5ALJA

Ligand complex structure of soluble epoxide hydrolase
Total Genus 182
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
182
sequence length
546
structure length
523
Chain Sequence
TLRAAVFDLDGVLALPAVFGVLGRTEEALALPRGLLNDAFQKGGPEGATTRLMKGEITLSQWIPLMEENCRFSIKEIFDKAISARKINRPMLQAALMLRKKGFTTAILTNTWLDDRAERDGLAQLMCELKMHFDFLIESCQVGMVKPEPQIYKFLLDTLKASPSEVVFLDDIGANLKPARDLGMVTILVQDTDTALKELEKVTGIQLLNTPAPLPTSCNPSDMSHGYVTVKPRVRLHFVELGSGPAVCLCHGFPESWYSWRYQIPALAQAGYRVLAMDMKGYGESSAPPEIEEYCMEVLCKEMVTFLDKLGLSQAVFIGHDWGGMLVWYMALFYPERVRAVASLNTPFIPANPNMSPLEVFDYQLYFQEPGVAEAELEQNLSRTFKSLFRASDESVLVCEAGGLFVNSPEEPSLSRMVTEEEIQFYVQQFKKSGFRGPLNWYRNMERNWKWACKSLGRKILIPALMVTAEKDFVLVPQMSQHMEDWIPHLKRGHIEDCGHWTQMDKPTEVNQILIKWLDSDAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords BIFUNCTIONAL EPOXIDE HYDROLASE 2
publication title Successful Generation of Structural Information for Fragment-Based Drug Discovery.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 182
structure length 523
sequence length 546
ec nomenclature ec 3.1.3.76: Lipid-phosphate phosphatase.
pdb deposition date 2015-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 5aljA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 5aljA01
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5aljA03
4KE6A 3H1BA 5A2GA 5HFNA 1CQZA 3VVLA 1VXOA 3GROA 3I6ZA 1GQSA 3OCYA 5AP9A 1UKCA 2Q0XA 4BP8A 2WUGA 5ALNA 1YAHA 5CXXA 2WF6A 1IVYA 1E89A 4H35A 5FDFA 3EWIA 5CT8A 4D9JA 3L1IA 4DIUA 3E0XA 4YIHA 3M81A 3PGVA 1Q92A 2G5PA 3RM3A 4UARA 2OAEA 2ZBEA 3N0TA 2X4DA 1XZGA 3WL7A 1YSCA 1JI3A 4ZI5A 2B30A 4X7BA 3OC0A 4U2CA 4ZEVA 2HI0A 4UFNA 3F96A 2G0AA 3H1AA 2QKYA 3MVEA 2DCMA 2ACEA 2WFLB 2QYHA 1Y37A 1LBTA 3L8HA 1IUPA 1XRRA 3ZWKA 1YV9A 4FHZA 3TJMA 1ZD3A 4X95A 5KWJA 2WF8A 1YCDA 2GYWA 1PFQA 3FWHA 4OPMA 4UBMA 4MYDA 1FFEA 4CF4A 4KYVA 2OPHA 5C81A 5EHXA 5HF5A 3WWDA 4N8EA 4V2IA 5IT4A 2JARA 1RYYA 3ESCA 4BC1A 1Z4PX 3IUQA 4Q82A 3OCWA 3OCZA 3LIPA 3EQ7A 3R9KA 1U7OA 4J7AA 1LPOA 4G8BA 3ZX4A 3Q8WA 2RAUA 2AGVA 3A2LA 2WSLA 4UBKA 1RMTA 3D0KA 5LZ8A 3MN1A 4BKMA 2CZQA 4HVTA 1NF2A 2G5TA 2O2IA 4QNNA 1ZS9A 2XQJA 5HK8A 1BU8A 5HKAA 5JAOA 3FOBA 2GO7A 2ZJ6A 4YK7A 4DTCA 3N5KA 1OILA 5CRIA 4CIAA 4QA9A 1XRPA 1XZKA 2HHLA 1H2XA 2WIDA 3RFUA 2H1IA 2OG1A 3TGLA 4KYTA 1U65A 5AW5A 4BE4A 2WF5A 3BJRA 1CUGA 3WKAA 3WL5A 2FPSA 5ALUA 3L1JA 4N5HX 2AH5A 1LBSA 4U2EA 3ZVNA 3UMGA 3UMBA 2RI6A 1RQNA 1ZD4A 3AR2A 4JUIA 3DKRA 4IH9A 5CH3A 5T4EA 2PL5A 5JIBA 4PSUA 3IRUA 3QX7A 4HS9A 4CG3A 1EB9A 4H1WA 1F0PA 3RKSA 3FVTA 1E66A 4Q1VA 3FM9A 2JGAA 3NANA 3PDWA 3C5VA 5D3ZA 2P69A 5AKLA 1J97A 5DTJA 1GQRA 3W9UA 1MAHA 5T4FA 4P92A 5FPQA 1JT2A 4N8DA 4E15A 3HJUA 3I2IA 2PKEA 2PSJA 3L1VA 3K6KA 5JZSA 3SKYA 2WIFA 1ODSA 3WZLA 1EK2A 4G9GA 2ZG6A 5J3JA 3D2CA 2IIVA 4BVJA 5LP1A 1YB7A 2YMQA 3IULA 1RWQA 1M33A 3ZI7A 5JAHA 3PI6A 2WG0A 1VA5A 2ZVDA 1AQ6A 4LXHA 3I76A 3KWFA 2X76A 1CV2A 1VE7A 1RLTA 2XDWA 4J0GA 3VKFA 2W4MA 3U1TA 1LPPA 2G09A 2PR7A 3EF1A 2V97A 3F97A 2AXEA 4H7EA 1MPXA 3DYIA 2PSFA 3ESBA 2V9ZA 3EBLA 4NFLA 1Z4MA 4ROTA 3FPSA 3QITA 4C89A 1CUHA 1A7UA 1MNQA 2VJBA 2XMBA 4Y2SA 1QIIA 4EX7A 3NRJA 4EHBA 4HXGA 1DTEA 1HPLA 1TE2A 5FV4A 4I4CA 1TK3A 1O6FA 4O08A 4A23A 3ZLVA 2FDRA 4C4RA 1FFAA 3W06A 3BWVA 4K6GA 4MEBA 1IUOA 1DWPA 2WQZA 4B85A 3WIBA 1BS9A 3ZWQA 1WR8A 3NWOA 1IWOA 1N1MA 4KX5A 3R3ZA 4BVLA 1BROA 1L7PA 2ZXEA 3IDAA 2JIDA 1K5PA 1QONA 2GFHA 1NX9A 1IMJA 4NZZA 5DJ5A 5AK5A 4J3JA 3DDUA 3BXPA 3WWEA 3WKCA 3ZI4A 4E88A 1CUFA 2WU4A 5AKKA 4U2FA 5YASA 4IH1A 2VTVA 3OCXA 2CUTA 5JJBA 2OGSA 5AM0A 1B6GA 2K2QB 1GPKA 4UMVA 4PF1A 5HQ3A 2AJBA 5EIEA 1BCRA 3LP5A 3QVMA 1YS1X 4XOUA 1ISPA 4U2BA 3OPMA 3DDHA 2CFRA 5K3EA 3SHQA 2JEYA 2XMQA 1U2SA 3M82A 1HQDA 2ORYA 1Q0RA 1W6RA 5CT4A 3KC2A 4K6HA 1XRQA 1QIDA 4CIBA 3R3XA 3O95A 3Q0TA 4MUMA 3KZXA 1WPRA 4L6CA 4UPDA 4UATA 2RBKA 1TJ3A 2HA6A 2JGMA 3IURA 1VE6A 5CURA 1F5SA 3C87A 4BCDA 3HABA 1FEZA 4FKBA 3EIOA 1G42A 3NIWA 3WIOA 2B0CA 3O9MA 1UOQA 1QIGA 3SC2A 4FFWA 5KBYA 2EDAA 3CZ4A 2Z3ZA 2VKQA 3RF6A 5F4ZA 1AUOA 4HGOA 3GFFA 3OTQA 2JAUA 1ZGCA 1BN7A 1QIFA 2YYSA 5IH7A 4XIIA 2XUGA 1L7MA 4BAUA 4JDPA 2J4FA 4AQDA 4ARBA 3FYUA 2WJ3A 1WB5A 5AI5A 4X94A 3GBSA 2PKYX 1NU6A 4L0CA 5I9IA 1THGA 5ESRA 4QDOA 1C4XA 2RARA 3IJ5A 4GLBA 4F5ZA 3ILSA 1QTIA 5LIPA 3I6BA 2I03A 3EF0A 1OCEA 1ZI9A 3STYA 4OB6A 3CN7A 2BUAA 5BWBA 4XVCA 1DWOA 2WHEA 5AI8A 3VXKA 4OCZA 4WDRA 4MXDA 3CN9A 3ESAA 3FVRA 3WK4A 4DCCA 2ONCA 5AW0A 3G9XA 5AW9A 1SCIA 3U7FB 3QNMA 2DQYA 1UFOA 1P0PA 3U19A 2OCKA 2VSQA 5AJHA 3LS2A 4KE8A 1QIMA 3D6JA 1ODTC 2ZYHA 2HX1A 2PQ0A 2YMMA 4E11A 5HCUA 4RE6A 4B6JA 1AZWA 5ALJA 2J4CA 1UT6A 3G9UA 4H7FA 2VAXA 3DYVA 2QJRA 5AM4A 2W22A 2WLSA 2FUCA 5AVSA 3AR8A 3STVA 1QIHA 4OHFA 3BIXA 1JU4A 1S2OA 3L5KA 2GBIA 1XZAA 2AMYA 4G63A 2EATA 3U26A 2I7DA 2QS9A 2C58A 4YASA 2WILA 3FYTA 4X6XA 2WTNA 4RE5A 3K1ZA 4QJBA 1EHYA 4RNCA 3R3VA 2XUOA 5IS2A 2RHWA 5CH8A 3V48A 2HRRA 5A3RA 2Z8XA 2YASA 1XRMA 3AIMA 2IX9A 5KREA 1A8SA 3H17A 2ZBGA 2FEAA 3I2KA 3H2IA 1Z4OA 1TAHA 2XMRA 5AM5A 4G8CA 3R4CA 3O9VA 3WWPA 2IOHA 3L7YA 2Y1KA 3ET5A 4GXNA 2AJ8A 5AM2A 1UZAA 4WJLA 1JMKC 3C8HA 2HSZA 1F6WA 3R3UA 4BX3A 2OQIA 4LYEA 4J2TA 4ARAA 1NNLA 4LIPD 3SKXA 2XT0A 3WGUA 1UK6A 3QPAA 