3E58A

Crystal structure of putative beta-phosphoglucomutase from streptococcus thermophilus
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
211
structure length
211
Chain Sequence
MVEAIIFDMDGVLFDTEKYYYDRRASFLGQKGISIDHLPPSFFIGGNTKQVWENILRDEYDKWDVSTLQEEYNTYKQNNPLPYKELIFPDVLKVLNEVKSQGLEIGLASSSVKADIFRALEENRLQGFFDIVLSGEEFKESKPNPEIYLTALKQLNVQASRALIIEDSEKGIAAGVAADVEVWAIRDNEFGMDQSAAKGLLDSLTDVLDLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative Beta-phosphoglucomutase
publication title Crystal structure of putative beta-phosphoglucomutase from Streptococcus thermophilus
rcsb
source organism Streptococcus thermophilus lmg 18311
molecule tags Isomerase
total genus 77
structure length 211
sequence length 211
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3e58A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3e58A01
1FEZA 4OHFA 4UAVA 5AVVA 2R8ZA 5A3SA 2WFAA 1YJ5A 2CN1A 3B9RA 3BA6A 2VKQA 3L0CA 4NWIA 4MUMA 5AVTA 3FM9A 3QUTA 3MMZA 5AKLA 1RKVA 1XP5A 2MSNA 1YNSA 3UMCA 1L6RA 4XOUA 2I7DA 3N5KA 1RMYA 3PGLA 2QYHA 5AW1A 3I6BA 4CF5A 5ALJA 5ALZA 4YIHA 1TE2A 1NF2A 1Z4OA 4Y2TA 1ZJJA 1WVIA 5T41A 1L7NA 3A1CA 5AM3A 4EX7A 5AM4A 1PW5A 2GHTA 1RLOA 2AMYA 2G07A 3N07A 4QJBA 1Z4JA 3QLEA 5ALKA 4F71A 3U7GA 2HO4A 3MPOA 5IT4A 2OBBA 2YJ5A 3OCYA 1O08A 3ZTWA 1U2SA 2B8JA 4Y2QA 3NRJA 2JAUA 3MN1A 3QU7A 4CE6A 4BNDA 4UMEA 3KD3A 2FPSA 3WGVA 3WK5A 1RQLA 1RC8A 1O03A 4EENA 4EX6A 3AR8A 1N9KA 3TLMA 1RQNA 3UMBA 3CNHA 4EELA 2B1QA 2R8YA 4HGRA 4NAVA 2BY4A 4CF3A 3ZX4A 4NABA 5AK3A 5ALHA 2CFRA 2HF7A 1SWVA 2IA5A 3L0YA 4EZEA 3DDHA 5AW4A 1ZD2P 1QQ7A 4MWOA 3ED5A 2HOQA 1RLTA 2IOFA 4F72A 2R8EA 3FPSA 3L7YA 5ALIA 5AM0A 2ZG6A 1L7OA 5AKYA 2GFHA 4GXTA 4BX2A 4BBJA 2Q5EA 1T5TA 4XPZA 5ALDA 1U7OA 3I28A 1Z5GA 2RAVA 3U26A 3FGOA 4FFDA 2ZBFA 4AP9A 5AVWA 2C88A 2C8LA 2R8XA 5AVRA 2RARA 4ZEXA 5AM5A 3RFUA 4J2TA 1WZCA 2GO7A 2O2XA 2JAWA 1RMQA 4Y3UA 5AW5A 3A1DA 4YH1A 1EK2A 4IG4A 5AI6A 3WK4A 2HX1A 4Y2RA 2G80A 1YDFA 4C4RA 5ALXA 3QU5A 2EAUA 3PGVA 1EK1A 4UASA 3AR4A 3ET4A 3KBBA 2EARA 4KN8A 5ALEA 4HAIA 5AW0A 3L1VA 3IB6A 3L0BA 1Z4MA 3N8GA 1Z4PX 4YCLA 4KNWA 4L6CA 4DW8A 2YN4A 5AKJA 3WK6A 5JJBA 1Z4NA 4NV0A 3SLRA 1J8DA 1TJ5A 4UM7A 3M1YA 5ALTA 2G06A 4CF4A 1K1EA 2FPXA 3GYGA 3NAMA 5ALOA 2HCFA 3WK7A 1SWWA 3AR5A 4KNVA 1Z4IA 1ZS9A 3U19A 3S6JA 5AI9A 1XVIA 5AI8A 4UMFA 4BYGA 5AVYA 5AI4A 4C4SA 5AW8A 5AW7A 3R9KA 4AS3A 3WKBA 4KX3A 3ZWKA 3A3YA 3WKEA 2B30A 1L8LA 1VJ5A 1J97A 4OCZA 2I33A 2C4NA 1NRWA 3DV9A 2RB5A 3L8GA 3NUQA 3R09A 3FPBA 2I54A 4Y2UA 1L7PA 5AW2A 1Q92A 5AKGA 2C8KA 3NASA 4OD0A 2I34A 3WK8A 4E88A 2PQ0A 3KOOA 2JGAA 4BEWA 4G63A 3SHQA 1YV9A 2ZBGA 3AR2A 1QYIA 3OPXA 4J03A 2AGVA 2FPRA 3IRUA 2YMLA 2YJ4A 3QNMA 4AS2A 4UAUA 1ZRNA 1RRCA 3B8EA 2YMQA 3ZVNA 2FUEA 4HGQA 1Q91A 4PNHA 5AKEA 1CR6A 4HGPA 2YJ3A 1TJ3A 2W4MA 1X42A 5A3RA 3QUCA 2HDOA 3SKXA 3QUQA 3IJ5A 4UU0A 1XPJA 1N8NA 2WF6A 3NALA 3L5KA 2YMMA 4G9BA 4O8CA 2YMPA 3QGMA 3SKYA 5FP0A 3PDWA 1MH9A 1Z4QA 3I76A 3QYPA 3NIWA 2AH5A 3AR6A 1ZD5A 3UM9A 5AK6A 1L8OA 2PR7A 1F5SA 3KZXA 3ZUPA 3D6JA 3NANA 2IOFK 5ALNA 3U13A 3OCXA 2W43A 3E81A 2CFSA 2AUTA 3E84A 2ODAA 3W5DA 4Y2XA 3ZW7A 1Z4KA 5AI0A 4OFZA 2P9JA 5IT0A 3FVVA 2RBKA 3WKAA 3L8HA 2G08A 2C9MA 2B1RA 2B8EA 5ALMA 4GIBA 3DNPA 4IFTA 5AKIA 2YBDA 3OCUA 5AKHA 1NNLA 5ALFA 4BX3A 5AKXA 1WR8A 5ALGA 3OCVA 3CZ4A 3MC1A 4YCNA 3ZTYA 3EWIA 5AVQA 5AVSA 5AKZA 3P96A 2OA0A 1RMTA 1RPZA 3WKCA 4UMDA 3SF0A 4BEVA 4HYTA 4RESA 4JB3A 3AR3A 3RF6A 4Y2PA 1SU4A 1JUDA 2WM8A 2QLTA 3L1UA 5AIAA 5ALQA 2IOHA 1TA0A 3ESQA 3DAOA 2ZXEA 3HLTA 4QQFA 4ZEWA 1L7MA 3B9BA 1QH9A 1U02A 2B82A 4HGNA 2CFTA 1KYTA 2JAOA 3ONNA 2WF9A 2YFYA 4BNDB 3UMGA 5AVZA 2X4DA 3AR7A 3AR9A 2Q4TA 3A1EA 3PCTA 2BDEA 5AIBA 4L57A 1ZD4A 4DCCA 2G09A 3ET5A 3N1UA 1Y8AA 3EF0A 2NO5A 5E0OA 3I1YA 1RDFA 4H1WA 5AESA 3ZWDA 5AICA 2ZBEA 3OCWA 3U7EB 3K1ZA 3L8EA 1T5SA 4NFLA 4EEKA 3QU2A 3L8FA 4I9GA 3WGUA 4FYPA 2OYCA 2B0CA 2YY6A 1RKUA 3J7TA 4Y2JA 5ALUA 4I9FA 2HI0A 5AW3A 1QQ6A 1Z88A 4DWOA 3ZVMA 2I6XA 2GMWA 2P69A 2W11A 3WK9A 1QQ5A 1RKQA 5ALLA 3EF1A 4ZEVA 5AK5A 2FUCA 3WKDA 3ZU6A 3W5AA 4CNQA 3EPRA 1S8OA 3E58A 5A3QA 3OTQA 2FDRA 1TJ4A 2G1AA 1YMQA 3VAYA 3W5CA 5AVXA 4UU1A 3SMVA 3QU9A 2FPWA 5ALWA 5AK4A 3U7HB 5ALYA 2GHQA 2HEGA 5AKKA 2EATA 4DFDA 2ZBDA 1ZRMA 2WHEA 5AM1A 5ALVA 3KDPA 4YGYA 4BKMA 3R4CA 4KX5A 5AVUA 1T9ZA 5AHXA 4UW9A 2FPUA 3KC2A 3ZX5A 4XE5A 2MU2A 1S2OA 2DQSA 2OM6A 2O9JA 2D2VA 3M9LA 2HHLA 5IS2A 1ZD3A 2FEAA 3SD7A 3QX7A 2BDUA 4B6JA 2G0AA 2NO4A 4UARA 4C4TA 4UMVA 2MU1A 1AQ6A 4UATA 5AM2A 3E8MA 2P11A 2WF7A 1U2TA 4JDPA 1CQZA 4XQ0A 1IWOA 3OCZA 5ALPA 3ZI4A 1VJRA 4Y2VA 4KYTA 3QUBA 3QXGA 5AI5A 2Q4RA 1Z5UA 4YCMA 1LVHA 2PKEA 5AW9A 2WF8A 1VFPA 4BX0A 1YS9A 2HF2A 2P27A 3F9RA 3N28A 1WPGA 4Y2YA 4Y2SA 5ALSA 2FI1A 2HSZA 3ZVLA 2NYVA 3ESRA 2I55A 4FE3A 3FZQA 3BWVA 1RLMA 2ZOSA 3U7FB 4HGOA 4L6AA 5AW6A 2WF5A 2YJ6A 1U7PA 2IYEA 1LTQA 4UM5A 3HYCA 1Z4LA 4YIKA 2JARA 3W5BA 5ALRA 3QU4A 1ZOLA 4RETA
chains in the Genus database with same CATH superfamily
