2B0CA

The crystal structure of the putative phosphatase from escherichia coli
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
199
structure length
199
Chain Sequence
AKMLYIFDLGNVIVDIDFNRVLGAWSDLTRIPLASLKKSFHMGEAFHQHERGEISDEAFAEALCHEMALPLSYEQFSHGWQAVFVALRPEVIAIMHKLREQGHRVVVLSNTNRLHTTFWPEEYPEIRDAADHIYLSQDLGMRKPEARIYQHVLQAEGFSPSDTVFFDDNADNIEGANQLGITSILVKDKTTIPDYFAKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative phosphatase
publication title The 2.0A crystal structure of the putative phosphatase from Escherichia coli
rcsb
source organism Escherichia coli
molecule tags Structural genomics, unknown function
total genus 69
structure length 199
sequence length 199
ec nomenclature ec 3.1.3.10: Glucose-1-phosphatase.
pdb deposition date 2005-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2b0cA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2b0cA01
2YJ4A 1F5SA 2ZBEA 1WZCA 1O03A 3SHQA 1T9ZA 2PKEA 1YS9A 2AMYA 4EX7A 3WK9A 3FM9A 3P96A 3QUCA 3W5DA 4UAUA 1U7PA 1YNSA 2YJ3A 1L7NA 4Y2RA 1RQLA 1RLMA 1SWWA 3TLMA 5IT0A 4HGQA 3PDWA 4C4TA 1L6RA 3OPXA 3WKBA 1Z4PX 1N8NA 2Q5EA 3N07A 4PNHA 4HYTA 4BYGA 4QQFA 2JARA 5ALRA 1WVIA 5AKLA 4F72A 2YJ6A 4JB3A 3K1ZA 3DV9A 3DNPA 4OFZA 5ALFA 3L0BA 2NO4A 4Y2SA 2ZG6A 5AW8A 4L57A 3OCWA 2GHQA 4HGOA 2C8LA 4Y2PA 3OCUA 1SWVA 2CFSA 4UATA 1TJ5A 3L8HA 1TJ3A 3QU7A 3SLRA 4BX0A 3SMVA 5AK4A 1WPGA 3IJ5A 2BDEA 3PCTA 3RFUA 5AKZA 5AVYA 3MC1A 2FPWA 1RMQA 5AM0A 2I7DA 4H1WA 4JDPA 1KYTA 1Y8AA 1T5SA 3L7YA 2YN4A 3A1EA 4NAVA 2MU2A 3U26A 3AR6A 3RF6A 2GMWA 3I76A 4XPZA 4XOUA 2P9JA 4AS3A 4OD0A 4YCMA 1EK1A 2W43A 2AGVA 2FPUA 2NO5A 3QX7A 2ZBDA 4NWIA 4YCLA 2YMMA 4F71A 3L1VA 5AI0A 1LVHA 2PQ0A 5ALIA 3HYCA 5AIAA 1NRWA 4I9GA 3ET5A 5AKGA 4KYTA 3QU9A 3KOOA 2C9MA 2AH5A 5AI9A 2EARA 4FFDA 5AKXA 2MU1A 5ALSA 1ZS9A 4EX6A 3IB6A 2WF9A 1RKVA 4HGNA 2I6XA 5ALQA 2W11A 3CZ4A 4HGPA 5ALKA 4O8CA 3UMBA 3UMCA 3UMGA 3AR8A 3E8MA 5AVSA 3ZX5A 2R8YA 4ZEWA 3F9RA 5ALTA 5AKYA 2WFAA 2X4DA 3AR4A 3NUQA 4YIKA 3I28A 2G09A 4Y2UA 4NFLA 4KN8A 5ALUA 5ALLA 4KX5A 1RC8A 4KNWA 3WGUA 4BEVA 3ZVNA 3ED5A 3R9KA 1QQ5A 5ALOA 2FPXA 2HI0A 3ET4A 5ALPA 2HF7A 1YV9A 2FDRA 3AR5A 3U7EB 1L7OA 2WF5A 3L8GA 4BX2A 2G07A 3L8EA 1Q91A 1U7OA 5A3RA 4GXTA 3A1DA 3ZVMA 2OM6A 2O9JA 1YJ5A 4FYPA 5A3SA 5AK5A 3OCYA 3SKYA 3W5CA 1Z5GA 3EPRA 1Z4NA 2I34A 5AKJA 4YH1A 3L0CA 3E84A 3N28A 3FGOA 3B8EA 2YFYA 2DQSA 3L8FA 4UARA 1ZD2P 2YBDA 2YY6A 2IOFA 5AW9A 2WM8A 1NNLA 4YCNA 5ALZA 2BY4A 3WK6A 2QYHA 2G1AA 4UU1A 1N9KA 1RKUA 3ZUPA 3QGMA 3L5KA 3VAYA 3IRUA 2P69A 3S6JA 3QNMA 3E81A 1VJ5A 1ZRMA 1LTQA 4FE3A 1ZD3A 1U02A 5IT4A 3A3YA 2B1QA 1WR8A 2R8XA 4IFTA 1Q92A 5AM5A 3SF0A 4XQ0A 3R09A 3UM9A 3WK8A 4NABA 3QYPA 4IG4A 2Q4RA 3L0YA 3U19A 4UMEA 3ZW7A 1Z4OA 1ZD5A 4UMVA 1ZOLA 3SKXA 2YJ5A 3FPBA 5AW0A 1RLOA 5ALYA 3B9RA 4RETA 1L8OA 4CF3A 4E88A 5AVUA 5AVXA 3QLEA 4Y2VA 4CE6A 2ODAA 3W5BA 5AI8A 2OBBA 4UASA 2HF2A 1QQ7A 5AK6A 3B9BA 1RQNA 1J8DA 5ALEA 4UM7A 5ALNA 2RARA 3EWIA 4EENA 4HGRA 1ZD4A 2FPSA 2I55A 3MMZA 4Y2TA 4MWOA 2I54A 1U2SA 3QU4A 2GHTA 5ALGA 2JAOA 4BEWA 1VJRA 4ZEVA 5AKEA 5AKKA 5ALHA 5ALXA 5AW1A 3M9LA 4KX3A 4XE5A 3L1UA 3AR3A 1TE2A 3ZTWA 5ALVA 2HCFA 3DAOA 5AKIA 1RPZA 2C4NA 2R8ZA 3GYGA 2C88A 2ZBGA 3I1YA 2B8JA 4Y3UA 2RBKA 1L7MA 1Z4LA 3N5KA 2HHLA 1L7PA 3KZXA 1O08A 2HDOA 4Y2JA 4Y2XA 3EF1A 3U7FB 5AHXA 2JGAA 3QUQA 5AI4A 3QU5A 5AK3A 5AM1A 3QXGA 2I33A 3ESQA 5ALMA 4C4SA 1QH9A 1Z4MA 5AW3A 1Z4KA 3R4CA 5AVVA 2G0AA 4MUMA 1RMYA 3MN1A 2FEAA 3OCZA 4Y2YA 1CR6A 2BDUA 5AICA 2ZXEA 1Z4IA 1Z88A 2HO4A 2FUEA 3NANA 4CF4A 2AUTA 1RRCA 2PR7A 2CN1A 2FI1A 4UW9A 5AM3A 3BWVA 3NIWA 2CFRA 5JJBA 4DW8A 2QLTA 2GO7A 2P11A 4L6CA 4UMDA 3WKAA 1XVIA 3PGLA 1S2OA 3HLTA 4KNVA 4DFDA 4CNQA 1Z4JA 1ZJJA 3ZTYA 4I9FA 2FPRA 1S8OA 1X42A 4UM5A 3D6JA 5AVRA 3ZX4A 3E58A 5T41A 3QU2A 5AKHA 2YMPA 3WKDA 3WK5A 1K1EA 2OYCA 3MPOA 1Z4QA 4BBJA 2WF6A 3KDPA 4DWOA 1ZRNA 3J7TA 4EEKA 2WF8A 5AM4A 5AW4A 3AR2A 3PGVA 1Z5UA 3U7HB 2RB5A 1RKQA 1AQ6A 3DDHA 2MSNA 1U2TA 3BA6A 4B6JA 1QYIA 3U13A 3W5AA 3SD7A 2HEGA 2IYEA 4AP9A 4QJBA 3I6BA 5AIBA 2CFTA 5AM2A 2NYVA 4Y2QA 1T5TA 3NRJA 3ONNA 5ALWA 2B8EA 2RAVA 4ZEXA 2HX1A 3WKCA 3KC2A 3AR9A 2Q4TA 2IOFK 5ALDA 1MH9A 2GFHA 2EAUA 2B1RA 3ESRA 4BNDA 2EATA 1L8LA 5AW5A 5AW6A 5AI5A 3OTQA 2ZBFA 5AI6A 1XPJA 3U7GA 4UAVA 5AW7A 3NAMA 1JUDA 1QQ6A 1EK2A 3OCXA 3NALA 2G08A 3KD3A 5ALJA 1TJ4A 4GIBA 2HOQA 3ZVLA 1TA0A 3A1CA 1IWOA 4C4RA 2C8KA 2B30A 2D2VA 5AESA 3ZU6A 3QUBA 5AW2A 4EELA 4EZEA 3NASA 5AVWA 5FP0A 4L6AA 4YGYA 4BNDB 2R8EA 2O2XA 2YMQA 1YMQA 2WF7A 3AR7A 3FZQA 5E0OA 3N1UA 2HSZA 3ZWKA 4BX3A 4HAIA 5AVTA 3N8GA 2FUCA 4G9BA 4NV0A 5AVQA 4J03A 4AS2A 5A3QA 1SU4A 2VKQA 4CF5A 5AVZA 4RESA 4OHFA 3ZI4A 1NF2A 2IA5A 4BKMA 4OCZA 1FEZA 4YIHA 4J2TA 2W4MA 3WGVA 1J97A 3EF0A 3KBBA 1YDFA 1XP5A 3FPSA 2OA0A 3ZWDA 5IS2A 2G06A 3WK4A 2YMLA 2JAWA 3QUTA 2B82A 1PW5A 2WHEA 4UMFA 3M1YA 1RDFA 3CNHA 4DCCA 3FVVA 3OCVA 4UU0A 1RLTA 2P27A 2G80A 1RMTA 1VFPA 2IOHA 2JAUA 4G63A 2B0CA 3WK7A 3WKEA 1CQZA 2ZOSA
chains in the Genus database with same CATH superfamily
