3S6JA

The crystal structure of a hydrolase from pseudomonas syringae
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
220
structure length
216
Chain Sequence
PQTSFIFDLDGTLTDSVYQNVAAWKEALDAENIPLAMWRIHRKIGMSGGLMLKSLSREITDEQAERLSEKHAQAYERLQHQIIALPGAVELLETLDKENLKWCIATSGGIDTATINLKALKLDINKINIVTRDDVSYGKPDPDLFLAAAKKIGAPIDECLVIGDAIWDMLAARRCKATGVGLLSGGYDIGELERAGALRVYEDPLDLLNHLDEIAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hydrolase, haloacid dehalogenase-like family
publication title The crystal structure of a hydrolase from Pseudomonas syringae
rcsb
source organism Pseudomonas syringae pv. tomato
molecule tags Hydrolase
total genus 76
structure length 216
sequence length 220
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3s6jA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3s6jA01
1F5SA 3A1EA 3RFUA 3NIWA 1SWWA 4UMDA 4UMFA 5ALVA 1Z5UA 2YJ4A 2I6XA 4O8CA 2YY6A 2WF6A 1N8NA 4FYPA 2RB5A 2HI0A 4MUMA 1KYTA 3UM9A 5ALJA 3KZXA 1T5TA 2FPSA 1RMYA 4UU0A 3UMGA 5ALHA 1L6RA 4B6JA 2DQSA 1Z4KA 5AKLA 4UW9A 4BX0A 4GIBA 3FVVA 2YMPA 4J03A 3L1VA 5ALGA 3L0CA 2R8YA 5AM0A 3EF1A 5AW2A 2G0AA 2IOFA 2YFYA 2W4MA 5AM5A 4DW8A 2B82A 3L8HA 3WK9A 2GMWA 2Q4RA 4RETA 3U26A 1L8LA 5ALFA 5AICA 4OD0A 3KBBA 2GFHA 3ZI4A 1Z4MA 4I9GA 3OTQA 3N5KA 1WR8A 3QUQA 4BKMA 2FUCA 3M1YA 1T9ZA 1Y8AA 2O9JA 3HYCA 4XOUA 5AM2A 3QU7A 4YGYA 4NV0A 4CF5A 2ZBFA 2C8KA 2I34A 3NAMA 4EENA 3R9KA 2JAOA 2WFAA 3QXGA 3E84A 5AVZA 2G07A 3NUQA 1YS9A 2B8JA 2MSNA 2NO5A 4G63A 2WF5A 2CFRA 5T41A 2ZBEA 3QUBA 5AW6A 5AM3A 4G9BA 4NABA 5ALMA 3HLTA 5ALDA 2EATA 2ZOSA 1YJ5A 3R4CA 4NFLA 3A1DA 4IFTA 4BEVA 3A3YA 1RMQA 2OM6A 3A1CA 4C4TA 1MH9A 2W11A 2FPWA 2JAWA 1NNLA 4HYTA 4BX3A 3I1YA 1RKUA 2YJ5A 2MU2A 3U19A 3GYGA 3QU2A 3WKAA 2WF7A 5AVVA 5AW0A 5AK4A 2NO4A 5AKYA 1RLMA 4F71A 5AVQA 4ZEXA 2GHQA 4HGRA 3MN1A 4BNDB 1RRCA 1T5SA 1N9KA 1QH9A 1YMQA 2IA5A 4KNWA 1Z4LA 3QUTA 3ZX5A 2OBBA 4JB3A 1AQ6A 1NRWA 3SKYA 4QQFA 3DAOA 1U7PA 3WGUA 4ZEVA 2I55A 5AI6A 4CF4A 4UAUA 4HGNA 2C88A 3L8EA 3MMZA 2B1RA 1EK2A 2RAVA 5AKKA 5FP0A 5ALOA 1Z4IA 5AHXA 1RQNA 2W43A 2G09A 4BNDA 3UMCA 2PQ0A 2P27A 5AKXA 3F9RA 4FFDA 3E8MA 2O2XA 3U7GA 1ZD5A 5AM4A 4EEKA 3DDHA 3ZW7A 1QYIA 3FPBA 4FE3A 3QU4A 1O08A 1RQLA 4AS2A 1TJ5A 4CE6A 3QU9A 2RARA 3L7YA 4XE5A 4Y2TA 3TLMA 3U13A 2I33A 2CN1A 3ET4A 2HF7A 2P69A 2WHEA 3BWVA 1ZOLA 1QQ6A 5ALSA 1Q92A 3ESQA 3DNPA 5ALWA 1PW5A 3B9BA 5ALIA 1RMTA 3ZWKA 5A3QA 3FGOA 4KYTA 2QYHA 3U7EB 3WK7A 2HF2A 2YN4A 1QQ5A 3ED5A 1S2OA 2FI1A 3WKBA 3J7TA 4UAVA 1L7OA 3OCXA 4NAVA 1U2TA 3ZX4A 2HOQA 1IWOA 4E88A 4YCMA 2GHTA 1RPZA 2FUEA 4BBJA 1Z4NA 2VKQA 4L57A 5AIBA 1L7MA 2IOHA 2B0CA 5ALUA 3FPSA 2AUTA 2YJ6A 5JJBA 5ALLA 2AGVA 2C4NA 5AW7A 4QJBA 1ZD4A 3BA6A 2BDUA 2CFSA 3WKEA 1RC8A 4EX6A 4OCZA 4YIKA 3SF0A 2R8ZA 1TJ4A 2JARA 2HEGA 3CNHA 3I76A 3QU5A 5IS2A 1J97A 3QLEA 3UMBA 4EX7A 1VJ5A 2C9MA 2JGAA 2ZBDA 1TE2A 5ALKA 5E0OA 3R09A 2JAUA 2RBKA 5ALTA 2R8EA 2ZXEA 5AI9A 2X4DA 3NASA 1Q91A 3QYPA 4CF3A 1L7NA 3DV9A 4HGOA 1XVIA 3N28A 4J2TA 5AW8A 5AW4A 4KX5A 1ZD2P 1Z4OA 3ET5A 1VJRA 3IJ5A 4UU1A 4NWIA 3WK6A 3AR2A 2BY4A 5A3SA 1ZRMA 2GO7A 3SHQA 1XPJA 3ZVMA 3AR7A 1FEZA 1TA0A 2FEAA 1RLTA 2G06A 1O03A 4KN8A 2PR7A 3L8GA 2B8EA 2P11A 4C4RA 4Y2QA 5AVUA 2AH5A 2NYVA 4OFZA 1U2SA 1Z4JA 3OCZA 3OCYA 3KC2A 5AIAA 4DWOA 1L8OA 5AVRA 1ZD3A 4RESA 5ALNA 3L8FA 1Z4PX 3ZUPA 3AR6A 1RLOA 3L5KA 4ZEWA 3WK8A 3RF6A 2YMLA 1XP5A 2HHLA 2P9JA 4IG4A 5ALEA 5AI5A 3WK4A 1U02A 4BX2A 4XQ0A 4KNVA 5AK6A 3ZWDA 1J8DA 4BEWA 3I6BA 3QUCA 3L0YA 3ZTYA 3E81A 2FDRA 2YMMA 5AW9A 3E58A 2MU1A 4XPZA 2I54A 2YBDA 1RKQA 3SLRA 1SU4A 2HDOA 4Y2SA 5ALPA 1S8OA 1ZRNA 5AKEA 2EARA 2D2VA 3PGLA 3AR5A 1ZS9A 4Y2RA 5AI4A 3MC1A 3K1ZA 5AI8A 4DCCA 5ALXA 3EF0A 3KDPA 5AW1A 3AR4A 4Y2YA 2B30A 2WF8A 4UM7A 2HSZA 4L6CA 3EPRA 3W5DA 4CNQA 3PGVA 3IRUA 2ZG6A 3ZTWA 4YCNA 4BYGA 3FZQA 4UATA 4EZEA 3OPXA 3OCVA 1RDFA 1WPGA 4Y3UA 2Q4TA 4JDPA 4Y2PA 1WZCA 3AR8A 2Q5EA 3ZU6A 1CR6A 4MWOA 3KD3A 5AKIA 1Z5GA 5AVSA 3ONNA 4GXTA 4YH1A 4DFDA 3N1UA 1K1EA 3QNMA 3I28A 4HGPA 4L6AA 4UARA 4H1WA 2YJ3A 2IOFK 3QGMA 1YV9A 2FPRA 3NRJA 1Z88A 5AM1A 3W5BA 3ZVNA 4Y2JA 2G80A 2R8XA 4KX3A 4HGQA 3MPOA 1LVHA 1U7OA 3PDWA 3AR3A 3SKXA 2I7DA 3OCWA 5AKHA 3B8EA 4AP9A 1EK1A 2YMQA 5IT0A 3N07A 2WF9A 5AK5A 3CZ4A 5AKJA 3P96A 3PCTA 1L7PA 4EELA 2C8LA 2WM8A 4Y2VA 3EWIA 3SMVA 5AW3A 3OCUA 4Y2UA 5AI0A 3ESRA 2BDEA 5AVYA 2PKEA 1VFPA 1Z4QA 3VAYA 3U7HB 4PNHA 3B9RA 1NF2A 2EAUA 4UASA 3AR9A 2ZBGA 5ALQA 1JUDA 3S6JA 1ZJJA 4AS3A 5ALRA 2HO4A 1YNSA 2HX1A 2OA0A 3QX7A 4F72A 5ALZA 1QQ7A 3KOOA 2HCFA 1CQZA 2B1QA 3NALA 3FM9A 3SD7A 5AK3A 4UM5A 3L0BA 5AESA 5AW5A 1YDFA 4UMVA 2OYCA 2CFTA 1TJ3A 3U7FB 5AKZA 5AVXA 4HAIA 2AMYA 5AVWA 2FPXA 3WGVA 2G1AA 2QLTA 2ODAA 3M9LA 1LTQA 4YIHA 5IT4A 3W5AA 3L1UA 5ALYA 5A3RA 2G08A 3W5CA 3WKDA 4UMEA 4Y2XA 1X42A 3WKCA 3NANA 3ZVLA 4YCLA 3IB6A 4I9FA 3WK5A 2FPUA 3N8GA 5AKGA 2IYEA 1SWVA 4C4SA 1RKVA 1WVIA 4OHFA 3D6JA 5AVTA
chains in the Genus database with same CATH superfamily
