3S6JA

The crystal structure of a hydrolase from pseudomonas syringae
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
220
structure length
216
Chain Sequence
PQTSFIFDLDGTLTDSVYQNVAAWKEALDAENIPLAMWRIHRKIGMSGGLMLKSLSREITDEQAERLSEKHAQAYERLQHQIIALPGAVELLETLDKENLKWCIATSGGIDTATINLKALKLDINKINIVTRDDVSYGKPDPDLFLAAAKKIGAPIDECLVIGDAIWDMLAARRCKATGVGLLSGGYDIGELERAGALRVYEDPLDLLNHLDEIAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Hydrolase, haloacid dehalogenase-like family
publication title The crystal structure of a hydrolase from Pseudomonas syringae
rcsb
source organism Pseudomonas syringae pv. tomato
total genus 76
structure length 216
sequence length 220
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3s6jA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3s6jA01
1XVIA 2ZXEA 2WF7A 2W4MA 2IOFK 1Q92A 5IT0A 3ZU6A 5AVZA 5AVRA 1RLMA 4HGRA 3ZWDA 3MC1A 2WF8A 3PCTA 3QGMA 5AKXA 2Q4RA 1Z4JA 4EZEA 2O9JA 3MMZA 3B8EA 1Z4MA 2P11A 4XE5A 4AS3A 2HCFA 2OBBA 3AR7A 1KYTA 4J2TA 1FEZA 3N07A 3AR3A 1L8LA 4BBJA 4OCZA 1K1EA 2HOQA 1VFPA 3A1CA 3A3YA 3E81A 4KX5A 4Y2QA 1Z4KA 4UASA 4RETA 3I28A 4I9FA 3QXGA 1QQ6A 3J7TA 3RFUA 2O2XA 3IRUA 5AKHA 1RRCA 3U26A 2C8KA 1TE2A 3KZXA 1ZD2P 4OFZA 2WHEA 2JAUA 5AW3A 3TLMA 1T5SA 5AKZA 1X42A 2G80A 2WM8A 4CF4A 4CNQA 3SKXA 2JARA 5AK3A 1Z4IA 5AI4A 2P9JA 3WGVA 3L0YA 3DDHA 1ZS9A 4AP9A 4Y2SA 3L5KA 1RDFA 1QQ5A 3W5DA 1T5TA 4Y2RA 2GO7A 3UMCA 3SMVA 4YIHA 1L7MA 2JGAA 4NFLA 5ALJA 3ET4A 2AUTA 3WKAA 1YNSA 4FE3A 1RKUA 3OCUA 3OCVA 2FPUA 4H1WA 4Y3UA 4EENA 5ALOA 5AW7A 2WF6A 4CF5A 3KBBA 2AH5A 3WKEA 4HGOA 2YN4A 2HO4A 1F5SA 3AR9A 2RARA 3L7YA 5JJBA 1U02A 2YMLA 2EARA 3I1YA 4HAIA 5AVYA 3WKCA 2YFYA 5ALLA 2HF2A 1IWOA 1U7PA 4EX6A 1PW5A 4IG4A 2YJ5A 2HI0A 1T9ZA 3PGLA 4Y2PA 4EEKA 1U7OA 3L8HA 4NV0A 5FP0A 4EX7A 3UMGA 3QU2A 3QU7A 4DWOA 4C4SA 3P96A 4UU0A 1RKQA 4AS2A 5AESA 4J03A 2CN1A 2VKQA 3F9RA 4UAUA 3DV9A 3U13A 5AI5A 3ONNA 4YIKA 3NALA 1TA0A 5AW5A 1ZD4A 3ZVNA 3WGUA 5ALWA 1VJ5A 3QX7A 3QUTA 4C4TA 5ALYA 3QU9A 3BA6A 1RLOA 1QH9A 5ALPA 1CR6A 4NABA 1XPJA 3WKDA 5ALEA 2IOFA 3WK6A 2ZG6A 4OHFA 1SWVA 2W11A 1ZJJA 3QYPA 3N1UA 3OCXA 3M1YA 2G0AA 4UMDA 2YY6A 3QU4A 1L7NA 3A1EA 5AI6A 2G06A 4UATA 2WF5A 4BX3A 4BNDA 1L8OA 5ALXA 4KX3A 4FFDA 2B8EA 5AVVA 4YCNA 5AW9A 1Z4LA 5AM1A 3NASA 4Y2UA 5AVSA 2YMPA 3FM9A 1N9KA 1O03A 4YCMA 4KN8A 2HF7A 1LTQA 2G09A 2GFHA 5AVTA 5ALHA 1CQZA 2IYEA 3GYGA 3EF1A 2P69A 4NWIA 3EPRA 5AM4A 3U7GA 3ET5A 2BDEA 2ZOSA 3HLTA 2R8EA 1N8NA 5AVUA 3AR5A 4KNVA 2AMYA 2HEGA 2B0CA 3OCWA 4O8CA 5ALIA 4FYPA 1J8DA 3ZWKA 3NANA 3ZI4A 3WK5A 2YJ6A 3SHQA 5AK5A 4DFDA 5T41A 5AW6A 3L1UA 4BKMA 2NO4A 5AI8A 2I54A 2YJ4A 2I55A 1JUDA 2HSZA 3AR2A 5AW8A 2D2VA 2C4NA 5ALUA 2R8YA 3N28A 4QQFA 2FI1A 5E0OA 1QYIA 3L8GA 2QLTA 5ALNA 2ZBGA 4UAVA 3BWVA 2BDUA 1Z4NA 2B1RA 4ZEVA 3R4CA 5AKGA 3EWIA 4F71A 2FUCA 4XPZA 4BX2A 2C8LA 2OYCA 1QQ7A 4DCCA 4UM7A 3AR6A 4ZEWA 1AQ6A 1Q91A 1Z4PX 3WK9A 3CNHA 5ALKA 4MUMA 4BEVA 3NIWA 1ZRMA 5AKYA 3UM9A 1U2SA 3ZTYA 3L0CA 2GMWA 2Q5EA 4NAVA 4DW8A 3B9RA 3U19A 2R8XA 1NRWA 4BNDB 3ZVLA 3KDPA 3S6JA 2B82A 3K1ZA 3SF0A 4UMFA 2EAUA 4B6JA 4G63A 1SU4A 4HGQA 5AIAA 4C4RA 4E88A 2DQSA 3NUQA 5AW0A 1O08A 4L57A 2PKEA 3VAYA 3U7FB 1YJ5A 4Y2JA 3ZX4A 3KC2A 2I34A 3QNMA 2AGVA 4GXTA 2WF9A 3W5CA 3M9LA 5AKLA 2CFTA 1YS9A 1WR8A 3OCZA 2FPRA 5ALQA 5AI9A 2B8JA 2MU2A 1ZD3A 4JB3A 4ZEXA 4EELA 3DAOA 3SD7A 2FDRA 1L6RA 2MSNA 2B1QA 2IOHA 1Z5UA 2JAWA 2PR7A 2I33A 4YH1A 4Y2XA 5AW2A 4UMEA 3W5BA 1SWWA 5AW4A 3E58A 4CE6A 2FEAA 3KD3A 5ALFA 1L7OA 3ZX5A 5AIBA 1MH9A 4F72A 3ZTWA 5AKEA 1RQNA 1NNLA 4UM5A 3SKYA 3WK8A 3OCYA 3AR4A 2C88A 5AK4A 1TJ3A 3U7EB 4UU1A 2BY4A 3B9BA 3ZVMA 4BEWA 3L0BA 1NF2A 3L8EA 1WPGA 2X4DA 5AKKA 1RMQA 5AVXA 2I6XA 4G9BA 1Z4OA 4MWOA 2YMMA 1XP5A 5AM3A 4BYGA 5ALVA 5AM2A 1EK1A 2R8ZA 1LVHA 2YBDA 5AKIA 3FPSA 2FUEA 2GHTA 4UMVA 1YMQA 1ZD5A 3ZW7A 1VJRA 3N5KA 3A1DA 3ZUPA 3QLEA 2WFAA 3OTQA 4Y2TA 4HYTA 5ALDA 2PQ0A 3ED5A 2FPXA 3PDWA 2RAVA 5ALTA 1RMTA 1YDFA 4RESA 2P27A 1S8OA 2NYVA 2RB5A 2CFSA 2G1AA 1TJ4A 5AVWA 5AK6A 5ALMA 1ZRNA 3I76A 3IJ5A 5AM0A 4L6CA 5A3QA 2W43A 4KNWA 4GIBA 2HX1A 3IB6A 2G07A 3MPOA 1RMYA 3N8GA 3U7HB 3FVVA 1WZCA 5ALSA 2YMQA 3W5AA 3QUBA 2EATA 2Q4TA 3R9KA 3I6BA 3QUQA 5AICA 4HGNA 5ALRA 2JAOA 3QUCA 3FPBA 3PGVA 3WKBA 3FGOA 5A3RA 3NRJA 3WK4A 5AKJA 3MN1A 1RQLA 3L8FA 4KYTA 1RC8A 2MU1A 2OM6A 1Z5GA 3OPXA 1RKVA 1Z88A 2OA0A 2HDOA 2B30A 1RLTA 5IS2A 5ALGA 1WVIA 4OD0A 2I7DA 3FZQA 4IFTA 4QJBA 4Y2YA 4XQ0A 2ZBDA 4XOUA 5AW1A 2FPWA 2CFRA 5A3SA 4YGYA 2G08A 4L6AA 2IA5A 3HYCA 5AI0A 2C9MA 5IT4A 4UW9A 3KOOA 1Z4QA 3AR8A 3SLRA 5ALZA 2NO5A 1TJ5A 2FPSA 4HGPA 3WK7A 1U2TA 2ZBEA 4YCLA 1J97A 2ODAA 2RBKA 4PNHA 5AVQA 3L1VA 4UARA 2YJ3A 2ZBFA 4CF3A 3QU5A 1S2OA 3CZ4A 5AM5A 3D6JA 3R09A 4JDPA 4I9GA 3E84A 5AHXA 1YV9A 1ZOLA 3ESRA 1RPZA 3E8MA 3EF0A 1Y8AA 2QYHA 3DNPA 3UMBA 3ESQA 1L7PA 4BX0A 3NAMA 2HHLA 4Y2VA 1EK2A 3RF6A 2GHQA
chains in the Genus database with same CATH superfamily
