4BX9C

Human vps33a in complex with a fragment of human vps16
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
95
structure length
95
Chain Sequence
ERIEGRVAALQTAADAFYKAKNEFAAKATEDQMRLLRLQRRLEDELGGQFLDLSLHDTVTTLILGGHNKRAEQLARDFRIPDKRLWWLKLTALAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords VACUOLAR PROTEIN SORTING-ASSOCIATED PROTEIN 33A
publication title Structural basis of Vps33A recruitment to the human HOPS complex by Vps16.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 38
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2013-07-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.780 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 4bx9C00
4BX9C 4KMOB
chains in the Genus database with same CATH superfamily
1JMSA 4OJ5A 1L7NA 1UCVA 3DEEA 2BQUA 1DK3A 2ODGA 2P6RA 3EYZA 2BPGA 2N1RA 1S76D 4EBDA 4NJ8A 2R8GA 1ZXIA 5KFRA 2RRDA 4PGQA 3TACB 3IG8A 3JPTA 2VJ4A 2ASLA 3NVVA 2Q0ZX 3QUCA 1QTMA 1SV0A 4DL6A 2HI0A 3PSPA 5G5GA 2XY6A 4DSKA 3B0YA 2Y1IA 3C28A 1J97A 2F8KA 4ELTA 5J0OA 2KSOB 5EE3A 4DSJA 2LMRA 3N7RC 4B9MA 4ED7A 3QU7A 1ZQRA 2D6FC 2H3IA 3B0XA 1ZQXA 3TQ1A 2KVCA 5KFLA 1S8OA 3RFAA 2KG5A 3M9NB 1EXNA 1BGXT 1S10A 2HBJA 2JRZA 3JPNA 3QU5A 4FS2A 2KKVA 2BQ3A 4FBUA 4DL7A 1CEZA 4Z6CA 4C4RA 2BHNA 4KLSA 1T3QA 1KN5A 4J9SA 4O9MA 5K4LA 1TAMA 2H3QA 4B6JA 4GXIA 1DRGA 1UHUA 5KFPA 2ZIUB 4Z6FA 4YP3A 3G6VA 4DF4A 4DEZA 2IBKA 5J0WA 2BDPA 2W04A 4YXMA 2JZBB 2HHUA 1C20A 3K1RB 4GC6A 3KOOA 2FMPA 3SZ2A 4EYHB 1KFTA 5HMLA 4Z6DA 2IHNA 7ICHA 9ICHA 4I2EA 1ZQFA 2YB4A 2JH1A 2W55A 3EPIA 4F2RA 2M9NA 3NS1A 1ZQKA 3H8JA 4KN7A 3IP4B 3PO4A 4KLUA 2EH9A 4QZDA 4UATA 1ZD5A 4ECYA 2HDOA 4KTQA 4X5VA 2HW3A 2F1JA 3TADA 2FI1A 1N5XA 3AEVA 4QWBA 2GH1A 4QW8A 1D8LA 2E1FA 2OHFA 3MGVA 5DGAA 4R63A 3N28A 2V4QA 1D8BA 1QQ6A 5AI0A 4JV0A 4Y2YA 3PW2A 4B9UA 1F44A 1DGJA 5ALDA 4QIWC 3VCBA 1ZQVA 3WKEA 4Q8EA 2LM1A 3SQIA 5J8YC 3M6KA 5KNIA 3C23A 4Y2SA 2GLEA 4BX9C 9ICUA 2KZ3A 4C8OA 4K4IA 4CCHA 4M6WB 5AM2A 2XC9A 4QZFA 2JH7A 4YR0A 1BPEA 2GWSA 3D6JA 2XCPA 2FPLA 1L7OA 3SEIA 4O3PA 2KZZA 1ZQ1C 3BQTA 2L5YA 2AHOB 3KTQA 4ELVA 1ZQIA 2E8PA 5ALKA 3RTVA 3IHQB 2DF4B 4RNNA 4I2BA 4QIWF 5KFVA 4Y2RA 7ICKA 1SGGA 1ZRNA 2BGWA 4KLIA 2F76X 1BVSA 2ES6A 5G5HA 5DQHA 4UAWA 5CWRA 2W3RA 4YCXA 5AI8A 4ECTA 5DBCA 5KT4A 5J0PA 2C28A 3T5JA 2ZTCA 4QZBA 8ICOA 3E58A 2G08A 3AUOA 9ICRA 1BPDA 1NNLA 2MAXA 2ZJAA 8ICJA 2QKQA 2AQ0A 4MF8A 3TARA 3QUBA 3OHAA 7ICMA 2KEYA 2BR0A 1MSWD 1S0OA 3AQFA 3UMCA 2UVRA 3KHGA 5ALFA 2WB1C 1PK1B 4KITB 2PMZF 2LYAA 3N7SC 5AK5A 3SENA 4F5NA 1WUDA 4UBBA 2Y0SC 4USAA 2WF7A 1UT8A 4YMNA 4O0IA 5CEHA 9ICEA 1TK8A 3Q8RB 2DKXA 5ALHA 4MEYA 3MR5A 5J2GA 2KIVA 4LZDA 4FS1A 1NJWA 9ICLA 8ICIA 1ZJMA 1JRPA 4I2IA 2YMPA 1PK3A 3F2CA 3RBEA 1RXWA 1DOQA 3H4DA 4DL3A 3LVVA 3T5KA 3MDAA 5D4BA 4NM1A 3WKBA 4GIBA 2XCAA 4JB3A 2LKYA 5EWGA 2WB1F 3HILA 2HCFA 4UB5A 4K4GA 3H7IA 5BOLA 5A0LA 3V72A 5KG3A 3WU2U 2K4IA 3JPSA 3V6JA 1NI3A 5AICA 4C8NA 3NGDA 2KSOA 2XIDA 2RDJA 9ICGA 3SMVA 2KICA 5HR6A 3ISCA 1XSNA 3CW2C 3QEAZ 5T14A 4Q43A 5ALQA 5F9LA 3M9OB 4EENA 4J9LA 4BDPA 2MUTB 1ZETA 3PW7A 3GU3A 1KFDA 4OJLA 3I76A 4O5CA 2WFAA 1NK6A 2PKEA 3WK7A 3GV8B 5KT7A 3C2LA 4DL5A 4CRXA 1L7MA 2ESEA 5C5JA 1LVHA 1K1SA 4P4OA 3T79A 3CYMA 1XNSA 5J2KA 2XICA 4B9NA 5KFXA 4UB6U 4RZRA 3KHRA 2F2AB 2DBYA 3H4BA 4ZOHC 4F4KA 4Q8FA 4RUCA 1Z19A 3FC4A 4DOCA 2YB1A 2W7PA 5AKKA 4DFPA 3F5EA 1ZD4A 2EZZA 4GLXA 5AI9A 2JZBA 3LYSA 3K1ZA 3V7LA 2KJ5A 4NL9C 3PW5A 8ICLA 4C8LA 4MEXA 3HP6A 3RB6A 5D46A 4PGXA 5KT3A 5KL1B 5ALSA 4PL1A 3RR8A 7ICLA 3MABA 5EOZA 4RPYA 3C2MA 2W7OA 2W11A 5CP2A 3SAHA 1JROA 3A0HU 1SXDA 1U47A 2MU2A 2DUYA 2K4PA 4KLHA 5ALMA 3PO5A 4NLCA 7ICTA 2P66A 5IIMA 5J0SA 4B9VA 1T8EA 3I1YA 4DSIA 1TAUA 3OHBA 5IINA 3SYZA 5ALOA 2BCUA 4YR2A 1ZQNA 4C8MA 2ZTEA 2AGOA 1NOMA 5FP0A 5J2CA 3MBYA 2V4RA 5E79U 5DB7A 4QZ8A 3D2QA 3TAPA 4CF5A 1BPBA 4F4WA 1XSLA 3BQ1A 2DPJA 2KD1A 4UW9A 1ZQPA 3UQ0A 4IR1A 5AKEA 5ALGA 1A76A 4IR9A 5ALNA 3WK4A 1Y88A 4F50A 4CE6A 1IM4A 1ZQEA 4GFJA 4JK1A 8ICKA 4US9A 3AL0B 1ZJNA 2JXJA 2WF8A 3QU9A 1U48A 2E1EA 5KFBA 1IG6A 5KFOA 5BPCA 4O5KA 1SIJA 2E8OA 5H2FU 1U49A 4M9LA 4B9SA 3SAFA 2ZXHA 3HT3A 3GIIA 2XI9A 1SKWA 2W9AA 3Q8PB 4FZLA 1QSLA 5EWFA 7ICQA 3RJFA 8ICBA 9ICKA 2KK0A 5KFTA 7ICJA 2R8IA 8ICTA 