3EZ5A

Cocrystal structure of bacillus fragment dna polymerase i with duplex dna , dctp, and zinc (closed form).
Total Genus 208
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
208
sequence length
580
structure length
580
Chain Sequence
KKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Mechanism of the Translocation Step in DNA Replication by DNA Polymerase I: A Computer Simulation Analysis.
pubmed doi rcsb
source organism Bacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords DNA polymerase I
total genus 208
structure length 580
sequence length 580
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2008-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3ez5A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 3ez5A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ez5A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3ez5A01
5KG7A 3K58A 2DFFA 1BPYA 3V6KA 3KJVA 4FJ9A 5KFWA 1BIZA 3M8RA 2IC3A 3KKSA 4MFAA 1BQNA 2BPGA 4F2RA 1ZQWA 3RMBA 3SQ1A 4C8LA 1BIUA 1D8LA 4YD2A 3RJEA 4JWMA 4RZRA 4KREA 2ZUBA 4KLOA 3Q8MA 3UQ0A 3IS9A 4P4OA 2BHNA 4KKOA 3TFRA 3AO3A 1RBSA 1RDCA 4MEYA 4FJLA 5KG2A 2P5OA 4P2HA 1ZQEA 1TK5A 2KW4A 4DU4A 4FK0A 4TUPA 3I0RA 1QE1A 4N76A 5E41A 4PHDA 3RJKA 4I2QA 7ICRA 1ZQCA 3OSNA 1S1TA 3WNFA 4DG1A 5F9NA 1J53A 3T3FA 1HYVA 3QIPA 3B0XA 7ICQA 4QZCA 4I2DA 3HVTA 5KFRA 2XY6A 2UVRA 1SKSA 3MECA 4ZH4A 1BVSA 9ICKA 5J2QA 5FRMA 1H38A 2IOCA 3TI0A 4J9KA 1N6QA 4M6WB 9ICCA 2BDPA 1XC9A 4C8OA 1I39A 2Z1IA 9ICVA 4M41A 2D0CA 4NY8A 1T8EA 5SZTA 4F5NA 1UT5A 4YMMA 4RNNA 3OYBA 4RUCA 4LZGA 4G1QA 3SV3A 1A5XA 4CE9A 4DFMA 4DSIA 5DK5A 5DDYA 5L1LA 4RQ1A 4DWIA 1KCFA 1WAFA 1KFSA 4W5QA 4KB1A 4OLBA 1PZNA 1WLJA 1ZQNA 3GIIA 1IO2A 3O4QA 5DG7A 2LYHA 1O1WA 2ETJA 1TV6A 1RXVA 1DTTA 3JPQA 3QETA 1MSWD 5J2FA 8ICRA 2BGGA 9ICEA 4DS5A 4ED2A 3OYCA 3HO1A 1RBTA 3HP6A 3LANA 1RYRA 2FPLA 4O3PA 4GLXA 1WSGA 2W42A 1JLGA 4CJ4A 4KHQA 3QEXA 4UAZA 3KHHA 5JUMA 1QSLA 4DQRA 1X9MA 4R5PA 4DLEA 9ICXA 4DU3A 2PI5A 4FJJA 1HJRA 2G8VA 2XCAA 4DSFA 2BCVA 4OLAA 4H4OA 1C7YA 2W9AA 4CGHA 4M3RA 5EOZA 4RQ5A 3OYHA 4J9PA 3BQTA 4ELTA 4GW6A 4K8ZA 4IFVA 1FXXA 1KLMA 8ICLA 1JIHA 1ASUA 4B08A 4Z6CA 3PW2A 1MQ3A 2AQ0A 5KFVA 4R63A 7ICHA 5BPCA 3ZT0A 1NK8A 1ZQOA 2YHAA 1NK0A 1ZQYA 3P83D 4BWJA 1ASWA 2BANA 2BR0A 3AA3A 3V9UA 1JKHA 5EU7A 4DTPA 1B22A 2R8GA 4CK1A 4E7KA 2KZMA 5J2PA 2KN7A 4BWMA 2XC9A 4C8KA 4M04A 1A76A 4K4IA 4KB0A 4Q8EA 3RWUA 1D9DA 2VWKA 1KTQA 1VSEA 4QWBA 1S0NA 4L8RB 4F93B 3CYMA 5CYMA 1RXWA 1S1WA 4ID5A 4EEYA 2C2DA 2HVIA 2R7YA 8ICEA 4I27A 4NCAA 4F91B 5D4BA 3OSPA 3H8SA 4J2AA 3MEGA 4HTUA 2G8KA 1KRPA 2R8JA 2V4QA 8ICQA 3RJFA 4FCYA 2XGQA 4KLUA 1S1VA 5L1JA 4CGFA 4RPYA 4RQ8A 2Q0ZX 1Y97A 3HW8A 5DBAA 4HUGA 5KT3A 4NLGA 4QZEA 4GC6A 3C94A 1U04A 4DO9A 1BPDA 3DLHA 3RRGA 2ATQA 4ED3A 3AA4A 3NTUA 1KEJA 3OYLA 3RJIA 5J0YA 8ICHA 4ECUA 1NJYA 5T7BA 3EZ5A 3QNNA 4FO6A 1JXEA 3TR8A 7ICTA 4DL5A 3KIOA 1S77D 4CK2A 4YR2A 1XHXA 2DFEA 7ICGA 3TAFA 1L3VA 3SNNA 4M0AA 3HYFA 4OGCA 5C42A 3O4NA 5J0RA 4ECSA 4NLKA 4DLGA 3C1YA 3G6YA 4UBCA 4CEFA 1ZJMA 4I7FA 4FS2A 3C6UA 3CM5A 2OZMA 9ICAA 4E3SA 2PYJA 3ZT2A 2HHWA 3PW7A 1SL1A 2P1JA 3QE9Y 3DLRA 4RU9A 4FVMA 3BQ1A 4E1MA 3DRPA 4B3OA 3MAQA 4KFBA 4PA1A 4CHYA 4RPXA 3AVIA 4KTZA 4KLMA 2ZTDA 5KFOA 4YR0A 5J0OA 3H8JA 3VQQA 5DMRA 4LH4A 4FZXC 5KTQA 2GBZA 9ICSA 4HHTA 3G6VA 2ASDA 4OGEA 4IRKA 1ZQMA 4DSEA 5CZ2A 5HBMA 1NOMA 2KFZA 5HRPA 3PO4A 4GC7A 2OYQA 1TGOA 1C1AA 1DGSA 3RTVA 4FZYA 4MF2A 1KFTA 4FJ8A 2FLPA 2XHBA 1J9AA 1LV5A 5J0WA 5L9XA 3RH6A 3KD5E 3MEEA 1B92A 1S9EA 3NCIA 4M3UA 3DI6A 2FPMA 2P6UA 1BCOA 4QZGA 3HK2A 5KT6A 1CXQA 4YR3A 4ZTFA 4K8XA 1MU2A 4E89A 3OYNA 1Q9XA 4MQ3A 4Z6EA 3ETLA 5HRSA 2PFPA 4FLZA 3SQ4A 1MC8A 4KHYA 4UB1A 1IKVA 3PY8A 4Q45A 1C0UA 1SKWA 5KFBA 4Q0BA 3ZSXA 3RH4A 4RW7A 5J0QA 5DBCA 4NM1A 4OKEA 2PFOA 4CJFA 4KN7A 1J5OA 5HNKA 4W5OA 4DMNA 1JL1A 5IIIA 4CEBA 2YNIA 1IKYA 9ICJA 4B9NA 1C0TA 5JS1A 5HP4A 5FDLA 1TKDA 4E1NA 4CJWA 3JPTA 4DTOA 3HP9A 2XRIA 3VA3A 2FMPA 4O0IA 4DQSA 4Z0UA 1ZQLA 2P51A 2ZE2A 3IG1A 4YMOA 3LDAA 3V7JA 5IIOA 1IH7A 1WCLA 4QAGA 3GV8B 4XIUA 1U4BA 2FMSA 4KLHA 4OKKA 2PI4A 1ITGA 3MGIA 3IRXA 1HUZA 4BE0A 4CGJA 4XUSA 3N4MB 4DTXA 4EBDA 3FDSA 3KLFA 1NOZA 1IKWA 1CZ9A 2ATLA 4NM2A 3AVGA 2OPRA 3D0PA 2GWSA 5DQGA 1HRHA 3WNHA 4E7LA 2JZBB 1TFRA 4KO0A 4DTRA 8ICCA 4BDYA 2BCSA 4CJPA 4F4XA 4EZ6A 2RDJA 3AO1A 4GVMA 4KTWA 3SUQA 9ICNA 5J2NA 4RT2A 2PYLA 3DYAA 3K5MA 1KLNA 3H08A 2PXIA 4O5KA 5HHHA 5KG5A 2DFHA 3BGRA 5KFAA 3C2MA 4CJLA 4TSXA 4JV2A 2KZ3A 4QZ8A 1REVA 5J0XA 4CEOA 3L2VA 8ICAA 4M47A 2VG7A 4DSKA 4O4GA 2W9CB 1WSJA 1S5JA 3RMAA 4F3OA 4JRPA 1QSSA 3MXMA 4LVSA 1HQEA 1ZQDA 3LWMA 3SYZA 4KLQA 4Z4GA 3ZD9A 3JPPA 3QZ8A 3OHBA 3EYZA 2FC0A 4M9JA 4CIEA 4G3IA 3AU6A 3DLGA 3SV4A 4O5CA 3V72A 2B4JA 3OHAA 2ASJA 2HHTA 4JLHA 3DLKA 5BOLA 2AGQA 4W5TA 1JLBA 3MDCA 4TUSA 5C5JA 5EWGA 1GOBA 1VSIA 3OYIA 4JS5A 3LAKA 4DSJA 3KLEA 4ZHRA 4PH5A 4I2HA 5DG9A 2PZSA 4K4HA 4ZTJA 1ZYQA 5KFLA 3C21A 4BDZA 5KFXA 4FBUA 5D46A 1S0OA 2BPFA 3CFOA 5JS2A 4F4WA 1FK9A 2HNYA 4CGIA 1UA1A 2BE2A 5KFYA 4FLWA 3V1RA 3UXPA 2G8UA 2BQUA 9ICRA 5KGWA 4DU1A 2AU0A 4DTNA 8ICBA 5IILA 3QLHA 4IQUA 9ICHA 4KTQA 