3E58A

Crystal structure of putative beta-phosphoglucomutase from streptococcus thermophilus
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
211
structure length
211
Chain Sequence
MVEAIIFDMDGVLFDTEKYYYDRRASFLGQKGISIDHLPPSFFIGGNTKQVWENILRDEYDKWDVSTLQEEYNTYKQNNPLPYKELIFPDVLKVLNEVKSQGLEIGLASSSVKADIFRALEENRLQGFFDIVLSGEEFKESKPNPEIYLTALKQLNVQASRALIIEDSEKGIAAGVAADVEVWAIRDNEFGMDQSAAKGLLDSLTDVLDLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of putative beta-phosphoglucomutase from Streptococcus thermophilus
rcsb
source organism Streptococcus thermophilus lmg 18311
molecule tags Isomerase
molecule keywords putative Beta-phosphoglucomutase
total genus 77
structure length 211
sequence length 211
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3e58A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3e58A01
3SLRA 3SD7A 1YNSA 1T5SA 4ZEWA 2YJ5A 1KYTA 1ZS9A 4HGNA 2WF8A 3QGMA 3SHQA 2WF9A 5ALOA 1N9KA 1ZOLA 1NRWA 4UM5A 3OCWA 4KX5A 3U7GA 1L7NA 2WF5A 5ALEA 4MUMA 5ALGA 1O08A 2HEGA 4DWOA 2G07A 3E8MA 5AK6A 4XE5A 4FFDA 3U13A 1ZRNA 1ZJJA 2WHEA 1Z4KA 1Z4NA 2YY6A 3ZVLA 5AW4A 1MH9A 3B9BA 1U2TA 2B30A 1S2OA 5ALQA 3U7HB 1FEZA 2CFSA 2JAOA 5A3SA 3QXGA 1VJRA 4C4RA 3AR8A 1U7PA 3NAMA 5AM4A 4Y2QA 1QQ7A 2IOFA 3I1YA 4KNVA 3L7YA 3ONNA 3OCXA 4CE6A 4QJBA 2C88A 3OCZA 4EZEA 2BDEA 3QNMA 3QYPA 3U26A 3D6JA 4CNQA 2R8YA 4YGYA 5ALKA 2ZBDA 2QLTA 2WM8A 5AW3A 2P11A 4AP9A 3ZWKA 1RLOA 3W5AA 2YN4A 5ALSA 4BEWA 2P69A 3NASA 1TJ3A 3ET5A 1QYIA 1TJ4A 3SKYA 3R9KA 3BA6A 3UMGA 4EX6A 3L1VA 1RC8A 1RMQA 5AW6A 2W43A 4FYPA 4G63A 3FPBA 5ALDA 4DW8A 1RMYA 2FUCA 2YBDA 5AK4A 1U2SA 2HDOA 1L7OA 3EPRA 2ZOSA 2IYEA 5AM2A 2B8EA 4E88A 3M1YA 3VAYA 4BX0A 5AKKA 2OM6A 3QUBA 5ALZA 1J97A 4L57A 4AS3A 3KDPA 2WF7A 3DNPA 3HYCA 2B0CA 1L8LA 4IG4A 3ZI4A 1RQLA 4CF5A 4BKMA 3SKXA 2NO4A 3I28A 2YJ6A 2D2VA 1ZRMA 4BX2A 2HO4A 3PDWA 4KNWA 5IT4A 2I54A 3GYGA 3CNHA 3ZX4A 2OYCA 3WKEA 2RBKA 3ZWDA 5AI8A 5ALHA 3U19A 2HHLA 2EAUA 3F9RA 3RF6A 3EWIA 4ZEVA 4BNDA 1K1EA 3K1ZA 5AICA 2FUEA 3WK7A 1X42A 2AMYA 3AR5A 4XQ0A 2PQ0A 2HSZA 2AUTA 2IOFK 4UMFA 4RESA 3IRUA 4Y2PA 1SU4A 3N28A 1T5TA 5AW5A 3ZUPA 3WGVA 3MMZA 3ZVNA 2HI0A 4UATA 2YMLA 2P9JA 3QU4A 1Z4LA 3N5KA 3OTQA 3FPSA 5AVXA 2O9JA 2C8KA 3IJ5A 3QU7A 5AW0A 1PW5A 2BDUA 4CF4A 3N07A 1Z5GA 4UMVA 5AKGA 2AH5A 3E58A 4UASA 3ZTYA 1WR8A 1Z88A 4KX3A 2O2XA 3UMBA 2G1AA 1EK1A 1S8OA 2NO5A 1RKVA 4UW9A 4UU1A 3L0CA 2GHQA 2BY4A 1Z4OA 3I76A 2Q4RA 1SWWA 1IWOA 2HF7A 2YFYA 2I34A 4UM7A 4BEVA 5ALLA 3OPXA 4YH1A 4L6AA 2ZBEA 2DQSA 5E0OA 2JARA 2CFRA 5AVUA 3DV9A 1XVIA 4EELA 4YCNA 5AK5A 1RLMA 5AK3A 2PKEA 5AW2A 3AR2A 1RQNA 2R8ZA 1T9ZA 2R8EA 3EF1A 4UMEA 2ZG6A 3QUCA 1L7PA 2RB5A 2PR7A 2ODAA 4KN8A 3E81A 3CZ4A 5AVSA 3ZW7A 4H1WA 1CQZA 2RAVA 1YV9A 4I9FA 4NWIA 3WGUA 3FM9A 5AKHA 2MU1A 3N1UA 4NV0A 4G9BA 3B8EA 4UU0A 3WK4A 1U02A 3ZX5A 5ALWA 1YDFA 2C9MA 4UMDA 3M9LA 2HOQA 2C8LA 3PCTA 4BYGA 3WKBA 3A1EA 3AR7A 3BWVA 3OCYA 3AR3A 5AVZA 2FPRA 3NRJA 2R8XA 5AM5A 4HGRA 5AW8A 2CFTA 3ZTWA 2G80A 5IT0A 5AKLA 3L5KA 5AM0A 4Y2RA 5A3RA 3ZVMA 1JUDA 2NYVA 5AIBA 1ZD5A 2QYHA 3A3YA 4L6CA 5AI6A 4GIBA 2HCFA 3UMCA 1NNLA 1QQ6A 2FI1A 3J7TA 2B1QA 4GXTA 4UARA 2FEAA 1Z4MA 2FPXA 2FPSA 1WPGA 3HLTA 2RARA 4EX7A 3NIWA 3P96A 3KBBA 5AESA 5AI5A 5AIAA 1N8NA 3KOOA 4UAUA 2JGAA 4C4TA 5IS2A 2YJ4A 4C4SA 5AVRA 1YJ5A 5ALFA 2HX1A 4ZEXA 1Z4PX 2FDRA 4NAVA 4Y2YA 3WK5A 4DCCA 5AKJA 5ALPA 1RKUA 2I55A 2ZXEA 3L0YA 5AVTA 3W5CA 1Z4JA 1XP5A 3U7EB 2CN1A 2OA0A 3OCUA 2Q4TA 3W5DA 1Q92A 4Y2VA 2YMMA 1WZCA 1CR6A 3B9RA 2B1RA 5AVQA 5ALUA 3WK8A 2WFAA 2G08A 3W5BA 1Z4IA 4J03A 2JAWA 1Y8AA 3R4CA 4Y2XA 1L6RA 3PGVA 4QQFA 4OCZA 1NF2A 1TJ5A 1AQ6A 2EARA 3IB6A 2WF6A 4Y3UA 2I33A 3MPOA 5FP0A 2YMQA 5ALIA 3KZXA 3MC1A 3QU9A 4DFDA 2GHTA 3MN1A 4I9GA 3QU5A 1LTQA 2IA5A 3KD3A 4J2TA 3PGLA 3I6BA 5T41A 5AI0A 4EEKA 5ALRA 5AKXA 1L8OA 3RFUA 3NALA 4RETA 3FVVA 5AI9A 1TE2A 3SMVA 5AW7A 5AVVA 3U7FB 3WKAA 1LVHA 5AVWA 1QQ5A 2B82A 3FGOA 4PNHA 1U7OA 3QX7A 4HYTA 4O8CA 3E84A 4KYTA 3WKDA 3N8GA 3QLEA 5ALYA 5AVYA 5ALJA 5A3QA 5ALNA 4BBJA 4CF3A 2YMPA 2MU2A 4YIKA 4UAVA 4F72A 1ZD3A 3EF0A 3A1CA 1ZD2P 2W4MA 3L8EA 4OHFA 1RRCA 3ESRA 1RLTA 2AGVA 4HGOA 4AS2A 5AM3A 4XPZA 5AW1A 4Y2JA 2IOHA 3WKCA 3SF0A 1YMQA 4JDPA 5ALVA 4HGPA 1QH9A 2YJ3A 3ZU6A 2Q5EA 3QUQA 3AR9A 3QUTA 3KC2A 2P27A 1RKQA 1Z5UA 4MWOA 5AKEA 2B8JA 5JJBA 2GFHA 1Q91A 1RMTA 3L1UA 5AHXA 4HGQA 4NABA 3AR6A 2MSNA 5AKYA 5ALXA 2G0AA 3NANA 4YCLA 3WK6A 4EENA 1XPJA 2VKQA 4YIHA 4OFZA 2EATA 2C4NA 5ALMA 2HF2A 4IFTA 1F5SA 4JB3A 5AKIA 4Y2TA 3ED5A 3L8FA 4B6JA 2I6XA 2ZBGA 1O03A 2ZBFA 2G06A 4OD0A 2X4DA 3AR4A 3L8GA 1EK2A 3TLMA 1VFPA 5AI4A 1RDFA 3UM9A 1L7MA 2JAUA 3S6JA 3OCVA 3L8HA 3ET4A 4Y2UA 3DAOA 1J8DA 3FZQA 1Z4QA 3NUQA 2GO7A 2I7DA 3WK9A 1TA0A 3A1DA 1WVIA 4F71A 5AKZA 4HAIA 2FPWA 2W11A 2GMWA 3R09A 3ESQA 4XOUA 1ZD4A 1YS9A 4FE3A 3QU2A 2G09A 5AW9A 2OBBA 4Y2SA 2FPUA 4YCMA 1SWVA 5AM1A 4BNDB 1RPZA 4BX3A 1VJ5A 3DDHA 3L0BA 4NFLA 5ALTA
chains in the Genus database with same CATH superfamily