2HL6A 2R11A 4AZ3A 1X70A 5AOAA 4HYTA 3H2JA 1A8UA 3ESDA 4FBMA 4LHEA 2YBDA 4KACA 4A16A 4N5IX 2HA7A 4H7DA 1X42A 1RRCA 2EEPA 4G9BA 3BDIA 3MUNA 1QZ3A 3J7TA 3AIKA 2QT9A 2P8SA 2FPRA 2WKWA 3SX4A 3W05A 4EBBA 4L72A 4UAVA 4H18A 2WF9A 1GKLA 3QPCA 1J1IA 1UXOA 4QDTA 2YJ3A 1FFCA 1ACJA 3A1DA 4XPZA 1XLVA 3WYDA 2BDUA 3TEJA 2YFYA 1X2BA 4DNOA 1YB6A 4Q3KA 5A7FA 4RESA 3RK4A 4UAUA 5LZ2A 4KAFA 2CKMA 1DQYA 1QQ6A 4JB3A 3QM1A 3A1CA 4BYGA 4AN1A 3P96A 2GYVA 2V98A 3WGVA 5AKZA 3KDPA 3MPOA 4AS3A 4QLAA 5SYMA 4BAGA 4KE9A 4ZGBA 4L9AA 2HRQA 5DYWA 1WCYA 3C6YA 1XQYA 2Y6VA 1GPNA 2QVBA 2JGFA 4N8SA 2I3ZA 2JGEA 5AOCA 4BYMA 3F67A 2OLEA 1LPBB 1B41A 5AK6A 4PO3X 4KJXA 2WIJA 4ETWA 3QPDA 1WPGA 4EELA 5AVTA 3QZUA 1QIEA 4ITVA 4CG2A 1HDEA 1VLQA 3ED5A 3T4UA 2GMWA 5DYTA 2ECFA 2HADA 3G0DA 2PU5A 2D5LA 2XLBA 5CH5A 1UKBA 1QQ7A 4OYLA 2GHTA 3ANSA 3HEAA 3U7HB 5A7HA 2JBWA 3BDVA 1L7OA 3UUEA 3QUBA 2Q5EA 1RDFA 2OA0A 4ZREA 5AM1A 4EY5A 3YASA 1O03A 5AKJA 4AP9A 4EUSA 1AURA 5E0OA 3BWXA 4LXGA 3A2MA 1XQXA 4CCYB 4DYHA 3N28A 3L0CA 1XZHA 2R8EA 1CUBA 4KEAA 4B84A 4X00A 1W52X 1Y7IA 2HA0A 3N2ZB 2YH2A 1CUYA 4U2DA 1FFDA 3H2KA 1WB6A 4Q3LA 2FI1A 1CIJA 2YN4A 3ZU6A 2GBCA 3AR4A 5JZBA 1EB8A 2XMSA 5ALYA 2C5GA 3QH4A 4AXBA 3DV9A 1MN6A 1AC5A 4MEAA 1CQWA 2YMLA 5FUMA 4J0IA 4YGYA 2YXPX 5EHZA 1YJ5A 2CJPA 3FPBA 2HDOA 3W5CA 1THTA 2I33A 1JKMA 2J3DA 1NU8A 2FUKA 3WA6A 1SU4A 4DW8A 5FOQA 3PE6A 3FCXA 5ALWA 1QE3A 2XMGA 4IHAA 4QDXA 5AI6A 2PX6A 4JYPA 2XQFA 3ZPXA 3HXKA 1GZ7A 2OXEA 4JEIA 1TIBA 3M1YA 1CRLA 2XE4A 5DYYA 3F9CA 2ODAA 3DOHA 3R3WA 3ANTA 1ORWA 4CF5A 3DEAA 3QU9A 3STXA 1LZLA 4FWBA 5FP0A 5ALXA 3I2HA 4BRZA 1LPMA 4J03A 2QRUA 1VJRA 1UK8A 3PFBA 1U8EA 1LVHA 2ACKA 3WZMA 4UMEA 1WM1A 1XFDA 5I8PA 5DWDA 2R8YA 4ZV9A 5ALLA 4AS2A 5AVRA 3HYCA 2P27A 1JJIA 4B81A 3AIOA 4XX1A 1YA8A 3FZQA 2W6CX 2C0PA 2WHQA 1VKHA 3FLAA 3U7EB 4DM7A 3I2GA 2O2HA 4W1QA 1R88A 4C88A 5ALSA 5JD4A 2H7XA 1U7PA 5HK9A 3I2FA 2VAVA 4AO7A 4OUKX 5HZGA 4EZEA 3WK8A 4BEWA 4GBGA 2BCEA 1TA0A 4UBJA 2B8JA 3UM9A 1ZIXA 1QLWA 4UBLA 1J07A 4PNHA 4YIKA 1MAAA 4B6GA 2BJHA 4Y2RA 4I19A 4CG1A 4PV7A 1W4LA 2DR0A 2UZ0A 4X6YA 3DAOA 1GPLA 1XZDA 5C8VA 4FE3A 2HA4A 1K8QA 2QM0A 4KAJA 2BGNA 4KN8A 1QQ5A 3MUOA 3B9BA 1Z5UA 4PSDA 1K6EA 2NO5A 1P0IA 3JW8A 3EF3A 4H7JA 4LKOA 1XZBA 1P0QA 3A70A 5JATA 5AKEA 2VA9A 3K9BA 3FNBA 2HA3A 3QU7A 3WK9A 5EHNA 3VVMA 4G4IA 1P0MA 2JGIA 4NABA 4C4YA 1T2NA 4W1RA 5ALIA 3JYHA 4BZWA 2C5FA 1E8MA 1VOTA 2QXUA 4NWIA 2PSEA 2RONA 4P9NA 3H19A 2B1QA 1L7AA 5AKIA 1XVIA 5AICA 4UHFA 2DQSA 2Y2VA 2I6XA 2VQ6A 3STTA 4L6AA 4CFSA 1R50A 1T5TA 5SYNA 4UMFA 3IUJA 4B9EA 4Y3UA 1BE0A 2PBLA 5A3SA 3V1NA 3SF0A 5CMLA 2PU7A 3ICVA 1XQWA 1W75A 1DT3A 2GBFA 5HF6A 3WKBA 4FFVA 4QDUA 2ZSHA 4J0JA 4EA6A 1CUUA 3NOXA 4M0MA 2RGUA 5ALMA 1CUDA 2JAWA 2QR5A 3AZPA 3MGAA 4EY4A 4BBJA 5AW4A 4BAZA 1K4YA 4QDZA 3S8YA 2WFMA 3PCTA 1RLMA 3DL4A 3EQ9A 4IO0A 2JEZA 5D6OA 2G1AA 3ZTYA 4GXTA 4J0KA 4OU5A 3I2JA 3VJKA 2HM7A 3O4GA 5ALRA 2V96A 5JAPA 2YJ6A 3IIIA 2Z8ZA 5ALQA 1CUEA 1BCSA 1SFRA 3U13A 3B12A 3QLEA 3FSGA 4BDTA 5LZ7A 3H18A 3DNMA 2HCFA 4YPVA 3IVMA 3UUFA 1MH9A 2WU3A 2ZYSA 1D07A 4FMPA 1L6RA 1USWA 1RQLA 2XUFA 1CUXA 1WVIA 5CT6A 2IITA 5LKRA 4AB1A 3N1UA 3NUQA 5KWIA 3U7GA 3NGMA 3T52A 3WA7A 2MSNA 2EARA 4HAIA 2XUDA 4FFDA 1BEEA 1SC9A 1UWCA 5JZ9A 4UFOA 1EI9A 4BCCA 4LYDA 1QFMA 3DS8A 2E3JA 3CXUA 2VATA 4ZEXA 1SOMA 2PSDA 2YJ5A 3AZQA 3KBBA 2QOEA 3ZLTA 1AMNA 3O4JA 4DMFA 4EEKA 1Z4IA 3IUNA 2G08A 3DL7A 2ZJFA 3DJYA 2FUEA 4C87A 1N8NA 5IVHA 5HQ3B 3L1UA 2CFTA 2GHQA 4HGNA 1OXMA 3HC7A 1CPYA 1BN6A 2G4LA 3LCRA 1JUDA 3FLEA 5CXUA 3G0BA 4AO6A 4TVKA 1XZIA 3L0BA 3HACA 3IB3A 4HRYA 4EB0A 2WM8A 5EFZA 3BJMA 5K3FA 3AFIA 2FX5A 5FLKA 3F9RA 5AW2A 1ZRMA 4PSCA 3ZX5A 1W76A 3AR3A 4HGPA 4HGRA 1EDEA 4GW3A 2G63A 2DFPA 4MQMA 5ALZA 5HFAA 1XROA 6YASA 2C9MA 4MWSA 4WFJA 3I28A 4A5SA 4BTLA 4P08A 1EVEA 5JASA 4BX0A 5LZ5A 2IOFA 1A88A 3D4LA 2WIGA 1XQVA 5EIAA 4YCLA 3UMJA 1XRNA 1ZICA 5ALPA 1KU6A 3OURA 2XQIA 4WY5A 3B9RA 2OQVA 1Z4KA 2WIKA 3IUMA 3R3YA 3FYUB 5T4HA 3ZVLA 1IZ7A 1E8NA 2C7BA 4X6UA 2HO4A 3B8EA 2HF2A 1XZJA 4NMWA 5K3FB 1TRHA 1Q0ZA 2AUTA 4DGQA 1QJ4A 1LGYA 1YNSA 2VJDA 3TLMA 4CCWA 5A6VA 3KD3A 3QUQA 2PUHA 3C70A 1L7QA 3WJ1A 3HZOA 1EINA 1R9MA 3B5EA 3BL8A 3E4DA 4ZV7A 2I78A 1SWWA 4G9EA 3AR9A 4G4GA 5ISMA 1H2ZA 5CW2A 5HF8A 1ZD5A 4W1PA 2PM8A 1QIJA 3G9ZA 4MYSA 4AZ0A 1PV1A 3QMWA 2OCGA 4M0EA 4B80A 2WTMA 3WK5A 4GDMA 2XI4A 4MWTA 2O9JA 4IG4A 3EQ8A 5D3KA 4UU0A 4KAAA 3MC1A 3NUZA 2AJCA 5ALEA 3ONNA 3C8DA 4CNQA 4MQLA 4GEGA 4H0CA 3KXPA 4BNDA 1L8LA 2WFZA 2OAGA 3ZLUA 2C8LA 1MJ5A 3X3HA 4Z49A 2JAOA 4B82A 1S8OA 4CF3A 3DQZA 4EX6A 2O2GA 4F72A 2AJDA 5I7UA 2JF0A 1J06A 3N07A 3O4IA 5ALDA 2BY4A 3TRDA 4G5XA 5JD6A 1Z88A 1CUCA 5CTAA 2Z3WA 3VJMA 1Q91A 1EA5A 5IT0A 4DMKA 1Y7HA 2GZSA 3HYSA 5AIBA 3S6JA 1C7IA 1VJ5A 2C0QA 1RKUA 3STUA 4YCNA 4O8CA 1Z5GA 3W2TA 4Q34A 3FGOA 3ICWA 2HU7A 3ZV7A 4NV0A 2HEGA 2PSHA 1DQZA 3STWA 1R9NA 5JANA 1ODCA 1WZCA 1O08A 4L57A 4AO8A 3FYUC 4EENA 4JH0A 1ZD2P 4FTWA 1MX5A 2W11A 4UW9A 3M9LA 2BUBA 2OGTA 1WPXA 3A2NA 1U4NA 3ET4A 1CUIA 5DLPA 3AR6A 1XZMA 1DWQA 5A71A 2XUHA 5ALGA 1G5FA 3A6ZA 4FNGA 5LYYA 3W9BA 4AMZA 2QMQA 4WY8A 5LLSA 3L0YA 2CN1A 1CUAA 3CCCA 4X97A 2Q4RA 2DHCA 4Y2PA 4Q05A 5AKXA 5HKBA 3QUTA 2C4NA 1LPAB 3D7RA 1H22A 