1VSKA 1JX4A 1TL1A 3ZSYA 4AHCA 2NRTA 2F1IA 5DLFA 4RW9A 4CFDA 3LP2A 2ZUDA 1QTMA 4M9GA 4HCBA 3PW0A 5IIMA 4RQ2A 4P4MA 1RNHA 4RQ6A 3HJFA 3MEDA 1SZPA 3TANA 3AVFA 1I3AA 1CXUA 1B9DA 5J2MA 4CIGA 1TL3A 4AHUA 4IQWA 1RT6A 9ICGA 4EYIB 7ICSA 2VA8A 4J2DA 3QEPA 3V6HA 3IAYA 1RBRA 5EWEA 1NOYA 4I2AA 2ZJ5A 1RPLA 5IINA 5J0SA 2LSNA 3ISCA 2HHXA 1IG9A 4DL2A 4YFKA 3JPNA 3QESA 4JV0A 1HUOA 2D0BA 4IR1A 3GIMA 5DQIA 5CA7A 3KHGA 4C8MA 3VQ6A 3KK3A 1TK0A 2HB5A 5KFGA 5J0UA 1EX4A 4R66A 4R65A 4KN4A 3KK1A 1ZQFA 3ZSWA 2I9GA 4KHWA 4BE1A 3RJHA 2KZZA 4UB4A 1RDDA 9ICFA 1U9LA 3NFAA 5I3UA 3RB4A 4F4ZA 4Z4HA 5J2EA 3THVA 4JRQA 1U49A 2E6MA 7ICPA 3PR4A 1WNSA 4EP4A 4DFKA 3RBEA 2VG5A 3QZ7A 4ECXA 1DLOA 3RH5A 4NYNA 1BHLA 3JYTA 4PGXA 3M9OB 1RT7A 3V9ZA 3NF6A 2DPIA 4NYFA 4DOCA 5KG1A 4C8NA 4LY7A 3V9SA 3TABA 3Q8SB 4ELUA 1YTUA 3HXMA 7ICUA 4QZ9A 4BDPA 4Q43A 3M9NB 1ASVA 1JL2A 4IDKA 3L2QA 4ECTA 5HRNA 4MFCA 4KLSA 4I2JA 2I5JA 4NLZA 4CEDA 2X6NA 4DTUA 3PW5A 3T5JA 2D0AA 3ZD8A 1S1UA 2F8TA 5KRTA 3TAMA 3LZJA 2Q3SA 3M9MB 3VQPA 5KFDA 5K14A 1RTJA 5DBBA 4QWDA 1HNVA 3VQ8A 1X9WA 1VSLA 3SI6A 1ZQXA 4GMJB 3SQ2A 2Z1JA 4FLYA 4EP5A 4PWDA 7ICFA 3ZSVA 2I1QA 4QOZB 1NKEA 2A1JB 1TK8A 3Q8RB 8ICTA 4RG8A 3LAMA 1TKXA 3DLBA 1N5YA 1ZBFA 4J9QA 1ZQIA 4B9UA 1IXRA 4UAWA 4J9SA 2F96A 4BE2A 4I2PA 3GDXA 5KFSA 1C1BA 3V7KA 4M42A 4FJGA 2P66A 4K4GA 5DB9A 4BACA 3AA5X 1W0HA 4FBTA 3QEWA 3ZT3A 3S3NA 3N97B 2GV9A 3EW9A 2A1JA 2BKEA 4OJRA 4CGGA 4O3OA 3ZDDA 5F9LA 1T05A 3QO9A 1D5AA 1K1SA 3M8SA 2W9BA 4IRDA 1FKOA 2WOMA 4YCXA 2OPPA 2W9CA 3QEAZ 4EBCA 4CJKA 1KVBA 3HSTB 3RMDA 3RJJA 5FROA 3L2UA 4DFJA 4RUAA 1LWCA 2F1JA 4Z4FA 2G8FA 4CEQA 8ICPA 3B6OA 4I2EA 3QINA 2OA8A 2ZTCA 4JV1A 3PNCA 5KG6A 3LP3A 3K5LA 3KLGA 2OPQA 3SPZA 2HHQA 4RQ4A 2A1SA 1UWBA 2Y1IA 8ICMA 8ICNA 3K59A 2YKNA 7ICKA 4CHOA 2XY7A 3SUPA 3NDKA 4Z4EA 5IIJA 3P5JA 3S3OA 2QKKA 8ICVA 4IKFA 5KFNA 4ED1A 1W9HA 4FLXA 1CUKA 4IFYA 1WAJA 1R0AA 3ZDBA 4GXIA 3A2FA 1NJXA 4ECVA 4O9MA 5CZ1A 3HPHA 4RQ7A 1GOCA 2Z1GA 4W5NA 2AGPA 5DG8A 4EYHB 3U6FA 5DB8A 4E7IA 8ICSA 1Z00B 4HUFA 3CG7A 4F2SA 3CQ8A 1RTIA 5KGXA 4UB5A 1N48A 2AGOA 1JLCA 1LB2B 3ZT4A 5J1EA 3BQ0A 1XSLA 3T19A 4DL3A 2DPJA 2G8IA 7ICJA 4UQGA 3P1GA 1TKTA 5D49A 4KHSA 4CF9A 4AHRA 1NKBA 5J2BA 4YFUA 2HNDA 1WCNA 2VANA 2P6RA 3WNEA 5KFPA 2XCPA 4FJ7A 1FKPA 1Q8IA 3VQ5A 3EPIA 2W9BB 1SKRA 4I29A 2C28A 4MF8A 1NJZA 4I28A 1U47A 1Q9YA 2UVWA 1JXBA 3BQ2A 4F5QA 5FRNA 4QWAA 3L3VA 4KLGA 2X78A 3NF9A 3CM6A 2JLEA 5HHIA 3EY1A 2B21A 4KHUA 3ULDA 1UT8A 2RPIA 4I2FA 8ICYA 3KHLA 1Z3EB 1LWEA 2MUTA 1S0VA 1LAWA 2R8HA 1RBUA 4CJQA 1S1XA 4MEXA 1XSPA 3DOLA 1ZQUA 2RDIA 3ZT1A 2W8LA 2XY8A 1C6VA 3U3GA 2NUBA 4CF2A 1BISA 2FPKA 1HYSA 1X9SA 4H4MA 4ID1A 5CB1A 3C6TA 4QZIA 3HVRA 3SI8A 1S97A 3AO2A 4FJXA 4AILC 3C5GA 3UPQA 4KLIA 4N41A 7ICEA 1KDHA 4MFFA 4F4YA 2JEIA 4DTMA 2AJQA 3OYFA 3OJSA 4QZDA 4FJHA 3EPGA 2A1RA 1BI4B 3VQ9A 1ZBHA 2IBKA 3QEBZ 4KLTA 1GOAA 2XO7A 3TAQA 3I0SA 1ZQBA 3NH1A 4N56A 4FZZA 3TAEA 3AVKA 4E7JA 4CHNA 2BCRA 3KTQA 1NK5A 4I2IA 9ICUA 3NH2A 1U48A 4QZAA 2NRVA 2X74A 1IM4A 3LK9A 4YMNA 2C2RA 2Z1HA 2O4IA 3VQAA 3AVBA 3AVLA 3GFKB 1HQUA 3OS1A 2C2EA 3MXIA 4OPKA 3SJJA 5KFCA 4TUQA 4YNQA 1X2IA 3S3MA 3AO5A 4O0JA 4GXKA 1U45A 5KT7A 3AVCA 3ZDEA 4R8UB 4H8KA 5J29A 4O3QA 4LD0A 1EP4A 4QCLA 4HVJA 4CJRA 1HYZA 3RAQA 2D5RA 7ICMA 1BL3A 4KLJA 2PFQA 4Z4IA 4PPXA 5CP2A 3VQ4A 3OYAA 4KI4A 3K2PA 1B43A 1T03A 4M6WA 5KFHA 3RB3A 3NGIA 2HMIA 3KD1E 4PQUA 2C22A 1ZQAA 3KKRA 2FBYA 3KHRA 4R8UA 1RTHA 1D9FA 1SV5A 5CJ7A 3H4BA 5DB7A 3OJUA 4UBBA 4FXDA 1A5VA 3MDAA 3LWLA 4IQTA 1JLFA 1BI4A 2G8HA 4CECA 5KT2A 1ZJNA 5KG4A 2ASLA 3MR2A 5J2AA 4MFBA 4JK1A 1S9GA 5C24A 4I9QA 3GV5B 2IS3A 4CJEA 4QZBA 3G6XA 4IG0A 3PO5A 4M9HA 1WSEA 4LZDA 3MR3A 1EXNA 4O3RA 2Y1JA 2KFNA 3H7IA 1EKEA 4BXOB 3V9WA 3O3HA 4HYKA 2FBVA 4CEEA 4ECYA 1XU4A 3MBYA 4I2GA 4JS4A 2HHVA 5J0PA 3ASMA 3F73A 4YD1A 4KLFA 4Q44A 5KFKA 3ZSZA 2OPSA 5HLFA 3JPRA 3AVNA 4O3SA 3V6JA 3G10A 4IR9A 4DL6A 2B5JA 3MFIA 3GIKA 4DQQA 1HMVA 1KVAA 1ZQTA 3V9XA 3V6DA 1V9PA 4FW1A 2JEGA 3QIOA 1L5UA 4RW4A 3L2RA 3LP1A 3HL8A 4UB2A 5J2IA 3PVXA 5KFMA 3MR5A 1YVUA 2JEJA 1TVAA 3OYKA 2F8SA 4QW9A 4KHNA 1DOQA 1EETA 1S6QA 2IDOA 1CEZA 2JEFA 4B8AB 1BGXT 2DY4A 8ICOA 2ZTEA 3F9KA 4CFCA 3PUFA 2GUIA 3KLIA 1ZQJA 2XGPA 4CGDA 4ED8A 1ZQSA 4M45A 5J2KA 4AHVA 4Z4CA 4E7HA 4J9RA 4YN4A 2BCUA 4FLVA 5J2CA 1BPXA 4F50A 9ICIA 1YTAA 7ICOA 3AU2A 1T7PA 1JLQA 3GIJA 7ICLA 3H8WA 1CZBA 4FM0A 8ICJA 3VA0A 1LAVA 4O5BA 3AO4A 3RRHA 3HWTA 4LH5A 4AH9A 4KLLA 3LPUA 3K4GA 2KQ2A 3ZCMA 3K57A 4CF8A 3PW4A 5C25A 4RQ0A 3MGHA 1VK0A 1XHZA 2V9WA 4Y1CA 4RNOA 3LDSA 3L8BA 1S6PA 1ZQVA 3NHGA 1J54A 3HPOA 3UXNA 5DDMA 2XY5A 3SZ2A 1XO1A 1HPZA 1ZBLA 1S9FA 3PX0A 3V81A 4PUOA 9ICMA 1RT4A 4FM2A 3NGYA 4IG3A 3GILA 4CFBA 5KFFA 1NK6A 1SL0A 4GXJA 1RT3A 3GQCA 5IIKA 3MABA 3TARA 4DEZA 3M8QA 4QZFA 3OGUA 4AHSA 8ICFA 3DMJA 2HHSA 1B9FA 1VSDA 4EZ9A 3C5FA 1XWLA 4M3XA 3IM1A 4OPJA 3Q8LA 1C0MA 1QHTA 9ICLA 2IHMA 1XSNA 3QNOA 5D3GA 4B9VA 3O3FA 5KT5A 4DTSA 1HJPA 2RF2A 3LP0A 4RT3A 1XI1A 4YG2A 4NCBA 4FS1A 3JPSA 4CHZA 4FYDA 1RZTA 3HT3A 4B8CA 5CWRA 4DQIA 2EHGA 1S0MA 2HVHA 1ZQQA 3OYEA 1UA0A 4UB3A 4F4KA 3CFRA 1BPZA 4CCHA 3H4DA 5J2HA 2E6LA 2FBTA 3VQ7A 3OYMA 