2MAXA

Nmr structure of the rna polymerase alpha subunit c-terminal domain from helicobacter pylori
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
114
structure length
114
Chain Sequence
b'LGVFGERPIANTEYSGDYAQRDDAKDLSAKIESMNLSARCFNCLDKIGIKYVGELVLMSEEELKGVKNMGKKSYDEIAEKLNDLGYPVGTELSPEQRESLKKRLEKLEDKGGND'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA-directed RNA polymerase subunit alpha
publication title Helicobacter pylori RNA polymerase alpha-subunit C-terminal domain shows features unique to -proteobacteria and binds NikR/DNA complexes.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Transferase
total genus 24
structure length 114
sequence length 114
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2013-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2maxA00
4YMNA 4IQTA 3RH5A 3RJHA 4ZH4A 5KFTA 4RQ2A 3RAQA 5KFFA 4ECUA 3C5GA 3RR8A 9ICKA 5KG2A 5DB8A 1U48A 1TKDA 2BPGA 2P6RA 3MGIA 1BGXT 3UXOA 4J9PA 1JXEA 1XU4A 3JPNA 3MR3A 4I29A 3C21A 1JXLA 4BDPA 7ICGA 2FLPA 4UAZA 1RXWA 4B9TA 1DGSA 2BQ3A 4RPYA 3H4BA 4O0IA 4R63A 2I9GA 4QZGA 4MFCA 4DFMA 5J2BA 4TURA 3HP6A 8ICAA 4YCXA 1SL0A 2ZJAA 1L3SA 4R65A 8ICRA 3RJJA 1IM4A 5J2GA 3MABA 1S10A 1HUOA 4I2BA 1ZQOA 4EYHB 4QZAA 2BCQA 5D4BA 1ZQPA 5J0SA 4KN7A 1TVAA 3UQ0A 3GDXA 4DL6A 2IHNA 4F4XA 4Q43A 3Q8KA 1NK9A 4BGDA 1KDHA 2PFPA 9ICMA 5J0WA 4RQ3A 4I2EA 4O5KA 1TK5A 5HHIA 2AGPA 1KEJA 1S0OA 4YMMA 4Q45A 4I27A 4QWDA 5IIJA 3UXNA 5KFPA 2R8IA 3C2LA 2AQ4A 1D9FA 4KLMA 8ICEA 3MFIA 9ICNA 7ICSA 4IR1A 2NRTA 2BQUA 3FYHA 2ZTEA 4QZIA 2P6UA 4F93B 4ED3A 8ICBA 2HHTA 4DO9A 4EYIB 4BXOB 4XA5A 1ZQUA 1ZJNA 3K4GA 3MFHA 3ZDAA 3M8SA 4DQRA 2NRVA 3TAPA 4EZ6A 5EWGA 1ZETA 5DKWA 2FMQA 3M9NB 3SI8A 4UBCA 3RBDA 1NJXA 1X2IA 2A1JA 9ICEA 5IIKA 4RQ1A 1UT5A 2RDJA 3GV7B 2DFLA 4QZ9A 3TFSA 3GIKA 2ZUBA 2BCSA 1LV5A 2FLLA 4DSJA 3EZ5A 4DL4A 2F1JA 2XY7A 2Y1JA 4I2HA 4PH5A 3MDCA 3H4DA 3QZ8A 4Q44A 5L1IA 5BPCA 4I2DA 7ICJA 3PX4A 3RH6A 1XSPA 5DBAA 5DG8A 4KLFA 2HHXA 4PHPA 1KFTA 5KFBA 4QWEA 4KLHA 2M9NA 5KFRA 4YFKA 4NY8A 3UXPA 4DS5A 5KFQA 3OSNA 3ISCA 8ICTA 4ECYA 2R8HA 5KG6A 4JWNA 2I1QA 2A1JB 5BOLA 3MR6A 4EBEA 3JPSA 5KT3A 1RXVA 2WTFA 2UVVA 4UB1A 4RUCA 3M8RA 1T3NA 3H40A 9ICUA 1S77D 7ICFA 1NOMA 3MR2A 4C8KA 2ZTDA 5KT2A 4RT2A 2FLNA 1ZQDA 4KLDA 2KZZA 4GXKA 4UB5A 2HHQA 3ISBA 4M9LA 3B0YA 1JMSA 1MC8A 4DFKA 7ICVA 1QSYA 9ICCA 3B0XA 4FO6A 5KG5A 3T5KA 5DQIA 4RT3A 4C8LA 4B9SA 4I28A 4FBUA 4BWJA 4QZBA 4X5VA 3OSPA 4NLKA 9ICWA 8ICKA 1U49A 5DB6A 1JX4A 2UVRA 2C22A 3V72A 4RU9A 4Z6FA 1XC9A 2R8GA 3RRGA 2FPKA 7ICIA 4DWIA 1RYSA 3RRHA 1JN3A 5KTQA 1ZQKA 3MR5A 1SZPA 4RQ0A 3N97B 5J2CA 4DS4A 2JEIA 7ICOA 3HPOA 3BQ2A 1KFSA 4YP3A 3Q8LA 3QE9Y 3HT3A 7ICMA 2R8KA 1ZQXA 5DDMA 3T5JA 4DF4A 3OHBA 3KHHA 4KLEA 8ICXA 3EW9A 1ZQSA 8ICWA 1EXNA 3Q8QB 3RB0A 4F50A 3HWTA 1ZQWA 2DPIA 1U47A 2C28A 5L9XA 1L3UA 2HVIA 4O3NA 4RZRA 1X9MA 2XY5A 1ZQEA 4YR2A 4KLUA 3BQ0A 3RB4A 5J2EA 3GQCA 5DB9A 1NK4A 1ZQZA 4RQ5A 7ICLA 4UQGA 2HHSA 8ICQA 4XUSA 5KT7A 4DOBA 4ECVA 5HP4A 5EWFA 5DLGA 2KZMA 2JEJA 2ZJ8A 4GLXA 4B9NA 1TAUA 5CJ7A 1ZQLA 4PHAA 1S76D 5IILA 5TZVA 1IXRA 2XGPA 4I2IA 5KFLA 1K1SA 3JPPA 4M04A 1KSPA 1NK7A 5CP2A 2R8JA 3C23A 9ICSA 5KFKA 4F8RA 4IRCA 2ISPA 4BXOA 3UPQA 3RR7A 9ICGA 1BPBA 7ICUA 3OHAA 2W9BB 4YG2A 1RZTA 2ISOA 1HJPA 1LB2B 4XRHA 4F4ZA 4O3PA 5J2AA 1ZQBA 4I2GA 4KLGA 3SZ2A 4RNOA 4F2RA 5CWRA 4DOAA 4DQPA 4ELUA 1NJYA 4PGQA 4Q8EA 5DB7A 3G6XA 3ZDEA 2IHMA 4O5EA 4O3QA 5J0XA 4HYKA 2PFQA 4IR9A 5KFJA 1KLNA 3BDPA 4GXIA 5KT4A 2OWOA 4KLLA 2NRWA 2UVUA 4JUZA 2AGOA 1SL1A 8ICFA 4UB4A 1ZQMA 1BVSA 1S9FA 4DSEA 4Z6EA 5DGAA 7ICRA 2HHUA 7ICTA 4F5OA 4CCHA 1X9WA 2VA8A 1SKWA 1XS9D 1Z3EB 4C8NA 4KLIA 4F4WA 1SL2A 2MUTB 5DDYA 4QWAA 2W9MA 3EYZA 2IBKA 4KITB 1ZQNA 3V6HA 2KFZA 5J2KA 5EOZA 4J9OA 4EBCA 4YVZA 3N4MB 1QSLA 1S0VA 2ASLA 3TAQA 4M9HA 2PFNA 4DFPA 4O3RA 3PV8A 5IIIA 1SKSA 1Z00B 3RJEA 4B9LA 4DLGA 5IIMA 3M9OB 5KFMA 4DFJA 2KTQA 8ICHA 4QZ8A 4TUSA 2HHWA 3NTUA 2BKEA 4ELTA 4GC7A 5DG7A 9ICBA 8ICGA 1RPLA 2LYHA 4PHEA 3RB3A 3V7JA 1QSSA 4M2YA 1XO1A 2BCRA 4YD1A 4O3SA 4F5RA 2P66A 3ISDA 9ICRA 4UB2A 5J0UA 4J9LA 1NK6A 3E2EA 2PI5A 2XC9A 8ICVA 3GIMA 3V6KA 4M9JA 2BCUA 2BHNA 4P4PA 1N56A 4QZHA 1ZYQA 4K4HA 8ICCA 4QW8A 5EWEA 2BCVA 4DSLA 4QZCA 5J2IA 3RAXA 3HX0A 4QW9A 4O9MA 2V9WA 3PW5A 3FDSA 3PR5B 4I2JA 5DQGA 2FPMA 3ZDDA 3AU2A 2PXIA 4MF2A 4ECRA 4M0AA 3KHRA 4EZ9A 1UT8A 2JEGA 5J2JA 2HW3A 5DGBA 9ICIA 1KRPA 5HHHA 3ETLA 3JPOA 4EBDA 5L1JA 4KLTA 1WCNA 3PX0A 3QZ7A 3C1ZA 1KFDA 2HHVA 3PVXA 3PW2A 4P4MA 2BPCA 2H5XA 4RPZA 8ICOA 2ALZA 3NGDA 5DG9A 3SV3A 1NJZA 2J6TA 5KFXA 5J2FA 3Q8PB 4I2AA 4KMUA 9ICQA 2W9CA 4PHDA 4C8OA 3PMNA 5L1LA 4O5CA 3OJUA 4Z6CA 1A76A 5BOMA 3KHLA 1U45A 3PR4A 7ICEA 4YR0A 1TK0A 4BWMA 3JPQA 5DLFA 4I2FA 2JZBA 4UB3A 3V7LA 3Q8RB 2VA3A 9ICHA 2Q0ZX 3PW7A 3BQ1A 3RH4A 7ICNA 1ZQGA 4ED6A 5KFOA 4R8UA 4DL5A 2W9BA 1COOA 5KFHA 2AJQA 4KLQA 4DLEA 1AROP 3QEAZ 1QTMA 4MFAA 2KN7A 5DQHA 5KFWA 5KG7A 4O3OA 1ZQJA 4DF8A 4M6WB 1L5UA 4DSIA 4DEZA 4NM2A 1ZQTA 1T7PA 2PI4A 2C2EA 1L3TA 5F9NA 5KG3A 4FBTA 3V7KA 4ELVA 2NRXA 2XCPA 1MQ2A 3MBYA 2BR0A 2W9CB 3PNCA 8ICNA 4YXJA 1T8EA 2DPJA 3RJFA 2MAXA 3BQTA 3BJYA 4DL2A 9ICOA 4R64A 3SV4A 3RBEA 9ICJA 3LWMA 4EEYA 4UAYA 2JZBB 1K1QA 8ICSA 2RDIA 2F1IA 4M9GA 1WCLA 5KFIA 2W8KA 1TK8A 4KLSA 1U9LA 2MUTA 4R8UB 4UBBA 3LWLA 8ICJA 1ZQRA 4QZEA 5HMLA 1A77A 4YQWA 3PY8A 4Q8FA 3H8SA 4F91B 4RNMA 4J9NA 4JV1A 5KFYA 3H8JA 5KFZA 5J2DA 4NLGA 4E0DA 7ICPA 1D9DA 3TI0A 1SKRA 4IQVA 4XQ8A 1NK8A 8ICMA 2BDPA 3ZDBA 4LZGA 4JK1A 5KG0A 3LK9A 3MDAA 5KG4A 2AGQA 7ICHA 2XGQA 2ATLA 3OGUA 1Z00A 4ECQA 1ZQIA 3MGHA 4MFFA 4ED7A 2B21A 4R66A 1JIHA 2IA6A 3GFKB 4NM1A 3G6VA 2FMSA 4MEYA 2W9AA 4J9RA 3TFRA 1BPYA 3C5FA 3GV8B 4ECTA 2XO7A 4GXJA 4DL7A 3AU6A 1NJWA 3RJIA 4F4KA 3JPTA 3G6YA 4RQ6A 1BPEA 9ICPA 4G3IA 4NLNA 4DQSA 3V6JA 5F9LA 1V9PA 2KZ3A 2BQRA 4IRKA 1D8LA 4ED2A 3PX6A 4K4GA 1MSWD 2BGWA 1QLNA 9ICFA 2JEFA 1B43A 4B9VA 1CEZA 4ECWA 1UA1A 1NKCA 3H7IA 1NK5A 5IINA 4F5NA 2V4RA 5C5JA 1BPDA 4PGYA 1BPXA 3C2MA 4QZDA 4B9UA 2AU0A 2ZJ5A 9ICXA 5J0TA 2FPLA 1XSNA 1XSLA 4LVSA 1N48A 3PW0A 4I2CA 1UA0A 2NRZA 1X9SA 1Y88A 5KFGA 3H8WA 4ECXA 3AUOA 2ASDA 4LZDA 4KN4A 5J29A 2ZUCA 1B22A 4YMOA 3T3FA 1MQ3A 3KTQA 4GC6A 1S0MA 3Q8MA 3ORYA 4JWMA 3PO5A 1KTQA 5CB1A 3T5HA 1BPZA 2AQ0A 9ICAA 3K75D 3RB6A 2ASJA 4RUAA 3GIIA 3TANA 4P4OA 3IM1A 4JV0A 2ZUDA 4TQRA 5J2HA 3ZD8A 4FS2A 1C7YA 4JV2A 2KFNA 4ED1A 9ICLA 8ICIA 4QZFA 5L1KA 2Y1IA 5KT5A 5KFUA 4RQ7A 3TARA 4M47A 4NLZA 4B9MA 4DSFA 3M9MB 8ICPA 8ICZA 5KFCA 3Q8SB 1ZQQA 1ZQAA 3OJSA 2XCAA 2F1HA 5KFDA 5CHGA 3ZDCA 3LDAA 1T4GA 5J0YA 4RQ8A 5CR0A 3C1YA 2HVHA 1TFRA 1ZQCA 4YD2A 4RNNA 4M6WA 5J0QA 4F5QA 4YR3A 4ECZA 4J9QA 3ZD9A 4F2SA 4QWBA 1ZQFA 1ZQVA 1ZQHA 7ICKA 5JUMA 3SYZA 8ICUA 4TUPA 5HNKA 2BPFA 1TAQA 3EPIA 4IQWA 3EPGA 3QEBZ 2C2RA 4PPXA 4ED0A 3T5LA 3PO4A 1XWLA 4PGXA 3GIJA 5KFEA 4DL3A 4KTQA 1S97A 3UQ2A 4UAWA 2VA2A 2W8LA 3GILA 8ICYA 4TQSA 5D49A 3HW8A 2V4QA 4IQUA 1PZNA 4C8MA 4DQQA 1NKBA 4ED8A 5KG1A 3JPRA 4KLOA 2XY6A 5KFSA 5DBCA 3THVA 4F4YA 4RQ4A 3KHGA 5J0PA 4DSKA 4KLJA 4MF8A 1CUKA 2J6UA 4Z6DA 3RJGA 5HMMA 4M9NA 1ZJMA 2ZTCA 4IRDA 9ICTA 3PMLA 1D8YA 3IHQB 2IMWP 3EWAA 5KT6A 4FS1A 3RTVA 1RYRA 4J9MA 5J0OA 1HUZA 7ICQA 1S0NA 5J0RA 2J6SA 1ZQYA 5IIOA 3TQ1A 5D46A 1TV9A 4YXMA 3PW4A 4J9SA 5CA7A 4YN4A 4MEXA 4F3OA 5KFNA 4P2HA 1L3VA 1H38A 2VANA 4NXZA 2FMPA 9ICVA 4RPXA 1NK0A 8ICLA 4DOCA 4K4IA 4F5PA 5DBBA 2C2DA 4ECSA 3RJKA 4F92B 1NKEA 5KFAA 4J9KA 2GWSA 4DQIA 5KFVA 2UVWA 1DOQA 4QWCA 2PFOA 3GV5B 4TUQA 1U4BA 3C2KA
chains in the Genus database with same CATH superfamily
