3EZ5A

Cocrystal structure of bacillus fragment dna polymerase i with duplex dna , dctp, and zinc (closed form).
Total Genus 208
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
208
sequence length
580
structure length
580
Chain Sequence
KKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase I
publication title The Mechanism of the Translocation Step in DNA Replication by DNA Polymerase I: A Computer Simulation Analysis.
pubmed doi rcsb
source organism Bacillus stearothermophilus
molecule tags Transferase/dna
total genus 208
structure length 580
sequence length 580
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2008-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3ez5A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 3ez5A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ez5A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3ez5A01
1S10A 1Z26A 5J0RA 3PO5A 4YMOA 1BCMA 9ICGA 1MQ3A 4J9MA 4IR9A 2XGQA 1KFSA 2YNGA 5KFNA 3TFSA 1HNVA 2C28A 5KG3A 1Z00B 4FZYA 5KFBA 5CR0A 2OA8A 2PI4A 4I9LA 3G10A 3K59A 2BCVA 3RRGA 4F4KA 4M6WA 4ED8A 1J53A 4I2DA 4PGYA 2PFQA 4KB0A 2VWKA 4HCCA 4ICLA 5FDLA 3Q8SB 1NK6A 3I0SA 1S1TA 4AHUA 3HPOA 2I1QA 3KLGA 7ICOA 2ATLA 1XC9A 3OYLA 5J0XA 2KZ3A 4UQGA 4CF0A 4I2BA 4KHWA 7ICEA 5J2PA 3TI0A 4RW8A 2B4JA 2OPQA 5KFPA 1ZQPA 3OYFA 3HVRA 4E7LA 2ZTEA 5SWMA 4PA1A 4CEDA 5KG2A 4R63A 1WSJA 2HW3A 1C0MA 3P1GA 4CFBA 1TFRA 2W9CB 1NK8A 2DY4A 2KFZA 1R0AA 4I28A 1IKYA 3AA3A 4Z4GA 4M9HA 2Q3SA 5KFHA 1MC8A 5F9LA 3ZSVA 4QOZB 4YQWA 4FK4A 1CEZA 5KFWA 2BCSA 1N48A 1K1QA 4O3PA 8ICWA 4E1MA 2RDJA 3ZSWA 4DLEA 3JPRA 2DFLA 5HP4A 3NH0A 2P6RA 3HPHA 1NKEA 8ICHA 1NJYA 4J9NA 4ECUA 2Z1HA 2ZD1A 4JV2A 2W42A 4KLMA 3DRRA 5HNKA 4KLOA 1ZYQA 3OYGA 4PHDA 4DTRA 4M3TA 3KLIA 3NTUA 4K8ZA 2XY8A 1BIZA 5DLGA 3DI6A 3GQCA 1ZQBA 1B43A 3JPNA 4EP4A 4RPZA 3MGIA 1XS9D 3GFKB 2YNHA 4M3UA 2NRWA 3RJFA 3B0YA 3NFAA 4NYFA 3SV4A 1PZNA 1HYVA 4AHRA 1LWCA 3ISCA 1ZQVA 2W8LA 1K6YA 4BE1A 3OJSA 2AGOA 4DSIA 1MQ2A 1U47A 4CJWA 8ICPA 3V1RA 3PX4A 3AVJA 4O0IA 3VQ6A 3U6FA 4M3ZA 4GXKA 1ZJMA 1W0HA 3QEBZ 4HCBA 2ZUBA 3SNNA 3M8RA 4RU9A 1RDBA 3AVLA 1ZQNA 4CHOA 4QWAA 4DL4A 3KLHA 3V72A 3T5HA 4KLTA 2KN7A 1ZQIA 2F96A 5IILA 5KT6A 2BQRA 5HRPA 3KJVA 3K2PA 1HQUA 1ASUA 5E41A 4PGQA 2FMQA 4CHQA 4YD1A 1WAFA 3OVNA 3RB4A 4J9QA 1QLNA 1C6VA 3O3HA 1U9LA 3VA0A 3BDPA 1L3UA 2DTUA 4EBCA 3C2LA 1RXWA 4N41A 2J6TA 4Z4EA 4BXOB 4F5NA 3TR8A 2BKEA 1XHZA 3PUFA 2JEJA 4K4HA 3O3GA 4DFMA 2PZSA 5DQHA 4RQ3A 3ETLA 2IHMA 3SCXA 4GXJA 3NCIA 3BJYA 1SV5A 4BGDA 1TKXA 4YXMA 1TKDA 3LK9A 4HVJA 3L8BA 2NRXA 3NGIA 4DQPA 1QQCA 1WSIA 2YHBA 1GOBA 2VA8A 3BQTA 9ICRA 1JXEA 4Q45A 4CEEA 4IR1A 1FKOA 2RKIA 3P83D 4QWDA 3V6JA 7ICRA 3LZIA 2C2DA 1VSMA 1EXQA 4N56A 3ZSXA 3KLFA 1HUZA 4FJNA 4DMNA 1ZQGA 4OPJA 1NJXA 1ZQZA 4RW4A 3RB0A 5FROA 4J2AA 3H8JA 2WOMA 2W9BB 4O9MA 1VSDA 4ELTA 4YMNA 3NDKA 4CJLA 1JL2A 3CM5A 3T5LA 1IKVA 1TVAA 5KFDA 9ICEA 3VQ5A 4KLJA 1UT5A 1BPYA 2P5OA 1RTJA 5CB1A 4RQ8A 4I2AA 4KTWA 4ECTA 3MFHA 1TK0A 3MEGA 5KRSA 3SUNA 3OHBA 4KLEA 1WLJA 4CGDA 4FJJA 5KG6A 4B9UA 3SUOA 2BPCA 4MFFA 5CP2A 4FJXA 4F5RA 4GC7A 2JEFA 4EP5A 2HNYA 4ED2A 5D4BA 1HYSA 1TAUA 3C23A 5KT7A 4FW2A 3RB6A 4J9RA 2QKKA 5KG0A 4EYHB 2LYHA 4QZCA 5KFEA 5J0WA 1ZQOA 4CERA 3S3MA 4FZXC 1RTDA 3SQ1A 4B9MA 4BDYA 3CG7A 1ZBHA 5J2CA 8ICOA 4QZEA 3RJIA 1BL3A 3B6OA 4IQTA 5DDMA 2RDIA 5D3GA 5J2NA 4RQ4A 3RBEA 4DTPA 4CF8A 4DQRA 3LZJA 3AUOA 2FLPA 1CZ9A 4QZGA 4MF2A 4KLSA 2XC9A 1TK5A 1ZQMA 2E6MA 5DQIA 2PI5A 8ICUA 5DGAA 1S76D 3IAYA 5KFIA 5CYMA 2JEIA 5JS2A 4GW6A 4ECYA 2JEGA 4KTQA 1U04A 5CY4A 3NF6A 3MXJA 3KIOA 3GV5B 4JS4A 4RQ2A 9ICJA 2ZE2A 5CWRA 3T1AA 3ISDA 1JLFA 2GBZA 4CF2A 4JV0A 4FJKA 5JUMA 3PW0A 5IIOA 3H4DA 1G15A 4P4MA 3AU6A 2HB5A 3VQPA 3DYAA 3VQEA 2O4GA 4UAYA 4DL3A 3CYMA 1CXQA 4YMMA 4FLXA 4Z6FA 1RT3A 2MUTA 4R8UB 3EWAA 3VQDA 4CGJA 3S3OA 2ASJA 2VG6A 2BE2A 5BOLA 5KFUA 2V4QA 8ICMA 4O3NA 3QEVA 4FVMA 3QIPA 3RR7A 4JLHA 4KKOA 2EX3A 1GOCA 4CGHA 3V9WA 3K4GA 1DTTA 3AA5X 1WCLA 5KFOA 2KQ2A 3QO9A 4B9TA 1RZTA 2ALZA 3Q8KA 1V9PA 8ICKA 4Q44A 2X6SA 3L2RA 3VQCA 1NKBA 3V4IA 4B9VA 2BGGA 3E01A 8ICVA 3QIOA 4Q5VA 2G8IA 8ICLA 4E7JA 7ICSA 3L2QA 3GIIA 3EZ5A 3TANA 1ZQCA 3HP9A 3TARA 4KHYA 2BGWA 2VG5A 1IKWA 4CIGA 2ETJA 2R8IA 2G8HA 2ISPA 1NOYA 5DBCA 4J2EA 4FBUA 2QXFA 4M42A 4CJSA 4E19A 3JPPA 1RT5A 5KGWA 4Z4IA 4KREA 4NY8A 4KHQA 2ZTCA 1S77D 5CJ7A 4PHPA 1RTIA 2HNDA 2BHNA 1U4BA 1S6PA 4KV8A 1JLAA 4BWJA 3E2EA 3OYAA 4ECQA 8ICJA 4UB5A 3DLEA 3H40A 4AILC 4I2HA 3HP6A 2HHSA 3ZSYA 3FYHA 1UAXA 1A5VA 3LP1A 3MEEA 4DTSA 3H8SA 4CEAA 2X78A 7ICHA 2J6UA 4OJRA 1TKTA 5EWFA 1IM4A 4MFAA 3B6PA 4LZGA 1KTQA 1XSLA 4K4GA 5EWGA 4O5BA 3PV8A 4DOCA 2WONA 3GIMA 4YR3A 2HVHA 2XY7A 1XU4A 1RT4A 4CK3A 3OYHA 1ZETA 4Q8EA 2RN2A 5KFVA 3OYBA 1JKHA 2Y1IA 1BI4A 3VQ9A 4X5VA 4M3RA 3NE6A 4UAZA 1SKSA 3CQ8A 1RXVA 3VQAA 5J2DA 4NLZA 1BPXA 4QWCA 3QNNA 1Y88A 3DRSA 3JPQA 1ZQJA 1DTQA 4E7KA 3RMAA 1O1WA 3NH1A 3BQ0A 4DTOA 3K5NA 3RBDA 4E3SA 3M9NB 1XI1A 1Y97A 3KKRA 3UXNA 4YD2A 4O55A 2OPRA 5CA7A 5KGXA 1SZPA 3QETA 5BPCA 4XUSA 4Z4CA 5HP1A 3LALA 4RNMA 3T3FA 4JUZA 4K4IA 4O5CA 4FJLA 2VG7A 3BQ1A 4J9PA 4KLDA 2QK9A 2ZTDA 2A1SA 