1ZL0A 2O8BB 3ONDA 3E3NA 4DY6A 1ADYA 1FRFS 1DKPA 4AJJA 1LQUA 4IIXA 5ADVA 4UTRA 1PJCA 2CDBA 1B6GA 3N0TA 2I3ZA 3PGLA 1KORA 3TFQA 4IR1A 1PR4A 3ICOA 4IV0A 3JD4A 2PJZA 3P8ZA 2WWGA 1RYMA 5EHZA 4G2NA 2BZGA 1PL0A 1WUIS 1DI0A 5JD3A 4F71A 1TJYA 2F8MA 4BCDA 1KJNA 4AJ1A 1XK6A 2RI1A 5BV7A 2GPSA 2JAUA 3HBJA 2A7XA 2ZI7A 4GQBA 2L82A 2XJ9A 3V46A 4BBAA 5KBYA 2B69A 5AH0A 3K0EA 4QGBA 5KS2A 3BQ1A 4YRFA 3L4SO 1XD9A 2H85A 1YDGA 3VC1A 1U9IA 5B2FA 4K9OA 3GRCA 3O6VA 4OXXA 1U0TA 2CE2X 4RIHA 3GOQA 4CUJA 4U2GA 4B43A 1XJCA 1OF1A 4CN8A 4FDTA 2YY5A 3SBEA 2R00C 2WICA 4DA0A 4JJFA 5AKJA 3SLRA 4S12A 1GEEA 3NHWA 5ALOA 1UPHA 4UVEA 4DUGA 5BY2A 3LDHA 1E64A 3Q8RB 1XA0A 3C3YA 3DBHB 3BAZA 4PSCA 1BPDA 3AF1A 3EZFA 1N2BA 4KLZA 2I6SA 4J75A 2FPGB 2YYSA 4TMZA 3E2PA 4UNRA 5FPQA 1VE6A 3F5QA 3Q9NA 5I7HA 5JJ5A 3ZCQA 3HJUA 4PX9A 4FFBB 2V9WA 3Q6MA 3T9AA 2IS1A 5EG5A 2V03A 2IS6A 2IEZA 3VMFA 8ICLA 2J6IA 4J03A 1TT5B 1IBRA 1X80A 1A69A 3BWXA 4YAIA 1SXHA 3U0VA 1E1MA 2C5FA 1VRWA 2VF5X 5HEKA 1B74A 2H08A 4PF1A 3V7LA 4IV5A 2A1JB 5FA5A 3PC3A 4MRNA 1FLVA 3N7SC 5J3JA 4IWXA 1HDOA 1CQJA 5JJIA 1BXRA 4XCXA 1JIKA 3N3AC 2R65A 1JKIA 1PGJA 3N7TA 5DXJA 2KBFA 2VAWA 5BT9A 2G08A 3NHFA 2X8LA 1IXRA 3WZLA 3K4GA 4PLFA 3CYFA 3BZKA 9ICOA 1X8LA 4P2BA 1ZLXA 5KNBA 2VSXA 2NQ8A 1QDUA 1YE5A 4IKOA 3W4KA 1F14A 4WXEA 4ZVSA 4KIWA 5MN4A 4MX8A 1ZGZA 4EGFA 1NVBA 4UHCA 1ULAA 7ABPA 3KALA 4ED3A 1VL0A 2BAGA 3ZH2A 2PSFA 5HZHA 4Y2HA 3UTDA 2XF8A 4YFYA 3U1BA 1H4QA 5A62A 1C4XA 2ACKA 1QH8A 5ITWA 1PVVA 1T6NA 2KZ3A 3GLTA 2OBMA 1M6WA 2D1TA 1WABA 4YROA 2H54A 3JYOA 4LE1A 1RQPA 3OQPA 3D7LA 4EFMA 2EBFX 1DJPA 4FIZA 2OZKA 1YE8A 3TKYA 4M0MA 4CLHA 2DQZA 4KLSA 4N5LA 3R0JA 3HKCA 2GR9A 3KUCA 4YAOA 3CUVA 1WXIA 2A5YB 3FDXA 4U39A 4Q3BA 5KQRA 2FK7A 4RMHA 3MS2A 1P2FA 1SCDA 1OX6A 4ZYYA 5JY6A 2VQEB 4DRZA 1FMFA 4LHEA 3PR3A 1FFDA 4WOJA 1B3BA 3L0SA 4UM5A 4DRXB 3EDQA 1SPXA 2PPVA 2P6NA 3JATB 4PSAA 5KTTA 1YBFA 2QMYA 2OHIA 4DLVA 3PXGA 1X9MA 1GQOA 4Y1FA 4ZMRA 3MWYW 2VWGA 2P75A 4BUGA 3O03A 2AMLA 2F1KA 1GPMA 4FEGA 4JBLA 2EZ4A 3V6JA 1GKUB 5A6SB 2CZQA 2X6RA 4JI4B 1H4TA 1BD4A 3KZVA 2F9MA 3DKVA 2I87A 1G6OA 4CNBA 3FJYA 4BN4A 1UMCB 2I4RA 4FD3A 5FJIA 5FBVB 5EMKA 2P1RA 4LZPA 4G84A 4P0PB 2PUGA 1BMDA 3OPYA 2OYRA 3TLAA 2KHVA 2WABA 4L9WA 4PTZA 1H6DA 3UAZA 3RVNA 1HTWA 3D3WB 4OHZA 4OO1J 1D2EA 4MYUA 3P20A 2YVKA 2R2GA 2ASJA 4ZO7A 4F6CA 1EX6A 2Q5EA 5KG3A 2UVUA 5FOSA 2H7XA 1C4OA 3SJUA 3ROZA 1DCTA 5CPBA 4ZEXA 4OQNA 1ZVJA 4UBBA 4M0AA 2XY4A 2HCBA 2ORVA 4QTTB 4XTCS 3Q3JB 1RTTA 4JI2B 3GVPA 1U0NA 4CMAA 1XFAA 3GZJA 4ND8A 3DR3A 2ISQA 4O5AA 3HZHA 5IXYA 4MVCA 8ICBA 5M7EA 2OO3A 3JWHA 1HA3A 4JS0A 2AFIA 4G89A 2IZOA 1ISSA 4C6TA 2JKZA 4XYLA 4M7WA 5FWAA 3ZLVA 1WO8A 5J5CA 4KVZA 1MA3A 4ZO8A 1CERA 1E7SA 1X0XA 4DIMA 1U7WA 4D02A 3KP1A 1U0HC 1ZOPA 3IUYA 4GE3A 5JNTA 2Z2XA 3W78A 4BYMA 3LX4A 1MJGA 4YCAA 3IKJA 4DUZB 3KOOA 2R48A 2O14A 3TSWA 1N9ZA 4BN0A 2YWEA 2HMTA 3OF2A 1RRCA 4BJ5A 3JD0A 3K2IA 3GFGA 3T5CA 3WNCA 3FNBA 3LZDA 3EVFA 5JS1A 5L3QB 1MZPA 3UM9A 4CLDA 2P4QA 4GDFA 2OAGA 1D1SA 1EQUA 1E8DA 1E77A 1S5PA 2I0FA 2Z5VA 2GVDC 4YJKA 5EUMA 5CFZA 4BB0A 4S05A 3VYSB 4GYWA 1MD9A 3DS8A 3VVMA 3ZGLA 4GVXA 4HX9A 1D04A 2WILA 4BE7B 1UBEA 4MTLA 3OFND 1CRPA 4A10A 2NZUG 4DEXA 3OA0A 1GYQA 2CMHA 2F1HA 3TAHA 4GFJA 5H70A 3UENA 4MYRA 1EUCB 1G20A 3P2JA 4TWRA 4EJMA 3QVGB 3LDAA 1ZSNA 3K09C 4C4AA 3RB3A 3C5GA 4IHJA 5C8XA 4RA9A 4BO0A 4UB1A 1JJBA 1QH1A 2E0IA 3PFGA 5KTQA 2Q62A 3W0LB 1K63A 1AHIA 4D9HA 3QLVA 4FMCF 5FCDA 1LDMA 1CETA 1UODA 3ROPA 5B5SA 3WLOA 2IUUA 2BTEA 2OV4A 5DRYA 3RB0A 1ZNQO 5FFFA 1KEJA 2FCAA 5CLJA 1YT3A 1CE8A 3C7DB 4OGWA 1KO8A 3H1PA 3NHJA 4BO3A 1HK7A 5K6RA 1WM1A 1KKMA 3BHNA 4KXQA 2HXSA 3NJ8A 3T94A 4ED2A 2DZDA 5J2AA 5BV2P 5IK2D 1QG6A 2DKXA 2WHPA 1YVUA 3E61A 3VAYA 5FEUA 1EJ0A 2J4DA 3FYCA 3KJFA 5C3MA 3K0CA 3A6DA 5HIIA 4ZAFA 2ODQA 4WOCA 5AOBA 1A3CA 4CMEA 4IH4A 2E6UX 1U48A 4JI1B 2FEAA 1MIOA 4YP1A 2PZBA 3FSRA 1N2HA 1H2WA 3TI0A 1CPYA 3WB9A 2FVXA 1ZQYA 4ENSA 1CUZA 3TYXA 2WMDA 4DT1B 1DCKA 1V5WA 5LQMA 2JHCA 3E35A 4R81A 2FWBA 3ESRA 3SC6A 2C3OA 3OU6A 3RHSA 2Y0DA 3V00A 4H7JA 1BNOA 3FDIA 2E6KA 1O57A 1FU8A 3BM5A 1P2DA 6ADHA 2BTQB 4NS1A 3IQZA 3A2LA 1QUFA 2EC5A 5GONA 4M9CA 3U7RA 3HNRA 5AKLA 4BLUA 1T4MA 1GA1A 3DH0A 3P9XA 3LHDA 4BE9A 2UXDB 1KMIY 4B9NA 3T15A 4MV1A 2A5LA 1N1MA 1XRRA 3HCOA 3WYCA 5COQA 3A9RA 4EAAA 3D43A 1II9A 3WJAA 5J0UA 1ZIYA 3MJCA 2Q6LA 3CLRC 4G5XA 4E22A 3BJEA 3Q5GA 2JNWA 3T5DA 3EGCA 2BZ1A 4J43A 1NXXA 4NIMA 4KLUA 3WK5A 4NJ8A 3LWZA 4MV7A 2XMCA 2CE7A 4N5HX 4R1TA 3TSYA 1UINA 1DIOB 2AOUB 3V1KA 2VTBA 5JS2A 4LIPD 1TZMA 2BI4A 4ZZ3A 4M8KA 5KEIA 2EZTA 1PYGA 5H4HA 1NPDA 1GY8A 1ECWA 3ZXSA 4FINA 4FW8A 2DUUA 4X1YA 4RJIA 1EK2A 4MAFA 4HGYA 1SXJB 4HVTA 3ROTA 2UYGA 4JYAB 4AS1A 3ZHZA 4M0UA 1NK4A 4TUSA 1RYHA 4IGKA 3IM1A 1PT9A 3A4VA 3RIMA 3EVAA 1QZTA 3ZDQA 1YUNA 4HP8A 4AJPA 4CPDA 3K6SB 4DYHA 1KR2A 5KOJB 2I2DA 3GOHA 2WPNA 5EMMA 2HCJB 5ESXA 4FS2A 2OE2A 3L7CA 3GPCA 4AI6A 4F9FA 1H1DA 5TGDA 3SHVA 2CDRA 2J9GA 5IC5A 4DN6A 4E1AA 4G4GA 3NUQA 4BFSA 5JAZA 2I99A 2WNHA 3QTTA 3L9WA 1MEJA 2PH5A 3UUGA 3MD0A 3IPCA 2AOWA 3CURA 1RRVA 1UEIA 1B4FA 1KS9A 4NENB 3ACDA 4AY4A 3DDNA 2FPPB 3NR2A 4J90A 4PO1A 4KODA 2C97A 1IPHA 3WGTA 2BBWA 3OIDA 5BV8A 3KVNA 4G5QA 2IV3A 3AM5A 2JFGA 5C35A 1EYZA 2CCKA 5EUCA 3VZSA 5CFPA 3DZCA 4LTDA 1RZVA 1A9TA 1NVWQ 1ATZA 4Z9FA 4RTOA 