4O3NA 3FDXA 5H81A 3EEYA 2D8MA 1NT2A 3VPGA 3AN1A 1C9NA 5MN4A 4LC0A 1UANA 3WAJA 2XDAA 3KV1A 2I22A 3FCYA 5C7IO 3FYCA 2HBLA 4Q16A 2QVXX 4CIVA 3KWLA 4LNUA 4R8UA 3E1SA 3RRFA 1RRVA 3WFJA 5LQMA 1BPYA 3B3AA 1AGXA 5KFUA 4J0KA 2WHXA 2RHHA 5CFNA 2IS2A 5KG2A 3CURA 4LRQA 3IOYA 2DMRA 4KQWA 3OWHA 3IT2A 3BWYA 4ZO9A 2MU2A 3JSAA 2Y0EA 4MA5A 3ROKA 2G5GX 2OSVA 1ZH0A 4TM7A 4LZGA 8ICQA 3NWEA 3WAGA 3W8RA 4B79A 1TAHA 2FLVA 4W9MC 1VZ3A 2Z8YM 3SIWA 4IZOA 1PS9A 2XYQA 1ZQOA 2XNKA 3DBLA 5JZ9A 4UHHA 3QF4B 3NWOA 3UMBA 4UQPA 3OM1A 2MRLA 3EEFA 3THSA 3AWIA 4FFBA 4EMBA 1YZYA 4ZO4A 4CV0A 4KN8A 3UOAB 4B7AA 5KFQA 1GL6A 4ZVPA 7ICGA 4RPZA 5ESDA 2DWQA 3TH5A 4OMFG 2CXHA 1BHSA 1N1EA 4WKOA 3HKCB 2C20A 2HK7A 1PQWA 1QOPB 1WW2A 1E3MA 2YBDA 4D6XA 4I1YA 4QO7A 3K20A 3TQSA 1SXEA 4PNEA 3Q8XB 1SXPA 2V7EA 2H3HA 3W5IA 1WUHS 3QHQA 3B13B 4UCQA 5FOVA 3EHDA 3WK8A 2HH9A 4C4XA 3CISA 1MJGA 2W5UA 3GRFA 4O2BB 4FB4A 2QIPA 1E5XA 4EIWA 1X74A 1MIOB 4UHKA 2F48A 2PLWA 4LDRA 5LQDA 1DFHA 3UKDA 5I8ZA 3H1GA 4XWGA 4LK3A 4NZPA 1A9RA 3GELA 3OFND 5K0NA 2IITA 4IMIB 1NLUA 3IIKA 5J0WA 1RAHA 1X1TA 1DIOB 1YU6A 1I7QB 1E58A 1QFYA 1Y1QA 4IZIA 3WWEA 2VA9A 3OJ0A 2XY5A 4GE0A 2JL1A 4YRZA 4QVKA 2AVNA 3AERA 3L1IA 3PEEA 5CDTA 2B7CA 3HO6A 5CX1B 4WJ3B 4ND2A 3I23A 2YX1A 3UXPA 3CUVA 1V95A 2P3OA 1L4BA 1NYLA 3ETLA 3MM4A 4BVGA 2V7TA 4RSHA 9ICFA 1CQJB 3FXAA 3MPOA 3T3GA 3GRPA 4M1KA 3H8JA 1SV4A 1S89A 2GWSA 2GPTA 1JEYA 1QF9A 3WLKX 4G1UC 5KFMA 3VZPA 2PSJA 4R1NA 3Q0TA 4INJA 4G6ZA 4MVJP 3UJPA 3IESA 2AK2A 2BM9A 3F97A 1SEVA 4R64A 3ISTA 1X80A 2GYVA 3UJNA 1QHSA 1QE3A 2EATA 5AI5A 3OTQA 1NAHA 2EOAA 1MOSA 2HXYA 4EB0A 2Q9BA 4CEHB 3WLOA 3T4XA 2D5BA 1HL3A 4PHCA 3KZMA 3HCDA 3K09A 4D3YA 4ZJYA 5DB6A 2ID7A 4PFQA 1DLIA 4C0BA 3EQ7A 1W59A 4N40A 4HZUB 4LVUA 4O0LA 4UNIA 4LOJA 3IBCA 1PDVA 5KL1B 5ICMA 2FG7C 1TM1E 2PUHA 2A19A 4N0PA 1O6CA 1MN6A 1VYHA 4R4JA 3HBFA 4MUNA 2P4HX 2V6BA 4IAOA 5IWCA 2GAAA 3I9FA 3J81A 4RM3A 3O3MB 3PC6A 4BLVA 5JHGB 2YYYA 4KJXA 1XV5A 4F12A 5FBKA 3PW5A 3NBYC 1YS9A 4H1VA 3PHHA 2R3SA 1AA9A 4YJFB 5KFYA 1XHFA 5I5GA 3WL8A 2XUQA 1OC2A 1HTWA 3O73A 3R0IA 3BX1A 5B3KA 4RLSA 3RSGA 1N75A 3K1RB 4UVDA 4JBHA 3A0UA 4M0FA 1EJ0A 4ZOAA 2VJBA 2X1HA 4AJEA 8GPBA 4KR0A 4R8LA 2CFSA 5ICSA 3DUWA 4WXRA 1TZKA 3QMVA 1YBHA 3OJWA 2EDCA 4ZD6A 5JAOA 4M0CA 5BVHA 2Z5GA 4J1SA 1BG6A 5GPBA 3BZBA 4HYQA 4C20A 2R6DA 4JDPA 2QTHA 1UPTA 5AJTA 1AQIA 1NLZA 3F67A 3BH0A 1AK9A 5FNVA 2Z83A 2LCFA 4P22A 3SE0A 4FHZA 3LCMA 3HB4X 2W43A 2F4NA 2NWQA 3F5AA 3LG2A 1VDVA 2Q28A 4X20B 3VU0A 3EZLA 4OMCA 4JT2A 2P0AA 2PUWA 7ICVA 1KMHB 4O4HF 3ADOA 1OD6A 1RI1A 4I1OA 3JD3A 4QWCA 4I14A 3C15C 1S1CA 4I2BA 3OZRA 2VLIA 2YB1A 1NJGA 1KMMA 1FQOA 1ULHA 4JBYA 1QYWA 4QUKA 1JDJA 3ZE8A 4GX1A 2IYOA 4I08A 3CR7A 2AFHA 1YAHA 4GBED 4R68A 5H3LA 4PPQA 2QOEA 2QTFA 4ND8A 2V9PA 2NZYA 3K09C 4IDBA 2RAPA 3L8FA 1V43A 3QTTA 2ZRIA 5BRAA 2YHSA 1DPGA 3WISA 3H6GA 3HVUA 1GUYA 4Q3DA 2NMVA 4MWSA 3M8SA 3A3YA 4O3QA 3LNTA 2ZVPX 4TVSA 4G41A 4PC1A 3I9V1 2J8ZA 4JOQA 1JLRA 2I71A 3ZHUA 5HR7A 4RU1A 3RTEA 4C8LA 4BVKA 1QQ7A 1A8QA 3E2MA 1Y7IA 2X2FA 4UE6A 1ZD4A 1A4IA 4NBUA 3K9CA 2CLIB 2PVPA 4OSEA 4B32A 3AINA 1WZ2A 4CLRA 5ERGB 2ZJAA 3R3VA 3F5DA 1KC1A 4CMHA 5KT7A 4AIIA 5HCNA 1E6LA 2VYND 3GNSA 4WIAA 5E6SB 2G36A 3DH0A 4BRWA 2AC2A 3ROXA 3KETA 3OT1B 2MR5A 4A03A 4HXEB 4XD7D 1SBNE 2FQWA 5K99A 2YTUA 1J2YA 2VAVA 2FHPA 3Q4GA 3NGLA 1IYZA 4M22A 4S12A 5E7JA 3IOBA 5IIOA 2W2NA 3KQOA 3C16C 4YALA 3KDPA 1M10A 1LQ2A 3NB0A 3PNPA 2CLOB 4DLRA 3K0EA 4IIHA 3ZN2A 3B6JA 5ALWA 3V4FA 1JFLA 5KAPA 3CB4A 2HVHA 3BQMB 1K3UB 3N7RC 3AFHA 3HRIA 4MWDA 2XGJA 2H8GA 3PY8A 1HFJA 2QPTA 1J2MA 4KQFA 2BBOA 3TB6A 3TLJA 2NW6A 3GHHA 3TFSA 2BCRA 1GXSA 5TPWA 3KBOA 1GPWB 2H5JA 2EQ5A 2JB9A 2QAGA 2DF4B 2B8WA 1C9DB 3CKLA 2JCXA 1UM9B 2R5WA 4TV9F 1T4MA 2IE0A 2IEGA 2M6KA 4P0QA 1LRJA 5CB4F 1HQYE 4BQQA 4G36A 3WTBA 2Y68A 2NYAA 1GQQA 2A88A 2MSKA 4EBDA 1EDZA 1QX4A 1W581 1DOHA 4DDHA 2V97A 4M76B 4PX2A 3M6IA 1HE4A 4E46A 1UMCB 2PNFA 4MKIA 2XCRB 1ECCA 2XCPA 2D4HA 4Z1MA 1W87A 1ZCFA 3T1YB 4Z6KA 3SQOA 4QDKA 3JQGA 4F7DA 3KQTA 4CKBA 3HRHA 4EITA 1L5LA 2JK1A 4A8PA 3C5WP 5F33A 2DLDA 3WLRA 1R6DA 3EWSA 4ZANA 4U0KA 2EJCA 1KJQA 4U7FA 4B8ZA 4DSJA 3QFTA 1TL7C 1RYZA 4CKWB 4NJEB 4J1QA 3L7NA 4H1WA 1R1DA 2JR5A 3BREA 1ND6A 2FPGA 2FSVC 4B80A 4HWTA 2AOTB 3H4VA 1NN0A 1TF5A 3T35A 1Q12A 2ZT7A 1XL1A 1TYBE 1JRPA 1S3SA 4G4GA 1L3BA 4CM9D 4O2AF 4FLFA 1ORDA 5LZ5A 2PWAA 1BDHA 1JTFA 4UB5A 3GRZA 3W05A 5J23A 2VJDA 2E4UA 4OTZA 1LK5A 1CLEA 5KYUA 2R18A 3WBFA 1VG0B 1US8A 1XD8A 2Q4OA 3DEAA 1ZZGA 2R8GA 1NXTA 3G7UA 1I3MA 5CH5A 2AG5A 1HQDA 4ECWA 4DA8A 5TS3A 4FSHA 1N6HA 3MFYA 2QENA 4F60A 3LH5A 1YRBA 4RD6A 1GZHB 2WIJA 1T13A 2HREA 4TTSA 4OAPA 3QP9A 2KLHA 4KN5A 1SCNE 4K6MA 3FCSB 1OXTA 2YVUA 1VC2A 5IXSA 4V1CA 2ZU0C 4K9SA 1W5TA 4JAVC 1I5RA 3ROFA 4GMDA 3WU2U 4DJEC 3ZJVA 5HF5A 4TUYF 4NABA 2LCQA 3T3MB 5F2NA 2ZULA 5K2MA 4NSNA 4BV3A 5C37A 4RC9A 3OQJA 4V0RA 1E9SA 4JQCA 2HMUA 2XITA 3W5UA 2PUVA 3VO2A 2WJGA 6ABPA 2X3UA 4GQAA 3LE8A 5TJHA 1TM7E 3N2EA 2R6JA 4EJSC 2BGLA 4U5QA 3FFXA 3R6WA 3DEHA 2H59A 3TZBA 5JYCA 1YB5A 3NMUF 4ZFNA 2AXNA 1ZVQA 1AN9A 1TVEA 3O8QA 2XE6A 5AW3A 4K5QA 3LVQE 4JOCA 1N25A 1W0JD 2QYOA 1E5QA 3D3KA 3SBXA 1D04A 5CDYA 3C5HA 2PLNA 2C97A 5KWVA 1XEXA 3T5AA 4IQ8A 5EJEA 1I13A 1EVQA 3P7MA 5HUQA 4KR7A 3PPYA 1M6YA 1PJZA 