3G7UA 3HPRA 4HATA 4LXQA 1K7XB 4FC6A 3T9CA 1J2NA 1BD3A 1JIKA 3SLRA 1X1AA 3SD7A 1G19A 1YS4A 2E55A 1SEVA 1I0ZA 1JU4A 2CPRA 3OICA 3GGOA 3HR4A 3VYRB 4BBZA 4DCJA 4IIYA 5CVUA 1G8JA 1RWMA 2DT8A 3JRXA 1XSNA 1M2OB 3AB8A 3CUUA 3TJZA 3QGMA 2QLNA 4US0R 4TZ0A 1ADJA 4HC4A 2J7PA 3AG5A 3E22A 1EE1A 4WXPA 2AE2A 4XGRA 5DM1A 1CEYA 1RR6A 3I8SA 4JJZA 2JH7A 4KL8S 2DUMA 2H1LA 1R3DA 3QMVA 4CPDA 3TX2A 3KHSA 2HW8A 2IYVA 5ALEA 1QH8A 1OIVA 1FJ2A 1ZC3A 1JNXX 3G89A 5JRZA 3J81k 1DELA 3NR2A 4TX1A 3SI7A 5D87A 1Z00B 4JMUA 5KG0A 1JMYA 2HJHA 4L50A 4W5HA 4DEXA 5J47A 4L0MA 3RVMA 2ZJ5A 1EDZA 5CB0A 3W4JA 1C0IA 2C2DA 1G5HA 1T94A 5L1MA 4QQNA 3DPIA 4Y9DA 1ZJJA 2QSJA 2WHEA 5KT3A 1XMVA 4UD2A 3I04M 4F46A 1ECWA 1Y48E 2WSBA 1HSOA 3GV8B 4TYMA 3SJUA 3TLAA 4A27A 2YY6A 2WILA 4J9QA 3IE1A 1W4BA 3ZI0A 1Q20A 3B9BA 3RV4A 5JASA 1FDTA 4J9PA 4OREX 2IHMA 1I7DA 5H5JA 1G4AE 2CLIB 3K6RA 1UC8A 4C4YA 1XC7A 3QXGA 4Q5IA 3CT6A 3P52A 4WFKA 1DKMA 1X7YB 1IOWA 5L45A 3HZRA 3P9SA 8ICGA 4I1VA 5G0SA 5CR0A 2FMFA 1NR7A 1ULAA 3K2EA 1B7GO 4ZAXA 4HVCA 1CUIA 2VO1A 2IYFA 4KQIA 4ZVNA 3OOWA 2IOFA 4BMZA 4NE7A 3V55A 3AVXA 2EH9A 1G8FA 1OAAA 3OECA 3KWLA 4YJGB 3JQ9C 3W34A 3ZV5A 5CVCA 3KFXA 1I9GA 2D54A 3UGTA 3JPNA 4LE1A 1KMMA 2L2QA 4JFRA 4NBSA 4PGYA 3WY9A 1RI5A 5LQJA 5L40A 1IATA 2FH5B 5EUCA 1D2CA 3I5AA 3VI3B 5ALKA 2ZBDA 3GA7A 5ER9A 1QHIA 1OBFO 2WUWE 5G1NA 3S40A 3KKMA 4O6VA 3PSAA 1D5CA 3C3WA 4FCWA 4LZPA 3WLPA 4AICA 4EY3A 4K40A 3PWZA 3NBMA 4N18A 1UT6A 4TQUS 4KBYA 4OXXA 1B0AA 4OGWA 5F3XB 1ZH2A 3QFRA 4OFWA 5DJ5A 4JLBA 1MAVA 1A1VA 4X1IB 5B6JA 2QL9A 1OC4A 3Q8PB 1T3ZA 1JAYA 2C4TA 4EHKA 1HI9A 4RQ4A 1FMCA 1Z36A 2COKA 2X13A 4I8DA 3T0FA 5IG2A 4YRCA 1C0PA 1CQWA 5J2UF 3GZJA 4KLJA 4PQRA 1JZSA 2EANA 3QKSA 3EPRA 4XRHA 1I5EA 3O1JC 2H3VA 4J9UE 4UDXX 5KYYB 4MW5A 4OX9B 4M1SA 1FFAA 1S4MA 1YQDA 1C4KA 3HCPA 2QUBA 5C9ZA 2IIPA 1R5NA 1HA3A 3DDZX 7ICOA 2ZRAA 1P91A 5KBYA 3BCHA 5K8IA 2WF7A 1JQLB 2CKDA 1FVXA 4C4ZA 2H7YA 2QJTA 1QJ4A 3R24A 1TZ2A 3GLGE 4OB6A 2GRUA 1MO4A 1VPDA 2X2FA 3WGKA 4D96A 1AHIA 3DLBA 1D4AA 2W8LA 1HUOA 3AESB 4BNHA 2PXXA 2Y93A 3FIUA 3HO6A 1JT9A 4DL6A 2O54A 1QFYA 3O94A 4P5PA 1DDIA 1U5CA 1T2NA 2H1SA 4KNWA 3UC5A 5FQNA 4AECA 1DC4A 1G3UA 5CHGA 2VTVA 1RAIA 1Z06A 7ICRA 1H42A 1MQAA 1LQ2A 3C16C 2BPFA 3LLMA 2PN1A 3Q3IA 4OSOA 3HR7A 2E5LB 1L7EA 2IHNA 3GRCA 2RGCA 2VAPA 4QJ5A 4A03A 2WD9A 1CZNA 5BSHA 3F5MA 3U19A 2FFRA 3M0EA 2RH4A 1VZ2A 3D4IA 2ID9A 3PNSA 4MWCA 4MQ4A 1S9FA 3VR2D 3THYA 2O8CB 2V0NA 4LJ5A 1ONPA 1FYEA 4TMFA 2W7TA 1TK3A 1UBEA 2RG7A 4MRAA 5JJ5A 4F8RA 3BRCA 3U7QB 1WLSA 2QD2A 4NQZA 3JTMA 1K08A 2JJ1D 2IOFK 1U45A 4PIMA 3I2HA 2GLXA 1T2FA 4RS3A 3A1SA 5ITSA 1GRVA 1SU4A 1R8XA 3VR4H 2YKGA 1ZD8A 4NPHA 1CI4A 4BJ3A 3HP6A 1DKPA 1KVUA 3W6NA 1OAKA 5A4MS 2OCYC 1KMNA 4ZCRA 2XRZA 1JBQA 1GFWA 1CB7A 2HI0A 1FFUA 2PRKA 4X91A 4Z6CA 3JZMA 4WFQA 3BE6A 2YWFA 7ABPA 5COBA 3W9UA 3N5KA 2OCKA 1THGA 3FOBA 1O7JA 1YR1A 2PBFA 4EQZA 4D5GA 2QVGA 1FSPA 4P7KA 4HTFA 4LQLA 1R4NA 4RF5A 1N2XA 4LSWA 1SVNA 4V0LA 4RIHA 1TO1E 1G8YA 2ZLBA 1GNPA 4UMVA 2Z95A 3HJHA 9ICMA 4KSBA 1ZR4A 5DHFA 2J3LA 1WR8A 3GFTA 1W36C 3GFPA 5JLJA 1G7CA 1XO0A 1F0MA 1CRQA 1FXWF 3DBHA 4TV9F 4KLMA 4JEIA 5DTIA 4NS1A 1CUXA 1VG1A 4QGHA 1ZGCA 1RKVA 4UW9A 3BB4A 3BH7A 1EBFA 3ASZA 3OM9A 4FYMA 4GKAA 4L4SA 1J9GA 2VPQA 3O8RA 3EBPA 3GIIA 4IXMA 2AI1A 4QOSA 5TZVA 1L5VA 1Z0FA 1P7YA 1TGVA 4PZEA 2R68A 4DRXA 4RO0A 2F3UA 4C3OB 3OPXA 5C35A 5JQGB 2NPFA 5DGCA 1X0VA 3I0ZA 2EZZA 5KAIU 3H40A 4ED0A 2LXNA 3RJ5A 1EX7A 3EQ8A 3LRPA 3TN7A 3WWDA 4D9JA 4D8VA 4KUGA 2IU0A 4DLVA 3AL0B 8ICOA 5HIKA 5ILGA 1B93A 4HFMA 4IXDA 2Y4NA 5LA6B 1E7YA 4MR7B 4Z7NB 4CHTA 5IIKA 1DKOA 4R2LA 4B6FA 1OBVA 5D7BA 2DFLA 3U7QA 3EIUA 1DO8A 1RZTA 2PTGA 1HDGO 4NCHA 3G2NA 4MIKA 3MSXA 4UMEA 1H2XA 4H3SA 3NRZA 2RB5A 2WTFA 2IY9A 3G0GA 5J2KA 1G5QA 2A5FA 3T3MB 1E32A 3IQHX 3RSGA 1T3HA 2CLCX 1K1QA 4J6EA 1FQJA 4MVJM 2JFYA 5E3IA 8ICIA 2BFEB 2GPTA 5AKHA 1OROA 2PIDA 1KR2A 2B4AA 4P53A 2AGPA 4IVRA 5J5VA 3RIHA 3UOAB 3I62A 1JAZA 5KHOC 5KFQA 1SPXA 2HLNA 1L9KA 1R8QA 3IXMA 3L4BA 3V6LA 4CTJA 4DJFC 3HEBA 2A1IA 4L3OA 2ZULA 5AO9A 1JA0A 1Z0AA 4WH0A 1DC7A 4KIFA 1KP3A 1O94C 2VJDA 4EECA 1N5IA 1XTIA 2E37A 4YPVA 1O5OA 5DM70 3T7AA 3TGPA 3NVZA 2B8WA 2SCUB 5J0QA 1KRWA 3Q41A 3H1FA 1GXSA 1JEEA 2NU7A 3L2OB 1EVLA 4FGKA 4N3CA 4GD3Q 1FYVA 3DULA 3AR7A 7GPBA 4WA8A 2GD6A 5DWVA 4OBWA 5F9NA 1C4XA 5BSEA 4HLDA 1IJBA 4QGGA 1LUAA 5FI5A 5BNWA 1P18A 1G8HA 3VZQA 4LZDA 5AKLA 5FPPA 2KSOB 2HDHA 4BEBA 3LW7A 1S3GA 4C01A 4D98A 6NULA 3AJRA 5I9IA 4DYHA 5WRFA 5JVDB 2QYHA 1UP6A 4KQWA 2BZ0A 2C0QA 2I4RA 2V7BA 2FWNA 2X77A 4O5EA 5FV7A 1Z2OX 5M3BA 4YT8A 1H3NA 2HHSA 1W6UA 4S1OA 2VH1A 1V3TA 1QBKC 4WY8A 1SOVA 3J7TA 3M9XA 4MUXA 1YQXA 5DLQC 4ZZIA 2P5SA 4GXTA 5MN6A 3TKAA 4FEEA 4QGBA 3PFFA 5ULLA 2PZ8A 4OPMA 5EAIA 4E6PA 2GJSA 4Q6WA 3HLTA 4BJ6A 1PFQA 2FWJA 4DL7A 3OIYA 3INGA 2HYIC 3T4UA 3GWZA 4XFDA 5CM9C 5AESA 4D4HA 4EHDA 1OBCA 5F1PA 2DSNA 2HN9A 3BWBA 4LI0A 3L9WA 3VYWA 5HQTA 1KKLA 1D9DA 1H1DA 5D3KA 1AKYA 2E4YA 1GGMA 3PQ6A 3IBFA 5AVRA 721PA 5AJWA 3H2SA 5K6TA 1Q1AA 2R8OA 1RRGA 4NYMR 2P2YA 1Q0RA 4BMOB 4LN1A 4KPYA 3JV7A 2NUTB 4HQ0A 4QUDA 4R6XA 1I2MA 3DW3X 4RIGA 3P9PA 3BIXA 1Z4JA 2VAVA 8ICBA 2VJ5A 4PSKA 1CETA 1OE0A 1K63A 3HKDB 2IY7A 2QTGA 3QF4A 4GLJA 1FO4A 1WZIA 5EMMA 3BDVA 4R8MA 3H9CA 4YRTA 4C89A 3HJCA 3BEDA 1Y81A 5DLGA 1QO0A 3B70A 3OIDA 3ZZTA 