2B0CA

The crystal structure of the putative phosphatase from escherichia coli
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
199
structure length
199
Chain Sequence
AKMLYIFDLGNVIVDIDFNRVLGAWSDLTRIPLASLKKSFHMGEAFHQHERGEISDEAFAEALCHEMALPLSYEQFSHGWQAVFVALRPEVIAIMHKLREQGHRVVVLSNTNRLHTTFWPEEYPEIRDAADHIYLSQDLGMRKPEARIYQHVLQAEGFSPSDTVFFDDNADNIEGANQLGITSILVKDKTTIPDYFAKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The 2.0A crystal structure of the putative phosphatase from Escherichia coli
rcsb
source organism Escherichia coli
molecule tags Structural genomics, unknown function
molecule keywords putative phosphatase
total genus 69
structure length 199
sequence length 199
ec nomenclature ec 3.1.3.10: Glucose-1-phosphatase.
pdb deposition date 2005-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2b0cA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2b0cA01
4BNDB 2ZBEA 1J8DA 3WK9A 2YMQA 5AI9A 3WKBA 1QQ5A 1RPZA 4DW8A 3ZWKA 3KDPA 3WKEA 1EK2A 2HI0A 3SD7A 3OCZA 3SMVA 3NANA 1IWOA 2FI1A 4YGYA 3AR6A 4BNDA 4Y2TA 2EAUA 4AS3A 3MMZA 4Y2RA 2O2XA 2HO4A 1L7MA 2GMWA 3DDHA 2ZBDA 5IT0A 3B9BA 1U02A 2I33A 3FPSA 3L7YA 3A1DA 4J2TA 5AVUA 1AQ6A 3E81A 3QUBA 3PCTA 3KBBA 1WVIA 3R9KA 5ALVA 4Y2SA 4QJBA 2JGAA 2Q5EA 4RETA 2NO4A 4B6JA 2OBBA 1XPJA 3U7GA 3L0CA 4ZEWA 2RB5A 5AW0A 3AR2A 4UARA 1NRWA 3ONNA 2CN1A 4UMDA 1RQNA 2R8EA 1Z4PX 3RFUA 1Z88A 1VJRA 4HGRA 4BBJA 3QNMA 1T5TA 1L7NA 2C9MA 2I6XA 1RMQA 5AM0A 3NASA 1ZOLA 5AKGA 1RLOA 3QGMA 3VAYA 5ALRA 1L8LA 2RBKA 1TJ3A 2MU2A 1VJ5A 3SLRA 2ZG6A 1RKQA 5AVRA 5AKKA 2HOQA 4NAVA 2I54A 1QH9A 3FPBA 3QLEA 1O03A 1LTQA 3L1UA 3AR5A 1T9ZA 2QLTA 4BX3A 2HCFA 5ALDA 1CR6A 3B8EA 1WPGA 2MSNA 2R8ZA 4I9FA 2ZOSA 1Z4IA 3GYGA 3AR4A 1X42A 2G08A 5AM1A 1K1EA 1F5SA 1L8OA 3D6JA 2G80A 2YJ4A 3OCUA 2EARA 1WZCA 4HYTA 5FP0A 1U2SA 2R8YA 4YH1A 4BKMA 3EWIA 5AM2A 3QU5A 3SHQA 1S2OA 2HSZA 2C8KA 3L8GA 2JAWA 4YCLA 1ZD5A 2CFSA 1U7OA 1CQZA 4XPZA 5A3RA 3IRUA 5AW8A 1TJ5A 4Y2VA 4E88A 4CF4A 3AR8A 4KX3A 2WM8A 3ZUPA 5AVZA 1RC8A 4YCMA 3W5BA 5IS2A 5AICA 2P27A 2B1QA 5AK6A 3K1ZA 2PKEA 3RF6A 1S8OA 4CE6A 2PR7A 3ZTWA 2FPWA 2FPXA 4NABA 3MN1A 4KNVA 5AI0A 2NO5A 4BYGA 4EX7A 1U2TA 2WF7A 4UMVA 1Z4NA 1Z5GA 3UMCA 3KC2A 4DFDA 3AR9A 3WKAA 1RDFA 3AR7A 3QYPA 4EX6A 3ZI4A 5AM4A 2YY6A 2YMPA 4Y2PA 2D2VA 1J97A 4UATA 3L8HA 3NUQA 3EF1A 4EENA 5AW7A 2YJ5A 2FUCA 2YBDA 1ZD2P 1RLTA 3ZTYA 3QUTA 3ET4A 3N5KA 5AI4A 1ZJJA 2HF7A 3QU7A 3U7FB 5AK4A 3L0YA 5ALNA 1LVHA 1PW5A 2G06A 4L6AA 4F72A 4OD0A 3WK7A 2B0CA 1QYIA 5ALQA 4KX5A 5AHXA 4Y2XA 3IB6A 1KYTA 2C88A 2QYHA 1L6RA 2YFYA 5AI6A 3W5CA 4FE3A 2OA0A 3QXGA 2B1RA 4C4SA 5ALLA 3WK6A 4KN8A 3KOOA 2IOFA 4C4TA 3PGLA 2IA5A 2AMYA 2HX1A 2P69A 3NIWA 4DWOA 1Z4OA 3A1CA 3S6JA 1Z4KA 5ALIA 2WF6A 1Z4JA 3AR3A 3FM9A 2VKQA 4G63A 1SWVA 5AM5A 4C4RA 3PDWA 2B8JA 1RRCA 4BX0A 2G0AA 5AKYA 3EF0A 2G1AA 3DV9A 3QU2A 2PQ0A 3NRJA 2FEAA 2C4NA 5AKZA 5AESA 3CNHA 4UAVA 5AW5A 4IFTA 3E8MA 2YJ3A 1SU4A 1RLMA 5AW9A 1EK1A 5ALWA 2X4DA 3A3YA 2CFRA 2W43A 5AVTA 2YMLA 5ALYA 1FEZA 4EEKA 5AVYA 3KZXA 3M1YA 5A3QA 3FVVA 3IJ5A 2I55A 2GO7A 4HGQA 4ZEVA 3HYCA 2EATA 1T5SA 3HLTA 2YN4A 2OYCA 3ZW7A 2FPUA 2B8EA 3L1VA 4O8CA 5ALTA 3ESRA 4NFLA 3ET5A 3WKCA 3N07A 2GHQA 5ALZA 3OTQA 4Y3UA 3ZX5A 3ZWDA 1YNSA 5ALKA 1QQ7A 3KD3A 5AIAA 1RKUA 4GIBA 4RESA 3ED5A 2G09A 4KNWA 5AKXA 1QQ6A 2OM6A 3WGVA 3QX7A 4FFDA 3OCXA 4EELA 3R09A 5T41A 1Z4QA 3QUQA 4YCNA 4OCZA 5AKLA 2W4MA 4QQFA 3PGVA 2HHLA 1Y8AA 2JAUA 4XQ0A 3QU4A 3L5KA 3SKXA 1TJ4A 2IOHA 1L7PA 3EPRA 4MUMA 2WF9A 2I7DA 2I34A 2FDRA 3L8EA 4UMFA 3B9RA 4CF3A 3E84A 2AH5A 3ZVMA 3WGUA 4UASA 3L8FA 3MPOA 5AKJA 2B82A 3N28A 5AVQA 3ZX4A 4Y2JA 2BDEA 2AGVA 3R4CA 5AW2A 5E0OA 1RMTA 2CFTA 2FUEA 5ALUA 1XP5A 2P9JA 2AUTA 4JDPA 3W5AA 5ALFA 3U7HB 1ZD4A 4YIKA 1N9KA 4KYTA 5ALPA 4UMEA 4F71A 1U7PA 3UMGA 4DCCA 2BY4A 5ALOA 2C8LA 3I76A 1SWWA 3U26A 3TLMA 4BX2A 2B30A 4HGNA 3BA6A 5ALSA 4I9GA 3NALA 3SF0A 2JARA 1Z4LA 3E58A 4UU0A 5IT4A 2WHEA 2P11A 5AVVA 4NWIA 1TE2A 1N8NA 4GXTA 3NAMA 2WF8A 3U7EB 5AW1A 2GFHA 2BDUA 2W11A 5AKIA 5ALJA 4NV0A 3U13A 4G9BA 3L0BA 3QUCA 3OCYA 5AVSA 4Y2YA 4HGPA 4JB3A 4UM5A 4Y2QA 2FPRA 1Z4MA 4J03A 2RAVA 5ALHA 2Q4RA 3ZVLA 5AIBA 1Z5UA 2GHTA 4L6CA 5AI5A 5A3SA 4AP9A 3QU9A 2NYVA 4H1WA 2O9JA 4L57A 4YIHA 2WFAA 5AVWA 5AK5A 4AS2A 2YMMA 2WF5A 4UM7A 4EZEA 4IG4A 4UU1A 3ZU6A 3ZVNA 5AKHA 4BEWA 1L7OA 1Q92A 2IYEA 1RMYA 2ZXEA 1YDFA 2HDOA 3BWVA 5ALXA 1ZS9A 4OHFA 5AW6A 1YV9A 4Y2UA 3FZQA 3OCVA 4CNQA 3WK5A 4CF5A 3F9RA 2HEGA 4ZEXA 5AK3A 3I1YA 1Q91A 4XOUA 2DQSA 4XE5A 5AI8A 1ZD3A 3J7TA 3DNPA 5JJBA 5AKEA 2ZBFA 2JAOA 1ZRMA 3N8GA 3P96A 3OCWA 3UM9A 2MU1A 2Q4TA 1NNLA 1WR8A 1ZRNA 1YMQA 3SKYA 3U19A 3MC1A 2IOFK 1XVIA 1RQLA 3OPXA 3CZ4A 5AW4A 4FYPA 5AVXA 5ALGA 1TA0A 3N1UA 3WK8A 3FGOA 3M9LA 2FPSA 3UMBA 3DAOA 3ESQA 3WK4A 1O08A 2RARA 2R8XA 1NF2A 4HGOA 4PNHA 2G07A 2ODAA 5ALMA 3WKDA 2HF2A 4UAUA 2ZBGA 3A1EA 5AW3A 3I28A 4BEVA 1MH9A 5AM3A 4HAIA 1YJ5A 1YS9A 1RKVA 2YJ6A 5ALEA 4OFZA 1JUDA 4UW9A 1VFPA 4MWOA 3W5DA 3I6BA
chains in the Genus database with same CATH superfamily