1IJBA 3AVQA 4EW3A 2E8OA 5DBCA 2GHIA 1QXSA 4J1NA 4MA0A 4DRZA 5LOVF 1OB5A 3OLVA 1ZNQO 4GO1A 2OO5C 4OBEA 4MWGA 2PKRA 5JXGA 2J5RA 1UC5B 3AEZA 2JZNA 2ISPA 4O5EA 1W29A 4B3CA 2VNKA 4TRMA 2JIMA 1MT3A 1QZTA 2UVPB 2W9CB 3GCGA 1PG0A 5CP8A 2OPBA 2JZCA 4MO9A 2W0MA 2AG0A 1A2OA 1G3RA 4ZO4A 4CF4A 3MR2A 1NTOA 1T5IA 3OBBA 8ATCA 4AAYA 4D25A 3DG9A 1LY1A 1M2KA 5TZVA 2VJQA 1TM7E 2IWHA 5KL8B 4WVLA 4C80A 4MDFA 1ZQTA 3UATA 1UJ6A 2UYQA 3K8OE 3OEED 2WILA 2OCXA 1HETA 3I64A 4RK1A 2BVNA 2NSJA 4B47A 5FP0A 1QX4A 4MKXA 3OKFA 1T8PA 4NLZA 1QH8A 3CVVA 4YP6A 3KSBC 1N9GB 1VI5A 4NFYA 3MQFA 8ICHA 1R10A 3RJJA 4B87A 2B21A 1IQ0A 3MHTA 1L5YA 1GGVA 1K88A 3RTGA 1MC1A 2ZYTX 5KVCA 3FTNA 3JQGA 4IIGA 1V16B 1LTQA 4NCNA 4MYDA 2F2TA 1OZ0A 1NZDA 1YB2A 2O5RA 5C8YF 5K3SA 4H6XA 4L27A 2J30A 4ZVQA 3PI7A 3CY6A 4B2PA 2WWYA 2HSZA 4F3YA 3OQPA 1W8IA 3HO1A 1EAYA 3JARB 1LKYB 3TE6A 5JFGA 3OF3A 5FUVA 3HJUA 5KT7A 5DULA 3AFHA 1NF9A 3G8CA 4JI1B 1J1UA 2Y93A 3RC9A 5F35A 2UUCB 3SY8A 3VFDA 3K94A 1SG0A 4ZC1A 1ZH0A 5DI3B 3L6BA 1AXRA 4DIOA 4H08A 5FL7D 5KFDA 2GYWA 3Q98A 3AFNA 3LA8A 1A7UA 4TKVB 3AU2A 4PO3X 3IBCA 1TZBA 4L57A 1Z68A 4KKXB 1Q20A 3ACDA 5EAIA 4XTRA 1DFGA 4JCCA 1R15A 2XCPA 1S0VA 1RC1A 3PVZA 2ZIFA 4IUCS 3SQNA 1FFXB 2Z30A 3AERA 5L8VA 1ZX1A 2AR7A 1NBMD 3BVPA 1AVTA 2ZBQA 2A2ZA 4XXHA 2Z8YM 3TTVA 2H3IA 4HSEA 3P5BA 1QIGA 2R1VA 1AZWA 5E1OA 4O1HA 4FEYA 5C1OA 3TI9A 3OZEA 2ASVA 3HL0A 4BWFB 5C7LO 4LC1A 4CR6A 1NVVR 3S3TA 2W55A 1CEZA 2C29D 2IF0A 1NBHA 1J9GA 1GTZA 3S5JA 2CV2A 1P5FA 4YQYA 1VHLA 5JALA 1MF7A 3FWKA 1ZSNA 1XLTC 4N7JA 3S99A 4D0GA 1Z45A 3KUCA 4U39A 3BIFA 1F1BA 2RB5A 4TTSA 1FFCA 1SY7A 1ONSA 3GJZA 3EBOA 4HX9A 2JASA 2C5EA 2ZBUA 2ILVA 3W6PA 4CG3A 3C3XA 2FEKA 3DV0A 3T9AA 5HRUA 2MSKA 1EWRA 4DYDA 3ETEA 3UJNA 3WLIA 2J3QA 3TD2A 4JLWA 2P66A 4IKOA 1MV8A 3FOFC 3HA7A 4PTYA 3OCJA 5ELMA 2P3LA 1KYXA 3AONB 2R18A 2GKSA 3UHFA 3KJGA 1P5JA 5KVQA 3WWZA 1MX3A 3IQZA 5AQ1A 1K6EA 3DXYA 4UVDA 1AGRA 3W8NA 1LNSA 2EX1A 4OIMA 1VCMA 1YR9A 2W3RA 4HS4A 3VGPA 2SHKA 1E9CA 3OG9A 1FTGA 1V1MA 3FYUB 3M6VA 2DQKA 5BY2A 4GVPA 1VYTA 3RS0A 3GP8A 5IKEA 1RWWA 3JPTA 4Y18A 5DM70 2QARB 1L3BA 3U4DA 2JIDA 3UB3A 5KG7A 2P11A 4Q45A 5LXTB 3LW8A 4NYMQ 3OJXA 2H92A 1EMDA 3KQHA 3E1SA 4NONA 5GONB 3C7DB 5KB3A 2GLEA 4I9FA 3B3JA 2I22A 2JD0A 1JG6A 2VPWA 2I3BA 1XTJA 3L06A 4G0OA 3PPXA 2EJBA 3R5JA 4PR3A 2PZMA 3D0OA 3I83A 4G85A 3I01A 4BVHA 4DLYA 1X8XA 4ER5A 1TO6A 1GUFA 4LJYA 4OH1A 2PKQP 5AVKA 3OMXA 2XVYA 2UVRA 2WQ7A 4JBWA 2ATCA 2HM7A 4MX8A 2X9NA 3W2FA 1MAUA 4PINA 1JAYA 2YMLA 1UBMS 2MHCA 3P9RA 1WPXA 5EQDA 2IUEA 2BZFA 2C58A 2PK3A 4LF5B 1W88B 2D13A 2HI0A 5TR9A 3IAS1 4ZVVA 4HB0A 2FMUA 3ZE6A 2HBQA 4J7AA 3U0BA 1WTCA 4H4EA 3D7MA 2V7GA 3OCCA 4WUTA 1T2AA 5H0IA 4QVIA 1ZUD1 5ALEA 2IOFA 3WK6A 4C0JA 3WICA 1I5RA 5GVRA 1W6RA 3CW9A 4KQEA 4BLVA 4UATA 1JZSA 2VCEA 4KO8A 3VI3B 2CVQA 2G7ZA 3B0YA 3IC5A 3TUZC 2V7QD 2CNDA 3Q40A 4TWIA 1UJBA 2ONCA 3NVMB 1T1JA 3W5SA 3M8SA 8ICTA 3LZCA 2X0KA 5CVDA 1L5UA 1JIXA 3OKAA 1NXSA 4FS2A 2LWIA 3D4BA 4RQAA 4DQVA 1Y4ZA 2IEGA 2Q1TA 3I9NA 5KT5A 3I0ZA 4D4JA 1FF9A 1NU6A 4ZIRA 3RV3A 2F2AB 3ZNOA 1RRKA 3JPQA 1LI4A 1GNVA 1SK9A 1PSZA 3MIZA 1R6UA 4HZIA 4E21A 1GCIA 3VO1A 5FUYA 1R8JA 5BR1A 3UA3A 2O8VA 1EM8A 1BDJA 2W9BB 4LHYA 4W6QA 3LDFA 1T4MA 5JC8A 2MMGA 1Z6AA 3ADKA 2NU6B 4KG7A 1P0MA 4B5LA 1IZ0A 5JUMA 3AB8A 4ND7A 3N7UA 2YCBA 3R5XA 1SOWA 4G63A 1J5EB 4C4RA 2GFIA 1JEOA 5EWJA 1NRJB 3CPJB 3C2KA 3UV7A 4R1PA 3SVTA 3IEXA 1KMHA 3D31A 4K9LA 4P3KA 1M72A 4GXRA 1LB2B 4CKWB 4FQ7A 4UNRA 3IA2A 4M9GA 1XVLA 3D54D 1YJ8A 4ZMSA 2ZRKA 3M9OB 3AR4A 4G0QA 4HDKB 4ZJPA 4DUZB 2Z2JA 3J81A 4OGGA 1QCDA 4LVNA 5DM1A 2BFNA 2YJGA 3GJTA 4LF4B 3EZYA 1YBAA 3WDKA 2CHFA 4H7PA 1WDLA 2HMYB 2QJOA 1R9MA 2FWMX 4XCVA 1QV7A 1NZBA 4MV6A 2LGJA 3M6LA 1EK5A 4W1SA 5KX5F 2H4JA 1X7HA 4ER3A 5AVWA 3U3ZA 1CEXA 4HEJA 3OJFA 3FVVA 2PBRA 5F64A 2I91A 4WA8A 1EFTA 4G25A 5FPPA 3NOVA 5COQA 4B6FA 3F8SA 4D9KA 1U8AA 2QDKA 2X77A 2JCXA 2WVHA 1XRLA 4N40A 1SBYA 4DRYA 3O8OB 1DS6A 5THQA 1LDMA 1XZ8A 2YXBA 5I9IA 2GYUA 2H4XA 3TLAA 2YQ4A 1HL7A 1QTNA 3GUCA 3KG2A 4DS4A 3P9IA 4BO4A 3WV4A 4QEKA 3OZDA 1VL2A 3JYNA 1SVKA 3GAFA 4DV0B 2C2RA 3QXHA 4O3PA 1G8YA 3K15A 3MWEB 2I1WA 4BMNA 3HY6A 3FLEA 5D51S 2QLNA 4HGRA 4E70A 2WF8A 3TLGA 4J9SA 5FTLA 5B3LA 5EJ9A 1G9XA 5CDFA 1L5SA 2ZYAA 5JXWA 2BFOA 3L6EA 1XTUA 4JV2A 1USGA 4EOGA 2DPGA 3CX3A 2Y0SC 3I3OA 3FDZB 4JMPA 4XB6B 2HCTA 2ACWA 4F4ZA 3HCEA 4DQKA 3AHGA 1KAGA 4F46A 4HN4B 1DO2A 4B8WA 2HU7A 2DSNA 2RK3A 1T5TA 3RADC 4Q05A 1SB8A 1CZHA 5L45A 4XDYA 1RKUA 4IFIA 5EZYB 1CG6A 4UVEA 9ICHA 3KQPA 4XQCA 5GOZA 3KQSA 5KFLA 3AP3A 1KGDA 5FLEX 4RE5A 2C31A 3T0IA 2YYSA 1W6UA 5EEGA 4MV8A 4TSFD 1BPXA 4Z7NB 3K6SA 3FVQA 4BGDA 4ARCA 1G7TA 4MOWA 4LQCA 5J2EA 1OROA 4AMBA 5ELXA 5HKLA 3UNXA 1ETHA 1YGYA 1WD5A 3UUWA 4L9SA 3ZHRA 4K3VA 1IB6A 4UNSA 3JZMA 3VR6D 4YLGA 1KVSA 3K4HA 2ZSFA 4MZXA 4D97A 2XUQA 5IJ9B 1RI1A 4K86A 2GZRA 4CV1A 1LFAA 2AUMA 4HQRA 2HQSA 4D3FA 2Z56A 3GCDA 2AJ8A 2J85A 3F5FA 1E5XA 4CKEA 1OZFA 2ZSHA 1PR2A 4P7GA 2Q0SA 2HWUA 1H0SA 2UZ4A 2CLHB 2VUSA 2C2XA 1BNOA 5B2ZA 5DTMA 3OQ1A 3N58A 1UBJS 4WCFC 2Z4SA 1NJGA 1QTQA 4PC6A 3BZUA 2VJMB 4MQEA 5JCZA 5FULA 3EGWA 4Q9DA 5SYNA 5DN9A 4RZ2A 1JKJA 1QIJA 1L3TA 4D26A 2W2KA 1L5FA 1WOMA 1X1TA 2H4HA 3DULA 1G21E 3PV0A 4JLKA 1ZMTA 4KPGA 1HI9A 2WB4A 4UMFA 2NXNA 3AEYA 4N6OA 2XTNA 4P5DA 2EHDA 3KR1A 5HUHA 2ERXA 2QZ9A 4D3DA 3AIMA 4XUGB 