5ALJA

Ligand complex structure of soluble epoxide hydrolase
Total Genus 182
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
182
sequence length
546
structure length
523
Chain Sequence
TLRAAVFDLDGVLALPAVFGVLGRTEEALALPRGLLNDAFQKGGPEGATTRLMKGEITLSQWIPLMEENCRFSIKEIFDKAISARKINRPMLQAALMLRKKGFTTAILTNTWLDDRAERDGLAQLMCELKMHFDFLIESCQVGMVKPEPQIYKFLLDTLKASPSEVVFLDDIGANLKPARDLGMVTILVQDTDTALKELEKVTGIQLLNTPAPLPTSCNPSDMSHGYVTVKPRVRLHFVELGSGPAVCLCHGFPESWYSWRYQIPALAQAGYRVLAMDMKGYGESSAPPEIEEYCMEVLCKEMVTFLDKLGLSQAVFIGHDWGGMLVWYMALFYPERVRAVASLNTPFIPANPNMSPLEVFDYQLYFQEPGVAEAELEQNLSRTFKSLFRASDESVLVCEAGGLFVNSPEEPSLSRMVTEEEIQFYVQQFKKSGFRGPLNWYRNMERNWKWACKSLGRKILIPALMVTAEKDFVLVPQMSQHMEDWIPHLKRGHIEDCGHWTQMDKPTEVNQILIKWLDSDAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Successful Generation of Structural Information for Fragment-Based Drug Discovery.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords BIFUNCTIONAL EPOXIDE HYDROLASE 2
total genus 182
structure length 523
sequence length 546
ec nomenclature ec 3.1.3.76: Lipid-phosphate phosphatase.
pdb deposition date 2015-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 5aljA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 5aljA01
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5aljA03
1R50A 1MH9A 5ALEA 2GHQA 3FVVA 2YH2A 3V48A 2IYEA 4HRXA 2Z8ZA 2OGZA 5JANA 2FPXA 5A2GA 2P9JA 3G7NA 5HKAA 4BC1A 1XZLA 2WIJA 4H35A 3FPBA 3DYVA 3HC7A 4HXFB 1DQZA 4E15A 3LLCA 2YN4A 4TGLA 3QM1A 3FNBA 4FBLA 4K6GA 3SC2A 5FV4A 5AM3A 2PQ0A 2OBBA 5BWCA 1SC9A 3DKKA 3DL7A 3B8EA 3OPXA 4OPMA 4G9GA 2XUFA 4C4ZA 2RAVA 2WIFA 4ZEXA 2WUDA 2FUEA 2W11A 4YIKA 1RPZA 2XUPA 3GZJA 1XFDA 1C7IA 5AM5A 2DCMA 2IOHA 2YMPA 4UMVA 1Y8AA 1YMQA 4BX3A 4FBMA 4BVJA 1A88A 3HEAA 1VXRA 3E84A 3C8HA 1WHTA 2HA0A 4DNFA 4B81A 5HK8A 3BDVA 1ZGBA 4CFSA 3I2FA 1GQRA 4H7DA 1XZKA 1W76A 2Q4TA 2BJHA 3ESBA 3BDIA 1CFJA 1UKCA 2JGMA 3BIWA 4BNDA 2HRQA 4YIHA 2W6CX 4HVTA 1F0PA 4NZZA 2VJCA 3FBWA 3WA7A 5AW2A 4WFIA 4DWOA 4QNNA 3OCZA 2WM2A 4YPVA 2R11A 2XMBA 2B8JA 1UXOA 1EVQA 1RKQA 1EI9A 2B61A 2XQJA 2QJWA 3QNMA 3U19A 1TJ4A 1BS9A 1RMYA 4C4YA 2JF0A 5DTIA 5DLPA 5FP0A 1E8NA 5CH5A 3MUNA 3OCYA 3QU5A 1QIIA 4OU5A 1UKBA 5JADA 4FLEA 2RARA 1YAJA 4M0EA 3FSGD 2HIHA 3WL6A 2QXTA 3QYJA 1O6GA 4H7HA 1K5PA 5D3ZA 1ZOLA 3ZWKA 5AW7A 1MNQA 4PW0A 2ZBDA 3GA7A 2QT9A 3STYA 4N8EA 4OB7A 2HA6A 5ALHA 5C8XA 1ODCA 3STUA 2YMLA 1XZGA 2OYCA 1XPJA 2G07A 5EGNA 1A8UA 1CUYA 2HL6A 1XQXA 3F9CA 2GO7A 4QLOA 4QDTA 2PX6A 2PU7A 3G9TA 2PSHA 3K6KA 4UATA 1Z4IA 3MN1A 1EXWA 5A7HA 2CUTA 2CMFA 1C7JA 1CQWA 1PJAA 1P0PA 3E81A 5SYMA 5D7BA 4EHBA 2JAWA 2XMCA 3IDAA 3UMGA 4FNMA 1P0QA 3W5CA 4YK7A 4UFPA 2J3DA 3PGLA 2BAGA 4XE5A 3TEJA 2QR5A 5AKXA 3M81A 2WILA 4E11A 1LBTA 1EHYA 4OCZA 4U2BA 2P69A 1DU4A 1JT2A 3WWPA 1TCAA 3MC1A 3BA6A 2GZSA 1X70A 5H3HA 1WB5A 1QO7A 4QJBA 3WZMA 4HGQA 4XWGA 5HFAA 1Q83A 4EA6A 4AO8A 2E3JA 4B6JA 5AW4A 2P11A 2VJBA 2I54A 4A16A 4X95A 1JMKC 4L57A 1RKUA 4BRSA 3I2HA 5CT8A 3SK0A 3WWEA 4KN8A 5IVHA 4TPKA 5AH0A 5CH8A 4A23A 1K6EA 2WFAA 5BV7A 1YA4A 5JATA 1XRMA 3ZLTA 3UMBA 3NASA 2FPSA 4UMDA 5T4EA 1R9MA 4C88A 2GYUA 1RP1A 1FFAA 5E4JA 5AI9A 2BGRA 3PDCA 3WK8A 5AVTA 5DTJA 4QQFA 7YASA 2IOFK 3ZTWA 4N5HX 1SWVA 1RLOA 2OM6A 3ESAA 3QUQA 4G4IA 3ZLUA 2ZXEA 1MTZA 2B20A 5EFZA 2WIDA 2ZYRA 2CN1A 5EIAA 3RLIA 5AICA 5IVIA 1BEEA 4E14A 1CUXA 1J8DA 2VAXA 4ZV7A 2I34A 3HSSA 4BC0A 3RF6A 4EZIA 1B41A 1J2EA 5HFNA 5AI4A 3ZUPA 4CCWA 2QLTA 2G06A 4FFDA 1G66A 3WI7A 3AR9A 1RDFA 4X7BA 1ZJ4A 3N28A 4I19A 4UHDA 2QZPA 1ZD3A 4M0FA 3PUIA 2J4FA 2VF2A 2WM8A 4OHFA 2PBLA 3HLKA 2RHWA 3KWFA 4Q3KA 2G80A 2B30A 5AK6A 2CKMA 3WL8A 5AK3A 3CCCA 4BAUA 3SMVA 1TK3A 2AXEA 3H17A 1ODSA 1NU6A 4CIAA 3PUHA 4L72A 3JYHA 4J0KA 1CR6A 2C5GA 3H18A 2YBDA 1QQ7A 3V1NA 4J0CA 3UM9A 2V97A 3UUEA 2G0AA 4GEGA 4LIPD 4LYEA 3DDUA 3G0IA 2NO5A 3C8DA 5AK4A 2XQIA 1XRRA 4BTLA 1PFQA 4KE9A 3OCWA 1LPSA 4BBJA 3AJAA 4X90A 5HCUA 2P27A 5ESRA 2OCIA 2VJAA 2Z5GA 1EX9A 4FMPA 4NMWA 3LIPA 3EBLA 5AI0A 1HLGA 2VA9A 4W1SA 3L7YA 1KU0A 4B83A 1CUHA 2ZOSA 3K9BA 2NO4A 2V9ZA 2ODAA 2H7CA 5LLSA 4Y2PA 4G63A 3GYGA 4XVCA 1ZD5A 1XZDA 4BZWA 5AVZA 2WQZA 2W43A 1XZBA 2WG1A 4Y2SA 3NANA 1UK6A 4XPZA 4C6HA 3B9BA 3BXPA 4B80A 1EB8A 4DCCA 3C6ZA 2WUFA 2WLSA 5AKKA 5DYTA 2WHQA 1Y7IA 4UHHA 5AVYA 3B9RA 2RHTA 2D0DA 2BDUA 5SYNA 1QIMA 4IH4A 4GIBA 3K2IA 4DGQA 1Q0ZA 3ESDA 2PL5A 4BYGA 1F5SA 5LZ8A 2Q0XA 4BP8A 5EHQA 3QPDA 2YFYA 3QU7A 3WKAA 5JASA 2BFNA 4KAJA 3VJLA 1QONA 3D4LA 1PW5A 3WL5A 1QLWA 3F67A 1Z4MA 2HA7A 3ZPXA 4PNZA 4FWBA 3FYUB 4G9EA 4WJLA 2WFZA 3JW8A 3ZVNA 1A8SA 2HHAA 1GPNA 4W63A 5A6VA 3R3VA 4UW9A 3RARA 3FM9A 1CEXA 3BJMA 1XP5A 4BAZA 1BN7A 3U7EB 1CRLA 1U02A 5A7FA 4N5IX 2CFSA 5C7YA 5ALZA 2XMDA 1UT6A 2HU8A 2WG2A 1VFPA 2HM7A 5AK5A 1Z88A 5AKEA 4J3JA 1EDEA 2GMWA 1QIHA 1PV1A 2DQZA 5JIBA 2RBKA 2QXUA 2GBFA 2JGKA 2ECFA 2XMQA 4B82A 2RB5A 3U1TA 5AVUA 4BCBA 5ALRA 3AIOA 5JARA 1W4LA 3FVRA 1T5TA 4OU4A 1QTRA 5AKZA 4Q05A 3H04A 3QMMA 3WKEA 4E88A 2VJDA 5CT4A 3IJ5A 2WKWA 1U8EA 5AW6A 4YCMA 4H1WA 2JGEA 4LXGA 3DNMA 3VVLA 1UZAA 2J3QA 2WG0A 4XX1A 3NGMA 4PF1A 3RKSA 1XZAA 1QIGA 4HGPA 4QWWA 4ZRDA 4DFDA 4KE6A 1RYYA 1B6GA 3L0YA 5ALOA 4INZA 3I6MA 3R09A 2FI1A 3VVMA 2RI6A 