3EZ5A

Cocrystal structure of bacillus fragment dna polymerase i with duplex dna , dctp, and zinc (closed form).
Total Genus 208
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
208
sequence length
580
structure length
580
Chain Sequence
KKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords DNA polymerase I
publication title The Mechanism of the Translocation Step in DNA Replication by DNA Polymerase I: A Computer Simulation Analysis.
pubmed doi rcsb
source organism Bacillus stearothermophilus
total genus 208
structure length 580
sequence length 580
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2008-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3ez5A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 3ez5A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ez5A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3ez5A01
4CJRA 3QERA 5JS2A 2Z1GA 4RQ3A 1BCOA 4CF9A 2JEFA 4JS5A 2KQ2A 5SWMA 3KK3A 5KFAA 2C22A 1Z25A 2DY4A 3C1ZA 4ECSA 2IGIA 4DQQA 3O3GA 4ED0A 3C23A 2JGUA 4HVJA 2YKMA 4KHSA 2KN7A 9ICLA 1TK8A 1KFSA 3LP1A 4RW4A 4KAZA 2ISOA 3MABA 4YFKA 1GOAA 1BPXA 4RQ5A 3GV8B 1JLQA 1JIHA 4FLXA 5CHGA 4DS5A 4ID1A 2G8KA 1NK7A 4FJJA 3A2FA 3HP6A 4I9QA 2KFZA 4ID5A 2OZMA 3VQPA 3RMDA 4ED1A 4RG8A 3I0RA 7ICEA 4DL3A 4RQ2A 8ICRA 2ZUCA 5F9NA 2FBVA 4AHTA 4YD1A 4IRCA 5HHHA 8ICEA 3L2WA 4JUZA 4IR1A 4W5OA 1Z26A 1ZBLA 4KLEA 1VRTA 3LALA 3QIOA 2W8LA 3BQ2A 2B4JA 3VQ4A 3L2UA 5J2IA 2KZ3A 5IIKA 4M3TA 2O4GA 1UA1A 1MQ2A 2X74A 3OYCA 1RILA 1ZQJA 3CQ8A 3ZT0A 1QSLA 4XUSA 1WAJA 1SL2A 1ZQEA 8ICOA 3SCXA 3HPOA 2NRVA 4AHVA 3JPQA 4EEYA 4P4MA 4YMMA 2ZJ8A 7ICLA 4O3PA 2HHWA 1BPBA 4Z6EA 3LZJA 2BCUA 4FJNA 4BACA 2KTQA 3CFPA 2YNFA 4AHUA 1J9AA 4JLHA 4YXMA 1NOMA 2W9MA 1B43A 1NJXA 7ICPA 7ICQA 4KPYA 3O3FA 2PFQA 4Q43A 1KLNA 1W0HA 4F3TA 4DTRA 2A1SA 1NK5A 3SUQA 4PY5A 3Q8MA 3O4QA 4UQGA 3SQ4A 5E41A 3VQAA 3BQ1A 3VQ6A 3KHHA 1B22A 3KLIA 1TKDA 4B9SA 3V6HA 1Z00A 3PO4A 4ZH4A 7ICOA 3C5FA 3MEGA 5J2JA 3NAEA 1COOA 2DTUA 8ICYA 1RNHA 4UAZA 8ICBA 2BQUA 4F4YA 3H8JA 3TQ1A 1X9SA 4ECQA 4ZHRA 2BDPA 4XRHA 3V7JA 3ZSRA 4H4MA 4BWJA 3HYFA 1HJRA 4CJKA 1KVCA 4DSFA 3HL8A 4N76A 4Q0BA 4P4PA 5EWGA 4O5EA 3OYGA 4CJVA 4TSXA 3LP2A 4DTUA 1VSLA 7ICHA 1UOCA 4NLZA 1RT6A 2A1RA 1L3UA 3OS1A 4DQIA 4YD2A 3RH4A 2PI5A 4E0DA 1C1CA 4CFBA 3O4NA 5J0RA 3M8PA 4OGEA 4IQVA 3TFSA 2XY7A 1ZQQA 1A76A 5KFYA 3RJGA 4FK2A 2V4RA 1Y97A 2X78A 4Q8EA 1TFRA 4FJHA 3K75D 2BR0A 1S0VA 3NBPA 2XY8A 4W5NA 3UPQA 4TUQA 4FJ5A 1TVAA 1WSGA 4QWBA 3DOLA 5DGBA 4J2EA 3ZT2A 1KFDA 4QW8A 4FJIA 4N47A 2HNDA 1T4GA 5CJ7A 3ASMA 1ZQNA 2FBXA 3NFAA 3M9MB 3SQ0A 4E3SA 5KFTA 1KDHA 2VWJA 3TR8A 4M2YA 2C2EA 1SL1A 2LSNA 4NLGA 1HYVA 4Q8FA 1LW2A 2ASDA 8ICXA 1T3NA 2Z1JA 4EP5A 1TAUA 1XO1A 2DFEA 4Z6DA 1DGSA 1ZJNA 4AH9A 4CJ3A 1FKPA 4MFBA 4LZDA 5IIOA 4EBDA 1C7YA 3QEXA 1W9HA 3ALYA 4QZEA 1DTQA 4M3RA 4B9MA 2YV0X 3F73A 3IG1A 4Q45A 2HB5A 3F9KA 1RTJA 4R63A 4F93B 2GBZA 2AGQA 1C1BA 2KFNA 1ZQHA 3NDKA 3K4GA 4NYFA 8ICJA 1ZBHA 9ICEA 1D9DA 2W9CB 2G8FA 3PVXA 4IG0A 5CR0A 2D0AA 4CGFA 8ICLA 4RNNA 3LWMA 1N56A 2H5XA 1S9GA 5KFFA 4MEYA 3OYIA 3AVAA 3JPOA 3MFHA 1G15A 3GIIA 1ZQWA 3ETLA 5IIIA 4M04A 1RCHA 4RQ1A 5J2PA 4RPYA 3TAQA 4Y1DA 4PHPA 3ZDAA 4G3IA 1S6PA 4B8CA 4KN7A 4TURA 4Z4FA 2FPKA 4PGXA 4DSJA 5J0TA 4KN4A 3DLRA 3TFRA 2IAJA 5C42A 4YNQA 4IFVA 1YTAA 5CB1A 4OGCA 4KHUA 4QZBA 3BGRA 1KRPA 5JS1A 3HPHA 5CWRA 3IS9A 2ATQA 2RDJA 1NJWA 3NF8A 3G6VA 3H4DA 1N5YA 3PW0A 5T7BA 5KG1A 1QSYA 1ZQMA 4M6WA 3MEEA 3I0SA 3SI8A 1LWEA 3MDAA 3DM2A 4FYDA 4QWEA 1ASUA 3KKSA 3AO5A 3V6KA 3ZSXA 1Q8IA 1ZBUA 3PMLA 1U49A 3QETA 4ECZA 1RZTA 4RT2A 7ICFA 3K2PA 4O3QA 4X5VA 5KFDA 1KSPA 4AHSA 3RAQA 3KIOA 4CK2A 4FLZA 5D4BA 2GWSA 3ZSZA 3RB0A 5J0PA 4QAGA 4AHCA 3FFIA 2FBYA 4F91B 4I29A 3N97B 1T03A 3THVA 3QINA 2JLEA 3B0XA 4DL4A 5KGWA 4I2JA 5KT2A 1KTQA 3AVNA 4CIEA 4B9NA 3SYZA 1B9FA 4M41A 1BI4A 3VQ7A 4QWAA 3H08A 2IMWP 9ICTA 3E2EA 4O44A 1H38A 4P4OA 5J1EA 4F3OA 4J9SA 1KCFA 1JXBA 2I9GA 4HUGA 3ZSVA 3V9XA 4FM1A 4NYNA 4J9QA 1BPZA 4GVMA 2BPGA 3PW5A 3GQCA 1HPZA 1RDBA 4MF8A 5J0XA 1S9FA 2C2DA 3H8SA 1SUQA 4Y1CA 3LPTA 4B3OA 5DMRA 1KFTA 3IAYA 4J9PA 4RZRA 4RQ4A 1B9DA 3H4BA 3OSNA 1RT7A 2X6SA 1ZQXA 4N41A 4I2DA 4BXOA 4M0AA 2OPSA 4RW9A 2HVHA 9ICJA 4GC6A 3VQ9A 4O3SA 1JLBA 1L5UA 2VG5A 3AVIA 3M9OB 1X9MA 3U3GA 4OLAA 1U4BA 3QNOA 3RWUA 1XHZA 3K59A 2P5GA 5HLFA 2OPPA 3TABA 3UQ0A 1IG9A 5KFLA 2IHMA 4RUCA 4TQRA 2VA2A 4FZXC 2J6UA 4J2DA 4O3RA 4R66A 4CJUA 8ICIA 4CFDA 4DO9A 1WNSA 4IG3A 3BJYA 2IC3A 4QZ9A 9ICGA 4CJLA 5J2AA 2W9AA 1RTIA 1SKRA 1QSSA 3K5OA 3MXMA 3E01A 1K1QA 1KVAA 8ICSA 5KFCA 4Z4CA 3AU2A 3HM9A 4EYHB 4IRKA 1XSNA 3VN5A 5CY4A 2X6NA 4J9MA 4E7HA 3P5JA 2F1HA 3OS0A 3V6DA 3GIJA 3Q8PB 3GFKB 4ED8A 4CEEA 1XHXA 3SQ2A 5EOZA 4QWDA 2G8VA 3PW2A 4WE1A 3ZDBA 3NH0A 4FJ7A 5L9XA 4RQ6A 3OYAA 5DQHA 3PW4A 1KVBA 3NGYA 4DTMA 4DFMA 7ICVA 1JX4A 5KGXA 3RBDA 3OY9A 3HO1A 2R7YA 4B08A 4DSIA 8ICWA 4KHQA 4CIGA 1NKEA 1X1PA 5HMLA 1LAVA 3QZ8A 3TAFA 2VWKA 4M45A 4DTJA 4CJTA 4E1NA 1U48A 1S1WA 4CERA 3OHBA 4C8OA 4BWMA 2I5JA 2MAXA 1MC8A 2R8IA 5HP1A 4JV0A 5CYQA 7ICTA 4RPZA 2Q0ZX 4UBCA 3S3OA 3H8WA 2BGGA 4KREA 3NF9A 4C8KA 4QZIA 5J0OA 4M3UA 