7ICVA 2NRWA 3ZSOA 3AVAA 3NH0A 2HW3A 5KFUA 3Q8PB 5HMLA 4JUZA 4HCCA 4J9MA 1WSHA 2ZQBA 1SL2A 1TAUA 4YQWA 5CYQA 4ECRA 1RT1A 3C1ZA 3TAPA 3E01A 4PGQA 4KLDA 5DKWA 5J2GA 2BQRA 2E4LA 3AA2A 4Y1DA 1MQ2A 4DSLA 8ICUA 3DRSA 3LPTA 3BDPA 3T1AA 4DOBA 8ICZA 9ICWA 1EXQA 1IKXA 3ISNC 4J2EA 4FJIA 3V4IA 3AVJA 5L1KA 3Q8QB 3ORYA 5KFTA 4XRHA 1JLEA 4Q5VA 3NBPA 4CJTA 2ZUCA 1C1CA 2J6SA 1RBVA 1NK4A 1AROP 4FK2A 5KFEA 5CHGA 4CIFA 4P4PA 2YV0X 1RDAA 4CJ5A 4LSLA 1A77A 4J9NA 2M9NA 2R8IA 4ELVA 2YNGA 5I42A 3ITHA 4ED0A 4Z6FA 4CEAA 2UVVA 4NLNA 4FJNA 2DFLA 1ZBIA 1VSFA 1NKCA 4QZHA 4O5EA 1LW2A 2ALZA 1T3NA 4F5PA 1Z26A 4DF4A 8ICIA 4KAZA 3HPGA 1VSMA 2QK9A 3QEVA 4F92B 1LW0A 4J9OA 2BQ3A 8ICKA 3M8PA 4N47A 2ZJAA 1ZBUA 4M9LA 3GV7B 2PFNA 4R64A 4O3NA 3I8DA 3ZSRA 5DQHA 4CFAA 1HNIA 9ICQA 1BPEA 2G8WA 2IHNA 2VA2A 4M3YA 4M9NA 1XS9D 1N56A 1RT5A 2J6TA 3DRRA 3V7LA 4DS4A 8ICXA 2QKBA 4F8RA 3TFSA 3CFPA 1Y88A 1ZQZA 4XQ8A 4IRCA 2NRXA 4PHEA 2FBXA 2IA6A 3RAXA 3PR5B 3DM2A 4KLEA 3LALA 4J2BA 1VRTA 1WN7A 4O44A 3VN5A 2QXFA 2J6UA 3ALYA 4RW8A 3C2KA 5EWFA 1QQCA 3OVNA 4KRFA 3VQBA 2O4GA 3BJYA 4Z6DA 4CHQA 2IAJA 4ECWA 5J0TA 5KFJA 5DB6A 3SUOA 4PHAA 5KT4A 4ECZA 2DTUA 7ICIA 5KRSA 4FLUA 3K5OA 3VQCA 5SWMA 3RB0A 3JPOA 4XA5A 2FLNA 1S76D 3TWHA 5HP1A 4FJ5A 4B9LA 4CF1A 5KI6A 4BGDA 1CLQA 9ICTA 1LWFA 1ZQHA 5KFZA 4CF0A 4RQ3A 1UAXA 3TQ1A 3SPYA 1L3SA 1K6YA 1ZQPA 1TV9A 4CJ3A 3NGZA 5CR0A 1ZETA 1VSHA 4CEZA 5TZVA 2YNFA 1D8YA 1WSFA 4YXJA 3UXOA 3RMCA 4FJMA 4PY5A 4TURA 2H5XA 9ICPA 4QWEA 4PHPA 4KMUA 9ICBA 3FYHA 4F5OA 2NRZA 3NF7A 1TAQA 4JWNA 2V4RA 2BPCA 1L3UA 3OS2A 5KFIA 4M3WA 3VQEA 1Z00A 3ZDAA 4B9TA 4FW2A 5J2JA 3RJGA 3S9HA 2JZBA 1QS4A 2BCQA 5KG3A 2R8KA 1K1QA 1RT2A 4NXZA 2ITGA 2IMWP 1TKZA 4FJKA 4YP3A 1QSYA 1T4GA 4KPYA 3SUNA 4F3TA 2VG6A 1VRUA 2YKMA 2W8KA 3FFIA 4CESA 4I2CA 4IQVA 4W5RA 1RTDA 2OZSA 5DLGA 1NJWA 3OS0A 1RILA 3UIQA 1Z25A 2EX3A 3G0ZA 3C23A 3NF8A 3T5HA 1RYSA 4RPZA 5J2DA 1L3TA 3E2EA 3PX4A 4KV8A 4KITB 7ICNA 3DLEA 2RKIA 4NCGA 5KFQA 4B9SA 1YT3A 2YHBA 2YNHA 1JXLA 2VWJA 1NK7A 2ISPA 3KK2A 4RW6A 3Q8KA 4DF8A 1KSPA 4RNMA 3C95A 3AV9A 4CHPA 1JN3A 3T5LA 1UOCA 4UAYA 4M3ZA 1SUQA 4ED6A 3NGDA 9ICOA 3PMLA 2VA3A 1X1PA 3AUOA 1WSIA 2P5GA 5KG0A 4X5VA 3NE6A 3HM9A 4YXMA 2FLLA 4FK4A 4N5SA 4TQRA 4TQSA 4DL7A 1ZQGA 4E0DA 2X6SA 2F1HA 4CK3A 2JGUA 4OKJA 4I9LA 3K75D 4M2YA 3U3YA 4FLTA 5HRRA 4HUEA 3TAGA 3C2LA 1S10A 5L1IA 3IHQB 3K5NA 4OVLA 3NAEA 2WONA 1COOA 1KVCA 5HROA 1BPBA 5HMMA 3OYDA 2HNZA 4IBNA 4M3TA 4FM1A 8ICWA 3B6PA 4DL4A 3PMNA 3B0YA 1G15A 3V1OA 3ZSQA 4Q8FA 3DOKA 4F5RA 2ISOA 2WTFA 2ZJ8A 2AQ4A 4QWCA 4J9LA 4PGYA 4DOAA 3JSMA 1F21A 2MAXA 1TVRA 1KFDA 4DTJA 2MUTB 4WE1A 4DQPA 3RB6A 4CJSA 2PY5A 3EWAA 3OYGA 8ICGA 2IGIA 1ZQRA 1ZQKA 4B9MA 1VSJA 3PV8A 3MR6A 3RR7A 1BQMA 4ICLA 3O3GA 5CY4A 1BCMA 3HX0A 4LSNA 4KI6A 4ED7A 3KLHA 1JLAA 3SCXA 3ISDA 4CERA 1NK9A 4BXOA 4AHTA 1A5WA 3ZDCA 5BOMA 3SQ0A 1DTQA 4QW8A 3MFHA 2KTQA 2ZD1A 5DGAA 3OYJA 4EBEA 3RR8A 3QEIA 3AVMA 2RN2A 4DFPA 3QERA 3LZIA 3ISBA 1JMSA 4YVZA 2FMQA 3OY9A 2OWOA 3RBDA 3MXJA 2UVUA 2B6AA 3L3UA 3T5KA 1RCHA 3UQ2A 3WNGA 4E19A 5DGBA 3PX6A 1QLNA 3V1QA 3AVHA 4O55A 4CJVA 2W9MA 4CJUA 3L2WA 3H40A 4ECQA 2BGWA 2HHUA 3D45A 3VQDA 1RDBA 4I2BA
chains in the Genus database with same CATH superfamily
2LQJA 3K58A 2VFVA 2VQEK 2PEHA 2GTDA 2XMJA 3CJSA 5GMKa 1OMSA 4FJ9A 4DMZA 4RQMA 2IC3A 2BPGA 4F2RA 1ZQWA 2Q79A 3AOAA 4C8LA 2XMVA 1BIUA 2ZIVA 4QU7A 2ZUBA 3KZXA 4KLOA 5JRTA 4TN2A 3IS9A 4P4OA 5AE1A 3NVYA 4YDXA 5GAGU 3I55S 3PYDA 1RDCA 2P5OA 3HD1A 4TUPA 3I0RA 3RZAA 5E41A 3CPWM 4H0PA 2EFQA 4WFBQ 4CWBA 3D5MA 5DZ7A 2I6WA 3IM8A 2QEXS 3FLCO 2ROPA 5F9NA 3U1LA 1HYVA 1ZRMA 7ICQA 1WEYA 3ZI4A 2NYHA 1RCOB 2SXLA 1BOTO 1WWHA 2WMMA 2UVRA 4MJKA 3DOMB 5EN1A 1N6QA 4M6WB 1LWFB 1KN5A 9ICCA 3R5GA 4PKIA 2R7VA 3OPXA 9ICVA 3VALA 4P74A 3EZWA 2KHQA 3E01B 3D1HA 4F5NA 1UT5A 4LZGA 1A5XA 4DWIA 1MN8A 2I38A 3MMAA 4QPXA 4NLSA 2NUUG 4DX7A 3J8AA 1HBUB 1WAFA 3HKWA 5K8NA 1IVZA 1OWXA 4XTTA 3ICXA 4LFBJ 1WLJA 3GIIA 1IO2A 5DG7A 3OBYA 5AXMA 3I33A 1HR0K 2NRHA 1PCAA 3Q89A 4C98A 3N6MA 4KGKA 4DR3F 4WFNQ 5AFUH 2A19A 3EGVA 2BGGA 4JI5K 2PE8A 1TKZB 1HWUA 3DC2A 3HO1A 1CQMA 2E5LJ 1RYRA 5J1NA 1WSGA 2CPHA 1JLGA 3WQUA 3HHNB 4CO4A 3SXLA 4DQRA 4K8RA 5F1XA 1FJGK 4DLEA 2DIUA 3DHXA 1OH7A 4BC9A 4JI0J 2G8VA 3BV8A 3U7JA 1C7YA 3I28A 4CGHA 3PEJA 2O66A 3E9PA 3N28A 3BQTA 1M1GA 2Z57B 4ELTA 2R7XA 2EDUA 3FRYA 2PN6A 4LMZA 3ZTSA 4QYZJ 5IWAJ 5HANA 1WF2A 3H1VX 1IBMK 2AQ0A 2D1CA 5GMEA 4BLGA 5K5MA 1U6ZA 1UPPA 3M6VA 3AA3A 4ZLJA 1R8PA 1SC3B 3FK4A 1JKHA 4YS2A 5EU7A 2LCWA 1RAOA 2ZBPA 2H3VA 4KQZA 2KN7A 1K0VA 3OLBA 1BUPA 4C8KA 4FPBA 2BTFA 4KB0A 5J2QB 4Q8EA 5BYRA 1VSEA 1FX2A 2KG1A 4F93B 2F65A 4L8RB 1S1WA 4ID5A 4EEYA 3ELHA 1SWVA 2N3LA 3ZYYX 4NCAA 4X4PA 1XK8A 4P9SA 5IS2A 3H3OB 2G8KA 2R8JA 3JAMU 1SV5B 3GDQA 3J7YI 1E4FT 2HFSA 1TFYA 3CIPA 2WHEA 3J7AN 1XNQF 1U04A 2GQCA 3HHLB 1X3NA 4DO9A 2IOFK 4V1Ak 3AA4A 2QX0A 1KEJA 2OMOA 5J0YA 2UV8A 3O5BA 2GO8A 3QIDA 1FKOB 4FO6A 2ALYB 4KH1B 1IWGA 3AOCA 2BDUA 4YR2A 4QQBA 1XHXA 7ICGA 2DFEA 1PYSB 1Y5IB 3AGKA 4NI2A 4M0AA 3LP0B 1LW2B 1Q18A 1FFUA 3H45C 4DLGA 4K0KJ 3CCJN 3G6YA 2EK6A 1O13A 5LL6d 5GAEI 4FKYA 2XLIA 4I7FA 2IBOA 1K73O 