3E58A

Crystal structure of putative beta-phosphoglucomutase from streptococcus thermophilus
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
211
structure length
211
Chain Sequence
MVEAIIFDMDGVLFDTEKYYYDRRASFLGQKGISIDHLPPSFFIGGNTKQVWENILRDEYDKWDVSTLQEEYNTYKQNNPLPYKELIFPDVLKVLNEVKSQGLEIGLASSSVKADIFRALEENRLQGFFDIVLSGEEFKESKPNPEIYLTALKQLNVQASRALIIEDSEKGIAAGVAADVEVWAIRDNEFGMDQSAAKGLLDSLTDVLDLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative Beta-phosphoglucomutase
publication title Crystal structure of putative beta-phosphoglucomutase from Streptococcus thermophilus
rcsb
source organism Streptococcus thermophilus lmg 18311
molecule tags Isomerase
total genus 77
structure length 211
sequence length 211
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3e58A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3e58A01
5T41A 5ALMA 4BBJA 4UMDA 3HLTA 1AQ6A 4XE5A 2FI1A 3E58A 1RKUA 1RPZA 3F9RA 5ALDA 1Q92A 3M9LA 4OHFA 2MU2A 2C88A 3HYCA 1S8OA 4GXTA 1RQLA 2JGAA 3E8MA 3R4CA 3B8EA 2FPXA 3IB6A 4EX6A 4HGNA 3QNMA 3CZ4A 2WF7A 2C8LA 1NF2A 3VAYA 2GMWA 2O2XA 2RARA 4Y2TA 2I34A 5AKZA 1EK1A 3ZUPA 4YGYA 1ZJJA 1XVIA 3FM9A 2HDOA 2OA0A 3A1CA 1RMQA 4YCLA 3I28A 3UMGA 1O03A 3N1UA 2ZBFA 4CF5A 2B1QA 3BWVA 3KDPA 5ALUA 1Z4KA 2HOQA 1Z4QA 1J8DA 4Y2QA 1RMTA 4UU1A 4XPZA 2FUEA 1N8NA 4UMVA 3ZWDA 2EARA 3U7HB 1LVHA 2CFTA 4UW9A 5AK6A 2YJ3A 5A3QA 5AW3A 4BX0A 2G0AA 5ALHA 1ZOLA 1RC8A 4L6CA 3WK9A 2P9JA 5JJBA 3WKEA 2C8KA 4GIBA 1VJRA 4QJBA 1RMYA 3K1ZA 3DDHA 5ALNA 1IWOA 2HHLA 3NAMA 3GYGA 3WK8A 3QXGA 2G07A 1WVIA 1XPJA 1Z4IA 5AW0A 4MWOA 3N07A 3OCUA 5AHXA 5AM2A 5AKEA 5IT4A 1U2TA 3NALA 2QLTA 3QLEA 3PGVA 3EWIA 4CNQA 2IOFA 3WK5A 3AR7A 4C4RA 3FVVA 3ZX4A 2HCFA 3R09A 4B6JA 3QU7A 5ALWA 2WF6A 3A1EA 2JAOA 3ZTYA 4DW8A 4AS3A 3E84A 2W43A 4UASA 1Z5UA 2P27A 2YMMA 5AW5A 5AVZA 2I55A 1WR8A 2YMPA 3EF1A 3IJ5A 2O9JA 1ZD4A 3EF0A 4DWOA 4EEKA 5AKJA 2JAWA 2YFYA 4KYTA 3WKCA 3ZVNA 3NASA 4UAVA 4BKMA 3FPSA 3ZX5A 2JAUA 3OCXA 2I7DA 4Y2JA 4HGOA 4UU0A 3WK4A 2YMLA 5ALVA 3WK6A 3L5KA 2YJ4A 1JUDA 3D6JA 5AIBA 2AUTA 3QU9A 4XQ0A 4QQFA 3L8GA 2EATA 5ALGA 4ZEVA 3WGVA 2RBKA 5AVTA 3L0BA 2C4NA 1L6RA 1Q91A 3L7YA 2ODAA 2B30A 5AESA 3U7GA 3SHQA 3N28A 1O08A 5ALFA 1Z4PX 3QU4A 3AR8A 3W5BA 1L7NA 2G1AA 5E0OA 3L0CA 1YS9A 5AM4A 5AVYA 2NO4A 1QQ7A 4HGPA 5AM1A 5ALXA 4CF4A 1X42A 3ONNA 4J03A 4H1WA 4C4SA 5ALIA 1QQ5A 3OTQA 3ET4A 3KC2A 1YV9A 1L7PA 4ZEXA 3L1UA 2RB5A 3W5AA 1WPGA 2MSNA 4HAIA 4Y2PA 5AK3A 1Z4JA 2G80A 1Z5GA 2YJ5A 1NRWA 4AP9A 2Q5EA 1CR6A 5AW9A 3P96A 2G06A 3FZQA 3U19A 1ZRMA 3WK7A 4FE3A 1QH9A 4RESA 2AMYA 1F5SA 5FP0A 2WHEA 3I6BA 4EX7A 4JB3A 1N9KA 2I33A 4HGQA 4UATA 4NV0A 3DNPA 3AR4A 4JDPA 4G63A 4BNDA 1TJ3A 5A3RA 4DFDA 5AI4A 4UARA 3PCTA 4HGRA 3SMVA 2HF2A 1PW5A 4YIKA 4Y2UA 2IOFK 1RKVA 1CQZA 2R8YA 3U13A 1L8OA 3NIWA 3OPXA 2G08A 2WM8A 2D2VA 5AI6A 4Y3UA 1Z4MA 2HEGA 2MU1A 5AKLA 4I9GA 4E88A 4O8CA 2FPUA 2WF8A 3ZVLA 5IS2A 2P11A 3QUCA 4EENA 4KNVA 1TJ4A 1T9ZA 1YDFA 1U02A 2BY4A 5AI0A 1ZD2P 4HYTA 3MN1A 2B82A 2ZBGA 2R8EA 2ZXEA 4I9FA 4BEWA 1LTQA 3L1VA 1ZRNA 1YNSA 4OFZA 4NABA 5ALTA 3QUQA 4AS2A 3W5CA 3U26A 2YJ6A 3WKAA 5AVSA 4CF3A 3A1DA 4OCZA 3WGUA 5AW2A 2NYVA 2G09A 3ZTWA 4F71A 4XOUA 3W5DA 1YJ5A 2I6XA 4C4TA 4KX5A 4Y2RA 5AKXA 3U7FB 3L8HA 3N5KA 2BDUA 4CE6A 2P69A 3I1YA 2YN4A 3RFUA 2FPRA 2Q4TA 5AW7A 3EPRA 3WKBA 4KN8A 3ZI4A 2YMQA 2VKQA 5AKIA 4UM7A 3ZU6A 4YCMA 1L7OA 5A3SA 1QYIA 1U2SA 2B8JA 3SD7A 5AIAA 2IOHA 5AI8A 1WZCA 1FEZA 1Z4OA 3UM9A 2B1RA 4KNWA 3WKDA 4UM5A 5AW1A 2QYHA 2YY6A 2OBBA 2PQ0A 3NUQA 4OD0A 5ALZA 2W4MA 2Q4RA 4RETA 1SWWA 3AR9A 2CFSA 1RQNA 3KOOA 5AI5A 4BX3A 1VFPA 4YIHA 4EZEA 2HI0A 3SLRA 2GHTA 5AVVA 1RRCA 5AKKA 2OM6A 3B9RA 1J97A 2BDEA 2OYCA 4BEVA 5ALEA 5ALYA 2HF7A 4DCCA 1RLMA 3PDWA 5AM5A 3MPOA 5AKHA 3E81A 1S2OA 5AM3A 5ALSA 3OCVA 3ED5A 4NAVA 1SWVA 4Y2SA 5AKGA 3U7EB 4BYGA 2C9MA 3AR6A 5AVUA 2GO7A 2FDRA 2WFAA 5AI9A 2RAVA 4FFDA 1ZD3A 1U7PA 5AKYA 4ZEWA 3OCZA 3QGMA 4L57A 3AR3A 5AVXA 5AVWA 2WF9A 4KX3A 4UMFA 4Y2YA 3MMZA 3ZWKA 3RF6A 1KYTA 1TJ5A 1Z4LA 5ALJA 3QUBA 3DV9A 3R9KA 3NANA 1RLOA 1TE2A 3S6JA 2FUCA 3AR5A 3I76A 3MC1A 3M1YA 3SF0A 2FPWA 1T5TA 5AM0A 2FPSA 4NWIA 1Y8AA 3AR2A 3QX7A 5AK4A 2HO4A 3B9BA 5ALKA 2PR7A 2JARA 5ALPA 3J7TA 2HX1A 3QYPA 3FPBA 4BNDB 3PGLA 4Y2VA 1SU4A 4FYPA 3FGOA 4J2TA 2DQSA 3NRJA 5ALQA 1T5SA 3ESQA 3BA6A 3CNHA 3SKYA 3OCYA 5ALLA 2R8ZA 3OCWA 2CN1A 1ZD5A 2I54A 4YCNA 1MH9A 1TA0A 1K1EA 2AH5A 4BX2A 2ZBDA 2ZOSA 1RLTA 1YMQA 5AVRA 2PKEA 2IYEA 1L7MA 3IRUA 3N8GA 3ZVMA 5IT0A 2YBDA 2W11A 4L6AA 2WF5A 4EELA 5ALRA 5AICA 3UMBA 1Z88A 1RDFA 4Y2XA 4UAUA 3UMCA 4F72A 3ZW7A 5AW8A 2GHQA 3DAOA 4NFLA 2NO5A 3TLMA 2CFRA 1QQ6A 2FEAA 2B0CA 1U7OA 2IA5A 1ZS9A 2R8XA 3ET5A 3QUTA 3QU5A 5AVQA 3ESRA 2ZBEA 2B8EA 1Z4NA 5ALOA 1VJ5A 3L0YA 4YH1A 3L8FA 4PNHA 1NNLA 4G9BA 2X4DA 4MUMA 2EAUA 1XP5A 5AW4A 4UMEA 3QU2A 3SKXA 2GFHA 3KBBA 2AGVA 4IFTA 5AK5A 2HSZA 2ZG6A 3L8EA 4IG4A 3KZXA 1L8LA 5AW6A 3KD3A 1RKQA 1EK2A 3A3YA
chains in the Genus database with same CATH superfamily
