2WF9A

Structure of beta-phosphoglucomutase inhibited with glucose-6- phosphate, and beryllium trifluoride, crystal form 2
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
221
structure length
221
Chain Sequence
MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQKQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords BETA-PHOSPHOGLUCOMUTASE
publication title Near Attack Conformers Dominate Beta-Phosphoglucomutase Complexes Where Geometry and Charge Distribution Reflect Those of Substrate.
pubmed doi rcsb
source organism Lactococcus lactis
total genus 72
structure length 221
sequence length 221
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2009-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2wf9A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2wf9A01
3ZWDA 1QQ5A 3FM9A 4L6CA 4UU0A 3ZX4A 3QUCA 3FPSA 2ODAA 2ZBFA 4BNDB 4BX0A 3KD3A 3U13A 5AW5A 2WFAA 2G06A 3OCXA 4IFTA 1TE2A 5AM4A 2HX1A 1Z5UA 4YGYA 1ZD4A 3WK6A 4Y2QA 5AK5A 3SF0A 3OCZA 3I1YA 2QLTA 4Y2JA 2YMPA 3OTQA 4UW9A 2WF5A 2ZBDA 2ZG6A 4J2TA 2EARA 2HDOA 4HAIA 4OD0A 3ZVMA 5A3RA 3B9RA 2WF7A 4EX7A 4KNVA 2O9JA 4XOUA 3NANA 3ZW7A 2PQ0A 5AW3A 2WF9A 3WK5A 1L8OA 1Z4PX 1ZD5A 1TJ5A 2RARA 1RC8A 2G07A 4DWOA 1RPZA 3B8EA 4H1WA 1Z4JA 2G1AA 3A1CA 3NASA 3U7HB 4KX5A 4YCMA 1RKQA 1YV9A 2AH5A 4CF3A 3K1ZA 5ALJA 4HGRA 4RETA 5ALWA 1J8DA 5ALFA 2Q4RA 1U7PA 5AKHA 5AKZA 1U7OA 3NRJA 4NV0A 4BX2A 5AKIA 3QXGA 4Y2UA 4F72A 5ALVA 1PW5A 1AQ6A 3QX7A 2OA0A 1Q91A 4Y2RA 2RB5A 1Z4NA 5ALEA 2B0CA 4CF4A 3N1UA 4B6JA 1MH9A 2OM6A 5ALUA 3TLMA 3W5AA 5ALHA 4UMDA 2HEGA 1YDFA 3KOOA 2W43A 4BNDA 1ZOLA 3WKEA 3EWIA 5ALTA 3E58A 3QU5A 1WPGA 2GHQA 5ALSA 2Q4TA 5ALYA 4C4TA 1T9ZA 2C9MA 4Y3UA 2I54A 3ESRA 2P27A 4YCLA 5E0OA 5AK3A 5ALPA 2CFTA 2D2VA 3I76A 4UMVA 2P69A 2FUEA 2MU1A 4UARA 3KDPA 3U7EB 2GO7A 5ALMA 2C8LA 2R8YA 5ALGA 1SWWA 3QUTA 4EENA 1YMQA 3AR2A 3QGMA 3M9LA 3OPXA 1ZRMA 2R8XA 2YMMA 2WM8A 3QYPA 2FPWA 3BWVA 5ALNA 2I55A 2RAVA 2GMWA 3VAYA 4Y2YA 2HOQA 4ZEWA 3RFUA 1RMYA 1Z4LA 2YJ6A 3L8HA 3W5DA 3ZTYA 3PDWA 2WF6A 1XVIA 3U7FB 1Z4KA 2BY4A 3ZVNA 2EATA 3R09A 4NWIA 2GHTA 2AUTA 3QUQA 4UAVA 1T5TA 4ZEVA 4C4RA 2C88A 2NO5A 2I33A 3AR7A 3AR5A 3E84A 1Z4QA 2B1QA 4EELA 3RF6A 2YBDA 3A1EA 1RKVA 3WKAA 1U02A 5AVYA 4Y2PA 5AKEA 4L57A 4AS3A 4DCCA 3QUBA 3SMVA 1Z4OA 2RBKA 1O03A 4Y2TA 2IA5A 3ONNA 1Y8AA 1LVHA 2VKQA 3IJ5A 3QU9A 4NFLA 3L8EA 2G09A 1VJRA 3QU4A 5AM3A 3FGOA 1XP5A 1SWVA 5A3SA 5AKXA 2WF8A 3W5CA 4UASA 1YJ5A 2FPUA 2G80A 3KC2A 5AK6A 3S6JA 3AR4A 2YJ5A 3ZU6A 4I9GA 2JAOA 5AKKA 3ZTWA 4QJBA 2FEAA 3PCTA 5AVWA 3N07A 1T5SA 5AW8A 2HF2A 2HHLA 3QU2A 5ALDA 3GYGA 2ZBGA 3WKBA 5AIBA 3AR6A 4CE6A 1RLTA 3OCVA 2CN1A 1EK2A 3N8GA 4JDPA 2W11A 2HF7A 4Y2XA 2C8KA 2YJ3A 5AM1A 1QQ6A 1L7PA 2GFHA 3OCYA 2ZXEA 1LTQA 1N8NA 3KZXA 3NUQA 3WK7A 2IOFK 2ZOSA 3EF0A 3L8GA 5AKYA 1NF2A 5ALQA 4HYTA 2ZBEA 1RLMA 5ALLA 3ZVLA 3DNPA 5AIAA 3L0BA 3QU7A 3UM9A 5AVUA 1CQZA 3MN1A 4JB3A 3WGUA 1ZJJA 4UAUA 5AKLA 3SD7A 2HCFA 2JGAA 5ALOA 3UMCA 1RMTA 3U26A 2HSZA 3F9RA 3PGLA 4UU1A 2BDUA 2B30A 3ED5A 4HGPA 3L7YA 2G08A 5AM0A 1S2OA 3M1YA 3ZI4A 1QH9A 3L1VA 3ET4A 4UATA 4XE5A 1L6RA 2B8JA 2AGVA 5ALIA 2CFRA 3KBBA 3U7GA 4MUMA 4AP9A 4OFZA 5AVZA 4OCZA 3IRUA 3OCWA 3E81A 3ZWKA 3UMGA 3L0YA 3A3YA 1F5SA 3SLRA 5AVVA 4C4SA 1VJ5A 1J97A 2JAUA 3ET5A 3R4CA 1YS9A 1S8OA 3B9BA 5AM2A 4CF5A 4KNWA 3AR3A 3ESQA 3D6JA 5AI5A 4UM5A 2PR7A 1Q92A 4BEVA 1JUDA 4YIHA 3MC1A 1L8LA 5AM5A 4HGNA 4YH1A 2C4NA 3FPBA 2YMLA 3ZX5A 4YIKA 2FPXA 4Y2SA 4EZEA 3WK4A 1RRCA 1K1EA 1X42A 2I7DA 5AW1A 4KX3A 2YJ4A 4HGOA 2G0AA 5T41A 3CZ4A 2HO4A 3DAOA 2FI1A 3WGVA 2IOFA 2OBBA 5JJBA 3QNMA 3FVVA 2DQSA 5AVTA 3NIWA 2YY6A 5IS2A 1RKUA 3DDHA 5AI6A 4G63A 5AKGA 2P11A 1TJ3A 5AI4A 4GXTA 4XPZA 1RDFA 4J03A 1IWOA 4BX3A 5AI0A 4UMEA 4CNQA 1TJ4A 2JARA 4BBJA 5A3QA 4KYTA 1ZRNA 3J7TA 1QQ7A 2QYHA 2B82A 2BDEA 3W5BA 5FP0A 4FE3A 2B8EA 4BYGA 1L7OA 2O2XA 4G9BA 1NRWA 1Z88A 1ZD2P 1XPJA 5ALKA 4PNHA 5AICA 3IB6A 5IT0A 1NNLA 2EAUA 1RQNA 4IG4A 1Z4IA 2FPSA 5AW4A 4BEWA 5AW9A 4FYPA 5AW6A 2PKEA 1SU4A 5AVQA 1WR8A 2MU2A 2FPRA 2R8EA 3MPOA 3SHQA 5AW0A 5AVXA 2NYVA 5AKJA 2NO4A 4E88A 3BA6A 2WHEA 3CNHA 2YN4A 1TA0A 1Z5GA 2YMQA 5ALXA 3WKCA 1RQLA 3QLEA 4DW8A 1FEZA 4O8CA 3R9KA 2X4DA 5AVSA 2R8ZA 3SKXA 2MSNA 2FDRA 3L1UA 3N5KA 1ZD3A 2CFSA 3N28A 3OCUA 2OYCA 3L8FA 2AMYA 3L0CA 1N9KA 1EK1A 3PGVA 2Q5EA 3A1DA 5AESA 4XQ0A 1WZCA 3EPRA 4BKMA 4HGQA 2I6XA 3WKDA 3DV9A 2P9JA 3NAMA 5AVRA 1RMQA 2IOHA 4OHFA 1Z4MA 2YFYA 2IYEA 4MWOA 3SKYA 5AHXA 4NAVA 4Y2VA 3U19A 3HYCA 3HLTA 4KN8A 2W4MA 4L6AA 5ALRA 2I34A 1CR6A 4UMFA 1WVIA 3I28A 3E8MA 5AK4A 4QQFA 4UM7A 3NALA 1L7MA 5AW2A 2FUCA 3L5KA 3WK9A 3P96A 4NABA 4EEKA 1KYTA 1VFPA 3AR9A 1ZS9A 1QYIA 4ZEXA 1O08A 5ALZA 4GIBA 1L7NA 3I6BA 3UMBA 3WK8A 3ZUPA 2B1RA 2JAWA 1YNSA 4AS2A 1U2SA 5AI9A 3MMZA 3EF1A 2HI0A 3AR8A 5AW7A 4FFDA 4EX6A 4F71A 3FZQA 4I9FA 1U2TA 4YCNA 4RESA 5AI8A 1RLOA 5IT4A 4DFDA
chains in the Genus database with same CATH superfamily
