5ALJA

Ligand complex structure of soluble epoxide hydrolase
Total Genus 182
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
182
sequence length
546
structure length
523
Chain Sequence
TLRAAVFDLDGVLALPAVFGVLGRTEEALALPRGLLNDAFQKGGPEGATTRLMKGEITLSQWIPLMEENCRFSIKEIFDKAISARKINRPMLQAALMLRKKGFTTAILTNTWLDDRAERDGLAQLMCELKMHFDFLIESCQVGMVKPEPQIYKFLLDTLKASPSEVVFLDDIGANLKPARDLGMVTILVQDTDTALKELEKVTGIQLLNTPAPLPTSCNPSDMSHGYVTVKPRVRLHFVELGSGPAVCLCHGFPESWYSWRYQIPALAQAGYRVLAMDMKGYGESSAPPEIEEYCMEVLCKEMVTFLDKLGLSQAVFIGHDWGGMLVWYMALFYPERVRAVASLNTPFIPANPNMSPLEVFDYQLYFQEPGVAEAELEQNLSRTFKSLFRASDESVLVCEAGGLFVNSPEEPSLSRMVTEEEIQFYVQQFKKSGFRGPLNWYRNMERNWKWACKSLGRKILIPALMVTAEKDFVLVPQMSQHMEDWIPHLKRGHIEDCGHWTQMDKPTEVNQILIKWLDSDAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords BIFUNCTIONAL EPOXIDE HYDROLASE 2
publication title Successful Generation of Structural Information for Fragment-Based Drug Discovery.
pubmed doi rcsb
source organism Homo sapiens
total genus 182
structure length 523
sequence length 546
ec nomenclature ec 3.1.3.76: Lipid-phosphate phosphatase.
pdb deposition date 2015-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 5aljA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 5aljA01
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5aljA03
3EPRA 5E4TA 3B12A 1MAHA 5DNVA 3ZVMA 1EK2A 2QTBA 4AZ0A 1YS2X 3BL8A 2WKWA 5FV4A 5ALKA 5CW2A 3WWOA 1Q92A 3WZLA 4BP8A 2WU3A 2WHPB 2WIFA 2Y1KA 3MC1A 1G5FA 2VAXA 2C9MA 1ZI6A 3WYNA 1ZICA 1YDFA 2J3DA 3ZW7A 3AZQA 4KYVA 4FFDA 4UHEA 1H2WA 1BS9A 1UKCA 3CN9A 3M81A 3I6BA 5AESA 5IT4A 3HYSA 2R8BA 1UWCA 4AMZA 1Y7HA 3FLAA 2WJ6A 2VT7A 3T52A 4EEKA 4QNNA 1FJ2A 1CV2A 3N8GA 1CUWA 3D0KA 1RWQA 2WILA 4W1QA 1CEXA 2ZJ7A 3CXUA 2I54A 3AR3A 2Z3ZA 3O9MA 5AI0A 4DMCA 2G06A 2C0PA 3AR4A 2P11A 4LYEA 3I6YA 4HS9A 1LGYA 4MWTA 5DYTA 3DCNA 1CQWA 3OG9A 3UMJA 4XE5A 3DL4A 5ALHA 2WUDA 4DNOA 4RGYA 2AJBA 3AZPA 1LZLA 3CNHA 1TK3A 2ONCA 2HF7A 1ZJ5A 4KYTA 2WTNA 1XZAA 4EZEA 1RRCA 3HI4A 3RLIA 4Q1VA 4OCZA 4K2AA 4U2FA 3R3UA 5LLSA 2WIJA 3B8EA 1WOMA 4H7DA 1EDDA 3IUNA 3F9CA 2C88A 4DTCA 4Y7DA 1VFPA 1VA5A 4ARAA 4KNWA 1EB9A 3L1JA 1VJ5A 4Q3LA 5BV7A 1E66A 4RE5A 1TJ3A 1XZMA 3LLCA 2R8EA 3SMVA 1Z4MA 3HYCA 1Z4OA 1F8UA 2HL6A 1EB8A 1XKTA 2Y2UA 4OU4A 3OCVA 3OPMA 2HF2A 5EIEA 4UASA 3NUZA 2WF5A 1MT3A 3U1TA 3W5AA 2HADA 1H2YA 4DWOA 1R50A 2G80A 3VJKA 2X76A 4TGLA 1ZRMA 3EIOA 2CFTA 5JASA 1M33A 1THTA 3NASA 4UFNA 3A1CA 4L6AA 5HF8A 3KDAA 4BZZA 2G0AA 1RLOA 2I34A 4BRZA 1QIMA 1X42A 5ALMA 4ITVA 4AZ3A 4FBMA 3LS2A 2C5FA 5A62A 2I78A 3R3ZA 3WKCA 1WB6A 3ANTA 2ZYHA 2CJPA 1MX1A 2PVSA 1YJ5A 2XDWA 2ES4A 2J3QA 3IURA 2R8XA 2W43A 1OXMA 2B30A 4G9EA 3HEAA 4UBMA 3O4GA 4BX3A 5ALGA 3RF6A 3W9UA 5AI4A 5AVRA 1N5RA 1UOOA 1YB6A 1RPZA 1C7IA 2OGTA 4WDQA 2BUAA 2WFMA 2HIHA 1BE0A 4XX1A 4JYPA 2XUGA 4I9FA 4MQMA 1VXOA 3JYHA 4KE7A 3QBJA 3JWEA 3NALA 1ZIYA 3G9XA 4AP9A 4HYTA 4UMVA 5HZGA 3W9BA 3WJ1A 4G4IA 5A3SA 3DS8A 2JGAA 4I9GA 4QJBA 1KU6A 2HA5A 3B9RA 4OB6A 2JARA 1O6FA 1F0NA 2OGZA 5AVZA 5J3JA 3FYUB 2HEGA 1YS1X 4KAJA 1L7AA 2C8KA 3KZXA 1USWA 1A8SA 5HF5A 3QUTA 4OPMA 3D7RA 1JJIA 4MYSA 4B9AA 3DYVA 3WIBA 2OQIA 4UBJA 3BJRA 1AC5A 1K63A 2XUAA 4FMPA 3WK5A 4OB8A 3FLBA 4BKMA 2V98A 2PU7A 3IUQA 3L7YA 4XQ0A 4YIKA 4BAUA 3N5KA 5JAUA 5H3HA 3RFUA 4X6UA 1QE3A 3BJMA 2PSFA 1CUSA 1LBTA 4JUIA 1Y7IA 2Y2VA 1WZCA 1UK6A 1CVLA 4ZWNA 3STWA 5AI8A 1J07A 1QTRA 2G5TA 2V96A 4DFDA 1SCIA 4H7IA 4QWMA 4JB3A 2D0DA 2YMQA 1O6GA 2XUFA 2QR5A 3BA6A 3QZUA 3QMWA 2WJ4A 3H2HA 4FNMA 1LPPA 4WJLA 2G63A 4UHHA 1SC9A 4FFVA 2WF7A 5AW5A 3H18A 1Z4JA 2X8BA 1KU0A 3ZUPA 2HA2A 3FLEA 4F0JA 5D6OA 2WLSA 4P08A 1HL7A 5FPPA 2RGUA 4UHBA 2Z8ZA 1DT5A 2WSLA 1SOMA 3KXPA 3DYIA 1X2EA 1IWOA 4B83A 2ZG6A 4W63A 3G0BA 5SYMA 1U02A 5A3RA 2VJAA 4UHFA 2B61A 5AVSA 3BWXA 2RAVA 1Q0RA 2XUIA 4KE6A 2JGKA 5A3QA 1A8QA 5FP0A 2OXEA 2XUOA 1WVIA 1CRLA 3GA7A 4ZGBA 5IT0A 1ORWA 1QQ6A 2BKLA 3M82A 4HRYA 1LBSA 1ZD5A 1DWOA 1XRLA 2W4MA 3WGUA 4G1FA 3PDCA 5F4ZA 4B6GA 4GIBA 2YMLA 3WL7A 3IULA 1CPYA 5IVHA 1XQYA 1JI3A 1DX6A 4EY8A 5T4HA 3QPDA 5ALPA 4LXIA 5CH3A 3BIWA 3IUMA 1CUAA 2FPSA 1LPNA 1AUOA 4F72A 2V9ZA 1L8OA 3E1GA 1PV1A 1QIEA 2WG2A 4F21A 4LYDA 1CUHA 1BEEA 3BDIA 3G0CA 1C7JA 4XVCA 3RKSA 2WHPA 4AS2A 3P96A 2WHQA 3E81A 4KE8A 3STUA 2XUHA 4FE3A 1CUZA 2DHEA 2XMSA 2GFHA 4OUKX 2WUEA 2JGJA 1IUPA 2HA4A 1ZOLA 5AVQA 3B3QA 3C8HA 3ZPXA 4Y2QA 3FSGD 4B7ZA 3C6YA 5ALIA 3AIKA 2I6XA 1Y8AA 3CN7A 4GHWA 1N1MA 1LPMA 5IVIA 2DQSA 1MX5A 1YNSA 2XUQA 4ZEVA 5CT9A 4HXFB 3QUBA 2GZRA 4DLNA 2FJ0A 4WY5A 5ALJA 1QH9A 1ZD4A 4KN8A 3DDUA 1TRHA 3MVEA 2YMMA 3PCTA 3WKDA 4UMFA 3L0YA 1UK7A 4UUQA 1XZDA 4L3WA 4O8CA 3A1EA 2XQFA 2O2HA 1WHTA 1WB4A 4Q3OA 3WYDA 1YAJA 3HXKA 3IIIA 4X71A 3C43A 2EDCA 2VA9A 2R8ZA 2VJCA 3C70A 2DHCA 4KACA 4LXHA 4EY6A 2WM2A 3EF0A 2Z5GA 4HGQA 2CN1A 2EEPA 2C0QA 1W4LA 2I3ZA 3KWFA 1GGVA 5A7GA 1GXSA 4BYGA 5A7FA 1EHYA 3L0CA 4B80A 4QE3A 2RONA 4U2GA 2B1RA 5BWCA 4FLMA 1RLTA 4I4CA 7YASA 4B0PA 4CF3A 1J06A 3SX4A 4HTAA 4MUMA 1XLUA 4C6HA 3FYTA 1VA4A 2DSNA 3K6KA 3H1AA 2GO7A 4UBNA 2OBBA 2YY6A 5DYWA 3X3HA 5FPQA 2FUKA 1T5TA 5E4YA 1W1IA 4K5QA 3AR7A 1CR6A 1XP5A 1UT6A 5LZ8A 1LPAB 4XWGA 4X7BA 1YS9A 2HM7A 3WKBA 4H7JA 3ZX4A 4M0MA 2P27A 1VXRA 3OC0A 