2WF9A

Structure of beta-phosphoglucomutase inhibited with glucose-6- phosphate, and beryllium trifluoride, crystal form 2
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
221
structure length
221
Chain Sequence
MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQKQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Near Attack Conformers Dominate Beta-Phosphoglucomutase Complexes Where Geometry and Charge Distribution Reflect Those of Substrate.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
molecule keywords BETA-PHOSPHOGLUCOMUTASE
total genus 72
structure length 221
sequence length 221
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2009-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2wf9A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2wf9A01
3WKEA 3S6JA 3ZVLA 2IOFK 1Z4MA 3BWVA 3W5CA 5ALTA 3FPBA 3MN1A 4Y3UA 2I34A 4HGPA 4UAUA 1CQZA 2AUTA 2CFTA 2JAUA 2YJ6A 3B8EA 4I9GA 1SWWA 1Z88A 3OCXA 4BNDB 1J8DA 5ALDA 3OTQA 5ALRA 3F9RA 4F72A 3PDWA 2MSNA 2OBBA 4BX2A 4FFDA 4CF5A 4F71A 5AVSA 4QQFA 1XVIA 3FVVA 4OCZA 2JAWA 3WGUA 2G06A 2YMMA 3ED5A 3QUCA 3UMGA 3L8GA 4EX7A 4IFTA 1RMYA 1RLTA 1SWVA 5ALZA 3WKBA 3MMZA 2P27A 4KNWA 3N1UA 2G80A 2JARA 3QX7A 3AR8A 2IOHA 3D6JA 3L8EA 2EARA 3N28A 1K1EA 3M9LA 5AW6A 3I1YA 5AI5A 5AM2A 2PQ0A 1RQLA 4XE5A 1ZRMA 2AMYA 4HYTA 3AR3A 2WM8A 4JB3A 3NUQA 4Y2XA 1U2TA 4B6JA 2QYHA 3FPSA 1WPGA 5ALOA 4CE6A 3WKAA 2HEGA 2Q4TA 3R09A 5AKZA 4DFDA 5AVXA 2YJ3A 1RQNA 3R9KA 1EK1A 3U7FB 3ONNA 4PNHA 4BBJA 3L0YA 4KN8A 1TA0A 3QLEA 2HHLA 3EPRA 3DDHA 1TJ3A 3OPXA 4XPZA 5AVVA 3CZ4A 3OCUA 4Y2PA 2NO4A 1Z4PX 1Z4JA 5AIBA 2DQSA 5AVUA 2FPSA 1RKQA 4YCMA 2G1AA 3NIWA 1Q92A 3QYPA 4J03A 5AKYA 1O08A 3NANA 3QNMA 1YV9A 1YMQA 2FPXA 3A1DA 5AICA 3QXGA 2ZG6A 5ALYA 1Z4IA 3KD3A 2YBDA 1Y8AA 3E84A 3ET5A 4BNDA 3OCYA 3E8MA 1T5TA 1L8OA 2YN4A 5AKEA 4OFZA 1WZCA 5JJBA 2W43A 1YS9A 2B8JA 5AKKA 3DNPA 4BX3A 4E88A 3EF1A 5A3QA 3UMBA 3M1YA 5AVQA 5AKIA 4CF3A 4G9BA 4UMVA 3RF6A 4GXTA 2HO4A 1QQ5A 2B8EA 4ZEVA 5AW3A 5AW4A 2C8KA 3GYGA 1L8LA 5A3SA 1QQ6A 1ZD3A 2Q4RA 4L57A 1L7PA 5AVZA 4Y2UA 1LTQA 2WF8A 3K1ZA 2R8ZA 4BKMA 2NO5A 5AKXA 1YJ5A 5ALWA 5AI0A 3E58A 1N8NA 3AR9A 3PCTA 5T41A 4YIHA 3EWIA 1J97A 1ZS9A 1RLMA 5AK5A 1S2OA 5AI4A 5AW8A 1XP5A 1RKVA 4DCCA 3U19A 4XOUA 1Z5UA 5IT0A 4BEVA 5ALEA 3BA6A 3QU9A 3J7TA 5ALQA 1T9ZA 4UATA 3IB6A 3KDPA 3QGMA 2WF6A 3A3YA 3KBBA 2B0CA 4NAVA 2C4NA 3WK9A 4YCLA 3FGOA 1TJ4A 5AKHA 2B1QA 5AW0A 5AM0A 1RRCA 1JUDA 1IWOA 5ALNA 2WF5A 2CFSA 4HGQA 2EAUA 2IOFA 3HYCA 2YMPA 3WKDA 1SU4A 4BX0A 3WKCA 1U7OA 2JAOA 3ZU6A 4EZEA 2IA5A 5IS2A 5AM3A 3ZVMA 4I9FA 3NAMA 1LVHA 1F5SA 2Q5EA 3UM9A 4FE3A 1U02A 3ET4A 5AVTA 3WK8A 1ZJJA 3KZXA 4UASA 3SD7A 3PGVA 3OCVA 5ALGA 2C88A 1YDFA 3KOOA 3CNHA 3IJ5A 2HF7A 4YH1A 3U7HB 1EK2A 2YJ5A 1T5SA 3ZVNA 2OYCA 3SKXA 5FP0A 2ZBEA 2WF9A 3WGVA 5ALXA 2FUEA 3L0CA 2GO7A 1NNLA 3N8GA 1RC8A 1U7PA 3ZTWA 2C8LA 2ZOSA 5AM5A 2FDRA 5ALFA 3ZX4A 5ALPA 2HSZA 3QUBA 2BDEA 2MU2A 5AW9A 3NASA 3HLTA 4DWOA 5AM1A 4C4SA 3I6BA 4UU1A 4YCNA 2R8YA 1AQ6A 4UW9A 4IG4A 2FEAA 2HI0A 3KC2A 5ALSA 1VJ5A 3A1CA 4QJBA 2PR7A 3R4CA 4DW8A 2YFYA 3OCZA 1U2SA 1QQ7A 1N9KA 1WR8A 4GIBA 2P9JA 4Y2YA 4FYPA 5E0OA 3RFUA 1Z4NA 5AI6A 3U13A 2JGAA 2R8EA 3U7GA 4UM5A 1RLOA 5AIAA 1Z4LA 4KX5A 2YJ4A 3AR5A 2HF2A 4AP9A 3U26A 2BY4A 5AI8A 2FPUA 3N07A 4OHFA 5AVYA 1TJ5A 3QUTA 1RKUA 2I54A 3B9BA 4RESA 5AESA 2I6XA 2BDUA 3U7EB 2HCFA 2FPWA 5AW5A 2YY6A 3ESRA 2G09A 3P96A 2FPRA 1RMTA 2HDOA 4NABA 3IRUA 2I7DA 4UARA 3DAOA 5A3RA 2HX1A 5AHXA 2G0AA 1Z4QA 4HGOA 1ZD2P 2AH5A 4Y2QA 4KNVA 3W5AA 5AW2A 1X42A 1ZRNA 3L5KA 3MPOA 4CF4A 2YMQA 2C9MA 4NWIA 1CR6A 2WHEA 2I33A 2CFRA 1ZD5A 3WK7A 1Z5GA 2ODAA 2P11A 3EF0A 5AKLA 4CNQA 4H1WA 1L7OA 4J2TA 1QH9A 2O9JA 2B1RA 3AR6A 4L6AA 5ALIA 3VAYA 3SLRA 2QLTA 3SMVA 4BYGA 4RETA 3ZW7A 4UMDA 4Y2RA 5ALUA 3DV9A 3ZWDA 1QYIA 4HGRA 3L1VA 4L6CA 3W5DA 4EEKA 4EX6A 2P69A 4Y2JA 3A1EA 3ZI4A 3ZX5A 3W5BA 1FEZA 2G07A 3L1UA 4G63A 1Q91A 2RARA 3WK4A 4HAIA 3AR4A 3NRJA 4Y2VA 4UU0A 2I55A 2ZBDA 4UMFA 1NRWA 2PKEA 4XQ0A 3ZWKA 3AR7A 4UMEA 3MC1A 5AKJA 2GMWA 2GFHA 5ALMA 3UMCA 1VFPA 3NALA 3QUQA 5AVWA 1O03A 4EENA 4AS2A 4Y2SA 2HOQA 1Z4KA 1ZD4A 2D2VA 3E81A 1L6RA 2GHTA 3QU7A 3ZTYA 4NFLA 5ALKA 4NV0A 3QU2A 2G08A 2R8XA 3QU4A 2RBKA 4EELA 4MWOA 5ALHA 5AI9A 4HGNA 3ZUPA 2W4MA 1WVIA 4AS3A 4C4RA 1PW5A 1YNSA 5AW1A 3I28A 2RB5A 2NYVA 4MUMA 1ZOLA 3WK5A 2OM6A 5ALVA 3L8FA 2FI1A 4OD0A 2RAVA 5AK3A 3SF0A 4JDPA 1TE2A 2ZBFA 4UM7A 5AW7A 5ALJA 2VKQA 4C4TA 3FZQA 3QU5A 4UAVA 1RMQA 1VJRA 1MH9A 2O2XA 4ZEXA 4Y2TA 5AM4A 2CN1A 1KYTA 3AR2A 1L7MA 2IYEA 2EATA 3OCWA 5AK4A 2WFAA 4BEWA 3TLMA 3L7YA 4KX3A 1RDFA 5AVRA 2MU1A 1Z4OA 3N5KA 5AKGA 3L8HA 1L7NA 2ZXEA 3PGLA 3SHQA 2GHQA 4O8CA 4YGYA 2X4DA 5IT4A 1S8OA 3ESQA 2FUCA 3WK6A 3B9RA 2AGVA 3L0BA 3SKYA 1XPJA 3FM9A 2OA0A 5AK6A 2W11A 4YIKA 4ZEWA 1NF2A 2B30A 2ZBGA 2B82A 2WF7A 2YMLA 3I76A 1RPZA 5ALLA 4KYTA
chains in the Genus database with same CATH superfamily
