2B0CA

The crystal structure of the putative phosphatase from escherichia coli
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
199
structure length
199
Chain Sequence
AKMLYIFDLGNVIVDIDFNRVLGAWSDLTRIPLASLKKSFHMGEAFHQHERGEISDEAFAEALCHEMALPLSYEQFSHGWQAVFVALRPEVIAIMHKLREQGHRVVVLSNTNRLHTTFWPEEYPEIRDAADHIYLSQDLGMRKPEARIYQHVLQAEGFSPSDTVFFDDNADNIEGANQLGITSILVKDKTTIPDYFAKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords putative phosphatase
publication title The 2.0A crystal structure of the putative phosphatase from Escherichia coli
rcsb
source organism Escherichia coli
total genus 69
structure length 199
sequence length 199
ec nomenclature ec 3.1.3.10: Glucose-1-phosphatase.
pdb deposition date 2005-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2b0cA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2b0cA01
1Z5UA 3NRJA 3KOOA 5E0OA 4EZEA 3OCUA 3ZUPA 1U2TA 4XOUA 1T5TA 2ZBEA 5A3RA 3A1CA 5ALNA 2HSZA 1SWVA 3QU5A 4BYGA 2VKQA 1L7NA 1QH9A 3ESQA 2IOFA 2C8KA 1U7PA 2R8EA 2G07A 3W5AA 3KZXA 3L5KA 2GHQA 4UM7A 2B82A 3WKDA 3ZVLA 1EK2A 2R8ZA 3M9LA 1RMQA 3WK6A 1SU4A 4UU1A 1MH9A 3ESRA 1WPGA 2CFRA 1YJ5A 2G08A 5ALMA 4UASA 3N28A 5AW2A 4EEKA 5AI6A 2MSNA 5ALDA 1L7OA 3A3YA 2PQ0A 5AW8A 4BX0A 1X42A 3ZI4A 5AW7A 3E84A 3L8GA 4RETA 3ET4A 1NNLA 3L8HA 3QXGA 5AIAA 2GMWA 3OCWA 4HYTA 3NANA 1QQ5A 3WKBA 3EWIA 2YMLA 4Y2TA 3NASA 4CF5A 4AS2A 1NRWA 2O2XA 3N07A 4HGQA 3U7HB 1T9ZA 3WK5A 1TJ4A 2JAUA 4UM5A 2IA5A 5AI4A 5AKJA 5T41A 4BBJA 2FPWA 1Z4NA 1CR6A 4Y2UA 2W4MA 4UMVA 2CFTA 1YMQA 1Y8AA 1Q92A 4BEWA 1N8NA 3DAOA 4EENA 3WK7A 2HO4A 4MWOA 3L0YA 2DQSA 3PCTA 3ZWKA 2AH5A 4EX7A 3QX7A 3SLRA 5ALEA 3FVVA 4XE5A 4UMFA 3GYGA 1U7OA 4ZEWA 3OCYA 1ZRMA 4CNQA 1QYIA 2C88A 4FE3A 2WF5A 2YN4A 1ZD5A 2ZG6A 4UW9A 1S2OA 1RLMA 2ZXEA 1VFPA 3FZQA 4YGYA 3RFUA 1RRCA 2ODAA 3KDPA 3U19A 3UMBA 2YBDA 4Y2PA 3KD3A 5AKKA 1KYTA 1XPJA 4KX3A 4YH1A 2MU2A 3L8EA 3N8GA 2RARA 3B9BA 2CFSA 4FYPA 5ALPA 3WKAA 3SF0A 4F71A 4HGRA 4NABA 1PW5A 5AKYA 3P96A 1VJRA 3U7EB 3PGVA 2R8YA 5AM1A 3VAYA 2YJ6A 4NFLA 1AQ6A 2FPRA 2HF7A 4XPZA 2C8LA 5AKXA 1TJ3A 1Z4MA 3R09A 5AM4A 3SKYA 2HCFA 1ZJJA 4ZEXA 4I9FA 5AKIA 4Y2RA 3W5BA 4UAVA 3BA6A 3ZX5A 4E88A 1YNSA 5ALKA 4I9GA 4OHFA 3AR5A 5AW9A 5AVZA 5AVWA 3NIWA 3ZU6A 2P69A 4YIKA 1L8OA 2NO5A 4B6JA 3QUBA 4YCLA 3M1YA 5AVUA 1Z5GA 1ZRNA 1Q91A 4KYTA 4YCNA 4J2TA 4J03A 4DFDA 2WF7A 3QUQA 5ALIA 3KC2A 3NALA 4YCMA 3S6JA 2IOHA 5ALWA 1RKQA 3I1YA 1EK1A 4KNWA 4L6CA 2B1QA 3IB6A 3SHQA 4JDPA 2PKEA 5AW4A 1CQZA 1Z4QA 2GO7A 2ZBGA 1YS9A 4BNDB 1Z4LA 4OFZA 1Z4JA 5AVVA 4EX6A 2QYHA 1NF2A 1L7MA 2RAVA 2Q5EA 3FPSA 3EPRA 2ZBFA 3FGOA 4HAIA 2G06A 3U7GA 3AR2A 1XVIA 4NV0A 1ZD2P 1RMYA 2B1RA 4Y2YA 4HGOA 1SWWA 5ALOA 4Y3UA 3ZVMA 2G80A 3MN1A 5AI9A 5ALTA 2EATA 3KBBA 3AR7A 4EELA 2AGVA 5AKZA 5AESA 1J8DA 5AW1A 1ZOLA 2FUEA 2D2VA 5ALFA 3WGUA 3DV9A 2JAWA 3QLEA 3BWVA 3ZX4A 2EARA 3L0CA 5ALQA 2W43A 1RLTA 3PGLA 1L8LA 2C4NA 4C4TA 2BDEA 1F5SA 2YFYA 2HEGA 3ZTWA 4RESA 4H1WA 3UM9A 1IWOA 3AR4A 2B0CA 3QU2A 1YV9A 2G0AA 1YDFA 3UMGA 3U13A 1O03A 2NYVA 2YMPA 5AVXA 3QUTA 3CNHA 1TA0A 2I34A 4UU0A 5AW0A 3ZW7A 5AVQA 2OBBA 2PR7A 5ALXA 2YJ5A 3B9RA 5IT4A 5IS2A 4DWOA 4BNDA 4QJBA 1QQ6A 2FUCA 1O08A 5AKLA 1ZD3A 3L1VA 2HOQA 2FPSA 2I54A 2P11A 5AK4A 3PDWA 4KN8A 4QQFA 3AR3A 1Z88A 2Q4TA 4Y2SA 3A1EA 3L8FA 3W5CA 3J7TA 2WF9A 2JAOA 2P27A 3ZWDA 3WGVA 2OA0A 2QLTA 1RMTA 3WKEA 3U7FB 4PNHA 3OTQA 3UMCA 5AKHA 3ONNA 4FFDA 3I6BA 3L7YA 3SD7A 3QGMA 4O8CA 3K1ZA 1L6RA 2FPUA 3NUQA 2WHEA 3RF6A 4C4SA 2FEAA 5FP0A 2YJ3A 2RB5A 1Z4PX 3HYCA 4CF4A 5AKGA 3WK4A 5AKEA 3DDHA 2Q4RA 2YMQA 5AM2A 4UARA 1VJ5A 4BX2A 4KNVA 5ALVA 3R4CA 3ED5A 3ZTYA 2YMMA 3EF1A 3NAMA 4HGPA 3E58A 5ALGA 4IFTA 1WVIA 2FDRA 4CF3A 3I76A 4YIHA 4Y2JA 1XP5A 4KX5A 4UAUA 3CZ4A 2HDOA 3OPXA 4ZEVA 1TE2A 4NAVA 2RBKA 3AR6A 5AK6A 2I6XA 1QQ7A 5AM3A 4BEVA 2G1AA 5AK5A 5AHXA 2HF2A 3U26A 2GFHA 1ZS9A 2W11A 3QYPA 5A3SA 3MPOA 5AI8A 2C9MA 1FEZA 2BDUA 3QU9A 4AP9A 2HI0A 3B8EA 5ALRA 5AVTA 3MC1A 3SKXA 4G9BA 3QUCA 3IJ5A 4DCCA 3IRUA 1L7PA 3I28A 3WK8A 5AIBA 3ZVNA 4IG4A 1RKVA 5ALLA 1JUDA 3R9KA 5AW6A 1WR8A 2WF8A 4BKMA 3D6JA 1S8OA 4UATA 5AM5A 1T5SA 3SMVA 5AVRA 5AICA 4GXTA 2OM6A 1Z4OA 3E8MA 3WKCA 1RDFA 4G63A 2CN1A 5JJBA 3F9RA 4Y2XA 4OD0A 3N5KA 5IT0A 1K1EA 2O9JA 2ZBDA 2B8JA 4L57A 2G09A 2NO4A 1LVHA 5ALJA 4Y2QA 1RC8A 4XQ0A 4Y2VA 2EAUA 3WK9A 5ALHA 1Z4KA 5AW5A 2ZOSA 5AW3A 3HLTA 4BX3A 1ZD4A 5AVSA 4L6AA 1RQNA 2JGAA 3W5DA 4MUMA 4AS3A 4DW8A 4HGNA 3DNPA 2P9JA 2YJ4A 5AK3A 2AMYA 2HHLA 5A3QA 3TLMA 5ALZA 2IYEA 3N1UA 3ET5A 4NWIA 2BY4A 2GHTA 2I55A 2WM8A 1RPZA 2X4DA 1LTQA 2YY6A 2HX1A 3E81A 1TJ5A 1N9KA 5AM0A 2FPXA 3MMZA 4F72A 5ALSA 3L0BA 4UMDA 2FI1A 2WF6A 1J97A 5AI5A 3AR8A 1U2SA 3QNMA 1WZCA 4OCZA 4GIBA 5AVYA 4JB3A 3OCVA 1RLOA 2MU1A 3OCZA 4CE6A 2JARA 2R8XA 5ALYA 3EF0A 2IOFK 3QU7A 2I33A 1U02A 3FM9A 3OCXA 2AUTA 2OYCA 1RQLA 5AI0A 1Z4IA 2B30A 4C4RA 4UMEA 2B8EA 2WFAA 1RKUA 3QU4A 3FPBA 3A1DA 5ALUA 3L1UA 2I7DA 3AR9A
chains in the Genus database with same CATH superfamily