1SCUB 4NFYA 4CPDA 1E60A 4QOHA 4WN9B 3TD6A 4Q4JA 1KEWA 3K0HA 3OA0A 3H87A 3KZVA 3T61A 2I87A 2ZR0A 2E8MA 2OT3B 4OJTA 3ESRA 2VLBA 1Z74A 4YQWA 3JASB 3OZDA 2O54A 4JI1B 5LFAA 5KG5A 3FGZA 1NQWA 2HJGA 5EE0A 3KG2A 1NUQA 1Q1NA 3CLRC 4F4FA 1G7RA 1JR6A 5DCLA 1JSXA 2CLHB 4OHUA 5HXAA 1LW7A 1U6KA 4DE5A 1X8XA 5CJ2A 3PL5A 4GU5A 2HCRA 2P6OA 2QBYB 2BMAA 2G1KA 4GGPA 3QEAZ 1MV5A 5I9NA 2HFKA 2WLSA 1RCTE 5JAUA 1G20B 3F1KA 2XTJA 1KOJA 1GRRA 3P32A 4YLGA 2B78A 3FF1A 4ZRNA 3ANSA 4MUYA 4FI3C 2ZR7A 3F5EA 3DLCA 4EZ6A 2QG4A 4I7EA 4EEZA 2CVQA 4C6TA 2IW1A 1ZUD1 4EA7A 3STTA 3H2ZA 2PWZA 2LM4A 3OTIA 5JXGA 2YJ3A 4LC9A 1WW3A 2J3JA 4BMPB 3VZRA 3B3FA 5K2OA 4QWEA 3RYIB 1G3RA 4LAFA 2WTUA 1MGOA 4EVRA 3GD5A 2DETA 4L57A 1U2EA 1Q11A 5FI0B 1MMFB 3PXEA 2E89A 3C43A 2FV8A 4Z9YA 1I2MA 1S6YA 1OT3A 4G1FA 3RU7A 2VSYA 4GMKA 3FZGA 4KIUA 2YNMD 1ED1A 3ECCA 3BGOS 3OE4A 4KLEA 4HNQA 3I30X 3OJSA 421PA 2X1MA 3UPQA 1MZPA 4YMNA 4QZBA 1RYRA 1LLFA 2ZJOA 4V0MA 4NL4H 1W4BA 4LWZA 1QG6A 1AKTA 3QEMA 5BV8A 4F3OA 3RC7A 9MHTA 1F9AA 4CLDA 1E5DA 5FPYA 3IUSA 2FMKA 1R88A 2CZQA 2BGWA 4LYGA 3LGSA 1N5OX 3JQ9C 2HUPA 2HA4A 2ZPTX 3OUUA 2EFHB 2J31A 2NZ8A 4YPVA 2NRXA 1DQYA 3FDZA 2GF0A 2C78A 1UXGA 4FX5A 1CLUA 3MT7A 4AQYB 4L5JA 3AKEA 1ZJZA 4ED3A 2ZBQA 4JU9A 1CRXA 4S1NA 2FW1A 1ZWLA 3MINB 1WUIS 2G88A 4Y30A 2DB3A 1WMAA 1UBEA 1ZSNA 2RBGA 1IG3A 2YRWA 2NX2A 1EUCB 1VHLA 1R0YA 1UFOA 1UEXC 1PVDA 4QOEA 5ES3A 2JZCA 4LGMA 5G1PA 2VHWA 3DQPA 3GP8A 2WA1A 2HBJA 2OBFA 4LJYA 2ZB8A 3QU4A 2JIMA 4A5SA 3OOEA 4KH0A 3TRHA 2DQZA 2CDCA 1YL7A 3KTAA 2HRCA 4CCSA 3N2KB 1EXDA 4MEXA 4P4NA 3FNGA 3ZBUA 3SIXA 1A9XA 3OUTA 3C8MA 1ZA1A 3ESBA 1O3YA 1D9DA 3ESQA 1RYYA 2FMSA 3VGPA 2QNRA 5DB8A 1GNTA 4MJXA 2XGSA 3ZKWB 5IU6A 3T1OA 3DLAA 5KAIU 2J1LA 3AJ8A 1L7BA 1PR2A 2OO5A 4K6OA 3GB9A 4EJFA 3FWHA 2QLTA 3GLGE 2W37A 1VJ0A 4L2IB 4H7KA 4JLWA 1IY8A 3QQPA 5JSKA 2GRJA 3G2JA 1KVRA 3HXLA 3P9CA 4HAXA 4HUQA 3L0PA 2G72A 4Q9KA 4ZMSA 3ORYA 2OCIA 3P0HA 4HDMA 3LDFA 1VMAA 4MUJA 2OHXA 2IYZA 4DJTA 3SD7A 5LQJA 5TIIA 4P7BA 2M0NA 3WQBA 4DVJA 2CKMA 1FPQA 4EUEA 2WAOA 3H2GA 2RK4A 4PVDA 4I46A 3PHGA 1KPHA 3TCNA 3OZFA 3NC0C 5DIZA 3OQVA 1XZGA 1DG3A 1TZ2A 1HDZA 1GD1O 2HBZA 5IKPA 2ACWA 5K6AC 3PG5A 2B61A 1C4WA 4C78A 3WLFA 1T0HB 4ZMRA 4BX3A 3COWA 5AVTA 2JAQA 3NVKI 4PNZA 1VYUA 1T94A 3OTOB 4GF5A 4HRVA 4KMSA 1C1XB 4GKKB 3D8HA 2FJ6A 5LP6A 1XP5A 4E7OA 2ZU6A 3G68A 5LB4A 1L3TA 2B82A 4MQMA 1USIA 2CDBA 3AFGA 1CR0A 3MJFA 5DT9A 1PSZA 2VCEA 1W44A 1TK3A 1V5WA 2Y2VA 1PK9A 1P2BA 2ISCA 2BTQB 3ZKAA 3EVAA 2K8BB 1QZZA 2AFVA 4TQGA 2XQKA 2J5KA 2VSNA 4N1AA 1X7XB 2W6CX 1W5AA 3HLKA 5K0SA 2D5LA 3JZFA 3EW7A 3DTTA 3D3EA 2O7NA 3M82A 1SWVA 5LYJF 1YULA 2YHAA 3D1VA 4F8RA 4PC7A 1P9RA 1PZEA 4US9A 3QKIA 5F52A 1XE3A 4A7PA 2BMEA 5K6RA 1ZCBA 3VC7A 4J29A 3RTAA 5HIKA 2YN4A 4NAVA 1EGHA 1J06A 2IHNA 2WB2A 5EP4A 5LNK6 2OORA 4RZHA 4GXIA 5J4HA 1MC5A 4QLAA 1NU8A 3ETDA 2AF3C 5FD8A 2CK3D 3KAQA 1VJ1A 1KI1A 4IRKA 4D82A 4HVCA 1Y81A 3JQ8B 2HCBA 3SYZA 1E79A 3C8DA 2ASVA 4E5DA 1SD5A 1QF6A 1UXKA 2V0NA 1EM6A 5C5DA 1GGKA 2O2HA 2GVZC 4ZIRB 3WGHA 4DSFA 3OQMA 2OWDA 4QJ3A 2QZ9A 2AS0A 2WAQC 4L75A 2JEIA 4MWBA 4BFWA 5C52B 3GA7A 2BKLA 3A3OA 1LLQA 1CZUA 3MG9A 1KORA 1MAAA 2A86A 3L46A 4P53A 1JQJC 4E4YA 3OZSA 1QGUA 4OXNA 4XWOA 3PIIA 2E55A 3VZCA 1H6AA 2OM6A 3NVYA 3EMVA 2E21A 4O1HA 4P2BA 1XZ8A 1DLJA 2C58A 2GZSA 4DWWA 2FZKA 4M2YA 2G1AA 1RYMA 1IN4A 1R6BX 3EXEB 4LDJA 4NEHB 2VTKA 2O8DA 3SX2A 4LRTB 1B1CA 5JVDF 1PWHA 2QTVA 1M2OA 1LTKA 4ROSA 4G5RA 5DBEX 2V7VA 3C97A 2VANA 3W4IA 3CR3C 1M5RA 4GPZA 3JVEA 3QLEA 3UK1A 3RHZA 1ZI6A 2DWCA 3EQ9A 1NQAO 1RM3A 4JSRA 1LI5A 2KJ8A 1WUTA 4ZEVA 2EZ8A 3M9LA 2YOGA 4ZMBA 4IJVA 2WNIA 3U4CA 1BVRA 1JR3A 2Y0BA 1X9HA 1Y8QB 4NXZA 1JAIA 4ZDKA 4I5GA 1HDXA 1FJHA 2CPRA 5FOTA 4EQ6B 2IHKA 2XVAA 1EXNA 4DLUA 1UDAA 2JGRA 2CN1A 3KKOA 1YJXA 3R3YA 4F91B 3QKRA 4P5EA 1ACJA 1OU0A 1T9CA 3VR5D 5CB8A 2E5SA 1Z2OX 1NRIA 3UKJA 3TNYA 4XVUA 1WBBA 4NOMA 2ZJ1A 1KOFA 2CBXA 4Q1FA 4RKQA 1KY2A 5AM2A 2ADOA 2A3RA 2CVOA 2BP7B 1OLXB 3AUAA 3HJRA 4J6EA 2XH8A 5F7OA 4D99A 3CRNA 4U7HA 4I5EA 1HOXA 2NUPA 2K6GA 3ZXXA 4RDIA 4BWJA 3EPIA 4CCYB 3QITA 3NKLA 4BO3A 2JFOA 3QKUA 5FDFA 3HY4A 2X42A 3P2JA 1JFSA 4HFMA 4H17A 1WY7A 2BEVA 3DTVB 4HR7A 1Y5NA 3O4RA 2UYCA 2H5EA 4E5NA 5FOSA 3HDQA 2WG0A 1ZQXA 2Q8PA 3B6ZA 1U65A 4AW9A 3AOEA 5BT9A 4DFPA 3VR2D 4KN4A 1HPLA 4N8EA 1YU9A 1XRNA 4IH4A 2IZ0A 4JEMA 1E1RD 1XDSA 2PH3A 1M7HA 2XJ4A 3NRCA 1VMIA 2JRLA 4QNRA 1O77A 3IE0A 3NTVA 3NZEA 3EVNA 3RH5A 4L5CA 2BE9A 5BN5A 3K6RA 1YIAA 1EYZA 1WCYA 2PGAA 3SDBA 1AUOA 1Q50A 1VXRA 2IKSA 3N75A 3U49A 2QRQA 4YMUA 1K98A 3A4IA 1KI3A 2NTNA 3KKNA 1QBKC 1X1DA 4MS1B 2AUNA 4WKBA 2O2DA 4A92A 4DLTA 4O4LF 5K3AA 3EY9A 2BONA 2DEUA 2LNDA 2GD0A 5LL6P 4CU2A 2X5KO 4BDPA 1G19A 1AKWA 1PNQA 3WGMA 4G8CA 6NULA 1JA0A 3LBYA 4UVHA 3C45A 1IUKA 1EJBA 3B9JA 2ATLA 1H9AA 3AFNA 3P9YA 4DL7A 4D0RA 4JNKA 1ZSYA 1TZJA 4ZHSA 4KWIA 3F3YA 4QQKA 2A5YB 1O94D 3I04M 4C2UA 5B53A 1GNLA 2ZR9A 3BWBA 2Q1SA 2A1IA 3HR8A 3EULA 3LDGA 2COKA 3ZZMA 4EZIA 2GDZA 2VSXA 4G5QA 1AQJA 4KKVA 1NFRA 4MYDA 4LDAA 4BKUA 1HBJA 3JWGA 4BVHA 4MVJG 3LWBA 3MFIA 1L1FA 4CQMA 5JPIA 2K5UA 3L7BA 4UVEA 4JJEA 3X43A 5J3JA 1OW3B 3CSSA 4H1HA 5CXXA 2E1FA 