1RI1A 2VTEA 3B20A 4C1BA 4EY3A 1PZGA 4C7BA 2CXTA 1IBSA 1KDPA 4IX1A 3MB5A 1L0BA 1IJFA 1QH1A 4DQIA 1VP3A 1MAAA 3K4QA 1I7LA 2B9VA 1PK3A 4RS3A 1ENZA 4I9GA 4DV5B 1WQ1R 2Y6VA 3A9RA 3CUTA 4F3YA 4AI6A 3GIMA 3RFXA 3ZS9A 3CH4B 2O8FA 3GPCA 2YB4A 3AU2A 3N8DA 4BNDB 5J58A 3EC2A 4QFDA 1LFAA 2GYVA 3WLPA 4S04A 3GG2A 4P80A 1SXQA 4RIIA 4MV9A 3JYOA 1XAGA 2BCSA 1HT2E 2V98A 4F72A 4CM3A 4GC7A 1M1YB 4ZQFA 1G5QA 2Q6OA 5DB7A 4WNIA 5EZYA 3CN9A 1XF9A 3IAS1 4M9UA 1AF7A 1Z1BA 2DKNA 3UXOA 3FCXA 1Y37A 3FOEC 1N4AA 1P5HA 4MGKR 4AECA 2HT6A 5IYZA 5B2EA 4FDMA 3QG5A 2QRUA 1OB5A 1Y6FA 1IL0A 4IFTA 4CTMA 1RMYA 1DC7A 4UU7A 3SZUA 5JRDS 2AFHB 2EQAA 3COPA 1SD5A 3GDXA 3C7DB 1PT5A 1V1MB 2JFHA 4N6NA 5JSYA 1KGDA 4NJOA 2AQKA 4PTZA 1OTHA 5DYNA 1AMOA 2JIPA 4DUYB 2UU9B 4QUKA 1HE4A 3RBAA 1U63A 1ANKA 4AKSA 2ZBPA 1ORIA 4UBLA 3T9EA 1HDIA 2IXAA 3BM5A 1YZGA 3AVXA 4BVHA 8ATCA 1YB7A 4GOND 4UDXX 3WXBA 5AM2A 4X62B 3GOHA 1WZNA 2RKBA 4QOFA 1KYXA 5BN1A 1G6KA 3CPHA 4ER0A 1NRXA 2K6GA 3CR8A 1TMKA 2GBCA 5CU7A 1KVTA 3RCBA 2O0MA 4EG6A 4BZQA 3BCRA 1GSOA 1J09A 1M1XB 4ZTUB 1OOEA 2D2IA 2JIDA 4AK9A 2JFBA 4JKOA 4MVJA 1PVPA 1EVKA 1NX6A 4FW9A 4BO1A 2UUBB 9ICFA 1HA3A 3V42A 2VUTA 3RB6A 1XXHE 1QRAA 2EGUA 3A3PA 2MSCB 3DAPA 4I1SA 5DBEX 2H1FA 3I0NA 1YDHA 1BGXT 4HDNA 2EJCA 1JE0A 3AKYA 3O73A 3IA2A 4V39A 4V03A 2BUAA 3CUSA 1VOTA 3DBRA 1KPGA 2FMQA 3LDAA 1J07A 2VHWA 2XUKA 4HUQB 3ZOZA 2VCEA 5IVKA 1H65A 2WJPA 1EXMA 4MR9B 2IIBA 2HTEA 2I03A 1ZSVA 1XB2A 2ZYHA 4U0KA 4MV7A 1E9FA 4JITA 4K03A 2WMDA 1PYDA 2EYQA 2YVQA 3OIDA 3WYDA 3RAXA 4MV0A 4GC6A 1XWWA 3FKSA 3JALB 2G4LA 4ZI3A 1A2QA 1EAYA 4F8RA 3VNSA 3LM8A 5JFGA 3QPBA 2HWKA 3EIFA 4AJLA 1AXGA 4AZSA 3OMWA 1A8SA 2OVFA 2PRYA 3Q11A 2WU1A 3R6TA 2WY2D 1CF4A 2WIAA 4YJ2B 2RFLA 4YLEA 1ISFA 3EIWA 1KR2A 2C2EA 1QFMA 5EKXA 1GEEA 5KT4A 2J6HA 1E69A 3NBXX 4QZEA 1MB3A 3OLVA 4ALJA 2B1IA 1M5RA 5KYYB 1VYTA 3MCAA 1WXFA 2Y67A 4KV7A 3NHLA 4ETIA 1P2DA 4MQ6A 2KLBA 4MS4B 2W2KA 4FZ3A 3ENNA 4JBXA 4J9LA 3BQNB 5AQEA 5FRDA 1VMEA 1V1RB 5ITZA 2HMXA 3TRDA 4YMOA 2TMYA 2LM1A 4BNDA 1WDMA 2DH6A 2IPXA 1P19A 1T5TA 2Y0PA 3AI1A 4O4LB 3MR5A 2IV3A 1KMMA 5DBFA 3O3NB 1ISRA 1W0KD 2J09A 3N97B 3KS9A 1CETA 4D1YA 5CAEA 2ZP1A 4QDTA 3M6XA 5EJ7A 1IBCA 2OG2A 1N6HA 4Q4HB 4BNXA 3AVQA 4GUDA 2C03A 1L5VA 3G0GA 3PW4A 2V96A 3F3MA 4TT8A 4RJLA 1JX6A 4XYGA 5G0SA 5TT0A 1DJMA 2F4NA 1W35A 3RGWS 3U37A 3GYBA 4BVJA 2PBZA 2R44A 1VZ3A 3A4IA 3LTEA 1O6FA 3OLYA 3QI7A 4K9SA 2FCAA 2Y1KA 5EJIA 4S1OA 1PJZA 1T5HX 2LW7A 1J2MA 3LXXA 3L6EA 2YWHA 1KU0A 2XWQA 4MZDA 4XGRA 1QXSA 2PVPA 1DARA 2CNOA 4D9EA 3EZYA 1TQ8A 4KQFA 5BN3A 3GWZA 4NE2A 1Z7BA 2ZJ8A 4LHYA 3RWMB 1YKFA 1OSNA 4GD3Q 4AMGA 1TXGA 2ZEJA 1DEKA 1WQ3A 4E5PA 3NVMB 4PXSA 3ZDAA 1A04A 5MHTA 4O3FA 1RM6C 4OQDA 2FN9A 3LDFA 4QUAA 4L72A 2Y1EA 1YJCA 4H1UA 1HUZA 3LKZA 4BLOA 5LUAA 1XD2B 4ZIRA 3M2TA 1CQJB 1O96A 3WB0A 3C5WP 5ALWA 3WZMA 4CLHA 1JHPA 1RADA 3E58A 3SM9A 9ICQA 2QRNA 4EIWA 1TVEA 3FDFA 5A9SB 3EPIA 4FT2A 5EHZA 4M9QA 1V5GA 5K09A 4AB1A 1DJNA 1Z5PA 2BC9A 3D2CA 4RIFA 1JVBA 1JFTA 3AKZA 2ZYRA 5KOHA 1QO0D 2QG4A 2NQ2C 4XA8A 5TGDA 1C3OA 3K09C 2J3JA 3OEHA 2F2AB 1Z6PA 1XRPA 2CXRA 3INYA 2XMBA 3ITKA 4IDEA 3IB6A 3IIEA 1JHOA 1IJEA 1XTPA 9ICWA 3WADA 5BXQC 4JLDA 1W6UA 4EFLA 1GYPA 1HLPA 3LLCA 1W1WA 4K6HA 2J9FB 5FDFA 3WI7A 4GFJA 1Z0JA 2H1VA 2WTAA 3AKEA 2CCJA 2YXBA 3BTUA 5IAJA 1FS5A 1JUDA 2X5NA 2C2OA 1N6OA 1URJA 2XUHA 1EM6A 1YA4A 4KGZA 4RMHA 1YK0A 1ZOSA 4D41A 3WMWA 4DLYA 5LN1A 2VK1A 5FTKA 5KMGB 1L4YA 3H5VA 2ZETA 3GD7A 2IA5A 1AC5A 2PWPA 3M6FA 1T6ZA 3NP9A 5L1JA 2Q50A 3E9MA 4F1KA 1G98A 3EZ9A 1JAHA 4CQMB 2Y4NA 2YV3A 4H0NA 5IILA 2JL1A 4NFYA 4WH0A 1Z83A 4B9SA 2L0XA 3M1AA 4KWCA 1ZI6A 4P7BA 3LK9A 3RAEC 3L84A 1KHTA 2JGEA 4PRZA 5H4HA 3FNRA 4DQUA 4QU5A 1F0YA 2TMKA 3HZHA 4NAUA 4IHKA 3PEEA 2WZQA 2AD1A 2BHNA 1XEWY 3OPYI 3U49A 1OB2A 2NMVA 3EN0A 4YDSA 3HDTA 2J46A 2ZU0C 3CX7A 3CVOA 1Y42X 3KKLA 2OO5A 1JXMA 1E1MA 1JTEA 1LK5A 4X6XA 1GZ4A 2FYTA 2V9ZA 5K3CA 4P4GA 5NLLA 2GWSA 4IS3A 4EF5A 4AUNA 3W6UA 4YAIA 5KTPA 3DTYA 2JLCA 3WP0A 1DRGA 1VJ1A 1UKYA 2CLLB 2ETXA 2ZS9A 3NEPX 4Q24A 5FNVF 5CG2A 3KSAC 2VJNA 1FJ2A 2H17A 1N6NA 3V4LA 4I08A 2A6PA 1PIWA 1G42A 2X0KA 3I72A 5DB4A 4CM5A 2NXNA 3NHZA 4OL0A 5GJWC 2GNPA 7ICOA 4X5OA 4CMIB 4DCSA 3SS7X 3TGLA 4NLBA 4XRGA 4MI9A 5G1PA 4N54A 4RPLA 3LAWA 1FBTA 4DSNA 3ZLJA 4O4LA 5A6SB 4HQNA 3ZWNA 3MAAC 3RSLA 3FDZA 1NSTA 2RH5A 4M0FA 3EZGA 2MUTB 1C5KA 3MABA 1DDIA 1NVUQ 1V1RA 1UZUA 2J7PD 3E03A 3CT6A 4L5YA 4MA5A 2ERCA 4ZD6A 4CLDA 2BH2A 3TIGA 1DG3A 3Q7QA 2NO7A 4IYRA 3JYNA 4N7RA 3QUBA 4YCAA 3LC0A 3W1WA 1GQFA 4QPCA 2GLEA 1RPNA 2V4MA 1BXRB 4C4SA 2XQFA 2PX6A 3K05A 1XCLA 4KK3A 3H0LB 2XVTA 3BJMA 4TS3A 3AUUA 4F4XA 1O4VA 5LQAA 2V9PA 5J2UA 5K8CA 3MQ2A 1K63A 1A71A 5JNVA 1RTKA 4Z53A 5EWJB 4HQ6A 4Q1DA 1WTCA 2K4EA 2Q3JA 5E2BA 3L2OB 4F60A 3EHDA 2ZUEA 3K16A 3PNQA 1J25A 2D0DA 4WFIA 5FADA 3GP8A 2FDCA 4OHCA 2Z57A 9ICNA 1HLFA 1B23P 1Z2DA 2JLBA 3IDOA 2FR8A 3KKZA 4MQLA 4D5EA 4DW8A 4ETMA 1ISMA 2YFYA 4BGDA 1U0SY 2J31A 1G8SA 7YASA 5BP7A 3RS9A 3WIDA 2BM8A 1ONPA 1M5TA 2O0LA 4IHJB 1QVVA 5JNRA 1FW6A 1AKNA 4I9UA 4GIBA 4I8XA 3TQIA 5JANA 3WQQA 4AJHA 4KWEA 3WDKA 3IE1A 4Y2YA 2FN4A 4AMBA 1YBVA 3U48A 4YUYA 1F4LA 1U04A 1T0HB 3WTBA 3ZR4B 3CVUA 4K5QA 2P2YA 1G6OA 4IRDA 1Z0KA 4HK4A 4WX2B 721PA 1EFHA 5CITA 5IIJA 4NHOA 4OGGA 3M7IA 1S3IA 1SVKA 5CH5A 1WXEA 3AERB 1Z6ZA 3E3LA 3K8ZA 3PQFA 3UAVA 5LWQA 1GAXA 