2WF9A

Structure of beta-phosphoglucomutase inhibited with glucose-6- phosphate, and beryllium trifluoride, crystal form 2
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
221
structure length
221
Chain Sequence
b'MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQKQK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-PHOSPHOGLUCOMUTASE
publication title Near Attack Conformers Dominate Beta-Phosphoglucomutase Complexes Where Geometry and Charge Distribution Reflect Those of Substrate.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
total genus 72
structure length 221
sequence length 221
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2009-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2wf9A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2wf9A01
3RF6A 5ALWA 5ALRA 1Z4KA 1J97A 4FYPA 1IWOA 4BNDA 5AM1A 3L8EA 3N1UA 3FVVA 4I9FA 5AM5A 3AR2A 5AW0A 2YJ4A 4XE5A 4UMEA 4CE6A 2YMQA 3KD3A 2YMLA 1Z4JA 4NAVA 4L57A 2BDEA 4EX7A 2IOFA 5AW7A 3PDWA 5T41A 5AVTA 3SLRA 3QU7A 2C4NA 3HLTA 3ZU6A 4BNDB 3QU9A 3OCYA 5AW3A 2Q5EA 2HX1A 5AI0A 4MWOA 1N8NA 4EENA 2P27A 3PGVA 1XVIA 2JAUA 5AVUA 4Y3UA 3MPOA 3QU2A 2C88A 1L6RA 3FM9A 5AI5A 3M1YA 3SF0A 4G9BA 4BX2A 1JUDA 2HOQA 4KN8A 4HGRA 2D2VA 5ALYA 3W5DA 5FP0A 5AESA 1XPJA 3L8GA 3WK9A 2HEGA 3AR4A 3L0BA 4ZEXA 2PKEA 3W5CA 3N5KA 4ZEVA 4J03A 4YIHA 4YGYA 5AM4A 2B1QA 4IG4A 4RESA 4UMDA 2MU1A 2B8EA 5ALLA 5AW8A 2IOFK 2X4DA 1RKVA 3QGMA 3DV9A 3TLMA 3QXGA 4Y2JA 1RMYA 2EAUA 1QQ5A 1L7PA 3ET4A 5ALQA 4F71A 2EARA 4Y2RA 5ALNA 3FGOA 3R4CA 5E0OA 4OFZA 2FPRA 5ALZA 3E8MA 4OD0A 3D6JA 5AK6A 5AM2A 3L5KA 2ZBGA 3ZW7A 1AQ6A 5AKLA 1VJRA 2ZBDA 4HAIA 3NALA 4BYGA 3B9BA 5AKYA 5A3QA 4OHFA 3GYGA 1RC8A 2I54A 2JGAA 1F5SA 5AKEA 3SKXA 4BEWA 3WK8A 1Y8AA 3IRUA 3KZXA 1RMQA 3MMZA 5AKXA 1RQLA 5AVQA 4G63A 4DW8A 3FPBA 4KX3A 1YS9A 5AK4A 1QH9A 1RRCA 2RAVA 3KDPA 2WF8A 4EX6A 2YJ6A 4BEVA 1WR8A 2GHQA 2WHEA 2G1AA 4XQ0A 1EK1A 1ZD4A 5ALSA 5ALUA 3SHQA 5AVWA 5JJBA 1VFPA 1U7PA 2RBKA 4C4TA 1ZOLA 3ZWDA 1PW5A 2Q4TA 1TE2A 2I7DA 3OPXA 5AW6A 2FUCA 5AI6A 1WVIA 3L8HA 2ODAA 2FEAA 1K1EA 3U7HB 2IA5A 3NASA 4CF4A 2YMMA 1ZRMA 3BA6A 5A3RA 4CF5A 1LTQA 2WFAA 3EF1A 4AS2A 2YBDA 3OCZA 2HI0A 2G09A 2FPWA 2B1RA 3E81A 1EK2A 1L8OA 4HGNA 4UU0A 3QU5A 1RDFA 3B9RA 3ZX4A 3UM9A 4YCMA 1ZRNA 2WM8A 3PCTA 2OBBA 4AS3A 2RB5A 2NO4A 3U7EB 1ZD2P 2YY6A 3ZWKA 2AMYA 4KNWA 4KYTA 5AW5A 3EF0A 1J8DA 3P96A 5AK3A 2OA0A 3QUQA 2W43A 4L6CA 3QUCA 5ALTA 5ALIA 1O03A 3IB6A 2G06A 1YV9A 2R8XA 2C8KA 2R8YA 3SD7A 3FZQA 3WKCA 3QNMA 2NO5A 2GFHA 3DAOA 3M9LA 2YJ5A 3ZVMA 4YH1A 2JAOA 4UAVA 4L6AA 1TJ4A 2HO4A 3NANA 1ZJJA 5AKKA 2I34A 4Y2PA 4Y2TA 3A1DA 2YJ3A 5AI9A 5AKHA 5AI4A 3NAMA 2YMPA 5ALKA 3UMGA 4Y2VA 3AR8A 4YIKA 4RETA 5ALGA 5AM3A 2YN4A 2CFTA 4BBJA 5AVXA 1TJ5A 1T5SA 2FI1A 2GHTA 2ZG6A 2W11A 3UMCA 1CR6A 1U2SA 1YMQA 3ONNA 1TA0A 1KYTA 2NYVA 4UASA 2R8EA 3WKDA 2JAWA 4FE3A 4BX3A 2AGVA 3ESQA 1ZS9A 4Y2SA 3ED5A 2B30A 5IS2A 3L1UA 2I55A 4UMVA 2EATA 2QLTA 4JB3A 3WK4A 1QYIA 2MSNA 3QYPA 4AP9A 3QLEA 3I76A 3F9RA 3ZI4A 5AW1A 5AVZA 1Z5UA 2WF7A 5AVYA 3U7GA 3A1CA 2PR7A 4NABA 2ZBFA 5AIAA 1X42A 2CFSA 1SU4A 5ALMA 5AVVA 3FPSA 3OCWA 3E58A 1Q92A 1RKUA 4YCLA 2P69A 3AR7A 3UMBA 1RLOA 1Z4MA 2BY4A 2HSZA 5AM0A 4MUMA 3KBBA 1Z5GA 1RQNA 4UARA 2AUTA 5AKGA 1YJ5A 4HGQA 3U19A 3A1EA 1VJ5A 1L7MA 4QQFA 3OCXA 2IYEA 1S2OA 5AKZA 4F72A 3L0YA 1NNLA 4CF3A 4HYTA 3QUBA 2FPXA 1RPZA 4Y2QA 5A3SA 2JARA 1SWVA 3HYCA 3N28A 3DNPA 3WK7A 2I6XA 1T5TA 2G80A 3AR3A 3ZX5A 1U7OA 1WPGA 5IT4A 2R8ZA 5AICA 4UU1A 4UM5A 1Z4OA 2HF7A 1L7OA 2QYHA 2WF9A 2OYCA 5ALPA 4UM7A 3WK6A 2HF2A 1Q91A 4H1WA 3SKYA 1RKQA 4EEKA 3RFUA 1CQZA 4J2TA 1L7NA 3KOOA 1NRWA 4UAUA 1FEZA 1RMTA 2BDUA 3MN1A 5AK5A 4DCCA 3BWVA 3ZTWA 2Q4RA 1T9ZA 2AH5A 4I9GA 4Y2XA 3E84A 1N9KA 4EELA 3ZTYA 4BKMA 2O9JA 1QQ6A 5AW2A 2ZXEA 3A3YA 4GXTA 4EZEA 3L8FA 2PQ0A 4Y2UA 4Y2YA 1XP5A 2HHLA 2C9MA 1Z4LA 1SWWA 3PGLA 2B0CA 5ALEA 3CNHA 3NIWA 3MC1A 5ALJA 3J7TA 5AKIA 5AW9A 2GO7A 3L7YA 1L8LA 3ZVNA 3OCUA 2B82A 2B8JA 1Z4IA 3SMVA 3ZVLA 1MH9A 2G08A 1YNSA 3N8GA 5ALFA 4C4RA 3S6JA 1TJ3A 4NFLA 2P9JA 1QQ7A 3U26A 2WF5A 5AKJA 3EPRA 2FPSA 5AHXA 2W4MA 5IT0A 3U13A 4UW9A 1RLTA 4DWOA 5AVRA 5AI8A 4JDPA 3R09A 5AW4A 3W5BA 4DFDA 1ZD5A 3L1VA 3VAYA 3DDHA 4NWIA 1LVHA 4KNVA 3CZ4A 3AR9A 4QJBA 4XPZA 1YDFA 2IOHA 5ALVA 1Z88A 2MU2A 3R9KA 4YCNA 1WZCA 2ZOSA 3AR5A 4HGOA 4E88A 2I33A 1Z4PX 1S8OA 5ALHA 2WF6A 3OTQA 3IJ5A 4B6JA 3NRJA 4BX0A 4PNHA 2C8LA 2G07A 5ALOA 3WK5A 4HGPA 3N07A 4IFTA 2HDOA 3WGUA 3WKBA 3KC2A 2FUEA 5ALDA 2ZBEA 1U02A 3NUQA 4XOUA 2FPUA 3K1ZA 3I1YA 3L0CA 3WGVA 3AR6A 3W5AA 1RLMA 3U7FB 3OCVA 4FFDA 2GMWA 5ALXA 3QU4A 1Z4NA 1ZD3A 4OCZA 3WKAA 4GIBA 2YFYA 3EWIA 2G0AA 2CN1A 4UATA 3I6BA 4KX5A 2OM6A 1O08A 1Z4QA 2HCFA 4UMFA 3I28A 2CFRA 3ZUPA 2VKQA 2DQSA 4O8CA 4C4SA 1U2TA 3ET5A 4CNQA 2RARA 5AIBA 2O2XA 1NF2A 2P11A 3QUTA 3ESRA 3WKEA 4NV0A 3B8EA 2FDRA 5AVSA 4ZEWA 3QX7A
chains in the Genus database with same CATH superfamily