4JS5A 2JZBA 3HPGA 2FBYA 3ZSZA 3AA2A 5BOMA 1A76A 3LP2A 4E7HA 2B6AA 4TURA 3IG1A 4DSJA 1LAWA 7ICGA 2ZUCA 3GV7B 5DG7A 2AGPA 3SUPA 8ICEA 1CZBA 3KKSA 4DTXA 3H7IA 1ZQSA 1JLQA 9ICOA 3AVCA 4M6WB 4FM1A 4Y1CA 3SI6A 2E4LA 4RW6A 3ZT3A 3UXPA 3NH2A 4F3OA 4RQ1A 1CUKA 4LY7A 1A5WA 4I27A 4I2CA 4DF4A 3Q8QB 4L8RB 4IQWA 3ITHA 3BGRA 1RPLA 1SKRA 7ICQA 9ICLA 1RT7A 2IHNA 1LB2B 4Z6EA 4KITB 4ZTFA 1HNIA 4NCGA 4FZZA 4CJTA 4IBNA 5J1EA 4PH5A 4B9NA 1WSFA 4M3WA 4G3IA 5J2KA 4C8LA 4CEQA 7ICNA 1QE1A 2R7YA 2D0BA 4DL5A 3T5KA 4ECWA 3CFRA 4QCLA 5DB6A 2FMPA 1LWFA 4HTUA 4ID1A 5EWEA 2I9GA 1Z3EB 3AA4A 4QZAA 2EHGA 4KLLA 2KFNA 4CJ4A 3C1YA 2HHUA 8ICQA 2KW4A 2LSNA 3D45A 2AQ4A 1KVBA 4JRQA 3NGYA 1HUOA 3LP3A 5J2GA 2IS3A 3SQ0A 1EXNA 4XQ8A 2XCPA 3VN5A 5DB7A 4KN7A 5L1KA 5HRSA 4FK2A 5KFJA 2PYJA 1FXXA 2G8WA 2V4RA 1RBVA 8ICXA 2IBKA 2KZZA 3LAMA 4FCYA 2FBVA 1UWBA 5KT4A 5DK5A 1A5XA 4CJEA 4DU1A 1RBUA 3KD5E 3AVHA 5KT5A 2ZUDA 3C1ZA 3V1QA 4B9SA 4CEZA 3NBPA 3V6KA 4OPKA 3C2MA 7ICMA 9ICWA 3AVNA 5D46A 4TUQA 2P66A 2Z1GA 3TAFA 1EETA 5KFAA 4YFUA 3G0ZA 4FLYA 3LDAA 5C5JA 4TQRA 3WNEA 4E0DA 4NLNA 3A2FA 1ZQFA 5KFTA 1BQNA 5IIMA 4OLBA 3AO2A 3WNFA 3CM6A 2C2RA 3M9MB 3RMCA 4I2PA 1WSHA 3ZD9A 4N47A 1ASVA 4ZHRA 3AVMA 1TL1A 4YN4A 4M0AA 4MFCA 4PPXA 7ICTA 4P4PA 3NHGA 2F8TA 2B5JA 4KAZA 4DL7A 4GLXA 1NOZA 4UB3A 3HWTA 3AO1A 1VSHA 2G8FA 4EZ9A 5L1JA 1J5OA 3KLEA 4I29A 4EBEA 3ALYA 3NF7A 4W5RA 4AHVA 4I2JA 4P2HA 4ID5A 5DDYA 1B22A 2D5RA 5K14A 4O5KA 4UAWA 4ECVA 1KRPA 7ICVA 3OYNA 1TL3A 2ISOA 3SYZA 3TAQA 5J2FA 3OGUA 9ICXA 3DOKA 2G8VA 4NM2A 1WNSA 5J2QA 2KZMA 2ZJ8A 1TV6A 9ICBA 2F1IA 4I2GA 3VQ8A 4ECXA 4DU4A 3UQ0A 1S1VA 1T7PA 1HMVA 5F9NA 3RAQA 4EYIB 9ICPA 4M41A 4Q43A 3OS2A 3MR2A 1XO1A 4KLUA 1WN7A 4Y1DA 4HUFA 3QE9Y 3ZDAA 1TK8A 4DFPA 4KI4A 2J6SA 3C21A 4CEFA 1X9MA 2VANA 4PY5A 5KFCA 3ZT4A 1COOA 1X9WA 1EX4A 1S0MA 4QZDA 1LW0A 2WTFA 5KFGA 3PMNA 4RG8A 2JGUA 1KDHA 3FDSA 4NLGA 4CJ5A 4FBTA 1QSSA 4TSXA 4O3RA 5C24A 1Q8IA 1LAVA 4OVLA 4RQ7A 4BE0A 4Z6DA 1TKZA 4DEZA 4QW8A 3KHLA 2IA6A 1Z25A 1U45A 1WSGA 1XSNA 4PQUA 4CGIA 4RQ5A 4KLGA 4CJ3A 3I0RA 4RUCA 5DLFA 2R8KA 1RT1A 4KLFA 5J2AA 2BCQA 5KFKA 2HHWA 3QEWA 4I7FA 1TV9A 1BQMA 4F50A 2AGQA 1NK9A 3PX6A 3NGZA 3CFPA 3KK2A 1BPEA 4CEOA 4W5TA 4WE1A 4HUGA 2A1RA 1A77A 4GVMA 4CHPA 1YVUA 5J0YA 5KG5A 1YTAA 4LZDA 3PW5A 4QWBA 1C0TA 3QINA 3DLBA 5HRRA 1QTMA 4J2BA 2NUBA 4ECSA 3Q8MA 4Z4HA 3HVTA 7ICFA 1NK5A 4KLHA 1RDDA 1QSYA 3GV8B 4MFBA 3TAMA 3MXMA 2GWSA 4UBCA 3RJEA 5KG4A 2MAXA 4XIUA 2OPSA 2R8JA 3OSPA 1BPZA 3RH5A 3HK2A 3DM2A 2M9NA 3AVFA 2E6LA 1RBTA 3RWUA 4F5OA 3JPOA 3LANA 3LP0A 3TAPA 3NAEA 4GMJB 3TWHA 1S1XA 3OHAA 3O4NA 3DMJA 4DU3A 1KLNA 2MUTB 5KG7A 3KHGA 4Z0UA 2Y1JA 3OS1A 1ITGA 1LV5A 3SQ4A 4CK1A 3V9UA 3V6DA 3H4BA 4DO9A 2C2EA 1HRHA 3V1OA 4OGCA 4ED1A 1ZQKA 4RNOA 4FJHA 3AVAA 2FPKA 3QEAZ 4KLIA 5FRMA 1IG9A 1S0VA 3ZDCA 7ICJA 3ZDDA 5KFYA 2YNFA 5DB8A 5L1IA 4QZ8A 5KFSA 4YXJA 4J9KA 3HSTB 1HQEA 3N97B 4DTMA 1S9FA 3C95A 4RPXA 1NJWA 5SZTA 2XRIA 4Z4FA 3K58A 1VSLA 4CJPA 1WSEA 3C5GA 5J2IA 1REVA 4FJ9A 1DLOA 1KFDA 2IAJA 2HVIA 1ZQUA 8ICBA 3I8DA 4CHNA 4P4OA 5KFRA 4MF8A 5FRNA 4RQ6A 1Q9XA 4IRKA 3JSMA 3OYKA 2XY6A 1EKEA 3VQ7A 2P6UA 5DGBA 4AHSA 3LAKA 2DPJA 2VA3A 2FLNA 4ZH4A 3IHQB 3MECA 4O0JA 2UVRA 4B3OA 5J2JA 2UVWA 3PMLA 1RYSA 2F1JA 1KSPA 4QZBA 1SL2A 4YG2A 1JXLA 2JLEA 4DS4A 3VQQA 4M9GA 2VWJA 1L3SA 4O5EA 2H5XA 1BPDA 3AV9A 3QZ7A 3H08A 4I9QA 1S0NA 2W9AA 4M47A 4CGFA 3ISNC 4FJIA 4FLZA 4FLUA 4E1NA 4FYDA 1BPBA 3EPGA 4KRFA 1BI4B 1IXRA 2G8KA 4CHZA 1QHTA 4IRDA 1XHXA 9ICMA 5KG1A 3S3NA 4YFKA 2PFOA 8ICCA 2Z1IA 2XCAA 4CGGA 3SV3A 2P5GA 1BHLA 3DLGA 5KT2A 2XGPA 1QSLA 3MR3A 4KLQA 1WAJA 1BVSA 3OS0A 3HT3A 4CIEA 1ZQYA 5DBBA 5HHIA 3IS9A 4QW9A 3AO3A 4M2YA 4XA5A 1JXBA 1RT2A 2XY5A 4G1QA 2NRZA 1UA0A 2ZJAA 1JLBA 1IH7A 3ZSOA 4UB2A 2JZBB 2BR0A 1NK0A 2Z1JA 4HHTA 1RCHA 4R64A 1N6QA 3RRHA 3EPIA 4W5NA 4UBBA 3M8SA 3LPUA 3SUQA 1SL0A 4DL6A 4CF9A 9ICSA 4F8RA 4M45A 3QLHA 3LWMA 5DBAA 1JLEA 4DQIA 4CESA 1S1UA 1RDCA 1ZJNA 4KB1A 3V6HA 4C8KA 3LDSA 3KD1E 1T05A 5KFLA 4FXDA 9ICQA 1NK4A 2HNZA 5J29A 4O3SA 3VQBA 1HJRA 1J54A 2ASDA 1ZBFA 1SL1A 5DQGA 3K57A 4M04A 4H4MA 1WCNA 9ICTA 5J0OA 3V7JA 4NM1A 1VSIA 2A1JA 3QNOA 3Q8RB 4DSEA 2OZMA 4ECRA 3Q8PB 4XRHA 4IFYA 4DTJA 4RQ0A 4IG0A 3PY8A 7ICLA 3PW4A 3RJKA 5J2EA 4PGXA 1BGXT 3PR5B 3O3FA 1BIUA 1GOAA 4IG3A 4CF1A 3Q8LA 4F4XA 2PY5A 3V7LA 2IC3A 1NK7A 2OZSA 1EP4A 4J9LA 3MAQA 3T19A 3IRXA 3OYJA 3AU2A 2IMWP 1KCFA 1IKXA 4NCAA 3ORYA 4DL2A 4QZHA 4MEYA 4OKJA 4TQSA 8ICIA 2FC0A 1VSFA 3EYZA 1X2IA 3QESA 3K5LA 3HM9A 2DPIA 4B9LA 1RT6A 3G6YA 1Z00A 4YR0A 3RMBA 1B92A 1I3AA 2IDOA 1TGOA 2I5JA 1KVCA 4J2DA 3HO1A 4E89A 4F2SA 4Q0BA 4ED0A 3MDAA 4R65A 1CXUA 3C2KA 3AO5A 3ULDA 1DGSA 3FFIA 3MR5A 2XO7A 3O4QA 4F92B 4CJVA 1C1CA 5KT3A 4CFDA 9ICKA 1UA1A 3MXIA 3ZDBA 1RYRA 4NXZA 1RNHA 4CIFA 1NKCA 3ZD8A 4RW7A 3KK3A 1ZBLA 4IKFA 3NGDA 3PW7A 1NOMA 2DFEA 5HHHA 3MDCA 1ZQHA 4M9NA 3CFOA 4I2EA 2X6NA 4EZ6A 1ZQTA 5KI6A 4IRCA 2W9CA 3DLHA 5KFZA 3AVKA 1HPZA 1ZQDA 1HJPA 4LVSA 4C8NA 4N76A 1S0OA 1S9GA 4CHYA 2P51A 5J0SA 5I3UA 2YNIA 3HJFA 1XSPA 4OKEA 3AVGA 9ICIA 5I42A 1VRUA 5J0TA 4CJKA 4F5PA 3U3GA 1JLGA 4J9OA 4NLKA 5HLFA 5IINA 1T03A 4M9LA 4BDZA 2PYLA 3SZ2A 