2B0CA

The crystal structure of the putative phosphatase from escherichia coli
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
199
structure length
199
Chain Sequence
AKMLYIFDLGNVIVDIDFNRVLGAWSDLTRIPLASLKKSFHMGEAFHQHERGEISDEAFAEALCHEMALPLSYEQFSHGWQAVFVALRPEVIAIMHKLREQGHRVVVLSNTNRLHTTFWPEEYPEIRDAADHIYLSQDLGMRKPEARIYQHVLQAEGFSPSDTVFFDDNADNIEGANQLGITSILVKDKTTIPDYFAKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The 2.0A crystal structure of the putative phosphatase from Escherichia coli
rcsb
source organism Escherichia coli
molecule tags Structural genomics, unknown function
molecule keywords putative phosphatase
total genus 69
structure length 199
sequence length 199
ec nomenclature ec 3.1.3.10: Glucose-1-phosphatase.
pdb deposition date 2005-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2b0cA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2b0cA01
1RDFA 4UATA 5AVXA 4KN8A 3L8FA 5AK3A 5AM4A 2B82A 4NAVA 4YGYA 1Y8AA 1VJRA 2R8YA 3NIWA 5AW8A 1YNSA 5ALQA 1VJ5A 2I34A 4HGPA 3QU4A 5ALWA 1S2OA 5AW5A 3E58A 1XPJA 2ZXEA 3L0YA 3BA6A 1TA0A 3EF1A 3U7EB 3FPSA 4HAIA 4AS2A 3I28A 2CFRA 5ALFA 4Y2PA 4UM5A 3B9BA 3ED5A 4IG4A 2W11A 5T41A 3WK8A 1Z4KA 2G06A 2P11A 3KC2A 3WKAA 4HGRA 3DAOA 5ALGA 5AK5A 4BEWA 3L1VA 1SWWA 3ESRA 1RQNA 3UMGA 1RMYA 4XPZA 4BYGA 2BDUA 3QU2A 5AVRA 1TJ3A 1X42A 3ZW7A 2GHQA 3A1DA 4C4TA 1RKVA 4OCZA 4BX2A 3WK9A 3OTQA 3M1YA 2Q4TA 1NF2A 3PGVA 4HGOA 2NO4A 4Y2RA 3I6BA 5AW1A 5AKHA 3NUQA 5AKIA 4KX3A 4G63A 2YJ3A 1RMTA 4XOUA 2R8ZA 4BX0A 2B8JA 4DW8A 3L8EA 3ZX5A 2CFSA 4BEVA 3L0BA 5ALSA 5AIBA 3SMVA 2R8XA 3OCWA 2WF5A 1TJ4A 2ODAA 3OCZA 1T5SA 2ZOSA 2C8KA 1QQ6A 2JARA 2HSZA 4UU1A 3B8EA 2YN4A 1WR8A 3AR4A 4UW9A 1RKUA 2FPWA 3SD7A 3DNPA 1Z5UA 2HEGA 3NANA 3TLMA 5AVQA 2IA5A 4E88A 3ZWKA 3W5DA 3QU9A 1QH9A 3PCTA 3I1YA 1LTQA 2FDRA 5AM0A 1U7OA 2FPRA 4KX5A 3CZ4A 4J03A 3KD3A 4RESA 4YCNA 3ZUPA 4HGNA 1TJ5A 3RF6A 3R09A 2HX1A 1Z4MA 3N28A 2C9MA 1T5TA 2FPSA 2C88A 4XQ0A 2ZBGA 4G9BA 3U19A 3HYCA 1O03A 3OPXA 4IFTA 5ALYA 2PKEA 3N5KA 3NASA 2YMMA 3W5BA 3SKYA 2GMWA 4B6JA 4ZEVA 4CF4A 1L8LA 3WKDA 3WK4A 4UARA 4QJBA 3EWIA 2W4MA 5ALXA 5AKLA 3K1ZA 3PGLA 4Y2VA 5AM1A 1Q92A 2EAUA 3MPOA 1Z4OA 4L6AA 4PNHA 1Z4IA 5AW4A 4Y2UA 5AKKA 3N1UA 5IT4A 1O08A 2HF7A 4CNQA 2HOQA 4HYTA 4XE5A 4BBJA 2P69A 4UMVA 2RARA 3WK6A 3D6JA 1Z4NA 2I6XA 3QLEA 3ZVNA 3N07A 3J7TA 5ALLA 2ZG6A 4YIHA 5AVWA 3E84A 5AW7A 3AR6A 4YH1A 2AMYA 1YS9A 3ZVLA 1K1EA 2NO5A 3ZX4A 3M9LA 1ZD2P 2YFYA 1L6RA 5ALIA 1Z88A 4I9GA 3IRUA 5AW3A 4UAVA 3MMZA 2IOHA 5ALKA 3U26A 3L5KA 3BWVA 1CR6A 5AI9A 5AI6A 5AKJA 5E0OA 4FYPA 5AESA 3WKEA 2IYEA 2W43A 4OD0A 5AW2A 3AR2A 4EZEA 3EF0A 5AVYA 2C4NA 3FGOA 3OCYA 2YMPA 2YJ4A 1QQ5A 4AP9A 1RPZA 2HCFA 2G07A 2IOFA 2WFAA 3P96A 2FI1A 4L6CA 4Y2YA 1ZRNA 5AM2A 5ALOA 1IWOA 1RLTA 4H1WA 4I9FA 1FEZA 2P27A 5ALRA 1EK1A 4FFDA 3NRJA 1Z4JA 2MU2A 3FM9A 2QYHA 2G0AA 3KOOA 3ZWDA 2EARA 4YCLA 3B9RA 4J2TA 2CN1A 3QX7A 5FP0A 3L8GA 1ZOLA 1ZD3A 3RFUA 2FUEA 3U7HB 3KBBA 2I55A 3SKXA 1RQLA 2GO7A 5ALVA 3U13A 1L7OA 5AVUA 1SWVA 3U7GA 2JAWA 2EATA 1AQ6A 4UASA 2B30A 1WZCA 3WKBA 2BDEA 3L0CA 4AS3A 1RRCA 5AIAA 2AUTA 2ZBEA 2OBBA 3FVVA 4UMEA 5AM3A 3MC1A 3QUCA 2D2VA 3GYGA 3S6JA 1Z4PX 3QGMA 4UMFA 4BNDB 3I76A 4UAUA 1L8OA 4MUMA 5IS2A 4RETA 3QNMA 4OHFA 3ONNA 5AI4A 3AR3A 2IOFK 1ZS9A 4YIKA 5ALHA 2HO4A 5ALUA 1L7NA 4BKMA 1XVIA 1PW5A 4CF3A 3AR8A 1ZJJA 5AKEA 2O9JA 3SF0A 2WHEA 1Z4LA 4L57A 5AKZA 2WF7A 4BNDA 2OM6A 1U2TA 1QYIA 2RB5A 3FZQA 2G80A 1NRWA 2MU1A 3R9KA 3QYPA 4JDPA 4CE6A 2RAVA 4Y2SA 5A3RA 1ZRMA 2RBKA 1Q91A 2B0CA 2AGVA 5ALZA 1L7MA 3SLRA 2OYCA 4UMDA 4JB3A 3IB6A 5AVTA 5AHXA 2YJ6A 1T9ZA 4EX6A 4EELA 5AW9A 3HLTA 5AW6A 3CNHA 2AH5A 2Q4RA 1NNLA 1J8DA 3NAMA 3ZTYA 2YBDA 3AR9A 4C4RA 3WKCA 2JAOA 1S8OA 5IT0A 2BY4A 3DV9A 5AK6A 4NABA 3KZXA 4ZEWA 5AKGA 3AR7A 4Y2XA 1KYTA 1Z5GA 5AI8A 2GFHA 2HF2A 1L7PA 2YY6A 1VFPA 2WF8A 4KNWA 1JUDA 3QUBA 1F5SA 2P9JA 4Y2TA 4NV0A 4YCMA 3ZU6A 3W5AA 4DCCA 3W5CA 2WF9A 3L8HA 2C8LA 1RKQA 2G08A 2X4DA 1N9KA 2CFTA 2GHTA 2QLTA 2JGAA 3WK5A 5AVSA 5AM5A 3AR5A 4Y3UA 1WVIA 3U7FB 2FPUA 4NFLA 3UMBA 3SHQA 3L1UA 3ZVMA 3PDWA 1WPGA 1MH9A 1TE2A 2ZBFA 4EENA 2B8EA 2G09A 1RC8A 4QQFA 3L7YA 3A3YA 4DFDA 2HHLA 1YV9A 5A3SA 2OA0A 2MSNA 3QXGA 2O2XA 2HI0A 3DDHA 3F9RA 3KDPA 5AICA 5AVZA 3ZI4A 1YJ5A 3ET4A 5ALJA 5ALPA 2R8EA 3UMCA 3WGUA 2WM8A 2JAUA 4UM7A 5AK4A 3R4CA 4KNVA 3MN1A 5A3QA 1RMQA 3QU7A 4HGQA 1N8NA 3VAYA 2YJ5A 3ET5A 2FPXA 5ALDA 1LVHA 2WF6A 3N8GA 4UU0A 2YMLA 2B1QA 3OCVA 1U2SA 4CF5A 5ALNA 1RLMA 2VKQA 5ALMA 2YMQA 4GIBA 4F71A 4KYTA 2PQ0A 4BX3A 5AW0A 5AI5A 2DQSA 3E81A 5ALTA 5AI0A 4FE3A 3OCUA 1YDFA 1YMQA 1QQ7A 5JJBA 3QU5A 2HDOA 5AVVA 4OFZA 3WGVA 2G1AA 1U7PA 4C4SA 3FPBA 2FEAA 3ZTWA 2FUCA 1ZD4A 2B1RA 4Y2QA 2PR7A 5ALEA 2I54A 3E8MA 3ESQA 1ZD5A 1Z4QA 1U02A 2Q5EA 2ZBDA 5AKXA 2I7DA 1SU4A 4MWOA 3OCXA 3A1EA 4O8CA 4DWOA 3IJ5A 3NALA 1J97A 5AKYA 3QUTA 4F72A 1CQZA 4GXTA 2I33A 3UM9A 4NWIA 1EK2A 4EX7A 4EEKA 4Y2JA 3A1CA 2NYVA 1XP5A 3WK7A 1RLOA 3EPRA 3QUQA 4ZEXA
chains in the Genus database with same CATH superfamily