3C1YA 1T6BY 3UQYS 2GEVA 1FS6A 4ND8B 4BFUA 4CDMA 3E9NA 4LZGA 3KXIA 3Q2OA 3UW3A 2OQIA 2D5AA 4OB7A 4O1MA 4AMBA 4II3A 3NVAA 4BVAA 1KI7A 3AY0A 4MYSA 4W4TA 1JR4A 2M2IA 3HJUA 2WUWE 1NTRA 4QPJC 3GGPA 3NNNA 1YQWA 4I9GA 4EPVA 3I62A 4HPWA 1E0AA 5DHRA 1FFGA 2ZAMA 3AUUA 3E84A 2MT9A 4UNSA 5LUAA 4NE9A 4JQOA 5J2JA 4E6PA 4OH7A 1PD0A 1P61B 4AM8A 2O7QA 3T3HA 3INTA 1XTBA 1WX1A 2ZBEA 4JGIA 3VPSA 2VG8A 3CW2A 1N78A 4NABA 3KZ1E 2ZOSA 1HPLA 1G21B 3A1DA 3EEFA 3Q7TA 1XAIA 3OH8A 3BIJA 2HYIC 5F78A 7ICIA 1T4CB 1VE1A 5AVVA 2WYIA 5LBUA 4FM9A 4HAYA 1P3JA 4KO1S 5BO5A 3O93A 4ND4A 1YIAA 5T7BA 1IONA 2C88A 4TTPA 1IHUA 5BSGA 3KT0A 4AB1A 4CLHA 7ICJA 3F90A 1GZSA 1PK1B 2XKKA 2XNJA 5FO1A 3PHBE 3ZGXA 2YWGA 4F4YA 3AHHA 4H7KA 3V46A 5DQHA 4DWWA 2OLJA 5HIIA 1DWUA 4RHXA 3V48A 3WOHA 4PXSA 1MA7A 1NMSA 5JY1A 4PR0A 3ZLUA 1R0CA 2AG1A 4EP1A 4M1EA 3TCXB 4HB3A 2B21A 3C6XA 2Q2VA 3QENA 1YDHA 5IWCA 1YVEI 3E9RA 1IMJA 2B37A 4K1LA 4M9NA 1GLNA 3VZDA 3L6BA 1E9VA 4QJ3A 1NK9A 6CHYA 3V4OA 1BW9B 1QIFA 1IY8A 1TA4A 1HQYE 4J2TA 2YICA 4BS9A 2C2XA 4TZ0A 5CYGA 3LYSA 4YQYA 1KMHA 1NC3A 2Q4EA 3MFYA 2VQDA 1NVXQ 2IPXA 3D9QX 2CFOA 1GJRA 5AUPB 5KTRA 3KO8A 3EUEA 4WXEA 4DDHA 2LD4A 1VL6A 3UJHA 3EODA 3HSKA 3WR5A 4B0OA 4RESA 4PZLA 4PGGA 2P9JA 3OOSA 2BJWA 1I6LA 3PQ2A 2R8KA 1G63A 3ZTYA 3P27A 3CY6A 1UPBA 2FEXA 5G1OA 3E8SA 3HFGA 2O1SA 1X80B 2EWMA 1QGUA 4G1EB 1P2FA 5KG7A 2ZB4A 1SM4A 1CVIA 5HCIA 4MVCA 5IM4A 4ZAZA 1KOGA 3QVGA 1ULHA 1H0RA 4FFMA 4LMPA 3F4BA 5H9VA 4O4LB 4EZ9A 3SHTA 2ZSDA 4D74A 5CDYA 2XUDA 4QOSA 1CR6A 4IZOA 2FZLA 1U5AA 3IBYA 3PC2A 3UXMA 1CUJA 4ER3A 2L19A 2PCLA 1M2EA 2AC2A 1HWYA 4DNFA 4KX3A 3VVMA 1L3IA 3I92A 1U7OA 4D6PA 2FX3A 5SY4A 2VPTA 2P6UA 2DC1A 2GBIA 3AYXB 5CEFA 3DEKA 2F1OA 2ZYGA 2FZGA 4WDRA 3AINA 4MDYA 1DJMA 2CD7A 1KMQA 4OYLA 3RS8A 1A4UA 5A3VA 4FGZA 4LDRA 2N1MA 2LKYA 1YNSA 4EVRA 1S1MA 1YR3A 4OLFA 4F72A 3K75D 3H8MA 2UVUA 1T9KA 1VLLA 1ZBDA 4G09A 2PBZA 3E0XA 4NBRA 5IT4A 5P8WA 2R1UA 4C07A 3WBFA 2RHJA 3I3OA 4NENA 1Q1QA 1R9GA 2DPHA 4NZZA 4Q15A 2OESA 2UZAA 1SHKA 2O8EB 3FFXA 4JUAA 1YRAA 4RKRA 1RXVA 3WG9A 5JJIA 1GA1A 3T4UA 3BQ7A 4C21A 2WAOA 2NZXA 4L73A 5GPBA 3E1KA 4A5OA 3UJCA 3IHTA 4NBNA 3OZVA 1OT5A 3KETA 2X9NA 3D2LA 2XH8A 1Y1PA 1Z68A 4C87A 1H0KA 3QKWA 4FYIA 5EJMA 5DIFA 2C8JA 5JDIA 4N6GA 4X90A 1JIQA 3B3QA 1AGRA 2OBNA 1TRHA 2J7KA 4CKCA 2VDMB 4CTMA 3FWYA 3TB6A 3UC9A 4ENWA 3LI2A 1LKYB 4WFJA 8ICTA 5C7YA 1YQEA 4QZIA 2ZSIA 1RLIA 2C7BA 4G63A 1ZDMA 4YAFA 4RK1A 4PM4A 4MPTA 1Q6YA 4EO9A 4OL9A 4JA0A 4DXHA 3A3YA 5ERXA 1XLWA 3SICE 1M7HA 1P18A 2ZYUX 4M47A 4G0YA 4I55A 5HS4A 1E3LA 3QM1A 3WSVA 5DBEX 2WILA 2IJGX 1UZUA 5EE1A 4A5SA 1YU6A 5EXEA 1EFAA 2VPPA 4XWOA 2XTZA 3OOEA 1MTZA 3RSZA 3JPRA 2P77A 3RUPA 1XLUA 2XBLA 4ZJPA 3QELA 2PTHA 2ZIGA 1RYYA 3JQAB 5DJ5A 4BB5A 4POOA 4RUCA 2RGUA 3RUFA 4PO3X 2Y9TA 4HXFB 5H80A 1WA5A 5FD8A 4M4SA 4RACA 5IPFA 3WJ7A 3IAFA 1DPFA 1RZTA 3U4IA 3QZ8A 5CITA 2P1ZA 4EI7A 1RWPA 4CLEA 4M9QA 2QRKA 2OBMA 1Z82A 5DKWA 4D9IA 1HUZA 3UV7A 4JJ8A 1YVPA 2KSOB 3EZYA 2NSYA 5H16A 5DG8A 1P80A 4JLSA 1I7SB 4YMVA 3J81j 5C35A 4CM8B 2IYQA 4ZTZB 3C45A 3GNLA 5E4YA 3ZQKA 1K08A 3WQQA 2YYAA 4N41A 4PRYA 4J91A 3E0FA 1JR3E 3OX3A 1H5NA 2KI5A 1DX4A 1Z62A 2A1IA 4EG4A 1XRQA 3R6TA 2KJ5A 4UVIA 4F4WA 1JDNA 3AW9A 3CZAA 3DAYA 4C0XA 4YB8A 5HFJA 2PXXA 1FP2A 1CF2O 2E18A 3DNMA 2XUFA 3LP5A 2AFHA 1VA4A 4DAOA 5CP8A 3D6NB 1SCAA 3LXMA 5EYPA 4UNRA 1A5BB 2Z5LA 1EXNA 2Q2NA 3DFFA 3Q9UA 1SG6A 2D74A 2AI3A 2ZK7A 4DMRA 5IG2A 2I54A 2PEYA 1SVNA 5A5GA 4YFYA 2R1VA 4IDFA 1LDNA 4IV5A 5E9QA 5J2IA 3SWWA 3NC0C 4CWAA 1Y8ZA 2WD8A 2GERA 5KWSA 7ICFA 4M3NA 4RK0A 4IHAA 2PRSA 3LRPA 1KFJB 2XEDA 5KFLA 3ELWA 5B7PA 2G04A 1XEAA 2Q45A 2Q0ZX 3WYAA 4CNBA 4H18A 3ZWCA 2CXNA 2DKFA 5TQ2B 3PXXA 3MTJA 2JHDA 4OH1A 3NM5A 2ZETA 1EK1A 3G7SA 3ROKA 1BJRE 3RI3A 5AXAA 4KU4A 1BDJA 3M83A 4WK4B 1WVGA 3KT6A 1OFIA 3UBTA 2BFCB 4UASA 2Z98A 3R5SA 2HCBA 3KOOA 1MA3A 1M34B 2QRVA 4B4UA 3AV0B 1L4BA 4LYGA 2AMYA 1LK5A 3UUEA 1SQGA 4QC2A 1E1CA 1FDWA 1BO6A 3RS0A 3UN1A 3BHNA 2OL4A 1WG8A 1BJKA 1P9WA 3W1VA 2GF9A 1X39A 2PS0A 1MO6A 1RKVA 3SE0A 4D1YA 2UYCA 1V1JA 4C89A 3B6KA 4YO8A 5B66U 2NUPA 2Y1FA 5EHZA 5IINA 2WW8A 1DKMA 2CHVA 3LK6A 2NT4A 1U0TA 2W03A 3AESB 9ICLA 1BMTA 2YC4C 1UBSB 2H7XA 5IDYA 4HHEA 1E61A 1Z2EA 3KJZA 5I7AA 3QEOA 1S7CA 3EF1A 2OCIA 4F11A 2R86A 3L8HA 1LSSA 4GLXA 2I66A 1ZR4A 5A4JA 4MVWA 1QLJA 1PJLA 1QIEA 3ZE0B 1PCXA 3E9CA 1IXKA 2AXPA 5TARA 3F5FA 1G8AA 3RFAA 1N6PA 4U2KA 3RU2A 1UBEA 1XXHE 2DVMA 4DSLA 2WJJA 3TPFA 3O95A 1NBIA 2B8JA 1A76A 4OJQA 2WAYA 4JMPA 2OKGA 3D0QA 4AX8A 1SHJA 2QMOA 2O54A 2K6GA 3A1CA 4LI0A 1YVDA 2F8KA 5A71A 3I4CA 3T15A 4J9RA 2NU7A 2ZJ0A 1KQ3A 2PMFA 4ZD6A 4CMCA 4X8MA 2PZKA 1GPNA 2XQFA 3TB4A 1T1SA 3VJLA 4E2FA 2CXOA 2H59A 2J5QA 3LNTA 5CG1A 5K3EA 2P27A 4KK3A 4D3FA 1MF7A 2ZROA 1H5QA 4YMHA 5SY6A 4NU6A 3IVGA 4LJXA 3LLVA 2EVWX 2OWOA 2FPIA 3JQEA 2DPMA 5KJ1A 1GEEA 5BRAA 5F9HA 3PSIA 2GM3A 1GGMA 4JHLA 3DFUA 3JRNA 3OMWA 2WVJA 3C5HA 3NOOA 3JYOA 4WZBB 3A70A 3RBZA 1RPZA 1Q7CA 3W1WA 4F92B 3Q8QB 1YDWA 2A14A 2CUZA 5ICCA 1E6KA 4YCXA 1B8OA 3TTTA 3W2HA 1JEQA 2OCAA 4L2IB 2HBZA 1C8KA 2W6MA 3IVMA 1BG6A 4DUPA 1VJ5A 3BEOA 4Q34A 2KBFA 3THXB 1KO8A 2CWDA 3L46A 4FJ1A 1LW7A 4OI4A 3HCOA 1M1YA 4HGOA 1GZ6A 4FC7A 4RNCA 2R65A 2BHNA 5L6LB 2GBLA 4ED0A 5AVUA 3L79A 1BYUA 3JYLA 1BPEA 4DWOA 1O87A 2AI2A 2RGRA 3WK8A 3E4DA 3RF6A 1J2NA 3IA2A 3VM6A 