4BX9C

Human vps33a in complex with a fragment of human vps16
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
95
structure length
95
Chain Sequence
ERIEGRVAALQTAADAFYKAKNEFAAKATEDQMRLLRLQRRLEDELGGQFLDLSLHDTVTTLILGGHNKRAEQLARDFRIPDKRLWWLKLTALAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of Vps33A recruitment to the human HOPS complex by Vps16.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords VACUOLAR PROTEIN SORTING-ASSOCIATED PROTEIN 33A
total genus 38
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2013-07-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.780 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 4bx9C00
4BX9C 4KMOB
chains in the Genus database with same CATH superfamily
2XIDA 2LI6A 4M9GA 5J29A 2RLTA 2DL0A 4IQUA 2F1JA 3CYMA 9ICKA 3GQCA 1XS9D 2DKZA 2EAPA 1ZETA 4EZ9A 5KFTA 2FPMA 2W8KA 1X9MA 2Q4TA 1IXRA 4CE6A 1L7PA 3HKZF 9ICUA 5ALUA 5KG4A 3PO4A 4Y2RA 2AGPA 4ECWA 1S0VA 4US9A 3MR2A 3MR6A 5L1KA 4O3SA 4J03A 1JROA 3BQTA 1NK7A 8ICRA 4DSJA 5KAFU 3OHAA 3KZXA 1VLBA 4YD1A 3M7DA 3LVVA 4UAWA 3NVVA 2BPGA 4UB3A 3RFAA 5DB8A 1TKDA 3IN5A 1JRPA 2DQNB 4DQQA 3MGVA 3JPQA 4QZFA 4Y2TA 1N61A 3RR7A 3KHLA 4QNLA 3PSPA 1JX4A 4JB3A 2H3ZA 4MFCA 2HBMA 4FFDA 4OJ6A 5J0PA 4HAIA 4TURA 3RJHA 4BXOB 3E0FA 4UARA 5ALFA 2AJQA 4ED0A 2OYYA 4GXKA 2YMLA 1B22A 1YZ6A 1N63A 3QUQA 3GILA 3BJYA 5DG7A 2BPFA 2NRVA 5DLGA 4KLUA 4KX3A 3OGUA 2WF6A 2G5IB 2DKXA 4MFAA 2AQ0A 4MFFA 4JV2A 1NK5A 1QCKA 3B0YA 3WKEA 1KKXA 4PHEA 3TFRA 4QIWC 3M1YA 3NS1A 3JPRA 2EDUA 2KJ9A 1S5LU 1PVQA 1NJYA 2EANA 5DLFA 3E2EA 5J2KA 5KFCA 5HMLA 4C4RA 5AKIA 3OHBA 4DLGA 1TAUA 3N97B 4ECXA 2JRZA 2WB1F 9ICIA 1D8BA 1NOMA 4IS7A 4IR1A 2FPLA 4UB5A 2CN1A 2MU2A 3H4DA 4UAUA 4KLDA 4DFMA 5GTHU 2GLEA 2F2AB 3ZD9A 1U48A 1Z1BA 1ZD5A 4DSKA 3H40A 1WYGA 5H2FU 5L1IA 4DEZA 3AQFA 4GLXA 5KFPA 2G06A 8ICUA 1OUQA 2W9CA 3GDXA 2B21A 5AKYA 4RNMA 4FO6A 1N5XA 3LDAA 2P6RA 3H8WA 5CHGA 4RQMA 1Q46A 2E5SA 3THVA 2WF9A 1K1SA 4DOAA 3Q8RB 4F5OA 2M0NA 3N7PD 5AIBA 2A3VA 3EPIA 5G5HA 4YMMA 4I2EA 3LWMA 1TFRA 2VA3A 7ICHA 2KG5A 1NJZA 1NZBA 3M9MB 3KHRA 1TVAA 2CRXA 4PHPA 4ECSA 5J0SA 2P35A 2A1JB 4QZIA 2JH1A 2KTQA 4QZCA 1ZQHA 1KFDA 2GO7A 4HYKA 4AP9A 5AICA 3M8SA 4O5EA 3AM9A 4DQRA 3KZIU 4UB2A 5KFOA 1U49A 4YFKA 4KLOA 2WF7A 1ZQQA 1GO3F 2HOQA 2KNJA 5JU5A 4KX5A 5ALOA 4I2GA 4Y2XA 1ZQLA 2HHQA 4R66A 1PK1B 1L3TA 4NWIA 3NGDA 1UPHA 2LPEA 3UM9A 2LYAA 3IM1A 8ICNA 5KFLA 4EZ6A 4M9NA 3QEAZ 2GH1A 2Y9UA 4OJ5A 1RZTA 4KLEA 5CRXA 3UMCA 2FLPA 5KFKA 5KT2A 2JEGA 2R8HA 3RAXA 4QJFB 1FEZA 3V6JA 1IV8A 4FS2A 2JV3A 3BZCA 3TQ1A 3I1YA 4DOBA 4XRHA 4RQ5A 1L7OA 3QZ8A 5AM0A 2VJ5A 2YB4A 2UVWA 4QZAA 2ESEA 2M9NA 3AMZA 4KN7A 1DXSA 2ZUDA 4ED1A 4F72A 1RQNA 4RPZA 2E8PA 7ICIA 2AGQA 5ALXA 2AH5A 3C2LA 2BQRA 2HHWA 5BOMA 4J9LA 4UAVA 2BKEA 4R65A 1RYRA 3PW0A 4J9NA 2YQEA 5KFIA 3IG8A 2PKEA 1L7MA 2FLLA 1F0MA 3HT3A 2FMQA 2W7OA 5HR6A 4PHDA 1QLNA 3C21A 3RB4A 4FBUA 3GIMA 1D9FA 4DQPA 5AM5A 1L7NA 3QU2A 2D6FC 1PUZA 3QU9A 4I2BA 5ALVA 3OPXA 3IG5A 2WAQF 2K4EA 1A0PA 4AYBF 5KFEA 4DL2A 2VA8A 2H5XA 1SL1A 1ZYQA 2W03A 2I9GA 4F91B 3OSNA 4DL7A 4Z6CA 2ISOA 3M6KA 3PSIA 5KFYA 1CRXA 4NLKA 2W9MA 5D46A 4C7ZA 5DBBA 2KEYA 1RM6C 4GIBA 3EYZA 5L1LA 3GIJA 2ZJ8A 3MFHA 2W43A 2BQ3A 3EW9A 1URJA 3HKZC 2XCPA 2CXYA 3MR3A 1ZQBA 2KN7A 3JPNA 5HHIA 3PX4A 4ELVA 2D3DA 4RUCA 5KFFA 2Y1JA 4PZNA 4NLGA 2E1FA 5KFJA 8ICLA 4UBCA 3QU4A 1MC8A 3C28A 4NL9C 3V7KA 2KFZA 4TUQA 3AU2A 4Y2JA 7ICUA 5J0UA 3UQ2A 2F8KA 5KFVA 2K8AA 3MFIA 2B0CA 3RH4A 2J6SA 4OJPA 3QYPA 3QEBZ 1ZQDA 2JHDA 1K1QA 1ZQNA 4PPXA 4ECYA 1CUKA 2W9AA 2E3TA 4KMUA 2E8NA 4JUZA 3I28A 4DOCA 4PGYA 3G6YA 2AU0A 9ICMA 4C80A 5IIMA 5AI8A 5JUMA 4NL9A 4B9UA 3KOOA 2DPJA 4UB8U 3RBEA 3AQEA 3RJGA 4YXMA 5DBCA 3A0HU 2PI4A 4QZBA 2ISPA 4I2IA 1B4FA 3UMBA 1KN5A 1QQ7A 4JV1A 3UXOA 3T5KA 2MRLA 4K4GA 4PGXA 1BVSA 2QKQA 4QIWF 2E1EA 5AKHA 4UW9A 4C8OA 2PFNA 2KV2A 1U45A 5DQHA 4JWNA 4KLIA 1S76D 3RR8A 2HSZA 3U26A 4O9MA 9ICHA 1LVHA 1Q3VA 5IIKA 5C0YA 1K5OA 2AGOA 2OCEA 4RU9A 2G07A 4UATA 1L3UA 5KFMA 1V38A 2NRZA 3MDAA 1S9FA 3BS5B 5KFWA 3HPOA 2WB1C 3SENA 4RQ7A 1CEZA 2ZIXB 4F4KA 3T5LA 2W9CB 1DK3A 3Q8SB 5ALPA 3ISCA 2KJ8A 4EBCA 1N56A 3HWTA 2ASDA 2YX8A 5KT3A 4RPYA 4YD2A 5L9XA 2JR5A 2O6KA 1SL2A 1ZQXA 5L1MA 4DL3A 3CW2C 