4AJOA 3UV3A 1ULUA 2I22A 2NU7B 4OGLA 5LA6B 1XCLA 3SQIA 4C14A 5HW0A 4YNBA 3ORYA 3DCNA 2X3UA 3EAQA 3H2GA 3NJ4A 3TLJA 4E5YA 1QZTA 2C83A 3U3OA 4AY3A 4YFKA 1IHPA 1L6IA 2GKOA 3K16A 3Q72A 4YGYA 5K3AA 3W5VA 2FG5A 4QHTA 3VMFA 1RLIA 4RZ2A 2Q3MA 1QG6A 5ELLA 1P33A 2WMYA 1VJ5A 5F9FA 2HRRA 1Z08A 5CURA 1NVVR 1Y6ZA 1YB2A 2A7XA 1XDSA 4GR5A 4LV5B 5GINE 1L8AA 2ILVA 1J8VA 4RANA 4QDOA 4BNIA 3E58A 1IQRA 5FH9A 4CPDA 4Y6LA 2XDQB 3OQMA 6LDHA 2AV6A 2WSSA 1V3TA 3A05A 3RSGA 2EANA 4DAOA 4MI3A 3FGZA 1LZLA 2FWAA 5EWMB 4L9RA 3V97A 4DA6A 1L6NA 1W4BA 1E5VA 4DHEA 4KLGA 1SZJG 1W52X 4GQAA 3BRWA 1X86B 2VYCA 2QN6A 4L8GA 4YRTA 3THXA 3VH3A 3AIIA 2H2FA 4EG5A 4S05A 2HNBA 1UAGA 2VAPA 3LIPA 2AX3A 4BX9C 4OMUA 1N9GA 1U81A 4KPGA 5ALFA 5F4ZA 4CBVA 5C4MA 3QXJA 3EB9A 3B9BA 4HLUC 2DB3A 4HY3A 1GZ5A 1YT5A 2MMCA 4N3BA 4QYIB 3KLNA 3DULA 5T41A 4EHBA 5IUJC 2GVDC 1CXZA 4LRWA 3T7TA 1XF9A 5IAJA 1VKJA 1DAFA 4ZODA 3SF8A 1CQIB 2OBFA 4D3FA 3W3AH 1B42A 2F2TA 2QRLA 3PX2A 3EC2A 4LGMA 3VPHA 1E1CB 1EFCA 3QZUA 2WYUA 4URYR 4EZBA 4F3YA 3N6XA 3EWAA 2GA8A 2ZREA 4FLMA 4AZSA 4KC0A 1AKEA 4O3QA 1Y6JA 2BAGA 4F8RA 5EE1A 1Z2OX 2FHSA 4LN1A 4ZOQI 5FWNA 4B71A 2P3LA 1W35A 3DBRB 8ICEA 4MDYA 4RD2A 3VKVA 2AHOB 4COOA 3EEFA 4PSUA 4R3UC 4F4WA 3MWDA 4JASB 4XA8A 1HG1A 5G41A 5J4KA 2Q6TA 2CLKB 1QORA 4M22A 3T0FA 1XZGA 2A3VA 1P81A 2DPGA 3L3BA 1K66A 2XOKA 5J2AA 2ASVA 1FBNA 1AG9A 2AB0A 2C2WA 2HWXA 5FADA 1JDSA 1NU8A 3DTVB 3RAXA 2NX2A 2OFPA 1JW9B 3IJPA 5AP9A 3UQ2A 3KZKA 2Z57A 3I2JA 4CTMA 3G02A 4AJJA 4OGGA 4US9A 3JQGB 3L7LA 2GB4A 4QUGA 5TGZA 2M6KA 4QGHA 1M6WA 2JFWA 3QTBA 5F7ZA 1KARA 2DKFA 5U4QA 2R96A 3LMKA 3TPFA 1FTNA 4R68A 2OAEA 1HC7A 2VWGA 3SVTA 1MVOA 2BFMA 4DLPA 2G5HB 4DQIA 4UVHA 3T12A 8LDHA 2YASA 3GRYA 1ZXIA 3PSFA 1FZQA 4NLNA 4QWBA 1GGKA 2P8JA 2V7QA 1SQ0A 3BHMA 4MVWA 5ALSA 3W7VA 1GG2A 1T6NA 3KEQA 1KBZA 4UBNA 5DCLA 2RQ5A 3AUJB 1G9TA 3MF4A 1BRMA 3NHJA 4ZA2A 3RC8A 5ECGC 3ITNA 4F3OA 1Q7GA 4IYJA 4LC9A 1KJWA 4QQKA 4A6XA 3JQAD 5EJGA 2HU7A 3RD5A 4R1PA 1OILA 1W0CA 1RRFA 4LUCA 4KUHA 1GL9B 4JP3A 3WFJA 5JD5A 3B9JA 3JARB 2R1VA 4LBYA 5D5PA 5BSUA 3W1EA 1YCFA 1Z06A 4I1UA 1CF4A 4ITRC 1FRVA 2EKLA 3HL4A 4JU8A 2Z2JA 3N5CA 4Q4AB 4IC9A 4QYIA 3PDHA 2C5GA 3K2IA 5JZOA 2C5AA 2O7RA 5AJYA 1I80A 3VH1A 1EB9A 1YQQA 2DPIA 5FLKA 2XVMA 3KXKA 3FPEA 2FEPA 4QULA 1GDTA 1XRRA 1L5NA 3UWMA 3IG5A 2B21A 3PTAA 4U0KA 1T5IA 4Y2HA 4ARAA 1JYEA 3DP7A 1PJ2A 5ETJA 1DX9A 1E6CA 1XQXA 1NQVA 1ZQ1C 1WUKS 4ZYZA 4CV2A 5TEVA 5EIBC 1XWIA 1EWKA 1MQSA 5CB1A 1F2TA 3WDLA 3UPTA 4E5DA 2IDKA 5LDGA 5DI3B 4J16A 3TQCA 1CQPA 2A0KA 2WU0A 1AF7A 1Q12A 1T10A 3N5KA 1JDUA 1Y9JA 1VLLA 3GELA 2RJOA 3D6AA 2QLFA 3F7TA 1YUBA 3W9YA 4QD3A 1PK8A 2BGIA 2IIQA 5CG1A 3VCBA 5BWOA 1K6XA 4HDMB 3TS1A 2CKMA 5HSGA 4EYIB 5MFZA 2YZ2A 2EFJA 1XTSA 2Q29A 2WU4A 4BLPA 3B89A 3TTXA 1ACLA 3DL2A 1EUQA 1ZMRA 2HV9A 1B6RA 1NJYA 2ZJ2A 3WNQA 1PAUA 3NRBA 3NT2A 3KDSE 4POOA 1G60A 4ZMRA 4RK0A 4M9QA 4I46A 1E7RA 1MCZA 5DYGA 1PG0A 1V47A 4CG1A 3OZ7A 1IOZA 1LNSA 2XD4A 2P6MA 1XSEA 1Z0JA 1WHTB 1WHSA 3DLAA 3KQKA 2QM3A 3QKSB 1QS0B 2XCOA 3ZQJA 3J7AC 3CLUD 5E7IA 2WTAA 3ACBA 3KD2A 4DSEA 3B3AA 1A9XA 3T4UA 3UUFA 4F50A 4IVRA 3DPIA 4ICAA 3L7AA 1DRGA 2AX4A 1JFFB 1WVGA 3T06B 1MT3A 1X87A 1YR6A 2B4KA 2WHXA 4GM4A 4L2IA 3FWHA 1Y5NA 3UK7A 3IP1A 2RGAA 5DNEA 4RJTA 3KSBC 3V6KA 3U2QA 4D2IA 1HMPA 3HYSA 2VEOA 3K15A 3F6RA 3Q10A 1FDOA 4XQCA 5FOWA 2CE7A 4HQNA 2CVFA 3ZXYA 5CLHA 5C7LO 3GIKA 1J22A 3E9CA 5KDOA 2ZWIA 1E0SA 2KVCA 3J7TA 2FFHA 4UM9B 5L7YA 2X86A 2ZB8A 2HK6A 3CX3A 3VPAA 4UCFA 4BZZA 3IYLW 4MWGA 5BR1A 1JR6A 1GU1A 2BZSA 3URKA 3ZDDA 1N2JA 3PGA1 3RG8A 4ZI2A 1ZQSA 4KN7A 1XYGA 1P3JA 3HWRA 3LOQA 3DVAB 2WIDA 3O2JA 4CTJA 1ODTC 1L6RA 2PTHA 1Z88A 4W82A 2LVBA 1DKNA 2GM5A 4DDHA 5HZMA 3CPHA 1V8FA 3OD1A 5CLLA 4OF4A 5DI3A 2OCIA 2NU8A 3VC3A 2DGZA 2PKCA 4N01A 4E5VA 5BN4A 5FBKA 1J00A 3SYRA 4UB4A 4JB8A 3EG5A 5CFLA 4ZOAA 2Q3EA 3MUNA 4PSCA 5JU6A 2OK7A 3IDFA 4EJSA 4O3NA 4ZK6A 2YHAA 1EFAA 1BKSB 2ZRAA 5ER6A 1ZHFA 2AJTA 5F3XB 1LC3A 2QVZX 2AG8A 3C3AA 4Q34A 4TKVB 3FGOA 2FSVC 1GO2A 1RXWA 1MX5A 1CY1A 2QRVB 3P2JA 4J8PA 2R2GA 5BOSB 1NQTA 1C14A 1SCUA 3H0MB 4UAWA 1N7GA 2C94A 5NULA 3TMYA 4PE5B 2C92A 3B3QA 1J8FA 4OJNA 3RYIB 4WJKB 1ZRNA 4OL9A 3O9MA 3QENA 4MYCA 1X1CA 2JEGA 3C8DA 4G4SO 3STUA 2IZ0A 3ENVA 3PD1A 1M8PA 5IZCA 3TD6A 2FMQA 1JDVA 1CE8A 3NRJA 4D92A 1S02A 2DTXA 1JMSA 2WA2A 2FZLA 2JIRA 2YV3A 3L07A 2M32A 4R51A 4WZAE 3ZX5A 5H9WA 2XC9A 4M47A 3QEKA 1DT5A 1L5ZA 4Y1EA 2IEYA 2I6TA 1UA0A 1G1AA 3L18A 4XGIA 5DN9A 4YPOA 5K0BA 3DZFA 2OLKA 3GFFA 4WN9A 3I0NA 1PSDA 2YN2A 2RKWA 1QVZA 4L9WA 4V0QA 1U9IC 1WSAA 1EP1B 4PN7A 3OSNA 4IR9A 5LD2B 4LX0A 3TRFA 2UUAB 4MMYB 2NRXA 2J5KA 1T0JB 5KL1B 4DANA 1SOWA 2ZJAA 3MCZA 2JAWA 5AWFC 3WV5A 1XQ1A 3DLHA 4KN5A 1RHRA 4YRDA 4X8MA 3MFHA 3P2OA 1KPHA 1G8SA 4X44A 1RRCA 1GTSA 1LI4A 3G7SA 4Q03A 2OCXA 1GADO 2VUSA 3OJEA 4HZUB 4AZTA 2HBMA 1MT0A 1N1MA 2JLBA 1GFWA 5BN3A 2GA9A 2HHUA 3RU9A 5IBRA 2Z04A 3FSGD 2B2NA 4HNUA 1XRLA 4J16C 4Z4GA 2UYQA 3ROZA 4UVDA 4YIKA 3TFRA 1EFPA 3SQWA 5CLIA 1GVNB 1JT2A 2Q5OA 4ZHSA 1KZYC 2PSSA 2XQJA 1PGOA 1RBZA 3QYAA 4NBNA 5D2CA 1ODSA 1Y5MA 1JLKA 1E64A 5DM1A 3WLHA 1U7XA 2PGNA 2O9JA 1MDFA 3IH5A 1A4UA 4NV3A 4DBLE 4AUEA 1DWQA 1OFUX 3HS3A 1SVKA 1T6XA 2HDNB 5JT1A 1AO3A 2G1PA 3HO1A 2XMBA 4XIIA 1VZ3A 1NI4A 2JV3A 3CNOA 5KI6A 3IVMA 