2XCLA 3ACCA 1ECGA 1P1KA 4XI9A 4NLZA 1RAHA 3IVMA 3D3WA 1Z1VA 4MW2A 5LZ4A 2HX1A 2I3AA 2OAEA 4G0MA 3F8TA 1QO0A 1V5FA 4F1JA 3I2GA 1HL7A 4RM3A 3QOYA 5LBIA 3TQSA 2WYUA 1JSZA 4RA6A 1TVMA 3Q0EA 4HS4A 1M54A 1KJIA 4QYXA 2KPOA 4YCMA 2Q6KA 3A2KA 3H1GA 5KFQA 3QW2A 1QBKC 2JB9A 1K3TA 3PRKE 1IN4A 4CTNA 2EFHB 2O59A 3SS9X 1EGHA 2WP8J 2GD1O 3SZGA 2F6RA 3E5MA 2FEMA 4R2JA 4E94A 4BKQA 4TXHA 2QJTA 1TCAA 2ECPA 3I72A 3L8MA 4IQ0A 3AEVA 2RP5A 2JGMA 1NONA 4FZNA 4PZOA 2I54A 1GR0A 3LH5A 3IQGX 4KPUB 3OZBA 1CJSA 2V74B 3BMNA 5A4JA 2GKSA 3KWLA 2Q4EA 1JDBC 2N47A 4TVKA 4LBVA 4Q8EA 3AP2A 2P5YA 3MWEA 2YV2A 1ORWA 2B78A 4CM4B 2C07A 1QGED 4XM0A 4MW5A 1LWOA 4IDHA 3OE1A 4CMCA 3E8XA 1SBHA 4GVPA 5IC4A 3MCTA 1YB2A 2IA5A 1JQDA 1Y8AA 1NQXA 4C05A 1ZOPA 1TK0A 4ND1A 4UBCA 2HHCA 5EOVA 4UASA 1YJCA 1OPXA 5IJZA 4N76A 1JDZA 3PEFA 2FMIA 3FVQA 2L69A 4KFTA 1OILA 2J5XA 3I9MA 4WE3A 5HJ7A 2D0PB 3BQNB 2B4TO 1EFPA 5LMZA 3TXAA 1U0TA 4O33A 5T8KC 1JHZA 4B6PA 1Y1TA 3H2HA 3RH5A 2RHCA 1XNGA 1D4OA 3L1JA 2B4AA 3U3KA 1IY0A 3IDSA 3BXXA 3R5KA 3A14A 3CW9A 3D54D 3H4TA 1VTKA 1LJUA 1DINA 1JMYA 4PRYA 1N2IA 1QFYA 4B40A 2I0FA 3HB4X 3MUNA 3ZR4B 2BFCB 1ECPA 2R8JA 2ALZA 1XD2B 5K0NA 1JAHA 4EHAA 4CMIA 2PUDA 2PMKA 1L3BA 1RZTA 4J1QA 1U7WA 4R3UC 2H06A 3FGNA 4HPJB 2BV3A 2BZ1A 3C5EA 3RTGA 1YXMA 1J56A 1NE7A 4B6RA 1TJ3A 5FBQB 2X13A 4NL4H 5JJ5A 3D43A 3DDUA 4KBYA 4KXMA 4LWZA 2BDEA 1Z39A 1DKLA 3DMNA 4Y9DA 4ZOLF 2BHLA 5C5CA 4HLUA 1XTJA 1J8FA 4ELVA 5GINE 5C8YB 4J0QA 4OAPA 4INAA 4CLOB 4D4IA 4J0EA 5K0SA 1OWNA 4QUJA 3M6ZA 1FK8A 1E1RD 3DMPA 1WZIA 3I5MA 1CWUA 3LA6A 1VLZA 1YCHA 1IEXA 3L5OA 3P19A 4KLUA 1RR6A 1AMNA 2QX9A 1AHIA 2EW1A 5H9VA 2I03A 4WVFA 4EYQA 3ODPA 2B6HA 4E7PA 2BR3A 1KWKA 2J5KA 1PLLA 4YAJA 3L7LA 4MZDA 4NARA 1Y63A 4OP1A 2HNKA 2WKSA 1RFGE 3PXCX 2PLRA 4R64A 2QV0A 2Q0SA 4JQZA 3UHPA 4F71A 4I9FA 3I3OA 1LNZA 1P17A 2XB8A 2QZJA 3JPOA 5BSFA 1HFWA 3QFCA 4XD7A 3C3XA 2QAJA 4D6XA 1KH1A 5HQJA 4CIBA 1W0KD 1YU9A 1VMAA 4TTTS 5DX1A 1QF6A 4YJFA 5CW1A 3D2AA 4YCBA 1G8SA 4C6SA 4JA2A 3SS8A 3LIPA 2QS9A 5TZVA 4LI0A 1T9BA 2MRLA 4GP9A 4DC0A 2E8MA 2H8GA 4H0NA 4JT8A 4G1FA 3ZWBA 2VEDA 1J25A 1KYZA 2DF4B 3ETCA 1NK7A 1E62A 1G8KA 4XVCA 4OX9B 4E2ZA 4B33A 1Z4NA 3TLMA 2KBFA 4QHTA 2B92A 2XUZA 3EQ7A 4OB6A 1PWZA 4OO3A 821PA 2JJ1A 5CFQA 4YEDA 1BGWA 3DTVA 4ZQCB 3LLCA 4KAFA 4RPHA 4XVUA 1X7ZB 3K72B 4IXNA 1EEXB 5F98A 3W5SA 3QPCA 4A2PA 2FMSA 4ZU6X 1SWWA 4R5MA 5FTJA 4OJTA 2IBSA 1E6MA 4KXXA 3RS3A 2JJQA 4MS1A 1ATZA 1UUFA 1N1DA 2OHFA 4LA4A 3QPUA 3QJGA 5B4TA 3BXEA 1TZ2A 2X58A 4MR7B 3NKVA 1OBCA 5BQPA 5EY5B 1NVVQ 5DJ5A 1KZHA 3OAAD 2MA1A 8ICVA 3K92A 4LJ7A 1JSCA 2WJWA 4ACBA 4EJMA 2NNWB 2RHRA 5KNIA 2OEHA 1JHPA 1X9SA 3ST7A 3SDBA 1U94A 1YBAA 3K05A 4GZ6A 3TAXA 3KX2A 1O4VA 1G8PA 1NW7A 5EMKA 5K45A 2YDYA 1ST2A 4JHXA 1JU9A 2VRWA 4HXYA 1O95D 4Q4AA 5F12A 5DKWA 3KR9A 1SL2A 5IIJA 5FWNA 3WGUA 2EH9A 2Q99A 1HZJA 3ZYCA 2PQ2A 2WB4A 1SUIA 1K63A 2HCFA 1NOMA 2C4VA 2XRMA 4UU1A 2B30A 3E18A 2IYUA 1JIUA 2PBZA 1ULSA 5I9TA 2YWHA 4XWKA 1NGSA 3EWNA 2ZETA 3F67A 3L0YA 3C74A 5CNKA 2CV0A 2A0XA 3BQ9A 3B9BA 3D7LA 4EW6A 4QOIA 3AUKA 5F9MA 4DE5A 1FQJA 4M98A 3AH8A 3AHDA 4KH1A 1RJEA 4L75A 4V03A 4Y2SA 1W96A 3G6XA 2J6CA 3ASZA 1K6XA 3HVIA 4OMCA 1KK2A 4TGLA 2OBBA 1L5WA 1KFKB 2CL7X 1P0MA 1GG5A 4AROA 1K08A 2M6KA 4KL8S 5TARA 3JR7A 5LOVF 4QZAA 1YGPA 1KVRA 1HM5A 3IT2A 5KINB 4NHOA 1KK1A 3UJ8A 1I4EB 4BEWA 3AX6A 4PHAA 4UB5A 2G5IB 4G4SP 1KKLA 1INLA 3JYHA 4IRXA 4N48A 3FSRA 13PKA 2VJPA 2GBLC 4BNXA 1ZD3A 3N28A 2IGTA 2BKXA 1I7PA 2JL1A 3Q7RA 1HFEL 4POAA 4L5BA 4H1UA 2ZE8A 4B7AA 3OTIA 3WLPA 4KAJA 4C0HA 3B2QA 4DANA 1SXDA 2BPGA 3A9SA 2MIIA 1LLCA 1P1FA 521PA 4IEFB 1WVIA 3HJRA 2P40A 4DLGA 4AUKA 4OQXA 2ZATA 2PVSA 2YRWA 5ARDA 3KXLA 3N86A 2GOYA 4MEXA 3AY3A 3FI0A 2ZZMA 3FZQA 1UBNA 1E9EA 2M32A 4UU0A 2QAIA 2BHSA 3U5TA 2B20A 5FORA 4D9EA 1Y9EA 1I2MA 3DMTA 1BMFD 4ALIA 5GP1A 5E7QA 3WVNA 5JMOA 1H4TA 3LHFA 4KQ2A 3ZV5A 3VU9A 5CPFA 3C85A 4ZTBA 1BVUA 4EHKA 1R5NA 3WYFA 5DHQA 1MQSA 3MFQA 2Z4RA 4YDHB 5LP6A 4YN4A 2QYSA 4W99A 3RADC 1QCKA 4WY8A 3DLTA 4MEAA 3E2EA 2XTAA 1AK1A 4TUYA 2H3ZA 3A1SA 3U7HB 3BX1A 1H9AA 1YVPA 3CVOA 2F7SA 1PW5A 1V8BA 4CV3A 4NBNA 4ZEOA 3Q8RB 4AWBA 4EUSA 5LXTB 4EF4A 4C89A 2VQEB 3BMQA 1W49A 2VPIA 2J9FA 4UNIA 2I4NA 2GLTA 3RFVA 3CLTC 5JZBA 5JUWA 1JW9B 4MUAA 2XKKA 3K4QA 5B1YA 1KPHA 2NU9B 5BW5A 3R3HA 2C4HA 4KKVA 2X6TA 2PXXA 2ZRAA 2FPWA 1BCSB 3HNPA 3W7VA 4X1IB 1AZTA 4CHGA 3WGGA 3NBMA 2VHUA 4Y2HA 2FKNA 3QKRA 4N3AA 1XKXA 3BL8A 1KR5A 3FVRA 2AR0A 2R2AA 1W85B 1E89A 1WUYA 3B13B 4DDTA 2ENUA 3W5CA 1ISRA 3UAGA 4EK9A 3RQSA 2E5SA 3EK2A 1ENOA 2A5DA 3M8KA 4M4SA 4Y2XA 5KG3A 2RJ3A 4A1FA 4Q7MB 1GAJA 1QC5B 4WA7A 5DFAA 2PKQO 1MO3A 1MVOA 4B9NA 3OT1A 3HYNA 1U0FA 2QRUA 4QREA 3U26A 4OLBA 3ZD8A 1G6KA 1NBAA 2L2QA 4CTOA 1EP9A 2VTEA 5J8YC 3M8RA 1QHIA 2BRUC 4KO1S 4B9EA 3JYNA 2JCBA 1FFXA 3OJEA 2PFKA 2GLEA 4F56A 5EEGA 1VJTA 4L2IB 5EWFA 1E79D 4X1KB 1JBKA 1B1CA 3EAFA 3PWKA 4GVXA 2IWRA 1DS6A 3PW7A 4EOGA 4Q12A 4RD0A 4FCCA 3U31A 2KI5A 4DLKA 4L7QA 1UP7A 4QODA 2C2XA 1KP9A 1UH5A 2J0UB 3AQEA 5GIOE 3TMAA 2W0MA 1QUEA 1GCAA 5ETJA 1RI1A 5A1TA 1YONA 2EGUA 4TLAA 1NVEA 3ONDA 5TMBA 3B82A 4Z7QB 2WMNB 4XM1A 1Z88A 2DE0X 3ER9A 3HY3A 4NYJR 2ZCVA 5AD1A 5G4KA 2WMDA 1ANKA 2O2CA 9ICOA 4C20A 4PLFA 2C2HA 4OM8A 4DS3A 4QDOA 3BREA 2DUUA 3K0CA 2ZRNA 3OJCA 2OZPA 1IPHA 3BVPA 3GCWA 2H17A 5HSGA 1QVVA 3HC7A 4Y6QA 4ZVMA 