3E58A

Crystal structure of putative beta-phosphoglucomutase from streptococcus thermophilus
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
211
structure length
211
Chain Sequence
MVEAIIFDMDGVLFDTEKYYYDRRASFLGQKGISIDHLPPSFFIGGNTKQVWENILRDEYDKWDVSTLQEEYNTYKQNNPLPYKELIFPDVLKVLNEVKSQGLEIGLASSSVKADIFRALEENRLQGFFDIVLSGEEFKESKPNPEIYLTALKQLNVQASRALIIEDSEKGIAAGVAADVEVWAIRDNEFGMDQSAAKGLLDSLTDVLDLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of putative beta-phosphoglucomutase from Streptococcus thermophilus
rcsb
source organism Streptococcus thermophilus lmg 18311
molecule tags Isomerase
molecule keywords putative Beta-phosphoglucomutase
total genus 77
structure length 211
sequence length 211
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3e58A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3e58A01
5AI6A 3QUQA 2ZBFA 4JDPA 3L8EA 3ZWDA 3DNPA 1TJ5A 2OBBA 1JUDA 2FUCA 2B0CA 3I1YA 2G09A 3SD7A 4I9GA 3L0CA 1XVIA 2HF2A 5AVTA 2G08A 4UW9A 3WK9A 2P27A 3ET5A 2WF8A 2IOHA 2FDRA 2RARA 1Z4PX 4G63A 4XOUA 1Z4MA 4HAIA 3SKYA 3E58A 2HF7A 3NANA 4UU1A 4C4SA 4Y2UA 3DAOA 1VFPA 4ZEXA 5AVYA 1RLTA 5AKEA 3ZX5A 1CQZA 1NF2A 2ZBEA 4YIHA 4C4RA 3I28A 1X42A 2W4MA 4BX3A 3DDHA 1CR6A 1XPJA 2AUTA 1QQ6A 3N28A 5T41A 1L8LA 3QXGA 3WKEA 3I6BA 1SU4A 2FEAA 2IYEA 4AS3A 2ODAA 3IJ5A 1SWVA 3MC1A 5ALMA 4NFLA 4UU0A 1WZCA 3QU5A 2P11A 5AW7A 1ZRNA 1MH9A 1QQ5A 4XPZA 5AK4A 3KZXA 3ZU6A 3OCZA 4UMEA 1U7PA 2YMQA 5AVSA 2Q4TA 4KX3A 1Z4IA 3HYCA 5AK6A 1RKUA 2OA0A 1F5SA 4UARA 3SMVA 3IB6A 2R8XA 5AI0A 4Y2XA 1N9KA 4KN8A 5AW8A 5JJBA 1ZD5A 5ALHA 4L6CA 2YJ6A 3FM9A 3N07A 3SKXA 2W43A 2FPUA 4G9BA 2RBKA 5AW1A 4FYPA 2HDOA 2GHQA 3ZVMA 4IG4A 4CF4A 2I55A 1ZD3A 2AH5A 3FVVA 2Q4RA 1QQ7A 4Y2YA 5AVZA 3QYPA 1YJ5A 3QUBA 1LTQA 5AW4A 1S2OA 2YBDA 2ZBGA 1WR8A 2FPSA 3D6JA 3AR5A 4EX6A 2G80A 1ZOLA 1AQ6A 4EELA 1TA0A 3WK7A 1RC8A 2FI1A 2G06A 2HOQA 4OFZA 2VKQA 1VJRA 5AICA 2EAUA 4RESA 4BNDB 2C9MA 5AVXA 3U26A 4C4TA 3UMCA 4UM7A 1K1EA 1T5SA 3GYGA 2NO4A 2B8EA 3W5CA 3OCYA 2DQSA 2G0AA 5A3RA 3OCVA 4MWOA 3FGOA 4UMVA 2FPXA 1TJ3A 5ALVA 3DV9A 4FE3A 2HHLA 1Z4OA 4NWIA 4HGNA 3UMBA 2EARA 4DW8A 4MUMA 4UAVA 4KNWA 2JAOA 2JARA 2B1QA 2IOFA 1Z4JA 2HCFA 1XP5A 2NYVA 3MN1A 1NRWA 2YJ5A 2YMPA 3AR7A 3K1ZA 1O08A 5AKJA 1RMTA 3WGVA 3ED5A 4YGYA 3ESQA 5AKIA 2FPRA 4UMDA 3PDWA 4BNDA 2I7DA 1RMQA 4L6AA 3SLRA 2WF6A 2RAVA 4HYTA 3BWVA 3F9RA 3ZVNA 2P69A 1U2SA 3M1YA 5AKXA 5ALEA 4BKMA 4F71A 3L0BA 1ZRMA 2GHTA 3U7EB 5ALXA 3BA6A 2RB5A 3L7YA 5ALPA 4YCLA 4Y2RA 3L1VA 3ZUPA 1L8OA 2YMLA 2PR7A 1Y8AA 3A1DA 3N8GA 1YMQA 2JGAA 2ZG6A 4NAVA 4Y2QA 4AS2A 1RLMA 3A1EA 1ZS9A 3OPXA 3N1UA 3UMGA 1N8NA 2PQ0A 2OYCA 5AIAA 4GXTA 5AM2A 3ZVLA 1EK1A 3U19A 5ALTA 4YH1A 3U7FB 1L6RA 4KX5A 4H1WA 3QU2A 4EEKA 3PCTA 3ZTYA 1QYIA 4EX7A 2HEGA 3MPOA 3MMZA 5AK3A 4UATA 3R09A 1O03A 4Y2TA 2FUEA 5AI4A 3A3YA 3NUQA 4YCNA 3QX7A 3L1UA 1QH9A 3FPSA 4UMFA 4BBJA 2D2VA 2I54A 2MSNA 5AM0A 1T5TA 3KOOA 4BX2A 5ALOA 3ESRA 1YDFA 3EPRA 2ZBDA 4Y2PA 4CF3A 3P96A 3RFUA 1IWOA 4L57A 1RKQA 3AR9A 5AI5A 2QYHA 2GMWA 2BDEA 2WHEA 4HGOA 4O8CA 3OCWA 5A3SA 1TE2A 5AI9A 4PNHA 2MU1A 1PW5A 2R8ZA 3WGUA 1RMYA 1WPGA 3WK5A 3U7HB 3N5KA 4CE6A 1U2TA 3SF0A 2I34A 5AVWA 3QGMA 3B8EA 3L0YA 5AIBA 2IOFK 5AW9A 1Z4NA 4EENA 3FZQA 5AM4A 4ZEWA 1Q92A 2C4NA 1J97A 3EWIA 1RRCA 3QU7A 2WF5A 3OCUA 3KDPA 4HGPA 3IRUA 3M9LA 3KBBA 3R9KA 4I9FA 1RKVA 5AESA 3L5KA 5ALRA 3W5BA 5AKHA 1NNLA 2G07A 3ZWKA 2I33A 2QLTA 4BX0A 3FPBA 1ZD4A 3HLTA 3PGVA 4GIBA 5ALZA 3EF1A 1L7NA 2B82A 5IT4A 5AW0A 2CFTA 1YNSA 2BDUA 3U7GA 5AKZA 2G1AA 4XE5A 3NAMA 3ZW7A 2IA5A 1L7MA 4UASA 5AKGA 3L8GA 5AKLA 2YJ4A 5ALGA 2CFRA 4KYTA 5ALDA 1U7OA 2WF9A 5AVUA 3ZI4A 3WKCA 5AI8A 5AHXA 5ALJA 3QUCA 5ALNA 3L8HA 1Z88A 5E0OA 1TJ4A 2HO4A 1S8OA 2R8YA 3ONNA 3KC2A 4EZEA 2B30A 1Z4LA 2P9JA 1Z4KA 3AR6A 5AW6A 2C8LA 3WKAA 4QJBA 4RETA 1LVHA 1SWWA 5IT0A 2I6XA 5A3QA 1WVIA 1L7PA 1ZJJA 3NRJA 4YIKA 3SHQA 5ALKA 1Z4QA 5AW3A 4F72A 4E88A 2CFSA 1RLOA 3WK4A 2HI0A 4J2TA 1YV9A 5AVVA 2OM6A 3B9BA 1Z5GA 2R8EA 4DFDA 4ZEVA 3NASA 3AR2A 3QNMA 5IS2A 2PKEA 3ZX4A 3U13A 2FPWA 5ALWA 3WK6A 3I76A 4BEVA 1RDFA 2EATA 3ZTWA 4J03A 4OCZA 4KNVA 3E8MA 2JAWA 2AGVA 4Y3UA 1RPZA 1VJ5A 4FFDA 4UAUA 2WF7A 4XQ0A 2WM8A 2GO7A 4IFTA 5ALFA 2O2XA 1L7OA 2ZXEA 5AK5A 3KD3A 4DWOA 4AP9A 5AM5A 1J8DA 3CNHA 5ALQA 5AVQA 3ET4A 5ALIA 4UM5A 3QU4A 3NIWA 1RQLA 4CF5A 1Z5UA 1U02A 3CZ4A 3EF0A 5AW2A 1T9ZA 3WK8A 3RF6A 2HX1A 2WFAA 1FEZA 2NO5A 4NABA 2HSZA 3UM9A 1KYTA 2C8KA 2MU2A 3TLMA 4CNQA 5ALUA 3W5DA 2B8JA 2YFYA 4OD0A 5AVRA 3WKDA 2C88A 3E84A 4BYGA 4Y2SA 3NALA 3A1CA 5ALSA 4HGRA 4QQFA 5AM3A 5AW5A 2W11A 3OCXA 3WKBA 1EK2A 5FP0A 4YCMA 5AKYA 2O9JA 3AR3A 2YN4A 1YS9A 4NV0A 2AMYA 2BY4A 2Q5EA 4B6JA 4Y2VA 3J7TA 2B1RA 2GFHA 1RQNA 3VAYA 3QUTA 3L8FA 4HGQA 2CN1A 5ALYA 5AKKA 3AR8A 5AM1A 2ZOSA 4DCCA 3E81A 2JAUA 3B9RA 3QLEA 3S6JA 3W5AA 3PGLA 5ALLA 2YMMA 4BEWA 1ZD2P 3QU9A 4OHFA 3R4CA 4JB3A 2YY6A 4Y2JA 2YJ3A 3AR4A 2X4DA 3OTQA 1Q91A
chains in the Genus database with same CATH superfamily