3NDJA 3SS7X 3S2IA 2RKOA 3FNGA 4BYGA 4Q01A 4MICA 2CVHA 3QQ5A 4BP3A 5IHXA 4GC9A 1X1TA 4C7VA 1NJGA 1RMQA 5B7GA 3ABSB 1X9GA 1L7OA 3LGAA 3DM9B 2D7DA 5CDHA 4RQ1A 1VGRA 3RJ5A 1NP7A 2Z5FA 3UKJA 3RYIB 4ZU1X 2W2KB 1GFZA 2YZ7A 1BXRA 2DPHA 3ANSA 3BWDD 3M6LA 2XGPA 4WFQA 1OBCA 4RZRA 2HCRA 3M8KA 3T35A 3KQSA 4FCCA 1QOZA 2VTKA 1WVMA 1KQPA 4QJ3A 3BMNB 3QLVA 1PTJA 4EW6A 5ALEA 1ISGA 3MTGA 3P9IA 5B30A 2NW6A 4EB6A 3O95A 1F48A 2YC2C 4H3HB 1IJBA 4Y1RA 4BU0A 3AV3A 4JT9A 4EI7A 1ZM3A 5TEWA 3DZCA 3LOUA 3GJXC 2YBDA 4X62B 2P9TA 2G5HB 3PFBA 3T3DA 4ALJA 3MMNA 4KDEA 3CLUC 4LYEA 3PJRA 2AFHA 2DZDA 2DQYA 4FOSA 1E9VA 2JIBA 2ZI7A 1KPHA 1JDJA 5LBUA 3NHBA 4E30A 4QUHA 3OE7A 2WEKA 1O57A 3EGVA 4C89A 5K0LA 4W9NC 2ZRLA 1E9DA 3FAKA 3M1LA 1JJFA 1WWVA 2AVDA 4DPMA 4PAWA 4BFVA 3T12A 1E6KA 3DKVA 1HLDA 1UPXA 4C3OB 4F60A 1AZLA 1J5XA 4C2UA 4GX5A 4MV7A 1NSYA 2RAVA 1DRUA 2FZVA 9ICXA 2UUPA 3STXA 4E14A 2MAXA 3EQZA 4C3ZA 2VHTA 5JV5A 5KYGA 1UFRA 1DFGA 2WYVA 3I62A 1EGQA 5F7XA 4L02A 4RZ3A 4MB2A 4BMPB 1B73A 5K2MA 5F3WB 5KQLA 1DT5A 2IBKA 4D9IA 1AXGA 2GZAA 2X2EA 4C22A 4EYIB 3LDUA 1F51E 1EWKA 1G5RA 1NU8A 2I4TA 1ARZA 3NH6A 2CSUA 4FLMA 3QA9A 2MSWA 3D3NA 2P27A 1Y8RB 5I8PA 4GOXA 1GUFA 1IAVA 1Z6YA 1HQCA 1LU9A 1JXOA 5BOMA 4Y2HA 3PW0A 3W06A 3H0LB 1X94A 1ZCJA 4QZCA 2IV3A 3BB3A 4TZ6A 5IUKC 1KDTA 4N0EA 4LRYA 8ICIA 1T4CB 4DL4A 3KWMA 4KU4A 4BE9A 1C0PA 4TVKA 1TAMA 3OLQA 1MAVA 3ASVA 1SGGA 2AOUB 3VHRA 1RHJA 4G0NA 2I0FA 3RIHA 5IFKA 4R3NA 3VSBA 2ZB7A 4H0FA 4G0OA 4OK3A 1FEZA 4AP9A 1OF1A 1JS1X 4LNHA 5I9NA 4JUFA 3NRBA 3N7TA 3P45A 4AZ3A 1ZIOA 1K6MA 1F4LA 1TVEA 5EPUA 2UDPA 4N5DA 4PC1A 3VZPA 4LJRA 2G63A 3DZBA 1FNNA 1WDTA 1ECBA 4XGQA 3V8QA 1P1CA 4YRJA 4I5GA 2QRZA 2D8MA 3GDGA 3LVRE 1WP9A 2R97A 3QZ7A 5A62A 2C04A 5JNWA 1W44A 3LUFA 2G67A 1PR2A 4R8LA 3AERB 4UNQA 2XMRA 2CYCA 4R8KA 1EVZA 3HGTA 3CVVA 3DCYA 1E69A 2EYQA 4QZDA 2GQ0A 3LP8A 1OPXA 4U3JA 1LVGA 3RH5A 3A1CA 4KJXA 1T2EA 3EIWA 2DHRA 4P3YA 1RC1A 2PKCA 3UV7A 3HJHA 1XD8A 1IXSB 5LZ4A 4BO3A 4N3GA 3OSPA 3C0KA 1C29B 1KBQA 1XVLA 2GEFA 3HWSA 4K4GA 5SV2A 4RVOA 3VU0A 4YRBA 1E0JA 3VKWA 4BVEA 1V0JA 3CEPB 2I3ZA 4QWBA 3GPBA 1T15A 2RDJA 4Z99A 1D0IA 2VF4X 4Q05A 4W4TA 3MGCA 3UJ9A 2LXNA 3JQGB 2Z1DA 2RFLA 3K7EA 4CMEA 4R40A 1PJ8A 1QQ5A 2EFGA 1NRWA 4K6KA 4AFNA 3JQFC 2DUYA 4AJOA 5FBLB 1BHQ1 2GKSA 4WN3A 3GNTA 2G0TA 4C0ZA 1R4AA 1ZGJA 4X84A 4D9HA 3QPDA 4I36A 1ZXLA 2H57A 4ZT2A 1KJQA 4KN5A 5IP5A 1P1FA 1P0CA 2QUBA 3GYGA 4M0PA 3C45A 3PPWA 2F44A 1L2TA 3P2MA 3NVWA 4UW9A 2H7XA 1VJGA 4FFLA 2JBAB 3JD1A 1CPYA 2DUMA 5IMBA 1Y42X 1V6AA 3N8NA 4EBBA 2FRDC 1XVUA 4HGRA 4XRGA 1TJNA 4J1TA 5EA2A 2QNBA 3F1KA 1E61A 3PPYA 4QUBA 4GX2A 2X2OA 1TUGA 2Q9AA 1FDRA 2Q6LA 2W2TA 4IVQA 1JB1A 3I9V1 4MPTA 5FUBA 2YWBA 2V7TA 5CU7A 3DZDA 3MFHA 1O6BA 4CDGA 1WAMA 2R79A 4GL4A 3UUGA 1ABBA 4YROA 4DDMA 1WMEA 4HH1A 1QYWA 3SC2A 3FCEA 2XNDD 1WETA 5BV1A 4KFCA 1KQ3A 4O2BF 5LUAA 2G3YA 3QMPA 2A67A 4QARA 3G0OA 4ZJUA 3G0CA 4FGLA 1SQ0A 4YP5A 3BMQB 2ERXA 3JY6A 4MP8A 1CUCA 4S0ZA 2PXHA 5AI9A 3FZEA 3JQAA 1LS6A 1Y1TA 3OG9A 1WF3A 1KYYA 3P32A 2ZTLA 1LF5A 1IM4A 1OBHA 4MAAA 4KLLA 3RAFC 1U5AA 4ENVA 1D4FA 4EKEA 3B1YA 5EFZA 1P5FA 2R1ZA 2DE0X 4XEUA 1T36B 2FMQA 1L3SA 1DKQA 4KQ6A 5EXEA 3DAPA 1W76A 3JD3A 1N8KA 3Q8KA 2JGMA 5DG7A 4J76A 2EKLA 1AU9A 3R7WB 3EOZA 1Q0HA 1NK7A 1F4VA 1PFKA 1E1QD 3RRZA 2O52A 3ZBPA 4LV8B 1AA6A 3TLCA 3F9CA 5D3KA 3RHFA 1IQRA 3OEWA 1E9AA 1E98A 2ZSKA 4EVRA 5BP7A 3OSNA 3I04A 3MT8A 1ORWA 4QZ8A 2BGKA 1LLDA 3DEZA 2Y1EA 2RAUA 1Z0SA 4N3BA 3VPFA 1FDUA 5TGTA 1Q0UA 3W9UA 2B5WA 1A7UA 2WSSA 3ROFA 1RADA 5AJUA 2YY5A 2XY5A 2QW8A 3VSAA 4U2KA 3GU3A 3MM4A 4MMYB 4K2AA 2HV9A 1P74A 1PR9A 1JLMA 3EZNA 4X64B 4BFTA 3O84A 3GLSA 3ZGNA 1YRBA 1DXOA 3UJ7A 3HYSA 1DG1G 2ARKA 1CIVA 2VJPA 4ZOAA 1PAUA 3N5KA 4CKBA 3VH1A 4DYHA 2W9CA 1ADYA 4TLLB 1UBKS 4EL5A 4MV9A 4H3VA 3QEJA 4FXOA 3AF1A 4R2WA 1NDHA 3HKDA 4UVDA 2ZSJA 1TU3A 3SI7A 1JSXA 3NUZA 5CIQA 1MAAA 3K73O 5B6IA 4M9SA 2O8FA 4N6GA 1E2GA 2VJNA 3WNCA 1AHPA 5I7VA 2QJTA 1VI6A 4WI1A 1CS0A 3KAPA 3A9RA 2O8DA 1LDYA 5EEHA 2FFJA 1XFDA 3N7RC 3CLVA 1L5SA 3SC3A 1FZTA 5CIWA 2BCEA 1MV5A 1FDWA 3HXPA 2BE7A 3WNBA 3B85A 4I8DA 5DTEA 3PEVA 2L17A 3E2IA 3H2SA 3I09A 1YOVA 1DUSA 4A27A 1NQUA 1HEIA 2DFTA 3WGTA 1Z47A 3EPPA 4OIFA 4EBCA 2J85A 1W1IA 2ID7A 1LJLA 4ESOA 4CMJA 4FLFA 1FVFA 2BC9A 2JFBA 2Y3IA 4MR9B 1PHRA 2LUOA 1UKYA 1JIVA 3U7QA 4E09A 4NLZA 1IY0A 8OHMA 4JFAA 2NSLA 3OLXA 3ESDA 1PGOA 4POOA 2C2BA 4MWBA 2GK7A 1G4UR 5JTTA 1Y5LA 2FFAA 3I2HA 1UPCA 1BEUB 3KSBC 2HLDA 1YUNA 3NHKA 4G0QA 5IVPA 2A1JB 3K0FA 4AJ2A 1JDSA 1E9CA 3U61B 4AUKA 2XH8A 1H2FA 4IDCA 4WESA 2XITA 4HHEA 4S1VA 3HWTA 1RTKA 2RGNC 4RZXA 3LDAA 2FPOA 3AFIA 2OB1A 2GDJA 1Z17A 3ND6A 2R2GA 2P2ZA 4PYQA 2ISQA 3TVDA 3TW8B 3ONVA 2TMYA 2A7QA 2Q3FA 3Q7EA 2CDCA 2JPDA 1H2AS 2AFVA 2PS3A 3WGNA 3NT4A 4TKUB 3LLMA 1KJIA 3EK2A 4I9HA 1J2RA 4KN6A 1V5WA 3UXEA 5GVRA 2G06A 3U7GA 4LVNA 4LF5B 3ZV3A 3THWA 4O3OA 1G2PA 4KYVA 1NNEA 3QBDA 3RANA 5T6BA 1VHDA 2X19A 3OQIA 1LDGA 2FQYA 2PZFA 2J9FA 1HWYA 4MHTA 3BB1A 3H5TA 3PRJA 5DGXA 3NAGA 4DC1A 1PNRA 4M8KA 3MZ0A 4PTLA 3OKCA 1FFEA 3C5HA 4ND2A 1T10A 3M6VA 4Z6CA 4P8RA 2DTXA 4LYGA 4Y0NA 1AKWA 3MWEA 2FW1A 4JYCA 2B4QA 5IF3A 3KZKA 3EH1A 2HHAA 3IVCA 3RB4A 4H7FA 1J06A 2A78A 4XD7D 5E8JA 4PN3A 1SK9A 2YRXA 2JH1A 3VR6D 4FS2A 2D3DA 5KYWA 2FPUA 4LHSA 3G7SA 1BPDA 1Q0LA 4BWGA 3VTFA 4HAWA 5TLSA 