1NK6A 4IR9A 2IOCA 1S1UA 3VQBA 4CGIA 2ZUBA 4FW2A 4KHYA 2XY5A 3CFOA 1ZQYA 3NGIA 4CJ5A 3MAQA 3O3HA 5DG9A 1XU4A 4I2PA 2M9NA 4PUOA 3NGDA 3AO4A 2HW3A 3AVLA 1HMVA 4CEBA 5DB8A 4NM2A 5KFNA 4IQTA 3RRHA 3AA5X 4CECA 2BKEA 4HYKA 4M42A 8ICHA 1DTTA 4CF1A 1BPDA 5HP4A 3VQCA 1EXNA 3CM6A 5DQIA 1QQCA 4OLBA 4E7IA 3RRGA 4KLOA 4E7LA 1LWFA 5HROA 4ECVA 1UT5A 1ZQCA 2OWOA 4K4GA 3ZSOA 4BDZA 4JV1A 5FRNA 5DK5A 1ZBFA 3MXIA 5KRTA 2PZSA 3S3NA 9ICFA 3EW9A 1S1VA 2I1QA 2NRTA 3ITHA 1A5XA 2R8GA 1RBUA 4NCAA 1KLMA 3PO5A 1JXEA 4R8UB 4DL7A 4I9LA 2KZMA 4FBTA 3IM1A 2BANA 9ICWA 4PWDA 3TANA 5C5JA 2A1JB 2YKNA 3HXMA 2VA3A 1ZQVA 1NJYA 2DFFA 2P66A 1IH7A 4CEQA 4I2HA 2GV9A 1ASVA 2ZUDA 2RKIA 7ICJA 3QEBZ 1BIZA 1ZQUA 4B9UA 9ICOA 2WONA 5KFVA 1YTUA 4KB0A 1BL3A 4PGQA 1JMSA 3L3VA 1VSHA 3OYEA 3MR5A 4ICLA 4R64A 4KKOA 4TUPA 3MXJA 1WSHA 4I2QA 4DL2A 4KLUA 4DMNA 3DLKA 1HQUA 4FJLA 3OJSA 3KLGA 5DKWA 1TKZA 4IKFA 3IHQB 1TV9A 3OYFA 3ZT3A 3NF6A 4DU4A 4BE2A 4F5QA 3V9UA 2D0BA 1GOBA 1BCMA 9ICVA 1S76D 3N4MB 4FLUA 1ZQZA 3VA0A 4QWCA 2FMSA 3MECA 3ORYA 3Q8RB 3KK2A 1VRUA 1ZQPA 3GIMA 1VSMA 2C2RA 5J2DA 2ZTDA 4J9RA 2YHAA 3SPYA 4LY7A 4CHNA 3T5JA 1C0TA 2Z1HA 4CGHA 3AVHA 3V9ZA 1X2IA 4FLVA 3AU6A 3C5GA 4H4OA 4E7KA 2W9CA 4YFUA 1LWCA 1XSLA 1VSJA 3DI6A 5CZ1A 3C2MA 4YR0A 3C1YA 4HUEA 9ICSA 4EZ6A 1Q9XA 1CZBA 1EX4A 2ETJA 2E6MA 5HNKA 2VG7A 2AQ4A 4NXZA 4UB1A 1T8EA 4HUFA 1ZQBA 1HNVA 4DFKA 3T1AA 3DLGA 1WCLA 2XC9A 1AROP 3KTQA 4DTSA 1HRHA 1TL1A 3AO3A 1TV6A 4CJWA 4CEAA 2PY5A 1D8LA 1F21A 4FW1A 3HVRA 2AGPA 5KFHA 4B9TA 2EHGA 3RJFA 1EP4A 5I3UA 4KHNA 2RF2A 5HRSA 8ICNA 3MBYA 3GV5B 9ICUA 1DLOA 1VSFA 4I2FA 2J6SA 4F5NA 4ED6A 1JL2A 4GC7A 3M9NB 1I3AA 5F9LA 4Z6CA 4FK4A 4CJQA 1TK0A 3BQTA 4O3OA 5J0UA 3AA4A 1ZYQA 1QHTA 2NRZA 1CUKA 2YNHA 8ICGA 4Z4IA 8ICZA 1IKXA 3UXNA 4CESA 3HP9A 5EWFA 4KHWA 3V1QA 4MFAA 2C28A 1SKSA 2PFOA 4LSLA 1CZ9A 4JV2A 1IXRA 4JWNA 1S6QA 2HNZA 4DF8A 2BHNA 3WNGA 1FK9A 3RJHA 3B6PA 4DTNA 3I8DA 3HPGA 3PX6A 1Z00B 1WSEA 1U04A 5L1LA 4NLKA 4CJPA 2MUTB 2HHXA 3OJUA 4KI6A 1V9PA 7ICSA 2PFNA 4FZYA 2R8KA 1IKWA 5J0QA 4Q44A 3BDPA 4DQRA 2DFHA 3CFRA 5DB7A 1HUZA 2XGPA 4E1MA 1JLAA 4TUSA 4O3NA 2VA8A 5KG6A 3C2LA 4EBCA 4CEZA 5C24A 1U9LA 3OYMA 1JLCA 1EKEA 1RPLA 2O4IA 5KT6A 4PQUA 4YQWA 3C2KA 4YXJA 4M3WA 3AVMA 4CEOA 2NRWA 4CF2A 4KTQA 3C21A 2DPJA 4I2EA 2OA8A 4YMOA 2R8HA 5BOMA 1Y88A 4G1QA 3V9SA 3LZIA 4KO0A 4RUAA 2W8KA 2ZJ5A 3C6UA 4CJSA 4LH4A 4UB5A 2PFPA 4F4ZA 3HK2A 2WTFA 3WNFA 3SZ2A 4FO6A 1XSPA 3GV7B 4F50A 3PY8A 7ICUA 3AA2A 3AVGA 1B92A 3LAMA 5KFMA 4LD0A 1J53A 4YR3A 4IRDA 4R5PA 3JPRA 7ICRA 3SUOA 9ICKA 4FLYA 3KLFA 3K5NA 1RTDA 4RU9A 1ZQFA 2D5RA 4CEDA 1RXWA 4B9LA 1UWBA 2FLNA 4I28A 3ULDA 3KHGA 9ICQA 4DTOA 4F5OA 1ZQSA 4N56A 4YMNA 1UAXA 4CF8A 2ZTCA 4DTPA 3MR3A 4RPXA 4E7JA 2XCAA 2JEJA 1XWLA 3RH5A 5KFBA 4YVZA 4FJ9A 4E19A 4DOBA 3HSTB 1FKOA 4UB4A 4O55A 5IINA 8ICMA 3S9HA 2NUBA 5J2QA 2OZSA 4C8LA 2UVWA 4R65A 4XQ8A 4DFJA 5DB6A 1RT5A 5FRMA 1FXXA 5D3GA 2B5JA 1BGXT 4RW7A 4ZTJA 8ICKA 3ZSWA 4CFCA 3V1OA 2BCRA 4LSNA 4DS4A 8ICVA 1RDCA 2BCVA 2G8IA 7ICIA 2J6TA 4ECRA 3NE6A 3DRSA 2AJQA 3VQ8A 1T05A 1XI1A 1ZETA 3RAXA 4PHEA 4CK3A 1S0NA 3OYBA 4N5SA 3VQEA 4O5KA 2HHTA 4QZAA 4XIUA 4F5PA 4M3YA 1BVSA 3MR2A 4DLEA 4UBBA 4CFAA 2ZTEA 4XA5A 3RR7A 4QZDA 3G0ZA 4FLWA 9ICAA 3ISCA 4J9OA 4NLNA 2HVIA 4QZFA 4K4IA 2QK9A 3RMBA 4I2GA 3AVBA 4W5TA 5KFXA 2FC0A 3EY1A 3RB6A 3RR8A 4RQ8A 4CHZA 4JK1A 3CYMA 1T7PA 4FBUA 9ICPA 2NRXA 1S0MA 4O5BA 1HQEA 1U47A 3RH6A 1J5OA 3EZ5A 5J0WA 2Q3SA 2YNIA 4QCLA 3UIQA 4F4KA 3SI6A 3RJEA 3WNHA 2EX3A 4KLJA 3OVNA 5KFJA 5KFRA 4KTWA 3SNNA 4DTXA 4MFFA 4ED3A 4CHQA 4FJKA 1IKVA 4KITB 4J2BA 5KG5A 3HW8A 1WLJA 5KG7A 4CF0A 4CHOA 4M9HA 3V4IA 4DEZA 4KV8A 4J9NA 5KFPA 4W5QA 1LW0A 4R8UA 1BI4B 4UB2A 5KFGA 2JEIA 3KD1E 5TZVA 3H40A 2VG6A 4DOAA 1BISA 1CXQA 3OYNA 5DG7A 2JZBB 4DL5A 4F4WA 3L2VA 9ICNA 1C0MA 9ICIA 2OPQA 4DF4A 1ZQLA 5J2GA 4I2CA 4FK0A 5JUMA 4KLFA 1XS9D 1ZQDA 7ICMA 5SZTA 5HRRA 3QEVA 2Z1IA 4BDYA 3T19A 3PR5B 3ISNC 2PI4A 7ICKA 1RDDA 2P51A 3KK1A 2ZJAA 1WSFA 1QE1A 4PA1A 1CXUA 4GMJB 2RPIA 1WSJA 1C6VA 2FMPA 4AILC 4RW8A 2LYHA 4DSEA 5EWEA 3RJIA 4BXOB 4LVSA 4MQ3A 3M8QA 4Z4HA 4ED2A 3P1GA 1TK5A 2HNYA 2G8HA 3C6TA 3NHGA 3B0YA 4QZHA 3L2QA 3K5MA 4OPKA 5HMMA 1HYSA 4JRQA 5KFUA 4I2BA 4OKKA 4PHDA 3KLEA 1JKHA 2DPIA 3QESA 2YHBA 3OYLA 3T3FA 1A5WA 5DDYA 3EPGA 2ALZA 4QZCA 2XRIA 1S9EA 4O9MA 1D5AA 4K4HA 4UAYA 4F8RA 2XY6A 3ZCMA 2HHQA 2W9BB 4M9NA 4RNOA 8ICTA 2E4LA 3D0PA 2B21A 5KFOA 5K14A 4UAWA 4ECXA 4M47A 1JXLA 3Q8KA 3QEIA 4KLSA 3KHRA 5DLGA 5BPCA 3PW7A 4KLIA 4LZGA 4I27A 2ASLA 1L3SA 3Q8QB 3ZD8A 3MGIA 4AHRA 4Z4GA 2GUIA 4IBNA 3T5KA 1K6YA 5J2MA 3V7LA 4Z0UA 1GOCA 4BE1A 2PYLA 4RNMA 3PUFA 3T5HA 3OSPA 8ICUA 1VSIA 4CE9A 3ZD9A 3CM5A 4J9KA 4W5RA 4Z4EA 1K1SA 4BGDA 3UXPA 2AGOA 4FM0A 3NTUA 1BQNA 3V1RA 1ITGA 4YCXA 4DL6A 3ISBA 3TARA 3LP0A 4IFYA 2FMQA 3OGUA 5CA7A 2P5OA 2ZE2A 4I2IA 2Y1JA 4FS1A 3RJJA 1EXQA 2IHNA 4PPXA 4C8MA 4OKEA 5J2CA 3RMCA 1RYSA 4UB3A 4F5RA 4DFPA 4JS4A 1JN3A 5KFIA 3EYZA 1CEZA 4M9JA 4M9LA 3AO2A 3QZ7A 3EPIA 3AA3A 2IS3A 3TI0A 1ZJMA 3OYDA 4RW6A 4PHAA 1TVRA 1MSWD 4HCBA 2F96A 3NF7A 2VANA 3SPZA 2Y1IA 3AUOA 3RBEA 4QW9A 4KTZA 1VSDA 1N6QA 3DLBA 5HHIA 4QOZB 2E6LA 