3E58A

Crystal structure of putative beta-phosphoglucomutase from streptococcus thermophilus
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
211
structure length
211
Chain Sequence
MVEAIIFDMDGVLFDTEKYYYDRRASFLGQKGISIDHLPPSFFIGGNTKQVWENILRDEYDKWDVSTLQEEYNTYKQNNPLPYKELIFPDVLKVLNEVKSQGLEIGLASSSVKADIFRALEENRLQGFFDIVLSGEEFKESKPNPEIYLTALKQLNVQASRALIIEDSEKGIAAGVAADVEVWAIRDNEFGMDQSAAKGLLDSLTDVLDLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of putative beta-phosphoglucomutase from Streptococcus thermophilus
rcsb
source organism Streptococcus thermophilus lmg 18311
molecule tags Isomerase
molecule keywords putative Beta-phosphoglucomutase
total genus 77
structure length 211
sequence length 211
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3e58A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3e58A01
5AKJA 2G09A 3R09A 3BWVA 3WK5A 2P9JA 3L8HA 3DV9A 4YCMA 1QQ7A 1Z88A 2JAUA 1RKUA 4NV0A 1QQ5A 1YNSA 4BX2A 5AKHA 1AQ6A 4L57A 2FPWA 4F72A 3FPBA 4Y2PA 4XQ0A 3ET5A 1RDFA 4MUMA 3QU4A 1SU4A 4EEKA 4UM7A 2AH5A 4EELA 5AM3A 4J03A 5AK3A 3M1YA 4JB3A 5ALFA 3N1UA 3NRJA 2YMPA 5AI0A 2HHLA 1O08A 5ALJA 2WM8A 3QLEA 4H1WA 4ZEVA 3N28A 4BNDA 2IOFK 4JDPA 4Y2TA 4ZEXA 1L6RA 3WK9A 1QH9A 4YGYA 2G08A 1O03A 4DCCA 2FPXA 4BX0A 1TJ3A 5FP0A 3SKXA 5AK4A 4NAVA 3WK7A 2HDOA 5T41A 3S6JA 3ZUPA 2Q5EA 2JARA 3RFUA 2G07A 3ET4A 3KBBA 2W11A 1N9KA 3W5BA 3DDHA 5AHXA 4OHFA 3WGVA 2OM6A 3AR3A 1Z4LA 4IFTA 5AVQA 1WR8A 3I28A 2C88A 4Y2SA 1S2OA 1Z4JA 1Z4KA 2C8LA 3IRUA 4CF5A 4MWOA 5A3QA 5ALPA 2YJ3A 1L7MA 1Z4MA 1WVIA 4FFDA 2RB5A 3L0BA 3L1VA 3ED5A 5ALLA 3OCVA 5AW4A 1VFPA 3AR8A 2ZXEA 3WK8A 4QQFA 2WF5A 4UW9A 5IT4A 2R8ZA 3U7GA 2ZBGA 5AW9A 4Y2UA 5AI5A 2PR7A 3SF0A 4UASA 3QX7A 3D6JA 5AVYA 5AKLA 2P69A 4Y2QA 4I9GA 3FM9A 5AK6A 3PGLA 5ALVA 1U7OA 5ALUA 3A1EA 1XPJA 3IJ5A 5AVVA 1RPZA 4YIKA 3NIWA 4Y2VA 3SKYA 1Z4PX 5AW7A 1YS9A 2GMWA 5E0OA 2ZOSA 3AR4A 3PCTA 2MSNA 4NWIA 2Q4RA 5A3SA 3B9BA 5ALSA 4CF3A 4KX3A 4O8CA 2B0CA 2I6XA 3J7TA 2FPUA 5ALGA 3WK6A 3K1ZA 2WHEA 2HSZA 4C4RA 5AESA 2NYVA 4UMVA 1Z4IA 3QUBA 5AI6A 2RARA 3ZW7A 5AKZA 2RAVA 4AP9A 1YV9A 1QYIA 2B8JA 3NALA 3ZVMA 2HX1A 4RETA 5ALNA 3AR7A 3WKEA 2YFYA 3ZU6A 2D2VA 3WKDA 5ALDA 2W4MA 1L8OA 1J8DA 2IYEA 5AIBA 4KYTA 2NO4A 2R8EA 4B6JA 1RRCA 1ZD4A 3P96A 3PGVA 5ALOA 2I33A 2WF8A 4J2TA 1XVIA 1X42A 4KNWA 2PKEA 2JGAA 1WPGA 5AKKA 3AR5A 2C9MA 4FE3A 3R4CA 1F5SA 5ALEA 4UAUA 4BYGA 2OA0A 3ZTYA 5AI9A 3WKAA 1TJ5A 4XPZA 5AW5A 2B1RA 3L0CA 4GXTA 5AKXA 3MC1A 3NAMA 2I54A 4DW8A 1FEZA 4HGPA 5ALXA 2B30A 2O2XA 1TJ4A 4CF4A 3DAOA 3ZVNA 5AVUA 1T9ZA 3OCZA 3VAYA 1RC8A 2PQ0A 3N8GA 4QJBA 2OYCA 2FDRA 2QLTA 5A3RA 1KYTA 3NASA 4BX3A 2HI0A 3R9KA 2CN1A 4ZEWA 5ALTA 3QNMA 3ONNA 3OCXA 2YJ4A 2CFSA 3SHQA 3ZVLA 2WF9A 1RMTA 1L8LA 3L5KA 4BEWA 5IT0A 2HO4A 1RLTA 2MU1A 3A3YA 2EATA 5AW3A 2HEGA 4HGNA 3QUQA 1RQNA 3UMGA 3MMZA 1YMQA 4HGRA 4CNQA 5ALYA 2VKQA 2YBDA 3MPOA 4OD0A 5ALZA 1U2SA 3MN1A 1Z4QA 3FVVA 3KD3A 1TA0A 4G63A 2GHTA 2P27A 1RKQA 4KN8A 1RMQA 1RLOA 3U7FB 5JJBA 1CR6A 2G0AA 3AR2A 3KC2A 1RMYA 4BKMA 4YCLA 3ESQA 1SWVA 3L0YA 1QQ6A 1RLMA 5AIAA 2ZBFA 1Z4NA 4AS2A 4DWOA 5AM4A 1EK2A 4CE6A 2FUEA 4L6AA 3U7EB 5AM1A 3I1YA 1ZJJA 5AW8A 3E58A 1T5SA 4G9BA 2RBKA 1L7NA 3KDPA 4BNDB 1Z4OA 3W5AA 3QU2A 5AVZA 2FI1A 3ZTWA 1NRWA 2YJ6A 3ZX5A 2OBBA 3W5CA 1N8NA 3KZXA 2WFAA 1S8OA 3L8GA 2WF6A 3QU9A 1EK1A 3I6BA 5AKEA 4NABA 1MH9A 3B8EA 2JAWA 3GYGA 2G80A 5ALRA 2I34A 2GO7A 3ZI4A 4UMDA 4OCZA 2DQSA 3ZWKA 3U7HB 1ZD3A 1XP5A 2BDUA 2GHQA 3IB6A 4BEVA 3DNPA 3QU7A 4XE5A 2FPRA 3W5DA 3NUQA 4UARA 1LVHA 3QU5A 3SLRA 5AVSA 4UM5A 4EX7A 5AW0A 3KOOA 1JUDA 5AKIA 4I9FA 1ZD5A 4IG4A 5AW1A 3ZX4A 1ZRMA 1Z5GA 2R8XA 2G1AA 2HCFA 1NF2A 5AW6A 1U02A 5AM0A 3QGMA 5ALKA 3EWIA 3OCWA 4Y2YA 2YJ5A 3AR6A 1ZRNA 3EF1A 3BA6A 5ALIA 3L1UA 4DFDA 5AICA 2FEAA 3L8FA 1K1EA 5AI4A 4UMFA 2HF7A 1ZS9A 3HLTA 3L8EA 2AGVA 5AI8A 3E84A 5AVXA 5AM2A 3SMVA 5AKGA 2B82A 3WKCA 4UATA 4EZEA 2CFRA 2ODAA 1ZD2P 2IOHA 2YMQA 3FPSA 4HGOA 1J97A 4RESA 4F71A 4YIHA 2I7DA 1SWWA 3AR9A 2AUTA 2B1QA 3OCUA 3I76A 2G06A 3FGOA 1LTQA 3RF6A 1Q91A 2C8KA 3QUTA 3U13A 3FZQA 3NANA 3OTQA 1RKVA 2WF7A 3L7YA 1U7PA 4HAIA 1NNLA 3WK4A 3U19A 4YH1A 2AMYA 4PNHA 4Y2JA 2IA5A 1Y8AA 1T5TA 5AVTA 2EARA 2YN4A 4EX6A 4NFLA 4UMEA 2CFTA 3WKBA 1YDFA 2C4NA 2GFHA 3HYCA 3EF0A 3TLMA 2FPSA 2YY6A 2O9JA 2I55A 1L7PA 2FUCA 4GIBA 5IS2A 1RQLA 2W43A 4BBJA 5AVWA 2YMLA 2YMMA 3B9RA 3WGUA 3CNHA 1U2TA 5ALWA 3SD7A 2MU2A 4YCNA 2P11A 3M9LA 2IOFA 3CZ4A 4UU1A 3UMBA 4Y3UA 3EPRA 2B8EA 1L7OA 1YJ5A 5AW2A 3A1CA 3QUCA 5ALQA 4C4TA 1PW5A 5AK5A 4Y2XA 3U26A 3UM9A 3ZWDA 1CQZA 2R8YA 3QYPA 4EENA 2NO5A 5AVRA 4E88A 3A1DA 4UAVA 3E81A 2ZBEA 3N07A 5AKYA 2JAOA 3F9RA 4HGQA 4OFZA 3ESRA 1TE2A 1VJRA 1ZOLA 1VJ5A 4AS3A 3OPXA 1WZCA 5ALMA 2HF2A 2ZBDA 4KNVA 3E8MA 4Y2RA 3N5KA 4HYTA 1Z5UA 1Q92A 2BDEA 2HOQA 2ZG6A 4KX5A 4UU0A 2QYHA 5ALHA 4FYPA 5AM5A 2BY4A 3PDWA 2X4DA 3UMCA 4L6CA 4XOUA 4C4SA 2Q4TA 2EAUA 3OCYA 3QXGA 1IWOA
chains in the Genus database with same CATH superfamily
