3EZ5A

Cocrystal structure of bacillus fragment dna polymerase i with duplex dna , dctp, and zinc (closed form).
Total Genus 208
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
208
sequence length
580
structure length
580
Chain Sequence
KKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Mechanism of the Translocation Step in DNA Replication by DNA Polymerase I: A Computer Simulation Analysis.
pubmed doi rcsb
source organism Bacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords DNA polymerase I
total genus 208
structure length 580
sequence length 580
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2008-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3ez5A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 3ez5A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ez5A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3ez5A01
5KFDA 2AGQA 3UXOA 3MGHA 8ICKA 3V6JA 3OYBA 4DO9A 4J9KA 3UQ0A 1WLJA 5IILA 4KLHA 3WNFA 3AVHA 4DTXA 3NGZA 4F4YA 4RPXA 1XI1A 1VSJA 8ICQA 2HHWA 3VQBA 1HJPA 3PW2A 4RW9A 2BDPA 4E0DA 1LB2B 4CJUA 4CEZA 4B9UA 4DF4A 3H8SA 1D9FA 4PHDA 4DU3A 2KZMA 4KLLA 4OKJA 4M2YA 3ZT3A 4PGQA 3S9HA 3OYJA 4CHQA 2Y1IA 4MFBA 3CG7A 1VSDA 7ICNA 2IMWP 5D46A 1RBSA 3U3GA 4RQ3A 1BQNA 4PQUA 4J9NA 2R8IA 5KT2A 2KZZA 5J0TA 3AVJA 4ZTJA 1KCFA 4F5OA 4CEOA 3I0RA 1JKHA 4C8LA 1S0OA 2LSNA 4NCBA 3DLGA 4Y1DA 3VQ6A 1KSPA 4ECRA 3ISCA 2PZSA 2ZQBA 5KG4A 4TQSA 2JLEA 2AGPA 1U9LA 4RQ0A 4E89A 3NBPA 5C24A 1B92A 3L2VA 4YN4A 4BGDA 4F2RA 4FCYA 3MDAA 3O4NA 3V7JA 2ITGA 4ED3A 3LDAA 3HW8A 4FJ7A 2F1JA 4DOCA 4BDYA 5HNKA 5I42A 3TQ1A 4Q43A 3QEIA 2BQ3A 5KFUA 5KT7A 1WSGA 4F91B 1TKTA 2ZTEA 4ECYA 2Q0ZX 2P6UA 5F9NA 3T3FA 4YD2A 3BGRA 1HYSA 4W5TA 3AO3A 9ICIA 2B5JA 2W9CA 4G3IA 4DTRA 7ICJA 4KLSA 5CWRA 4CHZA 2WOMA 4DQQA 3N4MB 2GUIA 4R66A 3PW7A 2W9AA 3K57A 2HNZA 2BCVA 1ZQCA 4FYDA 4XA5A 2DPIA 1JX4A 1IM4A 1S0NA 3VQ4A 2XGQA 4DTMA 8ICSA 3AVMA 3H40A 3TAMA 4DFKA 2I9GA 3RRGA 2IAJA 4FVMA 3GIJA 4KITB 1BPYA 2H5XA 9ICMA 1C1BA 4N56A 4QW9A 3AA5X 3ZDDA 3HPGA 4KTWA 4F3TA 5KG0A 4FJ9A 3AO1A 2ZJAA 4Z6EA 1IKXA 3TFRA 5KFXA 9ICUA 1Q8IA 3V9ZA 2XGPA 2ZD1A 3PMLA 1U48A 3ZDEA 7ICKA 1D5AA 2AQ4A 4KB0A 3PNCA 4GXJA 4ECTA 3CFOA 3MXJA 2GWSA 4QZGA 2DTUA 4DSLA 4FLTA 3OYGA 2FMSA 1TL3A 3V6KA 1CEZA 1D8YA 3C5FA 3HVTA 3G0ZA 5SWMA 3V6DA 3OS2A 4BDZA 4I27A 4YR3A 1SL2A 1SV5A 4BWMA 4PWDA 4I2PA 5CZ2A 2VA8A 5TZVA 4DL5A 1S10A 5J0PA 1Z25A 4OPJA 4DFJA 1R0AA 5JUMA 1ZQKA 4HHTA 4I2QA 4KV8A 5KFJA 4J9MA 1S97A 3IAYA 1EXQA 5J2CA 2P5GA 1FKOA 4FJJA 2HHUA 1DOQA 2HVIA 1GOBA 2OZMA 1BPZA 3ZSXA 4QZDA 3AU6A 4IBNA 4ECZA 2KW4A 4GC6A 4MFCA 3FFIA 4QZIA 1AROP 3KLHA 3JPSA 2R8KA 4DFMA 4UAWA 4AHUA 5DLGA 3HO1A 3L2WA 3NE6A 3RJIA 5KFKA 5J2DA 2PFPA 1RYSA 7ICGA 3RJGA 2X74A 4MQ3A 3NDKA 3BDPA 4CJRA 1N48A 4M3TA 1X9WA 3NAEA 4RUCA 4FLUA 2IS3A 4ICLA 4HCBA 1TGOA 8ICUA 7ICSA 5KFPA 4DTJA 2OA8A 4IFVA 4CEDA 4M3YA 1W9HA 3Q8MA 1BISA 4FZXC 5KI6A 4CJ5A 3DLKA 2BKEA 4O3SA 2YKMA 2I5JA 2VA3A 4R8UB 3G6XA 3AA2A 3EZ5A 4DLGA 2V4RA 1TKXA 9ICAA 1Y88A 4AH9A 4PH5A 4PHEA 4I2AA 4FM2A 5J2QA 2HHXA 1RCHA 3Q8SB 5DGBA 3OVNA 2C2EA 1A5XA 3OGUA 2Z1IA 5EWEA 5EWGA 3PO4A 1ZETA 4GVMA 3JPQA 3M9OB 3LPUA 2KQ2A 2YNGA 4YVZA 4DSFA 3FYHA 3SUPA 2KN7A 3KLEA 1KTQA 5KFNA 2G8UA 5FRMA 4DF8A 1NOYA 2HNDA 4ECVA 1CXQA 1XWLA 4KLUA 5DG9A 1S9FA 1NOMA 1V9PA 4CJEA 4ZHRA 3T5KA 3GFKB 4MEYA 1T8EA 5HRRA 5KFMA 4I28A 4UBBA 3HX0A 4DTSA 4I2JA 3RTVA 4DQSA 4H8KA 4AHRA 4KHUA 4ELVA 2X78A 3RMAA 4CESA 1ZQRA 4KI4A 8ICCA 4FBUA 3C23A 2XCAA 4IRCA 5J0YA 4LSLA 2XY6A 3UIQA 1TKDA 1BGXT 3VQEA 1ZQBA 3GV8B 2P6RA 2OWOA 1XU4A 4N47A 4CEBA 2OPQA 2WTFA 1L3TA 1SZPA 5KFFA 3HK2A 4M9HA 4RPZA 2HW3A 3C6UA 4QZEA 4AHTA 4ECSA 4YG2A 4XQ8A 4B8AB 4QWAA 1XSPA 4KHSA 4CEFA 4R63A 3MR3A 1LWEA 9ICJA 3QE9Y 2IGIA 4ELUA 2A1JA 3AVIA 1NK0A 2O4GA 1ZQWA 4CCHA 1A77A 2Z1JA 3BQTA 3RB0A 2G8VA 4CJLA 1C0TA 1U49A 1ZQIA 1JL1A 1TL1A 3DOKA 3MDCA 1HNVA 3MECA 3K5NA 4ZH4A 8ICFA 4Z6DA 2IHMA 4KREA 2E6LA 4O5EA 3PMNA 4Q0BA 1ZQXA 5DGAA 3PX4A 3QZ7A 1RXVA 1ASVA 4BXOA 1HUOA 3LZJA 3ZSRA 4RQ8A 1HUZA 3LPTA 3PW4A 3HVRA 3VQAA 4KHYA 1ZQYA 4J9RA 4GLXA 2BPFA 3OYMA 4YR0A 3RJJA 1VSHA 2V9WA 5DB9A 1NK7A 7ICTA 3SUNA 2IDOA 9ICTA 2ISPA 3AA3A 1S0VA 4HCCA 2QK9A 4YXMA 4C8MA 4IRKA 5DLFA 1S0MA 4RNMA 5BOLA 2BGGA 2IHNA 2ASDA 3MXIA 1ZQTA 1RT4A 1ASWA 4B9VA 1WSJA 3C1YA 1XS9D 3Q8LA 1RDCA 2BHNA 1UA1A 4KTQA 2R8HA 3B6OA 4M3RA 4DFPA 3L2QA 4UAYA 1NJWA 1WSEA 1DTQA 4PGYA 1J9AA 1TV6A 1SUQA 3MABA 4DG1A 8ICEA 4O0IA 1S76D 3O3FA 3DRSA 2ZTDA 4FLZA 2W9BA 4FO6A 3EYZA 2Q3SA 1UT8A 1ZQEA 4B9MA 4CFBA 3PY8A 2XRIA 1ZJMA 1L3SA 1TV9A 4K8XA 1IKVA 3VN5A 8ICXA 4EP4A 4E7IA 2BQUA 3RJFA 3G6YA 1BIZA 3AV9A 5L1LA 4DL3A 4KO0A 8ICTA 4F5QA 3RRHA 2HHQA 3QEVA 2KFZA 3NF8A 1ZQQA 1RYRA 3MXMA 3EW9A 3EPGA 4CJFA 5EWFA 3ISNC 4JV1A 4DOAA 4CERA 3H8JA 3ISBA 4LZGA 1ZBHA 5KFAA 3OHBA 4LZDA 1U47A 2OPSA 4DS4A 4J9OA 1VSKA 3AA4A 3NH0A 4M6WA 2OPPA 4JLHA 3V7KA 4CGFA 1SKSA 4KHNA 1RPLA 4C8KA 5DBBA 4K4IA 4M42A 4R65A 4RQ7A 3ISDA 4KN7A 2VWJA 4KLQA 4QZHA 4OLAA 1ZQVA 1WCNA 2FLNA 8ICJA 9ICPA 5JS1A 1JN3A 5L1IA 4KLFA 3QZ8A 1G15A 4JWMA 3DRRA 4HUEA 3VQCA 4P4OA 4HUGA 3F73A 3QEPA 3S3NA 2O4IA 9ICGA 