3F9CA 1IULA 1UBHS 4RA9B 3SFVA 3BE8A 2YYSA 3EGDB 3W2HA 2WT8A 3E9QA 4WADA 1KKMA 1PWHA 5THQA 5GIPE 1JKJB 3ESZA 3FAKA 4RFVA 3N4MB 1RYSA 3LT2A 2ZSBA 1G21A 2O3QA 2F17A 4PQYA 2I8AA 1MQ3A 3TZHA 4H6WA 1USUA 3AV3A 3D6VA 1JA0A 3ZHUA 5BNWA 2PSSA 4E2YA 3FGPA 3BT7A 4PHEA 1NBMA 2QSUA 1E9VA 2DBRA 1KN5A 2ZIEA 3M6WA 5BQ3A 4AJOA 1WWVA 3I2IA 3GIKA 4RY8A 2Z7JA 5ELLA 5J1SB 1XQ1A 3DLIA 1COKA 3KEOA 3VTZA 2H3QA 1ZA1A 2GHRA 3DAOA 4UB1A 3GRPA 3QE0A 2HHTA 3DE6X 3AM5A 4DLRA 4V38A 1I32A 2JV3A 2RP5A 1UIRA 1SG6A 1Z2PX 4GNRA 5JAQA 1EJBA 4AS1A 1NT4A 5F4ZA 1KF0A 3R7FA 3WYCA 3I2YX 3RRGA 2PE5A 2Q21A 1YVUA 2QZZA 1QONA 4H08A 3THXB 1DINA 1SBTA 3DM9B 4Y2QA 3JXEA 2JAPA 3RC7A 4PSCA 2DLCX 4DARA 2ECOA 1BPXA 2R8PA 2XCPA 4D8TA 4CF4A 2YMQA 5KHOC 3QBEA 3H5AA 2C9MA 4EJSB 1V2HE 4F5QA 2WTMA 4P4PA 3BZUA 4PLFA 5LSAA 3T5KA 2D1SA 5A0VA 1NMQA 1SMKA 1MGOA 4YRTA 3FCAA 1P81A 5TQ2A 1EH5A 1RVDA 1D09A 4G1UC 4EGJA 3F7OA 1KDTA 4FMCF 1FLDA 3OY7A 6ABPA 5B64A 1Y6ZA 3Q7RA 4WVLA 3SHOA 4Z3OA 4RNMA 3L1IA 3TZEA 1T29A 4MITA 2XZTA 2PKQP 3N59A 4L0CA 4U8GA 2O6KA 4DWIA 5D5QA 3TOSA 1KOFA 1R15A 4BTLA 2IIPA 3OE5A 1RNLA 5G1OA 2D1YA 1ZQFA 5A0LA 3JPOA 5KFYA 4RCVA 5EIHA 4YR0A 2IELA 3AETB 3H04A 3L7LA 1SHUX 2VUUA 2CWWA 4WBNA 2C5LA 3PQ7A 5FTNA 3FHLA 3O4GA 5C18A 1WKVA 1YDWA 5BSWA 3VO9A 2XNDD 1RLJA 4D46A 5A4FS 4Z2AA 1C41A 5TLSA 5CB6A 2H5EA 1QGOA 3VZQA 3HCWA 3GCGA 1U90A 3Q15C 4ID9A 1QLHA 2I4OA 4JS0A 3UGTA 1CJMA 2G76A 1OLUB 2AG8A 1DRWA 1T3ZA 2XBUA 4WINA 1JHUA 1KETA 2B99A 3H2YA 5ED4A 1A4RA 1COZA 10MHA 5AVWA 5GONF 1DVRA 1Q1BA 1QZ3A 2PSFA 1GZHB 2YB1A 4I2CA 2ZRPA 4MUBA 1IK6A 1GUZA 3TI7A 3WNVA 3TNJA 4EP1A 5AFSA 3U1BA 1P74A 1PJ2A 4RQ2A 4XVUA 1J0CA 5DSZA 4YR3A 4TMZA 2PUDA 3V8BA 3SXPA 2A7XA 3Q40A 3P0IA 3EEYA 4L5IA 2VNHA 1PK9A 4QJ3A 4CRXA 1HV8A 3DZHA 4MWOA 5ALHA 3C2QA 5IVHA 3AG6A 4QWMA 2QT0A 2OPBA 1Y63A 1QE0A 5EIBD 4EG1A 2P35A 4HFJA 3K2BA 3IKLA 3QA3E 3NPAA 4P5DA 3W5HA 3ZCXA 3IFSA 1FIUA 4Y1EA 3ZNOA 1ZOLA 1OZFA 4CG2A 3WXMA 3LA8A 1UQUA 4JT4A 4Q9AA 2OSVA 4BX9C 3GJTA 4NBSA 1GL7A 3DFIA 5DM70 4A8JA 1Y33E 3D2AA 3NTVA 5A1TA 2MIIA 1LRLA 2Q1YA 4UM7A 4GBED 4EB6A 4ZMSA 1XZIA 4U1RA 4DCPA 2MR5A 5AJZA 4ENRA 1FUUA 1IDOA 1B4FA 2R6GA 4AFNA 3I2HA 1C20A 1QOQB 2QYOA 4PV7A 4R2KA 3GLIA 4PCUA 4UFPA 1S96A 2C4VA 3GDFA 4NE9A 4YCDA 1V8DA 3GDHA 3LL7A 2W7OA 4QXAA 1Z07A 4CKBA 3CU5A 4DVGA 1KWGA 3IV7A 4MYSA 2IWHA 2OHIA 1DQSA 3ZIUA 5H4GA 7ICVA 3LY9A 4BFTA 3W90A 5I7UA 3JQAB 1HE3A 3B12A 5J5VA 4AVYA 3W34A 4I2FA 4LV8B 5LZ9A 2HF9A 2ZATA 4LOAA 1GPNA 5K0EA 1RLUA 4JDUA 2B8WA 3RDPA 1ZQBA 3IEPA 5EEHA 1MOPA 3LS2A 8ICMA 5IAEA 4CBVA 5IT9A 2C5AA 2VTBA 4AIIA 3I01M 3LCCA 3SYLA 1NK7A 2W03A 5EE5B 3T7SA 3UENA 1JXOA 3TEFA 2IXBA 1MU0A 5EJEA 5JO0A 1ZOOA 1S8OA 5C5EA 1T8SA 3GMIA 3BE4A 1GPJA 5DTQA 1XELA 4YP7A 4E6EA 5L6LB 2BIFA 3EUWA 5CB4A 2K7FA 2HMUA 1BCRA 4JLPA 3G79A 3RWOA 3TEMA 2K60A 3M4XA 3N5CA 3VC7A 1ZYUA 5FUXA 1L7QA 4LBZA 4MPDA 3CCCA 1TIPA 4X1YA 2JCYA 2RHLA 4WK2B 4BV2A 4YJ2A 4AKGA 3QFFA 1SZJG 1M2GA 2Q0QA 2ON6A 2HA2A 2YMLA 3BXXA 3DQQA 4REMA 1TYZA 1KQGA 5KL8B 1SG0A 2AQIA 2J5QA 2B3TA 3BJRA 3Q8WA 1M33A 1ABBA 1YFJA 3ZVLA 2GR9A 4JBHA 3X43A 3W5CA 3C3MA 1SVOA 4Z4QA 3WNDA 4U2BA 2FZWA 1ZI9A 4OMDA 4OJKA 4LC9A 5TS3A 3P0EA 3MHTA 1W5SA 3M83A 4RPJA 5DTIA 3ZDDA 4YAFA 2XRMA 3HYNA 3PNPA 1YVPA 5IC6A 2ZIWB 2YS7A 3BMCA 3AEXA 5K4HA 5CGZA 1XU7A 4MVJG 3BS7A 1YCHA 1E2IA 1M2EA 1A9XB 2HU7A 1M7GA 5TEVA 2HMTA 2VT2A 2PLAA 5LU8A 4L50A 3RS3A 2W6JD 1BJKA 2VF2A 1ZGBA 5CPFA 4BQSA 3TQFA 3AP1A 1R0BA 2KJ5A 1D2EA 3AF3A 1DFHA 1MX5A 3BQ9A 3DE2X 4ZCPA 4GWLA 5LQJA 2D6FA 2AJQA 3PI7A 2JAWA 3QXXA 4HZUA 4DDTA 5K6AC 1OY1A 8ICQA 1TF5A 3M9NB 3DV0B 2R11A 4FHDA 4MAAA 4Q1FA 1XSEA 2JJ1D 5DRYA 3K70D 1Q12A 1NVAA 1PS0A 3CH6A 3ITEA 2EJVA 2BKUA 2Z8YA 4ESEA 4ELUA 4W9NC 1ZQYA 3DB1A 4QNLA 2O3SA 3N1UA 2JARA 4UBCA 3GZTB 3MBOA 2MR6A 3LGSA 2POCA 4LGVA 4MVXA 3OFNA 3TR0A 3W2GA 4F45A 2D5IA 2ZE8A 3BS5B 4F56A 2JH1A 1ZR4A 2H6EA 2OXCA 5I7AA 5DHFA 3L8EA 2FSPA 3RFAA 3GJRA 6Q21A 3U7JA 1Q3VA 1K1EA 4KR7A 1HDEA 4Q8EA 3I1YA 1C7FA 1OKKA 3G5MA 5EYPB 2IYPA 2V6IA 3HB5X 1M6YA 4RZQA 3ZBTA 2NOAA 5JSHA 2YTZA 1X1DA 2EFHB 1Z8FA 2FZEA 2M1XA 3NOXA 4J2HA 4Z3KA 1YZQA 5JMTA 1NMZA 1U8AA 3ODPA 4HNRA 4YJ3F 4DR6B 1UFRA 1VG1A 2WM8A 1REQA 4XGNA 3FCOA 4NOKA 4YLGA 2DETA 4AUKA 2QTFA 1BYIA 2DBVO 1KY4A 2VYFA 4Z4HA 2ZIXB 3NHRA 3BB3A 4Q3LA 1ISHA 2ZIGA 4GHWA 4GW3A 4KN9S 3RYTC 3SYTA 4BY9E 4EH1A 5LQDA 2XDQB 1K5PA 2ID7A 2PSEA 1I7NA 2G5TA 4FKZA 3O2SB 2WHPA 1H42A 3JX9A 1QZTA 2WJ4A 3KZCA 3MJEA 4GH5A 1QCKA 4U6PA 2YJ3A 5CW2A 5J1TB 2XGOA 5KOJB 1EK1A 3ZN2A 5DW3A 3EIQA 4DR5B 1A69A 1Z17A 2QR2A 1XTRA 3IMCA 3U0BA 5KX5A 1N75A 1EVEA 4DLLA 1ODKA 1UJBA 2BEWB 2ZI6A 1YRYE 5BN4B 4EG0A 4UTPA 3OPXA 1K7SN 2XT9A 7ICUA 2BAGA 4JNCA 1ZN8A 1NJYA 2OAEA 3C3BA 3MWEA 4IIJB 1RZTA 1V71A 2AN3A 4Y2PA 4WLOA 4NOJA 1W1UA 1NVGA 2AFIA 1L3CA 3PPWA 3V46A 3BMQA 3NUZA 2Z5LA 1IY1A 2B69A 3JQQA 2NNWB 1ULBA 1EX9A 2NADA 5HHHA 5AKYA 2QTAA 2XSZA 4KVGA 4TLLB 2D62A 5CX1A 3Q7IA 4LTNA 4RD4A 5DHPA 4E32A 2R2GA 1Y6QA 4JT8A 3ECAA 1EX6A 5JQGF 3ZJTA 1U0HC 3ESYA 2IDJA 3GHYA 2P9YA 3SR3A 4HNVA 5I3ZA 3CH5A 1VMDA 2PYIA 4A6PA 1AU9A 4KPEC 2MT9A 3G0CA 1E79D 1ZI8A 4EUEA 1U3UA 4MWBA 