5ALJA

Ligand complex structure of soluble epoxide hydrolase
Total Genus 182
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
182
sequence length
546
structure length
523
Chain Sequence
TLRAAVFDLDGVLALPAVFGVLGRTEEALALPRGLLNDAFQKGGPEGATTRLMKGEITLSQWIPLMEENCRFSIKEIFDKAISARKINRPMLQAALMLRKKGFTTAILTNTWLDDRAERDGLAQLMCELKMHFDFLIESCQVGMVKPEPQIYKFLLDTLKASPSEVVFLDDIGANLKPARDLGMVTILVQDTDTALKELEKVTGIQLLNTPAPLPTSCNPSDMSHGYVTVKPRVRLHFVELGSGPAVCLCHGFPESWYSWRYQIPALAQAGYRVLAMDMKGYGESSAPPEIEEYCMEVLCKEMVTFLDKLGLSQAVFIGHDWGGMLVWYMALFYPERVRAVASLNTPFIPANPNMSPLEVFDYQLYFQEPGVAEAELEQNLSRTFKSLFRASDESVLVCEAGGLFVNSPEEPSLSRMVTEEEIQFYVQQFKKSGFRGPLNWYRNMERNWKWACKSLGRKILIPALMVTAEKDFVLVPQMSQHMEDWIPHLKRGHIEDCGHWTQMDKPTEVNQILIKWLDSDAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Successful Generation of Structural Information for Fragment-Based Drug Discovery.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords BIFUNCTIONAL EPOXIDE HYDROLASE 2
total genus 182
structure length 523
sequence length 546
ec nomenclature ec 3.1.3.76: Lipid-phosphate phosphatase.
pdb deposition date 2015-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 5aljA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 5aljA01
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5aljA03
2GFHA 4N8EA 2ZOSA 4OSEA 3M9LA 1FJ2A 3B9RA 1UOQA 2ZYRA 2D2VA 4AMYA 5CXUA 3U7EB 1XRQA 2OCGA 5AKGA 3IVMA 4C01A 2CB9A 2X76A 3W05A 4UBMA 1J07A 1A8UA 3IIIA 1BEZA 3ZV7A 5JAOA 5IVKA 3W9BA 1RKQA 5ALQA 2XMGA 5AVXA 4ARBA 5HQ3B 2NO4A 5AO9A 4BRZA 2O2IA 4INZA 2Q0XA 1G42A 2XMRA 1UXOA 4CE6A 3A1EA 4MWOA 3VXKA 2ODAA 3LS2A 3NANA 3MUNA 5A2GA 5CMLA 4JB3A 2PR7A 3HI4A 1QIKA 3T4UA 1VA4A 3LCRA 3H1AA 3IUJA 5JZ9A 1P0PA 2OQIA 1MX9A 3QUCA 4QDTA 4J0KA 1JU4A 3GFFA 3M83A 4O08A 1H22A 1K1EA 4LYDA 5A6VA 2ORYA 1TCCA 2Y2UA 4KYTA 