4BX9C

Human vps33a in complex with a fragment of human vps16
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
95
structure length
95
Chain Sequence
ERIEGRVAALQTAADAFYKAKNEFAAKATEDQMRLLRLQRRLEDELGGQFLDLSLHDTVTTLILGGHNKRAEQLARDFRIPDKRLWWLKLTALAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein transport
molecule keywords VACUOLAR PROTEIN SORTING-ASSOCIATED PROTEIN 33A
publication title Structural basis of Vps33A recruitment to the human HOPS complex by Vps16.
pubmed doi rcsb
source organism Homo sapiens
total genus 38
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2013-07-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.780 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 4bx9C00
4KMOB 4BX9C
chains in the Genus database with same CATH superfamily
2XO7A 5J0OA 4E0DA 1VDVA 2H3VA 3PY8A 3H8MA 7ICQA 5ALRA 4K4HA 1XSPA 3MR6A 4DF4A 3SQIA 1ED1A 4TURA 4P0PA 2LM4A 1QH9A 5IIOA 4Z6DA 2DF4B 4KLLA 3GILA 4PHDA 5ALTA 3ALRA 1BNPA 3UMGA 4CF4A 4O9MA 1PK3A 3IG8A 1JMSA 3HILA 2ZUDA 1LV5A 1CEZA 2KG5A 5AKEA 4FO6A 4DFMA 4RUAA 1S77D 2LYHA 2KV2A 1IIPA 3H0MB 4DQSA 3KBBA 4HYKA 5ALUA 2FLPA 5KG1A 1WWUA 3PNCA 3FM9A 3BQ0A 3RTVA 2MRLA 5HR7A 2DBYA 3QU7A 3RB3A 2BKEA 1RQNA 3GV8B 1BPBA 2JV3A 3KKAC 2KN7A 4J9OA 2IMWP 3PO5A 3TACB 3PSTA 4MF8A 4P4PA 4NLNA 4IQTA 2DGZA 2ZIXA 4AYBC 3M6KA 1ZQJA 4YP3A 5AIBA 4ED7A 3AUOA 1ZQXA 4Y2YA 9ICOA 4FS1A 2PFQA 9ICKA 4P4MA 2HBLA 5AIAA 2QARA 4QZIA 5AI8A 4MF2A 3MFHA 1ZD3A 3SD7A 4I2CA 1YZ7A 4QIWC 5BPCA 1Q46A 1X9XA 1A0PA 3KHRA 4YXMA 4IR1A 2JR5A 5AKKA 4O5EA 5KFHA 4RQ6A 3SV3A 4UB2A 5J2IA 3C2LA 5L1JA 3UXPA 2OWOA 4Y2TA 2W8LA 5L1KA 5KFRA 4UAVA 4XA5A 2M9NA 5KG5A 5J2DA 1L6NA 8ICUA 2K8CB 3PX0A 3TARA 5L1LA 5AM5A 4B6JA 1TAMA 1X9MA 4ELTA 1VLBA 3TQ1A 3AQEA 5J0QA 3QUCA 3BDPA 3BQ1A 1ZQYA 3V6HA 4K4GA 2DKZA 2VA2A 3ETLA 4F5QA 3CYMA 2G06A 4CNQA 3PMNA 3WKEA 2HCFA 2K4IA 3IDWA 2E5SA 2BDUA 2KNJA 1Q8KA 9ICCA 3BZCA 1X6JA 2HVHA 5DQGA 1ZQSA 2JEGA 2HHUA 4NLGA 7ICKA 4M9HA 4FBUA 2AXTU 2YMQA 5CWRA 5J2JA 3QU9A 2BGWA 3AN1A 5AK3A 1UT8A 4O3MA 4U7CA 1ZQRA 2Q4TA 3ZDDA 1S8OA 3GIJA 2ODGA 9ICJA 4DFPA 1BPZA 3IV6A 2K4PA 3G6VA 5TISU 4NL9A 3Q8QB 3UM9A 2W11A 4KTQA 2KJ8A 1RG6A 5HR6A 3B0YA 5AM4A 1L7PA 4DFDA 2KZMA 4DSJA 2L5YA 2KMDA 2PXIA 5HP4A 3SENA 2HHTA 5DB8A 4IQVA 4EEKA 1OUQA 2MUTA 7ICVA 2W9CA 2IHMA 4I29A 4NM1A 3KTQA 5KFJA 2BQ3A 4RQ4A 2WFAA 1JROA 1JX4A 5EWEA 4IQUA 1N56A 3EW9A 5DB7A 1L7OA 4QWEA 3RJGA 3UPQA 1V85A 4F4XA 3QEAZ 3RB0A 2BZFA 1PZNA 4ECTA 1J97A 1H38A 8ICPA 8ICCA 4ECUA 5DKWA 5KG4A 3TFRA 1DK3A 1F44A 5A0LA 5J8YC 4EENA 5KT7A 2H3QA 2W43A 2LKYA 2VJ4A 5AM3A 3LWLA 1K1QA 1NZPA 7ICFA 9ICRA 1AROP 3QU2A 3SAFA 3HW8A 2ZIWB 9ICIA 3QUBA 5K4LA 3PX4A 3IHQB 4TUQA 3ZD9A 2KHQA 3N28A 4YR3A 1PVRA 1J2MA 1TVAA 4RQ0A 9ICEA 5CA7A 3MGVA 3TAQA 3SMVA 2HHVA 2UVUA 3KD3A 2AH5A 9ICSA 3RB4A 4KLFA 4QWBA 2WF9A 3F2BA 5DGBA 4P0PB 3ORYA 1SL0A 2FPKA 3B9JA 1JN3A 3Q8RB 3L3FX 1NK4A 3BQ7A 1FFVA 4YD1A 4QNLA 5KT3A 8ICJA 3G6XA 3Q8KA 1ZQNA 4GC7A 2ZIUA 2ZTEA 2E1EA 2WF8A 1Z1BA 2KTQA 2KD1A 1LVHA 5AK5A 2FPMA 4J9NA 5KFPA 5DLFA 2RQ5A 1ZETA 2ZIVA 4MFAA 2ZG6A 2KSOA 5L9XA 2DQNB 4RPYA 4BDPA 1YT3A 5ALXA 4QZ8A 4P4OA 1TE2A 4UB8U 3HP6A 4F4KA 2A3VA 2QLTA 4RT3A 4EYIB 2ES6A 2ZIXB 2EDUA 1N61A 1JIHA 4PGXA 2RRDA 4F4ZA 3RH4A 5KFOA 2QARB 2JEJA 4F8RA 1U48A 1ZQLA 1J2NA 1O03A 2MAXA 4YR2A 3JPQA 1N63A 4XRHA 3MGIA 1U49A 5DBAA 8ICQA 2Y1JA 2VJ5A 5EE0A 2F1HA 3SAGA 4Q45A 4DL4A 4KX3A 1Y88A 5HNKA 5DDMA 3HRDD 1IXRA 1KFTA 1ZQOA 1ZQPA 3GZFA 1DOQA 1UCVA 1U45A 4I28A 4DSFA 3HT3A 3D2QA 2KIVA 4CE6A 2XIDA 2ISPA 4CF5A 2FLLA 1BPDA 5AKGA 2HHXA 1NK9A 4O3RA 2P66A 3M7DA 4RZRA 2IOHA 3QU5A 4PZOA 5AI4A 2E3TA 4J9LA 4IS7A 8ICMA 1NOMA 2AGOA 2YN4A 4QZFA 4YMNA 4FZNA 3GQCA 1M6YA 8ICAA 5J0WA 5ALDA 1KN5A 1N5XA 3GV5B 3TKAA 4GFJA 5ALPA 4C8MA 4IC9A 2PFOA 2F1JA 1D8YA 2JEFA 4PH5A 8ICFA 8ICRA 9ICXA 1K5OA 3TFSA 4F5NA 1A76A 1OW5A 5BOLA 1NKEA 4CRXA 4YXJA 1N62A 2AQ0A 4RQ3A 3SV4A 4I27A 5J2HA 3PVXA 5TZVA 5KFGA 4GIBA 5JUMA 8ICVA 4DSEA 2YQEA 3RAQA 1DXSA 1Z00B 4NWIA 1KL9A 1WCLA 2Y0SF 3MR2A 3V7KA 5DGAA 3JPNA 1RYSA 3EPIA 1MQ3A 2J6TA 2EAPA 2W9BA 3TANA 7ICEA 3C1ZA 4M0AA 1TV9A 1NJXA 5CEHA 1T4GA 3H8WA 1GO3F 8ICEA 4YQWA 1DK2A 4IRCA 4JV0A 4B9UA 3SR6A 2KEYA 2GOLA 2MUTB 9ICGA 1ZD2P 2KOBA 2W9CB 