4ZQFA 4ER0A 4JH0A 2YQ5A 2PUEA 3DEHA 5B6JA 1U0JA 3NDPA 1N2SA 3EAFA 3L6BA 3TLGB 4F9FA 4TWRA 4LYDA 3W9YA 3FWZA 2WJJA 1Y89A 1XA4A 3ZHQA 1X77A 5CYOA 3GIJA 2I99A 3NPMA 4CMIB 3QE2A 3W3AA 1SU8A 5CDYA 4RWZA 4N1AA 3H2ZA 2DFDA 1S8OA 1QR6A 4Z9BA 2H4FA 1UL1X 3SPXA 1JQBA 2ZE5A 3DE1X 1FZQA 1UDWA 3ZI7A 2OAP1 2DFKB 1G16A 1NN1A 3KT0A 3T7AA 3G82C 4DLAA 1O94D 4B17A 2Z8XA 2GPJA 2QR3A 3VNBA 1JLSA 1RSZA 4YJDA 2C78A 3PPVA 4GM4A 4QYIA 2X4DA 2YHAA 4Q7EA 3BF7A 5TRTA 4D9CA 1UBGA 1UAGA 2JARA 3K4PA 2Q6IA 3EF0A 5EERA 5JXWA 2EJWA 1A77A 3V55A 3LYUA 1CKEA 1FFUA 1NVVQ 4K5QA 3S8EA 4FZRA 4HX2A 3EXEA 4QXOA 4XOUA 2RHLA 1ESEA 2NYUA 3RTBA 1M6YA 3HXMA 3NBAA 3IXMA 2IOFA 1ZQKA 3A6ZA 2VDOB 2DLCX 2RGYA 2XWBF 1ZVQA 1JXQA 1GIAA 2Q6KA 4ROSA 3DVAA 1PL6A 1XZDA 3DFZA 4DREA 1E7SA 1FMJA 1VLMA 9LDBA 4WCFB 2O2CA 3VV2A 1XWLA 1XT6A 1UMDA 4YAEA 2JG3A 2WVGA 5FF9A 4BZXA 4EWLA 2OXFA 4B4KA 3LKVA 4DV3B 4RT2A 3X2SA 3NEAA 2QUHA 1EFVA 2M9MA 2ZJ0A 3VDQA 1EFAA 4TUYB 1U45A 3GJ8A 1SIWA 3TQTA 1I30A 4N5NA 1NXPA 5KVSA 1NUSA 4XWKA 1JQLB 3CNBA 4UHEA 2H17A 1UCFA 3LNCA 1XZFA 5JE8A 1EBFA 5IAGA 2C5BA 4NS4A 4DR3B 5KBYA 2C88A 1PFUA 3V7WA 4YGYA 2JAPA 3A9SA 3SZGA 3RSHA 1RI1A 3RQSA 1RAAA 4JWTA 2KLHA 1XV5A 4ENRA 1K08A 1QOQB 2A0XA 3V7YA 2CDRA 2GJAA 2ZTUA 1HY3A 3WX0A 1T3NA 3OEHA 3VOTA 1HT2E 2X7XA 3BK7A 2PS9A 1KMHB 5EE9A 4RDXA 4RZ2A 3NBZC 3PR2B 1R1DA 1ZK1A 3EY4A 4UAGA 4CM5A 3IHTA 3L4JA 4DMCA 1OXSC 3G5AA 1U47A 1X9XA 3PUKA 4R4JA 5WRFA 4NZMA 5TF0A 1QLHA 4DR4B 5LZ5A 2CVFA 1K9VF 2IHJA 5K3AA 3ZXIA 2ID9A 4Q4LA 4J1QA 2IXFA 4HLUC 2A9FA 2BGTA 3OWXA 4DF8A 1FPQA 3NP9A 4I8XA 2PWZA 1U9IC 4FJ0A 4UCFA 1J8DA 2WKWA 1V71A 4UJ5A 2H4XA 4LSZA 2A92A 4U0JA 1UBMS 3BFKA 1Q0ZA 3VKGA 1Y3BE 4GLXA 1YJAA 5AJYA 4I50A 1C5KA 1XTVA 5JNLA 5B53A 4DQUA 2C1ZA 1J7JA 4W63A 2D1YA 3PNQA 3TEFA 2GXUA 2IYYA 4YC7A 4HAUA 3R40A 4XWTA 1EP3B 3P97A 3D54D 5LQKA 2ZIWB 1G7CA 1R0CA 3WKEA 1FYDA 2PT7A 2CKMA 3R5FA 4KWTA 5J0RA 3VTZA 5CM2Z 3PUVA 4HQLA 4MW6A 3UWOA 3ZZMA 4DIMA 4OQ4A 2MOKA 2AQKA 1HE2A 2PT6A 1BDBA 3UHAA 5K3DA 3INNA 3AI1A 2X1VA 3FWHA 1VPEA 4QWDA 4RQBA 5ESWA 4MKXA 3O8QB 1F0MA 3ZHVA 2DTDA 5CG2A 3R7FA 2CD7A 5HR6A 4HF7A 1QRDA 1KKXA 3IJ5A 3WE7A 4A8PA 1L7PA 4H2DA 3L07A 2PU7A 2Q2NA 5EMKA 1EFPA 2FG5A 1GXSB 4B09A 3R3SA 1YL7A 1PJTA 3R9WA 2BP7A 5JJBA 3ZDYB 1USKA 3PWZA 4HS9A 4DWWA 4MUFA 3DS8A 3GBVA 3LYAA 4IJMA 3N2LA 2WFLA 3DC7A 4N8EA 4H60A 2O14A 2KVSA 3DE0X 1E66A 4M6WB 5K6RA 1QIGA 2H1FA 4RHCA 4MA0A 1GPYA 2HHTA 3WMFA 2B2CA 2BBSA 3H5IA 2FEXA 2VDQB 2YJNA 1OTHA 1YRQA 3DKKA 1K63A 4BNIA 1OWNA 1OY1A 2RDMA 4HNVA 4GI2A 3HB4X 5A3RA 4FMDB 5FWYB 3H1TA 1JXLA 2H4ZA 1DK2A 1LEHA 3FPHA 2HRCA 4DMGA 4RTJA 1E3IA 2B5OA 1BCSA 1XZ8A 3RTDA 1NMSA 3HI6A 4R6XA 1X42A 3AP1A 3ZI0A 1UC4B 1GSIA 3HEMA 3LQFA 1PSDA 2FCAA 3CM0A 4BO2A 2KQUA 4G5GA 3GCXA 3RVJA 2QVXX 2ZJ2A 1RXWA 1DRJA 1XA3A 5T8KC 3BT7A 4AX4A 5A6VA 5EHGA 5HF5A 3VPDA 4J16A 4MDHA 1P45A 1L5GB 1GVHA 1AIPA 3BD8A 2R8GA 4TKMA 2OK8A 1VFPA 4V0SA 4NBWA 3EQ9A 1CZLA 2V9CA 3PQFA 3MUEA 2JHFA 4CM4B 4MW9A 4NEQA 2BM8A 2QQGA 4RVSA 1UWKA 1D2AA 2XWQA 2R8YA 1FW6A 1MGPA 3L41A 5LQUA 2GZ2A 4XQCA 4P36A 3HN2A 4ZKEA 4E5NA 4FBMA 2QROA 4AWAA 3IDQA 1Q0SA 1Q7EA 1TD9A 2QTZA 1CUZA 4P3PA 4E5UA 1V1JA 5JYDA 3I6IA 3G1UA 4MFCA 2EBFX 1WUDA 4XB2A 2QQ5A 4NZNA 3FAZA 1UXOA 4DMMA 4O4LA 5TPWB 1DO8A 1UXIA 2QORA 4J0CA 3WRXA 4ZYXA 1YI0A 9ICWA 1IG6A 3H9BA 4WZAE 1LK0A 4L9AA 2B34A 2INGX 5PNTA 3UK6A 4ZQEA 3RC9A 1NAIA 4JIMA 3AOEA 4Q3AA 1PZNA 5IC6A 1GDHA 3K70D 2I5PO 3SAHA 2O6HA 1XMQB 3HADA 4XCXA 1H8ED 2WHRA 4GC5A 3AF6A 3TRJA 1BDJA 3EVNA 2ODTX 4QODA 5DB7A 2CLCX 2O7SA 4UBKA 2PX0A 3AL0C 4CL3A 2VP3A 2ZP1A 5ED0A 3KFUF 2AW5A 3A1NA 4L5AA 3GFQA 1JX4A 4AM8A 4NCXA 3V1MA 2H4WA 2J6HA 5A4DA 4P5DA 2VQFB 5C5IA 1BQ4A 4X00A 3K71B 2P6PA 3OTQA 1YKSA 1RRGA 2BMFA 3DBHA 4K9PA 5KYNA 1OX5A 2B3DA 4KIUA 2O2HA 1YAJA 3L8MA 2YTUA 4ELTA 4RTNA 3GLFA 4L8FA 5BXYA 4UUAA 4E7PA 4GOLD 4F5RA 1YQ9A 3ICWA 2E4YA 4YA6A 1WW3A 3RADC 4TUYF 4BECA 3I76A 1M2NA 2H5IA 4XFDA 1ZYQA 3U3ZA 2J5RA 4YLGA 1P73A 4WY2A 3QF4B 3FVTA 3HFRA 1CCWA 1P7WA 1LSSA 1ZS9A 2HHCA 5A3SA 5KHLB 1I0LA 3G0DA 4RPJA 2VLBA 3UPTA 1MABB 3CS3A 4P4PA 2ZJ8A 3R74A 5ALLA 3SMQA 5IZCC 5KNDD 3CN9A 3SJUA 1NN0A 2K4MA 2FMIA 1YKFA 3FOAA 1CP2A 1DP4A 3T7EA 5CA7A 3WSTA 1HFJA 2QTGA 4BNKA 3BFVA 1SV0A 4C07A 3HLTA 4ZD6A 2NTYC 1G3UA 1PU2A 3RC3A 1YI1A 2GD6A 4CV0A 4IQ4A 4ZCIA 2VYVA 3WLKX 5JXIA 2HCJB 5KNIA 4QGBA 3TDMA 3R7NA 1BKDR 3LAWA 4P33A 4PSDA 1QXSA 2XRFA 2MU1A 1QC5A 4IJWA 1MOSA 4QOIA 3P0FA 5DBFA 3OPVA 2XBMA 4JLSA 1KDHA 3GOHA 1ZQWA 1EHCA 1XAGA 2DUWA 2FYTA 5HIMA 3U44A 2A6PA 2QP9X 3ESZA 4RPHA 3Q7QA 3O92A 4RY8A 1RYBA 4N6OA 1G42A 3AN1A 2UUCB 2DPXA 4AW9A 3ZU5A 4BX0A 3CPJB 4X1YA 4B71A 2JDID 4MVXA 4MR8B 3BXEA 1GGJA 1L5VA 4CDNA 2IZOA 5A0LA 1S6YA 2XQKA 3KUCA 2PFGA 4NXNB 3EC1A 3BL8A 2PGDA 1YBMA 1YMQA 4CCYB 1HUOA 1SOUA 5A9RA 3PSIA 1YK0A 4X3PA 4D4IA 1GCIA 4XX0A 4YAWA 5KFLA 1E8NA 8ICCA 3E0XA 4DTCA 1S2OA 2YS6A 2XVZA 2YX1A 1NJ5A 4BJ1A 4LNAA 2XCRB 4CM8A 3QELB 1EGVB 4K6OA 3O0FA 2PFKA 3B9BA 1WTAA 4YJ3A 2XCSB 2IY7A 3CKLA 4XWYA 3BL6A 3KLNA 5JNSA 1E4YA 4HQKA 4ZU3A 5FO1A 5DK6A 4MUGA 5KOIA 3BGSA 2HJGA 4EJFA 5JJCA 5IDXA 2R8IA 4OHWA 2JNWA 3WFJA 1XSEA 4OLJA 5FV4A 