2XMBA 2Q4TA 2XQFA 4MYSA 2XUQA 1VLQA 2HA4A 2W4MA 4Y2TA 3U7FB 3K2IA 2FPSA 5T4HA 3H2HA 4N5HX 3CXUA 3PF8A 2Y2VA 1ODSA 1THGA 2C58A 3LIIA 1Q92A 2ROQA 1UOPA 1UKCA 1JMKC 3W5DA 1MTZA 4UHDA 1XVIA 2G08A 2IIVA 2Z5GA 5BWCA 2B9VA 2ZJ6A 3EF0A 3ZWKA 5K3BA 5ALKA 2WUDA 3ESDA 4JYMA 4X90A 4ROTA 4DLNA 2C9MA 4N8SA 4WY5A 2JGFA 4DGQA 1XQWA 2WUFA 2JAUA 1L7NA 4XX1A 3QU5A 2O2GA 4EELA 1TA0A 2VSQA 1PJAA 4ETWA 3O9MA 4FNGA 1LPBB 4Y2XA 3N0TA 1CUEA 1Z4QA 3HRHA 4F0JA 2VT6A 4YASA 3HYCA 1XRNA 1QGED 1YB7A 2MU2A 1X2EA 3F97A 3SF0A 2OGZA 4EX6A 4C6HA 1U02A 1MU0A 3KSRA 2CN1A 4BX3A 5JZSA 4WDRA 5AVUA 5ALUA 1Q91A 5ALRA 3OCUA 4X3CA 2PL5A 2JGAA 5JASA 1AQ6A 4BYGA 1CUFA 4FFVA 4EZIA 5AI8A 5FPPA 5IH7A 2YMLA 3L8HA 3GELA 3AR3A 3R9KA 3L0BA 2RAVA 4YPVA 2ZBEA 3ICVA 4BAUA 4CF4A 2WF8A 1SFRA 4G5XA 1AGYA 1R9MA 3FWHA 2OBBA 4K6KA 1ETHA 4BVJA 2WFAA 3JYHA 1TK3A 5AW9A 4FTWA 4HS9A 4GXTA 4FBLA 4G4JA 5HQ3A 4UPDA 3JW8A 2FX5A 2IOFK 4C4RA 2WHEA 1MN6A 3WKEA 5AVWA 3G9ZA 4NV0A 4ITVA 4RGYA 1MJ5A 3FPBA 4U2EA 1H2ZA 1G66A 3QLEA 2G0AA 2GYUA 4ZWNA 1AMNA 5FOQA 4LXHA 2VKQA 5AICA 3PUIA 4BCCA 2I7DA 3WA6A 5A71A 4Q34A 3G8YA 1SWWA 2P11A 2BDUA 5FKJA 3MMZA 4GLBA 4H35A 3IURA 1K6EA 1VFPA 1E89A 1XZCA 1EVQA 5E4YA 4EY6A 3FCXA 5K5EA 5AKZA 4MQMA 2VJAA 4NZZA 1QIHA 3DAOA 1DWPA 4BE9A 3DOHA 1DX6A 3O4HA 3NASA 5CT4A 2RIPA 3I2IA 4PV7A 4CG3A 2IOFA 1TIBA 3OPMA 1VE6A 4W1PA 3C87A 5AHXA 1BCRA 3H2KA 3W9UA 2ZSHA 3ED1A 3E0XA 1ZD2P 3BA6A 5BOVA 1UK8A 1YSCA 4KJXA 3NALA 1Z4KA 2W22A 4DWOA 1FFEA 3L8EA 1N8NA 4UAVA 1E5TA 2JGMA 3OG9A 2WIFA 4FE3A 3F67A 5ALZA 1CUWA 1ZICA 3VDXA 1Z4IA 2JARA 2UZ0A 2WHPB 5YASA 4YX9A 4Q3KA 2W6CX 4C87A 3G9XA 4QWMA 2HHLA 4X95A 3EF1A 5E4JA 2CZQA 1LBTA 1CR6A 2I54A 2XUAA 1UKBA 5DJ5A 3DNMA 3KXPA 5CT6A 3ZW7A 3R0VA 4XVCA 5ALMA 3WA7A 4TGLA 3OCWA 4BDSA 4QEKA 1N5MA 4G9EA 3ZLUA 5FUMA 3OCXA 4CIAA 4QA9A 3C6XA 1QQ5A 4KN8A 1MH9A 