2FW9A 1DPGA 5IU6A 3R75A 1SG9A 5T67A 1M6YA 4Z0PA 3SR0A 1N1EA 4X66B 2O2HA 3NFRA 1MQ9A 2WVAA 2FLNA 1AV7A 4RL4A 3MWLA 3B7PA 2FSHA 2XA1A 3W0LB 3FY4A 4KGXA 4EGJA 4Y30A 3MPOA 3I34X 1Z5NA 2X1HA 4FHEA 4FCWA 3OLCX 5ICGA 1ZOPA 3PIDA 3S0JA 2P4UA 2YH2A 2VTBB 1W5FA 4Q21A 2ZJOA 5K2OA 2IS2A 2C3UA 1TKDA 4F06A 1E2QA 1ZQWA 3CSUA 2OOKA 3ZNOA 1YRWA 1C4KA 3PA8A 3QEJA 1WEKA 3B6EA 4QJIA 5JAQA 1OYWA 4GXNA 5L1MA 3K9WA 1VCHA 1N6LA 3KLBA 4IQVA 3ZGOA 2EWWA 3DPUA 3UF0A 2N3ZA 1XZ8A 2IE8A 2I78A 4FHGA 4FEYA 2O06A 3L41A 5COBA 4UQGA 1ESCA 4RIHA 5JXJA 1AXRA 2IQ5A 3DLCA 3TB6A 3L8HA 4L4RA 2FKNA 4YCXA 1GXSB 4OY3A 1CUZA 2AJBA 2FOIA 2PK3A 4QUAA 3KOZA 1PEKE 4K86A 1TVEA 1PDOA 5FFFA 2CYCA 1UKVY 2PZAA 4KWEA 5JANA 4G1EB 5KT6A 4KFUA 4F8JA 4WXEA 2K4IA 1UKYA 5AHKA 2WDZA 1KL7A 1IAVA 1ZKMA 4RHXA 3B3QA 4IV0A 2I7XA 2VR1A 3Q88A 3D8TA 4C7BA 5FLEX 1QG0A 3PDCA 4GM4A 2P2YA 2IYLD 3ZY6A 4M21A 1YSCA 5K0LA 5L40A 4N5HX 3RUAA 4BRZA 3RTDA 4CODB 3CNEA 4F5RA 3H9UA 1K4YA 3KOMA 4HWTA 4DARA 3GOQA 4R2HA 1A8QA 2DUMA 4D80A 1RHMA 1X7HA 4HT3B 4GC5A 3IVGA 1J2UA 3KR9A 1TO6A 2B99A 4NU6A 3P52A 3HKBA 4URXR 3IQWA 4L6IA 3C21A 5KDLA 5F4ZA 3RUCA 1M3SA 3RKSA 4G07A 3H2GA 4ZPJA 4UU8A 8ICXA 4EOGA 2XUFA 2QTBA 2J07A 4ZRMA 2HCTA 3DP7A 3GLUA 2ETVA 4NRDA 1QF6A 1PRYA 4K3UA 3N2GA 4P83A 3GCDA 4JI7B 5JAOA 3DQZA 1PFQA 1GHTA 1P1JA 3GFTA 4XEHA 2GPTA 3A32A 2GKSA 2J5KA 2R60A 3CLSD 1F6DA 3HJTA 1C81A 2VXYA 4N65A 1G8AA 1P2BA 1HI9A 3AV3A 4B44A 4EUFA 3X2SA 4IV5A 3T99A 1SWWA 1F48A 5A0TA 3UANA 4C76A 1C7RA 3K0FA 4YR2A 1MZVA 4ZOHC 4MVJI 3FFWA 5K05A 2P77A 5TX7A 4EYHB 3A6ZA 5AP9A 1Y1QA 1PEYA 2N1RA 2VBIA 1R12A 2QL6A 1JXLA 3WFIA 4GWGA 2W0MA 1HZZC 3DE1X 1DUSA 1XNRB 3QEBZ 5CB4F 2XY7A 1Y8QA 3PSPA 4U2GA 4DQSA 3PX6A 4ABYA 4PRZA 1QV9A 2V6GA 3P2OA 1ZIDA 3B0YA 1JHZA 1IAQA 4FYKA 1BEZA 1FMLA 2A6PA 5B3LA 4MVJP 3TPFA 2C2GA 1FFAA 1NN5A 4RV4A 2AZ4A 1F12A 1M2OA 2CSXA 3TRHA 3WLFA 1FFYA 3CUSA 8ICYA 2PFQA 2D0OB 4HYQA 4OB7A 5G41A 1KI8A 5JS6A 4PSVA 2J0UA 3T38A 2FG7C 3TTVA 4U7CA 3WO1A 4EVSA 4LJSA 1QCYA 2R6JA 2Z2KA 5KJFA 1Q7RA 3DAPA 1UFVA 2HMTA 4YLEA 3QX3A 3FA2A 1QBKC 4BB0A 1KI2A 4KK4A 5AW3A 3PCRB 1MAUA 2D5IA 4HZUB 4KN7A 1LJUA 3K9QO 3HZZA 1L1EA 3RE1A 4BX2A 4G4SP 3Q1KA 2J08A 3EW9A 2XTMA 2EWMA 4FO6A 1UBGA 3G5UA 4R64A 3FXAA 1NJFA 1DBQA 4E32A 5JC1A 1OX4B 3SU8A 4EPVA 2HZBA 2ZXHA 1W88A 1QVVA 2PX6A 5HF9A 2E3JA 2B8NA 2Q07A 4QHYA 2J9ZB 3MRTA 1U6IA 3M82A 1BRMA 5AJZA 4OATA 3W2IA 5ESXA 1V2HE 2I54A 3L7NA 3NJ4A 2B9VA 2WSLA 2DF4B 5IVPA 3MMZA 2R8JA 2VP9A 3JARA 4FLEA 3VUFA 3LT2A 5BQXA 4U8GA 5KFUA 4LQ4A 1W0KA 3SBDA 2F1IA 3HKBB 3HZRA 1VSUA 3OPXA 2Q7XA 3LTNC 4FCTA 5IJXA 2AC4A 4EO9A 3HT3A 3SQMA 4ZVQA 3WWEA 1VYUA 4PRKA 2X22A 3M1LA 1DELA 3IKMB 1KSPA 4RV9A 3L07A 3N2GB 1PJ8A 5K6RA 4LKRA 4F56A 1EAYA 5KWJA 2NM0A 2D1RA 4KLIA 1RZ3A 4Q1VA 4MXDA 4M0AA 1DJOA 4AO8A 1L9KA 3ACDA 5EVJA 5IJWA 5DB7A 3V6HA 3F46A 5F1OA 2RK3A 3AHDA 2QZ4A 1FDSA 4WOPA 4TV9F 3TTYA 2R8EA 1AE1A 1UPTA 1XMQB 2CNKA 1NW8A 4IOLA 4RO0A 1KDTA 2I6UA 4L85A 4R5MA 1M2VA 1PT6A 3VSAA 2CKMA 4G5HA 3F5QA 2HD4A 5LZ8A 1IEVA 4D9HA 3DSRA 3DTNA 4W9MC 1GRCA 1E9RA 1QRRA 4GWKA 3SJZA 3CX4A 4ED0A 4BUJA 1Y8QB 3STUA 2RB4A 2ZI7A 5TPZD 2AUTA 3WZLA 3C41J 1WY5A 2QI9F 3PQ2A 3L4BC 2IHZA 3F7OA 1D0IA 3ETNA 5I7AA 1HDCA 1Z7EA 4K28A 1I33A 1M2OB 4Q7EA 2B61A 1DFGA 2CXHA 1XZBA 3X1KA 2Z43A 4CI9A 3SKYA 3RFUA 4BOYA 4J2TA 4QAQA 1NRWA 5KL1B 1ZQKA 2VPWA 2AA3A 2HZ7A 1E69A 1G4AE 5CNIA 4QNRA 1E2JA 4PC6A 1Y3BE 1IXYA 1SKRA 2WYHA 4A0QA 8GPBA 3OCUA 1PJQA 5FIUA 5IH3A 4DLVA 2GCPA 4GGOA 2MTBA 3EJWA 4H7EA 4EG1A 1QGZA 1Q16A 3W5BA 1N5XA 4FB5A 3W9UA 1KS2A 5KFWA 2E85A 1SUCA 3AJ8A 3UMJA 3IP9A 5L95A 5K20A 4O4IF 2QX9A 4Q44A 4CQLA 4IGKA 2HJGA 4J9LA 3MFYA 3UXNA 2YXBA 3LX8A 3N07A 2R66A 2WJJA 4EJSA 2YJZA 3KB2A 4W6ZA 1A7JA 3WGVA 1Q44A 1W88B 3W5AA 1FZQA 1JB9A 4MAMA 4OHYA 4KGVA 4DLYA 2HQBA 5KX5A 3KJIA 3U0VA 2HHHB 4U7DA 4YB8A 2OM6A 5DN6D 4O3QA 2QV0A 4OK3A 2HCFA 3TEFA 4V0LA 1Z0SA 2GWSA 3M0EA 3HCWA 3OEHA 3ERCA 3GCWA 3KM0A 3JARB 9ICVA 3AKEA 4EG3A 3HVHA 2MSLA 1GGEA 1BGWA 4R1TA 3ZCQA 3BRQA 4UMEA 5IZCA 5DNCA 4FSDA 1J90A 2CEKA 4LYDA 3N39C 1WOMA 1YI1A 2A0UA 1BDBA 2V6BA 3WXBA 1DXOA 4AWAA 1LJLA 2GGSA 8ICEA 5DB9A 2ADMA 4V0KA 3O47A 1PQ4A 3G0IA 3M2PA 3R9WA 3M5DA 2FWNA 1ONPA 5J2JA 1AS0A 4L3WA 1P45A 3AUTA 2HW3A 5A62A 1COWA 5CB0A 3OCCA 1F2TA 1MTOA 5L3QB 1HZZA 1R37A 3IMFA 3KU4A 3AHIA 5LB4A 1UUFA 3TH5A 2B3DA 1ZU5A 4WFQA 3JU3A 1EVIA 3NAQA 3SICE 4QZ8A 4DA7A 4ED3A 4UTPA 3BWXA 1GT6A 1MLDA 3OPYI 1RNLA 4JJ4A 4N6OA 1WSBA 1M2VB 5ARBA 4RCYA 2EX0A 4OP3A 2JL1A 2V03A 4RFSB 2G70A 3F78A 1GAEO 2WJWA 3G2PA 2YQ4A 5AXBA 3FUXA 4G5YA 1JBQA 2A5LA 4KVZA 2H29A 4X5VA 1CUCA 1A04A 3WMXA 5KFOA 1O6FA 3N53A 3CX7A 2H07A 4QTTB 4MR8A 4ZXFA 1SUFA 3C5VA 1P5FA 5IC5A 1NI5A 3RAGA 5JVDB 3JQ9C 2DPHA 1NG1A 3I9NA 1ZA1A 3QOYA 4F21A 2PGJA 4DLPA 1RM6C 1OLOA 3K4QA 3VMMA 5JNSA 5C7LO 4JJKA 4E3ZA 5LA6A 1E6MA 4KRGA 3VPCA 4JC0A 3ZWOA 4RVUA 3P0HA 4UB4A 4BGIA 3WL7A 4J0QA 3RBZA 1AS3A 1X2EA 3RVPA 4TWRA 1XZLA 3A6GA 2VVTA 4G1CA 1H3FA 4ZHSA 3HP7A 1M2EA 2GZHA 2CE7A 2I4TA 4MV4A 3SEIA 4CQMD 1AOXA 2P4HX 2HLDA 5FTLA 4JMUA 1WCV1 4K9DA 2PX3A 1Z5VA 3GQCA 4NXZA 5LL6P 4NABA 2PR7A 3TR6A 3O0FA 1ZMBA 2GT1A 1HUZA 5T4FA 2EWVA 4ALKA 4CLRA 1VL6A 4B6GA 2Q6KA 1X74A 1YCDA 1XVLA 4TV8F 3EBPA 4CQLB 1U8YA 2XQVA 1F6BA 4TTTS 3VU0A 4GI1A 1CYEA 2CYBA 4EJSB 2V9CA 1KRHA 3GN2A 2FPKA 1AKYA 5BR1A 5KX5B 4B34A 3WXMA 1PL6A 