4C8NA 1TKZA 3HYFA 1UWBA 2P1JA 4YMOA 8ICWA 8ICNA 2XCPA 2ALZA 3KIOA 3K5LA 3PR5B 1T03A 3SI6A 4CE9A 1JLFA 8ICMA 3OYHA 5KG1A 3MFHA 4DQIA 2XHBA 3NFAA 1NK5A 2JEFA 1YVUA 3MR2A 2OYQA 5DKWA 5E41A 4E7LA 4F4ZA 4HUFA 4QZBA 3ASMA 3B0XA 4QWEA 3Q8KA 3TR8A 4F5PA 2BGWA 2W9BB 3OSNA 3NCIA 4LH5A 5DBAA 5J2JA 4CK2A 2BCSA 4QWDA 4CF2A 4Z4GA 5J2PA 2G8KA 4F4XA 3NH1A 1BPXA 1ZQUA 3JPNA 4NLKA 4KLGA 1A5VA 3M8SA 8ICZA 1QE1A 1X9MA 4E1NA 4FM1A 4JRPA 4B9LA 3OS0A 1RT5A 1WAJA 3KHHA 4O3RA 5HMMA 8ICYA 5CJ7A 1J5OA 2EHGA 3ORYA 3TFSA 5L1JA 1DGSA 4FLWA 3SJJA 3LK9A 1C1AA 4M6WB 3RH4A 3V1QA 5J29A 4W5RA 3PO5A 1MSWD 4TSXA 3P83D 3JPRA 1Z00B 4O5CA 1KDHA 1ITGA 3RMCA 1N5YA 5L9XA 9ICCA 4EBEA 1C1CA 5J0RA 1ZQGA 1NK9A 1TAQA 1IXRA 3NH2A 4BE2A 3BQ0A 3ITHA 1J53A 2OZSA 4KLEA 4M3WA 2HHSA 1YTAA 4CF9A 3O3GA 1S6QA 1JXEA 5BOMA 1Z26A 3RWUA 1RBVA 3G6VA 3DI6A 4RW4A 4QAGA 2I1QA 1WAFA 8ICHA 3SV4A 1WSHA 4KB1A 4I2CA 2VG7A 3NF7A 4FJHA 4KPYA 2BE2A 2WONA 4KLOA 4H4OA 4DTNA 2PYLA 2PFNA 4NXZA 3AO2A 1CZBA 4PHAA 2MUTB 1LW2A 4IQWA 3CFRA 5C42A 8ICPA 4CJPA 4MFAA 4IG3A 2IC3A 1NKBA 3S3MA 5DB8A 4FS2A 4NLGA 1RT6A 9ICLA 5KFOA 3HSTB 5DK5A 2BCRA 3HWTA 1RXWA 2R7YA 4PY5A 3NF6A 4KTZA 4LSNA 4Z6FA 1I3AA 4DTUA 3GV5B 4TQRA 1CXUA 3C95A 2FBVA 4N76A 4X5VA 4AILC 4GMJB 5KTQA 4J2DA 5DQGA 5IIIA 1SL1A 2RDIA 1F21A 5DDYA 4RQ5A 4YFUA 4CHNA 1LAVA 1A76A 4ED1A 4UBCA 2F96A 3OS1A 1FXXA 3Q8PB 1QTMA 4F2SA 3TAPA 4CF1A 5KFEA 1ASUA 2RDJA 1ZQOA 4XRHA 3PW5A 2D0CA 5HRSA 2J6TA 4RQ6A 4J9PA 1Z00A 2C22A 3OYNA 3LWLA 4MF8A 7ICQA 1RNHA 4O9MA 4JWNA 4GC7A 4O3PA 1ZQSA 1RTJA 2BPGA 1B9DA 4DWIA 4R8UA 1JLCA 1ZQJA 4M9LA 3JYTA 4O3QA 8ICOA 4N41A 1BI4A 5KFLA 3UXNA 3RR8A 1I39A 3H4BA 1MU2A 1ZQNA 3IG1A 4ECWA 2KTQA 3V9UA 1JLGA 3CM5A 4E7JA 4O4GA 7ICFA 1KVBA 1H38A 4CFAA 4OKEA 3TAGA 3KHLA 2XY5A 3TANA 2IBKA 4L8RB 4OLBA 1S1WA 3MR6A 3K75D 4UB5A 4I9LA 3QIPA 2QKKA 2ZUDA 3RB4A 1ZQAA 3HPHA 1CUKA 2MAXA 4HYKA 2BQRA 3RMBA 4AHCA 1LWFA 1GOAA 4IQVA 2QXFA 3MBYA 2G8FA 1EETA 3SUQA 1RDBA 2FPMA 2BPCA 9ICWA 4I2FA 5CZ1A 3VQQA 4P4MA 3O4QA 4CGJA 3QEBZ 1Q9YA 4FLYA 3KLIA 4IR1A 4AHSA 4RZRA 5L1KA 3HM9A 3SZ2A 7ICLA 4UAZA 2FLPA 3VQ7A 4EZ9A 2LYHA 4I29A 1TK8A 3SCXA 3MR5A 2VG6A 1RT3A 4FXDA 4PGXA 4I7FA 2ASJA 4CJKA 5HLFA 2PYJA 3MGIA 5J2BA 1W0HA 4QZFA 3C5GA 4DL6A 3V9XA 2B6AA 4FJNA 1QSSA 5DB7A 4E3SA 4BWJA 1HQEA 3SUOA 3BJYA 1ZBIA 4FW1A 1KFDA 1X1PA 2ZJ5A 3PVXA 4MF2A 1MQ3A 4DQRA 3LP2A 2ZTCA 2PFQA 4QW8A 1Y97A 3LP0A 4W5OA 4KRFA 1NKCA 2YKNA 3JSMA 4RW6A 1ZBFA 1BCMA 1A5WA 3AVKA 2DFHA 1L5UA 2FLLA 1KLNA 1YT3A 4RQ1A 3HP6A 5KT5A 1NK4A 3ZCMA 3UPQA 2A1JB 4I2BA 3LDSA 3HL8A 2W42A 4FZZA 4XUSA 2Y1JA 4Q8FA 3BQ2A 1TAUA 5CP2A 3GIMA 3K5MA 3ZSVA 4FJ5A 2P66A 1NKEA 4DEZA 4M9JA 3HJFA 4OGCA 3SV3A 2KZ3A 3VQ8A 4JK1A 3SQ1A 2JZBA 2UVVA 5CYMA 3T19A 1S1TA 3HP9A 1BI4B 1S6PA 3PX0A 3QEXA 3TWHA 4FW2A 5HRNA 1VSIA 3T5JA 4CHPA 3DLRA 2XY8A 4B9NA 1U45A 3DM2A 4MFFA 3AUOA 3C94A 4KFBA 3RJHA 9ICHA 4PA1A 4Z4IA 2NUBA 1T3NA 5KGXA 3C6TA 3L8BA 2ZE2A 3LANA 4LD0A 4IFYA 3IRXA 3ZSWA 4CGIA 5J0UA 4ED6A 2FBTA 3H08A 2W9MA 3L3UA 3CYMA 4NLZA 2J6UA 4DL4A 3M9NB 2ZUBA 1RDDA 4CIFA 5SZTA 2QKBA 2PXIA 1IKYA 2A1SA 4CECA 1ZQZA 3UXPA 3DLEA 3P5JA 5DB6A 4I2EA 1JLQA 4Z4CA 1QS4A 4CJVA 5KFHA 1S1XA 8ICLA 3NGDA 2FMQA 4E7HA 5J2MA 5KT4A 4IQTA 3KHGA 3LZIA 1IKWA 8ICGA 5IIOA 1U4BA 4ECUA 2GV9A 4N5SA 4O44A 1RT7A 4F50A 2YNIA 5J0OA 1KFTA 4B9TA 7ICMA 5DBCA 3RMDA 1RILA 5CA7A 1XHZA 5KG7A 3QNNA 3G10A 4H4MA 3ZSQA 3RJKA 3ZT1A 5DG7A 2X6SA 3F9KA 2F1HA 1N6QA 5K14A 4F3OA 3DLBA 4RU9A 1RTHA 3RJEA 4TURA 5IIMA 4K4GA 8ICIA 5CR0A 3TAQA 2EX3A 3K5OA 2E6MA 4CJQA 2GBZA 4XIUA 3DOLA 3CFPA 1REVA 3GV7B 3OYCA 4NM2A 1ZBLA 3QNOA 2PFOA 3ZDAA 2D0BA 1C0UA 4C8OA 3ZT2A 1B43A 4Q8EA 1RTDA 1WSFA 2ETJA 1T05A 5J0QA 4TUPA 4RNOA 5HP4A 4K4HA 2P51A 2F1IA 1IH7A 1RDAA 4I2GA 4R5PA 3KHRA 3MAQA 4YMMA 3V6HA 2UVRA 3L2RA 2B21A 4CEAA 3ULDA 2VWKA 3V72A 5J2GA 1BPDA 4BE1A 3SQ0A 1IG9A 5KG6A 4YP3A 1WNSA 1T4GA 4B08A 4O5KA 5HRPA 1SL0A 1BVSA 4RT3A 2FPLA 4UB2A 4DTPA 3AVAA 3HT3A 3THVA 2DFEA 3QLHA 9ICSA 1TK0A 4M47A 4CGGA 3OYKA 3OY9A 4RQ2A 3LWMA 5J2NA 2JEIA 1KVCA 4UB1A 3ZD9A 1VSEA 2A1RA 3ALYA 1L3VA 1S9EA 1RBUA 3SNNA 4EZ6A 3WNEA 1JL2A 4QZAA 2DFLA 5DQHA 4NYNA 4F8RA 4OJRA 1KFSA 1HYVA 5FRNA 1NK6A 4ELTA 4M9NA 4M41A 4WE1A 4QZ9A 2XC9A 1HYZA 1YTUA 5J2AA 1NJZA 4CHOA 3C2LA 3A2FA 3QERA 2R8GA 4I2IA 1BPBA 5I3UA 4F4WA 3KD1E 2ATQA 4OKKA 3KK2A 4FM0A 1XSLA 2NRXA 4Q45A 4FLXA 1TFRA 1S9GA 1VSMA 4RW7A 4CJTA 4DLEA 5KFIA 5D4BA 1S1VA 7ICVA 3TARA 4KLTA 3DYAA 3RAXA 3VQ5A 9ICQA 4CJ3A 4CJSA 5J2FA 3GDXA 3EY1A 2P5OA 7ICRA 1FK9A 1WCLA 3AU2A 4FJ8A 4J2EA 5DQIA 3PX6A 5J0XA 3KKSA 3NGYA 3L3VA 4YQWA 5IIKA 3IM1A 1BIUA 3HXMA 5HMLA 4M0AA 1UOCA 1NOZA 7ICIA 3SPZA 3K4GA 2DFFA 3V4IA 1QHTA 2F8TA 1ZQFA 4B9SA 3IS9A 1NJYA 4DQPA 3MEEA 3K59A 3SPYA 3FDSA 1ZQMA 3S3OA 5C25A 2JZBB 4DOBA 4EBCA 1BPEA 1KRPA 2ZUCA 5CYQA 5KT3A 3ZSZA 3WNHA 3N97B 5C5JA 4YMNA 3ZT4A 4P2HA 1BQMA 3NTUA 4OVLA 4J2BA 4PUOA 1C7YA 5J2EA 4O3NA 4ED8A 2HVHA 3SQ4A 3ZDBA 2W8LA 5KFWA 1HRHA 3D45A 1ZBUA 3GILA 1RT2A 1BHLA 5KFVA 5HP1A 4CGHA 1XHXA 5DDMA 4IKFA 2J6SA 5J2IA 2HMIA 4ECXA 3VQ9A 2XY7A 1ZQDA 1QSYA 3CM6A 4JV0A 5KFCA 4QZCA 3OHAA 1Z3EB 3RH6A 2NRZA 4JUZA 4IDKA 4CIEA 5KG5A 