5ALJA

Ligand complex structure of soluble epoxide hydrolase
Total Genus 182
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
182
sequence length
546
structure length
523
Chain Sequence
TLRAAVFDLDGVLALPAVFGVLGRTEEALALPRGLLNDAFQKGGPEGATTRLMKGEITLSQWIPLMEENCRFSIKEIFDKAISARKINRPMLQAALMLRKKGFTTAILTNTWLDDRAERDGLAQLMCELKMHFDFLIESCQVGMVKPEPQIYKFLLDTLKASPSEVVFLDDIGANLKPARDLGMVTILVQDTDTALKELEKVTGIQLLNTPAPLPTSCNPSDMSHGYVTVKPRVRLHFVELGSGPAVCLCHGFPESWYSWRYQIPALAQAGYRVLAMDMKGYGESSAPPEIEEYCMEVLCKEMVTFLDKLGLSQAVFIGHDWGGMLVWYMALFYPERVRAVASLNTPFIPANPNMSPLEVFDYQLYFQEPGVAEAELEQNLSRTFKSLFRASDESVLVCEAGGLFVNSPEEPSLSRMVTEEEIQFYVQQFKKSGFRGPLNWYRNMERNWKWACKSLGRKILIPALMVTAEKDFVLVPQMSQHMEDWIPHLKRGHIEDCGHWTQMDKPTEVNQILIKWLDSDAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Successful Generation of Structural Information for Fragment-Based Drug Discovery.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords BIFUNCTIONAL EPOXIDE HYDROLASE 2
total genus 182
structure length 523
sequence length 546
ec nomenclature ec 3.1.3.76: Lipid-phosphate phosphatase.
pdb deposition date 2015-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 5aljA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 5aljA01
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5aljA03
4OPMA 5ALLA 3R09A 1CEXA 2HI0A 5HFNA 3HYSA 4MJ3A 3VXKA 5EI5A 3QM1A 2PU7A 1B6GA 1R9MA 3H04A 4G63A 4KJXA 5T4HA 3H2JA 3EQ9A 4MYDA 2YJ4A 3WA7A 2YBDA 4BNDA 4UHHA 1NX9A 1EK2A 3NRJA 3ZWKA 2CBGA 4C89A 3BF8A 2JAWA 4DWOA 4J0JA 2DHCA 2VT7A 3WYNA 2QT9A 5HQ3B 3OG9A 2FPWA 1XRLA 2O2GA 5I9IA 3F97A 1SCIA 3FVRA 1A88A 2IOFA 4UBOA 2RB5A 4ZI5A 1KU0A 1K8QA 1RMYA 1O6FA 4F21A 4JEIA 1VXRA 3O4IA 1YS2X 2OPHA 2JGIA 3W04A 2PUHA 1RC8A 1UFOA 4ZV9A 3C70A 3PE6A 1Z4MA 4KEAA 1YCDA 3LP5A 3Q8WA 3SKYA 3D2AA 2WF5A 4DLNA 2ZVDA 4LXHA 5EFZA 4Q3KA 3WZMA 4B0PA 5H3HA 4KE9A 4B85A 5AM5A 3DKRA 5AKXA 1Z4KA 2QVBA 4X6XA 3FYUB 2QS9A 3O0DA 2CFTA 3WIOA 5AW7A 4C4RA 3ZUPA 3QU4A 5T4FA 5AVSA 2PUJA 4AXBA 4E88A 1RKQA 2ROQA 4X6UA 5JAOA 5AKHA 1AMNA 2QLTA 4H7DA 3NASA 3V1LA 1XQWA 5IH7A 4AMYA 4FE3A 3ET5A 3FBWA 2VA9A 4ZV7A 2VJAA 5AW6A 3E1GA 1DWQA 1EHYA 1Z88A 2BFNA 2PSFA 1NNLA 2YY6A 3PI6A 3WI7A 3WMRA 3W5BA 1T9ZA 3I2IA 2QUBA 2JGLA 3DAOA 5C8ZA 1W52X 5DYYA 4MQMA 1UT6A 3FGOA 2OG1A 2WM2A 3AFIA 2WHEA 4FTWA 1U4NA 1GZ7A 2R8BA 5ALKA 3VAYA 3R41A 3WKAA 5IVKA 5AHXA 5HF8A 4A5SA 4E46A 2QXUA 4UHFA 2P9JA 3G7NA 3M3DA 4BTLA 1U2SA 1FFDA 2CN1A 1CUYA 4AZ0A 4A23A 2VTVA 3STTA 3R3VA 4C4SA 1GQRA 3H19A 1QIGA 4Y2UA 1LPSA 2OYCA 3FM9A 3QLEA 3WJ1A 5SYNA 2VF2A 3U7FB 2GYUA 2XUKA 1HKHA 5FUMA 1CUVA 5AOCA 5HCUA 4MYSA 4UAVA 3R4CA 3E0XA 5HZGA 1RYYA 2Z5GA 4NWIA 1PW5A 5CH5A 1PV1A 1CV2A 2AH5A 2JAOA 1WM1A 4EELA 2ZBGA 2C8KA 2DQZA 2BY4A 1LPPA 4HRYA 4QJBA 4YIKA 1C7JA 1OXMA 2VJBA 5AH0A 3P96A 4HGOA 2WF6A 3KWJA 3X3HA 3D5EA 5FOQA 4C01A 2OQVA 3N0TA 1QIMA 2X8BA 4WDRA 5KWIA 4KR0A 1YS1X 4W1SA 5HFAA 1RQNA 2XUJA 2W43A 1L8LA 3D6JA 4DGQA 1ZD3A 3PFBA 1UK9A 2H7CA 3M1YA 2YXPX 2HL6A 4HXGA 2B20A 3FYUC 4UBIA 5I7UA 4ZEVA 2XT0A 2PU5A 2C0PA 3UMJA 1GKLA 1FFCA 1MO2A 2I3DA 4N5IX 3WGVA 1PFQA 1XRQA 4XVCA 2OLEA 3FOBA 1XLWA 2BUAA 5D7BA 4BAZA 1XRPA 1L8OA 2JARA 3W9UA 2D5LA 2XUFA 2ZBFA 4BX2A 4L9AA 1LPBB 3QU5A 3STWA 3AIOA 4X3CA 3QPCA 4QQFA 4Y2QA 2WKWA 1P0QA 2PKEA 1LVHA 3MN1A 2JGKA 3ZWQA 1ODTC 4F71A 4UU0A 1WPRA 5A2GA 2HFKA 2OBBA 4MXDA 4QWWA 4EENA 1EB8A 1MN6A 1NU6A 4C4XA 1YMQA 4H7EA 4GDMA 4G1FA 4DCCA 3M9LA 3YASA 4OB8A 3MPOA 3G0IA 4HGNA 2D0DA 4W1QA 3WK7A 2WFZA 4DNFA 2HA3A 4Y7DA 2VAXA 4U2BA 4GW3A 2FJ0A 3GYGA 1UOOA 5CH8A 4I9GA 4PQEA 3B3QA 4IFTA 3G9ZA 1XZMA 2RBKA 5DNWA 2R8EA 2ZSHA 4RE5A 3QU2A 3HXKA 1EDBA 4F72A 5A7HA 1TCBA 1BU8A 3L8EA 5EHZA 3WK8A 4FLFA 2HA6A 4L57A 2O7RA 1RMTA 3C5WP 5AI5A 1P0IA 1VOTA 4WDQA 1Z4IA 2GHQA 4U2FA 1AC5A 3SC2A 3DOIA 4WCVA 1ZOLA 2OGTA 1KU6A 4KX3A 5FV4A 1CFJA 3U7GA 4JUIA 4B83A 1LPMA 3E3AA 3GELA 3TJMA 4KAAA 3U0VA 5CT9A 3N28A 4Q82A 5EHXA 5C7YA 1VE6A 1G4HA 3I6MA 5AJHA 3ESAA 5EIAA 1N8NA 3PUIA 4CIAA 4IG4A 4J0KA 4GIBA 1H2WA 1MX9A 4HGPA 1XZGA 2QYHA 3L8GA 3WKEA 1HQDA 4YCMA 4CCYA 2B0CA 2G07A 3FSGA 2G09A 3WKDA 4WY8A 3L7YA 3QITA 3KXPA 3UUFA 3WWEA 4TPKA 2O2IA 3WK4A 1AGYA 3OM8A 2ZYSA 1CR6A 2AJDA 1UOQA 2HADA 2HRQA 4FWBA 3WWDA 2P69A 4FBLA 4WY5A 3L8HA 1THGA 4GXNA 1DWOA 1TCCA 2XUIA 3DNMA 4WFKA 2JIDA 2XLBA 2IYEA 4AQDA 4XE5A 2PQ0A 1RLOA 3CCCA 5DTJA 2QOEA 5CH3A 3ZLTA 4HS9A 1QTIA 3RLIA 2YJ5A 1G5FA 5ALUA 4IO0A 1YSCA 5LZ7A 5AM3A 3G0GA 3HJUA 4LYDA 3QU9A 1Q0RA 4FHZA 1QQ7A 1Z4QA 2VT6A 1TA0A 3LIPA 3PF9A 2GYWA 4UBLA 1XZFA 1JJFA 2HA2A 3RKSA 3CN9A 4AS3A 4Q34A 1TJ5A 4WFJA 4Y2PA 3EQ8A 1CQZA 4N5HX 1SU4A 4U2EA 2V98A 5A71A 2C5GA 5A62A 3NGMA 3A2LA 1XZBA 1MPXA 2XDWA 2K2QB 3OURA 3GROA 4BEWA 3C43A 4DYHA 4DSZA 1SCKA 4KNWA 4U2CA 4YCNA 4X71A 4Y2VA 4K5QA 3QNMA 4GXTA 3BWVA 5AOBA 1EK1A 3WK5A 4BC0A 4Y3UA 5HKAA 3IUNA 1IUOA 5JASA 4PV7A 3A3YA 1J07A 3V1NA 2ACEA 2DFPA 1Z4PX 4J03A 4NZZA 4NMWA 1BCSA 3C8HA 4B9AA 1X2BA 4B7ZA 1TAHA 3G9XA 3JWEA 5FXMA 3HABA 1XRNA 4X00A 4W1RA 2QMQA 1GGVA 2HIHA 4GBGA 3SK0A 2HA5A 1RLMA 5SYMA 4BVKA 3F8SA 2HO4A 4C87A 1BE0A 4GI1A 5AVUA 4KACA 4UFPA 2HHAA 2XUOA 2ZJ6A 1WZCA 3QXGA 3WKBA 2XE4A 5AVZA 1S8OA 1Y8AA 5DJ5A 1TKRA 3EBLA 5AKKA 4Y2XA 