2B0CA

The crystal structure of the putative phosphatase from escherichia coli
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
199
structure length
199
Chain Sequence
AKMLYIFDLGNVIVDIDFNRVLGAWSDLTRIPLASLKKSFHMGEAFHQHERGEISDEAFAEALCHEMALPLSYEQFSHGWQAVFVALRPEVIAIMHKLREQGHRVVVLSNTNRLHTTFWPEEYPEIRDAADHIYLSQDLGMRKPEARIYQHVLQAEGFSPSDTVFFDDNADNIEGANQLGITSILVKDKTTIPDYFAKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The 2.0A crystal structure of the putative phosphatase from Escherichia coli
rcsb
source organism Escherichia coli
molecule tags Structural genomics, unknown function
molecule keywords putative phosphatase
total genus 69
structure length 199
sequence length 199
ec nomenclature ec 3.1.3.10: Glucose-1-phosphatase.
pdb deposition date 2005-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2b0cA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2b0cA01
1SU4A 4O8CA 1O08A 4J2TA 3M1YA 1XVIA 4YIHA 2G80A 3U26A 1U02A 5AW8A 2AGVA 3KZXA 3U7EB 4Y2QA 4UM7A 1QYIA 2WF7A 4QQFA 3N28A 1VJ5A 2QLTA 3W5CA 1ZJJA 2NO4A 3ZI4A 2C9MA 3QUQA 1RQNA 3FVVA 5AESA 2JAUA 3E81A 4KNVA 4L6AA 1FEZA 5AM1A 2IOFA 4CF4A 2IOHA 2I7DA 3W5DA 2BY4A 3A3YA 2R8EA 2FUEA 4XOUA 3WKDA 2EARA 5ALDA 4UASA 2ODAA 4IG4A 4F72A 4QJBA 3MPOA 4BX2A 3N5KA 2VKQA 3WKAA 1VFPA 5AW2A 3SKXA 5AM3A 4G63A 1QQ7A 5AICA 2IYEA 2YMQA 4YIKA 4Y2PA 2WF6A 4ZEXA 5AI4A 4FFDA 3ESRA 4HYTA 3OCYA 5ALFA 3WK7A 4EX7A 3ZU6A 4KN8A 1RMTA 1TE2A 3UM9A 1RKUA 2AUTA 2IA5A 3ZTWA 4CF5A 3SMVA 1N8NA 3IB6A 2NYVA 3GYGA 2AMYA 5AW1A 5ALIA 4YH1A 4HAIA 5AVSA 2WFAA 3NASA 3NUQA 3VAYA 3QU4A 4C4RA 2FPUA 5ALNA 5ALQA 5ALGA 4B6JA 5AM4A 1CR6A 2G08A 2ZBGA 4HGOA 5AK3A 5ALMA 4L6CA 4YGYA 4NABA 3OCXA 2I34A 3S6JA 3FZQA 4E88A 4ZEVA 5AW6A 5AW5A 3QLEA 3EF0A 3AR8A 4BX0A 2ZBEA 4Y2SA 3L8HA 1Z4NA 2RARA 4HGRA 2B1QA 3HLTA 3MN1A 2P11A 5ALWA 5ALUA 5A3QA 1NNLA 5AI5A 1T5TA 5ALKA 4Y3UA 1L7NA 2FPWA 2EATA 2YN4A 1Q92A 2EAUA 3DAOA 1RLOA 1L7PA 3RFUA 5AKEA 4C4TA 3OPXA 3W5BA 1L7MA 2YBDA 3HYCA 3SF0A 4BYGA 2D2VA 3I76A 4EX6A 2HX1A 3WKCA 1YV9A 5AVZA 3WK5A 1U2SA 3N07A 1L7OA 4XQ0A 4BKMA 3KD3A 4NAVA 3PGVA 4UAUA 5AI6A 2WHEA 3SKYA 4OD0A 5ALJA 5ALYA 1TJ4A 4RETA 2GO7A 2JARA 2GFHA 1F5SA 5ALZA 4DW8A 1T5SA 2WF9A 3KDPA 4BNDB 2HEGA 3QUTA 4Y2YA 4DCCA 3TLMA 1YDFA 5AVTA 3U19A 1VJRA 3SHQA 2W11A 4YCMA 4CF3A 1Z88A 4PNHA 1Z4OA 5AKKA 5ALXA 5AIBA 3N8GA 3ET5A 4YCNA 5AKZA 3L8EA 3L8GA 1SWWA 4HGQA 2GMWA 2HSZA 2YMLA 3UMBA 3L1UA 5AVUA 3AR3A 2W43A 3ZX5A 1JUDA 4C4SA 2RAVA 1N9KA 1Z4KA 3F9RA 4FYPA 1O03A 2GHTA 4NFLA 2PKEA 1Z4LA 3CZ4A 1AQ6A 3ZVNA 3ESQA 5AI9A 4HGPA 1J97A 5ALVA 4CNQA 3ET4A 3EPRA 2RB5A 3R09A 2Q5EA 1LVHA 3L0CA 2C8LA 5AW0A 4F71A 3E8MA 1U7PA 1Z4QA 2NO5A 2JAOA 1KYTA 3B8EA 5AK5A 5AK6A 2FPXA 2ZG6A 2B8EA 3KBBA 4CE6A 4DFDA 3WK4A 5AI8A 1NF2A 4KX5A 2OYCA 5AM0A 5IS2A 1QQ6A 3R9KA 4UU1A 2CFTA 5IT0A 3AR2A 4MWOA 3EWIA 3W5AA 2C88A 4EEKA 1YJ5A 3I28A 1EK2A 2G09A 1WVIA 3L1VA 3IJ5A 4GIBA 1PW5A 3A1CA 4H1WA 4J03A 3PCTA 3RF6A 2HOQA 5ALSA 2B1RA 4UMVA 4UAVA 3QUCA 3FM9A 5ALOA 3A1DA 5AVVA 1T9ZA 4Y2VA 2YMPA 3ZW7A 3UMGA 5AM2A 4XPZA 3L8FA 3QGMA 4NV0A 4UW9A 2FUCA 3AR6A 3U13A 4I9GA 2OM6A 2OBBA 1TJ5A 4KX3A 3AR9A 2CFRA 4KYTA 4FE3A 3UMCA 2B30A 3OCZA 3WGVA 4JB3A 2ZBFA 5AW4A 2I33A 2FPSA 3P96A 1S8OA 1Z4IA 4RESA 5A3RA 3L5KA 5AI0A 1ZRMA 2YMMA 3D6JA 4OCZA 2JGAA 3AR5A 3OCWA 3PGLA 4OFZA 2OA0A 1QQ5A 5AKGA 2ZXEA 3ZWKA 3SD7A 3WK8A 5ALTA 2YJ6A 3QYPA 5AKIA 1CQZA 4UATA 2QYHA 3MC1A 2MU1A 2ZOSA 2R8XA 4XE5A 3WK6A 1Q91A 3N1UA 4Y2UA 1Z5GA 1X42A 3KOOA 4ZEWA 3I1YA 5FP0A 2B82A 1YNSA 2ZBDA 3ZTYA 3ZX4A 3NAMA 2IOFK 2HCFA 5ALHA 4UU0A 4HGNA 1RPZA 5AK4A 1ZS9A 4UMDA 5AKHA 3QX7A 5AHXA 5ALEA 3NIWA 3PDWA 3L7YA 3BWVA 1L6RA 1Z5UA 3AR4A 5ALRA 3QU5A 2FPRA 4MUMA 1XPJA 3KC2A 2WF5A 1RDFA 4AP9A 3QU7A 3WKEA 3OTQA 3WKBA 2PR7A 2FEAA 5AKJA 4BX3A 5AVWA 4BEVA 5AW3A 3WK9A 4EZEA 2GHQA 2WF8A 3ED5A 1ZRNA 3U7GA 5IT4A 2HDOA 1EK1A 3ZVMA 1RC8A 1WPGA 1SWVA 4KNWA 2RBKA 3FPBA 4YCLA 3J7TA 3MMZA 1K1EA 4EENA 4UARA 3CNHA 4Y2JA 5A3SA 3WGUA 4NWIA 2G0AA 3BA6A 3QNMA 1J8DA 2CFSA 5AVXA 4GXTA 2HF7A 2FDRA 3NALA 3FGOA 1WZCA 5T41A 5AM5A 3SLRA 1U7OA 4DWOA 5AW7A 1ZD3A 1ZD2P 1RMQA 3B9BA 3ZUPA 5AVYA 2CN1A 3IRUA 1Z4MA 3OCUA 2FI1A 3QUBA 1RMYA 2YFYA 1YS9A 1Z4PX 2Q4TA 5AIAA 1RLMA 2G07A 2HO4A 4JDPA 4L57A 3FPSA 3E84A 5AW9A 3E58A 2AH5A 1Z4JA 2I54A 2BDUA 2I55A 3NANA 3ZWDA 2R8YA 2HF2A 1RRCA 3DNPA 3K1ZA 2B8JA 3DV9A 4Y2RA 4BBJA 1YMQA 1IWOA 3QU9A 4Y2TA 2P9JA 1S2OA 5AVRA 1ZD4A 5JJBA 4EELA 5AKYA 3OCVA 2I6XA 5AKLA 4UM5A 1RKVA 2YJ5A 2G1AA 1TA0A 2MU2A 2B0CA 1QH9A 4AS2A 2YY6A 2DQSA 1WR8A 1RKQA 1RQLA 2BDEA 4OHFA 3QXGA 3U7FB 1ZOLA 1LTQA 1L8LA 3L0YA 2P69A 1RLTA 2YJ4A 1L8OA 2HHLA 3L0BA 2PQ0A 2R8ZA 2O9JA 4UMEA 4IFTA 3M9LA 3R4CA 3U7HB 2WM8A 1TJ3A 3NRJA 2Q4RA 1Y8AA 2X4DA 4G9BA 4BEWA 5ALPA 2C4NA 2P27A 2O2XA 5ALLA 1NRWA 3A1EA 3EF1A 5E0OA 1U2TA 3I6BA 2W4MA 3ONNA 2JAWA 1XP5A 3ZVLA 5AKXA 2YJ3A 3DDHA 2G06A 4AS3A 2MSNA 4BNDA 1MH9A 4UMFA 2HI0A 1ZD5A 4Y2XA 5AVQA 3AR7A 3B9RA 4I9FA 2C8KA 3QU2A
chains in the Genus database with same CATH superfamily