4J9VA 2H2DA 1E1CB 4BNZA 4M87A 4YHBA 2ODAA 3X1JA 2JGIA 3MWFA 4CT4B 2AN4A 2CCJA 2Z04A 1XTTA 2JFQA 3SJ7A 2WTAA 3ECSA 1GZ5A 3ZZMA 2X42A 4D96A 1SKUA 1ABEA 2XTMA 4I1RA 3MC1A 3FSGD 3OVMA 1BTOA 2YWJA 1SBCA 5IYZA 5L1MA 1IJBA 3KXIA 1JG7A 1EFHA 5KFYA 4JWMA 4GU5A 1PFQA 3I01M 1U1IA 2ZDGA 3WXMA 4J7XA 3HCWA 3ZCUA 3DE7X 2GM5A 4C7YA 1PQ4A 2FN7A 3QZ7A 2WHXA 5DHUA 4G5OA 3LFUA 4BZPA 1NX6A 2V74B 5HF8A 5CCEA 2F67A 3K9WA 2H3EA 3L8EA 4ZDKA 2L69A 5DHTA 4LTMA 3PXUA 3PR4A 1GXSB 3ZU3A 3EUWA 5F98A 3Q1KA 1NPYA 3P2EA 1LDGA 2YRWA 2VBCA 4H3SA 3GDHA 1UKEA 2L18A 2YR0A 2AOTB 3FHOA 2FQQA 1XDDA 3DF9A 3GJYA 2KKPA 1TF5A 4HDCA 4B9EA 3S1SA 4QXRA 1U3FA 5BNZA 4DOAA 2W2XA 1RJ9A 4DS3A 1SAYA 3SZ2A 1BEZA 3SDSA 2Y9MB 4EO7A 3OZDA 2PA3A 1FSZA 1IWOA 4KLIA 2AQ8A 4Q7LA 1XMPA 2WSLA 1X1SA 5JD5A 5FNVB 5C8YB 1KP3A 4BN5A 5F51A 4RIFA 3WFJA 1L3CA 3WC4A 2UVPA 4NJMA 3Q7TA 2B5VA 1CUAA 4PYKA 4CM1A 4Y9DA 5C8ZA 4RACA 3KJXA 3ZBUA 1N6NA 2QLNA 7ICEA 2XAAA 3QEKA 2P3SA 1OAKA 4WW0A 3QE0A 1BDJA 4EITA 3RF9A 1QZZA 3ZJVA 3CUTA 4V0KA 3NXSA 4FBMA 3O8NA 4MP6A 4UTVA 3UBTA 2VPQA 1L4HA 2OCXA 1PW7A 2FQYA 1KWKA 4TTSA 4F21A 3PQDA 3CRZA 4R65A 3HVIA 5L53A 3L0YA 5CEEA 4DV1B 3ZZ0A 3PFNA 4MQ4A 2JLVA 3RT1A 4QDXA 1HYHA 4ER5A 4RJTA 2Q21A 1MUUA 1M1NA 5HW0A 1IY9A 2HBZA 2ORYA 3W9UA 4OOEA 2PKRA 1VKRA 3E03A 3VPFA 5EIBD 3LRPA 3FCUB 5ILGA 1J0XO 3ND5A 4KE8A 1B76A 3N3BC 2F1JA 4IIUA 2FZ5A 4R2LA 4YUVA 1J2TA 1C2TA 2YHAA 3LOPA 2QU8A 4OBBA 4PCLA 4GLXA 4Q19A 1ZWLA 4W5JA 4E0BA 4ITUA 2JFYA 1XA4A 1NG1A 3VVLA 2XLCA 4EQ6A 1A9YA 1DG9A 1JR3E 4UMFA 5JADA 1QFJA 1JW9B 2ZRGA 1I7SB 3DYIA 1VKJA 3KTFA 3KB6A 4WQMA 1T8SA 3TE6A 2WOOA 1Z08A 3QWAA 3KFXA 4B48A 4NFSA 4B3DA 4W7SA 2EFGA 4LRTB 5AW2A 1RCUA 3PIDA 3NASA 2QP9X 2M6SA 4IC9A 3TNFA 1GU0A 2W0MA 3IDZA 1QV9A 1OJLA 2CLMB 1FNNA 1C50A 2NSYA 1O94C 2HAEA 1X42A 3QUCA 1RWXA 2NZ8A 1XZPA 1JL3A 2ADMA 4JU9A 4B3RB 3W3AA 3ICEA 3LDFA 1T0JB 1RJGA 4XD2A 3M4YA 3N0XA 1GV1A 3F5DA 3I4CA 1GKKA 5GOTA 1N4AA 4AMUA 4NKRA 3V2GA 1THMA 2X4GA 2P66A 1JU4A 4BNHA 1RIIA 3BH7A 3NAZA 1MQ2A 3DONA 4O08A 3AHJA 1Z0IA 3L84A 2QQGA 1L4LA 1ZKMA 5AOVA 1SHJA 4J0DA 4X1KB 4R8RA 4MNTA 3K73O 4H6XA 3L7OA 4RVSA 4KN6A 4KLQA 2VRNA 5CH8A 3OM0A 3V1TC 1WWUA 4Y9RA 3OBIA 3FW1A 3EY4A 4S1VA 4RK4A 3PHJA 2WSYB 3ZS9A 2AK2A 2P9FA 3CCCA 3SVLA 4KDEA 3R3YA 4UBNA 1KYTA 2YFYA 2GEDA 3PPWA 3DEAA 1TAMA 3CLSD 1DWPA 3T38A 2C3MA 3IMEA 3NAQA 2C3UA 4YMHA 3ZWXA 4Z4QA 4WOPA 3VCBA 2J3QA 4JBNA 1V11A 1OLOA 2XB4A 4L95C 5KFFA 4CL8A 1MRZA 3ZBTA 3F1KA 1P0CA 3KKNA 1E1QA 2OPHA 1OZAA 1TT5A 5AT1A 2LP4Y 5BPHA 3KQKA 4NU6A 3ZWMA 4GFDA 5H02A 3ZI4A 3X44A 4ENUA 4PLCA 3ZVKA 4I2GA 3ACBA 2VH5R 5ADUS 2Z1DA 5EGSA 4R6WA 8ICEA 3ZVLA 2IYNA 3EEBA 1RYSA 3H5TA 1EVEA 3KAPA 3KWLA 1L4MA 4TMYA 1Z4LA 1V48A 2I9KA 4A3SA 1CJKC 3D8HA 1CI4A 3E5MA 3PUWA 4TKUB 5BSKA 4TWBA 4V38A 3BXFA 2I4LA 3GVIA 4CM9A 4KOEC 3ZLUA 1ZJ6A 3SHOA 1OKKA 3EVBA 1PR9A 2B0JA 1J06A 2HHQA 4LMRA 3HVHA 5JAHA 4JJGA 3WP0A 2ZSKA 4RK5A 3G1TA 2OGTA 3WV5A 3CX6A 1MDBA 5HJ5A 1VL6A 1CKEA 4RLQA 3VR4H 4GXKA 2H5JA 1ABFA 1H66A 3ED1A 1KPHA 1KVRA 2ATEA 4AJ9A 1MC1A 5HA5A 3U39A 5AWFC 1DFGA 2I67A 1U0JA 4B74A 3NWOA 4MYDA 4EBBA 3AEYA 1A88A 4MIYA 1V45E 4HDMB 4JBWA 2PAAA 2CD7A 3HBFA 4C3UA 5CAEB 1ZMTA 1ZW6A 4NLNA 4QDTA 4E2XA 4LYGA 3R9IA 4R2IA 2Q1TA 3PC2A 2WWYA 2OV8A 4ZT2A 4JN6B 5AI6A 1TRHA 4M6WB 3LQRA 1DBQA 1RQXA 1O4WA 3M5WA 1OBHA 4U7HA 1FZQA 2HF9A 4IM7A 5K4AA 5AW0A 1Z6GA 1G2IA 3VPSA 1B7GO 1GT91 3MGIA 1XD2A 4M53A 3C6MA 2JGEA 1AA9A 5LJIA 1A1VA 2WU0A 3K1AB 5CB0A 1UZLA 1USGA 4MCJA 2AFHE 5JQWA 5KHLB 1JTFA 1J0BA 5KI6A 4ZGGA 3VYWA 3G6YA 4QRIA 4WACA 1G60A 2IZZA 2LBPA 5H82A 4FZJA 5D8DA 4FMDF 3TKLA 4ALKA 1P6XA 1TAQA 3GLFE 1G0NA 1UKYA 3TVTA 3QYAA 4MAAA 3HDQA 4UOEA 3VJRA 1TA9A 3LL7A 5K99A 1Z56C 2J5BA 3BWMA 1G9XA 3O1JC 3WIEA 4E51A 1Y1TA 1ND5A 1I0IA 2ZBRA 2AUNA 4OFWA 2EHDA 3KFVA 2Q4BA 1ZUIA 5A6SA 2BM9A 2V58A 5F1YA 1M8GA 2P5UA 4GR5A 1DQPA 3QFFA 4XQ9A 3V7FA 1VG8A 4R8UB 4R8LA 2EG9A 4P0PA 2KIWA 3K96A 4D26A 2H17A 2QL7A 4FQ5A 5TMBA 2YTZA 3Q8MA 1KSHA 3RJEA 1DTSA 2OFFA 1U47A 5L6LB 4K2AA 1OB2A 3K1TA 3R7FA 2WWHA 1WQ1R 1ZUWA 3PDIB 3IR5A 4Y2PA 2ZXFA 5J4VA 8ICYA 1IJKA 1L5OA 3L01A 1QQBA 2G9ZA 1OA0A 2QRNA 2WSMA 3TQCA 1SUPA 4ENTA 3KB8A 5KFIA 1Z29A 2Q2WA 3KPVA 2BQUA 2FN8A 5JAQA 2FEMA 3C1YA 1ADFA 1YCFA 3MWDB 4WNYA 5JAOA 3ZWDA 2C57A 2ZBEA 1KH3A 3RC9A 4LQCA 4MW6A 1ZCFA 4NVRA 1TQ8A 3V4PB 4IMPA 3GV7B 1LDEA 1HYEA 4ASUA 3BMCB 4MRVA 3HZOA 4DLSA 1RLJA 2AR7A 1X66A 3HKEB 3MM4A 3GT7A 1LV8A 2IEDA 1P72A 4Z4IA 1QIDA 3OOEA 1NR7A 3FYUB 1V8BA 1HYQA 1EK5A 3DWGA 1KQ3A 4REQB 3LC2O 1JU3A 1UJ6A 4CRXA 2PBZA 2FSPA 4QPDA 4YQEA 5CJ7A 4Z3KA 1TVMA 1QNLA 3CKYA 2OQIA 3KPUA 3OJEA 1REQA 3RS2A 1JEJA 3VJKA 4H60A 4EZIA 2QMHA 1DNPA 4RIIA 4UB6U 4PPYA 1P1BA 1A7AA 3A1TA 5L3QA 4UUBA 4I6JA 3F9CA 3GA0A 2Q0HA 3JRNA 3GJ6A 1T5LA 4DQVA 5MHTA 3REGA 4QSMA 3NHKA 4EPWA 5A03A 3CH4B 4D4HA 2QVZX 4KMSA 3DUFB 1KJIA 2ZUCA 2PU7A 4W9RA 4ZPXA 3AQFA 3EDYA 4WAUA 3VC3A 2OWDA 5DM4A 2PLAA 2PH1A 2IELA 3TOXA 4EBCA 3KZKA 4FD2A 3X1KA 1P7WA 4R9SA 3PITA 3X1WA 2G7ZA 1TE2A 3IOMA 2Y0CA 4ED7A 2FXIA 2VVTA 3EIWA 4R7ZA 2OQ2A 1IIRA 1Z2DA 4DBZA 1W0KA 4I5FA 1OAAA 1EUCA 3HX0A 3U9SA 1IUOA 4NYMQ 4Q4DA 4QWEA 4D6XA 3GK3A 