3E58A

Crystal structure of putative beta-phosphoglucomutase from streptococcus thermophilus
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
211
structure length
211
Chain Sequence
b'MVEAIIFDMDGVLFDTEKYYYDRRASFLGQKGISIDHLPPSFFIGGNTKQVWENILRDEYDKWDVSTLQEEYNTYKQNNPLPYKELIFPDVLKVLNEVKSQGLEIGLASSSVKADIFRALEENRLQGFFDIVLSGEEFKESKPNPEIYLTALKQLNVQASRALIIEDSEKGIAAGVAADVEVWAIRDNEFGMDQSAAKGLLDSLTDVLDLI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative Beta-phosphoglucomutase
publication title Crystal structure of putative beta-phosphoglucomutase from Streptococcus thermophilus
rcsb
source organism Streptococcus thermophilus lmg 18311
molecule tags Isomerase
total genus 77
structure length 211
sequence length 211
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3e58A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3e58A01
5ALXA 5IS2A 3ESRA 5AVRA 4L57A 4EZEA 4I9FA 5AKLA 3E58A 4Y2VA 3FPSA 5ALEA 1CR6A 2WFAA 4CE6A 2EARA 2B1RA 5ALDA 4ZEXA 2YMLA 3KD3A 1QQ7A 3UMCA 3B9RA 2OA0A 1VJRA 3P96A 5AW1A 3ZVLA 3W5BA 4JB3A 3N8GA 1NF2A 3WK6A 4NAVA 3AR2A 2NYVA 2HI0A 1TJ3A 2G09A 2C8KA 3B8EA 4UW9A 2ZBFA 5AI6A 4BEWA 3S6JA 4O8CA 5AK6A 1YDFA 2YJ4A 4NFLA 4GIBA 5AKGA 5ALUA 5ALZA 2PKEA 5AKKA 5AVXA 2VKQA 1VJ5A 5E0OA 3MMZA 3SKYA 3L8EA 1AQ6A 2CN1A 4BYGA 1NRWA 4CNQA 3QXGA 1Z4JA 4HGPA 1L7MA 1QQ5A 1Z5UA 3L1VA 5AKXA 5AM5A 1RKVA 2O2XA 3NAMA 5ALKA 1XPJA 5IT4A 4Y2TA 1U02A 2GHTA 4AS3A 3RFUA 5A3RA 3N1UA 2I34A 2FUEA 1SWWA 1TJ4A 2YMQA 3KZXA 3AR8A 3W5AA 1RLMA 5ALSA 2B0CA 2AGVA 4KX3A 3ESQA 3ZW7A 3I6BA 3ZWDA 3WKEA 3FZQA 1Z88A 4YIKA 3NIWA 1O08A 3TLMA 5AW5A 3NANA 5AW7A 2WM8A 4F72A 2HSZA 1U2TA 4EELA 5AI9A 3EWIA 3WK7A 3ZVNA 5AM2A 1LTQA 4UASA 3A1CA 4B6JA 4RETA 2P27A 1RKQA 3U13A 2EATA 1IWOA 4FE3A 3ET5A 4HYTA 3OCWA 3CZ4A 4ZEVA 5A3SA 3DNPA 3HYCA 1TE2A 3I76A 2G80A 4Y2SA 5ALTA 1YMQA 3E84A 4IFTA 2R8YA 2FPSA 3AR7A 3U7EB 3QX7A 3SKXA 3L7YA 5AKHA 1WPGA 4G63A 3U7GA 4C4SA 1L7OA 2YJ5A 4YCLA 3QUCA 1YS9A 2R8ZA 4QQFA 4UM7A 2R8XA 1T5TA 1Y8AA 3U26A 1F5SA 5AVVA 2JAOA 2YJ6A 3EF1A 5AHXA 1L7PA 3SD7A 5FP0A 2YBDA 2YFYA 5AVTA 4EX7A 1RC8A 5ALRA 1PW5A 2HF2A 2IA5A 4Y2PA 3QGMA 2DQSA 2YMPA 4OD0A 1Z4OA 1Z4NA 2YJ3A 5AW0A 3WKCA 1ZD3A 4XQ0A 3EPRA 1Z4LA 3QU9A 2GMWA 3WK9A 4H1WA 3WGVA 1J8DA 4MUMA 3K1ZA 1RMYA 1Z5GA 4E88A 4XE5A 3IRUA 3BA6A 3AR6A 1Z4KA 2WF5A 3IB6A 3N07A 3NUQA 3CNHA 3QLEA 3VAYA 2IOFA 2HF7A 2WF8A 5AW3A 2FEAA 4PNHA 1Q92A 4UMEA 4QJBA 2GO7A 3OCYA 3MPOA 5AM3A 3N28A 2HOQA 5AVSA 2HO4A 5AM1A 5AW2A 2FPWA 2ZXEA 2D2VA 5ALPA 2MU1A 4UMFA 1X42A 2FPXA 4Y3UA 1MH9A 4EEKA 1T5SA 2ODAA 1RPZA 2ZBDA 3L8GA 4AS2A 3ONNA 3QU7A 1Z4IA 3B9BA 4CF3A 3AR4A 4L6AA 2FDRA 3WK5A 1WZCA 3R09A 2I54A 4ZEWA 3AR5A 3MC1A 3NALA 4YCNA 5AI0A 3OCXA 2HX1A 3OCUA 1ZRMA 4AP9A 4UM5A 1N9KA 2B1QA 3A1DA 1S8OA 1RRCA 5AK4A 2Q4TA 2W43A 2I7DA 3ZX5A 5AM0A 4CF4A 1YJ5A 4BEVA 3D6JA 3UMGA 1RLTA 5AK5A 3E81A 1CQZA 4IG4A 4OHFA 1Z4MA 3I28A 4OFZA 2YMMA 1JUDA 2YN4A 3L0BA 5ALNA 5AKYA 1J97A 5ALQA 1TA0A 3N5KA 5AESA 2G08A 2X4DA 2RB5A 4DWOA 5A3QA 2AUTA 1U7PA 2JAUA 2BDUA 4UARA 2MU2A 3L0YA 2OYCA 1LVHA 1L8OA 5JJBA 2RAVA 2OBBA 3ZTYA 5AI5A 3GYGA 5ALMA 5AK3A 4OCZA 5AKZA 4J03A 3BWVA 5AVQA 5ALIA 2G0AA 4UAVA 3L1UA 4Y2XA 2BY4A 5AI4A 2CFTA 4F71A 1QYIA 1RLOA 2RBKA 2P11A 1T9ZA 2HCFA 1RMQA 3PGVA 1N8NA 4C4RA 3QU4A 3FPBA 4EENA 1FEZA 1RMTA 3SF0A 4L6CA 5ALYA 3ZU6A 4BNDA 2B30A 3U7HB 3W5DA 2Q5EA 4Y2YA 2G07A 3OCVA 5AKEA 1KYTA 5AICA 1RQNA 3OCZA 4CF5A 3FM9A 3L8HA 3WGUA 3AR9A 5AW9A 1ZRNA 3HLTA 1ZD2P 4YIHA 2PR7A 3W5CA 4KX5A 2NO5A 2HEGA 2FUCA 2I6XA 1RDFA 2B82A 4YH1A 2GFHA 2Q4RA 1WVIA 1QQ6A 3QNMA 1QH9A 2WF7A 3OTQA 2RARA 4BX0A 5AVWA 3NRJA 5ALWA 4BNDB 3ET4A 4UMDA 4RESA 3EF0A 2NO4A 4UATA 3ZTWA 1O03A 5IT0A 1TJ5A 4FYPA 1ZD5A 2W11A 4DW8A 4DCCA 4UMVA 5ALFA 2R8EA 4NWIA 4NABA 2CFSA 5AVZA 3WKDA 3R9KA 1EK1A 3OPXA 1K1EA 3PGLA 4HAIA 4HGNA 2C4NA 1VFPA 4KNVA 4BBJA 2IYEA 1ZD4A 2G06A 3A3YA 5AM4A 4DFDA 2PQ0A 3KBBA 2O9JA 3R4CA 2IOHA 4Y2QA 3WK8A 1ZJJA 3KC2A 2P9JA 3L5KA 4UU0A 2P69A 3DDHA 2ZBEA 3ZI4A 1Z4PX 3NASA 3DV9A 3QYPA 4HGOA 2WHEA 4KN8A 3DAOA 5ALLA 4XPZA 2B8EA 1L8LA 4UU1A 5AVUA 1YV9A 1XVIA 5AKIA 4Y2JA 1XP5A 4G9BA 3SMVA 2JGAA 3KOOA 3L8FA 3QU5A 5ALJA 3MN1A 4JDPA 4EX6A 2JAWA 2JARA 4BKMA 1RQLA 4Y2RA 5ALVA 1ZS9A 5AVYA 5AW8A 2HDOA 3U7FB 5AW4A 2CFRA 5AKJA 3FGOA 1YNSA 3M1YA 3RF6A 3UMBA 2OM6A 4MWOA 3PDWA 2AMYA 2FI1A 2I55A 3ED5A 4HGRA 1SWVA 3WKAA 4Y2UA 1U2SA 2HHLA 2QLTA 2I33A 3ZX4A 2C88A 3L0CA 3U19A 3ZVMA 2W4MA 2MSNA 4I9GA 2ZOSA 2FPUA 2C8LA 2GHQA 3WK4A 3AR3A 3FVVA 4NV0A 4FFDA 3QUQA 4UAUA 4GXTA 3UM9A 3J7TA 5ALOA 5T41A 4J2TA 2G1AA 5AI8A 2YY6A 3WKBA 1U7OA 3IJ5A 2WF9A 3E8MA 4YGYA 5AIAA 1SU4A 2C9MA 1ZOLA 3QU2A 2AH5A 4XOUA 2IOFK 2ZG6A 1L7NA 3A1EA 4KNWA 1Q91A 2EAUA 3QUTA 1WR8A 3ZWKA 5ALGA 1EK2A 3KDPA 1L6RA 1S2OA 2FPRA 5ALHA 3SLRA 4HGQA 4BX2A 3M9LA 4C4TA 3QUBA 3SHQA 4BX3A 2B8JA 1NNLA 1Z4QA 2QYHA 3F9RA 3PCTA 3ZUPA 4YCMA 2WF6A 2BDEA 2ZBGA 5AW6A 5AIBA 1RKUA 4KYTA 3I1YA
chains in the Genus database with same CATH superfamily