2ZYUX 3B13B 5YASA 1IFXA 3BDVA 1MDFA 3KJEA 3TR0A 3RJGA 2JCBA 4U2EA 4Y2QA 2GETA 3RM3A 2C28A 3GEMA 4MUGA 3AYZB 2BEJA 3ZW9A 3H2YA 4YLGA 1VJGA 3CUWA 4UAWA 2F64A 2IX9A 2H8KA 4OGWA 4C14A 4RD4A 3PPIA 4EEZA 4HLUC 4ZVLA 1MOSA 4Z7OB 4X8LA 2I4RA 2PWZA 5K3DA 2X4IA 4UUMA 1J2RA 3L6EA 4IKPA 4QA9A 4WMLA 2Y77A 1BW9B 4L3VA 3H9QA 2I78A 5DGTA 1SZHA 4RCVA 3MWJA 1I3MA 5EHXA 1FZQA 1O5IA 1UKCA 1WLYA 1WNFA 4Q9IA 4X44A 2J3MA 3B3JA 3ZH9B 2W83A 1CEQA 1SKWA 4UASA 1DKQA 1ONSA 4L22A 4BN4A 4F72A 4EEXA 2WB2A 3A2NA 4QZ8A 5AQ1A 3TAPA 5CH5A 1KO4A 3WKAA 4X1YB 2B5WA 1LY1A 1PTJA 3NVWA 4XUGB 3HB7A 3LXUX 2AFHB 2RCNA 2ZIAA 1DEOA 4G4JA 4NDAA 5HCIA 5KG6A 4K5QA 4AZ3A 4O3FA 2C2EA 4M9CA 3KKKA 1Y8ZA 4JI5B 1WWVA 5DQGA 2KTQA 4M37A 3WMXA 2AQ0A 3UJNA 3KZIU 2O7NA 1ECFA 3EBPA 3G5LA 4RK7A 4YAUA 1Y3DE 1OX4A 3EZYA 2OHGA 7ICOA 5ANRB 1GPMA 3NT2A 4F5RA 4GOOD 4ND3A 3HRKA 1TE2A 2GWHA 3UM9A 1CDOA 4KVZA 2DFKB 3AN1A 3DZBA 3EVTA 1RKUA 2WFLA 2ZBPA 4NU6A 3V1LA 1PE0A 1DBSA 3ONFA 5U4QA 3RVSA 1YL7A 3K9HA 4XCVA 4YX9A 3P9YA 5KQSA 2HTFA 1I1OA 4PSKA 4R2XA 5ALIA 4TV9F 2IWHA 2WLSA 3A7EA 5AW1A 5JECA 4YD1A 5U9CA 4C6TA 9MHTA 4QGHA 5B2FA 4JN6B 1U4OA 4KV9A 1Q74A 5IXSA 3FOFC 5DO9A 4HNAA 3V72A 1KBUA 1WTCA 3H05A 4RIHA 3CRMA 3O4IA 3OF5A 1I80A 3RBXA 1WY7A 2BFEA 2DJIA 2C2XA 2FPUA 3TLBA 2EP7A 4G1BA 1Q7GA 2ZR9A 4GP7A 4JX8A 3TJRA 4KR6A 3CX8A 4QM7A 2KSOA 2XPCA 1N2BA 3FMPB 1T10A 4Q3EA 4QVKA 3TCNA 2I0FA 1M1NB 3RH6A 3PVXA 1Z28A 4D57A 3MJCA 1S9FA 1G17A 1X80A 3MJDA 3WWZA 4NRDA 2J67A 3S2UA 1B1AA 3TE6A 1D3AA 2UZ4A 1GPDG 4NZOA 1LLUA 1WULS 2V1UA 1ENYA 4AO6A 4BO7A 2R48A 4WWHA 1N5KA 1YFJA 1KHHA 5KFNA 3CPEA 2NT4A 4UFPA 4RABA 3SZOA 2IDMA 3WWYA 5IJ9B 1NL3A 4DMUB 1LBIA 1DXSA 3GQBB 2CJYA 4FB4A 4NLLA 5DJ5A 1Z63A 3QKSA 2X0EA 2QG4A 4OJQA 1R0BA 2KPOA 4N82A 3SC2A 9ABPA 1EM6A 5ILQA 1K8YB 3AJRA 2ILVA 3FB1A 4GZMA 3OPYB 4ZAFA 3JWJA 1ZJMA 1O7JA 4C78A 2L2QA 3EXG1 4MDHA 2P9FA 3WO1A 3TBKA 2W0SA 3QPUA 5D51S 5EJ8A 3KQYA 4BZXA 2XMGA 2YWBA 2OXRA 1A5SB 4EB0A 4C7OB 4XFKA 2W6OA 1DI0A 1PP4A 1NQOA 3KZ1E 2EAPA 3RFUA 3SKVA 4AJNA 4DSZA 2O2CA 1HYQA 1JEAA 2NXJA 3ASYA 3QFCA 1V5EA 3T5LA 4HLCA 3I2JA 3PBKA 5UKDA 3ESDA 1T9BA 4YP1A 1M2OB 2GK3A 2PL3A 4NCIA 3BCRA 3WZLA 4AW9A 1RSZA 3JATB 5DNEA 4FS2A 2PQ2A 1U2SA 1VI2A 2YZMA 3I6YA 4IRXA 5DDYA 2X5JO 2YUIA 1KFBB 3KD3A 4E32A 4QT4A 2RC5A 3D3JA 5JSFA 5L53A 3O7MA 5KVVA 3PX0A 2PO5A 5JANA 3C48A 1H0HA 1P1IA 2FTKE 3ZU5A 1IBSA 2BLLA 1BROA 2EP5A 4JV2A 1TX4B 1K7FB 2AWOA 2Z8ZA 4LDZA 1FX0B 4MRVA 3OIDA 3I53A 5HJ5A 1BFKA 1F5SA 2QYSA 1KK1A 4I6JA 5BV2P 3THWA 1WOMA 3PDJA 2O3UA 7ICUA 1A1SA 1EE1A 1UFVA 2WSSD 4L16A 4PFJA 2DB3A 1XRSB 1L2TA 2CLFB 3Q72A 1W48A 4CLEA 5K0ZA 1U7DA 4ND1A 4AJIA 3I5UA 3P9CA 5FOUA 5KJFA 3ZLJA 2K8CB 1NKVA 1TW2A 2QY9A 1YZUA 4LX8A 4TL6A 2M1ZA 2PMBA 4W7SA 2JBHA 1XRQA 1GUAA 3ND9A 3V34A 1VRWA 3ISBA 3G68A 4LNHA 2HPZA 3IAAA 4YRFA 4KLTA 2WVJA 3OQVA 3VNSA 4DG8A 3HXMA 4RK0A 2JGJA 1RC0A 2XVZA 1SIBE 5J0SA 3EGXA 3P8ZA 3JQ7A 1OE0A 2G72A 1F2TA 3UFBA 3KU1A 1MP0A 2HIAA 1JUDA 1QAMA 2OGUA 4XXHA 4KV7A 3AP2A 4BFSA 1Z4LA 1NXQA 2PUWA 4W8OA 4G5YA 4AXXA 5HKBA 4DT1A 1HY3A 3NEJA 5E3JA 3F8SA 1YRYE 2YZ2A 2D5AA 3TKAA 1K1QA 2RBGA 3BB1A 1J2YA 4L72A 3RE1A 1TQHA 3TXAA 2WD8A 4K9RA 5AXCA 5K3SA 3WQSB 1FTYA 4Z0NA 2FETA 4GU5A 5HRAA 2GERA 3DPUA 4CKXA 4LCJA 4F5NA 2LBOA 4RGBA 1Q19A 1XN1A 1TTPB 1S89A 4EQZA 2QQGA 4YJKA 1ZM2A 2F3NA 3MBYA 2R00C 2I3AA 3TARA 1G41A 2B92A 1DV1A 1H38A 1Q3VA 2NGRA 2CRXA 2P9BA 3ZW8A 5LJIA 3IP8A 2ZRCA 3WLIA 1QJ4A 4JR0A 1GWNA 4TZTA 5ESRA 5HHTA 2H92A 4CKEB 2BMWA 2IYOA 2WTMA 2XKAA 2DUMA 1EUCB 3UGQA 4NJ8A 1SZPA 1Z6YA 1N36B 4J0FA 5COAA 1UT5A 1UPCA 3OC6A 5CFRA 2PH3A 3GXBA 3IJPA 3MB8A 3RPEA 3WIDA 2Q5OA 3U6BA 2IHVA 3PNMA 4WAUA 4IC9A 1ST2A 5ETJA 1KQOA 2G1UA 4WN3A 4Y9UA 2VTDA 3KCNA 1R15A 1CJTC 4J75A 4P9NA 2CXPA 4Y98A 4LTDA 2GILA 1EEHA 4CQMB 3L41A 1JH8A 1VA5A 1B26A 2MSKA 1X74A 2WJVA 1EI9A 4GIBA 4OLFA 5KI6A 3WICA 3BJYA 4EJFA 4CRWB 4EMUA 3PV0A 4HOYA 4FP9A 2VJMB 2IF0A 4HH0A 2JFNA 2OH2A 1I1NA 4COOA 3TNFA 5IANA 1DDOA 2Q5CA 4ZZ3A 3IB3A 1YWGO 3B3QA 3HHPA 2IYUA 2VTBB 4CMIA 1C30A 1SUDA 1BE6A 1SKSA 1G3MA 2C03A 2AQ8A 3IBGA 3M9XA 5F51A 2A5GA 3ZQJA 3CVOA 3WA7A 5KIAA 5EG5A 3KOMA 4WOCA 3ZXSA 2CXRA 1RBYA 3VKWA 1IXZA 3ZNOA 2LRHA 4QIWF 3I2IA 4QU5A 1XZEA 1G21E 1X7ZB 3ZUGA 3KT3A 4UVEA 4MVJA 3QBVA 1YNOA 4EHIA 1X15A 3A58B 1PJZA 1XDZA 2FUCA 2REOA 3KSZO 3O4FA 4JQOA 1TQ2A 4MJ3A 4U7WA 1CEYA 2PL1A 3LGSA 4JV5B 3B6JA 3EDCA 2Q2VA 4JLOA 1A3CA 5AD1A 1X8LA 5GONF 4MIOA 5BW5A 4DLLA 3GGSA 3WLTA 1FFVA 1WXQA 3BZWA 4QO7A 5CEJA 1XL1A 2WIAA 3OZCA 5EMMA 2E8MA 2C92A 2F1KA 2ONYA 4FFMA 4G85A 2CV0A 3DWFA 2RK4A 2YXEA 4G24A 4YLYA 4CTJA 3PS9A 3SENA 3P2EA 1CDDA 4CM4B 5AW4A 5CVDA 1FP6A 4B2PA 4L3OA 5E3IA 3VU1A 5JRZA 2I99A 1TYEB 4YJ2F 4OA5A 4RXMA 3T3IA 5CEFA 1H2YA 5KFJA 2PTGA 1OBOA 4Q9JA 2BEUB 4DFKA 2V6GA 3G2KA 3TW6A 1JQAA 2BEUA 3SU8A 2CLMB 2AZ4A 3NEYA 4M0KA 1TNDA 2G8LA 4FN4A 4NYJQ 3W6PA 5BWLA 4XSGA 4WBNF 2FWNA 4AG3A 2R85A 1Y1TA 4CETA 5CEHA 1IBRA 1BKSB 2BL4A 4MLDA 4P4OA 4R0VA 2A0XA 2CVOA 1C8BA 2HRBA 5HILA 1CJMA 1ZGBA 4IXTA 2NO6A 1QIEA 2ASVA 2ZRKA 1DLIA 2MMGA 2W9BB 3NNNA 5EZYB 3UIEA 4ACBA 4EHNA 4FWIB 3GH1A 1KJJA 3NBYC 4PGAA 4BCDA 1SQGA 4ZANA 2R8XA 4FHEA 3WK6A 4F4YA 3DO5A 3BOSA 2NUAB 1Q0ZA 1Z5GA 1DJMA 4LJXA 3SFZA 1PRYA 1T6XA 3GFBA 4KQIA 4AF7A 5A0LA 3N53A 3OX1A 