4Q3OA 2XQKA 3AZOA 5AI8A 2WIGA 2NO5A 2HA7A 4I19A 5LZ4A 5LZ2A 4DM7A 2ZG6A 1YB7A 2FDRA 4FFVA 3MVEA 4E11A 2G4LA 5AK6A 1QZ3A 3U1TA 5EHNA 1TQHA 2XMSA 2OCLA 2GBCA 2WHPB 1MAHA 2YH2A 2PSDA 5ALQA 2JGEA 4B81A 1J97A 3I6YA 2WFMA 3QUTA 4Q1VA 3QPAA 4X90A 3SX4A 2CFRA 4F0JA 3NWOA 2YMMA 4G8CA 5CXXA 2GZRA 3TGLA 1CUDA 2WFAA 4XX1A 2PBLA 2BGNA 4KE7A 2XMRA 3IUQA 4UUQA 3OPXA 3OCXA 4P08A 2B1QA 5IT0A 1EB9A 4UU1A 4UPDA 2I55A 4P93A 1VA4A 2WIJA 3K2IA 4OU4A 2AXEA 3ZVNA 5ALGA 4UFOA 1TE2A 3GA7A 4RE6A 2HOQA 3ZTYA 3QYPA 4G4IA 3G0DA 5HF9A 3SHQA 4BCCA 5AKIA 2WJ6A 2EDAA 2RARA 1U2TA 3HZOA 3BDIA 4AO6A 2FI1A 3LLCA 3JW8A 5CBKA 3PCTA 3DL4A 1CLEA 3WL8A 3DYVA 2FUEA 3KD2A 3AUKA 4LXIA 3A1DA 1RKUA 1E8MA 1U7OA 1JT2A 2ACKA 4ZRDA 1LZKA 5EHQA 5FPQA 4G9GA 1W4LA 2B82A 5E4JA 4BKMA 1G42A 1QE3A 3G02A 4PF1A 1LPNA 2HU7A 4EY8A 2W6CX 1FSSA 3L1JA 1XFDA 2JEZA 2JF0A 1RLTA 3QYJA 2ZYHA 1AQ6A 1BEEA 1FEZA 3RARA 4KAJA 2IIVA 2JGAA 3G9UA 1Q92A 3WA6A 4UASA 2B8EA 5AW9A 3FCYA 3L5KA 1CUEA 5IVDA 1ISPA 5ALOA 1EDEA 2HU5A 1U2EA 3EF0A 2PKYX 5ISMA 3C45A 5C8VA 3KOOA 3FPSA 3U7HB 1O6GA 5HK8A 4BATA 1ODSA 4CIBA 5IS2A 2H7XA 1T5SA 5AW4A 3G0CA 3EWIA 4X97A 4BCDA 3HLKA 3ZV7A 2HU8A 1YJ5A 4K2AA 1LBSA 1ZJ5A 1L6RA 4S0XA 1CUBA 4HTAA 1L7QA 1MU0A 4DSAA 1BN6A 2WF7A 3STXA 5ALWA 3WK6A 5AK4A 1G66A 4KNVA 7YASA 2IOFK 1MNAA 4HRXA 2XMZA 1ZS9A 2C5FA 4ZXFA 2DHDA 3STUA 5FLKA 2PVSA 2W11A 4B6JA 4X94A 3N2ZB 3WWPA 2I6XA 2EDCA 1QFSA 4H7KA 4P9NA 4UM7A 2XMBA 2FUKA 3E84A 3I2KA 2DSNA 5DYWA 2OM6A 2RHTA 4K6HA 3AZPA 5IVHA 2G0AA 1QYIA 5LZ9A 1JKMA 3ESRA 1EXWA 3D0KA 2AJCA 4B0OA 4GHWA 4Q05A 5AIAA 4BX3A 3HRHA 1YAHA 1BCRA 1PJAA 1H2YA 5C81A 4AO7A 2XQGA 3LS2A 3R3ZA 3TEJA 3ESBA 3KDAA 4X6YA 1ZI9A 4J0IA 1MT3A 1H23A 2X76A 3L1UA 2EAUA 4J3JA 1C7IA 3WK9A 3I1YA 4H7HA 2WQZA 3R9KA 4BNDB 1BRTA 3ICWA 1QH9A 4QDZA 4PO3X 1ZD5A 3VISA 2Z3WA 3H2KA 2MU1A 3V1MA 1XRMA 5DNUA 4AX4A 4DMKA 4X7BA 4UBJA 3ONNA 5ALZA 2I3ZA 4BEVA 3I1IA 2WFLB 4DMFA 2WUFA 1XZHA 4BVLA 5AW5A 1IUNA 2C4HA 3R3UA 5AKYA 3UMCA 5ALRA 1NU8A 3RM3A 3C6BA 4GWLA 5IT4A 4BRSA 1I6WA 1A8QA 4G8DA 2BDEA 3H1BA 4EHBA 3FCXA 5E0OA 1SOMA 3ILSA 3FZQA 5AW2A 1AQLA 4EA6A 1FJ2A 4UBMA 3C8DA 4B9EA 5F4ZA 4BE4A 3DLTA 1NF2A 4BP8A 4OYLA 3I2FA 4U2DA 5A7GA 3VJKA 4NV0A 3KD3A 3KDPA 3WWOA 5CURA 3KZXA 3R3XA 1ZRNA 1MNQA 4OCZA 5JAHA 5AVTA 2FPXA 5I8PA 2PPLA 3K6KA 3ZPXA 1LGYA 3IURA 2H1IA 3BJRA 4OSEA 4PSUA 3FPBA 3GUUA 5AVQA 1U7PA 1L7NA 2G5PA 4CE6A 4FNGA 4AMZA 5K3EA 5A7FA 1IZ8A 4BAUA 4ETWA 4EY7A 2CKMA 1TIBA 2AGVA 1E8NA 3KSRA 3AINA 1IUPA 3FLBA 1R88A 1T2NA 5YASA 4FYPA 4UMFA 2QR5A 4XOUA 2ES4A 4C4TA 1Q91A 2GBFA 3KC2A 3VJLA 2X4DA 3AR4A 1J2EA 4RGYA 2FEAA 3J7TA 4XWGA 5CXUA 4BBZA 4MWOA 2FPRA 1K63A 1W75A 4Y2JA 4RETA 4RESA 1LNSA 1WCYA 3FLAA 4AB1A 5EIEA 3W9BA 4QLOA 4UMVA 3BIWA 4FMPA 2JGMA 2WJ4A 3D2CA 3QZUA 4NAVA 4ROTA 1VZ3A 3CNHA 1LZLA 4I3FA 2Z8ZA 2GMWA 1USWA 2FJPA 3IUJA 4V2IA 1XZEA 2R8ZA 1UOPA 2G06A 3R40A 5ALVA 3M81A 3DCNA 4KRYA 4OUKX 1TJ4A 4UMEA 2ZOSA 1YASA 2YYSA 1K6EA 1CUXA 1E5TA 4YGYA 4BCBA 4O8CA 3RK4A 3AJAA 1RQLA 2B4KA 2Y6VA 5AP9A 4LXGA 4CNQA 4BYGA 2ECFA 3B8EA 3IRUA 4UW9A 2WUEA 4OFZA 3C5VA 1MTZA 4BDTA 4J2TA 5AIBA 5CRIA 1UKCA 3IULA 3QMWA 1CPYA 2HM7A 1P0PA 4HGQA 1K1EA 3DYIA 2WTMA 5KBYA 5JARA 3ZI4A 4ZGBA 1XZJA 1ZIXA 2Q0XA 2GFHA 2WHQA 1UK8A 3H1AA 2V9ZA 4FFDA 1EH5A 1UK6A 3IBTA 4KRXA 4NFLA 2GBIA 1SCQA 3I2HA 1N1MA 2RI6A 3SLRA 1WB6A 3OCUA 4W1PA 1YA8A 1U65A 2O2XA 4UBKA 3OCYA 4EX6A 5JAUA 2Z8XA 1D07A 4P92A 3GZJA 4KN8A 3VKFA 4BP9A 2ZXEA 3NANA 2DHEA 2GBGA 2HF7A 5EIHA 2VAVA 1F0NA 3PF8A 4L6CA 3G8YA 1GPKA 4HXEB 1DX6A 1X2EA 5AVRA 1ZICA 4G5XA 5BWCA 2PR7A 4UARA 3V1KA 2EATA 1AUOA 3OC0A 3ZX4A 3OCZA 1ZIYA 3FNBA 3PGLA 2HA0A 1LTQA 4A16A 2ZYIA 1DQYA 1ORVA 3W5DA 1O03A 5JD4A 1SC9A 3PICA 3UUEA 1L7RA 4X95A 4L72A 1W6RA 5LLSA 4HGRA 3AR8A 4AZ3A 4J0GA 3UMBA 3W5CA 3BWXA 5BV7A 3KBBA 2BUCA 1MH9A 2FUCA 4FKBA 4CFSA 5J3JA 5AM2A 5HF5A 2AJBA 2Q4TA 5CMLA 2VJDA 4MEAA 4Y2TA 2BDUA 2OXEA 1QOZA 1XLVA 2VATA 4YPVA 1XKLA 2Y6UA 1ACJA 3O4JA 1GT6A 4NS4A 5HF6A 2DQSA 1VXOA 2IOHA 4OHFA 4M0FA 4Y2SA 3SKXA 4YH1A 4LIPD 4JB3A 2O2HA 1CUIA 1MX5A 2VJCA 4ARAA 2NW6A 2X5XA 1YR2A 1GPLA 3A2NA 3SMVA 4BTVA 5K3AA 2HDWA 3AIMA 2QRUA 5T4EA 4EZIA 4IH9A 2ORYA 1ZD2P 1W1IA 4BAGA 1ODCA 1JI3A 2D2VA 5JD6A 4AN0A 1UXOA 1GXSA 1VJ5A 4DTCA 2QJRA 3R0VA 1ETHA 4XJVA 1LBTA 2RONA 1QJ4A 5FPPA 4UFNA 1RKVA 2J3DA 1XVIA 3WJ2A 4I9FA 5BWBA 4KE6A 5AKEA 3NOXA 3L0BA 5AW3A 1YDFA 2Q5EA 2CB9A 4H77A 1RP1A 3RF6A 1DWPA 3IIIA 3NUZA 4U2GA 3N1UA 4MWTA 5AKJA 2XUDA 3M83A 2E3JA 4I4CA 5ALEA 5BOVA 4IH1A 1EVEA 3U19A 1R1DA 3N07A 4MUMA 4G9EA 4CCYB 1XQVA 2FPUA 5AO9A 5ALJA 1XZDA 4QZVA 5ALXA 3PGVA 1QFMA 2HA4A 1UZAA 3EIOA 3NAMA 3ED1A 2YFYA 2Y1KA 2MSNA 1CUHA 1E89A 2XMGA 5ALYA 3ANSA 3UM9A 3A70A 1QONA 4BC1A 1MX1A 2XMCA 4Q3LA 5AM1A 5AKGA 3O4HA 3OPMA 3L8FA 1R3DA 4UBNA 3C6YA 4EUSA 1N5MA 2Y2UA 3F9CA 3WYDA 4TGLA 2AJ8A 4IH4A 1CUCA 1UWCA 4AP9A 5DLPA 2EARA 1QO9A 1E3QA 5ALNA 4NABA 5DYTA 1BS9A 5FP0A 3ZI7A 5D3KA 4J0CA 1Z4LA 5LYYA 1OCEA 4EBBA 4N8SA 5ALPA 1O08A 1XZIA 5AM0A 1XZCA 1XLUA 5JADA 3AILA 2BUBA 3W2TA 2HSZA 4EEKA 1DT3A 1DX4A 2QUAA 1R4ZA 1ZGCA 1YNSA 5DWDA 3OTQA 4QNNA 5ALHA 1YV9A 3O9VA 1XP5A 4B84A 2DCMA 1CUUA 2WFLA 3DEAA 5K3FA 3I2JA 3ZVLA 3I6ZA 1TK3A 2XQIA 3BXPA 1SWVA 1L7OA 3HLTA 