3E58A

Crystal structure of putative beta-phosphoglucomutase from streptococcus thermophilus
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
211
structure length
211
Chain Sequence
MVEAIIFDMDGVLFDTEKYYYDRRASFLGQKGISIDHLPPSFFIGGNTKQVWENILRDEYDKWDVSTLQEEYNTYKQNNPLPYKELIFPDVLKVLNEVKSQGLEIGLASSSVKADIFRALEENRLQGFFDIVLSGEEFKESKPNPEIYLTALKQLNVQASRALIIEDSEKGIAAGVAADVEVWAIRDNEFGMDQSAAKGLLDSLTDVLDLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords putative Beta-phosphoglucomutase
publication title Crystal structure of putative beta-phosphoglucomutase from Streptococcus thermophilus
rcsb
source organism Streptococcus thermophilus lmg 18311
total genus 77
structure length 211
sequence length 211
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3e58A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3e58A01
1RLOA 3GYGA 1VFPA 3L8EA 3KBBA 3L1VA 2EAUA 5AKLA 1X42A 4AP9A 5AW4A 5ALMA 2IOHA 1ZD3A 3ZU6A 4NV0A 3B8EA 4AS3A 3NAMA 2P27A 4FYPA 2O9JA 1XP5A 2OBBA 3QUTA 3ZVLA 2R8XA 3ESQA 4BEVA 5ALGA 1L8OA 3PGLA 4FFDA 3BA6A 4OFZA 5ALRA 4Y3UA 3U7FB 4KX3A 4EX7A 2HEGA 3BWVA 4CF4A 2PKEA 3UMBA 1N8NA 2D2VA 4Y2TA 1EK2A 4UMEA 3KC2A 1ZS9A 2ZBEA 1RPZA 4DW8A 3D6JA 3L0YA 3U19A 4EENA 2NO5A 3QU9A 2W4MA 1Y8AA 2X4DA 3K1ZA 3AR3A 4Y2UA 5AW1A 4KYTA 2YY6A 4BNDB 3AR7A 2O2XA 4OD0A 2AUTA 1RC8A 1TJ3A 3PCTA 1NNLA 5AM0A 2WF7A 2C88A 2FEAA 4Y2YA 3I6BA 3J7TA 2AMYA 1Z4PX 4Y2SA 4BKMA 4NAVA 3CNHA 4XPZA 1ZJJA 1U2SA 4HGOA 5ALHA 5AW5A 2PR7A 2YFYA 2JARA 2W43A 3WK8A 1U7PA 4Y2VA 3L0CA 2B1QA 4UATA 5AI0A 2ZBGA 4IFTA 5AKZA 5AIBA 3PDWA 4JDPA 2OA0A 4NFLA 4BEWA 4GIBA 3QX7A 2FUCA 5ALFA 1T9ZA 2RAVA 1PW5A 2G80A 5AVRA 2HDOA 1RKUA 3SF0A 2HO4A 3QUBA 4UMFA 1L6RA 2FPUA 3KD3A 5AIAA 2QYHA 3L8HA 3A3YA 4C4RA 2JGAA 3N8GA 3E8MA 1YNSA 1WPGA 3E58A 5A3SA 3WKDA 2ODAA 3DV9A 4H1WA 4OHFA 3ZTYA 2WF5A 3ET4A 3SKXA 3ZTWA 1RQLA 4UARA 4ZEWA 5AM4A 4MUMA 2P11A 2I6XA 4L6AA 4GXTA 2YMPA 2WF6A 4XQ0A 2GFHA 1MH9A 3L8FA 5ALZA 3IB6A 5AVWA 3QYPA 3UM9A 3I76A 4KN8A 4I9FA 5AM2A 3NUQA 1ZD5A 5ALSA 4Y2PA 1YV9A 3B9RA 3KZXA 5AI6A 2I55A 3QGMA 5AW0A 4UW9A 2YMQA 3OCWA 3OCUA 5AW3A 5A3RA 4J03A 3QU4A 1J97A 3FVVA 5ALNA 1NF2A 4MWOA 3QU2A 1ZD2P 1XVIA 3WKEA 4Y2QA 5AVUA 5ALEA 3ET5A 2YJ4A 2B8EA 3AR9A 4HAIA 4UAVA 4DWOA 5AICA 1Q91A 3WKAA 3NRJA 4UAUA 4UMVA 3DAOA 3HLTA 5AVSA 5ALYA 2B0CA 3SMVA 5ALOA 3AR2A 4PNHA 5AM3A 1U2TA 5AVQA 5ALXA 4O8CA 2G0AA 2QLTA 2WM8A 4UMDA 5AK3A 5FP0A 1K1EA 5IS2A 3N5KA 3QU5A 3HYCA 4KNWA 3EPRA 1YDFA 3M9LA 4BBJA 2IA5A 2BDUA 2YJ5A 4HYTA 3I1YA 4Y2RA 1L7NA 1CQZA 2HCFA 2I33A 3DNPA 3QLEA 3R4CA 5ALTA 2W11A 2FPXA 4C4SA 1Z4OA 3WK6A 1U02A 3W5CA 3L5KA 4J2TA 2CFSA 1Z4NA 4JB3A 2FDRA 5AK6A 3R9KA 3ZWDA 2RBKA 4UM5A 1RKVA 2HF7A 3P96A 5AKJA 3IJ5A 3A1EA 5AVXA 1RMYA 5AHXA 1SWVA 2ZOSA 3QNMA 1NRWA 5AKXA 4RESA 3KDPA 1Z4LA 3WK7A 4KX5A 5JJBA 5ALLA 2C8LA 2P9JA 1VJ5A 2R8EA 1ZRNA 2FPRA 2G08A 1L7OA 2WF8A 3NANA 2JAOA 1N9KA 5AI5A 2GMWA 4YCNA 4BNDA 1SU4A 4AS2A 4C4TA 1TA0A 3PGVA 1S8OA 2B8JA 5AESA 3NALA 4EZEA 4YGYA 4DFDA 3ESRA 3U13A 3AR6A 3E81A 4ZEVA 2FI1A 4EELA 3U7HB 4XE5A 2HOQA 3NASA 2MSNA 3OCZA 1Z4JA 3UMCA 4CE6A 5ALQA 4YCLA 3U7GA 2CFTA 3RF6A 1QH9A 3U26A 4XOUA 2C4NA 5AW9A 2G07A 2B82A 3EF0A 2Q5EA 2ZXEA 5AK5A 2GO7A 1ZD4A 4DCCA 1ZOLA 1RMQA 2I54A 3NIWA 3VAYA 2G1AA 1VJRA 2AGVA 3SLRA 1FEZA 2RARA 3OCVA 3WK5A 2JAWA 5AW2A 1Z5GA 2RB5A 4QJBA 1RLTA 1L8LA 2VKQA 2AH5A 2C9MA 5A3QA 4EX6A 4EEKA 4HGRA 2YMMA 5AK4A 3ZUPA 4G63A 3W5AA 3L8GA 2HSZA 3WK9A 5AKEA 5ALKA 1RMTA 1F5SA 2R8ZA 2ZG6A 1Q92A 4RETA 4HGPA 3W5BA 1QQ5A 3WKBA 3CZ4A 5E0OA 1SWWA 3F9RA 1CR6A 3QUQA 5AKYA 3N1UA 2ZBDA 2MU2A 3ONNA 2YMLA 4CF5A 2YBDA 3OCXA 4UASA 2WFAA 2GHTA 3W5DA 2CFRA 1WVIA 5ALJA 2HHLA 2R8YA 3EF1A 3L1UA 5AVTA 2IOFA 3SD7A 3N28A 3FM9A 1S2OA 3FPBA 5IT4A 3FZQA 3SKYA 4BX2A 3IRUA 1O08A 1ZRMA 4UU0A 3WGVA 4F72A 4YIHA 3ZX4A 4FE3A 3RFUA 4E88A 1L7MA 3OCYA 4HGQA 3OTQA 2G09A 1QQ6A 2OYCA 2YJ6A 3AR4A 1AQ6A 2GHQA 3QUCA 5AKKA 1LVHA 5AI8A 2B1RA 3MN1A 1YJ5A 1Z4MA 4OCZA 3L7YA 4L57A 3E84A 5T41A 5AW7A 3S6JA 5ALUA 2WHEA 3ZVMA 3QXGA 1TJ4A 4BX3A 4YIKA 1J8DA 3ZX5A 3ED5A 3FPSA 3TLMA 2EATA 4B6JA 4IG4A 4BX0A 5ALPA 1IWOA 2YJ3A 3AR5A 1YMQA 1Z5UA 5ALIA 2I34A 2EARA 2WF9A 4Y2XA 4F71A 5AW8A 5AVZA 2CN1A 3I28A 4L6CA 5AVVA 2FUEA 5AKGA 1O03A 5AI9A 4QQFA 2G06A 2OM6A 3SHQA 1TJ5A 3A1DA 3MPOA 3R09A 4BYGA 2BDEA 4NABA 4UM7A 1RLMA 2Q4RA 5AM5A 2FPWA 4YCMA 2HF2A 5AVYA 3QU7A 1XPJA 2I7DA 3N07A 3ZW7A 4I9GA 3EWIA 2P69A 3A1CA 4KNVA 2BY4A 5AW6A 3B9BA 1Z88A 1TE2A 2NYVA 3MC1A 1U7OA 1YS9A 3DDHA 4Y2JA 1KYTA 4UU1A 3L0BA 2YN4A 5IT0A 5AKHA 2PQ0A 5ALVA 2FPSA 5AM1A 1QYIA 1Z4KA 1T5TA 1T5SA 1JUDA 3FGOA 5ALWA 2Q4TA 4G9BA 2MU1A 3AR8A 1WR8A 2IYEA 3M1YA 3U7EB 1RKQA 2NO4A 4NWIA 1Z4IA 2C8KA 2DQSA 3ZI4A 2B30A 1EK1A 1RQNA 1L7PA 3MMZA 1LTQA 3KOOA 5AI4A 5ALDA 3OPXA 4ZEXA 1RDFA 2HI0A 4HGNA 2JAUA 2HX1A 2IOFK 3ZWKA 1QQ7A 3WK4A 3ZVNA 1Z4QA 4CNQA 4CF3A 1WZCA 4YH1A 3WGUA 5AKIA 3WKCA 3UMGA 2ZBFA 1RRCA
chains in the Genus database with same CATH superfamily