1Z4JA 4K2AA 4E46A 5AW3A 3V1LA 4KRXA 5CT5A 3ESQA 4EY7A 1BEZA 4UU1A 2CMFA 4I3FA 3UMCA 1IZ8A 3FLBA 1JJBA 2B82A 5E4TA 1GT6A 1R3DA 1EX9A 4W1SA 3FVVA 4H7HA 1YR2A 2VEOA 4FOLA 4AMYA 4BX2A 1WOMA 5AI4A 3S2ZA 1MU0A 3WMRA 5AM3A 4TGLA 4E14A 7YASA 1RKQA 2XUKA 4U2GA 4G4JA 5K3DA 3DLTA 1I6WA 3A1EA 5CBKA 2QUBA 3WWOA 2OCLA 1Y8AA 2W43A 3W5DA 1ZJ4A 2MU2A 1XLUA 2DHDA 4BBZA 2R8ZA 4L3WA 1RMQA 2JGJA 1AQLA 1HLGA 2HIHA 4GWLA 3U0VA 3KD2A 4C01A 1VZ3A 4QQFA 1L8OA 2FPXA 4TPKA 1CEXA 1L7NA 4DMCA 2B9VA 2ZBDA 2CB9A 4M0FA 2I54A 1ZRNA 3AILA 4F60A 2YY6A 5E2IA 3VDXA 2DSNA 3QU4A 2ROQA 4FNMA 4B0OA 5JYCA 1Q84A 4C4TA 3MMZA 3P2MA 1XZFA 3B3QA 2FPWA 1ZI8A 3WLAA 2D2VA 1ZI6A 1ACLA 3L1HA 2QZPA 1Z4LA 4LXIA 3FAKA 4H7IA 2C8KA 1R1DA 3V1KA 3M3DA 2AJLI 1F8UA 4KNVA 3VISA 2WJ4A 4GIBA 4BTVA 4C4SA 3C6BA 5ALVA 4B7ZA 1QFSA 4EY8A 4Y2XA 3DNPA 1FJ2A 4BB0A 1R4ZA 1CFJA 5AK3A 1EDDA 1LPSA 2O7VA 4OB7A 3SK0A 4K6KA 2B8EA 4UBNA 5HF9A 4C6HA 3W04A 5AESA 4F0JA 4PNZA 4Y9SA 5AVZA 4UFPA 4I9GA 2GYUA 4HTAA 1TCBA 3WI7A 5JADA 1ZJJA 1C7JA 2HU8A 1XZEA 2WHRA 5K3BA 3V1MA 3GZJA 2BDEA 3G9TA 5E4YA 1EK1A 2WUDA 3C45A 3BE8A 3PDCA 4BATA 4X91A 2HOQA 4G8DA 2VT7A 2Y2UA 1A8QA 4QZVA 4YH1A 3WK6A 3WJ2A 1UOOA 3QXGA 1CLEA 2C88A 1JJFA 3GUUA 1KU0A 3C5WP 2GZRA 3LIIA 4BE9A 4DNFA 2OBBA 2PUJA 4FYPA 2ZOSA 3V9AA 3OM8A 4B0PA 4QE3A 4YCMA 2ZYRA 3BF7A 5A7GA 1YS2X 5LZ9A 1KYTA 2I3DA 3AJAA 4Y2JA 4Y2TA 4BZZA 4OD0A 1XRLA 5AVWA 1AKNA 4HZGA 4QWMA 5C8ZA 4QLOA 4QEKA 3DKKA 3AR5A 1LLFA 5AO9A 3O0DA 3GYGA 4MWOA 2OM6A 1T4MA 1Q83A 1YA4A 2G07A 2RB5A 1TQHA 4PW0A 4Y7DA 2DQZA 1DU4A 4P93A 2EAUA 1ZIYA 4JYMA 3PFCA 1HKHA 1WHSA 3I6MA 2QUAA 1SWVA 5ALFA 1XKLA 5AKGA 3RLIA 5AVUA 4RPCA 5DNVA 1LPNA 1RC8A 4BVKA 1JU3A 1YMQA 3VAYA 2RHTA 3I6YA 2Q4TA 1QOZA 4FLFA 1K1EA 5LZ4A 5AVYA 2VF2A 1DINA 1CUZA 2BGRA 3AR7A 3QU2A 2XUJA 2CBGA 2O2XA 3GELA 1YAJA 1U2TA 3SMVA 2CFSA 4AN0A 1MX1A 3I1YA 5AW7A 2G80A 4CI9A 3H0CA 4HGQA 4IH4A 4J0CA 1QO9A 2P9JA 3FSGD 1VXRA 2XMZA 5CT9A 3GA7A 3PUHA 3PF8A 4ZWNA 3WKDA 5JARA 2XUAA 1X2EA 3G02A 1TJ4A 2D0DA 2ES4A 3W5AA 2WUEA 1U2EA 5D7BA 4GECA 1GKKA 5AKYA 1J2EA 5EI5A 3QU5A 4GI1A 4DWOA 5AI9A 1CUWA 2H9YA 4DNPA 1PJAA 3R40A 1WHTA 3FCYA 5BOVA 4X90A 4DSAA 4B83A 4UMDA 4FLEA 4X3CA 2B61A 3IBTA 4IQ4A 2QXTA 4G1FA 3N8GA 3AZOA 1E5TA 4OFZA 3F8SA 1MX9A 2WG2A 2YMPA 4Y2VA 4Y2QA 1AX9A 4OU4A 3OOSA 3AINA 1JMYA 3R09A 3QGMA 4KRYA 3L8FA 4RGYA 5K5EA 4H77A 5LKAA 5AVVA 5A62A 4NVRA 3G0GA 1E8DA 4XWGA 3D3NA 4X85A 1RLOA 1UOPA 1VZ2A 4I9FA 1Z4QA 3JWEA 1J8DA 5AIAA 1QIKA 4UHEA 5AKHA 3CCBA 4X92A 4F71A 1RPZA 1LNSA 5AHXA 3K2IA 1DT5A 4QWWA 4DLNA 4NS4A 1Z68A 2VJAA 1BRTA 4DMHA 5AVQA 4OYYA 1CUJA 3G0CA 2MU1A 3PICA 3VJLA 2NO4A 2CEKA 1PW5A 1MTZA 5IVIA 2HU5A 1O6GA 1TKRA 2B4KA 2NW6A 1TJ5A 5IVDA 3D2BA 5AK4A 2HFKA 2RAVA 3F98A 4XJVA 3E81A 1XZLA 2EDCA 3DCNA 2DHEA 5T4BA 2IOFK 4HXFB 3HI4A 2H7YA 2J3QA 2IA5A 3FBWA 4UHHA 3WWCA 1XKTA 2XLCA 2FJ0A 3KSRA 1YASA 1QO7A 2GBGA 3ESRA 4AX4A 3KWJA 1NRWA 5C7YA 3QMVA 3ZTWA 2R8BA 2Z5GA 3HLKA 4KE7A 2WHPA 3H2HA 4BC0A 2C4HA 4CE6A 3SD7A 1ORVA 1SCQA 3G7NA 1YDFA 3G8YA 4BCBA 2ZYIA 4C4XA 4ZRDA 3NASA 3O4HA 2XMDA 5FPPA 2OGZA 3R0VA 3E8MA 1MO2A 4UUQA 1W1IA 2FPUA 3DOIA 4DNQA 1ZOLA 3PUIA 2ZBFA 5ALTA 3L8EA 2IYEA 2G06A 2OCIA 3WL8A 5EGNA 1ZJ5A 1CUSA 3AUKA 3I1IA 4WDQA 5AOBA 1HL7A 1AGYA 2Y6UA 5E4JA 5JAUA 1VA4A 1ZGBA 3IB6A 3D59A 4YX9A 2HHAA 1EVQA 4UM7A 3OG9A 4UASA 5K3CA 4OSEA 3E1GA 4JNCA 1H2WA 2WHPB 2XB6A 2VJCA 5ALHA 2WJ6A 4PQEA 2RIPA 5JD5A 2QLTA 1KEZA 3H2GA 4WCVA 4C4ZA 1CVLA 4S0XA 2HF7A 4X71A 1HBJA 1SCKA 4EY6A 1IUNA 2X8BA 3IA2A 1EH5A 5K3AA 4K5QA 4DSZA 5AVXA 2B20A 3BA6A 4B9AA 5AW6A 1EXWA 3WK7A 2ZJ7A 4OB8A 4BRSA 2ZSIA 3WQHA 4WFIA 3ZW7A 3D2AA 4ZXFA 1N5MA 2LIPA 1DX4A 4FLMA 5ALOA 1FFBA 3NAMA 3ZUPA 1N5RA 1TCAA 5AI0A 5A3QA 4KR0A 1UK7A 4ZEWA 3KDAA 5H3HA 1QYIA 4Q3OA 4KNWA 3QMMA 2QTBA 2I34A 5C8XA 1N9KA 1L7RA 2OYCA 5JALA 4BEVA 4W63A 1EDBA 1VFPA 1UK9A 4KX3A 3HSSA 5DNWA 5DNUA 1QTRA 3RARA 4UHBA 4FBLA 4UHCA 3C6XA 2HA2A 1FSSA 3OCVA 2JGKA 4FDMA 1XZCA 5T41A 4WFKA 2O7RA 2XMCA 2WFAA 1T9ZA 1Z4NA 5IVKA 2X5XA 5DTIA 1QH9A 2XQKA 4MJ3A 3OPXA 3ED1A 1H2YA 1N8SA 1G66A 4Y2YA 1RKVA 1GXSA 4RETA 2HDWA 2BFNA 4X93A 3HRHA 3ZVMA 3PF9A 2XUPA 5EIHA 1CR6A 2R8XA 2VT6A 1G4HA 1U02A 1JFRA 3WKEA 5EHQA 4BP9A 3OCUA 2HA5A 2B1RA 2PVSA 3QBJA 3R41A 4IFTA 3QUCA 4BDSA 2I55A 1LZKA 1ZOIA 1XPJA 1LTQA 1QGED 4BNDB 3NALA 3QYJA 4UM5A 3SWWA 3WL6A 4DFDA 1ETHA 3EPRA 3M83A 3QYPA 2HFJA 2H7CA 4J0HA 2WF7A 5FKJA 4INZA 1RP1A 4HXEB 1WB4A 2QJWA 2BAGA 2XQGA 1XLWA 1T5SA 1K63A 4GHWA 5FXMA 4NAVA 3SLRA 3A3YA 2PPLA 2WM2A 3HLTA 5AW1A 2BUCA 1E3QA 3H04A 1YS9A 1MNAA 4XE5A 1H23A 3WYNA 5BV7A 4J0DA 3E58A 4Y2UA 3DD5A 4W9RA 5FRDA 3E3AA 2JGLA 3D5EA 1UKAA 5ALKA 3ZWDA 2YJ4A 1F0NA 5BWCA 3LLCA 2XUIA 4F21A 5IKXA 3C6ZA 2WUFA 1DX6A 3KOOA 4HRXA 4UBIA 4UHDA 3W5BA 2BKLA 2WG1A 3L8GA 1RMYA 3CNHA 3E84A 4H7KA 3PGLA 3BF8A 1TCCA 1GGVA 4CCYA 4UBOA 3G0IA 3C43A 5AH0A 4EZIA 2FJPA 1MT3A 2XUQA 2P11A 1XP5A 1CUVA 2NYVA 5AW8A 3BIWA 4XQ0A 2WFLA
chains in the Genus database with same CATH superfamily