3CW9A 3FD8A 3UT0A 4M0UA 5HFJA 5G2OA 4OJOA 1M5RA 3QA3E 3DKPA 1RW4A 5JAQA 2J6SA 3K73O 1HYQA 3CZCA 4JP3A 4ZIRA 4LQCA 3EFEA 2OBFA 1HTTA 1W5TA 4XB1A 3P45A 2VJKA 2B5VA 2JGNA 4K6OA 2WY2D 4EEYA 4ZVLA 1T2VA 1I7PA 2HLNA 4EA7A 1CY4A 1XTSA 3HJNA 2I03A 5IJXA 2PRKA 1T8SA 4NCAA 1LI5A 5DBBA 1H6BA 2EAUA 1RRPA 4YJGA 4UQGA 3PO4A 1E6KA 1NXSA 1LNZA 4N1AA 5CFNA 4DLGA 3PRKE 4BFVA 1CY7A 3LYAA 4EATA 1WB5A 1ZM9A 1ZM4A 5K0TA 1KEWA 3DL2A 5BN3B 3UXNA 3DZ8A 3IGFA 4H16A 4MYTA 3RT9A 2F1KA 3UAGA 3UFXB 3HVUA 1BO6A 1X1AA 4LZWA 4OJNA 3GCZA 3JVDA 3DVRX 3CLVA 3O8LA 4B6PA 2ZROA 1YUBA 3QUBA 9ICCA 1DWUA 1JILA 4HGYA 2YBEA 4UVIA 1NBWB 4LIPD 2VNKA 2XF2A 4DBLC 4UUAA 2B69A 7GPBA 2SKEA 1NZBA 2OC4A 2WLSA 4FTWA 3GLGA 2EZYA 1KQ3A 1IB6A 2ZE5A 4P83A 3L3BA 3KYBA 1XPJA 2AZTA 3IVGA 5D6OA 4DSIA 2QJWA 2ZSKA 3A2MA 3CIOA 1NR7A 4AJ2A 4DJEC 1K88A 721PA 1KTVA 1Q7BA 4YJFB 3QBTA 5AOAA 5LUAA 1CETA 4LNHA 4RV5A 2WDZA 2WYUA 4JS0A 5EZ5A 1ZQEA 1YR1A 3D8NA 2OCDA 3U7RA 1J1UA 4ZVNA 3T5CA 4ABYA 2FE9A 2R66A 4LUCA 4QUHA 4IIJA 5H82A 1J42A 4I5DA 5LZ4A 3DBHB 2MSLA 3R76A 3V32A 2H08A 4M86A 4PZAA 2SICE 2BGJA 1D03A 3TSOA 4WUTA 3GV0A 4XJVA 4B7AA 4C78A 2ADFA 2AJTA 2P1DA 1K4KA 1DC6A 1JXMA 1L0BA 2NSJA 1ECLA 2FCRA 3C1TA 4RMHA 4AJJA 1FFBA 1XLVA 2JH8A 1BE8A 5JXHA 3PT5A 4BTLA 2OWEA 4XFDA 1XK6A 3FPBA 1J24A 3PQFA 4UXJA 3GVHA 5F64A 3TUIC 1PSDA 2A9FA 4ALIA 1R74A 6YASA 3SR6A 5EJ8A 4RF5A 4ZVPA 5ADHA 1CR6A 1Y8RB 1ZUNB 3D2NA 2O7SA 2P3QA 2X40A 2YYYA 3OQ1A 3SEZA 3TGPA 3B8EA 3Q3VA 5TXGA 1XELA 4N5NA 4KLRA 4U2EA 3K9NA 1HLDA 4P2GA 1BVRA 2HVHA 2XWSA 2OCPA 2YZ7A 4OA8A 3DTVD 3JQPA 4DPLA 1ZGZA 2QL5A 5JZMA 5KMGA 4UTPA 2JAPA 2YDYA 1PK7A 1RC0A 5IFLA 2Z56A 4IQWA 6REQB 4LW8A 2CVOA 1RI2A 4IQ4A 4AJHA 1I7LA 1UOEA 1HT0A 1W5AA 2BFEB 4IXNA 1XSEA 1OR8A 3M70A 3OCUA 1MB3A 3P9NA 3PGXA 4LQDA 4MQBA 4NJMA 5I5GA 4BE7B 7REQB 4BLOA 5HM8A 1IV8A 1YCFA 1XN4A 4AXBA 1Y3AA 2R8YA 5I01A 1P1BA 4C5CA 3IXMA 1LDGA 4DIOA 2ANCA 3R6WA 1X0VA 3AXTA 5EXXA 2BWJA 1V8BA 3K0AA 3IE0A 3OPNA 3P9PA 3D1LA 5E6SB 4X62B 3U3ZA 3K5IA 3MM4A 2FOXA 1EVQA 2JVKA 2GZDA 3L06A 4JV0A 2O2ZA 3ABQB 2FSFA 3AGQA 1SG9A 3KV1A 4JMPA 3QYJA 5A5GA 1CEYA 4EVQA 1FP7A 3IRUA 3C24A 1J5EB 1ESNA 3KEQA 4ZPJA 3AZPA 3JPNA 5IAJA 2FAXA 4JYBA 3FZYA 4OO3A 1BVUA 1UAAA 4CF4A 1KY3A 1SGWA 1T2NA 1S97A 1G4AE 1MV5A 3BIOA 3R5FA 4Q7QA 1R5NA 2GZ1A 3ER8A 4EY3A 3HV0A 4WLUA 4PGFA 1HFEL 2H8GA 1K89A 4YALA 2FLVA 5JY1A 3HJFA 2FN7A 4MMZB 4OJYA 1EDZA 5KFRA 1NKCA 1Y33E 2JFXA 1FS6A 2PS9A 2W2NA 3PFHA 4F97A 1E8DA 4NABA 4DY6A 1M9NA 1MJGM 1YXMA 1E9AA 3MN1A 5IEJA 1L7XA 1PG5A 3OLQA 3PDCA 2EXXA 3VPBA 3WLPA 1P8AA 3ZE2B 5FEMA 5BR8B 1U2TA 2PUHA 1L9KA 4UU7A 4YP5A 4H3KB 1O8CA 1ISMA 4GWLA 1JHUA 1GZHB 3BD6A 3LQKA 3NH6A 2P0YA 5C8ZA 5J0OA 2Y1WA 1D2CA 2X19A 3Q8LA 4TUPA 3BC1A 4R51A 3ORFA 2QUBA 2ZYAA 3TTXA 2I8LA 2PEYA 1YFZA 1PJ8A 4CLHA 3UMFA 1YHYA 4BQFA 5EZQA 1YZGA 4MVJI 4O5OA 4IRXA 4QGGA 1FTQA 3EF1A 1I4WA 1PZGA 5I7WA 4UBNA 4QLBA 3ITEA 4RNMA 4RPGA 1C8BA 2OFPA 1HNXB 3UY4A 5L4SA 4JFRA 4QTXA 1O87A 2HF7A 4RA9B 1TW2A 2P6MA 4D97A 3BWEA 1H4QA 3U7FB 2BF4A 4HTFA 2QZZA 3OH8A 4RKYA 1W36B 4DUGA 3MLAA 4XWGA 3OI7A 5C37A 4LXHA 4MUNA 4H1VA 4YAKA 4BTVA 1WZ2A 1DKUA 2C88A 4RTJA 3IVCA 3GLIE 1SIBE 2O2YA 1HE3A 5K0ZA 4YP6A 3BMNB 4NU0A 1O6CA 3GW8A 2B1RA 2ID9A 3X1XA 4TMKA 3MGHA 3MWEA 1TU0A 3W8DA 3P27A 8ICKA 3DE1X 1IN6A 1WMFA 1YL7A 3VKFA 2WPNA 4S35A 2XQIA 2JFQA 4XH9B 1YTUA 1PYOA 3D7LA 3IAFA 4RULA 3PUWA 4QVIA 5MFPA 1NJ5A 2IYAA 3O47A 4AMVA 1ZBDA 1ZYUA 5F2OA 2NTYC 5CT6A 3DFZA 2E87A 5J4HA 1FY2A 4M88A 3RABA 3KKZA 1ZQ9A 1TAQA 4S0ZA 1KK1A 3TNDA 2CFIA 1CUXA 5FUBA 3EA4A 3VPXA 1UPHA 5LQUA 1IM8A 4C0KA 4NZOA 1AC5A 1CTQA 2Y27A 3INNA 2X0IA 3TKLA 4CMHA 3GGOA 4JGGA 3MBYA 7ICFA 1V6SA 3C14C 5C0YA 5EQDA 1UMDB 1QKIA 5JDCA 4NEQA 3LVRE 2LM4A 3CVOA 1QZ3A 3ADCA 2FPIB 2ZIUA 3UK1A 3ROXA 2CNNA 5DB6A 1AGNA 2IXEA 4HVTA 3B1VA 2NSLA 3LCMA 1ZQWA 1L8XA 2HNKA 3UCEA 4CLEA 5BV8A 2V4ZA 2X5KO 1MA0A 4GZ5A 2A9KA 5A06A 2FFBA 3E0XA 1EFRD 1PUJA 3FDXA 4LHEA 4B6GA 2WZCA 3R8XA 3STHA 5DASA 3DW3X 4S05A 2OV8A 3EJWA 2BEVA 1WIWA 1UP4A 2EW8A 3EYWA 3FLMA 4ELVA 1UQRA 2A94A 2ZU6A 4B82A 5GZ3A 4G0OA 3B6MA 4R1PA 3RIXA 4TTRA 2IIPA 1IUPA 4DLZA 2JI4A 4PG8A 1H2WA 4UBMA 1LA2A 2JGDB 4OQEA 5CB0A 4W5QA 4DFMA 1M2OA 2OQ2A 5A3QA 2PPVA 3FWZA 1C8LA 2AMJA 1GUFA 2I6QA 4HGQA 4IICA 1C50A 5KNDH 2DHRA 4LE0A 4NULA 3P8ZA 2HU5A 2M1XA 1XEWY 1JB9A 2YVAA 2HCJB 1J56A 2H07A 3HLTA 1P2UA 4Y30A 3MS4A 4IJUA 3QE0A 4YI5A 3N86A 2JAQA 1OCEA 4LZPA 1V48A 1IZ7A 4DLWA 3SV3A 1F8FA 5E1BA 2BPGA 3ICXA 3VCBA 3VOBA 4Q6BA 4XVUA 1NONA 2MUTB 2FU5C 4MH0R 4EY8A 1N2EA 2H59A 3EDCA 1MZVA 4B35A 4P93A 3JTMA 4U7JA 4XW2A 2AOUB 5FA8A 1ZQLA 5T4EA 4BXOB 5ALKA 4D4GA 1H9CA 2HOFA 1R4AA 4DMCA 1NQWA 1QGDA 3W90A 4CTKA 5LB4A 2VANA 2OV3A 1P19A 2FVXA 2H1FA 3IAAA 3R23A 3FRJA 3IBGA 3ZE0B 5KG7A 2B3DA 3MD9A 2WICA 2YX1A 2GXSA 1FXWA 1BJTA 3BTUA 4EKGA 4D9IA 3AEUB 1OXBB 3GV5B 4OO1J 2C20A 3ZE9A 4YJ2F 1UDRA 3OESA 5CNKA 5K3SA 3WYFA 1QCCA 3N2ZB 3QPWA 5KOJB 1S02A 3QUQA 2F17A 2H5EA 3O8DA 3PLNA 4IDGA 5JD4A 1BGVA 1G6KA 1MR3F 1EFCA 1WUJS 1ZI6A 2FFRA 2WUWE 3RRXA 3IQIX 5IKXA 3LVQE 5LP6B 2ZIVB 4ZO7A 1JYSA 5BPCA 2G4VA 3KSDO 1O9GA 4ED8A 4H6VA 4F56A 1F60A 4OQYA 1IJBA 1L7PA 2DPMA 3EPRA 4J90A 4TKUB 3VTZA 5IVPA 2ZRNA 1QMPA 3THWA 3W6PA 3AKYA 4DS4A 3ZJVA 1AUVA 1RAAA 2J6HA 1OA1A 4RJTA 3LBAA 