1WUDA 3TKAA 5KFAA 4RPXA 2BGWA 2BDPA 3RRGA 5B5EU 5CWRA 3ISDA 3SD7A 5KG1A 3L4PA 7ICFA 3BQ1A 3KKAC 1S97A 5ALJA 2KMDA 1SV0A 1N5WA 2IBKA 2JXJA 3T79A 4UASA 2EZXA 3WKAA 9ICGA 4F4WA 4FS1A 5E79U 4F4XA 2L5YA 4US8A 2VA2A 1D8LA 4JWMA 2W55A 5ALMA 3CNHA 1NK6A 3WKCA 2W54A 4EBDA 3ZD8A 1Z1VA 3T3FA 1FFVA 1S77D 5ALYA 4QZHA 1T8EA 1T7PA 2NRWA 3TI0A 3SR6A 4RT2A 3RB3A 3WKDA 2BCSA 2I5HA 1QSYA 4JV0A 2KHVA 3SQIA 4MEYA 4YP3A 1FFUA 1ZQEA 3E58A 3GV7B 7ICVA 2RRDA 3HJEA 1PVRA 1S8OA 3RJIA 1B0XA 3TADA 3GIIA 4ECRA 4IC9A 2J6TA 5AKXA 1L6NA 1SB3C 5ALHA 5J2BA 1SZPA 2XGQA 3F2DA 2BDUA 5J2HA 8ICJA 1ZQKA 4O5KA 3F2BA 1RG6A 1ZD3A 2WTFA 1JXEA 1J97A 5AKKA 4O3PA 3JPTA 2Q0ZX 2P66A 8ICMA 4PH5A 1Y88A 1VJ5A 5J8YA 1MSWD 4CGZA 4Q8EA 2XY6A 1D9DA 2HCFA 2HVHA 3TARA 4IRCA 4BXOA 5KG6A 4YR2A 1UT5A 4PJ0U 8ICSA 2KD1A 5AKEA 3PZPA 2Z7JA 4IQWA 3FAHA 2HDOA 1ZQYA 2XGPA 4TQRA 3WK4A 2EAOA 4F4YA 3TFSA 1SZHA 4BGDA 2XVTA 1BPYA 1ZRMA 5J2JA 3QUCA 9ICJA 3NRWA 3ORYA 1YT3A 1ZQOA 2K4PA 4EX6A 4F2RA 4O3RA 2C28A 1NK0A 4CF4A 4UB6U 4FBTA 9ICQA 5IIJA 2BCQA 4A8EA 2BCRA 2K89A 2JEFA 9ICVA 2ZTEA 3Q8MA 4IL6U 5AI9A 2DUYA 3G6XA 4IRDA 2W11A 1KTQA 4U7CA 2QLTA 3C29A 2MAXA 4PGQA 4AYBC 4OCZA 5HMMA 2KVSA 5TZVA 2ES6A 8ICBA 1NNLA 5DB9A 3WKBA 3N7SC 3C23A 4DFKA 5C5JA 4YR0A 5ALTA 5KFQA 4YXJA 1ZQVA 4EYIB 3PV8A 4B9LA 1U47A 2R8GA 3PX0A 4ECQA 1WWUA 2IA6A 4ECZA 4KLFA 1ZQZA 1O03A 5IIIA 2MSNA 8ICHA 4GXJA 3GZFA 4NV0A 1NI3A 4B9TA 1SL0A 2PXIA 2C22A 1QTMA 4BUGA 2DFLA 5T14A 1X40A 1HJPA 5KG7A 1MQ3A 3ALRA 4ICAA 3KD3A 8ICXA 1X9SA 5KFGA 2YB1A 3SZ2A 3OJSA 3MDCA 5KFHA 2B6GA 4EELA 2K8CB 1X6IA 3F53A 4KLSA 2ASLA 2GWSA 3NTUA 2YMPA 5JRTA 7ICQA 4C8KA 2LM4A 2JGAA 4P4PA 1QH9A 4YG2A 7ICOA 4DFDA 4FZMA 1KQQA 3V7LA 1JN3A 4F5PA 2KP7A 4EEKA 4K4IA 2W04A 4YR3A 5ALGA 2C2DA 4C4SA 3D2QA 4M9HA 5J0QA 3HW8A 9ICXA 4UB4A 5TISU 1UA1A 5ALQA 5J2CA 4FZLA 1ZQAA 1A76A 5L1JA 3AU6A 5AK6A 3PW7A 2KHQA 5IINA 1KLNA 1UQVA 2OEHA 4TUPA 3K1RB 8ICZA 2F3NA 7ICNA 1JIHA 3PSTA 4DQIA 5EE1A 2XI9A 3PY8A 4UB1A 2BCUA 4RQ0A 4NM1A 2H3VA 3AN1A 4M9LA 2C2EA 3HRDD 5EWGA 2PI5A 2ZIVA 3CRXA 3IHQB 3QUBA 2JZBA 5AK3A 2VKQA 2ZG6A 4F5RA 5J8YC 4NM2A 1NK8A 2IMWP 5K4LA 3PX6A 2JEIA 1RPLA 4OD0A 5KFSA 3ETLA 4ZOHC 9ICAA 3RB0A 1EXNA 3SAHA 4F5NA 4J9OA 3DEEA 2V9WA 3QE9Y 1ZQRA 1T94A 4PZOA 4DQSA 1QQ6A 2LKYA 2ZUCA 1OXJA 3KKAA 1TAQA 4MF8A 4M2YA 5AI4A 3SYZA 2LYHA 4LZGA 4GC7A 2K4IA 5AK5A 1X6JA 2KOBA 4P4OA 1ZD2P 3FC4A 3B0XA 4WJ3B 4Y2UA 5F9LA 4P0QA 3B9JA 4B9SA 3JPSA 4GFJA 5KT4A 7ICEA 3GIKA 2KKVA 3PR5B 5BOLA 1DRGA 5CR0A 5KG2A 4PL1A 1ZXIA 4I2FA 4I29A 1XNSA 4Q45A 5AM3A 2HMXA 3ZDBA 1X9WA 1S0OA 2Y9TA 3BS7A 2IOFA 2JMGA 3LVWA 4DL6A 2XC9A 5AIAA 3BQ2A 2LYBA 3KHHA 4RQ8A 1ZQGA 8ICQA 9ICNA 3RBDA 5DG8A 4DF8A 5AI6A 4BWJA 4I2CA 2LMRA 3SI8A 4QZGA 1UT8A 4NLCA 2E8OA 8ICAA 4M6WA 4C8MA 5F9NA 2NYVA 2D8CA 2ZJ5A 1BNPA 5GTIU 1SKWA 4E0DA 4IQTA 2LM1A 2ASJA 2LHTA 4XA5A 3WU2U 4RNNA 5J2DA 1COKA 1P7DA 2ZIUA 4CF5A 3SAGA 4UAZA 1BPEA 1T4GA 1T3NA 4BWMA 3C5FA 2IOFK 4LJXA 4QWAA 5BPCA 1ZQUA 3H0LB 4C0ZA 1RYUA 2FI1A 2PFOA 5B66U 4EENA 3UMGA 5ALNA 2RDJA 2ZXIA 4B9MA 4USAA 4KLMA 3C1YA 5EE0A 3F5EA 1FO4A 3WK6A 4OJOA 4ACOA 4ECVA 1Q8KA 1RDFA 7ICKA 4ED7A 3IV6A 2XY5A 5AKJA 5ALZA 2RQ5A 2OH2A 2AHOB 4O5CA 3TACB 3SMVA 3QZ7A 4Z6FA 4O3NA 2G09A 5ALWA 3SV4A 1XO1A 2ZJAA 2BPCA 3PNCA 3ZDAA 3ZDDA 2EZYA 5F3XB 4Q44A 3M6ZA 4DWIA 1X42A 3KBBA 1H38A 2VANA 3HX0A 2R18A 2PFQA 3RTVA 1SIJA 4R64A 2W9BB 3M8RA 2R8KA 3TANA 4YMNA 4J9PA 2ZIXA 1SKSA 3KFUF 5ALKA 4ELTA 3BS5A 1XSPA 1L8LA 1Z00A 1XC9A 4KLQA 1F5SA 4Y2VA 1PVPA 2PMZF 3S6JA 4KLTA 2HI0A 4B6JA 4F71A 2FJ6A 4DF4A 3PR4A 2HVIA 3F5AA 2G5HB 4MF2A 4NXZA 3PVXA 1U9LA 4DFJA 4QZDA 5D4BA 4NJ8A 8ICVA 2NO4A 4KLHA 4O3MA 3RF9A 1YZ7A 5KFUA 2YY6A 2JH7A 3ZI4A 5J0WA 1S0MA 5J0RA 2HHUA 1A77A 3QX7A 3EPGA 2ZIWB 5A0LA 4BX9C 2FE9A 5EWEA 3H8JA 2RDIA 3KTQA 3H8MA 1DK2A 4LVSA 3DV9A 2KK0A 3RJJA 1RXWA 2KZ3A 2DBYA 5CEHA 1Z4OA 1UHUA 3EWAA 8ICOA 3Q8KA 3IDWA 4CCHA 4RUAA 1Q3UA 1X2IA 2ZTDA 2OM6A 1L8OA 1KSPA 5KNIA 1WCNA 1MQ2A 4QZ8A 2ATLA 1DGJA 8ICEA 2YTUA 1NZPA 3PSFA 3HP6A 4P2HA 2ZUBA 5KL8B 4I2DA 2ZIWA 2FMPA 2QARA 4Y2PA 3MGHA 1AROP 5ALDA 1LV5A 1N62A 4DSEA 8ICTA 2KSOA 5KTQA 5EE9A 1WWVA 4EBEA 2FLNA 2F1HA 4NLNA 3V72A 3L5KA 4P0PA 4F3OA 5CA7A 4J9KA 2UVRA 1Z3EB 4CDGA 3N28A 2EQYA 1N2XA 4U6PA 5AK4A 