4HRYA 5ISMA 2FX5A 4Y2TA 4UHBA 1RWQA 3DQZA 5ALYA 1P0IA 3ICWA 2ZG6A 1RQLA 1XQVA 2EATA 1ZICA 2EDCA 4L0CA 3VJMA 1A7UA 2O2IA 1IVYA 3WKCA 3KSRA 1YASA 1HDEA 4U2EA 4Y9SA 3T4UA 3FPSA 3PICA 5FKJA 3W9UA 1QQ6A 5FDFA 5LIPA 1LPMA 3O4IA 5AHXA 1AKNA 2YJ3A 3A2NA 2WFMA 3QX7A 3HABA 5CW2A 5JD4A 3U13A 3F97A 1EVEA 4AN1A 4ZGBA 5ALQA 1XQYA 3HRHA 1RLTA 3EF0A 2QS9A 3R40A 3SD7A 4PV7A 3NIWA 2FJ0A 3U0VA 1XLVA 4KE7A 1U65A 1TRHA 4AO6A 3QVMA 4F5ZA 4MEAA 4P9NA 3H2KA 3HACA 5AM0A 4X94A 4F21A 2XUKA 4UMFA 1IUOA 5AW3A 5K3BA 4NV0A 3R3ZA 2WHEA 5ALJA 1SCIA 1CPYA 1QIKA 3PF9A 2QJRA 3OOSA 3MPOA 1SCKA 4XIIA 1XKLA 1U2EA 1WB4A 3G9UA 4RETA 2DQYA 3VXKA 1LPNA 1QGED 3A6ZA 4AB1A 1ZRNA 5JYCA 4RESA 3I2IA 2PSDA 3VISA 4C87A 3H1BA 1UK9A 3IULA 2C7BA 2YYSA 1DWOA 1CUFA 4BAGA 5AOCA 2X8BA 1JJFA 4LXHA 1LPAB 1IZ7A 4KJXA 2C0QA 2R8XA 2WU4A 3R41A 1X2EA 3CNHA 3I1IA 4YCNA 4TVKA 4JYMA 1J97A 1RKVA 5AP9A 2HA3A 1Q91A 4J03A 1Z4KA 1E8MA 3SKYA 1JU3A 1WPRA 5ALVA 4AQDA 1ACLA 1CUGA 2G5TA 4CG1A 5JAHA 3S6JA 3ED5A 4L3WA 3DD5A 1GKKA 3PGVA 3DLTA 3S2ZA 5JZ9A 1ZIXA 1ODTC 1E8DA 5EHXA 1Z5UA 5FXMA 1BROA 3STWA 1LVHA 3F8SA 4L9AA 4GW3A 4N8DA 5AKLA 1JJIA 2CB9A 3ANTA 4XOUA 3WGVA 3D2BA 3AIMA 1XZEA 1H23A 4H77A 3FLBA 3AZOA 4MQLA 1U2SA 3W06A 2G5PA 3QU2A 4UASA 2O9JA 1JJBA 2R8YA 1QH9A 5CH3A 3WWCA 1RMQA 1L7MA 5FPPA 3G0GA 4J0IA 1YV9A 1UK8A 1FFBA 4ZEWA 4EY7A 1LNSA 1AQ6A 4J2TA 5ALKA 2AJ8A 1L7RA 3QBJA 2VSQA 4O8CA 4W1QA 3H0CA 2HA5A 2QRUA 4G8BA 4J0HA 4ARAA 4EEKA 2WTMA 1WPXA 5DNWA 5AW8A 2HI0A 2YJ4A 3NWOA 3UUFA 4UAVA 2UZ0A 2AGVA 4UHEA 4G5XA 1BRTA 4Y2JA 1LBSA 2C5FA 5LZ2A 1J1IA 2JGIA 1RQNA 3IA2A 5LYYA 3FSGA 1E5TA 1R9NA 4J0DA 3WJ1A 3MVEA 3STVA 3WWDA 2I55A 5K3DA 3H2GA 4HZGA 4N8SA 4OUKX 2JGFA 5K3AA 5ALWA 5AW9A 3AR4A 2VKQA 4H7JA 2FEAA 2QOEA 1Q84A 3WKDA 4YASA 2XUOA 1JI3A 1MN6A 4EENA 4WY5A 2FPRA 1MJ5A 3UMJA 1Y37A 2QUAA 5AI5A 4Y2RA 4BRZA 4BVKA 2H9YA 4AO7A 2I33A 4BEWA 4I4CA 2HFKA 4OYLA 3G9XA 1Q0RA 3I2JA 4C89A 4RGYA 3ICVA 1AQLA 5CT9A 3FYUC 2O7RA 3O9VA 4HGOA 3G0DA 1ZS9A 4HTAA 3PFBA 3KD3A 1Q92A 3L8GA 4W9RA 2FUKA 1QIDA 1YB7A 1KEZA 4K6HA 1N1MA 2X76A 3LS2A 5CXXA 5HF8A 1DINA 1WCYA 3CZ4A 4UHCA 4DMCA 5AW5A 4ETWA 3PDWA 3R3WA 3WZLA 2XQKA 1AC5A 1F6WA 5AOAA 4CE6A 3ZVMA 3R9KA 4WDRA 4BCDA 3IVMA 3FCYA 5IKXA 2AUTA 2R8BA 2RAUA 3O4JA 1QE3A 1F0NA 3RK4A 2JIDA 2BUAA 4HXGA 1WB6A 1ZD4A 1DTEA 4IG4A 2G63A 3D2AA 3D7RA 4B7ZA 2OA0A 3FCXA 3SWWA 4BX0A 3AR3A 3N2ZB 5I7UA 1BN6A 3H1AA 1YAHA 1CUDA 2B4KA 2ACKA 4XJVA 2ZYHA 3FYTA 2EEPA 3D5EA 1FSSA 5IVKA 4ROTA 4CG3A 3C70A 3QU4A 4EELA 4PNHA 2I03A 5AO9A 4X71A 4PQEA 3MGAA 3ZU6A 4MJ3A 1R4ZA 2VQ6A 4IHAA 3A3YA 4OFZA 3M9LA 1TE2A 3D0KA 2CFRA 3MUOA 1KU6A 3NRJA 2EDAA 4X6XA 4B0OA 3M82A 2WU3A 5IS2A 1MT3A 4ITVA 2BGNA 3L1IA 3E0XA 2OQIA 5D6OA 1EA5A 2HA2A 1CV2A 1L7OA 3R3UA 1DQYA 4G4GA 4G8CA 4JB3A 4PO3X 2IITA 1MPXA 3HZOA 3STXA 3ET5A 4FOLA 5CMLA 3FAKA 4UBJA 3IUNA 2OXEA 1IUPA 6YASA 2B0CA 1RMTA 3DYIA 2AMYA 1X2BA 3A2LA 1VA4A 1GQSA 2XUHA 4KRYA 1VE7A 1Z4NA 1U7PA 2WJ6A 4IH1A 3G8YA 1FFCA 5AIAA 2DFPA 5CTAA 3ZLVA 1ACJA 1QIJA 5AI6A 1EDDA 4GECA 3QU9A 1EINA 4ZEVA 4M0MA 3MMZA 4MQMA 3Q8WA 2O2HA 5E4TA 4KRXA 4Y2VA 4C01A 3HYSA 2I3ZA 4B84A 3FOBA 3DKRA 3A70A 3N1UA 5AI8A 4FNGA 2MSNA 1IWOA 4EUSA 4FTWA 2HOQA 2VEOA 2O2XA 3RM3A 5IT4A 5C81A 4ZI5A 4MYSA 4UARA 1BU8A 1H2WA 2CBGA 1ZI6A 2PKEA 3NAMA 5D3KA 4BP9A 4Y7DA 4UAUA 3NALA 1HBJA 3G0CA 2I78A 2O7VA 4WFJA 1N8SA 3I6BA 5K3FA 5ALXA 2XUJA 3KXPA 5T41A 1UOOA 3C6BA 3DDHA 2OAGA 5HF6A 1W75A 2V96A 1TKRA 2JBWA 4OYYA 2AH5A 1RC8A 2PM8A 3FZQA 3QUBA 4HGRA 1T2NA 3OCVA 3WK4A 4MWOA 3IUQA 4FYPA 1YDFA 1J06A 2WF6A 1FFDA 3AUKA 2XQGA 3D59A 4OB6A 4ZREA 5LZ9A 5LKRA 1DX6A 4EY4A 1ZD2P 1X42A 4B9EA 1H2YA 5C8VA 1WPGA 4CIBA 1WHSA 1AZWA 5JJBA 3ZWDA 4U2GA 5E4YA 3OCUA 3WK7A 2BDEA 4UBOA 3DJYA 3B12A 4QDXA 4H7KA 2Y6VA 4Q3OA 1QJ4A 1E3QA 1ZI9A 2HO4A 1CUJA 4Q82A 5AJHA 2GBCA 3WJ2A 3AR6A 4Q34A 1FEZA 3KC2A 3A1DA 4QDOA 5CXUA 2Y2VA 3W04A 4BKMA 4KR0A 4X3CA 2JARA 4FE3A 3EQ8A 3G0BA 4EB0A 2QTBA 5K3EA 1W52X 3N5KA 1HL7A 4BDSA 1CUIA 2OG1A 4KEAA 2PU5A 3SLRA 3IUMA 1MAHA 5AM4A 4GWLA 1UOPA 1W6RA 3AZPA 2XQFA 4MUMA 3SX4A 1GKLA 5AKGA 2Q5EA 4H0CA 2QYHA 1YA8A 4S0XA 3QUCA 5AIBA 5A3RA 2WUGA 2XUGA 2AJCA 4UBKA 1NF2A 3K1ZA 3L1UA 5AM2A 2B1RA 3W05A 2OLEA 1ORVA 2G1AA 2WF7A 2J4CA 3DV9A 3M3DA 1ZIYA 2PSJA 5DJ5A 2ZBGA 4AS3A 1OCEA 5J3JA 4I9FA 1QFMA 1L8OA 4CI9A 2ZYSA 1VZ3A 5HKBA 3ED1A 1EK1A 3VAYA 5AM1A 1ZJ5A 5CBKA 2VTVA 2ZBEA 4YCLA 1QOZA 2WHPA 2OQVA 3C5VA 3CN9A 4PSUA 3BF8A 1QFSA 1AX9A 3QLEA 1DWPA 3OURA 5KREA 1G42A 1WOMA 2HDOA 4L6AA 5EHNA 3V1MA 1SFRA 3W5AA 1N8NA 3CN7A 2JEYA 3ET4A 4WCVA 1GGVA 2QKYA 3P2MA 1ORWA 1SCQA 3G02A 1Z4LA 2DQSA 4ZV9A 1Z4OA 3I6YA 4U2FA 4GI1A 2BUBA 1U2TA 3I76A 3EPRA 2YJ5A 1O08A 1TAHA 3IRUA 2C4HA 3ILSA 5LP1A 1E66A 2WFLB 3UMCA 5JAOA 1K8QA 4DSZA 4QWMA 4DMKA 3BIXA 5AVRA 3R3YA 1UKAA 1MX1A 2HX1A 1QZ3A 5AVWA 4LYDA 4NABA 1AURA 4F72A 4YGYA 5KWJA 3E58A 5HQ3A 1XZJA 3GUUA 5C8ZA 2I7DA 3JWEA 4GBGA 1SU4A 2PPLA 1DT3A 3ZVLA 1Z4JA 4HS9A 4BDTA 4KYVA 2I6XA 1VZ2A 4BBZA 1XQWA 4Y2XA 2G08A 4I9GA 4DMHA 5I9IA 3X3HA 1P0MA 3B5EA 2EAUA 4I3FA 2ONCA 3WYDA 1L6RA 2YMQA 4MYDA 3QITA 5ALSA 4A5SA 3QXGA 3ZV7A 4MWTA 2CEKA 3N0TA 4EY5A 1XRLA 4BATA 5AVXA 5FPQA 1SOMA 1VXOA 2C58A 1F8UA 2RONA 5EHZA 3LCRA 5ALLA 3STTA 2Q4RA 