4BFCA 2QZZA 4MVJD 1N2CA 4UTRA 4P54A 1SJ9A 3OJLA 4K81B 1HQDA 2AHOB 1J21A 2ODQA 2EKDA 3M5CA 1BMFD 2YHAA 2J0UB 2KTQA 1Z6XA 1N8NA 3KAKA 4TRRA 1NBAA 4GP6A 3E8XA 9MHTA 1QVVA 1BD4A 3L2OB 1ZNQO 4M83A 3GK3A 4JY7A 1EIZA 3E3MA 4B3IA 1VL2A 6CHYA 1UJ4A 4I5FA 5HZMA 3REQA 4CM8B 3QUAA 2O8FA 4UDYX 4UM9B 1T24A 3BXPA 3L0CA 3GJ6A 3FGNA 3OLYA 3H8VA 2XZTA 1YB7A 5KS2A 2ANBA 3E3NA 1GNTA 3KJXA 1WP4A 5KJFA 5CURA 3NGXA 4D97A 3ZPXA 2IXTA 4KLHA 2HHCA 2XOKD 5H5JA 4EG3A 2C99A 4CM5A 1GVHA 5HE8A 2R8IA 4GICA 4W4TA 5BURA 3N2YA 3L8HA 4OQFA 4LVOA 4CCHA 3ZE6A 3MBOA 4E14A 3ZTWA 4KLUA 2HXYA 4FIZA 3KZMA 3Q3HA 2W4IA 2GEVA 1XRSB 1UKEA 4Z6CA 2IUEA 1XK6A 4DF3A 4GPEA 1D1QA 2GCIA 1LU9A 2AYXA 2A8YA 2D54A 1DC5A 3C7CB 2QM3A 2DOKA 1C4OA 4Y2QA 4HWRA 1Y1PA 2XVMA 5CBPB 4MB6A 4RVCA 1V47A 3DJYA 1J90A 2Z6UA 3W3AD 3HADA 3P0RA 3PZPA 3HB0A 2FPGA 4M9LA 1FLDA 4FXOA 3ZXIA 3TR6A 4LOLA 4D6PA 2H3VA 3NHZA 3A4VA 3D3JA 1DV1A 1OI3A 1MA3A 4EY8A 1L8QA 3ISJA 3O47A 3P96A 2VSOA 5CAEB 1BVUA 1G18A 4F6CA 2I4TA 1A97A 3DTVB 1ZQOA 3WHKA 5DOZA 1N2CE 2W42A 5KB3A 3GIWA 4BNDA 1YFKA 4JLKA 4G09A 1GPKA 3R44A 4BV3A 4PZPA 4AS2A 4XWAA 3CC8A 1V3TA 2PRYA 3ORRA 2UVRA 1KDTA 4L5CA 1PU2A 3M0EA 3GNSA 4RD1A 1SQFA 1Q0ZA 3AEUA 1RWBA 1W85A 2FUKA 2FZVA 3OSUA 4U7FA 1A95A 1U3GA 1HETA 2C5GA 2JHFA 1LCIA 1Q44A 3ZWWA 3AGPA 3FDXA 4Q9HA 3WIVA 3DG9A 2WM3A 2YICA 3HO6A 3RC8A 4ZGGA 1DAHA 1HDIA 3O84A 4Z5XA 1ECCA 3BS7A 4LVUA 4N01A 4RZXA 2PZ8A 3FWNA 1KQQA 3SPXA 3K9CA 1RWVA 4J0CA 3CB4A 4MP6A 5KU1A 4TZKA 1IWBB 2ASDA 4TV8A 1CRQA 2XKKA 3GUYA 1TQ6A 2JD2A 4DV6B 5KPDA 4IRMA 4L15A 3FF4A 1WLYA 1J33A 1FB5A 3OSPA 4NYIR 3F6EX 2KIVA 3ZCVA 3R7LA 3H11B 5EWMA 2D1YA 2GXUA 3GFPA 2QXTA 4AI6A 3VSEA 1KEWA 2BAGA 3GRAA 5KCZA 5E2IA 3IQDB 1KK3A 3UKOA 1U4SA 3M6WA 1ZRSA 4LTMA 3ZXSA 5CR9A 1B8NA 3SENA 5LMCA 5F12A 1J1ZA 2XVXA 3CMCO 1QONA 3BWYA 5KTYA 1JHZA 4W82A 1UPUA 4DL9A 3QWAA 5JASA 1ACLA 1ATIA 4PGFA 2C29D 2I3ZA 1N5WA 2NSJA 3I9JA 1E1QD 2XDAA 3OAAA 3MTQA 1U2ZA 2ORVA 1Z5ZA 3IHLA 5GV8A 2ZYTX 2LZ0A 2Q5FA 2G63A 2XLBA 2UXBB 3R0ZA 4EKEA 3PU6A 1LS1A 2B69A 4DO9A 2R1TB 1DMSA 1R5BA 1G8GA 2ZBFA 2AF4C 2CDCA 1QZZA 1OZGA 4WBSA 5B2ZA 4TXLA 1SXJC 4BN0A 1XX6A 3SK0A 4LGYA 3ZDCA 2I9PA 3TIXB 5JCJA 3K32A 5FI5A 2PGAA 1P29A 2X2FA 1BD3A 1BDBA 4IF4A 3KPUA 2Q7OE 1KYVA 2DUJA 4ZODA 1H4QA 4F8RA 1CE8B 2ISQA 1M5UA 3BTOA 2F8MA 1L5MA 3SQIA 4FFSA 3PIIA 1NK9A 2XRFA 1NOMA 3T5DA 3DLHA 3HBNA 3C41J 1I1NA 2VYCA 5DP2A 2YYSA 1ZEMA 5HR5A 1KVSA 3K5WA 5M5BA 4DIMA 5IVKA 3M9OB 4P4OA 1I7QB 3VV2A 3IUNA 4O59O 5FB3A 3O3OB 1O4VA 1PT9A 1XE3A 2G80A 4F5NA 5A4FS 1OU0A 4OH7A 2RH8A 3JQBC 2JI6A 3IAUA 3B0YA 3PTLA 2XMPA 5J1SB 1KR2A 4EA6A 1PEKE 4CL3A 4D3SA 2FG7C 3WAJA 1BE1A 1I2MA 4KMSA 1MH9A 4KQIA 2ZUEA 4EJ6A 1XD2A 1GZ3A 2AFHA 4HQRA 3AJAA 3DXYA 3QKTA 3RJHA 1PZFA 5CA7A 2J9YB 5DLPA 3Q11A 2I55A 4DARA 1UFOA 1PG0A 4G4IA 3JQGB 1LZLA 3ZN2A 5IN5A 3PF9A 3LDHA 1JLLA 1CUYA 3K0AA 1DBPA 1W52X 4O4LA 3PICA 3DBLB 1E4YA 2XTMA 3ME5A 2H5IA 1UEJA 4BVGA 4PCUA 1LD3A 4Y2RA 2BUAA 3IQGX 4UBJA 2BFWA 2ES6A 3F1KA 3R20A 2AHOA 4C7BA 2PWPA 4NMMA 4H3KB 1C1XB 1CS4C 1IEVA 2IYPA 4AAYA 1IPFA 4N7BA 3M6KA 1RYYA 3QY0A 2J0UA 2FZ5A 4R31A 4ZMBA 1ZGJA 2YC2C 4MQFB 2ZFUA 1ZBQA 2M9NA 1YS1X 4XDZA 1YIAA 3NANA 1QDEA 1KR5A 1ZQQA 2OPBA 1VKHA 4YNBA 2EZUA 3T3MB 3DZHA 3IHKA 3N0WA 5IXSA 4YGYA 5ESDA 4CM8A 1S97A 4LVSA 1QX3A 3E81A 5JAUA 2PVPA 5J58A 1MO2A 1IVNA 4LNAA 5U1PA 3U7GA 2PI5A 4Q1DA 4NLKA 3PLNA 3C1UA 1GQQA 2GO7A 1WZNA 3C3BA 3HJBA 1XWLA 1B0UA 2VUIB 3NETA 4ZV7A 4K4HA 4RE5A 3LF1A 2C3OA 2RC5A 1DAOA 2WB4A 1EH5A 3TW6A 4IFEA 4O2RA 4JIGA 3K1AB 3V4SA 3KSAC 2UUOA 4F1KA 2RHWA 5BSGA 5KNBH 4QOHA 1I7DA 3WDLA 1QE3A 2BFNA 3PV0A 4ER3A 2ACEA 3K0KA 3TLBA 1GTZA 4TMVA 1KN5A 1YR1A 1JVSA 3H9UA 4IDOA 3HW8A 2I6FA 4MUBA 2X8JB 4EPTA 2KHQA 1OX4B 2EJBA 2FWIA 3SSOA 3I1FA 3K9NA 3DMGA 1IWOA 4RTRA 1F7VA 1B41A 2HK7A 3RSCA 1GKIA 4U39A 1KOFA 2XRZA 4TT3A 4O3SA 3DL7A 5CAEA 4QAQA 2Z2IA 2REOA 3RWBA 3ONWA 4C22A 1OVMA 1QLHA 4POAA 4B9TA 2WIBA 1VLHA 4YP0A 1SM4A 4Y2HA 3DTVA 2W3SA 1ORWA 3DV0B 5CYOA 1N0WA 2EZYA 1YZ6A 1V5FA 3I5XA 3C7TA 1JHPA 1XXHA 4EYEA 4BP3A 4YRTA 2WI8A 3JPNA 1DAMA 4JXZA 4O1MA 5TMPA 4L9SA 4R0VA 2H4XA 2X0JA 3MTJA 4A8EA 4H7DA 4D74A 3ZI4A 4BMPB 3MMZA 4DV0B 1R4AA 3K94A 2CCKA 1GGFA 5DSTA 2HX1A 1SC4A 2BZ0A 2O2DA 3QF7A 2QVYX 1F12A 1IOWA 1GA4A 1FMTA 2IE8A 2XCLA 4R41A 3D6MA 1A4UA 3CX3A 3DHEA 1QE5A 3E9QA 4RLFA 4JP3A 3EC7A 2VDVE 5DZSA 2Y1CA 3PHLA 3CLTC 3LS2A 1BCRB 1L8OA 2XIDA 2KS6A 5HFAA 4OO1J 3WHPA 1W5FA 3F8WA 4LKOA 1DC4A 2Q50A 1NDQA 2CV0A 1OB5A 4CM3A 2C00A 2ERXA 5DK6A 3RFFA 2GD2A 1E4OA 4BKMA 4GI2A 4XPZA 2IYSA 3ETNA 4EW1A 2BI4A 3EUB2 3O38A 4X84A 4OGGA 2FHSA 3H11A 5H8WA 3UOWA 5FJIA 4JDPA 4GIBA 1GCIA 4XLTA 4GC9A 3RQSA 1NOKA 4YMVA 3FCXA 2VOEA 3VR6A 1AKTA 1E5TA 4RQMA 4DRXB 2QYHA 2JGAA 1XCJA 1G4UR 5DSXA 4EVSA 2WG2A 5ICCA 2X3UA 1MO3A 8ICBA 2ZIUB 1PT5A 4RGBA 2HQ1A 3TKYA 1THTA 5IAKA 3ICWA 4BV9A 5ERGB 4NAHA 1P61B 4CIYA 5H02A 1IG6A 1M6VB 2EQAA 2CMHA 4MPDA 5ITVA 1KYXA 4LRYA 4EOGA 4G0OA 1NFRA 5KYWB 2IXBA 4ZYXA 5GJCA 5EOZA 3SSNA 1L8AA 3D7MA 5GTDA 4OP2A 3MJFA 1G16A 2WYVA 1NI4B 2HU8A 2R1TA 2ICAA 2IHJA 1SVLA 3T1HB 1XALA 3BG5A 2HCFA 3AVQA 2W11A 3KYJB 3OD5A 1BAPA 1KI8A 2V8OA 2WAAA 3T7IA 1ZVQA 3WLEA 1OH7A 3N2EA 3U5TA 3C3PA 5CVUA 4YXWA 4GBGA 5C7OO 1CEEA 2PLFA 1XCBA 5ER9A 1FW8A 1Q0HA 5ICGA 4QWBA 2YZ2A 3WYCA 1CE8A 3FW1A 1P17A 1WDMA 3OIYA 