2A94A 3LVRE 3PXBA 3BH7A 1U4OA 2QM0A 1HE8B 3LKVA 3EZ7A 1Z6PA 3P96A 4RLHA 2Z2YA 4JB3A 1NWHA 3NHMA 1A4RA 5KDOA 2ID4A 5HF5A 1BA3A 1HMPA 2WUVA 3NWJA 2DUUA 4LX0A 4BMNA 3F2CA 2ZRMA 4MA4A 1UBRS 5AKGA 2QXUA 3KB6A 5AVXA 1VZ2A 4F93B 5TMDA 3DL2A 4ZQGA 2A9VA 1E1KA 3MFQA 1FTWA 4DWJA 4GO1A 3IEXA 1FTSA 1TQ2A 4TMYA 1UJBA 4N0MA 1YJXA 2J3LA 5DYYA 2WP0A 4U5XA 2WU3A 4PXAA 1YIDA 4QSMA 3VSDA 2ECQA 2ZJ3A 2EW2A 2P2CA 2FMQA 4MCJA 4USAA 1CU1A 1W0KA 4PHGA 3ETDA 1I4DD 1JFSA 3HVHA 1NNSA 4ZQIA 2WYHA 4Q0MA 1G66A 5A7GA 4QODA 4MRNA 1VCMA 4JITA 3ZDYB 4HQFA 4R3UC 5C8YF 4J9OA 3O90A 2X6QA 1YTUA 3ZC3A 2XW6A 1RKBA 4U00A 2X2PA 4D8XA 1CNMA 3DDZX 1YB1A 1BGWA 4R51A 2OBYA 3GGSA 1VPWA 1W87A 2FWBA 3IAS6 4NYJQ 1KI3A 4B3GA 3C1YA 1EVQA 2AQHA 4ZAGA 1PFWA 5DYGA 5GZ6A 1WWVA 1TECE 5BQOA 2GBPA 1NDUA 4KLHA 4F2WA 1JE1A 4UJ3A 2KNJA 5AM3A 2CLMB 2NIPA 1SB9A 2ZBQA 2WV7A 5K0ZA 3WOHA 1ZG3A 4HAWA 5LYYA 3FWYA 4CF3A 3QFHA 4B74A 1GEGA 4DA9A 4ZMSA 4TYQA 2BQUA 4EGFA 2HX1A 3GVIA 5CR9A 3ISDA 4MDYA 2R1TA 1TEVA 3W78A 3UCFA 2NO6A 4XDZA 3CINA 4GI1A 3O26A 3W3AD 2WJYA 5BUZA 4ENWA 4GMGA 1Z7EA 4RNOA 3PNVA 1RJ9B 3VNQA 4AI6A 3LWLA 3CJQA 5K0BA 5JD5A 1WTAA 2FPGA 5L3VA 3M9WA 2IYVA 3RO7A 2C2YA 2QB0B 4RV4A 1L3TA 3B7GA 4DMCA 2R3SA 1WG8A 1OFUA 2WNHA 3FPBA 2QHXA 3C24A 4U7PB 3S27A 1S9DA 3GJ8A 3W5DA 3CNLA 1TKBA 1E98A 4RXUA 4HS4A 3GOQA 1RQXA 2NUPA 3ORHA 4BJ5A 3MYRA 5J2IA 1U11A 3SHWA 3ZXSA 1BHQ1 3FKSA 3S1AB 1Z29A 2HHHB 4D9EA 2C3YA 4QU9A 1KI8A 1OREA 3C7CB 3PRHA 3I3OA 4ESEA 2ZZNA 1VLJA 1LV7A 5INTA 1MJFA 1KI1A 2DSTA 4N3BA 5IXSA 2YW9A 2HD4A 3HKBA 1G21B 1FW6A 3H9BA 3C3EA 3C3MA 1QFZA 1Z4PX 2DFLA 1CJKC 1PR3A 4IMIB 9ATCA 4RTMA 5HDQA 5EPUA 2YDXA 1K5DA 3BULA 4JJFA 3BL8A 4N7BA 2UXCB 5GTDA 5AW8A 1T5BA 3M83A 2HJHA 1AUXA 4HGRA 1IY2A 2GBCA 3SZUA 4NP6A 4D4KA 2CJWA 3R3VA 1WUKS 3SU8A 2EIXA 3R76A 2H11A 3A9CA 1U8UA 4TMZA 2EIHA 5ALOA 1FSSA 1NL3A 3WMFA 3TNJA 1KEZA 1H4QA 2KK0A 2VLIA 3INYA 1UJMA 2VHQA 1GGJA 3N58A 3UPTA 4EPTA 1D9XA 2G9QA 2IE0A 1ULBA 5FKJA 3KT8A 3QVJA 1L5KA 3N7TA 5KOIA 3GWZA 3RC2A 3J7AC 4BVHA 2NOAA 2RGGA 4L8LA 2K7FA 3RSGA 3T5AA 4RANA 3LX5A 4QOIA 2XA1A 5ALDA 4P58A 3PD1A 2JIRA 4L5IA 3JSXA 1KHTA 4BMVA 1EWRA 1O0SA 1L8QA 8MHTA 5DNDA 1XDWA 1NKEA 3OLXA 2YWGA 1J5PA 5BN3A 3UAYA 2AN5A 3CW9A 1T2VA 2QRQA 3L8EA 1F0PA 3F7OA 3QVOA 3UXMA 3ND7A 4MYHA 3GJ4A 3E23A 2FJUA 3EWAA 4JV5B 4J90A 5AH0A 1WX1A 1X0XA 3AM4A 2EKQA 2NUAA 4C0HA 5J2EA 4TROA 2W4IA 4CBVA 5BVGB 4KMRA 1NW6A 5JCOA 3EFOB 1RW4A 1PFVA 2PLRA 5FTWA 3S2GA 4Q4HB 1KZ4A 1U2TA 2A0XA 3OJOA 3QTTA 2VDMB 4HUQA 1SUPA 3MBYA 4JT9A 4AF7A 2M6LA 2WYIA 1MAAA 3A4VA 1OB2A 3A1UA 4P86A 3IHKA 3H2BA 3QVGB 5JBQA 4YQZA 3NO4A 4EI2A 2L69A 4QQFA 3O95A 2P6UA 3GNLA 1JQ5A 5DM4A 5FP0A 1JEEA 4GXJA 4DV7B 1RC8A 2HF2A 3H9JA 4YO8A 5FUYA 4Y1GA 1MKYA 1PGPA 3O8LA 3D0OA 3R5FA 2W2MA 3K16A 3B52X 3GDFA 3U4DA 3EVEA 4RGVA 1RYEA 3UK0A 1UXJA 2EL9A 3CU5A 3SP1A 4BYMA 3KQPA 4I9NA 2EAOA 1W94A 4B3BA 1ISRA 4R0NA 4BKUA 1RPZA 1L5WA 2HL6A 1NPDA 4O4HB 1P4RA 1UZMA 3B89A 2X8LA 3BDVA 4JUZA 5F52A 1N78A 4BB6A 3UFXA 5GZ1A 3U4CA 4U7GA 1T35A 4LF5B 4MSUA 2XVZA 3UMGA 4AURA 1LV5A 4XM1A 4NCNA 3RS0A 5J29A 5CB4B 2EGGA 2GOYA 4DSIA 1EINA 1X1DA 2RB5A 1QB8A 4KTQA 1IXYA 4OQNA 4I66A 4AICA 5G1PA 2WTNA 5F35A 1NXSA 2E1PA 3S8YA 2JLXA 1N2HA 3KJZA 2W54A 1RE1A 4LZPA 5KTMA 2ZSDA 2XRFA 2V8OA 4BVKA 2QAGC 1TV9A 4R1SA 4D97A 4I9HA 3QEJA 1ADJA 2IT1A 1B8UA 1DQPA 2ZAOA 1FFXB 1P31A 1YAJA 4J7AA 3LD9A 3QWBA 2RHLA 4YXJA 3ZCSA 4F4IA 5ED4A 2QNRA 2PX4A 2H5JA 1FMLA 4A0HA 1VZ3A 2PH3A 3UJ8A 2A3VA 2IOYA 2P3SA 4U39A 4DCCA 2VJ5A 2V5VA 4R16A 3ABRB 2AG8A 1GCIA 1MC8A 1XF9A 4RCZA 3ZWPA 4P4SA 3MR3A 3VKGA 4X9XA 4FR0A 1DXQA 1D4OA 2F3UA 3MDCA 3WFIA 1J9EA 3PQ7A 2D1RA 4RY2A 1NJFA 4PR0A 4OHPA 5JNWA 4U63A 1UWVA 4Z53A 2HGZA 1SL0A 3HGQA 2B98A 1M6WA 3TMKA 3ADBA 4PANA 4CI0B 3RF6A 4X93A 2OCAA 4LOHA 4LZWA 3G6YA 1G7RA 3U37A 1V5GA 3JASB 1RRMA 3VDXA 4DCTA 4F4JA 2GN2A 4C87A 5KFEA 3BZBA 5BNWA 4HWPA 2Z30A 1BH2A 1QWOA 5IJAA 5JG7A 3HWX1 2EJVA 2O2CA 2D62A 4BFSA 4ZYLA 1AF7A 4HAZA 4DSAA 1WEKA 5TF0A 4PO3X 3CN7A 2JJ1D 5ECWA 1WWUA 4WVFA 3AFIA 2H2IA 5DN6A 2XODA 3OOJA 3A0BU 3OIVA 3A6ZA 4I9FA 4CE6A 3AOEA 4B85A 2PX6A 3OFSA 2AZTA 1FZQA 3KIPA 1X39A 4X91A 1TC1A 4Y7DA 2VDQB 4L73A 5KAFU 2MINB 7ICHA 1ECLA 4GIBA 4F9GA 1Q0HA 1AO0A 4DR1B 4KITB 5AM5A 1YIOA 3O83A 3C3PA 1KTQA 1BVYF 3ELBA 2DY1A 1JR3A 1WDKA 1EZ4A 4QX6A 3DYIA 3SENA 1MIHA 1DQNA 1YZ6A 3LYUA 3I6BA 2IZZA 4K05A 4I2BA 5B7GA 3ISCA 3ORFA 1EG2A 3OHAA 3ASVA 5AI9A 5EWFA 1M8PA 2ZUEA 2ZGVA 4LPKA 1IU9A 4FQ5A 2HHUA 4F45A 3SCZA 1N3BA 1WPGA 3T79A 2HDNB 4QT4A 1SKUA 4PIVA 3Q9LA 1WYGA 5IXJA 1P2BA 1SK8A 2KZ3A 5AVTA 1E5XA 2IYPA 3VU8A 2VHCA 3F4LA 1RPJA 2F3QA 4TUQA 4YRZA 2GZ3A 1Z4LA 1E7QA 3G0DA 4CT0A 3M8SA 4Q47A 4LX8A 4KUGA 4Q3CA 2ZT6A 1J42A 1MAVA 4TVSA 4K88A 1H0HA 1PN3A 2OGUA 1L1EA 4MITA 3SX0A 1GPKA 3A1NA 4XJVA 5KSWB 4MRMA 2Q6LA 3T95A 4RL6A 4EYGA 1CUVA 3GQBB 1AO3A 2ANBA 4M8KA 1UAAA 1ZK3A 5F9MA 1R0BA 3LQQA 2B78A 4FGKA 1I2ZA 1IXZA 4EDFA 3D2NA 1LLDA 2ASLA 4F3YA 3ORSA 5A7HA 4ZZ0A 1XUOA 4TYNA 1ZO8A 2PZKA 1HL7A 3K09C 4N01A 3SICE 5IANA 1PR5A 3TB4A 1WSDA 5I47A 2A1UA 2C9YA 1X2IA 1RM3A 4YRSA 1ZN8A 4WW0A 5BV2P 4HN2A 1R50A 2BPGA 1O9HA 2ZRLA 3NJ4A 3CVWA 3C85A 3VH4A 1BPEA 2V45A 1NBME 2VAMA 1PV4A 4AKGA 2FW9A 4Z9AA 3LUPA 1TYDE 2NVWA 3NT4A 1G5RA 1J07A 1QRAA 3GH3A 1FTQA 2XDAA 3MCWA 3D1VA 4LNAA 