4JDPA 1ACLA 2C88A 5FRDA 1XROA 4UHCA 1UKAA 4RPCA 3BF7A 4PSDA 1X42A 1Y7IA 2NO4A 4FOLA 1A7UA 2XMDA 4M0MA 5K3DA 4C4YA 4PW0A 3RFUA 4WJLA 3CZ4A 3QUBA 5AOAA 2DQYA 1L7MA 3ED5A 5KREA 4B82A 3FVTA 4IQ4A 5ALMA 3DNPA 4AN1A 2JGFA 4FLEA 4QDUA 2HF2A 4YX9A 4XPZA 2JBWA 1CVLA 2HEGA 3HACA 2B8JA 4X93A 3TRDA 3ET4A 1GQSA 2ZYRA 5FDFA 3BDVA 1A8UA 4ZEXA 2J4CA 2CZQA 3K9BA 5AK5A 3IVMA 1VZ2A 3SF0A 1YB6A 2NYVA 5KWJA 4B80A 1N5RA 3PUHA 4BZZA 4C6HA 3CXUA 1ZD4A 5ALFA 3L0YA 2YJ3A 2WIFA 4EY4A 1CUWA 3WWCA 4Y2RA 3QUCA 3D2BA 4DIUA 1Z4OA 3FYUA 1QQ6A 3EQ7A 4YIHA 3O4GA 1FFEA 1QLWA 4E15A 4HAIA 4BZWA 3FVVA 3DQZA 5AW0A 4BVJA 2RAVA 1YAJA 4N8DA 3PFCA 2WUGA 2O9JA 1QGED 3HC7A 1Z4JA 4EY6A 1K5PA 3EPRA 1GPNA 2I03A 2QM0A 3ESDA 1H22A 1R50A 4CCWA 3ESQA 3ZTWA 5LKAA 2ZBEA 3CCBA 4X91A 2I33A 4K6GA 3HYCA 1P0MA 3WZLA 5AVVA 1NRWA 3MUNA 4QEKA 3QPDA 2WM8A 4C4ZA 4EY5A 2CFSA 1U8EA 2WIKA 1ZOIA 5E4TA 1BEZA 3WL6A 5HQ3A 3SD7A 1EDDA 4CF5A 1QIFA 3I28A 4BBJA 2XUAA 1VE7A 4MEBA 4LHEA 5D6OA 3VJMA 1EVQA 3ZU6A 3OOSA 3A1EA 5AICA 1LPOA 2MU2A 3F67A 5K3CA 1XQYA 2WSLA 2OGZA 4Z49A 4G4GA 1XKTA 2PM8A 3E81A 3EF1A 4Y2YA 3ZLUA 2WLSA 5AM4A 1N9KA 1VA5A 1H2ZA 3QH4A 1JMYA 1WOMA 5IVIA 2YASA 2B30A 1EI9A 2I7DA 1XZLA 5CTAA 5JZ9A 3A1CA 3WLAA 2Y2VA 3LCRA 2HRRA 1QIHA 1VKHA 4ITVA 4K6KA 1F0PA 1BROA 1KYTA 1TRHA 2AMYA 5CT4A 1QO7A 1YS9A 4BDSA 1CUFA 1R9NA 2ZJ7A 3W05A 4BYMA 1AURA 5AI0A 3D4LA 4X92A 2YJ6A 2VSQA 4WFIA 4JNCA 4MQLA 4L6AA 3VVMA 3L1HA 3STYA 1CUAA 1Z68A 3Q0TA 4X85A 1DQZA 2C58A 4KE8A 3QMVA 4QDTA 4TVKA 1LPAB 1IWOA 2BGRA 2J3QA 2QJWA 2G1AA 3L0CA 5JJBA 3V9AA 1DINA 2W22A 2OA0A 1QIEA 1BN7A 1EA5A 1ZI6A 3B5EA 4CG1A 4XIIA 4Y9SA 3ANTA 1QTRA 3T52A 4DW8A 2XLCA 5LZ8A 1L7AA 3E4DA 5CT6A 1JFRA 5ALIA 1UKBA 4UHBA 2IA5A 1QIDA 2HDOA 5A3SA 3GFFA 1J06A 2YN4A 2J4FA 3IB3A 4KYTA 3A6ZA 3EF3A 2RGUA 4W63A 2HCFA 4HZGA 3DDHA 4D9JA 2HFJA 2XI4A 5K3FB 1QIKA 3I2GA 3FWHA 2I54A 1QIIA 5ALDA 3M82A 1W76A 3AIKA 2WF9A 3MC1A 1QQ5A 4EB0A 4BRZA 1GKKA 3DD5A 2C8LA 1OILA 3S8YA 5LZ5A 4XQ0A 3MGAA 3H2HA 3PDCA 1FFAA 1Z4NA 4HVTA 1F5SA 3QBJA 5JATA 4UHDA 1S2OA 4QE3A 1VJRA 5T4BA 3U26A 2YMPA 1ZRMA 4BE9A 4OD0A 1RRCA 2H7YA 3WIBA 3U7EB 4HYTA 1CRLA 4M0EA 5A6VA 6YASA 2WUDA 5AKLA 3I76A 5AVXA 2QKYA 2CEKA 2WJ3A 5ALTA 1CIJA 1EX9A 4QDOA 1T5TA 1J8DA 3T4UA 1CUJA 4ARBA 2IITA 3AR2A 1UK7A 3TLMA 4H7JA 4EZEA 4YK7A 4JH0A 1T4MA 1ZGBA 4L0CA 5CW2A 1ORWA 4INZA 1RWQA 4FBMA 2WILA 1Z5UA 4ZREA 1JJBA 3IJ5A 1IMJA 2GYVA 2FPSA 1X70A 4NVRA 2XQJA 1L7PA 3BE8A 3FAKA 2FX5A 4QLAA 5EGNA 5CT5A 2V97A 3S2ZA 4OYYA 3H17A 2QXTA 3E58A 3ICVA 3PDWA 2ONCA 3I6BA 5C8XA 2ZSIA 1RDFA 3N8GA 3H2IA 4DMCA 1TCAA 3WKCA 3ZX5A 3VDXA 2P11A 2JAUA 1CUSA 3NUQA 3ZVMA 2C9MA 1H2XA 4CF3A 3B9BA 2PX6A 4QWMA 5JANA 3C87A 2WHPA 3AR6A 4CG2A 3DDUA 3R3WA 3BJMA 3ZWDA 3O95A 3H0CA 1JU3A 1SFRA 5JZSA 2Q4RA 4F60A 2CMFA 2Z3ZA 1Q84A 3W06A 5AKZA 1EINA 3H2GA 3UMGA 5IKXA 2P8SA 1XPJA 2XUGA 2AUTA 1U02A 4L3WA 5JAPA 1WPGA 4LYEA 4O08A 1C4XA 4W9RA 1B41A 4BX0A 3DOHA 5K5EA 5K3BA 1E8DA 3WGUA 5AVYA 2EEPA 3WL5A 4CI9A 3WQHA 3D7RA 1WHSA 3E8MA 5D3ZA 3NALA 2XQFA 4ZWNA 2R8YA 2WHRA 2OCKA 4IHAA 2R8XA 5CT8A 2DR0A 1RPZA 2H9YA 2RAUA 4CF4A 2BJHA 2BKLA 4G4JA 5A3QA 2C0QA 5E4YA 3C6ZA 3MUOA 2OGSA 2WG2A 3SWWA 2RHWA 5ESRA 4UM5A 4DMHA 2VEOA 2VQ6A 2BAGA 2HX1A 2OAEA 5AW1A 2PSHA 3FSGD 4KYVA 2XMQA 2HHLA 1HDEA 2OQIA 2PSEA 3ZLVA 4H1WA 4KAFA 3H18A 3P2MA 2W4MA 5AI6A 3IA2A 2WF8A 4YASA 1JU4A 5FKJA 3F98A 1N8SA 3IB6A 3FLEA 3D59A 2GO7A 3MMZA 3AZQA 1IZ7A 4BB0A 5JD5A 4GECA 3DL7A 1K4YA 1JMKC 4EX7A 3U13A 3CN7A 1HBJA 2B1RA 2B9VA 3DV9A 4FDMA 2G5TA 2JGJA 5AW8A 5DNVA 1THTA 3N5KA 3NIWA 2I78A 5JZBA 1M33A 3GBSA 3G9TA 3G0BA 5JALA 2C7BA 2ZBDA 3VVLA 2GHTA 4ZEWA 4GLBA 2YMLA 3JYHA 2CUTA 3QGMA 2WG1A 3DJYA 4H0CA 4F5ZA 2PSJA 1MJ5A 3BIXA 2QTBA 3B12A 4AO8A 4HXFB 1Z5GA 1HLGA 2G08A 4UHEA 5AI9A 1A8SA 1VLQA 2XUQA 1WR8A 4N8EA 5HK9A 2AJLI 5ALSA 3HI4A 4PNZA 3V48A 2I34A 5E2IA 3DS8A 1HPLA 4FFWA 2OCGA 3F9RA 2WTNA 1MAAA 4QA9A 1ZJ4A 2ODAA 2V96A 5LP1A 3OCWA 1TJ3A 3IUMA 2C4NA 3AR7A 3O9MA 1CQWA 1VFPA 3D3NA 4JYPA 4DNPA 3WL7A 1CUZA 1QIJA 1WHTA 4AS2A 1ZI8A 2WG0A 3QMMA 2YMQA 3QUQA 4B6GA 2GZSA 2P27A 5A3RA 1DTEA 4CG3A 3OCVA 2QZPA 4PSCA 5T41A 2BCEA 2G63A 3W5AA 4G8BA 5LIPA 4JYMA 3BA6A 1SWWA 1DT5A 1JJIA 1HL7A 1XZAA 4OU5A 3ESCA 2PL5A 4LKOA 1Y37A 4QDXA 4RNCA 2WIDA 4MWSA 4GEGA 1WB5A 2OCIA 4FLMA 3HSSA 4UAUA 4PNHA 4OB7A 2VKQA 5JYCA 2OAGA 2XUHA 3LIIA 1FFBA 3DKKA 4YCLA 1WVIA 1Q83A 4E14A 4H18A 5JIBA 3HEAA 1WB4A 1DU4A 5AI4A 3C6XA 1JUDA 1AZWA 1F6WA 3R3YA 4DNOA 3FYTA 4UMDA 4H7IA 3L1IA 1Y7HA 1CUGA 1KEZA 1XRRA 5HKBA 2ZJFA 3AR3A 4DNQA 4DFDA 2G80A 1AX9A 2WU4A 2IX9A 3AR5A 3QX7A 1RMQA 4H35A 4OB6A 4UATA 2LIPA 3L1VA 3ZW7A 3BL8A 3KWFA 1IVYA 2UZ0A 2R11A 3S6JA 2JEYA 1ZJJA 1YA4A 2O7VA 4H7FA 3B9RA 3F96A 1XQXA 4C88A 4KX5A 2WU3A 2RIPA 1XZKA 3IDAA 4J0DA 4J0HA 3QU7A 1AKNA 5AVWA 3K1ZA 3QVMA 1WPXA 3STVA 3A2MA 4FNMA 4G9BA 5AESA 1F8UA 1E66A 5DTIA 1LLFA 1J1IA 2XB6A 5LKRA 4J7AA 2CJPA 2B61A 2XUPA 5AK3A 3AR9A 1Q0ZA
chains in the Genus database with same CATH superfamily