4IQTA 3C29A 2K8AA 3RAQA 4ECUA 9ICKA 5AKIA 1TKDA 2MA1A 2RHFA 2DBYA 2Y0SF 3VCBA 4J9PA 1JXEA 2IOFK 2EH9A 3WK7A 3DEEA 2MU2A 2XVTA 1OXJA 4B9TA 5ALKA 2BQ3A 4RPYA 4MFCA 4QZGA 4DFMA 2EAOA 3HP6A 4YCXA 2ZJAA 4R65A 8ICRA 1IM4A 1S10A 3MABA 1HUOA 1VJ5A 4EYHB 2RP5A 5AI6A 2BCQA 1ZD2P 4UARA 3GDXA 5ALUA 3NVWA 2NV3A 5J0WA 4I2EA 2GO7A 5HHIA 1KEJA 4I27A 4YMMA 2OXOA 5IIJA 4QWDA 1D9FA 4QZIA 8ICBA 4EYIB 4XA5A 5AKYA 2W7PA 5ALHA 2D6FC 5DKWA 3SI8A 2A1AA 1KBUA 2A1JA 9ICEA 4UAVA 2DUYA 2BCSA 2FLLA 3EZ5A 4Y2YA 1JALA 2F1JA 4NWIA 4I2HA 1SZHA 3H4DA 1L7PA 2B0CA 3MDCA 1JUDA 2QLTA 2K8CB 1Z4NA 5EE1A 2YMLA 4KLFA 3OTQA 3WU2U 1KFTA 5KFQA 2OYYA 3MR6A 5BOLA 2CXYA 3M8RA 3H40A 3CNHA 4FFDA 4OJPA 7ICFA 3MR2A 3QUQA 3CP8A 4UB5A 2ZIVB 2KMDA 4QIWC 1QSYA 2Z7JA 9ICCA 3T5KA 4QZBA 1VLBA 9ICWA 3OSPA 1NZBA 3V72A 1RQLA 4Z6FA 1F44A 2YMQA 4UASA 3MR5A 4NLBA 1SZPA 4DS4A 1ZOLA 3Q8LA 1PVRA 3QE9Y 1C20A 1ZQXA 3BS7A 5ALOA 4DF4A 3OHBA 4KLEA 3WK8A 3EW9A 3RB0A 3HWTA 2C28A 4RZRA 3FAHA 1X9MA 5ALNA 4KLUA 4RQ5A 3FC4A 3NVZA 4UQGA 2HHSA 8ICQA 4DOBA 4ECVA 5HP4A 2EAMA 3EUB2 2E5SA 3R9KA 1NK7A 2R8JA 9ICSA 1ZD3A 5T14A 3AQEA 3N7PD 4UATA 3UPQA 7ICUA 2W9BB 4XRHA 1ZQBA 3SZ2A 3BS5A 4RNOA 4DQPA 4ELUA 1IG6A 4PGQA 2KG5A 3F5AA 4CF5A 4O3QA 4IR9A 1SV0A 5KAIU 4GXIA 2OWOA 1N60A 3NASA 1BVSA 4Z6EA 5C0YA 2HHUA 7ICTA 2KJ5A 2KP7A 2ZIUB 2KK0A 2F77X 2WF5A 2K8BB 2VJ5A 5J2KA 5J8YA 5GTIU 3D2QA 4YVZA 1S0VA 2RRDA 4O3RA 3IN5A 2QKQA 2ZXHA 1SKSA 3RJEA 4B9LA 2KTQA 4DFJA 2HHWA 3PSIA 8ICGA 1X6IA 1A0PA 2ESEA 5ALRA 3ISDA 2E8PA 3E2EA 4QNLA 2BCUA 4QZHA 1ZYQA 4QZCA 5J2IA 2V9WA 2KJ9A 3PW5A 1ZRMA 4C0ZA 2PXIA 4ECRA 4M0AA 4P0PA 2ES6A 5J2JA 5HHHA 3ETLA 4O3MA 5AIAA 3QZ7A 3HJEA 5A0LA 3PW2A 4OD0A 5TISU 3NGDA 5H2FU 2J6TA 4CF3A 3KKAC 1U45A 4BUGA 3PR4A 4YR0A 4I2FA 1N63A 5HR7A 3BQ1A 2W54A 3RH4A 5KFOA 4R8UA 1COOA 2LYAA 4DLEA 4MFAA 5DQHA 5KFWA 1RQNA 4NM2A 1ZQTA 2PI4A 4MHVA 3SAGA 4ELVA 2NRXA 8ICNA 1Z1BA 5AI0A 3BJYA 4R64A 3RBEA 4EEYA 4USAA 5AI4A 3M6ZA 1TK8A 2W8KA 1UHUA 3LWLA 5HMLA 4F91B 5KFYA 3H8JA 5KFZA 7ICPA 2DQNB 1T3QA 1SKRA 1YZ7A 4XQ8A 4US8A 2BDPA 3MDAA 5KG4A 2ATLA 1UPHA 3MGHA 5HR6A 1JIHA 2IA6A 3G6VA 2AH5A 2KSOA 3TFRA 4J9RA 1BPYA 3GV8B 2HOFA 2XO7A 1NJWA 3RJIA 5AM5A 4F4KA 9ICPA 3PSTA 4DQSA 3V6JA 4Y2VA 3PX6A 1MSWD 2BGWA 9ICFA 2E8OA 3LVWA 3F2DA 2OEHA 3H7IA 4UB8U 2V4RA 2YTUA 4PGYA 4QZDA 4BJQA 2ZJ5A 2LI6A 2M0NA 5J0TA 5EE0A 2B6GA 3PW0A 4I2CA 2NRZA 3AUOA 4LZDA 4YMOA 3T3FA 4GC6A 4JMUA 3UM9A 1S0MA 3AM9A 3ORYA 3NUQA 4Y2UA 3PO5A 5CB1A 1BPZA 2AQ0A 4QJFB 4FZNA 1N5XA 3GIIA 4P4OA 4JV0A 4FS2A 3TARA 4RQ7A 1V85A 8ICPA 2XCAA 2F1HA 5AM2A 3ZDCA 3LDAA 4NLCA 1X66A 2HVHA 4M6WA 4ECZA 1ZQFA 1ZQVA 7ICKA 3SYZA 8ICUA 3EPIA 4IQWA 2LM1A 2FE9A 4UB6U 4PGXA 1V38A 4NL9A 4DL3A 5AKKA 5ALFA 4UAWA 2VA2A 3GILA 5AIBA 5EE9A 2YB4A 4IQUA 1NKBA 3I28A 3JPRA 2LMRA 2XY6A 3THVA 4RQ4A 4DSKA 4KLJA 2QB0B 1ZJMA 5AM1A 3PMLA 1D8YA 4Y2PA 5J0OA 3A0HU 2A19A 4J9SA 1B4FA 5KFNA 4ACOA 1L3VA 5ALWA 1H38A 5AK4A 3SAFA 2XICA 1RDFA 4DOCA 4F5PA 5DBBA 4F92B 2GWSA 4DQIA 5KFVA 4QWCA 3SEIA 3SAHA 3RJFA 2YQEA 3F53A 4YMNA 3RJHA 4RQ2A 5KFFA 3C5GA 2BPGA 2P6RA 1ZD4A 3UXOA 1XU4A 4BDPA 3MC1A 3KZXA 3QU4A 2KHQA 4C4RA 4QIWF 1SL0A 2W11A 4I2BA 2PMZC 4IC9A 4KN7A 3UQ0A 2VIXA 2OM6A 4F4XA 1SV0C 1S5LU 3Q8KA 1NK9A 4BGDA 2PFPA 9ICMA 4RQ3A 3QU5A 1S0OA 5KFPA 9ICNA 2Y9UA 2ZTEA 2P6UA 4F93B 3LYSA 4BXOB 4RQMA 2WF9A 3MFHA 3M8SA 2NRVA 2KOBA 3TAPA 4C7YA 4EZ6A 1ZETA 4IL6U 5J8YC 2WF8A 2HMXA 1X2IA 3QNMA 2QARB 2H3VA 3GV7B 3QU7A 1PK3A 4QZ9A 3GIKA 1LV5A 4DSJA 5JRTA 4PH5A 3QU2A 1URJA 4Q44A 5L1IA 3RH6A 5F3XB 2HCFA 1NI3A 4PHPA 5KFBA 3SENA 4QWEA 2M9NA 4YFKA 5AHXA 4NY8A 3UXPA 4DS5A 3S6JA 2Q4TA 3J81j 1RXVA 3L5KA 3JPSA 5KT3A 2UVVA 1T3NA 3ONNA 9ICUA 4C4SA 1V97A 4C8KA 2ZTDA 3TKAA 1SWWA 2HHQA 1X6JA 4M9LA 3B0YA 1QH9A 1JMSA 1MC8A 2EANA 1SGGA 2G5IB 2WAQC 4RT3A 4B9SA 4P0QB 4X5VA 4KX3A 1XC9A 4DWIA 5KTQA 1ZQKA 4RQ0A 3N7SC 3N97B 2JEIA 2K4IA 1HIWA 1KFSA 2K4PA 3L4PA 5DDMA 2KKPA 2IOFA 4CGZA 1L3UA 5L9XA 1QQ7A 3TACB 1ZQEA 1QQ6A 3KZIU 1TAMA 3GQCA 1ZQZA 4EEKA 3D2SA 5K4LA 5KT7A 2W55A 5EWFA 1FO4A 4GLXA 1HEKA 5TZVA 1LKYB 3KBBA 4M04A 1WWVA 3C23A 5KFKA 2AXTU 4F8RA 4IRCA 9ICGA 3RR7A 3OHAA 1HJPA 5J2AA 3F5EA 1IV8A 4Q8EA 3G6XA 2IHMA 5JU5A 5J0XA 3BDPA 5KT4A 1SL1A 2AGOA 4OJOA 8ICFA 4UB4A 1ZQMA 1DXSA 7ICRA 3QUTA 3OPXA 3F2BA 4KLIA 4F4WA 5DDYA 2W9MA 2IBKA 2CRXA 3V6HA 2KFZA 3K1RB 4EBCA 2G08A 3TAQA 2PFNA 2XIDA 5JTIA 4J03A 1Z00B 4QZ8A 3NTUA 2BKEA 4ELTA 4GC7A 2MRLA 4PHEA 3RB3A 1QSSA 2P35A 4F5RA 4OCZA 2XC9A 3GIMA 4M9JA 2HBKA 1JRPA 1N56A 2BCVA 1VDVA 3MGVA 3HX0A 4QW9A 3FDSA 4I2JA 4EZ9A 2HW3A 9ICIA 2HSZA 1SWVA 4P4MA 4RPZA 8ICOA 5AI8A 3SV3A 1JROA 5KFXA 5J2FA 4I2AA 4KMUA 1D8BA 4NL9C 1L6NA 3PMNA 5L1LA 4CE6A 4O5CA 3OJUA 5BOMA 3KHLA 5AKJA 4BWMA 2K4EA 4UB3A 3V7LA 9ICHA 1B0XA 2Q0ZX 3PW7A 2JV3A 5KFHA 5E79U 1QTMA 4Y2QA 4DF8A 5AI9A 4US9A 4DEZA 1T7PA 5KG3A 2F8LA 2KJ8A 2XCPA 3C28A 4UAUA 3PNCA 3IRUA 2DPJA 4A8EA 2YY6A 1L7OA 3BQTA 2ZIWB 5KL8B 3SV4A 8ICSA 4UAYA 5AKGA 2RDIA 2F1IA 2LKYA 4HAIA 1WCLA 2MUTA 4KMOB 8ICJA 1ZQRA 4RNMA 2JH7A 3BZKA 1TE2A 1Z19A 4NLGA 4E0DA 5CRXA 3TI0A 4IQVA 1NK8A 3CYMA 8ICMA 4LZGA 2HBJA 5KG0A 4EX7A 3LK9A 7ICHA 2W3RA 4DFDA 1ZQIA 4MFFA 1Q46A 4NM1A 2FMSA 4MEYA 3C5FA 4AYBC 3G6YA 4NLNA 3N28A 5F9LA 2BQRA 4K4GA 4ED2A 5ALMA 4PJ0U 2JEFA 2KD1A 4B9VA 4ECWA 1NKCA 5IINA 1CRXA 2K89A 1BPDA 3C2MA 3H0RB 4C80A 4GIBA 1Y88A 5KFGA 3H8WA 2ASDA 2FJ6A 5J29A 4KN4A 3KTQA 4ZOHC 3K1ZA 9ICAA 3K75D 3ZD8A 3AL0B 1C7YA 9ICLA 8ICIA 5L1KA 5KT5A 4DSFA 3M9MB 4FE3A 5KFCA 3Q8SB 2JMGA 3OJSA 2G0AA 1GO3F 3DV9A 4Y2SA 5KFDA 4DCCA 3C1YA 2Y0SC 2IOHA 5J0QA 4YR3A 3ZD9A 1TAQA 3QEBZ 3UMCA 4ED0A 5KFEA 1S97A 1JI7A 8ICYA 3I1YA 4TQSA 3HW8A 4C8MA 4DQQA 3M6KA 5KFSA 2EZXA 3KHGA 2KE7A 5J0PA 3AMZA 1CUKA 4Z6DA 4M9NA 2D3DA 3PSPA 4IRDA 2Y9TA 4J9MA 1WYGA 2QB1A 1HUZA 2J6SA 2NYVA 3PW4A 1BNPA 5CA7A 4MEXA 1L7NA 1O03A 1J97A 3M1YA 9ICVA 3L3FX 1NK0A 2O6KA 2G07A 3GU3A 1X9XA 1OW5A 2C2DA 4ECSA 3T79A 4J9KA 5AI5A 2PFOA 1KL9A 4TUQA 3C2KA 2DKZA 5KFTA 5KG2A 5DB8A 5AM4A 4OJ5A 3SD7A 3MGIA 1BGXT 3JPNA 3MR3A 7ICGA 3C21A 1JXLA 2FLPA 4UAZA 1RXWA 1DGSA 2W43A 2ZIXA 4O0IA 4R63A 2I9GA 5J2BA 8ICAA 2H3QA 3RJJA 4QZAA 5D4BA 1ZQPA 3H0MB 4DL6A 1KDHA 4O5KA 1TK5A 4BX9C 1N2XA 4Q45A 8ICEA 2R8IA 2AQ4A 7ICSA 1ED1A 1J2MA 2NRTA 3FYHA 4FZMA 4DO9A 3K4GA 4DQRA 5EWGA 2FMQA 3M9NB 2KHVA 4RQ1A 2RDJA 2DFLA 2ZUBA 4DL4A 5ALVA 5AK5A 1RYUA 5ALPA 2EZZA 3GZFA 4I2DA 7ICJA 1SV4A 5DG8A 4P0QA 3PSFA 2N1RA 5AICA 3OSNA 3ISCA 8ICTA 5KG6A 4JWNA 2I1QA 2WTFA 4UB1A 4RUCA 2PKEA 1NOMA 5KT2A 2YMPA 5AKXA 4Y2RA 4DFKA 7ICVA 5ALTA 2KEYA 2KNJA 4PZOA 1AQ6A 4NJ8A 4BWJA 8ICKA 1U49A 5DB6A 1A6SA 2C22A 4RU9A 2R8GA 3RRGA 3RRHA 2LYBA 3LVVA 5AM0A 3BQ2A 4YP3A 1LKYA 3HT3A 2F3NA 2I6XA 2NO5A 1ZQSA 3WKDA 4EENA 4F50A 1ZQWA 4YR2A 3O0FA 3BQ0A 4F72A 2DF4B 3DDHA 4XUSA 4GFJA 5DLGA 2KZMA 2JEJA 3AQFA 4CDGA 4B9NA 1ECWA 5CJ7A 1ZQLA 4PHAA 1S76D 5IILA 1J2NA 1IXRA 4I2IA 5KFLA 1KSPA 2WB1C 3B9JA 1BPBA 1YZ6A 1RZTA 4O3PA 4KLGA 2FDRA 4DOAA 3ICXA 1NJYA 3NRWA 2HOIA 4WJ3B 2HDOA 3ZDEA 4O5EA 2ODGA 3WKBA 2PFQA 3ZI4A 5KFJA 1KLNA 2NRWA 2UVUA 4DSEA 5DGAA 1X9WA 1XS9D 3KOOA 4C8NA 2ZXIA 3EYZA 3PZPA 4KITB 1ZQNA 3E0FA 1QSLA 1X40A 1DK2A 5IIIA 3QXGA 2W3SA 2ZIVA 5KFMA 4TUSA 2F44A 3QU9A 2E8NA 4M2YA 2BCRA 4O3SA 2P66A 5KAFU 5B5EU 4UB2A 5J0UA 4EELA 2PI5A 8ICVA 3V6KA 1WWUA 4P4PA 8ICCA 2E8MA 2NO4A 3H8MA 4QW8A 3RAXA 4ICAA 3PR5B 3ZDDA 2FPMA 2DWQA 4MF2A 4NV0A 2JEGA 3JPOA 1KN5A 5L1JA 3HKZC 1WCNA 3PX0A 2K4HA 3C1ZA 2H5XA 2XI9A 4AYBF 5DG9A 2KIWA 2RQ5A 1SXDA 1UQVA 4PHDA 1F0MA 1DRGA 4Z6CA 1TK0A 2ZIWA 5DLFA 3Q8RB 2VA3A 2KICA 5AK3A 1ZQGA 4DL5A 2W9BA 2W04A 3D2NA 3QEAZ 5KG7A 4O3OA 4DSIA 1L5UA 4M6WB 2C2EA 1L3TA 4FBTA 3V7KA 1PK1B 1MQ2A 2BR0A 3IP4B 2W9CB 1T8EA 5ALQA 4DL2A 9ICOA 2E1FA 9ICJA 2JZBB 1K1QA 4M9GA 2BDUA 5KFIA 4KLSA 5ALSA 2ZIUA 4UBBA 3PY8A 1RG6A 4QZEA 4YQWA 4Q8FA 3H8SA 4JV1A 5J2DA 1MN8A 3QUCA 2F76X 4PL2A 2XGQA 3OGUA 1L8OA 3UMGA 1S8OA 2E3TA 4R66A 3D6JA 2HI0A 2W9AA 4ECTA 2FI1A 4DL7A 2EAPA 3JPTA 5EE3A 1Q3VA 1V9PA 5AM3A 4IRKA 1D8LA 5KNIA 4PZNA 1CEZA 1NK5A 2GOLA 5ALJA 1DK3A 2AU0A 1IIPA 1N48A 1QCKA 1UA0A 1FIQA 4ECXA 2CPRA 2ZUCA 2OH2A 4JWMA 1RM6C 3RB6A 4RUAA 3IM1A 4Y2TA 2ZUDA 5J2HA 2EDUA 5AKHA 4ED1A 2Y1IA 4M47A 4NLZA 4B9MA 2WF6A 8ICZA 1ZQQA 