2DX7A 1Y4DE 1SEPA 5EINA 1M7GA 3GLUA 3N8KA 4Q9HA 1A95A 5ARCA 2UVDA 2VF4X 1GVHA 4OLHA 2WWFA 3JQPA 4TVKA 4Z49A 1UFVA 3L7JA 1P17A 1V9LA 2E5FA 3EVNA 4WFIA 2OCYC 1ZAKA 2WIFA 4UQOA 3QPBA 3AF6A 2WVAA 3KXKA 5A9SA 1P3Y1 3SJZA 2QJOA 1YFLA 1GXSB 4LMAA 2NPOA 2JH9A 3LCMA 2Y1LA 4CM9A 3OPQA 1TCCA 3AF2A 1K8RA 1IQPA 3ZJ4A 3T1OA 4P4SB 1E2FA 3MT9A 1GYRA 3TQ1A 3AP2A 2WWVD 5FI1B 4LE1A 5CXQA 4F97A 1BFKA 2O1EA 1GPYA 1HDIA 2OZVA 3IAS1 4ES6A 5FL7D 4AMYA 1LVHA 2J8ZA 3L5OA 2O0KA 2P41A 1Z6XA 4M86A 2YS6A 3GCGA 3JVUA 2B98A 4K9SA 1IY2A 1A3CA 5CB6A 2QV0A 3GCDA 3WICA 4F12A 4R1QA 3ISJA 4I50F 3PTZA 2QD1A 4J3FA 1JDJA 5A0FA 2YZNA 4TLLB 3BGWA 3ISDA 2G0TA 1B23P 4YT5A 4LZLA 3IUNA 2XODA 5AJXA 3DWEX 3RIMA 2C58A 4ZVQA 3WGIA 4QYIB 1I7QB 3OPYB 2PUDA 3TOSA 1YA6A 3FIJA 5FHQA 3JQFA 4G86A 2UZIR 2V0NA 4BNTA 3KTAA 4YCLA 5H59A 1L3UA 4B9UA 4S24A 1GPWB 1RPNA 1WY7A 5J0UA 4ECVA 3R9IA 3VYWA 1U8YA 1LBSA 5AJHA 5KOIA 3HT3A 1X9IA 3TD6A 1FS4A 3S70A 2ALZA 1SL2A 4RHFA 4NLZA 1ZBQA 4B47A 2GTPA 1PBTA 2FRDA 4A6EA 4F4UA 1RMYA 4J0EA 4I1RA 5KYKA 4N03A 5T6BA 1P4HA 4TVSA 1TIBA 3ESCA 3HB7A 3RB0A 1SPXA 1U90A 4WADA 1YFJA 3BH7A 1X8JA 2VK4A 4HN2A 1USIA 3H4TA 3DWFA 1KAEA 2EZZA 3C6ZA 2DPYA 1XDUA 4J49A 4P36A 4IOJA 1L7AA 5HDQA 3WGHA 1X87A 1P81A 1XA4A 1N5DA 3S1AA 4TTQA 3H3FA 3AH8A 4PZ0A 1HV8A 4QLAA 4HUTA 1F8UA 5IYZA 2ZBVA 3JY6A 4JXXA 4M8SA 1X9WA 2QNRA 4ICAA 1GT91 3UW1A 4YT4A 4LFAB 2GWHA 2UVPA 3HP7A 4G9BA 1BS9A 4G65A 1GL7A 2JL1A 1NASA 3RYCA 3K0FB 3DZIA 3VNSA 2FE4A 3U19A 3RGGA 3B20A 3BIXA 3ORQA 2Z2ZA 3UKJA 1O0SA 1GN8A 7ICKA 3EIFA 3CISA 3GFRA 2XQJA 2B7LA 4TTJA 3NHJA 1FLVA 5JH7B 3MWKA 2QARA 3O9VA 2GK3A 4KE9A 1SZPA 3RDPA 1E6MA 4D4KA 1JQ5A 2ZRPA 1U8UA 4COOA 3NEPX 2FA9A 4UAZA 4N3AA 5E6SA 3WLHA 3WB2A 1I13A 4R1LA 3VKWA 5IVPA 4MIKA 1O5IA 4FWBA 5BT8A 4QECA 1U5BA 4TMYA 3I2IA 4PCAA 2F6RA 3ESYA 1IIRA 2BV3A 4DM3A 1EUDB 3FDSA 3BL5A 2FVXA 1F3LA 3SN6A 1EG7A 1QRDA 1NNSA 4P3XA 4R31A 1YC5A 4Q7QA 1GO3F 4ACOA 1VYHA 1Y7PA 1Z8NA 4D45A 4QWCA 1DIRA 4CTKA 1RIFA 2VDRB 1J97A 3JD4A 4EGCB 3PSHA 1MW9X 1LF5A 2QRQA 4DMFA 1N8SA 3GLGE 1BD4A 4C7MA 2EFEB 3H2HA 3CTMA 4NULA 5KYYA 4IM7A 4ZQIA 4JI4B 4R98A 1E9AA 2MYPA 3NBYC 4ZCTA 1YR1A 1DG9A 4ZC8A 4Q5IA 3G8DA 1K06A 3W79A 2XITA 5AVRA 1N2XA 1ZQMA 4Q0MA 1MV8A 2ZTUA 3H42B 1RLOA 1GZUA 2Q2WA 2IXTA 2ZRLA 5CBKA 5JNWA 1TF5A 4XJSA 2VLBA 2P9QA 2WIKA 2XNHA 1TM5E 1P1KA 3OE1A 3PDUA 1J8MF 4BRZA 1QZ3A 4KN5A 5DX1A 3AOEC 4ND1A 1GY8A 4KIWA 2OFWA 3SEFA 4EY3A 3DKKA 1X7WA 3V6HA 1HDOA 3QLVA 2CE2X 4CLDA 2HK9A 3K6SB 2RJNA 3R5TA 1QRAA 1RJ9B 2M6SA 3SX4A 5AKIA 3NGLA 4PL2A 4YH1A 5JD4A 4LOJA 3O0TA 3RV4A 1C1DB 4HGPA 2XVZA 4Q1AA 1ISJA 4GYJA 2VCYA 5TQVA 1ZIYA 4ZO9A 2AN3A 4OHPA 3CEHA 1FRZA 1NFQA 4A9AA 1IB6A 4XARA 3TTWA 1ARZA 4LSWA 4YO7A 4NV1A 3B8EA 4UB1A 4FFBB 1VE5A 2WF9A 2KLHA 1P2VA 3DWGA 2B3DA 2CK3D 2QVLA 4C7OA 2C28A 3PEYA 4F60A 4NOLA 5L1IA 1EJBA 1GGVA 2RHHA 3SAJA 1MRZA 4R5HA 2ZXHA 3HUDA 1JL3A 4MQFA 2A3RA 3PWSA 2ERYA 9GPBA 1SQ5A 3DTVD 4IIHA 1JFTA 3W5AA 1MXFA 5G2OA 2R0QC 1UKCA 4Q7LA 1G6Q1 4B85A 2GASA 3FCOA 2ZUTA 1IIBA 3L6CA 3SQOA 4RCZA 1E62A 1XEXA 4L3OA 1ISGA 3CURA 2X9QA 3HZHA 3SEAA 3GD7A 4WAUA 1PYDA 3IPCA 1HL3A 3T0FA 1K0FA 1V3VA 1BDBA 5KREA 1DC3A 2FQYA 1CIJA 1DJQA 1Z34A 2J33A 1U9CA 5DB6A 3UXYA 5JU6A 3HA5A 4GF5A 3IXQA 2R48A 5EWLB 3HWRA 3ILYA 2ZTEA 3HNOA 3VA7A 2FNAA 1KK3A 3UWOA 4ELUA 1MKYA 3KYCA 2QAJA 1PWEA 5DK4A 4DSZA 3U5TA 2YXPX 4Y1RB 1LBQA 4DLAA 3DAFA 5L7WA 3ZZTA 2R6ZA 3R3YA 5EI5A 1KJZA 4Q4CA 4RDCA 4MZXA 1CRQA 1AGYA 1R18A 5JXHA 3SEZA 4MR9A 5EQFA 2B92A 1QU2A 1GG5A 1GKIA 3HCDA 4E5YA 3TQHA 1YR7A 2HA4A 4ID9A 5JQGF 2Q6OA 4UAYA 1DC8A 1SC3A 4OU5A 1JHAA 2MU2A 2EJBA 3NI2A 3UK1A 1DHRA 2BEUA 3R3VA 2XICA 5HDBB 3F71A 4EYKA 2XR1A 2VAWA 1YRWA 2OO5A 2DL0A 3GLRA 4RS3A 1IRIA 3EW7A 4X85A 3I39X 3M4ZA 4JJZA 2QWXA 3MCAA 2L17A 3LY7A 4RQTA 1SN7A 3LVFO 5A05A 4IQUA 1KJ9A 1BHQ1 3PBKA 2NQ8A 3W1EA 1V3UA 3GQBA 1RYEA 2QRUA 4Q12A 1X7ZB 1I5RA 3AW8A 3C3YA 3UJ9A 3DOJA 4HTFA 2H7VA 2A1JB 3GJ3A 3GIDA 2IF0A 4X1IB 3DNPA 1Q95A 1CIVA 1F5NA 4US1R 5TS2A 4G41A 3ITKA 1ZOOA 3F3SA 3G0GA 1OROA 1RWOA 1LWNA 2UVWA 3GNTA 1XQYA 2V96A 2XE8A 3ZS9A 1ND6A 1T2VA 1HE8B 2IX9A 4WXMA 3NVKI 4U2GA 1DQPA 1CF4A 4IVQA 5DB9A 2GCOA 3R7LA 3FOEC 1GDHA 5ECGC 2D8CA 2Q46A 3EWAA 4V02A 5FRDA 1K3FA 2CJWA 2RAPA 3MLBA 4C43A 1Z8DA 5CNIA 3WI7A 4AO7A 1V1MA 1VE6A 3DBLB 3C3BA 4TM7A 3GEGA 2FPPA 2IY7A 1C7EA 1NMEA 2J4FA 3ZUPA 4WFQA 1ULUA 2F67A 1SB9A 5CHEA 2RI0A 2AGPA 3IKMB 4F2WA 1U8FO 2FGKA 4R7GA 4KR7A 3SENA 3K9HA 4Y2SA 1OBCA 1C4KA 3OF5A 4C88A 2P66A 1XELA 3BMQB 1AB5A 4H3SA 5DOVA 4LXIA 5C53B 3KCNA 5K5EA 4CIYA 5MGNA 2JLBA 3L1JA 3CVOA 3OZSA 5C5JA 3S1LA 5L4SA 4YACA 3HVUA 5DYIA 5FBWB 5D51S 1SRRA 3KVOA 3ZDCA 1HNNA 4ZGGA 4BO3A 4MW7A 1LFAA 3A1VA 3A3PA 5B1IA 1XCMA 4RH3A 1R64A 1FP4A 1TVKB 2C2WA 2NUTB 4ZIRA 3I52A 3ZN2A 2YIDA 1ZQKA 1PHPA 1FRVA 1RW4A 2QL9A 2C7QA 4Y1FA 3WYNA 2JZCA 2P3QA 4D96A 5KPDA 2I87A 4R2HA 2X40A 4NCNA 5IVKA 1DXOA 1D8BA 4OXNA 5I7VA 3HCRA 3B1XA 2W9CA 5LOVF 1RI3A 1MG5A 2KD1A 1R6DA 3HRHA 2BMWA 2QP3A 2FZ4A 3X2EA 1BHSA 1Z6TA 4X8LA 4YWHA 1VDZA 1F4LA 3D8UA 5AESA 2Z6UA 1IQ0A 4X5OA 1S7GA 1A9XA 1PJZA 5AFSA 1MN8A 4EL5A 3D31A 3OJXA 2FQQA 2D0IA 3LDHA 3ZDZB 6ADHA 