1COOA 2YMQA 1NK4A 7ICPA 5HP4A 4US8A 1XO1A 2CRXA 4BWMA 2B6GA 2BCVA 5DDMA 1SL2A 2QB0B 5IIJA 2NRZA 3M9MB 1RYUA 3ZD8A 2DPIA 1COKA 3ONNA 8ICRA 3IM1A 4HYKA 3K75D 4BJQA 3UM9A 4UB3A 4PHDA 2J6SA 4AP9A 2EANA 5AM1A 4O3OA 1NKCA 1PK1A 1JN3A 4KLMA 3LVWA 4DWIA 1BNPA 1X9WA 2R8HA 2G5HB 2CPRA 1NJXA 4EYIB 3AQEA 2EAPA 4PPXA 2KN7A 8ICYA 1QCKA 4NLBA 1S0VA 4G3IA 4QZIA 4ED6A 2OWOA 3LWLA 1KBUA 5CA7A 4J9KA 5BOMA 3RAXA 1DXSA 4FO6A 5GTIU 3GV7B 4EX7A 1V97A 5IIOA 1JX4A 9ICJA 4KX3A 1QSSA 5D49A 5KFMA 5ALIA 4UQGA 4ACOA 2AQ4A 5L1IA 4YR3A 1MN8A 4F92B 1A0PA 3TANA 1HUZA 3PSFA 5J2AA 2XGQA 7ICOA 1RG6A 1FIQA 5AI4A 4TUPA 3RJIA 4IL6U 1UT5A 4RQMA 3QU2A 1SKSA 2MA1A 5J2JA 4O3MA 1JI7A 3R9KA 3N97B 4XUSA 2KP7A 3BQ0A 3V6KA 3SR6A 3RF9A 4RNMA 1L3TA 1XU4A 3WKAA 2FMSA 1KSPA 9ICFA 4ED2A 2RLTA 3T3FA 2EAOA 8ICCA 2H3VA 2MUTA 1AROP 1SXEA 5DG8A 3GV5B 3Q8KA 1NK7A 2HHXA 3MR6A 1ZYQA 5KFYA 4PL2A 4QZ9A 2WF9A 3TAQA 2ALZA 1D9DA 1N61A 4DSLA 9ICQA 3CP8A 2ZJ5A 5KFWA 4OJPA 5ALWA 2XVTA 2BDUA 2HOIA 4DQRA 2WHEA 1L5UA 7ICSA 4Q45A 4EZ6A 3HWTA 5J0UA 2OCEA 2FMQA 4F4XA 3EZ5A 8ICNA 2KFNA 4UB8U 4QZEA 4O3QA 3C29A 4C4TA 5IIIA 5F3XB 2W9CB 1PUZA 3PV8A 4F5QA 4OJ6A 1U45A 1V38A 4ICAA 2YTUA 1PVQA 4G9BA 4M0AA 1L3SA 5J8YA 1ZD3A 5DBBA 4IRDA 2FPKA 3RBDA 4RPZA 2HOQA 4DQIA 3BZKA 4PJ0U 1YZ6A 2VIXA 2JEFA 2IHMA 2G06A 4TURA 4Y2QA 1RQLA 4RQ4A 3OJUA 3NRWA 4DS5A 2VANA 1DK2A 2HSZA 3WKDA 1ECWA 3N7PD 4I2CA 3G6YA 4C4SA 1TK0A 1N62A 5ALVA 3RJEA 1B43A 2GOLA 5J2IA 1CUKA 5ALRA 5KFHA 9ICAA 4IQVA 1S77D 3GZFA 4I2AA 4BUGA 2HHQA 4NLKA 2OH2A 5DBAA 2PFNA 1WCLA 4BWJA 4PZNA 4O5EA 4GXKA 3BS7A 3QEBZ 2RHFA 2LHTA 3PX0A 1X6JA 4KMUA 4KMOB 2E8NA 2F1HA 1L8OA 5KL8B 5DQIA 1Z4OA 1TE2A 3H8WA 3KFUF 2AU0A 9ICPA 4I2HA 3TKAA 4AYBC 2FDRA 2FLPA 5J0XA 2F77X 3J81j 3ZD9A 2OXOA 2ZIWB 3PW0A 3PNCA 4OJOA 3BQ7A 5B5EU 4XRHA 2V9WA 4ZH4A 2Z7JA 5ALXA 2A1AA 2EQYA 3SI8A 3M6ZA 4RQ3A 1D8YA 3MR2A 3RRHA 4MFAA 3H8SA 1T4GA 2O6KA 8ICMA 2F1IA 3L4PA 5J0YA 4MFFA 4UAZA 3WK9A 2EAMA 2FLLA 3NRZA 4CNQA 5JU5A 5AM4A 4FZMA 3WKCA 2C2EA 5HHHA 4NLGA 4DQSA 1X9XA 2QB0A 4B9TA 4AYBF 1ZQSA 2W03A 1LKYA 3RJHA 2K8BB 3AM9A 3RAQA 4NXZA 3A0BU 3ETRA 2K8AA 2KNJA 4MFCA 1BNOA 5KG6A 3AU6A 5KFCA 1JALA 1ZQOA 1N60A 2KZMA 3ZDBA 4RNOA 4RQ5A 3RRGA 2NO4A 3QU4A 8ICAA 1QQ5A 4TQSA 3SV4A 4I2JA 3BJYA 1KRPA 1SKRA 3BS5B 4U6PA 1VLBA 1RM6C 5AKLA 5DG9A 1UQVA 5KG1A 4HAIA 3TI0A 3HPOA 7ICVA 2KVSA 1F5SA 4IQUA 2HVHA 3IG5A 4IS7A 3C5GA 4M9GA 4YMMA 4WJ3B 1OXJA 1SZHA 4GXJA 1IIPA 2FPMA 1K5OA 1WG8A 2D8CA 5JUMA 2F44A 4QWDA 5J2EA 5AIBA 4JUZA 2IOFK 5KFZA 2I5HA 2KV2A 2UVVA 2BQRA 1JUDA 3HRDD 1N5WA 1B0XA 3C1ZA 9ICNA 2Y0SF 2DFLA 1FFUA 5KFQA 3H0MB 4UB2A 5KFKA 4KN4A 1U9LA 3DDHA 2D3DA 4QWAA 5B66U 2LPEA 4J9OA 4XQ8A 2W9BA 2WAQC 3H0LB 4IQWA 4NL9A 2JGAA 5F9NA 1XC9A 4P0QA 3BQ2A 1XS9D 2KMDA 4F4YA 4C0ZA 2ZIXB 5DB6A 3Q8MA 2ZIVB 2JEJA 1NZBA 1Z00A 3OJSA 8ICHA 5ALEA 4DOAA 8ICUA 2HBMA 2XY5A 1RYSA 4DQQA 2CN1A 1NK9A 5JRTA 2OM6A 3ZDDA 3JPQA 1S5LU 4FE3A 4UARA 2HBLA 4YMOA 5ALUA 1ZQQA 1U4BA 2KJ9A 1T7PA 1L3VA 4KLDA 4F72A 3WK6A 2ASJA 2W9CA 1ZQBA 3NUQA 2WAQF 2IOHA 4XA5A 5ALJA 2BCRA 3EUB2 4ED8A 3M8SA 4DFMA 2KHQA 5KFUA 2NRWA 3EW9A 1QQ7A 1ZQHA 1XO0A 2W8KA 4ED3A 2I9GA 3ALRA 4UB4A 3QYPA 2G09A 1KDHA 4MF2A 2E3TA 2DQNB 3HKZC 4QW9A 1BPYA 2KTQA 2I1QA 2E8MA 3OTQA 2NRVA 4NLZA 4RPXA 3C5FA 4P4MA 3RB0A 2XO7A 3UQ2A 5AKJA 4ED0A 1MC8A 2LM4A 3CNHA 4QWEA 3KHLA 4RT3A 5ALZA 2ZUDA 1LB2B 1WYGA 3OSPA 1PZNA 3K4GA 5KAFU 2W8LA 1Q3VA 4M2YA 4KLGA 4I27A 3MC1A 5KFAA 1L7PA 2YY6A 4EEYA 1QLNA 3FYHA 2IOFA 2BZFA 2EZYA 3F2DA 1A77A 4J9PA 4F5PA 5L1KA 3HKZF 4LJXA 3QNMA 2BKEA 3T5LA 2ZIWA 4FZNA 7ICUA 2P6UA 1KL9A 3GIJA 1GO3F 3M1YA 5EE1A 3M8RA 2MSNA 8ICSA 4PGYA 4P4PA 3Q8SB 4RT2A 3QUQA 4NLNA 3RR7A 3MDCA 1SWWA 4F71A 2WTFA 4DS4A 4UAUA 5DLFA 1ZOLA 4ED1A 1HEKA 3G6XA 4UB1A 5J0QA 9ICSA 1L8LA 4ECSA 1KKXA 3RJKA 5AK3A 9ICTA 2ISPA 5CRXA 1L6NA 2I6XA 2E5SA 4KLQA 3RB4A 4RQ0A 9ICBA 3GIKA 1N63A 2ISOA 4Y2JA 4LZGA 4ECWA 2P35A 4U7CA 2PI4A 3RH5A 3UMBA 1LKYB 1SWVA 4RQ8A 1CRXA 1RYRA 3UXOA 3TFRA 5AKGA 3GFKB 2R18A 4DLGA 1UA0A 7ICEA 5C0YA 4CDGA 2FE9A 2XY7A 1ZQTA 2W9MA 5CR0A 4EZ9A 1NK5A 1YZ7A 3BS5A 4Y2PA 3KKAC 4JWMA 3GIMA 1Z1BA 4I2GA 1VDVA 2HMXA 3LDAA 2GO7A 5J2HA 4DL2A 2J6TA 2K60A 3JPPA 5KG7A 3PMNA 1SV4A 4EBEA 1OW5A 3Q8QB 3NVWA 4DQPA 4NM2A 3H0RB 