1GPWB 4BBJA 3R6WA 2BCGY 4KXQA 2JGAA 4JC0A 3RSGA 4L8WB 2QUBA 2E37A 1DWPA 1JG7A 4RSHA 1FRNA 2Y71A 3R5JA 1J24A 4LOIA 2DWPA 2HDOA 4F60A 3SXJA 2C9OA 3G5TA 4OM8A 3UXHA 2ZPTX 3EZ9A 2AG1A 4RULA 1V1RA 4JJZA 4DQPA 4Y6QA 3KHUA 1TU3A 4KQCA 3C21A 4FNGA 2ZJFA 1TA9A 2VHCA 3STVA 2QT1A 3E0QA 3PLRA 2DOKA 3ORSA 4IVPA 1YR1A 2O5EA 3OJXA 3NAMA 2NZVG 1M0EA 1UAYA 4OJTA 1L1FA 2W7PA 1ZQMA 4FJ1A 4JAVC 1GPMA 4CMCA 1T8YA 5HKOA 5ULLA 1UBMS 4CFSA 4DQUA 4E14A 4IY1A 4MV7A 4YYZA 3SDSA 1N33B 1LQUA 4NKRA 1PS8A 4JI7B 1JQ5A 2MCFA 5CCDA 2IL1A 1E89A 16PKA 1I33A 3KFVA 1ZD1A 5FBVB 1O7JA 2OXTA 5TDHA 1TK2A 1KAMA 2X3UA 3K6JA 4ZEVA 3MR5A 5LU8A 4ZJPA 3DONA 1F6WA 3ERCA 3M3PA 2B99A 3W77A 1EA5A 3PGKA 2J9YB 2CXYA 4HB0A 3E9RA 3H4MA 3GA5A 3STYA 4XWGA 1XQWA 1EB8A 1N5MA 4A6PA 4Y1EA 10MHA 4E1BA 4Z7NB 4E12A 5DASA 3FWHA 2MMGA 5A3RA 2Q5OA 4CIWA 1UDXA 2V7XA 4Z2AA 2R8KA 3KQPA 4BVFA 4GD3Q 1OE0A 2NYAA 4X8HA 1LS6A 1LV5A 2WFLA 2VHVA 4AF8A 3IE1A 2XRFA 3ZIDA 4HDSB 4F91B 1DVRA 5D3QA 1DAMA 2QPAA 5DCUA 2UZ4A 3M0EA 4ZFNA 5J4HA 3G8BA 3JD1A 1CY2A 5IXSA 3CNQS 1E64A 3SAGA 2JH7A 4M7PA 2EYUA 1QF7A 2DB3A 3NDRA 5TF4A 4BB5A 5DIZA 3AYXB 5BOSA 4PN3A 5EN4A 3FKQA 1TYAE 1ZMXA 4PG4A 3IUMA 4R64A 3NP9A 1EZ1A 2O1XA 4IKPA 3FLBA 1ADGA 5SY9A 4ZQHA 2LKDA 4M9SA 1UQUA 3B6KA 3A37A 4C9BA 4PCVA 5G3ZA 1U2DA 4LFCB 2Q4OA 1XZ8A 2CFSA 4RY8A 3KOOA 5ES3A 1Q7BA 1WW3A 4LQCA 2WSSA 3MJ4A 1ZA1A 4BJ6A 2O8FB 1JHXA 3Q7RA 1JFSA 2ZJOA 4NDAA 2WYIA 2A59A 4BZPA 4GBGA 4XWTA 3IMCA 1BMFA 1OIXA 4QYXA 3EEIA 4XB6B 5LQUA 1ZBQA 3T7RA 2O3TA 2CJWB 3MWYW 1H2BA 2HRDA 2AMLA 4ZI7A 1PYOA 3X2SA 1NRIA 3V8EA 4D74A 2CUKA 1ZW6A 3K9QO 2HRZA 3IP7A 2RHOA 5C5IA 2ST1A 4KR3A 4S05A 4ZRNA 2FN8A 2Q6VA 4GPD1 3V8QA 1QG2A 1Z6TA 2FOXA 1NQVA 2VJ4A 2HQ1A 4G1FA 3ZOZA 1EE1A 4QIHA 2OBYA 2YC2C 2WIJA 5DHRA 3EUFA 4NP6A 2AH5A 4ZD6A 3OEHD 2XW6A 4QO7A 5DGBA 121PA 1VSQA 2VKTA 2BTQA 2OZLA 1QFXA 3OHAA 5K0BA 1YWGO 5LXTF 1TMGE 4ERNA 1AKEA 4ZH4A 5SYNA 2XIDA 1FBNA 4DC0A 4GMHA 3ZXYA 2AC7A 5ILOA 4MQ6A 3C43A 4IFEA 1JR3D 1KYIA 3W6OA 1ULUA 2GFHA 1C7QA 4M6WA 1YZ3A 5GJWC 2HSZA 2ZIVB 5KFOA 3VGJA 1Z6XA 3KT6A 3CLTC 1AROP 4P4GA 2DTEA 4D46A 3E8MA 4I2AA 4L3OA 2O3SA 3LHKA 1F0NA 2JFPA 4UBMA 4I9UA 1Q1QA 2O3JA 3SI8A 2YQ5A 4XWWA 4FOTA 1V11B 3IOYA 4BJQA 4TMZA 3DFKA 3DXZA 3WDMA 2JK0A 1K7SN 4UMVA 1TUBB 4C88A 3MERA 4RS4A 4MZDA 5J59A 4ZZ0A 1QOZA 5CA1B 3EQZA 4DR6B 5A02A 1DRUA 1QF9A 4EHDA 3D2LA 1GCAA 2AWNA 4GG1A 4CMJA 4QEKA 1KSPA 2XY7A 1DXHA 4QM7A 2WSBA 3E9EA 1JMVA 3K0HA 3KP1A 4QREA 1XDBA 4MFAA 2QLFA 5IJZA 3JALA 1IONA 5TGZA 3L07A 2W43A 3HI6A 2R6FA 5DCLA 1RIIA 2C07A 3S2SA 3LCVB 4EEKA 1DJNA 4L1KA 4EHFA 4WUTA 4NLNA 2YHSA 3FIUA 1PL6A 2PUHA 3QF4B 3B13B 1KMCA 1PO7A 2Q8PA 3VSDA 4PICA 4D6PA 2AUTA 1SQ0A 4ZGWA 3ETEA 4CG2A 4ML3A 4B5LA 4PXSA 1ZGHA 2Q5LA 1VA4A 1ZMBA 1NUHA 3UAOA 1L7NA 3ISTA 3RTDA 4PZPA 3QJGA 3AI2A 3TTXA 3KXKA 5DJ5A 2ERCA 3EIHA 2FX3A 4QTYA 1PFYA 4UBLA 4TQGA 3IEPA 5CA0F 3JATB 2Y1FA 3PUWA 3U4AA 4M9LA 2QW8A 3N0XA 4TTIA 3TDMA 3INRA 2C4HA 2YVQA 3QX8A 5TNXA 1PR3A 4QATA 2VHJA 1Q1GA 4JCOA 3QIAA 2Q9BA 1XIVA 2V0GA 1KKXA 4LV8B 4KLLA 4M7WA 3QPUA 4CFZA 5C7LO 2VZEA 4HL6A 3DZCA 3LLCA 2PJZA 1ONOA 2RAFA 3DHVA 2ZP1A 1LB1B 1HFKA 2DT8A 1KS9A 4LY0A 2H9AA 2LCIA 1UBRS 1T9HA 4MX8A 3R6DA 5JMTA 4I4TB 3MELA 1HIWA 5K3EA 4ZYLA 2HSGA 4F4HA 4B7AA 5CNKA 5T57A 1HT0A 2JS7A 1R00A 3B7PA 2I4TA 4BC1A 1FC0A 4AJNA 3V8NA 3WNBA 4O1HA 2P9TA 4YCMA 2UZ3A 2VP5A 5F9NA 4YBZA 2B1RA 2JAPA 1E0AA 5BYKA 1E1KA 4YCJA 4KLEA 1YAHA 4LYAA 1BNPA 3IP5A 1EX1A 2KNJA 2XLBA 1EBBA 4H9GA 3BWCA 2A0WA 2OCXA 4BB0A 2X0EA 2Y67A 3NBAA 4AIIA 4OIMA 1P39A 4PRZA 5CITA 1E1LA 2AB0A 3FNQA 5AM3A 1ICEA 1N34B 1FA9A 2I6UA 1ZQUA 3OJWA 3EC2A 1P0CA 3I2IA 2B2CA 4F4CA 1YB7A 1ZD3A 4HFMA 4IG9A 4KDRA 2WWIA 1QGZA 4IJKA 3GFQA 4Q66C 4JZKA 1P1FA 1F2UB 2ZJBA 3EA4A 2VATA 5CW2A 4ED2A 4J0FA 1KOGA 3C5VA 1RACA 4K9RA 3MJCA 1KC1A 5CLIA 5CDFE 4LGVA 3B38A 2B1IA 5EMMA 3RGWS 2P0EA 3HABA 3UFXB 3OZTA 1IZZA 5FLXA 1VHQA 1X74A 5JSZB 5DCYA 3ESCA 4DYDA 3PRYA 1HRDA 4TYNA 1XD2B 4ZN6A 3I4CA 2Z5GA 3EHDA 3O75A 2J3JA 2QG4A 4R5MA 2BYTA 2Y93A 3HR7A 4CKCA 4DDHA 3C8MA 2NU6A 3LL7A 1UADA 3CSUA 5HOEA 2DPYA 5DQIA 1XTUA 2R7LA 4WE3A 4KIJA 3H1GA 5IINA 1Y3CE 2LVBA 2ET6A 5KTKA 3KVVA 2CKMA 4OHFA 2BJWA 4PYKA 2PRZA 2F7SA 1VSTA 1UUFA 4IX9A 3PZPA 2YWDA 3I4FA 4YMMA 4X85A 1ESMA 1N5OX 4JLKA 3I28A 4GL4A 4QU0A 2VJPA 2IHTA 3AT1A 1KL9A 2W9MA 2IPXA 3OUUA 4E22A 2VP2A 5ICGA 1RXSA 4K9QA 1KAHA 3IAM1 4ECYA 1QC5B 3TSZA 3RC2A 7GPBA 5JTIA 4FZRA 4M9GA 1SIWA 1W88A 4TQ9A 3F8WA 2ZRHA 1RVDA 1J8MF 4M22A 4TUYF 2K6GA 4B6QA 1UJ2A 3OSNA 1IWOA 4IDEA 1YZVA 4FHGA 1SXEA 4MA0A 4TKVB 2PXXA 3UWDA 4CNQA 2OLKA 8ICSA 2QNRA 1F2DA 4C1NA 5FWDA 5JAUA 3ECSA 3IYLW 5ITZA 5HA5A 3R0XA 1BW9A 2Z9DA 1OGIA 1QB7A 3FDSA 2FXIA 4XGRA 4RNDB 2J4DA 4KIWA 3DZBA 4GZ3A 4NS1A 4BNNA 1B42A 5DBFA 1G6HA 4TMFA 1FPQA 3TSAA 4C0BA 4AICA 4EZ9A 2QLLA 4W4TA 5BOMA 2QK4A 1HUZA 3QFSA 2QD2A 4J1NA 4RM2A 1UXKA 4FHDA 4EY6A 1NAHA 1THMA 1N3BA 4BMYA 2J0VA 1KDPA 2ZRJA 3BXZA 1R4NB 4YA6A 3LX5A 1HMYA 1KFSA 1VBKA 2QJOA 3K94A 4EPTA 4W8HA 1O5OA 1YJQA 3T9CA 3T1VA 2FRXA 1KDVA 3HX0A 1WOYA 4IVRA 4AVYA 3OQHA 1U11A 1ISSA 5AKLA 3CM0A 2WIFA 3HGQA 5F3XB 2C57A 4L2IB 2DQNB 2W6PA 3D6UA 2VPWA 4TQUS 1INLA 2JJ8A 1CV2A 2WQ6A 3OMXA 1Z34A 2PGLA 2YJ6A 4IMJB 3H1BA 5AVSA 1OROA 5EJMA 3T3MB 2J9RA 1X87A 4M0DA 3PGXA 5AW2A 3ZN2A 2AOTB 4GE0A 3QNUA 