2W9MA 1SKSA 2FMPA 4PGQA 1N48A 2YMPA 1TK0A 4DQRA 5KG3A 4QZEA 4UBCA 4R65A 3GFKB 1SXEA 7ICNA 3OHAA 2R8HA 4P2HA 3DV9A 5KL1B 4Z6EA 1A6SA 2HMXA 1KFSA 5F3XB 1KTQA 1NJYA 3C29A 5KG6A 2LYAA 5L1IA 4FFDA 1L3SA 2ZUCA 4KX5A 4YD2A 2ISOA 2BPGA 3T3FA 5KG0A 3VC8A 1Z4NA 4F92B 4DO9A 4IL6U 2ZUBA 4F93B 4QZHA 4UW9A 4UQGA 2VIXA 4CGZA 1B22A 1KFDA 3AEVA 2K4HA 5IIMA 4OJ6A 4NLBA 3H4BA 3U26A 3AMZA 1KKXA 2Y0SC 1RDFA 4JB3A 2LMRA 2KK0A 1SKRA 2BCUA 4J9MA 2FMSA 2W3RA 2XCPA 5J0RA 5EOZA 1PK1B 5KFUA 4MEXA 5ALWA 1ZJNA 3ED5A 1NJWA 2QKQA 2YMLA 1XO0A 2RP5A 1BPYA 5AKYA 1F0MA 2PI5A 3K1RB 4F72A 3RJEA 1MSWD 1ZQAA 1NK0A 2KIWA 2ZIUB 2BPCA 5KFYA 2ZJ5A 4F5OA 7ICHA 2ASDA 2OCEA 3T5KA 1RPLA 3NVZA 1CRXA 2XC9A 8ICKA 2ZIVB 2KSOB 2A19A 1SV0A 2Y9TA 2KFZA 1P7DA 4ICAA 2LBOA 4DWIA 2GWSA 4PHEA 1NK5A 4B9TA 5HHHA 3MBYA 3E2EA 2W7OA 4ECWA 4C4SA 1UA1A 4UB1A 5KT2A 4I2HA 4U6PA 2FDRA 2LM1A 4UB6U 1SZPA 2HW3A 8ICNA 1T3NA 3RB6A 3QEBZ 3WK5A 1JALA 3UQ0A 4Y2SA 1WG8A 2FPLA 1A77A 1LKYA 3KZXA 5J29A 4RPXA 4ECXA 5GTIU 9ICMA 3D2NA 1RXWA 7ICIA 4DS4A 4KLSA 2GO7A 2QB0A 1TK8A 2AGQA 3E58A 2BR0A 5KFVA 2KZZA 2FI1A 1SV4A 8ICXA 7ICJA 1ZQDA 5J2FA 4GLXA 1UQVA 4KMUA 1B0XA 3H4DA 5ALFA 3HWTA 3M9MB 1NJZA 1XSNA 1Q3UA 3FYHA 4ECSA 5KFQA 3EYZA 3K4GA 2J6UA 5AKXA 2I1QA 1T7PA 4EX6A 3MC1A 1V9PA 5HHIA 4PPXA 1Q3VA 3KZIU 1L5UA 1UPHA 3OJSA 5EWGA 2Z7JA 4QWCA 2ATLA 2W9AA 1ZQFA 1ZD5A 2D3DA 2W54A 1CI4A 3WU2U 4F5RA 3IRUA 2BPFA 1TK5A 3NS1A 4O0IA 3JPTA 2G09A 4DSKA 3RR7A 2BQUA 5EWFA 5KG7A 2P6RA 4NLZA 8ICWA 4UASA 3ZDBA 1Z4OA 5J0SA 4M9LA 2KP7A 5ALKA 3V7LA 1X66A 4B9SA 3KHLA 3MDAA 3ICXA 1QSSA 4G9BA 4QWAA 2HHSA 1L7NA 1Z00A 8ICIA 4Q43A 1S10A 4FZMA 2YB4A 2W9BB 2C2RA 1Z3EB 2HBKA 5J2GA 3CW2C 5CP2A 4QZBA 3PR4A 2R8IA 1O08A 3N7SC 5DQIA 3MGHA 5CR0A 3RJJA 2DL0A 1IM4A 2M0NA 4DQIA 2XVTA 4OJLA 4USAA 4UAUA 3RH5A 5DB9A 3NASA 9ICQA 5KFMA 1ZOLA 3HX0A 4UARA 3PZPA 3GU3A 2F76X 2P6UA 3ONNA 4NLCA 4F71A 3H40A 3NVWA 4RQ2A 3LK9A 3TADC 1TFRA 4KN4A 2HDOA 5E79U 4ED3A 2XY5A 2ASJA 5JTIA 3EUB2 1ZXIA 2EANA 4AP9A 4TUSA 2DUYA 3IG5A 2KFNA 3LYSA 3WK4A 4NY8A 2AHOB 2PI4A 4OJPA 4QW8A 4RPZA 5C5JA 9ICNA 1QQ5A 2GH1A 3C5FA 1C7YA 1NI3A 3JPOA 3V6JA 1OXJA 2F3NA 1WUDA 2WF5A 2F44A 3OJUA 2C22A 2JEIA 4FZLA 3MFIA 2WB1F 4UB3A 4DS5A 4F50A 5AHXA 3PW7A 3BS7A 2XY6A 5ALMA 4EEYA 4JV1A 2AQ4A 3T79A 2HOQA 2UVRA 2YMMA 5AKIA 3C23A 5AKZA 1HUOA 5KFDA 5ALZA 5J0UA 4ZOHC 2PMZF 5J0YA 3A0HU 2IHNA 9ICLA 5ALSA 3J81j 1PK1A 4F5PA 3WK6A 5J2BA 3AU2A 4US8A 3AQFA 4Y2VA 4BWMA 3NRZA 1RQLA 1S0OA 4B9MA 1JXEA 1ZQGA 1QSYA 8ICLA 3C28A 1L3TA 3QYPA 3OTQA 4UB4A 4BWJA 2B21A 9ICPA 4KLDA 1ZQHA 1U47A 4Z6CA 4IR9A 4DLGA 3S6JA 1EXNA 3NTUA 4R64A 5KFSA 3PV8A 5AKLA 1S0VA 3AL0B 2E1FA 1UHUA 2G0AA 3GIKA 2NV3A 3SI8A 8ICZA 3BS5B 1XWLA 4RQ7A 2DPJA 4MHVA 2CXYA 2XGPA 3Q8LA 2F8KA 5KG2A 4EELA 1DGSA 2WB1C 2OXOA 2HBJA 4XUSA 1SIJA 2JZBA 4DL3A 1F5SA 1LKYB 1N5WA 1LB2B 1SL2A 4I2AA 2A1JA 9ICAA 5T14A 5AK6A 2WTFA 2QB0B 1TAQA 5KFNA 5DDYA 5ALVA 1T3QA 3T5LA 2PMZC 4OJ5A 4F91B 2W8KA 1SWWA 4RQMA 4CDGA 3UXNA 1SZHA 3NRWA 1SGGA 3WK8A 3HJEA 2OYYA 4B9VA 5AI5A 3M9OB 2F1IA 2ZTDA 4Y2XA 2FJ6A 5EE9A 3PO4A 3N7PD 4BUGA 1MC8A 3ZI4A 4YG2A 1JXLA 1RM6C 1X6IA 4ECZA 4PHAA 2VA8A 2H3FA 5KTQA 5L1MA 5DB6A 1S5LU 2I6XA 3KKAA 2C28A 5FP0A 5DBCA 4JWMA 4JMUA 3WKDA 4PZNA 5EE1A 4KLUA 4KITB 5KT4A 2HBMA 4CF3A 1ZJMA 4NL9C 1KSPA 2KHVA 2Y9UA 3KOOA 2N1RA 2DWQA 5D4BA 3LWMA 9ICVA 2MSNA 2E8MA 4A8EA 2H3IA 2K8AA 5AI0A 2BHNA 5J2KA 1ZQWA 4UB5A 1RYUA 5ALYA 3C2KA 4QZCA 1QQ6A 1PUZA 1COKA 3FC4A 4UBBA 3OGUA 4YFKA 2ZXHA 4Y2QA 2W55A 2V4RA 3WKCA 3LDAA 3MR3A 5AI9A 2I9GA 4LZGA 1SL1A 4BJQA 5HMLA 3RR8A 3ETRA 5KFIA 3KHHA 2VA3A 3FAHA 4QZ9A 4ECQA 2DFLA 2Q0ZX 2HI0A 2ESEA 2ZJ8A 1L8OA 1KRPA 5AI6A 3PX6A 4MFFA 5AICA 5AM2A 2MA1A 1BGXT 3HKZF 3AM9A 4NJ8A 4RNNA 4ED2A 3DEEA 3H8SA 3PR5B 3PSIA 4KLMA 2NRTA 5ALHA 2V9WA 1V97A 3RBDA 4GXKA 4ED0A 5D49A 1V38A 1UA0A 2IOFA 4YMOA 2OEHA 1ZQTA 3IP4B 4MFCA 2J6SA 3M6ZA 3PW0A 1Z1VA 4KLIA 5KFXA 2KICA 2EZXA 3OHBA 5F9NA 1IG6A 4Q44A 3M8SA 3ISDA 9ICBA 1U4BA 4ZH4A 1UT5A 9ICHA 1ZQCA 3QZ8A 3UMBA 4OO1J 2EZYA 1TKDA 5CHGA 3N4MB 4DQPA 5KAIU 5DG7A 4RT2A 5ALEA 1L3UA 3ZDEA 1PVQA 4I2IA 4WJ3B 3RJKA 5KFFA 5AM0A 1RYRA 1SXDA 4J9KA 5H2FU 3PMLA 3DDHA 2DPIA 2HSZA 2AU0A 4FBTA 7ICUA 3RJFA 2AJQA 4KLGA 2HHWA 2WF6A 4GXIA 4RQ8A 4M2YA 2NRVA 