y2KA 1P1LA 2DNQA 1FRIA 3BDPA 4QYZK 4AM7A 4TYBA 4Y2IA 5B0CA 2GOLA 4KFBA 2D69A 1K1QA 2O8EB 4U7UD 2ACYA 3DV9A 2IMOA 5DZ7A 2CRXA 2XHCA 3R6MA 2W9BB 2F1IA 3DOKB 2GELA 3M1VA 1L3TA 1XQIA 4M0AA 1S9FA 3AA8A 3WDOA 1C2PA 1UAXA 2F1JA 1R3NA 1WHVA 1N5VA 2IJFA 4PWDA 1ACMB 3GFZA 4ZVUB 1BQMB 3Q8KA 2G9OA 2CJAA 5CD4H 3I96A 3VAFA 3DOMA 3SQ2A 2CIMA 5IV4A 3IG8A 3UMBA 2HBRB 5BN9A 1Z6RA 4CZGA 2CG8A 4KT0C 5IFMA 4DTPA 2J76E 4K5RA 2VFTA 9ICFA 3VQSA 2IRXA 2M0GB 1C0TB 4DBQA 3A0IX 4X2BA 2VKQA 3V9ZA 4CTAB 4CJKA 1O1WA 2W2NP 4PGQA 1WBBA 4I67A 5CYMA 4OL8A 1S1XB 5AI4A 4B3OB 2JJ4D 5GADU 3OA9A 3ZSQA 3J7ZT 3OR2B 2V67A 1XO1A 3RU0A 1WOSA 2BMBA 5GTIU 4RQ7A 4FFDA 3UVJA 2FY8A 1DEJA 1Q9YA 4TU8A 1TL7B 5GADP 5KT3A 4BWMA 2Q6BA 2O8DB 2W04A 2CWKA 2DEJA 5CA5A 2X1FA 3UKRA 4BR5A 2KV2A 2I5HA 1W2IA 2VIHA 1K8KA 2ZNZA 3VQ7A 3P38A 2HHVA 3TAQA 4OO1J 2CYYA 1YBAA 4J9UE 5AI5A 4YD2A 5F8JA 1Q8KA 2KFYA 3P5TL 4WXWA 3HHDA 2POKA 4YDUC 2XMTA 1S5JA 1U04A 4EEKA 1S1TA 2Z1GA 2C2EA 1WKKA 2A1SA 3M9OB 4KE5A 4B9VA 4KLTA 1R8AA 1I94J 1XNQJ 5F9LA 4HCCA 1K44A 3SBGA 2WVCA 4NYPA 3LZJA 2FJEB 2W9CB 2WZ1A 2GW8A 4QAGA 4CM0A 1BDGA 4RQ3A 5CHIA 2IVNA 1HIWA 4K0KK 2KHCA 4CI6A 4Y2UA 2A19A 3IRWP 1X3MA 3AHPA 2HVZA 5AFUA 1JXVA 3MM8A 2A1JB 1QQCA 5IT4A 1UFLA 3FGVA 4JK9A 4RT2A 5LXYA 3G6VA 1OQ6A 1IXRA 5AJ3K 3TTDA 1MROB 2WVEA 2VG7A 5AQKA 3TADC 1H2VZ 3K1ZA 2BZ2A 4H5VA 4UAVA 3GQCA 3BQ0A 4JI8J 3TVZA 5JICA 5GAGU 2HVEA 2AX0A 1GXUA 2C2OB 2K3KA 2FVQA 4CDIA 3N5FA 3RBZA 4DR4K 3LAMA 9ICWA 4CO5A 5D0EA 2ZIXB 4YUDA 3AGRA 2WB1C 5GAGP 1VFJA 4JYAF 3M6GA 3C7NB 1FEHA 3C6HA 4GFJA 4M3TA 1NGIA 3O4QA 2KG5A 3VQ6A 1ZQLA 5FPEA 1IKYA 4E8UA 5JLHA 3CCUN 1K9MT 3FBBA 2YB4A 3F56A 1EHWA 2J8AA 5DB9A 4OD0A 2DGOA 2W6LA 4RO0A 1CXQA 4DTXA 2C2KB 4M47A 5HR7A 3AJ2A 3KLEA 4JI1K 4QWDA 1NM1A 2CJ9A 2KYXA 2K60A 1JJHA 3G2XA 2ZC3A 3O3GA 3KKSA 4NZ6A 5AM3A 4PJ0U 5ADXA 4B1VA 2FVSA 4IDKB 2W7AA 2CNKB 3MMBA 4OI4A 4AQYJ 4CEZA 5CE3A 2MKSA 2QXFA 5J0RA 3IM1A 4B3SF 4CK3A 1X4HA 3KZIU 2FQQB 5DBAA 2IHMA 3WNHA 4MDAA 3H4DA 4NLYA 3IXQA 4RNOA 4CQ1A 3MEDA 1Z25A 2MQQA 3MN6A 1KAXA 2QYCA 3B82A 4AILC 1DLOB 2DGZA 3KKAC 5ALTA 4LF2A 3UIQA 4A4JA 2VICA 1JB0C 2XB2D 3A1YG 2HK3A 5GAHU 1YG0A 3BGRA 3SMVA 3SCJE 1NSAA 1N62A 2YKQA 1KXPA 5L1MA 1U1LA 2E5LF 2VDHA 1N5YB 3BQ2A 3D4JA 1HW8A 2LU1A 5GAHP 2E8PA 3TJ8A 2XC9A 5AICA 1JL2A 1KVCA 2AWZA 3D66A 2YVSA 5KGXA 2ZUCA 4JI7J 2BUNA 2W2OP 4TN2A 1BMQB 4GRSA 1FW6A 2OPQB 1DARA 4C8YA 1J2NA 1BGXT 1MG7A 4LRFA 1XQSC 1H1VA 2B7BB 2RQ4A 5AM0A 3GE1A 4R63A 5AIBA 