5ALJA

Ligand complex structure of soluble epoxide hydrolase
Total Genus 182
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
182
sequence length
546
structure length
523
Chain Sequence
TLRAAVFDLDGVLALPAVFGVLGRTEEALALPRGLLNDAFQKGGPEGATTRLMKGEITLSQWIPLMEENCRFSIKEIFDKAISARKINRPMLQAALMLRKKGFTTAILTNTWLDDRAERDGLAQLMCELKMHFDFLIESCQVGMVKPEPQIYKFLLDTLKASPSEVVFLDDIGANLKPARDLGMVTILVQDTDTALKELEKVTGIQLLNTPAPLPTSCNPSDMSHGYVTVKPRVRLHFVELGSGPAVCLCHGFPESWYSWRYQIPALAQAGYRVLAMDMKGYGESSAPPEIEEYCMEVLCKEMVTFLDKLGLSQAVFIGHDWGGMLVWYMALFYPERVRAVASLNTPFIPANPNMSPLEVFDYQLYFQEPGVAEAELEQNLSRTFKSLFRASDESVLVCEAGGLFVNSPEEPSLSRMVTEEEIQFYVQQFKKSGFRGPLNWYRNMERNWKWACKSLGRKILIPALMVTAEKDFVLVPQMSQHMEDWIPHLKRGHIEDCGHWTQMDKPTEVNQILIKWLDSDAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords BIFUNCTIONAL EPOXIDE HYDROLASE 2
publication title Successful Generation of Structural Information for Fragment-Based Drug Discovery.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 182
structure length 523
sequence length 546
ec nomenclature ec 3.1.3.76: Lipid-phosphate phosphatase.
pdb deposition date 2015-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 5aljA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 5aljA01
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5aljA03
3FPSA 4QWMA 4BDTA 1F8UA 2G5PA 5AKJA 5AVQA 5FV4A 2GZRA 3OPMA 2Z5GA 1U7PA 3M9LA 1Z4PX 4G1FA 5LYYA 5I8PA 2XUOA 3I2JA 1YA4A 1VOTA 3FVVA 1H2ZA 3WI7A 3HYCA 3WQHA 3ET5A 3ZVNA 1EI9A 3DYIA 4FTWA 1DINA 2XE4A 2O2HA 1CUEA 3I2HA 4J0CA 2QUBA 4F60A 3CN7A 5ALRA 4OPMA 4RNCA 4BNDB 1OILA 4B0PA 1LLFA 3T52A 5K3EA 1Q0ZA 2XUAA 4X3CA 2Y6UA 2WF5A 1RKVA 2RBKA 2QOEA 3QH4A 3MPOA 5HQ3B 3HACA 2HA5A 3QU9A 5LZ8A 1HQDA 4FDMA 3E8MA 2MU2A 4N8EA 3ZTYA 5DWDA 3QUTA 4IG4A 4U2FA 3UUEA 2Y2VA 2WF9A 3WK9A 1UOQA 2AJ8A 5CH3A 1TK3A 4CCYB 3WL8A 5AP9A 1GQSA 1U8EA 1VE6A 4F0JA 3EQ8A 1DWPA 5IVDA 3QU2A 3IUQA 3STUA 2GYUA 2HA2A 5CT8A 2CKMA 5AVWA 4TVKA 3M3DA 2XLCA 1EVEA 2P8SA 2HA3A 3QBJA 5ALUA 4CI9A 4A16A 1H2XA 4OUKX 3OCZA 4QQFA 5AOBA 3D59A 3VJKA 4Y2YA 3CNHA 3JWEA 3KZXA 4LYEA 4C88A 1UKCA 4PW0A 3H2JA 1CUDA 2QXUA 4JYMA 5ALFA 4EZIA 3U7HB 1XPJA 1U4NA 3L8HA 5ALQA 3L8EA 3A2NA 3D5EA 4W9RA 5AI0A 3STYA 2YJ3A 3U26A 3OM8A 2GMWA 3AUKA 2RAVA 4CG3A 3M1YA 1ODTC 3HABA 4G4JA 3L8GA 5IVIA 2OPHA 4DMFA 3C5WP 3WLAA 3KOOA 1LPSA 3J7TA 2XMSA 4H77A 1H2WA 1RMTA 4UMVA 4G4GA 5K3CA 1GPNA 3QMVA 4BCBA 4E15A 2GYWA 1RQLA 4YCNA 2R8XA 5LZ7A 1H23A 5K3DA 2OCGA 4J0JA 4EB0A 4DM7A 3UUFA 1Q91A 4KYVA 4FHZA 5AI4A 1QQ6A 3AR8A 3KSRA 3GELA 2B1RA 2C5FA 3ED5A 3DNPA 2QT9A 3LIIA 1FFAA 2NO4A 3OCXA 4C4SA 1GKLA 2YMQA 3QGMA 1Y7IA 1TCAA 2VF2A 3ZV7A 3PFCA 4BKMA 4LHEA 3W06A 4L57A 1AX9A 5DJ5A 5J3JA 4PSDA 1EDEA 3HYSA 2WFMA 1IZ8A 1VZ3A 1E5TA 2PKYX 1T9ZA 4UHBA 3PI6A 4J7AA 1QQ7A 4X90A 1DT3A 3ZWDA 5HF6A 3R3WA 3F9RA 1X70A 5DLPA 2ZSIA 1XZDA 2RAUA 4Y7DA 4IQ4A 2Z8ZA 3C8DA 2B4KA 3WZLA 4F21A 3VDXA 3EQ7A 3W5BA 4DCCA 1SC9A 5AOCA 1R9MA 3O95A 2IOFA 5AVYA 3PDWA 4J0HA 2RARA 4J0DA 1HLGA 3ANTA 4RPCA 5AO9A 3BE8A 3O9MA 3ZX4A 1QIMA 1YSCA 1XZGA 4PSCA 2RHWA 5LKRA 3QVMA 1TIBA 4BP9A 1QE3A 4H7IA 5K3FA 1L6RA 4UBIA 1MX1A 3NALA 4MUMA 3RFUA 1PJAA 3NGMA 3VKFA 5KBYA 4NZZA 1SFRA 2Q5EA 2HHAA 1TJ4A 3G02A 3X3HA 3AR5A 1M33A 4X6UA 2VATA 2ACKA 3DOIA 2WFAA 1E8NA 4HS9A 4E46A 1FEZA 1WHSA 3O4GA 4D9JA 2JIDA 4DFDA 4QDUA 4BP8A 2VSQA 5AVVA 2ZJ7A 3ZTWA 3ZU6A 3OCVA 4EY6A 2P27A 4F72A 3M81A 3WGVA 3BF8A 5HK9A 2HFJA 3ZX5A 5AKGA 3WIBA 4ZGBA 3I2KA 4BRZA 4QZVA 1YDFA 1MX9A 4LIPD 4XVCA 4QDOA 4G8DA 1XFDA 1B41A 4EX6A 3O4IA 3AR3A 5T4FA 1CPYA 4G5XA 3ANSA 5ALIA 2I3ZA 4O8CA 4EEKA 1Z4OA 1D07A 5CRIA 5C8ZA 4UAUA 1RPZA 5LZ4A 2QLTA 3QYPA 3A1DA 1XZKA 2ZSHA 3HRHA 3E4DA 4P92A 3ZWQA 2ZYRA 3B12A 2QS9A 2LIPA 4L6CA 1QIKA 5FXMA 2ZJFA 2AH5A 3MMZA 2Y6VA 4KN8A 1IMJA 3I28A 3IDAA 4C4TA 4OD0A 3PICA 1DT5A 2QRUA 3W5DA 4X97A 4ARAA 2ZBEA 1E66A 2XT0A 4X71A 2W11A 4BEWA 2PSEA 3F96A 4C6HA 5AM5A 5AK4A 1Z4JA 2AJDA 3W5CA 1IVYA 2P9JA 4DYHA 4W1QA 3BJRA 3LP5A 2HU5A 1ZI8A 1W76A 2EDAA 2HO4A 1HKHA 2WIGA 3W9BA 4LXGA 2WFLB 1QLWA 2X8BA 1UKBA 4UW9A 1W1IA 4QDZA 1RKUA 2C0QA 3VAYA 2HDWA 4BAZA 4UHFA 4HRXA 3DL4A 4Y2TA 2BUAA 2HA6A 1XQVA 2XLBA 1U2TA 2HL6A 4KACA 2G63A 2QJWA 2QJRA 3QYJA 2HU8A 4BE4A 3JYHA 3W5AA 1XZCA 1ZD3A 3DKRA 2OM6A 5E4YA 2G4LA 1NX9A 5IVHA 5EIEA 1QFMA 2GHQA 2XQFA 5JARA 4BB0A 3AIKA 5CXXA 1BEZA 2BJHA 5H3HA 2QMQA 3GZJA 1Z4IA 2J3QA 1RQNA 3AZQA 4QNNA 4E88A 4AMZA 4MEBA 1NU6A 3DD5A 4X85A 5HF5A 4V2IA 4CG2A 3ZUPA 3H17A 5ALZA 6YASA 3D2AA 1Z4LA 3FYUC 2R8ZA 4Z49A 2WHQA 3AJAA 4M0EA 2B0CA 1BS9A 5HF9A 1T4MA 4CF4A 3UMGA 2BUCA 3Q8WA 4WY8A 2IA5A 1L7QA 4I4CA 3YASA 4Q3LA 4QWWA 1F6WA 3H04A 4FBMA 4OB7A 4EELA 4BX0A 2FPXA 4WFKA 1CUSA 5CW2A 2H1IA 5ALTA 4X00A 3WA6A 4ARBA 4B0OA 1MU0A 4OU4A 3LIPA 4K5QA 1LPOA 2ZBFA 2Q0XA 5AI8A 4U2CA 4LYDA 3TGLA 4XJVA 2V98A 4GI1A 4UM5A 4GECA 5LZ2A 4EY7A 2WHPA 4EX7A 4UM7A 1BCSA 2G08A 3QX7A 2J4FA 4JB3A 3KD3A 4FYPA 5DYWA 4BDSA 3O0DA 5EFZA 1SCIA 4UBJA 2OGSA 1L8LA 3L0BA 4Q34A 5AI6A 1C7JA 2YBDA 3G9TA 4FFDA 4H7HA 4C4YA 3G9UA 1CUYA 4EY4A 1ZD4A 2DHDA 3ESDA 4B9EA 1KEZA 2CUTA 1MO2A 4Y2SA 4HGPA 1QZ3A 2I7DA 3BWVA 1XLWA 4LXHA 2PR7A 5ALJA 2C8KA 1QIJA 2DHEA 3G0CA 5T4HA 3DLTA 1ZIYA 3C6BA 3QMWA 