2VPYA 2FPUA 1WUKS 3B1FA 3WGZA 3IOCA 1OTYA 3BZWA 4YD2A 4ENSA 5FULA 3KSBC 1NW5A 4F85A 1XTKA 4Q03A 1KP9A 1G2IA 2RKOA 4KUEA 2OKCA 2HM7A 4DL4A 1EFVB 1WKCA 3EEBA 4UU0A 3ZY6A 4MWTA 4E13A 4DIDA 2EJVA 5K2OA 4RJJA 4KDCA 1R4MA 3PR5B 2PUGA 3K72B 2VR1A 1P7PA 2AC4A 4DQUA 4PG5A 1J7JA 2AVNA 1N5LA 3RTVA 2JH3A 1E4OA 4D98A 2EQ5A 1WF6A 1K8QA 4I4TF 3CNEA 2VJOA 3AUXA 1SUPA 1S3GA 1XLTC 1OWNA 4WCDA 1U3TA 5I4KA 1KH2A 4OQPA 4WVLA 3DB1A 3UQ0A 3VOSA 2MTBA 1KZHA 3GBSA 1JQJC 2GB4A 3GU3A 3PENA 3EA5A 3K2IA 1ZK0A 3Q11A 2PQ6A 4PC6A 1POXA 1NNLA 3Q8SB 2X8LA 3MYYA 1CRXA 1Q3TA 5LM3A 1Z16A 3WL5A 5K8VA 1IG0A 2CVQA 4DS5A 1O4WA 1AQNA 2H51A 4JWMA 4TWRA 2ONKA 1L4GA 3JQGA 3N39C 5E1DA 3RVLA 1UZLA 5J0XA 4N40A 4PU0A 4KQHA 4J90A 4F45A 5FP0A 1RQNA 1NVGA 4OXRA 2AFIA 3DZFA 1TQHA 2EKLA 4JLOA 3RC7A 1VCNA 1GGEA 4J9NA 3FPBA 1FX0A 4PRZA 3IELA 3DDCA 4LGVA 2O5VA 3OU6A 3HVIA 1EINA 1B43A 5JW6A 3B5EA 3RBDA 1NOJA 3ELBA 2IUSA 3OPVA 5HHHA 3U4QA 5TDHA 2WJWA 4IZIA 4FS2A 4D92A 3C0KA 1T3HA 3W4KA 3CA8A 4JQSA 2VT7A 4G23A 2ISSD 2DZDA 1LV8A 1Q57A 2NTYC 5AD1A 4J0KA 3ZDAA 2FETA 1V16A 1PJSA 1NUUA 3HCFA 1V7QA 1FJXA 1QYXA 2JXJA 1JMSA 4NXZA 3UB4A 2ZI9A 4QYXA 4XIFA 3AJ8A 1WUTA 4AZ3A 4E5KA 1PGNA 1MJ5A 1YUBA 2NYVA 3IG5A 2IXGA 4BGIA 4S3MA 1NRIA 1T6NA 1YZFA 1TD9A 1JECA 2XGSA 1PN3A 2II6A 3VJRA 1G3MA 5DB4A 1U02A 5IC4A 3PY8A 4NLKA 4WMLA 4BEWA 1WXDA 3UHFA 3RARA 4CIVA 4QOEA 5H8WA 3E58A 3ICXA 2WAXA 4LF4B 5F2KA 2PE5A 3PGJA 2SKDA 2BT4A 1TT5B 1WP4A 2PU5A 3IBCA 1JU3A 4EUKA 5AI8A 3TX6A 4OFXA 3IO3A 1WEKA 4U6SA 4RQ3A 3W5DA 5C51B 4CMEC 1Z06A 4M0PA 2VF7A 4JC5A 2FEMA 5EWMA 2A5LA 3NM6B 5BW6B 4AJPA 2ZE5A 3BJZA 3PDJA 3BTVA 2XUHA 3TW0A 1PQ4A 3IBSA 4IWYA 2RIPA 5EPOA 1LVGA 1FQWA 1VSQA 2VZ0A 1AKYA 3AONB 3DOCA 9ICAA 1JFFB 3K9NA 1BS2A 2WTXA 3EGCA 3AVPA 4US9A 2C3YA 4UBCA 3PRYA 3I09A 3BQMB 3OOHA 2OPBA 4BN5A 3LE8A 3CKMA 1MAVA 1Q11A 5HQ3A 1P5JA 4DN6A 2XQGA 2HVIA 2Q3EA 4O59O 4EOGA 3ID6C 4RQ7A 4B48A 4LF8B 5IFLA 1RACA 1B6GA 3RVPA 4EUFA 1XVTA 4H1VA 2H52A 1SUIA 4JUBA 4DNOA 1RLUA 4PLGA 3C28A 3P71T 1Z2AA 2VSNA 4ZAYA 3WMWA 1J0EA 3PYLA 2ISCA 4HYEA 4M1TA 1G20E 2ZANA 3HYSA 4ECAA 5HTKA 3B60A 1EXDA 1XZIA 2EP8A 4JT9A 2OXCA 1GFWA 4MWSA 3DPSA 4YLEA 1SUEA 4B0PA 1MO2A 1A7KA 1KO7A 2ZE7A 1ZJYA 3PMNA 4ROTA 4KAFA 3SV4A 1RSZA 3DCJA 5BWNA 1CUIA 4F2SA 3PZPA 3DOHA 3VTAA 2GPJA 1HXHA 1U80A 2BHLA 5E3JA 4N5DA 1H3NA 1URJA 5K4LA 1W5TA 3NUQA 3TVYA 3GVPA 2UV8A 2ZUWA 3N7UA 3V34A 1RFLA 5TMEA 5U9CA 1N4DA 3GLFE 3C6YA 3PICA 4JITA 2QPLA 4MFAA 1A5ZA 4C4TA 1OAOC 1ABEA 5C8VA 1U3CA 4K6HA 2QZSA 2HMUA 4PBSA 2ZS9A 3IURA 2J3QA 3KZKA 4F06A 5IM5A 1OGJA 3RK0A 1YT3A 1EHYA 4QSMA 4GX5A 3ZW8A 2YHUA 4H15A 2W71A 2W9BB 3PT9A 5C80A 4FFRA 1YVRA 1KDTA 8ICQA 2EZ8A 4BNLA 1QGAA 5AM4A 4ZQEA 4BBPA 1CWUA 1IY1A 3WGTA 1W30A 2RCNA 3O91A 3CRW1 5KYTA 3MMPA 3BWVA 5C34B 3BJYA 1H2BA 2W58A 5ALIA 5AUNB 5FTWA 1FYXA 3LKVA 5ERGB 4QEKA 1ODFA 1AH2A 1K5PA 2AX4A 4ZOHC 1WKBA 1KDPA 4DFJA 3BD9A 4WKOA 2C4NA 4LXGA 3X2FA 3G2QA 3EEYA 3KT8A 1SBTA 4CQMD 4XB1A 2XNSA 2GGSA 3W9BA 1RQPA 1UFQA 4P31A 5TVKA 4U3JB 2HUNA 2FCRA 3KZNA 4JP1A 3S81A 1WCIA 3DBRB 2P3SA 2MYUA 3DEFA 1FU8A 4H7IA 5DHUA 1KERA 1U2SA 1YAJA 3NTRA 1UKEA 3G2OA 1XNRB 4D8VA 1Z4PX 1FJHA 3CNLA 1X2EA 3V4RA 3ZCPA 5CCXA 4XDYA 2JLZA 3KB6A 2IW1A 4QWMA 4F3NA 2Y77A 3T7AA 3UAYA 4DNXA 3GV8B 4P08A 4NMLA 4TKMA 3OTOB 4XQ9A 1VBNA 2XF2A 3DOIA 1YRYE 3TE6A 2OQRA 4G4SP 4B76A 3PLNA 3AVYA 1QF7A 3IESA 1NUPA 4BPRA 2NXJA 2QK4A 2X8JA 3L7IA 2PI5A 3TJRA 1U9IC 3TAXA 3O73A 3QVSA 4DLKA 1NW3A 3RK1A 1CXZA 2PIDA 4M1KA 1Y6GA 1D4FA 2ZB2A 1DLIA 1TADA 3DE4X 3SU8A 1IHOA 3KEQA 1VLBA 5EWGA 3NWJA 2J5XA 3MWFA 4IUCS 1XDZA 5TQ0B 3DG9A 2OM2A 5JSHA 5JDCC 4UU7A 2O23A 1RTKA 3Q9NA 4J76A 4RL4A 3M9NB 1CLUA 1Y3BE 1CR2A 4O3NA 2A78A 4C0HA 2A5YB 5LP6B 1CUKA 3RJ5A 4HFNA 2ZCUA 5HIAA 3PKIA 4GP7A 2JGJA 4AN0A 1IBRA 5KWEA 2OK8A 3HNRA 3UY4A 3WBKA 4N01A 1MORA 3CUKA 2BZSA 3V1NA 4WN9A 4ZAXA 5IJ9B 3V42A 4YY3B 1O9GA 2PQ2A 1W4LA 4PZPA 1JLHA 4J94A 1RXYA 4RHTA 2WVHA 2BKLA 2BH2A 3ESZA 1NN5A 4Y0VA 3ADDA 4DTIA 1UC8A 1ZUNB 1GARA 3KG2A 3SS7X 4XFKA 3VMMA 2YXLA 1FFCA 4BWGA 3A6KA 1D04A 2HPVA 4JC0A 4M9CA 3IDZA 5FL7A 1SZDA 3FCEA 1NLFA 1QHFA 3RUEA 5KVSA 3HWWA 3IUYA 1E4VA 4GRAA 3MAJA 2AKAB 4RH0A 4MB6A 5KFFA 2QVCA 1ZGHA 1RI2A 2V9CA 3SV3A 3H0CA 3W90A 4RETA 5GGYA 4PTYA 2FDXA 4X91A 2IV7A 1T8YA 4BOYA 1PVVA 3TAQA 3RKUA 1U2QA 3DV0A 2GSWA 4LOLA 1E8DA 1A7JA 4Z1OA 4CCHA 4LPSA 1MJGA 2O0JA 4GMDA 3CVUA 1NR7A 1L7DA 4NPHA 4Y9DA 2XZDA 4DT1B 1AXGA 3BK7A 2HSEA 2AF4C 1S3FA 4ED7A 5A62A 1ENPA 1E9RA 2CLLB 1ZIOA 4OJOA 3EZXA 5B4UA 1A88A 3FVTA 2GYYA 3EWNA 2YZKA 3OT1A 2AG0A 3A0HU 2EF1A 3HYNA 2JIOA 4EVSA 2BPCA 4HNVA 2JIPA 3GMDA 5A7GA 3OLCX 3I2YX 3PRKE 3IP9A 3D5EA 4UHJA 1OYVA 4QRHA 5KNLA 4RTMA 2EIHA 5H4GA 2EOAA 1F7UA 3FFAA 3L84A 1ETUA 3OOWA 1BC5A 2IFTA 4ZN6A 2OR3A 1S1CA 2CHQA 1S0OA 2AOWA 4CR7A 3IIEA 3BJMA 2QN9A 4WECA 2IBMA 2XNCA 1EXVA 4J0HA 1YB7A 4BUGA 4H3KB 2W90A 1BHJA 1ZKDA 1G4HA 1PNOA 3P8ZA 1BPDA 1CDEA 2LIVA 2GZDA 5IUKC 1B73A 3FUXA 3OHSX 2XMGA 1G5PA 3O38A 1TA9A 5KHOC 4FN4A 4M88A 4OCZA 4F5RA 2C04A 4E15A 4V3BA 2JGAA 2NUAB 3B1JA 4AJ4A 5FFMA 2K4MA 2I6TA 1G42A 1DE0A 4BFLA 2GJAA 3RYFA 4E32A 1FO4A 2ZJBA 2HHUA 3E3AA 