4AJNA 3TI9A 1FTYA 1Y1QA 3U3XA 1NJ8A 4R05A 4TLBA 1OBOA 1FTGA 1CQJB 1XDBA 1WABA 2H57A 2LDXA 3HKBA 1NHWA 2NIPA 4IFBA 1KE2A 3ZEAA 2FZWA 1CHNA 4DIDA 2J32A 3IUEA 3AFMA 4FYXA 2YRFA 4J1SA 5D00A 5I47A 1B00A 4X7RA 2OG2A 2ACVA 1SCJA 2J0VA 2W22A 5F3XB 1GXSA 1N5RA 2JFWA 1XA3A 2WTNA 1XZHA 1ZQMA 2NTNA 1L5KA 2X77A 2VJLA 3D7KA 4XKJA 1IIPA 1KYWA 3ZU3A 1QE3A 2W8KA 1V1MB 1V96A 4MWDA 4F71A 1S76D 2A1UA 2HMAA 5DSZA 2DY0A 5JMTA 4LDAA 4U7PB 1K2VN 5DNDA 5FT9A 4N41A 1KYQA 2YCBA 1EGMB 1COKA 4H17A 1E2GA 2KG5A 4CMKA 3QTLA 1X1RA 3QX8A 5IILA 1VYUA 2ATCA 2FW8A 2HN9A 5L3SB 5B53A 4Z49A 3GP8A 1HEKA 2RRDA 1AZTA 1GNTA 1U2GC 1Z18A 2ZYGA 3BE8A 3D6TB 3K2BA 5KFZA 3OD5A 1XWLA 1AF7A 2FWIA 1SCBA 2Q6LA 4Z4HA 1MX9A 1A2BA 1ZVJA 1O5TA 4PHAA 1C7QA 2PMFA 5K3CA 5HIIA 5JAHA 4QSMA 1A72A 4MWBA 1K1QA 1RAGA 3PX3A 1JW9B 4RBNA 3CRXA 1LCIA 3PEVA 3N7PD 5AW1A 3QVMA 1NP7A 4TMTA 3LT1A 1DWQA 1NKSA 2VH2A 3P2OA 3KX2A 2KS6A 1K2WA 3GBVA 3WIDA 1GGFA 1I2MA 2IE8A 3HA3A 3Q6IA 3WBBA 4CMJA 3PLAE 4CUJA 1MH1A 3KQMA 4OXQA 4HGPA 4MWCA 4Y0NA 2P6PA 3DMFA 1MUUA 4UM5A 3CUWA 1CEZA 4O3RA 5HF5A 1PTKA 2LRHA 1O4WA 3OWOA 1KVUA 2FPKA 1Q0RA 1GGHA 3VHRA 5DNCA 2O0JA 1DAIA 4PLWA 4DQKA 2KKPA 1W44A 4X3CA 4US9A 5CHGA 2VYVA 4MR7A 1QV6A 2UZ0A 2G1PA 4DFJA 4GX1A 1GQSA 1P2TA 2V6FA 3G6VA 1D7OA 3FPGA 5G41A 2V1UA 4K26A 3P7MA 3KEMA 4WD3A 4MS3A 1CKEA 3L92A 2DCUA 1PS0A 2QM3A 3ZU6A 5MF6A 2WT4A 1DTWB 2IYNA 4IC9A 4PCLA 5DXFA 3NFRA 4CODB 5CB6A 1FP4A 4UD2A 1RZTA 3QJ5A 1NKEA 3HFSA 3PVZA 4B2LA 4RY9A 1CVIA 5CDGA 1WEKA 1YQDA 2O8BB 1DTSA 1TMKA 2C5AA 2FWBA 4PLFA 3UT5A 3I9V1 1ND5A 3V33A 2BFCA 4JC0A 2AMLA 1ZNQO 3R0IA 3FPKA 2RE8A 4B3FX 4ZT2A 3RYFA 2Y2VA 4MNTA 4D5GA 2NO0A 3RU9A 5FPHA 5EJ2A 2AK2A 1HE8B 1KOJA 3LC1O 3VYWA 2PGDA 3L07A 4Q1BA 4WCFA 1ADGA 4J49A 3OX4A 3ZOZA 2YS7A 3OZCA 4Q4HB 4I3HA 1XVUA 2DFVA 3IEVA 1V2HE 4KPGA 4JLOA 4CCYB 1U9YA 1M54A 1A1SA 2HWWA 2Q6IA 4Q1VA 3SEQA 1WX1A 3I1FA 1HZZA 3KYCA 3PXXA 2V3CC 5HXAA 2F8KA 1DHTA 4PCAA 2H92A 2QMYA 4KIJA 5B1HA 1SEPA 3STWA 2V8BA 1TF2A 1Y8ZA 1U0EA 3TAPA 4PHGA 4TM7A 4UULA 1UJBA 1N0HA 5C53B 2VP2A 3HWWA 3KQOA 8ICTA 3IEKA 1SHZA 2EKBA 3A6EA 4HAUA 3TOVA 3UB4A 1PD1A 1KDHA 1A7JA 1SM4A 5AVXA 2IS1A 4MICA 5FOQA 1ELOA 3BDIA 4F4KA 1P4JA 3V1TC 1N2JA 2VYND 2UKDA 4N0EA 3ZCXA 4YK7A 4CIDA 3UUGA 1ZQDA 5T67A 1GCAA 3MBIA 4MUEA 1AZSC 3COJA 2AIRA 3EQ6A 2I87A 2KMLA 1GL6A 4B79A 1ZQHA 2I8AA 2GD6A 4AYXA 2R6FA 3SS9X 4JV5B 4PQEA 4LECA 2CJFA 1I3CA 3A1EA 4X3PA 4O3PA 8ICGA 9ICRA 1U0GA 2RHJA 2Q49A 1T8PA 3OQJA 4R84A 3W5IA 5I7OA 4YRLA 1W9HA 3QHQA 1VE6A 4GT1A 4JZYA 5DNEA 2O1XA 3GGJA 4YRPA 4CG3A 4TMYA 1LX6A 3JATA 1BCSB 4ZCLA 2V6JA 3VKHA 4PZEA 3WJ2A 2CBZA 4U2FA 2I65A 3GCGA 3K6SB 1GPH1 4QUBA 3RB0A 2FEXA 4OVKA 3KOMA 1IVYA 4JGIA 1UT5A 2PI4A 3WBKA 2K89A 3U4HA 3TRHA 2B6NA 2F7SA 2FLWA 3H4VA 3L02A 3Q40A 3USES 5KHOC 2E55A 2EW2A 1VFPA 2XOEA 1P81A 1WDWB 3I73A 4GLFA 4YJ3B 3TXYA 4TUSA 2D5BA 2R4UA 3IMCA 5FTWA 4FHDA 1QH1A 4RZUA 1CUBA 3W5VA 1RAHA 3LOQA 2BRUC 2ZBEA 4B81A 4PLVA 5JQWA 3AEUA 1CFZA 1UHUA 3PFGA 4DB4A 3C8UA 2GPSA 1V3TA 5LCXA 1NQUA 4RDXA 1CC1S 5GIOE 1RPZA 4CDMA 2DBRA 5BN5A 4UQLA 4BS9A 4AY2A 1F8GA 1O7JA 1XRJA 2MYUA 4RABA 3U17A 3NXSA 2G7ZA 4QE3A 5CA1A 1GZVA 3D59A 3SMVA 2C4MA 3EEOA 3ROQA 3KQVA 5KTQA 2AX3A 1JPUA 3GU3A 2NGRA 1B2RA 4YUAA 4KMRA 3TKYA 4Z3OA 4ZAWA 4IDDA 4XM0A 1QPBA 3F5SA 1MNQA 2HO4A 3MEQA 3H0EA 3RADC 4E14A 1SGGA 5BW4A 5KX5A 4UBBA 4H6XA 5ESDA 5IJAA 1BXKA 3E8SA 5CFMA 2ORVA 2O5EA 1B3BA 3W3AH 1U02A 2RDJA 4TSKA 4XLZA 4BVKA 2GD0A 5AJYA 1MD9A 3GLHE 2BCGY 4ZV4A 1AQ6A 3QW4B 3CH6A 2OOSA 1C4KA 3RK4A 3EH2A 2IOQA 1XF9A 1HV8A 1L7AA 3G6WA 4YQEA 4UHEA 4L85A 2PLFA 2BHNA 1UINA 1QTMA 2HQOA 2P65A 1RKXA 3JQFA 1U3VA 2OP1A 3LUHA 4NZ9A 4PF1A 3RHTA 4F2PA 3VDMA 5F4BA 3ONDA 4DFKA 4FKMA 2PO7A 4UUQA 2ZUWA 3B89A 4W5JA 5HE8A 4IMJB 1BXGA 1VFNA 4IDNA 1Z88A 1IHDA 2ERCA 1J0AA 1QG4A 1Q84A 1J2TA 1EK6A 3U3JA 1LZKA 1N6KA 1T25A 1UBRS 4FGWA 4C3OB 4LZDA 5KT6A 5LQSA 3RJMA 2JHPA 4AJ9A 2XMSA 4EVSA 1Y42X 4CR6A 3FCXA 4ZYUA 4F92B 1S4MA 2Q99A 2DH6A 2FQQA 2K7ZA 5D2CA 4G24A 2O6KA 3KCQA 1PSWA 1QYDA 1CRLA 4ZCPA 3WL3A 4P7BA 3W4KA 3QPVA 3QXXA 3GEMA 4YQFA 3VR5D 1WQ3A 3K31A 3P9RA 4PFJA 2Q9BA 3C4VA 4QAJA 4B71A 1E9RA 4K7JA 4YRCA 3ZQUA 1P29A 4IIJB 3QVUA 1OASA 2JASA 4RC9A 3KB8A 3LE8A 2AOWA 4QU0A 5BOSB 4TTVA 3O9VA 3N2NA 4EJ0A 3CX4A 2F2AB 4NLNA 1T9ZA 3TCXB 4ICIA 4QZ8A 5ALDA 3OLCX 5LUBA 3KP1A 4BLWA 5K6AA 3U4QA 1MHTA 4PZUA 4M7RA 3AI1A 3ND9A 4MW7A 4DC9A 1NG9A 1F38A 2A59A 1N5JA 2QXTA 3IIIA 4B3HA 2ZOSA 4HNGA 3MYRA 3WYCA 3TADA 1GQFA 2OD2A 1UDXA 3ZQ6A 2KTQA 3KT3A 3ZWVA 1WYGA 1AUQA 4YMGA 4II7A 4WKNA 3BXEA 4OKIA 1N78A 2ONJA 1F5SA 1UXKA 2VSNA 2ZB7A 4Q15A 4TGLA 3JQQA 3D6JA 1U98A 1K86A 1XRLA 4Q12A 1VIDA 5FBRB 3RG8A 5DM60 5KT5A 1DARA 1X7WA 2LKDA 2PIDA 1K06A 4MCJA 3EA5A 2HPHA 1RM4A 3CW8X 5FLYA 2MMCA 4FK8A 3KUCA 3ISDA 1ZXIA 3TIGA 1R0YA 1Z5PA 3N0XA 2XQVA 5AVOA 4F9TA 4F9FA 5EVCA 3CB2A 2VP4A 1EZ4A 4KQ9A 4M37A 4RANA 4PPXA 2WFZA 3SJBA 5DI3A 1I1OA 1NK8A 1X9HA 1KGDA 1VIYA 1BXGB 4GPZA 3DZKA 4ZARA 5J5AA 3S1LA 4LRQA 2G9UA 3W6NA 1E96A 4D3DA 4UAWA 5CDFE 4I8IA 2Z57A 5AJTA 3OGUA 2J9GA 2QUZA 4KXUA 4LC9A 4U3JB 4X92A 3VAAA 1YVEI 3TPCA 1PT9A 3QVJA 4X1KB 6Q21A 4JD5A 8ICXA 5EIAA 