1UOQA 4EX6A 2EARA 5ALDA 4HGNA 4RE5A 1AGYA 4DNQA 2C8LA 3W9BA 3AR7A 2B1QA 2OCLA 2GBIA 5ALUA 4KAAA 5T4BA 3U7GA 2JGJA 4QE3A 2PVSA 4MWSA 4X85A 2YXPX 3EF1A 1ZI8A 1H2ZA 1LPPA 1VJ5A 4WY8A 3ZWQA 1O03A 3ZI7A 2ZBFA 2XMSA 5ALTA 4NWIA 2WJ4A 2HFJA 3WWOA 2WUEA 5JD5A 1CUBA 2QMQA 3L0BA 4CF3A 1JFRA 4FFVA 2ACEA 1N5MA 3P96A 3ZW7A 2WF8A 2W4MA 1HQDA 2CJPA 2C0PA 2PUJA 4NFLA 3TLMA 5JAPA 3D6JA 1KYTA 3N07A 5JZSA 4AMZA 1WVIA 3VDXA 5CRIA 5FRDA 3DS8A 4QLAA 5DYWA 2JEZA 1EB9A 4UMEA 4J7AA 5A71A 2HA4A 3M83A 4KE8A 2HDWA 4F60A 2G4LA 4XQ0A 2AJLI 3R0VA 2JGAA 2BY4A 1CUSA 3CCBA 4IQ4A 3CXUA 4UM7A 2XMZA 1NU8A 4B9AA 3U7HB 3F96A 2PKYX 1R3DA 1K1EA 1UK7A 5E0OA 3U7FB 4FHZA 3GELA 3PF8A 1XZHA 1L7AA 1NNLA 3IIIA 4DMFA 5AVVA 1VJRA 3L8HA 4BEVA 1YCDA 4V2IA 1Z4PX 5LZ4A 3GROA 2ZSHA 4LXIA 4DM7A 3IB6A 3EF3A 1U4NA 3H19A 3N8GA 2IX9A 3YASA 1H2XA 4CG2A 3L1HA 1SWWA 2XLBA 4C4SA 2Y1KA 5AKIA 4UPDA 2IIVA 1DT5A 4OD0A 4UFNA 2I3DA 2ZJ7A 4UHFA 3WLAA 1RRCA 3L1VA 1WZCA 1CIJA 3LP5A 1UFOA 3WKBA 2YY6A 3AILA 4QA9A 1OILA 4JH0A 4WDQA 2OPHA 5EI5A 4MXDA 1CUEA 4KNWA 1YJ5A 2AJBA 5CT5A 3D2CA 3WYNA 4GDMA 2DHDA 3F9RA 4DLNA 4X97A 1BE0A 3KD2A 3WA6A 3I1YA 3H2JA 4QDZA 1CUCA 1QQ5A 3A2MA 1CUAA 2HADA 1TCCA 3PI6A 2XB6A 1K4YA 5KWIA 3OPMA 2WIKA 3WMRA 2WFLA 4X00A 5CURA 1R1DA 1T4MA 1JMYA 1GPLA 2OGSA 5HF9A 3WGUA 5JALA 3QUTA 1NRWA 2BKLA 1VE6A 1XROA 4OSEA 1FFEA 3QGMA 4DW8A 5AKHA 3AZQA 4Y2QA 2Z8XA 3C45A 5FOQA 5K5EA 3C5WP 5AW1A 2K2QB 1LLFA 2HU5A 3L8FA 2ROQA 4BNDB 4W1RA 5A3QA 1QYIA 2Y2UA 4JUIA 5JD6A 3KWJA 2X4DA 1MX5A 4WFKA 1BCRA 4CNQA 2GYWA 2XUAA 3O9MA 1M33A 4UBNA 4RPCA 3WK9A 2DSNA 1CUVA 4G9BA 4GXTA 3HI4A 5ALIA 2C88A 3L1JA 4ZXFA 3FLEA 4PSCA 5AKYA 4ZWNA 4BYMA 4X6UA 2WHPB 3WQHA 2DHEA 3PFCA 5ALGA 4HYTA 5K3FB 5I8PA 1GXSA 2YASA 4UBIA 3AR5A 2XDWA 2DHCA 3IBTA 1XZCA 1FJ2A 3FGOA 5AOBA 4G8DA 1JKMA 3C6XA 4IH9A 3I2KA 4AZ3A 2ORYA 2HF2A 1CUZA 3AR8A 4CF4A 3GFFA 3QH4A 4AS2A 3FLAA 4PSDA 1EDBA 4DNPA 5ALNA 3C87A 1LTQA 2PSEA 3BWXA 1T9ZA 3I2GA 4O08A 2NYVA 2JAUA 2GFHA 2XUQA 4AX4A 4Y3UA 4RE6A 5DYYA 1S8OA 5DNUA 1RLMA 3W5DA 3TJMA 3T52A 3LIIA 4QEKA 4X91A 2R8EA 3KDAA 1GZ7A 5HQ3B 1YB6A 4UU1A 2QUBA 1UWCA 2AJDA 4KACA 1USWA 3QZUA 3OC0A 1LZKA 3FWHA 3SF0A 3C6YA 1ZRMA 2XLCA 3V9AA 4J0JA 2Y6UA 5BWBA 1XZFA 1H22A 1YR2A 4X93A 3C43A 1YSCA 2XMGA 2C8KA 2ES4A 1THTA 1TCBA 2D5LA 1VLQA 1XLWA 2BUCA 1XRPA 3H2HA 3E1GA 3ZTYA 1TJ3A 4F71A 1TA0A 3QYPA 2WSLA 2DR0A 5FLKA 4BTVA 2GYVA 1QIEA 4H7EA 2YMMA 4JEIA 3H2IA 2FPWA 4JNCA 5ALMA 4AXBA 1S2OA 3ONNA 4BVLA 1WM1A 1HKHA 4K5QA 2B9VA 2VT7A 4KNVA 1QO9A 3BWVA 1XKTA 1YS2X 1L8LA 1NX9A 5ALFA 2ZYIA 4G1FA 1MAAA 2FJPA 2VAVA 2XUDA 3WIBA 2G09A 1ZOIA 1VA5A 1LZLA 5FUMA 1XZIA 5A3SA 3EIOA 1YS1X 1LPBB 5EIHA 3DAOA 4FDMA 4F0JA 3QMWA 3PE6A 1DWQA 1VKHA 4H7FA 4AP9A 1AUOA 5EIEA 4MEBA 4AN0A 4UUQA 1G5FA 2OGTA 1A8QA 4L6CA 5JAUA 3AIKA 4OB8A 1BCSA 4EZEA 4HXEB 1CUWA 4CF5A 2QVBA 1LGYA 3HJUA 3IB3A 4DSAA 2LIPA 4P92A 3QPCA 5AESA 4P93A 3DEAA 4Q3LA 5LZ7A 3I6ZA 3ZX4A 2IA5A 2WJ3A 1W1IA 3QPAA 2Z3WA 2IOFA 2H7YA 4K2AA 4E46A 2HEGA 4U2DA 1IUNA 2GZRA 4NS4A 2PR7A 1ISPA 3DNPA 1Z4QA 3DL4A 5HK9A 3NUZA 1L7PA 4IO0A 3L5KA 1J07A 3Q0TA 1CQZA 1N9KA 4GXNA 3OM8A 4BZZA 4B85A 3KBBA 1C4XA 3OG9A 2D2VA 3L0CA 4BCCA 2WF5A 1XZMA 4NAVA 4DTCA 3O4HA 3QMVA 5F4ZA 3BE8A 4BE9A 4C4XA 3TGLA 2XE4A 4K6KA 5IT0A 1U7OA 1I6WA 3ESRA 5A62A 3TRDA 2C4NA 4CCYA 4IFTA 3S8YA 2CZQA 3ANSA 3VJKA 1E89A 2HRRA 4Z49A 2GBGA 5HZGA 2ZVDA 3WK5A 3VKFA 4C4RA 4H7IA 4YX9A 3ESCA 3NUQA 3HXKA 4X92A 4FFWA 2VT6A 3V1LA 2OCGA 3KDPA 4Y2UA 4BX2A 3RFUA 3AR2A 4W1PA 5E2IA 1ZGCA 2HCFA 1HPLA 2YJ6A 5DNVA 1LPOA 2P8SA 4BB0A 4UU0A 1THGA 3O95A 3PCTA 1WR8A 5AKJA 3V1KA 3WIOA 1MU0A 1AMNA 3BJRA 1JU4A 4UM5A 2B8EA 5LZ5A 4Y2YA 2MU1A 3OTQA 1VOTA 3OCXA 3B3QA 3DOIA 3R4CA 5BOVA 4LKOA 4KX3A 1QTIA 2XT0A 3W2TA 4AZ0A 1ZJJA 2PSFA 3GBSA 4KX5A 2MU2A 4U2CA 3WL7A 4QDUA 2FPUA 4D9JA 4EBBA 5JZBA 2O2GA 4QZVA 4KYTA 4J0GA 4DYHA 1CLEA 5IVDA 4JYPA 1Z68A 1CUUA 3F98A 1G4HA 1D07A 1MNAA 3A1EA 4FLFA 1XLUA 1L7NA 2FUCA 1DX4A 3U26A 2HSZA 2HF7A 2XI4A 2B82A 4YH1A 1GPKA 3E8MA 1TIBA 2R8ZA 4FLMA 4DIUA 2C9MA 1CVLA 3WK6A 5AVSA 4GLBA 4P08A 4ARBA 4X6YA 3EWIA 3L8EA 3KZXA 1Y7HA 3BL8A 5K3CA 5IH7A 4H18A 1TQHA 3FVTA 5T4FA 1L7QA 2QM0A 3DOHA 2PUHA 1T5SA 1R88A 2H1IA 4UBLA 4AMYA 4EY8A 2OAEA 3E4DA 1MO2A 3NOXA 4KAFA 1XVIA 1QIFA 3I28A 1XRNA 3SKXA 1EH5A 2RIPA 2BCEA 1N5RA 3BF7A 1IZ8A 3HLTA 3SHQA 2FDRA 4B0PA 1YS9A 3O0DA 3G9ZA 3J7TA 3EQ7A 2OCKA 2RGUA 1O6FA 5CT6A 3AINA 4Q1VA 2HU7A 4CCYB 4EY6A 4RNCA 2H7XA 3M1YA 2JAOA 2XMRA 3E3AA 1YNSA 2XUIA 3ZX5A 3R3XA 5ALPA 2ZSIA 1TJ5A 2X5XA 1BEZA 4EX7A 4JDPA 2WHRA 1OXMA 4LHEA 2GHTA 5HF5A 2W22A 2WF9A 2NW6A 1XRQA 5T4HA 5LKAA 1JUDA 1Z5GA 4GHWA 5DWDA 2V98A 2ZJFA 4NVRA 1ETHA 3IUJA 3EQ9A 4FKBA 5A7GA 3D3NA 2ZJ6A 3ESQA 3O4GA 3FYUA 4G4JA 2HHLA 4HAIA 4B6GA 5AW0A 1IMJA 4UBMA 3A1CA 2Z3ZA 2VATA 3IURA 1GT6A 1K63A 2WTNA 5KBYA 4C4TA 5YASA 2WIGA 3AFIA 3W5BA 3DCNA 2JGLA 4BE4A 4DNOA 1MX9A 2CFTA 3HYCA 1EK2A 4UFOA 3KOOA 3ZI4A 5AVQA
chains in the Genus database with same CATH superfamily
