2MAXA

Nmr structure of the rna polymerase alpha subunit c-terminal domain from helicobacter pylori
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
114
structure length
114
Chain Sequence
LGVFGERPIANTEYSGDYAQRDDAKDLSAKIESMNLSARCFNCLDKIGIKYVGELVLMSEEELKGVKNMGKKSYDEIAEKLNDLGYPVGTELSPEQRESLKKRLEKLEDKGGND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords DNA-directed RNA polymerase subunit alpha
publication title Helicobacter pylori RNA polymerase alpha-subunit C-terminal domain shows features unique to -proteobacteria and binds NikR/DNA complexes.
pubmed doi rcsb
source organism Helicobacter pylori
total genus 24
structure length 114
sequence length 114
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2013-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2maxA00
3C2MA 4XUSA 2ASJA 4I2CA 5KFDA 2C2DA 4MFAA 3TAQA 2BDPA 3KHGA 4KLDA 1IXRA 3PY8A 4I2DA 2MAXA 4DQRA 2AQ4A 2F1IA 3V6JA 1KTQA 4C8KA 8ICIA 4KLOA 1NK8A 2M9NA 3PR5B 5KFNA 3EPIA 3IM1A 1ZQRA 7ICPA 5DQGA 5C5JA 4PGQA 2PXIA 5DKWA 2A1JB 3LWMA 5J0OA 4DSKA 3AUOA 2P6UA 3M8SA 2KFZA 1AROP 3QZ7A 4JV0A 4QWBA 9ICVA 4MFFA 2I9GA 5KFMA 9ICWA 2BCUA 4DQQA 5KFTA 1TK5A 9ICIA 2BKEA 5DGBA 2HHQA 2C2EA 5CJ7A 5KG3A 5EWFA 4B9TA 4DS5A 4F3OA 4DQPA 2BHNA 4YP3A 7ICVA 4Z6FA 1ZQLA 7ICJA 8ICMA 4NLKA 4KLQA 4DL2A 4PH5A 1KSPA 4B9LA 4J9QA 4DQIA 3H7IA 1ZJNA 3UQ2A 2KZMA 4YFKA 1ZQEA 2AU0A 3RJIA 2J6UA 1UT5A 8ICNA 3ETLA 7ICRA 1DGSA 4R66A 4I2AA 4RQ7A 3RB6A 1SL2A 3PVXA 5J0YA 3ORYA 1UT8A 4TURA 1C7YA 1KFDA 3JPTA 4I27A 4RUCA 1Z3EB 2V4RA 3PX6A 4MEXA 1ZQDA 2BCRA 4DSEA 2BCVA 5DBBA 1SZPA 5EOZA 4DOBA 5DQIA 2ZTDA 4RQ3A 4P4PA 1ZQKA 4KLUA 1MSWD 4Z6CA 2ZJ5A 1IM4A 3Q8SB 4I2FA 4ED8A 2R8HA 2HHWA 3GIJA 3BQ0A 5HP4A 4M47A 4TQRA 2KFNA 5KFRA 4NLNA 4ELVA 4GLXA 2BGWA 2WTFA 3RRGA 3G6YA 1ZQBA 4QZ8A 5KFCA 3QEBZ 8ICYA 4DF4A 4J9OA 5J2GA 4QZHA 7ICIA 8ICBA 3PO5A 3G6XA 3PW0A 3RJGA 1TK0A 1SKWA 4FBUA 4DSFA 3H8WA 7ICEA 2BPFA 2MUTA 5J2EA 4BDPA 4Z6EA 4GXIA 4O5CA 1B22A 4GXJA 1CUKA 4ECTA 4RPZA 5J0RA 3PX4A 3MFHA 7ICQA 2F1JA 4YCXA 4ECYA 4I2GA 2VA2A 7ICNA 5F9LA 3ZDEA 3MFIA 3SZ2A 4DL5A 3N97B 5IIIA 3HX0A 4GXKA 1XSNA 5KT2A 3UXPA 1NJWA 1RYSA 2JEJA 4KLGA 2KZZA 1ZQTA 1KRPA 3EYZA 2XC9A 3JPNA 3N4MB 4FS2A 5DG8A 3PMLA 1V9PA 4BXOA 1MQ3A 5KFLA 2BR0A 4QWCA 4R64A 4NLGA 4UAWA 2JZBA 9ICNA 3TAPA 2FLNA 5J2FA 4DQSA 2ZUDA 4F5OA 3Q8MA 2IHMA 3RJJA 3E2EA 1TFRA 3RR7A 1XSPA 2RDIA 4C8NA 1U9LA 5JUMA 2XGPA 3PW5A 4RQ5A 3QEAZ 1EXNA 3OSNA 3HT3A 4RT2A 1BGXT 1ZQAA 1NOMA 1D9FA 4DL3A 4KLHA 3RTVA 4C8MA 1T7PA 3RH5A 2ISPA 1COOA 1XO1A 1N48A 4ZH4A 3V7KA 2VA8A 8ICJA 4F5NA 2ZJ8A 3OGUA 2FMQA 3C1YA 2BCSA 1BPDA 4ED6A 4DWIA 4IQVA 3T5JA 3UXOA 2HHSA 5CB1A 1ZQCA 1ZQJA 3MABA 1U49A 2UVWA 1XU4A 1L3TA 9ICLA 9ICTA 2PFQA 4PHPA 5J0QA 1Z00A 4O5KA 5J0WA 1JXLA 4M9HA 1ZQGA 7ICMA 4R65A 2ALZA 4KLIA 4O3QA 5TZVA 4KLLA 4M9GA 3K75D 2V9WA 5D46A 1JN3A 5J0UA 3RJHA 2ISOA 5KFQA 2P6RA 4RUAA 4MF2A 2RDJA 4QW9A 4O9MA 1ZQQA 2W9AA 2R8JA 1XS9D 4YVZA 4RT3A 4TUPA 5J2AA 4EYHB 7ICTA 8ICOA 2DPIA 3OHAA 3ISBA 3PO4A 5KFFA 2W9BB 4M6WA 3IHQB 3RB3A 2FLLA 4J9PA 4LZDA 3FYHA 5HMMA 3LWLA 4F5PA 4DSJA 3UXNA 4KMUA 3HW8A 4EZ6A 3Q8LA 4QZFA 4KLMA 4UB1A 3C23A 3RH6A 1TK8A 8ICKA 9ICFA 3Q8RB 5CR0A 4RPXA 3M8RA 3PX0A 3HPOA 4P2HA 2BPGA 5DLGA 4K4IA 4F5QA 3KHRA 4DSIA 5KFHA 3ZD8A 4O3OA 4F93B 1ZQXA 3OJUA 2Q0ZX 1JIHA 2PFOA 5KG7A 2UVRA 2A1JA 1X9SA 2AJQA 1TAQA 5KFZA 5DG9A 8ICXA 2HHUA 5KT5A 3B0XA 1NK6A 3NGDA 4UQGA 4ECXA 3C5FA 4QZDA 4KN4A 3TFSA 1BPEA 1T4GA 1S10A 3RJEA 1KEJA 2DPJA 4Q43A 1T8EA 2UVUA 3SV3A 4I2BA 1D8LA 3Q8KA 1TV9A 2AQ0A 4RQ4A 4DSLA 1U48A 1T3NA 9ICJA 4KLFA 2ZJAA 7ICFA 2NRWA 3PV8A 2H5XA 5D49A 5L1IA 3MBYA 1TAUA 5KT7A 2AGQA 8ICUA 4UAYA 5L9XA 2LYHA 3V6HA 5IINA 4J9SA 5DB6A 4ELUA 8ICFA 5J2CA 4RNOA 4DOCA 2JEIA 4PHAA 3BQ1A 4F92B 1NK4A 4QZBA 2J6SA 4O3SA 2ZUBA 9ICMA 1JX4A 4MEYA 3GIMA 4M0AA 9ICEA 5IIOA 3JPSA 4J9NA 2FMSA 4PPXA 3BQ2A 4R8UA 2HHVA 1SKRA 4P4OA 8ICSA 4TUSA 2GWSA 3SYZA 1L5UA 2P66A 5KG5A 2C22A 4IQWA 4KN7A 5KFKA 1WCLA 1NJZA 8ICQA 1NK7A 2HHXA 2MUTB 3C2KA 2VANA 3K4GA 4YMOA 5J2BA 3GV8B 1NJXA 3MGIA 3JPOA 4G3IA 5KFXA 3H40A 4GC6A 4ED3A 7ICOA 1ZQSA 5KFEA 4M04A 1D9DA 3QZ8A 3V7JA 4I2EA 4QZCA 5BOMA 3OJSA 2ASLA 3RAQA 4KLSA 3LDAA 5KG1A 4UB4A 4ECQA 1TVAA 4J9MA 5L1KA 8ICEA 4RNMA 4J9KA 4DFMA 3TARA 2PFPA 4FBTA 1K1QA 2NRZA 4KTQA 8ICHA 4B9NA 3KHLA 4F2RA 1UA0A 3ZDAA 5KFGA 3JPPA 1KLNA 4I2IA 3RJFA 2BPCA 4MFCA 5KFPA 2BQUA 1S0NA 1XC9A 4JV1A 4QWAA 4ED1A 4BWJA 2AGOA 2ZTEA 1L3UA 3PR4A 3PMNA 1S9FA 3EZ5A 4F4XA 2C2RA 8ICPA 5KT4A 4RZRA 1XSLA 1A76A 2PI5A 3G6VA 3TQ1A 1KFSA 3SV4A 4KLTA 4ELTA 4DL6A 4XQ8A 1LV5A 9ICCA 4UBBA 3H4DA 4EBCA 4DEZA 1S0MA 4JUZA 5KT6A 5IIKA 1SL1A 4ED2A 4KITB 3JPRA 4DL4A 5J0SA 1BPXA 2IMWP 1QLNA 1PZNA 4ECRA 2HW3A 8ICRA 4X5VA 3MGHA 3GIIA 5KG6A 4QZGA 2XO7A 1S0OA 4B9UA 2W9MA 1U47A 8ICCA 7ICHA 4P4MA 3RRHA 4Z6DA 1NJYA 4O5EA 4O3RA 3EW9A 5F9NA 1WCNA 1ZQYA 3C1ZA 5HMLA 4YR3A 2W8LA 3BJYA 2FPKA 4FS1A 3KTQA 4JWNA 4UB5A 1Z00B 5HHHA 2NRXA 1SKSA 2ASDA 1KFTA 5DB8A 2W9CB 4F5RA 1H38A 3KHHA 4DLEA 1QSSA 8ICLA 4J9RA 3AU2A 5J2JA 3V7LA 4J9LA 4F4YA 4QZAA 5DLFA 3GILA 1NK5A 4UBCA 4B9VA 4ECZA 5KFBA 1ZQHA 5EWGA 7ICKA 4B9MA 7ICGA 9ICRA 1RYRA 2C28A 3HWTA 1QSYA 5BPCA 4JWMA 4LVSA 2HHTA 3T5LA 4IRCA 4IR1A 4TQSA 3MDAA 2KZ3A 2I1QA 5IILA 5CA7A 3H8JA 5IIMA 7ICLA 2FMPA 4YXJA 1HUZA 4I2HA 3RB0A 4M6WB 4UB3A 1S0VA 1JXEA 1ZQVA 4YQWA 3OSPA 1UA1A 3MR3A 3HP6A 2XY6A 5J0XA 4K4HA 1X2IA 3Q8QB 4YN4A 7ICSA 3M9OB 9ICXA 3ISCA 1SL0A 4F2SA 3GQCA 1ZQZA 2DFLA 4E0DA 2AGPA 3UQ0A 2XCPA 5CP2A 3RBEA 4Q45A 2JEFA 1XWLA 5DB9A 2IA6A 4RPYA 4PHEA 2W9BA 2R8GA 4NLZA 2PFNA 4RU9A 3EWAA 3H8SA 5CHGA 3ZDDA 3V6KA 4Q8FA 3MR6A 4DF8A 4UB2A 5DBCA 1NK9A 1BPZA 2F1HA 4NY8A 4GC7A 1LB2B 4PGXA 3LK9A 4XA5A 3EPGA 5KFAA 4NM2A 3PW7A 2FLPA 1MC8A 9ICAA 9ICHA 3PW4A 5J0PA 2NRTA 1D8YA 4CCHA 9ICKA 2XGQA 4ED7A 3T5HA 5KFJA 5KFWA 3OHBA 1ZQIA 1TKDA 3RJKA 4QZEA 3RBDA 8ICGA 1ZJMA 1ZETA 5DG7A 2BCQA 1S77D 5HHIA 3V72A 1ZQOA 2R8KA 3TI0A 5KFIA 4R63A 5D4BA 4EYIB 8ICZA 4RQ6A 1S97A 2IBKA 5DB7A 4Q44A 3RR8A 2KTQA 3M9MB 1NKCA 1A77A 2HVIA 4IQTA 2J6TA 4ECSA 1ZQNA 4M2YA 2HVHA 4EEYA 4M9JA 2UVVA 4IRKA 1S76D 3C21A 3C5GA 4O3PA 5J0TA 2JEGA 5L1JA 1N56A 1ZQFA 5KFOA 3T3FA 5J2DA 3TANA 3QE9Y 1QTMA 4DFPA 4YD2A 4QZ9A 4PHDA 3THVA 5IIJA 3GDXA 4DFKA 4R8UB 4DS4A 4M9NA 5KFSA 1MQ2A 3GFKB 2KN7A 5J2HA 1RXVA 1QSLA 9ICOA 1BVSA 3T5KA 8ICTA 5KG2A 4Q8EA 2BQ3A 9ICQA 5CWRA 4DL7A 2IHNA 5KFYA 4M9LA 3FDSA 4QZIA 1ZQMA 4NM1A 4F91B 5J29A 4YXMA 9ICUA 1DOQA 4RQ2A 3NTUA 5DBAA 5EWEA 2Y1IA 4O3NA 4QWEA 2PI4A 8ICWA 4C8LA 4PGYA 4ED0A 1NK0A 4F50A 4ECVA 4TUQA 8ICAA 4BXOB 1HJPA 3H4BA 1RPLA 4O0IA 2OWOA 1KDHA 4KLJA 1Y88A 4RNNA 4RQ8A 3M9NB 2JZBB 4C8OA 4F4ZA 5DDYA 3Q8PB 1L3VA 4LZGA 7ICUA 2FPLA 4QW8A 4YMNA 4ECUA 4IRDA 2W8KA 2BQRA 3PW2A 3BDPA 4BWMA 5KG0A 1JMSA 5J2KA 3MR2A 4YD1A 3B0YA 2FPMA 3C2LA 1L3SA 1U4BA 4MF8A 1BPBA 4I29A 5BOLA 4YR0A 3PNCA 5J2IA 2ZUCA 4HYKA 1B43A 4JV2A 9ICPA 1X9MA 1U45A 4YG2A 1RZTA 5KFVA 3RAXA 4IQUA 3GIKA 4YMMA 3RH4A 5KT3A 3AU6A 9ICGA 3MR5A 2ATLA 2NRVA 3BQTA 5HNKA 4DO9A 5DGAA 4QWDA 4F4KA 1RXWA 1NKEA 1ZQWA 4DOAA 1ZQPA 2Y1JA 1K1SA 3ZDBA 3RB4A 4JK1A 2XCAA 3MDCA 1NKBA 2VA3A 4KLEA 9ICSA 5DQHA 5L1LA 4ECWA 4DFJA 3ZD9A 3SI8A 4UAZA 4BGDA 2B21A 4RQ1A 1X9WA 4EBDA 1ZYQA 3GV7B 4IR9A 1BPYA 4B9SA 3ISDA 9ICBA 4EZ9A 2XY5A 4NXZA 5KFUA 3UPQA 4FO6A 4F4WA 1HUOA 5KG4A 4I28A 2ZTCA 8ICVA 1CEZA 4DLGA 1ZQUA 3JPQA 4EBEA 5DDMA 2XY7A 2V4QA 4YR2A 2R8IA 3TFRA 4RQ0A 2W9CA 4I2JA 5KTQA 4F8RA 3GV5B 4XRHA 3ZDCA 4K4GA
chains in the Genus database with same CATH superfamily