3K1ZA 1JALA 1UA0A 3RB6A 7ICLA 2Y0SF 4PL2A 2BR0A 3DDHA 1SWWA 8ICFA 2K8BB 1JUDA 1HIWA 5ALSA 4R8UB 1IM4A 3K4GA 3ED5A 3OTQA 2MUTB 3QXGA 3D2SA 3PW4A 4EYHB 4Y2YA 2F1IA 3M9NB 1M6YA 3L3FX 5KFNA 3A0BU 1DOQA 2HOFA 2G08A 7ICMA 2NV3A 5AM2A 2QARB 5KFZA 9ICOA 1ZQWA 1JI7A 2H3QA 1X9XA 2RHFA 1TV9A 5J2FA 9ICEA 4Z6DA 4ED2A 4F50A 5EE3A 3PMLA 2OXOA 4QWEA 1PK1A 5HHHA 3RJKA 3M9OB 3TAPA 3PW5A 2A19A 3SEIA 2I1QA 2PFPA 3ZDCA 2ZTCA 8ICCA 3VC8A 5AI0A 4TUSA 4CRXA 5DB7A 2F8LA 1J2NA 2HHVA 2W7PA 1BPDA 2QB0B 4G3IA 4R8UA 5DQGA 4BDPA 2RP5A 4M04A 5ALIA 3V6KA 4KMOB 2F44A 5D49A 3BQ7A 3QU7A 1V85A 2GOLA 2KKPA 4YQWA 3Q8PB 4RZRA 1AQ6A 7ICTA 1QSLA 2A1JA 1DGSA 3NVWA 4M0AA 1O08A 3D6JA 1KL9A 1ZQCA 1BPZA 2VJ4A 2N1RA 2R8IA 5FP0A 4IRKA 7ICJA 3C1ZA 1BGXT 4GC6A 2BQUA 2KSOB 4J9MA 4YVZA 4K4HA 3GU3A 4DSFA 2HHXA 3SAFA 4KLGA 2KFNA 2KVCA 3C2MA 2F76X 3LWLA 2HOIA 4Y2QA 1ZQJA 2NO5A 2BZFA 1LKYA 5KT5A 2FPKA 4DSIA 2XY7A 3PO5A 1ZQIA 8ICWA 4Y2SA 3BDPA 3NUQA 5AKZA 4TQSA 5J2IA 3RAQA 4P0PB 8ICIA 1ZOLA 1Z19A 7ICPA 5J2EA 3TAQA 1ZQMA 2ODGA 1WG8A 2G0AA 9ICCA 2IOHA 1RXVA 5KFXA 1NK9A 1TK8A 4KLJA 3NVZA 5HNKA 2W3RA 2HHTA 5JTIA 4JK1A 9ICPA 1A6SA 5KFBA 1C7YA 3D2NA 1XSNA 4MHVA 2IHNA 4QZ9A 1KW4A 5AI5A 3MGIA 4ZH4A 2OWOA 4F92B 4RQ6A 5AM1A 1NKCA 2WF8A 1SKRA 2MUTA 2H3FA 3ONNA 3EZ5A 3RRHA 9ICTA 2ZIUB 4NLBA 4RQ2A 3OJUA 2OHFA 3FM9A 1C20A 4YN4A 2XO7A 1JMSA 2UVVA 1KEJA 1NJXA 2W9BA 3FYHA 4M6WB 3RH5A 5J0YA 1BPBA 8ICGA 4RT3A 2KICA 3IP4B 3WK5A 4O0IA 1KFTA 4DO9A 3CP8A 2LBOA 2DGZA 4XQ8A 4M47A 9ICSA 1KRPA 2DPIA 1SV4A 4LZDA 4RQNA 1COOA 1L3SA 1BPXA 3MABA 1TAMA 3J81j 2PMZC 8ICPA 2JEJA 2E8MA 5ALEA 5J0XA 2EH9A 4O3QA 2J6UA 2QB0A 2BCVA 9ICFA 1LB2B 2HBKA 1ZQPA 4QWBA 4PHAA 2QB1A 5KAIU 4I2JA 5KL1B 1N48A 4DL5A 4DSLA 5G5GA 1NJWA 1ZRNA 1N60A 4CNQA 4UAYA 3JPOA 3T5JA 1NKBA 4G9BA 1X66A 5CJ7A 3GV5B 5HP4A 1LKYB 3C5GA 4QWDA 2W8LA 1SWVA 5AHXA 1TE2A 4OO1J 1XWLA 8ICKA 1PK3A 3BQ0A 4MEXA 4RNOA 4DL4A 4P4MA 3GFKB 5EOZA 1V9PA 4ED3A 5J2GA 1ZQFA 3PW2A 4I2AA 4ELUA 5AKLA 5KT6A 4GXIA 5DKWA 3RH6A 2CPRA 4UQGA 3R9KA 4C8LA 2ZIVB 2WF5A 5IIOA 3V6HA 1ECWA 1T3QA 4DFPA 1TK5A 1NK4A 4EX7A 2HW3A 4JMUA 3BZKA 3MBYA 2BHNA 1U4BA 3GV8B 2EZZA 2XICA 3QUTA 4NLZA 2KE7A 2YMQA 7ICSA 5CB1A 1Z00B 3RJFA 3HILA 1TK0A 1SXDA 4YMOA 3WK8A 4QZEA 2WHEA 2P6UA 3ICXA 4XUSA 3FDSA 4QW8A 4KN4A 4BJQA 4J9SA 3NASA 2WFAA 4C4TA 3JPPA 3WK9A 1OW5A 5DQIA 5ALRA 4Z6EA 2NRTA 1D8YA 3H4BA 4F4ZA 2KZMA 2FDRA 4FE3A 5DDYA 3OSPA 1S10A 7ICRA 2R8JA 2W3SA 2Y0SC 5J0TA 3H7IA 5KG5A 4RQ3A 1B43A 5KT7A 2KIWA 3QNMA 1HEKA 1JXLA 2VIXA 2C2RA 9ICLA 4UBBA 3K75D 3VCBA 1CI4A 4P0QB 1MN8A 2NRXA 2JZBB 3UXPA 4IQVA 2YN4A 5HR7A 3LK9A 3G6VA 1FIQA 1KBUA 3N7RC 1ZQSA 3TADC 9ICBA 1ZQTA 1RYSA 4J9RA 5DGBA 1ZJNA 2F77X 1MA7A 1ED1A 5DG9A 2I6XA 2V4QA 1VDVA 5IILA 3H0MB 3N4MB 4C7YA 4F93B 1L3VA 5DDMA 3AUOA 4OJLA 1UCVA 2ZXHA 3NVYA 4B9NA 3MC1A 1KDHA 3QU5A 4Q43A 8ICYA 3NRZA 3AL0B 5CP2A 3H0RB 2K60A 2HHSA 1QSSA 4J9QA 3V7JA 4KITB 1NKEA 3SV3A 3UPQA 1IIPA 2KJ5A 3RJEA 1ZQ1C 4RQ1A 3IRUA 1SV0C 1QQ5A 4F2SA 4B9VA 4I2HA 3UQ0A 2EAMA 4I27A 5AM4A 2MA1A 1PZNA 1XSLA 1F44A 3I76A 5KG0A 2Y1IA 4DCCA 1L5UA 1J2MA 1WCLA 3F2CA 5KFDA 5J2AA 5AKGA 2KIVA 1ZJMA 2XCAA 2K4HA 2V4RA 2FMSA 1ZD4A 1BNOA 1HUOA 5EWFA 3LYSA 3MR5A 5DBAA 3H8SA 1XO0A 4M9JA 1XU4A 3PMNA 4FZNA 3Q8QB 4O3OA 4DLEA 1Z4NA 4YCXA 4DS4A 7ICGA 2AXTU 4F5QA 4QW9A 3ETRA 2UVUA 4DS5A 3AEVA 4RQ4A 5DB6A 1SXEA 4ECTA 2YMMA 9ICRA 3Q8LA 1KFSA 3EUB2 2A1AA 5J0OA 2IHMA 3T5HA 4KLLA 9ICWA 4IR9A 4KTQA 5KG3A 5DGAA 2DWQA 1S0NA 1V97A 4NY8A 4CF3A 3ISBA 2HBJA 4QWCA 4EEYA 1HUZA 2H3IA 4C8NA 2ALZA 2HBLA 4R63A 4F8RA 4ED6A 4I28A 2DF4B 1RQLA 4ED8A 2WAQC 1SGGA 1IG6A 2KZZA 3ZDEA 3UXNA 4Q8FA 3WK7A 2AQ4A 5ALLA 3KHGA 3O0FA 3C2KA 4ECUA 5KFRA 4X5VA
chains in the Genus database with same CATH topology