1O89A 3D2LA 4FKZA 3QX8A 2B8JA 4JBNA 5EMHA 5FT9A 4YXFA 4G8DA 4ZEVA 1E96A 4DQSA 1RPNA 2F3SA 3S1SA 3OE7A 1TIKA 4YI5A 4J0FA 1NTOA 2QIPA 2H18A 1V6CA 4JYCA 4YASA 3HR8A 3I9OA 5K3AA 2PGDA 4H7KA 4HFJA 1UPFA 5BYBA 1OIXA 2P3QA 1M7HA 1TF2A 4FMCB 3DVLA 1W87A 1QOQB 3FR8A 3IG5A 4A6EA 4RKEA 5F23A 2JFUA 3ENQA 1TOAA 1HKUA 4BO7A 4NCNA 1LK5A 4XGIA 3OFVA 4C8NA 3LPDA 3JQGA 4NLGA 3CZMA 1PUIA 1ESCA 4UUPA 3U61B 3GPLA 8ICHA 1RWQA 2VZ9A 5DWQA 5JYBA 2J6HA 2QJFA 5DQGA 4M7WA 3GHYA 2XB8A 5CW2A 4CF7A 1TK9A 5DI3A 4QPDA 3DBLA 1T4MA 2FEKA 2IIBA 5JR3A 4ILEA 2EIHA 4DEYA 2AMJA 4DSIA 2NAFA 3IVMA 3OU2A 2QU7A 3T7RA 1C1XA 4UXIA 4NXMB 4QHTA 3OOYA 4MQFA 2B4YA 1XTUA 4C7ZA 4K6GA 1GN8A 1II0A 1NK5A 3TVDA 2RGYA 3KOYA 5JIBA 1VMEA 1XSEA 5DNCA 2G5CA 2JGNA 1JUDA 4EF5A 3TL2A 1GFIA 4HYQA 5G0TA 2KZZA 3P8ZA 3RYFB 1Y48E 3FTEA 2R18A 4FYIA 2NO4A 2XNJA 4HB3A 1C0IA 5G1OA 1P5FA 4LDNA 1AN9A 2ATVA 3GYBA 1Z4QA 1JAYA 4EF6A 4AVYA 3RGWS 3VR4A 1QIJA 2CBXA 1GZDA 3ZJ5A 5I4BA 2YL2A 1T0IA 1ZA2A 2QNBA 4AP9A 5T3YA 4RKYA 1XZLA 1TQHA 1VM6A 4FJ1A 1PZXA 4DNOA 2CV1A 4QBTA 1CU1A 4JBLA 2CSXA 2AV6A 4DRZA 3U19A 3PKIA 1VXOA 3DKVA 5EWJB 3K0EA 1BHO1 2O2XA 4OD0A 5IHPA 5C1IA 3VC8A 4K88A 4JQYA 5JO9A 5BO5A 4JUCA 2Y0SC 2Z3ZA 3JWGA 2X8JA 1RRGA 4DV7B 4HAVA 1CKEA 4UCFA 4OV6B 1XDSA 1PTJA 1MH1A 4I2NA 1ZM9A 5HA5A 2UDPA 4NBVA 1RAHA 1EX6A 3JWEA 2WP0A 2BISA 4DANA 4AJJA 3V4VB 3EGOA 1M2NA 2W0SA 2W2LD 2YCBA 3GJRA 3L1IA 1JZSA 5HM8A 4BO6A 1DC3A 2CL5A 3CIOA 1V48A 1J0BA 3JVUA 3LVFO 4TS3A 1NZDA 4M9CA 3D6FA 4UARA 5HIAA 1FRQA 4YRJA 2DF4B 2YMPA 4BMYA 3OVMA 1Y81A 3VSBA 4UCXA 1XTSA 1YTUA 3AI2A 3L7IA 2X2EA 5TVGA 4UOQA 3DV0A 1V8ZA 1MA0A 4ITVA 1V7PC 2E7ZA 2ZTLA 2LDBA 4M9JA 3PJFA 3AC0A 3DAOA 1KQFA 4E21A 4JVNA 3ZHVA 4YHBA 1PZEA 5DNEA 1DJOA 1YFJA 1CF9A 2PH5A 3W2HA 1JEEA 3QLEA 3W06A 2H1LA 5CM8B 1FRNA 3TJRA 3IEUA 3R9KA 4WZAE 4X1KB 1KBQA 3GG2A 3FWKA 5KFLA 2CNWD 1ULUA 2V6BA 1BCRA 1PGNA 2LE0A 3M6VA 3V80A 3FOWA 2XSZD 2YFQA 1P9RA 4WXEA 3D8BA 4NMLA 3ESAA 3GGDA 5KVAA 4QDOA 4IDHA 1Z33A 4G23A 2VNHA 1CYEA 4F06A 1F06A 4Q8EA 4DDMA 3WYEA 4GX2A 4FB5A 3ICQB 3RAXA 3KVRA 1GGHA 4NK4A 2RHTA 1GL3A 1G1AA 1FY2A 2CUNA 2FJPA 5KOIA 4ZANA 2QUZA 2IHKA 1AGNA 1D4AA 4JOQA 3KU1A 3ZI7A 4O5KA 2RI0A 5B55A 5F9NA 3O1HB 1X7ZB 3EGXB 2AQ4A 1M6NA 1XZ8A 2ZCUA 1G6OA 2YYZA 5EJ2A 5ARBA 1RT9A 1SKYB 4A8PA 4X20B 4B45A 1AF7A 1Z5VA 1SHUX 4M0AA 2JGDB 4KRYA 1RPAA 3ZVKA 2X0DA 3HGMA 3OSNA 3RPEA 3CEJA 3AHDA 2WYWA 1F20A 5JBNA 1JIJA 5LIPA 3TNFA 1M8FA 5KYWA 4R8KA 1MW8X 4CXMA 3MR5A 5B53A 2MUTB 3HLYA 3TRHA 3COVA 1E0AA 2QQ0A 2WUVA 1GTMA 1NI4A 1NUUA 4TVBA 5BWLA 3EIWA 4XJVA 1EXNA 1E2BA 1DIRA 5EXDA 2VJNA 1H0SA 3U0VA 3U3JA 4ZJZA 3BVPA 4MVJP 1UZAA 2LW7A 5AUOB 1WTAA 3T5HA 4LCBA 4RK1A 2ZWIA 5A06A 2FMPA 1AA6A 1KSHA 5IX8A 1YIOA 1PSZA 3B9BA 1V5EA 1DG9A 1YS9A 5BV7A 4F8YA 4C1BA 2ZJZA 2W2XA 3JPRA 1MAVA 2ZR7A 1Q1BA 3L1HA 4EY5A 4WFJA 4DCOA 1ZDMA 4J90A 2I80A 4FOOA 1E32A 2PXCA 5IYZB 2QV0A 3ZWNA 4DUYB 2HHXA 2HKIA 1YI0A 1HDGO 2CXHA 2PJRA 4ABTA 4ZEXA 2JV3A 2ORED 3X43A 2H1WA 3QF4B 3IDZA 2HDNB 3L9WA 2HRQA 1W2GA 3ZEIA 4QYXA 2GZHA 4N76A 2ZP1A 1UXIA 3QFFA 1Q16A 4N8DA 3ZVLA 5FLEX 3PNYA 1AS0A 2CSUA 2G9NA 3QK7A 1A77A 2JFXA 1PNTA 1OD6A 3BXEA 3EOAI 5JZ9A 3FYUC 3GOHA 3WJ1A 2ZCVA 2B78A 4F1WA 3QEOA 3TSWA 2QTNA 3KHUA 1E9VA 5DW0A 5FNVF 4DEXA 3E35A 4O4HB 3LI2A 1MV5A 4HN4B 3AU8A 1YF3A 3TQRA 3IA2A 1VL0A 1FU8A 2CFCA 2O2JA 1JEAA 1E62A 2X0KA 1E9CA 5LD2C 1R0LA 4CQMA 1GA6A 1PFWA 3LXRA 4JHXA 3MT8A 3EMVA 3IHQB 4MI1A 4DR6B 3RARA 5HJ2A 1LLFA 2IWRA 4NJMB 4BAUA 3OTWA 1V7QA 3O90A 4YEDA 3SM9A 3ZHOA 4OHFA 4MZDA 4X1YA 4IMRA 1CIPA 4UEKA 4UREA 3H5IA 2AD5A 3UUWA 5KFYA 1GTVA 1GZ4A 2QHXA 1X7HA 4WERA 2YMQA 5SV2A 2BFEB 5YASA 1T1EA 1GM5A 1GDHA 1TCUA 5E0KB 1T2NA 1XB2A 5DB6A 3RYFA 3TLEA 2JHPA 5DLFA 3PLAE 1BGXT 5ALYA 3QRWA 4XSGA 3C3WA 3EGCA 9ICHA 1JEYB 5DX1A 3G6VA 3UHOA 3SZ3A 4IYJA 4DQVA 4K8OA 3RRFA 4NZZA 1PLLA 2XAUA 3F74A 4LSZA 2ODEA 2BH9A 3M4JA 2KOBA 1L5OA 1HMYA 5H4GA 1ZZGA 3ZY4A 1K63A 1X0XA 4KR0A 1NMXA 3AM5A 5EWJA 3VDXA 2XXBA 4Y9TA 4QRDA 1DBVO 4C88A 1E9EA 1ZMXA 4L3WA 1PGQA 4KPYA 3IALA 1SN7A 3UGJA 2VPZA 1PEDA 1X38A 4AO7A 4FQ7A 5EC8A 1I7SB 1AKVA 1B1CA 1BWRA 1W4CA 4KQCA 4JWNA 2C84A 3DF7A 5D3MB 5LP6B 2C3MA 3WLSA 2H3ZA 1JEDA 3QH4A 4NR0A 1HG1A 2R68A 3HEAA 4XXHA 2G1JA 4LF7B 3I39X 3SYLA 2OCEA 3K5HA 2YWBA 3U5ZB 3RB6A 3GG9A 3NB0A 9LDBA 3AK4A 3PC4A 1OI2A 4R1OA 1U48A 1CI4A 3K09C 2F4NA 3ZHZA 5KO2A 2Y1JA 5BSRA 1EZ1A 5A0TA 5ICMA 5DM2A 5A4AA 1V38A 3FIUA 1Q12A 2N1BA 3PFWO 3IPLA 1JV2B 5BOMA 1U1EA 5AK0A 5DXAA 1SXEA 2O48X 1PR1A 3N7PD 4WLUA 4NE9A 3RJFA 2Q5OA 5A4IS 1QFXA 1EUDB 3BFVA 9ICIA 1RZ3A 1G6HA 1M0TA 2HDWA 1B73A 3VH4A 4X1KA 7YASA 1LPSA 4GX0A 5KWIA 3KXDA 4QG7A 1MUUA 2IZ5A 3A4NA 3IFSA 4ZYUA 4RQ6A 3FDJA 3LM8A 3EWIA 4YJHB 4YXMA 3RBVA 1ZKDA 1EJ6A 5EIOA 4CKYA 1NBMA 1AN0A 1TUBA 9ICKA 4J7XA 2DPLA 2O3TA 4HLUC 2I78A 1XTKA 4LXUA 4JUAA 2YIVX 2ZRCA 2PRKA 1AUVA 3DDNA 2FE4A 2ZI5A 1CHNA 4LZAA 1RRMA 4YDQA 2OKGA 1K86A 4R16A 1M8GA 1DAFA 1EFRD 4Q4HB 5SY4A 2CNDA 3JPWA 2GI4A 3C98A 1D4FA 3RVPA 3DF9A 3FMFA 3H2JA 2IUYA 1X7ZA 4FLFA 4FYPA 1AGXA 3EGXA 4GBJA 1HEIA 1UH5A 3KQPA 3EEIA 4RSRA 2Y27A 2IEYA 1M2WA 5IXYA 3BWXA 4MROA 1MQ8B 5J3JA 2XCIA 