2IHZA 1M6EX 2V5AA 4EL5A 5ALLA 3D3WB 4DSKA 3MMPA 2PG3A 3OMWA 4Q1CA 4J4TA 3BILA 2X7XA 4HDKA 621PA 3EMBA 4EOGA 3X1MA 1Z0IA 3C3WA 3Q6NA 5A1JA 3QM1A 4ND4A 5B3JC 1QRSA 3K9QO 4MPRA 3RYFA 2JGDB 4EAQA 3RODA 4KBFA 2VCEA 4A1OA 1NXPA 5F51A 2JANA 1LXCA 1Z34A 2PA0A 3KWLA 3EC7A 4QVGA 2ZXIA 1D2CA 3KE8A 1TYCA 4MOWA 3EQ9A 4KVZA 3VI4B 3U4QA 1DKRA 4YB8A 4BNDA 2V7UA 4UHHA 3QA3E 3KX2A 1EK2A 1EXDA 3HGQA 5KG5A 5DBCA 2XY6A 3NT5A 1XXLA 3BF8A 2G88A 2PZMA 1FDWA 2ZB3A 5K8CA 5KOYA 4AKHA 1XMJA 4Z9YA 2G77B 5J5VA 4M9QA 3GCXA 3IKVA 3I58A 1RYDA 2OFWA 1C4WA 3M1LA 1M34E 3O7WA 5IINA 2QT9A 5J4LA 4WNAA 4JK1A 2B9EA 3T5JA 1NW9B 5IUJC 2C7QA 3E48A 2NV2B 1K75A 4R2IA 1ORRA 1VC2A 2EANA 5A4AA 9ICEA 1MXFA 2GCOA 1OOEA 3I9MA 4HH3C 4UD6A 5I9IA 5KO2A 5B66U 2ZTCA 1SCIA 1W94A 1Y9ZA 2XJ9A 1EGQA 3NGXA 2LM4A 1HDRA 2DY0A 3IQXA 1NYQA 2H52A 3HPRA 3K0CC 2RB5A 3LJKA 4Q4HA 1FLVA 2AQ0A 1ONPA 2NP7A 4CMJA 1LI7A 1QX4A 3M6VA 3OPYI 5H70A 4CRXA 1LKZA 1TB4A 2PO5A 1L4FA 1RRVA 1XCBA 1O6FA 2QL9A 3GJ0A 3NG1A 3Q0EA 4L51A 4ZYLA 1JFSA 4PN7A 1J23A 4PQRA 2H4YA 5KSWB 1VXRA 1P2GA 2Q2QA 3V42A 1C9NA 2X14A 1ZHHA 2NSLA 5KYXB 3NEAA 1EQ2A 3PGA1 5FBRB 3ZIAD 4HWTA 4Q7JB 1SZHA 1FFYA 1RC8A 1UFOA 3DR5A 3M6WA 5EJ6A 1DC3A 2EZ8A 4N12A 4BMCA 2KFZA 4B4WA 3M8KA 2DZDA 3LP5A 1UPHA 3V2GA 1GPYA 1J8YF 2QGFA 1NR5A 5KYWA 3D2AA 4WE3A 5FWDA 4D99A 1N7GA 4LXHA 5LQMA 2IXEA 3C6QA 1F2TB 4Q3KA 4WVFA 2DFKB 4IDHA 1QR2A 3VZBA 4YLYA 1WXIA 1S5LU 2WD9A 4E3ZA 5JXWA 4M37A 5AKXA 2F8SA 3I4LA 4YAWA 2P5YA 2QS9A 1F2DA 3K0CA 2UXDB 3FE2A 4I3GA 4N5LA 3UBMA 5LA6F 3AO0B 2QPTA 2YNMA 3OIVA 3VM6A 3JWPA 4ZMBA 4QFMA 1OC4A 2AG1A 4PHAA 4C4RA 2E21A 3NH6A 4PLFA 4TUYA 1FTSA 4ZJPA 4PHEA 5A4IS 2J45A 2PUJA 2PFOA 1UBMS 4UCWA 1B6SA 4YROA 3ISBA 2IYXA 3VAAA 2QXYA 3ANMA 3PEEA 3JD0A 4YCAA 4DHEA 1E69A 4H7DA 1F1BA 2G28A 2WM9B 4OLFA 3HFSA 2IU6A 3FCSB 3HJTA 1KH1A 1ZBDA 2B2XA 4XRRA 3V1LA 3Q7TA 4TYNA 2ZUCA 1PNRA 1Z7BA 4TWAA 5I7WA 4WIAA 4BGVA 2AUNA 3DTYA 3TN7A 1F8YA 1X8LA 3KZOA 1H4VB 3Q3CA 3WLLA 1Q0SA 4J29A 1EFLA 4DMLA 4ESHA 4RK4A 1RJWA 2HMVA 2QVLA 2VJAA 3MWEB 3OZSA 5JMPA 2X8AA 5AW6A 3V6KA 5JJ5A 4DG5A 4H0FA 5KFFA 2WJZB 3NRBA 3P0RA 4EFMA 2EW2A 2YJGA 3I5XA 2CV0A 3G89A 4C6RA 2AMVA 3INNA 1NP3A 3CH6A 1RABA 2ERCA 2IYFA 1M3SA 2H1RA 2NQ2C 2Q27A 3NW9A 4LZOA 3OPYA 1BJKA 3RJEA 1MX3A 4I28A 2YY6A 5A2QA 1DTWA 3DO8A 1R4NB 1CETA 3KELA 4MV9A 3DAOA 3P2JA 4ENSA 5C8ZA 5DYYA 4CKEA 1Z0SA 1KQGA 2PL1A 1UT6A 4G24A 5CX4A 2P9YA 3CINA 3TX2A 2F8KA 4P8RA 3GQCA 4DLGA 1E60A 3AFIA 4W5JA 3IUPA 1Q77A 5B53A 1U4NA 1GZ7A 2R8BA 2ZRNA 1F6BA 3LQRA 4IAOA 4J90A 3TLAA 1BD3A 1H05A 4WKPA 1UJCA 2AR0A 3VAYA 3CRXA 1XC9A 2QENA 2XRYA 4EUNA 5JFOA 1E7QA 2ZRLA 4A5SA 4E46A 1MSWD 4K6GA 5K09A 5IPFA 3GRRA 1OGIA 1N3YA 3E1KA 2QXUA 3P32A 2C84A 3G7NA 3M3DA 4E1BA 4I2EA 4LPKA 4ETIA 2WYIA 1SIJA 5IUKC 2W7TA 2RGEA 1GILA 3LYLA 1NI3A 2WMYA 1EM8A 4P3XA 5CM9C 3RK0A 4A23A 1AKQA 4ZU1X 5IF3A 2ZI5A 5BUCA 2BDPA 3ITNA 3R3VA 3JZFA 4EFLA 3H19A 4TXNA 1SKRA 1ZK4A 2FSPA 3LQFA 4DIEA 1U8YA 2I71A 5L3SB 4RPJA 1LPSA 3TINA 3FM9A 3QLEA 4ZDIA 4J3NA 3U56A 5ETJA 4LGVA 1YR3A 2MCFA 2QN8A 4PONA 2ADOA 2FX2A 2R5WA 2XUKA 3D8NA 3I05A 2LKYA 2ZB2A 4IUDS 2XRMA 4Q7LA 1HKHA 2DKFA 3BMXA 1C0PA 2IHJA 4WACA 3UMRA 4XOIA 1LQTA 3MJSA 3MQFA 3ZVKA 1NMEA 2O1EA 4UAVA 3LQYA 1YQUA 3PYLA 1EHIA 1EVYA 5DLEA 3IEMA 1Z3EB 3W0LB 3BEDA 3PWTA 3UW1A 4J1QA 2AXTU 2ZB4A 4NAUA 1GUDA 1DCKA 1O4VA 3PQ2A 4N65A 2ZTUA 1WZUA 3CW9A 2GQ0A 1BGXT 2XAUA 3H0RB 1FJXA 1H8ED 5J0RA 1EJ6A 1CKEA 5AXAA 4F8EA 2VPZA 1PT5A 2C8KA 3ZWBA 1D03A 2BY4A 4RPIA 4DCJA 1ZAKA 3L6RA 3LKBA 4C8MA 1GRCA 1IB6A 3M1AA 5SZIA 2R8KA 1A5BB 4D41A 1UMDA 5KG6A 2NZXA 4UD2A 1LDGA 4YRSA 2WF6A 1U3GA 3KWJA 4I50F 3X3HA 3D5EA 2CJXA 5F1PA 1KE1A 4C01A 1PFKA 4EB8A 1VPWA 1V8FA 2B1GA 3N0TA 4IJMA 2HT6A 5TVKA 3L7AA 4KR0A 1YS1X 2JHAA 4IQUA 4C04A 2JGNA 4CU2A 3HX0A 3GUHA 2ZUBA 3OESA 1J5PA 1DGJA 4O4JF 4QC2A 4GM1A 4BLSA 4GKBA 1FQJA 2XGPA 3VKWA 2HRZA 3D3QA 1L2TA 3PXCX 4TTAA 1NL3A 4L8GA 3M1YA 2I1VB 3QKUA 4Z8YA 9ICTA 1Y9DA 2OD2A 4ZPXA 1J70A 5KI6A 3PXDA 3FYUC 4RORA 1D4ZA 4EFNA 4X8MA 3GLFA 3CRMA 3AESA 3AF2A 3OIWA 3UUWA 5C53B 4NH0A 1QVVA 4KXUA 2GGSA 5I7UA 2C2BA 4OLAA 3ZBQA 2GERA 4Z3KA 1CP2A 1Y1RA 4OGLA 5CDFA 4C0QC 4E09A 3UMJA 3PLAE 2V8OA 5KNDD 4N5IX 2V54A 2FZEA 3KHGA 1MW9X 1PFQA 3PQ6A 1DJMA 2OLEA 3FOBA 2QRVA 4O2AB 4RSGA 1V16A 1Z6GA 2KLHA 2G70A 4JS0A 2VJMA 3VSDA 2BUAA 1IN8A 1R27A 1WEHA 2G9ZA 2KWIA 2X9VA 3KLOA 4L7QA 4DBLE 5HVNA 1AF7A 1M54A 3FBGA 2E89A 3OO0A 3KQWA 1S0UA 3HFJA 1JBEA 4GKVA 3T7EA 1W35A 2GZAA 5CEJA 3UKJA 1HJPA 4QZDA 2XUFA 3DPUA 3KQTA 4PYKA 1OH6A 4LI0A 2PMKA 3QNUA 4L2IA 4CETA 4CQMD 1LPBB 4KMOA 4UZFA 1WPQA 2C5BA 1JALA 1X80A 2YZMA 3LF1A 4FKZA 3P0HA 1XKQA 3COZA 3MN1A 4ER6A 2QTVB 3BHNA 4HH1A 2RHFA 2PIAA 1WPRA 1ZSVA 2W00A 4ZVRA 2OBBA 2FXVA 5EKXA 1U04A 3A9CA 4QWWA 5KFTA 4O4LF 4L0QA 4YYZA 1TW3A 3MNFA 3NRZA 3LUKA 4MITA 4UQOA 3SYTA 2AFRA 3V2HA 3G23A 1YMQA 1Z39A 5F73A 2BR0A 2WYWA 4OIFA 4RD4A 4ZJZA 1DJLA 4KLGA 1KAEA 2DKNA 4DCCA 3M9LA 4HJRA 4OB8A 4OK3A 4TMFA 3YASA 3G0IA 3TZBA 2BJVA 3F6EX 5TRTA 4L9RA 1DAOA 1PHRA 1M2EA 2D0DA 3PJGA 3WK7A 4LSMA 3I62A 1B1CA 2OORA 1L5KA 2W58A 3T06B 2MSCB 4J4BA 3EC1A 3BORA 2WD7A 3PD0A 1L5HA 4E22A 4Y7DA 1RYSA 2VAXA 5EMKA 1NQ5A 1QH0A 1JAXA 2WA1A 3MYRA 2ZIXB 1TNDA 3L49A 4EKDA 1SHKA 4FN5A 1IXZA 1N3IA 2F2TA 4C7ZA 2WHXA 4PSKA 4PZEA 3ROKA 5EP4A 2CK3D 3G9ZA 4F6LA 3T5AA 5CEFA 3G9QA 3UPTA 1ZCZA 4DBVO 5IIOA 1PQYA 4UQLA 1E98A 4BQRA 1E4EA 3R9IA 4RE5A 2X8JA 2ONYA 1EGMB 