3SMQA 1KO1A 5IFLA 4LKOA 3H9GA 5EQTA 5CAEB 3OE7D 3HXOA 1TLLA 3MILA 1UBEA 1ZL0A 5T8KA 5JRJA 2W2LD 1NHGA 1P39A 3E2PA 3PI6A 1DI0A 2BFBA 5F9NA 4M0DA 3WICA 4I2EA 4IQGA 5A5FA 4CL3A 5FWNA 1WBBA 1ILWA 3LPDA 1PLJA 1PJ4A 3DFUA 4ECSA 2ZB2A 3H05A 1V45E 4J07A 4S35A 8ICNA 1AQLA 5I7HA 3OZIA 2GEBA 1B0ZA 2GJSA 3FYTA 2C5HA 3K3PA 4LVUA 4LYYA 3V97A 2DPGA 2HKIA 1WULS 3VKVA 3ZU2A 5JWRA 4Z4CA 2J4CA 1WY7A 4U9HS 4D44A 3HHPA 5KWEA 5LD2B 1T10A 4L22A 4RIHA 3L43A 4Z2YA 3OT5A 4XSGA 1N56A 3OE4A 4ZOLF 2V8OA 1RR6A 1IY9A 1W59A 2X13A 2KBEA 3LZ6A 4F5ZA 4UNRA 2HO4A 3DBLB 2VJYA 1SC4A 4FYVA 1W25A 2QTBA 1EG2A 3S55A 1FYEA 5I01A 1FFYA 3F1LA 5FI3A 4EYHB 3K0AA 3TTVA 5KFLA 1S0MA 1QAMA 2JFYA 4DJ5X 1GPUA 4F85A 4JNKA 1BHSA 1AO0A 4B3FX 4GKAA 4RUKA 3LQYA 1PSZA 2PY6A 1O6GA 2GCNA 4M60A 5A7FA 4IJUA 5K0NA 4QPJC 2OXTA 3VH3A 4WNAB 1TMGE 4MMYB 4MF2A 1UBMS 3R0XA 4ND1A 3L4SO 5FORA 5KTKA 2WZDA 3COZA 5JI2E 3C24A 1OH8A 4DILA 5CGQB 5HX7A 2VVTA 3NVDA 5HKLA 3OX4A 1LKYA 3LPLA 4TQ9A 1DBSA 2WU8A 4IIGA 1L7BA 4QU0A 3KKEA 8ICYA 4AJ4A 3U7IA 4GEGA 2BGWA 4IUBS 4BRWA 1MSWD 5EGNA 2A1TS 4JQOA 4RZXA 5JD5A 1XP8A 3D43A 2HHXA 3EVZA 4NQZA 3QX8A 4LE2A 2YZ7A 3FGOA 3ADDA 4TL8A 1B2LA 1HEKA 4OHZA 3L4BA 4NP6A 3A04A 4KO2S 3QKSB 5ALNA 1BKYA 4H18A 4JLKA 2JBWA 2DULA 1YK1A 3T1YB 2XB2A 3WKDA 3T9DA 3IDZA 1N60A 5J2JA 2RHCA 1KK1A 3ONWA 1JQ5A 4DJAA 3U56A 4ABTA 1H2RS 1JFVA 1NM5A 5B1SA 3RT1A 3VC2A 3VZPA 2NX2A 1Q95A 1LPOA 4MVWA 4J4TA 4TKVA 4PZDA 4I9NA 3QUSA 2C2GA 1XVAA 1WQ4A 2OAGA 5KT3A 3OJOA 5B6JA 2IH4A 2CLDX 1EVLA 5FL7A 4BFXA 4R3WA 4Z8YA 3C14C 5AVTA 1NDHA 1SBNE 3DE4X 4AO6A 1BXGA 1HXHA 3INGA 4RXUA 3TARA 1GSIA 3UUGA 2NT3A 1E59A 5EVCA 1LSOA 4RHTA 3K92A 1TIKA 4Y6QA 2XCRB 3ALRA 3U4QA 2GCPA 2C92A 4GXIA 3IJ5A 4DIUA 1HT0A 3NGLA 2OG1A 3KE9A 5EAIA 4ECTA 3TADC 1BWRA 3UW1A 3DMYA 5DRTA 5KFJA 2OCIA 3D3NA 2A9RA 1SQFA 2F43B 1J1UA 1Q0QA 4IGIA 1A7AA 2WF9A 1HFEL 2YNMC 3A2MA 2CSUA 3IDQA 4DGSA 3UMRA 5KFHA 2Q99A 4WK6A 3LW8A 4Y9DA 1TT5A 3ABRB 4LVSA 1MEJA 3E15A 1W6RA 4PC2A 1RXUA 1TU0A 5IM4F 3EQ9A 4X90A 5C1IA 4JIMA 3ZD7A 1NMSA 1XPUA 1MA0A 2PG3A 4O5AA 2Z8XA 2AF3C 1J9ZA 3TOXA 1EVQA 5HIAA 2HLPA 5ALPA 3HFSA 3RVOA 2MU2A 2WFLB 4ED8A 4FEEA 3UPDA 2DPMA 1SQGA 2DFLA 4QVKA 4TMYA 4HCJA 4RDXA 1BMQA 1HT3A 4AO8A 3TS1A 5B3JA 2RKWA 4Y1RA 4EI8A 4YACA 5AJVB 3ZC3A 5KDLA 2CVZA 3K5HA 2J87A 2PH7A 4FR2A 4JL5A 3VQTA 2CXNA 4ARZB 1RACA 3TMYA 4DSAA 3V80A 5CHYA 1ACLA 3JQPA 4G0NA 1HYQA 1LPBB 4PY2A 3RVBA 3OT4A 1IATA 1WU8A 2PR7A 2YZKA 5ERGB 3GLQA 4FFNA 5KCZA 3B51X 2CJYA 2KHVA 1N0HA 4UTXA 1M76A 1ZN7A 1AKUA 3OCZA 3ZWQA 1KH2A 1NLMA 1ELOA 4HT3B 1Q0PA 3CLKA 4KMMA 2JVJA 4WERA 4YJKA 3ZJUA 2FW8A 3SICE 2EKLA 3MERA 2QP9X 4ECUA 3F67A 4ZC8A 4CJXA 2PMBA 1D03A 1PFVA 2AHRA 2O4UX 3I2JA 4O4IF 1WHTB 4Z86A 3VNQA 4DIKA 3BMOA 3C23A 3HZOA 1UXHA 2IZ7A 2H3VA 1XYGA 2B1GA 2ZRMA 4PGGA 3HP6A 4X1YB 4W63A 4EJSC 1XO1A 2VBGA 3DE7X 3EISA 4R2JA 4UM5A 5C7YA 4F2WA 2RGNC 4ZRMA 3ZKWB 3DEZA 1AK2A 1B0AA 4ND3A 3ZY5A 3L77A 1MJNA 3QLVA 4RQ7A 5B7NA 2IHBA 5JBNA 2IWRA 5E95A 1QSYA 3BFXA 5DHRA 2XD9A 4AKTA 2IUFA 5CT8A 5K4LA 4BVKA 4D9CA 4QOHA 4AF8A 2Q6LA 4O63O 5LBIA 2I6XA 1YJXA 1Z5VA 4FFSA 4QGHA 5GVSA 3UWPA 3VBEA 1ADGA 1FYXA 1BU5A 2PA3A 3IPXA 1R4ZA 4UREA 3EWNA 3AJAA 1AA6A 3VPSA 3ZDXB 5J2IA 5A7HA 2GTPA 4W6ZA 3K70B 2F3RA 3G82C 3I12A 4WXMA 3FDJA 3RJ5A 4MDFA 3IP5A 3DAGA 2BI8A 4PZUA 2AN9A 5DOZA 3REQA 4LDPA 1DC6A 4H3HB 1ZFNA 4PX9A 4RO0A 2RDIA 4DTIA 1MZPA 4YROA 4IPTA 2VDKB 3W04A 2O2ZA 4MUNA 1SKQA 2VDPB 5B5SA 2QL6A 2W3SA 3KJGA 3I5XA 1Q7TA 3D4LA 2WVAA 2XIQA 1ZGJA 3CKYA 3VZCA 4JJFA 1OMOA 2B37A 1U2ZA 4RZHA 4CL0A 2ZJ7A 4XM0A 3JD2A 4WJKB 1XZAA 5TSDA 1NY5A 4PC7A 4Z0TA 3R9IA 3TM4A 7ABPA 2G4CA 4ITRC 1KZ9A 1ST3A 1CI4A 1XCPA 2EW2A 2D2EA 3PFCA 4WJLA 1XSPA 4UCWA 4J3NA 2DPYA 1QX3A 2F76X 4V0RA 2OQIA 3UHPA 4DY4A 3FBWA 4YRGA 3S1LA 5DYYA 1HC7A 4EA6A 4C0XA 5E79U 4H6XA 4UE3S 1Q7CA 1R0YA 4UB3A 2BJVA 1MFPA 2O9JA 4LE0A 3EBPA 1RAEA 3OZVA 1V6AA 4O3RA 5KFZA 2BZ1A 3EE6A 4YYZA 5FJJA 3SLRA 1A8PA 1Z74A 3DAYA 2K2WA 1U1CA 5J3JA 3ROQA 4YP1A 3D0QA 1E4EB 3RSCA 3BS4A 3DAHA 3ZWDA 4YRNA 1OPRA 1B1AA 3R2JA 4Q3KA 1BPEA 2WTFA 3H42B 3SXJA 3ZDRA 2C4WA 5FFNA 1RXCA 3F5SA 2XNSA 4EX6A 2P69A 3B9JA 3JR7A 4AM8A 3NRWA 1KZYC 2AR7A 3FC4A 4Z9AA 2X3UA 5I51A 4DYDA 4QDKA 1FLNA 1NRIA 2VZLA 2WKSA 5TS2A 2RHJA 4CIYA 4WD3A 3E05A 3UWMA 2AL7A 2P4EA 5HKOA 2ASVA 1U45A 1L5KA 1JIVA 1KVUA 2OYRA 3V55A 3F4LA 5E1BA 5JNSA 3PMNA 1WP4A 2YY7A 5AXAA 3W9YA 5H2FU 1WMSA 1T3GA 1ZK2A 1I4LD 1JPNA 1Q6YA 3M1LA 2O8VA 1N5MA 2GMWA 5ALMA 1WBDA 1Z25A 4H7EA 3A2NA 4NYJQ 1XAIA 4Y2SA 5H3HA 4KFRA 4Q00A 5FD8A 2BFAA 2D2VA 3QF4B 5KQLA 4E15A 2VAPA 4IKOA 5JTUA 1IBLB 2P40A 4QWCA 2VSYA 3V1KA 3W6PA 5CFZA 5F2OA 4M0PA 4UBOA 1HNZB 3VFDA 4QXMA 3EPJA 3KHHA 1WB6A 1CEYA 2EG9A 3CX3A 2LIPA 3IH5A 2A5FA 3L4JA 2J9RA 3QA9A 1N2CE 4DC9A 3HMQA 2G17A 4OGFA 1PVRA 3DXZA 1PGOA 3O21A 2F2TA 1XS9D 3C8HA 3EVGA 2VPTA 3HDGA 4DCUA 4K0KB 3HJNA 1SL2A 3M9OB 3UJPA 1XKTA 4C01A 4EKEA 4FWTA 4LFBB 2VH2A 4Z51A 1HO3A 5COBA 1VLHA 2BBWA 4DLUA 5KTNA 4GMKA 4IQFA 2XMCA 4WXRA 2WRZA 2J5BA 2ZBRA 3FJOA 1MT3A 3VO8A 2HHQA 4ME6A 2CYBA 3LCJA 3EG9A 4LW8A 1AUOA 3GGPA 3WRYC 2PYDA 3GGCA 4LWPA 1E7WA 5ALJA 4R2HA 1XO0A 3T1NA 