3VZQA 5K6RA 1JMKC 1FF9A 3FMVA 3LRTA 2JEZA 1GUBA 1U2DA 3F8TA 3JZAA 1ZRMA 2D5CA 3VI3B 3C74A 3UVEA 4EF5A 1P2SA 1JHZA 2B35A 3V48A 4PICA 3ICWA 4V38A 1TZCA 2YWGA 3L6RA 2D1RA 2G77B 3OX4A 2O3RA 4KG7A 2LCQA 2HT1A 2H65A 4RLSA 5KFWA 2H92A 3K1AB 3KXPA 1L5SA 3SFTA 2LHTA 2P9CA 1RPJA 5P21A 2ZUBA 2AQ4A 1DAMA 1Q3TA 3RS7A 1MAUA 4GFJA 3IV9A 3HZZA 3CURA 3L6UA 3BN3A 2Q4RA 4MQLA 2OHJA 2JLRA 1WX1A 3AEKA 3ZTYA 4AMYA 1RAIA 3K2EA 1W9MA 1XNGA 2YBDA 3B6IA 4IIXA 3SZLA 3WTBA 2R751 4LCJA 5AOVA 3KPVA 1S8OA 3TE7A 5ANRB 1ESEA 2W9AA 5FBVB 2W6IA 2GZMA 4IQ4A 3BQ7A 1PR1A 2ZU0C 1MQ9A 4I1RA 3TR5A 1JAXA 3A0RB 1J0DA 1MIOB 2GFHA 2GSWA 1OI2A 4X1YB 1UM8A 5FR1A 3EXIB 5EJ4A 3I3OA 4C4YA 1E7QA 2GDZA 4U63A 3FPAA 1IM5A 1JUDA 1OVGA 4ND6A 4REQB 1OW3B 3K9GA 1FNBA 1WWKA 3L8YA 2DBYA 3RROA 2ZKIA 3KCQA 3LC1O 1MNQA 2OCAA 4PTZA 3R3SA 4QDZA 2JD0A 3PJRA 1ZIYA 2PMFA 1X1QA 1BC5A 2BEVA 3JR7A 1DLJA 3Q5DA 3H7IA 4ABYA 3QK7A 2VP3A 3MUOA 2ZSDA 3AP3A 4Y6GB 4YRPA 2AWOA 2HBYA 1BGXT 2HLHA 2K87A 4M9GA 2X4DA 3OZFA 4QGBA 1JU4A 4P7GA 1A27A 4LC1A 4KXYA 2FCRA 3QPAA 5JS2A 3BT7A 4RVHA 3O03A 2WFLB 3N05A 2KK0A 5FV7A 4JA2A 4I3HA 4WUVA 3CRW1 3RB6A 1IM8A 2FSPA 2BBWA 1XEWX 2G09A 1OFGA 4PGFA 5CFQA 1UBFA 5ICSA 5A0VA 2OZLB 5EPEA 2V5UA 1R15A 4GYWA 1XQ9A 2BL4A 4RIGA 3NO4A 4D8XA 3KR1A 3F53A 1VE6A 3DEEA 4H4CA 2K4PA 3K0CA 4QIWC 4UB3A 5F51A 3S81A 4OA5A 3ZGVA 2GTHA 2CVZA 4K3VA 3DLTA 1Q0LA 1Z37A 2HA0A 3LT0A 4RHEA 3VU0A 1Q1BA 5GWXA 3NHKA 3W2FA 2BPFA 3WRXC 2JFUA 4WL0A 4XD2A 3V2HA 4GDMA 4QGGA 1XQWA 1CE8B 3NTUA 1U3GA 3W6ZA 4BVLA 2FN4A 4CTOA 3W9UA 3OFJA 4PANA 2IY9A 2FW9A 2WW8A 3GDHA 1D0IA 4GC9A 1RCTE 1JDBC 2RGEA 3AVQA 3LSYA 4EKEA 1J7KA 1XU7A 4JYMA 4YDSA 8ICFA 3VNQA 1Z5ZA 4DNPA 4ZYUA 3A36A 1RI1A 5L1KA 3ZVRA 4BNGA 8ICZA 2VDNB 5CW1A 3WLTA 1OLSB 2H16A 3MSCA 1Z6AA 3DZKA 4G4GA 3TPCA 4HI0E 3RV3A 4XB1A 3SHOA 4DQDA 4E5NA 2FDXA 5DHAA 4BQNA 1NSTA 2GM9A 4HAXA 3UHJA 1H42A 1LTHR 2DUJA 3MJVA 1NVWQ 3NWPA 3O74A 1Z6QA 1YMQA 2GFQA 3U17A 4BNXA 3G88A 4OUKX 4I1SA 4XZ3A 4LOIA 4EAQA 4KBFA 2D54A 3QELA 3KFLA 4DARA 1V8PA 2ZRBA 3KOYA 1HUOA 1JVSA 3B53X 4IJ5A 4R2XA 1ZR4A 1UOEA 1D8AA 2R6GA 2B1RA 4HDRB 3JD0A 2EZYA 5B7PA 4GXRA 4BGVA 3RRXA 3GCGA 3IBCA 721PA 9ICBA 3WS7A 2VDWA 3O9VA 4DFKA 1XKLA 2X76A 2I7DA 2XCQA 3ANTA 2ZBDA 2DHCA 4M7RA 3TOSA 5IJ9A 1FL9A 4IDEA 4AC9A 3BQMB 1XZPA 1XTBA 3GT7A 4ZD6A 3IP3A 2W7OA 2PFQA 2O8CB 2QRVA 1C50A 2X1MA 4NMWA 4R98A 1L3CA 2GBLA 2SICE 5HF8A 1R8XA 2QRHA 3KKQA 5TJHA 3FCUB 3SS8A 2B6NA 4FCCA 4DXHA 2K5UA 4PBTA 5B1IA 4F3CA 4KZKA 1TF5A 4C03A 4G36A 3PD0A 5KFDA 3O4HA 3WBJA 4M9ZA 3TKYA 3HR7A 4DB2A 1F9EA 2HA5A 4MGKR 1XUOA 1NXPA 3CT6A 3REFA 1JQEA 4UATA 1EUCB 1JYSA 3WJ1A 4AVYA 5AVXA 1MOSA 4LF4B 3L8FA 4IRKA 3DZDA 1NG1A 1IYZA 2RGNC 5TPZA 4AJLA 4TYYA 1J1ZA 4UXIA 1NSFA 3O38A 2NZ2A 2BF7A 2WLSA 3D7LA 3V2UA 3DO8A 3GUHA 4NEQA 3BFKA 4V0MA 3DQQA 4M54A 1ZYQA 1N0IA 1JJ7A 4EJ2A 2WA1A 1XEXB 1J5EB 2VTVA 5HKBA 1VA5A 2OKCA 3KXLA 4EL0A 2YH2A 1XPJA 1R12A 3KQVA 2F8TA 1HY3A 1TAGA 1TW2A 2QP9X 3DC2A 3MOIA 2HHXA 3U7EB 4ROSA 4ZVVA 4CMCA 2QBYB 1RR6A 5J0UA 4HAIA 1NJZA 1JYFA 3GNTA 5JH7A 3ZLVA 4B2PA 2GGSA 4F2DA 2Q4BA 1EXWA 3CWQA 5G5GA 3L8ZA 2JD1A 4V1CA 3NVMB 1F06A 2QSJA 2ACEA 3T5MA 3WLNA 1CT9A 4D9KA 2WMOB 4HVCA 4YAIA 1VL1A 2W11A 4MPRA 5CT8A 2GUGA 1NI3A 1PL8A 4QWMA 1KTQA 2O2ZA 3FWYA 3O0TA 4J1NA 4P0TA 1F6BA 2BCRA 3BMOB 4X93A 2V0GA 4O2RA 2O5EA 2VJ5A 2KMDA 4OJOA 2E4ZA 2O52A 4F1KA 3IUNA 5BT9A 4HXEB 3WHLA 1ENPA 1SWWA 1ZJMA 1V9CA 4J07A 4UC0A 1C30B 4EWLA 2ZE8A 4ZAWA 3FH0A 2P6UA 3JPQA 2IYPA 3EC7A 3GLVA 1E3MA 4QYXA 2OHFA 5H4HA 4Y1FA 3TRHA 3ZE0B 4F4UA 1V16B 3QLJA 2P5YA 1X66A 4C4TA 2A5LA 2DGDA 2HKIA 2YWXA 4KSYA 4JHXA 4TUQA 1FP1D 3ORRA 4NJEB 4F97A 3AM1A 2AEFA 3OH8A 5ESXA 2D8MA 1VPEA 3HSYA 5FOXA 3GRRA 4R0MA 1A98A 4LQLA 4MS3A 1GQYA 4MR7A 2XNDA 4O5OA 3E1KA 1Q20A 4G07A 1ZNYA 2OMKA 4N8EA 1T1SA 1NI5A 2C7GA 3ASVA 4JGGA 3T7RA 3I01A 4Q9IA 5CFRA 4UNPA 2LV8A 2VN8A 1IBLB 3EXHB 2FR8A 2PPVA 2XZOA 4QU9A 4G6ZA 4PR0A 1CKEA 3RK4A 3CF6R 1VIDA 3A9TA 4RV4A 3FVTA 5DM70 1FMTA 4TLDA 3QBEA 1L4MA 4GI7A 2C2OA 2EP7A 4EO4A 1XPUA 4A6PA 2B92A 2WIGA 4ZJZA 3S2UA 3L0BA 3GRVA 4B6EA 5JUWA 5D4BA 4J9SA 1ENZA 4NNOA 3H42B 1J7JA 1ZI8A 3HV2A 2ZSJA 3PI6A 1OU4A 3EZLA 3WNVA 2H3HA 1SBZA 3M3DA 3PNBA 3NH9A 2JAXA 3EZYA 3UUEA 1ILEA 3T5CA 5DTQA 2VK1A 2VUTA 3RLIA 2WKSA 4GLXA 2Y99A 2ASJA 3B8EA 3ICPA 5EWGA 3NC1C 2FUKA 4MJ3A 4UU1A 4MRPA 2A5JA 2E4YA 2OUIA 4BBAA 1S4QA 1BPXA 1QR6A 2D3DA 4IIEA 4M8SA 2C7PA 4BVEA 1NVUQ 4PNEA 2YQ5A 5C5DA 2W04A 5FUWA 4BY9E 2NXJA 1UPHA 2BHNA 1X9IA 4DHWA 5T5QA 2C22A 7GPBA 5FV4A 2ZWMA 3TXAA 1Q5PA 1VPVA 5HQJA 3CKLA 3G8AA 3MTDA 4C6SA 3LKZA 4B9MA 3N76A 3I1YA 1E2NA 3UK1A 4QAQA 1NE2A 5AM0A 4CGZA 4B44A 1M6VA 3L77A 2X8JA 4OQMA 1KMHB 4D02A 5FYQA 1K0UA 2JCSA 3ZUPA 4XWYA 5EKDA 4JL5A 3GRKA 3C5FA 1MW8X 1E7WA 1PEYA 2D4AA 4JR2A 4ACBA 5B7QA 4AJ2A 4G1MB 4OUDB 4YFVA 2IGTA 3GLTA 3QBTA 4E6PA 4GWKA 2NSHA 1EH5A 2PZGA 2PWAA 3EBOA 1QIIA 4TVSA 5HRUA 2ZM5A 3VNSA 1SBHA 4DUPA 2WWTA 2BI7A 2HMSA 2QX7A 3C1TA 3R3JA 3F71A 4KWHA 4B34A 1PZEA 2KSOB 1BW9A 2V1XA 4WY8A 3DHWC 3GPDG 3SGLA 5C0YA 5IH3A 3J81k 3ER8A 1Y1LA 4J9OA 5K3FB 3EOAI 3WKDA 4NJ8A 2PQMA 2IPOA 2OV3A 1W36B 3AINA 4C8NA 1BXZA 3DT9A 1TYEB 