3S6JA

The crystal structure of a hydrolase from pseudomonas syringae
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
220
structure length
216
Chain Sequence
PQTSFIFDLDGTLTDSVYQNVAAWKEALDAENIPLAMWRIHRKIGMSGGLMLKSLSREITDEQAERLSEKHAQAYERLQHQIIALPGAVELLETLDKENLKWCIATSGGIDTATINLKALKLDINKINIVTRDDVSYGKPDPDLFLAAAKKIGAPIDECLVIGDAIWDMLAARRCKATGVGLLSGGYDIGELERAGALRVYEDPLDLLNHLDEIAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of a hydrolase from Pseudomonas syringae
rcsb
source organism Pseudomonas syringae pv. tomato
molecule tags Hydrolase
molecule keywords Hydrolase, haloacid dehalogenase-like family
total genus 76
structure length 216
sequence length 220
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3s6jA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3s6jA01
2P27A 2HF7A 4EZEA 3L0YA 1ZJJA 3HLTA 4Y2SA 2HO4A 3B9BA 3ZWKA 4Y2RA 3WGVA 2R8XA 5IT0A 2G80A 3U7FB 3RF6A 3GYGA 3E58A 5AKYA 2FPUA 3ZTYA 3QU4A 3SF0A 5ALZA 3W5CA 3ZU6A 5ALMA 5ALOA 2HF2A 4C4TA 2Q4TA 5AIAA 5AI6A 1L7MA 2O2XA 1YV9A 5AVRA 2G09A 4UMVA 3NALA 4UM7A 1WR8A 2BDUA 3J7TA 4OHFA 4KYTA 5AI0A 3B9RA 3L5KA 2FDRA 2RBKA 1Z4JA 4YIKA 5ALFA 3IJ5A 3CZ4A 3ESQA 3FPBA 1SWVA 2EATA 1WVIA 2ZBGA 2HEGA 3U7HB 3L0BA 2YJ6A 2AUTA 2CFRA 4UMDA 3SKYA 2I34A 1PW5A 3QUTA 4JDPA 5ALHA 4FE3A 4OD0A 1L7OA 4C4SA 3QUCA 4BNDA 2AMYA 3SLRA 2WF8A 3FVVA 4O8CA 4UW9A 2YJ5A 4CNQA 4KN8A 3SHQA 3ET4A 5AK4A 2PKEA 4Y2XA 1MH9A 4UMFA 3N28A 4MUMA 1Z4OA 4YCMA 1RRCA 2HCFA 3ONNA 3FM9A 4C4RA 3ZVNA 2YN4A 5AI5A 4GXTA 2FUEA 3ZVMA 4EX7A 2C8KA 2P69A 5AKEA 2QYHA 4NAVA 3FPSA 2VKQA 3QNMA 2PR7A 4BNDB 1ZRMA 2HI0A 3MMZA 5ALKA 3EPRA 2C4NA 3E84A 5AVUA 1S8OA 3UMBA 2FEAA 3L1UA 2WF6A 3RFUA 2JGAA 2OM6A 1O08A 2BDEA 3WKCA 4J03A 4J2TA 3KZXA 4DW8A 2WHEA 4XQ0A 2YBDA 4NABA 4RETA 3N5KA 5AKIA 4HAIA 4HGOA 2YMPA 4HYTA 3ED5A 1ZD3A 4AP9A 3ZUPA 2AGVA 4B6JA 3S6JA 1QQ5A 3U7GA 2JARA 5AM3A 1T5TA 4BX2A 5AVSA 3I1YA 5ALEA 2OA0A 2GFHA 2ZXEA 4BX0A 1JUDA 3QGMA 2ZOSA 2R8EA 1T5SA 4XOUA 1RLTA 1TJ4A 1Z5UA 2OBBA 1TA0A 3MN1A 3ZWDA 3U26A 4F71A 1ZD5A 2GHQA 2ZBFA 5T41A 5AM4A 5ALNA 3CNHA 2C9MA 4BBJA 1NF2A 1ZS9A 2PQ0A 3AR2A 3AR4A 3OTQA 5FP0A 1LVHA 2AH5A 2W43A 3SMVA 3WK8A 5AW5A 1RMYA 3QUQA 2BY4A 3OCXA 5AVQA 4IFTA 4HGRA 4RESA 2W4MA 4AS2A 3KBBA 5AKZA 3W5AA 3ESRA 3SKXA 3F9RA 2HOQA 1J97A 5AKGA 3WKAA 2HHLA 4CF3A 1RKQA 3WK9A 3WK7A 3ZTWA 1ZRNA 2B0CA 2CFSA 1YDFA 2RARA 3ET5A 2FPSA 3BA6A 2B1RA 5AVWA 1Z4IA 1TJ3A 5AM2A 3OCUA 2FPWA 4Y2QA 4DWOA 2HDOA 3AR5A 2IYEA 2CN1A 3A1EA 1LTQA 2IOHA 1CR6A 5ALJA 1N9KA 1RQLA 1KYTA 2JAWA 5ALYA 4Y2JA 4DCCA 4CF4A 5AK6A 1Q91A 1T9ZA 3EWIA 3SD7A 3QUBA 4G63A 1VJRA 3AR9A 2I33A 3DAOA 4L57A 5AKHA 1U2SA 5AKXA 1QH9A 3TLMA 1U2TA 3E8MA 3WK6A 3NIWA 4H1WA 3DV9A 1Y8AA 3UMGA 3VAYA 3AR3A 3L8FA 2NYVA 5IT4A 4Y2UA 2FPRA 4E88A 1K1EA 2RAVA 1SWWA 4L6AA 2RB5A 3U7EB 3KD3A 1Z4LA 5ALVA 1X42A 4Y3UA 2G08A 3R4CA 2WM8A 5AW1A 2YFYA 4IG4A 3M1YA 1L8LA 2ZBEA 2B1QA 2I7DA 4I9GA 1N8NA 4GIBA 5AICA 3I28A 1Z4PX 4UU1A 5E0OA 4Y2VA 5AM0A 3WKDA 3NAMA 5AW0A 1VFPA 3ZX4A 2MU1A 4BX3A 5ALRA 3L8HA 4MWOA 4ZEXA 5AVVA 5AKKA 4HGNA 3N07A 5ALGA 3ZX5A 5AVTA 2D2VA 4DFDA 4ZEWA 4ZEVA 4KX5A 4UASA 1YJ5A 5AKLA 5AVZA 2GO7A 1F5SA 2P9JA 4YH1A 2P11A 4I9FA 5AIBA 3OCVA 4OFZA 3PGVA 2G1AA 1TJ5A 4XE5A 4EELA 3FGOA 3WKBA 4XPZA 3QU2A 3W5BA 4F72A 1WZCA 2FUCA 1L8OA 3PCTA 3IRUA 4UAUA 4FFDA 5AI8A 2QLTA 1XP5A 3WK5A 3NRJA 3R09A 2B8JA 2YJ4A 3E81A 3ZVLA 3QLEA 5AI4A 2DQSA 2GMWA 3DNPA 5AVXA 1U7OA 4YCLA 1YMQA 2WF5A 1Z88A 1L7PA 3L8GA 1EK2A 5AK5A 4QQFA 5AM5A 3D6JA 3B8EA 5IS2A 2B30A 2B82A 4Y2TA 2W11A 4BEWA 3A3YA 1CQZA 1RMQA 2JAOA 3IB6A 3P96A 4UM5A 2NO4A 3QYPA 2YMLA 3I76A 5AI9A 1RLMA 2G07A 3OCZA 3QXGA 5ALSA 2FI1A 2WF9A 3N8GA 3UMCA 1RKUA 1AQ6A 1Z4QA 3N1UA 3EF0A 2MU2A 4OCZA 4EEKA 2G06A 3KC2A 3K1ZA 3ZW7A 4CF5A 1QYIA 2I54A 2JAUA 1IWOA 3R9KA 2WFAA 1Z4NA 3KOOA 5AESA 4UU0A 1RC8A 1S2OA 5ALUA 5A3RA 1NNLA 3W5DA 3QU5A 2ZBDA 1TE2A 3A1DA 1QQ6A 2EAUA 5AW8A 4NFLA 5ALQA 2X4DA 1YS9A 4JB3A 2CFTA 5AM1A 4UAVA 3AR6A 3OPXA 4AS3A 1RQNA 4KNVA 3M9LA 1RDFA 5AW9A 3ZI4A 2B8EA 2YMMA 3NANA 3MPOA 5AVYA 2YY6A 1Z4MA 3QU7A 5JJBA 3FZQA 4FYPA 2IOFK 4EX6A 4G9BA 3DDHA 1WPGA 3U13A 4BKMA 5ALIA 1Z4KA 1O03A 2YJ3A 1YNSA 1RLOA 3AR7A 3UM9A 1XVIA 3PGLA 1Z5GA 4YCNA 3L1VA 2ODAA 5A3SA 1VJ5A 3QX7A 2EARA 1RPZA 5A3QA 2OYCA 4CE6A 1J8DA 3PDWA 5AK3A 3L8EA 5ALLA 2R8YA 5ALPA 5ALTA 3HYCA 3WK4A 4NV0A 2YMQA 4HGPA 1FEZA 4Y2YA 1U7PA 3NUQA 2WF7A 4EENA 4BEVA 3U19A 5AKJA 2Q5EA 5AW4A 5AW2A 5AW7A 4YIHA 3KDPA 3QU9A 4QJBA 2O9JA 3BWVA 4UARA 1ZD4A 3L0CA 2HX1A 3EF1A 4BYGA 2NO5A 4HGQA 1EK1A 1L6RA 2FPXA 5AW6A 4UMEA 3A1CA 3OCYA 5ALWA 2ZG6A 2GHTA 3AR8A 1XPJA 4PNHA 3WKEA 3WGUA 4L6CA 3MC1A 4Y2PA 4KNWA 1RMTA 2C8LA 2Q4RA 4YGYA 4NWIA 3L7YA 1L7NA 1SU4A 2IA5A 2MSNA 1U02A 2IOFA 2HSZA 2I55A 3I6BA 1QQ7A 5AHXA 1RKVA 4UATA 2I6XA 1ZD2P 5ALXA 2G0AA 1ZOLA 4KX3A 3NASA 5AW3A 2C88A 1NRWA 2R8ZA 5ALDA 3OCWA 1Q92A
chains in the Genus database with same CATH superfamily