2ACVA 4D9GA 1V9LA 4U2CA 3DM5A 3FA2A 1UZUA 3N9IA 3D9QX 3VR0A 1C7QA 2GFQA 1CRXA 1ZD2P 1X6VA 1IEVA 3IAS6 1JDBB 5TPZA 1KC1A 1W36C 2IOYA 1V39A 1ZHOA 2XA9A 3LUKA 1J7KA 1K4MA 1NJGA 3THSA 1EFUA 4RNNA 4PLVA 1Q14A 2XNCA 3I2JA 1YZKA 5J29A 1UKZA 3BSFA 4YP7A 2X23A 2JZNA 3RFVA 1QPZA 1O6ZA 4A5SA 4XQ8A 2XHZA 4F60A 4HAIA 3FKJA 3GFVA 1Z4PX 2GBCA 4KNWA 4DW8A 1EGHA 2E7ZA 1CIPA 3SX0A 4F84A 2QQFA 2O5VA 3SZGA 3H86A 3QVSA 1L8AA 1K7CA 5TQVA 4G86A 4GH5A 3WYDA 2PTGA 1OXKB 2NSLA 4DT1A 4KSCA 2Z9DA 4RMIA 4AX4A 4OX9Y 1X7HA 1L3BA 1JFFB 1EA5A 5BXQC 2NP7A 2D6FC 4ICAA 1ECBA 2XIJA 2BTQA 1FUYB 1ID1A 3E9YA 4Y2UA 3VR6A 3E9CA 3TCKA 1Q83A 3ORFA 4EW3A 4H1TA 1X8KA 3AINA 3Q4GA 5C81A 2JAPA 4V02A 4HPWA 2GLXA 5AKEA 1E2NA 2ZUTA 1E7RA 1PHPA 1ZQMA 3VNBA 2BBOA 1H4VB 5GJWC 1GPBA 2BLLA 2F3RA 3S29A 5AK6A 3F98A 4PV7A 5KMGA 5HM6A 5IANA 3K0FA 5F73A 4AWBA 3QPBA 4TLBA 3GI1A 2AGPA 2BFPA 5ALNA 3IHQB 1V7ZA 2XUZA 4JLWA 1E6UA 1JSXA 1YU9A 3RSGA 4MWDA 3TTXA 5IKMA 5ETJA 4DV6B 5E7QA 3ISDA 3WISA 3R2JA 2IH4A 4DFMA 2AOUA 1NNLA 4JU8A 4JEIA 3QKSB 2WYOA 4P35A 4JZKA 5KTKA 5BRNA 3QENA 2R84A 6CHYA 1XROA 2VHYA 2J3HA 4M8SA 3H9CA 4JC4A 1SXJA 2GEFA 2PZLA 1J25A 4Z0HO 3WV4A 4DQQA 1V43A 1P1IA 2KYRA 1XEXB 2BRUC 4YRKA 5C37A 1PVDA 3STUA 4JV5B 1YQ9A 3M34A 3WLFA 1HMPA 1FSPA 3I61A 1XS9D 3GJ7A 4FDMA 1R5OA 1JLMA 2WG2A 3K6SA 3NIDB 1O8BA 4QBTA 1B4DA 3RSCA 1KZGB 3KR1A 3STXA 3WYGA 1M1YB 1VLMA 4B7XA 1JU9A 2PWYA 2AOXA 4JOBA 3O0TA 3NBKA 3Q3GE 4F5WA 3LUCA 4M9NA 2M6LA 4EA8A 4M1QA 1P91A 1H0SA 1N1DA 2C3YA 4NL4H 4EKDA 2QI9C 3BFVA 3VPBA 1IOZA 1GA6A 2GCEA 3MT8A 2XGOA 2IE8A 4FM9A 2FPUA 1TNDA 1PR3A 1D8LA 3F2BA 3ISJA 3KB2A 4FSXA 1RXWA 2FOLA 2V5AA 2R6HA 4A36A 2VC2B 1QM5A 3IV7A 2AUMA 2JCGA 2AOVA 2Q3JA 5JTUA 1PK7A 2AZTA 2UZ1A 3LZ6A 2VHEA 4Z4CA 2QM7A 2WAOA 2FMIA 1GIAA 3QBEA 4X6UA 4RV9A 3K7EA 2OCLA 3TWOA 3AETA 4PR3A 1WB9A 1CVRA 4EPTA 1RQGA 2UU9B 3BQ7A 3A4TA 1ZICA 1K86A 5KG2A 3IUBA 2ZYAA 4FILA 3TANA 2YZ7A 2QN2A 4F2PA 2YQZA 1I4DD 3M6FA 1SUEA 1NZPA 1D6JA 2XT6A 2WAXA 5EIAA 3W9SA 5HOEA 1LU9A 1NJ1A 4F5OA 3KD3A 4F86A 1JXLA 3EXEB 1VLZA 1RAGA 1RACA 2KP7A 4OHXA 1KYXA 3LCRA 1UC5B 1KJQA 1X86B 4G6ZA 1UKAA 4EWLA 5CFQA 1CJUC 4CG0A 3WL7A 2V6JA 3UBMA 2QYSA 1T13A 2QE7D 4UBOA 5AD1A 1LI7A 2QUKA 4G0MA 2I9GA 5K2MA 3W77A 2VZ8A 1SGWA 1JILA 3HR8A 4QWMA 1W4CA 4W5TA 4C06A 3L0BA 1T9CA 1AM4D 4WFQA 4CLOB 5KJ1A 3EPPA 1Q7EA 4C0QC 4Q4JB 3AF3A 1TQ4A 2G1UA 1N9GB 4CBVA 4ZAWA 2I03A 2SKEA 1DHRA 2PJRA 2HCFA 3VM6A 3TBKA 1UBLS 5FNVA 1XEFA 4DPMA 3BGSA 4KPUB 3E5NA 2WYUA 2HXYA 2VJOA 2XE8A 3MAJA 1J4AA 4F5RA 5CK4A 2HUNA 1PUJA 5DNDA 4HWKA 3TG8A 3VI4B 2GD6A 4MFAA 1KDZA 1WD5A 3SDBA 5DN9A 4TTPA 2VJLA 2EANA 2I4TA 3MRVA 4KFTA 3N5CA 1X1DA 1JAYA 4W63A 4PG7A 4L0DA 3NHSA 3NKFA 3IRUA 4EUKA 4GD3Q 1N6IA 4X8OA 3PX7A 4X95A 5IVIA 3RQSA 5COBA 2QGNA 2B4YA 1GUBA 4QTUB 2E4AA 4LE0A 2IYTA 4YBZA 3D4LA 3PO5A 1IZ0A 4HB4A 1R9JA 1O97C 1P4RA 3NEJA 4OXIA 2D0IA 1SIUA 2FG5A 3U4CA 1B22A 3I6YA 3H1AA 1H0HA 2I76A 2RAPA 1SHLA 2R85A 5J0WA 3SPXA 2VP2A 2VJMA 1Q7GA 1AT1A 4I7EA 2FW7A 3NGXA 1Z38A 5HR7A 2E9SA 2PNJA 2O1SA 3UFXB 1KBQA 2YWFA 1AQIA 1UOOA 2R25B 4YMGA 4REOA 5IINA 5CR9A 4RW0A 3V2IA 1B0ZA 3PE3A 1ZQCA 4DQUA 2Q5HA 4KQHA 3OSUA 5ES4B 4G0VA 2DY0A 3S2IA 2QSZA 1X7GA 1ADBA 5JAIA 4MLDA 1NIJA 5AVZA 8OHMA 5KFZA 2RGRA 2BKEA 4OHMA 4ECWA 1OHHD 4BZXA 1NULA 1DINA 1L1FA 2WK1A 4OP2A 4YRDA 4BJ6A 1SG0A 2PT9A 4Q3AA 4CV3A 5DTIA 1AS0A 3MWLA 4E09A 2EYQA 1GR0A 2Z7JA 2VJCA 3SCZA 1LKYA 3R3UA 2VHWA 3IJEB 4UNIA 1R4AA 2AK3A 3IP4B 1RWNA 4LZWA 1CUBA 4GC7A 1LY1A 3AM3A 1YQQA 3WZMA 4EW1A 4RQ5A 5AM1A 5TV2A 3SAJA 2VOEA 3M6UA 2WWIA 4XIGS 5EGNA 3OPQA 2TMGA 1PKEA 2R6AA 2BDUA 4WXPA 4FEYA 4L8GA 4O29A 4UC0A 4HWGA 5G1NA 1KEZA 2QD2A 3ZHQA 1B6SA 3Q3IA 3EPHA 2TSYB 5D3MB 3ZZ1A 5B53A 5AVKA 3HB0A 1GO3F 1NVAA 1NJWA 4JC5A 4BMVA 1AUPA 3IVXA 1CZKA 1P2UA 1T5BA 3SM9A 2ZITA 2IU6A 4YDSA 2JLBA 4PL2A 4K46A 2EAOA 3I2HA 5L40A 4EFKA 3RVOA 1L1EA 1Z12A 3LYUA 4AJNA 1NE7A 3N8DA 4X0EA 4LCBA 2LCQA 3D4BA 2WT9A 1GDDA 2XV1A 3WQHA 2O20A 4B0OA 2HK8A 2GO1A 1QS0A 5UKDA 1H8EA 3E05A 1CZRA 4F4ZA 1ZQNA 1EX9A 3W06A 4NEHB 4ZD6A 4R68A 3SNHA 1TO1E 3M7DA 4ZH4A 3TTWA 2JD1A 4PN3A 1WA5A 4KRXA 5HJ2A 5ICCA 1YFJA 3TM5A 2IPOA 5LQDA 3LY7A 2GB4A 3ZQ4A 1F1BA 4N8EA 2FSVC 4IQWA 4KO2S 4Q4HB 3OOWA 1UPXA 3NMUF 2QTRA 2Q3FA 3DVAA 5EYPB 2XBMA 5CT4A 4WLEA 4RV4A 4PN7A 2GCIA 2YASA 3QVTA 4YRSA 3KUUA 3BGWA 3SBDA 3RM3A 1SH7A 3RUAA 1U8CB 3O8RA 3OZVA 3B1ZA 5DGBA 1IFXA 5JCXA 3IHWA 3NRWA 3IXQA 2CLSA 4FFPA 1KY5A 4OMCA 1OWMA 1NJYA 5DCUA 3W6PA 1NTOA 5DX0A 2O0HA 5L1IA 5GV7A 1S7GA 1ZJZA 4J0QA 2QR3A 3IAUA 1LBTA 3RKSA 4D9FA 3F6BX 3W4JA 4CTOA 4KX3A 3A3YA 3ZZUA 4LYYA 2IFTA 3BL5A 2W9XA 4L0CA 4LX8A 5LUBA 1FTSA 4TKUA 3VI3B 1TO6A 1IY2A 1JIVA 3II6X 1ZESA 2C5SA 2WB1C 1UC4B 3OE7D 1DDIA 4R9UC 4QOGA 1KVUA 4YR7A 5F2EA 2Z5FA 2FUEA 1E94E 1B0AA 1WJGA 5T3YA 3OP1A 1U6IA 2X0JA 5LZ2A 1FB5A 5JHHB 1MH9A 3WLSA 4L5AA 3KU1A 2GYUA 3V7JA 4J0KA 2NRZA 4CL3A 1L8OA 3I92A 3A2MA 3NWBA 2HRDA 5IBQA 1MB3A 5KYYA 1VZ2A 4Q1DA 5F5LA 4ATNA 1TFUA 3WNQA 2BHSA 3C4QA 4J1TC 3LP5A 3DE5X 4UUNA 1QB8A 4G5RA 2C04A 5TS3A 2K4MA 4Z54A 3NVAA 4JKYA 5KNIA 4LF5B 2YZNA 4HDMA 5MFZA 2IBKA 3VH3A 3E9ZA 4Q15A 5CAEA 4ENWA 5EMHA 4PC2A 