2WF9A

Structure of beta-phosphoglucomutase inhibited with glucose-6- phosphate, and beryllium trifluoride, crystal form 2
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
221
structure length
221
Chain Sequence
MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQKQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Near Attack Conformers Dominate Beta-Phosphoglucomutase Complexes Where Geometry and Charge Distribution Reflect Those of Substrate.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
molecule keywords BETA-PHOSPHOGLUCOMUTASE
total genus 72
structure length 221
sequence length 221
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2009-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2wf9A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2wf9A01
2FEAA 3WK9A 5AKKA 1X42A 3ZU6A 2GO7A 4ZEVA 3L0BA 2ZBGA 5AI4A 4Y2PA 1ZD5A 3NRJA 5A3SA 2QYHA 3N07A 3U7EB 5AM1A 1T5SA 2C8KA 2FPWA 1LVHA 2HX1A 5ALKA 1IWOA 4C4SA 5ALVA 4FYPA 2WM8A 4XQ0A 5E0OA 2G0AA 1Z88A 2OYCA 4Y2RA 3IRUA 3WK6A 3QU7A 4BNDB 1JUDA 1ZS9A 4O8CA 2C8LA 3I6BA 4J2TA 2BY4A 1J8DA 2OBBA 1SWVA 3OTQA 5ALEA 2YJ6A 1QYIA 2IYEA 3QXGA 1VJRA 1CQZA 2P69A 3A1EA 5AK4A 3U7FB 3D6JA 3ET5A 4HYTA 2O2XA 3L1VA 1Z5UA 3QLEA 2FUCA 5IT4A 1PW5A 3I28A 3FVVA 2ZG6A 5AI9A 4KNVA 3M9LA 2OM6A 3ZX4A 1XPJA 1RLMA 3PDWA 3SMVA 3SKXA 5ALNA 5AM3A 2Q4TA 4HGRA 3U26A 3ESQA 2I6XA 1RQNA 4CF5A 3NAMA 4XPZA 4JDPA 5AM0A 1RRCA 3U7HB 3OCUA 4BNDA 3L1UA 1Z4JA 2P27A 2ODAA 3CNHA 4KNWA 3I76A 2FUEA 5AW3A 2I54A 3QU2A 3E84A 2R8EA 3KZXA 3KOOA 2WF6A 3VAYA 5A3RA 1ZRMA 3UMBA 4KX3A 1F5SA 2R8YA 1NRWA 1YV9A 4RESA 1L8LA 1N9KA 2WHEA 2WF5A 2B8JA 3E8MA 4NAVA 3WKCA 4UAUA 2IA5A 1T9ZA 3WKBA 1J97A 2X4DA 3ZX5A 3QGMA 4CF3A 3WGUA 3WKEA 3OCYA 3W5CA 2D2VA 5AW5A 2GHQA 2YY6A 1VJ5A 1T5TA 1VFPA 1AQ6A 2FPXA 2HOQA 2BDUA 3EF0A 2Q5EA 3L8HA 3EWIA 1NNLA 3M1YA 3KBBA 3U7GA 3NASA 2O9JA 3RF6A 3FGOA 4YH1A 4Y2SA 5AVVA 3E81A 3ZVNA 5AVZA 5AKGA 4YIHA 1QQ5A 3OCWA 4ZEWA 2PQ0A 4BX2A 5IS2A 3WGVA 1WR8A 1RMYA 2HEGA 4DW8A 1XP5A 2DQSA 3QYPA 3L8GA 1RDFA 4NABA 4Y2TA 2B8EA 1YMQA 3W5DA 4OFZA 2YMQA 1U2TA 1TA0A 1Z4MA 3FPBA 4GIBA 3ONNA 5AI6A 4UMDA 3U13A 2P11A 2FPUA 5IT0A 2FPRA 3L8EA 5AI0A 3FPSA 3R4CA 3MPOA 3SKYA 3QUBA 1NF2A 2WF7A 3QNMA 1S2OA 1L7NA 3N5KA 4E88A 4PNHA 4DWOA 5AM4A 2JARA 2CFTA 2R8XA 2RB5A 3TLMA 4AP9A 4J03A 5AKEA 4AS2A 1Z4LA 3N1UA 1SU4A 5A3QA 2G1AA 3E58A 5ALUA 2G09A 1ZD4A 2AH5A 2ZBDA 1TJ4A 3AR4A 5AVYA 1YJ5A 4IFTA 3ZVLA 3BA6A 4EX6A 4YGYA 4BEVA 1Q91A 1ZD3A 3ZI4A 1L8OA 5AW9A 3HLTA 4UMVA 5AKLA 4FE3A 2EARA 1Z4IA 2WF9A 2NYVA 2C88A 3AR8A 3QUCA 2G80A 4HGPA 3KD3A 4MWOA 4UASA 1RKVA 4MUMA 2HDOA 1ZJJA 4HGQA 2ZBFA 3SHQA 1L7MA 1Z4NA 1Z4QA 4NFLA 3ED5A 3B8EA 3N28A 4UATA 1RKQA 4YIKA 1U02A 2G06A 3NUQA 5T41A 2YJ5A 3AR6A 4ZEXA 3HYCA 4G63A 2JAWA 3ZW7A 2WF8A 1TJ3A 3W5BA 4EENA 5AM5A 3SF0A 5AKXA 2HF2A 1Z5GA 3NALA 1YS9A 3ZUPA 2EATA 2G08A 4HGOA 3RFUA 4UMEA 2P9JA 2ZOSA 4B6JA 2GMWA 2RARA 3QU9A 3N8GA 4UU0A 1RPZA 3DV9A 2HF7A 3F9RA 5ALOA 4YCNA 2I7DA 5AW1A 3QU4A 3WKDA 4UW9A 3W5AA 2WFAA 3ET4A 2I55A 4KN8A 1K1EA 3L7YA 5AVSA 3WK8A 3DAOA 3IB6A 4Y2JA 4C4RA 3AR2A 4BBJA 4OCZA 5AI5A 2JGAA 2IOFK 2JAUA 1TJ5A 1L7PA 1YDFA 3KDPA 4BEWA 4QJBA 2Q4RA 2R8ZA 3OCVA 5AVQA 3BWVA 5ALHA 5ALQA 2YFYA 1ZD2P 5ALWA 2B82A 4F72A 3S6JA 2PR7A 1EK1A 4Y2VA 3UMCA 1RC8A 1EK2A 1RKUA 2MSNA 4L6CA 3FM9A 4EX7A 5AW8A 3OCZA 2AGVA 2EAUA 4GXTA 2HI0A 4JB3A 3SLRA 3QUTA 4BKMA 4EELA 5AK5A 4YCLA 3QU5A 3A1CA 1ZOLA 4OD0A 3WK5A 4XE5A 1WZCA 3B9BA 1U7PA 3FZQA 2RBKA 2RAVA 1QQ7A 2B0CA 2W11A 2YMPA 5ALLA 2HO4A 3L0YA 1L6RA 2GHTA 1TE2A 1Q92A 1WVIA 2JAOA 2AMYA 3WK7A 1Z4OA 4CF4A 4CNQA 3P96A 4EEKA 5AW0A 2B30A 2G07A 3PGVA 1XVIA 1Z4KA 4UMFA 2ZBEA 5AKYA 1RMQA 2B1RA 4CE6A 2PKEA 3SD7A 2FI1A 4UU1A 5AIAA 5AKIA 4G9BA 1U2SA 5ALFA 2OA0A 4I9GA 2I34A 5AW4A 2YBDA 3PCTA 2FDRA 5AM2A 5AW2A 3ZTWA 4DFDA 3L5KA 5AVXA 1Z4PX 4DCCA 5AIBA 4KX5A 4UM5A 1QQ6A 5AKJA 5ALSA 3EF1A 4L6AA 2BDEA 4NWIA 3MN1A 3J7TA 3ZWDA 3EPRA 2HSZA 2W43A 1O03A 1Y8AA 2GFHA 3PGLA 4Y2UA 5ALRA 3ZTYA 1RQLA 1N8NA 3AR5A 1O08A 4IG4A 4Y2XA 2HCFA 2CFRA 4OHFA 1CR6A 3AR9A 5AVRA 5AKZA 3R9KA 4Y2QA 5AW7A 2NO5A 5AICA 5FP0A 2MU2A 3MC1A 5JJBA 1KYTA 5AKHA 4H1WA 4HGNA 5ALZA 2C4NA 3UMGA 4XOUA 3UM9A 2CFSA 1S8OA 3A1DA 4Y2YA 2NO4A 1SWWA 5AVUA 1FEZA 1RLOA 4NV0A 4QQFA 3ZVMA 3CZ4A 2IOFA 2ZXEA 3I1YA 3QUQA 5ALJA 1ZRNA 5AVTA 5ALPA 5ALIA 3R09A 5AVWA 5AK3A 1MH9A 3AR3A 3AR7A 3U19A 2C9MA 4I9FA 4HAIA 3IJ5A 4FFDA 3L8FA 3DDHA 1WPGA 2VKQA 4F71A 2YMMA 5AK6A 3B9RA 4L57A 2FPSA 2YMLA 1L7OA 5ALMA 5ALXA 2I33A 5AW6A 5ALGA 3ESRA 1YNSA 2QLTA 5ALTA 4C4TA 3MMZA 4UARA 2YJ3A 5AI8A 5ALDA 1U7OA 1RLTA 1RMTA 1LTQA 3WK4A 4KYTA 2W4MA 3A3YA 3OPXA 4BYGA 3QX7A 2MU1A 2HHLA 3ZWKA 4BX3A 1QH9A 3L0CA 4EZEA 3OCXA 2B1QA 2YJ4A 5AESA 2YN4A 2IOHA 2CN1A 3NIWA 4AS3A 5ALYA 3K1ZA 2AUTA 5AHXA 4RETA 3DNPA 4BX0A 4UAVA 4YCMA 3GYGA 3KC2A 3WKAA 3NANA 4Y3UA 4UM7A
chains in the Genus database with same CATH superfamily