3GZFA 1XCPA 4MHTA 1B6RA 3VPDA 3BDIA 4US0R 4DV4B 4ZT4A 1FFHA 3EC7A 4FGZA 1Q0SA 3O1HB 4UTRA 1U0BB 1V11A 3ZTWA 3ZZUA 1LFDB 1NFFA 3PUVA 5K3BA 1OIWA 3TLBA 4CMAA 2C4MA 5IWAB 1GDDA 4BFCA 2I99A 4LZJA 2PYDA 5GTHU 3OVMA 2WB1C 2C2EA 4U6NA 5KNCD 3WLLA 1U9IA 3D6NB 1N2CA 1WIWA 2JA1A 2P69A 3JWHA 2CY0A 1R8XA 2UZ0A 3PGMA 3Q8MA 3FAHA 3GJ6A 2X9VA 4QATA 5DK4A 4JBWA 3C41J 1FA9A 1CJTC 3DMHA 1J21A 4IR1A 2BEUA 4D9IA 1JT2A 4QUIA 4GQIA 1NYLA 4F9FA 1JAYA 3U19A 2SICE 1Z0SA 5JMOA 1D2RA 1HV8A 2A0YA 3KKMA 4BO3A 3EIXA 2KSOB 2O0JA 1VCHA 3PP8A 2FMIA 4REOA 2IZ6A 5JHGB 3A0UA 3E82A 4JN6B 2QJRA 2OO3A 1RWMA 1ZUIA 5ICSA 1Z17A 5D46A 3ALRA 1SRRA 3E2PA 4DPKA 4R9UC 2V6FA 1MIOA 4BZPA 5YASA 1ONBA 2ZUDA 1P33A 2CUKA 1AN0A 1UK7A 3IAAA 4CIDA 2AFIA 3FI0A 3LU1A 2D74A 4D25A 3I5UA 8ICHA 2XWPA 3ZCQA 5DGIA 4BP1A 4Y2VA 1M8FA 4OM8A 1PEAA 4P3NA 4IMRA 4IP0A 2YFKA 4O5AA 1HDCA 4MQEA 4YRBA 2C7QA 1GZUA 4P81A 1HT1E 2JLRA 2C8KA 2RCNA 4YAIA 2YYZA 5L51A 2HPZA 5E0OA 4FDVA 4YPVA 2PH5A 2WSBA 4FZ5A 4YAFA 3COZA 3WLPA 4J9VA 4KIJA 3UJNA 3FIJA 4YP5A 4QKQA 3OBBA 1O94A 3A14A 4ZVTA 3UIEA 3K31A 2YOHA 3UV6A 3L6EA 3CNBA 5CB0A 4QXRA 4XD7A 1ODCA 5T5QA 4WBNF 1FFAA 3V2GA 4M1ZA 2A57A 5MFPA 4EHIA 4ZO4A 3OSNA 5JNLA 2X9QA 2QQ5A 2A9JA 2IPAB 4RPYA 2D13A 2Y6VA 2EATA 3NBFA 4ARCA 3CZ4A 3F8WA 4QUKA 2G77B 2RHCA 3S2EA 4JLWA 2QIPA 1IK4A 1TRKA 1NUSA 4B2YA 5JYDA 5H4GA 2BRUC 5CT6A 4ZOCA 4LXTA 1JPJA 1QOPB 3UHPA 1JTEA 1RYYA 1O6ZA 1UH5A 4NDAA 4YTEA 4HFMA 3KHLA 4KPFC 3WKCA 1Y6ZA 3C1AA 3LWZA 3ZDQA 3UK6A 4GPAA 4GZMA 2CBGA 5K51A 1OV4A 5JARA 4BIMA 4EO9A 1V7PC 1VBMA 2P4QA 5EE5B 4OHKA 3KHKA 1GZ3A 5J0RA 1E9DA 4GH5A 2TMGA 3HHEA 3JTMA 1VCOA 3H3JA 3O3OB 2NXNA 1FL9A 4GQAA 3M6ZA 2F3RA 2ZBVA 2O2YA 4BLSA 3AR4A 4WJZA 1Y7LA 5LUBA 5K0SA 2BGNA 3AW9A 2Q21A 2OV2A 2EAPA 2YIMA 5JT1A 1ZUNA 2C2XA 2GK4A 3AN1A 2O1SA 1L5SA 1MO6A 4QC2A 4QZBA 4QGFA 4CL0A 4CTOA 4MZXA 3FYTA 5JZ9A 5CFNA 1V8PA 3OPYI 1NXPA 4DQUA 3PIRA 3GUHA 1ZCBA 4K6FA 4KLNA 2H17A 4PYNA 4JI5B 1EAYA 2PFSA 4QRIA 1ZBDA 1T5OA 3AM5A 3C3DA 5DTIA 3GJRA 1T1SA 2RH5A 5F7ZA 1E61A 2JFVA 3UJ3X 4FKZA 4ENVA 2ZTLA 4MV6A 1OKKA 1HJPA 4K46A 3QVWA 5H1YA 2OD7A 2F1HA 1ZVMA 2ZB2A 1RZRA 3VDNB 3UK7A 4J9KA 4C0BA 3GCZA 5J2TB 2AZ4A 3EDRA 2B82A 4BL5A 1RYBA 1RAFA 1VMDA 3AKZA 2CXHA 3KR2A 5FDFA 2F9MA 4OJLA 4I55F 3R2JA 4DW8A 4ZARA 4QGGA 3EG9A 1I3KA 5IK2D 5CT4A 4ZOLB 3PDUA 3DLBA 3TG8A 3L43A 1FYDA 3I6YA 3L77A 1CVLA 4I2EA 2Y6UA 2FVXA 4E09A 5D01A 3COJA 3EY4A 4LFAB 1XU9A 2BLLA 4CM9D 1B23P 2JCYA 3ENVA 3VU1A 4AZWA 3RYHB 2JAXA 2JGLA 3SMVA 3AI1A 2Q0HA 2KE5A 5B1IA 2VVTA 1TTTA 2OHXA 5AVYA 1ZS9A 4TYYA 3GA7A 4EABA 1LDBA 1NKCA 4MWOA 3RT9A 5K4GA 3BXFA 1S0VA 1PJQA 2BSQA 1A4UA 4EKGA 3GV7B 4QWCA 1WTCA 3MTQA 2MYTA 1T4MA 5F4ZA 1GSHA 4D3XA 2RJ3A 4JUFA 4JOCA 3M6KA 1QANA 5EJ4A 5DXJA 1BIFA 3H2IA 2WFLB 4DCOA 5A3JA 1VMIA 1K8YB 4WNAA 2ZFUA 3RSOA 2VDJA 4QG7A 4WFJA 1HT2E 4XJTA 5KTTA 2OO5C 5F77A 4EYKA 3LQKA 2B4YA 2XC9A 4YR3A 3DMDA 4FHGA 1KEPA 1LK7A 4MPPA 2BFAA 3WBFA 1VHJA 2A9RA 3KPUA 7GPBA 4DGSA 2NUTA 4Z7JA 3CC8A 1Y9JA 4M83A 1BOOA 4PYIA 2OK7A 1F7VA 1USUA 1G42A 1PUZA 1SC9A 1TF5A 1IBKB 3IE0A 4HS9A 5A1TA 1Y3AA 4HDRA 3MWKA 2Z9BA 3ONEA 3KOXA 5EJ9A 3Q7TA 3JXEA 4NZMA 5E79U 1XRPA 3X1JA 5DNVA 4HRXA 3ICEA 1BXRA 1PK7A 2ZJOA 3E9RA 3PUIA 3BL5A 2VDKB 2YQ5A 1Q44A 3ZBQA 4YAEA 4F7DA 5LMCA 5KPJA 1DUSA 3I5AA 2I62A 4X54A 4YJ3B 3PC8C 1SFRA 4DEZA 2X2OA 4ZRDA 1LC0A 3K72B 3RVBA 1JHMA 5KJFA 2KJ9A 2P9ZA 4WCDA 3BJRA 3D1JA 3GEEA 4ZDWA 3MTDA 2QGFA 3RYIA 2ODQA 4LWQA 4L02A 1RRKA 3PJDA 1QQAA 3AP1A 4RZHA 1VHWA 4E11A 3T3NA 3LPAA 5KTKA 1L8AA 4KXLA 1EVLA 4HYKA 3HDJA 3HXLA 2QRNA 1NK9A 5CR0A 4I5IA 4XUEA 3PUJA 4WL0A 3H5TA 4ZHQF 2FMTA 3SKXA 5IVPA 1T8PA 4YMGA 1YRWA 1QC5A 3DF7A 3EVNA 4ONEA 2VQEB 3G0OA 3D0RA 2Y4NA 3T4XA 3UW3A 1A7JA 1ZQTA 1ZQCA 4PYJA 1SQFA 3N0RA 2IXDA 3K20A 3IGFA 1VDZA 4BQRA 5LMZA 4DY4A 4YR7A 1JDZA 4MWEA 1YKGA 4YRAA 2P9YA 5E4JA 1WZIA 2F64A 5DBGA 3UWSA 1L4BA 3IDWA 4IOJA 2ISPA 3EYAA 3W4JA 2BHTA 5AVOA 3Q3EA 1OPXA 1WY5A 1FYXA 1PJZA 3CJRA 3WX0A 4YCNA 2AXPA 2BFNA 5H81A 5BMVA 4V24A 3RC9A 2I5PO 3DBIA 1MGOA 4EGJA 4KXXA 3MWEA 1VIAA 2I4IA 4DDTA 3C45A 3UXEA 3SFTA 4CU5A 2FOIA 5FTNA 5KWJA 4LVUA 2NSHA 1BROA 3JVEA 1PZMA 3AVPA 4XGQA 3QP9A 1M1YA 3E7FA 1WB4A 3FAZA 2C94A 1SBTA 2DHQA 2G4CA 1WQ1R 3VVBA 4NOMA 4DSNA 4L5YA 1GUDA 3GARA 2BOVA 3TFSA 1DC6A 3OHMA 1W36B 2ZCUA 2GR9A 3LX8A 1URJA 1MEJA 3TR5A 4FFWA 2PMDA 3ACDA 5JSFA 3LT4A 5KL8B 1KR5A 5KB3A 1YJQA 2Z6VA 5HG0A 4OXXA 4ZCLA 1V25A 1DXOA 3EMKA 4MUNA 3AFNA 2EGHA 1A1SA 4L0CA 3EGXA 3KEQA 1EFVB 1EVJA 2OYYA 2DM6A 5B6PA 5G5GA 2OV4A 1XC7A 2YFQA 4DIUA 1E0SA 4D41A 1DJOA 1Z2CA 1KYWA 4LWOA 1LDGA 3L07A 1VB5A 1Y7IA 3BJEA 3O4FA 4CKBB 3HXKA 3OQHA 2QM8A 2REBA 3MRTA 1FDTA 2VH2A 2PXIA 1UXKA 3ZGOA 3NASA 5J2KA 2DFPA 5H70A 3SDBA 4HVCA 4NI5A 4Y2JA 2GNPA 2JGAA 3FVQA 1BPYA 4LNUA 4BPBA 4KN7A 4DQDA 2ZTCA 2GAAA 1YZFA 1GGVA 4EPYA 3FOBA 5CLGA 1KVRA 3BEOA 3FOCA 3KJHA 1C3XA 4R1TA 1H9AA 1NQWA 3H5AA 3UCEA 2JLUA 1QORA 1D2MA 3D6TB 5JCJA 2MCFA 3JYLA 4QQKA 2AI2A 3RYTC 1A8HA 5BQFA 3QUTA 4KLUA 4JNKA 3ENWA 3OKAA 1U65A 2IWRA 3HFSA 2DTEA 3CT4A 3IULA 1SZDA 3CZRA 2ATLA 4YJHB 3H97A 3A9RA 3GDWA 2GHIA 3R7SA 3NIBA 3CH4B 3M1IA 4FINA 1ZK0A 4HFNA 