1W26A 2DIUA 5CAAA 2Q3SA 4IR9A 3EM1A 3QU4A 3E9PA 4OZ5A 4ZIVA 3MECB 2CJXB 3QAEA 2BDUA 3E8OA 4ZLLA 2KDOA 1B99A 1Z2LA 2XEXA 1JNZB 4RWTA 2G2OA 4OJOA 1YRUA 1GOAA 4CFAA 3L4BC 4CZEA 4QW8A 5KT5A 4M04A 4UATA 1C1CA 4L6V3 1TV9A 3K57A 2A2CA 5ALDA 2NXJA 4TUSA 4IOBA 4CRXA 3L7UA 2B43A 4DB3A 2CJQA 2NYIA 4JI4J 1Y0HA 4USMA 4YVZA 4M9HA 3MPUB 3KHRA 3NNCA 4KPYA 3C6AA 2LVWA 4M5HA 1WLJA 3DXMB 3QX7A 1HL6A 4FJKA 4A57A 1RJJA 4X64F 5HROA 2VV5A 1EX8A 4EK2A 1H6KX 3BSAA 4Z4HA 1UPHA 1VRQC 5IIOA 1BE4A 3IUCA 4F71A 3ZT2A 1FK9B 1PO6A 3M30A 4G9BA 3CERA 3M6UA 2PSZA 1SUQA 4I2QA 3QWPA 2PAVA 1NU4A 2QLXA 4GVBA 3CO0P 1UPMB 3AOBA 4C11A 4UOGA 2ERRA 3KK7A 1K8AO 5AQSA 1HKAA 2FF3B 1W2BR 3T1AA 4MO4A 4YD1A 4K50A 4JWMA 3PTWA 4OJ1A 3VQCA 4YB7A 9ICTA 4URGA 4CP5A 3J81U 5HVFA 5AKKA 2LA4A 4Y1DA 3EDQB 3TZWA 3AA2A 1GTHA 4F4WA 2BUPA 4M3XA 1ILYA 4AL5A 1Z00A 3UD5A 4NL9C 4U9RA 5J2QB 5CYQB 2BJ3A 5H1SQ 1DURA 1E6VA 4DMZA 3PY8A 1X9JA 4PYAA 4URQU 3UD4P 3MTKA 4URSA 1RZMA 4NASA 1QHTA 2P9KA 2AJFE 5KNIA 2HFZA 2CVEA 4BDYA 2E9ZA 3AEVA 4RQ6A 1LK7A 5IIJA 4RU2A 2QMUB 3KJFB 3L2WA 1RT1B 4M5DB 4GKJJ 2UVUA 4DFJA 3H2VE 3BSOA 5HP4A 2DK2A 2KRBA 2WF7A 2FY1A 2WB1F 2XYHB 1SL0A 1UW4A 1IBCB 3V7LA 1Q16B 1T02A 4DZDA 2DHSA 3IM9A 5J1EB 2YB1A 4DOBA 4IG0B 2BH1A 3G4SN 5AZJA 1I51B 4RW7B 2CPIA 3QNMA 1FKOA 1DGJA 2F40A 2P5GA 1F9HA 5TISU 1RHQB 4KN4A 3CF5Q 3CJQA 3WKAA 1VSDA 1WAJA 2YQ0A 3LW5C 2F77X 2AYMA 1LWEA 3OYDA 3GG0A 4MH8A 3Q8SB 3QEAZ 2J9DE 4QIGA 2GZOA 1NDCA 3AT1B 1B43A 5HANA 2W7PA 2IS3A 4YMEA 4DQSA 2E1CA 2NR0A 3QRPA 1JROA 2YNIB 1I39A 4JI3J 1S0VA 2HCFA 3KLIB 2VPZB 4A8KA 1NG9A 2XYGB 2JFDA 4PWWA 5M1FA 2Z30B 5DQGA 1UCVA 1JKHB 1PZNA 2Q36A 4CJVA 1XR6A 3KG1A 4M5JA 2PXIA 2NV3A 5HMXA 4EENA 1FRXA 3PO4A 1I1GA 3EGWB 5D15A 4X62F 1M5KC 3AVBA 2R7OA 2WHEA 4NEYA 2GFFA 2FBXA 1S49A 1TUUA 2QYGA 4OZLA 1ZA2B 4A46A 3OXLA 2HWTA 4OPJA 3C65A 7ICLA 4WFXA 4DR2F 1AFJA 4CEFA 3OVBA 4JYAK 1WHXA 1VQ9N 2ODGA 3Q8VA 5AXLA 3R7NB 3ZETB 3VEZA 3IP4B 2B8QA 3DXBA 1RAAB 4DUYF 4RPXA 4IS7A 2MEWA 4LF8F 1Q78A 3KOAA 4DTSA 3D6HB 2DQNB 1CJUA 4DUZF 3BSCA 5IT9O 1VLOA 2QSWA 3V4IB 2Y1JA 3S9HA 1RTZA 4ZCLA 5C2DA 4FZZA 4QZAA 3TAPA 3UE5A 2HRUA 4KLGA 3SCIE 2ZD1B 1LKYA 1VLYA 1QAYA 3QERA 1UMJA 3M1YA 1COKA 1UA0A 2A6MA 4KTQA 4B3SK 2HBJA 2ZIVB 5CB1A 3V5RA 4DV5J 5AQIA 4FJ5A 1H73A 1KFDA 3MD1A 2N7YA 3V6JA 1SZPA 3E01B 3IBFB 2BOPA 3H7IA 4EBEA 2BKPA 2O5DA 3ATVA 3LYSA 4J8FA 3LDNA 3OTEA 1VQLS 3W1YC 3NGSA 3AN1A 2XM3A 4K43A 5FLXO 4PZNA 2ROGA 4FO6A 3MR6A 4O44B 3SFUA 1TL4A 2HOQA 