3WSWA 5BSWA 1VIDA 3Q87B 4ALMA 1GAQA 3OBIA 2P6MA 3WX0A 3HDTA 3V5NA 1ZD9A 1T9BA 3Q6MA 1JR2A 4QW8A 2BKUA 3FVVA 1SC3A 4E03A 3KIPA 3X44A 1AGXA 4HRXA 2Z8ZA 4X8LA 4LF6B 2F1JA 2JH7A 2QL5A 3UANA 4ZICA 3OX3A 1UDAA 3JVUA 5KOYA 1V35A 1XEFA 2Q62A 3FGZA 3PJRA 1M7HA 2C82A 1U63A 5HKAA 4QUBA 5G1NA 4Q47A 3K73O 1RADA 4ZQFA 1T9GS 4QO7A 4RF5A 1YJQA 3MBOA 3FPBA 3EH1A 4DSLA 4IR1A 4YVZA 9ICSA 5HZHA 5KG4A 4P7GA 1P1IA 4KLDA 2ZJ5A 1DQZA 2HSEA 3DEHA 3LXUX 4ENUA 1CHNA 4P7KA 4R31A 2DPGA 4G1MB 5JSFA 5LYJF 3RWBA 1YFJA 1HFJA 4E5SA 2CE7A 2VIIA 3ENWA 4XQ8A 5B5EU 4JWMA 5EFOA 5BWCA 1A5SB 4W8OA 1SC9A 3DL7A 2P5YA 3UGKA 3FTEA 1I2ZA 4FQ5A 5CLJA 3B8EA 4MDYA 1YR6A 4OI4A 5DLQC 1JPUA 4DV7B 2DKOA 3C7KA 3UHFA 4IGAA 2X5JO 5MGNA 1DTWB 1JQ3A 5KYXA 4WZBA 2DLCX 2XUFA 2YIJA 3KB2A 3T1NA 2FGKA 4KR2A 4C4ZA 4D0LB 2HRCA 4I55B 3R7WB 1JTEA 4O4IF 1ENPA 4NMHA 3T5GA 3T5PA 1JP7A 1Z35A 5BYAA 2WUDA 5B7GA 3L4BA 3OE4A 3R6LA 3EVFA 4B9MA 4HG2A 5I9TA 2JIMA 2ZBPA 1QFXA 5DZSA 1MN8A 1SC4A 4OKSA 2JFQA 4PR3A 2UVVA 2C2YA 1O87A 1Y8AA 2N46A 2IEDA 2O0JA 3O8BA 4A9AA 3MQ4A 3HEAA 1D1TA 1UBOS 2EL9A 2GNOA 2F9MA 2IU3A 5SYAA 4YRIA 3E84A 4CM9A 2XUZA 4B3XA 1F2TA 5L9AA 1QUEA 1WHTA 4NXMB 1JHPA 3ECAA 2XBLA 1ZGBA 3BDVA 1Y4ZA 2IODA 4WOKA 5T3UA 1G8YA 4CFSA 2WI8A 1GQRA 3GQBB 4H7DA 4MINA 2C7GA 2FWPA 4C2BA 5I3CA 4AQYB 5HMMA 3AVOA 1MH1A 4CIDA 3EGCA 3U3DA 1VCMA 3IEPA 4YIHA 2GPAA 2W6CX 2FN4A 1K8ZB 3UV7A 2PRIA 4R2IA 3K9HA 1R6VA 2PWPA 1NXVA 4F9EA 2PZLA 2F77X 4WFIA 1ZM9A 1RXEA 2FMXA 4QNNA 3OCZA 2WM2A 1JF8A 1VDMA 1WWKA 3BEOA 5CG2A 3OQMA 1D9XA 1FSGA 3G2LA 4QO8A 2ZCJA 1R5OA 1W5TA 4FILA 4CM9D 4RL4A 1XTRA 4G6ZA 1DV2A 1PJTA 1XD2A 3BDAA 2B61A 3DF7A 3DXZA 5KPDA 2QJWA 3QNMA 3MGVA 9ICCA 2I3AA 2WAQC 3QPUA 5CNMA 3BRCA 5TT1A 3UKDA 3ZWMA 1BS9A 1E9RA 1XFAA 3MILA 1LTKA 1RMYA 2JI9A 2P79A 5DTIA 5DLPA 3OOWA 3OZFA 3PYMA 3HFRA 4I6JA 3WGTA 2PT7A 3ZU3A 1ZVJA 3D6AA 8ICRA 1YC2A 2FY8A 1N5WA 1ZVMA 2H18A 2R1VA 1ZNZA 3A1FA 1Y1LA 3GIJA 3INGA 3V46A 3ZV4A 4U6PA 3KTAB 1YAJA 2A86A 1AF4A 1ZZEA 2FWIA 3JQAD 3W8RA 4F3RA 4FFRA 4M0EA 3PK0A 3OZXA 2IU6A 4WBNB 1QDLB 5K03A 2BZ0A 4Y18A 2EJUA 1H6AA 2IEAA 3P2KA 4RQBA 2BKEA 5AD1A 1RZ3A 2PANA 2H1FA 3JQ9C 3N58A 3QNUA 1ZOLA 2FSVC 3R0JA 1MDFA 1MNQA 1UMDA 3L43A 1MJNA 2DKXA 4FEEA 2EV9A 1T5BA 2QT9A 2YCLA 4FWIB 4WXEA 1HEKA 3QP9A 4P4UA 4LYFA 5ALHA 4KQHA 2ZFUA 4HWKA 4C6TB 5C8XA 4WERA 1NMSA 5HUJA 4FOSA 3RFVA 3STUA 1BC5A 3KYCB 4K6MA 2QBYA 2PJDA 2ABWA 1Z75A 1GZ6A 1MXHA 1PQWA 4USAA 1DIHA 2QM3A 5FA5A 2OYCA 3TDKA 3M70A 1ZK4A 1CIPA 1KKMA 3WAKA 5BYKA 3H42B 3GHYA 2OZEA 2ZANA 3R5XA 1LH0A 2VJLA 3ULKA 4EP1A 4HYKA 1NKEA 4XR4A 1GTVA 1XB2A 1CRWG 3REQA 1CUYA 1OTHA 3UG6A 3W34A 3DMFA 3IR6A 2W2OA 2F67A 5EPOA 5DM1A 2EQYA 3NWEA 2PX4A 5IC5A 2XYRA 2ZIUA 2GO7A 5KFDA 5CX4A 1E77A 3QK7A 1XN4A 1M34E 4QDTA 3C3JA 5H1YA 5DHPA 3RIHA 5JVDB 1PVDA 1GCUA 3RYIB 3VKUA 4ED6A 3ZW8A 2COUA 2ODNA 3E22A 3HHPA 1YA6A 4AD8A 2Z6UA 4UATA 4LOKA 1Z4IA 2CDNA 5DB8A 1W85B 1OT5A 1SBIA 4JT2A 5IZCC 3K3PA 4DV0B 1XPOA 2C2OA 3VU9A 5KOHB 4YP6A 3BZCA 2QJOA 3K6SB 4LBYA 5HZMA 3PPVA 2C83A 1Q50A 4D4JA 1ID8A 1O5IA 3DCYA 3IAM1 4HX9A 1V7CA 4B3FX 3QE2A 1K68A 3TIVA 4YCSA 1H65A 2P62A 3M6LA 3BKXA 1TM5E 5G02A 3VNQA 2D1SA 2L5YA 2I7XA 4XGIA 5IEBA 1WXGA 4EHBA 2ZXIA 4NDAA 3J7AC 1XAHA 4PG7A 3L0IB 2XMCA 1PT9A 3IDAA 5AJWA 3VPFA 2IHMA 1NSTA 5AVKA 4XCQA 1OWNA 1NV8A 4K2HA 4REOA 4WCFC 5K0NA 5JRDS 1HTWA 5LM3A 1NVDA 2PD3A 1D2RA 5IZCA 4HO1X 3JTMA 3TD2A 2GD1O 1OH7A 1HYBA 3VH2A 3BMNB 5BURA 3RVNA 3VHXB 4TKMA 1HRKA 2BHSA 2ZRDA 1I24A 3M81A 1IQRA 3KZIU 1JXMA 4UCFA 4I2VA 3JSXA 4OCZA 2PEZA 5I47A 5JBQA 2ID7A 4DLUA 1DU4A 1JT2A 3CYFA 2EBWA 1TCAA 2C00A 1VP9A 1T35A 4BTEA 4TXJA 1LNZA 1FP4B 3AHGA 3BA6A 3PC3A 1TVKB 1X70A 2YQZA 3K05A 1A98A 3NFRA 4OK5A 5H3HA 5BV1A 1E2UA 5FQNA 4XWOA 4DL2A 2K89A 5A4KA 2QG4A 3GUYA 2J3HA 5DU2A 2FMIA 4WCFA 5FUWA 3WZMA 2F48A 5KFNA 2QD3A 5ECDA 1U7WA 4KQWA 2V03A 3C8UA 3L84A 4IZOA 4RFLA 2P11A 1ZM7A 2EZTA 2I54A 2PXHA 5IJWA 3TPZA 2AG1A 7REQB 1UIMA 4L57A 3RS0A 1RKUA 5EINA 4UBBA 5KWSA 4PTYA 3SK0A 3I2HA 3ADBA 1AG9A 2J7PA 4HWGA 1H38A 3DULA 4NNJA 3TQIA 1R7RA 2WWXA 5B58C 2QRVB 1AZLA 1RQPA 1SBHA 2WDZA 2RHJA 2Q3EA 1A8PA 2XF2A 3PD0A 4JC4A 4PCUA 3WWEA 3JAMA 1QRSA 2M98A 3TIIA 4KN8A 4RVHA 3E1SA 3VDQA 3WTCA 2JAHA 2HQ1A 2D1RA 2UVPA 3D64A 5EKXA 4CFZA 1UXGA 3ZC3A 4QSMA 1RAIA 4HN9A 4PZNA 4UDXX 5H83A 5BV7A 1YJCA 3LPDA 3EASA 3PXDA 2OGUA 3BXZA 4G0YA 5B3JC 2BT4A 4BGDA 2ASJA 3UMBA 3MIIA 1I4EB 2VNHA 1GFWA 3QV1A 1OA0A 3ZLTA 4C88A 2FW8A 4YRTA 1RP1A 5C1BA 5AI9A 2EIHA 4GPD1 1REQB 4QRIA 5DWQA 3LUFA 1HE3A 4F86A 1URPA 3N2NA 3HBAA 4I4NA 3DE5X 4M98A 3SE7A 4ED7A 2O0LA 4KQ6A 1KYQA 2FX3A 2MR6A 5HBRA 4QQFA 1YRQA 2QUJA 5A5GA 1PG0A 4IR7A 1GPJA 1ZH4A 2CXQA 2O2CA 4PCLA 1JFVA 1XTKA 3KKLA 5THKA 4LYAA 2BM1A 3DHEA 1RLOA 3ESAA 4ND5A 3W6OA 2R6CA 3QFFA 2FRDC 2P0EA 1V71A 4LDZA 3LT1A 1PCXA 3KLNA 1P5FA 1HURA 4HY3A 1RW4A 3ZLUA 3HBFA 3O8QB 4UNIA 4FCCA 1NATA 1VG0B 3UWOA 2R85A 2GETA 2WVAA 4ZAVA 5EFZA 4E07A 4ZIRB 3EWSA 3WV5A 3ZHCA 2PHZA 1G20B 2ZYRA 2DCUA 5EIAA 3U3MA 1K5DA 2I9PA 3ZS8A 2DFNA 4HLUA 5L6MB 2K6GA 4QWAA 4FZMA 1ZMTA 5IVIA 4I55F 1BEEA 1ZDMA 2V9WA 3OQPA 1IBRA 3KFVA 3NNDA 1O97D 4KV9A 4KO2S 1V26A 4FYVA 1D8BA 2BLNA 3HSSA 5CX1B 4BC0A 4DDUA 3B13B 1FE8A 1N32B 1Z7YA 2KZ3A 5EVCA 3SYKA 5HFNA 4YRNA 2MWMA 5IABA 5AI4A 3OSNA 1G5RA 1Z74A 1FFXA 1R00A 2H3FA 3LFHA 3KQMA 3OIDA 3P45A 2EWWA 4GI3A 4LXUA 1A9QA 1IDOA 4PC6A 4CMIB 2G06A 2P5SA 3PX4A 1YKFA 1GUFA 3GA0A 3C85A 4X7BA 1BW9B 