1D1SA 3ZH2A 3MZ0A 3I61A 4RUCA 5FHQA 1BZYA 2VL7A 4AMVA 4B83A 1IJEA 3A6EA 4P54A 3SS7X 3M6FA 1KJZA 3B9JA 3FFTA 2GSWA 4URUR 1HTTA 1S3FA 1YUBA 2X19A 2ATLA 5DGTA 4CG3A 4J7AA 1XP8A 3A26A 3ORHA 3PQDA 1AN0A 1W0JD 2K4PA 1GVNB 3QHAA 4A2PA 2WHXA 1FVXA 3ZJYA 5B1HA 3HBFA 1YTLA 2ZVPX 4KLCA 3I53A 3QXXA 2EWVA 3EB9A 4D43A 4B73A 3EA0A 2PAFA 1TF5A 1JX4A 2Q9UA 1ODCA 2V0CA 4MV4A 2ODNA 3A2NA 3P52A 1SHJA 2ATIA 4AKTA 4O63O 3SJUA 2QAGC 1V48A 3U4QA 3RW9A 4LI3X 1KYWA 2CUZA 1VKRA 5CTJA 3RAPR 2IYSA 5JSHA 1CY7A 2BQ3A 4UUNA 1NVBA 4RGVA 7ICQA 4QJ5A 1CLEA 5AK4A 2GRUA 3KL4A 2FLKA 2Z43A 3PNCA 2HA2A 1PG2A 2P65A 2W93A 4RPKA 2OBFA 1SUSA 4PX9A 4KR7A 3OCYA 4XDHA 4K3UA 3ZIAD 1W6RA 5GJVC 3PL5A 4ZJUA 4ZP1A 1TT5B 2QTCA 2IYEA 1C7IA 3MFIA 5ALRA 4OLJA 4OGKA 4DANA 2WFZA 4UTPA 1Z5OA 3F9IA 4RWZA 3EMVA 1A2OA 4Q4DA 4BJ5A 4WFQA 4E51A 4C7OA 1GT91 1VPTA 4D82A 4G0ZA 5IIJA 2PKQP 2YNMA 3FE2A 4WOBA 1I6WA 5KNBD 2CFOA 2UVQA 4XE5A 1T9KA 1GZ4A 4ZMRA 3ABSB 1KTIA 4B87A 3QLUC 3AUOA 4H7DA 3ZQ6A 1LB2B 3QE9Y 2GMWA 1U7ZA 4ELUA 3GRRA 4KI0A 2GBLA 2UXDB 2B37A 2OFOA 1E2LA 2ZBFA 1T10A 2VDWA 1WU7A 1FFGA 1LDGA 3SAHA 2AN5A 3T7SA 3IHTA 1RKBA 2FMQA 1FFVA 1NOMA 5K0TA 1XXHA 4LGCA 2BP7A 4KUHA 3ORRA 4ZEMA 1WJGA 2GXQA 2PH7A 3I4LA 4B3RB 2ADMA 5I4BA 1DOZA 1KZHA 5JD4A 1ENOA 2GN9A 1EXNA 5C1IA 3MTDA 4GMDA 3HRDD 3KQLA 4W1PA 3OICA 2K4EA 1DCKA 1BXZA 2J6TA 3KOYA 2I22A 4KV9A 3HDVA 3PKZA 2Z98A 3SSMA 3JU3A 4TQSA 3K5WA 4FR5A 4P08A 4FB4A 2W9XA 3AEUA 4UAVA 4RIGA 4N5LA 3OY7A 2G28A 2Q29A 2BQRA 3KKKA 3N8DA 1M6YA 5GV8A 3T9EA 4FT4A 4LZOA 2AUNA 2WTMA 4EQ6B 5F78A 2KE7A 2AJLI 4U4AA 3WBFA 4RXUA 1OILA 4YBRA 3G17A 4JYAB 2B34A 4MQMA 4ZT2A 3K53A 1SZPA 4B31A 4Z6DA 5T8KC 3FNIA 3BEOA 1VGVA 4UOZA 1JQKA 1GR0A 4O2BB 3K6RA 3JAWB 1XMIA 2IPMA 3QMMA 3BBLA 4QG7A 5JWOA 4R63A 4QULA 2GTHA 4HR7A 3P2OA 1M6WA 2IF2A 5FP0A 4Z4EA 5B1DA 5DBIA 4LRXA 4J3JA 4ENRA 5DEOA 1PD1A 1OASA 4HGRA 5HOQA 4FFOA 4HBZA 3TAQA 3SC4A 3BRQA 5LLDA 2W2TA 4TT3A 5A0FA 1G8YA 4Y3UA 2UVPB 3N7SC 1GQFA 3RC7A 2LM1A 3PGMA 5A4FS 2NPOA 1YZGA 3D5QA 3ID6C 3SEIA 3NJ4A 1K4MA 3ELDA 4OMUA 3AIOA 1KEEA 4DN6A 2EGGA 4ZDIA 2XIJA 3BK2A 5EJIA 2VAVA 2PWPA 5B3KA 5LIRA 5HIKA 3ZHRA 1P4JA 3RVJA 1O6GA 3WO1A 2Q5QA 1ZU4A 4IJ5A 5IVIA 4MPRA 3DTNA 4RLFA 2IT1A 2XDYA 2I2CA 2DUWA 4MP8A 1DIAA 4UD6A 5A3SA 3SHFA 4EJSC 1RQ2A 3O4IA 2QGNA 1YUMA 5CNIA 5AI8A 2AVNA 1U0OC 2A4MA 3B20A 1BFKA 4HFJA 3UB2A 4V38A 4C87A 2AQ8A 1FP4A 5JQGB 3QVMA 4TKUA 4KO2S 4RKEA 3UHPA 3E1GA 4KXYA 3B85A 2V6GA 3JPOA 3I9JA 1B76A 3QVTA 1RLMA 3C1OA 3O4HA 1TVKA 1XTVA 1BKYA 3LV8A 3WP1B 4XQ8A 3K05A 4I9NA 1DCFA 1U7PA 1H65A 3G2KA 4DFJA 2X1MA 2V9ZA 1XNHA 4U8GA 2B4QA 3UXPA 3IUJA 1SK9A 5BWMA 2GCEA 5K20A 4PG8A 4PHHA 3M9NB 2DBYA 3SN6A 3V6MA 1IJKA 3IIIA 1YR8A 3ELBA 3T12A 1E60A 1PWXA 3RJFA 3PXAA 1WXQA 4G4JA 4TXHA 2JGIA 2E1FA 4BHTA 4M04A 1EUDA 4FYJA 5GMOA 1W8DA 3L40A 2OENG 3IBCA 3MS7A 2BIFA 4TRMA 4V0OA 3M8KA 5K6RA 1K89A 7ICEA 1DAFA 3P27A 2ONZA 1OBVA 3IT1A 1IIBA 4JI6B 1J9GA 3HSSA 1GWNA 2XTNA 4QYMA 3IODA 4PHAA 1KZYC 5ARCA 5B12A 2MINB 3PX6A 1ZMRA 2ATCA 3HWRA 3K1YA 5IXYA 1KP2A 3SKXA 1EFVB 1Z0FA 5JWRA 4FZ5A 3OT4A 2A2ZA 3IR5A 1NNSA 1CF9A 4WFIA 1JHYA 3PJFA 4FONA 2PK3A 1YZQA 5HUJA 1VLQA 2DQ4A 4DUYB 3EXHC 4PWYA 3FYTA 1X1QA 3W6PA 2REQB 4NH4A 1F7UA 3C87A 3PVCA 1RMTA 1AJEA 3G8CA 4CTOA 3DZJA 3AM1A 1EHYA 2ZSIA 2O1SA 2BZGA 5EZYB 3IEIA 3HGMA 4RX1A 3EODA 2IUYA 3EE6A 3ONFA 4LJKA 2GD0A 4X93A 5IJ0A 3N3AC 4HO1X 4CKWB 4JQOA 2C2HA 1W19A 1FLDA 3L4KA 1SMKA 3KHSA 3SM9A 2B7BA 5J4VA 4DKXA 1B6TA 4F86A 5EP2A 2AFRA 2ZRNA 4HPXB 1Z0DA 1KETA 3C3YA 5JLAA 2HJWA 5KQGA 4D9EA 4HUJA 4RFSA 4YJ2A 2XCQA 3SSOA 3E7WA 4DIEA 2DKZA 1S4MA 1E1CA 4G5SA 2CL6X 3MLAA 2JGEA 4QJFB 5BN5A 2JI7A 2WW8A 2Y8EA 1GGNA 2C96A 3IAHA 3FOCA 4MAAA 5D3MA 3BH6A 3PRHA 1MNAA 3OPYB 1RAFA 3EDYA 3CF6R 2PZFA 4P0PB 4WJZA 2X58A 4NE2A 5AVYA 3NG1A 2II6A 1QQ7A 3QNWA 1PUZA 4XPIA 3NFRA 4KPGA 3OAAD 1T1SA 5HF6A 3PFHA 4LJ4A 1IBMB 1MJNA 5KVSA 1LTKA 1JFTA 3CNBA 4E5VA 3DFUA 2NO7A 1KDZA 4JB3A 1I2ZA 1WWUA 2I91A 3EFOA 3SMQA 3DR3A 3L5OA 1YA6A 3VRHA 1FBTA 4N7MA 4CEIA 4KKXB 4BDTA 1J00A 2H3HA 1W5SA 5BMVF 4DA0A 5AQEA 1VRCA 3DW1X 3R0QA 1B4DA 2LPMA 4I9GA 4D44A 4H6PA 4RPIA 3MGHA 2AFHA 3WWDA 1OTHA 5B7PA 2OFXA 4H7KA 3OQIB 3AB8A 4N3NA 1UQTA 2YV5A 4QUIA 3LC7O 3VDNB 1V4VA 3O1LA 5F98A 2CMGA 3MMNA 3L7JA 1F12A 3O92A 4H3SA 4N8SA 5KNLA 1NYRA 4P38A 3BC1A 2H2IA 4TRNA 5AKIA 4E70A 8ICKA 1TM7E 2IHZA 2XHEA 1R6AA 1R3DA 1L8AA 5AW1A 1JU9A 1OIVA 1SN7A 4FYHA 3LUDA 1CE8A 1Z3IX 2H1IA 2EFYA 4NCIA 3IBGA 5F2OA 4RTOA 3X1ZA 3ZHBA 2PT9A 4EG6A 2NTEA 1I9GA 2P77A 2GPJA 2E4XA 3WL5A 3WLIA 5KTNA 3G0BA 3OCVA 1T0UA 3I3SR 3SSNA 2PUFA 1GSIA 3E22B 3IQIX 4AYXA 5IULC 4GXNA 3K9NA 6PFKA 5H9VA 1N60A 5JJIA 1RI2A 1XN4A 2ZIGA 1QH0A 4Z5XA 1JDNA 1NQAO 1HORA 1NG1A 4ZT6A 1J8VA 2OMKA 3A4LA 5J2TB 4W1QA 5EHIA 5L6LB 4G9GA 3QX7A 2UZ1A 4PZLA 4WOPA 4ZVOA 2I62A 3E9NA 3W8EA 4KQEA 4XFJA 1L7AA 2P8SA 4DLZA 5E3HA 4OOEA 3C98A 2E1PA 3PRJA 4BMCA 3M6UA 2WUFA 2NV6A 4MGEA 5L1MA 3ZDRA 5JG7A 2BGWA 2Q62A 1YMQA 2W6MA 4YN3A 1CFZA 2H11A 1XZDA 3RVOA 3WGQA 2IA5A 4DIFA 2CLSA 1RWMA 1SY7A 4M0UA 1Y8ZA 1Y9JA 4G37A 4NEGA 2F8LA 9ICKA 3HA7A 4W7IA 2QSYA 4MWZA 3L8EA 2B83A 1S89A 4EP1A 4B6PA 1RJ9A 