5IOLA 2RUGA 4BHQA 3I33A 2R4FA 3B78A 5FPDA 4LJMA 5J1NA 1Y88A 2E5LK 4P75A 4RW6B 3L6QA 5AQUA 2RD5C 2JZ5A 3CMAS 3H40A 2DPNA 1KAYA 1B0VA 5DZ6A 3OFEA 3EJMA 5BR8F 3OXFA 4YOVA 2WC9A 2DISA 4KPCA 3QZ8A 2KI2A 4X4PA 4F25A 2EFPA 4NMXA 3NMRA 1NMDA 1ASVA 4BR2A 1CJVB 3DNCA 3TVYA 3JQJA 4WBFA 3TA0A 1X40A 4LF5J 5IQ6A 3PNIA 4YXMA 4JKBA 2QKQA 3VPZA 4RW9A 3O3HA 3VF6A 1NZBA 4PG5A 2HFUA 4F4ZA 4RNMA 2CQ1A 3DRYA 1U2CA 4DI6A 4IQUA 1PAUB 5JLFA 3GJSB 4OKKA 2PMHA 4AF1A 2NUBA 4Z2XA 3BREA 4KH1B 2WVFA 2ASMA 3WK4A 1SJRA 4ZCMA 1S9GA 2O8BA 2WTFA 4GO7X 4C8OA 4JAXA 2HNDB 1KKHA 4Y2VA 1RU2A 5JVHL 1NZAA 3KLFB 5J2KA 4CERA 2I9SA 3VERA 3OYAA 1YBTA 1VIOA 3AODA 2EAOA 5I3QA 1R8HA 2O66A 2OPSB 1S72S 1J5OB 2R7WA 4X64K 3HILA 1VBXA 2Y0SD 3E0FA 2KKPA 2VFVA 3MDQA 1NGAA 4KHRA 2QWRA 3TADA 1FHTA 4B1YB 4ED1A 3HHLD 1QM9A 3D0GE 3D9BA 5ITHA 1QUVA 1TQLA 1H74A 2WAQD 1R6VA 2LI6A 2GUPA 1VOMA 5H9EJ 1CZAN 1H0HB 1OXJA 4M6WB 1RT7B 1SJ1A 2ZKTA 1VMBA 4K8RA 2R8GA 2VQEF 4CLKA 3NGUA 2G8WA 2MKHA 4NJ8A 5J2IA 3H8YA 3WKCA 3R8EA 2CPHA 3A8JA 3SI8A 1BO5O 4MT1A 2GV9A 3X1LB 1EJ7L 2B5JB 1FX2A 3DM2A 3F2DA 1FDAA 2CPEA 1WBDA 4BVPA 4F67A 3GV8B 4QZGA 2WSFC 3M2UA 1GMWA 1L3UA 4A8MP 3AGKA 2XZDB 3MM5B 3G8QA 1D4XA 1ZTTA 1LW2A 2V4RA 2BJEA 2GS8A 4F5RA 4JMUA 3CD6S 3HKZD 3MCOA 2VQFF 3LP1A 4DCHA 3K8WA 4H4MA 2OELA 1ELOA 3D1QA 4DU4A 4ZLPA 1Q8BA 1SL1A 1YTYA 5KG7A 1FO1A 2YWGA 3FQLA 3VQ9A 2XMAA 1HNVB 1WEXA 4F0KA 3VQEA 3I31A 2ASJA 3RYLA 4CJPA 3AU6A 2F4VJ 5AKXA 2E1ZA 1IM4A 1RT3A 4BVOA 4IFEA 4HTJA 3BQ7A 1HMVB 2P9IB 3R5GA 3MM7B 3HYFA 1PBAA 3R1HA 2ZITA 4JI6F 1XO0A 5LSOA 1FJGJ 3BV8A 1YITS 2Q4TA 4X4RA 1SB6A 3VENA 1BVSA 3VZHA 1DAXA 4GVMA 1BWVA 3OSNA 5F9NA 2KG0A 2WHOA 3TR5A 4CZLA 3V9SA 3DDNA 2H4YB 2X1BA 5IIIA 2V2KA 4Z4GA 2ZHOA 1VGYA 3QIPA 2DJWA 4DTMA 3OUYA 1JX4A 1HNZJ 4WCEQ 3H1VX 1NHVA 5E79U 3ZZPA 5J2AA 1IKVB 4ECZA 1FD8A 3DYAA 4CRJA 4IJAA 4TQRA 3MGHA 4IOCQ 2MUTB 4X62K 1PUZA 4AL7A 1NDKA 4UAWA 5J2JA 4UUXA 3H8SA 1Q3UA 3DXKA 2KVQE 4G1IA 3ASMA 2DD8S 3H0PA 1NGCA 1TYQA 2UU9F 4DR2K 1HQEB 2XS5A 4JD2B 2QL9B 3D6MB 3F44A 3EN9A 3J8AA 3CCTA 3JS6A 1HNXJ 4PPXA 1ZQVA 2A6OA 2P2CB 5IXUA 5E26A 2CGJA 3SQ0A 2H4WB 4IG3A 3TAMA 2ASLA 3QNNA 3KTQA 3ILOA 4D3GA 1MWZA 2BQ3A 3T3FA 2D9PA 3AVCA 4DUYK 9ICEA 4C80A 4LVNP 5D3GA 1EZZB 3WXMB 3SIPB 3T1HJ 4LF8K 5C25B 4OX9J 3CIMA 5D46A 4DUZK 1GLBG 4E3SA 1MN8A 5BN8A 3TO8A 1BA1A 2KU7A 5LOQA 1AA1B 3TX0A 4OFZA 3RRHA 4JI2F 2YX4A 1PILA 3ENAA 2E66A 4USKA 1WSEA 2B6AA 4ICLA 4MFFA 2FHJD 2IA0A 2GQQA 1V4TA 3B0YA 1X9WA 3M8SA 