3NVVA 3HKZC 2WF7A 4TUPA 5F9LA 3BQTA 3LVWA 5J8YA 3UMCA 1RXVA 4ECYA 2FMQA 1DGJA 4C8LA 5ALIA 4Y2PA 4CCHA 5J0PA 5KFKA 4QJFB 3F5EA 1HIWA 3Q8PB 2ALZA 2KKVA 5J0TA 3H0LB 1SB3C 3GIMA 2EAMA 2HOFA 1NKCA 3ISBA 4YR0A 4C8KA 4EZ6A 3MABA 1X42A 5KT5A 5B66U 3F2DA 1AQ6A 5KFWA 4Q8FA 1QSLA 1ZYQA 3EZ5A 3BS5A 1B4FA 2E8NA 2W03A 4M9JA 4I2FA 2DKXA 4F3OA 2JZBB 4M9GA 4QWDA 3OPXA 2A1JB 2JXJA 2D6FC 4X5VA 2H3ZA 1ZRMA 3PW4A 1JUDA 5KNIA 1C20A 2BCQA 3SAHA 1VJ5A 2CN1A 3WK7A 4DF8A 3L5KA 2LHTA 4RQ1A 2NO5A 1D8LA 1X40A 5CB1A 4P0QA 2KJ9A 2QB1A 1JI7A 4I2GA 1QLNA 1FEZA 3T5JA 1ZQBA 4KLHA 2E8OA 2WHEA 4OJOA 1L7MA 3Q8SB 3EPGA 2C2DA 1D8BA 1NK7A 5J2AA 2KE7A 1D9FA 4R8UA 4DSIA 2F77X 4PGYA 2G5HB 7ICTA 1K1SA 2MU2A 4O3NA 1L3VA 2PKEA 4EZ9A 2BCRA 5BOMA 4M47A 9ICTA 2EH9A 4NM2A 4KLQA 3JPRA 3OSNA 1NKBA 4J9RA 1L8LA 1ZQUA 4C8OA 4ECRA 2B6GA 4ECVA 2D8CA 1XS9D 4JUZA 4PL1A 5DLGA 4DLEA 5J2EA 4DQQA 4EBEA 4UAWA 1QCKA 2VKQA 4IQWA 4RQ5A 5AKHA 2EAOA 2R18A 4TQSA 3I28A 3F2CA 4M6WA 3PW2A 4Y2JA 2VANA 2W7PA 1T8EA 5KFLA 2IBKA 3N97B 2ZTCA 3MR5A 2NRXA 4DFJA 5DG9A 4O5KA 3THVA 2RHFA 1XC9A 3M1YA 4DOAA 4BXOA 1S76D 5J0XA 2R8GA 4G3IA 4O3SA 1KQQA 4UAZA 2ZXIA 4NLKA 5CJ7A 3BJYA 3WK9A 1KLNA 1CUKA 3PW5A 1D9DA 4LZDA 3V72A 4FE3A 3QNMA 4RU9A 1XU4A 1ZQVA 3PSFA 5C0YA 4KLOA 4J9QA 2FLNA 2F8LA 3A0BU 4RUCA 2JMGA 4C80A 4K4IA 1XSLA 1XO1A 2NO4A 5ALLA 5G5HA 4YN4A 5KFTA 3RBEA 4PL2A 4Q8EA 3TAPA 3RRHA 1WCNA 3RJIA 3PSPA 4F2RA 3NUQA 4I2BA 3ISCA 2KKPA 4QZAA 3SEIA 1FO4A 3ZD8A 4J9PA 1Z19A 5AM1A 4YCXA 3H8JA 7ICOA 3RH6A 2PFNA 2XY7A 3NVYA 5ALJA 1NNLA 3QZ7A 8ICHA 4KLJA 2WAQF 2JRZA 3OSPA 9ICFA 3B0XA 3JPSA 1ZQMA 1SV0C 2BCSA 3NGDA 2BQRA 1FIQA 4ELUA 2LYBA 3R9KA 4RQNA 3K1ZA 2G08A 1XNSA 5KL8B 1ZQIA 2PFPA 4EYHB 1MQ2A 4O3PA 7ICMA 2K4EA 4O3QA 2ASLA 4KN7A 2JH1A 4LVSA 3UQ2A 1HUZA 4ED8A 2XI9A 2OHFA 2O6KA 3K75D 4JV2A 1NK6A 8ICSA 5IIKA 5AKJA 8ICOA 8ICGA 1ZRNA 4NV0A 5IIIA 5EE3A 2NRZA 2YTUA 1MN8A 3O0FA 5IIJA 2YB1A 1KDHA 4J9SA 4J03A 1X9SA 4C0ZA 4I2JA 3CRXA 4EBDA 1HEKA 5DBBA 4F4YA 4MEYA 3WKBA 1T94A 4F4WA 3QUQA 4GC6A 8ICYA 3WKAA 1S0MA 5KFAA 3RJHA 2HHQA 1KW4A 4DSLA 3SZ2A 4R63A 2EQYA 4JWNA 1SWVA 4C7YA 2CRXA 1S9FA 9ICWA 3QUTA 2BDPA 1PVPA 3SYZA 4IRKA 4C4TA 2WAQC 3BZKA 4YVZA 1FFUA 4DL6A 2NYVA 1X2IA 5KFZA 4TQRA 2OM6A 2IOFK 5DG8A 2W04A 5DQHA 2R8JA 1ZQZA 3V7JA 4RNMA 4M9NA 7ICPA 1YZ6A 2K60A 4KLEA 4P0QB 3D2SA 1ZQKA 8ICTA 2YX8A 3I76A 4OD0A 2K8BB 2UVVA 3D6JA 4ED6A 2A1AA 4US9A 2KVCA 3IM1A 4I2EA 3BQ2A 4XQ8A 3ZDAA 2G07A 4BGDA 4R8UB 1BPEA 3KHGA 1NZBA 2HOIA 3QU4A 2G5IB 3TI0A 5JU5A 4QZGA 1ZQEA 3F5AA 4UATA 1BVSA 4ACOA 4DOCA 5CRXA 3RAXA 2UVWA 4Y2UA 1WYGA 4B9NA 3C5GA 1COOA 1JRPA 3T5HA 2OH2A 3QX7A 3CP8A 3E0FA 3M8RA 2RDJA 7ICLA 1IV8A 2JH7A 5ALNA 1BNOA 4QW9A 3UXOA 4B9LA 3GDXA 4OCZA 4QZDA 2EZZA 3G6YA 2FE9A 4PJ0U 2LPEA 3IN5A 4KLTA 1X9WA 1DRGA 2NRWA 5ALQA 4DL7A 4EX7A 4LJXA 3JPPA 3VCBA 2IA6A 3GV7B 1B43A 4M6WB 2GLEA 9ICUA 4KMOB 4O5CA 3RFAA 1ECWA 4F2SA 3FDSA 4DEZA 1NK8A 1N2XA 3EWAA 2E8PA 3QXGA 2HVIA 5GTHU 4GXJA 7ICRA 5IINA 2XICA 4Y2RA 2Y1IA 3KFUF 3L4PA 2I5HA 3AU6A 4BXOB 4RNOA 2XGQA 4NXZA 1N60A 3M9NB 2LI6A 4I2DA 3Q8MA 1SKWA 3HPOA 2W3SA 1S0NA 2RLTA 3H7IA 4DCCA 4YMMA 1S97A 2B0CA 5KFBA 5IILA 2F2AB 5JRTA 1BPXA 1URJA 4PHPA 4FS2A 3MDCA 2JHDA 5KAFU 4HAIA 2JGAA 3LVVA 3F53A 2R8KA 1KBUA 4DOBA 2H5XA 4DFKA 2P35A 2V4QA 3RF9A 1ZD4A 1ZQQA 1QTMA 4C7ZA 1MA7A 4ED1A 5B5EU 2C2EA 4O3OA 2KVSA 2RDIA 3C2MA 3H0RB 1TAUA 3C1YA 7ICSA 4C8NA 1QQ7A 2AGPA 3GIIA 4EBCA 4DL5A 3CNHA 1ZQ1C 4JK1A 2K89A 3I1YA 1U9LA 3QE9Y 8ICBA 3ZDCA 1RZTA 1WWVA 2KJ5A 5ALGA 1KEJA 2KZ3A 3N7RC 4R66A 5D46A 5AK4A 5G5GA 3C21A 4C4RA 2XCAA 4AYBF 2YY6A 7ICGA 4UAYA 2ZIWA 2CPRA 5KFEA 5J2CA 2ZJAA 1HJPA 3V6KA 4IRDA 4ELVA 5KT6A 2BCVA 5HMMA 4M04A 5ALOA 4DL2A 3RRGA 3TADA 4Z6FA 5KFCA 4QIWF 4BX9C
chains in the Genus database with same CATH topology