1TMKA 3SXPA 1V4VA 4GMDA 2WOOA 1F5NA 4KN9S 5IBCA 3IPCA 3HYRA 4K03A 5GVSA 1WCXA 1US8B 5BMVF 2CLEB 3PUIA 4C7OB 1DIRA 3AW8A 3FOBA 1ATZA 4YAGA 3GAMA 1TRHA 3IQHX 1KVQA 4D6PA 1L7DA 1EWVA 3N7PD 3PDUA 3ZEIA 4YCAA 1CT9A 5TQJA 3H42B 2H9AA 2R4QA 3H7IA 1PQWA 2X0DA 3CX8A 4D7AA 4JT8A 3ETLA 4XDZA 1JXOA 1N92A 2GRUA 4E5UA 1CUGA 2FR1A 3O94A 1EGVB 3MVEA 2WM9B 4WZBA 4EUNA 1F3LA 1R8SA 3Q1LA 3JWHA 4KRXA 4MMXB 2HIHA 1NQWA 1RLIA 5ILGA 1DEXA 1B41A 4HDRA 3UGTA 3WL5A 5FD8A 4FK8A 2C42A 2Y92A 4NS1A 3RHZA 4BV8A 2XT0A 3O8RA 1QH0A 5ALMA 2IDJA 4L6CA 4JQYA 2JC3A 3ZWBA 4MS3B 3G9QA 3FPHA 4ACAA 1YT5A 3VHLB 3R7LA 1V11A 4C04A 2JIQA 4I1PA 3VSAA 5H3CA 1F8XA 1QMGA 3RODA 1I13A 4E6PA 1Y3BE 1SZHA 2KD1A 2ZI9A 3OPXA 4WJLA 3BCRA 1B2RA 4C5CA 3LYAA 4F5ZA 1EYZA 2J45A 4XWGA 5IYZF 2ZBDA 3MOGA 5WRFA 3V8BA 1Q3KA 4KGVA 4YPFA 3ND5A 1NF3A 4TMZA 1L4KA 4UTZA 5E9QA 4HS9A 2CHEA 2NQTA 3KKZA 2V4MA 1A71A 4HRVA 3OKCA 5FDFA 2BBTA 4PQRA 3DFUA 3DNPA 4R9RA 2YWHA 3EVGA 1KSHA 5C5JA 4QPDA 1P4HA 3MQ2A 5BOLA 3VR2A 4L5CA 2H7VA 5CWRA 3AJDA 4JV1A 5K0GA 4FKMA 2BMDA 1VE7A 3GEPA 4D4IA 4DSNA 1D5CA 3PNCA 3GB9A 1TFRA 2NU7A 4BDTA 4PLTA 2TYSB 1KEPA 2QAGA 3M81A 3BFKA 4QVGA 3KAJA 1ZICA 4CCAA 3GRAA 2DERA 4TZ6A 2AD1A 1JZQA 3KV3O 4DAOA 3CNLA 3AVPA 4NBKA 2AUTA 2HJ9A 3AM4A 5TF0A 4PLZA 5KFAA 3CUEF 3B0XA 1QFMA 1R4AA 5AP9A 1F8FA 4QHSA 1XZAA 1XAIA 2RAUA 5DBGA 1QF9A 4G36A 3ODPA 4G26A 2ZCJA 4EEKA 3EN0A 4WOPA 4EAQA 1K5OA 2WQZA 3HJTA 5CXXA 2CLKB 3REFA 4N7MA 4IHJF 3EX7C 3MS2A 4BNMA 2G0TA 4X1KA 4B2IA 1Z75A 1L1FA 1CC1S 3DONA 4C4AA 1D9FA 3PF8A 3BD7A 1PFKA 2R96A 2H9YA 3A06A 2DKNA 2VN8A 4UULA 3SIRA 2CL0X 2YJTD 2CLIB 1DKRA 3JRNA 3F2CA 4IR9A 4PSAA 3OOYA 4AYXA 5EJ2A 4ANFA 1XQ1A 3TZBA 2PS9A 4JD5A 5LFAA 4G1MB 5FRDA 1SRQA 2CMGA 3UXHA 1KFDA 3JZIA 3ISTA 2OGWA 3W5VA 3VOTA 4S2EA 3GLFE 1NBAA 2BKLA 3FBGA 4LRSB 3MYYA 2I54A 2Q4EA 3MZ0A 3PBKA 3FWHA 2VDWB 1Y80A 2OAEA 3GP3A 1FDIA 4RO0A 1KI9A 1RJ9A 3U1VA 2IGTA 1CIPA 4P58A 4QZAA 1C2YA 3IUJA 3IQIX 1OH5A 2R6AA 4D8WA 2C94A 4D6YA 4ZOQI 1TVMA 1XV5A 3E70C 4OKIA 3NC4A 3FRJA 4DC0A 3G2OA 4NZZA 1PUXA 3SLGA 3AMVA 4J8PA 5JHGB 5KFQA 1SQ5A 3U9SA 3FCXA 5CXSA 4F6RB 2OB2A 1CUSA 2JJ1A 4F21A 4UE6A 3KB2A 1N0VC 1YVDA 4K4IA 2I3AA 4V0NA 4MGZR 4XW2A 1UIRA 1D2EA 1GA6A 1DLJA 1BPBA 1TJNA 2CFCA 3SKVA 3UOAB 1AKTA 3VR3A 4OXKA 1FA9A 3E3OA 2BGRA 3OQMA 4NQZA 4CI0B 1G55A 1LBEA 2G40A 3W3AA 4KAFA 5FPTA 4EEZA 4B74A 4OB8A 4I55F 1WB6A 3H11A 2PS1A 1ZR2A 4B8YA 5ER9A 1JJIA 4KBYA 5FTNA 3NAGA 3L4JA 2EXXA 2O2DA 3TXAA 4WADA 1SXJC 4P4UA 1GLNA 2AK3A 2M1ZA 4FPXA 3K35A 3NVVA 3VU0A 2CXUA 3BB4A 4ELUA 3QF4B 3H0EA 3FSJX 3M4YA 4HT3B 2LBOA 4NENA 2DBRA 3I9KA 1DFHA 1XK7A 4MVJF 1N2CE 3UMRA 4L8LA 1I6MA 2FMIA 4NE2A 2HXYA 3FSRA 3JALB 3LVFO 3H3XA 1DWUA 4EB6B 3CF4A 4QOJA 1JR6A 4I8IA 1Q22A 2JPDA 2PS3A 1Q1BA 2BM9A 1T6BY 2I99A 3F6SA 4JYPA 4JQCA 3KSAC 3E2EA 4N41A 3BL6A 2C5GA 2D4HA 2DU8A 1L5HB 2WTXA 3B82A 4PG6A 3IIKA 2QYTA 4RFSA 4IH4A 1TJ5A 3A70A 1MTOA 4HH4A 2YWDA 3CZ4A 1L5LA 4Y9UA 4GD3Q 3UJCA 2A1AA 2VPTA 4WASA 4Q1EA 4RAOA 2IBSA 3LK7A 5FL3A 1T8UA 4V0OA 1T1IA 1RXYA 1M76A 3P2KA 4B8ZA 3DLIA 2G4LA 4PGQA 4G4IA 4ECXA 4FMBB 4KQHA 5KYWA 3MD0A 1XAGA 4GLJA 1O95C 1I32A 2Q0ZX 4A2WA 1ZQ1A 4MP6A 3N07A 3TLJA 2J5KA 4I50F 4KX5A 4YB8A 1D1PA 1WQ3A 3MFYA 1JAHA 5KTKA 3B9PA 1LI5A 3MMSA 1ZQXA 4KFUA 3DOCA 2PH3A 3A6ZA 2AJQA 3KL4A 2KFZA 4EJ2A 2YL2A 1P7WA 4P3NA 1M7HA 1EVQA 2QN2A 2YYYA 3USES 3LBNA 4NLCA 1NVUQ 3RSOA 4DDHA 5F7XA 4WXMA 2BCUA 3AT1A 4QZDA 3WHIA 3PRYA 1UKEA 2QDXA 3F2IA 3GFGA 4I2IA 3NHLA 2BUCA 2H5LA 1TMGE 3R3JA 1E4YA 4CKCA 4NMMA 4D5GA 5I4CA 5F2OA 1FS5A 5J2TA 4YQWA 1M34E 1N34B 8ICNA 3T94A 3DZDA 3JRXA 4HRAA 2QD5A 3ZE2B 1V43A 4IRCA 1FTQA 3GFTA 2F3TA 4MDEA 1ZQBA 3JPWA 2O52A 1IBRA 2HADA 4TKUA 1Q8KA 1X3LA 4UBIA 3OT5A 3CUSA 4AT1A 3M4JA 4WN9B 3KR0A 2B8EA 4GPEA 3BZBA 1ITZA 4AZ3A 4F5PA 2BKUA 3GDOA 3ER8A 4A1FA 4YREA 1G4AE 1N7HA 5K5EA 2XODA 3NWBA 1KOJA 2PIAA 1MGPA 2AI1A 1U3CA 1DX6A 2B98A 1CS0B 3DSRA 5KT3A 1DRUA 6ABPA 2FUNB 2YIVX 3LLSA 3SS9X 1LGYA 1XQWA 1OUMA 3H87A 1QDUA 4O2BA 1CY0A 4CKBB 4AFNA 3KHRA 2DXIA 4R69A 3L1IA 2Z8ZA 2GDJA 2Q45A 1KZ7B 5BSMA 4EW1A 1J20A 3IUQA 2K7FA 2NUPB 4D0LB 4AKHA 1KSGA 3LPNA 4XX0A 3MGIA 1BW9B 3CGWA 3IAM6 4HADA 2ZUCA 1GR1A 1CW2B 1RJFA 4QFDA 3WLFA 4MRNA 1A98A 1QE5A 4KREA 4EMUA 4BKOA 1LBHA 4HVTA 1U7ZA 5JQGF 4KXFB 2LYAA 3M6FA 3W1EA 2I67A 2VYQA 4KWIA 5KYNA 1EP9A 3A6FA 2GNOA 3LCJA 1VECA 3M9LA 5FOWA 4I2BA 4B3GA 2Q4BA 1PJRA 2HUNA 3TQTA 4O02B 2KNJA 2BYTA 2R48A 3D4LA 1XXLA 2ZVQX 4QOIA 2CXRA 5KUTA 2DR2A 3L4BA 3AK4A 1IHXA 3FCOA 2HW8A 2X41A 4GI5A 1ZVQA 4LZNA 3S2ZA 1NXWA 1IC6A 3CLSD 3S2UA 1HDGO 4MWBA 4EJMA 1GTG1 1PYDA 3MQ4A 3C3KA 4IIDA 4N0EA 3FNBA 2IH2A 4LG1A 1E8MA 2PG3A 4I4NA 3GIKA 3PRHA 2XA2A 2A0WA 2X2OA 3R3HA 3CZQA 5LMZA 3G5AA 2YWRA 5KS2A 4C0AC 1IG3A 1C3LA 2Z95A 4G1VA 4BUCA 3V2IA 4PQEA 3IT0A 5DTIA 1DXSA 1I7LA 1KU0A 3AJAA 1D0VA 5EGNA 1T4CB 3QUCA 4A8EA 5EHNA 1KARA 3BQ2A 5HA5A 5I7OA 1XDZA 4X6UA 2X7XA 3NKFA 2BMAA 2FPWA 3LFTA 3RBDA 1KO7A 3NTRA 4MVXA 3AVUA 5EYPB 4JEIA 2E6KA 2F77X 2ZBFA 5G3ZA 3H8SA 2DUJA 4AYTA 5KEIA 2AOXA 5KFVA 4BRUA 3EPHA 3WGJA 3CRZA 1YV9A 1SFRA 2LKYA 1JKXA 1CXZA 4BX0A 5JNUA 5A3VA 3R3WA 4EBBA 2WTBA 4TL9A 