2N3LA 5ALKA 5KFKA 4J5OA 4FYVB 2E2PA 3QEPA 3IP0A 3KNAA 1UA1A 4CLTA 2YKMB 3CT9A 1JJCB 2NLWA 3DLGB 3NRZA 1S10A 3JQMA 2HMIB 3EEQA 3DU5A 4CLLA 4PABA 2B7CB 1LWFA 3RJHA 4J9VA 1SJ4P 4I56A 3D54A 1BHLA 4NL9A 3WXKA 2XYPB 1I5OB 4QYZJ 1ZQHA 1T9UA 1WUAA 3V9UA 2AIRB 4HACA 3NCRA 5KT7A 4UY8O 1RWMB 3KLHB 4DV0J 3WIUA 1XSPA 4RBVA 3NH0A 2A1RA 2ES6A 4ID5B 4IEIA 4TU9A 3J7YP 1C0UB 3ZZRA 5J2PB 2GQCA 2NQPA 4Q0BB 1HJOA 1VQKS 1SV5B 4ERDA 1CLQA 2FC9A 5B5EU 3HPHA 5BR8K 4CGFA 3RH5A 3DN9A 5CH7B 2Y9HA 4FDFA 4CJ7A 4JBCA 1ZETA 2DNNA 2O67A 2XGQA 3O5BA 1WSJA 3OYLA 5K4LA 2ZJQQ 3OFHA 4N5SA 5GADI 5DM7Q 2GIRA 2D3DA 4BC2A 3AXMA 3IWXA 3I56N 1FJEB 3ETMA 4BY9C 2PFFB 1WG4A 2M88A 5J2MB 2OUGA 2QA4S 9ICIA 2DKXA 3KJVA 1LNQA 4ZHRB 4MAKA 4DSKA 1Y5LB 2HS4A 1FE4A 2WONB 3EE9A 4EP4A 4QZ8A 3BPSP 3EZUA 5DGAA 1NK4A 3FMWA 2YBVA 1J97A 1VQMS 4F2RA 2LCWA 1U1QA 4E7KA 5CABA 3MN5A 2KHVA 2DNGA 1U0HA 3O0FA 2W2PP 4Q43A 3B6BA 1W2BM 1RBOB 4QJFB 2OMOA 2YKNB 5B08A 2CH6A 2LA6A 2BBEA 5B0GA 3C94A 4X4SA 2VF3A 5J8YC 5C2CA 3P8BB 3TAEA 1SQKA 1VISA 4FPRA 2EFNA 1V97A 2MDAA 2PIIA 2E3TA 2JGAA 1UVKA 1D8ZA 3CJ5A 1FCAA 1YLXA 3IG5A 1V9PA 3CD0A 4F91B 1RT6B 2KIWA 2BQRA 1RWOB 4USWA 2NRHA 2FSNA 4PXDA 2CQCA 3TAFA 3NEKA 4QS9A 3FLCO 1RCOB 1FFVA 5TKWA 4DOAA 4Y2CA 4R5PA 3PM9A 1VQLN 2ZBQA 2VQEK 3MZIA 1RHMB 1Q81T 2EQYA 4DS4A 5GAGI 2RRAA 1MWMA 1KR4A 5AKHA 1GEHA 3HO1A 3BEGB 4HHTA 5KFTA 2W40A 3OYIA 3H0MB 5HO4A 3OR1B 3G9CA 1FRLA 2E8MA 4K0KJ 3BJYA 4BQZA 1BY9A 3MEEB 5K14A 1RLCL 2AGPA 3CD5A 2GVZB 2JWLA 4EYIB 4M3ZA 3NNAA 1JLAA 3M32A 2JZBB 3OHRA 3H5YA 1AZSA 2X78A 3RZAA 5AJ3J 4I6MB 4KV8A 4WFBQ 4KHYA 3C6TB 2BABA 3GYNA 4LMZA 1KTQA 1VQSA 2DO4A 2WBMA 2AJ4A 1IG8A 3QNOA 2QSFA 5LSLA 4P52A 2ZDPA 2VQFK 2ALZA 5J2NA 1RILA 3LDOA 2EPIA 2E88A 2Y3YA 4DR4J 1RTDA 1X4FA 1NSKL 2PKEA 3N6LA 1X0PA 4FYDA 3R1XA 3ZNJ1 2UUAF 2LXFA 4DV6F 3FYHA 2RDDA 4F9OA 2VDIA 4ZVFA 3Q0AA 2IA6A 2BANB 4R8UA 5IM0B 1S3XA 4CHPA 5GMEA 4C4RA 1OVQA 5RUBA 1GLFO 4I2DA 2ZNYA 4PGYA 1HYSA 1RTHB 2P9UB 1IR0A 4PCQA 2I6XA 1XUPO 3TUJC 5AQMA 2IOFA 7ICVA 2UXBF 3DDHA 4EHTA 4NYNA 2B0GA 1CUKA 2YHXA 5L1LA 3JPSA 4ANDA 5CZVA 2IMWP 3HMJG 1WSRA 1QQ6A 3MUTP 4JI6K 2IC3B 3VF4A 2XS2A 4DR1F 3BBBA 3CJ1A 2E6MA 5A2QO 5GAHI 4B1XB 4TNOA 4CF8A 1NLVA 2O8CA 3MBYA 2ZIUA 2K1RB 3ETOA 4JRPA 4ED5A 4CD1A 2VZ9A 3RMCA 2Z7JA 1XBWA 2B9EA 4HTUA 3D2FA 2H3IA 3ZD9A 4QS7A 4F5NA 3SUQA 1MN7A 5J0YA 1X9MA 2BJ1A 1BUXA 3OBIA 2RB7A 3JSMA 2NLXA 4N47A 2CPFA 4A8FA 2XO6A 2YY6A 5ALLA 1LWXA 3MN7A 4KKOB 5HQLA 4BBYA 1F3FA 