3ECSA 1XG5A 2PWAA 5IIMA 3L0YA 7ICFA 2CDNA 1OX4A 1TZCA 2D0IA 1V16B 2NG1A 2QXUA 2DKFA 1ZM4A 5IT0A 2NU7B 4IJ6A 5LQMA 1FYEA 4KTVE 4L3OA 2HBYA 2IRWA 4Z6CA 3SZGA 1XVLA 5CDHA 1Y4SA 2VP4A 2Y0CA 4UUOA 3ZTYA 3KQHA 5L3SA 3DOFA 5ALZA 1TB4A 5ALOA 4WT7A 1JAYA 3K6JA 3RC7A 2NQ2C 5JV5A 1ZJ5A 3WGJA 3PUIA 5DM2A 4GQBA 4OLJA 1V5FA 4Z7JA 1ULUA 2WWWA 4QYIA 4DSOA 4YECA 3TD6A 3U3DA 1PT5A 1NKTA 1SCKA 1TL7C 3SVTA 1DXOA 1QYCA 1X1DA 4GG1A 2GLEA 1G9XA 2ECOA 1G9TA 5EHNA 1KRWA 2BPCA 4PXYA 1UXJA 4CKEA 4LQLA 2GBLA 5EJ7A 2CXSA 1B8PA 2C0PA 3ABRB 3BRQA 3CXUA 4BAZA 5IIJA 3WRYC 3WLQA 3AL2A 3KT3A 3LKZA 3JPTA 1WXFA 3BE5A 4ZAFA 1BWPA 1C0EA 3HU5A 4FEYA 2Y2VA 1JIJA 5CXUA 3RH4A 3WGZA 2J67A 3KJIA 5K99A 4KMRA 4NE7A 1K5OA 1BD4A 1WEKA 4U2DA 3WDKA 4HV4A 4D0RA 4WDRA 4DV1B 5EJ5A 4ADSG 4MA4A 2NVWA 1Q1ZA 5JC1A 3NPAA 5BPHA 1TX4B 9ICGA 5CDFA 3SZ2A 3FKSA 2A9OA 3G0HA 4A8EA 2C2OA 1XNSA 3L0BA 5FORA 3TTTA 5CA0B 2GA9A 4RVOA 5BW4A 1UBLS 4Z6FA 3HJHA 4HYEA 4PGFA 4AN0A 1TM1E 5ALHA 1WMEA 4G1BA 2QRLA 3B2QA 2FR1A 3C8UA 3AJRA 4WGGA 5F3DA 4EQ6B 3ZWMA 1LX7A 1V7ZA 4S1TA 1AQYA 2V4MA 3U4MA 3IXLA 5BWCA 1ZQ1C 4C0ZA 3CX4A 4KDCA 4ZT3A 1LKZA 1GZVA 1TU3A 2K7ZA 2XUGA 2Q3DA 2YIJA 2WF8A 3LC1O 3MGVA 2O7SA 1B3BA 1PJ8A 1WLYA 3B89A 4UW9A 3LT2A 4CNQA 2XCOA 3P1JA 4XASA 3SHQA 3T9AA 1EINA 3ET4A 4EGFA 4EB8A 2OORA 1LJUA 3DDZX 4CQMD 1WSBA 2BFAA 3NRCA 4U6QA 3N3BC 1X9WA 4RVNA 3UUEA 3FR8A 3PHIA 3X1KA 2Z3ZA 4KQ2A 1U1IA 4KXWA 1V9SA 3QZ7A 3V2UA 1PJAA 4YCMA 1Z4OA 3WQQA 3BGIA 4E2FA 2C4UA 2QTRA 3O47A 5JUWA 5AI5A 1VHTA 3TXXA 3I9V6 5TGTA 4C5BA 1D8AA 1LVGA 1VCOA 1GOTA 1I5OA 5IFKA 1XMQB 3LY7A 3RC1A 3E0XA 2GXQA 3GEEA 3Q0EA 4BNUA 4J0CA 2AU0A 3E6AA 3TEFA 1X40A 1XCMA 3IVAA 5HCUA 4BU1A 5GONF 2BCGY 3DP9A 3FPSA 3WADA 1L4BA 2BEUA 1Z34A 5CH5A 4XYLA 5CR9A 2O2DA 2F9FA 4Y7CA 1A50B 2W6MA 3PJEA 3K6SB 2HXSA 2QL9A 1AMNA 4G5GA 4L75A 1GFIA 1R6UA 2CXHA 2J85A 1U81A 4U2GA 3A0RB 5CA1B 5KPJA 1BS9A 3H5TA 2B3DA 2TMDA 1XS9D 3EZXA 3OFND 4HDSB 4Q9JA 4S05A 4HRVA 3G7NA 3GP5A 4FZVA 4TPKA 3RYFB 1N77A 2FMTA 1O08A 5LU8A 4RUAA 4L95C 2O1SA 3D6TB 5HQJA 1YOVA 4I3HA 2VDNB 2ZYAA 3I0NA 1CV2A 4G5SA 3TTWA 2NRWA 1X87A 4D8TA 2PMKA 3DYIA 4AKEA 3UK2A 1KJ9A 2QSYA 1HE1C 1Z19A 1NKCA 1IONA 1NJGA 1TNDA 1Y6JA 4QA9A 1U7TA 1QU2A 4UD2A 5G1PA 1MIOA 1GPJA 1HT3A 4L8VA 5L4LA 8ICNA 2C3YA 2YFQA 3GHHA 3DXYA 2F1HA 4ME6A 4BTLA 1CS0A 4B6JA 4GFJA 1JA9A 1MQSA 2QJWA 2V6FA 2ZI7A 3PC7A 4UZFA 4ZQIA 1Y82A 1WZNA 1ZUNA 2BR5A 3GFBA 4XTRA 5MN4A 3QEMB 1FP2A 1R4NB 2CE2X 5ELLA 2ZSHA 4O9MA 3EEIA 5K0TA 4MDEA 3C6MA 2SBTA 1D1SA 1XYVA 1C1DA 3A9UA 4RQUA 3ZTTA 3QBEA 4RC9A 4DUPA 1U3UA 3K9WA 1JMYA 3AF6A 1Y8QB 1Y3AA 2OP0A 2Y0EA 4G4GA 2HLPA 4UE2A 2V7QD 2J6IA 4RPGA 5F78A 2ZB2A 4BMOB 4BX0A 3ZLJA 3GP3A 1M8KA 3ON5A 4UAJA 5CT6A 1R4MA 2H2WA 2NO9A 1UBGA 2ZSDA 3K5WA 3LQFA 4OU4A 3FVRA 2PAAA 4PLHA 3Q6NA 2C5GA 4UBKA 3ZCUA 4BQEA 4I4TA 4C80A 2OCLA 5DLFA 2QKQA 1PVDA 2BKLA 3L0DA 3SKVA 4QTXA 1CUEA 2ZSKA 2FF5A 4I1YA 3U3MA 3RVOA 5JTTA 1X1TA 1ZZEA 1E9VA 1CUVA 2O0HA 3C14C 4IIGA 3BQ1A 3DBRA 5AM4A 5EOZA 3A36A 2BKEA 4LVSA 5GM2A 4I55F 4M7OA 3INYA 3OHPA 4BUCA 3R7AA 2F6RA 2D8MA 3AR4A 4WKBA 4RTSA 3OTQA 1VYVA 3OLYA 4KIJA 5FP0A 3T0IA 3ZQ4A 2H17A 3T7SA 1ZONA 3CUSA 4QFDA 3RVRA 2VRBA 1QH8B 4WXMA 5AVJA 2DPGA 4DAOA 5BXYA 3DFUA 1S6YA 2QRJA 5BOVA 1AT1A 1T6ZA 1XALA 5E2AA 2ZM6B 1HEUA 1Q2UA 1W0JD 2RAUA 1VXOA 1FFAA 2GD1O 3L4EA 4FYMA 4QOJA 4FGUA 1AZLA 3PEFA 1FDTA 4S24A 5AWFC 5ILGA 1BVUA 1NQTA 1W1UA 5GOTA 2XNKA 3OEHA 2ZULA 1RM5A 5KT2A 2H3IA 1OC4A 2H1LA 1ZGBA 3LPMA 4FC7A 4HXGA 5F51A 3SYTA 3UJHA 3CX3A 3MYRA 3M7IA 3WP0A 2R6ZA 2YX1A 1XMJA 1AA6A 1ONPA 4MYDA 3W8RA 2HRDA 2IIBA 4OXYA 1Z8HA 3PWZA 2BQ3A 2VZ9A 4HQLA 4MPJA 1JV2B 2PL1A 1G16A 2YWRA 3IJEB 3TCKA 2OHVA 2AA3A 5FPHA 2RARA 3PXGA 2GX6A 4IMIB 3VC2A 1JTVA 5A4IS 3WLPA 2Z4TA 2YWBA 3PO4A 3VXKA 4RQNA 4DOBA 3A1FA 2XWSA 2F8SA 2UVVA 2OHGA 5EG5A 4C1BA 3TDNA 1G5QA 3B48A 4KKXB 3OAAA 3H4BA 2ZT8A 4LTDA 2ADMA 4QELA 2IZ5A 1YHNA 3LTNC 2J9RA 1EIWA 4QGBA 3GNLA 5ER9A 3TIIA 5KWEA 1NWCA 2C7RA 4OFBA 4B3GA 1VB5A 2CN1A 1NMZA 8ICSA 2HJGA 3R5JA 3HKEA 5BYBA 2O8DB 3V4PB 2MINB 4QZCA 2B2CA 2OSVA 3TL2A 3ZK8A 4DGQA 1RPLA 4ACAA 5BWBA 1RM3A 2QARB 2RJOA 3FWZA 1O7JA 5FAXA 2JAWA 4WI1A 2ZTHA 4H7FA 3OBBA 1V3TA 4XQGA 5CYGA 1T9ZA 3F6SA 3CNOA 4MKHA 2BAGA 1AK2A 3OIGA 2H1WA 3D4OA 5KQRA 3GIJA 1MU0A 4TWAA 2Q6KA 4W7IA 4EGQA 1T5LA 1L7AA 2CNNA 3P32A 3RFFA 3E8MA 4DIOA 2H4JA 1R0SA 2HMTA 8ICOA 4OQLA 3AHFA 5FRDA 4ENVA 1PJCA 3DTVD 5JI3E 3LVBA 2F2AB 3CVOA 4RZXA 4ELVA 3CGWA 3TTSA 5L40A 1P81A 1H6BA 2ZUUA 2PAFA 1U5CA 5KFRA 4I27A 1BHSA 2NYVA 4GBED 4R1LA 4RL6A 4X3OA 5FWXA 1KR2A 1YASA 3DOOA 3W4KA 4CG2A 3O73A 4XGRA 4G25A 3ZHXA 1K1EA 1QVVA 2JEGA 2CBXA 3KSUA 4BVAA 1YVPA 3EA5A 4KLCA 1YQTA 1V2GA 3MYYA 4R01A 3ZE0B 4OHWA 3R4CA 3N7TA 1YCFA 1TIPA 4JC5A 3PC8A 3JZIA 4QD3A 2HAEA 3TARA 3EYZA 1CC1S 1P39A 2J0VA 4K6CA 5AICA 2WM2A 1DAHA 4N3GA 3ZI0A 1NSFA 1LNQA 1BWSA 3WV4A 3H1PA 2QVCA 5CIWA 3U7JA 2Q4BA 5CM9C 1DRKA 1BMDA 2KE7A 2NTJA 4BXOA 4F11A 1KZHA 2C99A 4KO1S 5BSFA 3GJXC 2AFHE 2MMGA 4AM8A 5IULC 2K60A 2HVHA 1XNQB 5HK9A 5EMMA 4ZVLA 2B83A 1ZQDA 1C7FA 4KLIA 4M9NA 3EHEA 1MOPA 4PXSA 1RAEA 3RBXA 4C0JA 1WO8A 3PLNA 3HLKA 4PHEA 1NVVR 2DKXA 5J23A 2AI3A 4BN4A 5C7YA 3NTLA 3DOUA 4LXIA 5A0FA 4ZCIA 1C4WA 3ASUA 5JD6A 3FZGA 3PEVA 3M6UA 4BP8A 4RTNA 1PL6A 1ISRA 4MAAA 2GJ4A 3WLLA 1N2ZA 4LJKA 3FPAA 4TUSA 1YR7A 4K4IA 1Y7PA 2CXRA 4NCBA 