5DGBA 3H4BA 5KFSA 1NVXQ 2ZBFA 3HO8A 1JLSA 1YVUA 2Q2WA 2EJTA 1EXNA 1IFXA 1NI5A 1F4PA 2AOVA 3L8EA 4L50A 5KNBH 4I1VA 3CJQA 4MB6A 1ZGAA 3K8OE 1TVCA 1RAIA 4RFSA 4B2IA 4BAUA 3PLRA 2BGRA 4F2WA 3UQ0A 2HLHA 2QW1A 2MAXA 2YZGA 3DEJA 3TZBA 3I01A 1X15A 3AFMA 3FSGD 1SXPA 2IKSA 8GPBA 2OGWA 4PO8A 4GXJA 2H16A 3MVEA 3OJSA 3S3TA 3WNQA 2XC9A 3Q88A 3RVNA 4JC5A 2G08A 1EINA 3S55A 3QEAZ 4H6PA 3RFVA 2WPDD 2CNWA 3WK9A 1CP3A 2CLIB 4B44A 5EIWA 2FPLA 3M8SA 2BJWA 3PX3A 1OCEA 5H68A 3V6JA 5TB5A 1U1GA 2NU9B 1HKUA 4N9QA 5CDGA 5ITZB 2RK3A 2Q3JA 4K6MA 1H0SA 1MORA 3BG5A 4WJKB 4J9RA 2BGUA 2D4HA 3CMMA 2BN4A 4WCDA 1BQ4A 4TV9A 1WWUA 1LRKA 2A7XA 2IYSA 4J4TA 3K9FC 3HFRA 1DCFA 4YCJA 2JCBA 1J5PA 2O6HA 2BCSA 5FPQA 4M47A 4W4TA 1P7WA 5HIMA 2D8MA 3VHRA 2C92A 1IY9A 2E87A 2PN1A 4EHLA 1KFTA 3SM3A 1P44A 2YICA 1NJXA 3D8BA 5K8IA 5C52B 3KHLA 1K75A 3C1UA 4L51A 2M0NA 1IC6A 2JJMA 2QZJA 2KZ3A 4LSGA 3KV1A 4OYRA 5AOBA 5BPHA 2OGUA 1HQYE 1ZVMA 2BCUA 1E6CA 3JPOA 5H7XA 4H18A 4C03A 2WWVD 4N6OA 5LXTB 2ZRKA 3T3MB 4MI1A 4BNLA 4CXMA 1N7GA 1YS4A 4K9RA 5EPUA 1L4HA 1ORIA 4TWIA 4US1R 3MLAA 5FTNA 3UQYS 2A3NA 1EVZA 3K9WA 4US2R 3IBSA 1P3Y1 5EZ5A 3KWFA 5H83A 5TE9A 2AJCA 1DXSA 2BHTA 3WGNA 3R3ZA 4PL2A 2DWCA 2PZFA 4EHDA 2QKQA 4EYQA 3LV8A 1YUBA 1TZBA 1EDBA 2KZMA 5DI3B 1X8JA 4G85A 4RM3A 3WYAA 1IBSA 4BRSA 3FCYA 4I55B 4NMXB 1ULUA 1CJBA 1G5TA 3L7CA 3HRKA 4XW2A 1M1XB 4BFVA 3FNIA 5ABPA 3RVJA 4GC5A 1S6YA 5AVJA 3P45A 1V5EA 3VDNB 3WMGA 4ECXA 4X1IB 3EZXA 3RVQA 2BFCB 2YUTA 3IQFA 4YRCA 4WCVA 5DLEA 5DI9A 3GP8A 1LSJA 3ESAA 1JHDA 1Y6GA 3ZI7A 1E2UA 4YT8A 2EDUA 5CDHA 4WDQA 1ULAA 2DJ5A 2O50A 3HQ4O 3MSXA 3K1AB 1Z3CA 2XZTA 3EEYA 4R69A 4YHBA 4RYDA 2NU8A 3GDGA 3BOSA 3QJGA 1WSAA 1N9KA 4G25A 4QXRA 3KYDA 3GZTB 4OK6A 3OSZA 1PR6A 3ZS8A 2ID9A 4G0PA 5SYAA 1QBKC 4FYHA 2DTXA 3ZBTA 5JADA 1XPRA 1K63A 2A9OA 1KERA 4FYPA 4DLAA 2HBMA 4IGAA 3BSSA 2B83A 2GHQA 4IX9A 1ZN2A 2X6TA 4XLLA 4CF4A 3STXA 4DILA 4US9A 1DC5A 3QI7A 3ZYCA 2I4OA 4OM8A 1KJWA 2QGNA 3G9UA 3KTAA 4Q39A 1QQ7A 2WUGA 3H2ZA 3MRSA 5IKEA 2WSBA 2PSEA 3MAAC 4KIJA 4L8GA 4DJTA 4DL4A 1FYEA 1JFTA 4RLQA 3HFJA 1LLFA 3DOJA 4F4DA 1TLLA 2G80A 5LP6A 4XDHA 5HX7A 2AMJA 3OG9A 5I6DA 4RHFA 4KMOA 2J9FA 3JQDA 1G2QA 4YP6A 2R62A 2WTFA 3DC2A 1PUXA 4WNYA 4YS6A 1GXSA 3WYBA 1QFMA 1U8YA 2GBCA 1LRLA 3A7DA 2ZAGA 1P1IA 3AONB 5J0TA 2HOQA 5KT7A 4RQ1A 9ICUA 1DO2A 1HXHA 3FR7A 3PVZA 5AICA 3DTNA 4G0NA 1Z0UA 4NV3A 3RS5A 3ZXIA 5JAHA 2P6NA 4ED3A 2C1ZA 2Y1GA 4IQ4A 3ZCXA 1E9RA 3UMCA 5L53A 3ONDA 1VP9A 3TFRA 2EBFX 3L93A 1RADA 2NV3A 3GT3A 3AK4A 5A9TA 1TF5A 3FOFC 2NSJA 1R0XA 3DBHB 4B2LA 1TU0A 1D07A 1SBTA 1YBVA 4IHJF 2QB5A 3C6BA 4Q00A 2IPAB 5F4BA 4ZI2A 6PFKA 2LVBA 2BWJA 3K70D 1KAEA 1LLUA 3WIUA 2OG1A 3JQ8B 4QDZA 3CLUD 4HVCA 4JGGA 3JARA 3PWKA 1GV0A 9ICAA 2PKRA 2VEOA 4UVIA 2A9RA 4FE3A 2XTAA 1INLA 3E4DA 1T0JB 3FE2A 3PQ7A 4ZK2A 3LC7O 1SIBE 3UMBA 1DJPA 1XZNA 2XWJI 3KLNA 4M0DA 4XQGA 1NXWA 4PHEA 5E0KB 3IL2A 5IM4A 3KQPA 3RR7A 5TEVA 5AD1A 4MYRA 3DKVA 2DUMA 4D92A 1EGQA 4UVDA 3BK1A 3R6WA 1NPDA 1H5NA 4IDEA 1ZA1A 2QMZA 3GNTA 2VT2A 1CRWG 4N5HX 3T7JA 1MPTA 4JYZA 1BCRA 2GK6A 4FXPA 3IP8A 1L5HA 2HBJA 1WU7A 2OOSA 4GFDA 1TEZA 2CK3D 1ZZGA 4QNMA 3ON5A 1DX4A 1RMQA 1NI3A 1O9GA 2HLNA 3FFAA 4H6XA 5LMCA 3LYUA 2O3JA 4MP3A 1NVUQ 2VUHB 5BNFA 5DG7A 1DKOA 3GLHA 1GYRA 3NTOA 2OORA 5HEKA 4WCFC 1X66A 1QANA 5ALXA 2WNSA 2Y4NA 4MHTA 5J4HA 2A5YB 2B5VA 4KDCA 3FX2A 3M4ZA 3PSFA 2EZ9A 1YGYA 1Z47A 3QLUC 5JQGF 5DLFA 1I4TD 4K6GA 5J1SB 3LLMA 4B9SA 1YAJA 1AKMA 1HPLA 4LXYA 4GPZA 2PUDA 1B1CA 1XRRA 1TIBA 2HADA 3QHQA 4LHWA 1UJ2A 2C0CA 1A4UA 1JR3D 2K89A 3E4CA 3ED1A 5A4DA 1KC3A 1P75A 3I6MA 5AIAA 5JS1A 4RF4A 4NM2A 2W3RA 3FTEA 3DZHA 1CK4A 3QV2A 1NDQA 5IAGA 5ADWA 4CDMA 2P7HA 4YH1A 1N6OA 3UWOA 4KX5A 1MGOA 3IELA 4JYCA 2NPOA 4E3ZA 1EX7A 2PKYX 2I3BA 2WWFA 4HUTA 1BVHA 3C3AA 3T5AA 1QYIA 2LYBA 2FHSA 2COUA 3UFXB 2RHOA 1A2QA 4RMGA 1IM2A 4DBLE 3THXB 3R09A 4OB6A 1XJQA 3HYTA 1XK7A 4QQRA 1O8CA 3VHQA 1N5RA 4DZZA 3JV7A 1L7QA 1HNWB 3SENA 5AI4A 1KH2A 1DQYA 1R7RA 1QYCA 2N75A 2HBZA 3A3YA 4K26A 2L82A 2D8CA 4DSZA 2NRXA 1JHQA 4OH1A 1GO3F 4Z1MA 3ZI0A 3GV0A 3K1AA 1QH9A 1X19A 4JUZA 3PXBA 2VJ4A 4XUGB 1EJBA 1V2HE 3GLUA 5DHQA 4REQA 3LT5A 2X77A 3TDMA 5IC5A 3UB2A 3E5RA 3LHIA 1FFBA 3DM5A 4OQZA 3TRHA 4JCCA 5IAOA 4QIWF 1P72A 2BFCA 3EPRA 1VOTA 1QFJA 4X93A 4WNAB 4N0DA 2QYSA 4N65A 1PTJC 1TEVA 5E2AA 6ADHA 3TOCA 4LZPA 1WWKA 4V0KA 3LFTA 1X8XA 1K1SA 1IEVA 2JGIA 2ET6A 5DHRA 3T5DA 4WBSA 4G3IA 2WLSA 1VDVA 4YD2A 3FLMA 3R77A 3ECSA 2H29A 4F21A 2JJQA 4R8UA 1M1YB 1NZPA 1WX1A 2ZE6A 3AEUA 3OF5A 4LRXA 3UW3A 4X65B 4ISCA 1KDTA 2AN9A 2BFBA 2X5OA 5G02A 3AETB 2QUIA 3UXEA 5AI9A 4EW1A 1XTVA 3GWZA 5D3KA 4D0LB 1SQ0A 4BAGA 2K4EA 4ZVQA 2O7QA 3MT9A 2ZYAA 4MYHA 4B81A 4IH1A 1UIMA 3EXG2 4P4LA 3SF0A 1FX1A 1UKBA 2D1SA 3B6ZA 4OQPA 3V6HA 2RGXA 2EG9A 4P3NA 1KFSA 5L1KA 1RT9A 3I83A 5IILA 3KOXA 1IBMB 4AKIA 1V8DA 1VXOA 2O6KA 1N3BA 4CUKA 1JEOA 2OUKA 5JANA 3KQLA 1Y98A 4GBJA 4U5XA 5J0YA 3R0ZA 5I3ZA 1NQAO 4B9EA 4Y1FA 4HGPA 4GWGA 3IRUA 3WDKA 3MIIA 1GPNA 4IRUB 2QTTA 1F0MA 4FOPA 4YREA 5GADl 1K5HA 4I28A 1RKVA 1X9IA 5KTOA 3RYFB 2IK8A 3GFRA 2FMHA 2WOOA 4J29A 2X5XA 3PNMA 3RBZA 2G07A 3GLHE 4YXJA 2O8EB 1RPTA 2QOEA 3HLTA 1B7GO 4PX9A 4MUHA 1IZ8A 1Z8DA 2F90A 2CK3A 3DAGA 1CEYA 4YK7A 4N6NA 1UOOA 2GN6A 2CD9A 1L7MA 2A1IA 5AKGA 2W2LA 2IEAA 2I62A 2V6IA 2K4HA 4G8JA 4MJ7A 3NU1A 