3OU7A 2CBGA 2OGSA 1PDWA 3KQLA 4L5YA 1L4YA 2A78A 2DKZA 1CKEA 3SYMA 5JNLA 3L41A 1GUDA 3IN5A 1SVKA 3H2KA 2BJHA 3C5GA 1R00A 5FTJA 1VPWA 1EBFA 2C5GA 2Z4SA 3EZGA 3ZYCA 2FFJA 2N1RA 5LZ4A 4L28A 3DUFA 4ZZ0A 1EP9A 2XVYA 4BUJA 3O92A 3GVHA 2XCOA 3TQHA 3GW8A 3KTFA 1DT5A 2CXPA 4D3SA 5BQPA 3AOEC 2X86A 4MVYA 1FP4A 3V1LA 3MZ0A 3ZE2B 2DPLA 5FR1A 2BQUA 4GHWA 3NV9A 4G86A 1NXOA 5JLAA 3K0FB 4RTLA 4J9MA 4MJLA 1GLGA 4C29A 2KJ5A 3U0BA 4DO9A 2XQIA 1KQOA 2P62A 4TL8A 1X7ZA 1MTZA 1JWBB 2O06A 3LC1O 4A6DA 3CNOA 3U60B 3T7TA 1G2OA 5DOZA 3Q40A 2H3EA 3GU3A 2QLBA 5CW1A 3EGOA 1QFZA 1RD4A 1W0KA 3DE2X 1Q20A 5JXHA 4NQRA 2AVDA 2YW9A 4JJFA 5G41A 4ZAXA 2RKOA 221PA 1TT5B 4FCWA 3HGTA 3S81A 1XVIA 2FE4A 3U17A 1Z63A 4WASA 4NNOA 2FPRA 1FU8A 3BMXA 3VC1A 5T41A 3Q11A 1HUZA 1D4OA 3IUJA 4X6LA 3PYLA 5LA6F 4E6PA 1UMKA 2WIKA 3V3KA 4KPUA 1ODFA 4QIWF 4WERA 3VR1A 5GJCA 3FYDA 1BX3A 2OKCA 2NSDA 9GPBA 3WQSB 3OE5A 5DRYA 5K4AA 2WNSA 5EJAA 5IM4F 3EX7C 1CW2B 4F2DA 1SA0A 2C3MA 3OI7A 2FCRA 2ORVA 2FVXA 1RNLA 3W7VA 2E3JA 2O8CA 4GYJA 4BLWA 3V1KA 5HA5A 1NVFA 3PUVA 4UEWA 1Q1BA 5J2CA 4ZGWA 1WTCA 4UDYX 3PSTA 3VPAA 4LECA 1I0ZA 3EIFA 1ZQ1C 3U4AA 4QEKA 1Y3HA 2B1IA 2NU9B 1BMQA 3AG5A 1UKCA 1XU7A 4B7ZA 4ZC8A 2DFLA 2BDPA 3R0JA 1CU1A 1FXSA 1U45A 4RNNA 3N3AC 5A3QA 1P7ZA 1M34B 4DG8A 1HYGA 4LNHA 4O4JF 2P9EA 4DNOA 5JY1A 3KBBA 2LD4A 2GKGA 4WBNA 4Q3KA 2R7AA 3DAFA 3D2AA 5DG9A 3CNHA 2FN4A 1CWUA 5DI9A 1JKMA 5EC8A 5LCXA 1N7HA 5EUMA 1ZINA 3A6PC 2F1HA 1O03A 2GOYA 5JARA 4C8OA 4I55F 1JXQA 3EXFB 5FI3A 2F8KA 5DTJA 4DIOA 3EJWA 1E61A 4TM8A 2GJ8A 5TV2A 3FYTA 1PK3A 4B48A 3I4CA 4A15A 4AYBF 1RXSA 4Y2PA 3AZPA 2CW5A 3MTEA 1O96B 3JPQA 3QBJA 5REQB 1VI2A 1D2NA 3OMXA 1LBHA 4LYEA 4Z54A 3AI2A 4LTMA 4OKSA 4Z6EA 3TTXA 9ICLA 1M5TA 2FWAA 3OHPA 4C6RA 1D9ZA 1V37A 4KLNA 3FKQA 4U6NA 3AU6A 1X7GA 3V8EA 2VAWA 1F7UA 2TRSB 1RLIA 4BDSA 1EWRA 3UO8B 4LHXA 4O59O 3PVSA 1Y4UA 4KQEA 3SF8A 1SHUX 4JLAA 3DEZA 3TRJA 2Y9PB 3AHIA 9ICGA 1W0CA 2HSGA 4AJIA 2OM2A 1ZUIA 3NBMA 5ALKA 4CL3A 3UTCA 3DVRX 3G2PA 2B2XA 3H8WA 3I6YA 1DJOA 3HNPA 1WIWA 1XPRA 1KJ8A 1N5MA 1Q3HA 2KBFA 2H92A 4KNWA 4RUKA 4OUDA 4MVXA 3UAGA 1YV9A 2YFHA 1B6GA 3WLLA 1Z7WA 4TX1A 3H0EA 2VZ0A 1APBA 1X77A 4P83A 2R1ZA 2VYVA 2PUTA 5T14A 4K28A 4MH0R 4NJMA 3JQEA 3KTDA 3IQHX 2HSWA 4GP9A 4GM0A 5AW9A 2BY4A 2DBYA 5D5QA 5LZ2A 3T3DA 4NX2A 5D01A 2D74A 3SQXA 2H3QA 4FE3A 2WY2D 3CFYA 3MWYW 4MQ5A 4IWYA 4IG4A 1F2DA 1MQ9A 2W6JA 3GXBA 4H31A 4CF3A 4RZRA 3PNOA 1I3LA 3THXB 2P6MA 4NS1A 1ZQRA 3VH4A 3RVOA 2WJAA 2CE2X 5BURA 4P82A 4E31A 2G7MC 3ONEA 3CX8A 3QKTA 3JZDA 3OX4A 1SHZA 4OVKA 2JVIA 2R8ZA 2B1JA 4V38A 2ZBGA 2Q1WA 2ZAIA 5JNWA 2QLJA 4DNXA 5EWMB 4HK4A 4GI3A 2ZDHA 1E3IA 3NAQA 4PHGA 1UWKA 2XUPA 5JS1A 1Z4KA 2YV5A 4YJHB 5KTOA 1CQIA 2VRCA 4EARA 4F5YA 1VLLA 1SH7A 4XTCS 1BQ4A 2LKCA 5LUBA 1JLMA 1G3UA 1OWPA 4KE8A 1SKRA 4K6FA 3O9ZA 2EH9A 5JSHA 4OK6A 2I7VA 3AUJB 3UAWA 5TRTA 3PSFA 4GBMA 4JEIA 3HCFA 2BMFA 2CMDA 4FFSA 1JEEA 1IOZA 4HAYA 2FZWA 1T36A 4DN6A 2V5UA 1D8TA 4WDRA 1JQKA 4YFYA 3DLPX 3RT7A 1QBGA 3V4SA 3BB1A 2OR3A 1P5ZB 3DWGA 1O7JA 3QBDA 2I6GA 1EGVB 4EI2A 1IRXA 2P3SA 4CT4B 4NM2A 4CEJB 1J8FA 5LMUB 1CHNA 2BR5A 1QH1B 1E63A 3TG2A 3HXQA 1KLNA 3IV7A 4YRQA 3QELB 1D4ZA 4EA6A 1KFDA 4HGZA 4G3IA 4WZAA 3MCVA 4KPEC 2OBNA 4M7PA 2Z2JA 2EC5A 4DEXA 4AAYA 3EYWA 1VFPA 4BJ5A 3KYCB 4G63A 2V8OA 1G5PA 3ZPXA 3Q88A 2JFXA 4YRNA 4UOQA 3QUCA 3TTSA 2XR1A 5CA0B 2XWBF 5G0TA 2OBXA 4I2FA 1YVUA 3E3NA 3TQQA 2H4FA 5C0YA 4ZT5A 2B36A 3CM0A 3VSDA 2VN8A 2RGAA 4NY8A 3WADA 2GB4A 2NO7A 1TJ5A 3AOGA 4COOA 4LF6B 5DVZA 3H6HA 2O57A 1K66A 4I2GA 5CFRA 5A4JA 1DBRA 1WXDA 4HDNA 4A5OA 1IY1A 2WTEA 2VK4A 4FDTA 4QJ5A 1LF0A 1TK9A 3WGGA 3G8AA 1ZGHA 3FSJX 2BZFA 4IOMA 3PQDA 2HRDA 2RMKA 1HFKA 3LGAA 5KG1A 3N97B 3DOUA 1V8BA 2FP3A 2AGVA 2HJHA 1EXWA 4Z3DA 2JJ1A 2JBHA 5KNDD 2H3ZA 1JVNA 2FZ5A 3FNIA 3K1YA 3ZU4A 9LDBA 3I5YA 2RSLA 3ZIAD 2WNHA 2FETA 1PGNA 5BN4B 4DPMA 3P0RA 2MTBA 4BGDA 4YTEA 4BLSA 1X7WA 3EC2A 3ABIA 3VAAA 4XKJA 1OXKB 1NK9A 1QQ5A 3NFYA 4V02A 2C2XA 2CMFA 2JF0A 2JHDA 1CIPA 4Q3NA 1OTYA 4ZRDA 3RTBA 2A30A 2IU6A 1CRLA 2EZ9A 2AB0A 2MINB 4D0SA 5A3RA 4PHHA 1Y42X 3FUTA 3L6DA 5BY2A 3EDMA 1GR1A 4COKA 4EYHB 5EVCA 3ERCA 1P75A 3TLXA 4HRXA 1NAIA 1SQ6A 3BL8A 1QIKA 4KVFA 3SYTA 3ZLJA 1P44A 4KQIA 3MERA 3PX6A 3UGKA 1Z4OA 4R9RA 2W42A 2O0LA 1KFJB 5JQGB 3WWPA 5JRDS 4IG9A 2ZETA 3L8ZA 3QZ7A 5KQSA 5CH8A 1VOTA 3PSHA 4MPJA 2VHJA 5KNDH 2Q41A 3UB2A 3DO6A 1NHWA 4D81A 5A7FA 2ZK7A 3OLZA 1A7JA 2OCXA 2JK0A 3B1WA 3NV7A 1USUA 2C54A 1WQ4A 4IEIA 4D97A 3GCXA 3CX6A 3C1YA 4XPIB 4Y2XA 4RQNA 3UQ2A 1AQYA 3HKCA 1FLNA 3NVDA 2P9BA 3RS9A 2FSUA 5DNYB 1QIDA 3V48A 3CW2C 1N6LA 5ITSA 1P5HA 4USAA 2Y1WA 2KI5A 3C3EA 1T29A 5TGZA 2GLTA 2H0RA 3KLMX 4M47A 1AH2A 4QG7A 4JY7A 1COKA 5BYBA 3HS3A 3QRWA 2QUZA 3F5FA 3L0DA 3GLHE 3VYUB 1B8OA 1ZNXA 7ICFA 2XWSA 5EXPA 4O3PA 2VA2A 1DX9A 4PZOA 1V41E 3Q2IA 2BZ0A 4B3MB 1PFKA 2J0UB 1N5RA 3THWB 4I3GA 1GZ5A 4YMOA 3CUWA 4M3NA 3L3FX 2TECE 4GVXA 4TQ9A 1PUIA 4OHOA 4ZT6A 3I83A 3K9GA 4BV2A 2GS9A 4QQNA 1D8AA 1JHOA 5EOZA 2WIFA 4I99A 3CEPB 4BP3A 1AHHA 2VOEA 7ICIA 4QU5A 3RAQA 1G2IA 3OJCA 3GGSA 2EHJA 4Q4DA 5CT4A 5BYAA 1S0MA 2ZSEA 2WD9A 4B9AA 2WA2A 1N1GA 3DB2A 4B44A 3GC6A 5CX1A 1D6JA 