2G09A 2ZBEA 3L1VA 1THGA 1L7OA 2HHAA 1RC8A 2HRQA 4BEVA 5AVXA 1ZI9A 3QU5A 3PGLA 2WQZA 5CT5A 4DM7A 3HZOA 1J97A 4GECA 2JF0A 4J03A 2VJBA 1MX9A 2Y6UA 3WK4A 3CCCA 1QJ4A 3N0TA 3GUUA 1TJ5A 4UMDA 4HXGA 2RB5A 1ZJ4A 1FFEA 2LIPA 3C5VA 1WR8A 1EDBA 1RQLA 4X91A 3F9RA 3FWHA 1XROA 4WCVA 5AH0A 5DNWA 5A2GA 2OM6A 4NVRA 3AR5A 4AN0A 1B41A 1AGYA 3IVMA 4HGNA 2WIDA 3A6ZA 1LLFA 3ZWQA 5LZ7A 4MWSA 4DYHA 3LCRA 3WK7A 3KC2A 2JEYA 5AKHA 4YCLA 4J0KA 5IKXA 3FYUA 3OCUA 2PR7A 4BC0A 3ZV7A 1ZD3A 3EWIA 3AZOA 4FKBA 4BCBA 3WWEA 5AKJA 1XRQA 2IOFA 5C7YA 1Q91A 1Y37A 2OLEA 1UK8A 5LKRA 2PSJA 5IVKA 3ESQA 2YMPA 4ZI5A 3G0GA 2FJPA 2CB9A 1AQLA 4FLFA 2O2XA 4MQLA 1XLVA 2BGRA 2WF8A 5ALWA 5C8XA 5A6VA 3OOSA 4K6HA 1YSCA 3IUJA 3QMMA 3K2IA 2XUPA 3QU9A 3VJLA 2OCLA 2WIKA 2AXEA 1BN6A 3QGMA 5DJ5A 3N2ZB 1P0IA 4G8DA 5I7UA 2PM8A 1IZ8A 5HK9A 4X6YA 2R8YA 5HCUA 2OA0A 1NRWA 1TCCA 3GELA 4EY5A 1ACJA 2QYHA 3F8SA 4QLOA 3UUFA 1ZGBA 3V1KA 4GWLA 1QYIA 5DTIA 5ALRA 4BTLA 5AKZA 4CE6A 1CFJA 5KWIA 2W22A 2QJWA 4N8EA 3PFBA 4MYDA 1TCBA 1G42A 2DQYA 1AZWA 1YCDA 1A7UA 1ORVA 1U4NA 4YASA 3GROA 4Y2VA 2QM0A 5K3AA 1CIJA 4H7HA 2GZSA 3P2MA 3PF9A 1HPLA 3C6ZA 3D2CA 2VF2A 2ZVDA 3FZQA 4BBZA 1MAAA 2HDOA 2VQ6A 4X95A 1OCEA 3PF8A 3SF0A 1XQVA 1AQ6A 2OGSA 4G4GA 3O0DA 4OB7A 1GZ7A 3W2TA 3PDWA 4CNQA 2B8EA 4AMYA 1XRRA 3S6JA 1ODCA 1O03A 1ZIXA 2EARA 2JAUA 1DINA 4H0CA 4QQFA 2YFYA 1QONA 4BX2A 4QDTA 1G66A 2C4HA 3HACA 5IS2A 5JANA 2ODAA 2EATA 2AMYA 4LIPD 1ZOIA 1L7NA 4F71A 1XFDA 3J7TA 3OURA 1N8NA 4BZWA 4PNHA 5D3KA 4UFOA 1FFDA 4M0EA 1MH9A 1Z5UA 2JGFA 3QX7A 1CUDA 1HKHA 1LPSA 5AW4A 4I19A 4J2TA 1AKNA 4M0FA 5AK3A 1HDEA 4G8BA 2BUCA 3W5CA 4G8CA 1GPKA 1Z4KA 3N07A 2P8SA 1CUXA 1L7QA 5AVYA 2WTMA 3H2GA 4MXDA 2IIVA 2AJLI 4CG1A 3H2JA 2HCFA 3IA2A 3OTQA 5IVDA 3DOIA 3VVMA 4OYYA 1GT6A 4J3JA 2BJHA 3WWCA 4XIIA 3WJ2A 2WFZA 4UM7A 5AIAA 2DCMA 2B4KA 1T4MA 1J1IA 4J7AA 5FUMA 4BAGA 1XQWA 5HFNA 2XUKA 3DD5A 3WWPA 1L8LA 3H1BA 3QXGA 5JYCA 5A7HA 3KOOA 1QZ3A 2CUTA 4IH4A 5AP9A 3N28A 3V48A 4AS3A 2ZSIA 2XQGA 1ZD2P 3ZI4A 2J4CA 3QUQA 1P0MA 5ALFA 2OG1A 4N8DA 3C87A 4GEGA 1SFRA 3FVVA 2B1QA 1NU6A 3I2KA 1TA0A 4L6CA 4C4SA 1WHSA 1EXWA 3H0CA 2VSQA 4QDOA 1GQRA 3E3AA 4B9EA 1A88A 1FFAA 2Q4TA 3H19A 3O4JA 2GBFA 4HGRA 4F5ZA 1CUGA 1GPLA 4EBBA 3QM1A 4BYMA 4KR0A 3KWJA 4BTVA 4CF4A 1K6EA 3HABA 2H7XA 2WHEA 3FM9A 2XE4A 1W75A 2E3JA 3DKKA 2XMCA 4E46A 4RESA 4X90A 4JEIA 4QZVA 5HK8A 4KAAA 3G0IA 4KX5A 2HX1A 1RKQA 4Y2RA 3ICVA 3WMRA 2WF6A 4EB0A 4HGPA 1TAHA 3NAMA 5AICA 2QKYA 2HFJA 5AKGA 4QEKA 2YH2A 3FAKA 3HC7A 1PFQA 1AX9A 2ROQA 4AQDA 2X4DA 1XZKA 1CUIA 2BFNA 2WFAA 3W5DA 3R3YA 4U2CA 1WCYA 3AFIA 3O4IA 5AM3A 5AI6A 3L5KA 3GFFA 5K3CA 2ZJFA 4H7EA 2DQZA 1BCSA 4ZV7A 4UW9A 4OSEA 3G8YA 4CG3A 2JGLA 4FFWA 5LZ2A 3IRUA 5D7BA 4AO8A 3FBWA 4ZV9A 5BOVA 2XB6A 3AUKA 2HI0A 5AK6A 3CCBA 2B0CA 2WF9A 1RQNA 3A2MA 3U0VA 1D07A 3ZLVA 5AM2A 1VZ2A 5K3EA 1XKLA 1HQDA 3MUOA 4W1PA 1XZHA 4Y2YA 4DMKA 2IYEA 1R4ZA 1MU0A 4G9BA 5HQ3A 5AW7A 5AKYA 3L8HA 4ZXFA 3ZWDA 5AKKA 3D6JA 1PJAA 4Y2UA 3VJMA 2JGIA 2PKYX 5CRIA 1ZI8A 1GPNA 1XVIA 3NIWA 1G4HA 1K1EA 4MEAA 1W6RA 3MGAA 1B6GA 1YA8A 1F5SA 4TPKA 1VLQA 1EVQA 3QYJA 2IOHA 4BC1A 3IB3A 5AVTA 4E15A 2Z8XA 3QPCA 4AO6A 2HFKA 3KD3A 4K6GA 5LZ9A 2WJ3A 1CUYA 4NAVA 1XZCA 4C89A 5K3FB 4QA9A 1VE7A 4BCCA 4B82A 3GZJA 4QDZA 1ZS9A 2QS9A 2FUCA 4BNDB 3G9TA 3WWDA 4B85A 4X94A 2GHTA 5AKXA 1SWVA 4QWWA 5ALYA 4C01A 4UHCA 3BWVA 4KEAA 3WL6A 2VKQA 2YJ3A 4FWBA 1MNAA 3SHQA 3HSSA 3ZVNA 3AR9A 5AM0A 4B6JA 4L57A 3BF8A 2QMQA 2XMBA 1QOZA 2ZYIA 3AR6A 3G7NA 4KRXA 4RPCA 1A8UA 3NWOA 3QNMA 2BY4A 2CFSA 1KEZA 4YPVA 1VKHA 3M9LA 4BBJA 1I6WA 3V9AA 3WA7A 4P92A 1XZFA 4DGQA 3I1YA 1SU4A 2CBGA 2XUJA 2HA3A 4BE9A 3N1UA 3NGMA 2OCIA 4WFIA 5LIPA 5LZ4A 4IH9A 5JATA 5AHXA 2VT6A 5JAPA 3FVTA 1QIHA 3R41A 4B81A 3L1IA 1XZBA 4X85A 4KRYA 3D5EA 4B84A 3L8FA 2PSHA 1UOPA 5HF6A 4EY7A 4HXEB 2QXTA 4H7KA 2G1AA 1H23A 4UBIA 3RM3A 2HU7A 4YCMA 1BU8A 3ESAA 4H18A 4YGYA 1GKKA 1R88A 1DTEA 5JD6A 1U2TA 2HOQA 3Q8WA 2ZSHA 5AKLA 4PO3X 4PV7A 3FPSA 5CH8A 5YASA 2JGEA 5AW9A 2OPHA 3Q0TA 3BIXA 3WK6A 3LP5A 2R11A 2PQ0A 2XLBA 2OAEA 4JNCA 1KYTA 1O08A 2G4LA 5AOAA 3VDXA 2XMDA 2XLCA 3R4CA 3F96A 2XMGA 2WM8A 3EF1A 3STTA 1HBJA 2QZPA 1TJ4A 3WA6A 5JAHA 1L7RA 3G0DA 3ZTYA 4LKOA 4OYLA 1BCRA 3ILSA 3QYPA 2PPLA 1Z4NA 3QPAA 4YIHA 1BROA 3C45A 4WFKA 1Z4LA 1ODTC 3ZU6A 4Y2TA 1Z5GA 4P93A 1N8SA 1FFBA 3U26A 4W1SA 1LVHA 4ZRDA 3DEAA 2I33A 4QDXA 1TQHA 5EHNA 2MU2A 3F97A 2Q5EA 4J0HA 3RK4A 1AMNA 3ESDA 2QUAA 4D9JA 4DNFA 3PUIA 3E4DA 5K3BA 1E8DA 4H1WA 2C5GA 1P0PA 2D5LA 3ZLUA 3W5BA 2GYWA 3WK8A 3BE8A 1RDFA 2C58A 4A16A 1JFRA 4X6XA 3V1MA 4RETA 1JUDA 2O7RA 4NS4A 3U13A 3JW8A 3VISA 4EELA 1NX9A 2BDUA 4EHBA 4E11A 4EX7A 4RE6A 4CCYB 3PUHA 3ZI7A 4GI1A 5ALQA 1SCKA 2IX9A 3I28A 1N5MA 5D3ZA 2YN4A 3RARA 3E84A 3FSGA 5CBKA 4PW0A 3STVA 2PUJA 3C6BA 2NO5A 4BEWA 2QLTA 2FDRA 1JKMA 3AJAA 5ALTA 4AB1A 5ESRA 3HRHA 1LPOA 5EHZA 5HQ3B 2GMWA 3SWWA 3T4UA 3WQHA 2WU4A 4UM5A 2HA6A 4FDMA 4FNGA 3R0VA 1CUVA 4KNVA 4ETWA 4UFPA 1VOTA 2PKEA 3QLEA 4Y2XA 1DT3A 5AOBA 1E89A 3DNPA 3STXA 2C7BA 2H9YA 2FEAA 3I2FA 2YJ5A 3ET5A 1UZAA 3NRJA 4J0CA 4BVKA 1MN6A 3FOBA 5ALEA 1XPJA 4JH0A 2WUGA 3KD2A 4PQEA 3R3WA 4UAVA 3AR8A 1MJ5A 1S8OA 4QLAA 2YASA 4BVJA 3MPOA 4DMFA 5C8ZA 3NOXA 2YBDA 4I3FA 