4R2MA 1PNQA 4CN9A 4BLPA 1ZGBA 5AUNB 3HKCA 2WZDA 4NAHA 5GY7A 2EHDA 2C4TA 1XQWA 1L7DA 3BMXA 1Z4QA 3AP3A 3IUMA 3O91A 4F5DA 3O8OB 4RSMA 5BW6B 3JQ9C 3VNAA 1EWTA 3CYFA 4CW7A 1P60A 3NH9A 4XIJA 3B2QA 4E31A 1IULA 1P0PA 1VKNA 3LK9A 4PTYA 4Q7KA 1X1CA 1NXVA 2Z30A 4UHDA 1D5CA 2HMWA 4R68A 3IR7A 1NASA 2I2AA 3NHSA 1D5WA 2G28A 2FZ5A 2WU8A 2ZZKA 1QIDA 3URMA 4LOJA 2KOBA 4I2DA 4PZUA 1VJ1A 2CD9A 4FMDF 1WABA 5JYEA 3L1VA 5IVKA 1I2MA 1X15A 2KJQA 4E4TA 3GILA 2HHQA 4L07A 3PMNA 3TEJA 4OL0A 2O0HA 5DBCA 3PPXA 3UJDA 3QE0A 2HDWA 2YJ3A 3IXQA 3LX5A 1C4XA 2P9QA 5FUWA 3L7AA 4D0SA 5D6NA 4LWOA 2QG4A 5DLPA 4C4YA 2EZZA 3AVOA 1UKVY 4PH5A 3L01A 4S2EA 4CJXA 4RF3A 1N9ZA 2QB1A 5TMEA 1G66A 4F3OA 3CTMA 3UCXA 4U6SA 2RHOA 4IEIA 2W6IA 3F5FA 3U09A 4RUAA 3D5TA 2W8BB 2FMXA 4QDKA 4MQEA 5J2KA 3OZAA 1VGQA 4D74A 1K3UB 3Q6NA 3Q8LA 1I2AA 2WW8A 1ID8A 3SYLA 9LDTA 1RPLA 3PWSA 1TKCA 5J4HA 4ZK6A 3L7KA 5IVHA 1PUIA 2D4HA 1RXCA 4HUJA 1XMSA 1USUA 5GIOE 2CLHB 3W4JA 1M72A 2X9GA 1GY8A 4N9WA 1SXQA 4QPPA 1LVHA 1KYZA 3HP6A 3B1KA 3GUHA 3K0EA 1EUDA 2FB9A 1T1GA 3IKMB 1FVHA 2QG6A 2PGIA 5KYVA 2V1XA 3PIIA 1K6JA 2ZIXB 2AVNA 1J70A 4RULA 2FSGA 4F72A 1WCV1 3MJTA 3ZWYA 4KE8A 4PLWA 3S44A 2OHFA 4LPKA 1U8YA 4JUIA 4R81A 3KOXA 1GNQA 2NTJA 2X5XA 2E37A 3P9PA 1LY1A 4PLHA 1J33A 1D6SA 4DFKA 5K6AA 1L5YA 3JAWB 5B57C 2IZ0A 3KYCA 5J2EA 5GTIU 3D0RA 4H16A 1JIUA 2WMDA 4JOQA 4YMSA 1NYQA 3BZBA 4PLFA 3UXOA 2ZRQA 4DCGA 3L7CA 6YASA 1Q1NA 5DYGA 3LQQA 5C8XA 1H3FA 2WMNB 4ZZ0A 5TGDA 1CNEA 1AKEA 3VKHA 4XDZA 5CYFA 2D2FA 5AUPB 3RJTA 1FYFA 4QATA 1SHZA 3PW4A 4O4HA 3VUFA 3EIHA 4WZAA 4X1IB 3QEKA 3VPHA 4KIWA 3ZZUA 5BSWA 3PSPA 1T8UA 3OZCA 2WU1A 2IP4A 3OCWA 4R1SA 2Q1TA 2EOAA 2KD1A 4QIWC 4BAZA 4C05A 5TS3A 3SJZA 5LPNA 1C1XA 3SEZA 4KXXA 1CUEA 1NIPA 5BVHA 1J07A 3I61A 1LRJA 1A71A 4DGSA 3DV0B 3N2GA 4CIXA 4M1ZA 1U3VA 1AS0A 1PJRA 3KQPA 1ULBA 4LCEA 3N2NA 3R3ZA 1TLFA 3N87A 4DFMA 4WBSA 3DE4X 2ZSHA 8LDHA 5JDIC 4RK7A 3GRKA 4G37A 2A1AA 1A9OA 1WCNA 4ECAA 3BH7A 2NG1A 1NM5A 4WK2B 4EF4A 2LP4Y 4K86A 1ULHA 2WM3A 4RHEA 3LX6A 2FSHA 1P5RA 1F5NA 1SD5A 5ENZA 3V33A 4NFLA 4LISA 5EHNA 1F8XA 4A8EA 3GP5A 4QBHA 4WLFA 1Q3TA 3OSUA 3FSGD 1W4BA 4BFCA 3PNSA 3P9QA 1PEKE 3NVMB 4A7PA 1DB3A 4KV9A 1U65A 4I6JA 4LRSB 4CEIA 2GCGA 1VIYA 3CJQA 1O58A 4JQOA 5J5VA 3SR3A 1HE1C 1LV8A 4DA4A 5ARDA 2P6UA 5DEIA 3VYSB 2P3OA 1M2GA 4F5WA 5CXSA 4A6DA 1I0IA 3PNCA 3FHTA 1RW4A 3F3MA 2Y1OA 1RG6A 2F9MA 1ADJA 5HKAA 3O0DA 2PJRA 3ND5A 1GGFA 4JL5A 3ZQJA 3GA7A 3O7WA 5JZ9A 2R6DA 3VYVA 3WR5A 1N32B 4H1WA 1J8VA 4DIFA 3KM0A 1U3TA 5AVXA 3SIPA 2AF4C 4AJIA 4YXFA 1MUUA 3AJ8A 2F00A 1JDPA 1XRQA 1OOEA 1Z6PA 4BC1A 2HVIA 2UUAB 3GVIA 3UYLA 1T2VA 4RQTA 5IANA 4PGFA 4FCWA 2XNJA 1PSZA 4ND3A 4UTNA 4WFIA 5FLXA 5TY0A 3DNMA 1YCFA 4RTRA 3ZDBA 2PYZA 1E3SA 1NXTA 1GQ2A 4RQ7A 3KVYA 1TA4A 1D4OA 3HBLA 2R7KA 1KY5A 4B6PA 4KMRA 5I45A 1VJ5A 4KNVA 3GP3A 3R3UA 2DGDA 3HTXA 1Y6GA 2BHTA 4MQ5A 4PR3A 5D4BA 4ITRC 3QPAA 2QZPA 4Z5XA 1SBQA 1J9ZA 1VRVA 3HHEA 4KLQA 3TB4A 1ID1A 4BE7B 4NYIR 3DSRA 1JR3D 3CLHA 2IT1A 1B22A 1Y5RA 5C5JA 3FTCA 4FI3F 3GPDG 3V3KA 8ICKA 3QUCA 2GJSA 1T9DA 2C5SA 2OXTA 5FL7D 1BGWA 3IDOA 3CR8A 1T5SA 2XT9A 2G76A 1WU8A 3CBGA 4WJZA 3WKCA 2PJZA 1JDNA 2FR1A 3PTAA 4I2CA 4DQ0A 9ICGA 2O1XA 2UVPA 3ROKA 2AEJA 1XVTA 5AW3A 3U4CA 3NYRA 3KETA 5CHGA 1ACLA 4LGMA 4QQKA 4CTKA 2VXBA 1JZSA 1AO0A 3HYNA 3WB2A 3H1FA 3REQB 5NULA 3P5BA 5TMBA 2C5AA 3D5QA 3WFIA 3FTQA 4MFAA 1L0BA 3NRCA 4I14A 3CCFA 1K68A 2AJLI 2G7MC 3GJTA 4YCXA 3LBAA 5SY9A 4BVAA 1M33A 1O9GA 2Q62A 4UNIA 5HZKA 4K8OA 4UQLA 2VI5A 4FOTA 1H0RA 2ZBEA 3GCGA 1JHYA 5FBWB 2GF0A 4KQXA 5TPZA 1QJCA 2DSTA 1G8MA 3F6BX 3OE4A 1C2YA 8ICZA 3O4RA 3CUYA 2UZ4A 1WPGA 5M3BA 3FD8A 3S1AB 3EJ6A 3SJBA 4Y6QA 4U9IS 4D92A 1CUXA 4WLOA 4RGYA 7ICPA 2FRVA 4M76B 3A6JA 3UFXB 4YCAA 4CI0B 1LBEA 4D8YA 1W96A 5IM4A 2K8CB 5HM8A 2WYHA 1WP4A 4PG7A 3CRZA 1UK9A 2I2XB 4ECQA 5KMGA 2YB4A 1K27A 2I78A 2FN8A 2J6BA 2ZCUA 2I9KA 4EQ6A 2BI4A 1D1QA 3AUKA 4K6CA 4BPRA 1Y8QB 1KI7A 4JSRA 4BQPA 2NO9A 4DZZA 3VHQA 2EEPA 4ERNA 3EGEA 1UP4A 1Z2OX 1IN1A 1IV8A 3UOAB 3HKEB 4DA7A 2K4IA 1TT7A 2ZRKA 5KO2A 3ANTA 4B32A 2ZGVA 3BUSA 4MW0A 2V55B 1U6JA 1YFZA 4QOEA 4A5OA 2CXTA 2QD5A 5JSFA 1ZH6A 4F2SA 4MYCA 5EINA 3F5SA 4MIKA 4HRVA 4DAEA 1M6WA 3I1YA 2F7SA 5AYVA 2O2IA 3G2OA 1KVRA 3T5DA 2XB4A 3A6PC 2BFBB 1X38A 1UBHS 1DQZA 3GN1A 1PR3A 2QSYA 4RK5A 4QOHA 1EE9A 4MUIA 1N3BA 1SR8A 4R84A 2CFIA 2ZETA 1XJCA 1O7JA 3TD2A 1Z5VA 4YDHB 3C7TA 2AN5A 4ND8B 3OBIA 1KMCA 3OJLA 4MQ4A 4BL5A 5CA1B 3BWVA 3ZX4A 2XZDA 1RLTA 3M6ZA 4DZTA 3CGWA 2W00A 2OFPA 2WDPA 1DO0A 3V80A 2AMJA 4M9GA 4EFNA 1F14A 3DM5A 4YECA 2YXDA 2GSWA 4ILKA 3PYLA 2FF5A 3RI3A 3LS2A 4QUAA 3TBKA 5CT8A 5CYPA 1FLNA 2B21A 1VQ1A 2CJWB 3ETJA 3UMYA 1AKVA 4EMSA 3VPGA 4IFIA 3ONNA 5J2UA 2FH5B 1WXFA 4FHZA 2ZSAA 3CBQA 4ENSA 4RK4A 1FL9A 5FNVB 3MTAA 3UQYS 4YR7A 2C84A 1E4EA 5M04A 1X1DA 2OV3A 3CP8A 3GT0A 3N76A 4I4CA 4OHOA 1V1RB 2NTVA 1RBMA 5C7IO 5DWQA 3W79A 3F46A 2GR9A 4AJEA 4AF6A 3ZC3A 4NARA 1KBOA 3E22A 1KI2A 5E2BA 4RNCA 1Z7GA 3GIKA 4FYXA 3AFMA 1F38A 2P0YA 3C43A 5CJ7A 1J8QA 2PVCA 3JAMA 1G8FA 1I7LA 5G2OA 1O4WA 3JQDA 2GEJA 4NBVA 1W2GA 3FPLA 1A5BB 4AZWA 3NW9A 3G8DA 2PZJA 3K32A 4BP8A 5HEKA 5JW6A 4ZOBA 