2WF9A

Structure of beta-phosphoglucomutase inhibited with glucose-6- phosphate, and beryllium trifluoride, crystal form 2
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
221
structure length
221
Chain Sequence
MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQKQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-PHOSPHOGLUCOMUTASE
publication title Near Attack Conformers Dominate Beta-Phosphoglucomutase Complexes Where Geometry and Charge Distribution Reflect Those of Substrate.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
total genus 72
structure length 221
sequence length 221
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2009-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2wf9A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2wf9A01
4Y2PA 2WM8A 5ALLA 2FUEA 3ESQA 1RMTA 5AM1A 5AW1A 3ZVMA 2HCFA 4NWIA 4UAUA 1L7NA 2Q5EA 3L0BA 2ZG6A 5AM2A 3M9LA 3QNMA 1XVIA 4L6AA 3B8EA 1N8NA 2O2XA 4I9GA 2RAVA 5FP0A 5AI4A 3AR9A 3UM9A 3WKDA 2YMPA 2P27A 2FPUA 4JDPA 5AKLA 2YJ5A 2HEGA 5AM4A 5E0OA 4OCZA 3U7HB 3QUTA 4F71A 1Z4OA 4MUMA 5AW8A 3CNHA 4HAIA 4Y2YA 1ZD3A 2FUCA 3N1UA 3I28A 3R9KA 3L8GA 1WPGA 2MSNA 1NF2A 3DAOA 2QLTA 3L5KA 1L7MA 2GHQA 5IT4A 3ZVNA 4OHFA 1Z88A 5AW5A 2C88A 2YJ3A 4HGRA 4KN8A 3FGOA 1QQ7A 4I9FA 2GO7A 3L0CA 4BBJA 3B9BA 2PQ0A 4YIKA 2P9JA 3M1YA 3QU7A 2FI1A 1Q92A 2ZOSA 4UATA 1F5SA 5ALPA 1Z4QA 4XPZA 3F9RA 1XPJA 3E58A 2HOQA 3ZU6A 2CFTA 5AKGA 2R8XA 1SWVA 5AW4A 5ALQA 3FVVA 4HGNA 1EK2A 5ALIA 1T9ZA 2HI0A 4HGPA 3N28A 2WF7A 3ONNA 3AR3A 2HDOA 1X42A 5ALDA 4EX7A 4Y3UA 2OYCA 5ALJA 5AI6A 5ALYA 2WF9A 3QUBA 2R8EA 5AVVA 1JUDA 1O03A 3DNPA 4AS2A 2BDEA 5JJBA 2HO4A 3ZWDA 4IG4A 4Y2RA 1AQ6A 5AK5A 4C4TA 4EELA 4FYPA 2WHEA 3EPRA 2JAWA 4HGQA 1RC8A 4CF4A 3GYGA 1O08A 2G1AA 4BEVA 1LTQA 4UU1A 3U19A 2FPWA 4OFZA 1Z4IA 5IT0A 1RRCA 4ZEWA 5AKZA 4KNVA 1VFPA 4UMFA 3D6JA 1U7PA 4BYGA 3MN1A 1RQLA 1ZRMA 2OM6A 4B6JA 1Z5GA 2YFYA 3QX7A 1Z4PX 4NABA 2O9JA 3J7TA 5ALNA 1U7OA 2FPSA 2G06A 4UMVA 3ET5A 2FPXA 3L8HA 5A3QA 4XE5A 3B9RA 4C4RA 1S8OA 2HHLA 4HGOA 4C4SA 3ET4A 1KYTA 5AM5A 3WKBA 1IWOA 2P11A 2AMYA 3L0YA 5AKXA 2RBKA 4F72A 5AK3A 3FM9A 1YNSA 2I54A 2C4NA 2ZBEA 3NALA 3A3YA 5AESA 3QUCA 3MMZA 5AIAA 1Z4KA 1ZS9A 3E8MA 3SD7A 5AM0A 4GXTA 3ZI4A 2HX1A 3PGVA 4PNHA 3AR4A 1Z4LA 3QLEA 3NANA 5AW0A 3IB6A 1RQNA 2WF5A 2FEAA 2EAUA 2PR7A 4UU0A 1ZD5A 1RLOA 1Z5UA 2C8LA 1VJRA 5AVWA 3HYCA 3KZXA 2Q4RA 3ZVLA 3W5CA 3WK5A 5A3SA 3I1YA 1ZJJA 4XQ0A 5AHXA 2W43A 2EATA 4YH1A 1U02A 3PCTA 2D2VA 2G0AA 3L7YA 4BX2A 2YMLA 3QUQA 2FDRA 5ALWA 3EWIA 2B0CA 4EX6A 4DW8A 4DCCA 2RARA 5AI9A 3AR5A 1T5TA 4Y2XA 5AW2A 3A1DA 3AR6A 1CR6A 1L6RA 5ALSA 3WGUA 4AP9A 3WK7A 1WR8A 4ZEVA 2YN4A 1TE2A 3P96A 2IOFK 1K1EA 3ZTYA 3HLTA 2AUTA 2YMMA 3QU2A 3WGVA 2Q4TA 3AR7A 3N8GA 1QQ6A 4ZEXA 3IRUA 3SF0A 4BNDA 1SWWA 5AW6A 4J2TA 5AI5A 4YIHA 1N9KA 3U7FB 5AKYA 2CN1A 2WF8A 1RPZA 3W5BA 4UAVA 4CE6A 4Y2SA 5AIBA 3MC1A 5ALGA 4L57A 3CZ4A 1MH9A 1YV9A 4KX3A 2HF7A 3OTQA 3QU5A 4QJBA 4UARA 2ODAA 4G63A 3L8FA 3KBBA 3E81A 3TLMA 4JB3A 2ZBGA 3WKAA 4KNWA 2B8EA 3I6BA 2I6XA 4UMDA 4EZEA 1TJ4A 3ZX4A 5AI0A 5ALZA 5ALXA 3ZW7A 3SKYA 3UMCA 1Z4NA 4Y2VA 5AICA 2NYVA 5ALUA 2C9MA 2VKQA 3NAMA 5AVTA 1YMQA 5A3RA 4Y2TA 2JGAA 3U7EB 3EF1A 2JAUA 4O8CA 5AKHA 2W4MA 3DDHA 1RLTA 1RMYA 1YDFA 3OPXA 5AI8A 3QGMA 5ALHA 2GHTA 3A1EA 4KYTA 1NRWA 3AR2A 1WVIA 2IOFA 3FPBA 4IFTA 3FZQA 2MU2A 1RLMA 3N07A 3WKEA 3OCVA 1ZD2P 2IYEA 3E84A 3SMVA 2YBDA 3NASA 4Y2UA 3NUQA 2B1QA 5ALEA 3ZUPA 5ALMA 1SU4A 4GIBA 4G9BA 4KX5A 3SLRA 3W5AA 2YJ4A 2JAOA 3ESRA 3L1VA 3SKXA 4DWOA 5AVQA 2EARA 3OCYA 4YCLA 1ZOLA 5AKEA 2I33A 4AS3A 1TJ5A 2NO4A 4MWOA 4HYTA 2NO5A 2B82A 3EF0A 3FPSA 3KD3A 1J97A 1L7OA 2B1RA 4CF3A 4UASA 3UMGA 3L8EA 5AKJA 2ZBDA 2G08A 2MU1A 3R09A 3R4CA 1CQZA 5AVUA 1L8OA 4UMEA 1PW5A 2ZBFA 4BNDB 1J8DA 2BY4A 3WK6A 5ALTA 3U13A 5AW7A 2WFAA 1RKQA 4EEKA 3OCXA 3OCWA 3ZTWA 3DV9A 4DFDA 5AVSA 4L6CA 4Y2QA 2G80A 5AM3A 3WK4A 2YY6A 3SHQA 3W5DA 2R8YA 3NRJA 1QYIA 3QU4A 1XP5A 3KOOA 1ZRNA 1L8LA 3U7GA 1T5SA 3OCUA 1U2TA 4NV0A 4BEWA 5AK6A 4UW9A 4CNQA 3IJ5A 3PGLA 1ZD4A 2B8JA 1U2SA 4YGYA 3NIWA 1TJ3A 2X4DA 4BKMA 4H1WA 3BA6A 1L7PA 2JARA 5AKIA 2C8KA 2CFRA 2G09A 4YCMA 5IS2A 4Y2JA 3QXGA 2I34A 3S6JA 3KDPA 4UM5A 1Z4MA 2FPRA 4XOUA 3OCZA 2YJ6A 2GMWA 2PKEA 3RFUA 3N5KA 1RDFA 1RKUA 2HSZA 1EK1A 2IOHA 1S2OA 1Z4JA 4FE3A 2W11A 3ZX5A 5ALKA 3AR8A 1FEZA 1Q91A 2IA5A 3PDWA 3RF6A 2I55A 1RMQA 2R8ZA 3QYPA 3QU9A 3ZWKA 4BX0A 3I76A 2QYHA 4EENA 4YCNA 3UMBA 1LVHA 1NNLA 1RKVA 1YS9A 4J03A 1Y8AA 5AVRA 2AH5A 5T41A 1QQ5A 3VAYA 2P69A 1WZCA 2GFHA 5AKKA 3WKCA 2BDUA 3U26A 5ALRA 1TA0A 3MPOA 3WK9A 2DQSA 1VJ5A 5AW9A 3BWVA 4FFDA 3ED5A 4CF5A 4NFLA 2RB5A 5AVYA 2G07A 2YMQA 2I7DA 4NAVA 3L1UA 4QQFA 4BX3A 3K1ZA 4UM7A 2CFSA 3A1CA 5AVXA 5AK4A 5ALOA 1QH9A 4OD0A 4RETA 2ZXEA 5AVZA 5ALVA 1YJ5A 5ALFA 5AW3A 2OBBA 2AGVA 3WK8A 2WF6A 2OA0A 2B30A 3KC2A 4RESA 2HF2A 4E88A
chains in the Genus database with same CATH superfamily