2HA3A 2DE0X 5B2ZA 3M6MD 3WJAA 4WJLA 1Q0LA 3WTCA 5HMMA 1CY6A 1BJTA 2XX3A 2VSYA 1UKZA 3B2NA 2JLAA 3M6LA 4OQQA 3N7SC 2WQZA 1WXEA 4I1RA 3DB2A 3UHFA 3UAOA 4P54A 3G23A 1G5FA 1KZHA 2G36A 1GPJA 2WR8A 3T1OA 2V9WA 4HQRA 3QZ7A 3I5YA 3DL0A 1KI9A 4HEA6 1C30A 2WW8A 3KC2A 1M67A 2WSMA 3QXCA 1O96A 4V0OA 4WMLA 5CJ2A 4GI2A 1SXQA 3C8HA 4WUTA 3U56A 4DIBA 5I4CA 3GEIA 4FEGA 5JTIA 5FRDA 4PYRA 3GJ4A 5KUTA 2G5GX 2CJWA 5KYVA 1A1VA 1PFYA 5IT0A 3RF9A 4ER6A 5K0NA 1QIJA 4DSAA 2GSDA 3A6EA 1H1LA 4JT9A 1GZVA 5T6BA 3VNAA 4W5QA 5A3QA 4Z6DA 3FUUA 2DPXA 4R2XA 4EUKA 3OQ1A 2EH9A 1LTKA 2JH7A 1JECA 1K4MA 1M7GA 2A14A 2IDMA 5F9NA 3AP3A 3LW7A 4GE0A 2VH5R 4NH0A 4XQ9A 3FWKA 4W1QA 5LZ9A 1MZVA 3KSUA 1FSGA 1QO7A 4N3AA 4KTTE 3VSDA 5CRIA 4FMDF 3C7TA 1BZYA 3WMEA 4MS1A 1TADA 3BMCA 4UB3A 3LY9A 3QOWA 1MQAA 2OYRA 4WA7A 3V8RA 3EIHA 1HFKA 3PW7A 1FPMA 3CUYA 4NCIA 4J9SA 3AW9A 1ZCAA 3EZLA 4NU8X 3WNCA 3TGLA 1O0CA 2DR2A 1Z17A 5KIAA 3EEQA 5K3FB 2X8JA 1NF9A 5JTUA 2IYFA 1GILA 3SJUA 1OB2A 4PJ0U 1Q74A 5A05A 2ZJ0A 4X7MA 2WHYA 2WU0A 4I4TA 3HGMA 2RQ5A 1DHRA 1LDNA 4JIMA 3PI7A 4E1AA 2XZLA 2O5CA 1BTOA 4HEQA 3ENWA 3K9QO 5TNXA 2PUCA 3ENVA 1KXJA 4QEDA 1GFIA 3LKBA 1FRFS 1QKKA 2AOXA 2DOKA 3UJ7A 4EVSA 4C2BA 5JS6A 5NULA 1KRHA 2JAWA 3WZ2A 3ES9A 3X43A 4MVJH 1Q44A 2Q46A 4EDHA 1ATZA 5EESA 2DXIA 1JRPA 3K72B 3CCCA 4K9OA 2IDJA 2WIAA 1A97A 2QSZA 2WAYA 3A11A 1HO3A 3T5BA 3WFIA 4IHJB 3LHSA 3RU7A 2OV2A 4AZ0B 2QVYX 2I29A 4QU0A 2GWHA 4M9ZA 1GNSA 5JD3A 3NT2A 5CFQA 4LFAB 5FOUA 4NEHB 5EI5A 2VUUA 4HBGA 1R16A 2VPIA 3M7DA 4NCHA 3V32A 2RHFA 2VUIB 3G5AA 4B3HA 1AZWA 4UPEA 5JALA 2CBGA 3ELUA 3SYRA 1J07A 2B2CA 4IRXA 3AUKA 4ECAA 1WDTA 1IB6A 3LT0A 2EFCB 4OIMA 2CEKA 1W0JA 3MJVA 4EUNA 3B89A 1EFHA 1I0IA 1YMUA 3BB3A 5CYPA 4DOMA 1V97A 1KNQA 4BATA 3E48A 4LZAA 1X7WB 3L9WA 3OLCX 3QWHA 1TLTA 3S2YA 5JXWA 3IALA 4DL3A 5D7NA 2GS9A 4FR0A 4JH0A 1GKKA 5SYMA 3GP5A 4BAZA 1Y5LA 4Z6CA 1AZSC 4OHYA 3DE5X 2BMFA 3CIOA 3JPTA 3QPCA 4CU2A 2H59A 2ARKA 2FZ5A 4URHA 2CJWB 2C8KA 3QF4B 3QVJA 4ML3A 4W6QA 4X3OA 2ZS9A 5EWJB 1DT3A 3G0OA 2D1QA 3LGSA 1YA6A 4MYDA 2A30A 3GGOA 3PGXA 5JDIA 4B9MA 1Z0KA 3ISJA 3QSYA 1T6XA 2POQX 1V4BA 3NTXA 4IQ8A 5ALUA 1ZK0A 1YBAA 3DMPA 5EWMA 3EUWA 3NALA 4ZVNA 3ZD6A 2HMUA 1Q77A 1FSSA 4NCBA 1U6IA 2HHXA 3EMKA 1VL6A 3O47A 3OE5A 3P0IA 1FXWA 4PSCA 4MW7A 2R44A 3RGWS 4V1CB 1XELA 5C4GB 1DARA 1T5DX 3GXBA 3RRGA 1TZ2A 4HS9A 4TXMA 4UEQA 4Y2VA 5KFIA 3PVSA 3UUGA 5LD2C 4TZ6A 4JV1A 4N0QA 5F7ZA 1QF6A 5CLFA 1YJXA 4KTVE 1P91A 2RFLA 1VCIA 1A2KC 1M0WA 2NQTA 3L8FA 3LVRE 4UD2A 5JYEA 2IBSA 2MA1A 1XTRA 3A6GA 4MLPA 5BT9A 5C1IA 3BSYA 2Q21A 2YJGA 5LIPA 3CKMA 3IVAA 2VT3A 1XCOA 2QY6A 3PCXA 2P77A 5EIFA 1TCVA 2CVHA 2JFOA 3DMGA 3IFSA 3K70B 4F4WA 1GVNB 4MTCA 1N8TA 3IE2A 4O4LB 1DRWA 2HTFA 2ACKA 3SIWA 2QIPA 4KPGA 4BVGA 1NDHA 3AFHA 1NBME 1HUOA 2XCIA 3SC3A 3MBOA 1LW6E 3LPMA 1D0SA 1TK2A 5JZBA 4YFKA 5DPMA 4L5CA 1P7ZA 4BX2A 4JB3A 5CFLA 2YHIB 2W4IA 3GFVA 1SIWA 4LI3X 2RDIA 1L5UA 5FWYA 1KVRA 4ER7A 4LDNA 1QVAA 1OYOA 4C7BA 2HHHB 3UBMA 1PYGA 3L0SA 4EPRA 3GJXC 3OKFA 2VSXA 1DB3A 4K28A 5EIEA 3KJGA 1FLVA 2C3MA 5A7HA 3SOZA 3UPTA 4B47A 3H0MB 2LTAA 4YJ3F 3OLXA 3TZ6A 5I8WA 1T24A 4XM0A 4EJFA 2OLKA 4HX9A 3T7EA 1LI5A 1DPFA 2PGDA 4M7WA 2HBKA 4MS3A 3SNKA 5JS2A 3P9YA 3K0FA 1WQ3A 3KZIU 1CFJA 3IVCA 4FD3A 2EFJA 4GMHA 1JHPA 4HFRA 5CMLA 3T38A 1U8XX 2J6CA 1U9CA 2OQ2A 3FVWA 3Q4GA 5KEIA 4ZFNA 1EH5A 3TACB 2ORWA 2YNMC 1NXPA 2NUAB 2DKXA 3ZDCA 2JRZA 3DBOB 1L4NA 1RG6A 4BV3A 4F56A 1FDIA 3B0XA 3BMCB 3ET5A 4TZKA 1YZ3A 4W9NC 1AT1A 4WNAA 2AE2A 4D6YA 3LK6A 9ABPA 2DM6A 3VV2A 1ZISA 4H6VA 2ZYHA 4D98A 2RARA 4AN1A 1TYAE 2QMOA 4R0VA 5CTJA 3CA8A 3EISA 3NBYC 1H2WA 1XMPA 2GHIA 1BWSA 4H08A 5B4UA 4CIWA 1AV6A 1ST3A 4G41A 3PDIB 4DLSA 1FFGA 1QK4A 3FYTA 1JHXA 3BREA 2X4IA 4DWVA 2W42A 1QH1B 3H4MA 1K98A 4NL9A 1HG1A 2W2OA 3IQGX 3OFSA 1U8TA 1M2HA 1Z5WA 1SD5A 5KT5A 4X54A 4D9NA 2YDXA 3QFTA 1DQRA 3HV2A 4IDAA 3DTVA 3NVKI 1S1CA 4JLJA 4TXJA 2PUTA 4ZEXA 1Q0TA 1RC0A 3IESA 1N2BA 3KOMA 4A2QA 3PNBA 2JI8A 3ETGA 5HMLA 3R0XA 5JARA 1MUUA 1XAJA 3G5LA 4HWPA 1YRHA 2IPLA 1BA2A 4MX8A 4N7BA 2V55B 2PYDA 3QOXA 3RS9A 4C05A 2BGTA 4QECA 4EPWA 1S4QA 1AKTA 4AYWA 1BEUB 1OXKB 3E2EA 3B6IA 3HJRA 1OX5A 2QD2A 4C29A 2OQVA 1CNFA 1QQ6A 2ACWA 2QJWA 2V6JA 5A5EA 3IURA 4MV3A 4LJRA 3VPHA 1Y4SA 3BN3A 2PX2A 2GLEA 3J81k 3MC1A 1EE2A 3NHYA 4MQFA 1CRZA 2ZYVX 4N18A 1ZXBA 4K1XA 4RD3A 8ICTA 2C95A 3RRFA 4DLKA 3ZZUA 5KWEA 4NYIR 4RQ8A 1F06A 2EGHA 1WY5A 4MF2A 2FVYA 1KSGA 2OFFA 4B48A 5KU1A 1K2VN 2D0IA 4II7A 4D4LA 3ULKA 3P20A 2RGCA 2CJYA 1QHEA 3K2IA 1OLUA 3QFHA 1YRWA 4HTAA 2CW5A 4TZ0A 3A1SA 3DVQX 3LXUX 2J41A 4YO7A 1GNRA 5F1YA 2JJ1D 2BW0A 2X8AA 4NM1A 1YASA 2HIAA 4YJFA 1I3LA 4M9RA 3RVLA 2HK9A 4FYJA 5REQB 4DJ5X 2RONA 1AF7A 1M8JA 1F5SA 4XGRA 4C22A 5IYZA 1EWYA 3WV5A 5LZ2A 5DTRA 5C8VA 4FHZA 3OPVA 4CKYA 1ZVKA 2WJGA 2CVQA 1P1CA 4KQ1A 4LDRA 2PMEA 3GLKA 3USCS 4GOLD 1YHNA 1DV2A 4UBBA 1JU4A 3COSA 5FAKA 5EHZA 5CP8A 3OF2A 1EUZA 3SBXA 1YBFA 3WMFA 1V4VA 3AC0A 3LZDA 4XLTA 3GIKA 2Y99A 5EIOA 2YB1A 1Q84A 4BBPA 4HCJA 5BT8A 5KJFA 4RTOA 3ACBA 4WA8A 1XTZA 1Z0AA 2ZVJA 3OF3A 4UDNA 3KNZA 4Z49A 4FNOA 4R8RA 2O2JA 1QV9A 2AH5A 1XJ5A 5KFQA 3TTVA 3PIDA 3FBWA 3QUBA 1FVXA 