2FMTA 2NPIA 2QYHA 4N5LA 4V2IA 4MRSA 1GPWB 3AVYA 2O0JA 1UCVA 1KPHA 1BDHA 4H15A 4IDOA 4INPA 4DM7A 3C7CB 2PMWB 1RYUA 3NGDA 3TDKA 4I2EA 3ADCA 1Y9JA 1XA3A 1HT3A 4DB2A 2O0KA 4J0JA 2OYYA 1DRVA 1GPBA 2IS4A 3SX4A 3QPCA 1L3SA 1JR3A 3I0ZA 3A11A 5B7GA 3HGQA 3PPIA 3B6MA 2YWHA 3VVBA 4RF2A 1S9FA 2E1EA 2GRAA 4LF4B 5DE3A 2R96A 4Q1DA 3KUXA 3L43A 2XYGA 1ZQEA 3E2IA 3JPQA 1M6EX 1P9NA 1VYHA 4B6JA 1VSBA 4HGPA 4UJ3A 3IR7A 1AMOA 2I1QA 3FYDA 1SR8A 5LBTA 4C8NA 1GP2A 1QRDA 3K1ZA 1FSSA 1F2TB 2J31A 2XYPA 5JOQA 2GBLC 1G7CA 1Z4NA 2H3ZA 3CR8A 1VKNA 3R7WB 1AGXA 2R6R1 4GRAA 4PHDA 4MS4A 5DNEA 1K9VF 1RYFA 2VP3A 3E9RA 2F8LA 4A82A 1J9EA 4F3YA 3ENQA 3RS0A 1WLYA 3CO0S 5HKKD 4RY2A 4NMWA 3W5JA 3JSAA 4ACOA 1E18A 4YAGA 1PTJC 2VCEA 3RTGA 3SYKA 4F2GA 3N0VA 3WG9A 5FWXB 4F2PA 9ICUA 3T35A 2PU5A 3PFWO 1YJAA 1FMJA 1Z26A 4EENA 2VCHA 3ZY2A 5TXGA 4X92A 2JZOA 1JIJA 5H3CA 4MR8B 3WWCA 4N48A 4KXUA 3VR0A 1Z2DA 2I5PO 2Z8ZA 2FXVA 1K3FA 2QP4A 4CHTA 2BMDA 3P0RA 4K03A 1Q3TA 5AWFC 1RMYA 4PYJA 4AI6A 3GGJA 1CR0A 4HH1A 3BTSA 4DS3A 2GCEA 5LA6B 5HKBA 1A96A 3NOOA 2WWRA 5LQNA 1GGVA 4O4LF 4NZNA 3CNLA 4JC4A 3PXXA 3KHSA 4TPKA 2N46A 4D3FA 3TLZA 3LUGA 4G36A 3FPBA 3G5TA 1I80A 5G0TA 3RS8A 3SYZA 1WDTA 3REOA 2F59A 1T9HA 5I7VA 3BBPA 5D1HA 1SHLA 4K6FA 3H1BA 1JB1A 1N9ZA 2YXEA 1T0BA 1KXJA 3K0HA 4EIWA 4ZAYA 3BD7A 4CLRB 3K70B 3U09A 2O1SA 4DIEA 2UV8A 4MIOA 1EXVA 3MS2A 2RB5A 2PO5A 1IMJA 4UBMA 4FEEA 4LDZA 1JQ5A 3ZIAD 2G06A 1CRLA 3ZYZA 2HDNB 3FYTA 5JS1A 4ZEMA 2DKFA 1QH1A 1FA9A 2AUNA 5CXUA 1PCXA 2GTIA 3USES 3TOVA 5A7GA 3S55A 2R65A 3NS7A 5IX8A 2YWEA 1KYTA 4N8EA 3M6WA 4W5JA 3N8IA 5CR9A 2D1YA 1C50A 4ARSA 1JP7A 1D1QA 2ZTVA 3QYPA 3F4LA 1VECA 3CPEA 4UHCA 4ZGGA 2GAIA 2QX8A 3UXYA 4Q3LA 2ZTCA 1ISGA 4I0WB 2AXNA 1GNPA 2JK0A 4TWZA 3A9UA 3GIWA 1P1CA 1DC5A 2HSZA 1A9RA 3E0XA 3TOZA 4PX5A 1JTFA 4IPTA 3HKZF 1Y4UA 4LXTA 2R4QA 2Q49A 1KFSA 1ZD8A 1VGVA 4MVJE 5IMSA 1WPGA 4F11A 1CFJA 4DMKA 2VF2A 1U90A 3SBOA 3LSTA 4N40A 2JGJA 2H1OA 1VP9A 1Z5PA 3GCZA 1VRCA 4JCCA 1JFVA 4MS4B 4D6XA 2BKEA 4M6WA 4C7KA 5J47A 4MKXA 4AD8A 3T94A 3KCQA 3X1YA 5JY6A 3FHLA 2Y92A 1A69A 1DUVG 1C14A 3OMLA 3RFFA 4UFNA 4MSUA 1ZXBA 4RHUA 1XD2A 4RHTA 1CJBA 2MYUA 1B8UA 1C1XA 4W4TA 3SPXA 5BYBA 2W4MA 1U0TA 1AQNA 2PVCA 3PJFA 1RYNA 5T14A 2OFXA 1RHRA 4DDKA 4FHDA 1Z0UA 5HVNA 3SYMA 5FI0B 3T8YA 1HEYA 1JLSA 4U7HA 4EHJA 1T4CA 1QTIA 1YC5A 3HB4X 2QPTA 1C9JA 3PVXA 2D5AA 2PI4A 2K7ZA 5CJ7A 4AICA 3P1JA 3PUJA 1ZVVA 5HJ7A 1PKEA 4NYMQ 3R5JA 4MQ5A 2DWOA 1EQUA 3K6JA 4M47A 1Q6ZA 4XH9B 3ZJVA 1DEHA 3TL3A 1UA0A 1SOWA 1OB5A 1XRQA 4UHDA 1GN8A 5T64A 4OSEA 3TQCA 1SQ5A 4KE9A 4A26A 1OPXA 2E89A 4S1NA 5TQJA 5GVRA 1X1CA 5DNAA 2RKBA 1NUSA 1F3LA 3P0EA 1FX0A 1X6JA 1QG6A 3SVTA 1F8YA 1ZLYA 2X2PA 1YVEI 5BN1A 4J7AA 1SZPA 6REQA 1DIOB 2D3DA 1QWOA 2HJSA 1OH6A 3JAKA 1OX5A 5AVTA 4WY2A 4Q3OA 2VDOB 4RLHA 4JKYA 2Y1XA 2R8IA 1IPEA 5B12A 4Q9HA 5IC4A 4U7PB 5ER9A 2HHVA 2C5EA 4KNYA 4XYMA 4HGRA 2X3UA 1XZGA 1RIFA 4FDLA 3LVBA 4NOMA 3FGPA 3VR3D 1F7VA 4WDQA 1QH1B 2Z7JA 2Q4BA 4YI5A 1G5PA 1JHVA 1HQDA 3V6KA 3D0QA 3VAAA 3GA5A 2VT3A 1VXOA 3DR5A 4F4JA 5HRUA 3KVNA 1PUIA 4OD0A 2XMPA 1QHFA 2P6RA 2RGNC 5JASA 4LHYA 2IRWA 3PYXA 3WBKA 1UJ2A 2F00A 4MPTA 2J3KA 1JTVA 1IY1A 2FP4A 1O8CA 4R05A 4J3JA 2ILVA 2NVWA 2J41A 4FW9A 3FSJX 3QYFA 4UPVA 1UH5A 4CTKA 2PV7A 4EX6A 5ALSA 3S29A 3R9IA 2IW1A 4PQRA 2J0VA 4W7HA 3QZUA 1LB1B 1ZJMA 2VTKA 3IFSA 3FJ1A 3QU5A 2O8FA 2HQ1A 4B6FA 2WM8A 5ESWA 1PTJA 1OILA 4EG4A 3FOFC 4ZQHA 3GFSA 3AI7A 2BF4A 4ARBA 1EUYA 2J0QA 4E07A 4FGSA 4C7JA 1DDGA 3HJGA 1BTOA 2IODA 1S9HA 3W06A 4M6WB 1HQKA 5KNDA 4IUDS 2COEA 2PI5A 2G72A 1DBSA 1IN4A 3H18A 3CEHA 4M8SA 1AUXA 1N6OA 3BH0A 1QO7A 1XD2B 3ED5A 5E9QA 3ZS8A 4NK4A 1C1XB 2HSGA 2QLTA 1EG7A 5CPFA 1K1QA 5DBHX 4CETA 5JSFA 1ZM4A 2GEKA 4X63A 3AF3A 1N36B 3KTQA 4P4GA 4OREX 3A6HA 3K0KA 1RAAA 3VR6H 2OEHA 4I1IA 1BVRA 4RJTA 3G5LA 2DSTA 4EZ6A 4DL9A 3WRXC 3EXAA 3KJZA 3I01M 1TVAA 3UMBA 1T4CB 4RQ7A 2GLTA 4F45A 1V8PA 1EDOA 5H9VA 4F72A 5JMTA 3LA6A 1S1CA 4C6SA 3DKKA 3ZHOA 4L0QA 1OLXA 4WHMA 2G80A 1H8ED 2QB1A 4FSXA 3E6AA 3GJ8A 4YTEA 1BMDA 2FU5C 1L7NA 2P66A 4YCAA 4I1UA 4DNQA 4X84A 2VQ6A 2H4XA 3OJLA 1ARZA 2V0NA 3ELDA 4X1IA 4GP7A 4IY1A 1MOZA 4BQPA 2HHLA 3IJEB 4OYRA 4AMBA 2W6OA 5FXMA 2A0FA 1YO6A 4YK7A 6REQB 1G64A 1LDMA 2IHJA 1E4VA 1W48A 3JAKB 3NC4A 2F1RA 2MINA 4LOAA 4LMAA 2QZSA 4QHTA 4BN4A 3NYRA 2D6FA 4QOIA 2FZGA 4U7WA 4PG6A 1HO3A 2VPZA 2GI4A 8ICMA 1RHUA 5GZ3A 4JIGA 3KPWA 4YFVA 1QWSA 4TYMA 4DL2A 9ICRA 4JP2A 2VA9A 5BW4A 1CUSA 3RUPA 4DLGA 4BKPA 4EEYA 2PZMA 1MHTA 1DIGA 4UBNA 4QOSA 2PKRA 3LX6A 5J43A 1UXKA 2ACVA 2MYNA 2GZAA 2PIDA 2XV1A 4I2FA 4URYR 2B1JA 2GK6A 4L4UA 1BSVA 3I01A 4GEKA 2I4LA 1CZRA 2DQSA 2CF5A 3K20A 1GQSA 1PGPA 5IDXA 3RW9A 3FYUC 2PUJA 5LQCA 5AM5A 3HI6A 1TM4E 3RIGA 3KQYA 4ASUD 2EKDA 4WK0B 5ABPA 4X95A 3UUEA 4WZBA 4OJNA 2OCEA 2PLAA 4RQTA 5EPEA 4KN5A 1VJTA 3MGVA 2QYSA 3RRFA 2O8FB 2RGEA 1CYDA 2AMLA 3CV3A 1XI2A 3VTKA 2HT1A 1AGNA 4IEEA 4IJKA 1QFYA 3UMFA 4DQDA 2QQ0A 2TYSB 4QQKA 4IC9A 3C6QA 4ZQGA 1DB3A 2CXUA 4XIYA 1H2EA 2WJYA 1L3CA 4Q3DA 3NBYC 1Q1NA 3ZY4A 3UMMA 1PVRA 1GKYA 2Q9CA 2IYWA 2WM3A 2RHWA 3AUYA 3HYSA 5BSGA 3S2IA 1A8HA 3EUAA 2FPGA 2GQ0A 4EUHA 2EAUA 