5T67A 1DOHA 1XZ8A 3T5PA 4AJ1A 2GQ0A 3W04A 4OYHA 4PLWA 3K1AA 1EQUA 2O7RA 4YJFA 4BNLA 5KTOA 1ZXIA 3S5UA 5ITVA 4RVUA 4EM6A 2QT1A 4OHUA 4LCJA 4I50B 1RAHA 3MCUA 2ZUTA 5G4LA 1NQOA 3JQ7B 2FLLA 3QBEA 2JEFA 3BHIA 4Y6GB 5IXSA 4WOBA 1GSAA 3H3XA 4NS4A 3U5TA 5A4JA 2C1XA 3O8OA 3SI8A 1QLHA 5KFLA 4UCFA 3K0AA 2O7SA 4EUFA 3UZUA 2O5CA 2ZEJA 1JHVA 5KU7A 5TPWB 4PF1A 1JKMA 1WXDA 5JXJA 3SYNA 3HILA 3WSVA 4JA0A 4C7OB 4FOTA 4DSEA 3OQ6A 3ND6A 3C5WP 3DO8A 2HT1A 4GPEA 1SU6A 5HHIA 4EH1A 4KBYA 1J2NA 1ECBA 3FE2A 4EHBA 1XRJA 4PGMA 1M2GA 1NIPA 1AHNA 4OU5A 5TDHA 4GKVA 3SQMA 5DT2A 4DUGA 1U7OA 2FPSA 3GUUA 1P7DA 4F8RA 4RY8A 1AKWA 1SKRA 2ZM5A 3K6KA 3RNOA 2AKAB 2VATA 3BL5A 4JP3A 1C9KA 2R4TA 4N8DA 4ECVA 4O4HB 3TDNA 3EEYA 3L0PA 1K4KA 4GC9A 2VDNB 1BGXT 2OCDA 1QG0A 2HC9A 3WNCA 3FF4A 4IDGA 2JLSA 1SUDA 5FH9A 2X5NA 1KMIY 1ZD5A 1X1CA 3WLEA 4MYRA 1E61A 3KZXA 2FEWB 3LUDA 1I33A 4J9NA 2Z5LA 4AZVA 4HNAB 4C0JA 1D9FA 1UT8A 5DNWA 3TLJA 3OJSA 4ZO6A 1MNQA 4BTEA 5CPFA 1TM4E 4NFHA 3T7IA 5L3SA 3SNHA 3ZKWB 2DZDA 1M7HA 4L27A 2FW7A 1OA0A 5CT5A 4S35A 4FEYA 1GA1A 1EWVA 4E21A 1UK8A 1DK2A 5CBPA 1R4NA 4X3CA 5DI9A 1XO0A 3HBMA 4CE6A 4Q7LA 4BAZA 3OZXA 1EXNA 4V03A 2VPZA 3CF0A 5LFAA 4EAAA 1BA3A 1U0LA 1QBKC 5AVKA 4H35A 4LHZA 5FOXA 3O0DA 5EJFA 3IQZA 4AG3A 1DEAA 3BEOA 4NOLA 2FMUA 1RMYA 4J7AA 3VO9A 1IN8A 4FILA 1RXIA 4NLBA 5CUQA 2RK4A 4TRNA 4ZIRA 4Q3BA 3B85A 4X7BA 4I28A 4IFTA 3BJZA 3VR4D 2QOEA 4ARVA 1D0SA 1U63A 3TLBA 1QV7A 5G41A 4JUIA 3LT5A 3DMFA 9ICAA 5D7BA 3NW9A 1LDNA 2NRVA 1PF7E 4PG8A 2DWCA 1L7VC 4AS3A 3QP9A 1ZGZA 1CWUA 2CNWA 3WA6A 2NO5A 4HT3B 3AW8A 5JIBA 4CF3A 4FCVA 3HJBA 1Q19A 4MUYA 1IE3A 3PHLA 1SL1A 3EGDB 5ALTA 4BMXA 2HLPA 1Y4AE 2DM6A 5G0WA 3DVAB 4E2WA 1CZRA 1OFTA 2AFHB 3AU2A 2YFQA 5LP6F 1JQBA 3IIEA 5IF3A 4OY3A 1H8EA 3ULKA 3KT6A 1QGZA 1GPYA 1NJFA 1BYUA 3V5NA 5F23A 4M2LA 4P3NA 1GKYA 4AZ0A 2HV8A 4P4PA 3OTGA 5IXYA 2VJ5A 4FZ3A 4MI9A 4RCYA 2IEBA 3IAEA 1DOQA 3UHAA 1YI1A 3CUVA 4TV8F 3ICWA 1G7CA 3PCXA 1ISIA 4YD1A 5JSHA 3N75A 2WWGA 5K5EA 4A82A 4I5EA 4J7CA 1E5DA 2ZRLA 1E5QA 1NFFA 4FYMA 3KHKA 3O3NB 3CWZA 1XNJA 1RLUA 3RM3A 1YMUA 2W04A 1BEEA 5GJVC 2ZIVB 3I9OA 1SK9A 8ICHA 3FOBA 2DF8A 1NQAO 3A2NA 1QKJA 1J42A 3CUKA 1GO2A 5KHOC 2JH9A 2YFHA 3ETDA 1UM8A 3K31A 4HSEA 1LTHR 3GVCA 4OHFA 2OAP1 4RD6A 3RKRA 2ZIEA 3I4LA 1UXHA 1E5TA 1WLSA 3PVCA 1XMXA 3AC0A 4E14A 3R8CA 2R5FA 3FVVA 4PO3X 2HF9A 1AN9A 2WF9A 1A8SA 2OV8A 1RNLA 1K1SA 1P1KA 2A94A 4RZ3A 4INAA 4D92A 3EPRA 4Y6QA 1RYFA 3F2DA 1T2FA 5IZ4A 1UT6A 2E4YA 4FU0A 5EWFA 2TECE 2Y6VA 3AVTA 1M2JA 2QB5A 3ADCA 3THSA 5I48A 2PUGA 1M8GA 2R85A 1Q12A 3T3OA 1I94B 1AXEA 3O7WA 4N54A 4Q12A 1IL0A 4HL6A 5KOJB 4EQZA 1GZ6A 4N4AA 3O93A 4MRAA 1ZM9A 2A57A 4WE3A 3NTXA 5BSTA 4ZVKA 2D8CA 2YOFA 1XD2B 4CCYA 4W1PA 2ZTDA 2QW8A 5J2UA 4G8BA 3AT1A 2HSEA 4RKRA 3D3WB 4D46A 2CW5A 1NPYA 1L5RA 4G8DA 5EE1A 2JLAA 4NLKA 1M75A 4AY2A 4PZYA 4DREA 1NN3A 3IEMA 1J2TA 2EJUA 5AW2A 4XQCA 2A0YA 2CUNA 4O4LB 4Y98A 4B4WA 1BXZA 3VHXB 1NP6A 4Y1GA 3FPLA 4N39A 2P9BA 1IHOA 2GEVA 5HWSA 1A76A 1PYOA 3O3CA 1MUUA 4JLNA 1IN7A 1G2PA 1TRKA 1E2LA 4WY5A 3VR0A 1QB7A 4RFLA 4ARIA 2OWEA 2OV1A 4OKSA 2RGBA 4EF4A 2EAOA 1FPMA 2H00A 4ZI3A 2IX9A 4ZO8A 1ODJA 2MWMA 1V3TA 4BMDA 3EZFA 5E79U 5FUQA 1WU8A 3D8TA 3ONVA 1AOXA 4YFYA 4XB2A 3VJKA 1TCBA 5IC6A 3MWDA 3JZMA 3BHJA 3BORA 1IOVA 1MB2A 2ISPA 4B9NA 2BTOA 2P35A 3AR2A 3MJRA 2J4FA 3FZQA 5KC8A 2I5PO 3HKCB 4RGQA 3AL2A 1RJFA 2ECPA 1P1RA 5L7TA 4KPFC 1XG5A 4UEWA 2I78A 1RQGA 5CM8B 2Y1LA 1DMRA 4FWTA 4ESEA 2NIPA 1NMXA 9ICEA 3W79A 4YR2A 2L2QA 5FI0B 1HJPA 3EC1A 2RLTA 5K8IA 3TLCA 5IVHA 2HPZA 1VE9A 3R4CA 2TRSB 2EP7A 1RXCA 4WUVA 1PD0A 3M6KA 1Q3VA 1O54A 3NTLA 4RQBA 5DGIA 2HHJA 1X9HA 4EZBA 1PUXA 4KR6A 3TE6A 3WBFA 1XS9D 1YK1A 4UB2A 3B6EA 4X71A 4P2GA 3EGOA 1N2SA 3EOAI 2OGUA 4B31A 4CODB 5KG3A 4OLJA 3C8MA 4LY9A 5FFMA 5HJ5A 2PSDA 3AVYA 3V4RA 3NC4A 2P30A 4BRUA 1SBQA 1W46A 2DULA 4NLLA 5KQPA 3BTOA 3ZWCA 4TTJA 3IR6A 1GSHA 1C7EA 3CX6A 3D7MA 2JGKA 4R41A 1RE0A 2RDJA 4C22A 2KJQA 1ED1A 4PR3A 4NFLA 2AZ4A 4J16A 4LOKA 3WFIA 1AGRA 1W36B 3U4CA 1FF9A 3Q41A 5AK4A 3UNXA 1EFRA 2KTQA 5JXIA 2K2WA 2W2XA 3GF4A 3K71B 2BF7A 4EPTA 1A8UA 4L8VA 4EUHA 3UFXA 1U94A 4DSLA 4K05A 5AW1A 1BFUA 3GGGA 3A10A 4RADA 1WCWA 2GN9A 1VA5A 3AEUB 4KQ9A 4IDHA 3VOSA 5IEJA 3W8RA 1FQKA 3EVAA 4ABTA 1LW6E 2P2YA 2E4UA 1FDVA 4QBTA 3ZEIA 3PSPA 1OZGA 3T54A 2MSNA 1PFVA 3NVVA 4BKPA 3DOCA 2HRDA 1M1NB 3WZMA 2FDCA 4HGRA 4L9RA 4TUQA 3RWBA 3TXYA 1RRVA 3GFSA 1NC1A 3LX8A 2QI9C 1ILWA 4NMHA 3C8HA 4Q1EA 2A4MA 4ADSG 2P2ZA 2E8PA 4BQNA 5JDIC 1L4UA 1NQVA 2PKXA 3HZHA 1KWGA 4PC2A 5IDVA 1JIHA 4QJIA 5DK6A 5KNCA 1JTVA 3R7FA 4YROA 2AG0A 2HW8A 3HR4A 4YUAA 4LYEA 3IODA 2O2JA 2G36A 2BEKA 4RBNA 5ER6A 2JLCA 3EEFA 4JL5A 3IAFA 4XYEA 3EODA 3MELA 3AP3A 4I1OA 3L0DA 4B3TB 1XRPA 2QZ4A 1EVIA 3FVRA 1ZN9A 3RJEA 1HPLA 3V4SA 1NUHA 5AVJA 1DKMA 3NALA 3DDSA 1JECA 4EIWA 5B37A 4PY2A 4RAOA 5IKOA 3AUJB 2ECOA 4QUHA 2EX4A 2EHDA 4MZXA 3ZLVA 2WQ6A 1GUDA 1OFUA 4WJ3B 1B43A 4BIIA 2W43A 2JIOA 3GCZA 3ZU5A 4Z4QA 4X61A 1P7YA 4F3KA 4R54A 3OM9A 5AXBA 4BFYA 4YQEA 3CFYA 4CM4A 1W49A 3PMLA 9ICNA 2GM4A 4G4GA 1W6RA 2BFAA 3RT9A 1GDDA 5KQMA 3IKLA 1QUFA 3UA4A 4X8HA 3T3GA 5EKSA 3BRSA 3BGOS 4EY3A 5LZ2A 5IDQA 1V3QE 5AO9A 3OIUA 4L0CA 1SQ5A 4TZKA 3LIPA 3OFKA 2HMWA 1N3BA 2D2IA 3SV3A 4MGZR 1QHEA 2VP0A 3P0JA 1O2DA 4Y2TA 1YACA 1NX9A 2IEIA 2A58A 1WW3A 2VJCA 5AI8A 4F45A 3R9XA 1G5IA 3RSOA 