1Q0TA 1HEIA 4H4EA 4NZYA 3ZZ0A 2ZJ6A 5BR7A 1DEKA 3ZY6A 4ESOA 2XXAB 3AETA 3FROA 3BB1A 3FFBA 1K92A 4URZR 1ZD9A 4EHBA 3KSAC 3VO1A 1YWGO 3MA0A 2PKYX 2FLLA 3TDNA 4NMHA 1RWKA 2R86A 4IYRA 4R2XA 4N5NA 2NZWA 2R2AA 4RZ3A 1MIOA 4DQLA 4P22A 1S0OA 1ITZA 1WXEA 1ZY2A 2DHDA 4JITA 1XF1A 3MGVA 3EPHA 5HR5A 5JMPA 2OPHA 5J0PA 5AKHA 2DQ4A 2GLXA 4PC6A 5CGQB 4NBVA 3P2IA 1RAEA 3EQ7A 3ET5A 4A2CA 2ZJ4A 1FY2A 2D3TA 1SU4A 2RKBA 2KVCA 2WJGA 3OZAA 5EUMA 1FIUA 4EELA 4JI3B 4I5EA 4J03A 2CVOA 4AO7A 2WPNA 3DEFA 1S8AA 1Q2XA 2WHPA 7ICLA 2CNDA 5IFKA 4P92A 4DG5A 2ZYGA 1K5OA 3TX6A 2BGRA 3DB2A 1IPHA 1F4LA 3HFGA 4RTOA 1QGED 1L6RA 2V4MA 4WDRA 4BO4A 2O8CA 4L9AA 3FETA 2E85A 5FO1A 4QOSA 1NM5C 1H1TA 4GZLA 5IC5A 4DMRA 1K6JA 4KHZA 2ZI5A 1TB4A 1DX4A 4ND3A 1HUZA 4RIFA 2CBZA 2WM2A 3QJYA 1KJIA 2PD3A 5EESA 4EPYA 1G6KA 4F4ZA 1T43A 2C61A 3HZRA 5I9TA 4M6WA 3ZY3A 1EHIA 2EZYA 2Q5EA 3GEBA 5FTLA 2WKRA 3N0XA 1EEXB 2H3VA 2Z98A 1RXVA 4INPA 1ZH8A 1ONNA 4B3TB 2NACA 3COPA 3N2LA 1T4GA 4J7CA 4TWAA 1M0WA 1XI2A 2CMDA 5B3JA 4WZ6A 5LMZA 3L92A 1KOLA 4NPAA 4CCAA 2ALZA 1XDBA 4B75A 3PHBE 1P4JA 1K4KA 3IPRA 4UAJA 1QHIA 1V0JA 4GSKA 4KXWA 1CUBA 4BX9A 3G82C 3USCS 4ZYXA 4MWOA 4CF5A 1QO0D 2W2VA 1Y6JA 3WNBA 4AJJA 4LWQA 1Z26A 1U2ZA 2ZPUA 1BN6A 4CBVA 3RTGA 3KPVA 1D2AA 4FZMA 1K8XB 1AKTA 4L4ZA 2XYQA 4OQLA 3NIFB 3VXKA 4BQSA 1P4HA 1EE9A 1TMGE 3RB3A 2P1ZA 3H19A 1RM3A 2B35A 1XA0A 1WCLA 3EZ7A 4RQBA 4TXNA 4ERNA 2YWHA 3AFIA 1E2JA 2YTUA 3VPBA 1FLNA 3C5VA 3HDYA 3WGHA 4A03A 4BEJA 1HF3A 2E8OA 1K6IA 1VFPA 3HHEA 3LK7A 3VOAA 4Z4FA 4MUKA 4G3IA 1DQNA 4NQRA 3VTKA 1NT2A 4KGZA 4UPDA 1NV9A 1WY7A 3D6FA 3TQOA 1QFZA 5JXJA 1JKXA 3HL4A 1L6IA 1XD8A 2GF0A 3EH2A 4Z7OB 3GVPA 4B76A 4E13A 2WA2A 5KVCA 1HNWB 2P4QA 4YV2A 4G41A 4MQBA 4P31A 1Z28A 2Y0SF 2BEWB 2ATIA 2PSEA 3AF4A 1CQJA 2FWPA 3D6JA 2EYUA 3D2LA 3EDMA 3SE0A 5J4HA 2SICE 3RKUA 5L7WA 1ZN9A 2VQ3A 4GKBA 4YC7A 5DBEX 4Y2QA 4ZO8A 1SIOA 4HRAA 5AK6A 1PJ3A 1SVLA 2BLLA 3F2VA 3OD5A 3RR8A 2XMBA 3BWMA 4XJXA 2ZJBA 3ONEA 3AF0A 1FJXA 3IG8A 2ZXIA 4N6OA 1CVLA 4NY8A 1J6UA 4W4TA 4KHPB 3A0HU 1S2NA 2GZ1A 3RAPR 3GT3A 5DF1A 4GXNA 1SCAA 5JVDB 1EXNA 2W9BA 2FPPB 3TNDA 1UF9A 4TWJA 1YR9A 1BQ4A 4YP7A 2C4WA 2Q4RA 1JSZA 1KI7A 2C92A 2ADMA 2VJAA 1YHNA 2WUGA 3EMVA 3V4PB 3GNSA 3QUSA 5YASA 1J2NA 2PUJA 2GCNA 1THTA 2JFNA 3K8QA 2RDJA 4HDMA 2RB4A 4CQMA 3R40A 2OB1A 5J1SB 4JUZA 3RYFB 4C4RA 3UPQA 3BEDA 4UCWA 1WWUA 2OLEA 2OXIA 1XROA 3I5YA 2GEFA 3EXEB 1R16A 3HJCA 1G4AE 1CDEA 1PI3A 4KUGA 1X77A 2I5HA 2NYVA 5JRDS 3ESYA 1X8KA 1F60A 1BU5A 4FONA 4BQRA 3UXHA 1GXSA 1UFQA 4OYYA 3DCJA 4JV1A 1T8RA 3WIEA 3ZYZA 4C14A 4AG3A 5I4KA 1FUEA 1Z06A 1ZRHA 1N5JA 3A4TA 2IXEA 4MULA 4NYMR 3VOBA 1PL7A 4BTEA 1N2IA 3G0OA 4FQ5A 1IUPA 1GP2A 1AKVA 4B48A 4F2PA 3FHTA 3QI2A 2HJGA 4Y30A 1VE7A 2WTEA 2NRWA 4MCJA 3M4NA 3DT8A 3X43A 2PCJA 1K8YB 3LE8A 3RUCA 1KFJB 4ZC8A 5K20A 2E4ZA 4ZVTA 1ETUA 1NUTA 2CFIA 2ZYAA 2BFDA 3BQ1A 2G0NA 2PNJA 5C37A 4N5MA 3ZCQA 1RRCA 3IEPA 4HAWA 1DIRA 1CY1A 1EGVB 1SZHA 3RJJA 2XRMA 3L01A 4LRYA 1KHHA 2XWPA 3ENKA 4MKZA 4O2AB 3D7KA 3TINA 2Z2XA 2ZSFA 5KPDA 3I09A 3G1TA 5F4BA 3I5XA 2QMHA 5CDGA 1L4BA 4N65A 2PLRA 4E14A 4BYGA 1LBSA 1W4ZA 2HQSA 1JEAA 3WADA 2FPIA 2FRXA 4JKIA 4P35A 2QJOA 3UAYA 2ZRPA 1WX1A 2JCVA 4NHOA 4YDQA 1VECA 1XU9A 3DOHA 3HADA 2F8MA 2JFWA 5DI3A 1UQTA 3WJAA 1AA9A 1JVSA 3UV7A 4DV3B 5IXSA 7MDHA 2JA1A 4WLVA 2UZ4A 1MJNA 5KQPA 1L5RA 2XUOA 1JEQA 2X15A 3C2QA 3GXBA 5EIWA 1KO5A 2PBFA 2P8SA 1GL9B 1C4XA 4IXDA 2W9BB 2FPPA 3D7SA 2BUBA 5T57A 4AJPA 3HWTA 3ONDA 1GQFA 3DMTA 3E2PA 3OWOA 3JZMA 3R7AA 3NASA 4RPCA 5GVSA 1JG2A 2IZ6A 3AOEA 4QU9A 5DW3A 4YWHA 5LWHA 3T1HB 3LY8A 3U0BA 1HKHA 1OFUA 2Y0PA 3PI6A 2AW5A 2ZYWX 4TX1A 2QPAA 1OIWA 1PJAA 1XCPA 4K26A 3K1RB 4YD2A 2QE7A 1WHSA 4RZIA 3KFXA 4ECYA 4E70A 1HE8B 1WZNA 2UZ3A 2HBJA 3BK2A 1U31A 1QVZA 1Y42X 4NH0A 1U28C 2ZYSA 4P0TA 4TQUS 4B6FA 4W8GA 2EATA 2FSGA 2WOOA 4RH3A 1GL7A 2A0FA 4M47A 2VTBA 3KXIA 4HGNA 4Y6GB 1JTVA 3DDSA 2XB6A 3TFRA 4OSOA 5H0IA 2E55A 3BRWD 5FIUA 2IUUA 2HT1A 1G3RA 3MWDB 1TEVA 2V6IA 1V6SA 2B7CA 1WJGA 2PK3A 1KRPA 3FPHA 3S2FA 3KD2A 4J9PA 4MH0R 5KREA 2FNAA 3TRFA 1U47A 1A9XA 4XD7D 3ZLJA 1FXUA 4QIWC 1TA0A 2F7SA 5GADl 2C4KA 3FOEC 4JWKA 2UYYA 5CX1A 1CZUA 1G2OA 1X3LA 5HG0A 3CW2C 2JGDB 4O3SA 3SICE 2AXEA 3OQOA 4CKWB 2PZ8A 5CEHA 1SQGA 1U3TA 2WZQA 4GQBA 5A05A 2HGZA 3EXIB 5K3DA 5JU6A 2BMWA 4CKBA 2XUQA 5JJBA 1U9YA 4OLHA 2EFCB 2GVNA 3LF1A 3I62A 2O2JA 3OIGA 4FEEA 2G63A 5LN1A 2EKDA 1XALA 5D51S 4Z0TA 1I01A 4YT4A 1EZ1A 1SXJC 3BIJA 5AM4A 4EHLA 2ZBPA 3LX6A 1Z33A 2VDOB 2J6BA 1CIVA 3GLUA 4CPDA 4DANA 1NYRA 1D0IA 5A4IS 5KAIU 2EG9A 3UBTA 2Z4SA 3Q8QB 4WT7A 3UCXA 1E63A 4BGIA 3ADOA 4MW1A 3J7AC 1CG6A 1Q19A 4JC0A 4KH1A 2P2YA 5ECGC 4BLOA 3IUJA 4Q9HA 3R6WA 2Z3ZA 2D4AA 4FDLA 3N2YA 3DMGA 1CUSA 2FI1A 3FSJX 3G7NA 3KYBA 5EZ6B 1E60A 3FFWA 5FLKA 4BMNA 5DWQA 5C8VA 5J47A 4WJLA 1F0PA 3BDPA 2LM4A 1JFSA 3UG6A 1EFDN 4RY0A 5KFMA 1BHSA 4XFJA 4BQFA 4KN6A 3GLIA 2YX1A 3H8JA 4MUYA 5KFDA 3GUCA 4GF5A 1QJCA 1FIQA 4QZEA 1E77A 1JKIA 3EGXB 4RMIA 1YZ6A 2EIXA 3E5HA 4LJ8A 4W99A 4EEXA 1KDPA 5AD1A 2BEVB 2OR3A 4JLWA 4B09A 3HU1A 1EVQA 5ETJA 3B8EA 4QODA 3CLTC 4DIOA 2GUGA 3TQIA 3QA3E 4HDCA 3VFDA 1BHQ1 3O5AA 1NL3A 2I34A 4QLAA 1OFVA 2MJLA 3P97A 4RVHA 2GO7A 1BWQA 4I1OA 4K6CA 5DYTA 3QVUA 2BI8A 2QAGB 1PBTA 3LV8A 5LP1A 3CVWA 4ZO6A 2EFJA 3MOSA 2AJ8A 2BSXA 2JFHA 3SYLA 1PR0A 4F86A 