3TJAA 4AHCA 1KDNA 2HGMA 1B9FA 3NS6A 3C14A 2DNOA 1T44A 1PYSB 2AQ4A 3VQPA 2FBTA 2ZVSA 3B6PA 2OD4A 3H4BA 2G0IA 4PR6A 2UU9K 4RUHA 1Q7LB 2IOFK 1E6YA 4KGXB 4P4MA 1EP4B 4ELVA 4JKGA 2K8GA 2XMJA 1XMOF 2N4CA 3NBPA 1NKCA 2J5AA 1X8DA 4JS4A 3IRUA 1BOTO 3VF2A 1R31A 2XMWA 3TAGA 5FRMA 1HQUB 2P8IA 2DTJA 2QFJA 3OPKA 5C42B 1A77A 3B0XA 1W0HA 2H5IB 5KFIA 5L38A 1TAMA 3IGNA 3KUGA 3ILJA 1Q7YT 4KHUA 7ICKA 1QAXA 3LP2A 3UXNA 3W2VB 4JI2K 1NCLA 7ICSA 2E7VA 1RTIB 4UW2A 2B9XA 3C16B 5CQGA 2IVFB 3AO2A 4LBIA 3WKEA 1L8OA 2G08A 1LAWA 2Q2RA 4Y0WA 3N01A 2HGLA 2CXEA 1WAFA 4DPOA 3QMLA 3SQIA 4KGKA 1YZ6A 4DQ8A 2HOFA 5JS1A 2FJWA 3Q8MA 2CJYB 2F2AB 2QB0A 2X7IA 5M1KA 2DUYA 2YWWA 4Z4CA 4WWSA 3CJ7A 5AQOA 2KZZA 1CULB 1WC4A 3PG9A 1XSLA 1R8BA 3C6UB 2QARA 4W90B 2RPIA 1D9DA 2YQ3A 2X1AA 2BW2A 1YITN 4K8XA 1Y3KA 2KJ5A 2ZBRA 2H5JB 2HPUA 2DEIA 2GWJA 1Q3VA 1LW0A 4UB6U 5IC4B 3AB2B 1D1UA 3HTVA 4C97A 4FLTA 1RHKB 1ZQNA 1HI1A 4N8NA 4J37A 1ZQKA 1TL3A 2MSSA 1OKJA 5K8NA 3HI0A 3NVKA 3RJGA 3IS9A 2KM8C 2R7RA 3JPRA 4KLQA 4NO7A 3H0RB 2OTLS 4UB1A 1NZPA 2PI5A 3ISZA 4XA5A 1C1BB 4C0ZA 2Y0BB 4QU6A 1HEKA 2MHEA 3EMTA 2ZH8A 1BIZA 1NM2A 3NL0A 2FF6A 4G1QA 1NB7A 3I5AA 5EU7A 3BPDA 2A1BA 1D9FA 5DM6Q 4MFBB 1L7MA 4C8KA 1RQNA 2OPRB 4FZLA 4KH0B 7ICTA 1SCJB 3R5AA 2MYFA 2JFKA 5CA7A 1JLBA 1WYGA 5AZIA 2EVZA 3CPEA 5KOWA 2HHQA 1UZHA 3HI9A 3NGIA 2OPPB 4Q2MA 2OHFA 3HVTA 3ISCA 3OYCA 4JV0A 1SC1B 2IBKA 5DK5A 2NUHA 4H0TB 4XPCA 2N4DA 2QT7A 5E3AA 2YHAA 1OWXA 3IG1B 4ZPCA 4OZNA 1SIJA 3PR5B 5KQ8A 3J7A1 2F9TA 4ZLNA 2WFAA 4R64A 5DS7A 2HNYA 1ZOTA 4QCLA 2FDRA 5F3XB 3OVNA 4ZVTB 2GJ2A 1ZBTA 2VOOA 4DR3F 1KHVA 2HDOA 3H98A 3MN9A 1IG9A 4IQVA 4B8AB 2MHNA 3V81B 5HRSA 3AJ1A 1M5SA 1RLDA 1XN9A 4DXLA 4YS2A 3CCJS 3I82A 4RUAA 5KG3A 4WQ4C 2XCAA 5CZXA 4MYUA 1VSIA 4B3MF 2OGUA 3K9KA 2DCUB 2LPEA 4CF2A 4NM2A 1RA7A 2F8KA 3NG8A 1RKIA 1S8OA 3NKYA 4H0XB 4ECQA 4I6AA 3U9DA 4LVOP 3CUNA 1XHXA 4P6QA 3PO5A 4CLWA 1FWKA 4YHHF 2D8CA 1A5VA 2JSXA 4C2MA 1X5PA 3M8PA 2YH0A 1RHRB 4Z37A 4Y34A 3TU5A 3NS7B 4F4XA 4L74A 3OLAA 4A5AA 3GFKB 5J2BA 3OJSA 2D3OR 5KFMA 1TUYA 3AOCA 3IKMA 3KKFA 1ZYQA 3PX0A 3KK2A 2DPIA 3FSIA 1CS4A 3BS9A 4CECA 3N6NA 5D78A 4ID8A 5L9XA 2UUAK 2QA4N 4DV6K 2A5XA 3PW5A 2YCHA 3EY1A 4JYAJ 3GMGA 4PHTX 3CCZA 3DGPB 9ICOA 2VG5B 5HP1A 4WP9A 4CIEA 3CCES 4PGXA 5KFUA 3B4DA 4P2MA 2K4IA 2ZFHA 2IJRA 4OGCA 1FT8A 4YEAA 2FJBB 4I2EA 3DRRA 1KQSR 1HWIA 2MSTA 3EO3A 1HBOB 4UBBA 4X4TA 1NJZA 1RXVA 1VBYA 2MXYA 4FE3A 4DR1K 2BE7D 4PL2A 2XY7A 1P8GA 1KEKA 4ZDNA 2G8UA 5IT0A 