2B0CA

The crystal structure of the putative phosphatase from escherichia coli
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
199
structure length
199
Chain Sequence
AKMLYIFDLGNVIVDIDFNRVLGAWSDLTRIPLASLKKSFHMGEAFHQHERGEISDEAFAEALCHEMALPLSYEQFSHGWQAVFVALRPEVIAIMHKLREQGHRVVVLSNTNRLHTTFWPEEYPEIRDAADHIYLSQDLGMRKPEARIYQHVLQAEGFSPSDTVFFDDNADNIEGANQLGITSILVKDKTTIPDYFAKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The 2.0A crystal structure of the putative phosphatase from Escherichia coli
rcsb
source organism Escherichia coli
molecule tags Structural genomics, unknown function
molecule keywords putative phosphatase
total genus 69
structure length 199
sequence length 199
ec nomenclature ec 3.1.3.10: Glucose-1-phosphatase.
pdb deposition date 2005-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2b0cA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2b0cA01
2ODAA 2C88A 1VJRA 2ZG6A 5AIAA 3KBBA 1SU4A 2G06A 5AVTA 2WF6A 2CFTA 3N5KA 2P69A 3MMZA 4NWIA 4JDPA 3IRUA 3U19A 5ALXA 3RF6A 2FI1A 2AH5A 3U7EB 3FM9A 4DCCA 1RKQA 3MC1A 5ALTA 1U7OA 4UMDA 1XPJA 4RETA 3WK6A 1T9ZA 3NAMA 2JAUA 3M9LA 3EF1A 3L1VA 2AUTA 3B9RA 4ZEXA 3P96A 5IT0A 4JB3A 3FVVA 4EX6A 1RQLA 1RLTA 4HGOA 2FPXA 2OA0A 5ALFA 3NIWA 4HGRA 5ALPA 2ZBDA 3WKBA 2EARA 4L57A 5AKGA 1RKUA 4UMEA 4BX3A 5AI9A 3UMCA 3SKXA 3K1ZA 1Z4NA 2B8EA 3EWIA 1SWVA 1K1EA 2HO4A 3W5AA 2R8EA 3WKEA 2NO5A 3QUBA 4FYPA 4ZEVA 3L7YA 5ALDA 2YJ6A 2BDEA 2G09A 4UAVA 4OD0A 5AW2A 4ZEWA 2RARA 5AKHA 1YMQA 3I28A 1QQ5A 3OTQA 3I76A 5ALLA 1IWOA 3AR7A 2RB5A 4UU0A 2ZBGA 1T5TA 2GHQA 2PQ0A 5AM3A 2IA5A 3L8GA 1VFPA 3E84A 3FPSA 4Y2PA 1RDFA 1WR8A 5AI8A 3GYGA 1ZD2P 2I55A 2IYEA 4RESA 3QNMA 3SLRA 2G80A 3UMBA 1TE2A 4OFZA 1Z4JA 4XQ0A 1TJ3A 3I6BA 1EK1A 5AM5A 3NASA 3D6JA 3WK8A 3B8EA 2B1RA 4NFLA 3KDPA 1SWWA 1Z4PX 4MUMA 3KC2A 1U2TA 2FPUA 2C9MA 4DW8A 3SF0A 3UMGA 1NF2A 2CN1A 2G1AA 3E58A 1L7PA 2YMLA 1U7PA 2BDUA 2CFSA 3KZXA 3OCZA 4EX7A 1RLMA 2QLTA 1WVIA 2WF9A 4UM5A 5AW6A 3I1YA 1RMTA 1YNSA 3ESRA 2Q4TA 3L0CA 2I33A 1Z4OA 2I34A 3ONNA 3QGMA 4PNHA 3WGVA 1X42A 1ZJJA 3L5KA 5T41A 5AI5A 1QYIA 4BYGA 2Q5EA 2OBBA 5AW3A 3NANA 1L7NA 5AK4A 2FPWA 3HLTA 4YH1A 1PW5A 4F71A 5ALVA 3OPXA 4Y2YA 4UM7A 3QX7A 2R8ZA 2B8JA 1ZD4A 4BKMA 1TJ5A 1RKVA 3QU2A 3QLEA 1J8DA 2YJ5A 4Y2UA 5AM1A 2I6XA 1O08A 3MN1A 1RQNA 3BA6A 3SMVA 3OCVA 3QUTA 4J2TA 3DNPA 4E88A 3ZTWA 2EAUA 4EENA 2FUCA 4BNDA 5ALGA 2ZOSA 3OCUA 2R8YA 2FEAA 1TA0A 3QU7A 1Q92A 2C8LA 4UMFA 2FPRA 1Z5UA 5AW9A 3N8GA 4OCZA 5ALSA 3N07A 5AM0A 2W11A 4AS2A 3R4CA 3ZUPA 5AI6A 2B82A 4KX5A 1WPGA 4KNWA 4BEVA 5AVSA 2WM8A 4C4TA 4Y2JA 2IOFA 1JUDA 3PCTA 2JARA 1O03A 5ALEA 4HYTA 3UM9A 4BEWA 5AESA 1RMYA 5JJBA 3KD3A 4HAIA 3ED5A 1RC8A 5AVRA 5ALQA 3ZVLA 3WKAA 3L1UA 2HI0A 1TJ4A 4DWOA 5AW7A 3OCYA 2NO4A 2GHTA 4Y2SA 3AR9A 5AW8A 1L8OA 4G63A 2YN4A 2YJ4A 1L8LA 2HF2A 4Y2QA 2HCFA 3IB6A 4YIKA 4B6JA 2W43A 3SKYA 5A3SA 4UASA 2W4MA 3VAYA 2DQSA 2PKEA 4Y2RA 3RFUA 1AQ6A 4EEKA 5AVVA 4J03A 2HHLA 5AK3A 5ALJA 3NUQA 1VJ5A 3CNHA 5AK5A 4Y2TA 1NNLA 5AVXA 5ALNA 3SD7A 3J7TA 3L0YA 5ALYA 1NRWA 1Z4MA 4QJBA 3L8HA 4BX2A 2AMYA 1N8NA 3ZWKA 1J97A 5AVQA 2ZBEA 3HYCA 3ZX5A 3L0BA 5AVZA 5AKYA 2FPSA 3A1EA 3L8EA 5AIBA 1YV9A 2CFRA 1QQ7A 1WZCA 3E81A 4IFTA 2JAOA 5AI0A 4L6CA 5AW5A 3U7FB 3PGVA 1ZD5A 2YMPA 2YFYA 4KNVA 3A1CA 1RPZA 2P27A 5AVUA 3EPRA 4HGNA 2P9JA 3IJ5A 4GXTA 1QQ6A 3B9BA 5AW0A 3KOOA 3A1DA 2HDOA 2R8XA 3BWVA 3QXGA 5ALKA 1L6RA 2MU2A 2ZXEA 1Z4LA 1EK2A 2G08A 3M1YA 5IT4A 3QU9A 3DAOA 4FE3A 2WF5A 4CF5A 5ALUA 4AS3A 4BX0A 5ALHA 2YY6A 4UU1A 2Q4RA 3WGUA 5ALOA 4OHFA 3ZVNA 5AM4A 1ZS9A 4BBJA 3MPOA 3QUQA 2FDRA 1XP5A 2RAVA 3FGOA 2D2VA 3ET4A 3NALA 2B1QA 1YJ5A 5ALIA 5AI4A 2GO7A 2OYCA 4EELA 1ZRNA 1Z4QA 3FZQA 4XOUA 3S6JA 3N1UA 4IG4A 5AKJA 1N9KA 5AKEA 2ZBFA 2WHEA 3NRJA 4O8CA 3WK5A 4F72A 1T5SA 3QYPA 2QYHA 3PGLA 5AICA 4L6AA 4XPZA 4HGPA 2C8KA 1QH9A 3AR3A 2AGVA 3ET5A 3FPBA 3ZX4A 2YMQA 4EZEA 3ZVMA 5AKLA 1L7OA 2G0AA 4KN8A 1ZOLA 2NYVA 5AHXA 5A3RA 4YGYA 1F5SA 5AW4A 2VKQA 4UAUA 4NABA 1Z4IA 2HF7A 4KX3A 3A3YA 1Y8AA 3EF0A 1ZD3A 4FFDA 2YMMA 2BY4A 2HOQA 3ZWDA 3L8FA 5AM2A 2RBKA 4CF3A 2WF7A 3WK7A 2HSZA 2X4DA 3QU4A 3R9KA 5ALWA 4C4SA 3W5BA 4Y2XA 4XE5A 1YDFA 1U2SA 2C4NA 1KYTA 4GIBA 5A3QA 1L7MA 2YJ3A 5AVYA 3N28A 3WK4A 4CF4A 2OM6A 2O2XA 2GMWA 4MWOA 1RLOA 4YCMA 5ALMA 3AR8A 5AK6A 2B30A 4YCLA 3CZ4A 4CNQA 2O9JA 1CQZA 1LVHA 2B0CA 3ZW7A 4H1WA 3U7HB 2EATA 2PR7A 3ZTYA 4G9BA 2GFHA 3E8MA 4UARA 5AKZA 1Z5GA 3U13A 3F9RA 1S2OA 3AR2A 4I9GA 3U7GA 4YIHA 3DDHA 3ESQA 3AR6A 3OCXA 1CR6A 3AR5A 4C4RA 3WK9A 3WKCA 3QUCA 2G07A 4Y2VA 3DV9A 2I7DA 3W5DA 2FUEA 3R09A 5AKKA 2JGAA 4UW9A 4NV0A 5ALZA 1LTQA 1Z4KA 1U02A 1RMQA 1S8OA 4NAVA 4Y3UA 1Z88A 4UATA 4QQFA 3SHQA 4I9FA 4HGQA 2WF8A 4BNDB 1YS9A 1XVIA 5E0OA 2IOHA 3PDWA 2JAWA 5AW1A 1Q91A 2I54A 4KYTA 5IS2A 4CE6A 3WKDA 1ZRMA 2HEGA 3ZU6A 3W5CA 2MU1A 4AP9A 5FP0A 5AVWA 1RRCA 5ALRA 2WFAA 3ZI4A 3U26A 2P11A 5AKIA 3TLMA 3OCWA 2YBDA 2MSNA 4UMVA 1MH9A 5AKXA 4YCNA 2HX1A 3QU5A 2IOFK 1FEZA 3AR4A 4DFDA
chains in the Genus database with same CATH superfamily