3NH1A 1U45A 4IQUA 1RBTA 1RT4A 3HVTA 5KRSA 3TAEA 1KEJA 4DSLA 5KT7A 4ELUA 2D0CA 4FM2A 4DOCA 5KFQA 4K8XA 5HRNA 3L8BA 4TQSA 2MUTA 4FLTA 3KD5E 3OYHA 3MDCA 2AQ0A 5KT5A 3KKRA 3SUNA 4DQPA 2ITGA 3VQ5A 3ZSQA 3UQ2A 1I39A 3KHLA 4LH5A 3U6FA 3IRXA 3PMNA 4KRFA 3JSMA 3HX0A 2V4QA 1VSEA 4L8RB 8ICQA 1DOQA 3GDXA 4KLTA 3TWHA 5KT3A 4J9LA 5J0YA 4CCHA 4C8NA 1RYRA 4OKJA 2FPLA 1RT3A 3K57A 4GW6A 3DRPA 1RDAA 4NCGA 4YG2A 3K58A 4F2RA 2BCQA 3V7KA 3SJJA 2OPRA 9ICCA 2FLPA 2V9WA 3QIPA 1IM4A 3G6XA 2PYJA 3CG7A 4F4XA 5EU7A 4IQWA 3DYAA 5KFKA 1JLFA 4PH5A 4MEXA 4HHTA 9ICMA 3AV9A 4OPJA 5KT4A 2BCSA 1HYZA 4KLMA 3LK9A 3EWAA 1BPYA 1Z3EB 4K8ZA 3TAMA 1C0UA 3B6OA 3ZDCA 2OYQA 3AVKA 2UVVA 1TKXA 3M8RA 1TGOA 8ICCA 1IO2A 1RT1A 4KI4A 3HWTA 4O0JA 1UT8A 1A77A 5J2HA 5I42A 1O1WA 1LV5A 4ECTA 4CK1A 2HMIA 1S5JA 3V9WA 4GXJA 3V6JA 4CJ4A 5KG4A 3VQQA 5J2EA 4O5CA 1SV5A 7ICGA 3LWLA 1ZQGA 3G10A 4RT3A 1S1XA 3C94A 3SUPA 3ZDEA 1ZQAA 1S0OA 4DSKA 9ICRA 3ZSYA 3KJVA 5L1KA 3DRRA 1SL0A 5D49A 3U3YA 3JPTA 3PX0A 1RXVA 2ISPA 3ZT4A 1ZQIA 4KB1A 1QS4A 5BOLA 3JPSA 1L3VA 1NKBA 3QO9A 2IDOA 4MFCA 5CP2A 1LB2B 3QE9Y 2XCPA 5DGAA 3TAPA 4FZZA 2BPCA 4CIFA 4F92B 4QZGA 1JLGA 1SZPA 3RJKA 5CYMA 5HRPA 5DLFA 2G8UA 1JL1A 1WAFA 2ZD1A 1RBRA 2WOMA 3MFIA 4GXKA 1ZQKA 3HT3A 2P1JA 2PXIA 4KLDA 3BQ0A 1R0AA 2AU0A 2FLLA 4FJMA 1CLQA 5KTQA 9ICBA 1EETA 5DBCA 2ASJA 5KFEA 1ZBIA 5IIJA 3JPPA 4DG1A 1HUOA 2ZQBA 1NK9A 1LAWA 3PX4A 2HHUA 3HJFA 4JWMA 1S77D 3LPUA 3NH2A 4YR2A 1VK0A 1RBSA 3FYHA 4FS2A 3TAGA 1PZNA 4HTUA 2XHBA 3QEWA 1RTHA 1ZQTA 5L1IA 5L1JA 4ECWA 3QEAZ 1S10A 4B8AB 5KG3A 3SV4A 3LDAA 3NCIA 3RB3A 4KLHA 3Q8SB 1NOZA 1WCNA 4QZ8A 4H8KA 1S1TA 2B6AA 3VQDA 2W42A 4YP3A 3C95A 2FPMA 4FJ8A 1ZQOA 5DDMA 1QLNA 5FROA 4ECUA 3OS2A 4FCYA 4ED7A 2BPFA 2KW4A 1Q9YA 4J2AA 4FJGA 3DLHA 4KLQA 3LP3A 2QXFA 2F8SA 5J0SA 2RDIA 4CEFA 2BQ3A 3L3UA 4EP4A 1D8YA 4M9GA 3M8SA 8ICPA 1WN7A 3AO1A 1IKYA 1X9WA 2F8TA 4ECYA 3AVJA 3K5LA 4HCCA 2JZBA 2DFLA 4DU1A 1J54A 1REVA 2F1IA 1NK0A 2HHVA 3LANA 1NK8A 1D9FA 1NJZA 3V81A 5J2KA 5DQGA 4Z6FA 4YN4A 1BIUA 1TKTA 1RT2A 5IIMA 1NOYA 3FDSA 1HNIA 4FXDA 2XGQA 4ELTA 1BQMA 4DWIA 3NGZA 2YNGA 5DBBA 5J2FA 3MR6A 3ISDA 4NY8A 9ICHA 5FDLA 4DLGA 3UXOA 1MQ3A 3PNCA 4DQSA 4CGJA 3DLEA 5DB9A 3KLHA 2HHSA 4CJEA 3SQ1A 3D45A 4O4GA 5KG0A 1RBVA 1XC9A 3OHAA 3ZDDA 4RQ7A 2ATLA 4GXIA 2IA6A 4DU3A 3G6YA 3QNNA 1TAQA 5CZ2A 3RMAA 3JYTA 4OJRA 3LAKA 4MF2A 1UA0A 4EYIB 1BPEA 4M6WB 4CGGA 1ZQRA 1YT3A 5HBMA 4CHPA 3H7IA 1HJPA 7ICNA 2IBKA 3SV3A 2BGWA 4M3ZA 2P6UA 3RTVA 1L3TA 4I7FA 2BQRA 1C1AA 2FBTA 2UVUA 2W9BA 1NKCA 4IDKA 2QKBA 2R8JA 3PR4A 1VSKA 4FJXA 4CGDA 3AVCA 4BE0A 2RN2A 4CHYA 2XO7A 4M3XA 4KMUA 1ASWA 4NM1A 4FVMA 4EBEA 5KFWA 3QEPA 2QKKA 3JPNA 9ICXA 4RQ0A 3GILA 2F1JA 4ZTFA 5KG2A 4O0IA 3WNEA 3RB4A 1YVUA 5C25A 3ZT1A 3T5LA 3AVFA 5J29A 3L2RA 4E89A 2P6RA 5DBAA 5IILA 5KFSA 4JRPA 2UVRA 3MGHA 1WSIA 3MEDA 4I2AA 3S3MA 5KFZA 4OVLA 4KFBA 5J2BA 1QTMA 4PGYA 3OYKA 2A1JA 2KZZA 1BHLA 1S97A 3V72A 4NCBA 3GIKA 4Q5VA 1A5VA 1NK4A 5J2NA 5DG8A 3Q8LA 1TL3A 3P83D 2G8WA 5D46A 2BE2A 1MU2A 4B9VA 3VA3A 3DOKA 4GLXA 4P2HA 4BDPA 3DMJA 3QLHA 8ICAA 1SKWA 8ICFA 1JLEA 4KLGA 4EZ9A 4ELVA 4F2SA 2JEGA 4CJFA 3OYJA 5KI6A 4KLLA 3PV8A 1N48A 3LDSA
chains in the Genus database with same CATH superfamily
2AWZA 5JS2A 2OUGA 1T95A 3K2YA 4CF9A 2JEFA 1URJA 2KQ2A 5HLFB 3KK3A 2C22A 2DY4A 3C1ZA 4I64A 2GWKA 3DXMA 1NDCA 3W2VB 2YKMA 2XSFA 4KHSA 2KN7A 9ICLA 2Z7JA 5C2FA 4QYZJ 2ISOA 4NLBA 2QARB 5HO4A 2J76E 1GOAA 1YG0A 1O8BA 1RQLA 2YX1A 2PFFB 4IJAA 3OFGA 2WC9A 2W40A 4FLXA 4JMUA 2NZTA 4DUZK 5CHGA 1UTAA 3C15B 3T1HK 2GX9A 2G8KA 4OZ3A 2PFUA 1NK7A 4ES2A 1WEZA 2NSBA 3HMJG 3VENA 1T9VA 1UL3A 2HEKA 3VTHA 3EUNA 2ZZMA 2HOEA 4USUA 1I6JA 4IR1A 4W5OA 4K4WA 1Z26A 1FRIA 4OPAA 3QIOA 2BXJA 3I6PA 3BQ2A 2ZITA 4QBUA 2BKPA 2KZ3A 5IIKA 4M3TA 2O4GA 4I6AA 2RQ4A 4NWBA 2AHOB 1N88A 3OYCA 1RILA 1ZXOA 4UOHA 1DQ8A 5BYSA 1WAJA 4C1NK 4NA1A 2YB1A 5ALEA 4IYQA 3SCXA 3NG8A 2HOQA 2E1EA 1YZ7A 5AKKA 1S1WB 1U8SA 2AV5A 5E79U 1WDDA 4GMKA 2QWOA 4DR2K 1J5EJ 5CYQB 2DHHA 4A57A 5A2QO 3LZJA 4C7YA 3HHNB 4MO5A 1PJ6A 2FSJA 3WK8A 4BACA 4DPYA 1RDRA 1RE1B 2RRAA 4JLHA 3FBCA 4YXMA 3NGRA 2W9MA 4GVBA 1NJXA 7ICQA 2V0NA 5ETRA 3AL0B 4DR1F 1VQ5N 3O3FA 4JK9A 2PFQA 4KR0B 3C8YA 5AICA 4PY5A 4PUOB 4CZEA 1SC1B 3FNNA 4UQGA 2D3UA 1SQKA 3BQ1A 1YBUA 3D7EO 1MW7A 2LMRA 1PVPA 1B22A 3KLIA 4C2MA 2VHGA 1Z00A 5AI5A 7ICOA 3BBCA 2V2QA 1XERA 4MN4C 3S1TA 1RNHA 5AQNA 4NI2A 3MUMP 1WHWA 4ECQA 5E2QA 2RRBA 1OVQA 1WHVA 4XRHA 3LDPA 2AP1A 4OYMA 1WF0A 1HJRA 1KBRA 2BM1A 4DSFA 2ACMA 3HL8A 3U1MA 1XMOJ 2KM8B 2RP5A 5EWGA 4K59A 4Y2KA 1NCLA 3BDEA 4TSXA 3LP2A 4DV0J 3CD7A 2NXJA 1UOCA 2A1RA 3VGMA 1L8LA 1DY3A 5IC6B 3U02A 1ZD5A 4YD2A 3RH4A 1HBMA 1T6CA 1HNXJ 2K89A 4WBFA 5J0RA 2QN6B 2XHWA 4OGEA 1OS5A 3TEHB 4IQVA 4LBPA 3BF1A 3TFSA 4WIIA 5DS7A 4KT0C 1RWUA 4QJVA 2X78A 2F8KA 1HNZJ 3DC2A 1YSJA 3K75D 1QZ6A 1N61A 2D3ZA 2VODA 3UPQA 4F7VA 1QQ7A 1TVAA 5B5EU 3ZT2A 4GO5X 4ZLPA 1ZQNA 2HLUA 3NFAA 3M9MB 2F76X 3CIMA 3HHKA 1KNZA 3R2DJ 5KFTA 4E3SA 4QNLA 4OYIA 2NXNA 5JLHA 2E5JA 3MX2A 1HQ2A 1SL1A 2XBPA 2JHEA 1C20A 3CJ0A 3M2UA 3ATUA 3UDCA 2MB0B 8ICXA 4USKA 2OO4A 9ATCB 4OX7A 2DFEA 1J6ZA 1ZJNA 1KHVA 1H6KX 1KQQA 