2DWCA 1EVEA 3IIIA 3DMGA 3UWMA 2RGXA 5K0NA 4UUPA 4ZEOA 3EMBA 3RSGA 4XA5A 3SR6A 4GPBA 1JLHA 4Q4DA 2CY0A 1EE1A 1XP8A 4OHFA 5LKRA 4Z4CA 1GUBA 3T54A 1VCNA 4IMPA 4PLPA 1KU0A 4IIHA 4AUNA 2GCIA 4Q19A 1E3MA 1YZGA 3HYRA 5DCUA 4ENTA 4G0VA 3IIEA 1LFDB 4UHFA 1YS4A 2O3RA 3K6KA 5KWVA 4F9TA 1FBTA 3H0RB 1BX3A 1UQUA 4HGNA 3U16A 1O1YA 3L84A 1HPLA 1EFVA 1L5QA 2O7QA 4II3A 2ISCA 4YAFA 4YAOA 3DE6X 1NOJA 2Z4TA 3F67A 4P8RA 4D3XA 5FLKA 3M4XA 3EIUA 1TKCA 5JV5A 2RE8A 3GFRA 2V7EA 1PYDA 4C0XA 1KJ8A 4BVBA 3MELA 4X1IB 4A16A 1GWNA 3PEUA 1ODJA 2NXEA 1ZQVA 1HYBA 4NBTA 2PBFA 3BD6A 4V0ME 4C9BA 3PU6A 3FN4A 5FBKA 3VR2D 1DWQA 3FRHA 4GP9A 3MGCA 3DHWC 3B1JA 2NTJA 1I2DA 5JCZA 2MINB 3AB3A 3RS3A 1TXGA 4B1FA 4E2XA 3P9QA 4ED2A 4ZAWA 1RI2A 5JSKA 2FR1A 4QTUB 3N74A 2YQZA 5AHWA 4I4NA 2K2QB 3FIJA 1U3GA 2EKQA 4FI3C 1E6UA 4EEXA 3HJFA 1T1GA 3G8CA 4YRJA 4PY2A 1XQ1A 3TLCA 3F6EX 3FOEC 3THYA 3FPLA 5H16A 2VPYA 2GD6A 1Q11A 5LQSA 2POQX 2E2WA 3MGAA 2CUNA 4B0OA 4M99A 1Q19A 5JNWA 3H0MB 3PSFA 1AHHA 3NHBA 1PO7A 1RM4A 4NLZA 5CXSA 4LTDA 2V6FA 3DOHA 621PA 2A14A 1CQZA 4ZRNA 5IBQA 3R3ZA 3JAWB 2PBRA 3A25A 3ZK8A 4HYEA 1RWQA 1C9DB 2EBFX 1QHEA 3PEWA 1TEXA 4PAWA 4YRFA 2P4EA 4YMLA 4JBLA 3SDBA 3EXEA 2XEDA 4HDOB 1Z4IA 2D74A 5L4SA 1I24A 1IHPA 1U6KA 3ZS9A 4B3MB 5I6DA 4WZBB 2BKLA 3MT9A 4ZC1A 1YR9A 4DGSA 2QX7A 2CUTA 4RD4A 3PR2B 1FQJA 2IOHA 4WZAE 3NQ41 2WG0A 5IYZB 2JXJA 2QZJA 1IWPB 3WGNA 2C2DA 3L0ZA 3DW1X 5JCPA 4X3PA 4IX9A 1HDXA 1X7XA 2OORA 1JAXA 3S70A 5DHQA 2XZPA 3WRXA 1IHOA 5BUZA 4YRTA 1XF9A 1LI7A 1QIIA 1EUQA 1GQRA 4RTPA 3FHCB 4IMIB 4LWQA 4NCJA 5KTNA 3AIOA 2OCYC 1JJFA 2RGBA 2DR2A 4ZKDA 4US0R 2IKQA 3JQPA 9ICIA 1QTRA 5J2IA 3NAGA 3FX2A 1ZRSA 4GLFA 3E7PA 4EA7A 1EWYA 2BPCA 3GEPA 4XGKA 2QVBA 4MVXA 3DCIA 2J6SA 1TM3E 1YH3A 2FMIA 1BJRE 1P81A 1F8FA 3VVLA 3PX0A 4TL8A 3L7MA 1X92A 4AROA 4WLEA 4D0LB 2VTBA 4Z6KA 4FYYA 4F93B 2QR3A 2EEPA 1V3TA 3U4AA 3QMMA 1JLKA 4BO9A 1WSWA 1F8UA 1CPYA 3BREA 2AK3A 4OQEA 2PSSA 3VI4B 1JHYA 2ZRMA 2WG2A 1RAGA 3HVKA 2PYDA 4IIJF 3WICA 3PB3A 3T9DA 5KT7A 2FSVC 3LXXA 3GMSA 3UGKA 3HRKA 1SELA 1GDHA 1JQDA 2CDAA 2XOKD 1ZZGA 4F8RA 1XN1A 1C0IA 2F3PA 3AIKA 5CTAA 1PJLA 3UQ0A 4PZUA 2DVMA 2OXCA 4DJ5X 3K05A 5IHPA 1L4FA 1GXSA 1L5WA 3PNBA 3C3DA 1FQWA 2IU0A 4R40A 2PD4A 4TQSA 1YZVA 2VBGA 4MUXA 2A0XA 1G66A 2PRKA 4S12A 1P80A 5AI6A 4A1OA 3ORSA 1YTLA 2JBAA 3THYB 2G09A 3BX1A 3S27A 2PCLA 2O3TA 3RS2A 2WILA 1C0PA 2CD9A 2V96A 4MPDA 2OBBA 4TT8A 3L49A 3FYUA 3GELA 3BILA 4NV3A 3QW4B 1GZVA 1YZHA 3QUQA 1PW7A 2ZS8A 1SVOA 1MSWD 4X93A 1OQAA 3BQNB 2R8XA 2R8YA 3OJEA 3ICWA 2DPGA 1I1HA 2EFYA 1SG6A 4WH0A 3TL2A 4MUAA 3FOWA 2FN8A 4FCVA 3O1HB 6AT1A 4JI4B 4NS1A 3STHA 1B8PA 1LU9A 4Q93A 1ORTA 2GEBA 1YJXA 1S6YA 4JBNA 1YMQA 3T0FA 3W7VA 1KYYA 4QQRA 1ENYA 2FEKA 4JBWA 1U7UA 2I55A 3SX2A 5P8WA 3EUB2 1A50B 4MS1A 1XZAA 3R8XA 2V9ZA 3VC3A 5ED4A 3D7MA 4EVQA 3B8HA 5JCOC 1E1MA 2MMCA 4KOAA 1EHYA 1HNWB 1TAGA 1Z36A 5G3ZA 4CMCA 1G9TA 3RRJA 4HGQA 4CTJA 4CMEC 3IERA 1X7XB 2JHCA 3R6TA 2QIPA 1Z4OA 2NUBA 4Y2HA 4DFPA 2AQ8A 2OQIA 4YN4A 3MWEB 1DK2A 1PVQA 1R66A 1GU1A 2NMVA 5C51B 3GEGA 4DCCA 1XRPA 5IWAB 2O6HA 1XKLA 4IR1A 4MZDA 3NI2A 3EY9A 3RVLA 1VE7A 2C5HA 1ZQNA 4UAJA 3HL0A 1WPRA 4D9MA 3B6KA 1O6CA 1HL7A 1L4YA 5FO0A 2WF5A 2GRJA 5G1OA 2Q7DA 4BFSA 1HKUA 2P3QA 1ADJA 2XDWA 2R48A 1YR3A 4Q02A 2LP4Y 4P7BA 4QWAA 3CVWA 3RC9A 2ZIUA 1Z33A 4DBZA 3G2LA 2YHSA 1BE6A 2QAJA 5JS7A 3I1YA 4X6LA 3R3JA 2CLMB 2VP5A 4JR1A 2XNJA 1W6UA 1Z00A 2QTRA 4OI4A 1V9CA 3DYIA 1P3Y1 3IHTA 5KTYA 3N2IA 1H9CA 4GOJA 3G0HA 3BFKA 4HGZA 1Z19A 2NZXA 1X1RA 2LD4A 5JD3A 2VQDA 3HQ4O 2CXOA 2BGKA 2PGLA 1KMMA 3OLXA 5ALRA 4LQCA 3UYKA 3ZDAA 3H8WA 4HZUA 1NC3A 1CUEA 3ND7A 4KKVA 4HO1X 1OXSC 2JBAB 1UR5A 3WLMA 3IV9A 5FI5A 2WB4A 1MA3A 1F38A 3WB2A 3SEAA 5KKNB 3L8MA 2ATXA 2IPMA 3TBKA 4GVLA 1OX4A 3FYUB 2C88A 2BGRA 8ICLA 4TL7A 4GOKA 4MKHA 3TE7A 1JEOA 3G2QA 4LOLA 1XCBA 4NYMR 3TKLA 4C5AA 4F7DA 4MYSA 1G59A 3VC7A 3HXTA 2RH4A 2QXUA 2F8SA 3PT5A 2P4SA 3A4IA 4INAA 1GYRA 1DFIA 1E4EA 2WJVA 3ZGNA 2VC2B 3PLNA 2WAMA 5TIIA 1DJQA 1SVLA 2HSJA 2AOUA 4MS1B 2XDAA 4QPDA 3MJEA 4GZMA 5GGYA 4L95C 1MUUA 5LMZA 3D6TB 3CNQS 5C32A 3U3ZA 1X9GA 4O2LA 1ZISA 2BMFA 2JPDA 5FL7D 3AXSA 2LKDA 4DUGD 4MYRA 1BD3A 1ZRNA 1K3UB 1Y33E 1KVRA 1HDOA 4HLUC 5DDIP 4NOJA 1XEWY 5TEWA 2XF2A 1HEIA 3IIJA 3IKJA 2CCGA 4H4CA 1GGKA 4UUMA 2JGKA 2VHYA 5J0UA 4CIVA 1T5BA 2GRUA 2WTXA 3M4YA 5TGTA 2J5XA 2GD0A 1RPTA 2CGEA 4I99A 3CUVA 5HZGA 2INGX 4YYZA 1XRSB 3K72B 5F78A 3E2MA 4HBGA 1U48A 4LPKA 3E5HA 4K40A 3IT3A 2VYCA 2WIJA 3D43A 3E3AA 5G4LA 4BX3A 1ZK3A 1N7GA 4IOJA 3WVNA 5EL0A 1RACA 2FSVA 1VG1A 1DX9A 3O7WA 4AT1A 3X43A 4AP9A 4OKSA 3NHRA 3CQ9A 2I7VA 3KYIB 4EKDA 1XDSA 2C5AA 2F76X 3ZDYB 5ES3A 3PHBE 4P93A 3EB9A 4M98A 2VNAA 4Q4JA 3AFNA 2C0PA 2ZIUB 2J9FA 3H11A 4DV3B 4WZZA 2XT6A 1DKNA 2WP0A 3ESYA 3HH8A 421PA 2A0YA 5I9BA 1FUIA 5IEBA 4C8KA 3PNPA 1Z6XA 4YUVA 3S1AA 2WPDA 3OM8A 4N9QA 5CBKA 1Y4DE 5HM6A 2OB2A 3RYFB 1Q95A 3CVJA 1Z00B 2WFLA 2R3SA 3WLRA 1OC2A 4V0NA 2YS7A 1AMUA 2GCOB 4JVMA 5JYCA 4GQIA 5FOXA 3Q8PB 5J2TF 3CRRA 3HJCA 4PV7A 3IELA 4WXHA 4ESHA 3TMKA 1TK5A 4Q82A 3RPEA 1PT8A 4EUKA 5LDHA 2FX2A 1NW5A 3C87A 4A8EA 4WKBA 2IXEA 3MZ0A 1NNEA 4EG5A 3JYNA 