5K5EA 3E8MA 1W52X 4BRSA 2PL5A 1J8DA 1T5SA 1DX4A 2XQKA 2H7YA 5DLPA 4RNCA 4HVTA 4AXBA 2NO4A 3QU4A 4EY4A 3DV9A 4JDPA 2G08A 4C88A 1QIFA 3L8EA 2VATA 5EI5A 4C4ZA 3V1NA 4NABA 2OCGA 5K3FA 2AJCA 5DWDA 4GW3A 1YV9A 5AVWA 5ALNA 1Q84A 4NZZA 2ACKA 1XZEA 2BUBA 2GHQA 3IDAA 4C4TA 2PSEA 3I2JA 2RBKA 4BNDA 5ALVA 1JMYA 3AIOA 4DMHA 2IOFK 5AW3A 3M83A 2AJ8A 4XJVA 3EQ9A 2CKMA 3DNMA 3O9VA 1FEZA 5LZ5A 4CIBA 2ZBGA 2ACEA 1CUFA 4Q3KA 1XRPA 4YX9A 2NYVA 4BAZA 3A1DA 3ZX5A 5JIBA 1R9NA 2PSDA 5FOQA 5E4JA 4L9AA 3H17A 4CI9A 5CXXA 1RMYA 3WL8A 2YJ4A 3AIMA 1IMJA 3QH4A 4J0JA 4YK7A 1UOQA 3U19A 2GBGA 4G4JA 3C5WP 3R3VA 4H7FA 2FUEA 2PU5A 5FXMA 4YH1A 1NU8A 3W05A 2V97A 3B5EA 3U7FB 2C4NA 3IBTA 4YCNA 3EQ8A 2PX6A 3KSRA 1F0PA 3F98A 4ZEXA 5HF9A 2JAOA 3OCZA 4IG4A 3TRDA 2OYCA 1Z4IA 3A2LA 4EZIA 1K5PA 1CUCA 5JZBA 2RI6A 3E58A 2XUDA 2P69A 2QT9A 1QGED 3MUNA 3QMVA 3ESCA 2HRRA 4PSUA 4F60A 5AM5A 1CQZA 4GLBA 3WIOA 3R40A 3MMZA 2JBWA 3FVRA 4OU5A 1T2NA 1VE6A 4OHFA 3C8DA 1R3DA 3SK0A 1XZJA 1IVYA 4L72A 3EBLA 3LIIA 4KJXA 4TVKA 4BDTA 4IH1A 5BWBA 1QQ7A 3QITA 4Y3UA 2AGVA 5AW0A 4FOLA 1GKLA 3SLRA 2RAUA 3B9BA 3KDPA 4UATA 5CMLA 1DWQA 1QIIA 2CZQA 2Q0XA 1QLWA 2OAGA 4NV0A 3AINA 1WM1A 4DIUA 3H04A 3TGLA 1S2OA 2ZYRA 2HO4A 4G5XA 3PI6A 5C81A 1NNLA 3AR2A 2DHDA 3W04A 2Z3WA 3S2ZA 3WL5A 4GDMA 5I8PA 1H2XA 4UBLA 2I55A 1TCAA 5EGNA 1EDEA 2FPWA 2JAWA 3UMCA 1WPRA 3QUCA 5ISMA 2DR0A 3H2IA 4G63A 3PGVA 4GXTA 3FCYA 5AJHA 2RARA 5AVVA 4DSAA 4CIAA 2O2IA 5T4BA 4C4RA 4BVLA 5FRDA 3G9ZA 3OM8A 3O95A 3ZTWA 1U2EA 1EI9A 1LTQA 2QOEA 5JD5A 1JU3A 2ZYSA 1UKAA 1XRNA 1U65A 5AW6A 3EQ7A 1QQ5A 2EAUA 2VEOA 1N9KA 2QVBA 2FPXA 4C4YA 2B8JA 3U7EB 1E8NA 3DJYA 4FBLA 4CFSA 1CUJA 1CUBA 1MNQA 4JYMA 4IHAA 4C87A 4BP9A 2AUTA 1JJFA 4Y2SA 3SKYA 5T4EA 4G9GA 4W1RA 2QUBA 3QU7A 1LNSA 2BGNA 2PBLA 3QVMA 1T9ZA 3ED1A 4NWIA 2AJDA 3BXPA 5AM1A 3ANSA 5CURA 1DQZA 2B82A 3GYGA 3OCYA 1QIDA 5ALUA 5JALA 5AK4A 5ALLA 1GQSA 2B20A 3IJ5A 4UU1A 1YMQA 1R9MA 3R3XA 4CCYA 3VVLA 2WFLB 5AW2A 2O2GA 3WGVA 1QIKA 3DOHA 3A70A 4BDSA 5EIHA 3WI7A 1VJRA 3I1IA 4GXNA 3UMGA 4O08A 5DNUA 3AILA 4UU0A 5ALOA 6YASA 4OFZA 1QO7A 4PSDA 2G07A 3H2KA 3ZLTA 3ESBA 3FNBA 1IUOA 2WG0A 4LHEA 4UBKA 3ICWA 3WKEA 4Y9SA 4INZA 3L0BA 1QFMA 4H35A 1QIGA 4ROTA 1MO2A 4Y2PA 3W06A 4H77A 3TEJA 3K9BA 4AN1A 4UHDA 3LIPA 5JARA 3BDVA 2WIGA 4IO0A 4X93A 5KBYA 4WDRA 4S0XA 3EF3A 3D2BA 3NUQA 1H2ZA 1L7PA 5EFZA 4KAFA 1L7MA 1WPXA 2JEZA 4AX4A 1TE2A 1YA4A 2RIPA 4BCDA 3I6MA 3M1YA 2K2QB 3E0XA 4QDUA 1E5TA 4NFLA 4ZEWA 1QO9A 2FI1A 3O4HA 2IITA 5AO9A 1JU4A 2CEKA 4DW8A 1TIBA 3F67A 2UZ0A 1Z4PX 2MU1A 2YXPX 5AKEA 2W11A 3D4LA 3R9KA 5AIBA 3ZWKA 1VZ3A 5ALSA 1ACLA 1X70A 5JAOA 1AURA 1OILA 3WK9A 4KX3A 1ISPA 4BB0A 1UK9A 1ZRNA 2XMQA 5CTAA 2I3DA 1F6WA 3GBSA 2X5XA 5AM4A 4W9RA 5HFAA 3OCXA 1L6RA 4UAUA 3PFCA 1QFSA 1W76A 1E3QA 1Z68A 2ZBDA 4UPDA 3YASA 4N5HX 3PICA 5T4FA 3ONNA 2Y6VA 5E2IA 1NF2A 4X3CA 5T41A 1K4YA 3L1UA 2W6CX 1U7PA 1MTZA 4A23A 3A2NA 1TKRA 4HRXA 5DYYA 5CT8A 3QU2A 3U7HB 5K3DA 2IA5A 2Q4RA 3I2GA 1RKVA 4X92A 4ARBA 2OCKA 4DNQA 3UM9A 4GBGA 4U2DA 4OD0A 4E88A 3D2AA 1RMQA 1FSSA 4WY8A 2BAGA 1EK1A 5ALXA 4FHZA 1YR2A 1U8EA 2CMFA 4BE4A 4CG2A 3WZMA 5I9IA 1YB7A 4HZGA 3FYUC 5EHQA 1EA5A 4HGOA 2WG1A 3L8GA 3WKAA 3G02A 1JT2A 1MPXA 5LYYA 3KBBA 3ET4A 4IQ4A 4J0IA 2FPUA 2O7VA 3M3DA 1EH5A 5C8VA 1PW5A 2YJ6A 2GYVA 2FPRA 5AI5A 1FFCA 3SKXA 3V1LA 2ECFA 1EVEA 4DNPA 5IH7A 1RLMA 4IFTA 2XMZA 1EINA 5HKAA 1IUNA 1XLWA 1UFOA 1WPGA 2GBCA 2D2VA 1BRTA 1LPBB 1RMTA 5AOCA 4L0CA 3MN1A 2HU8A 5AW8A 4Y2JA 4J0DA 1DWPA 4P9NA 3DKRA 1BEZA 2O9JA 4WFJA 4DSZA 5FLKA 3S8YA 4Z49A 3SD7A 3UUEA 1HLGA 2ZXEA 5CH5A 2HA0A 3DLTA 4U2EA 3C6XA 4C4XA 5KWJA 1H22A 3U7GA 3DL7A 1K8QA 5FDFA 3HJUA 1RP1A 4FLEA 5DTJA 2ORYA 5A71A 2AH5A 3A3YA 1JMKC 3PE6A 3L1HA 4PSCA 3VXKA 5E0OA 3STYA 2HA7A 3I76A 2C8LA 2XQIA 4CF5A 4V2IA 1CLEA 3IB6A 3WLAA 4NMWA 3OCWA 2VJDA 2BDEA 1UKBA 3HLKA 4N8SA 1U2SA 2P9JA 1IZ7A 3DDHA 1XQXA 1Z88A 4X97A 4PF1A 4UBOA 1XZGA 3SC2A 2I7DA 2MSNA 3NANA 1BN7A 1JJBA 2QRUA 4MWOA 2H1IA 2JGMA 2OQVA 1XRMA 4MEBA 3CZ4A 1WB5A 2XI4A 4XOUA 2GYUA 4EENA 1YAHA 3TJMA 2HSZA 4PNZA 1Q0ZA 5ALDA 2HDWA 1X2BA 1DU4A 4BATA 1RKUA 4EX6A 3TLMA 2VTVA 5JZSA 4FYPA 2WUFA 2WHRA 1J2EA 3FPBA 1CUUA 5EHXA 1ODSA 2ZJ6A 2WFLA 1ZJJA 3DQZA 5LKAA 2B9VA 4EUSA 2H7CA 2QJRA 2DFPA 3ZVLA 4K6KA 4U2BA 2NW6A 5HKBA 3VAYA 4MJ3A 2YYSA 3I6ZA 1QTIA 5AI9A 1ZGCA 1C4XA 4ZREA 2RHTA 3ED5A 1UXOA 2JIDA 4E14A 4EA6A 1Q83A 3VKFA 3UMBA 5CT6A 5EIAA 4Q05A 2ZBFA 4UMEA 4XPZA 5JD4A 4HAIA 2EDAA 4DCCA 5JZ9A 5AKIA 1EX9A 3D3NA 4B0OA 3K1ZA 3ESRA 2QXUA 5KREA 3HLTA 5AK5A 5LP1A 2J4FA 1CUEA 3FGOA 4X00A 2CFRA 1P0QA 1QIJA 2ZOSA 2HHLA 2HU5A 4N5IX 2XMRA 2VAVA 4Q82A 1YASA 5AVUA 2BCEA 2XT0A 1R1DA 1E8MA 3OPXA 5ALZA 1SCQA 1U7OA 5CT4A 1RYYA 3G9UA 4A5SA 5SYNA 5JJBA 4Q34A 3DAOA 2I03A 1ETHA 1Z4QA 2GBIA 1LZKA 4UARA 1SWWA 4FTWA 3FCXA 4J0GA 3I2IA 4KE9A 2RHWA 1XZIA 4CCWA 5CXUA 1DQYA 4LXGA 2G5PA 5AW1A 2FX5A 3I2HA 3R09A 3BF7A 2XQJA 5FKJA 4BX0A 2PUHA 1XZLA 4AO7A 3D59A 5JADA
chains in the Genus database with same CATH superfamily