3MINB 1XWFA 2W2NA 2P6PA 3KELA 1G21E 4CF6A 4UAVA 2FX3A 5JC8A 3BRCA 4MP8A 1TDJA 2K2QB 1I7PA 1FIQA 2KHQA 1N7GA 1QHHA 4IAOA 4M38A 4UHBA 2CN1A 4Y6RA 3DKRA 2HTFA 3VHXB 2GCOB 3Q9SA 3RBVA 1GPLA 4D82A 1CP2A 2ODNA 2GS9A 4NG4A 2YC4C 1CVIA 1TAUA 4FE7A 2ISPA 4GP9A 4HRVA 4ZCSA 4QHSA 4K87A 4F3KA 4D6XA 1DOAA 5J0SA 1OCEA 1ZHFA 4ND8B 5HILA 1EG7A 3PEFA 5TPWA 3U3KA 3TSAA 3JZFA 1LW7A 1P7WA 3CJRA 2A5LA 3JD0A 3PQEA 1IYZA 5JLJA 3WG9A 5IT4A 2UYGA 2HF8A 4KVAA 2QPOA 3HJBA 3JQFC 5DZSA 5ILQA 4JMUA 1T6NA 4JUAA 4RQ0A 4R4JA 5IMBA 5C5DA 4OJTA 1SL0A 3P26A 4JV0A 2C58A 2F1KA 2WB2A 3S68A 2DE0X 3C3PA 1E2KA 1R6TA 1RI3A 4FMDF 1THTA 2CGEA 2ZBVA 1D8BA 3HVRA 4ECQA 3AOGA 4C3OB 4E94A 1XHLA 1WJGA 3HWRA 5KG2A 1M54A 1P61B 2FW6A 4MRAA 1JGTA 1ZC4A 5ALTA 2I6TA 3JQGB 4DDUA 3H5IA 2I29A 1EX7A 1WMBA 2QX9A 3PNOA 3L82B 5KYVA 3URMA 5B1YA 2VF8A 1YHZA 2G7MC 2WHXA 3Q9LA 1SA0A 4TPKA 2OBXA 2SICE 1F6BA 4RLFA 2ZIWA 1WW2A 3BMCB 3D3WA 4JQZA 1GKUB 4F04A 4YN3A 2HBYA 4B3XA 1E9SA 1QYWA 5JASA 5CDFE 2UZ3A 1TM7E 5AUQA 2XEXA 3LUBA 4IJQA 3VVLA 3UWKA 2OBBA 4M9NA 2ILVA 3FPHA 1E94E 5D85A 4NXZA 4Q66C 4M04A 3DUFB 1BSVA 2J32A 4NCNA 4QD3A 2FG6C 3THOA 4CEHA 1VB3A 1F06A 2EU8A 5DTJA 5TIIA 4TYNA 5AUNB 5KFAA 1K9SA 4P82A 5KOIA 4O8ZA 1WHSB 1R0SA 4DNPA 4YAGA 4DL3A 3NMUF 1BA3A 5CDUA 3ZU4A 2MUTA 2C22A 1YAHA 2ANCA 2VSFA 3T4EA 4FZLA 1XNJA 1ZVKA 1NOMA 3C3XA 4YAJA 1VYVA 5HCUA 3MMZA 3Q8KA 2PH1A 3BIXA 3IALA 1SZCA 5DHTA 4DLTA 2W4QA 2J30A 2FKAA 4J0QA 4FCVA 2C7QA 4TT3A 3RBDA 3MTQA 1LVGA 3E0XA 3OMLA 4M1OA 1C29B 1OBCA 1H2WA 4P35A 4ERXA 1XEXA 3PFGA 2WYVA 3GRVA 1OZAA 2ATLA 3SYKA 1H5NA 7GPBA 1WVGA 2DFDA 4YP9A 4OLJA 1IXSB 2WB4A 1N6RA 5JZ9A 3C6KA 4QYSA 1I1NA 4DL9A 5AD1A 4BBZA 2WWTA 1JEEA 1PZEA 5A4JA 3DDCA 2DY0A 3HFRA 3G2IA 3KT6A 4L9AA 2NU7A 2QU8A 4FOTA 3TE7A 1M8FA 3HUUA 4JOBA 4KXXA 4NU5A 4RK6A 4BO3A 2VJAA 1E3MA 2D13A 2QYHA 3AF2A 3M6UA 4GBMA 3ZVMA 5I9IA 3IJRA 3ISCA 3GAMA 1HNNA 3IO3A 2A2ZA 2F9LA 2C5BA 3HYTA 2EZ8A 2VPWA 3VPCA 1XCMA 2XA1A 1JV2B 3C4JA 4K9MA 4OPMA 2V55B 1GZSA 2M2IA 2VRCA 2ZYGA 3COYA 4XGQA 2ZW9A 5COAA 4CU5A 5BW5A 1UJ2A 1C1DA 1MIOA 1RQNA 1YFZA 1YGPA 2JVIA 3ASYA 4FNAA 4L74A 4TKLA 5DHUA 4Y1GA 2YW9A 1ULUA 3F5FA 4YA6A 4AUEA 4PZZA 7ICNA 4PEVA 2PI4A 5DBGA 1EIZA 1CEZA 2JRCA 2H3IA 4KN8A 1XVVA 5LBUA 1N7IA 3NNDA 4B7ZA 2RLTA 1A5ZA 5DXFA 3HY3A 3VVMA 4CFSA 1I2AA 4ENVA 4KLUA 1JAIA 1ZRHA 3DM5A 3QYFA 5KTTA 3Q98A 1EZZA 1OFUX 5H7XA 5IKOA 4EWLA 4XEUA 2X6TA 1U3WA 3JAKB 5JXHA 2LKYA 4WOJA 4E5UA 2LCFA 4ITUA 3ZGYA 4B17A 3ZZ1A 5BNZA 1H6DA 3RIXA 4BNFA 4FINA 4E2FA 3LY7A 3ZGLA 2ECQA 3K09A 1TZJA 5BR1A 4PHGA 4E03A 2WWWA 2YV5A 4D3YA 2FNAA 3GMDA 4KV9A 3TVYA 1WCNA 4JYMA 4ECEA 3I9OA 1MVOA 3IIMA 4ECYA 2GJ4A 2ZTHA 4QOSA 3TUIC 5KJEA 3UXNA 3CNLA 4O5KA 4C4XA 3GGOA 1R9NA 3T5HA 2UUCB 1PJQA 1I2BA 4BL5A 1DAPA 4FFOA 1Z4IA 3V1UA 4BEJA 3KD3A 1NPDA 1CG6A 1JHMA 1LRKA 1C7QA 2JGRA 5G40A 5I7OA 4TUYB 1HR0B 1FNDA 3ECCA 4QW8A 2GAOA 4TXJA 2Y1GA 4WN9A 2FQYA 5KT2A 3KTQA 1Y5LA 3E8MA 1EMDA 4DDKA 2QB0B 4MS3B 5IJ0B 4BMYA 3QVGB 5AKEA 1ZK1A 3NYIA 3K9LA 1OFHA 1XMSA 3K71B 1FW8A 1Z00A 3JPSA 1U7ZA 2X5XA 2Y77A 1V43A 4QYWA 5I8WA 1YFLA 5KJ6A 2Y0SF 3RH5A 1P2SA 2RGUA 4RF5A 3TFWA 3VYRB 3SOPA 4CKEA 2KFNA 2OGTA 4KLFA 5EPUA 4HWKA 1VHJA 4TL7A 4AMVA 2C0QA 2FQXA 3O7WA 4P4SB 4DJJA 3O47A 3LQ4A 3IT2A 3OIGA 5A0TA 1R8JA 3FLAA 3TAUA 2ZVJA 5D3MA 4FXOA 4LRWA 1ZIDA 2BW0A 3LV8A 2P4QA 1KC1A 2I5HA 3SQDA 3AC0A 4B8WA 1UODA 2VBIA 5JXWA 3D8BA 4C2AA 3FKQA 2ODTX 4EEXA 1ORRA 2VSQA 3BGVA 3K9NA 4DV0B 3OLXA 5AW4A 4KLDA 2R00A 1KGSA 3WMFA 1QQ6A 1FVFA 5KS2A 3JPNA 2XOKD 2G6TA 2IZ6A 3RJ9A 3WLSA 1T1IA 5JNLA 4FW8A 5IJWA 2R18A 4LF9B 4IJVA 5AKXA 5J4YA 2NQ8A 5TQ2B 3ROFA 1UKZA 1UXIA 2DSNA 2RGEA 2QR3A 4BQPA 3FMGA 1J97A 1ZS9A 1SK8A 5ECYA 4JUDX 2VWGA 5L7WA 2NV6A 4Y0NA 1CS0A 5JLAA 4DWJA 6YASA 5HIMA 4EI7A 5CNIA 1BHO1 4PZNA 2BI4A 5KFWA 5CT4A 1F17A 4N12A 3U19A 4O59O 1YA8A 3CV3A 4UE2A 1T0BA 3T3IA 3ZGVA 4U7JA 2HWXA 1D2GA 4MUAA 1PQWA 4F5OA 2MTBA 4EG7A 3CEHA 2Q49A 4U7GA 1LW6E 4NAVA 4RKWA 4CT4B 3TXYA 4RD0A 1NNEA 1NPYA 2A58A 2V59A 1XRLA 4LXXA 4MEYA 5JZBA 1ZCFA 3DGEC 3DT9A 1U7UA 1ZHHA 3FMFA 1M7HA 1TK3A 2PQ6A 3FSGA 3OMXA 1RPLA 1QE3A 3LFTA 2GN1A 4H6VA 4MR9A 3V4RA 1UMDB 2BGIA 4RY0A 1RCUA 1HDCA 1QFSA 2XADA 4IDHA 3P9RA 3ZU6A 3SJBA 5CYOA 2DLNA 2ENWA 3GFGA 4IDGA 5A05A 3USES 5C80A 3MTIA 9ICBA 1QZZA 4I9FA 1FQJA 1TQHA 2AX3A 3SXUA 3K32A 3PQDA 5L7YA 5EVJA 1EJ0A 1DBWA 2WG2A 3KHTA 3PICA 4IIEA 3QSYA 1JKJA 2WM3A 4N7JA 1SXJA 2M1ZA 4KSBA 4W5WA 4WCFC 6REQA 3DLCA 1JYSA 1ZXXA 3O8RA 2Q7XA 1T26A 2A5YB 1M2FA 1URPA 1ICIA 4URFA 3I2KA 4OO1J 1JSLA 4IQ0A 1E0JA 4RW0A 3OWOA 5GOTA 1JG3A 3UA4A 2JD0A 2OMEA 3BC1A 2FGKA 3TI0A 2C2BA 2C7VA 3DC7A 3FLEA 5BMVA 5HYVA 5KJ1A 2HR1A 3UNXA 1SXJC 2Q27A 3S28A 3H9QA 3NDRA 3S1AB 2FQQA 1KRXA 3NATA 3A1WA 2VP6A 2OCXA 1ZMBA 5D7BA 2OYCA 4MP3A 3T3NA 4GDFA 3ZJ4A 4RF4A 2O8EA 4MB2A 3T3MB 1SZHA 3V7NA 3P2KA 1NZPA 3I9JA 3AEUA 4PC3A 3DO5A 5BW4A 1EAMA 4L9RA 4NMXB 2QGZA 3ZD8A 1U7PA 4XWYA 3ASUA 4WDQA 4ND7A 3F47A 4F50A 3RIHA 4GQIA 5B4UA 1X39A 4C29A 1OIVA 2C8LA 1IE3A 3HYLA 2F8MA 2IEBA 3H7AA 4M2LA 3MUOA 2KFZA 4G5OA 4ED7A 2ZR8A 4NQRA 1YHNA 2IBKA 4WXPA 1KOJA 3B0YA 2BDEA 2I2DA 3TM5A 8ICHA 3CUUA 1W93A 