2X8WA 3H1BA 1RABA 3I5AA 5HFNA 2VHYA 4LVCA 3L0OA 3LE8A 4HUTA 4D57A 2GN8A 4Z2YA 4RD6A 4AY2A 1OPXA 2KS6A 1CC1S 5BR1A 2VA8A 4D9JA 4BGIA 1IAVA 3AXTA 2Q3EA 3TO5A 2LM1A 3WL7A 1KORA 2BVNA 3ZE9A 5CPBA 3T3EA 3VU1A 1YRBA 5EUCA 1QM5A 2PFQA 1W1UA 3JVIA 1XD9A 3LDFA 1IBLB 2IXTA 3RVKA 1LBTA 3L8HA 4N3CA 4FHZA 5CD9A 4UB1A 2FMFA 1ZQKA 1R66A 3L8YA 2R66A 4P5EA 4Q44A 2RMKA 1IVNA 1YL7A 1F2DA 1RYFA 4N8EA 1X1QA 1Z8NA 2LGJA 4PG8A 3SYNA 2C5LA 3IPAA 4Z1MA 3ZX4A 1UAAA 4D9BA 2PZEA 1H1LB 4DQLA 4U7HA 1YDEA 2EAOA 3CSUA 4UBKA 1S5LU 3I92A 4C8LA 3K94A 3ELWA 2WZCA 1ZS9A 1A76A 1Z8FA 2GETA 3SF8B 5D84A 1ZVVA 2C1EA 1OILA 2FAXA 4YCJA 2WIDA 3UMMA 3W2GA 1IIPA 5JZMA 3WVNA 3PXBA 2WF5A 4QQRA 3HO6A 3DHVA 4O3RA 4I55B 2IPXA 3D6AA 3WQRA 3VKUA 4NCAA 2RI6A 4XLTA 3A6LA 3K0SA 1C7ZA 1UAGA 4JUIA 1EZZA 3V80A 1GU0A 3KB2A 2BEVB 2XBMA 4EG1A 3QXXA 2ZBVA 3NANA 3ZXUB 2P69A 1K8XB 4WNAB 4G65A 1GQRA 1P1HA 4QBKA 2OB2A 3FPJA 5KC8A 1KP3A 1RXVA 1SCUB 2R3SA 2HJ9A 3SEAA 1UBNA 1F0MA 3T5JA 1KK2A 4PC1A 2NOAA 4CL2A 5CLJA 1P0FA 5FPSA 1QS0B 4QUAA 3J81A 2LHTA 2QKQA 3I01M 2VTBB 1YFKA 3VDMA 1P2BA 1BQ3A 3E27A 4OUDA 1JHMA 4RJLA 4G1UC 3EBLA 2CLIB 1G5QA 4RANA 4PZUA 4J91A 2Y0BA 1UMDA 2PL9A 4OQLA 1YBHA 3SY8A 2K60A 4IDOA 2Q5JA 4DV2B 1KDTA 4DL2A 1GSAA 4RK0A 1SHJA 2OPBA 4H3SA 3R3ZA 1BROA 3S1AB 4J3JA 5B7PA 1CIPA 5COQA 3SC4A 4OBBA 2VTVA 3RWMB 3KKAC 3V1UA 3FPLA 3W2HA 1LV8A 5THQA 2DF8A 3H4IA 2CFRA 4CRXA 5SYAA 4A1FA 1EFCA 3G8DA 3AJ8A 3E7PA 2B8NA 4O4LB 5LPNA 5CT4A 2EW1A 1OKKA 4CIBA 2W8BA 2IPOA 4W5TA 3MLAA 1I2ZA 3A6HA 3FYDA 5IRCD 1TJ3A 5EWMA 1XIVA 1KL7A 1QPGA 2KSOB 3BD6A 3HY6A 1ZSYA 3PQ3A 5LQCA 3MHPA 4HGOA 4IRKA 4K3UA 4HDKB 3RUEA 2PRIA 3CT6A 2JAUA 4GMGA 5G1PA 3GPLA 2AR7A 3A7DA 4D4JA 3JXEA 3HXOA 3N7AA 1ZQBA 1NFFA 4OFBA 4FQ8A 2YZ2A 1YZHA 3A11A 3E0FA 3NRBA 1QTIA 3I6BA 5IZCA 3T5DA 3DC2A 2CK3A 4C0HA 1DWOA 2WHXA 2WYHA 4EG6A 1E7MA 2BR5A 1YZUA 4DCCA 3KYCB 3VO9A 3PY8A 4ER3A 4YRZA 2BL4A 2EXXA 4BUCA 5HGJA 5T64A 5IH3A 1AGXA 1DIAA 5TY0A 1OV6A 3OE7A 4NK5A 5DB6A 2YV3A 3GX1A 2VAXA 3D7NA 3AB7A 2ZTEA 2CL6X 3B7WA 4JP1A 2UUOA 4QOGA 2QS9A 1A0PA 4K1XA 2VNHA 3CF4G 2PUAA 1DK3A 3K1ZA 1JSZA 3ZGOA 1W4BA 2BI7A 1PD1A 5DBGA 1QRUA 1YR3A 1ORDA 1XRMA 4CZ2A 1S10A 5FWXA 2GRUA 8GPBA 3FJOA 4I1RA 3O9VA 1IQ0A 1AS0A 3R7DA 4TS3A 3AESB 1UZAA 2DPXA 3CC8A 4RK1A 4F96A 1OAAA 1A5AB 2QD4A 3CLHA 3MRXA 4ZOEA 3ZCRA 5KFWA 4QYMA 5AOAA 2GJAA 4HYTA 1FLDA 4WLNA 1EFVA 3T0IA 4FS1A 2ZJ2A 4FBMA 3E9EA 1RRCA 2R44A 2HGZA 2WKWA 1KE1A 5LQNA 1OH6A 4Q9AA 4OMUA 1RI3A 4QW8A 1NYLA 3BFVA 2GZHA 3O94A 3G79A 1ZWLA 1VG8A 4TXNA 3RT1A 3WL4A 3P96A 3S1SA 2V98A 5AKZA 3N6RA 1OTHA 1ILEA 2H8KA 2IZZA 3UWSA 4DA7A 1I3LA 4DANA 4OFWA 1K3FA 1A9XA 3KTFA 4PRLA 1JXLA 3SYRA 2Y99A 4WCDA 1JJVA 1A77A 1PZMA 3QZUA 4ITVA 3V1TC 4F2GA 2BHTA 1YOVB 1SC6A 2HADA 2YOFA 2AN9A 3SP1A 10MHA 3GRPA 5FI5A 4LTNA 1Q0QA 2UVPA 1QP8A 4RZXA 4V3CA 1GNLA 2DWQA 5G0SA 3PR2B 5F9MA 2WIBA 4PS1A 5GTIU 4ZU6X 1W36D 3F3MA 4A03A 5HHTA 4G97A 2I3AA 2OCPA 1BQEA 5TF0A 3UTCA 1CR1A 5IARA 2R8EA 3DR3A 3C5HA 2HA0A 2HHJA 2WB4A 1MFPA 5EWFA 5IF9A 3HVUA 2PS0A 3GD5A 4EJSB 3I5YA 3PVCA 1BC5A 5REQB 1UPUA 2RGCA 4POAA 1THTA 1E1QA 2HNBA 3MFYA 2FMIA 3RRYA 3R7WA 4IRUB 3AVTA 4QPDA 5FOQA 5GOZA 2G76A 4JASB 3NTQA 5AI6A 2PX6A 1OHHD 2IELA 5B7NA 3ITEA 2XE4A 1AO3A 2ODAA 6REQA 1CZNA 3W6UA 2Q0HA 3QKRA 4TMZA 5ALXA 1Y9JA 2OBXA 3LXXA 3OFVA 3L7MA 5JS6A 4AS2A 3TGWA 1PQWA 3DO6A 2DQ4A 3E4CA 4DBLE 2Z5FA 3J80A 6Q21A 4DM7A 5HK9A 4UAJA 4AO7A 4D7AA 1I4OA 3ER8A 3OTHA 2YWGA 5L3QA 3IUBA 3FWZA 3AHGA 1RW4A 3UM9A 2QQ5A 3OE5A 4TYQA 3NV9A 2PUDA 2WQ7A 4Y2RA 4LWOA 2DR0A 4FE3A 1ZU4A 4RPXA 3ROZA 1SCNE 4KN8A 2QY6A 2VNAA 4CCSA 2XRZA 5FJJA 5I9MA 5J1SB 3T1TA 4AY6A 4JR1A 2N75A 1P0IA 5G2OA 5AKEA 2AN1A 2TMGA 1P7DA 4WCFB 3NYQA 1DXOA 3GWZA 2O0MA 1W581 2YFQA 1NVUQ 1SHKA 4GP7A 4PZEA 4AZTA 2Z1DA 4M3NA 4KWTA 2C83A 1L7AA 1QLNA 3SQIA 2OOSA 2DQSA 1BZYA 4J29A 1PSWA 1K7YA 4I1OA 1APBA 2IF2A 2IHJA 3DG9A 3CJQA 4E03A 5J2UF 4LJAA 4JBGA 5BWNA 1AXRA 1ATIA 1YBAA 3QVXA 3ICCA 3O0FA 4D98A 3EQ9A 4F4DA 4N1AA 3N8NA 2AX4A 5D6OA 1QU3A 4AG3A 4OJTA 4LMAA 2GEFA 1RS0A 4DS4A 1GNVA 1FO4A 1X66A 2XAAA 1QLJA 4CEJA 4G26A 1Q3UA 2XVZA 2IH5A 3GJ8A 3FRHA 5LKRA 1PK8A 3PQ5A 4MYHA 3ZXSA 1YZVA 4HLUC 3O1JC 4ZN6A 2QG4A 3LL4A 2EAMA 2KZ3A 4YVZA 3VHQA 4C80A 4V0OA 2LKYA 1F1BA 1SOMA 4FB4A 3O4FA 1WCWA 4MCJA 1MJGM 4PYNA 5LB2A 3AHIA 3IIKA 1WSDA 1J23A 1XRSB 2JLWA 2I2BA 1KI6A 4PBSA 2G4LA 3FLEA 5CXUA 2YWBA 2GD6A 4RW0A 1WXEA 2V54A 2FX5A 2ETXA 1CY0A 5DHTA 1XBTA 5E7IA 3MSCA 3JQAD 4NYIQ 2IVFA 1OH5A 3EY9A 1JH9A 3H99A 5TMBA 2P68A 2AFIA 1AKVA 3UXHA 4D82A 1J99A 3EEOA 2WI8A 4A5SA 4HS4A 3GRVA 2JRCA 3NV7A 4KQMA 1YQTA 4PCVA 4ZOHC 1R00A 1N6IA 4R84A 4DV4B 2OBLA 4LV5B 5ALPA 1S76D 3C1UA 4AMBA 2C0CA 1Q0SA 1P62B 3HCEA 1K7XB 1JB1A 4NOKA 4JA2A 5CM2Z 1CB0A 4TSFD 5T4HA 3RVNA 4USAA 1KKMA 4FC6A 5E8JA 3EPPA 4X8OA 4CCWA 1AHPA 5A6VA 2C54A 5LDGA 3HZOA 1EINA 4NY8A 3E4DA 5GJCA 2JK1A 3GRKA 4EAAA 4XTCS 3ZJTA 3AF4A 5DGIA 4M1QA 3TF5A 4ID3A 1TECE 4ZO4A 4JVMA 4GICA 2VP9A 1L5NA 2PH3A 4UU0A 4RHTA 4ESOA 3I64A 1B4FA 2NAPA 1N5KA 2IEAA 1WZIA 2H9AA 3H11A 1SG6A 2IVZA 3OF3A 2ZSDA 2FHSA 4MLDA 1JE1A 3KETA 3TLAA 4FFBA 5K0CA 5BSFA 3LUFA 3AM1A 2KICA 1RM0A 1T3SA 3F6EX 4FQ5A 3SJ7A 2Q2WA 4KVZA 3KTOA 1AMUA 4LCBA 1AUPA 1SPXA 2Q27A 3NR2A 3WGIA 1MOSA 1IOWA 4E5NA 3ISCA 1DKUA 3KR2A 4FTWA 4MVCA 2HW8A 4MUHA 2OGTA 4A6XA 5T7BA 1WCV1 1XHFA 2O52A 3JVVA 3OIDA 5A71A 4O4HA 5KYWB 1YS7A 2V45A 4AMZA 4AUMA 1WD5A 3LHKA 1FW6A 2PGIA 