5AKYA 5ALQA 4XUSA 5KFDA 4Y2RA 4DQRA 2F1IA 2AHOB 5KFNA 7ICPA 4PGQA 2PXIA 5DKWA 2A1JB 5J0OA 2P6UA 3KZIU 3M8SA 1AROP 1CI4A 1O08A 1Z1BA 2ZIUA 2EAOA 5KFMA 9ICWA 1KW4A 2BKEA 3LYSA 2C2EA 2HHQA 1PVRA 3L3FX 4F3OA 4DQPA 1KSPA 4PH5A 1KL9A 2W55A 3H7IA 3QU5A 2AU0A 7ICRA 3ETLA 4FZNA 1WWVA 2K8BB 2W04A 4R66A 4CE6A 2W54A 1UT8A 3QX7A 1KFDA 4I27A 3HJEA 3PX6A 2BCRA 2BCVA 1J97A 4P4PA 4ICAA 2ZJ5A 2R8HA 4TQRA 1Q3VA 2KFNA 4NLNA 3WK6A 1ZQBA 1SV0A 4DF4A 4IC9A 4J9OA 5J2GA 2B0CA 3G6XA 2RLTA 2LPEA 4GXJA 4ECTA 2ZIWB 4RPZA 7ICQA 3PX4A 3MGVA 4P0QA 4YCXA 4ECYA 4I2GA 7ICNA 2YY6A 5F9LA 3SZ2A 4DL5A 1XSNA 5IIIA 3HX0A 5KT2A 2NV3A 1RYUA 4FS2A 4BXOA 3PSTA 2BR0A 4QWCA 3TADC 2FLNA 3ALRA 1P7DA 4DQSA 2ZUDA 2YMPA 1TFRA 2RDIA 1U9LA 3IN5A 4RQ5A 3QEAZ 1EXNA 3OSNA 4RT2A 1LKYA 4BX9C 2GO7A 2ISPA 1COOA 1XO1A 1NNLA 3M1YA 8ICJA 3OGUA 2BCSA 4DWIA 4ED6A 2WF6A 4IS7A 3T5JA 3A0HU 2MA1A 2OH2A 1XU4A 2PMZF 2RRDA 5J0QA 1Z00A 2WB1C 5J0WA 1JXLA 4M9HA 7ICMA 2ALZA 2ESEA 3F2DA 2HOIA 3K75D 5AK6A 1ZD3A 5KFQA 3WKDA 4QW9A 4O9MA 5AM3A 2W9AA 1ZOLA 1XS9D 5J2AA 5EE3A 5KFFA 2VIXA 2WF5A 3QUBA 4LZDA 1SIJA 3LVWA 4EZ6A 3C23A 8ICKA 1PVPA 4RPXA 1PK3A 2F8KA 3KHRA 4F93B 3OJUA 2UVRA 4UB6U 4A8EA 5KFZA 8ICXA 2HHUA 1NK6A 3C5FA 3SAFA 4Q43A 1T8EA 3Q8KA 3KZXA 4U6PA 1TV9A 1SV4A 5C0YA 5D49A 4EX7A 2IOHA 3MBYA 4EEKA 3WU2U 4J9SA 5IINA 5DB6A 1K5OA 4RNOA 4DOCA 5GTHU 2FJ6A 1NK4A 9ICEA 3JPSA 2HHVA 2LM1A 1VJ5A 1L5UA 5EE0A 5KFKA 1WCLA 8ICQA 1NK7A 3C2KA 2H3FA 5J2BA 3JPOA 4ED3A 1ZQSA 4P0QB 2YQEA 1D9DA 4I2EA 5BOMA 3OJSA 2ASLA 3RAQA 4UB4A 1L8LA 5L1KA 2PFPA 4B9NA 3KHLA 4F2RA 3ZDAA 4CF5A 1FO4A 3RJFA 2P35A 3DDHA 1X6JA 1XC9A 4JV1A 3NRWA 1Z1VA 2YN4A 3TADA 4WJ3B 2KMDA 3PR4A 1S9FA 1JROA 2LYAA 2PI5A 4KLTA 1O03A 9ICCA 3M6ZA 1S0MA 2NYVA 5KT6A 1SL1A 2HBLA 3JPRA 4AYBC 2JR5A 1T94A 2DL0A 1V85A 5KG6A 4QZGA 1T3QA 1U47A 1NJYA 3EW9A 3C1ZA 3BJYA 4FS1A 1Z00B 1RQLA 2NRXA 5AM2A 1KFTA 1ECWA 4F5RA 1RG6A 4DLEA 3KBBA 5DLFA 1MN8A 4B9VA 3M7DA 5ALWA 5KFBA 1ZQHA 7ICKA 4Y2QA 1Z4NA 1NZBA 2YTUA 5BPCA 2HHTA 3B9JA 2Y9UA 3MDAA 1IV8A 3H8JA 4YQWA 1ZQVA 3PSIA 4K4HA 1COKA 4CF3A 4YN4A 2L5YA 2YX8A 2DFLA 4E0DA 1BNOA 5CP2A 4Q45A 3RBEA 1XWLA 4RPYA 4PHEA 1WUDA 3EWAA 5CHGA 4Q8FA 1L7OA 1OXJA 4MHVA 3N7RC 3LK9A 4CNQA 5KFAA 3D2SA 4ED7A 3UMBA 3OHBA 3AMZA 1MA7A 1ZJMA 1ZETA 5KAFU 1HEKA 4RQ6A 5DB7A 2AH5A 2KTQA 2F8LA 3M9MB 1NKCA 3NVVA 3PSFA 2Y0SF 3A0BU 2HVHA 2UVVA 3C5GA 4O3PA 1PVQA 2LKYA 5J2DA 3IDWA 5IIJA 1DXSA 4DFKA 4M9NA 1MQ2A 2A19A 2KN7A 9ICOA 8ICTA 4Q8EA 2HMXA 4QZIA 9ICUA 1DOQA 1V97A 5DBAA 2Y1IA 2FE9A 4C8LA 5ALIA 2FI1A 2K4EA 2GLEA 3FM9A 3H4BA 1RPLA 1ZRMA 2OWOA 4RNNA 4RQ8A 3M9NB 2EH9A 5AKJA 2KD1A 4BWMA 4EENA 2ZXHA 2FPMA 3C2LA 1L3SA 2F77X 1BPBA 5ALDA 1B43A 3CW2C 4YG2A 2O6KA 2DQNB 4IQUA 3R9KA 1SB3C 3BQTA 3SR6A 1NKEA 4DOAA 2JMGA 2G09A 5ALTA 2CPRA 9ICSA 5KL1B 5L1LA 3SI8A 2RHFA 2RQ5A 4EBDA 1BPYA 4B9SA 3ISDA 4JMUA 2XY5A 3MC1A 3UPQA 4DLGA 3GU3A 2W9CA 2EANA 3C2MA 2ASJA 4RQNA 5B5EU 3KHGA 3PY8A 2MAXA 3IRUA 8ICIA 4EX6A 1B4FA 4Y2PA 3UM9A 5DQGA 1JALA 2CN1A 4DSKA 2HOQA 3NASA 2KSOA 4QWBA 4DQQA 5KFTA 1TK5A 5CJ7A 5KG3A 5JTIA 4C0ZA 2BHNA 4YP3A 1ZQLA 7ICJA 8ICMA 4KLQA 4B9LA 3UQ2A 1HIWA 5ALUA 3RJIA 1UT5A 2EAMA 1PK1A 1SWWA 4RQ7A 3RB6A 3PVXA 3ORYA 2OCEA 4RUCA 2V4RA 1ZQDA 4MEXA 4KMOB 4DSEA 5EOZA 4RQ3A 4Z6CA 2G07A 3GZFA 3GIJA 3BQ0A 3BS5B 5KFRA 4ELVA 5KFCA 3QEBZ 2XIDA 8ICBA 2G5IB 2K89A 4LJXA 3RJGA 1SKWA 2BPFA 4BDPA 4O5CA 1B22A 3F2BA 3MFHA 2W03A 2E8NA 2VA2A 3MFIA 1UA1A 7ICFA 2NO4A 3N97B 4GXKA 1NJWA 2K4IA 3UXPA 2KZZA 5ALXA 2XC9A 3JPNA 1X6IA 3PMLA 2WAQF 3CRXA 4R64A 4NLGA 5J2FA 3ZDCA 4F5OA 3RR7A 2E3TA 4Y2UA 2KEYA 3PW5A 3NVYA 3HT3A 1JI7A 1ZQAA 1NOMA 1D9FA 3RTVA 3RH5A 1N48A 4ZH4A 3V7KA 2FMQA 4AP9A 4IQVA 4JB3A 3N7PD 4PZNA 1B0XA 5CB1A 1U49A 2UVWA 9ICTA 5AM4A 4PHPA 2VJ4A 2KVSA 4O3QA 5TZVA 1J2MA 4FZLA 2P6RA 4MF2A 3WKEA 2R8JA 4YVZA 4TUPA 4EELA 2W3SA 4EYHB 3ISBA 2HCFA 3IHQB 1FEZA 5AI0A 3UXNA 2RP5A 2ZIVA 4UB1A 9ICFA 2KNJA 1L8OA 5CR0A 3PX0A 2H3ZA 3HPOA 2Q4TA 4P2HA 4K4IA 4F5QA 5KFHA 2EDUA 2PFOA 2Q0ZX 5KG7A 3N7SC 5KT5A 3B0XA 2WF9A 2G0AA 3NGDA 2H3VA 4QZDA 4KN4A 3RJEA 1KEJA 2DPJA 2UVUA 3SV3A 3N28A 5AK4A 1WG8A 5ALLA 1U48A 9ICJA 4KLFA 2ZJAA 2NRWA 3PV8A 2H5XA 1TAUA 5KT7A 2AGQA 4NJ8A 5L9XA 1F0MA 3V6HA 1C20A 2KICA 4F72A 5AM0A 2K4HA 3UMCA 4PHAA 4F92B 4QZBA 2MU2A 2J6SA 4O3SA 1JX4A 2FMSA 4R8UA 1SKRA 8ICSA 1ZD5A 5L1MA 3C28A 2P66A 4IQWA 1NJZA 3K4GA 5AI6A 4C80A 3H40A 3ONNA 4NLBA 4M04A 3V7JA 3PZPA 3LDAA 4J9MA 8ICEA 4RNMA 3TARA 8ICHA 2NRZA 3JPPA 4I2IA 2BPCA 5KFPA 2BQUA 1S0NA 3CNHA 2PMZC 1ZD4A 4BWJA 3EZ5A 4U7CA 8ICPA 3SENA 1A76A 3G6VA 3SV4A 4UATA 4PZOA 1S5LU 1N60A 1XO0A 3H4DA 4DEZA 2W11A 2PKEA 5ALPA 1FFUA 4ED2A 5AK5A 2IMWP 2HW3A 1PZNA 3K1RB 3DEEA 3D2QA 3GIIA 2W7PA 2AXTU 1J2NA 2XO7A 2W9MA 5EE1A 4C4SA 7ICHA 2YMMA 5AKKA 5F9NA 2KJ9A 4US8A 2W8LA 4JWNA 4MFFA 1X9XA 2ASDA 1H38A 1TAMA 8ICLA 1D8BA 3AU2A 5J2JA 2LMRA 2WHEA 4ECZA 2C28A 5ALRA 4JWMA 4LVSA 4IRCA 1GO3F 4TQSA 5IILA 2I1QA 5CA7A 5A0LA 7ICLA 2HBMA 4YXJA 2FMPA 1DK3A 3NVWA 4UB3A 2QB1A 3MR3A 2XY6A 1KQQA 2ZIUB 2F44A 3ISCA 1ZQZA 2XCPA 5DB9A 4P0PA 2R8GA 5FP0A 2W9BA 3VC8A 1F5SA 2HBJA 2DF4B 4NWIA 3PW7A 2FLPA 3QU9A 1MC8A 4C7ZA 3PW4A 4UAUA 5J0PA 1D8YA 4CCHA 1ZQIA 1TKDA 2LBOA 8ICGA 3V72A 1ZQOA 3TI0A 4R63A 5JU5A 1A77A 2J6TA 4ECSA 4EEYA 3C21A 1KN5A 5KFOA 3TANA 4DFPA 4R8UB 1URJA 2EZXA 5KFSA 5J2HA 1BVSA 2BQ3A 3S6JA 4DL7A 5KFYA 3H0MB 4QNLA 1WYGA 4YXMA 5EWEA 1QQ5A 4Y2SA 4O3NA 2PI4A 8ICWA 4ED0A 2VJ5A 3HKZF 4BXOB 1HJPA 1KBUA 4F4ZA 4OJOA 3Q8PB 4QW8A 1F44A 4YMNA 2W3RA 4YD1A 3B0YA 2JV3A 1U4BA 1LKYB 4YR0A 3WKAA 5BOLA 3PNCA 3TACB 9ICPA 3L5KA 3RH4A 5KT3A 2ATLA 5DGAA 4QWDA 4UAVA 1ZQPA 3ZI4A 3QUCA 1NKBA 4KLEA 4DFJA 4UAZA 4BGDA 4RQ1A 1X9WA 3GV7B 2D6FC 4EZ9A 2BZFA 1HUOA 4QIWF 3JPQA 1X40A 5DDMA 2XY7A 2DUYA 3GV5B 4XRHA 3IG8A 1KKXA 2EZYA 5AI9A 1UQVA 4KLDA 4I2DA 2KJ8A 2AQ4A 5CRXA 3V6JA 4C8KA 1KTQA 4KLOA 2M9NA 2K60A 3SMVA 3IM1A 5C5JA 5TISU 3AUOA 3K1ZA 2KFZA 2Y0SC 1YZ6A 2NO5A 3QZ7A 9ICVA 3WK8A 2WF8A 2I9GA 2ODGA 9ICIA 5DGBA 4B9TA 4DS5A 4PL2A 2F3NA 1N61A 1N5XA 4Z6FA 4NLKA 2IOFA 4DL2A 4B6JA 4DQIA 2KG5A 3QU4A 1ZQEA 3WK4A 4UASA 4I2AA 4F71A 5KAIU 1SL2A 4TURA 3JPTA 1Z3EB 1SZPA 4DOBA 5DQIA 2ZTDA 4KLUA 1MSWD 3WK5A 2BDUA 2FDRA 5HP4A 3AQEA 4M47A 4GLXA 2BGWA 3RRGA 3G6YA 5ALVA 2JHDA 7ICIA 1FFVA 3PO5A 3PW0A 2YB1A 4ZOHC 1TK0A 4FBUA 2DWQA 4Z6EA 2W7OA 5J0RA 2EQYA 2F1JA 5AI4A 1RYSA 2JEJA 1L7MA 1M6YA 1ZQTA 1KRPA 2D8CA 3EYZA 3N4MB 4GIBA 5AK3A 1MQ3A 4UAWA 2JZBA 3TAPA 4C4TA 3Q8MA 3RJJA 1YZ7A 1N5WA 1XSPA 1RM6C 4C8NA 5JUMA 5T14A 2ZIXA 1BGXT 3E58A 4DL3A 4KLHA 5AKZA 1T7PA 5ALKA 3F2CA 2VA8A 4F5NA 2H3QA 3UXOA 2M0NA 1ZQCA 1L3TA 2LHTA 5ALFA 3QUQA 4O5KA 1ZQGA 4KX5A 2W43A 4R65A 4KLIA 1PUZA 4KLLA 4M9GA 2G5HB 2V9WA 5D46A 1JN3A 5J0UA 1BNPA 1WWUA 2ISOA 4RUAA 2RDJA 1ZQQA 3E0FA 7ICTA 1SZHA 8ICOA 3OHAA 1XNSA 3RB3A 4Y2VA 5HMMA 1ZRNA 4F5PA 4DSJA 1L7NA 2EAPA 3HW8A 2LM4A 3DV9A 5G5HA 3Q8LA 4KLMA 3M8RA 1ZXIA 4NL9C 2JH1A 4C7YA 2BPGA 4DSIA 4UW9A 4O3OA 3AN1A 1JIHA 3F53A 1A0PA 2A1JA 2AJQA 5ALEA 1T4GA 1D8LA 2AQ0A 4RQ4A 1DRGA 2VKQA 1N62A 5L1IA 2QLTA 5J2CA 3PSPA 2JEIA 1FIQA 2WAQC 3QYPA 4MEYA 4M0AA 3ICXA 5H2FU 1YT3A 4TUSA 2GWSA 2C22A 4IL6U 3WK7A 2HHXA 4YMOA 5AHXA 1NJXA 2E8PA 3GV8B 5ALJA 4G3IA 5ALZA 5KFEA 4QZCA 4KLSA 5KG1A 4ECQA 3SAHA 1TVAA 5AI5A 4J9KA 4DFMA 1LVHA 1K1QA 1UPHA 1UA0A 1KLNA 4MFCA 3QU2A 2KJ5A 4ED1A 2AGOA 4Y2TA 2C2RA 3WKBA 1XSLA 4OO1J 2ZIXB 4ELTA 2Z7JA 5IIKA 1QLNA 4KITB 1V38A 5J0SA 8ICRA 4ECRA 4X5VA 3MGHA 1S0OA 4B9UA 3RRHA 4CDGA 4DCCA 4O5EA 3NRZA 4O3RA 5KL8B 1WCNA 1ZQYA 5HMLA 2JRZA 3KTQA 1SKSA 5B66U 2W9CB 3F5AA 4J9RA 3BZCA 2Y9TA 2E1EA 2CXYA 1NK5A 4UBCA 5EWGA 4B9MA 3HILA 2KHQA 2WF7A 1RYRA 9ICRA 5AKEA 2KVCA 4IR1A 3AQFA 4I2HA 3RB0A 3WK9A 1S0VA 5AM1A 2KSOB 3H0LB 3KOOA 3Q8QB 1SL0A 4F2SA 2AGPA 3UQ0A 2JEFA 2IA6A 4NLZA 4NL9A 4RU9A 3H8SA 3ZDDA 2JH7A 2YMLA 4G9BA 2ZXIA 4UB2A 5DBCA 1BPZA 4NY8A 4GC7A 2KKPA 4PGXA 4XA5A 3VCBA 3CYMA 4NM2A 9ICAA 3C29A 9ICHA 2NRTA 4BUGA 1PK1B 2XGQA 3T5HA 1X66A 3RJKA 4QZEA 2ZG6A 5DG7A 4C4RA 5HHIA 2R8KA 3BQ7A 5D4BA 2IBKA 1DK2A 2HVIA 5ALMA 1ZQNA 2HI0A 4M2YA 4M9JA 1S76D 4IRKA 2JEGA 5L1JA 1ZQFA 3T3FA 4QZ9A 3GDXA 4NLCA 4DS4A 2OHFA 2YB4A 1S8OA 3IP4B 1ZQ1C 1RXVA 3T5KA 2A1AA 5KG2A 9ICQA 2XVTA 2KP7A 2IHNA 4M9LA 