5FR2A 2HLDD 2Z56A 3QBDA 1DQYA 4E6EA 3Q7PA 5DYIA 3D2QA 2EAMA 4M6WA 4M9SA 4AUMA 3NVVA 4IWYA 1TK0A 5CLLA 1QCYA 5FOTA 1OTYA 1N0VC 4FEAA 5E9QA 3OTOB 4OX9B 1MQSA 2P9HA 4GBMA 3SR0A 1DOQA 2FR1A 2C7GA 1MP0A 5CB4A 4H1WA 4OLBA 4O2RA 3GIWA 4DWWA 3Q3HA 1X6IA 3ZD6A 3CZCA 2IW3A 2VK4A 1LC0A 4PZOA 1SKAA 1T2NA 5DH9A 4WTOA 4AY6A 4XGRA 2WW8A 1LTHR 2VYQA 1JFLA 4MVJE 3VR5H 1NP3A 2H0AA 2WWXA 4EI2A 4W7HA 3AKDA 1PQYA 3SEQA 3WYAA 5IJ0A 4CIYA 4JKOA 4JLPA 1JIUA 1ZFNA 3WTCA 4LXTA 2ZE5A 3UV6A 4J6FA 3V2HA 4I1YA 2VEOA 3E8MA 2Z2YA 2D1YA 2Q3MA 1AJEA 2XWPA 1VL1A 3ZDDA 2UYYA 3TUZC 1DGQA 1YB1A 3HB5X 1WPGA 3L5OA 5BWNA 5EPEA 4R8UA 1AURA 4QFCA 2HA0A 2HK9A 4O4HA 3GC6A 3HM2A 2EL7A 1KBOA 5HXAA 1CCWA 5K03A 1RLMA 3QXXA 3B1JA 2ERCA 1ZQRA 4QFBA 2WSBA 2Q0QA 2A9RA 1FEZA 4M0LA 2RK4A 3I9KA 4HLUC 1BN7A 1Q21A 4HNTA 2WYHA 4U2DA 2IY9A 4BO2A 2RBGA 1BFUA 1FYEA 1W96A 4LSMA 2Y1OA 3NI2A 3N5KA 3RC7A 2R2AA 3RSOA 1US8A 2FFJA 3PDIA 3TI7A 1Q12A 1WZIA 2Q3HA 4D41A 1XGKA 3S2EA 1CNEA 5HHTA 2CDAA 4D92A 2H1FA 4IICA 1GKLA 4M60A 3JARB 4ZU1X 4IVRA 3HYLA 4GC5A 1GNQA 4RPIA 2PQ2A 3H7AA 5TE9A 4UD2A 3W2FA 4OTZA 4L1KA 3LQFA 3QEMA 2ZIVB 1GILA 3CW2A 3OJOA 1VA4A 1E8NA 4Q7QA 4HLDA 4F72A 1BCSA 4GOND 3HDTA 2Q1UA 1SU8A 4XWYA 1OB5A 4TZ0A 2BONA 3AKZA 5A9SB 2ATIA 3UWSA 5I4BA 2F8SA 3BMCA 1DC5A 2WIAA 2GD1O 1ZN9A 4DHWA 1C1XA 5AW5A 2EVWX 1WV1A 2XZPA 5B7QA 1YS1X 3UY4A 4R5MA 2HYDA 5ALXA 4JUBA 4HMQA 1X7WB 1RC1A 1B00A 3PCXA 3C2KA 3ND8A 1VYHA 2HQSA 4JXXA 1VGQA 3C16C 1OFGA 3Q3CA 3UWDA 4MITA 3M1YA 2DECA 1V8ZA 2QPAA 3OMWA 4QDZA 4F8RA 5FLEX 4B6PA 1K7SN 4EHLA 3CEAA 5AVOA 3AR5A 4MMZB 2XUGA 1S1MA 1I0LA 4ZQGA 2X77A 2HHHB 3DDWA 4WFKA 3IA2A 3ENNA 1T35A 3DUFA 4FDAA 1GN9A 2WTXA 4TMVA 5B3JA 4E88A 2VDKB 3E48A 4ZHQA 4D97A 3M3PA 4M37A 5IUKC 1K7YA 2FJPA 3HCBA 3E0FA 4UU7A 2PFKA 4R3UC 3SKXA 1UKCA 1I6WA 1MNAA 4I1OA 3SX2A 5ULLA 4MV8A 2HD4A 3LI2A 3BD9A 5IIJA 3NIWA 1JHRA 4I66A 3QHPA 4XR4A 2AHOB 4WXHA 2R6DA 5B4TA 4NU8X 3D0KA 1O58A 5JXGA 3QITA 4H1UA 4ZZ0A 4BU1A 4GRIA 3KLPX 4RMJA 3LNCA 2BZSA 1F8XA 1D9XA 1VPTA 4ZJYA 4WKPA 1P1RA 3VH4A 4I2VA 1Z22A 2CV2A 2BW0A 5FR1A 2JEJA 3CISA 3A6EA 3D7SA 4HV4A 4RHUA 3NS1A 3VKGA 3Q9SA 2HHJA 1D8AA 2B4TO 4M38A 3ZDBA 1XV5A 2RHMA 1VBMA 4TQRA 4YRRA 4Q05A 1SVUA 1M2HA 1PUIA 4HEHA 1L7MA 1VHTA 4EF4A 4GLBA 5KG1A 2WMOB 4L76A 4XVRA 3DTVB 3UWPA 4XWOA 4GGOA 4DQDA 4JBXA 2X5JO 3ZTTA 1ZN7A 3E22A 3EHDA 3N2GA 3S55A 5JQGF 4X64B 4BO9A 1WUHS 2CD9A 2WUGA 4PGYA 2VYNA 4H4EA 3ZWVA 3ZW9A 1LJUA 1PG2A 3ABZA 1ISFA 4TKLA 3U16A 1D2CA 1E59A 1JFFA 2G1AA 2NZWA 5BSUA 4PLGA 2RGUA 3S70A 3G2OA 2WUFA 4DA4A 2QAGA 2HWXA 5CMLA 2QUHA 2EAPA 3PGKA 3EW7A 3WGMA 4B33A 1UL1X 2IL1A 5JAMA 2VCEA 3EXIB 3OZRA 1QHGA 2QZ4A 1XPRA 2R6ZA 2P11A 1PWYE 1Y88A 1S9HA 2HY7A 4A0QA 1BOOA 2F4VB 1N3YA 2WYVA 4IXDA 5IWAB 3H0CA 1VBKA 5DKFA 1ZY2A 4R40A 1HX7A 2J3LA 3DHEA 4M9RA 3B82A 1NJXA 1FNMA 5AVVA 5E6SA 2I29A 4N3NA 4QRHA 5LQUA 4K26A 5KTPA 2Z6VA 1UFQA 3BSWA 1SXPA 5J0SA 2CHVA 3PUKA 2ONYA 1CRQA 3QKSA 3GPLA 3KELA 1DCMA 1JKJB 1F17A 5FOQA 4WK2B 1PW5A 1TYDE 3WLLA 2WFLB 2XUPA 1CDEA 1W88B 2A9JA 4HXFB 2VEDA 1LNQA 1JDUA 1PX2A 2JXJA 3YASA 3FGNA 4GWKA 4U8HA 2CDNA 1KI2A 3UMBA 2FOIA 5KREA 2ZTMA 3RBAA 3JQCA 3HJEA 3K71B 4OQEA 4ED1A 4EG6A 4AURA 4DKJA 2BHNA 1YJCA 5JSHA 1M1YA 2X0DA 1ORRA 3F96A 1JIHA 1PK1B 5BN5A 4TYMA 5LKRA 2AC7A 2C2OA 3R5KA 2RFLA 4DJ5X 2LMRA 1G64A 4MJ7A 4YCDA 1LEHA 3KWFA 5BSVA 5IJ9B 2WUWE 3BXXA 3AUSA 4QJFB 5IU6A 4L4RA 1Z4MA 9ICNA 3VSBA 1ABBA 1CY6A 3KOUA 5D86A 1VE7A 2WU4A 5I5GA 5EP1A 5TJ9A 4P7FA 1LB2B 1N7GA 4N12A 1SO8A 1THZA 2X8BA 2H4XA 3NNSA 2ZT5A 4MSUA 3G82C 4EZ6A 4D25A 4GPZA 1FCJA 5CFLA 4NM1A 4J9LA 5BNFA 4Q7KA 1NW3A 3MVEA 4EUNA 2HDNB 4Y1RA 3EX7C 1U4OA 3BE6A 2H1OA 1J2RA 2CXNA 4KLAA 4KZPA 2BELA 4TV8B 2C9BA 2W6MA 4EATA 3ABRB 3KSUA 1EP2B 3EFHA 1WCIB 2IDZA 2DAPA 1FQOA 1PO7A 4UBLA 4EMUA 1VJCA 3MB5A 4D4MA 4PS0A 4EY8A 4DWVA 2V1UA 5KU1A 5KWSA 4N9QA 5DXFA 1U2DC 4NLBA 4Z51A 5FPSA 5J9FA 2W6QA 4KVFA 2V97A 2EX1A 1EXMA 4JLKA 5ISMA 5DK4A 4KHZA 2LNDA 2NWQA 2JJ1A 3EXEA 3T4XA 1P1JA 1W4LA 5E1OA 1IBSA 4BQEA 3IO5A 3P2OA 4JBIA 2WJPA 4PZDA 3FAZA 4N01A 3RVBA 2Q45A 2QLBA 3L6CA 4JHXA 1Y5MA 1CR4A 2PH3A 1HETA 1KYYA 3LUHA 3LE8A 4QG3A 3AUXA 3PICA 4BZQA 4RCVA 4BATA 3SAFA 4OEHA 5KAMA 1JR4A 4M1EA 1E4VA 2ZRCA 5B30A 2HPAA 3DE6X 3N2YA 2IITA 3MYYA 4Q43A 1PV4A 4FFOA 4Q44A 1T15A 4PJ0U 4WX2B 4Q4JA 3MRSA 1N9GA 5AJXA 3A4NA 2A1IA 4AUEA 1FUUA 3LDGA 1SL1A 4MS3A 1D0SA 2G4LA 4KPUA 3ES9A 5L45A 1BVUA 2HRZA 1ZM2A 2DF4B 2V7EA 1DFIA 2C7BA 3JQ8B 5C52B 4NRDA 1AS2A 4JR1A 3KKEA 1P4HA 3TZ6A 2YZ2A 3L07A 4R1LA 1E32A 2QTFA 1RHRA 1EB8A 5JFOA 2GOLA 2WHEA 1E1RD 1N3BA 1YMVA 5DT2A 2JEYA 4X41A 5LXTA 4DB2A 4R05A 3C8DA 2D4HA 3LQ1A 3CPJB 4KMUA 5IS2A 3ZE0B 1WBDA 2F90A 1AG9A 2NQTA 5EZQA 1QV7A 5EIEA 4TRNA 5ALPA 1MTZA 5G1PA 2BOVA 3VGPA 4AO7A 5JNVA 2B6GA 4BX0A 4RSHA 4GWGA 5CPFA 1J42A 4LCJA 2VIIA 1BPEA 2IEIA 1TCCA 4KBFA 3NFYA 1MO2A 1FFHA 1W4ZA 1EG2A 2ZAIA 2Y27A 2O8EA 3MLEA 4PY2A 2QJTA 1UBTS 2Q7XA 4DCVA 4B6SA 3GO4A 1NF3A 2FFBA 5C46F 4R1QA 4ZOEA 3L9XA 4UU8A 4BUJA 3OQ1A 2OC9A 5ITVA 3L7IA 2XD9A 1C8KA 3GEGA 3RH5A 5D6NA 3OAAD 4CCYA 3BK1A 2R4UA 4WPGA 1GQFA 5A4JA 5LNK1 1YRQA 2CNOA 3GD5A 2O8BA 1JN0A 3RK4A 1ESEA 