1ZL2A 3JR3A 3S2UA 4G8JA 5LQCA 3OPQA 4D3ZA 1TQDA 2Q2OA 4MWGA 2OO7A 3QFTA 2BM9A 2ZJ4A 1V7CA 1Y3BE 3FN4A 2BCUA 2QUKA 3O91A 5GVRA 2H2WA 4BVHA 3KQUA 4B9LA 4KN4A 2C9BA 1KZHA 3VC7A 3HP6A 4CIYA 4PGMA 4ALMA 2ZQYA 1U7WA 1EP9A 3OICA 3F5EA 2D3WA 1RMTA 2OV2A 2WWGA 3EQ6A 4F8RA 1P0IA 2GCIA 5KFXA 2OHJA 3KHLA 4PCAA 1RZUA 2Z1DA 3DPIA 2ZSKA 4E7OA 5KNBD 4D25A 3SI7A 1AZLA 1OH7A 5D8DA 3QZ8A 2FWPA 1D4OA 1GT91 1Z4IA 4P32A 4DQ0A 4US8A 1EIWA 1KERA 3LQ1A 3DOIA 1N77A 3C5CA 1H2AS 1NURA 4BV9A 1C14A 3ELDA 4OBXA 1YQDA 1IXRA 2BR5A 4GVLA 1P81A 4AZ3B 1K3TA 1V4BA 2IF0A 2G5IB 1M2VA 3H8VA 2YHBA 2AG5A 1LPMA 3PP8A 3ZXUB 4CMGA 4LCBA 5K0NA 5HUJA 4QL3A 2P6RA 4DL5A 1Z36A 1ZUIA 2OMEA 3LM8A 3N74A 5JY6A 1JL3A 1G4HA 1G5QA 1KMHB 1PJZA 1LWNA 1T26A 2AFIA 2HPHA 1DIRA 3GD7A 5HFJA 5IIKA 3N7UA 1IN1A 3PO4A 3OQIB 2DAPA 3KPVA 3TJZA 5LBUA 3PITA 4IXDA 1T1IA 3L05A 1X8JA 3EISA 2R00C 4FGWA 4A2QA 2I8LA 3K4QA 3NGLA 4JKIA 1U7XA 2AJQA 2MHCA 4FUTA 4DCGA 4KFTA 1PL8A 2BR3A 4JGIA 1IN5A 4KWEA 4HQNA 4MW0A 1BG6A 4U7DA 3DONA 1CNEA 4JVLA 5JQGA 1MG5A 2UUAB 2A1UA 4WXPA 1RIFA 4CCYA 3P9NA 1JEJA 3K5WA 2OECA 1CULC 3SYMA 3OQPA 1PX2A 1LI5A 3W34A 2W9AA 2PV7A 3PR5B 3GNTA 2ZYAA 3L7YA 4BMZA 1JHOA 2XVXA 4LVOA 5DMHA 1UKEA 4DQVA 3SQIA 1I7QB 4O4HA 3KXPA 4LUCA 3SEFA 3UUFA 3WWEA 4D0RA 2R00A 3TBHA 2BE7A 3X0DA 3MLAA 5B7GA 5JXGA 5LLTA 1L5WA 3WK4A 1UPXA 3DGEC 3Q6MA 2O06A 2HOFA 5E1OA 4GVPA 1GDDA 4O9MA 1E2NA 1II9A 2IBMA 1CR6A 3I9FA 3KVVA 2AL7A 5TDHA 1L3CA 3GT3A 1PYGA 2HADA 3BSFA 2R62A 3GJ5A 2P69A 2W83A 4FWBA 3DCYA 4KO4S 4MZXA 4W9NC 3WWDA 1E79A 3R24A 3LXMA 4IHQA 3E2EA 1T8SA 1W19A 3SIPA 4D4IA 3KJQA 3A9RA 1DWOA 2DQ4A 3KTAB 2XUIA 2UV8A 3A9SA 2XLBA 4GXNA 4JVOA 2BBSA 4WFKA 5FFMA 5C52B 5K8UA 2IYEA 3HYNA 3JWIA 3L43A 4UBBA 2PQ0A 4M54A 3CCCA 5DTJA 4AQDA 4YR3A 3ON5A 3E0FA 3NDRA 4OYRA 1SHZA 3NAQA 4PLTA 3EAQA 5CH3A 1TM4E 1Z73A 4GMXA 1G5FA 3UY4A 5CFOA 5ALUA 2A1UB 3IP6A 1YZHA 5LZ7A 2EAOA 3TZKA 1JMVA 3DHEA 2B25A 4GMFA 3AG6A 2EKLA 3ETCA 1RSZA 5FORA 1UDWA 2P65A 4URFA 3S3TA 3B1YA 1PTKA 5HZKA 1YR6A 3TUIC 2RHGB 2GAIA 3W6NA 3GRAA 1AKMA 4U5QA 1NUHA 1Q0RA 3OP4A 3D7SA 3SZLA 3REQB 2ZDQA 1V3VA 2A86A 2AXQA 4UBLA 1L5OA 3BGWA 4CCSA 4Q7KA 3EXHA 4DF3A 4X84A 3V7NA 1XZFA 1GGNA 2OC9A 1QF6A 3ZKAA 1Z3CA 3RKSA 5HMLA 3CN9A 4YHHB 2EXXA 3SGLA 5GIPE 3FHOA 1WDMA 3LX8A 9ICSA 1O87A 4JYZA 1B43A 1YFZA 2WTAA 2AC4A 2GA9A 3MHTA 3UG6A 2IUSA 5ESWA 5DBAA 2YB1A 3HM2A 5CCEA 5I6DA 4RMIA 5BRAA 3VZDA 2I3BA 3EY9A 3OECA 4IIEA 4ZAZA 2I9KA 5D1HA 4O2RA 2KG5A 5FTKA 4D8VA 3LPCA 4ESVA 2QJOA 3EJWA 1TO1E 5CNKA 4RVHA 4H1TA 2C5GA 5A71A 2IU0A 8ICPA 2P9TA 4JUBA 4EF5A 1QC5B 1ES9A 4ZCLA 5COBA 1MPXA 1WS6A 4G56A 4XSVA 4Q1DA 7ICHA 3Q12A 4OO3A 4DT1B 4ZC1A 2PFQA 3HJAA 5D85A 4R7GA 1J21A 3VR1A 3N39C 2OXIA 2PVPA 4ZVLA 4DYHA 1SCDA 4MYHA 2WT8A 3IAUA 4P35A 2QE6A 2LPEA 5KWSA 1SCKA 4FFOA 3PR2B 1P9LA 1MEJA 5TISU 1VPEA 2ID8A 3EEFA 2JMGA 4YCNA 1TZCA 4AMUA 1OZ0A 4GXTA 1HYGA 1G6HA 3IERA 4G3XA 4YC7A 3IE2A 2JI8A 3IJPA 1I10A 1F60A 3WK5A 3KPYA 4LVUA 4CM7A 1LF5A 4RULA 1NNUA 5DKWA 4MWCA 1B0AA 4WLEA 3AETB 4RU1A 3IUNA 1IUOA 4XAQA 4PV7A 3WYBA 3B2NA 1VRWA 1Z62A 2O7SA 3OUZA 3V1NA 3HH8A 3NHJA 2DFPA 4EBCA 4PRLA 3RAGA 3HJGA 3N86A 2G0NA 4Q93A 4NMWA 3GP3A 3C8HA 4O4LA 1SV0A 4B9AA 5BQPA 1X7WA 2ID7A 3CW2A 1WCNA 5H8WA 4RQ7A 2LTAA 2ZTSA 2KK0A 1ETUA 4BO3A 4NBUA 1U0RA 1YGPA 3HU2A 2EBHX 4EPWA 5CYOA 1K4MA 1PJRA 2B4RO 4X00A 1PFGA 2OC4A 3IP7A 3S40A 2BRUC 4YEDA 2KB0A 2WWFA 1GGVA 3RV4A 2HHXA 2C1EA 2ZSJA 4QLBA 1H9CA 4R69A 4R98A 2BOVA 3QVJA 3JYQA 3SK0A 4NLKA 4ZEMA 2C98A 3M49A 3TOSA 3H0MB 5SYMA 2PLRA 4L72A 2LCIA 2BFCB 3RAPR 3PQCA 3EARA 3F4BA 1JNYA 4XUGB 4AM8A 1BPBA 5JRDS 5EJ7A 4C87A 4PHHA 2SKEA 5DTQA 4DRZA 3D0OA 2ZSUA 1G3UA 4YFVA 1H38A 1IIRA 2K8CB 2DVMA 4JI0B 3ADDA 5HRAA 3OIFA 5DM1A 2WYVA 1FA9A 1W9HA 2AB0A 2D7CA 2PGNA 4DLLA 1KFEB 5LR6A 3GEMA 5GZ3A 2Q8NA 4Q4JB 4BMVA 4CN8A 2PTHA 1S8OA 1Y8AA 5DJ5A 2B5WA 2VHVA 1TKRA 4GFDA 4N7JA 3D2NA 4OQXA 1OI2A 4JYAB 4Y2XA 2AQ8A 2DY1A 1CHNA 3GLIB 2BSQA 1UBGA 1CYDA 1X1EA 5DXAA 3HG7A 4NBVA 4NXNB 1S2MA 4ZAWA 2CXHA 5AI8A 3TSYA 5KSYA 4I19A 2HA7A 5CNMA 5LDGA 2VJLA 2EVWX 3F3MA 1ZFNA 4EATA 4A0SA 1D8YA 3FYHA 2FMIA 2ZG6A 4C3ZA 5G4KA 2HR1A 2OV4A 2FDRA 2XCLA 3MR2A 4YQYA 1NSYA 3VTKA 2EV9A 1QZ3A 2IIBA 4DQIA 5EHNA 3SC6A 1CD5A 1M7BA 1N2EA 2D1SA 1TQHA 2A19A 4DOMA 4EGSA 2YB4A 4HG2A 1M2GA 3HNOA 2NT3A 3BB1A 1PBNA 2OCLA 3GLRA 3FF1A 3C4VA 1XD8A 3EXHB 2YH2A 4NCBA 1AS0A 2ASDA 3N0XA 5EJMA 4I46A 3SIRA 4W5NA 3I6YA 2B7CA 2R2AA 4Q1VA 3ROZA 3SX4A 3O7MA 2A1IA 2ZYTX 3OU7A 4JSTA 3F2VA 4BP1A 5TMPA 3CRNA 1V35A 5P8WA 4LXUA 4IZOA 4ZN6A 1RYHA 4G8CA 2VZLA 5DQGA 3NKFA 1UJNA 5CXXA 3OQNA 1T3QA 2GZRA 3CLTD 4NJMB 1H93A 1CUDA 2TMYA 3PUWA 4QUEA 1QHEA 3LQQA 1GUZA 1BCRB 1CJVC 2XMRA 1SPBS 3QI2A 3IUQA 4WXHA 1U47A 4XIGS 4DLVA 4EEXA 4YV1A 1EDZA 1KH3A 1IOVA 3OCXA 1R8JA 4XJTA 1ZQ1C 1XQ6A 2GJSA 3FJOA 3BXGA 2PZJA 3HR8A 3OCCA 2IU4A 1W36C 4DFJA 4PY2A 1IYZA 1ST2A 3EVCA 3NHRA 1PJQA 1VA4A 4P93A 4K4IA 1KBUA 4UBCA 1UEIA 3HZZA 3HKCA 3JTEA 5ALGA 4BJQA 3WNQA 1YF3A 1OYYA 2ZJ2A 4PXYA 4RIIA 3FI9A 3K5IA 2HRBA 4PGAA 4WHMA 1WXGA 1HY3A 2Q1TA 3W4KA 3U6BA 4TLMB 1JN0A 1C9DB 3ZTYA 3TUZC 4E33A 3QYPA 5IWCA 1AF4A 3GIIA 1R0RE 4OQNA 3FCOA 2DFLA 4ZQBA 2JFNA 1KDZA 1C7EA 4M1MA 3SHQA 4MHVA 3MCUA 