1ZQAA 2YX8A 1T4GA 4RQ8A 2OCEA 3BQ7A 1TFRA 2JGAA 4KX5A 1FFUA 2R18A 4QWBA 4B6JA 1ZQHA 5JUMA 4TUPA 5AKLA 5HNKA 2BPFA 3EPGA 2C2RA 1PVQA 3PO4A 3GIJA 3H0LB 4KTQA 1L7MA 3UQ2A 2W8LA 2LM4A 5D49A 1PZNA 4FZLA 4ED8A 3M7DA 1Z1VA 1O08A 4MF8A 2J6UA 3RJGA 5HMMA 1NZPA 2JRZA 2ZTCA 2L5YA 3IHQB 2H3IA 3EWAA 3RTVA 3E58A 7ICQA 5J0RA 1ZQYA 5IIOA 2HOQA 5D46A 4YXMA 2YMMA 5ALEA 4G9BA 1SB3C 2VANA 2FMPA 8ICLA 1T94A 3HILA 3ALRA 1NKEA 5KFAA 1BNOA 2UVWA 1SIJA 3RH5A 4ZH4A 3KD3A 3RR8A 1U48A 4I29A 2EQYA 4C4TA 1YT3A 3H4BA 4TURA 1L3SA 2KVSA 5J2GA 5G5HA 5GTHU 1ZQOA 3AEVA 5J0SA 1TVAA 2IHNA 3WKAA 5ALGA 4Q43A 3VC8A 4OO1J 2AGPA 3UXNA 3C2LA 4KLMA 3MFIA 4IR1A 2BQUA 4ED3A 2HHTA 1N62A 1ZQUA 1ZJNA 3ZDAA 1NJXA 3RBDA 4UBCA 1XNSA 4OJLA 5IIKA 1UT5A 3TADA 3TFSA 2XY7A 2Y1JA 4CNQA 2GLEA 3QZ8A 5BPCA 3PX4A 2KKVA 3SQIA 1XSPA 5DBAA 2WB1F 2HHXA 4KLHA 2QB0A 5KFRA 3NVVA 4ECYA 2R8HA 2YN4A 2A1JB 4EBEA 1ZRNA 5ALDA 3U26A 2PMZF 2JXJA 1S77D 4CRXA 4RT2A 2FLNA 4KLDA 1ZQDA 1M6YA 2KZZA 4GXKA 3ISBA 2G09A 3A0BU 3ED5A 3B0XA 1Z4OA 4FO6A 5KG5A 4C8LA 5DQIA 4I28A 4FBUA 5KL1B 4NLKA 1JX4A 2UVRA 1KKXA 1CI4A 1K5OA 7ICIA 2FPKA 3AN1A 1RYSA 1JN3A 5J2CA 3F2CA 7ICOA 1Q8KA 3HPOA 2JR5A 1KQQA 7ICMA 2R8KA 3T5JA 3KHHA 3RF9A 8ICXA 2A3VA 8ICWA 1EXNA 3Q8QB 1F5SA 2DPIA 1U47A 2HVIA 4O3NA 1ZQ1C 2XY5A 1MA7A 4C7ZA 3RB4A 5J2EA 3RFAA 5DB9A 1NK4A 2KIVA 1WG8A 7ICLA 1LVHA 2ZJ8A 1TAUA 2XGPA 1K1SA 5B66U 3JPPA 5CP2A 2ISPA 4BXOA 4UW9A 4YG2A 2ISOA 1LB2B 4F4ZA 4I2GA 4U6PA 3HKZF 2BZFA 4F2RA 4PL1A 5CWRA 2QARA 2WAQF 5ALIA 5DB7A 2F8KA 4HYKA 1FEZA 4U7CA 3WKEA 4KLLA 3I76A 4JUZA 1S9FA 3N7RC 4F5OA 4CCHA 3IG8A 2VA8A 1SKWA 1Z3EB 1SL2A 2MUTB 4QWAA 3IDWA 4CF4A 2W03A 5ALXA 3NVYA 3BS5B 3QYPA 5EOZA 4J9OA 3N4MB 2ASLA 4M9HA 4DFPA 3CW2C 3PV8A 2JHDA 4DLGA 5IIMA 3M9OB 8ICHA 2VJ4A 3QX7A 5DG7A 9ICBA 1RPLA 4F71A 2LYHA 3IG5A 1PUZA 3V7JA 1XO1A 4YD1A 4Y2JA 9ICRA 4J9LA 1NK6A 2H3FA 2D8CA 2BHNA 4K4HA 2AHOB 5EWEA 4DSLA 3ETRA 5CEHA 4O9MA 2YB1A 5DQGA 3AU2A 3KHRA 1OUQA 1SXEA 1UT8A 5DGBA 1KRPA 4EBDA 4KLTA 5ALZA 1KFDA 2HHVA 2K60A 3PVXA 2BPCA 1UCVA 2ALZA 1NJZA 4OJ6A 1PK1A 3Q8PB 9ICQA 2W9CA 4C8OA 2H3ZA 3CRXA 1A76A 7ICEA 3JPQA 2JZBA 4P0PB 2DKXA 1COKA 4JB3A 7ICNA 2LPEA 4ED6A 2AJQA 4EX6A 4KLQA 1AROP 1DGJA 2KN7A 1ZQJA 2JH1A 5F9NA 2DL0A 3MBYA 5G5GA 4YXJA 5L1MA 2MAXA 3LWMA 1U9LA 3WK6A 3SR6A 4R8UB 4AP9A 5ALYA 1A77A 4J9NA 3KFUF 1D9DA 3ZDBA 4JK1A 2AGQA 1Z00A 5FP0A 4ECQA 1QQ5A 2HBMA 4ED7A 2B21A 2LBOA 3GFKB 2CN1A 4GXJA 2W7OA 2LHTA 3AU6A 2OHFA 4RQ6A 1BPEA 1X42A 4G3IA 2KZ3A 3UMBA 1N61A 1QLNA 2G06A 1B43A 1UA1A 4F5NA 5C5JA 1FFVA 1Q3UA 5ALLA 1XO0A 1BPXA 4B9UA 3NRZA 9ICXA 2FPLA 1XSNA 1XSLA 4LVSA 5AKZA 2ZIXB 2KSOB 1X9SA 3HRDD 1N5WA 1PVPA 1B22A 2HBLA 5AK6A 1MQ3A 3Q8MA 4LJXA 3TADC 1KTQA 3SMVA 3T5HA 1KW4A 2ASJA 3TANA 4TQRA 2KFNA 4JV2A 2DGZA 4QZFA 2G5HB 5KFUA 4IS7A 3WK9A 3WK5A 4Y2XA 5CHGA 5J0YA 5CR0A 1ZQCA 4YD2A 4F5QA 4RNNA 3NS1A 4J9QA 4F2SA 3BZCA 2E1EA 4PPXA 1ZXIA 3T5LA 1XWLA 3KKAA 3WKCA 2KV2A 1L8LA 3QUBA 2V4QA 5KG1A 4KLOA 5DBCA 4F4YA 3IV6A 1P7DA 2EZYA 2WF7A 3WK4A 9ICTA 2IMWP 1NNLA 5KT6A 4FS1A 1RYRA 4RQNA 1WUDA 1S0NA 2MSNA 2F2AB 3TQ1A 1TV9A 4YN4A 3FM9A 4F3OA 4P2HA 2I5HA 2VKQA 4NXZA 1ZD5A 4RPXA 4K4IA 2KVCA 2WFAA 3RJKA 2RLTA 2GH1A 2ZG6A 1DOQA 3GV5B 5AKEA 1U4BA 2WHEA
chains in the Genus database with same CATH topology
4YMNA 4IQTA 3RH5A 3RJHA 4ZH4A 5KFTA 4RQ2A 3RAQA 5KFFA 4ECUA 3C5GA 3RR8A 9ICKA 5KG2A 5DB8A 1U48A 1TKDA 2BPGA 2P6RA 3MGIA 1BGXT 3UXOA 4J9PA 1JXEA 1XU4A 3JPNA 3MR3A 4I29A 3C21A 1JXLA 4BDPA 7ICGA 2FLPA 4UAZA 1RXWA 4B9TA 1DGSA 2BQ3A 4RPYA 3H4BA 4O0IA 4R63A 2I9GA 4QZGA 4MFCA 4DFMA 5J2BA 4TURA 3HP6A 8ICAA 4YCXA 1SL0A 2ZJAA 1L3SA 4R65A 8ICRA 3RJJA 1IM4A 5J2GA 3MABA 1S10A 1HUOA 4I2BA 1ZQOA 4EYHB 4QZAA 2BCQA 5D4BA 1ZQPA 5J0SA 4KN7A 1TVAA 3UQ0A 3GDXA 4DL6A 2IHNA 4F4XA 4Q43A 3Q8KA 1NK9A 4BGDA 1KDHA 2PFPA 9ICMA 5J0WA 4RQ3A 4I2EA 4O5KA 1TK5A 5HHIA 2AGPA 1KEJA 1S0OA 4YMMA 4Q45A 4I27A 4QWDA 5IIJA 3UXNA 5KFPA 2R8IA 3C2LA 2AQ4A 1D9FA 4KLMA 8ICEA 3MFIA 9ICNA 7ICSA 4IR1A 2NRTA 2BQUA 3FYHA 2ZTEA 4QZIA 2P6UA 4F93B 4ED3A 8ICBA 2HHTA 4DO9A 4EYIB 4BXOB 4XA5A 1ZQUA 1ZJNA 3K4GA 3MFHA 3ZDAA 3M8SA 4DQRA 2NRVA 3TAPA 4EZ6A 5EWGA 1ZETA 5DKWA 2FMQA 3M9NB 3SI8A 4UBCA 3RBDA 1NJXA 1X2IA 2A1JA 9ICEA 5IIKA 4RQ1A 1UT5A 2RDJA 3GV7B 2DFLA 4QZ9A 3TFSA 3GIKA 2ZUBA 2BCSA 1LV5A 2FLLA 4DSJA 3EZ5A 4DL4A 2F1JA 2XY7A 2Y1JA 4I2HA 4PH5A 3MDCA 3H4DA 3QZ8A 4Q44A 5L1IA 5BPCA 4I2DA 7ICJA 3PX4A 3RH6A 1XSPA 5DBAA 5DG8A 4KLFA 2HHXA 4PHPA 1KFTA 5KFBA 4QWEA 4KLHA 2M9NA 5KFRA 4YFKA 4NY8A 3UXPA 4DS5A 5KFQA 3OSNA 3ISCA 8ICTA 4ECYA 2R8HA 5KG6A 4JWNA 2I1QA 2A1JB 5BOLA 3MR6A 4EBEA 3JPSA 5KT3A 1RXVA 2WTFA 2UVVA 4UB1A 4RUCA 3M8RA 1T3NA 3H40A 9ICUA 1S77D 7ICFA 1NOMA 3MR2A 4C8KA 2ZTDA 5KT2A 4RT2A 2FLNA 1ZQDA 4KLDA 2KZZA 4GXKA 4UB5A 2HHQA 3ISBA 4M9LA 3B0YA 1JMSA 1MC8A 4DFKA 7ICVA 1QSYA 9ICCA 3B0XA 4FO6A 5KG5A 3T5KA 5DQIA 4RT3A 4C8LA 4B9SA 4I28A 4FBUA 4BWJA 4QZBA 4X5VA 3OSPA 4NLKA 9ICWA 8ICKA 1U49A 5DB6A 1JX4A 2UVRA 2C22A 3V72A 4RU9A 4Z6FA 1XC9A 2R8GA 3RRGA 2FPKA 7ICIA 4DWIA 1RYSA 3RRHA 1JN3A 5KTQA 1ZQKA 3MR5A 1SZPA 4RQ0A 3N97B 5J2CA 4DS4A 2JEIA 7ICOA 3HPOA 3BQ2A 1KFSA 4YP3A 3Q8LA 3QE9Y 3HT3A 7ICMA 2R8KA 1ZQXA 5DDMA 3T5JA 4DF4A 3OHBA 3KHHA 4KLEA 8ICXA 3EW9A 1ZQSA 8ICWA 1EXNA 3Q8QB 3RB0A 4F50A 3HWTA 1ZQWA 2DPIA 1U47A 2C28A 5L9XA 1L3UA 2HVIA 4O3NA 4RZRA 1X9MA 2XY5A 1ZQEA 4YR2A 4KLUA 3BQ0A 3RB4A 5J2EA 3GQCA 5DB9A 1NK4A 1ZQZA 4RQ5A 7ICLA 4UQGA 2HHSA 8ICQA 4XUSA 5KT7A 4DOBA 4ECVA 5HP4A 5EWFA 5DLGA 2KZMA 2JEJA 2ZJ8A 4GLXA 4B9NA 1TAUA 5CJ7A 1ZQLA 4PHAA 1S76D 5IILA 5TZVA 1IXRA 2XGPA 4I2IA 5KFLA 1K1SA 3JPPA 4M04A 1KSPA 1NK7A 5CP2A 2R8JA 3C23A 9ICSA 5KFKA 4F8RA 4IRCA 2ISPA 4BXOA 3UPQA 3RR7A 9ICGA 1BPBA 7ICUA 3OHAA 2W9BB 4YG2A 1RZTA 2ISOA 1HJPA 1LB2B 4XRHA 4F4ZA 4O3PA 5J2AA 1ZQBA 4I2GA 4KLGA 3SZ2A 4RNOA 4F2RA 5CWRA 4DOAA 4DQPA 4ELUA 1NJYA 4PGQA 4Q8EA 5DB7A 3G6XA 3ZDEA 2IHMA 4O5EA 4O3QA 5J0XA 4HYKA 2PFQA 4IR9A 5KFJA 1KLNA 3BDPA 4GXIA 5KT4A 2OWOA 4KLLA 2NRWA 2UVUA 4JUZA 2AGOA 1SL1A 8ICFA 4UB4A 1ZQMA 1BVSA 1S9FA 4DSEA 4Z6EA 5DGAA 7ICRA 2HHUA 7ICTA 4F5OA 4CCHA 1X9WA 2VA8A 1SKWA 1XS9D 1Z3EB 4C8NA 4KLIA 4F4WA 1SL2A 2MUTB 5DDYA 4QWAA 2W9MA 3EYZA 2IBKA 4KITB 1ZQNA 3V6HA 2KFZA 5J2KA 5EOZA 4J9OA 4EBCA 4YVZA 3N4MB 1QSLA 1S0VA 2ASLA 3TAQA 4M9HA 2PFNA 4DFPA 4O3RA 3PV8A 5IIIA 1SKSA 1Z00B 3RJEA 4B9LA 4DLGA 5IIMA 3M9OB 5KFMA 4DFJA 2KTQA 8ICHA 4QZ8A 4TUSA 2HHWA 3NTUA 2BKEA 4ELTA 4GC7A 5DG7A 9ICBA 8ICGA 1RPLA 2LYHA 4PHEA 3RB3A 3V7JA 1QSSA 4M2YA 1XO1A 2BCRA 4YD1A 4O3SA 4F5RA 2P66A 3ISDA 9ICRA 4UB2A 5J0UA 4J9LA 1NK6A 3E2EA 2PI5A 2XC9A 8ICVA 3GIMA 3V6KA 4M9JA 2BCUA 2BHNA 4P4PA 1N56A 4QZHA 1ZYQA 4K4HA 8ICCA 4QW8A 5EWEA 2BCVA 4DSLA 4QZCA 5J2IA 3RAXA 3HX0A 4QW9A 4O9MA 2V9WA 3PW5A 3FDSA 3PR5B 4I2JA 5DQGA 2FPMA 3ZDDA 3AU2A 2PXIA 4MF2A 4ECRA 4M0AA 3KHRA 4EZ9A 1UT8A 2JEGA 5J2JA 2HW3A 5DGBA 9ICIA 1KRPA 5HHHA 3ETLA 3JPOA 4EBDA 5L1JA 4KLTA 1WCNA 3PX0A 3QZ7A 3C1ZA 1KFDA 2HHVA 3PVXA 3PW2A 4P4MA 2BPCA 2H5XA 4RPZA 8ICOA 2ALZA 3NGDA 5DG9A 3SV3A 1NJZA 2J6TA 5KFXA 5J2FA 3Q8PB 4I2AA 4KMUA 9ICQA 2W9CA 4PHDA 4C8OA 3PMNA 5L1LA 4O5CA 3OJUA 4Z6CA 1A76A 5BOMA 3KHLA 1U45A 3PR4A 7ICEA 4YR0A 1TK0A 4BWMA 3JPQA 5DLFA 4I2FA 2JZBA 4UB3A 3V7LA 3Q8RB 2VA3A 9ICHA 2Q0ZX 3PW7A 3BQ1A 3RH4A 7ICNA 1ZQGA 4ED6A 5KFOA 4R8UA 4DL5A 2W9BA 1COOA 5KFHA 2AJQA 4KLQA 4DLEA 1AROP 3QEAZ 1QTMA 4MFAA 2KN7A 5DQHA 5KFWA 5KG7A 4O3OA 1ZQJA 4DF8A 4M6WB 1L5UA 4DSIA 4DEZA 4NM2A 1ZQTA 1T7PA 2PI4A 2C2EA 1L3TA 5F9NA 5KG3A 4FBTA 3V7KA 4ELVA 2NRXA 2XCPA 1MQ2A 3MBYA 2BR0A 2W9CB 3PNCA 8ICNA 4YXJA 1T8EA 2DPJA 3RJFA 2MAXA 3BQTA 3BJYA 4DL2A 9ICOA 4R64A 3SV4A 3RBEA 9ICJA 3LWMA 4EEYA 4UAYA 2JZBB 1K1QA 8ICSA 2RDIA 2F1IA 4M9GA 1WCLA 5KFIA 2W8KA 1TK8A 4KLSA 1U9LA 2MUTA 4R8UB 4UBBA 3LWLA 8ICJA 1ZQRA 4QZEA 5HMLA 1A77A 4YQWA 3PY8A 4Q8FA 3H8SA 4F91B 4RNMA 4J9NA 4JV1A 5KFYA 3H8JA 5KFZA 5J2DA 4NLGA 4E0DA 