3CZQA 1WCYA 1NBHA 5A9RA 5E3HA 4MAFA 3V8PA 2XGJA 4RA9B 1E2EA 1K7XB 4QXRA 4X91A 3AUJB 2H06A 2O07A 5CBKA 4YMGA 3KDAA 1YJQA 4AWBA 2NIPA 4UTPA 1QFSA 1FK8A 1HC7A 2JIBA 4U7CA 2ZR7A 5GV7A 1KEUA 4YWJA 5HE8A 4AMBA 5B2EA 1VL5A 3IILA 1PWHA 5CT6A 2GZ2A 4M54A 2IUUA 1T2EA 4JGBA 3UA3A 1OXSC 1TGVA 2IPAB 4JENA 1EBFA 3RTGA 2GZAA 5HM8A 2A5FA 3ZC3A 4KI0A 4DQSA 1T3QA 4OP1A 5L6MB 4NSNA 2WTAA 4GMDA 2AJCA 1HDYA 2QSUA 4ZZ0A 2CWWA 5CLGA 5J8YC 1JAXA 3G9UA 3X1DA 3CEHA 1RG6A 4ZOLB 5BORA 4LRQA 5ENVA 421PA 3RJMA 3U7GA 1OTXA 1Q0LA 2D2IA 2BCVA 3BEOA 1BE1A 4B5KA 5G0WA 3QSYA 2J33A 2C1ZA 5EKSA 1MB2A 3D8NA 5D00A 3AOEA 1Q83A 3QYFA 8ICAA 2IYSA 3SCZA 4BVJA 2EJUA 1C4WA 1NVDA 2O20A 4BO4A 2Z6VA 3HBLA 4IVQA 3V1YA 4I14A 1P4JA 2MDTA 3IDOA 3FW1A 4DNQA 4OHCA 3G7SA 1E32A 2AIRA 5A3SA 5KMGB 4B3GA 3C8DA 2R8IA 4CMIB 3OOYA 4CKBB 1AD2A 1N9ZA 2PFGA 1E1KA 3GG9A 1KVTA 1Z2EA 1ZIOA 2OC4A 4G0NA 3WA6A 1A9TA 3X43A 4BP9A 5K6TA 4AY3A 9ICHA 2X8JA 1EVYA 1YC2A 3PQ2A 4KIUA 3M49A 1A9YA 3HN7A 4AKEA 2YB4A 1XMVA 4GYJA 3C87A 3DFKA 3IBFA 3JQFA 4BNHA 4O5EA 1MTOA 3RRHA 5HBRA 3I0NA 4U7JA 4BMVA 1ZGAA 3EGOA 4U9IS 3DT8A 2ATVA 4D0NA 6REQA 4RMJA 1ZVJA 4JUCA 3SJBA 2P75A 1ORDA 3B1WA 2V55B 4JQYA 1KQPA 3LVQE 1QK5A 3DAHA 5DHPA 3JQAA 5L1JA 4HAOA 4O3SA 4OU4A 5KYKA 5BPCA 4G4SP 1RJEA 4ZALA 5L4SA 3C6QA 4RU9A 2IHKA 2ZRBA 2I1QA 1AN9A 3DMNA 1ISMA 1QNFA 3PFBA 3W9SA 3WWDA 9ICOA 4J9OA 2BDUA 3ILXA 4OB8A 2V7XA 3TRJA 1QIKA 2PMEA 2XCLA 1Q3HA 3ETHA 1A72A 1RLUA 3NHRA 1NXWA 1ZOOA 5KFWA 4NHOA 1A0OA 1ST3A 4NCJA 2AL7A 4EMTA 1LBEA 3CRZA 4AL4A 1CZUA 1R0CA 1YAHA 5HIKA 2DBYA 4MV1A 4YN3A 1IWOA 1O97C 2O6LA 2QZPA 5AVJA 3UJDA 4YAKA 2CYBA 3ER9A 3THYA 3VC3A 1SL1A 3C2LA 1GPAA 1UA0A 5BR8B 4IW3B 3IEUA 1ADBA 2WIJA 4O33A 3FHOA 3AHCA 4YLEA 4HRVA 4E12A 5AK0A 4FIZA 1WU8A 2PH5A 3WGQA 2CCJA 3OKCA 4UREA 1ZA2A 2GX6A 1Q0HA 3LYSA 2EL9A 4BVHA 1SA0A 3AINA 3LC1O 5CA0B 3E3MA 2P91A 4BECA 1ABBA 1L5RA 3EA0A 2AQ4A 2ZR8A 3K9NA 2YY6A 5DNAA 2FN8A 2V45A 1OZ0A 1RKQA 4JP1A 3C7CB 5DLQC 3WMGA 3AVTA 4QJ3A 2H5IA 3BHIA 3PB3A 2JFPA 3KEQA 5JUMA 3H7AA 3IQXA 2AT1A 2G9NA 1U0BB 5LLSA 3T1HB 3C2KA 4LVCA 2HVHA 2J3DA 4QPDA 1RJ9A 7ABPA 1XN4A 1UDBA 3FNRA 4FCWA 1BPEA 4KR2A 4EW6A 2OECA 4YDHB 5A2GA 5HOEA 2IC5A 1IQPA 1V11B 3GZNA 3PK0A 3LIIA 1MX1A 1D1QA 4DWVA 3H4IA 4EL0A 3QA3E 1YXMA 2FRDA 3EQZA 3MM4A 2Q5HA 3JASB 4B2YA 1LBQA 3DUWA 4IFTA 1DKUA 5KDDA 3NTQA 2EP8A 4JWNA 1NJWA 3BH7A 2QXTA 1L6NA 4PY2A 2YRFA 3B82A 4L8LA 3NRJA 221PA 4RKQA 4F2WA 2WMNB 4G9BA 2JCSA 1MQ3A 4N5LA 3ROQA 4BEWA 5KFTA 3S7ZA 3GIDA 1ZQXA 1QSLA 2QPTA 2WM9B 3NPAA 1Z6ZA 4W5QA 1U1DA 1ZGJA 3QKSB 4LMAA 4KSCA 3PD7A 1U8FO 4TMZA 3LTEA 3AQEA 2JAWA 3SQDA 1EFRD 4X1IA 5ITSA 1JYEA 2HLDA 4F06A 4DB2A 5EYPB 1CS4C 1EE2A 3N0TA 2GM3A 1HE2A 1D9ZA 4J0EA 4YAIA 5LQRA 1IOLA 4CN9A 4TTIA 2QL5A 2NYUA 3X1XA 3ZK9A 1F2DA 1HI9A 4AJ1A 1E3WA 5K0FA 2HBYA 1SKQA 3DEKA 1I7PA 3EXHB 1T1JA 4FONA 1DZIA 3DONA 1VGQA 3GFOA 3ISJA 2ZE8A 4KQ6A 4KODA 3DEEA 4W99A 3RUEA 2PRYA 1QRSA 2MRLA 5HUHA 2EFGA 4UB6U 3N70A 4JBYA 1WYGA 4AROA 3AF0A 1REQA 2OB2A 4A8JB 3EA4A 3QP9A 1LQUA 3ZIUA 2O57A 1ORRA 4MQMA 3WZMA 3G9ZA 3C16C 2YFQA 2F2AB 1L3IA 3PVCA 3Q7RA 4GGPA 4A8JA 1L4GA 2FJUA 1R88A 4I55A 1N3YA 3GBSA 1IB0A 3GFKB 2DWUA 2VJMA 4LQCA 3KUDA 7ICRA 4XTRA 4OSPA 3WLRA 2PX4A 3O31A 5AESA 1OH5A 5F2EA 2LW7A 5T4EA 4UVIA 4ZZ1A 2IMWP 3TZCA 4OFBA 2IOFA 1XEWX 2CL6X 5G3YA 1QAOA 2Y71A 3W5DA 2GKGA 2PLNA 4FMPA 4QOHA 3RSSA 5DMHA 3VHQA 3ETDA 5E4YA 2B5OA 2VP5A 1FLNA 5A3JA 1AXRA 1XFDA 4HUJA 4JKIA 2AMJA 1N3IA 2EJTA 1IMJA 4HSEA 4B09A 2ZVPX 3MFIA 2ATXA 1TZCA 2I2BA 4MI1A 2HADA 1LDMA 1YBVA 2JEIA 3PNSA 2PR2A 2EEZA 2FFRA 4PCLA 4YTEA 4YQWA 2B83A 2JK0A 3W7AA 4LZDA 2ISPA 1MTZA 1CUKA 1N2XA 1RHRA 2HMTA 2IYEA 1VG9B 3FVQA 4Y2PA 4PRKA 2B36A 4RAQA 2J9GA 4R8LA 2XIDA 1EFPB 3B6ZA 2KV2A 5AMXA 2DU8A 5K3OA 4X62B 1LD3A 2PGOA 1QF9A 4BZZA 2OHOA 5DNCA 3HCFA 1Z38A 3NX4A 2R4QA 2FNAA 3I9V6 2KI5A 1YR7A 2JIDA 4Z4EA 4LRYA 3H4DA 2J0UB 1DZ3A 1R74A 1OFUX 4MUXA 4Q8FA 4NV3A 1IK4A 3NDBB 5KFVA 1JHDA 1U3FA 1EP2B 3TTSA 1TB4A 5BV8A 1N2GA 2UXDB 1ULHA 2NTEA 4PAQA 4CT5A 1SCJA 2I80A 4KN6A 4FOOA 1NXTA 3V4OA 4BIIA 1BU8A 3OPYA 1K8QA 3ZHRA 5I9LA 1JMKC 4QZVA 2JFQA 2V4UA 1IHPA 1JDTA 2P3QA 5EHQA 4EBFA 3GW8A 1K06A 2CBGA 2AX3A 4K4HA 2NTJA 3BCHA 4FQ8A 5AVSA 5K7SA 1A04A 4IYRA 3NASA 1FVFA 3NHWA 2EFDB 5ELMA 4EPRA 4B3RB 2Y2UA 1KW4A 2FHSA 4KIWA 4ZOHC 1U4SA 3VAYA 4TURA 821PA 4Q7JB 2Q5QA 3KYIB 1W9MA 5H02A 4LGMA 3Q7QA 3VSAA 5EJEA 2YFKA 2DPMA 3LCUA 4HDKB 3A9UA 1U3DA 2FKNA 4PINA 5I7SA 1E3TA 2ZAYA 4R98A 3H99A 4KQKA 2PLRA 4RD2A 4UHBA 1WHSA 4M6WA 4D3FA 4PNEA 1YZLA 3O0FA 5H4GA 2QI9C 3DL7A 5T3UA 1ED1A 1ZMBA 2OCYC 2XCUA 5AW5A 1UM9B 5CYGA 2O1SA 2BGUA 2FMIA 1Z16A 3REFA 5HTOA 1I6MA 1KP3A 1JEJA 3WL6A 2NU8B 1JZTA 4WLOA 2NZJA 2IIBA 3TMAA 2B61A 3B6MA 3FZYA 1TUGA 4H18A 4R2JA 1E6WA 2SECE 1MNAA 2GB4A 2KE7A 5DN6A 4IIFA 2AOTA 1EFUA 4EABA 2P6OA 4KB5A 3JVUA 4M0UA 4PC3A 5KFIA 2XKJE 5T8KA 5TQVA 4ZV7A 2YJGA 1FYDA 1P4AA 4Z8XA 5A7HA 1AHHA 4QOEA 2L17A 4DM7A 4DREA 1K6IA 2EKLA 3OZSA 1J2TA 4JR1A 1SMKA 3MT9A 1UDXA 5ERYA 3R74A 5ICEA 1U47A 3GG2A 2RGXA 1PJ8A 3RS9A 1M0SA 3RTVA 3EMVA 3C2QA 2OMEA 2OVFA 1ZZEA 1ABFA 2AJTA 2Z43A 4ZA2A 3MGVA 2FAXA 5J2GA 5CYFA 1Y9JA 