1PQYA 1E5LA 1KOJA 2VRCD 4GC6A 3WOVA 4K2AA 2Q5IA 4LQDA 3V1LA 4KRXA 2O8DB 2F3UA 4F7WA 3FLBA 5JTTA 2VPQA 1W29A 5JJIA 3QX8A 1GT6A 2HBJA 1TUGA 2R8HA 5CG1A 5F7OA 1DGSA 8ICQA 6CHYA 4TVSA 1T9CA 4Y9TA 3PNPA 4DN6A 2GK7A 5KNDA 3H1PA 4YCAA 2QUBA 2G6BA 2XPCA 3W5DA 1PDWA 2DWUA 3UB3A 3ZQJA 4BMVA 3GJXC 3CZRA 5DMXA 4GPAA 3KD2A 3OZAA 3LA6A 5IXYA 4DDUA 4LOJA 4C5CA 2ZUFA 1R27A 2YWFA 4QHYA 1GSHA 5KG5A 2OY0A 4E5SA 4PU0A 3K20A 4X24A 2PGLA 3NTLA 2H5XA 1EHIA 4A5OA 3PMLA 2RH4A 4WTOA 4B7ZA 3GN1A 1U9CA 5FD8A 4G24A 1Z6TA 4F1WA 3TQRA 4PO9A 5BYAA 1HX7A 2YB4A 3TTYA 4F0JA 2FPPB 5AVZA 1KAEA 1JL3A 2GYUA 4XZ3A 1GSIA 3M4ZA 4CM4B 1FNSA 4HMPA 1LVUA 1BHQ1 1ADJA 2VJPA 5IDWA 2BDEA 3CQ9A 5DT2A 4YI3A 4JT4A 4MW5A 1G1MA 1FLAA 4ED3A 3E5MA 3NGLA 3DE3X 2CWDA 1U3TA 4LZZA 3CX4A 4BE9A 1BE1A 3ZH9B 5J0WA 5EXSA 3LX8A 1YXMA 4L28A 4MX8A 1AKNA 1BFKA 3GQBA 1PRYA 2CHGA 2X0DA 5AO9A 1C1XB 3C39A 4KLAA 4BKQA 4J9MA 3I42A 4RXTA 1SUBA 2JCYA 1RAGA 2QMEA 1KQPA 4OL0A 3FUTA 3IDQA 2NV0A 1K5GA 2HWKA 1DRKA 2HBRA 1JU3A 1YMQA 2RHTA 5MFPA 3FD8A 4LF4B 5AVYA 1N61A 2DFLA 4HEHA 2QARB 5CTJA 1X7GA 3AI2A 3TW8B 3H0CA 1NZDA 2Z1MA 1YL5A 1N2GA 2WUEA 1U2EA 2BFDB 1CDDA 2C29D 2H9YA 2ZT7A 2VQEB 3F5EA 3ZV5A 4Q6BA 3FCYA 4RD1A 4JP5A 1JTFA 3KFVA 4IQ4A 2V5AA 4RJ2A 2QXTA 1HE5A 3GLFA 1ZQNA 1M66A 3WGJA 2WG2A 3PK0A 2F1OA 2WW8A 4R8LA 1IVSA 1NIPA 1T6YA 5K5EA 4C2UA 1T4CB 3RTGA 5AVVA 5IDYA 4H17A 4C0SA 1PS8A 4LJRA 1US8B 3RC7A 5JC8A 3DZKA 5CITA 1E77A 1QZZA 3CCBA 5KU7A 1P7ZA 5I7RA 5IJZA 1RPZA 3ML1A 1JLKA 4IJWA 4O4IA 1Y3HA 5DM0A 5AVQA 1Z7YA 1SRQA 4URUR 2BMDA 4C4OA 4W9MC 1GUDA 2DPJA 1VCMA 4QPPA 5FWNA 4J9PA 2HU5A 2NW6A 4TTPA 5KG4A 2RAVA 1JVSA 3H4VA 4YCDA 4C7KA 1XT6A 3A9TA 1VSVA 1C0KA 1Q74A 1Z5WA 1NN0A 2CK3D 5KG3A 2OCYC 1T29A 3C97A 1TQ4A 3Q9UA 5HJ5A 1D6JA 1TXGA 5I01A 3DF9A 2J87A 4Y1RA 5C51B 5FOWA 3IKLA 1E2GA 4ER7A 3RRNA 3SXUB 4D6YA 2R79A 4BCBA 2BEKA 2VHZA 2AWOA 1TA9A 1I8TA 2M6LA 1EK0A 5JYEA 4K81B 2OCIA 3LBIA 4LF7B 2D0IA 3HR4A 1S4QA 3TAXA 3AEUB 5FADA 3LP6A 4R2WA 4CM6A 1JR6A 3O83A 1ZOPA 5JSQA 2E3TA 4KLQA 1Q3HA 1FBTA 5KWEA 3E1GA 2IS1A 4GH5A 1VE3A 2GYYA 2OV1A 3D8UA 1UJNA 4R31A 5LP6B 1OI3A 1YDHA 5A9TA 4RQ5A 3IDZA 1KY2A 9LDTA 2GOYA 4NZOA 5DRTA 5AW6A 2DY1A 2HSEA 3PNYA 4MA5A 2V4ZA 3LFTA 1M7HA 4FLMA 3HCPA 3NHZA 2R7NA 3BQ9A 1G9XA 4G23A 2GCOA 3V7YA 2ISOA 3WLJA 1V41E 3OEEA 2RDIA 2Y1DA 4Q3OA 2QTBA 3O3NB 1ND5A 3O8CA 1IIBA 3DWGA 3P9IA 4KXVA 1XVAA 4RTJA 3LC1O 3P2EA 2RG7A 3HCBA 5FA6A 4REQA 3QVJA 3L49A 5EHIA 3M6AA 1XTRA 5AD1A 4M1WA 2HA2A 4RKQA 3A1SA 3WP0A 3H4DA 1DJQA 3VR5A 3Q2KA 4H0NA 1A97A 2WFAA 4IV8A 3EGXB 2QRLA 2QQGA 1CY8A 3QKSA 1DC6A 2P0YA 3GJQA 1S7CA 5IUKC 2ZB3A 3OUUA 5CJPA 1YVUA 3EJWA 2XDYA 5IU6A 5ITSA 4PAWA 4TLCA 1QGED 5ILOA 1UMBA 2QNRA 1JPNA 3QYJA 3WLRA 1A9ZA 3F2IA 4YAGA 5FWDA 4DFDA 3VR3D 1DIBA 2W8KA 3KXDA 2ETVA 2WWFA 5EYPB 1RP1A 2ZJ0A 1JA0A 2QJWA 2M6KA 1JDJA 3GRUA 3PT9A 4H08A 4DXAA 2HB6A 2PPLA 1L4UA 1RM6C 5HIKA 2Y68A 4RD4A 5T3YA 4NXNB 4IXTA 1G8PA 2IEGA 2PK3A 3LLCA 5TQ2A 2ZDGA 2KV2A 1SK8A 1RMYA 1LU9A 3V2UA 5FFNA 5L8VA 1GGVA 3V42A 4Q3DA 1CQJB 1JSXA 4C20A 3HCWA 3C85A 3CG0A 4JLUA 3EC7A 4Q8EA 3WHKA 1CQZA 1EFTA 3GUZA 1LDGA 5JVDB 3IEKA 4LV8B 4DLUA 1BA2A 4DM3A 3GZ4A 9ICSA 3NJRA 3FHJA 1N0WA 3MINB 4B9TA 6LDHA 2K8AA 1Q92A 4NMXB 1NNEA 4YT4A 4WH0A 3THSA 5THXA 4JCCA 4U2CA 4JI7B 4ITRC 5EMMA 2VBGA 1DKQA 1ISSA 1XRRA 1EA7A 1XDUA 3TEMA 4QUBA 2XVTA 4P4TA 4QPJC 2C1XA 3UMSA 4RIFA 4A3SA 4BNUA 1T5DX 4Y9RA 2QZZA 2Z4RA 1KO8A 3Q8WA 2ZRHA 2R65A 3D0KA 8ICKA 4HVTA 2JJ8A 1OAOA 2ZKLA 4W5HA 3SQOA 2IY7A 1CY2A 1FTYA 3OEYA 3RYCB 3NBQA 3FFXA 2XNDD 1JLMA 3RFUA 3ZS8A 7ICPA 1CUGA 2VHJA 2FPSA 5FTNA 1AKRA 4RK5A 4YAOA 3I9KA 1LLQA 2Q0SA 3BZWA 1HH4A 1CZUA 3PE4A 4UEWA 3X1WA 1ZD4A 4KXNA 3IXLA 2PL5A 4M0UA 3GJ6A 1R4NB 1V1MA 1YR7A 1AO0A 4B46A 3IMGA 4XUCA 2WE8A 2FPIB 3D5TA 3MJVA 5FPQA 5CVUA 3ZHQA 5JZSA 3NB0A 2ZAOA 3LYHA 3WZLA 5KX5A 3FSEA 4PZ0A 2IIVA 4OP3A 1OIXA 3URMA 4B32A 5IILA 3VOBA 5J23A 2NXCA 1BVUA 2UYHA 1XR3A 4GMHA 4GM4A 1NYQA 1U0JA 2G09A 2AJTA 2V97A 1TVEA 1E61A 3ESBA 1NMYA 4LHZA 1S9FA 4ZKEA 5EP4A 3FWKA 3QITA 3MWEA 3TQ1A 2G67A 2W90A 4BPRA 1FFXB 3Q10A 4YTEA 4YRGA 5FV4A 1UJ2A 2CVQA 3ABZA 3ISJA 3O26A 2WP0A 2FN3A 3N53A 1NI3A 1O97C 2P9ZA 4AKSA 4KX5A 2ZIVB 1F44A 3IDAA 2IKSA 2ECKA 4YC7A 5JDIC 3MTIA 2SNIE 4LI0A 3QUSA 3KTQA 1CUFA 4PYRA 5F12A 3UANA 3FUXA 3FB1A 2OZVA 4IICA 2RJ3A 1ODFA 2YDXA 5DT9A 3QVMA 4EG4A 4CMHA 5IM4A 4RMIA 3KHKA 4JLDA 4M37A 5LQRA 4JC0A 4NICA 2FFAA 3JPQA 1XTQA 3O74A 5C1DA 5A4IS 2YZNA 4Q4HB 1ADBA 2ZCUA 4DEXA 3ZU2A 3Q0TA 4L0DA 3UCFA 4HVLA 4EUKA 4V0KA 2QL7A 4UATA 1CW2B 1V95A 2HA6A 5K2OA 4WBNA 1XPUA 1F5SA 1LK5A 2UZ4A 1Q0UA 3D6MA 3GLIA 2I80A 5I9BA 2IRWA 3IG5A 4CJXA 2KHQA 3INYA 3QQ5A 5BYJA 4NU6A 3GFFA 4TQRA 4MPRA 1ZGCA 2V6JA 1QCYA 4R8UB 1YQXA 2HU2A 1E63A 3Q3CA 1OFTA 5TF4A 3GEDA 1ISGA 5CP8A 1TT7A 3W78A 5D01A 1T0PA 2YS7A 1EK6A 2OZKA 5IMBA 3HVRA 1E0JA 5DKWA 4AWBA 2VXBA 5JISA 3T5AA 3IYLW 4H6XA 3I4LA 5BSTA 1TA4A 4OB6A 5BW4A 3DEFA 1XNQB 3M6VA 3VXKA 5IJWA 1PL6A 3PNBA 3EHEA 4XR4A 4QJ3A 2FN8A 1S0UA 3G9XA 1BVYF 4PRYA 3ETRA 1P39A 1P0PA 3U19A 2OCKA 3EXEB 1NK0A 4PO1A 1LX6A 1XSPA 1K3TA 4KE8A 3D54D 2ZI9A 3MCUA 4KIFA 1QVVA 1JFSA 2GARA 3DB1A 3DYVA 1P1JA 5DTMA 3Q40A 1JWAB 1D2HA 3BIXA 3CPJB 1P1FA 4Z53A 