2JRCA 3AERA 3V1YA 1OX4A 3RSQA 1L5YA 5FI1B 3DBLB 3TO5A 1AZWA 5KPJA 1AF4A 2WU1A 2X2EA 3B2EA 2Q5LA 4UM5A 1WXQA 3TLGB 1NPTO 1SXQA 2W98A 5JE8A 2A57A 1KBZA 3GXOA 2Y6UA 3CUKA 2VT2A 4URXR 1U7ZA 5EVJA 4L5CA 1GDTA 3HR8A 3U49A 1IG3A 3ADPA 3K1TA 4ECTA 4O2BA 2HK6A 1Y7IA 3HXPA 2OESA 2LMRA 1FFHA 3TL6A 4E6EA 3S2EA 3WA6A 3PNPA 3CLTD 2FQQA 3MCWA 3GLFB 1EGMB 2QM3A 1E1NA 5ALKA 2I3DA 2QNBA 5HIIA 2EJBA 2JLZA 3C6MA 1PJTA 4US0R 3IN5A 4QHTA 3DKPA 3F6RA 1I5OA 4D2IA 4YRGA 1KE1A 5ICMA 3AI2A 3AU8A 4MS3A 2IPLA 4F4IA 5IX8A 2EF0A 2JFUA 5CHEA 2ZJZA 4B0PA 1RADA 1NUAA 2AFIB 4X60A 3W8EA 1RHJA 3MBKA 4BLWA 2I5PO 5A03A 3A14A 4IIFA 4L02A 1MIHA 3MTDA 1LC3A 1B22A 1ZS9A 2OCDA 2B8NA 5DDIP 1HR0B 5B6IA 2FHSA 2RHFA 1LU9A 2YBEA 1W5BA 1O6FA 1VSBA 1FP6A 2NT3A 2OGUA 4ZO9A 4W5OA 1CUYA 3CX4A 1JEQB 4JCOA 1X8JA 2C9DA 2RGAA 2C3MA 3DOIA 3K32A 4ECQA 5ILQA 3C2MA 4OXYA 4EW1A 1M76A 1C9MA 1EQUA 2H4YA 1J8QA 2XXJA 3F97A 1GYRA 1MPTA 3GJSA 4M46A 3B1XA 4FYMA 5KFZA 5DI3B 2MUTB 3DONA 3TIXB 4YMSA 2R7NA 3IAEA 4ANFA 4RTPA 2HHHB 3NHMA 4AY3A 3JR7A 1EX7A 4RQNA 2CUKA 1P9LA 2YC2C 3UT6A 3BREA 5T14A 1LUAA 1RWNA 1PFQA 1T1EA 2X9VA 5JAQA 1MQ8B 4NRDA 4BJ3A 3HI4A 5CDHA 1MSWD 4GXQA 3BA1A 1SQ6A 4PE5B 3BFVA 3A6JA 5EJ7A 2XDQB 5L4NA 3WRWA 1FDTA 2H16A 1W4RA 2HV9A 2XITA 3W9UA 4D9NA 1XAHA 2AMFA 3HBJA 3ZDFA 4D80A 3MNFA 2H5JA 3RE1A 2KSOA 3SQXA 4G56A 4M1YA 4YEDA 3KDSE 1NIPA 1ADCA 4EYIB 1H6BA 4F6LA 3MYRA 1V4VA 3ZK9A 4O4LF 5HFAA 5JS1A 2GTPA 4JX9A 1LLFA 2G28A 1HMYA 1XTTA 3BXFA 4JYBA 1ISGA 1YC2A 3WL7A 3MR2A 1F6BA 3VSDA 3LC2O 3OE1A 1ZQOA 4D57A 4RCYA 2OV6A 4FYJA 4Y2JA 1YIOA 3SYRA 1OZ0A 5I7UA 3SPXA 5JH7A 1P2TA 1EM8B 1VLBA 3H0CA 2Q9BA 3DPSA 1ULZA 1V3UA 2XRFA 3QXJA 4MFCA 4UMEA 3ROEA 2ACWA 1Z68A 4PFJA 4EYGA 4RKRA 4JR1A 2DFKB 5KTTA 1RI1A 3AJ8A 1IUOA 4TYYA 1SQSA 1UBGA 1TQHA 4GYWA 1W76A 4IJVA 1K2WA 1A8QA 1L9XA 3FNHA 3BB4A 1IONA 2D0OB 3UMFA 1Q7GA 2XNJA 1GTRA 3T61A 2X8AA 5IS2A 4PPFA 1JIVA 1K5DA 3D3QA 3JVIA 4DR1B 1Y7TA 4RFVA 3E6AA 5EKUA 7ICJA 1DAGA 2Q1UA 2GK3A 4J0QA 4YCNA 5BOSA 3NFRA 3V6KA 2IOFA 3OTOB 5DP2A 1K7FB 5CLLA 4HRYA 2A3NA 4R1OA 5JMTA 5C4MA 2E87A 1TMKA 5CXUA 4H7PA 1U65A 4CI0B 4BO5A 4F4CA 4TTSA 3HUFA 2J8ZA 4B7AA 1DBWA 4R8SA 5C8ZA 3GO4A 2O2DA 3QFSA 3UG7A 1NU8A 2FQYA 5DNUA 1HNXB 1S97A 2A9JA 4YTEA 3TGWA 4C0ZA 5FUBA 2R6CA 3QKTA 4DQ0A 1Z8NA 3G9QA 1SHJA 1PO7A 1A8PA 4GU5A 4K1LA 2ZDGA 4E22A 5LU8A 4JNKA 1RQ7A 3EJWA 3VNSA 1VIMA 4AZVA 1AE1A 4MITA 3TQQA 2GVZC 3OPYI 1XHEA 3ML1A 2IJGX 4ARVA 4YXMA 2FLPA 1NK0A 3P9PA 4ZU3A 1WUYA 3STVA 5EJ9A 4FSDA 2VOJA 4BZWA 3LLMA 4L95C 1P5HA 1YB7A 2PI4A 4PC1A 2BQRA 1DO8A 3BMOB 4P3KA 3FYHA 3BBPA 3BDIA 2Z3VA 2Y3IA 4M8NE 3RK0A 3TJZA 3N39C 4B3CA 4BNMA 4E2FA 3S8EA 5CVCA 3E5MA 2JLAA 3OZIA 2C2WA 3SDBA 2J9YB 3B38A 1EDDA 4ED3A 2DJ5A 4NCKA 3OE4A 5FF9A 3TKLA 5ICCA 5CDSA 1RSZA 2BPOA 2GF9A 2QYHA 4ICAA 1A8HA 2P4HX 4A0SA 1Y0BA 4WLOA 1C9JA 3RRZA 3O26A 3B3FA 3TUIC 4ZFNA 5FO0A 5A4JA 4XAQA 1ADYA 3ADCA 1FMJA 4QBGB 5IUNC 5G1PA 3SXUB 2Q4TA 2AJTA 1N2CB 4NL9A 1J2UA 1LLQA 4N7RA 2QROA 1PK8A 1DJMA 2AG8A 3B1YA 1PWYE 4V2IA 3FVTA 1VE1A 4AJOA 4JV0A 4E32A 4I5IA 1TQ6A 3MAGA 4TROA 2IF2A 4EJSB 2PLFA 3NT4A 4MTCA 1UPCA 4FMPA 4MV6A 1I32A 2P9JA 4PANA 3JTEA 1OFGA 4IIVA 4UZFA 1EFVB 2SNIE 3JQ6A 4WKBA 5AOCA 3URKA 4JGIA 4BLPA 1YQUA 2ES6A 3ZZMA 2WD9A 1RKUA 4GMDA 4M9GA 2HO5A 3ULKA 3DZKA 4GX5A 5KFBA 4R1QA 5IU6A 4DFJA 1PW7A 2YNMA 2ZSEA 3UMVA 4B45A 4PNPA 1OH6A 4Y2PA 2CFCA 4XQ0A 2WSBA 4QREA 4PO8A 4FYVA 5BNIA 1B6RA 1CDOA 3LHSA 4W1QA 4DKXA 1OH8A 9ICAA 3A3KA 1G16A 5I7EA 4I99A 3LBFA 3G2OA 1CJVC 3IR6A 2VJLA 3THVA 2VQDA 3LX8A 5DXAA 5D7BA 3NO4A 5D5QA 1DIAA 2PD4A 3MWLA 3PKZA 4CCYA 3V3KA 1YZNA 3AQFA 4G0YA 4C29A 1I7PA 4A92A 5HOQA 1QORA 1T9AA 1YKGA 2BGLA 2ZJ2A 3KJXA 4HN4B 5TJ9A 3SSAA 3VVBA 1M2VA 3IOEA 2V8OA 4ZEXA 3WYFA 1EVEA 4ZYZA 5C1OA 1HT0A 3DSRA 4WCFB 5C8YF 1KK1A 1UK9A 3EYAA 3ZY4A 2X7XA 4L0QA 4LSGA 4FR2A 3FOFC 5AT1A 1KVQA 1OJ7A 2H5EA 7ICPA 1TJ3A 2IYTA 3IOYA 4RT2A 3KPJA 5EKSA 5JNVA 1BS2A 1J0CA 2VSNA 1J5XA 3E9NA 3AO0B 3TQTA 4REQB 3ERCA 2FE9A 1IVNA 2D59A 2GAFA 1E0JA 2E18A 1I2CA 4X1KB 5F35A 4DNOA 1ZNZA 5LPNA 2WQ7A 3DOFA 2VTEA 1C9KA 3NVMB 3A3OA 3FHCB 1JIHA 1PEKE 3HCWA 1XE3A 3Q3JB 4MVJE 5TQVA 1ODTC 3KQQA 2E5WA 5BWOA 4ETIA 4RXUA 2WAMA 4PVDA 4R01A 3ETJA 3MWEB 1Z4LA 4MYUA 1CZNA 2V3VA 2GBCA 4IFTA 4Q1FA 5KU1A 1LQTA 1CUVA 5J5VA 3EIXA 2JATA 2IEDA 2CL6X 3JQ7B 1AQIA 1T4CB 4FXOA 3VTZA 2I91A 1P17A 1NJGA 3ASUA 3FZGA 4FWBA 1J33A 5DGIA 4CR7A 1QMGA 4XLZA 1FK8A 4YCXA 1TF7A 1ZZEA 2EFYA 5IF9A 2V9ZA 1L7RA 5FNVB 4RD2A 1Q17A 4HPXB 1NK8A 2G82A 4KK4A 4DSLA 2GPWA 2L2QA 3OCVA 1XDGA 2ISSD 4RPGA 2H0QA 5D6NA 3PXCX 4AG5A 2C7OA 1YR1A 2GJ9A 2IRWA 1X7HA 1L4YA 1H5UA 1Q15A 4NBLA 3UJ9A 4WOKA 1P3DA 1DNPA 4DYHA 3UA4A 2UXBB 1CS4C 3IDAA 2AMJA 4BL5A 1PK9A 2YCBA 4YX9A 2H1OA 3D6VA 3P0EA 2M1XA 4I5GA 1I30A 2IS4A 4NPHA 1JBEA 4OV6B 4DWVA 2XIQA 3V8NA 3VHRA 4G1UC 1SH7A 1KY2A 3DDUA 1E2PA 3W2EA 1E0KA 5KHOC 1ZETA 1YVUA 1IYZA 1ZWKA 2NYRA 3VU3A 3HDJA 1C7ZA 4OEHA 2PQ2A 1MV5A 3Q40A 4G85A 5ELLA 5C7YA 4DCTA 5CCXA 4DSTA 1KEUA 1XPJA 4IIJA 1TT7A 2FR8C 2V1XA 4H6VA 3ZN2A 3TQFA 3PUKA 1F48A 4RW0A 1N3BA 3O93A 3QPUA 2HIAA 1JE0A 1GTVA 4H9GA 2IUYA 5K1ZA 3FJ1A 1HO3A 1U3UA 4U2KA 