3R1IA 4W6QA 4WA8A 2OKGA 4TXMA 5CIQA 3F98A 2JIZA 4DT1B 2FZ5A 4GP7A 4XX0B 1N7IA 5BMVF 1W5SA 3DOJA 2PRSA 3PFCA 4KREA 5I9LA 4UVGA 4Z8XA 2FFRA 1N3YA 5JFGA 2FMSA 3UK0A 5E8RA 3KUKA 2X8AA 3KWFA 1HTTA 4FOTA 1SUEA 4NBRA 5E1BA 3U37A 4QWCA 1N5MA 4PYNA 3G9TA 4J2OA 5CB8A 3PX6A 5DNCA 1I30A 4NU0A 1Z63A 4YVZA 3NS7A 1FTWA 2B4TO 1M8KA 4J9NA 1ZUIA 4M9SA 2QMZA 3GZNB 1N1DA 4WTOA 2X0JA 2FPGB 2BJHA 1W0JD 4UMVA 4QLOA 4ZU1X 2A0UA 1XEWY 2A88A 1WEHA 4GMDA 2OZEA 4EDFA 2WKWA 4U02A 3IOEA 1CG6A 4KRFA 5CJ7A 1WA5A 1U1DA 2G5IB 6AT1A 4NM1A 4GBGA 3WJAA 4ZQBA 1AKWA 2HPAA 5JW6A 1X39A 3IMEA 4DRZA 5E1OA 3OURA 5HHHA 1JG3A 4N9QA 3NU1A 3PNKA 1RBYA 2ZVDA 2UVVA 1KY5A 2VPTA 2P41A 1GPDG 1Y4ZA 2R85A 5FOTA 4OATA 1FFBA 1QCDA 1LFDB 2K89A 4YR0A 2IPNA 3IQXA 3MB8A 1T9HA 3PNVA 4MVXA 4WN3A 3OZSA 3PR4A 4X20A 4BKRA 4B3CA 4F3NA 3TF5A 4CM1A 3P2YA 4Q3KA 4PQEA 1VSVA 2W6CX 2QGNA 3V4SA 2WJAA 1KAQA 3DZGA 3P9XA 4BASA 2V7PA 3T8YA 2BMDA 1JSZA 2WP8J 2Z4RA 3MT8A 3WE7A 1NBIA 1EGAA 5DM2A 3RH4A 3CVWA 4RAQA 5B6PA 1SL1A 2PLWA 3GN1A 5KFYA 1PJBA 3FLBA 7ICSA 3ANSA 4ILKA 2BFOA 3EUWA 3GLRA 8AT1A 2WYWA 2Z9DA 4DSOA 3MJRA 4RZ3A 2W2KA 5LP6A 2P1RA 4IDAA 4PAQA 1SVLA 4O6VA 2F9FA 2NLOA 3IKTA 3ESYA 2XGPA 3BWEA 4RT3A 2WMNB 5L3QB 2H5LA 2HJ9A 3MBIA 2XTNA 5K3FA 5T67A 4RVDA 5IK2D 1IVSA 3B78A 5KFRA 4AG5A 3RANA 2COEA 4FGLA 1V1RB 1RPAA 3C2LA 2XYRA 1U0BB 4MW9A 1JS1X 3BD8A 1FSSA 1S1MA 4NOMA 2EJBA 2YR0A 3RWOA 3RGWS 4LRQA 1H4TA 3IM1A 1B15A 3LUFA 1V39A 5JOQA 1SVOA 3I83A 3TTUA 3RC3A 1CZLA 1HZJA 3PO5A 1XVAA 2CBZA 1A8QA 5TQJA 3HL0A 2WE8A 4D9BA 1R4MB 2F3RA 2GVNA 3CYFA 4G37A 4GF5A 5IANA 2Z5GA 3I8XA 1Z0SA 4PLTA 5DYWA 2VWQA 1EHCA 2HJWA 3ELYA 4S1PA 4GXQA 4E51A 5K0TA 3IAAA 1PQUA 2CN1A 3C41J 3ZNQA 2XKBA 5KYXB 1C80A 3SSAA 3K2BA 2H4JA 5DPMA 3HR8A 1S3FA 2GAIA 3BE8A 3IIJA 1W25A 5L51A 3TZQA 3WGQA 1BAPA 2WD9A 3F5AA 1D04A 2ZYWX 2J3QA 2PH5A 4X64B 4J3FA 3FFAA 1SWVA 3QLVC 2JGDB 4EY3A 1E2MA 5KFEA 3PNLA 2PRJA 4PZ9A 2VUIB 1HDGO 2YV2A 1Y4DE 3EDCA 4G1EB 4P33A 3ZK7A 3SI7A 3FAHA 3G7NA 1P60A 1E2UA 3W8NA 4LWPA 4NLGA 2ZBEA 3PSPA 2AI2A 3B82A 2J87A 1Z3CA 3OEHA 2VPQA 4OHWA 3ZI7A 1UEIA 3MC1A 3KKMA 3S6JA 4Q5IA 3AEZA 3CE6A 2J0VA 3IE0A 4S24A 4JYCA 3SXJA 1EXNA 1N92A 1CLUA 2EBUA 2E18A 3G9XA 5ITZA 1N33B 1ZXLA 2VJOA 2IOFK 1JA1A 3BDVA 3QXCA 4JB0A 5F2OA 5JS7A 1QLWA 3HUEA 3ME5A 1X13A 3U4HA 4DIFA 2ZROA 4RD1A 5LP6C 5CDHA 1FBTA 3QBJA 4PPYA 4R84A 4YCDA 5DTRA 4RTRA 4J6FA 4MQEA 5EXEA 5B55A 2C4MA 3N6VA 3UXOA 3QW2A 4LISA 4NCJA 4UM8B 4KKXB 1BQEA 4IQTA 2ZAIA 4WAUA 3KSRA 5JZBA 2XCRB 3K8YA 4QEKA 3A0BU 4BO5A 1IN4A 2W2OA 4BZPA 3S99A 3ERCA 1M7BA 4HWPA 4QJ4A 2O23A 2A9PA 1P7ZA 2IE8A 3U4IA 1D4ZA 3OO1A 4IW3B 2AC7A 5IX8A 4B2IA 3DMGA 5DP2A 2DP4E 5KX5F 1H4VB 2BKXA 1NK4A 3ND5A 1E0DA 4UBKA 3LD9A 2OV2A 4WUTA 1GQ2A 2WBLC 3F96A 4PV7A 4TMVA 4EO9A 2OE2A 3H6GA 1GZUA 1V7CA 5FPPA 3QWAA 3BXFA 3QLUC 4BJ6A 5K7SA 2DKZA 1YU6A 2OM2A 1F8GA 3F0TA 2B9EA 1ZHOA 2XSZA 1TEZA 1WOYA 5A03A 5IVDA 1KHHA 2QVCA 1WUJS 1EM8B 1JWBB 3HLTA 4L3OA 4LJSA 1GU0A 5E9QA 4D6XA 5EE9A 2JA2A 5ARCA 3HCEA 4IMIB 4D0NA 3UXHA 4ZVUA 4YPVA 2OQRA 5JECA 4ECXA 2BBOA 3G2PA 4GH5A 4ND1A 4C4RA 3L6DA 4OIMA 2PV0A 3CJRA 2F8LA 4V02A 4DA8A 1YXMA 4GSLA 2XV1A 4URHA 4TTVA 2E5SA 1H2FA 1NBME 1L7QA 3EJ6A 4K6KA 2PUHA 5GAJA 2PMCA 1SC3A 1VMEA 4WFQA 1EHIA 4Y6OA 2NRVA 3ZDFA 4DFPA 4R7ZA 1VFPA 3BF8A 5DX1A 4M38A 4ZT6A 5BV1A 4JBXA 2HGZA 1HFWA 3O4GA 3TD2A 4UFPA 3GNLA 2VF8A 4ZYLA 2P9JA 1SK9A 2XOEA 3AETB 4TOIA 4G0OA 4WOKA 4ZTUB 1N34B 1E5DA 4TMWA 1DFHA 2GPWA 2Z30A 1BVSA 3DDWA 1XHEA 5AJHA 2VVTA 5GP1A 4BP8A 3EAFA 1X9WA 1C1DA 1V4VA 2PQ6A 1G6Q1 1P7CA 3MILA 4HJXA 1GKLA 5J0SA 2L19A 3VKHA 2HCRA 2HB6A 3BCRA 4JJEA 1C0PA 3A06A 2ID4A 1VI5A 2PRZA 3TWOA 1XTKA 3C3EA 4GBED 1VCIA 1KC3A 2Q9UA 4L8LA 2FW6A 1DEXA 3RH5A 1N5XA 2ZJBA 1Q0ZA 4K05A 1BX1A 1UWLA 2H52A 2ZI3A 3ENQA 4MVCA 1JXMA 1O8BA 3PNPA 1WSDA 1TE2A 3I1IA 4FS3A 5FYDA 3V1KA 2OORC 4RZXA 1UFKA 5DNDA 5REQA 1U3FA 3RJ9A 2HHLA 2O20A 4BAUA 1KEEA 3HVIA 1AIPA 2WRZA 3M70A 4Z1MD 4NNJA 1UXIA 4LF5B 1QRDA 2QHXA 2VG8A 5HJ5A 3L0SA 2G83A 1KNXA 3OJFA 3RQIA 2KX7A 1XHLA 3BC1A 3TW0A 2EZ9A 4YYZA 1SQ5A 2A0XA 2FSGA 2NSLA 1RM4A 4X3PA 2UZ4A 2W6OA 4U00A 5ALPA 5KAIU 1WDLA 3KUUA 1KMNA 4Q47A 3QXXA 2BONA 1YQTA 3MS2A 4RHCA 4EA6A 5I8WA 1G9XA 3MGIA 2Q41A 3ET5A 4N6NA 3UTCA 2Z3ZA 1UDWA 3M4YA 3RO7A 2PY6A 1OZHA 5SV2A 1QG2A 3GCZA 3O0DA 1PWYE 4H27A 1Y8ZA 1B00A 2GZRA 1BE1A 1RQ7A 2VQSA 4TXLA 4LDNA 2WV9A 1WXIA 3B6EA 2UZ0A 2QSUA 3BREA 1H4QA 4JBIA 2EGHA 2WJ6A 1M1NA 3ZYCA 1RLMA 4F5NA 2GH1A 1BU5A 2IYUA 3GO4A 4KLNA 4G25A 1HURA 2AJQA 4OGWA 4DLBA 4QZVA 1NP3A 4FCTA 3IV7A 1XZLA 2YZGA 1R5BA 4TV8F 1AXEA 4DLKA 4PPXA 2EZ4A 1CIPA 3IXLA 1KI3A 4M1MA 2ZWOA 3WISA 3EPGA 1KFTA 3MTEA 5JRTA 5DNYB 1Q74A 2EZTA 4AM8A 2ARKA 4ABTA 3BPSA 4YRQA 2WABA 2JHFA 3GDFA 3WGNA 1G18A 2VZEA 3FLMA 1GCOA 3KPUA 4HUQB 4RMIA 3T94A 4BN5A 5B5EU 3IB3A 1C9DB 5D87A 1IHUA 4ZCLA 5TARA 3EEIA 3WGVA 5JJIA 1Q7RA 4YR2A 2QPTA 3IUJA 4IIGA 4ND8A 4A82A 2RI0A 2PJZA 3H18A 2ZTDA 2JC3A 4C20A 1BDHA 2W6PA 1SXDA 1NV9A 2AD1A 1KK1A 3NCTA 3UHAA 1P3Y1 5CNJA 2CDNA 4KLRA 1E61A 1ZU5A 3H13A 4ME6A 3UQ0A 1RKXA 1XKXA 1U02A 2ETXA 2G0NA 4OXXA 5KYVA 3KEMA 1ZQKA 4RZUA 5BW5A 3O7WA 1DBRA 5KC9A 4NLBA 3JAKB 