1WUDA 2CRXA 4KX3A 2MA1A 2XIDA 3RF9A 4O3MA 2VKQA 1F44A 2G5IB 2JH7A 4CGZA 1P7DA 2ZIUA 2ZG6A 4BJQA 3D2SA 4BUGA 3SAGA 3L3FX 5T14A 3IG8A 3NUQA 3CYMA 4QIWC 3F2CA 3ALRA 2HOFA 2JH1A 2KJ9A 2ZIWB 2G08A 4ICAA 2W7OA 4P0PB 5HR6A 3H0LB 2NV3A 4C0ZA 4BX9C 5A0LA 1Z19A 1PVQA 1TAMA 3SAHA 2KD1A 2PMZC 3DEEA 2H3QA 2Q4TA 3T79A 2K4HA 2YB1A 2RHFA 2D6FC 3AQEA 2ZXIA 1T94A 2G0AA 3HKZF 3PZPA 2Z7JA 3LYSA 4FE3A 3OPXA 3IG5A 2WAQF 2K4EA 3F5EA 1A0PA 2OXOA 4OJOA 2LKYA 4AYBF 4ACOA 1GO3F 2HOQA 2Y0SC 1XO0A 1SZHA 2HBKA 2KNJA 4KX5A 2K8CB 2XVTA 4FZNA 3F53A 2W03A 5KL1B 2WB1F 3VC8A 2OH2A 1D8BA 2KIWA 1Q3UA 2MRLA 2K4IA 4CRXA 3M6KA 1HEKA 3PSIA 2OM6A 2F8LA 3NRWA 2VIXA 3SMVA 1CRXA 2KOBA 4NWIA 2CN1A 3VCBA 1UPHA 3KZXA 2JGAA 1A6SA 2G09A 2W7PA 1YT3A 4P0QB 3D2NA 2KEYA 3M7DA 4WJ3B 2LYAA 3LVVA 4P0QA 4QIWF 2E1EA 3PSFA 4FZMA 2F2AB 5HR7A 4GFJA 3RFAA 2RP5A 4A8EA 5KL8B 2K89A 3IN5A 4KMOB 2KKVA 2ZIWA 1Z1BA 3N7RC 1KBUA 2KV2A 2W04A 1DRGA 2KHVA 2DQNB 3SQIA 4OO1J 3M6ZA 2GH1A 2GOLA 4PL1A 2KKPA 3D2QA 1Q3VA 1XNSA 1URJA 4OJ5A 3HKZC 3MGVA 2F77X 4U7CA 2HMXA 5CRXA 1MA7A 1ED1A 2H3FA 3AQFA 2R18A 2RRDA 2G06A 3ONNA 3C29A 5C0YA 4QJFB 1OUQA 1PVRA 2JMGA 3H0MB 2ZIUB 3LVWA 4FZLA 4AYBC 4NLBA 2G07A 2CPRA 4QNLA 2ZIXA 3KFUF 2E1FA 3PSPA 4OJLA 2HBJA 3N7SC 2ZXHA 2LYBA 2ZIVB 4IC9A 3C28A 2H3ZA 2VJ4A 2WB1C 1ECWA 2HBMA 2N1RA 2ZIXB 2H3IA 4OJ6A 4P0PA 1PVPA 1L6NA 2PMZF 2HBLA 2KHQA 2VJ5A 3AL0B 3H0RB 2YB4A 4JMUA 4CDGA 2E5SA 2K8AA 3F2DA 2XICA 4U6PA 2KJ8A 2BDUA 3GU3A 2DF4B 4NLCA 3K1ZA 2WAQC 3SAFA 2YX8A 2M0NA 3E0FA 2KICA 3IP4B 3N7PD 3PSTA 4OJPA 2A3VA 1IIPA 2KJ5A 2XI9A 3CP8A 3F5AA 2KVCA 3F2BA 1ZQ1C 2G5HB 2Y0SF 2H3VA 4PL2A 2JHDA 2LBOA 2OYYA 2DGZA 2F76X 2HOIA 3O0FA 2K8BB 3ICXA 2ZIVA 3GZFA 1HIWA 4NV0A 2LHTA 1NZBA 3CRXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BX9 C;  4KMO B; 
#chains in the Genus database with same CATH topology
 2XID A;  2LI6 A;  4M9G A;  5J29 A;  2RLT A;  2DL0 A;  4IQU A;  2F1J A;  3CYM A;  9ICK A;  3GQC A;  1XS9 D;  2DKZ A;  2EAP A;  1ZET A;  4EZ9 A;  5KFT A;  2FPM A;  2W8K A;  1X9M A;  2Q4T A;  1IXR A;  4CE6 A;  1L7P A;  3HKZ F;  9ICU A;  5ALU A;  5KG4 A;  3PO4 A;  4Y2R A;  2AGP A;  4ECW A;  1S0V A;  4US9 A;  3MR2 A;  3MR6 A;  5L1K A;  4O3S A;  4J03 A;  1JRO A;  3BQT A;  1NK7 A;  8ICR A;  4DSJ A;  5KAF U;  3OHA A;  3KZX A;  1VLB A;  4YD1 A;  3M7D A;  3LVV A;  4UAW A;  3NVV A;  2BPG A;  4UB3 A;  3RFA A;  5DB8 A;  1TKD A;  3IN5 A;  1JRP A;  2DQN B;  4DQQ A;  3MGV A;  3JPQ A;  4QZF A;  4Y2T A;  1N61 A;  3RR7 A;  3KHL A;  4QNL A;  3PSP A;  1JX4 A;  4JB3 A;  2H3Z A;  4MFC A;  2HBM A;  4FFD A;  4OJ6 A;  5J0P A;  4HAI A;  4TUR A;  3RJH A;  4BXO B;  3E0F A;  4UAR A;  5ALF A;  2AJQ A;  4ED0 A;  2OYY A;  4GXK A;  2YML A;  1B22 A;  1YZ6 A;  1N63 A;  3QUQ A;  3GIL A;  3BJY A;  5DG7 A;  2BPF A;  2NRV A;  5DLG A;  4KLU A;  4KX3 A;  3OGU A;  2WF6 A;  2G5I B;  2DKX A;  4MFA A;  2AQ0 A;  4MFF A;  4JV2 A;  1NK5 A;  1QCK A;  3B0Y A;  3WKE A;  1KKX A;  4PHE A;  3TFR A;  4QIW C;  3M1Y A;  3NS1 A;  3JPR A;  2EDU A;  2KJ9 A;  1S5L U;  1PVQ A;  1NJY A;  2EAN A;  5DLF A;  3E2E A;  5J2K A;  5KFC A;  5HML A;  4C4R A;  5AKI A;  3OHB A;  4DLG A;  1TAU A;  3N97 B;  4ECX A;  2JRZ A;  2WB1 F;  9ICI A;  1D8B A;  1NOM A;  4IS7 A;  4IR1 A;  2FPL A;  4UB5 A;  2CN1 A;  2MU2 A;  3H4D A;  4UAU A;  4KLD A;  4DFM A;  5GTH U;  2GLE A;  2F2A B;  3ZD9 A;  1U48 A;  1Z1B A;  1ZD5 A;  4DSK A;  3H40 A;  1WYG A;  5H2F U;  5L1I A;  4DEZ A;  3AQF A;  4GLX A;  5KFP A;  2G06 A;  8ICU A;  1OUQ A;  2W9C A;  3GDX A;  2B21 A;  5AKY A;  4RNM A;  4FO6 A;  1N5X A;  3LDA A;  2P6R A;  3H8W A;  5CHG A;  4RQM A;  1Q46 A;  2E5S A;  3THV A;  2WF9 A;  1K1S A;  4DOA A;  3Q8R B;  4F5O A;  2M0N A;  3N7P D;  5AIB A;  2A3V A;  3EPI A;  5G5H A;  4YMM A;  4I2E A;  3LWM A;  1TFR A;  2VA3 A;  7ICH A;  2KG5 A;  1NJZ A;  1NZB A;  3M9M B;  3KHR A;  1TVA A;  2CRX A;  4PHP A;  4ECS A;  5J0S A;  2P35 A;  2A1J B;  4QZI A;  2JH1 A;  2KTQ A;  4QZC A;  1ZQH A;  1KFD A;  2GO7 A;  4HYK A;  4AP9 A;  5AIC A;  3M8S A;  4O5E A;  3AM9 A;  4DQR A;  3KZI U;  4UB2 A;  5KFO A;  1U49 A;  4YFK A;  4KLO A;  2WF7 A;  1ZQQ A;  1GO3 F;  2HOQ A;  2KNJ A;  5JU5 A;  4KX5 A;  5ALO A;  4I2G A;  4Y2X A;  1ZQL A;  2HHQ A;  4R66 A;  1PK1 B;  1L3T A;  4NWI A;  3NGD A;  1UPH A;  2LPE A;  3UM9 A;  2LYA A;  3IM1 A;  8ICN A;  5KFL A;  4EZ6 A;  4M9N A;  3QEA Z;  2GH1 A;  2Y9U A;  4OJ5 A;  1RZT A;  4KLE A;  5CRX A;  3UMC A;  2FLP A;  5KFK A;  5KT2 A;  2JEG A;  2R8H A;  3RAX A;  4QJF B;  1FEZ A;  3V6J A;  1IV8 A;  4FS2 A;  2JV3 A;  3BZC A;  3TQ1 A;  3I1Y A;  4DOB A;  4XRH A;  4RQ5 A;  1L7O A;  3QZ8 A;  5AM0 A;  2VJ5 A;  2YB4 A;  2UVW A;  4QZA A;  2ESE A;  2M9N A;  3AMZ A;  4KN7 