4LISA 4XIFA 2UYYA 5HS4A 1ZJ4A 3N28A 3OAAD 4I19A 1ZQNA 5KFXA 4UHDA 5GM1A 4KOEC 4BU0A 4IPTA 3SNHA 1NBHA 2H2DA 4I2DA 2F8KA 1ZD3A 4LVNA 1NK8A 2W8BA 1IEVA 2MHCA 3G3EA 3PUIA 4K9PA 1LW7A 4M0FA 2J4FA 2QMUA 5A3VA 5CB0A 3L4JA 4AKSA 3ND9A 3PW2A 4OHFA 2PBLA 1SV0C 4Q3KA 1TQ6A 4RWZA 3GEPA 3IVAA 3HKBB 3VOAA 3ZYZA 4QM6A 5AK6A 1GR1A 5FO0A 4MMZB 2F43B 2N9UA 4PZYA 1BMDA 5C3UA 1KFCB 2E8PA 4KN5A 2O54A 1AROP 1PN3A 1H42A 1KYZA 1ODSA 1NU6A 2HF8A 5H3LA 5BSTA 4OXRA 3QA9A 4EECA 1TLLA 3PUHA 4ZAWA 4KQ1A 4L72A 3DZIA 3JYHA 4F4XA 1CR6A 1U7HA 2O3SA 2JEJA 4K03A 5ENZA 3VBCA 4TZ6A 2Q5LA 1OJ7A 2C5GA 3H18A 4U5QA 2YXLA 1QQ7A 1XTUA 1USKA 2VHZA 3IOCA 2V3WA 3E1KA 5DH9A 4IUYA 1EX1A 3UM9A 2HJWA 3R75A 2ZJAA 3NM4A 2G0AA 2XNDA 2CV0A 4QHTA 1MO6A 4YYZA 2C22A 3G0IA 3IS3A 1ILWA 2X0IA 1LBIA 1SQ6A 3C8DA 1R3UA 4X20A 4Y0VA 4CM4A 3CZRA 3GLGE 4H16A 5JPCA 5CFNA 1M8KA 4LRWA 1WCLA 1J2YA 3EXIB 3OCWA 2JBAA 1LPSA 3AJAA 3PX2A 2VZ9A 4MJLA 4RKQA 5REQB 1YOVB 3TZ6A 2OL4A 2OCIA 1UBKS 3O0FA 4LZAA 2DBQA 4YRKA 1L7VC 4JCCA 1E2HA 3LIPA 4XWYA 3EBLA 5ARCA 5HE8A 3CUEF 1HLGA 3C74A 4QT4A 2PZ8A 2G1JA 3CVYA 1DCFA 4TM7A 4PSAA 4FGKA 3AL0B 3RAEC 4E5MA 3BOSA 1RAAA 2ZOSA 4QBTA 3TE6A 4GNKA 3OGUA 2H7CA 2ODAA 4F9TA 5C5IA 4DBVO 4X65B 4Y2PA 4DE5A 4JQOA 3DZKA 1QANA 1ZD5A 2CHFA 3BD9A 3GWGA 4QDKA 5AXBA 2YFKA 3RUAA 5AVZA 4I2GA 1CB7A 2RJNA 4G5RA 2NV6A 3RO7A 2XNCA 3BCRA 3OQNA 1UK6A 5BPFA 1ZGJA 1BS2A 1R10A 2QVGA 2A2ZA 2XY5A 2ZB2A 5IVPA 5H81A 3SSNA 1EB8A 1NASA 3M9NB 3ENNA 3NAGA 3V7FA 4WY2A 4OAPA 1MQ2A 1ST2A 4F5PA 1ZKDA 1UAAA 3UXOA 4F45A 2AJQA 1OIWA 1R64A 2A3NA 2HBYA 3MGCA 3Q7EA 1QP0A 4Z7QB 1FA9A 3U31A 1I4TD 2WHQA 3LYAA 3PFNA 3HJRA 4O2BF 1WAMA 5J2TF 2RHDA 1Y6QA 1EP1B 3THXB 2A0YA 3CU5A 3TD9A 3NHAA 4QQNA 3IHQB 1QIMA 1Z6TA 4GIBA 4FZJA 3K2IA 4HNSA 1E79A 1R6DA 4PHTA 2AVDA 4WZAE 3VR5A 1R6XA 3L7DA 3GEBA 4ESVA 1NLFA 2LYBA 2VF5X 4EA8A 1DKUA 1CEZA 4TV9A 2NUBA 3PW0A 1Z6XA 1C30A 4MR9B 4KXMA 4TV8A 2A5LA 1K8XB 3H9CA 2ZI7A 2A92A 2PL5A 4C1BA 5EKDA 4C2AA 5TVGA 4BP8A 1BCRB 1PUXA 4YJ2A 5EHQA 2XXJA 3GXBA 3KHHA 3PNKA 1KK3A 1UBNA 4WFQA 1F4PA 4PZEA 3FFTA 4KAJA 3TDNA 3VJLA 1CK4A 1MUUA 2IYRA 3NP7A 1PW5A 1U3GA 2AG5A 1UEIA 4XUCA 4CLOA 3ZVMA 1DEXA 1OI2A 4YD1A 1Z4MA 1ECCA 2REBA 3VSDA 1T2EA 3NPAA 3ZPXA 4CU2A 3GDOA 3CF4G 4KUGA 5IINA 4M1OA 4PC2A 1J33A 1U7XA 3VUFA 3WQSB 4BO8A 5DX1A 3ZVNA 1PQYA 3MDCA 4BMVA 1GPNA 5F77A 2WV7A 4F56A 3G1TA 3K0FB 2JS7A 5FD8A 3FM9A 2O6HA 3CSDA 4RH0A 3THOA 3GFKB 2HSWA 4FGJA 9ABPA 5ILQA 3OLQA 1XP5A 4KIUA 3VTFA 5AUQA 2V9CA 1VPLA 4BWJA 2YIVX 3BMCB 2J85A 6AT1A 4URYR 3UBMA 1OAKA 1U1CA 1W46A 4LBVA 4ESOA 1BMFD 4EVIA 1LBEA 5JVDF 1IC6A 2I87A 4MUNA 4P54A 1SRQA 4CZ2A 5ALZA 1UT6A 2HU8A 1CB0A 2NACA 1JG3A 2WG2A 1QMPA 3Q15C 1PJBA 3Q88A 4EJFA 1GRNA 4NLCA 5KYKA 2VRCA 3MRXA 3UJDA 3DBIA 4F7WA 2ESRA 4S2EA 3N59A 4JC5A 4PGGA 5TVKA 4BNNA 3E6AA 1Y80A 1YL7A 5JIBA 2QZSA 2EQBA 3DE2X 1QH1A 3LQ1A 5L40A 5F9MA 3A31A 2GBFA 2QNBA 3OZGA 4EBEA 1OFVA 4C0QC 1IPFA 5JZVA 4LE1A 4JUDX 1ZEJA 2C4VA 2ECFA 4L5JA 2XMQA 3OIYA 4XPIB 1DJPA 2H85A 5H3CA 3SDBA 1P9NA 1TJNA 1X7DA 2ADFA 3EXG2 4Z9XA 5FOXA 4LJXA 4ECXA 1D4OA 3HBMA 3ZU2A 4CTNA 2JR5A 2PUWA 1XRSB 2OEHA 2D13A 1W4LA 2GN1A 3AV0B 5DEIA 5CEFA 1W36D 2EKBA 4LJ9A 4Q3BA 4DV2B 1QTRA 3BGOS 2CUKA 1IH8A 2EYQA 4J8PA 1UPUA 3CLUD 4DMMA 1F2DA 3QMMA 4QTTB 4WBNF 1ICEA 3TACB 1R0RE 2WJJA 3DPSA 4J91A 5CT4A 1U8EA 3R6WA 4JLWA 4MP6A 4YCMA 2F3QA 2ZE6A 2JGEA 3CH6A 4L73A 3GH3A 1DWUA 4KN9S 2XI9A 4L78A 1JB1A 2W5UA 3NGLA 4NR0A 5CJPA 4Z7NB 1YB4A 1LVUA 2J3QA 4U6NA 3V9PA 1IHDA 3OQIB 4AMYA 2Y1FA 4XX1A 1PYDA 3NGMA 4BO5A 4RTPA 1J9GA 3QA3E 3KUCA 2GVNA 1T6BY 1XZAA 1XQ9A 1A2QA 3GLUA 1QIGA 1CQJB 4J6EA 4MI1A 5G1OA 3ESZA 9ICWA 4FJ0A 2NGRA 2O8FA 1QYCA 3ILYA 4QWWA 4DFDA 3JVVA 4PVCA 4UQOA 2W2XA 3L0YA 2PYDA 3EDCA 3I6MA 1CCWA 1RHMA 1S2IA 1Y8CA 3R09A 4IRXA 4LMAA 1ZRSA 3D7NA 2X22A 3EQZA 5CIWA 3BGIA 3EFOA 3SS7X 1D6JA 2WHXA 4HRYA 1P2UA 1RQ2A 4W4TA 4C7VA 4ZJPA 2OLKA 5D00A 5F2NA 4C29A 3CJTA 4W5RA 5EWMA 5FHRA 1DXHA 4BLOA 2Y99A 1LB1B 1XQVA 1Z56C 1CY7A 2TRSB 3NBYC 4A0GA 1V8PA 1TM7E 1GO2A 5FLXA 4L5IA 1P29A 4ZVVA 3UH1A 4LPKA 3DFZA 1A7UA 2RGYA 3JWGA 2VHXA 2ZBQA 2B34A 1U1EA 2ZRPA 3EUB2 3RGGA 1KE2A 2WTXA 3IP4B 1NURA 3K94A 2I5HA 4KQGA 4U2EA 1E3MA 2FEXA 4Y9SA 2ATLA 3SVLA 4C0WA 2YY7A 1RS0A 1OI7A 3S5JA 3KSDO 1MC4A 3CLSD 4GQBA 4YD2A 3OZRA 4QPNA 5CVJA 2VSXA 2KLBA 2PH3A 3QFSA 4L50A 4C7MA 5FDFA 4YO7A 4ZOCA 5AHXA 4JLAA 4L75A 1VL6A 1SIBE 4LHVA 3OPNA 1Z5OA 3F3KA 4WINA 3ZGYA 2JLXA 1OZAA 3VKHA 1XEWY 3ASUA 3AM9A 1CY8A 2AC2A 3C14C 4XDGA 3CPJB 1T4DA 2JFXA 3HRHA 1VRCA 3NONA 2ZWOA 4PYRA 1Q77A 1V9SA 4ZAZA 4TLBA 3QOFA 4H15A 1Z6PA 4V0RA 3EUFA 2CYCA 4BKQA 1FIUA 1AZTA 2E49A 1JILA 2B3DA 3RRJA 4HX5A 4NLGA 4AJ2A 4CEIA 2AHOB 4KPGA 4EG4A 4EYGA 3AL3A 3GGPA 3LY7A 1TUGA 2ODQA 4TS3A 2FJ0A 5B7NA 2OVBA 1ISJA 4KE7A 5LYJB 1L5OA 1LUAA 1NZDA 2PGOA 2Z09A 4PLPA 3V55A 3DUFA 5EA2A 1D03A 3ROQA 1NN0A 2P40A 2Q6TA 3IPXA 4CKWB 1MVLA 3MEQA 2F4NA 1P2GA 1RWWA 4MKIA 2ERXA 2ZB7A 1AHPA 3HDJA 4U1RA 1ZISA 4F5ZA 4MEAA 2K60A 2BLLA 5C7OO 1KH3A 3GRUA 1XXHB 2E1PA 3AEUA 1OT3A 2XUKA 2ZI3A 3WGYA 2PK3A 5GIPE 2WMNB 3R3ZA 5KTYA 2WHEA 2VYQA 3DE3X 3L8MA 4M1SA 2EAOA 1CPYA 2Z5VA 2ALZA 2W8LA 3P2IA 3P0JA 2H3QA 4RAQA 1NT2A 2BPGA 2YWCA 4KYIB 3OPYA 2PWAA 