4V1CB 4V0NA 4EYOA 3ITEA 3IEMA 2HLNA 2WYUA 3H0KA 1VYUA 4NU0A 1JQDA 2X0JA 2WF6A 2CFCA 5EHGA 1A5AB 1VE1A 4FDUA 3EFHA 4PLYA 4G2NA 4WZAE 4YPVA 5AFSA 1ZGJA 5L9AA 1YMVA 2DSNA 2FRXA 5ALXA 1I8TA 3LJKA 2IYSA 5KYXA 3WZLA 1KIAA 3U7EB 1R0WA 3K9BA 2HSEA 2JJ1A 4NP6A 1O5OA 4XCXA 1JLMA 2VDQB 4OHPA 2NMVA 5K01A 4TUYB 4DYVA 4MPPA 3UGJA 5TF0A 4GOXA 5JPCA 3AIMA 4MQ5A 9LDBA 2EG5A 3CLSD 3FWNA 1E1MA 5G5GA 3DM9B 4FOTA 5KFUA 3HDJA 4KXXA 4BVHA 4DB4A 1K27A 3KJGA 3JPOA 2CB9A 3DEHA 4MPDA 3GUUA 3FR8A 4FOPA 3UHFA 2Q3FA 5TPWB 4P33A 3GDWA 2RG1A 4DLUA 3SR6A 4KSCA 1SRRA 1A3CA 4C14A 1QH8A 3DBHB 1BJRE 1RKUA 4AN4A 2G0NA 2HHAA 5DBAA 4DTIA 4REQB 3FW1A 3TTTA 4G0UA 2X7XA 3VC2A 4RO0A 1C1XB 4PL2A 2GYWA 3PUIA 1UAGA 4KXVA 1ADJA 4PG4A 1NQXA 3H16A 3BB1A 4C7ZA 4GP9A 5SZIA 1ZQUA 2OVBA 2J9FB 3MCZA 5CPFA 1KS2A 1TKAA 2Q0SA 1VSUA 3KO8A 2P40A 4EZ9A 5CU7A 5LC1A 3E9ZA 2VAWA 4IS3A 2JGIA 3N6VA 4D3SA 4YUYA 5KYNA 4PXAA 4CF6A 2QBYA 3HT3A 1I6MA 2DQZA 3IT1A 4GBJA 4PR3A 1M1NA 5BRAA 1WQ4A 2WIDA 5C53B 4M99A 2ODPA 2XYGA 3CUUA 4EFMA 2KTQA 1AC5A 4C30A 2FSSA 2HJRA 1R16A 4OD0A 2JFZA 4MHSA 3U7RA 2ZXHA 2IEAA 1JHVA 5DT9A 1FDIA 4PYIA 4O4LF 3ZY2A 2GWRA 2C9DA 3ZNNA 1X9MA 3BMNA 4EY6A 5IT9A 2ZIXB 4IX1A 2H4FA 5FLYA 3TTYA 3PB3A 3V7LA 5H68A 2XD4A 3ML1A 4YRDA 4FHGA 3S44A 2OESA 1OGJA 2GHQA 1S02A 1T5LA 3Q6IA 3OZ7A 1M2FA 2FP4A 3FPFA 4F92B 5ESDA 3TKYA 2PA3A 3KPWA 2D2EA 3EMVA 4HFJA 3S1SA 5K0BA 1MC8A 2XNDD 1U1EA 2HJSA 4LF4B 3CURA 4J16C 2WFLB 2J33A 4DUYB 3BAZA 1IQ0A 1ZHFA 1OSNA 1HE3A 2C1EA 3GQBB 1M2GA 3BWYA 3NT4A 3IUYA 2AKYA 2B94A 3JVUA 4QUJA 4AF7A 4EHKA 2C96A 3CN9A 3OJFA 1FNMA 1NVFA 2E82A 4RHTA 1BMQA 1ICEA 3ETNA 4LQDA 3S2IA 3LQFA 4F5QA 2AOXA 1W46A 3T94A 1XEXB 2PJZA 3WK8A 3OSPA 3B8EA 2IZ7A 4JQCA 3RF7A 2UU9B 1W5AA 5A4FS 4NBTA 4C7KA 1CS4C 1SWWA 1V8DA 4G5XA 2ZBQA 3EW9A 3DUFA 1E9AA 3JQFC 1SQSA 4GI7A 1MENA 1SVIA 1E8MA 3D3WB 2N42A 3PF9A 3QWAA 3JARB 4KRXA 5ARCA 5BSTA 1MX5A 4A16A 1O96B 1W75A 3LFTA 1W25A 4FIZA 1IV8A 1V9SA 3I6QA 3KZXA 1WF3A 2PANA 1JHRA 3RFVA 3X2EA 5J8YA 3U56A 4OATA 3D4BA 4F2WA 5SYAA 2GBCA 4TV8B 1O9GA 1KQGA 2B4QA 2EP5A 4LYJA 2AI1A 5CXUA 3DO6A 5JHGB 1AB6A 2NT3A 9ICBA 2MR5A 4CM4A 4DRXA 3OTIA 3SR3A 3U4IA 3ZQ6A 5DXFA 4BJ3A 5J47A 1DAEA 3KYCA 4ENRA 1FBNA 3QEBZ 1GV0A 1RRMA 4KWEA 1OXXK 4M3NA 1ZQGA 4RVGA 1W85A 1GARA 4D6PA 1L5RA 1YDEA 3EOAI 4QUHA 1H2AS 3UJBA 2HK9A 1NSYA 4JSYA 4MEYA 2JLAA 5EQJB 4GC5A 4ZDJA 3TB6A 3RODA 1HQYE 1BEUB 4R8SA 3OY7A 3K9GA 2MYPA 1NFQA 3FUWA 3VR6D 5C5JA 5IIMA 1GSOA 1RWVA 4CKWA 2Z4RA 5LXTB 3R5JA 1DK2A 1CEXA 2DULA 4RVUA 3ZOKA 3SAFA 1FFUA 1GGKA 1H1LB 4KLSA 2GTIA 2Z09A 3NC4A 1F12A 3L6UA 4DPMA 1LK0A 5J2FA 4QYMA 4CW7A 2XXAB 3NQ41 1A2KC 3ILYA 2FOIA 3N2YA 4RF3A 3FGZA 1VCHA 1ZD4A 1S2LA 4OOEA 3RKUA 3WS7A 1FNDA 4JB2A 1RKVA 1D4AA 3CRZA 3C5HA 1FLVA 1SXIA 5IJ9A 1FP2A 3PDCA 4JGBA 4YTEA 1RQNA 1XHFA 2AN9A 4ZT7A 2YWDA 3NATA 1KC1A 1E60A 2XZDA 4M4SA 4BV9A 3ETHA 3IAFA 5EE3A 3CRQA 5BV8A 1UQUA 3U62A 3AHFA 4BQIA 3T1QA 5HFNA 2KFNA 2Q2NA 3WA6A 5KPDA 1NUPA 3TARA 1PNOA 2Q62A 3HRIA 5K9ZA 3U09A 1RYNA 3T3NA 3P9PA 4IUYA 4B45A 1SUSA 2K2WA 2PGDA 5KU1A 2DU8A 3LD9A 3OKFA 3R3XA 1J0EA 2RHDA 2V59A 4M54A 1QXSA 4XLZA 4N9WA 1JKJA 3MJFA 1K8QA 1U7ZA 4N0PA 5AW9A 1ZG3A 2VO1A 4E1BA 1DBQA 2O7VA 3F2IA 1DBWA 3RG8A 4B32A 3FETA 4U39A 4RJLA 4AS2A 4EEZA 1QE0A 2W9BA 3W3AH 3ZE6A 5CH8A 5IN5A 2BFNA 3ZK7A 3X1WA 2QVZX 3H1GA 1G6KA 3KAPA 4KNWA 4L9RA 5ESWA 4H60A 1AF4A 3GRPA 4FMDB 5ICGA 3PRKE 1O94C 2YWXA 1BCRA 3I2JA 4DJFC 1CIJA 4C08A 3N3AC 3FPAA 3WSVA 3I2HA 1NA5A 1BXZA 3OE1A 1RMYA 3KV1A 1W87A 3AFHA 3OM8A 2O2DA 1KORA 1UPFA 2LD4A 1V48A 2DQKA 2WB4A 2WHYA 3MXTA 1N2OA 4WERA 5HW0A 2BFWA 5DHSA 3BWCA 1DP4A 4MRAA 1C30B 1FL9A 4NCBA 1S1CA 4MEBA 5LA6F 1HDRA 2LYHA 1N57A 1ZJ5A 2H54A 3PFBA 2RDMA 4Q44A 1TYAE 1U65A 1JLLB 3R6GA 1QLHA 3O1IC 4N3GA 3A26A 1IE3A 2VDMB 3BTOA 4XFJA 5AOVA 1Y6QA 4CPDA 2PKXA 3TR0A 3ASYA 3IH5A 1MHPA 4ZOLF 5CB6A 4R1SA 1HDXA 5FI5A 3CKYA 4OX9B 2XEDA 2BFEB 4KE8A 4YIKA 4DYHA 2Y0BA 3R3VA 4NECA 1E2IA 1J9EA 2NUTA 4YCCA 1SG9A 2GCIA 4JZKA 4BPRA 5EVJA 1YR1A 3MRXA 3RFUA 4PJ0U 2JEJA 1PX2A 1NW3A 1PVVA 3L0ZA 1SXPA 3PQ7A 3QVXA 3OESA 2GAFA 1J6UA 3JV7A 4MW9A 4YA6A 3V1KA 1JFLA 2CYBA 3I9FA 4REQA 5H4GA 1TW3A 2Y93A 5LMNB 1S96A 4NV3A 2NSYA 1M0EA 5KQRA 1N6RA 1E98A 1C9DB 1V43A 2IIPA 1Q77A 3BH0A 1LDNA 2ZBRA 3QJYA 4FLFA 4DOAA 4YK7A 3N2ZB 4C1BA 2DXIA 1X80A 1QWSA 3ENNA 3H4IA 4X7MA 5EKUA 5FOSA 4LXIA 2O0KA 2RFLA 5DX8A 5C4MA 3B6EA 5K3FB 4RJ2A 5LCXA 3RVSA 2DH6A 3VX3A 1MN8A 4NQZA 4QHSA 5CNMA 1UT6A 3QPCA 3A9WA 4RULA 1M2VB 2VDPB 4BDTA 4O2AA 4EQ6A 4LF5B 1CY2A 1NVDA 3ISVA 2ZU0C 3LXRA 4IRMA 4LY0A 3ZX5A 2GK3A 2J9ZB 3M9MB 3IX7A 3DMHA 1JEYB 2F8SA 3H4TA 2REOA 4N4AA 1YV9A 2VNHA 4O2AF 5KNDA 2JD0A 4EA7A 1ZZEA 2PUTA 1KQQA 1EH5A 1RWPA 3ABQB 3JZFA 1RZVA 1UPAA 2BFOA 3VHXA 3TFWA 4MRSA 2YMPA 3V72A 2DKNA 3C1ZA 2OUIA 2Q2VA 3D4NA 3FNGA 5K0ZA 3M6FA 1HZZC 1X8KA 2JZBB 3H1PA 3NPAA 2F1JA 4IMIB 3H1BA 4C3ZA 1QYCA 4X41A 1N0IA 2P9JA 2WU4A 2XYVA 4GXTA 4DNXA 2UZIR 2C5AA 4FEGA 3X1JA 4I4LA 1GTSA 3ZD6A 3AN1A 4XQ8A 1RYEA 3G2JA 3C3AA 3BXGA 1E3DA 2FSUA 4INAA 3T9FA 2NSJA 4EHJA 3AVPA 3COWA 3ZKAA 1R8QA 1ZM3A 4O3FA 3NTVA 3OU6A 5IT4A 2DWQA 1E2GA 3LSTA 3CX4A 1UQRA 4P5EA 4FZVA 1R0SA 1T26A 5DYGA 3ITDA 5J43A 4WDRA 3KQLA 1OX5A 5JCJA 1TEHA 3M6IA 2XGQA 1MORA 1E2HA 4AJPA 1U5BA 4YFKA 2PQ6A 1W1WA 