5LP6B 1XRQA 3EAGA 3P0IA 5FBVB 2W58A 4IIJF 2DCUA 1GG8A 3DXZA 4XYBA 3U49A 1VJ1A 2XODA 4ARBA 1IVYA 3HCWA 1FC0A 5J2CA 1Q1BA 4Q4LA 2VL7A 4ISBA 5GZ6A 3G89A 2H52A 1UPFA 1ZU5A 1W8DA 4JEIA 4PWZA 2EARA 4BNFA 1XDBA 4I2IA 1JA1A 1HZZC 5I51A 4CKEA 3DE1X 2YWEA 1J97A 4IJ5A 5KTKA 3IDZA 2ZVQX 4IS7A 3M5DA 4BNDB 2ACWA 3I6QA 2CE2X 2DFTA 4PSAA 2KSOB 2YY6A 2BHRA 3SHQA 5GIPE 9ICLA 2JS7A 2K4HA 1JT2A 3Q8LA 2I2WA 5EYPA 1KOLA 3MD0A 3W6OA 3T5AA 2NZWA 2QMUA 4Q7MB 3BQ7A 1T1EA 2B83A 1YBVA 4F2WA 3SXUB 4DLRA 5J4HA 2W90A 2WYWA 3KOUA 3VHQA 3NNSA 3KOWA 3HKBB 3QOWA 3G85A 5J2IA 2IK8A 1EA7A 1MD9A 1ZHFA 3AILA 2VWPA 2DQSA 2NO0A 2GCOB 1UP7A 1ECFA 5EWLA 4R9NA 2PX5A 4KFCA 1V26A 2GYVA 3ISVA 4IVRA 5KCMA 4ENRA 2HQSA 1KJYA 4RIEA 2SICE 4ZAGA 2XE6A 5LQKA 3EMVA 1WMBA 2D5CA 3DM9B 4G3XA 1NF8A 3B2EA 4GSKA 1FU4A 1ZEJA 1PWXA 4C78A 3HGQA 1TECE 1UC8A 5KFOA 2K5UA 1H8HD 1EQAA 1J24A 1HOTA 4ZVRA 1M6NA 4G0QA 4KRYA 4LK2A 3LP6A 3URMA 4KQIA 3CCCA 4YT5A 8ICSA 4D74A 1YC2A 5DK4A 2QTVA 1MOSA 2BEVB 4EW1A 3I5MA 2JGDB 5G02A 4YP1A 4IVPA 3TIXB 2IYTA 1CZNA 1AXRA 4S1VA 2QARA 2G63A 1LW7A 4ECZA 2XJ9A 4NICA 4LGCA 8ICKA 3TECE 1R0LA 5ALDA 3HWWA 3K0CC 1IZ7A 1NUAA 3FPEA 3CX8A 3GEGA 1BKDR 3V4OA 4JUCA 1RM0A 1JZTA 4ZHQF 3O75A 2W6ID 3GYGA 1G5RA 4XGNA 3S2GA 1AURA 2V58A 2ICAA 1EX6A 3IVGA 1SOUA 4KXFB 2WSIA 2VJBA 4HLDA 4JSRA 3ETRA 3L7IA 5EOVA 1KDYA 2AOXA 1WIWA 1GVNB 4C7BA 1NBHA 4IL5A 3ZS9A 9ICXA 3RVRA 1NVGA 1QNLA 5JHHB 4W5JA 5KFPA 2PL9A 5EP4A 1AF4A 8ABPA 1RVDA 2GD2A 1VMDA 1Z0AA 3MYRA 5H59A 3SQNA 4E1VA 1HURA 5ES4B 2WD9A 2ODQA 4H3KB 4KPGA 5ESRA 1D2GA 1D5WA 3ZN2A 1H69A 1QDEA 3PF9A 5ENZA 5C1DA 4E0BA 4GM4A 5IJWA 1NK6A 1E2EA 4D81A 1BN6A 2BI4A 2OD9A 1PVPA 3CEMA 1Y3FE 1L6RA 3EFOA 2UUPA 4XARA 3UJBA 4MVJP 1J5XA 4QLBA 3LLCA 1HNNA 3ZKAA 2QP4A 4H6VA 1T3TA 2LGJA 1VSQA 2Z5GA 2ZYVX 2PA0A 5C1PA 4I36A 3OZBA 1HYHA 2BHTA 1WUIS 2G9NA 4F4CA 4AJLA 3ZHVA 4Q4JA 2AV6A 3DO6A 5K3DA 2PH1A 2GEFA 2AFHE 5EERA 1X7DA 3KFUF 5B7QA 2D7DA 3LA6A 2Y0BA 3PR3A 1K4MA 2ZYUX 1OYOA 1RYHA 2YUIA 3FUCA 3S1AA 2JFYA 4TKMA 1CQIB 4C7ZA 1G59A 2MU2A 4GMXA 5K8UA 1PDOA 4MWGA 2VHQA 4QPCA 1A1SA 1C1DA 4B75A 1EJ6A 2GPYA 5LDDC 1ZH2A 2ZAMA 4EGFA 5ILOA 4Q44A 2CUTA 2AFVA 3MBYA 3C2QA 4I4LA 1M74A 3QQPA 1P9OA 4MRRA 3FWHA 4RENA 3K1TA 3Q7EA 4ID3A 1IUPA 4GFDA 4RQ0A 1STOA 1YB5A 1CHDA 2FVYA 2Z2IA 1N8SA 4K4HA 1NYTA 9LDTA 4O29A 3H7IA 3TZKA 3M1AA 4MNTA 3WK4A 3MJTA 2RHOA 1NBMD 3NIFB 4CT0A 1SXJC 5FUBA 4E1BA 4R0MA 3Q0EA 2NP6A 3IPYA 2QN6A 1DBWA 1ZHHA 2X4DA 5FL7D 2IYVA 3ICPA 1E1CA 1BVUA 4AYWA 2NX2A 3B8HA 5LJLA 1IZ0A 1PQWA 2QTMA 1WSWA 2WG2A 2XIJA 2B5VA 3OTOB 1HTWA 3T5DA 4O3NA 2Q8PA 3FYUB 3NHLA 2FK8A 3O8DA 4CTKA 1C30A 3HXTA 3B51X 4DWIA 1QIJA 3UMBA 1ORVA 4S24A 4MW9A 2E8OA 4MJ7A 3EH1A 1Y6JA 4DJAA 1WSDA 1USIA 2BN4A 1GGEA 3AWIA 1E77A 1RP7A 2DBVO 3ELWA 2R8IA 5LN1A 1BAPA 3MB5A 4KMMA 4Y0AA 3TBFA 5ARBA 3P9RA 1K7EB 1DC3A 5BW4A 5A3JA 4YRCA 8ICIA 3H2BA 4US0R 1PV2A 2AX4A 4BFUA 3OE1A 4R3UC 5B3LA 1N63A 3QTTA 4EFMA 1THTA 4GRDA 4L6AA 2GXAA 4BB5A 3ENWA 2PXHA 1N0WA 1ZK2A 1CRLA 1OXBB 3GLKA 1AU9A 3A28A 5GV8A 2NYRA 4L5BA 1SUEA 4U0KA 1ZCBA 4FT4A 1US8A 1A7JA 2C07A 4NJEA 1U1DA 1SCIA 1DI0A 4D3XA 4RD4A 3K6JA 4H3SA 4S0XA 4GI5A 1I1HA 2C7PA 4CV2A 2AU0A 3I73A 1BMTA 2RHBA 3DQQA 1PNOA 2VHVA 3JU3A 3RADC 4DMMA 1KEWA 3VVBA 3AVOA 2FPOA 3AUSA 3SX4A 2X0RA 3LA8A 5LC1A 3EPJA 2FG6C 1K3FA 2XGGA 1PS8A 1XDZA 5EJGA 4C7KA 2JAWA 2R1VB 1ZFNA 4JUDX 5B58C 4G1CA 2IVFA 3NWEA 4D82A 1QK4A 4OP3A 5CHGA 2BE9A 3KZOA 2PWYA 2PMKA 1FZTA 2JEYA 4IHAA 2COKA 4IUDS 4IZIA 5D85A 3UB3A 1DRJA 3Q7TA 2IUSA 4S3MA 1U4BA 2JHAA 5EKDA 1QCKA 4M9SA 2DQKA 4C0AC 3G49A 5JAIA 3SEQA 1ZS9A 1Y6ZA 2ZQYA 5JBIA 3TZEA 3LV8A 3TAPA 3SDBA 4EW6A 1JT9A 5JC8A 1Z2DA 3U3XA 1XROA 2K89A 2VSQA 3WDKA 3HKZF 4WNCA 3IBGA 3JQBA 3ROMA 3IO3A 3STYA 2WAQC 5FPSA 1XR3A 4ZCPA 3LE8A 2IYRA 4IIJB 1RWNA 5ITZB 1SZDA 1DQPA 2G1UA 3VPCA 2NZXA 2BM9A 2VZEA 4NZNA 5CDSA 3DDUA 1BFDA 3M2TA 2OHVA 2XBMA 1SBHA 5D1NA 1NUUA 5BN3B 1DAGA 2CN1A 4FYJA 4QZCA 1AUOA 2GEUA 2VAVA 4I1YA 1OREA 4ED1A 3N74A 3LP8A 1OWNA 3QTBA 4W6QA 3IE2A 1D09A 2AR0A 3K70D 4BQIA 3RIYA 5AICA 5AQ1A 4LECA 2WVHA 3J81j 2A4KA 1I14A 1ZXBA 3W1VA 4ZEOA 1UDBA 4O8CA 2Q6KA 4MO9A 1X8XA 1DE0A 2CL0X 2UV8A 3STTA 4HQRA 4X3OA 5I9MA 3Q8KA 4QWAA 2BM8A 3NVMB 1ZH4A 3HCOA 5F98A 3AERA 1QCZA 2ZRBA 1DQZA 3ONDA 4LVOA 1OLXA 1DOZA 1EU1A 2FZKA 5IZCA 4DIKA 2O1XA 1TK5A 3L4SO 4C04A 2KZ3A 2FWAA 3KOOA 4ZCMA 1RYDA 4ZZ2A 4PGAA 5KG6A 4JEMA 3BZKA 2WKPA 5EXDA 1WMDA 5KFIA 3BMNA 2W4QA 4OK3A 3I9LA 1MENA 3K09A 3QNUA 4OPMA 4BMZA 4UXJA 4FHEA 1W1IA 2NSHA 2OCBA 4DQDA 4PYMA 4PZPA 4E5DA 1EK1A 4JYMA 2VXCA 5J0PA 1ZQCA 3EPLA 1PJZA 2CHQA 3OX4A 1BPZA 1Y1KE 4JY7A 3UAYA 3RJ5A 2GFHA 2OHJA 4C9BA 3REQA 2Q4DA 2EX1A 1AROP 5IBQA 1DP4A 4UNPA 3M9OB 3VV2A 3CZQA 1P19A 2H4JA 1VQ1A 1JAYA 3R2JA 1U8TA 4I50F 1XXLA 4NNOA 4EFNA 1Z0SA 2QTFA 3EJWA 2WJPA 1ST2A 1N62A 2ZZKA 4WN9A 3MVEA 4YVFA 4YRZA 3H04A 2O2GA 2DL0A 2NO6A 2KG5A 4OB8A 2W8BB 3OE7A 1SBIA 3N97B 3ZHQA 2OZPA 2GDZA 5DX8A 3VKWA 5AM4A 4RJTA 4D98A 1A9XB 4BNTA 2ISOA 5A5DA 2VJMB 3C1YA 3NG1A 1SURA 5EWGA 2DGZA 2FWRA 1RYYA 3EXHB 1NT4A 3K2EA 4K3UA 1XAIA 4LF9B 1NDQA 4HDMB 2CVHA 4GU5A 2OZLB 2E2WA 1TQDA 3W2IA 2DSTA 1JG2A 