2JGDA 1PK7A 4H27A 2B1GA 2EFHB 2BGGA 1DCKA 2IZ6A 3D1VA 4PYIA 3J81A 3M4XA 3HSKA 4P3KA 3AO0B 1MN8A 2W6JA 4HX5A 2G4CA 4K7JA 3LLVA 3FRJA 2QYOA 4M1ZA 5EQDA 4UB8U 3WLJA 1DP4A 3GXBA 1TM3E 2YZKA 1JKMA 1OGJA 3STUA 1VL6A 2GZRA 4ZI7B 4DDUA 4YCJA 3B20A 5EP2A 1TYZA 4FFLA 3U4GA 3OX3A 2GCEA 4PN7A 3QENA 3L7OA 4AN0A 3WV4A 4HG2A 1T5DX 5CEHA 4B4OA 1PS9A 1KP9A 1G38A 1KMMA 1T0JB 5GJBA 4DG8A 2B4QA 4JHLA 2FWPA 4ALMA 4JMUA 4RPIA 4FFOA 4YT5A 4A8HA 4ZICA 1IB6A 1OFTA 4HRXA 5I8PA 2CE2X 4N12A 3SZRA 4Q1EA 2XGOA 4C0WA 5ITWA 1E3TA 2WIKA 3CRXA 2Y0EA 3HKDB 4FTWA 3O4HA 2XDWA 1LTKA 3I2GA 2NZWA 4DY6A 3QF4A 4JV5B 2ON6A 2D5IA 1Y9JA 4MA5A 1DX6A 4OB7A 3LUJA 3PNQA 3REQB 2OCLA 4DL7A 2O8FB 2ARKA 2W58A 5SICE 2L17A 5JZVA 2WUDA 2VJYA 3NDBB 3QXJA 5EEGA 4N5NA 1Y80A 3EDOA 3UK2A 1SWVA 4MQ6A 3CZPA 5FYQA 3ABSB 2X77A 1TTTA 3BXGA 1O95A 9ABPA 2RP5A 4X65B 1G8KA 2F62A 3LF2A 4ZT7A 4O4HA 1C50A 2K8CB 1SKYE 3OCZA 1JPJA 4ALJA 5F9LA 3WGIA 4HAOA 4ECTA 2HTEA 2PMDA 5BP7A 1NMSA 5F1OA 3SAFA 4M22A 3K0CA 2P2YA 1TUIA 2R751 5GTHU 2RGBA 4NJMA 4WADA 1AA9A 4FFPA 2BFAA 4EG8A 3OQIB 4MRSA 5JFTA 5CFZA 1N6PA 3CLVA 1RABA 2RIPA 4KR3A 1I7NA 3TZCA 2BFEA 4GOND 3B1ZA 3DP9A 2C92A 4RTOA 2G09A 4I1UA 1C0PA 2DFKB 1K5HA 4FU0A 5KL8B 4JR1A 1CRLA 1IIRA 1BFKA 3RC1A 4J0DA 4EO4A 4KQ1A 1V7CA 3A1TA 5I9SA 1IAQA 3ICOA 4HH1A 2G5IB 1U7DA 1RAFA 1YS7A 2I87A 2BP7B 4I1PA 4M89A 4PBRA 3WIOA 3WLHA 3VNVA 2EL9A 3L7AA 1QIDA 3SLKA 4TGLA 3TQTA 1JPNA 5D2CA 4QC2A 2R48A 4EFKA 1Z88A 3Q98A 1CDEA 2XIQA 2AG8A 5BSFA 4HAUA 1PGPA 3ZWAA 2XYVA 4UBNA 3VKFA 2POCA 1A7AA 2V6FA 1MQ9A 4DLVA 1Y6QA 5I7FA 2X1HA 3TFOA 4DC0A 1TW2A 4BQOA 5FFMA 2GZ3A 2P78A 5TJ9A 2VZ8A 3LK6A 4O5OA 1NKVA 4L95C 5AKLA 5D3MA 1GNQA 2GN0A 4ZCLA 5EWMB 2GA9A 5G40A 3HX0A 3UA3A 2Z5LA 2FE9A 2WSSD 3UMBA 2C3YA 1FYXA 4J1TC 3BXZA 4ZOLB 4L6IA 3ZHTA 2OG1A 1N1GA 5CB4B 3DE3X 4TMZA 3EVBA 4J4HA 1U1CA 1T3SA 3RJIA 1WWKA 3H1FA 5FJJA 4HLQB 1KPGA 3W7AA 4ZDWA 1HWYA 2HYIC 3NVVA 4GECA 4X9XA 2VYND 3QMWA 1EJBA 4W5HA 1Q5PA 3RT9A 3LPMA 5HZHA 4XX1A 5IDXA 1WQ4A 2APJA 1C7JA 1H6CA 4B9LA 2E8PA 3UWMA 2F3RA 1EUDA 3DLAA 1HUOA 2DHRA 4C4RA 4QZBA 4KQJA 2BEKA 4D7AA 3B5IA 3R8FA 1FS5A 3K2EA 4OH1A 1FQKA 2C83A 4AP5A 2HMVA 4BO4A 4YJHA 3Q7PA 4HAYA 1U31A 2D74A 4XRRA 2FLWA 1NJ1A 1NC3A 4IHQA 2AFRA 3I2HA 4F84A 1MC1A 4U9HS 4XZ3A 4HH4A 2YJ4A 3OZIA 5JSQA 4PFQA 1J9GA 1XAJA 3KS9A 3LK9A 3HVJA 1JIKA 3PR4A 3WLOA 4ZQHA 3MCZA 5CNMA 1JDPA 5FP0A 4V2UA 4Q4HA 2IL1A 2CDBA 4MV5A 3V00A 4XQGA 5HF5A 5HS6A 4NBWA 1UDWA 4YUXA 3QW4B 1TKCA 4KGVA 3TTWA 4FMBB 3ELBA 1E1NA 1GTL1 3BJYA 2EAMA 4BMCA 4OJNA 1Y7IA 1WPXA 1ZA1A 3EMBA 3ND9A 3C5FA 5H59A 1Q0QA 1KDPA 1VE1A 1Q2UA 4Z4GA 1GPAA 4YFKA 1ZM4A 1UCFA 4ALKA 5A05A 1RYFA 2Y2UA 2GPJA 1OFHA 1XD2B 3RH6A 2AFHB 1E2FA 1NUAA 1POXA 2H63A 1A9QA 4R1PA 2R65A 3NHPA 2NQ8A 2GFIA 3DCYA 2HQSA 1T9GS 2QSJA 4ZI7A 1EFDN 3G9TA 3NT2A 5F98A 2H9YA 1ZHFA 3S81A 4KV7A 1JLLB 2M98A 5JAZA 1T9HA 4O4LB 4KHZA 2HWYA 1YMUA 1BX1A 3UW1A 2ZIWB 4MNTA 1G1MA 1T1RA 2YXNA 2EU8A 2NV2B 1YR2A 1EVZA 1RTKA 3VI3B 1QLJA 4DNQA 1SOVA 4MUFA 3TSYA 2JCSA 3WVNA 3E9EA 4F9EA 2WE7A 3UWDA 1WVMA 1CQWA 4CIBA 2FPIB 3V7NA 1CYDA 3OJSA 5J4HA 1WYGA 5KNIA 3SLGA 1A2OA 1NRJB 1DBQA 4R3UC 2F3PA 3HKDA 2FU5C 5J9FA 5AW7A 2OUIA 3K1TA 4KR6A 3FPAA 5E6SA 4OXKA 2R87A 2QRUA 1RCTE 2EF0A 3H2BA 3W7BA 2HHUA 3MD0A 4GL4A 3V1KA 4LXHA 3SVTA 3RGGA 3ZK7A 4NABA 3EJ6A 3FTPA 2Q4RA 4BUCA 3MQ2A 3ZW7A 2ZAOA 4D9KA 1V95A 4ZT6A 1RIIA 3WV5A 3U1VA 3WGTA 2YRWA 1CFZA 3CLRC 4C0SA 2CE7A 4B9UA 2H59A 1QSYA 4HXGA 2ZJ8A 2ZM6B 1EK1A 3HNPA 4WY8A 2G5HB 1LQTA 3DNFA 4JIMA 4MRRA 1O5TA 4BLRA 1TKRA 1EP3B 2GN9A 3PGMA 4EG1A 3QI2A 4PZUA 1JHXA 1YFZA 4S35A 4QEDA 3K70B 5BNTA 4BNZA 3OQIA 3QVSA 3GCDA 1DARA 4E51A 4AL4A 1NTRA 4CG1A 3H5LA 3D2BA 5EHNA 1R9JA 5K0EA 1WDKA 4F3NA 2Y1GA 1ZQNA 1DWOA 2HHAA 4TTIA 1EDZA 3L4SO 2QRZA 5JAMA 5EGSA 5HCIA 2JBHA 1K7EB 1A76A 1S0NA 1O6FA 5AKZA 3TPCA 4A2QA 1A8UA 1G5FA 3OUTA 2NT3A 1GNRA 5K8TA 2HMSA 4O3MA 1Z3EB 5DM1A 1XXHB 5LM3A 2HLPA 5DBGA 2GWRA 5IWAB 2QYTA 2BP7A 3H0KA 1CJKC 4MLDA 2V4ZA 4OIMA 1CPYA 3ERCA 3GFFA 5LDHA 2AFIB 2KM1A 5TISU 3SKXA 2VTKA 4FYYA 2O8EB 1EGHA 4GH5A 3H13A 3FCUB 3OTIA 2PSEA 3OZWA 2HBQA 4H35A 2AZMA 2JGRA 3W8EA 2Y1DA 5HJEA 2X9NA 2H4HA 4MUXA 3UJ3X 5BR7A 5K4LA 2ZRGA 3R4VA 4K9PA 4L1KA 1C8BA 2FMFA 5EL0A 3OSZA 3BKXA 1KY2A 1V43A 1V8BA 4ZFNA 4ASUD 1OZHA 5COQA 2JEIA 5GONF 5DYNA 5JWOA 4ROSA 3E8SA 4MYSA 3THXB 4TURA 3RSOA 1NKBA 3ZQUA 3VU9B 4GMKA 4WZZA 1VB3A 1YS6A 3E23A 3PA8A 3UZUA 2WM8A 1FTNA 2JFBA 1SPXA 1UDAA 4LRUA 1R0RE 2Z9BA 5JTIA 5TJHA 2FETA 1SKWA 3PJRA 1P4SA 2FDRA 4KWCA 4LJ9A 3LKZA 2CDNA 4HRAA 1GT91 3WK7A 1Y8ZA 1BJTA 1XZPA 4I8DA 1U0TA 4A27A 4ZOLA 1OZFA 5CB4A 2W2VA 1QKIA 4D8VA 3D3KA 4LX8A 7ICPA 3F4KA 1YQEA 2DJ5A 4BLVA 4I4TB 4DL5A 3OEYA 2XADA 2BUBA 5EKDA 2JZCA 3E7FA 3CQ9A 2XKJE 4B9VA 3AI7A 4V0RA 1TF5A 5BN5A 3AKYA 4EDFA 1J6UA 3TI0A 3G85A 4RMJA 1JHAA 3NTUA 3COPA 2J41A 3ADPA 5IFLA 3BCRA 2FFHA 3W77A 3MGVA 1J2UA 2WHQA 2VWPA 4JP8A 3T41A 5EWFA 4IJKA 2LUOA 2KX7A 4EK9A 5KFRA 2IIVA 2ZJ3A 1S4QA 3S27A 2CFRA 4FHZA 3CW8X 5B7GA 5L1JA 3FVRA 2A88A 3N86A 2RHJA 5GIOE 3NJRA 3IVGA 1IV8A 1DC6A 1JDNA 4J9KA 2CHFA 3KQUA 2X86A 1ID8A 1IQ0A 3FCCA 2DWPA 3UQYS 4IIUA 4URZR 2FLKA 