3F6SA 5B12A 3LYSA 1JDBB 4C6HA 2GBPA 3NEYA 3WDLA 5J3JA 1XXHA 2ZBUA 4OBEA 2CSXA 3SEIA 3VH2A 2MMGA 4B81A 4CEIB 3HBAA 4KWTA 2P3SA 1KH2A 3SS9X 3TZHA 4FLEA 5EMJA 3J7TA 1M5UA 3UHJA 2BOVA 3C45A 5AJTA 4PGHA 4P81A 3RGGA 3GC6A 4ZMRA 3LQKA 3PNCA 3BD6A 3QPDA 1D8LA 3BXGA 4C0SA 3CG4A 4ENSA 3D02A 3LQFA 2C5AA 2Y2VA 3FYCA 1N5DA 3LI2A 4OO3A 2FFQA 4HXEB 4CKEA 4LS3A 3N8DA 5K45A 1I1OA 1IY9A 2B99A 3KSMA 1OA0A 4PLPA 3SR4A 3DAPA 3WC4A 4B87A 4OHZA 1GSOA 4I2EA 3WV4A 4JJ4A 1Q0SA 3T5GA 2XVZA 4TN5A 4HT3B 4L76A 1JALA 3ZVMA 2ID4A 3Q2OA 2A2ZA 4HWGA 4D9GA 3TB6A 1ISPA 2I22A 3B20A 3FIJA 4IDAA 4CR8A 4EGJA 4ARZA 1AZSC 3TFOA 3TS1A 4P0PA 1BWPA 3CY6A 3HTXA 3RF9A 4ITRC 4GQIA 1L0BA 1CEXA 2GCEA 3DLPX 3O9VA 3VPCA 2A58A 3UXMA 3VNUA 3ZHCA 1N0HA 2QPLA 3Q7EA 4DCUA 2WAYA 4NU8X 4WY5A 1PVQA 1ZMOA 2QVCA 4J2TA 5H9WA 1OUQA 1OFUX 2H4ZA 2HA0A 2HHCA 1XMIA 2W70A 3KQUA 1TM7E 1SKRA 4FE3A 2WJAA 2MSWA 2BSQA 1GQSA 2P9TA 4YRTA 2BKUA 4FHFA 4LBWA 3U0VA 2ACEA 4XOIA 2OA0A 3H8WA 4BWVA 3REFA 5BQFA 3K6SB 3M6FA 4U9UA 1VLQA 1D8AA 1TVMA 3KZCA 4FZ5A 3A2LA 5AW5A 3UBMA 4CM7A 4EUFA 2C2YA 2UVRA 1ZR2A 2V0GA 1BWSA 4F84A 5JRTA 3PENA 3V72A 1XVTA 5BN1A 3UENA 1FA9A 1Y1TA 1QIFA 5L53A 1QTMA 3M9OB 1OY1A 2IYVA 4P54A 4X24A 3SYTA 2C98A 3DAGA 1N8KA 2ZR8A 5B1YA 1UH5A 3JQ9C 1ZNXA 4PNZA 3BS5B 5ADHA 3HDHA 2ID8A 1J8VA 5HF9A 2O8DB 4U7GA 3O31A 1X7XB 1POXA 2DUJA 3R0VA 3K0HA 3PUXA 4RSHA 2IXTA 1DRWA 4DQXA 4UULA 3P2EA 4QJBA 4B4DA 2I6TA 3N7RC 5EP2A 3DBOB 1EWYA 2YJTD 3AHCA 4DL3A 3MTBA 1NNUA 2HW8A 3E5RA 1T35A 3CF0A 2H2IA 3ZCSA 4H1TA 5ARCA 3TAXA 4FN5A 1LI7A 4GOOD 2WF9A 2J0UA 2WC1A 2Z5FA 3LAWA 3NIGB 5KQGA 1BDJA 4DSEA 5DM4A 4MUIA 3HN7A 4ED1A 1NJ2A 2PLWA 2PA3A 3TAQA 1Z2CA 4NZ9A 3K0SA 1ADGA 2FMIA 2QU8A 3B9PA 2RI0A 3GIJA 4QOHA 4O29A 1UZNA 4WOBA 1L7EA 4ES6A 4IP0A 3RUFA 4Q44A 3RT7A 3HNOA 1VPVA 3ZZTA 5GZ1A 2AC7A 4FW9A 3IQWA 1Q1BA 4JI8B 2BCQA 3MPOA 1RRPA 3ICVA 4G9GA 2BZ0A 2VDQB 4IH9A 5ALZA 4J1QA 4QJ4A 4R6WA 4WN9A 1IG0A 3AKDA 3DV2A 1KY4A 4G63A 4R8VA 3NWJA 3PDIB 4L16A 5E3HA 4X9XA 4EFKA 2JH3A 4CFYA 1E66A 4WKGA 2JGJA 4NVRA 3EOZA 2INGX 3FD8A 3UC5A 2QZZA 5L9AA 1H3EA 1G21A 1JHAA 4PJ0U 1YE5A 3GJ7A 3ITKA 3VAZA 4BV8A 3HO1A 2A88A 2Q46A 3QQPA 4G2TA 4OGFA 2J9FA 4MI1A 4ELTA 3M9XA 1U2GC 2CE2X 2NSJA 2Q1SA 3PCRB 4J0JA 4U6SA 3UOWA 1PV4A 5EJIA 2CJPA 3CP8A 2IYUA 1HQYE 2O3TA 3JATA 4TQGA 4C3VA 2J0QA 3BIFA 1VSUA 1OILA 1IN8A 3LZCA 1SOVA 4N7JA 4Y1RB 2G17A 4KO1S 1H2YA 5I7RA 2QN1A 1QRTA 2BFBB 2JJ1D 5KTNA 4IGFA 5DIZA 1CEEA 4BFCA 2H1HA 4PZDA 4RSMA 1ND6A 4F92B 4KZPA 5GAJA 4HEA1 5KSPA 4V0MA 4M9HA 2BFMA 1SXJA 3CUYA 3MMSA 3OT4A 5D5PA 3CN7A 1KI2A 3DKRA 3F7OA 3JD2A 1Z00A 5TLSA 5I4IA 4PLGA 1XNQB 4ID9A 4UXIA 3V2UA 3EWAA 5J2CA 1C50A 1E2LA 4FZJA 1T2UA 3LPDA 2H4WA 2WWVD 4B6EA 5F1KA 2BBWA 2TMDA 3QMWA 4TV9F 3T3PB 5C53B 5EI5A 1CULC 1VYVA 1XLUA 1DTEA 1I6KA 3MFIA 3C1OA 5G53C 2WJVA 3EQ6A 3TANA 2VPXA 3EDCA 3I64A 3R23A 4IQ0A 1J90A 3M4JA 3MWYW 1G9XA 3LBIA 3TD6A 5LQCA 5BQ3A 2W0MA 3U44B 3C85A 5HZHA 5I9IA 3MCUA 5HMMA 5FLEX 2C3OA 3V1KA 2XOEA 1E5QA 1O9HA 1Y9ZA 3OT1A 4I3GA 1ZU4A 3N2GB 3LNTA 4U2GA 4XCQA 4KMMA 4P4MA 1X7YA 3RREA 1Q22A 3PPIA 5CB4B 1MTOA 2QL9A 2W6ID 3ZE6A 5FWXB 5D46A 3C3AA 2YB1A 4JV5B 4Q3KA 2WU4A 1FL9A 3OIUA 4BEVA 5BV1A 5DLFA 3LQ1A 3ODPA 4QDOA 3GLGA 3K5IA 4DV0B 4CYMA 3JQFC 4CDNA 4P3XA 1K98A 2W03A 3OE5A 2W6NA 4NEQA 3ROPA 3ZHRA 5DBOA 3P9XA 4LXYA 4RD1A 2R60A 3P2JA 3KQNA 1TUGA 3OIVA 5D5HA 2OAQ1 3TNFA 2XKKA 3GQVA 3AQEA 7REQA 2Q3DA 1ZQJA 1QCCA 1WSDA 3R5KA 4BVFA 1AGRA 2ISPA 3QTLA 4Q43A 1Z5GA 1U2DC 2AW3A 4G0MA 4O3PA 4AZSA 4ZA2A 3HPOA 1JLLB 1EA7A 3GJ5A 1LTKA 2LKYA 2C03A 2IHUA 5B1SA 3KV3O 1MJ5A 3WWOA 5L1JA 1ZXBA 1F0KA 5C81A 3HVUA 2VSXA 2PWAA 1AXRA 2N3ZA 3GCGA 2WYOA 4OH7A 1R15A 3W3AA 3SDSA 4ALIA 1HFEL 4DUGD 2PFPA 1CJUC 2EDCA 2NNLD 2JANA 1SA0A 3L8FA 1T8TA 2IV7A 3V7LA 5JXGA 1XZIA 1QJ4A 3QELB 1HWYA 4YRQA 1G5RA 4EF5A 3WGYA 2FU5C 3INTA 4XLTA 2WB1F 5JC1A 3O0DA 3ICQB 2RFLA 5A7GA 4NNPA 1YR6A 3W04A 2A5JA 1TCVA 2XLCA 4YXFA 1BX1A 3KYJB 5K0TA 2IDZA 3FPAA 1VJCA 3IB3A 3NTLA 4DTCA 3HYSA 2ODAA 4UFOA 1YRQA 2ZBRA 3KR0A 4Q02A 5EN4A 2RIRA 5CHGA 4HVCA 5ADUS 2FN3A 1T3QA 2A9VA 2ERYA 3A6EA 3AXSA 3KX2A 3T95A 3NHWA 3O83A 5EXDA 4C7YA 2PX4A 1SWWA 1L5OA 4NDZA 3VHQA 3ZV5A 5IVKA 3LCRA 3MB8A 2ZIEA 3ZZUA 3PC2A 2H7XA 2AF4C 1PVPA 4TKUA 4US8A 2R9VA 2ZTLA 2E21A 3BB3A 4IWXA 2R18A 3AI1A 3H17A 2VIXA 1VG9B 3QX8A 2HEIA 4KFTA 1NOKA 2XSZA 1IZZA 1ZMTA 4EHAA 3MMXA 1QV9A 1ZVJA 4RVCA 3N6VA 1HQKA 2GUWA 3EIHA 3HL0A 1JPNA 5ES4B 1DOZA 5KKAA 3NATA 4I6GA 2X1VA 1P31A 3ABSB 3UAGA 4O0MA 3CLKA 3U3DA 1SCUB 1Y3BE 2ID9A 1EFHA 2RGXA 3C2LA 1NBWB 1NN0A 2H31A 3GJQA 3OWXA 4MWCA 1H38A 4YCAA 5E8RA 3RC1A 2D0DA 3V8QA 5IAAA 3OC0A 3FF4A 4GKAA 3B82A 5C3UA 2FFHA 3ZE7A 5LOVF 1A5ZA 2OHJA 2DT8A 1B7GO 3IPYA 1Z00B 1J8MF 3IMGA 1I2MA 4MEYA 3L8YA 3EBLA 4G3XA 4G5SA 1O97D 5D86A 4M9SA 1G8AA 1ZRSA 4IHJA 2BCSA 1XKLA 3I32A 5T8KC 2XB8A 1A5AB 3CR8A 4JQCA 1H2XA 1UC4B 2W00A 2Y9TA 3TI0A 5KFFA 1M67A 3PX6A 2XODA 2Z9BA 3FRIA 4D4KA 3PQ3A 1XC7A 1GNVA 2B25A 2C77A 1MOZA 3WGUA 4JEMA 4K3VA 3U4HA 1F6WA 1L5NA 3VR4A 4PQFA 4E5VA 3MT7A 5ILGA 3WL8A 3ZHZA 4YAFA 4DWJA 1HETA 4F60A 2OZKA 4GOXA 5ISMA 4DRXB 3C4VA 4OQXA 4X6UA 4XXHA 3VNQA 1MA7A 