1C4XA 1FSSA 4DLNA 3HSSA 3W9UA 4LKOA 1WB4A 4MYSA 4PNZA 1CUZA 3ONNA 4BCDA 3WKDA 3QLEA 4JNCA 5HKBA 1EXWA 5HF8A 2ES4A 5CH5A 3WL7A 4C4XA 4ZEWA 1YJ5A 4MJ3A 1EHYA 3IUJA 3H1AA 2HDOA 2D2VA 1EX9A 5EIHA 3QPDA 3E1GA 4BVLA 5AI5A 1G4HA 3B5EA 3L8FA 3G8YA 5K5EA 3NRJA 5IVKA 1CEXA 2YN4A 3PUHA 4CIBA 3STTA 4HAIA 1L7NA 4N8SA 2CJPA 2WG1A 3K9BA 3BL8A 2W22A 5ALHA 2Q4RA 4FLFA 4NWIA 2BFNA 1PV1A 2PM8A 3QPAA 3BA6A 5E4JA 4I19A 1BROA 4IH9A 5D3ZA 4BX2A 3R0VA 3ESQA 2XUQA 4AS2A 4O08A 4H0CA 4WDRA 1VA5A 3WK4A 2GZSA 2V9ZA 3BJMA 1Q92A 1IUPA 5JD6A 2ZYHA 3IRUA 1P0PA 2O2IA 4UAVA 1QIDA 2G06A 4FWBA 1FJ2A 1ETHA 5CT6A 5ALXA 3KDAA 2QZPA 2IYEA 3U13A 3DS8A 2OGTA 1JKMA 3H2IA 3GA7A 2XUGA 4MXDA 1THTA 1BRTA 2MU1A 5DYTA 3WKCA 1YS1X 3LLCA 2OGZA 4W1RA 2XUJA 4PNHA 4CF3A 3R3YA 3OCWA 3QU7A 3U19A 3H1BA 1XZLA 2HOQA 1RWQA 1TRHA 4HGQA 2PVSA 3UM9A 4W1PA 5T4BA 2CZQA 4AO8A 3QUCA 1AUOA 1SWWA 4KX5A 5DTJA 1W6RA 4WCVA 2H9YA 4EUSA 2HRRA 4FBLA 3Q0TA 3E0XA 2HF2A 2H7CA 1OXMA 2JGJA 1WOMA 1E3QA 3QM1A 4ROTA 1LPNA 4UUQA 3LS2A 3FNBA 3RKSA 3B3QA 4TPKA 3SHQA 1WCYA 2H7XA 3P2MA 2XUFA 1L7MA 1JT2A 1I6WA 2FX5A 5AKXA 2FPSA 5LP1A 4BVJA 2JGMA 1JU3A 3DCNA 1LPPA 5A2GA 1HL7A 4B83A 4P9NA 5JZBA 5BWCA 4UHCA 3OURA 1JJIA 5AH0A 1JUDA 1XQXA 5AW9A 3UMCA 3R3XA 4C01A 5K3FB 1N8NA 4N5HX 1CVLA 3E81A 1JFRA 3WA7A 1F0NA 5K3BA 1ZJ4A 4QDXA 4C87A 3WMRA 3TLMA 1DX4A 4J2TA 4YX9A 2XQKA 4I3FA 2VAVA 3MN1A 2NYVA 1HPLA 2RIPA 3R3ZA 1GGVA 5HFNA 4GBGA 1UK8A 3PUIA 3ZW7A 2WF6A 2HM7A 2OCIA 4DMCA 3I76A 2IITA 2DFPA 3GUUA 4AO7A 2B8JA 3RLIA 4W1SA 3FYUA 1JJFA 4M0FA 1XVIA 5A62A 5AKHA 4AN1A 1ZRNA 3N07A 4E14A 1NU8A 3FOBA 4UMEA 2JAUA 1R88A 5BOVA 2WHEA 2Y1KA 4B9AA 3C8HA 4U2BA 2C9MA 2WG2A 5A3SA 4UFOA 1XZFA 3CN9A 3OC0A 3ED1A 1PFQA 5D7BA 2EARA 2O7VA 3WWEA 5JZSA 4NS4A 2WUEA 4EZEA 4DWOA 4BE9A 5ALYA 2HX1A 4UBKA 4DGQA 2B8EA 5CXUA 3SK0A 3FAKA 3UMJA 3MC1A 4B81A 2C88A 3PE6A 1CUVA 1NRWA 3F98A 1IWOA 1WM1A 1GZ7A 3SWWA 1K4YA 2O2XA 2VJBA 2O9JA 3QNMA 1VZ2A 5A7GA 2RHTA 1WPXA 2CBGA 4UU0A 3VISA 1R50A 3ZLUA 2PBLA 1CIJA 2C4NA 3R3UA 3OPXA 3C70A 4DTCA 2RB5A 3C6YA 4FMPA 1XZMA 3U7GA 5ALGA 5AM2A 1YB7A 2OQIA 2HEGA 1TCBA 1XRQA 4BEVA 1WZCA 4XX1A 4TGLA 4X91A 1R9NA 5AVZA 3WWOA 2G07A 4YASA 4GIBA 3SF0A 1U65A 4NVRA 4Y3UA 5EHZA 3C6XA 5ALWA 2VJCA 4FNGA 2RONA 2WHRA 1NF2A 4BAGA 4X6XA 1CUFA 4DNFA 1CV2A 5IS2A 3PGLA 1YCDA 1QIGA 1XZJA 2X76A 4B6JA 1QH9A 4AX4A 3KD2A 3M82A 3QUBA 1R4ZA 4NABA 1CRLA 1W4LA 1LGYA 2I34A 4DMKA 1XKTA 2WILA 5AK5A 3QXGA 1QTRA 3V1MA 2PSFA 3L1JA 3IIIA 1XLUA 2X5XA 4H7EA 2XMDA 3AINA 3WJ1A 2XUHA 3KDPA 4H7KA 5EHNA 5T41A 4HTAA 5ALDA 4AZ0A 4UARA 2OLEA 1MAHA 4AMYA 1QTIA 5LIPA 2YJ5A 7YASA 4W63A 2XUKA 2WQZA 3DOHA 1RMYA 2HA0A 1QONA 2AJBA 2QTBA 3S8YA 5ISMA 4YCLA 3C45A 5HQ3A 3FVTA 1NNLA 3KXPA 4FFVA 1E89A 2ECFA 1J07A 1RDFA 2DQYA 4BRSA 2BCEA 3AR6A 3BXPA 1MX5A 5DNUA 1BEEA 4ZEVA 5HCUA 1IZ7A 3EF0A 4FNMA 1TKRA 3R4CA 4IFTA 4CCYA 3M83A 4OSEA 3L1HA 4J0KA 5AK6A 5AVTA 2FUCA 1YR2A 1ZJ5A 3AR2A 2ACEA 2PX6A 1EVQA 1L7RA 4HXEB 3A1EA 2BDEA 1WB6A 3DKKA 1R3DA 3GBSA 3IVMA 5JANA 2HA7A 4H35A 1LTQA 1XRPA 3I2GA 3MGAA 4YGYA 1EB9A 2WUGA 4X92A 2WTNA 2XMRA 3QMMA 4HRYA 4GLBA 3ET4A 3R3VA 4Q82A 4L0CA 5ALPA 4BX3A 2O7RA 1EK2A 1WB5A 3STWA 4YIKA 1SCQA 1YA8A 2OQVA 3IJ5A 4Q3KA 2AMYA 1THGA 3OG9A 3U7EB 1ZRMA 3AILA 4GXTA 5D6OA 1J97A 4UMDA 2AJCA 4AS3A 1VXOA 2YXPX 3D0KA 1PW5A 3B8EA 3L7YA 1VXRA 5C8VA 5EHQA 2JBWA 4YH1A 2OAEA 3CCBA 5LKAA 1DQZA 3FBWA 3G9ZA 1N8SA 4U2DA 3EF1A 1GT6A 4X95A 1XZIA 2QVBA 1F5SA 3VJMA 1N5MA 3QU5A 5ALEA 2ZXEA 5AW7A 4QE3A 3CZ4A 1L8OA 2QM0A 1QQ5A 3SD7A 5T4EA 3SMVA 3DYVA 5C81A 2C7BA 4DIUA 2JAWA 4CE6A 4Y2PA 4MWTA 3F97A 1LVHA 3E84A 3K1ZA 3MUNA 2FJPA 4GEGA 4XPZA 3VXKA 1MAAA 4RGYA 5ALLA 3SKXA 4H18A 3ICVA 2PUHA 2GFHA 2C58A 4UBNA 1YB6A 2FI1A 2QYHA 4FLEA 5JAOA 4NAVA 5AM3A 2CFTA 2FPWA 4GDMA 1T5TA 1U02A 1L7OA 1LBTA 3ZLVA 4BYMA 2K2QB 3L5KA 1L7AA 3ESBA 2WJ6A 4PO3X 3WK8A 2G0AA 5A6VA 4KR0A 4L3WA 1ACJA 2AUTA 3AIOA 3FSGD 3WGUA 1VKHA 3I6BA 2ZBDA 3WWDA 4FE3A 5AKZA 1MTZA 5AVSA 2PL5A 1YNSA 1MT3A 3FSGA 3ZVLA 3FYTA 4Q05A 1XQWA 3U7FB 4HVTA 3RARA 1UXOA 4KRYA 2PSDA 4OHFA 4DSAA 2ZBGA 4PV7A 1RMQA 3DNMA 2X4DA 1EB8A 3E58A 1VLQA 4GWLA 1O6GA 4P93A 3H2HA 4L9AA 4BBZA 3EPRA 5AKIA 1AZWA 3C87A 1QJ4A 1EA5A 2YMPA 4Y2UA 1C7IA 3FCYA 1LPAB 4IO0A 3UMBA 4DSZA 3DV9A 1J1IA 1VE7A 1CUCA 2B82A 5CT9A 3FWHA 1GXSA 2E3JA 4HXFB 2VEOA 5AHXA 2JGAA 2WIDA 2RGUA 4GHWA 4U2EA 2JAOA 1LZKA 3NWOA 2BAGA 5FPQA 1HBJA 3HZOA 4A5SA 4CIAA 3K2IA 4X94A 2H7YA 2YH2A 2AXEA 4UHHA 1Z4KA 3U0VA 5LZ9A 1E8DA 5FKJA 2YY6A 2HHLA 3ZI7A 1VA4A 5CBKA 2FUEA 1JI3A 3AR4A 5JYCA 4X93A 3A2LA 5IH7A 3AR7A 4C4RA 2WIFA 2G80A 1VFPA 3W05A 1Z88A 4MYDA 5JD5A 4XWGA 3EIOA 2B1QA 4PF1A 1QO7A 2BKLA 3IA2A 3WWCA 4EENA 1KU0A 2XQJA 3L1IA 2WLSA 1RKQA 3ILSA 3V9AA 4B84A 2VT7A 4H7DA 5EGNA 1UKAA 4BZZA 5ALMA 4AZ3A 5JAUA 3DQZA 1JMKC 2FUKA 4G63A 2QUAA 5HK8A 2UZ0A 4G8CA 3H2KA 4OYYA 3FYUB 4FLMA 1U2SA 4HZGA 5AI9A 1ZOIA 2C5GA 1LPMA 1CUUA 3V1KA 2VJAA 2GHTA 4K6HA 1U2EA 1CQZA 2QXTA 1GKKA 4XQ0A 4M0MA 3A3YA 5A7FA 2WFLA 4KAAA 1AQLA 1YAJA 2I3DA 2OA0A 2XQGA 3IBTA 1TE2A 4ZWNA 4JEIA 1DWQA 2O2GA 1QIHA 3O9VA 1Y7HA 3HC7A 3S2ZA 2PU7A 1ZIXA 1Z5GA 4UBOA 5AW3A 1LNSA 2CEKA 3WL6A 1QFSA 3R41A 2ZVDA 1G66A 2CN1A 4Y2JA 4CF5A 2B9VA 2R8BA 2ODAA 3HLTA 4N8DA 