3CVUA 3MUEA 2UZ1A 2DX7A 3B3AA 4QSMA 4JJGA 4P3OA 5IBPA 2V6IA 1AMOA 1S8AA 1ULTA 4CRWB 1VPEA 2ZXUA 1T8RA 4M36A 3K70C 5L3ZA 3QELA 3CEJA 1ECPA 1PUIA 4BX3A 4HWGA 1J9ZA 2R11A 1E3IA 3VPDA 3U7JA 5KHLB 1QG2A 2YBDA 4CDNA 1RYRA 4HT3B 3KHRA 1NA5A 4G9BA 1AK2A 2FSGA 3QFRA 3TDMA 3R5JA 4LRXA 2AMFA 3QVTA 4ZQEA 3TYXA 2WF9A 2H3EA 5HR5A 4KDCA 4TXMA 3FY4A 1V9CA 2CBZA 1O5IA 4J49A 3T15A 2CL0X 1KRHA 1EPUA 5AVKA 5SYMA 2XCAA 3R74A 5EE0A 4IEFB 4QO8A 1NW3A 3M5CA 4RPGA 4D3FA 1W85A 2PGXA 4NBLA 1TRKA 1VL1A 4CLOB 1HDEA 4OHBA 2HSJA 5KFBA 2DOKA 3OA2A 1WTCA 5CH5A 3N59A 1XYVA 4QRDA 1NZJA 5K0TA 1ZC3A 5JSZB 2Q6TA 4O0MA 4WUVA 2P1DA 4E21A 3LFUA 4ZCMA 4UUNA 1O8CA 3LC7O 3PQ4A 2MYNA 1D9DA 4MCAA 3COPA 5DLFA 3C5CA 1ZITA 1Y7IA 2JBHA 1CUYA 1V96A 1C81A 4KI7A 3E3OA 1MOQA 2HSDA 1S1MA 2CFIA 2FSHA 4AMUA 3NC1C 4N6GA 5ADVA 5FBKA 3QOFA 5KFXA 3WA6A 3WR5A 5BV0A 4TKVB 4B6QA 5HVNA 1MEEA 1PNRA 1A9YA 4JUBA 3TINA 2XQFA 4GM1A 1JNXX 1ZQQA 3EOBI 1WIWA 3CB2A 2X5KO 5KO2A 3DOHA 3R3WA 2ZS8A 3I5UA 1I2CA 3NFYA 1O77A 4CEIA 5C5CA 1JQDA 2WWRA 2R8YA 3VNAA 1Z6ZA 4CR8A 4IMRA 4QOSA 4MLPA 1PTJC 1U1CA 2PMFA 2D54A 1VKHA 3C3MA 4UE2A 3ILHA 1V3QE 5B5SA 3HT3A 3DMTA 4TMFA 4UCFA 4J7XA 2YY7A 4HATA 1NBAA 2GK6A 1OT5A 3WK8A 4JOCA 2IY9A 1SHTX 3H9BA 2PZ8A 1TO1E 1R8JA 1V26A 3TQOA 2NTYC 3KX2A 5KYUA 1BX1A 3UK7A 1NJ1A 1W4LA 5LM3A 1KPIA 4P0PB 1QV6A 3W8EA 3G82C 1TVKB 3BFKA 1GARA 1ZA2A 2BEUB 3UPDA 1G20A 2FFBA 2PZMA 1R6DA 1R37A 3HA3A 4GKJB 3JD1A 1Z3EB 4RNMA 4FGKA 4YAUA 4DPLA 1IXSB 2E9SA 4C4YA 4GC7A 4I8DA 2G5CA 3Q9NA 3WYGA 4WEOA 1RXSA 4IMJB 4E94A 1VOTA 1R6TA 1GAWA 4LZWA 5SZKB 1XVIA 2POCA 2JLYA 4YQWA 3GCZA 1IBMB 2PD4A 1T3ZA 1U2GC 3L02A 4RL6A 1E4OA 3O90A 2P2NA 5CLLA 3RG8A 3GIDA 5HF6A 1OB2A 2J6HA 3NT2A 3ZCPA 4I2IA 2QR5A 2VDJA 3DFUA 3MGAA 3N0RA 4MJ7A 4NV1A 1U8ZA 4PHCA 4NENA 2A3NA 2WPDA 4DMLA 4TVOA 4KQ6A 1Q1GA 3O8QB 1WXQA 1MVLA 3IDFA 4BFSA 1WUHS 1NUSA 5JAPA 2P66A 2XCRB 3OPQA 3KR0A 2LKCA 4BQRA 2K89A 4UBBA 2J32A 1G9SA 2XUFA 2R1VB 5H5JA 4OOFA 4KHZA 3PVXA 1YACA 3CLSC 5EJ2A 3BH6A 3LNCA 4GKBA 2P2GA 4I6GA 2ECPA 3DS8A 1PYDA 2V0CA 2BZGA 4N03A 1YZ3A 5L4SA 1NVAA 3M34A 4ND8B 1Z4IA 5HRCA 3G2IA 1Z37A 4QZ8A 3VRHA 1BCRB 3L43A 2FRDC 4ZPXA 4A1OA 4M8SA 5LNK1 1XZIA 3L0BA 1SEVA 2D74A 5K3FA 4TT8A 5FLKA 2GJ8A 2A86A 5FL3A 4AKEA 4K8OA 2FMTA 4UTRA 4W82A 1QHFA 3G13A 1XROA 3H75A 5F64A 1FJXA 3U3DA 4MWSA 1TAGA 4OO3A 2AI2A 1HWYA 2LBOA 3RUFA 2XQIA 2P5YA 2O3SA 4BVBA 2Z1NA 4GMXA 3RS4A 2I2AA 1M8GA 3GGJA 3A10A 5ES3A 4QVKA 3WWYA 4H59A 4FM9A 3AR9A 3OJLA 2RSLA 3GFPA 1X74A 3NHMA 4ZVNA 3E23A 3V55A 3D4IA 4LK3A 2QB0A 2REQB 4I99A 4BV8A 4NNJA 1YU6A 5EPEA 4MVJI 2QI9F 1DDIA 2P30A 3CZ9A 4NOMA 2A4KA 4A8JC 5D5QA 1WZUA 1AE1A 3R3JA 4KB5A 3EXFB 1OFUA 1X3LA 5THKA 3KQOA 1D0IA 3RNOA 5B36A 2X1HA 3AP3A 1YB2A 1UAYA 1Z5GA 4QHSA 5C5JA 2HEGA 4FHEA 2PIAA 4UEKA 2PQ2A 4X1KA 4OAPA 4R65A 4NYIR 1Z75A 1WPXA 4FHGA 3JWIA 4F92B 3LLUA 2GPJA 2ZAIA 5D7NA 3V8RA 3TANA 1KYIA 4AQYB 2B4AA 2B83A 2FQXA 1MT0A 3K9CA 2RGDA 4X97A 1RKBA 3D2NA 4Y2PA 1CQIB 1E0KA 1M6HA 4E46A 2CY0A 3W4IA 5JXJA 4QU5A 4ALMA 4I3FA 3GLKA 3EUAA 1QGUA 2ZYWX 2R7LA 4EITA 4IKEA 1N9GB 1MQ8B 1PLKA 3GFBA 3TRHA 2WNSA 1LNZA 5DN6A 1ML4A 3DGEC 4Z7NB 2HMVA 2AXPA 3MS7A 1BWQA 1NR7A 2W43A 2DBQA 4R1LA 3LHDA 4IDGA 1RM5A 2HIHA 2R18A 2PNJA 2P6UA 1RRKA 4A9AA 1FA9A 2DSNA 4KUHA 2HLHA 1QV7A 2G70A 5J47A 4KFTA 5AXCA 1FSZA 4NEHB 1D2NA 2DECA 1JYFA 1ACLA 3D5QA 2RAFA 4DUPA 2C8KA 4WOPA 2AW5A 1IHOA 1S0OA 4GIBA 3T99A 1HMPA 1GPWB 4BNHA 3HNOA 3SK0A 2KKPA 2CHFA 5KFUA 3O75A 3CNLA 4MGYR 1QF9A 4I4TA 5LUAA 1OVMA 2HQRA 2QBYA 4YR7A 4WGGA 1YB5A 2HOQA 3RH5A 3F4BA 4KXWA 2AF3C 1A5ZA 5K8LA 3TFWA 3CP8A 1M75A 3S2IA 1GRQA 3BEDA 5BUCA 3JQCA 1SG0A 4H1UA 3WLMA 2PUJA 2VP6A 4P8RA 3BGDA 4J75A 3DULA 2Y76A 3PFHA 3QKIA 2HWWA 4JJEA 4QEKA 5J9FA 4AUKA 4HQLA 2ZIUA 2RB5A 3T5LA 1CNEA 5U4XA 1B14A 3HRKA 2PUVA 4A2CA 5BWOA 1HKHA 1HG0A 1SWVA 1LPNA 1RC8A 3I6YA 3ZE8A 2ZWVA 3QMPA 1KIFA 3HBNA 3KYJB 3GARA 1XD8A 4GL2A 4OQFA 2YWDA 3QEMB 4J9KA 4INOA 1AQNA 2IXAA 2CFSA 2AFRA 1OLUB 2NX2A 2OHVA 2QU7A 2D0DA 1ZA1A 4D97A 3G1WA 3QU5A 4LTDA 2O8CA 2A33A 5AT1A 4LZDA 4Z9FA 5KFHA 4GOMD 5EFOA 4FLEA 3IBTA 3WGQA 2ZJAA 2VHEA 1Y3DE 4Q12A 3F8SA 2PG3A 1G3MA 3LVBA 3L8FA 3I34X 1HYEA 3PWKA 4JOQA 5CB4B 5A62A 2V59A 2GJ4A 4FQ7A 2IYPA 2IU6A 4KLHA 1ZQJA 2QZ9A 2R00A 2XF8A 4Z6EA 3MS4A 4ILKA 3BCSA 3EGCA 3BS7A 2XADA 5IVIA 4RJTA 2COEA 1Q44A 3T9BA 3T5PA 3PQ2A 4U1RA 2O05A 1UBGA 4BV2A 2GPTA 1N4AA 3TLZA 2OCBA 2KZMA 3QWBA 2WNHA 3HI4A 2JMGA 4TMXA 2KD1A 3GA5A 4ENRA 2YR0A 4ZVOA 4AM8A 2WHPA 1I7QB 1RIFA 1Y9AA 2VHQA 3UXEA 1P74A 3O4HA 1E3TA 1ENZA 3E7XA 3R0VA 3W1VA 5BSHA 4JCOA 3IAS6 4NCIA 3BWCA 1ZJ5A 1I33A 4FEAA 3O8OA 2Y6UA 3OX3A 1VA4A 3GEGA 1JPJA 1VJTA 3PW0A 1T0IA 3FDIA 3K0FB 1FP1D 5IFKA 3L4EA 1C7FA 2IOQA 1YVEI 1D8YA 4A0RA 4OJ6A 1H2WA 5ECDA 2E4AA 3JZDA 2Y0PA 2PZAA 3L7IA 8LDHA 4RSHA 2QLTA 3OSZA 4EY6A 1N25A 3EH2A 3LYSA 7ICQA 3G2MA 1MF7A 1XZQA 3U3ZA 5C1BA 4V0QA 5FTLA 4RDHA 3LXMA 3FIJA 1W94A 2H85A 4A7PA 4GBJA 4ZAWA 4ZXFA 1N5MA 4JEUA 1TCAA 1LRJA 3TLXA 2B98A 1JROA 4KFCA 4YV0A 2FGKA 4W5QA 1MEJA 1EDBA 3GLUA 3MD9A 3GJ5A 1OZ0A 1LI5A 2D00A 5EMLA 4DT1A 4B48A 2GJ9A 4ISCA 5KYXA 3BRQA 1I30A 4E5PA 4B4UA 1O94D 3B38A 2GRJA 4DWWA 2W2XA 3ZD8A 4MR9B 1H2YA 4ECRA 1N8SA 4I2CA 