3BD7A 4D99A 5EQFA 2I6FA 5KG5A 1IN4A 3AIKA 3FHLA 1XA4A 4AXXA 3O8LA 2ABWA 4P3PA 5J2KA 5ICGA 4A0SA 3TH5A 3MTBA 3KDSE 5LA6A 1MJFA 5D3QA 3CRVA 4QYIB 3OQJA 5JLAA 3D6JA 5K0EA 4OJYA 2DFNA 3RS4A 2ZATA 4EG4A 4OREX 3RLIA 3SDZA 4GYJA 3CXUA 1N60A 5ALNA 4LDPA 2GBIA 4KVFA 4TYQA 3BCHA 4F1JA 2GYYA 3ZDYB 4OQXA 2DFLA 4MR9B 2JZNA 2RBKA 5L1KA 2COUA 3DZGA 1AKNA 1NW8A 1AZTA 2HF8A 4J0QA 2HBQA 5D2CA 4HF7A 2BZGA 3ZU4A 2OCIA 1DELA 3X2FA 2WHPA 2W9BB 4I2GA 4OOFA 4WEQA 4GKBA 1NI4B 1RCUA 2D1YA 5K0BA 1LSUA 2XZPA 3OCCA 2X3FA 5ICCA 4Y2XA 3PUVA 4Y7DA 3QVMA 1N48A 4YMSA 5K4GA 4CEJB 1FDWA 4U7CA 3AF2A 4BB6A 2X58A 3FWKA 2CFOA 2XUFA 1R0SA 4ZT6A 2JEOA 4MI6A 3I05A 9MHTA 3MNFA 1R4MA 3DBHB 3V3TA 2XXJA 3TD2A 3MRXA 3PQ7A 1V96A 5JALA 5AJYA 2FSGA 2FWIA 5DYTA 3V48A 2XY6A 2Z95A 4P2HA 1IUKA 3ESCA 3L0SA 1AS3A 4E6EA 1OVMA 3MBOA 1D2HA 1B74A 1WWUA 4G9GA 3KELA 5EXEA 3AONB 4XJXA 4AZ3B 4HYQA 1JFFA 2J3KA 1V9PA 3PA6A 4F4XA 3UJ8A 3KB8A 4EQ6A 4XLZA 1G3RA 1LUAA 2ADMA 2XNDD 3ID6C 2WLSA 1HE2A 4MRMA 4ALNA 4M0FA 2H5LA 3EXFA 2NO9A 4L75A 1GTRA 1PR2A 4RV4A 1I8TA 2KPOA 2C5EA 4CIWA 1YUBA 4S05A 1JALA 4N3AA 4M8NE 1VIDA 3BAFA 5AR1A 4UEOA 4DCUA 2HCTA 5KT5A 1NE2A 2PFGA 1KY4A 2IL1A 3IMGA 3U13A 2QVCA 3U09A 4JI5B 5EJ6A 1QP0A 3HO8A 2IU3A 3B70A 3QVVA 3RYHB 5CVVA 3VPHA 2OLJA 2ZBRA 5KWSA 4TLEA 3HK2A 3FFAA 3K0FA 3TGWA 1NKVA 3L46A 2RONA 2PXXA 2EJVA 5IYZF 1VKNA 2ERXA 1XTQA 1Z37A 4A6XA 1K98A 4NLCA 4GBJA 1FVXA 2GS9A 2NV2B 4MYDA 4INPA 2XUKA 2OVFA 1P6XA 2J7PD 4X7PA 1B73A 5BOSA 1TKBA 4NAVA 4UZFA 4WJZA 3RW9A 1P62B 4RETA 2PMBA 1ABBA 1XT6A 1QKKA 4UAYA 1YL6A 2E21A 4MPRA 3R76A 3Q3JB 4FMCB 4UAWA 1V2HE 3W5JA 1M34B 4KLHA 3WWZA 3VSAA 3E9RA 4R8LA 1VIVA 4PJ0U 2W6NA 2C5BA 2RHCA 1PT8A 3JARB 1O96A 3OU6A 3SY8A 3WG9A 1TO1E 2F67A 2FN3A 5E4YA 3R44A 3DONA 3RSLA 1G60A 4TKVB 2ZIAA 2J32A 1QTNA 4RJJA 2YOGA 2IWHA 1LNZA 4RK7A 3SR6A 2WAMA 1FO4A 3TR6A 1W1UA 1FUKA 1U0OC 2PX8A 3QVGA 4WXYB 4MB6A 4HGZA 2QBYB 1SUAA 4DMLA 1JGTA 1G5FA 5ALIA 4C6SA 2IDKA 2DTEA 2HJHA 5I7VA 3PEVA 4LI3X 1U3VA 2AJLI 5AI6A 2AIRA 4IIBA 1TEZA 1MH1A 4DAEA 1YKGA 3JTMA 1P3JA 2CWDA 1SB9A 5KX5A 3SOPA 1UMDB 4GMKA 1JR2A 1GN9A 3QELA 2QR3A 4P93A 5JLJA 2FPWA 1O7JA 721PA 1KY2A 3H16A 2Y0SF 4D9CA 2YVUA 4UCQA 5G53C 4M47A 2IZ5A 3QWFA 4YAKA 1MJGA 1QAOA 5FB3A 3TD9A 2RGNA 3ET5A 3HCFA 4HWTA 4WZAA 3OOEA 3X43A 1K6IA 3O4IA 5AK0A 4NXNB 3N5CA 4FFMA 3LSYA 5AKXA 3OZ7A 4O4LF 4QPJC 2HJGA 5CLIA 3PJRA 4HADA 3EW9A 1L8QA 4FP9A 2SKCA 4PN7A 1U2ZA 4FW9A 1RLOA 3RSGA 3NWOA 3JV7A 3CRQA 4DFJA 2GXUA 1V71A 1J39A 1Q1QA 1XELA 2QGFA 2KZZA 4TYWA 2BCUA 4NL9A 2AVDA 5JUMA 5KFWA 5T57A 2P3OA 1E4YA 3ZHXA 5AW6A 1N0HA 3TPZA 4X00A 3HG7A 1CY7A 2J09A 3Q3CA 2IU4A 3DAGA 1XDWA 1W9MA 2PI4A 3ZWMA 2WUGA 3K5IA 2WOOA 3WKAA 4D0SA 2R00A 4MARA 4HZGA 4QZGA 4PG6A 2NXCA 3VR4A 1CR1A 3H97A 4G4JA 3RQIA 4JNKA 1KKUA 3D8HA 3FLEA 5ECWA 2YYYA 4JLMA 3KEMA 3FROA 4Z1MD 1T2UA 4ZYTA 1X7GA 4RF4A 4L95C 4UHFA 2Z7JA 1JJBA 5ALMA 4KX5A 5E6SB 2PUTA 4RMNA 1ONBA 3E23A 3C48A 4N8EA 2A59A 3D1LA 4L4ZA 4ZRNA 5TQ0A 2Y1WA 4GW3A 1PFKA 1Q16A 3T8YA 3SZ2A 5ELLA 5C8XA 1LNSA 2AZXA 4E5PA 2J3HA 3SGLA 4XA8A 2XB2A 1CJKC 2JJ1D 1ZR4A 3FNBA 5C5IA 4KC0A 3MFIA 2ONCA 5EIWA 5L3ZA 3W78A 1CQXA 4OXKA 2ZE5A 5BQ5A 3P71T 4LXTA 3P9PA 2XI4A 4RGBA 3IV6A 3BB3A 1LD3A 3AU8A 4LMAA 5BUQA 2MTBA 3BDVA 1KQFA 3ZXXA 1T8EA 4GF5A 4Y6SA 3VX4A 1GA6A 3RK1A 2YB4A 3GA7A 3F2IA 2F1KA 4JVSB 4K86A 4I1SA 3A9TA 1R7RA 1I0LA 1NKCA 4FNAA 1YTLA 1L5MA 2ANCA 3QOFA 4AG5A 5IM4F 1SKAA 4PNPA 3EXIB 1M83A 2PGDA 3P94A 5JAOA 1JX6A 3KSUA 4J0DA 1SVSA 1ZQSA 1QZTA 4UVDA 3WGHA 2G72A 3RC1A 5AUQA 1PL8A 2C97A 1K27A 2J9FA 4L28A 2NUBA 3U7IA 4MW1A 3AKZA 1VBFA 1JMYA 1U0BB 3KUUA 4KLOA 5D84A 1KAGA 4HTFB 3FC4A 4CV3A 3OWHA 1PJLA 3KJNA 5JAQA 3BQ2A 4FCTA 4BZZA 4YMLA 1QU2A 3KPUA 1VHDA 3L7KA 5DGDA 2IXAA 1REQB 3U4IA 3U37A 2AA3A 5KYGA 3WQRA 5DBBA 1UBFA 2X8LA 3IKJA 4EL5A 4M53A 4PNEA 1JUDA 5FFNA 4RNCA 4HR7A 4AK9A 4KWTA 1YA6A 3NB0A 1KO5A 3QXXA 3ZH9B 2WV7A 2AK2A 4MGEA 3TARA 1ABFA 3TLYA 4DQRA 1XLUA 1KVSA 4RS3A 4KI0A 1RPAA 1NVUQ 5KREA 1PI3A 4U7DA 5JWHA 4M9UA 5EHGA 2OORC 4WECA 2HWKA 2YXEA 1J5PA 4JV2A 3PX2A 3K5HA 2E89A 1OXKB 1E0KA 4ZQIA 4EKEA 1Q7GA 3GJ0A 4HV4A 5JAMA 5KFTA 3VJLA 4GFJA 3S2IA 3BYZA 1FMLA 2ZWAA 1P1IA 1JSRA 5IFKA 3K9BA 3HRIA 4EG0A 1XKTA 1S5PA 3B52X 5FULA 1E2UA 5FEMA 4IIHA 3BZWA 4N9QA 3B82A 4P80A 1WP4A 5J63A 1H5NA 2AOUA 1I7LA 2NACA 5K3OA 2IW1A 2PS9A 4JLKA 3GDGA 3RH0A 6NULA 3FRIA 4YRSA 5NULA 1EIZA 3I2YX 2HMUA 2GJ8A 3DBIA 2RHRA 8ICNA 4ZV4A 2KBFA 3Q7RA 4F3OA 4YXJA 2ERCA 3WGVA 2DMRA 3AR7A 5AI5A 1E66A 2YV5A 3BIOA 3D3JA 4R81A 5KINB 2YXPX 2O06A 1CNEA 5BNWA 3PYLA 5DB7A 5CA1F 2J41A 3U61B 1YQEA 2J9YB 1I24A 4PSVA 5B36A 3BXZA 4P3KA 1VM6A 4MMXB 3IDAA 2GH1A 4GMFA 4WKNA 5JCJD 3U1BA 2IPNA 3DC2A 1OLSA 2JIRA 1E7YA 5ELMA 1FU7A 2A1UB 4J29A 3WP1B 1FU8A 3FPBA 4C3ZA 2HJRA 4J76A 4LCEA 2AS0A 1WZUA 4QWMA 3O73A 5IYZB 4N7JA 3JZDA 1NR5A 3ZDZB 1YZYA 4HVLA 2WV9A 3PEUA 3GIDA 1DCKA 2WT8A 4J16C 4PCAA 2ATLA 1O57A 2IIQA 4L8WB 1XHEA 1Q6YA 2M32A 4W7SA 3WK6A 1UEIA 4O4IA 5B1DA 2HOIA 3ZTWA 1Q1ZA 3F5AA 3WU2U 2BW0A 4RTQA 4LOJA 1XQVA 2OAQ1 3JD4A 2VVTA 3QU4A 1UDRA 1V7PC 4YCAA 1JW9B 1HYQA 2ORWA 2QM7A 1U8FO 4IQVA 3OVMA 4C4ZA 4CCSA 