4UW9A 4EBDA 4K0KJ 1C7YA 1RKIA 4NOHA 3ALYA 3QSYB 3M1FA 4HH1A 3MOJB 1UW9A 2W2NP 3F73A 1X4CA 3IG1A 1RT4B 2HB5A 4CRXA 4R63A 4FWOA 4DCJB 1WOPA 1ZM3A 2YX6A 2KFNA 1XR5A 1EKRA 1X8DA 3JSRA 4DI6A 4I0WA 1D9DA 5B0BA 3PVXA 2D0AA 3QU9A 4RNNA 4MK7A 3CO9A 1OYDA 3IRXB 2XMJA 3JPOA 3MOZA 3MFHA 2XQCA 3FUYA 4ANCA 2DNOA 2RVJA 3GIIA 5IIIA 2HQCA 3TAQA 5ETQA 2B9YA 2KU7A 4DSJA 4LFCJ 3CDAA 4KN4A 3DLRA 7FDRA 3TFRA 4C80A 2IAJA 5CB1A 4OGCA 4QZBA 3BGRA 4XAKA 3MD3A 4RR5A 4C4RA 3MM8B 1U2VB 2NSCA 1NJWA 4O4RA 3H4DA 3CC2S 3THTA 4CF3A 1U6FA 5HVGA 1N5YA 3PW0A 3CDWA 2V52B 5T7BA 2R18A 3PACA 4OHVA 5KG1A 3DYAB 2CPZA 3BSAA 4KH5A 4OZ5A 3T1YK 1HHQA 4AE5A 1NGGA 4AF1A 3CCLS 3ICXA 1ASUA 3KKSA 4UOFA 4EHTA 3AO5A 4FPRA 1AUSL 3ZSXA 1Q8IA 1ZBUA 4LR8A 5BR8K 4ECZA 5FD1A 4NXNK 4L3KA 5KQDA 7ICFA 1CQMA 4O3QA 1XR7A 1WC4A 2BM0A 3S6EA 2VBWA 2WVEA 3SCLE 2XLIA 3RAQA 3P5TL 1RT1B 2GA7A 3OVSA 2VOPA 3ZSZA 4A8OA 4AHCA 2GX8A 3FFIA 2I1RA 1NSKL 4I29A 2HSZA 2CNNB 3CJCA 2CQ4A 6AT1B 3B0XA 4FWLA 2MHNA 1N33K 2BKOA 1UVMA 2QC3A 4ZJQA 3SYZA 1Q81T 3DN9A 4MK9A 1ZH5A 2WSEC 3UDEA 2IMWP 4H5WA 4O44A 1UWAA 5J1EA 2UXCK 3TEGA 3T9ZA 4HUGA 3ZSVA 3DRRB 2X1BA 1SIZA 4FM1A 4J9QA 2BPGA 1SC3B 4DV6J 2C3UA 1JLAB 4F71A 1WKJA 4XO0A 4LF4F 3N6MA 4P72A 1SUQA 3CJAA 1U1KA 1VQSA 2UP1A 2M4MA 4MKYA 3QAUA 4OZ0A 4Y65A 2CQ1A 5ALOA 2GV1A 2QFIA 4ANDA 2D0PA 2W54A 3BQ7A 4RQ4A 1B9DA 3H4BA 3B78A 2E8NA 1RT7A 2X6SA 3M1VB 4WYWA 3ZETA 1Z05A 4M0AA 4KO0B 2HS4A 2WVCA 4GC6A 2QWLA 3VQ9A 3IWNC 3FSIA 2Q2RA 1L5UA 2YMPA 2YVSA 3GSIA 5CEHA 1FRXA 1U4BA 1E4GT 2A41A 1XMQF 3QNOA 3RWUA 2YJFA 5HLFA 2IOHA 3SMVA 3TABA 3UQ0A 2HFUA 1B0VA 1ZXIA 4IZ9A 4ZVFA 4R66A 5M1NA 2QARA 2O3DA 2X51A 1D09B 3WK5A 4L74A 9ICGA 1O5JA 4CJLA 2VFRA 1F9FA 5J2AA 2CQPA 1U26A 3CI5A 4H5VA 1KTVA 2YKQA 2F4VJ 3TADC 1K1QA 5KFCA 1ATSA 3EVWA 2ASPA 4C3LA 2X6NA 9RUBA 3P5JA 1RAJA 3LTOA 1KQFB 2E9ZA 2NUUG 2DGOA 1YIJS 5FIIA 1IIPA 2W25A 1FKOB 4X4PA 3Q8PB 2VC0A 5GAGP 1Q5VA 3G8QA 4Y2TA 1IR2A 1J5EK 5J8YC 2VFVA 1XHXA 3D6TB 5EOZA 1NSAA 3ZDBA 4FJ7A 5L9XA 3THWA 2QLBB 5LSRA 4DV7F 2OYYA 3LDQA 2WB1C 3TR5A 2PAVA 4DSIA 1Q82O 1X1PA 1IBMF 4JI1K 2R42A 1REVB 3E0FA 2K8BB 1Q79A 3QZ8A 2VWKA 1TKTB 4CJTA 1FNXH 4ISGA 1S1WA 4C23A 4C8OA 3OFEA 4BWMA 4Q2LA 5GAEI 3OBWA 2MAXA 2C2MB 2CQCA 5HSPA 5CYQA 4X65J 7ICTA 2QA4G 3O9QA 3S3OA 3H8WA 3MCOA 2CGJA 2AJFE 4C8KA 1GLLO 1P9YA 3VQBA 4CYUB 2FVCA 3UD5A 4UW2A 2HOFA 2ZUBA 5F8LA 4AL7A 2CNKB 1XMOK 1OO0B 2XY5A 1ZQYA 3HSDA 3M6GA 4TVAB 3M7DA 5BPNA 3B8AX 5CD4H 4R79A 2DTJA 2M9NA 4PUOA 4WK3A 3BY5A 2MA1A 3FAHA 1H98A 3TX8A 3AVLA 2YH1A 1HNXK 4DR3J 5D4PA 3FFKB 4NM2A 5KFNA 3AA5X 4CECA 3HFZB 1WG5A 5DM7Q 4YOEA 2LQ5A 3VQCA 4OZJA 3FJ2A 4L3NA 3CM6A 3C14B 4YDUC 1HNZK 5E26A 3DDIA 4E7IA 3RRGA 2DNQA 2ROEA 4LR7A 3IMXA 3KUHA 2M52A 1O08A 4ECVA 1UT5A 2OWOA 4K4GA 1VK8A 5FRNA 3MXIA 1TMMA 4RNFA 5KRTA 3BS9A 2PZSA 1XN9A 9ICFA 3DXKB 4PL7A 3EW9A 2R7UA 2OD4A 2ZH3A 4NCAA 1KLMA 5HJYA 1LW0B 4X4OA 4DL7A 2KZMA 4IUFA 1P1LA 4RLEA 1OSDA 2E20A 4KFBB 4Z94A 1KS2A 1E4FT 5ALKA 1EJ7L 4EFAC 2P66A 5C0YA 3CD6S 2UU9J 2F9TA 3MN5A 3CTRA 3ZFVA 3D0GE 2GHVC 4IKAA 3CCJN 3TVKA 2IDLA 4B9UA 1VCTA 3AM9A 4ZP6A 1O6XA 5EX3A 1BL3A 4KB0A 3H0PA 1JMSA 3D3CJ 4TUPA 3H5SA 3MXJA 2OP5A 5A8WA 2VPYB 2Q6CA 4DL2A 4KLUA 2PMZD 4DMNA 1NNEA 3QSIA 3IWLA 3WU2U 3OJSA 1TKZA 2APOA 2VFUA 3IHQB 3OR2A 5M2RA 1OPIA 2KG0A 2ADCA 4KHPJ 4BE2A 3M6UA 3NS5A 4HEA9 2D0BA 1SC4B 4ILRA 1BCMA 3B54A 4K2JA 3LP1B 3N4MB 2K2PA 4O8KA 2E3TA 2LEBA 2FMSA 4LFCK 3MECA 1KHWA 4MJKA 3ORYA 2NYIA 1S6OA 3S41A 3E3XA 5J2DA 2H4WB 1K0TA 4OI6A 3T5JA 1C0TA 1AFJA 1YAGA 1EAYC 3AVHA 3VF2A 3SSRA 1NB7A 3ZX2A 3W64A 1WOSA 4A8YA 1Q5YA 2JXJA 4E7KA 1M5OC 4XPEA 3OTBA 3KWMA 3CJ9A 3C2MA 1KONA 4GNIA 3MM5B 2E6MA 2AQ4A 1T8EA 1HNVA 3T1AA 3DLGA 4RTFD 3ZZTA 3FGVA 1MDUB 4F67A 2VH7A 1YVNA 4DR6F 3PRDA 4JP8A 3VAFA 1Q8BA 4WZMA 1GLJO 4ILLA 1TV6A 4CEAA 2ZH1A 1ZZNA 2FGCA 4UTGA 1FXRA 1YJRA 1F21A 1MA7A 4ZVSB 2BOPA 2IM2A 2E2NA 2AGPA 1EARA 3MM8A 3A3OB 4ZN1A 4EI2A 1YGYA 2A18A 2RF2A 5HRSA 3LP0B 3GV5B 2E7XA 1VSFA 4I2FA 2UUAJ 3TP2A 1CJUB 4H4KC 3KKAC 4CJQA 2ZDOA 4O3OA 5J0UA 3AA4A 2E5IA 3GYXB 2D0OA 1TQLA 5LMUF 4Z4IA 1IN0A 4RW6B 1N36J 2JH7A 3HP9A 2ZXHA 4LF9F 2UXDF 2U1AA 3V1QA 1SKSA 3D0IE 4A47A 3R5BA 2H5IB 3K7RA 3EVMA 1A6SA 2BHNA 1LOUA 3WNGA 5AKYA 4DCCA 2A1AA 2P9IB 3GP9A 3ENBA 3HVTB 4K50A 4YOTA 2W03A 4LF7J 4OX6A 1WSEA 2QE5A 3RF9A 2WHOA 1ZOTA 3J7Z5 2HKEA 4M5DB 4DPTA 1IKWA 3BDPA 3DV9A 2IYIA 2DFHA 2DGXA 2HF3A 1HUZA 1JLAA 4TUSA 4O3NA 1LKYA 2VA8A 4DN9A 3A5OC 1SJ4P 4CLFA 5AK6A 2V67A 4UY8O 1PKUA 4BRLA 2O4IA 5KT6A 1HI8A 3C2KA 2RDDA 4M3WA 2NRWA 2XIDA 2DT9A 2Y1LB 4CF2A 4A8KA 1RT3B 2R8HA 5A6PA 1FFUA 3NWGA 1NPPA 2F4VK 2GIRA 3LZIA 3M8PB 4KO0A 5AQGA 3CCMS 1TL7B 4TLRA 4GKKF 3C6UA 2CADA 2CXEA 3N7PD 1WACA 5L1MA 2KN4A 3SQIA 2BDUA 3PKYA 2PFPA 5KAFU 2LQBA 3MD1A 2EH9A 3NBPB 4OI2A 2EI5A 3GV7B 3AVGA 4CVNE 3QUBA 1FF2A 2P9GA 1J53A 2I6XA 3P8BB 5LM7E 5H1SV 2HNDB 3MN6A 1EB0A 1SQFA 2WF7A 3HOSA 1MN8A 5JXSA 2D5RA 4ERDA 2LXIA 5IFMA 1X6IA 1JJHA 4I28A 4CT8A 2BE9B 4F5OA 1ZQSA 5HL7Q 3PEHA 1KVJA 5GMKa 3NOGA 2MZQA 2F7TA 1FVSA 5I42B 2JEJA 4GRSA 1YRUA 4DUZF 3AQOA 1XWLA 3L3FX 3RH5A 5KFBA 1S22A 4K8RA 4DOBA 1FKOA 4WQ4C 3MGJA 4IXCA 