4MQ3A 1S97A 9ICNA 1X1PA 2ASLA 9ICVA 3G6VA 3RH4A 1ZQAA 3S9HA 4DSLA 2BDPA 7ICKA 3AVBA 4DQQA 2HHXA 4GXIA 3ZSQA 8ICFA 5J2MA 2YKNA 3OYIA 1LWEA 2BPFA 3SPYA 4BACA 8ICAA 4H8KA 4KFBA 3GDXA 1BISA 3RR8A 5HROA 3PVXA 3PR4A 4I2FA 3K75D 3C6TA 3H8WA 4AHTA 3QERA 3JPTA 3UXOA 4O3QA 5DMRA 4J9SA 4I2IA 2HHVA 4DOBA 1HYZA 2YV0X 3THVA 3LWLA 4F2RA 2FBTA 1ZBUA 2GV9A 1N5YA 3PNCA 5CHGA 3RB3A 3M8PA 9ICFA 1IO2A 3MABA 2ITGA 1JN3A 4KI6A 3AO4A 7ICIA 4KHUA 3BQ2A 2ZJ5A 3ZSRA 5L9XA 2RPIA 3DRPA 1FKPA 3QZ8A 5J0QA 3PO4A 4DTUA 2BCRA 1KVAA 1VSJA 4BWMA 2HHTA 4CJFA 3D0PA 2FPLA 9ICHA 4NYNA 4EBDA 2DFHA 3SPZA 1CLQA 1YT3A 3ZDEA 4CEBA 1XWLA 3DLKA 4BXOA 1D8LA 5HMLA 1VSEA 3K5OA 4DQSA 1L3TA 4JWMA 5EU7A 2UVUA 3EY1A 2IGIA 3DOLA 1T8EA 4DTNA 3RJJA 1ZQRA 3M9OB 4LD0A 2HHQA 1RBRA 3HX0A 3AVIA 3ZCMA 5TZVA 4TUPA 4CFAA 4ED3A 1ASWA 1ZQWA 4Z6CA 3HL8A 3RAXA 4CECA 3KTQA 4CK2A 3RJHA 1JIHA 4BDPA 1D9FA 3OJUA 2PXIA 4FS2A 2FBXA 4RT3A 3NF9A 3MGHA 4FS1A 3OYEA 1B9FA 4IFVA 4KHSA 4PWDA 2YKMA 3F9KA 4CJUA 3C6UA 3KHRA 2ATQA 4JWNA 4R66A 4M9JA 1X9SA 4IQVA 4CCHA 2W9BA 4ED6A 1ZQQA 4GC6A 4C8OA 4O3OA 1B9DA 3WNGA 3UIQA 4B8CA 4FLWA 4UB4A 5HBMA 3TABA 4RUAA 5JS1A 4TUSA 4HYKA 3TQ1A 1KLMA 3SI8A 2IOCA 4KO0A 4FM2A 4YCXA 1RTHA 1Q9YA 4CFCA 3SJJA 5DG8A 3QEXA 2O4IA 3ASMA 4RNNA 2NRTA 1N56A 4I2QA 4LH4A 4JK1A 4CE9A 3TAGA 4KMUA 3OYMA 5KFMA 4ED7A 4JRPA 7ICUA 4BE2A 4LSNA 2BPGA 1JX4A 4NCBA 4YP3A 4O44A 3LPTA 3MR6A 2OWOA 4Q8FA 1SUQA 1F21A 1TAQA 4FM0A 4ECZA 4FLVA 3MEDA 3RJGA 4B8AB 4PUOA 3L3VA 5J0UA 4F5QA 4W5QA 1UT8A 5EOZA 2AQ0A 2PFPA 1DOQA 1RBSA 2W9MA 2UVVA 2G8UA 4DWIA 4QZ9A 4OGEA 5CYQA 2R8HA 2FMSA 4KHNA 2KTQA 1K1SA 3L3UA 3GILA 1H38A 1YTUA 4KTZA 4ELVA 4E7IA 4QAGA 4F3TA 4W5OA 3RTVA 1LW2A 1U49A 1SKWA 4CJQA 2Q0ZX 4H4OA 4DF8A 4DOAA 1RILA 3L2VA 2HMIA 3C94A 3HW8A 4DSKA 2AU0A 3U3YA 4C8MA 1KFTA 1ZQXA 1ZQLA 4M3YA 5CZ2A 3KK1A 2BANA 8ICYA 4FK0A 4FW1A 3TFRA 1T4GA 1VSKA 4AHCA 3V9ZA 5CZ1A 4UB1A 4OKKA 2D0AA 3MBYA 4B08A 4M3XA 3L2WA 5DKWA 5DG9A 1MU2A 4R8UA 4LH5A 3RMDA 4F4ZA 1RDAA 1S5JA 5C42A 4K8XA 1UOCA 4AH9A 3QEIA 4FJ5A 1U48A 1NJZA 3ZT0A 1I39A 4FO6A 3UPQA 4IQUA 3V81A 8ICNA 1J9AA 9ICAA 9ICCA 4PHAA 4F91B 1C0UA 3DLRA 1C7YA 3PW2A 1D5AA 5T7BA 4YNQA 2RF2A 3GIJA 1D9DA 5J2BA 1KEJA 2OYQA 2BQ3A 4DFKA 1T3NA 3HYFA 3NF8A 1C1BA 3JPSA 4N5SA 4DG1A 5KFFA 2NRVA 3VQ4A 5KRTA 3F73A 1AROP 2P1JA 8ICZA 1W9HA 3TAEA 3K5MA 3V9SA 1S6QA 1VRTA 4FJ8A 4MEXA 4EEYA 3C5FA 3M8QA 2GUIA 3L2UA 4R5PA 4RZRA 4PHEA 2FLLA 3EW9A 3QEPA 5D49A 3ZT1A 4RW9A 2W8KA 4YVZA 5L1LA 2X74A 4FJ7A 4O4GA 1JMSA 3PX0A 2BQUA 4IDKA 2PFNA 2AJQA 8ICGA 4FJMA 3T5JA 5HRNA 3VA3A 5J0PA 1ZQEA 1L3VA 4F93B 1MSWD 3G6XA 1D8YA 1JLCA 3RH6A 2V9WA 1QS4A 2VA2A 5IIIA 2D0CA 2YHAA 3P5JA 3OYDA 4FJGA 3HXMA 4LSLA 2B21A 2F1HA 2OPPA 3SQ2A 2ZQBA 5IIJA 4RPYA 2FPMA 3MFIA 5IIKA 4KN4A 5KFQA 4F4WA 2XHBA 3V9XA 8ICTA 2DFFA 3UQ2A 1L5UA 3V7KA 2BCUA 8ICSA 4JV1A 4OLAA 3WNHA 1S9EA 5C25A 3JYTA 4RT2A 1ZBIA 2F8SA 1VK0A 2R8GA 9ICUA 2A1JB 4F4YA 2C22A 4ZTJA 2QKBA 5J2HA 4QZFA 5KFXA 4YR2A 4DSFA 5KTQA 4KPYA 4DLGA 1TVRA 3N4MB 1C1AA 5DB9A 4HUEA 3KHHA 4QZIA 3GIKA 3OYCA 3IM1A 5HMMA 3OSNA 1FK9A 4DS5A 3ISBA 1BCOA 8ICRA 4QWEA 4CJRA 3OY9A 3ZT2A 1JL1A 4FLTA 3B0XA 7ICPA 4DFJA 1S1WA 4ELUA
chains in the Genus database with same CATH superfamily
1BNPA 2PMWA 4Y2VA 2QWOA 2CQ3A 1IJJA 2GNKA 3S7RA 1LWFB 5KFNA 1HHQA 3HHLB 1RT6B 4FZYA 2UXDJ 2F9WA 4I9LA 4Y2QA 2BCVA 1B7FA 3RRGA 3GDQA 1YWXA 4M6WA 2CJYB 4ED8A 2P9LB 4I2DA 2PFQA 4UASA 4HCCA 3DNCA 1OSCA 1NH7A 3GSDA 3Q8SB 5H9EK 2M3DA 4NRUA 2J76E 3CD5A 2GUPA 2JH1A 1GTHA 1S1TA 3EVOA 4AHUA 2A41A 3KLGA 2HBYB 4DR5J 2ATLA 4Q7AA 3I5CA 2M9KA 2ZKTA 2R2TA 1YVFA 2LHTA 1SGGA 4OZ1A 2MGZA 3IWNC 4NYZA 3F2DA 2V2ZA 2KYXA 3C14A 5J2PA 1W2BM 3IGNA 3TI0A 4RW8A 3BGLA 2B4JA 3BP8A 5KFPA 1ZQPA 4L3NA 2ZTEA 3WXLA 2XYGB 2XYPB 3MPUB 2D9OA 3P96A 1WSJA 3P1GA 4CFBA 1XEZA 4YDDB 2W9CB 1HBOA 5KPTA 2O8DB 3SSRA 1KQKA 1MC8A 5I3UB 1ZM4A 2VIXA 4DR4F 4JNEA 3NNCA 1N5SA 1QAXA 2BCSA 1K1QA 1B4FA 2AJ0A 5AQQA 1IG8A 4FFDA 3AXKA 4E1MA 2RDJA 3BS5B 2RU3A 4CDGA 3R2CJ 1TUWA 4ZS6A 3JPRA 3THYA 2DFLA 2Z7JA 3D9BA 4B3SF 1SPBP 2Y3YA 2P6RA 2W42A 3HSZA 2GJ2A 4ZHRB 1NHUA 1HJOA 4OFZA 1AUSL 4PHDA 4DTRA 5J2MB 2KT5A 3H6EA 3KLIA 4K8ZA 3SCIE 4RL1A 2G13A 1ZQBA 1PBUA 1CJVA 3F53A 3K0SA 4KFBB 3F5EA 1NLKL 2Z4PA 1FHTA 4BR0A 3M05A 2VPZB 3B0YA 4WCEQ 4CZCA 5AQRA 1WEYA 1OS5A 2GW8A 5ALUA 1WHWA 4KGZB 3M8YA 1BDGA 4A8KA 4BUGA 4FF1A 1MQ2A 3D2SA 4JI3J 3E51A 2CXYA 2MU2A 4O0IA 4B3TJ 2E8OA 2FHJD 2V9KA 1N5YB 1HWUA 1HHTP 1X6IA 5EUHA 2UYTA 3KOOA 3AOAA 2ZUBA 3I31A 4DL4A 2YHXA 3K89A 2V8DA 3S01A 2G08A 1IN0A 3WKDA 1ZQIA 5HRPA 3KJVA 5AQOA 1H98A 3P39A 4JI4J 4YD1A 4L75A 5AXMA 2H3GX 1ZAXA 3VETA 4A8OA 1C6VA 1QLNA 2WMMA 5IT9U 3WEEA 4BQZA 1H74A 2FY1A 2DTUA 4EBCA 1NGAA 1Z1ZA 2J6TA 2CRXA 1FJGK 4BXOB 4F5NA 1HNWK 2DNOA 2BJ7A 2RRNA 3FNNA 1HBUA 1U0HA 5HMWA 3SCXA 3DOLB 4GXJA 3BJYA 1SV5A 2YPZA 1TKXA 4YXMA 4GFJA 2KYZA 2NRXA 3NGIA 4K41A 3FBCA 1QQCA 2YHBA 1K5OA 1GOBA 2VA8A 4ZKAA 4NMLA 9ICRA 4Q45A 2MQLA 2P6TA 4KAIA 1Q8KA 2P9UA 1WG4A 3LZIA 2DNHA 2QMUB 3WBZA 3CCWA 4CI6A 3WUHA 2ZITA 5EE1A 4DMNA 1ZQGA 3BSNA 3WDOA 1RTZA 1SS6A 4RW4A 1ZBTA 4JKEA 3H45C 3CJTA 5EHHA 1GLJO 4ELTA 3ZNJ1 