1IEVA 1QLHA 4G0YA 3RT9A 4I8DA 2ASVA 1XCPA 5AKIA 1FO4A 1E7SA 3WGOA 4B2IA 3QUSA 1U2TA 1X7DA 3ECCA 1RXUA 2QV0A 3F6SA 4QU5A 3VR4A 4EJ6A 3EVBA 2V7XA 3LLCA 3PRJA 3JW8A 4A2CA 1Y98A 1YDHA 3WGJA 3K75D 3ADOA 3HJNA 3M33A 4MW5A 3PCTA 3X1JA 3FWYA 3R5JA 4WQMA 3DL4A 3RYHA 5K05A 5KJFA 1NVTA 3DYVA 4P7KA 1NJ8A 1LSUA 5KNCA 1DKOA 1E3EA 4M9SA 4QPPA 4YPFA 2I80A 3KU4A 1MH1A 5KCZA 1E8MA 1RKUA 3LY5A 3V7LA 5IDYA 4N47A 1BPYA 2OLKA 4R3UC 4UNRA 4RFSA 5KOJA 5EWMB 1UCFA 2ACVA 5LQKA 2JHFA 3GR6A 3ZE0B 1XG5A 2ZGVA 1ISRA 1Z17A 5FPQA 2AI1A 1DO0A 1I0LA 2H3EA 4NZNA 1R9JA 5E4JA 5JIBA 1BKDR 1M8JA 4NIMA 5LB2A 1RI4A 1KYQA 4RWZA 4MDEA 3WTBA 1WMSA 1LPNA 1PFVA 3SEZA 3V6MA 5FWNA 5K0ZA 3WLQA 2QM7A 2Y68A 3IDQA 1SULA 2R79A 4YJ2B 3UH1A 3V32A 4BJ1A 3CF4A 1Z33A 1TJNA 1DCMA 2BGMA 2JEZA 2A4MA 1AQUA 3D8UA 3LW8A 3T79A 3B1FA 4MQUA 5E8JA 4HUQB 1OWPA 1RLTA 2QUHA 2PFSA 4LRUA 4XCXA 3SR3A 3NXKA 1KJ8A 2PUFA 2KZMA 3EPGA 1KY3A 1OROA 3CUYA 3EXIB 3HJCA 4BNTA 4LYAA 1VFNA 1YOVB 4E12A 5DE3A 4O2LA 3OTHA 3MAAC 5AW9A 5KZMB 1NNSA 3HVRA 1M75A 3L5KA 2ZFUA 1CUEA 2XTJA 4WH0A 3T1TA 4I1IA 1VSUA 1ISPA 5C3UA 2CXYA 2ZDHA 4L5CA 1EDEA 3R7FA 2ZREA 3W8DA 1SA0B 4TXMA 4R9VA 1KDRA 4BRUA 3N75A 3V33A 2FQXA 3Q9SA 2LM1A 2IQ5A 5ISMA 5C8VA 3TBFA 3RBDA 3J81j 1X9XA 1EP2B 1MD9A 1JGTA 4IOKA 5DHSA 1CNFA 1ODSA 2XGQA 1RKBA 3URMA 5IS2A 1T5SA 3WSVA 2WJGA 1UBKS 3C97A 1XX6A 3EWIA 4MR7A 5EJEA 4J75A 1JHDA 1NKEA 3DHVA 3E5RA 1PCXA 1W93A 2BFDA 3BMQA 1CR1A 1KQ3A 3HLKA 4K2AA 4Y2HA 4DQDA 5AXDA 1JX4A 1ZJ5A 1L6RA 1VYVA 2VK8A 4S0XA 4QZCA 2DULA 3MBIA 4HTAA 1CQJB 3BZCA 1L7QA 1MU0A 4M76B 2XQVA 4ZOAA 3PT5A 2QPAA 3IX7A 3FTQA 3D4NA 2C03A 1TU4A 5B7NA 4H15A 4OJKA 5IAEA 4ZMRA 5D46A 4KWIA 3AEXA 7YASA 3I2YX 1M2HA 3GRPA 4RVGA 2ZTVA 3G7UA 3DA8A 2ZWIA 2QVGA 3GN1A 4M2LA 5KT7A 4D2IA 5LMCA 1SGGA 1VE5A 4NMXB 1N75A 4ZXFA 1S77D 1Z5WA 1UEXC 4PG5A 4LZAA 5LQSA 5LU9A 2QBYB 2W11A 4B6JA 3UOWA 1S9FA 5EJ4A 1JX6A 3BQ2A 1URPA 2BF4A 3QVVA 3PD7A 1JF8A 1L3IA 3PNBA 5HBRA 1DBVO 3G1WA 4LF6B 4LY9A 4DT1A 4NLNA 1DTSA 1ZOOA 2R97A 3Q8KA 1GZVA 2IXBA 2EU8A 2IV2X 1P19A 2XB9A 1OI7A 1BNPA 1T9GR 2LDBA 4I36A 4Y9DA 3A0HU 1NW5A 3OIDA 2P3OA 1PQPA 2DSNA 1AUQA 1Q11A 3I2KA 4UCQA 4D8XA 3EZGA 1X2IA 1BVSA 4KIFA 1YJBA 4LE2A 5ED0A 2OM6A 5EUQB 1LK7A 4DTIA 2VZ0A 1G1AA 4FFBA 3AZPA 1H3EA 2UZ1A 1KVRA 2VYFA 2GHRA 4Q19A 4YT2A 4E13A 1QG0A 1XQ9A 2HZBA 1JKMA 4KQ6A 1YB4A 2HPAA 3D0KA 5H9VA 1RBQA 2RJ3A 1JVSA 2IYWA 4AC9A 4DA8A 3ZHQA 5JMOA 5IARA 2X2PA 4F3TA 4GHWA 1D0IA 2FFAA 3TTTA 4NL9A 1E6EA 1DIHA 1HFJA 2MJLA 1YAHA 4WGFA 4ZKDA 3JD1A 3W6ZA 5L40A 2DH6A 2PA3A 2XWQA 4KLQA 1XMVA 1E2LA 1Y1SA 4TN5A 5F1YA 4O0IA 4G1MB 2IXDA 5EIBD 3ZDFA 5C81A 1TTPB 3IILA 3WYFA 3EFBA 3BJEA 3UK6A 4O3QA 1QBGA 4EYSA 3HKDA 1WXHA 4G26A 1MT3A 1NR1A 4F3KA 2UYCA 1CS0A 2HSEA 4R1NA 5HX7A 4N40A 3TH5A 2C31A 4WESA 1Y5RA 4ZVKA 4J3JA 4PR3A 3SOPA 3SVTA 3R9XA 1H1TA 5J2IA 2A1JA 2JEGA 1C3JA 4RTRA 2BVNA 1S2GA 2QX7A 1RQPA 1ZQNA 3TIGA 1YUBA 2ZBPA 3P7MA 4KIUA 1TLTA 1ATIA 4J76A 2DTDA 2AU0A 3GRFA 5D00A 1ZD5A 4MCHA 3K1AA 1FMTA 1NRIA 9LDBA 3V1MA 3RF7A 3RR7A 4HS4A 4DMKA 3KTAA 5LU8A 2IY7A 4X7BA 1LTKA 1G8GA 1R8SA 2CLHB 2G1JA 3VPSA 1MQ8B 3V6JA 5H81A 1JHRA 2X0NA 3ZHSA 3MABA 3I1IA 1QOQB 3SHTA 2QY9A 2WUFA 4OI1A 4R16A 3N97B 4OYHA 4YMIA 5AW5A 1IUNA 3RABA 3TI0A 3IA7A 2RG1A 1KBOA 2R68A 3IN5A 1POXA 5LM3A 1NLUA 4JLDA 1ZQJA 5CB4A 2L42A 3K92A 3F73A 5ALRA 3L4PA 4R6XA 4HDRB 3BVPA 2W93A 1SEVA 2BPCA 2OBNA 3U7IA 3HCDA 4GWLA 1E2KA 5ELLA 3V2UA 2F3TA 2I4RA 4C4AA 3KJEA 1TVAA 5CBPA 2IOYA 4DCOA 1UT8A 1V41E 2EG5A 3H1BA 1PYOA 1RP7A 4WKCA 3QWIA 4JI6B 3S29A 1X8XA 3MGIA 4NL4H 3ILSA 3FZQA 3KOWA 3VBEA 3ZXYA 4B7CA 1GUAA 2ODQA 3LPAA 1QDUA 1CK4A 1DC8A 4XXHA 1OAAA 3ZEAA 4MQFA 3ZV5A 1QNFA 4M53A 1RYFA 1A2BA 2QP3A 1NF2A 1KHTA 2H3IA 3E1SA 1R4AA 3PUKA 4MEJA 3ZR4B 3S1LA 3I2FA 1SK8A 4U2DA 4Q15A 3TAQA 5A7GA 4BJHB 1VE1A 4BNIA 1WHSB 4UTXA 5IHXA 1MV5A 3EMVA 3GVHA 1JIKA 3WWOA 5CURA 2ZRCA 2IEBA 1WWVA 3C2QA 4N6OA 2J7PD 3RVSA 2B1JA 4ZJUA 3AEKB 5KFKA 1L8AA 3R3XA 2X2EA 1G8HA 2X86A 4Z1MA 4YMSA 1GQQA 2FP4A 2QRPA 3K2EA 3L6DA 4R83A 4B9SA 4KL8S 4OI4A 3F8WA 1DBSA 3V4LA 2JH3A 2WAQC 5KTNA 2FPXA 2DUUA 2VHCA 4J49A 4JQOA 5IJAA 2KHVA 5EINA 2VWGA 4DG8A 1OVGA 2VHZA 3A6PC 2ZIXA 4DS4A 1JKFA 1RM0A 1P3JA 2H4JA 3RS4A 3QKSA 4ZTUB 4JL8A 1N3LA 1JIIA 2G5PA 5BOLA 1YBFA 3M5DA 4KFSA 2RRDA 1U9IC 2P2LA 2R8OA 1JIHA 3TVYA 1UMKA 4FNGA 4AMZA 5JDCC 1PZHA 2JCYA 4A27A 4O3SA 2VHJA 4UB1A 4P4SB 1TIBA 4YRLA 3VR5H 1R0LA 1F0MA 4KGVA 4DJTA 2QZSA 3GLHB 4B47A 5DNDA 1BGWA 1D1PA 5IJZA 1R4NA 5CB1A 1GPAA 1WCXA 1EDOA 3D4IA 3DGFC 3FLBA 4XGQA 1GTJ1 1R88A 4LWPA 4M1OA 4HT3B 5YASA 3CVYA 1HMPA 5A0LA 1JSCA 5ES4B 2I2FA 1M6VA 2QR5A 3E2IA 4F56A 2BFFA 4RLFA 4TRRA 4MJXA 4ZZ0A 9ICLA 1ZITA 1DRVA 3MA0A 4B44A 1W1UA 4DJEC 3I9KA 4TV9F 1VDMA 1ODKA 4N3GA 3RVNA 1ZPDA 1OSNA 3TRJA 1KI1A 1NDQA 3CZRA 1ESNA 5CP2A 3OZAA 4IUBS 4JNKA 4WASA 4BVGA 1X7WB 2X4DA 2WR8A 1SOVA 3AR4A 1P77A 1A0PA 1PWHA 2ISQA 3ID6C 2FEAA 4CT4B 2EKPA 3U40A 3FIUA 5ITSA 1AIPA 2J07A 2CYBA 5DSTA 2ZSAA 4AZ0B 1L1QA 2XECA 4CMEC 3HY6A 3R0IA 4HEHA 3LL4A 5EIEA 3OF3A 4QLOA 5F9LA 1SEPA 3SCZA 5KOHB 3MRTA 2RMKA 1Y9EA 3LWNA 3Q85A 1HUOA 1WF6A 2H2DA 1O1YA 1MC1A 1P39A 3D2CA 4EKNB 5KU1A 1VJDA 4NAVA 5DIFA 5SY4A 1A6SA 1H8HD 4KQMA 4MVCA 