1YJAA 5TGZA 1P3JA 2AR0A 3G5AA 5D1HA 5CG2A 4CIBA 3H1EA 5I8WA 1T3LA 1CTQA 4LE1A 2EZUA 2G1AA 4OUDA 4X3PA 4Z2AA 1L6IA 2CJFA 3FGOA 4BQOA 3W5BA 2PXHA 2Y1XA 1K7XB 4CMJA 5KTPA 1ZHFA 4JY7A 4WZBA 1SXHA 5ARBA 2IPNA 1L8OA 2VTVA 1K2VN 1E5VA 2G8NA 2VSOA 2AKAB 4NPAA 2F62A 1I1QB 3V8VA 3W78A 2EDAA 1JLRA 1KQPA 1E8NA 5A4JA 1GAXA 3I05A 3QLEA 2PSEA 3GGJA 3M2TA 4G0OA 1P60A 5DM60 2DQSA 4BZPA 2EEZA 4G65A 3D43A 3EMKA 4HWSA 3ZU2A 4DA6A 5IKMA 1YMQA 5DG9A 1NIPA 4U5XA 3HWTA 1CQXA 1ZJZA 4Z9XA 1Q0SA 4RQ8A 1QE3A 2KNJA 2LYHA 2PHZA 4MQFA 2V6MA 2Q8PA 3NGMA 3IP4B 2XMCA 4Y2TA 4DXDA 1PS8A 3AI7A 5KYKA 5G4KA 1HZJA 3RS2A 3JYQA 1LBEA 4O4LB 1E3IA 3LOUA 3FTPA 4M0EA 3RSZA 4LXXA 1L7BA 1PR1A 2CJXA 2HEIA 3IV9A 4I50A 3SQNA 2FF7A 3JQ6A 4ATNA 2AKEA 1RKUA 4CKWA 1VPLA 1XXHA 1Z0UA 1AZTA 4OCZA 1ZG3A 5EKSA 1Q95A 2CJWA 3IUEA 3EUWA 3VSBA 3MSXA 3VVBA 2DF8A 1OU4A 2IHTA 4I9HA 4O5CA 4H77A 3WMXA 4GEKA 4Q4HB 4PZZA 5JU5A 1YQWA 2VPPA 1WG8A 2IHUA 2VK8A 3DEAA 4XDGA 2GOYA 3C8ZA 5HR7A 3PQ5A 5FUVA 2F3PA 4D8YA 2C9CA 4YJ3B 4HFMA 2Z1DA 1VKHA 5TS3A 1EDBA 1ZSYA 4D80A 3I61A 1KP3A 2J6CA 4OFXA 4Z86A 5F7JA 4TQRA 1EUDA 3GV7B 2QTWB 4PFJA 1ZOIA 4BNFA 4JJ4A 3LT1A 5DBAA 4RIGA 1QBKC 5ESXA 1D8LA 2BISA 2CUNA 3WGYA 5JLAA 1CY0A 1V96A 3OM8A 3U4IA 2GAOA 1CYDA 1Z74A 3D0OA 3ASZA 1KAEA 4C21A 5CFQA 3R3UA 4FR2A 2FK7A 1IJFA 4KMOB 2KI5A 2Z4SA 4LG1A 3UENA 4E33A 4FP9A 2P9HA 2YY6A 2MSKA 2W6PA 3LUKA 3PSIA 2PH1A 4M1QA 1JEYA 3B70A 5JJBA 2I71A 4OUKX 4F5ZA 3KK0A 4W9MC 3MR5A 3QVUA 2AI1A 1MT0A 1RQRA 9ICSA 1SXJC 2REOA 3UWSA 2ZRAA 3STYA 2RDJA 1J07A 1L3TA 1M6EX 1QTNA 4JB2A 1EG2A 5ALIA 4URHA 1U1GA 3IO5A 4KSCA 5KVCA 2O59A 3DVQX 5KQGA 4A73A 2AMVA 2AGQA 2OEHA 1JG4A 1FTNA 1CY8A 2OM2A 4LV6A 2I2WA 4ZQEA 1AROP 5NULA 2PMEA 3VR2A 1UK9A 2WKWA 5CVCA 4ZRDA 2C3PA 1U9IC 4L85A 5JANA 4BBAA 2KIWA 4LBYA 2OWOA 1W2WB 2ZCJA 3MUFA 1DBSA 2JGDB 2AS0A 2ZI4A 1YWGO 2A6PA 3RUIA 3KVOA 4O4HB 4K3UA 4XUDA 2JFGA 5BQFA 4QX6A 3VMMA 2XX3A 3KUKA 2AGPA 4X5VA 4MTCA 3LRTA 2K8AA 2MHCA 4Z9AA 3LBNA 3GQVA 4EEZA 2IY9A 2DY1A 5DGBA 2QU7A 4KPYA 1R0LA 1YZQA 5AW2A 3WIBA 5EIBD 4GKAA 5TY0A 5JAPA 4OHUA 4PZ0A 5HE8A 1VSTA 1TF7A 2BCJQ 3CC8A 3H04A 1XKLA 4XFKA 5HKAA 4N39A 4UQGA 5CVUA 1FVOA 1P0CA 1I4LD 2IK8A 3EC7A 4QDUA 1T6XA 1L4YA 1P4GA 1IIRA 4KQ1A 1FSPA 4HGQA 1YJBA 3NHLA 4M9LA 1GCAA 2FPXA 4QZVA 1V1JA 2WTAA 1BHQ1 4X8OA 3CW2C 2IGBA 2OD2A 2WYIA 1ZWLA 1U7HA 1V8PA 4RPJA 3GDGA 4BMNA 2SCUA 1XDDA 4DQ0A 3GLQA 1X1AA 4DF8A 4Z99A 4Y2PA 2HADA 3JYNA 3WGMA 2QRVA 4NE9A 2CVHA 1NK9A 2YW9A 4NCAA 4I2DA 3DEKA 4Z4FA 4IDBA 5THKA 2UVPA 4D3DA 2QQFA 3OZBA 5DF1A 1CDEA 1DOZA 1N3YA 3IR5A 4L5YA 3ZHYA 2XUKA 4TXMA 4KLDA 2FX5A 4WPGA 4LWPA 3RS8A 2KVSA 1U9LA 3ZWNA 5KNDA 1NVDA 4ESHA 3HJNA 3T52A 2GEVA 1Q12A 5JMPA 2IE0A 5LLTA 4V0ME 1E63A 2BFBA 5DSZA 5FFMA 8ICMA 1QKJA 2R87A 4NEQA 2GVNA 2FSHA 5EZQA 5HIKA 3FXAA 4HLUA 3T1YB 3SEIA 5KSZA 2AQHA 2CSXA 5JJLA 5TJHA 1O9HA 3JX9A 1BU8A 4C8MA 3P9IA 3QMWA 2AFVA 3FX2A 3QX9A 4J1SA 4IICA 4MGIR 3UAGA 2OOSA 3FLBA 3GRPA 4PGMA 3GLFA 4L4YA 1NJ2A 2JJ2A 3QV1A 2PXIA 1YB7A 3LTEA 4V39A 4DIBA 5GGYA 3U3OA 5JXHA 4IR1A 4JI5B 1G1MA 5DLYA 1SXJE 1QBGA 2HOFA 1RFGE 2XGOA 1HLDA 4DFJA 2BZSA 1DJOA 4HB2A 1EUCB 1SQFA 2ZJFA 4B40A 3UF0A 3JQAA 2XY5A 3V32A 2OFWA 3EXHB 5BRNA 1FNDA 5I7VA 3Q7PA 1JJFA 2DQ4A 5JAHA 1H0RA 3G5MA 1E4VA 5DDIP 2C2EA 2NYAA 3BQTA 1MF7A 4B3HA 2PIAA 4S1NA 3QOFA 4WERA 4A5OA 4EQ6A 4ZYTA 3AV0B 4UHKA 2W2NA 3SYMA 3DGFC 3C15C 3RG8A 3SYNA 2GF2A 3OE1A 4GGMX 2AD1A 4JLKA 4TSRA 5F4BA 1JFFA 4MUNA 4CGYA 3B85A 2CVZA 4RZIA 5AJYA 5BVGA 3W06A 2NM0A 3UHFA 4U7PB 3CGGA 4QNRA 2BDTA 3IIIA 4C3VA 5BMVF 1XJQA 4ENQA 5IASA 4OH1A 2W8ZA 4BGEA 3SLRA 5L9XA 2J4DA 3VNAA 4C7ZA 2Z6UA 4RWEA 4TKVA 1XAJA 3L6CA 2B20A 1EE9A 4LBZA 1EJ2A 3CZ4A 5CT4A 4J9QA 2N1RA 1EMDA 1JHAA 1HEYA 1ZICA 3ESQA 3DUFB 4M1ZA 4PPXA 1IJKA 2B7CA 3H84A 4JX8A 3M7DA 4DOCA 5BNWA 4UVEA 5C5IA 4IKOA 3PRYA 3ZDQA 3ZV6A 3EAQA 2X22A 1TCUA 3HDGA 4K40A 4JUAA 3NOQA 4C7XA 5J58A 2J33A 1EAYA 4XSHA 1FDWA 2OGSA 5IVKA 2NXEA 5EP4A 4KHPB 2QB5A 2PT7A 1KMMA 3T7RA 1VGVA 1E0DA 1NUHA 1TQ4A 1GPYA 1ZCFA 1JFRA 3BWXA 4F1JA 4Z1OA 1GAJA 4BNDA 4BV9A 2QZ9A 1ZPDA 2BOVA 3FWHA 4IMPA 2HB6A 1N34B 2NV0A 2QN6A 3CR3C 3GJRA 1I3LA 4R2IA 1MIHA 3PQDA 3STXA 1KO1A 5JNLA 3FJOA 4OATA 1ZMBA 1OJLA 5EGSA 1HQYE 3L7NA 1W44A 1T4CB 3O0FA 2NLOA 2NWQA 4WXHA 3SHOA 3SP1A 3VGJA 4F85A 2FZVA 1ZX1A 4X65B 2Q7DA 2PZAA 5JUMA 2ID8A 4L0MA 3R5FA 2XIQA 1E2HA 4BBZA 1KKLA 3KETA 4YALA 2NZVG 1T9GS 2I6GA 3I9FA 3PTLA 5FUXA 3NX4A 4RCVA 1FL9A 1WQ4A 2O52A 3AF3A 2ZYVX 5IRCD 2IY8A 3A6ZA 3TGPA 3KYIB 1TEZA 5AKEA 4QTTB 4XWOA 1RQ2A 1JKMA 2HMVA 2E6KA 3LD9A 5H68A 4H17A 3IQXA 3JTEA 1F2VA 3HP1A 2P3SA 3LPDA 1NK8A 1QAQA 3QV2A 3TADA 1SIJA 1CQIB 2VUIB 1ISFA 4W1RA 2HI0A 1BE0A 2HHWA 2V6GA 4UCWA 2IXFA 4A15A 1IATA 1OT3A 1B14A 4Y2GA 1E61A 1NU8A 5HFNA 1U8CB 4KXMA 2PX5A 3GLHB 3GLIE 4LCJA 1PX2A 1Y9EA 5EWGA 1ADFA 1AKTA 4QRHA 2C2KA 1FF9A 1IZYA 5U4QA 1BDIA 4J03A 1RAFA 1WEHA 3AUOA 2H2IA 2X0EA 4F9FA 1O77A 3PFCA 1J2JA 3VRHA 4P2BA 4GLLA 2H3EA 3L7MA 5J0YA 3MWJA 3EDCA 4HGOA 2FJPA 4JBYA 1G20E 2YMPA 1WTAA 2JIPA 1VB3A 4G0ZA 4KDEA 3HR8A 1PJSA 3UQ0A 5LZ4A 4CM4B 4YAUA 2VDOB 4NU6A 4JOSA 4OJYA 4BKUA 3PQEA 4X64B 3G85A 2K8CB 