3U8XA 2O8EA 1JL2A 1HNZJ 5AM2A 3NVZA 1IKVA 4QIFA 3NWRA 4KLJA 2HFNA 4DCPB 2K60A 1RTJA 5K8MA 3F2CA 5CB1A 3CJ7A 3U4LA 1YIJS 3M6UA 4ZJOA 4Y2UA 2SXLA 4CGDA 3B54A 4LSZB 4RUBA 2ZNZA 1VLBA 3M2UB 4WZMA 1RTHB 2MKJA 4MFFA 3TEGA 1BO5O 4BR5A 5ADXA 4I2QB 2HNYA 3QFWA 4ZA1A 4P7TA 3C23A 4ZCMA 2M5YA 4FW2A 4PAAA 2RRAA 3RB6A 4J9RA 3T9ZA 1W97L 2RQMA 3R5JB 4P71A 5HR6A 4OL8A 4M7YA 4XH4A 3M30A 2E8MA 3CNHA 5KFEA 2BJDA 1KAXA 1I94F 3OR2B 1Y7PA 5J2CA 4ZCKA 8ICOA 1VQ8S 1K8KB 2W01A 5JLFA 2JRZA 3IBWA 3CJ8A 1VISA 3RBEA 1U1PA 4TY8B 4DR1F 3S6EA 4I6MA 5ETLA 4CDIA 3LZJA 3R1HA 4X4QA 4KLSA 1WDDA 1TK5A 4JI0K 1ZQMA 5AQJA 2HIQA 4V1Ak 3M6VA 2HRUA 3IAYA 5KFIA 2CPIA 2J0QD 3WXKA 4AM6A 3P49B 1T3OA 2K1RB 5BREA 5JS2A 1DK2A 2FPHX 1HKBA 1U04A 2EFNA 5CY4A 1U1LA 4H4OB 4ACOA 2Y0BB 3N5FA 2DO4A 3HHEA 3K0JA 3ISDA 1JLFA 2IOFA 1RZMA 2KJ5A 5ALKA 4X66K 2Q31A 5A76A 4ZJLA 5IV3A 4P4MA 3AU6A 3U02A 4ZJQA 3NGRA 4UAYA 4DL3A 1CXQA 3JSMB 2KEYA 3MWBA 3R9KA 5BN8A 2MUTA 4R8UB 3EWAA 4CGJA 3S3OA 5EE9A 1BNOA 5BOLA 2V4QA 3PKMA 2XO6A 2MQOA 3V81B 4U95A 3RR7A 4JHDB 1JQGA 3MC1A 4KKOA 3T41A 3UKUA 2OMLA 1WTBA 3VVUA 3QJPA 3K4GA 3V9WA 4O8KA 5KFOA 3TO8A 3QO9A 1RZTA 1B4SA 2ALZA 4C0BA 3ISND 3SIPB 2VJUA 2KJVA 1NKBA 5LMNK 2BYCA 3HZEA 2BGGA 1D09B 3E01A 3MCOA 3L2QA 3GIIA 3EZ5A 1OY8A 1NZ8A 2NSBA 5EOYA 2VG5A 1IKWA 1IQTA 3KYLA 2LMIA 4FYXB 3AT1B 4KBIA 3X1LB 4J2EA 5C0YA 2FVCA 2QXFA 2AJ4A 2KIVA 3JPPA 1NGBA 3D6RA 3I96A 2A40A 4Z4IA 4NY8A 5CJ7A 5TISU 2MKKA 4K4YA 1U4BA 1ZQ1C 2R7OA 4BWJA 1WI6A 3VTHA 3ADAC 1NGJA 3DLEA 4H5VA 2W6LA 1N33F 1WC3A 3W7BA 1NZAA 4X84A 5E3RA 3ED5A 3AEVA 1Z6RA 3ZSYA 5GTIU 2H4YB 3LP1A 1A5VA 4DTSA 3R5BA 3H8SA 2XSJB 2J6UA 2BA9A 4OJRA 4ZLPA 2J7WA 3UR0A 4LZGA 3LDPA 1HW8A 3ENOA 4EMDA 2AW0A 2G5HB 4DOCA 2XY7A 1KN6A 1ATRA 4DV5J 3ZC4A 1ZETA 3CJCA 2ZIWB 4P2MA 4Q8EA 1JKHA 4W4MA 4GKKJ 4UAZA 4U9RA 4CVNE 1RXVA 2YWHA 4LFBJ 3OVSA 1TVRB 2DNLA 4I0WA 3BV8A 1BPXA 1Y88A 4HHJA 1ZQJA 1DTQA 4K5SA 1RAFB 4E7KA 1FK9B 2ZZNA 4DTOA 3LF0A 3RBDA 3HT0A 1HI0P 5AZIB 4DV3J 1XI1A 3VMFB 3UDLA 3M32B 5HMYA 3K9JA 3CJKA 1HR0F 1WF0A 3QETA 2EAMA 4MK9A 3R27A 3UKRB 2QKQA 3LALA 1S6OA 2HRYA 5H9FJ 3QRRA 5JMVA 3BPDA 4ID8A 1IBMJ 2BABA 2NREA 4H5TA 2FSKA 4J9PA 2QK9A 3CETA 4FP9A 2MSNA 3FZKA 5K20B 3QB0A 5BOMA 1A76A 3HTVA 4RPFA 1YG0A 1N8RO 1YJWS 2ZUCA 3NS5A 2UUCK 3SUPA 2ROEA 5E5NA 1M5PC 1CZBA 4DTXA 1IKXB 1ZQSA 4KGMA 4DXLA 3ULEB 2E4LA 3ZT3A 4MKYA 1CJUA 2X51A 1R8CA 4B3RK 4LY7A 2OXOA 2VBZA 2V6AA 3H2UB 4OJGA 2VFSA 1YZ7A 2LDYA 2NXCA 5D78A 3MM5A 4GO5X 4BC2A 2HURA 1RT7A 1KN5A 2V67A 4Z6EA 3QQCD 1KOOA 2LXIA 1O8BA 3T79A 3AGRA 4NCGA 2GOLA 4KJIA 1SIJA 4CJTA 2XMUA 3LVWA 2LBOA 4HTIA 1VS3A 5BXIA 2D3OR 4B9NA 4G3IA 4BRMA 3QU9A 4C8LA 4CEQA 3W60A 7ICNA 1QE1A 1X6JA 4OHZA 4OZ5A 4O4RA 1BA0A 1NNLA 1A0PA 1B64A 4ECWA 2P6SA 4RW7B 3QJLA 3CFRA 1UEKA 2JMGA 4ZMMA 2K8GA 2BKPA 5FP0A 1LWFA 3KK7A 2FJXA 3HHLA 4HTUA 1ZA2B 1M5HA 4FF4A 3W63A 5IOLA 3AA4A 3EUNA 4QZAA 4R0JA 1S57A 3AQPA 2NS1B 4BCAA 4Q2MA 2KW4A 2HBKA 3D45A 2AQ4A 4LF7K 1GXUA 3VF0B 3LP3A 2BJ3A 3ENAA 2IS3A 1SB3C 5LMUF 2XCPA 3VN5A 3AH6A 4DR6K 5B0FA 5L1KA 2GH1A 5KFJA 2PYJA 3PTWA 3GBTA 2ZXIA 3LDOA 5AQKA 4CM0A 5AM3A 1VQSA 5LJ5Y 4P7VA 3W5YA 4K4ZA 1UWBA 5KT4A 1A5XA 3MPDA 3H3OB 1U2FA 5A8WB 2DISA 4LF5F 4NLPA 3V1QA 3DU6A 3KOAA 1R3NA 2P9IB 1RKIA 4ED5A 3IDHA 1LKYB 4USKA 2G9OA 1UP1A 2ZUGA 1YGYA 7ICMA 3AVNA 2MQQA 1EAYC 4XDDA 3AFGA 4GKJJ 3PYEA 3TAFA 1EETA 2MLYA 4YFUA 2ZOGA 4FLYA 3LDAA 5C5JA 1QH9A 3N7RC 1Y11A 4ZVGA 1ZD5A 5F2RA 3A2FA 5KFTA 2C3YA 1VCTA 4JEPA 4OLBA 1GMWA 3GPAA 5BN9A 1ZS6A 2I0XA 2DNMA 4ZHRA 2DIUA 4MFCA 1YLXA 1G2EA 7ICTA 6FDRA 1OQ3A 4P4PA 3T1HJ 3NHGA 4YOWA 3ETMA 5U47A 1YHQN 1D8ZA 4URSA 1JCGA 4NO7A 1FKPB 2Q0RA 1WC0A 1DZ5A 1Y64A 4MLHA 3L4QA 5ALYA 4RX6A 5L1JA 4ZVUB 1J5OA 1RSCA 4IQXA 4DHVA 1X5TA 3ALYA 4AHVA 4I2JA 5KOWA 3Q7CA 4O5KA 2CQ2A 4ECVA 4QIGA 4IWVA 3CT9A 3GFYA 1FKOB 5JRTA 2W25A 1YK9A 4YMEA 9ICXA 4MK8A 2OM6A 4X62F 1HBMB 2XSFA 4DUZF 5L46A 2QMWA 3QT7A 1TV6A 1U2VA 4I2GA 5C12A 4DB3A 1WEZA 1T7PA 2C3UA 3GMGA 4M41A 4Q43A 4ZIVA 3NS6A 4Z94A 4V19S 4HUFA 1AUDA 4DFPA 4KI4A 1N0VC 2N7YA 1R6YA 1X9MA 2JC0A 2MLXA 1VQMN 1COOA 3D0IE 1LW0A 5KFGA 3PMNA 1EIYB 4RG8A 2JGUA 4NLGA 4FBTA 5KQ8A 2I5HA 4TSXA 3WKEA 1DRGA 3MEGB 1S72N 1B0XA 4IOBA 2X1GA 2E5JA 2ZIXB 3GCXP 5AI6A 5THWA 1YJ9N 4DEZA 1EQYA 1OH8A 2FC8A 5FPEA 1D0EA 1HYSB 2E5LF 4TYAA 4PG4A 4JI6F 3NCRA 2ATCB 3I0RA 4MK7A 4KLFA 3O9QA 3E58A 5KFKA 4PKGA 2WAQD 4N77A 4IH6A 4I7FA 1BQMA 4OX9F 3FZLA 4OZLA 4F50A 2AGQA 3CFPA 2QB0B 3KK2A 1HWKA 1BPEA 4CEOA 4WE1A 3UVJB 2D74B 1A77A 1I3OB 4CHPA 5D3GB 5J2NB 4O44B 3ZX2A 2HMXA 4LZDA 1I94J 4IOCL 4QWBA 5HMXA 3QINA 5A0YA 2ZVSA 3R97A 1QQ7A 2HGNA 5ALIA 4J2BA 4Z7YA 3CCZA 2KXHA 1K73T 2IFXA 2LFVA 3SJHA 5AJ3K 4G9BA 3VQTA 5CYMB 1RDDA 4QYZJ 2QXLA 3HI9A 1H73A 4HLBA 3PSPA 3TAMA 3KBBA 4W90B 2GMLA 1DBDA 3BBCA 3Q86A 1HWLA 4TVAB 1CRXA 4KPCA 3OSPA 3AM9A 3MTJA 3RH5A 1N2XA 1GO3F 3VERA 5BRFA 1K47A 3DDNA 2V7YA 2DKXA 3RWUA 2YQ1A 3JPOA 1TYQA 4CLWA 2CZ9A 3DYAB 2MEWA 4K0KK 1K0VA 2VQEF 3H5UA 4NA3A 3MCSA 4XAKA 3BY5A 1RT3B 2FD2A 3MMVA 2B7CB 3TYTA 3OS1A 1LV5A 4WJBA 2OCEA 4QNLA 2BE2B 4OYBA 4CK1A 1T9TA 1F0XA 3EE3A 1F5CA 2CA9A 2H3IA 3H4BA 1W7AA 3D1HA 