4I9UA 5KQMA 4F3OA 1TJ4A 1V8PA 1ZXIA 1G60A 3KJZA 2J5KA 2HD4A 3T5KA 3DT8A 4S1VA 4ZKDA 3HL4A 2IYAA 2HC9A 2IXFA 1WXQA 4HB4A 4YN3A 3FUVA 4YP3A 4IGIA 3WRXC 2PMEA 3Q2IA 4BP1A 2G36A 4JBIA 1VLQA 4BDPA 4Y9DA 1D03A 4BYGA 1T0BA 2WINI 4ARCA 3GO4A 2P1DA 3W90A 4XFDA 1XK7A 2HK8A 2P9EA 1N8KA 3CISA 4DYDA 4H7HA 2Y66A 1BWQA 2OCXA 3MJHA 4JJ4A 3UJCA 4NQZA 1E2HA 4OL9A 2MHCA 4KPFC 1MEJA 4EYKA 1MJGM 1GCUA 3H5OA 1IN4A 4IL6U 3MABA 3OPXA 2VDQB 1SK9A 3QJGA 4JXKA 4WD3A 5DQHA 4PAMA 4TV9B 4XLZA 4LZNA 5AXCA 3WE7A 4QFBA 1AGPA 1TRKA 5E1OA 4WFKA 2HCBA 4XB1A 1DWQA 4MV7A 3IILA 4Q44A 1BN6A 2GF2A 2E37A 5CD1A 1AROP 4OJQA 1DU4A 2ZIWA 3A06A 2KZ3A 1NKCA 5DI3B 1ULTA 2FX3A 2ZRQA 3D2QA 3GFRA 3ZOZA 3H9GA 3KC2A 1QIHA 4QXQA 1DE0A 4PAOA 3I9MA 3W4IA 1ZRHA 1Z83A 1R6XA 2FPIA 3F7NA 1E7SA 3N0RA 3G68A 2HHVA 1Y4UA 3P0FA 1P9LA 1NNI1 3BOSA 1KVUA 1YE8A 4O8ZA 1AZWA 1BEUB 5CFPA 3WGGA 2RGRA 1I80A 4GI1A 1XD9A 1TX4B 2YXLA 1F51E 1ZCBA 1H4SA 1RRPA 3L1KA 3NYQA 5F64A 3GEIA 2YTZA 2I2DA 3KD3A 4BFWA 5KOJB 5A3SA 3PGA1 2C54A 2IY7A 4AFNA 4PHPA 4UD2A 2V9CA 3OIGA 5LLSA 3T7TA 3C1ZA 1U7HA 4JI4B 1TNDA 1HQCA 3U3DA 1NW7A 1OXMA 4XARA 2OHHA 4RV5A 2V97A 3ELUA 4I14A 4H4EA 5KTQA 3HK2A 2Z95A 3A7EA 5KQRA 1YI1A 2PA3A 5AICA 4OGLA 1JAXA 1MQSA 4FNOA 4ENPA 4WK2B 2C7OA 2JJYA 4B3JA 5J5CA 4RNNA 3T9BA 4D6YA 2Z0MA 1K6MA 4Z1MD 2QN1A 1UC4B 4FW9A 5HWSA 3PZBA 1R8YA 5J2UA 3A9WA 4WK4B 2AFHE 5IAAA 4LWZA 3RYCA 3L92A 3Q7RA 5ALLA 1IEQA 4QDKA 1W0JD 1X1RA 3KB2A 5H9VA 4LZJA 4ZVPA 2L19A 3RS5A 2LV8A 4C7KA 1SQSA 4I50F 4HMOA 1GFZA 4DFDA 4POOA 1XU9A 1U3CA 1JQLB 2P9YA 4U6QA 1SUDA 3F3MA 1JG7A 3EXHA 4KKVA 4KLQA 3KAQA 4HUQB 2AR7A 4AM8A 4XIFA 4IRCA 5FWXA 1LB2B 5DB4A 1T8UA 2AVNA 3VSAA 2X0EA 5FOSA 1FNMA 3ICVA 4I27A 5CVTA 4EMUA 1AKQA 4RW0A 3NH9A 1JLSA 2AFIA 4CFSA 2FP3A 3IT2A 1EGMB 2O8EA 2WPDD 2ISCA 2VH1A 3PNLA 1G5PA 1PRYA 2B4TO 2OHXA 3O3NB 1G21A 2BGUA 4NL9C 4U7PB 3FM9A 1JSLA 5UKDA 1ZNWA 3WGNA 2P5SA 3DOUA 1VC2A 5DM70 2H31A 3V32A 3SQOA 4NLBA 3THXA 4NFYA 4ZVQA 2F1RA 3SHWA 3VU9A 3ZY3A 3OZBA 5JH7F 3ZE1B 2ZSUA 4UDNA 3UGKA 2Q62A 4EHLA 2FVYA 2QL9A 5KDDA 2EAPA 2WWYA 3WAGA 5IT5A 1RAAA 2HB6A 3WNDA 4DUGD 1WXEA 6Q21A 3TLAA 1BDJA 3HJAA 3SHQA 1TJ5A 2IDMA 3CT4A 4WE3A 1QFJA 3OE5A 3TD9A 2FMQA 1GRNA 4WCFB 3AGQA 3HB4X 2IBMA 4RU1A 4HCJA 3WL6A 2C9CA 4F96A 5K3DA 1XEXB 4MARA 2P7IA 1XPUA 1E1RD 3P2YA 3DBOB 3U44A 1B0PA 3DLTA 1Q19A 4D9BA 1DDIA 3CW2A 4I4TA 2DH5A 3HJHA 4Q1VA 4JFAA 3LTEA 1FX0B 3G23A 3MMXA 2PBZA 3W5HA 1UQRA 4RZ2A 2X7JA 2Z2JA 4PZYA 3HU3A 4DILA 2PXAA 3WISA 3DT9A 4ZCTA 1ICEA 1TZJA 1CJSA 1KQGA 2OAEA 3AHGA 3GD5A 4FC7A 4IQTA 1ZD3A 3WIEA 3N2LA 2AZ4A 4F6RB 4UNRA 4G6ZA 2AI3A 1RP1A 1KDRA 2A3VA 3O8OA 3T61A 1Z56C 1ZH8A 4NCHA 1WXWA 1PV1A 1Z2DA 3GGJA 1XXHE 2WTMA 3L0YA 3AUKA 1S6YA 1Q83A 2X1MA 4FINA 2W4MA 4L50A 1VCIA 1TVEA 3X1DA 3BD6A 1PNQA 2FB9A 1HDCA 3DE1X 4RQ7A 3AM4A 1JDTA 4AUKA 3PF8A 1ZJJA 3L6EA 3PRKE 1SC9A 3U3MA 5B6IA 4U9UA 1YUNA 4N0EA 3O95A 4MIYA 2BGMA 3AEVA 1Y6ZA 1XO1A 1BJKA 4ARZB 5KQSA 3QE0A 1PF7E 3QX7A 1AVTA 4Q3KA 4CEIB 1S2DA 1WA5A 4YRPA 4JJIA 5D5PA 4W5WA 3CE9A 5BOLA 4UE3S 5HVNA 2P2ZA 4GRIA 3PFKA 4KUGA 2DAPA 3AOEA 1G55A 4RZ3A 4J49A 1W59A 2Q49A 4W1RA 4DT1B 3DZ8A 4DLSA 5CVVA 1JNYA 2EW2A 2ZJFA 2IVZA 5AM2A 2Y1IA 3UAXA 2ZIFA 5J2KA 3USES 2WKQA 2GLTA 3DDSA 2B25A 1TPZA 1JHVA 3O91A 4URWR 1NMZA 1XWWA 3CMMA 5K03A 3WKEA 3UV7A 1VXRA 2KBEA 3NQ41 4WAUA 1OLUA 2GF9A 2B0CA 1NBOA 1JKJB 1U6IA 3RS4A 3AB7A 2GUGA 4TV9A 2X42A 4LSMA 4HQLA 4QL3A 3QEJA 3AN1A 4LFAB 5AUQA 3UKJA 3I9NA 1L5LA 4DCMA 4EY4A 2BKUA 1LC3A 1CY7A 1DT5A 1UXGA 4BLQA 3CUEF 4CQMB 4WN3A 4RESA 2XB9A 3RRGA 1Z2EA 2ZI7A 4DA7A 2NP6A 3ZIDA 2E4ZA 1BS9A 4AYBC 1QHXA 2WWHA 4KXYA 4M36A 2XB2A 3L5OA 4X1YB 5F5XA 2JVIA 1JU4A 2GVDC 1DKRA 1T0UA 5F76A 3IKTA 4F2SA 1U0OC 5CGQB 4GDFA 1BRMA 4H15A 5KNCD 1KOJA 1KY4A 5B3AA 1BS1A 3NTQA 3KQNA 2G1AA 5JUWA 3U16A 3LQFA 2VHXA 4QRIA 1BGWA 4Y6QA 2I91A 3G9QA 1GPLA 2V7XA 5AK4A 2P90A 2AKEA 2PDAA 4HQOA 2EAOA 5KOJA 4A15A 1YT5A 4H08A 2JAPA 4FZ3A 3K9HA 1ZJZA 3DPUA 1JN3A 5K0TA 3T99A 4D41A 2PJZA 3QLVC 1XQ6A 3FPBA 5KFPA 3NHBA 3R3XA 2GAOA 2HJWA 4ENQA 4BO2A 4QUBA 2A0KA 2LR0A 1ICIA 1J0XO 3SBXA 1P80A 5KVSA 5IM4F 3ANSA 4K46A 4FFWA 3A70A 4B84A 4BC0A 5KWVA 2R2AA 2ZDHA 1JSXA 1FUYB 4MCJA 4AY2A 8ICPA 4TSRA 2PSSA 2J3HA 3MJRA 3REOA 3E7PA 2IIQA 4PBSA 1O94A 1EVYA 2O2CA 4OXRA 5IIOA 1GGKA 5J0RA 3WBKA 1XR3A 4GRAA 3A4TA 1XAHA 1SIWA 2C4HA 2LM1A 4GOKA 1VYVA 1E2UA 1ABEA 1ESMA 1YA6A 1Q84A 3COYA 3IBYA 2WV9A 4YRCA 5LKRA 2VLIA 3EGVA 4JUIA 3GZJA 5KNDA 2UU9B 3UAYA 1N5XA 5EJ9A 1L4KA 2H2FA 3PW0A 1ZAKA 3IMCA 4JITA 2C8KA 4NEQA 3DULA 1IN8A 3RDPA 5A04A 3F5MA 2ZLBA 4HUQA 1E3IA 4G8CA 3WRWA 2WSIA 3ZCXA 1NUQA 1P91A 1IY0A 2H7VA 4HDOB 1NFFA 1QBKC 3AUAA 1MZPA 2I67A 2EGHA 1UBRS 1VSUA 1RQGA 4DZTA 4KYUA 4Y3UA 4P34A 5FTWA 3R75A 2CDRA 5JNWA 4N7JA 1NLZA 3NDPA 1QHEA 1E6MA 1LFAA 1FU7A 3E82A 3ZHBA 1X13A 1PS8A 1IATA 1WOMA 2YWDA 3ZU2A 3WRVA 4IQ0A 2A1JA 4KLEA 5E3JA 4HGOA 2EQ5A 2A9PA 3RNLA 2ZTEA 5K2MA 4ZZ0A 1TUBB 3YASA 4J76A 2HWXA 3ER6A 3K6JA 4IH4A 1IBKB 3CUVA 1VJGA 3RKUA 1D07A 5F2OA 1F0YA 4O2AF 4EB8A 2J48A 4PZCA 3PQ5A 3P1JA 3NHYA 1P7CA 1R2QA 3DPIA 8ICLA 3T54A 3ROXA 4WCFA 4Z0TA 3GWGA 2I71A 2GFQA 2PO7A 1TYCA 5KVCA 