3O08A 4OZ2A 3LPYA 3CCLN 4X65K 2OZSA 3HHLC 2MQQA 2UVWA 5A0YB 4DFJA 3FZHA 4H0XB 3NXZA 4JKEA 5ALRA 2FSNA 4ZTJA 4UT4A 1VAZA 1CC8A 1DKGD 3GJQB 2HWHA 3SR6A 4OO1J 1N60A 2Q97A 3CJQA 3GDQA 4LF4K 2XULA 8ICVA 2BUPA 1PVRA 1IR0A 4JI7F 2G8IA 4M5JA 7ICIA 4ECRA 1FJ7A 4YS2A 2V7YA 4UUWA 2AJQA 4PWUA 2AMCB 1K44A 2KD1A 1ACMB 3RAXA 5CHCB 4PHEA 1R0AB 4CZJA 4CK3A 3OYBA 4N5SA 2ZGYA 3VQEA 5GAHU 2HIYA 4A8SA 2HHTA 2GQQA 4M3YA 4NL9C 2CQHA 3QGIA 3AD8C 3MR2A 4FPBA 2MY7A 4UBBA 2ZUGA 4CFAA 4XA5A 3RR7A 4QZDA 3FVYA 5AFUA 5GIPA 3I96A 3FK4A 4FLWA 4PQAA 1RHUB 2CVIA 4ZMMA 4J9OA 3OFFA 5F2RA 2IY5B 3EZWA 3VAJA 4WFBL 2QK9A 3RMBA 3AVBA 3KMSA 3RB6A 2MLZA 3GU3A 1F0MA 3CYMA 2HVDA 1T7PA 4FBUA 3TUIC 2QFJA 4ZCKA 2NRXA 1HQEA 3A8EA 5FP0A 3L95X 3CETA 3RH6A 2C2NA 3PIOL 1KC8O 2UU9K 2DGTA 2J7KA 5J0WA 2HQ3A 2YNIA 2CH6A 2IJFA 5GAHI 2MSSA 1YXQA 4ZVUB 2EX3A 1SWVA 3OVNA 5KFJA 5KFRA 2W41A 1HUXA 4DTXA 1JJCB 3E9OA 4MFFA 3CCUS 3VCBA 1EWRA 3VAHA 1B4FA 2KVSA 1GTEA 3AHPA 5KFPA 4ED4A 5JVHQ 1LW0A 3PG9A 2HHHK 2JEIA 2CPJA 3H40A 1BISA 4B9QA 4DX5A 1CXQA 4CZLA 5DG7A 1HIWA 1TE2A 4DL5A 2RILA 4O3MA 9ICIA 4E98A 2PDAA 3PDNA 4CZCA 3M8ZA 4I2CA 2YWKA 4FK0A 4AXJA 7ICMA 5DRKA 1RLDA 3QEVA 2Z1IA 3DU5A 1NGEA 4CNZA 4BDYA 2CJKA 3EGWB 2MU2A 4F36A 3QT5A 3T19A 3PR5B 3H1QA 5FDLB 4WCEQ 1UMJA 1QE1A 4PA1A 1WSJA 1C6VA 3L0QA 1FEZA 3RW7A 4HT5A 5AZIA 2AEJA 3OL6A 3P1GA 2QLJB 5AXNA 3NHGA 3J7ZT 2AZ1A 4CM2A 3K5MA 4OPKA 2FVRA 5AK3A 4LF8J 4P73A 2VL1A 5DO2A 1SS6A 2G5HB 4P2MA 1N62A 2DPIA 4BR5A 3OYLA 5DJBA 1VK3A 3SJHA 2O8BB 2OPPB 4DV4J 2N4CA 2QA2A 2ATCB 2CAJA 2MGZA 2NR0A 4L72B 1VQ8N 3E9LA 5J1NA 2BMBA 1D0EA 5AIAA 4I7FB 3TTFA 3GWCA 3ZCMA 2OEKA 4M9NA 4ANEA 3DWLA 8ICTA 4X64J 1R31A 2E4LA 1NGIA 1RHRB 1HBUB 5KFOA 2B7BB 2P9EA 1NLVA 2YPZA 5ETMA 4ECXA 4NO7A 1ELOA 4DUYJ 4URSA 2JH3A 4KLSA 1SV0A 2MJNA 2P9NB 3R27A 3A0IX 2FC9A 2UUAK 2SXLA 3PTWA 2JZ5A 1ZD2P 2LQJA 3THYB 4AHRA 1LXJA 4Z4GA 4IBNA 3AH6A 4U6PA 5BR9A 3V7LA 3R2CJ 1XQSC 4XEIA 4DHYA 3CQXA 1N36K 3PUFA 3T5HA 1L7MA 3OSPA 8ICUA 1XK8A 2KO1A 3M1YA 2IA0A 2VFSA 2KK0A 1BUXA 3TZWA 4BGDA 3UXPA 3NTUA 2L9WA 4BR2A 3FBEA 2XS7A 1FJGJ 4DL6A 2K3IA 2EC0A 3ISBA 3LP0A 1BA1A 2FMQA 4P74A 1FESA 2NLWA 3HHLD 5B0DA 2ZE2A 1JLEB 3FEXB 5IT0A 1K73T 1H7WA 1CJUA 4MYTA 1Q86T 2MZRA 3L09A 1BO5O 2M8DB 5J2CA 1FIQA 1RYSA 3CNQP 1HKBA 4JS4A 4F0KA 2UXBJ 2LEPA 3QZ7A 3EPIA 5IQQA 3POTA 3CD6N 4RW6A 2DGUA 2DKOB 2F96A 2WF9A 3GG4A 2NO4A 3P3DA 4IOXA 2Y1IA 2ZM6F 3B8HA 2DB1A 2CA9A 3CD5A 3TUZC 4JI8J 4WKRA 4LIRA 4DV3F 4H5RA 2E2PA 1VSDA 1DRZA 5HHIA 3QT7A 1VIXA 4YB5A 3HVTA 1HMVB 4WP9A 5AQQA 5AK4A 4ELUA 4JI4K 4FM2A 5KFQA 3L8BA 1ZA2B 3W9JA 1DTTB 4I6WA 5AI9A 4M5DA 2ZIUA 1YX2A 3I0RB 3J80U 4DQPA 2ITGA 4ZA1A 4CNYA 1I39A 1AT1B 1RA7A 2E44A 1LWFB 2WCXA 3VR1A 2HIQA 4C9DA 1LCUA 3HX0A 1VQNS 1ZM4A 2XMUA 3OXFA 4L8RB 1K47A 1VRTB 1S79A 1H0HB 2O5DA 3R9PA 3GDXA 3TWHA 2JL9A 5KT3A 3DXBA 2E5LK 4CCHA 1SXLA 2ZJRQ 1AXQA 1FWPA 2FPLA 1RT3A 4OKJA 1N5TA 3M6VA 4GW6A 3DRPA 4OMFG 5HQMA 5IM0B 3SJJA 1RLCL 2C2ZB 2FLPA 4MYUA 2U2FA 2VDIA 4DPOA 3ISZA 1TL7A 3CWJA 3G6XA 4FXVA 2QA4S 2PYJA 1QAXA 5H9EJ 5E33A 5KFKA 3P6YC 2BE7D 4OJGA 4PH5A 4PL2A 4C6AA 2QI2A 4ZJOA 5AQWA 5KT4A 2BCSA 2XTJP 4JD2B 3LK9A 3EWAA 2HOIA 4K42A 3BKTA 4BQLA 2IM3A 1B0TA 3BKUA 3I5AA 2MDAA 2H1YA 2HPUA 1TKXA 3M8RA 4JYAF 4LF5K 1Q8KA 1R7IA 2FJAB 1XUPO 1NI3A 2D3OR 1RI7A 4KHMA 3H25A 2ZIVB 2KVQE 1HQUB 4IOAQ 3VHQA 5M1PA 2XZTB 5LXYA 3GIRA 5IWAJ 5I42A 4KX3A 1O1WA 4PL1A 4ECTA 4CK1A 2CQBA 1VQKS 3T79A 3BF3A 3VQQA 3MEGB 1X9JA 4RWXA 1DGKN 1SV5A 2W2PP 3IFEA 4C3MA 3G10A 1JRPA 4B3MF 3ZDEA 2CQDA 3RG6A 3HULA 1P8GA 1S8OA 3ZNUA 1SL0A 4I69A 3JPTA 4YDXA 1KDNA 1B0PA 3PX0A 2NYHA 3W1YC 3HZGA 3QYYA 1ZQIA 5BOLA 2KP7A 3KUEA 2HMXA 2VJ5A 2ROPA 2IDOA 2I8EA 3CUNA 3QE9Y 5DGAA 3QQCD 3RYLA 2V2VA 5BN8A 1VQPN 4HTJA 1VQLS 4JI1F 5DLFA 3WHIA 3MFIA 2VWBA 3HRDD 4CZFA 4MLEA 4B1WB 2P1JA 4FWQA 2PXIA 1R0AA 2QWQA 5ALXA 4W98A 2DEIA 2QG9B 1CLQA 9ICBA 3UFCX 4NJ8A 4PEOA 3E1YA 3MWTA 3N9UC 1GMUA 4AM6A 2DWQA 3DOLB 1EP4B 1WTBA 3NMRA 3RAMA 2ZQBA 4JWMA 1S77D 3LPUA 4YR2A 1VK0A 2CPHA 5H2FU 1GMWD 3QICA 3VF6A 2AX0A 2FPHX 1T9WA 2FQQB 3QU4A 3TAGA 1PZNA 2XHBA 3MTJA 2VGNA 3QEWA 1ZQTA 3PRVA 3I9ZA 4UASA 1K8AT 3BYRA 4LJMA 3Q8SB 3QMQA 1WCNA 1FO1A 3VQDA 2W42A 2FPMA 1ECWA 2MSNA 3HKWA 4NYOA 2DHAA 4OYZA 1FKPB 4B3TJ 1DXSA 4ECUA 1RG6A 3M2RA 1WC3A 3HD1A 2LFVA 1Q9YA 3SAHA 3CCQS 4JV5F 2FY1A 4A4JA 3QBXA 2IRXA 3LP3A 2YHYA 2Y0SF 1NMNA 4CEFA 5F3ZA 2ZBCA 3AJ1A 4M5GA 5LSOA 4EP4A 3D9BA 5CQGA 3M8SA 5D0EA 1K8KB 3AO1A 4DX8H 1IKYA 3A8KA 3CJRA 1X9WA 4C97A 5IS2A 4ECYA 4HCCA 4LF8K 2Q1NA 3OHRA 4IG0B 3LANA 1NJZA 5J2KA 4WWSA 5AQMA 4YN4A 3FE1A 1RT2A 2AJ4A 1S72S 2L5YA 4DV4K 4I4BA 3VQSA 3U1LA 1GMVA 1HNIA 1TMJA 4PKGA 4DWIA 1WEYA 8RUCA 2WK4A 3MZIA 4PQUB 2ZHBA 5F3TA 1VR6A 1AYEA 4LSZB 4YB1P 3MR6A 3ISDA 5FDLA 3UXOA 5C42B 3PNCA 4DQSA 3GOIA 1QAYA 2FVQA 4FDFA 1IJFB 5KG0A 3ZDDA 2IA6A 1XBWA 1TAQA 4M7XA 1BDGA 2WF6A 5GTHU 1OJ4A 1UA0A 4EYIB 1OH8A 1BPEA 1YT3A 1IWGA 2G1HA 2YQEA 2FGOA 5FLXY 1OSCA 2Y9TA 3TQEA 3FZMA 2H3EB 2DUYA 3KLFB 2BJ8A 5AKJA 1RTDB 3H2LA 1ZM2A 4I7FA 4Y0WA 2BQRA 2YXLA 2Y0BB 2XWYA 1VSKA 3CW2C 3X1LB 3VGLA 3A13A 4M3XA 3W60A 1ASWA 1HBUA 2ZWOA 1VQMN 