4L4RA 4B2IA 4KAJA 1W85B 3GIIA 3P9RA 4P33A 2A3RA 1XEAA 4F1WA 1FFXA 3P9CA 2PUDA 1QGED 2LDBA 3D02A 1JHRA 1U4BA 3DT8A 2OB1A 3T0GA 4QASA 1K3UB 2C42A 1PT6A 3H0RB 2R6HA 1N8NA 3KQOA 4TL9A 4AMGA 2FEOA 4CCAA 4NBWA 2QB5A 2G0AA 2R65A 1FX0B 2QZPA 2ONYA 6ABPA 5A05A 3NYRA 2O8DA 3QKSB 2OZKA 3HG7A 4KMOA 5LBUA 2FE1A 4B9AA 3ZY5A 1T4CB 4QDTA 4ECEA 1GIAA 4DQVA 1IPHA 4DBZA 2SKDA 3L0PA 3DW3X 2YWFA 4R8UA 2JCVA 1ZGBA 3ZVRA 2IIQA 1CZLA 4O4IF 2IXDA 1DCTA 1JHUA 5DDIP 3OHPA 2BFFA 5E1BA 3AO0B 2V7TA 1XVTA 4ZCTA 4IWYA 3M4NA 1R4ZA 2AOUB 3HJRA 3L7OA 5KDDA 3GA0A 5CIQA 3BWBA 3HKBB 5SZKB 3U44A 1NI4B 3HS3A 4PXYA 4KLTA 2C5GA 4KWEA 3V6LA 1HDOA 2KICA 1SBCA 5CT5A 3P9YA 2PL9A 4ETNA 5DXFA 1VFNA 1K8YB 4C7YA 2RBKA 5F9LA 1ZVQA 1PL0A 1VB5A 4JT8A 4PANA 1M9NA 2P9GA 4M0KA 3H9GA 3RIEA 2PQ6A 3AR8A 4BVLA 4J76A 3L92A 2O2EA 3SXUB 5E7QA 2HKIA 4PHPA 5K4HA 3KWFA 1M75A 4WBNB 3M7IA 3OOEA 2ZUCA 1Q0RA 3DNPA 4W5JA 1WHSB 4U8HA 4HWOA 4EB8A 3HHPA 1L5NA 3ENZA 2ZANA 4AX4A 3N59A 3DR5A 5FI1B 3DXFA 1TYCA 1Y6FA 3DTYA 1A88A 5COQA 1WSBA 3UH0A 3A0HU 1XF9A 3OO0A 2C4WA 3PEFA 1TJ4A 3O73A 4HYTA 2WZBA 3ZXUB 2C4UA 1EWTA 4RZQA 3STXA 3L1VA 1KI4A 1T34A 5K3FA 1Y1KE 4WZZA 1WEHA 5I01A 1NBME 3SF8A 2HNBA 3K16A 2I9KA 1XT6A 3EMBA 4R8RA 5T4EA 1B1AA 1ZN9A 3HYLA 1JSRA 1M66A 4O29A 3UAVA 4EUNA 3DUWA 5DYNA 3KAJA 1MXHA 3LXUX 1Z4OA 5ESRA 5LQJA 4YCBA 1QYXA 1TADA 4FHCA 4NPCA 3EMKA 4MB6A 1A27A 4XGQA 3B6JA 4RE5A 1RRCA 1N0WA 1U8FO 2AXPA 1OWPA 1ZVVA 2QBYA 4YDHB 3TB4A 3VR3A 1YH3A 1SNYA 3BTOA 2W04A 3QPVA 2IYVA 5FNVA 4D6YA 4NFHA 3ZJVA 4CVNA 5KWEA 3GRFA 5IIKA 4DLNA 2VANA 4G3XA 3C6KA 4ZEWA 4RA6A 2RGDA 5EY5B 3HCEA 3LBNA 3RNLA 1Y4DE 2DY1A 1AO3A 3JYQA 3DV9A 1JXQA 2J08A 4X8LA 1WMEA 2A0YA 3U1BA 1QP7A 1CUXA 3OJUA 2WM9B 3GGOA 4PYRA 2H1LA 4EYKA 4F4XA 2HO4A 1CJMA 2FPKA 2JG3A 1AKNA 2ZDQA 4HQNA 4MUKA 3LQ1A 1V43A 2PBFA 4ND8B 4IL6U 4XJXA 1CQIB 4IPTA 3OH8A 4NESA 1V71A 1QO7A 2QW0X 1IPFA 3ISCA 1XU9A 3PDCA 3HUTA 4F3OA 2W8ZA 4EHKA 9GPBA 3TR6A 4O4JB 1G8MA 1PL8A 4MUMA 2IV3A 5CR0A 4HTFA 1H9CA 3JYOA 2VK4A 1U2GA 1G17A 2BJVA 2IPAB 3EDMA 4JUAA 1MRNA 5T41A 2FGKA 3UV3A 1R8YA 4YG2A 2QM3A 1RYMA 5LA6B 4IR9A 5E1DA 1N2ZA 3BGWA 1E77A 1TO2E 3K32A 3SYNA 3SAJA 2RHBA 4AY3A 1RMQA 1X19A 4JH0A 5F5NA 4Q16A 4I50A 2XWJI 2V7QD 4AMBA 2Z5FA 5E95A 1S2IA 2NX2A 3LY7A 3OPNA 1FW8A 3B1VA 4JXKA 3I34X 4R6WA 4RVUA 3WLKX 2LIVA 3ICPA 4ODIA 5KWSA 3OPYI 5KOIA 1CS4C 3TFSA 2ZTCA 4O33A 4NBTA 4JK1A 2GYYA 1M6VA 3QXJA 4RHXA 5LQSA 1CS0A 1QOPB 4P4LA 4QZIA 2E1EA 3OZVA 1NLZA 4QUHA 1JR6A 4WZ6A 3Q2IA 4FFNA 2XXAB 4Q00A 5HG0A 5F7JA 2NQ2C 4O4LB 2DSNA 3LLSA 4FGJA 3EPHA 4BS9A 1V9LA 5J2UB 1GRNA 1A95A 1FP1D 4QLOA 3DZIA 5FL7A 3QE3A 1KSGA 5HIIA 3A1WA 1LZLA 4BX9A 5BPCA 4RF3A 4XB2A 4BV2A 5ENZA 1XLTA 3TWOA 2MUTB 4GU5A 1J90A 1GQ2A 1VYTA 4JGIA 1DTWA 4GFDA 4YP9A 4F2DA 4CEHB 2QHXA 4FK8A 1KU6A 3ZJUA 4BP8A 3EQ8A 2CLIB 5CXUA 5EE1A 2HA6A 1YCFA 1TZ2A 2AI3A 2Z3WA 2UYCA 7ABPA 4UBIA 1JBEA 3STTA 3MJHA 1RWQA 4LHSA 4WK6A 1FYEA 5CDHA 3ANSA 3HB7A 4KE6A 4RTKA 1LPAB 1CUGA 4FE7A 4HGQA 4WNYA 5HBGA 1IL0A 2DMRA 3CB2A 5HKBA 2I67A 1IMJA 1OZAA 4LRSB 2L0XA 4YRJA 5LWHA 5BR4A 3GI1A 2O8VA 1GNTA 1SH7A 1KYQA 1JEYA 4YDQA 3EBOA 4PM4A 3LVVA 4DSUA 1PBTA 2XOXA 4H7PA 5HEKA 1IY8A 1MQSA 3EVDA 3LPMA 5IUJC 5KU1A 3GP5A 5J43A 4M8IA 2ZJ2A 4D0NA 2P6UA 4TSRA 3L6CA 3O8QA 2EKDA 5FOVA 3H16A 1IXRA 3OQ6A 3DOJA 1J2NA 3TQCA 1GG2A 5AT1A 2HHTA 2IH4A 1FNSA 2EYQA 4OXRA 4DM4A 2A35A 4S12A 1QHYA 3QZUA 2QE7A 1NDUA 3ZHYA 1VBMA 1LFDB 5LB2A 3E5RA 1AA6A 2ZSAA 3F6PA 1NLFA 1YQUA 4H16A 2P41A 3JR7A 2BFWA 4CCHA 3TE6A 1MA7A 3DS8A 1UXGA 2HF7A 4DREA 5DGDA 2WKWA 4WADA 1FDOA 1P1JA 1E9CA 3RBVA 1OVGA 4X3CA 4A03A 3S8EA 5I7SA 3L7DA 1PVRA 2FDRA 1KJWA 3NCHA 3QVGA 5AI9A 5GV7A 2XZDA 2NN3C 2C5BA 2TS1A 1E3WA 4DXHA 3R44A 1UP4A 2H48A 2ISCA 1BJRE 4F2HA 2J8ZA 2F77X 3P4UA 4F5RA 5CFRA 4S1WA 1SRQA 3NANA 2O0KA 4J9MA 2QD3A 4UUAA 3SQMA 3ORYA 3QXSA 2QRNA 4LVCA 3ZK8A 5KIAA 3LWNA 1XKTA 1JEQB 4H1TA 2VHXA 4G4IA 3K9BA 1X1TA 4MTCA 4GOKA 3RUAA 1GO3F 1GO2A 4JJAA 3OTIA 1KOFA 4PHCA 1Z73A 2FEAA 2VJMB 1HQDA 2IHUA 2P2SA 2GEBA 4EKEA 1S0VA 3Q87B 5LFAA 2ORIA 2QD4A 3LBHA 3N76A 3LKZA 3CUEF 4CNBA 2GERA 2K7FA 2Y0CA 2O0HA 4UEOA 2BMWA 4C14A 4B45A 4IIVA 5LYJF 4MUXA 2KSQA 2YVKA 2JHPA 1MQ2A 3RREA 3E58A 2P1DA 1FUUA 4EKYA 1R0RE 4OXKA 4FILA 4KW7A 3U5TA 4LXGA 3R3UA 4W5WA 4DQSA 2VBIA 1BVYF 1F6BA 1XRNA 3PLNA 3KJQA 1QTMA 4MZXA 4M46A 2DETA 2GZDA 4Q34A 4AXBA 3KSMA 1GLGA 1XXLA 4C0WA 4NYMR 4XLTA 3ALRA 4JQCA 3REOA 4YXJA 1QO0D 2AZDA 3MILA 2W5UA 2G1UA 3BZCA 5FWXB 4PQEA 4GLOA 1JIIA 4YR2A 5E2BA 1ONBA 1EXDA 4CKZA 4K6GA 1Z4IA 3B70A 3D6HA 3EULA 5CIYA 3SU8A 3NXSA 5TPZA 3ZDDA 2YIDA 1YQTA 3VU3A 5C34B 1YOBA 2XSZD 5LQCA 3RC1A 2DY0A 1KY5A 1RBMA 3VR4A 1A9OA 4RNNA 1YFKA 5D1NA 5EIAA 3ADOA 2JVIA 4KRGA 5GVSA 2FHPA 4RQAA 3TPCA 4DJEC 4RMJA 4AI6A 3FNGA 2NZXA 3PRKE 1W5BA 1L5SA 4H6XA 4PG5A 4J9UE 2PGJA 2XXJA 5H4HA 2B30A 4NL4H 1MC8A 3BICA 3PQ3A 3VV3A 3WB0A 3BMOA 4KXFB 1MT0A 1FP2A 4ZRDA 3IOMA 3ET4A 3P45A 4NE9A 3FR8A 3L46A 4H15A 4CLDA 3ZD7A 5H16A 3GCGA 1N7JA 3GEBA 3HNOA 4L15A 1AHPA 2PX0A 3WMEA 3RSCA 2RSLA 2GA9A 4URZR 3UKOA 4A3SA 1MCZA 1D9XA 1MJFA 3TF5A 2Q6TA 4NDZA 3M6AA 2QVBA 3QOFA 3PPVA 3CTPA 3ROKA 4AKHA 3QG5A 