3N7PD 3DEEA 4BUGA 2HBKA 2XICA 3F5EA 4QJFB 4PL1A 3KFUF 2H3VA 1HIWA 3PSIA 2HOFA 2KKVA 3AQFA 3H0LB 2OM6A 2VIXA 3T79A 4CGZA 2W04A 3KZXA 3N7SC 2WAQF 2ZIVA 2H3FA 2ZG6A 3SQIA 4CRXA 3F2DA 3D2NA 1ED1A 4P0PA 2DQNB 2K4HA 4P0QB 3D2SA 4OJ6A 4NLBA 2M0NA 3C28A 2VKQA 2YX8A 3IP4B 2XVTA 3M6ZA 4OJLA 1YT3A 2DF4B 2LYBA 2R18A 2Y0SC 2K8BB 2KICA 2W03A 3K1ZA 3ALRA 4JMUA 2G08A 3F2CA 1XNSA 1L6NA 5KL8B 2F2AB 2A3VA 2KVCA 2HBMA 3IG8A 2K8CB 1URJA 3OPXA 2W7PA 2KHVA 2ZIXB 2D6FC 3PZPA 3GU3A 2F76X 2N1RA 2JHDA 3ONNA 5A0LA 2H3ZA 1F44A 4NWIA 2G07A 2H3QA 4NLCA 2JGAA 2K4EA 2RRDA 2Y0SF 2LKYA 2KV2A 1TAMA 1IIPA 3LVVA 3AL0B 3F53A 2VJ4A 3H0MB 1NZBA 1KBUA 2HOIA 2JH1A 1Q3UA 2G5IB 2RHFA 2H3IA 4A8EA 2E1FA 3AQEA 3RF9A 3SAHA 2K8AA 2CN1A 2XI9A 3F5AA 2G0AA 1XO0A 2NV3A 1MA7A 2RP5A 3SAFA 4OO1J 2ZIWB 4ACOA 2VJ5A 3SAGA 5CRXA 2MRLA 2LHTA 5HR7A 4QIWF 3H0RB 3CYMA 4KX3A 2G06A 3IG5A 1Q3VA 1UPHA 2KHQA 2K4IA 1GO3F 4P0QA 1PVRA 2KJ9A 3LYSA 4NV0A 2E5SA 2BDUA 2KNJA 2Z7JA 2ZXIA 3GZFA 2KIWA 1ZQ1C 2ZIUB 1PVQA 2OH2A 4OJPA 3D2QA 2KEYA 2K89A 3CP8A 2GOLA 2XIDA 3E0FA 3O0FA 2WB1C 2ZXHA 2OXOA 3MGVA 4WJ3B 2KOBA 2JH7A 2YB1A 2GH1A 2HBJA 3PSTA 4FE3A 4OJOA 3SMVA 3M7DA 3PSFA 4C0ZA 1CRXA 5C0YA 1WUDA 2F8LA 2DGZA 2ZIVB 2KJ5A 2ZIXA 4U7CA 2Q4TA 4AYBC 3CRXA 4O3MA 2JMGA 3F2BA 1D8BA 3M6KA 4FZLA 5T14A 2G09A 1P7DA 4P0PB 4ICAA 1HEKA 2LBOA 2WB1F 3IN5A 2F77X 3N7RC 1DRGA 2G5HB 4PL2A 2HBLA 4BJQA 5KL1B 3VCBA 1T94A 2HMXA 1A6SA 2PMZC 3L3FX 4OJ5A 2W7OA 4FZNA 3HKZC 3PSPA 4AYBF 3NUQA 4KMOB 2ZIWA 4CDGA 4QIWC 4U6PA 2HOQA 2CPRA 4QNLA 1SZHA 2KKPA 2KJ8A 1A0PA 3NRWA 3LVWA 3RFAA 2CRXA 3C29A 5HR6A 1ECWA 2LYAA 4GFJA 1Z19A 1PVPA 3ICXA 4KX5A 2WAQC 2OYYA 4IC9A 2PMZF 2MA1A 2ZIUA 3HKZF 2E1EA 3VC8A 4FZMA 2YB4A 1OUQA 1Z1BA 2KD1A 4BX9C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KMO B;  4BX9 C; 
#chains in the Genus database with same CATH topology
 2XO7 A;  5J0O A;  4E0D A;  1VDV A;  2H3V A;  3PY8 A;  3H8M A;  7ICQ A;  5ALR A;  4K4H A;  1XSP A;  3MR6 A;  4DF4 A;  3SQI A;  1ED1 A;  4TUR A;  4P0P A;  2LM4 A;  1QH9 A;  5IIO A;  4Z6D A;  2DF4 B;  4KLL A;  3GIL A;  4PHD A;  5ALT A;  3ALR A;  1BNP A;  3UMG A;  4CF4 A;  4O9M A;  1PK3 A;  3IG8 A;  1JMS A;  3HIL A;  2ZUD A;  1LV5 A;  1CEZ A;  2KG5 A;  5AKE A;  4FO6 A;  4DFM A;  4RUA A;  1S77 D;  2LYH A;  2KV2 A;  1IIP A;  3H0M B;  4DQS A;  3KBB A;  4HYK A;  5ALU A;  2FLP A;  5KG1 A;  1WWU A;  3PNC A;  3FM9 A;  3BQ0 A;  3RTV A;  2MRL A;  5HR7 A;  2DBY A;  3QU7 A;  3RB3 A;  2BKE A;  1RQN A;  3GV8 B;  1BPB A;  2JV3 A;  3KKA C;  2KN7 A;  4J9O A;  2IMW P;  3PO5 A;  3TAC B;  3PST A;  4MF8 A;  4P4P A;  4NLN A;  4IQT A;  2DGZ A;  2ZIX A;  4AYB C;  3M6K A;  1ZQJ A;  4YP3 A;  5AIB A;  4ED7 A;  3AUO A;  1ZQX A;  4Y2Y A;  9ICO A;  4FS1 A;  2PFQ A;  9ICK A;  4P4M A;  2HBL A;  5AIA A;  2QAR A;  4QZI A;  5AI8 A;  4MF2 A;  3MFH A;  1ZD3 A;  3SD7 A;  4I2C A;  1YZ7 A;  4QIW C;  5BPC A;  1Q46 A;  1X9X A;  1A0P A;  3KHR A;  4YXM A;  4IR1 A;  2JR5 A;  5AKK A;  4O5E A;  5KFH A;  4RQ6 A;  3SV3 A;  4UB2 A;  5J2I A;  3C2L A;  5L1J A;  3UXP A;  2OWO A;  4Y2T A;  2W8L A;  5L1K A;  5KFR A;  4UAV A;  4XA5 A;  2M9N A;  5KG5 A;  5J2D A;  1L6N A;  8ICU A;  2K8C B;  3PX0 A;  3TAR A;  5L1L A;  5AM5 A;  4B6J A;  1TAM A;  1X9M A;  4ELT A;  1VLB A;  3TQ1 A;  3AQE A;  5J0Q A;  3QUC A;  3BDP A;  3BQ1 A;  1ZQY A;  3V6H A;  4K4G A;  2DKZ A;  2VA2 A;  3ETL A;  4F5Q A;  3CYM A;  2G06 A;  4CNQ A;  3PMN A;  3WKE A;  2HCF A;  2K4I A;  3IDW A;  2E5S A;  2BDU A;  2KNJ A;  1Q8K A;  9ICC A;  3BZC A;  1X6J A;  2HVH A;  5DQG A;  1ZQS A;  2JEG A;  2HHU A;  4NLG A;  7ICK A;  4M9H A;  4FBU A;  2AXT U;  2YMQ A;  5CWR A;  5J2J A;  3QU9 A;  2BGW A;  3AN1 A;  5AK3 A;  1UT8 A;  4O3M A;  4U7C A;  1ZQR A;  2Q4T A;  3ZDD A;  1S8O A;  3GIJ A;  2ODG A;  9ICJ A;  4DFP A;  1BPZ A;  3IV6 A;  2K4P A;  3G6V A;  5TIS U;  4NL9 A;  3Q8Q B;  3UM9 A;  2W11 A;  4KTQ A;  2KJ8 A;  1RG6 A;  5HR6 A;  3B0Y A;  5AM4 A;  1L7P A;  4DFD A;  2KZM A;  4DSJ A;  2L5Y A;  2KMD A;  2PXI A;  5HP4 A;  3SEN A;  2HHT A;  5DB8 A;  4IQV A;  4EEK A;  1OUQ A;  2MUT A;  7ICV A;  2W9C A;  2IHM A;  4I29 A;  4NM1 A;  3KTQ A;  5KFJ A;  2BQ3 A;  4RQ4 A;  2WFA A;  1JRO A;  1JX4 A;  5EWE A;  4IQU A;  1N56 A;  3EW9 A;  5DB7 A;  1L7O A;  4QWE A;  3RJG A;  3UPQ A;  1V85 A;  4F4X A;  3QEA Z;  3RB0 A;  2BZF A;  1PZN A;  4ECT A;  1J97 A;  1H38 A;  8ICP A;  8ICC A;  4ECU A;  5DKW A;  5KG4 A;  3TFR A;  1DK3 A;  1F44 A;  5A0L A;  5J8Y C;  4EEN A;  5KT7 A;  2H3Q A;  2W43 A;  2LKY A;  2VJ4 A;  5AM3 A;  3LWL A;  1K1Q A;  1NZP A;  7ICF A;  9ICR A;  1ARO P;  3QU2 A;  3SAF A;  3HW8 A;  2ZIW B;  9ICI A;  3QUB A;  5K4L A;  3PX4 A;  3IHQ B;  4TUQ A;  3ZD9 