4CKWB 4D92A 4E03A 2G5GX 1NQTA 3OO0A 1NV9A 3LYUA 4TLLB 3SX0A 3WXMA 1JJAA 3I52A 4HQLA 5DBOA 5B37A 4P0PB 2X14A 1AA9A 3KOYA 4KX3A 5GVRA 4L4YA 4N5DA 4Z7OB 1FXWF 2H7VA 1W0KA 2WSSD 2A2ZA 4JYMA 2O2JA 3OHPA 1AKQA 1MMFB 3LRTA 4RZIA 2HA4A 1ZPDA 2UAGA 3EAFA 4EF5A 2DWPA 4G5GA 3EVBA 1XJQA 5I7SA 4EARA 4L4XA 4OGKA 4W5WA 3VBEA 1V9PA 4NJEA 2DCMA 2C2MA 1BA2A 3VI3B 1NVUQ 2NV6A 5HJEA 2RH5A 2A7XA 1ZW6A 4MFCA 2P6OA 3E3AA 1N6LA 4TYWA 2OILA 3KVOA 4IS3A 1KEZA 3VSDA 4QW8A 4P7JA 4EI7A 4DYDA 2IU3A 4DJTA 4E6PA 4BFTA 1HFJA 4EEXA 5HWSA 3OSUA 4J29A 4F4JA 4NS1A 3NUQA 1DFIA 3NTXA 4TWJA 4WH0A 1Z29A 2DMRA 1Y4AE 1Z7GA 1GZ3A 3CEJA 3EXG2 3AXSA 2DF4B 1R4ZA 4MA0A 2CFOA 2PD3A 3BWXA 3T0FA 4ZYXA 4CCYA 1N92A 1TLLA 4JT9A 5AUQA 3AVWA 2LW7A 3F8SA 5AK4A 1A77A 2G70A 1GR1A 2ZPAA 3GV7B 2OFWA 4OD0A 3FUVA 3GPDG 2OZPA 1E4OA 4U8GA 4KX5A 1GZ6A 1Q77A 3IAEA 3MLEA 5AI6A 1ZO8A 4KQIA 3GQVA 1N2BA 1NX6A 2C59A 2D59A 4JUFA 2OA0A 4FMBB 3GUYA 4DM4A 3GAFA 1EUDA 5DSTA 2YIJA 3L0OA 3JPOA 2P79A 2DPIA 4HFJA 4M1WA 3WDMA 4CG0A 2O8FA 4WY2A 2RHWA 4P92A 2DOKA 4C4TA 1AK2A 2PKXA 2AMYA 3JD4A 4NX2A 3I5MA 4UE6A 4YCJA 1RWVA 2JDIA 2H3QA 4MS4B 3SZMA 4BV8A 4PVDA 3ZJUA 3V4VB 3VHXB 4EBDA 1XQ1A 1Z4KA 3DXXA 4ZI7B 3NCTA 2Q5JA 1ZUNA 3FE2A 3LXXA 4DVGA 3PPYA 1H2RS 3HTXA 3KZMA 3WLNA 3HFJA 4FBMA 1U5CA 621PA 2XDAA 2P5UA 3OBBA 4HDKA 4MIEA 1FJXA 4U9IS 2C3YA 1I2BA 4QOGA 4BLVA 1HR0B 1NPTO 5BSFA 3UJ6A 4EHAA 3TK1A 1MXFA 3EHDA 4XM2A 2OHIA 2W6NA 5B57C 3DVSX 4JL6A 5DYTA 2C4NA 2FE4A 3C41J 3D43A 3G7UA 1BHQ1 3KSMA 4EYQA 3VR0A 1FYEA 2BFNA 4OJ6A 3EYZA 3D4LA 1YASA 3GDHA 2VCEA 3K0CC 1VI5A 3SJAA 4BNJA 4D0SA 1K7EB 4F12A 5TIIA 5EWJB 3PY8A 3NT4A 3RFTA 1TYAE 1AKUA 1GIAA 2V8OA 5JI2E 2ID7A 3N53A 3NHFA 4EITA 5F9MA 4WK2B 4OGGA 2IDKA 2FQWA 1A9PA 4UC0A 4KOAA 1JQDA 4B3TB 4KLUA 3MB8A 5JZVA 3E7XA 2FHSA 4EEKA 1R0SA 2EZZA 5HMLA 4HNSA 2FSVC 1OA0A 4PY2A 1GTJ1 3PHLA 3VYRB 3AM4A 2PQ6A 2OZLB 4V0ME 2Z6QA 1YB7A 2YC2C 4EYHB 2GO7A 3M9WA 2O54A 2GFQA 1WW2A 4LMPA 2QRGA 4ZOLF 2CLLB 1NVBA 1Q83A 4HS9A 3VZCA 3ZV7A 2W6MA 5B58C 3AIIA 2YN4A 2AV6A 4LFAB 1M1NB 1H9BA 3A1TA 1SXPA 1DBRA 5B3AA 1SCUA 3V9PA 1VBKA 1KFTA 1MHPA 3G8YA 3KZVA 4I5FA 3RHFA 4DQ0A 4J94A 3IJPA 1E5LA 4PO3X 4J2HA 4J75A 4K1LA 4FGSA 5ALTA 3BH6A 1UXJA 3GVCA 3I39X 1YU6A 4G36A 3WDKA 5KFEA 2RGDA 3TRIA 4BKUA 5KC9A 1KERA 4H7EA 2PBRA 2NMVA 3NT2A 3PW7A 1TVEA 2ZTSA 2K2WA 3FVWA 3ZX5A 4M9SA 4L72A 4OHKA 2EP5A 1OOEA 1N4AA 1IM4A 3DS8A 4YRTA 5CJJA 3U37A 2ZSEA 2PX3A 4GIBA 4ALJA 4EHIA 3H4DA 1N2CA 1GSIA 1K66A 2AC7A 2Y0BA 3CCFA 3H6KA 1VYVA 1PNRA 4ME6A 3ZCUA 2PJUA 3A7DA 4F5PA 3F90A 2ZJ8A 4FFDA 2UVVA 4AIIA 2VAMA 4EHBA 2O59A 5EYPA 3JYHA 3ZCSA 4EELA 1D7AA 3RJIA 5DI9A 5T41A 3ZH9B 1PFUA 2K2QB 4LZJA 3QIVA 2E8MA 1GTVA 4R8KA 2JIZD 3DKIA 2I9GA 1J7JA 5AKLA 1QM5A 2X22A 4W9NC 3HDVA 3X1DA 1PD0A 4KRGA 4C30A 2ZRJA 3L79A 1UBEA 4RQ0A 4DQQA 1W1IA 2GCNA 3MLBA 3KFXA 2JEGA 4YRIA 4MARA 1TJ4A 4BNHA 2D2IA 3B1XA 1U8ZA 2AN5A 1U9IA 4BMVA 1JNXX 4DLSA 1HDEA 1U0NA 3GXBA 4MUJA 4NTZA 3WLAA 4D41A 1IG3A 5B6IA 3RS4A 1CS0A 3V6HA 3LUPA 4Q1AA 3VYSB 3F6BX 1UBNA 3BG5A 2F77X 1CUFA 5GADl 3MPOA 3ZDAA 3FA2A 2B82A 3N6XA 4QUAA 3VR4H 1W75A 4JLBA 1N5WA 2AQ4A 2GNOA 4G67A 2C2RA 2HF8A 3COWA 3MR5A 2QTBA 1JHXA 1KR5A 3JPRA 5BT9A 2YFQA 3DCNA 4LHSA 2P9CA 2QUHA 1UQUA 4RADA 2A1JA 2H4YA 5HMMA 2DHCA 2ONCA 1OWPA 3CPJB 3H19A 3K3PA 3TCKA 4COKA 1ZMBA 3C1OA 2QRMA 1ZD4A 4FHGA 3P5BA 1KZHA 4B3DA 1VSBA 4JUZA 2RBGA 3GGSA 1IG6A 1L5SA 3H5VA 4PGHA 4YIKA 3RB8A 2Q07A 1G5IA 3D64A 1ESDA 4M9LA 1MN6A 4N03A 2VBCA 3DEJA 5JAIA 2IS4A 4TYPA 5IRCD 4G8BA 4C4PA 4FILA 2R1TB 4GPAA 4HX5A 4EY6A 3Q4GA 4QSHA 5C18A 1DQZA 1ODTC 2QMEA 3QX9A 3GI1A 1IQUA 4Y8VA 4ZO8A 3ZHTA 4BNGA 4DL6A 1PJCA 1M5UA 2H1IA 3GEGA 1IC6A 2XTJA 3AILA 3IHLA 3K4HA 1JLKA 5K4GA 1F7UA 4WN9B 4DMFA 5K3OA 1O2DA 1KRPA 1ES9A 3JYQA 4DFPA 3JCZA 3L82B 3QOFA 4DJJA 1XHEA 2GS9A 1DIGA 5CCXA 4RSMA 4YLGA 2E9SA 3QOYA 4G1UC 1NDUA 3E7FA 1TT5B 4HDMA 4R9SA 4P86A 1CR4A 2MINB 4FYYA 1Z36A 4URYR 1H1TA 3H2KA 3JQ9A 1VKHA 3ZHYA 4J7CA 4W8OA 4RTQA 4Z0TA 3AQEA 1SUWA 4M7WA 2YWXA 1QZTA 3QUAA 1HYEA 2DWQA 2NRXA 1OH6A 3QNUA 1JEAA 5K6TA 5KTOA 2I91A 4PHTA 2CV0A 4B5LA 7ICTA 3RF7A 3LSYA 2IXGA 4BWYA 2BTEA 1TRKA 3AP3A 3I3SR 1NATA 1SKAA 3OCYA 5KFQA 3AY7A 4XJTA 5DQIA 1LPMA 4GOOD 5TF4A 5KOHA 3ZXUB 8ICVA 4O4LF 2I5HA 1JHYA 3KWMA 4LF6B 1HOXA 4WZ6A 4P4LA 2P4HX 4Z6DA 3FLEA 3Q6MA 2X5OA 3HQ4O 3PYXA 2PANA 4W99A 2Z09A 3QEAZ 4KB5A 3WHIA 4HPXB 2J48A 2WYVA 5J2FA 4R8RA 3DMTA 3RS2A 1G8HA 2PRZA 1TGYA 3A9CA 4L9WA 4MO2A 1EWTA 3B78A 4BLUA 1KLNA 1U11A 5BP7A 4AKIA 1ZOIA 1WXEA 1H42A 3CZRA 4MUGA 2ZYTX 4U00A 4GDMA 1C7JA 3OZBA 2HU7A 1MT0A 1Q92A 1QG0A 2IJGX 3C6BA 3WYGA 5CXQA 5JVDA 2J87A 4IWNA 2BGNA 4K9PA 3S5JA 1KL7A 2BM0A 4YRRA 1DFHA 1I01A 4PSAA 3AGPA 4Y2UA 3FTNA 2D6FC 4L5IA 5K3FA 4KQMA 5DZSA 4RTLA 1R15A 5IAEA 5HK9A 3WK5A 4LF4B 4B9MA 3DXYA 2FVYA 2FZEA 3HADA 1VCIA 1U1EA 1LBTA 2HCRA 4ZVRA 3BQ9A 4DLYA 5E95A 3B2NA 1RXYA 4Q6WA 4KXXA 1N7HA 1ZLXA 3F2BA 5BOVA 5K2MA 4XLTA 4BNLA 1E5XA 4BMOB 1RI4A 3DNPA 4CUKA 1DQSA 4TMFA 1Z2EA 5IJ9A 1Y4SA 1EQAA 3CH4B 3EIQA 3GG2A 3MGCA 1MPXA 4DNOA 1TMOA 5AKEA 1KETA 4UCXA 3EXIB 4E09A 1KVRA 1TCUA 2V7WA 1DX9A 2RGWA 1PK1A 3IDOA 4LF9B 2BDTA 1XMSA 1LD3A 