2HW8A 3DOOA 4M0EA 2KOBA 2DOKA 1SU6A 2XGMA 3T5LA 5CGZA 3KKNA 1EA7A 1OW5A 3RWMB 2VQFB 3H99A 4NQZA 3SDZA 1CV2A 4HLUC 3HB7A 1NAHA 5F2EA 5AVJA 1AQ6A 3K8OE 4A4DA 4N65A 2EQAA 2Z2XA 5GTIU 4TXNA 3HVIA 1I33A 2VJKA 2ZJ8A 1NONA 4R41A 2BPFA 1BWRA 1KTIA 2W7OA 1V85A 3KSBC 5A3VA 3B8HA 1YUMA 1YRHA 3CX8A 1K7CA 1DAEA 4B79A 2PTHA 3HPRA 3WWZA 3TBFA 3L0IB 2PJUA 4PHTA 8ICZA 4WXHA 3EXAA 2BR4A 2P27A 4WFIA 1X7WA 3I1FA 3WYCA 4LGMA 421PA 3P9YA 2NZXA 3EC1A 3WBBA 1NRXA 1BEUB 3K0EA 4MPJA 3AEXA 2BISA 3L7YA 4Q1FA 4BKPA 2JEZA 3OP1A 4ZDIA 1MQ3A 2YUTA 2JLVA 2R79A 2PZEA 3R74A 2HA2A 4D9HA 1EXNA 3NWPA 1PBNA 3R75A 3I2FA 2YZGA 1BU8A 2GVZC 2HCBA 4JL6A 3RHFA 3IUJA 1CYEA 1Q3UA 2CXTA 3VZDA 3FMIA 3KJNA 3F7MA 1SVUA 4GMDA 4EFDA 3EDQA 4KB5A 4GX2A 5KTRA 1IZYA 3IQFA 3DKVA 4IJKA 5K3CA 1NOJA 3LAWA 4C20A 4ED9A 3BD8A 1FJHA 1NKTA 4XVCA 3LFUA 1AHIA 4KRFA 5KG6A 2GUWA 3UJDA 2W6JD 3DULA 3SBOA 4M1TA 4GWGA 1BJKA 2PBZA 3WYDA 4OJQA 1UBEA 3R5SA 3TRHA 3C8DA 3A1FA 1A69A 1WXEA 4HF7A 2XQKA 4BNJA 1X2EA 1EAMA 4L8YA 4HDQB 3QY9A 3DEFA 1K4MA 4K6KA 1Z6AA 4NFSA 3DYVA 2BGRA 5IU6A 5ARCA 4WZBE 3C15C 2BY4A 3ETNA 4C5AA 2DFDA 2CZQA 4EYHB 1M6HA 3LZDA 3DAGA 4O0IA 1C0PA 4RZ2A 1TD9A 1PG5A 2WUDA 1A2OA 4E4YA 1TB4A 3W6ZA 2QDKA 3KSAC 1MAUA 4KN9S 4BRZA 3IQWA 2EYUA 2NXWA 1SNYA 4H4DA 3ASYA 2HEIA 1L5HB 3O4HA 2QEQA 5IRCD 2QE7A 1KWGA 3QITA 5THXA 4IXNA 2M2IA 3JQAB 2X0DA 1GXSA 5CJPA 5J2BA 3ONWA 3BB1A 3T0FA 5BT9A 1NTOA 2G63A 3BD7A 4NENA 1RXVA 1QGUA 3VPSA 1OV6A 4DV0B 2R47A 1S1MA 5CA1B 5CCXA 1H2XA 1J39A 2HOIA 2V3WA 4YHBA 1YI0A 1J22A 4GRIA 5JCXA 4KKVA 2Z5VA 4B9UA 4DS3A 5DGAA 1JVBA 1DMSA 4TWBA 5JFTA 1JIQA 4HXEB 5JEEA 3RJJA 3PGXA 1ECJA 4AJ2A 1X2BA 5LOVA 3B53X 4DCSA 4GOMD 3GIMA 3I45A 1YZHA 4ITRC 1NK0A 3CX7A 4FJ2A 3E9NA 2QSUA 4Q82A 4AMUA 5HJEA 1FRVA 4V0SA 2JR5A 4B34A 3KQHA 2VYVD 2VOEA 2XGSA 2FFHA 1EZZA 3KFVA 1BMFA 2BGUA 2JDIA 2OAEA 1OOEA 1TTHA 2Z1NA 2XNDA 2JBAA 5EUCA 4RSHA 4C78A 2X1MA 3RUEA 4N0EA 1PL7A 4CT4B 3ENQA 1CWUA 4G2TA 4V3BA 3CUVA 2FP4A 4P80A 4RH0A 1JEQB 2A35A 5EKSA 3DFIA 3HUTA 1CEQA 1Z5ZA 2ZR9A 1QNLA 3O03A 4JLSA 1F2UA 4CMEA 4BNGA 3FOZA 1IBCA 3H18A 2NV2B 4B3MB 1BE8A 2RAFA 3WA6A 4V0OA 3KG2A 4BMYA 1OXMA 2PA0A 1G63A 1U4SA 3VJRA 4ENRA 1E9EA 2B35A 2J07A 5KFRA 3CE6A 4NL9C 1C7EA 2GXQA 3B1KA 3L8DA 2V0NA 3V9AA 4CLHA 1OWOA 1NXWA 5LA6F 2WJWA 4Q3LA 4KFTA 3P2YA 3F2DA 4KLLA 5HZKA 1P2GA 4P4PA 3PFGA 4QBHA 3K73O 3T1HB 3OKPA 3T7EA 2WJ4A 1ZICA 1SWWA 5LQCA 1VXOA 4IKPA 3LC1O 1T8UA 5BSUA 4B84A 1MXHA 2OZEA 4V2UA 2XIQA 4P38A 2WHQA 4G09A 5B55A 2YZKA 5E95A 4XVHA 3U31A 4BNXA 3M82A 2SNIE 2RGRA 2IF0A 4L5AA 1EI9A 4DSUA 1JSCA 4R84A 3I72A 3DKRA 1HFJA 4MIOA 2MSKA 4IPTA 4LQCA 4MLPA 4XI9A 5TRTA 3DAYA 3PKJA 3T1VA 3PJRA 1M2NA 4PF1A 4P5PA 1H6AA 3GYBA 3OIWA 4L72A 5KFQA 2DT5A 3ZWXA 1GNPA 1HF3A 5U9CA 2EJWA 1F9EA 1EXWA 1NW7A 3TLZA 4CM1A 3GROA 1IN6A 1S76D 3QU9A 3PSAA 4NCHA 3O84A 5T8KA 1NU8A 3VAYA 3FSJX 4PLGA 4PAGA 3D8UA 2ATEA 5MHTA 1ULHA 1ADYA 5DYIA 3F74A 3BKWA 4QBTA 1MH9A 2BEWB 1Q11A 1XYGA 3T41A 3HR7A 1EUCB 4G0YA 2PGXA 4GLBA 2O3SA 1C7QA 1MVOA 3SN6A 3BMNB 1TFUA 4ZEWA 1QGDA 4U9UA 1CRQA 4R7ZA 4MK4A 2DQZA 1F60A 2C00A 4MIKA 1Z22A 3WLKX 4ISBA 2JFWA 1TJNA 3O2SB 2NNLD 1KRPA 3E81A 3QVUA 2TRSB 1BCRB 2ZSAA 1NVMB 4HTAA 1ECPA 3ZHOA 4RK1A 4ZGWA 2AIRA 2ZQ5A 4ETWA 1FRNA 4L9RA 4J1SA 3CZQA 1GHTA 3D7MA 2L42A 2DBYA 4F71A 5ED0A 1BPZA 2BWJA 2JFQA 4CCAA 4D46A 2JHGA 1OROA 5M7EA 2J5KA 2HMAA 3U49A 2XNCA 4P7GA 3MMXA 2ZI4A 3RVMA 2Y92A 3FNRA 4KX5A 4GI5A 2VSYA 5FBWB 1L7DA 1TZCA 4W7HA 3RB3A 3AJRA 1HOTA 2H65A 4JQZA 1F8GA 2JLQA 3NWEA 3AILA 4LTMA 4CLDA 4HO1X 3IO3A 2ZYGA 3EMVA 3PNLA 3STWA 3WKDA 3RABA 3T7SA 4CMHA 2BN4A 3HDQA 2IZ7A 2VZEA 1J2NA 3AV3A 4JH0A 5DV9A 1XVLA 1S9HA 4YONB 2HQ1A 1DU4A 2PQ0A 4FBLA 1QYCA 4QASA 4WESA 2JRCA 4OU4A 4GKBA 3EYZA 2KYRA 5IUKC 4HDCA 4X85A 5DN9A 4IHJB 3ITEA 3RYCB 5C1BA 5BSWA 1YB4A 1VRCA 3BWBA 5J2DA 3IAUA 4BN4A 4HYYA 4W5QA 3GLHE 2UZ3A 3GJXC 4FN5A 3BCUA 1WUJS 1UPCA 5D5QA 5CNKA 4UB5A 1CJBA 4C7OA 2V74B 4YPOA 3UYLA 2XZOA 3ZX4A 2C88A 3VC8A 1XRRA 3OHPA 3FGZA 1ST2A 1M76A 1JDVA 5LNK6 1MNAA 2BAGA 3U9SA 1VKNA 2KZMA 1L7QA 1L7AA 3O74A 2RQ5A 4AYWA 4M7WA 1W1WA 3H1BA 3WGGA 3S28A 1G2PA 1B26A 4AZ3B 4GMKA 4PLZA 1N2IA 3AOGA 1G16A 3JVVA 4WJKB 3KYJB 3AEVA 1N2EA 5JWOA 4MV9A 1XZFA 1ULAA 5KNIA 2EG5A 4B1FA 4Z49A 3PKIA 1MOZA 4NLCA 2OV8A 1PLKA 3UMRA 2WKRA 4MW2A 4AP5A 4D74A 1XJ0A 3ZVLA 4JA0A 3L0SA 2HBJA 3FDSA 3SQOA 1M2EA 2WQ7A 2HNKA 1UUFA 4J3FA 3HN2A 2BKUA 1L5FA 1IBMB 4B3HA 1NBMD 1RXCA 3SBDA 1JR2A 5F1YA 1IQRA 3F49S 3GHHA 3FY4A 3KKLA 1T8RA 3PUHA 1Y6FA 3HXTA 3UA3A 3QXJA 1C7FA 4QG3A 1CUZA 2VTBA 4EPRA 3RU9A 2DCMA 2H48A 1N5DA 4OJ5A 3TI0A 2JKYA 2NZWA 2R25B 3T34A 4B44A 2AW5A 1XK7A 3JTEA 2JEIA 2A9QA 3GFKB 4F96A 3AKDA 2C57A 5AM2A 2PS9A 1A5TA 7AT1A 2EBFX 1IWOA 4QBIA 4BEJA 4B46A 2ALJA 2XUAA 1J0XO 5LFAA 1J06A 1YI8A 5KKAA 2JPDA 4DA4A 2DPJA 2DBZA 2GWRA 2FFBA 1E1RD 4XD2A 2VYCA 1NN3A 4B4VA 3VZPA 2XDQA 3PT5A 1I7SB 3N8IA 3PSTA 1SKWA 2QTTA 2Y0CA 1QFMA 6GPBA 4BMPB 5E6SB 2GCNA 3SEQA 4F5PA 2O3QA 2C2RA 5FF9A 4D0GA 2R60A 1K97A 3QLEA 5K8JB 2I67A 4YBRA 4YT4A 4RHUA 3QHPA 4ID3A 2H2GA 3VQTA 3C5WP 3VSAA 3WZLA 1F2TA 3LXMA 2YWXA 3GJZA 2HSDA 3DLAA 2GD1O 3G2KA 4X7PA 5AM0A 