4KLJA 3T5LA 4KHWA 5J0WA 2PI4A 4CIGA 4W5NA 2AGOA 5HROA 4CJ4A 5EU7A 3OYLA 3RB6A 5HHIA 4UB3A 4YXJA 3MEDA 4CJWA 4IQUA 1T7PA 2RPIA 3AVBA 9ICEA 1C6VA 4CFDA 1KVAA 3ZD8A 3NGIA 8ICVA 3KJVA 4PHPA 1LW0A 3PV8A 2IOCA 3AO4A 4HVJA 5BPCA 2BCUA 9ICNA 1RZTA 2BANA 9ICRA 1MC8A 5CHGA 1N56A 4FK2A 1PZNA 4RUAA 2RF2A 4UB4A 1VRUA 4FJMA 3GIIA 3TABA 3V7LA 2W8KA 4CF0A 4CGDA 4CK1A 4BDPA 1L3UA 3DMJA 5HHHA 2D0AA 3EWAA 4YNQA 3OJSA 1GOCA 4ID5A 3LAMA 4UQGA 4M3ZA 4LVSA 3KLFA 1WSIA 2YHBA 3M8PA 1LWCA 2FBYA 4Z4HA 4DU1A 4KLMA 1XO1A 2KFNA 3VQPA 4Z0UA 4NM1A 1J54A 3AVFA 2YHAA 1LV5A 3QESA 1JLEA 5KRTA 4LY7A 4FK0A 1DTTA 7ICUA 4FJXA 4JV2A 2F8SA 1XSNA 2YNHA 3LP3A 2VANA 2RKIA 4FBTA 4BXOB 3AVLA 1XC9A 3D0PA 2G8HA 3KK1A 3T1AA 4J9SA 4Z4EA 4O5BA 1JLBA 5FDLA 4DL2A 2UVUA 4I2HA 4CEQA 1JLAA 1VSLA 4JS5A 3AO5A 1ZJNA 1Q9XA 4OPKA 4QOZB 1B22A 5DMRA 5KFTA 3RBDA 4YCXA 4CK3A 4R64A 7ICPA 3I0SA 2G8IA 4O55A 2HHTA 3QINA 3DRPA 4DSEA 4P4PA 3OYAA 5KGWA 4IRDA 1U04A 5KFSA 4G1QA 4IR9A 4YR2A 3KTQA 1MQ2A 4RQ4A 4BE0A 2FBXA 5EOZA 3VA3A 5J1EA 1EXNA 4B3OA 3TAFA 4YD1A 9ICOA 3NHGA 3OYDA 1ZQPA 5IINA 2AJQA 5CY4A 3MFIA 1NJXA 4BACA 2Z1GA 4DTOA 1BL3A 2C2RA 4CEEA 4CHYA 3LAKA 5JS2A 4TUQA 3SQ2A 5KFGA 3RH5A 5KFYA 4FJKA 3JPOA 9ICFA 1IO2A 3B6PA 1SKRA 1UA0A 3AVCA 4Z4FA 3GQCA 5J2KA 3RB3A 1X9SA 4KLDA 3V81A 1HMVA 3O3HA 8ICRA 1CLQA 4E1MA 4J2AA 3GIKA 4EYHB 1K1SA 2AU0A 2M9NA 4PPXA 3IHQB 5J0SA 2JGUA 4F93B 3V9SA 2FMPA 1RT1A 3QEAZ 4Q44A 4CFCA 3K58A 2YV0X 4F92B 5F9LA 1HQUA 4EEYA 1ZQHA 4F4KA 4RT2A 4DSJA 2X6NA 1UAXA 3ZSYA 1JXBA 4E19A 5KFRA 4KN4A 4OGEA 4CF8A 4I2DA 3CQ8A 2C28A 3SYZA 4NLNA 1S77D 3MEGA 1X2IA 3M8QA 4ID1A 2G8WA 4KMUA 1O1WA 3ZSOA 3EPIA 5KG3A 2NRTA 3M8RA 4JS4A 4M9GA 1D9DA 4QWCA 4E7KA 2V4QA 4LH4A 1D8LA 7ICEA 1COOA 3Q8RB 1TVRA 3KK3A 9ICXA 1VSFA 1B9FA 4ZTFA 3K2PA 3V1RA 1S1UA 7ICOA 3C2KA 3ZDCA 3VA0A 5KFZA 1EX4A 1RBRA 9ICVA 4RPYA 3V1OA 2ATLA 4I9QA 2BCQA 4KLIA 4AHVA 4M3UA 1NK8A 4QZ8A 4RNNA 2JEJA 4F5NA 2D5RA 3C1ZA 3PUFA 2DY4A 3KKRA 3JPTA 5D3GA 3ETLA 1JXLA 3H8WA 1HJRA 2UVWA 4F5RA 3C21A 2OPRA 5KG2A 2XO7A 2HB5A 3C2MA 3BQ1A 3PW0A 3TAEA 4IG0A 2HHVA 4DL7A 5KT6A 4M45A 3Q8QB 2ISOA 2C2DA 5HBMA 4M3XA 1HNIA 2E4LA 4GW6A 3KD5E 2W9CB 3AVGA 3KLGA 2DPJA 4Y1CA 3UQ2A 4GXKA 4DSIA 3PR4A 2IA6A 1QLNA 3QEWA 3U6FA 1VRTA 2JEGA 4NY8A 3V9WA 5CB1A 3RBEA 1EKEA 3OYEA 3T5HA 4W5QA 5T7BA 3JPPA 2NRWA 4KAZA 4FLVA 5D49A 4FJGA 4TUSA 3TI0A 2NRVA 4M04A 1RTIA 3M9MB 1FKPA 3DLHA 4KKOA 1DLOA 1ZYQA 4RG8A 1QSLA 4J9LA 4KI6A 5DG8A 3RAQA 3U3YA 4ED7A 4J9QA 3QO9A 3OSPA 4NYFA 3OYIA 4MEXA 2PI5A 4FJIA 2R8JA 2MUTA 2B4JA 3HPOA 1EP4A 1TVAA 3QETA 5KFBA 1RBTA 3AVNA 3L2UA 4FK4A 2PY5A 1QQCA 3OJUA 1SKWA 4K8ZA 2AQ0A 9ICKA 4EYIB 1K1QA 5IIJA 2VG5A 4YFKA 4Q5VA 4NCAA 2RN2A 3SI8A 1LAWA 3WNGA 2FC0A 3VQDA 8ICBA 4ED0A 4QWBA 5KFQA 4RW8A 4O0JA 1UT5A 4ECQA 2YNFA 4ED2A 4DS5A 5J2HA 1BCOA 5KRSA 4EBDA 3NF9A 2Z1HA 4Z6CA 1S5JA 4O3OA 4FJLA 1VK0A 3E2EA 1WN7A 2ZJ8A 1KLMA 3LALA 8ICAA 4FS1A 1JIHA 4DU4A 4DMNA 1ZQLA 1HPZA 3QIOA 1C0MA 1KEJA 1K6YA 1JMSA 5FROA 4HTUA 3I8DA 4GXIA 1TK5A 2BR0A 2VA2A 4EP5A 2FPKA 3OYFA 9ICBA 3E01A 3ZT0A 1CZ9A 2HNYA 3H4DA 4JRQA 4FZYA 4NCGA 4KHQA 3P1GA 4QCLA 3H7IA 3LP1A 4B8CA 7ICHA 3B0YA 3RR7A 4DSKA 2ASLA
chains in the Genus database with same CATH superfamily
1VLOA 1WKLA 1Z1ZA 3MGHA 3SMVA 3HULA 1HNWJ 3OYBA 4DO9A 4QIWF 3D0GE 2CPJA 3WNFA 3AVHA 3MPDA 1ZA1B 3AJDA 4DTXA 3SEIA 2GMJA 4RPXA 3ZNUA 1XI1A 3MAHA 3Q8VA 4QU6A 3PW2A 2VKQA 4QYZK 4KBOA 1OIAA 4E0DA 1LB2B 3TTCA 2KZMA 4QR1A 3BPSP 1PC5A 4PGQA 3S9HA 2RUSA 3FZ2A 2WONB 4CHQA 4OYIA 1XK8A 2VQFF 2WCXA 4ZVRB 5GAHU 3CG7A 3KG0A 2KN4A 1YJUA 4AE5A 2LYBA 1VSDA 4OX7A 1RBSA 2N7CA 3L7OA 2JJ4D 1JJ2R 2QFIA 1A6SA 4JI3J 2QTDA 2Y9UA 3NUQA 4A62A 1TUYA 1Q79A 3AVJA 4D3HA 3UQSA 3R1LA 3K9JA 1KCFA 1RWNB 2FZGB 5IS2A 3OTCA 4F5OA 1OSDA 2UXBJ 2JLFA 4HH1A 2IM2A 4CP5A 3T6BA 2F9JA 1GLLO 2XM3A 1H74A 1IJJA 1FFWB 2WSCC 3BM7A 3TX0A 3ISCA 2LXUA 1VISA 1BDGA 4V1Ak 2JLEA 3DHWC 2H3VA 5E3PA 3F53A 2GVDA 1PK1A 4Y34A 2DNOA 4ES1A 4FZLA 4BG9A 4FCYA 2CAJA 2IVPA 3ZZTA 1CLFA 3BZKA 2QLFB 5FJ4A 2ITGA 4ED3A 1XNQJ 4USVA 2F65A 2COLA 4DOCA 1VRTB 3OT9A 4RNHA 4RBVA 2DIVA 3QEIA 3FR0A 5AHXA 1HARA 2VQEJ 4JOUA 2Q0ZX 1V97A 3SDEB 3BGRA 1SC4B 2K4EA 2BRKA 4DHVA 3I4HX 2B5JA 2W9CA 4G3IA 7ICJA 3J7Z5 1WOSA 2WOMA 3PEJA 2W7PA 3UNYA 4JI5F 4CRXA 1RFQA 2W9AA 1WHVA 3FQKA 2BCVA 2QWPA 1JLGB 1Q4RA 2V2KA 1IM4A 1Q8KA 3VQ4A 4DTMA 1YIJN 1N61A 2M2BA 2RRDA 2WF5A 2RQKA 2HI0A 3TAMA 5ETKA 4DFKA 4JAXA 2YN4A 3RRGA 1CS4B 3HFVA 2IAJA 4FVMA 3GIJA 4RW9B 4PL1A 3BN4A 4DR3F 4KGKA 4AXIA 4LF4F 4QW9A 5KAKA 1HPMA 3PIPQ 2Z58B 4FJ9A 2D1KA 2ZJAA 1IKXA 2E8PA 4YOTA 9ICUA 2V63A 3V9ZA 3K0JA 3UDCA 3CO0P 1ROFA 3WXKA 2V4JB 4MHVA 1U48A 4B3MK 7ICKA 2E8OA 4ECTA 3SMSA 1D09B 1OPZA 2XZTB 4FLTA 1K8AO 2FMSA 3V6KA 1TL3A 1D8YA 4NLCA 1NDCA 4PXDA 3V6DA 2HOFA 3OS2A 4I27A 3ENOA 3GG1A 1SL2A 1SV5A 1T3QA 4PWDA 1WKJA 2H3EB 2KXHA 5CZ2A 5M1NA 4DR1K 1TL4A 4ZVSB 2IYGA 2VA8A 2Q1LA 1WSVA 2HZCA 2A2CA 4ZCIA 2H5EA 4I2QA 3UE5A 2BJ7A 2PEHA 5KFJA 1O08A 1UWAA 1S97A 1FVSA 1EXQA 5J2CA 3NP5A 4M63C 2CGKA 1EB0A 3BN7A 1QM9A 1R7IA 2MLXA 3O1LA 5LSRA 4PYDA 5DRKA 4A5AA 2FJWA 1OQ6A 5K5MA 1TL7B 4QZIA 3NCPA 2EAMA 2PEBA 4EHTA 