5ALHA 2DBYA 4F91B 5J29A 2MRLA 3U26A 1Z19A 5HR7A 4QWEA 1JRPA 4F50A 4ECVA 2KHVA 4O0IA 1Y88A 3KKAC 1L3VA 4LZGA 7ICUA 3J81j 2W8KA 5J2KA 3MR2A 2QB0A 5E79U 2ZUCA 4HYKA 1DGJA 1SXEA 1OUQA 1RZTA 1L7PA 3RAXA 2OM6A 5J8YA 3GIKA 3AU6A 9ICGA 4OJPA 3MR5A 5HNKA 4FE3A 1ZQWA 4DFDA 3D2NA 2VA3A 5DQHA 4ECWA 4J03A 3QUTA 9ICBA 5GTIU 4FO6A 5KG4A 2DGZA 4OCZA 4I28A 2ZTCA 2I5HA 1CEZA 1ZQUA 4EBEA 2V4QA 4I2JA 5KTQA 4F8RA 3T79A 2KOBA 1UCVA 2IOFK 4Y2JA 4I2CA 2C2DA 4MFAA 3TAQA 2BDPA 1IXRA 2ZIVB 1NK8A 3PR5B 3EPIA 3I1YA 1ZQRA 3LWMA 4CRXA 3H0RB 2N1RA 3TKAA 4JV0A 3SD7A 2BCUA 4CF4A 2WB1F 2KK0A 5EWFA 7ICVA 2R18A 4J9QA 4GFJA 1Q8KA 1ZJNA 1A6SA 3IV6A 4YFKA 1VLBA 2KZMA 2J6UA 5ALSA 8ICNA 1SWVA 1DGSA 5J0YA 3HKZC 1C7YA 4O3MA 2ES6A 5DBBA 1ZD2P 1ZQKA 1IM4A 3Q8SB 4I2FA 4ED8A 3F5EA 2HHWA 2E8MA 2WTFA 4QZ8A 5EE9A 8ICYA 4QJFB 2F2AB 4QZHA 7ICEA 4DSFA 3H8WA 2HOFA 2MUTA 5J2EA 4GXIA 3I28A 4Y2YA 1UHUA 1CUKA 2K8CB 1QCKA 3ZDEA 2YMQA 4KLGA 2E5SA 2JXJA 3KKAA 3NVZA 3SAGA 5DG8A 1V9PA 5KFLA 2QB0B 3KFUF 9ICNA 4QIWC 3E2EA 2IHMA 1QQ6A 2F76X 2XGPA 3AM9A 5AIAA 2WFAA 2OYYA 4C8MA 4NV0A 5JRTA 2ZJ8A 3C1YA 2MSNA 1BPDA 2HHSA 2I6XA 1ZQJA 3MABA 2HSZA 9ICLA 2PFQA 4KX3A 1N63A 2QARA 5KNIA 3RJHA 1QH9A 4Y2XA 2KE7A 4ACOA 4RT3A 4OJ5A 2EZZA 4AYBF 2DPIA 3PO4A 4P0PB 3OTQA 2W9BB 4M6WA 2FLLA 4J9PA 2OEHA 3FYHA 3LWLA 2D3DA 4KMUA 4QZFA 3RH6A 1TK8A 3AEVA 3Q8RB 4UARA 5DLGA 3ZD8A 4KTQA 1ZQXA 1X9SA 1TAQA 3LVVA 3RF9A 5AKXA 5DG9A 3NS1A 4UQGA 4ECXA 4OD0A 3TFSA 1S10A 1BPEA 3ETRA 5ALNA 4I2BA 3M6KA 1QQ7A 4DSLA 2QKQA 1T3NA 2DKXA 4RQMA 1NI3A 4BJQA 8ICUA 4UAYA 2LYHA 4USAA 2KIWA 4ELUA 8ICFA 2DKZA 2E1FA 3BQ1A 2ZUBA 9ICMA 3GIMA 4PL1A 5IIOA 2KIVA 4J9NA 4PPXA 3BQ2A 2G06A 3CP8A 4UB8U 5AKGA 4P4OA 3AL0B 3SYZA 5KG5A 4KN7A 3UMGA 1Q3UA 5AKLA 2MUTB 3BS5A 2VANA 2G08A 3MGIA 1IG6A 5KFXA 4GC6A 7ICOA 2H3IA 3QZ8A 4OJ6A 4HAIA 4FBTA 2XICA 5KFGA 2K8AA 3ED5A 5ALOA 4QWAA 3D6JA 2ZTEA 1L3UA 3PMNA 1TE2A 4F4XA 1CRXA 5KT4A 4RZRA 3TQ1A 1KFSA 5CEHA 4DL6A 4XQ8A 1LV5A 4UBBA 4EBCA 1IIPA 3BZKA 4JUZA 1BPXA 4DL4A 8ICCA 4P4MA 4Z6DA 3SQIA 4YR3A 2FPKA 4UB5A 5HHHA 2GOLA 2HDOA 5DB8A 2B6GA 2QARB 3KHHA 1QSSA 1RQNA 3KD3A 3V7LA 4J9LA 4F4YA 4QZAA 1OW5A 3GILA 7ICGA 1SGGA 1QSYA 3HWTA 1AQ6A 2LYBA 3T5LA 2KZ3A 3QNMA 5IIMA 1HUZA 4M6WB 4FFDA 5K4LA 1JXEA 3OSPA 3HP6A 1N2XA 5J0XA 3HRDD 1ED1A 1X2IA 7ICSA 3M9OB 3GQCA 5AICA 3EUB2 2KKVA 2PFNA 3FAHA 3V6KA 3L4PA 3MR6A 4DF8A 1NK9A 2F1HA 3O0FA 2JGAA 2KV2A 1LB2B 3EPGA 1JUDA 9ICKA 2K4PA 5KFJA 5KFWA 5AIBA 3RBDA 2BCQA 1S77D 5KFIA 4EYIB 8ICZA 3I76A 1S97A 4Q44A 3RR8A 5G5GA 3WKCA 3BS7A 4IQTA 5AKIA 9ICXA 5J0TA 1N56A 3QE9Y 1QTMA 5ALGA 4YD2A 4PHDA 3THVA 1Q46A 2CRXA 2GH1A 3GFKB 1QSLA 2OXOA 4OJLA 3SEIA 1SV0C 5CWRA 3FDSA 1ZQMA 4NM1A 4RQ2A 2LI6A 3NTUA 4PGYA 1NK0A 3FC4A 4TUQA 8ICAA 3RFAA 2ZIWA 2A3VA 5AKHA 1KDHA 5HR6A 4KLJA 2JZBB 4C8OA 5DDYA 2FPLA 4ECUA 2E8OA 4IRDA 2BQRA 3PW2A 3BDPA 5KG0A 1JMSA 5AI8A 3H8MA 4MF8A 4I29A 3NUQA 5AM5A 5J2IA 4FZMA 5ALYA 5J8YC 4JV2A 1X9MA 1L6NA 1U45A 1VDVA 4CGZA 4PJ0U 5KFVA 4YMMA 1Z4OA 2NRVA 3QU7A 4DO9A 4F4KA 1RXWA 5F3XB 3OPXA 2Y1JA 1K1SA 3ZDBA 3RB4A 2XI9A 4JK1A 2XCAA 3MDCA 3ZD9A 1NZPA 2B21A 1SXDA 1ZYQA 4IR9A 4US9A 4NXZA 5KFUA 4F4WA 1X42A 8ICVA 3QXGA 4YR2A 2R8IA 3TFRA 4RQ0A 2HBKA 3IG5A 4K4GA 1RDFA
chains in the Genus database with same CATH topology
3C2MA 4XUSA 2ASJA 4I2CA 5KFDA 2C2DA 4MFAA 3TAQA 2BDPA 3KHGA 4KLDA 1IXRA 3PY8A 4I2DA 2MAXA 4DQRA 2AQ4A 2F1IA 3V6JA 1KTQA 4C8KA 8ICIA 4KLOA 1NK8A 2M9NA 3PR5B 5KFNA 3EPIA 3IM1A 1ZQRA 7ICPA 5DQGA 5C5JA 4PGQA 2PXIA 5DKWA 2A1JB 3LWMA 5J0OA 4DSKA 3AUOA 2P6UA 3M8SA 2KFZA 1AROP 3QZ7A 4JV0A 4QWBA 9ICVA 4MFFA 2I9GA 5KFMA 9ICWA 2BCUA 4DQQA 5KFTA 1TK5A 9ICIA 2BKEA 5DGBA 2HHQA 2C2EA 5CJ7A 5KG3A 5EWFA 4B9TA 4DS5A 4F3OA 4DQPA 2BHNA 4YP3A 7ICVA 4Z6FA 1ZQLA 7ICJA 8ICMA 4NLKA 4KLQA 4DL2A 4PH5A 1KSPA 4B9LA 4J9QA 4DQIA 3H7IA 1ZJNA 3UQ2A 2KZMA 4YFKA 1ZQEA 2AU0A 3RJIA 2J6UA 1UT5A 8ICNA 3ETLA 7ICRA 1DGSA 4R66A 4I2AA 4RQ7A 3RB6A 1SL2A 3PVXA 5J0YA 3ORYA 1UT8A 4TURA 1C7YA 1KFDA 3JPTA 4I27A 4RUCA 1Z3EB 2V4RA 3PX6A 4MEXA 1ZQDA 2BCRA 4DSEA 2BCVA 5DBBA 1SZPA 5EOZA 4DOBA 5DQIA 2ZTDA 4RQ3A 4P4PA 1ZQKA 4KLUA 1MSWD 4Z6CA 2ZJ5A 1IM4A 3Q8SB 4I2FA 4ED8A 2R8HA 2HHWA 3GIJA 3BQ0A 5HP4A 4M47A 4TQRA 2KFNA 5KFRA 4NLNA 4ELVA 4GLXA 2BGWA 2WTFA 3RRGA 3G6YA 1ZQBA 4QZ8A 5KFCA 3QEBZ 8ICYA 4DF4A 4J9OA 5J2GA 4QZHA 7ICIA 8ICBA 3PO5A 3G6XA 3PW0A 3RJGA 1TK0A 1SKWA 4FBUA 4DSFA 3H8WA 7ICEA 2BPFA 2MUTA 5J2EA 4BDPA 4Z6EA 4GXIA 4O5CA 1B22A 4GXJA 1CUKA 4ECTA 4RPZA 5J0RA 3PX4A 3MFHA 7ICQA 2F1JA 4YCXA 4ECYA 4I2GA 2VA2A 7ICNA 5F9LA 3ZDEA 3MFIA 3SZ2A 4DL5A 3N97B 5IIIA 3HX0A 4GXKA 1XSNA 5KT2A 3UXPA 1NJWA 1RYSA 2JEJA 4KLGA 2KZZA 1ZQTA 1KRPA 3EYZA 2XC9A 3JPNA 3N4MB 4FS2A 5DG8A 3PMLA 1V9PA 4BXOA 1MQ3A 5KFLA 2BR0A 4QWCA 4R64A 4NLGA 4UAWA 2JZBA 9ICNA 3TAPA 2FLNA 5J2FA 4DQSA 2ZUDA 4F5OA 3Q8MA 2IHMA 3RJJA 3E2EA 1TFRA 3RR7A 1XSPA 2RDIA 4C8NA 1U9LA 5JUMA 2XGPA 3PW5A 4RQ5A 3QEAZ 1EXNA 3OSNA 3HT3A 4RT2A 1BGXT 1ZQAA 1NOMA 1D9FA 4DL3A 4KLHA 3RTVA 4C8MA 1T7PA 3RH5A 2ISPA 1COOA 1XO1A 1N48A 4ZH4A 3V7KA 2VA8A 8ICJA 4F5NA 2ZJ8A 3OGUA 2FMQA 3C1YA 2BCSA 1BPDA 4ED6A 4DWIA 4IQVA 3T5JA 3UXOA 2HHSA 5CB1A 1ZQCA 1ZQJA 3MABA 1U49A 2UVWA 1XU4A 1L3TA 9ICLA 9ICTA 2PFQA 4PHPA 5J0QA 1Z00A 4O5KA 5J0WA 1JXLA 4M9HA 1ZQGA 7ICMA 4R65A 2ALZA 4KLIA 4O3QA 5TZVA 4KLLA 4M9GA 3K75D 2V9WA 5D46A 1JN3A 5J0UA 3RJHA 2ISOA 5KFQA 2P6RA 4RUAA 4MF2A 2RDJA 4QW9A 4O9MA 1ZQQA 2W9AA 2R8JA 1XS9D 4YVZA 4RT3A 4TUPA 5J2AA 4EYHB 7ICTA 8ICOA 2DPIA 3OHAA 3ISBA 3PO4A 5KFFA 2W9BB 4M6WA 3IHQB 3RB3A 2FLLA 4J9PA 4LZDA 3FYHA 5HMMA 3LWLA 4F5PA 4DSJA 3UXNA 4KMUA 3HW8A 4EZ6A 3Q8LA 4QZFA 4KLMA 4UB1A 3C23A 3RH6A 1TK8A 8ICKA 9ICFA 3Q8RB 5CR0A 4RPXA 3M8RA 3PX0A 3HPOA 4P2HA 2BPGA 5DLGA 4K4IA 4F5QA 3KHRA 4DSIA 5KFHA 3ZD8A 4O3OA 4F93B 1ZQXA 3OJUA 2Q0ZX 1JIHA 2PFOA 5KG7A 2UVRA 2A1JA 1X9SA 2AJQA 1TAQA 5KFZA 5DG9A 8ICXA 2HHUA 5KT5A 3B0XA 1NK6A 3NGDA 4UQGA 4ECXA 3C5FA 4QZDA 4KN4A 3TFSA 1BPEA 1T4GA 1S10A 3RJEA 1KEJA 2DPJA 4Q43A 1T8EA 2UVUA 3SV3A 4I2BA 1D8LA 3Q8KA 1TV9A 2AQ0A 4RQ4A 4DSLA 1U48A 1T3NA 9ICJA 4KLFA 2ZJAA 7ICFA 2NRWA 3PV8A 2H5XA 5D49A 5L1IA 3MBYA 1TAUA 5KT7A 2AGQA 8ICUA 4UAYA 5L9XA 2LYHA 3V6HA 5IINA 4J9SA 5DB6A 4ELUA 8ICFA 5J2CA 4RNOA 4DOCA 2JEIA 4PHAA 3BQ1A 4F92B 1NK4A 4QZBA 2J6SA 4O3SA 2ZUBA 9ICMA 1JX4A 4MEYA 3GIMA 4M0AA 9ICEA 5IIOA 3JPSA 4J9NA 2FMSA 4PPXA 3BQ2A 4R8UA 2HHVA 1SKRA 4P4OA 8ICSA 4TUSA 2GWSA 3SYZA 1L5UA 2P66A 5KG5A 2C22A 4IQWA 4KN7A 5KFKA 1WCLA 1NJZA 8ICQA 1NK7A 2HHXA 2MUTB 3C2KA 2VANA 3K4GA 4YMOA 5J2BA 3GV8B 1NJXA 3MGIA 3JPOA 4G3IA 5KFXA 3H40A 4GC6A 4ED3A 7ICOA 1ZQSA 5KFEA 4M04A 1D9DA 3QZ8A 3V7JA 4I2EA 4QZCA 5BOMA 3OJSA 2ASLA 3RAQA 4KLSA 3LDAA 5KG1A 4UB4A 4ECQA 1TVAA 4J9MA 5L1KA 8ICEA 4RNMA 4J9KA 4DFMA 3TARA 2PFPA 4FBTA 1K1QA 2NRZA 4KTQA 8ICHA 4B9NA 3KHLA 4F2RA 1UA0A 3ZDAA 5KFGA 3JPPA 1KLNA 4I2IA 3RJFA 2BPCA 4MFCA 5KFPA 2BQUA 1S0NA 1XC9A 4JV1A 4QWAA 4ED1A 4BWJA 2AGOA 2ZTEA 1L3UA 3PR4A 3PMNA 1S9FA 3EZ5A 4F4XA 2C2RA 8ICPA 5KT4A 4RZRA 1XSLA 1A76A 2PI5A 3G6VA 3TQ1A 1KFSA 3SV4A 4KLTA 4ELTA 4DL6A 4XQ8A 1LV5A 9ICCA 4UBBA 3H4DA 4EBCA 4DEZA 1S0MA 4JUZA 5KT6A 5IIKA 1SL1A 4ED2A 4KITB 3JPRA 4DL4A 5J0SA 1BPXA 2IMWP 1QLNA 1PZNA 4ECRA 2HW3A 8ICRA 4X5VA 3MGHA 3GIIA 5KG6A 4QZGA 2XO7A 1S0OA 4B9UA 2W9MA 1U47A 8ICCA 7ICHA 4P4MA 3RRHA 4Z6DA 1NJYA 4O5EA 4O3RA 3EW9A 5F9NA 1WCNA 1ZQYA 3C1ZA 5HMLA 4YR3A 2W8LA 3BJYA 2FPKA 4FS1A 3KTQA 4JWNA 4UB5A 1Z00B 5HHHA 2NRXA 1SKSA 2ASDA 1KFTA 5DB8A 2W9CB 4F5RA 1H38A 3KHHA 4DLEA 1QSSA 8ICLA 4J9RA 3AU2A 5J2JA 3V7LA 4J9LA 4F4YA 4QZAA 5DLFA 3GILA 1NK5A 4UBCA 4B9VA 4ECZA 5KFBA 1ZQHA 5EWGA 7ICKA 4B9MA 7ICGA 9ICRA 1RYRA 2C28A 3HWTA 1QSYA 5BPCA 4JWMA 4LVSA 2HHTA 3T5LA 4IRCA 4IR1A 4TQSA 3MDAA 2KZ3A 2I1QA 5IILA 5CA7A 3H8JA 5IIMA 7ICLA 2FMPA 4YXJA 1HUZA 4I2HA 3RB0A 4M6WB 4UB3A 1S0VA 1JXEA 1ZQVA 4YQWA 3OSPA 1UA1A 3MR3A 3HP6A 2XY6A 5J0XA 4K4HA 1X2IA 