2Y0DA 3NHZA 1NYRA 4RKFA 2XCRB 1SN7A 5HF5A 1ZNQO 3PV8A 2PWBA 5EA2A 5AVKA 2C96A 2RMKA 1AH2A 1C1HA 1C0PA 2OESA 1V1JA 4WFKA 1FPQA 5AOVA 3MELA 4FEAA 1YULA 3ROEA 1Y3IA 4M0KA 1JWLA 4HS9A 1DOZA 3D4BA 4GPEA 4B34A 4DA4A 3RJ9A 5EIEA 2P6NA 4XVHA 3F6YA 1Q57A 3RWOA 1NBOA 1XX6A 1MC5A 3MF4A 1VHJA 3TIFA 4NKRA 4PPYA 4Q02A 5SYMA 1TK8A 3KD3A 2NO7A 1JX6A 3DTNA 3TSCA 2DUNA 5CD9A 1QPZA 3ZWPA 4RD4A 4EA8A 5HM8A 1PGPA 4NNOA 4PCLA 1NL3A 1U5BB 1UPAA 1BJRE 3NM6B 1ENYA 5CT9A 1E9VA 3BRQA 4JZYA 5H9WA 3OLXA 4UJ5A 4DC9A 1CW2B 3DZGA 3MWDB 3AEQB 4DLBA 4BQFA 4JQSA 2OKGA 2CXXA 3TADA 1JXMA 3EXFB 3K1ZA 5E95A 5DBIA 5A2QA 1G5RA 2GAFA 2PKYX 4S05A 4IGAA 3GIWA 4C9BA 4QWWA 4DVJA 4TLEA 4L5YA 1HYHA 2W43A 1NJ2A 4DSTA 3LT2A 4OJNA 1A4XA 4MUKA 3HRHA 3GT7A 4IQ8A 3FUCA 2IUSA 3C2KA 3IOCA 2G9VA 4PHPA 1NOKA 3DE0X 1X39A 2XITA 1RD4A 1A77A 2I55A 2WD9A 2DHDA 3TMYA 4XX1A 1UBSB 2C3PA 2ZUUA 1CY0A 5CDFE 5D2CA 3E9QA 1E98A 1J2RA 1Q83A 2VA3A 3O3MB 4KK3A 4YV0A 4YT5A 4RK0A 5D3MA 3VZCA 1O03A 1NVTA 2PMZC 4Q4CA 2QBYB 2QORA 4MSUA 1B3RA 4FDAA 4RT2A 2NTEA 4BCBA 1BNPA 2C3YA 4N7JA 1YVUA 2P9GA 5THXA 2KVSA 4H7IA 2ACEA 2PL9A 1G7TA 3UJ9A 1ZQWA 2VF7A 2YJ3A 5DN6A 4I1SA 2PRYA 4I4LA 4EUNA 4DIKA 2AOUB 5K8TA 1RRGA 3IEMA 1M1YA 2OK7A 3CU5A 4LKRA 5AHRA 4C7JA 3UH1A 3LY9A 2P5SA 1EE2A 3W6UA 5IMSA 4Z1MA 3AIMA 2XUQA 3T5CA 3SLRA 3RSOA 1KAOA 5E9WA 3CBQA 4GPBA 4KTVE 1UK9A 4OHOA 2D13A 5KYTA 2FG6C 4IILA 4YJ3B 1V9SA 3T9AA 2FXIA 4ZOHC 2OM2A 2HD4A 2XKAA 5C7YA 1M66A 2A2ZA 4DMFA 1WD7A 1ODLA 1E7MA 3PUXA 2VAPA 4GMFA 5H0IA 4XM2A 3TO5A 2FN4A 3HJNA 2JCSA 1E3WB 3RJMA 4UQOA 1H2BA 3WAJA 4EFLA 1RJ9A 1Q3VA 4JI6B 2OOKA 2ACVA 3DPIA 3CJTA 3K2BA 4JR1A 3S2SA 1YMVA 3TI9A 5BMVB 4EA9A 4HB0A 3LHDA 5CRXA 1Q0TA 2QN7A 3V34A 3RYFA 3MPOA 1FDIA 3DLBA 1SOVA 3WNVA 3QXCA 5IXSA 1WTAA 4RSGA 3KPVA 3OHSX 4LXGA 5LPNA 3TCKA 1F0MA 4KDRA 3P32A 2HYIC 2OXIA 5ICSA 2ZB8A 4IQVA 3L0CA 4ODIA 4XX0A 5GONB 2P9EA 3VAZA 1DT3A 2GN0A 3A4IA 3LT1A 3C8MA 5JS1A 4A2WA 2FYTA 2E1EA 4WACA 2RHTA 2QL5A 4LF6B 2C2OA 4QQFA 3RTCA 5AW2A 1XDGA 1ZXXA 4PRLA 4MGHA 4HB4A 3Q5GA 4B35A 3LVWA 5FBKA 5DN9A 3PFIA 4J7XA 3VUFA 2P67A 1T1SA 3K4PA 3LBNA 1XS9D 2QR2A 1K88A 1HUOA 2YXDA 1I01A 3ZCXA 2ZYVX 3OE7A 2GK4A 1YK1A 1AM4D 3LC2O 1D1TA 1N32B 3U1BA 2P9ZA 1JR3E 3M1IA 2F55A 4BQNA 3VU3A 3KUDA 1I80A 3BQ2A 1JDJA 4A5OA 2B98A 2A94A 1CU1A 3V3KA 4YDSA 1HEKA 4L27A 1IHYA 1SVIA 2X0KA 1ULAA 2CHVA 4GKVA 4J16C 5J0WA 1KEWA 5C37A 1KMIY 5AFSA 1XCBA 4C0LA 3C5VA 3IBTA 1DELA 3G6YA 3EGOA 4NV0A 5DB7A 5ALVA 4CV2A 3JQFA 1IV8A 4NC9A 2R68A 4FKBA 1P7VA 1S3SA 4O3OA 1B8VA 1SAYA 3GUZA 3HVJA 3O0TA 3TGPA 1NUTA 3F7OA 5KSOA 3WU2U 5DM60 3AM4A 4BP1A 1S96A 1V7QA 1OTXA 2F3UA 1G3UA 4L02A 3A9UA 5GOZA 1B6TA 3WIBA 2P27A 3RJKA 2WUVA 1K7YA 1TV9A 3I76A 4AECA 1JEJA 3A6EA 3TLCA 3KYIB 4TN1A 4EW2A 4C0BA 1RNLA 3AR2A 4X66B 1H1LA 3GNTA 3DS8A 2Q1WA 3JPYA 4ZDJA 5ABPA 4EFNA 1AQUA 4KUHA 2A9KA 2F9MA 1NC1A 3QFFA 2IY9A 1VRCA 4R2MA 1P7DA 3A9VA 2F3TA 3I01A 2L0XA 3GRYA 1KFSA 2DP4E 9ICVA 4YP1A 2FTKE 2H5EA 2PH3A 2XSZA 2O2JA 1GY8A 3IJ5A 2W2KA 3DVRX 2VHWA 4WN9B 4L9SA 3EVCA 3JPWA 4NJOA 2E4ZA 3ZU6A 4DPMA 1NI5A 4GRAA 1TEVA 3HUFA 5DNUA 7REQA 4ZOLA 5AVJA 3VR5D 3EPHA 2OMKA 3TW6A 2L17A 3P9CA 2V9PA 4MIEA 2WMYA 5LQDA 5ALQA 3DBLB 5I51A 3W5UA 2AR7A 1AGNA 4Q93A 1RYBA 4BP8A 4B8ZA 7ICNA 1GYPA 5KIAA 1A2KC 1XBTA 3F6PA 2OAP1 4HGYA 1UR5A 3VR4H 1E1NA 1UPFA 4CTJA 3A1TA 3VPGA 1Y0BA 3OP4A 5JS7A 1BVSA 3IE2A 3A3YA 3QFSA 4KXQA 4DNOA 1II0A 1W4BA 4I1OA 1S8OA 2FF5A 2OSVA 3ESQA 1E64A 4LBWA 2P4EA 4Z6DA 4TWJA 1O0CA 3ZCRA 2J0QA 5I7VA 1AZLA 4Q4HA 1O95C 2EKBA 1HDRA 5HG0A 1U3UA 2XZOA 3ML1A 4LFAB 3EXG1 4H3HB 1H2WA 1HIWA 2JRZA 2RGWA 1XLVA 1VBKA 3WHIA 5JOQA 3EIQA 1SULA 1P45A 4RL4A 3TEMA 2G76A 4I2VA 3T41A 3WLIA 2O50A 3RC8A 2M6LA 1ZQYA 2ORIA 3ABOB 2BMEA 4E2XA 2KKVA 1RWVA 1P7PA 2LIPA 1M6NA 1SB9A 4PYNA 5B30A 3TVYA 1PSZA 3ZY6A 1IOZA 1N2OA 1X7WB 4E1VA 1YI0A 5LL6P 3WLNA 3TECE 1QH8B 3W7BA 1EFHA 5EWLA 4CM9A 1ZESA 1Q1ZA 3L1UA 3BAFA 4MVCA 3CTMA 2YY7A 1A9YA 1K0FA 2WAQC 2PSJA 3QEKA 3UKJA 3CM0A 3VR6H 2NOAA 1YZHA 3ZS9A 4XUCA 4CTKA 5JQWA 4B3JA 2OP1A 1HE3A 3A2NA 3OLVA 4YT2A 3OC0A 3UY4A 2CE7A 2JIZA 2VYCA 4MB0A 2VP4A 4YR9A 4JGIA 3IG5A 5BV8A 2AC4A 2MR6A 2WI8A 2VNKA 1AXEA 3ZWDA 3T4UA 2ZDGA 3U17A 1G1MA 4MYHA 1YCFA 1YC5A 4UBKA 2FPOA 1GNVA 1PR6A 2JH8A 2IUUA 1RPLA 2QPOA 3WLFA 3EYWA 1XNRB 1JG4A 1XKLA 2ZIXA 4BVFA 4MICA 3RSGA 2JPDA 4RE6A 4TKUA 4DQRA 4K9RA 3WK5A 1EUQA 2C2BA 1KDVA 4XIFA 1IWBB 1Z15A 1R8SA 1WWKA 3DEFA 3FD8A 4DUGD 4TUYF 4BX9C 1X80B 5DP1A 2YHUA 3D6VA 3UUFA 4JB8A 2QRGA 3LUJA 3MIZA 1NQUA 4OOEA 3JQAB 1V2HE 2O6KA 5LA6A 1QP7A 5ALHA 3TCNA 2B2CA 3L4JA 3BZBA 1OXKB 3I5YA 4BNHA 3AIOA 2C8VA 3C6QA 1PFWA 1IXZA 1XPUA 5EINA 2R48A 1Y42X 5KFHA 1MLDA 4U4AA 2Y4OA 2Q07A 3IOBA 2PA3A 1RYZA 4PGXA 3ETHA 4M47A 5JPCA 2R7NA 1NLFA 3OKPA 3P0RA 4K2AA 5D3QA 3PDIB 2UYHA 2I33A 1V4VA 4A0RA 3DKVA 4RPIA 3EVFA 3JTEA 3MTEA 5KDLA 1GZ5A 3V72A 1KE2A 4R1PA 1LA2A 3C3CA 3DLHA 4DCMA 5AM3A 4KDFA 1HEIA 1XTIA 5LOVA 1IZYA 3EASA 3DMRA 1IBRA 1PWEA 4JT9A 3DEAA 4EKNB 1KRHA 2AWNA 5G41A 3ZLJA 4JCCA 3Q5EA 1CYDA 1LSSA 2RAPA 1ZIOA 3GLHA 5FPHA 4IH4A 4ZCSA 5H5JA 1L7PA 2ADOA 1N8NA 3W5JA 3TX6A 1X9HA 5IRCD 3R3JA 2BPOA 4RTKA 