2PSHA 2WTMA 1E8MA 3BDVA 2I78A 4K2AA 1DWOA 1ODSA 3K6KA 1U7OA 5KWJA 4FOLA 3L0YA 4FKBA 3DDHA 1AQ6A 5AICA 1ORWA 1A8QA 2XMQA 4ZRDA 2D0DA 5DYYA 4DMHA 3TJMA 5AOAA 3B9RA 3VVMA 3V1LA 3KWFA 4H7FA 5AKYA 5AW4A 1BCRA 4G4IA 3BDIA 3I2IA 2FDRA 2HI0A 1MNQA 5C7YA 3NUZA 1CUHA 2ZJ6A 3NOXA 2AGVA 2Q4TA 1QO9A 5FOQA 2V97A 4BTLA 3AR9A 3C5VA 5JJBA 1CFJA 2WKWA 1A7UA 4B85A 1A8UA 1EDBA 3FPBA 4KJXA 2YJ4A 2JGFA 1ISPA 1QYIA 5C8XA 1K1EA 4IH1A 1MJ5A 3A2MA 2WFZA 5A7HA 2VKQA 2XMZA 4BTVA 4BCCA 3NASA 3NAMA 1FFCA 1Y37A 3IUMA 4Q3OA 2YJ6A 1FFEA 2FJ0A 5CH8A 5I7UA 4L6AA 1CUBA 4CFSA 2ZG6A 1SCKA 4K6GA 3ZLTA 4JDPA 2V96A 2J4CA 3FCXA 4B82A 1YS9A 2JF0A 2BGNA 1KYTA 1XZBA 4AQDA 2DR0A 3RK4A 4BZWA 2BY4A 4JUIA 3T4UA 4BAUA 4KE8A 2J3DA 1XP5A 1N9KA 2IIVA 1P0QA 3L1UA 3CCCA 2Z8XA 3IB3A 1VJRA 1P0MA 3N5KA 4BC0A 5IT0A 4WY5A 5EIAA 4N5IX 3F9CA 4H7JA 3QPCA 1TCCA 4BVKA 1JJBA 5AJHA 2GBGA 5CURA 4KAFA 2GBCA 5AW6A 2WM2A 5IKXA 2FEAA 3I6YA 3WJ2A 1ORVA 1X42A 3D6JA 3MUOA 4I9FA 1RP1A 3TEJA 5AW8A 2YASA 3O4JA 4HGNA 1LZLA 1O6FA 2JARA 2WM8A 3DDUA 5AKEA 2VT6A 1CLEA 1Q84A 4AN0A 4GXNA 1CUWA 1QIFA 4OB6A 3NIWA 2OCKA 1K63A 3I1IA 3WK5A 1O03A 2HSZA 2VAXA 3WKBA 3C43A 1XRRA 1USWA 5AVUA 4QJBA 2G09A 3H0CA 3ESCA 3N28A 2CFRA 1K8QA 2PUJA 2FPRA 2BGRA 3DEAA 2DCMA 2C4HA 1LPBB 2HRQA 2PU5A 3PF8A 4DNPA 5HZGA 2XDWA 1XQYA 3R40A 5CMLA 3N1UA 3ICWA 3EQ9A 2VA9A 2XMCA 4YCMA 4OU5A 3JW8A 1CUIA 4IHAA 1R1DA 4OCZA 5E4TA 3F8SA 5LLSA 5DNVA 1ODCA 4F71A 2I55A 1OCEA 5CTAA 4RETA 1MPXA 2HU7A 4JYPA 3V48A 5LZ5A 4HYTA 1K5PA 2JGKA 3EF3A 1CUGA 1BE0A 1G5FA 1ZJJA 2OXEA 3FLBA 1ZICA 3ZVMA 2Y2UA 1Z4NA 3A6ZA 2XUIA 4E11A 3I6MA 3BIXA 2WF8A 1ZGBA 4RE6A 2GBIA 1ZI9A 1ZGCA 4ZV9A 1Z68A 3D2BA 3IURA 3WKAA 3FGOA 5CT4A 4KX3A 3AIMA 3PCTA 1Z4MA 2R8EA 1UWCA 4BYGA 2DHCA 4PQEA 4AB1A 2GYVA 2OCLA 5EHXA 2NW6A 1AKNA 1N1MA 2Z3WA 5SYMA 1RC8A 5JAHA 1JU4A 5K3AA 4ZREA 1X2EA 3OTQA 1SU4A 3RF6A 3BIWA 4QLOA 5CT5A 4BNDA 3P96A 1UZAA 3PF9A 4Y2XA 4WDQA 2XMBA 2IOHA 1AURA 4ZXFA 3QUQA 4LXIA 4DNOA 5D3KA 1MH9A 3LCRA 3N0TA 1UK6A 3EBLA 4WJLA 2OG1A 1B6GA 1WR8A 5AW5A 2W6CX 5JADA 4Y2VA 3IB6A 1Y8AA 3SLRA 1H2YA 4KNVA 4G9BA 3HXKA 2GBFA 2XQIA 4YIHA 1ZD5A 4UBMA 4NV0A 1J2EA 1QIEA 4G9EA 3B9BA 1XROA 5ALKA 4MQMA 1J8DA 2WG0A 4OB8A 2HF7A 3G9XA 5E2IA 1ZS9A 5HFAA 3W2TA 5ESRA 2BDUA 5A71A 2D5LA 1RYYA 5IT4A 2RI6A 1MNAA 1BU8A 4DNQA 3A1CA 2JGIA 2R11A 2VTVA 3AZOA 1BN7A 1RRCA 2PKEA 1CUAA 4EY5A 5KREA 4B6GA 2B30A 4UFNA 2WHPB 1DQYA 3H18A 2XMGA 3TRDA 3IULA 5JZ9A 4PSUA 1WHTA 3DJYA 5E0OA 3WWPA 1S2OA 3R9KA 1DU4A 2YYSA 3FVRA 3GFFA 1N5RA 3AFIA 3STVA 2WUDA 4INZA 3FLAA 4U2GA 4CCWA 2P11A 1TAHA 3BWXA 4UU1A 1WPRA 2EEPA 3G0IA 2ZYSA 2WSLA 5DNWA 4YK7A 2VJDA 5KWIA 5FDFA 1FFDA 5FLKA 3H19A 1J06A 4YPVA 3ESRA 1IUOA 2ORYA 1YAHA 3I2FA 1T5SA 1S8OA 5JD4A 5A3RA 3L1VA 2W4MA 1XKLA 3HLKA 1Z5UA 4HGRA 1TJ5A 1CUJA 1MN6A 1XLVA 3ZI4A 4A23A 4NFLA 5FRDA 3G7NA 3SX4A 2B61A 1YS2X 2DSNA 4L72A 3FLEA 2DQSA 1JMYA 1XRMA 2PSJA 4J0IA 3W04A 2HCFA 5AM4A 2WIKA 3I1YA 4KNWA 3ZPXA 3AZPA 4S0XA 2R8YA 4KAJA 2P69A 3A70A 2XUPA 3WL5A 1QIIA 2EDCA 4GW3A 1L7PA 4K6KA 4XIIA 1Q83A 2MSNA 3QZUA 5ALOA 4B7ZA 1ZD2P 3IUNA 5FUMA 4JH0A 3WK6A 2ONCA 2PQ0A 2WIJA 1GPKA 2YFYA 1H22A 1QOZA 3WIOA 3N2ZB 1AGYA 1HDEA 4CNQA 1EINA 4QA9A 4IH4A 3VJLA 1TA0A 4J0GA 3FZQA 3GYGA 1VJ5A 1CUXA 1A88A 4Y9SA 2CB9A 2JGEA 1TJ3A 4MWSA 4ZI5A 1SWVA 5AW1A 4C4ZA 1RLOA 3WZMA 4ITVA 2HIHA 2JEZA 5AK3A 2I33A 2I6XA 5ALNA 1P0IA 3QU4A 3D3NA 1RLMA 2JGLA 4UATA 3WKEA 1IUNA 3D7RA 4I9GA 3G0BA 4NMWA 5JATA 3R09A 1F0PA 3ESAA 4KE9A 3STXA 2HFKA 1DTEA 4WFIA 4X7BA 3HJUA 4UMFA 2QKYA 2C8LA 1DX6A 3KBBA 2FPUA 5JASA 4QLAA 4EA6A 3D2CA 5AW2A 2EAUA 1K6EA 3HEAA 1SOMA 4CG1A 1EK1A 3SC2A 4EY8A 1GQRA 4UASA 1AMNA 1YMQA 3N8GA 4KE7A 2G5TA 2YMMA 3DL7A 4H1WA 2C0PA 4EHBA 1Q0RA 5FPPA 5A3QA 3I6ZA 4UPDA 3WYDA 1TQHA 5AESA 5YASA 4F5ZA 3U1TA 3SKYA 5AVXA 1EH5A 2WUFA 4G9GA 4KRXA 5AIBA 4FFWA 3VVLA 4B80A 3CXUA 3C6ZA 1CQWA 4BATA 3G0GA 4HGOA 5JAPA 4BC1A 1XZHA 5AKLA 5FP0A 4ZV7A 2ZOSA 1QGED 1BN6A 1CR6A 1XZEA 5AKKA 5F4ZA 5SYNA 5BV7A 2I54A 3FM9A 4KE6A 4KYTA 2B20A 2XUDA 4OYLA 3PGVA 2W43A 3WK7A 3QITA 4OFZA 2IOFK 2Z3ZA 3NUQA 5AIAA 1Z4QA 5JALA 4KEAA 1RLTA 3OOSA 4G8BA 2AJLI 5AW0A 3F67A 1XZAA 1A8SA 2DQZA 3V1NA 1X2BA 1LBSA 4Y2QA 2PPLA 1UT6A 3H2GA 4MQLA 3HI4A 4XE5A 2OYCA 1UK9A 5AM0A 3G0DA 4QDTA 1UFOA 4C89A 5AVRA 4AP9A 3L0CA 1YV9A 4ZEXA 1AC5A 4MWOA 4QEKA 1ZI6A 4BBJA 4EBBA 3MVEA 1ACLA 2OAGA 4WFJA 1UK7A 4UBLA 2I03A 1XRLA 4X6YA 5EI5A 2G1AA 4XOUA 1GPLA 3WYNA 3ZWKA 1UOPA 3DAOA 4AO6A 5JIBA 2XB6A 4ETWA 1ZOLA 3D4LA 1T2NA 2WJ4A 2YMLA 4Q1VA 2HADA 3OCYA 2IX9A 3E3AA 5BWBA 1YASA 2CMFA 1UOOA 3RM3A 4P08A 2WJ3A 2NO5A 3KWJA 4MEAA 2WU4A 2OBBA 4RE5A 1WVIA 4UHEA 1G42A 4UHDA 4Y2RA 3S6JA 2WU3A 4DW8A 4HXGA 3NANA 1W52X 2ROQA 3GROA 2WF7A 2HA4A 1EDDA 3OCUA 4RESA 5I9IA 5ALSA 1O08A 2EATA 1W75A 3PDCA 4UFPA 1XRNA 2VQ6A 2CFSA 2XI4A 5DTIA 5ALVA 2BUBA 5AM1A 3KC2A 1FFBA 3BF7A 4J3JA 1WPGA 5HKAA 2GO7A 4J03A 3PFBA 1KU6A 2JEYA 4AXBA 2ZYIA 3EWIA 2QR5A 3O4HA
chains in the Genus database with same CATH superfamily