1ZBQA 4MRVA 1O96A 2P2DA 1EIWA 3U3MA 4CIXA 3P27A 1FTYA 1ZZGA 4I1UA 3G2KA 5SY4A 3K53A 2PDAA 3DWIA 1LBIA 5BURA 3U26A 4AY2A 4DBLE 3I2IA 1U1IA 3QYPA 2Y0EA 1DJLA 2NO5A 3JD1A 2DR0A 4IGAA 4KEAA 4N3GA 5HE9A 4JI7B 1TCCA 2NO6A 5KC9A 1NK7A 3TBKA 5JPCA 3MELA 2SKEA 4ZPJA 1IE3A 2V5VA 1B6GA 1VJRA 3OJFA 4Q66C 2JJ2A 3HJTA 3TPFA 3OPXA 4I9UA 5M3BA 3ZE0B 4DAEA 1C3EA 1GITA 2KSQA 2K60A 3PO4A 1GL3A 2D1TA 3HJNA 4FS2A 3IAAA 4E1VA 3T5DA 5EMKA 3LT0A 4HCJA 4Q1EA 3DQZA 3OSUA 3UN1A 3BH0A 4HNHA 5HQ3A 5JSUA 1DBQA 2VPPA 2WR8A 3UHAA 3TQCA 2HTEA 2X86A 3CZQA 4H0FA 3OKPA 4E2XA 3C98A 5CVUA 621PA 4BP9A 5C5IA 3G5AA 3NS1A 2VNIA 2EZUA 3AUYA 3UPDA 4EAAA 1IJFA 2QAJA 4DREA 4OJTA 1XTRA 2EAUA 3DBRA 4ISBA 4BJ5A 1X66A 2Q5CA 3EXHC 4UE3S 4ZYUA 2G09A 5H2FU 4O0LA 3CBGA 3FAHA 1E58A 1UPUA 5EZQA 1KYIA 1NVVQ 4RA6B 1JG6A 3TR5A 1H4SA 4FCWA 2YWXA 4KIFA 3TXXA 2J0SA 3EB9A 5AWFC 5GJBA 1B1CA 1HORA 3QBJA 4UHEA 4BWFB 4HWTA 4XR9A 4EFDA 2O3UA 3G1WA 3H16A 3K70D 1N5RA 2XD4A 2O54A 4RNOA 1V1JA 4KQEA 5EVCA 1A5TA 1F17A 1ONBA 1G20A 3BVPA 3FR8A 4ED7A 2H65A 3TLJA 2RCYA 1SRQA 4ZAZA 2QPTA 2WTNA 2WHRA 4EPVA 3A3PA 1X9MA 1TC1A 4PH5A 1X0VA 2Z6QA 5IJXA 2LXNA 1P0CA 2PKXA 3M82A 5BW8A 3HYTA 3LF2A 5HW0A 3K9FC 1YKSA 4C01A 1V16A 5E2BA 5B7GA 1FMCA 1JXOA 5CB6A 5KO2A 4KQJA 2EWMA 2OBNA 4WXMA 3S7ZA 1PDOA 1J09A 2C4HA 2QGFA 3A10A 3R5SA 2IPAB 2VF4X 2CW5A 2O7NA 4IFEA 3UK1A 4OHPA 4AU1A 1CJCA 2W04A 4G37A 1U9LA 4KXVA 4DSNA 3EFHA 2GCOA 4XRHA 4NCIA 4NZMA 5FAXA 4QYIA 5DKFA 4JDPA 4M21A 4UVHA 2CUNA 2R1TA 3M3PA 4N5LA 3H8SA 1C0LA 2G08A 3G59A 3PXAA 4IO0A 4QPCA 2COEA 4UB2A 3IP8A 1RZRA 5ILOA 2F3SA 1DIBA 3INGA 1OV4A 3V9AA 1UMBB 1WUJS 5T6BA 3LQYA 5TS3A 1N34B 1GNRA 3A11A 2BUAA 1HKUA 3KNZA 3DBHB 3WYCA 4QVGA 2QTCA 3I4LA 2IBKA 4U3JA 1EFPB 1ZCAA 1FX1A 3V7FA 3OZVA 3H5TA 2ZTEA 2PMFA 4B9MA 3NQ41 1ZVKA 1USVA 3DUWA 3JYHA 4JR0A 2TMGA 1IIPA 1MO2A 1DPGA 3WGVA 3R44A 4XGQA 4IZHA 3OVMA 3HXTA 2V1UA 1S2DA 1V9LA 5E79U 1JZQA 3BICA 4YNBA 4K9OA 4PLCA 3V7YA 2Q41A 2NPOA 4D4GA 4RU1A 2HJRA 1JR4A 5IKOA 1L6NA 3OTWA 3I04A 2WSSA 2VANA 1NNI1 3UT5B 1KR5A 1Z4MA 3C3DA 3GRZA 1KOJA 1UDRA 1XQ9A 1QH0A 3H2JA 1ISMA 2F1RA 2UAGA 2ZKLA 2FWMX 3QJ5A 4H59A 1NVMB 5ALLA 4Q9LA 3WG9A 5FR2A 1UZAA 5DHQA 2XUFA 3WGGA 1EFRD 4MJXA 4PHTA 3BTUA 4LE2A 1OR8A 1P4SA 4GI2A 2C2DA 1Q44A 3RTCA 3C5CA 4TLDA 3H4TA 4TSKA 1YQQA 1M34B 4EITA 2WF5A 1XRSB 2OVFA 5M34A 1KORA 5MHTA 1TCAA 2HT6A 1MT0A 5TPWA 4A0HA 2QM7A 4HXYA 2BCUA 2PL5A 1PR6A 2AXQA 3K7EA 1N6KA 3KQKA 3RKSA 1DARA 1AKYA 4BLRA 4R69A 2X6QA 3OTGA 3QX7A 2VA8A 2PEYA 4GMGA 1HK7A 3J80A 5DBHX 1W581 1KIFA 5L1IA 4TT8A 4DCNA 1TK3A 2F1OA 4I9GA 5L45A 2X8LA 3W05A 3IE0A 4U6PA 5KFIA 3EQ8A 3A1EA 2CD9A 3D3EA 1USKA 1KJ8A 5EWFA 4A3SA 3ESBA 3NV7A 5EQTA 5KTQA 4PHFA 2AFHA 2GXQA 1XWWA 3QMVA 4GO1A 1WUHS 3GZNA 4DMLA 2GCPA 1MQAA 5HBGA 4AN0A 4J9LA 4W9NA 1X7DA 3UWKA 3FKQA 1GQ2A 2VT7A 4YRAA 4FCVA 1WVGA 4UB8U 5I7WA 3BTSA 5FNVA 1FNSA 2C1XA 1BYUA 2O8NA 5GGXA 2HHXA 2FSSA 1O7JA 2CYBA 4DARA 3A6PC 4NOLA 5ERXA 2FPKA 1A69A 2FPUA 2O1XA 4IGIA 3F96A 4CEHB 3R0ZA 4YP0A 4MEXA 4JLKA 4XYGA 3ZCXA 1U7XA 2E8NA 4WKPA 2RGNC 1VRVA 2C31A 2EIHA 2PSDA 3RH5A 1T2NA 1ECFA 3D0OA 3L7OA 5FCDA 1XKTA 1U4SA 2HBZA 3N8IA 3EVBA 1ILWA 3WLJA 3F49S 3N4MB 3QLVA 5CFNA 1V11A 1E0AA 1J20A 2DKFA 2CCGA 2JVKA 3Q5DA 4FKBA 4KMSA 2ZJ5A 5J43A 2GK4A 1H3NA 1JSXA 2GT1A 3NEPX 3OEWA 4ZO4A 4MVYA 1C41A 4H7IA 5KG1A 3RJHA 2GFQA 2MINA 1QYIA 2P41A 3DHEA 3BXHA 5F5NA 1NZFA 1R6VA 2Z1MA 4FOTA 2HX1A 2WV7A 3PTLA 4EM6A 3WU2U 2O6HA 3A0UA 2AA3A 3I8OA 1XVLA 5IP5A 4ZI5A 2X23A 3S2SA 3SR3A 4NG5A 5JO0A 3P4UA 4DQPA 1FS4A 1UBCA 4JFRA 4NPCA 1GGNA 3BZCA 5E1OA 3VKFA 4GI7A 1PQPA 4R31A 4QWWA 4DF3A 4Q01A 1EUDB 4R1PA 2QTFA 3DM9B 3MB5A 2PJZA 3FZEA 2Q1XA 5T67A 3PF8A 4CM8B 1F06A 1V45E 1IPEA 1IV8A 8ICEA 1ECBA 1OLSA 1SVKA 2G76A 2XMSA 4KWCA 3NAZA 4ECXA 4QUJA 3UO8B 3VDNB 2C5HA 4IDOA 4A10A 1U0OC 4FI3F 1QZ3A 4B3BA 1XZFA 4MMZB 2ZIAA 3A32A 2WYIA 4RMHA 4U9HS 2B78A 4KR3A 2AFRA 1A04A 2IL1A 3U6KA 1RT9A 2H5XA 1TKCA 2P7IA 3AILA 3INNA 3TH5A 3C14C 3CT4A 1EX1A 2SECE 4Q15A 3ZEAA 1JIIA 1IBKB 4XGIA 4TVKA 4X63A 1ORTA 5IAKA 2J9RA 4ZANA 3G1UA 1MZPA 1RBQA 4NLLA 1ZHFA 5ALXA 3NCTA 1DBRA 3PQ6A 4KLCA 3RASA 2LV8A 1A8SA 4QPJC 3DFFA 3SC2A 3VAYA 1N6OA 2O0LA 1O8BA 3QYAA 5T4FA 2B0JA 5HM8A 1G7RA 3DMYA 3KSZO 1ZQ1C 3NZEA 1HRDA 2OYCA 5CDUA 2AHOA 3BJMA 4LGVA 3FNRA 1N2CA 5BSMA 1YD7A 2R7LA 4LQ4A 1DIGA 2PT9A 3X1ZA 2BE7A 3ONNA 2CKMA 2B8WA 3DGEC 5JS7A 2CFSA 1QNLA 4TKVA 3CW2A 3FI9A 3DMDA 3PW2A 1T5HX 2VATA 3IIMA 4WVFA 1D0SA 1N1EA 1XD2A 1KMCA 3R8XA 4YUVA 3WBJA 4E2YA 1CETA 3IUMA 4O4IA 2NU9B 3W1VA 4WECA 4HTFB 2R25B 3UK6A 4B3XA 6YASA 1QCDA 3OZXA 2J3IA 3ZUGA 4XYBA 3RJKA 1C29B 1XYVA 2KOBA 4LC1A 4RHFA 4UTRA 3L6EA 4R0NA 1JPUA 3MMZA 3OICA 2Q4EA 2GBLC 3FCUB 4Q6WA 5ANRB 5AVYA 4RQAA 2IEIA 3KKNA 3SKVA 2NT4A 2XLBA 4B4KA 1U2SA 2BI4A 4EDHA 3AB7A 1U6IA 1ZEMA 4FFMA 3SFTA 4NS4A 5ICFA 1WB5A 3FLBA 4F3RA 3GH1A 2XTNA 1RKQA 2VZ0A 4QWBA 3CN9A 2IGTA 4R71A 2AQ4A 2YVUA 4FU0A 1P6UA 5GJWC 2EP8A 4MW0A 5EIBD 4A1FA 4NYIR 1N4DA 1ESMA 1CJBA 2AZMA 4G1EB 4A2WA 3OU7A 2XVMA 2XA9A 4N0DA 4ZCTA 1RXUA 2JIDA 5KIAA 4ENUA 4HY3A 3Q7QA 1N2SA 1G63A 1TUBA 2BHRA 4RJLA 1PFGA 1KXZA 3S4YA 3I1YA 1UBRS 4JC4A 