3EVZA 2IP1A 4Y2QA 2QN2A 3FUWA 3K72B 4PG4A 1SCIA 4GP6A 3QRWA 5KOHB 2MTBA 1I3MA 1NYTA 3IAM6 4QTTB 1A2BA 1BXGB 6GPBA 2GYUA 1NBHA 3VPCA 5B37A 4NY1A 5LKRA 1ZD9A 2ZWPA 5J3JA 4OM8A 4RAOA 5EJIA 4IMJB 4NYMR 4AMZA 1QCCA 1S89A 3DPSA 5K4GA 3GZNB 3PR3A 1VL0A 2IWRA 1T91A 3ABQB 3I01M 3ADPA 4Q4DA 4P7KA 5KWIA 2JHDA 3K4QA 3SOZA 4B9SA 5J0WA 1WHTA 4DSLA 1N2IA 2OHIA 3H9CA 4H7IA 3IC5A 3O3CA 5L45A 1VSQA 4YMTA 3WQQA 1DJQA 4M99A 4V0OA 1OWOA 3X1KA 5B4VA 4KZKA 3S70A 4PHAA 1Z0AA 4L5YA 2WAMA 1COWA 4M9CA 5EOVA 2BLNA 3RIEA 4B82A 5FWXB 3RG8A 1EP9A 2CJXA 2FLVA 4W9NA 5DCUA 3GB9A 5KYYA 1AVTA 3N3AC 4ZICA 3WIDA 1SOAA 3IMCA 4OL9A 3MB8A 2DHQA 3OE5A 1U3GA 1YTLA 2FFQA 2P2CA 4ZZ3A 5JQGB 4JVNA 4G8JA 4QWAA 1AMUA 5TQJA 3GFSA 3EBOA 2HADA 3N53A 1E9BA 5J8YC 3QEBZ 3PYMA 3A9UA 3E1KA 4REQA 3PD7A 1WUHS 2YV1A 4AO7A 3Q3JB 3BMCB 4YJGB 3DFIA 1Z63A 1KJJA 4C7OA 2DJ5A 1EAYA 1MRNA 1EVEA 1SK8A 1IONA 2UVVA 1P1HA 3MWGA 3JVVA 4K05A 3KDAA 4FCVA 3I1FA 2CHVA 1P1IA 1X86B 2HIGA 3JYPA 3PI6A 4IYJA 1TJYA 1OIVA 4KRGA 3CLTD 5IDVA 3ICXA 1PNOA 3VNUA 2EWWA 4DFDA 4FW9A 5B36A 2ODBA 3ASZA 4NQRA 3UCEA 4DF3A 1QH1A 3HCCA 4HH4A 5EWLA 2FMSA 4EGSA 3V4LA 1GU7A 2ZBFA 4DXDA 1H38A 1P2FA 2RHDA 4YCSA 4J9SA 1IAQA 2XE7A 4NRDA 4OGGA 2HF8A 2DETA 4JI7B 2VHXA 1N2CB 2C2YA 4OBXA 1E2IA 1IWPB 3AMZA 4W1QA 4TLCA 1Z22A 3IPYA 1OAAA 4UUNA 2OMKA 3CC8A 3IPAA 4DC9A 2QNIA 4RQUA 2I7TA 1E5LA 4DR5B 1PT9A 4YRNA 3CNHA 3K4GA 2VH5R 3V8NA 2CDBA 4LK2A 2AFIB 4DNFA 2QR2A 1T24A 1N6PA 3J7TA 5LD2C 2QLTA 2BM9A 4G0WA 3QSGA 1KRXA 4RWEA 4G67A 3GQBA 5JZMA 5AOBA 2QRVB 3FZGA 2IIVA 1WMSA 5IJWA 2RB5A 7GPBA 4R16A 1B2RA 2OCXA 4KW7A 1ZJZA 3LCJA 1SVLA 2Q4RA 1N0HA 3HL4A 3F78A 2IXEA 1UDAA 2G5PA 5TXGA 1SY7A 1E20A 1KWKA 1NW5A 3VC1A 1XPOA 2W55A 1HQYE 3MJ4A 3OC0A 2YV4A 4FE7A 3AHGA 3R41A 1NMZA 1JQJC 1EM8B 2G1AA 5KTMA 3QK7A 4RQ0A 5HR5A 1COKA 2YNMD 4KQJA 4KXQA 1OVGA 1ZIDA 3R75A 1RAIA 1TECE 4MCIA 1Z56C 2GZSA 3HH8A 3EUEA 2BTQA 2Z98A 2YWEA 2HDHA 4ED2A 3OKPA 1C7ZA 1N7GA 3WLNA 2W6PA 4UUOA 3GWZA 4I4TB 4HZUA 2ALJA 4D42A 4IQVA 3KJXA 3HDVA 4Z9YA 4JEMA 3L02A 4RL6A 5L3QB 4CT0A 5EKUA 3DMHA 2X8AA 4QO7A 2J0QA 3JQFA 3HUFA 1NBIA 4QWCA 2NSDA 1GWNA 3MMPA 1VLQA 1FLVA 3QKTA 4CRWB 1JDUA 4DQIA 1QNLA 2L18A 4QLAA 3FBGA 4X61A 1L7AA 4ZRDA 3H4MA 2VBFA 2WTEA 2VJCA 3N2EA 2P5SA 1PUZA 1F7UA 4PHCA 2WPDD 1J2JA 3OJEA 1PWEA 1R5NA 3JRWA 4KKXB 1GKUB 3MK31 5IVIA 5CA1F 2WOOA 4GW3A 2LTAA 4B45A 4B35A 4YMVA 2XIJA 4HMPA 3WFZA 3PDUA 1QLNA 1UDRA 4BZPA 1W88A 1NBEA 4ML3A 2O07A 1OILA 4E7OA 1QTNA 5J63A 3OJOA 1OD6A 3GLGE 3GVPA 4MGIR 5TARA 4ENWA 2C2HA 4JC5A 3AM1A 3IN5A 2J4CA 2VAMA 4JKOA 4XGKA 4I1SA 1SKYB 5KOYA 1CYEA 4ZV4A 3VPBA 4QSMA 4RE6A 4UB2A 3OD1A 2ZUWA 1NYLA 3IELA 2IPOA 4FBUA 1RQRA 5JCJD 3FROA 2QUJA 5JZVA 3BXPA 5FNVF 5E1DA 3FSEA 1ABFA 3CG4A 5CX1B 4D4KA 2R44A 3RSGA 2WI8A 2FFHA 1GZUA 3LZ6A 1NMEA 5JNRA 3L43A 2VPQA 4ZI5A 2YZGA 1ZESA 1G1MA 4ZI3A 3DBVO 1ZL2A 3MA0A 4MRNA 2Q2QA 3HBFA 1E1NA 5DNDA 1P7CA 2PRSA 4FDMA 4EECA 4KAXA 4C0HA 3GEIA 1F0KA 1VKRA 5AO9A 3KKLA 1LF0A 1QP4A 5KFMA 4RUCA 1BRTA 2MYTA 3K70B 1POXA 3L04A 3WRVA 4D0NA 4QYTA 3T7DA 3PS9A 2WJ6A 2AD1A 2W9XA 1Q1AA 3U60B 1RTTA 4TZTA 5EQFA 1R27A 1LLUA 3BHMA 3QUQA 3AY0A 2DF4B 5C35A 4ECRA 2FPKA 3HJBA 1MA3A 1QSLA 4IDHA 1A9XA 2W9BB 4DLPA 5IXJA 4ZTZB 3GFBA 1PN3A 2ZBVA 4A82A 4NV0A 1E0DA 4W6ZA 3H4VA 1ZSVA 1X1AA 4G4SP 4ARAA 3AIOA 2QMOA 1KQQA 4TYNA 3D6UA 4GQAA 4C2BA 1O5OA 3C4JA 5JS7A 4V3CA 3CVYA 4C0WA 3FYSA 1VIVA 2WIJA 4IH4A 3UM9A 4PN7A 1OW5A 1U2QA 4DRXA 1G3IA 1J8MF 4LY0A 4V0MA 2HIAA 4OJTA 4KIJA 4I7EA 4I3GA 3A2LA 1OBFO 2VSNA 2FEMA 3KHLA 5IAAA 4Q0MA 1SUDA 4GDFA 4R63A 4V38A 1WKBA 1X6IA 4Z1MD 1UMCB 1U63A 4YR0A 5DGTA 3GJ6A 1G6KA 3TLEA 1QS0A 2PZKA 1Q7GA 1RNLA 4F8RA 2QRNA 2H0AA 2K4EA 3GLFE 1G21B 5HP4A 4FC6A 1GKLA 3RRGA 2RI0A 3E58A 3NIBA 1OHHD 4MRAA 5FX2A 3MCAA 4P7JA 2H52A 4RK0A 5JQGF 1NK0A 3OETA 2W8KA 2QLJA 4LC0A 5KNCH 4WMLA 4S24A 1JX6A 2H5EA 2XCUA 2BFDB 3AF4A 3CPEA 4CR6A 2E18A 2E2WA 2ODPA 1E9SA 2WYOA 1IBMB 4AT1A 4N49A 1TL7C 2ERCA 4MI3A 1Q21A 5TS2A 2Q3DA 4I2EA 3TNFA 5TQ0A 1QONA 4HDNA 5ALHA 5KOJA 3O4VA 4BX3A 4X1KA 2WM2A 9ICLA 4FGJA 1N3YA 2WG2A 2WJ4A 1LCIA 4NWIA 1YT3A 1OLXA 3OIFA 2JANA 2B69A 3DGEC 2QE6A 1Y82A 3ZHCA 4KWCA 2XY4A 3AHDA 3F2IA 4PCLA 3ILHA 3B5EA 4FYKA 4GR4A 5ECDA 5HM6A 1DTWB 2AXTU 2B8EA 4FFRA 2KX7A 3G5TA 2I7DA 3IMKA 3K3PA 3ETNA 5T14A 4TXHA 1FA9A 1T5TA 3IEUA 1EUQA 1GLVA 4UBNA 5HK8A 2IYQA 5TNXA 3LGXA 3DO8A 1SZCA 4QZVA 4ZQHA 3NVDA 2P2GA 1H66A 5KDDA 5KQRA 2RGNA 4JP8A 1D6JA 4YN3A 1G20B 2C7QA 1OI2A 3D81A 1EA7A 1YSCA 3EYWA 2IX9A 3JR3A 3UGQA 4PU0A 2E8OA 1G41A 4EUFA 3G1WA 3ZD8A 3VGPA 1XNGA 4PE5B 3RAJA 3LQYA 1A4XA 1U28C 4M8IA 5ADWA 3ON5A 3VYTB 2DF8A 1QIHA 4NJMB 3CX4A 2RG7A 4BNGA 4B85A 1V43A 1GARA 2J5XA 3SYKA 1DBWA 4K3VA 4JQSA 3QV1A 5GZ6A 5LB4A 2QLBA 3IPCA 2EF1A 3KKQA 2Q99A 3SYMA 2BCUA 3EMBA 3O8BA 3KKEA 5K0EA 1E5VA 2RGAA 3BM5A 3ETCA 3ULKA 5LQNA 2WKPA 4OB7A 3NHUA 3K0HA 3H2HA 2C7BA 4XXHA 1G38A 3LQ2A 1WPRA 1KFEB 1ACJA 2DJIA 2H4HA 4DLEA 2AG8A 2NN3C 5CGQB 2IS4A 2C2ZA 1SELA 2NO5A 2PIAA 1BEEA 4CF7A 5EVJA 4J2TA 1AX9A 2DLDA 2XQGA 2DQZA 3KQMA 2I7XA 2KG5A 1UBJS 4DNQA 1F6DA 2ZYUX 1PDWA 3ZCVA 5CBKA 4I4TF 3N7UA 4ZCPA 3HVRA 4PX2A 4G8CA 2MIIA 