5L8VA 3FBWA 1V7QA 2SBTA 5FD8A 4RTRA 1UAAA 2X4IA 4R8VA 4CG2A 5F7OA 5BW5A 2KJQA 1R1DA 2VP3A 3F7NA 3MUEA 1ZQZA 1QK3A 4YMWA 1AMOA 1UP4A 1MG0A 4GMDA 2OYRA 2W4IA 3U1BA 3I5MA 4DUZB 4OHVA 3RS4A 5BN5A 4R1NA 4QOEA 5E9AA 1OU0A 2EARA 3IV9A 4LJ9A 5KNCD 2JLVA 2IYPA 1PT9A 4FKBA 3E9EA 5C1BA 3RWOA 2KVSA 1N5OX 1CZLA 1S10A 4F3OA 2AG1A 2W22A 3K6JA 3PUKA 4IIFA 4OYLA 3SXUA 3OP4A 2C7RA 1Q1BA 2ACKA 3HKEB 4C0WA 4PN3A 3AVWA 3MN1A 3L1JA 5FLXA 3G0HA 3KB2A 2BELA 3TZQA 2Q8QA 4F50A 1KDPA 1XKQA 2A9OA 2Z2KA 5PNTA 1PQWA 1CSEE 3GZTB 4MO2A 3CLTD 4RJKA 2RG1A 5EIFA 1CUWA 1Z0KA 2R7NA 2NV3A 2DWOA 3WGJA 5KOHA 2NMVA 1NASA 3C5GA 2EJVA 3P0HA 1W5AA 5FL7D 4OYRA 3S70A 3KQNA 3NALA 4PGAA 2QUZA 4C03A 4IQFA 5TQVA 1TCCA 1DBVO 1GEGA 5DO9A 4D6YA 1JBKA 1WW3A 1QVRA 2H8GA 3OZRA 3QMWA 4LKOA 5EMLA 4E12A 2VHVA 4BNUA 3HLYA 3KQVA 5GPBA 4DS5A 1YXMA 1MNQA 3OQIB 2YFHA 3FTNA 1HG1A 1SVKA 3RUFA 3H4TA 1MENA 1TAGA 5CYPA 4IIVA 5C5IA 3COWA 4BLUA 2AT1A 3IBTA 3WLSA 4AIRA 4NLCA 1QGOA 4OJKA 4JVSB 5A4KA 3KKLA 3EDOA 1XZMA 1YS1X 1ZH4A 2CW5A 3KEMA 4PFJA 4RKEA 1DAHA 3AJDA 3ESRA 1SQFA 3EIEA 3G2LA 5GONA 3SX4A 2SKCA 1M34B 1L7DA 3QW2A 4IJ6A 2OGSA 4P34A 5LWQA 3EG9A 4EJSA 4GW3A 1Z83A 2D4AA 5F77A 4EQ6A 4DQQA 1XB2A 3COZA 2QPOA 2ZUEA 3QI2A 2B99A 4KLRA 4W9RA 5SZKB 2X5XA 4GDFA 5C32A 3K9GA 3IBSA 3Q7PA 3QUTA 4Q4AA 3K0SA 3OFND 4XR9A 3AZOA 3FR8A 2OLJA 1ZKMA 3IS3A 3LW8A 4JGBA 1EM6A 2XO7A 4GOXA 4BQPA 3PHGA 2L5YA 3QV2A 1GAEO 1XVAA 2AG6A 3BMQA 4HGQA 4ESEA 2LKCA 4LFCB 2VP2A 1ORRA 3A0BU 1G5RA 3MJSA 3NANA 3JR3A 3OZGA 4HMOA 1C7IA 1EXDA 1Z0ZA 1HX7A 2CYAA 3O0TA 4J07A 4W82A 3Q8MA 2PH3A 2QG6A 1W5FA 4ZARA 2JFUA 5F12A 1XLTC 1LW6E 3D0QA 4YRPA 2F00A 2W2KA 4Q19A 2HRBA 3MUNA 5F9LA 1TKBA 4NBUA 4R1LA 3SEFA 2AF4C 4C3ZA 1QYCA 5HF6A 4Z6FA 3AOEC 2BHRA 8ICNA 2DBRA 3FUVA 3VUEA 3WLNA 1ECBA 1NT4A 2RKOA 2D5IA 4CDGA 4ARVA 1P74A 1MO6A 2WEKA 1L3IA 3H11B 3HO8A 2XOKD 4MGHA 5K6AA 3DPUA 1NSTA 2AEMA 3FGPA 3L6EA 4L0CA 4Z9AA 3PS9A 3ISJA 3JAKA 3KYDA 1EJ6A 4GC5A 4M0KA 4ME6A 1RXVA 4RTKA 4OTZA 4TS3A 4PF1A 4MEBA 1GGFA 1OZGA 3JSXA 3L82B 3UTCA 3OO1A 1RE1A 4DE5A 2HDWA 3UXMA 3INYA 2F64A 2QKYA 1QYXA 3CRZA 3OPMA 4GQAA 5EJMA 1P6XA 2EGGA 2I2BA 2JIRA 3G6VA 3NM6B 1E7RA 2J3HA 2VHUA 1H6BA 5HBRA 4FS8A 6PFKA 3GT4A 3OMXA 1OGIA 3RB3A 3KE9A 1DAGA 3R09A 4ND4A 3ZWWA 5KYWA 1GR0A 5IM5A 3HK2A 1R0WA 2GAAA 3OT1A 4NIMA 3DZFA 3BREA 2Z3VA 5JMOA 5AW9A 2RHJA 4G5SA 2GN4A 4RZ2A 3GQCA 2CFOA 5DFAA 5IT9A 2Y0CA 1QDLB 5UKDA 4LG1A 3C7TA 2IOQA 3UQ2A 1XA3A 1NVGA 3GFVA 5EZSA 2PGLA 4CMCA 5EJAA 2FETA 2I1WA 3C8MA 5TMDA 1WKCA 5A71A 5TQ2A 2QUAA 2XWPA 1NUQA 1YOVB 1GVNB 1JDUA 4I2CA 1X87A 2YV1A 2PGJA 1ODCA 4MIYA 4ENPA 3K92A 1JT2A 1BH6A 1H2BA 2FLLA 2JGIA 5DSTA 4ZOEA 5C18A 1OVMA 2ATLA 2ZRFA 2OILA 5HKKD 4QIWF 1G5IA 1OT3A 3AHJA 1XRSB 2ZITA 4BNMA 5BYKA 5HQ3B 2K4PA 4KX5A 5IDXA 1MAUA 3R6DA 1N5MA 4Z7JA 2WF5A 1AGYA 1RYRA 4EUHA 4Q43A 4UNQA 4BB5A 3TRHA 4MULA 4Y7CA 3WBKA 1N7GA 1T5OA 3CKLA 3Q3GE 3Q6NA 1GM5A 1NVAA 1PV2A 3X43A 4LSMA 3O6VA 4K9QA 4UCFA 4F2GA 5MF6A 4Q3EA 2TYSB 5JISA 3C2LA 3V6HA 1S2MA 1Z9BA 4JLMA 4QBKA 5CR9A 5IJ9B 2WIGA 1FS4A 4ENWA 1CB0A 2HD4A 1VGQA 2FG5A 4DHEA 3F49S 4V03A 3PRKE 1KIFA 3LQ4A 5K5EA 4Z1MD 1XZKA 4BNFA 3BJMA 3H9EO 1XR3A 4WKOA 3FOZA 3WGYA 4OOFA 4MRNA 2W2MA 3FUXA 3LLSA 1WDKA 4XA8A 5IVHA 1X74A 3GVIA 5H82A 5A3SA 3NVMB 2P6PA 2W2XA 3X3HA 1B4DA 4UB1A 1F9EA 5IZCA 2LW7A 2C2EA 2HIMA 2FHPA 5KTPA 1UXIA 2J5BA 4B0PA 4NJEB 1QIMA 3EEQA 4NV1A 1EM8B 1KPHA 1E3SA 1JLLA 1PGJA 5HBGA 4RV9A 1GQYA 4KXLA 4PZYA 1JGTA 1H2FA 5FL3A 1RXYA 3CX7A 3TW8A 2BAGA 1Q7EA 3FYTA 4NAHA 3LKDA 3G7NA 4NR0A 3VNQA 4C6TB 4CKCB 4XD7A 4C2UA 3OCZA 3TFSA 3FTPA 1LX6A 3B38A 4J9RA 4EZEA 2ZRBA 3CBGA 3ZU4A 1F6BA 3BL8A 1HG0A 3L01A 3H2BA 3HBFA 4C7XA 4KQ6A 3GGJA 2C4HA 3K2QA 2VWQA 1SCKA 1FSFA 4GPIB 1RWKA 4KE9A 4YGYA 3QXSA 3ZYZA 3D1LA 3GJXC 3HHEA 5L3SB 8ICSA 1YCGA 2VI5A 2VCHA 4D8UA 4MVYA 1JVSA 1E9FA 1ZAKA 4KDFA 3I9MA 2V6JA 5KFNA 4NMXB 3OQPA 4I9UA 1GSOA 2OL4A 1CUEA 3G5UA 3TRJA 3ET5A 1TJ4A 1K0UA 3ILYA 4J1QA 3R9KA 4QDZA 4Z0TA 1S0UA 5HQ3A 3GIMA 4IMJB 3VO1A 3WHIA 5BWNA 3LRXA 1JHUA 1CUAA 1KY3A 3FPHA 4EF6A 4CQMB 5IPFA 3VOBA 1YZFA 1W88A 9ICQA 5ALDA 2EFHB 3TCXB 4ED2A 2FUCA 4XSGA 2BPGA 1U2SA 1BOOA 2VPIA 4YCAA 1ODSA 5J9FA 3CUEF 4RJTA 4Q1VA 2WJAA 3MBIA 2C98A 1UZLA 5J2TF 1LA2A 4RCVA 4DZTA 2PS1A 4PLHA 2YXPX 2GI4A 3WSVA 3HJAA 2IRWA 3GJ4A 5HUHA 5I7UA 2J48A 4DANA 1PK1A 1Y1KE 1YJQA 2B9EA 2EJWA 2MSCB 1JPUA 2WM2A 2XUHA 3EYWA 4BKMA 2OAEA 1AXRA 4F2HA 1WVGA 1OWOA 2KJ5A 4J9KA 1SQ5A 1Y8RB 4WEOA 5KJCA 1GNQA 1O9HA 1DX9A 1HWYA 1TVCA 1U31A 1ZRMA 1SG9A 4A15A 3H83A 4O9MA 2Y68A 4LV6A 4FN5A 4RV4A 5D5PA 3EEFA 4ZO8A 3TAUA 3E27A 3F5QA 2QGFA 3SENA 5LP1A 4DV2B 2X6QA 1H23A 3OLZA 3GFOA 2I4NA 1SO8A 3GH3A 4HG2A 2A9QA 1L7AA 4FJ0A 4HYEA 1JJIA 2P9TA 3RKSA 4CV1A 1YZUA 3OI7A 4FHDA 4JEMA 2W2LA 5DQGA 5CFQA 1GTRA 1QR6A 1YKFA 3QSYA 1OXMA 1KRHA 1U4BA 1EVJA 3JQ6A 4ZEMA 2FR0A 4ENSA 1PEYA 3OETA 2PT9A 3LWLA 3G2KA 2IP1A 4GM1A 1K66A 4ZC8A 3USZA 4GF5A 4Z5XA 4PU0A 1KZ7B 3BD8A 3D6TB 2A0XA 2VS1A 3GJ6A 3G6KA 4HP8A 3WX0A 2AEJA 4E2FA 1E7MA 2Q3DA 3TX6A 2ZIWB 3PYLA 3QPUA 5F2OA 4BCBA 4EPYA 3VDNB 2LM1A 1KDHA 3F6EX 4HNRA 3R3XA 5FQOA 1M0EA 4XJVA 4AZ3B 3LVVA 2NO7A 1PF7E 