2WWTA 5EGNA 5J3JA 4F5QA 2D2VA 1IZ7A 2RGUA 4UPEA 4JLMA 5H8WA 1VTKA 1J5XA 1UBHS 3S1AB 4GOJA 2Y6VA 3TSCA 1VIAA 2DYKA 4JYPA 1Q0QA 2I6QA 4TTJA 3H1FA 1RBYA 1XZJA 5EJEA 3R7SA 1RYDA 3SOZA 2IYLD 1V95A 1HYHA 1CYEA 4ZU6X 1PS9A 2FYTA 4O5KA 4MW4A 1H5QA 2H2DA 2A57A 2RHWA 1G98A 2ZPAA 4ZVQA 4PG6A 1GPLA 3IHLA 4C0AC 4FC6A 4JYZA 3GJ0A 4YV1A 4LV6A 4H4EA 4XSVA 1KOJA 4ZHQF 2C1ZA 5CLJA 2Y1EA 3O7WA 5L9XA 1QR2A 4MFFA 1HDXA 2VFAA 1NPYA 1S1CA 1RI5A 1SKSA 1GYPA 2CRXA 4WOKA 1Y6JA 4BUZA 2GJ4A 5JAOA 1AC5A 4LZNA 5C5EA 3ED5A 2W9BA 3GFPA 4YR3A 1OU4A 3KZCA 4EA6A 4G0VA 5TQ2A 1PV2A 3GYBA 4TVSA 1FYDA 2R6AA 2WZQA 4X6XA 4DBLE 5EXDA 1RSZA 1Z28A 3DTVB 5JXGA 1L4NA 1P9OA 4KO4S 1B7GO 4B4DA 2HA5A 4QUKA 4B9SA 4F2RA 1II9A 5K0CA 4WKPA 3QYPA 3K9WA 4PZOA 1ZQEA 3GDXA 2JIZD 4RCVA 4BJHB 1F6DA 4XYBA 4DA6A 1NIPA 5C5JA 1NFFA 5K01A 2C28A 1OF1A 1IDN1 4E4TA 1JAXA 4WIAA 4JODA 2XTJA 1RLTA 2N9UA 1ID8A 2R1VB 1WKCA 4GEKA 3CRMA 3BMCA 5EJAA 1DFGA 5NLLA 1VPVA 3VOSA 4ARSA 4KV7A 6CHYA 4Q37A 3L0YA 4D4HA 3OWOA 3A70A 1CCWA 3P32A 3KR1A 3IURA 3TOZA 1RYUA 2CHFA 3GNLA 1E6UA 1A97A 2VUHB 3MBOA 1MKYA 1EDEA 3NEYA 3CLRD 4OHPA 4KMSA 3ANTA 1Z33A 2Q45A 2IH2A 3DZKA 4DQRA 2CVPA 4AG6A 4U7TB 2VF8A 3OPQA 3JD3A 1W49A 5DT2A 8ICGA 3LT2A 3IAEA 4K0KB 1XRRA 1I6KA 5GOTA 2QY6A 2XOKD 4YVFA 1A7KA 2ZRGA 1HTBA 4BU0A 2XYPA 3QH4A 1YFZA 4XR9A 3R6GA 3GLKA 3RAQA 3F6CA 3QFFA 4HDRA 4I1UA 2OG2A 5J2GA 3FUCA 3NALA 1DGJA 1SVSA 3RIHA 4U63A 2YZGA 4GLLA 4Q9IA 4EL0A 4DMMA 4EHNA 2WK1A 1TUEA 5E2IA 1TKBA 4B81A 1MQAA 4BNWA 4EH1A 3IILA 2Q3EA 4UKDA 3IJRA 1Z37A 4UTRA 4GR5A 1GKIA 1YQ9A 4OREX 1O97D 1X80B 4MDFA 3VR4H 2BE9A 1GYRA 2ZZKA 4K86A 9ICEA 1SC9A 2V9CA 2WJJA 5ELLA 2G5TA 1P61B 4UBKA 2AZ4A 1X7DA 1GU1A 4H1HA 1E0KA 3F9CA 3KUKA 4RQ4A 4WASA 2WY2D 4HJRA 3LXMA 1X42A 4TXJA 4R9NA 3FNBA 4QG3A 2DE0X 5CYPA 1A71A 2MWMA 3IAM6 1DIBA 4GWKA 4B2PA 2ZJ7A 2ZFUA 1E9AA 4M1TA 3PNVA 2OPHA 2UYHA 1W0KD 3ORFA 2OO5C 1DP4A 1GXSA 3IA2A 4ZJZA 2DQZA 3SMVA 4NK4A 1BX0A 1Z0ZA 2VJYA 4Y2UA 1E3JA 4K8RB 3RB8A 5FX2A 3OPXA 1EPUA 3ZV3A 1EUQA 3JQDA 5B37A 5FYDA 4HPJB 3QV2A 4P32A 4D4GA 3FCYA 1JFFB 5HKAA 5JECA 4DFMA 4C3VA 4I9FA 1JSZA 2ZI7A 4A36A 2VRCD 3LQFA 2EAMA 3INYA 1HJPA 3R7NA 3KPJA 1V39A 1ECWA 4X1IA 1Y82A 3N5KA 2G40A 4LMBA 3EPRA 1W2GA 1FUIA 3FSEA 1EDDA 4F84A 5C5CA 2J5QA 4QOHA 1WZCA 3OE5A 2HNKA 4WN9B 3IUQA 3UHJA 5EP4A 3HCPA 2JH1A 3G23A 4YMIA 3SLRA 4DDUA 4PLCA 3QY9A 2A1TR 4TXMA 2DHCA 5ALEA 4C78A 2QAJA 5BNFA 1TMKA 2YY7A 1SCBA 5D01A 3MF4A 5BV8A 4HVAA 2QI9C 4NZZA 1GPNA 5JS7A 4F92B 3PEVA 3VHLB 5AKGA 1IC6A 5C35A 4RD4A 2JI6A 2WFAA 2YV3A 1XALA 1FP6A 2H85A 2ZIFA 2IYQA 4BV9A 3V2GA 1GLNA 3LS2A 5AVXA 2I4NA 1YS7A 3KKPA 4N48A 2Q8NA 4GAEA 4M9JA 3TD6A 2R18A 4B4VA 2ORED 4H18A 3BJYA 1PJLA 3R7DA 3PYLA 4M3NA 4MJ7A 2PV7A 5BMOA 4YLGA 4Y6PA 2PXIA 4HDCA 3VBEA 2VDKB 2B1JA 3NVDA 4UFOA 5GGXA 4LY9A 4MR7B 2R8ZA 1XKLA 4JOBA 3DMTA 3GV0A 2IUUA 2CDNA 3FWZA 4YUXA 3LWMA 4DIUA 4O2RA 2J3EA 4ID3A 5G0WA 4PAWA 2PPLA 3VPHA 1VIVA 4M83A 3FKSD 2Z5LA 2I3DA 4DBVO 1YCHA 5DTEA 6REQA 2HJGA 4ECUA 3EUAA 4KYVA 5JUMA 1SXJD 2XCUA 3GZJA 2DG2A 5KYKA 2XNKA 4V0RA 4QXOA 4DT1A 3K0AB 5JSQA 2FRDC 3VAYA 2FB9A 2WUGA 4YGYA 4MVJD 2OA0A 3DYBA 1N2CA 4PPFA 5C1DA 1KEKA 2E6UX 3TARA 5H5JA 3CZPA 3UTCA 1X0XA 1E2DA 2YXDA 1G7TA 2RGWA 4ZO9A 4Y9SA 3WL4A 4HNSA 3Q6MA 3F5EA 2CSXA 2C58A 3CJQA 2CSUA 3LXXA 1GSOA 5FTJA 2O23A 4AY6A 1USWA 1A4UA 3PGA1 4CIVA 1H5NA 1BKSB 2AXEA 2OVBA 3CUVA 5AHWA 1U5AA 4JP1A 5BO5A 2C95A 1WQ3A 4FNAA 5I7FA 3TIVA 2G5CA 1W7AA 1YZUA 3IIMA 1E3LA 1HLPA 2QUHA 3P4YA 4B3HA 5KYTA 1Y3FE 2Z9BA 2QRPA 1QX4A 5DHAA 2NUAA 4NLLA 2C03A 5KYYA 3UWOA 2F1KA 2HOIA 4Q4JA 1H5UA 5K3AA 2X3YA 3T1OA 1NZDA 4FFRA 3LECA 7ICNA 3WADA 3DD1A 1IY0A 3KJHA 4QFBA 3I9NA 1FFAA 1X8LA 3GV5B 3L93A 3BIXA 2EXXA 4NZMA 3LPCA 4MLZA 4JI2B 1IBCA 1QZUA 3EPJA 1SJ9A 4NMMA 1AH2A 1YA8A 2K8CB 4DIKA 3EZ5A 5PNTA 3MYYA 1D8BA 1WXIA 4A73A 2XNDA 3VDXA 3TLCA 3QEBZ 1JTFA 2HPZA 5FWYA 3FOBA 3O90A 4IVNA 3LX6A 1OH8A 4ZAWA 3K20A 3VO1A 2WYVA 4MLDA 5KKCA 1MU0A 3A27A 4LHWA 2VJCA 5JNLA 4CCYB 1YB6A 2EL9A 1PDVA 3GDFA 5SYAA 4ASUD 1VL5A 1Q0PA 3U40A 3RTAA 4I4IA 1G20B 3UW3A 3GHYA 1GUYA 3OM1A 4HWKA 3OA0A 1L4GA 4GI1A 5DLEA 3F5QA 1L4HA 3FUUA 3AEKA 5AW7A 5EYPB 2P2YA 2V5VA 2QQ0A 2OXIA 1Q1NA 3L6RA 3AFOA 2PVCA 1RABA 4CM8B 2KOBA 1V8BA 1Y9EA 3A9TA 4INOA 4Y6RA 4C3ZA 2RH8A 1BXRB 2BFBA 3CF2A 2OM6A 2DPHA 1JQAA 2KIVA 3NNNA 1R6UA 3ROQA 1V97A 1UXOA 2WIDA 1FXWF 3VOBA 3OP4A 3BAZA 5ITWA 1Y48E 1TVCA 2VT6A 2BONA 3U0BA 3LAWA 5AVUA 4NXMB 3E9YA 4K26A 4D26A 4LOLA 2XOEA 3L04A 3TL3A 4WXYB 1E2KA 3T35A 1DKPA 1YMUA 2PR2A 4YJGB 3GY0A 3PFNA 4N8DA 4MNTA 1BHO1 4HY3A 3H87A 1HYBA 5BUSA 4FS8A 5FRDA 4EFMA 3UC9A 4C5AA 3WA6A 2HX1A 1P1BA 4FYPA 3GT3A 1OREA 4M2YA 3IESA 3CNHA 3N53A 3M7DA 4HSEA 2L69A 1ZD5A 1LC0A 4CDRA 1IBKB 5TS2A 3FPGA 5IT0A 2I1LA 3WJ1A 4MW6A 3GJ8A 5J8YC 5B64A 3QU5A 2VJAA 2QV7A 4ZCQA 3IV6A 4KE7A 4OBEA 1KKLA 1X9GA 5IKMA 1AD2A 3CHYA 1PJAA 3JQFA 5KJCA 5FWNA 3DAYA 3OLZA 4NQRA 3KZXA 2ZIZA 2GWHA 3PCRB 4EYQA 4X7PA 3SKVA 3W2TA 2W6JA 2OCLA 1LK7A 2JHCA 2BMEA 3H5IA 4IYJA 1KMHA 4Y7DA 5EZQA 4ND5A 5LWQA 3GL9A 5B58C 4C5BA 5LQKA 4R7TA 3A4MA 4R3NA 4RK0A 1WUDA 4H08A 5F4BA 2BOVA 2NO1A 5ELMA 3ST7A 1DFIA 2ZJYA 