3P5BP 3JPSA 1V3RA 4UAWA 2JRZA 3HO1A 3RJIA 1KQSR 1A6LA 2X1GA 4C0HA 2MY8A 2FGCA 1NDPA 1MW7A 4MK7A 3R6MA 3W60A 4JI8F 2E2NA 1RTHB 3EZUA 2KRRA 3NY0A 2N3LA 5ETOA 5CHCB 3S6EA 8ICUA 2EZYA 7ICSA 5KFPA 3OTEA 4OHYA 3OW2R 1VBKA 4X62K 2QG9B 1IQTA 1M5SA 4CEDA 3BF3A 2OPQB 4M3YA 5ALIA 5KI6A 3EN9A 3IBPA 1RTDB 4CJ5A 2PMZC 2YKMA 2HQCA 1ELOA 2VA3A 2OFGX 3TNVA 4R8UB 3AA2A 4DLGA 1NHVA 4H0OA 1LWFB 4IXCA 9ICAA 5JMNA 1FE0A 5IV3A 4BR5A 4JI2K 3AD8C 3MPUB 4B9QA 9RUBA 2GFFA 4KMOB 2HHXA 1SV4A 1RCHA 5ALUA 3Q8SB 1FX2A 4ZPAA 4RO0A 1Y7PA 3UD5A 4CQ1A 1S59A 1A5XA 4CDIA 5JVGQ 5EWEA 4U67L 3ONNA 5EWGA 5A0YA 4USKA 3JPQA 2HKEA 2RU3A 2FLOA 4DSFA 4AYBC 1WBDA 2M88A 1FO1A 3KLEA 3MM7B 5CCMA 1RZMA 1KTQA 2YB1A 3DLEB 3HI9A 4Y2XA 4OPAA 5AI4A 4JI4K 1HWJA 1S9FA 4HT5A 3PHTA 4GVEA 1T9UA 2HG4A 2W2OP 3T5KA 2YTCA 3A8IA 2AP1A 4MEYA 5KFMA 4I28A 1VBZA 4UARA 1HUXA 4RQNA 4DTSA 4OYOA 1GXLA 4H8KA 2WSEC 1SIZA 2RHFA 3CCMN 5LMNJ 1WI8A 3MUVP 3C23A 5J0YA 3UIQA 4TKTA 1ZQBA 3GV8B 1VHIA 2WTFA 3P96A 4ZVGA 4WIIA 2HMPA 4O0NA 3UPFA 4M9HA 4A2BA 3OV7A 3KNAA 4RPZA 4QZEA 2QLXA 5BR8F 4B8AB 2Q1NA 4QWAA 3Q7BA 1TL5A 4R63A 3MR3A 5H1SQ 9ICJA 2IGIA 3CW2C 1MN7A 2R7SA 5AXLA 3E0FA 4G1PA 1CQMA 2O4GA 3AVIA 1N34K 3KLVA 3BQTA 4I64A 3RB0A 2GNKA 5CA5A 1FJGF 2KLAA 4B3TK 4CJLA 1JL1A 1U49A 3OBIA 1ZQIA 3MDCA 1K0VA 4ZH4A 2C1EB 2E6LA 1QVFM 1Z6RA 4Q0BA 1Q3VA 4MKAA 3CCQN 1QQNA 3GFHA 4X4SA 5B0CA 1OYEA 1YJTA 5IWAJ 2HBMA 3RYLA 3VQAA 1ZQYA 1UQVA 3OYMA 2W54A 1WD6A 3JAMU 4JI7F 1WF1A 3L4QA 4HCCA 2QK9A 4YXMA 2A10A 2HMXA 2VJ5A 4CLSA 3LDNA 2JMGA 4RNMA 1X4HA 2BGGA 1VQPS 2IHNA 3NAHA 2XS2A 4B9VA 3DU5A 2YWEA 3F2DA 2BHNA 2M8HA 4KTQA 4M3RA 4DFPA 3PIOQ 3L2QA 2VOOA 1D0EA 3E58A 2QX0A 4UAYA 3HSGA 4A8FA 2XS5A 1NJWA 3O2IA 4PGYA 1TV6A 2WF7A 4DG1A 8ICEA 4O0IA 4F36A 3DRSA 4FO6A 2RRBA 1UT8A 2Q3SA 2HS4A 1ZQEA 1ZJMA 3M8ZA 3MCAB 3H6EA 3VN5A 8ICXA 2BQUA 2LDYA 3VWSA 3WXJA 3KJVB 4DL3A 4QJFB 1FXLA 4F5QA 3EZOA 3J81O 5AM3A 3RRHA 3D0IE 2HHQA 3LP1B 4JNEA 2O8BA 4CYUA 3NF8A 2HOQA 2CVIA 4KAIA 5AKKA 4YDXA 3IDHA 3D6FB 4AM6A 4GVBB 4X4OA 2UUBF 3ISBA 4LZGA 1ZBHA 4EX6A 3OHBA 2GIRA 4JYAF 2V51B 1S6UA 4JLHA 3V7KA 4CGFA 3BUZB 2C2NA 1X4CA 1RPLA 4C8KA 2CDQA 1U6FA 2G0JA 4CNZA 4LF8F 5AQWA 2KXFA 3NVMA 4QZHA 3VEVA 2B51A 5J8YA 4EFAC 1ZQVA 1DRGA 2VWBA 2P9UB 3J80Y 4QPXA 5F0WA 3KZIU 2D3O1 3QZ8A 4LF5J 3OW2M 2J9DE 4WFBQ 2QEXS 2QWLA 4FWNA 3UN3A 1X4GA 3DXSX 3BSCA 5HVHA 4WCEQ 3S3NA 4K41A 3CJRA 1E6YB 4DR5J 3PCOB 2P1JA 8ICNA 3OLAA 2XCPA 5CCLA 1ZTWA 4ZJLA 1Y4ZB 4CE9A 1JLFA 3VAHA 4W98A 3MFHA 5AI6A 2XHBA 5IT9Y 2YHXA 3CCTA 1NK5A 2JEFA 3O80A 3PRBA 4WBFA 3CETA 2RH3A 1R89A 2VV5A 3CJKB 3MN9A 2OYQA 4E7LA 1DTQB 4A8KA 3ASMA 4ZIWA 3Q8KA 4QWEA 2HZVA 1ATRA 3QFUA 3WKEA 1FD8A 3OSNA 4UF4A 2QN6B 3CCRN 2PA3A 2KYXA 5DBAA 5J2JA 3GB0A 2NPFA 4TVAB 4QWDA 2G8KA 2HZAA 2ZZNA 3HHDA 3KK2B 2KDOA 1ZQUA 2IOFA 4NMXA 4KLGA 3M8SA 8ICZA 1KHWA 1X9MA 5HJYA 3NGTA 3MCPA 1WAJA 3KHHA 2W4PA 1V3ZA 1IR1A 5AT1B 5CJ7A 5FPNA 4LBPA 4PL2A 3BF4A 1HI1A 3ORYA 1VBYA 3TFSA 5K20B 5L1JA 3OLBA 4GV9A 2JNJA 4M6WB 1KQSM 3V1QA 2EZXA 2KH9A 1MSWD 4MIWA 4ACOA 3U8XA 3SQOP 2VQEF 5EXWA 5J0RA 3J7AP 1SC6A 2B5JB 4NXNF 1U6BA 2DXEA 2CQ3A 1IXRA 4G9ZA 2A3JA 4BE2A 3DRRB 1X42A 3VAJA 1NJIO 4JI7J 4YHHK 3VALA 1N36K 4C48A 1ICEB 2EKYA 5BOMA 1FEEA 1RBVA 2DGOA 3G6VA 3DI6A 3I56S 4RW4A 1HD1A 2I1QA 4C8ZA 5CABA 4JV5J 4H4OA 4AL5A 3ZZOA 4LF7J 1HA1A 3J7YU 1CZBA 2ITMA 3LGHA 2JH1A 3CFRA 3GFXA 2KVCA 3S3MA 2E1AA 3BH6B 2XLIA 2DPNA 4I2QB 2IDEA 3TACB 2CQIA 4E98A 3CJSA 4NLSA 2V4JA 3V2UC 1ZPVA 3AH6A 2R7YA 1BU6O 2F4VK 1HQEB 1U2VA 1NGIA 3O8MA 1CXUA 5BR8J 4OLPA 3QU2A 3CCJS 1CPZA 3V6DB 3C95A 4A2AA 5AK4A 4QIFA 2EW9A 1EARA 1RT7B 4C1NK 3VVUA 3ICLA 2FHJD 4NZ0A 3IN5A 4EWTA 2B8QA 2VG6B 5L46A 4RQ5A 4YFUA 1MROA 1IBMJ 4UBCA 2MZSA 5H9FK 4IO8A 1R0AB 3Q8PB 1QTMA 4BC7A 3CJ5A 5BYSA 4OX8A 4KGZB 4KH5A 5BN8A 4DKWA 1ZQOA 2NUUG 3O6WA 4U9RA 2UXDJ 1IG6A 3M32A 2F7TA 4RQ6A 5GAHI 4J9PA 2C22A 2OCEA 1CC7A 2OXOA 4MF8A 5D0EA 2OFHX 3KLGB 1Q8BA 1S7HA 1R27B 4G1IA 4GC7A 1KKHA 5ADXH 1RTJA 3SDEA 3ICXA 4R25A 1IKVB 2P9KA 4R8UA 4NLDA 1DFDA 1JLCA 2VBXA 3CPWR 1RHRB 3UN2A 4Q2LA 2Q6BA 2BDUA 5AJ3K 1I39A 3KKAC 2QMUB 2HAFA 3TSQA 1LKYA 3H98A 2KTQA 4X4UA 4QS9A 2HBYB 3UE2A 4M5DA 2DNHA 4O4GA 3KLFB 3KZBA 2D3UA 2KEYA 1JI7A 2XY5A 4NZ6A 1XNRJ 3CCSN 1FDAA 2HS3A 1QZ5A 3MR6A 5AI8A 3K75D 5FLXY 4I9LA 2LQ9A 2QKKA 4EO8A 3RB4A 1CUKA 2H48B 4HYKA 3AXMA 2P9CA 4ZPWR 2OIHA 2XWXA 4FWKA 2BTFA 1Q46A 3DOMA 1P27B 3IV6A 3MBYA 1EETA 3DJCA 4PZNA 4US9A 2PC6A 5T7LA 4H5TA 4I2FA 1NXIA 2VDIA 1I6JA 1S48A 3M05A 2MJNA 4FLYA 3KLIA 4WXWA 4LC9B 4AHSA 3HM9A 3KWMA 3SZ2A 1UW9A 4ZVFA 3GBTA 4Z37A 1UJ4A 2FJVA 3ZZRA 7ICLA 3DDIA 5ETMA 1UWBB 1S57A 1GLFO 2VC0A 3SCXA 4M94A 3MR5A 2X7IA 4PGXA 2OUGA 4CBUA 3W5ZA 5LM7E 4CJKA 1X3MA 2PYJA 2Y8WA 2DR6A 2ZE2B 1VDHA 1W0HA 4YY3J 3C5GA 3SMPA 1YK9A 3V9XA 3B8AX 2EG1A 4JI8J 1KNZA 2XBPA 4GY2B 4E3SA 4BWJA 1ZOLA 4LRAA 1U2VB 3GWCA 3OTDA 1D1UA 4FW1A 3OVAA 1CULB 3SQGB 2JC0A 2KE7A 1HJOA 4CLTA 1GTEA 4I1TA 1GLCG 2FC8A 4MF2A 1MQ3A 5F8JA 2PFQA 4HLBA 2NZTA 1Y97A 3SIPB 4KRFA 2MZTA 2YKNA 1BNOA 1FWLA 1GLEG 1ZBFA 2DFHA 2FLLA 5ALGA 1YT3A 2PFFB 4Y65A 1Y5LB 1C0UB 4B02A 4Y0FA 1K73O 3UPQA 4IYQA 1N60A 4IOBA 