1Q3TA 4QWMA 3IIKA 1SPXA 1T2UA 3OPMA 4F96A 4PRZA 4PHAA 3RRNA 4PXSA 1QSSA 2Q4BA 3BKWA 1LSOA 4RNCA 4BNDB 5EJMA 1MQAA 1K5GA 4ZVKA 2Q4EA 1NN5A 2M98A 3WG9A 4DILA 4GBJA 3SZ2A 5TARA 4B9TA 5H1YA 3NS1A 2K60A 4U3JB 4N65A 3W2EA 1VG9B 3RJGA 4O2BA 2ZSFA 4Q66C 3DXZA 2DE0X 4QUEA 2JIMA 2ZS8A 5B3JA 4RELA 4Y2YA 3MTDA 3KZXA 2JCSA 4RK1A 5IAKA 1X14A 2BF7A 3OPVA 1U0JA 1U4NA 2A9OA 1ZMTA 3L8HA 4GMFA 2OWDA 3D2SA 4BNVA 4QC2A 2GMWA 3MLAA 3T1NA 1XG5A 1HUQA 1E2DA 1XWWA 4MUXA 2VO1A 3DL0A 4DMFA 4I6JA 3JWGA 1FUIA 3GZTB 1PV2A 4H77A 5DBFA 3C23A 2VNJA 3K31A 3W8FA 1EP1B 3W8DA 2W9AA 1UP6A 1QF7A 5IT5A 3EYWA 1Q91A 1Q7CA 2O8DA 4JYBA 4DY4A 4BO6A 1RXCA 3M8SA 4PTLA 1T6BY 1O9GA 2B1RA 2B7BA 3K5PA 3RVKA 4Q3NA 1FFAA 4YUWA 2ZRFA 4LV6A 2PCLA 3BJEA 4Z1MA 2DR3A 2VJYA 1SCAA 3JVVA 1MIOA 1G9XA 2AEJA 2BDTA 4RLQA 3CZCA 4G97A 4BQNA 4O5EA 2DETA 2W2NA 1T1RA 2J3MA 4X90A 1YB5A 4QFDA 4A6PA 3R3WA 4MYTA 2ZSIA 3UCFA 5B5EU 2W9CB 1NJYA 1C7QA 3QPWA 1L5RA 1T24A 2X5OA 4IILA 2A0FA 1GZ5A 3SHOA 5JFOA 3KJNA 3OUTA 1HUZA 2VEDA 2RHWA 4PGGA 1W581 4BUCA 2CK3A 3OP4A 4RK7A 4KFCA 5FULA 3X3HA 3ORYA 1OIWA 1VBFA 2J9ZB 3OD5A 2Q4DA 1E2IA 3GFTA 5KFRA 4MMZB 3T7RA 1MBZA 1NNUA 4YN3A 5CHGA 2WMNB 2F9FA 5G53C 4DV2B 3WIBA 4ZGBA 1YBFA 1RJDA 5KQGA 3TTSA 1YBMA 5CM8B 1T2CA 4INAA 1V3UA 2EJWA 2Q62A 4ML3A 4TSKA 5T3YA 3DBIA 3AEVA 4DEZA 3UPUA 4U6QA 4K9QA 2G8LA 5CLQA 1JA9A 4Z3DA 2ZJFA 2AH5A 3DEFA 1RM4A 4GPEA 3B3JA 2C3YA 2B2NA 1RVDA 2FPKA 3M6XA 4I2CA 2WAAA 1C1DA 3DG9A 2HO4A 5L8VA 1UKBA 4PFSA 3OY7A 1WCXA 1ZD9A 4DLLA 1D6NA 4YMMA 4LCBA 1K5HA 4LE1A 3HXLA 4D46A 3D9QX 5CCDA 4YT5A 4V0OA 2P4UA 1MHTA 1TVKB 1QFMA 4IVPA 3R3JA 2AF4C 1VJDA 4BN5A 5L1LA 3HWSA 1NW4A 2I4MA 2H5XA 3PV8A 1CF9A 4KSCA 2W2PA 4PLWA 2OHJA 1D6MA 3QTLA 3LDHA 2BJVA 4ZFNA 3VUEA 5DBEX 3UMGA 2MDTA 1L7QA 2W7PA 2I8AA 3HN7A 5CEEA 1E62A 4EHKA 4I1OA 1KGSA 2FPXA 4J76A 4WFKA 5CW2A 2RAFA 4MW5A 3TEFA 3WA6A 4K87A 3F2CA 1ZY2A 3LIPA 4B9LA 1TJPB 1V97A 3L8ZA 1BDMA 1BXRB 4RKQA 3WB0A 4A0HA 2VPIA 2IYUA 3PD7A 4RQ5A 1BX3A 4ETIA 1NBMD 2FMFA 4A92A 1R6UA 1XTBA 1G6KA 1R3UA 3O1HB 2H3QA 1KFEB 1S0VA 1XEWY 4CPDA 1C4XA 1EVLA 2R1ZA 5CLFA 2IELA 3QX3A 4NZOA 1YQGA 1P6XA 4JNCA 3CO0S 5KT2A 2VZ9A 4ZEWA 4RF5A 3GA5A 2DTDA 2O8VA 4PGQA 1PVQA 3IOYA 1DKPA 3GY0A 5IMSA 4YFKA 3NLLA 4CIBA 2VK2A 4D4IA 1NY6A 3ND8A 3BL8A 1RYMA 3CRQA 4L4SA 5FA6A 1IXYA 1G9SA 4M55A 4BX2A 4LNUB 4OGFA 3M9NB 3WO0A 4QWAA 5EA2A 3A1NA 3DFKA 4RQAA 5LMNB 2GBPA 2VRCD 2R7MA 3T4EA 3QTTA 3WHPA 3M6FA 4GLJA 3VO8A 1U1CA 4G24A 3H4BA 3F5AA 2VDWA 2HOQA 1YL7A 3C85A 1AUOA 3LT2A 2H9YA 4FFBB 1MN8A 4JLBA 4NLZA 4HEJA 2MRLA 1JT2A 4X7MA 1TMKA 4RZ2A 5K0LA 1NX6A 3TF5A 1JJIA 1NJ1A 3OFSA 5LOVA 3KTOA 3BOSA 1DVRA 7ICPA 4GI5A 3VTKA 3WA7A 4MA0A 3WMRA 1FW8A 1Z8FA 3HPRA 3AEKB 1GM5A 2FLVA 3DDOA 1SKBA 4R31A 2YJGA 2LM4A 5IXYA 1KO8A 2WTFA 4IYRA 1ZK3A 4JT8A 4FILA 3GRCA 5TF0A 3KKPA 3VNRA 5K9ZA 2PWYA 7ICRA 4ILKA 1FDIA 1JXOA 3JAKB 1NF3A 3DE3X 1UBOS 4U7TB 2IE0A 3M4JA 3WWEA 2J6UA 1XJWA 4RLHA 5A9RA 3QTBA 3MC1A 1GUZA 2QB0B 2G9ZA 2JH9A 3MIZA 1IWOA 1M34E 2XTNA 2MWMA 2CBGA 3WNQA 3V34A 2BZSA 1WW2A 4WHMA 4CR7A 3U7GA 1ZJWA 4NIMA 1TCBA 3LWZA 4XX1A 1LNQA 2KNJA 1BXZA 2O1XA 5EHZA 2VCYA 3K1RB 1IEXA 2WTUA 1U0NA 4JOCA 3Q9UA 3HP6A 3SZLA 2WWFA 4X8LA 3CSSA 3G2HA 1YCDA 1YHYA 2O5EA 1E2QA 4OJ6A 3QXGA 1NSYA 4NZMA 3NTUA 3VR4A 5IJXA 4FXOA 3H5VA 2PVPA 1QONA 5TMPA 4GMDA 3A4LA 4HADA 4Y6LA 2VYNA 1RDFA 3FFTA 4O59O 1BPXA 1A4RA 1D2MA 3K4HA 1LQUA 1F7VA 4BLTA 1MX5A 3RFAA 3OZRA 4DCGA 3AERB 1I2AA 2V4QA 1D8TA 4MHOA 3ZDZB 2HJWA 1PJ8A 3EMBA 3JPYA 4FS2A 3NTXA 4MR8A 3JQBC 4GOND 2WZDA 5E6UB 1QHEA 5CP8A 5FWYB 1ZQOA 4YGYA 1I8TA 3A6GA 2DWQA 1DC8A 3RWBA 4JJIA 4BOYA 1NMSA 5TISU 1WF3A 1KYWA 1HE5A 3W5VA 1U0FA 4GXTA 1UHUA 1PTJA 3D0KA 4MUKA 3TRFA 5J0UA 1B3RA 4NXZA 4YH1A 2OAEA 3IT3A 3GLGE 3BN3A 2HBLA 4O5KA 3D6UA 2QVBA 1XCBA 1ZXBA 5F64A 2C7OA 3CZ4A 3C2LA 3OJEA 2Z9DA 1ESNA 1WWUA 2HNAA 3THWA 3F97A 1FUYB 4BVAA 3E84A 2WSIA 4WESA 1HY3A 1PQWA 4H18A 2PUHA 1Z5WA 1BA2A 3FMFA 3MBIA 3KTAB 1ZVKA 3IP8A 2D3WA 1P3JA 2D1YA 3S81A 2ZXIA 4EG7A 3ZLVA 1T1JA 2N42A 3L5KA 2UVWA 4LJ4A 3OSNA 2GRAA 2CXRA 3AU6A 3R6GA 3H5RA 1EDZA 2VSNA 4YPOA 1LLQA 4PV7A 1BGVA 1SCUA 4ZT5A 1J7KA 3MSCA 5DSZA 4BBZA 5AKIA 2GXQA 5ITSA 1NQWA 2G36A 3VDRA 2L69A 3FOWA 2FK8A 4NBRA 5CNKA 3IELA 1CY1A 2CD7A 2XRZA 2B82A 1E5XA 1OFIA 5KDOA 1F2DA 2BE9A 5AHXA 4N18A 2WQ6A 5DNDA 3Q8XB 3W6OA 1Q15A 2VH2A 4MKRA 5M34A 1YBAA 2RBEA 1ESDA 2YYZA 2YY6A 3RAJA 1TXGA 4CEIB 4BQQA 4D3SA 2ZEJA 4F8JA 4J1TC 2VOEA 3WB9A 2JJMA 3BHIA 2RK6A 2OCXA 3HCBA 2W03A 1WULS 3P9YA 3F5MA 3BSWA 3TW4A 2W8LA 1QO7A 3MR5A 3BEOA 1J2JA 3GVIA 3A6KA 4B4UA 4EFNA 5TEWA 2XX3A 4NJMA 1EK0A 1LF5A 2PBZA 2AZXA 4G8CA 4BLSA 4KXNA 1KQFA 3HWWA 1A8PA 3ITNA 1VECA 4BNTA 1QTMA 4RVOA 1RRMA 3L7CA 3LPLA 4YROA 3KXKA 5KFCA 3ZXUB 4H0FA 3DFZA 2XY7A 1KJJA 1CDEA 4B73A 4Y2JA 5BOSA 2V4RA 4G85A 5KYXB 4S05A 3L2OB 1NI4A 4PWZA 4TQUS 4Q4HA 4JI3B 3AHHA 4B3FX 3VR2A 3O3NB 5AICA 1G5TA 2AGQA 3H4DA 1KJYA 3BHNA 2AA3A 2XMQA 4DZRA 4XDHA 4DMHA 5L7WA 4IS3A 3HRIA 4CM4B 2IHUA 1IDN1 4K46A 1LA2A 5JRTA 5I7SA 3NUZA 5A06A 1I9GA 2ZJ6A 1JHRA 4OK5A 1YOBA 3ABZA 4QQ8A 3SGLA 1ZDMA 3CEHA 2W7OA 1EDBA 3FPBA 2FOXA 4OH7A 1R5BA 3EG9A 2WU8A 4M1OA 5I51A 2V8BA 1F8YA 4XB2A 3IUMA 3WBFA 4PZEA 1QRRA 3ORHA 1UWVA 3I45A 4CFSA 3SJ7A 2PX8A 1F3LA 2K4HA 3QX9A 4BAUA 3LKBA 3HP4A 1G21B 2OV2A 2A0XA 3L1UA 3UHAA 2SKCA 4UQGA 1LX7A 4R40A 3S44A 3G2KA 2VPPA 3NVYA 5IC5A 3PT9A 2YVQA 1UBUS 3KKAA 2KS6A 4LZOA 2WMYA 3R7NA 4HMOA 