3CI5A 2VG7B 2G9OA 3ZT2A 1SL1A 1EKRA 1HBMA 3U27A 2F3NA 4BRAA 3M1VB 1MG7A 1VJQA 4KFBA 3ETOA 4NWBA 2W2OP 2CPFA 2ZTDA 1Q7YT 2XSJA 3H6EA 3TSQA 4KRWA 3RU0A 2QWMA 4FZXC 1YHQN 3MTJA 1JROA 3MF5A 4HHTA 2WBMA 5IV4A 2LDIA 4OGEA 3FGVA 1NHUA 3O1WA 4F3QA 2WVEA 5CZ2A 3VAHA 1NU0A 2OIHA 4JI8K 4JI2K 3ULEA 2GVZA 1DGSA 4FZYA 1KFTA 4FJ8A 4ED4A 2XHBA 1LV5A 4ETXA 3AHPA 2WW8A 1PBUA 3MEEA 1S9EA 3NCIA 4QIVA 5AKGA 5D4NA 4OV1A 1Y9OA 2P6UA 4OI2A 1BCOA 4B1ZA 2VJUA 2IHR1 2LMIA 4YR3A 4K8XA 5BN8A 2DPNA 3W61A 3I32A 1H2VZ 2E5GA 4MQ3A 5HRSA 2PFPA 3HVWA 4DR1F 3SQ4A 1FD8A 3CMQA 4AYBD 4BREA 4Q45A 2QSFA 1YITN 1SKWA 5CE3A 4M5HA 4NJ8A 4H54A 2E20A 1RTZA 4NM1A 1WWUA 4CJFA 1HNZJ 2UYTA 4ISEA 2DKZA 2P9IA 3C14B 4FWLA 2F4VK 2B6AB 4BRHA 3CNQP 2NZTA 3CVKA 5EX0A 3A3PB 5AQJA 5FDLA 2G09A 1OY8A 2V50A 1GLEG 4CJWA 3SFGA 5M2PA 4DTOA 1UZHA 2B9WA 3CCJS 1D1UA 4Y2QA 3VA3A 3ZEUA 1ZQLA 2HI0A 2AF6A 2BKNA 2WBRA 1NDPA 4YMOA 1F3VA 5HMXA 5HMYA 5CRXA 4H4KA 1ITGA 1HUZA 4CGJA 5I3QA 4EWTA 4DTXA 3FDSA 4H0YB 2ATLA 4WP9A 4NM2A 3O8MA 2OPRA 2YVSA 2GWSA 3OR2B 1HRHA 2XWXA 3CMEN 5J1EB 2ZJPQ 4LVOP 5IT9O 2BCSA 4F4XA 1ZC6A 5LY3A 3K17A 4RPFA 3MCOA 9ICNA 2AYGA 1UJ6A 2PYLA 4M63A 3ETRA 3T41A 2CH5A 1QVFM 3H08A 2EKYA 5A2QY 1QAJA 4JHDA 1Q95G 1J2VA 4BRPA 4OMFG 2DFHA 1RT3B 2DHSA 1NCLA 2AP6A 3D0IE 3C2MA 4NWIA 3TTCA 5LOQA 3QUCA 4CJLA 4TSXA 3WEEB 3HVTB 2EFNA 4JV2A 4KMOB 2K4IA 4QZ8A 2N1RA 1R0AB 2YWHA 4ILRA 2NSCA 4KGVB 2BX6A 4M5JA 3T79A 4CLWA 4X4NA 3OTBA 1U6BA 3L2VA 1MNEA 3HKZC 4M47A 2KLAA 1HWIA 2NO4A 3MXMA 4R5PB 3SD7A 5BR8J 2RQKA 1TP7A 4KLQA 2FVSA 4Z4GA 3ZD9A 4M9JA 1NGCA 3AJ1A 4KX3A 3V72A 4J03A 4DR7F 1VQ8N 4K4VA 5BOLA 3NMUA 2VQEF 3GB0A 4EI2A 3V4MA 3OV7A 2OO4A 3DYAB 4CLZA 3GR1A 2VPYB 3IFEA 1GOBA 1VSIA 2ZIUB 4PABA 2H3IA 2G5HB 4I2HA 3F44A 1E3MA 3MD3A 2K8AA 3JSRA 4ZTJA 1ZYQA 2Z56B 5KFLA 3C21A 3H8MA 4I6MB 3F5AA 3A13A 3DMJB 4FBUA 5D8HB 5JS2A 1FK9A 2HNYA 4CGIA 4A8WA 2YWKA 5ELZA 2NXNA 4IL6U 4M5DA 2J4RA 2G8UA 2DR8A 4ZJLA 3QLHA 7FDRA 1XO0A 3NP5A 4CRXA 1TL1A 3ZSYA 1S3XA 3MHYA 1OYEA 1YRUA 1Q86T 2IFXA 1KDNA 4N7TA 3D66A 3CMES 2WAQF 1QTMA 3OXLA 1H0HB 5E3PA 4M9GA 2YI1A 4HCBA 3PW0A 4RQ2A 1RNHA 4RQ6A 3T9ZA 1XNQK 4A8EA 3DRXA 2OFHX 2YMQA 4K2XA 1NBWA 2BJ8A 5AQWA 4IQWA 1RT6A 5A8WB 2BYCA 7ICSA 2LDYA 1ZD3A 2O3DA 2Q6BA 3QU7A 3QEPA 4J2DA 4WQ5A 1XTZA 5C15A 3O5TB 1NOYA 3MPDA 5IINA 5J0SA 1B7FA 4BC5A 1XIQA 2V5HG 5I3UB 1IG9A 1X4BA 3D6JA 4QYRA 2VQFF 2HSZA 5F8GA 4IR1A 5CA7A 2UXDK 3WX4A 1TK0A 4B6JA 3SSSA 2AT1B 4OJHA 3AY0A 4R65A 4JI5F 2MHEA 3KK1A 1CJUA 3BKTA 3MCPA 4BE1A 1HNVB 3RJHA 1OUQA 2KZZA 5CA5A 3CMAN 4UB4A 2FJXA 4JNEA 1MROB 2DBBA 4ID8A 2P9GA 1RDDA 3X3UA 2IVPA 3VF0B 4JRQA 2HRTA 4ZVUB 2O1PA 1ZOLA 3WKDA 4EP4A 3FZKA 5E84A 3D6MB 3RH5A 4BRFA 4Q2MA 2HZVA 1NLVA 1HBOB 3DEEA 5FLXY 4PGXA 4PPDA 2LU1A 1RAEB 2UUAJ 1RHQB 3HDSA 1KC8O 2FVPA 3FKBA 3NF6A 4FZVA 3V4IB 2P9LB 3ZX2A 4C8NA 3C6AA 2IPOB 3QICA 4P7TA 3SENA 3MM9A 2XMTA 4CZCA 5F3ZA 1YTUA 3N7PD 4Q43A 4USTA 4IDKA 3SAHA 3UVJA 1RA7A 2QSWA 4CW7B 4NX9A 4QS8A 5KPZA 4CEDA 4JV5K 3CCZA 3ILJA 2WAQC 3LO3A 2F5GA 3T5JA 2WF8A 3ZD8A 5A8KB 3TACB 3ZZUA 1NB7A 2IJNA 1S1UA 2F8TA 2LM1A 5KRTA 4MO5A 2HF3A 4OZ5A 2CQBA 1CJTB 4MHVA 2YKOA 4LRFA 5CD4A 4QWDA 1RWXB 1HNVA 3J7ZO 4LFCK 2VPWB 3SI6A 4GMJB 5AIBA 2HK3A 1FX4A 4WU2A 4PWDA 2BJ1A 4KGZB 4QOZB 1DGJA 1V9OA 8ICTA 2JVRA 4RG8A 4ZCMA 1TKXA 4X2BA 1EP4B 4B9UA 3PHEA 1IXRA 2AX0A 4N77A 2KK0A 2FLOA 1G2EA 4BE2A 5BR9A 2J0QD 2JHEA 1RSCA 2HKEA 4ZDNA 2P66A 3ULEB 2K3IA 2NCKL 2C2KB 2AZ3A 4DR2K 3UCUP 2KJWA 1W0HA 1Q46A 3QEWA 4JI6K 4KV8B 1KC8T 3S3NA 4ICLB 3N6LA 2GV9A 3L09A 2P9PB 4CGGA 1FFVA 1FDNA 4ES1A 4OX9J 4Y2YA 2YPZA 4PPZA 2F8LA 4UOFA 3EN9A 4IRDA 4YN3B 3QU9A 2G0AA 2MKYA 5CHIA 2GWJA 3PTWA 4CI6A 3RMDA 2O8FA 1Q5YA 3AQFA 3O0FA 2HYIB 5ALWA 3B6OA 4UY8T 2XS5A 5KG6A 4BY9C 1HWKA 4MH8A 2OPQA 4NB4A 4QIFA 2LECA 4DV0F 4F0KA 1WKJA 3MM5B 2U2FA 3PIPL 2AHOB 7ICKA 1Q1KA 4YHHF 2RDDA 4ZCIA 2VQFK 2H5IB 3FSXA 3HSJA 3S3OA 4ED1A 1W9HA 2UUBJ 4FLXA 1TKXB 1CUKA 1WAJA 2PSZA 3W8PA 2EKNA 2FQQB 4LRAA 3JTPA 4IOAL 1YI2N 4W5NA 2KHVA 4RLEA 3U6FA 4C0OC 4DR4J 1Z00B 4USUA 3A8IA 3MEDB 1MN9A 1RTIA 3BR8A 1JLCA 1LB2B 4LF4J 4AUKA 3T19A 4QR1A 4DL3A 2DPJA 2G8IA 1RLDA 3KFUF 5LMUJ 1RT4B 4YOYA 4X65K 2AXTU 5D49A 4JI4J 1UW9A 4AHRA 4W90B 2ZGYA 4ER8A 2FJAB 1XMQF 1Q8IA 3VQ5A 3P49B 3FZHA 4ZLLA 2W9BB 2KXHA 2C28A 1JQGA 4X66F 3CCQS 1U47A 3KWMA 4F0HA 1VBXA 4A62A 4F5QA 5AKJA 2RQMA 4KLGA 2X78A 4WFZA 4U6PA 3LGHA 3CM6A 3OUYB 5HVGA 2LHTA 2KVIA 2H4YB 5LT5A 1UT8A 3DFEA 3L7OA 2R8HA 1RBUA 1VQNN 2RDIA 1SH3A 3ZT1A 4YOEA 1F1BB 4YDUA 1S1TB 1C6VA 4DR7K 2NUBA 4CF2A 2HHHK 4WYBA 1HD1A 5J8YC 4I68A 5IWAK 4FO0A 4RWTA 4H4MA 5CB1A 3C6TA 1KQSR 4IKAA 4DDFA 3AO2A 4J90A 3VOVA 4WBFA 2V8VA 4CBUA 4M94A 4KLIA 1FFGB 2GLEA 4QZDA 4R0JA 4FJHA 3EPGA 2OFGX 3GONA 4ZVSB 3M32A 4BC3A 2EAPA 4KLTA 2XO7A 2KFYA 2PIIA 2W4DA 4JI2F 4A2AA 3QDKA 4N56A 2OEJA 4C8ZA 3AVKA 5AQHA 3WK7A 3DLLQ 1HNXJ 2YWGA 5CR4A 4QZAA 1J2MA 2NRVA 9ATCB 3IS9B 1UW4A 4NLBA 3CF5L 2LQ9A 3CNHA 1SQFA 2JFDA 4JD2B 2QFJA 3MR7A 3GFKB 3VQTA 2PEBA 2C2EA 4WE1B 5GIOA 4TUQA 1S6OA 2QLWA 1U45A 2VIXA 1TZ0A 1WOPA 3WQTA 3CCEN 5J29A 2P6TA 4O3QA 2MSNA 3MPUB 1DQ8A 1T6DA 3JS9A 4HVJA 3E0FA 3BF4A 