3GIMA 3ZSVA 2WBMA 3HJFA 1U1QA 5C0YA 3J7YI 3SV3A 4DCPB 2KZ3A 2K8AA 4JK1A 3SQ1A 1C1CB 4C97A 3BQ7A 5L8RC 4DJBA 1VQMN 4DN0A 1BI4B 2ZWHA 1EETB 3DOLB 3TWHA 1B0XA 3AAWB 1A0OB 4C7ZA 3CE8A 3JSYA 2XY8A 3AQFA 3PM9A 2CQCA 3QLHB 3DM2A 3RAMA 5HJXA 3S7RA 1LQ9A 2R3VA 3NS6A 3C94A 3HI0A 4A8WA 1B7YB 1RAJA 3RJHA 5HSPA 5D4NA 1V38A 4K5RA 4PA1A 4HL9A 4DR3J 4KJIA 5ALPA 4Z4IA 1AA1B 3PXGa 2I7PA 2RHSB 1WNEA 3LANA 4LD0A 1KWMA 3IRXA 3GOIA 2CIMA 3Q86A 1UTAA 2FBTA 2W9MA 4OX9F 2UXDK 2J7WA 4WQ4C 2N4DA 1VHFA 3H5SA 3AEVA 4CIFA 1APSA 1H1VA 2YH1A 5D4PA 1Q8LA 2YHYA 4CECA 1FXDA 1ZQZA 3DLEA 5DB6A 4I2EA 2BEFA 3A8EA 1B0PA 1QS4A 3F2KA 1QQ6A 1S1XA 1UCVA 2FMQA 4IQTA 1WTFA 1J6ZA 8ICGA 3R8YA 2VKRA 4N77A 2AJ1A 1RT7A 3L4BC 4F50A 3QU7A 5J0OA 3HKZD 4BHQA 1I1GA 4B9TA 5DBCA 2EQYA 1XHZA 1KW4A 4DB3A 3TWZA 3QNNA 1GTHA 2BZFA 3NWRA 2X6SA 4PG5A 2XZDB 3HSCA 1VQLN 2EI5A 3NGUA 2V8PA 2GHPA 5K14A 1TAMA 3LM9A 4F3OA 1YUWA 4WFNL 3RJEA 2WF8A 4K4GA 1T11A 3TAQA 2EX3A 4EU0A 2YJFA 3E9LA 2GBZA 4XIUA 3CFPA 4LF5F 3GV7B 4NM2A 3Q24A 2XIDA 3R7BB 2I6XA 3QNOA 3ZDAA 3ZT2A 2Q36A 2IJFA 3VCDA 2CQDA 1RTDA 1S4FA 3QUCA 2WAQF 5J0QA 5CYQB 4K4HA 2F1IA 3MURP 1VR6A 1XMOK 1GMWA 4R5PA 1ITPA 3KHRA 3V6HA 2KKHA 2ZKUA 3MN7A 2B21A 5A8RA 3ULDA 2R7QA 2E8NA 4BE1A 3LL3A 1OJ4A 1WNSA 4DV1K 3IBWA 3SAHA 1QUPA 1NLVA 1RU2A 2GA7A 2LPEA 4Y28C 2UV8A 3U4LA 2FPLA 2VFVA 9ICSA 1URNA 3JB9k 4CGGA 4RQ2A 2AYMA 3NVZA 1ZD5A 3SBMA 1QAYA 2RHKA 3KLIB 3L7PA 4LR7A 4UB1A 2Y9HA 3VMFB 1VSEA 1HKCA 3EE3A 2YX4A 4YB5A 1UPHA 3DC2A 2B3TB 2YBVA 4PKDB 3C6TB 3VGVA 4ALZA 2DB1A 2V50A 2X1BA 4P0QB 3KOOA 2IMOA 2RKIB 3D7EO 1RK8A 5DQHA 1GH8A 1KAXA 1KFSA 1HYVA 5FRNA 3L4PA 4M5IA 4M9NA 1L6NA 4LFBJ 4CIOA 1FD2A 4RJVA 1NJZA 3B78A 3Q0AA 3A2FA 1RP5A 2HRTA 1G2EA 4UW2A 2NPIA 1REGX 2DRDA 1U8SA 2VGMA 4NLVA 4RW7A 2GWJA 2HFNA 3MM5B 4KLTA 3R5BA 5FD1A 2K06A 1SJRA 9ICQA 2FVQA 3VGKA 3OL9A 4U96A 5J2FA 3EY1A 2V2VA 2WRMA 4LQ9A 2KICA 1WCLA 4FJ8A 4ILMA 4J2EA 3KKSA 5J0XA 2IRUA 2Q97A 3NMAA 3HXMA 5HMLA 3H42A 1BQXA 2QXLA 2QIFA 3K4GA 3V4IA 4AQYJ 4WXOA 2GS8A 5ETLA 1WHYA 4H4KC 1IBCB 3QXGA 2XVTA 3QUBA 2W6KA 2UZAA 4WTYA 1F1BB 1BPEA 2DGSA 4J9VA 4EMDA 3N97B 3HJVA 2DL0A 2IRYA 1BQMA 1EQ0A 5AE1A 4PUOA 2ASPA 2QGFB 5J2EA 4ED8A 2BJ1A 4OFZA 2HVHA 2W8LA 5KFWA 1HRHA 1VQ7S 4KHPJ 1E6YA 2ZH8A 2KHVA 2LQJA 1RYUA 3MPVA 5KFVA 3A13A 4P71A 2JLGA 2ZHAA 1X5SA 1YG0A 3M2RA 4UB6U 4QJVA 1KAYA 1VAZA 5ALNA 2L3MA 2FF6A 1SC3B 2IPOB 2J6SA 2KM8B 5C12A 2HMIA 2APOA 3F41A 2YNHB 1UEUA 4NWIA 4ECXA 2R42A 3VQ9A 4Y2PA 4NX9A 2WW4A 3FK4A 1FI4A 1B0TA 1UFKA 4XAKA 3RH6A 4CIEA 4KLJA 1J2NA 1TUUA 3T5LA 3ZYYX 4O23A 1H2VZ 3T1YF 3GU0A 3D6HB 4NLOA 4CJ4A 2ZITA 3QWUA 4TLRA 4K0KF 3BBFA 2KSOB 3TP2A 2OEJA 2AEMA 4FO0A 3LQVA 3CJ2A 3NRBA 3KJVA 3BGUA 2NO5A 1R43A 3AO4A 2VIXA 3PYEA 4JHDB 4PXBA 2BCUA 9ICNA 1AB8A 1DQ9A 2QA2A 1B0VA 2HFZA 2BANA 4X4PA 2K4HA 9ICRA 3Q2SC 1UCNA 1FVQA 1HBMA 5AKLA 1PZNA 1RU1A 3CJ7A 3RJMB 4NLBA 2EFGA 4FJMA 3GIIA 3TABA 3H1VX 2VONA 1WOPA 4K4ZA 1FDNA 4CGDA 1Q95G 3DMJA 2I5JB 4YDUA 3EWAA 1RAFB 1RHUB 3OJSA 5JRTA 1GOCA 3W2VA 2JWKA 3HFZB 1IBLJ 2H3FA 2WOMB 4F71A 2ZVSA 4M5JA 2YHBA 1LWCA 3FC4A 2HLTA 3MECB 3VEWA 4DU1A 5A6WA 4Z2XA 2O8CB 3VQPA 2EKNA 2UUAJ 4Z0UA 1TR0A 2ZH2A 3TUPA 1LV5A 1JLEA 4BRMA 3WX4A 2YNHA 4JKCA 3DXKB 3AVLA 4ZVUB 1XC9A 3QJLA 3W3SA 1KQQA 3D0PA 2FGOA 3T1AA 1RSCA 4J8FA 1XIQA 2UVUA 3WKAA 1N88A 2WB1D 4OPKA 4BQZA 3RBDA 2R7UA 4R64A 4FWPA 2YQ1A 2NRHA 1AZSA 5JICA 5J1NA 3HVAA 3DRPA 4DSEA 2ZM6J 2F3NA 2GVZB 3QSYB 1WWVA 4IR9A 4NA1A 3KTQA 4P7TA 1MQ2A 4OPHA 2F8LA 4JKHA 2LVWA 4RQ4A 4BE0A 1SV5B 2AJ2A 2OJ3A 3KLHB 4I67A 5AQRA 4B3OA 3U7JA 1GNKA 2IVNA 3MFIA 3RRKA 2J5AA 4FOEA 5IOLA 4DTOA 4DPWA 2GEMA 1NNEA 5JS2A 4TUQA 5KFGA 4LF8J 3RH5A 3ELHA 1XQSC 2EDUA 3KHYA 3JPOA 4MKBA 1FWPA 1FFGB 3D1HA 1SKRA 3ZNJ1 1RGVA 1PYTA 4C3LA 4KLDA 3SAFA 3ILIA 4JMUA 4JKGA 3V81A 4ISFA 5ALHA 3MR7A 5CYJA 1KBRA 1K1SA 4PPXA 2FVCA 3CJCA 1SBRA 3V9SA 3C7NB 3CIZA 4DUZF 1K5OA 2QJ3A 4PUOB 4F0KA 3D2FA 2YV0X 2VFRA 5AQSA 3VQSA 4USJC 1JLEB 2FC9A 1DXSA 4NLTA 3L9ZA 1Q86T 1M5HA 2ZHOA 4H4OB 3ZSYA 5AQGA 2DRBA 3UCUP 5A6PA 5IT9U 4CF8A 2C28A 1YITS 4E8UA 4ID1A 1HNZF 1FJGJ 3VAFA 3ZSOA 5C10A 5KG3A 3J81U 3M8RA 4IL6U 1D9DA 1M5PC 4E7KA 4LFCK 3A3NB 3QGHA 4NL9C 1PC4A 2HWIA 2AX0A 3BO3A 1VSFA 4IDHA 2VQFK 3TQEA 4JD2A 7ICOA 1S1UA 3TO8A 5KFZA 4H03B 1NGFA 2ATLA 4I9QA 1YJWS 4B3TJ 1QHAA 1NK8A 2B0GA 1EJ7L 2D5RA 4CDGA 1FXRA 5HVFA 3MOZA 3GE1A 4M7XA 1M1KT 2VQEK 2B8PA 2VF3A 5GAEU 1RE1B 1WC4A 2FIUA 1FFSB 4B3SJ 2WBRA 3BP8A 3SXLA 2CVEA 1TMJA 3H20A 3C2MA 3PW0A 4JI7K 2MA1A 2HHVA 3KJFB 5KT6A 4DR7J 3BR9A 1JWWA 1FEHA 4NV0A 3CT9A 2E4LA 3FZLA 3KD5E 1Y3JA 4NLYA 1U1KA 1N62A 2DISA 2YKNB 2DPJA 3AAPA 3T69A 4GXKA 4B3OB 2IA6A 1HWUA 2MHEA 1DRZA 2ZWOA 1IQZA 1FHTA 3ULEB 1GT8A 3BKFA 2WVEA 4BG8A 2JEGA 3RBEA 2K60A 3ZEUA 3U27A 1VI7A 3G87A 3IAM9 4RU2A 4KAZA 1QH9A 5D49A 4FJGA 3MWBA 2HOIA 5ELZA 4FFDA 3EM1A 8ATCB 4C11B 4Y2JA 4TUSA 4M04A 1XJWB 1UAWA 2NXEA 3PFOA 1FKPA 2JVOA 5LL6Z 3DXKA 2VPYB 4DR5F 3S6JA 4XDDA 1QSLA 2WB1F 3W5XA 2YWKA 3RAQA 2CPDA 2B0CA 4K4UA 4ED7A 2R7WA 1F9HA 4OZ2A 2W04A 1NU0A 4M5GA 3NGKA 3F5TA 3UCGA 2DKOB 2QA4S 5B08A 2R8JA 4A8SA 3ZETB 1TL3B 3EKUA 2LYVA 3EWGA 1EP4A 1TVAA 