2IX3A 4BUGA 3DMTA 2BR0A 2D6FC 1J42A 1OBOA 1L3IA 3FCAA 3N7RC 2ZS7A 1L8LA 1AJEA 4PANA 4LXIA 5KYXB 1G6KA 2G5HB 1ZUIA 2NRXA 4IDGA 2GX6A 4U2FA 4P5PA 5C51B 3RB4A 3U26A 1Q7BA 4Q7LA 1QYVA 3Q8RB 1Y5MA 2AUNA 4OO3A 4G5GA 4M1ZA 4Y2SA 3IQWA 1RJEA 4MKIA 5HMMA 4KL8S 1ISHA 4X1IA 2R751 2VJYA 3UO8B 2AH5A 3RG8A 3I09A 1EFPB 1HNNA 3V6LA 3SEQA 2B0JA 3FW1A 2M98A 1OC2A 4LGYA 3ZDRA 1WWKA 2ZJYA 4B9VA 1EFHA 2V7TA 4UBOA 2PIDA 3H16A 5T14A 4GE3A 5T3UA 2X2PA 2Z4RA 1MJ5A 3WMFA 1M8KA 4FLMA 4TXNA 1PJQA 1EGMB 2MINB 1T36B 2VAXA 3BJMA 3G5UA 2IYVA 1W94A 5AJTA 1YJBA 4WK2B 2PZ8A 3LXUX 2E8PA 4LRWA 2BFEB 2ODNA 4TVSA 2YY6A 1TK9A 5EY5B 1YQDA 1XELA 5HIJA 5BSHA 1FLVA 2C5SA 5B58T 1GXSA 5DM2A 4R7ZA 4Q15A 3BSSA 2II6A 3GLUA 4C29A 3ZOKA 1H2BA 4MRVA 5IH7A 2UZ1A 4RDCA 4K8RB 3T34A 5C4IA 1KI8A 1F51E 3ITKA 3DMFA 4C7ZA 5FNVA 1JUDA 4ENSA 4YV7A 3WRXA 4IGEA 4JV5B 5E0OA 3H99A 4IDCA 1D4FA 4UAYA 3VHQA 4MF8A 4W1QA 1QM5A 3QP9A 2WJJA 5TPWB 1O6FA 4A82A 3JSXA 1A9YA 4B6QA 4Q7QA 4F86A 1FNSA 1L4NA 2HA7A 3U4QB 5THKA 2QUAA 4EH1A 1GUYA 4WIAA 3EQ8A 4QTZA 1M1XB 3UT5B 4F5YA 4DO9A 3F5QA 3V8RA 4QPPA 4H7JA 3K6RA 2O8DA 5C53B 1L4HA 3X2EA 1RAGA 1WYGA 1M2OB 3ZX4A 3KLBA 2LV8A 5JSQA 4R8LA 1J9EA 1NLFA 3NM5A 1QANA 3LL4A 1ZCAA 1RI2A 2FQWA 2QNRA 1XEWX 4EELA 4CLOB 2W9AA 3L8DA 1N6NA 2PR7A 3DL0A 4Q3AA 5CTAA 1N0WA 1W5BA 3HT3A 3K31A 4MW0A 1ZNXA 3IAUA 4NL4H 1GRVA 1BKSB 3PUVA 4GI3A 3ZZUA 2H2AA 3CWZA 3K0HA 5GV8A 1U0FA 3NV9A 3MK31 4F5WA 5C8XA 4Y1FA 4OLFA 2HBRA 3T0GA 4TRNA 3KKAA 3QMVA 4JKIA 4XGKA 1Y8QB 4ZAVA 1D4ZA 1JHMA 1Q0UA 4MR8B 2CE7A 2IU4A 5A4KA 2R47A 1I2DA 3NJ8A 3HUFA 4PXAA 4U2BA 3LNCA 4NYIR 6PFKA 4YRQA 5KTRA 4ZV9A 1YE5A 1R64A 2YMQA 1NFRA 3PVCA 1NW5A 3HJNA 2V65A 5HKAA 3ECSA 2NO6A 2NPOA 1ZI9A 4DQ0A 4LFAB 3ZK9A 5HR5A 2WRZA 4K9DA 2NNWB 2ZQZA 4WVFA 1S0UA 3EGEA 3R6LA 3UW3A 2JFOA 4CKYA 3B52X 2ISCA 3AEUB 1H23A 2ODAA 3T06B 2OV4A 2YVAA 2YNMC 3OTIA 3KOUA 3HBNA 5I7RA 5HJ7A 2W2LA 5E7MA 4WZ6A 3UB2A 2QB0B 4YV1A 4CMIB 4DPLA 2VYVD 2V6BA 1N2SA 4CL2A 2EWWA 5IZCC 1UBUS 2UV8A 2PZFA 2VTKA 3KVRA 4GMKA 3K30A 1QSGA 1FJ2A 3A1FA 3ENWA 4BXOB 4HX2A 2IRWA 1M1YB 3AUUA 2Q9UA 4MF2A 2W2VA 4OHBA 5H68A 1V7PC 1OLSA 3IVGA 3Q11A 1JQ5A 2O7NA 3T5KA 4V0LA 1V8BA 5FB3A 2ZVDA 1FBNA 1ONOA 2YHIB 2C96A 2OZLB 1XSNA 8ICMA 1CJKC 3NJ4A 1ZS9A 3NHBA 1YB7A 3V8NA 1FXWA 5IEBA 3F3KA 1QPBA 2IXGA 4BX9C 4M9RA 5B66U 3C3EA 2HV8A 4NK5A 1UJNA 1BEUB 3E9QA 1NM5A 3C29A 5BNWA 4MYUA 3A0BU 4JVNA 4UAZA 3H4MA 3B78A 2MIIA 4MI9A 2XHZA 5BPFA 2IS1A 3OETA 1RHJA 9ICVA 1CERA 1CD5A 4A0FA 4JWTA 2Y3IA 3PW5A 4EL0A 4PHGA 5CNIA 4UAUA 2JH3A 3MGCA 4YMIA 2DHEA 1PDWA 3WLLA 1WKBA 1VJ5A 2H2FA 1IL0A 3DXXA 3LX4A 1P4JA 4M37A 1TK8A 3COSA 4M1KA 3S8YA 4AJ2A 1T10A 3Q8KA 1YR1A 2VYFA 2W11A 3OLYA 5HMLA 2D2IA 3JYLA 1IVNA 2VUIB 5EIBD 4J94A 2GQ0A 1O6GA 4KX3A 4QKQA 3WMWA 2I0FA 3VNVA 5LB2A 1JVNA 4CNBA 3CKLA 3EQ6A 3QENA 4UBKA 1G17A 4YO7A 5JSHA 2HEGA 2ZRJA 3VVMA 1VGVA 1UCVA 1Z37A 4DIMA 1W8DA 3ML1A 4E32A 3QYFA 4AX4A 3VSBA 3X0DA 1A6SA 4NDAA 5E38A 3FKSA 1W36C 1JQBA 1J22A 1R8YA 4MVJH 3CLVA 4RPLA 1BYUA 2PGAA 5JMTA 4J4HA 5J4HA 3ICVA 1JHYA 4NXZA 3CC8A 4ZT2A 1ZWLA 3O03A 3KRTA 1QNFA 3U19A 4XJVA 2YN0A 1Z17A 3ZVLA 3MNFA 2KE7A 9ICCA 3G2IA 5I6DA 1SXJE 3TSYA 3MA0A 3HUEA 4DXHA 3DL2A 3GROA 5EKUA 1XWIA 1RM6C 3LWDA 2FB9A 3SC4A 2PX4A 1NN3A 1KTIA 2CVZA 1LV7A 3Q7SA 4IEIA 1V6SA 2WNSA 3EEQA 3M9MB 3D6FA 5U1PA 2VPYA 1K9VF 2C9BA 2FQ1A 2B1QA 3KT8A 3J81j 1LRKA 3ZX5A 2PWBA 1S0NA 4HZUA 4YAKA 1SURA 4FDLA 1RW4A 3BKXA 4CGYA 3QWIA 5CVJA 3KEGA 3OIDA 3CX4A 3D0RA 4UJ3A 5K8CA 1TIPA 3ZEAA 5J0PA 3D3WB 3OAAA 2AN3A 4UB6U 3NV7A 1Z6YA 1UKBA 2WPDD 2GHTA 4IDHA 1ODIA 3MGVA 4NCBA 4WE3A 2GEUA 1N2EA 1HEIA 1FVXA 1V9CA 2A1JA 3KFLA 1XNHA 5LDDC 1JNXX 4PAMA 4MW1A 2NYUA 1Y7PA 3TQRA 1DRJA 2IUUA 4C2BA 4B43A 3WBJA 3GLIE 2UVQA 2FVXA 1G5RA 4ROTA 4INZA 1IM4A 3M1AA 1IN4A 4KLDA 5DRYA 1MNAA 1Z5GA 4ED2A 4FDTA 3ROKA 4GX2A 2KV2A 2OL4A 3AYXB 5DGHA 4QJBA 5EJAA 4DLWA 5LDGA 3KJNA 4YJ2F 2WYVA 3HKBA 1W85A 2VTVA 4F91B 5KC9A 1W4CA 1GFWA 4TOIA 2WWIA 4HNSA 3D2NA 1ZO8A 4DJ5X 5D3ZA 4BBZA 4MIYA 2ZYUX 3M5DA 1FLDA 4L72A 3ZHXA 3WAJA 2B83A 1ECFA 4I81A 1YOVB 4XQEA 3EWSA 3TR0A 5AXDA 2VTDA 5HKOA 5FAXA 4CEJB 1NWCA 3ZVRA 5DF1A 1UKZA 5JVDB 2REQB 4BO0A 1KIAA 2JLZA 4JC0A 5C0OE 2CY0A 3LWZA 2VDKB 4US8A 3NONA 4PZ9A 6LDHA 2VDJA 2OSBA 3KVVA 4JU8A 1KFCB 2V4RA 4O63O 4Y9SA 1NK9A 1QHHB 4LZJA 3HN6A 4MJLA 1TIBA 1I2ZA 5FOSA 4OQPA 3I9LA 1KEKA 2AX3A 2HGZA 3LE8A 4JYCA 4ZYXA 1XL1A 2JS7A 4L76A 2C8VA 1PKEA 4IGKA 4RPJA 4FSXA 3Q9NA 5HK8A 3QI2A 3Q0EA 1OPRA 2FN9A 3EUFA 1LV8A 2P62A 2ODWA 3HNRA 5HE9A 5ITZB 2A92A 4AS2A 2XTAA 2CN1A 3DLBA 1YS2X 1R4MA 2Q8NA 3U4CA 3VU9B 3NUGA 4CT4B 4DJDC 1IEXA 3V7NA 4PHAA 2JHGA 4EHNA 3TW0A 2CNWD 3K5IA 2XEXA 4FHGA 1VZ3A 2YYAA 4CETA 3ETDA 4MK4A 3VR4A 4BQFA 1ZUWA 3H3JA 4XM2A 5DIFA 4BU1A 1PT7A 1UK6A 4ARZA 2Y9PB 2QL9A 4X8MA 1F44A 1G8FA 1QZXA 2RG1A 4B44A 3MLEA 1UBFA 1T1EA 4U7GA 1YVPA 3SYZA 2M32A 4PYOA 1SXGA 3ZI4A 1ZN9A 1V47A 4AMGA 2E87A 1OF1A 2NVOA 3HPOA 2ATIA 1HURA 3DR3A 2VATA 4LTDA 3BWVA 4KLOA 2HO5A 3L93A 2W3SA 3AHJA 1EFUA 4J9MA 3I62A 3R0IA 5T6MA 2F3PA 3AQIA 2QB1A 4WW0A 1NLYA 4MVJP 1OLUA 1AZSC 2R8KA 1H8EA 2QNBA 3EOZA 1R6DA 1MN8A 4F1JA 4LCJA 4O4HB 