4P9NA 3IT1A 3HDGA 1XRLA 4GKVA 2AMFA 3ULKA 4ETWA 3CZCA 2YTZA 1CF2O 3HILA 4ZJYA 4IFTA 4U7FA 1QIDA 1Y4AE 1G6KA 3NJRA 1Z68A 2FWMX 1JLLA 1QNFA 2FPMA 2P65A 3U49A 2DY1A 4R83A 1N7IA 3STXA 3CCFA 5E1MA 4C0QC 3I2FA 2F3UA 5IBPA 3P2EA 2UVDA 4P7JA 4B46A 3LQQA 1F4LA 1E3LA 3Q9UA 1JU4A 1VPTA 2TRSB 3NZEA 1ORVA 3Q8RB 4AKEA 1E4EB 1E79D 4JIMA 3KQLA 3MMXA 3G2OA 3F6CA 4M8LA 2AOUB 2GOLA 1C8VB 4JROA 1CY2A 3Q8QB 3KTAA 4KMUA 1TL7C 2DBYA 3W8RA 4KPEC 5TV2A 2AFIA 3BMCA 3S2ZA 1YZQA 3KWJA 4EPYA 2NYAA 4JLSA 1CB0A 4MGEA 2PH1A 2BHLA 3F49S 4YPOA 3MR5A 3HXPA 4MA5A 1R9JA 1EX1A 1ZSVA 4OP1A 4XD7D 1JUDA 4O63O 1KH1A 3CWQA 4UDYX 4Q1AA 3B9QA 1ISSA 5L3QA 3TXAA 3WNVA 3F8WA 3TNLA 2YIMA 1L0BA 5C5EA 3GP3A 4HDMA 2G77B 2C2ZA 2YCBA 5B1IA 3NRZA 3ZG6A 3QGMA 3N70A 4EZIA 4IDGA 4I2JA 1AUQA 1OI7A 1I3KA 4FUQA 1Q1EA 4XYBA 3O8CA 1ZIYA 2OCGA 1Z06A 3DTTA 3GGSA 4M0LA 1A8SA 3D0OA 3KT0A 5I9IA 1KRPA 2NRWA 1QZ3A 3DF7A 3VYSB 4RFSA 1VLQA 4QNLA 3RVNA 4O8ZA 2AQ0A 1C7QA 4QG3A 3GP8A 4G63A 3L5OA 3I62A 1T36A 3GQBA 4ZFNA 2IXBA 4D0RA 4FDAA 3P5BA 2HTFA 3ROTA 4JYAB 1YZNA 4MV9A 5FBRB 3PR4A 3K9BA 4YLYA 2C92A 5TMEA 1A4IA 4Q4JB 4EEZA 4IGFA 2Y68A 1SPXA 3DLPX 4Y6PA 5JVDA 2J9FB 3CLTC 5DP2A 3ZHZA 3H11B 1TYCA 1HDEA 3EBOA 3E5RA 5U4QA 4LVUA 3UFXB 2ONYA 1Z07A 3ZGZA 4OXNA 2AN3A 1CJUC 3S1AB 5DCYA 3EXHC 5JZSA 2WFLB 3RBEA 1C29B 4R1PA 3ZCTA 5BMOA 3W2HA 4OHWA 4H3VA 2P2CA 2CDRA 2QTZA 4HMPA 2MCFA 1ECFA 4YUYA 4JWNA 3RGGA 3MTDA 3DL7A 1BAPA 3C16C 3ZV5A 2I1VB 1UBFA 5TE9A 1PGJA 4HRXA 2B7BA 3INTA 3NHZA 1YIOA 3IHKA 2ISQA 2Q1YA 5MF6A 1K5HA 2QVGA 2X0FA 4RD1A 3KPVA 1OSNA 2OZLA 3HFRA 5CRIA 5EXSA 1Z5UA 4RHCA 1KJJA 2DM6A 5CHEA 4P2BA 3WJ7A 5DCWA 4IMJB 1JDJA 3Q3JB 1EXWA 4JOSA 1WBJB 3R7DA 2DFVA 3W1VA 1T3NA 2DH5A 3P97A 2JZNA 3WX0A 4EY7A 1C2TA 5M04A 3T1YB 3N58A 4KAXA 4X60A 3INYA 1U3VA 3C3JA 3WGGA 2CUKA 1JLLB 2I6XA 5AVOA 1EFCA 4CG2A 1ODCA 2XI9A 5KVVA 3A2NA 3IEMA 3O8OA 5FBQB 3RUIA 3BWVA 3T4XA 3D6VA 5F9HA 1QOQB 4DLLA 1SU8A 2ZTHA 3U7JA 4C8OA 4YECA 3R6WA 2CMKA 3L8FA 5KBYA 1LXCA 5BSMA 1N1MA 2BIFA 1YE8A 2VDNB 3KTAB 3NV7A 1KDYA 2HQSA 2ORVA 3I52A 4GBMA 1JU3A 1MAAA 2AFIB 3BMCB 3EEIA 1MNAA 4XIGS 1HEKA 4Q9JA 1HORA 3CG4A 2FK8A 3A4VA 2FLWA 2BHSA 2WB1F 4FIZA 2ZUBA 2B4KA 3RU3A 1WMFA 1DBVO 4R5HA 1FXWF 1PL7A 2QUBA 4QJBA 4UFPA 1IK4A 3PFHA 4OUKX 1NX9A 1EVYA 1E2GA 5AUOB 3T34A 2JGNA 1S3FA 4V0QA 4G37A 4B31A 3BWYA 3VSBA 3R7WA 4PN7A 4HDMB 2VP4A 2C3MA 1DC6A 1P73A 1X1AA 2GZ1A 1PVVA 1N5RA 3Q5EA 4JNCA 4UVDA 4GM1A 4DZRA 3PFBA 1RI1A 3U9SA 4Q1EA 1T6XA 3D4IA 2RHRA 2ZRGA 3NPAA 3BQ0A 4MV7A 4WX2B 5LZ2A 3TW0A 1XZMA 3UQZA 3GIJA 5EYPA 2BKVA 1O08A 4D02A 3RRYA 4FZ5A 2A57A 2XAAA 3VR5D 4AMUA 1DWOA 2QJWA 2O1XA 4URUR 2YQ5A 3ENZA 4CM4A 5EC8A 3EGWA 2ANCA 2WW8A 2I6GA 1NUTA 3DOOA 3TUJC 5FWXA 1T36B 4OJYA 2VRCD 5JLAA 3GQBB 3DZKA 2RDJA 2CNWD 3D7SA 5TQ2A 4IL6U 4EDFA 4QEDA 2ZTSA 1H5NA 4GKAA 3C3YA 4RFLA 2YWXA 4RXTA 5L51A 2KX7A 4P1ZA 5B6PA 1ZD1A 3WDMA 4BO6A 2ZT5A 3G6WA 1T6ZA 4KKXB 2DPYA 5AESA 4KWCA 4NP6A 2XOEA 4ODIA 3GT3A 8ICTA 2II6A 1BQ4A 4PNPA 1XMIA 3BHJA 5CAEA 1GEGA 2A94A 2WMYA 3IE2A 4MLCA 1UADA 3ZE9A 1BIFA 3U4HA 2JI7A 4N49A 3Q7EA 2QYTA 1PN3A 2C96A 1HLFA 2JI4A 5A3QA 2JVIA 2OZKA 1IM4A 2C7RA 2QR5A 4JQYA 1P9WA 4FK8A 2Q2OA 2ORWA 5TLSA 2Y6VA 2VJAA 1VBMA 4ZYLA 1WXIA 2AMJA 1CQXA 1G1AA 2W6JD 3OJSA 1SB9A 1X66A 5ALUA 3SG0A 2OZLB 1ENOA 1U7PA 2NIPA 4QRDA 1MTZA 5ERGB 3SENA 2BISA 3E18A 5LQJA 3VJRA 4E11A 2VTDA 3EA5A 4KWIA 3OCZA 4HNSA 3RU7A 5L4NA 3D31A 2Y0DA 3ZVRA 3HHPA 1U4SA 2PT9A 1J20A 4JX8A 1L5VA 3IQGX 1DRUA 1NBAA 1T6NA 4KNWA 2BELA 4RAQA 5J2HA 1Z56C 3TB4A 2AJTA 1X94A 4QE3A 1HYEA 1QDLB 3TIIA 4JR2A 1C4OA 2SBTA 4TURA 3EGOA 1SL0A 1DJLA 2FFJA 3D7NA 4MW0A 3SD7A 1X6VA 4AB1A 4B83A 4W8OA 3T95A 5AR1A 3O8OB 2JJ2D 4M76B 1KAEA 3B9PA 3AXTA 3ZY5A 4KPFC 1USWA 2AN5A 3HDVA 2Q99A 4QU5A 4Q66C 4E2YA 1V9LA 1W2WB 3QITA 3BM5A 4N8DA 4RTSA 4NH4A 4KLCA 4I9HA 2PL3A 4FX2A 1ZS9A 5TVKA 7REQA 3L6BA 4LF8B 4IUYA 2UUPA 1B26A 3B78A 1PS8A 3LPNA 2G9QA 2PWBA 3DPIA 4GMGA 1X42A 1LC3A 3MTBA 3TVYA 1V3VA 3DMPA 4OK5A 4P92A 1UPUA 2OYSA 3KT8A 3P4YA 3KZIU 4BMNA 1U4OA 3FVQA 3EGDA 2ATLA 4U63A 2HBQA 2Q4OA 4RTKA 2JH7A 1P4SA 5IAJA 2VL7A 2R8ZA 3JAMA 4XWOA 3BWBA 4AG6A 3C6YA 3M6VA 3L4BA 5EYPB 3COVA 4QWMA 1E4OA 4HAOA 3PDIA 2H4YA 3UHAA 5I9LA 1AM4D 2A5GA 2ZSEA 4MF2A 4XYLA 4CM4B 1Z6AA 4PBRA 3V7UA 3TIFA 4NTZA 3DWEX 5B57C 5DLFA 1VIDA 1KHTA 1B00A 5TQ2B 4MEAA 4QOEA 2WYUA 1YNSA 2XE4A 5ALFA 4MV1A 3GR6A 4EB3A 3WGJA 1KP9A 1FSFA 1PJAA 4HAUA 2X15A 1CDOA 1NXTA 2PJDA 4MI9A 5CNJA 4MWZA 2H1HA 1JT2A 4GFDA 1U0OC 4XX0A 1QF9A 2DEUA 2KVCA 3OAAD 5DGBA 1YQWA 3QWHA 1ESNA 4V3BA 4QFMA 3OZWA 4HL6A 4RMIA 4YC7A 3GXBA 5EIOA 4ZVPA 4RL6A 3T9AA 2ZBEA 3UMYA 3NUQA 1REQA 4FGZA 5CAEB 3UK2A 2HPAA 2H1VA 5KOJB 3MYYA 4RZHA 4FFDA 5HILA 4BV8A 4BQQA 1NVBA 4R71A 1TTQB 2ET6A 3V6MA 2JLSA 1IUNA 4X8LA 2JLBA 3ZJ4A 4HQKA 4O8CA 4MGKR 4IAOA 5I7FA 1NLYA 1ZQQA 1COZA 1G17A 1K8ZB 3MQFA 4DDWA 2B2CA 2CNDA 3N7PD 3RGWS 5CDFA 1ZHHA 2X9VA 3LZDA 4DEZA 1VHTA 1DAGA 3OFJA 1A0PA 5D84A 2W37A 4YJ2A 3UMRA 4U2KA 4FDUA 1WUDA 2ZWAA 1B6SA 1T94A 3IVMA 4L5BA 3AF6A 2FETA 5JAIA 4PINA 1NHGA 1G3IA 2H9YA 4Y3UA 4CTMA 4B2YA 2XIJA 3DVSX 2B6HA 3AI3A 1ZGGA 4GLLA 3A1NA 3S8MA 3W5DA 