5JROA 3GLGB 4H1TA 3OQNA 4PG5A 1G38A 3AUAA 4FZNA 1Z36A 1FY2A 1YZQA 2WKPA 4E94A 3NTLA 3RJJA 1FVXA 2JZCA 2ES6A 3I5YA 4DSKA 2HV9A 5CX4A 3WRXC 3MS2A 3ANNA 5LDGA 3W4IA 4CEJA 5ICCA 4NOMA 2TSYB 1VL8A 2ECPA 4ECXA 3L4BC 3OX2A 4MVYA 5C3UA 3RC2A 2B7CA 3WK5A 4BNYA 2JHDA 3KB8A 2WTXA 3T9EA 4ARAA 5FI3A 4PYQA 1UQRA 1FDTA 2PV7A 2QUZA 2CY0A 2NUTA 4QDJA 3TF5A 4U2CA 4HDMA 1PSWA 4MUBA 5CHEA 3ESZA 2J5XA 2YJZA 3DKRA 3MWFA 4ZCRA 2IH2A 4JX9A 2ST1A 4UCFA 1VCOA 3IIIA 3Q2IA 4O9MA 1KZ1A 4QYMA 5LQNA 3ZHZA 1IRXA 3QJGA 1C9DB 1DBPA 3C70A 4X1OA 1TYDE 2IHBA 3H1GA 1MSWD 2K2WA 2R84A 4JV0A 3DG9A 4BQFA 4YRSA 4MQFA 4TYPA 4MI6A 4NYIR 1YDWA 4B8ZA 2JJYA 3E9EA 1VZ2A 2WAYA 4X61A 3BFPA 3IO3A 3NWPA 4FDTA 4CM9A 3TLMA 1FFXB 1UZUA 4Z0TA 5K0TA 2P9QA 3DOFA 1KQGA 2NRWA 1KQQA 2X86A 3HVHA 1BXKA 3O94A 1JPVA 2HUPA 4M8SA 3CEAA 3IV9A 3FWHA 4H31A 1WCIA 1U8AA 3PLRA 4M0MA 5JS1A 4ECEA 3L8GA 3CS3A 3OZBA 3PNPA 4EA7A 2W3RA 2AE2A 2PXXA 1JR2A 1LV8A 1FFEA 2YMLA 3FGZA 2QD2A 5CX1A 3WIUA 1R00A 1NLMA 3Q8SB 2R00A 3RBAA 4GLLA 2D13A 3N74A 2XMPA 4ZVRA 4QWCA 1SXJE 1Z82A 1S0VA 2FSHA 1YCDA 2VYCA 3FA2A 4R2WA 5EUQB 2NUAA 4ZT6A 3T35A 1OFGA 1PHPA 2VWPA 5K3AA 3WSVA 5AI9A 3F2IA 4TVBA 5EWJB 2QJWA 2N42A 1TEHA 4Q8EA 2H9YA 5DLYA 5DSTA 5JT1A 2GYVA 3C97A 3O8NA 1IN8A 4YUWA 3HV2A 1LKYA 1NXOA 16PKA 1YD7A 5COBA 3U61B 3LDHA 5A7GA 2I6UA 4JOCA 4P33A 4JJEA 5FF9A 4DJ5X 1MB3A 2Q0QA 1W29A 2B8EA 1X7ZA 3FIJA 1YRQA 3SDZA 1KC1A 1ELOA 1NTRA 2R97A 2HLDD 3B9QA 3NHAA 4DA7A 3PX3A 4MR9A 3KWJA 4KX5A 5EIHA 3QX3A 1D7OA 4MB2A 3DVAB 3BMOB 3VU8A 3KELA 6LDHA 1WL8A 2WG1A 4D80A 1KMMA 1K7EB 1V26A 4BTLA 2HA7A 4II2A 2PS9A 1VJDA 2ZTLA 3FRHA 4OUKX 5F2NA 3L0ZA 5CCBA 3R7WA 1VLMA 2NUPA 3UC5A 4BATA 2NZ2A 2E4YA 2L5YA 1HUZA 1N5DA 2OHVA 2V6IA 4ETIA 2VHXA 2HW8A 1Y6JA 2VAXA 3DLTA 1K66A 3R2JA 4TXJA 3TLXA 3M8KA 3NTUA 3J7AC 1YR9A 3FZNA 1TMYA 1SJ9A 1T3GA 4LF7B 3IR7A 4U1RA 3UJ7A 3NW9A 5MHTA 1LSUA 2WC1A 4YJFB 4AYTA 3R3YA 4CFZA 4HDRA 2C07A 1DJQA 4R54A 3K9WA 5KTOA 3O3NB 3B12A 4LZZA 3F4BA 5THKA 3OETA 2V1XA 2Q3FA 4F6RA 1VYVA 3RUCA 1ESMA 2BMFA 2KBFA 1Q21A 2PX0A 1WETA 5KTYA 1I9GA 4ZCSA 1CUBA 5AVVA 1DG1G 3O8OB 1H93A 3A27A 5PGMA 3PMNA 1JILA 2Y99A 3P2OA 4KGXA 1G291 2X6TA 4FDVA 3V6LA 2GSWA 5KNBH 1C1HA 4CEIB 1MNQA 3L8FA 4EF5A 1S3FA 1KRPA 4YPVA 1M5RA 4RQ5A 3W1VA 1XU7A 3BMXA 5L95A 1FLAA 3RFFA 1XCBA 1S10A 3ICPA 4IR9A 3H1BA 5D1HA 1U0LA 3QBDA 2C7PA 4J7UA 4B3BA 4NXZA 1B76A 3PEEA 2FW1A 3TSOA 3UGJA 4GI7A 3FUXA 4X3CA 1O95C 2KHQA 2BGTA 4MUYA 2FQXA 2B4RO 4RDHA 1GCIA 5K6RA 4B7CA 3RRGA 4GICA 3KZOA 4LJYA 2HHUA 2BPGA 5DWQA 5I8WA 1N57A 3CLSC 1JHOA 2ONJA 4N0QA 1F48A 1W4CA 3A04A 4IJ6A 4M0CA 1LDEA 1HFWA 5EN4A 5FR2A 3SIWA 3WYBA 1ZR4A 2WUWE 4JC8A 1P5ZB 1RU3A 2HU8A 2XB9A 1XTSA 4ODIA 5JDCA 3EPHA 4JJFA 2ZJ7A 1O96B 4S1TA 4NK5A 4KYUA 9ICIA 2EKBA 1UAYA 1TXGA 2Y1OA 5ESXA 4BX9C 4RMHA 5DWDA 3B8HA 3PDUA 3PUXA 1L5VA 2PZMA 2O52A 2NLOA 3A26A 5DSZA 4JJ4A 1R50A 2Q3LA 4NLCA 2WB4A 4H4EA 4CR8A 4QJFB 4IH9A 4PLPA 3I01M 2VPIA 3SZLA 1E3QA 1IVNA 1GQYA 4DM4A 2OV1A 2JH7A 3ZWXA 3LHKA 1DTEA 2MU1A 4U5XA 5FV7A 1VKNA 3BXGA 5EQJB 5EIEA 2BTOA 2MJLA 4Q93A 4QHTA 3TG8A 3IAM6 1OBHA 4L4XA 1ZDMA 4ROTA 1OLXB 2B82A 3VC2A 2OZLB 2WPNA 3NHYA 1MJHA 3GAFA 4RE5A 4V24A 2E55A 1ZUWA 3H65A 3BXHA 1N2OA 4MYDA 5LZ2A 3D5EA 4G5RA 1KK0A 4IZIA 5ICSA 5F9HA 2JI8A 5ITZB 2EX1A 4BQOA 4UHDA 3EMDA 1KS9A 3H1TA 5B1SA 1QFZA 2BHLA 3IXMA 4KFUA 4Q19A 5DBEX 2I29A 4WOPA 3WY9A 3AR4A 3G82C 2UUAB 4KMOB 4EEYA 2GM9A 4Z8YA 4GVXA 3S0JA 4NTZA 4AP9A 1Z3EB 2VIXA 2MSEB 4QTZA 2HK9A 1X39A 3Q7EA 3ZHXA 4C7OA 1Z3IX 2FRVA 3OAAD 3BE6A 1KH2A 3MCTA 2EF0A 1R0SA 4MPTA 2NPFA 5CFZA 5AKJA 3UAVA 3EZXA 1WB4A 3CZ5A 2YOHA 5AW3A 3K96A 1K0UA 2IIVA 2WJWA 4U9UA 3UWOA 2O7QA 5IT4A 4X92A 4EP1A 1EK1A 2I67A 4AF8A 2BGKA 2HF8A 2C04A 4EY8A 2O2EA 1T3ZA 1LCIA 1LLCA 5IBQA 3DDSA 3ZTTA 3TEMA 9ICXA 4FHDA 1I94B 2JCVA 1GL9B 1D8BA 4TLDA 2QQ0A 3FBWA 3JYOA 4MLZA 2JEZA 1Q0UA 5C8ZA 3FWPA 2Q3DA 2ZB8A 3H5WA 1AMNA 5KFGA 4PPXA 4NWIA 1SBIA 1SXGA 2ONZA 3AL2A 3IAXA 1XZCA 4DPKA 2UVUA 1L4BA 4WESB 3TQOA 2CFSA 2ZYSA 1W93A 2XZOA 2ZJBA 1XCLA 2FK8A 2ZBUA 3CQ9A 2J5BA 5L3SA 2C5LA 3Q7SA 3ZZMA 2C9DA 2D5CA 3B9BA 1JXEA 2OL4A 2PVPA 3T0IA 4EO9A 1Y7LA 2CV2A 1R4AA 3WLEA 2PMCA 5LL6P 3VDMA 4BGEA 2A0YA 1QLNA 1A77A 4UAZA 3QUBA 5KWJA 3H13A 4E14A 4KMSA 4RZXA 2VKTA 5IXJA 1IZYA 1U8ZA 3G9TA 4OBWA 2E5LB 4PSCA 1T5DX 4MWGA 3SSNA 3IR5A 1DL5A 4FNMA 4L57A 4TMFA 2ZRAA 3EGXB 3W7BA 2YV2A 3T7KA 1PWXA 2ODPA 3LW7A 5E9WA 4EKEA 1E2DA 4YP0A 5J40A 3ZD7A 3TMYA 1Z4JA 1T25A 2C3UA 3HACA 1NQVA 1E2KA 1W76A 3O73A 3TL2A 3KG2A 6ADHA 2YJTD 1GTG1 1N92A 2YH2A 3K1ZA 5A6SA 2W2KA 1QG0A 4P3YA 3ZY5A 4NBWA 4US0R 3DBIA 3NAZA 1Z8FA 2XY6A 4LWZA 3KZNA 2I2DA 4KOEC 3MMSA 5TVGA 2FXVA 1W59A 4IR7A 2VQDA 1G8PA 3U5TA 2KFNA 4QPJC 3ICEA 5DQHA 1NHWA 1XFAA 3TH5A 3SM3A 5B36A 1UH5A 4UNIA 5IK2D 1XKTA 2WWWA 3MD9A 3CB2A 3CX3A 3FCXA 4TOIA 2PGLA 5HR7A 7MHTA 1UA1A 1RKVA 1CFJA 1HE8B 1TA0A 2FN3A 2ZJ2A 1OXVA 2JEOA 4E3WA 2R1TB 3EEBA 3H2GA 1IE3A 3C3DA 2BI8A 3I83A 4IIXA 2GEJA 3GZ4A 3TI0A 1H8HD 1C2TA 2DKFA 3EVBA 3WGLA 4AUNA 4IVRA 1G20A 4MYSA 3AZQA 4QYXA 5IVIA 1MA0A 4RQTA 3ZHQA 4F6RB 5TISU 2I1WA 4OU5A 4IJUA 1NU6A 4BCBA 1NI5A 1OZAA 3D64A 3CLHA 1ZZGA 3ODPA 2F55A 