4ZAXA 3S7TA 3DZIA 2PL9A 3ESDA 3H5NA 3KQQA 1XV5A 4JB0A 4M89A 1TADA 3Q8RB 2PV7A 3GDFA 4RTNA 2M6LA 1VG0B 4DLAA 4P4LA 5AI4A 3KQSA 4JEMA 4HEJA 1JSXA 3W7BA 3FTDA 3U48A 4DQPA 1PV2A 3CZ9A 1CUKA 3S6JA 1QG6A 1SUBA 3HGMA 4I36A 4KDRA 4JUFA 4EEYA 1T1EA 2PZ8A 3A3NA 2K8BB 2Q50A 1JILA 1N9KA 2Z3ZA 4JJZA 5GY7A 4ZTUB 2P0YA 2FMUA 3FUVA 3OT1A 3UK7A 4XGQA 2FPIB 3ZS9A 3TDNA 1PIWA 2BFBB 3O4VA 4UHKA 4AJ9A 2Y71A 4AY5A 2WD7A 4MV3A 4DLBA 3LNTA 3TD2A 4HKTA 1OJLA 4Z1MD 1T13A 4Q02A 1EVLA 2N0SA 4ZQIA 2WJGA 3N2KA 1UKYA 3BCRA 3MTEA 1YQEA 1W34A 2JZCA 3NBUA 1TT7A 2QZZA 2XITA 2YJTD 4QJFB 2YMQA 2L42A 4KH1A 3UGQA 2L82A 3VR6H 2QPLA 3ZIAA 1DV2A 1LV7A 3EZ2A 3K0EA 5I4BA 3KL4A 1CF9A 2DOKA 1SA0A 1IG6A 1T8UA 2H06A 1LV5A 2PVPA 2QXYA 4JHXA 4Q9IA 3RSFA 1T6ZA 4DL3A 1LKYB 4KN4A 4JQSA 1X7YB 1TM7E 3TNYA 4AZTA 1ZN8A 4KWTA 4M9CA 1Z4IA 1ZIOA 4V3CA 2H1LA 4DV6B 3M8RA 1WOYA 4DQ0A 4G5FA 1M6VA 3U3XA 3EQ9A 4C80A 1XZHA 4BJ1A 3K4PA 5K3EA 3ZHBA 3JPTA 1Y89A 1PQ4A 2PL1A 3GJ3A 4JUDX 2R8PA 3MDAA 1D1QA 3VH1A 1Q21A 2XNSA 4DBVO 5ADVA 1RRFA 4MKGA 4QTYA 1I5RA 1ONOA 1Z13A 2BIFA 2ECOA 3H11B 4QT4A 2HK8A 5EIBD 4WZ6A 2COKA 2YVLA 2JV3A 4YPFA 1G8PA 1CRWG 2IYNA 5JRDS 1AKVA 4D9BA 2WUDA 3RB0A 2GZHA 1Z7YA 3BXEA 4GQAA 5F33A 4PZZA 5A4IS 4C03A 1VZ3A 2Z9BA 5LIRA 4B3IA 1KKMA 1Z5ZA 1EA5A 2HLDA 1O77A 1Y8ZA 4O4JA 4WJZA 3G1UA 1FLNA 2ERCA 2VP6A 4P38A 1DCMA 4XYGA 2Q1XA 3GLVA 1XCGB 2CE7A 4TMXA 5KB3A 3LK6A 3LV8A 2VXCA 1MR3F 2EFDB 4MV5A 2W9BB 1J5EB 1V8ZA 3X0DA 1KMMA 3DMTC 2CV0A 1GTZA 1YB5A 3AR8A 3T4EA 3TZKA 1PL8A 2IZ0A 3WLAA 5HZGA 1TKDA 1YACA 1UK7A 3C24A 2ZI5A 4MGEA 4XGKA 3DW3X 2IHJA 2JCGA 4EKYA 3NMUF 1S2NA 1P1KA 3PUKA 4GGPA 4MXDA 4BATA 3G23A 1DDOA 4RNCA 3ZE9A 1ST3A 3PKJA 1YB1A 2Y0SF 3QA9A 1UP6A 4Q1DA 5KJ6A 3SAGA 4WXEA 3VTZA 2O2JA 2FZ4A 1RYFA 2RGNA 3GFRA 4QRDA 3U60B 3K09C 4G9EA 1BVRA 1SRQA 2Q0HA 4KXYA 3NM5A 3AR6A 3ZI7A 3B6ZA 1BXRB 4YWHA 5JVDB 1CR6A 1UJBA 1XEWX 1XYYA 2ZRFA 2FGKA 4KGDA 4ZXFA 3SJBA 5B2EA 4NL9C 3D8UA 1TM4E 4ELTA 2F1OA 1JBKA 4YAEA 1EGVB 2AT1A 2PN1A 3IKMB 1N2CE 1O2DA 3UVEA 4Z51A 5JTTA 4A23A 1ZVVA 4BV3A 4Q9JA 1ZJZA 1F4LA 2B5VA 4TWIA 1EWTA 4Y2GA 3G2LA 1W6UA 1KGSA 5CFQA 3VJLA 5CDTA 1EHYA 2ZYDA 4O02B 2CRXA 2W54A 4BZPA 3HEAA 2QB0A 1P7PA 3WMGA 3CRXA 2Z8ZA 1ZO8A 1LLDA 4Y3UA 9GPBA 4BLQA 5FLXA 3ABZA 1YZQA 4H7PA 3DC7A 3KKKA 5EJ4A 5CLHA 4EO9A 3SJCA 3EEQA 3NVAA 4HFRA 1J2YA 2HM7A 4L8WB 4MRMA 2P65A 5JXWA 3K9WA 3U4GA 2AVNA 3MT9A 1CERA 5FLEX 1FFGA 1S7GA 1XEAA 4AP9A 5L4SA 2EEZA 3NOXA 2V5UA 1NOKA 1JAIA 1SQFA 1SUEA 2X3UA 1H0SA 2VT2A 2BPCA 2BGRA 3QKRB 4K6OA 3ZZ1A 1BWPA 2J67A 3ZI4A 2K4EA 1U9ZA 4LUCA 1S10A 2AX3A 4IQ0A 1E3IA 3T3GA 6ABPA 2VHWA 2ZJ3A 1OBFO 3U5TA 2PXXA 2JH8A 4JCCA 5DLQC 4FWTA 3DEJA 1GSIA 2W2OA 4BNIA 5K05A 3EPJA 2P4EA 1CZRA 2Z2IA 5CT5A 2JCYA 1BDMA 3IXLA 5D7NA 4UNSA 4TS9A 1C7RA 1QO9A 3G5MA 4LY9A 3ZWCA 3FF1A 1OE0A 3PHBE 3UENA 3RS8A 4BLTA 4DFDA 4K3UA 4YFYA 1I0LA 4IXTA 3NR2A 5E0KB 4JP1A 1PNRA 4K9MA 2OMKA 3WMEA 1XTUA 4G4JA 4YAWA 1M1UA 1QLWA 3EXAA 4RVHA 2XF8A 4XKJA 3RF6A 4DBLC 2XT0A 2RHHA 4EGSA 1MO6A 4FSDA 3Q7RA 3V4ZA 2IXDA 1LZLA 2QP3A 4K8OA 4WL0A 2FZLA 3TXYA 1U7OA 1U7XA 4WMLA 4RETA 3UAGA 2D8MA 3VZRA 3KYIB 4KH0A 6CHYA 2V4UA 3KHKA 1EPUA 1EBUA 1H2EA 3K71B 2NTJA 4NYMQ 1I2CA 1KDRA 2P9FA 4BNLA 1V26A 4EY5A 2P6MA 1MABA 1XT6A 3HP1A 3EPIA 1GO3F 3AY3A 3GRUA 2QTVA 3O75A 1RVV1 4WZAA 4EHIA 1YB7A 4IHJA 4MPTA 1G2QA 3EZNA 4XR9A 4DCTA 4E12A 2DHQA 2WVGA 4L2IA 4OA8A 5I6DA 4PCLA 4WK0B 3UICA 2L0XA 3GLHB 4MKRA 4BX3A 1K5PA 1WZNA 2CYAA 2EQ5A 4WRRA 4IIJA 3HJBA 5J2UA 3WGKA 1BD3A 2C84A 4G23A 2F4NA 1BDBA 1W5SA 1DMSA 2I8LA 1N6LA 1JT2A 1Z29A 2C5FA 4JX8A 4PIPA 3QBTA 2FK7A 10MHA 2XUOA 5K8VA 1IBCA 1E20A 1T1RA 4FYPA 5KT6A 3KHLA 3R0IA 4C4OA 3M1IA 4FJ0A 3AF6A 1HTTA 4PHHA 1JS1X 1Q74A 5BRJA 2GXSA 2NADA 1BE6A 4DILA 2VHZA 1WU7A 4ZYVA 5H0IA 4F4HA 2O8EB 5DHTA 3C8MA 1KAGA 3F3MA 1N5MA 4HV4A 4GO1A 4AO6A 1MT0A 2FR1A 3CBGA 3RIMA 2AMJA 2VDNB 1VBNA 3DDSA 4NOJA 4MH0R 4ZI2A 5EJGA 1M3SA 1IEWA 1T15A 3VPDA 3FOEC 2A59A 2JR5A 3M5DA 1JQKA 1K3UB 2D54A 3ADDA 1GLNA 2W3RA 5DBHX 4UXIA 1EUYA 2NXNA 1NP3A 2ZQYA 3NWPA 2HHTA 4CL0A 4LV6A 5DX1A 2KLBA 4ZQEA 1D8TA 3AVTA 5KL8B 1XD8A 2QQ0A 4MKHA 1SBIA 1ZD2P 3RIEA 1URPA 1LSOA 1NLUA 1YIAA 3GA7A 4L7QA 3C1UA 2YWJA 3Q6NA 3FVTA 4DA9A 3QLVC 3I32A 3VDMA 4EVIA 4O3NA 1U04A 3HFSA 1GQ2A 5EJ2A 3B85A 5KJCA 1C8LA 4H35A 2DHEA 3K0FA 4E6PA 2CVPA 5JARA 4BX9A 3NYRA 3UV3A 2E18A 4B1FA 1DBSA 4JLKA 1VPVA 1NU6A 3TL6A 1KMQA 2Y1LA 1L5GB 1M34B 2FPUA 5JYEA 2M6SA 2XNJA 1K7YA 3UMGA 2OZLA 4QZ9A 4LX0A 2FFJA 3W4IA 4IGEA 3VH3A 3LWBA 4IH1A 5EHNA 4R8MA 5FWYB 4LMAA 4ZI7A 5IKEA 4P3XA 3P0RA 1XZ8A 2D2IA 2YMLA 2WJAA 4RS4A 4RTJA 1JDBC 4WQMA 3KKLA 3ZG6A 4HOYA 1JJAA 8LDHA 3SYZA 3ESBA 3VPBA 4DSAA 8ICGA 1DNPA 3HJAA 4B6QA 4TQUS 4YMOA 2WF9A 1T7PA 4I28A 2NQTA 5KDDA 5I9NA 4YRNA 1YRLA 2PX8A 3ZLJA 3R7BA 1AHNA 5ERXA 2XT6A 2I33A 3FOAA 4BTEA 2P6OA 4OAPA 4XQ9A 3SEFA 5EG5A 1JEJA 4DV5B 3WGVA 1QC5B 4CKZA 3WWYA 3QHQA 1OB5A 1Z3CA 1NZDA 4CT0A 1Z6AA 4M22A 1L3IA 3MTQA 4IQFA 1C7FA 4HAYA 2OHGA 2WSMA 8ICLA 4GNKA 1DGQA 2C8JA 1I3CA 4MRPA 4DQVA 2Z8XA 3KAQA 1YR3A 2QMQA 4FQ8A 4NATA 3PEYA 1CY4A 1PW5A 1HH4A 1Y3AA 4XYEA 1BX3A 3GV7B 221PA 4G86A 1JZSA 4IZHA 3NM4A 1MJGM 