4X85A 4BS9A 5K3FB 1N3LA 1JDNA 4LWQA 3CLRD 2FWAA 1L4BA 4MROA 1AO3A 8ICYA 5L45A 1PZNA 3ORYA 1J24A 4RFSB 3EWSA 5KFZA 2AGVA 2N0SA 2FX5A 4INOA 4AN4A 4IF4A 3G2KA 3RVQA 4ICAA 3ROZA 5FD8A 3GXBA 4DIMA 4FEGA 1I5RA 1PZGA 3E2IA 3I37X 2PV0A 1E7SA 4KO2S 4X6YA 3WLTA 2YWGA 1KPGA 4DR6B 2YH2A 1R6DA 2CMFA 1TPZA 3HVHA 4BU0A 4J3FA 5EG5A 3KQYA 3CGGA 5B1DA 1E6WA 3A6JA 2ZBVA 2VZ8A 3K30A 3ZY4A 4A92A 1C30A 2EQAA 4PVCA 5CDHA 2CSUA 1WKBA 1OREA 2IBKA 3C6MA 1TO1E 1T29A 1X9GA 4BO5A 3AMZA 5KFLA 5DYTA 4DIFA 1CE8B 3WLJA 4A0QA 4OQ4A 2DJ5A 3GLRA 2A58A 3L7MA 4GC6A 1EQAA 2HSDA 2NO0A 4DF8A 5AJVB 1QFSA 4PGFA 3KEGA 1XMIA 1RTTA 3RUFA 1TZJA 4C7ZA 3BWBA 3IGFA 4EI2A 1SXHA 4CTMA 1ZEMA 3EDCA 1F2UA 5C5JA 4JGGA 3U9LA 3DUFB 4P22A 1DNPA 5TEWA 2JIBA 2QXUA 4GH5A 2TS1A 1ULZA 3I2HA 1FYWA 3WFIA 1M2OB 1GARA 3RASA 2R1TB 1O5TA 3THYA 1PL7A 2ORVA 1DO8A 2AUNA 5K1ZA 4MWOA 2CFCA 3W7AA 4ZODA 2QN2A 4C3ZA 2B37A 3K0SA 1Y89A 2Q8QA 2XA9A 1VJCA 4U5XA 4MGZR 2YVKA 2A9QA 3WQHA 2DGZA 4YV7A 2QRPA 4ZVPA 2GS9A 1VG1A 5DMHA 1OAOA 1JHOA 1WQ3A 1JQBA 4L1KA 1RLOA 3DW1X 3L9XA 3HZRA 4OREX 2ZBFA 4JQCA 3SXUA 2YNMC 1BPYA 4EZBA 5AM4A 1PJ3A 1XA4A 1NMEA 2VQ6A 3CNBA 3G9XA 3UW3A 1F38A 1U0NA 4BBAA 2CNBA 3SZUA 2GF0A 4ZI3A 3KPUA 1DQZA 1M0EA 1UAYA 1E3LA 1JAXA 1JFFB 4H0CA 3AB8A 2ZJ4A 2EWWA 4XWWA 3OTHA 3NASA 4MW6A 2A57A 3LCJA 3AEKA 4K05A 1P81A 1ZK2A 3GR6A 4KR3A 2HY7A 1SKUA 1SY7A 3JS5A 2D1TA 3ZIUA 2WHPA 3NVZA 3C5FA 4S1TA 5BV1A 3VMMA 1XZGA 4DKXA 1T9DA 1IOWA 1XVLA 3IMEA 3QU5A 2ZPUA 4M99A 3VI4B 1ZW6A 3CCCA 3KV3O 1LX6A 4QPZA 4IMJB 4YRDA 3Q8LA 3GEGA 1TL7C 4XGQA 2E49A 4G24A 4LOKA 4DCNA 5J2TA 4F96A 4QRDA 3EEQA 5JT1A 7ICHA 1NNSA 1TB4A 1KZ6A 4KB5A 1U28C 2ZJ1A 2FPGB 3UPTA 1Z2EA 1K5HA 4EJFA 3EDMA 2W8LA 4MUGA 2AMFA 1NY6A 3IKVA 4KXNA 3VJKA 2ZTDA 2GHTA 3OA0A 1RHMA 3KQPA 1E7YA 1T3ZA 3R3VA 2BSQA 4Z1OA 3CJQA 4ZTUB 4H7EA 2ZJ5A 1PYOA 1K7EB 1MX9A 4V2IA 2KWIA 1LPAB 2DT5A 3ZDCA 4NS4A 4Q8FA 5DU2A 4X62B 4WESB 3QVOA 4O5EA 3ZTWA 5AKKA 1MEOA 2H3VA 5EKDA 2HJSA 5B3JA 4J29A 4N5HX 3Q8SB 2ZXEA 3LQ4A 1DEAA 2ZTVA 1Q1NA 2COEA 4J0JA 4LZGA 2J5BA 1Z19A 3QWFA 4EO9A 1GN9A 3ROPA 2FCRA 1N9GA 4E21A 3UCXA 4BQIA 4XKJA 1EHCA 3HB5X 3WJ2A 3H1AA 4RHUA 1G8MA 3GHYA 3DAPA 4K6KA 3AG5A 4LMAA 4OFWA 4RADA 3G9ZA 4HRVA 2XO7A 1RRPA 2DFKB 1KY5A 2O3JA 3RS0A 1CR4A 1EUCB 3TTWA 7ICLA 4AX4A 4UFNA 4LE1A 4ACAA 3LQ2A 4D9NA 5ITSA 4CRXA 2IXAA 3WLSA 1YZTA 2NUAA 4RX1A 1UMKA 1BXGB 4FR5A 3PKIA 5AXAA 2WB2A 2UYCA 1AKNA 3EOZA 2BBOA 3MABA 4FWTA 4Y1EA 3X1DA 4PU0A 5IXJA 3QLTA 3JVVA 2PSDA 9ICXA 4PIMA 4WL0A 2ZWVA 1SQSA 3C1ZA 3K0AA 2HQSA 4N0QA 1OIVA 1N5DA 1CSEE 5BMOA 3X1JA 2BF7A 4BLWA 2G71A 4B0OA 2ODWA 3U1TA 1QIFA 3K9QO 4KLSA 4YACA 4ZI7B 3ORRA 4LCEA 4I50B 4JI8B 2R96A 1TLFA 1NX6A 4ARZB 2FMHA 1Y8CA 3AL3A 3N9IA 1DC6A 5FUBA 1GUAA 4CNBA 3R3ZA 2F77X 1V1RA 1ZDMA 4MV7A 1TA0A 3IALA 2WY2D 2ZS9A 1EFRD 4P32A 4JV2A 3ZBPA 2JATA 2A33A 3BA1A 3G1WA 5CIWA 2HNAA 2VI5A 3Q6MA 5B55A 3PR1A 5K6RA 3RJJA 4IRKA 3B3JA 1QLWA 2C61A 4GX5A 1ZYQA 1NWHA 3RTAA 1PNVA 1YR6A 1EE1A 4P4TA 4KZPA 2I34A 3NU1A 2YIMA 1BMQA 3CURA 1JEYB 3PW4A 3WSWA 2ILTA 3LG2A 1IU9A 1ULBA 1AU9A 3MXTA 4GBED 3CUUA 2XGPA 5KFCA 1EQ2A 4GWLA 4K8OA 3NT4A 4BGIA 3PENA 1SIJA 2HI0A 3L79A 5C4GB 3H65A 2AQIA 3KZMA 4R63A 1FPMA 2PH7A 3DF9A 3OQNA 2VJOA 2QRHA 1Q0PA 3S8YA 2JMGA 3UXEA 3WO0A 3LC0A 4BX0A 1Q77A 4ZO4A 3KQMA 4YRRA 1HNNA 4ANFA 3I6QA 1ZNWA 3RUCA 3OZAA 1V35A 3AL0C 2GJ4A 2C4TA 2DY1A 2FN7A 2ES4A 4HBZA 1J7KA 3KUUA 2JLCA 1C3OB 1RXVA 3KOXA 1KJ9A 2OCKA 2A0KA 4ER7A 3WOHA 2P1RA 3UB4A 3HDHA 2ZREA 2CLLB 1D5CA 4LISA 4TMZA 5LNK6 3G9UA 4CF3A 5JYEA 4BV2A 2GPTA 2G4CA 2PEYA 5JTTA 3B7PA 3OBIA 3OVMA 4TKVB 1I51A 1TK9A 2GAAA 4NXMB 1IWPB 2MCFA 1T4CA 4O5KA 2M1ZA 4C4YA 3DEKA 3GUCA 3I4LA 4D0SA 2F3QA 3EDQA 1PK1B 5LBTA 4I81A 3GPBA 3F8WA 1O4WA 3SHWA 4K28A 2X0IA 1Y3AA 3LW8A 5ALGA 1CUGA 3KYCA 3I05A 4JK1A 5FPPA 1AGYA 1EM6A 1RJWA 5KNDA 2YMMA 4DT1A 4MS4B 3FLEA 3KAQA 1VP3A 4GQIA 1XEFA 4MITA 3C3EA 1KP2A 3C3AA 3Q3VA 4OVKA 2ZTSA 1TM2A 1X92A 1IZ7A 2GBFA 2ZXIA 2ORWA 1QRSA 1RYMA 1BN6A 4NENA 3OU6A 1XNQB 4V0KA 4LOLA 2PQ6A 4FB4A 3I61A 1XSPA 3UMJA 4RENA 1A8SA 4P5EA 1QIIA 4Q37A 4LF9B 3CT4A 3K0KA 3FGOA 3ZJVA 1WDWB 3EJ6A 5ES3A 2W6QA 3CB2A 5EYPB 3K1TA 2ZTEA 5JSUA 1ZJMA 2DR2A 3QMPA 1JXQA 3G82C 4EFKA 4IHAA 2FFJA 1OUQA 1WCLA 1YQGA 2VDLB 2W55A 4JL5A 2WSSD 1KFEB 3DZJA 2ZSIA 4X8LA 2G9RA 1ZHFA 4IC9A 3PXAA 5IF9A 4OV6B 4YJGA 1HK7A 1GFWA 3PE4A 3SQNA 5JQGF 4M1WA 2JLZA 1JPUA 4QE3A 2H1VA 3P9KA 3H4VA 4HNSA 4JMLA 5DNAA 1M1NB 2FFBA 4YPFA 1OH8A 3JRNA 3OZFA 2ZTMA 3DG9A 2ZB4A 4HO1X 5U4XA 2V9CA 3LXRA 4ED0A 4KQXA 3TZEA 3K71B 1L4NA 2JK1A 1J97A 2RHJA 2ZRBA 1OHHA 2AXTU 3KXIA 2KHQA 2RHDA 2BFNA 4M49A 1V37A 1CS4C 3C16C 3UOGA 1YAJA 2VDMB 2E8NA 3G5MA 3LYUA 4LJSA 1T10A 2NVUB 1YDWA 2H08A 4N03A 4C4ZA 3CY6A 3GEDA 3VSBA 2ODGA 3TYXA 4BWVA 3CP8A 3T7EA 1VQ1A 4PHDA 4HPXB 5LQNA 1OA1A 4UNSA 1M2HA 3DWGA 3T7JA 2XYQA 4XSGA 4L6IA 2HF8A 1KDRA 1RFLA 2VDPB 3NWPA 3V46A 2IYZA 1YR7A 2C7GA 1B8NA 3C1TA 2HDHA 2O1XA 2ZJBA 4YXWA 8ICPA 5GJBA 5L3SA 1JLMA 2C5FA 4IGIA 2PX8A 1NNI1 4J9OA 2IP4A 2R97A 3AHEA 3CHYA 5INTA 1S89A 3N97B 4IH9A 1I10A 2AJTA 1Z6QA 1XMJA 4NATA 4WVLA 3TUZC 4L8WB 3F73A 1MVNA 1T24A 3A6HA 3M33A 2PZEA 