4B47A 4EJSC 1W52X 3MR5A 4FP9A 4PQEA 3SYMA 1N7JA 1T5IA 1NXQA 1TJYA 1T5SA 3QKRA 4DLKA 3GMDA 1OXMA 3QBDA 2BEKA 4IR7A 4DDKA 2J9ZB 1FTNA 4D9HA 1ORVA 1XBTA 2YXLA 3JR3A 5IKEA 3ZLTA 3GZ4A 1P7WA 4JVMA 1LB1B 2KIVA 4ML3A 4I50F 5HS4A 5KG2A 4J7XA 1Y5RA 4Q4AB 5CFPA 1X6IA 2J3KA 2VLIA 3GGOA 2YR0A 1SVNA 2R7MA 4KODA 5JH7B 4ZD6A 2OBBA 4DR6B 1FPQA 5CVJA 5FHQA 3IHKA 1DUIA 3W5CA 2QTLA 4ENRA 4M1TA 1NBOA 2MINB 2JH8A 4M9JA 3QVTA 4MGZR 4O5OA 1OLOA 3HCNA 4GM0A 2OHXA 2RK3A 1V37A 1VXRA 2JFYA 1PGQA 2FUNB 4HD8A 4D0LB 1B42A 4F4KA 2QTNA 3LYAA 7GPBA 1OXJA 2HAEA 3IP1A 2P5TB 3OEYA 2VNSA 1V11B 2X0NA 4B2LA 2Q9CA 4QT4A 2XTMA 2P67A 5KYNA 1AA6A 5FPYA 3TG2A 2G3YA 3UUGA 3ZI4A 4UMDA 5HFNA 4DEXA 1B76A 3BMQA 3ZE1B 5T7BA 4JOSA 3ZCPA 4QGAA 3DFZA 4U7DA 1TECE 4CEHA 4F06A 1PNRA 1XL0A 8ICQA 4KRXA 4O5CA 1VBNA 1YVPA 4KQGA 4EX7A 4N5HX 1PTJA 2DGZA 4DSOA 4K2HA 4I50B 4ZV9A 4PIPA 1RWXA 2XQKA 5IANA 3NTXA 3L4BC 1RJGA 3C87A 3K9WA 3OTHA 5DGCA 3DW1X 4B6PA 2DC1A 2M0NA 2G1AA 2V6MA 4N12A 4BGEA 4RHYA 4Z6KA 5KFHA 2ZSKA 4J2HA 3K1AA 3GAMA 3WHPA 4OGKA 3SS7X 3O2JA 3EF1A 3STTA 4EWLA 2EW2A 2FRDC 4CDMA 1N3LA 5JQGA 1T13A 1M6WA 2OCIA 1YBAA 4JHXA 4NNJA 1PJSA 2PX0A 3HDQA 3OLYA 3I23A 2ES4A 1YF3A 2ECKA 2XW6A 3F2IA 1RYUA 1WSAA 1ZMXA 2YS7A 3O4VA 4K5QA 4W8HA 1BPZA 4OJYA 3ZWWA 3MINA 3VNVA 1W9MA 1Y8ZA 2H17A 3EULA 4DLGA 2O14A 4HX9A 4RZXA 1RIIA 4M1SA 1F7UA 4PTLA 3SC3A 5K3OA 5AKGA 1ZSNA 1Z0FA 4QQNA 9ICPA 1DT3A 1NUUA 2WYHA 3FOBA 5DZSA 3DW3X 4HO1X 1NKTA 3CKMA 3PR2B 4LDAA 3ZZ1A 3GV8B 5DX0A 3DL7A 2ZS9A 2FX5A 1Z7GA 4QDTA 1YS6A 2GOLA 3G49A 1OAOA 1NKSA 2Z09A 3KCQA 3PFIA 2I8CA 5DTRA 1JLRA 3LUHA 5E9AA 5GOZA 5HILA 4ZK2A 1FDWA 4QBTA 1WBJB 1C7YA 4G4JA 4CMGA 4M9NA 3IQHX 5E6UA 5I8WA 3V80A 3G6KA 4DQRA 2BFCA 2VJBA 3KLOA 5DP1A 5C8YA 2QAGA 1QLWA 8ICAA 1UZLA 2QUJA 3NETA 1TK0A 5J0YA 1QKKA 2ZR9A 3U4AA 2BKLA 2FRVA 3BXXA 2GN4A 3UWDA 2WW8A 2EKPA 4K6GA 5LFAA 1YRYE 2CK3A 5JCOA 1YFKA 1AUQA 2RH8A 4MQFB 1SUCA 3ENQA 4QX6A 5FX2A 4M8KA 1GNTA 3GDHA 3WFJA 4HDNB 1ZA1A 2UUPA 5BNTA 2K8AA 1IAVA 3RJFA 3AFGA 3N6XA 1EQ2A 1SRRA 2QAIA 2QVYX 3JQDA 2UVWA 2FPOA 5COAA 3V7UA 4ZOAA 3V8MA 2M6SA 4PYMA 1SBIA 2FUKA 1MHPA 4CV1A 4J6EA 1BHO1 2AOWA 1Z0KA 3E8SA 5DNDA 1XSNA 4A2QA 1G42A 4S04A 1VKOA 3M6UA 1L4KA 3EXHA 3QY9A 4KFSA 3KE9A 5J0TA 4J1NA 2W9AA 4DJJA 4DSIA 2HM7A 2HJ9A 3FRHA 3R5XA 4ZVNA 5F7JA 4FB5A 1P74A 5DG9A 1TYAE 2QI9C 3M4YA 4W9RA 5CH8A 5JANA 2A84A 5JD5A 1F8UA 5B4TA 5KYYA 4UHJA 1UBSB 4QUHA 4HFJA 4YJHB 2NSHA 4DT1B 3RJ5A 3V8BA 1A3CA 3M2TA 2ODBA 5CM9C 2FYTA 2QVGA 1C1DB 1RYNA 5B58T 3RROA 1RPAA 1GZVA 2DLNA 1OBVA 1QHFA 3U60B 1TVEA 3QH4A 2OKCA 5DU2A 5JBIA 1EHYA 2GLTA 2QXYA 1ZQYA 2Q1WA 5E6SA 4B80A 4FC6A 1N5LA 1ZA2A 2A9RA 5KJEA 3ISCA 4BECA 4MAFA 5BPCA 2OCYC 4I2JA 3RS3A 1GPBA 2L18A 4MV9A 4WY8A 4Y2XA 5DB8A 2BWJA 3WYNA 3ZWDA 1UWVA 1JN3A 1BE8A 1R4MA 4F3TA 1XKXA 1GO3F 4XPIA 4EENA 1A9QA 4KMRA 3WRXA 5ITZB 2OP0A 4OX9B 2UYHA 1I51A 2EZ4A 4UKDA 2YXEA 3BN3A 3LMKA 3OPNA 1LTHR 1FMTA 1TU0A 3AG6A 5ELMA 1NXOA 4HGQA 3ZZNA 3LDGA 2LKCA 1T2DA 4BVHA 2CT8A 3LUCA 1VJ5A 1XD2B 3DNFA 4YQZA 2QD4A 1I3NA 4Q48A 1H0HA 1YZYA 1UFKA 5EHNA 3TYXA 1P4GA 2UZIR 2AN9A 3PDJA 4WNAA 5J0UA 4TS3A 4AYTA 2AOVA 5DG8A 4Y2RA 1TGYA 3ZWBA 3UKDA 4FB4A 5IYZA 3LUFA 3N5KA 2XWQA 5JFOA 7ICTA 1E99A 1NUPA 1YI8A 2PFSA 4DLEA 2VCHA 3F74A 4UD2A 1JT2A 2Q28A 4WI1A 4N76A 2UXDB 4RTLA 3D8NA 3PGMA 4J2OA 3WHIA 1DKMA 1JJAA 2Y1IA 2BZSA 2R68A 3OF2A 1P2FA 3UMCA 2C9OA 4MIKA 1CV2A 1KKLA 2H1RA 3DZHA 5U4XA 3WB0A 4V0QA 1XPRA 1GCAA 2XAUA 3C1AA 2R84A 1Y9DA 4RGQA 4B7ZA 2PX6A 1R6DA 1ZCBA 2V7QA 4KAFA 2NTNA 4M49A 1MCZA 1SOWA 3EQ2A 5FEMA 5JNRA 1KWKA 1NM5A 1NHGA 4NBUA 1FSSA 5ESRA 2YOFA 3HWWA 4QBKA 2OD2A 4KYVA 1LF5A 4LRWA 1KPIA 1XELA 3ECCA 4BX2A 3D9QX 4U1RA 2I3AA 2JBWA 4QOIA 1T1JA 1QHEA 5LR6A 4RY2A 3A0BU 4W5QA 4AF7A 9ATCA 1HI9A 1KBUA 5DBCA 1SB3C 2HNKA 1IEWA 3EOBI 5JPDA 1RZ3A 3CPSA 2J85A 3VKUA 4ZEMA 1BNCA 2VAVA 3PSAA 1H9AA 4MRAA 3LTNC 3PQ7A 4EBEA 1IM2A 3GR6A 3QLTA 1QVRA 3DV0B 3OIFA 1JAXA 1DHTA 4HWRA 2IX9A 5IHPA 1WDWB 1TYEB 3WRXC 1RRFA 1XZ8A 1MRZA 4O4IF 4H1WA 2VQSA 2FZEA 1ZC3A 3LHFA 3DEYX 1QIHA 5JLAA 5LCXA 4B35A 4W82A 2J3EA 4TZ0A 4KIGA 4WNCA 3UUEA 2Y6VA 3O8QB 1G2IA 1Q21A 3KLPX 5HM6A 4DCCA 4HDRB 4HG2A 1J8FA 2FPXA 3FKJA 4WFKA 4HV4A 4GR5A 4Z8YA 2FJ0A 1BNOA 1IJBA 3HJGA 4ZP1A 5LBUA 3GRKA 4KR9A 2JJ1A 4Y1EA 3AUTA 3TMKA 3T94A 5BXYA 4F4HA 1J70A 1P60A 2JZOA 4NZZA 5IF3A 4NAVA 3WK7A 1S4QA 3THXB 1ZHOA 2AK3A 4HC4A 2AN3A 1US8B 1YI0A 4FFSA 4F9FA 1H4VB 1OCEA 2G07A 1JHYA 4CLEA 1GLGA 4WZAB 1G60A 3FTDA 1XJ0A 3NDPA 3MWFA 4Q9DA 4RIIA 4TXMA 1FLDA 4NFHA 4KO2S 2CLKB 3QRWA 1J9GA 3B1JA 4FS1A 3GT7A 1HJPA 4CTNA 2OM6A 2KHVA 1K6XA 3NHUA 3NWOA 1Y3CE 2BGUA 5F2OA 2I2CA 5A6SA 2IBSA 2NO1A 3TTTA 3G7SA 1S2OA 3OQJA 1OFTA 5KYXB 4BNGA 2R6GA 3GL9A 1ZNWA 2B21A 2PZKA 3CZ9A 3EASA 4HDMB 3EUAA 4L1KA 1H4QA 3L7BA 1J9ZA 4X92A 2IYWA 4LJ6A 3UTDA 4I8DA 3GEMA 1JB1A 3TRJA 1QQAA 3LO5A 3FOZA 2AMLA 4A0QA 2UYCA 5CLHA 1Q5PA 3SEQA 4JT4A 4XGKA 1Z39A 1JKFA 3GLHE 2C2ZA 1HFWA 2C2OA 3PDHA 2PRSA 1SIUA 3PIRA 3VZCA 4LDZA 5J2UF 2DBYA 3C7TA 4BFYA 2WJ3A 4UEQA 1Q14A 3WTBA 2R8ZA 2VLBA 3KKQA 5C8DA 3CW9A 3JCZA 3P9QA 1PTKA 4YAWA 3PGXA 3SLKA 3FFXA 3FGPA 5E7MA 1LK5A 1PKEA 