5BSTA 1QF6A 3AP2A 4IJVA 1QP0A 4WBNF 4UHEA 1DC4A 4ZOBA 1N2CB 1JHVA 2YS6A 4I1VA 2EBWA 4WDRA 3KR0A 4YJHA 3TJZA 3PQEA 3REQB 3W3AA 1U7WA 1A9TA 3IO5A 5FPSA 3FAKA 1GUYA 1UMDA 4A8JA 5IC4A 3QX3A 3ZDAA 1NK9A 3OWHA 3G2IA 1EGMB 4UNNA 3LXRA 1ND5A 2BRUC 4TQAA 2GXAA 1CEEA 4M21A 5K3SA 2A30A 2EKPA 2VO1A 3FLEA 4L4XA 2VXCA 2VYNA 4E94A 4ETWA 1YQXA 2ADMA 2NZJA 1N7JA 1SG0A 2DY1A 3JQ9C 9ICAA 2QTTA 4WI1A 3PO4A 1ZGCA 2JVKA 1ORVA 5H16A 4D9FA 1EG7A 3HJGA 1AKQA 5CFZA 1LB2B 1T24A 2YC2C 3LF1A 1LLCA 3DE2X 5AM4A 2KP7A 2V4QA 3I5XA 1HA3A 4OJPA 4HFRA 2DQKA 1XLTC 4URVR 1HE3A 4K8OA 4ER3A 3ZJYA 1X7WB 2EG9A 3I9V6 3KV1A 2JD2A 4QRHA 4EJ6A 5AW8A 2WZQA 1K6JA 1TK5A 2PNFA 2ZB3A 2JZBB 1V6CA 5KYWB 4HXFB 3VR2A 4RMGA 3KHTA 2GJKA 1SD5A 1AKYA 2VDWB 4LWQA 4TKUA 3SDSA 3SNHA 3ZC3A 4C0JA 1K27A 4Q82A 9ICTA 2VLIA 4GW3A 4OHRA 3C1AA 2R8HA 4I50A 3WP1B 3ZPXA 4D25A 3FCXA 5JJKA 1Y9AA 4OB7A 2N1BA 1E2FA 2JJ1D 5IDWA 2PCJA 5GVSA 4JLPA 1NJXA 3RB4A 2I0FA 5JFOA 5EXDA 3SC2A 4IO1A 4ALKA 4EFMA 4EHKA 4UZFA 4DDVA 5J2UA 1YC5A 3LX6A 3ZDYB 4C80A 1XS9D 2A1TR 2G5CA 2I7TA 2QQFA 3Q4GA 3RVMA 3OT4A 1SKYE 5JNRA 4CCSA 4RACA 1ZOIA 3PZRA 4YUWA 3KL4A 1XDBA 4XB6B 4B7AA 5B6JA 4Q9HA 3ZLJA 2JA1A 5CFNA 2GD0A 4ZARA 5ERYA 4K88A 1Z74A 3N53A 1SB8A 1RWBA 4MWZA 5IHPA 4XH9B 3EH1A 3DAOA 4JLKA 5IDXA 4ARZA 3ESCA 4REMA 4Y9SA 4HEQA 2Y76A 3DBIA 4Q1DA 4NOKA 1XGKA 2C82A 4F4YA 1HRDA 2P6OA 3DFKA 4R0VA 3KPWA 3NHYA 2XECA 4HQLA 4KXQA 4ZOLF 2PR2A 3A1DA 1D0SA 4M46A 4XCQA 4EFDA 4BNLA 2BFDA 2FH5B 4OCZA 2JKYA 3HXKA 1MXFA 2V4MA 1W34A 4I3GA 3W8RA 1K6MA 1XTZA 3AERB 2J5BA 3CUWA 3B0XA 3GZ4A 2NO4A 3IULA 3K05A 3NAGA 3PGVA 4WLUA 4EKGA 4YRSA 2FA9A 3NEYA 1M2EA 4KL8S 3WJ7A 2CXUA 3COVA 1N5KA 2P67A 4YMOA 4JLUA 5B3KA 4KHPB 2GPBA 3FBGA 4ZVQA 4CUJA 3PC2A 2YJ3A 3BWYA 3RYTC 4TGLA 5DB8A 5EPOA 3OPNA 2JEOA 3UY4A 2WVAA 1KFBB 1ONOA 1WXHA 1GZDA 2CFSA 3M6VA 4NJMA 4QGAA 1UZLA 4BMZA 4DLYA 1IDN1 1VE5A 1PQYA 2D1FA 2EG5A 2GESA 3C3PA 1KQOA 4NP6A 1GNVA 1VECA 1DXSA 3NUZA 4H59A 5IUKC 1KO8A 2ZIVA 4BMOB 2WF5A 1YZLA 1TJ4A 2AXQA 5G5HA 1ZGBA 5DW0A 5FI1B 2Y93A 4NR0A 5I6DA 4WLNA 3ROMA 3PC8C 3K9BA 3RSHA 5CP2A 2ZCJA 4YLGA 4QASA 1D6MA 3PUXA 4F5OA 4D3XA 3DAYA 1KRXA 4UUMA 1A7UA 2LKCA 5DNAA 5KWJA 1GCUA 2Z2XA 4ZRDA 5BRNA 4QZ9A 2LM1A 3OBIA 4M0PA 4OJ5A 3KZ1E 4MCIA 4NMMA 3QEMA 1YRQA 5DT2A 3GROA 4CF6A 7REQA 5AHOA 1CP2A 2J6HA 4C78A 5H82A 4DNFA 1I7SB 1HH4A 4CEIB 1ESDA 2Q9BA 4BC1A 5FO0A 1LI7A 1YI1A 4NU6A 2JDID 3SS9X 1T8SA 3DFUA 3TLMA 2YVAA 4Y0VA 4MUEA 2DUUA 2IOYA 7ICGA 3NBUA 4QOGA 4X1IB 5D7BA 4E88A 2WT8A 4PFSA 2GJ4A 4HH3C 4KTTE 3TKAA 2Q6LA 2C5EA 2VNJA 1LPAB 3RE1A 2QUAA 4ZQCB 2DTDA 4R9SA 3D8SA 1ZICA 4LJ6A 3BG5A 3MR5A 1Q0UA 3E4CA 4ROTA 4RESA 5EKSA 4K4HA 5IAKA 5I01A 5LWQA 2QBYA 4O1HA 3TSYA 4JOSA 5G1PA 1G38A 1FS6A 4ARSA 5I7HA 3JAMA 1K1QA 2E85A 4OMDA 3P20A 2YWRA 1SCAA 4XGKA 3CXRA 3A1WA 2P1ZA 3G9UA 4B3HA 2QX8A 1U8EA 2C54A 4RYLA 1D2AA 3IBSA 4B2YA 4HNHA 3HU5A 4JMUA 1DC3A 4O25A 4RW0A 4GRDA 3AESA 4A6DA 2V58A 4I2GA 3CR7A 4M9CA 4MGHA 3T4XA 1NDQA 3ZE7A 4DDKA 3E61A 3HXMA 1MQAA 4M8IA 4YI3A 4P5PA 4ZEVA 2I1QA 4LGVA 1QOQB 4BQRA 2A4MA 3PEUA 2QUIA 1G2IA 1SXJE 4C7JA 1YQ9A 2J5XA 4WNCA 2H31A 3KDAA 4P7KA 5EWEA 2AYXA 2QTVB 3T5BA 3BM5A 1WU7A 3WK4A 1J9EA 2H9YA 3F90A 1JXEA 1EJBA 2ZANA 3KOUA 4M37A 1POWA 4OP2A 4U7TB 5CVVA 1PT9A 1BHO1 2FF5A 3S27A 4EY7A 2IP4A 3ISBA 2KHVA 3KJHA 3KSDO 4F8EA 3OU6A 1YVDA 2PUGA 2X23A 2I99A 1OASA 1PV4A 3O4IA 3JPRA 3L7KA 4R1OA 2P4QA 1F2VA 3BWCA 3G2NA 4NYJR 4D98A 3JYQA 4PLYA 5KQRA 4Y2UA 4GQBA 5AKKA 4E14A 1R6UA 5LU9A 5EHZA 4LJ4A 2EXXA 4QKQA 2HF7A 5EHIA 1Z6GA 1ISGA 3QTTA 4MR9A 1T8RA 2FUNB 3I8SA 4FHZA 1NF3A 2HU5A 2VPZA 2BUBA 3CONA 3THSA 2SKDA 4IJMA 1GHTA 4E6EA 3UK2A 3H16A 3ZHYA 3C14C 2TMYA 4KLSA 4US0R 3WB2A 1QO9A 2RAPA 5KT6A 5CW2A 3D4OA 2RGRA 3E9RA 2WWYA 1KDPA 1FMJA 1PKEA 2L82A 4Q7QA 4Z7NB 4Y6RA 1QGAA 2K2WA 4LJKA 4DLLA 3QTLA 2ZG6A 5D3MB 3INTA 2BBTA 1NK6A 1QGYA 1VHQA 1IFXA 4HN9A 2NU8B 2R0QC 2H9AA 2V4UA 4Y6QA 1MF7A 5I45A 1T13A 3AHJA 2PUEA 5IINA 1Q11A 4UB5A 1MEJA 1N6NA 3KPYA 4M7PA 3SJUA 5GJCA 5KFPA 1V5EA 2YOFA 1JHRA 2V4ZA 1ZM4A 4LTMA 5ILOA 4ZGBA 2EBHX 1C1YA 4ZJUA 4KACA 4RQ2A 1AX9A 1DCFA 4P82A 3K5PA 5THXA 3L5KA 3KJGA 4Z4HA 3TCKA 1XNSA 3W2EA 5AI9A 2FYTA 5EXPA 5FBQB 2ZTCA 2MMGA 4FYPA 4MKGA 1E0AA 3QVTA 3NBAA 3GFKB 3NT5A 1Z3EB 3OIYA 3U56A 3EG9A 1X0XA 2FJ6A 5LXTA 5KFMA 2XCTB 1JEEA 1KY4A 3R7BA 2CLOB 3FLAA 2P9HA 3UT0A 3CRNA 4G65A 4AP9A 3EDYA 4N82A 4E31A 2QN7A 4F5EA 4MFCA 1HIWA 3ABRB 2QJOA 2FQWA 3LHSA 2ET6A 3NDJA 4O1MA 4PLHA 4TS1A 4GKKB 5ALOA 1TIBA 4UTZA 4I9NA 1COOA 1E5XA 2UVQA 3OUZA 4I9FA 3ANYB 2WJZB 2FCAA 4RIHA 1T1JA 4XDZA 1GFZA 4JOBA 3DMRA 5CXQA 1E7SA 2ZI6A 3ETDA 3JSXA 2WHQA 4HH1A 2V6GA 1CUBA 2CC2A 4WY5A 5FNVF 2ISSD 3H5AA 3QWHA 1G17A 1MJNA 1Q1GA 1QCYA 2WTXA 2XBLA 2INGX 4TWJA 3TRDA 4QODA 3TSAA 4QT4A 3E0QA 1O94A 3TR6A 1NK8A 1B0AA 1O9HA 3L7CA 3RPEA 1OWOA 2FUEA 4HAVA 3OE7A 2ZE6A 3RUAA 3CZCA 2EP5A 1U99A 2IY7A 3NONA 3U13A 2Q2WA 4FZRA 4D3ZA 1HO3A 5F2NA 2QG9A 4FFBB 3HRHA 4P2BA 3WGKA 3C2MA 4MP3A 2D3TA 4YT8A 2H1SA 1CU1A 2XBUA 3C2QA 3IILA 3ZV5A 1HORA 3RADC 3X1KA 2VHEA 2BI4A 3K94A 4YD1A 1T4DA 3C1UA 4FZ3A 2R8JA 3BXZA 3T38A 4R8VA 4TMTA 3UB3A 2F67A 4BVKA 1E1QA 4NPCA 2JFVA 