1H7XA 2PEBA 2RHQB 4RQ0A 1FJGK 3WNEA 3RB4A 2GQ2A 2P9NA 1EIYB 3T5LA 5J29A 2EFVA 5IZHA 2P6RA 2RNEA 5JMNA 1WSIA 3MEDA 4K4TA 5J2BA 2L08A 2RD5C 3QGPA 2A1JA 2UXBK 3HRGA 4JOUA 4WQ5C 2CWKA 2B5JB 1DRGA 1U1OA 4DR1J 3ZO7A 2MQPA 3G71S 1SJRA 4OI3A 3TUPA 1A5VA 5DG8A 2NRHA 5D46A 2B3TB 2QEXN 4LSNB 4IH6A 2GVZB 4L3QA 4JI8K 1XIQA 2HBQB 3DOKA 4YDDB 4GLXA 4P2HA 3SBMA 4OHYA 3CVKA 4ZVEA 2B4PA 3I55S 1JLEA 4OLOA 2OPSB 1NNDA 5LJWA 2ERRA 3I5CA 4RW9B 4F2SA 2X1GA 5EUHA 3ADAC 3OYJA 4H5TA 4PL8A 4KLLA 1WG1A 2VG5B 1Q7YO 5K8OA 4IOBA 3AODA 1WF2A 1ULRA 5SWMA 4IS7A 5AQYA 4X66K 4BREA 2IGIA 3O3GA 4ED0A 3C23A 2JGUA 4HL9A 4LUBA 3FC4A 1VISA 5ETPA 1KFSA 2F2AB 1VBXA 3QX7A 3O4WA 2VZ9A 1WC6A 2E5GA 4LRDA 3C29A 4YFKA 3Q83A 3CQYA 3BEXA 4RQ5A 3GV8B 2YH0A 4NLUA 1HI0P 3QWPA 4TYAA 3C7NB 1Z19A 1Y7PA 4UOGA 2DXEA 4IJNA 4C3KA 4PG7A 5K9FA 4V19X 2OZMA 5GAGU 1TUWA 3K5PA 2VPWB 3VQPA 4RG8A 3I0RA 7ICEA 2F1FA 3TYTA 3O9SA 5E3PA 3VAGA 2EZZA 4HKQA 5HHHA 2JLGA 1PK1B 4XK8C 3UNYA 2XZWA 1ZBLA 2B43A 2F44A 5D0HA 1VRTA 2D8CA 4P10A 4KMOB 4OJHA 3EE8A 3A3NB 4KV8B 2X1FA 3G9CA 3L2UA 5J2IA 1YJVA 1UA1A 5ETTA 4DV5F 2AXTU 3SAFA 4Y2IA 1ZQJA 3CQ8A 3ZT0A 2Y8YA 2EFOA 4WTYA 2CGLA 1SZHA 5IWAK 1PIEA 1FRHA 2BJ9A 1S5LU 1UEKA 3HPOA 4OX9J 1A7GE 2HK2A 3LDOA 2NPIA 2HAIA 3JPQA 5GAGI 4JD2A 2W04A 4C4TA 2ZOGA 2HHWA 5I3PA 4M5MA 1SIWB 3CCWA 1R0CB 4G6VB 1OW5A 2JWLA 2DQNB 2K1RB 3D3BJ 2DXFA 2CVEA 4O0NA 3C6TB 5FLXU 3MMBA 3SDEB 4PXEA 1W0HA 4DTRA 2A1SA 3GB0A 3SUQA 1Q3VA 2KNJA 3SQ4A 4ATNA 5E41A 2K4IA 1QCKA 4WU2A 2FHJA 4B9SA 4FF2A 4ZH4A 1Y0HA 2IYGA 1VHXA 3C5FA 3MEGA 4H5NA 5J2JA 2XMMA 3TADA 4CQ1A 1IG8A 1TR0A 4FZLA 8ICYA 2FZKB 5E3CA 5LL6Z 2GLEA 2OHDA 4NXMF 3H8JA 3TQ1A 3I82A 5CCMA 3QJJA 2BDPA 3ZSRA 2H3IA 3TPQA 4BRMA 4PRFA 2ZBQA 4N76A 5IT4A 3OYGA 1WC0A 4C0OC 2ES6A 1P7DA 1S1VB 7ICHA 4A8FA 4NLZA 1CJVA 3EE9A 1RADB 2YWHA 1SB3C 4UUXA 4DQIA 4CZGA 1Q46A 1C1CA 3UCGA 1GLAG 1N0VC 3CC7S 3KXDA 3BZKA 4TYBA 3AOCA 5LJ3Y 2XY7A 2DGVA 2N4DA 2OMLA 5KFYA 4FK2A 5E3AA 4MT1A 4Q8EA 1TFRA 2RKIB 4B3TK 1V3SA 4OX8A 3AD7C 4IO9Q 3QFWA 2EQYA 3I1YA 4WPAA 2VV5A 4FWNA 4QWBA 3DOLA 5AJ3F 2XVTA 4KHRA 3UN5A 1KFDA 2RS8A 4QW8A 3DOMB 4FJIA 1T4GA 4IFYB 2QV6A 4U7BA 4KKOB 1YTYA 1KKHA 1KDHA 4M2YA 2IJNA 2IHR1 3TVZA 2C2EA 3EGVA 1HYVA 3CJ8A 3UKUA 1LW2A 4LF4J 1S99A 3Q2SC 4LR9A 4USTA 3VEOA 2H65B 4RWTA 4HTIA 2ILZA 1XO1A 1Q78A 5IT9Y 1H1VA 5CHIA 4AH9A 4CJ3A 4WFZA 1FKPA 2KL8A 4MFBA 4QU6A 5F41A 4LZDA 3CJ3A 4UF4A 1GK8A 5KAIU 2AZ3A 2PMHA 4B9MA 4JNEA 4YDUA 4F4AA 3ET6B 1NDPA 4X4UA 2W2OP 3KK2B 5MLCQ 4F93B 1AUDA 3QRQA 3P5BP 1CLFA 1ZQHA 5AKHA 4NYFA 3L7UA 1PJ7A 5I9EB 1XMQJ 3NASA 2BV3A 4DCOB 2W9CB 2KT3A 3PRBA 2HHHF 1FD8A 1ZBHA 3KLVA 4IG0A 4GVLA 2A2CA 4CGFA 3DI6B 8ICLA 3LWMA 2H5XA 2J9DE 4YN3B 3AVAA 3G25A 3R5DA 1VQ6S 5F8HA 3EM1A 1RCHA 5FPNA 1PGZA 1PILA 3FGUA 4FWMA 4KN7A 2FPKA 5J0TA 4BS2A 2G2ZA 5C42A 4NCGB 4CBXA 2NUHA 5KOWA 1I94F 1KRPA 3U7JA 4ZVQB 5CWRA 3ONNA 3QIPB 3IS9A 2ATQA 2RDJA 4P6QA 2YQ1A 3L6QA 3PYGA 3KNAA 2M88A 1NGCA 2ZJQQ 3FQKA 1SKUB 2ZWPA 1MWYA 1ZQMA 3D2FB 3SI8A 2QLXA 3DM2A 4RQNA 3P96A 3Q8YA 3WQUA 2PKEA 1PAUB 1C0UB 2YX8A 4DV7J 4DMZA 1O13A 4RT2A 2MKHA 4DR1K 4X5VA 4I1TA 3EGNA 1IBMJ 1NBWA 4AHSA 3FM9A 5D4BA 2GWSA 1S6QB 3RB0A 5J0PA 5ALLA 5ITHA 2YMMA 3CERA 2DYAA 1RBAA 2FXUA 1T03A 2JLEA 4MAKA 4DR4K 3AARA 3JXUA 5KT2A 1KTQA 1JI7A 4NLXA 3LGHA 4OV1A 1B9FA 2RQ5A 3RW6A 1BI4A 2BRKA 5AXKA 4CF5A 3IBFB 4QIWD 1GLBG 3D66A 5DZ7A 3C65A 4J9SA 1KCFA 2YTUA 3I28A 1RACB 1KVKA 1BPZA 3PW5A 4MKAA 2V8DA 1RDBA 5C24B 2C2DA 1WWUA 1NGJA 1JLCB 4BR7A 3CCQN 4Y1CA 1SWWA 4PG8A 1X7VA 2HFZA 2G13A 4J9PA 4FYWB 5TKYA 3ZTPA 4ISFA 4G1QB 4OJ3A 4N41A 2OPSA 2FVPA 5G4DA 1S7HA 4FVCA 4RW9A 4ILJA 2HVHA 9ICJA 4MDBA 1JLBA 1SBRA 5A0LA 1X4HA 1Y9OA 3WEEB 1XQIA 2VG5A 3C16B 3AVIA 3U3GA 4MKBA 2KIWA 2J7WA 2ZIXA 1YRTA 1G3OA 2R2RA 2J8AA 5AXLA 5D6GA 3MXHP 2O67A 1IG9A 1CJKA 2V7ZA 5FPDA 4M95A 2IHMA 4RUCA 2VA2A 3GG0A 4B1YB 1SQGA 2E29A 8ICIA 3CNHA 4B3RF 1WNSA 3TKAA 1RTHB 3TTDA 2JMGA 2IC3A 2X7IA 5C2GA 3F2DA 2W9AA 3KZXA 1QSSA 3K5OA 2HZVA 3MXMA 5B8HA 1IQZA 2WBNA 4PXCA 1KVAA 1FTRA 3AU2A 4K4VA 3C7NA 3H5XA 4JI4F 1XSNA 5CY4A 4J9MA 4E7HA 2ZH2A 4OX9K 5ALUA 1OYEA 3OS0A 1T3VA 4KIAA 3V6DA 3D6RA 1RWOB 3GL1A 1RUSA 3GFKB 3SQOP 4WU3A 2VPXB 4A48A 3SQ2A 3PW2A 1PK1A 2HCFA 3I76A 3LM2A 3NH0A 2GJIA 3OYAA 3UI3A 3NGYA 4DTMA 1OMSA 3OXGA 7ICVA 1SQEA 3OY9A 5LXRA 3HO1A 4WTOB 4RU2A 2E5LF 2J9EA 2BKNA 4NL5A 2BW7A 1KD1O 4HI1A 3OL9A 2R7XA 4M7YA 2E1MC 3TAFA 2W2MP 4ZP7A 4DBQA 4E1NA 4PR6A 1U48A 2DBBA 4FWPA 1MC8A 2QKQA 2BA9A 2R8IA 5HP1A 1RBOB 3WXMB 3ZZ0A 3OL7A 2KHVA 2JC1A 1MNEA 2BGGA 4HHJA 4KREA 1DBDA 1NK6A 2K1RA 1GLCG 2B0CA 1QH9A 4CGIA 4FW2A 4LBIA 3CFOA 2L41A 1OQ6A 2ODGA 4LF5F 3NGIA 2KKHA 4PWWA 5ETVA 4RPFA 5E0OA 3SDEA 3MAQA 1B64A 3G6EN 3O3HA 3NP5A 1M90T 1RABB 3NGDA 2HW3A 4P75A 2FJVA 3WQTA 2IIHA 1AB8A 5AI6A 5AR0A 3QNMA 1VQ4S 3I55N 3RRHA 3IBPA 3GFZA 4DR6J 3ALRA 4HYKA 4M42A 2VGMA 2DNPA 2PBDA 4CF1A 2EFNA 1K9MO 1T3QA 4OJ1A 1J5OB 1EXNA 3KDOA 3H1VX 4IDKB 3MMJA 4CO1A 4OLBA 2YN4A 1TZ0A 4KLOA 5LJ5Y 4WQ4A 5HROA 4BDZA 2DR7A 4JV1A 5DK5A 4X4VA 1ZBFA 1O51A 1VQOS 1T0TV 3T6JA 2FYXA 1RA6A 2CPFA 4CT9A 3SMSA 1S1VA 2Q66A 5CYJA 2NRTA 1VBYA 2HBZB 1D8BA 