5CFZA 4JHLA 5E9WA 1OV6A 2FJPA 4FHCA 4RKEA 4CV0A 4TYYA 2R48A 3BBLA 2FVYA 1XZEA 2NO1A 3OJEA 4AY2A 3R40A 5CU7A 3M81A 3ZZ1A 5DHQA 2J0EA 4BB6A 2C5HA 1FP2A 3D3EA 1YZYA 1OX6A 3JQ8A 3T3NA 2FWJA 2COEA 1E5TA 1SUWA 2C5LA 3JASB 4H4DA 4YGYA 4RQ3A 3RK4A 3WLIA 4LDPA 1F0YA 2B4KA 1DBIA 3DOFA 2Q5LA 1UZLA 2P1DA 4LXGA 4ZVOA 5B1YA 4P7BA 1FDIA 4RMHA 2AOTB 1V1MA 1JYSA 3QLTA 3A1WA 4W5RA 2ST1A 3IRUA 2I7VA 2R1TA 2HU2A 2YV4A 3M6XA 5B30A 5EAIA 4H31A 5DPMA 4Q9KA 4OFZA 1ESMA 2O1SA 3SU8A 1U1EA 4LZPA 3VSCA 3VU9B 4NBTA 2OTCA 1U45A 3O2NA 3GN2A 2W8KA 3IULA 3L41A 4UNSA 1PNTA 1CPYA 2HM7A 1PLJA 2QPLA 4NFYA 4J9NA 2BZGA 4YMLA 2WTMA 2KBFA 4UAWA 1Z6QA 4JB0A 1ISIA 4LQ4A 5KBYA 5JARA 3GGCA 4ASUA 2OBXA 2JA1A 4ZGBA 2XGSA 4F11A 2R8IA 1C9YA 2ZT5A 5KAPA 4I5DA 4X5VA 5LL6P 2GFHA 2J6IA 3H8MA 1E1YA 3SS9X 2DMRA 2VYQA 1UWKA 2OFOA 2V9ZA 3LDFA 1DNPA 3Q1LA 1Z2AA 4RTPA 5JTIA 4OHRA 1JA9A 4MR8B 3KVRA 3IBTA 4B4UA 4N76A 3UT6A 2BFPA 2KSOB 2PRIA 5A4JA 5DG7A 1BAPA 4MWEA 3LW7A 1NW3A 5IJWA 2GKSA 4RZ2A 1SCQA 4R63A 3CF6R 4D4JA 1PT9A 3I2HA 4GX0A 4B3DA 1GQYA 2QGNA 4ID3A 5KG2A 3G2MA 1Z8DA 3DMTC 4M22A 2RI6A 3T3PB 3ZIDA 2E4AA 4L8LA 3TYXA 4HDRA 4W1PA 3WZ2A 3CW2C 3ZGZA 1WL8A 3E7DA 1GO2A 2WT4A 4K9MA 4MP6A 1ZR4A 2C2DA 1DDGA 3BIOA 4YFYA 2BQRA 3LK7A 4NYIR 2O2XA 2IT1A 3PVZA 4ZU3A 2BZSA 3H42B 4PZDA 1ECBA 3G68A 2PGJA 5G2OA 1TJPB 4HPWA 5EE1A 1F4PA 1D07A 1XEAA 3DFUA 3HDTA 5KPJA 3HJRA 3UIEA 4BO1A 1JPUA 2PYIA 2C7OA 1P2SA 4KN8A 1R8QA 2VN8A 3IAXA 4OL0A 1M5TA 2IXGA 1QYVA 2MYNA 3PCXA 2XGMA 2HCTA 1XMSA 3PNPA 4XYEA 5TMEA 1NQOA 2LPMA 3CT6A 2HF7A 4MR9A 5EIHA 2J6BA 1V1JA 3LT1A 4HMPA 1NN3A 4L6CA 2Z30A 2ZULA 1A69A 3CZ9A 3D0RA 3KXIA 5JCZA 2RGRA 1XTSA 3ZDXB 1X2EA 1XMXA 4K28A 3ND7A 1ZH4A 2R5FA 4G5XA 5BWMA 2PR7A 1TAQA 3FUCA 2K4HA 5K51A 4IHJA 4J1TA 5FBKA 4HNUA 1NJXA 2CVZA 2DFTA 2RGBA 2FUNB 1AUOA 2I62A 3OC0A 1YFJA 4DSNA 3P9PA 3ZX4A 1CJSA 4CM9A 3VU9A 3H84A 1FYFA 1LTQA 2J5KA 1FY2A 2PH3A 3WLPA 2XY5A 1OTXA 2GF2A 3AF1A 2IYTA 4E4YA 4QWEA 2BHSA 3QSYA 4YMMA 1RQGA 4S12A 3W5DA 2K8AA 3KLNA 4JUZA 2IZ6A 4NK4A 3IP3A 2DT8A 3PICA 1T15A 2VC2B 4ND2A 4C1BA 3KHSA 5LLSA 4QOSA 1GSAA 4HGRA 1JR3E 1J56A 3UC5A 3TQOA 3U2QA 4LOIA 3UMBA 3LX4A 1XDWA 3W5CA 2OQ2A 3JU3A 1OQAA 4FFLA 1XJWA 4JP3A 1FNNA 1YACA 2EGHA 2BUCA 2A5DA 3T5LA 2GPSA 2NU9A 2VJPA 3DOUA 2GJKA 4M9CA 3EA4A 5DU2A 4FKBA 4US1R 1MB0A 4LQCA 5G0UA 4DV1B 2CVQA 3QEMA 4ND1A 1T1EA 5J3JA 2JDID 4KRGA 5CM8B 4F2HA 2NTYC 5IYZB 2XD9A 3O4RA 5CMLA 3AMVA 4MEAA 3Q8MA 2LW7A 3JVEA 4HX5A 3HQ4O 1VKZA 3QEAZ 1XLVA 2VJ4A 3T6KA 3OZEA 2EJBA 4YPVA 4MFAA 1XKLA 5KUTA 1EJBA 1JZQA 4IRUB 1OFIA 4E5YA 2PLNA 2CLDX 4NS4A 3QKRA 4AYBF 1DAIA 4RTNA 3IAS1 4BLWA 1BMQA 4G6ZA 4OHFA 1UHUA 4Q6WA 4TV9A 3WNZA 1T0HB 1JG3A 3B0XA 4X6LA 4YH1A 2F2AB 2FLLA 1X7GA 2FW0A 2HTFA 2Q7XA 3D6FA 4ZT4A 2MYTA 2NW6A 1CQJA 4LTNA 4QPCA 2O8DA 1ZJMA 4M8NE 1TU0A 3TTWA 5A1TA 2I4MA 4D8YA 2XB2A 2N1MA 1AV6A 3SHWA 4ZVUA 4P4OA 1MO3A 4BTVA 3JYNA 3TPFA 2C3YA 3VZQA 2JLWA 4G1EB 3ZWYA 4AW9A 3FH0A 5FR1A 2KP7A 4PBRA 2V3VA 1C1YA 3HVIA 4C7OB 5K0CA 1NPYA 4QIHA 4BLPA 2NSYA 1EWQA 13PKA 4KLOA 4CLDA 1K3UB 3Q10A 2D2VA 1Q0QA 3BGDA 1FL9A 2XHEA 3F3KA 1EUDB 2GPYA 4N5DA 4BNGA 4C2AA 1KI6A 2AN5A 3GFTA 1CI4A 4TQRA 4I66A 3KLBA 4RJIA 1F7UA 3R23A 4QOGA 4R66A 3WGNA 4LZLA 1LBTA 2JBAB 2RONA 3OLWA 3QVLA 4B6QA 4M36A 4BGIA 2QTCA 4BLQA 2O8CB 4OJQA 1RKVA 3MD0A 4UFNA 2J3DA 3TG8A 4QZGA 1U9ZA 1EXNA 2WPNA 3RASA 3BQMB 2WRZA 3U9TA 1XFAA 1G55A 5AKEA 3NOXA 4UUNA 4ZK2A 3OE5A 1VG9B 1CLUA 4DA4A 1U5BA 3FTCA 4XQCA 5JQGF 2CB9A 4H77A 4Y1EA 4G81A 4QXRA 2D1TA 1ORDA 4HAXA 5DX8A 1BGVA 5BMVB 2OHIA 4U2GA 1CJTC 4XCQA 2GZ1A 2NT4A 1ENPA 2A9JA 2NZ8A 4L73A 2QARA 5AKJA 4PFSA 3BZKA 5H4HA 3FOAA 2XB4A 2XUDA 1QP7A 4FYHA 3M83A 4AJEA 4S2UA 3DEZA 2H57A 5EOZA 1GU7A 8ICLA 4L8VA 1AOXA 4YECA 5FJIA 3GZNA 1VI2A 3RVMA 5JRZA 1EVEA 2LYAA 1WXXA 4A0FA 4ZI7F 4ZYTA 4RQ2A 1K27A 3JQAB 4D4MA 4DEYA 2BYTA 4KN6A 3HCCA 1SUSA 4AS1A 1T3SA 4LKRA 5EN4A 4K9DA 2IH5A 1N6RA 5ALJA 4MW2A 4MR8A 4FZNA 1AN9A 2WWYA 3EG9A 1GVHA 4HDAA 3G49A 4RF3A 1TKCA 2HA4A 3KOZA 3NHYA 1UZAA 3ZWNA 4Q03A 3PXGA 5HJ7A 3WGHA 3JARA 5DISB 1ZNWA 3B85A 3Q7EA 3WSWA 1ZVMA 1KZ1A 3ED1A 2YFYA 3VKVA 3AF3A 2MSNA 3GAZA 1CUHA 3K8YA 2C78A 4MCJA 5I7VA 1RCUA 3R0ZA 3I04A 1AT1A 3L01A 3REGA 2PL9A 4Y30A 1XXHA 1QONA 2G8NA 4LDRA 1T4DA 3C5GA 4Q9AA 4BQIA 4BC1A 1G2OA 4ER3A 5KQMA 3TGPA 1Y34E 2XH8A 3GLKA 5U1PA 3ROFA 5JXJA 2W2XA 3HJBA 3L8FA 5LYJB 1JLLA 1R3DA 4UBNA 3UGJA 3IQIX 4A03A 1N5MA 4EUSA 2Y2UA 2ZAGA 3PTZA 4CKWA 4EQ6A 2GZMA 4II2A 1QOPB 3HHPA 4IH4A 1CUCA 1UWCA 3MZ0A 4AP9A 4TGLA 4EVIA 4KR7A 4PO8A 1GTMA 4H1UA 4R1SA 4DGSA 2XOEA 4OQDA 2KZ3A 2ZIVA 1IM2A 3QFSA 3PPIA 1O0BA 3TQSA 3NB0A 3PQ3A 4YRBA 4J6EA 2G3YA 3TI7A 2VDKB 4ARZA 5D3KA 1W581 3NBUA 5KFOA 5BP7A 4D0SA 3MTDA 5IKEA 1TO2E 2QVXX 4DLPA 4CLOA 1SKYB 1SCAA 4G5RA 1Z4LA 4YP9A 4NICA 5BR8B 3GPLA 2Z2YA 1MOPA 2A4KA 4V24A 2VUSA 5CDSA 3I8XA 4GPTA 3VC1A 1I2DA 3MDAA 1IH8A 2BWJA 4GT1A 4IIGA 2PE5A 3U3KA 1T6BY 3MJEA 2KMDA 2Z9BA 1O08A 1TPYA 5AM0A 4D1YA 1UUFA 4W5WA 4ZKEA 4JT8A 4EZ9A 8ICEA 1U9YA 3AILA 4D7AA 4XTCS 3KBOA 4OY3A 2P4EA 5TT0A 4XB2A 2QORA 2NTEA 3OLQA 1YVEI 3PV8A 4PFKA 2HSZA 1FS5A 2JAXA 3IOCA 2UVDA 2E4YA 2QUAA 4GBMA 4Q37A 4MKIA 3AP2A 3M2TA 1U1GA 3VNSA 3OTQA 2FGKA 3CKLA 2ID9A 