4KE8A 5AM2A 4BAZA 1RMTA 3R09A 1DU4A 3PICA 1XZLA 3ZUPA 2DR0A 2K2QB 5A7FA 3FSGA 1IZ7A 2FPWA 3VKFA 2B8JA 1GQRA 5LP1A 1SC9A 1NRWA 3FYUA 1K4YA 1YR2A 1QYIA 3LLCA 4G9GA 1LZLA 2HRQA 4G8CA 4Z49A 4QE3A 2HO4A 4AZ0A 1L8LA 2ZJFA 1VZ3A 3R40A 4HGOA 1MT3A 3RK4A 4C4SA 4HRYA 4AMZA 3HYSA 4UFNA 1Z4PX 3EF3A 1LZKA 2HSZA 1FFDA 4RETA 5ALYA 3E84A 3K9BA 5EI5A 5DTIA 3AR6A 2G63A 4PQEA 3RARA 2QOEA 1K5PA 3D2CA 4GXNA 1E3QA 2WSLA 4UHBA 1CUBA 4W1SA 3N1UA 1CUDA 1J8DA 4QJBA 1XZHA 3G0BA 1T5SA 2H1IA 3H2JA 3G9UA 3PUHA 3A6ZA 2GBIA 4RE5A 2DCMA 4YK7A 1QQ6A 2GBGA 4UUQA 1EXWA 5K3FB 3UUEA 1EK2A 2QVBA 3FVRA 2WIDA 3EPRA 3QMVA 3QBJA 4DMKA 2ZBFA 2AH5A 4L9AA 3X3HA 2J4FA 5C7YA 5FV4A 1WCYA 4BTVA 4AX4A 2VTVA 1QFSA 1ZD5A 2BJHA 2HI0A 3MGAA 4OU5A 5CH5A 2WTNA 2WFZA 2XUIA 1KYTA 2VA9A 5AVYA 3OCVA 1CUZA 5HF5A 5ALSA 1XROA 4B0OA 4YCNA 2PVSA 1JJIA 5ALHA 2JGKA 3U1TA 3F98A 4M0EA 1EINA 1SCIA 5LZ5A 3FSGD 2HA7A 2WHRA 1NU8A 2VATA 4P9NA 3IULA 5DYYA 4YCMA 5AW7A 1ZD3A 4GI1A 5A3SA 2XLBA 1QH9A 1RWQA 2YASA 5T41A 1BE0A 1P0QA 5AP9A 1WHSA 3K1ZA 4EY8A 4W9RA 2PKEA 2G06A 3AR2A 1QTIA 2BDEA 1RRCA 1QIIA 2G5PA 2RHWA 4ZV9A 4WY8A 1ZRMA 3U26A 2DQSA 3TRDA 4H7IA 2RHTA 1RP1A 1H23A 3SLRA 4FFWA 4KAJA 4E15A 1QZ3A 1XZMA 1GT6A 1YASA 4J0GA 3G0DA 3A1CA 4FOLA 1P0MA 3M81A 2CBGA 5LKAA 4G8BA 3ED5A 4UM5A 2JGLA 5DWDA 2QJWA 3U19A 2V98A 2AJBA 3WL6A 2X4DA 2VJBA 1A8QA 1QO7A 3WL8A 5ALLA 1ZIXA 5DYWA 2FPRA 3PFCA 3QMMA 2H7YA 4UBJA 1SCQA 3G7NA 2XMZA 2FUCA 2C0PA 4PSCA 2HF2A 3D5EA 4AQDA 3M1YA 3W5AA 1GKKA 4XJVA 3FYUC 2V9ZA 4UAUA 3NUZA 2YMMA 3L7YA 2CFSA 1BRTA 5D3ZA 4QLAA 1XZFA 2EAUA 4X85A 2WFMA 3RLIA 2FUEA 5HFNA 4QLOA 1EI9A 1PV1A 5JD5A 3PDCA 1AX9A 5HCUA 5JADA 5FXMA 2QTBA 2HA3A 2EDCA 4X7BA 1Z4NA 1TKRA 5C8ZA 2QYHA 2I03A 1EDDA 2FPXA 5EIHA 2RGUA 3DL4A 1VE7A 5CW2A 3L8GA 3MUOA 2ES4A 3DLTA 4UASA 3W5BA 4B9AA 3D7RA 2ZXEA 3QU7A 3IA2A 1U2EA 3QUQA 3HSSA 