2FMQA 3EUNA 4B3SJ 3UB5A 1S1VB 5ALQA 3D28A 3H1QA 5BRDA 1RCXB 4FJ7A 4RW4B 5KG1A 1QQ5A 4Y2PA 2CQGA 4C3LA 3QPIA 5IZHA 4FPAA 4IEEA 9ICBA 3DCAA 1VK8A 5BRFA 1CXUA 4TXSA 1T6DA 4WK1A 4P0PA 2CQ0A 1GH8A 3QFHA 1A0PA 5B66U 3ALRA 5DB7A 4RQ4A 1VIXA 2E5LJ 4A8QA 2ATQA 4JI5F 2ZH6A 3G86A 1WACA 3AL0B 5I4MA 2W2QP 3BBFA 1Q5YA 1NI3A 4MEYA 4R79A 3ET6A 4E7IA 2IJNA 4ANEA 4CEEA 3I55N 2QWMA 3QESA 5B0FA 4W5QA 5J8YA 1QD1A 4XRHA 3O9RA 1XMOK 5FPNA 1JLCB 2A1AA 4RQNA 2RU9A 3FUYA 3NY0A 2MQ8A 4BC5A 3S3MA 4QNLA 2DCLA 8ICOA 4LR8A 1BCOA 2W9MA 2JH1A 1S57A 2JLFA 4JB8B 4OZJA 5AQLA 4BRQA 4QZBA 2RQKA 4X66F 4CJFA 4RQ0A 4ECVA 3SUNA 2PA3A 1REVA 3BDEA 4K4XA 3DLJA 2V51B 2D0AA 1ZJNA 1EWRA 1X5TA 2PE8A 4PHAA 2VH7A 3H42A 1JLFA 1SKUB 2E5JA 1NDLA 2IM1A 2V2QA 1T0TV 1ECWA 1L7OA 3ZEUB 4BXOB 3UNYA 4DO9A 3D0PA 4X64J 3ZDBA 1T3OA 3NGZA 4V1Ak 3AA5X 2MPUA 5T7BA 1TV6B 1C6VA 4LD0A 2MKKA 5M1NA 1YTAA 1PYTA 1Q1KA 2AZ3A 5EE9A 3E9LA 1VQNS 2HQFA 1N0UA 4NLWA 3BN7A 4CHOA 4UTGA 1NJIO 2J6TA 2MKYA 1S1UB 3WC2A 4P72A 4CHNA 2ZWPA 4JHDB 1ZS6A 4K41A 1U1KA 3UKUA 3CMES 4WE1B 3T9ZA 3K8VA 2XY5A 4X4OA 3WK7A 3BO4A 3QJLA 3R2DJ 3CFRA 1TUWA 1KFTA 4O4GB 3BO2A 3MUMP 2BCRA 2J7KA 2RQCA 4KHMA 3HHEA 4KI4A 4OPAA 3V6DB 2YV0X 4ITSA 4YP3A 3K1RB 1ZM2A 4FZMA 3W3DA 1NSQA 1NHUA 1GX5A 4ALZA 2HEKA 4FWRA 4O3PA 2PFDA 4FJLA 8ICBA 2HF3A 3MABA 1C7YA 5EE0A 3KZBA 3W0LA 1UT5A 4DEZA 1KEJA 3W9IA 3FEYB 1A6SA 2IAJB 5EGYA 2C2NA 3T19A 4KBOA 4B1ZA 1U2VB 5GVQA 3ZCMA 3AAQA 1NGGA 3R7SB 2W4DA 1UL3A 2LLZA 5GAEU 4O3NA 9ICJA 5DBCA 9ICUA 1SXEA 4MYTA 4ILJA 2VJUA 4DR3K 3W9HA 2QWOA 5GAEP 3RJJA 1P9YA 1BUPA 1U2FA 1VBKA 2K3IA 2LQBA 2ZUBA 4XIUA 3NE6A 3HWTA 4BC9A 4FF4A 4LT6A 1DTTA 4HVZA 1TKXB 3BGFA 3OL9A 1IN0A 5AKGA 4CH1A 4FZVA 4B3MK 3UVJB 4AL6A 4A8YA 2O8FA 3VQTA 2WCXA 2ZIWA 1SJQA 5KG0A 2V4QA 4NZ7A 3R7BB 1KOOA 4YB5A 2Z4PA 3BUZB 3IAYA 1KWMA 3EE3A 1ZBUA 3UDEA 2G5HB 2DRAA 2OYYA 3EKUA 4M7YA 1RUSA 1IR2A 5AM5A 1HBNA 3ISNC 4YHHK 1O6XA 2RRBA 5AQNA 2R2RA 1A5WA 1LWCA 3FSXA 4KMOB 2J0SD 3L4PA 4GV3A 1S0MA 2ZH3A 2VANA 2V6AA 5F2RA 4KLIA 4BC4A 4C9DA 1JXEA 4Y6IA 2HQCA 5CYJA 1XU4A 3CJAA 4X62J 4YOTA 2YMPA 4LJXA 4RWWA 2Y1RI 3CCVS 4H5NA 4DPYA 2ZH7A 4USIA 2VG6B 4NV0A 4NLKA 1X4AA 1HUZA 2CKWA 4HEA9 2BJDA 4NZ0A 4A5BA 2VODA 2EKNA 4DR2J 1PIEA 3GBTA 2L48A 3EICA 4R66A 2GMJA 1FKPA 5E5NA 3V1OA 2IRUA 2B9WA 3CW2C 4IFVB 2MAXA 3A8EA 3W62A 2W55A 2HURA 1UEVA 4IOAL 7ICOA 1M6YA 1MU2A 3JTNA 4DUYJ 3NCIA 1DKGD 1X4DA 1YGYA 3N9UC 3CB4A 1KVIA 4PHEA 1B22A 3A3NB 4LF8J 4E1JA 2EZYA 3OS0A 3OYNA 