1VQ6N 2D5RA 2RHQB 1BL3A 3ISZA 2MLZA 3QBCA 4KI4A 4USWA 3W64A 3K2PA 1MWZA 1RISA 4M6WA 1HI1A 3G96A 3NGIA 2WB1F 1D8BA 2FJBB 2RUSA 1OY6A 3KKRA 2QTDA 5KAKA 1D9FA 2UXDF 4NASA 3OJUA 1UL3A 3DGPB 4FXDA 4M7YA 3G4SS 1JRPA 4C1NK 4IQTA 1BI4A 2B0GA 2G8HA 2YX6A 2P9CA 7FD1A 3MR2A 2KV2A 5HJYA 2XM3A 3GFZA 1DRGA 3GV5B 2AIRB 2IS3A 3OTOJ 4GVBA 1SH2A 2KXNB 1CJVB 3MR3A 3H7IA 3IWNC 3QT7A 3O2IA 3O3HA 2ZWPA 4CRJA 3H90A 4ECYA 5LMUK 4LQ9A 3PJXA 5GAGP 5D0EA 3MBYA 1TL7A 1TL3B 5C2DA 4KLFA 5KFKA 4ZP7A 3JPRA 2AEFA 4JBCA 4DV5K 1VBZA 2DGSA 3FVYA 2F8KA 4DV1F 2WW4A 3NKYA 4IR9A 3TUPA 4BC4A 3BYRA 2YQ0A 2DH7A 3BS9A 3ZZPA 2E1ZA 1KVIA 2HF4A 2ADBA 2DUYA 1KVAA 3QUBA 3V9XA 2J9EA 1NRKA 2ZBCA 4BRMA 2X1GA 1JLGB 1X40A 4D3GA 5AJ3F 1PJ6A 3LTOA 3H42A 1ICEB 3HL8A 4C4RA 4UB2A 2J9DA 3SFUA 4CO2A 2GFFA 2XI3A 2FGCA 2D69A 5KPTA 2OSQA 2F8SA 4QW9A 3TVYA 1DOQA 3IRUA 3QFHA 3M2UB 8ICOA 5KQDA 2NQPA 3FR0A 4KT0C 1WTFA 2XGPA 1UQVA 2PFDA 5J2KA 5HQMA 3WXMB 2DR7A 4J9RA 1U0HA 2KT3A 2WB1C 4F50A 9ICIA 2DNPA 1CJVA 2XZWA 1H6KX 4CI0B 3GIJA 7ICLA 2RRAA 1U25A 2B56A 5ETOA 3VA0A 5DO2A 1WC4A 2DCUB 2F1FA 3EMTA 1RHJB 1FXDA 1I51B 3MMBA 2QL5B 4GV3A 4KLLA 4CF8A 2NNWA 3MGHA 3NGRA 3F2KA 2V9WA 4FPIA 4GY2B 4OZ2A 1N36K 2BVZA 2Z58B 2GQQA 5HQLA 2HS4A 3L8BA 1U1LA 2HRUA 3DOMA 1P7DA 2CWXA 3HPOA 5HSPA 2BKOA 5F0UA 5DDMA 3THXB 1U2CA 4G9BA 1S9FA 5B5EU 2E88A 3V81A 4G1IA 3KWIA 3I87A 4DQ8A 2ZZTA 1QQNA 2JMGA 4ACOA 3D54A 1SV0C 2GNKA 2JH7A 3D4JA 3MI7X 1G3OA 1AXQA 2G0CA 4IO8A 3Q22A 1HNXF 1X4DA 1XWLA 5T7LB 4X62J 2O8EA 1URNA 1G7CB 3IM1A 4WPAA 4ZVTB 3I96A 3Q8LA 1C0MA 3MM8A 1Z1ZA 1L7PA 3W2VB 4B9VA 3LP0A 2RF2A 3LDOA 1VI7A 3CUNA 4YG2A 2E9ZA 1JJ2M 3FQKA 3U9DA 2I5JB 1RT2B 1AZSB 4JB3A 4FYDA 3HT3A 5CWRA 2OCEA 3UN2A 2DNYA 2M9KA 1V6HA 4CM0A 4FWNA 1BPZA 3H4DA 1DLOB 2FBTA 1N88A 2NRWA 4FF2A 5KFUA 2YNHB 3UD4P 4J9MA 4NXMJ 2JRSA 1VGYA 3R6GB 5CYQA 1OKJA 1N8RO 1NHKL 2J0WA 2XB2D 3E01A 4NL5A 5GVQA 2LMRA 4YDDB 5AZIB 1PK1B 4NMXA 2EWSA 4NRTA 1Q81O 4CF3A 2E7XA 2EAMA 5GMDA 8ICUA 2EBGA 1NPKA 3BDPA 3T1AA 4DOBA 8ICZA 5B7WA 3AAWB 2VPZB 2IYGA 1HJOA 4OYAA 2HQDA 3V6DB 3KUGA 2HMIB 3ORYA 1FJEB 2P9NB 1NBEB 1E6YA 2C42A 1JLEA 5HVFA 4J9VA 1SGGA 2RU9A 4WYLA 4X4QA 5C42B 1FA0A 3C6HA 2L9NA 4HHJA 1NK4A 1AROP 5RUBA 5DM7Q 4OZNA 1RYUA 4LSLA 2M9NA 2XMUA 4ELVA 4ED0A 4Z6FA 2XMMA 4CEAA 4IS7A 3K9JA 2EZXA 3QUQA 2EG1A 2UU9J 4JKGB 1OH6A 1HARA 1X9XA 1NGIA 2OLWA 2CADA 4X4TA 2ALZA 2A3VA 4F5PA 1PAUB 5IT4A 8ICIA 4KAZA 1N6QB 4F92B 1YJ9S 1LW0A 3R8EA 2BQ3A 4N47A 8ICKA 1MROA 2MKJA 2ZJAA 4CTAA 3MDQA 1ZBTA 1NGDA 2R2TA 2VOPA 2PFNA 5E3AA 1WTBA 3D6RA 3NY0A 3CTRA 9ICQA 1XNRJ 1X3MA 2QWRA 3RJMB 2VA2A 1SBRA 3CWJA 4M9NA 2LEPA 3J7A1 3AA8A 5C10A 2LBOA 3E51A 2W43A 8ICXA 4AP9A 5EE9A 1H98A 5A2QU 2RB7A 1OS5A 1Y4ZB 4JI7J 2ADCA 4UT4A 2IA6A 2I0XA 3PR5B 2QMXA 4JEPA 3PZPA 1GEHA 3O3LA 3LALA 4DV1K 2CA9A 4CZJA 2JDJA 4XK8C 1EJ7L 1YJWN 1SC1B 3ALYA 5FPMA 1GXLA 3UDCA 5AKIA 4JI8F 2AA4A 5AICA 1VQ4S 3RF9A 3OVNA 2IM2A 4KRFA 5FJ4A 2O4GA 1KONA 2P9LA 3A12A 2VB6A 3QMLA 5KFJA 2FZKB 3ET6B 1RHMB 3OVAA 4CH1A 5KT4A 2HK2A 1YF5L 5JVHQ 3PRDA 3Q23A 5KRSA 1DK2A 3K5OA 3VQCA 4Y2PA 3T1YK 5JMNA 5HP1A 2X1FA 2KB2A 4FJ5A 2MLXA 4NZ6A 2ZZNA 4LT6A 5KI6A 1CLQA 3U1NA 1LWFA 2CNLB 3K89A 4JKFA 3BF3A 3R6MA 5ALHA 1K6YA 1SV4A 2G5IB 1RU2A 3JQMA 4A61A 1K8KB 3H5XA 3DRPB 4AL5A 1T05B 5TISU 3IR6B 1I94K 1WSFA 1GX5A 4PY5A 5AQQA 1I1GA 2N3OA 2FIUA 4TVAB 1FESA 9ICBA 3FYHA 1RGVA 4OHXA 3O08A 5KOXA 4X62K 3AN1A 4ZPDA 3VF6A 4K4XA 3EZUA 3P5TL 4X65J 3FBCA 4M3WA 4WFYA 4LF6F 5GINA 2O8CB 3VAJA 2AJ1A 1Z00A 3ZDAA 1A7GE 4NOHA 5DDPC 1U1MA 4FW2A 1W7AA 2VYPA 3RJGA 3OL6A 1Q7YO 5BPMA 4FJKA 3MOZA 1YHQS 5A2QO 4YP3A 1VRUA 1NGHA 5B0GA 3FFIA 4W4MA 2BUPA 2MTLA 2KDOA 4Y28C 5B0AA 4I2CA 5AQYA 3NASA 4IQVA 4W98A 4W5RA 2OZSA 1HKBA 5ALDA 2YNFB 2B4PA 3O1LA 3B82A 3NF8A 4XPCA 3T5HA 4RPZA 1WC5A 3RBZA 1L3TA 2FHKA 2GCFA 3DLEA 1EKSA 1TUVA 2CQHA 5K8PA 2AYEA 3CIMA 3V2UC 1ESVA 3QJJA 4B9SA 3N4PA 1YT3A 2UXBK 5GTHU 1F2HA 3NNAA 4FL9A 4DF8A 1KSPA 3HHKA 3T5LA 4FOIA 4AM7A 4JKEA 3TO8A 3NGDA 1CS4B 2HS3A 1QE1B 9ICOA 3EUB2 2NPIA 3A5OC 1W2IA 3D2NA 5KG0A 1RM6C 2EFGA 2QG9B 2E2PA 4FNHA 3HM9A 4FK4A 2LI6A 2VODA 2A0FB 2DT9A 2F1HA 2NO5A 2K7JA 4LFBF 5C2GA 4DFDA 1PYTA 2F9JA 2R2UA 1W2BM 4HUEA 2D41A 1AUDA 4HHHA 3QPIA 4M1KA 3OTEA 4JI8J 1F5BA 2F8MA 2BACA 2W4PA 2HVZA 3WK5A 1VQSA 4BG9A 3KKAC 1VRTB 4M3TA 4I2QB 1GO3F 3FZ2A 2G13A 4BBYA 3OD2A 3PMNA 4LBIA 3BUZB 3DOKA 5AQMA 1M90O 4F5RA 1MWMA 2PA8D 2WTFA 3MPVA 1VAZA 2DNQA 3VQSA 5K4LA 2XYGB 8AT1B 3FSYA 1F21A 1FI4A 4DR6J 1U26A 3D2QA 1UVJA 4C3MA 3EVOA 1VHIA 4MYTA 4DQPA 1LKZA 1S9EB 3MGVA 2PY5A 4PWDB 3SCJE 1U1KA 3LGNA 3M4XA 2MZJA 2RQ5A 1ZQRA 2BZFA 2FZGB 4CZLA 1VSJA 4L72B 2K4PA 3H46O 3MR6A 1BQMA 5D0HA 1KQGB 3PSTA 2R7TA 3ISDA 1WEXA 4BXOA 3WK9A 1DTQA 2DO4A 3MFHA 2XICA 1P1LA 4BR4A 4ATNA 4BR7A 5K20B 3ZETB 1L7NA 2W6KA 1DRZA 2LQ8A 2VL1A 3RR8A 3OYJA 2FJDB 1Y3JA 1PVQA 2FJWA 4WK3A 4YVZA 2ZXIA 3OY9A 4ZJQA 1J6ZA 3MXJA 2OMLA 4A4JA 2B6AA 3ULHA 1KP6A 3BREA 2ASYA 3D9BA 4DUZK 4GNIA 2WFBA 2KVSA 3ENBA 2FVRA 1FIQA 1IQZA 3AVHA 4CJVA 5AKYA 3LQVA 3K8VA 5AIAA 3UPFA 2ZM6K 2DKXA 3LM2A 1PC4A 5KG7A 2LEAA 2DFFA 1OSCA 3Q0AA 1BPYA 3BBBA 5DM6Q 2QL9B 5A0LA 4MFAA 