1TJ3A 4NABA 5AOAA 3MPOA 4BBZA 1ZJ4A 4IH4A 3VJMA 4DNFA 3DYVA 2O7VA 3QITA 1U7PA 4PNHA 5AVQA 4BRSA 3C43A 4CG2A 5I9IA 3QYJA 4BP8A 1MNQA 1SCKA 1GZ7A 2OQVA 2AXEA 4NVRA 3SX4A 4WDQA 4JEIA 3WJ2A 1N1MA 3WK5A 2HX1A 2P9JA 3WWEA 1QO9A 2RI6A 2JEYA 1XQXA 2FUKA 1WPXA 4X71A 4X6UA 5IVDA 1DT3A 1R3DA 5BWBA 4C4YA 2WM8A 3SMVA 4V2IA 4GECA 1HL7A 1GPLA 4K2AA 5AM4A 3U7HB 4DYHA 2ZBDA 3HXKA 1GPKA 4K6HA 4IQ4A 1MX1A 5K3AA 1VJRA 2PUJA 1RQLA 3KWJA 4DNOA 2R8XA 3WKBA 1DINA 2NO5A 1EHYA 1U4NA 2QM0A 4IH9A 4X94A 1VA5A 4YH1A 1W75A 5JATA 1H2XA 4ZRDA 2WF5A 3EQ8A 2XUOA 5AW6A 5FLKA 3V1MA 1XZDA 3ESBA 4ZI5A 2ONCA 1AQLA 4OPMA 1JJBA 4QDXA 2X8BA 1O6FA 5EHZA 3NOXA 4HGNA 2Y6VA 2VQ6A 1YB6A 3ICWA 4MWTA 3WLAA 4DMFA 4HYTA 3GROA 5T4EA 2WF9A 2YBDA 1RLMA 1WR8A 4WFKA 3I28A 2AUTA 5K3FA 2MU1A 3B12A 4JYPA 5AW2A 3YASA 3CN7A 1WM1A 5JD6A 4TVKA 4LXGA 2ZBGA 1T4MA 5C81A 2Z8ZA 3UMGA 3I6BA 1CEXA 4KE6A 4MYDA 4KX5A 5AI6A 1EK1A 1RKVA 2AGVA 4E11A 2PUHA 4FLEA 1Z4OA 4YIHA 4OU4A 5IS2A 4PF1A 4G9BA 1VJ5A 2XLCA 5CTAA 3C45A 2I55A 3NWOA 5AI4A 2DHCA 5AIBA 2BUCA 3V9AA 2WHQA 2JEZA 4IG4A 3DCNA 4RE6A 3VJLA 4BZWA 1X70A 4BB0A 3WWCA 3BIWA 1MAAA 4RESA 3WIOA 1FFAA 2Y6UA 3E8MA 4F21A 3WK7A 2P8SA 1TAHA 2WF7A 4Y2PA 4Y2UA 1JJFA 4OD0A 5AW1A 4OYYA 1YJ5A 4C4XA 4ZEXA 1GQSA 4I9GA 3MN1A 1QLWA 4BZZA 3QX7A 4J7AA 2YN4A 5ALXA 1EDBA 4JH0A 4DSAA 1Q0ZA 4C4ZA 4X00A 1LTQA 4Y2VA 2XUGA 2WG2A 2WUGA 4UM7A 1CQWA 5LZ9A 3QYPA 4HAIA 3BE8A 1PW5A 3E1GA 4IO0A 5DYTA 1XFDA 2O2HA 2GBFA 3PCTA 3UMJA 4CG1A 2DFPA 3E58A 2I33A 4HRXA 3STTA 2PBLA 3CN9A 2IA5A 4U2FA 2XQJA 2WTMA 3W06A 2HA5A 5AOCA 3STYA 1QONA 3QXGA 1Z88A 3ONNA 4PNZA 4EZEA 4MEAA 5EIAA 5FRDA 3SD7A 3I2JA 4UBOA 1BROA 2FI1A 3PF9A 2YXPX 4BE4A 4KE9A 3ZVNA 3I2KA 3DL7A 1CV2A 3V1KA 7YASA 4BYMA 2XUFA 1MNAA 5EHQA 4B82A 5AW0A 2WFLA 3O9VA 5FDFA 4NS4A 2PPLA 2CKMA 1RLTA 3BDVA 5SYNA 4PW0A 3ZWQA 3DDHA 4X97A 3ESCA 