2PZ8A 3G5LA 2C57A 2RJ3A 4M38A 2PRZA 4OFXA 2HSZA 2X1VA 5DNDA 1GGNA 1DZ3A 4GVPA 5CAEA 2B3TA 5FRDA 1P5ZB 3T3DA 3X1YA 2QY6A 3M0EA 1OT3A 1E1RD 4N3BA 4OJMX 3B3FA 4DLBA 4QXMA 4YBRA 4Y6RA 4OXNA 5MFPA 2LKYA 3N2EA 2P66A 1RBZA 2VBGA 3LYLA 2OQRA 1KSHA 2VZ9A 3Q7SA 1DARA 3AKDA 5P8WA 3IE0A 1PWHA 4RESA 1MXHA 1E3LA 4FQ7A 2NU9B 4ZZIA 1ESZA 1J20A 4N3GA 4Q5IA 4IZOA 1S6YA 3AFOA 3W8EA 1PZNA 3ND7A 2KB0A 2NZYA 3TW8A 4G24A 3QI7A 4OYRA 1D8TA 4IHKA 2Q07A 4F92B 2D1TA 1UJCA 1JRPA 2M6RA 5DX1A 2VDMB 3UHOA 2BIFA 1RWMA 5IT4A 3GLIA 1JXMA 1SZHA 2HVHA 2A1IA 2PZMA 2FMKA 3SG0A 2VRCD 2IHTA 2EIHA 4F93B 3LZCA 3N70A 3B12A 3PR2B 3UV7A 4LYGA 4JMLA 3NEYA 5L8VA 1APBA 2QRUA 3VI3B 3S40A 1NLYA 1NK9A 1EI9A 2FXIA 3OI7A 3RK4A 4D02A 4YECA 3G02A 4AP6A 3TNJA 4HJXA 1PT6A 1EXDA 4RY2A 3CV3A 4TTAA 3RVDA 4QOSA 1JJAA 4D4GA 3KQHA 5FWXB 1PZEA 1GPMA 4LZLA 5H81A 5ANRB 4DLSA 1BVRA 3AQEA 3RAGA 3CVWA 5DYNA 6ADHA 2D54A 1LZLA 2PSHA 1ITZA 3I04M 3DHWC 1FIQA 3MJFA 1WCXA 2FEAA 3H75A 2XOEA 1FQJA 3GDOA 4F6LA 2GPNA 1GLVA 1TCVA 4PLYA 3GJZA 1O8BA 2C96A 4Z6KA 3W5CA 3ER8A 2NU7A 1YAJA 3ESDA 3VU8A 4EGAA 5A7FA 1WXQA 3IQFA 1JIXA 2QTGA 4U2BA 2HA4A 2Q6LA 3GVIA 4XR4A 2BCJQ 3LQYA 1ZJ5A 4M21A 3A1DA 3T9DA 3IPXA 1CUIA 1FMJA 3W7AA 2D7CA 2DE0X 4C4OA 4EPRA 1UPUA 4PC1A 1GFZA 2CLEB 4GX1A 3ABSB 4NU5A 4RQAA 4LE1A 1GPKA 1O89A 3I4CA 2HHCA 2BUBA 2VO1A 3BTUA 1X6JA 2DJIA 2R9VA 5DVZA 3R3SA 3CZ4A 1DHTA 4FYKA 4ALIA 4DQQA 3OUUA 4BMYA 4KNWA 2XICA 1JHRA 5ARDA 4DEYA 5ALXA 1CQJB 3L8CA 3NC0C 3Q88A 1UBLS 3RABA 1ONSA 2J31A 1T5DX 5AKHA 4O3QA 1MEEA 2O1EA 4Z3KA 4KVGA 4EDHA 1VBNA 4FN5A 8ADHA 5REQB 2ZE8A 3HUFA 5KFMA 4I19A 3V2IA 4US1R 4TTRA 5FIUA 1F06A 2XMCA 3IN5A 1PT9A 3ZQJA 3NEAA 3E84A 2HIGA 3IPLA 1D1TA 1ZQ1A 2LPMA 3CW2A 2AWNA 5MN4A 4EP1A 4P34A 5K0FA 3BULA 1JSLA 3TQ1A 4B82A 3SE0A 4YAGA 5A0LA 3VSBA 4CHTA 3RB4A 2DWPA 2MU1A 4K0RA 4MGKR 1M34E 2PZLA 1TUIA 1X1BA 3MT8A 2ZYRA 4K9PA 3M6VA 3RUIA 5FTLA 5CHYA 2BZ0A 1IBKB 5MFZA 1XBTA 2V6GA 4F7WA 1V7ZA 5HS4A 2A6PA 2IXTA 3DV0A 2X0KA 1HT3A 3PYXA 1Q7RA 4RGVA 2C99A 4D8UA 1MZPA 1R18A 2A7QA 3AINA 1DT5A 3K6SA 1OX4A 2EQYA 4O3FA 4TTSA 1P2VA 4FKBA 3ORSA 4WVLA 1M2OA 3MUOA 3H1AA 2YWGA 2AMVA 3RBEA 3AF5A 3QSGA 3QPCA 1BCRB 1XOIA 4L8GA 1VRVA 3RKUA 1LJUA 4FSHA 3PSFA 1N2ZA 1DIHA 4IFBA 4QFMA 1F4LA 3AJAA 4I29A 1SEVA 3UWPA 3ZWPA 3NDRA 3KUKA 4QDUA 4K6MA 4DPLA 2VF2A 3N87A 4E5YA 2HF2A 1H8HA 2FETA 3ESBA 2WAOA 4QL3A 1XX6A 3MBKA 3NHMA 1WB4A 1RM3A 5CJJA 5TMBA 3OJCA 5IKEA 3O4HA 3IOCA 1DUIA 2F00A 4US8A 4MUMA 1X0XA 2WAXA 5FV4A 1OE0A 4PAGA 2PMDA 2NQTA 3SFTA 1VCHA 1UMKA 3D0KA 2GAFA 4P53A 2QK4A 4Q34A 2FI1A 3O91A 5EJ7A 1X70A 3GFRA 4JVLA 1L1RA 5J0YA 1TLFA 4RD2A 5KYTA 1WZ2A 5HFNA 1U3GA 2W6IA 3LQ4A 5DX0A 1ISRA 4M6WB 1Z0KA 5JHGB 1KR2A 2W22A 1SIWA 2CLSA 5FOWA 3CH4B 1W85B 5H68A 4ZD6A 4QIWC 3F6CA 4YJKA 4TYYA 3PHBE 5G40A 4F3TA 4QNNA 3D3KA 3PENA 1QF9A 5HF5A 2D8MA 1HETA 2MSDB 1X3SA 4AL4A 2WNHA 4X7MA 2W6OA 5HA5A 5EC8A 4YAWA 4HCJA 4MO2A 1QAQA 2FMSA 1G6KA 1JFVA 1A9QA 1QIFA 2P4UA 4GGMX 2BEUB 5CA1B 1VI6A 1EFLA 2C4KA 1I6LA 4J75A 2HBZA 2XUGA 3A3NA 5B2ZA 1Z6PA 1H42A 2GD0A 3QLEA 2CXPA 1FPQA 5K01A 1L4FA 3AVUA 3SZ3A 3TKYA 1WDMA 1XCOA 3LWZA 4COOA 2JC3A 5C8VA 3UJDA 1JTFA 2Y66A 3RAJA 1VGRA 3EDYA 2X7XA 2C2GA 2AC4A 4H1VA 3KZ1E 3KKLA 3NDJA 3PFNA 1ZQYA 5IN5A 3P9QA 2C42A 2BC9A 4M8LA 1ZCZA 4J49A 3URKA 2CV1A 2C7RA 4DCTA 4ZJPA 1WY7A 3BCSA 1F2UA 4TTIA 3B89A 3M3HA 3WIVA 1WCLA 3MOGA 1QK3A 4RJKA 3HY4A 4WNYA 4MW7A 3SWWA 4QECA 1V4VA 3BERA 2HF7A 4GPTA 3P0EA 1NYQA 4HJRA 4XYGA 3I6BA 4X8LA 2Y9MB 5IIJA 4PYKA 4AN1A 4REOA 1O4WA 4KMUA 3UMVA 2DG2A 2R3SA 2PZAA 1K1QA 4GX0A 3DG9A 4LOAA 2O8FA 3V00A 3P2YA 3KJEA 3EQ8A 3GVXA 2WA2A 3DD5A 4IMJB 4D44A 1OFGA 4P4UA 2UDPA 1T6XA 2GSDA 4FFPA 4LNHA 4PV7A 4HPWA 4Y2UA 4IILA 1U31A 4H7KA 2F2TA 4P1ZA 5HOQA 2CLIB 4M04A 3OSUA 1YR2A 2P6OA 2P78A 2PDAA 3MFQA 1DQSA 2V7BA 2HIAA 2REBA 2B82A 1Z13A 1NBMA 1WVGA 3CPHA 4Q4HA 3G8BA 4KPEC 3OA0A 5E9QA 3JQDA 1VJCA 3FCXA 4F4HA 4ND3A 5LSAA 4Y2QA 1DRUA 4P86A 2XF2A 3COVA 4BLRA 4PGXA 4Q7EA 5IBPA 2IKQA 2B4YA 5HQ3A 1GV1A 2FZCA 4AWBA 1N6RA 5CW1A 2JATA 621PA 3VSDA 4I5GA 5ERXA 4EFDA 5A1TA 1Y8QB 2FR8C 3OCZA 2WB1C 2YDXA 3AEZA 1U1EA 2J9ZB 3QEMB 1ULUA 4HDQB 3INTA 2FSFA 3MXOA 3T95A 1AY0A 1KERA 3D7LA 1SVLA 4XCVA 4PBSA 3WLHA 1C9EA 4QNMA 4B44A 4MLDA 2H63A 3CUTA 2GLEA 5ALRA 1XNQB 3RUDA 5EQDA 1LDMA 2ESEA 1SUSA 3UPDA 3HP1A 4EHNA 3IQWA 1Y0BA 2WWWA 2IS2A 1JVSA 3A9WA 3ZS8A 3ENNA 3G5AA 2EX0A 3D43A 3HR8A 1MT3A 3TIVA 2XX3A 4Y1EA 5FI1B 5JSZA 4HN9A 4WFKA 2PKYX 1FTQA 1EUCB 5BW8A 4OF4A 2F17A 3EZNA 2I87A 4HWKA 2EQBA 2B4RO 1TGVA 4XX1A 4DCSA 5JDCA 3HJUA 2QD3A 8ICAA 3L5KA 2W2TA 3TR0A 2HMAA 4M88A 3F6BX 4MQFB 5CJPA 3VYVA 2C88A 3VZQA 2Y93A 3FGOA 1QQ7A 1NK4A 1KZ9A 5FTMA 1LRLA 5KZMB 1TT5B 1A1VA 1FTWA 3T1NA 1FBTA 1R6VA 2Q49A 3FPGA 5DI3A 1L3UA 1G4HA 3VC1A 2C03A 4F38A 5FA5A 4HGNA 1C5KA 3BSFA 5DNYB 3JQBC 1RI4A 3C43A 4XYMA 1N3IA 4YJ3A 1ZUIA 4QGFA 2YN2A 3KXLA 3GCXA 4P83A 5J4LA 3EVDA 5M3BA 2Z3VA 1C4KA 1KLNA 2RH8A 2PKCA 3SC2B 4Z2YA 2EYUA 4Y6PA 1PEAA 3TX6A 3P9XA 1EUDA 2VRNA 1YSCA 3DHVA 1UOPA 2JZBB 4K6KA 4EGQA 2L69A 3RWOA 5LLSA 2V4UA 3W77A 4KDCA 3QA9A 3GJ5A 5CXXA 4US2R 2HDWA 3KQWA 4B3MB 3STVA 4P38A 