A;  2KHQ A;  3N28 A;  4YR3 A;  1PVR A;  1J2M A;  1TVA A;  4RQ0 A;  9ICE A;  5CA7 A;  3MGV A;  3TAQ A;  3SMV A;  2HHV A;  2UVU A;  3KD3 A;  2AH5 A;  9ICS A;  3RB4 A;  4KLF A;  4QWB A;  2WF9 A;  3F2B A;  5DGB A;  4P0P B;  3ORY A;  1SL0 A;  2FPK A;  3B9J A;  1JN3 A;  3Q8R B;  3L3F X;  1NK4 A;  3BQ7 A;  1FFV A;  4YD1 A;  4QNL A;  5KT3 A;  8ICJ A;  3G6X A;  3Q8K A;  1ZQN A;  4GC7 A;  2ZIU A;  2ZTE A;  2E1E A;  2WF8 A;  1Z1B A;  2KTQ A;  2KD1 A;  1LVH A;  5AK5 A;  2FPM A;  4J9N A;  5KFP A;  5DLF A;  2RQ5 A;  1ZET A;  2ZIV A;  4MFA A;  2ZG6 A;  2KSO A;  5L9X A;  2DQN B;  4RPY A;  4BDP A;  1YT3 A;  5ALX A;  4QZ8 A;  4P4O A;  1TE2 A;  4UB8 U;  3HP6 A;  4F4K A;  2A3V A;  2QLT A;  4RT3 A;  4EYI B;  2ES6 A;  2ZIX B;  2EDU A;  1N61 A;  1JIH A;  4PGX A;  2RRD A;  4F4Z A;  3RH4 A;  5KFO A;  2QAR B;  2JEJ A;  4F8R A;  1U48 A;  1ZQL A;  1J2N A;  1O03 A;  2MAX A;  4YR2 A;  3JPQ A;  1N63 A;  4XRH A;  3MGI A;  1U49 A;  5DBA A;  8ICQ A;  2Y1J A;  2VJ5 A;  5EE0 A;  2F1H A;  3SAG A;  4Q45 A;  4DL4 A;  4KX3 A;  1Y88 A;  5HNK A;  5DDM A;  3HRD D;  1IXR A;  1KFT A;  1ZQO A;  1ZQP A;  3GZF A;  1DOQ A;  1UCV A;  1U45 A;  4I28 A;  4DSF A;  3HT3 A;  3D2Q A;  2KIV A;  4CE6 A;  2XID A;  2ISP A;  4CF5 A;  2FLL A;  1BPD A;  5AKG A;  2HHX A;  1NK9 A;  4O3R A;  2P66 A;  3M7D A;  4RZR A;  2IOH A;  3QU5 A;  4PZO A;  5AI4 A;  2E3T A;  4J9L A;  4IS7 A;  8ICM A;  1NOM A;  2AGO A;  2YN4 A;  4QZF A;  4YMN A;  4FZN A;  3GQC A;  1M6Y A;  8ICA A;  5J0W A;  5ALD A;  1KN5 A;  1N5X A;  3GV5 B;  3TKA A;  4GFJ A;  5ALP A;  4C8M A;  4IC9 A;  2PFO A;  2F1J A;  1D8Y A;  2JEF A;  4PH5 A;  8ICF A;  8ICR A;  9ICX A;  1K5O A;  3TFS A;  4F5N A;  1A76 A;  1OW5 A;  5BOL A;  1NKE A;  4CRX A;  4YXJ A;  1N62 A;  2AQ0 A;  4RQ3 A;  3SV4 A;  4I27 A;  5J2H A;  3PVX A;  5TZV A;  5KFG A;  4GIB A;  5JUM A;  8ICV A;  4DSE A;  2YQE A;  3RAQ A;  1DXS A;  1Z00 B;  4NWI A;  1KL9 A;  1WCL A;  2Y0S F;  3MR2 A;  3V7K A;  5DGA A;  3JPN A;  1RYS A;  3EPI A;  1MQ3 A;  2J6T A;  2EAP A;  2W9B A;  3TAN A;  7ICE A;  3C1Z A;  4M0A A;  1TV9 A;  1NJX A;  5CEH A;  1T4G A;  3H8W A;  1GO3 F;  8ICE A;  4YQW A;  1DK2 A;  4IRC A;  4JV0 A;  4B9U A;  3SR6 A;  2KEY A;  2GOL A;  2MUT B;  9ICG A;  1ZD2 P;  2KOB A;  2W9C B;  2W9M A;  1SKS A;  2FMP A;  4PGQ A;  1N48 A;  2YMP A;  1TK0 A;  4DQR A;  5KG3 A;  4QZE A;  4UBC A;  4R65 A;  3GFK B;  1SXE A;  7ICN A;  3OHA A;  2R8H A;  4P2H A;  3DV9 A;  5KL1 B;  4Z6E A;  1A6S A;  2HMX A;  1KFS A;  5F3X B;  1KTQ A;  1NJY A;  3C29 A;  5KG6 A;  2LYA A;  5L1I A;  4FFD A;  1L3S A;  2ZUC A;  4KX5 A;  4YD2 A;  2ISO A;  2BPG A;  3T3F A;  5KG0 A;  3VC8 A;  1Z4N A;  4F92 B;  4DO9 A;  4IL6 U;  2ZUB A;  4F93 B;  4QZH A;  4UW9 A;  4UQG A;  2VIX A;  4CGZ A;  1B22 A;  1KFD A;  3AEV A;  2K4H A;  5IIM A;  4OJ6 A;  4NLB A;  3H4B A;  3U26 A;  3AMZ A;  1KKX A;  2Y0S C;  1RDF A;  4JB3 A;  2LMR A;  2KK0 A;  1SKR A;  2BCU A;  4J9M A;  2FMS A;  2W3R A;  2XCP A;  5J0R A;  5EOZ A;  1PK1 B;  5KFU A;  4MEX A;  5ALW A;  1ZJN A;  3ED5 A;  1NJW A;  2QKQ A;  2YML A;  1XO0 A;  2RP5 A;  1BPY A;  5AKY A;  1F0M A;  2PI5 A;  3K1R B;  4F72 A;  3RJE A;  1MSW D;  1ZQA A;  1NK0 A;  2KIW A;  2ZIU B;  2BPC A;  5KFY A;  2ZJ5 A;  4F5O A;  7ICH A;  2ASD A;  2OCE A;  3T5K A;  1RPL A;  3NVZ A;  1CRX A;  2XC9 A;  8ICK A;  2ZIV B;  2KSO B;  2A19 A;  1SV0 A;  2Y9T A;  2KFZ A;  1P7D A;  4ICA A;  2LBO A;  4DWI A;  2GWS A;  4PHE A;  1NK5 A;  4B9T A;  5HHH A;  3MBY A;  3E2E A;  2W7O A;  4ECW A;  4C4S A;  1UA1 A;  4UB1 A;  5KT2 A;  4I2H A;  4U6P A;  2FDR A;  2LM1 A;  4UB6 U;  1SZP A;  2HW3 A;  8ICN A;  1T3N A;  3RB6 A;  3QEB Z;  3WK5 A;  1JAL A;  3UQ0 A;  4Y2S A;  1WG8 A;  2FPL A;  1A77 A;  1LKY A;  3KZX A;  5J29 A;  4RPX A;  4ECX A;  5GTI U;  9ICM A;  3D2N A;  1RXW A;  7ICI A;  4DS4 A;  4KLS A;  2GO7 A;  2QB0 A;  1TK8 A;  2AGQ A;  3E58 A;  2BR0 A;  5KFV A;  2KZZ A;  2FI1 A;  1SV4 A;  8ICX A;  7ICJ A;  1ZQD A;  5J2F A;  4GLX A;  1UQV A;  4KMU A;  1B0X A;  3H4D A;  5ALF A;  3HWT A;  3M9M B;  1NJZ A;  1XSN A;  1Q3U A;  3FYH A;  4ECS A;  5KFQ A;  3EYZ A;  3K4G A;  2J6U A;  5AKX A;  2I1Q A;  1T7P A;  4EX6 A;  3MC1 A;  1V9P A;  5HHI A;  4PPX A;  1Q3V A;  3KZI