3JQFA 3UBTA 2RHDA 3KQQA 3MHTA 1ISIA 4POAA 1V3QE 5AHWA 3VDMA 4N12A 3RT7A 1SPBS 4H6XA 1ODLA 1PD0A 1WM1A 2J9GA 3R4VA 2PUVA 3SJAA 1AA9A 3SQNA 1SL0A 4TWJA 4BFYA 3PYMA 4XI9A 1NUPA 3ZIAD 1KEJA 2H3EA 3C5HA 1SQ6A 1OAOA 2J4DA 2HFKA 2I87A 4BZWA 4HTFB 4YP3A 1N5KA 2C8KA 4IV5A 2BDUA 1QSSA 4IUBS 1BJKA 4U2DA 1DJMA 4FT4A 4J0QA 2JFGA 1ICIA 4LWQA 1UK9A 3RYHA 7REQB 4F92B 4H7DA 1WZ2A 4QJIA 4M54A 1N0IA 2ERXA 2P6UA 3TUJC 5G5HA 1S8OA 1EK1A 3MBOA 4B8ZA 2GUWA 3EQ6A 2ISQA 4MJ3A 4OG2A 4NY8A 3PIRA 5EE1A 4DPMA 2RDJA 3QWHA 4CT0A 4E22A 1FIUA 5FWXA 4MNTA 4JJ8A 1NGSA 4JNCA 1IRXA 4LECA 4DRXB 1IN1A 1X8JA 5J0WA 3O4JA 3EARA 1A7AA 4JKOA 3H2KA 4MW0A 2ZIAA 2A67A 2Q0SA 4LMPA 5D01A 5DNWA 4MGKR 4EPRA 1AUPA 2DQSA 2AB0A 2XQJA 2O2EA 4N6GA 4DF8A 2FE4A 1NZJA 5FWDA 3SAJA 2DPIA 5KDLA 3MT8A 3QXHA 4NH4A 2FXVA 3SS7X 1TJNA 3T7EA 1I4DD 3PQ5A 4C6RA 1KSPA 3HDQA 5BWCA 4BFXA 3T1QA 3E4DA 3TNYA 4F9FA 1KAGA 4KPFC 4GLLA 3L0IB 4I4TA 3P19A 4O4IB 1S2GA 2Z56A 5LN1A 2WT9A 3FJ1A 1TMKA 3K3PA 3A4MA 4P3KA 2J59A 4YRNA 1ML3A 1DIBA 5JRDS 1OX4B 2VC2B 1NW7A 2Q6TA 1E5LA 2RIRA 1L3SA 2QRKA 4DSEA 1BX0A 3QWBA 4P80A 3WLRA 4NWIA 1VE5A 2A0WA 2QTHA 1IVSA 3FAHA 1Z7YA 1TTTA 1AUVA 1JR3E 4G67A 4JBYA 1YBMA 2ZRLA 1U11A 3NP7A 4G36A 4GMHA 4TLLB 4TMZA 2BCRA 3M4ZA 3C98A 5D1HA 1WSWA 5DHUA 4UHBA 4ERNA 3G2JA 4FLMA 3EVCA 4UNPA 5TLSA 1O96A 4E33A 1KKUA 2GEJA 2GK3A 4JBXA 2WIDA 3RYIB 2XUAA 5CM2Z 3MGKA 3LDHA 3UJNA 2PZLA 4I8IA 5U9CA 1II8A 2BP7A 5BW4A 2XY5A 5KT6A 1MT3A 4DR7B 1KRPA 4KPEC 3PG5A 1ZOSA 2BEUA 1D2AA 3OEWA 3MSCA 5IBPA 4JV1A 3H0MB 1ZZGA 4ED8A 1P2UA 3GY0A 5G0VA 5ISMA 1JFFA 3RRXA 4NMMA 4QW8A 3RFTA 5AUNB 3CZ9A 4MV7A 3IOMA 1XDZA 3E7FA 2IUTA 3B6IA 4H15A 2P68A 2Y27A 9LDTA 3DZJA 1HTTA 1H94A 2HHXA 1LCIA 3INRA 4ZMBA 2XB8A 4PL2A 2JCSA 1T4CA 1XEXA 4RF3A 5AHKA 5LDHA 1U1GA 1PEDA 1P1BA 1UPCA 1OWPA 4LCJA 3K05A 4TWZA 5EJIA 5FR1A 3ND7A 5HFAA 1USKA 2FTKE 2W6QA 4UCQA 4B9EA 4RVHA 4HLUA 1ATIA 2HHJA 4XVRA 3WJAA 4O2BA 1OWMA 1X7HA 2HWKA 3IAS6 4G01B 2AMVA 2FPXA 2VHXA 4LDZA 3M83A 4UUOA 3UFBA 4P2HA 1A7JA 1G4HA 2PKCA 5CH5A 1VSBA 4YJ3B 3WZ2A 2ASLA 1B76A 1ORWA 2CLDX 4IIXA 5I7EA 2P8SA 4MP3A 5EMJA 3NVVA 2J9FB 5C0OE 1PJZA 3QVSA 4FDAA 2G82A 4XRGA 5HS4A 5DB7A 3SG0A 1RNLA 2OD9A 2PX3A 3GCDA 5I5EA 3T3IA 2OH2A 3ROQA 1NJXA 3GGSA 1ZVKA 4HT3B 4Q00A 1GV0A 2Q0QA 1EUDA 4GS5A 4QGFA 3GV5B 3SXPA 1Z4PX 4C7MA 2HH9A 3AVOA 4IDPA 2FEMA 4BECA 1I7SB 1RKUA 1GNTA 3LHFA 4D9KA 5L6MB 2O2CA 4NJMB 3U9LA 3EGOA 5CNIA 1RIIA 2QDKA 2X14A 5FUVA 3LTNC 3RBAA 4U5XA 1Z5WA 2ZIUA 3NI2A 3RUDA 3JCZA 5D85A 3EOAI 1Y80A 2QRMA 3R0IA 1M2EA 4J0JA 4U7GA 3RREA 2N1MA 1IUNA 1CR6A 4UKDA 5AVQA 4OLAA 1IOVA 1JR3A 1OASA 3ANXA 3LCUA 3Q1LA 3VPGA 4NMWA 2Q8PA 2A7QA 4B3IA 4J03A 2OMKA 5JWOA 1LTKA 3V8EA 2HMXA 3BJEA 2O1EA 3DQPA 2RHWA 1JFFB 2C82A 3MCTA 3R3JA 1O87A 4ML3A 4IV0A 5LQNA 5D4BA 1RKBA 5KI6A 2II6A 3LWDA 1XA0A 2BTQA 4PO9A 4F8YA 1DJQA 4IILA 2FPPA 2HT6A 4PPYA 4EW1A 4B9AA 1V8PA 4H77A 3IPAA 3RS3A 4FI3F 1GTG1 4G1MB 1A5SB 1ORHA 2EQ5A 4DY6A 4G25A 1RTKA 5KYKA 3DD1A 1AKMA 3D6FA 2J6HA 1I1HA 2BFMA 2YIVX 4R2JA 3CO5A 4U9UA 3SBXA 4DCNA 3ABZA 5KHLB 2AJTA 1BH2A 1O1YA 1WCIA 4CM6A 3ICVA 1G20B 1RYEA 4ZU3A 1T3LA 1GYQA 4DV1B 2RONA 4CM4B 1P5ZB 3JD3A 3SIWA 4F9TA 1KPIA 3OF2A 2HUPA 2IU3A 5CK5A 1TM3E 2XF8A 4IGKA 1YDMA 9LDBA 4TLBA 3AF4A 2BFWA 3TQTA 3Q3HA 3DMYA 2FGKA 2JFVA 2C5LA 2MWMA 2X0NA 3GX1A 1PV4A 1PJCA 2FW6A 4ARZA 4KFSA 1TX4B 3D1VA 3FPGA 3MTAA 5A3QA 1BRMA 3KZCA 3PUHA 1JLRA 3GJYA 4M47A 3FH0A 2QTRA 1ZYUA 4P35A 4MVJA 4R8SA 5J2JA 4EBDA 1M1YE 2KIVA 1VCIA 4UVIA 4CLEA 3RAEC 4DV5B 1K3UB 3DCJA 5IKOA 3VHXB 4C0BA 3IOCA 3FUTA 4HWKA 4L08A 4MV6A 2QWXA 4AX4A 1JYSA 4YUVA 4WBXC 4TS1A 5J1TB 5LR6A 1AMNA 5IVKA 2QXYA 2Y1KA 2P79A 5D3ZA 2ZI7A 3O2SB 3NWBA 5F9HA 3RJGA 2IZ1A 3MIZA 5CB4A 1FP4B 2NRZA 1HE3A 1O95D 4N6NA 4CV2A 7YASA 2WA2A 3U80A 2ALJA 3MTGA 3ETCA 1DDGA 2CZCA 4QUAA 3VR4A 1PJRA 3Q72A 3ZU6A 1QU3A 3ROEA 4KYIB 4XW2A 4D3XA 4X71A 3BUSA 1Q2XA 3JW8A 5T3UA 3RVKA 4XRRA 4KLQA 4O08A 2B94A 4MWBA 3RWMB 1V9PA 5AKEA 1Q15A 1GUYA 3AL2A 5GQSA 2A4KA 3C3PA 3I9NA 4F5RA 1CV2A 1XD2B 3MS7A 3OZUA 1CUUA 4O4JF 1H9BA 4AWXA 5BV7A 1IB0A 2ZDQA 1GYPA 4L2IA 1WW2A 3U17A 3IBCA 3N76A 4RPZA 1U2RA 1W76A 2R6JA 4FJ1A 5H3HA 3KSUA 3LCRA 3JARB 2WUEA 1ECPA 1TMGE 3UAVA 1JG6A 1KYIA 1P62B 5JATA 3F7MA 2GNAA 3DE6X 3GB9A 1WCIB 2KWIA 2MT9A 1GL3A 3G8AA 3R3ZA 4UPDA 1MFZA 5CEHA 4Y9SA 2F55A 4IX9A 4I2EA 1IPHA 4B6JA 1GLNA 1V2HE 4IQUA 1ZQUA 2B34A 2V7XA 4TL7A 3W6UA 4CMAA 2L0XA 2WRZA 4LCEA 4C7KA 1OOEA 1T1GA 3GLKA 3NT4A 4OQPA 2NU9B 3Q3VA 3DYIA 3SQXA 3C2QA 5DOVA 4IOKA 2A5GA 2P6RA 1LBTA 4FYXA 2IWHA 3ZE2B 3PKJA 2Z83A 2JAUA 4M8KA 4ZVSA 5C34B 1R15A 4OJPA 4PS0A 3DAOA 2PD6A 3K8OE 3NUQA 2GLTA 3PPIA 3QFFA 4CM8A 4COOA 1I3OA 4OHUA 5K20A 2O2ZA 2AC2A 4QEKA 4EG3A 1XCBA 2BEJA 3R23A 2GYUA 2G5TA 2W6NA 4QLAA 3CB2A 1W4AA 2HC9A 2VKTA 4Z8YA 3MWEB 5A0TA 2K89A 1T2UA 2GD0A 3IESA 2IEDA 3V8PA 3L93A 3VPHA 2CXNA 1IVYA 3O1HB 3ZI7A 2BISA 3ZDEA 4RTPA 2ZDGA 2UDPA 2NACA 2CDCA 4KXFB 2WWVD 2OB1A 1WUKS 3W9BA 1N9GA 4BNIA 2B6GA 1JLHA 4EPWA 1OH6A 3LTEA 2DM6A 3ESDA 3RYCB 2WA1A 1EFAA 2G09A 1Q3HA 2QRQA 3GJ5A 3QKIA 4ISBA 5KNDH 2XTJA 2UU9B 1QIGA 3F53A 4UNSA 4OHXA 4B1FA 4F6CA 2A33A 1SWVA 1US8A 