5EPEA 1I14A 3OZUA 1SUIA 1BG6A 1YJ8A 1J33A 2J0UB 3G0CA 3M4XA 4OEHA 4C8NA 1CJTC 3AESB 2CE7A 1G63A 1KAQA 1RLUA 4ZVUA 4Q18A 4X65B 3PR5B 1ML3A 4G4SP 1T1GA 2A92A 3WGNA 3BH7A 4IL5A 3CRVA 2L82A 2CHGA 2CJYA 2KKPA 4RM3A 3QELB 3CCFA 1VPEA 4B47A 4B4OA 4Z4HA 3T5GA 3KJGA 4BE9A 1K6MA 1V35A 1PJTA 4F4WA 4L85A 3RSFA 3O47A 1BXGB 4C7XA 2XBUA 4RK7A 5KYXA 1FFSA 1LBHA 1T13A 1NHGA 4FYXA 5I8PA 4Q93A 2VP9A 1CP3A 3V1KA 3TL6A 1DEKA 1KDRA 1GKUB 3NTLA 2F43A 4H1WA 4ZU1X 3W5AA 1VLVA 3H2GA 2C54A 2RC6A 4MI1A 2VOJA 1LDEA 2C5HA 4EX7A 4RUKA 4ESOA 4BNDA 3KTAB 2XY5A 3P71T 4F2WA 1SM4A 1O4VA 3MD0A 4MMYB 3PHCA 3HRHA 5FJJA 3VYUB 4IIXA 2WM8A 3VMMA 2O4UX 2VEOA 4EPVA 4A10A 3DNMA 4UAJA 1U8EA 3KUDA 3IMEA 1NWCA 4P81A 2IYAA 2BI8A 5CYGA 3QEOA 5C37A 2IEIA 1UC8A 1YJBA 4PLTA 1MGOA 2VHWA 2IUFA 3RC8A 2Q2NA 1TB4A 4HZGA 4FMDB 2IIVA 5JAHA 5L3VA 4JGGA 4CE6A 1R6BX 4ZTBA 1ZQZA 3M9MB 1B73A 1WSDA 2YBEA 3VR5A 1CVLA 2ZR7A 1F9EA 4IGKA 3VV2A 1GQRA 3UUFA 2YB1A 3EZYA 3NS1A 1MT3A 3SX0A 4WCDA 2G5PA 1GA1A 4HH1A 4W7HA 1WDLA 1ISJA 4ZT7A 5M2QA 2FPIA 5LDDC 4GZLA 2PT7A 3K1TA 1T2VA 1JE0A 3F2DA 2SHKA 1FRZA 2OCIA 4DQIA 1MG5A 2ZUUA 2DJ5A 2VQSA 5BYBA 3HO6A 5AXAA 4NAVA 1B16A 4O1MA 3FTCA 3OQBA 4DSTA 3U7EB 1R7RA 3UWKA 4DR5B 1U6KA 1V45E 3HR4A 5IXJA 4AJ1A 1HDGO 4KG7A 5REQA 2VSXA 3OE7A 4L76A 4Y2YA 2GAOA 4RANA 2A14A 4BAUA 4Z1OA 2O54A 2QAGB 5DOVA 3R0ZA 1RLOA 3S6JA 3F4LA 1L5QA 5LQNA 4B3MB 3J7TA 4OI2A 3VA7A 2GK3A 3QVJA 5F9FA 3C3XA 5JCZA 4BUCA 3BA6A 3O8RA 3OECA 4BN4A 1JG2A 3BGSA 3VJLA 5BN4A 1M7HA 1VMIA 3IUSA 2H4WA 3DBRA 5JBIA 1DIOB 1E5DA 3W6UA 3A1FA 1S8AA 1H2AS 1IIPA 3A6GA 4NM2A 3JARA 3SEZA 4U39A 1VGRA 4MKXA 1AK9A 5ALDA 1CR4A 3B8EA 1X1DA 4BBPA 1EFPB 1CEYA 2ZVJA 5IN4A 2Z4RA 4U0KA 3K2EA 3D7LA 3EXEA 5IWAB 1DS6A 5C2JB 1Z47A 1I2CA 4IFBA 4HQKA 3C8ZA 3K2IA 5CXSA 3TD2A 2UVWA 1NR7A 2DQYA 5BQOA 2VHYA 1ILEA 4UAWA 4I19A 4GIBA 4N47A 1SKWA 2VP4A 3E53A 2HSEA 3DDHA 2LI6A 5K6TA 2K4MA 1ZOOA 4PV7A 1NYLA 3ILXA 4CTNA 2WSSD 3DL7A 1RTKA 4R0NA 4A0SA 1OUQA 3IE2A 2OXCA 2IKSA 4JEHA 3OOJA 4RTJA 1S97A 1M1ZA 1GV1A 3SDBA 3D31A 1BMFD 1DGQA 3CP8A 4MVCA 1RNLA 3O74A 3NC4A 4RIFA 3EXG1 1E2HA 2B4YA 1YE5A 4L4YA 1PJ4A 2ISSD 3I01A 3EPIA 5H80A 3D6VA 1E1RA 4KLAA 4ENPA 3EPGA 2Z8YA 3AFHA 3V7YA 4AQYB 5IAAA 4D80A 2WTXA 2IHNA 4URXR 1KRWA 5DQHA 5KTSA 4E7OA 1LKYB 1IUNA 4NTZA 4BUGA 4BMNA 4P35A 2F44A 2BZ0A 2EF1A 1WZNA 4DY6A 4XM0A 4KCGA 2IRWA 1T3ZA 3KJIA 3FPCA 1PYGA 3R7AA 4U2DA 4U7WA 1IQUA 2OR3A 4R68A 1I0LA 1NSYA 2Q7XA 5KFUA 3RJJA 1MX1A 1D04A 3L49A 4MULA 5AXCA 1ACMA 1UF9A 3VU9B 1G20E 5HE9A 5DTQA 4WZBB 3C7TA 2W54A 4URYR 2NRXA 2J7KA 1E69A 3A36A 3ZD8A 2NXCA 2QPLA 2UYOA 4NENA 2OG1A 1KK0A 1EGMB 2GASA 1KY2A 4O4HA 4KFRA 3SM3A 4YJFA 4GOOD 5BW4A 2IXBA 3FCAA 1JB1A 2CL5A 4YAEA 1NN5A 2EGUA 1OA0A 3TBFA 2B5WA 2VAMA 3NGLA 1NMYA 3KD2A 3UW1A 1C7FA 3ZIUA 4JR1A 4CW7A 2F3SA 3RS2A 3L4BA 2VYFA 4DF8A 5IDYA 3ESYA 3M2PA 1LLCA 4I6JA 2NUPA 1EXMA 2ECKA 4UM9D 3AIMA 1TYEB 3MPUA 1EDOA 2IHKA 3NUQA 1BX1A 1M5TA 4CMAA 1BE1A 1P1KA 3VPBA 3BFXA 4MI3A 4XQEA 3RH0A 2CLHB 4EJSB 1H66A 5ESDA 1E4YA 3VR5H 1T4DA 2PXAA 3LGSA 4MPJA 4C0KA 4WPGA 2DQKA 3QWIA 4PVCA 3NNDA 2CCGA 4C76A 5DK4A 2W8LA 5FUYA 1TL7C 2DUUA 4GWLA 4GSKA 5IM5A 4C0XA 1GN8A 1NK0A 3FROA 5F33A 5FWAA 3CG0A 1NK6A 3CNLA 1EFAA 1W96A 3EYZA 1A6SA 4ZEOA 3V2UA 1NT2A 1ODSA 2ASDA 1H05A 4JFAA 2JI4A 4PRYA 1PHRA 1VDMA 2Y6UA 5JNUA 5G40A 1EYZA 2PO5A 4MICA 5ALKA 1XNQB 5KJEA 7AT1A 4BAGA 1IBSA 3M1AA 3M1LA 2PS0A 1S0MA 2IS1A 1D6NA 2CFCA 4AN1A 4LE1A 4YAUA 4NDNE 4TV9B 2J1LA 4EEYA 2C3YA 2DLCX 3NTRA 8LDHA 4TLBA 3SBEA 1PV4A 1KO5A 1UKVY 2R8GA 1JLRA 4IWXA 1ACLA 2PSSA 3KKEA 4DCMA 4ABTA 4XX0A 2XZTA 2Z1DA 1WEKA 2RGRA 2XVMA 3KO8A 3Q6NA 4QUAA 3R3JA 3GLIA 3M4ZA 2HJSA 3HA3A 1RZTA 1WMSA 3T4PA 4Z9BA 4URWR 1NW6A 3KZOA 4F4DA 1NFQA 3U3OA 4BN0A 3FMIA 2WNHA 2MSDB 3EY4A 5AXBA 1Y6ZA 1ZJJA 3GJ6A 4E1AA 2Y1LA 3IAAA 1PJ2A 3SIRA 4JASB 5IABA 1ZQLA 3MUNA 2FUEA 3EXHB 4M7RA 2F9MA 4RDCA 1JZTA 4HH0A 1RC8A 1KFCB 5EVJA 1TCCA 3D3QA 3BXGA 2XYQA 3GEEA 3THYA 1ZESA 1DX9A 3JR3A 4JEIA 4IDCA 2E5FA 2QLTA 4KUEA 4QZEA 4K6MA 3KWJA 3A1EA 1G59A 1RCFA 4HQLA 2DLDA 2A8YA 2EQBA 5FO1A 4HAWA 2JAWA 4BKOA 3WKCA 2HB6A 1ZK0A 3DWFA 2ZE8A 2C78A 4YQFA 1GTG1 3VOAA 1PGPA 1NX6A 2E1RA 3F7NA 2FSGA 1DRJA 3OLYA 1X7YA 2F9LA 2E4WA 5CEEA 3F2VA 3PR4A 2EHJA 3PF9A 3CUYA 1ZXIA 1UBFA 4D2IA 2EU8A 4FM9A 4REQA 4D8YA 1NZFA 4G89A 1P33A 4HYEA 1OXXK 1DWQA 3SQIA 3KT3A 3NIFB 5C81A 5LMCA 3QX9A 3RVPA 5EC8A 5CB4B 3D81A 1V96A 3IPLA 4ZJYA 1G5PA 1KR5A 3HL0A 4TMWA 5HJ2A 1I3MA 1G1AA 2BE7A 1ORDA 1AUOA 1EP2B 1ZM9A 5KAMA 3MRTA 3LCRA 1HH4A 5FI0B 1A8IA 1E7YA 4M9NA 4HVLA 1ZH8A 5KFDA 4MRRA 4FMBB 3GUVA 2QL9A 3AEZA 3F3KA 1VSUA 1EFRA 5JO0A 3GWGA 4ZCPA 3GIWA 2VZ8A 3FMPB 2X0JA 4WA8A 2QN6A 1U5BB 2WD9A 8ICBA 2FTKE 3ZTWA 1YJ5A 3HZHA 3W2GA 3LCUA 4OJLA 3L8HA 2N47A 2WIGA 4GGPA 2BFCA 2FPRA 3JQQA 3HCDA 3OJCA 2HUPA 5GONF 1A9ZA 5CB8A 3PTLA 4A0GA 3NHAA 1AXGA 3OBIA 2CBXA 2AQ4A 2NU8B 3GH1A 2J87A 4WBSA 2R86A 3N2ZB 1RAEA 2GN1A 3JPNA 1FFYA 5ALSA 3R2JA 4DA4A 2VHTA 3AU9A 3CPJB 4NAHA 2C0CA 2AYZA 1JYEA 4QYSA 3AM3A 4R69A 2D13A 1QR6A 3CZMA 2G9UA 5INTA 3VZSA 9LDTA 2GPNA 1X39A 2VF2A 1R4MA 2WILA 3UWSA 3ZZ1A 5HKKA 2AI2A 5ADWA 4FDTA 3LKVA 1HBJA 