3SJUA 1XEXA 5DH9A 1OREA 4ZZ2A 4DGQA 2NSDA 4NYJR 4HPJB 1P1BA 1POWA 2K4MA 4C0QC 1FX0A 4L4RA 3EIQA 1SBTA 3ESDA 1TAHA 3EFBA 4MEXA 1X0VA 3JYQA 3Q8XB 1QJCA 1CV2A 1K1EA 2C7QA 1O87A 4HFNA 3WHLA 1BPBA 4L3OA 4CI9A 5GP1A 5A4KA 3GGSA 1R1DA 3N7AA 4RZIA 4XUCA 2FJUA 4F6RA 3ZHUA 3R23A 1KAGA 5ICSA 1UKZA 1UOQA 4FHDA 4PPYA 2O7RA 4RMIA 2BMFA 3LO8A 2C8LA 3ZHQA 4J9LA 1AB6A 1P1HA 3NYRA 5LKAA 1RSZA 1CIVA 1P0PA 5GGYA 4CDMA 3TIVA 1D3AA 1YRBA 1ZLXA 1H2WA 1SKAA 3PWKA 5PGMA 1JQEA 1YB2A 4UE6A 3ZNOA 1XNRB 3DO6A 1SIBE 2GQ0A 4HEJA 3N7TA 2M1XA 2LMRA 3RLIA 4XVUA 3BQMB 1TM1E 3AUTA 3GUUA 3EXFB 4ARZA 1ZD4A 3W2TA 5A9SB 4CEIA 3A27A 2ZPTX 2RB5A 3KEOA 2VT7A 2XUGA 4FHCA 3X3HA 3OOWA 2C58A 3QVJA 3SDBA 1M6YA 4P58A 2IEBA 3AKZA 1NBWB 3C7DB 1YBFA 4DT1A 2WNHA 1VJDA 3EPLA 3AETB 3MSCA 5ALJA 4WQMA 3T95A 3AERB 3LNTA 2Z8ZA 1D6MA 4ZI5A 2Y0CA 4D9NA 1OA1A 3GJTA 3NPAA 4HOYA 4JWKA 4IDNA 5LDGA 2A94A 4G3XA 5G0VA 3VA7A 1A71A 2IV3A 3VJMA 1ZM2A 1JKJA 2XTNA 2VSYA 1ZXBA 1Y3AA 3SC4A 4PF1A 2XE4A 2YVQA 2FX2A 4D0LB 1KIAA 1ORVA 1NJWA 4BNFA 5CNIA 1V9LA 3LXXA 3Q2OA 4PYJA 2Q5QA 2RQ5A 4YALA 1LF0A 1ZEJA 3JQAB 5CCXA 3VZDA 3OURA 1N0VC 1RI1A 1KTQA 3VNSA 4GBMA 1U9IC 2ZIGA 2KI5A 4LHSA 2BEWB 1SC1A 4GOLD 5IT0A 4BMNA 2V9PA 1NI5A 1DK3A 3MB5A 4Q7QA 3SS8A 3HILA 2PVCA 3FLEA 1U49A 4TV8F 4B7XA 4LOJA 3VR2A 3FDSA 1L7PA 4ZDKA 2BCVA 4O2BF 2NZXA 2BSAA 3KKZA 2QNIA 2RI6A 3GPDG 4BJQA 4ANFA 2VP0A 4LFCB 2UUCB 2HU5A 2PWZA 2B92A 1RM3A 2ZYWX 2QSYA 4NDNE 2OP1A 2PYZA 3ONEA 1G20A 2PH3A 2ALJA 1ZYQA 2ZU0C 3LSYA 1HC7A 3Q5DA 2AMLA 4EG4A 4B85A 3KQHA 1XTZA 4M53A 3OF2A 2XYPA 3KDSE 1WL8A 4D79A 1RI4A 2SECE 1M1YB 4EFLA 1R8QA 1ISRA 1SCIA 4ZHQB 1OBHA 2CB9A 3UJAA 1Y89A 4WLEA 4H3HB 5JNSA 4YRQA 4OSEA 5AIBA 1ZY2A 5CLJA 1DEAA 3A0HU 1E2JA 1DBRA 1G5TA 1WKCA 3CO0S 1XA3A 4TL8A 4W1PA 1DCMA 2PUDA 1OW3B 3KK0A 1WLSA 5AM4A 1FLNA 5ED4A 3NOOA 1L1FA 1Z6ZA 3DVRX 1TEVA 2C7GA 3L7DA 4ECZA 4ECEA 3WLNA 4M9RA 2Y92A 1QHHB 1IZ7A 2K4IA 4CLHA 2WP8J 4OMDA 3BTSA 3IG8A 3G8YA 1L5NA 1ZISA 1OYVA 3IBSA 4MRAA 1WUDA 3T7JA 3COSA 2R5NA 1C7EA 3ZQ6A 1VG9B 2NWQA 3IQFA 3BMQB 2C2YA 1XZJA 3JQEA 3CINA 5L1MA 2I1QA 1I0ZA 2QPTA 5CYPA 3Q0TA 4I9HA 4M9XA 1TF7A 4MI9A 2YJGA 4Z9BA 5EOVA 1Y7PA 5FUQA 4NOLA 2AQ8A 3CG4A 5D86A 2ID8A 4KXXA 4B2PA 1K98A 5L4SA 1R50A 1R64A 3CLKA 5KFUA 3VC1A 4YCCA 1YQWA 4FDUA 3IODA 3OETA 1EQAA 1AZSC 1AY0A 3K6KA 2Z3VA 3GH3A 1GZVA 4DR5B 3TOSA 2YNMD 3ROGA 1NUTA 2HA6A 1C8KA 3LT2A 3BL5A 3FHCB 3BJEA 2GBIA 5JI3E 4O08A 4JJGA 1O6ZA 4KGZA 2K7FA 2IHUA 4RD3A 3URKA 1BNOA 1B93A 1Y5LA 1T6NA 4AULA 1BTOA 4CVNA 1F5SA 4GWLA 1LH0A 1K7SN 4CGYA 3H2SA 3WGHA 2ZR9A 3VZBA 4M9SA 4HN2A 3UF0A 1D5CA 3H7AA 3BMNA 4C0JA 3DDWA 1HO3A 3KQTA 4GG1A 4V03A 3L84A 2J0QA 4MLPA 1KBOA 4BMZA 2DKXA 1XAGA 5JTTA 1JFTA 4B4DA 1L3VA 4NBLA 4L5JA 3IAM6 3ZGVA 2ATCA 2GT1A 3OZEA 3DTYA 3GNLA 3V4RA 4HEQA 1SCJA 1U5BA 4IM7A 1SV0C 4BLOA 1SGGA 2SICE 1FFBA 4UEJA 3JZFA 3W9SA 4FBTA 4KO2S 1Z0SA 4H6VA 4ARUA 1KO1A 5CYFA 2BMDA 2YS6A 5IIIA 5KTTA 4ZA2A 3G2OA 4DLYA 3QQ5A 4WWHA 4ZDIA 4L9RA 4FSDA 4QG3A 3BM5A 1MX3A 4Y6RA 5C8YB 2G17A 2P69A 1Q1AA 3QXCA 2R8GA 2WVHA 4LJSA 3EAQA 5CPBA 1C4KA 4J07A 3WAKA 1B4DA 1JDZA 3L02A 1ZQDA 3N75A 5AKHA 3JWHA 4OA8A 3A3PA 2I2XB 4FB4A 1Y1TA 4OKNA 3UO8B 2CHGA 2D1QA 1N92A 4LHWA 1WPQA 1PVDA 5T4FA 3MT0A 4DIDA 2HI0A 3EXFA 3HM2A 1LUAA 2QW1A 3P0HA 4M8NE 3GBPA 5A9SA 3JVIA 2UYGA 2YB1A 4UE2A 3T12A 3RFTA 2VHCA 2I66A 4DCJA 2HFKA 2BFBB 3VNRA 4UVEA 1AH2A 2B7LA 1SZHA 4TMFA 2GBLC 3FBWA 3TEFA 1NBME 2UUPA 1KK1A 2D2IA 4X61A 5E6SB 2PQ2A 1OYWA 5H9WA 3AETA 2D3DA 4UB4A 4ED7A 3OX1A 4NK5A 3TDKA 4M1YA 3C6QA 3M6FA 1MVOA 4BECA 3AERA 4NEHB 4RGQA 4M1QA 1ST3A 5CU7A 2WT8A 4JODA 5NLLA 3S3TA 1C2YA 1AK2A 4WLVA 1T94A 4TLCA 1RW4A 1WQ1R 1YCGA 5HTOA 4K0RA 1TLFA 2UYYA 1Q0RA 5BVGB 2ZJOA 3UV3A 1CRWG 1SUPA 3MRXA 4IIVA 2J45A 1ZMTA 4R1NA 1V8DA 4OEHA 1CC1S 1KJIA 5G41A 3EF3A 5FA6A 2B4KA 3PI7A 1T2DA 3JQAA 4Y7CA 2H51A 2WFLA 3IP5A 3L8FA 4JJ8A 2NVUB 3PI6A 4RJ2A 2OK8A 4BFZA 3RJEA 4M0FA 1T36B 4PX2A 2BEWA 3QBVA 1AUPA 5CJ7A 3TL3A 2XE8A 4JFRA 1N6IA 2P9TA 4H1HA 3H6HA 2ZUFA 4S0XA 1E3JA 2M6SA 1C7YA 2PFNA 1F1JA 2FGJA 1CRXA 1EFTA 5HHIA 4RWEA 4IS7A 4HEA1 1GZUA 1WNTA 4XM1A 1KEUA 1QGAA 3K92A 1IBMB 1ZR2A 5ILQA 1IK6A 2H7CA 2HQOA 1I3CA 5LB4A 1B0XA 2KICA 3EVEA 3BQTA 1TI7A 1YZFA 3QW2A 2P62A 3HKEB 1I2ZA 4NYIQ 2FPOA 5DHPA 2XGPA 1RXYA 3RVRA 5JALA 3JQRA 4LCEA 1GU0A 1LV8A 3IJRA 4Z0HO 3KOZA 4O63O 3TIGA 4YMMA 1YB6A 1B43A 4M76B 5KJCA 4G0XA 3B7PA 1M1YA 2ZGVA 3RUIA 1RADA 3HEMA 2I3DA 3PTZA 4ZHQA 2XQJA 2FRVA 5GZ6A 1YVPA 1W8DA 2PGNA 3P2KA 4MFCA 1N3LA 3GMDA 3VAYA 4FBUA 3FN4A 2D7CA 2ZRNA 3RS2A 1ZVKA 2E4AA 1GZ5A 1VYUA 3BTVA 3DZGA 3W9UA 1ZHOA 3G5UA 4DXHA 1ZGCA 1IAVA 3PUXA 4RETA 5E95A 3CZ4A 4J0GA 4QU9A 2OAP1 1ESZA 2P0EA 4RAQA 4TRJA 4OSPA 4KLOA 2NV3A 1E64A 1CF2O 4U0JA 2H7XA 1BQ3A 1DAPA 5ES3A 1QHHA 4UU0A 1P0MA 2ONZA 3H0EA 2LXNA 2QG6A 3V3TA 4HDCA 2X4LA 5FFFA 3BJMA 5IZ4A 3GJ8A 1XU4A 1Z4MA 1KZGB 4I0WB 3LPNA 3F90A 3NDRA 1K1QA 4NCKA 3GJYA 1FMFA 4YPOA 2XE6A 3TLMA 4IDCA 5BR1A 1HEYA 5KL1B 1DLJA 1YQTA 3NPMA 3WYFA 3BMQA 5T67A 1DJNA 2GCNA 4Q7LA 1JMVA 3I28A 5CRIA 4FZVA 1W34A 4LY6A 2AIRA 5BN5B 4W8GA 2OMKA 4CMGA 3RH4A 2IP1A 1DV2A 1ZR4A 4CM6A 4ND6A 1R8XA 