4EJSC 1HE1C 5AK5A 4WUVA 1E96A 5D51S 4DRXB 2OOSA 3HWSA 4PQRA 1JE0A 2NACA 1BWQA 3HU1A 3LT5A 3FLMA 3HN6A 1YASA 3OZ7A 4H59A 1BD3A 5GGYA 4LFCB 5KVQA 3DV0A 4ND2A 2CB0A 1CQJA 3S2SA 4JHXA 5KVAA 3T5TA 1UCVA 3N2LA 2OY0A 4QJ5A 3KL4A 4X60A 1BFKA 2GZMA 3VNVA 4EG4A 1RMTA 4NJEA 4YFVA 4EG3A 5CXXA 4N40A 4C8KA 2ZI9A 1N0WA 1UBLS 3RD5A 3EG5A 1VMAA 1RDFA 4YH1A 2GFHA 5GV7A 3FPEA 4OJPA 1WVIA 3N53A 2WZQA 3E5HA 3GV0A 2V7XA 1W36C 3H9CA 4IGKA 1ICEA 1UMCA 3L6CA 1ODSA 1G7SA 1OHHD 3VZQA 5JH7F 3LZCA 3GBVA 1Y9EA 4YMIA 3IR7A 4AJIA 4M21A 5EZ6B 2PR2A 2X23A 1D9FA 2YUIA 2EKDA 4N03A 4R9SA 4Z4HA 2OKGA 3E3NA 1YU9A 2IP4A 4JEMA 1ZM3A 4IHQA 1TF2A 4C5CA 2H7XA 5KREA 2XO7A 3HKCB 1PQYA 2CUZA 5J2UB 1IHUA 1D2EA 1EQUA 2NRTA 2VH5R 3PDIB 1FBTA 4Y1RA 3CRMA 3LLCA 3D3QA 1LS6A 1R4MB 4QTTB 1T7PA 3CO0S 4QXOA 1F0YA 2OFOA 1A2KC 3PA8A 5T14A 1OVGA 3RREA 5FNZA 5FT9A 1II8A 3GGDA 3EN0A 2WHXA 5HKAA 4KO4S 1GPJA 1AN9A 4LRYA 3DTVD 2IHJA 2QYOA 4KO3S 1NVDA 1YQDA 3KVNA 4RZSA 2H0QA 4JCCA 3SHQA 1LC3A 4RORA 4EHFA 4KRGA 3QEMB 4E2FA 4XASA 2WQ6A 3TLEA 4U7HA 5EG5A 5FWYB 2XUDA 8ICOA 2HSGA 5IN5A 1OXKB 3L06A 3TTUA 2JCSA 3LO5A 1HH4A 5ENZA 1E0JA 4ZEXA 4P08A 2FEPA 5EWEA 2Z6UA 1PL6A 2QTBA 3MJ4A 3JQ7A 1Y98A 3QX9A 4PLFA 1AXGA 3WQHA 1YE3A 3CEJA 4LXYA 1JIVA 1QVRA 3JRWA 4CNQA 2UUOA 4POAA 2X6RA 1GN9A 1KTVA 2RG1A 5KDLA 1FDRA 3PRJA 3RJTA 1I7NA 1B41A 5B53A 4YP9A 3ZU5A 3COWA 2O8FA 1Q0UA 3EBOA 2ZZKA 1Z88A 4C3OB 1JEAA 2FSFA 3VHQA 5BUSA 3WNQA 1IXRA 3IN5A 4RSMA 4K86A 2ZJ5A 4ED3A 1E60A 5IM4A 1PVVA 1I7DA 4B6PA 3MCZA 2B7LA 4A5SA 4WN9B 1KK1A 2EERA 3CE9A 4DJJA 5F9HA 4KYIB 3IAM1 1W46A 1X15A 4CV1A 2TSYB 5IMBA 2CNKA 4RBNA 4ZYVA 5EHNA 3IIEA 4TZKA 4RA9A 1Z4OA 1K98A 4WLNA 4EHAA 4PTLA 3GEMA 3PQCA 2GMWA 4TXMA 2B4KA 5I3CA 4YJ2B 5ES4B 1KFSA 1I4WA 1V8BA 4DSZA 1XQ6A 3KHUA 1YDGA 2C42A 2BFFA 2PZ8A 3G9QA 1UM9A 2FEKA 1WB9A 2OAGA 1P9RA 3V7NA 1A8QA 5LIPA 2A3RA 1SXJA 2JFUA 4FYMA 2G70A 1SHKA 5HZMA 5CXSA 3LC2O 3W7BA 3MHPA 3TR0A 1RWPA 1JX6A 2QTMA 2QZ9A 2QR5A 1EJ6A 1ZA2A 5KFZA 4CQNA 3MWLA 3WGQA 1NQ5A 2RK4A 4FZJA 1WUIS 1IY0A 1X8JA 4X61A 3GHYA 4EPXA 1T6BY 1TK8A 2D00A 3P9NA 4FW9A 5LVAA 1CUSA 2J3EA 3IT1A 2IPXA 3C5CA 3H1EA 4FMBB 3I9OA 2HIAA 3B1FA 3C1TA 2XSZA 2OB1A 3ROFA 3PIIA 4DT1A 1C4XA 3CNQS 1QYIA 2QG6A 4PCLA 4XQCA 3FDZA 1NMXA 4RTNA 3UXNA 2GN0A 3BJMA 4G25A 4MGHA 2G7ZA 1PQWA 1IJBA 2ZIVA 1KJ9A 4BX9C 4JP1A 4L8FA 3FHTA 2FE4A 1X0VA 1T91A 3H04A 3D2SA 2J0QA 5MDHA 4PZEA 1YH3A 4QXPA 2ODTX 1OGJA 3K53A 3M6XA 4KI0A 3GMDA 3TKLA 5JMTA 4QECA 1XMIA 1SV4A 4UREA 3LSTA 3T3PB 4N1AA 1LVGA 5LD2B 2KLBA 5ES3A 4NV1A 1DG1G 3IFSA 3I9MA 4XX1A 4LTDA 3AVTA 4QOFA 3QYPA 4XH9B 1E2HA 5JZSA 3FWNA 7REQB 2Y9TA 3Q5EA 2AE1A 4YD1A 4G9BA 1NLYA 1SQ6A 2RGNC 5ALJA 1UAYA 3C7KA 3PJEA 2D7JA 1Y89A 4RVSA 4YRRA 2YJNA 4OMCA 1V43A 3WKAA 4Y2UA 3RSHA 121PA 4R2IA 3ETCA 4Z99A 2K6GA 4IHAA 3L9XA 5T41A 3NDIA 2N75A 5GONB 3GFFA 4MAAA 5DNCA 3E2IA 5A04A 4EJ2A 3L05A 3CXRA 4H6PA 4NH4A 3KE8A 4J0FA 3GJ5A 3OZVA 1BPBA 1YI1A 1AXRA 2A58A 4LY6A 1ZK4A 4YCMA 3EIWA 3VUFA 5EQDA 1P9NA 4ZPJA 2V7EA 1DUVG 2GYWA 1P45A 3SQIA 2LRHA 3RKUA 3TQTA 1RZ3A 4ZQCB 5IHXA 1DDGA 3BGSA 2O8DB 3A2LA 2FH5B 3KVVA 3GRKA 5C8XA 1W59A 2W8BA 2EX4A 3H5WA 3LT1A 4OHBA 1CUYA 5J9FA 1E6UA 1TJ3A 2OCBA 3R5JA 1XGKA 3W34A 3L40A 4QFCA 2CN1A 4O3FA 3QXGA 3VR5H 1SPXA 3BCHA 2XHEA 3HRIA 2B25A 3HJHA 1OI4A 1Y3DE 4ALLA 3HACA 4FCTA 3NCHA 1N5MA 4UEKA 2ZRHA 3EA0A 3G5LA 4LF4B 2O2EA 1J49A 5IT9A 2GZ2A 3LDFA 4WKNA 3WL4A 5B5SA 1AB6A 1U9JA 1XC9A 4Z6CA 4P33A 3UT5B 3FCYA 3W5UA 5IZ4A 2PE5A 1O4WA 1PFUA 2BDTA 4JI0B 2I2BA 3GMSA 4EG7A 2R7NA 4UM9D 4C08A 1P4HA 4DF4A 3OJ0A 4BTEA 2HV9A 5KYYB 5F3RA 3EUFA 2XECA 1N5KA 4GWLA 5HJ7A 3WAGA 4PR3A 1N4AA 2SCUA 4S1VA 1KJWA 3WFJA 3LNCA 5KOJB 2W55A 1IRIA 2PYZA 4RK7A 2J9RA 1PEDA 4TTRA 1A5ZA 3I04A 1U28C 4XX0B 4D44A 4HRAA 2WHRA 4Z8XA 3AHCA 4PLHA 3CNHA 1RXUA 4FDTA 1JXOA 2ZIAA 4P2GA 2PUAA 2XCIA 4JQCA 3CKYA 3ZZMA 3B5EA 1Z3EB 1LRJA 1U0FA 1T9DA 2FPIA 4TL8A 4EBCA 4WKOA 5KVSA 4KXQA 1KI9A 3X43A 5M04A 3FYUA 4ZIRB 1EWQA 1QPGA 2FSGA 4DVGA 3A6DA 4PX5A 2FMHA 1F20A 5DO9A 3USCS 4AP6A 1GV0A 3EZ2A 5CVUA 4ZT7A 3D2AA 2Q3CA 2P1RA 3K4HA 4I5DA 2BELA 3W5JA 1DC7A 4F6LA 5EP3A 5KNLA 1NUHA 1ONNA 5K09A 2CT8A 4ZAZA 1CXZA 2ZR0A 1KO4A 4KMOB 4GXKA 4ZV7A 5LJIA 2D54A 3SR3A 5AKEA 3L8HA 3HKZC 3G2MA 4F91B 3JU3A 3FJYA 2DQ4A 3KCQA 1QHEA 5BXYA 2PMEA 4FLFA 5H3LA 2JHDA 2I4NA 2ES6A 1T0BA 2FG7C 1YE8A 4X1OA 4BVFA 4RFVA 2DUNA 4B6FA 4HTFA 3HWRA 2BPCA 3TZKA 1UAGA 1OBHA 1Z0AA 4YDHB 1EDDA 3THXB 4YJKA 2OQVA 1S0MA 1U5BA 2XXJA 3WK8A 1H0RA 1XVAA 5A4MS 4RHXA 2JGRA 1UXOA 2BQRA 4GKAA 9ICFA 4Q01A 3QQ5A 2BFBA 1R0LA 3HVRA 5L7YA 2W2XA 4IH4A 3ZNQA 1TIPA 3I53A 4ZC1A 2Q6TA 2WSMA 1DWPA 2ACWA 4R65A 3A04A 1LSUA 3HCOA 1GPDG 2WIGA 4OLBA 5CA7A 2VK8A 2J87A 2VDVE 5JJIA 1W5AA 2W4MA 2DSNA 2JRLA 3ETJA 2JIBA 1UBUS 2XB2A 4JJ4A 4DILA 4URHA 4YX9A 4Z1OA 2XE6A 5E38A 1B2LA 1T6ZA 4Q6WA 2D3WA 1M0EA 3LRXA 1KEVA 3DXFA 1HC7A 1UZAA 1Z4QA 3PB3A 6YASA 2A1IA 4CI9A 3OZSA 1AKVA 2HHJA 1GL7A 4F46A 1W93A 5JUMA 3F6BX 4BVAA 1LTHR 4KAJA 3OLCX 2VAWA 3AQFA 2WJZB 3LP6A 2CD7A 1EMDA 1SV0A 4AJKA 3MERA 5DNUA 2VTDA 1P2DA 2OAP1 1EB9A 1SOVA 1M2OA 1MQ2A 3RHTA 3UQZA 2GZHA 2JGDA 3GCGA 4OGKA 4ZI2A 2NU7B 3LQ1A 1THGA 