4ZYWA 2ESEA 3G2MA 1SBHA 3P2IA 2A86A 2IV2X 2WUVA 1YACA 1U8FO 2P90A 5AO9A 1UAGA 1ZA1A 1EIZA 4OSOA 3E27A 4EELA 1SJ9A 2C4UA 3I5UA 4OA8A 1U7DA 2BMWA 3VSEA 2FR0A 2HOQA 3ED5A 1OA1A 2O5EA 1HFWA 4C4PA 7AT1A 4LNUB 2A3VA 3IIJA 2AFHB 1ULSA 4DS5A 4AMYA 3VO9A 5A02A 4LDPA 2PJDA 4UUOA 2L5YA 3AEZA 4JVLA 3OF5A 2VHXA 1IPEA 3NG1A 3GLFB 2IWRA 1X70A 3FR7A 1I7QB 3RRZA 3T5LA 1ST2A 5JXWA 1X7XB 2PGNA 4KE9A 4FN4A 4C7OB 2W2VA 3LIPA 4OPMA 3KTAB 1J09A 3DYBA 4YQWA 1ZX1A 1UPBA 4Q0MA 1XVIA 2J31A 4X6YA 4FSDA 2R68A 4ARSA 3R6TA 5D3MA 4QEZA 1S76D 2G5IB 1V8DA 1NQXA 3LUDA 3D7MA 4L4SA 4UOZA 3BHJA 4ACBA 1TTHA 3OX4A 1NK0A 1CDZA 4W1QA 4FZMA 1E89A 4AFNA 4WLFA 1SBNE 5CB6A 3DBHA 1I14A 4JI6B 4U7DA 3CQ9A 1KO1A 3NBFA 2YV5A 5FLXA 3OSZA 4C01A 5B6IA 2FPGA 3T1VA 2HVIA 4F4HA 2BCGY 2VJDA 2GRJA 4XB1A 3GUYA 2Q5IA 4MRRA 4FFBA 2QXUA 2BH9A 4EHAA 3RVKA 2BSAA 1XTKA 3NNDA 3W2HA 2IU3A 1NQAO 1Z5NA 2UUBB 3LWDA 4G1VA 1Z7BA 1A8SA 5E4YA 1GRQA 2OGSA 2ZUFA 5KFNA 4Q4HA 1YA8A 4JJ7A 1DCFA 3Q7RA 1Z83A 1OGIA 2A1JA 3EWIA 1EBBA 1ZM7A 3UW3A 2O8FB 1LVUA 5EMJA 4YP0A 5F1KA 3RUPA 4Z53A 2P2YA 3GJZA 3MUFA 5BMVF 4ZQCB 4I3FA 2FZVA 3OPMA 521PA 1BWSA 2JAOA 3ETDA 5KFBA 1O95C 1DV1A 1SELA 2MAXA 5E9JA 2YFQA 1C9KA 3V5NA 3G7SA 4I36A 2A84A 3IMKA 3H8VA 3T0FA 2Z95A 4G67A 2ZSBA 1T26A 2GJ9A 1QV6A 5DDMA 4OG2A 1H2FA 1G7TA 3HKDB 1DZIA 2QD4A 3KHKA 4EVRA 1V3QE 4RS3A 3PCRB 5BWCA 4YJDA 3IEVA 4C0HA 3RI3A 2QRVB 9ICBA 2W71A 1BX0A 1XAHA 5CM9C 1KZ4A 2ZB8A 2B92A 3ZNOA 1Q0LA 4JMUA 4R7TA 2UVRA 1G7SA 3EOAI 2BGIA 5DGAA 4C89A 1EXVA 1HZZA 2A1AA 2CBXA 1F3OA 4EF6A 3PNLA 1CTQA 1J8VA 2OSBA 4NLLA 3O4FA 1LZLA 3DMHA 1CF2O 1FQWA 5JZMA 1T1SA 4PHGA 2WHYA 4RSGA 1JP7A 1UXJA 2KS6A 1ZKDA 4NSNA 3TGPA 1YB2A 1PI3A 2V7TA 3AUJB 2OBLA 3LT0A 5TEVA 3VU3A 4BKUA 2O48X 2J87A 4KMOB 5P8WA 2PGXA 1IOWA 3ZJ5A 2VKQA 4IFEA 1E3WB 2V6MA 1UJ4A 1NVGA 2NRVA 3I9FA 1QP8A 1LX6A 1PZXA 3QPVA 1CUFA 5D01A 4GE0A 4DPKA 4IVQA 4DRXA 3F7OA 6Q21A 4B3MB 1DMSA 2H3IA 4NLKA 3JATA 2WJGA 4IXWA 4LSZA 2VP4A 1WUTA 1GG5A 4BMXA 2P41A 2QTBA 4J0IA 5J40A 1KU6A 2IHYA 1NI3A 5DYTA 1G4HA 2VJAA 4O5OA 5A5VA 4NBWA 1PIWA 1N9KA 3ENVA 1CJSA 4CV0A 4AJIA 1N5JA 3TL6A 3FHJA 3I2GA 4C78A 3H2BA 3B13B 4G4JA 4L4XA 4GXTA 5ITSA 1UMCA 4K05A 1KTVA 2DSTA 2JGKA 5E6RB 4M0EA 3NVWA 3F7TA 1QANA 4D43A 1R6TA 1GPNA 1M67A 5H1YA 1YVRA 1XNSA 1VCIA 1WKVA 1VSTA 4JVOA 4QFDA 3W5VA 3D3WA 5TLSA 3WGJA 1TW2A 2O6HA 2P1DA 3LXRA 5IT5A 5DP2A 1WDTA 4GLJA 1YQXA 3N8GA 3FRJA 1NV9A 1JHAA 4GF5A 5AQEA 1S2NA 3HQ4O 1NW9B 2XDWA 3O3OB 3OMXA 4YXFA 3GYGA 2UZ4A 3E7PA 1IBMB 3FN4A 3PUXA 2V7UA 1L5YA 5JVDF 3U19A 4UHKA 1HLPA 1K0UA 4MTCA 5DTQA 1SNYA 5LDHA 1DGJA 3AQEA 3WLMA 4MHOA 2HSEA 2CLHB 3LO5A 3UK6A 4O4LF 2Q6TA 4S24A 2QKYA 5A4FS 4ENQA 2VT7A 5HS6A 4F4IA 5IDWA 3AUUA 5HUHA 5KAPA 2J0UB 4V1CI 2R96A 1VPEA 4ZK2A 2UYHA 2YJ3A 4B73A 3F2CA 3ZV7A 2ZTSA 1DIAA 2WSSA 1NBME 4URHA 4YRNA 2GCNA 1H2RS 5NULA 2L17A 3HVUA 1W19A 2NOAA 2JGDB 3JARA 4O63O 5CA1F 4ZOLB 5CP8A 7GPBA 5JCJA 2RHOA 3UMFA 2ISPA 2AFVA 3CV3A 1K9SA 1S7CA 1MABB 8ICXA 5A4IS 2A3NA 1RYYA 1ZVVA 4IO1A 1ZG3A 5DNWA 1NI4B 2YHBA 3ZW7A 4LVNA 1DX4A 1ODKA 4FNGA 3KQTA 1E6WA 4Q39A 4YGXB 2AXPA 4D4GA 2EJTA 1J70A 1M0SA 4CG1A 3B51X 4F56A 4DNPA 4CU5A 3U56A 2R1ZA 4YCNA 1Q0HA 1JQDA 3THYB 2DOKA 3AR3A 4F8EA 1S2DA 2WYIA 3BHIA 3E53A 3G0GA 3FOWA 5G40A 3RAPR 4LJXA 4QATA 4D3YA 2F77X 3EZ7A 2P0EA 2ZYDA 3VJMA 4PL1A 1W5FA 4LF7B 4BFWA 3PNKA 3QA3E 2C0PA 1U1FA 3GEDA 4GM0A 2VPIA 1NU8A 5I9TA 4Z4EA 1RI3A 1VMIA 2Y6UA 2AXTU 3RAXA 4R2WA 3JYPA 5EZ6B 1IXSB 2JH3A 4RANA 3QVGA 5JS7A 3LC1O 2P7IA 4MA4A 1Q6ZA 2Q6KA 1GPAA 3ODGA 1F0KA 3T3EA 1S2GA 1XZNA 2WB4A 4RQ8A 5L1LA 2WWFA 4IQTA 2Z6QA 2OZEA 1IUPA 4K88A 2BJWA 3IQEA 3Q0EA 2K2WA 5CB1A 1RP1A 2IZ6A 3G02A 1DX6A 2RAFA 3LPLA 3VZBA 4XFKA 1YZTA 3W1WA 4L3VA 4FFWA 3DZHA 3JPNA 5BT8A 5FUXA 3S99A 2BHRA 2C29D 3OQJA 1BS9A 1Z5UA 1XWIA 5AHRA 2FZ4A 1SC1A 1AO0A 1JAXA 4Y2SA 1WCYA 2ERYA 1L9XA 3UJ9A 5LVAA 2FSUA 4ZKEA 4JVSB 5CLGA 3BWVA 2ANBA 3LS2A 4L6AA 2VYFA 5KDLA 4XDZA 3Q10A 3D1JA 4HXGA 3HCRA 1ZIDA 1F20A 4KQ1A 3BORA 3G2PA 4IRMA 1AK1A 1QZXA 3IP9A 3HN6A 3FMVA 1KY3A 3MJDA 4IDEA 3W6ZA 4YRQA 2Q6IA 1F12A 5KPDA 1PD1A 4DADA 5JW6A 3ZWOA 1WTAA 4ZA2A 2C83A 4GKBA 3F90A 4Z6CA 4D99A 3AQ4A 4MGEA 2TECE 4MW9A 1QGOA 3ROXA 4JX9A 4BNWA 1FOEB 4TZKA 2FF5A 4BAZA 2PLNA 3DTVA 3DZGA 3RASA 3NHYA 3SBOA 1WMFA 4EG5A 2EDAA 3OZTA 1K7XB 1NOMA 1QNFA 5KFDA 3UHOA 3TL3A 1OXXK 4AICA 3IHKA 4XASA 2KOBA 2DPHA 2HV8A 4JSYA 1FJ2A 3R77A 3G9TA 1EWQA 1OI7A 4A91A 4TGLA 3BRCA 4AP9A 1H1LB 4V1CB 3COWA 4IKEA 4LXQA 2CW5A 1W9MA 4IMJB 1HR0B 5JYBA 5H3HA 1OE0A 2VDPB 3UH0A 4NFYA 4W5NA 2PS0A 3IB3A 2AWOA 3OC0A 3EXIA 1AXRA 3EE6A 3NM6B 3MT0A 4F1WA 3TD6A 4ZQBA 4QA9A 3HCPA 1KDPA 4H3VA 4Q47A 1EGAA 1WDKA 2B61A 4MKZA 3OKCA 1ILEA 5FL7A 1RYRA 5CD1A 3A1UA 5C0YA 2PL5A 2O52A 4MKFA 1U1EA 3WK8A 5KOJA 9GPBA 2CYBA 3CG0A 2F3QA 4G5SA 4P7KA 1VPLA 2MWMA 1QSSA 1GWNA 1YHNA 1IN1A 1S9FA 3UATA 3ZZTA 5LLSA 4ZCIA 1JKJA 4QBFA 4YASA 2YIMA 4X5OA 5F3XB 3ZDFA 5CA7A 6REQB 2BGKA 4R69A 4U00A 1M34E 1YR1A 2X7XA 4P98A 4MIKA 2KK0A 5L7WA 4QZAA 1GRNA 1TL7C 3KZXA 1W88A 4CFYA 3L4BA 2VP9A 3K2QA 2QPOA 4GOMD 3TIVA 1ISRA 4EG8A 1FXUA 2FN9A 2M2IA 1A9SA 4NENA 1MT0A 1JLRA 1U90A 3KNZA 4O2LA 