3SNKA 3B9QA 1KZ7B 4P80A 4Z7OB 5IZCC 3FTEA 5TMEA 2Y1WA 5IIMA 2JI9A 1H5UA 3DVAA 4PCLA 3FDZA 4HWRA 1SY7A 3K4QA 3G0BA 3AU9A 3BWXA 4NDAA 2WTBA 3AFHA 1DDGA 4FR2A 1Z4PX 4TRMA 3RSQA 4B45A 1N25A 4IQUA 3KKAA 1Y81A 2OYSA 1K1SA 1X9MA 1WF3A 4RL4A 5YASA 2AKYA 2EEZA 4DA9A 4AY6A 3KAJA 2FOXA 4JX8A 3WRYC 1XVIA 3K9LA 4D3DA 3WWDA 4ZQHA 2MCFA 3SF0A 1ZEMA 1HNXB 1X92A 2W6JA 3WRVA 4EHFA 3QVXA 2X15A 3X1ZA 1JGTA 7ICNA 5FX2A 1RLUA 3T7AA 4N6OA 1QYIA 5DISB 3WMWA 4CIWA 2PXAA 4KAJA 4TN5A 4YVFA 4ZVRA 1DEOA 3REOA 2DOKA 2FWRA 2RHRA 3QVWA 5E6SB 2H3ZA 1Z1BA 3RS0A 5A3RA 3SVZA 2RKBA 2ZS9A 3LQFA 4XYGA 3MBOA 5J2UB 1KI2A 4MCAA 2WTFA 1MAHA 3SLRA 3QX8A 1GPUA 1GM5A 1UK6A 2P68A 1B1AA 1ZBQA 8ICHA 2Z6VA 3DFMA 2B34A 3IBTA 1GQFA 5K4AA 5AHXA 2AE1A 4PZAA 5K0CA 4J4TA 1HSZA 1DJOA 4YMVA 2GBIA 1X2EA 4MR8A 4N0QA 4YHBA 2IPLA 2AVDA 2DJ5A 4PYKA 2NO0A 4GYJA 4GE0A 3LVBA 5KG6A 2V7BA 1XA4A 2PLFA 2VCHA 3KKOA 3PXDA 4RF3A 3W6OA 3CNLA 5CX1A 3S7ZA 1V9LA 3CNQS 2WG1A 3AKYA 1WW3A 3GFQA 5CT5A 3NXSA 4LWOA 3TUJC 4L5CA 2TRSB 5IT0A 2BY4A 3M5PA 4PG6A 5DM60 1P73A 4PHDA 4P0PB 2OHGA 4PXAA 4R7GA 5FUVA 2QAIA 1H93A 3GNQA 3HJUA 4AN1A 3QY0A 3WI7A 3ZWCA 2C03A 1H05A 2CHFA 3E9NA 1TL7C 3DZIA 2JGEA 4NCNA 3C8ZA 1I9CA 2IUYA 3QHPA 4F6CA 2LIPA 1CR2A 4O4LB 2X8LA 5A5EA 3BKWA 1GZVA 2QK4A 3R7FA 3T15A 1C7ZA 3VJLA 3PW7A 4B3GA 4PPNA 2X13A 2X7HA 1YFZA 2YUIA 3B52X 4M87A 2CXNA 4NPHA 2L5YA 3NDRA 3IMGA 3LDAA 4YTEA 3ZWWA 1R8SA 5TF4A 5IC6A 5JS8A 4K1LA 3QJGA 1TJPB 2V6MA 1YS7A 3BQ0A 1GTMA 8ICYA 3CEMA 1SIBE 4J3JA 3TSZA 4DVJA 2O3JA 3JYNA 1Z83A 2RMKA 5INTA 2FP4B 3I6QA 4GUAA 4Y3UA 3S3TA 3SFZA 4D79A 1N2XA 4YG2A 2QENA 4DA7A 4RJKA 5HBGA 3PNMA 1TMOA 5F5LA 4CCWA 3TUZC 1GSHA 1IIRA 2JCGA 4C1BA 4CI9A 2HUPA 2PZBA 1SHLA 2QTVA 1YV9A 1Z00A 2G1JA 2O2GA 2XZPA 2OA0A 4CU5A 2HHTA 2E1PA 3GA0A 1GKIA 1Q16A 1GV1A 1WWVA 3P7MA 4H0NA 5EC8A 4YAKA 3TGPA 3F9RA 1I7NA 2AZMA 3OC6A 1U8TA 3HKEA 5DBOA 2XTZA 4QOIA 3NBFA 1UMBA 1DPGA 4M1EA 4EPRA 1SU6A 5HK9A 4PG8A 5G4KA 5BORA 5DCYA 1KDTA 2AZ4A 4BLVA 5D8DA 1OI4A 1FQOA 1NVBA 3TAHA 4Q4JA 2DETA 3ONVA 1VQ1A 1S0VA 2I2AA 4LPKA 3UYKA 3E4DA 3AB7A 4FP9A 3H1BA 4RQ4A 3L06A 3I9KA 3PFIA 4XUCA 4UU0A 2YMLA 1W5EA 1IXRA 1Y82A 3WSTA 1OZ0A 2P2NA 2PT6A 1MG0A 1QSSA 1U0GA 3CZ9A 5AR1A 3VO1A 2DULA 1SCDA 3QSGA 1JHYA 3I01M 5IWCA 3W5JA 2RHFA 1CJTC 2VSFA 1QTNA 5G2OA 5JXGA 3UMMA 2H4XA 1I6MA 3OMXA 1RFLA 4DZRA 1D8BA 2VH1A 3BB4A 3S2YA 4J9PA 2FWNA 4HVTA 1K3TA 4LMPA 5JC1A 3E53A 1VIYA 1OLOA 3BK2A 2KOBA 3EW9A 1K0FA 2B4YA 4B4WA 5BN5B 2AEJA 2PUVA 3E81A 1KVRA 3SDZA 3ZZ0A 4WXEA 1D4FA 1T1IA 4ZN6A 4CNBA 1A95A 3THRA 5DK4A 4G5GA 3IDWA 1ORWA 2ZRNA 1LV5A 4TTJA 4B0PA 5KQPA 1LUAA 5KFTA 1YOBA 4EPTA 2ZYVX 4OU4A 4L5JA 1R27A 4K6HA 3A2KA 3II6X 2VC2B 4OQDA 3R6DA 3GD5A 3D4PA 2ZXIA 4OO1J 4TQSA 1L4NA 4GRAA 5DK6A 4B3XA 2JDIA 3BXOA 2JHAA 3FRHA 4RKEA 3KTAB 3JQDA 1U28C 2QQ0A 1S4MA 2R4UA 5E7JA 4C3UA 3THVA 3QVGB 1ZJWA 4F3TA 2WY2D 3JR3A 5T4EA 3VNBA 2BUCA 2KIVA 2BMVA 4CFYA 3CUEF 4IDPA 1G8MA 3G9QA 4Z6FA 4HOYA 1Q3HA 5LLDA 1A2OA 1MN6A 3EDOA 3OJWA 4M49A 1YAHA 4QUBA 4C0QC 4YMHA 2GQ0A 2CVQA 3QRWA 4C7OB 2KPOA 4ONEA 5BOVA 2XUKA 8ICKA 3W7BA 5JDIC 5LOVA 3GLIA 1DUSA 1JDTA 3MDCA 3NDPA 5AO9A 2HCJB 3BS5A 2C3MA 3VZBA 1HUZA 2YXEA 4EGQA 1VYHA 1TRKA 2RI1A 4R71A 1R18A 3ETGA 4J0EA 4M4SA 3J81j 2ZRCA 3JVDA 1RLOA 4I5DA 4X45A 4EMBA 4ZCRA 2QNRA 1MABB 3HUTA 4YGXB 5KFAA 6REQB 3U48A 1P17A 2OGTA 4HLUA 3GCXA 4ZOHC 4C6TA 4IJUA 1HNNA 3ZDEA 4KN8A 4PO8A 5FNVB 2VIXA 5LMCA 3R0JA 2RG7A 3TIFA 4YJ2F 4H31A 2ROQA 1IG3A 1KP3A 1Y33E 3QHQA 5K8UA 1E3TA 3ZD9A 2Z8YA 3LDGA 3OU7A 4J94A 3TQSA 1GN8A 2GASA 5B3JC 1JDNA 2AFIA 4ZT4A 2CUZA 3ORQA 2I6UA 1GQQA 4JZYA 2VJKA 4XM2A 2C1EA 4LOJA 4BAGA 1COWD 3G79A 1LNQA 2C84A 2VPWA 4YRZA 1Z0FA 4ZI7F 1SUBA 4IQ8A 1P3DA 1JFVA 5EERA 2Y0EA 2EEPA 4CTKA 5J1SB 2QD5A 2WB1F 1QHXA 1EBFA 4R9UC 3IAEA 1IMOA 3R3UA 4G85A 2G8NA 1DIRA 1K7CA 2Z5VA 3HHPA 4J9UE 4JNCA 4EM6A 1YA8A 2BD0A 4KO8A 3L4JA 5ADHA 1KO1A 2XKAA 5CA0A 3RSCA 1WZUA 3M7IA 4OY3A 4PZPA 2H2WA 3O2SB 3TLAA 5JEDA 5T4BA 1NBWB 2CFRA 4KO4S 4ZZ2A 4LI3X 3DVQX 4PIVA 4UM5A 1PZFA 3DE5X 5CT4A 1CS4C 1UMKA 3F6PA 2F1HA 1YRWA 2WUEA 3JPWA 3OJOA 3T9EA 4D5EA 1Y3FE 5DLGA 2VPXA 1EHYA 3LW7A 4CQMA 3HDTA 2W7TA 4EEYA 5TPZD 2Q62A 4MRMA 4BMYA 9ICKA 3BS4A 4TUYB 4B46A 5CWRA 3OA0A 1QHIA 1JQLB 3UPQA 4FDVA 1CHDA 2A3NA 1KYIA 4L07A 4ZVMA 2V7EA 5J2IA 4K1XA 4MQMA 4DLGA 5FTKA 5C3UA 2GOYA 3RR2A 2HOFA 2V3WA 5CCBA 4OHXA 2J9XB 2PKWA 3GBPA 3LX4A 4P4NA 1D1SA 1JBEA 3C6MA 3WQRA 3WYGA 5CDUA 3IUQA 4QFMA 7YASA 1KSFX 3EVBA 3GUZA 5KHOC 2DWPA 4KDRA 4F4FA 4FYIA 3BSSA 1U1IA 2LW7A 4O59O 3WLJA 1OWPA 4B6OA 4EH1A 1WHSB 1WHTA 4AY2A 2FXVA 2H07A 2W6NA 5CT9A 4F96A 4ND8B 2CSUA 4TROA 5JWRA 1N5JA 4FWIB 2A1JB 1TVKB 2YUTA 4B7ZA 4GP9A 5A9RA 5K2OA 3B60A 3ZY3A 3R2JA 1B8OA 4QDKA 3NUQA 1CB0A 1TQ2A 3U80A 1ZIOA 5G4KB 3SWWA 4YYEA 2C99A 5DBFA 5DOZA 4YV7A 5IM4F 3D3EA 3RTDA 4UB1A 3OLCX 3A9VA 3HP6A 5JYDA 2BGGA 4BO0A 1BHQ1 1GTJ1 8ICVA 1W4AA 4LXIA 1QOZA 2X4IA 1NJ5A 2R8XA 3L04A 4Q1FA 2GLXA 2B78A 2A9OA 2FOIA 3FNEA 3LKVA 1D2MA 1U2QA 2ZDQA 3BFPA 3FCCA 3GFRA 3QOYA 4J0IA 2OXEA 4L7VA 1WV0A 2ORED 2W9XA 5CMLA 2XVTA 3S68A 4OYHA 2C2XA 1U9CA 3TSOA 3WGLA 3CZMA 4UBIA 4NG5A 1WXQA 3EQ8A 3EIOA 3WGMA 