3Q8QB 4YN4A 7ICSA 3M9OB 9ICXA 3ISCA 1SL0A 4F2SA 3GQCA 1ZQZA 2DFLA 4E0DA 2AGPA 3UQ0A 2XCPA 5CP2A 3RBEA 4Q45A 2JEFA 1XWLA 5DB9A 2IA6A 4RPYA 4PHEA 2W9BA 2R8GA 4NLZA 2PFNA 4RU9A 3EWAA 3H8SA 5CHGA 3ZDDA 3V6KA 4Q8FA 3MR6A 4DF8A 4UB2A 5DBCA 1NK9A 1BPZA 2F1HA 4NY8A 4GC7A 1LB2B 4PGXA 3LK9A 4XA5A 3EPGA 5KFAA 4NM2A 3PW7A 2FLPA 1MC8A 9ICAA 9ICHA 3PW4A 5J0PA 2NRTA 1D8YA 4CCHA 9ICKA 2XGQA 4ED7A 3T5HA 5KFJA 5KFWA 3OHBA 1ZQIA 1TKDA 3RJKA 4QZEA 3RBDA 8ICGA 1ZJMA 1ZETA 5DG7A 2BCQA 1S77D 5HHIA 3V72A 1ZQOA 2R8KA 3TI0A 5KFIA 4R63A 5D4BA 4EYIB 8ICZA 4RQ6A 1S97A 2IBKA 5DB7A 4Q44A 3RR8A 2KTQA 3M9MB 1NKCA 1A77A 2HVIA 4IQTA 2J6TA 4ECSA 1ZQNA 4M2YA 2HVHA 4EEYA 4M9JA 2UVVA 4IRKA 1S76D 3C21A 3C5GA 4O3PA 5J0TA 2JEGA 5L1JA 1N56A 1ZQFA 5KFOA 3T3FA 5J2DA 3TANA 3QE9Y 1QTMA 4DFPA 4YD2A 4QZ9A 4PHDA 3THVA 5IIJA 3GDXA 4DFKA 4R8UB 4DS4A 4M9NA 5KFSA 1MQ2A 3GFKB 2KN7A 5J2HA 1RXVA 1QSLA 9ICOA 1BVSA 3T5KA 8ICTA 5KG2A 4Q8EA 2BQ3A 9ICQA 5CWRA 4DL7A 2IHNA 5KFYA 4M9LA 3FDSA 4QZIA 1ZQMA 4NM1A 4F91B 5J29A 4YXMA 9ICUA 1DOQA 4RQ2A 3NTUA 5DBAA 5EWEA 2Y1IA 4O3NA 4QWEA 2PI4A 8ICWA 4C8LA 4PGYA 4ED0A 1NK0A 4F50A 4ECVA 4TUQA 8ICAA 4BXOB 1HJPA 3H4BA 1RPLA 4O0IA 2OWOA 1KDHA 4KLJA 1Y88A 4RNNA 4RQ8A 3M9NB 2JZBB 4C8OA 4F4ZA 5DDYA 3Q8PB 1L3VA 4LZGA 7ICUA 2FPLA 4QW8A 4YMNA 4ECUA 4IRDA 2W8KA 2BQRA 3PW2A 3BDPA 4BWMA 5KG0A 1JMSA 5J2KA 3MR2A 4YD1A 3B0YA 2FPMA 3C2LA 1L3SA 1U4BA 4MF8A 1BPBA 4I29A 5BOLA 4YR0A 3PNCA 5J2IA 2ZUCA 4HYKA 1B43A 4JV2A 9ICPA 1X9MA 1U45A 4YG2A 1RZTA 5KFVA 3RAXA 4IQUA 3GIKA 4YMMA 3RH4A 5KT3A 3AU6A 9ICGA 3MR5A 2ATLA 2NRVA 3BQTA 5HNKA 4DO9A 5DGAA 4QWDA 4F4KA 1RXWA 1NKEA 1ZQWA 4DOAA 1ZQPA 2Y1JA 1K1SA 3ZDBA 3RB4A 4JK1A 2XCAA 3MDCA 1NKBA 2VA3A 4KLEA 9ICSA 5DQHA 5L1LA 4ECWA 4DFJA 3ZD9A 3SI8A 4UAZA 4BGDA 2B21A 4RQ1A 1X9WA 4EBDA 1ZYQA 3GV7B 4IR9A 1BPYA 4B9SA 3ISDA 9ICBA 4EZ9A 2XY5A 4NXZA 5KFUA 3UPQA 4FO6A 4F4WA 1HUOA 5KG4A 4I28A 2ZTCA 8ICVA 1CEZA 4DLGA 1ZQUA 3JPQA 4EBEA 5DDMA 2XY7A 2V4QA 4YR2A 2R8IA 3TFRA 4RQ0A 2W9CA 4I2JA 5KTQA 4F8RA 3GV5B 4XRHA 3ZDCA 4K4GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C2M A;  4XUS A;  2ASJ A;  4I2C A;  5KFD A;  2C2D A;  4MFA A;  3TAQ A;  2BDP A;  3KHG A;  4KLD A;  1IXR A;  3PY8 A;  4I2D A;  2MAX A;  4DQR A;  2AQ4 A;  2F1I A;  3V6J A;  1KTQ A;  4C8K A;  8ICI A;  4KLO A;  1NK8 A;  2M9N A;  3PR5 B;  5KFN A;  3EPI A;  3IM1 A;  1ZQR A;  7ICP A;  5DQG A;  5C5J A;  4PGQ A;  2PXI A;  5DKW A;  2A1J B;  3LWM A;  5J0O A;  4DSK A;  3AUO A;  2P6U A;  3M8S A;  2KFZ A;  1ARO P;  3QZ7 A;  4JV0 A;  4QWB A;  9ICV A;  4MFF A;  2I9G A;  5KFM A;  9ICW A;  2BCU A;  4DQQ A;  5KFT A;  1TK5 A;  9ICI A;  2BKE A;  5DGB A;  2HHQ A;  2C2E A;  5CJ7 A;  5KG3 A;  5EWF A;  4B9T A;  4DS5 A;  4F3O A;  4DQP A;  2BHN A;  4YP3 A;  7ICV A;  4Z6F A;  1ZQL A;  7ICJ A;  8ICM A;  4NLK A;  4KLQ A;  4DL2 A;  4PH5 A;  1KSP A;  4B9L A;  4J9Q A;  4DQI A;  3H7I A;  1ZJN A;  3UQ2 A;  2KZM A;  4YFK A;  1ZQE A;  2AU0 A;  3RJI A;  2J6U A;  1UT5 A;  8ICN A;  3ETL A;  7ICR A;  1DGS A;  4R66 A;  4I2A A;  4RQ7 A;  3RB6 A;  1SL2 A;  3PVX A;  5J0Y A;  3ORY A;  1UT8 A;  4TUR A;  1C7Y A;  1KFD A;  3JPT A;  4I27 A;  4RUC A;  1Z3E B;  2V4R A;  3PX6 A;  4MEX A;  1ZQD A;  2BCR A;  4DSE A;  2BCV A;  5DBB A;  1SZP A;  5EOZ A;  4DOB A;  5DQI A;  2ZTD A;  4RQ3 A;  4P4P A;  1ZQK A;  4KLU A;  1MSW D;  4Z6C A;  2ZJ5 A;  1IM4 A;  3Q8S B;  4I2F A;  4ED8 A;  2R8H A;  2HHW A;  3GIJ A;  3BQ0 A;  5HP4 A;  4M47 A;  4TQR A;  2KFN A;  5KFR A;  4NLN A;  4ELV A;  4GLX A;  2BGW A;  2WTF A;  3RRG A;  3G6Y A;  1ZQB A;  4QZ8 A;  5KFC A;  3QEB Z;  8ICY A;  4DF4 A;  4J9O A;  5J2G A;  4QZH A;  7ICI A;  8ICB A;  3PO5 A;  3G6X A;  3PW0 A;  3RJG A;  1TK0 A;  1SKW A;  4FBU A;  4DSF A;  3H8W A;  7ICE A;  2BPF A;  2MUT A;  5J2E A;  4BDP A;  4Z6E A;  4GXI A;  4O5C A;  1B22 A;  4GXJ A;  1CUK A;  4ECT A;  4RPZ A;  5J0R A;  3PX4 A;  3MFH A;  7ICQ A;  2F1J A;  4YCX A;  4ECY A;  4I2G A;  2VA2 A;  7ICN A;  5F9L A;  3ZDE A;  3MFI A;  3SZ2 A;  4DL5 A;  3N97 B;  5III A;  3HX0 A;  4GXK A;  1XSN A;  5KT2 A;  3UXP A;  1NJW A;  1RYS A;  2JEJ A;  4KLG A;  2KZZ A;  1ZQT A;  1KRP A;  3EYZ A;  2XC9 A;  3JPN A;  3N4M B;  4FS2 A;  5DG8 A;  3PML A;  1V9P A;  4BXO A;  1MQ3 A;  5KFL A;  2BR0 A;  4QWC A;  4R64 A;  4NLG A;  4UAW A;  2JZB A;  9ICN A;  3TAP A;  2FLN A;  5J2F A;  4DQS A;  2ZUD A;  4F5O A;  3Q8M A;  2IHM A;  3RJJ A;  3E2E A;  1TFR A;  3RR7 A;  1XSP A;  2RDI A;  4C8N A;  1U9L A;  5JUM A;  2XGP A;  3PW5 A;  4RQ5 A;  3QEA Z;  1EXN A;  3OSN A;  3HT3 A;  4RT2 A;  1BGX T;  1ZQA A;  1NOM A;  1D9F A;  4DL3 A;  4KLH A;  3RTV A;  4C8M A;  1T7P A;  3RH5 A;  2ISP A;  1COO A;  1XO1 A;  1N48 A;  4ZH4 A;  3V7K A;  2VA8 A;  8ICJ A;  4F5N A;  2ZJ8 A;  3OGU A;  2FMQ A;  3C1Y A;  2BCS A;  1BPD A;  4ED6 A;  4DWI A;  4IQV A;  3T5J A;  3UXO A;  2HHS A;  5CB1 A;  1ZQC A;  1ZQJ A;  3MAB A;  1U49 A;  2UVW A;  1XU4 A;  1L3T A;  9ICL A;  9ICT A;  2PFQ A;  4PHP A;  5J0Q A;  1Z00 A;  4O5K A;  5J0W A;  1JXL A;  4M9H A;  1ZQG A;  7ICM A;  4R65 A;  2ALZ A;  4KLI A;  4O3Q A;  5TZV A;  4KLL A;  4M9G A;  3K75 D;  2V9W A;  5D46 A;  1JN3 A;  5J0U A;  3RJH A;  2ISO A;  5KFQ A;  2P6R A;  4RUA A;  4MF2 A;  2RDJ A;  4QW9 A;  4O9M A;  1ZQQ A;  2W9A A;  2R8J A;  1XS9 D;  4YVZ A;  4RT3 A;  4TUP A;  5J2A A;  4EYH B;  7ICT A;  8ICO A;  2DPI A;  3OHA A;  3ISB A;  3PO4 A;  5KFF A;  2W9B B;  4M6W A;  3IHQ B;  3RB3 A;  2FLL A;  4J9P A;  4LZD A;  3FYH A;  5HMM A;  3LWL A;  4F5P A;  4DSJ A;  3UXN A;  4KMU A;  3HW8 A;  4EZ6 A;  3Q8L A;  4QZF A;  4KLM A;  4UB1 A;  3C23 A;  3RH6 A;  1TK8 A;  8ICK A;  9ICF A;  3Q8R B;  5CR0 A;  4RPX A;  3M8R A;  3PX0 A;  3HPO A;  4P2H A;  2BPG A;  5DLG A;  4K4I A;  4F5Q A;  3KHR A;  4DSI A;  5KFH A;  3ZD8 A;  4O3O A;  4F93 B;  1ZQX A;  3OJU A;  2Q0Z X;  1JIH A;  2PFO A;  5KG7 A;  2UVR A;  2A1J A;  1X9S A;  2AJQ A;  1TAQ A;  5KFZ A;  5DG9 A;  8ICX A;  2HHU A;  5KT5 A;  3B0X A;  1NK6 A;  3NGD A;  4UQG A;  4ECX A;  3C5F A;  4QZD A;  4KN4 A;  3TFS A;  1BPE A;  1T4G A;  1S10 A;  3RJE A;  1KEJ A;  2DPJ A;  4Q43 A;  1T8E A;  2UVU A;  3SV3 A;  4I2B A;  1D8L A;  3Q8K A;  1TV9 A;  2AQ0 A;  4RQ4 A;  4DSL A;  1U48 A;  1T3N A;  9ICJ A;  4KLF A;  2ZJA A;  7ICF A;  2NRW A;  3PV8 A;  2H5X A;  5D49 A;  5L1I A;  3MBY A;  1TAU A;  5KT7 A;  2AGQ A;  8ICU A;  4UAY A;  5L9X A;  2LYH A;  3V6H A;  5IIN A;  4J9S A;  5DB6 A;  4ELU A;  8ICF A;  5J2C A;  4RNO A;  4DOC A;  2JEI A;  4PHA A;  3BQ1 A;  4F92 B;  1NK4 A;  4QZB A;  2J6S A;  4O3S A;  2ZUB A;  9ICM A;  1JX4 A;  4MEY A;  3GIM A;  4M0A A;  9ICE A;  5IIO A;  3JPS A;  4J9N A;  2FMS A;  4PPX A;  3BQ2 A;  4R8U A;  2HHV A;  1SKR A;  4P4O A;  8ICS A;  4TUS A;  2GWS A;  3SYZ A;  1L5U A;  2P66 A;  5KG5 A;  2C22 A;  4IQW A;  4KN7 A;  5KFK A;  1WCL A;  1NJZ A;  8ICQ A;  1NK7 A;  2HHX A;  2MUT B;  3C2K A;  2VAN A;  3K4G A;  4YMO A;  5J2B A;  3GV8 B;  1NJX A;  3MGI A;  3JPO A;  4G3I A;  5KFX A;  3H40 A;  4GC6 A;  4ED3 A;  7ICO A;  1ZQS A;  5KFE A;  4M04 A;  1D9D A;  3QZ8 A;  3V7J A;  4I2E A;  4QZC A;  5BOM A;  3OJS A;  2ASL A;  3RAQ A;  4KLS A;  3LDA A;  5KG1 A;  4UB4 A;  4ECQ A;  1TVA A;  4J9M A;  5L1K A;  8ICE A;  4RNM A;  4J9K A;  4DFM A;  3TAR A;  2PFP A;  4FBT A;  1K1Q A;  2NRZ A;  4KTQ A;  8ICH A;  4B9N A;  3KHL A;  4F2R A;  1UA0 A;  3ZDA A;  5KFG A;  3JPP A;  1KLN A;  4I2I A;  3RJF A;  2BPC A;  4MFC A;  5KFP A;  2BQU A;  1S0N A;  1XC9 A;  4JV1 A;  4QWA A;  4ED1 A;  4BWJ A;  2AGO A;  2ZTE A;  1L3U A;  3PR4 A;  3PMN A;  1S9F A;  3EZ5 A;  4F4X A;  2C2R A;  8ICP A;  5KT4 A;  4RZR A;  1XSL A;  1A76 A;  2PI5 A;  3G6V A;  3TQ1 A;  1KFS A;  3SV4 A;  4KLT A;  4ELT A;  4DL6 A;  4XQ8 A;  1LV5 A;  9ICC A;  4UBB A;  3H4D A;  4EBC A;  4DEZ A;  1S0M A;  4JUZ A;  5KT6 A;  5IIK A;  1SL1 A;  4ED2 A;  4KIT