3SQ1A 4Z7CA 2C3OA 4YD2A 3RJEA 1OPZA 3HFKA 1HNWJ 2DY9A 4FF1A 2BHNA 3TFRA 2ZIXA 1WEZA 4X64F 4EU0A 4MEYA 5KG2A 4ANDA 1ZAXA 5AQKA 4CZHA 4KIAA 1ZQEA 4ANEA 2KW4A 4TKTA 1NH8A 2KHCA 5B0CA 3D7EO 1SZHA 2FTRA 5IM0B 4BJQA 1WD6A 4DV7K 3PM9A 2V7YA 4GKKJ 1FDAA 1J53A 1IBMJ 3W0LA 2W55A 2DNRA 3HVTA 4DN9A 3MECA 2IOFA 1CQNA 1RDRA 1BWFO 2MKCA 2BDPA 1XC9A 4GRSA 1M1KT 4RW9B 1I39A 2Z1IA 2CIMA 2V0NA 4M41A 3THXA 3W9IA 4ILHA 5F8HA 4YMMA 4RNNA 2B9EA 4DSIA 5DK5A 4RQ1A 2B4UA 1KFSA 2G06A 4F02A 4WF9Q 3M8WA 4KB1A 2LYBA 4DI6A 4OLBA 1QQMA 2HGMA 3AB2B 2P9KB 2LYHA 1V5VA 2L41A 2JZ5A 4WJ3B 3R8YA 1RXVA 2XWYA 2HPUA 1B64A 3UDEA 3JPQA 3DXSX 4AQYJ 8ICRA 2Y0SC 2KL8A 4Y2AA 2FHJA 1DHMA 4DR2F 1RAJA 1RBTA 2IVNA 3LANA 3R7SB 1SB3C 3P45B 4TXSA 3HZGA 2GW8A 2HSEB 1Y0HA 5B0EA 2YCHA 2E8MA 2K8BB 1X9MA 4R5PA 2BRKA 3NGSA 1J27A 4DU3A 2PI5A 1IBKF 1HJRA 1LQ9A 2MYFA 4DSFA 1O03A 3WIVA 4ZPBA 3KZBA 3L3FX 5ALYA 3IP0A 5EOZA 1N32J 3OYHA 4J9PA 4GMKA 3TADC 1VQ9N 3LH2S 2XTJP 4DCOB 4K8ZA 2IVYA 4IFVA 1KLMA 2QJ3A 3VZHA 1ASUA 2WONB 2C3MA 4P0PA 1Z6RA 4ZVRB 2MQLA 5DRKA 5C7PA 1DTTB 4R63A 4OPHA 1ZQOA 5ETLA 3O6WA 4F04B 4X4UA 1ZQYA 4BWJA 2Q0RA 5HAOA 2G2ZA 3Q86A 2BR0A 2BJ9A 3V9UA 2QMWA 4DTPA 1B22A 4E7KA 2KZMA 5AQUA 5HR7A 2J8AA 2XC9A 2GJFA 4KPCA 2MQMA 3TJ9A 2GJIA 5KL8B 1YJWS 1D9DA 1M1HA 4NLTA 1KTQA 2VWKA 4QWBA 2DEIA 3JAMY 5LMNJ 1S0NA 3CYMA 3G9CA 1RXWA 3DXMB 2D3ZA 1HKAA 2W41A 8ICEA 1RLCL 1NSAA 5D4BA 3ZEUB 1FJGF 4ZPTR 4HHUA 3MEGA 4HTUA 3A8KA 2ZJRL 1KRPA 4RBTA 2V4QA 3AB4B 4FCYA 4M7XA 2WSFC 2XGQA 5ETVA 2W4CA 5L1JA 1R6VA 4CGFA 4RPYA 2M0NA 3VGKA 2Q0ZX 4UASA 2WSEC 5KT3A 4NLGA 5ETTA 1NI3A 1BPDA 2MA1A 3RRGA 2ATQA 1MW7A 4Y2VA 1IBLJ 2CPRA 5AQTA 8ICHA 3KLEB 1NJYA 5T7BA 2MQNA 3QNNA 3NGKA 2KG0A 2E8NA 3TADA 1C4AA 2D0OA 5TKWA 4DV4F 5ALLA 4KX5A 3TAFA 1VQPS 3ILIA 3SNNA 2LXFA 5D4OA 2OEMA 5C42A 3C3LA 3O4NA 3PFEA 2JWLA 4ECSA 3C1YA 3GJRB 1H2TZ 1S57A 1QD1A 4UBCA 4I6AA 4LR9A 2Y9HA 3HFZB 3ADAC 3UMBA 1C0UB 2IIRA 9ICAA 2HHWA 3PW7A 1CJUB 1RBOB 5L46A 1BMQB 2FVCA 2J7WA 4RU9A 1NNLA 4C2MA 4BHQA 3TTDA 3MECB 4PA1A 4CHYA 5B8HA 4RPXA 4TNOA 3AVIA 3HRGA 3OTQA 4YR0A 5J0OA 1N5SA 2IJFA 5KTQA 2QA4S 1V97A 9ICSA 1ULRA 3DRRB 4IDKB 1W26A 1VQLS 1ZQMA 4QU6A 1NEEA 5HBMA 2KFZA 5HRPA 4GC7A 4JI0F 2ESEA 2MPUA 1RUSA 1I3OB 1TGOA 1C1AA 2J7UA 3O80A 2ZJQL 2FLPA 3FZFA 5J0WA 4PL1A 3KD5E 1B92A 2R7QA 3HK2A 4OZJA 1FNMA 2MMYA 3H0RB 3Q8YA 3MWPA 1SQGA 5M1KA 1FD2A 4F71A 2MY7A 1MU2A 4E89A 3OYNA 2QZ8A 4Z6EA 2ZH7A 3LVVA 4HL9A 4UB1A 4DB3A 2Y8WA 2NS1B 1VYAA 1F0XA 4M5DB 2E2NA 4U67Q 3H0MB 5LXRA 4RW7A 5J0QA 2CGLA 3UN3A 3KLVA 4KN7A 5AI5A 5M1QA 2XG8A 5K9FA 2YWFA 1UJ4A 4K0KK 4LJXA 2E1EA 3HT0A 3DXKA 4BRKA 1V5IB 1HNWK 3C6UB 3GE1A 1SQKA 4NXMK 4NLDA 4E1NA 1RAIB 1F5SA 5JLFA 4XPEA 2FJEB 2XRIA 1HI8A 4O0IA 2IMOA 4DQSA 2P51A 2RF2B 2Y0SD 1L8LA 4CYUB 4ETZA 1H2UX 2ZE2A 3IG1A 3V7JA 3LDAA 2W2QP 4JI6J 3F5TA 1IH7A 4QAGA 3DCAA 3EVMA 4U7CA 5A76A 4NE9C 2E8OA 1U4BA 4MLHA 2FMSA 4KLHA 4OKKA 3MGIA 3IRXA 1CJKB 4BE0A 1VS3A 4ILMA 3SAGA 3N4MB 1VRUB 4LR8A 5ITHA 1CI4A 4EBDA 3KLFA 2F4FA 2M3DA 1MWYA 1ED1A 3IGNA 4HLBA 5E2QA 1IJJA 1GMWA 2IJRA 2JZBB 1TFRA 4KO0A 4BDYA 2IVOA 3T69A 4UTGA 4EMDA 4EZ6A 1K44A 1RHKB 5J2NA 4P2MA 4RT2A 3HILA 3DYAA 2W01A 1HQEB 3QXGA 2B0CA 1HKCA 2GVDA 5KG5A 1U7LA 4UUWA 3BO4A 4OPAA 2OAUA 2APOA 2QWLA 2XQCA 3A5LC 1N33F 1REVA 4J8FA 2PMWA 5J0XA 4DR5J 1IR2A 3CCES 1D0EA 1BDGA 2RS2A 2KJ9A 3RMAA 4RL1A 3H1QA 4LVSA 5AE2A 5A6WA 5ALQA 1KBUA 3RYLA 3OHBA 4G3IA 3AU6A 1L7MA 3DLGA 1UVMA 4O5CA 1MN7A 2MZSA 2B4JA 2WRMA 3OHAA 2ASJA 4ZJOA 5D0RA 2HHTA 2JLGA 4JLHA 3DLKA 1F3FA 3OFFA 2B7CB 1AFIA 3TW0A 4ZS6A 3FMBA 1KHWA 3LAKA 4DSJA 2KSOA 2PZSA 1Q53A 3W5XA 1DZ5A 1TUWA 4CLSA 3W8GA 4BVPA 1BQNB 3E9OA 5J1PA 4UZCA 2VPXB 2DO0A 3JS6A 2D1KA 2K4HA 1UA1A 3VVUA 4QBUA 4I0WA 5KFYA 3VTHA 4FLWA 3V1RA 2KJ8A 3UXPA 2CFXA 3S1TA 3TOQA 1A6SA 3LYSA 1K9MO 2BQUA 4MKAA 5KGWA 3MK6A 2CJXB 4DTNA 2ES6A 8ICBA 4HI1A 1PVPA 2ZNZA 4OX9F 2FF6A 2YJFA 3QU5A 3W5YA 2K7KA 4ED5A 1NLKL 1VSKA 2E7WA 2MRLA 4AHCA 5G5HA 2F1IA 2HWIA 4RW9A 3LP2A 3TAMB 1WF0A 1RTDB 1R31A 3SMSA 4CO5A 4MT1A 4P75A 4NPOA 3TP2A 4JKCA 3QSIA 2E1CA 3FFKB 3QBXA 4K59A 3MEDA 3TANA 2YJEA 4IFEA 1URRA 1CXUA 3O4WA 5CCMA 3L4QA 4CNQA 3BN4A 2NRRA 4CIGA 1IBCB 1JCFA 4MKVA 1TL3A 4AHUA 1LWEB 5D0GA 1X66A 2EEYA 1KNZA 3HD2A 3SQGA 5ETPA 5EGYA 1N62A 2ZF5O 4AL6A 3IAYA 1R7IA 4IH6A 1RADB 4X66K 3SLCA 1C4CA 5BR8K 1YRTA 5HJXA 4NYZA 3JPNA 1RKIA 2RHSB 3H2LA 1EZZB 4QPTA 3I56S 3UFCX 5AHXA 3KHGA 5HL7Q 4C8MA 5KFGA 1RABB 2HB5A 4FWQA 1FEHA 1T02A 5T41A 3MMJA 5AZIA 4RUHA 3ZSWA 3A5NC 2I9GA 2UUBF 3CD0A 3CDWA 2CZVC 2P8IA 3GFXA 3C16A 9ICFA 5HP1B 4OYZA 1U9LA 4MDBA 3BO3A 4ZCLA 1VQ7N 5J2EA 3THVA 4OQJA 2E6MA 4MK8A 3PR4A 1PJ5A 3RBEA 5G0RA 1J5EJ 3QZ7A 1DLOA 4LF6J 2XMAA 2LVWA 3M7DA 2M70A 4IQXA 3CJAA 4LY7A 1RB0A 1VQMS 4OI3A 4YY3J 3NBPB 3ID6A 3VGVA 4IDHA 2HG4A 3SQGB 3QRQA 3L2QA 5GADU 4MFCA 2AJ2A 2C2NA 3R5BA 4I2JA 2F4VF 4K42A 2O8DA 2MY8A 2X6NA 3PW5A 3N4QA 1B0XA 2F8EX 3SSRA 2UU9K 5E33A 3THTA 4PWUA 1VCTA 1QUPA 3ZZTA 2W24A 3A3NB 3U8XA 1NSQA 3GYXB 2Q3SA 2E29A 2Z30B 3KOAA 4MLEA 2UUBK 2DHAA 3W3DA 5BREA 4QIEA 1BG3A 3CCRS 4Y2JA 3EM1A 5DS7A 3ZXWA 1X9WA 4TU8A 2B51A 1ZQXA 3ITHB 1SC6A 2FXUA 