1JMYA 5D3MB 5JO0A 5T4EA 3UBMA 1I1QB 1K27A 1ZUNB 3T7RA 4J90A 3NHLA 4PSUA 1CETA 1G60A 3PD7A 4EPWA 2R5WA 5A3SA 2B35A 2JI4A 2UKDA 2QYHA 3DJYA 1PNVA 4C7MA 1RJ9B 3PSHA 4PINA 5F2EA 3K9CA 1UBLS 5KB3A 3IR6A 2VP3A 3QBDA 1C3OB 3CB2A 2I2DA 3LVBA 4HZUA 5FTJA 3TL2A 4DLTA 2BMDA 2J3LA 2VAXA 2WSYB 3W2GA 1GQ2A 4IS2A 1N2ZA 2Z8ZA 5K3AA 4B9LA 4C22A 5K6RA 4H3VA 4XUCA 9ICPA 1W73A 3EXG1 3H8VA 4FOLA 1M2OB 2Q99A 3DBRB 4R8SA 3D8NA 4WKCA 2OYCA 2XE8A 5EAIA 2BR3A 2A5FA 2C2WA 3JVDA 1SEPA 2B34A 3M0EA 4BNDB 3VR3A 4C87A 4O8CA 1WUTA 3BZCA 3DBLB 1C41A 1VM6A 2BY4A 3DT9A 2QGNA 4HR7A 4EHBA 2WIKA 2ECKA 1T8PA 3IERA 3ZBTA 3R24A 2X7XA 4C0ZA 1SL2A 1V5IA 1VA5A 3GV8B 2EHJA 2IWRA 1PYGA 2G36A 3JALB 1IB0A 4BAUA 3BGOS 4BNLA 2C4HA 3T1QA 5BT8A 3QW2A 5CHGA 3I72A 1JLHA 2BCRA 2IT1A 5IW8A 1U7UA 1U8ZA 2PZEA 1WOMA 4KQGA 4ECEA 2WM2A 3ET5A 1DQYA 3H40A 2DSNA 2NLOA 1UOOA 3QVJA 5DP1A 3C5HA 3ZZTA 1FYXA 3L1VA 1U7DA 5IT4A 2WKQA 3PTAA 1XZCA 1DCKA 1BD3A 1N2GA 2NU6B 3G6WA 3V7LA 3Q7PA 1LF0A 3OPQA 4HTFA 5JYDA 3L77A 2ZZMA 2A33A 3OEWA 4ICAA 2QTLA 2O23A 2VDQB 3ZE0B 2HMVA 1H2ZA 1YHYA 4EOGA 2O2DA 2WKWA 2P3LA 2VUHB 2QVLA 1GYQA 3CJQA 3TDNA 5C3MA 3VC3A 4TS3A 5EHGA 2QPAA 1T3ZA 1K9VF 2AJQA 1MFPA 3ENQA 4BWJA 1QHNA 4N3CA 3WWPA 4DJDC 2Z6UA 1AO0A 1G5QA 1MLDA 1QO9A 2AT1A 4JQZA 4XPZA 2PANA 3SYRA 1ZQGA 3WIUA 2BE9A 3PRKE 5G2OA 5BSFA 2GH1A 3E23A 1GPLA 1THGA 4BGDA 1XQYA 3UC9A 3LPMA 1JI7A 4ZEOA 5EJMA 4DYHA 3RAQA 1JN3A 1AIPA 3GU3A 2XQFA 5FL7A 4NXZA 1NVBA 3OFVA 2JFXA 3E84A 5JCZA 2CT8A 4JOBA 2H3EA 4JI6B 1T8EA 4BV2A 2OOSA 3LOUA 3Q87B 4NHEA 2R8BA 2YYYA 3NNDA 1KGDA 5DJ5A 4EPYA 5HA5A 4ZCTA 2FJ6A 1W2WB 2XOKA 2C2DA 3PFFA 2VF7A 4KQ2A 4M2LA 3AETA 4ZT5A 4KVGA 1HM5A 2CBGA 2FW8A 3FKQA 3KWFA 4O08A 4OGLA 4BCCA 2NZYA 4B0OA 4C5CA 1Z25A 1JN0A 5F98A 5A0LA 2IZ6A 1NSTA 5IIJA 1IZYA 1DELA 2IA5A 3CZMA 3NVWA 3GXBA 4NESA 4NU8X 3CBGA 2IJGX 3PFHA 1CIPA 3CGGA 5J0QA 4O02B 3F46A 5CRIA 3FSJX 5FNZA 4AXBA 5CXUA 5HM6A 3KE9A 5J2DA 1ZU4A 5EHNA 2ZDQA 3W8FA 5FULA 3VJRA 4DJTA 4KWIA 2PR2A 2ZUEA 2VDVE 1HUQA 4K6HA 5ICMA 5NLLA 1KC1A 1RPJA 1SIUA 4JASB 4YRTA 3V8EA 1HSZA 4EBFA 1ESNA 1BC5A 2J67A 3IYLW 3RKSA 5KNLA 3PFIA 1TZ2A 3W04A 3CLVA 3H0CA 1VFPA 4Q3BA 1AQ6A 3H8WA 4URYR 1GGJA 3VR1A 2WJ6A 1TMYA 1I2DA 3KG2A 2AZDA 4CM4A 1OIXA 3U44A 1DGJA 3A6HA 3GFPA 5KFMA 3FN4A 3GT4A 2O06A 1GRVA 2YWGA 4KFSA 4JR1A 1EG7A 1GA6A 1G59A 3RRHA 3ILVA 1UJ4A 3KOMA 3M83A 3U3DA 4TV8A 3UXNA 3BA1A 3GPLA 4M0EA 4DAEA 4Y2SA 5FPYA 5DLQC 1T4GA 3S8MA 2DHDA 4TN5A 4V0SA 1L5FA 3C1YA 2ORVA 1MQ9A 4ZGGA 2W2KA 2LI6A 1EHCA 2P6RA 1OFUX 4PYQA 3SAFA 1JIXA 1HT3A 4DW8A 3BGVA 3PVCA 5KQRA 3X2FA 1NU6A 4PHFA 5H9VA 5T3UA 4RL4A 3FBWA 2IEYA 3SE0A 3EXEA 4JK3A 1PV2A 3LYUA 1R8YA 5HS4A 3G1TA 2H5XA 1P5FA 1V6SA 2GEFA 1P2BA 1R6BX 2JD2A 1VCNA 3LDGA 5AJWA 1JT2A 4MXDA 3SV4A 4POAA 1IQUA 3RC9A 4BGVA 1NJXA 5CH3A 1TD9A 2NMVA 7ICIA 3K16A 3KSBC 1N7JA 3OCCA 3P9ZA 1ISPA 4JI2B 1WWVA 2ZB3A 3R3HA 2R8GA 3L3FX 4M6WB 1U0RA 5JSYA 5TNXA 5F1YA 2NZUG 3R7DA 4GRAA 1VHTA 1BW9B 1QIEA 3D3WB 5TX7A 4F4UA 2XHZA 3GJ7A 1WWUA 4Z5XA 5KWEA 1KTVA 4GI7A 3KQHA 1KJQA 5L3RA 1L6NA 5KSZA 4Q43A 4HI0E 3CJTA 5AO9A 1IN5A 4YJ2A 1RZTA 3TW0A 1K5DA 5LBUA 4K9OA 2J9FA 1DG3A 2O5VA 5IILA 1CU1A 1N32B 1IZZA 1NXOA 4M1OA 4HGZA 4HNGA 2YY7A 4YCCA 1KU6A 2EFDB 4NY8A 4MV8A 2D7CA 4TPKA 2FSVA 4TS9A 4EA8A 1D1PA 1LVGA 1IZ8A 2OSVA 2FV8A 3N8NA 4HDKA 8ICWA 3PRHA 1W5BA 4X90A 1N5IA 1MVOA 1X9GA 3O83A 4MS4A 2ZIGA 4U39A 4HAUA 2AK3A 3LPLA 3T6KA 2HXYA 5CH8A 4EGFA 1RJDA 2DH6A 2CDRA 1EYZA 2C5EA 1AC5A 3AR4A 4WEQA 4AUKA 1I7SB 2W6PA 5DW3A 2FQYA 2R79A 3JCZA 4M98A 1BKYA 2PXHA 4A82A 3PUHA 4RZXA 4RHTA 3TACB 1S8FA 1JDSA 1XCMA 3HUUA 4FZRA 4MUHA 5BYBA 5BMVA 3IIJA 4KO2S 4LZWA 4V1CI 3UYLA 3D3KA 4C7OB 4NZNA 2YWBA 4S1TA 1KZ7B 2LUOA 2WM9B 4KDRA 3WMXA 3T3GA 1XZAA 3PR4A 1S3FA 1LWOA 1XMIA 2IY7A 4MQ6A 1QOZA 2EARA 4EK9A 4EUEA 5AVRA 1DUVG 1TT5A 5DHFA 3OO1A 1W36D 2BJWA 2ODPA 3SHVA 1VYHA 4ZXFA 3VOSA 3IT2A 1UAAA 2YW9A 2W03A 4OI1A 3ROQA 5KFEA 2UYCA 1GR0A 3UHJA 4HN2A 1ANKA 2O20A 3UOWA 1WSBA 2AOTB 4AMBA 3RKRA 3PB3A 3MM4A 3BWXA 4K86A 4MZXA 5C1OA 2QNRA 4QAJA 5D8DA 2R7AA 1GFWA 5IKMA 2R8JA 1RCFA 4REQA 2H0QA 2WT8A 1DAGA 3AKEA 4P4MA 3RU7A 3PQ8A 4MR7B 1HV8A 4C7OA 3G6YA 4F4HA 4HEHA 5LNK1 1VMKA 1YASA 5AHWA 4BQQA 3A10A 5EHQA 5AM5A 2XTMA 3I9OA 3VU1A 3B2QA 1HEKA 5CDUA 2W6IA 1M34A 1TQ6A 3AF6A 1PYDA 4B9VA 3EVCA 4GM1A 4PY2A 4YCBA 5L4LA 5LP6A 1JG1A 1I4EB 3QPVA 4H15A 3C6BA 1ZN9A 1R64A 4UNSA 1KERA 5ITVA 4Z49A 3KO8A 3RRNA 2JCVA 1C3OA 1QDEA 4HZUB 5CLIA 1F4VA 4KMUA 2G5PA 2VA2A 3F9RA 4UPDA 4W7SA 3F5EA 1XIVA 3LQ1A 3WGOA 5JH7A 1I9CA 2W2XA 4Z0NA 4CDGA 4FDAA 1LRKA 3V00A 2A4MA 2UZAA 4YUVA 4C4AA 5M5BA 2XYGA 4WLNA 5EZSA 4RPYA 1C1HA 2IYQA 3N8KA 4J91A 4S1PA 5IDYA 2YW2A 1RADA 3ROPA 5EJ5A 4MA4A 4Y2JA 2KYRA 4X6UA 3VSDA 2PLWA 4ZV4A 1AMNA 1Q0ZA 2K7FA 1N75A 4BBJA 3U61B 1R3DA 3AFIA 3LOPA 3MBIA 4FR5A 3L6RA 4G9GA 4UTXA 1L7PA 4BLQA 3M89A 1K6MA 1BE1A 2HLPA 5AHKA 1GU0A 1H0KA 3HYTA 3VR4A 4IRKA 4LQCA 1O8BA 4M53A 3DXYA 4TYQA 4PYRA 4Z1MD 4G6ZA 2PMBA 2IYUA 5IZCC 4LJ6A 1ODSA 2VEOA 1DO2A 4QZDA 2V9WA 2A84A 2VCYA 4RANA 1KWGA 1NSFA 2E4AA 2MSDB 4CLRB 4NENA 5A1JA 4F91B 1IPEA 1J8YF 1V95A 2RC6A 2CBXA 3DL0A 1ST2A 3LQYA 1MJFA 1D4OA 1PQWA 3PX0A 5IIMA 1Q44A 2V03A 3JWJA 3PJGA 3OJFA 3RVKA 3MDAA 2X4LA 4QGAA 1I7LA 2VSQA 4BNGA 1JE0A 2KIVA 4IIGA 1SXJA 1N3LA 4M0CA 3GGGA 4LZAA 4YDHB 2X14A 4EPTA 2HMSA 2OV1A 3EJWA 1Y4DE 