3HCAA 3D3JA 3RARA 3N9IA 3LQ2A 4PG5A 1FFUA 3TZCA 2OOSA 1E9VA 4NNPA 3UGKA 1RI5A 3WMEA 1E2QA 1XP8A 4G1CA 3NAZA 3SD7A 5JIBA 3T1QA 4AWXA 2FDCA 1AUQA 1NBMD 3GQVA 4HRAA 3H3XA 3HU1A 1IN5A 3MJTA 4OI1A 2IA5A 1JQBA 3GUYA 1IMJA 1K08A 3EXEA 3EZ6A 1V5GA 4I5FA 3ZWKA 3PFFA 3W5DA 1WM1A 4DQPA 3VJMA 3KHHA 2FLLA 2H3IA 1HETA 3WAGA 4H7DA 3VPSA 2A1AA 1A7KA 1U48A 4I4LA 4MW5A 1M1ZA 2JF0A 3B12A 1A5ZA 3AV3A 2K4IA 5KTQA 1TJ5A 1XYYA 4HMPA 3RF6A 1DXOA 3MCTA 5K3EA 1TKCA 3R7NA 2Z58A 2CFOA 4CU2A 9GPBA 1P1IA 4XQ0A 3CINA 4MKIA 3AM9A 4QBGB 1OH5A 3V7UA 2HRZA 2WSIA 3LY8A 4FQ7A 3PFBA 4JVMA 1I14A 3CUUA 3KNZA 1U45A 4MIKA 3GUVA 3AKCA 1PD0A 3GT4A 3OT1A 1OKKD 4G5QA 4IS2A 2AZXA 3LHIA 3RUPA 3FTNA 1RYSA 2RHBA 3MWEB 4YJGB 5JG7A 1JQ5A 3FYTA 4M7OA 1KJ8A 4C05A 3VDRA 1TUBA 3WLPA 4CKBB 2BGMA 3M2PA 1YBMA 3HUFA 4G86A 4PTLA 4LBVA 1UDXA 3ILXA 1SBTA 2IZ7A 3TOXA 4M9NA 3UATA 1ANKA 3ZWYA 2BP7B 1R4AA 2DFVA 3P1JA 4B35A 2VJPA 1KN5A 2H3FA 1NASA 1WDWB 3G0DA 3D6NB 3GK3A 5J1TB 5BWMA 3VOBA 3EVFA 2WNHA 1YS2X 2W8ZA 2FPLA 1P72A 1SUSA 2AMJA 1Z4IA 4XAQA 3IKVA 2YNMA 4PLGA 1HE1C 1DAGA 5I7AA 3ZWQA 1H0HA 4AF8A 2H00A 4CNQA 1RPLA 1EWRA 1EGVB 1JSRA 4BNWA 5IARA 4G4JA 5JI2E 3GILA 4GXNA 1B4FA 2QG6A 2OHOA 3KHSA 4M9RA 3QEAZ 2CVOA 2XB6A 5EXSA 3GGPA 2CMFA 3T3MB 4CM9D 1R0RE 4XI9A 3H8MA 1NYQA 1S0OA 3UKOA 1WD7A 2FN9A 3T3DA 1DRVA 1ULSA 4HLDA 1P0MA 3SXUB 2OH2A 2RGXA 1D2EA 3IBFA 1PEKE 5DIZA 3BXXA 2CNWD 5DYYA 2Q6OA 5IMSA 3UGQA 4BB0A 5GY7A 5HIJA 3KWLA 3BL6A 3MCWA 1VGVA 5IM5A 1B8PA 2H5IA 1GIAA 3E84A 3ZDXB 1MP0A 4O2BF 4YH1A 4U7DA 4I2JA 4R9VA 4HSEA 1GNPA 1L4FA 4US8A 3MG9A 4JN6B 4KN4A 1JG6A 1MAAA 3ZHQA 4IHAA 2I3AA 2R84A 1DC7A 1RP7A 2SNIE 3P9IA 3P0HA 3QVLA 4LCEA 4TQRA 2XA9A 1EX1A 1GT91 4MV9A 3ZKAA 4RPZA 1LBSA 2F62A 3ZS9A 3GD7A 3RS3A 2YV1A 4GI5A 3VUFA 4UDOA 5KUTA 4DR4B 2DQ4A 4WGGA 4ZQIA 5TNXA 4CKYA 2H1RA 1FYXA 3DT8A 5G40A 4HAYA 3ZU4A 4WVLA 5AESA 4EG0A 1SA0A 1QPZA 1FCJA 3WKEA 1Z45A 3K75D 1KVQA 1DB3A 5HGXA 2WILA 2HZ7A 5CT6A 3FPFA 5LNK1 1BMDA 4NOJA 1OREA 1S9DA 3CY6A 3D0RA 3LGSA 2QE6A 2PS3A 2V9CA 3QX9A 4JXKA 1B43A 4PONA 4ZPJA 4B1FA 4M0AA 3MYRA 3AOGA 3AZPA 3L46A 4Y2YA 4R8UB 5ABPA 3HMKA 3PZPA 3K53A 4XWAA 5GMOA 3C3DA 5LFAA 5CYFA 4GOJA 4IY1A 4BO6A 4KLUA 2Y2UA 2O48X 1DAPA 4R4JA 3O47A 4P0QA 1L4EA 1EXMA 1QX3A 4W1SA 4EJSB 1ZMBA 4TMXA 1TYBE 4FINA 5DN6A 1PSWA 4B6SA 4I55F 4ZDIA 5C18A 1PV2A 1JX4A 1FUIA 1ZQ9A 4MYSA 4RFSB 4KSCA 3UWPA 1NJFA 3B9RA 4J2TA 3PTLA 1XMXA 3U3ZA 3AWIA 2H29A 2VFAA 2YRXA 3VU9B 3PNYA 4I6EA 5ERXA 4YPFA 3CTPA 2H59A 2GO7A 2VNHA 4PWYA 4RZSA 3RC1A 1Z8FA 4JLOA 3PEFA 1QFJA 5IJAA 2AG5A 1L7OA 3KHUA 3QM1A 4MV4A 4N03A 1QU2A 1U0NA 3OQJA 2O50A 5LDHA 3G2LA 1GD1O 5ES3A 4R66A 4AJPA 3HILA 3RWBA 3KKKA 4HB2A 1M73E 3WNBA 4DE5A 4DL9A 3R3YA 5G02A 4R2WA 2AFHE 4EFLA 3RKSA 2H7VA 2OGUA 4URZR 1RPTA 1BVHA 3KOWA 4WCFB 1I01A 4KQ1A 3E5HA 3FVVA 1QHHB 1YULA 3EMBA 1A9SA 3RKRA 4EW2A 4LJ8A 4A73A 3LCMA 4C30A 3BEDA 4Q1CA 3G3EA 4LK2A 1R5OA 2OFOA 1NBAA 4TURA 2CB9A 3B38A 4MINA 3PXCX 4RETA 3W06A 4F45A 5I7WA 2PYZA 1IRXA 3HDYA 4QUJA 1T91A 2P2GA 5J4LA 1L4BA 2RGNA 3C8HA 1UODA 3ER6A 1W5AA 1XSPA 3FJYA 2YWFA 4H6XA 4REOA 2AFIB 1QONA 4FPXA 4ANFA 3E2EA 1QGUA 1ZK2A 4WIAA 1FQJA 2REQB 4PAOA 4IOJA 1JI3A 3RT7A 1VE1A 4LXYA 4IJWA 3GF4A 3MFYA 5JISA 3T5KA 1ZUD1 2WT9A 4JBYA 4D5GA 2HTFA 3ZWAA 1U8AA 5IYZF 5IJ0B 3DKPA 2XZTA 1OJ7A 4M89A 3C24A 5BQ3A 1H0SA 1YI0A 2QAJA 3FYSA 4IIJA 5A4FS 5HHIA 3QYPA 4N7BA 3FROA 4AY5A 3QFHA 3F5SA 2PKQO 2RH4A 1CJKC 3G7UA 3DBHB 1T8UA 3R3HA 4WMLA 3DWGA 1MX1A 1Q7EA 5G0WA 4RPCA 3ZQ6A 5EJMA 1DMSA 2BJVA 1JKXA 2JASA 2R8BA 2HMAA 2PGIA 4ACOA 4FTWA 3LF2A 1YL7A 2DPLA 3BIOA 1F1JA 3CNEA 3DVLA 3HBLA 4GGOA 4B87A 2OHIA 3CNHA 4KQFA 5DEIA 3EGXA 3R0XA 5IK2A 1CK4A 4MP6A 4CETA 2ZUDA 1J8DA 4R1LA 4HRVA 1Z0ZA 3L1JA 5LXTB 3F73A 4EBBA 3TLZA 9ICLA 2Z2IA 3JD1A 3MLEA 1URPA 2BZ1A 4ENVA 1ZINA 3CNNA 3DV9A 2W6JD 3F97A 3EDQA 4ZIRA 4AI6A 4MWEA 1KYTA 2W2NA 5F1OA 1BOFA 1E1LA 4DSUA 2A9RA 4LGCA 4RPIA 5DXFA 4FKMA 2P77A 4RK4A 3GXBA 1MW9X 3ASYA 5DULA 1ZUHA 4A0FA 1JSXA 1SURA 2QM0A 3JQBA 2IHVA 1SNYA 3QKTA 4CM8A 3CLTD 4EUEA 4B8WA 5ITZB 3P94A 5E95A 1FYFA 4RNMA 3ZU6A 1PX0A 3TCXB 2O8BA 1TTPB 5L4SA 2BMJA 3UG6A 4ZJYA 2GN2A 1C0IA 4Y67A 4PRZA 1Z0KA 3AEUA 4AO6A 2NTNA 3AJ8A 3C2KA 1M72A 3GGOA 3UANA 3AONB 2VQEB 1SUDA 1RWPA 2M2IA 3SMQA 1R16A 2O0JA 3O1HB 3KQLA 2Y1CA 1YVPA 4DSAA 1ZI6A 2HLNA 2W37A 4B7XA 2XXJA 1B14A 1MHPA 3E2IA 4NENB 4KLEA 5CVUA 3S70A 1FSZA 4R63A 3WQBA 1SJ9A 3U7FB 1VM6A 3H6HA 1E2DA 2ERXA 3LNCA 4HFNA 2FFJA 3NBMA 4EENA 1VMKA 2FMKA 3EQ2A 5DVZA 4Z53A 2PV7A 3WLLA 2QPAA 5K8IA 5B2EA 4BNKA 1CEZA 2LDBA 1V37A 5A3SA 3W5UA 2XYVA 4M0CA 1VLHA 5JBQA 2XICA 1GOTA 1G5HA 1PWHA 4J9QA 1QVVA 2HY7A 3NRCA 5T4HA 1AN9A 3WSWA 3VDQA 1P1FA 1M8GA 5CVJA 1JXAA 1I4WA 2WJPA 1KQPA 5G1NA 4FWTA 1VP3A 4BVBA 1C2YA 2G1UA 4KNVA 1KKLA 1AOXA 4QTXA 3QU7A 4X8LA 4KODA 4RLFA 1I3NA 1ZO8A 2XZDA 4QPNA 4D44A 3OPYI 6NULA 2ZZNA 2FX5A 5IMBA 5BN4B 1U4NA 4XIJA 1MG5A 3Q9UA 4L3WA 2J3KA 1IDOA 3OQVA 5A04A 2UXBB 3IKJA 3FKJA 4IDFA 1VBNA 4YUXA 1JFRA 1FC0A 4YLYA 4K2AA 5CDFA 1W5BA 1Y6QA 4KQCA 5F3WB 2Y0SF 4DOCA 5MN6A 4BNTA 2HHQA 3RIXA 2ZQ5A 2VKQA 1OE0A 5TF0A 2O6HA 5ISMA 4JJ4A 4LOLA 1V3VA 4YJFA 1GAWA 2BFFA 2FP3A 