2R8KA 4UAVA 5AM5A 3F2BA 4J9NA 4M04A 3PX6A 2C2RA 1NK8A 3AMZA 2G5IB 1AQ6A 1HUOA 5IILA 1SL0A 1P7DA 1PVPA 2ZTDA 4ECXA 3MFIA 4F93B 1NKEA 8ICXA 4P0PA 4TUQA 3ORYA 1D9FA 4KX5A 3PMLA 1V9PA 5AI6A 1O08A 4DFKA 2YQEA 1TAQA 2W9BB 2KOBA 4YG2A 1KW4A 2PFQA 1S9FA 4RUAA 3C2KA 5KTQA 1ZQJA 4P0QB 3NVYA 2ZIXA 3ZDAA 2AJQA 3SD7A 3OPXA 1NJYA 2ZIVA 1MA7A 4Y2TA 1NKBA 5AM3A 1X9SA 1Z00B 5HMMA 1ZQZA 5TISU 5J2BA 1C7YA 3PY8A 4ECQA 4M9NA 1ZQUA 2FJ6A 3KD3A 5DKWA 4UAYA 2ZJ8A 4IC9A 3QXGA 3TFSA 3QUTA 4DSEA 4O3SA 1SV0C 5KFFA 2JEGA 1A6SA 2F8LA 5AKZA 1KQQA 3RJGA 1Z4NA 2DKZA 2ATLA 2BCSA 2M0NA 1WCNA 2A19A 3WK8A 5L9XA 4GC7A 2HHSA 3MR3A 5KFIA 1H38A 1TFRA 1ZQMA 1KFSA 2EDUA 9ICWA 1Q8KA 3L3FX 7ICIA 1MQ2A 3LWMA 3GQCA 3EWAA 5EE0A 3QZ7A 4RQ2A 3OGUA 4DSFA 3AU2A 5ALYA 4NWIA 2K4EA 4QZAA 1X40A 5DB8A 3PX4A 3KBBA 3PSTA 2AGPA 2C2DA 2K89A 1SB3C 5J29A 3QX7A 5KFDA 2B21A 4ECZA 3ZDEA 1WWVA 1TV9A 5KT2A 3PW4A 4EX6A 4C7ZA 2QB1A 3GDXA 3AN1A 3DV9A 3UXPA 1XWLA 5KFNA 7ICNA 5HHIA 9ICXA 2VA8A 1N48A 2ASDA 4IQTA 2IA6A 1FO4A 1S0NA 4M9JA 3PR4A 4C80A 8ICWA 1ZQCA 1VJ5A 1ED1A 4J03A 1PVRA 3HX0A 4DFDA 5IIKA 4RQ1A 1X2IA 2B0CA 4Y2VA 2VA3A 3NASA 4TQRA 4BXOB 5DG7A 3UXNA 2R8JA 4M9HA 5HR7A 4PHAA 2FLNA 2BCQA 3FDSA 2NRXA 1KTQA 3TADC 4LVSA 3LK9A 2NV3A 5TZVA 1UA1A 5ALLA 1X66A 5KFEA 2G0AA 2JEIA 3FAHA 1Z1VA 2H3FA 3B9JA 3GILA 1L3UA 4R8UB 3V7JA 2LYHA 4CF4A 4EELA 2WF5A 3RJJA 1X9MA 5CB1A 4EBCA 2BPFA 4JV2A 2PMZC 1DGSA 5KFSA 4PHPA 3O0FA 4O3NA 5KG0A 4C8KA 8ICVA 4KLJA 5AKHA 1KLNA 4O3RA 4B9LA 4Y2XA 1T3NA 5AKYA 3D2SA 1Z3EB 1RQNA 2ZUCA 2YX8A 5GTHU 1K1QA 3PVXA 1NK0A 9ICMA 1Q46A 5AHXA 4P2HA 3V6HA 2YMLA 1RDFA 5J0TA 4RQ6A 1V85A 3HJEA 3KZIU 4R66A 2A1JB 4Y2UA 3VC8A 1RXVA 4A8EA 2PI5A 4YD2A 3IN5A 3HW8A 5J2DA 4J9QA 2QARA 1NZPA 2VKQA 4IRKA 4JMUA 3EPGA 4QZHA 1BPZA 3F53A 2JR5A 3NTUA 5KT6A 5DGBA 1ZQLA 4EEKA 2HBKA 3ISBA 4JWNA 3KZXA 4OO1J 5AK4A 1SZPA 5AI5A 2DWQA 5AKIA 4KLLA 4TUSA 2LI6A 3E0FA 9ICOA 4YD1A 2Y9UA 3T5HA 2JHDA 2NYVA 2YMMA 4DO9A 2KE7A 1Q3UA 3UPQA 2KHVA 2VA2A 4ELUA 3NVZA 4P0PB 2OYYA 2WF6A 3QE9Y 2KJ8A 2RQ5A 4J9MA 4ECRA 1TKDA 1ZQDA 2NRTA 3D2NA 2LYBA 3PR5B 1MQ3A 3I28A 3L5KA 4DLEA 8ICPA 4KLTA 1BPXA 4I28A 4FFDA 4KLEA 1N2XA 3ZI4A 4NV0A 3U26A 4KLOA 1JXEA 1CI4A 3FM9A 1YT3A 1FFVA 5ALTA 4JV1A 2AH5A 4QJFB 2C22A 5J0RA 1QSYA 4F5RA 2A3VA 1O03A 5DQGA 5KG4A 4F91B 4R64A 5AM0A 3OSNA 4IRCA 4I29A 1HJPA 2DL0A 4Z6EA 2ZUBA 3THVA 2PFPA 1M6YA 4QZCA 5AK6A 2IMWP 3MGIA 2NO5A 4Q44A 3H40A 2ZIUA 3V7KA 1QH9A 3BZCA 5J2FA 2KFZA 1TK5A 3WK5A 4QNLA 2UVWA 4NY8A 3MGHA 2J6UA 3IV6A 2DGZA 4OCZA 2G07A 2RDIA 3QZ8A 5EE9A 9ICVA 3F5AA 8ICQA 4F5OA 8ICEA 1WWUA 5KT5A 2HOFA 4DOBA 1J2MA 5KFJA 4YVZA 5CJ7A 5KG5A 3ISDA 1HIWA 2VJ5A 4QZGA 2XGPA 7ICFA 4ECUA 4E0DA 3RB3A 5L1JA 3C21A 4F8RA 4DF8A 4F3OA 9ICCA 3ETLA 4F4ZA 3IRUA 4RQ7A 3Q8LA 8ICFA 1KEJA 2AXTU 3SAGA 2ZG6A 5DDYA 1X6IA 1JIHA 2PXIA 3SV3A 4PZOA 5HNKA 1TVAA 7ICRA 1T94A 2W3SA 2CXYA 3PZPA 1IV8A 3RH6A 1LV5A 2HHVA 2UVUA 1ZQAA 1J2NA 3UMGA 5DLGA 2HHTA 2EZXA 4I2FA 1SL1A 4M6WA 4BXOA 1B22A 4DCCA 5KAIU 4FBTA 3ICXA 5EWEA 7ICGA 3ZDCA 2Y9TA 1JXLA 4QWCA 3RH4A 2F3NA 2Q4TA 4I2DA 2KKPA 4YXJA 2LBOA 3ED5A 3C1YA 4R8UA 3CRXA 5DB9A 3KHHA 3JPOA 2W54A 3N4MB 2HVIA 3PSIA 5AIAA 3KKAA 2MRLA 4M47A 4K4HA 4UASA 4YN4A 4BGDA 4CF3A 4PHEA 4DFJA 1ZQGA 1FEZA 8ICGA 1X42A 2JV3A 1ZD2P 5JTIA 4UBCA 2OEHA 8ICZA 2KIWA 1NJZA 4RU9A 4PH5A 2JMGA 1OUQA 3JPRA 1XSPA 4R65A 2K8CB 4MHVA 2PFOA 3MFHA 5KG2A 4OD0A 3S6JA 3IDWA 1RPLA 1IXRA 4DL4A 9ICIA 3M7DA 4ECVA 3BDPA 2A1JA 1RZTA 1ZQYA 4YFKA 1ZRMA 2QLTA 5CHGA 1B4FA 4J9RA 2RP5A 4RQNA 3E2EA 5ALPA 1URJA 1UPHA 5L1LA 2QARB 2HHWA 4KLFA 5KFGA 2K4HA 1N56A 1S97A 1F0MA 2H3ZA 4C7YA 2AGQA 2ZXIA 5AKXA 2W43A 4F2SA 2Y1JA 2YN4A 1S0MA 3H8MA 2H5XA 4YQWA 4CGZA 5L1MA 1ZQWA 2BPCA
chains in the Genus database with same CATH topology