3V1OA 3ISZA 1PCAA 1M6YA 4LF2A 2UXCF 1NSKL 4CO0A 2YNFA 4IUFA 2O3DA 4YXJA 3HSTB 2ZJQQ 3O1LA 3N97B 3OTQA 4DL0C 3W3DA 2G1DA 3PZPA 5BR8K 4DTMA 3MI7X 4YY3K 4RPXA 2CNKB 3H5XA 3FLCO 3I9V9 4HL9A 3IG8A 3EDQB 4OJOA 1VSLA 2O01C 4B3MF 4FWRA 3IWXA 1DLOA 1KFDA 4DG1B 4M5HA 1RT5B 8ICBA 4GVLA 4OZ2A 4MF8A 1EX8A 3QUQA 3THPA 3T1YJ 3JSMA 2GHWA 3TP2A 1ZXOA 3VQ7A 1S6PB 1VRTB 1YF5L 3LAKA 3LH2S 3LTOA 2FLNA 3Q8YA 3MECA 1KQSM 1N36F 1IR0A 4B3OA 3I56N 1JNZB 1EHWA 3D6MB 5HO4A 2OYYA 2EC2A 3N6LA 3F56A 1KSPA 1HBNB 4NLSA 1SL2A 3KKFA 3MEEB 4KH4A 2Y1RI 4YDXA 2FJWA 2JLEA 4UY8T 4U67L 1FDAA 1XC3A 1BC6A 2FSJA 3QBXA 3KKAC 4M9GA 2VWJA 1IWGA 1L3SA 1BPDA 1V6HA 3QZ7A 3HRDD 2CJAA 2VL1A 4J37A 4A2AA 2HVZA 2WONB 1J5EK 4CGFA 2E7VA 4ILJA 1URJA 4LR9A 3N6NA 4FLUA 4E1NA 3EGVA 3FMWA 1V5VA 2G0JA 3EVMA 4KRFA 1UVNA 3DJCA 1F2GA 2NLXA 2VV5A 1FRLA 1OPZA 3WQPA 5DDPC 3MD1A 1XQSC 3HFKA 4EX6A 4CGGA 1FRHA 5DM6Q 2VOPA 2DT9A 5KT2A 1U6ZA 4PWUA 2VQFF 2A0FB 2E2NA 3RBXA 3TVKA 1BVSA 1NGIA 3S6JA 1ZQYA 4OHVA 3BS9A 5HP1B 2NXEA 3AO3A 3ENBA 3PYGA 3R2DJ 2LEAA 1IH7A 1CULA 4RJVA 2E1EA 1HR0J 3M2RA 3PRVA 3C8YA 2F8LA 2XNRA 3Q2TC 2GVDA 4R64A 5FPDA 3EPIA 2GMJA 3FE1A 4LF8K 4W5NA 3LPUA 4CF9A 4DL6A 3E9PA 9ICSA 3RFAA 4F8RA 4M45A 1JLEA 5DBAA 2QLFB 3O80A 2BE9B 1YXQA 1T05A 4Y28C 5KFLA 2JSXA 1YBAA 4IQMA 3VCBA 2XLKA 3VQBA 4JI5F 9ICTA 5J0OA 1HD1A 3QNOA 2AZ3A 5E26A 4QJVA 4ECRA 1ULRA 2DD8S 4AYBC 4IFYA 1WELA 4IG0A 4U8VA 2FXUA 4KE5A 5LL6Z 7ICLA 3PW4A 4P74A 2WB1F 3PR5B 1BGXT 4H4KC 2R9LA 4OJ5A 3Q8LA 2RS2A 4F4XA 2H5IB 2BOAA 1S7HA 3NKYA 3CJ9A 3VAKA 3A5MC 2OPQB 3CCSN 3UWTA 3NMUA 5JU5A 5AM5A 4OO1J 2BEFA 1IJFB 4NLYA 4WTYA 3VGMA 1IKXA 1Z19A 3ULEA 4DL2A 1IBKJ 2DO0A 1OY6A 1N0UA 3JS9A 3VF6A 2BZFA 1NGFA 4B9LA 1VQNS 5H1SQ 2W43A 4YR0A 3KZXA 1RWWB 4C2MA 2MTLA 4BC4A 3W9JA 5LMUJ 2GAGC 3HO1A 2PFDA 1VQLN 4E89A 2E8NA 3UDEA 9RUBA 2XZDB 3J80Y 1DFDA 5FLXY 1W26A 2ZIUB 4F92B 2GO9A 4FF3A 4CBUA 5B0DA 3EGNA 4PZNA 3QT6A 4OI3A 3DXMA 1G4CA 3GFHA 3ZZPA 1RNHA 2QGFB 3W65A 4RW7A 3O8MA 4IKFA 1Y4ZB 2ZC3A 2OSQA 2E44A 3MDCA 1ZQHA 1Z1VA 3CFOA 1Y9OA 2DH9A 3C3LA 2EH9A 1HPZA 3HX9A 1ZQDA 4LVSA 4N76A 5ELZA 4AT1B 1U25A 3MGJA 2NZ4A 2FYXA 2FIUA 3HHKA 2J0WA 5J0SA 3M3ZA 2YNIA 3HJFA 1XSPA 4KBOA 2A1BA 4DPTA 9ICIA 1VRUA 5J0TA 1UW4A 2BDUA 3DOMB 3D2NA 4M63C 2E1YA 4JI2K 1PAEX 4J9OA 2ZBQA 1UEVA 4GNIA 3KLHB 4LF6F 3VAHA 3KZBA 2YKAA 1PK1B 1X1PA 5AQNA 4CYUB 3G6VA 1ZQAA 2RQ5A 2F3JA 4USUA 2IIHA 3CJ3A 1WSRA 4P10A 2HHXA 4GXIA 2P9IA 1K9MT 3EGZA 1YJRA 4GVBB 1MLAA 2BPFA 3SPYA 4CQ1A 4ID5B 5CABA 5K14B 4PZOA 4J91A 3BO4A 5AT1B 5M1OA 3IFRA 1KONA 4LF4F 1TL3B 1BISA 1AFIA 3CDUA 3RR8A 3R5CA 4FE3A 3K75D 5JTIA 3R7NB 4M5MA 4O3QA 1Q7YO 5DMRA 1FEEA 5MAOA 2YV0X 2WBMA 3KMQA 3HKZD 4X62J 4TYBA 4DUZJ 1LXNA 3OTOF 5CHGA 4CTAB 2MPUA 2QYCA 1GMWD 3CXCR 1KD1T 3MABA 4JB3A 2LEBA 7ICIA 2YH0A 1LCUA 1MWKA 1OYEA 3BQ2A 3D6HB 2ZJ5A 3W0LA 2AP6A 3TA2A 5DO2A 4NXMF 3DRPA 3GG1A 1FKPA 3R3TA 3QZ8A 4DR7F 3ZX3A 3CCQS 5E33A 2FDNA 1WHYA 3PSFA 1KVAA 1SJRA 4JKBA 2FPLA 4NYNA 4GO7X 4EBDA 2DFHA 3AJ2A 3OQ2A 3ZDEA 4M95A 2DWQA 1DQAA 3BKUA 2EKNA 1CJKA 1D8LA 4AM7A 4PQUB 4F67A 2ZBIA 3UN5A 5EU7A 5CR4A 3IKMA 2HHHJ 2QLBB 1HBMA 2Y8YA 2DRAA 2IGIA 5AXLA 3L4PA 3RJJA 3FSXA 3BN4A 3M9OB 4US8A 4Z2XA 1RBRA 2K89A 2ZJPL 3SEOA 4USWA 2YJEA 4CFAA 4ED3A 4M94A 1ZQWA 4HEA9 2DNKA 1JCFA 4U96A 4CECA 2VIHA 1WYGA 4CK2A 2UXDK 3UPFA 2A2DA 5I3QA 2PXIA 4FS2A 1A7GE 1TTHB 4FS1A 1MA7A 4X4RA 1RTDB 1E6YB 5AZJB 4F3QA 2FVQA 8RUCA 1G6BA 3F9KA 2P9SB 1KL9A 2KVIA 4M9JA 2EG2A 4IQVA 4DN9A 3ETOA 2KT2A 4DR5K 2ZIXA 1A6SA 1RWMB 2HSEB 3I4HX 4USHA 2OPSB 3SBTA 2Z56B 2JVOA 1S48A 3LPEA 3TABA 4RUAA 4TUSA 1SZ2A 4JD2A 3TQ1A 4XPCA 3I8BA 4S0MA 1FX4A 4KO0A 3W9HA 4CLUA 4FM2A 4YCXA 4KHPF 5GADU 3LP0B 4CFCA 5M2UA 1ZZFA 4RNNA 1RQ0A 2DGOA 1AT1B 1S1XB 4CE9A 4LH4A 3FZMA 2EKYA 3Q22A 2ZE2B 1JX4A 5CE3A 4YP3A 4O44A 3MR6A 4CO5A 1ZRMA 2QWRA 3LM9A 5AKGA 2ZOMA 1H1VA 2QRRA 2IDEA 4J90A 4FLVA 1BWVA 4H0XB 3MEDA 3RJGA 5L1MA 2JWLA 1UT8A 1RP5A 5EOZA 3KKAA 2GV1A 4DJBA 4EGLA 2ZF5O 4ZVOB 1F5SA 2PA3A 2XHWA 2F8KA 2OD6A 5AQSA 3O1BA 1FXLA 4E2FB 3NMRA 1B70B 2G06A 2HVEA 4KHNA 1DTTB 2W11A 4L76A 4ZIWA 4ELVA 4E7IA 5AQUA 4QAGA 2BW2A 2K8BB 3RTVA 4JI3K 1U24A 4OYAA 2UXBF 3L2VA 4FNHA 2V8VA 4B3TK 2IBOA 3HW8A 2QMXA 1S12A 1GAOA 1U6BA 2MA1A 1BG3A 1X8DA 2CWXA 1ZQXA 3D6TB 4C97A 4C7YA 3KK1A 2BANA 8ICYA 3PIOQ 2O8CB 2XLIA 3LVVA 2F8HA 5CZ1A 4UB1A 1VHXA 3VENA 3MBYA 2VPWB 3L2WA 1HHSA 2E7XA 3TTCA 2DGQA 5DG9A 1SJ1A 1RDAA 2NYIA 2RD5C 5C42A 4JI4K 3QEIA 4UB8U 2W7AA 4B1WB 4FJ5A 3ZT0A 1I39A 2XICA 2HWIA 1VJWA 3QT8A 1QHAA 4AUKA 3BO2A 3OW2R 3MM8A 1KHVA 1J9AA 3BSCA 2LQ9A 2OMOA 3M1YA 2BMBA 1D5AA 5AKEA 3GIJA 1WEXA 1Q5VA 2CQHA 4DFKA 1RBAA 5IM0B 1T95A 3H59A 1C1BA 4DG1A 1T6DA 4FWKA 3VQ4A 1X3MA 4FVCA 2LM4A 1T3QA 2AYMA 2PFFB 3N4PA 2W41A 3NVYA 1S6QA 1VRTA 1W2BR 3DEEA 3PIPL 1XMBA 3L2UA 4R5PA 4RZRA 5D49A 2OP5A 4RW9A 1F6TA 4YVZA 3CSKA 1VOMA 1X5PA 4O4GA 3WXJA 4OD0A 2HYIB 3CMES 1RM6C 2AJQA 4H4KA 3VA3A 5J0PA 2I6XA 2HBLA 1L3VA 5AFUA 3U9ZA 1MSWD 3L5KA 1HNZK 2KL8A 2QZ8A 1M1GA 3OXLA 1RDWX 3KJFB 1QS4A 2D3DA 4A57A 2W2MP 5IIIA 2D0CA 2HOFA 5TKWA 1WB9A 1Q81O 1S49A 3SQ2A 1Q1KA 5GADP 3AN1A 3MMBB 1YQHA 2YB1A 5E79U 4BJQA 1MN7A 