2VSYA 2WNSA 3AFIA 2HWXA 3R3ZA 3DKVA 1HBJA 5DWQA 5HVNA 4OJ6A 2E6UX 1H6CA 3CPHA 4GH5A 2ECOA 4Q8FA 2O2SA 2ID7A 4CIWA 3X1DA 4TZ6A 3WGOA 4MKZA 2WINI 4BZPA 1OWOA 4QXPA 3HNPA 2W2TA 4INAA 5AXCA 5JZ9A 4LJ8A 7MDHA 4M0EA 1YJ8A 4WA8A 1KFCB 2P2CA 1FMJA 2DF8A 3AUTA 3M4YA 3PP8A 5BV7A 1U0JA 2LCIA 4EZEA 3EDYA 3KLNA 4GYWA 2VWHA 1RDFA 2VXCA 4HDNA 2MSWA 4YBZA 3Q8WA 5FIUA 1Y5IA 1EQAA 3O31A 2I0FA 4G1MB 3N70A 4W5JA 4C20A 4QFBA 1CDDA 1BE6A 4CN9A 3ZZUA 3QEMA 1H3EA 1JT9A 1QBKC 3E3LA 4H6PA 4IIJF 1L7BA 1QDLB 4NJEB 3KQNA 3CGWA 5I9NA 7GPBA 5D5PA 5AK5A 2CUNA 5KT6A 1Y48E 3KYBA 1YQ9A 2ZVJA 1C3LA 5M04A 2QR5A 2H5XA 3N2KA 1C41A 1SXQA 1O97D 3FM9A 2Q21A 4U2CA 1O89A 1NM5A 1ZQUA 1PUIA 5JRTA 4R8UB 1AURA 1FDRA 2WTUA 2AG8A 1ECBA 1B0ZA 2X22A 4I2GA 1Z0ZA 4B46A 2XGPA 2VZLA 2Y76A 3M1IA 3G9XA 1X1CA 3WV4A 1DK3A 3G5TA 3BT7A 4AKSA 3Q0IA 1DIOB 3CHYA 3G2IA 2AZTA 3PK0A 1OJLA 1Z5UA 3C2KA 2Z43A 2Y1CA 3THOA 4NECA 1NK7A 4JSRA 4BKOA 1V4VA 3SC2A 1E4EB 1FFHA 2LR0A 4N0PA 1IM8A 3VC2A 2HHAA 5E4TA 3Q8RB 1H4SA 2CK3A 4ETMA 1WU8A 4LMBA 2ZFUA 2BZGA 3CEPB 1X1EA 3PW0A 3T54A 4BKRA 3PFGA 5A4DA 4UEJA 4UB5A 2KZMA 4NS1A 3DTVA 5H82A 2OHJA 3R9XB 2LE0A 1L3TA 1KOLA 4QVIA 2ZUBA 1N48A 1KOFA 3ZJ5A 2DR0A 2IC5A 3PG5A 3SYKA 1W93A 1SKQA 3V1YA 4ICIA 4YRSA 3TGLA 1F4PA 2ZZKA 3NDJA 4KLUA 7ICTA 4CT0A 5BMVB 1MH9A 2XE4A 4HNHA 3ENZA 4RTJA 3AHJA 4B4WA 4LHSA 1Z4LA 1EVLA 4XEHA 2XCLA 2W0SA 1TMGE 4F9TA 2YCLA 5BT9A 4CF4A 1DG3A 1L7RA 4X65B 5GONF 3JW8A 1T4DA 1Q3KA 4OBBA 1RRFA 1E6CA 4EHAA 1I4DD 2X7JA 3I6YA 4RBNA 2F3UA 4OQLA 3T5CA 2UVVA 5GGXA 5EN4A 2FW1A 4XE5A 1N63A 1IY0A 2VDQB 4R0MA 2XRYA 1MXHA 4I1UA 3ZCVA 4DCJA 1QQ6A 5ALSA 2MAXA 3NC4A 4UAWA 3GIIA 4BN4A 4ZANA 2OY0A 3T7KA 5EIBC 5KTNA 1JVNA 1S77D 1X77A 4IDBA 3I01M 1L5HA 1P1CA 2ZRBA 2EEPA 9ICPA 2HBJA 2IOHA 3OFND 2QRNA 2BFBB 3PIIA 4LG1A 3FSEA 1LV7A 4LJ4A 2QG4A 3VOTA 1OLXA 3AHEA 3U4DA 2ZRJA 2CUKA 2V65A 1ZLYA 4BDSA 1I7NA 1IV8A 3I34X 3OUZA 2VAPA 1UA1A 4YUAA 5DBFA 3PPYA 2OZKA 5A5EA 2MINA 1KYYA 5FYQA 4JP2A 5E2AA 1Y8QB 5KI6A 4Z7JA 4TLEA 3QA3E 1P45A 3BBLA 3OCYA 3H0MB 4QHSA 3G0IA 3CBQA 2Q2QA 4CL8A 1QLHA 2F59A 4A1FA 2HA5A 1ZQHA 2QZPA 1BZYA 1J8DA 4V24A 2FF5A 4ZU3A 3MS2A 3LVRE 4KMUA 1A1SA 2F17A 2EARA 3NS7A 4NBWA 1PR9A 1DOAA 3WC4A 1ZQSA 2GD2A 1OX4A 5BSKA 4DDWA 5KFGA 1R0RE 5FBKA 1S97A 1OGIA 1VG1A 1SU8A 3MGAA 4EYHB 4EW3A 4JDPA 3UMRA 4YMLA 4BQNA 2PUVA 5TE9A 5AYVA 3JQQA 4EF4A 3ASZA 4EKEA 1ENYA 1Q0QA 3DONA 2JEFA 3NRJA 3PPIA 3VYVA 2PZGA 2BR0A 2XTNA 3THWA 2PS3A 1WULS 5HNKA 1HEYA 3QMVA 3OY2A 1OBFO 1XTVA 4OHBA 5L4LA 3UNXA 1OUMA 2HMVA 2QA5A 3I6QA 1X19A 1XO1A 5CP2A 3I4FA 3PX2A 5IEJA 1H9CA 3LWMA 1Y9JA 5CB0A 3EWIA 1FDIA 5BVHA 5AI0A 2D2EA 1SCUB 3UK2A 5C1DA 4TV8F 3B9JA 1VKJA 5KG5A 3E2PA 1ADYA 5ENVA 1BNOA 4MJ3A 4LGMA 4NL9A 1HLGA 4PRKA 3PI7A 4C4YA 5CJ2A 5FNVF 2O48X 2GN2A 1P8JA 3KHRA 2CNBA 3LM8A 1WXWA 1GHTA 1PHRA 2QB0A 5HM6A 3O9MA 4R5MA 1S8FA 1F51E 2ST1A 1XU4A 4OHFA 4L95C 3SBEA 1KEVA 4R2MA 1I1NA 4CHGA 1ZETA 3DP9A 1S02A 3KL2A 5D5HA 2PRYA 5EUCA 2WF6A 2E49A 4AY6A 3UMGA 1YQDA 2IDJA 1SV0C 1PV4A 5ALGA 2J0SA 3WGQA 3KAJA 2C22A 1I3MA 2PT9A 4C7YA 3Q7RA 5JCOC 4XR9A 5JLJA 1R0SA 3BHJA 4N7JA 4UDOA 2FPLA 2KB0A 1FP7A 5FWYA 3QU7A 3IE0A 2J6CA 4R9VA 4XGNA 3MBKA 4M9UA 3KVNA 3HA3A 4RD1A 3OKCA 4NS4A 1S2MA 5FUBA 1LWOA 3BIWA 3GBPA 2O50A 2WOOA 4UOQA 2P90A 1KS2A 3EXEA 3TPZA 3TVDA 2GK7A 1PWHA 1KVSA 3PDHA 1MVNA 3ROQA 2XNKA 2K89A 2P2ZA 3T1NA 4RADA 3NXKA 1M1XB 3IEKA 2V6GA 5HTOA 1SHLA 2B7BA 4RZIA 1OFUX 3TAHA 1F6DA 2OV6A 3TQTA 4DVGA 4JU8A 1UXHA 3F4KA 1MZVA 3RNOA 3FPGA 4LBWA 2GN0A 1V95A 2YRFA 1JG6A 3UOGA 1YZQA 4JLPA 5E2IA 5BOSA 3SXJA 2NZYA 1VL1A 5TMBA 2WWTA 3ZCTA 1OXBB 2Y1EA 1ILWA 2EKBA 3UJBA 4IVRA 1VI5A 1P0PA 5LQUA 1H1TA 2QUZA 1XF1A 3DEEA 2Y05A 4CRXA 5C3MA 3L7YA 1PWXA 3VNUA 3MJEA 4GI5A 3DT8A 5SZJA 1PJAA 3NDBB 2AN1A 4E5VA 2DLNA 1LV5A 2ZJ7A 2DECA 1QO7A 3PZRA 4U2EA 1UJNA 5JMPA 1FNDA 4JV1A 4YXMA 3ZDFA 3VUEA 2VHWA 3S29A 4IJMA 1BU8A 2Z8YM 2JRLA 2GJKA 3FNEA 1H5UA 1JU4A 4C03A 3I9FA 1GGKA 4BTVA 5IWAB 1QTIA 1JKJA 1RYRA 2BQRA 3BWYA 3M6WA 3GRUA 1XL1A 4GLLA 3QHAA 2CNLA 3A2NA 3ETGA 4Y6QA 2HJGA 1XC9A 3RVBA 5B7GA 3N5CA 1UBRS 3B1VA 8ICMA 5EXPA 1OLSA 1B7GO 4DM4A 1DAIA 4FYVA 4D9MA 1LSJA 1H22A 1AC5A 1RI4A 4L5AA 1JV2B 5EZYF 121PA 3WIEA 2F2AB 1RWQA 3BGSA 3C3WA 4ZOLA 4HY3A 2QN8A 3TCNA 3LQRA 4ARUA 2R6CA 3GAFA 1QYDA 3R40A 1P4RA 1A9YA 1VL5A 3ZWVA 1IUPA 3FPCA 4N5IX 4FHEA 3RS4A 4PN7A 2V7EA 1NDQA 3AF1A 3TW6A 2IVZA 4UZSA 4QBKA 4KRXA 2ZZNA 4HS9A 3MLAA 4MV8A 1DO0A 5EVCA 4EJ0A 1A9SA 1QLNA 2J09A 4U8HA 5F23A 5CPBA 2FU5C 4L5YA 3K4HA 1XHLA 3ZTWA 1DQNA 3EXG2 5BORA 4HX9A 4QYTA 3A1WA 1N32B 3Q7SA 4MVJE 5BOVA 3X1ZA 5ESWA 5SZHB 1Y4SA 1RAFA 5JHGB 5F52A 3BUSA 3IMFA 3KT3A 3ISVA 1U3FA 1XDBA 4AULA 5C9ZA 2PH7A 1ADFA 3VJKA 3KJIA 3UMJA 3PF8A 3VI4B 3DHWC 4I99A 4N12A 3GT7A 4TQ9A 2I4TA 5JRJA 3MUEA 4IH9A 5IXJA 3ZV6A 2BCUA 4Y2VA 2A86A 1TKRA 2LBPA 2PKEA 5K7SA 2VEDA 3ZLJA 4PNHA 3EXG1 4FFVA 1ZUIA 5DF1A 2IDKA 4NNJA 1TM1E 2HZ7A 2VT3A 1X1DA 1KZ9A 1S9DA 2FTKE 1DC6A 1P6XA 1UUFA 2JG3A 4UMEA 3VV3A 3P2EA 4X0EA 4WGFA 1XZLA 3LFUA 3U39A 5EP1A 1X1TA 2R8IA 1SOAA 4OSPA 5LYJF 1DWQA 1X2BA 5E9AA 3GEBA 4FZ3A 1R5NA 1KVTA 3BCUA 5BVGB 3MELA 1XZJA 2FCAA 4MUBA 