3GQBB 2GAFA 1KYTA 5FRDA 3F2CA 4LZGA 4QTTB 3IUMA 3HYNA 2I4OA 4NOKA 3S1AA 2CBGA 2BELA 1YZTA 3ROZA 2WJ3A 5B6PA 2KLBA 3EUAA 3D0KA 3BSSA 2QVGA 4WXHA 3EGEA 1KDYA 3STVA 5HUJA 1SL0A 1QV6A 2ZVPX 2Y77A 4IG9A 2CWDA 2AEMA 5EQTA 4LOHA 4RH1A 1ZUD1 5LJLA 3QOXA 1M1YE 2NU9B 1U4NA 1W29A 1BVYF 4AU1A 2J6UA 1JDVA 1IY9A 4WECA 4JLBA 1QOPB 1QORA 3AU6A 1SBIA 1LGYA 4UC0A 2DKOA 1C81A 1ZVVA 4M1KA 5E2BA 2DKZA 3OMWA 2ODNA 4A10A 2PKEA 3UPDA 1J56A 1ZS9A 3EEBA 4G2TA 4Q1FA 2Y76A 5JCXA 4L0CA 1XTVA 4L28A 2Z08A 4OYRA 1W36C 5I01A 5IJXA 1NXQA 3IP3A 4I08A 3G6KA 3GVHA 4UHJA 4CIWA 1ULSA 1M0EA 3QKIA 4F5EA 5HIKA 2J3KA 4HPWA 1QFSA 4Z7NB 3TLXA 3KOWA 4ESHA 2ZAGA 1URPA 1M66A 3ISTA 4Q3CA 1KI1A 1H0HA 2XY4A 3EIUA 3PWZA 3IQHX 2GSDA 3HTXA 4RF2A 3W6NA 1GADO 2GILA 4O3OA 3VYVA 3IBFA 4NICA 5K8LA 3IVAA 2H3IA 4BKRA 2EH9A 5C8YA 3NJ4A 3ZDRA 3X0DA 3VAAA 1UBTS 1BA2A 4ED8A 2M1ZA 1RXUA 4JSYA 4G5RA 4ITRC 4BO8A 4MB0A 3ZIAA 4HL6A 1JVNA 4P81A 4XVRA 3EODA 4U2GA 4HAIA 1QTQA 3DLPX 1AS2A 3G49A 4DR3B 4E07A 5AT1A 2CJXA 1ZNYA 1KOLA 2W2KA 5ALXA 1QS0A 4YRSA 1PL6A 3LYAA 2WTXA 3S8EA 3PRYA 4FIDA 5CEFA 5BY2A 2QVBA 3LW7A 4H1VA 2XVAA 4PYLA 4B1FA 3A6LA 2FP4A 1THZA 2DKNA 2JIMA 2BFBA 3C4VA 2OXRA 1CULC 2RMKA 4BASA 2X5OA 4D8XA 1K27A 2YZGA 4OY3A 5CT9A 4CMAA 5LQMA 1YHYA 5JS7A 9LDTA 4BWFB 4KN9S 4LHZA 1QUEA 2RKWA 2BPOA 3KLBA 5IPFA 3F7TA 2F9FA 4LYYA 2IPLA 1EU1A 3O3CA 4ZCPA 4HDNA 1UJNA 3M2PA 1IDN1 2HIMA 5BVGA 5FX2A 2PL1A 3N58A 5A1JA 3H2IA 1X1AA 5AW2A 2VJAA 1F9AA 1S10A 3T5PA 4X95A 3DFKA 2Y9MB 3T4EA 1OHHA 1KXJA 1CQXA 1LTHR 1FCJA 3OZUA 1DHTA 1YK1A 5J5VA 3LZDA 2NVUA 2AE1A 3EZYA 2XECA 2QTCA 1FVFA 3VPHA 2ZSKA 3GJ4A 3PEEA 3EC2A 4BMSA 1T36A 1DGSA 5J2UB 4L76A 5CNKA 1DIGA 2QARB 3RYCB 2G9RA 2JRLA 1BVRA 4HWKA 2D4HA 5CT8A 2WHEA 1NVDA 4WL0A 2AJBA 1OPRA 3ZX5A 1Y3FE 3S28A 2AOXA 2YJ3A 1NPYA 4LG1A 3HKEA 3RYTC 2I34A 1DLIA 2PMKA 4FDMA 2VF4X 1ZBDA 4NOJA 2PZLA 1A9PA 2CK3A 1U8YA 3EXHB 3WZ2A 4XCVA 1E0KA 1IZZA 5HG0A 5C3UA 5FWXB 1LPNA 3KUDA 3E9DA 3SXJA 4UB5A 3HE3A 1U28C 3HYTA 4AMBA 2FN7A 4YRBA 4Z2AA 4Z7JA 1YT3A 1ZKMA 5KVQA 4C0BA 1FFDA 4RK6A 3ROTA 4INOA 3F5EA 3B78A 4OQEA 2FR1A 2A0XA 4E4YA 3MS7A 3PC8A 2ZJAA 3OEHD 1G21B 4Q03A 3TMYA 1YDGA 1FUKA 3MCWA 2EKPA 5ISMA 5HKKD 4PSVA 3PEYA 2F1KA 3WGUA 2IYNA 3F8TA 2FK7A 2JK0A 3MNFA 1P1JA 5BPFA 3RS9A 2XKAA 4TYWA 2VK1A 1F0MA 1SNYA 2JH7A 1NUHA 1M72A 2GA8A 3VOAA 1PW7A 3NP9A 1Z7BA 4EYHB 4RVSA 3IIKA 4NP6A 3P2MA 2IHBA 1HMPA 3GNQA 1JR4A 2DRIA 3F98A 2Q4OA 4Q7MB 1U2DA 3TTYA 2FZCA 2W6QA 2C88A 3D54D 2BONA 2JFHA 4TPKA 2EBFX 3BGVA 2H06A 1YKFA 3MTAA 3U7RA 2OSVA 4JYAB 5KTMA 1BA3A 1T8WA 3ZZ1A 4EG5A 1RLIA 3U6KA 4QZAA 4ESOA 1S8FA 2QD2A 1N9GB 4CG3A 1MFPA 4A16A 5FBHA 3U44B 2AOWA 4KB5A 3G0DA 4JOBA 3KKAA 1TEXA 5IANA 1X2IA 3UAZA 1OX5A 3E8MA 1SZPA 4HNTA 5CFNA 3ZE0B 3H6KA 4A91A 2JDID 4E12A 3KM0A 3T34A 3VJRA 2NVOA 3QM1A 2PGOA 3I76A 3KQOA 5IF3A 2B3TA 3F4BA 5DNAA 2CXNA 3GQBA 5A2QA 2JZBA 3HA7A 1I94B 1ETHA 1XLTC 4FMCF 2BOVA 2GK4A 1XVVA 5COAA 3Q40A 2IEIA 4FFMA 1P75A 5JQGB 3O8OB 5AH0A 1DBWA 2RHGB 1FQWA 2ZQ5A 3TIIA 1PZNA 2ZPUA 3UMVA 2PLWA 2Y71A 4RT2A 2K4HA 2Z98A 3MJCA 5HOEA 2NU9A 3DLIA 1U02A 1P3JA 3RFCA 5JSUA 4Q1CA 2BMJA 2O54A 4J0KA 5P21A 4MUAA 4IS3A 5IKXA 4M1OA 4CFZA 5DYTA 4HHEA 1VJ1A 1X1BA 2XCAA 2IZ1A 2W48A 2RHLA 5GADl 2DUUA 2ZYAA 2VUSA 1JNXX 5HXAA 2ORIA 1GZHB 3ADOA 5TQVA 1UCVA 2WU1A 5DDIP 5ILOA 3U13A 4KWHA 3DQPA 2WUWE 5DHAA 4MF8A 3EXEB 4G0PA 3GUVA 4UQPA 4NI5A 3I04A 2C4NA 1L7XA 3IL2A 3LY8A 3ILHA 4DTIA 4DLXA 1ADBA 1N5DA 2ZIAA 2P66A 4IJMA 3UJBA 3F5DA 3NS7A 5DJ5A 2VFAA 1OLUB 3GEHA 4E2WA 1NT4A 3C0KA 1P39A 2MTBA 2GNPA 4W9NC 4HGZA 4N0QA 2A5JA 4MP8A 2FWBA 2R4QA 2ASJA 1T2AA 4N3GA 4ZO9A 2GHTA 2CMFA 2DUYA 1QMGA 2GF0A 3HKZF 1TLLA 3P27A 2R8YA 3EXG1 2GERA 4BUZA 5I5EA 3IRUA 1GG2A 1IRIA 4JLAA 2CMKA 2OYCA 2YJ6A 5KFIA 2GHQA 3CS3A 3WFIA 3IJEB 2DPHA 4KI0A 2WSMA 1ML4A 1TVAA 1S5LU 2JLUA 2DPJA 8ICGA 2V59A 4HK4A 4XWKA 1L3UA 3ZDXB 2V5AA 1ZN8A 1HF3A 4CR6A 3PBKA 2DM6A 1R15A 1XV5A 3EFOB 3G13A 1CETA 3I58A 3TRKA 4F2HA 4O6VA 4BKPA 4PC1A 2NZJA 3C28A 2DCUA 4C5CA 1RWMA 2WAQF 2A58A 2HBLA 3K75D 2R6CA 1WUYA 1KFCB 3E1GA 5KX5B 1W73A 2IQIA 5HGXA 1IHYA 3LCMA 4RYDA 4YJ2B 1QB7A 4LECA 1Z1VA 4B0OA 1F4PA 1UJ2A 2GK6A 3RSSA 3SZMA 4ENSA 4RD2A 5AI4A 5IJAA 1BU8A 4U2DA 4UBCA 1CNFA 1NK8A 5U9CA 5JYDA 4B3SB 4JNKA 4PCVA 3ENWA 1UOEA 1JQJC 3V6LA 5FI0B 3NV7A 4QBGB 5BN4A 1VMDA 4HC4A 1P0CA 3LHKA 4DMRA 5JSFA 3ETGA 1SVWA 3U3KA 2OEPA 2RGDA 4I3GA 2R8RA 2VH2A 2WJJA 3KUKA 4KQGA 1PK8A 1BHJA 4B2YA 3P9ZA 1DRUA 2GKOA 4DW8A 2OO5A 1BXRB 4GR4A 2WQ7A 1S89A 1JG2A 1O4WA 2PX4A 5AW1A 2GN2A 1TK3A 5BNZA 2QARA 2DXIA 3AB8A 4I6JA 5JSKA 3BIWA 1O77A 1FTWA 2DB3A 4QATA 3NUGA 2MA1A 4E0BA 2PS0A 2CHEA 4MV4A 4DM3A 4C89A 1LDMA 2IUFA 4UUBA 3L1JA 4AWAA 3I2YX 1XDZA 4V38A 5DLEA 7ICGA 3HZHA 4JC4A 9ICOA 3RVDA 2VJMB 4PZNA 4JLOA 5FF9A 1B00A 1JW9B 4GXTA 3EPPA 4EGJA 3NVZA 1UZNA 3UXMA 3ZGYA 4K9RA 4CLEA 2PX2A 5LUAA 2Q6IA 3DVAB 2EZXA 3CJTA 4XR9A 3TF5A 1U99A 2Q8NA 4G4JA 3DVSX 4YR3A 3ER9A 5AW3A 2GLEA 5JSHA 5CLHA 3FOEC 3T4PA 3W5UA 4C8OA 4NONA 4KLLA 1N2IA 2WZCA 3GCXA 2IEAA 5L8VA 1DJLA 4WINA 1FXUA 3IR5A 1VI6A 5EIBD 4JJEA 2QRJA 1VA4A 3ASZA 2A1JB 2DT8A 3V2IA 4KH0A 1U3TA 3A2MA 4KG7A 3IUPA 