4LNUA 2X9LA 3UZUA 3CKYA 2VAMA 5KFEA 1NOMA 4RUCA 4JR1A 4I1SA 2R6ZA 4Z9AA 3LY9A 3I2GA 4NFSA 1MN6A 2YY5A 3IO5A 2EU8A 3A7EA 2OB1A 4NXNB 4M98A 4KMUA 3RRJA 3RJ9A 5CIWA 2DQ4A 3U49A 3I42A 4U00A 3H9QA 3BICA 4J9VA 1M8JA 2GZ1A 3OHMA 4HDNB 1SUWA 1L7OA 4DB2A 1PD1A 1VLQA 4UM5A 2PVSA 4RKEA 3FMIA 2X4GA 1GM5A 1ZJNA 4CM8B 4CIYA 1E1MA 3FUCA 2XKJE 3LH5A 4EZ9A 1QGYA 1TT5B 3WLOA 4FC7A 1NU8A 4R8MA 5AKKA 1QGUA 4EJ0A 2JHCA 4JOSA 2CVOA 2WUGA 5DV9A 3QJYA 1H69A 4BYGA 3RSFA 4QTXA 3H4DA 3HM9A 3VA7A 1QGDA 1FX1A 3GNQA 4Y2TA 4OHWA 3KSRA 3M7IA 2RGRA 4M0CA 2JI6A 4PS1A 4JJIA 3X1KA 1I7SB 3KVYA 1X1SA 1KLNA 2Y71A 2XRFA 3GV5B 1KDVA 2ECQA 5E4YA 3P71T 4L2IA 3THYA 5T6BA 4DSOA 1RYFA 3R23A 4BFUA 1ZSYA 4I1YA 2V45A 1NVDA 1WF6A 2IGBA 5DN6A 1Y3HA 3QPUA 3NHWA 5AJZA 1S9HA 3TCKA 1UFQA 4HAXA 4G9EA 4CL3A 5K09A 3UICA 5KOIA 1Y3AA 2AOUA 2BFCB 4OFBA 4OL0A 3HRHA 5JLAA 5D01A 3DFZA 1UBSB 2DT8A 1NI4B 1A1VA 2BE7A 3Q3GE 3V33A 1P2GA 4C0KA 2NACA 5DTQA 2KKVA 4GGOA 4N5LA 1E8NA 1E1YA 1GNLA 4BB0A 2AFHE 1E3EA 1WPQA 1QC5A 1VPWA 3O8CA 5KYGA 1YQGA 2J6HA 4G6ZA 4B3BA 3AZQA 3OZUA 5IXSA 3U7QA 5DLFA 3TNFA 3LQ2A 2XUPA 4DMCA 4YD2A 1F6WA 3QJ5A 1IXRC 3PQ7A 3PW0A 4KQXA 1NHGA 3PDIB 2QD3A 1ID1A 4LV6A 2FKAA 3H0LB 1MPTA 1M1NB 6REQA 4N18A 4LWPA 1C0PA 4ZZIA 4YMTA 4P9NA 2GI4A 2WSBA 1NE7A 2G6TA 5JADA 2O57A 4IY1A 3UW1A 3OCUA 1B00A 2CZGA 3NATA 1C3XA 3A04A 3MFQA 3I39X 3WKEA 3LDUA 5MFZA 1L5RA 4Z3OA 1DOQA 3OE7D 3ICOA 3MGGA 1UODA 1YFZA 3BULA 1JG7A 4JLPA 4RHXA 2J3EA 1K97A 3FR8A 4TN5A 3WL7A 2A7XA 2WTAA 4DEYA 4LDJA 1J0BA 4NV0A 5T67A 3P52A 2HYDA 4E12A 4DCNA 3SQLA 2POQX 2OO3A 4GGMX 1MB2A 4KIJA 2QLLA 5IAGA 3EG9A 3NI2A 4R0VA 3NWEA 2KFNA 4RQ4A 4ZDJA 1A9SA 4UFOA 3BDIA 2ZEJA 2N1BA 3N0TA 2V0CA 3HL4A 4EGSA 9ICXA 2AOTB 3IXMA 3PO5A 4WSOA 4A8HA 4NYMR 2E48A 3QVKA 1FP2A 1E9EA 1V4BA 3B3QA 1XDWA 4O33A 1U1GA 4COOA 1I1QB 1ZNZA 2HU2A 4LKOA 1ZQGA 5HQJA 4NWIA 3AY7A 1O7JA 3RBZA 4HTAA 4HD8A 4GXQA 4X9XA 4RTJA 2AMYA 4BQNA 4OQXA 1WUYA 1MJNA 3O7WA 5LBTA 8GPBA 4U7WA 1KSPA 2CKMA 1YF3A 4KLJA 2GXSA 2BP7B 1ZOOA 4YT8A 4XIYA 4EDFA 4BLSA 5LL6P 2O48X 3ONEA 1Z07A 3X1MA 4EFNA 4PGAA 2XGPA 1DTWA 5KNLA 1ISRA 3FSGA 5F9HA 3BX1A 3D1VA 4RSGA 3GY0A 2E37A 1INLA 4ZV7A 1F2UB 4NC9A 1MHPA 4IDPA 3ENNA 4LC9A 3RLFA 3KZKA 3QI7A 1AKWA 2F76X 3ZQUA 1UQUA 1PFGA 1WUDA 3G2JA 1FYVA 2LTAA 3WGGA 4GOJA 3H2SA 1JG4A 1QCCA 5T7BA 1JU3A 5ALQA 1Y82A 5K6RA 5AI9A 2GWRA 1PGJA 1WA5A 2ZJ8A 3RJTA 2PPVA 2QTVA 1UAYA 1D07A 2RAFA 4LXXA 2VF4X 3EVTA 4YMUA 3ZDQA 1AKRA 3OHSX 4UB4A 1FIUA 3RAPR 3VO2A 1YWGO 2MRLA 1NJFA 1ESDA 1WPGA 1IHOA 4KLIA 5IT9A 4OYYA 2COEA 4JLVA 4CV2A 4JVMA 5L1MA 4M53A 4YPVA 1ZCJA 2JLCA 4BMVA 4KJXA 2PKWA 3GI1A 5IBRA 1JS1X 4QAQA 3KD2A 1GYRA 3N3BC 2NG1A 1BX1A 3RV4A 4LZWA 2IPXA 2OHOA 2OXOA 1NXOA 3B1XA 4ARUA 4LRXA 1C0IA 4MHVA 3QLVA 1R7RA 1XX6A 1UC4B 2OQ2A 3HH8A 2GWSA 3VKVA 3LECA 4Q1DA 1IRXA 3RJKA 4YA6A 4KUGA 2F1IA 5GGYA 2E4VA 5MHTA 3S2GA 3MJEA 4JI4B 2ODQA 1SCUA 2ZRHA 4K3UA 2O1WA 4GHWA 4WNIA 4MCAA 3HS3A 1USIA 3TLEA 2VHTA 3SCZA 5HWSA 3P2YA 2ZIUA 5A5VA 5LQKA 1HM5A 4O6VA 1SKUA 5SYMA 4AXBA 1YRYE 4GVXA 3HB4X 2BHRA 2EBHX 1SZDA 2C03A 5FA8A 5U9CA 3P2EA 3PEFA 1B4FA 1E3MA 3ICCA 4KQ9A 4PHCA 1MR3F 3A4YA 2FEOA 2PUHA 4Z6DA 3DBIA 3NFYA 3DUFA 3RVKA 3MMXA 3IHWA 1CDEA 3S44A 3HWX1 3CVOA 4LA4A 4DQDA 5B2FA 3JU3A 3DVLA 3NNDA 4YRNA 4MXDA 3S2SA 3LPAA 3TN7A 3PPVA 1DG3A 4KBGA 4Q00A 5BW6B 2F3QA 1WUKS 1AT1A 1DAMA 5FTMA 1NQTA 3X1ZA 5HNKA 3JWEA 4RD2A 4MGHA 4UB2A 1ZQMA 4L4RA 5KYYA 3II6X 2OBMA 1BGWA 1A5AB 3FTEA 3RVBA 1CUWA 1WXQA 3O9MA 1TYAE 3TAPA 4DTIA 3STYA 1ABFA 3K1AA 3KETA 5K0EA 4NFHA 1A4UA 4EATA 3ZQ4A 3H2BA 1KO5A 1NV9A 2XITA 1XPJA 3CLUC 3WMEA 3HY4A 3OCXA 4UMDA 4MRMB 5LC1A 3KQMA 1NUAA 2OXFA 3NJRA 4PX3A 2JXJA 4G3XA 4P0PB 5AVSA 2VLBA 5B53A 1ECWA 5KIAA 1XD2B 3BBLA 5IDVA 5HBGA 4MS1A 3JPYA 3IEPA 1SNYA 3ZDZB 1KI2A 2F8MA 1UZMA 2I2WA 2X2EA 5IXYA 1FNDA 2GAJA 2O8NA 3OP1A 5C31A 3KLMX 4QVKA 4QJ3A 5TEVA 1Z4NA 4ENPA 4N8DA 3WYAA 2CHUA 2JLUA 2WVGA 2H0RA 1Z0SA 4QNNA 2W6QA 1DRGA 3E22B 2XAAA 1AUXA 1TNDA 1C14A 3VKUA 2VHWA 4J9LA 5BSVA 2GK4A 1EIZA 1UADA 3JATB 5DOZA 1XXHA 4V39A 1A9XB 2JJQA 1XF1A 4OLBA 3KPYA 5IANA 2ZYHA 1AQJA 4KZKA 4YCCA 1X40A 3AILA 2IX9A 2CYBA 4H4CA 2XVAA 4LZZA 4CMGA 4AKTA 2D3DA 2V97A 1LSJA 4OGLA 4P7KA 5BVHA 4L8GA 3L8ZA 4Y2XA 1F6DA 3SHVA 3L7LA 1CRPA 3GRZA 2G1PA 1JAZA 4IZ6A 2HGSA 3B9BA 3OT1B 5JAIA 4TL6A 1LLQA 4BZQA 5HUJA 2QTCA 1XDDA 2HIAA 2XOKD 5TARA 1UQRA 3G6YA 4YRJA 2Z5FA 1VC2A 1Z0IA 5AM2A 2JGLA 3OQOA 2WVJA 4D56A 2PZJA 1Y7HA 1S2LA 3N59A 2KW5A 1QUEA 5BNTA 1M6VA 4K9OA 2AB0A 1K86A 4X63A 2A7QA 2JFUA 1RMYA 1A8SA 3OESA 1U6JA 4OUKX 2JLBA 2RC5A 2QN8A 2TSYB 3RYIA 3LI2A 2P4SA 4ILKA 3H5WA 1TOAA 3L8FA 4KYTA 4WACA 1NA5A 4PR0A 2WC1A 1IY8A 2H06A 3HVHA 2BSQA 5HDBB 4YEDA 4YRSA 5JU6A 4JXZA 5A9SB 4EBDA 4OQYA 1ZETA 5SZHB 1XJCA 2DFNA 2FY8A 2SCUB 4M55A 1Z12A 1E7QA 2YN2A 2B7CA 1NGSA 2YJ3A 2A0FA 1BXZA 4ABYA 3M6MD 2FF7A 8ICEA 2XHEA 1LKZA 1E3WA 4JDPA 1C8KA 3EB9A 1ZUNB 4UTXA 2E1PA 5GTIU 4IIJB 2WABA 3WB1A 3G0OA 1CY2A 5TQ0A 4CMBA 4O4LF 3LRPA 3P9PA 2B3TA 1SL1A 1T2CA 3SFZA 1J56A 8ADHA 4P83A 3O2NA 3AR3A 3IEUA 2FWJA 5KNDH 2XH8A 1EE9A 2OR3A 1R0ZA 5EJ7A 4NV3A 1ADCA 1ZOPA 5CA0B 1FDUA 2J1LA 4ZZ1A 