1E6VB 4J9UE 1SJFA 4KN4A 1T6CA 2XHBA 1X5SA 3A4TA 4FYYB 2MKYA 3UQ2A 1R43A 2QSFA 5A6WA 2BCUA 5K8PA 4KH5A 1SQFA 4ZPDA 4JV1A 3G25A 1P7DA 2MQPA 2Z2YB 2KG5A 3MEKA 4OLAA 3WX4A 5HL7L 5LL6d 3WKAA 4FKXA 3OL8A 2WF8A 1VK0A 2GJFA 2CPXA 2R8GA 2A1JB 4F4YA 2C22A 5HVGA 4U7UD 1C0FA 1RWOB 2QKBA 2X1FA 1T94A 4W98A 2N82B 4JK9A 5KTQA 4KPYA 1KS2A 4DLGA 2E1ZA 1C1AA 4JI5J 2IIRA 3OSNA 4IG3B 3L09A 1HKCA 2LU2A 2DPNA 4PL2A 2IC3B 2RU9A 2LYAA 4JK8A 2CKWA 4FZLA 5J1EB 3NVVA 2QG9B 5EE0A 3IRXB 3ZT2A 5M1NA 4YB7A 3B0XA 2FZGB 5JVGL 2F3NA 1S10A 2P9GA 3SK3A 5J0RA 1ZA1B 4A8EA 3VEWA 4LFCF 1S59A 1RCXB 5HSPA 4BRIA 2KKVA 4BRNA 2XS5A 4M63A 2XWXA 4A46A 2PMZC 5KG3A 5KFBA 1L6NA 4WWSA 2OA8A 2PI4A 4F4KA 3DXKA 4CD3A 4GV6A 3FAHA 4Q0BB 5FDLA 4F0HA 1RHUB 4TNOA 2Y9UA 1N5XA 1NK6A 2ROPA 3I0SA 2QFIA 1BUPA 4Y2JA 3B4DA 3HPOA 2R7TA 2I1QA 1C1CB 2KJ8A 2RILA 4BRQA 3DLJA 3ZZTA 4MTPA 4ZPVR 2ASPA 5J0XA 1YJWN 2DCUB 4FWSA 4UOHA 3QBWA 5D0GA 2K4PA 4UT4A 3HVAA 4LMZA 2OPQA 5B0CA 4K25A 3OYFA 3HVRA 4NJ8A 2OJ3A 4PA1A 5KG2A 2A2CA 3UFCX 3X3UA 1N34F 2HW3A 1C0MA 1TFRA 2DY4A 4B1VA 2CG4A 1V38A 2KFZA 1R0AA 2YMQA 3AA3A 4GV3A 4Z4GA 4M9HA 2Q3SA 1S9GB 3FGVA 4WKYA 3D0GE 3SCLE 3ZSVA 3NY0A 4Y00A 3DC2A 1R27B 5MLCQ 4YQWA 5I42B 5CYJA 3NS7B 1JLGB 2RIJA 3MCAB 4KH0B 3NH0A 1VQON 4OJ3A 3HPHA 1NKEA 3Q89A 3DAWA 4J9NA 2EQYA 1J2VA 1M90O 5HNKA 4CLZA 2HOEA 4URQU 4LF6J 3BYRA 4YB5A 3L7PA 2QN6B 1LWEB 2FF3B 1TUYA 1HIYA 1MMDA 3AOCA 2VDHA 4KGKA 4JI7J 3MUTP 3GFKB 3T7ZA 5KQDA 4TXSA 2CZVC 4NYFA 3SV4A 1PZNA 1HYVA 5HROB 2VBXA 2EEYA 5C2CA 3ILJA 3PHTA 5J8YC 3C6TB 4NXNF 2W8LA 3WK8A 3U1NA 1K6YA 2H48B 3OJSA 3C29A 3GB0A 5AE2A 4ZVQB 5KNIA 4CT8A 3THWB 2J9DE 3V1RA 2Z57B 1AW0A 4DPXA 3VQ6A 5LJWA 3C2PA 5E84A 3EO3A 2EXUA 5C2DA 4CW7B 3QEBZ 4DV5K 4HCBA 2AXTU 3VVTA 3AVLA 4QWAA 1N32J 3KLHA 3T5HA 4KLTA 1S1VB 5IILA 1ELOA 4LFBK 3CRXA 1HQUA 3OTOJ 4M5IA 1XUPO 3RVCA 3O44A 2FMQA 1C0GA 2P5VA 2HAFA 1NB2A 3RB4A 3M6XA 1V85A 5ALGA 3O3HA 3ZYYX 1U9LA 5C10A 4WF9L 1KOHA 4DV3K 4NXMJ 1L3UA 4QR1A 1IM6A 1R8AA 3DLKB 5GMEA 1RI7A 3PUFA 1EQMA 3RU0A 4RQ3A 2BACA 4DV0F 1Q86O 5H9FK 2IHMA 1IBMK 3NCIA 5AKZA 4OI4A 2QC3A 2ZIVB 1TKDA 1YI2S 5BPNA 3L6QA 3TVZA 3L8BA 3PJXA 2F4VJ 4Y2XA 4OZ0A 3G71S 3LDQA 4TU8A 3AB4B 3DGPB 4DV6F 2K8AA 2RKIA 4LREA 7ICRA 3CD0A 3NEKA 4PPZA 1FNXH 4N56A 3KLFA 1HUZA 4DV4J 4FJNA 1LWXA 1IR2A 2COLA 3CDBA 1NJXA 2IM3A 4PKHA 3NRBA 2B7BB 3C6UB 3QRQA 2G0CA 4J2AA 1LK7A 1HNXF 2MZ1A 2W9BB 2KH9A 4HR2A 3KUGA 5HOOA 5M1PA 3NDKA 2VHGA 3CM5A 3GP9A 3DGVA 9ICEA 4KX5A 2KXFA 2ACYA 3CF5Q 4LQ9A 3NASA 4I2AA 2VDIA 5HBMB 3SUNA 5KRSA 2F40A 1QAJA 3OHBA 3MPWA 2VF3A 4B9UA 3SUOA 2O1PA 5CP2A 3OL9A 1UPHA 3GFXA 5D4BA 4CLTA 4LSNB 5DM7Q 1U02A 3CE8A 4KHPJ 5KG0A 2LI6A 4EYHB 2CUYA 2DJWA 2GX9A 1NH8A 4TY9A 4ZP9A 1SUQB 4CERA 3S3MA 4JKFA 4FZXC 1B7YB 1RTDA 2OGUA 5HATA 3THXB 1AZSA 3BM7A 4TU9A 2IM1A 1QJHA 3K8WA 3RJIA 3B6OA 5DDMA 1AQ6A 4RQ4A 2EZZA 4KQZA 4DQRA 4BQLA 2B51A 2DNQA 4QZGA 5AQGA 3NS1A 1A9NB 2XC9A 2E6MA 3FQKA 2KRRA 5DGAA 3J7ZO 1S76D 5F0UA 1VGYA 3MK6A 4HT7A 2D3ZA 5CZVA 3GONA 1VLOA 2JEIA 1LW2B 4DUYF 2JEGA 1VQ6S 3E0FA 2OEKA 5E2QA 3KIOA 2FJAB 4FKYA 2K4EA 2ZE2A 2CPYA 3UO0A 4GKJK 4KY3A 5EN1A 3T1AA 4OPAA 1WWUA 4EI2A 2GBZA 2EI5A 2HK3A 4QR2A 2DHXA 3PYFA 3CDAA 1Q0NA 4NEYA 4CLSA 5JUMA 2F44A 3UW1A 2ZBCA 2O4GA 5A8KA 3CYMA 3AD7C 1B3TA 4GRSA 4Z6FA 1FXRA 1MU2B 8ICMA 1FNMA 1TL7B 3T1HK 3QEVA 4Y2IA 4P72A 2WHOA 2E1AA 3ZTPA 3HVWA 1BU6O 1DHMA 3EE8A 2RF2B 2NLWA 1DTTA 4CZJA 3J7A1 8ICKA 4Q44A 1HFEL 1SH0A 3ZTSA 3G4SS 1ATSA 2X6SA 3QGHA 5H1SV 3A8YA 4JKCA 2DXEA 4M5DB 2NPFA 2YWFA 3QIOA 2KXNB 5EE3A 1X7VA 5D6GA 3HP9A 2BGWA 4CIGA 3D2EA 3M8QB 3FGUA 3NCQA 1P27B 3A8IA 2HQDA 3NLCA 2BE7D 3EKUA 4FBUA 2V63A 4OZJA 4M42A 4CJSA 3KZIU 3M2VB 2A6MA 5KGWA 4BRFA 2HNDA 3KWMA 1RTIA 3P4UB 3SDEA 2GWJA 5EY4A 1S5LU 1JLAA 4NLQA 2DQNB 4ECQA 8ICJA 5F41A 4UB5A 3D2FA 1JLCB 3H40A 3BR8A 4AILC 3SMSA 1Y0HA 3GJRB 4KIAA 4I2HA 2HGLA 1UEUA 4NZ7A 1UW9A 3MCMA 1MG7A 3AJDA 5D4LA 2GVZB 3KLVA 4LRAA 2GTDA 1QQ5A 4CEAA 1YRTA 4I6AA 2X78A 7ICHA 3E3XA 4ER8A 3A5NC 1PVQA 4U7BA 2XG8A 3EN9A 3B6PA 3CCEN 1KTQA 1XSLA 2IRUA 3PEHA 1FFGB 1OVQA 3GIMA 4YR3A 2HVHA 2M8HA 1L7NA 3QAUA 3GIRA 3CCUS 3OYHA 2LYBA 1UWAA 1IV8A 2Y1IA 1R6VA 4LF9J 4X5VA 2QYGA 1DURA 1SKSA 3CQ8A 2ZJRL 4WQ5C 4FZMA 5J2DA 3AHPA 2E9RX 3IFEA 4ILRA 3WKCA 3QNNA 2K7KA 4WBFA 2NO4A 3ZFVA 4AYBD 4HT5A 3TKAA 3RMAA 1O1WA 4HH0A 3RW7A 3BQ0A 1YDLA 2DHAA 4LT6A 4Y3CA 3K5NA 1ZTTA 3M9NB 2NXNA 3I4PA 1ZH5A 3Q7BA 2Y0SF 1Y97A 1I94K 3KKRA 3UXNA 1FKAF 4YD2A 5HN0A 4O55A 2OPRA 3J81j 5KGXA 4WFAL 3CCVS 4L72B 4O5CA 3MMBA 4MYUA 1D1UA 2BH1A 2N1RA 3BQ1A 4X4UA 4QYZK 2ZTDA 1LXJA 1KKXA 7FDRA 1XR6A 5GAEU 2JZBA 2FBYA 3ZSZA 2QB1A 4C48A 5IC6B 2B6AA 4TURA 4DSJA 2CZ4A 1LAWA 1KW4A 7ICGA 4YUDA 3GV7B 3PEJA 4RWWA 2CJQA 1DJ0A 1QUVA 4XPEA 1M0SA 3MMJA 1JLQA 3AVCA 4M6WB 2GAHC 4Y1CA 3SI6A 4LFCJ 5EX5A 1SWVA 3KVGA 1NCLA 1X4EA 4I2CA 4DF4A 1A0OB 3ITHA 5B09A 1VQ9N 3KLGB 1RPLA 2CRLA 2M2BA 3U9DA 4NLVA 2CGJA 4BY9C 3W9IA 3L3CA 2MGZB 5J2PB 3C14B 2RHQB 4RW8B 1VHFA 4IBNA 5J1EA 4PH5A 5J8YA 5M1QA 1M5OC 4M3WA 2KU7A 1UCNA 4ZCIA 5J2KA 2LU1A 4DX8H 4QS7A 3ZLJA 3JQKA 3P31A 4JV5F 5GINA 3T5KA 4QCLA 3CPWM 5DB6A 2FMPA 2QM1A 2IVYA 1IIPA 