3W5HA 7ICHA 1R0CA 2XUIA 2ZE7A 1DU4A 3FOFC 2ZE8A 3DP9A 4IZIA 2GZSA 1QQTA 2CNKA 1Z0UA 1ACJA 3BGWA 4NFLA 2J0UB 4XIIA 1ZM2A 1SV4A 2WIAA 3ECCA 5TGDA 1N75A 4KFRA 5HFNA 1L5NA 1NU6A 1X3LA 1A9TA 1YNSA 1MDBA 1ZS9A 1E0DA 1SD5A 2VDKB 4HQ6A 2DFKB 3KTDA 3MWDB 4JJAA 1JYEA 4JVMA 1IOLA 4LPKA 4TVOA 3RBZA 5JNLA 2RAPA 2AWNA 3TW6A 3DA8A 1Y6ZA 2H1OA 4U7PB 1RJEA 3MRVA 3ZHVA 1M2HA 3KL2A 1R16A 4UM5A 2HK9A 2XXAA 1WBJB 4GKKB 3H8WA 3U7GA 1SIJA 2EKDA 3E61A 1NG1A 5DF1A 4KLIA 3C7DB 1J2TA 4E07A 5B4UA 5KEIA 1KJWA 2K8CB 4RXMA 1DXHA 1PNTA 5FLEX 2VRBA 1SXJD 3IILA 5FBWB 1NZPA 5MGBA 1KAQA 4MJLA 3PPVA 4X7RA 5F98A 2COEA 4FFDA 3IVGA 4NY1A 1COOA 5DQHA 3RUIA 3FBTA 2HMAA 3K70B 3EIXA 2QN1A 4URHA 1SC4A 1VXOA 3GROA 2O7QA 1R0YA 2YB1A 5CRXA 2IHYA 3I42A 3ILVA 4FW8A 4KQ1A 1VJ0A 2CXXA 3UAGA 4MAFA 3OQIA 4ZO9A 1PWYE 4RAOA 1BFDA 4D1YA 4ECYA 3F6CA 4RD0A 1U2TA 3WV4A 5LWHA 2VN8A 7ICTA 3E2EA 1LDBA 3NUGA 3UMVA 2OT3B 2PLNA 5EHIA 4JI2B 1FMFA 1ES9A 1K6IA 2C1XA 3OURA 4LGVA 4EPVA 1KI7A 1KBUA 1KAMA 1UR5A 2QU7A 3EXHB 4Y0AA 2X6TA 3O1LA 1DJOA 4OQ4A 4YUWA 5J2TA 4EZ9A 1TLFA 2C2BA 3H6HA 1JSRA 3ONWA 2E87A 3U7RA 4A26A 1YVDA 1D6MA 3U3DA 2RGXA 2DR2A 3RJKA 1JLLB 2FVYA 5CURA 5K0TA 1QC5B 4N7JA 2IVZA 2J3JA 3BSYA 5K8LA 1EU1A 4C29A 2V7PA 5ELXA 2O5RA 1NK8A 1F7VA 4RV5A 5KSYA 1UFRA 5KHAA 2DPYA 1JJ7A 2BSXA 1T1EA 3MVEA 3KKEA 2BDEA 1MEJA 5DVZA 3RSSA 3QYPA 3SOPA 3DYVA 4R5HA 4D57A 1UJBA 4BOYA 3RUCA 1ISJA 3R3VA 5K05A 3GMTA 1YZYA 4KVGA 4EMSA 4FUTA 5KDOA 3JPTA 2G72A 5L4NA 1YZGA 3MLAA 4IJQA 1KS9A 1AQIA 4AP9A 2JHFA 3CZCA 4NX2A 1WYGA 2PCJA 3FCYA 2ORVA 1Q46A 1ZH6A 1TK2A 3W5AA 1SC6A 3ENVA 3R0JA 5TVKA 1SFRA 3ABQB 4FIDA 1GTMA 1HQDA 2WPNA 4ED7A 1X94A 4B9TA 3U60B 3BA6A 4QVKA 1X2EA 1E2MA 3R3YA 5NLLA 2ZSUA 4BFWA 4QZDA 2Y9UA 1UC4B 3EE6A 4FMDB 5E1DA 5B1YA 1TQ4A 1QONA 3OVMA 4RWZA 1BPEA 2G67A 3BWYA 3B6KA 4KRFA 5EVJA 5LCXA 2Y99A 1T2CA 5G4KB 4D9CA 4WLOA 4M83A 3FFXA 3CBQA 4JP2A 4LX0A 5TRTA 3FWHA 4WXMA 1C2TA 2AG5A 4FBLA 3MJEA 2DHEA 3AONB 4FBGA 1WNTA 4HPXB 1CHNA 4J8PA 4X6UA 1GNVA 2X0FA 3SJZA 3GFRA 2BWJA 2KB0A 3BK7A 4FE4A 4WOBA 2QVZX 5BQOA 3O8OB 3QLVC 1GV1A 2PRYA 3TCNA 4R1PA 1KYWA 4ZKEA 4M1MA 1A8SA 2H1HA 3GRUA 3MMSA 1GTSA 4QW9A 3Q9SA 3IH5A 3KR2A 2PVSA 3M81A 4NE2A 2FPIA 4N9WA 4DR5B 4EHNA 2QL7A 1YS2X 4A8JC 4RTLA 3PQFA 1OF1A 5K8TA 1XMPA 5FL7A 4EY7A 3CW2C 2C4KA 3SFVA 1H2RS 3FRJA 2DKNA 1E58A 2H07A 4LVCA 4D9GA 3TK1A 1B00A 3W78A 4LJKA 1MP0A 5JQGA 2FE1A 2FMUA 4OB8A 5GONB 2RBKA 2EWMA 2XTMA 1CNEA 3ABRB 3PL1A 3KJHA 4XQ8A 4WEQA 4RW0A 3IDQA 5BY2A 3TRKA 3W8EA 5K3FA 1MX9A 2LCFA 2Q3BA 2ZUSA 3K4QA 3PL5A 4OV6B 3UWDA 2W6JD 4A6XA 3G02A 5LC1A 2AE1A 1J0XO 3N5CA 3KPYA 3ZVRA 2ZT6A 1X42A 4BKRA 4N76A 9MHTA 1Q74A 5TQJA 2OBMA 3STTA 1ZBDA 2DLDA 1VTKA 3D4BA 2ZUWA 5FHQA 4PZAA 3QTBA 2PT5A 4GBMA 1R0XA 3PDCA 4YK7A 1OFGA 5JU6A 3BZKA 4N48A 5CBKA 4LYYA 1O6ZA 5HILA 4KMOB 1JS1X 4L4UA 2CHVA 3IJEB 3MMZA 1VM6A 4NNPA 4P83A 3NTOA 3LUFA 4E14A 1QH1B 2A30A 2WIBA 3HPOA 1V5EA 3NVYA 1ISMA 1EFKA 1P31A 1VL1A 3FPSA 4OVKA 3OTIA 4GL4A 3AF0A 3SQDA 4FWTA 1EX9A 3S0JA 2YRFA 3E1SA 4RLHA 3T1OA 2IL1A 4GL2A 4IR7A 4O29A 1VE6A 3HCRA 3L8MA 1RC1A 4KV9A 2KP7A 4EW2A 3KJNA 4N03A 1G6KA 4G5GA 4JS0A 1E0KA 2DG2A 5CEEA 1BJRE 2GX6A 3AG6A 1K3FA 2NUAB 1UIMA 2VF2A 1IY8A 3DL4A 3HBAA 4WESB 1YU6A 3PKIA 5BT8A 1RI4A 2ZB8A 3I76A 3UJ6A 3A9CA 1P17A 2HF7A 5BNTA 4HDNB 2XMBA 4IDOA 1TU4A 3GH1A 4R8KA 1XVLA 3WIBA 2XUJA 4A82A 1L5QA 1IWPB 2XTAA 5KT7A 4LE2A 3LBAA 4HQRA 2OCPA 4Z3DA 1GA4A 1OR8A 4DEYA 4LYGA 2R0QC 1F0PA 2Z58A 2Q2NA 1EB8A 1VLJA 1VSTA 4GFDA 2OPBA 5EP3A 5JIBA 1R2QA 5JBNA 2JJ1A 1GNRA 5AVUA 3OT1B 4NLKA 2ES6A 5KWJA 1EFPB 4B6PA 1R64A 4OGFA 1PTKA 3HSSA 1FIQA 2AQIA 4RANA 3ME5A 3R5TA 4BQNA 2PKEA 2F9MA 2AUMA 2E49A 3H5VA 1L7BA 3STWA 4XWGA 4NBTA 4I4TB 4XUCA 2IHVA 4D4JA 4E5NA 2FHSA 2WK1A 1I0IA 3H2JA 4DTIA 3PW0A 2R8KA 2IDMA 2NUPA 1KYVA 5JNRA 2GAIA 3BXPA 3PFWO 5EG5A 3E81A 1JSCA 3N2GA 5K2OA 5AVSA 4H1WA 1NWCA 1CDEA 2VHYA 1CQZA 1Y3BE 3MTDA 1ISPA 5I9MA 2NUTA 4BJ5A 4DC9A 5KVCA 1TXGA 5DBEX 1QHGA 4BAGA 2XGMA 3MAJA 1T4GA 2IEIA 3C1TA 3GLTA 3TLKA 2C0CA 3ZH9B 1EXNA 5CHYA 4EYKA 3IA2A 3CH4B 3DBRB 4UU0A 4RF4A 3U48A 2X40A 3PXAA 2VBCA 1TVKA 2V3WA 5IAKA 2XNCA 3JALB 2FDXA 4G41A 1V48A 3IUJA 1V47A 2FUG1 4ZJYA 4Q34A 3OKPA 1T13A 1I3MA 2BPOA 2K60A 1EJ2A 3A9RA 1SD1A 3KYIB 2X8WA 4BQIA 5JFTA 1NQTA 4M21A 3W5IA 4BYGA 3IQGX 2CT8A 1RHJA 2CLKB 1LJLA 3AU6A 1QFMA 2H4FA 3OCYA 3RIXA 1N61A 4F96A 4ZDIA 3JQGB 4HQNA 2R8XA 4N01A 5FUMA 2K8BB 1BQ3A 1A96A 3AEZA 3U4AA 3KR0A 4NHOA 1PVOA 1RAHA 1XQ6A 1DQNA 4LVOA 2XUZA 3W5UA 2C9OA 2XZPA 2CD7A 5IDYA 3BE4A 4PPQA 1E59A 1Z16A 1RABA 2PQ6A 5T57A 4BTEA 4YAOA 1JQJC 5EJ2A 1E5QA 3A6KA 3B82A 3P9YA 3U6BA 2RH5A 2PY6A 4PV7A 5HIAA 1NNLA 1JDNA 4D2IA 1T0JB 4PAQA 3VHRA 4C0XA 1YT5A 4YJ3F 5EN4A 1Q84A 2I6UA 1GD1O 3L7IA 4GGOA 1XRRA 2H5JA 2BEKA 4Z1MA 1NATA 2DAPA 4AMVA 4KE6A 1CY4A 3I12A 2QYOA 3WS7A 8ABPA 2HVIA 2AHOB 4RL6A 2GAOA 4EOGA 3UAXA 521PA 3IO5A 3L8CA 2WM9B 1ZZEA 3C3BA 5A4IS 2O8EB 3LI2A 3E0FA 1KO1A 2BI4A 3MFQA 2ZXIA 3FOEC 3EQZA 3N2KB 3Q11A 4YRFA 3BWMA 1ZK1A 3FJOA 1L7VC 2OGUA 1HY3A 5FI3A 4JLWA 3KZNA 4AQ7A 4Y2YA 3E4CA 1XS9D 5IWAB 4DNOA 2HBJA 4KAJA 3E22B 1FX1A 1AO0A 1BU8A 3JQBC 4S1TA 1TQ8A 