4NECA 4O1HA 1KK3A 3FHTA 1CUAA 2J9GA 3AUFA 2WF5A 1YH3A 3SBDA 1JN0A 1OVGA 3LC7O 3O5AA 2XRYA 1PUIA 4ZVSA 4KBGA 3A8TA 2BFDB 3FIJA 3ROKA 1NZJA 5HM8A 2A0WA 3PFHA 1NYLA 2FN9A 3BVPA 3SJCA 4CQMD 1DINA 1FA9A 3EIWA 1QF7A 1IY0A 5EMMA 4DSAA 4H7EA 3RRBA 5DCUA 2EBHX 1DL5A 2JKVA 5KS2A 4ZEXA 1A77A 5CTAA 2CVQA 5BSGA 3GAMA 3NI2A 4TWAA 4MUHA 1AK1A 3GWZA 5IZCC 1YJAA 4OHCA 3TKAA 3A6DA 4NS1A 2IIPA 1EGAA 4QTUB 4C29A 2M1ZA 3QPVA 3FCEA 1Z15A 2V6MA 4IF6A 1MAAA 4UTXA 2Y1FA 1EZ4A 3QW2A 1V8ZA 3EVEA 2W71A 5KOHB 4YAOA 4MV6A 1VECA 1R16A 1ZESA 4WNAB 5H80A 4LZGA 1IJBA 4L9AA 2CXQA 2F59A 1GJRA 1L4BA 2YWXA 4BQFA 1VLLA 1SUPA 1N75A 9ABPA 4GIBA 4KHZA 4D8YA 3CM0A 4HX5A 4DWOA 2G6BA 4MIEA 2ZTHA 4FLMA 2WZQA 2X14A 2UZAA 3G0OA 1E98A 4OQMA 4UUPA 1ADFA 1GXSA 3I30X 3ASZA 1FJ2A 1PBNA 3MOSA 1HYGA 4JL8A 5EJIA 4PS0A 4QPPA 1X6IA 3T7RA 1Z8FA 3LLMA 8ICYA 1E2NA 2OFWA 2ZKIA 4NTZA 4JQZA 2JFNA 4E2XA 4E2FA 3KQQA 3ROQA 2EH9A 2IP4A 2ADFA 1ADBA 3DCJA 5KU1A 3EUFA 1J99A 1N61A 2FSVA 5TNXA 2XWJI 1WV1A 2UYQA 1ZSVA 3N8NA 1F2TB 4J0KA 3W6PA 2B0JA 2GAAA 3MJ4A 1KP9A 3PV8A 3UIEA 4FMCF 3PY8A 1AHHA 3WYGA 4B7ZA 2FZWA 2WDZA 3VVCA 1X77A 3PR1A 2PLAA 3GDHA 2VPPA 5LPNA 4GKJB 3KJFA 3RJZA 5MF6A 1I7SB 2JI9A 3TANA 5ULLA 4PBTA 4JJ8A 4R1SA 5CH3A 2O3SA 2D8AA 3G6YA 4XEHA 9ICPA 4KXWA 3FPHA 2CRXA 3SM9A 2X8JA 1G5PA 3MWYW 3BS7A 4Y2PA 5AJVB 1ZQRA 5TB5A 1P74A 4NWIA 3ZBTA 1ZKDA 3CT4A 4DLAA 3BS4A 1U2GA 2OHHA 3L7OA 2GWHA 1HRDA 4AQ7A 1CUVA 4D9HA 3K1RB 5GVSA 2P27A 2C9CA 3C1AA 3NOVA 5JZ9A 3G5TA 4BBPA 4HZUA 1PK1A 2QZSA 3B3QA 4PCUA 1E2PA 3ADOA 5D86A 3U17A 2V54A 5A6SA 1AMUA 5KDOA 4QUIA 1WRBA 5CTJA 3RAPR 1X3LA 2G8NA 3M6FA 4H15A 2RSLA 1ZJYA 1JEQA 3L06A 5ITWA 3TXAA 4WZBB 4AJJA 1DAHA 4CL0A 5FWYA 4JI1B 4BU1A 3ZYZA 3ZLUA 2R8EA 4I14A 1L5GB 4C4TA 3LDHA 5CG2A 1J9EA 1HY3A 4YT2A 1J5EB 1CYEA 1L7EA 4YDRA 4MLPA 3GQCA 3E22A 3P2EA 3G23A 1Q0RA 3OURA 2JFHA 1EFUA 4MQ5A 1U8UA 2LE0A 4ENVA 4XVHA 1FTNA 1P4JA 3ISJA 4BB9A 2HLNA 4Z4FA 4UHCA 3E3AA 4D42A 3KV3O 4IGFA 1PR0A 1WW2A 1ULSA 4N9WA 1D4OA 4OI0A 3WO0A 1BEUB 4OI4A 1AKRA 4RFSA 4XM0A 1KFEB 2PZKA 2OXOA 2MYPA 2ASJA 2Y1CA 4C07A 3ZI4A 1CUZA 3PGVA 1S2NA 3QYAA 3FD8A 4B3FX 4RPXA 1Z5UA 5F21A 1ZYQA 1QRSA 2I67A 4DSZA 2C2XA 2ZWMA 1UOOA 3WNQA 4KFSA 4TL8A 3HCAA 4OQPA 2D2XA 3UPTA 5LQCA 2IYSA 1ZNYA 2A0KA 4FW8A 4N76A 3TQTA 1JLSA 1MX3A 4PFJA 1WV0A 1YDMA 1F44A 1VRCA 2GN1A 3DCYA 1KK0A 1T0PA 2ZPTX 2VWQA 4TKUA 3GEHA 5KQLA 1C1XA 1P2TA 3NAZA 2QYTA 2XITA 3V6HA 1O6FA 3KT3A 3SJAA 1IBSA 2VCEA 4KQ2A 4KXLA 5BRJA 2A9KA 2UYOA 4QJBA 5A4KA 1GNSA 5JCXA 3HQ4O 2Q1WA 2OO5A 4ECRA 3LFHA 4QBFA 5ALZA 2XB8A 4I2AA 1WZEA 2M1XA 4XA5A 4V0KA 4K6HA 3OKPA 3USZA 3CNNA 3DLHA 1EFPB 3M70A 1NF9A 2XNDA 3ENZA 2PU5A 5BWOA 4UJ3A 1ZITA 1F0MA 2CMFA 2GPWA 5KCZA 5CLHA 1ZDMA 3ZZTA 3PEEA 5DLPA 5BW5A 3NASA 1RE1A 4PQYA 4Z7NB 4YV0A 4NX2A 1G8KA 3I2JA 5K8VA 2YZGA 3PP8A 1Z5NA 3RAXA 3F7MA 3EPHA 3F6PA 4HRVA 4B5KA 3P0HA 1P0CA 4DBLC 2BYTA 3KQLA 1ULZA 5KFFA 2HEIA 4F2RA 1CF4A 5DASA 3AUAA 2WU4A 1YBMA 4GS5A 5JROA 1S77D 1BKYA 2PBZA 3ICCA 1EK5A 1QYXA 4MINA 4PX2A 2ZLBA 3STWA 2UVPB 1K6EA 1WKCA 1N77A 2QRMA 3IBYA 4CQLA 3NYIA 3DFUA 3H7AA 2C2OA 1CY1A 2Q29A 1JRLA 1NVKA 1ZQPA 3M82A 3QVUA 2NG1A 4FMBB 4HQNA 2IBTA 2I0FA 3M89A 1BMFD 3SZOA 3FFTA 2J7PA 2DOKA 4B85A 2DPGA 4ITVA 4NENB 1DCMA 3C21A 2LDXA 2QW0X 1USVA 7ICLA 2VTVA 4HAWA 1E7WA 2I6GA 2R8HA 2RB5A 3SQIA 3C8DA 3T94A 1T5IA 1TYAE 3IXLA 3FTCA 3TZQA 3M9MB 4JX8A 3NHAA 4A8JA 3W3ZB 3WNZA 5J8YC 1QO7A 4CETA 1A5AB 2D3DA 3VU1A 2QE6A 1SVWA 2C7VA 3M9LA 3CZ5A 1ZBDA 4C0KA 1LLFA 4ETWA 3ETNA 1CTQA 1PJ4A 3MINB 1BNOA 1Z8NA 2CJWB 1FDTA 3VC3A 4M9CA 3BG5A 2RGNC 1VXOA 4NEGA 4FXOA 2PR2A 3I6YA 1RBYA 3K16A 2PWBA 4ZCSA 4GQBA 1EX9A 2QRNA 2REXB 1UH5A 1K08A 4F96A 2LW7A 1SPXA 3HRHA 1Z56C 4OHKA 1QIEA 4KQXA 3MF4A 1AZSC 4B84A 1ZHOA 3CLRC 2LIPA 4EX7A 3UGJA 2FSSA 2XKAA 3C1ZA 3ZZ1A 3QUBA 3GMIA 2I1LA 4W99A 4UOZA 4BJ6A 1MQ8B 5IDWA 5HEKA 3V8BA 1B8UA 1I30A 4LZZA 1N2CA 4X7RA 4EG3A 1XCPA 4NL9C 1ZAYA 3MTEA 2XTZA 1F12A 4BLSA 3T3HA 1F8XA 2CZCA 3HLYA 1XU4A 3JRWA 4FDLA 3IBSA 3DBRA 1J56A 3PPVA 4V0LA 2OQVA 2BMFA 4BXOB 3C39A 1ZRHA 4GI7A 1TKRA 2O7VA 1DBRA 2R00C 4OMFG 1XYVA 2H3EA 1BA2A 1BCSA 3EZ9A 3HKEA 1FFDA 4PVDA 1SR8A 4KZKA 3TMYA 5CB4A 2IITA 5K7SA 3OIYA 1E3WA 1RCFA 1UXGA 2YQ4A 1M7GA 1MB3A 1U3WA 2YHUA 1QZXA 3BF7A 3NPAA 3OP4A 4B2IA 4L50A 4B71A 3DXXA 3IM1A 2XMRA 1YZHA 3A6JA 2G67A 5EUCA 1YF3A 3KVOA 1TCUA 3ZWBA 221PA 4EABA 2CMHA 5DHSA 1CF9A 3UV3A 4EFKA 4N3CA 2ZSKA 2WAYA 3VH2A 4EVSA 1ULBA 4KXVA 1ZM4A 5INTA 9ICRA 2CNDA 2C5LA 1L5HB 2YZMA 2FPMA 4JXXA 3BXPA 3NBAA 1N2IA 2WTXA 4EJSB 2PBFA 2EVWX 5K09A 1H0SA 1J06A 1SBZA 4X1KA 4Z1MA 2F1HA 4LVNA 4GKKB 4DLXA 1YCFA 1J6UA 1ZQ9A 3TQOA 3MJSA 2ZR7A 1WQ4A 2Z5VA 7ICPA 4I4CA 1HH4A 1KU6A 4AP5A 3CUYA 5T6BA 4YMGA 1RBMA 2GLUA 3KSRA 1KZ4A 5C5EA 4WLFA 3ODGA 3L8DA 1P9LA 1EFTA 2WIAA 1FFXA 4DNFA 1JIUA 2PX3A 3CLVA 1H2FA 2WYOA 1TVKB 4IQ8A 2I03A 1QM5A 3P2KA 3RCBA 4F3RA 2BAGA 4Y9TA 3AG5A 5K3FB 2JJ1A 5DB9A 1LBQA 2WWIA 2DH5A 1JQLB 2GYUA 1BXGA 5F7OA 2GR9A 1G9XA 3CB2A 2ZIFA 1EFVB 2OHXA 1CZUA 3VPGA 1PTJA 3HVRA 3OGUA 3L43A 4JZKA 4NV0A 2HPVA 1IY9A 3JWJA 4NBUA 2QGZA 3F5DA 3OTHA 4FWIB 4D3YA 1PX0A 5LZ9A 4BO1A 4KR3A 2H2AA 