3GLRA 1T3GA 8ICNA 4M1KA 3GGJA 2Z30A 3OIVA 5C4IA 5IHXA 2QDKA 2XT6A 5IYZB 2WOOA 4RQ8A 1QVRA 1GCOA 5E3IA 4RQMA 3CLRC 2R6R1 4Q4LA 2CFRA 3UJ9A 4UU7A 3M83A 3BSFA 1C8BA 4O4IA 2OO3A 1NM5A 4US0R 1U28A 2H3IA 1NBIA 1HE5A 2EBWA 4KLZA 2ZTHA 4FYKA 1NKEA 1SVKA 3DE0X 3F5FA 1QHSA 4JIMA 4INAA 4UZEA 3TQTA 1XPUA 4GW3A 4RH3A 1K0UA 3FWPA 4AT1A 1C4OA 2Q50A 1SCUA 4J0GA 5CVJA 5JHHB 2AMVA 3FCUB 1UMCA 3IDWA 4MRVA 1SUAA 4IHJA 3C85A 5DRYA 4MAMA 4GMFA 2CXHA 5FI3A 4PLGA 1SXDA 5A5FA 2Q5CA 2AG6A 5LC1A 1KYYA 1HTWA 4FLEA 3UANA 2X7JA 5C8YB 1VJGA 2XMCA 4CI0B 2RHFA 5M04A 3WO0A 5TLSA 4KQ1A 2WWRA 4RVHA 3QTLA 5HK9A 4DWJA 3SZUA 4IOLA 1NVGA 1ZQAA 2H00A 4L4SA 4Q3LA 1ODIA 5EL0A 3SQDA 4B2YA 2QN1A 2YV4A 4KYIB 2FF5A 5T14A 5A6SB 1E0SA 4CQMA 1HT3A 1O97C 5C8DA 3RWOA 4B85A 4Y9UA 4YXWA 1ZK2A 4NMWA 3OCUA 1JWLA 4UJ3A 2XRMA 2R5WA 1CBUA 2HCFA 1PX2A 3KYIB 3HDQA 3E84A 5EERA 5K09A 4JHLA 5C3MA 1NVWQ 2X4IA 3JAKB 5KX5A 3QKTA 3NBXX 2QTZA 2XNCA 3F5SA 5KFQA 2XUOA 3L7IA 4JBGA 4KFSA 1JLLB 4AZ0A 4I4NA 2O2HA 2VJNA 2DVMA 3VSAA 4JV1A 3KHKA 1ZK3A 2JANA 4ZOEA 2ZUWA 3HDTA 4WZBE 1XV5A 3OTWA 3WGGA 1Q50A 5F52A 3H2ZA 4BQSA 4R9UC 1U2ZA 3DUFB 4CQLB 4RO0A 3PQ2A 1HETA 4NG4A 4KQGA 5M5BA 1G291 4AU1A 1D1QA 4E6PA 4FE3A 3BFKA 4LHZA 1KQQA 1N0HA 5KNDA 3DZ8A 3KB1A 3GNQA 5EP3A 4HLDA 4YRSA 3VR2A 3KEFA 3F96A 3PG5A 4Q4HB 3WRXC 4LNHA 2K5UA 2F1RA 1Q3VA 3Q98A 2O3QA 3BD9A 1OW3B 3W5UA 4EENA 1MHTA 4BBZA 3C7DB 4DCJA 2JFBA 5J0RA 3P2IA 1MJGM 1MXFA 1AGNA 7ICPA 4IJVA 5BV2P 3GJ3A 1YE8A 4HN4B 2VCEA 1OJLA 2JIBA 2EFGA 3O38A 4CKEB 2N0SA 1S7GA 2FQYA 4NJMB 3GP3A 3U49A 4GQBA 4G0QA 1P2TA 3K09C 4LDAA 3ZE7A 3WIEA 3EPPA 2JLUA 3KAPA 4C7BA 3GV7B 4DLXA 1IOWA 2C7GA 1VIMA 5FTNA 3KTFA 2R6ZA 3OLWA 1JALA 3P9ZA 4JUZA 4UHFA 4I5IA 3DJYA 1UWCA 1JIUA 2W4IA 4GR9A 5FEUA 2D7CA 2Q99A 1P7PA 3A3NA 1H2XA 3RDPA 1E20A 4KH0A 3RRBA 4V3CA 3GOHA 2E8OA 4C6TB 5KFXA 5BSFA 3OMWA 3ZE0B 3FWYA 4MCAA 1Z75A 4YCCA 4WK0B 1Q3UA 1UZLA 5D46A 4TKZA 2Z3ZA 5BVHA 3GLHB 5T3YA 3U80A 4QOSA 2JZBB 1RBQA 4RPJA 5IJ9B 3SS9X 2XV1A 3ANYB 3ER6A 4G5RA 4AIRA 5ADVA 3TOSA 3AWDA 4DLUA 3L6OO 4RZIA 1FDIA 4PQYA 4WOCA 1AZWA 1Z6GA 1V2HE 3FSRA 3HVRA 1OFGA 3HN7A 4X45A 3CVUA 4UNRA 5DMHA 1BGVA 4EJMA 4EDFA 4EO9A 1SA0B 3RBXA 4YYEA 3FR7A 1DOAA 1SXJC 2UVUA 4MPPA 2VQ3A 5JZSA 3GIDA 4OHRA 1ST3A 3QSGA 1EUYA 2YL2A 1DKMA 4PBRA 4Y2XA 4BZZA 4CF7A 4ZAZA 2Q7OE 2V1XA 3DE1X 4ARVA 5EP1A 2WA2A 2J3KA 1O6CA 3IMFA 3S28A 2FPPA 3IXMA 4UOQA 1OXTA 2XTZA 4ZKEA 1CY0A 4TT3D 4REOA 3D8UA 1ETUA 4CTKA 5IMBA 4ZYTA 3AHDA 2AK2A 3A1TA 4QODA 4J9LA 3MINB 3DL4A 5JTTA 1J39A 5FBLB 3IDQA 4EY4A 5DT9A 3HTXA 4KXXA 2VLBA 1L4BA 1VMEA 4HDKA 1N77A 4BQRA 3ESBA 1W4LA 4LJ8A 1PLKA 3AV3A 2O2XA 2OBLA 5DU2A 3IH5A 8ICOA 2AC4A 5KTYA 4DJJA 3TE7A 1CVRA 4PO9A 5B30A 1R10A 4ZAXA 4C0JA 1CRQA 2VDOB 3DOOA 1A3CA 5IUNC 5D00A 1S0OA 2H1HA 1P5ZB 2AMFA 3CW2C 3O9ZA 4IIYA 1GAQA 2A0UA 3EQ2A 5JHGB 3QEMB 5TS3A 3DXYA 4DILA 3A05A 5A4DA 5ICCA 2IPLA 1P0QA 2XB4A 3LZDA 3KU1A 2A1IA 5B4UA 4DNXA 1T6BY 1NUSA 3LU1A 2G1JA 1SEPA 1E1QA 5ECWA 4XVUA 1N6KA 5H0IA 3CRXA 4WNCA 1FFWA 3GXBA 5E4FA 3OM9A 3HACA 1Z5ZA 5KTOA 4LJRA 2R8RA 4O2LA 4OJYA 5K8UA 2K8BB 1CDDA 1MZVA 1ZA2A 3L05A 4XLZA 1SHZA 3TEFA 1W25A 3C8UA 3D3WB 5I7VA 3F1LA 2PUCA 1B6GA 4NICA 2BC9A 1TW3A 3OFNA 2PY6A 3CIOA 1SGWA 1XMOB 3BB1A 4FMCF 5AQ1A 4QDJA 2EDUA 3JQAA 1L7QA 4R41A 1AUQA 3ZQUA 3C6YA 4MW7A 2GBIA 4NX2A 5JVDB 1PK1B 1Z07A 5A3VA 1NF9A 1FIUA 3U4MA 5DN9A 2Y0BA 2EKPA 3O8DA 4UDNA 2VDLB 2JGJA 2WYOA 3NWPA 1ZWKA 2KZMA 3VH1A 5MDHA 1X14A 3HKZC 4UARA 4C07A 3S2FA 4O2AB 3VZRA 4MRMB 3KTQA 4NCJA 4QARA 1NXXA 1RKVA 1YQGA 2P9HA 5KNDH 4EGJA 4P31A 4DGQA 3PXGA 4W63A 2BEWA 2C8JA 3HB1A 1I51A 4C7MA 3CW8X 3H2BA 3ZCVA 1GUDA 2WTAA 3A3PA 2PD3A 4J0EA 4K28A 2NSHA 2G09A 3LIIA 2RDJA 4LXHA 3GGPA 2BUBA 3ZQKA 1P91A 4YMOA 3PYXA 3DBHB 1UFQA 4HS4A 2VKQA 2YMQA 1QYIA 1CERA 3LY5A 3F6YA 2XPCA 2OBBA 4P4SA 5EKXA 4D7AA 1NJ5A 2GJAA 3DMRA 5JNRA 3JQ7B 2ECQA 4BNFA 3RVDA 1H0HA 3NHJA 3GFOA 5LYJA 5D5HA 4YRTA 1RW4A 2PX4A 4O3RA 2PL3A 4COOA 4GF5A 2D1FA 1OWOA 2X2OA 1GLVA 1HZZA 4HK4A 2NTVA 3DOUA 2Q6LA 4XGKA 2GS9A 3GN1A 1OXKB 5KFCA 2O8EA 1L4FA 1T6NA 1L5OA 4HH4A 3W5HA 4YMWA 4PR3A 5I7AA 3FAKA 3WWYA 1R0LA 2I6FA 3HXTA 2NZUG 2JARA 1Q0SA 2BM8A 2BLNA 3EUWA 4X44A 2OKCA 4GX0A 5DNYB 3RJ9A 4JBLA 2C20A 1XMVA 3W1WA 4ZRMA 2HWXA 1D8YA 4L6AA 4D6XA 4MEYA 3MJTA 2EP7A 3TAHA 1ZRHA 3HKDA 3ETNA 3LK7A 5I9NA 3Q15C 1Q7EA 4JVSB 1KDYA 3PEYA 1NLYA 2R66A 3DCNA 5K7SA 1PF7E 3FRHA 4REMA 2VTEA 1KJ9A 4M1YA 3U6BA 3ZLBA 1RPZA 3GT0A 1S2DA 4ENWA 2BMVA 2W55A 1C1DB 1XCGB 2D1SA 3DDSA 4QTTB 3GNTA 3R76A 2COUA 1HEUA 3TRFA 2F64A 1FRQA 4CV3A 5IASA 2X0RA 2VDQB 3FHOA 3JQPA 3HHEA 2XB9A 3H11A 2PHZA 4TSKA 7ADHA 1IEQA 4CZ2A 2ECPA 1FYWA 1TEZA 3EIEA 2OGSA 4UBNA 5JFOA 2J6IA 5CCBA 2GKOA 3SNHA 3EFHA 2WVGA 2OO7A 2Z1MA 2JJ2A 4EYIB 4HJXA 4JX9A 7REQB 2WAQC 3LUJA 3P0IA 4JN6B 4C2UA 5CD1A 1YZTA 4YRRA 1CJKC 2QUAA 1GL3A 3RRYA 4J0IA 5BXYA 2EGHA 2A33A 2YMMA 1Z6AA 1KI8A 2FZ4A 2PX6A 4H77A 5CFZA 4KLJA 1TC2A 4KYTA 5HVNA 2JAQA 4B7UA 1WPXA 3DCIA 2ZROA 3KT0A 2HLPA 1O94C 3M3HA 4U6NA 1LSOA 2GWRA 5LOVF 3T5LA 3U48A 4IQVA 3ITDA 2PA3A 3FMOB 1JDVA 2C94A 5JZ9A 3F2BA 3P26A 3GLGA 2C4NA 2JR5A 5CM2Z 1ITZA 4Y6LA 3R8XA 2Q4BA 