3SMVA 4OJ5A 2KICA 2XIDA 3LVWA 5HR6A 3DEEA 2F77X 3VC8A 3ALRA 3ICXA 4A8EA 2OXOA 2ZIWB 4P0QB 3IN5A 5T14A 2ZIXA 2YB4A 2JH1A 2G09A 2G5HB 2CPRA 2KV2A 4OJOA 4U7CA 3D2QA 3AQEA 3GU3A 2N1RA 4OJLA 2Z7JA 2G08A 3OPXA 2ZIVA 1MA7A 3HKZC 2DQNB 2Q4TA 3M6ZA 3C29A 2KD1A 2KKPA 2RRDA 4NLBA 3IG8A 1CRXA 2VJ4A 2ZIUA 2LBOA 3IP4B 2VKQA 2Y0SF 3CRXA 4JMUA 1KBUA 4OJ6A 2KEYA 2R18A 4QNLA 3H0MB 1ED1A 4CRXA 3PSPA 3F53A 2DGZA 4GFJA 4ICAA 1PVRA 3PSIA 2G07A 4KX3A 4CDGA 1PVQA 5C0YA 2MRLA 3AQFA 2HBKA 3C28A 2GH1A 3AL0B 2E1FA 3F5AA 3CYMA 3KZXA 3MGVA 3T79A 4IC9A 4ACOA 1XNSA 4OO1J 2E1EA 2WAQC 4FZMA 3H0LB 2XICA 2WB1C 1A0PA 3E0FA 1D8BA 5HR7A 2JHDA 2HOQA 3N7RC 2JGAA 2KIWA 3PSFA 2PMZF 2LYAA 3N7SC 1F44A 2VIXA 4P0QA 4QIWC 2F2AB 3VCBA 1Q3VA 1WUDA 2HOFA 2G06A 2D6FC 2H3IA 4AYBF 4C0ZA 2ZIXB 1A6SA 1Q3UA 1Z19A 2NV3A 2W03A 2F8LA 2KHVA 2Y0SC 3NRWA 3SAFA 2G0AA 1Z1BA 2JMGA 1OUQA 2ZXHA 3SQIA 2K8BB 2KVCA 2H3FA 2HMXA 1HIWA 2VJ5A 2YB1A 2W7PA 2ZIVB 2K8AA 2MA1A 2KNJA 3F5EA 3M6KA 1NZBA 4O3MA 2OYYA 2K8CB 2XI9A 4P0PB 2M0NA 3LYSA 3RFAA 2KJ8A 3K1ZA 4BX9C 1ECWA 3N7PD 3F2DA 2KJ5A 4FZLA 2HBJA 3D2NA 3M7DA 2HBMA 3RF9A 2LYBA 3HKZF 2GOLA 3H0RB 2KKVA 2CN1A 5KL1B 2OM6A 3L3FX 4PL1A 2JH7A 3SAGA 3F2BA 2ZG6A 3GZFA 2PMZC 2ZIWA 4FZNA 4BUGA 2W7OA 4FE3A 3F2CA 2HBLA 2CRXA 2RP5A 3O0FA 2H3VA 3SAHA 2OH2A 1GO3F 3LVVA 1TAMA 2H3QA 4NV0A 2KJ9A 4NWIA 2G5IB 1ZQ1C 4PL2A 1YT3A 1T94A 2K4EA 2RHFA 1DRGA 4U6PA 1URJA 2LHTA 1UPHA 2LKYA 2WAQF 2ZIUB 1HEKA 2WB1F 3NUQA 1PVPA 3PSTA 1P7DA 3D2SA 2K89A 3CP8A 4KMOB 3ONNA 4QJFB 2K4HA 2YX8A 4NLCA 3PZPA 5A0LA 2DF4B 4QIWF 2H3ZA 2K4IA 5KL8B 2W04A 4BJQA 4P0PA 2ZXIA 4OJPA 2A3VA 3IG5A 4KX5A 2XVTA 3KFUF 2BDUA 2HOIA 4WJ3B 5CRXA 1SZHA 1IIPA 2KHQA 1L6NA 2F76X 2E5SA 4AYBC 4CGZA 1XO0A 2KOBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BX9 C;  4KMO B; 
#chains in the Genus database with same CATH topology
 1JMS A;  4OJ5 A;  1L7N A;  1UCV A;  3DEE A;  2BQU A;  1DK3 A;  2ODG A;  2P6R A;  3EYZ A;  2BPG A;  2N1R A;  1S76 D;  4EBD A;  4NJ8 A;  2R8G A;  1ZXI A;  5KFR A;  2RRD A;  4PGQ A;  3TAC B;  3IG8 A;  3JPT A;  2VJ4 A;  2ASL A;  3NVV A;  2Q0Z X;  3QUC A;  1QTM A;  1SV0 A;  4DL6 A;  2HI0 A;  3PSP A;  5G5G A;  2XY6 A;  4DSK A;  3B0Y A;  2Y1I A;  3C28 A;  1J97 A;  2F8K A;  4ELT A;  5J0O A;  2KSO B;  5EE3 A;  4DSJ A;  2LMR A;  3N7R C;  4B9M A;  4ED7 A;  3QU7 A;  1ZQR A;  2D6F C;  2H3I A;  3B0X A;  1ZQX A;  3TQ1 A;  2KVC A;  5KFL A;  1S8O A;  3RFA A;  2KG5 A;  3M9N B;  1EXN A;  1BGX T;  1S10 A;  2HBJ A;  2JRZ A;  3JPN A;  3QU5 A;  4FS2 A;  2KKV A;  2BQ3 A;  4FBU A;  4DL7 A;  1CEZ A;  4Z6C A;  4C4R A;  2BHN A;  4KLS A;  1T3Q A;  1KN5 A;  4J9S A;  4O9M A;  5K4L A;  1TAM A;  2H3Q A;  4B6J A;  4GXI A;  1DRG A;  1UHU A;  5KFP A;  2ZIU B;  4Z6F A;  4YP3 A;  3G6V A;  4DF4 A;  4DEZ A;  2IBK A;  5J0W A;  2BDP A;  2W04 A;  4YXM A;  2JZB B;  2HHU A;  1C20 A;  3K1R B;  4GC6 A;  3KOO A;  2FMP A;  3SZ2 A;  4EYH B;  1KFT A;  5HML A;  4Z6D A;  2IHN A;  7ICH A;  9ICH A;  4I2E A;  1ZQF A;  2YB4 A;  2JH1 A;  2W55 A;  3EPI A;  4F2R A;  2M9N A;  3NS1 A;  1ZQK A;  3H8J A;  4KN7 A;  3IP4 B;  3PO4 A;  4KLU A;  2EH9 A;  4QZD A;  4UAT A;  1ZD5 A;  4ECY A;  2HDO A;  4KTQ A;  4X5V A;  2HW3 A;  2F1J A;  3TAD A;  2FI1 A;  1N5X A;  3AEV A;  4QWB A;  2GH1 A;  4QW8 A;  1D8L A;  2E1F A;  2OHF A;  3MGV A;  5DGA A;  4R63 A;  3N28 A;  2V4Q A;  1D8B A;  1QQ6 A;  5AI0 A;  4JV0 A;  4Y2Y A;  3PW2 A;  4B9U A;  1F44 A;  1DGJ A;  5ALD A;  4QIW C;  3VCB A;  1ZQV A;  3WKE A;  4Q8E A;  2LM1 A;  3SQI A;  5J8Y C;  3M6K A;  5KNI A;  3C23 A;  4Y2S A;  2GLE A;  4BX9 C;  9ICU A;  2KZ3 A;  4C8O A;  4K4I A;  4CCH A;  4M6W B;  5AM2 A;  2XC9 A;  4QZF A;  2JH7 A;  4YR0 A;  1BPE A;  2GWS A;  3D6J A;  2XCP A;  2FPL A;  1L7O A;  3SEI A;  4O3P A;  2KZZ A;  1ZQ1 C;  3BQT A;  2L5Y A;  2AHO B;  3KTQ A;  4ELV A;  1ZQI A;  2E8P A;  5ALK A;  3RTV A;  3IHQ B;  2DF4 B;  4RNN A;  4I2B A;  4QIW F;  5KFV A;  4Y2R A;  7ICK A;  1SGG A;  1ZRN A;  2BGW A;  4KLI A;  2F76 X;  1BVS A;  2ES6 A;  5G5H A;  5DQH A;  4UAW A;  5CWR A;  2W3R A;  4YCX A;  5AI8 A;  4ECT A;  5DBC A;  5KT4 A;  5J0P A;  2C28 A;  3T5J A;  2ZTC A;  4QZB A;  8ICO A;  3E58 A;  2G08 A;  3AUO A;  9ICR A;  1BPD A;  1NNL A;  2MAX A;  2ZJA A;  8ICJ A;  2QKQ A;  2AQ0 A;  4MF8 A;  3TAR A;  3QUB A;  3OHA A;  7ICM A;  2KEY A;  2BR0 A;  1MSW D;  1S0O A;  3AQF A;  3UMC A;  2UVR A;  3KHG A;  5ALF A;  2WB1 C;  1PK1 B;  4KIT B;  2PMZ F;  2LYA A;  3N7S C;  5AK5 A;  3SEN A;  4F5N A;  1WUD A;  4UBB A;  2Y0S C;  4USA A;  2WF7 A;  1UT8 A;  4YMN A;  4O0I A;  5CEH A;  9ICE A;  1TK8 A;  3Q8R B;  2DKX A;  5ALH A;  4MEY A;  3MR5 A;  5J2G A;  2KIV A;  4LZD A;  4FS1 A;  1NJW A;  9ICL A;  