4EY5A 5F4ZA 4BC1A 2GO7A 4DTCA 3EQ9A 1CVLA 5DNVA 4UMDA 3WYNA 3K6KA 4UARA 5HKAA 2I3DA 2IX9A 3HC7A 5ALDA 3EQ7A 2D0DA 4WCVA 1ZGBA 2I3ZA 2G07A 4FYPA 4Q05A 2CJPA 4UHHA 2YH2A 1WPGA 5HFAA 2WQZA 4QDUA 4DMCA 3N28A 1DWOA 3FM9A 2XUKA 3ZU6A 2Y1KA 3EBLA 5T4BA 1CUVA 2PX6A 2XQGA 3G9TA 3C6BA 4BDTA 2YMQA 3KBBA 1Q0RA 1T2NA 4F5ZA 1QIJA 1GKLA 5AKKA 1XLWA 2XMCA 4PSUA 2G4LA 2VAXA 1ZI8A 4EB0A 2YJ6A 4H7KA 4NMWA 3IB3A 4B6GA 4KRYA 3NUQA 1GPNA 1O08A 2PSJA 1L7RA 4LYEA 2GHQA 2VAVA 5AI9A 3H17A 4AB1A 1ACLA 4N5IX 3H04A 4Y3UA 1LPPA 3DKRA 4L3WA 1DT5A 3DKKA 4BBJA 1LLFA 1YA4A 1QOZA 5HZGA 3E81A 1RMYA 2EEPA 3ET4A 3I1IA 1SU4A 3E4DA 4UFOA 4KRXA 5I8PA 3BXPA 3ZI7A 4CF3A 1ORWA 1WZCA 4OYLA 1RYYA 2C88A 1L7QA 2H7CA 5ISMA 3FZQA 1AKNA 3C5WP 4M0FA 5AESA 2VF2A 4AN0A 3H18A 3A2LA 2QMQA 4B9EA 2QXTA 5JIBA 1SWVA 2HF7A 1U7OA 5ALWA 1E8NA 4D9JA 5JARA 3C5VA 1E8MA 3SK0A 1DX4A 4EY4A 2QLTA 3OTQA 1Y7IA 4Y9SA 2JIDA 3L1VA 3FBWA 1R9NA 1N8SA 1QIMA 2BCEA 5EHNA 1Y8AA 1ZGCA 3I2FA 2QUAA 1UK6A 3P96A 3DOIA 2C8LA 3CCCA 2BY4A 4H0CA 3AR7A 3PDWA 1X42A 3AR5A 4OB7A 3V1LA 5C8XA 2XDWA 1F5SA 1KEZA 2GMWA 2QKYA 3WQHA 2JGJA 5AJHA 2ZYIA 2C8KA 5JAPA 1JKMA 4I19A 4X92A 3CCBA 5JAUA 2HFKA 4NWIA 5C8VA 1IUOA 4XPZA 1BCSA 4CIBA 1W52X 1R1DA 4H77A 3OURA 4QWWA 3QNMA 3STWA 3R3UA 2JGIA 2CFRA 3EWIA 2XMQA 4L72A 5AVTA 3S8YA 4X93A 1TCAA 2YJ3A 4CCYA 4UFPA 2WJ4A 3PI6A 4AN1A 3DEAA 4Y2SA 3G0GA 4WFJA 3H19A 2Z3WA 1S8OA 4J0DA 4LKOA 4YGYA 3ANTA 3VAYA 1Q83A 2R11A 3GZJA 5E2IA 3ZPXA 2BUAA 3PFBA 2R8BA 2YMPA 2PM8A 2FPUA 5HF6A 2EARA 4UATA 3BIXA 4MWSA 3TJMA 4CCWA 3IB6A 4H1WA 1A8SA 3AR4A 3W5CA 1FSSA 1HQDA 2NW6A 1L7OA 3BJRA 4GEGA 1XP5A 3ZX5A 5A7GA 4FLFA 5AKXA 3S2ZA 3WWPA 1BN7A 2JBWA 1WPRA 4ZV7A 3WIBA 4F72A 1ACJA 2OPHA 1TRHA 1MO2A 1HBJA 4BX0A 2HADA 4QZVA 4U2GA 1YS1X 3ZX4A 3TEJA 1QE3A 4DNPA 4LIPD 2RB5A 2OCKA 5JAHA 4G4GA 3NRJA 3M82A 2HOQA 4HXGA 5D3KA 