2OWDA 1XDGA 3DMTC 4QZFA 2H1RA 1KSJA 1S7CA 2YJ4A 3GIIA 2IPMA 4TV8F 2C9ZA 3GUYA 4Z0HO 3R0IA 3B6EA 4YRJA 1AKYA 1KKMA 2AJLI 2V7QA 1SKAA 3NGLA 4WDRA 4NLGA 1ZH6A 3KTOA 4OLAA 2XUFA 4B7XA 4LFBB 2VHYA 2VJNA 3ITEA 2OUKA 3LM8A 4L6IA 4HXEB 3HE3A 1GG5A 3MTDA 3EULA 4XX0A 5D3MA 1RRGA 2DTDA 2C5EA 1XO1A 1EUDA 1QTNA 1NRWA 2C4NA 5SYAA 3EWNA 2GYWA 1X14A 3SEFA 2VRNA 2F9LA 2ORWA 1R5JA 4FX5A 4L4SA 3VKHA 5CDUA 1XXHA 4B3MB 1JIHA 3LDAA 2JJ1A 3DVAA 4QZCA 3NNDA 3IVGA 2IFTA 1PJLA 4IDHA 4JJ8A 2QB5A 3ZGXA 3ZCVA 4QRDA 4FWTA 1OYOA 3ABIA 3RH4A 3OH8A 4UVHA 7ICFA 4A3SA 4A9AA 3F5FA 5EC8A 3AVXA 4IJWA 4PGQA 3GJZA 1J23A 1YRWA 1PUZA 2QMOA 2VQ3A 5EIWA 4PX5A 2PVCA 5KAPA 4WY8A 4LRWA 3WYAA 1RBMA 1NIPA 4N12A 3JU3A 4NXNB 1XVIA 2Y0PA 3NOQA 5LWQA 3OOEA 3RAXA 9ICQA 3F4LA 2P9ZA 4EG1A 1A8PA 4HLQB 5HM6A 3V97A 3KZXA 1FU7A 2JDIA 3JYHA 1SZCA 4Q4HB 3LUJA 3DV0A 4NG5A 2DRIA 1T9CA 4BFLA 4QBGB 2DYKA 4MA4A 1KMQA 3ZGVA 3IMKA 3MLEA 5D2CA 1GZVA 3CUSA 1D6SA 1JE1A 1YDHA 3Q3GE 3LOUA 1BPDA 4CLDA 5KNCH 3BIWA 2EW8A 4RE6A 1WO8A 1K68A 1JL3A 2Q99A 3D3NA 1T2DA 3QKRB 2G9UA 3I0ZA 4G0ZA 1BD4A 2YC4C 3P9ZA 3JQ8A 2FRDC 4K26A 4RPGA 4ZI5A 1K4MA 2R8EA 2FUEA 3WKDA 2WSSA 3BXEA 3F8TA 3T0GA 3PTAA 3Q8LA 1YB4A 1GAQA 2ODAA 3K1YA 4FZJA 5FNVB 1F06A 1K8XB 3DXXA 3BKWA 3LPCA 4MV4A 1AXEA 5JQGA 1O9GA 1U6KA 2MYNA 4ZHQF 1U1CA 3RK4A 2BZGA 3FN4A 3S2GA 2HC9A 5AM3A 5KFHA 1QQ7A 4V03A 1NFQA 1O2DA 3L7JA 3QVKA 5BQOA 2ZAGA 8ICIA 1PR4A 2GAIA 1B6GA 2EXXA 2X2OA 3O3OB 3ORSA 4FFPA 4XDGA 3E05A 3TD2A 4ZV4A 2HLPA 5TPZD 4HPWA 4XGNA 5DRTA 2XAAA 3HCDA 3LP8A 3PTZA 3TLCA 5DYYA 3UT0A 1D2CA 5DNDA 4KN8A 1ZINA 4S1WA 4RBNA 3C4QA 4EY7A 1QU3A 2IA5A 3I3SR 4LZAA 1V9SA 4YBRA 1VBFA 3W9YA 2I1VB 1G5RA 3E2PA 5AH0A 2DXIA 3RS4A 3E35A 1IDN1 3JQPA 3M4JA 3NTXA 4RF3A 1MHPA 2F3TA 2OORC 1DRWA 2OMKA 4LJRA 3KJXA 3ECSA 3AFOA 2LIVA 1F9EA 1KAMA 4M9LA 1C2YA 3TSAA 4MH0R 3WHPA 3FHLA 3CPSA 6GPBA 2Y9UA 5C9ZA 1RKBA 4HZGA 1PJQA 3QIVA 2XGQA 2XHEA 1Q1ZA 5AM4A 2W4IA 2LTAA 2B7LA 3GJSA 1DIAA 1I3NA 2QUHA 4KRXA 3UBMA 4PIVA 1HO3A 4BPBA 3GLFE 1JWBB 1JSXA 3GRKA 2FHPA 2DQKA 3RUIA 3AC0A 5EVCA 4G86A 5IHXA 2PLFA 3SEAA 1ILWA 2Q3CA 4PFKA 1H9BA 4ZICA 5FUQA 5MF6A 4TKLA 2GOYA 2OHXA 1F4VA 3IEXA 2CF6A 1G6OA 1UWVA 1Q0TA 1YHZA 4MS1A 4E30A 3CLUC 4MS3B 5T8KC 2C58A 3MJRA 4MS1B 4KYVA 1SUCA 4MO9A 4P4LA 5BP7A 1E2FA 4MP3A 4R9RA 3PCRB 2A67A 4ZT3A 3ZNQA 2YHAA 4MWBA 3BTVA 3K1JA 4F8EA 4XVUA 2G6BA 5EZYF 3WTBA 4WDQA 1SAYA 2GBIA 2QKQA 1ANKA 1XZHA 2WHYA 2R7NA 3HVKA 3LW8A 4FR0A 2BFBA 1RYYA 3BJEA 3NJ8A 4YJ3B 1P6QA 2FWJA 2C2RA 5AVOA 2DM6A 3R23A 2VA3A 3MSXA 4MR7B 4ZODA 3S81A 1I4OA 1JPNA 2WOJA 2PT5A 3OIUA 1IY1A 4Q12A 1VIMA 1G9TA 3B0XA 4R8RA 1MABA 4K9PA 3AM9A 1R6UA 1USKA 4N1AA 1HQDA 1E3EA 1PO7A 1PZXA 5DI3A 3WL7A 4PVDA 2IXAA 5IZCA 3SNKA 1HNWB 3KX2A 4RPJA 5HFAA 1NJ5A 4BNVA 3GLIE 4DOMA 3PITA 3Q7TA 4PC1A 1CUZA 1CUUA 3HYCA 4P3OA 1ZQAA 3OJWA 1AF7A 4O4HA 3GLHE 4CFSA 1WDMA 2GBPA 2O8FA 5EE9A 3LOPA 4WOJA 3AKYA 2B1GA 4HQOA 3WXMA 3UXPA 2BKAA 8ICHA 2J6CA 2WHPA 2XZDA 3PHJA 5B1DA 4EGAA 5FLKA 2QDKA 2AXNA 3MINA 3TZEA 3D0QA 1IM2A 1AGNA 3CJQA 4DXAA 3SKYA 2OV2A 4OD0A 1OZFA 2GXSA 4AJ4A 2XH8A 4A73A 3NR2A 1NVBA 3OMXA 4GLXA 3D6AA 3PDHA 1PVQA 2FLPA 5DCYA 7ICJA 1VBNA 2JARA 3ID6C 2BVNA 2IBKA 4QREA 5ALZA 4IH4A 9ICTA 1H5NA 1AH2A 1EQUA 4TKVA 4BNDB 5BNZA 1LBHA 4BRWA 1KAGA 1U80A 3A4YA 2WFZA 1YKGA 4GC9A 4K6KA 1JV2B 4JCOA 3R7BA 4QU8A 2ZE6A 4JXKA 4WFKA 3A11A 4DLWA 3IP5A 3CWCA 4DUYB 3U56A 4U9HS 4BJ6A 1N78A 2TMYA 3GT0A 3PPXA 3IQZA 2C9CA 2QU7A 3FGPA 3QX8A 3O8LA 4A2WA 1VJRA 3I30X 1UADA 4KUEA 1GL7A 4NNPA 5EPOA 4RPYA 3KJHA 3STVA 3GV8B 1OXMA 5E95A 5GP1A 4JI2B 2YYSA 3F1LA 1BH2A 5K8IA 2CJPA 2K89A 1QRRA 3HYNA 4DRXB 1SC3A 2RI0A 4UOZA 1IUOA 1SOMA 4MPPA 4D02A 4BKRA 4QAJA 5ADVA 2XTMA 1AKMA 3AR3A 3ZY6A 1A82A 4M22A 1F4PA 3RS0A 1R0YA 3HJHA 3H9EO 2R4UA 1ZPDA 2YTZA 5AOAA 1RXSA 3KQSA 4LNUB 5C8YB 4HGPA 4Z54A 1SVOA 5EFOA 5J2UA 3U4QB 1KOFA 5BPFA 2DERA 2D0PB 4G25A 4M87A 4WKBA 4IP0A 2FMSA 1G20B 1LPNA 1JVBA 4P8RA 2EBHX 4QUAA 2JJMA 2OK8A 4JSRA 4MULA 1CUXA 4G9EA 1HR0B 4PYOA 4V1CA 1Q20A 2R1TA 1GPWB 1WP9A 2D5IA 2RHOA 5L3SB 3HJNA 2UXCB 5ADWA 4BWMA 1KDHA 2R0QC 2ODGA 1UMBA 2OEPA 2PMZC 3WK4A 5CT9A 3O1HB 1NATA 4XPIA 3EH1A 4DIFA 4GD3Q 2B4YA 4K86A 2HHWA 1JB1A 1NJGA 2CDNA 2ZP1A 1Q8KA 4RYLA 4IS2A 1YQ9A 1O6BA 1YE5A 2MSCB 3EZ5A 2ZUCA 3PUKA 4HQ6A 3TPZA 1QQ6A 5CBPA 4IXDA 5AUPB 4DSLA 1D6NA 2G6TA 4KXWA 3GK3A 3H3JA 3LKBA 3OIGA 4BZQA 1Q1BA 1HURA 4LY0A 3HCWA 4PTYA 4BO3A 4HH4A 4K9KA 4KE6A 4O5CA 5DU2A 5CBPB 3IEIA 3USES 2A8YA 1MD9A 3I28A 3IUJA 4IO1A 1ZUNB 4FJ2A 9ICUA 5CJJA 4DABA 4G8JA 1RPJA 3FJOA 3L1VA 3SAJA 5AO9A 4JI8B 5DX8A 3IAFA 1MDBA 3QWBA 2HHAA 2Q2QA 2IS1A 3Q9LA 2CD9A 1JFRA 1FCJA 3CV3A 4HZIA 4JI1B 2HA3A 3K4HA 5LVAA 3A1CA 1Z00A 5ALSA 3DQQA 4ENSA 1Z15A 4JWKA 5DW0A 2B0JA 3ORHA 4BFYA 3AY7A 2BMAA 1AQJA 1QH8B 1RHKA 2GRUA 2ZYTX 3D59A 4RPLA 4ZREA 3ZGLA 3CKLA 5J43A 2AUMA 4AZ0B 4EF6A 1PL0A 2GCGA 1N9GB 1NNSA 2YY5A 1K6JA 3GNQA 5J2TF 4DADA 1FIUA 1M1YA 2SICE 2OKGA 4D8WA 1Y5IA 3DCYA 1DCFA 3OHBA 3FNEA 1A95A 1X1DA 1ZQSA 4H59A 4WOBA 1SU7A 4O5OA 3EVGA 3HJCA 3PIIA 4ECAA 2GBLC 4BV2A 1W2WB 1ZQGA 2PUJA 4O3OA 4TXLA 3F5SA 2ZJ0A 4E5UA 3RYFA 2XCAA 2VJOA 4KYTA 3O2QB 3VR4H 