4KLSA 2YIJA 1E60A 3JQDA 1C1DB 2OAP1 1E2EA 3Q7TA 1X1AA 1OX4A 1JFRA 3ZBTA 5K7SA 2B1RA 1G38A 1RXWA 3AH8A 3NBKA 4C04A 3C7AA 4BNDB 4UZSA 1P1CA 2WUWE 3ZJUA 3TLKA 2WF7A 4QUDA 4V0MA 4HXEB 1WB4A 5CA0A 1YJCA 4R9VA 4GHWA 1D1SA 4DTIA 4PVCA 1K89A 1ST2A 2BDTA 1W93A 2ZXFA 4MP3A 3D5EA 3SOPA 3ZWDA 4Q1AA 4BVFA 3PV0A 1R18A 6ABPA 4F21A 2F3TA 3SAHA 4MR7B 4HRXA 1SD2A 3RS5A 3LX5A 3AGPA 2WVHA 4YAKA 3E84A 1ZJYA 1SKSA 1RD4A 4JLOA 1M2HA 2IS2A 4BJ3A 1HGXA 1E79A 3UG6A 2OZEA 5A2GA 4Y6PA 1UKCA 4DDKA 1TZMA 4C3ZA 1T9GS 1KJ9A 1W59A 1ZXXA 1E1MA 3RC9A 2ZE5A 4E5MA 3ROGA 4FS2A 1XMPA 3UPQA 4TV9B 5CAEB 5LOVA 1ZK2A 3AG5A 3K9WA 2Q2QA 2FXVA 1OT3A 4OHZA 5F5XA 4KO4S 1J2UA 4EYOA 3CO0S 5HRAA 1WCLA 1NN5A 1RWMA 1R4MB 4DSUA 3GZNB 2ENUA 3EPGA 2IBTA 4OJPA 1YCDA 2EL7A 4NZMA 3FWHA 3S5JA 1FDOA 3V4ZA 5JG7A 3FPHA 2FLWA 2KVSA 2CCGA 2OPHA 1L7BA 3R0QA 1QX4A 5CBPB 2JARA 3EY4A 1VIYA 4BC1A 3IUQA 1REQA 4PPQA 1M74A 5HGXA 1OYWA 3A2LA 4RABA 4FC7A 2FFRA 4GSKA 2GA8A 1BDBA 3AUOA 1QH1B 2GZAA 3ZHRA 4MYTA 4CIAA 4G0PA 1XZKA 2HHLA 2RKBA 2P62A 4PGXA 4UNIA 1MXFA 3TGLA 4KYTA 5LJLA 4LBZA 2ZTLA 5FFFA 2J4DA 4G5HA 2I87A 4ZTZB 1GNTA 1QHXA 3FB4A 1KFBB 4BB9A 5BR7A 5E1BA 2ID7A 4OV6B 3RS8A 4DJFC 1D9ZA 4LRSB 4PSUA 3DTVA 5IAJA 2QN8A 2CXYA 1KNXA 4H1WA 4MVJM 1B42A 2WWIA 1UP4A 3W9UA 2P3QA 2A94A 2XXAA 3FFBA 1FXSA 2PSJA 5J2GA 2WIFA 1SIOA 4NBSA 3K73O 4IDAA 1MC8A 1KYWA 4EYGA 5KMGB 3IULA 2V6FA 4M9SA 3HFGA 2UUAB 1X7DA 3DQPA 4M9ZA 2F55A 5C5IA 4PG7A 2M9MA 3IPXA 3RB8A 3PD7A 2QGZA 4FW9A 3AMVA 4LJSA 1Z2DA 4FK8A 2ALZA 1JA9A 3LDHA 1L4LA 3N2YA 3W06A 5BRJA 1WUIS 4F56A 3ZWQA 1PVRA 1I7SB 4BVLA 4CDRA 1PGNA 3IOCA 4LGCA 5ES4B 2JIDA 1IMJA 4LZOA 4FXOA 2VYVA 1AQJA 4N9WA 2W3SA 3FSRA 1Z0FA 2IWRA 1KVQA 5F77A 1SH7A 3PRKE 3U7RA 2K2QB 3C5GA 4UMVA 1YS1X 4YAJA 5BN3A 5KJ6A 2GOLA 2XCOA 5A5EA 1VBKA 5FT9A 2XYGA 2ORWA 4JWMA 1F60A 1QIDA 3B89A 2OV2A 121PA 4BKOA 1W46A 2OKGA 2ODEA 4DCVA 1WWVA 5ANRB 4EHAA 5CURA 1UJ5A 3W2EA 2R1TB 1E59A 3OESA 3DZDA 4AICA 3CWQA 2XMPA 3A3OA 4FFWA 4GGOA 1ES9A 5KZMB 3EQZA 1KDVA 1XQ6A 2PFGA 4ECVA 2RIRA 1FXWA 4B5LA 3RSGA 4S05A 4HRAA 1GYRA 3IESA 4P4LA 1PR0A 4C7XA 1ZLYA 4TKUA 1QVRA 4IIXA 4C2TA 5JAMA 4ZMBA 4XYMA 5F9LA 2LIVA 4PQYA 4HP8A 1E6EA 4KGDA 4OMDA 1QK5A 4EECA 3AVXA 3GLQA 4C7BA 1YE8A 1HJPA 4MDYA 1ODTC 4TT3D 1XI2A 2AC7A 1GG5A 5KYYB 2QSYA 1TUBA 2A14A 4YD2A 3RIHA 1QIHA 1QNFA 3FJ1A 1WO8A 3SVLA 4C6SA 3NRWA 1UP7A 4YNBA 5CGQB 3OUZA 1OSNA 1PVDA 2D4HA 2IX3A 4EQ6B 4Q9LA 4MCHA 2HHCA 4XUGB 8ICXA 4ZCPA 1GUZA 1XD2A 4BB5A 1TM1E 3V4RA 3I12A 3WGNA 2ZTVA 5EIOA 1YZQA 1FDUA 3I2KA 2Y27A 3EMVA 4IDQA 3BD8A 1HQYE 2IP4A 3ET5A 1T2UA 4NOLA 3H0RB 1R64A 1CR2A 3HCDA 4TS1A 2Z8YM 4F3TA 3SYKA 3GIKA 5DN6D 3SICE 4ARAA 4BTEA 4CKXA 1G2OA 5BMVF 1TTPB 1ULUA 4A16A 4ZRMA 4H9GA 1NJGA 5DYIA 3IHQB 1CYDA 2Q6OA 3H13A 1E2HA 1S1CA 4S1WA 1FNDA 4UAVA 4J1SA 2FMHA 1RI5A 2WWHA 2FF5A 5ITZB 3TRIA 4KAFA 4BXOA 3BDPA 5KT4A 3FETA 3RS9A 1WB9A 3HRIA 4GPEA 3NAGA 1TTHA 1NDQA 4JMLA 5HG0A 5LXTF 3WMFA 2QX6A 4RSMA 1WPGA 2NTJA 4C76A 1GVNB 1ADGA 3UV3A 3GZFA 2E1PA 1FX0A 3SX2A 4M49A 3A9WA 2FMUA 3GI1A 4JJIA 3BJYA 1K1SA 3DKIA 1NKTA 3SR3A 3WDSA 3CRVA 4Z1MD 3L6UA 2RHFA 1U6JA 1OH8A 2W9XA 1S2NA 4PPNA 2EWMA 5F1YA 4C7OB 2CT8A 5EP1A 1EWKA 2A57A 2OA0A 4FYKA 5IDXA 1O03A 3AERB 2IE8A 4KH1A 2QSZA 4CCYB 4R1QA 3OETA 5IFLA 2CLHB 4NKRA 1RAIA 3N2ZB 2YH2A 4FYJA 1JAZA 1CIJA 4Y30A 1EFKA 1NTOA 4RVFA 1TFUA 3PJGA 4MVJF 1WQ4A 2OR3A 5T67A 4G0XA 3DBIA 5FUMA 3ENZA 5JH7A 1FYEA 1S2MA 4YGYA 3W7AA 4QIWF 1IG3A 1UC9A 3WJ7A 4PG6A 5CNJA 1OUQA 4N7JA 5I47A 1D7AA 2WM3A 2OILA 3RGGA 1CF9A 4PYOA 4P4OA 4KGVA 1TIBA 4ZT3A 2GEKA 2G28A 1ZK4A 1NUPA 3NHPA 3THWB 4Q93A 2X5OA 1OZGA 3VYWA 1LPMA 4Y2HA 5TQ0B 2FK8A 2BPCA 3WZMA 4FHCA 1WM1A 1CJKC 1GNQA 1OOEA 1TUEA 2C8VA 2PNFA 3AIOA 2ESEA 3UWPA 5WRFA 2B2XA 3W5IA 4ND3A 5DIFA 2PJZA 2ZRKA 1RPJA 2BH9A 2C3MA 4IR7A 1TA0A 4DHEA 4GOKA 1H6DA 3N7UA 4EHIA 4HLUA 3WGMA 1ZIXA 1J07A 1JFLA 4KIGA 2AHOA 1KVUA 1Z00A 2HHQA 3JAKB 3VC2A 2VSNA 3LH5A 1CJCA 4LBVA 4O02B 3IALA 2VVTA 3AMZA 2V0NA 4S0ZA 1YIOA 1TF2A 3PUXA 2C2OA 4YLGA 2A0UA 2DC1A 5M2QA 3U31A 3BDAA 4G4IA 4JVSB 3U4QB 3B1FA 2QJOA 1V3VA 3LLSA 1KBQA 5GMOA 2AQ8A 3IIMA 4WBSA 4JI4B 2XXJA 3T9CA 4UMFA 1UH5A 3UGJA 1OKKD 3SBOA 4GU5A 5E8RA 4X5VA 4X9XA 1FZQA 2PV0A 1CUUA 3BK2A 1U0FA 4NH0A 1EUDA 3CR7A 4TMWA 1O96B 2GERA 3OO1A 4RQ1A 2W04A 3PCTA 1JEAA 3LVWA 1NVFA 2H1FA 1C9MA 1ZL0A 3Q72A 1KQ3A 2PV7A 3RVRA 3ZTYA 2Z6UA 1IY9A 4J0KA 3PU6A 5ALRA 2V96A 5IHPA 5ETJA 2A0YA 5CNMA 4BRUA 3RRZA 1Y4SA 5FBRB 2O20A 1GG2A 5M7EA 3U7GA 2C2WA 4WZ6A 3WMXA 2XUDA 4IIJA 1QORA 1QRTA 2I5HA 3JQPA 4LYDA 4M1ZA 4HWPA 3I4FA 4RTPA 1ZJ6A 7ICSA 1CULC 4UU8A 1AMNA 4PH5A 3OE7D 4ES6A 4GXIA 1FYWA 3EQ6A 5HUHA 1IJFA 3L93A 1IIRA 2G71A 4FEGA 2IHVA 4DA6A 2WJWA 3RSSA 3HC7A 4PSVA 3NFRA 2C42A 3G0BA 3B1WA 3Q98A 5FWYA 3JR3A 4EW2A 3NVZA 3IP8A 5CWRA 4DV5B 5AW2A 4CIYA 3GJ4A 1CERA 4LBWA 3N5CA 4UHJA 3V6JA 5IWCA 1EWTA 1ORHA 3K0KA 3HYNA 2Z9DA 1LEHA 2GESA 2GBLA 4P08A 1F38A 3AP1A 3D4LA 2A4MA 1W87A 1R6VA 4QOHA 3SNHA 1XRNA 1VLHA 2YXLA 5HA5A 3RUPA 3IUMA 3F1KA 3U5ZB 2OXCA 1M1UA 1Q0ZA 3P4XA 3IBSA 1JDZA 1Q1NA 5JNSA 2IYSA 2I8LA 2F3QA 4M46A 3AHEA 4Q4AA 2FPMA 4DV3B 4QZIA 5ISMA 1H2ZA 5CW2A 1ZD5A 2BGIA 3CKYA 5CCBA 1PBTA 1CY4A 5JJ5A 4PFQA 4IG4A 3O8LA 