1N2CE 3SU8A 5EJEA 1T25A 3HLKA 1UM8A 3RRNA 2MYNA 2NYUA 5CH5A 4EEZA 5FA5A 3PCXA 3LYHA 3GBSA 3UXYA 5ULLA 2W6JD 5KFKA 1BRMA 2IYTA 1ADCA 2XYRA 4QHYA 2Q3FA 2IXFA 1V1MA 1OV6A 1S97A 3VKWA 2E6KA 2W8ZA 4TSRA 1H38A 3FCYA 3BXGA 3IYLW 1L0BA 2WTBA 5JARA 4UBLA 4WOJA 2I76A 2ZPTX 1U7ZA 1Z6YA 5BSUA 5BVHB 4NJ8A 2AIRA 4A15A 3HDJA 1ECBA 5JD4A 1IRIA 3I9LA 1V9PA 3LFTA 1I2CA 3IIMA 2OSBA 2OWOA 1JU4A 1PWXA 2IHKA 5KNCD 4G5GA 1NBMA 2FPMA 2Y1KA 3UAXA 4BNTA 1A9OA 3TRHA 2Y4NA 2QUIA 5LA6F 2UUOA 4KLZA 4S0ZA 3IAS6 3C39A 4K88A 1XALA 1ZQ1A 3VTZA 2V0CA 3EXIA 4F5DA 4C4TA 4EGQA 2C9MA 1GXSA 2RK4A 3T61A 1Y9DA 3ESRA 4D26A 2BLLA 4EG5A 3UXOA 2BL4A 3IEUA 3Q10A 2CHFA 4DMRA 1A7UA 5ALMA 2J0VA 2PXHA 4NE2A 3QVGB 2OZLA 5EWMA 1B2LA 2P9QA 1CUVA 4PVDA 2BY4A 1FO4A 2QVYX 4ZDIA 1SXIA 3WB0A 4YT4A 4IUBS 3F49S 5FO1A 5C81A 4HDKB 1GL3A 1Q1BA 3GNQA 4IDOA 4GYWA 2QY6A 2D06A 4GOND 4GMKA 1VGVA 2O8BB 2GNOA 1OFGA 2IY8A 4RJ2A 4MQLA 4WFIA 4AJ2A 4RNMA 1ZK1A 2R66A 3PFFA 4BNMA 4B84A 3HCFA 4O3FA 3CNQS 4CIVA 4YJ2B 3CPEA 1S2IA 1GVHA 4QJ4A 4J9UE 1YDGA 1BFUA 5JWOA 4AY2A 3QYJA 5TMEA 1N2ZA 4NOJA 4NXNB 1DJLA 2IHVA 4P84A 4Q45A 1ULTA 4PTLA 3F2DA 2OBNA 2IOFK 5TPZD 2ZTHA 4Y9UA 3ADBA 5JCZA 3MBIA 3M6FA 4DV3B 4LHYA 1YR9A 2CWDA 3EZXA 4DL7A 5E6RA 2V8OA 2YR0A 4J75A 3PCRB 2PS3A 1VB5A 3OJOA 5FT9A 3CXRA 1I0LA 3PF9A 4DSOA 3CUTA 4RNNA 5K4GA 2DPXA 2XNKA 3UIEA 2KVCA 2MSKA 4JC8A 4JGBA 1KS2A 3RH6A 3D0KA 3IEKA 4NICA 1LVUA 1HDXA 1CP3A 1M76A 1N56A 1SCBA 4ZMBA 3I52A 3I5AA 1A50B 4RK4A 3VO1A 4C7MA 4Y9TA 3LCRA 3QX9A 3M4ZA 2BM8A 3WGKA 1HTBA 4ND3A 3HA3A 4C4PA 3KHKA 4G1CA 1SHUX 2ZAOA 1Y4AE 1AKYA 3ISDA 3UUGA 4CM8A 4Z8XA 3CLRC 3E23A 3F2CA 1YTUA 3KZCA 1LFAA 1BDJA 4M8LA 1V16A 2ZIWA 1KXZA 2BKEA 2FR8C 2X22A 8LDHA 1W4LA 5E2AA 5ILOA 2BQRA 5KQMA 4QXAA 3STUA 1MIOA 3UOWA 8ICZA 1QYXA 1TD9A 3S2GA 1P73A 3FPGA 2A5JA 3ZE8A 1U90A 3R8FA 4N8DA 3KG2A 3E5RA 1QTNA 2ZM6B 2HFJA 2LDXA 2V4RA 3VNBA 2X0JA 2WJ4A 4DARA 2PGOA 4UEJA 1NE2A 1UDAA 1FYFA 3EZYA 1WU7A 3BPSA 3I83A 2OYRA 4DS4A 4E30A 2Q5EA 4DFMA 4RKEA 3JALA 4D02A 5TGZA 2UDPA 1N4DA 2J07A 1C20A 3D59A 1GNQA 1E4EB 2C7OA 4AS1A 1OFVA 5KFGA 4CDGA 3EVGA 4N01A 5EKUA 1OW3B 3UCFA 1YNSA 3UHOA 1X9IA 1GHTA 2MUTA 4X91A 1TQ6A 3BICA 3HSKA 1M3SA 5K8IA 4M0CA 1X6IA 5MN4A 3BFVA 1PJQA 4CFZA 1UA1A 5REQA 3ZCQA 3OE4A 5EE3A 4OXRA 3OJFA 3TLZA 2QIOA 3SK0A 1DKRA 2XNDA 5KYWB 3W3AH 2Q4BA 2FG5A 1A04A 3MR3A 1X0XA 3ELYA 5GTDA 3TNFA 3ILVA 2XX3A 4LC0A 3E05A 2ONKA 2IPXA 5KFPA 3GH3A 3CSUA 3RUIA 3RWBA 1VE1A 1YV9A 1PD0A 4EW1A 2IQIA 3PX3A 2V6JA 4FFBB 3RRBA 3UENA 2ZS7A 3O2QB 2I99A 1QWOA 4YP0A 4X44A 1H93A 4QT4A 1IATA 3O2SB 4TN5A 4TMXA 1ZUIA 1IG3A 1ZJ6A 4KZKA 3DP9A 3ZLVA 1LQ2A 4DFJA 4XCVA 1VSTA 3M4XA 5EJ9A 3M81A 4R9VA 1R50A 4MUFA 3LWLA 2GXAA 3N7RC 3M2PA 4BWMA 2QVCA 3FHJA 5J2TF 2HW8A 3N7TA 2I91A 2R8XA 2QWXA 1ZWLA 2YCBA 2BH9A 3QIAA 1N8KA 5L3QB 5KFYA 2PANA 4IXTA 5KAIU 1JRLA 4IFBA 3AHIA 4REMA 1DQRA 4BUJA 1E61A 3IIEA 2YX1A 2OHGA 2RH9B 2UYYA 2D5LA 2ZAYA 4AS3A 3IH5A 4F8RA 3EYAA 4KGXA 2WB1F 2QB0B 3D7MA 4QNLA 2ZIGA 1T5BA 1P3JA 2YDXA 2PA0A 4HY3A 1QPBA 4BGEA 3EPGA 1G9SA 2G17A 3IAXA 3ND9A 3RV3A 2QZPA 5LIRA 2JJMA 5BWBA 1P77A 7ADHA 4EJSA 4MRMA 1HMPA 4WY2A 4DMCA 2WSBA 3GV0A 2H2IA 4MPTA 5ELMA 3PPXA 2ZSJA 5JIBA 1X9WA 3N5CA 1ABFA 3FUUA 4RCYA 2NV2B 5KDDA 4BMVA 2PGAA 1K8YB 4UB6U 3B6KA 4DQSA 5CK5A 4CKEA 1MO4A 2YNMD 1XRSB 5F9LA 4Q4JB 1M0TA 2I2BA 2VS1A 2B8JA 2YWJA 4BASA 2AQ0A 3GA7A 4Z9XA 2ZKLA 4PG7A 4CCYA 4DQIA 4LQCA 4LYYA 3WL7A 3H18A 4O0LA 3HGMA 3OX3A 3WIDA 4XEUA 3O9MA 3HP7A 2ISPA 4JFRA 3QOXA 3G13A 5IANA 2XE4A 4GU5A 3DCYA 3WG9A 4TSFD 1C41A 3S1AB 1IOVA 4MGIR 4B3TB 1UWLA 4ARAA 4TMKA 3Q8XB 4MQFA 4X84A 5CVDA 4XB1A 2XKJE 1GPYA 3Q3JB 3EFOB 2WWIA 3SYLA 1BDBA 4EZIA 1X3SA 4C4OA 5J4KA 4AZ3A 1W5BA 1NRWA 1NVFA 5CFNA 4JUBA 2M2IA 4EFMA 4QOFA 2KFZA 1FFBA 1ZAKA 2V7QD 4RZIA 3ROTA 3H2BA 2PFOA 3BH6A 3H5RA 1F4VA 4PG6A 1D2EA 5A05A 2Q50A 3WJ1A 3RJZA 3SR4A 2VT7A 2AX3A 4RLFA 1KC1A 1GP2A 4LZNA 5AESA 1VRWA 3RSFA 1WZCA 1RCFA 3VNVA 3N6XA 2Y9PB 1B14A 3CLHA 3PJGA 3RF7A 2EZ4A 3G2JA 3HKZC 3E0FA 2RB4A 1F8YA 4HZUB 1GG8A 3X1KA 4YP5A 4A9AA 1Q15A 1RJDA 3HCDA 1U9ZA 3FAKA 3QE9Y 3RYHB 3IVGA 3P0HA 3G9QA 3Q8MA 4RZ2A 3ZUPA 1GUYA 2BFBB 3WRYA 1G63A 2R7KA 3EZFA 3ZW8A 5CXXA 1K7SN 4PL1A 3K6RA 2BFDB 5D1HA 3QV1A 3UWOA 5DWDA 1UPTA 3Q6NA 3U13A 2AJ8A 4J43A 1FDUA 1XMXA 1AA6A 3MRVA 2ZR8A 4C8MA 3ZIAD 2WA1A 3NBAA 3JWGA 4DN6A 3QI7A 1WY7A 1E0JA 1L8OA 2PH1A 3HEAA 1RWBA 1Z7BA 4B2IA 3AKEA 2G83A 5C9ZA 4I2FA 5HIJA 4J7CA 1Z2CA 2PKXA 4IOKA 1YZQA 1XQ6A 4QUEA 3TLBA 5IIIA 4AURA 1OV4A 4RVOA 3IV9A 4TMYA 4YR0A 4X1YB 5BNZA 2FDCA 3M9XA 3DZCA 3HYRA 3U9SA 5HFNA 5LMCA 4L8YA 1UQVA 3GRUA 3ZY3A 3O0DA 1M2JA 5DX0A 1O6ZA 1TM4E 3QUTA 2PQMA 1QG0A 2QZSA 3FR8A 4EVIA 1K68A 2HK6A 2ZWMA 2FLKA 4G23A 2B5VA 2DQKA 1R0XA 3TAPA 1X14A 3DWEX 3JQBC 1AT1A 4UAVA 3JPPA 4LVCA 3SIXA 1N33B 3F6SA 1KLNA 2B69A 4DM3A 4DCJA 2CNLA 2G3YA 1TTHA 3WQRA 3PNBA 1O6GA 1FRVA 5CJJA 3WMRA 4NY8A 3L0DA 4Z3KA 2YV5A 3R2JA 4Q66C 4PJ0U 3UAOA 2GN1A 3Q8QB 4LXIA 2GVDC 2AI1A 3F4KA 5CVCA 3VBEA 4L9WA 3MGGA 1BE8A 5T14A 4QKQA 5CYGA 1CRPA 1SGWA 1FZQA 1EGMB 1ZQEA 3KKMA 1E2NA 4NLGA 4HEA6 4HJRA 4NYJQ 1ZSNA 4HZIA 2J6BA 5B4VA 1I3MA 5KQLA 4IKPA 