1NE7A 1NVEA 2EIHA 2FPGA 2QYOA 4LYDA 4UE6A 4G5OA 2VL7A 3GG2A 1P5ZB 2F59A 5DGBA 3NJ4A 2CV1A 4QG3A 3U3KA 5B7GA 3KALA 4AT1A 4JLNA 2QI9C 3ZLBA 2M98A 2R1VA 2JIBA 4BKMA 3PNSA 5JW6A 4K9QA 3FDZB 3RARA 3TL2A 1JHPA 3P97A 4MYCA 3U3MA 1UZUA 2BW0A 1UXGA 4OK3A 3PC8C 5I8WA 2K5UA 3MN1A 3U49A 1M5UA 3O3CA 3EVEA 3JY6A 1O6ZA 4M9ZA 1YTUA 4URUR 5FTNA 4NYJQ 1IIRA 1HYGA 4LF7B 1UJ2A 4BWYA 5LP6B 3OMLA 1NMXA 2EKDA 4E88A 4IIUA 4ENQA 1QBGA 5LJIA 4N0QA 2XBUA 3KSRA 5HNKA 4FZ5A 2O3SA 2ZIWA 3QI7A 2VJMB 3MXOA 5IP5A 1ETUA 1U45A 1FX0B 2G5CA 1Y6ZA 1YZFA 1E4VA 4NLCA 1MNAA 1FFXA 1DAGA 3A27A 3AC0A 3DPSA 1TA0A 3PWTA 4LRSB 3UCEA 3HP6A 1XU9A 1FNCA 3PIRA 5JFTA 4QDZA 1JHXA 2NAPA 5KHAA 1EFTA 3V8PA 3PLNA 3WYGA 3P27A 3QKRA 2G25A 2XVXA 1YTLA 4HTFA 7ICJA 4OCZA 4Q4JA 4RAQA 3N07A 4URZR 3CUSA 3TXXA 4RQMA 4NHOA 3PG5A 4ENVA 4YMTA 4F45A 4KACA 3EZ7A 5FPPA 4DR2B 3CXRA 4KLIA 3TAUA 3N39C 2EOAA 2OQ2A 4NESA 4NU8X 3WLIA 3QYAA 3ZHYA 3ROPA 2YZGA 4AF8A 3DE1X 1Q3VA 1HT1E 1SHUX 2GJ4A 2WTXA 2X8JB 4IOLA 4YI3A 4BBZA 4GYKA 4V2UA 2WVHA 3NTRA 4HYTA 3VYTB 5DE3A 1TPZA 1B16A 3LUAA 1BYUA 1WG8A 1I7LA 2WAQC 2A6PA 4MICA 4PFQA 3WBBA 1MW8X 4P3YA 4NBKA 4TTRA 1U0LA 3INTA 3QLVA 4YYZA 4GOKA 1F0YA 1L4EA 3V7WA 5AVRA 4X65B 4ZGBA 4CRWB 4D44A 1TYZA 3EJWA 5ICCA 3RVMA 2G4LA 2YXLA 3BN3A 3ZGNA 4UB2A 1T2EA 1Z83A 2Q8QA 3PLRA 3VRHA 2RJNA 2YWBA 3MILA 2HI0A 1G2IA 2IP1A 3WTCA 4UXJA 4AY3A 5AW7A 2PZGA 4QXPA 3VKWA 4JITA 5LQAA 2XQIA 2ZS9A 3F5MA 3GMTA 2W83A 5G40A 4NMWA 1R5BA 4D9CA 4TKVB 5HKLA 3GZJA 2W9AA 3LY5A 2X4IA 1Q0RA 4D9FA 5DQIA 2KIWA 1EDOA 4OJ5A 1JDZA 1MIHA 2C5HA 2A1IA 5A3SA 2A19A 1X6IA 3L7NA 2ATEA 4ZYUA 2WMDA 3THXB 4ZOBA 1VHJA 4EG7A 2R0QC 5LBIA 3PJRA 4M1OA 1MIOA 1AHIA 2CDNA 2RGYA 1X0XA 3MIZA 5KTOA 4NZPA 3F2DA 2R44A 1E9DA 2FUG1 4J03A 4IGFA 2OXTA 5ALJA 2FP3A 2MYNA 1PR5A 2XIJA 4LVNA 4QOIA 4GMFA 2J09A 4F12A 4DDHA 4OHMA 1OH7A 3NUGA 1NNLA 2ZKIA 3HJUA 3O73A 3SD7A 5AYVA 3O8OB 1OIXA 4RVFA 5IVIA 2RIPA 4PBTA 2PWPA 3LYUA 5J5VA 5LYJA 3R7WB 3L8HA 5FOVA 2G5TA 3W5SA 3L7CA 4US0R 4M0EA 5DMXA 5B1HA 4ENPA 2WD8A 3RI3A 4UQGA 1YGYA 2QZSA 4KO2S 3ZGZA 1EB8A 1SC3A 1QH1A 1BDHA 1OZHA 2I7CA 1S9DA 3CV3A 4OP2A 3DPIA 4MULA 1QHYA 4EZ6A 1YA4A 2CJWA 3I1IA 3OZEA 2PXAA 1WCYA 2VP2A 4OQFA 3B51X 5AVUA 3X1DA 4Z0HO 2R62A 4PVCA 3T1TA 2J4FA 3TOZA 3RLIA 2UVUA 1XDSA 1CC1S 5JS2A 1E7RA 1QG0A 2VDJA 2ZUVA 3DKIA 3JD1A 13PKA 3T99A 3HILA 1PJSA 4F4FA 3UWMA 5AVOA 4HVLA 1Y9EA 1ZGGA 3KSBC 2HNAA 3AVWA 4TMYA 4RPYA 3K0KA 3QY0A 3GJ6A 1MB2A 1SGWA 3QKIA 5EWLA 4UHEA 2PRZA 2DG2A 3UA3A 5IM4F 4B40A 4PSDA 4EY3A 2E4WA 2ZI3A 4FOLA 4O0IA 5IASA 1FW6A 1ZQFA 5BR8B 3FBWA 4I5IA 4FFNA 5HKBA 1U1IA 1GU7A 2IZ1A 2OO7A 5EP1A 1QYRA 2IPNA 1K3FA 4ZIRB 1HDEA 1AS0A 4V24A 1FTQA 4C7BA 5GZ1A 2X9QA 4I1RA 3H17A 2D0DA 2VWHA 5F2EA 3FVWA 2MMGA 4HJXA 1KJWA 2C54A 5GMOA 5JWHA 1G0NA 3OEYA 4BBJA 2PZBA 4XW2A 4N5LA 5BWCA 2C5EA 2W9CB 2IVZA 5KOIA 3G2QA 2VPZA 1VG9B 1E58A 1NKSA 4OG2A 5DWQA 5DGIA 1RJFA 2B1QA 4DARA 2PUDA 1QMGA 4H1UA 2HN9A 1H2YA 2J08A 1X7DA 3SLKA 1SV4A 5KFWA 4TYPA 3T0IA 3SBDA 3PCRB 4TTTS 2ZDGA 3LRTA 4BKPA 2BMVA 4DLPA 1LKZA 4B7ZA 1REQA 1Y63A 3OTGA 2YFKA 4BEJA 2MYTA 2TMDA 3A05A 2P66A 4UAGA 1YE5A 1SUFA 5E1MA 3ZGYA 5FWXB 1UA0A 4F84A 3IRVA 2KLHA 1M2KA 2MWMA 3ECSA 3KLPX 2ZB8A 3KVNA 1U98A 1U90A 1XLVA 2HLDD 4E14A 5CA1F 1ZQ1A 4BLUA 4JOQA 3U44A 1R0YA 4ROTA 5KVQA 3H9EO 1JAXA 4V03A 5EMMA 1XOIA 3RIYA 4IJMA 4RTPA 2F3NA 3FYHA 3GCDA 2QTZA 2DM6A 5JAMA 2H7XA 4AQDA 5CB4B 7GPBA 2J3KA 2AGVA 2C03A 3HKBB 3CRVA 2K8CB 1VE9A 2PKRA 4WBSA 4NZOA 5AKLA 3SXPA 3WWEA 4CKYA 5F4ZA 3A6ZA 3Q5EA 2WWTA 4CHTA 1VBKA 2GBIA 4RFVA 2ZXUA 2O6LA 5J2EA 1SVLA 1GTVA 2W2MA 3F47A 2DWOA 2G5IB 4IHKA 4Q9LA 4DAEA 3QQ5A 1YJCA 1AQNA 4ACOA 4F3YA 4RT2A 3QPUA 3QW4B 4HAOA 5HK8A 8ICAA 1JDPA 5IK2A 1KVTA 3BE6A 4DIFA 2XBMA 1KI1A 3SV4A 1E5VA 2Q6LA 1EA7A 1JA0A 2BKVA 3IO3A 3L3BA 4FFDA 4EI8A 3HYTA 4E3ZA 1H1DA 3F6PA 4MKIA 1MC5A 4DJDC 3PJGA 1XMOB 3L8FA 1SD2A 2C82A 1ESMA 3RTAA 5K0TA 2WF7A 1XR3A 2PX6A 1WA5A 5C31A 5BSVA 1Q7RA 1WXXA 3RAQA 5CYPA 5GTIU 4G1VA 4A2WA 4EMBA 3LXUX 3OPYI 1KJZA 3UH1A 4BIIA 3KFXA 1YDFA 4MQLA 4QDKA 3DZBA 1IY1A 2F48A 1PK1A 5B53A 1I2MA 1K66A 1Z22A 3W2IA 3PWZA 1NAHA 4IGKA 2IT1A 4EPWA 2VJNA 5L3VA 4JA2A 1TMKA 1IULA 1USVA 1Z8DA 4I6EA 5DHRA 4RPHA 2QN7A 2H1VA 1ISHA 3N5CA 1DELA 4FGKA 3LDFA 3UUWA 4HWGA 3P2OA 2R25B 1QCKA 1XG5A 4WJLA 3GIMA 2EH9A 3EZXA 3N6XA 1MPTA 3GX1A 2PDAA 4XX0B 3AHEA 5DNDA 3VZSA 3ZBQA 4D81A 8ATCA 5JSQA 1NT2A 4NG4A 4QHTA 2WTMA 2YXPX 1ISRA 1UBOS 2AW5A 4ARIA 3B2NA 3K1RB 3M5PA 1ZQEA 3KJEA 5B37A 4B73A 3NKVA 2VSNA 2HWUA 4OXNA 1WUJS 4BP8A 4YAIA 4AICA 3QHPA 3HB5X 4A2CA 3OE7D 2QJOA 2H16A 3ADPA 1HYEA 4WECA 1WDLA 1Z25A 4TVKA 3DDHA 3QFFA 1N8SA 2CWWA 4TLAA 3FJYA 2NXCA 4PXSA 1TZ2A 1XP8A 1ZN7A 4OMCA 1II8A 1ZGCA 4MR9B 1DBIA 5CHYA 3PEFA 2CF5A 4Z86A 3WX0A 2PUGA 2TECE 1KK1A 3JQ8A 3WKCA 1M6NA 3MUOA 3ULKA 4UFPA 1HTWA 3VH4A 1SQ6A 4Y2VA 4DLVA 2PMZC 1S8FA 2H48A 5DLYA 1M0WA 2EF0A 1EDZA 1WPRA 4YR0A 2XZPA 3F53A 3LP6A 4H7HA 1IM2A 5CNJA 4DZTA 3ZXXA 5HS6A 1SKUA 2CCKA 4FZMA 2ZR7A 1PF7E 5ALZA 3OF3A 4R1TA 1TAMA 2ZRDA 4Q7EA 3COJA 3AONB 2XB9A 5ELLA 1AKMA 5EHZA 1QCYA 5LQMA 3FKSA 3RSSA 2RK6A 4ODIA 4ZZ0A 4ON9A 2JLRA 4DA4A 1XU7A 1NJGA 3QW2A 