1LUAA 1XYVA 2OILA 1Y9ZA 4PGFA 1CUHA 2AFVA 2IP1A 3UV3A 4BMSA 3AHCA 3TCXB 2B7BA 3N7TA 5H1YA 1EI9A 2FZLA 4JHLA 3A4TA 1JVSA 2GWHA 1KORA 2VT7A 1P60A 1QWSA 3J7AC 5KREA 4JYCA 4GI2A 3HCDA 1JMSA 3RM3A 1M2VA 3SZLA 3VYWA 2OB1A 2ZZKA 4CODB 2D74A 4DZRA 1LY1A 3IP6A 2VWQA 2PFOA 4RH0A 2VP4A 5KQGA 1FUEA 1JQDA 2W2TA 3EXHA 1MC5A 2C2DA 1GUBA 3FMPB 1RCFA 4FFMA 4KQIA 4N5IX 5D1NA 3UXPA 3Q7EA 2RE8A 2BLLA 2RHMA 2Q5HA 2QI9F 3RUAA 3D1JA 4BASA 4E6PA 3RB4A 2PXCA 5B7QA 2AZDA 4Z9YA 1KDYA 4DBLC 2Z58A 2BFDA 1PGQA 5GV8A 2BMEA 1Y8ZA 4LC1A 1N5LA 3L6RA 4A2PA 1T2UA 1C14A 2OHVA 3PKJA 1GKKA 4OI0A 2PMZC 2I2BA 4CLRA 3K0CA 3DS8A 9ICRA 2ESEA 5FKJA 3K6SB 4B3BA 2OHGA 2R5NA 5LC1A 3BIJA 3B38A 1N36B 1YR2A 2FWJA 1OH6A 4PPNA 4CR8A 4BKQA 3KQYA 1WCYA 3PF8A 5LP6A 1F38A 1MPTA 2B6HA 3Q0TA 2RK4A 2DHDA 4BCBA 5FPKA 2E5FA 2TMGA 4II3A 4X66B 1UBSB 4HBZA 3VYSB 4PH5A 3UT5B 2FPWA 1GZ7A 1HLGA 3IDFA 2HU2A 1KEKA 1WPXA 2BEWA 4RAQA 3PJRA 5DEIA 2GCEA 1JP7A 3HKBB 4MIOA 5JZSA 3I4LA 1QUFA 4M86A 1DCMA 2QX4A 3FHJA 1RRVA 4AQ7A 1ES9A 4A8EA 4B3GA 5EQDA 7ICRA 2BHRA 4MK4A 4TV8A 1ZKMA 5KOJA 2APJA 4MAMA 1NM5C 3EARA 2GEUA 3HEBA 4FX5A 3CISA 1E2NA 1G19A 2UZ0A 5JXGA 2D00A 2J7KA 4QUIA 3UV7A 1S97A 3B3FA 1OI7A 4J94A 2WIDA 3AB7A 2QZSA 3BKWA 1IPHA 1PQ4A 3DTVD 4GRIA 4C0WA 5C5IA 2V74B 5CCDA 4I5DA 1OAAA 3UOWA 5B66U 2W7PA 1MB9A 3OM9A 4UC0A 5LZ7A 3LHIA 1Y4DE 3EOAI 5HCNA 1PFKA 3O8OB 4B9AA 2XUPA 2C82A 1R74A 1HJPA 7ICMA 4YONB 5KU1A 3T1HB 5JADA 2PGAA 3B1FA 1L9XA 2V3CC 1NVDA 3U16A 1DX9A 3CRXA 1P0QA 2C5EA 5DLQC 4NARA 4A8JC 1SELA 4XSHA 5TPZA 1VSUA 5HM6A 2WQ6A 1C8BA 3KQTA 2ZIVB 4OXIA 1KQPA 1CKEA 1VJCA 4W5HA 4YAOA 2W70A 2YJNA 4J2TA 3QRWA 4O3OA 1AO3A 4QT0A 4YBZA 1ZP6A 4JB8A 4BECA 4DIOA 1ZH6A 2OBYA 2E3JA 1VHQA 4BVAA 4GI5A 4UTRA 4WGFA 3UIEA 3ZHOA 8ICCA 2Q3EA 2HW8A 2LDXA 4M36A 5AQ1A 4O5CA 121PA 4IIBA 2II6A 3NDPA 4TTJA 4DJEC 1QAOA 2HBMA 1LLDA 1KAOA 2QUIA 1MNQA 1TYEB 4PPYA 1G8YA 2YIJA 4R1LA 1AVTA 4XJVA 4YASA 1KU6A 4AXBA 3P8ZA 5BSFA 4IH9A 3HU2A 3HYRA 3L49A 5DQHA 1W581 3FPKA 4ND5A 5AOVA 2KE7A 3H40A 1N5KA 1X7YA 2C77A 2JFFA 3VV2A 5JCZA 1NJ6A 2IYYA 1A97A 2G07A 3K75D 2RG7A 4GPBA 4MI3A 2BGMA 5LOVB 4XD2A 5JISA 2RARA 4HAIA 1IPFA 4W7HA 3L7JA 5GPBA 3EXHB 1TQDA 1CZLA 1XDGA 2C4UA 4JLMA 4UVHA 5DSTA 1UADA 2MDTA 1JEJA 3ILYA 4P7JA 3ESCA 3GLSA 1Q0LA 4RHEA 5A04A 2VP0A 1CR1A 3A26A 2JIQA 3LHFA 3D8HA 4FFRA 4HJXA 3BX1A 4K26A 3RSHA 3WLAA 2BGRA 4OJLA 1TO6A 2FSGA 3SIRA 2OLJA 1PFGA 3PHCA 3FZGA 3BQ1A 1T4CA 3W6ZA 1WV0A 3MT7A 5CP8A 2LR0A 4G0YA 1GDTA 2W9XA 3DMRA 3I5YA 1LC0A 1P1FA 3KTAA 3F5EA 1W4RA 3DNFA 4ZVKA 2Q0XA 5DGTA 3NHWA 5JAZA 4C1NA 1SKAA 5F1OA 1W34A 1Z0DA 2HIGA 1E9DA 4M7WA 5BN5B 4AJIA 4HGNA 4RJ2A 4CWAA 1QIHA 2BGTA 3R3SA 4BWGA 2YV1A 4X20B 5J23A 4HQKA 4BX8A 2AEFA 2SNIE 3PXEA 2WZBA 1NZDA 2Q5FA 4HDCA 2P9CA 4IYJA 2ID8A 3CURA 4BMCA 2GN2A 4KMRA 2QPAA 4AULA 4YUWA 4HO1X 3STXA 2W00A 5J2EA 1WLSA 3QLVC 1PL8A 4XZ3A 5FOTA 1I3LA 5BPFA 5KYKA 1DRKA 2FI1A 1ZISA 1X15A 4WZBA 5JTIA 2ZRKA 2VH1A 4GR5A 1XR3A 5ESRA 4DQQA 1ESEA 2KBFA 3M3DA 5JJIA 2HHCA 1XFAA 1OPXA 1OGJA 2Y9TA 1N5IA 4YRDA 4YRMA 4MYDA 2I9GA 1MABB 1H3FA 1RXSA 2A9KA 5CLGA 5K0LA 5CA0A 4B75A 1F0KA 2JHGA 2O7RA 4L28A 1J7JA 1FP4A 1VBKA 2G9UA 2FWIA 1H22A 1Z62A 1A4IA 4JUCA 1SU7A 3AF5A 1ZJWA 3LO8A 3G8AA 1HYEA 2ZJ4A 1GU1A 3PZRA 3OCWA 4CQLA 3E3NA 3LSYA 5KG5A 3AB8A 5CR9A 2FZ4A 2KNJA 2WJAA 1O95C 1SO8A 3BREA 3CNOA 3I34X 3SQXA 3JAWA 4TRNA 3LBYA 1P75A 5KQPA 3QLTA 4HDRA 4YDRA 1CUGA 1DBPA 2AN4A 2ZT6A 1AKMA 2VDQB 4B9MA 3GCDA 1JZQA 5KOYA 4F4ZA 1Z8NA 1JPJA 2Z2XA 1DRVA 1KI8A 2QA5A 3IUSA 1O95A 2R6ZA 3LWMA 4URYR 4G2NA 4TLEA 4K6FA 3PQ6A 1AHNA 2OORC 5TNXA 4F96A 5LP1A 2Q1XA 3BIFA 4MCJA 3NVZA 5C4IA 1J8VA 2C54A 2A1TR 4WKGA 2JMGA 1F0MA 4FDTA 1M83A 5BSTA 1E79A 1OWPA 3VGPA 3JYQA 2IDMA 4F9EA 1TJPB 5EXTA 2CJWB 2ZRJA 3CHYA 3MJHA 2QMUA 4YWJA 5J2BA 2ZAGA 2LXNA 2F59A 1XWLA 4QEKA 4TWZA 4WWHA 2F1JA 3AEKA 2FEWB 4JROA 4KXUA 5ALLA 3O1JC 3S6JA 1XF1A 1YRHA 2G9RA 1KRHA 2IEDA 2WSSD 3VU3A 4D3XA 4MQEB 3EDCA 4Y3UA 5EIEA 2HSDA 1IM5A 3VO1A 1G7TA 4TTRA 4C80A 2X42A 1RWKA 4UNPA 4RSHA 4ZYXA 5HMMA 4BN5A 2VTKA 4CMJA 3E53A 5LOVA 4ID3A 5M5BA 2GH1A 2Z04A 4YMSA 1PG5A 2EAPA 1MVNA 2KKPA 4NYJR 5T67A 1BZYA 3RVPA 4R71A 3WL7A 4C8KA 4CI0B 5BW8A 5CCEA 1EQ2A 5F2NA 2QZJA 1MB2A 4NHEA 4R16A 3DKPA 4WACA 1SCDA 1NK0A 3B6EA 4RDCA 2Q7DA 4H9GA 1QFJA 1TVKA 3OPVA 1SHTX 2KWIA 2BN4A 3BB4A 1T5OA 2QRZA 3QJ5A 1TMOA 3QWIA 3A27A 5DJ5A 4IVQA 1KQNA 4JVLA 2OH2A 2AW3A 4LXGA 1JI0A 3N87A 3CZRA 3HM2A 5KAFU 3RWBA 1ECGA 3ODGA 4J16C 2OZLA 3IVMA 1WRBA 2P7IA 5HUJA 2VATA 2AXNA 4F9FA 4L4SA 3TSZA 2X3YA 4U3JA 1D07A 4FB4A 3I4CA 4E33A 4MUIA 4KIWA 4A0QA 3QX7A 1EZ1A 3IESA 1Q46A 5K6RA 3BRQA 1JFRA 5JH7F 4H3SA 1UP4A 4S0XA 5FL3A 4CDRA 1ZWLA 2P1ZA 3C7AA 5A3VA 4K9NA 3VNAA 3IN5A 1BPDA 1S2LA 3FVTA 3AL0B 3MCTA 4KPUB 4P9NA 5A7GA 5T8KC 3SPXA 3PC6A 4AZ0A 5JQGA 1FRNA 2NRTA 1Y6RA 3OFJA 1GFWA 3S2IA 4ZVQA 5IAKA 4MJ3A 3NKFA 4KACA 4MVYA 4N7BA 4M99A 1U9IA 1YT3A 1OD6A 2OO3A 3K5PA 5CLHA 3RKSA 1XU4A 1I4TD 1X1EA 2DR0A 3HDQA 1F8FA 4OFWA 4YV2A 2XTNA 2H2GA 2ET6A 2Q1TA 4BKRA 5FBWB 5EHQA 2GYWA 1PL6A 4C6SA 4F21A 2PEYA 1XE3A 2GJ9A 4DYHA 1J2NA 4B6JA 3H11B 2JFVA 1GY8A 3N53A 4MR7A 1RZRD 