4LREA 1ILYA 3GYGA 5DM7Q 1QQCA 2AEFA 1PUZA 4PWDB 3WXIA 1O03A 5F0UA 9ICKA 1DTTB 3LOUA 3UMGA 4OHVA 4Q5VA 4DUYF 4ZDNA 1XNQK 2RN2A 3SI8A 1RWPB 3WNGA 4ED0A 4QWBA 1W7WA 4RW8A 3KK1B 5J2HA 4EBDA 4WF9Q 1TMMA 4FYWB 4USWA 4Z6CA 3WIVA 1VQ6S 4FJLA 5B09A 1M1HA 3O1WA 2XMKA 3RBZA 1XNRF 4BRHA 4DU4A 3K2YA 4OZJA 3R1XA 5B0DA 2D69A 1TKTB 1KEJA 4HTUA 2BM1A 1TK5A 5AQUA 2JWNA 5HQMA 2D9PA 4Y0WA 2YNIB 5GMDA 1HNZK 5C24B 4NCGA 5HATA 3P1GA 1RT4B 3CDBA 4B8CA 2FY8A 2QT7A 7ICHA 3B0YA 6AT1B 1EX8A 4ZCMA 4NA2A 2AGQA 2AMCB 3UXOA 8ICKA 3MTJA 1GMWD 2F3JA 3KVGA 2E5LF 3AD9C 4M5HA 3MWPA 2HGLA 3SR6A 5IILA 4KLHA 2HFUA 4K2XA 2E7WA 2R2UA 4CNYA 5AQNA 3JYTB 1N5SA 2RQMA 3MMBB 4NMLA 4RW9A 2HGMA 1KONA 1RKIA 4X64F 4KH6A 1U7LA 3HCXA 2IOFK 2CA9A 4CJUA 1NNLA 4B3MJ 2W3RA 1DJ0A 3ILOA 1RAHB 3AOCA 3ZT3A 3M2VA 3QJPA 1IJFB 2Y1RI 4ICLB 2Y1IA 4FSVA 2DK2A 3EDRB 2CPIA 1H73A 6FDRA 3A4TA 2OPPB 2LYAA 5B66U 1WTBA 1NH7A 3R5GA 4RQ3A 2KFYA 4PQUA 1BHNA 2KZZA 2MMYA 5J0TA 5EGYA 5KPRA 2ZIXA 4Y6IA 3UKRA 4Y2VA 3N7PD 2P9UA 2HNDB 2ZXHA 5AKYA 4CEOA 4EAHD 3SSQA 2M0NA 1S0OA 4CF3A 3VQ6A 1SXEA 3CPEA 3UM9A 3OFHA 2PZSA 1SGGA 2CGLA 4FYVB 4A61A 4A5BA 1HR0F 5HBMB 1HNIB 2VG5B 4X66K 2DUYA 3L2VA 1B92A 4F2RA 2JWLA 2G13A 1IVZA 3LDLA 4XTTA 3V7JA 5C7PA 3MMJA 3MPYA 3H0PA 2G06A 3ZTSA 3I33A 4BDYA 5HNKA 4LFBF 3TQ1A 3Q89A 2BH1A 3CUNA 5KOWA 1VQOS 1IBKJ 4OCZA 2KJWA 5KFUA 5KT7A 1HPZB 2F76X 2P6UA 5F9NA 4M63A 3A1YG 2KSOA 2JOQA 4KE5A 1CJKA 3AO3A 1SXDA 1NB2A 3KUGA 1HX1A 9ICIA 3MUMP 2P6TA 4F4AA 5F8HA 3MUTP 2FVRA 1JROA 5F8LA 1R6VA 3WDOA 2XZWA 4ZVHA 4A57A 3PSTA 4FYDA 4IOAQ 2DPIA 4LIRA 1QUVA 1S0NA 2EBEA 3KYLA 1SB6A 3RU0A 2HWTA 2ZH1A 2ACYA 3H40A 4RL1A 4RX6A 2EFNA 2UUCJ 3VEOA 1DT9A 1A9NB 2E1ZA 3AB2B 4NL9A 4OZ3A 5AM0A 4F72A 3IFRA 1Z1VA 3HSZA 5B8HA 4WWSA 1MWYA 2Z2YB 3DM2B 3K8VA 3HPGA 4CO3A 1YKWA 4GMKA 2HBJA 4KTWA 5KG0A 5F8MA 3AO1A 3I6PA 5AI5A 3KXDA 1Q8IA 3MM6A 4C98A 1R59O 2ZD1A 1L7PA 3HKZF 3PMLA 3ZDEA 4NLPA 2AQ4A 2CFXA 4AM7A 3CFOA 2GWSA 4DSLA 2BE2B 3OYGA 1ZXIA 1NGJA 1L7OA 3C5FA 4BDZA 1URRA 1YRTA 2Q0UA 4BWMA 2CZ4A 2ZBQA 2I8EA 1P7DA 2ZZTA 5TZVA 5HO4A 2D9OA 5J0PA 3U9DA 5JUMA 2V6AA 3AXKA 1UETA 4HHTA 1FE4A 5L1MA 4KV8A 3MM7A 3N9UC 2FHMA 1COKA 2WC9A 4J9MA 2LQ8A 2MU2A 2O8EA 3AQOA 1ATSA 1FKOA 4FJJA 2HVIA 4L76A 1VC6A 4AL7A 3HHLC 5U47A 2CQ2A 1BXNA 3AU6A 3FCWA 4IBNA 4ECZA 1NPPA 3JSMB 1H7WA 1WBBA 5F3XB 3C16B 1FJCA 5EVZA 2Q66A 4KGXB 2R8KA 1HL6A 3IGVA 3L2WA 1RABB 4WP3A 3A0IX 2IIRA 2UUTA 1RYSA 7ICGA 1SJ1A 3RJGA 3NDKA 4X4RA 2YKAA 4PWUA 1CJUB 4WTOB 2OPSB 4FVCA 3CCQS 3N6MA 3SK3A 3F56A 4K5SA 4M3TA 3D67A 2IFXA 2V67A 4ENOA 3R5DA 1MA9B 3IWXA 2R2RA 2Z7JA 1RAGB 1IG8A 3CC4N 2OA8A 3IA0A 4CZCA 1O51A 4IFVA 2RDDA 4IS7A 1K8KA 5LMUF 1BISA 4KO0B 4BGBA 4ILLA 2BKEA 2I5JA 1IKXB 4BBYA 2G2OA 3G6XA 1D9AA 4OX6A 4BGAA 3THTA 1TKXA 2E5LK 2WFAA 2Z56B 4F3MA 1KHVA 3L09A 1NWKA 1SS6A 4WJBA 4PH5A 1DZ5A 4LF4J 5AJ3J 3CXCR 3HTVA 3QGIA 3ISZA 3DOKB 3S8SA 1WC6A 4WFBL 2DKZA 1V85A 3PO4A 2MRLA 1ZD4A 4GVMA 3M9OB 1OVYA 1NSKL 3R5CA 2KQ2A 2YNGA 4UOCA 3FYHA 2ZOMA 3FUYA 1R8AA 2BVZA 1B4FA 2NS1B 3DU6A 4CW7B 2MQPA 4ECVA 3MTKA 1FJGK 1NOMA 1V9PA 5F41A 2X1FA 2ZC4A 2Y8YA 4CJ7A 1X0PA 3HX0A 4CTAA 4I2JA 3RTVA 2OKQA 2DXFA 4URSA 2GAHC 3R9LA 4ELVA 3HT0A 4H5WA 4C4TA 2R2TA 4TN2A 1NDKA 3QT8A 4BC4A 2CQ0A 2AJ4A 3T79A 1FNMA 5BJRA 3H2UB 3HDSA 7FD1A 4IRCA 4GKKF 1KC8T 1T44A 4LSLA 4WP8A 3TZWA 2UUCK 1U6ZA 4JHDA 1Q7LB 2P6RA 1KQGB 1U2FA 3ISND 4CEBA 2OPQA 1HBNA 1NJIT 3LDPA 4IZ9A 2A42A 5H1SV 5KFFA 4F0HA 2HHHJ 1HBUB 3C6UA 4AHTA 4NO7A 3QRPA 1HI8A 1S6QB 4XQ8A 5MLCQ 4CEFA 4LF7K 5AM2A 1NMEB 2YX7A 3IUCA 2AIRB 1LWEA 4OIXA 2EBGA 2FZKB 4L73A 5FP0A 3QE9Y 2UXBF 3UN5A 4ELUA 2VBYA 3MM6B 4UB8U 5EUHA 4DR4K 1HIYA 1F60B 1Z2ZA 5TKYA 3KNGA 2RE2A 1A77A 3V4IB 3TOQA 2ADCA 5HI7A 1C0TA 3DOKA 4KHMA 1HNVA 4X84A 4Z6DA 2IHMA 4KREA 1N52B 4O5EA 3PMNA 2YNGB 1KQKA 4ZS6A 3W61A 3MN5A 3VGTA 1H2TZ 3PX4A 3D9BA 3H0LB 4DV2F 3NS5A 4Y00A 1TELA 3H2VE 2VOPA 1ASVA 4BXOA 3LZJA 5IM0B 4O3MA 3ZSRA 4C6AA 2W6LA 1HUZA 3DGVA 3PW4A 3LPTA 4DMZA 4KHYA 4GLXA 2BPFA 5ALFA 4MLEA 3RJJA 1VSHA 3H1QA 3VTIA 1O5JA 3WK7A 1OH6A 1X0FA 3DKDA 3SUNA 2IDOA 2UUAF 1YZ6A 1SJQA 1NGGA 2IM1A 1NBWA 3K8WA 2QL7B 4NYOA 1RJJA 5LL6d 5JVHL 2BKPA 4G1QB 1ZQTA 1R8PA 2ESEA 1VQMS 1CI4A 1RDCA 4FXWA 1DQ8A 5C15A 3D2SA 1YIJS 4RTFD 4ZHRB 2Y0SD 2DTJA 3UD4P 2V8HA 3MABA 1WACA 2F9WA 4UW9A 1NPKA 1IBKF 1S76D 1ZM3A 3OXGA 3ZTQA 4CFBA 2XRIA 1L3SA 1TV9A 4CI0B 3TPQA 4YHHJ 4ES2A 3RJFA 4U7BA 3G6YA 1SJ3P 1BIZA 2CN1A 4KO0A 4L3QA 3WXLA 1P1LA 4RWXA 3M1FA 1GMUA 1NPRA 3QEVA 2BKOA 3MXMA 3WEEA 1HW8A 3T6JA 4DOAA 1YJ9N 1F0XA 2MKSA 2W2PP 3NAIA 2A6AA 3J81j 3OR1B 3AA4A 4CLUA 4M6WA 3W9IA 3GDQA 1Z4OA 2YVSA 4KHNA 3SQIA 5DBBA 4K4IA 1VIOA 2OYYA 3ISDA 4IQMA 1M5KC 4LRBA 2GMLA 1Y00A 1LW2B 2FLNA 3FMBA 8ICJA 3D5MA 4C0OC 5L1IA 1IIPA 3BZCA 4KLFA 2ZH9A 3ITHB 4JWMA 3O9TA 1WHXA 9ATCB 1ECWA 2Z30B 2GHWA 2QL5B 1W26A 1PVRA 3F73A 1T05B 3HRGA 2O4IA 9ICGA 3HYFA 3X3UA 3GR1A 4FZVA 1M90T 2ZH6A 3K89A 2ALZA 2GVDB 4I56A 2W2NP 4O8UA 3K5LA 5EHHA 3PR5B 4CI6A 1KD1O 3OYHA 2P9NA 1R3NA 3CC7N 2VH7A 4DQIA 1R6YA 2ZDOA 2E20A 2DEJA 2B6GA 1X4EA 3FEYB 1YVUA 1TP7A 2MB0B 1PBUA 1SQEA 1VQNN 5LMNF 2ZGZA 2H4WB 4USMA 4HUFA 4QZBA 