3LOPA 1E99A 3EVDA 2DQYA 2ENUA 3MRTA 3OZUA 1XNJA 4JODA 1AUVA 2FN3A 2V7XA 1ZM2A 3NKFA 4WOCA 5T6BA 4TUYB 5CBPA 4W5QA 5E1MA 3BWBA 3GFRA 1QGED 3PC2A 4R98A 5H16A 4Z3DA 3FG9A 5H02A 1ZRNA 5JYCA 3QWHA 2G40A 4RESA 4CDNA 5FL7A 3H4VA 3Q7TA 5BQOA 4CQLA 4RPJA 1R8QA 1HE2A 4BNGA 5HTOA 4LYHA 1AQNA 4FS3A 1RRMA 1Y0BA 1Z0KA 4ZI7B 1M7BA 1P33A 1QK4A 4CI0B 3JQPA 4MVJI 1O4WA 4F4IA 5HIKA 2RC5A 1LA2A 2C7BA 1M54A 4ZC8A 3EPGA 2Z9DA 3WLPA 1CUFA 2Q8PA 4K26A 4NESA 3Q8PB 4P4SA 1TTQB 5AHWA 5AUOB 2Z56A 2VOEA 1JB9A 1R0YA 1OY1A 3WDKA 1VSTA 2NUTB 4MVJM 5JCJD 5JDIC 1T36B 4I4IA 4M9ZA 2QJTA 3BB1A 2P7IA 3NBUA 4HAUA 1FJXA 4LSGA 1L5VA 2ZTEA 1NVEA 2PZFA 3AYXB 3VSBA 1A04A 1ZK3A 3R41A 1XJQA 3S29A 1KBZA 4URXR 5A6SB 3MJSA 5FBKA 1B8OA 3MZ0A 1J97A 2E4WA 1P62B 2EZ9A 2Q3MA 3NEYA 2E5SA 5K09A 3PHHA 1SA0B 1TKBA 3HPQA 3NT2A 1E8MA 4ZMRA 3RT9A 2BZFA 1JU3A 4JJFA 4M38A 3SKYA 2JEOA 5ALVA 4AQDA 1ACLA 5JAHA 2G5TA 2MYUA 4E33A 2HQSA 2V58A 1P39A 2Q27A 2GAOA 1FXUA 3RAQA 1FS6A 5E7MA 4US2R 4EKGA 1D4AA 5F3DA 1NIJA 1C50A 2NXEA 1ITZA 1ODTC 3DWFA 1JEJA 3CUUA 1DMSA 3LECA 2YR0A 4ME6A 4MUYA 5TJHA 5FXMA 3TQSA 4EG1A 2VJPA 3STWA 4DBLC 1GUYA 1BRMA 1JSXA 3AHDA 4NNOA 4WKGA 5AKLA 3HE3A 3WTBA 2LVBA 2RD2A 2CB9A 3ANTA 2C9YA 2K2WA 4YI5A 3KL2A 2PE5A 3CO0S 4RMGA 2AU0A 3QKIA 5EPEA 4AMBA 4ERNA 3BILA 4R83A 3GJ8A 5BMVB 2V4RA 1N3BA 1V1MA 2BFPA 2DQ4A 1RWNA 4OHUA 2BCGY 1W5EA 3BD8A 1R0KA 1HA3A 2VA2A 3GA5A 1U2SA 5DK6A 1EIWA 4TS1A 3LVBA 5B1IA 3QEMB 1O54A 2G5PA 9ICBA 3HN7A 3W06A 3W8NA 4LK3A 1IBKB 2V4UA 3G8AA 1XTPA 1QNFA 4ER0A 2J67A 4HR7A 3VHXA 5CH3A 1ZQWA 1RMQA 1DC8A 1E92A 2WYIA 3IUYA 4NK5A 4AJ9A 5CA1F 3G0GA 2J6SA 3O4FA 2FVXA 3LV8A 2RHCA 4J0IA 4XGKA 4CV3A 5A06A 1JI7A 3NR2A 5LXTA 2PFQA 3G8CA 1JIIA 2EH9A 3KJIA 3KKZA 3O8DA 4RPHA 1XA0A 1KI8A 4TVBA 5ECGC 5JYEA 4MW7A 4ZVUA 1LCIA 4MP3A 2XKAA 3CNQS 1NJ8A 4L5YA 2VPYA 1X7WB 2NZXA 1OWLA 2J6UA 3DT9A 3RSQA 1YBFA 2VSQA 4W1QA 1FMLA 1JFLA 4FUTA 4XGRA 5LQNA 1U7TA 1ZN2A 3H0CA 4KI0A 1V39A 5HFJA 1KKUA 5LOVA 1KOJA 3KTOA 5TQ0B 3RJGA 4NLZA 2R6HA 4UZEA 4ARAA 5K0JA 3F8TA 5IZ4A 1UA0A 4U7CA 1D5WA 2PSSA 3TCNA 1OB5A 2PT5A 5FJIA 4MFCA 9ICMA 2HI0A 3NWOA 2XR1A 4RD2A 2KYRA 5DGHA 5EAIA 3UUFA 2FRXA 2YIMA 3V8NA 4BWGA 2FUNB 2AGVA 3CRNA 4BZXA 3S1AB 1XAJA 2G5CA 4G5XA 2CF6A 4UPVA 4NSNA 4Y1GA 1HMPA 1LBSA 4EYEA 4HH4A 4O8ZA 5BW8A 2P1ZA 2JGIA 3MRSA 4GE3A 5LYYA 4BNKA 4LF7B 1HFKA 2RGXA 1E5TA 2QSUA 3PPYA 4LJAA 2XKJE 4DAOA 4F46A 2HLHA 1GLVA 1KAQA 5K3DA 3H2GA 1Z39A 1P3Y1 4IFBA 4XZ3A 3BPSA 4V0QA 1P77A 4NBNA 5GJCA 1COWA 2FZWA 5GP1A 1YRYE 4C0AC 4DL5A 4Q4HB 5T5QA 1ORIA 2FEAA 3WL4A 4ECSA 4MV0A 1A2BA 2X3YA 1FTSA 3LU1A 1N56A 3MJFA 2GQ0A 1ZD8A 1OFTA 1U81A 2XZDA 2VDKB 4PYOA 3RS8A 2XGOA 1AS0A 4BJ6A 4ED9A 1TPZA 1IK4A 2QF7A 4GE0A 5FAXA 3DBRB 4ZMBA 2VUSA 2CCJA 1VSUA 1UBSB 2DBRA 2ZRMA 3BHJA 3KCQA 4IDCA 1H3FA 3H9JA 4BNZA 2NP6A 1YS4A 1UMDB 4EENA 4MF8A 2Q3CA 3TFWA 2FPRA 5JWHA 1KEWA 2QUAA 3L2OB 3N2KA 3PEUA 3VC3A 2I4RA 3IG5A 2H9YA 3VI3B 3Q5GA 1LNQA 4JVSB 2JI7A 4QRHA 3CYMA 1P9RA 3KB1A 4I0WB 4N9WA 2KJ5A 4TM8A 3STHA 4D9GA 3ES9A 4BEWA 1VRVA 5FUVA 1U5AA 4EO4A 3G9XA 1MEJA 4QGFA 4B40A 1X9MA 2JKVA 1LD3A 1RWKA 3CM0A 1XIVA 1QYDA 3FUUA 3OFVA 3INNA 3I2JA 1GNQA 1E9BA 3L7NA 1F5NA 2RK4A 4QQRA 2ISSD 4S1TA 3TFSA 2ATXA 2FPIB 4M9SA 7ICFA 1AQLA 4QDJA 4PZ0A 5BMVF 2RGGA 5I7SA 2NLOA 5FPKA 1GSAA 3O9VA 1V95A 2GJKA 2ZJ1A 2G8LA 1Z6ZA 2X6QA 3O21A 4A91A 4QYXA 5BN3B 1JDJA 5J2BA 3JD1A 1YTUA 4C4AA 4A73A 3PFBA 3KD3A 1GG8A 2DHQA 1SO8A 1W88A 1KW4A 2JHFA 3U1VA 2QQ0A 3HNRA 4UB3A 4I8XA 2FUKA 3BZBA 3MYRA 2NU9B 1BXZA 1EZ4A 1GDDA 2V5VA 1K1SA 5GPBA 2ZPTX 2HUNA 2WAYA 4RQ5A 1N1MA 4EL0A 4JQZA 3ZEAA 2X76A 1Z00A 2IVZA 1Q74A 1YOBA 2F8MA 2QKQA 1DZIA 4PX2A 3A4YA 3LS2A 4BKRA 3E48A 5L4LA 2XWJI 1AU9A 1YHZA 3QKSA 3SV4A 2HGZA 7MHTA 4W8HA 1AKYA 4KGXA 4D79A 3MMPA 1X8LA 5K8IA 1E3EA 3L7AA 5D3MA 2KVCA 3HGTA 5KFAA 1JX4A 1N2GA 2LV8A 5AOAA 2XIDA 4RZ3A 1F2TB 3F6EX 4WDRA 1IZYA 5THQA 2W6JD 1DEOA 1DLIA 1NJ1A 1SAYA 3I8SA 4RNNA 4FS2A 1QPBA 2GEBA 3FCYA 2AUTA 1WXEA 2R8BA 2RAUA 2JCGA 4BX9A 4R7ZA 4H1HA 4KGDA 2GTPA 2P4HX 2ZQYA 3SIWA 4HXGA 3GCZA 1W87A 5JXIA 1DTEA 3LP6A 5CR0A 3O8QA 3D7RA 5G40A 4B7ZA 1JHXA 4CQMA 4MLPA 3TW8A 4YJ3B 4LY9A 3A3KA 4LV6A 1XEXA 4CN8A 1O57A 4PBTA 2IBKA 4YXJA 1HL3A 1SHJA 2OAQ1 4JFAA 4ZI3A 2CLCX 1S96A 4ENWA 3SEAA 2XCLA 4QPDA 4MROA 1C9JA 3E03A 3PDHA 1W5AA 5F9HA 2FQ1A 4JHLA 4ML3A 3CURA 4D5EA 4KLAA 4V3CA 1IY2A 4Q43A 4WXMA 4YJGB 4FBUA 1EE2A 3PHIA 2ERCA 4MYUA 4MVJH 5MDHA 1EBFA 2ACKA 3N7PD 5EG5A 5BN4B 5K4LA 1FYFA 3K9FC 1VJGA 1CVRA 3JASA 3HYRA 1BKYA 2ZYHA 3RTBA 2X1VA 4OO1J 2XW6A 2OB2A 1ZBDA 3KKQA 4MPRA 4A3SA 4PY2A 3OHPA 4YAIA 1MC1A 1E6WA 3D2QA 3C3CA 1EK6A 2H2GA 2HQRA 2K7ZA 4X71A 4NYIQ 4OA8A 1A9RA 2AHRA 3JARB 1ZUD1 1XCGB 3MGAA 4GGPA 4XXHA 3R76A 3ZU6A 1R4ZA 3P71T 1RHRA 4CCSA 4URFA 3E8SA 1OBFO 5J2UB 1BWQA 4OFZA 5E6RB 4LQLA 1GPWB 1NF9A 3DAFA 3NRJA 4B0OA 3RCBA 3IV6A 1F8GA 3TAHA 1JLKA 2A84A 3TX6A 2DH5A 3BX1A 1MT3A 4J9QA 2KEYA 4EMSA 2J0UB 4MYRA 2J6IA 4HVAA 4E0DA 4GL4A 1Y7PA 1C8VB 5J59A 4OJ5A 5CLGA 5KNDA 2HA2A 3DCJA 1YBMA 1SC6A 1L7OA 1ST3A 2CLSA 1Z8DA 3DD1A 2ORVA 5C8VA 2PUEA 4G4GA 4YAFA 4JB3A 2Q0QA 4KMOB 4PO3X 4RA9B 3STXA 3TWOA 1WXIA 4NULA 2Z5LA 5C1DA 2M2IA 2WTBA 2ZIUB 5FI0B 3KVVA 4DO9A 4Q7KA 2PKXA 