1PTJC 4UUAA 5ELMA 2HU2A 2BH9A 1DCMA 2OA0A 1EVKA 2V4UA 3OCUA 4X7PA 1UOEA 2G1JA 4R6WA 2BHLA 4AMBA 4YY3B 1G5FA 1DG1G 1YAHA 4QRIA 2WTXA 1FDIA 4UCXA 4E31A 4BY9E 1IXRA 1V26A 4D02A 3FWYA 4O5AA 3DMFA 1JHMA 1PWHA 2FWMX 4TQ9A 4F12A 2QQEA 1SUSA 3LNCA 3TXXA 4F4ZA 3LYHA 2HOFA 1WDMA 4S1PA 1I51A 1T8EA 2NU7B 2OENG 5KB3A 1UF9A 3N0XA 4EF5A 3U9SA 2CBZA 3G49A 1L6RA 1L0BA 2XGQA 1OZFA 1SUAA 3NBZC 3PRHA 2ICAA 2ZYWX 3ORRA 3TBKA 4OCZA 1ZJ5A 2PGAA 3MJDA 1IMJA 2PXHA 1O2DA 3LBNA 3OE4A 4BWJA 4FGLA 4G97A 4RKWA 1CE8A 3O4RA 2X2OA 4RYDA 5DCYA 3SQIA 2JHGA 5JXWA 5CWRA 2XNKA 1QTIA 1EMDA 1W8DA 2O2DA 4IX1A 5KFZA 2J07A 3DXFA 1E4YA 4A23A 1O94D 4J49A 2W2KB 1J56A 3DKKA 3UJDA 1R18A 5CLJA 3T9EA 2OWDA 2I1QA 2JGDA 1VB5A 3S68A 3UENA 5ALRA 3OZDA 5B1EA 5IM4F 2FQXA 4EY8A 1VG9B 2PFQA 4EYQA 4JUCA 3ZU5A 1WG8A 2BR3A 1MB0A 3HBMA 3PNVA 4V24A 3GARA 3K9HA 4ZD6A 4RFSA 3DS8A 3WKAA 2O2JA 4ECVA 2QI9F 4EG6A 5G3ZA 3DO8A 4YMOA 2QE7D 3E84A 3WKDA 3N8GA 3PW7A 2JDIA 4TWBA 4YN3A 1RM6C 5FCDA 3VO8A 3AVTA 3PX0A 3PQCA 4OLFA 1UXJA 2GF2A 2QD3A 3DHVA 1SBYA 3F7OA 3PLRA 4D4GA 2FEOA 1P0CA 1QV7A 5A3VA 5AOCA 3ELBA 1L1RA 1JWAB 2WMDA 1FXSA 1W96A 2FWPA 2V7VA 3CUWA 2ZRGA 4UTOA 5DMHA 4LE0A 2H7VA 3ZD9A 2CLLB 3EF0A 4ZALA 1Q17A 3ZCQA 1BEEA 5AUPB 2XYHA 3KT0A 4CCAA 1S7GA 1D1TA 1UBTS 3CUKA 2D0PB 4PCLA 3ZBQA 2P5YA 1JIJA 1XP8A 5E6RA 4RQ8A 1CHDA 3T0GA 3ZIDA 4LHEA 4AM8A 4EFDA 3JQDA 5IC5A 5FOWA 1J23A 1ZQSA 1FK8A 1A4UA 3RADC 1GL9B 3FDJA 3B52X 4IW3B 3WV5A 3HNRA 2F8LA 2IYYA 4A5SA 5KNCA 3OUZA 2Z98A 3PE6A 2BYTA 4KE8A 2BP7B 1BDIA 4LXUA 1EE9A 1YQWA 2P3OA 4NLBA 3MS2A 2VOEA 1Q0LA 2BEUB 4JR0A 1QNFA 1ISGA 3NHYA 4JC0A 1V1RB 3ROMA 3UV3A 3IHWA 3JYHA 5IUKC 3JVVA 1XTUA 2H51A 2ETVA 3HZZA 4YBZA 3SGLA 3SICE 4N0EA 3ZK9A 2R84A 2B5OA 2E6UX 2Y1CA 1IWBB 3I64A 5EXXA 2NQ8A 3AR6A 4PPFA 4WOCA 3OJSA 2ASDA 1DFHA 3GG9A 1VMDA 1BS1A 3WAKA 4F3NA 4INAA 4PQYA 5L3QA 2HHCA 3A6DA 3DZBA 4K2AA 3HXMA 2BFBA 4OFZA 2EATA 3AJEA 3B5IA 1OXJA 3TTYA 3AOGA 2B7CA 1ZIDA 3O9VA 3PJFA 2VZ0A 2OHJA 4Z4CA 3QELA 4PGFA 4G86A 1XJ5A 4YCSA 3HUDA 2R2AA 4D26A 1NKSA 4PXSA 2RQ5A 1SC1A 3G13A 2C3UA 2VHZA 4G2TA 2H0AA 2GNOA 2JGRA 3ZDCA 1E3WB 4BNNA 2O3JA 1UFOA 2CB0A 3DE1X 2J9FA 3O4VA 4LMAA 1VFPA 2Q3JA 3HYSA 3LA6A 3I9V6 4R2KA 1KC3A 3IEXA 2HWYA 3R7FA 3T5HA 1ZCJA 3WXMA 2V4QA 2QQFA 1L5SA 3U5TA 4GDMA 5C8YA 1GPAA 2C9ZA 3O8QA 1N1MA 1J8DA 1K7YA 3ZEAA 2JA2A 3R0XA 4GEKA 1GJRA 4LDQA 2I7DA 4YLEA 1DIGA 5D51S 3IKJA 1QORA 3OG9A 2AS0A 3DEHA 5FNVF 1B8OA 2HPVA 2LI6A 2IU6A 2OGTA 2GBLC 4PSVA 4HX9A 3JQQA 1E99A 3UKJA 1MUUA 3VDQA 4PHDA 4NXMB 5FIUA 4UEOA 5K3CA 2H2FA 1RYMA 4EUKA 2C54A 4HWGA 5JY1A 3GDWA 3RU2A 1C8VB 1ZD4A 2HNKA 1M8JA 2RGUA 2M9NA 1YS9A 4BNTA 3FFTA 1NW9B 2W4QA 4DTCA 4MF8A 3H7IA 2GESA 1ZQ1C 3C3DA 2P1DA 3N0RA 1LDNA 4GM4A 2WAQF 2AJCA 2WMOB 5HE9A 2XGGA 1TOAA 3GLIB 1Z6ZA 4ZVTA 2PZBA 4MV9A 5F9MA 5TQ0B 4O3SA 1HE5A 4BNDB 2PS3A 3AV3A 3H1EA 1UPTA 4Q4AB 4LKRA 4DA9A 2EBFX 3JWEA 3CWQA 4YP9A 3WNQA 5B30A 5KFRA 4DM7A 1E63A 2H16A 2G1KA 5EC8A 4QFDA 3DD5A 4H2DA 8ADHA 4FZLA 1I5RA 1JEOA 221PA 1Y6RA 2HMYB 5J0SA 2WWFA 3V4VB 4LK3A 1NXOA 1E6WA 2F9FA 4FDLA 4Y1FA 3DLIA 5FV4A 5HDBB 3ZGZA 1BHJA 2J0QA 3TLJA 2VJMB 5AVJA 1ZXXA 2G40A 4B6GA 3KKAC 2C3PA 3QITA 4O1IA 2BGKA 4HNQA 3HDGA 3BXGA 2CL5A 2JFZA 1AKQA 1M6HA 2INGX 4KFUA 3PMLA 1L7NA 1Y8CA 2ZSHA 4X92A 3UV6A 4B3TB 4MUMA 4DN6A 2GWSA 3PEVA 3SNKA 4I2BA 2YJZA 3CEJA 3E35A 2GA9A 5H8WA 1JG7A 3OIWA 2WDPA 1YB4A 1QHXA 4JLDA 5HKLA 1Y6GA 1V4VA 3PT5A 1I9CA 1NJ2A 2ZSKA 4KLNA 4RTJA 2I6GA 4KE7A 2YW2A 3ZZMA 5LA6A 1P2BA 5B5SA 4ACAA 4EPTA 4MS1B 4HNGA 3EXEA 2VWPA 3OPQA 2D2IA 2GCOB 3TLXA 2F8MA 2QARB 5EEGA 4F2RA 2UZ1A 2BGRA 4KI0A 3OJOA 3PDIB 4HDMA 4I4CA 4M86A 4E7PA 1H0RA 3F5DA 3OAAD 4UVDA 3N2ZB 2VJBA 3L7MA 1XU4A 1M3SA 8ICJA 2DFVA 2GCNA 2J85A 3MGVA 1GUZA 1UXOA 1ZVMA 3KQPA 4GOLD 4NOKA 2YWGA 3IXLA 4JQZA 4TGLA 3WLLA 2OXCA 1XJ0A 5I7SA 3H0EA 2I78A 2X4LA 2BFEA 3UAWA 4EKDA 5A5FA 4EHBA 2UVRA 2ZWIA 3GRYA 3K0AB 2P8JA 3I37X 3FYHA 2DP4E 2G70A 2GTIA 2OBLA 3BHNA 3PXCX 4V0SA 4YDRA 2I4OA 3DZGA 4KOEC 3ON5A 4PC6A 3U4CA 3VVLA 2VZEA 4NLLA 1EG2A 4BAZA 2ZTLA 5A6SB 2HJ9A 4BFTA 3EXIA 2AN1A 7ICQA 5DBHX 3RAFC 3JR7A 3BKWA 4H7JA 1U65A 1AKRA 1F2UB 4HDSA 4NBVA 2F3NA 1Z2CA 4TLDA 3ADBA 3FA2A 3MILA 2W2TA 4H0CA 4Q1DA 3FHLA 1L8AA 3WGLA 4TXMA 4EJFA 4MARA 2BGMA 1XZNA 2ZIWA 3HC7A 5JCOA 2ZIXA 2HAEA 2QVCA 3L92A 4L2IB 1ADBA 3W7BA 2A9VA 4GX5A 4YMTA 1H3FA 1MABB 3AUSA 2W2PA 3LF2A 4BO5A 2Y0SC 2KSOA 2H92A 3O8DA 2DPLA 2ZVJA 1SKWA 4U4AA 3WJ2A 1MSWD 3K73O 1LU9A 3M5PA 1TLTA 1T9AA 2G76A 3JZFA 3RCBA 5IAAA 3IB3A 3TECE 1E2GA 4QVIA 4FYPA 1CLEA 4DLSA 1LK0A 2VJLA 2OE2A 1GKIA 4O4IF 1Y63A 2FMPA 1ULZA 5THQA 4UE6A 7ICJA 2X2PA 2W3SA 5B57C 2QPAA 5DTEA 3TZLA 1IBLB 2FRVA 1KARA 2IYEA 2OESA 1L6IA 2CD9A 3Q3JB 1P3JA 5F3RA 1J2MA 4B40A 2NU9A 5JTTA 3M1YA 2B25A 2VFAA 4LX8A 9ICNA 3GOHA 1NE2A 2ECPA 2ZJOA 4L73A 4QECA 5J4YA 5M5BA 2WDZA 3DBOB 2AOUB 4KXNA 3A4YA 1Y3IA 4WZAE 4YJ2A 3EIWA 1HYQA 4NL9C 2B0CA 1G66A 1TPYA 3SX2A 2JD0A 1DT3A 2KPOA 2PUWA 3RVPA 1R0RE 1CZRA 4JC4A 4JSTA 4ARZB 1T5HX 2H17A 5CJ7A 2GZHA 5JZBA 2XNJA 1YGPA 3KTAA 3VYSB 4DSOA 2YJ6A 3VU1A 4BB6A 1BEUB 4JX8A 1XNGA 2GXSA 2Q5CA 1QQAA 4FOSA 1YB6A 4KLUA 2WNSA 1I7LA 