4MR8A 4BEBA 4Y9RA 5C1OA 3HKBB 4Q6WA 1GUDA 1Z34A 4ILEA 3BFPA 2EFEB 3E9YA 2I1LA 5EIOA 3NM4A 1G8JA 4RQ3A 2RCNA 2VAMA 3BMOA 3I53A 4HFJA 6GPBA 2BQUA 5E1DA 2DFLA 2XQIA 1JN3A 5BNFA 2FB9A 1KEZA 5I7SA 1XQXA 3DBIA 5GTIU 5JD5A 3WZ2A 1Y80A 4F9GA 4P4LA 1M6VA 3WXBA 1W4ZA 1RWKA 3PNSA 4ZZIA 2LRHA 1I7QB 3CRQA 1AX9A 5F5XA 1PQPA 3GFVA 3IQZA 3B60A 2G0AA 2VH2A 4Z51A 2JGDA 3A04A 4LXUA 4EPRA 3OETA 3VJRA 3PEWA 4JVLA 4MUNA 3C1UA 1EVKA 2PI5A 2XUPA 3D81A 3T4XA 1CR1A 3Q85A 2IODA 2F4VB 2G1PA 4QBIA 2BEVA 4RUAA 3QW4B 3U39A 3RC7A 4AYTA 2FQXA 4YV2A 2ZIVB 2YHBA 3DOIA 5T64A 3P2IA 4LFBB 5LB4A 3OU2A 1RAGA 1VPWA 4Z4IA 3DE6X 3A06A 3D7NA 4YUYA 4WFJA 3E27A 1RABA 3TNJA 5AVXA 3WA7A 2ZWIA 4E13A 5AKJA 3BC1A 4PYJA 5MN5A 3VNRA 1XCPA 2Y9TA 1GNPA 3WR5A 4RZSA 3CT6A 3G2MA 4YMSA 3WJAA 2Q27A 3FTEA 3Q3IA 3AP3A 1ODFA 1WAMA 2OUKA 3UWKA 3LKBA 3FBWA 3K20A 2RI6A 4UVEA 3ZS8A 5HNKA 5AVRA 4JODA 4LW8A 4I8XA 4YRFA 4W82A 1KI2A 1DFGA 2AEEA 1CF2O 4UBJA 3CKMA 3QKTA 3DWIA 4PLTA 4QLBA 3K2IA 4KTQA 4NABA 1GCUA 4F5NA 1JVBA 2YB4A 4YRJA 3N05A 1SURA 2HCJB 5TS3A 2YXLA 2CJXA 3P2OA 4L08A 4YCNA 5IT4A 4BQSA 5IJXA 5CHYA 1U0HC 5JNLA 1IK6A 6YASA 4JLNA 4V24A 1JYFA 4GZ5A 5BO5A 2AU0A 2OXCA 1SC3A 1L3CA 3OECA 4B9VA 3DMDA 5FLKA 5THKA 3CPSA 4YP7A 5G1NA 4DRXB 3JWIA 2DUMA 4B4UA 1TFUA 1BPDA 2IYVA 1DEOA 5JYDA 1JHAA 4FFPA 2A92A 4M6WB 3HX0A 3O8RA 1P62B 2G1AA 1WLSA 2FZWA 1FMTA 2UVWA 3BF7A 4W6ZA 1PEYA 4YQFA 3HNOA 3VYVA 3WL3A 3M9NB 4EYIB 4YFKA 3DSRA 3MWYW 1ZQQA 2AQ8A 1GQFA 3I8SA 5JQGA 3HRKA 1MQAA 4NI5A 1K75A 3OJWA 3W2IA 2JVIA 5AH0A 2ZIUB 2N42A 1Y37A 2BTEA 2C5HA 1DIRA 3W5IA 3TNYA 3GL9A 2PO5A 3M2TA 1MRZA 4KLNA 4PGHA 3O21A 1B74A 3EW7A 1FVOA 3BERA 5AHWA 1QLNA 3DXYA 5DQGA 3VC8A 5FLYA 3L6OO 4HTFA 2FVYA 4JVNA 3W8FA 1P60A 4RXUA 2VNHA 4IG9A 2B1QA 2YBDA 1B73A 4N0PA 1FBNA 5ESDA 3H9UA 3HB9A 2EDAA 2NO6A 4CCHA 4C7OA 2QRVA 4DCCA 4C7XA 3LNCA 3I12A 1YS4A 4KI7A 1G5TA 3F5DA 2PZMA 2P2GA 5JVDF 1LS1A 4IXMA 1UZUA 3UXHA 2PL3A 2VHEA 4HQRA 2YZ2A 2PGXA 5AVWA 5ALDA 2W7OA 3NIFB 3SMQA 1U3TA 3L46A 1SQ0A 3OICA 3PTZA 1LXCA 2Q3BA 2QTWB 3C4JA 1VA5A 3EIOA 4LRQA 2P9CA 3BFXA 3EXHA 1TW3A 3R9WA 4X8HA 4AVYA 1EDDA 4HJXA 1O77A 4JWMA 4YYZA 4WD3A 3MN1A 1M34E 1IEQA 4UUOA 1DPFA 1NNEA 1A9ZA 1IIRA 1FYVA 2R3SA 5CH8A 4ZOQI 3B9JA 4KLEA 4RQUA 5KKCA 4Z4GA 1ZZGA 1GQYA 1EZZA 3QVTA 4GI2A 3GLGA 2WFZA 3TVTA 5BVGA 2IDJA 1QDLB 3CKYA 1EUDB 2J0EA 4NZ9A 5BSKA 4XYGA 2VHCA 2FJUA 4Q47A 3FBTA 2P4HX 2FMUA 2BFMA 2G8LA 1Q92A 4ETNA 1CX9B 1SCUB 1EHIA 3MGBA 1UBTS 4MNTA 5E4JA 2D8MA 2J30A 1HT1E 4QATA 1MZPA 2DBRA 3RVDA 3MGCA 1T8WA 2BN4A 3AJEA 1KA9H 4JV1A 4GC9A 5LWQA 2GN6A 1TKDA 3RBXA 2I6TA 5E9AA 1LD3A 2H5IA 2J6HA 1S8AA 1ZQCA 2N46A 4ONEA 2FX3A 5HJ2A 4WKNA 1HZZC 2WE8A 4TS1A 1ZU4A 2WYOA 4INZA 4X54A 3FVWA 3LT0A 2R1ZA 3C98A 2RDIA 4N0EA 1CQJB 4JP1A 3HBAA 4TUSA 1FJGB 1T8EA 3ISJA 2NO4A 4YQZA 3LUPA 1Z5GA 1Z0DA 3TW8B 4DW8A 3TL2A 1R8YA 1OA0A 4BNNA 3RKRA 2JH3A 1N9KA 2P2CA 3GW8A 4KJZA 1NXQA 1COWA 4QFCA 4JBNA 1H05A 2W9CA 5KT5A 1ZD9A 3N3BC 4WZAE 2PUGA 5TT0A 4BNYA 4KXUA 3LWNA 4Y0VA 5KOYA 1SOMA 2IYOA 3OZ7A 3VH1A 1ESZA 1AE1A 4KODA 3U16A 4W63A 1TO2E 3TDNA 3NZEA 4AMYA 1ZS9A 4XASA 1UJBA 4FCWA 5HK8A 3TGWA 5CU7A 2GWRA 1NKTA 3FYHA 4DTCA 2R7MA 2W6IA 3GFTA 2N75A 2DC1A 3OIDA 2Z1MA 4IS3A 4DLPA 2E55A 1M67A 4IFEA 4ZVQA 4N49A 1GSIA 1GU7A 4YUVA 3SYMA 4L4YA 5IP5A 3HO1A 3LQQA 2BEWA 3FA2A 4HG2A 3CF2A 3LVFO 4EH1A 4Z6EA 2ZR0A 1JEDA 3UN1A 3AOGA 2BCJQ 2ANBA 5C8DA 3ZHUA 1Q12A 1ZQ9A 3HXLA 4YASA 1JQKA 3HKCB 1U4BA 4C78A 3KEOA 3PUKA 4PQFA 3D3WB 3GJZA 4LNUA 5EPEA 2KZZA 1L8AA 1JI7A 2GYVA 3WICA 1ZINA 3B6EA 5DYYA 1WDLA 4DQQA 4IHKA 2DZDA 3MJ4A 2GFIA 4HLCA 4B7ZA 2FV8A 2VWQA 4G0PA 4RA6B 5CGZA 2ZJ6A 1QMGA 5ERGB 1ISIA 3TI7A 4B6SA 2YCLA 3MSXA 4TZKA 2YUIA 3GAFA 2QTBA 1JMVA 3AY0A 1FVFA 4XWOA 1GUZA 2FZLA 4COOA 4LHZA 1J70A 4ZCMA 2BGGA 1YE3A 2VDVE 2P4UA 2CDRA 2BSXA 4UULA 3U0VA 4KBFA 2G28A 3RB6A 2C0QA 1KP3A 4OQFA 3PE3A 3VUEA 4KE9A 4G8BA 3FI9A 1ZJNA 3TIIA 4DR3B 4F06A 3NGLA 3MWEB 4FHDA 2R65A 2FEAA 2C5SA 1JNXX 1I1QB 1GIAA 2WUDA 5EKXA 1Q3TA 4EAAA 4WZ6A 3PPYA 3BZWA 4J91A 2QN6A 4Y18A 721PA 3O4JA 3DZHA 3VOBA 1KO7A 3ADOA 5L7TA 3KHGA 2GM4A 3HCCA 3GWZA 4NDNE 1DBVO 5IKPA 4Z99A 1O57A 5HKAA 3CX4A 1KY2A 1G5QA 4PFJA 4GICA 4N4AA 3VVBA 3IA7A 1OC4A 3PQ6A 4KQCA 1LDEA 2YQ5A 2R11A 4IDNA 4RIIA 1E3MA 2OXFA 1XC9A 4E14A 5A0TA 2PJDA 1ZIYA 1QIEA 4GPAA 1XF9A 3UUEA 1GZVA 4RMIA 1NBEA 4ZZ1A 4D9JA 1IAQA 3KOUA 3LPLA 1FSGA 3C6BA 3ENNA 4YUAA 4RBNA 3C4VA 2QVGA 1OTYA 4CDRA 3WGOA 3C2QA 4BNJA 1I8TA 4ADSG 4E5UA 1U9CA 5L95A 1Y5RA 2BFAA 1T6BY 4YRTA 4Z86A 3A2LA 5JO9A 4YRGA 1SJ9A 1WKCA 5AKGA 5CM2Z 4W5WA 1EJBA 2YWDA 1UXKA 2WTNA 1ZRNA 4CV0A 4WTOA 1SV0C 1AZSC 5CFLA 2Z1DA 1EP1B 5DNWA 3UZUA 4YV1A 2NO9A 3DVSX 3GROA 3TCXB 2WFLA 3QLJA 5CFMA 1YBHA 4FGLA 3VH3A 1JEQA 1PL8A 1Z2DA 4WLNA 1Z3CA 3H8MA 621PA 2YW9A 4O4HF 4DV4B 3OSPA 3MNFA 3C7TA 5EXEA 5ELLA 4X64B 1JKMA 1KYIA 3FCCA 1YZLA 2HHAA 3KELA 4LYGA 1X13A 3CQ9A 1U2PA 1Y1QA 3PGVA 3NBQA 1HI9A 2BR5A 2LCFA 4CMJA 2OB2A 4MVYA 3R44A 2NXCA 1TJNA 1MXHA 4Q9AA 3FCUB 9ABPA 2KP7A 4ZYYA 1IONA 2TMKA 4I1PA 3PLRA 4P3PA 4BMPB 1XLWA 3G17A 3JVUA 5AHOA 5HCUA 3NP9A 3TZBA 1NKEA 4JH0A 3VPSA 1UC4B 2WQ7A 3GWGA 5J0UA 