1SOMA 1I30A 1ENOA 1PT8A 1RAGA 3JY6A 4KAXA 4NBVA 4JI2B 1M8KA 1N2CB 4KO4S 4H16A 5LZ4A 1K4MA 1RQXA 1V96A 4I6EA 4C20A 5KNBD 2I91A 2BGUA 5BYKA 2WA2A 3TF5A 3A31A 4FCWA 5KNDD 1JIUA 4D80A 3CVJA 3GQBB 5T3YA 4F9GA 2BHTA 4MYRA 4AC9A 2YXPX 1Z75A 1P18A 2X1MA 3HCFA 2VHUA 4U0JA 1X1BA 1M0EA 3JYLA 3UF0A 3PRKE 4PAMA 5DHSA 4G89A 3P45A 4DLXA 5LOVF 3AQFA 2OK7A 1WXGA 3AUYA 3HKZC 3D3WB 4FS8A 4PS0A 3V00A 4D81A 2QZ4A 4QDUA 4R0MA 4Q93A 1HZZC 1PGNA 1RC0A 1U8TA 2Y4OA 3CZ4A 3O3MB 4LJKA 5DWQA 3PSHA 1LLQA 1C1DB 4B4UA 1ZIPA 1D9XA 1EHIA 2FHPA 3JAWB 5T6MA 5FOSA 2JFPA 2Y1DA 1HDZA 2NU8B 4YR7A 3ROXA 3F3YA 5J0XA 2H48A 3ETLA 1TTPB 4RHUA 4X0EA 1H4TA 2HCTA 4RT2A 4NE7A 1QGUA 2RHFA 3NGDA 1FP2A 2B5WA 2PSDA 1KEUA 1H85A 2DCUA 3GLRA 3IKMB 2UZ1A 4O4HA 1O08A 4URWR 1XPOA 1I9GA 1P2VA 1YV9A 2P68A 3HVUA 4MMXB 1AH2A 3RU9A 1UANA 1FP4B 4FGZA 4NSNA 1A5AB 2AFHE 4EMBA 2YY5A 2X5KO 2AZMA 3QELB 5KFIA 2A0FA 5TQ0B 3PNVA 5DYTA 5FAKA 2CUTA 2VXOA 1X9WA 4B4DA 3JPWA 1O94C 4IHAA 4HRYA 1PUXA 2BL4A 4MW0A 4O3PA 3KVYA 1L7DA 2JJYA 2NXEA 2ZWVA 1Z68A 3QH4A 1I8TA 4TQRA 1ZW6A 1YOVB 4DEXA 4DA4A 2WPDD 2I67A 1ADYA 1VL2A 3ZWMA 3W05A 2W2QA 2HQBA 3S44A 5CX4A 3PD7A 1IMJA 2PX2A 3ETJA 4P4TA 3S7TA 3TQQA 4UM8B 4BWJA 1LSSA 1R0RE 1WXWA 5K0BA 4L6IA 3B85A 2J33A 3MBIA 2IHUA 1Q0HA 2VUHB 4ZAYA 5BWMA 2H31A 3DEHA 4GXTA 1PWXA 3DUFA 2YN0A 3ULKA 2ZGVA 3AEUB 3H9EO 1USGA 2HRDA 2HPHA 2G77B 1QQ5A 1ML4A 2KQUA 5EKSA 1CFZA 1QYVA 3BK2A 4EEYA 1OIXA 1VL1A 3AHIA 3KLOA 1XCGB 4TXLA 5EL0A 2WWFA 1JXLA 2BMFA 2PD6A 4A2CA 3VOSA 2HA6A 2VYVD 2Z6VA 3IQWA 4ZQGA 2V7QA 4YUXA 1PR2A 3PWTA 4TUYF 3PCTA 2UVPA 1GG8A 3OX3A 3PT9A 7AT1A 3QEBZ 1R1DA 2YN2A 3FTDA 3QBJA 2SKDA 4OSEA 5JD3A 3V8PA 3AB3A 1W0JD 3EUFA 2R68A 3DEEA 3RRHA 1GUYA 2C7RA 1SC9A 3OIWA 3SSNA 1E5QA 2RH9B 1SXJB 3OQBA 2E4AA 2RAFA 3OZXA 4L8FA 4BLVA 1GKYA 3R5SA 1U7XA 4GPEA 2CWDA 5F1YA 1TA4A 1XDBA 1MQAA 1P1RA 1V85A 1R64A 3DLPX 3MMPA 2BPGA 4YJGA 1ONNA 3K2EA 3PPXA 3I01A 2OHHA 3GPDG 4NEGA 4X71A 5EUQB 1TJ4A 3PXGA 1G1AA 1T9BA 4NDNE 2P90A 2NU6A 5FJIA 5TRTA 2J0QA 1UMDA 1XKXA 2EKDA 4IWXA 4EI9A 4BHTA 1P6QA 5CBPB 2FOXA 4GMDA 4OX9B 2FMXA 4LIPD 7ICFA 3CRQA 2KK0A 3NRZA 1PK1A 3ORSA 3R6WA 3LRTA 3L7MA 3UHFA 1ADCA 1O5IA 1LVHA 3FTEA 4FBMA 4IQWA 1B1CA 4EYSA 3ZHZA 1YI0A 1K6XA 3M0EA 4PWYA 2HA5A 3HS3A 4KWIA 4RCZA 5K03A 1I2CA 4GP6A 4UASA 1B42A 5E7MA 1X9GA 2O19A 1N6KA 2H1HA 2IYWA 4LV5B 3TNFA 4WCVA 2EHDA 1F51E 3VYVA 4DSLA 1SVIA 4PX2A 4RVOA 5DSXA 1Y82A 3H13A 1TM1E 2HQRA 1S0NA 3MLEA 2FE1A 1EP3B 3CXRA 2V6BA 4K7JA 1L1EA 5E38A 4ZT3A 1NBIA 5HKAA 3ERCA 4QYTA 5IINA 1X6VA 3KHLA 5CDFA 1PS8A 2HUNA 3QQ5A 4KH0A 1YVEI 3DLBA 2FP4B 3PUWA 2FUNB 5AXDA 2FDXA 3EGXA 4JEIA 4KOEC 3JQAD 5DX0A 3H4DA 1D0IA 2ZJBA 3N2GA 4S0ZA 5FEMA 1KJIA 4V0ME 2TMDA 5CVJA 3CINA 5EJ4A 3ENZA 4J9OA 2ZOSA 5D3MB 5JG7A 5MN6A 2Z6UA 2Y0BA 4PYQA 4CKZA 4BVBA 1XNQB 5EXDA 3GEPA 1KJNA 1NZBA 3R5KA 1YQDA 3IG8A 3FPGA 4WZZA 1WDWB 2EF0A 3HLTA 5AW9A 4HAOA 5D5PA 3WWCA 2PUCA 4WMLA 4OM7A 3E9DA 3V2IA 1I4WA 1MD9A 4TMKA 4HNSA 2XLCA 1OYYA 1T8PA 1CTQA 2OHXA 4UXHA 3JPQA 4DA8A 1Q3HA 1E2DA 3HPQA 3RG8A 3ZEAA 1AQ6A 1IHPA 2IS6A 2FSIA 4BWVA 2HNBA 3EMDA 2FTKE 5I5EA 2LPEA 4H3KB 5T7BA 1F5NA 1NVBA 5D00A 2X4IA 3DA8A 4KG7A 1L4NA 1T3SA 4DLBA 3HNRA 1QO9A 1ZKDA 3T1QA 3GFOA 2PMDA 5EMMA 3RJTA 2O52A 3LTNC 3SLKA 2LYHA 3E5MA 3NVYA 4RM3A 4B79A 3CF4A 4LDNA 3HFGA 3TSYA 3RVRA 3N3BC 1BVYF 1MG5A 3K35A 1S2IA 3BSYA 2RD2A 1U99A 2EC5A 2JS7A 3WB9A 2ZIFA 3ORFA 1QDLB 3BH6A 5K4AA 2NPFA 3C7TA 1SCNE 4CMGA 4ZI2A 4HAWA 1SKWA 3NH6A 5FQNA 1MJGA 2QN1A 3T7KA 1OWNA 1J0DA 3C48A 2H4JA 3GJSA 4S2UA 4AP9A 4EBFA 5C0YA 2BY4A 4NY8A 5L3SA 4TLBA 9ICGA 2WD7B 1PBNA 3QXJA 4KDCA 2X1VA 4RHYA 1HURA 2W3RA 1EUCA 2QXTA 4PHHA 1KXJA 4B8ZA 2K8AA 2BKAA 3UBMA 1W85A 3WWPA 1J8FA 1CQXA 4G3XA 5FQOA 1RBQA 4WXHA 2YW2A 1YIOA 2VPZA 3KCNA 2INGX 3O8BA 2ISSD 3Q0IA 1CUJA 3EWAA 2Z2JA 1ENYA 4O0MA 2GZ2A 2HHWA 1NQAO 1I7QB 2QAGB 3BN3A 3HDHA 2FV8A 2L18A 2WM2A 2ZTVA 3O4IA 3IVCA 3PXUA 1M5UA 4FOPA 1OF1A 2VTDA 4PNZA 5CFPA 4D57A 1JZTA 1IZYA 2ACEA 3QZUA 3UYLA 1Z6QA 3WIVA 2O7QA 5K0FA 1AN0A 1W4BA 4WUVA 1W88B 3CEMA 3C1ZA 5DXJA 2VQDA 4WLEA 2HT1A 5DGDA 5BT9A 3IAM6 4E3ZA 1TCUA 4KSCA 1KMNA 4YFVA 4DT1A 3HBAA 1ETUA 2LDBA 4ZQCB 1ZUNA 2LBOA 3DXXA 1NVTA 3R77A 2AK2A 4FGKA 2CFRA 5T57A 4BV9A 4EJ2A 5JS6A 1XLTC 5EGSA 4BMVA 4CM4A 1SPBS 4FNMA 1JDUA 4Z6CA 3U3XA 3CPEA 1S9FA 1P4SA 3V1TC 2PU5A 5GJBA 3DOFA 2H1LA 1Y9JA 1P0PA 2TSYB 1E58A 2GSDA 2GYYA 2J59A 4HLUA 3TFRA 5EN4A 1Y7PA 3P94A 1BC5A 2LRHA 1RRFA 3TVTA 1D04A 2B1RA 1U8CB 3LQQA 4L6AA 4PZ0A 4RPYA 1VCMA 1T8EA 1IEVA 2PKYX 2XDQA 2W98A 1ZQOA 4NS1A 3AOEC 1HUQA 1Y48E 3UTDA 2P4SA 4ED0A 1KNQA 4HAXA 3VR3A 4U9UA 4IS7A 3S5JA 4UMDA 5ALUA 4Q9DA 2FR0A 3QPDA 5GWXA 3VZSA 4CETA 3P0JA 3SYRA 1J1ZA 3PQ3A 4UVIA 1BDMA 2OAQ1 1NA5A 4IDBA 4QICA 3VUFA 2HBJA 3UKOA 2ZSHA 5U4XA 1L5QA 9ICPA 4Y2JA 2CLEB 2OL4A 3AJDA 3IP9A 4W5JA 2FLPA 1EWVA 5B3AA 4KLJA 3NV7A 5EZYB 3QBVA 2I99A 1ZQHA 2LPMA 3CH7A 3SYMA 5L51A 2GO1A 4PBSA 3R7WB 3WJ7A 1IUKA 1E2JA 1KYIA 1OLOA 4NICA 4Z9BA 2R0QC 1QJ4A 2NU6B 4PYIA 2DKFA 2ZBDA 4MJ7A 4EUKA 2CLMB 2V1XA 1RWPA 4EUSA 4H7HA 4NXNB 3ORYA 3HKCB 3BSWA 3CWCA 2WAMA 4FYKA 5DT2A 4V24A 3PVZA 1GGNA 5DLEA 2O8CB 1E2GA 