3DMHA 3NHJA 2IT1A 2E5SA 2AFIE 5FADA 5TS2A 5JALA 1NJFA 1PR4A 2JGKA 1Z74A 3EUFA 4KK3A 2ZCUA 2H1WA 4J1TC 4KJXA 1WUTA 3AWIA 3QY9A 4OJ6A 1GPJA 3AXTA 3C3CA 2Q4OA 1E9CA 2DHDA 1ZHHA 4P3XA 3ZLUA 1P61B 2PTHA 5MN4A 3SR4A 5KSPA 1EUQA 2IPLA 4ZYWA 4MVJD 3RF6A 4JH0A 1K1EA 3FJYA 1MD9A 2PZKA 2M1XA 1KFKB 3OZXA 1NOIA 4YR0A 3HE3A 3RB4A 2NU6B 2OLKA 3T7SA 4MUGA 2V6FA 4L76A 4PG6A 5G1OA 5L3SA 1Z75A 4IM7A 5BT9A 4IDDA 4ABTA 2J9ZB 4UMFA 3IRUA 3KQSA 4QTYA 5IAJA 3LSTA 4EFLA 1YE5A 1O95A 1CG6A 5BOLA 1Q3KA 5AMXA 2P6MA 4M7RA 4HO1X 1P2TA 1FNDA 2KNJA 1X7DA 3QFCA 3T06B 5CB1A 4ZHQF 1NFRA 3CCCA 2I71A 4REMA 3OY7A 4L0QA 2CHEA 2CK3A 2RGDA 3LKVA 4Q03A 3HKEA 3O2QB 4RD6A 1BDMA 1Q0PA 2QX4A 3JARA 1NR5A 2E5FA 2MSEB 2AOTA 4ZZ3A 1FNCA 3K4GA 1MEEA 2YN0A 4XYEA 1CUFA 1NE7A 2ECKA 2XC9A 4HZUA 1SGGA 1Q3VA 2VUSA 3HFSA 1P7ZA 3HI6A 1G4UR 4LWPA 3AEUA 1VKNA 2YIDA 2FRDC 1B22A 4J9NA 3V6JA 1Z2DA 1YIAA 3FZNA 5TSDA 1L5GB 4OQNA 5CDSA 2ZCJA 5AKGA 1KMHB 2XW6A 4O2AA 1T6YA 2ASJA 4EGCB 4TN1A 4GYWA 3DFZA 4DR1B 2XNDA 2JGMA 4LTDA 4W1RA 3R6TA 1DTEA 3HB0A 2FZEA 4JYAB 1R37A 4AYBF 1JV2B 3L05A 3UHOA 1W85A 1XIVA 1P1KA 2H1IA 1Z4OA 3K2BA 3QSGA 2IIVA 3OPVA 4UM7A 3SZOA 2I34A 1T4DA 3BB1A 2XT6A 5BOVA 3RVNA 1QLHA 1XWLA 1V8ZA 3FWZA 4MR9A 1D8AA 1GRQA 5B2FA 4PYOA 4CG3A 1WEKA 5B5EU 1HDZA 3PHLA 4WLUA 3ZJ5A 2LDBA 3BE8A 3C1AA 4J0KA 1DAFA 3GCXA 4MGYR 4NZPA 1T2DA 2XAUA 2HA4A 4L6AA 3PXDA 5E0OA 1XHFA 2EIXA 4J0FA 4EYHB 1DC5A 1WV1A 5D6NA 4PR3A 1IULA 5EPUA 2I99A 2CVFA 4GNRA 3ZCTA 2N75A 2WWXA 5M04A 4HH0A 4B44A 4FZNA 2VBIA 1D0IA 4IZ6A 2B4YA 3SHFA 5AK5A 4MP8A 5TPZA 1N6LA 3MDAA 1I4EB 1WSBA 2M9MA 3FC4A 2H54A 4L0DA 4RK5A 5B3AA 3TW0A 3X1MA 1DPFA 1JXAA 3AR2A 3IJRA 2NVUB 1SK9A 3VDRA 4D3FA 4UM9B 5HZHA 4U2KA 4MVJI 3KHLA 2C4VA 2OWOA 4MW9A 1I6KA 1TCBA 2A57A 3L84A 5LP6B 1HR0B 1GQRA 4X9XA 5KAPA 1WF6A 1W48A 3JYNA 2HU5A 4Z9YA 2GN6A 3WB0A 2BQ3A 1EBBA 2JIZA 3CLUC 1SCJA 3FF1A 4KN8A 3IVMA 4TKZA 4JLOA 3AZQA 2P9ZA 1PQYA 4LMRA 1URJA 2BZFA 4KCGA 3KLBA 4YAJA 2IF2A 2Y8EA 5JI2E 5IKMA 4YCXA 4CIVA 2LYAA 3JYLA 4QHYA 2V74B 2MU1A 2OXRA 2AV6A 2PR2A 4NV0A 2Q3EA 2PFGA 5CBPB 3GUVA 2YDXA 2RC6A 3IIJA 3O82A 5C4IA 3DBLB 4ZYYA 1HDEA 2EU8A 3FB4A 2WTUA 4JQOA 3G6YA 3ER8A 2ATEA 2Q5FA 4IZOA 3CTPA 4B3FX 3L18A 4E4YA 5HDQA 4EY5A 1P75A 1EIZA 5F76A 4DBLC 4OJMX 3AY6A 4HRVA 1KAHA 2NSDA 2VNIA 1KH2A 1IBRA 3WG9A 4RL4A 5TMEA 4GT1A 3DSRA 3ZQ6A 4XB6B 3V1YA 2CGEA 3OU7A 4Z6EA 2LCIA 4DR4B 4H18A 1WNFA 5CXUA 1CS0A 2A5LA 5FOTA 2A94A 3CZRA 3OX1A 1QV6A 3ZVMA 2E48A 1WD7A 2QTTA 3W8RA 4KR2A 4ZOLB 1RHUA 1P2VA 2AFIB 4CLHA 3OHBA 3UPTA 4Z3OA 1HDCA 4YHBA 2PBZA 2P4HX 3EXHA 4YV0A 4JWMA 5M29A 3DZHA 4WXRA 5JH7A 3TAPA 4MKFA 1CTQA 4GIBA 2HCFA 2XRFA 2X7XA 4G5OA 4EB8A 1LDEA 2KIWA 4CCHA 2XSZA 1G20A 4V0NA 1QWOA 3OKAA 4XCXA 1K5GA 5A5GA 3R5FA 1Y1SA 3LL4A 4D3ZA 3GXOA 5BQ3A 4XQCA 5JS7A 2HHQA 5TMPA 4TWIA 3SZ3A 1JFSA 4LRYA 4KTTE 3OY2A 1YB5A 4RLSA 1XK7A 1HV8A 4ZI7B 3UPUA 2OR3A 3DE3X 4LRTB 3TLCA 3IHQB 2C8VA 4D9BA 1LQUA 1V11B 4RS4A 4IP0A 1YJCA 4PICA 3QTLA 4I7EA 5EZ6B 3H5TA 4C6HA 4F86A 5LQMA 1Y82A 3GDFA 3LDUA 1IM5A 3O8LA 1Z8HA 4C4SA 3BFVA 2VP0A 3BZUA 3L49A 1WD5A 2ST1A 5KFBA 2C4WA 3A14A 3RF7A 2XUGA 2F1IA 1MO2A 2QRPA 1GITA 2E2WA 4ARAA 2O05A 2QTCA 3P2OA 1QH1A 3HY4A 1UFKA 2AOXA 1E7QA 1P6UA 1R6AA 2D5AA 2F3RA 2P4UA 5F2KA 3X44A 1X66A 4LNAA 1ZI6A 1C30B 3T4XA 5EOVA 1V16B 1VDMA 3IIMA 4C3UA 5KO2A 2IBKA 2OZVA 3E3MA 1L3UA 2UVDA 3VR5D 1PBTA 3G1TA 4WK6A 4JVNA 1YD7A 4DSIA 3DF9A 4IKEA 4K6CA 3TEFA 5TT1A 1FUKA 2D1QA 4K9PA 5C8DA 5IKEA 4ND1A 2YZNA 3U7JA 5K0JA 3RRYA 1WBBA 2NVOA 4NTZA 1WUDA 5ALUA 3S1LA 2VEOA 2BMFA 4UB4A 2Q1UA 3R7SA 1Z4IA 5HCIA 4TRNA 4NU6A 1R0SA 3PWTA 4MV8A 1ZETA 1QG4A 1Q12A 4B46A 1UMCB 3B7PA 5IU6A 1EGAA 1WLYA 4PZ0A 3R9XB 3GLQA 3LHSA 4I4TF 1GPKA 4JB0A 4ECEA 5COAA 3GI1A 2XTZA 1JU9A 1R0LA 3T1VA 1U0GA 4QFMA 2YMQA 2ODBA 3OJXA 2LBOA 4P0QB 2OK7A 3NV7A 3OPYB 4G4GA 1O54A 2QB5A 3TPCA 4L5BA 4X60A 4EEXA 1S7CA 4WUVA 1AS2A 4TMYA 4REQB 2Z3WA 3SP1A 5AUQA 2PI5A 1OPRA 1VYUA 4NOLA 5L3RA 2HNBA 2PMDA 1Q0ZA 1E79D 3LX4A 1U99A 1ZVVA 4ZREA 3V32A 1H2YA 3SC3A 5CTAA 1A72A 1SKQA 3K2IA 1ZL0A 4DO9A 4I2NA 1E2IA 3WI7A 3AL0C 5LUAA 3A6HA 3ZS8A 1HYEA 3KQTA 1GGKA 1M0SA 2XOEA 1G5TA 5AW7A 4K9NA 4GUDA 1TO2E 2V7WA 4U2FA 1U9IC 1V11A 5JCPA 2J41A 1Z56C 3E5MA 3PHCA 3MYYA 5ALYA 1TZMA 2IF0A 4IV8A 5E3HA 4YRZA 1HL7A 5F64A 1BDHA 1RYYA 2EG9A 4ZGGA 2JI7A 2F44A 2WNHA 2QTVA 3D7LA 3H8JA 4MFCA 1JHAA 1H4SA 4HAOA 4LSZA 3V2IA 4CKEA 2OXFA 9ICOA 1NVXQ 4DL3A 3IVRA 3ZZ0A 4K0KB 2LRHA 1TK5A 2C29D 2D1TA 1SUBA 3A1CA 1B2LA 3WO1A 2JVKA 3ZN2A 1JR3D 3A2MA 3K4PA 4QLBA 5CT6A 3EFOA 4JOSA 2W6MA 3I4CA 1A0OA 1U9CA 1L3VA 1WV0A 2JEOA 2PKYX 3WICA 1V16A 2A3RA 1N9GB 3W5SA 4TRMA 2KI5A 4A91A 2COUA 1QH8B 3GMDA 1Y1TA 4GLXA 1RZUA 2WJGA 3SF8B 3JY6A 3H17A 1GG8A 3HM9A 2GD1O 3M9OB 2JAPA 1EI9A 1ZNYA 5GV7A 2O57A 1FTYA 4ANFA 4EG7A 1QANA 1G7SA 3USES 4HXYA 3WWZA 3T79A 3PGMA 2YWXA 2QW0X 4AJKA 1KH1A 2GAJA 2AC4A 3OLQA 4QUJA 4RNCA 3BQNB 2O8NA 9ABPA 3RJMA 3PUZA 3TADC 1R6DA 3OZCA 4H3KB 2FEPA 4QXRA 3IG8A 2BTQB 3CUTA 4GQBA 2WD8A 4OBEA 3MWDA 2ZW9A 3KTFA 5DULA 5BRAA 5CCDA 2O14A 2WB4A 1VMEA 3WAGA 3U7IA 1Y3AA 2H4ZA 4NZOA 1V7ZA 3TANA 4U3JB 2KOBA 3LK6A 4DVGA 3IKTA 1UMKA 