3A4VA 4HGNA 1MZPA 2BHTA 4NK5A 2NQ2C 3LT5A 4GXNA 3W79A 2PD3A 5BR1A 1RXSA 4TMYA 1IMOA 5HCIA 2CFRA 4AIRA 5F35A 2VN8A 1ZRHA 5SY9A 1LS6A 2XDWA 1MJGA 4UUPA 3CO5A 4GVLA 1S4MA 4OCZA 1NJSA 1C4KA 1U1FA 4RETA 1SB8A 3T7JA 4OJQA 3W0LB 4RNMA 2JGKA 5DB9A 3H11B 1SC3A 2IYXA 3BE4A 4JBXA 1K75A 4Q0MA 2CNLA 1K4KA 4O4JB 3SMQA 3EVEA 2X9LA 3S7TA 1TO6A 1K3TA 4TTIA 5C8YA 3E8XA 3ISVA 3AMVA 5CT4A 3SQNA 1W36D 3QSYA 1YJAA 4D56A 3GQBA 2ZTUA 1PD0A 3REFA 3HHPA 4EF6A 2ZAIA 4ZREA 5DMXA 3NDRA 1Z00A 2DRIA 4JEMA 5L7YA 4EEXA 3UY4A 4EARA 2IOHA 4J9QA 1L4BA 4DADA 2MOKA 3LCRA 4UEKA 2W6CX 1H2YA 2QX8A 3OSPA 4FZRA 4PZUA 4WZBA 2G71A 4NV0A 2F48A 1SQ6A 1LDNA 4I2NA 3HCPA 4OAOA 2KG5A 1J8DA 1YRYE 4QPCA 4F5YA 5IT4A 4BS9A 2JGIA 1B4FA 2VTVA 4IJWA 1P1IA 4B7CA 1MC5A 4DUGD 4B6GA 3CLRD 4K9KA 2WHPB 1KPHA 3AI2A 2TYSB 3WWPA 4PR3A 4FDUA 3N70A 1N5RA 3STVA 3GLUA 3L79A 4AJ1A 2V6JA 3BMOA 1H0RA 5TY0A 4MA5A 5KWIA 4IO1A 2ODWA 5KSOA 1W85B 3V6MA 2IH4A 3I6IA 1Z6AA 3BWBA 3Q2OA 3K0BA 5KX5F 2JA1A 4LFBB 4ZYYA 3ECSA 4B6QA 2J5RA 3ADBA 4XQ8A 4DG8A 1Y9ZA 3ZOKA 5FUXA 2QROA 4AZ3B 4FFLA 4L72A 4K4HA 4O4IF 2A94A 1RQGA 1MW9X 2EDCA 2R8PA 4FYWA 1Q83A 1R6BX 1KOGA 2B0JA 1IG0A 4EAAA 1D1TA 1OFUX 3MGBA 4QTTB 4BMCA 3C1UA 2OOSA 4TKMA 3ZCTA 3WIOA 1AGYA 1EIZA 2XO7A 1SKUA 2H07A 1A2BA 4UCQA 4EQ6A 4OTZA 1C8BA 3SZOA 1D8LA 2XF2A 2NSJA 4MW4A 4FFRA 1KJ9A 3LW8A 5ALNA 1YDGA 4CETA 1O95C 2J3JA 2K8BB 3WKEA 2VHWA 3CVUA 1CY7A 5LLDA 1MFZA 1CE8A 3CNQS 3E9NA 4ZHQA 2HW8A 2AU0A 1NNSA 1OX6A 4LKRA 1DX6A 1XEXA 2AFHB 4AKSA 1U0LA 1ZU5A 1ZK0A 5EIOA 3HEAA 3ZR4B 5JVDA 1EK1A 2VP9A 4EY8A 2HMYB 1RXWA 4ZC8A 2ZUTA 1U8TA 2PLWA 2YMMA 2CFCA 4F4WA 4G5HA 3MWKA 4XA8A 4I5EA 1BNCA 3K0EA 1VL2A 4M1ZA 1NW9B 1NUTA 1E7RA 3EISA 2I54A 2CD9A 4RJTA 3JRNA 4JLNA 3LK7A 1TFRA 3W7AA 2QRNA 3UCXA 4YQWA 3RV4A 5BW5A 3UAYA 4DNXA 4NH0A 1Y5RA 2CBXA 4AJJA 2W98A 2EKDA 1N61A 4CG0A 3PNSA 1C1XB 3BJIC 2OYCA 1OWMA 1XHFA 4QDTA 3I32A 5J2AA 1NVEA 1GO3F 3NNSA 3DUFB 2R00C 4MX8A 3ER8A 3B20A 3DAOA 2Y92A 3X44A 3GLTA 2FAXA 4CYMA 3AB3A 3T06B 1NW8A 1EAMA 2WJ4A 3TARA 4Q1VA 2HADA 4C04A 1YASA 1C3LA 2VHJA 3WDLA 4UVGA 3P94A 4LNHA 4U0JA 3ZYCA 4I55A 4EDFA 3ZDCA 4LJ6A 4ZTUB 2GPNA 1GUAA 4JK1A 4KAXA 4NECA 1Y6RA 3RRYA 3EDRA 4N4AA 4Q9NA 4D8XA 4OSPA 8ICYA 4QZAA 1E20A 3KSAC 1A0OA 4X9XA 1E3DA 4MGKR 5LYYA 2VQ3A 1DLIA 1ST2A 5BUSA 4WCFB 4K2HA 1BKYA 3HYCA 3TSCA 4E5SA 1ZCAA 4FMCF 3CY6A 3TXXA 2O2HA 4LPSA 3HU2A 5I9NA 2QUBA 3CN7A 2IU4A 2Z43A 5K3EA 2XUAA 3AVOA 1U4OA 1T0HB 2QOEA 5KFQA 2GI4A 4JUCA 4OQ4A 1SH7A 1H3NA 5ED0A 1B76A 3E15A 3F6BX 3T9FA 5K3SA 3INNA 2AN3A 4BX8A 4MHTA 1D9XA 2DERA 5IVDA 4URZR 5FNVA 2WHXA 2GN2A 3QPUA 5F7ZA 4J0EA 4OYRA 4JT2A 5KCMA 1VSUA 2ZSJA 3K9HA 3OCZA 4QQFA 3D59A 5EMKA 4C88A 2PUGA 1M1NB 4PW0A 4XWWA 5IT9A 3L07A 5IARA 1H2RS 4RIGA 4QLBA 3PVZA 1G16A 4LXXA 1I30A 3UJ7A 5ILOA 3KBOA 3M1YA 2NSYA 1H9AA 3EIWA 4N6NA 2Y1GA 1L5NA 3DP7A 4LX0A 3LUGA 4WK2B 3V6KA 1H23A 2GN1A 4D8YA 4D81A 4Q12A 2XNCA 2O8BA 2KFNA 1M2KA 3QKSA 2VL7A 2QTCA 4GM1A 3Q9SA 4RQBA 1NHGA 1ECWA 1VSQA 1HT0A 2GB4A 3DHWC 5GOTA 4GPAA 1EJ6A 3DVRX 3JPOA 5D00A 1IN5A 1QE5A 2SKEA 3PFCA 3IPCA 3UAWA 3BB1A 4V1CB 1EDEA 2Q3BA 4FCWA 4X7RA 1TZCA 1YKSA 1E5TA 2QSZA 1QAQA 1T9ZA 3EH1A 4DL4A 4HB3A 3JVUA 3T3DA 4D41A 2KHZA 3MS7A 3FKQA 3AHIA 4R5HA 2K8AA 1NDUA 5B1SA 1G20B 1HLGA 2QTZA 4MGIR 5DFAA 3RRZA 3AUAA 2ECKA 2OYSA 3AKYA 4F3RA 4UBIA 4MV6A 1Z1VA 5KBYA 2F3QA 2FW8A 4EMUA 4UUMA 3K9GA 1PG2A 1DRKA 4NV3A 3ZIUA 2A0YA 4Z54A 4BQRA 3C3YA 1VCOA 2ATEA 4S1VA 2ACKA 1ZQUA 3DEEA 2VSQA 2IA6A 4DY6A 4EY6A 2VA8A 1XSNA 2K2WA 5JE8A 1P1JA 4RV5A 3T6KA 4DV4B 1MX9A 1GKIA 4G8DA 4JB0A 1CPYA 4YPFA 2I2BA 3ETRA 1Y80A 2C7VA 1SHLA 3A1DA 5I4CA 2KBEA 2GK3A 3TCKA 3B12A 3V2IA 3FHJA 4N1AA 2XIJA 2DJ5A 1HDXA 2DKXA 1UPXA 3OAAD 1EUDA 2QIOA 4UU8A 1DKUA 5F1YA 4X97A 3PYLA 1KY4A 2C77A 4L15A 3DEHA 1XI2A 3Q6IA 4MV1A 4DYHA 4LC9A 1RR6A 2EDAA 2WIGA 4HWOA 1U0OC 3DL4A 4OI0A 2JI9A 1WEKA 3U3JA 1G63A 3U4CA 1V5EA 2Z1NA 4ZI3A 3WC4A 1OXKB 3OKAA 4FEYA 1CZLA 1UXIA 1GSOA 3I4CA 1X8XA 1QNFA 2EG5A 2I6TA 2JJ2D 2ZJ1A 4ND7A 4MP8A 1CW2B 2V5UA 4G5YA 4JBIA 4GU5A 5EKSA 3B9PA 2XTJA 4DB4A 3KO8A 4JLSA 2C2WA 5B3JC 1XS9D 1WA5A 1TYDE 3PCRB 3L4BC 4ZOBA 4OHOA 2IA5A 2F55A 3H0LB 1F8XA 2QMOA 1NUHA 2YL2A 2I6QA 1WUJS 3WAKA 3FFBA 3AV3A 5IJ9B 1FW6A 1DV2A 3JQFA 4BFCA 3TWOA 2JLYA 2GNPA 3B89A 3IDFA 5DH9A 3RKRA 1MHPA 3SP1A 3PHLA 3VPFA 4QPJC 3NT2A 5D51S 3PA8A 2NOAA 4BDSA 4OREX 1WXDA 2DGZA 3WLHA 5EWEA 3RU3A 2HHJA 1WE2A 1CJVC 1X7YA 2EW2A 4MKFA 2BLLA 1WSBA 1D9FA 5EJ9A 1M2EA 4Y2SA 3VHLB 1DO0A 3MINB 3HKEA 1PLLA 3NHWA 1HQKA 1ZIYA 1I9CA 4XKJA 2CL0X 4JAVC 4RORA 1WMEA 2PZLA 1EXWA 4C0KA 4C4XA 4Y8VA 2W5UA 5DG8A 2P9HA 2PK3A 5FI0B 5K5EA 7ICGA 1COWA 5EJAA 3TN7A 5BY2A 4R1TA 3DFIA 3STTA 3NWPA 1Z74A 2IY8A 2PLAA 3IT2A 1N5IA 1KEEB 4TN1A 1P1BA 3I9LA 1WDLA 2GGSA 5F23A 4AC9A 2X2PA 3WK4A 1TYCA 5B5SA 2Z4SA 5BPCA 4YDQA 2CC2A 3HDVA 3GEHA 1YE5A 4RA9B 5FPYA 4BQPA 2VRBA 2VXBA 1OIVA 3HKCB 4DF8A 3VQTA 3CCFA 1M1YA 5JYBA 2H3IA 3V8VA 2YYAA 3U19A 3X1DA 5C37A 3M70A 1E5QA 2I7CA 1NG1A 2CZQA 3VHQA 2B4QA 5SZHB 4PNEA 2CYBA 2TMKA 1W36B 4DQPA 4PCVA 2B83A 4QDJA 3UBTA 3M4XA 3TI0A 1XR3A 1S2IA 2JGJA 3OVMA 3VAAA 5FYDA 3RKSA 4TPKA 3BGWA 2Y0PA 3UOGA 1HTTA 4UHCA 3QYAA 1BSVA 1QZTA 3N8NA 4JLDA 3SS9X 3ZHUA 1D03A 