3PTAA 1R6UA 5KAIU 2FPPA 2ZYSA 3AGPA 2GT1A 4M0FA 5HIJA 5YASA 1I7NA 4EKIA 1JR3A 4L15A 5EWLB 1PUXA 5KNDD 3V8RA 1YNOA 1PL6A 7ICJA 4WJZA 2I4IA 2OMKA 4Q3EA 5K8IA 3KVVA 1E1CA 5EJ6A 1U28C 1IM2A 2DT8A 4W9NC 5IJ9A 2ZUSA 3W8EA 2ADFA 1TCAA 2QSUA 2H0RA 3AJ9A 1ZI6A 1FP1D 3K6JA 3WLHA 4RXMA 4PG8A 2PXXA 3RROA 2P6RA 1Z5VA 1R6DA 3BA1A 3P0IA 3KQSA 3HCEA 1EG7A 2QJOA 4DCPA 2B5WA 4G1MB 2O1EA 3IAEA 8AT1A 4LHVA 2RGDA 3ROQA 3AYZB 5CRIA 1E99A 1O3YA 2HMAA 1ULUA 2K5UA 5JNWA 3HUTA 3QHAA 4EMSA 3GEIA 4QZVA 3I05A 3I0ZA 1XZCA 1A6SA 4ZAXA 3ISTA 2FZEA 4UULA 5EEHA 4ZREA 1X94A 3P0EA 1J21A 1IHDA 1ZEJA 5JAPA 1MLDA 1VB3A 3H5WA 3K9FC 1RBMA 2JW5A 1GXSA 2WP8J 2QV7A 4QWAA 1WCIA 4KITB 2RHTA 4BMDA 4MVJI 4O5CA 3L02A 4LJLA 2AOTA 5BQ5A 4G5HA 5KX5F 1QCZA 2K2QB 4F9GA 4OU4A 4GQAA 2AQHA 1I1NA 2PX3A 1LFDB 3ESXA 2OHFA 2WKQA 5E2AA 1Q16A 2VQSA 3IP8A 1H69A 5FKJA 4A6DA 2H48A 2I6QA 4MW4A 5KQLA 5C8YA 4BNXA 1NA5A 3SG0A 1U3DA 5CDHA 2PIAA 1SCKA 5KNCA 1R9GA 4FZ5A 4XX0B 1C7RA 4A0SA 3BT7A 3HBNA 3C8ZA 1YDEA 4IWNA 4CIBA 3TR0A 4R4JA 3I6ZA 2ODTX 2B7BA 2AGOA 4IKPA 3ONEA 3BGVA 3WB0A 8GPBA 5F4ZA 1E7MA 2QN8A 1PEAA 5IAJA 2H1IA 3TBFA 2AEEA 2HQRA 5HE9A 4WINA 5FYDA 3OFSA 5AK3A 2NZXA 3B0XA 1CIVA 4HPJB 4UFNA 1YFZA 5AHKA 3H1BA 4MVYA 4KLJA 2FMTA 4C29A 1JPUA 4LGMA 5AJUA 3TLGB 1Z9BA 3G0OA 1QG2A 2GRAA 4RA6B 4GX1A 3BJZA 4TXNA 5KYKA 1GCOA 5AM5A 2Q3BA 1ZGCA 1RWOA 2ODGA 2YHSA 4UUMA 2G9QA 3ZV5A 2A5DA 1YS2X 1MZVA 4R2JA 5C80A 4TL6A 3EZ2A 3HSKA 3JZAA 5I9BA 1ONOA 2VJ4A 2HA4A 5SZJA 1F0NA 3X2SA 4I2CA 2GPNA 1UBUS 2QJFA 3TF5A 1VM6A 4R51A 4NONA 7ICNA 1LTKA 1Z6QA 3ZBQA 1MJNA 3ZU4A 1KOLA 3BS7A 1I6KA 4MUYA 4RCYA 3WKEA 1TK9A 2XE7A 2JGFA 4JR0A 2XJ4A 3EIEA 4IHAA 1WVMA 2PUEA 2X86A 1JHDA 1ZQVA 3RTBA 4Q1BA 1ZZEA 4NZMA 3A58B 2IZ1A 1W0JA 4V0ME 3H84A 3OZBA 4ZI2A 4C7BA 2RGAA 3C5WP 4KLDA 1M1ZA 2QX4A 4JHLA 4RDHA 3EA0A 1QH0A 2OCGA 2FWRA 2KG5A 3KHLA 2KWIA 2OCYC 2QNIA 1KJYA 2ZJ3A 2VJPA 3QVVA 2Y1KA 3UOWA 4ZGBA 1BA3A 2H5EA 4PGGA 4I55F 3ZIAD 4QHSA 1QR6A 2HU5A 3ITKA 1D9FA 1SR8A 4JYBA 5CURA 2PGJA 1XAGA 5K3EA 2HO5A 1KKLA 1LPMA 3GJXC 4BX3A 2IEBA 5DOVA 2AFHA 2PZFA 4B3BA 2OFXA 2L19A 5KVQA 5ABPA 3L6DA 3BOSA 1XRNA 2IF0A 5BPCA 1V3UA 1Y9JA 3VRHA 3GLFA 1CUVA 4DJTA 2Q07A 4A8HA 4COKA 3LTNC 2HDWA 4LGYA 5H81A 1NC1A 3PNVA 3UXHA 2XCUA 4X1KA 2E4VA 3VH1A 1X1TA 5H7XA 4F9TA 4BECA 3FI0A 1DRGA 1AGPA 5JI3E 4CQLB 5BSGA 4YAKA 4P22A 4C7OA 3ZCTA 3A37A 1W30A 2ABWA 4B9VA 3JPOA 1A4RA 1EVLA 1BG6A 4FYPA 1M5UA 4KQKA 1ZJ4A 4ZC1A 3PUZA 2FYTA 3NHZA 3P52A 5BMOA 2X5XA 4U2EA 2XIDA 4F06A 2VWHA 3I3SR 1RZRD 4Z2AA 3RJMA 2Y76A 4II3A 4QC2A 4RHYA 4Z9YA 3VNUA 2XCRB 1K75A 4GXJA 3BHMA 4RF3A 1LZKA 2EXXA 3H1FA 4ESVA 5M29A 3T5BA 3FNEA 5CA0F 1SXQA 1RZUA 4WV3A 5TGTA 1U45A 1HEIA 1UANA 4AK9A 2WWRA 2PKEA 1S96A 5CCDA 2DHEA 3SFZA 1H93A 2RC6A 4MI3A 1SVOA 4CMHA 4AULA 4K8RB 1KGDA 5HS4A 3H40A 4KTQA 1RXEA 4EHKA 2K89A 3LD9A 5I3CA 3BC1A 4IILA 4KU4A 3UV3A 4DS4A 2DL0A 2I3AA 2MSNA 5HKKA 3T7CA 4QU8A 3A6KA 5DBEX 3FMIA 1VMAA 1VKZA 5KSWB 5A5FA 1AN0A 1FLNA 2O8FA 3CWQA 2KQUA 2QW8A 4HLNA 3DBVO 3GJ3A 4FIDA 5LBIA 5JNRA 4NOJA 4W1RA 5HX7A 1M0EA 3R7SA 1AZLA 4KJXA 2ASVA 4I8XA 4M2LA 3ZE9A 2DGZA 4KSYA 1PR0A 2D1RA 4I6EA 4QOJA 3NVZA 5TR9A 1A2OA 1E79A 1BHQ1 3JPTA 1SWVA 4EG4A 1Q11A 5KVCA 4KLHA 3AI2A 3BRWD 3T7EA 3TKAA 2TMKA 1QYXA 4FMPA 4UVGA 3FC4A 3H5IA 2YXDA 4GPTA 2DQKA 3TR6A 4J0JA 3S28A 4R2MA 5G0WA 4J16C 5BW4A 2GEVA 5JSKA 1XZHA 2G1JA 4FU0A 2JH7A 3GMTA 2PKCA 5EJ4A 1G9TA 4C4RA 4QZ9A 2ISCA 4Z1MD 3NT5A 1FMJA 1CBUA 4ZU6X 1KBZA 3DO8A 1EBUA 1ZSVA 5CIWA 4C05A 1TCUA 5JJBA 5HBRA 1ECGA 2ZWPA 1OU4A 2CHGA 1O8CA 4TQUS 2RK3A 2H16A 1B8PA 2GHRA 1ZK1A 2XVAA 3HG7A 4I1UA 3PT5A 1WP9A 4A8JC 2QB5A 3OZEA 1F8YA 4DG9A 5EWMB 3KKKA 3T61A 3DV0B 3R3SA 3DWFA 3GN2A 1Q0SA 3EODA 2BBTA 1QYVA 4RZQA 3K1AA 3KQYA 3BJMA 1DARA 4AS2A 1BH2A 3H5OA 1CR6A 4EJSC 4FJ2A 5JT1A 2VSNA 5EZYB 2R4TA 2PR2A 3MTIA 1T9BA 2C96A 2X9GA 1DC8A 2HUPA 4OXYA 1FX0B 5BUZA 4J1SA 3KEMA 1W2HA 1NMEA 1HDIA 2CFSA 3HP4A 4JWNA 1L3SA 2C5BA 1XJWA 5C7LO 2V7XA 1DUSA 4NBVA 5TISU 3C21A 3MUEA 5AKHA 4FFLA 3EH2A 3TXYA 4H7EA 2R5NA 3ZWBA 4L5IA 1CQWA 5JO9A 1XMSA 2J9XB 5E6RA 4FKMA 4R54A 2WKRA 1RJDA 1AQJA 2FH5B 9ICHA 2BR3A 2WJHA 2GJKA 1SIWA 2ACWA 3KSBC 4KGDA 3RVMA 1SQ6A 4AYBF 4DMUB 2D2XA 4AJOA 1J90A 1NUAA 4B3IA 3UAVA 3AL0C 1EE2A 1ZQHA 2C03A 4OJKA 3D4NA 4FZ3A 3M89A 1UBNA 3MGAA 4EA9A 4DWOA 5KO2A 2QRLA 3GV8B 3DLPX 3R7WB 3GT0A 3KEQA 2EKZA 4ZI5A 1YMQA 5E79U 1UCVA 4TLLB 3FUCA 2GK4A 3UFBA 1OXJA 2GOYA 3KOXA 3ACCA 3MWDA 2NACA 2FX5A 1AXEA 3WNBA 5THXA 2EQ5A 1CEEA 3B1YA 1L7AA 3IVMA 4OI2A 4LXXA 4X8HA 4Q3CA 3WB1A 4TYPA 1ZSYA 2XTZA 3R5TA 2FWJA 3TFSA 1SG6A 4N47A 2Y8EA 1H9CA 5EZSA 3HKEA 2F6RA 1SCIA 2IHJA 1URJA 2JGDA 3FYUA 4K40A 5LP6F 2GN9A 3K16A 2YJ6A 4YIKA 4REQA 3ZLJA 4N6OA 4XUGB 3W5BA 1SXEA 5DG9A 3B2QA 2HN9A 2DUMA 2F8KA 3CZ5A 3UJNA 2Y1WA 1PNTA 2YWCA 2REQB 1PQUA 1HT1E 4QWWA 2VAVA 1LB1B 4EOGA 2BEJA 1KAHA 1TK5A 4W5RA 5FOWA 3THYA 3A1CA 1IBKB 4AAYA 2QX7A 4QW8A 2PMZF 6AT1A 4DXHA 3BE8A 2FRDC 3KLBA 4J9SA 2OAEA 2ZTUA 2GBLA 1Q0QA 2QR5A 4GSKA 2PX4A 3ERCA 1L7QA 4UEWA 1NIPA 3DFUA 1JI3A 1SK8A 2DF8A 5AJZA 2PWZA 5JZVA 1T2VA 1E1NA 4RY8A 4F4UA 3ETJA 1C1YA 2B1QA 2RGCA 1DAEA 4RKFA 4X65B 4BQSA 