3PS9A 4FJ2A 2ZIUB 1XWFA 2P9ZA 1NNUA 2QARB 5F2EA 1ANKA 1YB2A 1WR8A 2D0IA 4I2AA 4QUGA 5IH3A 5BXYA 2OZVA 1NLMA 2IUTA 1U0JA 4L8VA 2J9ZB 2ZUVA 2ZR8A 3SAGA 2XNKA 2BKUA 2YQ4A 3DOFA 2I78A 2V7QD 3EBOA 3N2KB 3QH4A 4QBFA 3ULKA 5JDIA 1P9OA 1X7ZA 5KAFU 1LDEA 2Y1OA 4MEXA 3AFHA 1DRKA 1G291 5EP2A 1RU3A 2PO5A 3MGKA 4WK0B 3IX7A 5DCUA 3T06B 4ID3A 2BI4A 5IBRA 2BR0A 3WK8A 2I2BA 4EG5A 2XGPA 2XCQA 3SDBA 5FHRA 3UMBA 3TGWA 4CV1A 3KHHA 3LPNA 3MQFA 3OSPA 5IXJA 3GQCA 1WU8A 4F3CA 1E7QA 2G07A 5D3MA 3T7IA 5HGJA 4R9VA 4IIFA 5A4DA 1RE1A 1FYDA 1XNHA 2WAXA 3DL7A 3W5UA 1UC4B 5IDWA 4KIWA 4RY2A 4UNPA 1F8UA 1RLUA 3GLRA 1CUCA 4ED1A 4KXYA 1ARZA 2PRYA 3NTLA 1YJ5A 4LRXA 1OVMA 2BN4A 4UNNA 7ICPA 3HDJA 1NVVR 3CU5A 4X85A 5FRDA 2QR3A 1FZQA 4LTNA 5NLLA 3KFUF 3LF1A 5CT8A 3K6KA 1CT9A 2WHXA 3CO0S 4RD0A 2WMNB 1DRWA 1MRSA 2G4CA 4BWJA 2Q2OA 4PN7A 5LJLA 3M7DA 2VBIA 1N5XA 5E3JA 2OAP1 1WO8A 4RS3A 1ODJA 2Q1WA 2G9ZA 2HXYA 2X13A 2X5NA 4OLFA 2H1SA 3K4PA 4ZU6X 1OV4A 3JPYA 3I6MA 4BVGA 3KQHA 3WK9A 2I6SA 3Q7EA 3ZEIA 2GJSA 2YHBA 3K2EA 2KFZA 4C80A 1RRVA 1N2ZA 5KHAA 4BWVA 1LJUA 3RSGA 4P9NA 3I6ZA 1N1DA 5K3FB 3EWNA 4XFJA 2P30A 4FGKA 1NI4B 4NOJA 3AUAA 4RFLA 3WO1A 4YJ3F 4R0VA 1XEWX 4FYWA 4E13A 4BVAA 1TW3A 1F44A 1VRWA 3N76A 4P22A 5U1PA 3ZZMA 4IYJA 1CI4A 1S96A 2DBYA 1AHPA 3HYTA 1CQIA 4QJFB 3OFND 3P2KA 3RC2A 2GXUA 1Q7EA 1QVZA 1PVRA 2PTHA 3GRVA 2AF3C 3RWBA 3WQHA 4II2A 3ZNQA 1BH2A 3HXLA 3W0LB 3DZGA 1MGPA 3PNBA 4E0DA 3TZLA 1J90A 1GGJA 2GUGA 4KQJA 3T94A 4UPVA 1ZQIA 3I61A 2W3RA 4G9GA 3THRA 1D4AA 3V7UA 4H7PA 4QDXA 5C8YF 4O4HA 1WB9A 2GARA 3PFIA 4Z1MA 3HCRA 1E2PA 1ZGAA 4DL2A 2EX4A 4IDOA 5JQGF 4ZMBA 2H9YA 1G3QA 2Q6KA 3JQBC 1SXJB 4RNOA 2F67A 2MAXA 2OBBA 4ZAYA 1OMOA 3K9CA 2BGTA 3NIGB 3PQCA 4IIBA 3TQTA 3IVXA 4IZHA 4K6MA 5GJWC 4D8UA 1CE8B 4UMDA 1T5LA 3G8AA 1X7XA 3MWYW 4YRQA 5CDYA 3IFSA 1KIAA 1CJSA 1XTJA 3L7NA 4I2HA 4OKNA 4Q48A 4PX3A 1R6BX 2W9MA 4YMIA 3MRSA 4REOA 1A76A 2IGTA 2IIVA 3WYEA 2FRVA 2HAEA 1MJNA 4TV9A 1J0XO 4RQMA 1EXNA 3M9MB 3MCZA 5KNBD 3GIIA 1I4OA 1YQXA 3UJ9A 4YD2A 4AQDA 1X1TA 1EDEA 1ISJA 4OYHA 4G0ZA 3HNRA 3C85A 1RC1A 1O3YA 3H1EA 2C2KA 5KKNB 1JXAA 4Q47A 2P2DA 2IUSA 1F4PA 3TDKA 3OUZA 2CKDA 4YMVA 2Z95A 4FW9A 1CRXA 5EC8A 3QYFA 5LSAA 1Y6FA 1DC7A 1G8PA 4NPHA 4UEJA 1RZVA 2HD4A 1SCAA 3QPAA 3ZVLA 1I1HA 1JX4A 1I9GA 1LSOA 3R9XA 5GTHU 1K6IA 4GOXA 4EF6A 1H66A 1XRSB 1DTEA 1XCJA 2OD9A 3R74A 3K4QA 3UMJA 2XSZA 2RKWA 2Z9DA 1NDHA 2ZTMA 4ZYWA 3L4EA 2Q5LA 4LOHA 2M98A 2FMTA 4B5KA 1Z73A 3IIKA 4CN8A 4YCCA 4AO8A 3U09A 2J46A 3GD5A 4PXYA 3U4CA 4L5BA 3PXUA 4AZVA 1KFJB 3ETRA 1C0PA 3DDWA 4XPIB 4J3NA 3WLQA 5BWLA 5KJFA 1C1XA 5DSXA 2IPAB 2H51A 5JHHB 3REQA 3ADDA 1QGED 1VXOA 2MYTA 2QDXA 2ZRCA 3BRWD 1VJTA 2W8BA 2FN8A 2X8LA 1L4NA 4LV5B 3VOAA 1UBCA 4ZIRB 2WAAA 4REQB 1C8KA 4IR9A 5L6MB 1TTHA 1OLXA 2EGGA 2JJ2A 4B9VA 1P3DA 3E9NA 4JT2A 2PT7A 5KT3A 2FN3A 1DS6A 1R8QA 4QVGA 4K6HA 1O0CA 4B7CA 2D3TA 3I0ZA 4ENUA 4I2CA 1E66A 1R0RE 4OIMA 4UHJA 5AR1A 3F1KA 3EGCA 3QBVA 4K6KA 5FLXA 4DSUA 1HNZB 4ARIA 5KX5B 5TGDA 2VR1A 5ED0A 1NW4A 3OE5A 4KRYA 4RF2A 3SM9A 5EPEA 5IYZA 2J8ZA 2CFSA 1M1NA 3LUFA 1YC2A 3FPFA 5EUCA 3T5BA 3BL6A 4Z5XA 1JWLA 3BQ0A 1KNQA 1SD1A 4LK3A 5B7PA 4F3OA 1CF2O 1MDFA 4J16A 5FA6A 1NRIA 5CEHA 3F78A 3SFTA 5M34A 2LCQA 2W8LA 1ZH4A 3S2GA 3INGA 1Y81A 4YBZA 2VEDA 3DHNA 4TUYB 5JO0A 1OIWA 4HWOA 3K9BA 1WXDA 1Z13A 4FX2A 5EJGA 1Q2XA 3IT1A 5AK6A 3BXGA 3M9XA 3IS3A 3T4EA 5EIEA 2FV8A 1JEYB 1KK2A 1QFXA 1COOA 3TEMA 2IYWA 1HT2E 4ZRMA 3ZU4A 4CTMA 4ZC8A 3G02A 5D51S 1N2OA 4XIYA 1YE8A 3RLFA 3ZWOA 1Z07A 1XWWA 5JLJA 3KT0A 3U7QA 2CBGA 5FJIA 1NM5A 3T15A 4AI6A 4K4GA 1TZJA 4N47A 4HDMB 4CU2A 3WISA 1IBMB 1FNSA 3V7LA 3X1ZA 1J23A 4F06A 1OGIA 3IC5A 5K0NA 4DR6B 2WUEA 4EI2A 1RQRA 2Z8XA 3GJZA 5JWHA 3AL3A 5SZJA 3NVMB 3CSSA 3QFFA 4OHZA 1V3QE 3GFRA 4PGAA 3TSCA 4ENQA 4PRYA 5DK4A 2P67A 4PXSA 6AT1A 2FRDA 4RQUA 2HBZA 1L7DA 2Y66A 2YBDA 2CSUA 3H2IA 1J25A 1OPRA 2NXNA 1NASA 4F4HA 5EP3A 2KX7A 3QU7A 2RK4A 3DZCA 3MVEA 4QUIA 1OFIA 4X97A 2FY8A 2ECKA 2IK8A 1K5PA 3K32A 4KHPB 2HLDD 1LVHA 1VKRA 3UJCA 2VXOA 4E94A 3QEMB 2DHQA 4NNOA 3RRGA 3RVPA 4C4ZA 3B2EA 2HHWA 3GRRA 5DH9A 1AK9A 2J3EA 4IHJB 4DV3B 1EJ6A 4BFYA 1E9VA 5DMHA 3LLMA 4QGFA 4R2HA 4ZCMA 4J0QA 3QXGA 1MORA 1UWKA 2KP7A 3BA1A 4O2LA 1ZQVA 4RQ1A 4PLHA 6PFKA 2W5UA 3SQWA 4HYEA 3N8HA 1NBIA 1HYBA 3WE7A 2C7QA 4RHFA 2YN2A 3BRWA 3A28A 2BQ3A 4O3SA 3C16C 3G1UA 3PA8A 3G2NA 4GHWA 4HAWA 4JP1A 4LJ4A 1Z56C 2HA5A 4MYSA 4RMGA 4Q9IA 3V34A 1M73E 2HMVA 1YQQA 3FCYA 3V6LA 3WLFA 1P9WA 5HKBA 4YB8A 1NVDA 1G21B 2R60A 1KNXA 1TZBA 3HDHA 1MQAA 2W6ID 2R6HA 2CXRA 4G84A 4UHHA 4C4RA 8ICNA 3B0XA 3DO8A 3TI7A 3ZV4A 5JISA 3MFHA 2ZI3A 5K8CA 1CUWA 4IWXA 2O20A 5I6DA 4LYYA 1XOIA 4A6DA 5AKYA 3STVA 1Z9BA 4HWTA 4O5KA 1W85B 1HEUA 2QP3A 4DIEA 5BWBA 2JAHA 2QRVA 1ZAYA 2ZZNA 1PK8A 3C3MA 1Y34E 2FZGA 1O94C 1N7JA 2W9CA 3IQFA 5JROA 4IOMA 3O4IA 1PWZA 3L4SO 3KEFA 4DWWA 2ZW9A 2H2HA 2JGDA 4J7AA 5FF9A 1YI0A 1POWA 2YJ3A 1OBFO 1SU4A 1T3ZA 2Z5VA 3A7EA 1CRQA 1JZSA 2X41A 3PQ4A 1DUSA 1Q17A 2B2XA 1IZ8A 1UZAA 1CQIB 1A2KC 2D8MA 5JSZB 5K6RA 3L0IB 2QU7A 4NVRA 1GM5A 3SSOA 4UHKA 5I3CA 1KYIA 2JLVA 3ONFA 4KLEA 2AFRA 3ODPA 3QEKA 1QQBA 2CFRA 4G0QA 3GVIA 4I55A 4NSNA 5EAIA 