4GZ3A 4FDMA 2X0RA 3O73A 3T3EA 1KMQA 1R4NA 1M1NB 4KAJA 2AHRA 1JMYA 1NW8A 3LBHA 4KXLA 5BW4A 2J3QA 3LFTA 4NCAA 1YJCA 3EPJA 1L5HB 3MQ2A 1XCBA 5BQOA 3NHPA 2X41A 3ICOA 1UWCA 1ENYA 1NQAO 3SHOA 5LM3A 3N75A 3IOBA 1FRZA 1IBMB 3UAOA 3OZUA 5DGHA 4OB6A 4TS9A 3PK0A 4TZ6A 5E0OA 4KXFB 1GUBA 2Z7JA 3NPAA 1QC5A 4BCCA 3SQWA 2BM9A 5JO9A 1KDZA 1NXXA 3THYA 4FHEA 2WAQF 4CF3A 4OK5A 1EFTA 1XEWY 1GA4A 1QG0A 1G4HA 4KACA 4O8CA 3WP0A 2P9EA 5EZYA 1TW2A 4ZI2A 4UUPA 5KFPA 5TEWA 3T9EA 3K1ZA 5ALGA 1WRBA 2IW1A 3PVXA 4O59O 1SCQA 1PR4A 3DE0X 4UC0A 3RFXA 3UTCA 1JHVA 1V6AA 2W6JA 4WGGA 1U0HC 4YUXA 4YFYA 4YR2A 3LUDA 4ZJUA 3CUVA 2F8SA 4I4TB 1OVGA 1VI2A 1IM8A 2RARA 2G5TA 2ZJAA 2HUPA 5LLDA 3COYA 1RHMA 1W2HA 3MT8A 5IDQA 1XTPA 1JFRA 3WHLA 1JAHA 5AFSA 1NZDA 4X54A 5B2EA 1PT9A 1XAIA 3EIEA 2O3RA 3MGGA 1ZFNA 3NALA 1Z0ZA 4QYSA 4S2UA 4US9A 2H1IA 2JMGA 4X6YA 4X5VA 2HMVA 4DL6A 2NVOA 3CT6A 2IYOA 2FFBA 4XIIA 1MF7A 4ZCSA 3V7KA 1TRHA 4AK9A 5A0LA 2YFKA 1MC8A 3DO5A 1OQAA 2VDUE 4NMLA 4HQNA 4RZUA 1UFOA 3UGKA 1ZQWA 1L8OA 2ZU0C 3U7IA 5KHLB 4EUHA 1PBNA 3TR6A 5AIBA 2IP2A 5AOVA 2AXNA 3FX2A 3OU2A 3H42B 4GOND 2C9ZA 1K27A 2XKBA 1XMOB 3KTDA 1Y1LA 5AJYA 4P7KA 1KZ7B 3KHRA 3DV0A 4HMPA 4I1SA 3R3VA 2YQ5A 3TUJC 4YV0A 2YVKA 3R4CA 1SCNE 5KCZA 1L5VA 1GTSA 2MSLA 5K0BA 4V0KA 5HKKD 3EEFA 3QWHA 4IFBA 3AUJB 3FSEA 4AJ4A 4WINA 4OHXA 3GUHA 4HWSA 4EG0A 2W90A 1FYWA 2J9FB 4U5QA 5KT2A 1XO0A 2CXQA 2VXCA 1L5SA 3L0CA 3GBVA 3MC1A 1YUBA 2F6RA 2I54A 2WJWA 1KEEB 2XOXA 3PG5A 3RU2A 4EABA 4LHZA 3BILA 3C6BA 1UPFA 1NC1A 3M3DA 5REQA 2O07A 4M53A 4EMUA 5L4LA 1EXVA 2PMZF 2QUZA 1KDHA 3EMDA 4ENTA 2EKBA 2OXEA 1KERA 5FBZA 4MV0A 3A6HA 1V41E 1R0YA 1U8ZA 2LE0A 5GTDA 3IUNA 3DEIA 2O06A 4UVGA 1OYOA 1RYDA 3CRZA 4DYVA 4ZQHA 1NVAA 1OWOA 3R9KA 4IQUA 4MGIR 4BFXA 1SUBA 2LZ0A 4XCXA 4BX3A 1G19A 1P9OA 1QCKA 3AU6A 1SK9A 3AF1A 2ZYUX 1YT5A 2ODPA 5K0EA 2PEZA 4RA9B 2JJYA 3GLHB 1OROA 2FOXA 3ZVLA 2ID7A 1WCXA 3U3RA 1V96A 1R0KA 2HXGA 1Z0JA 2DBQA 3E7FA 3L5KA 2GWHA 2XBLA 2PT5A 3WMGA 1KAMA 1C4OA 2KE5A 2QF7A 4IQTA 1CRZA 3KRTA 3OQ6A 4R1LA 3S5UA 2OE2A 3CNEA 4LF6B 1XTIA 3VSAA 1F0MA 1VIAA 3NBAA 8ICHA 1FBNA 1YBVA 2JGRA 1YRWA 2P5YA 3JVDA 2QLJA 4MVJM 521PA 4NJEB 3WQSB 5E2AA 3L1JA 3AN1A 4AW9A 1OPXA 5FEUA 4WXHA 5KEIA 3GV7B 4D9JA 1SD1A 1NMXA 4BVAA 4H7HA 2VKQA 4UU7A 5REQB 1SOUA 1UM9B 2ZUCA 3ECSA 3IQXA 5J2UA 4J07A 3J81A 4JEIA 4QFBA 5GONF 4D6XA 1P5ZB 2X42A 3DB1A 4CTOA 4YXWD 5KYKA 3CS3A 3V34A 1JQ3A 1N77A 4QXRA 3ZWQA 4CIAA 4B85A 3HCDA 2VTKA 3W90A 1NN3A 1AK1A 2NTEA 5JAUA 1D1PA 1JXAA 1T8SA 1XEFA 3F78A 2HK7A 1XEWX 3HSKA 4NEHB 3VC1A 3KHLA 4AWAA 1CUAA 4K4GA 3AR2A 3OLWA 3RRYA 5KYTA 1QU2A 3UV3A 4P7JA 4J9OA 4BDPA 2YB4A 3BSYA 3G6XA 3KUKA 1X9IA 4AMZA 1CHNA 2ZBFA 1RE0A 3S70A 2CZGA 2SHKA 4KI7A 4D79A 4ZDJA 4AKTA 4QZHA 4IGKA 3ICPA 2YHIB 3R7SA 1YRAA 3QLJA 4A6XA 1J5PA 1PDVA 3KTAA 4JVNA 5AM1A 4ESHA 3RS0A 4FDAA 1CPYA 1F4VA 1ZJJA 4K6HA 4Z4GA 2YNMC 3IQEA 4BOYA 1GAJA 1O54A 2JD1A 3G8BA 5IYZF 1P61B 2X5KO 4L7QA 3C8UA 4R1TA 5KFUA 4EKNB 4EVSA 4PZAA 3ZNPA 1UBNA 4CV3A 5AUOB 1XF9A 2X0JA 1DP4A 4XUGB 4B9AA 4MV3A 1E7RA 4Q3DA 1N2JA 4TKZA 5FBQB 1OFIA 4JMUA 1OX5A 3RBDA 1GLVA 1T5BA 2AFHE 3IT2A 2LIVA 3CPJB 5SY9A 2ZSHA 4N01A 4IZ6A 4U6NA 4DIBA 2FLNA 3LC7O 5SZHB 4AXXA 4HH0A 2R1VA 4UU8A 1TUIA 1GR0A 1UP4A 5KFTA 8ICZA 1YVEI 3EA4A 3G2HA 3WIVA 1UK6A 4CMHA 1GV0A 4G86A 2V96A 1Q7TA 2RHJA 3VSBA 2WIJA 5A9SA 1NK6A 2O8EA 4TS1A 3QSYA 4TMKA 4BNJA 3UAXA 4IJ5A 1SAYA 4PXYA 3JYQA 4TXJA 3GZTB 5JR3A 4OJOA 2RHBA 4CU2A 1T5DX 5L40A 1NTOA 2NIPA 4XX1A 3HU2A 4HTAA 5BSHA 2E5LB 1R0CA 2O23A 5B36A 1U3WA 2FQXA 4CV0A 2DQSA 2GN6A 2BFCB 3A8TA 3WNDA 3EXFA 4IZOA 1JEYA 3BJEA 3C3JA 3OJUA 3EHDA 1I1HA 2AWNA 2B61A 2A33A 4W6ZA 3IBYA 1URPA 2VUUA 3MRXA 2GKSA 1Z1VA 3CH6A 1LVHA 4G9EA 4BB0A 4XVCA 3QE4A 2JAPA 1CUDA 2OYYA 4TLMB 5JHHB 5DGBA 1KY3A 4BKOA 4DLVA 5IZ4A 4LBZA 2BM8A 4CJXA 2JKYA 1M66A 5DYNA 2NG1A 3AK4A 1BVSA 3KK0A 4AJLA 3EW9A 2XHEA 3B3JA 4KE6A 3QELA 2PL9A 4RAOA 1EFAA 1C9NA 2LYAA 1SL0A 1YCHA 2C2HA 3PC8C 4MQUA 4MW2A 4ER0A 3GLIB 3VKGA 1XZKA 2XMDA 3HFJA 2CWWA 1XRPA 1L8XA 5BYAA 3UWPA 4DIEA 3SOZA 2CF5A 4JL6A 3C7DB 4MJ3A 4Q12A 2P6PA 1YAJA 1TD1A 5FL7D 4OM8A 2HHQA 4O5KA 4DOBA 2BDTA 5I9BA 3SXJA 3FNGA 1E9SA 1Q57A 1S1CA 1K0UA 9ICRA 1JLLA 2JW5A 3L1UA 4G4SO 4ARIA 2AQ8A 4JUDX 1E92A 1V1MA 2NV0A 3M6VA 3E1KA 4RKFA 5KSOA 4N41A 1HE3A 3CUWA 2IT1A 5F73A 3DOUA 4IX9A 3OG9A 3G2MA 3T5HA 2BGKA 3OQ1A 1DBSA 5DLPA 4BP1A 4NYJR 4EVQA 3KUXA 2CHEA 3F7TA 5CJ7A 3G13A 4BASA 4UATA 1GGKA 2VDWA 4EB8A 4JA2A 4QOEA 3OQIA 4BE9A 5BSKA 3VJRA 3V6HA 1BFKA 2D13A 2ZE5A 3L93A 3V46A 1FDRA 2DFNA 1FNMA 1SPXA 3BWDD 1L7BA 3DQPA 5AJWA 1Y6FA 1HOXA 1CF4A 4KLHA 2QX4A 1WF3A 1BX0A 3E23A 2VBFA 4IDCA 4QLOA 1HM5A 3JQ7A 3BTOA 2HMYB 4FZVA 2DPLA 5K6TA 3DZGA 2Y8EA 4F5PA 5JAIA 2O8FB 3U44A 2LRHA 3MWEA 4IOKA 5H1YA 4EA8A 4N7MA 1US8A 4XARA 5IEJA 3U9LA 3TD9A 3G0IA 1KEVA 4OJLA 2AQIA 4F12A 4RUKA 4ETNA 4RQ0A 1L5KA 1XA4A 4ACOA 1XDUA 3HJEA 1BMFD 3KT6A 3EF3A 4MAMA 2IYNA 3HS3A 2WF7A 1E8DA 1SB8A 2XNHA 4GSYA 2WWYA 1EK6A 1T2VA 2OY0A 2I2XB 3AEQB 3ANMA 2HBRA 3ANYB 3HB4X 3JW8A 4MRSA 1T6XA 3ZCVA 1MJHA 3LZ6A 3ZD7A 2AN4A 1PHPA 1APBA 3CFYA 2NVUB 1QPZA 2DLCX 3MFHA 3M7DA 4PNHA 3D7LA 4EA7A 