8ICI A;  1ZJM A;  1JRP A;  4I2I A;  2YMP A;  1PK3 A;  3F2C A;  3RBE A;  1RXW A;  1DOQ A;  3H4D A;  4DL3 A;  3LVV A;  3T5K A;  3MDA A;  5D4B A;  4NM1 A;  3WKB A;  4GIB A;  2XCA A;  4JB3 A;  2LKY A;  5EWG A;  2WB1 F;  3HIL A;  2HCF A;  4UB5 A;  4K4G A;  3H7I A;  5BOL A;  5A0L A;  3V72 A;  5KG3 A;  3WU2 U;  2K4I A;  3JPS A;  3V6J A;  1NI3 A;  5AIC A;  4C8N A;  3NGD A;  2KSO A;  2XID A;  2RDJ A;  9ICG A;  3SMV A;  2KIC A;  5HR6 A;  3ISC A;  1XSN A;  3CW2 C;  3QEA Z;  5T14 A;  4Q43 A;  5ALQ A;  5F9L A;  3M9O B;  4EEN A;  4J9L A;  4BDP A;  2MUT B;  1ZET A;  3PW7 A;  3GU3 A;  1KFD A;  4OJL A;  3I76 A;  4O5C A;  2WFA A;  1NK6 A;  2PKE A;  3WK7 A;  3GV8 B;  5KT7 A;  3C2L A;  4DL5 A;  4CRX A;  1L7M A;  2ESE A;  5C5J A;  1LVH A;  1K1S A;  4P4O A;  3T79 A;  3CYM A;  1XNS A;  5J2K A;  2XIC A;  4B9N A;  5KFX A;  4UB6 U;  4RZR A;  3KHR A;  2F2A B;  2DBY A;  3H4B A;  4ZOH C;  4F4K A;  4Q8F A;  4RUC A;  1Z19 A;  3FC4 A;  4DOC A;  2YB1 A;  2W7P A;  5AKK A;  4DFP A;  3F5E A;  1ZD4 A;  2EZZ A;  4GLX A;  5AI9 A;  2JZB A;  3LYS A;  3K1Z A;  3V7L A;  2KJ5 A;  4NL9 C;  3PW5 A;  8ICL A;  4C8L A;  4MEX A;  3HP6 A;  3RB6 A;  5D46 A;  4PGX A;  5KT3 A;  5KL1 B;  5ALS A;  4PL1 A;  3RR8 A;  7ICL A;  3MAB A;  5EOZ A;  4RPY A;  3C2M A;  2W7O A;  2W11 A;  5CP2 A;  3SAH A;  1JRO A;  3A0H U;  1SXD A;  1U47 A;  2MU2 A;  2DUY A;  2K4P A;  4KLH A;  5ALM A;  3PO5 A;  4NLC A;  7ICT A;  2P66 A;  5IIM A;  5J0S A;  4B9V A;  1T8E A;  3I1Y A;  4DSI A;  1TAU A;  3OHB A;  5IIN A;  3SYZ A;  5ALO A;  2BCU A;  4YR2 A;  1ZQN A;  4C8M A;  2ZTE A;  2AGO A;  1NOM A;  5FP0 A;  5J2C A;  3MBY A;  2V4R A;  5E79 U;  5DB7 A;  4QZ8 A;  3D2Q A;  3TAP A;  4CF5 A;  1BPB A;  4F4W A;  1XSL A;  3BQ1 A;  2DPJ A;  2KD1 A;  4UW9 A;  1ZQP A;  3UQ0 A;  4IR1 A;  5AKE A;  5ALG A;  1A76 A;  4IR9 A;  5ALN A;  3WK4 A;  1Y88 A;  4F50 A;  4CE6 A;  1IM4 A;  1ZQE A;  4GFJ A;  4JK1 A;  8ICK A;  4US9 A;  3AL0 B;  1ZJN A;  2JXJ A;  2WF8 A;  3QU9 A;  1U48 A;  2E1E A;  5KFB A;  1IG6 A;  5KFO A;  5BPC A;  4O5K A;  1SIJ A;  2E8O A;  5H2F U;  1U49 A;  4M9L A;  4B9S A;  3SAF A;  2ZXH A;  3HT3 A;  3GII A;  2XI9 A;  1SKW A;  2W9A A;  3Q8P B;  4FZL A;  1QSL A;  5EWF A;  7ICQ A;  3RJF A;  8ICB A;  9ICK A;  2KK0 A;  5KFT A;  7ICJ A;  2R8I A;  8ICT A;  1COO A;  2YMQ A;  1NK4 A;  7ICP A;  5HP4 A;  4US8 A;  1XO1 A;  2CRX A;  4BWM A;  2B6G A;  2BCV A;  5DDM A;  1SL2 A;  2QB0 B;  5IIJ A;  2NRZ A;  3M9M B;  1RYU A;  3ZD8 A;  2DPI A;  1COK A;  3ONN A;  8ICR A;  3IM1 A;  4HYK A;  3K75 D;  4BJQ A;  3UM9 A;  4UB3 A;  4PHD A;  2J6S A;  4AP9 A;  2EAN A;  5AM1 A;  4O3O A;  1NKC A;  1PK1 A;  1JN3 A;  4KLM A;  3LVW A;  4DWI A;  1BNP A;  1X9W A;  2R8H A;  2G5H B;  2CPR A;  1NJX A;  4EYI B;  3AQE A;  2EAP A;  4PPX A;  2KN7 A;  8ICY A;  1QCK A;  4NLB A;  1S0V A;  4G3I A;  4QZI A;  4ED6 A;  2OWO A;  3LWL A;  1KBU A;  5CA7 A;  4J9K A;  5BOM A;  3RAX A;  1DXS A;  4FO6 A;  5GTI U;  3GV7 B;  4EX7 A;  1V97 A;  5IIO A;  1JX4 A;  9ICJ A;  4KX3 A;  1QSS A;  5D49 A;  5KFM A;  5ALI A;  4UQG A;  4ACO A;  2AQ4 A;  5L1I A;  4YR3 A;  1MN8 A;  4F92 B;  1A0P A;  3TAN A;  1HUZ A;  3PSF A;  5J2A A;  2XGQ A;  7ICO A;  1RG6 A;  1FIQ A;  5AI4 A;  4TUP A;  3RJI A;  4IL6 U;  1UT5 A;  4RQM A;  3QU2 A;  1SKS A;  2MA1 A;  5J2J A;  4O3M A;  1JI7 A;  3R9K A;  3N97 B;  4XUS A;  2KP7 A;  3BQ0 A;  3V6K A;  3SR6 A;  3RF9 A;  4RNM A;  1L3T A;  1XU4 A;  3WKA A;  2FMS A;  1KSP A;  9ICF A;  4ED2 A;  2RLT A;  3T3F A;  2EAO A;  8ICC A;  2H3V A;  2MUT A;  1ARO P;  1SXE A;  5DG8 A;  3GV5 B;  3Q8K A;  1NK7 A;  2HHX A;  3MR6 A;  1ZYQ A;  5KFY A;  4PL2 A;  4QZ9 A;  2WF9 A;  3TAQ A;  2ALZ A;  1D9D A;  1N61 A;  4DSL A;  9ICQ A;  3CP8 A;  2ZJ5 A;  5KFW A;  4OJP A;  5ALW A;  2XVT A;  2BDU A;  2HOI A;  4DQR A;  2WHE A;  1L5U A;  7ICS A;  4Q45 A;  4EZ6 A;  3HWT A;  5J0U A;  2OCE A;  2FMQ A;  4F4X A;  3EZ5 A;  8ICN A;  2KFN A;  4UB8 U;  4QZE A;  4O3Q A;  3C29 A;  4C4T A;  5III A;  5F3X B;  2W9C B;  1PUZ A;  3PV8 A;  4F5Q A;  4OJ6 A;  1U45 A;  1V38 A;  4ICA A;  2YTU A;  1PVQ A;  4G9B A;  4M0A A;  1L3S A;  5J8Y A;  1ZD3 A;  5DBB A;  4IRD A;  2FPK A;  3RBD A;  4RPZ A;  2HOQ A;  4DQI A;  3BZK A;  4PJ0 