3NOXA 1DX9A 2BM1A 2H31A 2ZJZA 3DWEX 3FOBA 3KP1A 4L2IB 3HJBA 5T4BA 5CBKA 4DDVA 1WR8A 2OSBA 3FMPB 1REQB 4HATA 1M2GA 4RYLA 4ND1A 4HUJA 1XALA 3EF3A 3HNPA 1F6BA 4H6WA 4RTNA 1WDMA 1XQYA 4EELA 1NW5A 3ABIA 4LJKA 2YRXA 4G0YA 4JC0A 5HQJA 4H1UA 2KJQA 1DUSA 3L8YA 1Z25A 4ZC8A 3GUHA 1VMIA 4H3VA 3NEAA 3SOPA 1UBLS 1T0HB 2XUZA 3F7MA 1GL7A 4GBMA 4KI7A 2C4KA 4KQHA 5KTMA 4QPPA 4DB2A 1TKAA 1T4CB 2G1JA 2CXRA 1CDOA 4JV0A 1RPJA 4IF6A 1BVSA 1VBFA 4OOFA 5KS2A 1NMXA 5TMEA 3W5CA 1QC5B 4MVCA 5B7NA 5A6VA 3EIWA 1UOEA 1DFHA 2GPSA 1HDOA 3P5BA 4N6GA 4BKOA 1C8VB 1KVSA 4G81A 1ZD8A 5FKJA 3C1AA 4DJAA 2HCTA 4K4IA 2CDRA 1N7JA 2KW5A 1PK3A 2PXHA 4NDZA 4RHTA 3TLBA 3MXOA 2BFEA 2A9JA 3G02A 3WLSA 5JRDS 3L92A 2GN8A 2R85A 2IYYA 5LZ8A 2C28A 1DKPA 4ZA2A 5CDUA 3T1YB 1Q95A 2GX6A 4ZCQA 3V1YA 2Z8YM 1NUPA 5JR3A 1RWPA 4PLCA 4M60A 2NUPB 4D6PA 1R6XA 3MWJA 4KTQA 1Z07A 4GH5A 2O8CB 1FMTA 5BSKA 5HQ3A 5HKAA 2EP8A 3FB4A 4DEZA 4PHDA 4RO0A 1FUEA 3UHAA 1D2MA 1XLUA 3TTYA 5HWSA 4W5NA 3H1BA 1JLKA 3L02A 3D1LA 2WAXA 3KBOA 2NM0A 3M5WA 4O25A 1W29A 4IXNA 1T2CA 3SR6A 1AX9A 5A6SB 5DNEA 4EKIA 3OP1A 4L6AA 4ZPJA 1QV6A 5IBRA 5HP4A 2W2MA 1E2FA 1DO0A 1W9HA 3DVSX 2F8KA 4IRMA 1AN9A 3NI2A 4QQ8A 4PCVA 3ZV6A 3L0BA 4F2RA 7REQA 1WXWA 4G0MA 4KIFA 1W0KD 4DSOA 3H5NA 3LT2A 3PF9A 3MD0A 3V4ZA 2QPTA 3PQDA 1VZ2A 2IZ7A 4HQ0A 3WSTA 4YAIA 3TLXA 4V3CA 1Q16A 1ZK2A 1GLGA 2PJDA 3RC3A 3EY9A 5J4KA 3KKAA 3DZBA 4DOBA 1YRQA 2PQ6A 4B3JA 3PUKA 3PJDA 1IN1A 3RFXA 1Q22A 1G6OA 2XE8A 2XYGA 5LQNA 4DCGA 2NT3A 2VHVA 1M2OB 1EVEA 2Q4EA 1NLMA 2AC4A 3JAKB 3RWOA 4BLQA 5KQRA 3IQHX 5DHPA 5FWXB 3UKJA 1X77A 1MXFA 2J67A 4HMQA 1YWGO 3LSYA 3THWB 5C8DA 4FCTA 2BIFA 1NNI1 4N3BA 2P2SA 2FTKE 3GROA 3MMZA 4QKQA 2C9DA 4YRBA 2ZS7A 3UT6A 4HNVA 2YB4A 4CM8B 5TY0A 1E1RA 1WCIA 3IJRA 2FUEA 3WP1B 4KPEC 4GKKB 2WWIA 2Q4BA 1CUCA 1OF1A 2MOKA 3H1GA 4MYSA 1L3IA 3VMFA 1MO3A 5KSWB 4KXFB 1YOBA 1IMOA 1QG6A 3WBJA 3IP5A 3EMBA 1HK7A 3FZEA 1C8KA 3F2CA 3ORHA 1QJ4A 3A4LA 4GZMA 4A03A 4ETNA 1N5LA 4MP8A 2JASA 5JXGA 3TAPA 3I3OA 2V5AA 1OT3A 2WIFA 2IXAA 1EUDA 4HLUC 5BR7A 1UAYA 3RFUA 3KEOA 1PZMA 2VQSA 1U0NA 3EGIA 4KXQA 2XVZA 1CQPA 2WJ3A 3A9TA 3IMKA 3OM1A 4PAGA 1JIHA 1U0LA 4U39A 2MRLA 2QYHA 3FNRA 2X0EA 1C8LA 2FG5A 1W4AA 2GB4A 4QRDA 4RKEA 1NW6A 4QNNA 5ARBA 4F4CA 4DR3B 1IXYA 2XUQA 2DERA 4QE3A 1BWQA 2DU8A 2OCKA 4R2IA 1W96A 1YBHA 4M0LA 1XFAA 4FNAA 1KO5A 2Q1YA 3RHFA 4ZYWA 3OEHD 2WYHA 4AYBF 3SICE 1NMEA 3DVAA 3SJZA 1N0WA 1CY4A 4YQYA 2MMGA 5AVWA 1F9EA 4O4JA 4DSKA 1GUDA 4YP7A 5J2UF 3RAJA 1P0IA 5IM5A 1CUBA 3H0RB 4ECSA 5AM4A 3BE4A 1Q92A 2K60A 2QRZA 4OHBA 1C4OA 2YOFA 2GZSA 3IMGA 3EBOA 3GN1A 1UZUA 3I1IA 4N0EA 2XB2A 1HX7A 4B79A 1UBFA 3I04M 2V7QD 1Y6FA 3GHHA 3GGCA 1HLGA 1E3SA 3VR5A 5FBHA 1BFDA 1HSOA 1YK1A 1Z7GA 2R48A 3RI3A 4L8FA 1I6KA 1OZGA 2G4VA 4PYIA 3W3AA 4IS2A 4F6CA 4NXMB 5CCDA 2R84A 4NMWA 1E2HA 3QZ8A 2ZQZA 1A98A 1U8EA 1YCDA 4RWZA 4AJHA 3BD8A 4NQRA 1NNLA 1G6HA 2GCGA 2P9QA 2Z9CA 3QPVA 4YB8A 1PLKA 3DMYA 3PW2A 1SA0B 3PGA1 1FDTA 1BX0A 5AUQA 1KOGA 3FPJA 4JIGA 2XE7A 5H80A 4BFCA 4BWGA 1Y89A 1HM5A 3MD9A 1G20E 1PE0A 3NVDA 5G40A 2Q49A 5BXQC 4KLQA 3PXDA 3I34X 2X7XA 4DC0A 3URKA 4DM7A 1J2RA 3EGCA 3L4BC 5A3JA 1R8JA 3PD7A 2JJ2A 4PPNA 3TFOA 1KEUA 3U7JA 1IOZA 3I32A 3U16A 4HVTA 5BSVA 4DNFA 3R7BA 3Q0TA 1MZPA 4MEBA 2LBPA 3V97A 2KBEA 4ON9A 5DV9A 3MWDB 4WXMA 1J2EA 3O75A 2MYNA 2N1MA 4FFRA 2JDIA 4AG6A 4F6LA 4D81A 1DI0A 4MA5A 1NR1A 4A0QA 1NOMA 2HB6A 1KY4A 4PPQA 4RL6A 3I2KA 5TQJA 2FLKA 3ZDEA 4R71A 2VUTA 3NHAA 5DBAA 3AF4A 1ADYA 1DWQA 3GFBA 4BV2A 5M04A 1F3LA 2Y1IA 4BMVA 4MGYR 3DV2A 1PZEA 4FWBA 3GRAA 2RI0A 4OOEA 5JVDB 4A6DA 3OC6A 4PM4A 4QATA 5DHSA 1FQJA 2RI6A 1LEHA 2ZR9A 1FLNA 2QSJA 2Z8YA 3CB2A 3G9ZA 3O1JC 4OBEA 2F3RA 4XASA 5TJ9A 4TQ9A 3TD9A 3H5LA 1YDHA 3CUWA 5AUPB 2JLXA 1E3MA 3VO9A 3WJ1A 3SSMA 4A5OA 4MARA 1Y0BA 3F3KA 5D5HA 2A88A 1ZJJA 4YI5A 3SKVA 3VPFA 2KHVA 1DCMA 2LKDA 2PH3A 1GYPA 3BFVA 3C6ZA 4XKJA 4D6XA 2WKQA 3FYUB 2E4AA 4CNBA 1UJ6A 2HUPA 5K0JA 1KEKA 4X5VA 3T0IA 1Q12A 3BFPA 3NHLA 2RH9B 2VTVA 4LSWA 4MV4A 2CFSA 2Y0DA 4ONEA 4QUHA 1FSFA 5DGTA 3TVYA 1GSHA 1R9GA 2VDWA 3TMKA 3RVMA 3BK7A 5I9SA 2D1YA 2HKIA 4R2WA 4TM7A 1FFHA 1TZJA 1VFNA 4DFDA 4I7EA 1J99A 4YJ2B 4MCHA 3MJFA 5DDYA 1NFFA 4CKXA 3AR2A 1LW7A 1OLOA 3TEMA 1YRAA 2ODPA 1PR4A 1R3DA 2R7MA 2IUUA 4ACAA 4GI7A 2FZEA 3HPRA 1U3VA 5KMGA 3RHTA 1QGDA 1D3AA 2WUEA 4QARA 2WM3A 4D99A 2NSDA 3I76A 2K8CB 2NW6A 3TD2A 1Z13A 5FLEX 5FUWA 2AI2A 4JR1A 2VPWA 3E8MA 3PMLA 2JHGA 3L6BA 4AMZA 4MFCA 4CFSA 1AC5A 1YDMA 2H1CA 1QCYA 3RWMB 5K7SA 1DBRA 1Z7WA 3HKDA 1M6NA 4K6FA 1N8KA 1E77A 1IE3A 4BPRA 3NDJA 1YZTA 2YYSA 3EQZA 4H4DA 3R20A 2PBLA 4F2PA 5JJKA 1T6ZA 2YVAA 4ALKA 1KVUA 2QSYA 4MUIA 1L7OA 4MZDA 1YZLA 3W4KA 1BJRE 1A27A 2NU7B 1TYZA 3BKXA 3IVGA 4X00A 4ZU1X 4Q4HB 3UN1A 2V54A 1I0ZA 2KZZA 1J00A 1NW3A 3LQ4A 3R3YA 4C1BA 2GDJA 1G8MA 3DKIA 1J56A 9ICBA 2HNAA 4TL7A 2G9VA 3VR5D 4Z7OB 1CRQA 2J9XB 3CNOA 3MRXA 1Q0QA 2J45A 1HYQA 3CYFA 3AU8A 4OYYA 4YCBA 5D1NA 3TNDA 2PMZF 1DWOA 4LY9A 2C1XA 4YRDA 1PWYE 2HIHA 3UMFA 1PG0A 4Q66C 4TMTA 3AFGA 1TZCA 1YJCA 3FOAA 3CZ9A 4GL2A 2CUTA 4R1OA 5K0LA 2I66A 1SXJA 3DXFA 1IQUA 1R10A 2YN2A 4U9IS 1ECJA 3HT3A 2NO5A 1U0TA 1YBMA 1WHSB 1MJGA 2FWIA 