3ZZ1A 3O6VA 4OXQA 3L7OA 1X0XA 3MQFA 2BQRA 4CQLA 1V5FA 1IEQA 2RK4A 4ZARA 1F51E 1RRGA 3FOEC 3EXIA 3WK5A 1PGQA 2EW1A 1R4AA 1ST3A 2EAPA 1QHHA 3H5RA 3EIQA 3T7EA 1SCBA 2P2LA 4YS6A 1Q95A 5DBIA 2VDNB 4CGYA 2BT4A 2I6UA 4OOEA 3RJGA 5EQTA 2GHTA 1U8TA 4D8XA 2JFZA 3KZ1E 4FI3C 3W6ZA 4MP3A 1LGYA 3EE6A 1PUZA 1OZFA 3QM1A 3HL0A 3IOYA 1Z4OA 3M9XA 4J4BA 1V3QE 3K1AB 4EEKA 5B1DA 1VKOA 1Z38A 2VDOB 3TARA 3OZXA 4LJ7A 4WK6A 4KFCA 2HGSA 2GF9A 1W4BA 4FWIB 2K4IA 5G40A 1G21E 1X7XB 2GCNA 2R6R1 5JNRA 4Z6CA 1SKYB 3N58A 5A62A 2IIVA 2F43A 3N2GA 4KSYA 4GPZA 2XQVA 4P4GA 3UK6A 3WGQA 3GRVA 3ZY6A 5JS2A 4IXTA 4D9EA 5KYUB 2XVXA 1RT9A 3A0UA 3HRIA 2V6GA 3OLYA 3VZRA 3ZD9A 1F2UA 3PCTA 3QFCA 2P4QA 4NICA 4QZEA 5EN4A 5H7XA 2DHCA 2O7RA 3EULA 3FJ1A 2XT0A 3PQEA 5DBBA 5CP8A 1E0AA 5CR0A 3VNQA 5CBPB 3BGWA 4FR0A 4C0XA 4FB4A 2BCQA 4DLVA 4YMGA 1RZRD 3DMFA 3GEPA 3T5MA 4YUYA 1XU4A 2F1KA 2VUUA 4NJEA 1YOBA 2WABA 4UKDA 4RTPA 8MHTA 4GZ3A 2CF6A 4DIFA 4G0WA 2ES4A 2YASA 4HDSA 2Q6LA 3ZWDA 4NPCA 3KT3A 1A98A 2GLUA 3E2PA 3ADPA 1UODA 2Z1MA 2CNDA 3PW4A 3BWMA 3PUZA 4XDGA 1SB3C 1T34A 2AXQA 3B13B 4IG4A 4HFNA 3ADCA 4OK3A 1URPA 5LBIA 2J87A 4U1RA 1YF3A 3AJ9A 5AXAA 5TQ2B 1MR3F 1IHUA 5C7OO 1WPQA 4CIYA 3MCAA 3NETA 2AGQA 1BCSB 2QGZA 4MIOA 4KIUA 3U17A 1FIQA 3IDZA 1EFVB 3BE5A 2ONYA 3IHWA 2BJVA 4GFDA 2W7TA 4GZLA 3H65A 5DKFA 1QX4A 4R1NA 1F8UA 3RC1A 2JLBA 4W6ZA 5AVUA 3QXHA 3C1AA 4BASA 4B3BA 3V4FA 1P7VA 3EBLA 1GGNA 3KJQA 1U9JA 3T61A 3UAZA 3ZVMA 3HNRA 2CVFA 4DCSA 2H1OA 3RVSA 1K98A 2ZLBA 1MJGM 1NWHA 4RCYA 1ZRNA 3CV3A 2GPYA 4RVUA 5EY5B 3VR6H 3TGLA 2IV3A 1DQRA 5JSKA 4OBEA 5CWRA 1MH9A 1QHXA 3QBJA 3KWMA 3H5IA 1NW4A 4JGGA 4RTNA 1Q84A 4LPKA 4E5YA 3WQRA 4IO1A 1KSJA 1PX2A 1BRTA 3ENVA 4Y6LA 3T9AA 4DCJA 2AR9A 1RYSA 4LY9A 1KXJA 5C3UA 1ZDMA 3SCZA 4DSNA 5BOSA 4EW1A 3G5MA 4B2LA 3L8FA 5HJ5A 1Y3BE 2C2HA 2C77A 3F74A 2IL1A 4RQ3A 4F71A 4NC9A 1YR9A 4M8LA 2YMMA 2XQJA 5DDIP 4F7DA 3THYA 4RQ1A 4HEA1 2C4TA 2FPSA 4CR7A 5I7EA 4G23A 1F6WA 4EGJA 4F85A 1CUDA 2W2VA 2QLTA 1T1EA 4YJHA 4QO7A 1WLSA 4ZDJA 3EMDA 3MAGA 1MJHA 4YG2A 3JQ9A 1BO6A 2NXCA 2XMDA 4X9XA 3AYXB 5EWLB 1B0XA 5EKTA 1RLTA 3FG9A 1TF2A 2IPXA 3VKWA 1DTWB 3PZRA 2W54A 3PD1A 1X7HA 4EBCA 4U2DA 4RKRA 5HDBB 1JEQB 4BX9C 4PG8A 3TSWA 5G02A 3N6RA 4UHKA 1P17A 2PZMA 4UUAA 4BX3A 3G2PA 5E38A 5JRJA 3AEZA 3NVYA 2DRIA 1T4MA 1FFAA 3B7WA 3OSNA 4A8JC 4E30A 1I6KA 1ES9A 3B1FA 3DMDA 1V37A 1PAUA 2BGKA 4X91A 3TZLA 2KQUA 4ZQHA 4EMUA 1NKSA 2AJBA 2VAPA 3R3ZA 4XM2A 2Z2XA 3VR5A 1T3SA 1RHQA 2CW5A 7ICNA 1NP7A 1UF9A 3IGFA 4ITVA 3ZOZA 4D57A 5CA0B 2CBZA 4RQ2A 3GMIA 2YNMD 4PYKA 5ERGB 1FX0A 4YRKA 1N78A 1JA1A 3RR2A 2ZE6A 1KYVA 2NYUA 2GN8A 5B12A 2ZJOA 4X93A 3BEDA 3N97B 4MS3A 4BFVA 4DL7A 2A35A 4MLPA 2FF7A 1RWXA 3K20A 3I5XA 1NW3A 4MK4A 3U9TA 4PGFA 4RV4A 3FTFA 2HQBA 3HU1A 1XMSA 1Z8DA 2WD7A 3VR2A 4LJYA 1PKXA 5IVDA 4QZHA 2OBFA 1ADFA 3KHLA 1HMPA 3AUUA 3P20A 4J1NA 4EY5A 1D0VA 5JTUA 1UC4B 1E5XA 5ECGC 4D82A 2QZSA 1KAMA 1T9GR 9ICLA 1FZQA 2IKQA 2C8KA 4WVFA 5A06A 4GKBA 5KJFA 1GV0A 3RJFA 1J42A 4RXUA 5LP6C 1XA4A 1N0IA 1I6WA 1XF1A 2CK3D 3ZE7A 4D3ZA 2IS4A 2V9PA 3OIFA 2NTJA 3EXHC 4P9NA 3HVKA 4PZPA 2Z6VA 1VDMA 3CLSC 4O2LA 2VVTA 4RVDA 1X6JA 1P80A 1X7WA 1RQ7A 2G0AA 4LX0A 5I9LA 2QKYA 2IUEA 4ARVA 8ICYA 3BULA 3I64A 4TWIA 1OTYA 2DR0A 2FZLA 4RF5A 3LXMA 1X6VA 3FPKA 1R15A 2D2EA 1J2YA 4L8FA 3TOSA 3A0HU 4RCVA 4O5EA 1J1ZA 2YJZA 4YMNA 1TM1E 4P7JA 2AXNA 3ANXA 1QYIA 2P9BA 1HDXA 3V2GA 4B7AA 1W1WA 1N7IA 2X1HA 3I53A 2G63A 2P8SA 4JU9A 4O4JB 4J3JA 4B75A 2X0NA 1CR4A 4BB6A 4BRSA 1QO0A 2JJ2A 4C0HA 5IX8A 2HYIC 1MX1A 3H2GA 3TUJC 2B2NA 3LAWA 4DF4A 4KMOB 3O4FA 5CK4A 5CB4A 5IASA 1JFVA 1BQ3A 1XJCA 1YB7A 1JR3A 2AN3A 5FX2A 1XN4A 2FEMA 2VDUE 3VZQA 2B9VA 1KO8A 4WOCA 4EA9A 2OV4A 4BGUA 4ZJYA 2PI5A 1VB3A 1GITA 1POXA 3NWJA 1ATZA 1NYTA 3Q6IA 4YCDA 1G5RA 1YIOA 2OM6A 1QKJA 1XPJA 1P5JA 2UVUA 3A36A 3LA6A 1RRPA 1TUIA 4IXMA 1IAQA 3CX4A 2DFKB 1NOKA 5EMLA 1N1GA 4I2AA 4MTCA 4PZCA 4HRVA 3H16A 1NFQA 2I7TA 4ELUA 2QAGA 3ZD6A 2VANA 1W35A 4QXPA 3ICXA 2LPMA 4HATA 4NE2A 3OY7A 2V4RA 1JAYA 3SC3A 4DDWA 3KUXA 5FD8A 4JWKA 2O5CA 1JPNA 2QB1A 3L7AA 4RM2A 4XIIA 3KZMA 3EVDA 3BAFA 3JY6A 1UWKA 3A8TA 5CLLA 4H6VA 2QLMA 4FDVA 2WFLA 1QLNA 3KKEA 4BNKA 4JOCA 3KOOA 4ZZ0A 2QTCA 3W90A 4NOKA 4DOCA 1Q7EA 2H3HA 4MYTA 4WK0B 3VSCA 1SG0A 3P2JA 5KFZA 3CT4A 2HK6A 2WYHA 5K4LA 3N8IA 5I8WA 4J9KA 1B2RA 4MI6A 4YA6A 2MWMA 3FOCA 4MARA 1FRNA 5ENDA 2AOTA 4F5YA 2Q9UA 1KYQA 3DDSA 4FI3F 3LMKA 3DA8A 4O63O 4OMDA 5JAPA 3HX0A 3T9CA 1I5EA 4G5QA 3PXBA 3DOFA 2OO5A 2H4FA 3B60A 3INNA 1N7HA 3PR3A 4KI7A 2OY0A 4H16A 1JEEA 1T7PA 4KAJA 4TS1A 1CW2B 4ZOLB 4UAUA 5KNCD 2XGGA 3AL2A 3I1JA 5ED0A 2N42A 3OQIB 1RWNA 2ZIVB 4EF6A 4P32A 1R6AA 2LE0A 1M34B 1E6UA 3HXMA 1VSUA 3RF9A 2ZW9A 4N8SA 5H59A 3W5CA 1J9ZA 1W47A 1D0SA 1GPH1 2BMFA 2Q6VA 1ZQWA 3F7MA 3NYIA 4F1JA 4UOQA 2V5UA 4ND5A 3FYUB 2QK4A 1ISIA 1E69A 3V48A 3UV3A 3WP0A 1EXMA 3IAEA 1AQUA 1QVRA 4F1KA 4ZI3A 1J9GA 3BCRA 3RHZA 4BVHA 4EHIA 2MHCA 3R7FA 4JLWA 3MJVA 1W4AA 3IULA 1X2BA 5ER6A 1YSCA 2NU9A 2V96A 2IH5A 1BD4A 1AG9A 1Y82A 4PJ0U 3RS5A 9ICJA 1GEGA 1ZD9A 3JR3A 3MLEA 4C2TA 4JB2A 2KN7A 5H80A 4C89A 4X44A 3UA4A 2B98A 2QX6A 3WB9A 4GQAA 1RJGA 3GC6A 