U;  1L5U A;  1UPH A;  3OJS A;  5EWG A;  2Z7J A;  4QWC A;  2ATL A;  2W9A A;  1ZQF A;  1ZD5 A;  2D3D A;  2W54 A;  1CI4 A;  3WU2 U;  4F5R A;  3IRU A;  2BPF A;  1TK5 A;  3NS1 A;  4O0I A;  3JPT A;  2G09 A;  4DSK A;  3RR7 A;  2BQU A;  5EWF A;  5KG7 A;  2P6R A;  4NLZ A;  8ICW A;  4UAS A;  3ZDB A;  1Z4O A;  5J0S A;  4M9L A;  2KP7 A;  5ALK A;  3V7L A;  1X66 A;  4B9S A;  3KHL A;  3MDA A;  3ICX A;  1QSS A;  4G9B A;  4QWA A;  2HHS A;  1L7N A;  1Z00 A;  8ICI A;  4Q43 A;  1S10 A;  4FZM A;  2YB4 A;  2W9B B;  2C2R A;  1Z3E B;  2HBK A;  5J2G A;  3CW2 C;  5CP2 A;  4QZB A;  3PR4 A;  2R8I A;  1O08 A;  3N7S C;  5DQI A;  3MGH A;  5CR0 A;  3RJJ A;  2DL0 A;  1IM4 A;  2M0N A;  4DQI A;  2XVT A;  4OJL A;  4USA A;  4UAU A;  3RH5 A;  5DB9 A;  3NAS A;  9ICQ A;  5KFM A;  1ZOL A;  3HX0 A;  4UAR A;  3PZP A;  3GU3 A;  2F76 X;  2P6U A;  3ONN A;  4NLC A;  4F71 A;  3H40 A;  3NVW A;  4RQ2 A;  3LK9 A;  3TAD C;  1TFR A;  4KN4 A;  2HDO A;  5E79 U;  4ED3 A;  2XY5 A;  2ASJ A;  5JTI A;  3EUB 2;  1ZXI A;  2EAN A;  4AP9 A;  4TUS A;  2DUY A;  3IG5 A;  2KFN A;  3LYS A;  3WK4 A;  4NY8 A;  2AHO B;  2PI4 A;  4OJP A;  4QW8 A;  4RPZ A;  5C5J A;  9ICN A;  1QQ5 A;  2GH1 A;  3C5F A;  1C7Y A;  1NI3 A;  3JPO A;  3V6J A;  1OXJ A;  2F3N A;  1WUD A;  2WF5 A;  2F44 A;  3OJU A;  2C22 A;  2JEI A;  4FZL A;  3MFI A;  2WB1 F;  4UB3 A;  4DS5 A;  4F50 A;  5AHX A;  3PW7 A;  3BS7 A;  2XY6 A;  5ALM A;  4EEY A;  4JV1 A;  2AQ4 A;  3T79 A;  2HOQ A;  2UVR A;  2YMM A;  5AKI A;  3C23 A;  5AKZ A;  1HUO A;  5KFD A;  5ALZ A;  5J0U A;  4ZOH C;  2PMZ F;  5J0Y A;  3A0H U;  2IHN A;  9ICL A;  5ALS A;  3J81 j;  1PK1 A;  4F5P A;  3WK6 A;  5J2B A;  3AU2 A;  4US8 A;  3AQF A;  4Y2V A;  4BWM A;  3NRZ A;  1RQL A;  1S0O A;  4B9M A;  1JXE A;  1ZQG A;  1QSY A;  8ICL A;  3C28 A;  1L3T A;  3QYP A;  3OTQ A;  4UB4 A;  4BWJ A;  2B21 A;  9ICP A;  4KLD A;  1ZQH A;  1U47 A;  4Z6C A;  4IR9 A;  4DLG A;  3S6J A;  1EXN A;  3NTU A;  4R64 A;  5KFS A;  3PV8 A;  5AKL A;  1S0V A;  3AL0 B;  2E1F A;  1UHU A;  2G0A A;  3GIK A;  2NV3 A;  3SI8 A;  8ICZ A;  3BS5 B;  1XWL A;  4RQ7 A;  2DPJ A;  4MHV A;  2CXY A;  2XGP A;  3Q8L A;  2F8K A;  5KG2 A;  4EEL A;  1DGS A;  2WB1 C;  2OXO A;  2HBJ A;  4XUS A;  1SIJ A;  2JZB A;  4DL3 A;  1F5S A;  1LKY B;  1N5W A;  1LB2 B;  1SL2 A;  4I2A A;  2A1J A;  9ICA A;  5T14 A;  5AK6 A;  2WTF A;  2QB0 B;  1TAQ A;  5KFN A;  5DDY A;  5ALV A;  1T3Q A;  3T5L A;  2PMZ C;  4OJ5 A;  4F91 B;  2W8K A;  1SWW A;  4RQM A;  4CDG A;  3UXN A;  1SZH A;  3NRW A;  1SGG A;  3WK8 A;  3HJE A;  2OYY A;  4B9V A;  5AI5 A;  3M9O B;  2F1I A;  2ZTD A;  4Y2X A;  2FJ6 A;  5EE9 A;  3PO4 A;  3N7P D;  4BUG A;  1MC8 A;  3ZI4 A;  4YG2 A;  1JXL A;  1RM6 C;  1X6I A;  4ECZ A;  4PHA A;  2VA8 A;  2H3F A;  5KTQ A;  5L1M A;  5DB6 A;  1S5L U;  2I6X A;  3KKA A;  2C28 A;  5FP0 A;  5DBC A;  4JWM A;  4JMU A;  3WKD A;  4PZN A;  5EE1 A;  4KLU A;  4KIT B;  5KT4 A;  2HBM A;  4CF3 A;  1ZJM A;  4NL9 C;  1KSP A;  2KHV A;  2Y9U A;  3KOO A;  2N1R A;  2DWQ A;  5D4B A;  3LWM A;  9ICV A;  2MSN A;  2E8M A;  4A8E A;  2H3I A;  2K8A A;  5AI0 A;  2BHN A;  5J2K A;  1ZQW A;  4UB5 A;  1RYU A;  5ALY A;  3C2K A;  4QZC A;  1QQ6 A;  1PUZ A;  1COK A;  3FC4 A;  4UBB A;  3OGU A;  4YFK A;  2ZXH A;  4Y2Q A;  2W55 A;  2V4R A;  3WKC A;  3LDA A;  3MR3 A;  5AI9 A;  2I9G A;  4LZG A;  1SL1 A;  4BJQ A;  5HML A;  3RR8 A;  3ETR A;  5KFI A;  3KHH A;  2VA3 A;  3FAH A;  4QZ9 A;  4ECQ A;  2DFL A;  2Q0Z X;  2HI0 A;  2ESE A;  2ZJ8 A;  1L8O A;  1KRP A;  5AI6 A;  3PX6 A;  4MFF A;  5AIC A;  5AM2 A;  2MA1 A;  1BGX T;  3HKZ F;  3AM9 A;  4NJ8 A;  4RNN A;  4ED2 A;  3DEE A;  3H8S A;  3PR5 B;  3PSI A;  4KLM A;  2NRT A;  5ALH A;  2V9W A;  1V97 A;  3RBD A;  4GXK A;  4ED0 A;  5D49 A;  1V38 A;  1UA0 A;  2IOF A;  4YMO A;  2OEH A;  1ZQT A;  3IP4 B;  4MFC A;  2J6S A;  3M6Z A;  3PW0 A;  1Z1V A;  4KLI A;  5KFX A;  2KIC A;  2EZX A;  3OHB A;  5F9N A;  1IG6 A;  4Q44 A;  3M8S A;  3ISD A;  9ICB A;  1U4B A;  4ZH4 A;  1UT5 A;  9ICH A;  1ZQC A;  3QZ8 A;  3UMB A;  4OO1 J;  2EZY A;  1TKD A;  5CHG A;  3N4M B;  4DQP A;  5KAI U;  5DG7 A;  4RT2 A;  5ALE A;  1L3U A;  3ZDE A;  1PVQ A;  4I2I A;  4WJ3 B;  3RJK A;  5KFF A;  5AM0 A;  1RYR A;  1SXD A;  