3PACA 3G8SA 2G0IA 4F5PA 3HBTA 2W3SA 4KB7A 2OPRB 1KQFB 3IFEA 1XERA 4ETZA 5K8NA 3NVVA 1RT3B 2VL1A 4Z4GA 5J2PA 2ZIVB 4C80A 4F4XA 3NH1A 1HEKA 2H4YB 2FJ6A 4B17A 2Y9TA 4NLKA 1QE1A 3D7SB 1A5VA 4QQBA 2YCHA 4MIBA 3U02A 1U1MA 4O3RA 3J7A1 1H2UX 1FWKA 1LFPA 4YB1P 5GADU 3GJQB 1DGSA 3T1HK 4FLWA 3SJJA 1NO8A 2QB0B 3J7AN 3WT0A 4TSXA 1Z00B 1ITGA 4LF9K 4EBEA 3L4IA 1P9QC 2IOHA 1L8LA 3G6ES 4IOCL 2UUWA 1KVIA 3POTB 1GXTA 3BQ0A 2OZSA 4U8VA 4KLEA 2HHSA 2NZCA 4OZNA 4CF9A 4DR3K 3QNMA 1S6QA 3RWUA 4QAGA 4KB1A 3SV4A 3NF7A 4FJHA 2BE2A 3G82B 3N7SC 3OXFA 3GG4A 2MZQA 3S01A 2PYLA 1FJEB 5ADZA 3MM9B 1T0TV 1T03B 3VAIA 4PHAA 1VQ4S 1LW2A 2P9NB 4WQ4A 4IQWA 3BS7A 3THXA 4CJPA 2C2MB 2IC3A 4JI8K 1KN5A 2GIQA 4RLEA 5AKXA 3I87A 4J5OA 1JRPA 3M1VB 3SEOA 4DR2K 3K9KA 5GMKa 3HSTB 3HMJG 5HOOA 5DK5A 4AQYK 3H45C 1D3WA 1KR4A 1E6VB 3B6BA 2HPUA 3IP0A 2ZH5A 4IQXA 2BCRA 2ZUAA 3HWTA 1RXWA 2GQCA 5T7LB 4LSNA 2HBKA 3M6VA 5AIAA 3P45B 3QGGA 4Z6FA 3CJTA 2HQDA 2Z0GA 4DTUA 2AEJA 3W9JA 2DF4B 4TQRA 2RB7A 2MKKA 1YJ9S 3R6LB 1IBLK 3AQPA 4LRCA 3PDNA 2E9TA 3HD2A 5GAGI 2CQHA 2CADA 4HTIA 1Q7YT 5MAOA 3UI3A 5D3GB 4BRLA 1VJQA 4LBIA 5KFEA 1ASUA 3FMWA 2R4FA 1U09A 1VLYA 1AQ6A 3PW5A 5HRSA 4RQMA 1K44A 3WEEB 4JK7A 4ITSA 3MMCB 1ZQ1C 2W11A 3SFGA 4Y2KA 2JR5A 4JI0J 4K42A 3KG1A 2OHFA 2BACA 3QX7A 2CZ9A 1Y10A 4DWIA 3PKMA 1AFJA 2W1BA 4MJKA 4DOZA 3IWNC 4M9LA 3KKFA 5ITHA 3R2CJ 1S6OA 2KHOA 5KFLA 4BR0A 3UXNA 4V19X 3H4BA 2FSNA 4I6YA 3CM5A 4E7JA 2YY3A 2Z8QA 1KVBA 2E2PA 4DV7F 2QSWA 2JHDA 4X66F 1NI3A 1S1WA 3C66A 2BANB 4MTPA 2DIUA 1AUSL 3NVYA 2FJBB 4LUBA 1BWFO 2ZUDA 1ZQAA 4KH4A 4PG6A 3SLCA 1CS4A 2C2ZB 2MAXA 3FM9A 4DV5F 5EE3A 4WP9A 3M1YA 2F40A 1LWFA 3R1HA 2VCPA 2QXFA 2G8FA 2DEIA 5CZ1A 3VQQA 4P4MA 1OW5A 4CGJA 4JB3A 1ZM9A 4ZK7M 4DUZK 2E2OA 3N7RC 1J5EJ 5L1KA 4UTGA 4MDBA 3KMSA 4A8YA 2YI1A 3CJAA 3EUB2 4WZQA 2FLPA 1VQ6N 1M1KO 4EZ9A 4I29A 5EE0A 1N8RO 1CJVB 2VG6A 4IG3B 2XICA 2OLWA 3PSPA 2LEPA 1RT6B 4RW8B 4A8XA 4IFYB 1JLFB 2QTWA 1BE4A 4QZFA 2C3UA 1RT5B 3EMTA 1M90O 5C2CA 3CCSS 3GJTB 3SUOA 1HNXJ 4ZVQB 2PA8D 1KFDA 2CQ1A 2IVOA 1SKUB 4NRUA 3G4SS 3LP2A 4CF5A 4WU2A 2ZTCA 3CJ8A 3CF5Q 2WW8A 1N32J 3LP0A 1Y9OA 1NKCA 5CR4A 4MYUA 4LBHA 4RW6A 1BCMA 5AXMA 3RW7A 1NAQA 3PSIA 4BUGA 1IKWB 1KLNA 1PKUA 2B56A 4FZMA 2F1FA 2K7KA 1NK4A 2IJNA 3ZCMA 2A1JB 4I2BA 2J0QD 5IZHA 3HL8A 3LDSA 4ILGB 2PAVA 5BN9A 4FZZA 4XUSA 2Y1JA 4Q8FA 1KVJA 4BC9A 2ZM6F 2DGXA 4L3KA 4TU7A 2P9LB 2WHEA 2DHHA 5THWA 1XMBA 4M9JA 3O1BA 1N34F 3B4MA 5K14B 4B3SK 3G6EN 2JZBA 2AW0A 4ZVTB 2UVVA 1TUWA 3C46A 1RBLA 5CYMA 4DR7K 3S1TA 3MM5A 3PX0A 3CEDA 1VSIA 1LWEB 3DLRA 1U45A 1FA0A 4P72A 1T6DA 1LEOA 4W4MA 1XR6A 4WU3A 1H72C 3ZZUA 4AP9A 5CH7B 1JJ4A 1X4BA 4WQ5C 2AH5A 1U1NA 3QQCD 1T3NA 3MM9A 5KGXA 1F0MA 3N6NA 3DAWA 4CF4A 2ROEA 4CZEA 3HHLA 1FRHA 5GMEA 5AKJA 1VQ9S 3L3UA 3T1HF 3RG6A 5A2QU 1VQNS 4CLFA 1QJHA 2J6UA 1KAZA 1XQIA 3DDKA 4YOVA 1MWMA 2QKBA 1SJFA 2PXIA 2A1SA 2CXYA 2EEYA 3UXPA 4ZVEA 4ZOSA 3CHWA 3LUYA 1SAZA 2QA1A 1JLQA 2VZ9A 5EN1A 4IFEA 4HEA9 8ICLA 3DXMB 1TE2A 1CC8A 2JH3A 2OGUA 2O1PA 2B9XA 4BC2A 5KT4A 1RKJA 1RWWB 1S9EB 1U4BA 4C0ZA 2EZZA 4ECUA 4N5SA 3GYXB 4O44A 2RRAA 7ICMA 2LCWA 3RMDA 5CA7A 4K0KJ 1YJ7A 4K4XA 4L72B 2FVPA 2DH7A 1C0GA 4H4MA 4KBIA 5BYQA 2LU1A 3QUQA 3RJKA 5DG7A 3MC1A 4DX7A 3TEHB 2F9TA 3F9KA 2XMWA 4B1YB 3OTOJ 3LW5C 1Y3KA 1V4SA 1NZAA 3LP2B 1RTHA 3D2EB 4IEIA 4O5FA 4TURA 4HVZA 5CE3A 8ICIA 5CR0A 1BMQB 4X4TA 4WKRA 3K5OA 2E6MA 3E51A 4CNQA 3R2DJ 3OYCA 1ZBLA 2YHWA 1PILA 1QCKA 1B43A 1SZ2A 4L3NA 1WSFA 5ETNA 2C2KB 1T05A 2ZVIA 3FZMA 3RSEB 5HMWA 5HP4A 1IH7A 2L48A 1RDAA 4Z94A 1UPMB 2DNRA 2IIHA 3CCJN 4RPFA 3L2RA 2MQLA 2P9SB 4X64J 3CXCM 3W3DA 3V72A 1KD1T 3CDAA 2H3ZA 1M0SA 3SQ0A 1IG9A 3N4WA 1VC5A 1EWQA 3D28A 2EFOA 4K4WA 5CQGA 4UB2A 5FPDA 1RTIB 3THVA 3QLHA 2DFEA 2ZIWA 3AA8A 2A6MA 2MY7A 5AQHA 2D7SA 4AL6A 2JEIA 2QO3A 3ILJA 2BJDA 3CJ3A 5ETVA 1C4AA 3SCIE 3OBWA 2FZCB 2A1RA 4ILRA 1W2IA 3EE8A 1GEHA 2P8IA 5ALJA 3CCES 3PJWA 2MZRA 1OO0B 3NEKA 3K1ZA 5E33A 1RM6C 2A1AA 4F8RA 1V9OA 2DY1A 4CH1A 3MF5A 2E1MC 5C2FA 2QB0A 1AW0A 2J4RA 4FYXB 2VYPA 1NLKL 3O9QA 3BY5A 5J2AA 3C2LA 2KJ9A 3PEHA 2H65B 3E9OA 4PPZA 1LOTB 1WDTA 4C2MA 3VPZA 3KD1E 4P10A 1N36J 4OKKA 4DR2F 4X4QA 3OVSA 3WKBA 4Q45A 1TFRA 1S9GA 2GCFA 1VRUB 3FGUA 5AQLA 4OJGA 4NYZA 5D4BA 3PYGA 3DYAA 4OYBA 5EY4A 4CJ3A 4CJSA 2LDIA 2CPEA 1PCAA 4ILJA 2YKPA 2PMZF 3PX6A 3DLJA 1YI2N 2QW9A 4M0AA 3WQPA 3VQTA 2XLKA 3I5AA 2A19A 1QHTA 1Z2LA 2Z2ZA 3IS9A 4DQPA 3K59A 4GKKK 2FJAB 1ZQMA 1QAJA 4DOBA 4ZP6A 3M8QB 5KPTA 4LR9A 4PXEA 4EBCA 5BRDA 5LOQA 4C4WA 1KRPA 2VQFJ 2NRRA 5CYQA 3D3CJ 2GIFA 2Q79A 1GQEA 4J2BA 2H9ZA 1C7YA 3TA1A 5K8OA 2HSEB 3SQ4A 3CIMA 1UMJA 2UXCF 2ZJPQ 3D45A 3MAAA 2OTJS 3CDEA 1RT2A 1BHLA 5IFMA 2WTUA 2ADBA 3FLCO 4MFBB 5HP1A 1XR5A 2J0XA 1H98A 4X65F 1S22A 4IKFA 4F7VA 3B8HA 5J2IA 2DHXA 5DM6Q 4M5NA 2CH6A 4RUHA 3CM6A 4JV0A 2LXIA 4UZBA 3OHAA 2NRZA 4JUZA 4IDKA 4B3RK 5LSLA 1MMNA 1IBMF 5J0WA 2PI4A 1XBWA 3ID6A 1GMVA 1YHQS 4CIGA 4W5NA 3KDOA 2AGOA 1OYDA 1SUQB 1YRUA 3DXMA 4GNIA 1FFUA 2PFDA 1UFLA 5HHIA 1BY9A 2UUBJ 1HKAA 3MEDA 3VEXA 4IQUA 1I51B 1T7PA 2RPIA 9ICEA 4ZLLA 2KI2A 4ZVOB 3PRVA 2R7VA 2H3GX 1DGJA 4PHPA 3CB4A 1FK9B 1UFWA 3CD6S 1LW0A 3PV8A 