4H7KA 5LZ9A 4G3IA 1XP5A 1A0PA 2NGRA 4LW8A 3S2YA 4EYEA 3GQCA 4YAGA 5A4DA 1PHPA 1RDFA 1M34E 2IXDA 3Q7TA 3H9EO 3K32A 1XUOA 5IC6A 2N1MA 7ICTA 3OSPA 3CURA 4NU5A 4BNVA 4ENUA 3C6KA 4Y67A 5L40A 3SVLA 1AKWA 1LDMA 3RVBA 3G2IA 2W6ID 3UJ6A 4ER7A 1TU0A 2W9XA 2AG8A 4BVGA 2CC2A 2OT3B 5BMOA 7REQA 3MGHA 1SELA 4U0JA 1FXWA 1V0JA 2QLLA 3NNSA 3KZIU 1B73A 4N4AA 4UDOA 1Q83A 3T4EA 3E2IA 4R41A 4BL5A 2Y1JA 4QYSA 4TL8A 4TV9F 4V02A 4JI4B 4OK5A 4OQXA 5CYOA 3UICA 3U44B 2PGLA 1K92A 2W9MA 1FUEA 5FAKA 2EH9A 4QDUA 4KUHA 1G2QA 3EMVA 4YX9A 5FOSA 4C0KA 4HLUC 1HT2E 5JS6A 2C2RA 4E88A 4FDUA 3G88A 4QWDA 2XX3A 2Y2VA 4FK8A 4ICIA 1VFNA 2JGDA 2OO3A 3DKPA 3I37X 1PJ3A 5TMEA 4DWOA 3Q3VA 4BJ6A 5JFGA 5A02A 4I1IA 4R1OA 4HEQA 4IICA 1D09A 2Z2JA 3LWMA 4Z6EA 5D1HA 1O5OA 3GELA 4M36A 2BHSA 5FI5A 2PUFA 5AKEA 1U3CA 1Z00A 2ZWVA 3QLUC 3BZKA 1FQKA 2I2BA 5BV8A 2EQBA 3BZBA 4N47A 1GGKA 3CB4A 2G1AA 1IUNA 3PHJA 5JARA 4B3SB 1J20A 2JHGA 3MMXA 1J1IA 1ZMOA 2VTEA 2X22A 3ND9A 4QBFA 4S24A 1IMJA 3ND6A 2YS6A 3RCBA 3ZDFA 4ZA2A 4Z1MA 1PQ4A 1C14A 5LN1A 2Y9TA 1YU6A 3DO5A 1GU1A 2VO1A 5IYZA 2CV1A 3JD0A 1M2NA 4EX6A 1HL7A 2DTXA 2EFGA 4UOEA 3IIIA 2ISPA 1MQ8B 1BVUA 3T99A 1HG1A 1T36B 4QYIA 1PL8A 2JFGA 2B4TO 4ZVMA 4C06A 3AEVA 1NJFA 1Y3IA 4DC9A 1ZGGA 2H6EA 5KVVA 2DBVO 4FE3A 3OBIA 4RQTA 3C6MA 3G8DA 4OLHA 2XXAA 1R9NA 2E85A 1T29A 2HZBA 2XV1A 4HGPA 4JQYA 2ALJA 4O8ZA 4Z8XA 5JI3E 1N2OA 1YE8A 5L3SB 3IEUA 3B20A 2OESA 3LZDA 3E4DA 4MKXA 4ONEA 1Q17A 1BA2A 3V4VB 4NM1A 3DHNA 3GP3A 3E9ZA 4JYPA 1C8KA 2Q4BA 1LDEA 8ICLA 3DEJA 1BH6A 2OZVA 2CHEA 2V7QA 4GZMA 3NBFA 5B37A 1HNXB 3NUQA 3WV4A 3NHUA 4YGXB 3K9QO 4O2AA 3UK7A 1RBMA 3RK4A 4IF4A 2YIJA 2HU8A 2FLVA 3IAUA 3RYCB 3EB9A 1P61B 4JT9A 1LA2A 3MZ0A 4IDNA 1GSHA 3HRHA 1XMQB 1Z07A 1GPAA 3T3OA 4D4LA 3NXKA 5LA6F 1NWCA 4UMEA 1ZG3A 2JANA 1MOPA 4ZV7A 3H5LA 4CUZA 4YJ3F 5GQSA 2XO7A 2DBRA 3E61A 2WIAA 2DFVA 2M6KA 3SENA 3E9QA 2XGSA 2YC2C 1XD9A 1K4KA 1PFUA 2CZCA 1DIGA 2ZQ5A 3AJDA 2HIGA 3CSDA 3EIHA 4N40A 2PJUA 3A2KA 4O5KA 4ZTBA 2HF7A 2V6BA 2A30A 3PX7A 3GW8A 2ZIUA 5FF9A 5BQXA 1SKQA 2ZRMA 5AOAA 4GMHA 4RPIA 2D4HA 1BVRA 1JHPA 3GCWA 3C3EA 3H5AA 3IUJA 2F6RA 4BNWA 2Z4SA 2GZHA 2V45A 9ICNA 3CN9A 4WOBA 4EFLA 3OIDA 1CCWA 5TMPA 1VG0B 3UUGA 1YAJA 3RAFC 1UINA 1T10A 2JZOA 5BV0A 4XRRA 3L41A 4ZQIA 3DFZA 3R5SA 1KH3A 1W87A 3I52A 3P7MA 3V7JA 5J1TB 4DUPA 2ZRDA 1KHTA 2KW5A 3FZNA 2DMRA 1TM4E 3BWVA 4TLDA 1Q1ZA 5C1IA 4BCDA 3AY6A 1KOFA 2WJHA 1C1DB 3WGZA 3WNZA 2ZBVA 1S2DA 3BPSA 3FKSA 2J9RA 4FHZA 5KZMB 2A78A 3FPGA 4HRAA 4LFBB 1JIHA 3WLAA 2XDYA 3WJAA 1YOVA 4JYBA 1RLUA 3OHBA 2AUMA 4RHEA 2XCIA 2JZBB 4CKWB 5J2IA 1F3OA 3PO4A 1D9XA 2X19A 1YFJA 2OL4A 1UMDA 1AGPA 2H1FA 1CY7A 1YD7A 2PT7A 3D6AA 5F52A 3ZD8A 1Z28A 4OJKA 4NX2A 3FM9A 1WB4A 3LT0A 4TTIA 4WZBA 3TQQA 3KQMA 3UT6A 2HB6A 3O0FA 3LM8A 2QD1A 1YH3A 1I5OA 3HFJA 3CNOA 3K0FA 3SQIA 3OEYA 5KTSA 5F5XA 4KQ6A 4KE8A 4LCBA 6CHYA 4DCNA 2OLEA 4HH3C 5KFNA 1A4UA 3ZWQA 3JATB 3R3YA 1IAVA 1GN9A 1XLTC 4G5SA 1T6NA 3N9IA 3PGMA 3BE4A 5JSZB 1H42A 4F4IA 3LYSA 2W2KB 1K66A 9ICRA 2VATA 1AF4A 3LQ2A 4OHKA 3KB1A 2GZAA 5EYPA 2O0LA 3VPGA 4CKCB 2JZBA 5D46A 2REBA 4EO7A 3Q3IA 1Z12A 3AYZB 3UQ0A 2Y9UA 4M9HA 3R6TA 3D8HA 4MUBA 1ZIPA 4XW2A 1MT0A 1JQKA 5A1TA 3P96A 1V71A 1A27A 4JGBA 1FX0B 1ZW6A 3PGVA 1FFXB 3N2YA 4KAAA 4UMFA 4KJZA 1FDRA 2GYYA 2EYUA 4WX2B 3WLHA 3PHBE 3G0OA 4UTZA 2I3AA 4MEXA 1U3GA 2EP8A 3CLRD 2IXEA 2X3YA 5J0RA 1P8AA 3QE3A 4MQ4A 3P5SA 1X6IA 3UIEA 1XJWA 2J3MA 1Q11A 1N2BA 4MPTA 4QEDA 1SVWA 4G2NA 4LXQA 1KBQA 4ZCRA 4H1TA 2HSDA 3I92A 4X5OA 3UNXA 3VDXA 4PHTA 2XCQA 3F2VA 3RRZA 3DKVA 4HLCA 3TNFA 4MMZB 3UK2A 3ZHRA 4JELA 5LYJB 2VWGA 3ZCSA 2C7VA 4C7XA 4IJQA 4PEVA 2ZE8A 2B7CA 3OZGA 1BX1A 1R6UA 3CVVA 7GPBA 3N87A 1M66A 5KOYA 1I3MA 1SKBA 1VQ1A 2FLKA 4MDYA 1I2BA 4QUDA 1EUYA 5I7UA 1HOXA 4ZQGA 1VPEA 2WHRA 4JBYA 4PM4A 5FBRB 4QFDA 3GT3A 1RYRA 3HCEA 4KK4A 4YJ2F 3W4JA 5CLFA 4W9MC 4FNOA 1A95A 1GDDA 2J7KA 3KPYA 5F73A 5IJAA 2UU9B 5FPQA 1DWQA 3VR6A 4CTJA 2WE7A 5IBCA 1QK3A 4XZ3A 1E5LA 1JIVA 4DLZA 2XT6A 5AUOB 3ZTYA 1Q16A 3GHYA 3FNEA 4I3GA 4O5OA 3S1LA 4RK5A 1BX0A 4BB0A 2LTAA 3TJRA 4JSRA 3FOAA 2NU7B 1FXUA 1VTKA 1CR6A 3IFSA 1Y1PA 2XUPA 3C74A 2B7LA 4Y2QA 1UFRA 1XQVA 4U9UA 4ZU1X 1E66A 5FP0A 3I9MA 5FA8A 5JJBA 4WACA 1ATIA 4IWYA 5AKHA 1JVSA 1L3CA 1SC9A 1J09A 2DP4E 2IUFA 2C4NA 3BXHA 3FPAA 3ZBPA 4H1WA 1D9DA 3P32A 1E3WB 3OE4A 3PUIA 3U4HA 2W0MA 1DU4A 4PX9A 1R9GA 1Y9AA 4ARUA 2DJIA 3PIDA 4XGRA 3ZGZA 1G8AA 2P0AA 1SWWA 2V4MA 5ENZA 3KV1A 4GOKA 4DIEA 3WGHA 1M2HA 1TF5A 3N53A 3L9XA 5I9SA 4RZUA 3O5AA 2GBGA 4L74A 2IX3A 2R751 4OXNA 1ZW1A 4PZ0A 4F2RA 4D9IA 3HKEA 2QZ9A 1UOEA 4UXHA 3FAZA 4JYCA 1T5HX 4ZMBA 3SYLA 5ALPA 1SCAA 3A4YA 1FTGA 2W90A 5HJ7A 3EG9B 3EXHA 1BMQA 1J7JA 3LUCA 4FFOA 4GGPA 4BKQA 3T41A 1ZR2A 1GFIA 2OG2A 4P0TA 2F55A 1Y42X 4JJ4A 3H2YA 1UKAA 2YHIA 4BKUA 1KO5A 1O7JA 1Z47A 2B4QA 4PFKA 5K3EA 4ECZA 1I3KA 4IV0A 1CUXA 1Z8NA 3RYIB 1IJKA 1B93A 1Y3CE 2XQKA 3DM5A 2ASLA 2AQHA 4GZ5A 4Q7QA 4LGVA 4MJXA 1U6KA 2HHQA 5EUCA 1DUIA 3BQ0A 4ELVA 4TKLA 3NHYA 5CNIA 1F2UB 2YWHA 1SBCA 2O6KA 4C4TA 2OK7A 3IJRA 1YL6A 1CEEA 2RKBA 3VISA 4A8JA 3MF4A 2C0QA 4AJ9A 5HRCA 1KRXA 5B4VA 1DKNA 2ASDA 3B3GA 4ZYWA 2PIDA 3MHTA 4YUXA 