4ON9A 3HXKA 5BR1A 3A10A 4Q1CA 5AVYA 2QSZA 1FVHA 4YMLA 3G2IA 4C7VA 2PXIA 3EK2A 3FVVA 1J8QA 2HY7A 3KL2A 4KMSA 2A0XA 3AU9A 2PHZA 3SC4A 3VV2A 2CD9A 5FH9A 3GDXA 1QSSA 1GN9A 2KJ9A 3ROFA 1RT9A 2WD7A 3NRBA 1IQ0A 1ZXXA 2WD9A 2CYAA 4X1KA 1IXSB 5FWNA 2XZLA 3R7BA 2IYLD 1CPYA 2GAJA 2O50A 3SQLA 3F3MA 1OI2A 2OCYC 2GJAA 2QMOA 4QPPA 4U39A 5CYFA 3ECAA 3E0QA 2IYOA 1ZETA 3HKZF 1ZP6A 1PDVA 1TFUA 1K3TA 2QD1A 5DYGA 2O8DA 2XBUA 4R5HA 2DUWA 3ET5A 1EFTA 2A0WA 1G41A 1GR0A 2M2IA 4MFFA 4ZA2A 4B8WA 4Y3UA 3RRBA 3R0XA 5E9JA 1Z5OA 3W4JA 2KSQA 4Y6GB 2HQ1A 4PLTA 3MOGA 3ISVA 3QW2A 3D3WB 3NRCA 2AHRA 2VAWA 2ZAYA 3CRVA 1VDMA 3N8KA 1VDVA 4JLDA 2O7VA 4Z6KA 1QORA 3DKVA 1OI3A 2Q1UA 1FLVA 3KNZA 5DHSA 3WJ7A 2CNLA 3G1TA 1NRJB 4G5OA 3ZGXA 3QF4A 5CFLA 1OWLA 5DHAA 1YQWA 2B25A 2X15A 3F67A 3HRKA 5FFFA 3PP8A 5D3MB 3WAJA 4J07A 3FOWA 4Q3OA 4Q4AB 4XVQA 2QD2A 2WFMA 4I5EA 5JTTA 1KQOA 4XIJA 3H2SA 4RA9A 10MHA 1Y8AA 4ILEA 2QV7A 4ZI7A 3BPSA 2ZQZA 2BSQA 3S8YA 3C7CB 3KSUA 3BFXA 4QWCA 4WK6A 4UTOA 3LTNC 3I45A 3WVNA 4IO1A 4DA6A 5B7QA 3V2IA 2OXTA 2W6CX 4X24A 3PX4A 1D9ZA 3HP4A 1UKZA 3RT1A 2XNDD 3N7SC 1EUDB 1VLMA 1EKXA 3P4UA 3Q85A 3ZDZB 1HDGO 2YZNA 3SHTA 2V0NA 2A9OA 1HLPA 4QJIA 4R9RA 3PSAA 1W1UA 2NX2A 1XTRA 3DTTA 3PF8A 4P36A 3EGEA 3UJ7A 1U9ZA 1EUQA 3EZ5A 3DP7A 3EARA 4R54A 2QRPA 3WLKX 1X15A 2G1KA 2KSOA 2OXRA 2PRSA 1XP5A 1T8UA 1V47A 4L74A 5TPZA 3HNOA 2YR0A 4D56A 3MJRA 3ZNNA 4OEHA 2V6GA 5A9TA 5KO2A 2N1RA 3L93A 1AROP 4KLDA 2VJMA 3D8TA 2OY0A 2HEIA 4R2IA 4MKRA 2XODA 3OF5A 3Q41A 4M1ZA 1SB8A 2AOTA 2FMFA 2XRMA 4HX2A 1UJMA 2HJSA 2PGLA 4YDSA 5EGSA 3TQSA 3ZIAA 1FF9A 1E2UA 1PU2A 2BPOA 3LSTA 3O2JA 4E46A 4GI3A 5CAEA 3K1TA 5JYEA 4J9MA 3TLMA 4BX2A 5JS8A 4IMPA 1ZR2A 5EIWA 1MJGA 2QN2A 2CXOA 3KJNA 1B1AA 2YJNA 3EHEA 4HEQA 1HSZA 4L9RA 2JCYA 4IQ8A 4MVJE 2JH3A 3PVSA 4CYMA 3BWDD 3L9WA 2ZRFA 3OZRA 4K9QA 3SZUA 4ASUD 5BNZA 2ZJ6A 4XARA 2KMDA 3ANSA 4R1LA 4G1FA 2XBMA 1Q46A 5IM5A 5AJVB 1O97D 3NKVA 3GWGA 1EX7A 2FZLA 3O8RA 3VH4A 1QU2A 2Q9CA 3JYOA 1E2DA 3H2HA 1MTOA 4YONB 1L4FA 2GFHA 2BDUA 3LT4A 3U7EB 4I9UA 4BQRA 4OB6A 4G2TA 4ZCTA 2I4IA 3FDZB 2HSDA 1W2HA 3QXCA 3TW0A 5I7FA 1FFCA 3OP1A 5TF0A 2BMAA 4H2DA 4ZAXA 2FSSA 5CIQA 2YVLA 4P0TA 3TLEA 2BZ0A 4I2IA 3KLMX 4OHWA 3GHYA 4LX0A 1F14A 1QFSA 3H1BA 3AT1A 5HIMA 3WZ2A 2QA5A 5IC6A 4KH1A 3SIRA 5JI3E 2C9OA 1DIBA 3ZY5A 3ZGLA 3PO5A 2A86A 3UUFA 4L6CA 2XJ4A 4DR3B 5F21A 4Z7QB 5A02A 4RJLA 5A3SA 4UHBA 1GRRA 3HL0A 4BO3A 4YIHA 1WJGA 4DLNA 3ZHBA 2CVQA 1GVNB 4OK6A 4NM1A 3MHPA 4AVYA 3H13A 5IFKA 1WP4A 2ORYA 3W6ZA 4IHJF 4UM7A 1JR3D 3DG9A 4IG4A 1C7FA 1P33A 1ECWA 4BEWA 1TQ4A 3FBTA 1I2CA 1PTJA 2JRLA 5GTDA 1SD2A 1TAMA 1LRLA 1YTLA 2JL1A 2HDOA 1ENOA 4PW0A 1BTOA 5A4JA 3EMBA 1YKFA 3TZCA 8ICPA 3GRZA 1BS9A 1JQJC 3NR2A 1LU9A 3OCVA 2QM0A 3G89A 3OF3A 4I8DA 3RVQA 3OQHA 3VAZA 2WWYA 3CY6A 3D2SA 1KBOA 2C31A 1X14A 1AB5A 2W0MA 1P4GA 1MDBA 2FE1A 3A1WA 3I1YA 1WSDA 5KS2A 1CY0A 1TK0A 1GHTA 3H8SA 3JPQA 1EFHA 3LQYA 4HQOA 4IOJA 1TRHA 4WLOA 3AL0B 5FD8A 3R7NA 4BP3A 3EGDA 3VVMA 4DHWA 2F43B 1HUZA 4PZCA 1TUBB 3LAWA 2OC9A 3C7TA 3LJKA 4DBZA 3T5DA 1JIXA 3QHPA 1T6YA 4C4OA 2PA0A 4NCBA 1YULA 2OV4A 2HRQA 3FX2A 9ATCA 3AV0B 9LDTA 1D0IA 3UKJA 5FFMA 3GEHA 2AQHA 1IN8A 1LVGA 2QKQA 3DD1A 3RIEA 3T5MA 4TURA 1HE4A 3DVLA 4Q01A 4RVUA 2WJPA 5TS2A 1WS6A 3NZEA 1DG3A 3PFFA 4WNYA 4JWTA 4C1NA 5KOYA 1CJTC 3BCUA 1L4BA 5CLHA 2PNJA 3ZK7A 1IXZA 1GZ5A 1KJ8A 1KSPA 1FFGA 1UMBA 2WSMA 4WASA 4CIYA 3JRXA 9GPBA 1PJ4A 3PR1A 3RK0A 5K8JB 2JRCA 3E4DA 3CLKA 4R5MA 5CW1A 3JZMA 1XA0A 4GWGA 2OEPA 3OIFA 1OX4A 5DM2A 1TA0A 3ZZUA 2I7XA 2BQUA 3MD0A 3E9QA 4L0DA 1MAWA 2ASEA 3FGOA 3PLRA 2VPTA 4F46A 5DG8A 1SQ0A 2QENA 3WK4A 2PSEA 4JWMA 2XGMA 3SLKA 4K9RA 3GGPA 4JOQA 1LLDA 3C4QA 4ECTA 2HJ9A 4JHXA 3L6UA 2Y1CA 4KTQA 3OY7A 3FPLA 3E9EA 3UKOA 2C1XA 1SKRA 2FZ4A 2I1VB 3EOBI 5BY2A 2FEMA 3RIGA 2BTQB 4H7JA 1ML3A 1USVA 4MIOA 3SQXA 1CRPA 2B7LA 1XD9A 4ODIA 2O8CB 2IHBA 1VECA 2BFDA 3F74A 4TV9F 1SQ6A 1TD1A 2E37A 2W7TA 4BEBA 3CYMA 1J39A 4ZI3A 1R8YA 2QRHA 1EMDA 3TVYA 2H1LA 3RV3A 4EVRA 1AMOA 5F9HA 1C0KA 4PRKA 1HIWA 1N36B 1N61A 2WTAA 4YI3A 2FQXA 4GMGA 4M9JA 4PHPA 4NCKA 2ZTLA 4P8RA 1Y6GA 1C1YA 1OPXA 3HYNA 2D4HA 1I0IA 1W35A 1JA1A 1P1IA 3C97A 2WI8A 3ESDA 4HQ6A 2Q3CA 5EINA 3SIPA 5B3KA 3NEAA 3RKSA 1YR9A 3VU1A 3NUZA 1RQ2A 3G0IA 4B84A 2Z4SA 4BNDB 2WJ4A 1JR3A 2YMQA 2ZDHA 2AI1A 2QPLA 5D1HA 2Q7DA 3MS7A 1JU4A 3FIUA 4GZ6A 4TT3D 3GJYA 4BLPA 2AFVA 3QWAA 4ZCQA 4AF6A 2BHRA 2DLNA 3BHNA 4HYKA 1D6NA 3PEYA 1P5ZB 2DJ5A 5KREA 2ZRGA 1PRYA 4Q5IA 3NANA 4RHCA 1V8FA 3KXDA 4GXIA 1BCRA 1OLSB 1QIHA 3RUAA 3DB2A 3FMGA 4RVHA 4D1YA 3DAFA 4P6VF 1KC3A 3RQSA 4POOA 3N8NA 3UQZA 1ZI9A 5LU9A 1OAKA 3DB1A 3L43A 4RTOA 4DARA 4AG5A 1PL7A 1P1CA 4TTIA 1CJUC 1UH5A 3UK6A 5AQ1A 2UVWA 4N49A 3PTZA 4D43A 1KEUA 1ZOPA 5KTSA 2PZLA 2C2GA 3TSWA 5AVUA 3P9QA 2FGJA 3K09C 4X65B 3Q7QA 1DJMA 4PANA 1CY1A 3PXGA 1MQSA 3Q8PB 1ZISA 3OT5A 3OHAA 2CLCX 3B6JA 2QQ0A 3D1VA 4FX5A 3A1VA 4L16A 4QO7A 3QKTA 1NGSA 1C1DB 1R0BA 5AUOB 1UJ5A 2QZ4A 3PHCA 1E9DA 3EFBA 3NWBA 3E3OA 5CK4A 2VBGA 4F4CA 3FUUA 4NMMA 2RB5A 1ECGA 5KMGB 3FDIA 4B1FA 1Z4PX 2GCIA 4MZXA 1Z7WA 2HTFA 1KMNA 4HRXA 2ECQA 1U0SY 2VVTA 1DK3A 2H3EA 3KZOA 2JKYA 1RE0A 2P2SA 4PS0A 1ZK1A 