3QKTA 9ICOA 1IWPB 3R7NA 1L4HA 1WUDA 1HUOA 4ARSA 5JJLA 4DCJA 3TTUA 4M88A 1OLXA 3H2SA 1UBLS 1K86A 3JQRA 1YDWA 4MMYB 3OOYA 1AV6A 1MEEA 1WP9A 2XKBA 2C2KA 2BGWA 1R15A 2GDZA 3SNKA 3K1JA 2GVDC 3ZV3A 4B6OA 5KKCA 2B8WA 4RTOA 1U7PA 2WJ6A 3NVMB 3F74A 3R7LA 4I2BA 3RU7A 3BK1A 4CF7A 1W5FA 1NXWA 1ZR2A 4P36A 5AIAA 3EZLA 3BZWA 4IHQA 2DFPA 3R24A 3QZ8A 4JV2A 1QGUB 5CTAA 1ACJA 4DSNA 4GECA 2YWRA 1H94A 4EYIB 1T1GA 1K7EB 2I9KA 1Z0DA 4IHJA 1CDOA 2Z98A 3EUEA 4I1SA 3LRXA 4M0AA 4IM7A 3SS8A 4ZEVA 3WLQA 1UH5A 2PN1A 1DFGA 3PNLA 4AM8A 1ISSA 3B7PA 2CHUA 4M0MA 3JWPA 5IHPA 2VSNA 3ZDDA 1MMFB 1Z2CA 1ZQYA 1PJSA 5TPWB 3IRVA 5E4TA 4PZAA 1ZK0A 3GN1A 5KHAA 3A6FA 1KBQA 2JLCA 2PY6A 4C01A 2EX0A 4ANFA 2AMJA 5DGDA 2A0WA 3DKRA 1AKTA 3Q3JB 3NQ41 4ZARA 9ICLA 1C3LA 1RM0A 2QLMA 4R3NA 3UJPA 4BNUA 1G291 3K96A 4FTWA 3ZXSA 1Q1AA 2J45A 2O2XA 3UPDA 1D6NA 1B22A 1UPCA 1DC6A 3FUVA 3JV7A 1FX0A 4O6VA 4BFZA 2AI3A 3HFJA 3LK9A 4MYSA 1ZQEA 2E8OA 2A0KA 2IZ7A 5FJJA 4EF5A 2G9NA 3BB3A 1SXQA 1XL1A 3VR6A 3FR7A 1MD9A 3CG0A 2WY2D 1HT3A 1ZI6A 3VMFA 1IM2A 4Z3OA 4CLDA 3NAMA 1SOAA 2YINC 1OGJA 1YU6A 4BP9A 1WUKS 2VSYA 1PBTA 2CV2A 4PNEA 5BT9A 4I4TB 4I55A 3QF7A 2P0YA 4WT7A 3R7WA 4AJ4A 1T6ZA 5DP1A 4F4ZA 3P9RA 3BAZA 4WFJA 2JLWA 5ALXA 3ZVKA 3KXPA 3M4XA 1RJ9B 4RK6A 5DLFA 2C97A 4O1MA 3RVLA 1JV2B 4L0DA 2IELA 3ZNOA 2EGHA 3LDFA 4MI3A 3REOA 3TZBA 3DFKA 2G72A 2OAGA 2V7TA 2KJQA 5HF6A 2XGJA 1PVOA 1QCZA 1TKRA 1JSLA 2JBWA 4OYYA 4D9EA 4F4YA 2HHVA 1RACA 1RC8A 5JEDA 4HH0A 4L9WA 5AJZA 4RLHA 4XTRA 1ZH2A 1Z38A 2RHHA 2WKQA 3O3NB 2J08A 4I81A 5JH7B 3A36A 1GD1O 1GL7A 4WJ3B 1V96A 4HGRA 4J75A 3IUQA 3OCVA 2KSOA 1S6YA 4DQPA 4I27A 2BH9A 2D1TA 1DIOB 3AUKA 3NH6A 4MR7B 4OB6A 4OY3A 4UQPA 1ARZA 5M04A 4Z0TA 1N75A 2WSSD 5F23A 2KB0A 1EVYA 5LKRA 4MW6A 4UVEA 1DC7A 1OTXA 1CJKC 1DOAA 2E4YA 1H2YA 3H1FA 3H87A 4B9EA 2WD7A 1WPGA 3T7KA 4J3FA 1LRKA 2Y9MB 2ZRAA 5J63A 3BWCA 1X9SA 1BYUA 4FUQA 4YJFB 1CQJA 3GQCA 4U2GA 4PHHA 3GXOA 1EVIA 1RM6C 3IDOA 1Q5PA 4I3HA 3TB6A 4YV7A 3PNYA 3V6LA 4MRVA 1C1YA 5A3JA 1NMEA 2QAGC 5ERYA 3SEIA 1S0UA 1KO8A 3RRFA 4OEHA 1QVWA 2BGJA 3THYB 1LDBA 1V2GA 1JHQA 1RJEA 2VCYA 4HZUA 1RWMA 2I2FA 2Y6VA 4Q3OA 1TVKA 2FPOA 2FWJA 4FC7A 1L5GB 3GJ7A 3RJ9A 3UQ2A 3RLFA 4ZYXA 5K05A 1L3VA 3JATA 2A7QA 1CUJA 2FMFA 5IU6A 3WMEA 4D1YA 3FVQA 3WR5A 1T8PA 3M1AA 4UVHA 2D4HA 5CB8A 1XJ0A 2W4IA 3TVDA 4DARA 3NH9A 5EUCA 1TJYA 5EMMA 1W47A 3AM1A 2R1TA 3SXUB 3X0DA 4EG5A 4E5DA 1NPYA 1EUDB 5J8YA 3H7AA 3TPFA 1PSDA 1BD3A 3NCHA 1SBQA 2GN8A 4RPGA 4OQFA 3G5MA 3NIFB 2WYUA 1CXZA 1KJQA 4HAXA 1Z0ZA 4X1KB 4GOOD 4QWEA 2P6UA 3L7IA 4V03A 3A1DA 2NO1A 3MLAA 4PYIA 2C61A 3EG9B 3OSUA 2Y2VA 4YRGA 5IASA 1EUQA 4BKMA 5H9WA 4IXWA 1NWCA 4PHGA 2O5EA 1A9SA 5H7XA 1UJ2A 4UB1A 3Q7IA 4LSWA 1Z9BA 2FW7A 2MJLA 2QQFA 3EQ8A 2QTBA 3OTGA 4QHYA 4RADA 1W52X 4R8VA 2EU8A 1KS9A 2YB4A 1FQJA 1GKYA 2PBRA 3H9GA 3LUKA 4Q9DA 4D0SA 4M7WA 4F4CA 2WQ6A 2MA1A 2CHVA 2FQYA 4KEAA 3ORQA 4UJ3A 2F7SA 1H05A 3GJSA 2PU5A 5J8YC 2WSSA 3O3MB 5GGYA 2EFGA 2JRLA 4R84A 5AM4A 3SZGA 1H2EA 3W0LB 3QF4A 4UQLA 3DZGA 1IPHA 4U7TB 3AZPA 3ZHZA 2XQFA 3AOGA 3V7LA 2J5QA 3NIBA 4QZDA 3PA6A 1N6OA 4IG9A 4TTTS 2C7PA 3PQ2A 4DG5A 5FYDA 5CLHA 2ZETA 1F51E 2PZGA 2QYHA 4JENA 4NBLA 4R9UC 2B9EA 1MRZA 3QUCA 2XUGA 2AJCA 3ISVA 4UBKA 5IJAA 3IEUA 4Q7QA 2VQEB 4DGSA 1NYLA 1NOKA 1ZRHA 5AM2A 4GXQA 4TT3A 5F7OA 1Z47A 1KHHA 3I9FA 7ICSA 1H9AA 3CGGA 2XVMA 4TMVA 2GJ8A 2C2WA 3EFEA 3SZLA 2I91A 2QENA 2XRYA 2ZVQX 4I50A 3TDMA 3CJRA 4MV9A 5LQCA 3LLSA 1ZIYA 2E5FA 1ISMA 2ZUUA 3HKCA 5CB6A 2ZBGA 1UQRA 2IYPA 2O0MA 3A6HA 4BLQA 4V0NA 4CXMA 3MR3A 2CFIA 3QG5A 1J2TA 1OCEA 2PS9A 1US8A 1E2JA 3CY6A 3JD0A 3PQ7A 4FFBB 4GICA 4IYJA 2ZEJA 4Q9KA 4QUGA 2JFPA 4HRVA 5EE5B 1V45E 4M2YA 4N5MA 4RSHA 2AVNA 1DAOA 1IHPA 4IDAA 3ICXA 4ECTA 1G38A 1VZ3A 4TUYA 3DOFA 4OMDA 4Y6PA 2WM3A 2C7VA 5TF0A 3X1YA 3WZLA 1EK1A 2W4QA 1T5DX 1ZJ5A 3DLBA 3W4JA 4CRWB 1SBTA 4K40A 1AD2A 1FDIA 4HN2A 3EEOA 2EANA 1BPZA 4MUEA 4YCLA 4ECWA 8ICBA 1XWWA 3L0DA 4B5LA 3CN9A 1UADA 5J0PA 3GCDA 4RD1A 4Z0PA 2CJWB 1QFSA 5DULA 4UNPA 5IH3A 1N8KA 1XU9A 3DMTC 1R4MB 2JW5A 3HB0A 4JZYA 4AMVA 4DG9A 2FJ6A 3DDCA 5TQVA 3SJ7A 2IUFA 2AGPA 2AA3A 4DLTA 1WOMA 3MJ4A 5KG1A 4L6AA 1U3UA 4P5EA 5EHNA 5FULA 1SFRA 1Y6JA 4OGGA 2QORA 4IICA 1IPEA 5IPFA 5J4YA 3HM2A 5L45A 4O5KA 1X87A 3G8DA 4TRMA 4WCVA 3LQ4A 3RVJA 2UUCB 1B1AA 4U6QA 4LJRA 2DQSA 4KN4A 5J0QA 1ZH8A 2HXGA 3I9V1 4KFUA 1YZQA 4D8UA 1KJYA 4LOJA 1U2TA 3GILA 4HQNA 3VZDA 1NPTO 3I34X 4PU0A 1OF1A 3EPRA 3VPHA 3D2LA 3IVRA 4CF6A 4EW3A 1GVHA 4S24A 4W9NC 1TYEB 3HW8A 5ED0A 3S28A 4INJA 4NNPA 1DDGA 1O3YA 1O8CA 2DKFA 5JAOA 1OUMA 1K8QA 4LFAB 3Q72A 3GQVA 3I0MA 1U11A 4JLOA 5F2KA 2QGNA 4DMKA 1MZPA 2PMZC 1GR0A 1MX1A 2H11A 4IVPA 4ENVA 3G2HA 1NOIA 3LVFO 1QZ3A 3L02A 3MTGA 3UQ0A 1Y89A 4G0QA 2H1HA 4O3NA 3VYRB 2FW1A 3U3KA 1L4UA 4O3OA 5GAJA 3RFFA 5BQFA 2VPTA 1ZQZA 1UP6A 1ZH6A 1A4RA 4IOMA 2PVPA 3DVLA 3O4RA 2EBHX 4QREA 1XZJA 1QRRA 5JMOA 4LBWA 4BDPA 3DEIA 1GRCA 2ZJZA 4C0HA 5JXJA 3JWEA 4P4TA 4E51A 3HLYA 1ONSA 2B4AA 4WEQA 1SU4A 1R6BX 4PO1A 5BWNA 1A8IA 1DT3A 1T2CA 1RHJA 4FINA 3ZVLA 3N8IA 5ER9A 4YA6A 3KT6A 4D25A 1VZ2A 1T25A 4LX0A 4W5WA 3C39A 2G08A 2KJ9A 1M2FA 2HK7A 1J0AA 3E0QA 1KZ6A 1NC1A 2H5XA 1QHGA 2JKYA 1DRVA 4ZZ0A 2Q2VA 3EIQA 4C21A 3AX6A 3JYPA 