1OB5A 3LQ4A 2C82A 5JCPA 1FU8A 4IHKA 3HA2A 3K4PA 5F77A 3L92A 3TYXA 3WYFA 4UHEA 3CN9A 2ASVA 2R8BA 5C2JB 3O2SB 3TIVA 3TPZA 4RIGA 5KQPA 5BRNA 2AOTB 1O95C 4GP6A 4KIJA 4CMIA 1SGGA 2NPFA 3N05A 2C4UA 3AR4A 1JIVA 2JFBA 3UKDA 4GDFA 4JJAA 5IBQA 1PK7A 4IJ5A 3GBPA 2VNIA 3BA1A 3UMJA 2CB0A 3DL4A 4C1BA 3IMEA 2ZXUA 4JUDX 1P77A 1PE0A 5SYAA 4K2AA 4U2FA 3L4PA 3R3UA 1ISHA 3AL3A 3TG8A 4A03A 3JQ7A 4BFLA 2H59A 1XZMA 3SZ3A 4HH0A 1Z4MA 4Q01A 3OPMA 3WO1A 5FWDA 2M6RA 2PUAA 3R20A 4DWOA 2O54A 1JRLA 2GSDA 2OWDA 5B58T 3EGOA 1SUBA 3KJIA 4YRBA 3X2SA 2O2SA 1RJEA 2WMDA 1X42A 5ALMA 4EJMA 3LS2A 5KPJA 1GGHA 2I67A 1K8ZB 4NZ9A 4GGMX 3K32A 2GVNA 1N5RA 1UOOA 4RULA 4ZI3A 4ZHQA 2NRTA 5DK6A 3KT3A 4PRKA 2HWUA 1RI3A 5HR7A 1BVRA 4JC4A 4M37A 2IW1A 1F9EA 3O8OA 4CM8B 3I62A 1N0WA 3K09C 4S2UA 5U9CA 3IQWA 1UP6A 1M7HA 1NYTA 4OJTA 1VLVA 3F8TA 3AUOA 4ZAVA 3IR5A 2XHZA 1FMLA 5LQRA 3G2KA 3PGXA 3F6PA 8ATCA 3RD5A 4WERA 2CK3A 4TVSA 1NUQA 3MWJA 4RM3A 1YQTA 3GLVA 1JIQA 1HNWB 4UHJA 3KYBA 3OJ0A 2GM4A 5EUCA 1JQBA 4QWMA 3NDRA 2ZJBA 1ZUHA 4FOPA 4HAYA 3ZE6A 2XYPA 4B4UA 3O1HB 3PGJA 3RC9A 2Z0MA 3SJCA 2AOWA 2R96A 2V6GA 2G70A 2FSHA 2IEDA 2OXEA 1HNNA 1XD8A 3ZDQA 3D4NA 4YAEA 2VPQA 5KNBD 2OQRA 2BONA 1EFRA 4GM1A 4R8MA 3E1GA 2N47A 3AG6A 4WKCA 2CWDA 4IXMA 3HCCA 4ENQA 1B14A 1IOWA 3G0CA 5DHFA 1C7JA 1N3IA 1QFZA 3TNDA 1V8OA 2ZTUA 1KRHA 1CX9B 1JZTA 5KTYA 3LBFA 2JGJA 1D8LA 2C9CA 2BLNA 1HYEA 1Z45A 4Z4QA 5KVAA 2V58A 2AOTA 1T1RA 4ILEA 4KQMA 2DQSA 2ACWA 3E6AA 4DEZA 3VU8A 3HBAA 3FIJA 4WUVA 3VU1A 1L4LA 3RTCA 3RSLA 4J29A 5SY6A 1COWD 1GGEA 5EJMA 2O3UA 5C1BA 2VA9A 1WSDA 2B5VA 4XTCS 3WZ2A 4OMFG 5A7FA 5JDIA 3GMSA 1EHIA 3KFUF 4Y98A 3RRGA 5TMDA 3SEQA 2YUIA 1NW7A 1ZXBA 3U9TA 3KJGA 1JWLA 3ZKWB 2O07A 3BFJA 1OUQA 3K20A 1O97C 1R15A 3WLPA 2OBBA 4NAUA 4QUEA 3H9EO 2Q6IA 8ICJA 1YRAA 2XB8A 1XP5A 3P5BA 2W2OA 4RD3A 3DEIA 1L3BA 4N5MA 5JDCA 2BWJA 3PDHA 1WU7A 3A6GA 3QU5A 1TM5E 4D9GA 1V26A 1EVYA 3IAFA 5C53B 4G1MB 3RRBA 1ZJ4A 5I8WA 1ULZA 2WVGA 3IBFA 4JY7A 5IZ4A 4CM8A 4F5RA 3O2QB 1UBKS 1B41A 3HUTA 1VHLA 2VNJA 5JPIA 2OHOA 4AUEA 2E8NA 2NZJA 1W44A 3FN4A 3I73A 3NQ41 3M9MB 4UUBA 4N76A 3UAYA 1BDBA 2V7XA 1JR4A 4PHGA 3EWIA 4CLXA 1LLCA 1N75A 1ZK0A 2WNHA 3ONVA 3WWEA 4YQEA 2YOGA 2YV4A 5CVDA 2VHUA 2BCVA 2FKAA 5JTIA 1SQSA 4RH1A 5JAQA 5CIQA 4U7TB 1V8ZA 3K2IA 2V5AA 2B6GA 2AXEA 1Z33A 4D81A 1V1JA 1PWZA 1TCCA 2QYHA 3UN1A 3V1KA 1CNFA 5IRCD 3GD5A 1ZM7A 2V6FA 2D06A 2MYPA 4ARZB 3NBXX 4R1SA 2V03A 3CWZA 3PDUA 2EX4A 1B3BA 4DKJA 3EXHB 4JWNA 3EY4A 5M7EA 2GH1A 2HBKA 3GMDA 4M1MA 2QZ4A 2OB1A 2PNJA 3MJVA 3WDMA 5KNCA 5AR1A 5LUAA 3MGCA 5E9JA 5ERGB 2JAUA 3MCZA 1YJAA 1U1DA 4BLRA 3MAAC 1G66A 1E0DA 5LDDC 2DKZA 1L7NA 1EAMA 4TWJA 1KKUA 1N2ZA 4Y9DA 1K6IA 4NV1A 1RPLA 3K1JA 3RYHB 6CHYA 1FIUA 1ZESA 4MPRA 4LDZA 4UTOA 4XVHA 1NQOA 4DN6A 4HH4A 1NVTA 4XB6B 4AX8A 4MB2A 2VG8A 2JHCA 1HF3A 1CUXA 4LQCA 1SQFA 2AJLI 3RUAA 4C5BA 5HIMA 2KNJA 4GM0A 2B4KA 1T9GR 1OA0A 1HDYA 2F62A 3DD5A 3WWPA 1L8LA 1M5RA 1H2RS 3BMOA 1J2JA 4XEUA 1B00A 1NU6A 2ZB3A 2YV3A 2YZKA 2DTDA 2X4GA 5L1LA 2A9KA 2Z2JA 4AWAA 4TMWA 4N39A 3A6FA 3ZKWA 4AIIA 4GD3Q 2QXYA 2DQNB 3S40A 2WHEA 1XVVA 3MS7A 4DCTA 2WF6A 2BFDA 1JFFB 4QEKA 4BVEA 1AX9A 5KT5A 3L6EA 2X4DA 3IIEA 1WCYA 1K9SA 3L5KA 5FBVB 2FYTA 4I1OA 1A9SA 1VI5A 4OSEA 4BNKA 5HPYB 3IRUA 3VHRA 3PFKA 3A9TA 2ESEA 4Q1FA 1E1QD 4Q1CA 3MUOA 3KHSA 1N5OX 3IA7A 3C74A 4IHQA 3B6ZA 3QEAZ 1OLOA 5AKKA 3ZV6A 2G5GX 3ICPA 2NXJA 4YDQA 4CFZA 2QG9A 1OREA 1ODKA 3L0OA 2H4JA 4LI0A 3JPNA 2NZYA 1DRVA 1NYRA 1TD9A 1YMUA 2ASJA 4N47A 5J0SA 4K6GA 3USZA 5KFFA 3DQPA 1OXKB 2Q0ZX 5KAMA 3E61A 1N3LA 1SCJA 3SFVA 1ZS9A 1Z07A 3KV1A 4MVYA 3DTVD 1KJWA 1DO0A 3CVXA 4ZVUA 2ZZNA 4BQEA 1BNCA 4ARZA 1MV5A 5FORA 1AQUA 2FQXA 3AEZA 3UBTA 1KTVA 1C14A 1OSNA 1H8EA 4HAUA 1SKYB 4FDUA 1A8UA 1GZSA 1FY2A 5C5EA 4MW6A 2PXAA 1V4BA 2SKDA 2OV8A 4JQOA 4OK5A 4DSKA 3D9QX 5K6AC 3FOFC 2ECQA 4D6YA 4ZOLF 1TMYA 2CHQA 5JAPA 4Z0NA 5TQ0B 3OETA 2GN6A 3WB9A 1N5XA 4WFQA 3L1IA 1RXEA 5IH3A 1GYPA 3PUWA 1U1FA 4LDRA 2YCBA 1VHDA 9ICFA 2HU7A 1Z5PA 3LC7O 3H40A 3RYHA 2Q8NA 2W4QA 5L4LA 2HOQA 2ENWA 5BYBA 4TV9F 4WKOA 4EVIA 5KDLA 5H2FU 3T95A 4IDFA 2OAEA 4CYMA 1PZEA 3LM8A 1V3UA 3EF1A 2QPLA 1HBJA 2QZPA 2ACVA 3ZTYA 3S3TA 3CH7A 2PPLA 2V5UA 4IGFA 1Z4LA 3B1KA 1V1MA 1ISSA 1YBHA 3O21A 1MB3A 1JL3A 1SPXA 2I33A 1TQHA 5DTMA 4C3VA 2W90A 1RWWA 2JFVA 2BMDA 1DCTA 1QCDA 3TFWA 1S7CA 4N1AA 5L3SB 1TYAE 2N1MA 4IIJA 2AQKA 1XWIA 4NLZA 3WDKA 1ZQOA 2KSQA 3T3NA 4E11A 5JSQA 4QVKA 4MYRA 1NK5A 1BCSB 1AM4D 4RE6A 1USUA 1BHQ1 4HMOA 3V7KA 1JFFA 2AUNA 4NNPA 1HM5A 1OU0A 3GUHA 4W5WA 4KXNA 3WGGA 4ZANA 1B6SA 4Z6FA 4B40A 5FWYA 3WFJA 3SWWA 4DRZA 1C7ZA 3KEQA 3H4BA 4DTIA 1F4LA 1R5BA 3K7EA 3USCS 3BS5B 4Y2XA 2CEAA 4G1EB 3GLFE 1VJGA 5EKSA 13PKA 3DM9B 4LYJA 2HHJA 2V3CC 4A8TA 4DJAA 3SR0A 3FSEA 2A3NA 4B31A 9MHTA 2JFFA 3IVCA 3DC2A 2JXJA 1FLAA 3TNJA 2ZIWB 2R5NA 1CC1S 2OGUA 5GONB 4CN8A 5ULLA 3AEUB 3L8YA 4M88A 1PR2A 4EUEA 1C9DB 3WTBA 4X44A 3M5PA 2JH7A 3TIFA 2H51A 5AVWA 4HFMA 4C4TA 1BMFA 4EBDA 1Y34E 2RBKA 1PFWA 3AIOA 4JDUA 1C2YA 1RWVA 1FEZA 2IUYA 3T38A 5FOQA 3BQ2A 4Q0MA 4MA0A 4WZBB 4MGYR 3C3BA 2Q1WA 4LYFA 2A1TR 3O03A 4PZYA 1I7DA 2PU5A 1NU8A 4OY3A 4IZHA 2BDTA 2ES6A 2OTCA 4RVDA 3QE3A 4ED1A 1NN3A 1Z4IA 4RCYA 2IYLD 1CUCA 3ROQA 1GRQA 1TUBB 2YW2A 3EIXA 2MTBA 3DMPA 2X15A 1Z22A 2O05A 4TYWA 4KWHA 3FVRA 1T2NA 1VE6A 4BTEA 4NMMA 5T7BA 1YBVA 3KS9A 3EBLA 2M2IA 1XXHE 5BWBA 1Z5OA 3X1ZA 3AMZA 3MBOA 4N0EA 1I32A 3D0RA 4D3ZA 2MWMA 2BGLA 2Q1XA 