2ZJBA 3GFSA 1TAMA 3JQ8A 1K9SA 3LUPA 1NL3A 3EN0A 3CNLA 1X7YA 4CQJA 2WWWA 4YQZA 4JB3A 1BQ4A 4AFNA 1FPMA 1KVTA 3M6UA 1L5UA 2O23A 1DRWA 4JKIA 5JUMA 4UBLA 1UQRA 3DMNA 3HDJA 4W1QA 2AG8A 5ECWA 3PZPA 2Q45A 1PGOA 4J0EA 4A7PA 1U7UA 3GPLA 2UUBB 2B8NA 1RCFA 2NN3C 1JQAA 2D00A 3CUYA 1PW7A 1WZUA 2GCPA 2I1LA 1U0OC 2ACVA 4EL0A 2QYSA 4NDAA 2PXCA 1I1QB 1UPUA 3UYLA 4YAKA 1VKOA 4J2OA 3FZQA 1IEXA 1ZJYA 4CKEB 1NMZA 3WK9A 2PZEA 5JU5A 2ORWA 3EC7A 3KRTA 4LBWA 4Q12A 3W3AA 2OD2A 4O02B 1BFUA 3DXYA 3VX4A 1L9XA 3H8SA 2IE8A 3ML1A 4C05A 1QHHB 3RRGA 3JWIA 1ZQLA 2KYRA 3DC7A 1ETUA 1Q0UA 3B7WA 3W6PA 4ZOCA 1K6JA 4B7ZA 1RAAA 5F35A 3ZWCA 5KYWB 4LFAB 1ZY2A 4KVFA 1ZM7A 3EAGA 2HCTA 2O8FA 1HXHA 1VHTA 2E4UA 4NLZA 3ROGA 1WWVA 3CMCO 1J09A 1H8EA 1ESDA 1UBRS 3H4VA 4ZHSA 1IZ8A 3QFTA 3SYRA 3A36A 4ND6A 1VSQA 2GTPA 1K4KA 4O3PA 3FZYA 1JXLA 1SHLA 2B6HA 2NXWA 1KS2A 3FVRA 1SVLA 3HCNA 4G1EB 4J6FA 4O25A 3FCUB 4XYBA 4BUJA 2Q5HA 3DDHA 1V5IA 2TMYA 3L0BA 3LZ6A 4U6QA 1BRTA 2VJAA 3HWX1 3JQAD 4ICIA 3UB4A 4C07A 1QP0A 1A4IA 1GPWB 4PC7A 1NK4A 4OHKA 4ZEWA 4E0DA 3KEGA 4L28A 2I7XA 3A05A 4JEHA 2MUTB 1ZLXA 4M8NE 1VLQA 4AJ4A 4L07A 2HBRA 4QWBA 3UQZA 4F5YA 1YF3A 1BCSA 4L8YA 5THKA 2OEHA 3DB1A 4J94A 1KZYC 5IP5A 1T1RA 2W83A 4Y6PA 3ZD6A 1JMVA 3J81A 1EGMB 1N6IA 5DG8A 4TUQA 1NJ1A 1RPAA 3OLXA 3DOJA 4UHKA 2YWCA 3WP1B 4BFCA 5JSFA 3OHSX 2ZJAA 4K03A 3LWNA 3FMIA 1I32A 1U8EA 3IR6A 2OFWA 1UL1X 4DJTA 2CXQA 4DWOA 4EGJA 2X8AA 5DLYA 5HUQA 1A9RA 3LO5A 4WK4B 3TLGA 3K9WA 1C3VA 4ACOA 2PCLA 1SB8A 1HQKA 5KCMA 1X7XA 2ZSBA 3DL7A 3THYB 2WPDA 2AKAB 2MJLA 4WKGA 4HBZA 4J3NA 1ODIA 5H4GA 5K4GA 1QHSA 4Q6BA 4YMIA 4C88A 3I9OA 4TTAA 4W6QA 5F21A 1W36D 8ICUA 4HWRA 1GP2A 1RCTE 5ADWA 1IE3A 1ZJMA 1E3QA 4CKBA 2ABWA 5BWOA 1XLWA 5JC8A 2KHVA 2HW3A 4DLUA 1EA5A 1SL2A 5JANA 1NM5C 1Q3UA 1EP2B 1U0SY 4QZ8A 1Y3CE 1KFCB 2PX8A 2PI4A 1TZCA 1E9DA 4UHCA 3Q2OA 4RQAA 3WNBA 4XWWA 2Q3LA 4FPXA 1WQ4A 1YDEA 4US8A 4R51A 3FMGA 1X77A 1SOMA 2IYAA 4J0DA 2RH8A 2YQ5A 1LV7A 3UVEA 2FXIA 2VQ6A 3RBXA 5HF8A 2KQUA 1XZHA 3GLFA 1HEIA 1FP7A 1BWQA 2O07A 5BWLA 5EXSA 3T4EA 1NBMD 4U00A 2FR8A 1D4OA 4Q05A 3GW8A 1T25A 3PP8A 3Q7QA 4OHRA 3VC7A 4M89A 1V6SA 3CNOA 1T9KA 4FYVA 4BKQA 2WM8A 1PNVA 1UEXC 5ARDA 4UUMA 1SN7A 4L51A 3IKVA 5K3SA 1QLNA 8ICRA 3B13B 1SZJG 4YASA 2VLIA 2XWJI 3LDAA 3D7RA 1SXJA 2W8BB 2PT7A 4L5IA 3TOXA 4URUR 2C5EA 5KQLA 2PA3A 1WB6A 2H7XA 1GGVA 4OHYA 1T8PA 2X58A 2Y9PB 2BUBA 2F8KA 3THSA 3R0VA 4G1BA 1FFDA 2X19A 3G1UA 4JBNA 4AC9A 4OJYA 1I3NA 1W52X 2G63A 2JB9A 5G1PA 5KFDA 1A69A 1QTRA 1KR5A 1VP3A 4WL0A 5TDHA 5MHTA 4ER5A 1XDSA 4E88A 1ZI8A 4DF3A 1C9NA 3BS5A 1DCKA 4BN4A 1P7PA 3THRA 2XVXA 1G9XA 1DO0A 3ILHA 4MGIR 3U4IA 3QUBA 2O1XA 3K0BA 3QVOA 3R1IA 4EG5A 2EQBA 1XELA 4YCJA 5KG1A 3DAGA 3CRMA 4RQ5A 3HA7A 1L8LA 1UBMS 2Z1DA 4MZDA 4NYMQ 4BVFA 4WESA 4NU0A 2X5NA 4YQEA 4EKYA 3W06A 2XV1A 1OIWA 5B36A 2XE4A 1AX9A 4J16C 1XZCA 2IXFA 3GAAA 5SYMA 1Z63A 1OV6A 3EGDA 4YECA 1JTVA 2FZWA 3ABSB 1SXJC 1Z0DA 3PC3A 4BX2A 1RI2A 2O0LA 3M8RA 3LC0A 2NT3A 4PHAA 4YS6A 3CVYA 2ZJ4A 1HT1E 2EIHA 2HGZA 4RKYA 4UHDA 4UHHA 4C4AA 1RM4A 5E6RB 3E2MA 4LPSA 1NJ8A 6ADHA 3B6ZA 2WZBA 1BQEA 1DWOA 3QG5A 1A2QA 2PKWA 1L1QA 2MSKA 1DIRA 4BNDA 3UTDA 1V9LA 3L1IA 3WK7A 3MGIA 2G4CA 3OLVA 5ERYA 5EXTA 3KXLA 2RH9B 4ZA2A 2B4QA 4RH0A 1Y6JA 4WKCA 2ORED 3MELA 1JECA 5JXGA 3EZ5A 1ZQ9A 3CONA 1GFZA 3C6ZA 4RESA 4AVYA 5J0RA 2BQUA 5L6LB 4FYIA 4IIHA 2NV6A 4ZVRA 2E3JA 2X6RA 5E4JA 3S8MA 5J4VA 3D6HA 4G37A 4N1AA 4QPNA 4TLMB 2OVFA 1V8BA 2WSMA 4JLAA 5FOXA 1ISSA 3WL8A 5TARA 3V1TC 3A37A 4ZT5A 4DT1B 5KREA 2IIQA 3C1ZA 1D8TA 4FP9A 1VBNA 3ORYA 1EFLA 4K81B 3AIOA 3CJQA 5B7QA 2P9JA 3I5XA 1ZQKA 4F4DA 4B2LA 1IHYA 4IMPA 1U0HC 4UVEA 3DMGA 1P2FA 3C3KA 1R0KA 4YP1A 1UP7A 5JECA 2P9FA 1MC1A 3DDUA 5JZOA 5KPJA 2KVCA 3NORA 1B16A 5KNCH 2WJYA 3H1BA 2IS4A 4TYWA 1N2CA 1A95A 4QZAA 1HLDA 2CRXA 2YRXA 2MA1A 3CZ5A 4HX2A 4EBFA 1D2EA 1M75A 2JEJA 1M7HA 2Q41A 2RGNC 2ORYA 3E18A 4B3HA 4DDTA 3C4VA 4P54A 3SJCA 7REQA 4NXNB 3C2MA 3A27A 4UB2A 3EXEB 1KY2A 4HB3A 4YMGA 1B8PA 1RYDA 4ZCTA 4IUYA 3DGFC 1DAOA 4AY2A 2KHQA 1VPVA 3ETEA 5GADl 4B9NA 1OPXA 1JHZA 2BY4A 3PO4A 2X8LA 3NWEA 2Q4RA 4MLDA 4WK2B 5KDDA 5J4LA 5E7MA 1KOGA 5B6PA 4AMUA 1PWEA 4B84A 4JX9A 5JNSA 1Z62A 4MDEA 3JATB 1LBSA 4B2PA 5ECYA 2BFDA 2X0DA 4BV9A 2XUKA 5FPTA 1CDZA 4NL9A 4H4EA 2ZTCA 2R48A 2FSSA 4DSFA 1PJTA 1RXCA 2YZMA 4LGYA 4UVHA 5JH7F 1UM9A 5TISU 1THMA 1UBOS 4MIEA 4ENVA 1ZITA 1T9HA 2VHCA 4AJ9A 5KINB 1UKZA 3QOWA 1XQ1A 3E3AA 1AQYA 1E6MA 2P40A 1WHTB 3EMKA 3ETJA 3QLTA 2WY2D 4JI3B 2O8CA 1A5TA 1KF0A 2A2ZA 2DJ5A 5T67A 3D4LA 1EWKA 2WAOA 5KNBH 3MBYA 4V1CA 1T5IA 4QOJA 3IO3A 4BRSA 5I6DA 3GEMA 1CF9A 1VCNA 3DFKA 4N8EA 1NJZA 1L4EA 1I1OA 1K8ZB 2O50A 4WKNA 4WK0B 3DLHA 2VPXA 1UPAA 2Y0DA 3HZHA 4JSYA 4W1SA 4G0VA 4GLBA 1ZESA 1SEPA 1AGXA 4BRUA 3ZGXA 4QBGB 1NZDA 1J24A 4JLJA 3K9LA 2R8IA 4JYPA 4PBSA 3EJ6A 2B4TO 2I3ZA 5AXAA 3VTKA 4XASA 1PX0A 3N1UA 1I7QB 1AURA 1Q6YA 1EGQA 1QFJA 4DMRA 3BHJA 1IHPA 2FB9A 3WK4A 1ZGGA 3D59A 3U40A 4D92A 1T0BA 3TSZA 1S1CA 5ALWA 1YR7A 4E09A 3QE4A 1HO3A 1W75A 2BGUA 4IO1A 4RQ7A 1ECFA 2Q5IA 4WACA 3OZSA 3OZVA 3WSTA 1V2GA 1Q1ZA 4GPEA 3C1UA 3PCTA 5KTRA 3IUYA 4FM9A 2X5KO 2XD9A 4HB4A 4WJZA 4BEJA