2N9UA 4JA0A 3IPAA 2ZJ3A 1I4OA 3QPVA 2H1IA 4GOLD 3ORHA 4GZ3A 4KLDA 2B7LA 2K4IA 4FHZA 4HYKA 3GI1A 7GPBA 1Z25A 3H1FA 4PICA 5F5LA 1JX4A 3RJEA 4YMMA 2XMZA 1KMNA 3HO8A 1DUIA 4IICA 3NONA 4G1MB 1IIPA 4FHEA 4KXWA 2CUKA 4NMLA 3E1KA 5HUJA 5J2JA 4BVKA 3O31A 2D2FA 2Q7OE 1Z6XA 1PEDA 2A8YA 1JHQA 1G2IA 4YR2A 1SD5A 1Z36A 2YVLA 1TT5B 3PJDA 1D8BA 1GZ4A 1WTCA 4PX9A 3GRVA 2DR0A 5JFOA 4YJFB 1U0JA 3KDAA 3KJEA 4DEYA 1DKNA 1IYZA 1PWYE 4UMVA 2RHBA 3LE8A 4MEBA 4DMUB 1M7BA 4MKHA 1NKVA 2E48A 1G17A 4CI9A 3BSSA 5AOCA 1UT5A 1DC3A 4Q1FA 2IZ0A 4IIGA 3UGQA 3D1LA 5K3AA 4H7KA 4FNGA 2IE8A 1GV1A 4H1TA 2VWGA 5HM6A 5EP4A 3V2HA 2XD9A 3DTVB 3SI7A 2W2LD 3KSMA 3AVOA 1JAYA 4TWZA 3VOSA 5A6SA 2P6RA 4JITA 4PFSA 2OGZA 3A6PC 4OM7A 1LK5A 3IDZA 5DLEA 2OHXA 2ONJA 2XIQA 2BPCA 2SKCA 1KVTA 4ALLA 2JS7A 3G5AA 1PO7A 4LZPA 3ZZTA 2GGSA 1SL0A 2O57A 4QOEA 1JSXA 3PIDA 3E9RA 5ITZA 3VHXB 5KYXA 5AKLA 4HWRA 1W5SA 2RHHA 2DB3A 4FOPA 2JLBA 3W79A 1KI1A 1ZGHA 1DEHA 8ICAA 2QTHA 3ZOKA 4ENTA 2CMDA 4TMVA 3WNBA 4ETIA 1T8SA 2RRDA 3LIIA 3PUZA 1P1CA 3Q9NA 3OPYA 4JLKA 2XA1A 1EMDA 3IBFA 4G81A 3VPXA 3OIYA 4S12A 1II9A 2JGKA 4FR0A 4OSPA 5KFSA 4BAUA 5L9AA 2A5YB 4OF4A 5IEJA 4A10A 3N59A 1NK9A 2W42A 1M5RA 3A1WA 2YMLA 1ZQMA 5HCNA 4DA6A 3FKSA 1GKUB 3CR8A 1MQ9A 5A04A 3QWAA 4CVNA 3GT0A 3SSOA 4EI8A 2V3VA 3CEPB 3V1TC 3OJUA 2XRZA 2Y67A 1IUKA 3ZCUA 5CCXA 7ICIA 4FGKA 2DJIA 2X0FA 2FWBA 4X6UA 3DZFA 1Z8DA 3BS7A 4MPDA 4B09A 1UXIA 2RGGA 4P3NA 4X90A 2K7FA 2C95A 4UZEA 3ZZ0A 2FA9A 1YFLA 1UOEA 4PZUA 2XGMA 4MYTA 1G0OA 4GL2A 4B83A 1XJCA 1Y7TA 3PNVA 2H9IA 3T4PA 1IMOA 1XTSA 4FKMA 4NEGA 3M83A 2F90A 2MMGA 2P77A 1EDEA 4TKMA 1JXEA 4TLLB 1ELOA 1Y82A 2WT9A 4ECQA 1KQFA 3UK1A 5LLTA 2JW5A 5I7FA 4Y2VA 4V39A 1VHLA 1NG1A 5JCJD 1JB1A 2JHAA 1YVDA 2WJVA 2YY5A 3B70A 4XYMA 1DBIA 3PTAA 5EJAA 3FUWA 3KWJA 3PSFA 4GC5A 3MDAA 3N4MB 5LQJA 4G4JA 1IE3A 1GTVA 5LB2A 4QGGA 2JZBA 2QQGA 4F86A 5KYYB 4PZEA 1UBHS 2X2OA 3DHWC 2O0JA 2QJOA 3NNSA 4LDNA 5HBGA 3OQIA 1TU0A 5CJ7A 5GGXA 2DKFA 4OJ6A 3D8HA 3R8XA 2Y0CA 1SKQA 4EKGA 1R5BA 2ZUVA 3D2NA 4NZNA 4FC7A 4F92B 5IYZF 3WSTA 1XZBA 5F51A 1T6ZA 1I9GA 1DQNA 3KT8A 1C1XB 2J87A 3S55A 3V48A 1LKYA 5K0LA 4KWCA 3PGJA 3VKGA 4BO3A 3OOSA 3LLVA 3OIVA 3UKDA 1JA0A 1S2MA 5HHIA 4IMRA 3T12A 2VUUA 5HRCA 1W59A 4CWAA 4DDWA 2WWHA 4DQPA 3OQHA 4P7FA 5GOTA 3E9ZA 1G4UR 4CKWA 3C2LA 2VP5A 5E0OA 3WB9A 5LP6B 3LT5A 4TV8F 4E2WA 2PYDA 1PTKA 2BR4A 1W2GA 4RSMA 1O94C 1Z2NX 3ORQA 4RULA 4IIBA 4YO7A 4ECAA 4C6TA 1GO2A 1KU0A 2DWCA 1DXOA 3D1VA 4L5IA 3RS9A 3ITDA 2WF6A 2NW6A 5B6PA 2KE7A 2G9QA 3HJEA 3QVWA 3RR8A 1RAIA 2J9FB 3BQ7A 1XWIA 4MW7A 2L5YA 2H92A 3QQ5A 1EJ0A 3E9EA 4KRXA 5K6AA 1NP7A 1KFCB 3QU9A 4CDNA 2FEPA 5TF4A 9ICEA 4FCVA 4M89A 3JSXA 4REOA 3PC8C 3K09A 2BE9A 2VHZA 5TVGA 2NV0A 1B8UA 2JF0A 3ZVRA 1DE0A 4I8IA 3GQCA 5C8ZA 3OBBA 3VSAA 4DR4B 2JAXA 2Y1CA 4RS4A 1IAVA 7ICJA 1RVDA 3IUQA 3HU2A 1KOJA 3QKRB 4KEAA 1Z0ZA 2OCXA 2BFEB 1RYNA 3IIKA 2DUWA 1ZA2A 3K6JA 2FLVA 3H97A 5TX7A 4Z9AA 2SKDA 1P2DA 2XWSA 4ER5A 4UHEA 3N7SC 3FMPB 2AI3A 3DOCA 1XD9A 2JXJA 4JSYA 2GJKA 1Z00A 5JG7A 2H2GA 3QUAA 1ZN7A 3EG9B 4RZHA 1MX3A 4O2AB 4PHGA 1OKKA 1E18A 1T2VA 3ET4A 1ZHOA 5E2BA 1NDQA 2Q6LA 3F5AA 1K8ZB 2HGSA 1DAFA 1R6VA 4AP9A 2F8MA 3ZDXB 4D97A 2KJQA 3L7DA 3RC9A 1BKYA 2FH5B 2P1ZA 1JFLA 4WK2B 3AFHA 1U7DA 4ESHA 3NTVA 2BEUA 2XNSA 1PJSA 5IKOA 1H5QA 5IT5A 2I1QA 1PG0A 3T3FA 4DF3A 1OF1A 3LK6A 4O5CA 1T0HB 4DQ0A 1FXWF 2JFBA 1PT9A 2MYUA 3IB3A 4J7AA 1EKXA 5KWVA 4LJLA 3IXMA 3TEJA 1AB6A 1S8FA 4IO0A 3DUWA 5DLQC 5BV2P 4K6OA 3V4VB 5DI3A 4XA8A 3QBEA 2WZQA 1FFXB 2XQGA 2FKAA 1DB3A 1Z29A 1LPNA 1YRYE 2I66A 1K4MA 3GN1A 1Q1AA 1N2GA 1WEKA 5C3MA 5CG1A 3KB8A 3EEFA 3CMCO 5IC6A 2IDZA 3RRFA 5I3ZA 1M8JA 1GNRA 1SG6A 1N62A 5C1IA 3EDYA 2AFHE 2YWCA 1AUQA 4LJRA 5HKKD 1EFDN 5BPFA 4MDYA 1GPAA 3JWPA 2OFFA 2R62A 5M2QA 4P7BA 4AI6A 4HGQA 4BZXA 3DV9A 1ZK3A 1DC7A 3SKYA 3P9NA 1CQIA 1J33A 3TBKA 1JN0A 5ALRA 1XDSA 2VHJA 3SAHA 5G4KB 1C8LA 4U6SA 2BP7B 3ZBTA 2FUCA 3L5KA 4AN0A 4D0GA 5JI3E 3IJPA 3PIIA 1IXRA 4TQRA 4WJLA 4AMVA 5H02A 2JKYA 3RG8A 1VCOA 2VSNA 3WI7A 2Y9MB 2HFKA 3UMSA 2Q2NA 5L1LA 3T7IA 3QXHA 1PLKA 3OI7A 2DHRA 1MRSA 4JUFA 3FCSB 4L16A 3FLAA 3D6UA 3T1OA 4YLGA 1MP0A 4PHEA 4D42A 1QGYA 1SUDA 2V5VA 5JVDA 3CZ5A 4B0PA 1MB4A 2NXJA 1QJ4A 3HEBA 1I4TD 3KZ1E 3ZJ5A 4K81B 5JROA 3F78A 2GN8A 3MLBA 1CS0A 1FIUA 3BIXA 2DCMA 1OLSB 3RBDA 8ICUA 3F6BX 3QX7A 4ZQGA 3N8HA 2F76X 2I4OA 1I24A 1JIQA 5CVJA 1KEKA 3P20A 3CVUA 5HR6A 4DJDC 5EJGA 4L22A 3KOMA 4I99A 2NQ2C 4IDPA 1SH7A 5TISU 1OAKA 3EUFA 2X4IA 2EGHA 4L0QA 3SX4A 2QPTA 5DGAA 4HLQB 3V33A 5DK4A 3RUAA 2XXAA 3TAUA 5BN4A 3B9PA 3AIKA 5K0GA 1OU0A 3I2FA 4CIYA 1KF0A 3E3AA 3AVQA 1DK2A 1G3IA 1XSEA 3KLOA 4XIGS 3Q7EA 1SVWA 3IO3A 4QRHA 3DB1A 4OMUA 5DZSA 4P33A 1G21A 4KKXB 1WXIA 4LBYA 1EU1A 3J81k 5I7AA 1TK3A 1CUXA 4Q7KA 1ATIA 4GGPA 2O1EA 1L7XA 2Q5QA 1YB6A 4HHEA 4C4XA 4KGZA 2FZCA 4F4KA 5KAFU 3V4RA 1DAMA 5F2KA 1FSZA 1AKRA 5H4HA 1YF3A 4F3CA 3KPWA 5BQOA 1AF4A 5JXGA 3PA6A 2UZ1B 1QQ6A 3ZHYA 1MENA 2ISSD 3L8YA 1QGUA 2ZOSA 3R4VA 3R77A 3P9SA 4V0OA 2FMFA 5DBOA 4A8TA 2JHPA 4IUCS 3CCFA 4MRRA 4MVJI 3JD3A 1GPH1 2HBQA 4M0MA 3DD5A 5D3MB 4MV6A 3HU3A 1G20A 3BDIA 5EZ6B 1PHPA 2D1RA 2VATA 3C28A 