3L7NA 2QTHA 3WZLA 2XVTA 2N1MA 2PXCA 2OHJA 2YXLA 1T5OA 4PXYA 2IYLD 5BSUA 4BLTA 4ER7A 3NYRA 1UM9A 2R7LA 3D3JA 2IODA 4C4PA 3RS3A 3D3KA 1QHYA 1KTQA 2HO4A 2YOGA 5L51A 4OBWA 3UUEA 3HV0A 2ASLA 4K28A 4PYIA 4DDTA 5A0FA 3GU3A 3V1TC 3UWKA 4C3OB 2J7KA 4GBED 3PSTA 3NBZC 3NBKA 3O83A 5ALWA 1XMIA 2YASA 4YUVA 2WJIA 3EHDA 3ZR4B 1E4OA 4DILA 4H1TA 3ZWPA 2P5UA 2Z6AA 3W9YA 5D5HA 2YJZA 5FH9A 4HWOA 3RE1A 4B3HA 4LXTA 3HCDA 3OJEA 3Q7EA 4MNTA 3CR7A 3A3PA 1UA0A 4H3SA 2PS0A 2YZNA 4R65A 2P6UA 3QEBZ 4IVQA 4M36A 5KSWB 3GGGA 1W1UA 4QZEA 2QUZA 2JKVA 4WNAB 4PFQA 1DC4A 3SF8B 3ELBA 3ZU2A 2G83A 3ZWQA 2O3JA 4GLXA 3GJ3A 3KYCB 3H17A 1W0JD 2JG3A 3T3IA 4Q12A 1JXAA 2QW0X 3THRA 1E7YA 1O94D 1MOSA 4A4DA 1XCLA 2D4AA 1BDMA 4BX2A 4QQ8A 3O5AA 4HLCA 4ETMA 1UFKA 2XNDA 2VUTA 3G82C 4Z3DA 1KAEA 1DKOA 2ES6A 1T8TA 4LAFA 3TVTA 2G9VA 2IEYA 2XQFA 4C8MA 4B7AA 1FXUA 3ZJTA 2K2QB 1E6KA 2O7RA 1PO7A 2HCRA 2RBEA 1T2FA 3KOXA 3SICE 1XO0A 4R8UB 2ZBVA 2ASDA 1XZQA 3WRWA 4PO9A 5KNBH 2IPLA 2FSHA 5AJYA 3UAVA 1D03A 4X91A 2V7VA 3HI4A 4IJUA 3CT6A 4LX8A 4RBNA 2JVIA 1JYEA 4WJ3B 2QD4A 2X5KO 4NZ9A 2IHTA 5M2QA 4IV0A 3ABOB 4C6TB 3RJIA 2QAIA 1JFVA 4JZKA 1FUYB 4FI3F 4GNKA 7ICJA 5EQJB 3D8BA 4IDEA 1T9GS 7ICPA 1Z29A 4C14A 4U0JA 4GXKA 1YB6A 4NQRA 4ZT5A 4Q3NA 1H66A 4W4TA 4W5JA 5DDMA 2D2XA 3C8HA 3GFQA 1JLSA 2RH4A 1N2JA 4XH9B 3BF8A 2LRHA 1C30B 5DGCA 3C7TA 3DLHA 3U4MA 1H4SA 1KAOA 1IN5A 2Y9TA 2WINI 2ZATA 1YASA 5LOVA 1WP4A 4LFBB 3MJSA 1C7QA 4RNOA 4KOAA 2FN3A 1FUUA 2ODEA 4WK4B 4RANA 1TB4A 4M1WA 4Z1MA 1ZAYA 2N46A 3MCWA 2OAP1 1UKVY 3KVOA 3RAEC 4W9MC 3UPDA 2ZU6A 2DH6A 2ES4A 1HE2A 4ELTA 4PONA 1NR5A 4ALKA 1JYFA 2J9FB 3H9UA 5KKNB 1T3SA 3DZKA 3ZGXA 1AKNA 1T8SA 4CFYA 2DFLA 1S9FA 2RP5A 4YWJA 1E4EA 4HLUC 4WT7A 4RQ1A 4JJAA 1SPBS 2CJWB 5CJPA 4X3OA 3JQPA 3OZVA 3VI4B 1KFTA 2E1RA 3ISJA 4OXNA 3DO5A 4LJRA 4BUZA 3VZDA 3WIEA 3BHJA 3G2PA 2NGRA 3L79A 1H9AA 4TN1A 2Z83A 4Y9DA 2NLOA 4FX5A 4QJIA 1DQSA 3FNEA 1CR2A 4HN2A 3SAHA 2ZJ5A 2FW1A 3QELB 1KERA 2YINC 4NOLA 1IZ9A 2DULA 4DY6A 4EYGA 4UOEA 3TRJA 2B4TO 1SGGA 1HYEA 2OCLA 4HWTA 1R74A 3V1KA 4O0LA 3FFXA 1A5ZA 2CCJA 4Z1OA 4JLSA 2C28A 1GTRA 3OPNA 3LVRE 4BMZA 4TVKA 3IQGX 4ZTBA 2Q0XA 3F6BX 3P27A 4GP6A 1DWPA 1CZOA 5C8YA 2EJWA 3UBTA 5DLQC 4CEIA 3QZ8A 1FDOA 2P2LA 2IV2X 3SDSA 1DIOB 2FJUA 1NG1A 4DR4B 1FRVA 1NG9A 3D4IA 4FSDA 2M9MA 2DH5A 1FP1D 3EMKA 2NUTB 4ED7A 3L77A 1JIIA 5LQAA 3N2ZB 1Z9BA 3QYPA 2H9IA 3K6KA 3QU4A 1O89A 4F2WA 1AA9A 1JSRA 4BNDA 4WINA 3MM4A 1GAJA 4PC7A 4RHUA 5BSKA 3MWDB 1SCNE 1NQOA 1YZTA 4W6ZA 4AY5A 2R1ZA 2ZR9A 2QRVB 4ID3A 2IYEA 5KU7A 3A3OA 3IJEB 2ZITA 2PMZF 1Y8ZA 2LM4A 4YX9A 3IJRA 1PP4A 2VSYA 3ISVA 1AK9A 3Q3IA 1V3VA 3H5RA 1WWUA 2ODTX 2EFCB 3IODA 1AUQA 1OKKD 1II9A 5BUZA 1R50A 4CTNA 3HCAA 2HJVA 2OBNA 2IEDA 4GU5A 3WG9A 4BWJA 4R9UC 5JI2E 3CR3C 5LQUA 1Z0ZA 1NONA 3AFIA 1JDBB 1W46A 5FBQB 1Q16A 1T13A 3HZRA 2I76A 4GOXA 4Q82A 2VUHB 1XA3A 2DL0A 3O31A 3RS2A 4O29A 5F2NA 4FMDB 4QD3A 3ZY5A 521PA 4G01B 5HTKA 3K09C 3OUZA 5F21A 2RGDA 2VHYA 2XCQA 2OXCA 3NTVA 1KAQA 4QUDA 5E6SB 1P2DA 1AMOA 1OFUA 3L6RA 4RJKA 3ZQJA 2IYSA 4NNOA 4OGWA 2BELA 4NLGA 1KRHA 5DTEA 1VHQA 3L1JA 5EVCA 3B1VA 1EINA 3C6BA 1KXJA 1OLOA 2ZYDA 2IXFA 5DBHX 3GJ8A 1HE1C 1MH9A 1ZQ9A 1BXRB 5CRIA 2PZEA 1ZLYA 3WYNA 2WKQA 4IJ5A 3CH6A 3L8EA 3FBWA 3FUUA 3ZE9A 2AHOB 1YS1X 4J3NA 1U3DA 5AJHA 2GJ4A 2V8BA 3R5TA 2C83A 3GJ4A 1N3YA 3BXOA 5K0BA 2ORWA 3BEOA 4RL4A 2GVDC 3IFSA 3EVDA 2V7XA 4OHUA 1GPDG 1K2WA 4MMYB 3IDOA 4DEZA 5ALTA 5KOYA 5JAOA 1O5IA 3CLTD 5JZ9A 1LX6A 4MV5A 3TAXA 1GARA 1PEAA 3RBEA 3RJMA 4HDSB 1PDVA 2X4LA 3V7KA 1Q21A 1MVLA 5A6SA 3ZLBA 2DFPA 2G82A 3UPQA 2XUFA 2Q7OE 4PIVA 1UWKA 4CM7A 3AWDA 3HZHA 2ZJZA 4V3CA 3L02A 1NOIA 2RQ5A 5LBIA 1J49A 3NBXX 1X13A 4GW3A 1SU6A 1E0SA 3FXAA 5LD2C 4XOUA 1X9XA 2V4ZA 2J41A 3KOOA 2QYOA 3RH5A 4KCGA 4YR2A 2ZTDA 2O2SA 4EY5A 2VCYA 3ZHZA 3UJBA 5K8TA 2X8BA 1VPLA 4H2DA 3VBEA 1JJVA 1Z3CA 2DPIA 3PC6A 2EDAA 3IP7A 1H9BA 1KFKB 2R5NA 3SP1A 3KSDO 2J0SA 4X66B 2A5GA 1A4IA 3QTLA 3TLKA 4K1XA 4EZEA 3B8EA 4R2HA 4FCCA 3WYBA 4M1SA 5BN3A 4KIWA 4L7VA 3D9QX 4GPTA 2CLCX 2AF4C 1JWBB 1KNQA 3T5GA 1J70A 3C6MA 1U9IC 4WECA 4N8EA 5F51A 2EFGA 2QP4A 3OIVA 1OXKB 2XQGA 1B2LA 5HR7A 4PFSA 2VAWA 4DCTA 2OORC 2NIPA 2DG2A 3D6HA 5DKFA 2PQ2A 5SZJA 4DL7A 4EENA 1T26A 4M8LA 4RU1A 2Z3ZA 1SVMA 3JYQA 2QU7A 4HAIA 1Z06A 3QA9A 3IKTA 4XB2A 3LWMA 3WB0A 1RRGA 1W5EA 4L4SA 4KVFA 4C89A 3EEOA 1C7FA 1G0OA 2HWWA 3BREA 1O9HA 1KGSA 2Y4NA 2AR0A 2PLNA 1O97C 1ZJJA 2ZAIA 1IRIA 1NX9A 4JN6B 2PLAA 4MDHA 2NZYA 4V24A 2EP8A 4KBFA 4NBLA 4P54A 4M76B 4MSUA 4UDOA 2O0HA 2ODGA 4U2EA 4EG4A 3ZG6A 4BJ5A 2CV0A 4M9NA 2V1XA 2AXTU 4FT2A 4AY2A 1GL3A 2IPNA 4RFVA 2ENUA 3MOSA 5FOXA 1XRRA 2CMDA 4NJMA 3W2HA 1M8GA 4KIGA 4OTZA 9ICPA 1UQTA 1V25A 1YXMA 3BQTA 3IHLA 2J9XB 2P35A 5LQRA 3F7TA 3L7CA 5J2CA 2NO7A 5DX0A 2J7PD 3TTTA 4ZCMA 5HFJA 4CQMA 3DMPA 2DYKA 1V0JA 4IQTA 1Q1ZA 4PQFA 1Y37A 4YMSA 2LXNA 3LW7A 2AZTA 4XI9A 3RROA 4TZ0A 3L0CA 5DDIP 4FFBB 1VE1A 3SF0A 3ZCUA 3W8RA 3DEHA 2C2GA 3QA3E 2ZTEA 1DDOA 2P9ZA 1V2HE 3RTEA 4IH1A 2QYSA 5KX5A 3GC6A 4O0MA 3NVKI 4YJDA 2A0UA 2GLTA 3NX4A 2GOYA 4MYSA 1GZ5A 4LUCA 1FQJA 4O4JB 2AKEA 5IKPA 2I3ZA 4IOJA 1VIAA 1V38A 3TAUA 1FLAA 4HCJA 5JOQA 