1SCNE 4C7MA 5IVPA 1UBOS 1R8SA 1SKBA 1QH0A 2IW1A 2ZR0A 4DWWA 5SYNA 3OX4A 3NCHA 1QSLA 3ZU3A 4P2BA 1S0OA 4M88A 3V6KA 2V1UA 1YCDA 5AJYA 1COKA 2C2BA 1GGVA 2C4MA 5KT3A 1ZJNA 3HL0A 1CVIA 3M4YA 5JD4A 2C96A 8ICRA 4P3XA 2QMUA 1B22A 5K0NA 4YCXA 4EI7A 4HP8A 3MZ0A 2LIVA 4IUBS 4CIXA 3TTVA 4C0LA 3SYZA 4V0LA 2JLSA 1V16A 1N9GA 3RKRA 1I32A 821PA 2GYYA 3OCVA 5TF0A 4L4XA 1L8LA 1TKDA 5IYZF 4N48A 2B6HA 4TSFD 3G2HA 3O0DA 2XMZA 2C2MA 4H17A 1SZDA 2R86A 5CP2A 4RPHA 2FOLA 3O2JA 3CF4A 1YO6A 2VP5A 3GFOA 3DZIA 1S3GA 2J30A 3AJDA 2XMDA 1AZTA 4R1UA 5JQGA 4NM1A 3OTHA 3VVLA 1OB2A 3BJRA 4MS4B 1Z25A 4MVJM 3OM9A 2JJ2D 5BQPA 3HCRA 1QRAA 3G1WA 4B71A 2B8TA 3WGMA 2O06A 2J6TA 1E7YA 5GOTA 5KHAA 4RZRA 2IYUA 4O4HF 3MCUA 5DRTA 1U1GA 2AFIE 1J0DA 1PD0A 3PHGA 4MQBA 2AE2A 2B36A 2G9VA 5EGNA 3CXUA 4UHDA 1HH4A 4EJ0A 3TLJA 3JD4A 1G21E 2OQRA 1A9YA 2I7DA 2G7MC 3LW8A 1UPXA 2OZVA 4QZHA 2O0KA 2OBFA 4H7FA 1ZQZA 1U7OA 4QDXA 3QKWA 8ICIA 2VSXA 3ITKA 3NHJA 4PC2A 4YV1A 2F3TA 3SBOA 3MWEB 3D4PA 3IR7A 2W98A 4BBPA 2XLCA 1ONBA 2YC4C 4GXJA 3EXEA 4AUNA 2OSBA 1Q0SA 1RBQA 3Q9LA 3RAPR 2O0JA 2G9UA 3AFGA 1NYQA 3IPRA 1OXJA 4A1OA 3HWRA 3EAGA 3VGPA 5I9BA 1Z7YA 5BN1A 3PQ8A 2HPHA 4EUSA 2TMGA 3QWHA 4D45A 2FSIA 4OQPA 1T1JA 3DBVO 2RBGA 1REQB 5FHRA 4O5AA 2XGMA 1RXCA 1ZX1A 2FG5A 4L0MA 2BTQA 3G2LA 5EA2A 4E11A 4DF4A 2QL6A 4XX0A 1LNZA 4CMBA 3TX2A 1U9LA 2OO3A 3AL0C 4B09A 1GRVA 3KVOA 1CUEA 5LBUA 1WWVA 3UAWA 3CGGA 1GAWA 2AS0A 2YWEA 1VIVA 2IPOA 4Z7QB 3V8NA 3T3HA 1MNAA 2AOVA 2F8SA 3C8ZA 4IUYA 4KC0A 3EFOA 2P11A 4J2HA 1INLA 4FMDB 2VWQA 1MDFA 4YA6A 1I4LD 1W93A 4JT4A 4RZQA 3NUQA 5E9QA 5LP6F 1C3VA 1Q2XA 3RFAA 5C1OA 1RKBA 4FHEA 3FB1A 5KX5A 8OHMA 3Q8LA 4OFBA 3ENVA 1MJGA 4YJ2A 1G20B 1ZQBA 4II2A 3TTTA 4UAVA 5L1KA 1VP3A 3PQDA 4A5SA 3HZOA 1N60A 3NRZA 4G5FA 1EWYA 3SNHA 3FI0A 1OSNA 2EQBA 5E9WA 1FFUA 3IJPA 5TPWA 1JPVA 1KZ9A 4PWYA 2HHHB 3FCSB 4J0EA 1TC1A 5EXPA 3OZRA 4MUGA 1JWBB 4DA9A 3RAGA 4ZOHC 1KFKB 4GNKA 4F9FA 2AN1A 4ZQIA 1K4YA 1E9FA 2OO7A 4K4IA 1GEGA 4R63A 3MMPA 1BXRA 3SC2B 1T5BA 4LMRA 4B6SA 3HA3A 4DV3B 5KAPA 4LTDA 1U8EA 2R47A 1G9TA 1G8YA 4Z0NA 4OQLA 1W0KA 5J2GA 4D9MA 2EP8A 3IKMB 4R2MA 1SEVA 3LYSA 5ESXA 3OD1A 3L0DA 5KTNA 2Q2VA 3V7FA 4GFJA 1J9EA 3ST7A 3HJEA 2OCBA 1CUZA 4WOCA 2PGXA 1TCVA 2VBCA 2A9VA 2VJMA 4GVLA 2HSZA 3S5JA 3GLFB 5CTJA 1E2MA 2E8MA 3I09A 1T4GA 4I4NA 3EEOA 2IYZA 2C0PA 2Y3IA 2X6QA 5BUQA 621PA 5D6NA 2PRZA 4R98A 5BWCA 3DVAA 3MRVA 1K6JA 1Z0FA 3HP4A 5I4CA 2QMYA 2OFFA 2JHDA 4X7PA 2HCTA 4IIYA 4GSYA 4INZA 2G67A 5B57C 3QPWA 3F3YA 4KMOA 1PV2A 4KYIB 4UPDA 3HRDD 4EPXA 4QDJA 4LV6A 4M4SA 4JLVA 3SAGA 2PSFA 2JJ1A 4LCJA 5DB8A 3I37X 3KKKA 3TRFA 5AJWA 5DBBA 3EQ8A 1JKFA 3BUSA 4EJSC 5JNVA 3LYHA 3MGIA 2EKLA 4QIWF 3ZLUA 1OWLA 2VPYA 5C8ZA 3S2YA 2PT9A 3O2SB 3IBCA 4ZI7F 1UP6A 3GW8A 2CLCX 1X8JA 3B85A 3RKSA 4EWLA 3BH7A 3WQHA 1FP6A 3DDHA 4Y2JA 3KL4A 3CUSA 3L0BA 2UZ4A 3CNEA 5C18A 2Q21A 3AFMA 4ED6A 5EHQA 1OT3A 3OPVA 4PQYA 1FFGA 2WWTA 2OH2A 2ZK7A 1ZW1A 1Z4IA 2YVAA 3KWJA 3DFIA 1N36B 1EJ0A 5A4DA 1F8FA 3BMNB 2INGX 5TSDA 1ZFNA 1QYRA 2O0LA 4FYHA 4ZHSA 3I0NA 3RBEA 2AJTA 4BRSA 1XMIA 1T1IA 1DFIA 3Q7TA 4HXFB 1MX5A 2HHJA 1SUCA 1LNSA 4KDRA 1WZ2A 5F4BA 3WMGA 1U5BB 1E9RA 1RRVA 5I6DA 5JD3A 4ZI2A 1MFZA 4CNBA 1K3FA 2XO7A 5DX0A 3L77A 3KALA 3B53X 1LNQA 3TGWA 3BB3A 4MS4A 4DKXA 4OJ5A 2ZJBA 2UYCA 4UUOA 4Z3DA 4J9VA 3SEIA 1MOQA 2BRUC 5DGXA 3UAVA 1HPLA 1TA4A 1VG8A 4FKMA 3S4YA 3R5KA 4LTNA 1C8LA 5C32A 1PJCA 2HSGA 5H82A 2FFQA 4E5PA 3OIVA 5J0YA 1ZJYA 4IIJB 3T15A 1NUSA 4E5VA 1GVNB 4G07A 2ASLA 4R66A 4TOIA 4MFFA 3B51X 2ZRAA 4IFIA 1YJAA 2JA1A 2P91A 2A2ZA 2VSFA 5C34B 4LVCA 3E3LA 1FYDA 4L16A 1KAOA 5F7OA 5JJLA 4DV1B 3MWEA 5JU6A 2G5GX 1MT3A 4UHKA 4XYEA 3NKFA 4HYEA 3EZ7A 2J7KA 2WAMA 3PO5A 2R7LA 1PFUA 1OAAA 4JXJA 1CZUA 3IMGA 1ORTA 4LRSB 1MGPA 2FRDC 5HDQA 3L7CA 2JLQA 3IOEA 3QNUA 4BUGA 1I3OA 1KSPA 1K8QA 2RBKA 1PJSA 1YULA 4PTYA 2A5LA 1NJZA 3Q4GA 5LQRA 1REQA 4C78A 5JJBA 4ES6A 4P36A 2OY0A 2O8DA 1L0BA 2QD3A 1XNQB 1CK4A 1PUZA 3QP9A 2J87A 4RJIA 3PGVA 1FTSA 4B7UA 2OGWA 1UBFA 2RJOA 1UJMA 5CX4A 2WFLB 3L4JA 2HOQA 2BDPA 5BXYA 4G8BA 1QDUA 2TMDA 3WS7A 2B7CA 1JYEA 4OHBA 4DDTA 5J0OA 5LA6A 4FYJA 1RS0A 4NMWA 4TYQA 4X63A 2C61A 3LOQA 3ZV5A 1MLDA 5AHKA 1P2FA 2UUBB 2AA3A 1FL9A 4GVPA 1VBFA 2NUTB 1V1JA 3VNBA 1WO8A 5WRFA 2JH8A 3QX9A 3D8SA 1QG0A 4YPVA 5CRXA 2DBQA 4HGPA 1LDNA 3SAHA 3RSHA 4FJ2A 4IDBA 2HMWA 4IHJA 5EQFA 3QYJA 3UAGA 5DGTA 5A9TA 2D4AA 1PDOA 1A9ZA 1XQ1A 2VF2A 3L06A 4ML3A 1RJDA 3G0OA 5L3SB 1SZCA 4R1LA 4D4HA 5JNTA 3AIKA 4N39A 3BSWA 4F4WA 2AWOA 3NR2A 3CRZA 4GYWA 1XIVA 2ADMA 5DCYA 1XZEA 3G0BA 1ZJ5A 2LYHA 4B3TB 3QFTA 4DVJA 5CB4F 3BAZA 2NYRA 5EKUA 3QBTA 3RH5A 1VHWA 3DOOA 3IUBA 1NXVA 4AJ2A 2IKQA 4IYRA 4P4TA 3WXMA 4IJ5A 4IEEA 5FUWA 2PX3A 1FA9A 3RC2A 1G8AA 1WZEA 5D5QA 4Q45A 4IMPA 4P38A 5IUJC 4DHWA 1JX4A 3T52A 4ZVUA 4AZTA 3WIBA 4FGKA 1GP2A 2OB1A 1T9KA 2D5BA 3SC2A 1XNHA 1G3IA 2KIWA 4YRIA 3K0SA 5JAPA 2QZPA 4OQZA 3F67A 5BSUA 3FZGA 2MU1A 3CLRD 4C0AC 5C52B 4DYVA 4NWIA 4UU7A 2GCGA 2C4WA 1DVRA 2LCIA 2JAUA 2FPPB 2COEA 5D00A 4MA0A 7ICTA 3R3SA 2JIZD 5K3SA 4TKMA 1H0KA 1K5PA 2V98A 1W581 2EP7A 3K6RA 3VR6H 2WHPB 2OXCA 2HU2A 2ZSFA 3GLFA 1ZQCA 4OYHA 4P3PA 2RGNC 1BS2A