2BCSA 2V0NA 2W8ZA 3B7PA 2VATA 4FBLA 4NS1A 3VHRA 4B3FX 1U8XX 3LXRA 5DIFA 3H8VA 2X3YA 3FLMA 1UODA 4LWOA 4MP6A 1Y6GA 3LKVA 2E7ZA 1JG4A 2XQIA 3KB2A 3CF0A 4LN1A 4EJ2A 1VLQA 3L84A 5A3RA 5JH7F 1PUXA 1FL9A 1N6LA 1Y6FA 3B1JA 1N62A 3RGWS 1GA6A 5ISMA 3EJ6A 3V48A 2BHTA 2ZSIA 3M3HA 4ZU3A 1ZN9A 4L0CA 4O1HA 4ZVSA 4RTNA 2F90A 1MX5A 4YMTA 1ZA1A 1AHIA 1NKSA 3H3XA 3BS7A 2GN0A 4BYMA 5AKGA 3F6SA 4LDNA 3LIPA 4P4GA 3VZRA 2R86A 4MVXA 3WOVA 4UAYA 1JLSA 5ALTA 4EMBA 1QG6A 1XWIA 1RZRA 3UV3A 4V3CA 3U62A 3VYUB 3NP9A 2D2EA 2QYHA 2X9VA 4OG2A 2FE1A 1JA9A 5D87A 3SZUA 3TI7A 3K53A 2ZQYA 5HMMA 3N1UA 5D01A 3RJZA 1BW9A 4OJ6A 4V0QA 3M6FA 4ZU1X 3UW3A 2Y05A 1YONA 1W4ZA 3HC7A 2DX7A 3HCPA 2YHIA 3QF4A 5A05A 3ZTYA 1PFQA 4CBVA 3EUEA 2PUEA 4JUZA 1B8PA 5AK4A 1HEKA 2ZWIA 1W2HA 3EXFB 1PNRA 4KFCA 5KQRA 2C00A 3AWDA 2WTNA 2Y0CA 3GHHA 4QGAA 3QEOA 4F2GA 1A5BB 4M1MA 3ZHVA 5TF0A 5J2UF 2XUHA 5DB6A 2FN4A 4NQRA 4NLBA 4KFRA 1N4AA 4XYEA 4WA7A 4PYRA 3L18A 1E3WB 1PIWA 1RPNA 2DP4E 1JXQA 2SCUB 1M34E 2XE6A 5FI0B 3QU7A 1U1EA 1XCPA 3H5OA 3ZG6A 2W9CA 3AZOA 2M6LA 2ZGVA 3UHAA 2B69A 2EBFX 3BMCB 1SUAA 1ZVKA 3FFXA 4DDWA 2QRKA 3OEHD 5AVWA 4ECSA 2I3ZA 2ZYIA 4R0NA 2PKYX 1D9DA 4C80A 1CJUC 3FRJA 3LUFA 1BX3A 1NW3A 1W87A 2NSDA 3BB3A 4EZ9A 3PG5A 3SF8B 4MWDA 4J7XA 3D8UA 4AY6A 1VKOA 4KL8S 4L9SA 2X58A 2YB1A 1D1PA 1M76A 3RFCA 3QFHA 2JAXA 2D0IA 2AC2A 3WGNA 4HFRA 1H2ZA 3RKSA 5M2QA 2II6A 8ICYA 3S2EA 2A3NA 4DIEA 4DT1B 5IMSA 3EWSA 1P4SA 3RJKA 3NI2A 1PQ4A 2XYPA 4F5OA 1V7CA 4EY4A 4HL6A 5K9ZA 1QO0D 4LXHA 2JFBA 1KY5A 1B0AA 1Z08A 2KMDA 2AFIE 2WJIA 4PGHA 1USGA 1E3DA 1U0EA 2HFJA 1ORWA 2B4KA 1NVXQ 1TMOA 1Z0SA 2H9AA 3HCCA 4ZXPA 3AW8A 3F3SA 2O5VA 3TBFA 2BKEA 1CIPA 3ZKAA 4J9KA 1EH5A 2IY7A 2OO5C 4P80A 5DF1A 3MJ4A 4INJA 4AZ0A 3SLRA 4RTJA 1CNEA 2ZITA 3F6BX 3RV3A 2JLYA 3KHGA 3O91A 1UC5B 1ZH2A 2DY1A 5SY9A 5KC9A 5E2AA 1P2SA 3N7PD 2VSYA 4P4NA 4M9HA 1LLFA 4PCAA 1GT6A 2V9PA 3UV6A 2ZIWA 1G2QA 2E49A 4QOJA 2O2ZA 4X1YA 1ZH0A 5TQ2B 3WB2A 3ADOA 4QUEA 1MEEA 2AEMA 1DKLA 5AIAA 3PL5A 3MWEA 1C3XA 1G21B 2DFNA 4GP9A 1SV0C 4PGMA 4RY0A 3VPHA 2WYVA 4LZLA 4CCWA 5GGYA 5ADUS 2GESA 5CX1B 4ACOA 1GSOA 4X66B 3KIPA 4G2NA 3GLGA 2CDRA 1KYZA 2W2MA 3PDIB 3R3HA 3T3PB 1H5QA 5H80A 2A3RA 3S8MA 3MABA 1U5BB 1HV8A 3LRXA 4AVYA 4LE1A 1MQAA 2QE7A 3KPWA 4NCXA 1TVKB 2J0VA 1EG2A 1ZQNA 1CUHA 5ICMA 3L40A 2O19A 5KFPA 3ICQB 2M0NA 1VMKA 4ALMA 3J81k 1HORA 3D6VA 3QU9A 1XU9A 3EIWA 5DM60 4C4AA 4Y2TA 1L5QA 5FTJA 4BFVA 2C2HA 1N5JA 2COKA 2PANA 2Y6UA 3BZUA 3LO8A 3FHJA 1ISJA 2QSZA 1KJIA 2IELA 2WV7A 3F46A 1YA8A 5IP5A 5F3WB 4ADSG 5KVCA 1XMPA 3RUAA 2CFIA 2HOIA 3LQKA 4DEYA 4QE3A 3GFPA 4PYKA 3WAKA 4BU0A 1PT6A 3B51X 3FPFA 1BPBA 4X97A 1KRXA 1XLUA 2VT3A 4FMDB 1Z5VA 1QGED 1ZITA 3O0DA 3V3TA 2VUHB 1WR8A 3HY3A 4NLNA 3L4SO 3CW9A 1WQ4A 3A4MA 3DVLA 3FYDA 1HDRA 3T34A 3TWOA 1QH1A 3SZ3A 4BE4A 4FYJA 1IUKA 3IODA 1HRKA 3LT0A 1IJKA 5HP4A 1OYVA 1UDAA 1UPAA 1XD9A 2EKDA 3AKDA 3PLNA 1LJ8A 2DFTA 5FOVA 1ZQ1C 3HCEA 4A5OA 1IG3A 1QS0A 3VX4A 3EPGA 2QMHA 1RLTA 4J1TC 3B7GA 1ZG3A 4JEMA 1Y8RB 2P9GA 2QW1A 2OM2A 4X94A 1P0MA 2HY7A 4X93A 3C3JA 5DK6A 2W7TA 5EPUA 3U7QA 4D3SA 3OPNA 5TJ9A 3BEDA 5A2QA 2J5QA 2O06A 4D8VA 1YIAA 4FSXA 1HOTA 1OZGA 3LLCA 5JCOC 2VF8A 1QB7A 4M36A 3UJAA 2G82A 1ISSA 3S3TA 4FBGA 1KVUA 1VSBA 4F2RA 2YIJA 4MEYA 1NF9A 4E07A 1RJWA 1RWQA 1Y3IA 1NBOA 4FMCF 1DEXA 1W34A 5CGZA 4DMKA 3CHYA 5H5JA 3LNTA 3M33A 4RQ2A 1CR4A 4BLSA 3R7LA 5KQGA 1FJXA 2RHRA 4QDTA 5F5XA 1BOOA 1S5LU 3M1IA 3T15A 2ZTVA 3L1KA 5LQSA 4MPJA 2ALZA 1IEXA 1Y4UA 2IYWA 4DUPA 4YMNA 2YQZA 2EAOA 2PXAA 1ZD5A 4KLRA 4C6TB 1S9DA 4Y6OA 2R6CA 1R9NA 4HRAA 5DXAA 4EQ6A 1IWBB 4A2PA 1ZBQA 2IYRA 2FPIA 2PWBA 4MMXB 4PPQA 4AMZA 2XW6A 3W4KA 3F7TA 1NRXA 2VG8A 1V8FA 5K20A 3F4KA 4JROA 1HTWA 3T5AA 4I4NA 2X8AA 3GXOA 2OC9A 3RR7A 1LTHR 4RV4A 1ZI6A 3FTPA 2AN1A 3LK7A 3LO5A 1IY9A 1EXDA 1ADYA 2NXWA 1II8B 3QBTA 4ZIRB 1E4VA 1Y6RA 1Q3UA 1V5WA 1D2EA 4EHBA 4XR9A 2H31A 5CA0A 1GITA 1WY5A 3Q3IA 1KJ8A 3MR6A 5JO9A 4EATA 4I8IA 3K73O 2K8AA 2Z5GA 5I7WA 3BSSA 3H2KA 2QTHA 2R6AA 4LJ6A 4LSZA 2ZJYA 3E9CA 5LMNB 4HQFA 1C30B 5KUTA 4F2DA 2EARA 5E8JA 5F1YA 1NVUQ 2Z98A 2UYQA 2OGWA 3UW1A 1MLDA 4X7BA 2MIIA 3MLBA 4DS5A 2AI2A 2P3OA 2VKQA 1M8JA 4W1SA 2PJDA 4A1FA 4A2CA 3H2IA 5IULC 4LXYA 3I1FA 5TDHA 3ZDQA 3OQ6A 3ZCRA 4NECA 4GPBA 5GJVC 4IRKA 3JWGA 1KY2A 1K92A 1VIYA 3O84A 1RXUA 4RMNA 3WE7A 2BUBA 5KT3A 1T26A 2WSYB 2ZI4A 5SV2A 4MKGA 4MYUA 3JWPA 4GBMA 4CG0A 3SX0A 2CNDA 3ETLA 1DX9A 4HUTA 5D7BA 5KOYA 2YJNA 1JMSA 3VZDA 3O4VA 1FUKA 2FJPA 4EFMA 3OSNA 1M6EX 1UKEA 4EX7A 2WAOA 3RSQA 3W3AD 3HSSA 4MKIA 4E5YA 5J4YA 1OR8A 3LBFA 4NXMB 1MB9A 1I7SB 1Z9BA 4B5LA 1VBMA 1CLEA 3DULA 2FK7A 2AUTA 2JJ8A 5B53A 4JYZA 5F9LA 2AD1A 2R47A 5CA1B 1DAFA 3V7YA 4ZC8A 4QJIA 4EPTA 2BIFA 2NG1A 4LHSA 2LUOA 1P0CA 3A6EA 3JZDA 4BCCA 1E20A 4GS5A 5JQWA 1NUTA 1GGMA 2W9XA 1WBDA 2YZNA 3U60B 2AC4A 4U6SA 4GH5A 3V00A 2QTGA 3X1ZA 4OXXA 1NX6A 3ASUA 2LD4A 4MRPA 2Q7OE 3GLKA 4AYXA 3QU4A 4F50A 3S1SA 2VO1A 3TVTA 4DILA 5HS6A 3DMRA 1NK8A 2OILA 2EJVA 1WXGA 4JUIA 1GARA 1U0NA 1RQ2A 1XVLA 2H1HA 2Q27A 4XAQA 4ARCA 2PSHA 3WLNA 7REQA 3GLVA 1G8FA 2JRCA 3OTGA 4KLHA 3UVEA 4GP6A 3T1QA 3ZWYA 3VH4A 2FPOA 2P9TA 3SR4A 1CK4A 1P1FA 4Q5IA 5E1DA 