1L5ZA 1KYYA 4IR7A 4YRTA 5H3LA 3ZGLA 3BGWA 2IE8A 3PQ2A 3AJ9A 2ZRCA 4ASUA 5EMLA 4MO9A 2JAWA 1V7PC 3RVDA 4AM8A 4DIUA 4ZC1A 4RT3A 4CE6A 3QTLA 5EESA 2HSDA 3A10A 1LW7A 3LE8A 2Z6AA 2XKAA 5FP0A 3IMKA 3O83A 2H18A 1KEZA 1MV8A 4P92A 2QRHA 4Z0TA 3GPDG 2P2YA 5DI3A 5ALRA 1JKJB 4LZGA 1N3IA 4YQEA 5ARBA 2OCIA 3D3QA 4YMIA 1KDHA 2VOJA 2LM1A 5FA8A 4ZCRA 4QJIA 4RMHA 5LWQA 3R9WA 1SOMA 2CJXA 4LOJA 2WKSA 1SHLA 3GEBA 5COQA 3CEAA 5U1PA 2ERYA 4MCJA 4DG9A 2QRPA 3CVOA 4TWAA 3AESA 4X3OA 4UEKA 5TPWA 1I6WA 4JC5A 1NQ5A 2Q1UA 1KNQA 2D6FC 4MVJA 1SIWA 4O4LB 4WN9A 5AXCA 2BISA 2D0PB 3FPKA 4BFLA 1TTTA 1UXOA 4C8LA 1AB5A 4OJPA 3IAS1 1WCWA 3RIXA 2CLOB 1WO8A 2VF2A 4M46A 2HJWA 4QHYA 1AG9A 4LHEA 4L9SA 4UUOA 2WPDA 3IRUA 4TTIA 1BA2A 2CZCA 5CBKA 1Q14A 4OYYA 4L5YA 2Z4TA 3PKIA 4DCMA 1KJ8A 5HDBB 4DCCA 1VJ1A 3KFLA 1UJMA 1IPEA 3GOQA 2HREA 4RQ6A 4URFA 3FCXA 1P7YA 1J00A 1ZJ6A 3LHIA 3C3KA 3MDCA 3BDPA 1I7NA 1G5PA 1PFYA 3PX4A 2VYCA 3BS4A 4C7YA 3PL5A 3IAM1 4MUNA 4YJFA 4MQEA 4BU0A 3WICA 2AR0A 3C7AA 3CC8A 3ECAA 3Q3EA 4LYFA 4UCQA 2H3EA 1OREA 1DXOA 2GKOA 4KZPA 4WESA 3ZNPA 4D46A 5IT0A 4MB2A 5KREA 3G9QA 4PGYA 4XUSA 2HSJA 5JI3E 1T6YA 5K09A 2OHXA 5C1IA 1J7JA 1BE1A 2OG1A 5LNK1 3V8MA 5C51B 7ICQA 2HRDA 3PNBA 4BDSA 4PRYA 2ZITA 3GRYA 5B4VA 4CQMB 1AV7A 1UP7A 1OBOA 1A1SA 1LC0A 2VF8A 3QYFA 2JHFA 4RMGA 5TC4A 3I3OA 3PFHA 5G53C 1C8VB 4ZRDA 1RAFA 2GKGA 2YICA 2YHSA 4GMGA 1KFEB 2GCOA 2F3TA 2GPWA 2HO4A 1N0HA 1ZMXA 2Y77A 3HSYA 4I46A 1QNFA 2OBLA 3LA8A 2HWWA 3LKZA 1Z7GA 2BBOA 4PGQA 1DTWA 4OJOA 4DIEA 1ARZA 4QVGA 4LISA 3EZYA 4NPCA 5DNUA 3DMRA 3N87A 3AHCA 3T4UA 2R751 1SB8A 3CLHA 4HD8A 2C4KA 2I4TA 2QKQA 1M54A 1GDDA 3C15C 4UAVA 3R24A 4TVBA 1KEWA 3E3AA 5HKAA 1HR0B 5AKHA 3IE2A 4KSYA 4M6WA 4RCZA 4X85A 2OPBA 2QSZA 3TXAA 3S3TA 3GIIA 1LS6A 4LQLA 1FSPA 1V8PA 3R0QA 2VUIB 5DBGA 3JVIA 1RI2A 2VNKA 1BVHA 2QL7A 5BV7A 2YY5A 1JMYA 2ZBGA 1O5TA 1L1QA 3Q85A 5KDLA 1X1AA 2G6TA 2C9OA 1XEFA 3WL8A 4GR4A 5DGCA 1RM5A 2VLBA 1KVQA 4LA4A 2O2SA 3L0IB 4Q4AB 4X92A 3I42A 3ZJ5A 3KJIA 3ORYA 2PT7A 1S3GA 5FUBA 4BVBA 3RT9A 1A9OA 5G2OA 4RTQA 1Z18A 1XVTA 4R8VA 1ORIA 1C50A 3GT0A 4OFZA 1JEDA 4DS4A 4PANA 3IP4B 2H1CA 3AUXA 1NBEA 3H99A 3F5DA 1UK8A 2CLSA 3JATA 5FI0B 3R7FA 1T0PA 1CNFA 1YBHA 2Q0XA 4R2IA 3NONA 3VOSA 1NW4A 1VKZA 4TRMA 3FFWA 1X8JA 2F9FA 5F3DA 1LI4A 3FUCA 3N3BC 2BM8A 5HQ3A 1LNSA 2L18A 3AVOA 4YAUA 4IGAA 1J0XO 4G5HA 2H8GA 3K5HA 4WXRA 1H8EA 5FBQB 1KR2A 1WAMA 3BWMA 3KC2A 4K28A 5TZVA 1ZP6A 3HA7A 3HDVA 1IBLB 3GJXC 1WETA 2R7LA 5E1BA 1Q3HA 1H2BA 2PGJA 3NC1C 5KAMA 2OQVA 2QMUA 3M7DA 2IFTA 1PT5A 4B0PA 4RKQA 4ZOCA 4J75A 5IEBA 2ZJAA 2VBCA 1JJVA 2YXEA 3HCDA 5J63A 1YT3A 4NS1A 1OTHA 2XNHA 1HQKA 1NX9A 2PUVA 1CYDA 2QUHA 4QLAA 4WPGA 5EYPB 2QLTA 3TJRA 4DT1B 1WVIA 4E3WA 1XTBA 5MN4A 3EODA 1KO1A 2CXOA 2H08A 1HL7A 3H2GA 5A2QA 1FJHA 1VL6A 2QJRA 2WWRA 4HDOB 4CLRA 4JUBA 1E6KA 2C3PA 1YR7A 4OHZA 1ZQRA 5DLFA 4ZAGA 4I3HA 3DZGA 1Q22A 4JKOA 4PZ0A 3DULA 1ZSNA 2YW2A 1JFVA 4JUIA 4WH0A 4GFDA 5J2TF 4S1NA 3VUFA 3X3HA 4PZYA 4EBDA 2OYRA 2VQDA 2A84A 1HURA 3CFYA 2Z9CA 3C14C 2EJCA 2PMZF 3ELUA 4JVSB 4UVIA 3ZJ4A 2EFGA 4HZUA 4UNNA 4URYR 3EGIA 1NN5A 2VJDA 3SZMA 1SVWA 4YALA 3HDTA 1A5ZA 2XSZA 4BVKA 5FTLA 2MUTB 3ORSA 2WINI 1HEKA 2LM4A 3W34A 4U6PA 4MRNA 3OD5A 1RZ3A 4L74A 3PHCA 3HW8A 3HQ4O 2FLLA 3VNBA 5K0JA 1T5BA 3OSNA 2JPDA 4MJLA 4RJKA 2B8JA 3DXZA 5EXXA 2J6BA 2FW7A 1OU0A 4EZIA 4RD0A 2LI6A 4CMBA 5PGMA 2CMDA 1J8DA 3JWJA 3O7WA 3A6JA 1XMVA 4Q4HB 4EGCB 1ZQMA 1RADA 1ZUIA 4RD4A 2D00A 1BCRB 3TBHA 4DEXA 4F8EA 3U61B 3S2UA 2VYND 3QFCA 4ZMSA 1P2FA 2LP4Y 1A9QA 1O6CA 4I1OA 4RK1A 3DEFA 3WE7A 2FFHA 2WT8A 5TXGA 3F5EA 3WMFA 1LA2A 2NTVA 4C01A 5IYZB 1JG1A 1QBKC 4Y8VA 1AF7A 3SMQA 4K5QA 5ALGA 1BPZA 1J56A 3NTOA 1MO5A 3AEKA 3AKDA 4PGXA 3ANTA 4JH0A 1U0GA 1XSPA 1N78A 3IP7A 3O8NA 1ZZGA 3PFCA 1P1HA 1V97A 3G7NA 1W9HA 4RQ1A 4MOWA 2ZIUA 2NU9B 1PL7A 1A9XA 3N86A 4UD6A 4EVQA 5JZSA 4TMFA 2NNLD 1AUVA 2QTHA 2Q3LA 3IR7A 1UM8A 4ZP1A 2Q5QA 1SPXA 3I83A 1C5KA 1H6CA 1SCAA 3CH6A 4KLCA 4RCYA 4WLUA 4Y67A 1EE9A 3EVNA 4GF5A 1XCBA 4OK5A 1NBIA 1WHSA 5K0SA 2QVYX 4I14A 4MDYA 3WB2A 1AGRA 2EZTA 2X9LA 3LPMA 2F90A 1S1MA 4XDGA 1EAYA 4UPEA 4AY2A 4U8GA 5DTJA 1RXIA 1SZPA 4GX5A 3URKA 1U6KA 2Q7XA 3ENQA 2C3YA 4RIFA 3T35A 2I3ZA 4PH5A 4ZU1X 1KZ4A 5KNDH 3L7IA 1XC7A 3FNBA 3AHHA 4L5CA 1MV5A 4CM3A 5L7WA 1HG1A 2P0EA 3CE6A 3I6ZA 4HC4A 5CVJA 2DHCA 3WHLA 4JQYA 3WKAA 2E2WA 3E5NA 1GT6A 4OKNA 3ZIUA 1L5HB 4Z8YA 3H84A 3ONFA 4U4AA 3UGKA 3KP1A 4NTZA 1NJ2A 5FAKA 1E6CA 3S55A 2X58A 4XH9B 4B2PA 1DJLA 1VL8A 3DEAA 3DNFA 2P35A 3SNHA 3FZNA 1D4ZA 4S2EA 3EGVA 3L4SO 4YECA 1ZINA 3ZEIA 4DCVA 3GQCA 1E7MA 1GTRA 5IAAA 2KBEA 1WQ3A 3JZMA 3OU2A 2H5EA 4EGJA 3O90A 4YQZA 1XPRA 2GPAA 4LRYA 4UUAA 3LW7A 1X7HA 2VUSA 3MHPA 1P0FA 4MP6A 4TN1A 3RJGA 1KFCB 1YD7A 5LA6B 3Q10A 1HT2E 3UNXA 3ABOB 4QNMA 5FBKA 2PAAA 9LDTA 5CT8A 1NZJA 2HADA 4LCEA 4KKXB 4A0SA 3BJEA 4IIYA 1IWBB 5AK3A 3DVQX 3ZE0B 3BZCA 4N49A 2AEMA 2DFKB 2PBFA 3RV3A 4X7PA 4MVWA 2E4XA 4IKEA 3L18A 4JT9A 4RGVA 5JJKA 2ADMA 1PWYE 1UFOA 2ZYAA 1CQWA 1FSZA 2FEMA 2XNKA 1OXKB 3BWDD 1C9EA 2CE2X 1CU1A 4LHVA 3MNFA 4A5OA 4DV0B 1NRWA 4C0KA 3DOIA 4P5DA 5LOVF 5F2NA 4CMAA 4AMUA 5CJ7A 3GDOA 2YC2C 2WZBA 1M8KA 2QEQA 