3VZPA 3K2QA 1OZ0A 1PK3A 1FFYA 4XDHA 1P1JA 3OQ6A 3K96A 3H86A 3PFNA 4MUEA 3VZSA 5G0WA 3HJAA 1HORA 1JTVA 5T8KA 3WQHA 4DSAA 2KJ9A 1U2RA 1UKZA 1XTUA 5D3MA 3RBZA 3N7TA 5IXJA 2IA6A 1W19A 1EJ2A 2QT1A 2K6GA 4Z4CA 2CL5A 3NWOA 4Z0PA 2O3SA 2HADA 1U63A 2L18A 5GONA 5KSYA 1NVUQ 1G5IA 1P44A 4KQIA 4I2BA 5KVSA 1E3MA 1JYSA 3GIDA 2QYTA 1I3OA 1W2HA 4NYMR 2RCNA 2F2AB 3JWIA 1E7QA 1TL7C 3W3AA 3TZBA 3BKXA 3ZLTA 2KMLA 3V1NA 3RFCA 1KZHA 4K0KB 4WKOA 5FCDA 4AM8A 5A6SA 2X1VA 1IOWA 3MOSA 5ESWA 3TBKA 4GE3A 3U7IA 3NMUF 3JYPA 4UCQA 2OFPA 1ZEJA 3H2ZA 3Q88A 4HVAA 4YROA 1PR9A 4PZZA 1DXHA 4OSOA 2Y0PA 4DNOA 2IVFA 1DOZA 2VPPA 5AUPB 1BVHA 1IY8A 2PA0A 1KYIA 3AIKA 3QMVA 3LPCA 5F9HA 4WKPA 3O4GA 4ZO6A 1C1YA 3C3PA 3ONWA 1J24A 1JDJA 1ZD5A 5BPCA 4BLPA 1EKXA 1ULTA 4QDOA 3WYEA 4NP6A 1Z35A 5CNKA 4E46A 3KX2A 5K9ZA 1N25A 1XZMA 1CF4A 3F9CA 5JYBA 2X0FA 2XUIA 3FBGA 3V7YA 1JFSA 3OMLA 2F1JA 3OQHA 2HX1A 3OP4A 2C4MA 1XRLA 3WGJA 1P1RA 3JQBC 5CHYA 1ZU5A 3L4BC 2QUBA 4C7VA 1NG9A 3ZY3A 1IPHA 5LQAA 3VM6A 1KZ9A 4KPUB 2PKWA 1PT8A 2QTVB 3F1KA 3UOAB 3WWCA 2KJQA 2OCPA 1PVDA 4XQ0A 3GPIA 4GX1A 4DB2A 5ESRA 3WGNA 1EVKA 1YS4A 3NC1C 4CCYB 2PZLA 2VHTA 4FDLA 4UUOA 4NNJA 4YJ3B 3V2IA 4F4CA 1YR3A 2E6UX 1MSWD 3FR7A 2OQVA 2C58A 4ZZ2A 3NRBA 5LXTF 1J8DA 2AK2A 5FWYB 1KYZA 2ZSIA 3H05A 3NPAA 1UMCB 1T13A 4N0QA 5BW4A 5HXAA 5BN5A 1CEYA 4WSOA 3LZ6A 1IZ9A 3EZ9A 4JZYA 3H0KA 2EL9A 5AK4A 2AMJA 3HA3A 4BQIA 1Q3HA 2WYUA 4MO9A 1GZ4A 4PIPA 3LY5A 5CH5A 1Z6AA 3N0RA 4OL9A 2MOKA 3QE2A 1Z2DA 4MV4A 3E27A 4HNUA 3HXQA 3JQ9C 4LHVA 4R9NA 4YXFA 2XIDA 1M1XB 1P31A 2PH7A 3K6SB 2WHQA 1I2AA 3FROA 4UZEA 2XXAB 4CTMA 1WEHA 1Q19A 4G0PA 1UH5A 4UJ5A 1SM4A 1T1RA 4IWNA 2CXOA 2EJTA 4AW9A 4TVKA 5FJIA 1OF1A 3DL7A 4RWZA 1RXWA 1Z15A 4MPPA 1G7SA 4EVIA 1EUQA 4QZVA 2JHFA 1IXZA 2KI5A 3E3MA 3ILYA 3VAAA 3DVSX 2DPIA 4OB8A 5K20A 3NBXX 4RD1A 3NJ4A 1GKIA 4PL2A 1MP0A 1VLBA 4TMZA 5L3SA 1NRJB 3OM9A 4OO3A 1CVLA 2MRLA 3L4KA 2EG5A 3GR6A 3LF2A 4U9IS 2PVCA 4IEIA 3PSTA 4LOLA 4S1NA 3K9LA 4BO0A 1M1YE 1L8AA 2PFPA 1NJ5A 4BTVA 3CNHA 4M9SA 5LQKA 1K08A 4I50F 3AFNA 2WFZA 1YJXA 2VQFB 1QPZA 3O47A 1RAAA 2QMYA 4G4IA 4PG5A 4DWIA 2DFLA 1UKYA 2HWYA 4RVNA 2GLEA 1HTTA 1NUAA 3OF2A 3P0FA 4OLJA 5H4HA 3UH1A 5A5GA 2WF6A 3O2NA 5FYQA 3OZVA 4UHCA 2D62A 4I2NA 3RM3A 5A3RA 5EJ7A 2DTEA 1N62A 4PO8A 3BXEA 4IY1A 1NW7A 4L73A 1DKMA 2Q5FA 4BQOA 2IYWA 4V0QA 1IY1A 1MUUA 3L02A 1OFTA 4FGUA 1EFDN 2GWSA 1GNRA 2Y8EA 3CRQA 4G5YA 3WDKA 1NPDA 4BTLA 3AHFA 4R05A 2ZB4A 621PA 1YZGA 2CD7A 2D6FC 5EKXA 4DNXA 7ICLA 1KKXA 3KR1A 2XYVA 4IUCS 4MKRA 2C28A 4QPDA 5B3LA 1T5OA 4TMYA 4M0DA 3F8SA 2XTJA 3P9QA 4LSZA 4MMYB 4PPYA 4AYWA 1YBHA 1XPOA 1QJ4A 1X92A 1BWRA 1LLDA 4FEAA 2QW0X 2UXBB 5EL0A 3ZX5A 1M67A 3EAQA 3QGMA 4CF3A 1TEVA 1NIJA 2QGFA 4FFBA 1L5HB 3DOIA 3IDSA 3ZXXA 2Z6QA 5AH0A 1AJEA 3GPCA 1EUDA 3SNHA 3VU8A 1T5DX 3WO1A 4RTSA 1M6VB 2JIQA 2R7NA 2HOQA 3D81A 4UTPA 5J1SB 1EBBA 1EINA 3MGAA 3I58A 2V1XA 2WSSD 1CRXA 2AQIA 4H17A 2JGRA 4GVLA 3T3NA 3MJCA 1K8RA 1DTEA 3KZCA 2A14A 1XTRA 2D5AA 2DPMA 4QVGA 1OZAA 1QP8A 3Q8PB 2Q9CA 5KMGB 2C5GA 1TFUA 4RACA 2I9KA 3IAXA 3ONVA 1CUVA 5KYWB 1VI5A 3OJLA 5KFRA 5DI3B 4XM1A 1SO8A 3UPQA 1HFJA 3C7TA 3QVWA 5CYPA 4AECA 3IP1A 4PN3A 1X1BA 3KDSE 4B83A 1C9EA 3QEJA 1SXIA 4MW6A 3OKFA 1YRHA 3RG8A 1ZN8A 3NHRA 3E81A 1LSJA 4FOOA 3T0GA 1EP2B 1JLRA 4LTMA 4ZEWA 2OFWA 1GG8A 5F35A 4DIOA 5DHRA 1MG5A 1TLFA 4NYMQ 2FSFA 2JRLA 3M4YA 4MVJI 4R5MA 1H05A 3KVRA 4CKCA 5FPHA 4B3JA 4GP7A 5BSTA 4BQPA 3C87A 3GEBA 5DGXA 1G5PA 2ERXA 4X8HA 1XZJA 1XVLA 2PYIA 3DAPA 4FHDA 5C80A 3AIIA 3CVUA 1OXXK 3MTEA 5EKUA 3T5GA 5CFPA 1GT91 1NAIA 2KEYA 9ICAA 3DEFA 4KRFA 4CGZA 1P3Y1 2IYOA 2PUVA 3MIIA 1A72A 3RC2A 4IIJA 5K0CA 4QJFB 2I4IA 1PFYA 3PKJA 1VP9A 4NBWA 4WNCA 1C9YA 3ZQKA 3FDXA 4LYDA 1HBJA 4RT2A 2XY4A 2EJWA 3MXOA 2FN9A 4G8CA 1A4XA 3QTTA 1IM5A 1L9XA 3M4ZA 4F45A 1FTYA 4EQ6B 2H11A 3EGWA 3PJRA 4JLVA 3SZOA 3SOPA 3VPDA 3QUBA 4I3FA 1TKCA 4ES6A 3OU7A 3H2IA 5BSRA 1H9BA 5CEJA 3WWYA 3G13A 3L4EA 1GO3F 2HA4A 3SXUA 1E98A 3A14A 1XTZA 2WVGA 3DDUA 4KMOA 1DEOA 2DUNA 2WNHA 4WCFA 4FEGA 3RS8A 1OW3B 5JWOA 4XWWA 4FC6A 2ZZNA 1W76A 2RI6A 2FPIB 1SFRA 2ZR9A 3VVMA 4BMNA 4ITRC 2P9TA 4ZI7F 1G38A 4D5EA 2JARA 4MVJD 4DR7B 8OHMA 1R8QA 3X1ZA 4EA7A 3TLMA 3R7NA 1ZQLA 3K0BA 4ZZ3A 3J81k 3LUHA 3HN2A 1HNZB 4AS2A 2QNIA 3CTPA 4EY8A 4ZICA 5TPZD 1I2MA 9ICXA 4R54A 4X8OA 2EZZA 1N2SA 1MO3A 2C5BA 2ZYVX 1GY8A 3JQPA 1UC5B 2CXPA 4QZFA 1LKZA 4S0XA 1N8TA 4AJPA 2PXIA 1SB8A 2WUGA 1RJWA 2CSXA 5K01A 4ZDIA 5AVYA 3QE9Y 1FVFA 2XD4A 4DBLE 3IG8A 4YQYA 3PGA1 2C4VA 5KU1A 1KFJB 3M8SA 2H2FA 3OPMA 4EI9A 3BA6A 2EZYA 3PR5B 3MS2A 1K7SN 4IJUA 4Z3KA 3IN5A 1NJWA 1NKCA 1AOXA 1H2XA 1LDYA 3C7KA 3EH2A 2EJVA 2P65A 3A11A 4US0R 2I2CA 2K4MA 3JD4A 3DP9A 5JEDA 3PLAE 1AS3A 3BSSA 1NK6A 4J9OA 1ISSA 1QRSA 3R9XB 1J25A 2A6PA 4PZOA 1EK6A 2WF9A 2ZTEA 3AR8A 4MKHA 3QUCA 1FUYB 2PFSA 4M9XA 4X1YA 2JAXA 1G9TA 1MB4A 2O2YA 2QQGA 5KG1A 1FQOA 1OLSB 2AMFA 3GBPA 1W0CA 3IEIA 1FQWA 4DHEA 2VHWA 1KVQA 2RQ5A 1ZJJA 1VSVA 3A6KA 3DW1X 4HGQA 1KGSA 1Z4NA 4P86A 1R6VA 1WXXA 3MBOA 3SHQA 3HFSA 5SZHB 4BNYA 2GHIA 5K4HA 3UGQA 2A3VA 1F6BA 1V11B 3LL7A 4WLUA 1EIZA 5L3VA 4RQ4A 1JKFA 1ILEA 1QANA 2FR8C 3VKUA 4AZ3A 1FU8A 