1RJ9B 2HSJA 4AMGA 1P7VA 2V7VA 4GAEA 1N57A 1WJGA 3IUSA 1WY7A 3KUDA 3EFOB 5KFLA 3DHEA 4PHFA 3JSAA 3QU5A 2NXCA 3V6JA 1M6VB 3DOUA 1ZU4A 3UA3A 1U7PA 3PY8A 1KVSA 1HTBA 2HA6A 2Q6IA 3NAQA 5DM4A 2FEAA 1NXTA 4IGIA 2B3DA 3T5JA 2FUCA 5FQNA 3WWPA 3K4PA 2XI9A 5JJBA 2CZCA 4INOA 1NFQA 5J58A 1WSWA 4Q4LA 3A6KA 2I66A 5HNKA 1ONPA 3PHCA 5I7UA 3C0KA 3E8MA 3FJOA 3UMYA 2YL2A 2GEBA 2VYFA 1T2VA 1UHUA 1EJ6A 4TS4A 2KBFA 1TQ8A 4OXRA 3MS4A 1TZMA 1HEUA 1VXOA 2FW7A 1NVFA 2H4HA 2DFNA 3DEJA 3K0HA 4HX9A 3VZPA 4NFHA 3OCXA 4GBMA 1XZJA 3MM4A 4Q48A 1ZJ5A 1UBRS 2BI8A 2W0MA 5AJUA 5HDBB 3HUDA 5JO9A 1KJNA 1KFDA 1REQB 2I3ZA 4BWVA 1TZBA 2EHDA 3JQAA 5BWBA 5F7JA 1I9GA 5K3DA 3R6TA 3ZD6A 1PZGA 1WL8A 4IAOA 4WKPA 1GTRA 1BEEA 4XARA 4Q3LA 3A1CA 4GZ5A 3RAQA 4W7HA 5A2QA 3WK7A 1E9SA 4G2NA 3WNDA 1Q14A 4DWJA 8ICSA 1SCJA 1YR7A 3UMJA 4MHTA 3FNBA 2QY6A 3UKDA 4JXZA 1KJQA 1SB9A 1FE8A 2XB9A 3IELA 2H5JA 3JATA 3PE4A 1U31A 3MCUA 3O91A 4I55B 1KI8A 2RGUA 4NBUA 4UE6A 4BRUA 3I09A 2NUBA 4KHZA 5L95A 1BPZA 1CTQA 2PFKA 3CMMA 4NAVA 4R1TA 3X1MA 4E2ZA 4KGXA 1WPRA 2FHPA 4Z6EA 4H17A 3G5TA 3HG7A 2HM7A 2VP0A 2XOXA 3OOEA 1GRNA 4UCWA 1NP7A 3TIXB 4IXWA 3WLRA 1KO4A 5DB7A 4LFCB 5A06A 3TW6A 3HA5A 2FMHA 1RQ2A 3RFVA 3WL3A 4YN4A 1G7SA 1BQ4A 3NVWA 1I4LD 2YBEA 1ZUWA 1ELOA 1X8KA 3WIBA 2VRCA 1DAKA 3QU4A 2ECKA 1N1GA 3L0DA 1S76D 2GR9A 4NJEA 2VDKB 5KT3A 4L8FA 5HOEA 1OXSC 5JAIA 2ZYAA 3EXAA 4XX1A 1RI2A 4M1WA 2HF9A 5CNKA 3AP1A 1LNZA 4C8LA 3M5DA 4BPBA 1QHEA 1PT7A 1XZKA 4F6RB 3WB1A 4KLIA 3V7JA 3H05A 4Z0TA 1R0CA 4ENWA 3EXHA 1CY7A 3OOSA 4EBEA 4LSWA 4HDSA 5AVKA 4YONB 5GONF 1G66A 3UBTA 5CNMA 1F0NA 2PH3A 4MKXA 3JAWA 1J4AA 5K0ZA 4KGZA 4P34A 4CM8B 5JMWA 2IUFA 3A28A 4WZZA 1L3BA 3OWXA 2G06A 2FE1A 2P11A 5A7HA 1VMDA 3WWOA 1X80A 4WASA 1PE0A 2XRZA 1K3FA 1H3FA 1YKSA 4ND3A 4OQPA 4U9IS 2CLMB 3LLUA 1B3BA 1OBCA 2GBPA 4GVLA 4J0QA 4YV1A 1E1QD 4L7QA 1SQSA 2D0PB 4MYRA 3WGIA 1Y4AE 1FYVA 1Z34A 1VIVA 4AUKA 4LQ4A 1EINA 1PL6A 1D03A 2BWJA 2PUAA 2KJ8A 2WPNA 4H6WA 3BL8A 4FHEA 4ILEA 4JP5A 3O92A 3C6XA 2PUTA 2HBZA 2ZBRA 2LBOA 1BO6A 3QVJA 1RABA 2LP4Y 4UHHA 4PQYA 1BTOA 3VOSA 1D5WA 2XIJA 5EINA 3VTAA 5J0YA 4ZANA 3MABA 1U1CA 1H38A 1HJPA 2C29D 2F1RA 3Q3HA 4WV3A 1NMQA 4HL6A 3T3FA 1W9HA 3USZA 1IB0A 3VU9A 4BFSA 2GK3A 2QPLA 5CA1A 4W5RA 2FLPA 3ZN2A 1EFRA 3R5KA 1TZ2A 1DJPA 3NYRA 1DC8A 3ED1A 4UTRA 5F64A 3AJ9A 3PX7A 1XO0A 3PHGA 1ZIDA 4RL6A 1KKUA 2Y1LA 2Z43A 4ED9A 2XKJE 3O4VA 4HV4A 2A78A 4ISCA 3RC7A 9ICQA 3ZLTA 1HZZA 3A6ZA 3DCJA 1ZBDA 5AKHA 1FDSA 4G1UC 4MB2A 2QPOA 5HQ3B 4KR3A 4KI0A 1GTVA 3KTAA 3OLZA 3R4VA 1Q8KA 3VR3A 4AZVA 1LSUA 5C52B 1Y7PA 4QOSA 5D86A 1CDOA 3ZEIA 4P38A 4JJ8A 5UKDA 1R3UA 5IDVA 1P0CA 3KP1A 2B8JA 2O0LA 1XNJA 2PS1A 4QM7A 4UBBA 2YOGA 4JBNA 4NQZA 3NIBA 1BEZA 3M3HA 2DR2A 1IK4A 2V7UA 4U6PA 3LGAA 4OH7A 1DOAA 1F8FA 2BPOA 2J0EA 2CLIB 2R6R1 3GJ4A 3LUHA 2OYYA 1G8AA 4KXXA 3WJ2A 4EA9A 5JUMA 5FWXB 3T7CA 3G0CA 4TXNA 3HA2A 4RKRA 3RU3A 4MLPA 2UVWA 4EO7A 1T8TA 4EG6A 4CG3A 3NVAA 2C9OA 4LZWA 1R8JA 4URXR 2VA2A 4MO2A 3Q87B 4GX0A 5FHQA 4GD3Q 4WQMA 5HYVA 1L3UA 3BGDA 2WICA 5KOJA 1RKUA 1OX4B 3GV8B 2ISQA 1HI9A 4K03A 3PPVA 3KSAC 1G64A 2FPWA 2ZUVA 4GMFA 3KR9A 3S1SA 4XX0A 2P9GA 4C4XA 2RB4A 3L7BA 3NANA 1JAIA 3OHBA 5AVQA 2B1IA 3TLBA 4KXVA 2CCKA 3QSYA 1MEEA 4AXXA 2IS1A 3U1BA 3T0IA 5MGBA 1FNNA 1LTQA 2FDRA 3AL3A 4K3UA 1XQ6A 1LB1B 5KDLA 3EPLA 4RDIA 3KD3A 1FQWA 2QQEA 5LZ2A 1W36C 3AY3A 2WZDA 4L5YA 4CCHA 1QE5A 1RRGA 1ZESA 4FZ5A 3P2KA 4QLAA 4DA4A 3BJEA 3VTKA 5IW8A 5FBWB 2WWWA 3BGOS 1N0UA 2ZYGA 5CXSA 1SKQA 3DJYA 4HWTA 1E79D 1WW2A 3U19A 1T2NA 1ZNZA 4P58A 4QQ8A 4XYBA 2J6UA 1RM5A 2DE0X 2HHVA 2JJ1A 5KAMA 1YKFA 2AC2A 2GAJA 2OXOA 1XC9A 2ORIA 5H3CA 2P6PA 4HEJA 3V8RA 3NASA 4IZ6A 3JPOA 4WECA 1FFWA 1RYYA 3E3AA 4J0DA 5CX1B 1UBMS 4OEHA 4PYOA 4EITA 3K20A 5DHRA 3V7LA 1KVTA 5BNWA 1ABFA 3GB9A 2RBGA 2WJHA 3OJXA 1KMHA 4ALMA 2J33A 5BV8A 1ECWA 2AGQA 4NEHB 2FSFA 4X7RA 4ZVNA 4DIBA 3G6YA 1S8NA 1BKDR 3PXUA 1UPXA 3DMHA 4IM7A 3A0UA 1XN1A 3FMGA 4IEIA 1YWGO 4UNIA 1RWMA 1PSZA 2HCBA 1OXKB 1GAJA 3D2BA 5LYJA 3W8DA 2OWEA 1BWPA 1WXXA 1QANA 2FSUA 3RH0A 1HSOA 2JIZD 4RTPA 1RYDA 1JB1A 8ICTA 1NLZA 2BTOA 2WUWE 3LUKA 5CVDA 4AU1A 2EX0A 2W03A 5J47A 5AW4A 1Y3DE 4AX4A 4DJEC 4JC0A 2HFJA 4J76A 3WXBA 4XDHA 4UB2A 5EZSA 1TC1A 2QR5A 1FLVA 1GUZA 3G23A 1D1TA 1O96B 3WAKA 3I4CA 4HVAA 4ID9A 1OLUB 2RK6A 1GL3A 1KTVA 4FYHA 2JFYA 4JLNA 5TB5A 4EYQA 1JEYA 3WL4A 2WYIA 1ID1A 1ZW6A 3NYIA 1G4HA 4K46A 1Q0RA 2PS0A 3FVQA 4AUMA 1G3IA 3GLUA 1Q0QA 4C4ZA 5KNBD 3ESXA 2CL0X 1BPBA 1U47A 3IODA 2A5DA 2EFHB 3C85A 3MWEA 2WYVA 4G23A 2Q46A 4YAJA 1NZDA 3X43A 2OV8A 3AL0C 5DGIA 3PENA 4MLZA 5F3RA 3EYWA 2ZT6A 3JQQA 3H5RA 4FBLA 4RPHA 5AVWA 1RE1A 1E3DA 4MUJA 1IU9A 3DNMA 4ZXPA 2Y1GA 3QF4B 2ES6A 1CRXA 1NQAO 2GXUA 1P4AA 1RAHA 1BXGB 4EUNA 4DV6B 5HILA 1TT7A 3DMPA 5KX5A 1JFSA 2TS1A 4NHEA 4OMCA 4FEYA 3GA7A 1GR0A 1PNOA 1XBTA 4NBTA 4W7SA 5B7NA 5ALIA 2BFDB 1LSOA 1MJGA 2VNIA 3H2SA 3P9NA 4JT4A 3WXMA 2NU9B 1E4OA 3V1MA 4DQLA 4P3XA 2IH4A 1RD4A 4BFVA 2ZYSA 5JTTA 5KFJA 4DM3A 3CZPA 1UH5A 3STVA 1GKYA 4DCSA 1VI6A 2FOLA 2P75A 2RK3A 3PR1A 4NE7A 2VTBB 1ZA1A 1J1IA 4ZKEA 1E99A 3RTBA 1EK5A 4PSAA 1YFLA 2J3DA 2VF7A 3BH6A 4MH0R 1Z9BA 3ZWXA 1ZD8A 3LY5A 5AVYA