4KLNA 4YJ2F 1IY0A 3VTFA 1H0SA 2FPIA 3KR9A 4RVUA 1ZQKA 1L4EA 2QW0X 3I4FA 4E30A 3E4CA 1FDRA 1BJRE 1IQRA 1XTTA 2VEOA 2WIAA 4X95A 2PM8A 2D0PB 3GLVA 2HRCA 3RHZA 3BWYA 2EVWX 3H7AA 2FPMA 1Z33A 4C2UA 1PJ3A 3CRW1 2YYSA 2ZIXA 3KHSA 4E7PA 3DDUA 3W5IA 1YCGA 4UBOA 3RCBA 4ZHQB 1N32B 3QRWA 2R60A 1RHUA 1WPXA 3P45A 1OZGA 4QGHA 2ZVQX 3IP5A 2OBBA 1B00A 1CIPA 2VRWA 4CLHA 4W99A 1ENOA 3KVRA 3ORRA 4L5JA 5BQXA 3I0MA 3JYHA 5LQRA 2ZPAA 3W6NA 4F91B 2QQ0A 3P26A 1P9NA 4U8HA 4WCFC 3WYNA 4B17A 1OH5A 3LDUA 1U7DA 2OYRA 5ALNA 5HFJA 3CNHA 5C4GB 3TRJA 5FTLA 1KJIA 2DWUA 4IRDA 3DV0B 4O2BF 3H1FA 2GR9A 2ASJA 2Y4NA 4DQIA 2Z1MA 3ISVA 2JAHA 4A0RA 4U2KA 7ICPA 3VR5H 4BV8A 4HNVA 4CIWA 4QUEA 1B76A 1BJTA 4IH1A 1LPAB 4IFTA 1N7JA 4TQGA 4UZSA 1DU4A 5DQHA 2VVTA 1NQAO 2O8DA 2CYCA 3KE8A 5BNZA 4Q8FA 3COZA 3BWEA 2R8HA 3JS5A 3NBQA 2DAPA 1A8PA 5H5JA 4Z3OA 1DEOA 4UBNA 3SKXA 4FFNA 3IBFA 1IL0A 4NYMR 3BXXA 4YJGA 3U7QB 4KR2A 4WGFA 5EP2A 2R48A 5LU9A 1N6LA 3LC2O 1MA7A 5BMOA 2ORIA 4NS1A 4PZLA 2Q9AA 2IBKA 3M2PA 5FO0A 2ZIEA 3WMGA 3O9MA 4AP6A 4DB2A 1FFGA 2XGMA 3OGUA 5HIAA 3CVYA 1ZJYA 2V1XA 1SBNE 3K0AB 4AO8A 2C96A 3JPOA 3D8BA 4IEIA 1VRWA 2IBMA 3GEGA 1FUIA 3D6AA 4FI3F 4NKRA 4I5FA 5DBCA 5FWXB 2FAXA 5ULLA 3MGHA 3QVVA 2YOHA 2IXTA 4AYTA 1K6MA 3BF7A 4ZT5A 4ZIRA 2O2ZA 1Q5PA 4WCDA 5K05A 1BPZA 5KWIA 3BMNA 3TLBA 3MA0A 2P4QA 1ML4A 1Q0ZA 1GTZA 4IV0A 4E94A 1K66A 1N0UA 2QJFA 5A5FA 4AG6A 1KIMA 1PGOA 5CLIA 1EK5A 3K09A 2GSDA 2MSWA 4K4GA 2ZWAA 1PV2A 2A7QA 2CYBA 2VDRB 4S0XA 2I87A 4CF6A 5KJ6A 3FSGA 3C48A 3TB4A 3USES 2A5YB 4IUBS 4UEJA 4CCYA 4KO2S 4CM9A 4BEVA 3OZ7A 5IDYA 2O5EA 1L3VA 2ZP1A 2I33A 3VHXB 2CXYA 1MABA 1R88A 4LWQA 1GGKA 4WEQA 2J5KA 2WM3A 4LY9A 1TZJA 4DLVA 5AQ1A 3RYCB 3IKMB 1JQAA 4RHUA 3FYUC 4RJLA 4C0BA 2VJ4A 1FSZA 1XVUA 2QVXX 2RGUA 4CMIB 2PMFA 3UGTA 1P44A 3F2IA 4JK1A 1W5AA 4UPEA 4UEWA 2FUNB 4KREA 2OBXA 3GFQA 2NQTA 1T9KA 3ZE6A 1I2ZA 3NIFB 4L22A 5EOVA 3D8HA 4JR1A 1YGYA 2E55A 1ZUHA 2PIDA 1J7KA 1LU9A 2G5TA 4MPTA 4FLFA 4KN7A 3FDJA 4PIVA 3STHA 4U7JA 4PL2A 2GLTA 1F2TB 3V3TA 4GOOD 4U3JB 5FJIA 3RR2A 1XV5A 3N75A 3EUB2 4X24A 3V1UA 2VCHA 4X3CA 1ZNYA 2C4TA 3A7EA 2FW0A 2YFYA 2QLFA 3HSSA 1QHFA 4O5AA 1N9ZA 4LBWA 4Q1AA 3O31A 1EXNA 2HIMA 3EG5A 2W8LA 1IBRA 3WQBA 1BPEA 3I28A 2IOQA 3WE7A 4NY1A 4DR3B 1JIUA 1TO6A 4HAZA 1X15A 2FTKE 2XNDD 2NT3A 1ZCAA 1LTHR 3KAJA 4FXOA 4JU8A 4NH4A 4BRUA 9LDTA 4MARA 5DTJA 4NEGA 4D43A 1WZIA 2UZIR 4HDQB 2VH1A 2ZKLA 3PKIA 1S96A 4HNGA 1BH2A 2HK8A 3K0FB 5ECWA 5BUQA 5CH3A 1OGJA 1IOVA 2Y1CA 1A5ZA 3CNLA 4CTJA 4KE7A 1X77A 1YCDA 2OO5A 3S28A 2P1ZA 3OQVA 4ZZ0A 4UOQA 3ZR4B 5L45A 3QE3A 1KC1A 1PS0A 4OQPA 3SNKA 5DNCA 1E60A 1XEWX 2W9BA 1SU7A 8ICQA 1Y3BE 2OY0A 4KBFA 5K6RA 1Z1VA 1IHPA 4MVCA 2I3BA 9ICKA 1KYYA 1XZIA 3U3RA 3R41A 3H86A 1B0XA 3CLTC 2ZI6A 4NFSA 4WESA 4BO0A 2ENWA 3OU2A 1B3RA 3VR4H 3DGEC 2W6JA 2XIJA 2ZAOA 4ZHSA 3NVMB 4XQ8A 1GNLA 2XNHA 2EIHA 2HMWA 3QQPA 2ZCUA 4GUAA 3D3WB 1WXEA 4L27A 1J8YF 3HN6A 2XVTA 1I2BA 1IK4A 4TM7A 3PCRB 3VSEA 3UA3A 4CKWB 5A4AA 1STOA 2ZJ6A 4UBIA 1II8B 2YN0A 5FPKA 2QRQA 1XRJA 1CZUA 2PGXA 2YCLA 1F60A 3E61A 4XEHA 1E0KA 3PCTA 4OTZA 1CUDA 2ZVJA 3L6EA 5KG1A 2GZ2A 5EIHA 4YAWA 3H5LA 1KSHA 1FDIA 5IVIA 1FS6A 1F4LA 3U4DA 2ES6A 5LXTF 1PZXA 2Q5FA 3WMRA 2CXTA 2ZS8A 4IFBA 4FHEA 1MAVA 3BQ9A 5T4HA 4YCLA 3HCFA 4H59A 2LM4A 4QQFA 4JHXA 3R8XA 2Q5IA 4F5RA 4F97A 3I34X 3M9NB 1CQZA 3KQUA 4G8DA 1W36B 2FP3A 3RRJA 5IJZA 2BJWA 3C5VA 3I76A 2V9CA 4JEHA 4FHCA 4BQQA 2XVZA 1DO2A 2J87A 5KNCD 4S2UA 4ZZ2A 4RMJA 3DLBA 4AJIA 1U63A 3GRCA 4NE2A 3K35A 3LC0A 2WK1A 3KFUF 2JGLA 2NV6A 3K1ZA 2QP3A 2VAVA 3AETA 3IERA 4DVJA 1G38A 1DX4A 1V8OA 2W5UA 2P9BA 4MFAA 4G0MA 3OZAA 5B1EA 1JNYA 1MR3F 2AK3A 3AQEA 1IY2A 2Q1WA 1VLQA 2XOEA 2K4HA 4DLPA 2BDPA 3V3KA 3X3HA 4EVRA 4X71A 3AUXA 3E2IA 1H5NA 3IT1A 3CF4G 1EHYA 3FSRA 4TWJA 4DDKA 4FHGA 3JQGB 1T0UA 1IM5A 1RBQA 2OCEA 3K4PA 1H4QA 4Y6OA 4EUEA 1ACLA 9ATCA 2VBCA 4QNMA 1DXQA 3GPBA 5G0SA 3AOEC 3L0OA 3HDJA 4RQ6A 3L8ZA 3LQ1A 3IQFA 5DWDA 4U63A 1K97A 2RHHA 3VYWA 3TAPA 1QDEA 1AS0A 1WQ1R 2E4UA 5LDGA 1T36B 4LTMA 1Z73A 1VA4A 1L5KA 4MI9A 2FE9A 2QY6A 1S76D 3PVZA 4FK8A 4DWJA 4MIKA 3CO0S 5CFOA 2UXCB 5K3FB 4K6FA 2J6HA 4WN9A 5GTHU 3UNXA 4OBBA 1GCUA 2K4MA 5K4GA 4PX3A 1XUOA 3LYSA 1W76A 3NANA 3TI7A 4DLSA 1AUPA 4QFBA 5HW0A 3AILA 2VG8A 1XMIA 2P91A 1C30B 1Q0LA 2PUJA 4LNUA 2YVUA 4OG2A 4B9EA 5CJ7A 3TXAA 3I39X 3LUHA 4EBBA 3IP6A 4NM2A 1GLGA 9ICXA 4KUGA 3C1UA 4BKMA 8ICWA 5J2FA 2E4YA 3AKCA 1V8DA 4IHJA 1FTGA 1X6IA 4RPXA 1VLZA 2Q3JA 4M7WA 3UHJA 5J8YC 2Z57A 1M2OA 3OC0A 3V6JA 3MWKA 5ICFA 2QR2A 1VL6A 1WD5A 2OAQ1 1WU7A 4PAQA 4ZD6A 5JVDF 2WD7A 4HAYA 3QLUA 3UHAA 3ZU4A 2XCRB 4ARBA 2V7UA 3A6DA 4OXKA 2EARA 2QUZA 4ZYXA 3S2YA 5FEUA 2PK3A 5B6IA 3B6MA 4IOKA 3OJSA 2QL5A 2KSQA 4OJMX 2C2YA 2WJ3A 1NKBA 1L3SA 4RLFA 2DUUA 3WDSA 1XU9A 2JJ2D 1I8TA 4HXEB 4MRRA 4QBHA 3BKXA 2P35A 5K8CA 5IKEA 1U0LA 3HYCA 1F0KA 2ZRNA 3ER8A 1AE1A 3CA8A 2GKGA 3FLAA 2QLMA 4LTNA 2BEVB 4DC9A 4OYRA 4NNJA 1JEAA 1JBQA 1SG9A 3NAQA 4AVYA 3MGKA 4JR2A 2BMVA 4RMGA 5CK4A 3UJDA 4QT4A 4QARA 4DM4A 2P90A 1H1LB 3BMQA 2VBGA 4FFRA 3BKWA 2BFBB 4UNRA 3HQ4O 2LW7A 2RAFA 2O9JA 3CEAA 3JD0A 4I6GA 2PUDA 2XXAA 2A0YA 1ZOSA 4NV1A 2IWHA 3V00A 