4IDOA 2OZLB 3HPRA 4CMIA 3AR6A 1VIDA 2AJCA 4NK5A 1UDRA 2OXFA 5LZ4A 3THSA 3DPUA 1KY3A 4OMUA 4WCFB 5JALA 4R2LA 2BF7A 1KJYA 4NAHA 1SIJA 1KMMA 2R18A 3D8RA 2DETA 1G7CA 1BGXT 3H0RB 2HA6A 2R6ZA 2G08A 5DXAA 3VVCA 2XRZA 1C3JA 1AN9A 1HTBA 2L2QA 1WHSB 3KPJA 4P92A 3Q8XB 4PX5A 5BRJA 4C3VA 1W36C 1UXOA 2RARA 2WUFA 4GFJA 5EZYF 1JLLA 2JRZA 1IM8A 3N8HA 5IBRA 2BGGA 3M7DA 5KFDA 1NJGA 4OATA 2OECA 1GDHA 1UPUA 1YHNA 3S2FA 3V1MA 3NIDB 2A7XA 1J49A 3OUUA 5JD4A 5J2UB 1FA9A 2EQAA 1ISJA 1RP7A 3AIOA 4LOJA 3ZBUA 5FIUA 1EU1A 2ZJ5A 1P62B 1E9VA 1NBMD 4JJ7A 2W8KA 5LP6F 3I3SR 5DN6D 3MS4A 2WG1A 2X3UA 3BMQA 1QX3A 2WICA 3PG5A 4JODA 3GWGA 4JITA 4W1SA 1OFGA 1SXJB 4PTZA 4YR2A 4W9NA 5DHPA 2WZQA 4MICA 3TPZA 3UA3A 3VO9A 1E3JA 1RM4A 1AF7A 2XNJA 3UJCA 5EJ4A 3K4PA 3KE8A 4R66A 1PKEA 4H4EA 2Q4RA 1WV1A 2VT3A 4Q19A 5FA5A 4PHPA 1EP9A 5G5HA 3L0SA 2GK7A 2ZREA 4HDAA 3FRHA 2QY6A 2GCIA 3CG0A 2Z30A 3R77A 3NUZA 4HADA 2FKAA 3VOTA 4ARBA 1PD0A 4BP9A 4I36A 3R8XA 2O14A 2PZGA 1W4RA 2YFYA 1WKCA 5ALWA 4BMXA 1O94D 4DV6B 2YIMA 3S6JA 4L85A 1MCZA 2PR7A 4HYYA 4LE1A 4Y30A 5GGYA 3ZW8A 4BIMA 5B5SA 3TTYA 4DWVA 1YL5A 1BDHA 3C5GA 1JHMA 2WINI 4FWTA 2FHPA 4IIXA 4IXNA 1RBZA 2E0IA 7ICKA 1GKKA 2PEZA 3CXUA 2BEVB 1I4WA 5IKPA 3P9KA 4JB3A 3QZ7A 4HPXB 3VPBA 1UBRS 3REQB 1L7AA 4GBMA 4IKPA 3KT6A 1G21A 4V0NA 5KYTA 2ZIUB 5CCDA 2AI1A 4QTTB 4PNEA 1COOA 4KR3A 4LQ4A 4OD0A 1P0FA 4JR2A 3L8DA 2B7BA 2PI4A 3IOBA 2X9NA 4TYPA 1P73A 2JDID 3OLZA 4NI5A 1JXOA 2X7HA 4LJKA 4UBOA 5LLDA 1SBTA 3P2IA 2PMZC 2NUBA 1XSPA 4MGYR 1V5EA 2I76A 4XCXA 1KAOA 3R6GA 1PEYA 3H19A 4DSOA 3RTAA 3CX7A 5TDHA 2Q50A 2G07A 2AR7A 3REGA 2GNAA 4JLJA 2OAEA 3EODA 1G6HA 4Q3AA 5EZYA 5HM8A 3RFFA 1Z4KA 5C1PA 5E8RA 1Q7GA 1SKYE 1YULA 4CFYA 5NULA 3L4BA 5HR5A 1N9GA 3D4OA 1BCRA 2J9FB 3DE4X 2OGWA 1V7CA 3OT4A 2XGMA 3PQ2A 1RWKA 5BN5B 1QZUA 5A4KA 3AVWA 1BA3A 2ZJ4A 4DSJA 3C45A 3LYHA 3RU3A 4C3UA 3T9FA 2DG2A 4D25A 2IEIA 4I9GA 4QWCA 5MGNA 3NM6B 4KK3A 1U0SY 1PSZA 1UMKA 4YCJA 4ETWA 3EEQA 1I9GA 5GZ6A 3ALRA 1JQ3A 2W3RA 2QQEA 2RHWA 3GA5A 4JZKA 2IS6A 4CUKA 4FZLA 1P9RA 1EVJA 2Z5LA 3C29A 1OY1A 2HPAA 4KPUA 2NXEA 1UPFA 5KTKA 4D8VA 2DBYA 1OTHA 2M1ZA 1A3CA 3B38A 3OMXA 4JD5A 5FUXA 5HF9A 1CULC 1X8XA 4HYQA 3EPRA 1PI3A 4PHAA 4JBWA 1F20A 1AXRA 4LSWA 3IMFA 1CRPA 4DXHA 3BXOA 5ALRA 3IT0A 4GP9A 2JCSA 1LSOA 4FCVA 1QGAA 2ZTVA 2RCYA 4KXQA 1NONA 4GP6A 1O5IA 1NUPA 2CFRA 4UU8A 2VOEA 5D00A 4EHKA 2C07A 5K0EA 2D3WA 4XVHA 2VJNA 2WTUA 4JWNA 5KMGA 3DVRX 1XDWA 1JG3A 4JLUA 1QYDA 1XMXA 2MYUA 3EOAI 3OBBA 3PPIA 5DI3A 3I32A 4EEZA 1FFWA 4PIVA 2PS3A 4V1CB 1QAOA 3NATA 4BGIA 5A4MS 4HGNA 3PYMA 1RXUA 1VKZA 2AZTA 3HI6A 2EL7A 3O82A 1BVSA 2XUOA 4GYJA 4OHWA 3UO8B 1PZFA 4FQ8A 3U7JA 1USIA 2O5EA 5ELMA 3ETJA 4MUGA 2LHTA 2CFOA 4W5TA 3UAOA 2ZCVA 2C1XA 1E6CA 2X2EA 4MPRA 1CPYA 2QJRA 4OSPA 3RT9A 4BP8A 2G67A 4PG7A 3CF4A 5C32A 1IK4A 5GJVC 1QDUA 1W8IA 3S2GA 3PQDA 3TTVA 3C4VA 3W5UA 1G20B 4X8LA 1SOAA 5TXGA 4FCTA 3T9BA 4C0LA 5JUWA 4L0QA 5KFCA 1E7SA 3A4LA 4TKMA 4G84A 1PJ4A 2QLNA 3FY4A 3LRXA 4KUGA 3F8TA 4IRXA 5EUQB 1ODTC 3W5HA 3WLPA 1Y7PA 2O2JA 4D6YA 2XLCA 3EGCA 2IBKA 2WBLC 1RBQA 4MB6A 1SUWA 1J56A 2VHXA 5FWDA 2XMPA 3Q3GE 4C20A 3K4GA 2HHUA 2CLFB 4NR0A 2QTGA 3C8HA 4Q4HB 2FCAA 2RHDA 3MMNA 3VV3A 2ODQA 2W2LD 1ZMXA 1MT3A 1NGSA 2OHHA 2XNDD 1V1RA 2EBUA 5GTDA 1XB2A 2J08A 1V8DA 3FVTA 2VI5A 5BOLA 1KORA 4D46A 4N8DA 2B3DA 2BTQB 2ZDGA 1TM5E 4KCGA 3IVRA 4TUYB 5BW8A 1UJCA 5JW6A 2VP4A 2Y67A 4JN6B 5FBZA 1X80A 3RJEA 3SHWA 4EJ2A 4TZ0A 2W8LA 3IPRA 4I1YA 4L4SA 5CFZA 1MQ3A 2GJ8A 1RD4A 2YRXA 1JH8A 4DLBA 4IQ8A 3S81A 4U5QA 1K86A 3CX8A 1SUCA 4KQHA 2A1AA 1VLMA 3KSAC 5ANRB 1HZJA 1E2DA 3EHDA 4GL4A 1XELA 1DAPA 3DMNA 1RAHA 4Y0VA 4BVAA 1Y6RA 2YN2A 3E7XA 4J8PA 3ZWKA 4UAZA 5KPDA 3C43A 3RT7A 5EG5A 2AC2A 2BWJA 2IIPA 4O3NA 1LBEA 1UFVA 2VNJA 3PE3A 1KN5A 1ZQ9A 4A5SA 4IJ5A 1JECA 3JPQA 1U49A 4HRXA 3VNUA 3G8CA 1E3LA 1YDWA 4Y98A 2CLHB 3DTVB 1YVEI 1OI2A 3BWEA 4FYJA 3BXZA 4PLCA 1KPHA 4I2VA 3S2UA 4DZZA 4D0SA 5JASA 1CY8A 1DDOA 1YRWA 1DBVO 3KM0A 2VIIA 3M6KA 1GZSA 1M6VA 2VJKA 3FPFA 4LYFA 4DA0A 4EHHA 3R74A 3DZGA 4JJIA 2HLDD 1OFVA 2X9QA 4UFNA 4K4IA 4FMCB 1E3WA 2DAPA 2QMHA 4EBEA 4RA9A 4YUAA 4CMGA 2GD6A 3ELDA 4O4HA 4EGCB 4LRWA 3KIPA 3IVXA 4FW8A 4UUPA 5DYIA 3VYSB 4EFMA 1C20A 1YB5A 4W8GA 4C0WA 1P4SA 1H2EA 4JV0A 2B2XA 3DPIA 4TN1A 1L5VA 1ZD8A 2GAAA 5DB6A 2QG4A 3DMTA 4XUEA 2UVQA 3MMPA 4O1MA 4RYDA 4TXNA 3RK0A 3NRZA 1IG6A 2AEJA 2E49A 2IF0A 2OGSA 3MOGA 3OZIA 3P45A 4R3UC 2GFIA 3WLLA 4ARAA 2G40A 2TSYB 4HAVA 3DSRA 3RANA 1ESZA 3ESDA 3F3YA 2IP4A 3UBTA 1G18A 2DKOA 2P2YA 2Q0ZX 1K7EB 2Q07A 2ZRKA 4K9QA 4MWEA 5TF0A 2G7ZA 2ST1A 4O3PA 1E8MA 3E3OA 3ILHA 3OWXA 1T24A 3GLUA 4HMOA 1NK7A 3H11B 3RYIA 1UZUA 3Q8KA 2ZXUA 5E1DA 5BSWA 4GC6A 1CUHA 2V7GA 1U2ZA 3L92A 3NBZC 4QEKA 1RM3A 2C8LA 2IXFA 4YMHA 3BDIA 1C3XA 2EKPA 2AFHE 1UC9A 4P4TA 5CDYA 5KHLB 3EX7C 4M21A 1C8VB 4FBMA 4TSRA 2CXNA 3CM0A 5ALEA 3I9KA 1UJNA 3MINB 3QXXA 3MFQA 3SBXA 3GVXA 2QTBA 5BY2A 3CVYA 2BFAA 4G85A 1XDSA 3QXGA 4I1RA 721PA 3U60B 3E5HA 5GADl 3SR0A 2PX0A 3FNFA 4YB8A 4R7GA 1GCIA 1Y1QA 4LZLA 1E7WA 4C0QC 1XMVA 4PRYA 5JNVA 2AQ8A 5FXMA 3OA2A 1ZN2A 1E4OA 4E31A 1ZUNA 5LYJF 4B9NA 3I8OA 4RJLA 3GI1A 4Y2HA 