4QZDA 3QLEA 3A9VA 3DCIA 2G8NA 4LEIA 3WLQA 3EIFA 1W35A 2DQYA 2IDZA 5CM8B 1OC4A 4F6CA 3BDIA 1TKCA 4HG2A 2FMPA 1O5TA 2ENUA 2YCBA 3A2MA 1HH4A 4KFTA 4L2IA 4O2BB 3UPTA 2VTVA 2ZRQA 3MN1A 4XKJA 2BFAA 3VR6A 5JFTA 4QJ5A 4BKOA 2YWCA 2IUTA 3SE0A 4XQ9A 3BGVA 2R8OA 2XGOA 3HKDA 3GLGE 1YMUA 1QVWA 5E6SA 2LPEA 2PX5A 4G2TA 5LXTB 4UJ3A 3M6AA 1DFHA 5ALKA 2MWMA 1QTMA 3PJRA 4MO2A 1OBFO 4DCJA 1NN1A 2V54A 3VMMA 3PYLA 2OQ2A 3MIIA 2IU4A 4PX2A 3HU5A 5GOZA 1RXVA 1N2SA 3DAOA 1HBJA 4X9XA 3TOXA 3PJEA 1X9WA 3EZ7A 1TIPA 2RGEA 1TT5B 3OEEA 5BR1A 4ME6A 3THRA 5C1OA 2M6KA 1R8YA 1FS6A 1GV1A 3AESB 3W3AA 3T5MA 3L4KA 3PW0A 2EAMA 3I76A 2QT0A 4RIFA 4GQBA 3OKAA 1YO6A 1P39A 4CLOA 4HFMA 4JGIA 1OJ7A 1J90A 2QU8A 4XQ0A 1XIVA 4QIWC 1Z2NX 1KRHA 4LPSA 4FFRA 4FX2A 3NIFB 4NCBA 3KSUA 2X15A 3PFGA 4XGKA 2H1VA 2EG5A 2JFYA 2BW0A 3W2FA 4KQGA 3WG9A 3UWDA 1TTHA 2HNAA 1Z13A 2XXJA 3GQBA 3QXCA 2ACVA 3D4LA 4LY3A 3VPBA 2I7TA 2DHDA 3BHNA 1H1LA 4KQHA 2HVIA 3VTZA 1GEEA 3BD9A 4O0LA 2XVTA 3QM1A 2YS7A 3LL4A 5EYPA 2V96A 3OECA 3QEMB 1YJ8A 3U40A 5BV0A 5JXIA 4D6YA 4ZVPA 4YCJA 5BY2A 1XPUA 1JDSA 3F6EX 1ZFNA 2QTVA 2XRMA 2Y66A 3HWRA 4GQAA 2XI4A 4X20B 1X7XB 3WYEA 4PHGA 3EE6A 5HGXA 4RD6A 1ZQPA 4FYYA 1VPTA 4KK3A 2HU5A 4NJEB 2CV1A 3G2OA 1A5ZA 5L6LB 3AP3A 2GI4A 3H8MA 2FJ0A 4ED6A 3NBQA 2ENWA 4F4KA 4AY5A 2Q6KA 1UZLA 2HSZA 4JLSA 4C8NA 4XA5A 3UMBA 3PC8C 2VHJA 4ZGGA 4OQMA 4PAGA 2WE8A 4ZU6X 1GKKA 1YR2A 1Z2PX 2C3OA 5H1YA 4DIKA 1OXUA 5J5AA 1CCWA 3W6ZA 3WLMA 5LYJF 5KL8B 4RKFA 3NG1A 5JOQA 4Z7NB 2OXIA 2GJ8A 2OHHA 2WOOA 4TT8A 1AQUA 1C1DA 4ND6A 5GVRA 6PFKA 5I4KA 3V33A 3ET4A 3ROMA 3JQFC 5KG2A 5J4KA 4CM6A 3I8OA 3I37X 1DGSA 4Q0MA 1U7XA 2V4MA 2XTAA 3A8TA 1PCXA 4TTJA 3WNVA 3B0YA 2TS1A 1X9HA 1U7PA 3P5BA 4S0ZA 2IHZA 1RT9A 4OX9Y 4UCQA 3X1KA 2H3QA 5ILOA 1AOXA 4ER5A 3PNLA 2E4ZA 3KU4A 1C80A 1SRRA 2MA1A 4DEXA 4ZQIA 5CXUA 1I0ZA 4LJAA 4IZ6A 3EAGA 3D3WA 3CVYA 2CT8A 2Q4DA 3GD5A 1JDNA 1WDWB 3RC1A 3MFHA 1CQXA 3D6UA 4YV1A 2JRZA 1OAAA 1U81A 2BEVB 4YMUA 1KLNA 3JQGB 4N3GA 4Q45A 1NM5A 1ZYQA 1W6RA 1O77A 2GNOA 3LDGA 3GT7A 5LYJB 8ICCA 5ED4A 2HYDA 2X2FA 2NO7A 1QV7A 1YJ5A 1EK2A 3T5HA 2DCUA 3ZHYA 3LUBA 4MKZA 3HSYA 2QE7D 2QGZA 3QVOA 1A9PA 1YZTA 1WVIA 4F5DA 4TWRA 4B73A 1OAOC 4M49A 1XF1A 2DPXA 2YWFA 3L1IA 4OQDA 2CSXA 1WE2A 2FXIA 5KYXA 1Q7TA 2W98A 2W7PA 3GVHA 4QQRA 5J2AA 4IY1A 1KY4A 1IC6A 1PL7A 5C8XA 1KMHB 3CZMA 3IN5A 1KFKB 1U6IA 2D1TA 4HH1A 4GM1A 3CXUA 1UP6A 2EEPA 4KXUA 4PO9A 5KOIA 5T4BA 2I1LA 3VR2D 621PA 1QIGA 2Y4OA 4PLZA 5JPCA 3QUCA 3R0QA 3HCBA 2D62A 4E1VA 4BMZA 2WWYA 2C2DA 2IJGX 4N4AA 2WYWA 2OXFA 4K81B 1AKRA 4IV8A 2DR0A 2QRJA 2KLBA 4MLPA 2PSJA 1E7SA 4FXPA 4UUBA 1R16A 2ZIFA 3KPVA 5AHWA 4KH1A 3W8RA 5ARBA 3AR6A 5HRUA 3AF6A 1VPLA 1G16A 2VPXA 3I42A 2GCOB 1FXSA 1W5AA 2RSLA 1RD4A 1P80A 2UUCB 3ZE0B 4TQAA 4QWWA 3GFRA 4KLQA 1F6WA 2XGGA 5EJ5A 4EYGA 2FV8A 3F5AA 3U39A 3GV0A 4NESA 4FHCA 5LKRA 2LHTA 3H4BA 4OHZA 1YB7A 4O4LF 3C3MA 3KCQA 4C5AA 4WBNB 1V97A 1LDYA 2Q5LA 2AI1A 3OQPA 1AZSC 3IJRA 1E66A 3U9TA 1CJVC 1VCHA 3UQYS 1Z39A 4ZCMA 1ORVA 2I91A 1CZKA 1Z7GA 3G6YA 2I33A 5TPWB 1HQCA 1UAAA 4OQFA 3GJ8A 3WX0A 3F90A 5FYDA 2PPVA 3DFZA 4LTNA 5BN3A 2JASA 3WRVA 3EVZA 4OHUA 5K09A 1FMCA 3TAQA 2E3TA 4ZMRA 2MT9A 5JD6A 3RTAA 4OCZA 1C5KA 2FW9A 2QG6A 4OYRA 3TIGA 2ID9A 2NO1A 3KKZA 4LRXA 5G1NA 3RARA 3ETNA 3KBOA 2RHWA 4P4SB 3N2LA 5JJLA 3UXMA 2P77A 2WU0A 1F2UB 4QHYA 4MW9A 5DTEA 4AKHA 4GZLA 2RHMA 1NC1A 4JVMA 4TYNA 5H8WA 3I1JA 2XT0A 2RKBA 5T3YA 4RNNA 1CQPA 2WJJA 3GC6A 3T4PA 4F38A 5JWHA 1GADO 1W581 1S2IA 4Y2UA 3EZ2A 1ORIA 3IELA 1R8QA 3L43A 4PYNA 1C8LA 2HJ9A 4JAVC 3LQFA 1M83A 3BSYA 2KZZA 5K6AC 1CIVA 1U0HC 1Y1KE 1DC6A 2RHGB 3Q7PA 4CJXA 2RHCA 3S2YA 3R8FA 2VLIA 4NM1A 3ZD9A 1Y82A 2RHLA 2CNOA 2M2IA 3TOZA 2I2FA 3NXKA 4R41A 1LJLA 3PRYA 1NKEA 2GZ1A 2D0OB 2ZB2A 3HX0A 1L7QA 3DV0B 3FR7A 4ZRDA 3VTAA 4TUYB 3DV2A 3A4IA 4WXMA 2DLCX 4K6OA 3SICE 1TQ4A 4MV5A 1MVOA 3N0RA 1CJBA 3E4CA 4G3XA 4X6LA 1NJXA 4FSDA 1S01A 1TZ2A 3DDUA 1YZGA 3NYWA 5KKAA 3VH2A 5KEIA 4IINA 3NNSA 3JYPA 1RQXA 5JTTA 3FR8A 3WKEA 1PJRA 1WF3A 3SXUA 4EITA 4L4ZA 3HABA 1Z06A 2O2DA 2X5OA 3OIWA 3F6PA 3ICWA 2MOKA 1ONOA 4KQJA 2AXQA 3IQGX 3M34A 1M1XB 4G4GA 5KREA 1BS2A 2JGDA 3NFYA 2HCRA 2XWSA 4W8HA 3EIUA 1TV9A 3ED5A 4XX1A 1BVRA 1AGYA 2Z30A 1CUSA 4MVJP 4YCAA 5GGXA 3TW0A 4Q3OA 3ZJ5A 4CV3A 3ABRB 3T1TA 3KQNA 3K70B 2ZSDA 4JT8A 5JAUA 4UHJA 1B0UA 5JQGB 3PMLA 2VZLA 4WZAB 5DG8A 1ZQJA 3HDYA 5AR1A 3FPBA 3MJHA 3HB4X 1Z7WA 2PGJA 2XYQA 2FSFA 2ZAOA 1GNVA 5IIOA 3HKEA 3WBJA 4XZ3A 3Q3VA 2QF7A 4EENA 4L0MA 4MINA 1EDZA 1U3UA 3OBIA 1TT7A 4N3NA 4UARA 1LSSA 2ZJAA 2C82A 1U3CA 3JQ8B 3RRNA 1WCXA 2QW8A 3LF1A 3UO8B 4A1OA 5JMWA 5KKNB 4NI5A 1C1XB 3BA6A 1WZ2A 4AZWA 4ID3A 3JQAD 5D3KA 2C2WA 3K8QA 4PIPA 2CZCA 4HNUA 4AF6A 5A0VA 2CBZA 2HMUA 2XUDA 5MGNA 2RD2A 4BNJA 4JYMA 3WYNA 2YVKA 3LYHA 1LRKA 2AHRA 3M9MB 1CRLA 1ESEA 5LPNA 3KQKA 1QGDA 4DY4A 1JIJA 1RAHA 2DMRA 2IXBA 1XUOA 2REQB 3E3LA 4YBZA 4NDZA 5FTWA 2VYQA 3E22A 3ZUPA 4BWFB 3E9RA 4YCCA 4LF9B 1ECPA 3CKMA 2JIZD 3D6MA 4FDMA 4MSUA 4WLNA 3U9LA 3LWNA 1VHLA 2BFBB 2RFLA 4J6EA 4XASA 4EDHA 1COKA 1ICIA 1CZHA 1EFDN 5EJ4A 4OOFA 1UPBA 4QTTB 3CFYA 4YJFA 3JPPA 3U37A 1USIA 4IDBA 4ASUD 2Y1JA 1S0OA 2JKVA 2VPPA 