2F4FA 2ALYB 3PO5A 4JK7A 1JXEA 3SBTA 3QRRA 1BNPA 5HVHA 5AE1A 5I3QA 3FEYB 2BANA 2VG6B 2KHDA 3SBGA 2WUSA 5LMUJ 3TANA 5C5JA 1M1HA 1RDUA 3LM9A 1ZQVA 1NJYA 1BWVA 4LF9J 2D69A 2OPQB 4QOTA 2K06A 1H72C 2UXDJ 2DFFA 1IH7A 4CEQA 3CF5L 4B1UB 2LLZA 2LYAA 4OV6A 4JI5F 2XI9A 2RKIA 3GE9A 3QEBZ 3ILLA 2J9CA 4F3QA 3HVWA 1MU2B 1VQ5S 4OZNA 2A6MA 1OWXA 3KK1B 2BX6A 3DOMA 2GJFA 3DMJB 1VSHA 2PEHA 3MR5A 4CD1A 4ICLA 4KKOA 4RW8B 1RISA 1VJQA 3NVMA 2OSRA 3M8QB 4NLWA 2GMHA 2HNYB 4I2QA 3Q0AA 5AM2A 3DLKA 1RGIA 1HYSB 5EE1A 5M2PA 4OJLA 4Y2AA 2EKYA 1J2NA 2OI2A 2CKWA 3J81Y 3D1QA 1TV9A 3OYFA 3KK3B 3AGKA 3J7ZO 4DU4A 2WFBA 3MAAA 1S9EB 1NNLA 4PCQA 2Y3YA 1N5XA 4KGKA 4A8XA 3LVWA 4MO4A 4PKIA 3ET6A 3Q8RB 3KK2A 1VRUA 5LOQA 1NPRA 4GKKJ 4CWBA 1VSMA 2C2RA 4J9RA 2OM6A 2YHAA 4JB3A 2D7SA 2LXFA 3NMAA 5IXUA 2Z1HA 4CGHA 4M5HA 4FLVA 3V9ZA 3QAEA 3QATA 2W9CA 2RUSA 5EHHA 4YUDA 1T11A 1XSLA 1VSJA 3DI6A 3QB0A 3C1YA 4GIBA 3BR8A 9ICSA 4EZ6A 1EX4A 2VG7A 1FHTA 4UB1A 2A3JA 2ZH8A 4DV7K 4DFKA 2H3VA 5CAAA 2RAQA 1RHMB 2MQLA 4Y2PA 4HACB 2KJVA 2LI6A 2PN6A 3EMTA 3FKBA 1ZOLA 4DTSA 1BE4A 1OY9A 3AO3A 2VB6A 4CJWA 2LPEA 1MMNA 3HVRA 3VEYA 2C2KB 5KFHA 2EHGA 3SK3A 1KW4A 2CQ2A 4DUZJ 1GX5A 5FLXO 1SC6A 4YHHF 5BRDA 2Z4PA 3QU2A 8ICNA 3MBYA 9ICUA 2KSOB 2J6SA 4F5NA 3WXIA 4MMOA 3N01A 1EZZB 2V69A 1I3AA 4Z6CA 3H3NO 1F3FA 1CVJA 2B4UA 1YJ9N 1WKLA 1CUKA 1U02A 4B6JA 8ICGA 1M5SA 1UZDA 5AXMA 2P2CB 1TVRB 1Q86O 3US5A 4CESA 3IG8A 1J2MA 4Y2UA 3NS7B 4JI7J 3LGMA 4IO8A 1IXRA 1S6QA 1IV0A 2HNZA 5MAOA 3AQEA 4DF8A 2FZGB 5IC4B 3ZLJA 3RJHA 4K2XA 1DEJA 2ZBRA 1S49A 3ISND 2BVZA 1Z00B 3RJMB 3M4XA 2MUTB 1UVIA 2HHXA 5HJXA 2XWXA 7ICSA 2HI0A 4MLHA 1WJ9A 4FF1A 2H54B 2JSXA 1QUPA 4U7UD 2DL0A 5DETA 2GHPA 2Y0SC 3KFUF 5C24A 2QJ3A 1JLCA 2E1FA 1NO8A 4IH5A 1ESVA 1RAOA 1TUGB 2GW8A 3LP2B 3AVMA 3IM8A 3C19A 5LL6d 3C21A 1YVFA 2DPJA 2OA8A 5LSLA 1RHKB 1XNRF 4LRBA 4PHTX 2OPRB 3MR7A 4E8UA 1Y88A 4G1QA 2I0XA 3V9SA 1SGGA 4JHDA 1PCAA 4AQYK 1RWNB 4CJSA 4LH4A 1EO1A 1NZ8A 1JLFB 1SI9A 2YWGA 5EX0A 4H0VB 2LU1A 1N63A 1VRQC 5KFMA 1HX1A 4YR3A 3JPRA 9ICKA 2R7QA 2VONA 4X66F 4B1VA 3Q23A 1R8PA 4ZVOB 1ILYA 2WBMA 4RU9A 5B0FA 3J81U 2ASYA 5D8HB 4HT7A 4CEDA 1UWBA 1L8OA 3D68A 3I87A 1IQTA 4OFZA 9ICQA 2B0GA 3G8TA 1OH6A 2V8HA 3J7AN 2JOQA 2DF4B 1RU2A 1RAFB 3BO3A 4DV1K 1NZPA 3K8VA 1HFEL 2HMIB 1HNWF 4L75A 2W7PA 5J1PA 4K4XA 4MK8A 2XHCA 3G82B 1R6VA 3S9HA 1PJ5A 2YKOA 1TP7A 3D2EB 4R65A 1NSPA 3IG1B 4EU0A 1FXXA 2H51B 2ITMA 2P9LB 8ICKA 2VPZB 3ZTOA 1VQ7S 1FA0A 2J5AA 2BTFA 3R7BB 3PEJA 2BCRA 1JWWA 1Z2ZA 4DS4A 3AJDA 1P1TA 4BR0A 1F5AA 1JLGB 4NRTA 4WFNQ 3M7VA 3J7AP 3C66A 3NE6A 2VBZA 4D3HA 2ZD1B 2E66A 3QBCA 1UZHA 4DR6K 3AD9C 4JI0F 3UR0A 1YUWA 4I56A 1C0GA 1Y5NB 5AK5A 3Q22A 4O5KA 1RK8A 5THWA 2CPRA 1RU1A 2KVCA 2LKYA 4XIUA 3M8WA 2FB0A 3U8XA 3VZIA 3ENQA 3HOTA 1VHFA 1F60B 5DM6Q 5EGYA 1HARA 2KT2A 3HKZC 4K5RA 1VDVA 5F8MA 3FC9A 5K4LA 2HBYB 4CI6A 4NLQA 3SCKE 1KQSR 4RKUC 4BG9A 3G86A 4K4IA 1A9NB 4HH0A 6FD1A 5KFXA 3W66A 4BRIA 1WD6A 3EY1A 1WSVA 2DKZA 3DHWC 5LMUK 4RQ8A 4FZNA 4QIVA 4CHZA 1I1GA 5AQHA 4JK1A 4BJQA 2B6AB 1S0MA 3QUTA 3JQKA 4LF9K 2UXDK 1K8AO 1J5OA 3L4PA 4O8UA 1FERA 1ZAVA 4QCLA 1TFYA 4F4KA 3SI6A 5IV3A 4KLJA 2V51B 4MIAA 1B7FA 4KTWA 2KJ9A 1QAJA 3SNNA 3WIUA 2KYXA 4ED3A 4CHQA 4J7CA 5E5NA 4C1NI 1IKVA 1NHVA 4KRWA 2RRDA 3BN7A 2GVDA 4DOZA 5KG5A 4NLVA 2XZDB 4CHOA 4DEZA 2FJ6A 2WAQC 1ZRMA 3N6LA 1VHIA 4W5QA 3O1BA 1ZA1B 3B4MA 4CLWA 4O44B 2VG6A 2ZF5O 2ZFHA 5J1EB 1P27B 1BWEA 2CJ9A 3OTEA 1C0MA 1X42A 2I2YA 2OPQA 4OYXA 4DF4A 2ZM6J 1ZQLA 2KJ8A 5J2GA 1DQ9A 4BGAA 5G5GA 4DV3J 3GPAA 5F8GA 3ILOA 2A42A 3HCXA 7ICKA 1B0XA 3TRGA 3KK1A 2ZJAA 1RDDA 3WXJA 3N5BA 2EBGA 1IJJA 3HBTA 4GMJB 3PXGa 4IEEA 4BRAA 4O4GB 5IT9O 2JGAA 4RW8A 3ZETB 1V9OA 3UR3C 5EWEA 3R97A 5AQIA 4LVSA 4NASA 4MQ3A 3M8QA 1TK5A 2HNYA 2G8HA 1NGFA 5ALGA 4P0PA 5HMMA 1HYSA 2C2OB 4HWIA 4I2BA 2Q0UA 1NHUA 4TY9A 1RDFA 5KOXA 4LIWA 3T3FA 1FT8A 2RE2A 4KBIA 1NLKL 2ALZA 4QZCA 4EO8A 4DHVA 1S9EA 1LEOA 4A8QA 3ATVA 1WNEA 3L5KA 1Y3KA 1Q18A 4K4HA 3FMBA 1VLOA 1X31C 1SJ3P 1KAXA 4BLGA 3HSJA 3TWZA 4C7QA 1ZD4A 3EICA 2KRRA 4ITSA 3R9LA 2QWNA 3MDFA 1NH7A 2E5HA 4EX6A 2OTLS 2G2YA 4USIA 2R7OA 3N4QA 5K14A 4UAWA 3EJMA 4JI3F 4M47A 2JFKA 4BUGA 3Q8KA 8ATCB 5E7OB 4L6V3 2FJWA 2V50A 3KHRA 5JVHL 4KGVB 1TFWA 5L46A 5DLGA 4I27A 3CCJS 2BW2A 1FRMA 1OH5A 3Q8QB 3R6GB 1VQ4N 3MGIA 4JYAJ 1OUQA 3KG0A 1T9UA 3THWB 3GZ7A 1GOCA 4FPIA 3O3LA 2MKJA 4HACA 2EW9A 5D0GA 5AQJA 4CE9A 1WBBA 1YHQN 3CM5A 2GIQA 5ETLA 3NRZA 2EFGA 2BE2B 4JI7K 2IIRA 4BG8A 3KHYA 2GMJA 2OGUA 4WCEL 2E9RX 1BQNA 1VQON 3V1RA 5CXTA 3MX5A 3MGVA 1Q7LB 1RWKB 2B9XA 3C6AA 3K9JA 4GVEA 2C3MA 1WORA 3FR0A 2KSOA 3MPVA 4B3MJ 4I2IA 2Y1JA 2R2TA 3E9PA 3RJJA 2EC2A 4GKJF 4C8MA 1PK3A 2G0CA 4F5RA 1WBDA 4DFPA 5KFIA 4M9JA 6FDRA 2FJEB 4LBHA 2A19A 2E8OA 5B0CA 2IS3A 4PHAA 1TVRA 1MSWD 2F5GA 1SV4A 2F9WA 1R8BA 3Q89A 3BGFA 1ROFA 1NZAA 2HS3A 1T9YA 4JI1J 4CO0A 1IR1A 2HBMA 4BRNA 1U45A 4LF2A 3BS5B 4ER8A 3NUQA 3VC8A 1KEJA 2B6GA 5KT7A 2D0CA 4DOCA 4DR4F 4K8XA 2XNQA 4TQSA 1I5OB 2MUTA 3LDNA 4NB4A 3KD5E 5GMDA 3ZX0A 4UOCA 2BRLA 1PC4A 3H2UB 1FFVA 1OH7A 1C2PA 3W8PA 4IWVA 3GFYA 4LH5A 1SH0A 1XJWB 5DDRC 3UM9A 4LQ9A 5ADXA 2XYGB 5ALHA 1SJ1A 4J9LA 