1Q9XA 4ZVHA 2OSQA 4DUZJ 5C24A 3G82A 4OIXA 4QWEA 5EVZA 1S9EB 3FC4A 2DNHA 1MC8A 2ABYA 3J7YI 1HUOA 5M1QA 1HA1A 3GYXB 7ICUA 1SKSA 3D1OA 2JDJA 2LHTA 1HBUB 5C0YA 4OX7A 4A48A 1ZZFA 4B1WB 1Z05A 1R6YA 1N34F 3LP0B 9ICPA 1IKYB 4FXVA 1Q86O 4LSZB 1HHSA 1NB2A 3DI6A 1FFSB 1VRTB 4ANCA 9ICKA 2RMLA 3CCJN 2FXUA 1UW9A 1N36F 2W4PA 2LYHA 3VR1A 2OO4A 4W4MA 3IV6A 1O0PA 1QDUB 1N4LA 4IBNA 2HHTA 3RUBL 4HH1A 4ED8A 2F7VA 3ZX2A 3EYZA 1KLMB 4ES1A 2KT5A 2I0XA 3SQ1A 3DMJB 1RU1A 3QEVA 4F50A 1YJUA 2BA9A 3HD1A 4P0QB 4DL0C 4F5OA 5GINA 3AQFA 5K20B 1HNIA 1HD0A 2RIJA 4M5NA 3LWLA 5BR9A 4LH5A 5ALOA 4ZTFA 2YX7A 4LF6F 4HH0A 1YF5L 5BR8J 1F44A 2RN2A 5BREA 4OPKA 2QG9B 1KCFA 4FBUA 4NI2B 4YDDB 2Z2ZA 4X65F 5E7OB 2QIFA 1YVNA 1VRUA 3OL8A 4IUFA 5ALNA 2A40A 4GO5X 5KFLA 4IRCA 1EB0A 1PYOB 2WOMB 5HRRA 3JSBA 3D2EB 2QLFB 3VGSA 3FK4A 3QXGA 1YJWN 2F5GA 4RNFA 3EVWA 2O8EA 4X66K 3R6LB 4FS2A 2W9BA 3RJFA 1IBKF 2DH8A 1DK3A 4ZPDA 2CPYA 3PJWA 3OW2R 5ALZA 3K4GA 2HYIB 2XVTA 2VONA 4I2JA 2JVRA 5BOMA 3JPPA 3FRYA 4PXEA 5BXIA 4H8KA 4LRBA 3TSUA 3MXIA 3PFEA 1JXLA 1SQGA 4HDHA 5KFYA 1DT9A 2DHXA 5THWA 4LZDA 5D0RA 4WF9Q 1NK5A 3MK6A 1L7NA 3GU0A 3SBMA 3NP5A 4WFZA 4WF9L 1Y9OA 2OTJS 4DSEA 1VDHA 3BBCA 3U1NA 2HMXA 5JVGQ 2WB1D 2KVSA 5JVGL 1BQMA 1YIJN 6FD1A 5K5MA 1ATRA 5KFJA 1VJ5A 4WFNL 2LBOA 1M1GA 4AHVA 5HNKA 3PVXA 8ICMA 4BUGA 1IQTA 3OBWA 3MWTA 3BYPA 2GAGC 2V63A 2CG4A 4KLOA 3DLBA 3EPGA 1TMJA 4KQZA 4OYXA 4NYFA 3H7HB 2V9KA 5C5JA 4K4YA 2RE2A 3RBEA 3ZNUA 4CTAA 4MJKA 4K2JA 3V1QA 2AMCB 4GMJB 4LY7A 1S1XA 1GMWD 2VQEJ 1FXDA 1U1MA 4ECYA 5DKWA 3ZTOA 3OR2A 3GILA 4DOCA 2ZJAA 5HL7Q 4K4IA 1WUDA 4OHVA 3GWCA 1TL7A 1F5CA 2QFIA 1DGKN 4GLXA 2XI3A 2O8DA 4NOHA 3M30B 2QEXS 5AKJA 5I42A 4U8YA 2GLEA 4YOWA 2HVIA 1VK3A 4CNYA 1X1PA 3A2FA 4A61A 5E3RA 4M5KA 3M8ZA 4OI6A 2WSCC 2CNOB 3KDOA 4Y2QA 2VQFJ 4FF2A 2HHHK 3SD7A 1QS4A 1KC8O 4U95A 2QK9A 1OH8A 3VQ4A 2PYJA 4NCAA 3L4IA 1HR0F 3HT3A 1BPYA 5AIAA 4DU3A 2XWXA 3Q83A 3PX4A 2VBWA 4OCZA 2R7XA 3DDKA 3K5PA 1E6VB 1S99A 4I2AA 4WKYA 4R65A 3VEYA 2W01A 3A13A 4CHYA 5LMUF 3BH7B 2P9KB 8ICVA 2A1JA 1VS3A 2E5HA 5JTIA 4TSXA 3TZZA 2E29A 4Q2LA 2QLTA 1Q79A 1MROA 1WC1A 4DSIA 4MF8A 3PSTA 2C2DA 3C23A 2NSBA 4KR0B 3OL7A 3Q22A 3CHWA 4M3WA 2HBKA 3ZC4A 3L2QA 2HW3A 3SMPA 1V9OA 3SLCA 1TFYA 1S6QB 3GV5B 4YORA 3L3FX 3UN3A 3G71S 3E58A 2ZIXA 3DAWA 1X7VA 3NOCA 4US8A 3C7NA 1ZQYA 1NBEB 2HKEA 4DTRA 5KPZA 2G2YA 1TKZB 2KYZA 3THPA 4WU2A 4A59A 1SGGA 4D3HA 4CGZA 3CMEN 4DPTA 1FFGB 1OIAA 1TELA 3GIJA 1T7PA 3CC2S 4NXMJ 4O0IA 4PYDA 