4DY4A 3L82B 4W9NC 5LXTA 3M81A 4HWSA 1QSLA 4Q39A 1NR1A 4D9CA 4GC9A 3C5WP 2PMBA 1P6QA 2JEYA 5G3YA 2QPOA 1B8UA 3BQNB 4DSKA 4KQ6A 1TD1A 4ZO8A 4PNEA 2OBMA 2C9ZA 1EB9A 3WS7A 3KZVA 3PFGA 2F4VB 4OL0A 4IO1A 5JAMA 4QPDA 2IY9A 1WM1A 1L5VA 2G82A 1GCGA 2HSDA 3CT6A 2JRZA 4JLAA 3WNZA 3AUAA 3NIWA 2H4HA 2A86A 4Y9TA 2ZB4A 4JS0A 3AILA 5FAXA 4CHGA 1Z6PA 2H0AA 4HLNA 2GRAA 1RPTA 4IIEA 4BNYA 3OZIA 2G1KA 3JVDA 2HZ7A 4DCSA 2RHDA 4KWIA 1OC2A 4JQSA 3TJZA 5DCWA 2XUQA 1EFKA 5BT8A 5JPCA 3A6ZA 1RQPA 5NULA 2EQAA 1IXZA 4J7CA 4XLLA 3KEMA 4J0CA 9ICQA 1CUZA 3SAFA 3ZE1B 3AHCA 2G9QA 3TGPA 2GLEA 3K2BA 1D4OA 3DDUA 3QHPA 3ZI4A 1U1IA 3MJEA 2JEIA 3O4GA 1YR7A 2YFHA 1QGYA 4UEKA 2ZJ4A 4LSGA 1L8XA 4L16A 2QTRA 1KNQA 3DEAA 5KYVA 4FKBA 3X1YA 2BZSA 3PGJA 1OQAA 4OFWA 1J97A 1WW8A 2YUTA 4OXIA 1MORA 3TTTA 1EG7A 3O9VA 2ZKLA 1IMOA 3EY9A 1OH7A 1X66A 4DAOA 1ZU5A 2ZRBA 1R0KA 2QLJA 3KB2A 1ZIPA 3TTSA 4DDVA 2PGXA 1VXOA 5AKYA 1JR3E 3ZQJA 3LHSA 1NVVQ 3ELUA 4F5EA 3QUBA 1JU4A 3TI9A 2BEVB 5CA0A 2ZIAA 2PJDA 4CWAA 3CO0S 3Q12A 2JAXA 3JXEA 1SQSA 4S24A 3K35A 1RVV1 5KTMA 4BXOA 1SL0A 1CQXA 3DA8A 3GC6A 1Y9ZA 4QZ9A 2ZUDA 4MVJP 3VNUA 4W6ZA 2MSWA 1I2DA 3KVNA 4OQZA 1BN6A 4FFWA 1LDBA 4HUTA 2NLOA 1WDTA 4R1LA 3A4NA 3KQWA 4AKGA 4IJUA 3L8FA 1NQWA 4L50A 3DT9A 3O4JA 4KQMA 2FUG1 1RXIA 3H2SA 3LC0A 2GARA 1ZVMA 4DL6A 1NKTA 4X92A 3HY6A 1AT1A 3OWXA 9ICTA 4BVAA 2VP0A 4G0UA 3C2KA 3T5AA 1XL0A 1U2DC 4ZV9A 2XECA 4P98A 5K0SA 4D9KA 1K2WA 2C8LA 3MS2A 2ZRKA 1J7JA 3W04A 3MMXA 1NWHA 5EJGA 4MO9A 4MI6A 1H85A 3PWSA 1IRXA 1POWA 4R9VA 3QVLA 1Q6YA 1M2KA 4FBLA 4KBFA 2YB4A 4FX2A 1O9HA 2HC9A 4O25A 1E1DA 1YTUA 1DEXA 2PYZA 4FBGA 2W2KB 2CLOB 2H4ZA 1QAMA 4Z9AA 3BE4A 1IN7A 3Q88A 1Y80A 4YPVA 1QK4A 4JX8A 1DKUA 2H29A 2IZ0A 4QOEA 4AJIA 1R27A 3TJMA 3GLUA 3VR3D 3JZFA 1W75A 3UA4A 1MQ3A 1PNQA 1HG1A 3UYKA 1NXTA 4YLEA 5PGMA 2J32A 3LH5A 3B48A 2XQGA 2YMPA 1CLUA 1LBTA 4L0DA 4LE0A 2V3VA 2YDXA 1J7KA 4OVKA 5K3BA 4KDEA 2V03A 4BC0A 4AMZA 4P7KA 3P9XA 2QDXA 3NHZA 1JJVA 3NVZA 1W2HA 2PYDA 4W5RA 4GOMD 4L9AA 2FHSA 2OECA 1T3NA 4FXOA 5KFTA 5KT2A 5CVDA 1Z5NA 2NWQA 4PCAA 2CE2X 4RA9A 3SP1A 4HXEB 1C81A 4Z4FA 2PD6A 3R7FA 2VNAA 1U8XX 4UCWA 1NJYA 1P4AA 2FP4B 5IC5A 3HJFA 4D0RA 2Z2ZA 2MR6A 4QRIA 5IEBA 2EZ9A 1JXOA 1CQZA 1JFRA 1UEIA 3BS5A 4YAJA 1YVUA 5JZBA 3NOQA 2XBLA 1L9XA 3TJRA 4WX2B 1H69A 3VX4A 3QUAA 1ZJWA 3G0IA 1I1OA 3CVJA 2V65A 4MMXB 4TLLB 4HYQA 5C8ZA 3I5UA 2GKGA 1II8A 4OH1A 2ANCA 2QTMA 1VI2A 1M6EX 3OZGA 3GLTA 4TUYA 3A1DA 2V5UA 1LBSA 1EMDA 3DM9B 5TMDA 1S8NA 4CIDA 4MF2A 3KZ1E 4PSCA 2JGNA 1OLXB 4HUQB 2HNAA 2YZ7A 3W8DA 3ES9A 1ZFNA 3IQHX 2DJIA 2LWIA 2QTTA 1U8UA 1NY6A 5T64A 3KIPA 2PIAA 5JJ5A 4LC9A 1FZQA 2Q2OA 1YKGA 3KU4A 3SWWA 3DMDA 2JD2A 4K8OA 4JMLA 4NBRA 3SQNA 3O82A 3BGOS 2O0MA 1SB3C 5GJCA 3KKZA 3PA6A 1QYVA 1O54A 5FL7D 1QLJA 3S5UA 5TV2A 6LDHA 1R0SA 3HDYA 4BYGA 3WMGA 1DIHA 2G6BA 4GS5A 1R6DA 2E55A 2CWDA 4BNLA 2EEZA 2LR0A 3ITEA 3WNDA 4DG8A 2MRLA 5JC8A 1UZNA 1E3MA 3HB4X 5C1BA 2HF9A 2Y27A 1KFKB 1PI3A 4M4SA 4LRTB 3M2TA 2WV7A 4Z86A 4IIUA 1M8JA 2JFOA 4N6NA 1HE4A 3EVGA 3Q7SA 3RBZA 3TZ6A 1BE8A 3VYVA 4NIMA 2AKAB 1HUOA 2UKDA 5KJ1A 3BHMA 3PSPA 1PX0A 3L43A 1QGAA 2HK6A 1DEAA 4MK4A 1XTQA 4X8MA 5D84A 1N9GB 3U31A 3UY4A 1VCMA 2MOKA 5CAEB 1C7JA 3N8GA 4X54A 1OB2A 4WGGA 4JDUA 4F85A 4XCXA 4HGZA 3AL3A 4PRLA 1CJUC 2QW1A 1KAEA 4BLQA 3M89A 3DLAA 2Y0DA 3HVUA 2AYXA 1E7QA 4MI9A 3EC7A 4S2UA 4R1SA 3KD3A 4FNMA 3ESAA 1R88A 3J80A 3C7AA 4FEEA 1XKXA 3HYCA 3WYBA 4EUKA 5MN5A 1KZ4A 2PSJA 1YQDA 2OESA 4FGWA 1T9GR 4DB4A 2I6GA 3Q3CA 1O94D 4CF5A 4J0KA 1J0AA 1G3MA 3VHQA 2P0YA 1MW8X 1USUA 1ACJA 3TACB 3S55A 1CY6A 4M8SA 2WHQA 4M9UA 4MVJI 4F3NA 1P2VA 4NZPA 4PZAA 1OFIA 5AW3A 2YDYA 2QE7D 1UPCA 3ND5A 4DR4B 2CVQA 3VPAA 4HZUA 2IHBA 5FXMA 1Z7GA 1Z83A 4RXTA 5U1PA 1SUDA 2Q2VA 5HF8A 3HILA 1RRVA 1IM4A 4ALLA 1JQBA 1LPOA 3N07A 1UKYA 3QLEA 2Y9TA 2DKNA 1QHNA 1UJNA 1Z2AA 3LY8A 1D2RA 2WF6A 3RJGA 1V3TA 3AY7A 1E5TA 1XVVA 3LQRA 5EQFA 1U94A 3AQIA 2KV2A 4OK3A 4A8JA 1Y8CA 3TW0A 3FDFA 2YFYA 2GEDA 2GOLA 1KO8A 5JW6A 3W8NA 1US8A 1ZJ6A 1IOLA 2ODBA 2D6FA 4D4IA 4DL7A 1A4XA 1JEDA 3RYCA 5GGYA 3GRAA 1OC4A 3G7SA 5IJWA 2A88A 1IVSA 1A9PA 1D5WA 4Z6KA 5AESA 1EVZA 5A06A 3MWLA 5EMNA 4J2HA 1VIYA 2XUDA 1T0HB 4TWIA 3GB9A 3GFVA 2EBUA 4DLRA 3LGAA 4TZ0A 5FO0A 4BMPB 3A1NA 5JNWA 1T36A 3AEXA 4F04A 4DPLA 4EPXA 2QAIA 1N32B 5A3JA 4GGOA 3N5CA 4JP2A 5E7MA 2L18A 3Q8RB 1GUZA 2G6TA 1P7YA 3LG2A 2P4UA 2FR0A 3QXCA 1PW5A 1U99A 2E5WA 3V3TA 2PL1A 1EU1A 4Q6BA 4LWZA 3V46A 4DV4B 2FWJA 2WAXA 1UDWA 5CHYA 4FVTA 4F6RB 3FRIA 1MO3A 1VE6A 3EWSA 2XYVA 3RH6A 3NWJA 2Y4OA 3PXEA 1A9XB 1VCOA 3H1TA 3KUXA 5KTQA 1ZRNA 1M67A 1GL6A 3W5CA 1K1QA 4N03A 3FOWA 5JYBA 4AYWA 1GTMA 2CDCA 1PJZA 3BB4A 3DE6X 1TKDA 3FTFA 2VPTA 3AIKA 4RQ7A 4YWHA 4AYBC 5KFNA 2VTBB 2VCYA 3UM9A 1FLAA 3WKDA 4LY6A 4LVOA 1G18A 3GBSA 4NHOA 1MTZA 5K0NA 5TPZD 1T2FA 4IXWA 2VDRB 2D59A 4MWDA 1E2NA 2FJ6A 3VR4D 1TJPB 2IEZA 3JPTA 3HO1A 2X0IA 3AVQA 4OYRA 2IYRA 5AM5A 3QBJA 3GCDA 5JI2E 1V25A 1DIRA 3R41A 1XZNA 4MUAA 4XARA 3WLJA 1OI4A 3VJRA 4Y0AA 3PNYA 1JA0A 2ZAGA 4EG0A 4AM8A 2QR3A 2IITA 1BS2A 5IP5A 2WHYA 4RNCA 5IIIA 3CX3A 2I6TA 4JLUA 2X5OA 1DK2A 4TMXA 3ASZA 1PUXA 1SZHA 4RK4A 4JZYA 1VLLA 1OR8A