B;  3JPR A;  4DL4 A;  5J0S A;  1BPX A;  2IMW P;  1QLN A;  1PZN A;  4ECR A;  2HW3 A;  8ICR A;  4X5V A;  3MGH A;  3GII A;  5KG6 A;  4QZG A;  2XO7 A;  1S0O A;  4B9U A;  2W9M A;  1U47 A;  8ICC A;  7ICH A;  4P4M A;  3RRH A;  4Z6D A;  1NJY A;  4O5E A;  4O3R A;  3EW9 A;  5F9N A;  1WCN A;  1ZQY A;  3C1Z A;  5HML A;  4YR3 A;  2W8L A;  3BJY A;  2FPK A;  4FS1 A;  3KTQ A;  4JWN A;  4UB5 A;  1Z00 B;  5HHH A;  2NRX A;  1SKS A;  2ASD A;  1KFT A;  5DB8 A;  2W9C B;  4F5R A;  1H38 A;  3KHH A;  4DLE A;  1QSS A;  8ICL A;  4J9R A;  3AU2 A;  5J2J A;  3V7L A;  4J9L A;  4F4Y A;  4QZA A;  5DLF A;  3GIL A;  1NK5 A;  4UBC A;  4B9V A;  4ECZ A;  5KFB A;  1ZQH A;  5EWG A;  7ICK A;  4B9M A;  7ICG A;  9ICR A;  1RYR A;  2C28 A;  3HWT A;  1QSY A;  5BPC A;  4JWM A;  4LVS A;  2HHT A;  3T5L A;  4IRC A;  4IR1 A;  4TQS A;  3MDA A;  2KZ3 A;  2I1Q A;  5IIL A;  5CA7 A;  3H8J A;  5IIM A;  7ICL A;  2FMP A;  4YXJ A;  1HUZ A;  4I2H A;  3RB0 A;  4M6W B;  4UB3 A;  1S0V A;  1JXE A;  1ZQV A;  4YQW A;  3OSP A;  1UA1 A;  3MR3 A;  3HP6 A;  2XY6 A;  5J0X A;  4K4H A;  1X2I A;  3Q8Q B;  4YN4 A;  7ICS A;  3M9O B;  9ICX A;  3ISC A;  1SL0 A;  4F2S A;  3GQC A;  1ZQZ A;  2DFL A;  4E0D A;  2AGP A;  3UQ0 A;  2XCP A;  5CP2 A;  3RBE A;  4Q45 A;  2JEF A;  1XWL A;  5DB9 A;  2IA6 A;  4RPY A;  4PHE A;  2W9B A;  2R8G A;  4NLZ A;  2PFN A;  4RU9 A;  3EWA A;  3H8S A;  5CHG A;  3ZDD A;  3V6K A;  4Q8F A;  3MR6 A;  4DF8 A;  4UB2 A;  5DBC A;  1NK9 A;  1BPZ A;  2F1H A;  4NY8 A;  4GC7 A;  1LB2 B;  4PGX A;  3LK9 A;  4XA5 A;  3EPG A;  5KFA A;  4NM2 A;  3PW7 A;  2FLP A;  1MC8 A;  9ICA A;  9ICH A;  3PW4 A;  5J0P A;  2NRT A;  1D8Y A;  4CCH A;  9ICK A;  2XGQ A;  4ED7 A;  3T5H A;  5KFJ A;  5KFW A;  3OHB A;  1ZQI A;  1TKD A;  3RJK A;  4QZE A;  3RBD A;  8ICG A;  1ZJM A;  1ZET A;  5DG7 A;  2BCQ A;  1S77 D;  5HHI A;  3V72 A;  1ZQO A;  2R8K A;  3TI0 A;  5KFI A;  4R63 A;  5D4B A;  4EYI B;  8ICZ A;  4RQ6 A;  1S97 A;  2IBK A;  5DB7 A;  4Q44 A;  3RR8 A;  2KTQ A;  3M9M B;  1NKC A;  1A77 A;  2HVI A;  4IQT A;  2J6T A;  4ECS A;  1ZQN A;  4M2Y A;  2HVH A;  4EEY A;  4M9J A;  2UVV A;  4IRK A;  1S76 D;  3C21 A;  3C5G A;  4O3P A;  5J0T A;  2JEG A;  5L1J A;  1N56 A;  1ZQF A;  5KFO A;  3T3F A;  5J2D A;  3TAN A;  3QE9 Y;  1QTM A;  4DFP A;  4YD2 A;  4QZ9 A;  4PHD A;  3THV A;  5IIJ A;  3GDX A;  4DFK A;  4R8U B;  4DS4 A;  4M9N A;  5KFS A;  1MQ2 A;  3GFK B;  2KN7 A;  5J2H A;  1RXV A;  1QSL A;  9ICO A;  1BVS A;  3T5K A;  8ICT A;  5KG2 A;  4Q8E A;  2BQ3 A;  9ICQ A;  5CWR A;  4DL7 A;  2IHN A;  5KFY A;  4M9L A;  3FDS A;  4QZI A;  1ZQM A;  4NM1 A;  4F91 B;  5J29 A;  4YXM A;  9ICU A;  1DOQ A;  4RQ2 A;  3NTU A;  5DBA A;  5EWE A;  2Y1I A;  4O3N A;  4QWE A;  2PI4 A;  8ICW A;  4C8L A;  4PGY A;  4ED0 A;  1NK0 A;  4F50 A;  4ECV A;  4TUQ A;  8ICA A;  4BXO B;  1HJP A;  3H4B A;  1RPL A;  4O0I A;  2OWO A;  1KDH A;  4KLJ A;  1Y88 A;  4RNN A;  4RQ8 A;  3M9N B;  2JZB B;  4C8O A;  4F4Z A;  5DDY A;  3Q8P B;  1L3V A;  4LZG A;  7ICU A;  2FPL A;  4QW8 A;  4YMN A;  4ECU A;  4IRD A;  2W8K A;  2BQR A;  3PW2 A;  3BDP A;  4BWM A;  5KG0 A;  1JMS A;  5J2K A;  3MR2 A;  4YD1 A;  3B0Y A;  2FPM A;  3C2L A;  1L3S A;  1U4B A;  4MF8 A;  1BPB A;  4I29 A;  5BOL A;  4YR0 A;  3PNC A;  5J2I A;  2ZUC A;  4HYK A;  1B43 A;  4JV2 A;  9ICP A;  1X9M A;  1U45 A;  4YG2 A;  1RZT A;  5KFV A;  3RAX A;  4IQU A;  3GIK A;  4YMM A;  3RH4 A;  5KT3 A;  3AU6 A;  9ICG A;  3MR5 A;  2ATL A;  2NRV A;  3BQT A;  5HNK A;  4DO9 A;  5DGA A;  4QWD A;  4F4K A;  1RXW A;  1NKE A;  1ZQW A;  4DOA A;  1ZQP A;  2Y1J A;  1K1S A;  3ZDB A;  3RB4 A;  4JK1 A;  2XCA A;  3MDC A;  1NKB A;  2VA3 A;  4KLE A;  9ICS A;  5DQH A;  5L1L A;  4ECW A;  4DFJ A;  3ZD9 A;  3SI8 A;  4UAZ A;  4BGD A;  2B21 A;  4RQ1 A;  1X9W A;  4EBD A;  1ZYQ A;  3GV7 B;  4IR9 A;  1BPY A;  4B9S A;  3ISD A;  9ICB A;  4EZ9 A;  2XY5 A;  4NXZ A;  5KFU A;  3UPQ A;  4FO6 A;  4F4W A;  1HUO A;  5KG4 A;  4I28 A;  2ZTC A;  8ICV A;  1CEZ A;  4DLG A;  1ZQU A;  3JPQ A;  4EBE A;  5DDM A;  2XY7 A;  2V4Q A;  4YR2 A;  2R8I A;  3TFR A;  4RQ0 A;  2W9C A;  4I2J A;  5KTQ A;  4F8R A;  3GV5 B;  4XRH A;  3ZDC A;  4K4G A; 
#chains in the Genus database with same CATH topology
 5AKY A;  5ALQ A;  4XUS A;  5KFD A;  4Y2R A;  4DQR A;  2F1I A;  2AHO B;  5KFN A;  7ICP A;  4PGQ A;  2PXI A;  5DKW A;  2A1J B;  5J0O A;  2P6U A;  3KZI U;  3M8S A;  1ARO P;  1CI4 A;  1O08 A;  1Z1B A;  2ZIU A;  2EAO A;  5KFM A;  9ICW A;  1KW4 A;  2BKE A;  3LYS A;  2C2E A;  2HHQ A;  1PVR A;  3L3F X;  4F3O A;  4DQP A;  1KSP A;  4PH5 A;  1KL9 A;  2W55 A;  3H7I A;  3QU5 A;  2AU0 A;  7ICR A;  3ETL A;  4FZN A;  1WWV A;  2K8B B;  2W04 A;  4R66 A;  4CE6 A;  2W54 A;  1UT8 A;  3QX7 A;  1KFD A;  4I27 A;  3HJE A;  3PX6 A;  2BCR A;  2BCV A;  1J97 A;  4P4P A;  4ICA A;  2ZJ5 A;  2R8H A;  4TQR A;  1Q3V A;  2KFN A;  4NLN A;  3WK6 A;  1ZQB A;  1SV0 A;  4DF4 A;  4IC9 A;  4J9O A;  5J2G A;  2B0C A;  3G6X A;  2RLT A;  2LPE A;  4GXJ A;  4ECT A;  2ZIW B;  4RPZ A;  7ICQ A;  3PX4 A;  3MGV A;  4P0Q A;  4YCX A;  4ECY A;  4I2G A;  7ICN A;  2YY6 A;  5F9L A;  3SZ2 A;  4DL5 A;  1XSN A;  5III A;  3HX0 A;  5KT2 A;  2NV3 A;  1RYU A;  4FS2 A;  4BXO A;  3PST A;  2BR0 A;  4QWC A;  3TAD C;  2FLN A;  3ALR A;  1P7D A;  4DQS A;  2ZUD A;  2YMP A;  1TFR A;  2RDI A;  1U9L A;  3IN5 A;  4RQ5 A;  3QEA Z;  1EXN A;  3OSN A;  4RT2 A;  1LKY A;  4BX9 C;  2GO7 A;  2ISP A;  1COO A;  1XO1 A;  1NNL A;  3M1Y A;  8ICJ A;  3OGU A;  2BCS A;  4DWI A;  4ED6 A;  2WF6 A;  4IS7 A;  3T5J A;  3A0H U;  2MA1 A;  2OH2 A;  1XU4 A;  2PMZ F;  2RRD A;  5J0Q A;  1Z00 A;  2WB1 C;  5J0W A;  1JXL A;  4M9H A;  7ICM A;  2ALZ A;  2ESE A;  3F2D A;  2HOI A;  3K75 D;  5AK6 A;  1ZD3 A;  5KFQ A;  3WKD A;  4QW9 A;  4O9M A;  5AM3 A;  2W9A A;  1ZOL A;  1XS9 D;  5J2A A;  5EE3 A;  5KFF A;  2VIX A;  2WF5 A;  3QUB A;  4LZD A;  1SIJ A;  3LVW A;  4EZ6 A;  3C23 A;  8ICK A;  1PVP A;  4RPX A;  1PK3 A;  2F8K A;  3KHR A;  4F93 B;  3OJU A;  2UVR A;  4UB6 U;  4A8E A;  5KFZ A;  8ICX A;  2HHU A;  1NK6 A;  3C5F A;  3SAF A;  4Q43 A;  1T8E A;  3Q8K A;  3KZX A;  4U6P A;  1TV9 A;  1SV4 A;  5C0Y A;  5D49 A;  4EX7 A;  2IOH A;  3MBY A;  4EEK A;  3WU2 U;  4J9S A;  5IIN A;  5DB6 A;  1K5O A;  4RNO A;  4DOC A;  5GTH U;  2FJ6 A;  1NK4 A;  9ICE A;  3JPS A;  2HHV A;  2LM1 A;  1VJ5 A;  1L5U A;  5EE0 A;  5KFK A;  1WCL A;  8ICQ A;  1NK7 A;  3C2K A;  2H3F A;  5J2B A;  3JPO A;  4ED3 A;  1ZQS A;  4P0Q B;  2YQE A;  1D9D A;  4I2E A;  5BOM A;  3OJS A;  2ASL A;  3RAQ A;  4UB4 A;  1L8L A;  5L1K A;  2PFP A;  4B9N A;  3KHL A;  4F2R A;  3ZDA A;  4CF5 A;  1FO4 A;  3RJF A;  2P35 A;  3DDH A;  1X6J A;  1XC9 A;  4JV1 A;  3NRW A;  1Z1V A;  2YN4 A;  3TAD A;  4WJ3 B;  2KMD A;  3PR4 A;  1S9F A;  1JRO A;  2LYA A;  2PI5 A;  4KLT A;  1O03 A;  9ICC A;  3M6Z A;  1S0M A;  2NYV A;  5KT6 A;  1SL1 A;  2HBL A;  3JPR A;  4AYB C;  2JR5 A;  1T94 A;  2DL0 A;  1V85 A;  5KG6 A;  4QZG A;  1T3Q A;  1U47 A;  1NJY A;  3EW9 A;  3C1Z A;  3BJY A;  4FS1 A;  1Z00 B;  1RQL A;  2NRX A;  5AM2 A;  1KFT A;  1ECW A;  4F5R A;  1RG6 A;  4DLE A;  3KBB A;  5DLF A;  1MN8 A;  4B9V A;  3M7D A;  5ALW A;  5KFB A;  1ZQH A;  7ICK A;  4Y2Q A;  1Z4N A;  1NZB A;  2YTU A;  5BPC A;  2HHT A;  3B9J A;  2Y9U A;  3MDA A;  1IV8 A;  3H8J A;  4YQW A;  1ZQV A;  3PSI A;  4K4H A;  1COK A;  4CF3 A;  4YN4 A;  2L5Y A;  2YX8 A;  2DFL A;  4E0D A;  1BNO A;  5CP2 A;  4Q45 A;  3RBE A;  1XWL A;  4RPY A;  4PHE A;  1WUD A;  3EWA A;  5CHG A;  4Q8F A;  1L7O A;  1OXJ A;  4MHV A;  3N7R C;  3LK9 A;  4CNQ A;  5KFA A;  3D2S A;  4ED7 A;  3UMB A;  3OHB A;  3AMZ A;  1MA7 A;  1ZJM A;  1ZET A;  5KAF U;  1HEK A;  4RQ6 A;  5DB7 A;  2AH5 A;  2KTQ A;  2F8L A;  3M9M B;  1NKC A;  3NVV A;  3PSF A;  2Y0S F;  3A0B U;  2HVH A;  2UVV A;  3C5G A;  4O3P A;  1PVQ A;  2LKY A;  5J2D