3GIDA 3DVAB 1HETA 2PKEA 1EJ6A 1UBRS 1IHDA 2XQFA 3KPYA 2V6JA 1MH1A 4QZBA 4Z6FA 3T9BA 1YAJA 2VT2A 4ELVA 1YZ7A 4FGKA 1OKKD 1VJDA 3FNRA 5IH7A 3W2TA 2GBCA 5CYOA 1CJKC 3VVMA 1LQ2A 4QW8A 3ZW7A 3DEEA 4DMFA 4PYRA 3L8ZA 3NOQA 4AJKA 3RF7A 2VP0A 4NC9A 3AP3A 3H2YA 3ZWPA 3WGQA 7REQB 2HOIA 1Z18A 3QUSA 4HF7A 3MQ2A 3I6QA 1GRVA 1M1YB 3WGIA 3PW2A 4XDYA 1I3CA 2GEDA 5CH8A 5EMJA 4D8UA 2PR2A 3M8RA 1PWZA 4N1AA 1T29A 2IVZA 4G2NA 5F7OA 1NJXA 2J67A 4HS9A 5CFMA 2IYZA 1PJCA 2AN9A 3EGDB 4J91A 3TE6A 3B38A 3P96A 1XN4A 4WVFA 3K0AA 3E4CA 1AKTA 1Z7GA 1JS1X 1KJYA 3VDXA 2VAVA 4MLPA 3VPDA 4D3DA 3RIMA 4I4LA 5T3UA 2ZT6A 4I5FA 1ZJJA 3PDIB 3JQ9A 3TVDA 5DM60 1EFRD 3RK4A 3WSTA 1BO6A 4QWBA 2JLWA 3WO0A 1M6HA 4YPFA 3DXZA 4G4GA 3ITNA 1O6BA 2P5TB 2C5FA 2C5SA 4E5MA 4TKVA 2X0KA 3H13A 4F5WA 4B73A 2AXPA 3DBHA 4IYRA 1V1JA 4XI9A 4XX0B 7ICQA 2PS3A 3GVHA 4W5NA 4ECUA 5E7JA 4GXRA 4N3NA 3ANTA 4N9WA 3ONDA 1XD9A 4FEGA 4AJ9A 5HYVA 3DNFA 2H2HA 1MV8A 4D0GA 3HRIA 4ZYYA 1NQWA 3P9IA 1REQB 1FJ2A 3ZV6A 2HVHA 4QU0A 3RANA 3EVGA 2QVLA 1AHIA 2IYVA 1E2PA 2WNHA 2I3BA 3PR3A 4J9SA 5FOWA 3VR6D 1H8HA 4ZA2A 3JRXA 4Z1OA 4JZKA 2WE8A 2ZDGA 5CEJA 2CMHA 4JJ8A 5ICCA 5J4YA 5KOYA 5DLQC 1V5GA 3DEYX 3RS9A 2KSQA 3ZW9A 1SXJD 3A6JA 5BSHA 2HFKA 5AQEA 2PTGA 1NVXQ 1J0DA 3KK0A 1SUSA 3KHTA 3V1UA 1NAIA 4IQ4A 4FMPA 3EZ6A 3SYLA 1PLLA 4YJ2B 1BXRA 3C5GA 5FD8A 4EYKA 4L9SA 1UINA 1R4ZA 1P33A 2XUGA 1H38A 5HE9A 5EJEA 5C0YA 1FJHA 1KARA 3TAPA 2EF1A 2W9CA 2EX1A 1D2NA 4X7MA 1FDOA 1J8MF 4PNHA 2GWHA 1W5SA 3ZDRA 4I1YA 4I28A 4X7PA 1X7ZB 4QDKA 2P9TA 1I2BA 4PSUA 1I7LA 2WIBA 4IDBA 5ALXA 4W9RA 2B8WA 2GEVA 1W5BA 3U7RA 4BJ3A 4H35A 3FD8A 2GBLA 2P9YA 1ZCZA 1OXUA 1VG0B 2HWKA 1TCBA 1B15A 4ZZ1A 1WNFA 4LY9A 2HRBA 3IHWA 2GSWA 2PL1A 2AX4A 2DT8A 2YL2A 3V55A 2XSZA 4ER7A 1XROA 1PR9A 1Q0TA 3BFJA 4QL3A 4MAFA 2OAGA 4IXWA 1BDMA 3IEUA 5G1NA 4CIAA 2WWIA 1XX6A 2F55A 4A23A 2J3IA 2VSQA 4LSWA 1Z6PA 2VF8A 1AN0A 4E12A 3GJYA 1AKVA 1RRFA 3G85A 3QSGA 3AW8A 2D5BA 2FF5A 1PDVA 2ZWPA 4DAOA 5CDUA 2PXAA 4I1SA 3K0AB 4LAFA 3V32A 2E4XA 4OA8A 3WTBA 2QMOA 1ZKDA 3MJSA 5DBOA 1GFSA 2A88A 2DOKA 3WRWA 4FGWA 1T8SA 4RK5A 3DT6A 2BBTA 2ZRPA 1FFEA 1UPFA 4ZV9A 4UTXA 2M9MA 3C0KA 1HG1A 4JSRA 3PHLA 4GT1A 2A5YB 2JCGA 4OYLA 3ROGA 3VPGA 4S1VA 5GJWC 1NK9A 4K8OA 4E4RA 3KKEA 4D45A 4TKVB 3SYRA 2PLFA 3EVTA 5TEVA 1XA4A 2W6ID 1S0UA 4RU9A 1MOSA 3B52X 3DBHB 4PPGA 3ZWDA 1Z0JA 1DP4A 4G1FA 3PKZA 1CUXA 1A9YA 3AM4A 4CF5A 2K7FA 2HR1A 1U49A 2PL5A 2QAGC 1SKBA 2BI7A 1L8OA 1ZNYA 2FUG6 1ORWA 5I8WA 2QRQA 2OCLA 1DAPA 3ZHCA 3K3PA 5BQFA 5KTSA 4OXQA 3U3KA 3GVCA 4UUAA 2DETA 5H82A 2XPCA 1OT3A 3SI7A 4KODA 1KZYC 2IP2A 4ZOAA 3O8NA 3VNVA 4Y0NA 5ESRA 3U1TA 5IDQA 4CZ2A 3LK7A 2O19A 1NU8A 4LF6B 2YN4A 3VDRA 1TJ5A 2JRZA 4M9ZA 1IZ7A 1BA3A 3BKWA 1CR6A 1X1BA 1KFCB 1J2MA 4CDMA 1PYGA 1BXRB 3L6EA 1R4AA 2ES4A 2B98A 3SKVA 5D5PA 1VIMA 2QM7A 3QLEA 1B93A 4DR7B 4PU0A 1JGTA 1HSZA 2PA0A 1J23A 2IZ0A 4NNOA 4C30A 3OCWA 2PS1A 4OMDA 4B3BA 1G19A 2H18A 4JKOA 1OWMA 2W9CB 3L1KA 4Q7JB 2DUNA 1Z5GA 2XE7A 4X64B 4EP1A 1WE2A 3CJTA 2XWPA 3D4BA 3B3GA 1UWKA 2XVYA 3B6ZA 4PLYA 4RULA 5A3SA 3JAWA 3KV1A 1F0NA 3L9XA 5ERXA 2L82A 4U8HA 4U1RA 3V3TA 3WHKA 1Z82A 3ZNQA 2VOJA 3LPMA 3KZCA 4JT9A 3DFUA 2KLHA 1HV8A 2AD5A 5JZBA 3KXKA 1R6DA 1NZJA 1LV7A 4FWBA 4QXOA 1SKMA 1UOEA 3IBYA 3GV0A 2EG9A 4B40A 5LXTF 1K2WA 4NZOA 4K9SA 4XD2A 1FYFA 5J0WA 1OVGA 3ZHVA 1OA1A 2IBMA 4QRIA 5IYZA 1I3MA 3ISVA 2Q28A 4QEZA 2QXTA 5IAAA 3HCAA 1MKYA 5DWVA 4P80A 1E2NA 1NXVA 4HGOA 4A15A 1S8OA 1H0RA 4C20A 5K6AC 3TXYA 2BR5A 1JAHA 1WDMA 1JJ7A 3GUZA 1X8KA 2FX5A 1FFDA 3AOEC 4N8SA 5DX1A 4XQ8A 2UUCB 3GGOA 3ROFA 3UA3A 5FLXA 3MOSA 2IXGA 1Y48E 4F4WA 2Q5QA 3GLGE 4PZDA 1KL9A 4BLWA 5D01A 4C4YA 1NQOA 3KSRA 2XQGA 2WMOB 3S4YA 3TQOA 3LL7A 2JHAA 2C5BA 1AN9A 4J0HA 4YRLA 2DUUA 3HUTA 3MWKA 4LHXA 2I2DA 3OOWA 4XLZA 5FBWB 4JX9A 3QK7A 2IYYA 2EIXA 5IAKA 3G0BA 1M2KA 5BV1A 5K3AA 4EYGA 2WQZA 4GSYA 3DOJA 1QX4A 2JASA 3LQYA 2WYWA 4DHWA 3C23A 3KQNA 4BO1A 4F2SA 4NMLA 5EAIA 3R3XA 5F7XA 2VK4A 1SK8A 1KEWA 3K53A 3W3AH 2X9LA 2XUZA 1DADA 4V1CB 3D54D 4CDRA 4UBCA 4J8PA 4I1PA 1C8KA 1FY2A 1YB4A 3OZAA 3UC5A 3V2IA 1YQ9A 4YUXA 3FNFA 4K6MA 3NX4A 5DO9A 4NPHA 2PBLA 1EZ1A 3QQ5A 3QH4A 4AUMA 5JAZA 4HNRA 2V1XA 4YBZA 4RFVA 2BVNA 4QW9A 4KV7A 2GBGA 2RGNA 4LSGA 1ISHA 3NH6A 3KDPA 3EG5A 3D64A 2QGFA 1C41A 3WAGA 1X1DA 3RWMB 3SHQA 4DAEA 1DZIA 1ZM9A 2AI1A 4LX0A 2ODAA 3VKHA 2WTAA 4F97A 3FHJA 2YMMA 5KG3A 2CT8A 2EDUA 1ZQTA 4D79A 3ZU4A 4MYDA 4QDJA 5T8KC 3AJRA 4MVCA 4YCMA 4DQKA 3QF7A 5PGMA 4PPNA 4K26A 3E3MA 1ZESA 9ICEA 2F67A 2VHVA 4F12A 4XM0A 4RK1A 4J43A 3MR3A 4MR7B 5DF1A 3CJQA 3FMOB 5B4TA 5ER6A 2OHFA 1VE1A 4QECA 2HWUA 4KO2S 4IKOA 2WAYA 1TM2A 4QYMA 5HKLA 1P9LA 1ZQ1C 2ORYA 2IS1A 1HMYA 3TJRA 3ABQB 3M6XA 4MDYA 3V9PA 7ABPA 3L7JA 2F9MA 2IWHA 3EVNA 5FPQA 3ABIA 3S99A 1XT6A 1EEXB 2ZFUA 3SZOA 3AO0B 5DTJA 2CK3A 1TV9A 1T13A 3F6YA 3AMZA 3DVRX 3AH8A 1UWLA 2A84A 1NHWA 4RD0A 4ETMA 4MUFA 4ECEA 2XGJA 2CHFA 5KFDA 4DMGA 5AW1A 4BGVA 3U4CA 2Q9AA 3T7KA 2WJAA 5BN3A 3T5GA 3UB3A 5IP5A 2LIPA 5DK4A 5H81A 1GAJA 2FPXA 3MWEA 1XDGA 1MEEA 3SS9X 3NIGB 2FWRA 5CW2A 5KWSA 1OA0A 5CJJA 3GUCA 3RJTA 1ULZA 3DONA 1E7MA 4BNXA 3S2GA 5K4AA 4PHAA 4IM7A 