2XMDA 1ETHA 2GAIA 1ZQQA 2Z1NA 3HYCA 3QFHA 4MV7A 1KOLA 1YQTA 4D96A 3R0JA 2JFFA 3S5UA 1VJTA 5LU8A 1SKMA 1KL9A 3AUUA 4PFKA 4URWR 2HBYA 2Q0ZX 4UTXA 5AXBA 4KXNA 3RCBA 4BUJA 4KR7A 4O2BB 4G5SA 3NXKA 2YVAA 4J9NA 1GTMA 1OR8A 2JAOA 1EBFA 3EASA 4FTWA 4MSUA 1BE0A 2YX8A 4PNEA 1GU1A 3HSSA 3DOUA 3A3KA 4KNVA 3WWPA 5C7LO 4RMIA 3JAWA 3LH5A 4ZEOA 1J24A 1VKRA 1A0OA 1YBAA 3EPRA 3DEEA 1ZMOA 2HF8A 3H0LB 1QX3A 3WNBA 3HXQA 1T2CA 1IHYA 3SS7X 3KOOA 2X5KO 2RRDA 3VPAA 2VWPA 1QFSA 3LFHA 4JHLA 5L3SB 3WDKA 5EGNA 3JPWA 1QQBA 1ULSA 2QQ5A 1V3TA 4MVJG 2VHXA 3HBJA 3P0JA 3TFQA 5I4KA 2Y0DA 1LDEA 5E7JA 2J9YB 4YI5A 4RIIA 2Q0QA 2MU2A 3KOZA 1PZHA 4YNBA 5E2AA 1Z4LA 3BHJA 3EPLA 2Z5VA 2IELA 3TLYA 1VBFA 4YQWA 1HFJA 3F49S 1UQVA 3LPCA 4QXQA 3RVRA 2FE1A 5F7JA 2W6MA 3GAZA 1KKXA 4GKVA 2YY6A 4AY4A 1EUZA 1ECFA 3JQ6A 1AKRA 4M98A 1Z26A 1ZQJA 1R27A 1BPBA 2BQ3A 1US8A 2C2OA 4KEAA 4CMIB 4NJ8A 1EX9A 1K08A 4M1MA 1ZH2A 1JQAA 1NBAA 5C81A 1AMUA 5KJ1A 3M6ZA 1B93A 2P78A 4Z9XA 2IBSA 4WXYB 3AKEA 2B1GA 1PV4A 4Z6EA 4A8JA 5HM8A 2G8LA 1X15A 2VDRB 2C3MA 2ZWMA 3T5LA 1ZKMA 4IV0A 5EYPA 4BWFB 3CPEA 4E2XA 5B1DA 5U9CA 2OYCA 2BFFA 3GV8B 2H1RA 1VLHA 4P2GA 4DSOA 2RAFA 5AOCA 1ZK2A 3C45A 1M6VB 4ARAA 5AKJA 3L46A 1C3LA 5HCUA 1L7VC 4F50A 1OLXB 1T29A 2H2HA 2ZBFA 3W8RA 3WGIA 1JJBA 4R3WA 2QUJA 1QRDA 4FJ1A 1YR9A 2C3UA 4Q43A 4OQEA 2OHHA 3F6EX 8ICZA 5IAJA 1UC4B 1UODA 2V7WA 2Q7DA 4AJHA 5K03A 3QYPA 5GGYA 2QYHA 4GPZA 4MYUA 5HTKA 4PZ9A 1D2CA 4LPKA 5JSKA 2AOWA 5HHHA 2L19A 2JLYA 2PUFA 3HKCA 4KXQA 2XI9A 1E1RA 1ZK1A 5GP1A 5BY2A 4UDXX 5IJAA 3UMFA 2IHUA 3V8EA 1T9GR 1X66A 4Q3EA 4R2MA 3REQB 1JSZA 4CV1A 4HBZA 4Q4DA 1WB4A 4R40A 4CLHA 4R0VA 1LGYA 3PXUA 1XN4A 2CVOA 4L0QA 5AW4A 5FUQA 4QVIA 4TQSA 1C7YA 1FMTA 5KSZA 5K51A 3PT5A 1MG5A 1SIUA 5DQGA 3R9IA 4KX3A 4F2DA 2O6KA 5H80A 3Q8WA 4RXUA 2OSVA 1QP7A 1NI3A 2XUGA 4J9QA 4F4UA 1GKUB 2OCKA 4YRQA 1F4VA 2WFMA 2ZT8A 1GN9A 2BY4A 4UVGA 3RWBA 3S2YA 1VTKA 5A2GA 1INLA 4XDYA 5FX2A 1RSZA 2XB4A 3A1NA 1ZPDA 1MQAA 1PUJA 1YRAA 3O1JC 4A92A 2QUAA 3RF9A 1KFTA 4GPD1 2HO5A 2I87A 2AD5A 4C0JA 4XE5A 2GM3A 5LU9A 4WOKA 1V37A 1OZGA 2PV0A 1X1DA 1FOEB 6YASA 4MR7B 1JXLA 1OD6A 1JE0A 2C5SA 3LM8A 1AIPA 3RVLA 2YIDA 4KVFA 1L7MA 5AVYA 2J31A 1A72A 2AFHE 2B25A 9ICNA 3RJZA 2A9KA 1MX9A 2VZEA 3C8DA 2FRVA 3P5BA 1B7GO 1JI3A 2WKPA 3F6BX 4U2FA 4MQFA 4Q21A 2IXBA 4LBZA 4WCDA 2DFLA 4XASA 4ZT2A 4W5OA 2P4SA 1WBJB 3FDJA 3CVUA 2ZIZA 2VJQA 1JA1A 2IRWA 3HPOA 2EATA 1BVSA 2BKAA 3IEVA 9ICPA 1VG8A 4ZAVA 1XHEA 3I04M 3G6KA 3L5OA 3ZXIA 1ULZA 4MVJF 4BMYA 1JIVA 1U0EA 2X76A 2C07A 5J23A 2AJCA 3EH2A 4FZNA 5ENZA 3ZR4B 4P93A 4WNIA 4YJ3B 2J5XA 3U7GA 4MYRA 2AX4A 3UMJA 2VCHA 4LK3A 4Q37A 4D98A 2QX8A 1FIQA 3S1AB 4F21A 3JS5A 1A69A 1FUKA 2WILA 4CKCA 4F86A 4P7JA 3UK6A 3WK9A 3AM9A 1Q7EA 2NP7A 3KE9A 3IT0A 2Q4BA 4DO9A 5JECA 1BFKA 3JPRA 2BEVA 3I0ZA 3OD1A 4GI1A 3PHHA 1G4UR 3HYSA 3QKSB 1RWQA 4MGIR 4F38A 5SZHB 2CSXA 2JF0A 3MTIA 4V38A 4UNIA 3SIPA 3W06A 3WMXA 4FYXA 3BGVA 4PYMA 5EZ6B 3WAKA 4X5VA 5KT5A 3UIEA 4JJ4A 3RHZA 3OA2A 3VYRB 1HFWA 3F96A 2R5WA 1MGOA 4MS1B 2ZVPX 1XEXA 3JRWA 4S05A 2B2XA 2E5FA 3PHIA 1I5EA 1P4GA 5J2BA 4HH4A 1O89A 1VMDA 1YDMA 1NU8A 2I4NA 2VWGA 2ZIWB 5TVKA 3L79A 5ULLA 3PUHA 3QI2A 1NK5A 3QMWA 2O2EA 3DL7A 2WJWA 8ABPA 4B3RB 3HYNA 4DLNA 3NHJA 3W5CA 1ZCJA 3O2JA 3OJOA 4TLBA 4WVLA 5JFOA 1NXPA 1XMSA 3H5VA 3OZAA 2ZB7A 5I8PA 2AMLA 1SVKA 5CJPA 1A8IA 1L4LA 3CNQS 2ZBVA 2YOGA 1LLFA 5EOZA 3B9JA 4IQVA 4CEIA 3N2GA 5BUZA 3GMDA 3FCSB 4ZHQF 4C0HA 5FF9A 3LQ1A 2IOQA 2GXQA 1U28C 4QPNA 1A04A 1FMFA 1L7BA 1E1KA 2MSNA 2N1RA 1OQAA 3B3JA 4X1YB 1FYXA 2GPSA 2E5LB 4P4SA 3C85A 5A9RA 3GLHA 4EG3A 1JPVA 4QBTA 3VXKA 3RU2A 3GFTA 3CO5A 4KN7A 1U6IA 4KMOB 3TSOA 4AP6A 3GLIA 3K9CA 4H77A 3E7WA 1R0LA 1EE2A 2J5BA 4QASA 3MMZA 3OZRA 4L72A 3T7TA 4B7UA 3IAAA 3GEPA 4MW0A 5LJLA 2GD2A 4GSYA 1CUIA 1TLLA 3PBKA 1WKCA 5CURA 2VPQA 1RKQA 1Z0DA 4B4WA 2VZ8A 1F5NA 5FR2A 4KQ9A 2BFDB 4F4ZA 1W88B 8GPBA 3KL2A 2CL5A 4K81B 1HZZA 1LSUA 5DTMA 4QBGB 1BU5A 1O58A 3H13A 1EXWA 2CZGA 4RM2A 1ZETA 5JY1A 2JFUA 4JBLA 1WDMA 4IBOA 2HCBA 4J8PA 4QRHA 1XO0A 1EFCA 1FUEA 4PGGA 4HQ6A 5F9NA 2XADA 4EY8A 1P91A 3BSWA 7ICRA 2XDQA 1UT8A 4BGUA 2MR6A 1U2QA 3WIEA 3WFZA 2CXXA 2NV3A 3LRPA 8ICBA 3NHUA 4ND2A 4JZYA 3UWDA 4QZVA 5IHPA 4MQUA 4EPYA 3HCAA 4V39A 1E9RA 3RW9A 3CKKA 1D9XA 5JSFA 3QVKA 4NENB 4PZLA 3MERA 3K1ZA 3IHWA 4ZAYA 1NUUA 2I4OA 3DBOB 4D0RA 2CSUA 4EB6A 1U8ZA 3WKEA 1LRKA 2OWEA 4UCFA 1PBTA 1IN4A 1E7YA 1VI5A 3MJEA 3NDIA 3O4RA 4PZPA 2IUYA 1P3DA 3STUA 3ESYA 4J29A 4UHHA 1CWUA 4D0NA 3LS2A 3Q98A 2GN1A 4I2JA 2HHQA 2NO1A 4LVOA 1N6HA 3A2LA 4YD1A 1RWMA 3I64A 2WAMA 2PT9A 2GK6A 3V1TC 4DHEA 4AG6A 1VPTA 3K2BA 5D00A 2J7PA 5JPDA 4YT2A 3E9NA 5GONA 1PWEA 4HGZA 4HQOA 3TLGB 1L3SA 1PX0A 2EWVA 2Q3CA 2ZWPA 3DJFA 4JYMA 3W2TA 1EUCA 1BJKA 1E4EB 5KFCA 3VR2A 4YLYA 3T4PA 7ICHA 2Y0EA 3VKVA 3T7JA 2ZIEA 2GF2A 3I53A 1NXSA 1ZYQA 2XGSA 1QWOA 2Y67A 3N05A 4WLEA 1G0OA 1YZUA 2R1TA 3MOIA 4E7OA 4JODA 1FTWA 4MUAA 4H16A 4FFVA 2FUG6 3QE9Y 1M2OA 1PZMA 1VE6A 1XZGA 3OZUA 4DDUA 1YRQA 2R6R1 3D5QA 3G79A 1GG8A 1S2GA 4KSBA 4PW0A 4MINA 4CFZA 4X20A 1TIKA 4JASB 4LTDA 4RV9A 3V7JA 2CNDA 4MW5A 4QDTA 4UNPA 3QPVA 3I6BA 1T9KA 3CISA 5KSPA 4LHSA 5JLJA 3UMYA 