3SQ2A 5MLCV 2A6OA 3ZSVA 3MM7B 3N0VA 4HWIA 4ZPWR 1TK8A 5HVHA 3LAMA 5IFMA 4KH0B 1N5YA 1ZBFA 4J9QA 1Y3KA 1WC1A 3PSIA 4ZN3A 1JLCB 1BWVA 1FFSB 2H65B 5DB9A 4JI4K 4BACA 3HX9A 3AA5X 4FBTA 3N97B 2EC2A 1KHVA 5L8RC 2HS0A 2M2BA 2A1JA 1WOSA 4J91A 4A8XA 3ZDDA 5F9LA 3M30B 4RUBA 1K1SA 5F41A 3M8SA 4E2FB 4YCXA 4PKGA 1UPHA 1T9YA 4TYBA 1XJWB 4CZEA 2JHDA 3U26A 4EBCA 1VQ5S 5GAEP 4CJKA 3NGTA 1HNZK 1X60A 2G8FA 4CEQA 2VC1A 1VLBA 8ICPA 4RKUC 5IT9Y 3QINA 1EWRA 1X4EA 4JV1A 3PNCA 4JI7K 1Q4RA 1S1VB 3KLGA 2HIYA 2F9WA 3SPZA 2VIHA 2A1SA 1YZ6A 1SXLA 2WOMB 3WK8A 1FTRA 4LF2A 2Y1IA 2F7TA 3SUPA 1DJ0A 4QR2A 4Z4EA 2XLJA 5IIJA 4EHUA 2QKKA 1TU0B 5KFNA 1KAXA 2QWOA 2KH9A 3E3XA 2BZ2A 4IFYA 1EO1A 1WUUA 2CNKB 4M5KA 1ZZFA 2NREA 4GXIA 1NJXA 4ECVA 5DZ6A 5CZ1A 3R1XA 4O4GB 2AGPA 1U2VA 5FIIA 5DB8A 5F3XB 3R1HA 2P9EA 4E7IA 1CJKA 2XO6A 4OZ3A 2F76X 1L6NA 2HOIA 3UKUB 2JXJA 3CQ8A 1V4SA 1GAOA 2B8QA 3BQ0A 1XSLA 2XZDB 3NL0A 2X1AA 1RQNA 7ICJA 2C3YA 2BE2B 3OXGA 4V19S 3P1GA 3ZTOA 4CF9A 2LEBA 5AKKA 3GJQB 1WCNA 2C2ZB 4WK1A 4Y2IA 5KFPA 4CZMA 1FKPA 2V51B 2KE7A 1FNOA 1GH8A 3M2RA 4DV0K 3F2BA 1SKRA 3UO0A 1NJZA 4X64J 2QEXN 2QLTA 3WQPA 3BQ2A 3MPWA 1TR0A 3UNGC 3AARA 1OPIA 3PIPQ 2L3MA 5JXSA 4Y2UA 3NF9A 2AMCB 1T94A 2H3QA 1VRQC 2JLEA 3LA0A 2F77X 3T1HF 3MMCB 1GX6A 2IIHA 4DZ6A 2MKSA 5C2FA 3ULDA 2RPIA 1ZD2P 3GU3A 3TJAA 3KHLA 1Z3EB 4JKGA 3H59A 1S0VA 2HZAA 2YQ1A 3O9SA 1S1XA 4ZN1A 2WHOA 2FB0A 2NZCA 2HDOA 3DOLA 2CGJA 2XZTB 2XY8A 3VF4A 3U3GA 2H1YA 1G1XA 1BISA 1HWJA 4R0EA 1S97A 1BE4A 3G8QA 3I1YA 4FJXA 2IM1A 3HFVA 3UPQA 5H9EK 4EFAC 3DLEB 2DCLA 3HRDD 4EIAA 1KDHA 4MFFA 4F4YA 4DV5F 2JEIA 4DTMA 5F8LA 2LXIA 3WT0A 1ZBHA 5CAAA 3QEBZ 2F9DA 3P31A 5EE1A 1W25A 2A5XA 4B3SF 2CZ9A 4FZZA 4E7JA 2R42A 3KTQA 4BRIA 4I2IA 3TYTA 3THWA 1U48A 4KHMA 4KBIA 2Z1HA 2O4IA 3VQAA 2UUWA 3AQPA 3VVTA 2HSTA 3IG1B 3P3DA 4ZP6A 3MXIA 4OPKA 3PEHA 3AMZA 5KFCA 4ZIVA 2GOLA 2AJ0A 3S41A 2G0JA 3IA0A 5IOLA 3J80Y 3S3MA 2QLFB 3AO5A 1J97A 1AW0A 1WOOA 2I6XA 3AVCA 4R8UB 1MA9B 3MOJB 3C0BA 1HYZA 3DWLA 2MJNA 2KRBA 5ALSA 2RHFA 1R27B 2QLXA 1NZPA 1O8BA 1IN0A 1REVB 2HMIA 1NGJA 4N8OA 4PQUA 2M7SA 1XMBA 3B4DA 4I6WA 2FBYA 1H7XA 1Y64A 5CJ7A 3H4BA 4KHRA 5DB7A 3E9LA 1A5VA 2QLJB 1TQLA 1FXRA 1VHFA 4M5NA 4OV6A 1JLFA 4QOTA 4CECA 3E8OA 3DAWA 3O6QA 5DM7L 3W2WA 1R0CB 2KJVA 3BH7B 5J2AA 4YB5A 2HBYB 3ET6A 5C24A 3H0PA 3OR1A 4RNHA 1KKHA 4QZBA 2Y9TA 3G6XA 3CC7S 1U1PA 4A59A 4LZDA 3WKBA 2UXCJ 2KFNA 1NPRA 2ZVSA 3CJ8A 2QA1A 4CE6A 4LRBA 1WDTA 4JYAF 5CXTA 1RDFA 4DPUA 4I2GA 2HHVA 3ZSZA 2OPSA 3HSZA 2Z0GA 1HR0F 1S1XB 1TKTB 4O3SA 3ONQA 5F8NA 1Z19A 3IMQJ 3V6JA 3HI9A 3SEIA 5KQ8A 4DV2K 2ZNYA 1JMTA 2E3TA 3FNNA 4CZFA 2Z4PA 4ZITA 1E6VB 5DDRC 2DR9A 5D6GA 4FW1A 1MLAA 1YVNA 2CYYA 4EEKA 2UUAF 4TY8A 3T6JA 4PWWA 3L0QA 4CO0A 3L2RA 4C4TA 3IUCA 2E5LK 1K8AO 4UAUA 3UWTA 5AK5A 4OYXA 3M6XA 1TVAA 2LKYA 4CDGA 2OSRA 3C15A 3OYKA 1Z4NA 1AB8A 1EETA 1S6QA 2ACYA 2IDOA 2E1MC 3AA9A 2DWQA 3OXFA 5AQLA 1YLXA 4CIOA 3KLIA 1Z1BA 5EXWA 4FYXB 1IBLK 3CC4S 4CGDA 4ED8A 1WACA 4Z4CA 4AHVA 2HBLA 3SR6A 3NRWA 4LF9K 1V3SA 3PLAA 3JSYA 3LL3A 2KVQE 4BX9C 7ICOA 3AU2A 2WCXA 4C9DA 2AH5A 5D15A 1TTHB 3TWZA 5ALTA 2B9YA 5GADI 8ICJA 2DNLA 4Q7AA 5T7LA 1LAVA 3AO4A 4B3RJ 2XBPA 3EE9A 3ZNJ1 3LPUA 3O1BA 4BS2A 3ZCMA 4ZVPB 1VK0A 1I6JA 2E1RA 3HJEA 3C7NA 4Y1CA 3CJ4A 4WIIA 2H3ZA 4USKA 1ZQVA 1ZM2A 1J54A 3UXNA 3SZ2A 1XO1A 2R4FA 3MN6A 1IJFB 2HMPA 4Z2XA 1ECWA 9ICMA 3BBCA 4LRCA 4IG3A 1ZQ1C 4TY9A 1NK6A 2KICA 3ZZRA 3BGRB 5IIKA 1KBRA 4DEZA 2ZEJA 2L5YA 3O9TA 1X42A 1SV0A 1YTYA 1RE1B 4OYBA 3OGUA 4AHSA 5BRFA 4OYPA 2Y0SF 2HHSA 4WP8A 3CEDA 1SAZA 2WBNA 3MCNA 2VV5A 1XMOK 3M1FA 2A1BA 5KT5A 4DTSA 1UCVA 4JK7A 4AFFA 3J7YU 4IEEA 3MUVP 4NCBA 4ERDA 3JPSA 4CHZA 1RZTA 4B8CA 1M1KO 3ZX0A 4DQIA 1O5JA 2RNEA 1S0MA 4LSZB 2EHGA 2HVHA 3UKRB 3CJ7A 2HFVA 1UJ5A 1RAHB 8RUCA 4CCHA 2HLTA 3OYMA 7ICVA 3GMGA 3R5CA 4QZVB 3G4SN 2MSSA 2XMWA 3GJSB 3AVAA 3QNWB 3Q8PB 4DU8A 4RWWA 4WFBL 5M1OA 3R5DA 4V19J 5ALEA 4HCCA 2DR6A 3KNAA 1SL2A 4ECRA 5IQQA 3C1ZA 2ZOGA 1W2BR 2IC3B 4OI0A 1X5SA 1NM1A 1K8KA 1WNEA 2EC0A 2E4LA 4EO6A 2VFTA 2EW9A 4M8LA 4LF7K 4Y1DA 2DGZA 4GIBA 2L9WA 3LP1B 3ENWA 2ZWHA 3DRSA 2DNKA 2GS8A 2D0PA 2DD8S 2COLA 4Y2TA 1IKXA 3IGVA 4J2EA 4FJIA 3V4IA 2IRXA 3SMPA 3UDVA 3M3ZA 3WXJA 4EHTA 4XRHA 3WU2U 5LSRA 2ZH1A 2B43A 4YB7A 4A8YA 3NBPA 4A8QA 4YDUC 2ZUCA 2GX8A 4P7VA 1E4GT 4UB6U 4FK2A 5KFEA 5CHGA 4P4PA 1A77A 4IUFA 3MURP 1Y5NB 1T44A 2XYPB 2G07A 1SI9A 4NLNA 1G99A 3TTFA 2FSNA 4LFAK 4F67A 2DFLA 2D6FC 3R7NB 4O5EA 1HKGA 2F7VA 4LIRA 1JJ4A 2DGXA 1T3NA 4HH1A 3GYGA 2KVCA 3CIZA 2H9ZA 3M6WA 4HH0A 1NXIA 4F36A 3C66A 1XMOF 4O3NA 3I8DA 4MTPA 5B0DA 4CFAA 2HVDA 1BPEA 1N61A 5IQ6A 5MAOA 2GIFA 5AFUA 1RT5A 3DRRA 4DS4A 1VBKA 2CNNB 4IXCA 5ALZA 2QKBA 1PK1A 1Q3UA 4F8RA 3C6TB 3H2UB 3NCPA 3RBXA 3TFSA 4YHHK 1N2XA 1Y88A 1ZQZA 4XQ8A 4IRCA 3DNCA 4PHEA 3RAXA 3DM2A 2BE9B 3SBMA 2KI2A 4G1PA 4DR3K 3SEOA 4KGXB 1U1RA 3A8JA 2EAOA 2EWHA 2WVDA 2QXFA 2RD5C 2KJ5A 5E3CA 1D09B 4K7QA 1QQCA 2GHVC 1NG9A 2MLYA 1WB9A 4Z6DA 4CHQA 3M1YA 2IAJA 4ECWA 5ALFA 3EUNA 2F63A 5IC6B 4X4VA 2E1PA 5HO4A 1S9GB 4ECZA 2EFOA 7ICIA 2ZC3A 4DR4K 3QFUA 3B4MA 3JPOA 4XA5A 3QGPA 1JNRB 1F2GA 4FZMA 4B9LA 4CF1A 3ID8A 4AM6A 4FF4A 