1GUAA 1LPOA 4MS4A 4WACA 4XR4A 2FZVA 1A8SA 1DSSG 1M0WA 1QOQB 3RVSA 2A9JA 2AVNA 3G17A 5KL1B 3AM5A 1E3EA 2COKA 3KDAA 2XUHA 4KUEA 3STUA 4C05A 2HHUA 3M4JA 3MAAC 1S3SA 3NHKA 5BV1A 2C92A 3CW2A 4ZU3A 3R0ZA 3B5IA 1FLDA 2C5HA 4O4IA 3FYTA 5TVKA 3ZHZA 5J47A 2AW3A 4D42A 3IJRA 3UJNA 1CK4A 2REQA 4V03A 4MHSA 2WTUA 2ODGA 1I4EB 3FY4A 3HU1A 2P68A 1KJYA 1DPFA 4GC6A 1NUQA 1PUXA 3B13B 4MWGA 5F4ZA 4TYYA 2G1UA 3T4PA 1VGQA 1HURA 5DO9A 1NAHA 3GCXA 1YVUA 5TV2A 2BP7B 3OMLA 1KARA 3PXDA 3U7QB 5B7GA 1RZRD 3ZVKA 1W6UA 2NOAA 4DQPA 2JATA 4NR0A 4RJJA 1A7KA 4DMRA 2I6TA 4OGFA 1XAIA 3Q3HA 1OXVA 5I4CA 1BGXT 2PWZA 4CLOB 4E21A 2EF0A 1FFEA 3PKJA 3VU0A 4WFIA 2G08A 1K1EA 1G3RA 3D1JA 1Q0PA 2ILVA 3FN4A 5KFKA 3CC8A 2GRUA 1SKSA 3PF9A 4CCAA 3MF4A 2FEPA 1E0JA 3ML1A 2GAFA 2X4IA 2YJ4A 2Z8ZA 1FQJA 3GK3A 1SIWA 4H7HA 4I9NA 4UXHA 5I9NA 5FOVA 1JRPA 4K8OA 2WB4A 1XZGA 3HG7A 3HRIA 3QM1A 2RQ5A 4L4SA 4QYWA 5LJIA 3QU5A 4MWEA 3ZIDA 1FE8A 1F2VA 1BS1A 2RH9B 1S1MA 2ZRIA 3TS1A 2W2LD 1WHSA 3I9JA 3A25A 1ULUA 3MGVA 1RIIA 1T6ZA 1V8OA 4Q1FA 3DZBA 1FFYA 1RYFA 3DMGA 1CUKA 4TL9A 3C3CA 4NM2A 1QX4A 5HQJA 4HNAA 4IZOA 3FMIA 5LXTF 1ORVA 2YQ5A 2J7PA 4I1RA 4JEUA 2E5SA 2BZSA 2ZR9A 1LLFA 3NHPA 2ZIWB 2J6TA 2K6GA 1EQ2A 3VPHA 4BFZA 3TQIA 1TQ6A 2G5CA 5IS2A 1L2TA 2BFOA 2FW9A 5AICA 2ZKIA 3ZLVA 2C54A 2J5RA 3A05A 3KWJA 4LYFA 1WQ4A 3HYRA 4IDFA 4X63A 5DB9A 4B3MB 3U0VA 4YMMA 4H0FA 4LNAA 3BXFA 3X1YA 3K70D 1Y8QA 2DKZA 2C77A 4FUTA 1DB3A 1L1RA 3NDJA 4M9HA 5KKCA 5KQPA 2AK3A 3N2YA 4YWHA 1TCVA 2R6GA 5JNVA 3ZK9A 1QP4A 4KQKA 4MROA 2O3QA 1CUAA 3OP4A 1ODFA 3OM0A 5T3UA 1XALA 3WKAA 2B20A 1SUAA 3OAAA 4DY4A 3PX6A 5CH5A 1E94E 4OPMA 3GIDA 4I1IA 5IT0A 3EVCA 1RVV1 1Z06A 5FI5A 4QZAA 2E4XA 4M8KA 4NPCA 4P2BA 4UDOA 4WA7A 5BWCA 3KB1A 5L45A 1KI6A 3GJQA 1QF6A 1QHIA 3KPYA 1WPRA 2FUCA 4QYXA 5F5NA 5ADUS 3T5AA 3NM4A 2AJ8A 1C3EA 5JUMA 2D8CA 2WB1C 1JEOA 1XTUA 1BG6A 1ZQZA 1SXJC 1P9RA 2R1VA 1Z7BA 2VF7A 3RHZA 4C21A 5JHGB 3PNKA 3ZWYA 1JIHA 3V3TA 4ZC1A 3HKCA 3Q12A 2X0DA 4IILA 3KHLA 1DUVG 5EWEA 2QN1A 5ALQA 5EY5B 3SG0A 2R8HA 5KFVA 3GFTA 4FE4A 1RVDA 4DM3A 1MB4A 4MI6A 1DXYA 4LF8B 4R8UB 1RWPA 1U2ZA 4HADA 3T3MB 1S2IA 2GUWA 2BFDB 2O2IA 1CQJA 1XZCA 3GFPA 3G2HA 1PQYA 3DOEA 1L4LA 1NVAA 4MVJM 5TT1A 1YS6A 3SICE 2JFUA 4CLXA 2DJIA 3KR0A 4I3GA 5I4BA 1TO6A 1Z34A 3M1LA 1S8FA 2Z30A 1Z08A 5H7XA 4LWPA 4RYDA 1EA7A 2O5VA 3QEOA 4KLCA 4TQUS 2IL1A 4X6XA 2V6IA 1G6HA 2QSYA 4TL8A 1DDIA 5KSYA 1YIAA 3KAPA 3PUZA 1AURA 4X90A 2XTNA 5CNMA 3HXOA 5IK2A 4LY0A 5ALIA 2PEZA 2FW1A 2P3LA 2W70A 4XA5A 1MX5A 1HL3A 5DT2A 3S27A 1QO9A 2M32A 2X8BA 1F9EA 2PZAA 4TOIA 2C4HA 2JH1A 1JQLB 3KOZA 5L1KA 3GUHA 4A0QA 4R1QA 1SUCA 3H42B 2QYTA 3LHSA 3H5RA 4KLIA 1YJAA 4LDRA 4LYHA 3C5HA 4P32A 1VJ0A 4BX0A 3NG1A 4WPGA 3NATA 3PW0A 2YV4A 1N6NA 3S7ZA 4OQMA 5H9VA 3VDNB 1B8UA 2WTXA 4QWEA 2BGMA 3FB1A 1NI3A 4LHVA 4O02B 5FCDA 3AVYA 4KZKA 1GTZA 3L8MA 4KKXB 2QP9X 3VPDA 1D0SA 1YS7A 1QRAA 5KG6A 4GSLA 4JA0A 2ODNA 5IVHA 2NUPA 2QLJA 4G0YA 2WM2A 3TFWA 2CXSA 3Q1LA 3LQ4A 3ISBA 4LOLA 5JZBA 2B35A 4ZKEA 3THOA 1K08A 1ST3A 3BMCB 3N7TA 1FC0A 2ZSFA 5BVHA 2JIPA 5KYYA 4YRJA 1P2BA 1NNEA 4GQAA 3CLUC 3PCXA 3X1WA 1UM9B 2GCOB 3C3BA 2CB0A 2BEUA 2Q2VA 1Z8DA 2YDXA 4A8PA 3U6BA 5A03A 5KL8B 3PD1A 4FC7A 4YQWA 1AA6A 5KFLA 3MHTA 1K97A 4QXAA 3X0DA 4KR0A 1IU9A 5HPYB 2DFPA 2Q1XA 4JOBA 4J1QA 5KSZA 3S55A 4G5SA 4HOYA 2OHHA 5U4XA 2YWBA 2JIDA 2W4IA 3L1KA 3SCZA 4YV7A 2F8MA 5J4KA 4MF8A 3L84A 1U6IA 2OZKA 1U8XX 3H5NA 2Z1NA 3L1VA 4LY6A 4L15A 1JG6A 4I2DA 3ESRA 2DQNB 4NL9A 1E7SA 3TFQA 2E8NA 1B1CA 1BX1A 2Y0SC 4GDFA 2E4YA 3HDQA 1VE5A 3JZAA 4DC1A 5JY6A 5ALZA 3OTQA 1QGYA 2J6CA 2ZPUA 3SQOA 2NN3C 3TE7A 2WWXA 3IDSA 4HQRA 7ICVA 4QYMA 4Q02A 4OLAA 1JNYA 1ZCAA 1M2JA 1MCZA 1T9BA 5TR9A 1F0MA 2ETXA 1SKWA 3RB6A 4BMZA 3JASB 1RKUA 4ED0A 1EK0A 2ZT5A 1A0PA 3E7PA 1P9NA 4XUSA 1GQQA 4MRMB 4RKQA 4B2YA 4UUMA 3D6NB 4GXNA 2QRVB 2X9NA 3PUVA 4OSEA 1B16A 4D3SA 2L2QA 4EFDA 5DNYB 4LNUB 2CZCA 3AOEA 3E3NA 3ISCA 4HB2A 2IP1A 2HT1A 4PAMA 4D0RA 2VEOA 3KZIU 3CG4A 3C2KA 4UQOA 5EZYB 4CRXA 2P4SA 4JLPA 4B4DA 5JH7A 4P3PA 1Z4QA 4D98A 1PK1B 2O3TA 3GA5A 1JQEA 5KYYB 1ZM7A 4ENPA 3NOOA 2W4MA 4Z9XA 4RK1A 1XTPA 3ED1A 5HDBB 5G0UA 1EA5A 5FJJA 1V9LA 3GD7A 2DE0X 2AQIA 1JR6A 1XRRA 3HHEA 3VR1A 5EHZA 1P0MA 3LRXA 4HB3A 4L0CA 1CZNA 3IHKA 2WWIA 2G4LA 5CXXA 2YJTD 4WN3A 3E61A 5IVIA 7REQA 4F50A 2AI3A 2NTJA 1EGVB 2VA8A 2W6PA 3B38A 1XZIA 2FEWB 3HXPA 3KU1A 3MTAA 2Z04A 1Z2OX 3B9RA 3JVIA 2YV1A 1CY2A 1CF9A 8ICFA 2AOTB 5FOTA 3ND7A 1C3XA 5D3KA 4F38A 3J81k 5CEJA 2HIGA 1V8PA 3EIEA 3R4CA 2NU8A 3ZDEA 2VJMB 3HZZA 4RUCA 5E0OA 2VL7A 4KOEC 3G49A 8ICQA 3BH0A 3NVWA 3OU7A 3UENA 3VO1A 4LGYA 4AF8A 1U7UA 2FUEA 1OY1A 4BMNA 3H04A 8ICCA 1V39A 1QJ4A 1X80A 3QPBA 3VZRA 2G88A 1B0XA 3R0QA 1R12A 1T9HA 2PGAA 1IXRA 1A5TA 2OB2A 3NBMA 4O1IA 4J9SA 4YJFA 2EC5A 2R6ZA 5IF9A 1P2SA 4BNXA 5IASA 1QHGA 5EQFA 2GASA 3WP1B 3ER6A 3LFTA 1PEKE 4WKOA 4E0BA 4TQSA 1U7PA 2Q0QA 4WQMA 2FMQA 3O3OB 4BO6A 1ESCA 4WJLA 4EZ6A 2I6GA 2VC2B 5CHYA 2ZIWA 1Z0DA 5KJ1A 1F3OA 3GZ4A 2P4QA 2JZBA 2HJVA 1R16A 3I9FA 3RU7A 3BA6A 1LV5A 3BIWA 3UK7A 1TTTA 2HHQA 2DXIA 4HQ0A 1OGJA 3D8UA 2VZ9A 3IR7A 5P8WA 3HWTA 4FXOA 3KHRA 2ZTCA 2QORA 3EQ8A 3LVFO 1F0KA 1NZDA 2GERA 