U;  1YZ6 A;  2VIX A;  2JEF A;  2IHM A;  2G06 A;  4TUR A;  4Y2Q A;  1RQL A;  4RQ4 A;  3OJU A;  3NRW A;  4DS5 A;  2VAN A;  1DK2 A;  2HSZ A;  3WKD A;  1ECW A;  3N7P D;  4I2C A;  3G6Y A;  4C4S A;  1TK0 A;  1N62 A;  5ALV A;  3RJE A;  1B43 A;  2GOL A;  5J2I A;  1CUK A;  5ALR A;  5KFH A;  9ICA A;  4IQV A;  1S77 D;  3GZF A;  4I2A A;  4BUG A;  2HHQ A;  4NLK A;  2OH2 A;  5DBA A;  2PFN A;  1WCL A;  4BWJ A;  4PZN A;  4O5E A;  4GXK A;  3BS7 A;  3QEB Z;  2RHF A;  2LHT A;  3PX0 A;  1X6J A;  4KMU A;  4KMO B;  2E8N A;  2F1H A;  1L8O A;  5KL8 B;  5DQI A;  1Z4O A;  1TE2 A;  3H8W A;  3KFU F;  2AU0 A;  9ICP A;  4I2H A;  3TKA A;  4AYB C;  2FDR A;  2FLP A;  5J0X A;  2F77 X;  3J81 j;  3ZD9 A;  2OXO A;  2ZIW B;  3PW0 A;  3PNC A;  4OJO A;  3BQ7 A;  5B5E U;  4XRH A;  2V9W A;  4ZH4 A;  2Z7J A;  5ALX A;  2A1A A;  2EQY A;  3SI8 A;  3M6Z A;  4RQ3 A;  1D8Y A;  3MR2 A;  3RRH A;  4MFA A;  3H8S A;  1T4G A;  2O6K A;  8ICM A;  2F1I A;  3L4P A;  5J0Y A;  4MFF A;  4UAZ A;  3WK9 A;  2EAM A;  2FLL A;  3NRZ A;  4CNQ A;  5JU5 A;  5AM4 A;  4FZM A;  3WKC A;  2C2E A;  5HHH A;  4NLG A;  4DQS A;  1X9X A;  2QB0 A;  4B9T A;  4AYB F;  1ZQS A;  2W03 A;  1LKY A;  3RJH A;  2K8B B;  3AM9 A;  3RAQ A;  4NXZ A;  3A0B U;  3ETR A;  2K8A A;  2KNJ A;  4MFC A;  1BNO A;  5KG6 A;  3AU6 A;  5KFC A;  1JAL A;  1ZQO A;  1N60 A;  2KZM A;  3ZDB A;  4RNO A;  4RQ5 A;  3RRG A;  2NO4 A;  3QU4 A;  8ICA A;  1QQ5 A;  4TQS A;  3SV4 A;  4I2J A;  3BJY A;  1KRP A;  1SKR A;  3BS5 B;  4U6P A;  1VLB A;  1RM6 C;  5AKL A;  5DG9 A;  1UQV A;  5KG1 A;  4HAI A;  3TI0 A;  3HPO A;  7ICV A;  2KVS A;  1F5S A;  4IQU A;  2HVH A;  3IG5 A;  4IS7 A;  3C5G A;  4M9G A;  4YMM A;  4WJ3 B;  1OXJ A;  1SZH A;  4GXJ A;  1IIP A;  2FPM A;  1K5O A;  1WG8 A;  2D8C A;  5JUM A;  2F44 A;  4QWD A;  5J2E A;  5AIB A;  4JUZ A;  2IOF K;  5KFZ A;  2I5H A;  2KV2 A;  2UVV A;  2BQR A;  1JUD A;  3HRD D;  1N5W A;  1B0X A;  3C1Z A;  9ICN A;  2Y0S F;  2DFL A;  1FFU A;  5KFQ A;  3H0M B;  4UB2 A;  5KFK A;  4KN4 A;  1U9L A;  3DDH A;  2D3D A;  4QWA A;  5B66 U;  2LPE A;  4J9O A;  4XQ8 A;  2W9B A;  2WAQ C;  3H0L B;  4IQW A;  4NL9 A;  2JGA A;  5F9N A;  1XC9 A;  4P0Q A;  3BQ2 A;  1XS9 D;  2KMD A;  4F4Y A;  4C0Z A;  2ZIX B;  5DB6 A;  3Q8M A;  2ZIV B;  2JEJ A;  1NZB A;  1Z00 A;  3OJS A;  8ICH A;  5ALE A;  4DOA A;  8ICU A;  2HBM A;  2XY5 A;  1RYS A;  4DQQ A;  2CN1 A;  1NK9 A;  5JRT A;  2OM6 A;  3ZDD A;  3JPQ A;  1S5L U;  4FE3 A;  4UAR A;  2HBL A;  4YMO A;  5ALU A;  1ZQQ A;  1U4B A;  2KJ9 A;  1T7P A;  1L3V A;  4KLD A;  4F72 A;  3WK6 A;  2ASJ A;  2W9C A;  1ZQB A;  3NUQ A;  2WAQ F;  2IOH A;  4XA5 A;  5ALJ A;  2BCR A;  3EUB 2;  4ED8 A;  3M8S A;  4DFM A;  2KHQ A;  5KFU A;  2NRW A;  3EW9 A;  1QQ7 A;  1ZQH A;  1XO0 A;  2W8K A;  4ED3 A;  2I9G A;  3ALR A;  4UB4 A;  3QYP A;  2G09 A;  1KDH A;  4MF2 A;  2E3T A;  2DQN B;  3HKZ C;  4QW9 A;  1BPY A;  2KTQ A;  2I1Q A;  2E8M A;  3OTQ A;  2NRV A;  4NLZ A;  4RPX A;  3C5F A;  4P4M A;  3RB0 A;  2XO7 A;  3UQ2 A;  5AKJ A;  4ED0 A;  1MC8 A;  2LM4 A;  3CNH A;  4QWE A;  3KHL A;  4RT3 A;  5ALZ A;  2ZUD A;  1LB2 B;  1WYG A;  3OSP A;  1PZN A;  3K4G A;  5KAF U;  2W8L A;  1Q3V A;  4M2Y A;  4KLG A;  4I27 A;  3MC1 A;  5KFA A;  1L7P A;  2YY6 A;  4EEY A;  1QLN A;  3FYH A;  2IOF A;  2BZF A;  2EZY A;  3F2D A;  1A77 A;  4J9P A;  4F5P A;  5L1K A;  3HKZ F;  4LJX A;  3QNM A;  2BKE A;  3T5L A;  2ZIW A;  4FZN A;  7ICU A;  2P6U A;  1KL9 A;  3GIJ A;  1GO3 F;  3M1Y A;  5EE1 A;  3M8R A;  2MSN A;  8ICS A;  4PGY A;  4P4P A;  3Q8S B;  4RT2 A;  3QUQ A;  4NLN A;  3RR7 A;  3MDC A;  1SWW A;  4F71 A;  2WTF A;  4DS4 A;  4UAU A;  5DLF A;  1ZOL A;  4ED1 A;  1HEK A;  3G6X A;  4UB1 A;  5J0Q A;  9ICS A;  1L8L A;  4ECS A;  1KKX A;  3RJK A;  5AK3 A;  9ICT A;  2ISP A;  5CRX A;  1L6N A;  2I6X A;  2E5S A;  4KLQ A;  3RB4 A;  4RQ0 A;  9ICB A;  3GIK A;  1N63 A;  2ISO A;  4Y2J A;  4LZG A;  4ECW A;  2P35 A;  4U7C A;  2PI4 A;  3RH5 A;  3UMB A;  1LKY B;  1SWV A;  4RQ8 A;  1CRX A;  1RYR A;  3UXO A;  3TFR A;  5AKG A;  3GFK B;  2R18 A;  4DLG A;  1UA0 A;  7ICE A;  5C0Y A;  4CDG A;  2FE9 A;  2XY7 A;  1ZQT A;  2W9M A;  5CR0 A;  4EZ9 A;  1NK5 A;  1YZ7 A;  3BS5 A;  4Y2P A;  3KKA C;  4JWM A;  3GIM A;  