3GEHA 5KEIA 4RHXA 1X7WA 4OXRA 1SVMA 4XRHA 1KY2A 1NJ1A 2B94A 2I4MA 3CNBA 2AX4A 1PYGA 3NKVA 2WIJA 3L6CA 2BPCA 5ALKA 3R0JA 4J0HA 2IEZA 3M7DA 2NYAA 3BSFA 1LCIA 4XJXA 1ZM2A 2C04A 3RTVA 1ZX1A 3CRVA 3UEOA 2N75A 1MZVA 1P5ZB 4KDFA 3DLAA 3DOCA 3M5WA 2ZS7A 2WU0A 4BFZA 1FDOA 2NYVA 1YMVA 2V65A 2EZUA 1J24A 1Q1ZA 2QVBA 3PW7A 1UMBB 4YVZA 5EMNA 4GKJB 1Z2NX 3HCBA 2H3ZA 2E37A 2Y6UA 2XRZA 4BV8A 1Y6JA 4M9LA 3A6GA 5DGAA 3A3OA 4OKNA 4REQB 1YZYA 5GJVC 4K0RA 2VQSA 4UTOA 2RHTA 1JXEA 4C03A 3IKTA 1L9KA 1NXVA 4TRMA 3PMLA 1T9DA 1F6WA 4CKWA 3QPAA 3IG5A 3QU5A 4ND6A 1V16B 2WAQF 1D1QA 4K8RB 1K66A 4WBNF 4OIFA 4AQDA 1A9PA 3NBAA 2DM6A 4ZT2A 3BB1A 4RTMA 3DPIA 3MJFA 3ZGNA 3DEAA 4Y2TA 4O9MA 1HE8B 1Y4UA 5THKA 1KSJA 1R9MA 1L4UA 2WHQA 4HEQA 4U6SA 1UBCA 2VYVA 3OX2A 4QU8A 3PFHA 4WFKA 1Z06A 1ZVMA 3FIJA 3SHFA 3LC7O 4M0AA 1C3JA 2F90A 4FI3C 4OI4A 4DMKA 1OGYA 3CVVA 4FS3A 3C3AA 1VI5A 4DMRA 4X92A 2ZI9A 1T6YA 3X1WA 4AIRA 3RADC 2YVUA 1SB3C 1I4OA 3AESA 5JV5A 3NO4A 5DI3B 3IOBA 1R7RA 4KE6A 1JALA 3H65A 5AKGA 3MGHA 2KI5A 2QGNA 4CL2A 2VBCA 1TAHA 1SJ9A 2GHQA 4O8CA 2VDRB 5C1OA 3F74A 3VVBA 3L01A 1DU4A 4CT0A 2F1IA 5IW8A 3WY9A 2XNJA 4W5QA 3GILA 5C8XA 2GM4A 5KQSA 1GZVA 1YH3A 1V11B 4G8DA 1TTTA 1JT2A 1RHMA 3FM9A 4I2HA 1XPJA 5AK6A 2Z8ZA 3E1SA 3JQBA 4RL6A 3WLKX 1B43A 1SCUB 1YUMA 2VHVA 1LI4A 2YASA 3MSXA 4FHEA 4MICA 2QTWB 1U3FA 5CLLA 5HFJA 2E49A 1NW8A 4QFMA 3EVFA 3V4ZA 1G63A 2GZMA 2IOFK 2F9MA 2VRWA 3BMQB 4IH4A 3ZVKA 2C1XA 3L92A 4MCAA 2P5SA 1JFLA 4NTZA 5CH8A 4TMWA 3ILHA 1OWLA 2CUNA 3CVYA 2WJHA 2ZWOA 1ZVJA 3HCAA 3EY9A 1K06A 2GJ8A 4EA7A 4XVCA 2QUBA 4ECRA 4EYKA 1K7XB 1BROA 1ZCAA 1NE2A 2ZRQA 4GRAA 2F3QA 4LKRA 5DF1A 1QG2A 4QE3A 2WD8A 3PJFA 3ANTA 3P4UA 3HRDD 3RYHA 1TADA 2CT8A 1XNRB 5FF9A 2MSNA 1RPJA 1MLDA 8ADHA 4QUHA 2K7ZA 2HV8A 1M2HA 2O6HA 1EJ2A 2X5JO 4HMQA 4FT4A 4H1HA 1W5AA 2ESRA 4GT1A 4H1TA 4Y1FA 1XVIA 5BYBA 5DULA 2RGGA 4LY6A 2PMKA 4MV4A 2G9NA 3UAZA 1KQOA 1G3QA 2VP9A 1TI7A 2Q3FA 3QUCA 3B1VA 4FR0A 5CRXA 3FFXA 1SWVA 2FSUA 4HJRA 3PXAA 3AM1A 3O0FA 2J85A 1F8YA 4GDMA 1X7ZA 3MUEA 1G3MA 4MPTA 4BBPA 4QZHA 4MP6A 4DJTA 1FFGA 1W36C 1FC0A 1ZQRA 2I6GA 3ZE2B 4E5MA 3WLRA 1F2DA 2ZRIA 1KFTA 3DBHB 2ZJFA 3I6YA 2JHAA 1UMBA 4NZZA 2Q3MA 2JHDA 1EUDB 1KO4A 2P5TB 2AYYA 3PSFA 3KR1A 4LJ7A 4TX1A 3OTIA 1GEGA 5L1IA 4FDUA 4G26A 4KO8A 2ZRBA 1YA6A 5KTRA 1N33B 3R5HA 2J3IA 4IXDA 3RR8A 1EEXB 1QKKA 1SA0B 3RJKA 4P0PA 1LS6A 1X1AA 2E1PA 5EOZA 1FY2A 3EODA 3K2QA 2QY6A 2QMZA 3BFPA 1E4YA 3O38A 4LRSB 3PC8C 2NNLD 2AMYA 4XD7A 4JB3A 4UEQA 2GT1A 5FXMA 4KFTA 2OXEA 4Y2XA 2FWMX 5I9MA 3RV3A 4V2UA 4X8LA 2IUYA 1P7PA 1SIJA 4PFKA 5F64A 5ILGA 3MEQA 3KTFA 1ORDA 1AK1A 2W2XA 2UV8A 3LZCA 4A5SA 3BWCA 2BFFA 2H2AA 3ZWPA 1G4UR 1HDXA 3GBSA 1YXMA 4NEHB 1QB8A 5F2EA 5HM8A 2AXQA 2B35A 1NUUA 2IYUA 1GDHA 4C7KA 1IZ7A 3GN2A 2IUUA 4PLZA 1SXHA 5C8YA 4UPVA 2DR3A 3UK0A 4IHJF 5C3MA 3FCCA 4QX6A 3TOZA 4BBJA 3L0YA 1EUYA 1QHYA 2YS6A 2SBTA 1KI6B 1JJIA 3AESB 4FDLA 4MUYA 2CNBA 4INPA 4QARA 5L7TA 2WSYB 5F7ZA 2YR0A 1YQGA 3GJ0A 4YC7A 2XT0A 2DVMA 4FBUA 1G8FA 3NAQA 4AJ9A 2QI9C 2ZBUA 2C83A 3UJHA 1KBZA 1XCJA 1QIIA 1U11A 2RHOA 4BB0A 4CNBA 2WG0A 3RC8A 2H1SA 2I7VA 2NN3C 1MN8A 2AS0A 3HVKA 3NDBB 3WSVA 1QGDA 3H2KA 5FPQA 4JLVA 3N74A 4YV7A 3V5NA 4DG5A 2ZXHA 9ICUA 1JKFA 3KAPA 4NJEB 2M98A 3QPWA 4QAJA 1GCOA 2WIBA 3PWSA 2UXBB 3W7VA 3IE0A 1IRIA 1KKXA 3GJ7A 3R76A 4ECAA 5JSKA 1E4VA 1P9NA 1ZYQA 2B83A 1J2TA 2PX8A 1MJGM 1OLSB 3KJFA 1TZ2A 2QN9A 1UT6A 4QUJA 3PTLA 1G4HA 4ZO9A 4IZOA 4X85A 4PG8A 2XCAA 3M9MB 3BXHA 1A76A 1NNUA 2X9LA 4ED9A 1JH8A 1I5OA 1Z2CA 4WVFA 4XX0B 1NIJA 2GBIA 2DSTA 3P0FA 3PE4A 5CVUA 3UCEA 3HY4A 3GELA 3K31A 2DUNA 4Q48A 1K7FB 3U40A 4NZ9A 4IOKA 4POOA 5CTJA 3G2HA 3NEAA 4QPPA 2H4YA 2DHQA 3D9QX 1LPMA 5KBYA 1OUQA 3EGDA 4B3MB 1JHDA 1NG1A 2IYQA 3GO4A 1N0UA 4HOYA 5KSZA 2GRUA 3NJRA 4YT2A 3WFIA 1Z28A 4OXYA 4A26A 4IRMA 2FMSA 1HEIA 2PJZA 4TXHA 1NSYA 1VYHA 3GHHA 4M9XA 1SD2A 1YU6A 2YDYA 4D97A 2RB4A 1UK6A 1JJBA 3D8RA 3VTFA 1L8AA 5AVQA 4AWAA 3NWOA 4CF3A 1YUNA 4V0MA 1FYWA 4LWQA 2JLAA 5DFAA 4LZGA 2CMHA 2XNHA 3D2QA 4N49A 3RRFA 4AWXA 1LSUA 2G71A 1JDNA 4LY0A 3SWWA 2XMDA 3TJZA 2WTUA 4OQMA 2F8SA 4DAEA 3AJEA 1JHYA 3UB2A 2AB0A 4EB6B 1YRLA 1G2IA 1ABFA 3LG2A 2XA9A 5K51A 3ZWYA 3EMKA 1SIUA 2EF1A 1GV1A 4IUCS 4RDIA 2XZLA 3WQSB 1DJPA 3CX4A 2V97A 3DBHA 3CY6A 3UQ0A 4EMTA 3U5ZB 4NLZA 1C3VA 4HX9A 3E5NA 1FOEB 1WW3A 4LSGA 4OBWA 3FTQA 4ZT7A 5KC9A 1YZKA 1Z5WA 3JAMA 2TYSB 3PZPA 1FVXA 4HTAA 4BKUA 3ETDA 1DXSA 1PZMA 4KL8S 1YQUA 1D8TA 4WGGA 1BPZA 1JR2A 4II7A 2GA9A 2DUJA 2C7OA 3DWIA 1T9ZA 1KWKA 4P7GA 4RVCA 3E1KA 3PNLA 4TKVB 3PUHA 5WRFA 3ROEA 2COEA 3CWZA 2OBMA 4NMHA 4I1UA 5JW6A 5IF9A 3GPIA 5L3VA 2YICA 4IRKA 2B1QA 2VNKA 5AM0A 3AP3A 3BA1A 3N2KB 1WY5A 3ORRA 4IDQA 4LV6A 3IAXA 2AFRA 3SF8B 1K2VN 2XF8A 2YFQA 3T3HA 2B25A 1ZQKA 4UB5A 1N5DA 4CFZA 5INTA 2XA2A 3NOVA 4M9SA 3DTVA 3IVXA 2I9KA 1LGYA 3RUIA 1T6BY 2O2SA 3R0ZA 1ZBDA 5EZSA 3PX4A 2H7YA 2I6UA 1D2NA 2LUOA 3QXCA 2W9CB 2PR2A 4GEKA 5E7IA 1FTSA 2VT3A 1J8YF 3NAMA 4P32A 1F5SA 4LHZA 3TIVA 2QVXX 1R66A 3EOBI 1A50B 1AHPA 1CZUA 4F0JA 4L15A 4GICA 4MAFA 2R6JA 3RSZA 5CURA 3FYDA 1V97A 3KZXA 1Z5OA 4N3AA 3U3DA 1NBEA 5JNTA 3T3OA 2XO7A 1HTWA 1KJJA 2QJWA