5ALHA 3D2SA 3MFYA 4LJSA 1KETA 1PYDA 4RT3A 1YV9A 3OKCA 1I01A 3G2QA 1O95C 2HKIA 3HR4A 3O9VA 4QICA 3RIEA 4RENA 1XP5A 1QO0A 2H1WA 5BV2P 1HDIA 1CUUA 3L8MA 2JIPA 5K0EA 2HCJB 4MSUA 5TPWA 1GG5A 1NQWA 3RFVA 1FW8A 2WBLC 3ZVLA 1J8QA 4OUDB 2XQIA 1I3CA 4DSJA 1HG1A 4EGQA 5K99A 4NG5A 4G0MA 2GK7A 2PMDA 3I9V1 3QI7A 1C8BA 3DWFA 2PT6A 4FUQA 1UXHA 8ICUA 3LY7A 5FRDA 4F4XA 1K88A 1SU8A 3A32A 1XCMA 1PK7A 4UHCA 3ZS9A 4Q9DA 3ICOA 1A4UA 1RJEA 2D5CA 4H6XA 3TRDA 2I66A 3ZQ4A 1A7UA 2XMDA 1J2YA 1HFKA 4Y7CA 1S0NA 3NEYA 3I37X 1QZUA 2EJVA 9ICPA 1X1BA 1AUVA 3VNUA 1XAHA 1D5WA 4X8LA 4ES6A 4FYMA 3RKRA 4F3YA 5KREA 2W90A 4B82A 3U7RA 3RWOA 4IQ4A 1DLJA 5ALMA 1PF7E 4IIBA 4OK6A 1Y42X 4ABTA 1P2FA 5COQA 1Z06A 2YIJA 2UZAA 4YP1A 3WFZA 3PVSA 4X1IB 4RF4A 4FCTA 4EJSA 3VU8A 3GDFA 2J5XA 2W04A 3PR4A 1COWA 2JFZA 3B1KA 3OM1A 1E5XA 7ICPA 1CVLA 4AJJA 1A9TA 1M1UA 3HACA 1W25A 4F92B 2WMOB 2ZUUA 3NQ41 3EXFA 1P6XA 1GTL1 1Z3IX 2HJSA 2COKA 1AVTA 2O3SA 2X40A 3HCOA 3LZ6A 4KLCA 1N9GB 2GLXA 4YJKA 3VNBA 3PXUA 2XDQA 4CTMA 3FAZA 3LBNA 4DSIA 5FDFA 1Y7LA 2CZQA 4R41A 1L3UA 2GOLA 1QS0B 1VZ2A 2FSVC 2W6ID 1Q5PA 4XZ3A 4P4SA 4ITUA 3SF0A 4C6HA 1W5BA 5LDDC 3L0YA 4TKVA 2YJ3A 3EXAA 3V3KA 3PY8A 5AXCA 4EY4A 1RJFA 3O8NA 4Y2RA 2YC2C 4JQZA 4YCXA 1GG8A 1W30A 3EULA 3UO8B 5JYDA 1KP3A 4FW9A 4JFRA 3ZJ5A 3N2YA 4QU9A 2HUPA 4HAIA 1P29A 4R68A 3ADCA 3EIFA 4BZWA 1WABA 3CUTA 3DQZA 4YALA 1Y3AA 5DG9A 3DKIA 4GC6A 4M0AA 4HRAA 1K8ZB 1Q0HA 2HSWA 2WJPA 2IEIA 3CYFA 4R81A 4I1PA 1A97A 4YUYA 1OXBB 1VKRA 3THXB 2E48A 2L5YA 8ICYA 1KEUA 1YZLA 1B42A 2QEQA 3QF7A 3LHSA 1UF9A 4TTVA 3EUFA 5FBHA 1XP8A 4EY6A 1QJCA 4QGAA 4AMBA 4CL3A 5C2JB 1B26A 2WWWA 4KNYA 1NZJA 4M6WB 4ECTA 3JPWA 2D00A 3FB1A 4KLZA 3B1VA 1JHYA 4EPYA 1EEXB 4C7MA 4MRVA 2C4TA 4EVRA 3C8MA 4CCWA 2F17A 2F1OA 1TVEA 3LO5A 4YT5A 3C7AA 2ZJOA 3NI2A 3P4UA 5G5HA 4HLCA 2ZBEA 1SXDA 1IL0A 4Y0VA 5I45A 2J30A 1OYVA 1S2LA 2JCXA 4X91A 1O94D 2D5AA 3PA8A 2FTKE 1P0MA 2WA2A 4IVRA 1QH8B 4WUTA 2XNKA 1VL0A 1YOBA 5F2NA 1NONA 1A2QA 2WM8A 2VHWA 3QPDA 2AI2A 3MAGA 2CFSA 1CEZA 4Y0AA 5IW8A 1OJ7A 4JBHA 2F1RA 3PRHA 4OTZA 3A6HA 5FOVA 3AVWA 2AN9A 4A0QA 4M04A 5KFBA 5J2AA 2DH5A 4YD1A 1EDDA 4QVIA 3JD4A 3D6TB 3RS3A 3TTYA 1RD4A 1FIUA 1RBZA 2XUAA 1R6DA 3BUSA 4I29A 4W8OA 1DO2A 3SM9A 5J29A 3HA5A 2IYZA 3RB6A 4H4CA 1HKUA 1JVNA 1HM5A 4LHEA 2VSOA 3WGQA 3VJMA 3TCKA 1EVQA 3ZU6A 4OJOA 1H8HA 4EKYA 1P7CA 3WY9A 5AICA 4R84A 3VSAA 5JO0A 2HHUA 2IUYA 2RSLA 4ALJA 1ZOSA 1XDUA 2EHDA 1FZQA 2X6TA 1L5NA 4MI1A 121PA 2UZ1B 1TV9A 3CRW1 2WD8A 4MFCA 3A0RB 5HE9A 1FDVA 1G5RA 4QYWA 2Q1YA 1QSGA 2PM8A 2VBGA 5AJVB 5HCIA 3EF1A 4Y2YA 5H83A 1WSDA 4P36A 4B40A 1C3EA 4Q18A 1G7SA 5BN5A 3LLUA 4RJLA 3ANNA 4BWMA 1H2ZA 2JIZA 1RPTA 2GZ2A 2O2ZA 3BMOA 4GYJA 3EVFA 4FCWA 4B31A 5KQGA 4DUPA 2BP7B 1YZNA 5B1SA 5T67A 4RL6A 1T8EA 4I4LA 1QVRA 4PEVA 3K1AB 2WMDA 5IABA 4EBDA 2CLEB 1ZQBA 4Z54A 3WLAA 5KSOA 3BULA 5JJLA 2COUA 3Q88A 1JLKA 1XI2A 1O5IA 2HRRA 2UYGA 1VKHA 4JU8A 3UXEA 4PANA 3ZN2A 3P4XA 1CZHA 4IQFA 1RQ7A 4TM7A 5LYJA 3TLGA 4H4EA 4PH5A 2KN7A 1BA2A 2AQIA 1FBTA 2NADA 3ANLA 4BDSA 4I5FA 2NO9A 1ZH0A 3TRFA 3LBIA 1D9FA 3WYGA 2HWYA 2K6GA 5E9QA 2ODEA 2QLLA 2VH1A 4I08A 1BPZA 1YR8A 2ZJ7A 4KH1A 3SZGA 1PR3A 2I6SA 1Q7CA 5DKFA 2XA2A 2HGSA 3LLMA 4FZRA 1PV4A 2VBCA 2D1YA 2DKZA 3EZ7A 3B13B 3OCJA 2YFQA 4MQLA 5BT9A 3ZHUA 1JQKA 1L4NA 1Q1ZA 3UA3A 1GCUA 5AXBA 3OTIA 1OU4A 1QP4A 3IT1A 1X39A 4WZ6A 4D46A 4X7MA 1KRXA 2BGIA 3CQ9A 2BFFB 4TT3A 4DQUA 5BRNA 1Z2DA 3STYA 3VC2A 1OUQA 2OB2A 1CUAA 2C07A 2ASJA 4HRVA 1ZXXA 4HWRA 3TZCA 2BRUA 3RRGA 4L4SA 4E2FA 1DQZA 3WVNA 3MD9A 2I7CA 3JQ7B 4ISCA 4KE8A 2OYSA 1NFFA 4QDTA 3F7NA 2LBOA 4TVKA 4BPRA 1LK0A 3LQKA 2J3QA 9ICFA 3G79A 3JQAA 2FOLA 4WOPA 5IX8A 2QJWA 1BVHA 1EAYA 1Z7YA 2JFGA 5JU5A 2HBRA 2XHZA 1YZFA 5C35A 1H85A 4YJ3B 3RS7A 4ECRA 3DO6A 3FNEA 2ZRGA 3V9AA 4C4ZA 4F9TA 5BUSA 2OT3B 1LV8A 2FYTA 1QIEA 1WMBA 5JVDB 3T4EA 4NV1A 5GJVC 1ZQFA 5ILGA 1FU8A 1ZI6A 3VHXB 2FPMA 4F3RA 1DQNA 1KVTA 5JD3A 3BCUA 3G88A 1WU8A 4N0MA 1O96A 4I4TB 1FXSA 3S2FA 3SNKA 4E5DA 5DGBA 2ORVA 1RJ9A 4I2FA 2DF8A 4L5AA 4C43A 4DFMA 2XLCA 2ZWMA 3MWJA 3T52A 1QG6A 3QEJA 4C7BA 3U44B 1KJIA 2BEWB 2BTQB 1N4DA 3M9OB 1JFRA 3FX2A 3H6KA 4P3YA 3RSFA 2AZ4A 5KSPA 4BVBA 2AGPA 3VYSB 5FEUA 3AEKA 2VUIB 3FTPA 4QUKA 2QU7A 3IEKA 1FP4A 5AD1A 5DGDA 2ON6A 3HNRA 2EP5A 1A4XA 2CDAA 4O0LA 1YB2A 5IMSA 2HDOA 1TXGA 1KYXA 2AN4A 3T1HB 3NKVA 3KEOA 3IOEA 1G8PA 2BBOA 1C4OA 1KI6B 3O0TA 3AFHA 5J0UA 4XIJA 3A6ZA 4Q8EA 4P4PA 5AJYA 1JFTA 4DOCA 2C9ZA 1PR5A 3OJFA 4B9VA 1QYCA 2I6FA 3IOMA 4S1PA 5KVQA 4RPKA 1PD1A 4S0ZA 4QWAA 1I32A 2ZBVA 4GZLA 5EESA 3DDHA 4M1KA 4YDSA 3WOHA 5HUQA 1QYXA 1Z56C 4RZRA 4D9JA 3BDPA 3KFVA 4NCAA 5K3FB 4DANA 2ZAIA 1A9XA 1HUQA 2QZ4A 9ICCA 1JH9A 3B82A 3HE3A 2UAGA 1O8BA 2JJ2D 4J7UA 4Z4EA 3AEVA 3TS1A 1G3IA 3SXJA 4KRFA 4K6OA 3PQEA 4GSKA 3Q3GE 1XVTA 5ALDA 1FTQA 3M82A 5A6SB 1W76A 4WXRA 3VUEA 2I5PO 2JJ1D 2JLCA 4IKEA 5BSGA 4MIYA 2WF9A 1XR3A 3HBNA 2DPIA 1QQ5A 4CM9D 5CJ2A 5JEEA 1QPBA 2FFRA 2RDIA 2AXPA 1ZXLA 1GKKA 1HG0A 2RG7A 4LHXA 1IQUA 1PWYE 3HUEA 4KPUA 1LBQA 3PENA 4KXWA 1W6UA 3K0AB 2HQ1A 2J3HA 3AV3A 1U0EA 2J6CA 3D3KA 3D6VA 1QSLA 3H9JA 4LK2A 1QTMA 4KVAA 4ELTA 3TPZA 3QG5A 3VZSA 1FFAA 1C7YA 1Q3UA 5GZ1A 4TMTA 3RSHA 4LDJA 3VQTA 2P6NA 3QBJA 4J9RA 1V96A