1QWOA 4DY4A 1E0DA 1MBZA 1SKUA 2BBTA 3FNQA 4XX0A 1IM5A 4IMIB 4FT2A 4P0QB 1AK1A 5KFTA 2XQKA 2I8AA 3TACB 5DG9A 3BGDA 4ALMA 4MP6A 1KWGA 5GINE 1Y88A 2UYOA 4BP8A 3RYHB 3TCKA 2ZBQA 4G97A 1ZZGA 2V97A 5ICEA 4RTOA 3EYAA 5GMOA 5FQNA 3DAGA 3WTCA 4BY9E 3ZE9A 3EG5A 2AS0A 3B0XA 2Z04A 3WWDA 1WWKA 1OI2A 3BRWD 4EA7A 2JIZD 3ROZA 3VH3A 1P39A 4IY1A 4BX3A 4ON9A 2GJ8A 4YRNA 3A6PC 2IODA 3U1BA 3FKSD 4B45A 2CE7A 3ZH2A 1GG2A 2BFEB 4EUNA 1TUEA 4DBLC 4JBWA 1E0KA 2I78A 3NETA 1HZJA 4KR2A 3GZFA 3QIVA 2WB1F 5AKKA 1RQ7A 5CVDA 3H84A 3DFKA 4OHXA 4ND6A 1IC6A 4JVLA 4PZAA 4W1SA 3AWDA 2KTQA 3CLRC 2POCA 1W2HA 1R0KA 3PVCA 2Q3FA 4B7XA 4WJKB 4I6JA 2IOQA 2KOBA 2H0RA 1DI0A 2I4IA 2HF7A 2DULA 3LPCA 1V4NA 3AZPA 3HA2A 4QZEA 2QXUA 2NVUA 1YULA 4C22A 1JBEA 5JSZA 1U2TA 2IYLD 3MHPA 1X7YA 4QXQA 3V7NA 2C8VA 4EJSB 2AUTA 3ZHQA 5KNCD 3EARA 1Q1GA 2H2DA 4H16A 3HKZC 5EY5B 1ACLA 1J2TA 1CRWG 3NYIA 1IZZA 1H93A 3CZ5A 2J6SA 2NW6A 4M8IA 5H68A 1R88A 2I65A 1G5TA 1A98A 4IIBA 5DTQA 3NIDB 3AR7A 3BQ1A 1KKLA 3TNDA 4IQVA 3H13A 3GIKA 4DLGA 2XBMA 1GPJA 4J9PA 2PLAA 4RQ4A 4UJ5A 3KQQA 4FZNA 1H6AA 2HN9A 5EIXA 1WHSB 2FPOA 1GUZA 2ZXFA 1RLJA 1CRLA 1PTJA 1XMVA 5LSAA 2JJQA 3GFOA 4O4JB 3C87A 3PVSA 1JEYA 1JLLB 4Y9RA 1XL0A 3G3EA 4U2BA 3FTCA 4QNNA 4Z6EA 4DB4A 1GGJA 3TI7A 8ICSA 3OM0A 3TFRA 4G81A 2BM8A 4M9ZA 5GTIU 2VJ5A 2WF8A 3KS9A 1R6VA 2WABA 4LJ6A 3VDMA 4EBDA 4F4XA 4IW3B 1XDWA 3U4CA 1QTMA 3ZKWB 4YP6A 1WMFA 3MIIA 1O94D 3L9WA 2M6KA 5KIAA 2NSJA 3UJ8A 3UQ2A 4JJFA 5E6RB 4BWYA 5A04A 1MABA 1SXJE 1UMDA 2IU0A 5CB4A 5JQWA 4FHZA 1O6FA 3I45A 4ZDWA 3EGWA 4XWKA 3D0KA 1V48A 2ESRA 3P2OA 4PNEA 5KOJA 3DMRA 4UUNA 2X0FA 1Y1SA 1LCIA 3WLSA 4YVZA 2FUG1 3QUAA 5HEKA 3TSZA 3NBUA 2C20A 2FDCA 1ORRA 3H2JA 1PEYA 4HAZA 3UICA 2QG9A 3DJYA 2WSSD 4C5AA 3IOYA 4ECYA 3KAQA 3O1IC 3NHRA 2SICE 2OLKA 2CV2A 3EGVA 3BK1A 3V7WA 4HVTA 3VI3B 4PQEA 3H40A 5AVXA 1P1IA 3KHLA 2X6TA 5BRJA 1G8PA 3V7JA 2Y9MB 2XWSA 3B85A 1UMCA 4P5DA 3NHBA 1GTRA 4RY2A 5AVTA 2HMXA 4EGFA 1JBKA 5LC1A 4ZCRA 3I04A 5B37A 3SR0A 1JAIA 3PNOA 3KUDA 4OU4A 4QDOA 3AHDA 1ZUWA 4BQOA 4QJ5A 1VJ1A 4MB0A 2P5TB 1XJWA 2I2FA 3H0LB 1YUNA 1G8JA 1ITZA 3CE6A 1SKBA 4PO9A 1PJ4A 5F9MA 1JJAA 2IUTA 1QVZA 3NBZC 4FW8A 3L1KA 4PHFA 1CY6A 2EAPA 3TLJA 1VCIA 5EHXA 4CMIA 3LLSA 1ORHA 5A6SB 3AL2A 2PX0A 1YS9A 1P72A 1F12A 3OWXA 2WKWA 5J2TA 5HZMA 2QNBA 3IEIA 3I1IA 1KZ6A 5DRTA 2WJAA 4XJXA 1GOTA 4XLZA 2X8AA 3LQQA 3Q10A 2WF7A 1TCUA 3HKCA 5KT2A 1KRHA 2ADMA 3AUOA 4DA4A 4B40A 1ZQBA 4OXQA 4B1FA 4P83A 5DASA 5CIYA 3MJTA 1C0IA 2VC2B 2G09A 1WCNA 4MZDA 2ZS8A 2LM1A 4F3OA 4WHMA 1D7OA 2VA8A 3BRSA 1SIJA 3WMEA 4DQKA 2FLLA 1YE3A 5J0QA 1SCJA 3U1TA 2JFVA 3GLIE 1N6IA 1PQPA 1R15A 3TG8A 2G1KA 4URYR 4UFOA 2H06A 4TYQA 2LW7A 3TLGA 5CA7A 4B3RB 4M46A 4GC7A 1JRLA 1J0XO 1VCHA 3TE7A 1MRSA 4EF5A 1RZ3A 5I4BA 2QMQA 2QR3A 4NCAA 4AS1A 4ACBA 2HRCA 1XJ5A 1WEHA 4RA6A 1NUQA 4I66A 4IICA 5LZ4A 1KQFA 2G5IB 3NZEA 2WHQA 2BZ0A 3PQ8A 3B38A 3REFA 2CT8A 5KC8A 4NH4A 4WI1A 1FMCA 5M5BA 1KMHB 1FDUA 4ZO7A 4TV9A 4UPEA 2O6LA 2JAUA 3Q12A 1QHIA 3AM4A 3INYA 2WB4A 1W2WB 3TLKA 4W9NC 4M8NE 3IH5A 1QR6A 2IITA 4DOMA 2D6FA 3SFTA 4GWKA 2JCBA 1R8YA 1UQUA 4HNAA 4B5LA 5TZVA 4ZQBA 1S5LU 2Q50A 4QU0A 3PA8A 1Y1RA 2TSYB 2ZSHA 2RK3A 3ZOZA 3OZBA 4HYQA 1MCZA 2WU8A 2CB0A 3K32A 4W8OA 3L5KA 4R71A 5EMJA 4AWBA 2P6NA 2KN7A 8ICNA 2JHAA 4WOPA 1QGUB 1EGVB 5H9WA 4P32A 1J1IA 4P4OA 5GP1A 3ANSA 3PXCX 3DZBA 3FYTA 1E66A 1U6KA 3IQHX 3QVGB 1Z6YA 1ZAYA 3N59A 3Q9LA 1ZGGA 4FQ8A 4Z7OB 4F5EA 1GZ5A 1N6NA 3FSRA 3EF0A 3DE1X 1EXWA 3BZKA 2I7CA 1PFQA 3RIXA 3D3EA 4DL7A 4GBED 3LECA 2ATXA 5KTMA 4ATNA 1WMAA 1CUUA 2R79A 1UFKA 3P9XA 3MNFA 4S0ZA 1EEHA 1RM5A 4IR1A 4YRZA 5K4HA 2LP4Y 3Q15C 3W6UA 3PUHA 3AR8A 3B5IA 3UG7A 4LVUA 4RU9A 5FUQA 9ICRA 1V6AA 1OWPA 3HDTA 2UUOA 3P9QA 3AJRA 2CBZA 1XJCA 4JSTA 3ZVNA 3CF4A 4UB6U 2L42A 4W7HA 5J0TA 5TPZD 1NZPA 3AR3A 1KVUA 3NVZA 2GPWA 3N74A 2XI9A 1G3IA 1U0EA 4HDOB 4OHYA 3ZD7A 9ICVA 5JS2A 3CJRA 1YTUA 2GPBA 4HLUA 4JWKA 2X1LA 3B2EA 1IL0A 2NXWA 4NENB 2C59A 1GM5A 3TH5A 5C8XA 5CFRA 2BTQA 1TXGA 3AEKA 3N53A 1SUFA 2VYVD 4M53A 5JWRA 4PICA 1K86A 4HRYA 2OFPA 3IKVA 1ZCJA 4ITVA 4KNYA 3NANA 2QTMA 2V8BA 4L4XA 2CLKB 4GOXA 1TPZA 4IJ6A 1G8HA 5DCUA 4O2AA 1X9GA 2F3NA 3TTSA 4QDXA 4DDMA 1VRCA 5L45A 5LPNA 4CKCB 4UHCA 5C3UA 3UXNA 2RC6A 3TAUA 3BULA 3X2SA 3PFWO 2NTJA 2ZJ8A 5KAPA 1WQ3A 1TW2A 2XVXA 2JJ8A 4MDEA 5DSXA 4S1NA 1KC1A 4J7XA 5HQJA 4E5MA 1PZFA 4FSHA 2P62A 2C9BA 3I5UA 2VNJA 2QKQA 4BV8A 2P2NA 4CUJA 3LWZA 2VDUE 1M6EX 1J2UA 1AKUA 1YS2X 2G3YA 1N6OA 4AVYA 4I55B 3OZCA 2XGJA 3RJIA 3AWIA 3QOFA 3NGDA 1ZK2A 4I6EA 4AF6A 3U3RA 2Q3HA 1RLMA 5KVCA 1C7QA 3FOBA 2G6BA 3RKSA 2YN2A 4U7WA 4IHJA 9ICFA 4ND2A 1II8A 1QSYA 3S28A 3JPNA 4AJ1A 1EWVA 3SDSA 1KDHA 3DDZX 3ABRB 3EIWA 1JA0A 5B2EA 4NOMA 2XT9A 3CH7A 4PSVA 3DDHA 5I47A 4AWAA 1CR4A 1NV9A 1TJ5A 4DV5B 4XVRA 5JH7F 1VFNA 2QTCA 2YX8A 1II9A 1LU9A 3JD3A 3D6TB 1CYEA 3AVTA 1XN1A 3NTUA 4JOSA 2XI4A 1C2YA 2OHVA 3IUMA 3W9SA 1SVOA 5B1DA 3RS5A 2VCEA 3FPSA 2PD6A 3P2MA 5IF3A 2R8HA 4BJ3A 4IIDA 4EX6A 1W87A 3TSYA 2GSDA 3KJQA 1IN5A 1F8GA 1U0GA 2VK1A 5GOTA 2DB3A 1VSTA 6AT1A 3DLBA 1LLQA 2AFHB 1W4RA 1QIDA 2PD4A 3QYJA 4RFSB 1LI4A 1MFZA 4CMKA 4WZAA 5EYPB 3R9WA 1UKZA 