2P9PB 4CYUB 4HVJA 2V7YA 2MEWA 5BPCA 4OJ3A 3KK7A 1RZTA 1DK2A 4MDAA 2W03A 2LMIA 4NEYA 5A76A 3UDLA 4RUAA 2AJFE 4P2MA 1VRUA 4ZVPB 4DZDA 1WJ9A 1DK3A 2V9KA 5LXYA 1WEZA 2VU5A 4HI2A 4LR8A 4CK1A 3DLKB 4CT8A 5HHHA 4YNQA 3CERA 3FZKA 4ID5A 1G1XA 1N36F 2HF4A 1QAXA 3C28A 5BR8K 2OH2A 4TYBA 3H59A 4K4VA 7FDRA 2M52A 5AJ3F 2AJ0A 5AZIA 3AQEA 3WK6A 1SQKA 1XO1A 3T7ZA 2XI9A 2KFNA 4NM1A 1JQGA 3N5FA 4LY7A 1U1PA 1DTTA 7ICUA 1NSPA 2E8AA 1X4DA 2F8SA 3ZX3A 2N3OA 2ASYA 1AYEA 5ALRA 2FTRA 2GW8A 4FBTA 4WFZA 5E3CA 2E8MA 4LFCF 2G8HA 1ED1A 1JLBA 2XSJB 2YMMA 5FDLA 3H3NO 1QQ7A 1F9FA 3J7ZO 5ALQA 4TNOA 3AO5A 1Q9XA 4QOZB 4AF1A 2K4IA 3B4DA 7ICPA 1F2HA 3I0SA 2CNNB 2HHTA 4IG0B 1BNPA 5E3RA 4P4PA 2RILA 3OYAA 3MM8A 2V2ZA 1FJ7A 3FNNA 3CD5A 5KFSA 3ZLJA 4ANDA 3FSXA 2YX1A 4YR2A 3AJ1A 1UL3A 3DNCA 2XYPB 4WFYA 3Q23A 3O9UA 3OYDA 1X7VA 5CY4A 4BACA 3M6XA 2Z1GA 1BL3A 2C2RA 3LAKA 4J91A 3CC2S 3NCQA 4K43A 2CPFA 2A6OA 3NRZA 2CG8A 3D4JA 1ZZNA 1Q16B 1UA0A 4DFDA 2DGUA 3AVCA 5E26A 4Z4FA 4U7UD 1N32K 3RB3A 4OZ1A 3SAGA 2R7OA 1HMVA 3IG8A 3O3HA 2C3OA 5HAOA 3GIKA 2LFVA 3BREA 2QA4G 2AU0A 2UV8G 4JI2J 2MHNA 1JCGA 1SV0A 5ETQA 2X1AA 4HKQA 3BO4A 1XNSA 3RUBL 2OTLN 1CJUA 2VHGA 2BJEA 5GAEI 4EIAA 2A18A 4FPIA 4JI6J 1NGAA 1ZQHA 1OS5A 3GFYA 1VQ8N 2CNKB 2ROGA 4KN4A 4QIGA 2DR9A 3CQ8A 3SYZA 3CJQA 4NLNA 1WKKA 1S77D 2YJEA 3W8PA 5HMYA 2QLTA 1GX5A 5TISU 4KMUA 4Y2AA 3HHEA 4QIVA 1X66A 1V5IB 4OX9K 3M2VB 1P8ZA 2HHHK 3CCVS 4K4SA 3OA9A 3OTBA 4QWCA 2CDRB 2ZKTA 4USAA 2E3TA 3Q8RB 9ICXA 2QC3A 3H0RB 3C2KA 3VA0A 1PJ6A 1UEVA 1S72N 4RWWA 3V1OA 2X51A 3IM8A 2BCQA 1NSAA 3QICA 4ILHA 5G0RA 1CG2A 1SH2A 4OYZA 4RNNA 2JEJA 5KAIU 2CWKA 4C4RA 1VS3A 3C3LA 4JV5K 1N5VA 4DXLA 4DV3K 2NXJA 5D3GA 1YDLA 1MN9A 3H8WA 3W1YC 3EZWA 3OBYA 2UVWA 3TJAA 3C21A 2OPRA 3HD1A 4ZLPA 4IG0A 4NI2A 3ATVA 2ZC3A 2HCFA 2C2DA 2NYHA 1HNIA 4GW6A 4WCEL 3UWTA 2W9CB 3AVGA 4C4SA 4NZ7A 1OKJA 2F4VJ 3NNCA 3QMQA 5D77A 1VQYA 2AD9A 3HM8A 3Q8UA 2L9NA 3PR4A 1S49A 4KGMA 1ZM2A 1N34J 4Y2CA 3U6FA 1VRTA 3V9WA 3DV9A 4WZMA 2B9WA 3OYEA 1JALA 2B9EA 1UZHA 3JPPA 4PKHA 3W9HA 2J9CA 2FPHX 1PSDA 4FLVA 1G7CB 1OPIA 1RWVB 4LQ3A 3P5TL 4LF8K 1PGZA 2JFDA 5LSOA 2NRVA 1C1BB 1RTIA 2J9DA 3C14A 3C15A 2O5DA 3DLHA 3EDQB 1FNXH 3KFUF 1DLOA 1ZYQA 3DI6B 3CTRA 4J9LA 2AZ3A 4EFHA 4KI6A 5DG8A 2F9DA 3QUTA 2ZD1B 1TFWA 3I32A 4JI5J 1X3NA 4MEXA 4CBXA 2PI5A 5ALMA 1IV8A 3CO9A 4BRGA 4X66J 2AYEA 3AVNA 3KDNA 3L2UA 2KT3A 4X64K 2PY5A 5GINA 3OJUA 1SKWA 3I8BA 4K8ZA 4DR4J 3D6MB 1HIWA 5IIJA 2VG5A 2FJDB 4Q2MA 4NCAA 2FC0A 3QWPA 8ICBA 4XH4A 4NLWA 5ALLA 2MQ8A 2E7VA 5ALVA 4ED2A 3TJ9A 3WKDA 2M5YA 5KRSA 1PAUB 3C19A 2KMDA 2CWXA 3H25A 4O3OA 3R7SB 1X40A 1NM1A 1PYOB 3PYDA 1S1UB 2KHQA 3UDEA 8ICAA 1HPZA 1C0MA 1B4SA 3P4IA 5RUBA 1LFWA 1JMSA 4F3QA 2ZGYA 2B4OA 3M5RA 4GXIA 3I8DA 2BR0A 1IWAA 2FPKA 4DUTA 4QYRA 1PK1B 3ZT0A 2QM1A 4ZKAA 3M32B 3NBPB 1MA7A 4RBUA 4KHQA 3SCJE 3QU5A 2MQQA 3H7IA 4KX3A 3MXHP 2O66A 4HACB 5DS7A 1YJNN 4DCOB 5KFDA 5EDWA 1EQMA 2M3DA 4A46A 4J9KA 2GQQA 3QFWA 7AT1B 3LM2A 3AMZA 1WLJA 4A48A 4OQJA 3BO2A 2DR5A 3NGZA 4F4YA 2X3DA 5BXIA 3MN6A 1VSJA 8ICQA 1RDWX 1HYSB 3VQBA 2H51B 2BDPA 5CYMB 2R9LA 3LA0A 4CEZA 3W2WB 4DF4A 3H8SA 1D9FA 1Q5VA 1RACB 4M5DB 1RBAA 4DU3A 4KLLA 4M2YA 4DHYA 5HANA 2NR0A 4D3GA 2CXEA 2F8HA 4IH7A 3OXLA 2BE7D 1WOOA 4B1XB 2OI2A 1IXKA 3W8GA 4HTLA 3KMQA 4C11A 4JI1K 3VEZA 1HW9A 2W7OA 3MCNA 3H7HB 5D46A 1VQON 3VESA 3CPWM 1BQNA 4J9NA 5DM6L 3CQYA 1TQLA 4XEIA 3THYB 1RG6A 2ZIWB 2K3IA 4DCJB 1V4TA 2H3QA 4B1ZA 3MAAB 4NCBA 2LSNA 3DLGA 1I94K 1KSPA 1OY8A 1JLQB 4I7FB 1OSCA 2ZQBA 5KG4A 2XHWA 1W7AA 3THWA 4DR1F 1U9LA 2DHAA 2ZH3A 3T9ZA 4RUBA 4FZNA 4FWRA 3NBPA 4HHJA 5J1PA 4BGDA 1BG3A 1WC3A 2V52B 3L6QA 2R7RA 3RBXA 1NMDA 3MDAA 1IV0A 3CI5A 3W65A 2N1RA 4DR6J 4FJ7A 2F1JA 2OD4A 4AXJA 2ABYA 2HS0A 2BOPA 5I42A 4F26A 4A8MP 4OYWA 5B0FA 2NSCA 2DBYA 4Q43A 3OFGA 2BQ3A 4KH1B 1IBLF 1WSGA 4F91B 1TKTA 1LVHA 5I3UB 4ECYA 2NCKL 3R6GB 3T3FA 1L7MA 3W5YA 2ZZMA 2QMWA 4NXMJ 3VERA 4KLSA 5A0LA 5AQOA 2GUIA 4R66A 1XO0A 4OJPA 1QVGM 2HNZA 1ZQCA 4ZCLA 4LSZB 4XA5A 2M4MA 2EPIA 5T14A 2DNNA 2RE1A 3NNHA 3AVMA 4BR7A 3IR7B 3CMQA 2VB6A 2KHCA 1S6PB 1RA7A 2CG4A 2DYAA 4M7YA 3ENHA 1BPYA 1K8AT 4K2JA 3UKRB 1I94J 9ICMA 3ONQA 1C1BA 3HHKA 3J7ZT 2GMHA 3ZDDA 3WK4A 4KHRA 1C2PA 4Z6EA 4OYPA 3TFRA 5KFXA 2RQCA 3VVTA 2YXLA 1U2RA 4C9DA 1O13A 1ATNA 4OJLA 4KB0A 3PNCA 1Q53A 2GJIA 4QZGA 5EE9A 2UYTA 1SWVA 3G0ZA 1OH5A 2YMQA 4CWBA 1MWZA 4OV1A 1W25A 4PZVA 4I2PA 1QVGR 1ZD3A 4NPOA 3MGVA 5C42B 1M1GA 4M1KA 3A5NC 1R0AA 5M2RA 2H5IB 3FC9A 3DLLQ 5EE1A 4LIWA 5FPMA 1E6VA 2E88A 2YPZA 2P5GA 3M8WA 4BRIA 1DOQA 5L39A 2OZMA 4LFAF 1N5QA 2B4PA 2YH0A 1MG7A 4GC6A 3VGSA 2VC1A 3QAEA 2QFJA 2OEHA 1VQ4N 3MD1A 1RTJB 4DFMA 1GFWB 5DLGA 4FKXA 4PR6A 1VQLS 2XMAA 3NE6A 3AT1B 3NXZA 2DNKA 5J2DA 5F8NA 3OTOF 4MQ3A 2XMJA 3PIOL 4ZPBA 1C20A 5HR6A 1HKGA 4CJRA 3OR1A 5GIPA 3NAEA 4RUCA 2J7KA 3EGNA 4I6MA 4JI3K 1TGOA 3JS6A 4KIAA 4DV3F 3AHPA 1Q81O 4GV6A 3MMAB 1JK9B 1W9HA 3FEXB 1JNRB 2UXBK 1JB0C 2YMLA 1VGYA 2VIHA 4YB6A 2EFPA 3DRYA 3EZ5A 3D2NA 2V4RA 3FSIA 2GV1A 2UUCF 1F5SA 3AOAA 2J0SD 4AH9A 4PHEA 2DJWA 2ZM6K 4FM2A 4XPCA 1KTVA 1UVJA 1HHTP 4QBUA 2E44A 5AQJA 4TU9A 2DVIA 3HKZC 5DGBA 3A3PB 3OVNA 4H0TB