4J9K A;  5H2F U;  3PML A;  3DDH A;  2DPI A;  2HSZ A;  2AU0 A;  4FBT A;  7ICU A;  3RJF A;  2AJQ A;  4KLG A;  2HHW A;  2WF6 A;  4GXI A;  4RQ8 A;  4M2Y A;  2NRV A;  3NVV A;  3HKZ C;  2WF7 A;  4TUP A;  5F9L A;  3BQT A;  3LVW A;  5J8Y A;  3UMC A;  1RXV A;  4ECY A;  2FMQ A;  1DGJ A;  4C8L A;  5ALI A;  4Y2P A;  4CCH A;  5J0P A;  5KFK A;  4QJF B;  3F5E A;  1HIW A;  3Q8P B;  2ALZ A;  2KKV A;  5J0T A;  3H0L B;  1SB3 C;  3GIM A;  2EAM A;  2HOF A;  1NKC A;  3ISB A;  4YR0 A;  4C8K A;  4EZ6 A;  3MAB A;  1X42 A;  5KT5 A;  5B66 U;  3F2D A;  1AQ6 A;  5KFW A;  4Q8F A;  1QSL A;  1ZYQ A;  3EZ5 A;  3BS5 A;  1B4F A;  2E8N A;  2W03 A;  4M9J A;  4I2F A;  2DKX A;  4F3O A;  2JZB B;  4M9G A;  4QWD A;  3OPX A;  2A1J B;  2JXJ A;  2D6F C;  4X5V A;  2H3Z A;  1ZRM A;  3PW4 A;  1JUD A;  5KNI A;  1C20 A;  2BCQ A;  3SAH A;  1VJ5 A;  2CN1 A;  3WK7 A;  4DF8 A;  3L5K A;  2LHT A;  4RQ1 A;  2NO5 A;  1D8L A;  1X40 A;  5CB1 A;  4P0Q A;  2KJ9 A;  2QB1 A;  1JI7 A;  4I2G A;  1QLN A;  1FEZ A;  3T5J A;  1ZQB A;  4KLH A;  2E8O A;  2WHE A;  4OJO A;  1L7M A;  3Q8S B;  3EPG A;  2C2D A;  1D8B A;  1NK7 A;  5J2A A;  2KE7 A;  1D9F A;  4R8U A;  4DSI A;  2F77 X;  4PGY A;  2G5H B;  7ICT A;  1K1S A;  2MU2 A;  4O3N A;  1L3V A;  2PKE A;  4EZ9 A;  2BCR A;  5BOM A;  4M47 A;  9ICT A;  2EH9 A;  4NM2 A;  4KLQ A;  3JPR A;  3OSN A;  1NKB A;  4J9R A;  1L8L A;  1ZQU A;  4C8O A;  4ECR A;  2B6G A;  4ECV A;  2D8C A;  1XS9 D;  4JUZ A;  4PL1 A;  5DLG A;  4DLE A;  5J2E A;  4DQQ A;  4EBE A;  4UAW A;  1QCK A;  2VKQ A;  4IQW A;  4RQ5 A;  5AKH A;  2EAO A;  2R18 A;  4TQS A;  3I28 A;  3F2C A;  4M6W A;  3PW2 A;  4Y2J A;  2VAN A;  2W7P A;  1T8E A;  5KFL A;  2IBK A;  3N97 B;  2ZTC A;  3MR5 A;  2NRX A;  4DFJ A;  5DG9 A;  4O5K A;  3THV A;  2RHF A;  1XC9 A;  3M1Y A;  4DOA A;  4BXO A;  1S76 D;  5J0X A;  2R8G A;  4G3I A;  4O3S A;  1KQQ A;  4UAZ A;  2ZXI A;  4NLK A;  5CJ7 A;  3BJY A;  3WK9 A;  1KLN A;  1CUK A;  3PW5 A;  1D9D A;  4LZD A;  3V72 A;  4FE3 A;  3QNM A;  4RU9 A;  1XU4 A;  1ZQV A;  3PSF A;  5C0Y A;  4KLO A;  4J9Q A;  2FLN A;  2F8L A;  3A0B U;  4RUC A;  2JMG A;  4C80 A;  4K4I A;  1XSL A;  1XO1 A;  2NO4 A;  5ALL A;  5G5H A;  4YN4 A;  5KFT A;  3RBE A;  4PL2 A;  4Q8E A;  3TAP A;  3RRH A;  1WCN A;  3RJI A;  3PSP A;  4F2R A;  3NUQ A;  4I2B A;  3ISC A;  2KKP A;  4QZA A;  3SEI A;  1FO4 A;  3ZD8 A;  4J9P A;  1Z19 A;  5AM1 A;  4YCX A;  3H8J A;  7ICO A;  3RH6 A;  2PFN A;  2XY7 A;  3NVY A;  5ALJ A;  1NNL A;  3QZ7 A;  8ICH A;  4KLJ A;  2WAQ F;  2JRZ A;  3OSP A;  9ICF A;  3B0X A;  3JPS A;  1ZQM A;  1SV0 C;  2BCS A;  3NGD A;  2BQR A;  1FIQ A;  4ELU A;  2LYB A;  3R9K A;  4RQN A;  3K1Z A;  2G08 A;  1XNS A;  5KL8 B;  1ZQI A;  2PFP A;  4EYH B;  1MQ2 A;  4O3P A;  7ICM A;  2K4E A;  4O3Q A;  2ASL A;  4KN7 A;  2JH1 A;  4LVS A;  3UQ2 A;  1HUZ A;  4ED8 A;  2XI9 A;  2OHF A;  2O6K A;  3K75 D;  4JV2 A;  1NK6 A;  8ICS A;  5IIK A;  5AKJ A;  8ICO A;  8ICG A;  1ZRN A;  4NV0 A;  5III A;  5EE3 A;  2NRZ A;  2YTU A;  1MN8 A;  3O0F A;  5IIJ A;  2YB1 A;  1KDH A;  4J9S A;  4J03 A;  1X9S A;  4C0Z A;  4I2J A;  3CRX A;  4EBD A;  1HEK A;  5DBB A;  4F4Y A;  4MEY A;  3WKB A;  1T94 A;  4F4W A;  3QUQ A;  4GC6 A;  8ICY A;  3WKA A;  1S0M A;  5KFA A;  3RJH A;  2HHQ A;  1KW4 A;  4DSL A;  3SZ2 A;  4R63 A;  2EQY A;  4JWN A;  1SWV A;  4C7Y A;  2CRX A;  1S9F A;  9ICW A;  3QUT A;  2BDP A;  1PVP A;  3SYZ A;  4IRK A;  4C4T A;  2WAQ C;  3BZK A;  4YVZ A;  1FFU A;  4DL6 A;  2NYV A;  1X2I A;  5KFZ A;  4TQR A;  2OM6 A;  2IOF K;  5DG8 A;  2W04 A;  5DQH A;  2R8J A;  1ZQZ A;  3V7J A;  4RNM A;  4M9N A;  7ICP A;  1YZ6 A;  2K60 A;  4KLE A;  4P0Q B;  3D2S A;  1ZQK A;  8ICT A;  2YX8 A;  3I76 A;  4OD0 A;  2K8B B;  2UVV A;  3D6J A;  4ED6 A;  2A1A A;  4US9 A;  2KVC A;  3IM1 A;  4I2E A;  3BQ2 A;  4XQ8 A;  3ZDA A;  2G07 A;  4BGD A;  4R8U B;  1BPE A;  3KHG A;  1NZB A;  2HOI A;  3QU4 A;  2G5I B;  3TI0 A;  5JU5 A;  4QZG A;  1ZQE A;  3F5A A;  4UAT A;  1BVS A;  4ACO A;  4DOC A;  5CRX A;  3RAX A;  2UVW A;  4Y2U A;  1WYG A;  4B9N A;  3C5G A;  1COO A;  1JRP A;  3T5H A;  2OH2 A;  3QX7 A;  3CP8 A;  3E0F A;  3M8R A;  2RDJ A;  7ICL A;  1IV8 A;  2JH7 A;  5ALN A;  1BNO A;  4QW9 A;  3UXO A;  4B9L A;  3GDX A;  