1JTFA 3KO8A 3BCHA 1NK5A 2WKQA 3VJMA 3CUWA 2XOEA 2Y0EA 1EUCB 1NQTA 1K7FB 4CLRB 3D2SA 2O6LA 1FUEA 4QBTA 4XLZA 2OXIA 4MVJA 4XUGB 4KRFA 1VDVA 1OLUB 4YR3A 3H2JA 3QVXA 9ICAA 1UJBA 4FR5A 1GO2A 5HWSA 3UMGA 3UOGA 3I6YA 1BD4A 3AEYA 1FFYA 4JVSB 1GSHA 2G77B 3PGKA 4KACA 1V25A 4C1BA 3FHLA 4V39A 3TOCA 3D0QA 4HWOA 2QTFA 1E3LA 4B9EA 3C21A 1TZ2A 4DUPA 1UQRA 5KYTA 4IOJA 2FLNA 2GVDC 4LVSA 4BLSA 3NOQA 3K0BA 2RIRA 2GYWA 5HS4A 1RXEA 2P75A 4GOOD 1T3TA 2BEVB 3OEYA 1IQ0A 4XW2A 3G3EA 3DDSA 4JWKA 1MEJA 4EG0A 3ZJYA 5B64A 1Y1RA 4Z7QB 2A5JA 1B8VA 5JATA 2GBLC 1QFXA 3UAYA 4EB8A 3BVPA 1X7ZA 1HSOA 3OIDA 1UF9A 3DLTA 4GMXA 1SL2A 4MTLA 2MSCB 2I80A 3HLKA 3P4UA 1RM3A 4ZP1A 5B55A 4A3SA 2JCVA 4XIYA 3GLGA 2C94A 2EZXA 2PBRA 3TQIA 1TI7A 2WTXA 3BREA 5FWAA 1G3MA 3NORA 3RHTA 1H0KA 2V4ZA 4MQ6A 4BNWA 4P2HA 3CRVA 1GHTA 4OO3A 2JFPA 2P7IA 3OGUA 4BBPA 3JQ6A 5FTLA 1IY1A 4EUSA 4EG4A 4QG7A 1T3QA 2Z3VA 1O97D 2G8NA 2LWIA 1E1YA 3PE3A 3ERCA 4NFSA 3K1YA 4B31A 2Z1NA 1ILEA 2H5JA 3UAVA 1ENOA 3L0BA 4ZO8A 3FB1A 5IT9A 2CXSA 4I19A 4PJ0U 5I7OA 3UMSA 2OWOA 4KO4S 1OBOA 1N7HA 2IVFA 1DEXA 4ELVA 2ONZA 4EMTA 2YYYA 1KZ1A 4CF6A 3GMTA 3QBEA 3E0QA 5BRJA 1COZA 5LLTA 2PEYA 5KL1B 5EJ6A 2P30A 4YAIA 1W48A 2CXYA 2Q0ZX 4H7KA 3VR5H 5JTUA 4C8LA 4DO9A 4OXIA 2LKDA 3DZFA 1ZMBA 2YX8A 3G2PA 3C1UA 4E2WA 4C88A 3I5AA 4HLQB 3NANA 2QVLA 1DKMA 2YVQA 1THMA 2GERA 3EZLA 1BQ3A 1W30A 5TJ9A 1C9EA 2ZU6A 1TW3A 2D59A 2I67A 1H4VB 1VFNA 3B6ZA 1SB9A 3DAOA 1VSTA 5A5EA 2XZTA 4M2YA 3KE8A 3ZH2A 4HLUA 3C5WP 4K9MA 4B3GA 1N3LA 3DOUA 1LPPA 1IY9A 5IRCD 3FMIA 2EERA 2XXAB 1U9IA 5JDCC 3KJEA 2RIPA 3MR2A 1MTZA 3KFLA 5I7EA 1WULS 4IIHA 1CUAA 2AG1A 4Y1FA 3N2KA 2FRXA 1M8PA 4DKXA 2XXJA 4CMHA 3AY6A 3IV7A 5F7ZA 3VXKA 1QQBA 4TWAA 3HT3A 1XZJA 2J5BA 3LT0A 2AOVA 2GDZA 4OI1A 2QARB 2ZLBA 3SYZA 1DBIA 4M98A 3OFSA 4RFSB 4PLTA 1LNZA 3LHKA 3TXAA 5DHPA 2JL1A 4I9GA 4BAUA 3AR5A 4HN2A 4P0QB 1QNFA 3L79A 4L16A 3A37A 2IZ6A 5IT5A 3GZ4A 3B6JA 4LBWA 4FHGA 3O2NA 4L6CA 5KTOA 3PLNA 1T94A 1OZAA 3WSWA 3WWEA 5ADVA 3KKZA 4IMIB 3FUUA 4EHDA 1LRLA 5JRZA 5AJVB 2W83A 4Q4HA 3B89A 2FMFA 3ER6A 1DI0A 3KBBA 1QP7A 3F98A 3PE4A 3CF2A 4G4IA 5JALA 3F5QA 2YTZA 2HM7A 1U8ZA 2B0CA 2II6A 1KU0A 4JVOA 3MERA 4N7JA 3WBBA 4JASB 2DKXA 4AICA 3OUZA 3F49S 5EEGA 1BJTA 5KI6A 4UTRA 1PK1A 1FLDA 5F23A 1UC5B 3ROEA 3NTRA 1F0NA 4FI3C 3K9WA 3QG1A 2ZJ4A 2OHJA 4UE6A 3DBLA 1U9ZA 3K8YA 4RPYA 1OH5A 1L3VA 2AI3A 4GEKA 3DDHA 2AUNA 3K75D 5IJ0B 4COKA 4DLNA 1OXTA 3TLYA 1A97A 2FZCA 3HPOA 1CSEE 3OZFA 3OICA 5FBKA 3KJFA 4CM6A 2VWHA 1AZSC 2DFLA 1B6GA 5BUZA 4QVGA 3KEFA 4P7BA 4X71A 3QKRA 1OROA 4FNAA 5BSRA 3Q3GE 2YRWA 3RASA 4AK9A 1OT5A 1M8KA 1FXUA 4TWIA 2K8BB 3B6KA 3HL0A 1XTPA 1CJTC 2W7OA 4TRNA 1GM5A 3ETGA 3HILA 3QOXA 2NU9B 3HABA 3TQOA 2C99A 2C3UA 2FK8A 1JBKA 3WZMA 2WB4A 2UVUA 4C76A 4JAVC 1RJEA 2NP6A 4PSUA 4PNPA 1L5HA 3AM9A 5JCXA 4PHEA 3HYLA 1XNHA 3AXTA 4YN4A 4EDHA 2CNDA 4ZCMA 2XLBA 4PSKA 1L8XA 4OKSA 3LPAA 2HPAA 2W90A 2DB3A 5DYTA 2XNCA 1FP1D 4J9NA 3C7KA 3E81A 4WXMA 4BO6A 4OUDA 3PUZA 4YP9A 5DYWA 5JMPA 1XK7A 1M75A 5AVYA 4D3YA 1NXSA 3QKSA 2ATIA 3RSFA 1VL8A 1M0SA 4FJ1A 3BEDA 1KS2A 1YGPA 4UCXA 5CH3A 1GAJA 4BP9A 2HF9A 4YLEA 4P4TA 4LC9A 3NWPA 4AZ0A 3C5CA 4XWOA 3LLSA 4L2IA 4IJVA 2C2WA 9MHTA 4C6TA 4GPZA 5FLYA 3UB2A 3IQHX 5J2TA 1SKRA 1P62B 5AW8A 3BTSA 1Y3AA 4B7XA 1E89A 2EH9A 1DVRA 3FPGA 1XPUA 1P29A 1IUPA 4LCBA 1KYWA 1Z8NA 3IQXA 4S3MA 4MV1A 3WP1B 4Y9TA 1JG1A 1H2RS 5HX7A 4K1LA 1RPAA 5DNCA 1M2VA 4YRAA 2WHPB 1LNSA 2IPNA 4GPBA 2XW6A 3ITEA 3EGXB 1TKDA 1WOMA 1RCTE 4AN1A 2JJYA 5FFMA 2HO4A 2DAPA 5CURA 3JQ8A 3UW3A 2ZJYA 2BZFA 1Z2EA 4H35A 1DEOA 1JZTA 2W6JD 2Y1WA 1OLSA 2BOVA 2FMUA 4FE3A 4QZ9A 1V2HE 4Z3KA 2ZUEA 4YMLA 1FNSA 1XDSA 5EL0A 4Z4CA 3FJYA 2XNKA 4Q9LA 2H00A 1RYYA 1CQJA 2FU5C 3FMGA 4JLVA 2DU8A 3DL4A 3HJRA 1DCMA 2OCEA 4A16A 1DCFA 4XVRA 1AQ6A 3NHWA 2HF7A 2Z2JA 1Z19A 1FJ2A 4U6QA 5EKSA 1XEWX 1DRKA 4LRTB 5DX8A 4RCZA 5T5QA 3UXHA 4PLCA 3ORQA 3H0EA 3SX4A 3K1AB 1Q7CA 3OF2A 2AUMA 4FDLA 2N1MA 4UHKA 5L7YA 5J1TB 4DCUA 2A1UB 1AQJA 1NBAA 2RJ3A 4HWRA 4DEXA 4NJ8A 1QIKA 1IBCA 2A7XA 2HMAA 5LB2A 1IM5A 1PFYA 4FGWA 4EF6A 3RB3A 1USIA 1T1SA 4IR7A 4OMUA 2PUFA 1AS3A 2O4UX 3FOZA 1VA4A 1JEYA 3JARA 4MWDA 1K06A 5FXMA 5K8UA 4HH3C 3HUUA 1N48A 1VSUA 3BMOA 3M6MD 1FS4A 3E3NA 1T2FA 5IBQA 1XTRA 5K0FA 1S10A 3SQLA 1UKAA 4PNZA 5IZCA 1E7YA 3MCTA 3LECA 3FKJA 1ZD3A 1U1IA 3B82A 3KEMA 4MGKR 1UEXC 1FQJA 3COJA 1SOMA 4KE6A 3RVOA 3VQTA 4AY5A 3LL4A 4BBZA 5IJ9A 4IDAA 4GMHA 5CA0B 2ZIVB 1VYUA 4X65B 2L0XA 3OU2A 3N58A 2MUTB 4DA0A 1NRJB 1IY8A 4JV5B 3EY9A 3JPRA 5ECGC 2OAEA 1KDOA 1VPTA 2Z2KA 4ICIA 3IVAA 4J6EA 3DMTA 4ZVSA 1VZ3A 5CRXA 3AEVA 1J5PA 1E6MA 3HUEA 3OIYA 3Q12A 4NZOA 4Q02A 4MZXA 2N1RA 3GMDA 4XB1A 3U39A 1C2TA 3ONWA 4FMBB 1DLIA 4Z3OA 4DV1B 4TWZA 3NHYA 3QUSA 2C7GA 1D8TA 2X9VA 3OD5A 4J9LA 4QQNA 4KMSA 4N4AA 4UXIA 1N6KA 2X5JO 3UUWA 4E4YA 2MA1A 1I1QB 4KMOA 3PIDA 2W2XA 2AR0A 3F9RA 4EO9A 1UFOA 1Q77A 1KAHA 3I2JA 1PS8A 2GN9A 1JE1A 4JBWA 1ZFNA 2NXEA 3DJYA 3NM4A 3CLTC 2DPMA 2WA1A 3E9ZA 5B1EA 4EBEA 1GKIA 4JB0A 1USVA 3LD9A 3GLHB 4LJLA 1T1EA 2I8CA 1U81A 3Q40A 3B6IA 5FKJA 4D9EA 2RGXA 4F12A 3DGFC 4X91A 4E03A 5E0OA 3CRNA 4LJAA 5J2HA 4XTCS 4TTVA 1AOXA 4P98A 2F6RA 