2V6GA 3PZBA 4DIBA 3AWDA 3K15A 2RH5A 5BW6B 1KA9H 4ENQA 2OAGA 2C8LA 2FWPA 1U1IA 1Y8QB 2JH7A 3L7LA 2JF0A 2Z08A 1KEWA 4GF5A 4BRWA 2JFWA 2HBLA 2ZI5A 3S6JA 2IEYA 2ZVJA 1E79D 2A9VA 1QAQA 4YHBA 1P72A 2G40A 3JQAB 3VYTB 1HT0A 2PSHA 1N2OA 3UENA 4MNTA 3JRXA 1R9NA 1WZCA 2VHXA 1M54A 3B3GA 2B5WA 1NJ5A 5BUQA 4BN0A 2FR8C 3M4YA 4S1OA 3ET4A 4HNAA 3KQYA 4MKIA 4EKIA 1IWBB 2QMQA 2VDKB 1X80B 3HR7A 3MTJA 2I3GA 3ONVA 1PL8A 1DGQA 1PJ2A 1C7YA 2REXB 3D7SA 1K8YB 1JQ3A 4GX5A 3DPSA 4DUGA 1YK1A 4JUZA 3ROQA 4TS9A 2W03A 1QOQB 2J67A 5J0UA 4LY9A 2W2TA 1J8YF 1YHNA 1NXPA 1POWA 1E1QD 4DF4A 3A25A 5KSYA 1C8BA 3N2GA 1M9NA 4H7HA 4DCMA 3ASUA 3JZMA 4MV7A 1PNTA 5AM3A 4TGLA 1FTWA 1ZNWA 2XGPA 2E1FA 1VSUA 5HX7A 2MOKA 5CBKA 1L5UA 2MU2A 3HDGA 2QD3A 3PQ7A 4GWLA 2QLNA 1H0RA 3KAQA 2PX0A 2ZYGA 3Q88A 1YR6A 3K1RB 2Q3MA 3VDXA 1DG9A 4RQ8A 1Q84A 2E89A 2QF7A 4F5PA 2ZTHA 1R5OA 4KWEA 4BV9A 4KNVA 3VISA 4IR9A 4J9VA 2ATLA 1R4ZA 4QC2A 4Z0NA 4P4PA 2C96A 3G2NA 2EH9A 1MG0A 1UPBA 3RRHA 3MTEA 4K05A 3TFOA 2WHRA 4OQQA 1RRMA 2XB4A 1FUIA 2A8YA 3E3MA 3P9YA 2I4OA 3TTVA 4GR5A 1VIDA 5B1EA 1AROP 1BX3A 1SXPA 1JJFA 3HG7A 5K1ZA 4DIMA 1HM5A 4PYMA 3USES 1H69A 2ZYRA 1P29A 4NBWA 1XS9D 4BZZA 2ODGA 5AVWA 1GLNA 2KE5A 5E7JA 5H1YA 3EYWA 4ZO6A 2LUOA 3OAAA 4D9HA 3GYGA 5K0EA 4I2BA 1NJFA 2VPIA 4BNIA 4RVDA 1XFAA 1S4MA 4PR0A 5CG2A 5KQSA 4DCSA 4RHXA 4RPCA 5DNVA 2JI8A 3CYFA 1FJHA 2I4IA 1C3LA 5F5NA 4DKXA 2BRUC 2P7HA 2WSYB 4OSPA 1G8FA 3HKZF 3AB3A 3IEMA 4BLOA 3UF0A 4DCTA 4HFNA 4IH4A 4RHCA 2QRKA 4C2AA 4A6DA 3PF8A 3QXSA 1C3VA 5EPOA 3KQMA 3TZHA 2YX8A 2Y0SF 1KKUA 5K51A 2JLUA 3K6SA 1J8VA 1VJDA 3HXMA 4GOJA 4RZRA 1CR0A 1F2UA 2LBPA 2Q9CA 3AZOA 3H3JA 4LY0A 2HWXA 2NRWA 1XGKA 3E48A 4KKVA 5DNCA 1JDUA 4KRYA 4RGYA 1PT9A 4DBZA 3D6VA 3EIWA 1N2BA 2A0KA 1RYEA 2HR1A 1C1HA 1NC3A 3D3NA 1XHLA 4I9FA 3KLNA 2EWVA 2EFYA 1Y8RB 4P4MA 1J24A 2OO5A 4ZOLB 3G68A 1BRTA 5AHWA 4CLEA 3LCJA 3U6BA 3PICA 4DIOA 3EEYA 1GU7A 1E1RA 5JI2E 3FMGA 2EVWX 1J2JA 1J8MF 1I4EB 2XE7A 4OF4A 1MV8A 1XZLA 3TD9A 5B6PA 5IDQA 4NDNE 2ZIWA 1J22A 2X9VA 5ELLA 3QMVA 2YWHA 3H2HA 3TLBA 4B3FX 3EUEA 1DIOB 3FZEA 3PVZA 4YUAA 4YT5A 4GI2A 3GIJA 1UL1X 4KLFA 2XYQA 2FKAA 5ITVA 3AUSA 3HJTA 1HL7A 4CQMB 5DGAA 3A27A 2GILA 3KOMA 1Y6FA 3LT5A 3NBXX 4EGFA 2XXBA 1NP7A 2H3QA 2OLJA 3QE3A 2CWWA 4FN5A 2I1WA 3BRSA 2NQ2C 2P6NA 4Z0PA 5I3ZA 4NS1A 2NU9A 2I7XA 2HF7A 5DHAA 1E7QA 2X8BA 2P1RA 2BEWB 4WN9A 2BGJA 5EUBA 3Q8PB 4WFIA 3IOYA 2W9CB 4BNFA 3BQTA 4ZODA 5IN4A 3RTCA 3MYRA 5BNTA 4Z6FA 4H3HB 3MFIA 1X14A 3IPYA 5C8XA 1L7RA 4WJ3B 1CZKA 1UXIA 5CB1A 2O0JA 1FP2A 1YGYA 2D5IA 4IVPA 1DBWA 2BHNA 1IY2A 3OCVA 3AVPA 4JU8A 1TVCA 3PHHA 3MWKA 1BH6A 4WZAA 5HILA 3PHGA 3RJIA 4F2SA 2NUAB 1NWHA 4G6ZA 4MV9A 3U9SA 2LVBA 4N18A 1L5KA 3LA8A 4UEJA 4EGCB 4MAAA 3BRCA 1WF6A 1Y3FE 5KNDD 2JLBA 1ZH6A 4DR3B 4YHHB 1EX1A 5TS3A 5EVCA 3O93A 1BEUB 1JZTA 3L92A 3IV6A 2AOUB 2X3FA 1K63A 2DF4B 4NP6A 3VDNB 1USVA 3PUJA 1B0PA 2WM2A 2HOIA 4A92A 2VPTA 1QVWA 4ACBA 1Y5MA 2JGLA 8ICHA 2J9RA 4PSAA 3V97A 3S55A 1K88A 3DVSX 2AMVA 3FW1A 4AKIA 5DNDA 2VHUA 4PS0A 2D8MA 4MA0A 3E05A 3PGLA 1KEEB 5IJAA 3R6DA 4K7JA 1MT3A 2FJUA 2EZYA 3EVBA 3O8NA 4UVIA 3RYHA 5CEJA 2YY5A 1HIWA 3ZBQA 4CFZA 2UXCB 3TKAA 1PR2A 1U3VA 4J9NA 4N3BA 1EX6A 3LZ6A 4KIUA 3OCYA 1SBZA 5FOSA 3EPKA 4EB6A 4MARA 1ZXBA 2HLNA 3KKQA 4F4JA 4WE3A 2A5LA 1FTQA 2X7HA 2H06A 4MGIR 2H4FA 4L07A 1TVAA 2B30A 4FINA 3O92A 2J3HA 4UFNA 1E9RA 2GN6A 3N6XA 3ID6C 5H82A 3RT9A 3OP4A 1I0LA 3SKVA 1GN9A 1ODJA 2Z95A 1EBFA 2BT4A 1ZD3A 1M1NB 2EZ4A 1Z5NA 3L0SA 1S7GA 2NYRA 3RRFA 5DX8A 5BV2P 3B7GA 3BKXA 1Z1VA 3CU5A 3KQQA 2ERXA 5BPHA 3TPZA 2XDQB 1RYYA 1GQ2A 2IC5A 4K9OA 1UM9B 1RXUA 1Z0DA 2BFEA 4J7AA 1FNMA 5LA6A 1TYDE 3BGWA 5DASA 4BBPA 2FMPA 1KERA 3DHYA 3KFXA 3T0FA 1LB1B 1XAIA 2GWRA 2ZJ6A 3K9NA 5JDIA 3ZHOA 3ZJYA 3SZRA 1JR4A 1JQ5A 2WB1F 1H2XA 3VR0A 1RKXA 4NRDA 1X1RA 3AY7A 2F1HA 4IZIA 3DEHA 1HDXA 3A6DA 2WWTA 1YCHA 4ZVTA 3DBOB 3F3YA 2PJUA 3RLFA 3JWHA 4L7VA 2V7GA 4C7MA 1IG6A 2XIDA 1ZM4A 3PLNA 1MAWA 3R5XA 3ZEIA 2AK3A 3ZDFA 4N54A 3TZ6A 4DV6B 1BFUA 4MKZA 3MZ0A 4A82A 2XCSB 3UHPA 3UT5A 3L1VA 4LPKA 3Q7IA 5TT0A 5J0XA 4TM8A 1K3UB 3IDSA 4DV0B 2C95A 5IHXA 1LB2B 1O4VA 4D4HA 3ZIDA 3TQCA 1I0ZA 4QUIA 4FGWA 3CG4A 2Q5CA 1WCIA 3H5WA 3C16C 3K0AA 5BOMA 1HC7A 3OFKA 1BGWA 3BBPA 2JFXA 1A7UA 4B7CA 3HY3A 1O3YA 1GCUA 4TLLB 4QIHA 1E5DA 1ODKA 1DTEA 3V7JA 1UBHS 1HPLA 3MJEA 4ZD6A 1QUEA 1Y88A 4U9UA 1O6FA 1L4MA 2A0FA 2VPPA 2QVGA 1BWSA 5L3VA 1YE5A 4WOKA 1IJEA 3K0EA 1CP3A 2EBWA 3AONB 4AJIA 2LYHA 2OD9A 2XZDA 4MQ6A 1M2KA 4AYXA 5HS4A 5GJWC 4ED9A 4NZZA 1YT3A 5KFDA 2EGUA 3DDUA 4PL1A 1JDBB 3WYCA 2P6MA 3HH8A 1UKEA 4K6OA 4IH1A 3SYTA 2OGSA 1GKIA 3TSOA 2JZOA 5EJIA 4TV8A 4KMOA 3W9YA 2PKXA 4Q18A 3AI1A 4MGZR 2PT9A 1I3CA 5MGNA 2WZBA 3ZY2A 2RLTA 1PEYA 3DXZA 3JALB 2Y05A 1XRQA 2R25B 1VJGA 5DULA 3LUAA 4JMUA 2P3SA 4KXXA 4URXR 1G6OA 1V16A 1TU4A 3C87A 5JWHA 1TZKA 4A8PA 3WIOA 2B0CA 3OEED 2JFBA 1QIGA 4HYYA 3C6MA 1G6Q1 2JVIA 1DZ3A 1RHJA 2PXIA 2ANCA 1QTMA 4ZDJA 3P26A 1BN7A 2OFXA 1AKTA 1PJLA 2DBZA 3HN6A 4MF2A 3P0JA 1A9OA 1EKXA 5A4JA 3VR5D 5SV2A 2BEJA 3USCS 3EF0A 4L5AA 2ZTCA 1BKSB 2BFCA 4JXZA 4MUIA 4OXNA 2XKAA 2DTDA 3VH4A 4TRRA 4W5NA 3LUCA 4L78A 3HKEA 2QU8A 4X1IB 1K2VN 2EV9A 3HZRA 2Y67A 2K7FA 5HCUA 4B6JA 4G1EB 4H7FA 4NHOA