1X7XB 4X1IA 3GN2A 3JX9A 5E1MA 2XGQA 5K8VA 2R1UA 2X42A 4ABYA 1R88A 1LQ2A 3WGMA 5TT1A 4OEHA 1AGYA 1ZOIA 3T94A 1VL2A 4B6SA 4RIHA 2ZYTX 2COKA 2EP8A 5LSAA 1SKYE 4MWZA 4GBJA 1GTZA 1BTOA 2Z6QA 4PYLA 4B6JA 3ZHBA 2O3RA 4FDLA 1P77A 4E4RA 1HKHA 3TXYA 4GS5A 1DEXA 2CNOA 2JGKA 5P8WA 1K6JA 2F67A 2VK1A 1GFWA 3D4PA 4TM7A 2XTZA 2JAOA 4TN5A 5EFOA 4KQMA 2BGJA 3L6RA 2ENWA 4JLAA 7ICGA 3O8CA 4GW3A 4R9NA 2J4CA 3DMPA 4UCXA 2C2KA 1DGJA 3MQFA 9ICBA 2OKCA 1U7ZA 3K9FC 1G5PA 2WF5A 3U44B 2RD2A 1JU4A 5KG1A 4KOAA 1KFKB 2CVHA 2ZDGA 1C1DA 2HO5A 3JV7A 3KJIA 3KZMA 4BV8A 5FO1A 3KLPX 4Y3UA 5J4VA 3EFEA 4K8RB 4NL4H 1NE7A 3GBPA 3WK5A 2R65A 2AR9A 3I2JA 5LLDA 2HRDA 5JCPA 3PVXA 1CRWG 1RPTA 5JY1A 4HNAB 3LYHA 3GEBA 1P7PA 5EXPA 13PKA 1N25A 2J33A 3R6DA 4LXIA 3TJMA 3EXHB 1X92A 3NYIA 1QRUA 4QZGA 5ADWA 3RH5A 4WLVA 1GP2A 1K3TA 3D31A 3O21A 1F6WA 2FLVA 4B47A 5JRDS 1ZESA 2YC4C 5GY7A 3H84A 1HLGA 1L4KA 2XGPA 1SB8A 1GPNA 3VO9A 2O8CA 3GZNA 1QIMA 1Y3BE 4DARA 4M04A 1TIKA 3OO0A 3PD0A 2I4OA 3KLOA 3GEDA 5I9TA 3T7RA 1S0NA 1D2HA 3T7AA 5F7OA 2PT5A 1MCZA 1YOVB 2VTEA 1U7HA 5D84A 1RI4A 7ICSA 4YRMA 2ZTMA 2G17A 4F06A 3LBAA 4W9NC 3OTQA 1EYZA 4EZ6A 2BEJA 1ODLA 1DQRA 1N2JA 4QU5A 7ICMA 9ICTA 2VKTA 5EHIA 3RRXA 2LHTA 3T5HA 3PO4A 4OI2A 2W2LD 1P6UA 3ESCA 1X9HA 2VJMA 1VTKA 1P5FA 2ZQYA 4JUIA 5FD8A 2R6GA 3H8VA 1UFVA 4MUAA 2LZ0A 4FUQA 2GZ1A 4OF4A 3KBBA 2PI5A 1U6IA 4RAQA 2P9JA 2CVQA 1H2WA 2PSJA 2UXBB 1XZIA 3A2MA 2F59A 2QQ0A 3BGVA 2P3OA 4JDPA 1RJGA 3FLEA 3OM1A 3H83A 2IYUA 3CSDA 4ENUA 2G5HB 3CMCO 4HEJA 5E1BA 3WNBA 4NBKA 2J3DA 5J8YA 4OAPA 2UYHA 3R7NA 2G8LA 4HBZA 1SCJA 2YIJA 3JQ6A 2O2DA 2OZPA 3BEDA 3A9TA 2HBYA 4ZT3A 3WV5A 3V8VA 3CUTA 2EVWX 2R6DA 2W0SA 3ILVA 2ZG6A 3A6GA 2FXVA 5H02A 3ZWKA 1A0OA 4AU1A 4F5RA 1QIJA 5LQMA 3G3EA 4QE3A 3FTQA 3ZUPA 4FFLA 5JSZB 1JPUA 1KVUA 5B3AA 5MF6A 2R5NA 1ZVJA 4GOKA 3ON5A 5JRTA 3AFOA 2WWYA 1QAMA 1W75A 3AO0B 2PXAA 2PHZA 5LKRA 1MJGM 1IBSA 2GS9A 2EBUA 4PFJA 2XMCA 2Y93A 1QFSA 4BU1A 1T8YA 4EW1A 1MDBA 2Y4OA 4UXIA 2IGBA 4OSOA 1ABEA 4Q02A 3OJCA 4BNFA 3U5ZB 3A05A 5FL3A 4R63A 1P2SA 3QVVA 5K6AC 2G09A 4E14A 3D8NA 2CK3D 5B6JA 1ZETA 3P2KA 4CFSA 1IYZA 1JTFA 1WEHA 1M0SA 4ZEMA 3JAKB 1J70A 4BE7B 3BF8A 4PLTA 2IYTA 2OXOA 5DHFA 4EK9A 1OWMA 4KUEA 3OWXA 1ATZA 5LWHA 3ZQUA 5CLHA 3N76A 1S2DA 1H5NA 3ZV6A 3F67A 5LBUA 1XTRA 1QO9A 3IKMB 3IC5A 5L40A 2I6QA 2XT9A 1EEHA 2V7TA 4HZUA 5E6RA 1LKZA 3VTFA 4KLSA 1PYOA 4BJHB 1D1PA 1C3OA 1LJLA 2O2SA 4WASA 5ITZB 4L0QA 4MGZR 2J1LA 1ZHHA 1OA1A 1V8FA 2ZS9A 4IUCS 1UKYA 3INNA 3AU9A 4HXGA 3UBMA 2K8CB 3ELYA 4OSEA 1Y4UA 4GC7A 1JB1A 4X63A 3L4JA 4MV7A 4DCMA 3QFFA 4XWWA 4MW1A 3AY3A 1WP9A 5CMLA 3MUFA 4CTJA 4FGLA 2W2KB 1P0CA 5A71A 4UQGA 3N0XA 3MT7A 1M6VB 1XG5A 3W2FA 1P0IA 4WFQA 1PVOA 2GM3A 4ZCMA 3A6PC 2GESA 4B8YA 2FEAA 1YQ9A 1L5OA 1SGWA 3OOSA 3K5HA 3SAJA 4JS0A 4ZMRA 2ZXEA 2FKNA 1JIKA 1U3GA 3FCSB 2F55A 2GZDA 3GLRA 4OJNA 2C8VA 3GU3A 3MUEA 3MWFA 3QW4B 2P8JA 2PSEA 1N5LA 1YF3A 1QXSA 2ZJFA 2O8NA 3AF5A 5IAGA 1ZMRA 4JX8A 1TCBA 3KKOA 3MABA 2QROA 3GFTA 1Q1AA 1JHUA 1B00A 2REQB 4EGSA 3ROXA 2W9BB 3E9YA 1DDIA 2VP0A 4L4YA 5DYTA 3LWDA 4YV2A 4ILKA 2AUTA 1U7PA 5FWXB 4I1IA 1Z83A 4KR9A 4ECWA 5AI5A 1QZTA 3OJEA 1R4NB 5IMSA 2CWWA 3NGDA 4BO9A 1F44A 3KYDB 4LJ8A 4NK4A 1A9XA 4Y6SA 4LWZA 4A16A 5BV1A 5I9BA 2H54A 3CA8A 1EEXB 2XJ4A 5KYVA 3CZMA 1XKXA 3DEHA 1M34B 4PFKA 2R6JA 5IJZA 1QIKA 4N7RA 2C9BA 1WWKA 1W6UA 2HR1A 1JJAA 3VZCA 3OIFA 1QGED 1P7ZA 5I8ZA 4GE0A 1KMNA 5JS7A 5HM8A 3T12A 1FX0A 4DC9A 1U0HC 3BRWA 4Q24A 1HDEA 1ZN7A 4YMOA 3G2HA 2BGTA 3RVJA 1Y4DE 2I3GA 3N6RA 4U2BA 1IM2A 3HCDA 3DPSA 1SHUX 2Y0PA 3AUUA 3LRPA 1PF7E 1NV9A 5C1OA 4RQUA 3BSSA 5K20A 2ODPA 1CVIA 4MUBA 3NI2A 2SKCA 3T9EA 5IAAA 5LD2C 4R1QA 1JROA 4L9SA 4E0BA 4DWVA 3P26A 1ISHA 2V7WA 3DJYA 5T6BA 3X1YA 3KLBA 5D2CA 3VU9A 1UHUA 1UPUA 5K8IA 1T24A 1C29B 1DINA 1V3QE 2WJGA 1EDZA 4KBYA 4NFHA 1DAOA 2PSHA 1CDZA 2PV7A 4DABA 3IOBA 2AGPA 1L1FA 3I4LA 3Q8QB 4AKTA 3L4BA 3W8NA 1RLJA 4FMDB 4ODIA 4LXUA 4YRQA 3A1WA 3MJRA 2E5SA 2FW6A 1GTVA 2Q2QA 1YRYE 3STXA 2QAJA 5DISB 1K75A 2CHUA 3FJ1A 1S97A 3G5AA 1W4CA 3L8CA 4L22A 1W44A 4KWCA 4X7MA 1NR5A 2PIAA 2EHJA 1IG3A 1K7FB 1GJRA 2R00A 3SIRA 3CRXA 5AXBA 2V96A 1TQDA 1HUOA 3SKYA 1EX6A 1JW9B 2ZI3A 2IYYA 2HF9A 1L7MA 1Y3HA 1BO6A 3LC7O 4G0ZA 4NY8A 3UEOA 4M49A 4IH1A 3GDGA 1VDVA 4IOKA 2VPQA 3CH7A 2H57A 3CBGA 4RELA 1IK6A 5E8JA 4C0WA 1X1EA 4D02A 1UDWA 1X1TA 4GHWA 3N75A 1DQZA 4DMLA 5JQGA 1H2RS 2NO7A 3IBSA 3MJDA 4KPGA 5J4YA 5HE8A 1RAAA 5IASA 3TE7A 4D0RA 3ST7A 2Q9CA 1TJPB 1W48A 4EI8A 3TXXA 1KP3A 1X7ZA 4ZI3A 2Z5FA 4AY4A 2PU5A 4XQ0A 3IO5A 3OZWA 5L1IA 1EIZA 3PL5A 3F4BA 1KYYA 2CXNA 4KXUA 3RV4A 4ZJPA 1TK3A 2GEFA 2JL1A 3KTFA 1QP7A 1W96A 4LF9B 3LKZA 2FHSA 3NIDB 4L3VA 1MV8A 4WCFB 4UZSA 5TPWB 1HEYA 5L3QA 1E18A 3WWEA 4MW4A 3RTEA 2J7PD 2YCBA 2IBTA 5KDDA 3QHAA 1TM3E 5G0VA 3ROTA 4MROA 3A1DA 5GPBA 3GLFE 2XB6A 1UJ5A 3QWHA 3K6KA 4MARA 4RQ4A 2QZPA 2HLNA 1RHKA 4ZA2A 2CLEB 1SCBA 2V03A 4PAWA 4DPMA 2HQOA 2PBLA 3NBAA 1X66A 3LXRA 3WTCA 2EDUA 2X4DA 4GI7A 2YZ7A 5FBKA 1Z5WA 3L0YA 1BW9A 2B7BA 1C9MA 2TYSB 4U2EA 4JBXA 5KFXA 1V4NA 4DV6B 1JN0A 1DEAA 4FFVA 4U3JB 5CA0B 2PT9A 5AHKA 2JGJA 3PGVA 1T5IA 3K6JA 4A2PA 2BKXA 1TA4A 1LY1A 4UB8U 