5CXQA 4N5HX 1KW4A 3E1KA 4PWYA 1DX4A 3AUYA 2H00A 2J85A 3EAFA 2C2MA 3MN1A 2JW5A 4DRXA 3HO6A 4OO3A 4R8UB 2PGDA 3AEQA 3H5NA 3AHGA 3RG2A 1HJPA 2VP6A 3IKVA 3QELA 2B8JA 8ICXA 3S5UA 3K1AB 2FGKA 4LVOA 3K73O 3MUEA 5AYVA 2P2DA 4WBNF 1NU8A 1C30A 2NX2A 4F93B 3W1WA 3KR1A 2E6KA 2E9SA 3H3FA 4JL5A 1HNZB 3RABA 5H59A 4RV9A 4M9LA 2GSWA 1PFQA 2OKGA 1G8AA 4B4KA 2W00A 2EHJA 4ECXA 1DJNA 2VG8A 2FYTA 2CJYA 5EP1A 1ZKMA 3EGEA 1YB1A 4D9MA 1ENZA 4ALJA 2QRVA 3HZZA 1IWPB 1T0UA 5EIXA 1KDYA 4DQVA 4L5AA 1QQTA 1RQRA 5AM2A 4HNAB 4B87A 5KJFA 3EPHA 5D01A 3EASA 3PFKA 3ISBA 1JECA 2GARA 3PR2B 4ZAYA 3SHFA 2WDPA 4I2HA 3H16A 2X86A 4CMAA 3E27A 2GJ9A 1EDOA 5BN3A 1XTVA 4NQZA 4E5PA 4TTRA 2F77X 3QUBA 3QW2A 3O4VA 3NHYA 3ZU3A 4B76A 3G13A 1GFSA 4W9NA 1H9BA 4PONA 2GN9A 1XD8A 4YQEA 4H7KA 4OIFA 3H9QA 5EHNA 1URJA 4UARA 2ESRA 4RTOA 2AHOB 3QKRA 1FP4A 3IHLA 1I33A 1EMDA 3C45A 5EOZA 2J7KA 5E9JA 3WGJA 2J45A 1ITZA 3KKLA 3U4AA 3U9SA 1BEEA 1QHFA 5HCUA 3WHLA 1YUMA 1U8XX 3RFXA 1G5HA 3CUEF 1MDFA 3KEMA 2PUFA 4BE7B 4O4LF 3VC7A 3EVZA 1G38A 3V2HA 3C1YA 4HXEB 2ZLBA 1F8GA 1XTIA 1JBKA 3MGAA 1H5QA 2H4WA 1CETA 1R0RE 4IDHA 3T5LA 4F84A 5H4GA 3SQLA 2XTAA 1QGOA 1J97A 4QGBA 1F2VA 3S68A 4KMOB 2LCQA 3EDCA 1TF5A 1Z3IX 4DLSA 5D3MA 2P91A 4D0GA 1JQKA 4DE5A 3QU5A 1J9GA 3RBDA 5H16A 5T4EA 4FGKA 1HZZC 3IJRA 2AC4A 1ZO8A 3ABOB 2DU8A 1WDTA 1I80A 2H85A 4JD5A 2W8BB 1L4NA 1MAAA 1LTHR 3A9TA 3EMDA 3EGCA 3KFXA 3PW0A 5GVSA 1YB6A 4C7KA 2W42A 5CFNA 2JLBA 5F4BA 1KRWA 2BD0A 2G5HB 2R96A 2J9YB 2K2QB 3S8EA 2A9QA 5BMVB 4FVTA 2ANCA 1RJ9B 3UJPA 3H1TA 5DHTA 1XQ9A 1KETA 2IXDA 4CL3A 2WSSD 4DSAA 1JROA 4BNFA 4AM8A 1O6GA 4JV0A 4KPEC 4MKZA 5HIAA 4TYQA 4O2BF 1GZHB 4ER3A 2WAOA 1PZNA 2V9CA 2RK3A 1LPAB 4RVUA 2NTEA 2JKZA 1VE7A 4KDEA 3TQRA 1X7GA 1UCFA 2XVMA 3QF7A 4MRMA 2XYVA 1FYXA 1T5HX 2VK1A 4CMIA 1PUZA 2CSUA 1AA9A 2CUKA 4QJFB 1I3NA 1A2QA 1TM3E 1JLLB 1VL5A 5WRFA 2YH2A 1NLFA 1GTMA 3O2QB 3OZVA 3T54A 2X4LA 3IV7A 3CRRA 5C4GB 2H31A 3RI3A 3NBXX 1MRSA 1P80A 3U7IA 3C3JA 3MWFA 3RQSA 4X93A 5IH7A 4UEOA 3RB0A 3R5JA 2X0DA 2GM3A 1AHIA 1K92A 2AYXA 1KEJA 2JFZA 1VYUA 2IYFA 2XNKA 4CKBB 3I73A 3FCCA 5C51B 1E4EB 4BZZA 4C3OB 3QHAA 1N0WA 2F9LA 3GGGA 2F4VB 3QOXA 2FE1A 4GLFA 3WQBA 1Y4SA 1UJCA 2IVZA 1RYFA 1RBZA 3CIFA 3KLOA 5LP6B 5GJWC 1DWQA 1QIHA 2Q1TA 2GERA 3R41A 1MGPA 5FUWA 3DE1X 1NVVR 2JHGA 1Y34E 4UVHA 1NLZA 5IC6A 4CCAA 1EVJA 3PFWO 1MEJA 1SEPA 3ZDYB 3L0YA 4BJQA 3UKJA 2WINI 3NVMB 4IJ6A 4IMJB 2JFPA 5DYYA 4OJPA 3AMZA 2FFBA 3PNCA 3H6KA 4KFRA 3RHTA 4LBZA 4M6WA 4DDWA 3SZGA 3PO5A 4PAGA 1KFDA 3CW9A 4EKEA 1XXLA 9ICGA 4TWAA 2X41A 1CFJA 3DLPX 3LSYA 3IV9A 3TD2A 5EJEA 1R00A 1JI0A 2WFZA 1D4ZA 2PT6A 5ICEA 1ZSVA 2QSJA 1ZA2A 4IDPA 4RMGA 3HADA 4UTZA 1NMEA 1JZQA 5KNBH 1SA0B 2I4RA 2ZG6A 3G8AA 2W71A 3ZY6A 1SV0A 4QD3A 1YZGA 2Y1FA 1A82A 2J4CA 4Y9UA 5CD9A 2JF0A 2C8VA 1ZMBA 4M1YA 4MUIA 1PG0A 4GLLA 8ICCA 1GRQA 1JR3A 4TVOA 3OP1A 4I2VA 3QXSA 3UAGA 1M83A 3HFJA 1K06A 2X7XA 4BC0A 3D6VA 5EIAA 3OWHA 1TCCA 4WGGA 2WM2A 2WYOA 2HPAA 2XEXA 1FFXB 2OHOA 4ZA2A 3L93A 4XVQA 3ILHA 3OZTA 4XAQA 4D8TA 3O38A 1RP1A 4DSEA 2N1MA 2QG4A 5B1YA 1FRNA 3VSBA 1CQJA 2EKLA 1NOIA 3D3JA 2Z56A 2HSDA 3ZGLA 2QRZA 1X66A 3WYAA 3AG5A 5DHSA 4JGBA 3C43A 2EHDA 5AVUA 2FUNB 3KYCA 4HN4B 4NU6A 3HNRA 2HRQA 4OMFG 1B23P 3P19A 2ISPA 3R40A 4E70A 3CLUC 1SQFA 3VR6D 3W2GA 3GNTA 4AZWA 3AKEA 3LQRA 1OCEA 2HU7A 5CLLA 2GD1O 1XDUA 4DMRA 1UMCA 1GG8A 3HR4A 1R64A 1R8QA 2BFFA 4A2PA 4YRKA 3A9SA 1CYEA 1EYZA 1VLLA 3BIXA 3TPZA 3GOQA 2YFHA 5CIQA 4B8ZA 2GBIA 4CTKA 4L5JA 1G21E 5FLEX 2EAMA 1DPGA 3VZSA 4ITRC 4QO7A 3NTRA 2AV6A 1RJWA 1IJKA 4A0SA 5ELXA 3O3CA 4MR7A 2ATIA 3NI2A 1ZOOA 3COVA 1E61A 1QP4A 3MPUA 3WISA 4IL6U 1JLMA 1E9FA 1NUSA 1T3GA 4I7EA 5DB4A 1IBLB 1VKNA 3TAPA 4WJLA 1XYVA 2QPOA 2WVHA 2QMUA 1F51E 3GLSA 4NBTA 1B6RA 3MFYA 5JDIA 2V7PA 1XROA 3ADCA 3IVGA 5E2IA 1DZ3A 2TMYA 3KS9A 2D5LA 1FRVA 4DJ5X 1MNAA 3A6DA 4HMQA 4ECVA 2FN9A 4WGFA 2O5CA 2Y66A 4P86A 3A6PC 3W3AA 5E0OA 3WICA 1V37A 4PPXA 1Y7LA 4RQTA 3LY7A 2GXAA 4ZRNA 2ZYSA 3CUUA 2MT9A 4KR2A 3U7QB 1ZBDA 3ZBUA 3NEPX 4YPVA 2Z6UA 1VHWA 1ZM7A 4QHYA 4MNTA 4XIGS 3TQFA 5F1PA 1D5WA 1S8OA 5JD4A 5FR1A 5AVOA 1XKLA 1Z5UA 3NDBB 1CS4C 3EEQA 3TGWA 3U1BA 4GXJA 1WP9A 4E5VA 1E3EA 5BNIA 4TUSA 3IUSA 4GW3A 4D98A 1TQ4A 4S1PA 4OV6B 1D8YA 4EM6A 2WQ7A 1L5QA 3H40A 4V3CA 4IH4A 3LPCA 4ZJUA 3JPWA 3TZ6A 3VSDA 3D7SA 4JMLA 2BR5A 5BVHB 2ZT8A 5LOVF 5J5VA 1RLOA 4DF3A 2VQDA 1ZMXA 2FR8C 4WA7A 2V7QA 7ICIA 2FU5C 2H8GA 3JTMA 4CLRA 1LK0A 4E6EA 1F0PA 4OM7A 4RZSA 5LWQA 3MBYA 2ZIVB 3ZGOA 3SEAA 1K1SA 2QKYA 3INGA 3C7DB 5EVJA 2QN2A 3SC2A 5HUHA 3N8GA 1U2QA 2VTKA 3DL7A 1PDOA 1Q0RA 4G6ZA 3Q3HA 1W88B 5YASA 3EEBA 1AQIA 2W9MA 1U7WA 9ICIA 1DAFA 1WPQA 3G0GA 2UXDB 5JAPA 3DEIA 1VMEA 4Z9YA 1Z29A 1QGED 1USIA 3UHFA 3HDQA 2CXHA 1B42A 1MR3F 3K71B 3J81k 3PZPA 3ZE6A 2PFGA 5AIAA 1KDHA 5E38A 1PGNA 5ADVA 3Q7PA 3SSOA 1CCWA 2YNMC 5JCOA 2W4IA 3T3FA 4H1TA 3HDTA 1GR0A 3MCWA 4RUCA 4F4XA 3TLXA 1JKXA 3UAXA 2HIGA 3LFTA 2ODNA 5CHYA 1ACLA 4JJ8A 2I4NA 4HH3C 4RL6A 1YWGO 5KFBA 4DDMA 4CW7A 3VKHA 2VQEB 1Y8RA 2LBOA 3QP9A 1ZOLA 1MKYA 3DMRA 4EH1A 5KDLA 3OUUA 4YREA 1VLMA 3KUCA 4BMOB 3Q8RB 1MF7A 4GSLA 4D43A 1F4PA 3HN6A 2AF3C 2XI4A 2Q2NA 3GP8A 2WAYA 1WPGA 4RNNA 3IVRA 4KWHA 1SN7A 4N76A 2FMTA 3W4IA 3GNSA 