1U4NA 2WW8A 5BVHB 2QYTA 2F44A 1T0JB 1X1EA 3D6JA 4GQBA 2ZUUA 4LDPA 5FV4A 1IZ8A 1V16B 2PRSA 2JATA 3PPXA 4E5UA 1W5FA 4ZV4A 2W8BB 1ODLA 3FNFA 4AMYA 1ONSA 4AKGA 2B4YA 4BU1A 2OYYA 4OHCA 1N9GA 3PEWA 1U2TA 1HLDA 1P44A 5BN5A 2HXGA 4FFSA 4FT2A 4Q4CA 1JU3A 1G6OA 4ZVLA 3H04A 3QBDA 1QV7A 2ZYRA 4GKBA 2PFQA 2DFTA 5TGDA 1QZXA 2JB9A 1KVSA 1VLBA 4R9RA 3X2FA 3H05A 1NLZA 2G17A 1SXDA 1ZQVA 2CD9A 2PXCA 2ZRGA 3THWB 1SL1A 1C0LA 4L02A 5KFMA 4XRHA 3AUFA 1ZN9A 4MJ3A 4P36A 4X9XA 4Y2HA 1YFJA 4US8A 3WZ2A 4F8RA 4HMOA 2ZYIA 2XE7A 2RHMA 2J4CA 2YZKA 1CUHA 1D0IA 2B7BA 2IUTA 2OV1A 2PH3A 4X1KA 2AG6A 3P9CA 3S99A 2GZRA 3ENZA 3SQOA 5B4TA 4G1FA 1ESNA 5ITZA 2FETA 2WHXA 4YXMA 3AO0B 3OEEA 4GMKA 4ZO4A 2R6FA 3KXLA 3CX3A 3TM5A 2IYXA 1XDGA 3NRZA 1SELA 2C2KA 2ATCA 3SJ7A 4EKIA 2WWHA 5B1YA 1DTSA 4KR9A 2JRCA 1FFXB 1T9AA 4HPWA 4YRRA 3VDRA 4Q9AA 3H1EA 1DRWA 4K9PA 4V3BA 3ETGA 5DYIA 1KMHA 4F0JA 1TKBA 3MCVA 4UM7A 3GP5A 4F5WA 1DKUA 3E27A 4C6TA 1OKKA 3AY7A 1A4RA 1DEOA 2G04A 3MMXA 1C4OA 3P9YA 1Y8RA 1Y4DE 1ZJMA 1FSSA 1Q0TA 1VLVA 2W6OA 1DI0A 3AEXA 1LX7A 3EUEA 1DWUA 3NHRA 4IP0A 5B58T 2A5FA 4OJMX 5FO0A 2BWJA 3PD7A 3GIDA 4ZVMA 1MTOA 3WXMA 4B4OA 3RFFA 4P7GA 5EFOA 3WLHA 4D5EA 1PZEA 1V8OA 2B4RO 3GO4A 3Q8XB 2PSHA 2DVMA 1ENZA 5DH9A 1PL6A 1VRCA 4IY1A 3M4NA 2H2GA 3TW8B 1I7DA 4P31A 1T3QA 3ZLVA 1QZ3A 4I2BA 2Z98A 5J1TB 2PX4A 1F2VA 1YI8A 2EAUA 4BX8A 2HRCA 3GPBA 4EJSC 4DR3B 1IXRA 5JMOA 5F9LA 3W2FA 3SAHA 5D87A 4LTNA 2LMRA 3RBZA 4J43A 3BCUA 1ENPA 2BBSA 1O9BA 4NLBA 4DQLA 3C2LA 3QTBA 3U7HB 3EYZA 4FBTA 3PUJA 5DWVA 1PK3A 2FW1A 2ZTLA 3BPSA 3W6OA 5BWNA 5B3LA 2LNDA 1ECWA 4PZEA 3O3OB 3MTGA 5FPHA 1USUA 3TJZA 1HDCA 5F9FA 4LMBA 4PWYA 3FMIA 1JIJA 1ZVKA 4ERXA 4W99A 4FYMA 1AMOA 3R9XA 1Z2DA 2XGGA 4QREA 1G2PA 1C0IA 1JEQA 3RS9A 4GXIA 1X39A 3DMTA 2DWCA 4QTTB 1UJ6A 4RA6A 4KBGA 1U0HC 3PNOA 5I9LA 3TIIA 3B20A 1KPGA 3SYNA 4HNUA 4PFSA 2QKYA 1YMUA 3HYLA 1WUDA 1XZLA 4NIMA 5TEVA 3V9PA 1N32B 1Y9AA 1WXDA 3LDGA 4RPIA 4M86A 4TURA 3U40A 2FPIA 5CRXA 1Q57A 2FW6A 2XVMA 3O0DA 4AG5A 1XTSA 4QG7A 3NNNA 4N7MA 3EPGA 1WSWA 4JAVC 3GJYA 2YIVX 3G2KA 3KJQA 4C0XA 3KJXA 4TMKA 3E1GA 5FHQA 1U49A 2BSQA 1VECA 4MWEA 3H2BA 3QP9A 1N6OA 3QBEA 4BJHB 4G81A 5A4KA 2ZAMA 1DQNA 1JXOA 4QM6A 2BBTA 2ZE8A 5KIAA 5LZ5A 4GWKA 2C2RA 2X7JA 3OQJA 2I3DA 2W2KB 1TTPB 4JLBA 4M53A 4WZBB 2QTMA 1TK0A 3WNZA 1I4TD 4HEA6 4MWSA 5CFZA 5MGBA 3EFBA 4ZOEA 2YJ4A 1H8ED 4RDIA 1G2OA 1WV1A 2F64A 4Y2QA 3UGTA 3LQYA 5B12A 3LOUA 4NBRA 1PR1A 2VHEA 3OBIA 1RFLA 1HGXA 3EQZA 1COWA 2W6JA 3ON5A 4TT8A 2O8NA 4XWTA 1JKXA 1LX6A 3G1TA 4CN9A 5IAOA 1AGNA 1R6UA 3Q2KA 1SCNE 1OLSA 1NV8A 1AQ6A 2O3UA 4HATA 4H9GA 5BSFA 5I4IA 3GN1A 3C4VA 1A8QA 1A9RA 1VBMA 4RD3A 5FRDA 2J0VA 1XZPA 5H9VA 1Z3IX 1VJ5A 3MINB 3DFUA 5HM6A 1YONA 4POAA 4TL7A 4CM6A 3O2SB 1HNXB 2TS1A 5AK5A 2Y99A 1Q46A 3HN2A 2KICA 4P7FA 3L0YA 2W22A 5DK4A 5KWJA 3DC2A 3N76A 1S3FA 1ECPA 1F3OA 2I2DA 3DV0B 4ZJYA 1FFYA 3U6BA 2HIAA 4UDNA 4A36A 4RACA 3EXEA 3KR9A 4RPJA 1FZTA 2J46A 2BEUA 1K9SA 1ZUNB 3ZWKA 1Z5WA 5IT5A 2H3HA 2H2FA 4X61A 5CXXA 5BQ5A 3W9UA 5IIKA 3H4MA 3RVPA 1XWIA 4OLBA 3D5EA 5JSUA 3QNWA 2VP5A 5TQ2A 4BCCA 5KDOA 1DJMA 1EB9A 3OJUA 2KI5A 4UHFA 3A1EA 5ELMA 3UFXB 4F7WA 4H6XA 3MRSA 1O1YA 3K9HA 3FAZA 1GL3A 3L1JA 4IFTA 4DUZB 5AW5A 1P4AA 3G68A 2HTFA 3PGVA 2EYUA 2XTZA 3SENA 2H9IA 3NJ8A 4GBGA 3BD8A 5DM0A 8ICTA 1SXJB 1T5HX 2WDPA 2XTMA 1QX4A 2XMQA 5A5FA 2VDWB 3A04A 3E53A 5IMSA 5JISA 2Y1WA 5KTTA 1NX6A 4F3KA 2LCIA 1W36C 1KK3A 2W6NA 3G8DA 3CYMA 3K1AB 1EZ1A 1Y6JA 2PA0A 3QVTA 5IU6A 2NZ8A 3HWWA 2V6FA 1A71A 1KYXA 4RF5A 5CMLA 3U7JA 2BUAA 1PW7A 5JNTA 1BNOA 3BWVA 2XUFA 3GUZA 2V6JA 4I19A 4LI3X 5DCWA 1T3GA 1YNOA 2GRAA 2KP7A 1NQWA 2Z1MA 1YDGA 4GLLA 2H4ZA 4DC1A 4DCGA 3JZIA 1D3AA 4OM8A 2KKVA 3URMA 4IW3B 1G42A 2OEHA 2VF5X 4FKBA 1KEEB 2ZVDA 3FDXA 2BDTA 1U7TA 1N61A 2FMSA 2VDKB 4M0LA 3ZC3A 4PHPA 4WBNA 3MJVA 2IXAA 2ZSKA 3A9SA 3ZD8A 5FOUA 2CW5A 1D0VA 1ZM4A 3QSGA 2CVFA 4NV1A 5M3BA 3JVEA 5I9TA 5JBNA 3O4JA 1JYFA 3MPOA 1Y48E 3RRYA 2IBMA 2MSCB 2DCUA 1L0BA 1Q0SA 3PE4A 2F4VB 2RBEA 1KVUA 2J85A 1OWNA 2VPWA 3MELA 3Q7QA 5DHPA 5ES4B 3T3FA 3PC8A 4DAOA 1AM4D 1XI2A 2XE8A 4G1BA 1VPLA 2XCUA 3N8KA 4NZZA 1BS1A 3DOJA 1AGYA 3NU1A 5BWLA 3E35A 5D85A 1XIVA 4HNRA 2BHTA 3UB2A 1B74A 4EJ2A 3FGPA 1T0UA 3TVYA 2YWGA 4JS0A 2JIDA 2GNOA 4M1WA 4NNOA 4MUGA 5D2CA 2O5EA 1R6AA 3MBIA 1E3TA 4Z3DA 4NZ9A 2XCAA 2B20A 1NF8A 2KE5A 1FLAA 3IOCA 4L6AA 1HKHA 4DCNA 4CHGA 4KIJA 4EECA 1TK2A 5DX0A 3GLGE 2ZZMA 2WR8A 3GHHA 3EEYA 5IILA 1LD3A 1DEKA 2EW8A 2HKIA 2QE7D 4ITVA 4P08A 3RU7A 3TEMA 1LI5A 2QX6A 1V2GA 4P0PB 1JMVA 3R3HA 4AB1A 3M9WA 3NVMB 4J4BA 3M6XA 1KK0A 4MS4A 5CFNA 5KTRA 3TUZC 2ZIVB 2CL0X 1BW9A 3GARA 2GGSA 4R2XA 5KX5B 4XIIA 2JH3A 4Y0AA 1LB2B 4R1OA 2OCLA 1UUFA 2CGEA 4ADSG 2PMKA 1DX4A 1W4RA 1Z6TA 1ZD3A 4EHAA 3UAYA 3IV7A 2C04A 1FO4A 5LDHA 2YUIA 1EVEA 5C1OA 1VMAA 1W59A 3L0DA 4GS5A 8MHTA 3CR7A 1Z5NA 3K15A 5KX5F 3ZDAA 1CQPA 1HA3A 2RBKA 5EJ8A 3HSKA 3PCXA 4NCAA 3PUXA 1W581 5A5DA 1JEOA 1NURA 3QVOA 4KLMA 1U31A 1XELA 2CLFB 3HO8A 2FOLA 1S0VA 1OYWA 3AFMA 2B4AA 4PSCA 5FBWB 1SAYA 5KJEA 4DSNA 5HKKA 4J3JA 5HIMA 5I7HA 4XUEA 4I1PA 5C8XA 2PLFA 3GRFA 4F5OA 2HA0A 5IC6A 2VT3A 2C4NA 4KI0A 4H3KB 1FJGB 1A8UA 1O87A 