3CRW1 4YD2A 1J0AA 4C30A 5HCUA 1U48A 5IYZF 4KVZA 3TL3A 2Z58A 4RNDB 4OJ5A 1TK2A 3F7NA 5JECA 3HYRA 3OAAA 2WEKA 4ZCQA 4Z6CA 4LC1A 4LYFA 1OPXA 4I9HA 3EMDA 2AMYA 3KSUA 1LJ8A 1PL0A 4YMHA 5BNWA 3PTLA 2POCA 1OC4A 5D3QA 4ZOLB 3T9EA 3TAHA 4W5JA 2G67A 3FNBA 4CEHA 3N07A 3KDAA 3NI2A 4UXHA 5KAFU 1ZM7A 1N2CE 4OQNA 4WAUA 5AW8A 1AX9A 4LJRA 2GBPA 1VLBA 4A26A 3K53A 1CC1S 1PP4A 4HZUA 3VTFA 4NULA 4TL9A 4M7WA 4GC7A 1WXWA 3UMYA 2XMQA 3CP8A 2R1TA 1CRZA 4GLBA 3WNCA 3C7DB 1P6QA 1BXGB 2DCUA 2PWYA 1IBSA 5EWLA 4DBZA 1H3EA 4UBJA 3VUEA 3GHYA 4GD3Q 2O3QA 3PQCA 1GUZA 5J4YA 4YCLA 1SKSA 4X65B 4JLPA 2PQ0A 3WJ7A 3K75D 1GAXA 4XWKA 4N8DA 5K8VA 2W93A 3T7IA 2GBLC 3U4HA 3I42A 3WNVA 4N7RA 3NTLA 4X66B 1W7AA 3X0DA 3D7LA 5HHTA 1CEYA 3ZLBA 1RYNA 4ZCTA 2F1KA 4U2GA 3TDNA 3KFVA 1YQUA 3I01A 1Z6YA 4HH3C 1X2BA 4BVEA 5GINE 3TIVA 3K0KA 5ALUA 1TDJA 4K3UA 3FKSA 4BASA 5K3EA 2WU8A 1N2IA 4IJUA 2FSVA 1WPRA 4K6HA 2XWQA 4C21A 3TJRA 2AX4A 2YS7A 4PSKA 3K6SB 4XYGA 2JZBB 4WESB 4PHFA 4H27A 2ZZMA 1HUOA 3JS5A 1ZD8A 2X22A 2IUFA 5LOVB 1W19A 3UQ0A 1KFSA 1F38A 2JFWA 3QNMA 7ICKA 4H0FA 1W6RA 3U3RA 4C9BA 4X20A 3NDIA 5C7LO 3B12A 1KMHA 1OAKA 4ZJPA 4DOBA 1N9GB 2VZEA 2BH2A 3T3NA 2KX7A 3B3JA 4EHIA 2PIDA 4CWAA 3WZ2A 1CJSA 3FOZA 2HZBA 1W29A 1WKCA 5BR8B 4HH1A 1KRPA 4MVJM 3RIHA 3IP7A 5KSYA 1M2JA 3E0QA 4ARAA 3ZTWA 2PX8A 1KRHA 1IG0A 4F3NA 3D0RA 1GCOA 1YC5A 1QHFA 4DS5A 4D8TA 1SC3A 5AM1A 2VDJA 5EXEA 4D46A 5AVVA 1TCBA 1V7QA 2YUIA 1T3LA 4URUR 2Z5LA 3NIWA 5JE8A 1DV2A 4Q4LA 1LDYA 3B1XA 3GOHA 3LOQA 3WWYA 3FVQA 2AIRA 3HCPA 4EJSA 4KK4A 1Z2CA 2P6PA 4I81A 4MYRA 3QLUC 4DWOA 3HZHA 2WF8A 3O4GA 1KK0A 4IWNA 2JFFA 1VTKA 1JU3A 3WS7A 3KRTA 2ZYSA 3R3ZA 4ITRC 4I8DA 4WLEA 3AIOA 3W2FA 1S3GA 1PJAA 5KFNA 4QDUA 3FOEC 1VMDA 5B37A 6AT1A 2N47A 3UT5B 1OILA 1WF6A 2ENUA 4EJMA 3TSCA 1E2LA 1H4TA 2K8CB 1YR9A 1D09A 1U49A 5E6SA 4L4RA 4Q05A 4F4YA 3GJXC 5F1YA 4ZHQB 5M5BA 4FK8A 3IQGX 4MMYB 2O2XA 3OT1A 4P7GA 1PAUA 1M8GA 2DHCA 1CQWA 1TKDA 1U0NA 1NK0A 2BYTA 1NJSA 1KFKB 1C7YA 1NONA 4CZ2A 5DGHA 3FA2A 3NM5A 1XQ9A 4UQLA 1TCAA 2WSLA 5FBLB 3R5KA 2I8CA 1DKPA 2CUNA 3EA5A 4EGAA 1UK7A 4Y9RA 3HCNA 4U4AA 3ON5A 1WNFA 5CNIA 1K7SN 1D2AA 2VXBA 1DCFA 4B3HA 1SEPA 1AB5A 4IC9A 1Q0ZA 4MF8A 2C7BA 3GG9A 4DHWA 1TUBA 5CT9A 2V6MA 1QG4A 1KVQA 2OHFA 3V4OA 5CLGA 4OX9Y 4WE3A 3RCBA 3VTKA 2BFOA 2Q1XA 3DMTC 2HU8A 5TMPA 1D9FA 5LBIA 1UM9A 2BFBA 4KMOA 4YJ2B 2PZLA 1OVGA 1JPUA 2IVZA 4E1AA 1FU4A 5BXYA 1I14A 4DAEA 1BMDA 4X7PA 1L5VA 4KWEA 1PJCA 4D8XA 2F17A 3ZW9A 3LXUX 1FXWA 4K6KA 3HLYA 1TW3A 1A0OA 1QAMA 3F1LA 1TIBA 1RYBA 1H3FA 1RTKA 1UMCA 3TAPA 2IL1A 1UPCA 1E2EA 4ZZIA 1NKCA 4CKEA 2XCAA 4Q4HA 3WZLA 4HAVA 4IGKA 4NARA 2FH5B 3TBFA 2YWCA 1OH5A 4CMGA 1G2QA 1JA1A 4Q19A 3TLZA 1TQ6A 2ZYIA 1H5UA 5BVGB 3H2YA 3PNVA 1KTIA 2D7JA 3UWOA 4NOJA 4MHTA 3F46A 2IEDA 1VJDA 1TYEB 2PD3A 4MUGA 4D25A 4NJEA 1OIXA 4DWIA 2DC1A 3REGA 4AL4A 1NOIA 4Y8VA 3JQPA 5C7OO 3EN0A 4J0JA 3JQ9A 5CLLA 3DMPA 1CS4C 3ZUPA 3ZVKA 4QDTA 3EIXA 3D3NA 5AT1A 3SR3A 3SZGA 3K0CC 1SVWA 3KFLA 4Y1GA 1KJ9A 3BJZA 1DFIA 4R2LA 3PPIA 3S3TA 2BT4A 1PNTA 4C4ZA 3ZDZB 2A57A 3B9BA 1JHPA 4DLEA 5EIWA 5FHQA 2FW9A 4LX8A 4YWJA 4JBIA 4FKZA 3DOFA 1OXBB 1RBMA 1J2RA 2OP0A 4DCSA 3D0QA 4LW8A 3VKUA 3SAGA 5ALXA 2C3YA 5DM0A 1XZFA 1Z2AA 1IZ8A 4MZDA 3H1BA 4I2JA 1A3CA 1CBUA 3IR5A 4HYYA 1Q6ZA 1YDHA 3FNEA 1QP8A 1YNOA 4IHJA 1SV0A 3WL7A 5JEDA 3JWEA 4K9QA 1FF9A 2FEAA 3LT0A 4Q18A 2GD1O 1E89A 3FTPA 2ZDGA 3NXSA 3IT3A 2OD7A 4NC9A 5A5DA 1IUNA 4RKRA 2HMVA 4RY8A 1MRSA 1NG1A 4NOKA 4JMLA 4ZV9A 1EFRA 1V8FA 3ROTA 1LS6A 4ZWNA 2HJSA 5ERYA 1WVMA 3EXG2 1S2IA 2PFGA 2FE9A 5AJHA 1N2EA 2Y05A 4FS8A 1ZIOA 3C5CA 4DTCA 3HMKA 5L7WA 4L5IA 5KFWA 4FWBA 3O8BA 1ENZA 3LDAA 3WYFA 2D3WA 4GOMD 2ZIGA 1W88B 5IBPA 3GLIE 4JUIA 2IC5A 3UHFA 3CT4A 4DCVA 4UM8B 3CR8A 1C4OA 3ENWA 2ZJYA 1HH4A 2ONKA 4AKIA 4Q8EA 4DQXA 4EBCA 5HILA 2ZUVA 2ATXA 1OGJA 4Q15A 3PITA 3H9GA 1J8MF 1M0TA 3CUUA 3RUHA 2BFPA 2BFDB 1UIMA 2KQUA 3FLBA 2GTPA 2FX2A 4NYJR 4ROTA 4RLHA 2YN0A 1SCUA 4WN9A 1ZO8A 1CCWA 3AKYA 3WK7A 3CYFA 4R1OA 3CLTC 2AGQA 3WA6A 1PJSA 1EA5A 4UNSA 4UPEA 1R18A 1A9QA 4CDMA 2ZTSA 3UJHA 2R86A 5K6AA 4EYIB 1PFYA 5DEOA 4RH3A 2I4OA 4DCTA 521PA 4J9OA 1F0KA 4MIEA 4FPXA 5D84A 1K5HA 5EG5A 4MVJF 5JCJA 4BL5A 1RWWA 4LZJA 4BMSA 1Z0UA 3PKIA 3VUFA 3M6VA 4UD6A 3UMMA 2QBYA 5E0KB 1SXJE 1SV0C 4RGYA 3AB3A 1YQ9A 3BQ9A 1DVRA 4XD2A 4YP7A 4U7GA 2YV3A 4AN1A 2C2OA 4Z53A 1ESEA 1PEYA 3W8NA 4BMDA 3L7YA 2PUJA 1JIQA 2RGCA 5UKDA 1W8DA 2ZJ2A 1R4MB 2UZ4A 3HGMA 4JQYA 5CM9C 1U1GA 1PO7A 1TFRA 5DYWA 3WLMA 3ZZUA 3HWX1 3O9VA 4LHSA 3DE0X 4QTUB 2XA9A 4GR9A 4TTJA 4PCVA 4BE4A 3TLKA 4Y1RB 1YWGO 2A1TS 4PU0A 2W11A 3VU8A 1G4HA 4PTYA 3RYIA 3QVTA 2HJVA 3MMSA 4L7QA 3WNZA 3RV4A 1VBFA 3GFKB 2DR2A 3IAAA 3EOZA 1XJQA 2ZEJA 4R9NA 3PFKA 1IIRA 1JKIA 1TRKA 1FB5A 4FFPA 1KYYA 2UZ0A 1JLKA 1S0OA 1G291 2FE1A 2Q6LA 1X1BA 4C0AC 3DMRA 2H31A 4ZA2A 3UJDA 2Y1DA 3K71B 4HOYA 1A7KA 3MPUA 2IZ6A 4BNVA 1TEHA 4WV3A 1PWYE 5J2TA 1DO8A 5CVUA 3AKCA 4A6PA 4UHJA 3VV3A 2C61A 4MHSA 4DOCA 2UZ3A 3CPSA 1CP3A 1ESCA 1UJCA 4UOZA 2A9PA 4IMRA 3GGGA 1W9HA 1OCEA 3T5BA 5LMNB 3LL7A 1EWQA 3HXMA 3LJKA 1CJKC 5LWQA 1XO1A 4EGFA 5LZ9A 4L27A 4ARCA 3L4PA 4F2SA 4F2RA 1I2CA 1DKNA 2HHLA 3GLVA 3EPKA 