3V2UA 4BZZA 3JPYA 3TJZA 1USWA 1P80A 2BEWA 3CEAA 4Y6LA 5DKFA 3BZUA 1NK4A 4X97A 1TK2A 1EVJA 1VCOA 2DECA 5DGBA 4CKCB 3MTEA 2ZITA 4E11A 4NL4H 2BMEA 2JFVA 1M73E 4Y7CA 3A11A 4KR9A 4NENB 2I76A 1ICEA 9ICFA 4LZDA 1KEEB 2QN1A 5I7WA 2PMDA 1KQFA 3DLBA 2H9YA 5EZSA 4DV4B 5EG5A 3TR5A 1KAEA 4MRRA 1HTBA 4M3NA 3ED1A 3L7LA 3TEMA 1P61B 3JQ9A 4KKVA 3EBLA 3GCZA 4R2LA 2VUSA 3T5TA 1PZXA 2ZIGA 3LX8A 5FPYA 4QDTA 4BFSA 2G36A 1WCIB 4DILA 2ET6A 8ICWA 2FX5A 3NHPA 4ZQIA 4F4CA 2PFNA 4KX3A 4OU4A 5JI3E 4IQUA 1BPXA 3DQPA 5JFTA 3ZY6A 4MYDA 1GD1O 4E22A 10MHA 1VIAA 4RHFA 2QP4A 5JMTA 4BUZA 4IS3A 4TMFA 3NYIA 3EQ2A 1GPWB 2Q07A 4JR1A 1K8QA 2YNMC 4ACAA 1UIRA 2JH7A 2PLAA 2R1VB 1U2DC 2JRLA 1XDBA 1WU7A 4X7MA 1KU6A 1WO8A 1DCKA 2OB2A 4F2HA 2ZCVA 1L1RA 4ZH4A 4YCMA 1CRWG 1AURA 4CEHB 5BYJA 2Y71A 3L4PA 2R1UA 2CBGA 1NQAO 4RHYA 1JIJA 1G18A 4WCDA 4IXDA 1RFGE 3BDPA 4JR0A 2W2NA 5HTOA 4OQMA 5A0TA 4JOBA 5EP4A 1TZKA 4JLBA 4BLVA 4EELA 3LUGA 3THOA 2GCIA 4M36A 2PKYX 4AMGA 4R1TA 3AL3A 3BQ7A 3OJ0A 2V5UA 3VMFA 4G0PA 4HDMA 4JI4B 4TTJA 2ZR0A 4ZHSA 4YRLA 2JGNA 1NZJA 4EA7A 3FKSD 3U16A 2E8MA 3IAAA 4IDFA 5CFPA 4BO0A 4DWOA 3RAXA 1YU6A 2XY7A 2HW8A 4M54A 4LRQA 4MS1A 3LBFA 4TYQA 1YZVA 2Q3HA 4ATNA 1U3DA 1PZEA 1HYEA 2QVGA 4BAGA 3SV4A 2BIFA 5AJTA 3BDAA 2H0RA 1JQAA 1Y4ZA 3NRZA 2Q2WA 1YCDA 5BYAA 4Q3NA 3EF1A 1NATA 2FW6A 2FDRA 3O9MA 3NBMA 1FXSA 4MWZA 4G1VA 1QCDA 4HY3A 2JZNA 2H9AA 2QUIA 2RQ5A 1ZH8A 4UC0A 1E3QA 5TT0A 5FAXA 2H1VA 5LA6B 4ARSA 3BRCA 3ZEAA 5JLAA 3TFRA 1J42A 4IDQA 3HCPA 4KZPA 2A5DA 1YB1A 4R7ZA 1NWHA 4NBUA 3FYUB 5EJFA 2EBHX 2ST1A 2O4CA 2XMSA 5HW0A 2EZ9A 4X8HA 3DUFA 3TB6A 1I3KA 3HXTA 2QLNA 5JQWA 2RGDA 4YVZA 4D1YA 4AY2A 4MHOA 2P3LA 1RWBA 1ZUNA 1A4IA 2NO4A 4CG2A 4W5WA 3DMRA 2RB4A 3R3HA 2AOXA 4KFRA 3F2BA 2NTNA 3OURA 4JJEA 1QYRA 3L1JA 3A0UA 3HNRA 5AUQA 4XA5A 1QTRA 4BDSA 1MVNA 1Y1PA 1ZVMA 3LE8A 4ZOLA 1XR3A 1Z34A 1I4EB 3OQ1A 4C7YA 4J6FA 4YD2A 4PTZA 3QHAA 4X20B 1V4BA 4S05A 1C7RA 3PLAE 4DM4A 1KSFX 4MH0R 2IVZA 1TPZA 4NOJA 3I8XA 5KFHA 5ALYA 3U3OA 1WX1A 2J59A 3NOVA 4PFKA 1RJ9A 2ZSDA 3U4IA 3FPBA 5JDIA 1EJBA 4FILA 4PZ0A 1Z5UA 4B87A 1MA7A 2QD2A 1N75A 3L4EA 4I2IA 5K8IA 3KZXA 5LOVB 2QKQA 4WN9B 2EG5A 3OMXA 3WTBA 2AEEA 3A10A 4XSVA 4C7XA 2WD7A 3D6MA 1V8DA 4F9GA 1TX4B 4ASUD 1O94C 1TMOA 4HXEB 3KR9A 1CVIA 4DSAA 3ETHA 1Z36A 2P79A 3KJIA 1YVRA 1L7BA 2PANA 3ZOKA 3B1XA 5I8WA 1Z4NA 5G1NA 2G71A 2BEUB 5DHQA 3SDZA 5CA0F 4CM9D 3HX0A 1S1CA 1YFJA 4CV1A 4IGAA 4Q34A 8ICNA 4EX7A 3CWCA 1H6AA 3ZCUA 2DPIA 3C3DA 3DEYX 3ZVKA 1XOIA 3TMKA 1C8KA 5B2ZA 2O7VA 5B2EA 2X2PA 1EP1B 5F2OA 1NLZA 1S2IA 1U3WA 1PR0A 3NO4A 1H4SA 1MR3F 2ISSD 3NWOA 4X8MA 3H7AA 5CDTA 4LDZA 2BMAA 2D1FA 2VSYA 1AROP 2MU2A 6PFKA 1KDRA 3U81A 3O82A 5AXCA 3CW8X 3TUJC 4XUDA 2JZBB 3VV3A 3AEZA 1ZMTA 2MSLA 2FFBA 3CF4A 4RPKA 3M5DA 3RAQA 4DUZB 3BF8A 1JNYA 4N0MA 5DGCA 4I1IA 3MGKA 3R0QA 3IAEA 3BDIA 4AF8A 1DOAA 3UENA 3TQHA 4AMVA 4B46A 3AWIA 3WB0A 3RSOA 2OCLA 5H3HA 2OLKA 2ZBGA 3I8OA 3PHGA 4L8WB 4QG3A 1ZQHA 3K4HA 5DM2A 2EDCA 2Q1WA 1DIRA 4Q8EA 3PNOA 5FOQA 2NUTB 1RD4A 1XD9A 2Y27A 1ZD2P 1QVAA 1G8HA 5JT1A 2UXBB 1OFIA 3WWYA 4WXHA 4JT8A 1K0FA 4TS3A 1T4MA 1U2GC 4XQ9A 5EWGA 2XGGA 4N65A 1NVAA 3I9LA 4F5EA 2XF8A 1XLTC 1XZBA 5KB3A 4EY3A 3P9CA 2JLYA 3LHFA 4JODA 1EUZA 2IDJA 1SU7A 3H2BA 1KZGB 1GKYA 4V0ME 3VZCA 3IURA 3U62A 2CV2A 1IHOA 2H16A 5L3SB 1H1DA 5L3ZA 3OJUA 4F50A 2B83A 1GPBA 2SNIE 2NZXA 3MGVA 4TMYA 3T3FA 2ZE8A 1V3QE 3QVMA 3RJFA 3PVXA 4X1OA 2P0EA 5C3UA 3LCUA 1FC0A 3MOGA 2WTUA 1L6RA 1AJEA 2ID8A 4PPYA 5DIZA 1WA5A 3FA2A 4H27A 1D2EA 1DJPA 3PR5B 3FC4A 1AHHA 2MINB 1FP6A 2HBZA 1VE6A 4GI1A 3VBEA 3WLMA 3SXUA 2EEZA 3VKFA 1GA4A 3MWYW 5F9HA 1D8LA 5G0UA 1FJGB 2XCPA 2CJPA 2E87A 4JIGA 2QE7A 1Y8RA 1XEAA 1PEAA 3HY3A 5GINE 3W77A 1J25A 2FWMX 1PJBA 7ICHA 4D2IA 3DG9A 2CNKA 4G0VA 4P5EA 4YCCA 3U1BA 5KFTA 2OR3A 4V2UA 1LI7A 1XHFA 1DX4A 4PM4A 3TZLA 1OFHA 4WKNA 3FWNA 4ZJZA 3TMYA 4FBGA 5EZYA 6LDHA 4BJ6A 1Z7WA 3C8HA 1T4CA 3UXPA 3SIRA 2CB9A 1T5BA 1WRBA 3CYMA 3EGOA 1DRGA 3MSXA 7REQA 1N5OX 2VP0A 3QXJA 3T7KA 2D0OB 5BSMA 2R7LA 5KG3A 3ZY2A 3BQ1A 3GJSA 4WXEA 2IYVA 1JSLA 2QMQA 2RHBA 4W5QA 3K2EA 3VR6A 1EX6A 3SBDA 1RYUA 4NZ9A 2RHHA 4HWKA 1NC3A 3G2IA 3ISTA 3FM9A 1P4SA 5EAIA 4CMGA 4F1WA 4L27A 3KHRA 4GHWA 1KOGA 1MQ3A 4B9TA 3WGMA 1F8GA 5DB9A 3OY2A 4A8JB 3HFJA 1ENYA 2E85A 4UHHA 1A9SA 3AUXA 4FO6A 4Z2AA 2AKEA 1JQ5A 3TZHA 1MDBA 1Z16A 1KYQA 2C0PA 4OJLA 2FW7A 2Y77A 2HNBA 2XYQA 9ICQA 3D7KA 1P2TA 4EYQA 1HZJA 1L1QA 5LL6P 4HTFB 2DHCA 4NU8X 3GRCA 3R3WA 4GE3A 4Q3EA 1HNWB 3AESA 1QHHB 2Y1FA 3WYAA 4DG5A 3QZUA 5DKWA 3DHVA 5JLJA 5AKJA 4BBJA 2O2JA 1KDZA 3IP6A 1GU0A 4BVJA 1UHUA 4N48A 3TRHA 3WWDA 4LV6A 4EENA 1N5DA 2XE4A 1EMDA 3FETA 2DBQA 1FB5A 3BHJA 3BE8A 4GGOA 3TNJA 3D4IA 3DAFA 5C37A 3VC2A 1T3GA 4K6FA 3JQGA 1BE8A 5AXDA 1KO4A 4LJSA 3U9SA 4N6NA 4GRAA 2WTMA 2Y05A 8ICFA 5DSTA 3SBXA 2PO5A 5LA6F 4Q12A 1B00A 1W6UA 4PPXA 1XDGA 4QGSA 5E4YA 2YHSA 1ZXBA 1T13A 1G8JA 3NTLA 1EE1A 4IINA 1V41E 4XOIA 4B6JA 2PG3A 1IB0A 1WD7A 3ORSA 3AUOA 2BTEA 2PMWB 2YIJA 1KQOA 2ZYGA 4CQMA 4ZMBA 1AV7A 4P86A 2JBAA 1GSAA 1IN6A 3DBRB 4Z0TA 2WHXA 4ND1A 5E4TA 4DA9A 1L7MA 3D8BA 4UNNA 1LRKA 2XB2A 4HAIA 3UAGA 4AY3A 1EXVA 1IPEA 1O97C 2YXLA 3T54A 