4K8RB 3LS2A 5JZBA 4WW0A 3IOYA 3E58A 3UB4A 2GPWA 3UCEA 5FBVB 5FA6A 2YWGA 1RYBA 3P9IA 3PU6A 4DN6A 3TZLA 2HA2A 4LQDA 3NVVA 1I1QB 4RZQA 3MQFA 4UNNA 3ZXUB 2NU9A 4XLZA 1NX9A 2GZMA 3RB0A 2HJVA 4G07A 3OAAA 4GG1A 2Q1TA 4B8YA 2JGMA 1VHDA 2WYOA 1NBMD 5DWVA 2E87A 3HGTA 1KYVA 4Z7QB 4DNFA 2Z4TA 4G09A 4EUFA 2NRXA 3TE7A 4RHFA 1EDDA 2LYAA 1OSNA 3AI7A 1PGQA 3ENZA 2ZTCA 3WOHA 1PK1B 1EJBA 3N3BC 2HHTA 5KFMA 3KKEA 2H7CA 2NU6A 1AKEA 1XDWA 5CIQA 4O2AB 1W4AA 2FR1A 2H00A 3HUDA 3H17A 1SCIA 1UK7A 3NFRA 3TW4A 1DWOA 2QNRA 4AS2A 4BIMA 3MQ2A 2YNMC 1YGYA 4QYSA 4C89A 4GXQA 3TRKA 4QVIA 1RQLA 4F5PA 4MUNA 1X92A 4Y30A 4ELVA 3HT3A 4F5QA 1GA1A 1LTQA 5EWLB 3ZE6A 1BPZA 3T5TA 1RLJA 1ENZA 1C9JA 1PLJA 1Q15A 4JMPA 4NS4A 1L8LA 4WCVA 1KL7A 1L5LA 1CVLA 1SXJA 1Q7EA 3HUEA 5EL0A 4F7WA 3DZCA 3RJEA 3K5HA 1H6CA 4I6GA 5K5EA 3IQFA 1NKBA 3C1OA 3DUFB 1U2DA 2DFVA 5KTRA 2AOTB 5T6BA 5A62A 4MQ4A 3H84A 2ANBA 3LQ2A 1BWRA 1NYLA 1W73A 4YJHB 2W6QA 5SYNA 1EFPA 2PAFA 4JI6B 4BVGA 2Z95A 4CKEA 4DLAA 4Q48A 3FUVA 3ZI7A 3AILA 2JFWA 3UFXB 4G0WA 1A9OA 1GRRA 3WFZA 5I3CA 3QYAA 1H85A 1XLTA 4FFOA 4PQRA 3MTQA 3KPYA 3FOAA 3SSMA 3URKA 1TEXA 3PI6A 3WLHA 2YW9A 4AIIA 1UXKA 4DS3A 4RVOA 7ICTA 2OO7A 1G6HA 1XA4A 4PO3X 4E6PA 1EB9A 5J0TA 1RPAA 4YI3A 2AR0A 5LKAA 1RHQA 2ODQA 2HZ7A 1KI6A 4QNRA 5DLDA 5EIBD 3EX7C 4LYGA 4R1OA 3JD1A 3DMFA 1E3IA 1ESZA 3IERA 4J1NA 1U94A 2C83A 5E7QA 5AVQA 1PHRA 1E2UA 2HLHA 3AR7A 3K0CA 2AFHE 4UC0A 4ZAWA 1X66A 5GVSA 1I3LA 2FDCA 3BL5A 4B3TB 2EHJA 3MA0A 2VEOA 4C0AC 9LDBA 4MCHA 4EHLA 4RO0A 4GR4A 1Q0PA 4ESEA 1FQWA 5CEEA 4QPCA 3OJLA 4R1LA 2VWQA 3SM9A 2VTKA 3PKIA 3DF7A 2RI1A 3OPQA 4Y6SA 1Q1AA 1NI4A 2R44A 3D4IA 4B8WA 4ZYWA 3TYXA 3KVNA 4DA9A 3FOCA 4V1CI 2AG1A 2RJNA 1DSSG 5K6AA 3REGA 2Q7DA 1ECBA 1ZJJA 2PUTA 2ZXIA 3QUQA 1OYYA 2C9MA 1S2NA 1SUEA 2A4KA 1B4DA 5TE9A 1US8A 1MG5A 5E9QA 4TYQA 5HXAA 4LDJA 1Z74A 2AA3A 2ZXHA 2HU7A 2ZI3A 4RK6A 5CAEB 4MHTA 1EEXB 2D2FA 4HDQB 1EP1B 1SUIA 2I7VA 1P1JA 3A32A 3C6KA 3W2TA 3A3YA 3G2QA 3SQMA 1R12A 3ZNNA 3ORQA 3G8AA 5KCZA 2O05A 3MPOA 1X1RA 4GXNA 1DTWB 1P2BA 3K94A 1UXOA 1SGGA 1B8OA 3DBHA 3HB9A 1PNVA 2OYSA 3AQ4A 3K92A 2X6QA 4JUDX 3TPCA 3DF9A 3T94A 3TZBA 2ZTEA 2KZMA 3KJQA 2QJRA 4M1QA 1JEOA 2WZCA 3LYAA 1ODSA 1PBNA 4NJEA 1M3SA 5JYCA 3IT2A 1RJDA 1Z6XA 3ZLTA 4LZGA 1JEQB 4HLNA 4HXGA 3R5FA 2XQKA 5HYVA 2EIXA 5KNDA 1I4DD 3GUZA 1S2DA 1RWNA 4L07A 2V7WA 2HIGA 1G2IA 4KMOA 3RKUA 2XITA 4EB6B 2AYXA 2CSUA 2E21A 1QGUB 1HL7A 2RH5A 1P2TA 2PI4A 5FAXA 1OGJA 3PQEA 4HWRA 1ZK2A 2R6DA 2WU4A 2HH9A 2RI6A 3DKPA 3G2HA 1JHVA 3RS8A 5KX5B 3GCWA 3ER6A 3LPMA 1UJ2A 4GI3A 1V38A 1LPPA 3SE7A 2O4CA 4EYSA 2NQ8A 2HDNB 4XRGA 3OU6A 2O8DA 3ROZA 1E2QA 3HFGA 3HFSA 1Y37A 4J9SA 1Z0JA 2KICA 1QE3A 2HHJA 3E15A 4QFDA 4QZHA 3F2CA 2QSYA 3T3OA 1QH8A 1CRWG 1XHLA 2OWEA 3LD9A 5HIJA 3RWOA 3OTIA 5LD2C 2G08A 3AJDA 4IPTA 2IU0A 5AK3A 1U0GA 4EGQA 2Q3MA 3BDAA 4UHHA 1GNRA 4AUKA 5JO0A 4BDPA 2A3VA 1TAQA 5ENDA 5FBZA 4EG8A 4WEQA 3HMKA 2KG5A 3L2OB 2PMKA 3ZIAD 5AW6A 4BP8A 3HKZC 2JAPA 4NPCA 3LBHA 3UAOA 3L6DA 2PFQA 1J39A 2VP2A 2ZPUA 3I0MA 1GPUA 3DVQX 3JZAA 1QNLA 3OJ0A 4NJOA 5C5IA 5JU6A 3TLGA 4JI4B 4MWEA 4R66A 3ZE9A 1VPWA 1JJIA 1XEFA 4M9XA 1QG2A 4CLRB 2WHXA 1I4TD 3HLTA 4L1KA 3VH1A 4NBLA 1JR3A 3H5LA 1QHHB 4BO9A 4YMIA 2HA4A 1T9DA 3HCAA 4I8XA 4LOIA 4FCCA 2VH5R 2C1EA 4Q1CA 1JFSA 2XCTB 1XKQA 2XGMA 2XLCA 4JBNA 2O5CA 4OYLA 4LZPA 1E9CA 3N2GB 4FEAA 4J90A 4LJSA 2CKDA 3I45A 3OPYI 1EGQA 3MG9A 3VZQA 3ZKWA 1RQRA 2FLNA 4BXOB 1FSZA 1J56A 2FGJA 4KW7A 2J6SA 3AUKA 5LYYA 5TIIA 3DHVA 5EVJA 3N76A 2V98A 1U0RA 1HSZA 4J49A 4CV0A 1PFUA 3VR4A 5AKEA 2GHRA 2Y1DA 4C4TA 3TFSA 4IVPA 1YKFA 8LDHA 4QFCA 4B79A 5JEEA 4BYGA 5LA6A 1T36A 3JZMA 4J0DA 4WSOA 1GXSB 4C0QC 3DGEC 2X2PA 3WGMA 1SVWA 1NASA 4B9NA 2GM5A 2W37A 3QVUA 4AJJA 4HEQA 2GUGA 3FPKA 4MUEA 1E58A 3ZWWA 2WYUA 3K5WA 3CYMA 4XLLA 3OFKA 1V7QA 2GN6A 2GF0A 1IQUA 3DZJA 3N39C 5C8DA 2PJRA 1UPUA 4UAUA 3GQCA 2VTEA 1Q6ZA 2X4LA 3PRKE 5KFZA 1DJNA 1Z7BA 3RAJA 1OLSA 1AA6A 8ICWA 2ZIXB 1LC3A 2DH5A 2FZGA 1N56A 3FYSA 4QUJA 4I28A 3PXGA 1FX0A 4DFPA 3R75A 2IGTA 4HADA 1RNLA 1RLIA 1T8UA 1E0DA 1ONBA 1A9XA 1MRZA 1NA5A 3PA8A 2E85A 2PS0A 1A2OA 2PWYA 4TWZA 1T9AA 1M0EA 2RDIA 3DUFA 4Q3CA 5F1PA 5AUOB 1COWD 3SLKA 4FI3F 5LQKA 3ENKA 3F97A 2OD2A 3LVBA 4FFBB 3ITDA 1ZQWA 3T3GA 1PQWA 4OJOA 3LP6A 5H70A 5EJ2A 3SHVA 1F1JA 4DKXA 1CP2A 3S1AB 1Z88A 4B6EA 5ALXA 1NG9A 2JIZA 4RZSA 3I5AA 2EGHA 4RSMA 1V8BA 4DVGA 1T4MA 1UWLA 3ZNPA 2EERA 4V0OA 1FQKA 5AVUA 1YASA 4KJZA 4C4SA 5G5HA 2ZUBA 2W22A 4P4PA 2KJ5A 2IYQA 3D5QA 4LCEA 3VKFA 2RGUA 3FBGA 2J9XB 3MJFA 5E4FA 3A1SA 3VU0A 1BDHA 1EE9A 1FPQA 2JEYA 1TCUA 2NV6A 4WD3A 2VNAA 4C8LA 1ZR2A 1UFOA 1R10A 4OSOA 4BNGA 5B58C 4HVTA 1ZI9A 3UN1A 3VGJA 1H4SA 4XDZA 1N6NA 2C5SA 2H1IA 2FKAA 3IOMA 2XRZA 1N2JA 3NH6A 1B73A 3CKYA 3PWKA 3PX2A 5CJ2A 1LVHA 3BIOA 4HI0E 4KKXB 3RSFA 3RYCB 1O0CA 3GGPA 1DXHA 4LS3A 3LDFA 2HKIA 1YOVA 2Z6UA 3K72B 4JV1A 3GA7A 4IDPA 3VR4D 5J2IA 3KBBA 1VL2A 3FE2A 4V0MA 3WNQA 2OR3A 5CB4B 3VPCA 3FOZA 1NVVR 3RIYA 3SYRA 3L82B 4DV3B 3KOXA 1GUZA 4MTLA 2APJA 2H48A 5K03A 1HRDA 3QPDA 2QV7A 1RHMA 4Y2GA 1R4MB 5HVNA 2QP3A 3NBMA 3H86A 4FK8A 4MGYR 2PX8A 3IBTA 2Y0EA 2H3HA 1JJBA 1WKVA 1ZNYA 1G3QA 1QOZA 2QJFA