3O0TA 1PSDA 4FEGA 5GINE 1X8XA 1JQKA 2CK3D 1SB3C 2JLAA 3FR8A 1C0IA 5E8RA 3C3CA 3JPTA 1EDEA 4EO4A 3FTPA 2ZT5A 4FC6A 2P5SA 2HF8A 2FFBA 1ZCJA 2IS1A 5BSRA 3AMVA 5JUMA 1FLVA 4CIAA 4BFXA 2QMUA 2ZRBA 4CMJA 4A6EA 4G8JA 3OQPA 3H0LB 2EAUA 1E8NA 1V5GA 3CX4A 4JK1A 4BL5A 3KOUA 3TFQA 1N0HA 3LSYA 2ISSD 3WLFA 1QOPB 3DO8A 3KAKA 4EVRA 7ICIA 3DG9A 5HS6A 5ARDA 3ED1A 4RJJA 5MGNA 3DO6A 1FVHA 4NNJA 4YFYA 3TX2A 3B1YA 2JKYA 2PD3A 4DQVA 4U7CA 4J9NA 1E6LA 1P91A 1AKUA 3VVLA 5AJWA 5A9TA 2P4HX 1EFRD 4H08A 4O2LA 1GPUA 4N18A 1RQ7A 4GXNA 2WKQA 4PFSA 3HU2A 5CVCA 3IMCA 4HNAA 1D0VA 2Q7DA 1NTOA 2BL4A 3UWSA 4S1VA 3KQWA 2YVKA 5G1PA 2VDUE 1R4MB 2WEKA 1Y5IA 3RB6A 4OUDB 2IPOA 3DVAB 2BPFA 2C5HA 3E48A 3R44A 1D8AA 1YZFA 5JXIA 4RMJA 4B4DA 1V96A 4L7VA 2ZIWA 2AG8A 4X8MA 2GWSA 5K3OA 5GONA 4MV0A 4QL3A 4X3OA 3GDGA 1C8BA 2RAFA 4NFSA 2IITA 3EPGA 1W4AA 3OF5A 1I4DD 1QTNA 4M99A 3A2KA 2VRCA 3GV7B 2HBRA 3B48A 1XJCA 5IIMA 1D0IA 1M66A 3W3AD 3QFHA 3GT3A 3CH5A 1N6KA 3DE1X 4KQJA 2XBLA 1FTNA 2VCHA 3JS5A 4ILKA 1FJGB 2R84A 5D8DA 3D7NA 4QKQA 2IHJA 2XV1A 1L4KA 5KKAA 3WIVA 4QXAA 1YBAA 3ERCA 1K1QA 3VH4A 3FNIA 1J8VA 1TKRA 3OJWA 1J2UA 2IA5A 3G79A 2PCJA 2M9MA 4LF7B 4X92A 4WINA 4YXFA 3TOZA 3L6DA 5EUBA 4WADA 1RWPA 3OHMA 3RB4A 1J90A 1SXJE 2Z9CA 2P66A 4HN2A 3MG9A 3NBYC 3KYJB 5F2KA 4QPJC 1Z29A 2WU8A 1MBZA 3CURA 1EVZA 1NXWA 4NMXB 2B7CA 5FX2A 3HGTA 1ODJA 3WKAA 3OC6A 1XZ8A 4JLJA 3L4KA 2R7NA 2H1VA 4UKDA 3MSXA 4H7PA 4G26A 5IINA 4MGZR 1KBQA 5HKAA 2J8ZA 4HDNB 2X5KO 2D2VA 3RAEC 1XWWA 2IQIA 4PGYA 2IIBA 3PSTA 2OZVA 1DBIA 3B38A 4J9VA 3ILHA 2JMGA 4RVOA 2AS0A 5I45A 4KQWA 3F2DA 1NNUA 1QHGA 1SL1A 2W83A 3RIXA 1J56A 4I2VA 4LPSA 5A71A 3U17A 3RIEA 1FS4A 4PSCA 1B4FA 5JMPA 1W4BA 2HA7A 1WXDA 2C99A 4ECXA 3AIIA 1E3SA 4V2IA 3EXIB 3UTDA 1MH1A 4Q03A 4QFDA 4HC4A 5HKOA 3GZNB 3GJ6A 5AJXA 2HPHA 4YLYA 1ZK4A 4HNSA 4WOPA 1ULBA 3KKEA 2ZSBA 1CR1A 3NANA 2ASEA 4M9JA 4WSOA 1CEQA 4CKWB 1EDOA 4JVNA 3CF4A 3K5PA 1B8VA 2O0HA 1Y6FA 2PA0A 4RHEA 3W5UA 4YXJA 4FGWA 3QA9A 2WHRA 2O52A 4GZLA 1A82A 2XRZA 5C35A 1SIBE 1GQYA 1KH1A 2VF7A 4M3NA 3PNLA 2XA1A 4URHA 3VAYA 1YR8A 4E5KA 2F9FA 3V4OA 1HL3A 3HXTA 3BRQA 2C4KA 2ALJA 4F2WA 2Q0SA 4HEJA 3CZPA 1OZGA 1H0RA 4UB1A 1R4MA 4OUDA 2WP0A 3IUBA 1F7UA 4RHYA 3DVAA 2WAYA 5KDDA 5TQVA 1EX9A 4REQA 5KREA 1R8QA 1AZSC 1VSVA 5LP1A 2KB0A 3T94A 4OFWA 4DF3A 2FKNA 2O6LA 3EDYA 4MI6A 1JA9A 2GTPA 4XI9A 2CHGA 3GA0A 3KPUA 1ETHA 1Z4QA 4MSUA 1RABA 5T5QA 2H9AA 2ERYA 1RWMA 3KKQA 3TIIA 4USAA 4RKEA 1PL6A 1XP8A 1M34B 2I9KA 3D0OA 1T2FA 2OVFA 3D59A 3PVXA 3HI6A 2EANA 3VC7A 1IWPB 3RYIB 4Q9DA 4WBNA 2WKWA 1SA0A 3RSZA 4H1TA 4EW1A 1GGNA 2VJMA 3SV4A 1Z08A 3KZIU 2ZSDA 1ZI6A 1EFVB 4XWOA 4MRMB 3KJHA 3ZCSA 1S5PA 1ZQCA 5K0TA 1QV6A 2GPWA 4PZLA 2YV5A 4P4TA 3U09A 4BFCA 4ACBA 5B2FA 1KP3A 4FN5A 3I6YA 4HS9A 3IIMA 1I7LA 5DASA 2BGGA 1CQWA 3B53X 4DR5B 3ZY3A 4RLSA 3F7OA 3OE5A 5JQGB 1JHVA 2IGTA 2AG5A 4I7EA 1L7EA 4AICA 4BQRA 3HI4A 2V0NA 2P9TA 2WIJA 4MPTA 4HDNA 4MUEA 4I36A 5BV7A 1FUUA 3LLUA 5HRUA 2FF7A 4DZTA 2WP8J 1J0AA 1SH7A 2HL6A 2PRKA 3CEHA 3T0GA 5CPFA 1GSIA 4I8DA 4UASA 5C5JA 3NC0C 1S0UA 4DFKA 3PHLA 4N0QA 1C9EA 5TR9A 3NBZC 2E5WA 1QMPA 3M6ZA 3W6PA 4R1OA 3VMFA 3I04M 4JROA 4BNXA 4FBMA 3CWCA 2HVIA 1BXZA 3B6KA 3T99A 1TD1A 5JS1A 3N97B 4RQBA 2I91A 4ITRC 4TYQA 2W43A 2QMEA 2FPKA 1DAIA 1XRSB 2IP1A 4CKWA 2OGTA 1J8FA 5EXDA 3VDRA 2ANBA 3MQFA 3E7FA 4MV5A 3RJZA 3DW1X 5ADHA 1P7CA 4MVJH 2QLJA 5J29A 1U80A 3QX3A 2G6TA 5KAPA 2ZYTX 4DR3B 4DCSA 2GUGA 2ZUSA 2I4MA 4H60A 2H3FA 2EJUA 3G8DA 1AQNA 5E6SB 4DLKA 2Z8YA 3VR0A 3X43A 3V34A 1FDTA 8ICPA 1RCUA 1Q0UA 1NPYA 5DRTA 1MKYA 4BNZA 3WK5A 5KFZA 5HXAA 1VLJA 1YWGO 4XQ0A 1K7XB 2R6R1 4UD2A 1OWOA 5DCUA 2R1TB 4ML3A 4JUIA 1R4NB 4LAFA 1UK6A 3WG9A 3STWA 2RGGA 2ZWVA 3LVWA 4P3XA 1L9KA 2H1RA 1JXLA 2QSYA 3JSAA 1GEEA 1HGXA 4JUZA 3GFPA 3MJ4A 1THMA 2XUFA 4HI0E 2ZE8A 3FCAA 3GVPA 1J0BA 4TL7A 4GMHA 4QOJA 4WNYA 4PZAA 1CRQA 3JAMA 2WPDA 3NMUF 2WLSA 2V4ZA 4UHBA 4QYTA 4LN1A 2JJYA 1WUIS 4ZYZA 2PFQA 4PN3A 4B83A 2VJAA 5KFHA 5FL7D 1J24A 5M3BA 4MEYA 3P97A 2JH1A 4TT3A 3MCTA 5EIXA 1DWOA 1NG9A 2W4MA 2V3VA 3PVCA 1QGOA 1W8DA 2OH2A 5CDGA 1DX6A 1OKKD 1M34A 1C2TA 1Z0FA 3E9MA 2XT9A 5A3JA 2X0DA 1TAUA 1RZRA 2GFQA 2H2WA 1GPWB 3RYIA 2J07A 3RASA 4IS2A 1XJ5A 2CC2A 5KFBA 1XJQA 4U0KA 1CJTC 3AEKB 5BORA 5LMCA 2J0VA 3TG2A 4KTVE 4YRJA 3JQQA 4X1KA 4OUKX 3ROZA 3IQHX 5H59A 4MRMA 3Q8SB 4L4YA 2FEWB 4WX2B 4UEQA 2Q3MA 4DY6A 3JPOA 3IHLA 3AL0B 3E9DA 4UJ3A 3K9GA 2XUQA 4JYBA 3OQMA 4D44A 4OGFA 4DLNA 4IJWA 5KYNA 1XTSA 1W9HA 3O8LA 4IJKA 4DIMA 3FHCB 3UV3A 4UUQA 3S27A 3DDZX 5HEKA 5JQGA 5FPHA 3H8SA 1WB4A 4YBRA 3HXKA 3U7RA 1J1ZA 4LFCB 2Z5GA 5DPMA 1KH2A 3CUKA 5K0LA 3HJBA 1ZVKA 2OD2A 1NNSA 1CJSA 1T5LA 4U2GA 5BWCA 5B30A 3ZNPA 2WDPA 3K9CA 1VSUA 3SX4A 4Z8XA 2B25A 4JJ7A 2F00A 3THXB 2FCAA 1BMFD 1B0PA 5PGMA 3IVGA 3II6X 5BMVB 4K5QA 1LPAB 4OJ6A 5D5HA 4EPVA 1VXRA 2Q5HA 3N7AA 3JYQA 1W5SA 5KOJB 2J9RA 3HZOA 3QE9Y 3PLRA 1G60A 1KZYC 4MH0R 1RQLA 1PZHA 3NM6B 4KTQA 3E9NA 1W87A 1FFGA 5EN4A 3U7IA 2HDHA 3QX8A 2FHSA 4UEWA 5CEJA 2JEYA 4M1OA 2ODTX 4FJ1A 1UZMA 3V9PA 2LXNA 3AKZA 4BVHA 2IYOA 3VSAA 3HTXA 1IULA 4DVGA 3ZHUA 4QSHA 2R1TA 1RXYA 1ZN7A 1LDNA 2W2LA 2RKBA 2X6RA 3UMMA 4M60A 1I7PA 1ZKDA 4II2A 4JC8A 4PS1A 2FLKA 2F9MA 1NRWA 4F4DA 