1X9SA 3OQOA 3NORA 5EEHA 3WS7A 3QBEA 4DUGD 4QZ8A 4J6EA 5AK0A 1JECA 1CRLA 1ZW6A 2WP8J 3DLIA 5AW9A 4D9JA 1F1BA 1IEWA 3HYRA 2IXGA 3IB3A 3PBKA 3O4RA 4HAXA 1DIOB 5KSPA 3PMNA 1K88A 3LOPA 3GGJA 4I2HA 5IINA 3M3PA 1MQ8B 1NJ5A 2VBCA 1V7ZA 2ROQA 3BZWA 1N0HA 2VQ3A 2JFZA 1JIHA 4ECTA 4GOOD 2JH7A 2QL6A 2HCRA 2M98A 1NY5A 1R8YA 2BP7A 2ODNA 3I1IA 2D0PB 5GP1A 1EUDB 1C3EA 2L2QA 2C3OA 5K4LA 4M9HA 3KHSA 3MR2A 2WHYA 1B8OA 3PQ5A 2ZRNA 2CLIB 4CF7A 1S0OA 5GADl 4EYEA 2HK9A 1V16B 3CLTC 4YMMA 16PKA 1LDMA 3ZN2A 2YWEA 4RJTA 2ESEA 4GBMA 2PD6A 2AMYA 5DBBA 2NVOA 3MGKA 4I7EA 4M37A 1N9GB 1A96A 5FNVA 5E6UA 3K5WA 5CCDA 2GPJA 3WGNA 3OHSX 2EFYA 4UAUA 3GIIA 2XY5A 3WKBA 3TUJC 9ICHA 2OTCA 5FTKA 3WVNA 2CE7A 3FDXA 4RU9A 2FG6C 3K8QA 1K8ZB 3GD5A 5FX2A 3Q7RA 4RMNA 5KNDH 1L6RA 1IHXA 3DHYA 3ESAA 5G3ZA 3VBEA 4C4TA 2C54A 2B94A 4MCIA 4TMKA 4D9KA 3OY2A 1XTZA 1HUQA 3CLSD 5K5EA 3N2GB 2AWOA 3EJ6A 4U2GA 2YNMA 2CUNA 3C6XA 2H4HA 1JEOA 4E6PA 5A02A 4B7CA 3SX4A 4MAFA 1NKVA 4RK5A 4Q3NA 1ZRHA 1O89A 1O97C 3DAPA 3V7KA 2AX4A 4C4YA 3L6UA 2IWHA 4IEFB 3UCXA 3IE2A 2PZFA 2OD2A 1GUYA 3ZWYA 1C1XB 1N6HA 3LQ2A 3GRYA 1SURA 3F97A 4UVHA 1GZ6A 4HGPA 3WDKA 1M8KA 2C4HA 4H6XA 3PDHA 1U5AA 5A3RA 1J7JA 5EMHA 3LPCA 3DE1X 3HRKA 4R8LA 2AGVA 2ZBRA 4OM7A 1QIFA 4JVMA 4MICA 1YJCA 4GVPA 3IVCA 4O2LA 6Q21A 3GRRA 4F1KA 5EIBD 2HSZA 2FJ0A 1VA5A 3ZIUA 1EGQA 3H5IA 1YBVA 1F1JA 1C30A 4JB8A 3IE1A 3FZEA 4UCQA 1JHDA 5C80A 1UJ4A 5HK9A 4OIFA 4RVNA 3KUUA 1NVUQ 2ZQZA 4MO9A 5AFSA 3A58B 4C7VA 4BB0A 5CP8A 4G5FA 1CIJA 4LW8A 3EA4A 5KG7A 2C77A 3VR0A 4H1VA 4EL0A 4B2IA 4INOA 4LDJA 1KOLA 1RAEA 1WU8A 5A2QA 1ZITA 1A71A 2QE6A 4GXIA 2BCVA 3NUQA 3O91A 2BYTA 5KEIA 3SYRA 4B6GA 4B7XA 1ODJA 3AUYA 4JLNA 1S3FA 3G1UA 2QTWB 1NQOA 3V8RA 4QQ8A 1V48A 3ZLVA 1Z68A 2FPWA 1MAWA 5AOBA 3WL8A 3K1RB 3PX4A 2P2SA 4GLJA 4G8DA 1Z3CA 3D7NA 3PC6A 1Q0ZA 3M4JA 2PD4A 3WJ7A 4OQQA 5AI0A 2P9GA 5D00A 4EG1A 1FSGA 4X94A 4BLTA 1E3SA 3ZGYA 4LRWA 5EZSA 2GERA 1ZDMA 2HRRA 4ZDKA 4PH5A 2HYIC 3PHLA 3CVOA 3QBTA 4YREA 4F2GA 5TGZA 2J3MA 2SHKA 5EMNA 4ZVNA 3FTPA 5HK8A 5FA5A 5JYEA 3TGLA 1OZAA 1E92A 1XQ1A 4FCWA 3RJMA 2WJPA 1N77A 3EXHC 4LJ9A 2G0AA 1EVZA 7YASA 1ACMA 4FOTA 3GPCA 2NTEA 1Y81A 5JC8A 1E6LA 1MB2A 2WIFA 1ISMA 4CVNA 3FNGA 2HBRA 2GD6A 2N3ZA 2P6NA 2Q2NA 5ENVA 1P0FA 3HWWA 4UVIA 3EPIA 1QH9A 1PG2A 3ZK9A 3KKQA 2N1MA 3F2IA 3MTJA 1XTIA 3GJ0A 3IHLA 5BWBA 5F98A 1VSUA 3LP5A 4NNJA 5CHGA 2C3MA 1MLDA 1HNXB 2NVBA 3FHLA 1TK9A 4BN5A 2HU2A 4TKZA 5HTKA 2IH2A 3GLIB 3U3DA 3KK0A 1MO3A 2WWVD 4LKRA 3IDAA 3Q7EA 3S40A 1AV7A 1TKDA 1HDZA 3B70A 4RLSA 2BFEB 4ZAVA 3DOCA 3IH5A 2E89A 2WUEA 9GPBA 4BLUA 3ISVA 5DG9A 1ZNYA 1JBKA 1QX3A 3PI7A 2C78A 4ZPXA 2PO5A 2G40A 2X9GA 1TF7A 4OA8A 1D2GA 2QLLA 2JIZA 2MYPA 3RKRA 1I7PA 2NT3A 4I9GA 2C8LA 1WQ4A 2VHVA 1QGAA 2WWTA 4K2HA 2Y9PB 5JW6A 4DF3A 5KOYA 3E8MA 3SJAA 2C96A 1ZOLA 3UB2A 4MVJP 4R8UB 4IDAA 1XRNA 2BONA 3PF9A 1IZ9A 4K28A 3KQTA 1E1CA 1EFPA 3WB2A 2AKEA 3PCTA 3T5MA 5HOQA 5DSXA 3NETA 1W5FA 3C2QA 1OBCA 2F4NA 2WU4A 1U9LA 1PIWA 5AIBA 1F4LA 1CB0A 1VC2A 1DKPA 5BV0A 2H3FA 2FYTA 3TZQA 3ZCVA 2OXFA 1CR6A 1A8IA 2NO0A 2PO7A 3ANSA 2BIFA 2NTYC 4UDYX 4QAJA 3R4VA 1GO3F 1P7WA 4TMFA 3MLAA 2CKMA 3PFCA 3KQQA 3QVLA 3VPCA 3H8WA 1E3WA 4G37A 1J2RA 4XQ9A 3RUPA 2C3PA 1DT3A 3QI2A 1KKLA 5ECYA 2BCGY 5E7QA 2OGWA 5EHQA 4UCFA 3EIEA 3TOZA 4K3VA 1MU0A 3DMNA 4UHBA 1C3VA 1C8LA 3Q4GA 2I34A 1HSZA 4YASA 3T5DA 4MUYA 1K86A 4MGEA 3WKEA 1QQTA 1C3JA 2P2NA 5AQ1A 4JXKA 1HPLA 2QMEA 1IBRA 1W19A 4Q4JB 5KJCA 2IZ5A 1LTQA 1Z36A 4NK5A 5K8UA 4YECA 3CUYA 1JFTA 4QYXA 5JXJA 2H9IA 5JJ5A 1HSOA 5DX1A 1X9MA 4KN6A 2IHTA 4J0CA 1YQWA 2QI9C 4QNNA 2MA1A 5EUQB 4QYIA 4IILA 2RI6A 4EG8A 1YQUA 2QK4A 2YJ3A 1YB5A 3TPFA 2D06A 2QBYA 4E21A 2O4CA 3VVCA 5KKCA 3HPOA 3UENA 1VKJA 3R6WA 4M9NA 3KOZA 3UJ7A 5BR7A 5D49A 3JPWA 4QJBA 5FOXA 1G8HA 1JWAB 1W2HA 4J29A 3VDQA 5K8TA 1KQPA 2IPNA 4CQJA 5JTUA 4CFYA 2BFDA 2ICAA 3KVRA 4H6WA 1FPQA 2V7GA 3B3QA 3BWCA 3AEUA 3OI7A 5DB9A 2PGAA 1ZQQA 4DSJA 3H0KA 1J2EA 1YRBA 4J7XA 1MFPA 1QP8A 1B2RA 4K81B 4X1YA 3LDAA 2I1LA 1YT5A 2QRVA 3Q9NA 1BFDA 1E4EB 1XDBA 3PDCA 1LPSA 1CUIA 4QU8A 2ATCA 4MYDA 2B61A 2I9GA 4I2JA 2LKDA 4R2MA 2PUEA 4PL2A 4CM4B 3RSCA 1P0QA 3FVTA 4UZFA 5IVHA 3LPMA 2A4MA 2MMCA 2H31A 2C2MA 4ZD6A 4DLRA 3K6SA 1IRXA 1UIRA 4PS1A 4AY2A 2Q5EA 5BRAA 3P97A 4N5HX 1EVYA 1OLXA 1FFBA 4ENPA 2NGRA 3VSEA 1QYDA 4EEZA 4O4IA 2CNNA 1BVSA 3WWPA 1GZHB 4BGIA 1RQ7A 1W88B 3U4QB 1MO4A 3KLMX 4FI3F 4PPNA 4CHGA 2PFQA 1O96A 4NECA 1YO6A 1E6WA 1V2HE 2HJSA 1MJNA 1U3WA 2IYZA 2Q8PA 5E4YA 5DG8A 3IYLW 4V39A 4RZIA 3PQ4A 1TT7A 6ABPA 5EPEA 1U63A 3CRW1 4TV9A 1K66A 1USVA 3WI7A 4ZYXA 1KMCA 3TFRA 5ICMA 1C4OA 3F5DA 3NAQA 4UU0A 1JLKA 3TD9A 4LYEA 3RJHA 3BMXA 4F6CA 4PSUA 3HDTA 3P27A 2BMWA 4IVRA 3I5MA 5C8DA 4RC9A 2BSXA 1SCAA 3WGLA 2HZBA 3UOAB 1NJZA 1EHCA 5KTOA 4E46A 2BL4A 1FPMA 2HA3A 1M1YE 1YD7A 3ECCA 4Z3DA 3PNQA 2FPUA 4DZZA 4E7PA 3CPJB 4KH1A 3R77A 3BWYA 4G5SA 3RQSA 1WMBA 4YI3A 3EHEA 4KL8S 1VE1A 2HXGA 2AVDA 2X5JO 1KKUA 1QS0B 4F4DA 3FJOA 3F9IA 4LVSA 3QUBA 3GAMA 1QAQA 4RD1A 2AR7A 3ZQJA 3ITNA 2FLWA 2O7VA 5LYJF 2O7SA 4L5JA 5ISMA 1HEIA 1R0YA 3WK6A 3QLVC 8ICGA 3PEUA 2NPOA 4FEEA 3OJXA 1GWNA 1SUIA 3OM0A 4LVCA 4QOEA 1C4WA 3B8EA 