3VVCA 5DBOA 1SKQA 4TTIA 3U1BA 1VLHA 3HWX1 2HMTA 3NCHA 5C1BA 4URZR 2HA4A 2ZCVA 2L19A 2VDJA 1Y63A 2OTCA 4M0PA 1N1GA 3LM8A 2AHRA 4RCVA 4R6XA 1R6DA 4DYDA 4O9MA 2IOQA 4D4HA 4Z7QB 1ZK3A 2IVFA 4BMXA 4KXXA 3OUUA 4IS7A 1OAOA 1CIPA 2HSEA 2PBZA 2L69A 1L0BA 4PE5B 3CLRC 5DWQA 1K9VF 2YH2A 2MYTA 1I1HA 1AUXA 2FY8A 1RD4A 2J9YB 1E9AA 3E9QA 3R7NA 4YY3B 2G04A 3IAHA 1LS6A 2GM9A 3OOSA 1OIVA 2YNMA 4FU0A 2C78A 3GFGA 2OXIA 4NULA 2A0XA 3L0DA 3RLIA 3SHFA 4MYCA 1YS9A 1U2GC 3V8PA 1TA4A 1WW8A 2YR0A 3TLGA 3HWWA 5ICGA 5IVHA 1FNMA 3QMVA 4J6EA 4IJUA 3J7TA 3HCOA 4RD0A 3U9TA 1QP7A 5FUXA 2GESA 1SAYA 3H11B 2Z8XA 1QCKA 1KK2A 1QORA 3O4IA 4GAEA 2H2DA 5EVCA 3OTOB 1B73A 1MKYA 2J0SA 5KWVA 2KI5A 2LM1A 4W5RA 7ICLA 3EG9B 7ICPA 3N7RC 1N7HA 1POWA 2EIHA 3DEZA 2FOLA 4P4UA 3H3JA 5AHOA 3PHIA 4BV8A 3TXXA 3HJHA 4HNHA 1QB7A 3AB7A 3AIMA 3GJ7A 3G2KA 4ICIA 4UZFA 5I3CA 1JAIA 1ZW1A 5AM1A 2ZOSA 4D80A 1L8QA 2F17A 2O2EA 3N3BC 5LQSA 1B0UA 5FH9A 3IUEA 5SZHB 5K8VA 3VR4D 1HIWA 2JEGA 2E4XA 2OCXA 5ALLA 1SRRA 2RGBA 5G41A 3A0HU 2OCGA 3F9IA 2J3HA 2ATXA 1GGFA 3EMVA 4S1PA 1E2GA 5FA6A 5DQIA 3TLJA 3ZDZB 4EHKA 2GAFA 3DFIA 1R9MA 5LFAA 1RAEA 3AQEA 5HUHA 3ABZA 3TB6A 4JP1A 2GJ4A 1RW4A 1T36B 5GJBA 1S02A 4JC4A 2KJ8A 1TK3A 2PKWA 3BWXA 3QEJA 4K8RB 1DGJA 3JQ9A 2G0NA 1XRLA 2B5OA 2DAPA 4MKRA 4RV5A 3IVRA 1Q57A 1SHLA 1JW9B 3DMTC 3E1KA 4URYR 1EM6A 2ERCA 3EVGA 1FFVA 1CEXA 2ZRQA 4IINA 4ZVMA 3ITKA 1RS0A 4PHPA 1KZ4A 4WINA 1FX0A 3C5EA 1W25A 3IG5A 2F00A 2YJTD 2K87A 3I1YA 1OZAA 2B61A 2ZVDA 3K6JA 2ASEA 2BEVA 4MV6A 4TYYA 4LDQA 4LNAA 7MHTA 4L4RA 1NFRA 1XVIA 1ZINA 1BCSA 1P1JA 3RJFA 3O84A 5JXJA 2ZWPA 3BA1A 3VOSA 5COBA 1T6NA 3L6EA 3LY8A 2VYVD 4PS1A 1CZUA 5KFNA 1P9RA 3FPGA 4CEJA 3D8SA 1M8FA 4GZ6A 5EC8A 2BMEA 3JPNA 3GJTA 4HH0A 4HX2A 4M1SA 3DE3X 2EG5A 3CZMA 4MO2A 3KQMA 4I6GA 4JY7A 4ZAXA 4NFYA 3P2MA 3OTGA 4HAIA 4RTKA 5FBQB 2FZWA 1TNDA 4RXUA 1NG1A 4UU1A 5CNKA 3AM9A 4YPVA 2VDLB 1VHTA 4ZDIA 4BLTA 4NARA 5A7FA 5BW8A 3MILA 3RTGA 1EJ2A 4LYFA 4DA9A 2YNMD 2OESA 4MFFA 1K8QA 2ZRNA 1IU9A 3AESA 2XSZD 3I9FA 4FNMA 4G26A 4RQBA 4LUCA 4RSRA 4DIFA 2O8FA 1WW3A 3PKIA 2CXQA 1BJKA 3NQ41 1TM4E 5JMTA 2JEOA 5B6JA 1SBIA 3HUDA 3U4QA 4DUPA 1Z2CA 3W6NA 3R7WB 1N36B 2HU7A 3TR6A 4P7FA 3BHJA 1MW9X 2XECA 3GLTA 4TRMA 3HJAA 1YF3A 2Q6IA 4KVGA 4MVJI 1IJKA 5KG2A 1R0SA 1X42A 3PICA 4OAQA 3NNDA 1X0VA 3IE0A 4Q3AA 4ZOLB 1SZCA 1SELA 3CISA 3NP7A 4Q9LA 5H5JA 4PYJA 4YJGA 2ZK7A 1JFFA 3ROPA 5ISMA 1TC1A 3D3WA 3IJ5A 4BNMA 3GIDA 3V7YA 1U80A 4NFLA 2C2HA 4AMUA 2W7OA 4G09A 1RLJA 4OREX 4YRJA 3AKZA 4XUCA 4XR9A 4CDGA 5CT6A 1HZJA 2P6RA 1ZZEA 4CCYA 5FNVA 1ZYQA 3ZU6A 1MB4A 5EMLA 1LBSA 1NC1A 1H2AS 2B5WA 2JZOA 4KLNA 4YAJA 5C5JA 1C3LA 1ZESA 1U1DA 2YS6A 4JL5A 4QOSA 2OHXA 2C29D 4WOJA 4PTLA 3ZXXA 1W36C 2R8JA 3O8DA 1H9CA 3GP3A 4F2DA 3DTVB 3MXTA 2Q4TA 2EYQA 1M3SA 2PBFA 2XYRA 4PSKA 3D2QA 2HSGA 2QE7A 4TLAA 1TUIA 2ATVA 2VTKA 1Z4IA 2QJRA 3HNOA 3HYCA 3HYSA 5JS7A 3KT0A 3HABA 1D0VA 1AA9A 4G0UA 4XGKA 1LZLA 5YASA 3VC1A 1O94C 4HJRA 4JI7B 4DSFA 5KOHA 4CN8A 3DGFC 4CQJA 4Q21A 3Q3JB 2ZJ7A 5GP1A 1N5KA 1J2MA 1XT6A 2IQ5A 3I53A 2J6BA 2JW5A 1YNOA 5G0VA 1W581 2N42A 2P2DA 1QHHA 2AVDA 2BTQB 1RXVA 5BV0A 5FULA 2YWRA 2GT1A 3BWBA 3U4MA 1AUOA 2CE7A 5E1OA 1YKSA 1ZD3A 3DAFA 2IW3A 4YRGA 1MDBA 4O02B 2PHZA 4P7BA 1I4WA 2BBSA 3VZBA 2W6MA 4MS3B 1JWBB 4ZJPA 3E1GA 3MT7A 1PNQA 4RLFA 1XWLA 5JDIC 3Q3HA 4UU8A 4F1WA 1DC8A 3NM6B 3B1YA 3FRIA 4KO8A 4PC3A 3N9IA 7ICJA 3TQCA 4ITRC 3DAYA 1R50A 3ZGOA 1KJNA 1O9BA 2TYSB 3AF1A 4D3ZA 2FFBA 4MQ6A 2VDPB 1FRZA 4ZMSA 2V4RA 2CC2A 1W0JD 2JAPA 2Z5LA 3B70A 1Y5RA 1Z5VA 4E5KA 1DFGA 4RESA 4PYLA 3PXCX 5E3IA 1X74A 5F9LA 4HV4A 2PH7A 2XKAA 5EP3A 1WXHA 4G1VA 1RWVA 1I13A 1ETHA 1IAQA 4JMUA 3R5XA 2W83A 3QKRB 4BHTA 3CVXA 4E4RA 2PJRA 4ALMA 1SOMA 1CR2A 3TPZA 1FU7A 4R63A 1EU1A 3JWEA 4ED8A 4LYYA 3ZDAA 1PFQA 2OD7A 4P7KA 2JG3A 3RBDA 2AW5A 2X2EA 3HVRA 3ORQA 4HEHA 1NXVA 3ZDQA 5ALVA 3R6DA 2JCXA 4EFDA 6LDHA 1A5ZA 3T5CA 5LR6A 3DFFA 3K6SA 2I6SA 4D9FA 3LPAA 1PZFA 1I7SB 5F3WB 2NV2B 2C4UA 3PHGA 2I4IA 1SC3A 4P33A 2BM8A 3GLFA 5C7OO 2NZJA 3BEDA 2LYHA 1BIFA 4ALJA 4C0XA 4DSTA 4LIPD 4O5AA 1SXJC 1MJGM 3KZOA 3VDRA 4D57A 2ZRBA 4ZO9A 5E6SA 1JHRA 1GCGA 3GBVA 4Q1EA 5K3CA 3AR7A 3FJOA 4BDSA 4UBNA 4YYZA 3MBYA 1NRIA 5KYGA 2HYDA 3U4AA 1ZM3A 4O4IF 3SR4A 1V5FA 4RXMA 1J0XO 1QFYA 4GRIA 3GLVA 3EOAI 1JPJA 3UB3A 1ZQZA 1VI2A 4CQLB 1UWKA 3ZGNA 3OSPA 3HZZA 4P2GA 4KOAA 1E99A 1SZPA 3RIYA 10MHA 3QIVA 5EWMB 3ITEA 5BO5A 3ZVNA 5IANA 5AKXA 5ALEA 3KQWA 1XZAA 3QA9A 4ZEOA 1XX6A 3L06A 4J6FA 3IIKA 2M6KA 5LLTA 2WYUA 3EVTA 3L04A 2OVBA 4YAFA 1NBMD 2RB5A 2GSWA 4MPTA 2EOAA 5ALPA 1JG3A 1YZFA 3Q9SA 4Q15A 3ZHQA 3MS2A 1L8OA 4MUBA 5FWAA 5J63A 2GXAA 1XMIA 3D64A 4IXWA 2YYZA 3PD0A 4QM7A 3CNNA 1VLQA 3L4JA 1PEKE 1IN7A 4YJGB 2JGAA 2ZG6A 2QVGA 3GT4A 3V7NA 1U3DA 1LFDB 4UZSA 4Q9JA 3ZZ0A 1W19A 4FP9A 4GPEA 4NCKA 2IZ6A 4KU4A 2NMVA 4LEIA 2UXCB 3CF0A 4CR6A 5D4BA 3D4NA 2GNAA 3WSWA 5U9CA 3E22B 4DRYA 2C9YA 1H6BA 4MRSA 4EGQA 3Q8PB 4G97A 4YVFA 5JS8A 3R7WA 3G2MA 1EBBA 1YONA 4FGKA 4ZOCA 3V72A 1NLYA 4RENA 5KTYA 1RNLA 1VPTA 1KP9A 2D5LA 3F7NA 4IJVA 2CXTA 3LO8A 3PSIA 2IYAA 1BDMA 4I2EA 3WL6A 4YMUA 1U0RA 1CJKC 5CB0A 3FHTA 1NVKA 2Z3WA 2Z83A 1X7HA 1J25A 