1TYDE 1NSTA 2QGNA 4J9KA 2W83A 4QWEA 4IZIA 3J80A 3AF4A 3MBKA 4ETNA 3U37A 2P5SA 2V3CC 4AZ0B 1IN8A 1LPMA 3RAFC 4IIFA 1IXZA 2JCVA 3N7AA 3I32A 4GZ6A 4YDHB 2CCGA 3RYCA 3DMYA 3SBDA 4PSCA 3W1VA 3AL3A 4KVAA 4JLJA 5CURA 4DB4A 2HX1A 4YECA 3DF7A 3ON5A 5LLTA 4WESA 3TF5A 3QUQA 4DQPA 3BJZA 3OFJA 1YZNA 5DM4A 2H8KA 1BGXT 1PJBA 3SQDA 4EA7A 3H0CA 3IMGA 5IIMA 1OFIA 1E20A 1QB8A 3IV7A 2V9CA 3JQAD 3VHXB 3IAEA 2FPGA 2C5BA 3I9MA 1OASA 4PM4A 3DBRA 3CX6A 3JD1A 4NEQA 4U7FA 4X45A 5THXA 3AXTA 4TUQA 3KKQA 3FNQA 2BUBA 3EJWA 5D8DA 1CJVC 1A5BB 3QVGB 5CDUA 4OAQA 2MSWA 4OVKA 2DOKA 2RCNA 1UEXC 3H2JA 2B20A 2IYOA 1SCIA 2AN4A 4AM8A 4F4DA 1NKEA 3DZBA 2QI9C 4PZLA 4XA5A 4LECA 4IMIB 1F4PA 1JFLA 4IDDA 3O26A 3U5ZB 5JJ5A 2Y1KA 3FF1A 1J2RA 2UUPA 1TC1A 2EKBA 1QIHA 3LUKA 4P34A 5HIMA 4ZVOA 4RF5A 2H5XA 1UT5A 4P1ZA 3FDSA 3KQLA 3WKAA 1BHSA 2R7NA 4XRRA 2YIMA 2VRCA 1E9SA 4OYLA 1F2TA 5KFBA 3UXMA 4YDRA 1XO1A 2AXEA 3Q8XB 2HQ1A 3MBYA 4KLTA 1JB1A 4A6XA 3LQ1A 3GP5A 2Y4OA 4XQGA 1H3FA 1DXYA 1KHTA 3DVRX 2BW0A 1MD9A 3QW4B 1N5JA 4QGBA 1EE2A 2XECA 2JGKA 3M4XA 2VK4A 2IH5A 4HHEA 4BFCA 2PYIA 5CAEA 1BXGA 2HRDA 4BIIA 1DT3A 1OW3B 1FJXA 4UBLA 4P93A 1T9GR 4CBVA 1E94E 1V26A 3FFTA 4EKEA 3K4GA 4J0GA 2XGGA 9ICAA 2OXTA 2D1TA 4EKGA 2ADOA 1SIOA 4QIWC 4GC9A 4AMUA 5FPKA 1NE2A 2WYIA 4UAJA 4NBRA 1XWFA 5DHTA 2AFVA 2YMPA 5JBNA 2H85A 1H2WA 4PTLA 2QGFA 3UCEA 2VI5A 2FXVA 1GUDA 4PWYA 4PL1A 5L4SA 4BRWA 1NUSA 3RHSA 3CIFA 4YFVA 1QLWA 2HOIA 4L3VA 3DC7A 5KG5A 5JCOA 3UFBA 1YIAA 2BGGA 5HX7A 3LOPA 5BMVA 4GL2A 3DO6A 5JYBA 3C48A 1L1EA 4R8VA 3Q3JB 3DVAB 2FGKA 1NXVA 1V41E 2AOVA 4FO6A 5DGIA 2PV7A 5LM3A 2H29A 4QTTB 3NVYA 1DXQA 3TW8A 4O4IF 1R4NA 3B1FA 3O93A 4ECWA 4L8YA 3ZKWB 1LC3A 1DXHA 5JASA 3PQFA 3KUKA 1EE1A 2Q6LA 8OHMA 1YJ5A 4QWDA 2C0QA 5HJ5A 2RHGB 1CEYA 1JEEA 2X76A 4FOSA 5E1MA 3D4NA 1E79A 1N77A 4PZYA 4J16A 1PVQA 2CF5A 2I2FA 1CLUA 2IYYA 3Q12A 3EIXA 3RRBA 3TECE 2JGFA 3VO8A 2ORVA 2VIIA 4P82A 4EY8A 4GI7A 2VQSA 5IH3A 3PLNA 5K0ZA 1F0MA 2QTMA 1BDHA 4AROA 3SJCA 4KV7A 2Y0SF 2PAFA 1C9DB 4C76A 1YBVA 5IYZA 1FMFA 3H40A 4YC7A 2H1CA 3E5RA 3KVNA 3GQCA 16PKA 1S76D 1JG1A 4RK0A 3WC4A 1SUCA 3RIEA 4LHSA 1ZD5A 3H9GA 4MULA 5JBQA 4XUSA 2ESEA 4R2XA 1CI4A 1RYNA 3EF3A 5A3QA 5CBKA 5TV2A 1G9SA 1GN8A 1YL5A 4OJ5A 4JOQA 2Y77A 3VNBA 2R8GA 1YJCA 3O91A 4AZVA 3FPBA 3BK7A 1GAQA 1VLHA 1OH8A 1XZNA 2JIZA 1FUIA 4WQMA 5JD3A 4YMVA 1Z88A 4NBNA 4CDNA 4LJ8A 2CJFA 2RSLA 5JLJA 1NZFA 5EWMA 3PX3A 5BUCA 1MXFA 1AGYA 5DP1A 4GFJA 4N49A 2QQFA 1WXFA 4MV0A 4BAUA 4KQIA 4MLZA 3FJOA 5J2UF 1KS2A 3RVJA 5KFUA 5E2AA 1KJ9A 4LMAA 3EXEA 4G86A 4DV6B 1U63A 2YZ7A 4QYIB 4ZQEA 1E89A 5JH7B 5EUMA 2C9ZA 3RF6A 1VB3A 4Q3OA 5JAZA 3PZPA 2HPVA 2XA9A 2HCFA 3AY0A 1ISGA 4YR9A 1D3AA 4PC3A 4IHJA 2G5TA 2ZYRA 4Y30A 4ER6A 3PUYA 1T3NA 1USVA 2X42A 3I92A 4JVLA 1P6QA 3A2KA 4L5JA 3YASA 3ROXA 3M6ZA 3DE3X 5F7OA 2JGAA 2QQ5A 3WV5A 2ZIVB 1KBOA 1EVJA 1PQ4A 1K98A 4J0KA 3VUFA 1Z62A 1QS0A 2DHQA 3ES9A 5JXJA 4RQNA 1SBTA 1L5MA 5K8VA 1T6NA 1BHQ1 1PJZA 1BCSB 1GCGA 2Y67A 2GM9A 3MBOA 3AF6A 2O1SA 2WJ3A 3KOWA 1VJTA 3HCFA 4JUFA 1YZ3A 3FYHA 1FVHA 5EOVA 1YDEA 5NULA 1K4KA 2CDRA 3RH6A 2QZ4A 3MELA 1V6CA 3OLWA 1ULHA 3HA2A 1PZEA 2RIRA 2O5CA 3QQ5A 1NRXA 1KJIA 4HP8A 4N3AA 5ITVA 2PWZA 4E5PA 4XGQA 1XMPA 5AI6A 1WQ1R 5J47A 4X8HA 4MI3A 2B6NA 3FRIA 3B8HA 4FDVA 2R97A 4DCGA 3ZCTA 3BN3A 1WEKA 3D6AA 3PXEA 3VBCA 5SY6A 1W2WB 3VH4A 2ZI7A 2R60A 1N2IA 4I36A 2QTLA 2D1YA 3EVFA 2R8EA 4PIMA 1HT3A 4XD2A 2Y05A 4H3VA 4IIEA 1YZVA 4Q3DA 4URZR 4OI1A 4HXYA 1Z0UA 2E2WA 4YJHB 3BQ1A 5I4IA 2DRIA 3I6ZA 2CKDA 1HUOA 4I55A 5CLQA 4IVNA 2C7OA 3X2SA 2BKXA 1RC0A 4R84A 4OK6A 1XG5A 2EP7A 3CN9A 4G5QA 4MEYA 1WUHS 3QEMB 2GESA 3OE1A 3SIPA 2DUUA 3HACA 1OV6A 3HN7A 1E5LA 3A26A 3TOVA 1LRLA 1HO3A 4Y2JA 3JQRA 3WMXA 2A8YA 1R0SA 4Y2HA 4MVJA 1C0EA 4YO8A 1QJ4A 1LSOA 1ODJA 2B7LA 3N8NA 4MUIA 5L3QB 1I14A 4OUDA 3SAJA 3W4KA 3BIJA 3RD5A 5CB4B 3LBFA 2X23A 1JT9A 3HV2A 5HQTA 1RTKA 2GK6A 3FYUC 4JSRA 2Y0CA 3R7WB 4M1TA 3ZXYA 4ACBA 3KKLA 3K1RB 5REQA 3UEOA 2ZPAA 3EXFA 3WNQA 3L0BA 1WXHA 1YT3A 3A11A 4UTPA 5H1YA 5KFTA 3PEWA 4ZQFA 3OTOB 4AU1A 5AM3A 1FQKA 3ED1A 3JTEA 1GSIA 3FDFA 4K6CA 1W0KA 3BFVA 2FLNA 3FOCA 2WYOA 2RAVA 5TMPA 4W63A 1U5BB 2O8EB 5BXQC 4NF2A 2XW6A 1UA1A 3VNAA 5K8JB 3A2MA 3QOFA 4DQIA 2I62A 3MXTA 2WQ6A 3KT0A 3PTZA 2B7BA 1EFKA 1J7JA 4N7BA 3G23A 4IDOA 4NV1A 5AKJA 1RC8A 2WTEA 3I9V1 1YIOA 1E63A 2AK2A 1NVMB 1IIPA 2X5JO 3LKZA 1VJCA 4GZ5A 3O2JA 3C5VA 3A3NA 4NEGA 4AZSA 2HBLA 3LZDA 2H2IA 3UMYA 5L40A 3NBMA 4FMCB 4DXDA 3BJRA 4ZRNA 1O96A 1JJFA 3I4FA 1B6GA 3RB3A 4DPMA 3SYMA 1SHKA 3R09A 3PJEA 1KDHA 3EOAI 3URKA 2WW8A 3ZQ6A 4IR7A 2O2ZA 3H9JA 3LLVA 2WHQA 1NYTA 2Y8EA 2XCAA 4Q4HB 3VZBA 3AGQA 4JJ4A 3P0IA 4NPHA 4NNPA 1MENA 4MW4A 5FUWA 2QLJA 3A1CA 4GOKA 1AUVA 3OH8A 3UHJA 1T7PA 4HTFB 1JFFA 5IVKA 4HDMB 5A06A 2XPCA 1Z5WA 1ZHOA 1G8KA 4BDPA 2R4UA 3GDWA 3ZYZA 3TCNA 4DYHA 2ZVPX 2VPZA 1L4LA 1XZPA 1J06A 3DDHA 1RZTA 2FPPA 1RDFA 3UFXB 1CDDA 1LBIA 4AP6A 4N48A 4A8JB 4R1NA 3ELDA 4JOCA 1F14A 3QSYA 1F4VA 1A04A 3GLHB 1SR8A 3DJYA 3ND8A 5LMNB 1SOMA 2R1VB 2JD1A 1EUYA 4AECA 5DW3A 4X60A 2DFTA 4TV8B 1JSZA 3VVLA 1FFDA 3QU2A 2HU8A 4YJGA 4YG2A 4EI8A 4KIUA 3F3SA 3F47A 3OEHD 1Q7RA 3JRWA 