7ICPA 1D9DA 3TI0A 1SKRA 4IQVA 4XQ8A 1NK8A 8ICMA 2BDPA 3ZDBA 4LZGA 4JK1A 5KG0A 3LK9A 3MDAA 5KG4A 2AGQA 7ICHA 2XGQA 2ATLA 3OGUA 1Z00A 4ECQA 1ZQIA 3MGHA 4MFFA 4ED7A 2B21A 4R66A 1JIHA 2IA6A 3GFKB 4NM1A 3G6VA 2FMSA 4MEYA 2W9AA 4J9RA 3TFRA 1BPYA 3C5FA 3GV8B 4ECTA 2XO7A 4GXJA 4DL7A 3AU6A 1NJWA 3RJIA 4F4KA 3JPTA 3G6YA 4RQ6A 1BPEA 9ICPA 4G3IA 4NLNA 4DQSA 3V6JA 5F9LA 1V9PA 2KZ3A 2BQRA 4IRKA 1D8LA 4ED2A 3PX6A 4K4GA 1MSWD 2BGWA 1QLNA 9ICFA 2JEFA 1B43A 4B9VA 1CEZA 4ECWA 1UA1A 1NKCA 3H7IA 1NK5A 5IINA 4F5NA 2V4RA 5C5JA 1BPDA 4PGYA 1BPXA 3C2MA 4QZDA 4B9UA 2AU0A 2ZJ5A 9ICXA 5J0TA 2FPLA 1XSNA 1XSLA 4LVSA 1N48A 3PW0A 4I2CA 1UA0A 2NRZA 1X9SA 1Y88A 5KFGA 3H8WA 4ECXA 3AUOA 2ASDA 4LZDA 4KN4A 5J29A 2ZUCA 1B22A 4YMOA 3T3FA 1MQ3A 3KTQA 4GC6A 1S0MA 3Q8MA 3ORYA 4JWMA 3PO5A 1KTQA 5CB1A 3T5HA 1BPZA 2AQ0A 9ICAA 3K75D 3RB6A 2ASJA 4RUAA 3GIIA 3TANA 4P4OA 3IM1A 4JV0A 2ZUDA 4TQRA 5J2HA 3ZD8A 4FS2A 1C7YA 4JV2A 2KFNA 4ED1A 9ICLA 8ICIA 4QZFA 5L1KA 2Y1IA 5KT5A 5KFUA 4RQ7A 3TARA 4M47A 4NLZA 4B9MA 4DSFA 3M9MB 8ICPA 8ICZA 5KFCA 3Q8SB 1ZQQA 1ZQAA 3OJSA 2XCAA 2F1HA 5KFDA 5CHGA 3ZDCA 3LDAA 1T4GA 5J0YA 4RQ8A 5CR0A 3C1YA 2HVHA 1TFRA 1ZQCA 4YD2A 4RNNA 4M6WA 5J0QA 4F5QA 4YR3A 4ECZA 4J9QA 3ZD9A 4F2SA 4QWBA 1ZQFA 1ZQVA 1ZQHA 7ICKA 5JUMA 3SYZA 8ICUA 4TUPA 5HNKA 2BPFA 1TAQA 3EPIA 4IQWA 3EPGA 3QEBZ 2C2RA 4PPXA 4ED0A 3T5LA 3PO4A 1XWLA 4PGXA 3GIJA 5KFEA 4DL3A 4KTQA 1S97A 3UQ2A 4UAWA 2VA2A 2W8LA 3GILA 8ICYA 4TQSA 5D49A 3HW8A 2V4QA 4IQUA 1PZNA 4C8MA 4DQQA 1NKBA 4ED8A 5KG1A 3JPRA 4KLOA 2XY6A 5KFSA 5DBCA 3THVA 4F4YA 4RQ4A 3KHGA 5J0PA 4DSKA 4KLJA 4MF8A 1CUKA 2J6UA 4Z6DA 3RJGA 5HMMA 4M9NA 1ZJMA 2ZTCA 4IRDA 9ICTA 3PMLA 1D8YA 3IHQB 2IMWP 3EWAA 5KT6A 4FS1A 3RTVA 1RYRA 4J9MA 5J0OA 1HUZA 7ICQA 1S0NA 5J0RA 2J6SA 1ZQYA 5IIOA 3TQ1A 5D46A 1TV9A 4YXMA 3PW4A 4J9SA 5CA7A 4YN4A 4MEXA 4F3OA 5KFNA 4P2HA 1L3VA 1H38A 2VANA 4NXZA 2FMPA 9ICVA 4RPXA 1NK0A 8ICLA 4DOCA 4K4IA 4F5PA 5DBBA 2C2DA 4ECSA 3RJKA 4F92B 1NKEA 5KFAA 4J9KA 2GWSA 4DQIA 5KFVA 2UVWA 1DOQA 4QWCA 2PFOA 3GV5B 4TUQA 1U4BA 3C2KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YMN A;  4IQT A;  3RH5 A;  3RJH A;  4ZH4 A;  5KFT A;  4RQ2 A;  3RAQ A;  5KFF A;  4ECU A;  3C5G A;  3RR8 A;  9ICK A;  5KG2 A;  5DB8 A;  1U48 A;  1TKD A;  2BPG A;  2P6R A;  3MGI A;  1BGX T;  3UXO A;  4J9P A;  1JXE A;  1XU4 A;  3JPN A;  3MR3 A;  4I29 A;  3C21 A;  1JXL A;  4BDP A;  7ICG A;  2FLP A;  4UAZ A;  1RXW A;  4B9T A;  1DGS A;  2BQ3 A;  4RPY A;  3H4B A;  4O0I A;  4R63 A;  2I9G A;  4QZG A;  4MFC A;  4DFM A;  5J2B A;  4TUR A;  3HP6 A;  8ICA A;  4YCX A;  1SL0 A;  2ZJA A;  1L3S A;  4R65 A;  8ICR A;  3RJJ A;  1IM4 A;  5J2G A;  3MAB A;  1S10 A;  1HUO A;  4I2B A;  1ZQO A;  4EYH B;  4QZA A;  2BCQ A;  5D4B A;  1ZQP A;  5J0S A;  4KN7 A;  1TVA A;  3UQ0 A;  3GDX A;  4DL6 A;  2IHN A;  4F4X A;  4Q43 A;  3Q8K A;  1NK9 A;  4BGD A;  1KDH A;  2PFP A;  9ICM A;  5J0W A;  4RQ3 A;  4I2E A;  4O5K A;  1TK5 A;  5HHI A;  2AGP A;  1KEJ A;  1S0O A;  4YMM A;  4Q45 A;  4I27 A;  4QWD A;  5IIJ A;  3UXN A;  5KFP A;  2R8I A;  3C2L A;  2AQ4 A;  1D9F A;  4KLM A;  8ICE A;  3MFI A;  9ICN A;  7ICS A;  4IR1 A;  2NRT A;  2BQU A;  3FYH A;  2ZTE A;  4QZI A;  2P6U A;  4F93 B;  4ED3 A;  8ICB A;  2HHT A;  4DO9 A;  4EYI B;  4BXO B;  4XA5 A;  1ZQU A;  1ZJN A;  3K4G A;  3MFH A;  3ZDA A;  3M8S A;  4DQR A;  2NRV A;  3TAP A;  4EZ6 A;  5EWG A;  1ZET A;  5DKW A;  2FMQ A;  3M9N B;  3SI8 A;  4UBC A;  3RBD A;  1NJX A;  1X2I A;  2A1J A;  9ICE A;  5IIK A;  4RQ1 A;  1UT5 A;  2RDJ A;  3GV7 B;  2DFL A;  4QZ9 A;  3TFS A;  3GIK A;  2ZUB A;  2BCS A;  1LV5 A;  2FLL A;  4DSJ A;  3EZ5 A;  4DL4 A;  2F1J A;  2XY7 A;  2Y1J A;  4I2H A;  4PH5 A;  3MDC A;  3H4D A;  3QZ8 A;  4Q44 A;  5L1I A;  5BPC A;  4I2D A;  7ICJ A;  3PX4 A;  3RH6 A;  1XSP A;  5DBA A;  5DG8 A;  4KLF A;  2HHX A;  4PHP A;  1KFT A;  5KFB A;  4QWE A;  4KLH A;  2M9N A;  5KFR A;  4YFK A;  4NY8 A;  3UXP A;  4DS5 A;  5KFQ A;  3OSN A;  3ISC A;  8ICT A;  4ECY A;  2R8H A;  5KG6 A;  4JWN A;  2I1Q A;  2A1J B;  5BOL A;  3MR6 A;  4EBE A;  3JPS A;  5KT3 A;  1RXV A;  2WTF A;  2UVV A;  4UB1 A;  4RUC A;  3M8R A;  1T3N A;  3H40 A;  9ICU A;  1S77 D;  7ICF A;  1NOM A;  3MR2 A;  4C8K A;  2ZTD A;  5KT2 A;  4RT2 A;  2FLN A;  1ZQD A;  4KLD A;  2KZZ A;  4GXK A;  4UB5 A;  2HHQ A;  3ISB A;  4M9L A;  3B0Y A;  1JMS A;  1MC8 A;  4DFK A;  7ICV A;  1QSY A;  9ICC A;  3B0X A;  4FO6 A;  5KG5 A;  3T5K A;  5DQI A;  4RT3 A;  4C8L A;  4B9S A;  4I28 A;  4FBU A;  4BWJ A;  4QZB A;  4X5V A;  3OSP A;  4NLK A;  9ICW A;  8ICK A;  1U49 A;  5DB6 A;  1JX4 A;  2UVR A;  2C22 A;  3V72 A;  4RU9 A;  4Z6F A;  1XC9 A;  2R8G A;  3RRG A;  2FPK A;  7ICI A;  4DWI A;  1RYS A;  3RRH A;  1JN3 A;  5KTQ A;  1ZQK A;  3MR5 A;  1SZP A;  4RQ0 A;  3N97 B;  5J2C A;  4DS4 A;  2JEI A;  7ICO A;  3HPO A;  3BQ2 A;  1KFS A;  4YP3 A;  3Q8L A;  3QE9 Y;  3HT3 A;  7ICM A;  2R8K A;  1ZQX A;  5DDM A;  3T5J A;  4DF4 A;  3OHB A;  3KHH A;  4KLE A;  8ICX A;  3EW9 A;  1ZQS A;  8ICW A;  1EXN A;  3Q8Q B;  3RB0 A;  4F50 A;  3HWT A;  1ZQW A;  2DPI A;  1U47 A;  2C28 A;  5L9X A;  1L3U A;  2HVI A;  4O3N A;  4RZR A;  1X9M A;  2XY5 A;  1ZQE A;  4YR2 A;  4KLU A;  3BQ0 A;  3RB4 A;  5J2E A;  3GQC A;  5DB9 A;  1NK4 A;  1ZQZ A;  4RQ5 A;  7ICL A;  4UQG A;  2HHS A;  8ICQ A;  4XUS A;  5KT7 A;  4DOB A;  4ECV A;  5HP4 A;  5EWF A;  5DLG A;  2KZM A;  2JEJ A;  2ZJ8 A;  4GLX A;  4B9N A;  1TAU A;  5CJ7 A;  1ZQL A;  4PHA A;  1S76 D;  5IIL A;  5TZV A;  1IXR A;  2XGP A;  4I2I A;  5KFL A;  1K1S A;  3JPP A;  4M04 A;  1KSP A;  1NK7 A;  5CP2 A;  2R8J A;  3C23 A;  9ICS A;  5KFK A;  4F8R A;  4IRC A;  2ISP A;  4BXO A;  3UPQ A;  3RR7 A;  9ICG A;  1BPB A;  7ICU A;  3OHA A;  2W9B B;  4YG2 A;  1RZT A;  2ISO A;  1HJP A;  1LB2 B;  4XRH A;  4F4Z A;  4O3P A;  5J2A A;  1ZQB A;  4I2G A;  4KLG A;  3SZ2 A;  4RNO A;  4F2R A;  5CWR A;  4DOA A;  4DQP A;  4ELU A;  1NJY A;  4PGQ A;  4Q8E A;  5DB7 A;  3G6X A;  3ZDE A;  2IHM A;  4O5E A;  4O3Q A;  5J0X A;  4HYK A;  2PFQ A;  4IR9 A;  5KFJ A;  1KLN A;  3BDP A;  4GXI A;  5KT4 A;  2OWO A;  4KLL A;  2NRW A;  2UVU A;  4JUZ A;  2AGO A;  1SL1 A;  8ICF A;  4UB4 A;  1ZQM A;  1BVS A;  1S9F A;  4DSE A;  4Z6E A;  5DGA A;  7ICR A;  2HHU A;  7ICT A;  4F5O A;  4CCH A;  1X9W A;  2VA8 A;  1SKW A;  1XS9 D;  1Z3E B;  4C8N A;  4KLI A;  4F4W A;  1SL2 A;  2MUT B;  5DDY A;  4QWA A;  2W9M A;  3EYZ A;  2IBK A;  4KIT B;  1ZQN A;  3V6H A;  2KFZ A;  5J2K A;  5EOZ A;  4J9O A;  4EBC A;  4YVZ A;  3N4M B;  1QSL A;  1S0V A;  2ASL A;  3TAQ A;  4M9H A;  2PFN A;  4DFP A;  4O3R A;  3PV8 A;  5III A;  1SKS A;  1Z00 B;  3RJE A;  4B9L A;  4DLG A;  5IIM A;  3M9O B;  5KFM A;  4DFJ A;  2KTQ A;  8ICH A;  4QZ8 A;  4TUS A;  2HHW A;  3NTU A;  2BKE A;  4ELT A;  4GC7 A;  5DG7 A;  9ICB A;  8ICG A;  1RPL A;  2LYH A;  4PHE A;  3RB3 A;  3V7J A;  1QSS A;  4M2Y A;  1XO1 A;  2BCR A;  4YD1 A;  4O3S A;  4F5R A;  2P66 A;  3ISD A;  9ICR A;  4UB2 A;  5J0U A;  4J9L A;  1NK6 A;  3E2E A;  2PI5 A;  2XC9 A;  8ICV A;  3GIM A;  3V6K A;  4M9J A;  2BCU A;  2BHN A;  4P4P A;  1N56 A;  4QZH A;  1ZYQ A;  4K4H A;  8ICC A;  4QW8 A;  5EWE A;  2BCV A;  4DSL A;  4QZC A;  5J2I A;  3RAX A;  3HX0 A;  4QW9 A;  4O9M A;  2V9W A;  3PW5 A;  3FDS A;  3PR5 B;  4I2J A;  5DQG A;  2FPM A;  3ZDD A;  3AU2 A;  2PXI A;  4MF2 A;  4ECR A;  4M0A A;  3KHR A;  4EZ9 A;  1UT8 A;  2JEG A;  5J2J A;  2HW3 A;  5DGB A;  9ICI A;  1KRP A;  5HHH A;  3ETL A;  3JPO A;  4EBD A;  5L1J A;  4KLT A;  1WCN A;  3PX0 A;  3QZ7 A;  3C1Z A;  1KFD A;  2HHV A;  3PVX A;  3PW2 A;  4P4M A;  2BPC A;  2H5X A;  4RPZ A;  8ICO A;  2ALZ A;  3NGD A;  5DG9 A;  3SV3 A;  1NJZ A;  2J6T A;  5KFX A;  5J2F A;  3Q8P B;  4I2A A;  4KMU A;  9ICQ A;  2W9C A;  4PHD A;  4C8O A;  3PMN A;  5L1L A;  4O5C A;  3OJU A;  4Z6C A;  1A76 A;  5BOM A;  3KHL A;  1U45 A;  