3BL6A 3BJMA 1QP7A 1YI8A 2IW1A 3NWBA 1OQAA 4F7WA 1Y7LA 2HA7A 4QPDA 1BEZA 1RI2A 4BQFA 2AFHA 1T29A 4CKBA 2OCBA 5AW6A 1LGYA 4X6YA 1CY7A 2YJTD 2ZIWB 3MHPA 4OBWA 3QKUA 4LRXA 3OCYA 4JHLA 2M2IA 4PNHA 2GCGA 2GHTA 2JIZD 3RNLA 4IOJA 4DNQA 5CA7A 1W87A 2OXTA 3HY3A 2NACA 1XQ6A 4TL6A 1N5IA 2CHFA 4XVQA 5IVHA 1SU4A 4C0WA 3Q88A 2FKAA 3PP8A 4E46A 5IFLA 4KVFA 2LXNA 2PFKA 3N86A 2PT9A 3D1LA 4MOWA 3TVDA 1U2QA 4LRSB 3M4NA 1X7YB 2BWJA 2DRIA 1VJ1A 2FYTA 2OXCA 4OHMA 5TT1A 2B61A 3H16A 4QUKA 4AJHA 4BFWA 4RKFA 1S3SA 5GZ6A 2MIIA 1XXLA 1QQ7A 2ZR9A 4B46A 4DR4B 4BV3A 4EUSA 1ODFA 4XX0B 3IOEA 4QODA 4LMAA 3WNQA 1NXSA 2GN1A 1XQ9A 3B9JA 3NASA 2QNIA 1M2JA 2VWGA 3TQCA 4AMGA 4D3SA 5H8WA 1GM5A 1JFFB 4TZ0A 1PLKA 2ESRA 4EGCB 1GKIA 1TADA 4V0SA 3UW1A 5JWOA 2FWRA 1XYYA 3CG0A 3SDBA 3TZQA 2BLNA 2CDCA 2VPWA 2C2DA 3TR0A 3RIGA 2I67A 1PNOA 4QIWF 1LB2B 1CCWA 1W88B 2QK4A 2D5LA 4RU9A 3CH7A 4Z4IA 4DQQA 4IXNA 4Y2SA 2AOUA 3HYLA 3UZUA 4LHVA 3BAFA 1BCRA 5IWAB 1Q57A 1T0PA 2ZS7A 1T2UA 3OMWA 4Q37A 3WRXC 2PJRA 3RF6A 2FCAA 2IVZA 2D0OB 3GJ5A 3ZZMA 4B2PA 1MDBA 2FW8A 4NCNA 3FFXA 1U28A 2B8NA 5LNK6 3TSOA 2B1IA 1LDMA 3CUTA 1G7SA 1V8BA 1QS0B 1GNVA 4QIHA 6LDHA 2W6NA 5FNVF 4GUDA 4HADA 1BGVA 1PNVA 2FDXA 2JIZA 4HAWA 1J70A 4E3WA 2VHUA 1YV9A 3C2LA 2QIPA 3GJ8A 4FKMA 4MW7A 2JA1A 3SJ7A 2XQFA 1HYGA 3DLPX 2AWOA 4D3ZA 4EB3A 3LU1A 1T34A 4I1VA 2JHDA 1QGED 4KK4A 4DL7A 3M9XA 3QI2A 2C5HA 4DRXB 5JSQA 4R8MA 2VA8A 1ULBA 2IYAA 3K8QA 4W5WA 3SQMA 3HUDA 1U5BA 5TMEA 1AO0A 2QZPA 1RIFA 2Y1WA 2IYNA 5JRZA 3PMLA 5GV8A 2YVLA 2YZMA 2LKCA 3B9QA 3H8MA 3C6YA 5K0NA 3UYKA 3THXA 4R1SA 2PFSA 421PA 1TQHA 4IWNA 3G2NA 5KNLA 1DTWB 3CFYA 1O8BA 2NP6A 3ZE7A 4AKIA 3BQ0A 4XUEA 1XAHA 3MNFA 4P0QB 1TD1A 3DE5X 4XRGA 4EBFA 1GU0A 1TM3E 3U5ZB 1W96A 2HC9A 4X9XA 5DLDA 1M33A 3W79A 4AZVA 5EEGA 3FOBA 5KYUB 4JQZA 1EBFA 2CD9A 3FBGA 2PVCA 1YB6A 2WSLA 2ODWA 2QZZA 3K4QA 1PYOA 2YJ6A 4HAOA 1PVVA 3CRVA 4LXUA 3GA0A 4MPDA 4QDXA 2GB4A 3C3AA 4DM7A 4TYMA 1F4VA 1U4NA 1QDUA 2FEMA 2RHLA 3AO0B 4ZRNA 4OGFA 5I7WA 1NBWB 2CF6A 1A8HA 2OCXA 1T13A 2DFKB 4JJGA 3M9WA 2PGLA 3T7IA 3NTUA 2ZAIA 4CKEB 4PJ0U 4AROA 4IJQA 2WWVD 4XWYA 4TYNA 4DMCA 3C1YA 4KI0A 2A9FA 4PSCA 1MEOA 4XUGB 4EHBA 3FVVA 3GAZA 1DV1A 1P7ZA 3F3SA 4QLAA 1XEXB 5AJZA 2XQVA 2WG0A 3ML1A 3OICA 4ZO6A 3HYTA 4YCJA 1BMFD 4NPHA 2WYHA 3RB8A 4QGSA 1PR2A 4H60A 3KLOA 4WASA 4Y2XA 3SI8A 5KFEA 2WIDA 3HACA 4TLCA 4XSVA 1LDYA 3MJFA 5FPTA 3KWMA 4ZYWA 2CY0A 5HQTA 3K0BA 4KMSA 2ISPA 5EJFA 4DR2B 4QNLA 3WOVA 2PX2A 3DC2A 3IRVA 3N2GB 4ZAZA 3SZUA 1P62B 2H1FA 2L69A 4A8PA 3NOXA 3DEFA 4DHWA 2O7VA 5HX7A 1IAQA 2XZDA 4KLEA 3RRBA 1JBEA 4CU2A 4WX2B 4A8HA 4MINA 2R62A 2BCUA 4IQ0A 3RARA 1CERA 4PLFA 1QP4A 4D0SA 1SBTA 3T9DA 1W4RA 3O7WA 1N0IA 3DC7A 3H1GA 1XZDA 3I8XA 1Z2EA 4IM7A 1OXXK 1YBFA 4UBJA 4ZXFA 3GROA 4TUYB 3FHOA 4EJMA 1L7EA 3MMZA 5ALKA 5AVUA 4DYHA 1X0XA 2XTMA 4H7KA 4I6EA 4YYZA 1P61B 3RLFA 4X7MA 1ID1A 3RJFA 2R6DA 1Y8RA 5FI1B 3N8IA 1ULZA 5K0ZA 1FMCA 1QF7A 2PQ2A 2QNBA 3D81A 3WFZA 5LVAA 1H42A 4PZNA 5G40A 3O82A 1CJBA 2PMWB 4HQ0A 1DWQA 1LY1A 1REQB 3KO8A 3LCJA 4DW8A 2A1JA 1SOWA 2XUOA 3ETEA 3N0TA 1QLWA 3B1JA 1EZ1A 4XR9A 2QD5A 1V5IA 5J8YA 1O96A 1TLLA 1OHHD 1QWSA 2UVRA 4HAIA 2NZUG 1FFDA 4QOSA 2J6UA 4OO3A 3QVMA 1ZD3A 2V4QA 1F8UA 2RK6A 1XK6A 4GGPA 4IJVA 1BMQA 2FNAA 1G5FA 1ZXXA 2IXAA 3Q7QA 4TMXA 3JARB 3SC3A 4CM1A 3TSZA 3UCEA 1A7AA 1T3GA 4HNTA 5FA5A 1NP6A 1PG2A 5BT8A 1A71A 1NXWA 4H4CA 4NJMA 1I1HA 3SVZA 4AL4A 1T5TA 1UPBA 3H18A 4PINA 4UNQA 1KL9A 1XMXA 1NJXA 5IUKC 5LYYA 4EKGA 5AVSA 3AGPA 4JDUA 1B43A 1MA0A 2QXTA 4NSNA 4YXWA 1KC3A 2FMSA 1RYMA 2WD9A 2XD4A 3QGMA 5IW8A 4KR7A 2DL0A 1E1RA 2VJPA 3WXMA 3RVQA 4KN4A 3IILA 4ETMA 4BVBA 1J5XA 3Q87B 2E1EA 1N2CA 2VNIA 2GZRA 3E7DA 1XWLA 3U26A 3KWFA 3MN1A 4LXGA 1G8AA 4ZU3A 2VRNA 3T3HA 3DJFA 2IKSA 4F3RA 2HLNA 1ZD5A 3PCXA 4D4GA 5HKBA 2ZJ1A 1SUBA 1FBTA 5IVDA 1PL8A 2V0NA 1XR3A 4LC1A 2D13A 4W6ZA 3WYCA 4OXNA 1O5OA 2HSGA 4N7MA 4QL3A 2QD3A 3I6IA 3A26A 4M49A 1PQUA 1KOGA 3FOAA 1PU2A 2W2OA 3H4MA 3MMNA 3ZDCA 4YR3A 1ZUNB 2VTKA 2YY7A 5AW5A 4ZIRB 3L3FX 3BFVA 4DIUA 2VHCA 1YUNA 3WV5A 1IG6A 4KIUA 2BMEA 4B6EA 1L1QA 4OOFA 3QNUA 1C5KA 4LE0A 3VO9A 5CFMA 3K8ZA 1S1MA 1M8PA 3LF1A 4HNAB 3GJSA 4AQDA 3UMMA 2FMQA 2C5EA 3PSAA 4ND4A 4M9QA 1HG1A 2QV7A 3W5HA 3V72A 1VHLA 1TW3A 2O5VA 4L8WB 3ER6A 2GT1A 2MTBA 4B5LA 1YS2X 3QVWA 1AB6A 1AS2A 3OEHD 5GWXA 2VPQA 3K71B 4RMHA 2NW6A 4MKRA 1YZNA 5C5EA 3RYCA 1X7ZB 2C3MA 2EQBA 2H4ZA 1Q17A 4GOKA 4RSGA 4LKRA 3K7EA 4QYSA 3VGPA 5A0TA 3FB4A 4YP5A 3FCEA 2ZRLA 3DBRB 3PJGA 4F4DA 2G9UA 4GZ5A 3DWEX 1EXWA 3CQ9A 3V33A 3TBFA 2X0DA 4A2WA 3ZD8A 1C4OA 2K2WA 2HXGA 5IAJA 5K7SA 1LD3A 2VNJA 3HEMA 5DXFA 3UO8B 4CUKA 5EPEA 3A6HA 3IXQA 3PNKA 3A25A 3FVTA 4E07A 1KU6A 4U3JA 5JD5A 2VJMA 4V0OA 5F12A 2FJ6A 1TVMA 1P7DA 2H16A 3W9UA 5HJ5A 3SAFA 3UTCA 1LKYA 2BE9A 2QT0A 4WINA 5CM8B 3RIMA 1KQQA 1I10A 4CG1A 5ALJA 2WAMA 1PEKE 1C7JA 1PSWA 4JV2A 2Q3BA 2E18A 5KINB 3ECAA 4LF7B 3OJCA 3MCTA 4IQGA 4RUCA 4MHTA 2DTEA 3AY6A 3JALA 3ZDRA 3E9YA 3RE1A 1E20A 2P9CA 2JGNA 4MV5A 3K73O 1NM5C 4JASB 1JIVA 3ICWA 2DYKA 3UFXB 1PDWA 2B21A 2J9XB 6ABPA 4HRXA 1K7CA 5E7MA 1QYXA 1COOA 1BU5A 4MEJA 5FIUA 4BV2A 2W7PA 3PBKA 4E7OA 1VLVA 4D6YA 