1NUUA 3DQPA 5IWCA 3X2EA 1LBSA 1N3YA 1V16B 5KWJA 1XAJA 2ZG6A 4TXHA 1ZVKA 3OJCA 3WYAA 1UDXA 4RTRA 3L1IA 1QK4A 4O2BF 3PJDA 2IEAA 2FN8A 2G4VA 2IEBA 3IIKA 4HFMA 4JROA 1Z6ZA 4O4HB 4DFKA 5JYCA 3RTGA 5JNTA 1RLMA 1YR1A 3TPFA 2UXDB 1H1TA 3ESCA 4F56A 2BRUC 3A6EA 3ELBA 3IM1A 5ALNA 1ZNQO 8ICGA 2NTYC 2V7WA 1W85A 3A3PA 3ILXA 1E8NA 4HGRA 4QUAA 3WDLA 1NZPA 3FMFA 2C57A 5E4YA 1X3SA 1YKSA 1RQNA 4CF5A 2R1ZA 3FYSA 3ZVRA 3CNQS 1FX1A 3PZBA 4H4DA 1LLUA 2COUA 4PHDA 3GJSA 3C0KA 2YNMA 3KK0A 5EWJB 4BNDA 1GADO 5A2GA 5AUNB 4ZODA 1S4QA 5DB4A 5BV7A 1RXIA 1EWRA 2IX9A 3L43A 2AE2A 1B3RA 3TAUA 3I2JA 1PR1A 1WVGA 2IGBA 4L4YA 4CF6A 4RMHA 2E55A 4RY2A 1ZKMA 3ETEA 2EFCB 4ENRA 3RAPR 4WESB 1DXOA 1E32A 1MDFA 2WB1F 1HRKA 5CCBA 2D54A 4DJ5X 3KTOA 1EWVA 4JBHA 4AQDA 3PNVA 4MVJM 3TYXA 1HDCA 5LOVF 3I62A 2O0HA 3M6XA 3TH5A 2W83A 5DG8A 4KKVA 2ZM6B 2C2XA 4DVJA 3K6SA 3O1LA 4F5NA 3ETNA 1RPTA 4NV3A 3P4XA 4ECVA 1G5FA 2G3YA 2OHGA 1E4YA 3IE0A 1NASA 3W6NA 1AY0A 4P6VF 4NAVA 1Z33A 3UFXB 4EKIA 4WUVA 2P78A 4JIGA 5SV2A 3LQFA 5FLXA 1IY9A 2Z08A 3N74A 5FOXA 5CVJA 4PF1A 4DHWA 5AT1A 2BEKA 3GIMA 2HUNA 1WXEA 3F7TA 3E22A 1P0IA 3PDIA 5LC1A 2H52A 1YIDA 3M8KA 2VHJA 5FH9A 4IBOA 4OYHA 4RGBA 4JOQA 1U8AA 4IS7A 2CNWD 3NDPA 1L5QA 2MSCB 3SS9X 5CG1A 1B0PA 2XLBA 4LXHA 4DKXA 4NOJA 1G64A 4IQ4A 2CLCX 1RJFA 5KX5B 4YP7A 3U5TA 2IS1A 5KNIA 2QRMA 3WBFA 1XVAA 4GRIA 2AL7A 2Q5EA 1CJBA 3V1YA 4ESOA 1E79D 2ATCA 1SQ6A 2HMUA 4O2BA 4KE6A 1N6OA 1BTOA 1HDRA 2C2MA 4J9QA 4IIEA 2V4UA 2FPLA 5TARA 1NDUA 1XQ1A 2JCBA 4YEDA 4UTVA 4FONA 5CXXA 2DL0A 4GEGA 4R8KA 2D2XA 2H3ZA 2Q5CA 2X2PA 3FOBA 2VJDA 3FGOA 4MWSA 5GP1A 4GX0A 4BZZA 2RP5A 2ZVJA 1R0LA 3ICWA 3QEMB 1TO2E 4I55F 4AG6A 1XQ6A 5AVZA 4L8GA 4R6WA 1QQ5A 3OCWA 2PWAA 1OLUB 2PQ0A 5C4GB 5SZIA 1GPUA 3T3PB 3P2YA 4C04A 3KHGA 1BGVA 5B55A 1RMYA 3TRDA 4ZHQA 5K8UA 2IGTA 2O2HA 1YZHA 1YGYA 5DMHA 3IPCA 1N2CE 2TMDA 3GRFA 4Y1RB 3E1SA 1GNTA 4HF7A 1JROA 2M6RA 4ND6A 2RBEA 4UNNA 1JB9A 2BKEA 4ZT2A 2ZATA 4PH5A 5PGMA 1UDBA 2WJVA 9ICHA 3EQ8A 3UGJA 3LGXA 4A4DA 5SZJA 4KSBA 2H92A 2IHYA 3K70B 4MWZA 1W0JD 2ZSBA 4D4MA 4E12A 2Z09A 3LU1A 3IHLA 4A2QA 3D0KA 5FBWB 4HWGA 2LPEA 2GPBA 2FETA 3EJ6A 4NZYA 5B2ZA 4C4OA 4WL0A 2VAMA 5JU6A 1KQ3A 4OQ4A 2MMGA 1WB9A 3KU4A 4LNAA 4ZOCA 3SKYA 3DFUA 4OVKA 4BWVA 5H4GA 1GPYA 4QZAA 2P0EA 2V5AA 4W1PA 3O7WA 2EWMA 2SCUA 4JVNA 1MD9A 7ICPA 1S2OA 2QRKA 4GMFA 4MULA 3L7IA 3WNQA 3JPNA 2IPNA 3WB1A 3K9HA 4G9EA 1U9ZA 1U8XX 4M04A 2GR9A 3PNOA 3KETA 4C0SA 1YT5A 8ICNA 1U48A 2ONKA 2YWDA 3BQ9A 1U11A 2K87A 2FRDC 3QMMA 5SZKB 1BU8A 4PU0A 2CDAA 1CUFA 3GT7A 2WT4A 3SBDA 5L6MB 5MN5A 4QUJA 4G56A 4NULA 1ZD1A 3SS8A 4Z6FA 1HYGA 2NQ2C 1Q0QA 2HBLA 5ALUA 1ZESA 2HJWA 3B0XA 4XYBA 4V3CA 1U4OA 4KV7A 1JDPA 1EVYA 1U9IA 1ADCA 3DD5A 5CA1A 1C0PA 1NI3A 1IPFA 1DWUA 2AWOA 3C3WA 3SXJA 1Q91A 2CLIB 3QQ5A 4P7KA 3VO1A 4A7PA 2QEQA 4LN1A 5DHUA 4YR7A 1C0LA 1B6TA 3HSKA 1WTCA 3FMIA 1S96A 3K0EA 4TSFA 1ZRHA 4RNCA 4H0FA 1ZQFA 5DH9A 5JQGA 3BBLA 2DUUA 4LECA 2QZPA 1IOVA 2F3NA 2Z95A 1OV6A 1BQEA 4P0QA 1PCXA 1QYVA 2QAGB 1KMQA 2HNKA 4LCJA 2WJIA 3BL8A 3O8LA 3BSFA 3IQWA 3CPEA 3L7NA 4JP5A 4QRDA 4WLOA 3ZK7A 1EH5A 4K9PA 1Y1RA 4H3KB 3L2OB 3RWOA 4U3JA 2QX4A 3F5SA 1HG0A 3UB4A 4LUCA 1AM4D 1U0LA 1HYQA 1L7MA 1J4AA 1XGKA 4YAOA 1S89A 5D1NA 3VZCA 1VYTA 3CVXA 4P3YA 4FX2A 3P26A 4KQEA 2UXCB 1XXHB 3L7KA 5BUZA 3TO5A 1NBOA 2G06A 1E4VA 4GE0A 5T41A 5L7YA 1OA0A 3AKDA 1ZNWA 3E4CA 4FMCF 3GYBA 2JIRA 2R4UA 3F49S 4PWZA 5F12A 2I8CA 3TOZA 1I36A 2F8LA 3S5UA 4EG0A 5IAGA 3W5BA 5CFQA 5T67A 3RUFA 4FN4A 1BPEA 4I2CA 4ZO7A 3ERCA 1VRVA 1JDBB 3G6XA 2FUNB 1E6EA 2Q6TA 2WHPB 3MJSA 3N76A 5KYKA 5HHTA 2X4GA 2BUAA 2QY9A 4JC0A 1UBFA 4OY3A 4P34A 2MYNA 2FZGA 2BW0A 2ZIFA 1O8CA 2R68A 1HI9A 3SHTA 1M10A 2XY6A 2KG5A 2ECOA 2ZRCA 4RKQA 4GPIB 3V1UA 3OETA 3TJMA 3U56A 3AVVA 1GL7A 4JMLA 1OI4A 3OEED 5E2AA 1ZH6A 1RZRA 2FE9A 1G42A 4I2HA 2XY7A 1C8LA 1NJYA 1ENZA 2RKWA 1WXIA 1HE5A 3Q9LA 4P7FA 4QECA 2WTAA 3MHPA 3R2JA 2IU0A 1N33B 4H7FA 2WFAA 1Z2NX 1GTSA 3UWMA 3TNLA 4RV9A 1F8XA 2PLAA 1J33A 2Q27A 4QU9A 4G89A 3WMGA 1FTWA 1YZFA 2VWQA 2EFJA 1N1MA 1PLLA 2I71A 5CITA 4DQQA 1E1LA 4JV5B 2Y6UA 3FFTA 1V11A 3GDXA 1UEIA 3KDPA 2O59A 2ZAOA 4JLDA 2HU7A 3TTTA 4QJBA 2FGJA 4ETNA 1KJWA 2KLBA 3V80A 4G8BA 2G70A 5ES4B 4YASA 3PGJA 1O89A 3UJ9A 2HA0A 2I22A 1ZC3A 4I08A 5IM4F 1ZD2P 1MOQA 3ZGOA 3F7OA 4EABA 4R51A 2BGIA 3NVAA 1V16A 3TFWA 1NDHA 3STWA 4OB7A 3W77A 4AJIA 4YV2A 2CEAA 2QRZA 1L5LA 2Q3EA 3IA2A 5LYYA 1U4NA 2CVOA 3LP8A 4HEJA 1R8SA 3MLAA 1LZLA 3O3OB 1IE3A 2H4HA 3K72B 1A9XB 2NT3A 1P5ZB 1B0AA 3K09A 3LX6A 4YJGA 3ZVKA 4AP6A 1AB5A 1SKMA 5TGZA 2WWYA 3V5NA 4OG2A 5HKLA 3KZVA 4MI1A 2J8ZA 1FUUA 2VQ6A 3I39X 3PEYA 1RWOA 1ZL2A 3B2NA 3G2OA 4N9WA 2KK0A 2JA1A 3UMFA 3ETLA 1U5BB 3N2KB 3PT5A 1P6QA 1AHNA 1QQ7A 4GSYA 2YMPA 1YJCA 1ZSYA 4Q7JB 3VAZA 4EKEA 4F4KA 1JQJC 4ND8B 2C4KA 2GWHA 2J41A 2Q45A 3L0OA 4IIUA 4YQFA 3B52X 1PWHA 4XTRA 2LP4Y 3GXOA 3DZFA 4TVSA 2D0IA 3MTBA 2JV3A 3G1WA 3ISCA 1OA1A 1I1OA 1Q7TA 2PU7A 2RAFA 4Q7MB 4R0NA 4YMSA 2GYUA 3CZRA 1QCYA 1Z0KA 3B1WA 4XPIB 1N5DA 3IUPA 5KSWB 4X66B 1AKNA 4FXPA 4WUTA 4XJTA 3N39C 2W58A 2BP7A 1E9BA 1MNAA 1LQTA 4EFKA 3RRFA 5EJ6A 3FD8A 2V3CC 2NYAA 1IJBA 4XYLA 1FMJA 4EQ6A 