A;  1DXS A;  2ZUD A;  4ED1 A;  4F72 A;  1RQN A;  4RPZ A;  2E8P A;  7ICI A;  2AGQ A;  5ALX A;  2AH5 A;  3C2L A;  2BQR A;  2HHW A;  5BOM A;  4J9L A;  4UAV A;  2BKE A;  4R65 A;  1RYR A;  3PW0 A;  4J9N A;  2YQE A;  5KFI A;  3IG8 A;  2PKE A;  1L7M A;  2FLL A;  1F0M A;  3HT3 A;  2FMQ A;  2W7O A;  5HR6 A;  4PHD A;  1QLN A;  3C21 A;  3RB4 A;  4FBU A;  3GIM A;  1D9F A;  4DQP A;  5AM5 A;  1L7N A;  3QU2 A;  2D6F C;  1PUZ A;  3QU9 A;  4I2B A;  5ALV A;  3OPX A;  3IG5 A;  2WAQ F;  2K4E A;  1A0P A;  4AYB F;  5KFE A;  4DL2 A;  2VA8 A;  2H5X A;  1SL1 A;  1ZYQ A;  2W03 A;  2I9G A;  4F91 B;  3OSN A;  4DL7 A;  4Z6C A;  2ISO A;  3M6K A;  3PSI A;  5KFY A;  1CRX A;  4NLK A;  2W9M A;  5D46 A;  4C7Z A;  5DBB A;  2KEY A;  1RM6 C;  4GIB A;  3EYZ A;  5L1L A;  3GIJ A;  2ZJ8 A;  3MFH A;  2W43 A;  2BQ3 A;  3EW9 A;  1URJ A;  3HKZ C;  2XCP A;  2CXY A;  3MR3 A;  1ZQB A;  2KN7 A;  3JPN A;  5HHI A;  3PX4 A;  4ELV A;  2D3D A;  4RUC A;  5KFF A;  2Y1J A;  4PZN A;  4NLG A;  2E1F A;  5KFJ A;  8ICL A;  4UBC A;  3QU4 A;  1MC8 A;  3C28 A;  4NL9 C;  3V7K A;  2KFZ A;  4TUQ A;  3AU2 A;  4Y2J A;  7ICU A;  5J0U A;  3UQ2 A;  2F8K A;  5KFV A;  2K8A A;  3MFI A;  2B0C A;  3RH4 A;  2J6S A;  4OJP A;  3QYP A;  3QEB Z;  1ZQD A;  2JHD A;  1K1Q A;  1ZQN A;  4PPX A;  4ECY A;  1CUK A;  2W9A A;  2E3T A;  4KMU A;  2E8N A;  4JUZ A;  3I28 A;  4DOC A;  4PGY A;  3G6Y A;  2AU0 A;  9ICM A;  4C80 A;  5IIM A;  5AI8 A;  5JUM A;  4NL9 A;  4B9U A;  3KOO A;  2DPJ A;  4UB8 U;  3RBE A;  3AQE A;  3RJG A;  4YXM A;  5DBC A;  3A0H U;  2PI4 A;  4QZB A;  2ISP A;  4I2I A;  1B4F A;  3UMB A;  1KN5 A;  1QQ7 A;  4JV1 A;  3UXO A;  3T5K A;  2MRL A;  4K4G A;  4PGX A;  1BVS A;  2QKQ A;  4QIW F;  2E1E A;  5AKH A;  4UW9 A;  4C8O A;  2PFN A;  2KV2 A;  1U45 A;  5DQH A;  4JWN A;  4KLI A;  1S76 D;  3RR8 A;  2HSZ A;  3U26 A;  4O9M A;  9ICH A;  1LVH A;  1Q3V A;  5IIK A;  5C0Y A;  1K5O A;  2AGO A;  2OCE A;  4RU9 A;  2G07 A;  4UAT A;  1L3U A;  5KFM A;  1V38 A;  2NRZ A;  3MDA A;  1S9F A;  3BS5 B;  5KFW A;  3HPO A;  2WB1 C;  3SEN A;  4RQ7 A;  1CEZ A;  2ZIX B;  4F4K A;  3T5L A;  2W9C B;  1DK3 A;  3Q8S B;  5ALP A;  3ISC A;  2KJ8 A;  4EBC A;  1N56 A;  3HWT A;  2ASD A;  2YX8 A;  5KT3 A;  4RPY A;  4YD2 A;  5L9X A;  2JR5 A;  2O6K A;  1SL2 A;  1ZQX A;  5L1M A;  4DL3 A;  3CW2 C;  1WUD A;  3TKA A;  5KFA A;  4RPX A;  2BGW A;  2BDP A;  3RRG A;  5B5E U;  5CWR A;  3ISD A;  3SD7 A;  5KG1 A;  3L4P A;  7ICF A;  3BQ1 A;  3KKA C;  1S97 A;  5ALJ A;  2KMD A;  1SV0 A;  1N5W A;  2IBK A;  2JXJ A;  3T79 A;  4UAS A;  2EZX A;  3WKA A;  9ICG A;  4F4W A;  4FS1 A;  5E79 U;  4F4X A;  2L5Y A;  4US8 A;  2VA2 A;  1D8L A;  4JWM A;  2W55 A;  5ALM A;  3CNH A;  1NK6 A;  3WKC A;  2W54 A;  4EBD A;  3ZD8 A;  1Z1V A;  3T3F A;  1FFV A;  1S77 D;  5ALY A;  4QZH A;  1T8E A;  1T7P A;  2NRW A;  3TI0 A;  3SR6 A;  4RT2 A;  3RB3 A;  3WKD A;  2BCS A;  2I5H A;  1QSY A;  4JV0 A;  2KHV A;  3SQI A;  4MEY A;  4YP3 A;  1FFU A;  1ZQE A;  3E58 A;  3GV7 B;  7ICV A;  2RRD A;  3HJE A;  1PVR A;  1S8O A;  3RJI A;  1B0X A;  3TAD A;  3GII A;  4ECR A;  4IC9 A;  2J6T A;  5AKX A;  1L6N A;  1SB3 C;  5ALH A;  5J2B A;  1SZP A;  2XGQ A;  3F2D A;  2BDU A;  5J2H A;  8ICJ A;  1ZQK A;  4O5K A;  3F2B A;  1RG6 A;  1ZD3 A;  2WTF A;  1JXE A;  1J97 A;  5AKK A;  4O3P A;  3JPT A;  2Q0Z X;  2P66 A;  8ICM A;  4PH5 A;  1Y88 A;  1VJ5 A;  5J8Y A;  1MSW D;  4CGZ A;  4Q8E A;  2XY6 A;  1D9D A;  2HCF A;  2HVH A;  3TAR A;  4IRC A;  4BXO A;  5KG6 A;  4YR2 A;  1UT5 A;  4PJ0 U;  8ICS A;  2KD1 A;  5AKE A;  3PZP A;  2Z7J A;  4IQW A;  3FAH A;  2HDO A;  1ZQY A;  2XGP A;  4TQR A;  3WK4 A;  2EAO A;  4F4Y A;  3TFS A;  1SZH A;  4BGD A;  2XVT A;  1BPY A;  1ZRM A;  5J2J A;  3QUC A;  9ICJ A;  3NRW A;  3ORY A;  1YT3 A;  1ZQO A;  2K4P A;  4EX6 A;  4F2R A;  4O3R A;  2C28 A;  1NK0 A;  4CF4 A;  4UB6 U;  4FBT A;  9ICQ A;  5IIJ A;  2BCQ A;  4A8E A;  2BCR A;  2K89 A;  2JEF A;  9ICV A;  2ZTE A;  3Q8M A;  4IL6 U;  5AI9 A;  2DUY A;  3G6X A;  4IRD A;  2W11 A;  1KTQ A;  4U7C A;  2QLT A;  3C29 A;  2MAX A;  4PGQ A;  4AYB C;  4OCZ A;  5HMM A;  2KVS A;  5TZV A;  2ES6 A;  8ICB A;  1NNL A;  5DB9 A;  3WKB A;  3N7S C;  3C23 A;  4DFK A;  5C5J A;  4YR0 A;  5ALT