1ADJA 2A30A 3DP9A 1M72A 3HWTA 1EZZA 2XRFA 2P1ZA 4C5AA 1QRUA 4JT9A 5EEGA 3G5LA 4BTLA 4CM5A 2D6FC 2LMRA 4N8EA 5E7IA 1RVV1 1U4NA 5B6PA 1Y82A 2D3TA 2NV3A 3AOEA 3WGIA 1U7WA 3AU8A 1MAAA 5CB8A 3PF8A 3TM4A 3OZUA 2YNMA 4LCEA 3GU3A 4FD3A 1Q14A 3UXMA 1U8AA 2HWXA 1G8SA 5JQWA 1R10A 2YFYA 2VSNA 2OHXA 2ZQYA 3AY0A 2ZITA 1HO3A 2AMYA 5JT1A 4OJYA 4QUGA 2XRYA 1V3TA 4IVNA 3AEKA 4JFRA 3OESA 4LMPA 5COAA 5DEOA 1ONNA 5IAJA 3H9JA 2L17A 3ECAA 3CEAA 1AKNA 2CZCA 2BUCA 1IATA 2CLMB 2VP9A 1L4MA 4GUAA 1L7QA 1PNRA 1SCAA 2RQ5A 1WTCA 2GEVA 1QAMA 3CLUD 5GTIU 2QL5A 2ZBQA 2CHEA 3PUKA 3WTCA 1J21A 5AIAA 2RH8A 3H5IA 3BZCA 3ORHA 3KB1A 3PO4A 1KO5A 3IT0A 5B3LA 9ICLA 4QQRA 3VSDA 1U0OC 1DV1A 3V48A 2QI9F 2HY7A 4WNIA 1SFRA 1L5HA 3I2KA 8MHTA 4N7JA 3GB9A 3H0CA 3ROPA 2D2FA 4F11A 1GQRA 1DC8A 3AFGA 2CL6X 1B0ZA 1CUGA 5HCNA 4KXUA 3WGKA 3THXA 4M04A 4LJSA 2RHHA 3DLAA 3ICXA 3Q7RA 1U9IA 4UM9B 4KX5A 2JVKA 2X1LA 4OM8A 6ABPA 1TAHA 1BQEA 2AGOA 3FAZA 3RFCA 4N0PA 2GZ1A 4BJHB 4EJSB 2AI1A 2GO1A 3DMNA 5KOJA 3L7JA 3RB8A 4DCPA 2F3UA 1D1SA 2ZVQX 1N2GA 1X1CA 1I5OA 1N1DA 2J09A 1SVLA 4RVUA 1UC8A 1U0GA 4UM8B 1X7ZB 4LMBA 5ITSA 2R8JA 2SHKA 1FW6A 5CNIA 5AK6A 1RQNA 1SG9A 4UVIA 5FI1B 2WU0A 4NAHA 5IJAA 1KQ3A 1V5EA 4YPFA 5A9SB 5FO1A 1RBYA 1TJNA 4QBTA 1JEEA 4K03A 4ZYXA 1TEVA 4UNNA 3E2MA 1QCKA 4Y6GB 4KR9A 3VHXB 3V3KA 3P71T 3FDZB 4DLLA 4QM7A 1IY9A 3WLHA 4XD7A 2GCIA 4M1SA 3JQFC 3LX6A 2ISQA 2PT7A 2NPIA 4Z1OA 2CFIA 4BCCA 4BO2A 5TSDA 3PEWA 1Z06A 2JIZD 2PA3A 1XQ1A 2JCYA 2QLMA 4GO1A 4PE5B 4YAOA 2W9MA 1TTHA 4LBVA 1Y6QA 4GU5A 2DPXA 2QD5A 3OD5A 3B3JA 3MERA 1RZTA 2NRZA 4RSRA 4HNTA 1Z3IX 5H5JA 4US2R 5AM0A 4E5YA 2XMBA 3LXUX 1YZKA 5GVRA 1QAQA 2PLRA 4M0AA 4KL8S 1CQJB 4MHSA 1ULHA 1CD5A 1KLNA 4FVTA 3WA7A 2OCIA 3ZWXA 3PV0A 1Z36A 5E7JA 3DBOB 3QQPA 2FEXA 1FYXA 4DA4A 2YX1A 4BMYA 3PG5A 2Z1DA 5C46F 2G6BA 4IICA 3LW8A 3NM5A 1DLJA 5JWHA 3A6EA 1GFSA 4DUGA 4H18A 1ST3A 4B3TB 1DTEA 4ZI2A 5CDFE 3C41J 1UZLA 3PWKA 3NRBA 3NTVA 2QD2A 3C98A 3MNFA 1JR3D 3LC1O 5YASA 3PA8A 1XJ0A 1AF7A 4CCHA 4OXXA 3BQ7A 1OVGA 3GY0A 4RV4A 2VPZA 2QKQA 3NH9A 2C3MA 3KNZA 2EC5A 1K7FB 1TJ4A 3KPYA 5IAGA 3UJ8A 4GNRA 1Z5GA 4P93A 4DSTA 3U26A 4JR2A 1YCFA 1Z2OX 5L4NA 3BWBA 4AS1A 2HUNA 3PUVA 1E8DA 4H1WA 1JWBB 3CU5A 2CYBA 1RI5A 1BVYF 3RUIA 3IAXA 1P0CA 4KGZA 3ONWA 4EMUA 9ICOA 3DZJA 3RWBA 4NYMQ 3T9DA 4M1KA 5MFPA 4A7PA 1SXJC 4C7XA 4S04A 4MUXA 4EELA 2PMEA 2BDPA 1CZKA 1XU7A 5DWVA 3T9CA 4JT8A 1JQLB 3B0YA 2YWHA 3I42A 4FHFA 3P2YA 2C3YA 2FQQA 3ZI7A 4GPAA 1XDUA 1BNOA 4DQDA 3M6XA 4U1RA 1Z56C 2IW3A 1XVTA 4QUBA 2J0SA 2FEKA 4OMUA 4QODA 2RHDA 2OOSA 3AJAA 4AB1A 4PTLA 3MXTA 1X7ZA 5KHLB 3C0KA 2OLJA 2OOKA 3V7LA 5DBHX 4WW0A 3DNPA 4C05A 1NATA 5C5DA 1LFDB 1SBNE 1UZAA 3FYDA 121PA 4NK4A 5TT0A 2HMSA 4J91A 2ZAYA 4G5OA 3SJAA 3A1TA 4RFSB 1MJ5A 4CKEB 3ILYA 3GQCA 2BTOA 4RNCA 3VHXA 5A4AA 5ELLA 3FDZA 5DN9A 4YV1A 1MABA 1OLSB 1V5FA 2C7GA 1GITA 2LDBA 4QATA 2X4LA 4JIMA 3LDGA 4WNAB 4D4KA 1J00A 3R0XA 2CNOA 2RKWA 4MQUA 4CKZA 3KFLA 1JMYA 3LX8A 2AJ8A 2CDNA 4QDJA 5JO0A 1E9BA 4RJ2A 1HRKA 2QB0B 5ES3A 2NYVA 3VOSA 1KYZA 3ZX5A 3PR5B 4JI0B 1YRLA 3P9CA 3NVVA 3V46A 3WGQA 3BB3A 1JEOA 4XIFA 2UAGA 3B5EA 3A4YA 4AU1A 2DPJA 3TQIA 4EQZA 2V0GA 1Z73A 2C2BA 5DTRA 1COZA 1EFLA 3ESCA 3PQCA 2R00C 2HRCA 5U1PA 4LXYA 3QVVA 4DWJA 2PZBA 3ZHOA 3ETLA 5KFKA 2IXTA 4HV4A 4U7DA 4M0PA 3PVSA 1IVYA 3K3PA 3UQ2A 5G0SA 2NP6A 5AW0A 2BD0A 3B9BA 4OXRA 1M8GA 3QTLA 1ND6A 1DUSA 4GGPA 3TGLA 1IEWA 2BJWA 1YVRA 3D4BA 3UGJA 1UT8A 2O8CB 1T3TA 1G8YA 5CPBA 1JSZA 2FR8A 5I8PA 1SQGA 4I6GA 3I45A 5ISMA 4NULA 2MSDB 4DL2A 3PGVA 4GM4A 4BVLA 5A5VA 2WQ6A 4R8LA 1K6MA 2I2BA 2G1JA 5AD1A 2WPDD 4RD4A 1QFJA 1VLZA 4RM2A 4OI0A 5K4GA 2AFRA 1RI2A 1P4RA 5KJFA 1XNJA 4NWIA 2I7VA 3G49A 4O5EA 3PNPA 1NJGA 4E31A 5CDHA 4TT3D 3RS2A 1HDCA 1VB5A 3OCYA 1T2AA 2C4WA 4DSJA 1W7AA 4RPJA 2B20A 1YMQA 1TOAA 4ER0A 4Z4FA 2WTAA 4DCUA 2W6IA 2X8WA 1GNTA 5TC4A 2QNRA 1DBQA 1YONA 3GGPA 1K1SA 2YQZA 4I5DA 2CLEB 4EVQA 2UVUA 1OXSC 2R8IA 2HXYA 8ICCA 3QEMA 3GIKA 3TEJA 3B6IA 6PFKA 2IZ0A 4MYCA 4ZO7A 1N7GA 2UZ1B 2XHEA 3EF3A 2DAPA 2X2OA 4ZVMA 4LPKA 2AR9A 1Q6ZA 3GIDA 2RIPA 4E94A 3KJXA 1Q21A 3DZHA 2EWVA 3KPWA 5HILA 4JLMA 2PGXA 3ASZA 4DW8A 1Z0UA 5GY7A 3JPPA 3R9KA 5IABA 3VGPA 3SOZA 1YB1A 3BAZA 4BMNA 1X70A 1OILA 4TLLB 1GA6A 3P9RA 3GI1A 4L16A 4JXXA 1B0UA 4W9RA 2YFQA 2D1RA 4UAUA 3TOXA 4OHKA 4R2WA 3SQXA 1Z68A 3FNQA 5IBRA 2HIMA 1U7PA 4A23A 3LO5A 4RZ3A 1YIDA 4KFSA 3UHJA 5EHIA 3RGGA 1NRIA 1W35A 3GA5A 4OD0A 3DH0A 3C1TA 1ZR4A 1VCIA 4FHZA 2ODQA 9ICEA 2VTBB 2QB1A 4F2RA 2QN3A 4HQOA 4O3PA 3CR3C 3KJNA 4F2PA 4IR7A 4IR1A 4ANFA 2Q6KA 5HJEA 2PRSA 4H17A 5IH7A 1XLTC 4ZP1A 3MB8A 1Z5NA 2RDIA 2YB1A 1P6XA 1Q2UA 2FPGB 3OTWA 4BDPA 4Y2JA 4LRSB 1NBMD 3OOHA 2O9JA 3NHZA 4TM7A 3SE0A 3Q2IA 4AYTA 2FRVA 4UVHA 2RMKA 1XN1A 2RC5A 1U7UA 5B5EU 1H2HA 4JLKA 5JRJA 5E7QA 2QTNA 3OQVA 8ICMA 4DG8A 3UPQA 3UHPA 3QOFA 3QPVA 3W5JA 2H9IA 4MVJA 4INOA 1P0FA 2C2ZA 4B4WA 1XQXA 1CKEA 4AJ2A 2R48A 4XJSA 1IK6A 3E18A 3SAFA 5KL8B 3EWAA 2IV7A 4FGLA 1DKMA 1GARA 4NCIA 2YQ5A 2YNMD 2EFGA 4PRLA 2Y68A 4BATA 2J5XA 3MFHA 5ED0A 4DV4B 5KVSA 5BY2A 2PJUA 4LXTA 1YHNA 5BSUA 3DFFA 1L3VA 3AYXB 1R8YA 3AB3A 2YINC 3KQLA 3G6XA 2INGX 4B3IA 5KFYA 1NI4B 3TFRA 1ZGCA 4TL9A 3ABZA 4M0LA 1UXOA 3ABRB 2NZ8A 1ZQQA 4EZBA 