4OCZ A;  4QZD A;  2EZZ A;  3G6Y A;  2FE9 A;  4PJ0 U;  2LPE A;  3IN5 A;  4KLT A;  1X9W A;  1DRG A;  2NRW A;  5ALQ A;  4DL7 A;  4EX7 A;  4LJX A;  3JPP A;  3VCB A;  2IA6 A;  3GV7 B;  1B43 A;  4M6W B;  2GLE A;  9ICU A;  4KMO B;  4O5C A;  3RFA A;  1ECW A;  4F2S A;  3FDS A;  4DEZ A;  1NK8 A;  1N2X A;  3EWA A;  2E8P A;  3QXG A;  2HVI A;  5GTH U;  4GXJ A;  7ICR A;  5IIN A;  2XIC A;  4Y2R A;  2Y1I A;  3KFU F;  3L4P A;  2I5H A;  3AU6 A;  4BXO B;  4RNO A;  2XGQ A;  4NXZ A;  1N60 A;  3M9N B;  2LI6 A;  4I2D A;  3Q8M A;  1SKW A;  3HPO A;  2W3S A;  1S0N A;  2RLT A;  3H7I A;  4DCC A;  4YMM A;  1S97 A;  2B0C A;  5KFB A;  5IIL A;  2F2A B;  5JRT A;  1BPX A;  1URJ A;  4PHP A;  4FS2 A;  3MDC A;  2JHD A;  5KAF U;  4HAI A;  2JGA A;  3LVV A;  3F53 A;  2R8K A;  1KBU A;  4DOB A;  2H5X A;  4DFK A;  2P35 A;  2V4Q A;  3RF9 A;  1ZD4 A;  1ZQQ A;  1QTM A;  4C7Z A;  1MA7 A;  4ED1 A;  5B5E U;  2C2E A;  4O3O A;  2KVS A;  2RDI A;  3C2M A;  3H0R B;  1TAU A;  3C1Y A;  7ICS A;  4C8N A;  1QQ7 A;  2AGP A;  3GII A;  4EBC A;  4DL5 A;  3CNH A;  1ZQ1 C;  4JK1 A;  2K89 A;  3I1Y A;  1U9L A;  3QE9 Y;  8ICB A;  3ZDC A;  1RZT A;  1WWV A;  2KJ5 A;  5ALG A;  1KEJ A;  2KZ3 A;  3N7R C;  4R66 A;  5D46 A;  5AK4 A;  5G5G A;  3C21 A;  4C4R A;  2XCA A;  4AYB F;  2YY6 A;  7ICG A;  4UAY A;  2ZIW A;  2CPR A;  5KFE A;  5J2C A;  2ZJA A;  1HJP A;  3V6K A;  4IRD A;  4ELV A;  5KT6 A;  2BCV A;  5HMM A;  4M04 A;  5ALO A;  4DL2 A;  3RRG A;  3TAD A;  4Z6F A;  5KFC A;  4QIW F;  4BX9 C; 
#chains in the Genus database with same CATH homology
 3N7P D;  3DEE A;  4BUG A;  2HBK A;  2XIC A;  3F5E A;  4QJF B;  4PL1 A;  3KFU F;  2H3V A;  1HIW A;  3PSI A;  2HOF A;  2KKV A;  3AQF A;  3H0L B;  2OM6 A;  2VIX A;  3T79 A;  4CGZ A;  2W04 A;  3KZX A;  3N7S C;  2WAQ F;  2ZIV A;  2H3F A;  2ZG6 A;  3SQI A;  4CRX A;  3F2D A;  3D2N A;  1ED1 A;  4P0P A;  2DQN B;  2K4H A;  4P0Q B;  3D2S A;  4OJ6 A;  4NLB A;  2M0N A;  3C28 A;  2VKQ A;  2YX8 A;  3IP4 B;  2XVT A;  3M6Z A;  4OJL A;  1YT3 A;  2DF4 B;  2LYB A;  2R18 A;  2Y0S C;  2K8B B;  2KIC A;  2W03 A;  3K1Z A;  3ALR A;  4JMU A;  2G08 A;  3F2C A;  1XNS A;  1L6N A;  5KL8 B;  2F2A B;  2A3V A;  2KVC A;  2HBM A;  3IG8 A;  2K8C B;  1URJ A;  3OPX A;  2W7P A;  2KHV A;  2ZIX B;  2D6F C;  3PZP A;  3GU3 A;  2F76 X;  2N1R A;  2JHD A;  3ONN A;  5A0L A;  2H3Z A;  1F44 A;  4NWI A;  2G07 A;  2H3Q A;  4NLC A;  2JGA A;  2K4E A;  2RRD A;  2Y0S F;  2LKY A;  2KV2 A;  1TAM A;  1IIP A;  3LVV A;  3AL0 B;  3F53 A;  2VJ4 A;  3H0M B;  1NZB A;  1KBU A;  2HOI A;  2JH1 A;  1Q3U A;  2G5I B;  2RHF A;  2H3I A;  4A8E A;  2E1F A;  3AQE A;  3RF9 A;  3SAH A;  2K8A A;  2CN1 A;  2XI9 A;  3F5A A;  2G0A A;  1XO0 A;  2NV3 A;  1MA7 A;  2RP5 A;  3SAF A;  4OO1 J;  2ZIW B;  4ACO A;  2VJ5 A;  3SAG A;  5CRX A;  2MRL A;  2LHT A;  5HR7 A;  4QIW F;  3H0R B;  3CYM A;  4KX3 A;  2G06 A;  3IG5 A;  1Q3V A;  1UPH A;  2KHQ A;  2K4I A;  1GO3 F;  4P0Q A;  1PVR A;  2KJ9 A;  3LYS A;  4NV0 A;  2E5S A;  2BDU A;  2KNJ A;  2Z7J A;  2ZXI A;  3GZF A;  2KIW A;  1ZQ1 C;  2ZIU B;  1PVQ A;  2OH2 A;  4OJP A;  3D2Q A;  2KEY A;  2K89 A;  3CP8 A;  2GOL A;  2XID A;  3E0F A;  3O0F A;  2WB1 C;  2ZXH A;  2OXO A;  3MGV A;  4WJ3 B;  2KOB A;  2JH7 A;  2YB1 A;  2GH1 A;  2HBJ A;  3PST A;  4FE3 A;  4OJO A;  3SMV A;  3M7D A;  3PSF A;  4C0Z A;  1CRX A;  5C0Y A;  1WUD A;  2F8L A;  2DGZ A;  2ZIV B;  2KJ5 A;  2ZIX A;  4U7C A;  2Q4T A;  4AYB C;  3CRX A;  4O3M A;  2JMG A;  3F2B A;  1D8B A;  3M6K A;  4FZL A;  5T14 A;  2G09 A;  1P7D A;  4P0P B;  4ICA A;  1HEK A;  2LBO A;  2WB1 F;  3IN5 A;  2F77 X;  3N7R C;  1DRG A;  2G5H B;  4PL2 A;  2HBL A;  4BJQ A;  5KL1 B;  3VCB A;  1T94 A;  2HMX A;  1A6S A;  2PMZ C;  3L3F X;  4OJ5 A;  2W7O A;  4FZN A;  3HKZ C;  3PSP A;  4AYB F;  3NUQ A;  4KMO B;  2ZIW A;  4CDG A;  4QIW C;  4U6P A;  2HOQ A;  2CPR A;  4QNL A;  1SZH A;  2KKP A;  2KJ8 A;  1A0P A;  3NRW A;  3LVW A;  3RFA A;  2CRX A;  3C29 A;  5HR6 A;  1ECW A;  2LYA A;  4GFJ A;  1Z19 A;  1PVP A;  3ICX A;  4KX5 A;  2WAQ C;  2OYY A;  4IC9 A;  2PMZ F;  2MA1 A;  2ZIU A;  3HKZ F;  2E1E A;  3VC8 A;  4FZM A;  2YB4 A;  1OUQ A;  1Z1B A;  2KD1 A;  4BX9 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...