3PR4 A;  7ICE A;  4YR0 A;  1TK0 A;  4BWM A;  3JPQ A;  5DLF A;  4I2F A;  2JZB A;  4UB3 A;  3V7L A;  3Q8R B;  2VA3 A;  9ICH A;  2Q0Z X;  3PW7 A;  3BQ1 A;  3RH4 A;  7ICN A;  1ZQG A;  4ED6 A;  5KFO A;  4R8U A;  4DL5 A;  2W9B A;  1COO A;  5KFH A;  2AJQ A;  4KLQ A;  4DLE A;  1ARO P;  3QEA Z;  1QTM A;  4MFA A;  2KN7 A;  5DQH A;  5KFW A;  5KG7 A;  4O3O A;  1ZQJ A;  4DF8 A;  4M6W B;  1L5U A;  4DSI A;  4DEZ A;  4NM2 A;  1ZQT A;  1T7P A;  2PI4 A;  2C2E A;  1L3T A;  5F9N A;  5KG3 A;  4FBT A;  3V7K A;  4ELV A;  2NRX A;  2XCP A;  1MQ2 A;  3MBY A;  2BR0 A;  2W9C B;  3PNC A;  8ICN A;  4YXJ A;  1T8E A;  2DPJ A;  3RJF A;  2MAX A;  3BQT A;  3BJY A;  4DL2 A;  9ICO A;  4R64 A;  3SV4 A;  3RBE A;  9ICJ A;  3LWM A;  4EEY A;  4UAY A;  2JZB B;  1K1Q A;  8ICS A;  2RDI A;  2F1I A;  4M9G A;  1WCL A;  5KFI A;  2W8K A;  1TK8 A;  4KLS A;  1U9L A;  2MUT A;  4R8U B;  4UBB A;  3LWL A;  8ICJ A;  1ZQR A;  4QZE A;  5HML A;  1A77 A;  4YQW A;  3PY8 A;  4Q8F A;  3H8S A;  4F91 B;  4RNM A;  4J9N A;  4JV1 A;  5KFY A;  3H8J A;  5KFZ A;  5J2D A;  4NLG A;  4E0D A;  7ICP A;  1D9D A;  3TI0 A;  1SKR A;  4IQV A;  4XQ8 A;  1NK8 A;  8ICM A;  2BDP A;  3ZDB A;  4LZG A;  4JK1 A;  5KG0 A;  3LK9 A;  3MDA A;  5KG4 A;  2AGQ A;  7ICH A;  2XGQ A;  2ATL A;  3OGU A;  1Z00 A;  4ECQ A;  1ZQI A;  3MGH A;  4MFF A;  4ED7 A;  2B21 A;  4R66 A;  1JIH A;  2IA6 A;  3GFK B;  4NM1 A;  3G6V A;  2FMS A;  4MEY A;  2W9A A;  4J9R A;  3TFR A;  1BPY A;  3C5F A;  3GV8 B;  4ECT A;  2XO7 A;  4GXJ A;  4DL7 A;  3AU6 A;  1NJW A;  3RJI A;  4F4K A;  3JPT A;  3G6Y A;  4RQ6 A;  1BPE A;  9ICP A;  4G3I A;  4NLN A;  4DQS A;  3V6J A;  5F9L A;  1V9P A;  2KZ3 A;  2BQR A;  4IRK A;  1D8L A;  4ED2 A;  3PX6 A;  4K4G A;  1MSW D;  2BGW A;  1QLN A;  9ICF A;  2JEF A;  1B43 A;  4B9V A;  1CEZ A;  4ECW A;  1UA1 A;  1NKC A;  3H7I A;  1NK5 A;  5IIN A;  4F5N A;  2V4R A;  5C5J A;  1BPD A;  4PGY A;  1BPX A;  3C2M A;  4QZD A;  4B9U A;  2AU0 A;  2ZJ5 A;  9ICX A;  5J0T A;  2FPL A;  1XSN A;  1XSL A;  4LVS A;  1N48 A;  3PW0 A;  4I2C A;  1UA0 A;  2NRZ A;  1X9S A;  1Y88 A;  5KFG A;  3H8W A;  4ECX A;  3AUO A;  2ASD A;  4LZD A;  4KN4 A;  5J29 A;  2ZUC A;  1B22 A;  4YMO A;  3T3F A;  1MQ3 A;  3KTQ A;  4GC6 A;  1S0M A;  3Q8M A;  3ORY A;  4JWM A;  3PO5 A;  1KTQ A;  5CB1 A;  3T5H A;  1BPZ A;  2AQ0 A;  9ICA A;  3K75 D;  3RB6 A;  2ASJ A;  4RUA A;  3GII A;  3TAN A;  4P4O A;  3IM1 A;  4JV0 A;  2ZUD A;  4TQR A;  5J2H A;  3ZD8 A;  4FS2 A;  1C7Y A;  4JV2 A;  2KFN A;  4ED1 A;  9ICL A;  8ICI A;  4QZF A;  5L1K A;  2Y1I A;  5KT5 A;  5KFU A;  4RQ7 A;  3TAR A;  4M47 A;  4NLZ A;  4B9M A;  4DSF A;  3M9M B;  8ICP A;  8ICZ A;  5KFC A;  3Q8S B;  1ZQQ A;  1ZQA A;  3OJS A;  2XCA A;  2F1H A;  5KFD A;  5CHG A;  3ZDC A;  3LDA A;  1T4G A;  5J0Y A;  4RQ8 A;  5CR0 A;  3C1Y A;  2HVH A;  1TFR A;  1ZQC A;  4YD2 A;  4RNN A;  4M6W A;  5J0Q A;  4F5Q A;  4YR3 A;  4ECZ A;  4J9Q A;  3ZD9 A;  4F2S A;  4QWB A;  1ZQF A;  1ZQV A;  1ZQH A;  7ICK A;  5JUM A;  3SYZ A;  8ICU A;  4TUP A;  5HNK A;  2BPF A;  1TAQ A;  3EPI A;  4IQW A;  3EPG A;  3QEB Z;  2C2R A;  4PPX A;  4ED0 A;  3T5L A;  3PO4 A;  1XWL A;  4PGX A;  3GIJ A;  5KFE A;  4DL3 A;  4KTQ A;  1S97 A;  3UQ2 A;  4UAW A;  2VA2 A;  2W8L A;  3GIL A;  8ICY A;  4TQS A;  5D49 A;  3HW8 A;  2V4Q A;  4IQU A;  1PZN A;  4C8M A;  4DQQ A;  1NKB A;  4ED8 A;  5KG1 A;  3JPR A;  4KLO A;  2XY6 A;  5KFS A;  5DBC A;  3THV A;  4F4Y A;  4RQ4 A;  3KHG A;  5J0P A;  4DSK A;  4KLJ A;  4MF8 A;  1CUK A;  2J6U A;  4Z6D A;  3RJG A;  5HMM A;  4M9N A;  1ZJM A;  2ZTC A;  4IRD A;  9ICT A;  3PML A;  1D8Y A;  3IHQ B;  2IMW P;  3EWA A;  5KT6 A;  4FS1 A;  3RTV A;  1RYR A;  4J9M A;  5J0O A;  1HUZ A;  7ICQ A;  1S0N A;  5J0R A;  2J6S A;  1ZQY A;  5IIO A;  3TQ1 A;  5D46 A;  1TV9 A;  4YXM A;  3PW4 A;  4J9S A;  5CA7 A;  4YN4 A;  4MEX A;  4F3O A;  5KFN A;  4P2H A;  1L3V A;  1H38 A;  2VAN A;  4NXZ A;  2FMP A;  9ICV A;  4RPX A;  1NK0 A;  8ICL A;  4DOC A;  4K4I A;  4F5P A;  5DBB A;  2C2D A;  4ECS A;  3RJK A;  4F92 B;  1NKE A;  5KFA A;  4J9K A;  2GWS A;  4DQI A;  5KFV A;  2UVW A;  1DOQ A;  4QWC A;  2PFO A;  3GV5 B;  4TUQ A;  1U4B A;  3C2K A; 
#chains in the Genus database with same CATH topology
 4IQT A;  3C29 A;  2K8A A;  3RAQ A;  4ECU A;  9ICK A;  5AKI A;  1TKD A;  2MA1 A;  2RHF A;  2DBY A;  2Y0S F;  3VCB A;  4J9P A;  1JXE A;  2IOF K;  2EH9 A;  3WK7 A;  3DEE A;  2MU2 A;  2XVT A;  1OXJ A;  4B9T A;  5ALK A;  2BQ3 A;  4RPY A;  4MFC A;  4QZG A;  4DFM A;  2EAO A;  3HP6 A;  4YCX A;  2ZJA A;  4R65 A;  8ICR A;  1IM4 A;  1S10 A;  3MAB A;  1HUO A;  1VJ5 A;  4EYH B;  2RP5 A;  5AI6 A;  2BCQ A;  1ZD2 P;  4UAR A;  3GDX A;  5ALU A;  3NVW A;  2NV3 A;  5J0W A;  4I2E A;  2GO7 A;  5HHI A;  1KEJ A;  4I27 A;  4YMM A;  2OXO A;  5IIJ A;  4QWD A;  1D9F A;  4QZI A;  8ICB A;  4EYI B;  4XA5 A;  5AKY A;  2W7P A;  5ALH A;  2D6F C;  5DKW A;  3SI8 A;  2A1A A;  1KBU A;  2A1J A;  9ICE A;  4UAV A;  2DUY A;  2BCS A;  2FLL A;  3EZ5 A;  4Y2Y A;  1JAL A;  2F1J A;  4NWI A;  4I2H A;  1SZH A;  3H4D A;  1L7P A;  2B0C A;  3MDC A;  1JUD A;  2QLT A;  2K8C B;  1Z4N A;  5EE1 A;  2YML A;  4KLF A;  3OTQ A;  3WU2 U;  1KFT A;  5KFQ A;  2OYY A;  3MR6 A;  5BOL A;  2CXY A;  3M8R A;  3H40 A;  3CNH A;  4FFD A;  4OJP A;  7ICF A;  3MR2 A;  3QUQ A;  3CP8 A;  4UB5 A;  2ZIV B;  2KMD A;  4QIW C;  1QSY A;  2Z7J A;  9ICC A;  3T5K A;  4QZB A;  1VLB A;  9ICW A;  3OSP A;  1NZB A;  3V72 A;  1RQL A;  4Z6F A;  1F44 A;  2YMQ A;  4UAS A;  3MR5 A;  4NLB A;  1SZP A;  4DS4 A;  1ZOL A;  3Q8L A;  1PVR A;  3QE9 Y;  1C20 A;  1ZQX A;  3BS7 A;  5ALO A;  4DF4 A;  3OHB A;  4KLE A;  3WK8 A;  3EW9 A;  3RB0 A;  3HWT A;  2C28 A;  4RZR A;  3FAH A;  1X9M A;  5ALN A;  4KLU A;  4RQ5 A;  3FC4 A;  3NVZ A;  4UQG A;  2HHS A;  8ICQ A;  4DOB A;  4ECV A;  5HP4 A;  2EAM A;  3EUB 2;  2E5S A;  3R9K A;  1NK7 A;  2R8J A;  9ICS A;  1ZD3 A;  5T14 A;  3AQE A;  3N7P D;  4UAT A;  3UPQ A;  7ICU A;  2W9B B;  4XRH A;  1ZQB A;  3SZ2 A;  3BS5 A;  4RNO A;  4DQP A;  4ELU A;  1IG6 A;  4PGQ A;  2KG5 A;  3F5A A;  4CF5 A;  4O3Q A;  4IR9 A;  1SV0 A;  5KAI U;  4GXI A;  2OWO A;  1N60 A;  3NAS A;  1BVS A;  4Z6E A;  5C0Y A;  2HHU A;  7ICT A;  2KJ5 A;  2KP7 A;  2ZIU B;  2KK0 A;  2F77 X;  2WF5 A;  2K8B B;  2VJ5 A;  5J2K A;  5J8Y A;  5GTI U;  3D2Q A;  4YVZ A;  1S0V A;  2RRD A;  4O3R A;  3IN5 A;  2QKQ A;  2ZXH A;  1SKS A;  3RJE A;  4B9L A;  2KTQ A;  4DFJ A;  2HHW A;  3PSI A;  8ICG A;  1X6I A;  1A0P A;  2ESE A;  5ALR A;  3ISD A;  2E8P A;  3E2E A;  4QNL A;  2BCU A;  4QZH A;  1ZYQ A;  4QZC A;  5J2I A;  2V9W A;  2KJ9 A;  3PW5 A;  1ZRM A;  4C0Z A;  2PXI A;  4ECR A;  4M0A A;  4P0P A;  2ES6 A;  5J2J A;  5HHH A;  3ETL A;  4O3M A;  5AIA A;  3QZ7 A;  3HJE A;  5A0L A;  3PW2 A;  4OD0 A;  5TIS U;  3NGD A;  5H2F U;  2J6T A;  4CF3 A;  3KKA C;  1U45 A;  4BUG A;  3PR4 A;  4YR0 A;  4I2F A;  1N63 A;  5HR7 A;  3BQ1 A;  2W54 A;  3RH4 A;  5KFO A;  4R8U A;  1COO A;  2LYA A;  4DLE A;  4MFA A;  5DQH A;  5KFW A;  1RQN A;  4NM2 A;  1ZQT A;  2PI4 A;  4MHV A;  3SAG A;  4ELV A;  2NRX A;  8ICN A;  1Z1B A;  5AI0 A;  3BJY A;  4R64 A;  3RBE A;  4EEY A;  4USA A;  5AI4 A;  3M6Z A;  1TK8 A;  2W8K A;  1UHU A;  3LWL A;  5HML A;  4F91 B;  5KFY A;  3H8J A;  5KFZ A;  7ICP A;  2DQN B;  1T3Q A;  1SKR A;  1YZ7 A;  4XQ8 A;  4US8 A;  2BDP A;  3MDA A;  5KG4 A;  2ATL A;  1UPH A;  3MGH A;  5HR6 A;  1JIH A;  2IA6 A;  3G6V A;  2AH5 A;  2KSO A;  3TFR A;  4J9R A;  1BPY A;  3GV8 B;  2HOF A;  2XO7 A;  1NJW A;  3RJI A;  5AM5 A;  4F4K A;  9ICP A;  3PST A;  4DQS A;  3V6J A;  4Y2V A;  3PX6 A;  1MSW D;  2BGW A;  9ICF A;  2E8O A;  3LVW A;  3F2D A;  2OEH A;  3H7I A;  4UB8 U;  2V4R A;  2YTU A;  4PGY A;  4QZD A;  4BJQ A;  2ZJ5 A;  2LI6 A;  2M0N A;  5J0T A;  5EE0 A;  2B6G A;  3PW0 A;  4I2C A;  2NRZ A;  3AUO A;  4LZD A;  