2RKBA 3DCIA 3IDQA 4DIUA 1YB1A 2XIQA 4RSMA 5DYTA 1E6EA 3VJMA 3VYVA 3WKDA 3ALRA 2IHMA 5I9NA 1QE0A 1RCFA 3E9ZA 2RH9B 4DMMA 4BX3A 1MAVA 4ALJA 3JCZA 2ERCA 3HKEA 5ANRB 4U6QA 3AKDA 4DGQA 5F7JA 2ZIEA 2G77B 2E0IA 1HXHA 3OM0A 1N9KA 3DV0B 3RT1A 3HCPA 4MEJA 5JQGA 2HBJA 3QKRB 1OYWA 3N3AC 2W2TA 4RGQA 1SQ0A 4EHLA 2B94A 1FDSA 3WLMA 3WMGA 4LJ7A 3KQWA 4Z6FA 1M33A 5D4BA 2FG5A 3KB1A 3G9UA 3N28A 4HUQB 3IUSA 3T3MB 2NZ2A 1E5VA 1P6UA 3OPYB 2IS6A 3IERA 5JRDS 1MORA 2O2JA 3WLQA 1L3UA 1G59A 1LSUA 4XJSA 1J1ZA 4MIKA 1THZA 3T5JA 1NUUA 1UFVA 4RIGA 1DV1A 1EZ4A 1MO4A 3VJLA 1Y3FE 2FQQA 1VTKA 5I7VA 3QH4A 1Y9AA 2KIVA 3IMKA 3D6TB 2D1RA 3BS5A 1OAAA 5U4XA 3VR5D 3RH0A 3AM3A 3HKZC 1U4BA 4K46A 2FE9A 4K6FA 4UFPA 1VCIA 2OGSA 1HSOA 2GETA 4LW8A 1Y4UA 1VJ0A 4MCJA 2W6IA 5EE5B 4YR7A 2CL6X 5JW6A 4GMGA 4RZUA 3CW2C 4DIFA 2NO1A 1BSVA 1XQ9A 4ZC8A 4E2WA 2B9VA 3CG4A 5D6NA 3EIQA 3T9CA 5HOQA 1QMPA 4PNZA 2HXSA 4GBMA 2WG1A 1ZNYA 4QELA 3HCOA 3T7DA 1K7CA 3LY7A 4L50A 2GD1O 3ZUPA 4UCWA 4KWHA 4LJLA 4JELA 2IYNA 2UZ3A 3TW6A 1G5FA 5CDHA 1K5GA 4W1PA 2IZOA 4UEOA 3V9PA 1QGAA 1F9EA 4KIFA 3IP1A 3SWWA 4FCWA 5IILA 5DT2A 1NJ1A 3CRW1 4DFKA 3PXGA 4KZPA 4TWRA 2O8BB 1L8XA 1XNRB 2H5EA 4C8NA 1XVUA 3EGXB 4G8BA 2P6MA 4J1SA 4UHDA 3CINA 1A8QA 4MWDA 3SQMA 1Y8RA 4IQFA 3KTAA 5HOEA 3RFAA 3DZGA 3GFSA 4B35A 1OLXB 2PGDA 4E2YA 5CA1F 3MINA 2IV3A 4WXEA 3PMNA 1OTHA 1Q6YA 2BFPA 2VTEA 2IU0A 3FTPA 5C1PA 2AC2A 2GHQA 5LQSA 1T9KA 4BRSA 5IT0A 2QN3A 4U0KA 1U0HC 5C8ZA 5CM2Z 3HKDA 1FTNA 5AHRA 1RE1A 1WVGA 1KP3A 4OSOA 4ABTA 3JQAB 2JIRA 2QAJA 4CQLA 4X20A 2HTFA 4ZOLF 1N6KA 1QWSA 3GJ5A 5IWAB 3JZAA 3LUPA 4OFZA 1X42A 1Z7YA 2G80A 4GKKB 3JTMA 3HR4A 5EJ6A 4MV7A 1XIVA 2NUBA 1J9ZA 1M5TA 1TAHA 4ISCA 2HBKA 4QZBA 4JUDX 5H82A 2PKCA 5EOZA 2FPUA 5LJIA 3BSFA 3S29A 5K6TA 2UXDB 1UKCA 3Q1KA 2GJAA 3SHFA 2L82A 2Z9DA 1EIWA 4WY5A 4YLYA 2QJFA 4CPDA 3QF7A 2XBLA 5FA6A 3LLMA 1FYFA 3WLTA 3R3SA 1CNEA 1NKSA 1H1LA 4B7XA 1NW7A 4I0WB 5J0WA 1JQKA 3VMFA 3QE0A 3KQTA 5UKDA 2BMJA 3GPCA 2DM6A 2G88A 2H1FA 1CR6A 3CZAA 1DVRA 2JFYA 1H93A 4XEUA 3F53A 2WE7A 5CW2A 1S3SA 4DSJA 4GI1A 2G06A 1KJZA 3ILVA 2F8KA 4UPEA 4NZYA 3CF6R 5J5CA 4DXAA 2OUKA 3QVWA 2NYRA 4R98A 4WNYA 3U62A 1OPXA 3K70D 1FL9A 4PO8A 1WCLA 1B26A 2Q2WA 1E98A 2AJBA 1GPAA 3LA6A 3OM8A 4HNVA 2NP6A 5CCEA 4UC0A 4WRRA 2RGUA 4P6VF 3O92A 4TQGA 2JBAB 3STWA 3EC1A 4FGWA 5JD6A 5ALIA 2BFBB 3QVOA 1THTA 2DWPA 3JQ9C 4CUZA 4U3JB 3G9ZA 4XQ8A 3NANA 3LX5A 4CI9A 4Z2AA 5BUQA 2FWNA 4QQFA 4Q21A 3HXQA 2D59A 2YVLA 3KSMA 3UJ8A 1JHRA 4QWWA 3Q5EA 5CNKA 2D00A 5K51A 1LPNA 2OCAA 3R0JA 3MJTA 4UB8U 2Q6IA 1N2OA 3EXG2 1T9DA 4OP3A 3OJUA 4HRXA 2ENWA 2AIRA 4F2GA 4HQ6A 3CXUA 4JJGA 1FX0B 5KZMB 2WHPB 1X7ZB 3SV4A 2ETXA 4OO1J 4EG1A 1XEWY 3DE0X 4L4YA 5FIUA 2JD2A 4J9UE 1AUOA 3ZWNA 3BERA 3U7FB 4FMPA 4B73A 4OG2A 5DXAA 4QWAA 2ZVJA 4BBAA 4R2WA 1L6RA 2AA3A 3AV3A 3O4IA 3ZWXA 4UAWA 1L5KA 5AW4A 3I6IA 3EQ9A 3ZZTA 5B7GA 3AEQB 1NJ6A 3QXJA 1QO0D 2VTBA 3X1XA 1DBSA 4JLNA 1UZLA 5C0YA 4EA9A 4GGPA 1ULBA 1VL1A 3BQ9A 4OH7A 2FWIA 4BQRA 3EMDA 4MS4B 2QRZA 4Y6PA 3ZI7A 2ZI6A 1ORIA 3BK1A 2YBDA 4DV2B 5JY1A 4DR1B 3WJ7A 4QZCA 4DSZA 1QBKC 1NQVA 1HK7A 1CZKA 1L9KA 4AXXA 7ICKA 2YZMA 1NBEA 1P3DA 3GEHA 1TZKA 1RZRD 2BJVA 2I9PA 1AMUA 1CUVA 1ECGA 3QKSA 2QMOA 1MJGA 3EXG1 1AZLA 3Q8QB 2PANA 3ZLVA 4URHA 1IZZA 2GNPA 3SZ3A 1ODTC 1HTBA 4QU8A 1K4MA 2I4IA 1VE3A 1T3QA 1J2NA 4N3CA 2VAPA 4HZGA 4KXQA 5ALGA 2H3FA 1U4SA 3AVOA 1NFFA 4JK1A 2Q49A 2YW9A 3ETNA 4RJLA 2A94A 2V55B 4KLLA 4BC1A 1S4MA 2B4YA 5DB8A 2X0NA 4PHFA 5EIFA 3SM3A 4AD8A 2VRNA 1IY2A 1AQIA 2F90A 3JD0A 3E4CA 1BMFD 3UKJA 3BWXA 3VYSB 4XZ3A 4CRWB 3WWDA 4B34A 3CRXA 2D7JA 1ENPA 3DFKA 1WMDA 1FEZA 3GDXA 5T4HA 4CKZA 2ORYA 4I3GA 4R2MA 5AXBA 3OLCX 2QTWB 2H3QA 3R9IA 4B81A 4URFA 4DDKA 1WMBA 3P20A 4M8SA 3KSUA 4XUDA 1JQJC 2A3RA 2Y1DA 3SYRA 4JL8A 2CUZA 1HYQA 3UOGA 2H63A 1SL2A 1I24A 1P7PA 1SBIA 4PG8A 5IJ0B 1WPRA 1AHNA 3U4HA 1A88A 4XFKA 1T3TA 3GL9A 3ZLJA 2FFJA 2KHQA 2O0LA 3UT6A 2VPPA 1SV0C 2ZB8A 4W5WA 3PGLA 2IA6A 4XIFA 1UFOA 4WZAE 4DT1B 1PW7A 3GYBA 5IVHA 3N4MB 2VDVE 1KK1A 4IYRA 1VI6A 4PC2A 3UQYS 2IE0A 1DE0A 2FX5A 5LMUB 4PX9A 2CFIA 4NZMA 3NYQA 3BA6A 1KZ6A 5D3MB 1ZN7A 5EI5A 2QMQA 3T95A 3DPSA 3CUUA 5AW9A 4RUAA 1XEFA 3O8LA 1V11B 1Z74A 4M89A 1Y0BA 4O2AB 3INTA 2Z2IA 2Y1JA 1IN7A 3MSXA 2E4AA 3K8ZA 3NDJA 1CKEA 2BPOA 2WFMA 3TVDA 3MGKA 1IHPA 2JZBB 5EINA 3GRYA 1V3TA 2BCQA 2Q1WA 4U2KA 1K66A 4RXUA 3GO4A 2FEMA 4M4SA 2ZBGA 3WQBA 2Q5OA 3PX7A 2XNHA 5J23A 9ICQA 2VBIA 2QPLA 2H5IA 1WUTA 5B4VA 3CLRC 2VZ8A 2PMFA 3E0XA 1N4DA 2D5CA 2YV3A 3I58A 4DJTA 2Q27A 4IL6U 4AG3A 1SULA 2ZRLA 4YRMA 2GMWA 4DRXB 3O0TA 3SE0A 3T5HA 1ZSVA 5A02A 3HO8A 4L78A 5FPSA 4H7IA 1GA4A 3O74A 4K9RA 5C4GB 4OGKA 1X6IA 4BX8A 1RHUA 8ICKA 2PI5A 1ZEJA 4OFXA 3U56A 2PGIA 1JLMA 4F4KA 1UDWA 5KFIA 2E5FA 2EQ5A 4ND1A 4DDUA 3E4DA 5DG7A 1H85A 5C80A 3H5LA 1QG0A 2Z9BA 3VH2A 1QVRA 1Q1NA 4QUJA 1PL6A 2GPJA 5K9ZA 1ORDA 1UPXA 4KMRA 3SSMA 4GNRA 4P53A 4KDFA 3R6TA 1FFSA 3LCMA 1GNQA 4GLLA 1QHXA 4YJ2A 3U48A 1V37A 3FJ1A 1CP2A 3H1GA 1Y6FA 3P4UA 2AT1A 3GVCA 2VYND 3N6RA 3COWA 4LOJA 2D8MA 4RK4A 1AN9A 1P2TA 4XR9A 3WYFA 4F12A 4JP5A 2Z6VA 5JXIA 3HJHA 1U3WA 3UQ2A 1HBJA 3DT6A 4TUYF 4PVCA 4RQ5A 2MR6A