3U09A 1O5OA 5AVQA 5FV4A 2GN0A 3I1JA 4DL6A 3AM5A 4L07A 1YKFA 3QXJA 4ZCSA 4XX0B 3E5HA 1U5BB 5G1OA 3WQHA 4E13A 4FTWA 2KHVA 2ACVA 1C9EA 5DLDA 1M5UA 1FSGA 3ZGVA 4F60A 1BG6A 1NLYA 1Z83A 1NQAO 1VHJA 4Z4FA 4CKZA 1KVUA 3H4VA 1KVSA 4U7CA 3D3WA 1HQDA 4HUTA 4ZU1X 2AFVA 1KTQA 4IG4A 4JT9A 1JKJB 1KIAA 4JHLA 3N7RC 1YGYA 1DDIA 2A9RA 5BXYA 3DVLA 4J6FA 1IFXA 4P38A 3OEED 1RJEA 1TPYA 1F44A 5FWXB 4KK3A 3USZA 2P8SA 1E92A 5C0OE 4IM7A 2OZKA 3QEJA 3D0QA 1F60A 1KXJA 4JUFA 1BPEA 1SKSA 4RF2A 4EG5A 2JFHA 1RI2A 3TR5A 1NVDA 2YRFA 3FC4A 3KG2A 5JEEA 4GMGA 3IDQA 1U9YA 1EP9A 2XVYA 1NLMA 2R8XA 3E9QA 4X8MA 4MVJM 3RBAA 5EUMA 1UODA 2OCGA 3V4RA 1YJ8A 3UUFA 2ZCJA 2HK6A 2XY5A 4TLMB 3MJEA 1KYQA 4IIFA 3FB4A 3NV7A 4AL4A 1A1SA 4M1WA 1XK7A 5JJLA 2FFRA 3LMKA 1BVUA 3W06A 4RHYA 3IQGX 3PQ3A 1GKYA 4QBIA 1P9NA 1R10A 1OZFA 1Y5MA 4J7AA 5E1OA 2YCLA 3AESA 3TVTA 3F9RA 4C22A 1MXFA 4HTFB 3WZLA 4RU1A 2BCRA 3C16C 4RADA 4DFJA 2Z6QA 1A4IA 3PW4A 4KXLA 1J8YF 1Z0DA 4P4GA 1TZKA 4H7IA 1LJ8A 1MX1A 3IKLA 2YB1A 3RFUA 4RZHA 3NGMA 4GNKA 1KYXA 4DMGA 1BHJA 1DAGA 2ZATA 1YZFA 1SL0A 1P0FA 4ITUA 1FTSA 4X6UA 4XWOA 2BQUA 2FFHA 4LHWA 1TM4E 1M6VA 2I1LA 3T7TA 4E46A 5B1DA 4CL0A 3GZNA 5IJAA 2NRVA 4F72A 3UN1A 4K0KB 4QZVA 3OJWA 4F1WA 3AR3A 4O2LA 5DSTA 4XCQA 1D07A 2P9EA 4UAUA 5IKEA 1K89A 3NOQA 1P7ZA 2ZSHA 4P92A 3VZPA 4L6CA 3LGXA 2HPHA 4A27A 3MMZA 2GKGA 1UJ4A 1CD5A 1UBEA 3WLPA 1SIJA 3K20A 3PICA 1IYZA 3W5DA 1O5TA 2E3TA 2XT0A 5DPMA 3PJFA 2PSEA 1HURA 2BIFA 3DDWA 4W4TA 2KPOA 3TW6A 1NE7A 2OH2A 2BFWA 1HKHA 4K6FA 1QLWA 5F5NA 4PZAA 5DG9A 3VAYA 2OVFA 4R05A 2Z83A 1KKXA 2HA6A 4IINA 5FPKA 3C4VA 2NZ2A 6LDHA 4F2GA 2QJRA 1WRBA 2XWPA 3T1OA 4WOPA 4R16A 4EHHA 3H8SA 4RQUA 3GJ7A 4XSVA 5LDDC 3OESA 4BEBA 2E89A 3GZJA 4I50A 4GUDA 4DIMA 4BO1A 5A0LA 1VP9A 4IGKA 4N6GA 4ENUA 1RCTE 4Z9AA 5EJ5A 4CKWB 4O3PA 2HAEA 4DPMA 1T4MA 3OETA 4BJHB 3F7TA 1JAIA 3YASA 4PLPA 3PV0A 2OQ2A 2PI5A 1PGPA 1U1GA 3SYZA 5BR7A 3AKDA 5AXAA 2I71A 2QM3A 4U63A 4ARBA 2NVOA 5JS1A 4PHTA 2ISQA 1B43A 1SNYA 2Q5QA 5J4HA 4QPDA 1VIVA 2C4KA 4KBFA 4UM7A 1KMHA 4LK2A 5BQXA 3QX7A 2VTBA 1QUEA 3FIUA 4G0MA 4YXJA 2Y0CA 4UXIA 3Q72A 1EWKA 3EGXA 2PWPA 4EF4A 4WW0A 5AI6A 3S4YA 1E2FA 1X13A 2H5IA 5B6IA 4OQEA 5LWHA 1XNSA 3C6BA 3HJAA 3AOEC 1ZH0A 4DQKA 2RCNA 3HZHA 3HILA 1HYGA 3RU2A 2D7DA 3ONNA 3DA8A 3THYB 4F91B 2ES4A 4RCYA 2F4NA 3NDJA 2GF2A 4YRCA 1ZQSA 3E1GA 5KYUB 1MD9A 3NRJA 4DJTA 1CERA 4F4HA 1H0HA 1K6JA 1UC8A 5HFJA 3K9BA 5F2EA 5J1TB 3UF0A 1V8BA 2W22A 4LDNA 3PUYA 4LSWA 2FCRA 3PW7A 1U9IC 4DO9A 2C9YA 4OY3A 4YMUA 3NBMA 1N3BA 2A8YA 2DJIA 1RABA 5T7BA 3NYQA 4FWTA 5JROA 4X61A 1QVAA 3K4QA 2VP2A 2HHCA 3RVDA 4JEHA 4XUEA 4KR7A 3RJFA 3H2IA 1PVDA 3KE8A 1C41A 5K0BA 3PR4A 1YACA 3ND9A 1AG9A 1M54A 4O3FA 4P58A 5JI3E 5CB8A 2J9RA 5FAXA 3P20A 1YZQA 3AX6A 4FE4A 1QVZA 5KFHA 5L4NA 4M8NE 1FMLA 3ULKA 1DGJA 1VL1A 4UQPA 3AP2A 2INGX 3IQZA 3F0TA 1W5SA 1IK4A 1VLBA 1GAEO 5JRZA 1MH1A 4ROTA 4UEJA 1UDAA 4P2HA 5G0VA 4YUXA 1FQOA 3C4JA 4GMHA 4KKXB 4TT3D 2O1EA 3G1TA 5EEGA 1HE2A 3H5IA 5CAEA 3DDZX 4MGZR 1GZSA 1NURA 4ZJPA 2W2LA 3ZHVA 2JKVA 3OCJA 4WRRA 1SHTX 3D0OA 2EP5A 4IV8A 2XQKA 4IIGA 2FMSA 2BWJA 3LYLA 4C7ZA 4DA9A 4PM4A 4GBGA 3N7PD 3I58A 4AP5A 2EU8A 5E95A 5BV8A 3JCZA 2X58A 1JLRA 2J41A 5DKFA 2ZIXB 1K0UA 3T7DA 1LK7A 4B9AA 4BXOA 5F51A 4I3HA 2JG3A 4TWJA 3B2QA 5IW8A 3X2FA 3NTLA 4LMBA 4RDHA 1X7ZA 1LCIA 2HX1A 3I9NA 3FAKA 4DCNA 1XU9A 2E4ZA 3V42A 2E48A 1CUVA 4ZHQF 1M10A 3H7IA 1WPXA 3WSTA 2ATLA 4GC7A 2ZJYA 1DRGA 4O4HA 4WKCA 1CZNA 5JVDF 4V39A 2VI5A 2B6NA 1DELA 4JMUA 4ISBA 3WWOA 4WPGA 4Z0PA 1GCGA 2PNJA 1Y48E 1OX4B 2ASEA 3D64A 3IVXA 2JLRA 3GFOA 1X9SA 5I9TA 4RCVA 5JJKA 4AX4A 1PK1A 1UBJS 4KN7A 5FUVA 1NRXA 1IY2A 4WN9A 1QTRA 4URFA 2AXNA 5J2UF 4KVFA 3IODA 1DO8A 2YWDA 1KPGA 3LI2A 2RDMA 3W9YA 421PA 1O0SA 3B1WA 1S8AA 1B00A 5KQMA 4CKEB 1S8NA 1TKRA 2UU9B 1QS0A 4LYHA 1L7RA 4JDUA 3TI9A 1YD7A 2NZWA 3BMCA 2KSOB 3I83A 1M75A 4YJHB 4R9NA 2FRDA 1XRPA 2R44A 1FNDA 5EZ6B 1ZK4A 3A05A 3NZEA 2PV7A 121PA 4FOOA 3VPGA 4DIBA 3JQEA 4N0PA 1DQSA 3D6FA 4AS3A 4TV8B 4WKGA 1T8UA 4UZEA 5C1PA 1U31A 2R1VB 3CCBA 4RKWA 3ICXA 4Z9XA 1J0DA 1ENPA 2DF4B 4IG9A 1UP7A 5JJIA 1Q3VA 2ZXEA 5HHIA 2HWKA 5ICSA 4MWTA 2BI8A 2QUIA 3KWMA 3W6PA 3UKDA 4ZYZA 3T5MA 9ICEA 3BTVA 3VYVA 3NH6A 4B17A 3E05A 2CHEA 3JWIA 3VPBA 3N97B 1J0XO 5JXGA 4MR9B 5A4MS 1J21A 1GU1A 8MHTA 1DXYA 1LBEA 3A1VA 1Q7EA 1KO5A 2F3NA 3U40A 2W6OA 3C0KA 4F5DA 5CDFE 4TKVB 2QP9X 1XD2A 2PSDA 1RMQA 2O5RA 3GDFA 5FTKA 3UANA 5MN5A 1DKRA 3TG2A 2B6GA 4P0PB 1VB5A 5J0QA 3LSTA 5MHTA 2H5EA 5JMPA 4QUBA 1E1QA 4Q03A 3LL4A 3IDZA 1CUCA 1OD6A 3ZZNA 2WJJA 3W2IA 3K92A 1OLOA 4IEEA 3K2IA 4RF3A 3RANA 2M6RA 4EG0A 4F86A 3GF4A 5CVEA 5DGXA 5JCJA 3IIJA 3H3JA 1ZQPA 4O29A 3FUCA 1K98A 3JQAD 2ZI9A 1ZH2A 1VFPA 2JHFA 5A1TA 3L4PA 1BAPA 4PF1A 2D5BA 2MR5A 4EENA 3AEYA 3GMSA 1E2KA 1XTUA 3ROKA 3RB4A 2VDQB 4D74A 1H65A 3FOEC 3U3MA 2XICA 2Q28A 4G63A 5BP7A 3TZCA 2JFXA 2QVZX 3G82C 4HCJA 3URMA 1NYLA 2I3BA 3DAHA 5AI9A 5HIKA 1ZGJA 1A77A 3E6AA 3QA3E 1PX0A 2HSJA 1N6PA 1TT5B 1N2HA 1ZCBA 2H92A 3A1FA 4MKIA 3PSPA 3OHMA 2YJTD 1CG6A 3GV7B 1ECLA 2O2GA 5DO9A 2PU7A 3EIQA 2IEBA 4IR1A 3TNFA 4KLMA 2PSHA 2WTMA 4QUGA 3TO5A 4K2AA 4EDHA 4C20A 5KG2A 4FBTA 3E2IA 1NZFA 4NCBA 1FYVA 2R87A 2GFIA 2WJHA 1VDMA 3QWIA 