4YMO A;  3T3F A;  4GC6 A;  4JMU A;  3UM9 A;  1S0M A;  3AM9 A;  3ORY A;  3NUQ A;  4Y2U A;  3PO5 A;  5CB1 A;  1BPZ A;  2AQ0 A;  4QJF B;  4FZN A;  1N5X A;  3GII A;  4P4O A;  4JV0 A;  4FS2 A;  3TAR A;  4RQ7 A;  1V85 A;  8ICP A;  2XCA A;  2F1H A;  5AM2 A;  3ZDC A;  3LDA A;  4NLC A;  1X66 A;  2HVH A;  4M6W A;  4ECZ A;  1ZQF A;  1ZQV A;  7ICK A;  3SYZ A;  8ICU A;  3EPI A;  4IQW A;  2LM1 A;  2FE9 A;  4UB6 U;  4PGX A;  1V38 A;  4NL9 A;  4DL3 A;  5AKK A;  5ALF A;  4UAW A;  2VA2 A;  3GIL A;  5AIB A;  5EE9 A;  2YB4 A;  4IQU A;  1NKB A;  3I28 A;  3JPR A;  2LMR A;  2XY6 A;  3THV A;  4RQ4 A;  4DSK A;  4KLJ A;  2QB0 B;  1ZJM A;  5AM1 A;  3PML A;  1D8Y A;  4Y2P A;  5J0O A;  3A0H U;  2A19 A;  4J9S A;  1B4F A;  5KFN A;  4ACO A;  1L3V A;  5ALW A;  1H38 A;  5AK4 A;  3SAF A;  2XIC A;  1RDF A;  4DOC A;  4F5P A;  5DBB A;  4F92 B;  2GWS A;  4DQI A;  5KFV A;  4QWC A;  3SEI A;  3SAH A;  3RJF A;  2YQE A;  3F53 A;  4YMN A;  3RJH A;  4RQ2 A;  5KFF A;  3C5G A;  2BPG A;  2P6R A;  1ZD4 A;  3UXO A;  1XU4 A;  4BDP A;  3MC1 A;  3KZX A;  3QU4 A;  2KHQ A;  4C4R A;  4QIW F;  1SL0 A;  2W11 A;  4I2B A;  2PMZ C;  4IC9 A;  4KN7 A;  3UQ0 A;  2VIX A;  2OM6 A;  4F4X A;  1SV0 C;  1S5L U;  3Q8K A;  1NK9 A;  4BGD A;  2PFP A;  9ICM A;  4RQ3 A;  3QU5 A;  1S0O A;  5KFP A;  9ICN A;  2Y9U A;  2ZTE A;  2P6U A;  4F93 B;  3LYS A;  4BXO B;  4RQM A;  2WF9 A;  3MFH A;  3M8S A;  2NRV A;  2KOB A;  3TAP A;  4C7Y A;  4EZ6 A;  1ZET A;  4IL6 U;  5J8Y C;  2WF8 A;  2HMX A;  1X2I A;  3QNM A;  2QAR B;  2H3V A;  3GV7 B;  3QU7 A;  1PK3 A;  4QZ9 A;  3GIK A;  1LV5 A;  4DSJ A;  5JRT A;  4PH5 A;  3QU2 A;  1URJ A;  4Q44 A;  5L1I A;  3RH6 A;  5F3X B;  2HCF A;  1NI3 A;  4PHP A;  5KFB A;  3SEN A;  4QWE A;  2M9N A;  4YFK A;  5AHX A;  4NY8 A;  3UXP A;  4DS5 A;  3S6J A;  2Q4T A;  3J81 j;  1RXV A;  3L5K A;  3JPS A;  5KT3 A;  2UVV A;  1T3N A;  3ONN A;  9ICU A;  4C4S A;  1V97 A;  4C8K A;  2ZTD A;  3TKA A;  1SWW A;  2HHQ A;  1X6J A;  4M9L A;  3B0Y A;  1QH9 A;  1JMS A;  1MC8 A;  2EAN A;  1SGG A;  2G5I B;  2WAQ C;  4RT3 A;  4B9S A;  4P0Q B;  4X5V A;  4KX3 A;  1XC9 A;  4DWI A;  5KTQ A;  1ZQK A;  4RQ0 A;  3N7S C;  3N97 B;  2JEI A;  2K4I A;  1HIW A;  1KFS A;  2K4P A;  3L4P A;  5DDM A;  2KKP A;  2IOF A;  4CGZ A;  1L3U A;  5L9X A;  1QQ7 A;  3TAC B;  1ZQE A;  1QQ6 A;  3KZI U;  1TAM A;  3GQC A;  1ZQZ A;  4EEK A;  3D2S A;  5K4L A;  5KT7 A;  2W55 A;  5EWF A;  1FO4 A;  4GLX A;  1HEK A;  5TZV A;  1LKY B;  3KBB A;  4M04 A;  1WWV A;  3C23 A;  5KFK A;  2AXT U;  4F8R A;  4IRC A;  9ICG A;  3RR7 A;  3OHA A;  1HJP A;  5J2A A;  3F5E A;  1IV8 A;  4Q8E A;  3G6X A;  2IHM A;  5JU5 A;  5J0X A;  3BDP A;  5KT4 A;  1SL1 A;  2AGO A;  4OJO A;  8ICF A;  4UB4 A;  1ZQM A;  1DXS A;  7ICR A;  3QUT A;  3OPX A;  3F2B A;  4KLI A;  4F4W A;  5DDY A;  2W9M A;  2IBK A;  2CRX A;  3V6H A;  2KFZ A;  3K1R B;  4EBC A;  2G08 A;  3TAQ A;  2PFN A;  2XID A;  5JTI A;  4J03 A;  1Z00 B;  4QZ8 A;  3NTU A;  2BKE A;  4ELT A;  4GC7 A;  2MRL A;  4PHE A;  3RB3 A;  1QSS A;  2P35 A;  4F5R A;  4OCZ A;  2XC9 A;  3GIM A;  4M9J A;  2HBK A;  1JRP A;  1N56 A;  2BCV A;  1VDV A;  3MGV A;  3HX0 A;  4QW9 A;  3FDS A;  4I2J A;  4EZ9 A;  2HW3 A;  9ICI A;  2HSZ A;  1SWV A;  4P4M A;  4RPZ A;  8ICO A;  5AI8 A;  3SV3 A;  1JRO A;  5KFX A;  5J2F A;  4I2A A;  4KMU A;  1D8B A;  4NL9 C;  1L6N A;  3PMN A;  5L1L A;  4CE6 A;  4O5C A;  3OJU A;  5BOM A;  3KHL A;  5AKJ A;  4BWM A;  2K4E A;  4UB3 A;  3V7L A;  9ICH A;  1B0X A;  2Q0Z X;  3PW7 A;  2JV3 A;  5KFH A;  5E79 U;  1QTM A;  4Y2Q A;  4DF8 A;  5AI9 A;  4US9 A;  4DEZ A;  1T7P A;  5KG3 A;  2F8L A;  2KJ8 A;  2XCP A;  3C28 A;  4UAU A;  3PNC A;  3IRU A;  2DPJ A;  4A8E A;  2YY6 A;  1L7O A;  3BQT A;  2ZIW B;  5KL8 B;  3SV4 A;  8ICS A;  4UAY A;  5AKG A;  2RDI A;  2F1I A;  2LKY A;  4HAI A;  1WCL A;  2MUT A;  4KMO B;  8ICJ A;  1ZQR A;  4RNM A;  2JH7 A;  3BZK A;  1TE2 A;  1Z19 A;  4NLG A;  4E0D A;  5CRX A;  3TI0 A;  4IQV A;  1NK8 A;  3CYM A;  8ICM A;  4LZG A;  2HBJ A;  5KG0 A;  4EX7 A;  3LK9 A;  7ICH A;  2W3R A;  4DFD A;  1ZQI A;  4MFF A;  1Q46 A;  4NM1 A;  2FMS A;  4MEY A;  3C5F A;  4AYB C;  3G6Y A;  4NLN A;  3N28 A;  5F9L A;  2BQR A;  4K4G A;  4ED2 A;  5ALM A;  4PJ0 U;  2JEF A;  2KD1 A;  4B9V A;  4ECW A;  1NKC A;  5IIN A;  1CRX A;  2K89 A;  1BPD A;  3C2M A;  3H0R B;  4C80 A;  4GIB A;  1Y88 A;  5KFG A;  3H8W A;  2ASD A;  2FJ6 A;  5J29 A;  4KN4 A;  3KTQ A;  4ZOH C;  3K1Z A;  9ICA A;  3K75 D;  3ZD8 A;  3AL0 B;  1C7Y A;  9ICL A;  8ICI A;  5L1K A;  5KT5 A;  4DSF A;  3M9M B;  4FE3 A;  5KFC A;  3Q8S B;  2JMG A;  3OJS A;  2G0A A;  1GO3 F;  3DV9 A;  4Y2S A;  5KFD A;  4DCC A;  3C1Y A;  2Y0S C;  2IOH A;  5J0Q A;  4YR3 A;  3ZD9 A;  1TAQ A;  3QEB Z;  3UMC A;  4ED0 A;  5KFE A;  1S97 A;  1JI7 A;  8ICY A;  3I1Y A;  4TQS A;  3HW8 A;  4C8M A;  4DQQ A;  3M6K A;  5KFS A;  2EZX A;  3KHG A;  2KE7 A;  5J0P A;  3AMZ A;  1CUK A;  4Z6D A;  4M9N A;  2D3D A;  3PSP A;  4IRD A;  2Y9T A;  4J9M A;  1WYG A;  2QB1 A;  1HUZ A;  2J6S A;  2NYV A;  3PW4 A;  1BNP A;  5CA7 A;  4MEX A;  1L7N A;  1O03 A;  1J97 A;  3M1Y A;  9ICV A;  3L3F X;  1NK0 A;  2O6K A;  2G07 A;  3GU3 A;  1X9X A;  1OW5 A;  2C2D A;  4ECS A;  3T79 A;  4J9K A;  5AI5 A;  2PFO A;  1KL9 A;  4TUQ A;  3C2K A;  2DKZ A;  5KFT A;  5KG2 A;  5DB8 A;  5AM4 A;  4OJ5 A;  3SD7 A;  3MGI A;  1BGX T;  3JPN A;  3MR3 A;  7ICG A;  3C21 A;  1JXL A;  2FLP A;  4UAZ A;  1RXW A;  1DGS A;  2W43 A;  2ZIX A;  4O0I A;  4R63 A;  2I9G A;  5J2B A;  8ICA A;  2H3Q A;  3RJJ A;  4QZA A;  5D4B A;  1ZQP A;  3H0M B;  4DL6 A;  1KDH A;  4O5K A;  1TK5 A;  4BX9 C;  1N2X A;  4Q45 A;  8ICE A;  2R8I A;  2AQ4 A;  7ICS A;  1ED1 A;  1J2M A;  2NRT A;  3FYH A;  4FZM A;  4DO9 A;  3K4G A;  4DQR A;  5EWG A;  2FMQ A;  3M9N B;  2KHV A;  4RQ1 A;  2RDJ A;  2DFL A;  2ZUB A;  4DL4 A;  5ALV A;  5AK5 A;  1RYU A;  5ALP A;  2EZZ A;  3GZF A;  4I2D A;  7ICJ A;  1SV4 A;  5DG8 A;  4P0Q A;  3PSF A;  2N1R A;  5AIC A;  3OSN A;  3ISC A;  8ICT A;  5KG6 A;  4JWN A;  2I1Q A;  2WTF A;  4UB1 A;  4RUC A;  2PKE A;  1NOM A;  5KT2 A;  2YMP A;  5AKX A;  4Y2R A;  4DFK A;  7ICV A;  5ALT A;  2KEY A;  2KNJ A;  4PZO A;  1AQ6 A;  4NJ8 A;  4BWJ A;  8ICK A;  1U49 A;  5DB6 A;  1A6S A;  2C22 A;  4RU9 A;  2R8G A;  3RRG A;  3RRH A;  2LYB A;  3LVV A;  5AM0 A;  3BQ2 A;  4YP3 A;  1LKY A;  3HT3 A;  2F3N A;  2I6X A;  2NO5 A;  1ZQS A;  3WKD A;  4EEN A;  4F50 A;  1ZQW A;  4YR2 A;  3O0F A;  3BQ0 A;  4F72 A;  2DF4 B;  3DDH A;  4XUS A;  4GFJ A;  5DLG A;  2KZM A;  2JEJ A;  3AQF A;  4CDG A;  4B9N A;  1ECW A;  5CJ7 A;  1ZQL A;  4PHA A;  1S76 D;  5IIL A;  1J2N A;  1IXR A;  4I2I A;  5KFL A;  1KSP A;  2WB1 C;  3B9J A;  1BPB A;  1YZ6 A;  1RZT A;  4O3P A;  4KLG A;  2FDR A;  4DOA A;  3ICX A;  1NJY A;  3NRW A;  2HOI A;  4WJ3 B;  2HDO A;  3ZDE A;  4O5E A;  2ODG A;  3WKB A;  2PFQ A;  3ZI4 A;  5KFJ A;  1KLN A;  2NRW A;  2UVU A;  4DSE A;  5DGA A;  1X9W A;  1XS9 D;  3KOO A;  4C8N A;  2ZXI A;  3EYZ A;  3PZP A;  4KIT B;  1ZQN A;  3E0F A;  1QSL A;  1X40 A;  1DK2 A;  5III A;  3QXG A;  2W3S A;  2ZIV A;  5KFM A;  4TUS A;  2F44 A;  3QU9 A;  2E8N A;  4M2Y A;  2BCR A;  4O3S A;  2P66 A;  5KAF U;  5B5E U;  4UB2 A;  5J0U A;  4EEL A;  2PI5 A;  8ICV A;  3V6K A;  1WWU A;  4P4P A;  8ICC A;  2E8M A;  2NO4 A;  3H8M A;  4QW8 A;  3RAX A;  4ICA A;  3PR5 B;  3ZDD A;  2FPM A;  2DWQ A;  4MF2 A;  4NV0 A;  2JEG A;  3JPO A;  1KN5 A;  5L1J A;  3HKZ C;  1WCN A;  3PX0 A;  2K4H A;  3C1Z A;  2H5X A;  2XI9 A;  4AYB F;  5DG9 A;  2KIW A;  2RQ5 A;  1SXD A;  1UQV A;  4PHD A;  1F0M A;  1DRG A;  4Z6C A;  1TK0 A;  2ZIW A;  5DLF A;  3Q8R B;  2VA3 A;  2KIC A;  5AK3 A;  1ZQG A;  4DL5 A;  2W9B A;  2W04 A;  3D2N A;  3QEA Z;  5KG7 A;  4O3O A;  4DSI A;  1L5U A;  4M6W B;  2C2E A;  1L3T A;  4FBT A;  3V7K A;  1PK1 B;  1MQ2 A;  2BR0 A;  