5B3KA 1S2NA 1U1EA 2OZVA 1BN7A 2WSSD 3BK1A 4UFOA 1J0BA 1Q0RA 2RAVA 2JLQA 2YR0A 3V7JA 2H5XA 3S44A 5JH7A 1P1KA 5HF5A 1Q16A 1Z4LA 2VHYA 1CUAA 1TZ2A 1D03A 1VRCA 4B4WA 1I7SB 1UBNA 3M34A 1KEVA 2QARA 4R1OA 5HPYB 2O3UA 2RGGA 2VA9A 3EVTA 1KH2A 4FS3A 5DCWA 4YRNA 3ADDA 2WUFA 3BQ2A 4XUSA 2Q1UA 3KJGA 3QF4B 4RD4A 5BSEA 1G3UA 1KK0A 3ITEA 2WWIA 3JQFC 3K15A 3K9FC 4EMUA 4PSDA 2Y1GA 3NAMA 4FMDB 2PSHA 3AP1A 1WTCA 5DBIA 5CEHA 2V55B 1T2VA 1ZIXA 1XD2A 1AGPA 2JA2A 2K5UA 4B74A 5HYVA 1Y0BA 2V7XA 1HDEA 1URJA 1LLFA 1WXHA 1U2DA 3JSXA 4V38A 5TQ0A 4D02A 4CQMB 2VJAA 1ZYUA 3NFRA 1ZIYA 3HP6A 5ICCA 2QTTA 5CLFA 5CNKA 3MOSA 1IYZA 4ISCA 2JDIA 2P4EA 3NNNA 4A2QA 4C5CA 1OZ0A 2KV2A 3RWMB 2FRDC 4ZEVA 2PYZA 3P9ZA 3SQXA 4P3OA 4J75A 2VATA 4BNLA 1Y6GA 1RHRA 3WTCA 5KFWA 2J9FB 4AMUA 3UXHA 2GO7A 2GS9A 2BM9A 2FMKA 1OYVA 4IHQA 1SIOA 2P9JA 3FYUA 3SHVA 4DJDC 4DLXA 1HTTA 1E1QD 4M0CA 1V35A 3FD8A 3WYBA 3T9CA 3UAZA 1NXQA 3B5IA 3B0YA 4N3CA 5BURA 3D5EA 1DFGA 1KYXA 4URUR 3GZNA 1JN3A 2DHRA 2WJZB 2XVMA 4WA7A 3FWYA 3VHQA 5HSGA 3OQIA 3U5TA 4EVIA 2NUAA 4PANA 1E3TA 4BXOB 4YONB 1A72A 3KFXA 5GY7A 1T2AA 3ROEA 1J0EA 1FUYB 1NMEA 5ARDA 1GTSA 1HRDA 1F17A 3NRJA 1Z12A 1KL7A 4TQSA 3JVDA 3RFAA 3QEAZ 1MV8A 1D1QA 5B2FA 1EXMA 3QEKA 2BTQB 2HLDD 4M36A 1U7OA 1FP1D 3F6YA 1YD7A 3KKPA 4GYWA 4DCTA 1EK2A 1JHRA 1MW9X 2PL5A 1NNSA 3JAWA 1TAUA 1KERA 4WTOA 1KWKA 2VLBA 3FUTA 1RPJA 4EPXA 1POWA 3KT0A 3D4PA 3QXCA 3T5HA 1KZ1A 1GSIA 5GZ3A 4LW8A 4Z49A 3IB6A 2Y0BA 4QAJA 3MW8A 5I7UA 3ZD6A 5EJ2A 3SV3A 2NRTA 1LFDB 1RCFA 1PGNA 2INGX 2YTZA 1RLMA 3CURA 3ONWA 3U7IA 5CEJA 1LI7A 3T5LA 4FBLA 4AQ7A 2WF9A 3A28A 3L7LA 3PGMA 4TV8B 2HBQA 2XEXA 1GUBA 4YRAA 3GN1A 5EXEA 1SZHA 4IYJA 1UOQA 3SE0A 1DT3A 4QPJC 1N61A 2RRDA 4C8OA 1ZD1A 2RG1A 3M3HA 3QBJA 4XSGA 3HBAA 1XJ0A 3LGAA 4GRAA 1PNQA 1GN9A 1R15A 2GBGA 1I9CA 2AFRA 1MO2A 5AOBA 2YTUA 5A9TA 4PG4A 4TYYA 2CUKA 1ZD9A 2PD6A 1D5WA 1ZQBA 1BDBA 1S9FA 2CNOA 2CUTA 4Y9DA 3IE1A 1FQJA 3HM9A 3PFKA 4BVHA 5KFDA 4CL3A 3DL7A 4BO3A 1WUDA 3QU5A 5BUSA 2V3VA 3HC7A 4NZMA 1BE8A 4EATA 2ZB3A 5H9WA 6ADHA 1PFGA 1S97A 2AG8A 2JH9A 2X4DA 1GNRA 5KDOA 3T1HB 3LPCA 3QBTA 4N0EA 5FI3A 1E79D 1HR0B 1NBIA 2OORC 4BFXA 2QW8A 3ZXXA 5IIKA 2X13A 1MA3A 1PWEA 4AB1A 2ERXA 2JCBA 1QIHA 4LZOA 1EI9A 3WYGA 1J2EA 3VZPA 3D2AA 1O97D 3F1KA 4LDRA 4BS9A 2BTOA 3MJSA 4BECA 3JASB 3QA3E 2WNHA 2AXPA 3O2QB 4ARIA 5B57C 5CXSA 3FTDA 3IH5A 1E9EA 3CNEA 1II0A 1L5HB 1ZNZA 3H2GA 4DA0A 1ZR4A 1EWQA 3PW4A 5FBLB 1KJJA 5CG1A 3QIAA 2UYCA 4QJFB 1EA7A 3E2PA 1MW8X 2NVUB 1EP3B 3F1LA 4F3CA 3V4SA 3GF4A 5DGXA 5F23A 1UIRA 5CVDA 4OREX 3RUFA 4PX5A 3S2UA 2CMGA 1YNSA 1ZDMA 4OJTA 1WXDA 1ARZA 2EHJA 2QMUA 3O8OB 5K8LA 1VKRA 3H0CA 1DQRA 4KWHA 2OMEA 3D8TA 3H3XA 2HJ9A 3OIDA 4N48A 3RNOA 5T64A 2V6IA 5IH3A 2EP8A 4MFFA 3BQNB 3FCSB 3FCCA 1JH8A 1QTIA 4P3KA 5EXSA 4YJKA 3NRBA 3CLVA 1PDVA 1UC5B 1XKQA 3TMAA 1HDRA 1E2PA 1NW5A 3B82A 3H4IA 1S0MA 2NSDA 3PDWA 2DKOA 2W8KA 4CGZA 2BF4A 3OOEA 3KKNA 5DB4A 4GLFA 5FLEX 3G82C 5HZKA 3LUGA 5TPWA 3QM1A 4XCQA 3UUGA 1BXZA 2I7TA 3PRHA 4KACA 4UHHA 1JEYB 2AQKA 2NXCA 1DC6A 1BE6A 4RQ5A 2C4VA 3JQ9A 1TFRA 3FNBA 5JEEA 3WLKX 4MGKR 3GEBA 3QVGB 1FQWA 4KUHA 3ETRA 1JMKC 2QTFA 2IHBA 3G9ZA 3USCS 4OHRA 5BSVA 1IBMB 2OV4A 2AFIE 4XX0A 3OTIA 2JD0A 4FCVA 1PUIA 2JBWA 4RK6A 4EAQA 3OE4A 3QENA 1NXTA 2J41A 3L0CA 3ONDA 2RGAA 3UT5B 5EXPA 1SKBA 1YIDA 4GHWA 3BS4A 3F97A 1E3LA 3QFFA 4YFVA 2P5TB 1OAOC 4FWTA 4JBGA 1EK1A 2ZW9A 2ZREA 3B36A 3ZC3A 5KVQA 1A4RA 4YBZA 2JIOA 2VJBA 1E9CA 2JR5A 1EU1A 1HI9A 2V98A 5TSDA 3VTZA 4M6WB 1CUYA 4KWEA 4Z8XA 2XWPA 1U2EA 4I5EA 4WK0B 3BGDA 3L1HA 3QPCA 3JQ7A 4KNWA 7ICKA 2Y9PB 3BPSA 3N0XA 1JYEA 1ZQNA 2Q5OA 3H9GA 3K96A 3QG5A 3QOYA 4XM1A 5JXJA 5K5EA 4K0KB 3GWZA 4V0KA 3B6EA 1LK7A 5CUQA 5J2UF 3RUCA 1XDGA 1XC9A 2QLBA 3KSDO 3PGKA 3O26A 7ICQA 4O3SA 2MUTB 2WR8A 3BXHA 1QS0A 3L43A 2F3SA 3PPYA 4RQ1A 1DNPA 1YRYE 4YRSA 1S5LU 9ICRA 1XDWA 2EFJA 5C9ZA 2YY5A 4C4YA 3TJRA 2FPPB 1MP0A 4HWKA 2YL2A 3BE8A 4PR3A 1RJ9A 4JLAA 5ICMA 4BLTA 4DRXA 1NRWA 3PHJA 1HYEA 2NVUA 2R85A 2DCUA 3PFNA 1WHSB 1JG7A 3AZOA 3GNQA 3WR5A 4JQYA 4XVUA 2QN2A 4TYQA 3DD5A 4YDHB 3GH1A 3HB4X 3LF2A 4B8ZA 3LOPA 4XCXA 1ZJJA 5TV2A 1UOPA 4XDZA 1SOUA 1WCV1 1ZQCA 2HO4A 3DZBA 3OFVA 4K6KA 4ZQBA 4ZWNA 5DLEA 1MB9A 2R6AA 3T34A 4I2EA 4BQIA 4Y1EA 3OWXA 4BO7A 4P0QA 5ADUS 5AKYA 3UBMA 2B1GA 1DINA 1PK1B 4BGDA 4ITRC 3RUPA 4JI6B 1J8QA 1Z68A 10MHA 2ODGA 5C8VA 4JIGA 2BKUA 3NHZA 2KVCA 3AUAA 5ER6A 5FV4A 3UPQA 4U0JA 3VNRA 4N7JA 3RTVA 4FC6A 4HVTA 1W4BA 1CVRA 1WCIA 4L50A 4JC0A 1F51E 4PYJA 2VC2B 2VDUE 3DMYA 4HNRA 1G6OA 5AQEA 4MHSA 1UIMA 1J1ZA 2QVYX 3Q2IA 1YF3A 3P19A 1HXHA 1EBUA 4CFYA 4QUIA 5BQ3A 1SVNA 4YCBA 3ENKA 4JENA 4EF4A 4CM7A 3BIJA 5JECA 3B9RA 1I4OA 4JGGA 1ZQHA 4TT8A 1MPXA 4YV7A 4LRYA 1J39A 2D6FA 2EXXA 4I9UA 3SM3A 3TQTA 1H2RS 2E82A 3M81A 4P3XA 3CE9A 4ZDWA 5DGIA 5ALFA 3T41A 3TLCA 1VHQA 5F5LA 1YQEA 5IF3A 3W5JA 3WVNA 5BPCA 3IAHA 3QHQA 4G84A 3H83A 2WIFA 4GPIB 4A03A 4FFWA 3HA5A 3EPKA 1AXGA 3Q3VA 5DBGA 4ZC1A 5PGMA 3P0RA 4BP9A 3N2GA 3JQAB 4M9XA 2BEWA 4QAQA 3WQHA 3B1XA 5CD1A 4QWMA 2AW5A 3BJEA 2W04A 3HKDB 2KP7A 4AZTA 4DUGA 4AULA 4IR9A 1KI6B 3PYLA 1C1XA 4AWBA 4MKGA 2DP4E 5CWRA 1OTXA 3R40A 3MLBA 3PXDA 