1XRSB 3U16A 2FJ6A 4H7PA 4G4IA 4D4HA 2FTKE 4DL5A 1EZ1A 5J0XA 4A6EA 4YNBA 4QAQA 3NPAA 3BKXA 2J87A 4JWMA 1IM8A 1UQVA 1NAHA 2W6QA 2ZVJA 2QW1A 5H4HA 3ISJA 3BMQB 1A7UA 3G6YA 4WZAE 5C4IA 4I29A 4ZPJA 3A2MA 4D5EA 2H0AA 1T2VA 4QXPA 4ZZ1A 4NP6A 3C8UA 4B71A 1IN4A 2GAAA 2G82A 5FADA 4UE2A 2FJ0A 5CH8A 1RFGE 4AZ0B 1A5BB 4A1FA 5HR6A 5B7QA 4TUYB 1APBA 3LBFA 2JRCA 2DR0A 2H0QA 2AFIA 5I7FA 4HDRB 1NVFA 3MJTA 5BQFA 2XNDA 5EWMA 3C74A 3PVXA 3AHJA 3KB1A 4NJOA 2QL6A 1Z8DA 4MHSA 3I5UA 1LQTA 5EJIA 2WR8A 3MFQA 4KV9A 2Z5FA 4NBLA 1E2UA 3N6VA 2Y71A 3ZH2A 1SO8A 4LJ8A 3T5BA 4EHIA 1QLHA 4QYIB 1BQ3A 4N0EA 2OCKA 2JLWA 2GZAA 4J0FA 2DLDA 2PUTA 3HEBA 2ZRKA 3T3IA 4PGXA 3ZKWA 4B3SB 4GR5A 2POCA 4U9IS 1XQYA 2NP6A 2DUNA 3BAZA 4JIMA 2KYRA 1ZUD1 2RI1A 2R5NA 4H16A 5ARDA 5CCEA 4QIHA 1GTVA 5LLSA 1Q7TA 4XCVA 4J94A 2QN8A 1R0CA 1X6IA 3K5HA 3LKVA 1EKXA 1HFKA 4KLSA 3EF3A 2G5CA 5JLAA 4JR2A 1V2GA 3IILA 4UB5A 4D8UA 3AY3A 5L7TA 4WJ3B 1VI6A 2GXUA 3HBLA 3BQMB 3V7LA 3AM1A 1FPMA 3HBFA 4RXUA 2NV3A 1BOFA 5JS8A 6GPBA 3E2EA 2ZRBA 1OR8A 2R8EA 2D2FA 2ECOA 4IYJA 1ESCA 8ATCA 5BSFA 8ICFA 3GYBA 2FZKA 1EEXB 3HHEA 3KV1A 3VYTB 2ZSBA 1GL6A 1JU4A 3IAS6 2CUNA 4BO8A 1OGYA 2ES6A 1H05A 2HYDA 2IEAA 4UTPA 3O0FA 5F21A 5DCLA 2NRXA 5LCXA 4AQYB 3BTSA 1GAXA 3KQWA 1ADBA 1XDSA 1EUYA 4XFDA 4LF7B 4RBNA 1XNHA 5EP2A 3J81A 2ZBPA 1E1RD 1VP3A 1KK3A 4IV0A 1RPTA 4WOKA 1Q3UA 5IUNC 1VTKA 3WLTA 3TK1A 2WTAA 2RGAA 2X6QA 1N5JA 1VLZA 3A1CA 3FUVA 1QZZA 4MJXA 4CV3A 1J4AA 1XJQA 1CUAA 1BWPA 4ZT7A 5KFDA 4UFNA 9ATCA 3I04A 1VMAA 2JI4A 1ST3A 3NHPA 4MIEA 1Q16A 1E2NA 4TN5A 4HUJA 4KVGA 5IK2D 1GRNA 3FOCA 1A2KC 3LYHA 3LBIA 4YAUA 1J06A 3S8MA 2ICAA 2XOKA 4P35A 4FHGA 4JODA 2IPAB 2NVUA 5CPFA 5I8WA 2XT6A 3JQ7A 5L3SB 4E1BA 1BE1A 3G7NA 3NFRA 4DBVO 3VPDA 4Q7MB 1TUIA 1JMYA 2MSLA 3W04A 2WIKA 5JYDA 3W2FA 3Q40A 3OICA 5KNCA 3EZ7A 1JIIA 4KAJA 3A70A 4YY3B 1RCUA 4F9TA 2BKXA 3E1SA 3O8QA 4MROA 3QZUA 1I4LD 1SVSA 1CY6A 3IUNA 4N3BA 2VHUA 2ONCA 2NACA 3Q7IA 4GI3A 4ASUA 3JQPA 1MG0A 3COSA 3N2ZB 1T8RA 3N0RA 3B2NA 5AD1A 1YQUA 3LQFA 3UJ6A 4O2AF 2FG6C 4FW8A 2X5KO 4IHJA 1SUIA 1U5AA 2NADA 2IV7A 3DOEA 2QRQA 3RRXA 1E9VA 2QB1A 1GPYA 4IDNA 4GKKB 4PRYA 3BSYA 2I3GA 3PNLA 4BNXA 2NO7A 1TGVA 2WWYA 4LISA 2FPUA 3UT5B 1WUYA 3H0EA 4E0BA 2RSLA 1ISSA 4PZDA 5K05A 1YMQA 1NN0A 4IQUA 3SR4A 3KVRA 2ZJ0A 4Q39A 4YAFA 1A7AA 2I6GA 1ZUNA 5HUQA 1A95A 3SVLA 4PO1A 4IGIA 4JXJA 5DBCA 1ZQCA 4ZYLA 4YFYA 1XZHA 4ZV7A 2ZETA 5AKKA 5CJJA 2I2DA 1GPBA 3AKCA 1H6CA 2NSLA 4KYTA 2B20A 2CNWD 4XASA 4BJ5A 2FR1A 2NZXA 3IAM1 3GLQA 1JG7A 5DXAA 2Z3ZA 1T9AA 1E5VA 1CNFA 3AEUB 1W49A 2QLMA 1OFVA 3OOSA 2AJLI 1IQUA 4DLRA 4KSYA 3AVTA 4BV2A 4KQHA 1TAQA 5DNAA 3G0DA 2X6TA 4L50A 1MRNA 1NFQA 1KH2A 2ZE6A 1QCYA 1E2PA 2VHEA 3NHLA 4DA0A 2ERXA 3MVEA 1UK7A 2F1OA 2I1VB 2I03A 4MCAA 1L3BA 1V43A 1SIUA 2VP4A 1COOA 1FDVA 1UOPA 1BW9B 5LC1A 1KDZA 2ZJ8A 4YMIA 2AQ8A 1UOOA 1ML4A 3PTZA 4D80A 1MEOA 2P1DA 1SUDA 2E8NA 1T8TA 3V8BA 4H4CA 2P7IA 1DGSA 2IHTA 1YVRA 3Q5EA 2Q3LA 3BT7A 1ZEJA 4IDGA 3FRHA 1EBFA 1W75A 3JYQA 1F9EA 1W4AA 2K87A 4RVHA 3ZCXA 4J3JA 2IPNA 2E87A 3R76A 3C6QA 6ADHA 1V8FA 3UOWA 4Q7LA 3AUUA 2YWGA 1L3SA 2YFKA 3VX4A 2YCBA 2MSKA 3QBEA 4ND2A 1CJTC 4JI4B 4GYJA 2CXPA 4RM2A 3HB7A 3OLQA 2RH5A 1UUFA 5GONF 3U7JA 1EFDN 4X8OA 4XJSA 3GIIA 4NFSA 3WWYA 3PNQA 8GPBA 2AW3A 2VWGA 3KKNA 3NC0C 4J6EA 1C9YA 4EZ9A 1PR0A 3SCZA 3OQNA 2PSSA 2QN9A 2NO0A 5FBQB 4OBBA 4FDMA 4HXYA 3KU1A 4J9SA 2H4HA 4L2IA 4EK9A 3WK9A 1E9DA 2AJ8A 4F6LA 3CC8A 5J29A 2X0EA 3FDZB 5FAKA 3RWOA 1SUCA 3WLEA 4F0JA 3OTIA 4L8GA 1DWPA 2ONKA 3STUA 3VSEA 2ZR0A 2HA2A 1H3EA 4AYXA 1EE1A 1G17A 1NTRA 2C2YA 3I0ZA 1C9NA 5JAZA 4DB2A 4EFLA 2YIJA 5A6SA 1CEYA 2FZEA 4D9FA 5ALFA 2X23A 1WHTB 5LQSA 3U7HB 4IMPA 1T36A 3DEJA 1P19A 5KMGB 1SRRA 1PVOA 2NXWA 4F92B 3V8RA 1PHRA 3TRHA 3CP8A 3N59A 3UB3A 4NLKA 3JASA 2PXHA 2IH2A 4K40A 2VBIA 2R79A 5ARBA 1MXHA 4EJ6A 3OPQA 1ZN2A 4ZVPA 4KO1S 4FHZA 1OUQA 3KVVA 4IQGA 4U7JA 3ENZA 2YNMD 3DNPA 4PLHA 1EG7A 3UXOA 4PG7A 1QWSA 5BSRA 3ZKAA 1LH0A 4CMGA 3QGMA 2D3DA 1WU8A 4PYOA 3LYAA 3J80A 4QXAA 1BPBA 5FBVB 4LWOA 1U11A 4MYUA 4M7PA 3PI6A 2CWDA 1IJFA 2BEJA 4NI5A 5HF6A 1X70A 1SBHA 3CM0A 1XZDA 1FVHA 2ZE7A 2RAUA 2DBYA 4MQEA 2EKQA 2DPXA 4LWZA 3SOPA 2QTFA 1U0SY 3OHBA 2LXNA 3VU0A 3O95A 3FPLA 1RHMA 1XRJA 4CIWA 4V3BA 5KJCA 3WHKA 1A9XB 1FJXA 1YI0A 3ROFA 4CN9A 1XZGA 3ASUA 2AUMA 4F50A 2QRPA 2PG3A 1I7LA 4RLFA 2ZDGA 1L4KA 1CIVA 1U9CA 2W04A 3SQWA 1LWOA 4FP9A 4R1UA 9ICOA 4AECA 5LQCA 2JAPA 4GYKA 2PUBA 4F45A 1E8NA 4TKLA 1OT5A 4ND3A 4DRYA 4D9JA 4MUYA 2ZJ4A 4F2WA 2XCTB 3OCVA 3FROA 2F44A 3FPEA 2B4TO 2CFIA 2FSHA 3AY0A 1KMMA 1JEOA 3DW1X 3ZY4A 2I3ZA 2OAQ1 3N86A 1NK7A 5CTJA 3JQAB 4P7KA 3ER6A 1JEQB 3I28A 4KXFB 4AJLA 2Q5LA 4GX0A 4D42A 1E66A 3FCOA 3VNUA 5BPHA 1IQPA 1K7XB 1L0BA 4LJ9A 1IVYA 2IYLD 1IB6A 3IN5A 3W77A 4MRNA 3QSGA 4LXGA 4LF4B 3WMFA 2EEZA 1DC5A 2QTRA 4GAEA 1Z75A 3PRYA 5KWSA 4ZI7A 5E79U 4LXQA 4TL7A 4LBVA 1M2VB 1TAMA 1WKCA 5AXDA 3IGFA 1TW3A 2OD2A 4BB0A 2OYRA 5K6RA 2W9XA 1U5CA 3CYMA 3DTTA 4QNNA 2NMVA 3KSBC 2W9BB 4H3HB 1PVVA 5HF5A 4FHDA 1U3UA 2ZUWA 3ZXSA 4XYEA 3S3TA 4EVRA 4EFDA 4CF4A 4AMUA 9ICSA 2AXPA 4GX1A 4MUAA 4XWYA 5L1JA 5FX2A 2P9FA 4B6PA 1GGMA 1C9JA 5KYNA 1OWOA 4X00A 5CYPA 1NY5A 1P5JA 1E69A 1L5GB 1IK6A 4I08A 3GLIB 2GVNA