3IP4 B;  2W9C B;  1T8E A;  5ALQ A;  4DL2 A;  9ICO A;  2E1F A;  9ICJ A;  2JZB B;  1K1Q A;  4M9G A;  2BDU A;  5KFI A;  4KLS A;  5ALS A;  2ZIU A;  4UBB A;  3PY8 A;  1RG6 A;  4QZE A;  4YQW A;  4Q8F A;  3H8S A;  4JV1 A;  5J2D A;  1MN8 A;  3QUC A;  2F76 X;  4PL2 A;  2XGQ A;  3OGU A;  1L8O A;  3UMG A;  1S8O A;  2E3T A;  4R66 A;  3D6J A;  2HI0 A;  2W9A A;  4ECT A;  2FI1 A;  4DL7 A;  2EAP A;  3JPT A;  5EE3 A;  1Q3V A;  1V9P A;  5AM3 A;  4IRK A;  1D8L A;  5KNI A;  4PZN A;  1CEZ A;  1NK5 A;  2GOL A;  5ALJ A;  1DK3 A;  2AU0 A;  1IIP A;  1N48 A;  1QCK A;  1UA0 A;  1FIQ A;  4ECX A;  2CPR A;  2ZUC A;  2OH2 A;  4JWM A;  1RM6 C;  3RB6 A;  4RUA A;  3IM1 A;  4Y2T A;  2ZUD A;  5J2H A;  2EDU A;  5AKH A;  4ED1 A;  2Y1I A;  4M47 A;  4NLZ A;  4B9M A;  2WF6 A;  8ICZ A;  1ZQQ A;  1ZQA A;  2YX8 A;  1T4G A;  4RQ8 A;  2OCE A;  3BQ7 A;  1TFR A;  2JGA A;  4KX5 A;  1FFU A;  2R18 A;  4QWB A;  4B6J A;  1ZQH A;  5JUM A;  4TUP A;  5AKL A;  5HNK A;  2BPF A;  3EPG A;  2C2R A;  1PVQ A;  3PO4 A;  3GIJ A;  3H0L B;  4KTQ A;  1L7M A;  3UQ2 A;  2W8L A;  2LM4 A;  5D49 A;  1PZN A;  4FZL A;  4ED8 A;  3M7D A;  1Z1V A;  1O08 A;  4MF8 A;  2J6U A;  3RJG A;  5HMM A;  1NZP A;  2JRZ A;  2ZTC A;  2L5Y A;  3IHQ B;  2H3I A;  3EWA A;  3RTV A;  3E58 A;  7ICQ A;  5J0R A;  1ZQY A;  5IIO A;  2HOQ A;  5D46 A;  4YXM A;  2YMM A;  5ALE A;  4G9B A;  1SB3 C;  2VAN A;  2FMP A;  8ICL A;  1T94 A;  3HIL A;  3ALR A;  1NKE A;  5KFA A;  1BNO A;  2UVW A;  1SIJ A;  3RH5 A;  4ZH4 A;  3KD3 A;  3RR8 A;  1U48 A;  4I29 A;  2EQY A;  4C4T A;  1YT3 A;  3H4B A;  4TUR A;  1L3S A;  2KVS A;  5J2G A;  5G5H A;  5GTH U;  1ZQO A;  3AEV A;  5J0S A;  1TVA A;  2IHN A;  3WKA A;  5ALG A;  4Q43 A;  3VC8 A;  4OO1 J;  2AGP A;  3UXN A;  3C2L A;  4KLM A;  3MFI A;  4IR1 A;  2BQU A;  4ED3 A;  2HHT A;  1N62 A;  1ZQU A;  1ZJN A;  3ZDA A;  1NJX A;  3RBD A;  4UBC A;  1XNS A;  4OJL A;  5IIK A;  1UT5 A;  3TAD A;  3TFS A;  2XY7 A;  2Y1J A;  4CNQ A;  2GLE A;  3QZ8 A;  5BPC A;  3PX4 A;  2KKV A;  3SQI A;  1XSP A;  5DBA A;  2WB1 F;  2HHX A;  4KLH A;  2QB0 A;  5KFR A;  3NVV A;  4ECY A;  2R8H A;  2YN4 A;  2A1J B;  4EBE A;  1ZRN A;  5ALD A;  3U26 A;  2PMZ F;  2JXJ A;  1S77 D;  4CRX A;  4RT2 A;  2FLN A;  4KLD A;  1ZQD A;  1M6Y A;  2KZZ A;  4GXK A;  3ISB A;  2G09 A;  3A0B U;  3ED5 A;  3B0X A;  1Z4O A;  4FO6 A;  5KG5 A;  4C8L A;  5DQI A;  4I28 A;  4FBU A;  5KL1 B;  4NLK A;  1JX4 A;  2UVR A;  1KKX A;  1CI4 A;  1K5O A;  7ICI A;  2FPK A;  3AN1 A;  1RYS A;  1JN3 A;  5J2C A;  3F2C A;  7ICO A;  1Q8K A;  3HPO A;  2JR5 A;  1KQQ A;  7ICM A;  2R8K A;  3T5J A;  3KHH A;  3RF9 A;  8ICX A;  2A3V A;  8ICW A;  1EXN A;  3Q8Q B;  1F5S A;  2DPI A;  1U47 A;  2HVI A;  4O3N A;  1ZQ1 C;  2XY5 A;  1MA7 A;  4C7Z A;  3RB4 A;  5J2E A;  3RFA A;  5DB9 A;  1NK4 A;  2KIV A;  1WG8 A;  7ICL A;  1LVH A;  2ZJ8 A;  1TAU A;  2XGP A;  1K1S A;  5B66 U;  3JPP A;  5CP2 A;  2ISP A;  4BXO A;  4UW9 A;  4YG2 A;  2ISO A;  1LB2 B;  4F4Z A;  4I2G A;  4U6P A;  3HKZ F;  2BZF A;  4F2R A;  4PL1 A;  5CWR A;  2QAR A;  2WAQ F;  5ALI A;  5DB7 A;  2F8K A;  4HYK A;  1FEZ A;  4U7C A;  3WKE A;  4KLL A;  3I76 A;  4JUZ A;  1S9F A;  3N7R C;  4F5O A;  4CCH A;  3IG8 A;  2VA8 A;  1SKW A;  1Z3E B;  1SL2 A;  2MUT B;  4QWA A;  3IDW A;  4CF4 A;  2W03 A;  5ALX A;  3NVY A;  3BS5 B;  3QYP A;  5EOZ A;  4J9O A;  3N4M B;  2ASL A;  4M9H A;  4DFP A;  3CW2 C;  3PV8 A;  2JHD A;  4DLG A;  5IIM A;  3M9O B;  8ICH A;  2VJ4 A;  3QX7 A;  5DG7 A;  9ICB A;  1RPL A;  4F71 A;  2LYH A;  3IG5 A;  1PUZ A;  3V7J A;  1XO1 A;  4YD1 A;  4Y2J A;  9ICR A;  4J9L A;  1NK6 A;  2H3F A;  2D8C A;  2BHN A;  4K4H A;  2AHO B;  5EWE A;  4DSL A;  3ETR A;  5CEH A;  4O9M A;  2YB1 A;  5DQG A;  3AU2 A;  3KHR A;  1OUQ A;  1SXE A;  1UT8 A;  5DGB A;  1KRP A;  4EBD A;  4KLT A;  5ALZ A;  1KFD A;  2HHV A;  2K60 A;  3PVX A;  2BPC A;  1UCV A;  2ALZ A;  1NJZ A;  4OJ6 A;  1PK1 A;  3Q8P B;  9ICQ A;  2W9C A;  4C8O A;  2H3Z A;  3CRX A;  1A76 A;  7ICE A;  3JPQ A;  2JZB A;  4P0P B;  2DKX A;  1COK A;  4JB3 A;  7ICN A;  2LPE A;  4ED6 A;  2AJQ A;  4EX6 A;  4KLQ A;  1ARO P;  1DGJ A;  2KN7 A;  1ZQJ A;  2JH1 A;  5F9N A;  2DL0 A;  3MBY A;  5G5G A;  4YXJ A;  5L1M A;  2MAX A;  3LWM A;  1U9L A;  3WK6 A;  3SR6 A;  4R8U B;  4AP9 A;  5ALY A;  1A77 A;  4J9N A;  3KFU F;  1D9D A;  3ZDB A;  4JK1 A;  2AGQ A;  1Z00 A;  5FP0 A;  4ECQ A;  1QQ5 A;  2HBM A;  4ED7 A;  2B21 A;  2LBO A;  3GFK B;  2CN1 A;  4GXJ A;  2W7O A;  2LHT A;  3AU6 A;  2OHF A;  4RQ6 A;  1BPE A;  1X42 A;  4G3I A;  2KZ3 A;  3UMB A;  1N61 A;  1QLN A;  2G06 A;  1B43 A;  1UA1 A;  4F5N A;  5C5J A;  1FFV A;  1Q3U A;  5ALL A;  1XO0 A;  1BPX A;  4B9U A;  3NRZ A;  9ICX A;  2FPL A;  1XSN A;  1XSL A;  4LVS A;  5AKZ A;  2ZIX B;  2KSO B;  1X9S A;  3HRD D;  1N5W A;  1PVP A;  1B22 A;  2HBL A;  5AK6 A;  1MQ3 A;  3Q8M A;  4LJX A;  3TAD C;  1KTQ A;  3SMV A;  3T5H A;  1KW4 A;  2ASJ A;  3TAN A;  4TQR A;  2KFN A;  4JV2 A;  2DGZ A;  4QZF A;  2G5H B;  5KFU A;  4IS7 A;  3WK9 A;  3WK5 A;  4Y2X A;  5CHG A;  5J0Y A;  5CR0 A;  1ZQC A;  4YD2 A;  4F5Q A;  4RNN A;  3NS1 A;  4J9Q A;  4F2S A;  3BZC A;  2E1E A;  4PPX A;  1ZXI A;  3T5L A;  1XWL A;  3KKA A;  3WKC A;  2KV2 A;  1L8L A;  3QUB A;  2V4Q A;  5KG1 A;  4KLO A;  5DBC A;  4F4Y A;  3IV6 A;  1P7D A;  2EZY A;  2WF7 A;  3WK4 A;  9ICT A;  2IMW P;  1NNL A;  5KT6 A;  4FS1 A;  1RYR A;  4RQN A;  1WUD A;  1S0N A;  2MSN A;  2F2A B;  3TQ1 A;  1TV9 A;  4YN4 A;  3FM9 A;  4F3O A;  4P2H A;  2I5H A;  2VKQ A;  4NXZ A;  1ZD5 A;  4RPX A;  4K4I A;  2KVC A;  2WFA A;  3RJK A;  2RLT A;  2GH1 A;  2ZG6 A;  1DOQ A;  3GV5 B;  5AKE A;  1U4B A;  2WHE A; 
#chains in the Genus database with same CATH homology
 4YMN A;  4IQT A;  3RH5 A;  3RJH A;  4ZH4 A;  5KFT A;  4RQ2 A;  3RAQ A;  5KFF A;  4ECU A;  3C5G A;  3RR8 A;  9ICK A;  5KG2 A;  5DB8 A;  1U48 A;  1TKD A;  2BPG A;  2P6R A;  3MGI A;  1BGX T;  3UXO A;  4J9P A;  1JXE A;  1XU4 A;  3JPN A;  3MR3 A;  4I29 A;  3C21 A;  1JXL A;  4BDP A;  7ICG A;  2FLP A;  4UAZ A;  1RXW A;  4B9T A;  1DGS A;  2BQ3 A;  4RPY A;  3H4B A;  4O0I A;  4R63 A;  2I9G A;  4QZG A;  4MFC A;  4DFM A;  5J2B A;  4TUR A;  3HP6 A;  8ICA A;  4YCX A;  1SL0 A;  2ZJA A;  1L3S A;  4R65 A;  8ICR A;  3RJJ A;  1IM4 A;  5J2G A;  3MAB A;  1S10 A;  1HUO A;  4I2B A;  1ZQO A;  4EYH B;  4QZA A;  2BCQ A;  5D4B A;  1ZQP A;  5J0S A;  4KN7 A;  1TVA A;  3UQ0 A;  3GDX A;  4DL6 A;  2IHN A;  4F4X A;  4Q43 A;  3Q8K A;  1NK9 A;  4BGD A;  1KDH A;  2PFP A;  9ICM A;  5J0W A;  4RQ3 A;  4I2E A;  4O5K A;  1TK5 A;  5HHI A;  2AGP A;  1KEJ A;  1S0O A;  4YMM A;  4Q45 A;  4I27 A;  4QWD A;  5IIJ A;  3UXN A;  5KFP A;  2R8I A;  3C2L A;  2AQ4 A;  1D9F A;  4KLM A;  8ICE A;  3MFI A;  9ICN A;  7ICS A;  4IR1 A;  2NRT A;  2BQU A;  3FYH A;  2ZTE A;  4QZI A;  2P6U A;  4F93 B;  4ED3 A;  8ICB A;  2HHT A;  4DO9 A;  4EYI B;  4BXO B;  4XA5 A;  1ZQU A;  1ZJN A;  3K4G A;  3MFH A;  3ZDA A;  3M8S A;  4DQR A;  2NRV A;  3TAP A;  4EZ6 A;  5EWG A;  1ZET A;  5DKW A;  2FMQ A;  3M9N B;  3SI8 A;  4UBC A;  3RBD A;  1NJX A;  1X2I A;  2A1J A;  9ICE A;  5IIK A;  4RQ1 A;  1UT5 A;  2RDJ A;  3GV7 B;  2DFL A;  4QZ9 A;  3TFS A;  3GIK A;  2ZUB A;  2BCS A;  1LV5 A;  2FLL A;  4DSJ A;  3EZ5 A;  4DL4 A;  2F1J A;  2XY7 A;  2Y1J A;  4I2H A;  4PH5 A;  3MDC A;  3H4D A;  3QZ8 A;  4Q44 A;  5L1I A;  5BPC A;  4I2D A;  7ICJ A;  3PX4 A;  3RH6 A;  1XSP A;  5DBA A;  5DG8 A;  4KLF A;  2HHX A;  4PHP A;  1KFT A;  5KFB A;  4QWE A;  4KLH A;  2M9N A;  5KFR A;  4YFK A;  4NY8 A;  3UXP A;  4DS5 A;  5KFQ A;  3OSN A;  3ISC A;  8ICT A;  4ECY A;  2R8H A;  5KG6 A;  4JWN A;  2I1Q A;  2A1J B;  5BOL A;  3MR6 A;  4EBE A;  3JPS A;  5KT3 A;  1RXV A;  2WTF A;  2UVV A;  4UB1 A;  4RUC A;  3M8R A;  1T3N A;  3H40 A;  9ICU A;  1S77 D;  7ICF A;  1NOM A;  3MR2 A;  4C8K A;  2ZTD A;  5KT2 