2OY0A 3PNQA 2GA9A 3UCFA 4GEKA 1AS2A 1NMSA 2BBWA 3C6QA 2W93A 1THZA 1YVEI 4Q37A 3GXOA 2H0RA 1EVIA 4OBWA 4OTZA 4C6TB 3E70C 1GNPA 4M1MA 2OC9A 3KAJA 3ER6A 4MR9A 4FDUA 1Z7EA 2IUSA 2KE7A 2PL3A 4MMYB 2H5JA 4PHCA 4OLJA 2C2ZA 4AUMA 1RHMA 1A8UA 4C7MA 1N2HA 4DGQA 4IDPA 2Y6VA 1FJHA 2GCOB 2PUFA 4CGZA 1M8PA 3CS3A 3G1UA 1VHJA 3OM9A 4Y2PA 1V41E 1M2VA 2QJFA 1HMYA 1WP9A 2EJWA 4FGZA 4JJ6A 3TW6A 3ZE7A 3BE5A 3W4IA 4S1NA 4E32A 2HGSA 1PLLA 4BS9A 2WD7A 2WTNA 4QZGA 2NNWB 1EDZA 1K89A 1RJ9A 3IX7A 3K8YA 1OFTA 4G4SP 1KYYA 4EJ6A 2A1TS 3UJHA 3N7PD 1FXUA 2WJWA 3QLUA 4KREA 4PNHA 1NXSA 2W2PA 3BWCA 1QZZA 3J7AC 2AQ0A 4XYGA 1Y1QA 1QX4A 2RC5A 3W77A 1PQYA 3ZWVA 4DCNA 1AXRA 5AJYA 4DQVA 3QBEA 2QVXX 1H4QA 1N6RA 1R8YA 1ZCZA 5LZ7A 3TQFA 4HZGA 2REXB 4LRYA 4CIDA 4QZCA 1PV1A 4JUBA 3CSDA 3SJBA 3BX1A 1SV0A 4NXZA 3Q8XB 3AF5A 1ZGBA 1VDMA 5EMNA 5H3CA 5IJ0A 5IKPA 1VZ3A 4CDNA 3VO2A 1Y3FE 4UQLA 1A95A 1PL6A 3PHCA 1ECWA 4LDPA 3U0VA 1RWQA 1RACA 1ZRSA 3UG7A 4L3OA 3QVMA 5FUMA 1MAVA 1H4SA 3Q40A 4Y98A 5I7FA 2XY7A 1GGVA 3MGGA 1ORTA 4K86A 4CQMA 2Y4OA 3B1ZA 1TQ6A 4M8LA 1KR2A 5U1PA 3SAGA 3UMRA 2MYPA 3BYZA 4OU4A 3PLNA 4WLOA 5AXAA 5BW6B 4BX0A 1ZD4A 4K0RA 3UVEA 4GIBA 2GF0A 2WUVA 5JCOA 1WJGA 1FYXA 3OZFA 1UKYA 4B1FA 1O7JA 1WBDA 5JAQA 2ZBRA 5KFMA 2IA5A 1IK6A 3FDFA 4AZ3A 2PR2A 1JU9A 1SVSA 4XGNA 3WGJA 1UBUS 1IQ0A 3X44A 4ASUA 5BYBA 2P90A 2FPGB 3KEFA 3L7BA 1E5DA 1NM5A 2BKXA 2Q5FA 3D8HA 1ZLYA 4HRYA 4XYEA 2XIJA 3AEVA 3QX8A 4IIFA 3P97A 1JG7A 1QDEA 2WF9A 1AK1A 2Z43A 3N0WA 3QJ5A 4J7AA 3UIEA 3VZCA 5AI8A 1ESEA 3UWDA 2VZEA 4C20A 1FE8A 5C4IA 1GAEO 4EGJA 7ICQA 3R6TA 2D4AA 4FDTA 3OEYA 2F4NA 1KI6B 1TKCA 2ODTX 3EQ7A 1B0ZA 2LNDA 3NDIA 1I6LA 3SQLA 4BQQA 3EZGA 1J2YA 3H19A 1RPZA 4IRKA 3FMVA 1EGAA 2PBRA 4J0IA 1SU6A 1SC4A 2ZJ8A 2OPBA 4O3PA 4LSMA 3O8RA 1Z12A 4KO4S 4BBZA 4C7KA 2P4HX 4EYEA 1ODIA 2D3WA 1KAMA 2Y1KA 1AE1A 1C9DB 1L5SA 2VJNA 4KXUA 5ESXA 1HEIA 2JJYA 4CLRB 3LK7A 2B8WA 2YW2A 3HRHA 5FL3A 5GINE 2ZANA 3HILA 4J1TA 4L8WB 1ID8A 5BQ5A 1L7PA 1OFHA 3ENNA 3PC6A 5D85A 5AO9A 2IDZA 5IULC 3JRWA 4ZN6A 4YIKA 2WINI 4R0MA 2I4LA 3TXYA 4EY4A 2HV9A 4QUKA 1MA7A 3SHVA 5KFDA 1IATA 4AWAA 1BU5A 4IEIA 1IIRA 4GUAA 5CH5A 1JR6A 1K7SN 3ZGVA 5FUVA 4PAQA 4GMKA 4C3OB 3EZNA 3TSWA 1Q46A 3BS5B 3DOFA 4HAOA 4O4JF 3SZGA 5AVVA 2R8EA 3ZN2A 1I6WA 4UVEA 1UC9A 5DN9A 3KPWA 4IKEA 5TX7A 4ZI7B 1O2DA 4GXNA 3CMCO 5F52A 5MFPA 2ZDGA 5BMVA 1G291 2VF8A 3TO5A 4A2WA 4QUGA 3ETEA 3WFZA 2V4ZA 5HBRA 3NC0C 1MAWA 5L6MB 2ISOA 3ICXA 4TKLA 3UJAA 1AHIA 4DJDC 1PR0A 3LX4A 3LUJA 1SK8A 3I0ZA 3MS4A 4QSMA 4IQVA 3Q8RB 2RBGA 1PQ4A 4EECA 3EQ2A 3AYZB 3L0ZA 3SVZA 2QVZX 1TO6A 2BMAA 1JTVA 1GXSB 4D44A 2HMYB 1EZ4A 1AK2A 2J9FB 5KYUA 2CNKA 2XTZA 5KYYB 4DL2A 4C7JA 4FOSA 3VNVA 3RAQA 1SFRA 1P1RA 3BS7A 4BP8A 4U7DA 5LKAA 4AP9A 5KFAA 1LTHR 2BCEA 3LIIA 3PFKA 4F2HA 5JBIA 1YQQA 4PSUA 1B14A 1RPNA 1VYHA 4J94A 1M76A 3G2LA 1SVUA 2O3SA 4HN4B 4YFVA 4W99A 2G70A 1E96A 1ZUIA 2VCYA 5BMOA 4LGVA 3SBOA 1JZSA 3OQMA 3F71A 3EF0A 3BK2A 4EJMA 3Q5EA 3G8CA 2KSQA 3RF6A 4YMGA 2X13A 1ZOPA 3ZXYA 3HB1A 5KO2A 5BN4B 5CLIA 2EKPA 6REQA 3JSAA 5H4GA 5F4ZA 3PHLA 2AN1A 1YZQA 4JB2A 4ZQIA 1PJQA 3V1MA 1JHYA 1XEXB 4XIIA 2G6BA 2HSZA 3HXMA 4JROA 3ROEA 1B93A 4RQTA 4DCTA 5NLLA 3H5AA 5JY1A 3P5SA 2J87A 3TLMA 1FJXA 2BR0A 2LGJA 3QFRA 1GA4A 2HRQA 2R6GA 4IW3B 5F3RA 4NG5A 3CBGA 4NOMA 8ICMA 1XQXA 4UQPA 4EBDA 3K16A 4BLUA 1E94E 4E21A 4TSRA 4NLGA 4I27A 1Y7LA 2GM5A 4P8RA 3W5DA 3GQVA 3V4SA 4LPKA 3E7XA 4GNRA 1UEJA 5T8KC 1EK2A 4HN9A 3IE1A 1GTRA 3UB4A 4G4IA 2AG6A 5AKYA 1GUYA 1TEXA 2P2ZA 2XBLA 2XYQA 3R6GA 4TVBA 5I47A 3G0BA 4GZ3A 4PC1A 4BFYA 1WB6A 1JN3A 4J7CA 3MOSA 1E62A 3NVAA 2UVPA 1QAOA 3AEQA 2AFHE 3BFJA 4UBJA 1RQRA 2IYUA 3ICOA 3DULA 1GN9A 2IP4A 2I1WA 5JU6A 3RE1A 2VA2A 3CNQS 5F7XA 4HWTA 2E37A 1A4RA 1JHAA 4JU8A 1YCHA 1RVV1 4DEYA 1TZKA 4UREA 5CJPA 3CXUA 2AKAB 8ABPA 4UFNA 4NOLA 2IPNA 2PWBA 3PFCA 5IIMA 1VE9A 3VR6A 4MS1B 4AJKA 4I2JA 1UBRS 2XTMA 3MMPA 5C2JB 3WSVA 2O1SA 3D9QX 5BPCA 1ULHA 3ZR4B 3AQ4A 1RBQA 1P1HA 2WTBA 4NNPA 4EY5A 4QJIA 3WLQA 1ZGHA 5EE5B 4RIIA 3R4CA 2XBUA 4YR2A 3PSAA 1Y8QA 1VXRA 1Y7HA 4OGFA 3WYCA 4D1YA 1T43A 5LLDA 4ZYLA 5FNVB 1F0YA 1I14A 4MRMA 3X1KA 4LJYA 4WY8A 4Q8FA 3PFWO 5T14A 3D54D 1Q91A 4DOAA 3QM1A 4TQGA 4ZO7A 4GYJA 1LBIA 1XK6A 2AZMA 2QPOA 1GLVA 4WLFA 4ZOAA 2FN9A 4BMCA 2WEKA 4L1KA 1I2ZA 1LK0A 1XRJA 4PWZA 4LHZA 1R8SA 2RSLA 3KB8A 4V0NA 4YAWA 2CV2A 1M2FA 3OOHA 2J31A 1F17A 3LW8A 1WTCA 4KFCA 3BHMA 3NEYA 4JOCA 3KFXA 5HJ2A 2VAPA 3IPYA 2CUZA 4HGYA 3T7DA 4I9GA 4TUSA 4JP3A 3NEPX 4LCBA 1W88B 2VOEA 4ZREA 4DQDA 1KEZA 1XRQA 4DLNA 4TUPA 2Q2NA 1C7YA 2Z30A 1C0EA 3U4QB 2PDAA 3IUNA 1VJDA 4KIUA 4HFJA 3EY4A 3PC7A 5IH3A 5SYNA 3PXGA 3R8FA 2MSLA 3P71T 2FPMA 2ZGVA 3EPHA 1F38A 3CTMA 3FMGA 2VP4A 3PFIA 1NV9A 2KD1A 3PWZA 4KR2A 4Z4QA 2F76X 3F5SA 1OGYA 3T0GA 3ZE2B 3IT2A 3GPIA 4FT2A 5JQGB 3GGSA 5BURA 4M86A 3NBZC 2GPTA 3FYUC 2HF7A 3SKYA 1O6CA 1PJ4A 2X5KO 3NANA 4FYYA 4Y6SA 3LQKA 4YMVA 3PRKE 1X7DA 1UBKS 1J22A 2FN7A 2H4XA 2Y1LA 2ZEJA 3PUZA 4MGHA 3V4RA 3KYJB 1YJBA 2P0YA 4KXLA 4JGIA 4LQLA 3OHBA 1MEOA 4TYPA 3TJZA 3GFTA 5LPNA 4TRNA 5L7TA 1VFPA 3B12A 3DFUA 1OLXB 1PS8A 3MQ4A 3MTBA 4J7XA 2ZRCA 3WL4A 3MW8A 1J39A 1WZUA 2Y2UA 