1PI3A 2H57A 1YS7A 3H5LA 3QXGA 2M6LA 3HKBB 3RRXA 1SUPA 1DIHA 5BUCA 4M60A 2KMDA 2XGPA 4F6RB 4F84A 4F5WA 2P0YA 3OCCA 5JJBA 1KH2A 4JJ8A 3MINA 1H2FA 4HTFB 1UDCA 3F6EX 5HDQA 2XD9A 3F7MA 2XT9A 3PXCX 2HB6A 4OGGA 4FHFA 1PGQA 1QLWA 2HBYA 3PQFA 2JJMA 5KC9A 3A7EA 4QJIA 2R7MA 2HO5A 4X62B 3TR5A 5IHPA 5HJ2A 3GYBA 2I03A 2Q3FA 1UBUS 2WM3A 5JO0A 2G1UA 2BPGA 1Y6QA 4DXHA 2YHIB 1XRPA 4DL2A 2NYVA 2OD9A 2B8EA 2QZZA 2BEKA 3LLVA 3AZOA 1NRXA 2ODQA 3TAUA 4FEGA 4MYHA 1L8LA 1D9XA 4BC1A 2JAPA 3FMIA 3DOJA 2XNHA 4KSYA 4O5AA 4UJ3A 4OQEA 3N2KA 1PR1A 3OZXA 3MT9A 3DFKA 3BK1A 4D5GA 5AK0A 2HW8A 2AGOA 2AW3A 4FINA 2HSDA 3SHFA 4BNDB 4HWRA 4LXGA 5EJ2A 3PUJA 1Z7YA 3L0ZA 5JPCA 2GH1A 3H5RA 3A6DA 3EE6A 4GOLD 2AE2A 2ATVA 4L2IA 4LSWA 3ZXUB 4ZAVA 1UKVY 3GEDA 4UU7A 1PFGA 4ZV4A 4BKMA 2VQSA 1L5KA 2OCAA 1V3TA 1Q15A 3C1AA 5HJ5A 4U8GA 3WL4A 1TJPB 2Z4TA 4CLOB 1Z82A 3VR4D 4BQIA 1OWLA 2OCPA 1RC1A 2IXAA 1VDMA 4DMFA 5C3MA 1GIAA 4WKCA 3HSYA 2PPVA 3TOZA 1C50A 2CLFB 1ZC4A 3MDAA 5ALFA 4LJAA 1HSOA 1FIUA 4NH4A 5JSZB 2QUBA 5AHRA 1CI4A 1YAJA 1GP2A 1NXQA 2PGJA 1PIWA 3C0KA 4LV8B 5J29A 4A0QA 1U1IA 1TTQB 3EZXA 4MTCA 4ZVLA 3VU9A 3P26A 4RLQA 3LM8A 3LSTA 3AT1A 3IG5A 1R37A 1QHEA 3RC3A 1W5EA 4WGGA 2HY7A 3B3GA 1FE8A 3UBTA 1X6IA 3M33A 4JJGA 4G5OA 4GUAA 3JU3A 2YMMA 2J4DA 3RF9A 4Y98A 1KYXA 1Y9JA 1GRQA 5EJ7A 3O84A 3F2DA 3A9UA 4FFRA 3TNJA 2NYUA 1E9CA 3L9WA 4D80A 4A23A 3RBZA 1BEZA 2PZFA 3VR0A 1X7XA 4FLMA 4KYIB 1XNSA 4OQQA 4HC4A 1HEIA 2ZUBA 4F5PA 1ESDA 3G2IA 3PX7A 3PK0A 1ZM2A 9ICRA 1KOGA 5AFSA 3OSPA 5K4GA 2DUJA 2ZT8A 1OBFO 2WSMA 3PWSA 3NHYA 3TBHA 3ANXA 3CTPA 4JC5A 4I4CA 4JP2A 2YVAA 3SZRA 5JATA 1M76A 3KPWA 1ISPA 4F46A 5HOQA 5TDHA 3OD5A 4QODA 3AUSA 3EUFA 3IDSA 4NLKA 1IEQA 4RBNA 1M1XB 1IWBB 1U02A 3JQ8A 1N8KA 2GXAA 3SKVA 1N2ZA 2JG3A 4C8MA 1KIAA 5COBA 3FPBA 3ADCA 3B9RA 1OGYA 4J2OA 2LPEA 1OBOA 1V2GA 2C4HA 3IGFA 1CFZA 4KXYA 2BKVA 3HUUA 4S04A 3PEUA 2A0FA 2ZAOA 2HRZA 2EEPA 5I8PA 5IT5A 5CLFA 5H82A 3WP1B 1UC9A 2EL7A 4BIIA 2AC7A 4FJ0A 4IGFA 4GVLA 2C07A 5CB0A 3H86A 1WDWB 4EB8A 2O4UX 3F9IA 2H17A 3W8DA 2DPIA 3ECAA 4HATA 2IP1A 5C5CA 2EFCB 1EVEA 2OQVA 1GCUA 4ZCSA 3I5MA 3F6RA 3EXEA 4O0IA 3REFA 2JLWA 4F85A 1V8DA 2WWGA 4XWAA 3VR5H 3HCAA 5JMTA 1VP9A 2CLMB 3SCZA 2V59A 1V8OA 2V55B 4RW0A 2RHDA 5THXA 3LVBA 2C2ZA 2MSEB 1MF7A 3HZZA 4L1KA 1UKAA 2XE4A 2C5EA 1H8ED 3TCXB 4DAOA 3CCFA 4W1RA 4F3RA 4AK9A 4MLPA 4DKXA 4UAGA 2ATIA 2PXAA 3HVHA 4I4TB 3RTCA 4MV1A 1JXMA 1Y34E 3ZGXA 2CCGA 3H05A 3IKLA 2WWIA 4JHLA 3AY0A 1CR1A 1Y8QA 1DAOA 4NNPA 4N5HX 5CRIA 2ZYRA 3H8VA 5JAPA 3RRNA 1COWA 4WBSA 2HYIC 1XELA 3HWRA 5FEUA 3ZWKA 1RVDA 4ZTZB 1TO1E 4CGZA 1G8KA 4F50A 1YA8A 4K9NA 1SUWA 3WV5A 1E3TA 3QX3A 4LWOA 3CO5A 1QKIA 4DIKA 7ICPA 2IYTA 1U3DA 1B8UA 4HDSB 5EJFA 1ZGGA 1I3NA 3EFEA 3JR7A 4BLOA 4L8VA 3HP4A 3BMQA 3E5RA 3ZD9A 2F3RA 1MJNA 4FMDF 4N3BA 4U9UA 1FW6A 1SGWA 1UA1A 3BKXA 3OF3A 2BP7A 2I8LA 1I0IA 3RFTA 3QXCA 1E8DA 1W36D 1NUTA 1I4LD 4L72A 1O1YA 4ESHA 1ZQ1A 4LCJA 4TV9B 3WOHA 2X8JA 5CURA 1BRMA 3TLGB 1FTSA 3VYRB 3QNUA 3HSKA 2K7ZA 1ZP6A 5J2IA 1NJYA 3DMDA 1IQ0A 2NRZA 2IOQA 3RVRA 1XOIA 2ETXA 2REBA 4OHBA 3NW9A 3G8YA 5ADUS 2Y76A 3DTVA 4IYJA 4BJHB 4PXYA 2QY9A 1H2AS 3X1WA 1OREA 4DIFA 1R4ZA 1N33B 3NP7A 3HYLA 5TR9A 1DC6A 4AC9A 1HQKA 5LYYA 4DQDA 2OTCA 4NLNA 3D02A 3R7WA 1R2QA 4XEUA 5A04A 4CHGA 2HAEA 2G9QA 3I1FA 5JJKA 4W9NC 4H60A 3DTYA 3AX6A 3AHGA 2VHYA 3ET5A 3RRMA 3E7DA 1Q0RA 1CQPA 1YMUA 1L8AA 1WWKA 1DDOA 1TQDA 1UJ4A 1B0ZA 1ORHA 1GLVA 5SY4A 5JJIA 2BFFB 4WWHA 4RGBA 2PX2A 1DTWB 2AK3A 4YJKA 2J7PD 2DKXA 2PWBA 1PDOA 1WXQA 1ACLA 1UL1X 2ABWA 2QE7A 3SWWA 4MS1A 5IG2A 1M8FA 3G6WA 5K6TA 3E03A 5T5QA 3HJTA 3IP4B 1X14A 4BXOB 3K8YA 3I62A 3RFAA 4OFBA 2BSXA 3RS4A 2R8HA 1J4AA 4PAMA 5P21A 2EZTA 1L5NA 3O4JA 3FMFA 4IEFB 4IXNA 4Q4AA 1DUIA 2WKPA 1FVOA 4R2HA 4NMWA 3LXRA 2RCYA 3G1UA 3N5CA 3WIDA 4KXLA 2KV2A 2P2SA 4YUZA 2EG9A 1ZNQO 1X19A 3U39A 4K0RA 3W4JA 2GEJA 4QXRA 4EFMA 2BCVA 2HTEA 1M33A 1KYZA 5A03A 1GJRA 1GAWA 4RXTA 1ZIDA 4KN6A 4QTYA 2Y9UA 3BN3A 1P39A 4K86A 4FC7A 2SKEA 1P7PA 2K2WA 4IRMA 1I4WA 3RB4A 5CR0A 4L8FA 3P19A 4WZBA 3B9QA 5EP2A 5C35A 2VF2A 2QX4A 1JXLA 2V7QA 1J8QA 3WQHA 2N1MA 9ICPA 4WK2B 5IH3A 2X0IA 4BMOB 4QFBA 4UVGA 3RKRA 2I4TA 1SD1A 1K27A 1QGED 4TS3A 3TMAA 3WMWA 3CLUD 2W3SA 2YXLA 5KTNA 1BKDR 2RHMA 1DV1A 5C7YA 4D0LB 4X93A 2YKGA 1GG2A 2ZPUA 4W5HA 2BEJA 4D41A 1JEQB 3BWVA 4J0EA 2HWWA 5J0PA 4AG3A 1OJLA 2P30A 3IDZA 4R31A 1QYRA 4YROA 5C4GB 1J9ZA 3GPIA 3LRPA 1SAYA 4UUOA 3W3AD 1BCSB 1XZDA 2HHWA 3K0FA 1AQUA 2OAEA 3AF5A 1GUFA 4A3SA 3KU4A 2HNKA 2YZ2A 1FSGA 1IXZA 2XF8A 5J2HA 1KFBB 4OSOA 3AF6A 3WAKA 2X4IA 1BWRA 1QQ6A 3KQKA 2ORED 4UCXA 4YP6A 4QLOA 4MRVA 2G9RA 1UAYA 4B17A 2GSDA 3W5HA 4G5HA 4N48A 5KB3A 1SKBA 3NBFA 1FFVA 1G5HA 2W2KB 3EXIB 2YXPX 3AHDA 1PK1B 5EHXA 5F7ZA 2B69A 2QT9A 4J03A 1QTNA 2DUMA 3V1TC 3DBOB 5JCOC 4R65A 4PQYA 2BMWA 1EWYA 3O93A 2AJLI 4GVPA 2GF9A 1QLHA 1UR5A 2IPOA 4ND4A 2RGXA 9ICEA 4B8YA 1CNFA 3I34X 1KZ4A 3EIOA 2J3KA 1XDZA 2JAUA 1VGVA 1F1BA 4U6PA 1JDBB 4ZYWA 3V7NA 1K7XB 3CEJA 1FNCA 3TSOA 1VE7A 3HCRA 1M2VB 7ICLA 3U31A 2HNBA 1VSTA 2Q5EA 3D6TB 3HR4A 1ISMA 2PV7A 2IUUA 2G9VA 4KMUA 3B7WA 1DRWA 3R6DA 5TPZA 1BNCA 2PT9A 3DBRB 2HBKA 2WQ7A 3EWAA 4L4ZA 