2QM7A 1FP6A 2YJ3A 3U6KA 1T94A 1GCOA 2BM0A 4KN9S 4POOA 4EO7A 4CF4A 4UPDA 1TMGE 3A1UA 4X95A 3VVBA 4CVNA 1S3IA 5CBPB 1KRWA 3ZWXA 1VPEA 3QTTA 4K0RA 2ZUWA 1T6NA 1SPBS 5AK6A 2GERA 1KFBB 1HFKA 3AL0B 2QB5A 4MRRA 3N53A 4RPGA 5KZMB 3CZ4A 5KUTA 2D8CA 3PTAA 1K7CA 3RVNA 4ZXPA 3TVTA 1CQZA 1LDBA 4GZMA 2ZJYA 4A8JC 4PX2A 5BSKA 2NZWA 4OHBA 5L3QA 1NMYA 1KWKA 4B3BA 1T8WA 1BFDA 1LB1B 3Q3JB 4FXPA 5JU6A 1ZEMA 3PC4A 4FOOA 3EXIB 1F4PA 4HEHA 4LYGA 4ARSA 2EFYA 3GJQA 4MVJH 1QHEA 1DFHA 1T5DX 2ANBA 2W58A 4KQEA 2UZ1A 5LZ8A 7ICOA 3DE6X 2W6IA 2C57A 4FS3A 2I62A 3PGXA 2YKGA 2YTZA 4K26A 3O4IA 5E9QA 3O8CA 1QF9A 4Q01A 3F1LA 2WAOA 3P4YA 4WW0A 1H4QA 3WQHA 4HQKA 3LVRE 4BTLA 1A7AA 4WZBA 2CJFA 3QXJA 1L4HA 1BGVA 5JDCC 5CCBA 1N1DA 4G4IA 3CW2A 1KY5A 2KHZA 2RJOA 1OTYA 2CDCA 2J9GA 9ABPA 1VHQA 1U2DC 4NEHB 4EQZA 4CLXA 3K0AB 2QRMA 4RELA 3A2KA 3S2EA 1E0AA 1WSAA 2VH1A 2EW2A 2H0AA 4X24A 4AMGA 1B8NA 3S2GA 4Q19A 4CMEC 4ER7A 4D9KA 1O8CA 1ODTC 4PHEA 1SUWA 2QMOA 2C78A 4ECSA 3DAPA 3W2GA 2ACVA 2E21A 2NVUA 1HMPA 4M83A 4LS3A 4RHEA 1UC9A 3DF9A 4W1SA 2GPBA 2BN4A 5EZYB 1DKLA 4A6EA 3NH6A 1R8XA 1UFKA 3QKTA 5IS2A 2FWMX 1UIRA 2IEGA 3MS2A 4N48A 1WCIB 5KVCA 5J2GA 1F6BA 2XIQA 3IPYA 3BH6A 4LV8B 2J6HA 4BNMA 2ZIUB 2NU9A 3OZSA 4ITUA 4TX1A 1CJMA 1COOA 1D9DA 1YCDA 2NSHA 2WFAA 3B1VA 2IVFA 4TYQA 4X5OA 2K4PA 2DECA 3N0RA 3OFSA 3NVKI 3L1IA 1Q6ZA 3IA7A 1MKYA 4COKA 3DO5A 3GRVA 2QG6A 1X7ZB 3KLBA 3LBYA 2Z30A 4TMZA 1FNNA 4LEIA 1TXGA 3SHWA 1LNQA 1XVUA 2BZ0A 3KRTA 1WDWB 2WYOA 2HYDA 3GB9A 1DCKA 2QLBA 1P2SA 3OCWA 1E62A 5LLSA 4LJKA 2QAGB 1NT4A 1PQYA 5KFJA 4WOJA 3BT7A 1NN0A 3AM5A 1VYTA 2C22A 2E6UX 2VDLB 3ZIDA 1RXSA 4S0XA 4BGDA 1EUQA 2YTUA 1UKVY 2FMHA 4ZI5A 4Q8EA 4P0QB 2AXTU 4EHNA 1CHNA 1PGPA 2CYCA 3P9NA 5JATA 3QEOA 1N34B 1XC9A 2Q1TA 3ILSA 1FDOA 2AI2A 2CHFA 1U11A 4UB4A 2VDOB 2Z3WA 3B12A 4DLWA 3MC1A 2PFSA 1Y4UA 2XYRA 3HKEB 3NAMA 3FLMA 4L7VA 2JA1A 2NX2A 1UOPA 4KDFA 4RPXA 3BJRA 2KJQA 1NJZA 1C1YA 2ENUA 2FXIA 2X0KA 3JD3A 3KLOA 4FUTA 4JKIA 4L5JA 3SJZA 3GLIE 1PGQA 1YVEI 3KKOA 3QVSA 3WL3A 3E3LA 1HDZA 3EMKA 5T14A 4PLGA 4F4IA 4PC1A 3FDZA 3NTXA 4IHQA 2Z58A 4JIMA 5C0OE 1RM3A 3A6FA 3QPBA 2ASLA 2MAXA 1TC2A 2GILA 3ZUGA 2XUHA 5A1TA 3FX2A 4EYHB 3W77A 3DV2A 5J0RA 2QRGA 5CP2A 3WTBA 1WF6A 5TMBA 1MHTA 5HF8A 3B5IA 2HDHA 4FHDA 4FLEA 1CLUA 1UFRA 4OO1J 5F2KA 4HDNA 1QQTA 2PK3A 1RZRD 3M8KA 4R8UA 2RGUA 3JYQA 2JW5A 4LOIA 4KMSA 4YREA 1NK4A 3PO4A 1Q2UA 3TAHA 4RYDA 2FQ1A 2VK2A 4BMXA 4WWHA 5FFNA 2A5DA 1JECA 1T4CB 4I3FA 5IH7A 4Y1RB 2HSWA 4TOIA 1XVLA 2AEJA 1G5HA 2BDEA 3ICOA 3O8BA 3A0UA 1G41A 2BI8A 3CSUA 1U5AA 3C3YA 3DE4X 2AL7A 2VRNA 3HKDA 1IY2A 3KB8A 4J1TA 1NUQA 4OHKA 1SXJE 1K0FA 4F5ZA 4XZ3A 2VH5R 1QIMA 2XAUA 4HTFB 4MP8A 1Z73A 4KR2A 3MWGA 4Z8XA 2E8OA 2F77X 1HE2A 3N2EA 4F5EA 3OTQA 3E61A 3B5EA 2D0IA 2WB1F 5EOVA 4BECA 3O03A 4G65A 3T7SA 4HP8A 1CVIA 3GIJA 3GMIA 4NG5A 2R8RA 3DD5A 3HHEA 3AUYA 3ZYCA 3KPVA 2QYSA 3LIPA 4QDUA 5KJFA 3A9RA 3F6SA 4IIJB 2DQNB 1XDBA 2FXVA 2X19A 5JJCA 3FMOB 1X9IA 4P1ZA 1WR8A 2D1TA 5AI8A 5BSGA 1B76A 5LQDA 3LQ2A 4QSHA 5IW8A 121PA 5L8VA 5LM3A 5F7OA 3T1HB 5CT6A 3IPLA 2FLKA 1VHLA 4UBBA 1XZCA 2DLCX 1GUDA 1USKA 4V0RA 4JV0A 4P84A 3EPPA 3T9EA 2GCGA 5EWMA 1JDBB 2O5VA 2HA6A 2RD2A 1QS0A 3C41J 3Q7EA 3LU1A 1Z3EB 3K5PA 4KGZA 4XRRA 4DCOA 3ZDEA 5LQKA 3KDPA 4EOGA 3UMMA 2PSSA 3HXMA 1RQPA 2ZRKA 3RJJA 1G3RA 1G8AA 3KHSA 5DJ5A 5C18A 4I81A 1T5IA 5L40A 3EUWA 3VGJA 1OPRA 4HNVA 1RT9A 2E4YA 2A9VA 2X5NA 3HBNA 3OA0A 4NBLA 3GNLA 4XPIB 2V54A 1Z45A 3FAHA 1SCQA 3RANA 4TWRA 2V7QA 3GDXA 2IHVA 5BNIA 2GFIA 1GAWA 1KTVA 2IL1A 2EFHB 3RREA 2YCLA 5JR3A 1EVZA 3W90A 4EHLA 2HNKA 2G36A 9ICQA 4PPQA 1KDOA 4R01A 4D4LA 3IAUA 4YAGA 1YNSA 2ZTDA 2Q29A 3CBQA 4GI5A 4TQGA 4GKKB 3H7IA 3CLTD 2BCJQ 1B3RA 4OK6A 5JZOA 1JPUA 2PH7A 3E03A 4HUTA 5JDIC 3L5KA 5DHFA 5EAIA 2R97A 1P0PA 3TQFA 5TLSA 3RBEA 2IUEA 5IZCA 3ROKA 1GGVA 1HRDA 3W6PA 2A4KA 4LFBB 2WSLA 5DQHA 3K7EA 3E1KA 3GVPA 4WUVA 4I2VA 4ZD6A 5HFJA 4HYKA 4L85A 5TPZD 4K1LA 2VDUE 2M32A 2WVAA 2KEYA 3LBHA 3Q7PA 5F1PA 1HOTA 2GK4A 3BF8A 4NX2A 4YH1A 1XQXA 2CBGA 3L6DA 5E6UA 4F71A 1T2DA 5BNTA 3GFOA 1ZRHA 2H52A 4P4PA 3L1HA 4I9HA 3R76A 5F7ZA 3ZK9A 2UUCB 5ESXA 3AQEA 1JV2B 3EJ6A 3C6QA 3SXUA 3I01M 1S0NA 2BCSA 5DRTA 4ND8A 5HP4A 3F6YA 2UVPB 1C30A 1G6HA 2ALZA 2WWIA 3DFFA 3HVUA 1E63A 1VB3A 2VYVA 1RBYA 4ICAA 4Y2UA 5IINA 1P39A 2QI9F 2QY6A 3ZDBA 2CLCX 3I58A 2LYBA 3KK0A 1W4LA 1QANA 5DHUA 1KI2A 4J2TA 3EIWA 1I4DD 3O8QB 3N7SC 2NU7A 3I45A 3DHWC 3LY7A 1IB0A 4QXAA 1NW7A 5BSUA 4YCBA 5A4MS 4LXTA 2XCSB 4YP7A 2WQZA 3TAXA 2QORA 4GPTA 2ASEA 5CUQA 3OCUA 1VDVA 1DUSA 5BOMA 2WUWE 3CCCA 4JJFA 4KBYA 4OJTA 3FKJA 1EZ4A 1UC5B 1J0DA 3ITKA 4EG4A 1LLCA 3U1TA 5F77A 1J2TA 2O52A 1Q92A 2XPCA 4KTTE 4TZ0A 1SBZA 1WTCA 2HFJA 1CY6A 4KTQA 3PFWO 2ORIA 4M9GA 2ZI9A 5C37A 3VKGA 5DB7A 1P1IA 4MUHA 2V7TA 4HFNA 2WTEA 4MVXA 2F3RA 1AQJA 4NLLA 1NVMB 3R4CA 5TQVA 2IKSA 1QSLA 3KKZA 1URJA 1D04A 1IDN1 3A25A 5IC5A 1OHHD 1DOAA 5A06A 4Y18A 2O8BA 4C4TA 1AHHA 2Z9DA 5LA6A 2GFQA 2BE9A 2YYZA 4RY0A 4DMKA 1FPMA 1AA9A 3EY9A 5C1DA 5KOHA 3ZDXB 4ECWA 1JDUA 4O1MA 2R9VA 3LQRA 1UCVA 4PPYA 2JHPA 4AWXA 3KXPA 1TB4A 2XXBA 4RTKA 3FSEA 1OC4A 3U16A 1L4BA 3A06A 1YUBA 1DHRA 2PJUA 3ONDA 1GNRA