A;  5KFQ A;  4YXJ A;  1ZQV A;  4EYI B;  3PV8 A;  4B9L A;  1U47 A;  2R8G A;  3PX0 A;  4ECQ A;  1WWU A;  2IA6 A;  4ECZ A;  4KLF A;  1ZQZ A;  1O03 A;  5III A;  2MSN A;  8ICH A;  4GXJ A;  3GZF A;  4NV0 A;  1NI3 A;  4B9T A;  1SL0 A;  2PXI A;  2C22 A;  1QTM A;  4BUG A;  2DFL A;  5T14 A;  1X40 A;  1HJP A;  5KG7 A;  1MQ3 A;  3ALR A;  4ICA A;  3KD3 A;  8ICX A;  1X9S A;  5KFG A;  2YB1 A;  3SZ2 A;  3OJS A;  3MDC A;  5KFH A;  2B6G A;  4EEL A;  2K8C B;  1X6I A;  3F53 A;  4KLS A;  2ASL A;  2GWS A;  3NTU A;  2YMP A;  5JRT A;  7ICQ A;  4C8K A;  2LM4 A;  2JGA A;  4P4P A;  1QH9 A;  4YG2 A;  7ICO A;  4DFD A;  4FZM A;  1KQQ A;  3V7L A;  1JN3 A;  4F5P A;  2KP7 A;  4EEK A;  4K4I A;  2W04 A;  4YR3 A;  5ALG A;  2C2D A;  4C4S A;  3D2Q A;  4M9H A;  5J0Q A;  3HW8 A;  9ICX A;  4UB4 A;  5TIS U;  1UA1 A;  5ALQ A;  5J2C A;  4FZL A;  1ZQA A;  1A76 A;  5L1J A;  3AU6 A;  5AK6 A;  3PW7 A;  2KHQ A;  5IIN A;  1KLN A;  1UQV A;  2OEH A;  4TUP A;  3K1R B;  8ICZ A;  2F3N A;  7ICN A;  1JIH A;  3PST A;  4DQI A;  5EE1 A;  2XI9 A;  3PY8 A;  4UB1 A;  2BCU A;  4RQ0 A;  4NM1 A;  2H3V A;  3AN1 A;  4M9L A;  2C2E A;  3HRD D;  5EWG A;  2PI5 A;  2ZIV A;  3CRX A;  3IHQ B;  3QUB A;  2JZB A;  5AK3 A;  2VKQ A;  2ZG6 A;  4F5R A;  5J8Y C;  4NM2 A;  1NK8 A;  2IMW P;  5K4L A;  3PX6 A;  2JEI A;  1RPL A;  4OD0 A;  5KFS A;  3ETL A;  4ZOH C;  9ICA A;  3RB0 A;  1EXN A;  3SAH A;  4F5N A;  4J9O A;  3DEE A;  2V9W A;  3QE9 Y;  1ZQR A;  1T94 A;  4PZO A;  4DQS A;  1QQ6 A;  2LKY A;  2ZUC A;  1OXJ A;  3KKA A;  1TAQ A;  4MF8 A;  4M2Y A;  5AI4 A;  3SYZ A;  2LYH A;  4LZG A;  4GC7 A;  2K4I A;  5AK5 A;  1X6J A;  2KOB A;  4P4O A;  1ZD2 P;  3FC4 A;  3B0X A;  4WJ3 B;  4Y2U A;  5F9L A;  4P0Q A;  3B9J A;  4B9S A;  3JPS A;  4GFJ A;  5KT4 A;  7ICE A;  3GIK A;  2KKV A;  3PR5 B;  5BOL A;  1DRG A;  5CR0 A;  5KG2 A;  4PL1 A;  1ZXI A;  4I2F A;  4I29 A;  1XNS A;  4Q45 A;  5AM3 A;  2HMX A;  3ZDB A;  1X9W A;  1S0O A;  2Y9T A;  3BS7 A;  2IOF A;  2JMG A;  3LVW A;  4DL6 A;  2XC9 A;  5AIA A;  3BQ2 A;  2LYB A;  3KHH A;  4RQ8 A;  1ZQG A;  8ICQ A;  9ICN A;  3RBD A;  5DG8 A;  4DF8 A;  5AI6 A;  4BWJ A;  4I2C A;  2LMR A;  3SI8 A;  4QZG A;  1UT8 A;  4NLC A;  2E8O A;  8ICA A;  4M6W A;  4C8M A;  5F9N A;  2NYV A;  2D8C A;  2ZJ5 A;  1BNP A;  5GTI U;  1SKW A;  4E0D A;  4IQT A;  2LM1 A;  2ASJ A;  2LHT A;  4XA5 A;  3WU2 U;  4RNN A;  5J2D A;  1COK A;  1P7D A;  2ZIU A;  4CF5 A;  3SAG A;  4UAZ A;  1BPE A;  1T4G A;  1T3N A;  4BWM A;  3C5F A;  2IOF K;  4LJX A;  4QWA A;  5BPC A;  1ZQU A;  3H0L B;  4C0Z A;  1RYU A;  2FI1 A;  2PFO A;  5B66 U;  4EEN A;  3UMG A;  5ALN A;  2RDJ A;  2ZXI A;  4B9M A;  4USA A;  4KLM A;  3C1Y A;  5EE0 A;  3F5E A;  1FO4 A;  3WK6 A;  4OJO A;  4ACO A;  4ECV A;  1Q8K A;  1RDF A;  7ICK A;  4ED7 A;  3IV6 A;  2XY5 A;  5AKJ A;  5ALZ A;  2RQ5 A;  2OH2 A;  2AHO B;  4O5C A;  3TAC B;  3SMV A;  3QZ7 A;  4Z6F A;  4O3N A;  2G09 A;  5ALW A;  3SV4 A;  1XO1 A;  2ZJA A;  2BPC A;  3PNC A;  3ZDA A;  3ZDD A;  2EZY A;  5F3X B;  4Q44 A;  3M6Z A;  4DWI A;  1X42 A;  3KBB A;  1H38 A;  2VAN A;  3HX0 A;  2R18 A;  2PFQ A;  3RTV A;  1SIJ A;  4R64 A;  2W9B B;  3M8R A;  2R8K A;  3TAN A;  4YMN A;  4J9P A;  2ZIX A;  1SKS A;  3KFU F;  5ALK A;  4ELT A;  3BS5 A;  1XSP A;  1L8L A;  1Z00 A;  1XC9 A;  4KLQ A;  1F5S A;  4Y2V A;  1PVP A;  2PMZ F;  3S6J A;  4KLT A;  2HI0 A;  4B6J A;  4F71 A;  2FJ6 A;  4DF4 A;  3PR4 A;  2HVI A;  3F5A A;  2G5H B;  4MF2 A;  4NXZ A;  3PVX A;  1U9L A;  4DFJ A;  4QZD A;  5D4B A;  4NJ8 A;  8ICV A;  2NO4 A;  4KLH A;  4O3M A;  3RF9 A;  1YZ7 A;  5KFU A;  2YY6 A;  2JH7 A;  3ZI4 A;  5J0W A;  1S0M A;  5J0R A;  2HHU A;  1A77 A;  3QX7 A;  3EPG A;  2ZIW B;  5A0L A;  4BX9 C;  2FE9 A;  5EWE A;  3H8J A;  2RDI A;  3KTQ A;  3H8M A;  1DK2 A;  4LVS A;  3DV9 A;  2KK0 A;  3RJJ A;  1RXW A;  2KZ3 A;  2DBY A;  5CEH A;  1Z4O A;  1UHU A;  3EWA A;  8ICO A;  3Q8K A;  3IDW A;  4CCH A;  4RUA A;  1Q3U A;  1X2I A;  2ZTD A;  2OM6 A;  1L8O A;  1KSP A;  5KNI A;  1WCN A;  1MQ2 A;  4QZ8 A;  2ATL A;  1DGJ A;  8ICE A;  2YTU A;  1NZP A;  3PSF A;  3HP6 A;  4P2H A;  2ZUB A;  5KL8 B;  4I2D A;  2ZIW A;  2FMP A;  2QAR A;  4Y2P A;  3MGH A;  1ARO P;  5ALD A;  1LV5 A;  1N62 A;  4DSE