3N8HA 3C74A 3DAGA 4EHKA 2NU9A 4O5KA 1PLKA 3QWBA 4PYIA 1QSSA 2C94A 4DSKA 1QDUA 2OGWA 1M34A 1RM5A 3FYSA 3V4PB 5MGBA 3THVA 5KREA 5T4EA 1I7DA 5KG7A 3VNBA 5JAZA 3MJCA 2LYHA 3KQYA 4IGEA 2ZTHA 3QYAA 5IABA 1PJ4A 5JEEA 1X86B 5FPSA 1XVUA 4XIGS 5DP2A 3COYA 2JI9A 4GMHA 4XOIA 4OM8A 3CZRA 2J46A 4G5FA 4YJDA 3ESYA 1E1CB 2ZI6A 4FR2A 5KVSA 4K1LA 3RUAA 3R74A 5EHZA 3RVSA 1FMJA 1P3Y1 1GZ6A 4M1WA 4BLTA 4E33A 4PR0A 3G6VA 5B1EA 5LKRA 2J3DA 3TIXB 1NQUA 4RE5A 5EJGA 1O96A 5REQA 3EVEA 4U2EA 1OZFA 3PD7A 1BWPA 2MMGA 5NLLA 2BSAA 2FHSA 5FAKA 2I34A 4ALLA 1E6UA 3BZCA 2BCUA 4HRYA 4ZVMA 5LQNA 1TT7A 2ORWA 2Y67A 4PXSA 4WJKB 2RHWA 2PXHA 2W48A 5HUJA 3QJGA 4M0EA 4QZFA 1TTHA 1CF9A 3HZRA 4E14A 3RRGA 2FKAA 3RJTA 3CIFA 3IIIA 4RZ3A 4TLCA 4URZR 3A2NA 1YR7A 4UASA 1DRKA 4A82A 4MEYA 4DLNA 1JX4A 4CF6A 1EFDN 1JDVA 5DHFA 5D5HA 5IUKC 4OHWA 2APJA 2JLRA 3HO8A 1AMUA 4DM4A 2K87A 4KO2S 4CDRA 3OE7D 2VBFA 2HCFA 2OYRA 2PRJA 3I1YA 4Y3UA 5EN4A 4ZARA 1TEZA 2E2WA 1UEIA 1P74A 1JE1A 5FI1B 2D7CA 3ABSB 4JEHA 3KQHA 1G55A 4PM4A 5I7RA 1FFGA 1SVSA 2C99A 4Q12A 1BC5A 4LKRA 1Q7RA 4Q8FA 4EHHA 2QDKA 2JLZA 2P2CA 1WTAA 3GDWA 3LF2A 2QMZA 5HHHA 1B2LA 5JAHA 4IQGA 5H9VA 4QYIA 2Y1GA 1E99A 4GRDA 5DLYA 3OQ6A 1TA9A 3MJRA 4DC0A 3TPCA 4YS6A 3TQFA 3ABRB 4UTRA 1ZQBA 8ICNA 2A7QA 2JEFA 1YOVA 2Z3WA 4FR5A 3HXPA 2VNHA 4KYUA 2YHBA 2FF5A 5BYKA 2FZGA 3CW2A 4TYWA 4YUXA 3HDTA 1RG6A 1QU3A 2X0RA 2GM9A 5TEVA 3FH0A 4WFIA 5JH7B 3T52A 3KJZA 1KVUA 2IVFA 2YICA 1EUYA 2OBLA 3VNSA 3GPDG 2JKYA 3HPOA 5JT1A 2ONJA 1I7PA 4RFSB 2VYFA 3A27A 3LAWA 3PFGA 2XKKA 1RAFA 2FUCA 1IXSB 4YRDA 3RK1A 1FVFA 2XUDA 3D64A 2M2IA 1A4XA 4NFHA 1XUOA 3LLSA 3NBXX 2HD4A 3OU6A 3O1IC 1AN0A 4WH0A 3I4LA 4F5ZA 4G8BA 1WCXA 3GD7A 2JIZD 3KOUA 1MJFA 3NUGA 1CZOA 1D0VA 3D2SA 3HKZC 1RKXA 5HTOA 2D2EA 2HM7A 3NT2A 5HIMA 3C2KA 1RBYA 2HJRA 4L4YA 3HA7A 2FFHA 3C6QA 4R51A 4PSUA 1NKVA 2KD1A 4M8SA 1JDBC 4NCXA 3KJXA 1DJNA 4M1MA 5KYNA 1E2FA 2VT3A 3WB9A 1NXVA 1OX5A 3SMQA 2RGUA 3SZOA 3QU7A 4JZYA 1QH1A 5IASA 4JA2A 2Q99A 4KLRA 1SJ9A 3PE3A 5JG7A 1NP6A 2P8SA 5E9QA 4DLLA 4K05A 3IVCA 4FU0A 2EWMA 1QDEA 1UQRA 3GPBA 2HCJB 3QF4A 3TOVA 2LZ0A 4JB0A 4DLXA 2E4WA 3MVEA 5EWEA 3KYCA 2QMQA 1KKUA 2WHPB 5LQAA 2YW2A 5AI9A 3HC7A 1OV6A 3NR2A 3E82A 3KOWA 3N2ZB 4QUDA 4UAJA 3DWEX 1FTNA 5CA0A 2RHJA 3LK6A 4X84A 4LBWA 4U7WA 1UDBA 1FRQA 3CQ9A 1PZNA 1R0WA 4QRHA 3R7NA 1PSWA 1BNPA 1Q19A 4CIWA 1JU9A 3JALB 3SSOA 5FV4A 3IAXA 1HDIA 1KC3A 1ONOA 3KP1A 3L7IA 2Q4DA 4BCCA 3U6BA 4DMRA 4GKVA 1PTKA 1B3BA 4MYTA 2GBLA 4LQCA 4RPLA 4WK4B 3NHAA 4O2BA 4B3FX 1QK3A 5JC8A 1MIOA 1QB7A 2Q4EA 1UPAA 1RXEA 3OUZA 1GTG1 4UC0A 3TYXA 2UZ1B 1YZNA 3L0IB 1YR8A 4QASA 4YHBA 5BOLA 5LNK1 3UCEA 1GLNA 4KIJA 1Z68A 4X7BA 4WUVA 3UGTA 1H2ZA 1RQNA 2OENG 5BN4A 2E4ZA 3ZNQA 2BR3A 2EW1A 5BP7A 4Y2TA 1WB4A 3ZD7A 4DMKA 3IT1A 2GNPA 2ZW9A 4AU1A 4P2GA 2TMGA 4MI6A 3T5HA 2G9NA 4EDHA 1SRRA 3IKVA 3R76A 3KZXA 3COSA 1JI3A 3QUQA 1XCMA 5G53C 2AD5A 1FXUA 1RLUA 4TLLB 2PR2A 4QGSA 2UVVA 1CQJA 2VTBB 1CJBA 2ZTVA 1V45E 3CVUA 1Q77A 3BDVA 2QTMA 5FFFA 1QRUA 3LC7O 2OCGA 3NBZC 1AO0A 5F1KA 2VDNB 3MDCA 1RAAA 4ZCLA 2XBLA 1LV8A 3WWCA 1DAHA 3RRJA 3I58A 2GZHA 2YVQA 1PQYA 3QVMA 3VO1A 5DN6A 4LY9A 2R6AA 4XYBA 5MHTA 5JQGA 4BC0A 1GNPA 1WDMA 5KFXA 1G3MA 5AIBA 1A5SB 3GWGA 5LDGA 5KT6A 4E94A 3WKCA 1X7HA 4YR9A 2BI7A 3DV2A 1MH9A 2P9ZA 2X5XA 3MWLA 2GCNA 4ZICA 1O6GA 4OATA 1QKJA 4IUCS 1PT6A 1QQAA 4DR4B 3BAFA 1N0VC 5EKTA 2PQMA 3IPRA 1HIWA 4XPIA 4URXR 1WHTB 3A1CA 3PJEA 3A31A 4Q34A 1UZAA 2ZRDA 5C1OA 2OCEA 1KFCB 4TSFD 2ZRGA 3BS5B 4FT4A 3QLUA 4ECXA 1CY0A 3Q41A 2ALZA 4W5RA 3FSGA 2JIPA 3M4YA 1Z8DA 2PU5A 3TEMA 3NS1A 2VPTA 3GLGB 2XUIA 1C81A 1ONPA 1NVKA 2LI6A 1Z6QA 4US1R 4ZVUA 3QV2A 2EFYA 2GAJA 4YJFA 1VKOA 2FW6A 3PDIB 3TUZC 3T5LA 3ZR4B 4ZQEA 1D6MA 2VJYA 4LF5B 2C5AA 2NV6A 2J0UA 1I2BA 3E0XA 2XC9A 4XSGA 3THWA 2OB1A 3DE7X 4PFJA 2O2YA 3SHQA 4G81A 4Q47A 1BU5A 3KOMA 4Y1EA 4RIIA 3U1VA 1N0IA 1SU7A 4CI9A 1TD9A 3P2IA 1MOZA 2YWRA 4PRYA 1V85A 1U0HC 1SBCA 4PNHA 2W7PA 1SULA 3HG7A 3FROA 2A1AA 4CTNA 4J9UE 3ZY3A 1IEVA 2VHVA 5IKMA 1GAJA 2F00A 1JXOA 4CVNA 4GBJA 3OO0A 5BQOA 3KWJA 4G56A 5KVQA 2I9GA 3DCJA 4GSYA 2VPYA 4OQXA 3EVFA 2A67A 1OJ7A 4MLDA 1N2HA 1IMJA 1NR7A 4RF2A 4RK0A 1YA6A 7ICUA 1CRWG 2KKPA 3G5MA 5BW4A 4Q45A 1JS1X 4DLPA 3JQQA 4WA7A 5C31A 2H3VA 1NBMD 3HB0A 2CXOA 5E2BA 1E3LA 2VL7A 1AZSC 1JJ7A 2G1PA 4PW0A 4Q43A 3CRZA 4F5EA 4MYUA 4F5NA 3DT9A 3IUQA 1E77A 3W6ZA 1Z6GA 5EJ6A 4HTAA 1A96A 3LUPA 3MJHA 2MIIA 3IAEA 3U3MA 4FNGA 1HFWA 3DMTA 3RVBA 2E5FA 1JKJB 4QBIA 3JD2A 3TXYA 3GCZA 2ZSUA 3BKWA 2GBCA 3EQ8A 3T54A 3R9KA 4IRDA 2O0HA 4WA8A 3AR5A 1MP0A 2IYYA 2JH3A 3L77A 1VSUA 2HBMA 1H8HD 3BQ7A 1A76A 3ZE6A 4DNFA 5AK5A 4N0QA 4KBYA 3HJHA 3SYLA 3FWKA 1E9VA 3DPSA 4LBVA 4MR9B 3FCEA 1BXGA 3C8ZA 2FOXA 3RAGA 4ED6A 3KVYA 1DSSG 4CKYA 2IWRA 1KPGA 2MJLA 1D1PA 4FFLA 2R44A 4IJQA 5CXSA 3K7EA 5IBCA 5IKOA 2H2AA 1DT3A 4RQ0A 2G70A 4UBNA 4RF5A 4ZK2A 1DO2A 2WYVA 4YP5A 4OU4A 3N74A 2BW0A 5I7VA 4G0ZA 3A3NA 1VIMA 1EFVB 1GRCA 1MQSA 3PNQA 5FBQB 2FUKA 1BFDA 4RA9B 5EINA 3EIWA 3U0VA 1RT9A 5AW1A 4KR6A 2BHTA 3W06A 1ZQ9A 2JC3A 2BN4A 2PFKA 2B8JA 1XIVA 5DXAA 4J94A 4HMOA 4IO0A 3DF7A 6GPBA 4J9LA 2VHUA 4EHBA 4ZDJA 4F97A 2QR2A 3K0CA 2UXCB 3V8MA 