3G0HA 4TQ9A 5JRTA 3I2KA 2FI1A 3RS7A 3ZUGA 4XUSA 2K7ZA 3ZH2A 4EB6A 3HO6A 4CKBB 5CT8A 1SXGA 1VPVA 1SZCA 2A0YA 2WG0A 3INGA 4GDFA 2LGJA 5CDHA 3E53A 2FQ1A 3O8QB 2CUKA 2IY8A 3HK2A 2P6MA 3ER9A 1L5RA 2OXTA 2OFFA 2R6CA 1H66A 1V3UA 3LUGA 2FOLA 2NSHA 4XIGS 5A7HA 5J47A 3B82A 4KX5A 1U0OC 2C8VA 3QVGA 4KVZA 3RSOA 4ARZB 5C1DA 2PCLA 4QNMA 2AW5A 4IHKA 2P4HX 5H0IA 1SXJC 5JCOA 4AS1A 2CFCA 5D5QA 3GFVA 1S3GA 1CK4A 1GUDA 1ZQZA 2QTAA 1SOVA 1WMEA 1Y8AA 3PGLA 4O6VA 1SQSA 4PR3A 5CG2A 3F78A 2UVDA 4K9NA 4M1MA 1HH4A 2WWRA 3V4RA 521PA 4RPCA 1XKQA 2OLKA 2J9XB 1QCZA 3OZEA 3QZ8A 4Q9DA 5IZCA 1WDLA 2V3WA 5A03A 4WBNF 3SI8A 3AOEA 4Y9DA 2HC9A 2I1VB 2M2IA 3S29A 1R66A 1GPMA 3BWBA 3E7PA 4LDQA 3KJNA 1IBRA 2E21A 1ZOIA 2QN7A 5IH3A 1DAEA 2AGOA 3B1JA 5FPKA 5EZ5A 2P7IA 2ZUBA 3HW8A 4OU5A 1NR7A 5A0FA 1SA0B 2FUKA 5INTA 5LOVB 2AG6A 1NURA 2ISCA 1NJSA 3BHNA 4EHAA 4F46A 3B2EA 4IFBA 1CERA 4R83A 5FHRA 4ER6A 1CS0B 3BRSA 4CM5A 2ZXEA 5JPIA 5TV2A 2FOXA 1CZKA 5HRAA 3EOZA 4RO0A 5ESXA 3UWDA 2ZIWB 1K06A 2O3JA 4J7UA 3TD9A 4CQMD 3SEQA 1NMZA 1V3VA 4LHZA 1VYUA 3LGAA 4MIEA 4ND3A 5DX8A 1MRSA 1Y8ZA 4B3IA 3TZCA 3O8CA 1VRWA 1JDNA 2P62A 4OAPA 4FCWA 1WA5A 4YECA 5T7BA 2CLEB 4PNZA 4ED0A 4QXAA 5H2FU 3A7DA 1OXSC 3PLRA 1QONA 1P60A 3RUIA 4EY6A 4JENA 4YTEA 2WTXA 3A3OA 3H1TA 3N2GB 3Q10A 3CZ9A 4PANA 1Y63A 5K2MA 3K94A 3DLAA 1DBPA 1ZA2A 5T8KC 1YBMA 5ALMA 4ZMRA 3GUCA 4GVPA 4HB3A 4PVCA 2Y92A 5FV4A 1QIHA 4BLRA 4L0CA 3VHXB 3QITA 4MW0A 1QH8B 1XEAA 1Y7LA 1AA6A 5T4BA 2BIFA 1FFEA 4DA8A 4IINA 2ZIEA 3U39A 4AF6A 1F7VA 1WDWB 3RUAA 5JNSA 5DU2A 1T91A 3M9OB 2R47A 3B9JA 1YCFA 4OKIA 3ZZMA 5CXQA 4KHZA 2GZSA 4S12A 1DKRA 1O6CA 1QO7A 2FSUA 4CLHA 2VBIA 3DWGA 3KD2A 1ONSA 2PWPA 2R6HA 1TZCA 4GBGA 3WXBA 3L0CA 5C46F 4YY3B 1WUHS 1Z2CA 2VWHA 2GAIA 4X95A 4YDSA 3WMFA 4JQSA 3H1GA 5BO5A 3PDHA 5FV7A 3EZ5A 2PL3A 3L6DA 2HJHA 4PXYA 3W3AH 10MHA 2VSOA 2GM4A 4FKMA 3KV3O 3KXLA 3AY3A 4N0EA 5BN3A 5J4LA 2ENWA 3AVOA 1D2RA 4BVKA 4Z4EA 5E7JA 3EEIA 3A6FA 1GKUB 5CJ7A 2DQNB 1SUIA 2AN4A 3HRKA 9ICVA 3RAJA 1J2MA 3AHIA 4U02A 1MRZA 3KTAA 5AMXA 4YCMA 5M2QA 2H7YA 2VYFA 1SHKA 3FGZA 1TJPB 2RGXA 3KC2A 1WCYA 1YIAA 3PEUA 3Q6NA 5DNYB 2Z9DA 4DREA 4WIAA 3R9WA 4XLZA 2F8SA 4ANFA 1WG8A 3SHFA 1KZYC 4YLYA 4PLWA 4QTUB 3EGXA 2H5IA 4XAQA 1DEAA 2RI1A 3P8ZA 3ZI7A 5KU7A 2L42A 3RRGA 3AINA 3IHKA 1WXGA 3UKJA 3NRJA 4OJLA 3C28A 3BFVA 5BPFA 5LWHA 2VDMB 4LC1A 4TLBA 4I2DA 1O4VA 1PF7E 1N6LA 1JMSA 3CBQA 4QYXA 4YAJA 2RGUA 1XA0A 2NO6A 1YJAA 1W0JA 1QTQA 4NTZA 1B6RA 5ALKA 2P9FA 3KTAB 2QP9X 4LDRA 4PYLA 4C88A 3DT6A 5EKDA 1AUOA 1QYCA 1N2CB 2C03A 1BRMA 2KV2A 2WDZA 4HS9A 4FFVA 4AY4A 3RS4A 4Q4HA 2ZDHA 4F06A 1THMA 1QTMA 4E03A 4CLOA 3TDKA 2H2AA 5C18A 4KDFA 3H18A 4B6QA 2XE4A 4Q9AA 4YCXA 1AE1A 1QORA 4YMTA 3OTQA 1JKIA 3NBAA 5ERXA 2PK3A 3GMSA 4CKEA 1U98A 4CKXA 3O8NA 3FFBA 2DKZA 5P21A 1IIPA 1DO8A 2NV0A 1KMHA 4NZPA 2IYEA 3VH3A 1ZO8A 3DUFA 4ZCPA 4O25A 5BN3B 4MF2A 4G8JA 3M6ZA 1MO2A 1A0OA 1YRBA 1ZQJA 2JIOA 5DT9A 3W05A 4HYTA 2ZRFA 5DCLA 3WA7A 3EZ2A 4KXNA 5DB8A 1OX4B 2QXUA 2BKVA 1GCAA 3W4KA 1CNEA 3BORA 2BZ1A 1USKA 1LXCA 1E6WA 2C0CA 4PGAA 1UBCA 2Q9BA 3ZWOA 4E09A 7YASA 3LVWA 1WOYA 3FLAA 1BXGB 3ZX4A 4W99A 4F21A 3L82B 2J5QA 3PDWA 1E2JA 3ANSA 1XD2B 2F4NA 4HDMA 4DDMA 3TB6A 4PC1A 3DB1A 3LHSA 1U9LA 4A1OA 3U26A 4QQ8A 3ACDA 4P82A 3ON5A 1UAYA 3OOWA 1TIBA 2A5GA 1REQB 1TNDA 1A5ZA 2Y99A 4AMGA 1YZVA 1PHRA 2Z9CA 1WDKA 2JFOA 4KZKA 2OR3A 4ENSA 4KLAA 3LX8A 4YQEA 3D4PA 4II2A 5A4IS 3DYVA 3L6UA 4IO0A 1VKJA 1OAOA 3L6CA 4H0NA 4R5HA 4WFKA 3F9IA 4ENWA 3GLGE 2XZLA 1WV0A 3EDCA 1NK4A 3HDJA 3OZDA 2DWPA 4I1VA 1TXGA 4CZ2A 2VYNA 4CLOB 5EWGA 4JDUA 3ZCVA 3WGGA 3CEJA 4Y9RA 4NF2A 3MK31 4NATA 4ZOLF 5SY4A 5KIAA 2R8PA 1MHTA 2BFEA 2HPZA 2Z57A 1MB2A 3JWGA 4G5HA 4NPHA 1E9CA 2C4UA 2FZ5A 4QVKA 3EQ9A 5D4BA 1KKUA 1XRSB 3NC4A 3QLVC 1I32A 1IM2A 1HWYA 2UVVA 1UR5A 1EJBA 1WHTA 4GKVA 5H70A 4DE5A 5J4KA 1TQ4A 2NX2A 3LXUX 4A26A 1ONBA 1Q0RA 4ZCSA 2APJA 2VJAA 2XOEA 3K9WA 4P4LA 1KTIA 2X4IA 1GXSA 2ZSDA 2FEPA 2V55B 3URKA 4N12A 1FNBA 2AS0A 3WWOA 5F64A 1Z36A 4X64B 2ZRBA 5AW1A 3ZJVA 4LF5B 1YCGA 2YV5A 2FLWA 2JI6A 5JSQA 1NOIA 1OX4A 3BZUA 1YT3A 5CVDA 4MB2A 1QGYA 5TJHA 4U2KA 2N0SA 2WDPA 1HNWB 2V7XA 1GR1A 2LDXA 3KL4A 4G0YA 3TBHA 5B3KA 1K1QA 3H6KA 1DAIA 3ICEA 4KVAA 5AW5A 1P4GA 1WF6A 1ZHHA 5IAKA 5DLYA 1YCDA 2PMCA 2FPXA 4D45A 1ARZA 1GG9A 2NZXA 2RG7A 3EF0A 4PXSA 2REQA 4Y6SA 4BC0A 5EXDA 2FX3A 3E70C 4DA6A 1VXOA 1EZZA 2QMUA 1OILA 1REQA 2OAQ1 1XKXA 3UMRA 4LHXA 4RC9A 3N3AC 1FTSA 1X77A 2AIRA 3A2MA 5FUYA 4BQRA 4GMGA 1XO0A 3AERA 4QFCA 3WWZA 4O5CA 1QV7A 1WCNA 1DRGA 3NDBB 1PR5A 3KKAA 3O1JC 4BQSA 2R96A 4ZKEA 4L72A 4X8MA 1S5PA 3HKZF 1MJGA 2JCYA 2Q5IA 4M1ZA 2XAUA 3DF9A 3ZQ6A 2E8NA 2UVWA 1EFAA 3Q9UA 5JZOA 1W25A 3RTEA 4H27A 2RHBA 1I4OA 2WV9A 1FBTA 4D97A 3T1OA 1TZBA 3BH7A 4FZJA 4X94A 1ULAA 5JXWA 4K05A 1GCOA 3BWYA 1ZQXA 3KOXA 2OHVA 4K3VA 1ZQHA 5CFOA 4U2EA 1ACLA 2GD2A 3MXTA 4C3OB 4PSAA 2FPIA 1LTHR 5IRCD 2QJOA 2REOA 4NCNA 4OFZA 4Z3OA 3R6LA 5BWNA 2F67A 2NQTA 2DERA 4ZREA 2PZBA 3NLLA 1BE0A 4LOHA 2QD3A 5AI6A 1WXDA 4FZMA 5GTHU 4KIGA 2PSHA 3AQFA 1C8BA 2FPUA 2PZKA 2PY6A 2XMQA 3IQEA 5BSUA 3ROTA 2W8ZA 3OU2A 3TI7A 3PIIA 3IVGA 1T3LA 3BQTA 1X7ZB 1LW6E