A;  4RT2 A;  2FLN A;  1ZQD A;  4KLD A;  2KZZ A;  4GXK A;  4UB5 A;  2HHQ A;  3ISB A;  4M9L A;  3B0Y A;  1JMS A;  1MC8 A;  4DFK A;  7ICV A;  1QSY A;  9ICC A;  3B0X A;  4FO6 A;  5KG5 A;  3T5K A;  5DQI A;  4RT3 A;  4C8L A;  4B9S A;  4I28 A;  4FBU A;  4BWJ A;  4QZB A;  4X5V A;  3OSP A;  4NLK A;  9ICW A;  8ICK A;  1U49 A;  5DB6 A;  1JX4 A;  2UVR A;  2C22 A;  3V72 A;  4RU9 A;  4Z6F A;  1XC9 A;  2R8G A;  3RRG A;  2FPK A;  7ICI A;  4DWI A;  1RYS A;  3RRH A;  1JN3 A;  5KTQ A;  1ZQK A;  3MR5 A;  1SZP A;  4RQ0 A;  3N97 B;  5J2C A;  4DS4 A;  2JEI A;  7ICO A;  3HPO A;  3BQ2 A;  1KFS A;  4YP3 A;  3Q8L A;  3QE9 Y;  3HT3 A;  7ICM A;  2R8K A;  1ZQX A;  5DDM A;  3T5J A;  4DF4 A;  3OHB A;  3KHH A;  4KLE A;  8ICX A;  3EW9 A;  1ZQS A;  8ICW A;  1EXN A;  3Q8Q B;  3RB0 A;  4F50 A;  3HWT A;  1ZQW A;  2DPI A;  1U47 A;  2C28 A;  5L9X A;  1L3U A;  2HVI A;  4O3N A;  4RZR A;  1X9M A;  2XY5 A;  1ZQE A;  4YR2 A;  4KLU A;  3BQ0 A;  3RB4 A;  5J2E A;  3GQC A;  5DB9 A;  1NK4 A;  1ZQZ A;  4RQ5 A;  7ICL A;  4UQG A;  2HHS A;  8ICQ A;  4XUS A;  5KT7 A;  4DOB A;  4ECV A;  5HP4 A;  5EWF A;  5DLG A;  2KZM A;  2JEJ A;  2ZJ8 A;  4GLX A;  4B9N A;  1TAU A;  5CJ7 A;  1ZQL A;  4PHA A;  1S76 D;  5IIL A;  5TZV A;  1IXR A;  2XGP A;  4I2I A;  5KFL A;  1K1S A;  3JPP A;  4M04 A;  1KSP A;  1NK7 A;  5CP2 A;  2R8J A;  3C23 A;  9ICS A;  5KFK A;  4F8R A;  4IRC A;  2ISP A;  4BXO A;  3UPQ A;  3RR7 A;  9ICG A;  1BPB A;  7ICU A;  3OHA A;  2W9B B;  4YG2 A;  1RZT A;  2ISO A;  1HJP A;  1LB2 B;  4XRH A;  4F4Z A;  4O3P A;  5J2A A;  1ZQB A;  4I2G A;  4KLG A;  3SZ2 A;  4RNO A;  4F2R A;  5CWR A;  4DOA A;  4DQP A;  4ELU A;  1NJY A;  4PGQ A;  4Q8E A;  5DB7 A;  3G6X A;  3ZDE A;  2IHM A;  4O5E A;  4O3Q A;  5J0X A;  4HYK A;  2PFQ A;  4IR9 A;  5KFJ A;  1KLN A;  3BDP A;  4GXI A;  5KT4 A;  2OWO A;  4KLL A;  2NRW A;  2UVU A;  4JUZ A;  2AGO A;  1SL1 A;  8ICF A;  4UB4 A;  1ZQM A;  1BVS A;  1S9F A;  4DSE A;  4Z6E A;  5DGA A;  7ICR A;  2HHU A;  7ICT A;  4F5O A;  4CCH A;  1X9W A;  2VA8 A;  1SKW A;  1XS9 D;  1Z3E B;  4C8N A;  4KLI A;  4F4W A;  1SL2 A;  2MUT B;  5DDY A;  4QWA A;  2W9M A;  3EYZ A;  2IBK A;  4KIT B;  1ZQN A;  3V6H A;  2KFZ A;  5J2K A;  5EOZ A;  4J9O A;  4EBC A;  4YVZ A;  3N4M B;  1QSL A;  1S0V A;  2ASL A;  3TAQ A;  4M9H A;  2PFN A;  4DFP A;  4O3R A;  3PV8 A;  5III A;  1SKS A;  1Z00 B;  3RJE A;  4B9L A;  4DLG A;  5IIM A;  3M9O B;  5KFM A;  4DFJ A;  2KTQ A;  8ICH A;  4QZ8 A;  4TUS A;  2HHW A;  3NTU A;  2BKE A;  4ELT A;  4GC7 A;  5DG7 A;  9ICB A;  8ICG A;  1RPL A;  2LYH A;  4PHE A;  3RB3 A;  3V7J A;  1QSS A;  4M2Y A;  1XO1 A;  2BCR A;  4YD1 A;  4O3S A;  4F5R A;  2P66 A;  3ISD A;  9ICR A;  4UB2 A;  5J0U A;  4J9L A;  1NK6 A;  3E2E A;  2PI5 A;  2XC9 A;  8ICV A;  3GIM A;  3V6K A;  4M9J A;  2BCU A;  2BHN A;  4P4P A;  1N56 A;  4QZH A;  1ZYQ A;  4K4H A;  8ICC A;  4QW8 A;  5EWE A;  2BCV A;  4DSL A;  4QZC A;  5J2I A;  3RAX A;  3HX0 A;  4QW9 A;  4O9M A;  2V9W A;  3PW5 A;  3FDS A;  3PR5 B;  4I2J A;  5DQG A;  2FPM A;  3ZDD A;  3AU2 A;  2PXI A;  4MF2 A;  4ECR A;  4M0A A;  3KHR A;  4EZ9 A;  1UT8 A;  2JEG A;  5J2J A;  2HW3 A;  5DGB A;  9ICI A;  1KRP A;  5HHH A;  3ETL A;  3JPO A;  4EBD A;  5L1J A;  4KLT A;  1WCN A;  3PX0 A;  3QZ7 A;  3C1Z A;  1KFD A;  2HHV A;  3PVX A;  3PW2 A;  4P4M A;  2BPC A;  2H5X A;  4RPZ A;  8ICO A;  2ALZ A;  3NGD A;  5DG9 A;  3SV3 A;  1NJZ A;  2J6T A;  5KFX A;  5J2F A;  3Q8P B;  4I2A A;  4KMU A;  9ICQ A;  2W9C A;  4PHD A;  4C8O A;  3PMN A;  5L1L A;  4O5C A;  3OJU A;  4Z6C A;  1A76 A;  5BOM A;  3KHL A;  1U45 A;  3PR4 A;  7ICE A;  4YR0 A;  1TK0 A;  4BWM A;  3JPQ A;  5DLF A;  4I2F A;  2JZB A;  4UB3 A;  3V7L A;  3Q8R B;  2VA3 A;  9ICH A;  2Q0Z X;  3PW7 A;  3BQ1 A;  3RH4 A;  7ICN A;  1ZQG A;  4ED6 A;  5KFO A;  4R8U A;  4DL5 A;  2W9B A;  1COO A;  5KFH A;  2AJQ A;  4KLQ A;  4DLE A;  1ARO P;  3QEA Z;  1QTM A;  4MFA A;  2KN7 A;  5DQH A;  5KFW A;  5KG7 A;  4O3O A;  1ZQJ A;  4DF8 A;  4M6W B;  1L5U A;  4DSI A;  4DEZ A;  4NM2 A;  1ZQT A;  1T7P A;  2PI4 A;  2C2E A;  1L3T A;  5F9N A;  5KG3 A;  4FBT A;  3V7K A;  4ELV A;  2NRX A;  2XCP A;  1MQ2 A;  3MBY A;  2BR0 A;  2W9C B;  3PNC A;  8ICN A;  4YXJ A;  1T8E A;  2DPJ A;  3RJF A;  2MAX A;  3BQT A;  3BJY A;  4DL2 A;  9ICO A;  4R64 A;  3SV4 A;  3RBE A;  9ICJ A;  3LWM A;  4EEY A;  4UAY A;  2JZB B;  1K1Q A;  8ICS A;  2RDI A;  2F1I A;  4M9G A;  1WCL A;  5KFI A;  2W8K A;  1TK8 A;  4KLS A;  1U9L A;  2MUT A;  4R8U B;  4UBB A;  3LWL A;  8ICJ A;  1ZQR A;  4QZE A;  5HML A;  1A77 A;  4YQW A;  3PY8 A;  4Q8F A;  3H8S A;  4F91 B;  4RNM A;  4J9N A;  4JV1 A;  5KFY A;  3H8J A;  5KFZ A;  5J2D A;  4NLG A;  4E0D A;  7ICP A;  1D9D A;  3TI0 A;  1SKR A;  4IQV A;  4XQ8 A;  1NK8 A;  8ICM A;  2BDP A;  3ZDB A;  4LZG A;  4JK1 A;  5KG0 A;  3LK9 A;  3MDA A;  5KG4 A;  2AGQ A;  7ICH A;  2XGQ A;  2ATL A;  3OGU A;  1Z00 A;  4ECQ A;  1ZQI A;  3MGH A;  4MFF A;  4ED7 A;  2B21 A;  4R66 A;  1JIH A;  2IA6 A;  3GFK B;  4NM1 A;  3G6V A;  2FMS A;  4MEY A;  2W9A A;  4J9R A;  3TFR A;  1BPY A;  3C5F A;  3GV8 B;  4ECT A;  2XO7 A;  4GXJ A;  4DL7 A;  3AU6 A;  1NJW A;  3RJI A;  4F4K A;  3JPT A;  3G6Y A;  4RQ6 A;  1BPE A;  9ICP A;  4G3I A;  4NLN A;  4DQS A;  3V6J A;  5F9L A;  1V9P A;  2KZ3 A;  2BQR A;  4IRK A;  1D8L A;  4ED2 A;  3PX6 A;  4K4G A;  1MSW D;  2BGW A;  1QLN A;  9ICF A;  2JEF A;  1B43 A;  4B9V A;  1CEZ A;  4ECW A;  1UA1 A;  1NKC A;  3H7I A;  1NK5 A;  5IIN A;  4F5N A;  2V4R A;  5C5J A;  1BPD A;  4PGY A;  1BPX A;  3C2M A;  4QZD A;  4B9U A;  2AU0 A;  2ZJ5 A;  9ICX A;  5J0T A;  2FPL A;  1XSN A;  1XSL A;  4LVS A;  1N48 A;  3PW0 A;  4I2C A;  1UA0 A;  2NRZ A;  1X9S A;  1Y88 A;  5KFG A;  3H8W A;  4ECX A;  3AUO A;  2ASD A;  4LZD A;  4KN4 A;  5J29 A;  2ZUC A;  1B22 A;  4YMO A;  3T3F A;  1MQ3 A;  3KTQ A;  4GC6 A;  1S0M A;  3Q8M A;  3ORY A;  4JWM A;  3PO5 A;  1KTQ A;  5CB1 A;  3T5H A;  1BPZ A;  2AQ0 A;  9ICA A;  3K75 D;  3RB6 A;  2ASJ A;  4RUA A;  3GII A;  3TAN A;  4P4O A;  3IM1 A;  4JV0 A;  2ZUD A;  4TQR A;  5J2H A;  3ZD8 A;  4FS2 A;  1C7Y A;  4JV2 A;  2KFN A;  4ED1 A;  9ICL A;  8ICI A;  4QZF A;  5L1K A;  2Y1I A;  5KT5 A;  5KFU A;  4RQ7 A;  3TAR A;  4M47 A;  4NLZ A;  4B9M A;  4DSF A;  3M9M B;  8ICP A;  8ICZ A;  5KFC A;  3Q8S B;  1ZQQ A;  1ZQA A;  3OJS A;  2XCA A;  2F1H A;  5KFD A;  5CHG A;  3ZDC A;  3LDA A;  1T4G A;  5J0Y A;  4RQ8 A;  5CR0 A;  3C1Y A;  2HVH A;  1TFR A;  1ZQC A;  4YD2 A;  4RNN A;  4M6W A;  5J0Q A;  4F5Q A;  4YR3 A;  4ECZ A;  4J9Q A;  3ZD9 A;  4F2S A;  4QWB A;  1ZQF A;  1ZQV A;  1ZQH A;  7ICK A;  5JUM A;  3SYZ A;  8ICU A;  4TUP A;  5HNK A;  2BPF A;  1TAQ A;  3EPI A;  4IQW A;  3EPG A;  3QEB Z;  2C2R A;  4PPX A;  4ED0 A;  3T5L A;  3PO4 A;  1XWL A;  4PGX A;  3GIJ A;  5KFE A;  4DL3 A;  4KTQ A;  1S97 A;  3UQ2 A;  4UAW A;  2VA2 A;  2W8L A;  3GIL A;  8ICY A;  4TQS A;  5D49 A;  3HW8 A;  2V4Q A;  4IQU A;  1PZN A;  4C8M A;  4DQQ A;  1NKB A;  4ED8 A;  5KG1 A;  3JPR A;  4KLO A;  2XY6 A;  5KFS A;  5DBC A;  3THV A;  4F4Y A;  4RQ4 A;  3KHG A;  5J0P A;  4DSK A;  4KLJ A;  4MF8 A;  1CUK A;  2J6U A;  4Z6D A;  3RJG A;  5HMM A;  4M9N A;  1ZJM A;  2ZTC A;  4IRD A;  9ICT A;  3PML A;  1D8Y A;  3IHQ B;  2IMW P;  3EWA A;  5KT6 A;  4FS1 A;  3RTV A;  1RYR A;  4J9M A;  5J0O A;  1HUZ A;  7ICQ A;  1S0N A;  5J0R A;  2J6S A;  1ZQY A;  5IIO A;  3TQ1 A;  5D46 A;  1TV9 A;  4YXM A;  3PW4 A;  4J9S A;  5CA7 A;  4YN4 A;  4MEX A;  4F3O A;  5KFN A;  4P2H A;  1L3V A;  1H38 A;  2VAN A;  4NXZ A;  2FMP A;  9ICV A;  4RPX A;  1NK0 A;  8ICL A;  4DOC A;  4K4I A;  4F5P A;  5DBB A;  2C2D A;  4ECS A;  3RJK A;  4F92 B;  1NKE A;  5KFA A;  4J9K A;  2GWS A;  4DQI A;  5KFV A;  2UVW A;  1DOQ A;  4QWC A;  2PFO A;  3GV5 B;  4TUQ A;  1U4B A;  3C2K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...