3F5FA 1W48A 5SV2A 1RYNA 1UJ5A 8ICVA 2FG5A 4CMJA 2V96A 5JNWA 5JFTA 3MTJA 2E8MA 4ZN6A 4JS0A 2DHEA 1RKVA 1EVKA 2P40A 3K2IA 3E9EA 3DDCA 3UKDA 3QMMA 2R6DA 5JD3A 4TS9A 4UB5A 5AW9A 4FFDA 2W2KB 1IEQA 5FLYA 1Z83A 1RC1A 3P0FA 2XQVA 1N5IA 1KJQA 3Q12A 4YCBA 4CL3A 2G7ZA 4LTNA 2PKRA 4RY9A 1JLRA 5CVEA 2Q5EA 4ODIA 5DDYA 1V48A 3MWEB 2WJZB 1L3BA 2PL1A 4R7TA 1YE8A 3MWJA 4HUQA 1UK9A 4WWHA 3GILA 3PW0A 4OHXA 4OYLA 5HCUA 4E1AA 5ADWA 2O8BA 4HAIA 4JI3B 1GU1A 2Q21A 3KEFA 1JQKA 5F9NA 3L4PA 4UUOA 5J0SA 4E0DA 4U7WA 3D4OA 2W48A 3X44A 2GFIA 1D8YA 2V7VA 3QFFA 2NXNA 3MS2A 2X6TA 4KHPB 5DM2A 1CETA 1HQDA 4RQ5A 3L6DA 4R2KA 1RXSA 2IXFA 1T7PA 2OKCA 3DT9A 5AVVA 3CLSD 4X91A 2XZTA 3P97A 5K3AA 1RIFA 2I7TA 3ROXA 1VDZA 5IAAA 1VG1A 2VNJA 4KR2A 3AV3A 4JBLA 3CVJA 3I61A 4CKWB 1PLKA 5EVCA 3E9CA 4NE9A 2I76A 2P3SA 3L8HA 3C5VA 3B9RA 3T5MA 2I8AA 1KZGB 4HGOA 4DM7A 3WYFA 7MDHA 1YVRA 1Y5NA 4KUGA 5BN5A 1HMPA 4FBUA 4TTQA 3VC2A 1C3VA 4HDSA 1AQLA 1F20A 2H1FA 4IR1A 1G1MA 1D7AA 3COWA 1EUQA 5BQ3A 5GV7A 4RQMA 3P4UA 3W0LB 3QI2A 4ER5A 5B7NA 3A11A 3BSSA 5IJZA 2ETVA 4M0PA 1U8ZA 4G0WA 3GVPA 3VTFA 3FKJA 2E49A 2JEZA 3CKYA 4C6TB 1KO7A 2G0AA 1JEYA 1EBFA 1RXWA 1JVNA 4B8YA 1EP1B 4FDAA 3K2QA 1F14A 1G3UA 5DBFA 2ZB7A 4GHWA 2NRTA 3FAHA 3FOEC 3KT8A 3JVVA 4E15A 2FZVA 1OZHA 3D2SA 3DEYX 2WNIA 2XQIA 5FPHA 5K3CA 4LQCA 3U3KA 1BOFA 4YA6A 3DAHA 8OHMA 4NLGA 3KETA 3PHJA 4EY4A 3O4VA 4P9NA 3CHYA 5JCJA 4C8MA 4G63A 5J2TA 2X0FA 1Q11A 3DAFA 3OZSA 3UAOA 5DQIA 4X6YA 5FO1A 1QP8A 2R1UA 4F5EA 3JSAA 3L1HA 2EF0A 4RL4A 4WCFB 4XWWA 3NHSA 1EM6A 2J0UB 1Z1BA 5DLDA 1SKUA 2QVBA 4QW9A 1DADA 2WZDA 4L5JA 3N58A 4BPBA 1EVEA 4YAFA 3ZCVA 2C2RA 1K3UB 4RKYA 1N1GA 1FS4A 2C83A 4LYHA 3GX1A 2JAOA 3DDNA 5HK8A 1HNXB 4ZYWA 3V6LA 5BQOA 4U63A 2RHWA 3R09A 4H18A 3IDFA 2OBLA 3CRXA 1OR8A 1ZC3A 3U4MA 2ACEA 1XZJA 4YB8A 2IE0A 2BTQB 4KLRA 4Q3CA 3TSZA 2IKSA 4F8EA 3BJYA 4IJMA 4BNIA 5CYOA 5A0VA 1S2GA 2H4XA 1NP3A 2AI2A 3RJ9A 2AJCA 4I08A 4YONB 3DSRA 3FLMA 5AUNB 3QKTA 4I46A 1K9VF 2JLUA 2PZJA 2J3QA 4RO0A 3WQQA 3U4GA 3UW1A 5DM1A 1E1RA 2HHTA 1WTAA 3PFWO 2C92A 5JATA 2UZ1A 2FTKE 4DGQA 4PPQA 2AOVA 3QU9A 3ZWKA 1XPRA 2F8SA 5JCZA 1M33A 1MPXA 5L7YA 3WGIA 4WZBE 4R9SA 4U9IS 3LKBA 1MTZA 5SZJA 4UBOA 4N5LA 3IQHX 1EDBA 1NQUA 1LFAA 1JJIA 3VDMA 2R11A 4UBKA 4RU9A 5ALOA 3TOSA 2OBBA 3JTEA 1V41E 1CRWG 4QZEA 4GXKA 3RANA 5D3MA 2NSYA 2F1JA 1P5FA 4YR0A 4EHAA 1KBUA 4I2CA 3E4DA 1IPEA 3F9CA 4B4UA 5KFRA 1Y48E 2P2CA 4O2AF 4LX8A 5JQGF 3I0ZA 5C5CA 4PHDA 4DF4A 1K6MA 2IPAB 4I9HA 3UENA 3JWPA 2PL5A 4R63A 2UVDA 3KQUA 5G0SA 2VRCA 1OUMA 2L19A 2RKWA 1T2CA 3S99A 2DR0A 1Y3CE 1K97A 4DLPA 1N92A 4HWGA 1GLGA 1PIWA 3HHPA 1HE8B 5M34A 4AWAA 1U0EA 4RD0A 1UBEA 3FWPA 2NTNA 1WD5A 3D2CA 3QU7A 2PXAA 1W76A 2GJ4A 2EZXA 1Y1LA 1NVAA 4PRKA 4DLTA 1YZ6A 1OAKA 8ICOA 4M98A 1XPJA 4G1BA 4PINA 1P73A 1B93A 3F7TA 4ZVMA 1Z2NX 5IJ0A 4O63O 2XUZA 2W6CX 3AI3A 3IT1A 4G97A 3L1KA 1Q0TA 3C16C 4BUJA 4F4YA 1I7DA 1Z8DA 3NQ41 1ZBQA 2P4SA 4AUMA 2Q7OE 4EPXA 5JBNA 4EBCA 5KMGB 1JS1X 1GRCA 3HI6A 3DZCA 5KFGA 3TZHA 3Q15C 3EDQA 4DOAA 3FI0A 4RSMA 4HN2A 3ZXSA 1Y4ZA 4NJMA 2O9JA 1FYEA 2R0QC 2GT1A 2QJWA 1JLMA 1U9ZA 4P3XA 4L16A 2PUBA 5JYDA 1JG7A 3VM6A 3OKCA 4QTTB 8ICJA 4JLWA 4PH5A 1AUVA 4WLNA 4NZYA 4IRUB 4D4JA 5FADA 1FVHA 3P4YA 2BSXA 4D56A 3R7BA 3R7LA 2H07A 4ZGWA 1MC4A 1SQFA 4IX1A 3TGLA 3MT9A 3PGA1 4A7PA 4ZCRA 2GBLA 4F91B 3A2LA 3VSEA 4WBXC 1XK7A 4N7BA 2D00A 2GETA 4Z99A 3PXDA 3W2EA 2X1MA 1ORDA 4O1MA 4V1CI 5MN5A 1XVTA 2FZLA 1SWWA 2QN7A 2WI8A 3UQZA 3K92A 3KVYA 2HTEA 3PKIA 1JR6A 2ZDQA 5FWNA 1GADO 4BVGA 2ZP1A 2BISA 2PEZA 4DF3A 1SOAA 3G2IA 3WV5A 4YMVA 3X1JA 1JILA 3RR8A 4ZKEA 2ZI7A 4P0TA 1G19A 3EBOA 1OWOA 2JEIA 1W96A 1OFHA 4RZSA 1RI1A 3PX0A 1E8NA 4A8HA 4LBYA 2ONJA 2ZVDA 4RQ2A 5DDMA 1RT9A 2Y1IA 3FKSD 2PMZF 5FBHA 1IG3A 4XRHA 2NU8A 1GRQA 3ITDA 4REQB 4E32A 1M8KA 2KLBA 4CLEA 4G41A 5JVDA 4RPZA 4RULA 4M0EA 3GBPA 5G2OA 3WLFA 5ERGB 2VF5X 1YI0A 1RD4A 1G5QA 2BMAA 1YR3A 3P26A 1RQPA 4V0ME 4JP8A 3T12A 2AG6A 5IC4A 2ZR8A 2R79A 1KIMA 3ZHBA 5D01A 3BD6A 2GBCA 1KEEA 4I81A 3T7DA 1DGQA 4AJPA 1R9NA 3HSSA 4CIVA 5DSXA 3BTVA 1AA9A 3SQOA 1TK2A 1E3DA 3S81A 4LV8B 4JWMA 4YC7A 1JB9A 3QG1A 1I2BA 2AC2A 3QHAA 4GOJA 3GLGB 3GFGA 1I5OA 1SC9A 3PEYA 3T5CA 1ZQMA 4QGBA 3PUIA 2UZIR 1SC4A 2QS9A 1PGQA 5BT9A 1PR1A 1AB6A 3WE7A 2AR9A 1IOLA 2VJLA 2MMCA 4W1SA 1QDLB 3A1CA 3OQOA 1QH9A 3DYIA 3V8PA 3H5TA 5SICE 5ALFA 4WACA 2JIMA 1CZLA 1KWKA 3NVKI 2H4ZA 1XKQA 1IQ0A 4CUKA 5FORA 2WTAA 2LZ0A 1G21A 1Q2XA 2KQUA 4HFJA 2ZJYA 4B9TA 1TW3A 3K0HA 1A4XA 2NV6A 4A4DA 3SAFA 4KO8A 1SKQA 3GJSA 1DO8A 3ZLTA 5F2KA 4OQYA 1W93A 1Q7TA 1DRGA 4FM9A 4XPIA 5KTMA 3BWCA 1L7BA 1M2VA 4K1XA 4C87A 4QZIA 2R8PA 2FRVA 5BSVA 1NDUA 3DMHA 5LBTA 1T8UA 5TS3A 3S55A 3T4XA 4F5WA 4RKFA 1LZKA 3TZCA 1J8QA 4KN7A 1ZOSA 3ES9A 4WLVA 4EHHA 4JT9A 2OO7A 5F51A 3I6MA 1H2BA 4QZ9A 1TO6A 1KBZA 1JIQA 4J91A 2BL4A 4K5QA 3C3AA 1UXKA 4M0CA 5C53B 3LDUA 1JG3A 4I55A 4TUYA 4KLDA 3MGAA 1N7IA 1AS0A 1T0IA 5JO9A 3VC8A 4K2AA 3QHPA 3PNQA 3L8MA 1LRKA 1CZHA 4AJHA 4ZDJA 1O6BA 3PO5A 5TS2A 3OIFA 1ECGA 3WHIA 4LF8B 1M2HA 1GCAA 5KFXA 2M98A 4C5BA 4IV5A 5HTKA 3DVLA 2VRBA 5MN6A 3WYCA 5FQOA 3CG4A 4R64A 1HDIA 4OHBA 3E3MA 4DCNA 4UBCA 2IYXA 