1E2DA 4YFVA 1N5KA 3OCJA 4Y2QA 4B6SA 2XUGA 1O9BA 3DOOA 4A82A 5JO0A 3QF7A 2AQIA 1VJGA 4DLZA 2JFGA 5K05A 5HOQA 4WK6A 1C80A 5F5XA 3SXUA 3CV3A 1QOZA 4IG4A 5M34A 3FR7A 3DYBA 4Z6CA 2ZEJA 4MUJA 3OFNA 1MIOA 4F96A 3UT6A 1NLUA 3BRQA 4E70A 5I8PA 1XIVA 2W6JD 1WUIS 2C54A 2Z1MA 5ENDA 4EVIA 4ZA2A 4QL3A 1ZVVA 4XSVA 3TKYA 5CG2A 4BQFA 3IV6A 2HSZA 1AGPA 3N9IA 1CB7A 3P9IA 1JLMA 1EB9A 5J2CA 3OCVA 4DEXA 3BDPA 5BUCA 5ITZB 2Q5EA 4HVAA 1WZ2A 4AY3A 2C2RA 1OFUA 2Z4SA 5LZ5A 1D4ZA 5JNLA 3I2JA 5E8JA 1PU2A 2QB1A 3PDWA 1VB3A 3SKXA 5EFOA 3AEUA 3ADPA 3ANXA 1C9NA 3TL3A 2QRVB 3CVWA 1L5SA 4P22A 1XAJA 2D59A 2VOEA 1E1CB 1R27A 2BFDA 2YNMC 1XNHA 1GEGA 4ML3A 5EC8A 4DHEA 1U2DC 2OV2A 2EZTA 1N3IA 4S1VA 3WGVA 2NUPB 1LBTA 3FKJA 5F3DA 1CEXA 3P97A 3BB1A 1JG3A 3STYA 3HRIA 1E99A 5K3AA 3ZJYA 2PGLA 2QX7A 3HYRA 3LC2O 4FJ0A 2E4ZA 3ZXIA 16PKA 4ZAWA 4F2GA 1N6RA 4O8CA 3T3OA 1QP8A 2ISPA 1U0SY 3Q6NA 3K1AA 3QFRA 2TYSB 4PINA 4ZALA 3E5RA 2C61A 4JI8B 1E32A 5KNDH 1YB1A 1KFTA 3T95A 4BAGA 3I9V1 4HH0A 3C8UA 4KE8A 2ZTHA 3H1PA 1A9OA 4A03A 2VI5A 1A4XA 1BXZA 4IINA 3ZLTA 4JP8A 2DWQA 1ED1A 1K88A 3R9KA 3K2BA 3C1AA 2NU7B 4HB0A 3V8EA 1PDVA 5E79U 5IDXA 3GLHA 2GCEA 1U0LA 3F49S 4WQMA 4E5DA 3BTUA 1T2UA 3C5CA 1JF8A 2XUJA 2LTAA 2VRWA 5AK0A 1DRKA 4FYKA 2R7MA 4QOFA 4HFMA 1DAMA 3S7ZA 3CW2C 5GZ6A 3VUFA 5DB7A 2FPIB 3NX4A 5DP1A 2FMSA 1O6BA 4RVSA 3W2EA 2QYTA 4IDGA 1QIKA 2HMAA 4FFDA 1IH8A 3E0QA 5KG0A 2I3ZA 3F2DA 4I5DA 2QF7A 4C6TA 1EA7A 3LUPA 4C4PA 1CY8A 5IJ0A 1V4BA 1KK2A 1OB5A 1JYEA 2TMYA 4L28A 1WZIA 3QYAA 3MAGA 3IV7A 3A3OA 1LF0A 5LLDA 2EX1A 2WD9A 4YG2A 5C46F 4M1WA 4IYJA 1DU4A 4JJ6A 1EESA 3OJFA 4TURA 4E88A 3DZGA 5CDTA 1KDRA 1PVDA 3B51X 1A7AA 5AIBA 1XI2A 4H0FA 4L5BA 2M32A 3TLCA 1M1YB 4JV2A 3EZLA 2V9PA 4O29A 2XF8A 3RC2A 4LVOA 2GXAA 4R8VA 3U60B 1TE2A 1W25A 1IN6A 4C4ZA 4A0HA 4QX6A 3BERA 3FCYA 3L43A 2WJPA 3H19A 2IE0A 3M5DA 3RCBA 2QT9A 4NLGA 3G1WA 1FMLA 3ZVMA 4QZCA 2JZOA 2ORIA 1CY7A 4LQDA 5JV5A 5DB8A 1US8A 4L07A 3L8GA 2GD1O 3A7DA 1T8EA 5DYWA 2V74B 4ZEWA 1K6IA 3R75A 3WDMA 5G0WA 4O4HF 4I1PA 5A9SB 3QVTA 2YW9A 4BMOB 2FOLA 3L6UA 3VFDA 3NNDA 3G0CA 4KFSA 1KKMA 1J9GA 4HP8A 4P7BA 521PA 4Q4DA 1A9TA 2XHZA 4JIGA 2CDBA 4KN4A 5CH3A 4DR6B 1JR3D 1XMJA 4B7AA 2GD6A 5ISMA 4PYJA 3GVHA 3PE3A 5D3MA 4EATA 1KQOA 3F2BA 4XM1A 4LZJA 1BX1A 1QTQA 1KDOA 2C5EA 3DDSA 3J80A 5JAQA 3PR3A 3B1WA 1KAMA 1FDVA 5GJWC 1CV2A 2GUWA 2HL6A 4MHSA 2PPLA 1WSBA 4S2UA 4RX1A 3MYRA 1KEEA 4M0MA 2YVUA 1Z6PA 1N0WA 2HREA 3VHRA 4GSLA 4MUEA 3K0AA 2YMQA 1PZHA 2PDAA 2HU2A 3EUAA 1IBCA 2WM9B 4DCNA 3L1IA 1U0RA 1GADO 2GNOA 5KQRA 3RAQA 3KTAB 2AQHA 4XLLA 3GGCA 2QDXA 2E5WA 2XE6A 1SBHA 3AUFA 4QZ8A 4BB6A 4WBNF 2YTUA 1UPFA 3E3OA 3FXAA 1UJ6A 2JJ2D 2XUZA 3H8VA 3GVCA 3MSXA 3HB1A 1BA2A 4IQ8A 1Q46A 1P1RA 3TMYA 2AQ4A 3GLTA 5IKXA 4RQMA 4KLLA 4WDQA 3FGNA 1NJFA 4JC8A 5C8YA 3O03A 3VNQA 5TC4A 3UA3A 3WJAA 3UMSA 1AA9A 4XTCS 8OHMA 1GU0A 4R1MA 5IYZB 4FVTA 4OP2A 2FQ1A 3UUGA 4QUAA 2HXYA 2FWRA 2UVPB 1F1JA 1E8NA 2XYHA 5CH8A 4DSEA 4L9RA 1IXZA 2ARKA 3RYCB 1XNGA 3N3BC 3PYMA 5CRIA 1F7VA 3FJ1A 3CR7A 5JDIC 1E2KA 5F64A 3SJUA 1RWBA 2JHFA 3NCTA 5IUJC 3FROA 1ZVMA 3LQFA 4BEVA 2Q9UA 1RI1A 3TRJA 4YD1A 3DA8A 1ABFA 1M33A 2JAWA 2QARB 2KE7A 4OM8A 1G8FA 3I61A 4G9GA 4KE6A 3GHYA 4DSTA 3L41A 1G2OA 5BQ5A 4H6VA 1UK9A 4MO2A 2WNIA 3ZHBA 1NQUA 5E6SB 1I9GA 2XJ9A 5HG0A 4GE3A 2PKWA 3IDOA 3PJGA 4PZZA 4WNIA 1J5XA 1CYDA 2VUTA 3TEFA 4LY3A 2YQZA 1A69A 5B64A 3QXHA 4LK3A 3IFSA 4DIOA 3LQ1A 2RG7A 4R1TA 1MAWA 4DA9A 5KFBA 4PZ9A 2R7AA 2PS9A 2P69A 1S0MA 2RHDA 4OHKA 3TSWA 1N77A 2JIZA 3EVDA 5B58C 5CIWA 3NAZA 5CYFA 1OUQA 4B33A 1K9SA 4E2WA 4TL8A 2LPEA 3FKSA 4IIUA 4RTSA 2OBYA 3UT0A 2NQTA 2AR9A 4ESEA 2O07A 1U81A 4NMXB 4F38A 4A8JA 2G8NA 3CS3A 4XVHA 1IIPA 3FNIA 4KVZA 3FZYA 3WNVA 2IP2A 1TYBE 1RXEA 4RSRA 1GAJA 1KZYC 4XQCA 1TK0A 4MYTA 2XVAA 2BUBA 1RC0A 4TKUA 2VP4A 2ZS7A 4PZOA 4F5QA 2LZ0A 1R4NA 2A8YA 1AUVA 2RGNA 2GARA 2BBWA 5LA6F 1P44A 1Z83A 3RRYA 2BFWA 3KKAA 3TOCA 1TAQA 4UTXA 1A8PA 4MULA 4RZ2A 1KI8A 5BR7A 2ZSEA 1J42A 4NYIR 5AUQA 1WB5A 3TGWA 4CMGA 3T9CA 1DO2A 4BO0A 2NV6A 1H2RS 4ZGWA 1SHUX 3I6BA 1X7WB 3CEAA 4RPYA 5KNCA 1L7XA 1Y89A 4NAHA 3VX3A 5HKKD 2AL7A 3F7NA 4DYDA 2WP0A 3UTDA 9ICUA 1ODTC 3TRKA 1UAAA 3IT3A 5KG2A 3MSCA 4A8TA 1R5OA 1XRSB 1GSHA 3IPRA 4BECA 3N2LA 3JWJA 1BX3A 1WVMA 2RGBA 3HTXA 2W9MA 1WPGA 2AW5A 2IF2A 2IWHA 1Z5GA 2F7SA 3OSZA 3MR3A 2GK4A 1GYPA 3A4TA 4EZ6A 3CMMA 1HTBA 5KFCA 1U9JA 1M75A 4OK6A 3TLEA 4DIMA 5KCMA 2RHGB 4OJYA 3G0OA 4RA9A 2BR5A 5AKHA 4URFA 5D1HA 1Z1VA 3SYNA 4EELA 3QTTA 4RU1A 3TIVA 3VAYA 4MPDA 5ALQA 4LXXA 1W6RA 1XEXB 4J7AA 3ZDRA 2O8FA 1XRJA 2OYCA 1DBQA 3RFTA 4GPEA 1TKAA 2VL7A 1O94A 3KQTA 2IY9A 1Y42X 2J87A 2WWIA 1J21A 3WK5A 1FE8A 2NNWB 2OCKA 1T0HB 4KTQA 4BMXA 2B8WA 1PDWA 3R5XA 4K3VA 1C9YA 1R10A 3KYCB 1CS0A 4H6WA 3F3YA 1BEEA 1MMFB 3FRHA 4PSUA 3CRRA 4QEDA 4RIEA 3U0BA 1E6UA 3AI2A 3L0CA 3COWA 4F7WA 3U9LA 4FZLA 4EW6A 4TYMA 4AMVA 2WSSA 1XA3A 4YJFB 4PXAA 1HQKA 4MR9B 2AOVA 1F06A 1U7XA 2KIWA 5DLYA 2EX0A 1T8RA 1ZWLA 1Y5MA 1PR6A 2Z4TA 2D1FA 2FG5A 3EULA 3L7BA 2BEUB 1JLKA 3G17A 4UHEA 3DV2A 4EG8A 5IEBA 1KJJA 5JLAA 1G55A 1TM4E 3ZD6A 2ZYAA 2PX5A 2GCIA 1EB8A 2BMDA 2C07A 3ZHSA 3ZE1B 3BICA 4UUMA 