5HL7L 3H0LB 3E58A 3G8TA 5GAGI 9ICTA 3KHYA 4H5NA 3M2RB 4RQ3A 3KDOA 3FEXB 3SPYA 2YMPA 1CG2A 1TV9A 1FHTA 4IG3B 1RACB 3TQEA 2L48A 1ZETA 4PKDB 4BR5A 2WF9A 4FWSA 2HURA 1HYSB 1NJIT 4DXLA 2KMDA 3W62A 3RMCA 3CC2S 4FJMA 9ICPA 2GIQA 4PHPA 4DL0C 4KMUA 1X7VA 4PXCA 2NRZA 3ISND 3VTIA 3VEYA 3B8AX 1QZ5A 2H3FA 5D77A 1DGKN 3J80U 2CQ4A 3KLFB 5EE0A 2GZOA 3RUBL 3KZIU 1F6TA 3CDEA 2QE5A 3GYNA 5EX3A 3P38A 3OQ2A 1QS4A 3JSMB 1JJ2R 2F4VJ 2ITGA 3HI0A 1TKZA 4B1XB 4J9UE 1QSYA 2P6SA 3SUNA 2DNNA 2QC3A 3C8YA 2XEXA 2YKMA 1OSDA 2DGVA 2CQPA 3GP9A 3B9JA 2E5JA 5HQ8A 4FWMA 1ZOTA 1NJWA 1KLMB 3FGUA 3OS0A 1I5OB 5E7OB 4KHPK 5ALUA 1Z25A 3UIQA 4IWVA 1P8ZA 3C14A 2WB4A 3GFYA 2ZC4A 2EX3A 2VCPA 2GJ2A 3G0ZA 1VC6A 2QN6B 2JH1A 4MMOA 2JGAA 4Z7YA 1WI6A 4LFCJ 1NNEA 2MB0B 4KV8A 4OZLA 4KITB 1H3DA 2DL0A 4NCGA 4M5LA 5KFQA 4KE5A 2YNHA 4DR3J 2YHBA 5K14B 1NK7A 3BYPA 2ISPA 4F3MA 4RW6A 3SDEB 2FSJA 3OTOK 3Q8KA 2OEKA 2D3UA 1QVGM 4IFYB 4A8SA 3C95A 4CHPA 1JN3A 3WK4A 4M3ZA 4UUXA 5AKHA 4A47A 3ENVA 1NZBA 2A3JA 1QQ5A 4ED6A 2RU3A 1SS6A 3AY9A 1M5HA 1S6QB 1B3TA 5AQNA 4BRDA 2H48B 2PGCA 4PQAA 2DF4B 3NE6A 2ZIXB 4YXMA 3HKZF 1HR0J 2FLLA 1HHSA 3CJQA 1M5PC 1P6TA 4KH6A 4TQRA 8ATCB 4DL7A 1NU4A 1ZQGA 4E0DA 1EQMA 2PMZF 1R59O 4OKJA 5A0YA 4H4KC 5GTIU 1QDUB 4I69A 4B3MJ 3E66A 3C2LA 4JAXA 4CP5A 5L1IA 4OVLA 3HCXA 4NLRA 2CNOB 2FPHX 2YPYA 2ERRA 1HD0A 3VWSA 1IKYB 1X5TA 5HROA 3QT6A 3VGSA 2ZWOA 5BRHA 2VOOA 4IBNA 1B7YB 3GLJA 2Q6CA 3O44A 3HLUA 2ZIWB 3R2CJ 3VGTA 1YG0A 4D3HA 4JV5J 2HOQA 1IIPA 2ZJ8A 1RJJA 4WXWA 1RWMB 5B0BA 2E9TA 3F56A 3N6NA 3T6BA 1NZAA 1C20A 1TFWA 4P2FA 3WXIA 2A42A 4WE1A 4QJFB 5A8WA 3RB6A 6FD1A 1KR4A 1SJ1A 4GKJJ 1WG5A 3EWAA 3R97A 2Z7JA 4QS7A 3CCVN 3AAQA 4I67A 3A0HU 3PV8A 1UVLA 1VOMA 4ICLA 3OL7A 3O3GA 2GHPA 3S6JA 1RWWB 4LSNA 2FGOA 2PT0A 1JLAA 3CC2N 2CUYA 3AFGA 4CERA 3SCXA 3I0SB 1HBNA 2VHGA 4LF9F 1WI8A 3ZDCA 4Y2MA 5BOMA 2FSKA 3SQ0A 4QW8A 4WKRA 2KTQA 2GQ2A 2ZHAA 2XS7A 3AVMA 3GG0A 3AXMA 2F40A 2KN4A 5ETMA 3QERA 3ISBA 2OWOA 1BNPA 2Z2YB 2UVUA 1ZXIA 5HBMB 3T5KA 4KJIA 3VPZA 3WNGA 1T03B 2RSQA 4C11A 5DGBA 4UQTA 4NZ0A 1RFQA 3GG4A 4XH1A 1FE4A 2W9MA 3L2WA 3POTA 2G08A 4I1TA 2HHUA 3D45A 4K4TA 4E1JA 3VQDA 5E5NA 1GLJO 2CQGA 3DU6A 2AZ1A 1QUVA 3VETA 5J8YA 4A8MP 2EI5A 3ALRA 3V6KA 2CPIA 2P5VA 5KFWA 2GAGC 2NSBA 3M8RA 3KKSA 4NLUA 1WC0A 1KAZA 3K0JA 1NSKL 1QAIA 1D8LA 1U02A 2HFOA 4ZPCA 4KREA 5H9EJ 3Q8MA 3UQ0A 2K1RA 3IMXA 4KKOA 4PG5A 3AO3A 1RBSA 2MEWA 4FXVA 4X64K 4FJLA 3UE5A 3WKAA 3OLAA 2NV3A 3BEXA 1XMQK 5ALJA 4A8KA 2AJ4A 2E9RX 1QE1A 4N76A 4PHDA 4DR6K 4C4SA 4YB6A 3VGUA 4G6VB 3QGIA 4OJLA 3J81O 4DG1A 2I8EA 5ETSA 1S4EA 3NGUA 2MU2A 3GSDA 3B0XA 3KXDA 4QZCA 4I2DA 3TEGA 4K4YA 3P4UB 5KFRA 2D3O1 2XY6A 4ZH4A 5FRMA 1H38A 2IOCA 4DCCA 4J9KA 4U7BA 1WG8A 4C8OA 3NRZA 1VQNS 2DBYA 3R7BB 2D0CA 4ALZA 1T8EA 1B0VA 1JUDA 5SZTA 2ZBRA 3CCLN 4LIWA 4JI1K 3OYBA 1CBKA 4CE9A 1BQMB 5DDYA 5L1LA 3SQOP 4DUTA 4DU7A 3DN9A 1SXEA 3CSKA 3BN7A 1SIZA 3CD6N 4W5QA 2G1HA 1ZQNA 4Y00A 1MMNA 5M1NA 2KSOB 4XDCA 2W7AA 5FP0A 1TV6A 1WBBA 5AK6A 1OH5A 1FRIA 5JU5A 2JV3A 4R79A 1DTTA 3QETA 5BPNA 1MSWD 5J2FA 4DS5A 3IAM9 5BYQA 3OYCA 4FOEA 2OPQB 3HP6A 4IFVB 1XMOJ 2FPLA 1D4XA 4B3MK 4OX9K 1VQYA 3V81B 4FPAA 1N33K 3I9ZA 4KHQA 5ALRA 5G4DA 4UAZA 2RQ4A 3MGJA 3KNGA 1IQTA 4OHWA 3F5EA 2OTLS 9ICXA 2MGZB 1WHXA 4FJJA 1EIYB 3QAEA 2BCVA 5AZJB 3ATVA 2BUNA 2GA7A 2W9AA 1FKPB 4LBHA 4M3RA 4RQ5A 5LMNK 2HBQB 4YOUA 2DHHA 4EAHD 4GW6A 1U6FA 4B3RF 2N82B 1WF1A 8ICLA 1JIHA 4B08A 3M6GA 4Z6CA 3CW2C 5GIPA 3UMCA 5L38A 4X4OA 1OY9A 3BF1A 5KFVA 3H5YA 5AI4A 1C1BB 4PL7A 2A18A 3CJBA 3KJQB 4A48A 5BPCA 1NGEA 4C80A 3IRXB 1NK0A 3P83D 3H2VE 3DLJA 4Y34A 1FDDA 1ASWA 2BANA 4RNFA 5FDLB 3MUTP 3ATUA 1T6CA 1VK3A 2BJ3A 2LFVA 3NG8A 2WZ1A 3SIPB 2O8BA 4BWMA 3N9UC 4Y65A 3R6LB 4K4IA 4AXIA 1XNQJ 4JN4A 3AM9A 3CCLS 2OJ3A 1OQ6A 2B7BB 5CYMA 4ZOSA 1Q8KA 4O4RA 1H74A 4C23A 3KMQA 2BOAA 3OSPA 2LYVA 4NLWA 2UV8G 3PSFA 5AKZA 4NV0A 3CD6S 8ICQA 3RJFA 3UB5A 2ZJPL 1D9AA 1RT1B 4HDGA 4RQ8A 1Y97A 2YX7A 3THYA 4LFAJ 2IOHA 3D2FA 4HUGA 4KGMA 4QZEA 1UTAA 1X8DA 2V4JA 1OO0B 2BXJA 2OH2A 2E44A 4M5GA 3DLHA 5AK4A 4RBUA 4JYAJ 2KG5A 3QT8A 2PFFB 3NTUA 3OR2A 1QVGR 3RJIA 3LF0A 7AT1B 1JLQB 1NMDA 1F0MA 4WQ4A 4WQ4C 4Y2KA 3TR8A 7ICTA 4DL5A 3TJ8A 1JCEA 1S77D 1WJ9A 3AGRA 3D7SB 4CK2A 3MCMA 1BC6A 4OJ6A 3GU0A 4J37A 3HYFA 1BQXA 4OGCA 1YIJN 3OL9A 3T1HK 1SWWA 5J0RA 4Z94A 4NLKA 4FNIA 3ILOA 4C11B 5AM1A 5I4MA 4DV3F 1FJGJ 4CEFA 4UATA 4OIXA 2BW7A 3CM5A 5HK4A 1CULB 2OZMA 3K2YA 1F9FA 4E3SA 4G65A 5E3QA 4C7QA 2PYJA 1IV0A 4Y0WA 4PZNA 3VENA 3QE9Y 2YHYA 3W65A 5AJ3J 4IOBA 1FWPA 5HOOA 2MXYA 2QFIA 4E1MA 1K9MT 3DRPA 4B3OA 1ZM4A 3CQYA 1LKYA 3C16B 1R8HA 3OTDA 1IKXB 2W3SA 5K8MA 4KTZA 5KFOA 3RW7A 3WHIA 3H8JA 1HWLA 5AM4A 4LH4A 2CRXA 4B1VA 3G6VA 1HQ2A 2ASDA 2QGFB 4EX6A 1YRXA 2I2YA 1YI2S 4DSEA 1F9EB 4PAAA 4JKBA 1NOMA 2BE7D 1K8AT 3PO4A 2EPIA 4WFXA 3VEXA 1RWVB 2OYQA 3RTVA 2CG8A 1QAXA 1IWAA 4JK9A 2BM0A 2EK1A 4HR2A 1J9AA 3AODA 3L4PA 1PKUA 3RH6A 2ZDPA 3GBTA 3JSBA 4M3UA 3DI6A 3H98A 3S01A 2UUCF 2MJUA 4X4SA 3U4LA 1S12A 3C29A 1G6BA 3PXGa 1HNIB 2EZYA 2DB1A 1MC8A 3MM5A 1IKVA 4IJNA 3QWUA 4Y2CA 1C0UA 2BBEA 3SJHA 4Q0BA 3ZSXA 3RH4A 2OYYA 4OLOA 2PFOA 3M6UA 4ES3A 1X4CA