1Z1B A;  4I2G A;  1VDV A;  2HMX A;  3LDA A;  2GO7 A;  5J2H A;  4DL2 A;  2J6T A;  2K60 A;  3JPP A;  5KG7 A;  3PMN A;  1SV4 A;  4EBE A;  1OW5 A;  3Q8Q B;  3NVW A;  4DQP A;  4NM2 A;  3H0R B;  2R8K A;  4UAV A;  5AM5 A;  3F2B A;  4J9N A;  4M04 A;  3PX6 A;  2C2R A;  1NK8 A;  3AMZ A;  2G5I B;  1AQ6 A;  1HUO A;  5IIL A;  1SL0 A;  1P7D A;  1PVP A;  2ZTD A;  4ECX A;  3MFI A;  4F93 B;  1NKE A;  8ICX A;  4P0P A;  4TUQ A;  3ORY A;  1D9F A;  4KX5 A;  3PML A;  1V9P A;  5AI6 A;  1O08 A;  4DFK A;  2YQE A;  1TAQ A;  2W9B B;  2KOB A;  4YG2 A;  1KW4 A;  2PFQ A;  1S9F A;  4RUA A;  3C2K A;  5KTQ A;  1ZQJ A;  4P0Q B;  3NVY A;  2ZIX A;  3ZDA A;  2AJQ A;  3SD7 A;  3OPX A;  1NJY A;  2ZIV A;  1MA7 A;  4Y2T A;  1NKB A;  5AM3 A;  1X9S A;  1Z00 B;  5HMM A;  1ZQZ A;  5TIS U;  5J2B A;  1C7Y A;  3PY8 A;  4ECQ A;  4M9N A;  1ZQU A;  2FJ6 A;  3KD3 A;  5DKW A;  4UAY A;  2ZJ8 A;  4IC9 A;  3QXG A;  3TFS A;  3QUT A;  4DSE A;  4O3S A;  1SV0 C;  5KFF A;  2JEG A;  1A6S A;  2F8L A;  5AKZ A;  1KQQ A;  3RJG A;  1Z4N A;  2DKZ A;  2ATL A;  2BCS A;  2M0N A;  1WCN A;  2A19 A;  3WK8 A;  5L9X A;  4GC7 A;  2HHS A;  3MR3 A;  5KFI A;  1H38 A;  1TFR A;  1ZQM A;  1KFS A;  2EDU A;  9ICW A;  1Q8K A;  3L3F X;  7ICI A;  1MQ2 A;  3LWM A;  3GQC A;  3EWA A;  5EE0 A;  3QZ7 A;  4RQ2 A;  3OGU A;  4DSF A;  3AU2 A;  5ALY A;  4NWI A;  2K4E A;  4QZA A;  1X40 A;  5DB8 A;  3PX4 A;  3KBB A;  3PST A;  2AGP A;  2C2D A;  2K89 A;  1SB3 C;  5J29 A;  3QX7 A;  5KFD A;  2B21 A;  4ECZ A;  3ZDE A;  1WWV A;  1TV9 A;  5KT2 A;  3PW4 A;  4EX6 A;  4C7Z A;  2QB1 A;  3GDX A;  3AN1 A;  3DV9 A;  3UXP A;  1XWL A;  5KFN A;  7ICN A;  5HHI A;  9ICX A;  2VA8 A;  1N48 A;  2ASD A;  4IQT A;  2IA6 A;  1FO4 A;  1S0N A;  4M9J A;  3PR4 A;  4C80 A;  8ICW A;  1ZQC A;  1VJ5 A;  1ED1 A;  4J03 A;  1PVR A;  3HX0 A;  4DFD A;  5IIK A;  4RQ1 A;  1X2I A;  2B0C A;  4Y2V A;  2VA3 A;  3NAS A;  4TQR A;  4BXO B;  5DG7 A;  3UXN A;  2R8J A;  4M9H A;  5HR7 A;  4PHA A;  2FLN A;  2BCQ A;  3FDS A;  2NRX A;  1KTQ A;  3TAD C;  4LVS A;  3LK9 A;  2NV3 A;  5TZV A;  1UA1 A;  5ALL A;  1X66 A;  5KFE A;  2G0A A;  2JEI A;  3FAH A;  1Z1V A;  2H3F A;  3B9J A;  3GIL A;  1L3U A;  4R8U B;  3V7J A;  2LYH A;  4CF4 A;  4EEL A;  2WF5 A;  3RJJ A;  1X9M A;  5CB1 A;  4EBC A;  2BPF A;  4JV2 A;  2PMZ C;  1DGS A;  5KFS A;  4PHP A;  3O0F A;  4O3N A;  5KG0 A;  4C8K A;  8ICV A;  4KLJ A;  5AKH A;  1KLN A;  4O3R A;  4B9L A;  4Y2X A;  1T3N A;  5AKY A;  3D2S A;  1Z3E B;  1RQN A;  2ZUC A;  2YX8 A;  5GTH U;  1K1Q A;  3PVX A;  1NK0 A;  9ICM A;  1Q46 A;  5AHX A;  4P2H A;  3V6H A;  2YML A;  1RDF A;  5J0T A;  4RQ6 A;  1V85 A;  3HJE A;  3KZI U;  4R66 A;  2A1J B;  4Y2U A;  3VC8 A;  1RXV A;  4A8E A;  2PI5 A;  4YD2 A;  3IN5 A;  3HW8 A;  5J2D A;  4J9Q A;  2QAR A;  1NZP A;  2VKQ A;  4IRK A;  4JMU A;  3EPG A;  4QZH A;  1BPZ A;  3F53 A;  2JR5 A;  3NTU A;  5KT6 A;  5DGB A;  1ZQL A;  4EEK A;  2HBK A;  3ISB A;  4JWN A;  3KZX A;  4OO1 J;  5AK4 A;  1SZP A;  5AI5 A;  2DWQ A;  5AKI A;  4KLL A;  4TUS A;  2LI6 A;  3E0F A;  9ICO A;  4YD1 A;  2Y9U A;  3T5H A;  2JHD A;  2NYV A;  2YMM A;  4DO9 A;  2KE7 A;  1Q3U A;  3UPQ A;  2KHV A;  2VA2 A;  4ELU A;  3NVZ A;  4P0P B;  2OYY A;  2WF6 A;  3QE9 Y;  2KJ8 A;  2RQ5 A;  4J9M A;  4ECR A;  1TKD A;  1ZQD A;  2NRT A;  3D2N A;  2LYB A;  3PR5 B;  1MQ3 A;  3I28 A;  3L5K A;  4DLE A;  8ICP A;  4KLT A;  1BPX A;  4I28 A;  4FFD A;  4KLE A;  1N2X A;  3ZI4 A;  4NV0 A;  3U26 A;  4KLO A;  1JXE A;  1CI4 A;  3FM9 A;  1YT3 A;  1FFV A;  5ALT A;  4JV1 A;  2AH5 A;  4QJF B;  2C22 A;  5J0R A;  1QSY A;  4F5R A;  2A3V A;  1O03 A;  5DQG A;  5KG4 A;  4F91 B;  4R64 A;  5AM0 A;  3OSN A;  4IRC A;  4I29 A;  1HJP A;  2DL0 A;  4Z6E A;  2ZUB A;  3THV A;  2PFP A;  1M6Y A;  4QZC A;  5AK6 A;  2IMW P;  3MGI A;  2NO5 A;  4Q44 A;  3H40 A;  2ZIU A;  3V7K A;  1QH9 A;  3BZC A;  5J2F A;  2KFZ A;  1TK5 A;  3WK5 A;  4QNL A;  2UVW A;  4NY8 A;  3MGH A;  2J6U A;  3IV6 A;  2DGZ A;  4OCZ A;  2G07 A;  2RDI A;  3QZ8 A;  5EE9 A;  9ICV A;  3F5A A;  8ICQ A;  4F5O A;  8ICE A;  1WWU A;  5KT5 A;  2HOF A;  4DOB A;  1J2M A;  5KFJ A;  4YVZ A;  5CJ7 A;  5KG5 A;  3ISD A;  1HIW A;  2VJ5 A;  4QZG A;  2XGP A;  7ICF A;  4ECU A;  4E0D A;  3RB3 