1NR7A 1O3YA 3V46A 1E9RA 4ERXA 4AX8A 2GKSA 4ECEA 2XCAA 2OV3A 4QATA 1H22A 4DEZA 3R9WA 4F8YA 3AB8A 2PZGA 3QU2A 4JYCA 1R1DA 8ICBA 1GG9A 2WJVA 4EHDA 2II6A 2WE7A 2JFPA 2AHOB 5H3HA 1CS0B 2HJ9A 4DC1A 4OA5A 4IOMA 4XVRA 4L57A 4ENSA 2NUPB 3Q10A 2BLLA 1CVLA 3O8RA 2YWJA 2ZRCA 5DTQA 2ONZA 5DP1A 3QU5A 4UARA 2ZWVA 4RDHA 5K8JB 1GYPA 3N2ZB 1Y3DE 5HG0A 1C1HA 4DARA 3C3EA 3RI3A 1OSNA 3CLUC 1AV7A 4K6GA 3A31A 3QRWA 3UTCA 3V6JA 1E1MA 4CFZA 2C2YA 3SSNA 1FB5A 3UMRA 2P5TB 4TLBA 2EFDB 2ES4A 2FQYA 1HEYA 1BMDA 3UMYA 2W9CA 2QAIA 4RPLA 1P7VA 4NMLA 1QE5A 1AGPA 4QDXA 3W5AA 1EM8A 2A9FA 4Y8VA 3FVTA 4KP7A 1LY1A 1WZNA 5DGXA 3SBXA 4KQCA 3E0XA 1DX6A 1G20A 4GP6A 3PICA 1N5JA 2HR1A 5E4FA 1YKFA 2PRKA 4ZCLA 1OTXA 5BSRA 1C2TA 2XQKA 3D9QX 2VAWA 3FDIA 5JH7F 4KLTA 5DEIA 3WY9A 1YRWA 4L6CA 2K4IA 2UYHA 1PGJA 3U7GA 3IJRA 1JROA 5AJHA 1W0JD 4J8PA 4GR5A 3KO8A 5ICEA 4O2AB 1IATA 5JQGB 3HEMA 4BO5A 4YCMA 4M22A 3MDAA 1Y3AA 1FFUA 1F9EA 1GTG1 5ALKA 5K20A 1UBGA 4NEHB 3PUHA 3SVTA 3V33A 2FZEA 3AQIA 5JE8A 1AQNA 1Y7PA 2J85A 5IANA 3EOZA 1G8JA 1SA0A 1D6MA 1V85A 1VYHA 1VJ5A 3PEFA 1IRXA 3PYMA 4BP9A 3K73O 2BKEA 4V1CA 3V1UA 3CP8A 2O2SA 1YZNA 3ANLA 1SOVA 3LX6A 3HBAA 2QG4A 4WCVA 5L3QA 3GLFA 2H18A 2HPAA 1N57A 2B30A 3QE9Y 1UWCA 4BWVA 1EJBA 1COZA 2B8NA 2Q2WA 1A7AA 4WKCA 4ED7A 3M33A 3A25A 3AR9A 1NNEA 1N0UA 4LZAA 4EHFA 1MAVA 2XUDA 4QDOA 4BNNA 2FWBA 4QAJA 4QM6A 3DAOA 4UJ5A 2O2YA 4GOXA 3TQCA 1UKYA 1GNQA 5CDGA 1EEHA 3ILYA 4KODA 1D9XA 3GW8A 4W5RA 7ICMA 4FGZA 3GJXC 3CYMA 1QVVA 3Q7IA 1KH3A 2EXXA 4NY1A 4PCLA 1U3UA 3BDAA 2BP7A 4D3ZA 1ZQZA 1JIKA 4L5YA 3ZWDA 4HYKA 1QZ3A 3FWZA 2VTEA 2ATEA 3MG9A 5C8YF 1QTIA 4BJ3A 1HF3A 2QTBA 2NVUA 3CRRA 1ZK4A 5ESDA 2C28A 2QX8A 4MQEA 3BGSA 3T52A 4J9KA 3RFTA 1G16A 5JISA 1W19A 3KKOA 3RC9A 2DQNB 3LK6A 5KJCA 1DDIA 2HK7A 1S8OA 1ZO8A 4CUZA 1BS2A 5HHHA 3FOCA 2V5UA 3THOA 5LWQA 4HDRA 3WXMA 4FMPA 1QRRA 3A3YA 3TDMA 1JDZA 3SD7A 5F9LA 4POOA 3I09A 4H0CA 3QKWA 2WNSA 4Q24A 5IHPA 2D1RA 4HB2A 3GQVA 2WLTA 4PHAA 4CQMA 4GVXA 2WFLA 1NXOA 4QE3A 2C94A 4ZRDA 4N82A 1MZVA 1XJ0A 2JIZD 3IAS6 4D6PA 3HE3A 5FL7A 1P0QA 3PXUA 3SIWA 1T43A 3ZY4A 2VA9A 3OF2A 3VR5D 1KJIA 1MRZA 3QBDA 4G0PA 4JGIA 2JHDA 2XGPA 4OVKA 3V4LA 3SF0A 5I7AA 1BD3A 5ECGC 4EG8A 1A0OA 3V1YA 2RE8A 5CDFE 5DTRA 4KX3A 4RIHA 4LV5B 1XJQA 3CU5A 5LKRA 1Z3EB 2C5GA 4MKGA 4H31A 3RU2A 4BZQA 4DR6B 1X7XB 3NHFA 2ZIGA 2BCGY 5L6LB 4CDMA 3MMSA 3DOFA 3QVOA 2FSVC 1OBHA 1ZVVA 3LUPA 5IX8A 2VDWA 4PTZA 2OFXA 1D2MA 2ZUSA 4KN9S 8MHTA 2BQ3A 2F77X 1RFGE 3RO7A 1T4DA 3HPOA 4MF2A 4K6CA 1XJCA 2YY7A 1OBOA 1JE1A 4G9BA 1OUQA 3TVTA 2EKBA 4OU4A 5IKPA 1WMAA 2I33A 2V1UA 1P4SA 1JJ7A 3RSZA 1W44A 4GI1A 3ZGXA 4IR9A 2PSJA 4U3JB 2Q0QA 4P0QA 5FBLB 3U3ZA 2VUTA 5DG8A 5AHRA 3IMCA 1GU0A 3IPCA 4DCPA 3NGMA 3EG9A 5FHRA 1UFKA 2I7XA 1FSZA 3IGFA 2YJGA 1IC6A 1DAKA 3AUXA 1GSOA 4P4SA 2VSOA 1ODFA 2Q27A 4BFLA 3KDPA 4BGIA 1J22A 2PKEA 3RFUA 4Q8EA 4TV9A 1QCDA 1X9MA 1P0MA 4RA9A 2PH5A 1XFDA 5KTQA 3F78A 3I2GA 3EK2A 4V3BA 2DHDA 4U6NA 2J30A 4RM3A 4X44A 3HL0A 5KNDD 6YASA 4QGHA 4ALJA 3AETB 2D0OB 3JYQA 3A06A 3K96A 4QVGA 1U0JA 4ECQA 2JCBA 2BWJA 4HLCA 2PTHA 3EHDA 1U2DA 5AW3A 1E9FA 3HGTA 3KK0A 3L3FX 1OH5A 5AD1A 4GM0A 2JAHA 3EGXB 1NBIA 4DHWA 1TB4A 1Z0DA 4KPUA 4U5QA 4L3OA 3IP7A 3QK7A 1SG6A 4QM7A 1FBNA 1N33B 2DT5A 3KYDB 3OLWA 4IR7A 1YOBA 3D6NB 3VNRA 3BQNB 2L5YA 1FVOA 3AEKA 2MJLA 4OUDB 4PZCA 2X0IA 1JQEA 3WLTA 4OG2A 4EB0A 3GUYA 1ZQDA 4R6WA 1GRVA 4LNAA 3BQ1A 2HKIA 1PV4A 4WTOA 5F76A 3N28A 4G25A 1QHXA 2P90A 2J9RA 5HXAA 2UZ3A 2ZDHA 4OJLA 1ZQUA 4DV3B 2OV6A 2GHIA 3DNPA 4B3CA 3JWIA 2OPHA 4YNBA 3W6NA 2XRFA 5T5QA 1UZUA 5CCXA 2GJSA 1C3XA 1JVBA 1R5OA 3DZBA 2IUUA 2VP9A 4LGVA 2VPQA 4TVBA 2BVNA 2OM6A 1XWIA 4BFVA 4H1HA 3O4JA 5A9RA 4RTRA 4GX5A 2ASEA 3QVLA 2C20A 3IVCA 3K09C 1FNCA 5KVQA 1XKLA 4G89A 4ZDWA 1XWFA 5JTIA 1SXJE 3AF4A 2I65A 1QH8A 5AK3A 4L4UA 1S9HA 5GTIU 4LHVA 1L5VA 3W8FA 1O6GA 3NANA 3NVAA 4FXPA 1FXUA 4RK6A 2VTBB 2AOWA 3TMKA 5SZKB 2WB4A 4Z6FA 5AVWA 2BGIA 4OMCA 2AK3A 2Q45A 4YH1A 4Q00A 2Y67A 5BV1A 4I5DA 3FNEA 1LTKA 1EAYA 1SCJA 3A2MA 2RHGB 4HB0A 2F90A 4UNSA 1KDRA 2H48A 4MKIA 4FS8A 1P1FA 1NT2A 1BJKA 4R2IA 2GJKA 1I9GA 2KS6A 3GR6A 2Y1OA 3A1TA 4M9ZA 2NV0A 1TI7A 2BGLA 1G41A 3AESA 1MC1A 1R5NA 2Q5HA 1LH0A 3BK7A 4KR0A 5KNBD 821PA 5H5JA 2XNCA 5JH7B 5FFFA 1E79D 3VZSA 4R9VA 4A73A 3DUFB 3TLMA 4BNVA 1R12A 1WCNA 2CLLB 2QORA 1C8LA 4OJPA 1URJA 2V9WA 4BWFB 3HWRA 1Z82A 2W5UA 4S2UA 1XGKA 4L7VA 4A0QA 2OP0A 3LT2A 2QRLA 1ECWA 3EXG1 4YP9A 3GLGE 3FHOA 4ZI5A 2VJNA 5HIJA 1NRWA 3GI1A 3OQIA 2N42A 3LG2A 3R0VA 1JDBC 1JHXA 3SMVA 4UU7A 1TEXA 2Z43A 2BZSA 1U7UA 4ZAVA 1I5EA 4QOHA 1NJ8A 4R3NA 1KMMA 2HN9A 4YJDA 4MYHA 3N2KA 4XWTA 5JEDA 1CV2A 3UXMA 4BE7B 1JYEA 1CZOA 3O7MA 4IVNA 3OCWA 4OLAA 1XNRB 1JHDA 1EE9A 4IRXA 1WDKA 2B7CA 3AO0B 3FF1A 1CJCA 4RXUA 3UGKA 3E7FA 3RAEC 3HW8A 3IKMB 3F73A 2R7MA 1BMFA 1WXGA 2QT9A 5B6IA 2QI9F 4F9GA 1SULA 2NWQA 3LRXA 3BQMB 1VCIA 1S3IA 2CY0A 4XD7D 1KDHA 4Y9UA 2B5WA 1Q91A 3GAZA 4O2BB 5DXJA 4Q3LA 2GILA 1LX7A 2O0JA 2GVDC 3GRVA 4UDYX 1RYMA 4ED2A 5F2EA 3BREA 2FW1A 2PAAA 1XEWX 2VRWA 1BXRA 5SZHB 3E6AA 3EQ7A 5AVXA 3WOHA 3ZWVA 4CEIA 4JEUA 4O4JA 1NWHA 2JZCA 3CVYA 2IBKA 2EAPA 1MX9A 2YKGA 3LZ6A <