4KDRA 1L7VC 1ZR2A 2RI0A 3KU1A 5L4SA 2ZBFA 4XPZA 9ICBA 1Q19A 4EBCA 2VBCA 3QNUA 2UZ1A 3F4KA 4PHCA 1RQPA 2PTGA 3CRZA 4JLNA 2A4MA 3HU5A 3Q2KA 2F4NA 3HLTA 1NVUQ 3VC1A 1CUEA 4YYZA 2BGTA 1YE5A 4S1OA 1FSPA 3TXXA 1P45A 3JASB 4DQPA 2XMRA 1I2AA 2KEYA 1OFGA 3I37X 2O7SA 4ENRA 3EGIA 3G9UA 4YP5A 5E1OA 3Q3HA 2M6LA 1IONA 5HDBB 1AKTA 2CXPA 1KO7A 4QICA 1SWWA 4FTWA 2NUTB 3OJEA 3WBBA 2KJ8A 2OAP1 4XQ9A 4KE9A 1R6UA 2AZ4A 3LCVB 1QYWA 5KYYB 2BPOA 3JZAA 1DQYA 2PO5A 3VTFA 5HWSA 3SC3A 1TZJA 1KO4A 2PUHA 4BX0A 1ZK3A 1JSXA 2AN5A 4FDAA 1YR6A 2DTXA 5DNEA 1KFCB 3CTMA 4MA4A 3WZLA 2O2EA 1NDUA 1PKEA 2NU7B 4RXTA 2VF5X 2EKBA 3FMVA 1Z6YA 1OAOA 3H1PA 1XMQB 1YACA 1DXSA 1K98A 2EJVA 4Q4LA 4RL4A 4IMIB 3K4HA 2ATLA 1Z39A 4W1QA 3GVIA 2VP0A 1YBFA 2ZETA 4Q4AB 1QV7A 2VTBA 2DWOA 2H0AA 1P1CA 3AEXA 4TSKA 4HB3A 4KMUA 3S0JA 7ICQA 3H75A 1G3QA 3VVCA 3A7EA 1BOFA 3LLVA 3KLBA 3NWJA 4H7DA 3R7LA 5LA6F 4M1WA 1UBCA 1YC5A 2C5BA 4Q3LA 2IS2A 4G1BA 2Y2UA 3OCVA 3DMRA 2ZRGA 3LGAA 3GGOA 1CY0A 3CGWA 3IQDB 4HEHA 4JGIA 4OAOA 4NPAA 1C3VA 4ROSA 3DXFA 1GU0A 1U3WA 1YQXA 3VZCA 1JH8A 1Z0JA 3KSZO 2W6OA 3U31A 5DBFA 5BPFA 2WWRA 3T15A 3BIFA 3VPBA 3IURA 2C20A 1DLIA 4UBBA 3FI0A 1QWOA 3QI2A 2QN1A 1NURA 2VSOA 2NQ8A 3ANLA 1VXOA 4E5SA 1ZGGA 4R54A 4CT4B 3JCZA 5EJ5A 4F6CA 4AP9A 1XAIA 4EG8A 2XZOA 3EA0A 2CHUA 3D6NB 3FF1A 4KWTA 1NK7A 3LP6A 1MZPA 1GFWA 1W94A 3QY0A 5HF5A 1ED1A 3FRJA 3PY8A 3BDPA 5TMBA 4CF6A 2OV2A 3AUYA 1J8YF 1WWKA 1EK5A 4I14A 4CMKA 4OB8A 4DUGD 1N5IA 2AFIE 2PU7A 4HYYA 5FPKA 4KXMA 5HZKA 4U39A 4IDPA 4ZEOA 1KDHA 4W8HA 2SBTA 2JFNA 4C04A 2F77X 1MQSA 2EJBA 4FFBB 1XD9A 3BA6A 3QMWA 2WAAA 2WSMA 3CJQA 1GUAA 1YI8A 3H4TA 4KVAA 3H18A 5AW5A 4L1KA 2WYUA 4P08A 4MR9B 5DGTA 1KDZA 2WSLA 1SOMA 3B13B 2ZZMA 3DYIA 3NV9A 2EKLA 3C1YA 4XVQA 1IHDA 4KO2S 4KQCA 4UHFA 1JHYA 1CRLA 3K9LA 4Q3CA 2NUTA 4ND2A 4ZDKA 5I47A 3AN1A 2YWJA 4PHTA 3EXHA 3PNOA 5DULA 1ZHOA 4LDNA 4Q3NA 5F4ZA 3RTEA 3QW4B 4K9DA 1GGJA 1IRXA 1NNEA 3JQ6A 1AUOA 1J20A 4FWTA 9ATCA 4OHYA 2WG2A 2D7DA 4LYDA 4ZI7B 5BT9A 5AWFC 4PVDA 3T3GA 2NU7A 3P96A 2QT0A 2POQX 3AJRA 4F3NA 1JX4A 2I1LA 1TYZA 5J8YC 1D9FA 3GCWA 1G4AE 3C6YA 1L1RA 2PZEA 3CN7A 2GCNA 4BJQA 5HIAA 1XO0A 1SULA 5JBNA 4XEHA 1YNSA 2QI9C 1Q1AA 1Z7YA 2XGJA 2GD0A 4WY5A 1Q7RA 2C2DA 3WIEA 1UA0A 1A1SA 1X15A 4H1VA 1XAJA 1JG7A 3OLCX 1UK7A 3PC8C 1OH7A 1USIA 1YULA 3SSOA 4AJ1A 3K8ZA 4PR3A 1F8FA 3C2LA 3DDCA 4L8VA 4F4KA 1B2RA 3L0CA 1KBZA 4TLAA 1UJMA 3L8DA 4B0PA 1L8AA 4RY8A 1BO6A 2R65A 4FT2A 1TMOA 4G41A 4MW7A 3H1AA 1T3HA 1NKCA 5IJWA 2Z43A 4I2DA 2BN4A 3DV0B 2WJYA 3BD9A 3AR7A 3N59A 1KK2A 2HM7A 4IDOA 3EJ6A 4YRLA 3BTUA 3QHAA 4X5VA 5L95A 4NS1A 3OC0A 2WYWA 1HZZA 3L1VA 3VO2A 5CR9A 1YJXA 2IXBA 3FMIA 4I1YA 4WV3A 3Q7PA 1MX9A 1GAXA 1QJ4A 2QX8A 3IV6A 2XEDA 4RY9A 1QFXA 1FFEA 1ENYA 1E63A 5COBA 5DZSA 3A36A 4AJKA 4P3KA 2DWQA 4NNOA 4R0MA 4CXMA 1NXVA 3SYZA 3MDCA 2RHOA 2DULA 1RLJA 4TOIA 2AX4A 3DZIA 3I6IA 3C3DA 4BC0A 4KIFA 4CUJA 4NH0A 4KP7A 1XRQA 2HKIA 1O9BA 5FFMA 2F8LA 1NBOA 4B76A 2JIOA 3OOJA 1JEYB 3SBDA 3ESQA 5FO0A 2VJYA 1U5BB 2VOEA 1H9AA 4HY3A 2BGRA 2BGMA 4HR7A 1U8YA 3KKMA 3QP9A 3QMMA 4DDMA 4FFBA 4D45A 2H0RA 4EY5A 2EFEB 4CMBA 1CFJA 2G0NA 4DLGA 4MR9A 5EWMB 2CY0A 1YCDA 5LOVB 2XIQA 1AU9A 2PT9A 2VF2A 2IHTA 4ELTA 1W36C 1KERA 2K8BB 2UZ4A 2VQ6A 4R3NA 3ICCA 2PLFA 3GJ0A 4D97A 1EJBA 2Z3VA 4ZOQI 3CRQA 2QL6A 4QOIA 3PENA 3T5MA 4H15A 1WD5A 2ZRMA 3EMBA 4D1YA 4E70A 3MCUA 4ZI7A 3A0UA 4X1YB 3V72A 1RNLA 5TQ0A 4A8PA 2ZE7A 3QUSA 1MO6A 3X1XA 1Z5UA 1CUDA 3NKLA 1KWGA 2W6ID 3HP7A 3LFUA 2RDJA 1VG9B 2R66A 2OK7A 3GNQA 1Z2PX 3BB1A 3IA2A 2ERCA 3ZY5A 4QFBA 3DOIA 2KJ9A 2ZTCA 2N1RA 1GT6A 3T3FA 2AF3C 3WWCA 4OJNA 4JQZA 3CVVA 1X0VA 1ECGA 1W93A 1A9OA 2QK4A 3CNQS 5HVNA 2C3PA 4D0RA 3DKIA 3FHTA 1XEAA 3VRHA 3MTBA 3FVVA 2JEJA 3PD0A 3T9FA 3D02A 4F2DA 4KN7A 3MQ2A 2G8NA 4K9LA 4N4AA 1GL9B 2A1JB 3GRKA 1L3TA 3TDNA 2X4IA 1SN7A 1M1ZA 3LG2A 4QUKA 2Y93A 3UQZA 1A4XA 3DKKA 2Q5JA 1VGQA 3GBVA 3FFXA 4CKXA 2ZUUA 3EGDB 4Y2RA 4P5DA 5L3SA 3GRZA 5DQIA 5FLEX 1P9NA 1P4GA 1XHFA 3QSYA 4RZHA 4M6WB 1PGNA 5AI6A 3GFFA 5IBCA 2H63A 1BCSA 2YC2C 4DADA 3A6DA 4S3MA 4MLPA 1RZUA 4ZV9A 3QWHA 2ZSKA 2WF9A 3U0VA 2F17A 5AM2A 2Q9AA 4IMRA 4L8YA 2MRLA 5AW7A 2ZYVX 4MUGA 1AK1A 3MZ0A 1YB4A 3FKJA 4GI3A 3BS5A 1ZI8A 2M98A 3IDOA 5K51A 2D1TA 2B6NA 2QENA 1U5BA 3CONA 3NKVA 3BS7A 3WGTA 2HSWA 4C89A 5K3FB 2XWBF 2VBGA 2CXRA 2HHXA 4N41A 1F8GA 4NARA 3H87A 3UKJA 1SKRA 1OPRA 3AEUA 3KPJA 5EWJB 4FZRA 5CJPA 4W9NC 3HO8A 1JECA 2BFPA 1HIWA 3Q8MA 2ZRAA 3LVBA 2IHVA 1X7XB 2O23A 5EWMA 3WU2U 4NEHB 3HK2A 5TV2A 1ZZEA 3COVA 1ID8A 5LOVA 5JMOA 4B6JA 4DEXA 2QUIA 3G7NA 4AYXA 4FS1A 3NWOA 4AJHA 2P2NA 5FTWA 5JJKA 2E3TA 3QNMA 3IR7A 1OE0A 3M4YA 1RVDA 4WZBA 4X61A 4Q12A 3VC8A 1S96A 1L3SA 2ZKIA 2K4EA 1EDZA 3N6XA 1XZFA 1X40A 3P2OA 4D82A 5LZ4A 3AF2A 4ERNA 1T91A 1IHYA 1P31A 5BR7A 3DBLB 4KRYA 1ZCAA 1MJGM 1TUBA 4X1YA 1GL3A 2QLLA 5LSAA 4ZAWA 4UPVA 2ZVPX 3VPAA 1JLLB 4UEKA 5CH8A 4ND8B 3ITKA 4ZVOA 2CLCX 3LP5A 3NONA 2ZRPA 2AQ4A 3DV2A 1XBTA 1KYTA 5AOAA 2XMDA 3HPQA 2ZI9A 3S68A 1YQQA 3NJ8A 4LCJA 5KC9A 3JPWA 1KOFA 1N5JA 4EGJA 4G5YA 1LBIA 5K0JA 1XNGA 4Y2TA 2XIJA 1WVMA 3URMA 3HUDA 2FW6A 1LVHA 1G8GA 4QG7A 1CFZA 2B8TA 5DKWA 3WLOA 5DSXA 4XFKA 2QUAA 1Z9BA 2A1JA 3VU9B 3BRSA 2X7JA 4RIFA 1SRQA 2C83A 2WHYA 