A;  8ICT A;  2KSO A;  5KTQ A;  5EE9 A;  1WWV A;  4EBE A;  2FLN A;  2F1H A;  4NLN A;  3V72 A;  3L5K A;  4P0P A;  4F3O A;  5CA7 A;  4J9K A;  2UVR A;  1Z3E B;  4CDG A;  3N28 A;  2EQY A;  1N2X A;  4U6P A;  5AK4 A;  3K1Z A;  1JAL A;  1UA0 A;  3RB6 A;  7ICL A;  2Y0S F;  4PL2 A;  2BR0 A;  3DDH A;  1SWW A;  8ICF A;  2K8B B;  1JUD A;  1HIW A;  5ALS A;  4R8U B;  1IM4 A;  3K4G A;  3ED5 A;  3OTQ A;  2MUT B;  3QXG A;  3D2S A;  3PW4 A;  4EYH B;  4Y2Y A;  2F1I A;  3M9N B;  1M6Y A;  3L3F X;  5KFN A;  3A0B U;  1DOQ A;  2HOF A;  2G08 A;  7ICM A;  2NV3 A;  5AM2 A;  2QAR B;  5KFZ A;  9ICO A;  1ZQW A;  1JI7 A;  2H3Q A;  1X9X A;  2RHF A;  1TV9 A;  5J2F A;  9ICE A;  4Z6D A;  4ED2 A;  4F50 A;  5EE3 A;  3PML A;  2OXO A;  4QWE A;  1PK1 A;  5HHH A;  3RJK A;  3M9O B;  3TAP A;  3PW5 A;  2A19 A;  3SEI A;  2I1Q A;  2PFP A;  3ZDC A;  2ZTC A;  8ICC A;  3VC8 A;  5AI0 A;  4TUS A;  4CRX A;  5DB7 A;  2F8L A;  1J2N A;  2HHV A;  2W7P A;  1BPD A;  2QB0 B;  4G3I A;  4R8U A;  5DQG A;  4BDP A;  2RP5 A;  4M04 A;  5ALI A;  3V6K A;  4KMO B;  2F44 A;  5D49 A;  3BQ7 A;  3QU7 A;  1V85 A;  2GOL A;  2KKP A;  4YQW A;  3Q8P B;  4RZR A;  1AQ6 A;  7ICT A;  1QSL A;  2A1J A;  1DGS A;  3NVW A;  4M0A A;  1O08 A;  3D6J A;  1KL9 A;  1ZQC A;  1BPZ A;  2VJ4 A;  2N1R A;  2R8I A;  5FP0 A;  4IRK A;  7ICJ A;  3C1Z A;  1BGX T;  4GC6 A;  2BQU A;  2KSO B;  4J9M A;  4YVZ A;  4K4H A;  3GU3 A;  4DSF A;  2HHX A;  3SAF A;  4KLG A;  2KFN A;  2KVC A;  3C2M A;  2F76 X;  3LWL A;  2HOI A;  4Y2Q A;  1ZQJ A;  2NO5 A;  2BZF A;  1LKY A;  5KT5 A;  2FPK A;  4DSI A;  2XY7 A;  3PO5 A;  1ZQI A;  8ICW A;  4Y2S A;  3BDP A;  3NUQ A;  5AKZ A;  4TQS A;  5J2I A;  3RAQ A;  4P0P B;  8ICI A;  1ZOL A;  1Z19 A;  7ICP A;  5J2E A;  3TAQ A;  1ZQM A;  2ODG A;  1WG8 A;  2G0A A;  9ICC A;  2IOH A;  1RXV A;  5KFX A;  1NK9 A;  1TK8 A;  4KLJ A;  3NVZ A;  5HNK A;  2W3R A;  2HHT A;  5JTI A;  4JK1 A;  9ICP A;  1A6S A;  5KFB A;  1C7Y A;  3D2N A;  1XSN A;  4MHV A;  2IHN A;  4QZ9 A;  1KW4 A;  5AI5 A;  3MGI A;  4ZH4 A;  2OWO A;  4F92 B;  4RQ6 A;  5AM1 A;  1NKC A;  2WF8 A;  1SKR A;  2MUT A;  2H3F A;  3ONN A;  3EZ5 A;  3RRH A;  9ICT A;  2ZIU B;  4NLB A;  4RQ2 A;  3OJU A;  2OHF A;  3FM9 A;  1C20 A;  4YN4 A;  2XO7 A;  1JMS A;  2UVV A;  1KEJ A;  1NJX A;  2W9B A;  3FYH A;  4M6W B;  3RH5 A;  5J0Y A;  1BPB A;  8ICG A;  4RT3 A;  2KIC A;  3IP4 B;  3WK5 A;  4O0I A;  1KFT A;  4DO9 A;  3CP8 A;  2LBO A;  2DGZ A;  4XQ8 A;  4M47 A;  9ICS A;  1KRP A;  2DPI A;  1SV4 A;  4LZD A;  4RQN A;  1COO A;  1L3S A;  1BPX A;  3MAB A;  1TAM A;  3J81 j;  2PMZ C;  8ICP A;  2JEJ A;  2E8M A;  5ALE A;  5J0X A;  2EH9 A;  4O3Q A;  2J6U A;  2QB0 A;  2BCV A;  9ICF A;  1LB2 B;  2HBK A;  1ZQP A;  4QWB A;  4PHA A;  2QB1 A;  5KAI U;  4I2J A;  5KL1 B;  1N48 A;  4DL5 A;  4DSL A;  5G5G A;  1NJW A;  1ZRN A;  1N60 A;  4CNQ A;  4UAY A;  3JPO A;  3T5J A;  1NKB A;  4G9B A;  1X66 A;  5CJ7 A;  3GV5 B;  5HP4 A;  1LKY B;  3C5G A;  4QWD A;  2W8L A;  1SWV A;  5AHX A;  1TE2 A;  4OO1 J;  1XWL A;  8ICK A;  1PK3 A;  3BQ0 A;  4MEX A;  4RNO A;  4DL4 A;  4P4M A;  3GFK B;  5EOZ A;  1V9P A;  4ED3 A;  5J2G A;  1ZQF A;  3PW2 A;  4I2A A;  4ELU A;  5AKL A;  5KT6 A;  4GXI A;  5DKW A;  3RH6 A;  2CPR A;  4UQG A;  3R9K A;  4C8L A;  2ZIV B;  2WF5 A;  5IIO A;  3V6H A;  1ECW A;  1T3Q A;  4DFP A;  1TK5 A;  1NK4 A;  4EX7 A;  2HW3 A;  4JMU A;  3BZK A;  3MBY A;  2BHN A;  1U4B A;  3GV8 B;  2EZZ A;  2XIC A;  3QUT A;  4NLZ A;  2KE7 A;  2YMQ A;  7ICS A;  5CB1 A;  1Z00 B;  3RJF A;  3HIL A;  1TK0 A;  1SXD A;  4YMO A;  3WK8 A;  4QZE A;  2WHE A;  2P6U A;  3ICX A;  4XUS A;  3FDS A;  4QW8 A;  4KN4 A;  4BJQ A;  4J9S A;  3NAS A;  2WFA A;  4C4T A;  3JPP A;  3WK9 A;  1OW5 A;  5DQI A;  5ALR A;  4Z6E A;  2NRT A;  1D8Y A;  3H4B A;  4F4Z A;  2KZM A;  2FDR A;  4FE3 A;  5DDY A;  3OSP A;  1S10 A;  7ICR A;  2R8J A;  2W3S A;  2Y0S C;  5J0T A;  3H7I A;  5KG5 A;  4RQ3 A;  1B43 A;  5KT7 A;  2KIW A;  3QNM A;  1HEK A;  1JXL A;  2VIX A;  2C2R A;  9ICL A;  4UBB A;  3K75 D;  3VCB A;  1CI4 A;  4P0Q B;  1MN8 A;  2NRX A;  2JZB B;  3UXP A;  4IQV A;  2YN4 A;  5HR7 A;  3LK9 A;  3G6V A;  1FIQ A;  1KBU A;  3N7R C;  1ZQS A;  3TAD C;  9ICB A;  1ZQT A;  1RYS A;  4J9R