A;  3IDW A;  5IIJ A;  1DXS A;  4DFK A;  4M9N A;  1MQ2 A;  2A19 A;  2KN7 A;  9ICO A;  8ICT A;  4Q8E A;  2HMX A;  4QZI A;  9ICU A;  1DOQ A;  1V97 A;  5DBA A;  2Y1I A;  2FE9 A;  4C8L A;  5ALI A;  2FI1 A;  2K4E A;  2GLE A;  3FM9 A;  3H4B A;  1RPL A;  1ZRM A;  2OWO A;  4RNN A;  4RQ8 A;  3M9N B;  2EH9 A;  5AKJ A;  2KD1 A;  4BWM A;  4EEN A;  2ZXH A;  2FPM A;  3C2L A;  1L3S A;  2F77 X;  1BPB A;  5ALD A;  1B43 A;  3CW2 C;  4YG2 A;  2O6K A;  2DQN B;  4IQU A;  3R9K A;  1SB3 C;  3BQT A;  3SR6 A;  1NKE A;  4DOA A;  2JMG A;  2G09 A;  5ALT A;  2CPR A;  9ICS A;  5KL1 B;  5L1L A;  3SI8 A;  2RHF A;  2RQ5 A;  4EBD A;  1BPY A;  4B9S A;  3ISD A;  4JMU A;  2XY5 A;  3MC1 A;  3UPQ A;  4DLG A;  3GU3 A;  2W9C A;  2EAN A;  3C2M A;  2ASJ A;  4RQN A;  5B5E U;  3KHG A;  3PY8 A;  2MAX A;  3IRU A;  8ICI A;  4EX6 A;  1B4F A;  4Y2P A;  3UM9 A;  5DQG A;  1JAL A;  2CN1 A;  4DSK A;  2HOQ A;  3NAS A;  2KSO A;  4QWB A;  4DQQ A;  5KFT A;  1TK5 A;  5CJ7 A;  5KG3 A;  5JTI A;  4C0Z A;  2BHN A;  4YP3 A;  1ZQL A;  7ICJ A;  8ICM A;  4KLQ A;  4B9L A;  3UQ2 A;  1HIW A;  5ALU A;  3RJI A;  1UT5 A;  2EAM A;  1PK1 A;  1SWW A;  4RQ7 A;  3RB6 A;  3PVX A;  3ORY A;  2OCE A;  4RUC A;  2V4R A;  1ZQD A;  4MEX A;  4KMO B;  4DSE A;  5EOZ A;  4RQ3 A;  4Z6C A;  2G07 A;  3GZF A;  3GIJ A;  3BQ0 A;  3BS5 B;  5KFR A;  4ELV A;  5KFC A;  3QEB Z;  2XID A;  8ICB A;  2G5I B;  2K89 A;  4LJX A;  3RJG A;  1SKW A;  2BPF A;  4BDP A;  4O5C A;  1B22 A;  3F2B A;  3MFH A;  2W03 A;  2E8N A;  2VA2 A;  3MFI A;  1UA1 A;  7ICF A;  2NO4 A;  3N97 B;  4GXK A;  1NJW A;  2K4I A;  3UXP A;  2KZZ A;  5ALX A;  2XC9 A;  3JPN A;  1X6I A;  3PML A;  2WAQ F;  3CRX A;  4R64 A;  4NLG A;  5J2F A;  3ZDC A;  4F5O A;  3RR7 A;  2E3T A;  4Y2U A;  2KEY A;  3PW5 A;  3NVY A;  3HT3 A;  1JI7 A;  1ZQA A;  1NOM A;  1D9F A;  3RTV A;  3RH5 A;  1N48 A;  4ZH4 A;  3V7K A;  2FMQ A;  4AP9 A;  4IQV A;  4JB3 A;  3N7P D;  4PZN A;  1B0X A;  5CB1 A;  1U49 A;  2UVW A;  9ICT A;  5AM4 A;  4PHP A;  2VJ4 A;  2KVS A;  4O3Q A;  5TZV A;  1J2M A;  4FZL A;  2P6R A;  4MF2 A;  3WKE A;  2R8J A;  4YVZ A;  4TUP A;  4EEL A;  2W3S A;  4EYH B;  3ISB A;  2HCF A;  3IHQ B;  1FEZ A;  5AI0 A;  3UXN A;  2RP5 A;  2ZIV A;  4UB1 A;  9ICF A;  2KNJ A;  1L8O A;  5CR0 A;  3PX0 A;  2H3Z A;  3HPO A;  2Q4T A;  4P2H A;  4K4I A;  4F5Q A;  5KFH A;  2EDU A;  2PFO A;  2Q0Z X;  5KG7 A;  3N7S C;  5KT5 A;  3B0X A;  2WF9 A;  2G0A A;  3NGD A;  2H3V A;  4QZD A;  4KN4 A;  3RJE A;  1KEJ A;  2DPJ A;  2UVU A;  3SV3 A;  3N28 A;  5AK4 A;  1WG8 A;  5ALL A;  1U48 A;  9ICJ A;  4KLF A;  2ZJA A;  2NRW A;  3PV8 A;  2H5X A;  1TAU A;  5KT7 A;  2AGQ A;  4NJ8 A;  5L9X A;  1F0M A;  3V6H A;  1C20 A;  2KIC A;  4F72 A;  5AM0 A;  2K4H A;  3UMC A;  4PHA A;  4F92 B;  4QZB A;  2MU2 A;  2J6S A;  4O3S A;  1JX4 A;  2FMS A;  4R8U A;  1SKR A;  8ICS A;  1ZD5 A;  5L1M A;  3C28 A;  2P66 A;  4IQW A;  1NJZ A;  3K4G A;  5AI6 A;  4C80 A;  3H40 A;  3ONN A;  4NLB A;  4M04 A;  3V7J A;  3PZP A;  3LDA A;  4J9M A;  8ICE A;  4RNM A;  3TAR A;  8ICH A;  2NRZ A;  3JPP A;  4I2I A;  2BPC A;  5KFP A;  2BQU A;  1S0N A;  3CNH A;  2PMZ C;  1ZD4 A;  4BWJ A;  3EZ5 A;  4U7C A;  8ICP A;  3SEN A;  1A76 A;  3G6V A;  3SV4 A;  4UAT A;  4PZO A;  1S5L U;  1N60 A;  1XO0 A;  3H4D A;  4DEZ A;  2W11 A;  2PKE A;  5ALP A;  1FFU A;  4ED2 A;  5AK5 A;  2IMW P;  2HW3 A;  1PZN A;  3K1R B;  3DEE A;  3D2Q A;  3GII A;  2W7P A;  2AXT U;  1J2N A;  2XO7 A;  2W9M A;  5EE1 A;  4C4S A;  7ICH A;  2YMM A;  5AKK A;  5F9N A;  2KJ9 A;  4US8 A;  2W8L A;  4JWN A;  4MFF A;  1X9X A;  2ASD A;  1H38 A;  1TAM A;  8ICL A;  1D8B A;  3AU2 A;  5J2J A;  2LMR A;  2WHE A;  4ECZ A;  2C28 A;  5ALR A;  4JWM A;  4LVS A;  4IRC A;  1GO3 F;  4TQS A;  5IIL A;  2I1Q A;  5CA7 A;  5A0L A;  7ICL A;  2HBM A;  4YXJ A;  2FMP A;  1DK3 A;  3NVW A;  4UB3 A;  2QB1 A;  3MR3 A;  2XY6 A;  1KQQ A;  2ZIU B;  2F44 A;  3ISC A;  1ZQZ A;  2XCP A;  5DB9 A;  4P0P A;  2R8G A;  5FP0 A;  2W9B A;  3VC8 A;  1F5S A;  2HBJ A;  2DF4 B;  4NWI A;  3PW7 A;  2FLP A;  3QU9 A;  1MC8 A;  4C7Z A;  3PW4 A;  4UAU A;  5J0P A;  1D8Y A;  4CCH A;  1ZQI A;  1TKD A;  2LBO A;  8ICG A;  3V72 A;  1ZQO A;  3TI0 A;  4R63 A;  5JU5 A;  1A77 A;  2J6T A;  4ECS A;  4EEY A;  3C21 A;  1KN5 A;  5KFO A;  3TAN A;  4DFP A;  4R8U B;  1URJ A;  2EZX A;  5KFS A;  5J2H A;  1BVS A;  2BQ3 A;  3S6J A;  4DL7 A;  5KFY A;  3H0M B;  4QNL A;  1WYG A;  4YXM A;  5EWE A;  1QQ5 A;  4Y2S A;  4O3N A;  2PI4 A;  8ICW A;  4ED0 A;  2VJ5 A;  3HKZ F;  4BXO B;  1HJP A;  1KBU A;  4F4Z A;  4OJO A;  3Q8P B;  4QW8 A;  1F44 A;  4YMN A;  2W3R A;  4YD1 A;  3B0Y A;  2JV3 A;  1U4B A;  1LKY B;  4YR0 A;  3WKA A;  5BOL A;  3PNC A;  3TAC B;  9ICP A;  3L5K A;  3RH4 A;  5KT3 A;  2ATL A;  5DGA A;  4QWD A;  4UAV A;  1ZQP A;  3ZI4 A;  3QUC A;  1NKB A;  4KLE A;  4DFJ A;  4UAZ A;  4BGD A;  4RQ1 A;  1X9W A;  3GV7 B;  2D6F C;  4EZ9 A;  2BZF A;  1HUO A;  4QIW F;  3JPQ A;  1X40 A;  5DDM A;  2XY7 A;  2DUY A;  3GV5 B;  4XRH A;  3IG8 A;  1KKX A;  2EZY A;  5AI9 A;  1UQV A;  4KLD A;  4I2D A;  2KJ8 A;  2AQ4 A;  5CRX A;  3V6J A;  4C8K A;  1KTQ A;  4KLO A;  2M9N A;  2K60 A;  3SMV A;  3IM1 A;  5C5J A;  5TIS U;  3AUO A;  3K1Z A;  2KFZ A;  2Y0S C;  1YZ6 A;  2NO5 A;  3QZ7 A;  9ICV A;  3WK8 A;  2WF8 A;  2I9G A;  2ODG A;  9ICI A;  5DGB A;  4B9T A;  4DS5 A;  4PL2 A;  2F3N A;  1N61 A;  1N5X A;  4Z6F A;  4NLK A;  2IOF A;  4DL2 A;  4B6J A;  4DQI A;  2KG5 A;  3QU4 A;  1ZQE A;  3WK4 A;  4UAS A;  4I2A A;  4F71 A;  5KAI U;  1SL2 A;  4TUR A;  3JPT A;  1Z3E B;  1SZP A;  4DOB A;  5DQI A;  2ZTD A;  4KLU A;  1MSW D;  3WK5 A;  2BDU A;  2FDR A;  5HP4 A;  3AQE A;  4M47 A;  4GLX A;  2BGW A;  3RRG A;  3G6Y A;  5ALV A;  2JHD A;  7ICI A;  1FFV A;  3PO5 A;  3PW0 A;  2YB1 A;  4ZOH C;  1TK0 A;  4FBU A;  2DWQ A;  4Z6E A;  2W7O A;  5J0R A;  2EQY A;  2F1J A;  5AI4 A;  1RYS A;  2JEJ A;  1L7M A;  1M6Y A;  1ZQT A;  1KRP A;  2D8C A;  3EYZ A;  3N4M B;  4GIB A;  5AK3 A;  1MQ3 A;  4UAW A;  2JZB A;  3TAP A;  4C4T A;  3Q8M A;  3RJJ A;  1YZ7 A;  1N5W A;  1XSP A;  1RM6 C;  4C8N A;  5JUM A;  5T14 A;  2ZIX A;  1BGX T;  3E58 A;  4DL3 A;  4KLH A;  5AKZ A;  1T7P A;  5ALK A;  3F2C A;  2VA8 A;  4F5N A;  2H3Q A;  3UXO A;  2M0N A;  1ZQC A;  1L3T A;  2LHT A;  5ALF A;  3QUQ A;  4O5K A;  1ZQG A;  4KX5 A;  2W43 A;  4R65 A;  4KLI A;  1PUZ A;  4KLL A;  4M9G A;  2G5H B;  2V9W A;  5D46 A;  1JN3 A;  5J0U A;  1BNP A;  1WWU A;  2ISO A;  4RUA A;  2RDJ A;  1ZQQ A;  3E0F A;  7ICT A;  1SZH A;  8ICO A;  3OHA A;  1XNS A;  3RB3 A;  4Y2V A;  5HMM A;  1ZRN A;  4F5P A;  4DSJ A;  1L7N A;  2EAP A;  3HW8 A;  2LM4 A;  3DV9 A;  5G5H A;  3Q8L A;  4KLM A;  3M8R A;  1ZXI A;  4NL9 C;  2JH1 A;  4C7Y A;  2BPG A;  4DSI A;  4UW9 A;  4O3O A;  3AN1 A;  1JIH A;  3F53 A;  1A0P A;  2A1J A;  2AJQ A;  5ALE A;  1T4G A;  1D8L A;  2AQ0 A;  4RQ4 A;  1DRG A;  2VKQ A;  1N62 A;  5L1I A;  2QLT A;  5J2C A;  3PSP A;  2JEI A;  1FIQ A;  2WAQ C;  3QYP A;  4MEY A;  4M0A A;  3ICX A;  5H2F U;  1YT3 A;  4TUS A;  2GWS A;  2C22 A;  4IL6 U;  3WK7 A;  2HHX A;  4YMO A;  5AHX A;  1NJX A;  2E8P A;  3GV8 B;  5ALJ A;  4G3I A;  5ALZ A;  5KFE A;  4QZC A;  4KLS A;  5KG1 A;  4ECQ A;  3SAH A;  1TVA A;  5AI5 A;  4J9K A;  4DFM A;  1LVH A;  1K1Q A;  1UPH A;  1UA0 A;  1KLN A;  4MFC A;  3QU2 A;  2KJ5 A;  4ED1 A;  2AGO A;  4Y2T A;  2C2R A;  3WKB A;  1XSL A;  4OO1 J;  2ZIX B;  4ELT A;  2Z7J A;  5IIK A;  1QLN A;  4KIT B;  1V38 A;  5J0S A;  8ICR A;  4ECR A;  4X5V A;  3MGH A;  1S0O A;  4B9U A;  3RRH A;  4CDG A;  4DCC A;  4O5E A;  3NRZ A;  4O3R A;  5KL8 B;  1WCN A;  1ZQY A;  5HML A;  2JRZ A;  3KTQ A;  1SKS A;  5B66 U;  2W9C B;  3F5A A;  4J9R A;  3BZC A;  2Y9T A;  2E1E A;  2CXY A;  1NK5 A;  4UBC A;  5EWG A;  4B9M A;  3HIL A;  2KHQ A;  2WF7 A;  1RYR A;  9ICR A;  5AKE A;  2KVC A;  4IR1 A;  3AQF