A;  5L1J A;  3C21 A;  4F8R A;  4DF8 A;  4F3O A;  9ICC A;  3ETL A;  4F4Z A;  3IRU A;  4RQ7 A;  3Q8L A;  8ICF A;  1KEJ A;  2AXT U;  3SAG A;  2ZG6 A;  5DDY A;  1X6I A;  1JIH A;  2PXI A;  3SV3 A;  4PZO A;  5HNK A;  1TVA A;  7ICR A;  1T94 A;  2W3S A;  2CXY A;  3PZP A;  1IV8 A;  3RH6 A;  1LV5 A;  2HHV A;  2UVU A;  1ZQA A;  1J2N A;  3UMG A;  5DLG A;  2HHT A;  2EZX A;  4I2F A;  1SL1 A;  4M6W A;  4BXO A;  1B22 A;  4DCC A;  5KAI U;  4FBT A;  3ICX A;  5EWE A;  7ICG A;  3ZDC A;  2Y9T A;  1JXL A;  4QWC A;  3RH4 A;  2F3N A;  2Q4T A;  4I2D A;  2KKP A;  4YXJ A;  2LBO A;  3ED5 A;  3C1Y A;  4R8U A;  3CRX A;  5DB9 A;  3KHH A;  3JPO A;  2W54 A;  3N4M B;  2HVI A;  3PSI A;  5AIA A;  3KKA A;  2MRL A;  4M47 A;  4K4H A;  4UAS A;  4YN4 A;  4BGD A;  4CF3 A;  4PHE A;  4DFJ A;  1ZQG A;  1FEZ A;  8ICG A;  1X42 A;  2JV3 A;  1ZD2 P;  5JTI A;  4UBC A;  2OEH A;  8ICZ A;  2KIW A;  1NJZ A;  4RU9 A;  4PH5 A;  2JMG A;  1OUQ A;  3JPR A;  1XSP A;  4R65 A;  2K8C B;  4MHV A;  2PFO A;  3MFH A;  5KG2 A;  4OD0 A;  3S6J A;  3IDW A;  1RPL A;  1IXR A;  4DL4 A;  9ICI A;  3M7D A;  4ECV A;  3BDP A;  2A1J A;  1RZT A;  1ZQY A;  4YFK A;  1ZRM A;  2QLT A;  5CHG A;  1B4F A;  4J9R A;  2RP5 A;  4RQN A;  3E2E A;  5ALP A;  1URJ A;  1UPH A;  5L1L A;  2QAR B;  2HHW A;  4KLF A;  5KFG A;  2K4H A;  1N56 A;  1S97 A;  1F0M A;  2H3Z A;  4C7Y A;  2AGQ A;  2ZXI A;  5AKX A;  2W43 A;  4F2S A;  2Y1J A;  2YN4 A;  1S0M A;  3H8M A;  2H5X A;  4YQW A;  4CGZ A;  5L1M A;  1ZQW A;  2BPC A; 
#chains in the Genus database with same CATH homology
 3SMV A;  4OJ5 A;  2KIC A;  2XID A;  3LVW A;  5HR6 A;  3DEE A;  2F77 X;  3VC8 A;  3ALR A;  3ICX A;  4A8E A;  2OXO A;  2ZIW B;  4P0Q B;  3IN5 A;  5T14 A;  2ZIX A;  2YB4 A;  2JH1 A;  2G09 A;  2G5H B;  2CPR A;  2KV2 A;  4OJO A;  4U7C A;  3D2Q A;  3AQE A;  3GU3 A;  2N1R A;  4OJL A;  2Z7J A;  2G08 A;  3OPX A;  2ZIV A;  1MA7 A;  3HKZ C;  2DQN B;  2Q4T A;  3M6Z A;  3C29 A;  2KD1 A;  2KKP A;  2RRD A;  4NLB A;  3IG8 A;  1CRX A;  2VJ4 A;  2ZIU A;  2LBO A;  3IP4 B;  2VKQ A;  2Y0S F;  3CRX A;  4JMU A;  1KBU A;  4OJ6 A;  2KEY A;  2R18 A;  4QNL A;  3H0M B;  1ED1 A;  4CRX A;  3PSP A;  3F53 A;  2DGZ A;  4GFJ A;  4ICA A;  1PVR A;  3PSI A;  2G07 A;  4KX3 A;  4CDG A;  1PVQ A;  5C0Y A;  2MRL A;  3AQF A;  2HBK A;  3C28 A;  2GH1 A;  3AL0 B;  2E1F A;  3F5A A;  3CYM A;  3KZX A;  3MGV A;  3T79 A;  4IC9 A;  4ACO A;  1XNS A;  4OO1 J;  2E1E A;  2WAQ C;  4FZM A;  3H0L B;  2XIC A;  2WB1 C;  1A0P A;  3E0F A;  1D8B A;  5HR7 A;  2JHD A;  2HOQ A;  3N7R C;  2JGA A;  2KIW A;  3PSF A;  2PMZ F;  2LYA A;  3N7S C;  1F44 A;  2VIX A;  4P0Q A;  4QIW C;  2F2A B;  3VCB A;  1Q3V A;  1WUD A;  2HOF A;  2G06 A;  2D6F C;  2H3I A;  4AYB F;  4C0Z A;  2ZIX B;  1A6S A;  1Q3U A;  1Z19 A;  2NV3 A;  2W03 A;  2F8L A;  2KHV A;  2Y0S C;  3NRW A;  3SAF A;  2G0A A;  1Z1B A;  2JMG A;  1OUQ A;  2ZXH A;  3SQI A;  2K8B B;  2KVC A;  2H3F A;  2HMX A;  1HIW A;  2VJ5 A;  2YB1 A;  2W7P A;  2ZIV B;  2K8A A;  2MA1 A;  2KNJ A;  3F5E A;  3M6K A;  1NZB A;  4O3M A;  2OYY A;  2K8C B;  2XI9 A;  4P0P B;  2M0N A;  3LYS A;  3RFA A;  2KJ8 A;  3K1Z A;  4BX9 C;  1ECW A;  3N7P D;  3F2D A;  2KJ5 A;  4FZL A;  2HBJ A;  3D2N A;  3M7D A;  2HBM A;  3RF9 A;  2LYB A;  3HKZ F;  2GOL A;  3H0R B;  2KKV A;  2CN1 A;  5KL1 B;  2OM6 A;  3L3F X;  4PL1 A;  2JH7 A;  3SAG A;  3F2B A;  2ZG6 A;  3GZF A;  2PMZ C;  2ZIW A;  4FZN A;  4BUG A;  2W7O A;  4FE3 A;  3F2C A;  2HBL A;  2CRX A;  2RP5 A;  3O0F A;  2H3V A;  3SAH A;  2OH2 A;  1GO3 F;  3LVV A;  1TAM A;  2H3Q A;  4NV0 A;  2KJ9 A;  4NWI A;  2G5I B;  1ZQ1 C;  4PL2 A;  1YT3 A;  1T94 A;  2K4E A;  2RHF A;  1DRG A;  4U6P A;  1URJ A;  2LHT A;  1UPH A;  2LKY A;  2WAQ F;  2ZIU B;  1HEK A;  2WB1 F;  3NUQ A;  1PVP A;  3PST A;  1P7D A;  3D2S A;  2K89 A;  3CP8 A;  4KMO B;  3ONN A;  4QJF B;  2K4H A;  2YX8 A;  4NLC A;  3PZP A;  5A0L A;  2DF4 B;  4QIW F;  2H3Z A;  2K4I A;  5KL8 B;  2W04 A;  4BJQ A;  4P0P A;  2ZXI A;  4OJP A;  2A3V A;  3IG5 A;  4KX5 A;  2XVT A;  3KFU F;  2BDU A;  2HOI A;  4WJ3 B;  5CRX A;  1SZH A;  1IIP A;  2KHQ A;  1L6N A;  2F76 X;  2E5S A;  4AYB C;  4CGZ A;  1XO0 A;  2KOB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...