A;  5DGB A;  1ZJN A;  2F77 X;  1MA7 A;  1ED1 A;  5DG9 A;  2I6X A;  2V4Q A;  1VDV A;  5IIL A;  3H0M B;  3N4M B;  4C7Y A;  4F93 B;  1L3V A;  5DDM A;  3AUO A;  4OJL A;  1UCV A;  2ZXH A;  3NVY A;  4B9N A;  3MC1 A;  1KDH A;  3QU5 A;  4Q43 A;  8ICY A;  3NRZ A;  3AL0 B;  5CP2 A;  3H0R B;  2K60 A;  2HHS A;  1QSS A;  4J9Q A;  3V7J A;  4KIT B;  1NKE A;  3SV3 A;  3UPQ A;  1IIP A;  2KJ5 A;  3RJE A;  1ZQ1 C;  4RQ1 A;  3IRU A;  1SV0 C;  1QQ5 A;  4F2S A;  4B9V A;  4I2H A;  3UQ0 A;  2EAM A;  4I27 A;  5AM4 A;  2MA1 A;  1PZN A;  1XSL A;  1F44 A;  3I76 A;  5KG0 A;  2Y1I A;  4DCC A;  1L5U A;  1J2M A;  1WCL A;  3F2C A;  5KFD A;  5J2A A;  5AKG A;  2KIV A;  1ZJM A;  2XCA A;  2K4H A;  2V4R A;  2FMS A;  1ZD4 A;  1BNO A;  1HUO A;  5EWF A;  3LYS A;  3MR5 A;  5DBA A;  3H8S A;  1XO0 A;  4M9J A;  1XU4 A;  3PMN A;  4FZN A;  3Q8Q B;  4O3O A;  4DLE A;  1Z4N A;  4YCX A;  4DS4 A;  7ICG A;  2AXT U;  4F5Q A;  4QW9 A;  3ETR A;  2UVU A;  4DS5 A;  3AEV A;  4RQ4 A;  5DB6 A;  1SXE A;  4ECT A;  2YMM A;  9ICR A;  3Q8L A;  1KFS A;  3EUB 2;  2A1A A;  5J0O A;  2IHM A;  3T5H A;  4KLL A;  9ICW A;  4IR9 A;  4KTQ A;  5KG3 A;  5DGA A;  2DWQ A;  1S0N A;  1V97 A;  4NY8 A;  4CF3 A;  3ISB A;  2HBJ A;  4QWC A;  4EEY A;  1HUZ A;  2H3I A;  4C8N A;  2ALZ A;  2HBL A;  4R63 A;  4F8R A;  4ED6 A;  4I28 A;  2DF4 B;  1RQL A;  4ED8 A;  2WAQ C;  1SGG A;  1IG6 A;  2KZZ A;  3ZDE A;  3UXN A;  4Q8F A;  3WK7 A;  2AQ4 A;  5ALL A;  3KHG A;  3O0F A;  3C2K A;  4ECU A;  5KFR A;  4X5V A; 
#chains in the Genus database with same CATH homology
 1WUD A;  2CRX A;  4KX3 A;  2MA1 A;  2XID A;  3RF9 A;  4O3M A;  2VKQ A;  1F44 A;  2G5I B;  2JH7 A;  4CGZ A;  1P7D A;  2ZIU A;  2ZG6 A;  4BJQ A;  3D2S A;  4BUG A;  3SAG A;  3L3F X;  5T14 A;  3IG8 A;  3NUQ A;  3CYM A;  4QIW C;  3F2C A;  3ALR A;  2HOF A;  2JH1 A;  2KJ9 A;  2ZIW B;  2G08 A;  4ICA A;  2W7O A;  4P0P B;  5HR6 A;  3H0L B;  2NV3 A;  4C0Z A;  4BX9 C;  5A0L A;  1Z19 A;  1PVQ A;  1TAM A;  3SAH A;  2KD1 A;  2PMZ C;  3DEE A;  2H3Q A;  2Q4T A;  3T79 A;  2K4H A;  2YB1 A;  2RHF A;  2D6F C;  3AQE A;  2ZXI A;  1T94 A;  2G0A A;  3HKZ F;  3PZP A;  2Z7J A;  3LYS A;  4FE3 A;  3OPX A;  3IG5 A;  2WAQ F;  2K4E A;  3F5E A;  1A0P A;  2OXO A;  4OJO A;  2LKY A;  4AYB F;  4ACO A;  1GO3 F;  2HOQ A;  2Y0S C;  1XO0 A;  1SZH A;  2HBK A;  2KNJ A;  4KX5 A;  2K8C B;  2XVT A;  4FZN A;  3F53 A;  2W03 A;  5KL1 B;  2WB1 F;  3VC8 A;  2OH2 A;  1D8B A;  2KIW A;  1Q3U A;  2MRL A;  2K4I A;  4CRX A;  3M6K A;  1HEK A;  3PSI A;  2OM6 A;  2F8L A;  3NRW A;  2VIX A;  3SMV A;  1CRX A;  2KOB A;  4NWI A;  2CN1 A;  3VCB A;  1UPH A;  3KZX A;  2JGA A;  1A6S A;  2G09 A;  2W7P A;  1YT3 A;  4P0Q B;  3D2N A;  2KEY A;  3M7D A;  4WJ3 B;  2LYA A;  3LVV A;  4P0Q A;  4QIW F;  2E1E A;  3PSF A;  4FZM A;  2F2A B;  5HR7 A;  4GFJ A;  3RFA A;  2RP5 A;  4A8E A;  5KL8 B;  2K89 A;  3IN5 A;  4KMO B;  2KKV A;  2ZIW A;  1Z1B A;  3N7R C;  1KBU A;  2KV2 A;  2W04 A;  1DRG A;  2KHV A;  2DQN B;  3SQI A;  4OO1 J;  3M6Z A;  2GH1 A;  2GOL A;  4PL1 A;  2KKP A;  3D2Q A;  1Q3V A;  1XNS A;  1URJ A;  4OJ5 A;  3HKZ C;  3MGV A;  2F77 X;  4U7C A;  2HMX A;  5CRX A;  1MA7 A;  1ED1 A;  2H3F A;  3AQF A;  2R18 A;  2RRD A;  2G06 A;  3ONN A;  3C29 A;  5C0Y A;  4QJF B;  1OUQ A;  1PVR A;  2JMG A;  3H0M B;  2ZIU B;  3LVW A;  4FZL A;  4AYB C;  4NLB A;  2G07 A;  2CPR A;  4QNL A;  2ZIX A;  3KFU F;  2E1F A;  3PSP A;  4OJL A;  2HBJ A;  3N7S C;  2ZXH A;  2LYB A;  2ZIV B;  4IC9 A;  3C28 A;  2H3Z A;  2VJ4 A;  2WB1 C;  1ECW A;  2HBM A;  2N1R A;  2ZIX B;  2H3I A;  4OJ6 A;  4P0P A;  1PVP A;  1L6N A;  2PMZ F;  2HBL A;  2KHQ A;  2VJ5 A;  3AL0 B;  3H0R B;  2YB4 A;  4JMU A;  4CDG A;  2E5S A;  2K8A A;  3F2D A;  2XIC A;  4U6P A;  2KJ8 A;  2BDU A;  3GU3 A;  2DF4 B;  4NLC A;  3K1Z A;  2WAQ C;  3SAF A;  2YX8 A;  2M0N A;  3E0F A;  2KIC A;  3IP4 B;  3N7P D;  3PST A;  4OJP A;  2A3V A;  1IIP A;  2KJ5 A;  2XI9 A;  3CP8 A;  3F5A A;  2KVC A;  3F2B A;  1ZQ1 C;  2G5H B;  2Y0S F;  2H3V A;  4PL2 A;  2JHD A;  2LBO A;  2OYY A;  2DGZ A;  2F76 X;  2HOI A;  3O0F A;  2K8B B;  3ICX A;  2ZIV A;  3GZF A;  1HIW A;  4NV0 A;  2LHT A;  1NZB A;  3CRX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...