3ZH2A 4GM1A 1XL1A 1G55A 1YDFA 4MQ5A 1EG7A 2XAUA 3FNIA 3UKJA 1LLQA 3M4YA 2ZIWA 4ZTUB 4Y2TA 4RIEA 2EYQA 3D3EA 3FMVA 4GPIB 4NPCA 1O9GA 3HU2A 2PT7A 4WIAA 1T3GA 1NM5C 5COAA 4YUVA 1U8XX 3N3BC 2F3SA 5CW1A 1WS6A 3BN3A 3LLSA 4NSNA 3SNKA 2E0IA 1CJVC 2XYGA 4ACOA 3PRYA 1NVVR 1YZLA 1O58A 3R0QA 2GASA 5LIRA 3AQEA 4BVBA 1UBJS 5C7LO 3MINB 1XPUA 4TURA 4O9MA 4IFIA 3VM6A 1T8TA 1QLWA 5AMXA 1GSIA 1DVRA 4INPA 2WT9A 5H16A 3G0GA 3FF1A 1L4EA 4NAUA 3WO0A 4PBTA 3T5JA 3BFVA 3H2GA 1DQYA 1U3TA 2FN3A 5JSYA 3UTCA 3IB6A 2Z1MA 4RTJA 1J1UA 2QTLA 3SK0A 4FFSA 5DX0A 3PR3A 2UZ4A 1QCYA 4J4BA 1F8XA 1E79A 3EZNA 3IPXA 4XDGA 1O6CA 5EE9A 2YOFA 1TI7A 3TIVA 1C9KA 1VSTA 8ICCA 2QAGA 1DC8A 3TTWA 2G5IB 1M1NA 4OJKA 4AN4A 5H82A 3BM5A 3GCWA 1C41A 1WAMA 1PSDA 4FHEA 1Q12A 4O2BB 4MFAA 1EKXA 4WCFC 3QJYA 1DKOA 3OGUA 5BOMA 3WHKA 3ZHCA 3HMKA 3WSWA 3VR5A 4D8YA 2J9XB 1UWCA 5DGBA 1K9SA 2AQIA 1X80B 1S8AA 4Q4AA 4D2IA 4MQMA 1NULA 3HP7A 1OXUA 2CFIA 2WTXA 1KEUA 2YV1A 2RCYA 3ABOB 3OETA 1KMQA 2XCTB 4KH0A 1I24A 3P5SA 3OLWA 4HWGA 4WNCA 3JATA 5GJCA 3PFKA 1ZQBA 3KQWA 1KKMA 1UF9A 1E66A 3RTDA 3D8BA 4K26A 1XDSA 1U0EA 3QPBA 4HB2A 3EQ8A 2LI6A 4Q4DA 4B5KA 5K0EA 2AG5A 4NMLA 1I5OA 3NP9A 3OP4A 2BZ1A 2VP3A 2NQTA 3NS7A 1ZJYA 3NJRA 3UPUA 1YNOA 1T2DA 3W2TA 3DM5A 1E0DA 5F2KA 1P17A 4WGFA 5AVUA 4P3OA 1YV9A 2HC9A 3PK0A 1KDRA 3DVAA 3GZ4A 3HU5A 1U8AA 2DUJA 2NTJA 3K70B 3P9QA 1O0BA 2HDOA 2CJFA 2P3QA 2W37A 1VIYA 1X7YA 3UHOA 2C20A 5IDQA 2I0FA 3B78A 3B2EA 1AZTA 4QWMA 2EEZA 5IX8A 2OV6A 2EG9A 3BXXA 1UMDB 3GLGA 4O2AB 2BBSA 3G6KA 5DGHA 3FVVA 2NWQA 2H8GA 3D0KA 3F5MA 4NBSA 4PBRA 3ANTA 1Q15A 2YX1A 1NZBA 3RFCA 2HSEA 3JRNA 4G1EB 4CG1A 1IDOA 4RZUA 1MQSA 3TRJA 4XAQA 2NADA 4N12A 1OYWA 3HG7A 2NU8A 3UBTA 4RD0A 1I1OA 4C5BA 2QLBA 2GLEA 2PG3A 2R6ZA 1U3VA 4XRHA 3GJTA 2GAOA 5THKA 2ZM6B 1NNLA 1AD2A 5EMKA 3I8XA 3ZJVA 5CX4A 2X3YA 4XM2A 3RIHA 4MRPA 1ZIDA 3SZLA 2XJ9A 3T5PA 3L02A 3TX2A 2F3NA 4O8ZA 4JSRA 2IEYA 3UMYA 3D43A 1CQWA 1DO8A 3BGOS 5KG0A 4K5QA 4YCSA 1Z0DA 3QNUA 1YCHA 4UULA 1MVNA 3VI3B 2NPFA 3L0DA 2JW5A 4KFRA 3FCUB 4QHYA 1A4IA 4PL1A 5CFPA 1XL0A 1LB1B 2LKCA 4M8NE 1QGOA 1QBGA 2KKVA 1HL3A 2ZTHA 3B9QA 5DMXA 4D5EA 1NNEA 2Q6IA 1J0CA 3SYLA 3TH5A 3UATA 1D6MA 3KWJA 2DMRA 2FJ6A 4JYCA 4AS3A 3SDSA 3OPQA 4PFQA 3BFJA 2VWPA 4L9WA 3T1NA 1MPTA 1NVBA 3KZXA 3C8MA 1J0AA 3ZW8A 1TGYA 1KEEB 3NHPA 2K60A 3FSRA 4C0SA 5REQA 1BGXT 4PZPA 1CZKA 4I50B 1DJMA 3DFUA 5AW5A 1L3CA 4QZIA 2PZJA 4FD2A 4P4LA 1Q1GA 4ND5A 3M2TA 5JSKA 3PEWA 2MYNA 4AXBA 2Y1IA 1TM5E 2QQEA 4J8PA 2DWPA 4PLWA 1MC4A 3HVUA 2GOLA 4P36A 1OLUB 4DJTA 4LOIA 1WXDA 3I6MA 3VYVA 2QM3A 4IKOA 2IIPA 2YJ5A 1SULA 4JC4A 3PQFA 1OT5A 3FCCA 2OZKA 1JLLB 2IQ5A 2GCIA 4FDMA 2UZ1B 2XGGA 3S99A 5LZ7A 2CPRA 2QU8A 3MS4A 4GYJA 2JI4A 4H35A 1V4VA 3P94A 2L5YA 4I1YA 4ALKA 3ZKWA 1TAGA 2DAPA 3K09A 3IURA 4JJ7A 2P62A 2WJVA 5J2HA 3M6VA 2HXYA 5CLJA 1WCLA 1J0DA 3I01A 5B2EA 3TJZA 5CP2A 5P21A 1ZSVA 7MDHA 5JUWA 3WIVA 2V65A 2C0PA 1YJAA 4CCSA 2ALZA 4W1RA 5L3SA 5CTJA 2YVQA 2OXCA 5AKYA 3THWB 4M7OA 5DTEA 4FU0A 1GCUA 1NUAA 1OXSC 4NEQA 2RAVA 3TG2A 3IBCA 4YCDA 1AGRA 3F3MA 3UNXA 3QF7A 2WAQF 1P29A 2RH9B 3VJKA 3GT7A 4ZZ2A 3N97B 5AI4A 2XYPA 1PJBA 2R8HA 5EOZA 1M2FA 3SF8B 5HVNA 1V1MB 1OGIA 3HNOA 4L6CA 4MH0R 3KPWA 3MFYA 2QY9A 4N82A 3ZQ4A 4YBZA 5DB4A 1UQRA 3K15A 2FAXA 3ZCTA 1W29A 1CF4A 4FIZA 3UH0A 1GEEA 5AJWA 1VI6A 4Z4CA 2GF0A 1M1ZA 1J0EA 2FMFA 4RPXA 4BO6A 5FI1B 4KOEC 5CVVA 3GDXA 3BGIA 4QLOA 1RBZA 1YB2A 2KBFA 1OASA 1JHPA 4MR7A 3KQYA 3BC1A 4G24A 2QG9A 4URZR 2GZAA 4P84A 1ORDA 3DFKA 1KH1A 4M0AA 1WU7A 1ML4A 1AMUA 4KLEA 3N0WA 2X0EA 4PZZA 4ECAA 5CX1B 1ZQFA 4EA6A 5DN6D 3HUUA 4KG7A 2FWJA 5JANA 2DZDA 3HZRA 5E3IA 3O92A 4E2XA 1VCNA 2B8NA 2HBLA 1MMFB 5KTYA 5HHHA 3PW7A 3F2VA 2PV0A 4DCGA 1H8HA 1O5TA 3IXQA 4OXYA 2AJLI 3BGDA 3Q2IA 1Q0RA 4AY6A 4F8EA 2WE8A 4UAWA 4J0IA 1V3VA 3AERB 1HFEL 1JAXA 1ZQLA 1C7RA 1UA0A 1Q6ZA 2O0KA 1IXSB 3M9OB 3FPLA 4GOND 3U60B 1O95D 2WG1A 1BMQA 3UQ2A 4P54A 4NCXA 4GC6A 4GWKA 5DIZA 4IFBA 1C50A 3DBOB 3GMIA 2GJAA 1DKUA 5C2JB 4QBGB 4IL5A 3OCCA 4G23A 3PO5A 2NYRA 2QNIA 3B9RA 4E94A 1EJ0A 5ELLA 1D07A 3MT8A 3AR2A 3MTIA 4BEWA 4UTPA 4WKGA 4L0MA 3ZIAD 3COYA 1KLNA 3SZRA 2NM0A 1KOJA 1ARZA 3ES9A 4ZYWA 4C8LA 4TWJA 3NHFA 1NY6A 1GPLA 3DH0A 2BRUA 2GHTA 1PK8A 2R85A 5LQAA 5GIOE 2ZWVA 1KMIY 3FXAA 2I6GA 1TM4E 4UE6A 1WXXA 3G9ZA 1JG4A 4CHTA 9ICRA 2H5IA 1GRRA 3O2NA 1GT91 1DGQA 1ZQEA 2XI9A 1MC5A 2P5SA 3DZBA 4F9TA 2VRCA 4CKCB 4U8HA 8ICQA 1P19A 1HOXA 3AR7A 1H23A 3WA7A 2OBLA 1TYZA 4V0NA 3VPHA 1U0OC 2E3TA 2ASJA 3ZDFA 2YV5A 4QDTA 2GNOA 3Q0EA 1C7IA 2WY2D 3PNBA 3E3OA 1Q1BA 4CKYA 4OQEA 3WQSB 4DLUA 2EFEB 3H6GA 4UFNA 1MDFA 5KNBD 1E4VA 2PQ6A 2PM8A 1UEIA 4J0HA 5J1TB 2R5WA 3DYBA 5IEJA 4WVLA 1Y1KE 2UVPB 1G18A 1R5NA 1KXZA 3LQFA 4FLEA 2VBIA 3S2ZA 2YIVX 4YP3A 2JXJA 1Q0QA 4R9RA 2WVJA 2UYGA 2LGJA 1P2UA 3MPOA 4IIJF 1AS0A 3JQ9C 4CM8B 2IW1A 4KXFB 1MX9A 3GFVA 3QU7A 3U5TA 4JVNA 4ARSA 1KKXA 2WAOA 4QSHA 2EP5A 3RE1A 3ELUA 5EZYF 2FWIA 3FWPA 3O8OB 1T4CB 2JJ2A 2BHRA 4YC7A 4DPLA 1WA5A 2QB0A 3MAJA 1J0BA 2Y1CA 1Y1LA 1V9LA 2RKOA 2XTAA 2O3UA 4YRGA 1WXWA 2ZSIA 2OYCA 4D8TA 3EXG1 3W4KA 3KHTA 1L8OA 1IHYA 2B4RO 3RIXA 3ED1A 1I4TD 3ZXYA 5JADA 4H2DA 3AIMA 5KG3A 4C7MA