3RUBL 4I56A 1VI7A 3JQJA 5LM7E 3V5RA 7AT1B 5HANA 5K5MA 3THYB 1FI4A 4CJ4A 4JRQA 1HUOA 3R7SB 5J2GA 1ZBSA 3T1YK 4BRPA 5HRSA 1HKGA 1NMNA 1YITN 1FXXA 5ALRA 2YKPA 2V4RA 3KLIB 1F0MA 4BRCA 4B1XB 1T03B 1RJJA 5CHCB 2PT0A 4RCHA 2IBKA 2EWSA 3MPVA 2WBRA 1CJVB 2FBVA 1ACMB 5E0OA 5DK5A 4G9ZA 2EPIA 3WKBA 1SJQA 3AVHA 4GMKA 4FPAA 5KT5A 4CGZA 4B9SA 1RHMB 3ZZZA 4RUHA 2B4PA 2ZEJA 4YOYA 3D54A 3VEYA 3C2MA 2DGVA 3A12A 1O51A 4TUQA 4QS8A 4BG9A 1DRZA 3NGTA 2XI3A 2AX0A 3HJVA 2AJFE 3K17A 5ALDA 2J8AA 4E0DA 4C4TA 2EZXA 4X66F 1O13A 2YX4A 1GXTA 3IM9A 2CVEA 1APSA 5IIMA 3KJVB 3AO2A 3WNFA 3DU5A 1PYTA 4WK1A 1JALA 2LPEA 3RMCA 3ZD9A 4C8YA 1ASVA 3D7EO 5IT9Y 1TL1A 4YN4A 3D66A 1NJIO 3QWPA 4RQMA 3M6KA 3WEEB 3BF3A 2PIIA 1YZ6A 2YB4A 2CNOB 4LIRA 4FWMA 3VZHA 2DYAA 4GLXA 1KVJA 3F5AA 2DITA 3IXQA 4H0OA 1PVRA 4YB1P 3JB9k 5LJ3Y 2G8FA 1HBUB 2V8GA 1U0HB 3UQSA 2XS2A 3IP0A 5GAEP 1SV5B 1TKXB 1ESVA 4I29A 3VOVA 3WC0A 2HCFA 4P2HA 3JTOA 1F44A 1HR0K 2MJUA 5DDYA 1NNEA 2G5IB 2D5RA 3I5AA 5LMNF 2ZH2A 2UP1A 1NMDA 1SWWA 3OYNA 4DV0J 2P9UB 1B99A 2G8VA 4MYTA 4NM2A 1RAHB 1PAUB 5J2QA 3L7UA 2ZJ8A 4EFAC 2IPOB 3UQ0A 1S1VA 4ZLNA 9ICPA 4DV6J 4RW4B 4CRXA 4KLUA 3IBFB 2XMTA 2CPHA 4TLQA 5GIPA 4CEFA 2O8EB 3EEQA 2VCPA 4IKAA 2VANA 2LQ5A 4DBQA 2R7RA 5CH7B 1IWAA 5CD4A 3W2VA 3OXFA 1S0MA 2CYYA 1RTJB 2WTFA 3CO9A 4IFVB 2DNZA 2QTWA 3N0VA 4OYPA 2DRDA 4O3RA 5C24A 3ENVA 4HI2A 4OVLA 4RTFD 2RMLA 2VPYB 4BE0A 2ZIVA 3R5GA 2POKA 1KQSR 3KHLA 4P52A 5AXKA 2MZRA 1RWPB 3GJQB 1WSGA 5B0BA 4P0QA 1GLLO 1WG5A 3F0NA 4KLGA 5EGYA 4CJ3A 1V4TA 2DEIA 5DLFA 5J2AA 4IO9Q 3QEWA 4LRDA 3SR6A 3M30B 4MMOA 4Y6IA 1TV9A 1RYUA 1CJTA 4XO0A 1IBKK 3MN6A 3HF5A 1FWLA 1DT9A 4AFFA 3ICLA 1NGEA 3FK4A 1IBLJ 2H3VA 2A5XA 4DR2F 2A1RA 3NGKA 2MQ8A 4V19J 4AF1A 5KG5A 3PW5A 2YJFA 4ES3A 3C15A 4I6MB 3R5AA 3EZOA 2P9PA 3BZCA 5LMUK 4PUOB 4Z7CA 1VBXA 1QTMA 3QU4A 3P5TL 1YBTA 1U26A 3LDNA 4KLHA 4KC5A 4MFBA 2H3ZA 3RJEA 5KG4A 2AEMA 5CHIA 1H2UX 4ZCLA 2R8JA 2ERRA 2JWKA 3RYLA 4J03A 1HIWA 2FVPA 2HBRB 1JLFB 2PO4A 2EBEA 1VQ4S 5AR0A 1CG2A 1UL3A 1X5OA 2E6LA 3QT5A 1N63A 4F5OA 3AY0A 3LANA 3SCKE 4EHTA 1Q82O 3TSQA 2NUHA 1NMEB 3O4NA 3DMJA 4B3RF 4DU3A 2HMIB 2MUTB 5KG7A 4BVPA 1FX2A 1RBOB 1J2MA 3OBWA 2EG1A 2ZWPA 1X4BA 4C11A 2XMVA 4M8LA 2CQGA 2VFVA 2DBBA 2EFPA 3UKUB 2XEXA 1ZQKA 3PXGa 2DGZA 3C46A 4FJHA 4EO6A 3CCJS 1RAAB 5BRHA 3D5MA 3VQSA 1S0VA 3QO9B 4QIVA 3ZDDA 3JTNA 3MMCA 4YOXA 5KFYA 2OAUA 4Y2AA 5L1IA 2WBNA 3PDNA 1NWKA 2HFOA 1FVSA 1WF2A 1RK8A 2L9WA 1YVNA 4PCQA 3C95A 4PQAA 2VG5B 3UCUP 1VQ5S 1RHKB 1KC8T 4HWIA 1REVA 3ZZYA 4OJHA 4QU7A 4RO0A 1ZQUA 4DFDA 1BY9A 2HLTA 4WQ5A 4RQ6A 3H5YA 5B7WA 1T9YA 5JXSA 2HBZB 4X62K 2WVDA 1NSAA 3BB5A 1SIZA 3ID6A 4DUZK 4RU2A 1RFQA 4DR6F 1D3WA 3BR9A 5J2JA 2UVWA 3DRXA 3DLEB 1XNRF 1OWXA 4ZVFA 4MIBA 3TWZA 1DXSA 2P8IA 3KFUF 4IDKB 2V51B 4U67Q 3LP1B 4DX7A 4TU7A 1DY3A 1JXLA 5KAIU 3OFGA 4DS4A 2E1MC 2K2PA 4O5EA 3ALRA 3EJMA 3AY9A 4RBVA 3H08A 1XTZA 4KH1B 4DR3F 3QICA 1NGCA 1LK5A 4LSLB 3OVAA 5HQLA 4DZ6A 1Q78A 4FYDA 1BPBA 2HQFA 3SQIA 4NI2A 2UUBF 2AJ1A 3QATA 2YH1A 2G8KA 3OPKA 4CHZA 1QHTA 3VALA 6AT1B 9ICMA 1WOSA 4BBYA 2H54B 3CCMS 5CRXA 1DTQB 3I33A 2P5GA 1BXNA 4AP9A 5DDOC 2GMHA 2K3KA 4JAXA 4OX9K 1XR7A 3DLGA 2XGPA 3CJKB 2L08A 3MR3A 1RQNA 4YORA 5DBBA 3BKTA 3IS9A 3GG4A 3G82A 3QYYA 4XA5A 1JXBA 3UE5A 3MUVP 4ZOHC 1JLBA 4CNYA 5BYQA 4NV0A 2ZHOA 2HZVA 3KUEA 4X65J 5CA5A 2P9NB 1SI9A 1RAJA 2BR0A 3UD5A 1O08A 4I4BA 2HMPA 1N6QA 1S6UA 2Y8WA 4UBBA 3J7YU 2RT3A 1BD6A 3SUQA 1Z1BA 3CC7N 5IC4B 3O1WA 1S1WB 4TN2A 3CMEN 1NO8A 2DL0A 3BH6B 1CJUB 2PMZD 4CESA 3QUTA 5GIOA 1S1UA 2B8QA 1M1KO 4C8KA 4QZVB 4HI1A 4OJ1A 2AMCB 4FXDA 2YI1A 2QARB 1NK4A 2FJBB 1ZBFA 1SL1A 5DQGA 4H4MA 4DV7F 3AMZA 5L38A 1WCNA 3MM5B 3F41A 1RT7B 2VGMA 1VSIA 1UVKA 3Q8RB 4ICLB 3WT0A 1ZZNA 3VEVA 4NCGB 5HI7A 5AQYA 3L3FX 1WBBA 5AQLA 4LBIA 2VKRA 3WQUA 2ZFHA 3RJKA 2KB2A 2GX8A 1RADB 4H0YB 1BIUA 1QE1B 3CVKA 2HFZA 4Q2LA 5D4PA 3O9SA 2GQCA 3QGIA 3MZIA 1X9JA 2YX7A 3FQLA 4WFBL 4I1TA 2FDRA 2YMLA 1NBWA 2BBEA 2G2OA 3OYJA 3AU2A 3EM1A 5EXWA 1RU2A 1TUGB 4MEYA 3PFOA 4OKJA 4C0OC 2FC0A 3FKBA 2DHSA 4K2XA 1FRIA 3HRGA 5ADZA 2DR8A 2DPIA 2BM0A 1VDVA 3B8HA 1Z00A 3D4JA 2Z2ZA 3NVKA 5B0EA 1QZ6A 1KVCA 2GO8A 4F04B 3UCZP 3MM9B 2I2YA 4BRLA 1OYDA 1UWBB 1CXUA 1U09A 3ULDA 1DGSA 3H0RB 3FFIA 2KKPA 2UUAF 1VBKA 3KWGA 5IS2A 3LUYA 4DPWA 4L73A 4CFDA 1E4GT 1F3FA 4LBPA 1UA1A 2BVZA 4YHHF 4NYPA 3MXIA 3M8ZA 3JAMO 4IOAQ 4NXZA 4WP8A 3DWLA 2AD9A 1NXIA 3ZD8A 1ZBLA 3KK3A 3CHWA 3NGDA 1EETB 2CIMA 2EK1A 5I4MA 1XIQA 5HHHA 4M9NA 1LWCB 1Z05A 3B4MA 4DCHA 3JSYA 2GWKA 4IRCA 2MQMA 3AVKA 3JXUA 1HJPA 1HLUA 3BO3A 4C8NA 3O3LA 1FJEB 2Z2LA 2P51A 4RNHA 4PHTX 2G0AA 3MOZA 2IJRA 4CJKA 1M1HA 1YJUA 1SV0C 1BOTO 2CGKA 2JOQA 5HLFA 3K2YA 1GMVA 3NGUA 1T03A 1QD1A 4BDZA 4LIWA 2YXLA 9ICNA 3AL0B 3EL2A 2KFYA 3S9HA 4IYQA 2BDPA 4CNQA 2DGTA 1J5OB 5FPMA 2V94A 1TR0A 2NXJA 3ZSQA 2YKNA 2A6AA 3CPEA 1RHQB 5F3XB 8ICAA 2L5YA 4B6JA 3THTA 4LRCA 3CERA 2NQPA 4H8KA 2LQJA 3J7YP 3ID8A 4YY3F 3R9LA 4CBXA 3GE9A 4I2FA 4FOIA 2WSCC 3Q24A 3M6WA 2E29A 4AHTA 3SFUA 1TV6B 1U2VB 3BUZB 4FYWB 4I2IA 2D7SA 5M1KA 2XVTA 2VYPA 2PC6A 1HYZA 4DN0A 2H65B 2FBTA 2HOIA 3OPXA 4YB6A 2GV9A 3PNCA 1WI8A 3M8PA 3D2QA 3KFWX 