3CKMA 4Q39A 1P2TA 4ZMRA 1WXXA 3U13A 4OTZA 1TM3E 3L6BA 1A9TA 4LHVA 3H8VA 4LV5B 4LWPA 3KE8A 4UTVA 2YXLA 4PG4A 1FS6A 1NVAA 4AQ7A 3ST7A 4GI1A 5E0KB 4BQOA 4FIZA 2MSKA 5D3ZA 1YJ8A 4DYVA 5KNCD 4BX9C 4O02B 3WR5A 4B74A 1JALA 1C0LA 3E1SA 2QZJA 4J3FA 3SZMA 1JJAA 2D0IA 1I5RA 2UV8A 2LPMA 5K4LA 4J9MA 2QY6A 2DPHA 4JUCA 3P9QA 5C52B 1F38A 1K06A 1OFUA 2IF0A 3TD9A 3AXTA 3DVQX 3DXYA 1D2HA 2VDNB 4MR7B 1N6PA 4JH0A 4EF5A 1NQTA 4P4GA 2G67A 1XDGA 4PC1A 3EFBA 3OJXA 1UDXA 3N74A 2J3IA 3LHKA 3NOXA 3SIRA 1PIWA 3PUYA 3TSCA 5KJEA 3HJNA 3O8CA 4ND3A 3WAGA 1QIFA 3AHJA 5THKA 2OCGA 5K3FA 5DWDA 3FFTA 3K73O 3TBHA 1DQPA 4V0LA 1MGPA 2BUBA 5KAIU 1GTG1 3BRWA 2PD4A 4L0DA 4RORA 3PKZA 4KMMA 4C7MA 1JR2A 5EWJA 1OTYA 1APBA 4V0QA 2ACEA 1E2GA 1OZAA 5BXQC 3ZE8A 5J2KA 4MMZB 4BAZA 1X7XA 3A1DA 1ZCZA 2IPLA 2PAFA 3U3MA 1ORDA 3H17A 4QJIA 3MR2A 1UOQA 5IC6A 3C5WP 3F73A 5TMPA 2H92A 1WL8A 4HWPA 2QORA 3TRDA 2EGHA 4URVR 6NULA 1DIGA 4HAZA 5E38A 1NP7A 4G56A 2JC3A 4IQFA 1CQZA 4ZVLA 3PQ5A 4E4TA 3PTAA 4A0SA 5JYEA 1Z37A 2PMKA 3TE6A 1B73A 2QAGC 1U7XA 3D7MA 4BOYA 1G19A 2EX0A 3IP9A 3DKVA 3FDIA 1UXJA 1GKLA 2RAUA 3IPCA 1HTBA 3RH4A 1QLWA 2L18A 3TZHA 2CUNA 4GVLA 1O58A 3H2SA 5I9SA 1M8JA 1KEVA 1W5EA 1RE0A 1P74A 2VVTA 4DSOA 1OX6A 4M1EA 4JC0A 4U6PA 1XWLA 3LD9A 4PZCA 3H2YA 5T3UA 3SQIA 2E49A 3UMSA 4G0ZA 4DXDA 3VTZA 1XU4A 2EQ5A 5K4HA 2OCDA 5BR1A 1ZM3A 4HK4A 2VEOA 5F1PA 2OG2A 3QVOA 3T7SA 2HMAA 1MNQA 2EJCA 4IHAA 2CVZA 3B60A 1RR6A 1CVRA 4KN4A 3SKYA 3IP5A 4R2MA 3T5GA 4DB4A 4WESB 4OH7A 3EXIA 2BH9A 4A0FA 2ZK7A 3Q0IA 1RT9A 4ZIRB 1GUYA 3I4CA 3GZNA 4ZC8A 3GFVA 4FCVA 3AUSA 2QJTA 4I4TF 3RK1A 3UJDA 3OZFA 3GQVA 1T6ZA 2NZ2A 1H8ED 2PMFA 1XKQA 2A88A 4RQ2A 1FMCA 4FDLA 4QZEA 3R3XA 1GU7A 3D6MA 2CNWA 4X8HA 5EMNA 2AEMA 3RW9A 3UWDA 2WNSA 3GUYA 3VKGA 1FYEA 4FXOA 5ALOA 4Q7KA 5FUBA 2B3TA 2XB4A 3TSZA 4XCVA 4F6LA 1MEOA 4ROTA 3M8RA 4WD3A 3W06A 4X54A 3WP1B 4AJLA 4WXRA 3E0FA 5A5FA 2P7IA 4MR7A 4IM7A 3D2BA 3MELA 3BXGA 3RQSA 4G5SA 3L9XA 3HV2A 4RKWA 3P9XA 4OOFA 2JA2A 4ZEWA 3T7KA 4XLTA 4EL5A 3EIUA 4Q9AA 3GLKA 4LV6A 2MU1A 2V9PA 5EZ6B 3ZYZA 4OO3A 1RYUA 2R87A 3TUIC 4ENPA 2I7TA 3QVTA 5ELMA 4XR9A 1YE3A 2GF9A 2VYNA 4NEQA 2G5HB 2KBFA 1T8TA 3CF6R 2QM3A 4RGQA 5CX1B 1EP9A 5DYNA 4K05A 5DW0A 2K60A 1UMDB 2RSLA 2V4RA 2MIIA 1RE1A 5LB4A 1V7QA 4DWIA 3PICA 4AZ0B 5L7TA 3FUTA 3KVNA 1HUOA 3SI7A 1FFUA 1GZVA 1KJZA 1PJRA 1CE8B 4KZKA 2GM3A 2HZ7A 2VDMB 3VYUB 2PGIA 5AHWA 1RMQA 3B1VA 1EFVA 3WGHA 1TTTA 4PWZA 2YN0A 5B3AA 4RPKA 4L76A 5JWRA 1EA5A 4EFMA 4LZPA 4BLOA 1UPHA 2VHEA 5LYYA 2DFLA 4NX2A 3HA7A 5C8VA 1EH5A 4KGXA 4EKNB 1P9LA 1MB0A 2SNIE 1KZ9A 2GESA 2QTHA 1GQ2A 3TACB 4DSLA 3LUKA 3I0NA 3TN7A 1EQ2A 3HBNA 4IDBA 2GDZA 1LKZA 3IUYA 4P3PA 4TKMA 4J0DA 3B3FA 1BEZA 3C15C 4XIJA 5CEEA 2HWYA 2ODWA 7ICKA 3IEUA 3B89A 2HA0A 4C4XA 1V39A 2VHXA 5DTJA 3PXDA 2BR4A 1UJ6A 2WSSA 3STYA 1PUJA 1U99A 2C8LA 3RTDA 3WQBA 3WLAA 4NMWA 3HB7A 1JHMA 2RH5A 2FLLA 1HNXB 2ASLA 4D4MA 2H1IA 2OQVA 1H4QA 4RUCA 4CQMB 4NFHA 4CT5A 4ZIRA 3DM5A 4X9XA 3F3YA 4FSDA 2WWGA 1AA6A 3EPJA 1E5LA 2C9ZA 4K9NA 2J3MA 4XA8A 1UFQA 3V2IA 2ZJ6A 5FYQA 3RHZA 4QOEA 1RHKA 4N03A 3FKSA 1WV1A 1ZIOA 4U2BA 3AXSA 2WKPA 2Y05A 1GNSA 2Z30A 4M55A 5L6MB 2HH9A 4LGCA 4J7UA 4DILA 1VG0B 1E59A 2YYYA 4K4GA 4ATNA 4K2HA 1XHLA 2EG9A 3L3FX 3C5EA 5IDWA 5E6SA 4X1OA 4GEKA 3B6JA 3RSQA 4H2DA 2Y8EA 4UMEA 4PLFA 2W37A 1YUNA 3DCYA 5AJZA 1KZGB 3D3NA 2MT9A 4OI4A 3EVEA 2JLZA 3I52A 1R4NA 1JAXA 2HHLA 1JW9B 5TF0A 2UYOA 1ODFA 2O8VA 3TZLA 2ILTA 5B5SA 5JNTA 9ICAA 4A5SA 4YUAA 5IDQA 4Q4CA 3B7PA 2D5CA 3BD8A 1E3EA 1R6BX 4C2TA 4FJ0A 1K7CA 3A06A 4EP1A 5E9AA 4Q8FA 1JE1A 1ZQTA 2EGGA 3E7XA 5L51A 4ER7A 4RJTA 2D7JA 1K08A 1UOEA 3MBKA 5THQA 5E3HA 2O0KA 1UMDA 5ADUS 1J9EA 1K3UB 4L02A 4AZ0A 4LS3A 2BI8A 1Z6GA 1QP0A 2JCGA 3T5TA 4XUCA 3V55A 1Z8NA 3ZDBA 4Z54A 4OHUA 1KNXA 1UWCA 1QRSA 5EZSA 2ZM5A 2ATEA 3GILA 4JX8A 3G68A 2MHCA 3C85A 3DFMA 3HS3A 4HRAA 3ND6A 1T5BA 2ESRA 3GOQA 5G02A 4MV3A 4TUSA 3EX7C 1WF3A 4NR0A 2YL2A 1KDOA 2IV2X 3UY4A 3RVBA 4ESVA 1W46A 1H5QA 3OH8A 3CZRA 3I8OA 5K3SA 5DXJA 2VP4A 4DNOA 3AZPA 3HXOA 1CY1A 3DLHA 1ZJ5A 2V7PA 4HWOA 5EMJA 3RG8A 1V71A 2C57A 1SZHA 2FVXA 2P0EA 3NTQA 3VOBA 2BOVA 2H2GA 2AL7A 2VH2A 1Z63A 1E66A 4G4SP 4TRJA 2FN8A 5GADl 2R8EA 3JQEA 1F8UA 4C2UA 3RJFA 1UEXC 4D9FA 2DPIA 1R50A 4EG5A 1YE8A 2ZIXB 5KFIA 1THTA 4KXWA 1RQ2A 3KYDB 5LUBA 2P9YA 1FRZA 3KR2A 4BZZA 4O5AA 3SC2B 1KSHA 3VUEA 4U5QA 4O4IF 3NS1A 2H2HA 4ZZ2A 2I78A 4ECVA 2VRCD 3VKVA 1NJ5A 2VNSA 2AG0A 1DKPA 1JHOA 1U6JA 5BMVA 1KXJA 3HXMA 3HCNA 1XN4A 4CQMA 3CX8A 1FA9A 3JYHA 5A4JA 2IL1A 3KB2A 2RGCA 5G3ZA 1SHKA 3DCIA 3QVJA 1MHTA 4EFKA 3PX2A 2NO1A 2H7VA 3B3AA 3EH2A 2BHLA 1D1TA 2ENUA 2VHJA 2A5JA 2GZMA 2NPOA 3DMHA 3LWDA 3I34X 2KWIA 3IH5A 4CLOB 3BH0A 4ZDWA 1E1MA 2J6IA 1WBDA 3S2EA 7ICLA 2VNHA 1SB9A 1Z18A 2P4EA 1BQ4A 2VZ9A 1FXWA 5LQDA 1KZHA 1XT6A 4ALMA 5AI8A 3E9CA 3PXCX 2XRMA 3JV7A 1HXHA 2K4IA 4RTSA 1ZGAA 2HA2A 3TVDA 4F0JA 1GAWA 1DT5A 4JC5A 2QZ9A 5CNKA 3KKPA 2FEOA 1JF8A 4KE6A 2A33A 5DEIA 3IX7A 2VK2A 4OMDA 1ZD5A 2Q21A 3E22B 1Y0BA 1D03A 3J80A 3GPBA 3L4JA 1XQYA 2WQ7A 1IV8A 4OQMA 2B8NA 3NO4A 3BIWA 2ZWMA 1NC1A 4PAQA 3HBFA 2O5RA 4RX1A 1UBEA 3RLFA 3M34A 1ZQWA 2PFOA 3C4JA 4FBUA 5TT1A 2CT8A 4R9RA 2LV8A 4WT7A 1YZLA 2KX7A 3JYOA 3LVQE 3COJA <