3P2EA 3QYFA 1TAHA 1WRBA 1GNTA 5IG2A 3CWCA 5LIPA 3PE4A 4AJ2A 3WHPA 1FP4A 4EG4A 1BPBA 2BH2A 3AM4A 2XUHA 2C5SA 5HMLA 1DRUA 3MR2A 4RHFA 5J0UA 5J0PA 5G0UA 2ZM5A 1XA3A 4RENA 2YJ5A 1PT9A 5G02A 5AYVA 3DTNA 1BAPA 4F4IA 1T1JA 2J8ZA 4P4PA 1SO8A 2HK7A 4JBNA 3U0VA 4QZFA 5AW8A 3SVLA 1OIWA 3F8SA 1DGQA 1H4VB 2O1EA 1NV9A 3SIRA 1QCCA 1Z0JA 2QI9F 4K1XA 3W2EA 1CJCA 4LJSA 2A1JB 3KB1A 2GN0A 3TIXB 4C5AA 4GR4A 1KPIA 2X6QA 2O57A 1E2QA 1T3TA 3ONNA 2ZTSA 4L6IA 4XWKA 4C03A 4M8SA 1UAGA 3M8KA 1QPGA 2KW5A 3UV6A 2IELA 4D9IA 5AO9A 4D7AA 3LWBA 3AF0A 1KI8A 3I73A 3A1WA 2P69A 2I4LA 3LX8A 3LYUA 4MVJG 4QXAA 1TF5A 4XDYA 3BAZA 1ISSA 4JCOA 4LECA 3ANMA 3O8BA 3L84A 1K08A 5TVGA 5JZBA 1V48A 1G66A 2AG5A 1G8SA 1P31A 2XBLA 2WOOA 4J8PA 4NJMB 1UQVA 5F52A 2WHXA 1EDDA 1LW7A 1WZEA 5LQKA 2RGDA 1T6BY 4KWIA 4HNSA 1SIUA 1E69A 2WTXA 2F1JA 3ZE2B 3A9WA 3RS4A 3EZ6A 3QVJA 3ZWPA 3LJKA 5JS8A 3JD4A 3ZGLA 1S8OA 1L5SA 3HE3A 3BF8A 4EH1A 4YMLA 1M5RA 2DQKA 4M1SA 2IP1A 5SYAA 5HTOA 5KYVA 3FRIA 4DSJA 1GPBA 1T4BA 3O9ZA 4X00A 4JQSA 1QIEA 4GM1A 2FZLA 1GFWA 4CR7A 4B2YA 4KH0A 1N5LA 4IF6A 4OAPA 2Q41A 1SC1A 1XTUA 5ERYA 5HM8A 3DCYA 5ITVA 2AOXA 4RSHA 1V2HE 2PX4A 1CFJA 3TLEA 3VU9B 3LRPA 2FMPA 3SPXA 4NAHA 5CNIA 4M0DA 4EEYA 5JAUA 2NAFA 4IQWA 3OQHA 9ICIA 3OOJA 4MDYA 4MH0R 3S68A 4RH0A 3MR3A 4GW3A 3GEDA 4G3XA 4YDQA 2CNDA 3KLMX 5F98A 2BHNA 3EQZA 4MI3A 1F8XA 2ID7A 2BFFB 2G4CA 1WE2A 2QAJA 4CIYA 4L74A 3RADC 2AX4A 4JA0A 2F43B 4P08A 4XH9B 2OGWA 1SZPA 3BERA 1X80A 4MWBA 4R2XA 1M34B 3JWEA 4BX2A 1T9CA 3IKJA 4DCVA 4DILA 3EMVA 1A97A 3L7OA 2NUTB 5J2BA 4MUYA 2NT4A 1DV2A 3M1IA 1XLWA 5KUTA 4WLNA 1CEEA 5BP7A 2ODEA 4MVYA 1T5SA 2XY6A 1NXXA 2ZDGA 4Q1DA 5IBQA 2MJLA 2V03A 1G64A 2OQ2A 5AVOA 3W9YA 5KNBH 3QY9A 4EG0A 4M98A 1F3LA 3QKRA 2YXNA 3G8YA 2WD8A 4O63O 4C1NA 4DSZA 2VDVE 5CVTA 1UPAA 3QX3A 2V4RA 4TX1A 3ZZ1A 5T41A 1Z5VA 1HNWB 1V4VA 1HBJA 1VKJA 2ZRHA 4CM4A 5TC4A 4C3UA 5JCOC 5JSHA 4DJ5X 1IG3A 3ND8A 4XLLA 2V59A 1IIBA 4JX9A 4G8JA 5FOQA 3I6ZA 3D6MA 1BC5A 4MWEA 5B7PA 1NW3A 2JB9A 2ZTLA 4MV9A 4NEHB 4DCPA 1TAMA 5IZCC 4AQYB 3HJAA 3LSYA 2BKAA 2CCJA 1T8WA 5I9IA 3BS5A 2QBYB 1W52X 1B6SA 4QPCA 1NA5A 4AKTA 5HOEA 3MS7A 5L1IA 1A27A 5I45A 3CO5A 5I5GA 1OB5A 3JALB 3FNHA 1XA4A 5IH7A 3RGGA 2ZJ2A 5E1MA 3SC2B 4JWTA 4AJJA 2C9OA 3IUNA 2EU8A 2YRWA 2H9IA 4J2HA 2EX1A 1YDFA 9ICCA 1E4EB 4RIFA 4K8RB 4X92A 2O8NA 4U5QA 2FN7A 3VZQA 1X6VA 2P5UA 4F50A 1OYYA 4F8JA 3IAEA 3QE4A 5KFHA 2YWCA 3VVMA 5A4FS 3JAKB 2O8BA 2Z58A 2M1XA 3FJYA 3LDGA 4A7PA 5KFAA 5DBOA 2P3LA 3FUWA 3CF6R 3GFGA 5LYJA 1H22A 3RJTA 1WB5A 3OQBA 3KPJA 4HAVA 4M54A 3ODPA 4J7AA 2IUEA 3C3DA 4F56A 2BZFA 4LGVA 4XX1A 2D6FC 3NYWA 3EGDA 1Z63A 1KI9A 3EWIA 4LNAA 3DA8A 1PRYA 4ZYVA 2C77A 4US8A 2AG6A 1QRUA 1T4DA 3FGPA 1T9AA 3O4GA 4KUEA 4ZU6X 3VNSA 1FLAA 1U9CA 1FRQA 1KJQA 2Q3FA 1KORA 5COBA 4BNWA 5B3JC 1XD2B 1B0ZA 1GP2A 1JSCA 1M1YE 3F4KA 1Z6YA 4M0UA 4R6XA 1KJZA 3L8FA 3QW4B 4TLEA 3SYRA 5JSKA 1DC8A 3WYEA 1T8EA 2V7PA 4KFSA 5DTEA 2EAPA 3GU3A 1FJHA 2XRFA 3ZD9A 3P97A 1KS2A 5K0LA 3TB6A 3TK1A 1JIHA 4MLDA 4QHSA 1WY7A 3WL8A 4UB6U 1E58A 1E1QA 1FRNA 4HVLA 4R41A 4MROA 2IX9A 2OHJA 1RWVA 5B6PA 2WYOA 3KEMA 2XSZD 3RI3A 1FX1A 2R3SA 2KMDA 4R65A 4CNBA 2AXEA 1C7ZA 3KZMA 4CCYB 1W73A 3IE0A 1UBHS 2JKYA 2IUUA 3SJBA 2IVFA 4A92A 4F0JA 1YAJA 3JQBC 4CCAA 5JBIA 3W5CA 1BCSA 1TTQB 2HT6A 1G4UR 3OQIB 3D3EA 4QGGA 3TRHA 2W8BA 3CF4A 3SU8A 3H11B 3L7KA 4MHOA 3RFXA 4Q48A 1VLMA 2H18A 1DO0A 1KHTA 1KKMA 2POCA 2HHVA 2YWJA 4HWGA 2Q2NA 2VWHA 2NGRA 4WKOA 3DW3X 4ZEXA 3TZHA 3ZVKA 3SNHA 2G4LA 2IEIA 2P67A 1CUKA 3F47A 4HGNA 2FEXA 1USGA 2HIHA 5ALGA 2IV2X 4OM8A 3VR6H 1VZ3A 1SURA 5AXCA 5T3YA 4WHMA 4MSUA 4UASA 3LE8A 1WKCA 2HPHA 3EQ9A 5AKLA 3BZCA 1P2SA 3ROXA 3ZU3A 4ID3A 3L4JA 1XZJA 4MIEA 1XROA 1YBAA 4X1IB 3V2HA 5KFTA 3VMFA 1EX7A 4RULA 1K92A 1SB8A 3BIWA 1Y80A 4JWNA 3LFUA 4OJOA 4KGDA 4R9SA 1KEPA 3FMGA 1RRVA 4KVAA 4C78A 2K7FA 1T3NA 1TYZA 2B6HA 5KTTA 3CY6A 2RGYA 3UY4A 4O0IA 4OMDA 4K0RA 1KFBB 3E22A 1Z36A 3FBWA 3E1SA 1XNHA 4EELA 3PV0A 4ICIA 4WNYA 2CZCA 4ECEA 1R12A 4ONEA 1Z38A 2QE7D 4Q7KA 1WMAA 1WCYA 1DB3A 3QPWA 2XV1A 4W8OA 2O1XA 2HHUA 2OV6A 4BKPA 4IIJB 4O0LA 3ZJTA 4CFSA 1L5NA 3R09A 4RQ2A 3BZWA 3NNDA 2K4IA 3KPUA 1DEHA 2G17A 2GN6A 1BMTA 2JGIA 3HNOA 3ND7A 1UJ5A 3MIZA 1N3LA 4H1UA 4N6OA 2NV2B 3R5TA 4ZDJA 5DNYB 3AERB 4TUPA 3H87A 3KKLA 3GCZA 3MJRA 2WF5A 1Z88A 2RBEA 1U3TA 4QC2A 4GX2A 1S0VA 4WNCA 1ULTA 4XGIA 5JSZA 3B8EA 1VMDA 2NN3C 5DHQA 3DVAA 4CV1A 4WESB 1GTG1 1KAOA 4IHKA 9ICMA 1SN7A 1PJQA 5BWOA 1UJNA 1UKEA 1Z0DA 3KU1A 4IX9A 4ZVNA 4JU9A 4X97A 5KTMA 4DNPA 2V0GA 2XF2A 2JV3A 3UMCA 2G63A 2XH8A 4B0OA 4ZJZA 5LZ9A 1N56A 1YS6A 4LZWA 4P34A 2EF0A 2OUKA 4QATA 2GFQA 3V7NA 5LZ5A 1A9XB 2G06A 2FLWA 2PL3A 2WVJA 2WTBA 4OXRA 4E6PA 1J2NA 1EQAA 1QYIA 1L5HA 5C8XA 5K6AA 4WUTA 5B53A 5KG2A 1Q1QA 1DX9A 2CDRA 3CCBA 1GYQA 3CRQA 1CJKC 3KKQA 3C3YA 3L7CA 5JCOA 1JDVA 5EVJA 3NHFA 4YA6A 5HIJA 4ETIA 3Q5DA 2VHEA 1QFZA 4ZVOA 1NK5A 8ICKA 3E05A 1S2OA 3HBMA 4B7ZA 4AYXA 5KSWB 3MHTA 3DFMA 1DMRA 2YHIA 1USVA 4LE2A 4RKYA 1MN8A 1QGZA 3KBOA 3EIHA 3W04A 4BMSA 3HWRA 2R96A 2XQJA 3VH2A 5JMTA 4MP8A 4AZ0B 4L3WA 1NW6A 4GNRA 3T7KA 2LV8A 3KAKA 3MTBA 1KMHA 4OLBA 3HW8A 3NHBA 1RWQA 1IN4A 