4HVAA 4IDCA 1BMTA 1TE2A 3KOUA 4O4LB 3UATA 1L5OA 1IYZA 2MDTA 1Z22A 1WCXA 2WDPA 3T52A 3JZFA 4H35A 2K5UA 5C5IA 3H8MA 1OJ7A 2SBTA 4FYKA 2F3PA 2WF8A 3LOPA 4ENWA 2E82A 1W48A 3ENZA 2PMZF 3RKRA 4RD1A 2IPOA 2RI6A 4X94A 1JPJA 1KI6B 4A16A 5DLPA 3ER9A 2HYDA 4BB9A 3K2QA 5KYXA 3L0BA 3LKDA 4UB4A 1C14A 5CA1B 4FD2A 4V3BA 3V6MA 1QZZA 1KQPA 2MRLA 1RBQA 1WY7A 1VGRA 3HCOA 3I92A 2Q4RA 1SIOA 4H0CA 4QUKA 3G9UA 3UWPA 1QIDA 3GUZA 1U8UA 4AWBA 4M9ZA 2ZVJA 1T94A 2QPTA 1SVSA 2NYVA 3L8CA 4G5XA 1BQEA 2F48A 4G85A 4R68A 5FWYA 2YWRA 5KINB 4NOMA 5KTNA 3B0YA 2WVJA 2ZK7A 1EPUA 2IHUA 2XXAA 3GLHA 2D62A 2N1BA 3D3NA 4BKPA 4P4NA 1NWHA 1RD4A 4KLOA 5CP2A 3GFQA 3UGJA 1R9NA 4UB2A 2PMWB 5EN4A 4CBVA 1L5RA 1Z83A 4PIPA 1N9GB 5JFGA 4RTKA 3KD2A 5CIWA 1CQXA 1FFXA 4OUDA 3T3DA 3ZD6A 3PNMA 3TKAA 4FFMA 4F1WA 1V1RB 2DKOA 5BV7A 1PGQA 3WL7A 2A3NA 2R96A 4FCVA 3FCOA 2VZ8A 3T35A 3E9CA 1XCOA 4RVFA 4M9XA 5FO1A 1X6VA 3EY9A 3VI4B 1ILWA 1EVYA 2UZIR 3DDOA 3ETGA 4M98A 2CHVA 1L9XA 4UM8B 4X0EA 5JSYA 2HGZA 3QLTA 4JR0A 4M8SA 4EO4A 5BR4A 5I7RA 4GYYA 3R5JA 4JI5B 2Q0SA 2JLXA 3VXKA 3J7TA 2R7AA 3ZDDA 3N8DA 2DM6A 3NWEA 2F00A 2YL2A 5IDVA 3A0BU 1FLAA 3GNTA 4M0PA 1ZCBA 3DPSA 2GH1A 5TB5A 3ZWNA 1BJRE 1Z8FA 2OCBA 2I5PO 2IXTA 5F5XA 4ARUA 2R79A 1EM8A 3ZDFA 3KALA 2AD1A 2GTHA 1XCGB 2RC5A 4D6YA 2BGUA 4GL2A 3F3KA 1T0BA 2R1ZA 3EH1A 1Z33A 4BRUA 4DA4A 5IN5A 2ZJOA 3H2GA 5LU8A 1VKOA 1Y63A 1FLNA 1S3GA 3MILA 1U65A 4QWAA 2M6SA 3LV8A 4FEYA 3VVLA 4ZHSA 2QTFA 2GXAA 1WULS 3TNLA 3MC1A 1EK5A 1CVRA 4N5MA 3AVQA 3EGVA 4XQ8A 4FYPA 2EQYA 5ALGA 2H4WA 3MJVA 3V4OA 1DUIA 5KFPA 1NLYA 3KXPA 2JIQA 1PZNA 4OXYA 2PJZA 3FTQA 1E9FA 4PZNA 1KDZA 5H3CA 1W49A 1YA6A 4ZI5A 1WZNA 2AMVA 2RARA 3DEHA 3QFSA 4NV3A 4EYOA 3ZD9A 5LZ9A 3QELB 1U9LA 4M9UA 4D0LB 3LWNA 1RJEA 2QAGA 1N3YA 2VUIB 2RHHA 3B7WA 3I8OA 2ZI4A 4CM4B 2WFLB 4HUQB 4DREA 3KSBC 4IWYA 5DX8A 3VC2A 1JB1A 4DTCA 4F3TA 5FTJA 3NP7A 4R3NA 1XO0A 3WLEA 4UEQA 1QG2A 1OAOA 1QSGA 3LGAA 1MIHA 1B0ZA 3BK7A 3N0TA 4HAIA 1E79D 4RLHA 2YRWA 3UXHA 1JH8A 1ECJA 1FJ2A 2EP7A 4JWKA 1HNNA 1D09A 4CM6A 4A82A 5KYUB 3UHAA 3JU3A 1AUXA 5ALEA 3EIOA 3EQ9A 2PY6A 2HFJA 4J0HA 5KSPA 3RANA 1U1DA 2ATXA 2XVYA 4DV1B 1NJGA 4XTCS 1NLZA 3TX6A 2QT9A 1LGYA 1O0BA 3QFHA 2H3IA 3D31A 4BFWA 3RGWS 3E0FA 2GCEA 2H1WA 2WHQA 3FOBA 2K4IA 3SYZA 1MQ3A 2H17A 4WK4B 2PUCA 2HWXA 2VDKB 2ZJYA 5CX1A 5FWAA 1EFLA 1FTWA 4M53A 1I2DA 2OQIA 4K87A 5LBTA 4J6EA 5K4LA 1XHLA 5CHEA 3BAFA 2ORIA 3A4NA 3V7NA 1TD9A 3ZJYA 3CONA 5AJWA 4RDHA 2XYQA 2OPBA 2ZI9A 1EK2A 3BXXA 5IUKC 3PSTA 5CIYA 5HUJA 2OV6A 3FPHA 1BPZA 4GLJA 1IWOA 2C1EA 2VP6A 4GMDA 5DP2A 5JCOA 2C3OA 3VMMA 4L6IA 1O77A 2XX3A 3RYCA 5HFAA 1ATIA 3AUUA 3MMZA 4GBED 4Y7DA 1V0JA 1DKPA 3CUSA 5JAZA 2GMWA 4AYWA 2Z1MA 3HWRA 1JFLA 3CLRC 1KOFA 2ZSUA 3JQ7A 5T64A 3TNYA 3V00A 2PSJA 3M4YA 4TRMA 1PWHA 1C0LA 4EA8A 4M0AA 3A9WA 3DEEA 1NT4A 4HXGA 4FT2A 2QTZA 2V03A 4QPZA 4RAOA 4CM1A 2V97A 3ZDQA 1M34E 1TDJA 2XV1A 1BJKA 1RRGA 3DQPA 2VJ4A 1DAGA 3E2IA 4PLGA 4NECA 4XZ3A 5ESRA 2I22A 2J6IA 5F1OA 4EG7A 5BUSA 4MI3A 1EAYA 3TM5A 2VHCA 3R9KA 1EWYA 2UVUA 4NLCA 1KYZA 5KFUA 2F9FA 3HHPA 4DKJA 3KG2A 2KEYA 3B1JA 1NW8A 4WFKA 3BZCA 4B6JA 2F4VB 4FYHA 3NHLA 4DCUA 4MQLA 3FSEA 3PRHA 4YRGA 1KRWA 2HMXA 1ZC4A 2VWGA 5PNTA 1NRWA 3D7SA 4KGXA 2XGSA 3HX0A 3LCUA 2NAFA 3O31A 5I7VA 1RPTA 4P33A 3Q8RB 1MC4A 8ICSA 5SY6A 3SOZA 3UH0A 4XRRA 1HG1A 5HVNA 1Q95A 3TRJA 4CT4B 2I6XA 1HFWA 3JALB 3KR1A 1UEIA 3FFBA 4F2RA 2WYOA 4EPWA 3HO1A 5EEGA 3ZU5A 2GEKA 5DWDA 3EXAA 1W6RA 2IHMA 4I28A 3NP9A 3FCCA 3R3XA 2P5YA 4NONA 2CL7X 4H7FA 1TJ3A 2O8FB 3L9XA 4N8SA 2VA9A 4W82A 1QRDA 4EUKA 1YHNA 1R5JA 4D0GA 2AZDA 3EPKA 1JDPA 3ICCA 4G4IA 4UTZA 2O6HA 4MB0A 4WEQA 3TQ1A 5B1EA 4NAVA 1JI7A 2O8EA 1QH9A 2H65A 4HDRB 3RARA 4QYSA 1SXIA 4PZ9A 5B30A 4GMKA 3C48A 2ZAGA 3E1GA 4UJ3A 1Z00B 1RADA 4PNZA 1AS2A 4HFRA 4UXIA 1SUPA 2ZE7A 5DF1A 1QHHA 4C29A 4DV0B 1XQXA 1OX4B 1G20A 4H31A 3PSHA 5DGDA 1QIMA 1FRFS 1YBVA 2R4QA 4RM2A 4U0JA 1ULZA 1WTAA 4CQMB 2XA1A 1LBHA 3AB7A 2BBWA 2NYUA 3EMDA 2QM8A 4DR2B 2QE6A 4Q8FA 4LYEA 3F6PA 3MTQA 4FFLA 2DT5A 1HH4A 4L8YA 2PKQP 3JQDA 4I1SA 3TQRA 1N0WA 1B6RA 5JJ5A 3B6ZA 2XOKD 2OWDA 4QUJA 2I4LA 5TMDA 4C01A 2DULA 3DAHA 4BB0A 1G20E 3HKZC 1KVSA 2O2HA 2XAUA 3Q7PA 2TSYB 3B9PA 3AIKA 3B6IA 4OGLA 1PJSA 2QJOA 2ZWMA 2HSZA 2L5YA 1N2GA 3LCRA 4AYTA 2ZVQX 3RUHA 5CVVA 3L8GA 1YKSA 1PK3A 1TQDA 3JS5A 4D99A 2Y0SF 4BNVA 3B5EA 5F3DA 4C4YA 1DMRA 4R1SA 1J0EA 2EFGA 3TG2A 1YGPA 3ESAA 1NBOA 2G9VA 4DXAA 5DNUA 1SC9A 3VOTA 4YRNA 1N33B 4Q3KA 2X8JA 1B6GA 2P6RA 2FR8A 3GGGA 1E1RA 2EAOA 2MT9A 2OXEA 1JFFA 3M6MD 3OJFA 3OY2A 4PG4A 2BZFA 2A6PA 3V4ZA 2I3ZA 1QP7A 2F4NA 1LFAA 3JD2A 4Y6LA 4D26A 2IPLA 3HO8A 1E9EA 4MAFA 2JGRA 5E1DA 2EFCB 5DHRA 2A78A 4BPBA 3CV3A 2AKAB 4IIGA 2IW3A 3URKA 4ALMA 4CE6A 2YJZA 3E1SA 4WJKB 4BB6A 1E1QD 3D2AA 4ITVA 1SUIA 2OO5A 4QX6A 4RGVA 4UM9D 4WI1A 3KKQA 1CUEA 1Q50A 2K87A 4E4RA 2E0IA 5F3WB 3Q7SA 2VHQA 2ZRBA 4MW9A 3PCRB 4AL4A 1AKYA 3H9BA 2EYQA 2HDHA 1C5KA 2GBCA 1Q21A 2HCTA 2XI9A 2UVQA 4ZGBA 4NZNA 5KG3A 1JSXA 5DQHA 2ZRHA 4YCAA 3WL4A 2VQSA 2L0XA 1QBGA 3CT4A 3PR2B 121PA 4NE2A 3ELYA 1O94D 2DX7A 1TO2E 4UATA 1IEQA 1X86B 4M60A 5HR7A 1YI8A 5AW7A 3VYUB 3PHBE 5TQ2B 5B1IA 4RPHA 1B26A 1TXGA