4ZQGA 2PZGA 1OBHA 1F5NA 3HKZC 1V16B 1XLTA 2CLCX 3D7KA 3R5JA 4BRZA 5A2GA 2R0QC 4JYAB 3L0IB 1NF2A 3CLHA 2TMGA 1TJNA 1QPGA 1WLYA 1JG2A 1NATA 4LC1A 2IX3A 2HWYA 3I2JA 4I55A 5L4SA 1T3LA 5CM9C 4CMBA 4NONA 4D9JA 5J2TB 2DSTA 2W4MA 2BSAA 1ORHA 4BX3A 2NVOA 4Z0HO 4HNRA 4MKGA 3I9JA 3UXYA 2R7NA 1SU4A 4A1FA 2QBYA 2QMQA 1LB2B 3HEAA 4HDNB 1Y5IA 4ZVSA 3QV1A 3R7LA 4F5PA 1U63A 3ZW8A 4L8YA 1TLFA 1W4LA 3ILHA 2GN1A 1PFGA 1PT6A 3S68A 1GITA 4AUKA 3V2UA 4A8JA 4AU1A 2D06A 3E0XA 3MYYA 4M3NA 2ZYGA 4MK4A 4ARAA 1T4GA 1UXGA 5GTHU 1DAKA 2CKDA 2YMQA 4EY8A 5KFTA 3S81A 1GARA 4P32A 1N3LA 3RYCA 1IXKA 4BDPA 2I6UA 3L5OA 4NATA 1IDOA 3TRDA 5F23A 1XWWA 2AHOA 3DFKA 4MW4A 2FPIA 5DHAA 1T1GA 4F60A 2OL4A 3CPHA 2PGAA 4NC9A 8ICWA 3TPCA 2Z98A 4NK4A 1P4AA 3QIAA 1GPWB 1UOQA 3O1IC 4YJHB 2QPLA 3PLAE 4NMMA 3PK0A 3HU3A 1XYYA 4DMCA 2YWBA 3DFMA 4IZIA 1GSAA 3EE6A 3ZDDA 2P4SA 4G23A 5HG0A 4YD1A 1PR1A 4G9BA 3BAZA 1NR5A 3FRJA 4BO9A 3H11A 3STHA 1XFDA 4ZMRA 1I7LA 4RKRA 2Z6QA 2PFGA 3QLJA 2BPGA 2P1ZA 2XRYA 1AMNA 2O0JA 3AHDA 2BQRA 5TEWA 3IODA 1JIKA 1PUIA 2WFLA 3GFPA 1A9YA 3RABA 4RTPA 1XSNA 3N86A 4CKWA 5EPOA 4QUDA 3D6TB 3AZPA 2Y0PA 3B1JA 3RB0A 3CLSD 3DBLA 1OE0A 5AW4A 2ZBGA 2YBDA 4BVLA 4I8DA 3U44A 2XVMA 4KNYA 5HOQA 4FBTA 1N78A 4DPMA 2EXXA 2AU0A 1YQGA 1D03A 2H92A 2PLRA 2VJOA 1SUPA 1Y37A 2YV1A 4OBXA 5COQA 1P1KA 3TE6A 4ND4A 2QTCA 4ZYUA 3L2OB 3B36A 3ZCVA 4DFJA 2JCYA 4BMZA 4EKDA 5CEEA 2GRAA 4XB6B 2ST1A 2XNJA 2XDWA 1YS2X 3GWGA 3NJRA 4BNDB 2H63A 4XCXA 1B43A 1Z1BA 4COOA 3MWLA 2PNJA 1NKCA 1WMBA 7YASA 1Q7RA 2H4FA 2N47A 3IIEA 2AYXA 1S5LU 2DQZA 5BOSB 4P2BA 3FYHA 4UB4A 2FW1A 2O4UX 5KC9A 2VNKA 4N3NA 4Y0AA 1AXGA 4KCGA 1LPAB 2XJ4A 4QHYA 4X0EA 4R41A 1WA5A 4WNIA 4B4OA 3DZFA 3UY4A 1TJ3A 4EKGA 2FWRA 3DV9A 2IHTA 5FWNA 5DASA 4G4JA 1NI4A 1P0MA 4HGNA 4DQXA 3ZD7A 3OWOA 3H8SA 5JFGA 2BSXA 3LLCA 2CLFB 3A0BU 1PL0A 1NZBA 1N2CA 4FFMA 3K0CA 2DUWA 4CIYA 1JFVA 5KX5F 2B1QA 2IE0A 1D9DA 4XAQA 8ICCA 3D3QA 5BQFA 2DWOA 1NKSA 1W47A 1I30A 2IDKA 2K7ZA 1OFUX 3D8UA 3QITA 4DMUB 4EW3A 5JNRA 4EM6A 3HR8A 4UFOA 5AJHA 3CN9A 9ICNA 3VPSA 3IXMA 4M53A 3EMDA 5AKIA 3L8ZA 4C0JA 4EDFA 1D9XA 2FGJA 3T5PA 2D6FA 3JPPA 3NH9A 4C6RA 1N2ZA 2GEFA 3PW4A 3JWGA 1DAEA 1SOAA 1TA9A 4PHGA 2QAGC 2WTUA 3ZVRA 9ICQA 1Y1SA 3IDWA 3BWVA 1OBOA 1ORVA 3FFBA 4WOBA 3E5NA 4YCCA 3ZQ4A 1M33A 1D04A 2Z3ZA 4ALNA 5JHGB 3P4UA 3AO0B 4C14A 5CBPB 4PS0A 4QFCA 1HDYA 3MNFA 3GV7B 4QX6A 4AYXA 2B6HA 3OECA 4J9NA 5LQJA 4FBUA 3KHRA 4RS4A 1YR8A 2XDYA 4J16C 1DLIA 4IF4A 4AF6A 4AF8A 5BRNA 2YMLA 1VHLA 1DOAA 3LECA 4XEUA 3T61A 1U3GA 3GIJA 3OIWA 4DG9A 3O9MA 3EEOA 5KOJB 1U7DA 5C18A 5DK6A 5CA1A 3SVTA 1U8ZA 4KLMA 3THVA 1H94A 2JNWA 3B1KA 3UCEA 4M7PA 1IM5A 2PQ0A 2WMDA 4F8RA 1OI7A 3Q7QA 4F4KA 4BIIA 5AM2A 1PKEA 1J0EA 3ECAA 4FE7A 1L6RA 4GYKA 2CHUA 1U48A 1Z5PA 3PDUA 4F5NA 4OX9Y 3VI3B 1BDJA 2MSDB 3GEMA 4N5LA 2BGJA 1EVQA 1Y7IA 5GGYA 3OT1A 2XTNA 3GOQA 5B6IA 3SEZA 4DDMA 1QGYA 5AYVA 3U81A 3LBIA 2AQ4A 2AKYA 2HOIA 1NXTA 2E3JA 2XSZA 5B7PA 5JAPA 4QPNA 1SL2A 2J6TA 2FZ4A 4Q9HA 5IDWA 5JISA 1JA1A 1A77A 4RJJA 4DEXA 1JIQA 1LKYB 3SXUA 2RGRA 1JSRA 1WXFA 1Q0HA 4E3WA 2JLYA 1FIQA 1Z0DA 2WSSD 4U2DA 4BBJA 4IR1A 4IEFB 4IO0A 4RIFA 4E2FA 4N47A 1FP4A 3C3XA 4DABA 3KKNA 4RJIA 3FKJA 2GZHA 3AOEA 2JMGA 5J47A 4YP3A 3OUTA 4WKCA 4R7GA 5I7OA 3GRKA 1I33A 3HX0A 2G1UA 8ICNA 2AS0A 3BVPA 3O4FA 1MH1A 4IIJF 4XCVA 5KQLA 3OJWA 5J2UB 4TT8A 5DGDA 5IXSA 3JQ7B 1UDWA 3V7LA 5JECA 1L4EA 2FMKA 3VO1A 4PNZA 3LC0A 3NKVA 1WETA 1KYVA 3D6NB 3MWKA 3V4PB 4KSCA 1HDEA 1ZPDA 3ABRB 1K8XB 2DBRA 3AGQA 3Q1KA 4LPSA 1XQVA 4FFBA 1N61A 1NBIA 3OWXA 1ZUHA 2HQSA 2MU1A 1G63A 4MB0A 3VR1A 1N4AA 1NOKA 3VH4A 1DDIA 4G36A 2B4YA 2O2GA 4Q01A 3WGUA 7ADHA 2OHGA 4NI5A 3AF0A 1LPSA 2I34A 3OZAA 4RZXA 3OH8A 1T1JA 4CIVA 2F1KA 4C88A 2IOFK 4DBVO 5HKBA 3KHSA 3H97A 3KD2A 1T1IA 1DRKA 2C2BA 4BBAA 5JJIA 2IEIA 5HZKA 4ZIRA 4Y30A 4I2NA 2IHMA 2H51A 4B40A 3TNJA 4XWKA 5TXGA 3L79A 5A03A 4BN4A 4AFNA 1FQKA 3LY7A 5KFFA 5FCDA 1U6JA 2X3UA 1MFPA 1SG9A 2DT8A 4I1OA 2C83A 4OP1A 3TDKA 4C6HA 4V1CI 2IV3A 4CM9A 1F6WA 2VH1A 1U0JA 4MQEB 2JBAB 4IQ0A 2OBLA 1UP6A 3G2IA 3WJ2A 1KAQA 1N9GB 3OPQA 1VG1A 1CR1A 1YUNA 1E1QD 2FZLA 3WB0A 2FWMX 2HRZA 4BFSA 3HU1A 2I33A 2XD4A 3FPBA 3DHEA 4KPUA 2VF4X 1L4BA 1QSYA 1BMDA 3TLKA 1YNSA 1NP6A 8ICIA 2O06A 3HU2A 4GKJB 1A7UA 4BKRA 5LP6F 3S44A 1PJSA 4RNCA 1PK9A 5EIXA 3R7FA 1GU1A 5LKRA 4JI8B 5AKLA 2BM9A 5DHTA 4ZHQA 4ENTA 1C1HA 1F2TB 1KR5A 5ALGA 1WBJB 4DAOA 5ALDA 1HUQA 1W88A 3N2EA 2VF5X 4S04A 4NY1A 1SD1A 5JI2E 3VSCA 3NAQA 5ALNA 1GIAA 3C97A 3BQ1A 1TUEA 2R8HA 5CB4A 2OXTA 4BNNA 3TFSA 1Y8QB 3I45A 4F4ZA 3TOXA 4HDAA 1V39A 3LPLA 4HQFA 2FMTA 2HLDD 3UUWA 2ZUWA 1FA9A 3RJ5A 3F98A 4WD3A 4JEMA 1BH6A 4J1TC 3UOWA 4IG9A 4FYXA 1TYCA 3UWSA 2ZIWA 2QN7A 4EK9A 2A57A 1PCXA 1H42A 1SZJG 2M32A 2N9UA 4FGLA 4NHOA 3RD5A 2J48A 3U9LA 3WGIA 2P35A 1STOA 1UAGA 2OCPA 2P67A 821PA 2ASDA 1FRNA 1U7UA 3IDAA 5C31A 3VKVA 4B82A 2P9FA 4BWVA 1JEYB 4NXNB 1OX4A 2F6RA 2HMSA 5KVCA 4LFBB 5E7MA 4FMCB 4NBKA 2VL7A 3TANA 1LLDA 3KEQA 1EFPB 2HA5A 4GD3Q 3BZUA 4BFTA 1SCNE 2WIKA 3LL4A 4IVQA 4UCQA 3LYLA 2QDXA 4GO1A 2ZJ4A 4J9MA 1ODKA 1U4OA 2Q3LA 4HLDA 4MLCA 3RFFA 3RJ9A 3BICA 3S5JA 2D0OB 3ILVA 1SUIA 2FK8A 4YAEA 