3HZ6A 4WQ5A 4C8NA 2MKIA 3NAHA 3AT1B 1RYRA 1KLMB 4FP9A 1W2BR 4A8MP 1WUUA 2AYMA 3K58A 3CJ2A 3U9DA 3V7KA 2OPRA 5ALNA 2O8CA 2V9WA 2D4WA 3T41A 2NLXA 2AEMA 4MIBA 2QZ8A 4KGXB 2YB4A 1JLFA 4CDGA 4JV5J 1BA0A 1U8WA 2P9SA 3T7ZA 4HHTA 1W25A 2BUNA 4QPTA 2QLWA 3S6JA 3QGHA 1U0SA 2ROGA 4RUHA 4K8ZA 1QTNB 2A10A 3H98A 2CG4A 2OYQA 2MRLA 4ZKAA 5HR6A 3DDKA 4CRJA 4IQXA 2YNFB 5A8WB 4WYLA 3IR5B 3A4TA 2VKRA 2BEFA 2E7VA 3HWTA 2DNZA 1UT8A 1FRKA 5K5MA 4FOEA 2OTJS 1TKZB 2GZOA 3OR2B 2GGPB 4WFAQ 2VC1A 2HMIA 2MSTA 2GS8A 3GU0A 3V9WA 1GLEG 3V6JA 4EMDA 5KG4A 3R7SB 4B1ZA 4BC3A 2YBVA 4OX9F 3G82A 1FDNA 4S0MA 1V85A 3DGPB 1ZS6A 1ZQGA 4RT3A 1ZQAA 3D2EA 1S0OA 4DSKA 1YQHA 3MECB 2WF8A 3N7RC 2MTLA 3MMCB 1ZD3A 3K1RB 1JXVA 3BO2A 1YJNN 3ZEUA 2P9LA 1L3VA 2UUCF 1BD6A 3NGKA 4O23A 3VESA 1C0TB 2NRRA 2CWXA 2BBEA 1LB2B 1RTZA 3PHEA 2XCPA 3TAPA 2PO4A 2NPFA 2BPCA 4AT1B 1O0PA 3UB5A 1NMEB 3MM7B 2KJWA 1Q4RA 1JLGA 2ADBA 5HRPA 1XNQF 2G8UA 1JL1A 2EXUA 2ZD1A 1RBRA 1EQ0A 1HNVB 1TL5A 4DDFA 4BVPA 3DLGB 1YI2S 3BQ0A 4LREA 3BZCA 2Z2ZA 2CYYA 1FI4A 4FXWA 5ALTA 4OQJA 4ZPCA 1M1GA 5ALJA 1RP5A 1TV6B 3JAMU 5KFEA 1CRXA 1Q1KA 2GHWA 3HHEA 5D78A 3I5BA 4CLKA 4U7UK 3ZZZA 4DG1A 2NO5A 2R7VA 2RF2B 3HJFA 5KPTA 1MWMA 4BBYA 2KYZA 4JAXA 2OLWA 5D0RA 4LFBF 1FEHA 1S10A 4IOAL 1GXUA 3VGUA 1YKWA 4QZ8A 4H8KA 4KH1B 4ZVRB 1S1TA 1Y00A 2B6AA 4YP3A 3HF5A 1Z4NA 4FJ8A 2ZM6K 3PIOQ 3RFAA 1ZQOA 4CLTA 1RAIB 4IQMA 1KXPA 1HKAA 5FROA 4E1JA 4DV3K 5GAEP 3F0NA 3R6LB 2KW4A 2O1PA 2M0GB 3DLHA 4KLQA 2AYGA 5J0SA 1QQ6A 1RBLA 4JK8A 4CZKA 4HVZA 1JUDA 3WZ0A 4BRFA 4UZCA 4M5LA 1C1BB 3LGNA 1BQXA 3IBWA 1WN7A 4MKVA 3RUBL 2Y9UA 4KX5A 2DHGA 2XI3A 4Y28C 1QUVA 4TLQA 3K5LA 2GOLA 1IKWB 4DU1A 4Y2MA 1J54A 2F1IA 4ZCIA 1NK8A 4OL8A 5T14A 3RVCA 3EXCX 4EUVA 1LKYB 1DQAA 3M30B 4WZQA 2XGQA 3R5GA 3NGZA 1YJUA 2DPNA 2DRDA 3LH2S 2XMAA 2IVOA 4A5AA 1S6PB 4BRCA 5J2FA 4YMEA 5AI0A 3GJTB 2VQFF 4CGJA 5DB9A 3KLHA 4TNOA 3SQ1A 3J81O 1SXEA 4O4GA 4CM0A 2R7SA 2COLA 3UNGC 4DKWA 1XC9A 1VQ7N 2IVMA 4ZLNA 3C6UB 4PKDB 3RMAA 3MDQA 2D9PA 1RJJA 4FWKA 1WC5A 2MPUA 4CGGA 3I0SB 2AJ1A 5HBMA 3VGVA 3KJFB 4CHPA 3O0FA 5F8NA 2E8AA 4JYAK 7ICNA 2P6UA 4DV5J 2EZXA 1WTFA 1QAIA 2EWHA 4FSVA 2UVUA 3EL2A 4ES3A 2R8JA 3ENHA 2NXUA 3BYPA 1U7LA 3ZNJ1 1NUEA 4NM1A 1FE0A 3TVYA 1NGHA 3WBZA 2QKKA 9ICXA 1IBLF 3GILA 4ZTFA 1B3TA 4BCAA 5EDWA 5C25A 3F2KA 3AVFA 2CQGA 2DGZA 4B3MK 2PA8D 2JR5A 1HHSA 5DBAA 5M1OA 5KFSA 2UVRA 3MGHA 5CA5A 1X4DA 4I2AA 3S3MA 1KEKA 5A8RA 3O8MA 4PGYA 3OYKA 5IV4A 2G0JA 1BHLA 3V72A 1Y4ZB 3KOAA 1YWXA 1HJOA 3NRBA 1JNRB 3P83D 4OIXA 1TU0B 2BE2A 4LRAA 3MCSA 4XTTA 4A46A 2AJ2A 4B3OB 3AQPA 1U1QA 2F3NA 3VEXA 3MPUB 2YX7A 1GO3F 2DR5A 1ZPVA 4IC9A 2V94A 4C7ZA 3EZUA 1X4BA 4NXMJ 3PCOB 5HANA 1N52B 1VQ8S 3ZZOA 1N48A 4CJRA 2Z1GA 3MPYA 3EN9A 2I38A 2E8PA 3MCMA 4JS5A 2H48B 5KFAA 4JI6F 3UPFA 1Z25A 4ECSA 3DEEA 2WVDA 4DQQA 3NY0A 4HVJA 4K43A 2W4DA 5A2QU 1TK8A 1ITPA 4OZLA 4RW4A 4P2FA 2EAMA 1P90A 2AP6A 3M6KA 2AYBA 4QIGA 4NZ0A 3BGUA 4IG3B 3BEGB 2A40A 3AAWB 2Q0RA 4US8A 1BPXA 1PBAA 3BS5A 3LA0A 3VETA 1JIHA 1Q95G 2QWRA 3E01B 3HSZA 5DDPC 2KVIA 4ID1A 3PM9A 1HQEB 1H2UX 3KWIA 3A2FA 4LJXA 1CULA 3HP6A 3G8SA 3CDEA 4I9QA 4ED1A 2YNIB 3GCWP 4JV5K 5AJ3J 3WK7A 4AHTA 3CB4A 4CI0B 4YD1A 1DHMA 5HVFA 2AJ0A 2A1BA 4UATA 3OD2A 2CH5A 2FY8A 4FFDA 4LRFA 3HTVA 2W8LA 5M1FA 1ATNA 1KR4A 3ID6A 5CABA 2MY8A 3M32A 4YY3F 3HILA 1NDLA 2OTLN 3TZZA 5AQFA 2QL5B 1ZQEA 1COKA 3NGUA 3MM9B 4DV2J 4AQYF 2MZTA 4AHVA 4P4MA 3WK6A 2GAGC 4YMMA 2O8DB 5C7PA 1EWQA 7ICLA 4O3PA 3CCES 4ZVPB 2DR6A 3NNAA 4Z6EA 1RDWX 2BCUA 1QE1B 3O9TA 3CFPA 1S1UB 2YNFA 5K8PA 5AZIB 4AHUA 4KE5A 3VGSA 3GCXP 5LMNF 4OZ1A 2HHHJ 2E5SA 1B43A 2K4PA 3KNGA 4A62A 3RZAA 3VF0B 1JJ2R 2XMKA 4Q43A 4F3TA 1CI4A 3ZYYX 3SD7A 3Q8MA 5AKEA 2GGPA 3D2QA 3IDWA 2HBJA 3VQ6A 1IJEB 3KHHA 1L3KA 1M5HA 3L7OA 1TKDA 2KG5A 2MGZB 4DV1F 5AM5A 3NAEA 1X5TA 1COOA 4PPDA 3DGPA 4UAZA 1NSQA 4F4YA 1I94J 3S01A 4ZHRA 3RBXA 4MHVA 3MMCA 3CPWR 1QQNA 4H4MA 4BWJA 5B09A 3HYFA 4I67A 4AFFA 3VMFB 4Q0BA 2QMXA 4ISEA 3WKEA 3IP4B 4CJVA 4ZPBA 2G4BA 4DTUA 3ITHB 1VSLA 4BC2A 1QD1A 4QIEA 3MM7A 1RT6A 3CDBA 2PI5A 4E0DA 2RQMA 4PWDB 4WJBA 2KKZA 3O4NA 4V1Ak 2KB2A 1Z2LA 4NA2A 3IA0A 1JK9B 4URGA 3O6WA 2FHJD 3TJ9A 2B8QA 1A76A 2V4RA 4ZVTB 3CMQA 1Y97A 3CJKA 1BUPA 1W7AA 3D67A 4FJHA 2OH2A 4N77A 3CJ5A 5F1XA 4W5NA 2DY9A 2WONB 4TUQA 1JNZB 1OPZA 1WSGA 4JEPA 5DGBA 4J2EA 4CJ7A 4DB3A 1N54B 5ALMA 3UW1A 1VQYA 2ZE2B 3THXB 2VWJA 2PT0A 3TR8A 4Y2YA 3F2BA 5CH7B 3KFWX 1IM6A 3V4MA 4KY3A 2QRRA 2WB1D 1UPHA 4Q8FA 1NM1A 3KLGB 3PLAA 4FOIA 2ASDA 2RT3A 2Z1JA 1TAUA 3POTB 2D1KA 3ENWA 4LF6F 1QVFR 1DGSA 3GR1A 4HHHA 3WKDA 4WK1A 3LVVA 2WSCC 4A2AA 3QEXA 1W9HA 1DJ0A 5JVGQ 1N2XA 4M3RA 5F0WA 5KPRA 2QB0A 1VQPS 1X5SA 2X1AA 2VBYA 3U26A 3K0JA 5EX5A 3D6MB 1A6LA 3F9KA 2C3YA 1RTJA 1YJ7A 3ILIA 3UQSA 2AGQA 1GMWA 2M8HA 1C1BA 2D3O1 4ZPAA 3QJLA 3NDKA 1MROA 1BWFO 4KH4A 2K4EA 4BRDA 4H4OB 1J97A 2QYCA 2ZIUB 3LF0A 8AT1B 2XICA 1LWCB 2OTJN 3RGIA 3A3PB 3O8WA 3CIPA 4X62F 4F3MA 1N56A 5KFFA 4NV0A 3OYIA 3V2UC 2A3ZA 4MDAA 1G15A 1R27B 3M30A 4DXLA 3AXKA 4CO5A 4B3RJ 2RHFA 1V3RA 4RQ1A 2LEAA 5MLCV 4DV5K 4Y1DA 3ZDAA 4G3IA 1S6PA 1HPMA 4TURA 3SIPB 4Z7YA 2HG4A 3DRPB 4OHWA 4IO9L 2LQ8A 3N5FA