5TJHA 1CYDA 1WBJB 1BCRB 3PP8A 4LF6B 1RYBA 1Q3KA 3QPAA 1FVHA 4LZDA 4BJHB 2AG1A 4QBGB 1QUEA 1U80A 4J2TA 2GRUA 3WDSA 5FOXA 3RJFA 4ILKA 4IJWA 2KD1A 3EAFA 2N9UA 1YL6A 2G80A 4QD3A 4BJ1A 4BVLA 4OQ4A 621PA 4G37A 2A78A 3HJGA 4IQVA 4QXOA 3NIFB 1F48A 4KMRA 1M6YA 1T4DA 3CB4A 4KLFA 3IB6A 3JRWA 2BGWA 2WZQA 2QTNA 2Q1YA 1DG3A 3AKEA 4DSUA 4P93A 3PHIA 4F8JA 3PR2B 3AB7A 4URVR 5TXGA 3T7RA 4JLNA 1SQ0A 3Q7QA 3HRKA 5AI4A 4LHSA 2OK8A 4M89A 3IEXA 3M6VA 1RAAA 6GPBA 1KFKB 1N25A 2E4XA 5G5HA 1XE3A 1ORHA 3V8PA 4DYDA 1MEEA 1F2TB 4PO9A 4L0QA 4BASA 5EXSA 1I2CA 1M0WA 1JWBB 3CZRA 3ZE7A 2WU3A 2R7AA 1IVSA 1ISMA 4NPHA 4DUPA 3HFSA 1QHHB 5GP1A 3A7EA 3BGDA 1KEVA 3VHLB 3N2KB 2QZJA 1NR5A 4PBRA 5FPHA 3MBIA 4D4LA 3U17A 4PFKA 1T2FA 3O1HB 3GGJA 3KTDA 4N6GA 2B2NA 3G9ZA 2FQXA 3F67A 5FQOA 3PMLA 1IXKA 1EESA 4U6NA 5KKAA 2RCYA 1N5IA 2ZULA 3MHPA 3DZIA 1WNTA 2PX6A 4XM1A 2O2EA 2VRBA 1EX1A 2MSEB 3ZTYA 5F77A 4LJYA 3ROKA 3KWJA 4ADSG 1A50B 4BNMA 3JWIA 121PA 3RVPA 1T3NA 1U1GA 4I1IA 1QVZA 1ANKA 1ZK0A 2PSDA 1NSFA 3CRRA 4RIEA 3WLKX 3PD7A 5JPDA 2QVLA 4BNDB 1NQWA 2Q0ZX 2VAXA 4EG7A 1BPBA 2WFZA 4RZSA 2PZMA 1IB6A 2XW6A 3GJ5A 3VNRA 5LMUB 2QMQA 1RHKA 4KGVA 1ESMA 5DM0A 3Q15C 1V37A 4RVCA 2JGMA 1G4AE 2G5PA 3OPVA 5H4GA 3IDAA 5ENZA 4QOSA 3QMPA 3DM9B 4ND1A 8ATCA 1XEXA 4DCUA 3JR7A 1YUBA 4LK3A 3VZQA 4ZTZB 1XZMA 4QLOA 3IV6A 3UAYA 3E58A 4I8IA 2LKCA 1L1QA 3T52A 1NUTA 5LQSA 3RR7A 5K0CA 2R8KA 2BCUA 2FWMX 3FAHA 2HFJA 4R0MA 3GFBA 4ETIA 4UB2A 2FSSA 1HH4A 4JC8A 1MX5A 2SICE 4GGMX 4E5KA 4IDBA 4KCGA 5TMPA 1S8NA 3HE3A 1ZXLA 4UQOA 4A1OA 3DW1X 5K8TA 5AJWA 3UGQA 1T8PA 1T29A 3W3AD 1H2ZA 2RHFA 3UUFA 4F6RB 2JLQA 4FNAA 1RJFA 4CEJB 5HQTA 1SBZA 2F1RA 2PUFA 4J0FA 4EK9A 1D7AA 3ANNA 1CUJA 1PFYA 3OC6A 1ISJA 3A9VA 3D2BA 2VFAA 5KL8B 4H15A 2JLUA 5L95A 5LQNA 4C0LA 3I1FA 5EWLA 2J6HA 3UMRA 4B2YA 3H42B 4U6SA 2ZREA 4LRUA 3KOWA 1RXYA 3RC1A 3N07A 3F3SA 3V6HA 3GFSA 2OBBA 3LGSA 2FPKA 3JZIA 4P08A 5C7IO 3HFJA 5JCOA 3Q12A 1Z3IX 1R27A 3K2BA 2PKWA 2OV3A 3OE4A 2DKOA 1ZQBA 4D9EA 3FGOA 2UKDA 2ODPA 1XMOB 3OETA 3N58A 5BW6B 1XTVA 5DYGA 3FH0A 4WXYB 3JQAB 1JTVA 4F3KA 5KT6A 3K70C 2EAUA 4Z3DA 1E1QD 1E4YA 3L6UA 4TM7A 3TADA 4RJ2A 5INTA 4H6WA 3TRHA 4GZLA 1EWTA 3WK6A 2W4IA 2IA6A 5HOQA 4DV3B 1HIWA 3I1IA 3PHHA 5H68A 1J9ZA 4CWAA 3PDUA 3T1HB 1SKMA 5K0JA 4FFNA 4MB6A 1KVTA 2PGAA 3HVJA 3OZFA 2DWOA 2NP6A 3KQPA 4MEXA 4ER3A 1PNQA 2I1LA 4OCZA 1GP2A 2WPDA 3HKBB 1M73E 1C7YA 4CLOA 2C5LA 4DQ0A 2X7JA 2WJAA 4CYMA 1P6QA 4MA0A 1G55A 5EFOA 1OKKD 1M8PA 4N8SA 1KQPA 2J08A 1PS9A 2Q0XA 5TY0A 4NBLA 1SC4A 2C2RA 3VHRA 2NSHA 1YKSA 3X3HA 3RTCA 4ZO6A 1QKIA 2XC9A 2CEKA 1JHOA 5AFSA 3DT6A 1E2JA 1YS4A 2BJHA 1GSIA 4XX0A 4JGIA 1SB8A 1EHIA 1LLDA 4YJGB 3B12A 5KG5A 1XN1A 4B7AA 4J4BA 3EQ6A 1GLNA 3ZUPA 4D3ZA 1E1YA 1C0PA 1OWOA 5BSTA 1OUMA 3BKXA 4XLZA 1XYVA 2O8NA 4OK5A 4M9ZA 1GGMA 1Z4KA 1R2QA 1SBYA 4OI1A 4MWTA 3ZE1B 4BDPA 4ISBA 4ND2A 1PJ8A 1SL2A 1NL3A 2V59A 2C7VA 4ZIRB 3TLGA 2QQ0A 4QWDA 3S40A 4RA6A 3AEXA 3RTGA 3F5EA 3VYUB 3WAKA 5E4TA 1CP3A 3HN2A 2EFYA 1UDWA 1B23P 3ESQA 2J0EA 1OU0A 3TIFA 3CO5A 3TLJA 1RKBA 3EXG1 1LQTA 3W8RA 2MUTB 1PJLA 1W25A 1M6VB 2W6IA 3UFXA 2DPYA 3AP2A 5L3RA 1P7YA 3LJKA 1XKLA 1PFUA 2XNDA 2JD2A 4Q16A 5DSZA 3LPMA 1TV9A 1CY8A 5KTOA 4X3CA 1JXQA 9ICPA 4W99A 3MILA 5KFRA 3N6RA 4N03A 4ECZA 3LFTA 1WOMA 4N0DA 2GDZA 5FB3A 5JALA 4A4DA 2LXNA 3HM9A 3MR3A 2KTQA 2VR1A 5G0VA 3R5SA 1GGHA 4AVYA 1X1AA 2YYYA 1V2HE 3BZWA 3O1LA 2UUPA 4EJ6A 3KC2A 5LYYA 2P2CA 4J76A 4L9RA 3KQOA 2KIVA 4ZYZA 1XWLA 1RE0A 4UEJA 2QUJA 4DIDA 3TPCA 2BUAA 3K5WA 1C8VB 4MI9A 3H75A 1LVHA 3HLKA 8MHTA 4AJEA 3RFXA 3UJBA 4BQQA 1K1QA 1OAOA 1ZXXA 4HNAB 4ZCSA 2H1RA 3GIJA 2I1WA 5BWOA 4YJ3B 4HFJA 1LD3A 4YWJA 4WKOA 3U44B 4DNOA 4TLEA 3E7DA 2A30A 1D0VA 3UXPA 1J0CA 3BBPA 4MV4A 2I66A 4MIEA 1UXIA 3SY8A 2OWOA 1AXGA 2GVZC 3LPDA 4B9TA 2CVOA 1ZW1A 1YI0A 1E8MA 4BKRA 1Y42X 5AM4A 4E08A 3HKZF 4QZGA 1X8XA 4MVJA 1I51A 1X14A 4FR2A 1OV4A 2VTDA 2IEGA 1MC8A 1UBRS 3CF4G 1H05A 1P18A 5JEEA 4HFRA 2DTDA 4FGSA 1KH2A 4YLGA 3KXLA 3KZNA 4TQGA 1UJBA 2BY4A 3RH6A 4AUNA 3PSAA 4X00A 3NTVA 5CM2Z 1FBNA 2VPXA 3OQOA 3A36A 1KDRA 1H9BA 5EJAA 3TMAA 2BE9A 3BJIC 4PRZA 3WRWA 3LG2A 5FBKA 2ZBFA 2EGUA 1XTZA 3TOZA 4EYKA 2QORA 3H3JA 3DPSA 2C84A 1QYRA 1E6EA 1IMOA 5EUBA 3TUIC 4EY6A 3DPIA 3EG9B 3WRXA 4QHTA 2PUHA 4QQNA 4RD6A 4B9MA 4ZALA 3HPOA 4LOJA 4CUZA 4OREX 2JFOA 2VZLA 3H9BA 2CVZA 3NCHA 4GEGA 5EYPA 4KRYA 1FFBA 3N0RA 5LBUA 4GR4A 2FMFA 3DMNA 1VMKA 1CUDA 2I1VB 3HYRA 1L5QA 2Z2JA 1SXIA 4ZT5A 4EHFA 1P2SA 2H0QA 2AG5A 3ICPA 4LV6A 3CF6R 4JBYA 7ICMA 2IZ7A 4KSBA 3C6KA 1CUHA 3G2LA 3SIRA 3PKIA 3RJJA 1IG3A 5EKXA 5BYKA 3GG2A 2WIDA 4UBIA 2NVUB 3AFHA 2XH8A 4KWIA 1BS2A 2C07A 2C8JA 3H0RB 5KOYA 1LDNA 1I4WA 2X1LA 3S0JA 1LK7A 3D59A 2C0QA 5F1PA 3ROGA 1Z3EB 5JLJA 1XPJA 1W0KD 1N8NA 3A04A 4BNFA 3ESZA 4Q9NA 2EZ8A 2ZYVX 1DDOA 4ZMSA 4JUZA 3OSPA 4EDHA 1TDJA 1ZUHA 1H2AS 1VFNA 3TN7A 4OK3A 3T3HA 1CIJA 1YR9A 3W5DA 1A72A 2DWPA 3IAM6 3FVVA 3JWPA 1BRMA 1KS2A 5BURA 1F8FA 1N63A 4HX2A 2VHQA 2E48A 1IJFA 3DVQX 4RZ2A 4Q45A 4MUFA 5L4LA 2OL4A 1NUHA 3BE4A 2WWWA 4NXMB 4K6GA 1AHPA 4K9PA 1OFIA 3VTKA 2B83A 4O25A 3O94A 5EWJB 4YR3A 1WMBA 4G0NA 1GZUA 3LC7O 5DNUA 4YQFA 3A9SA 4PNZA 3GFKB