1H38A 3BF3A 1KQSM 4NLTA 3CJKB 1PGZA 4RBUA 1UFKA 5DQHA 3ENQA 1F6TA 3SFGA 1TK8A 4E98A 3K9JA 1D9AA 2EANA 4M3YA 1WNSA 1RYUA 4DR5F 1YRXA 4IDKA 2UU9J 3LPTA 4F72A 1ASUA 3J80O 1EAYC 3OJUA 2ATCB 4PAAA 5CZ1A 2G8KA 2LQ8A 2H5XA 4WKRA 3DLLQ 2HK2A 4FJMA 4DSJA 4P9SA 4J2AA 1EARA 2CH5A 1U1NA 2EG2A 3OVSA 3G0ZA 4LC9B 2ZOMA 3LPYA 3RG6A 4JP8A 1QQ7A 3O9QA 2LM4A 4Y1CA 2BGWA 3LVVA 4JWNA 3Q8YA 1FJ7A 5HSPA 1QH9A 1IKWB 5I3PA 3ZTPA 1L8LA 4J9RA 3GTYX 3V9XA 4V19X 2EFVA 5I9EB 5IIMA 3C5GA 1LEOA 4HHUA 3W8GA 4ZA1A 3R9LA 1XR7A 5ALPA 1X9XA 3OS1A 3W5YA 2L3MA 4FPBA 5KFAA 4F4YA 4DL7A 4J9MA 1F2HA 1M1KO 4KTWA 3ZD8A 2FJXA 3LA0A 3T7ZA 4FOEA 2YWEA 1GK8A 2J0XA 4L76A 2NPFA 2OPQA 1N36K 1Y5IB 5EX0A 1YVUA 3PFOA 1B70B 2YY3A 4F04B 4ZTJA 4H5RA 4I2FA 4H0YB 3LPUA 3BM7A 2E1AA 2SXLA 3S6EA 2VUGA 3MECA 3SI6A 5JUMA 4MDBA 1BU6O 2Q0RA 1NGFA 3Q7CA 1FXLA 2HHWA 3RSEA 3UMGA 1S5LU 5ALRA 7FD1A 1FA0A 2EXUA 1WEYA 4LF6K 4ED2A 1B7FA 4KITB 3GIRA 3ITHB 1U9LA 3SQGB 2B3TB 5GMKa 4NYOA 2YX1A 5DDPC 3CXCR 4X65K 3IDHA 3CCVN 3H2UB 4HCBA 4OZ3A 3VAIA 4O55A 4DQQA 3ZZ0A 2PFPA 1X0FA 1U48A 3DXMA 2HAIA 4KSEB 4USHA 4ED4A 3NUQA 3WUHA 4P2XA 3MURP 3E1YA 4A2BA 3RRGA 3SSQA 3TUZC 2AZ1A 1GLEG 2GX9A 3ADAC 2YTCA 3LGNA 2GX8A 8ICUA 1FK9A 4CJ5A 4DL4A 3SV4A 5HATA 2NYVA 1HKCA 4QZCA 1IBKK 3KD5E 3UQSA 3SEIA 3FCHA 4QS8A 1S0NA 4RPFA 1T9XA 4BRDA 1I6JA 1EETB 2BHNA 3W5XA 3CM5A 3THXA 1S4FA 3MMCA 4FPIA 2HNZB 3UQ0A 2CAJA 1HPZB 3BF4A 2ZH1A 1SC3B 3K0JA 1HYVA 2GWKA 4ZVPB 1I3OB 4CEBA 3AVAA 4FYXB 2O8BB 3BKUA 5J2QA 1J5EF 3D2QA 3UWTA 3SPYA 2ZBIA 3IO1A 4BDPA 2VGMA 2LYVA 1MLAA 4QR0A 4CFCA 2VBZA 2KFNA 1LV5A 5H9FK 4FCYA 5DLGA 3RTVA 3QNWB 2NRZA 4G3IA 4NB4A 2RKIA 1FEZA 4QOTA 8ICIA 1X6JA 5ALVA 1EKEA 1BI4B 3M1FA 4IOXA 1NGBA 1RT1A 1U2RA 4M5DA 1NBWA 1QTMA 4USTA 3FEXB 5LT5A 2LYAA 3H0LB 2FZCB 2RAQA 1IWGA 1QAIA 2I2YA 3CNQP 5KG2A 1PJ5A 2ITGA 2JRZA 4L3NA 3L4QA 4AHUA 3NDKA 4CGGA 4BDZA 1WC5A 5J1EA 2IDLA 2H3FA 1NH7A 2A3VA 4B3RF 3NCQA 2VA3A 3PSIA 4RW7A 1ZQQA 3BF1A 1BPZA 2CRLA 3THYB 4Q5VA 4RWXA 3R9KA 4ZVEA 5DJBA 3KWMA 1CG2A 3CDBA 1GLDG 4J90A 2WVBA 4NYZA 4EUVA 1FNMA 2BKOA 2ZH9A 2ZBCA 4H5TA 2F8SA 1B0PA 2N1RA 1LFPA 1F5BA 4CZCA 2LQJA 3ZT1A 4K4VA 2UUAJ 2HQDA 4DV6J 1HR0K 5C10A 4ED0A 3JYTA 2OJ3A 1Q8IA 2G4BA 4ED7A 4UB4A 4TUQA 2P9SB 1SXDA 1VJQA 3KFWX 1JKHA 4PL1A 1LW2B 2L9DA 2C1EB 4OI3A 5LMUK 4WFAL 4YFUA 5EX3A 3SCLE 2HVHA 4C4WA 2P9PB 4I2BA 2PEBA 4DX5A 3LP1B 3PIPL 2G2ZA 3VGKA 1JLEB 4C1NK 3W66A 1W9HA 3AVLA 1VQ7S 1VSMA 3ZSYA 2OTJN 4ZP7A 2ZJRQ 2OXOA 1OY9A 3ENWA