2ITGA 4KGVB 3AO4A 3B78A 3M7VA 2V4JA 3BF4A 3WXIA 1LW0B 2G2YA 1GLCG 1PUZA 1OVYA 2RPIA 2CPZA 3OLBA 3ZEUB 2HEKA 4JI5K 1GXLA 2W4DA 3PO4A 3H2LA 2MHEA 3D0PA 1WBDA 1CLQA 3J7ZT 2U2FA 2MLZA 2E3TA 2D41A 1VSEA 3K5OA 2PD1A 4IFEA 4DQ8A 4Y2PA 3I0RB 1J5EF 4ALZA 1T8EA 1UVLA 1UVJA 1FD2A 2ZJPQ 4I7FB 3HKZC 1BQMB 3BS7A 5F0WA 4OJPA 3UE2A 3LA0A 4IEEA 4A59A 5TZVA 1NG9A 3KK2B 4ANEA 2DXDA 3UNGC 3KWIA 2E5GA 4WE1B 1WC6A 1VFJA 2GLEA 1ZXIA 3KTQA 3MHYA 5I9EB 1WOQA 3M4XA 1VQYA 1NZPA 1D9FA 2MKCA 1FIQA 2UV8G 2JGAA 3NF9A 3MGHA 3IG5A 4IJNA 5A0YB 4KH6A 4DR2J 4IFVA 4PWDA 2YKMA 4CJUA 4IS7A 2VUGA 1XBWA 3KHRA 3BBBA 3QXGA 3HILA 4R66A 4JWNA 3VEOA 1X9SA 4J7CA 3PHEA 1E3MA 5LOQA 2HHPA 3TAMB 3AQOA 2YHWA 4C8OA 4OI0A 1B9DA 4GVEA 2QSWA 2ZWOA 4B8CA 3ONQA 1E4FT 2LQ8A 1JJ2M 4UB4A 4GV9A 1B0VA 2M0NA 2QT7A 1KLMA 3SI8A 1FERA 4LF8F 1NUEA 1TYQB 4BR9A 2O4IA 3ASMA 1RISA 4K5RA 4F26A 2RQKA 1N56A 3IBCB 3TAGA 5ALNA 4ZPBA 4MDAA 3O08A 2RRBA 5KFMA 3CC4N 3JAMU 4JRPA 7ICUA 2E9TA 5ETNA 2E8PA 5L9NA 4LFAJ 2KP7A 2MQNA 4QYRA 3A0IX 1PG5B 3F9MA 1FFWB 4C80A 1LVHA 1BMQB 4ECZA 2A10A 5IWAJ 4RQNA 1UMJA 4OX8A 4B8AB 4PUOA 4DMZA 4A62A 3P3DA 3L3VA 5J0UA 2H3QA 1LOUA 2OIHA 3TUJC 3QSIA 5GAEI 2AQ0A 4CLLA 2PFPA 2E2OA 4NLRA 2YNFB 4LF6K 3F2KA 2I9SA 3ET6A 3SSQA 2W9MA 3E1YA 4LJXA 2G8UA 5SUHA 1MMNA 1ITPA 4DWIA 5LXYA 4G1PA 4JI7K 4DV2J 3S41A 4WU3A 5CYQA 2FMSA 2XB2D 2NNWA 2YN4A 4MO4A 1U1RA 1WC1A 3CQYA 1DLOB 1RHJB 2VH7A 1CVJA 2RHSB 1YBUA 5HQ8A 4F3TA 2E2PA 4JI1J 1WG8A 1H2TZ 1QVFR 3ZTOA 2ZJQL 2HMIA 3DLLL 3H0MB 4B1ZA 2JHEA 3J7AP 2CNLB 5AKLA 3MECB 2CVIA 3I76A 4B3OB 1H2VZ 4M3YA 1GLEG 1XO0A 2CJKA 1N32K 1T4GA 3H46O 1VRQC 3IWLA 4M3XA 3B9JA 3OTOK 2YMMA 5DKWA 4LH5A 5AQFA 1XNRJ 1NJZA 4FO6A 2K4IA 1WC4A 8ICNA 4NXMK 3KG0A 4MAKA 1C0UA 3QGGA 1KEKA 1TZ0A 3PW2A 4A8XA 4YNQA 4IC9A 5J2BA 1KEJA 2OYQA 3SXLA 3HYFA 2AJ2A 3JPSA 5KFFA 2NRVA 3LDLA 5KRTA 2ZC4A 2W2OP 3NXZA 1XNQJ 2F4VK 3FEXB 5EX3A 2G4BA 3BN7A 2P1JA 8ICZA 4DX6A 1W9HA 2HGMA 2DKOB 2P9KA 1NDKA 4NE9C 2QA2A 4JB8B 4FJ8A 3DDKA 2NUUG 3ULHA 4K4SA 2W1BA 4JI2F 5AE1A 2UUBJ 1GFWB 3VGVA 2FLLA 6FD1A 3OL6A 1V3SA 5FJ4A 4DV4K 2W8KA 4DX5A 3JQMA 3PM9A 5ALOA 5GVQA 3R5DA 3PX0A 4P9SA 3FBEA 4JKAA 1R89A 2ZZTA 2C3PA 4IDKA 5AI8A 2YPYA 3I55N 4DKWA 8ICGA 3QWUA 5L8RC 1FFUA 2GS8A 3SENA 2B4UA 4BR2A 1CULB 1Z4NA 4L3KA 3M2RB 2RSQA 2V9WA 2HFSA 4QIWF 3G8QA 4FJGA 2YHAA 3P5JA 1RAIB 4LSLA 2B21A 1NSQA 2F1HA 2OPPA 2GVDB 2XS7A 4RPYA 3GZFA 2WVCA 4JI8J 3SMPA 4NMXA 4QPXA 3US5A 3ENWA 5IIKA 3VHQA 1JLEB 2XYHB 8ICTA 2ZM6J 4A48A 3CJAA 2HLUA 2E1RA 1F5AA 3N79A 1X4DA 2V7ZA 5D4OA 1T05B 1TAMA 4X4TA 2YKQA 5DDRC 3W2WA 3TX0A 3ZNUA 2WVEA 2IHR1 5C25A 3JYTA 4PRFA 4KHPK 2OO4A 4U7UK 1ZTWA 4QZFA 1Q53A 2IYIA 3L9ZA 2LMRA 3IN5A 2YVSA 4IFYB 4AD6A 1S79A 1GLBG 4IG0B 4DV7J 5HK4A 2OTLN 3GG0A 2HDOA 4K43A 3H0PA 2XI2A 1UVIA 2HZAA 3HHNB 3WIUA 3G8TA 3CCUN 4CLPA 2P9NA 3AAPA 2ZH4A 5B0AA 4ISFA 3OY9A 3IO1A 1OO0B 1I6JA 1VC5A 3SCJE 1QQOA 2CQ4A 2KICA 1S1WA 1FA0A 4ELUA 2VD3A 1Z26A 4DCOB 4YMOA 3ILIA 1BCMA 2F9DA 3N5BA 4CZIA 4HHHA 5HVHA 4J9MA 1MWMA 4IR9A 2XGQA 2YX8A 5AK5A 2QARA 2YNGA 1GLAG 4Y2CA 1SV0A 3TFSA 1HNVA 5E3PA 2C28A 4IH5A 5CR0A 3K59A 2QA4S 3RZAA 3LL3A 1SVDA 3CULA 5G0RA 3CQXA 2G0IA 4PGYA 3GSIA 2UXBK 2VWKA 5F3TA 4ICLA 1QVGM 1GX5A 1SAZA 1NJIT 2YWGA 4IXCA 2DGUA 4KHMA 2MY8A 1KQFB 1KKHA 5HR7A 5EVZA 7ICOA 3KNGA 5ETRA 2WSEC 3M6GA 5DETA 1VIXA 2ZBRA 2QLJB 3DXMB 2KZ3A 1Y3JA 2BUNA 4UQGA 4KHWA 3PLAA 2UUAJ 1PILA 4CBWA 4R63A 2C2OB 2DR9A 1DKGD 4XK8C 2DGXA 4OYZA 1NK8A 4B9QA 1FJ7A 1HPZB 4NLTA 5KAKA 4I28A 1IKYA 1IR1A 4DR4J 2Q1LA 1UJ4A 2ZG6A 5KFHA 5F9LA 3UB5A 2CWKA 2YNIB 2KG0A 4FK4A 4DDFA 1VRUB 5KFWA 1N48A 3A5OC 2C3OA 1YHQS 4B3SJ 5AE3A 2PEHA 1EZZB 1FDBA 3MM9A 2DNGA 8ICHA 1H7XA 3IA0A 4ECUA 3ZZOA 5G4DA 2ZD1A 2K06A 5IZHA 2Z1HA 4KLMA 3CJQA 3DRRA 5LY3A 1ZYQA 3OYGA 5IXUA 4IEIA 2XY8A 3C16A 1Q18A 1BIZA 2ZNYA 2PN6A 3GQCA 4C4RA 4MT1A 4CZFA 4RPZA 1XS9D 1KTVA 2YNHA 4M3UA 2NRWA 3RJFA 2WFAA 3FZFA 2CH6A 1LWCA 2H5JB 1ZQVA 2YQEA 4YDUC 1U1KA 2WVFA 3BPSP 1V3ZA 4DSIA 1YX2A 1F9HA 2F5GA 4BHQA 2V5HG 2DH7A 2KM8B 1U47A 4CJWA 3PX4A 3U6FA 2VZ9A 4M3ZA 3DOKB 3TOQA 4B3TF 2J9CA 2YBVA 1SC3B 3M8RA 1RDBA 2QI2A 4CHOA 5ALFA 4OYOA 4LF9K 4UB6U 2F96A 3LGNA 5ETPA 1HMVB 2BQRA 2IJNA 3DRPB 4NA2A 2B9WA 1ASUA 5E41A 3I5BA 1YJ9S 4PGQA 3GYGA 2LYVA 3IR6B 4LF1A 4CHQA 4ZVRB 4USJC 4JI4F 1KHWA 3VA0A 2W7PA 1TP7A 2JZ5A 3C2LA 2ZDPA 4K50A 1CJKB 4Z4EA 2J4RA 4OX7A 3W8GA 2PZSA 2B4VA 3WK9A 5DQHA 4UUXA 2W24A 1NZBA 4BGDA 2P35A 3QSYB 5ETKA 2I7PA 2VGNA 3LK9A 1KXPA 3GWCA 4HVJA 4HH1A 2KE7A 5AQXA 1T0TV 2DNYA 4CD1A 3HMJG 3IAM9 1JK9B 2DHHA 1JXEA 2DY1A 4CEEA 4IR1A 5AKYA 1FDDA 4UOFA 4QWDA 3V6JA 2XMKA 1GT8A 3SLCA 2JR5A 3WHIA 4K4UA 1X42A 1EXQA 1VSMA 3ZSXA 2QWPA 1RACB 3FEZA 4LFCK 5HJYA 3CIPA 4OPJA 4UOGA 4DV1F 5ALHA 2KHCA 3MUMP 3ZEUA 3QU5A 5ALXA 3EDRB 2WOMA 4IL6U 4O9MA 1UFWA 3PJ9A 4CJLA 4DCJB 3T5LA 3L0QA 3VQ5A 3B6BA 4NZ6A 1BPYA 1JROA 3I32A 2P5OA 4LRBA 2ODGA 4KTWA 4RQ8A 3L7OA 3VR1A 4ECTA 2RUSA 1TE2A 1BWFO 4JD2B 4KLEA 1WLJA 1S3XA 3CCLS 5KG6A 2RQ4A 4KO0B 2BPCA 3W62A 2BX6A 3HSDA 2XMJA 2HG4A 4F5RA 1F1BB 4FJXA 2JEFA 2KM8C 4EP5A 4ED2A 1DK3A 2EDUA 4NWBA 1TAUA 2OTJS 5KT7A 2HIYA 5F3ZA 2VKQA 2LEPA 4IOXA