1XZKA 1EHYA 1JDBB 5ALOA 3CLKA 2HYIC 5IW8A 5A4MS 4DR6B 4A36A 3GRZA 2RHJA 4MVJE 2JKYA 1HNZB 1PR1A 1Q44A 3K9FC 4IRCA 1NXQA 3O3MB 4PX9A 1MHTA 3QIAA 5IXYA 3GT3A 3AVQA 4P80A 5HNKA 2ZKLA 2YQ4A 3D8UA 5G4KB 4EY8A 3OJSA 3FUTA 1GZ4A 2WTNA 1CY4A 1YHNA 2ACWA 3PEEA 2EQYA 2WNHA 3H05A 4F38A 5LOVF 2W70A 3W5CA 2BFFB 1N34B 3BD7A 3Q2IA 5IULC 2GI4A 5CTJA 3NAQA 2Z57A 2H54A 3RF6A 4WJLA 2F8KA 4PYOA 4X9XA 2LR0A 4F04A 4IV8A 5AKGA 1FU7A 3RAGA 2GEDA 2OP0A 4BNZA 2ZBUA 4RKRA 4B34A 5JASA 1H1LB 4YDRA 2HVHA 3MRTA 2J8ZA 3GRUA 1EXDA 3G23A 1CC1S 4UVGA 5DPMA 1WW2A 1DXQA 5A71A 5FTMA 1HLGA 3K70C 3MJFA 1VE7A 2FRDA 3IUSA 3KXLA 1FFHA 4OQLA 5GADl 2VSFA 3JD4A 5AHXA 3OY7A 3H40A 5AI8A 3A1SA 1Z37A 3E5MA 1BVHA 3N0XA 1OT3A 1VIDA 5KG0A 4KIGA 2IHZA 4N0QA 4J7UA 3LT5A 4ECSA 1U90A 1Y3CE 3BJRA 2A14A 3UYKA 2MYNA 1YBVA 4GI7A 2HR1A 3KR1A 4AP5A 2JCBA 2BZGA 2HU7A 4PLVA 4WUTA 3U1VA 2Q41A 2R66A 1A1SA 4IHQA 3L7OA 3JR7A 1M1XB 5IKXA 1ZU4A 2FWRA 1TUBB 3ZJTA 4A6EA 1CUJA 4YHBA 3ZE9A 4YRTA 2GAJA 2A8YA 2LGJA 3DVLA 4NM1A 2CE2X 2R4TA 4DWVA 2Z04A 2MT9A 2PFSA 1Z0UA 4X5VA 5DQGA 3RUCA 1GEGA 5JSHA 2ZW9A 1FVXA 5D3ZA 5J8YA 1KH2A 2A9JA 4LQCA 4EZEA 3MDAA 4K4HA 4L72A 1R4NB 1NT4A 4K7JA 3ER9A 3LT2A 4B3RB 3F4BA 3OOHA 5L53A 1FQOA 1U0NA 2H7VA 2H1LA 1ZQVA 3NTUA 4DS5A 2CFRA 2ZXUA 4RIHA 2B37A 4E5MA 2BFEB 5KDOA 3ZI4A 4CQNA 1Q1QA 1UODA 3NR2A 1ELOA 4X6XA 4LXIA 4C78A 3C8UA 3HWRA 2ZUTA 1V16B 4US1R 3KHUA 1VSVA 4FKBA 3P2JA 3TXXA 4Y0AA 2Q5IA 1XN4A 4WCFC 4UMVA 1MCZA 1GTSA 2UZ1B 4LKOA 4HSEA 3CVXA 1TQ4A 4RPGA 1TCVA 2CF5A 2CLKB 8ICHA 2D0PB 2V58A 2HFKA 2JFYA 4MQFA 4OXNA 2NPFA 2BZSA 1GG8A 3ACDA 1AV6A 4QW8A 2QMYA 1N61A 1BS9A 3CNLA 1OASA 1KI8A 1M2OB 1KK2A 5AXBA 5DN6A 4C4XA 4Z0NA 5AHOA 4RSGA 1WB9A 4ECUA 2HBKA 1U6IA 4I6GA 3L49A 2PZ8A 4AWXA 3IAHA 3BD9A 3TSAA 4WOJA 5EJAA 4TUPA 1H23A 3T4PA 3WWZA 5CXQA 5KINB 1W5TA 2QTWB 4QUGA 1KXZA 3QXHA 2QL5A 4J94A 4AN0A 5JSZB 3TLKA 4Q5IA 1PX0A 2YRFA 4BNTA 3HNOA 5DCYA 4K87A 3QLJA 4UPVA 3RSSA 9ICPA 4NE2A 3O6VA 4JUCA 3H1EA 4WE3A 5BN1A 4MPRA 4ISBA 4IIEA 1WTCA 1VDMA 5EI5A 2K89A 3GARA 4J3NA 2A1JA 2TSYB 4C7KA 3TTVA 2GAOA 1Y63A 3L40A 4Z1OA 3KKOA 1WVGA 1UBCA 2HA2A 3ZQ4A 4RPIA 5KU1A 2XUJA 4UJ3A 2C92A 1WS6A 2NZVG 3ROXA 4M9XA 1TCAA 1TM3E 5F4ZA 4H7DA 4U8GA 5ALFA 2FGJA 3NNSA 4ETMA 2JMGA 3OZXA 1HFWA 3PGLA 3EWAA 2AG6A 4I5FA 1N2XA 5K3SA 4ZO6A 3V6MA 5C5DA 1NBWB 4BMNA 4CMKA 4EBDA 2V6IA 1YGYA 3NU1A 3GEBA 3BTOA 2HW3A 3LF1A 3LC1O 4ZT4A 2G25A 2CLMB 4F85A 2W3SA 3DZ8A 1Q0QA 4A15A 1H85A 3CMCO 1KKLA 2QTVA 3GLUA 1L5UA 1T9KA 2EAOA 2FR8C 5REQB 4FGSA 1SPXA 3D2QA 1EJ0A 1QSYA 1ADGA 5LQDA 2RGBA 2MMGA 1SHUX 1E1MA 1SBYA 3ESXA 4PEVA 1Y4DE 4RQ6A 2R85A 1T6NA 4RLHA 2IPLA 2TMDA 3I2GA 4AJKA 1JJAA 5A0FA 3GY0A 4E15A 3HR4A 1W5BA 3QLUC 1QRAA 2PUHA 4GOND 4YIHA 3GVCA 2QRHA 3OOWA 1TQ6A 2BM0A 3EWNA 2JFGA 4J8PA 4PQGA 3PHJA 2QTMA 5TR9A 3KPVA 3BB4A 2H2IA 4B9LA 2ZE6A 2F43B 1CR2A 3MTIA 4DQXA 1N0IA 1XTTA 5C9ZA 1NJ8A 2BPFA 2AOTA 3D8TA 3C70A 3PTZA 3ANNA 4C4ZA 4DEZA 2EP8A 5GGYA 2ZULA 2F1RA 3WK8A 1QBKC 4B9AA 3WL6A 4LXYA 3GGSA 4U2BA 1CVRA 4NBKA 1YO6A 1AGXA 1T0HB 4C5CA 3F3SA 5SZIA 3GV0A 5EXTA 1Y5MA 2YINC 3A6DA 4DFJA 1SEVA 4F4DA 2O2DA 4Y6SA 2NRVA 4R41A 1R15A 4F7DA 1M1YE 1RCUA 3EJWA 1MO3A 2HOIA 4DCVA 4BO9A 2QNRA 3SEFA 4J9OA 3NP7A 3FTDA 1D8AA 2R9VA 2P9FA 5LNK6 4BUJA 3B52X 4Q48A 1ST2A 1EGMB 1Q6YA 2KSOA 5ALUA 1PGNA 1NNUA 4Q9DA 1HDYA 3TCXB 4UCQA 5KNCD 1ML3A 4JLAA 2EFJA 4OUKX 2XQJA 4F2RA 3CZPA 2R8ZA 5DW3A 3M2PA 5B2FA 2OILA 1G9XA 1RBYA 3NBYC 4KPFC 5HRAA 1DIAA 3I5YA 3DNFA 4Z7NB 1VDZA 4G5HA 1PJ3A 1XRPA 3GG9A 4RT3A 3MBKA 4CMAA 3QW2A 1QQAA 2VWPA 3LQKA 5C5CA 2FOXA 1VPVA 1R0ZA 2EGGA 2O0LA 3PF9A 2RRDA 3LPMA 5KNDA 1K97A 2B8WA 2PY6A 5FPQA 4YRGA 2H18A 3Q0TA 2E1RA 4BWMA 3ICPA 3KLPX 1SXEA 1P8JA 2CFTA 3X1WA 1ESCA 4MW5A 1ZIYA 1EB8A 3SR4A 2GRJA 4BNJA 3AUAA 1V96A 5ITVA 2C4MA 2HU8A 3UH0A 1VMIA 1TO6A 1QU3A 4L0DA 1U7OA 4LE0A 3V8BA 1PLLA 4PHDA 3JS5A 2CLOB 1IFXA 1RS0A 2B3TA 2OQRA 1EE2A 1KYTA 3CNQS 3OO1A 3NKLA 1W581 3S8MA 1X92A 2VWQA 1N6OA 3WHIA 2PA0A 3BIOA 4RTPA 2XVAA 3VR4A 5D7BA 2QTBA 3BWBA 3OPYB 2FLPA 1COOA 4KH1A 4WBNF 4MF2A 1BE6A 1X1EA 1RJGA 3HCNA 1PZHA 2NRTA 3OM9A 4CL8A 5BYBA 3IBTA 3PL1A 2FP3A 1US8A 3LRPA 5HJEA 4HO1X 4CCSA 4F5OA 2FZGA 2EP5A 4A0GA 1W73A 3F5AA 4I1RA 2RHCA 1J0DA 1BX3A 7ICVA 4G97A 3DH0A 3KALA 4Y2YA 4CDMA 5COBA 4CHGA 3AR7A 2XZLA 5AKZA 3RWMB 3NZEA 1DX9A 2YCBA 3EFEA 1UC8A 5LR6A 3Q9SA 4QZBA 3W8NA 3IG8A 4XEHA 3T0IA 2J7KA 4QXQA 2H8KA 3HDYA 4P7GA 3FOBA 3EIXA 1GYRA 2PD4A 2CK3D 2NV6A 2XTAA 8ADHA 4IOMA 5IKOA 4J9PA 2OUKA 1KP2A 5ALXA 1MN6A 1DAPA 3PFHA 1L3BA 5F3DA 1DAIA 4M1OA 4I2GA 2OO5C 5TZVA 2AMFA 3KNZA 4KWHA 1JKJA 2PLWA 1D8BA 5EYPA 3T3NA 3HYCA 4MKFA 2HZBA 4M7WA 3QEMA 1NV9A 9ICBA 4PLYA 3B9JA 2BGRA 4HNUA 1E6LA 1TAUA 3KXKA 1AKYA 5AUOB 3KE9A 4QEDA 1KE1A 1TE2A 2QPOA 4IRDA 3OJCA 3QEOA 4ZAWA 5AJWA 2ZIWA 4ARUA 2C9BA 3FFWA 1ADFA 4PAMA 5EJMA 5C53B 2PRYA 4OG2A 5CPBA 4PSCA 3TRIA 5AIBA 4GLOA 1FTNA 1YBFA 5T3YA 2PRZA 1EA5A 1UIMA 3HCRA 1NBMD 1NVGA 1L5KA 3FR7A 1WOYA 3FNBA 3AYZB 1TEZA 4MCJA 4PGHA 4CDRA 2A0YA 1CP3A 3IUNA 3BJZA 4HQ0A 4PQFA 1UBUS 4BVFA 1E8DA 1VHLA 3X1JA 3EPJA 1PVRA 2E4UA 4YQEA 3HP7A 2VC2B 4YP6A 2V5AA 2HXYA 2NO7A 1Y34E 5L8VA