2UU9B 2OHGA 1RRVA 3C1TA 2RDMA 1PQYA 1L5MA 3GQBB 4NDNE 1WL8A 1LRJA 4FTWA 1B8NA 5LL6P 1NULA 2RAVA 4CETA 4HTFB 3PRJA 4J43A 1A4RA 2RHCA 3A2MA 4RK6A 1O3YA 4Z9AA 3GNSA 3T4PA 3RF9A 4DOAA 1C7IA 3RB3A 3D7MA 2Q5IA 1NUAA 3EQ6A 2AMJA 4EY4A 2GK6A 4BVLA 1A96A 1QF9A 1Y5NA 3EHEA 3PX3A 2GLXA 2ALJA 2H4FA 1I4EB 3G59A 2F9LA 2BKEA 4GXIA 2I5PO 3VU1A 3EMVA 4F93B 1UAYA 2VP9A 3GZNA 1BOFA 2GCOB 2QRLA 5JFOA 1T5BA 5CLJA 4CQLB 5TEWA 1M83A 2R11A 1ZU4A 3K1TA 2AX3A 5EG5A 3JAWB 4RDXA 1CNFA 4FYJA 1S8AA 1Z56C 4M83A 3KLPX 5TLSA 5LFAA 1HIWA 3KPWA 2EANA 3OA2A 2FMQA 1V1MB 2OECA 4J0DA 4P3YA 4NEQA 3C6MA 4F86A 1NPTO 3KB2A 4FFPA 3CPSA 5DN9A 4O4IF 1MAAA 1JTVA 3LCRA 4L1KA 2VJBA 2IP1A 1ZNZA 4EG6A 5F33A 2ODWA 1QZXA 3A6ZA 4FHGA 1W5EA 5B7NA 2R87A 5B1EA 1QCZA 3WLEA 1X2IA 3RRMA 5CA0F 3WK4A 2KFNA 1C14A 3ZWDA 4EQZA 1Y9DA 4CT4B 5LDHA 4BNWA 3NIGB 4I8XA 5LP6C 3L01A 4IF4A 1HEUA 1L5QA 1TUBB 3UJDA 1TEHA 5DGDA 1ZVKA 2WP8J 5ULLA 4BLTA 3U44A 2X42A 1FP4B 4UBBA 3ND6A 4FYYA 4HAWA 1Q21A 4TRJA 4ZIRB 5DHTA 4LOAA 4PFKA 3MGVA 4K26A 5EJ4A 3CGGA 2W93A 4Z4GA 1II0A 2ZPTX 1X40A 2J5KA 3V7UA 2NRWA 3AERA 3KPYA 4H77A 3QNUA 3BVPA 4H1WA 3O82A 5EKUA 4LHYA 4HO1X 4GOMD 2W9CB 3NR2A 3O1HB 2LCQA 1EMDA 3HL0A 1YKFA 2X9VA 5A4FS 4R63A 3WGYA 3EPPA 5A7HA 2XYGA 5L40A 2HTFA 2OPHA 3KKZA 1T1JA 1SB8A 1A9XB 1PVPA 1P9LA 5DNYB 5KFDA 2P5SA 3WRYC 4HWOA 4JI0B 5AT1A 3UJAA 3FNRA 2B1QA 1C9DB 1XMQB 3ZY5A 2E8MA 3QQ5A 3PCXA 3HHEA 4RMNA 2CB9A 1LTQA 4FDAA 2GOLA 4HDMA 2QP4A 3WE7A 1FXSA 1EP9A 4L7QA 2VXBA 1H65A 1YIDA 1QQBA 3LOUA 4PS0A 5A1JA 1R4MB 2WJGA 5HKLA 2P9GA 4ILEA 3Q8MA 5JAOA 1P33A 1B74A 4BX9A 3KUCA 4UNPA 4U7PB 4QZVA 3P9NA 3CG4A 4ITRC 3R0JA 2HBLA 3JQFC 4RVHA 4DFMA 5J58A 4MW0A 2A4MA 5LLTA 4E22A 1JEEA 1SIBE 5LXTB 4ZAGA 3KE8A 3HWSA 3MTEA 4EA8A 3KALA 2B8NA 2JFHA 1M6NA 2YXEA 2FRDC 1E96A 4PSKA 1OU0A 2VYVA 2CYAA 1KEKA 2IPNA 1SPBS 5IT9A 2G9ZA 4X1KA 3NH9A 4OHCA 1HG1A 2R8OA 1QQTA 4KUGA 4QOGA 4DCGA 1K27A 4OYRA 4PZDA 3SJ7A 3JQGB 3ROPA 1E2EA 3ED1A 2YZMA 2PSDA 2IHYA 2O8BA 3DB2A 3HACA 3L8MA 3VAAA 3OT5A 2C9YA 1HRDA 2AFIB 5J2GA 1V7ZA 1OZFA 4QFCA 2X0RA 4H1HA 2H4JA 4UAUA 1FX0B 3CNBA 5A0LA 4BRUA 4OUKX 3P0RA 1F0PA 4GOND 2OHIA 3LRXA 1GV0A 1FDTA 2R6JA 5DNAA 5EA2A 4DCUA 1NBHA 3QPUA 1HLPA 2G83A 2ZKLA 1H2WA 3QU4A 4UXHA 3FWKA 3NAGA 3FNFA 4W6ZA 3U4QB 5B3KA 3GI1A 4CKEA 3IHWA 3C8HA 4GPAA 1Y7IA 1JQEA 4KQ9A 1PJBA 3IIJA 3I9JA 4AYWA 4PGAA 3TUIC 2H5IA 3HL4A 4Z8YA 1KZ4A 1HGXA 2CD9A 1LC0A 2B35A 4KWHA 4YCJA 2VKQA 4IQTA 1V16B 3WYEA 3OHMA 2Q1TA 3HS3A 1UT6A 5EGNA 2WSYB 1SHZA 2YXNA 3DBIA 4REQA 3EUFA 4ZV4A 2GD0A 2AJCA 2CLMB 4AZ3B 3GELA 4NZMA 4O4LF 1M0SA 5I48A 1CY4A 2C5SA 3HEAA 3W7BA 1XRLA 3FGZA 2CDAA 1IHPA 4BGUA 3CLKA 2WIDA 2G77B 4Q7KA 1TZMA 3IMCA 4EJ2A 3BDVA 5THQA 4PS1A 4R2KA 4BEJA 1FFAA 3GEEA 4D9KA 3LVVA 4JYMA 3UPQA 3OURA 5AP9A 4F4FA 3FNBA 4DL5A 3HP1A 1AQIA 4G5GA 3ZPXA 5IBQA 1D09A 3LUCA 2WIGA 2BW0A 5EWMB 3A9TA 4U7FA 2W8LA 4QUGA 4OAOA 2XCUA 2I4MA 2QLNA 1ZD1A 3L0DA 3DE7X 1LA2A 3W9YA 3IE1A 3NRWA 4PCVA 2RKBA 2BPOA 1TTTA 1CJVC 4C7BA 3WIVA 4P35A 3OPXA 3NWEA 4LUCA 4G37A 3HV0A 2FF7A 4QRIA 4U7GA 4C08A 3K8QA 2IOFK 3K0HA 1XZDA 3FWPA 2VYQA 1RHMA 3S7TA 4NI5A 1M8JA 5DXAA 1DT5A 4ZYLA 1HYHA 5HQ3B 1I6KA 2PR2A 3OZWA 2HEIA 3D6AA 1XVAA 4V0QA 3HC7A 3PUYA 1UPHA 2ZYTX 4ENUA 3JZFA 4ZTUB 4O3OA 3VNAA 1MGPA 1NATA 1DOHA 1J0DA 2W6JA 3WFIA 4R69A 1NR5A 1NXQA 3EXAA 1V9SA 5I7OA 3DF9A 4FBGA 1SBIA 5JMWA 3RR8A 2RK4A 1J22A 5F3WB 2Y1OA 3JPYA 1CZOA 1H23A 1YZKA 4RXUA 2V9WA 2I1VB 3N8GA 5AKGA 1VLVA 1Z6ZA 4JYPA 3SY8A 1WABA 2ZYRA 3AG6A 1HE2A 4OIMA 1XTPA 3OICA 1K2WA 2B1JA 3CM0A 3KE9A 4L5CA 1C9JA 4LVCA 4LXYA 5EMLA 2EBWA 1PI3A 1DC5A 4YJHA 2B34A 2QBYA 1L5RA 2G28A 1I94B 4NK4A 4CMBA 4JS0A 3U7QA 2RGYA 3PNVA 2Y8EA 3SSAA 3TR5A 1E20A 4F9EA 2R6DA 1OXXK 4YASA 4F7DA 4Q39A 4DEYA 4DQDA 3D1LA 1NVUQ 2Q1XA 4Z1MD 4CF5A 13PKA 5HJEA 2INGX 3BE4A 3ENVA 3GT4A 1IJKA 1PL0A 2W00A 4MVJG 3OTHA 4EBFA 4WK0B 1T9GS 4WE3A 1KAQA 3PX7A 1SUWA 4D6YA 3KSMA 3FYUA 3G9TA 1E6EA 1HLFA 4QT4A 5FB3A 5U1PA 4LZAA 2CKDA 3TARA 3MUNA 2VNSA 4JJ7A 2H54A 3H0KA 3M4JA 3H5AA 3K1RB 2B1GA 1V8BA 4JB3A 3UBMA 3E9QA 1CG6A 4MS1B 3MD9A 2BVNA 4XUCA 1UA0A 1PYGA 3KKNA 5JSQA 5I4IA 5GZ1A 5JBIA 1Z39A 1X6IA 4IOLA 1KSPA 3IYLW 2JCGA 2OO5C 4EEZA 4GR9A 3KQHA 2POQX 3T3MB 2H6EA 4CQMA 2D1TA 3LDUA 1YJQA 1BWRA 5KQSA 5EHGA 4DIEA 3UXPA 1L4EA 3HKZF 1YOBA 4BMDA 1QYCA 4PZNA 4G36A 2HA3A 4GUAA 2Q3DA 3OSPA 1F0NA 2VF2A 2VYCA 1Y4ZA 3H18A 5A5FA 4DR7B 9ICIA 3DWIA 1KQNA 8ICEA 2BAGA 3FPFA 1QV7A 5I9MA 4PHHA 2NP6A 4RQ0A 1MNQA 1FVHA 1ZLXA 4FMBB 4KQCA 4B3FX 4E08A 4BE4A 3V8VA 4XVCA 3D6MA 5LKAA 4DIFA 2PRZA 3A4MA 1T34A 3QVUA 5DGHA 1IWPB 4G4IA 5BSRA 3T3DA 4P9NA 1SUSA 4K9QA 3IIKA 5IAEA 1DDOA 3C3CA 3UTCA 1Y9ZA 4B31A 1VBFA 3U7IA 421PA 4CKYA 2LWIA 2O05A 5G0UA 1RQXA 3MOGA 1TMKA 4YP9A 1TCVA 4I4NA 2BRUA 5KSZA 5JJLA 3BZCA 1ZMTA 4PCLA 2O3UA 4Q01A 1PJRA 1Z7GA 3A1FA 3HMKA 4MNTA 2GH1A 2X8JB 4LCJA 3EVGA 1FQOA 2VHYA 4MGIR 1UPTA 1WDMA 2ODNA 2Q5HA 4HF7A 2HDOA 3RUHA 2X0JA 1VE3A 4X6YA 2H65A 1HZZA 2NZVG 1L5ZA 4RQ6A 4FX2A 3RVQA 4G0XA 1DCKA 1NY6A 3RAXA 2B6GA 1FZTA 3CKYA 4J2OA 3UO8B 2AE1A 2C7VA 3DDWA 1L4YA 3ZXSA 5C18A 2G4VA 3ZV3A 3QBEA 4B75A 2AOXA 2P0AA 1NVVR 3FAKA 3D6UA 1FNMA