1W36C 2XI9A 1T6ZA 5B3JC 2E6KA 2O7RA 1V6CA 3HXKA 2O5RA 5TQ2A 4OJKA 4USAA 2CFTA 8ICCA 1E9FA 4N0PA 2C4NA 5JZMA 5BMVB 4EBCA 4JC5A 3AL0C 3FPKA 5K5EA 1RR6A 1E2DA 5JS6A 1Q74A 5K3AA 2Y77A 2OH2A 1N61A 2QL7A 4YCDA 1MQ9A 3V4RA 1Z7YA 5DB7A 1HRKA 2C4UA 1T0JB 1FNNA 2KS6A 2R8RA 3Q8SB 3D6NB 3QKRB 2Y0BA 3DZIA 1RQLA 1ULAA 2I8LA 3VPSA 3EN0A 2DLDA 3H0MB 3LA6A 1RE1A 4DLLA 4QKQA 4UBNA 3GLGE 1M0TA 3Q8PB 4NBSA 4L73A 4R16A 2GD6A 2M98A 5EWMB 3RFTA 3UIEA 3IXLA 2OXFA 3IUSA 4UU1A 5K8VA 2HLNA 3KT0A 1BX3A 3DLHA 3OPYA 5JAOA 3MTJA 1SC9A 4UVDA 2PUCA 2QG4A 3IVXA 1G7TA 5CJ2A 1W36D 5IDYA 3UPUA 2A67A 4GXRA 3SSNA 4DR5B 3KETA 2WFMA 3B85A 4A5SA 3CNOA 4X94A 2OHVA 1TK2A 1YZVA 4IJWA 2JD0A 2VPTA 3UM9A 2ECFA 3KXDA 3VHXA 4M37A 4DY6A 3JPRA 2A1TR 2DFLA 2REOA 3PHLA 4P0QA 1YQDA 5FBKA 5BXQC 5GIPE 5L1LA 4G67A 3HKZC 5K01A 1QGZA 4UB1A 4P4TA 4C04A 5HPYB 1TZKA 2PUHA 2X1LA 5J2KA 5FA6A 1HURA 2FWAA 3LPAA 4LK2A 4MGEA 4O3RA 3EARA 4RGBA 2VUSA 4RQ5A 3T1VA 4F5ZA 1D2NA 2QUHA 2OV4A 5AHOA 5KFQA 3THWB 1Z75A 3HV0A 1MVOA 2KMDA 1GDDA 1RCUA 2R3SA 1RTTA 3E8MA 2PMDA 1FJHA 1VPWA 4OSEA 4DB2A 4FFNA 2YZ2A 2ABWA 5TT0A 3R9IA 2NSDA 2OCLA 4UOZA 1YZKA 3O03A 2XR1A 4TYMA 1KBOA 2DUWA 4XDHA 2FEMA 1GLNA 2JZNA 3CTMA 2PX2A 3C41J 5FPPA 2NWQA 1W1IA 4E12A 3NTRA 2AUMA 3JASB 1R4MB 1ABFA 2HU2A 2AHOB 2WWWA 3QNUA 2VXBA 3T1QA 2HF9A 4QZGA 2P9HA 1PV1A 1UXKA 4JC8A 2VJMB 3FJOA 5FV7A 4BUJA 2ZBQA 3E3NA 1G8SA 4M22A 3H8VA 4MRMB 4ZYVA 5IKMA 1X1DA 4CT5A 5E6SB 4DDMA 4YUZA 3B2NA 6LDHA 1B1AA 2ATEA 3K6SA 3CB2A 3U61B 4H6XA 5TQJA 4RSRA 1WETA 1ZGJA 1Z2EA 2PS3A 1QNFA 2P4UA 3VR6H 1LRKA 2XY5A 5B5EU 1D6NA 1Q20A 1EB8A 3KVNA 5EUBA 5IH3A 4C6SA 2XOKD 2I67A 3KZIU 4PZNA 1E5DA 3HYNA 4I6EA 2M6LA 3U7RA 1NVDA 3OZTA 4E46A 2I87A 2Q0ZX 3IEUA 3PJEA 4G07A 4ZOEA 2C8JA 4LE0A 5BOSB 4HB2A 1ZSYA 4IXWA 1FO4A 4GLLA 5EFOA 5IAEA 3KJIA 2Y67A 3NRJA 4K6FA 4FFWA 4ZDIA 2TSYB 1IOLA 1BMTA 2B92A 4JL5A 1O08A 4X8MA 7MHTA 3HKCB 3LP5A 4EO4A 1KZYC 1VTKA 2WYUA 3CZPA 4XIYA 2GGSA 1IB0A 1PZMA 3AUFA 4QG7A 2J3MA 1TK5A 2X7HA 3H0EA 4YQYA 1XVUA 1NXSA 3A06A 3BMCB 4CW7A 4ED9A 3FWPA 4KXQA 1BZYA 4REMA 5HIJA 5JQGB 4MF2A 3CGWA 5DTIA 1E6KA 4EL0A 1G17A 4OI1A 4B3SB 1NU6A 2LBPA 1MH1A 3TL3A 1UK7A 2CVQA 2R96A 4I1PA 4DLRA 1DQZA 4FYHA 1JR3A 4IJUA 3K9CA 4C8OA 1VLVA 4G97A 4X3PA 3K70C 1J0AA 3K31A 5LXTA 1CTQA 1N6HA 1SU6A 5TQ0B 5JD6A 1ZK4A 4EAQA 3C5GA 1C1XB 2FEOA 1Y1SA 2FQ1A 2GEBA 1X1TA 2J07A 3KBBA 1HEKA 1C0IA 3BHNA 4I4LA 4V39A 1CUIA 3NVYA 4D4MA 1EZZA 1W0CA 3V2GA 1GPAA 2PWZA 2WSSD 1GCIA 2F62A 2RG1A 1ODLA 3WJ7A 4XM2A 3ZY5A 4NXZA 1MQ2A 1UMCA 1VDZA 5KFAA 1YR3A 2G72A 2IDMA 3FLAA 3IV7A 3JYNA 3L06A 1NZPA 2Y92A 3PUZA 1XXHB 4M0DA 4S1TA 4V02A 3O3MB 4KVFA 1S3GA 1W0KA 2J48A 2QN6A 5CLFA 3H11B 2E4VA 3HFSA 2XGQA 3UVEA 4EF4A 3RFCA 3TM5A 9ICSA 2BGIA 4TLLB 4ZTBA 1LBTA 5F4ZA 1NJ8A 3C4JA 1MG0A 3AVWA 3AGQA 3PGA1 1ECGA 1T36A 3VR2D 4GP6A 4AWBA 3JPSA 1P1CA 4NG4A 3DEAA 2YVAA 5C18A 1QO9A 4WXRA 1CE8B 5A3JA 1ZOPA 5K0CA 1OHHA 4EG6A 1HDCA 5BW6B 1SG0A 2ANCA 3V1LA 1Q83A 1CUUA 1R0BA 1VYUA 2FG6C 3ETEA 4TV8A 2NZUG 2VRCD 1M6VB 3U7GA 4ZOHC 1F0YA 3O2NA 4CMIA 3NBMA 1KSHA 3ICCA 3NWPA 2DR2A 2BPCA 4DA7A 1GGMA 4G81A 4UM9D 1RXSA 1MUUA 1Y6GA 2XZDA 3OQHA 5AHWA 4GSLA 4ZU1X 2OCEA 4F04A 1PZXA 2NRTA 1B2RA 2JI4A 2ZWIA 4LJ5A 3HCAA 4RHXA 4YMIA 4RLHA 5K8LA 4O4HB 5LYJB 1SC6A 4EK9A 1W30A 3DEEA 4BIMA 2VYVA 4UQLA 5LZ9A 2GS9A 1NKCA 1UKAA 2MYUA 3QEMA 4FGKA 4ZCMA 3DS8A 2OG1A 3A3NA 1XZJA 4MCHA 3WLMA 3IG5A 2FLKA 5CPFA 4HUTA 2I4IA 4Q00A 4D8XA 2K4HA 5JNLA 2B5WA 4LJKA 1SXPA 2DHEA 3BRQA 1P1KA 3IKJA 4UEKA 3P5SA 3TEJA 1II9A 3ZR4B 1G8JA 1Z6ZA 4AG6A 3MS2A 1QFSA 3PD0A 4UEOA 3ZE8A 3TSYA 1CF9A 4FO6A 1X70A 4OHUA 2X5NA 3JPNA 6PFKA 3I45A 5C2JB 3UQ0A 5TQ0A 2ZETA 3B52X 4FEAA 1GSAA 2B98A 2VHCA 4L22A 2OGTA 4LOIA 2RHWA 2XJ4A 1EVKA 2IH2A 4XQ8A 2Q8QA 2O8VA 4CDRA 1BXGB 4RMJA 2REQA 2R7AA 1Q8KA 3C3EA 3AFHA 3X1MA 3BQ0A 2VP2A 3L0ZA 4DQQA 1JNXX 5JBNA 3V6JA 1EP2B 4WEOA 1YV9A 1K1QA 1Z37A 2CLEB 1M2VB 1DBPA 3D3JA 1BVUA 3F6EX 3AEUB 2G77B 3JAKB 1GGHA 4KBYA 3VV3A 3ZNNA 3NDBB 1GD1O 1XRMA 2HHVA 2IU3A 1VM6A 2YFYA 2ZJOA 3KS9A 4ZOCA 3HKCA 3PW0A 1H8EA 2CLHB 2OHGA 3GAZA 4OIFA 3VR6A 4J3FA 3VUFA 5D4BA 2IZZA 4M89A 4S2EA 4D8YA 1Y3HA 4HVTA 4ZJZA 1KJWA 1HXHA 3O95A 2FR8A 4U4AA 1D6SA 3GD7A 3RW9A 2ZAMA 4ER5A 3Q5EA 3NHBA 1E4EB 2GPJA 2KICA 2C28A 1RBMA 3L7MA 3P96A 3KAKA 4O3FA 2GCGA 4INZA 1FSPA 2ZSAA 1NSFA 1ZJ6A 4QJFB 4TUPA 2CXXA 3NUZA 4EUKA 2ZAGA 2WMYA 3VAAA 3ESZA 1MX9A 1VZ2A 3OSNA 1N0VC 2HWWA 2FZKA 2JR5A 1Z56C 3D64A 2XTJA 2YHIA 3LUAA 3G0CA 2DQZA 2BMAA 2J45A 3V1UA 4PBSA 5L3QB 4EYHB 3VJKA 5LMCA 1BQ3A 5D85A 4EBFA 2UVQA 1K08A 3A6KA 4QSMA 4OXIA 2N46A 1UAGA 4L4UA 4QULA 4GKKB 1OTHA 8ICYA 4JI6B 2BTOA 1MX1A 4DOCA 4JT9A 3NAMA 4LX0A 2IH5A 1FFDA 2V4ZA 1Y9AA 1KLNA 2DQNB 1BJKA 2GK7A 2QV0A 3NHLA 5BUZA 8ICIA 1FS6A 1WKBA 3PR5B 2QDXA 2G7MC 1DELA 2JVIA 1EFRA 2O2XA 2X40A 4K6MA 3O2SB 4MUHA 4RVSA 4YRDA 4MUBA 4EF6A 4F7DA 1EI9A 1H8HD 3D2AA 5K05A 4ARBA 3G0HA 1EVJA 2WE8A 1ZQGA 1QOZA 1N62A 2UUOA 1O95C 2X9LA 3DOOA 3I6IA 3K5PA 4X7PA 5G40A 2EW1A 3WOHA 4YRKA 2AN1A 4PGMA 3KT8A 5J2UB 2FDRA 3DBRB 3PS9A 3Q3VA 3GILA 3GFFA 2BMVA 2D7JA 2NUPA 2HI0A 2PTHA 2R6R1 3DZCA 3WGOA 3FE2A 3NI2A 4GKVA 4RVDA