A;  4I2H A;  3RB0 A;  3WK9 A;  1S0V A;  5AM1 A;  2KSO B;  3H0L B;  3KOO A;  3Q8Q B;  1SL0 A;  4F2S A;  2AGP A;  3UQ0 A;  2JEF A;  2IA6 A;  4NLZ A;  4NL9 A;  4RU9 A;  3H8S A;  3ZDD A;  2JH7 A;  2YML A;  4G9B A;  2ZXI A;  4UB2 A;  5DBC A;  1BPZ A;  4NY8 A;  4GC7 A;  2KKP A;  4PGX A;  4XA5 A;  3VCB A;  3CYM A;  4NM2 A;  9ICA A;  3C29 A;  9ICH A;  2NRT A;  4BUG A;  1PK1 B;  2XGQ A;  3T5H A;  1X66 A;  3RJK A;  4QZE A;  2ZG6 A;  5DG7 A;  4C4R A;  5HHI A;  2R8K A;  3BQ7 A;  5D4B A;  2IBK A;  1DK2 A;  2HVI A;  5ALM A;  1ZQN A;  2HI0 A;  4M2Y A;  4M9J A;  1S76 D;  4IRK A;  2JEG A;  5L1J A;  1ZQF A;  3T3F A;  4QZ9 A;  3GDX A;  4NLC A;  4DS4 A;  2OHF A;  2YB4 A;  1S8O A;  3IP4 B;  1ZQ1 C;  1RXV A;  3T5K A;  2A1A A;  5KG2 A;  9ICQ A;  2XVT A;  2KP7 A;  2IHN A;  4M9L A;  5ALH A;  2DBY A;  4F91 B;  5J29 A;  2MRL A;  3U26 A;  1Z19 A;  5HR7 A;  4QWE A;  1JRP A;  4F50 A;  4ECV A;  2KHV A;  4O0I A;  1Y88 A;  3KKA C;  1L3V A;  4LZG A;  7ICU A;  3J81 j;  2W8K A;  5J2K A;  3MR2 A;  2QB0 A;  5E79 U;  2ZUC A;  4HYK A;  1DGJ A;  1SXE A;  1OUQ A;  1RZT A;  1L7P A;  3RAX A;  2OM6 A;  5J8Y A;  3GIK A;  3AU6 A;  9ICG A;  4OJP A;  3MR5 A;  5HNK A;  4FE3 A;  1ZQW A;  4DFD A;  3D2N A;  2VA3 A;  5DQH A;  4ECW A;  4J03 A;  3QUT A;  9ICB A;  5GTI U;  4FO6 A;  5KG4 A;  2DGZ A;  4OCZ A;  4I28 A;  2ZTC A;  2I5H A;  1CEZ A;  1ZQU A;  4EBE A;  2V4Q A;  4I2J A;  5KTQ A;  4F8R A;  3T79 A;  2KOB A;  1UCV A;  2IOF K;  4Y2J A;  4I2C A;  2C2D A;  4MFA A;  3TAQ A;  2BDP A;  1IXR A;  2ZIV B;  1NK8 A;  3PR5 B;  3EPI A;  3I1Y A;  1ZQR A;  3LWM A;  4CRX A;  3H0R B;  2N1R A;  3TKA A;  4JV0 A;  3SD7 A;  2BCU A;  4CF4 A;  2WB1 F;  2KK0 A;  5EWF A;  7ICV A;  2R18 A;  4J9Q A;  4GFJ A;  1Q8K A;  1ZJN A;  1A6S A;  3IV6 A;  4YFK A;  1VLB A;  2KZM A;  2J6U A;  5ALS A;  8ICN A;  1SWV A;  1DGS A;  5J0Y A;  3HKZ C;  1C7Y A;  4O3M A;  2ES6 A;  5DBB A;  1ZD2 P;  1ZQK A;  1IM4 A;  3Q8S B;  4I2F A;  4ED8 A;  3F5E A;  2HHW A;  2E8M A;  2WTF A;  4QZ8 A;  5EE9 A;  8ICY A;  4QJF B;  2F2A B;  4QZH A;  7ICE A;  4DSF A;  3H8W A;  2HOF A;  2MUT A;  5J2E A;  4GXI A;  3I28 A;  4Y2Y A;  1UHU A;  1CUK A;  2K8C B;  1QCK A;  3ZDE A;  2YMQ A;  4KLG A;  2E5S A;  2JXJ A;  3KKA A;  3NVZ A;  3SAG A;  5DG8 A;  1V9P A;  5KFL A;  2QB0 B;  3KFU F;  9ICN A;  4QIW C;  3E2E A;  2IHM A;  1QQ6 A;  2F76 X;  2XGP A;  3AM9 A;  5AIA A;  2WFA A;  2OYY A;  4C8M A;  4NV0 A;  5JRT A;  2ZJ8 A;  3C1Y A;  2MSN A;  1BPD A;  2HHS A;  2I6X A;  1ZQJ A;  3MAB A;  2HSZ A;  9ICL A;  2PFQ A;  4KX3 A;  1N63 A;  2QAR A;  5KNI A;  3RJH A;  1QH9 A;  4Y2X A;  2KE7 A;  4ACO A;  4RT3 A;  4OJ5 A;  2EZZ A;  4AYB F;  2DPI A;  3PO4 A;  4P0P B;  3OTQ A;  2W9B B;  4M6W A;  2FLL A;  4J9P A;  2OEH A;  3FYH A;  3LWL A;  2D3D A;  4KMU A;  4QZF A;  3RH6 A;  1TK8 A;  3AEV A;  3Q8R B;  4UAR A;  5DLG A;  3ZD8 A;  4KTQ A;  1ZQX A;  1X9S A;  1TAQ A;  3LVV A;  3RF9 A;  5AKX A;  5DG9 A;  3NS1 A;  4UQG A;  4ECX A;  4OD0 A;  3TFS A;  1S10 A;  1BPE A;  3ETR A;  5ALN A;  4I2B A;  3M6K A;  1QQ7 A;  4DSL A;  2QKQ A;  1T3N A;  2DKX A;  4RQM A;  1NI3 A;  4BJQ A;  8ICU A;  4UAY A;  2LYH A;  4USA A;  2KIW A;  4ELU A;  8ICF A;  2DKZ A;  2E1F A;  3BQ1 A;  2ZUB A;  9ICM A;  3GIM A;  4PL1 A;  5IIO A;  2KIV A;  4J9N A;  4PPX A;  3BQ2 A;  2G06 A;  3CP8 A;  4UB8 U;  5AKG A;  4P4O A;  3AL0 B;  3SYZ A;  5KG5 A;  4KN7 A;  3UMG A;  1Q3U A;  5AKL A;  2MUT B;  3BS5 A;  2VAN A;  2G08 A;  3MGI A;  1IG6 A;  5KFX A;  4GC6 A;  7ICO A;  2H3I A;  3QZ8 A;  4OJ6 A;  4HAI A;  4FBT A;  2XIC A;  5KFG A;  2K8A A;  3ED5 A;  5ALO A;  4QWA A;  3D6J A;  2ZTE A;  1L3U A;  3PMN A;  1TE2 A;  4F4X A;  1CRX A;  5KT4 A;  4RZR A;  3TQ1 A;  1KFS A;  5CEH A;  4DL6 A;  4XQ8 A;  1LV5 A;  4UBB A;  4EBC A;  1IIP A;  3BZK A;  4JUZ A;  1BPX A;  4DL4 A;  8ICC A;  4P4M A;  4Z6D A;  3SQI A;  4YR3 A;  2FPK A;  4UB5 A;  5HHH A;  2GOL A;  2HDO A;  5DB8 A;  2B6G A;  2QAR B;  3KHH A;  1QSS A;  1RQN A;  3KD3 A;  3V7L A;  4J9L A;  4F4Y A;  4QZA A;  1OW5 A;  3GIL A;  7ICG A;  1SGG A;  1QSY A;  3HWT A;  1AQ6 A;  2LYB A;  3T5L A;  2KZ3 A;  3QNM A;  5IIM A;  1HUZ A;  4M6W B;  4FFD A;  5K4L A;  1JXE A;  3OSP A;  3HP6 A;  1N2X A;  5J0X A;  3HRD D;  1ED1 A;  1X2I A;  7ICS A;  3M9O B;  3GQC A;  5AIC A;  3EUB 2;  2KKV A;  2PFN A;  3FAH A;  3V6K A;  3L4P A;  3MR6 A;  4DF8 A;  1NK9 A;  2F1H A;  3O0F A;  2JGA A;  2KV2 A;  1LB2 B;  3EPG A;  1JUD A;  9ICK A;  2K4P A;  5KFJ A;  5KFW A;  5AIB A;  3RBD A;  2BCQ A;  1S77 D;  5KFI A;  4EYI B;  8ICZ A;  3I76 A;  1S97 A;  4Q44 A;  3RR8 A;  5G5G A;  3WKC A;  3BS7 A;  4IQT A;  5AKI A;  9ICX A;  5J0T A;  1N56 A;  3QE9 Y;  1QTM A;  5ALG A;  4YD2 A;  4PHD A;  3THV A;  1Q46 A;  2CRX A;  2GH1 A;  3GFK B;  1QSL A;  2OXO A;  4OJL A;  3SEI A;  1SV0 C;  5CWR A;  3FDS A;  1ZQM A;  4NM1 A;  4RQ2 A;  2LI6 A;  3NTU A;  4PGY A;  1NK0 A;  3FC4 A;  4TUQ A;  8ICA A;  3RFA A;  2ZIW A;  2A3V A;  5AKH A;  1KDH A;  5HR6 A;  4KLJ A;  2JZB B;  4C8O A;  5DDY A;  2FPL A;  4ECU A;  2E8O A;  4IRD A;  2BQR A;  3PW2 A;  3BDP A;  5KG0 A;  1JMS A;  5AI8 A;  3H8M A;  4MF8 A;  4I29 A;  3NUQ A;  5AM5 A;  5J2I A;  4FZM A;  5ALY A;  5J8Y C;  4JV2 A;  1X9M A;  1L6N A;  1U45 A;  1VDV A;  4CGZ A;  4PJ0 U;  5KFV A;  4YMM A;  1Z4O A;  2NRV A;  3QU7 A;  4DO9 A;  4F4K A;  1RXW A;  5F3X B;  3OPX A;  2Y1J A;  1K1S A;  3ZDB A;  3RB4 A;  2XI9 A;  4JK1 A;  2XCA A;  3MDC A;  3ZD9 A;  1NZP A;  2B21 A;  1SXD A;  1ZYQ A;  4IR9 A;  4US9 A;  4NXZ A;  5KFU A;  4F4W A;  1X42 A;  8ICV A;  3QXG A;  4YR2 A;  2R8I A;  3TFR A;  4RQ0 A;  2HBK A;  3IG5 A;  4K4G A;  1RDF A; 
#chains in the Genus database with same CATH homology
 3C2M A;  4XUS A;  2ASJ A;  4I2C A;  5KFD A;  2C2D A;  4MFA A;  3TAQ A;  2BDP A;  3KHG A;  4KLD A;  1IXR A;  3PY8 A;  4I2D A;  2MAX A;  4DQR A;  2AQ4 A;  2F1I A;  3V6J A;  1KTQ A;  4C8K A;  8ICI A;  4KLO A;  1NK8 A;  2M9N A;  3PR5 B;  5KFN A;  3EPI A;  3IM1 A;  1ZQR A;  7ICP A;  5DQG A;  5C5J A;  4PGQ A;  2PXI A;  5DKW A;  2A1J B;  3LWM A;  5J0O A;  4DSK A;  3AUO A;  2P6U A;  3M8S A;  2KFZ A;  1ARO P;  3QZ7 A;  4JV0 A;  4QWB A;  9ICV A;  4MFF A;  2I9G A;  5KFM A;  9ICW A;  2BCU A;  4DQQ A;  5KFT A;  1TK5 A;  9ICI A;  2BKE A;  5DGB A;  2HHQ A;  2C2E A;  5CJ7 A;  5KG3 A;  5EWF A;  4B9T A;  4DS5 A;  4F3O A;  4DQP A;  2BHN A;  4YP3 A;  7ICV A;  4Z6F A;  1ZQL A;  7ICJ A;  8ICM A;  4NLK A;  4KLQ A;  4DL2 A;  4PH5 A;  1KSP A;  4B9L A;  4J9Q A;  4DQI A;  3H7I A;  1ZJN A;  3UQ2 A;  2KZM A;  4YFK A;  1ZQE A;  2AU0 A;  3RJI A;  2J6U A;  1UT5 A;  8ICN A;  3ETL A;  7ICR A;  1DGS A;  4R66 A;  4I2A A;  4RQ7 A;  3RB6 A;  1SL2 A;  3PVX A;  5J0Y A;  3ORY A;  1UT8 A;  4TUR A;  1C7Y A;  1KFD A;  3JPT A;  4I27 A;  4RUC A;  1Z3E B;  2V4R A;  3PX6 A;  4MEX A;  1ZQD A;  2BCR A;  4DSE A;  2BCV A;  5DBB A;  1SZP A;  5EOZ A;  4DOB A;  5DQI A;  2ZTD A;  4RQ3 A;  4P4P A;  1ZQK A;  4KLU A;  1MSW D;  4Z6C A;  2ZJ5 A;  1IM4 A;  3Q8S B;  4I2F A;  4ED8 A;  2R8H A;  2HHW A;  3GIJ A;  3BQ0 A;  5HP4 A;  4M47 A;  4TQR A;  2KFN A;  5KFR A;  4NLN A;  4ELV A;  4GLX A;  2BGW A;  2WTF A;  3RRG A;  3G6Y A;  1ZQB A;  4QZ8 A;  5KFC A;  3QEB Z;  8ICY A;  4DF4 A;  4J9O A;  5J2G A;  4QZH A;  7ICI A;  8ICB A;  3PO5 A;  3G6X A;  3PW0 A;  3RJG A;  1TK0 A;  1SKW A;  4FBU A;  4DSF A;  3H8W A;  7ICE A;  2BPF A;  2MUT A;  5J2E A;  4BDP A;  4Z6E A;  4GXI A;  4O5C A;  1B22 A;  4GXJ A;  1CUK A;  4ECT A;  4RPZ A;  5J0R A;  3PX4 A;  3MFH A;  7ICQ A;  2F1J A;  4YCX A;  4ECY A;  4I2G A;  2VA2 A;  7ICN A;  5F9L A;  3ZDE A;  3MFI A;  3SZ2 A;  4DL5 A;  3N97 B;  5III A;  3HX0 A;  4GXK A;  1XSN A;  5KT2 A;  3UXP A;  1NJW A;  1RYS A;  2JEJ A;  4KLG A;  2KZZ A;  1ZQT A;  1KRP A;  3EYZ A;  2XC9 A;  3JPN A;  3N4M B;  4FS2 A;  5DG8 A;  3PML A;  1V9P