1QMGA 1YOBA 2AHOA 3IKLA 3OD5A 3RR7A 2FR8A 3DWGA 3ZGVA 4OYYA 1JQ3A 3HKBB 3MIIA 3RVBA 1FFVA 4YY3B 4E4TA 2ZYIA 4UUBA 2WFLB 4QOGA 5IABA 1SRQA 2N9UA 2I7VA 3PL5A 1CUSA 4QOIA 4A82A 1WZ2A 3G59A 1Z4MA 3TQOA 3QSGA 2XY7A 2B8WA 3X2EA 3LY8A 3O1IC 3UV3A 4MYHA 3NH9A 3VX3A 3HKZF 2OZPA 5EUMA 1AGNA 1JG1A 2JZNA 5DYTA 1JE0A 2ZRIA 3HU2A 4EDFA 3ZHRA 3DDHA 1XHFA 2H31A 5EZSA 4O33A 1GDTA 3X2FA 5DYNA 1WCXA 3DEIA 2GBFA 4QZHA 4L5CA 3W34A 1H3EA 1M1YB 3CZAA 3U09A 3W4IA 1G9SA 1KEZA 3CRXA 2IQIA 3NM6B 1U8EA 2XY4A 3I23A 4KXNA 4JKIA 1XVIA 4WXRA 3KQVA 2XT0A 1SVWA 1JPUA 2BM0A 1UKBA 3L1VA 3AZPA 4Q16A 4YAFA 5TARA 1ST2A 1Z7WA 3OIVA 3SJAA 4Y6QA 4NLGA 4RHXA 8LDHA 3EVEA 4DL5A 3BQ7A 1ZEJA 3H1TA 5KOIA 3GXOA 4M6WA 2DGDA 1XJWA 4B9NA 1EQUA 1J8DA 4BGUA 2X23A 1X74A 3WIDA 2BKXA 3SIPA 1IQ0A 3R5HA 5CEEA 2B0JA 3SFTA 4EHJA 5DISB 3MT8A 2Y71A 2HIAA 4MVJP 1R3UA 2QN1A 1E9SA 2J6SA 4MCIA 4Z51A 3I37X 3GMSA 4FFLA 2RIRA 3KUXA 4HDMB 3WDLA 2YMQA 4BJ3A 2X3YA 3G68A 4JYMA 2WF7A 4FOOA 5DCYA 2Q5EA 3I1IA 4HD8A 4MYUA 3E48A 1CRZA 2GF0A 1YZ3A 3ECCA 4KO8A 4LI3X 3WLOA 3DHEA 4YIHA 8ICCA 1DK2A 3SF8B 5U1PA 4OP3A 2ZAMA 3WRVA 1MFPA 1RJ9B 4KQJA 4LYEA 3K0CC 2WZBA 3EF1A 4XB6B 5IN4A 2NO5A 2JW5A 1A0OA 3ETLA 1WAMA 2JEFA 1J33A 2FZEA 4C8LA 1LDBA 2FLKA 3LY9A 3NOOA 1EH5A 3VR6A 3GDOA 3QPVA 4KPGA 1OX4B 3CG4A 3IPRA 3KOWA 5CLJA 3RR8A 4Y9SA 3HRDD 1FSSA 4EY7A 1H38A 1KDRA 4D9MA 1M5UA 5B4UA 5LQNA 3L7YA 4FDMA 4LYHA 1LRLA 2Z2YA 3G5UA 4RHEA 4G1UC 4UNPA 4GYYA 3SSAA 4D8WA 1D0IA 2O7RA 4HEHA 1R10A 3C6QA 5JCXA 1JI0A 2I22A 2GK3A 3T4UA 2G0NA 2RLTA 3USZA 4QTZA 3CJQA 1TTHA 1VL8A 3WJ1A 1C8BA 1IBSA 4KE9A 4ZDIA 2P5YA 1O4WA 2VT7A 3EY9A 6CHYA 1P2TA 4KXLA 2HY7A 1YE8A 2P78A 1H1LA 1OV4A 4RS3A 1I33A 1O5TA 3FPLA 5GM1A 1H6CA 3KTOA 3EZNA 1ZQIA 5DRTA 5BO5A 5KMGB 5A6SB 5KYGA 1KI1A 3KEQA 2IDKA 4OHXA 4DANA 2X76A 4B80A 5DKFA 2L19A 4BFVA 5IM4A 4MDHA 2ZIVB 1XTPA 1ZGCA 3OCWA 1FFYA 4H2DA 2SKDA 1QC5A 4P7JA 2L2QA 4WFQA 3T5JA 1HDOA 2C7GA 1ECGA 1ZM2A 1GT6A 2FQYA 3IDOA 3PVXA 3KDSE 3ZWKA 1AA9A 3NBAA 1EZ4A 1N92A 3HHPA 4NMMA 4ZYLA 4N54A 2OFPA 3HDVA 4D42A 2E3JA 2IXEA 1IN5A 3I4CA 1EFCA 1QK3A 4GPEA 3RVMA 4DMLA 2PKQP 1K7EB 2PFPA 3ZU6A 4RQAA 3Q98A 3DHVA 2BEWB 4QPZA 3T12A 4C4TA 2PLNA 2WT4A 3HKDA 3K30A 2VP2A 3MXOA 3KOUA 1ODTC 3LDAA 3OZIA 4IIXA 4G41A 4M3NA 4DLUA 5JOQA 1I94B 5C52B 1ORVA 4PSAA 1XTKA 1QIMA 3NCTA 5LP6A 2Q0XA 3B3AA 4JJ8A 1D5CA 1QO9A 3TI0A 3PQ3A 4AURA 3B1WA 3EBPA 4LXTA 2ST1A 5KSPA 5A03A 5LDHA 3J7TA 3WNZA 3WWYA 1FP4B 2XAUA 1J1IA 4CI0B 1V6CA 3KPYA 1M2HA 3D2LA 1VBNA 5FUMA 3S2SA 4ZCQA 2FEKA 1AUOA 2F1OA 4CKCB 2FR0A 4YIKA 3T3GA 2Y99A 3NHJA 5BSUA 2K2QB 3CRMA 3OTHA 3F3YA 2O2GA 1JJVA 1Q7EA 4RXUA 5FB3A 3SZMA 4ZJUA 1CP3A 1OLUB 3Q9LA 4PYQA 5IWCA 4RYDA 4IEEA 4E31A 4EHIA 4MF2A 2ETVA 1GSOA 1EWKA 2ZJBA 1GL9B 2I2DA 3TMYA 4E09A 3PITA 5NLLA 4Z53A 1D4ZA 1KIFA 2BBWA 3P4YA 2XO7A 1X7HA 1M83A 4MWTA 3OTOB 1IDOA 1ISIA 3CU5A 1CUBA 1NUSA 2KPOA 4YCXA 2M6RA 3KU4A 1D3AA 3DT8A 3MINA 3ROFA 1KEKA 4X8HA 1Y8CA 2BR3A 5KFIA 2RFLA 1HUQA 3HS3A 4XGNA 3I52A 3ORSA 4JQCA 3I9OA 4OHOA 2XKAA 1M0WA 1G8FA 4XARA 1GZDA 3SDZA 4B2LA 2OHIA 1N8SA 4CMEA 4EZ6A 3EGWA 4YWJA 1UOEA 3FWNA 3JVVA 2ZRCA 3ZKWA 4GZ6A 1K27A 4HQ6A 1U5BB 1KSPA 1W85B 1SCQA 3CXRA 1A6SA 1O6GA 3COVA 3H40A 2PXXA 3H6GA 3KEFA 3L8MA 3MFYA 3PDIB 4HDSA 3JTMA 4N1AA 4TS4A 5ESRA 3SEQA 4D98A 4FZLA 3DMTC 3DMGA 4JJ7A 3T7CA 3Q0IA 4RTQA 2HBKA 3CF2A 5TEWA 1Q19A 4IDDA 1ZRHA 4WBNA 5C8YB 2JASA 1BXRB 2ZUTA 4K9OA 2R6CA 3UC5A 1WCWA 4MUGA 4URZR 2VXBA 2H5EA 1RE0A 3MSCA 5DN9A 3GG9A 3JPWA 3FYTA 3ZVNA 3OX3A 3PR3A 4YP9A 1K5HA 4ARAA 2ZUFA 4LA4A 4E2XA 4I1SA 5IN5A 5IPFA 3IDSA 2EJBA 4EX7A 2HMSA 3CZMA 4L8YA 1ZQOA 3JQAD 1SPXA 3QE0A 3R3JA 3CNNA 4MIOA 4TV8F 5IJXA 1CQJA 4IDQA 1LPMA 4O4IF 1CE8B 3GLHE 4CZ2A 2C7OA 1HYHA 3P2OA 4NAVA 2VKQA 1BQ4A 4NBTA 1CDDA 1KDVA 5JDIC 1XZPA 1ZRMA 2QKYA 3BSWA 1VLJA 3T5MA 5T57A 4DBVO 2RHOA 3E9DA 4KFUA 3GELA 4E51A 2Y0SF 5BOSA 1OKKD 2QPTA 4ISBA 3T3FA 2G1KA 1J06A 2CEAA 3GFSA 3RFUA 1RAGA 3UBTA 3H2KA 1HQDA 4ESVA 3NC0C 4MCAA 1ESNA 1MUUA 4QSMA 1N36B 4BNTA 4G56A 2WI8A 1U0TA 2ZYWX 4I4TB 1DP4A 4NBKA 1VI5A 2OCPA 4X6XA 4HPWA 3A9RA 3WIOA 4D3FA 2OG1A 2YBDA 4RETA 2VS1A 1KQFA 3PQCA 1IOWA 3JY6A 4DDMA 3KYDA 4E5VA 3AVUA 3PFWO 3QYAA 4KQIA 4I3GA 2PTHA 4JI8B 2OUIA 3FFWA 1Z28A 4RFLA 4RE6A 3PJDA 4RHCA 4LF9B 4OJPA 4HL6A 2JL1A 2QP4A 1Y5LA 3QX8A 2WMDA 1SXIA 3WB0A 5LMCA 2QAGA 5E6SB 2XQGA 4AO7A 1X6JA 1NKVA 3A32A 3A2LA 3BWDD 3DF9A 1QANA 2AVDA 1RM6C 2JARA 2O05A 4ZAXA 2XT6A 2EX4A 1K7FB 4D9BA 2P2GA 1G0OA 2VTDA 4N65A 5J1TB 5K3DA 5JDCA 1E5QA 1PD0A 1VCIA 3RS0A 5FWAA 3C3WA 2HA4A 3P9YA 4PH5A 3R7FA 3ZUGA 4Q8EA 2DBQA 1ZJMA 2BUBA 3UJ3X 4WZBE 4D41A 5BN4B 2A30A 2GZMA 4FOTA 2OA0A 2ZXEA 3WMEA 3SYKA 1Q7CA 4ZJYA 2A78A 1JEEA 1QO7A 4YI3A 5DOVA 1U3DA 8ICRA 2F9MA 3P2MA 4W5HA 4ZFNA 3AU2A 2CMFA 1DQZA 3ZJYA 3JATB 5T8KC 2O0JA 2YV1A 2WMOB 1ZMOA 3K92A 4PZDA 4J0FA 1EFPB 4RZ2A 4XXHA 4TMFA 4YWHA 3H9CA 1H93A 5KJEA 5K0CA 3KJFA 3RPEA 3IM1A 1ZNQO 3IT0A 1GRQA 4HY3A 4JJAA 3UXYA 3OD1A 1M1NA 3G2JA 3N59A 5G1OA 3GPCA 4CEHA 4HUJA 1CY2A 1JZSA 4F5YA 4P54A 1QIFA 3E9ZA 4ARZA 1ZS9A 6REQA 2CXXA 4A23A 4DR6B 1NBOA 3B7PA 4KN6A 5KYNA 1D2RA 1TUEA 1SBIA 1ZVQA 4JLBA 1XWWA