3IUYA 5GTDA 3ZX4A 1YACA 4OI4A 2HHQA 4HADA 1CJTC 4EVRA 3DDNA 3WK6A 3BDAA 1L1RA 1VJCA 1DG9A 4NBWA 3FXAA 5BVGB 3EPKA 1BOOA 3KR2A 1QP0A 4O5CA 2RCNA 3RU2A 4RNOA 3T4UA 5K6AC 1ZM7A 2R65A 4G89A 1CB7A 1J4AA 2IUTA 2J30A 2G25A 3C7CB 1QIGA 4KYIB 3RG2A 5IAAA 3HBFA 5TSDA 5KG5A 3LAWA 4Q1BA 4Y3UA 4B85A 4FFDA 4UAUA 1ZH6A 3QQPA 4LHXA 2GFIA 4C5CA 2F3NA 3GQBA 3IHLA 3C29A 4ZOLF 1P9LA 2ALJA 5GMOA 1T8PA 5MHTA 4UNNA 2PXAA 4MWEA 4PG5A 2MIIA 5DFAA 1I0LA 2R751 2VWHA 1MC8A 3LDFA 4DWOA 4EFNA 3L4SO 4QZ9A 2VPZA 1O95C 1YZVA 2VAXA 2WYWA 1ZONA 1RYRA 2H52A 2Q41A 2BKUA 1Y88A 2QHXA 1U81A 3CXRA 3D6UA 4P31A 3SBDA 1KFKB 1B6TA 4YR7A 5JCZA 1D2AA 3D31A 4UM5A 2IWRA 1FPQA 4MEYA 2W9BA 3VKWA 4QYIB 4RH1A 5JAOA 2F1RA 2A58A 2RHRA 3CUSA 4Q82A 4BNFA 5HOEA 2DQKA 3GK3A 1HE8B 3JQEA 4NAUA 2VJLA 3U17A 1SUBA 2GKGA 2ZJ6A 2OVFA 3M82A 3ODPA 1DK3A 1ZH2A 2QTWB 4H1HA 1E7RA 4FKBA 3CLRD 2XCRB 3TUZC 4HYKA 1LDYA 2CLMB 3G6XA 3NGDA 1MIOB 3AP2A 4ALLA 2G1PA 2WQ6A 1ZR4A 1FEZA 4YXWD 4OXXA 3U09A 2XXJA 1JYFA 4DMFA 1S89A 2XUPA 4BNGA 2VYCA 4LMAA 4C7ZA 1PVDA 2DCMA 2K4PA 2GPYA 4FHCA 3PRHA 4LXXA 1T0PA 1W2WB 3LVFO 4AJ9A 1PVOA 9ICVA 1G8JA 1L7RA 3W7VA 2J3EA 2B8JA 1FK8A 3TIFA 4N76A 2J7PA 1CSEE 5ALSA 2HU5A 3MLEA 2N3ZA 5GM2A 1K06A 6ABPA 3LNCA 4FN4A 5A1JA 4B6SA 4KR6A 3NGLA 4KN6A 4YMWA 2IPOA 3HB7A 5J2KA 1UPBA 5M7EA 1XZLA 2OCYC 3D7NA 3DNFA 2YN4A 3NIFB 1JMVA 4HB3A 4M8SA 3MCTA 4BC1A 4BQPA 2DC1A 2OK7A 4WY5A 3OIFA 4QD3A 4WOPA 4B6JA 1P0CA 1Q0RA 2EU8A 2FWJA 3EUFA 4YEDA 5FL7D 4YUZA 3WAJA 2CV1A 3V8NA 1GZHB 3I12A 4BO1A 1RQNA 5I9MA 2GEDA 2XUHA 4RPYA 3QUTA 3HZRA 5CVUA 1ESMA 7ABPA 4PLFA 4RPHA 1Y33E 4GPD1 3F6CA 3URMA 5HGXA 3R74A 4LZNA 2R1TB 2YXPX 4G1FA 5AKKA 2O8EA 2FEPA 1MMFB 1AV7A 2WPDA 4CLOB 3OP4A 4BCCA 4Q3BA 4UKDA 3QLEA 5HR5A 4P0PA 4PR3A 3EW9A 1FTNA 2QE7D 3EIEA 1U4SA 3PEUA 2G5PA 3Q3GE 4DBZA 5HCUA 2BMWA 2H4HA 4FB5A 2WD9A 1YR2A 4WEOA 3ZWXA 3V1KA 5CAEA 2UZIR 3UKOA 5J0SA 3EHEA 1J8QA 3UOAB 1VP3A 2VANA 1E4YA 1U5BA 4WZBB 4BNWA 4D42A 5D84A 2GA8A 4B6OA 1ZQJA 5TPWA 4ZMBA 2EZZA 2PLAA 1RI2A 3BMQB 1ZHHA 3TQQA 2CE2X 4PZDA 2HT6A 5FDFA 2C4VA 4ARVA 1G42A 5BUCA 3I5UA 2P9ZA 4GUDA 4BO3A 5F1PA 8OHMA 1YR9A 4P1ZA 4QIHA 1SXIA 1FDSA 1P7PA 2DF8A 2ES6A 2P9EA 5JRTA 2QTBA 2RAPA 1GL3A 1H3NA 2OBBA 3R75A 1NONA 4QDTA 4Q1VA 1IM8A 1JUDA 1KI6A 3HCAA 2FUCA 5CVCA 3W8RA 4CM4B 3BQ7A 2WAAA 3AVPA 4FSDA 1VCMA 4BE4A 1BEEA 1LDGA 1QMPA 4UAGA 3SD7A 3K4QA 4UJ5A 2D3TA 1LPPA 3L0CA 1QO0A 3TQIA 5AVTA 1E1CA 1X9HA 2FWBA 4Q6BA 4YRKA 4RF5A 4BO5A 1IIPA 4UUPA 2ERYA 1XD2B 2G63A 2VTEA 2FQQA 3AZQA 3MK31 3F2DA 1IG3A 2RJ3A 3IT0A 1DQNA 1P6QA 4E30A 4QWBA 1U2PA 5KTNA 4C8KA 2NO6A 2C7PA 3V46A 4D0GA 1OGJA 2XCSB 2W2QA 3OQIB 3R3WA 1QIFA 4KHZA 3LY5A 5KNDD 3WQSB 5EFZA 3QTTA 3DQPA 4REQB 4HRVA 1MX5A 4EI9A 4NPAA 4Z4EA 1Y7TA 5L3VA 4BTVA 1CUUA 4WI1A 4EBEA 3TF5A 4RKQA 4N8EA 5E4JA 3T94A 3DXZA 1I2DA 1KK1A 3AB8A 1HRKA 1U3TA 4TT3A 2JA2A 4CQMB 1E3IA 2H06A 2HLDA 4RJ2A 3LPCA 4RGQA 2XADA 5E6RB 1E0AA 4NESA 5E6RA 4RPLA 1XDDA 3M49A 4D2IA 1I3NA 4FEAA 5K8UA 1CUDA 2PY6A 1JIUA 2FCRA 2Z0MA 4PIPA 2E18A 2AGQA 4BJ3A 4EPVA 1ZAKA 4ZJYA 2O3TA 1XD9A 5DE3A 2V7WA 5KNCH 3DBIA 3B6JA 4IIUA 5SY6A 5AVYA 5KAIU 2XGOA 3O8OA 4HJXA 2BYTA 3RC7A 1YB2A 1Z62A 3C74A 3FUTA 5L4NA 4R7ZA 4QUIA 4GHWA 3G6VA 4F3OA 1UMBB 2OZLA 2BHLA 3PYXA 4NLZA 3Q7RA 3IHWA 4QPDA 1HI9A 5JSFA 5LQDA 1GEEA 4R2KA 1L3TA 1JKIA 1WZCA 2E7ZA 3ZHOA 3VPAA 2P68A 2YRWA 3OMXA 3DOUA 2I3GA 1W0CA 4I14A 4OHRA 1EK5A 5CD9A 3FOZA 1AN0A 3B9PA 1PJCA 3GFOA 2NZ8A 5CCBA 1SEPA 3Q6MA 5LU9A 3R9XB 3DCNA 1KMCA 3L8DA 4UJ3A 3SC6A 1DXYA 4K7JA 4AMVA 1HE1C 1TM7E 4P3KA 2VK4A 3BCHA 4PLPA 5HF6A 1G3RA 1QVWA 1Z3EB 1U9LA 3N7TA 3TLZA 5IYZF 1H8HA 4YRZA 4EEXA 4QREA 1M34E 3BTVA 4LCJA 4YV1A 1LSSA 1TQ4A 4QT4A 1E6UA 3UXPA 3T95A 1CULC 1KEVA 4FS2A 1SCIA 1TUBA 1U3FA 1T9BA 4LBYA 5AW8A 2BZFA 3O2JA 4K6OA 2FW6A 1YS7A 2DHDA 4IS3A 3TVDA 3EAFA 4PV7A 3KTQA 3E05A 2HDWA 4OXIA 4B7XA 2XWPA 5A4AA 2A9VA 1FVFA 1K9SA 1SUEA 1HTWA 5IU6A 3OOWA 3OFNA 5EPEA 4Y9RA 4JKOA 5DT2A 5CA1F 4R8KA 2H7VA 2P6UA 2Z1MA 5B3JA 3PEYA 2E0IA 3SAFA 2O8VA 4Q3LA 3FDSA 4CMEC 4PAMA 1UKEA 3SQMA 3TZQA 4IXTA 2VK1A 1KFBB 2ZS8A 3KKLA 4FFOA 5ECWA 1GGJA 2A0YA 1LTQA 3D6HA 3IAXA 4JJKA 1GNQA 3R0QA 4AW9A 4YI3A 2BFFA 1JDJA 1B8VA 2FPSA 1XDZA 3HYLA 5LA6F 1E2MA 2JIBA 3GLFB 3WO0A 3H5RA 4M0KA 4R8SA 4B3SB 1SVIA 3M1AA 2IU3A 4TVKA 4E94A 2B7CA 5DG8A 1DAHA 1U8CB 2ZLBA 1QLWA 5K0BA 2ZULA 3HYNA 1J09A 4J3FA 4NDAA 4UB6U 1C0KA 1VJRA 3C85A 3CF2A 3OESA 4YG2A 3QW2A 1LV5A 4ZVKA 4DPKA 4DZTA 5J43A 1FFYA 2B94A 4QZ8A 5AVXA 4YMOA 5KFUA 4DQSA 4NJMA 5CEJA 3ICCA 3P9IA 3D1VA 3WIVA 2F1HA 5KG7A 1VL2A 2AA3A 2B8EA 2AMVA 3LPDA 1P5JA 4LX0A 3T1VA 4B6PA 2PUBA 1XKTA 1IBRA 1GL6A 1J0BA 2JJ8A 3ENKA 2C7VA 3K0KA 4MS4A 4PF1A 1RVDA 4MA4A 3DW1X 4NV1A 4RMNA 5DXFA 3DOHA 1TYDE 3OZTA 1CHNA 2DY0A 2ONCA 4CHGA 2CMFA 1EIZA 3M0EA 4BNXA 1E6MA 4D9HA 4LDAA 1Z75A 2P30A 2X41A 1VIYA 1FUIA 3GYBA 1UMCA 2JD2A 5D1HA 4B2YA 4D56A 2PNFA 4RTQA 4MPPA 4A10A 5BOLA 2PUVA 1WP4A 5IEJA 4B3DA 3P2KA 3SJCA 2WVHA 4R2JA 4URFA 5E79U 2R1UA 1UC5B 1U9ZA 2JARA 3FETA 1OXTA 2XGGA 3QKWA 3MGCA 4D9KA 2H08A 4F84A 2CNNA 5DB7A 2X3YA 4FBGA 1RAGA 4RABA 3ZY6A 3GOHA 4AJPA 4EG6A 2IYTA 3VR2D 3CEMA 3OZRA 3DE4X