A;  4BXO A;  1MQ3 A;  5KFL A;  2BR0 A;  4QWC A;  4R64 A;  4NLG A;  4UAW A;  2JZB A;  9ICN A;  3TAP A;  2FLN A;  5J2F A;  4DQS A;  2ZUD A;  4F5O A;  3Q8M A;  2IHM A;  3RJJ A;  3E2E A;  1TFR A;  3RR7 A;  1XSP A;  2RDI A;  4C8N A;  1U9L A;  5JUM A;  2XGP A;  3PW5 A;  4RQ5 A;  3QEA Z;  1EXN A;  3OSN A;  3HT3 A;  4RT2 A;  1BGX T;  1ZQA A;  1NOM A;  1D9F A;  4DL3 A;  4KLH A;  3RTV A;  4C8M A;  1T7P A;  3RH5 A;  2ISP A;  1COO A;  1XO1 A;  1N48 A;  4ZH4 A;  3V7K A;  2VA8 A;  8ICJ A;  4F5N A;  2ZJ8 A;  3OGU A;  2FMQ A;  3C1Y A;  2BCS A;  1BPD A;  4ED6 A;  4DWI A;  4IQV A;  3T5J A;  3UXO A;  2HHS A;  5CB1 A;  1ZQC A;  1ZQJ A;  3MAB A;  1U49 A;  2UVW A;  1XU4 A;  1L3T A;  9ICL A;  9ICT A;  2PFQ A;  4PHP A;  5J0Q A;  1Z00 A;  4O5K A;  5J0W A;  1JXL A;  4M9H A;  1ZQG A;  7ICM A;  4R65 A;  2ALZ A;  4KLI A;  4O3Q A;  5TZV A;  4KLL A;  4M9G A;  3K75 D;  2V9W A;  5D46 A;  1JN3 A;  5J0U A;  3RJH A;  2ISO A;  5KFQ A;  2P6R A;  4RUA A;  4MF2 A;  2RDJ A;  4QW9 A;  4O9M A;  1ZQQ A;  2W9A A;  2R8J A;  1XS9 D;  4YVZ A;  4RT3 A;  4TUP A;  5J2A A;  4EYH B;  7ICT A;  8ICO A;  2DPI A;  3OHA A;  3ISB A;  3PO4 A;  5KFF A;  2W9B B;  4M6W A;  3IHQ B;  3RB3 A;  2FLL A;  4J9P A;  4LZD A;  3FYH A;  5HMM A;  3LWL A;  4F5P A;  4DSJ A;  3UXN A;  4KMU A;  3HW8 A;  4EZ6 A;  3Q8L A;  4QZF A;  4KLM A;  4UB1 A;  3C23 A;  3RH6 A;  1TK8 A;  8ICK A;  9ICF A;  3Q8R B;  5CR0 A;  4RPX A;  3M8R A;  3PX0 A;  3HPO A;  4P2H A;  2BPG A;  5DLG A;  4K4I A;  4F5Q A;  3KHR A;  4DSI A;  5KFH A;  3ZD8 A;  4O3O A;  4F93 B;  1ZQX A;  3OJU A;  2Q0Z X;  1JIH A;  2PFO A;  5KG7 A;  2UVR A;  2A1J A;  1X9S A;  2AJQ A;  1TAQ A;  5KFZ A;  5DG9 A;  8ICX A;  2HHU A;  5KT5 A;  3B0X A;  1NK6 A;  3NGD A;  4UQG A;  4ECX A;  3C5F A;  4QZD A;  4KN4 A;  3TFS A;  1BPE A;  1T4G A;  1S10 A;  3RJE A;  1KEJ A;  2DPJ A;  4Q43 A;  1T8E A;  2UVU A;  3SV3 A;  4I2B A;  1D8L A;  3Q8K A;  1TV9 A;  2AQ0 A;  4RQ4 A;  4DSL A;  1U48 A;  1T3N A;  9ICJ A;  4KLF A;  2ZJA A;  7ICF A;  2NRW A;  3PV8 A;  2H5X A;  5D49 A;  5L1I A;  3MBY A;  1TAU A;  5KT7 A;  2AGQ A;  8ICU A;  4UAY A;  5L9X A;  2LYH A;  3V6H A;  5IIN A;  4J9S A;  5DB6 A;  4ELU A;  8ICF A;  5J2C A;  4RNO A;  4DOC A;  2JEI A;  4PHA A;  3BQ1 A;  4F92 B;  1NK4 A;  4QZB A;  2J6S A;  4O3S A;  2ZUB A;  9ICM A;  1JX4 A;  4MEY A;  3GIM A;  4M0A A;  9ICE A;  5IIO A;  3JPS A;  4J9N A;  2FMS A;  4PPX A;  3BQ2 A;  4R8U A;  2HHV A;  1SKR A;  4P4O A;  8ICS A;  4TUS A;  2GWS A;  3SYZ A;  1L5U A;  2P66 A;  5KG5 A;  2C22 A;  4IQW A;  4KN7 A;  5KFK A;  1WCL A;  1NJZ A;  8ICQ A;  1NK7 A;  2HHX A;  2MUT B;  3C2K A;  2VAN A;  3K4G A;  4YMO A;  5J2B A;  3GV8 B;  1NJX A;  3MGI A;  3JPO A;  4G3I A;  5KFX A;  3H40 A;  4GC6 A;  4ED3 A;  7ICO A;  1ZQS A;  5KFE A;  4M04 A;  1D9D A;  3QZ8 A;  3V7J A;  4I2E A;  4QZC A;  5BOM A;  3OJS A;  2ASL A;  3RAQ A;  4KLS A;  3LDA A;  5KG1 A;  4UB4 A;  4ECQ A;  1TVA A;  4J9M A;  5L1K A;  8ICE A;  4RNM A;  4J9K A;  4DFM A;  3TAR A;  2PFP A;  4FBT A;  1K1Q A;  2NRZ A;  4KTQ A;  8ICH A;  4B9N A;  3KHL A;  4F2R A;  1UA0 A;  3ZDA A;  5KFG A;  3JPP A;  1KLN A;  4I2I A;  3RJF A;  2BPC A;  4MFC A;  5KFP A;  2BQU A;  1S0N A;  1XC9 A;  4JV1 A;  4QWA A;  4ED1 A;  4BWJ A;  2AGO A;  2ZTE A;  1L3U A;  3PR4 A;  3PMN A;  1S9F A;  3EZ5 A;  4F4X A;  2C2R A;  8ICP A;  5KT4 A;  4RZR A;  1XSL A;  1A76 A;  2PI5 A;  3G6V A;  3TQ1 A;  1KFS A;  3SV4 A;  4KLT A;  4ELT A;  4DL6 A;  4XQ8 A;  1LV5 A;  9ICC A;  4UBB A;  3H4D A;  4EBC A;  4DEZ A;  1S0M A;  4JUZ A;  5KT6 A;  5IIK A;  1SL1 A;  4ED2 A;  4KIT B;  3JPR A;  4DL4 A;  5J0S A;  1BPX A;  2IMW P;  1QLN A;  1PZN A;  4ECR A;  2HW3 A;  8ICR A;  4X5V A;  3MGH A;  3GII A;  5KG6 A;  4QZG A;  2XO7 A;  1S0O A;  4B9U A;  2W9M A;  1U47 A;  8ICC A;  7ICH A;  4P4M A;  3RRH A;  4Z6D A;  1NJY A;  4O5E A;  4O3R A;  3EW9 A;  5F9N A;  1WCN A;  1ZQY A;  3C1Z A;  5HML A;  4YR3 A;  2W8L A;  3BJY A;  2FPK A;  4FS1 A;  3KTQ A;  4JWN A;  4UB5 A;  1Z00 B;  5HHH A;  2NRX A;  1SKS A;  2ASD A;  1KFT A;  5DB8 A;  2W9C B;  4F5R A;  1H38 A;  3KHH A;  4DLE A;  1QSS A;  8ICL A;  4J9R A;  3AU2 A;  5J2J A;  3V7L A;  4J9L A;  4F4Y A;  4QZA A;  5DLF A;  3GIL A;  1NK5 A;  4UBC A;  4B9V A;  4ECZ A;  5KFB A;  1ZQH A;  5EWG A;  7ICK A;  4B9M A;  7ICG A;  9ICR A;  1RYR A;  2C28 A;  3HWT A;  1QSY A;  5BPC A;  4JWM A;  4LVS A;  2HHT A;  3T5L A;  4IRC A;  4IR1 A;  4TQS A;  3MDA A;  2KZ3 A;  2I1Q A;  5IIL A;  5CA7 A;  3H8J A;  5IIM A;  7ICL A;  2FMP A;  4YXJ A;  1HUZ A;  4I2H A;  3RB0 A;  4M6W B;  4UB3 A;  1S0V A;  1JXE A;  1ZQV A;  4YQW A;  3OSP A;  1UA1 A;  3MR3 A;  3HP6 A;  2XY6 A;  5J0X A;  4K4H A;  1X2I A;  3Q8Q B;  4YN4 A;  7ICS A;  3M9O B;  9ICX A;  3ISC A;  1SL0 A;  4F2S A;  3GQC A;  1ZQZ A;  2DFL A;  4E0D A;  2AGP A;  3UQ0 A;  2XCP A;  5CP2 A;  3RBE A;  4Q45 A;  2JEF A;  1XWL A;  5DB9 A;  2IA6 A;  4RPY A;  4PHE A;  2W9B A;  2R8G A;  4NLZ A;  2PFN A;  4RU9 A;  3EWA A;  3H8S A;  5CHG A;  3ZDD A;  3V6K A;  4Q8F A;  3MR6 A;  4DF8 A;  4UB2 A;  5DBC A;  1NK9 A;  1BPZ A;  2F1H A;  4NY8 A;  4GC7 A;  1LB2 B;  4PGX A;  3LK9 A;  4XA5 A;  3EPG A;  5KFA A;  4NM2 A;  3PW7 A;  2FLP A;  1MC8 A;  9ICA A;  9ICH A;  3PW4 A;  5J0P A;  2NRT A;  1D8Y A;  4CCH A;  9ICK A;  2XGQ A;  4ED7 A;  3T5H A;  5KFJ A;  5KFW A;  3OHB A;  1ZQI A;  1TKD A;  3RJK A;  4QZE A;  3RBD A;  8ICG A;  1ZJM A;  1ZET A;  5DG7 A;  2BCQ A;  1S77 D;  5HHI A;  3V72 A;  1ZQO A;  2R8K A;  3TI0 A;  5KFI A;  4R63 A;  5D4B A;  4EYI B;  8ICZ A;  4RQ6 A;  1S97 A;  2IBK A;  5DB7 A;  4Q44 A;  3RR8 A;  2KTQ A;  3M9M B;  1NKC A;  1A77 A;  2HVI A;  4IQT A;  2J6T A;  4ECS A;  1ZQN A;  4M2Y A;  2HVH A;  4EEY A;  4M9J A;  2UVV A;  4IRK A;  1S76 D;  3C21 A;  3C5G A;  4O3P A;  5J0T A;  2JEG A;  5L1J A;  1N56 A;  1ZQF A;  5KFO A;  3T3F A;  5J2D A;  3TAN A;  3QE9 Y;  1QTM A;  4DFP A;  4YD2 A;  4QZ9 A;  4PHD A;  3THV A;  5IIJ A;  3GDX A;  4DFK A;  4R8U B;  4DS4 A;  4M9N A;  5KFS A;  1MQ2 A;  3GFK B;  2KN7 A;  5J2H A;  1RXV A;  1QSL A;  9ICO A;  1BVS A;  3T5K A;  8ICT A;  5KG2 A;  4Q8E A;  2BQ3 A;  9ICQ A;  5CWR A;  4DL7 A;  2IHN A;  5KFY A;  4M9L A;  3FDS A;  4QZI A;  1ZQM A;  4NM1 A;  4F91 B;  5J29 A;  4YXM A;  9ICU A;  1DOQ A;  4RQ2 A;  3NTU A;  5DBA A;  5EWE A;  2Y1I A;  4O3N A;  4QWE A;  2PI4 A;  8ICW A;  4C8L A;  4PGY A;  4ED0 A;  1NK0 A;  4F50 A;  4ECV A;  4TUQ A;  8ICA A;  4BXO B;  1HJP A;  3H4B A;  1RPL A;  4O0I A;  2OWO A;  1KDH A;  4KLJ A;  1Y88 A;  4RNN A;  4RQ8 A;  3M9N B;  2JZB B;  4C8O A;  4F4Z A;  5DDY A;  3Q8P B;  1L3V A;  4LZG A;  7ICU A;  2FPL A;  4QW8 A;  4YMN A;  4ECU A;  4IRD A;  2W8K A;  2BQR A;  3PW2 A;  3BDP A;  4BWM A;  5KG0 A;  1JMS A;  5J2K A;  3MR2 A;  4YD1 A;  3B0Y A;  2FPM A;  3C2L A;  1L3S A;  1U4B A;  4MF8 A;  1BPB A;  4I29 A;  5BOL A;  4YR0 A;  3PNC A;  5J2I A;  2ZUC A;  4HYK A;  1B43 A;  4JV2 A;  9ICP A;  1X9M A;  1U45 A;  4YG2 A;  1RZT A;  5KFV A;  3RAX A;  4IQU A;  3GIK A;  4YMM A;  3RH4 A;  5KT3 A;  3AU6 A;  9ICG A;  3MR5 A;  2ATL A;  2NRV A;  3BQT A;  5HNK A;  4DO9 A;  5DGA A;  4QWD A;  4F4K A;  1RXW A;  1NKE A;  1ZQW A;  4DOA A;  1ZQP A;  2Y1J A;  1K1S A;  3ZDB A;  3RB4 A;  4JK1 A;  2XCA A;  3MDC A;  1NKB A;  2VA3 A;  4KLE A;  9ICS A;  5DQH A;  5L1L A;  4ECW A;  4DFJ A;  3ZD9 A;  3SI8 A;  4UAZ A;  4BGD A;  2B21 A;  4RQ1 A;  1X9W A;  4EBD A;  1ZYQ A;  3GV7 B;  4IR9 A;  1BPY A;  4B9S A;  3ISD A;  9ICB A;  4EZ9 A;  2XY5 A;  4NXZ A;  5KFU A;  3UPQ A;  4FO6 A;  4F4W A;  1HUO A;  5KG4 A;  4I28 A;  2ZTC A;  8ICV A;  1CEZ A;  4DLG A;  1ZQU A;  3JPQ A;  4EBE A;  5DDM A;  2XY7 A;  2V4Q A;  4YR2 A;  2R8I A;  3TFR A;  4RQ0 A;  2W9C A;  4I2J A;  5KTQ A;  4F8R A;  3GV5 B;  4XRH A;  3ZDC A;  4K4G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...