1B76A 3C3MA 1TM4E 2QUHA 4O1IA 1IUOA 1QUEA 5B2ZA 2PV0A 5CB6A 2GO7A 4MVJE 1AUVA 4NLLA 3NBAA 5JPDA 4E1VA 4DM3A 4XAQA 1Z2NX 4QNNA 1NUHA 4RMHA 3C1TA 1BQEA 1A5TA 1XHLA 1TEVA 3P9IA 4W5OA 3N7AA 1J09A 4B6PA 3V1UA 1GZUA 5IEJA 1ZG3A 3W5AA 1EINA 5K0GA 4CQJA 3RGWS 4R7TA 3W7BA 1ZCJA 2DBZA 3M1IA 1LLDA 121PA 1OZAA 5FWNA 4QZGA 4KIWA 2GHIA 2OC9A 2P65A 4DIEA 1MQ3A 2Q6VA 2E1EA 1O5OA 9ICOA 2YTZA 1T8SA 4EG5A 1FYXA 1TA0A 4LE2A 3I2IA 1RPNA 4S1TA 3UK7A 5DNVA 4MPTA 3HJEA 1T15A 2JLQA 4QXMA 3GO4A 2H3FA 4QDXA 4B75A 1SG6A 4TWIA 5LA6B 4IF4A 4PJ0U 4NBVA 4ALMA 3MWJA 4GKJB 3GIMA 2Q2WA 3H0RB 4BB0A 5C9ZA 4JJ7A 1PBNA 1U90A 5DM2A 1OTXA 2WUEA 1NM5C 4RVUA 4JBGA 1R8QA 2ZSIA 4IILA 4NL9C 5AUQA 2ZUDA 5K3FB 5TVKA 4RVDA 1E1LA 4X54A 4QUAA 4M1YA 1F60A 2QP4A 3W9YA 1VHJA 2A35A 4N12A 2GYWA 3VPSA 1EP3B 4JOBA 4PO9A 4DZRA 4R8VA 4EPXA 4U1RA 3VDRA 1KI6B 1YI8A 4IICA 5L3ZA 1RHJA 3TVTA 2C0PA 2VZLA 1H4QA 2R8IA 5IBQA 3NVMB 4ARZB 3WO1A 4J9VA 3W6OA 3UT5A 4CKWA 5BT8A 3P9ZA 5AXCA 3TRDA 5GV7A 3BJEA 4H15A 4ZHQA 4M9CA 4GM1A 2WR8A 4BJQA 4R8KA 2AOTA 1QZTA 2OAGA 1G9SA 4AXXA 1PEAA 2VXOA 2BDEA 1WU8A 3C48A 4KYVA 2UXBB 5AJXA 3PFCA 3EJ6A 4PZPA 1KJIA 2H1IA 3SVZA 1FS6A 2QTCA 2AE1A 3EZNA 3ROEA 4BE9A 4G0XA 3DCYA 4I2CA 2EKDA 3D4OA 5EUQB 3ONVA 4BZXA 1R9JA 1PTJC 2OECA 1OFVA 1MXFA 5LQSA 4BMCA 4MXDA 1PZMA 3F71A 3WDLA 2IXFA 5TY0A 1RBQA 2I8AA 3W1EA 4FYVA 2Q1UA 1S5LU 1TVCA 1ABFA 4IY1A 1QSGA 4YYEA 1A9OA 1I7SB 1TPZA 1E2NA 1U98A 2QKYA 2FSHA 3WLHA 2PUEA 1YQQA 4IX1A 5LDDC 1QE0A 1ID8A 3Q8RB 4RD3A 3HBLA 2IJGX 1LBEA 3UUFA 2Q0SA 2QWXA 4GKBA 1Z5GA 1KFEB 2REOA 2I9PA 3IDQA 2R66A 1QFJA 2P7HA 1YF3A 1J49A 1XJWA 1IN5A 2ZE7A 5LIRA 3D4NA 1KJNA 2Y0CA 1X1SA 4IKOA 2DY1A 3O82A 3H2IA 1HM5A 5LUAA 1ZHFA 5ILOA 2J0QA 2DP4E 5B58C 5K20A 3GN2A 4E88A 5AVUA 3ISJA 1INLA 2EBFX 4NCNA 3K2QA 3PFWO 1P0PA 1YL6A 1NF8A 3QWAA 3RU2A 2NO9A 1UBJS 5AH0A 2A6PA 3ZWBA 3A1FA 4JLDA 1BH6A 3DF9A 1R8JA 5KYWB 3HO1A 2F3QA 2C2YA 1WA5A 4KLDA 4NHEA 1N62A 3RH6A 4JITA 5BVGA 2AEMA 3G0HA 4RS4A 4YFVA 5KFTA 4MWTA 3GMIA 4XRRA 5DBHX 4P3KA 2JNWA 1N6OA 1O57A 1BU8A 3T5GA 5CAEB 5DB7A 1QH9A 4QKQA 2O7SA 4MV0A 5C80A 3K94A 2VP5A 4Y2YA 3SZMA 2QGFA 3WJ1A 1NZDA 5DO9A 2I3AA 2GA9A 3UEOA 2SICE 1QTQA 4L02A 3OIVA 3DOIA 3QWFA 2XDQB 4GXRA 2FXVA 3WB1A 5DDMA 4MRSA 1SZCA 3JASA 1OXXK 2XMGA 4CIYA 1ULAA 2Z43A 4FDVA 4LI3X 1X9WA 4AICA 2FEOA 4JOSA 1R0KA 1MH1A 3CWZA 4RCZA 1PS0A 5IMBA 3P9RA 3O5AA 4CKZA 1I6MA 1ZXBA 4EUHA 1Q22A 4P4OA 2YINC 4WNIA 4M36A 3JWJA 3LPNA 2R84A 4M9GA 3IBYA 4RQMA 2GN2A 4UEQA 4NLZA 4JL5A 1M8JA 3ULKA 2ODEA 2KP7A 1G20A 4CL2A 2PSFA 1DAIA 2AMLA 4DPKA 1DAGA 5KCMA 2GPWA 4JBWA 2VPWA 2NSYA 3G49A 1WG8A 2AG6A 2QQ0A 3K5PA 3C3KA 2FR8C 3UG7A 3IURA 3PUHA 4DR3B 1Z6AA 8ICKA 3ENZA 3PTAA 4G0VA 4RSRA 4DBLC 2RK6A 1H2YA 2NQ2C 1XTPA 3AUXA 1BXRB 5J5AA 3V4LA 2RE8A 1AMOA 2REXB 1BD4A 1K92A 4Y7CA 2NV3A 3L92A 1L7NA 2ZI9A 3PB3A 3L8DA 3LCVB 3UIEA 3P1JA 1W88A 4K40A 4QUHA 1K63A 5HWSA 3C39A 4YVFA 1HYBA 1D4AA 2XOEA 8ICZA 2F67A 3WMRA 5EE9A 1VE5A 4PSCA 2HADA 1FX0B 1ZX1A 1K7YA 2QRVB 1FDWA 3OZ7A 4XTRA 5JAQA 3KSZO 2WHYA 1MB2A 5U4XA 2PYIA 4N18A 2XRFA 3WYEA 4EGCB 3LBAA 2IMWP 4DFMA 2VH1A 4W63A 1VMEA 3IAHA 4ILKA 4MCJA 3KXDA 5JD6A 4XFKA 5FFNA 2XMZA 1KI9A 2XCSB 1A4UA 4ZZ1A 4ZPXA 3GVXA 3IQEA 4DMGA 3C1ZA 1ISFA 1QNLA 2D5IA 5EZSA 2MAXA 5J2FA 2DHQA 2IZ7A 4MV8A 3B5JA 3V6JA 2IDMA 4PS1A 4A2QA 1G5RA 1EFHA 2WP8J 1NBHA 3LF1A 2XAAA 4U3JB 3TLCA 4ADSG 2A9RA 3AR4A 3H2BA 1JKFA 4C7KA 4JH0A 4KX5A 3GNTA 4ESEA 4ENUA 4C6SA 4ED0A 1YKSA 4MP8A 1DOAA 4D45A 4NY1A 4KLIA 2P2LA 2WF5A 5LMZA 3RJHA 5C81A 4IIEA 2COUA 1GO2A 2Y1EA 2W2MA 3HE3A 4NPCA 4YAJA 3DXZA 3Q8LA 4YT2A 1EUCA 4MW5A 1G9TA 2H0QA 1QFXA 1RAIA 4D6YA 3UJ9A 1M66A 3TFQA 5DBOA 3ZGYA 4YMMA 4A2WA 1ZN7A 3IC5A 3IRUA 1JGTA 4OLJA 1R4MA 2JDIA 1D2GA 1SKMA 3JR3A 1JPJA 3INGA 3O4VA 4DSUA 1WR8A 5JYBA 3H0MB 3FWNA 1SNYA 1GFSA 3GEGA 3TGPA 3ZW7A 4MI3A 4EECA 5CYFA 1C0LA 2OHVA 5J2GA 4FHEA 1GKYA 4Y1RA 3JXEA 2GYYA 2ODAA 1HOTA 4AJ2A 4NTZA 3R5FA 5ALNA 2R6HA 4EENA 2NSHA 7ADHA 1CF2O 2CL5A 1UH5A 3NATA 5AKEA 1GGFA 2CXNA 3LP8A 1VLQA 1Z00B 3ZKWA 3ZBQA 1FSFA 4NU5A 2YN2A 3IA7A 3H83A 2CHQA 5IIJA 3QNWA 3GZNB 2XZDA 1VJCA 3OLWA 1V7ZA 2O19A 4N0MA 1YFJA 4ZCIA 4WFQA 2ZBRA 3RPEA 2JLVA 1Z4IA 3EDOA 4MO2A 3CSUA 2HHAA 1RRPA 3FC4A 3IP8A 5SICE 4L3OA 4RDHA 5BRJA 1OV4A 1V1MB 2IS4A 4DDVA 2JFNA 4B3SB 4DLGA 3NT5A 4PPFA 2R8KA 4U7DA 1E6WA 3TW0A 1JHMA 3P2EA 5AKHA 5E3HA 4NHOA 1IXRC 4D79A 3QXXA 1EFKA 5F1OA 4R83A 4OH7A 2ZBVA 3GJYA 4ZV7A 1BE1A 4C80A 3T4EA 3NAZA 1RWKA 1QCCA 4M83A 2ZT6A 2RAUA 3W2EA 3BA6A 1KEKA 1C7ZA 4Z1MD 4ZDWA 3B78A 3MFQA 2OXRA 1GNSA 2YX8A 1C9KA 3O7MA 4HEJA 3RR8A 1K0FA 4TV8F 2G8NA 4PGMA 3MS4A 5IVIA 3RLIA 2C3OA 1XCBA 2R7LA 1SXGA 5I48A 1V6AA 1C1XA 3U6KA 1Q21A 1E1KA 3HKBA 1CJUC 2YDYA 4G67A 2H4WA 1C8BA 2F3TA 3PR4A 1IN6A 1SMKA 1DKQA 1FFHA 3EBOA 4HPWA 3GV7B 3OJXA 2BM1A 1RU3A 3RH0A 4DGQA 4I8XA 3ZGLA 3I2YX 1UBGA 4OHFA 3UQZA 2BTQA 4J2TA 2WWVD 5IS2A 3WVNA 1ZCZA 3ZG6A 5J0UA 2PKCA 5DJ5A 4JC8A 2VA8A 3K70B 4R2MA 3VR4H 2OZLB 3GPLA 1KDPA 2JKZA 3P5BA 1T3HA 1IAQA 2P67A 5L4SA 1T0IA 4LWPA 1SZDA 2F90A 4R1QA 2ADFA 4IDCA 3COPA 2OV3A 2H1WA 3QYFA 4O4HB 4WKNA 3QE3A 2W58A 4K7JA 3LCCA 3PWTA 3O94A 2IYAA 1XAGA 2ZZNA