2YMQA 1NFFA 3QITA 1GGMA 3CZCA 4F1JA 4WOJA 1Z63A 3U09A 4JVMA 2CEKA 2KSOB 4M1ZA 3O8NA 1KAMA 1DQNA 1M2OA 3ZDYB 4RM3A 5JY1A 2PZBA 3CX4A 4CR8A 1TK8A 3L6BA 4INPA 4Q8FA 2P41A 4KTVE 4NCNA 5TQ0A 4JI8B 5AVXA 1W25A 1ZINA 2YNMA 4IC9A 3L7KA 2EJTA 4MVXA 1KP3A 3A4VA 4H6XA 4M76B 4WNCA 3UC5A 4D3XA 4GLLA 4DIOA 5K8VA 5DO9A 3OQ1A 3CVXA 1F8UA 2DT8A 2I76A 2A1JA 3OPYI 2QA5A 2J87A 3I8OA 5AQEA 3TLGB 5FUBA 4YC7A 3N70A 3OEHD 3VR3D 1UKZA 1WIWA 3FNIA 4JSYA 5G3ZA 1RYSA 2IDKA 3VYSB 5EJ6A 2ICAA 3BZKA 5ALUA 1X1EA 4CEHB 1WCV1 4R6XA 1ES9A 2XCRB 4QE3A 2KD1A 1AKEA 1E5XA 2AZXA 2YXPX 1E60A 1ZI8A 1QVAA 2OY0A 4YTEA 5LLTA 2QL9A 1VSQA 5A02A 5JCOA 4PG5A 4LGYA 4AVYA 1GP2A 1ZMRA 3ZWQA 4H2DA 2XMSA 1L3IA 2ES6A 2UUAB 2E48A 3OZAA 3O2SB 5DVZA 3ADOA 1U0LA 3EEQA 4OK6A 4IRCA 3SIRA 2ZWVA 1T9GR 2JI6A 1QKIA 5H80A 3WWOA 4V1CA 5KJFA 1XMQB 3P8ZA 1E6CA 4KMMA 2LCFA 3C2KA 1CUBA 2QUKA 3DV2A 4LRSB 3TL3A 2MSEB 3NIDB 2Z30A 3SBEA 3BMOB 5JNLA 3UK0A 1DIAA 1T0UA 2HO5A 5FNVF 1JHDA 2Y4OA 5FBLB 5KFZA 4FFLA 4QG7A 5DV9A 2FG6C 1EEHA 2WMYA 4ECEA 2D54A 1H2BA 2PUJA 1V11A 3N7RC 4E3ZA 4KPUB 1K9SA 4II3A 1Q3HA 1Y1PA 5J2FA 1A9TA 1XAGA 1KI4A 2QRKA 4AG5A 3N07A 3DOCA 4OQZA 4AMZA 4BVHA 1EP2B 2XVZA 3VDXA 1U8TA 2YTUA 2BGIA 2Z2YA 2QTNA 3PB3A 4Y1EA 2C4MA 3CLKA 3BQ1A 4Z99A 3QLTA 5FRDA 3L4SO 5DYWA 3QIAA 3LUBA 2JEZA 1T2DA 1UM9B 5EXDA 3EXHB 4N1AA 4HPXB 2W7TA 4UMEA 3RYFA 2BPOA 2H3ZA 2VJMB 4K9DA 3S40A 1XS9D 5I9BA 5A6SA 1NMZA 2HBQA 3F3MA 2G4LA 3R1IA 4CKBA 3Q5DA 1KSGA 1OREA 4AZ3B 3CH4B 4KFRA 1QHSA 2VL7A 3OJCA 3OWOA 1T5OA 3BSWA 1NJXA 2BY4A 3E7DA 4A7PA 3GR6A 1DOHA 1GUAA 4DHWA 1NJYA 3KHSA 3H5TA 3MCVA 2IP2A 5DTRA 5I8ZA 1SXJA 4BJQA 1B8VA 4IMPA 3U7HB 1L4FA 3C5HA 4R6WA 4UTNA 2Z58A 3MR6A 3EIHA 4QBKA 1UK7A 2QN1A 3QLUC 4DBZA 1C30B 4MR9A 3GELA 3WGLA 1XZHA 3K0BA 1NNLA 1BOOA 2X8WA 3PNMA 2F1OA 1KEUA 2ZT8A 3OHBA 3OWXA 1G21B 4EG0A 1P72A 3VZSA 4N7JA 4JI5B 1QO0A 3LGXA 1Z4PX 2Q4OA 3ICOA 4V2IA 5L3SA 3CA8A 3FPLA 4NCHA 5EN4A 2WAOA 4IDDA 1BE6A 1FRVA 1KO4A 1XTVA 2DULA 3IB6A 3PU6A 3T7CA 3NAZA 2ODEA 4F6RA 5AFSA 5HRCA 1FUYB 1Z7GA 3EHDA 4QXMA 3LPMA 3H19A 1VRWA 4HB3A 4B7AA 1PVPA 1GZHB 1LSSA 4OHPA 1TW2A 2W42A 3TSZA 1H2XA 4CG2A 4DFJA 3DB2A 3K8OE 3UMRA 4C4SA 3B82A 3OI7A 1CSEE 2JGNA 2RHLA 2H5JA 5AKIA 2Y1KA 3A0BU 2IIVA 4QU8A 3Q8RB 3MB8A 4WBXC 1DT5A 3B1JA 3SMQA 4D81A 4DUYB 4BP3A 2BSQA 3RYHA 8ICGA 1HKUA 1NUQA 5JVDA 1NJ2A 4XW2A 1G5IA 1FU4A 4MA4A 4R2HA 1AA9A 1CIJA 5JRJA 3PIRA 8ICOA 5K0CA 4Q16A 2VLBA 4LXYA 3LP5A 4A5OA 5EWFA 3MJTA 4MX8A 2YY6A 3E9RA 1YZUA 1KSPA 1R0LA 4QA9A 3W1VA 2OK7A 3PX3A 4RNOA 1RTTA 4OXXA 4G5FA 4IFEA 1MFPA 1RWOA 1F2VA 3RSHA 3MJCA 4QOEA 4KWTA 3NVKI 3IJPA 4D3FA 1RQRA 2X8JA 1J49A 1YJ5A 3PJGA 5CT5A 2C03A 2J5BA 1KK2A 3MBYA 2QAJA 4P0PB 3KYIB 3TW4A 4BKUA 3F9RA 2H3IA 2ATVA 2HEIA 1GG2A 4MQUA 1QHIA 3I2YX 3KD2A 5ULLA 5BT8A 2FAXA 6REQA 1EEXB 3UW3A 4KLIA 3OE7D 3WA6A 4PRLA 3TQHA 3AB7A 3DXYA 3U4GA 4ARCA 1U5BB 3AI7A 5PGMA 3N87A 1H3NA 3PXAA 4NEGA 2A5GA 4RSMA 5HIIA 2BKXA 1E1KA 2YVUA 4EO7A 2QMHA 4NOMA 5MFPA 3V6HA 2JGRA 1BJTA 1SGGA 4CDGA 4TKUA 5ADVA 2P9QA 1GFIA 3H4IA 5A1JA 1EGVB 1CF4A 4J1NA 1GPAA 1T4MA 3LZ6A 1JMYA 2F3SA 4AKEA 1GPLA 4ZEMA 3RRHA 2BMJA 2CGEA 4WW0A 3TLCA 2MAXA 1A69A 4TLEA 3AV3A 3A3NA 2PUCA 3S1SA 3QUTA 2BKLA 3T8YA 2YJTD 2HGSA 3EVAA 2DSTA 2I2BA 3RABA 3ZXIA 4CM5A 2W2VA 3WIDA 4ASUA 2KKVA 4WXHA 2KN7A 5IDVA 4KBYA 4EGJA 4YRMA 4MEYA 2DJ5A 3AZQA 2OO7A 5BNZA 1FZTA 4F6LA 4Y2QA 3ZWWA 2Z8XA 2G1PA 5FOQA 3C5WP 3DAHA 4HQRA 4MVCA 1RD4A 4YT5A 2QVLA 4IBOA 4KLJA 2RKBA 4LNUA 1JIVA 3P20A 4HGZA 3V7WA 4KWIA 5L1JA 1LLFA 1D9FA 1ZY2A 1IHUA 2HCRA 3L8FA 4RD3A 5KQMA 1CKEA 1U0NA 1ZC4A 2YOHA 3LWNA 3TLYA 2QT1A 4LZOA 3GVCA 2IK8A 1M75A 3KWJA 3O3OB 3GRZA 4M86A 5B57C 4YCXA 1QRDA 3R3HA 2VYVD 3DE7X 4NL9C 1GCOA 3SAHA 1XX6A 4WFKA 4MWEA 1MGOA 3RS3A 2GCGA 2Z2XA 1QOQB 5COBA 3LDGA 3HRDD 1A8HA 1YQ9A 2XUAA 1HE1C 1L2TA 2WW8A 4RORA 1M33A 2JHGA 5FTKA 5ITWA 2CL6X 3S7ZA 5A0VA 3WK9A 2YRFA 3PI7A 1KMQA 1KEEB 4P3XA 3M6KA 5FFNA 2XNDD 3FYSA 3JAWA 2FCRA 3KK0A 4GOJA 4O33A 1Z5VA 3KR0A 5ALIA 5DLGA 5DP2A 4FDTA 4GSKA 4PSCA 5BWLA 5F64A 4E21A 1QV6A 5LQKA 2I6GA 1ZWLA 2XCAA 3B9PA 3KOWA 3WSVA 3TKAA 1LDMA 2KI5A 2CLLB 5KYNA 1FNNA 5DTEA 2G9RA 2O3UA 2UXBB 3D3EA 3HWRA 3W2FA 2ARKA 2W04A 3FAHA 1UINA 1M6WA 2NV0A 2BMEA 4H9GA 4TSRA 1RM3A 1SXPA 1QF7A 1DAIA 4P31A 5LU8A 3J81A 2YRXA 2ZROA 3B3AA 2QD1A 3AR5A 3VHQA 3GV5B 5FH9A 3WMGA 3KKNA 3ZCTA 3GARA 3KKEA 4V3BA 3B52X 2CNKA 4EB8A 5HSGA 1FJ2A 4Q15A 4CLEA 4ZVKA 4DB2A 2C77A 4X66B 2JIOA 3AFHA 4J7UA 4BNLA 1J2MA 4IH9A 3UXYA 3HH8A 4I2EA 3DJFA 4HMPA 2ORYA 2QPTA 3OIUA 1MQSA 3CLHA 3IP9A 3N2GA 4UAWA 3C5GA 1X9HA 2D7JA 2Z1MA 3ZHVA 1KARA 1E79D 1AO0A 1ZN8A 5AYVA 3ODPA 3GGGA 4RJ2A 4PM4A 4MDHA 4UULA 1MR3F 1PZGA 3GN2A 5G0TA 3WLFA 5FQOA 1RP7A 2DWUA 2FGJA 1NJWA 2PSEA 1W0JD 3TI0A 1C9EA 4BO3A 1LQTA 4RVSA 1GO3F 3V8VA 2PUVA 5JSHA 4KPUA 4PQYA 2O5CA 1XDUA 3OFKA 4R1UA 3HP7A 1YUNA 1OHHA 2OE2A 4I5DA 3HL4A 2Z43A 3ENVA 2R97A 5E1OA 3CRVA 4Y3UA 4YQEA 2ALJA 4IIJA 3PDUA 4MLCA 1PR5A 1DO2A 4RMJA 4YAOA 1FFUA 1F8XA 3S44A 1S8OA 1TEZA 1Z08A 4PJ0U 4QNRA 3ITNA 2ORED 4N3NA 1A97A 4OXNA 3GCWA 1K2VN 3L8YA 4PPFA 1KFDA 1N9GB 2VKTA 3TJMA 5T14A 1Z15A 4AIRA 5CHGA 2Y05A 3LVQE 4WLOA 2R8EA 4X91A 4HLCA 3DBLB 2QI9C 4WACA 2JASA 1RI3A 1Y9JA