2QAGA 4WD3A 4ESOA 2CB0A 3TMYA 4ZCMA 3EZ5A 4RMHA 2ZJ0A 5KYVA 1MB9A 3KEOA 4Y2YA 3VNQA 3LKDA 2AC7A 2PKQO 4LRQA 4U6NA 1PWEA 1MPTA 3BGIA 2FQXA 5CFLA 2IYOA 2XY5A 3D8SA 4CKWB 1FC0A 5HDQA 1KRWA 3DH0A 2I7TA 4FGLA 4I1RA 3ZCXA 4NCHA 4KREA 3PEYA 1S76D 4NE7A 1EUDA 3U81A 4L5JA 4DJFC 4U02A 5J2BA 3GFOA 1KZHA 4CMAA 1E8MA 2WM2A 3VC8A 1BOOA 3BSSA 5JUMA 3TZHA 3PUIA 3GRKA 1IQPA 4IJWA 2R0QC 4I3GA 4K46A 5D1NA 2BGGA 4LVOA 2NSJA 5DOVA 3ZOKA 3GA0A 4B3SB 1U45A 3PFNA 4GW3A 1XGKA 3SI8A 5F9NA 2G0AA 4TS9A 2C2YA 2YR0A 1E9CA 2PX2A 1PR1A 4PHPA 1XL1A 3CVXA 3IYLW 1R3DA 3DXYA 3P71T 4QZVA 1YQTA 4B3XA 1KEPA 4LOKA 2CD7A 3AF0A 2Y6UA 1K27A 4MDFA 1B22A 1L5UA 3CF4A 1AQIA 2PH5A 3H0LB 4HN2A 4MIEA 2XCOA 1N5WA 1CXZA 4KVFA 3I0NA 4MW5A 1Q1AA 4JK3A 4RH1A 5C18A 1SD5A 1Z12A 4EFKA 3C3BA 2CXYA 4YR0A 5IUKC 1IDN1 5HF5A 3AFHA 4G8BA 5CFPA 9ATCA 1FYXA 3IDFA 1MB3A 3OIUA 2QU8A 2CHQA 3G79A 1JSXA 4UB6U 3GT0A 3EY4A 1QG4A 4OHRA 4KQCA 1YHNA 1W5AA 4G67A 4AURA 2FOLA 4EJ0A 1BPZA 1APBA 4O02B 2GAOA 5D49A 1Q77A 4E1VA 1W19A 3DM9B 3UH1A 4BAUA 3OX1A 521PA 3QPVA 3HJAA 1UKAA 2GLXA 4IDPA 1XNGA 5CT8A 4JUIA 4G5RA 4G0MA 4FEAA 1W36C 3AHHA 4XIIA 4V24A 3AOEA 2HSEA 1XB2A 1ONBA 4Q1BA 1EEHA 4YWJA 1PHPA 4YRAA 3OKCA 4J4BA 4K7JA 4ILEA 4K6CA 1FDUA 3OESA 2Q3EA 4GHWA 3LVFO 1TAUA 5BN3B 1L6IA 2HK6A 3JPRA 1NNUA 3M5CA 1X86B 2J7PD 2YTUA 3H2BA 3A9SA 1ZWLA 2QD1A 5EVCA 2F8TA 2CDNA 4R81A 3DE3X 4QULA 3GPBA 4ZI5A 1EJ2A 4GLJA 5TGDA 2VTEA 3LWLA 4E09A 1RQXA 5LN1A 2ZB2A 4FR5A 5F2KA 1QDEA 1D8TA 2QAGB 4P5DA 1RQGA 1MX3A 5DHTA 4JVNA 2OAQ1 3DOCA 1UFOA 3UMGA 4HAXA 1HNXB 1IDOA 2PYZA 1YE5A 3AB8A 2KOBA 5EZYA 3LCRA 4WEQA 4EQZA 1WDKA 3DW3X 4QEKA 4UUQA 4E30A 1JE0A 1RKBA 2O1WA 3I42A 2O4UX 5JAUA 1OI4A 3UQYS 4AQ7A 1ISJA 1EUDB 1IVNA 1LBTA 1DXSA 4XW2A 2DG2A 2DUYA 4U2EA 1DT5A 3DHNA 5E38A 1VSQA 3CZ5A 1PG2A 1FUKA 5I7RA 1PVOA 4ND2A 4PO1A 4PYIA 1B4DA 4JYCA 3UGQA 3RYFA 5AKZA 1G7RA 4TTQA 1AKUA 1YBMA 5B36A 1BMTA 1T4GA 2I4OA 4DCOA 3IDWA 1TVKA 1EWTA 2JV3A 3A9TA 2DBZA 2GCOA 4KACA 1RWVA 2WHRA 3V5NA 4BZQA 1SCJA 5T8KA 3VYTB 1C0LA 4IGEA 1OGYA 4I8DA 2FZWA 2A1UA 1PLJA 7YASA 4BKMA 2C98A 1GQYA 3EN0A 3KSUA 4DTIA 2AX3A 3ETLA 2WUEA 1KBQA 4BATA 3ZNNA 5FFNA 3V4PB 4Q8EA 4DJJA 3DM5A 4XASA 3AF1A 2BFEA 4HJRA 4HRYA 5FX2A 4GBJA 2CV0A 2RBGA 3VAYA 2RHHA 3NUZA 3DA8A 1OHHA 2MU2A 2V4RA 2ON6A 1WX1A 1KXZA 3TAQA 1Q0UA 2RHDA 1QIGA 5KFFA 1EX7A 2C2OA 1BD4A 1KKMA 1A9SA 3NP7A 4U3JA 3LRTA 1RG6A 1PLKA 2CN1A 1T2NA 3LQKA 1RZRA 3WSVA 2HBRA 4YCDA 1QFMA 1GUAA 2PH3A 4H0FA 3DXFA 2UVUA 3K4HA 3W1EA 2HB6A 4TMYA 4BBZA 2O07A 5ALWA 4DB4A 1W7AA 2VHJA 5IIKA 2ZSHA 5DOZA 1KC1A 2O5RA 3OTOB 1CRXA 4A73A 1D9FA 4LNUB 4KIUA 2GS9A 2FPOA 1SUBA 1DCFA 3HW8A 4MWGA 4MWOA 3H86A 4JLVA 2XOXA 3JD2A 3BEOA 3L6RA 5B55A 3OE4A 3VZDA 1PS9A 1SG0A 1U31A 1KZ7B 3L18A 2ZE5A 4TQGA 3USCS 4BMSA 1P5ZB 4LYJA 1LRKA 2IX9A 5FUYA 3C1TA 2DC1A 2BE7A 1QO0A 4LHVA 2AR7A 1J4AA 4BWVA 2H3QA 3K1RB 3L82B 2G71A 2Z3WA 3H1EA 4JZYA 1HNZB 5DTMA 1GG8A 2KZMA 3E9QA 2ZBGA 2QVXX 3DO8A 2WWYA 3TARA 3LCJA 1DJPA 4XB1A 2YZKA 4BKRA 3YASA 1Y6QA 3AM1A 2G5PA 3OPMA 5EZYB 3BGVA 5HS4A 3ICEA 4WNIA 5CEEA 5IXSA 3LF2A 4N7RA 1T10A 4FT2A 3BUSA 5C1OA 1P74A 2Q1WA 3WGZA 3G13A 3QJ5A 3GRYA 3H4MA 2GESA 3UFXA 5FUMA 2C04A 5SYMA 1T5IA 2G9ZA 2J0EA 2ZKIA 4KLTA 3THWB 1IZ0A 4F3KA 2Q2NA 4MVJA 1P6QA 2JEZA 1OU4A 4NEGA 4YY3B 4RBNA 1G20E 3A05A 2TMGA 5J0OA 2YHIB 4HEQA 4Q43A 1TVKB 4D8WA 4IJ6A 3KSZO 3OKPA 1BPDA 4H9GA 2GFHA 3AC0A 3B51X 3GDWA 3MJTA 4MDHA 4NU5A 2KHQA 4N82A 3ZK7A 4R0VA 3G02A 4LXHA 3HNPA 2A1UB 4HN4B 2F4VB 2OV8A 4H7FA 3ZE2B 2J6TA 4M0PA 3OJOA 2G82A 1XMXA 2VT6A 4ZK6A 3FFXA 4B0PA 1QIHA 4B09A 1CNMA 4ZZ2A 3PO5A 3L3BA 2NO0A 4Q00A 3OTGA 2HAEA 4PO9A 1QZZA 3ORYA 2BFEB 1Q0SA 3A9WA 1EX6A 1JHDA 1UBNA 3AZQA 4XCVA 2L18A 5ALMA 1G16A 3DQQA 4DMLA 3RRMA 2O05A 2GHRA 2B4AA 5JCOA 4GKJB 4MINA 1YJ5A 1W35A 3ZCRA 4ETIA 1YFJA 3RQSA 4BZWA 1JH8A 1RI3A 2VI5A 2IPXA 4DNPA 1GO3F 1SWVA 4EY6A 1XPRA 4DIOA 4U3JB 4CMEA 2ESEA 4RGQA 3QI2A 1ECCA 3T0IA 1ODSA 1V4BA 3LKBA 2J45A 1K97A 1M34E 4QASA 1DEKA 3CLKA 2YDYA 1HDRA 1UANA 5C9ZA 3FCOA 5CDYA 2HU2A 4RS4A 4EA9A 4UVGA 1Z0KA 2VPQA 1N78A 3F2VA 1M67A 3RD5A 3NIFB 5C5IA 2N75A 3H65A 5K3CA 1IBMB 3I12A 4DQQA 4U00A 4P0QA 4CN9A 2OO3A 4ECXA 2G9UA 2IEBA 1DG1G 1YUMA 4Q6BA 1XJQA 2HJ9A 2W6CX 1PV4A 4BKOA 1EHIA 4KQHA 1WV1A 2W03A 1A5AB 2ONCA 4RQ6A 4HFNA 4QNNA 2WF6A 2ECPA 1QYRA 4QM7A 4I2DA 3EBLA 1ZD9A 2BM1A 3WR5A 4IIVA 5CH5A 1RRPA 2ZWOA 3T7DA 4BFZA 1YI0A 3A4YA 1I6LA 4USAA 1E6CA 1ZNXA 1U1EA 4R2LA 5I5EA 4DV1B 2AG8A 2QEQA 4IRKA 3N2KA 4D4KA 4JV2A 2Z6QA 4G0WA 4MUHA 3C1ZA 1LUAA 2V65A 4ESVA 4YJKA 4IWNA 5J4KA 2YFQA 4K2AA 2FQWA 1T9GR 5B1EA 3ESZA 3R5SA 4BS9A 1DKPA 4XFJA 2EOAA 2RD2A 3EZ9A 1EFHA 4QDOA 3LDFA 2PXHA 5ITVA 2VXBA 1X3LA 1DCTA 2WIGA 1RVDA 4DOAA 4TTVA 1KLNA 4QKQA 4WN3A 1JHRA 4IS3A 2C20A 3Q87B 2AW5A 1ABEA 2XUHA 2JDID 3UCFA 4REMA 2O8NA 1K4MA 2Q3DA 4MQUA 6ADHA 2QROA 2OESA 3N0XA 3FKSD 3OZ7A 4RQ8A 3EEFA 3K0CC 3EZNA 3PK0A 3MWGA 5ALLA 2IOFK 2H5LA 5HSGA 4OI0A 1V38A 1Z0AA 5KS2A 4JBIA 3JD4A 4RK6A 3MBIA 3EZ7A 1V37A 1H66A 5TSDA 1WU7A 3QVTA 3I6ZA 3AUKA 2NRZA 5IVDA 3K1TA 3SQOA 3M8SA 2HJHA 4RVFA 2QE7A 3E5MA 1WZIA 2EG5A 4JP8A 3EJ6A 1P6XA 1ZD4A 4BVJA 5KTKA 