3SLGA 4WBNF 1M8KA 2YHIB 4KR2A 3C3DA 1EEHA 2B4RO 3FSGA 3FOEC 1ZH8A 2R8HA 1HQKA 1SBNE 2ISQA 4KN9S 2NUBA 4OB8A 3PQ4A 1TUEA 1QRAA 3AT1A 4E46A 3VR0A 1IM5A 4M83A 2JIOA 4E2YA 1YR8A 4KFUA 1UM9A 2QMQA 1J6UA 5DP2A 5KI6A 3HP4A 1TAUA 4ECZA 3G5UA 4RPYA 3CVJA 2I4RA 5DNYB 3I1JA 4DSLA 2EF0A 3AUJB 3AIIA 2GLXA 3WWZA 5P21A 2WW8A 1Y3HA 1DQYA 3EUEA 3RJIA 1JKJB 4CL8A 3MS4A 2QE6A 1WVGA 4MQ4A 3GMSA 2EFYA 1Q7CA 1ML3A 3REQA 1SBCA 4U9IS 1LLUA 1FYXA 3Q3HA 1AMOA 3DGEC 3BRCA 4F6LA 4R51A 2QYHA 3N2GA 4R1UA 4BYMA 4JEIA 2XUOA 3RU3A 1E3JA 2R751 2WWWA 1JKXA 3UHAA 3GGJA 1XDUA 2Z9DA 2FWRA 2I7CA 3PHGA 4RY2A 4KN6A 4CQMB 4P0QA 3JQAD 4PSUA 2Q1TA 3KTOA 3FAZA 3GT3A 1CV2A 4LRWA 4MCHA 3CPHA 3VXKA 5KWEA 5GIPE 1CEXA 4WGGA 4R31A 3BH0A 4Y9SA 2OQRA 2BGJA 5BT8A 1NR7A 1YS7A 4U63A 4O02B 3LFUA 4QPNA 3ZNNA 4PRZA 5KVAA 2BFWA 3ESDA 5KSYA 5I9BA 3IDOA 4DUZB 1MHPA 5A5DA 5EGNA 1RJ9B 2VYVA 1B2RA 3THWA 4JU8A 2CEKA 4IJVA 4QDZA 4KJXA 4CG1A 3AY7A 8ICEA 2VA8A 1KYXA 4GOXA 4BKPA 3THXB 2C0CA 3SM9A 3PC4A 4DOAA 3BBLA 3KJIA 2I8AA 2PRKA 4ZVVA 3BUSA 4I4IA 2R87A 1IXKA 3PW5A 5ENVA 4PZZA 4L95C 4XB2A 3UJAA 4PZPA 4XX0B 3QUCA 3E1GA 4IIJF 4JAVC 1LK7A 1V43A 3WRXA 4MGEA 5B36A 4LNHA 4NG4A 1LU9A 2A19A 1N5WA 4DR2B 3AVTA 4ZK6A 4LRTB 2GEUA 3U44A 1QV7A 2BMDA 1IBSA 2F44A 4DM7A 3AJDA 2GILA 3P2YA 2JGLA 4DSUA 1RKQA 1GUBA 1OVMA 5A7HA 1X6JA 2P6PA 1MHTA 1J8DA 3SBEA 4OXQA 4PX3A 3VTAA 1Z5OA 3CX8A 1YUMA 5L40A 2HQOA 3PWTA 4XRRA 5KFJA 2C5LA 2H9AA 5DE3A 1JAZA 3KALA 3MGHA 3MS2A 1YOVB 1W5FA 4IJKA 1IB0A 3ETEA 3LUGA 1ZEJA 1KGSA 5HW0A 2B5WA 1W4CA 1AQYA 1AC5A 3SHTA 4W9NA 1EE9A 1JR4A 3KUCA 1U98A 1N5JA 3RKUA 3SBXA 4RMJA 1NXVA 5B7QA 4RU1A 3IEXA 4I28A 2VDJA 4JVSB 3GLTA 4EHFA 1G8GA 3NXSA 5J0OA 1QIMA 3K70B 3DE5X 3WKAA 4YMWA 4I27A 3GV7B 3W6ZA 2EZZA 4K0RA 1QOQB 4JHLA 3NV9A 5JZMA 2XMRA 3W2TA 4DNPA 1MABB 2QF7A 2QOEA 3DKIA 1AQIA 3EH1A 4OJKA 1KC3A 4DQLA 1H1LB 2DRIA 4BDTA 4PSVA 4P7KA 5EJ8A 4B6EA 4TXJA 4KPYA 4MAMA 4M53A 4R7ZA 1E9FA 4KLTA 3OCVA 4MKFA 2BD0A 3PL1A 4LSWA 3WK7A 3O03A 1G2PA 1CJVC 1Q7RA 4O4HA 1ZM4A 1DX9A 4QXQA 1CUSA 1ZLXA 2AG6A 1HMYA 3KSZO 2JC3A 1DTWA 2W2KB 1Q74A 2C00A 4MJ3A 3N2ZB 4WCDA 1ESDA 4KQGA 1NURA 3AUOA 4TS3A 4TM8A 1GA6A 1P9NA 1CY1A 2ZYIA 2WK1A 3NAGA 7REQB 4QDXA 4ZOLB 3OQ1A 3OCWA 4KWHA 2O2HA 1XZLA 3SEIA 1TKAA 3ZDRA 2YBEA 2GKGA 3UK0A 2M9MA 2OO5A 2P30A 4DFKA 3OFKA 1JUDA 2Z1NA 4XJVA 3EY4A 2UXBB 3TI0A 1Z7EA 2B1JA 3P1JA 1SBIA 4ZTZB 5I7HA 4NEQA 2EZXA 1H22A 2FP4A 3GZNA 1OZHA 3MHPA 2WJZB 3SXPA 1FE8A 3EYZA 2OG1A 4KG7A 4FGZA 1BDMA 2YKGA 3M6LA 4KUEA 1VIAA 3CN7A 1C9MA 4F93B 4JROA 3WGMA 3H0RB 4C88A 1XD8A 4BBJA 1G18A 4KQ1A 1L7OA 1IN6A 4R8MA 3QZ7A 1XROA 1DC5A 2RGXA 4JBLA 2X9QA 1OUMA 1NMQA 3R5JA 1ECFA 3TZ6A 3IQFA 1VJGA 4IFIA 2DBYA 3PW0A 4MVWA 4RACA 3OOHA 4E88A 4BGUA 3V4ZA 2YN4A 3NNDA 1ZWKA 4NYMR 1KDPA 1V3UA 1MEEA 3HYCA 4UTZA 3H9EO 4LJ5A 4WCFA 5FNVA 4LQ4A 3L7IA 1V95A 4D6YA 3PR2B 5GM2A 2AWOA 2NYRA 1CJMA 4ZEXA 3KYBA 3T9EA 1Y7PA 3U4GA 5EWLB 3O47A 3V8VA 1L3IA 2PLWA 1N5LA 4MJXA 1MN8A 3UV6A 3ELUA 1ZGGA 3VYTB 2BLNA 3FPCA 1PK7A 1TA4A 3IG8A 3BWCA 1SKSA 1Y6RA 3OTOB 3WHPA 3QLUC 3RS2A 4HYYA 2IUYA 4F85A 2R6CA 3F2VA 3GGGA 1FBTA 5JXIA 4U7CA 2RGCA 4FFVA 2GTIA 4N6GA 2HHTA 1ZD5A 2OXEA 1U2DA 1H3EA 1M83A 3LC1O 4LGMA 2H31A 1T34A 9ICCA 2JI4A 2R85A 4B8WA 3BXHA 3G5LA 4JI4B 1Q91A 2W9XA 2V6BA 3GNLA 1GZHB 1VIYA 4BNDA 4N8SA 2KSQA 1NVKA 4REQA 4U1RA 1K6JA 1U2EA 4FIZA 1PVVA 2ZIXB 4KQEA 3HS3A 3U81A 4Z54A 2ZZKA 4TKUB 1PEAA 5LQMA 2MT9A 2W90A 1D2RA 3H13A 2AW3A 5BSHA 4FYHA 2DEUA 3JAWA 1NASA 9ICFA 2IUEA 3IP1A 2N1BA 5F77A 3ZXXA 2YJ6A 3K5IA 2PX4A 1XRQA 2J3IA 4BHTA 5FWXA 1EX1A 4NSNA 1TYDE 5IEBA 3UWDA 4GSLA 3E03A 2C2YA 4H6PA 2ZW9A 2CF5A 4MMXB 1IHUA 3SZ2A 1X3LA 1CNFA 2XOKD 4QUHA 4ZD6A 5C32A 1NN5A 2PKQP 2KLBA 4EO4A 4YAEA 1QIDA 3T7AA 3VHRA 1IEVA 4JEUA 4ZP1A 5PNTA 3I04A 2ZT5A 2SBTA 1I2ZA 3UICA 5H8WA 3IVAA 4QHSA 4P4GA 4U2KA 1G291 2VTVA 3HXKA 1MH1A 1QANA 1NUSA 5C4MA 2XUJA 1HDCA 3WDMA 3UVEA 3PNKA 5FJJA 2MR5A 1VGQA 4KFCA 5JJIA 3UXNA 5FLEX 3QVXA 4K9KA 2JLAA 1SPBS 4C7BA 1P9WA 1TYZA 3VDNB 2VDWB 2EKQA 3NB0A 5DSXA 4NJEA 3MCAA 5A2GA 4W5TA 3NGMA 1KBOA 4AO6A 4EG0A 5LOVB 3A4NA 4C2AA 9ICMA 1QH1A 3NYWA 4Q1EA 1C80A 1VJ5A 2CHGA 1BD4A 4BNFA 2LYHA 2AX4A 3OF5A 3VQTA 3COYA 1XAGA 4MRAA 2AFRA 3UANA 4FQ8A 4IF6A 2IYAA 4BLTA 2R2GA 1GQ2A 4M3NA 7ICFA 4ED7A 3H5AA 4KV9A 7MDHA 4OHRA 1FFSA 3RANA 3F1LA 4RNOA 4FEYA 2VQDA 2Q6OA 2WUEA 5KNBH 4AJNA 1U9LA 1B0XA 1ILWA 2XWJI 1V8FA 5IYZA 4LDRA 2QQ5A 1BHSA 2WTXA 3ANMA 1B8PA 1O94D 1S10A 2YV1A 4PN3A 3HFJA 4RPLA 5HVNA 2HPAA 1RPNA 3G3EA 1MB3A 4ZT4A 1U8EA 2GXSA 4Q01A 2JHDA 3AB7A 3IHQB 1C30B 2A3VA 1YASA 1PFGA 3KHSA 1KI8A 2AMYA 3ICOA 3CUEF 3BE6A 1BFDA 3P2EA 1TF2A 2H1RA 1VCNA 5HDBB 4BO7A 3UTCA 1TAHA 2ATLA 2PD4A 9ICNA 4TV8A 1UKBA 3LS2A 2FGKA 1G0NA 2BC9A 3LX5A 1KSGA 2OV3A 4AJOA 2FY8A 1ZGZA 1F2UB 1MC4A 3FHLA 4JUIA 3TANA 1L5RA 2JEYA 3T0IA 1K5OA 1XAHA 4ROTA 1FRZA 1YQQA 3I1IA 3RAQA 1XC7A 2P4QA 4EPXA 3V7JA 3EEBA 2JLWA 3DQPA 5DM1A 1UMDA 4EL5A 4M04A 3THYB 1F2TA 3FNQA 1G98A 5HFAA 5IZCA 2Y68A 4XUSA 2PSHA 4MWSA 3RFTA 4MV1A 1F6BA 3F4LA 1WNTA 4GC7A 3EIFA 5DKFA 4DMMA 2QV7A 3KB1A 1XNHA 1IJBA 4H7JA 1L5UA 1JQJC 1YFKA 5CGQB 5F9NA 1W6RA 4B46A