2CF6A 1HOXA 1OBCA 2E8PA 1S96A 1Z0FA 2L19A 3ZBTA 1EGVB 4FR2A 5DNVA 3ZJTA 3ZR4B 1P61B 2AZTA 1VMAA 4Y1FA 5IF9A 4E46A 4PX2A 4XB2A 3PC8C 1JDZA 2CLLB 1BN7A 1FO4A 4HLUA 6PFKA 3OVMA 1Z6ZA 3IAHA 3HKDB 4PC3A 2Z83A 3C2KA 3LD9A 8ICKA 3PPVA 2Q3MA 4JK1A 4ENVA 2WHPA 3EPPA 1H93A 3D5EA 2HDWA 3GZTB 2OFWA 4ZAFA 3MM4A 3R7NA 3CZMA 4KBGA 1A9OA 1OXVA 2P1DA 2QZPA 3CR3C 3DZ8A 4GMXA 4D9CA 2JLCA 4B8ZA 1GKUB 2F3RA 2IZ1A 1KO8A 4MUJA 4P0QB 3WISA 4PICA 4PYLA 3LUDA 2E8MA 3TACB 3E58A 4PX9A 4GPAA 3N4MB 4Y8VA 1NJSA 4QJ5A 4OAQA 3BXGA 2VNJA 3H9JA 4NFYA 1DIAA 2A3VA 5FHQA 2VZ8A 3WYEA 4GXJA 2JARA 4GX2A 4C87A 3DNPA 2Y3IA 1X9MA 3V4VB 1U4BA 3LWBA 5FBZA 4DS5A 5TQVA 1CSEE 1USGA 4UM7A 4YV1A 4XIFA 3N2KB 3DEAA 2H2GA 4CLDA 3OURA 2AG1A 5CEFA 4YG2A 4YJ3A 3ANMA 3UJ7A 2BGNA 4KC0A 3WGHA 4Y2XA 1SXHA 3NVWA 2JBHA 1R8YA 2GA9A 3H9BA 4Y1EA 4UBBA 3FROA 4I2CA 3ZVNA 3QVSA 4CM9A 2DPIA 1WMAA 2G6TA 1IVSA 3ELBA 3EG9A 4GPD1 1M66A 5AJVB 4YN3A 3TO5A 3U26A 4IHJF 3OPYA 5L6MB 4RVHA 4O3PA 2HOFA 1F1BA 1Y5NA 4F6CA 1K1SA 4KW7A 3X3HA 2OENG 4BV9A 3ROQA 5KOJA 2VQFB 4WW0A 3PMNA 3JRNA 1BMFA 5BV2P 1BHSA 1E60A 3FFAA 2R4TA 3NNSA 3LUFA 4YQEA 1HT1E 5BYAA 4YAUA 4OGKA 1OJLA 2BJWA 2XYVA 5JYBA 1G8SA 3C3CA 4A1FA 4RUAA 3KJQA 4MRVA 2ADFA 4D26A 4TUYF 3VUEA 4XX1A 1R5JA 2H5XA 3NGXA 3PW5A 1LKYA 1YUNA 1Q83A 1ZAYA 2KICA 3U4MA 5BO5A 2HF9A 3FPEA 4DEXA 1M6VA 4YVFA 4UM9D 4UAYA 4ND1A 5KFBA 2PANA 4RKRA 1IXSB 2IOFA 3GVPA 4PRYA 1II0A 5F1PA 4L07A 4TS4A 1QP4A 5HCNA 3RJMA 4OHCA 2PLRA 4YR7A 3LXMA 3DVAA 3FAHA 3KSMA 1Z2PX 1C5KA 4ZTBA 1PQUA 4UREA 4G24A 1WLSA 3PYMA 2XZTA 2P8SA 3V8VA 4ZH4A 1KO1A 2PUGA 3PXGA 5FUVA 4GX0A 4ZEVA 3TJZA 1SB8A 1K7XB 1YQDA 4BP3A 1SVSA 2B4YA 4V0MA 4MICA 2GA8A 4ZDKA 4M1WA 1RTKA 1MJ5A 2C4KA 4WIAA 4EL5A 2ISSD 3FSGA 8ATCA 4M9RA 2WR8A 3DKVA 1M8PA 5G1PA 3LA8A 2WHPB 1RHJA 3CXUA 4F4FA 2HK9A 3JZAA 1G0OA 1YBHA 1M1YA 3GYGA 4RPCA 1JIXA 2QLMA 4DT1A 1K68A 4B3DA 4RZRA 4OOFA 2IEGA 1EXNA 3WTCA 3SE0A 3TM4A 2JMGA 5IDWA 4S1WA 3HU2A 4DSOA 3PE6A 5JJBA 1QSSA 1PWHA 1HK7A 1NKCA 4CCWA 5AUNB 4TRNA 1KIAA 1BHJA 4JLDA 3VKVA 1S5PA 3W8NA 2PZKA 1ZUNA 2V6IA 3NHKA 1FYWA 2CHVA 2DUJA 1C1YA 5AK3A 5CFZA 3WL5A 5ALTA 1U6JA 1NP3A 1JJBA 3QKTA 5K01A 2YJ5A 4LXXA 4Z99A 4DNXA 2W93A 3EXHA 4CI0B 4GBGA 4YJ3B 2HA5A 2XMCA 1YCFA 2ERXA 2F62A 1F2UA 1V71A 4PZOA 2RGYA 1FF9A 3MT7A 3EG9B 1JXOA 1P4JA 1PIWA 1UBHS 3OPYB 3H87A 3I76A 3VJLA 2CBGA 1FUUA 5BY2A 2P2ZA 3TNJA 2D5LA 3O1JC 2BFPA 5JR3A 3P9ZA 1UZAA 1BS9A 3ANLA 3DJFA 1NMEA 1FJXA 1IOLA 2WV7A 3PV8A 1S2OA 2AC2A 4GOND 2VHTA 2CV1A 1U3FA 4OHXA 2MUTB 4FS3A 4KO8A 4IX1A 4JC8A 1V6AA 4D2IA 5FH9A 2R25B 1KYVA 3V8MA 4LOHA 4RYDA 1CY7A 1QLHA 1LKYB 3Q2KA 2W04A 4ZANA 1NKTA 3RTBA 5KQLA 2OHHA 5LQKA 3P9CA 1ND6A 2QUKA 3FR8A 4BRSA 1SY7A 4Y2UA 1Z7WA 1K9SA 4TLDA 4CN8A 3HRHA 4LSZA 1CS4C 1M6VB 4GXIA 1I9CA 2PEZA 5IDVA 3D2NA 1JN3A 3DDSA 3O5AA 1Y3CE 3IHQB 5EJ8A 3GXOA 2GCGA 4A2PA 1XA0A 2BGUA 2ZTUA 4S04A 4CEJA 5DRYA 1IM5A 3JQRA 4BMPB 2WFMA 1X7ZA 1VLLA 2Y77A 4QT0A 2LPMA 2PO7A 2VUIB 1EGAA 1Z4PX 2TMDA 4I27A 4XUSA 2WABA 3RNOA 1V2GA 2Q4EA 3AG5A 4PG4A 4LZWA 5H3HA 3OE7A 3IPRA 1Z2EA 3IMEA 4DSZA 3BWMA 2OH2A 2OE2A 1QPGA 4I1OA 2XBMA 3VPBA 3KU1A 1LSUA 2YZNA 1G6Q1 3NKFA 1JSZA 2P9FA 1VDZA 5HHIA 4BQRA 4IWXA 5BNFA 2VDQB 1KYWA 5LQRA 4DT1B 5DW3A 1ZJNA 3ESDA 1KQOA 2A86A 4EF4A 1J97A 4TKLA 2QN2A 3IAUA 5FA6A 4PL1A 1L5GB 1W96A 1ZH6A 3FRJA 4J07A 2H11A 1PFVA 4H08A 4KXLA 3JYHA 3CLUC 2WQ6A 2FEWB 1IMOA 4H7IA 1L5ZA 2JRCA 1ULHA 3R6DA 5KNCA 1ZUNB 1NPDA 2QDXA 3BS5A 3FBGA 2D13A 5DRTA 1V7CA 3R0VA 1JPVA 4GYWA 3BDPA 3O4FA 4RY9A 4AIRA 4DCSA 1O3YA 5GONA 5AW8A 5KFIA 2I2FA 2B9EA 5JD5A 4YREA 1LRJA 3OFVA 1RCTE 4P32A 3EXHB 4CUKA 1NURA 3PQEA 4ZVOA 3V6JA 3RB4A 1R8XA 1YULA 2OXIA 1F2UB 1N7HA 4MI1A 3IRUA 1CUYA 3R76A 2E4YA 1D2CA 5JQGF 4P33A 2Q8NA 5CVVA 1JG7A 2WU0A 2HBYA 4ADSG 2IPLA 5INTA 3B1YA 3ANNA 1E9VA 3U0BA 3EXIB 3V72A 2IV7A 3IESA 4R1QA 4LPSA 2YBDA 2ST1A 2IXAA 1OI2A 3NP9A 2FMQA 2ZJZA 3VU9A 1X9HA 4RQUA 4NLBA 5BYJA 2XF8A 2ZJ7A 4TLLB 2HVIA 1YFKA 1JG1A 3OJ0A 1JMVA 2DCUA 3HBLA 3OQJA 3DAOA 1E5LA 4LHZA 5B5SA 1L5OA 1KMNA 5BW5A 4Z6CA 1OFIA 4JSYA 3GW8A 3OF3A 2BZGA 2AJCA 4PJ0U 1RBMA 4QBFA 4PC1A 1X8XA 4FP9A 4R6XA 1XVAA 5CGZA 3FOAA 2P6PA 5JTUA 2MYPA 3JZMA 3KWMA 2VWGA 4JJGA 2JJQA 1JX6A 1ICIA 5CCXA 1UBCA 2DKOA 3M9MB 3EGVA 3MINB 2ASLA 1N2XA 2NO1A 4ERXA 1ZQCA 2ZXIA 1E6LA 2WAXA 4NPAA 3W1WA 1PJTA 5BSUA 1JKJA 4CEJB 2WZQA 1XDZA 5EUQB 3BIJA 2H1WA 3UAZA 5I48A 1JRLA 3CP8A 4J9RA 5KSPA 5DLGA 1QONA 3JPSA 4MP3A 2BYTA 4R1MA 4FGUA 2B37A 3ZZ0A 4JI0B 3EIOA 3LTEA 4CQJA 2CHEA 3KTOA 2LYBA 4I5EA 3HEMA 4OMFG 1D04A 4EITA 3EOAI 1N57A 1BX1A 2ZQZA 4PCVA 2MA1A 5L3ZA 3ZTTA 1MPXA 3ZGYA 3IDOA 3P4XA 4RAOA 1TO1E 3QA9A 1JFLA 3IV7A 2G1JA 3E84A 1CZUA 2JIZA 1NTRA 2ZXEA 2BGLA 3CZ9A 2HWYA 1CNEA 3MCTA 3ZVLA 1ZQXA 4BU0A 2W2XA 1PUXA 1BCRB 2HUNA 3L6UA 2VXCA 4JJIA 4QZAA 2OSVA 1Y5LA 3HRDD 4M36A 4JLUA 1V8BA 1P91A 1TLLA 2LPEA 1LK7A 3BS5B 3JASA 2WOJA 3RS5A 4KTTE 1U8UA 3W5UA 3NRJA 4O0IA 3OHAA 5B7NA 1VXRA 3JWEA 4I50F 1IM8A 4P81A 3NCTA 5GONB 1XF1A 3RAXA 3UXPA 1I3LA 1Z0IA 4HLDA 3OP1A 1W4CA 5LQUA 2PL9A 5NLLA 2OZVA 1TFUA 1QUEA 3N6VA 1P5RA 2BDPA 4RDIA 4CPDA 5CEHA 3BERA 5AIBA 3PC7A 3HUEA 5KVAA 1Z62A