2GYWA 3QPAA 4Y7DA 4H7HA 1ZJ5A 2VJCA 4PO3X 1MPXA 2OCIA 3ESAA 3D2BA 1VKHA 4Q3OA 4FWBA 4JNCA 1YS2X 3A1DA 5AW5A 1XRMA 2I78A 3IUQA 4P92A 2B30A 4BVLA 2D5LA 1L7AA 3HLKA 4JUIA 5DLPA 4HXFB 3FGOA 2HU8A 1U65A 4KX3A 1QIGA 3OPXA 5AW4A 5EIEA 5AKLA 5HK8A 3DJYA 2WG1A 1RMQA 3F8SA 1HDEA 4C88A 2HU5A 3I1YA 1FFBA 3OCYA 1W76A 4UBNA 3KOOA 4KEAA 3FPSA 4GDMA 1QIFA 5KBYA 5A3RA 4G4IA 2WIJA 3B9BA 4Y2YA 3BF8A 3M3DA 1J97A 1K63A 3QUBA 4UW9A 2R8EA 2WLSA 5ALJA 4IHAA 1G5FA 3E3AA 1R88A 1YNSA 2GZSA 2R8ZA 4HGQA 4UBLA 2VT7A 4U2BA 1LGYA 2QXUA 3ZTWA 4OB8A 4KAFA 3WWDA 4Y2RA 5LZ2A 3FVVA 4ZXFA 3AUKA 1XZKA 2ACEA 2AMYA 3FAKA 4B7ZA 3N2ZB 4NFLA 1Z68A 2ZYHA 3FOBA 3GUUA 1L7MA 5AK3A 1IUNA 3PGVA 2XUJA 1AZWA 2RONA 1QTRA 4OB6A 1XRRA 2QS9A 5AVRA 1L7PA 1EVEA 5AK4A 4FLMA 1EH5A 1F0PA 5T4FA 5A7HA 1JUDA 2XUPA 1U2TA 1Y7HA 3F9RA 4H7EA 3KZXA 2QJRA 1GXSA 2PSEA 1UOOA 2G09A 1CUAA 2GYVA 3B3QA 2WG0A 3TGLA 4YIKA 2BAGA 4OCZA 1WB6A 1YA8A 3UM9A 6YASA 5AM5A 4UU1A 1TCBA 3C6ZA 2OCLA 2DHEA 3DV9A 3ZVMA 1U2SA 1RC8A 3KDAA 1RQNA 4KYVA 5LKRA 2CEKA 5AH0A 5JJBA 3UUFA 3QH4A 1YS9A 4Q1VA 2XB6A 5AKYA 2V97A 1G4HA 2QRUA 1TJ5A 1DQYA 5ALEA 3A2MA 4H7FA 4U2DA 3QUTA 2XT0A 4MUMA 3AZQA 3ILSA 1USWA 1XQYA 3IBTA 4AS2A 4L0CA 3N8GA 4CCYB 3RM3A 3QPDA 3D3NA 3R41A 1BN6A 2B4KA 3W04A 3A70A 4J3JA 1Q84A 4LXIA 2DQZA 2C7BA 5ALIA 2GZRA 1JMYA 3G0CA 3HZOA 3ANSA 2XMDA 2OA0A 2J3QA 3FLEA 3R3YA 1DWQA 2C5GA 4Q3LA 1YV9A 5AVZA 1XQVA 4BEWA 2HA6A 3QU4A 3QU9A 5JANA 1CUXA 4QNNA 1WHTA 1CQZA 5ALFA 1Y37A 1CUCA 3NGMA 4B80A 2CUTA 3STVA 3RKSA 5AI5A 3R3VA 4B81A 4MXDA 4W63A 4IH1A 3STXA 4F60A 4BCBA 5AVSA 3KC2A 2GHTA 4G8DA 1YMQA 1ORVA 4J0HA 5LZ8A 4QDZA 5KWIA 4BNDB 2PU5A 1R50A 1VOTA 1L6RA 4E88A 1NU6A 2X5XA 1XLVA 1PFQA 2FJPA 4TPKA 1UKAA 1Z5GA 5AW3A 3L1JA 4Y2JA 2YYSA 4KE7A 4FMPA 1H2WA 4YCLA 2C0QA 1M33A 3WK4A 5JZBA 3DNPA 1BS9A 4QQFA 2XMSA 1AC5A 2J3DA 1CIJA 1XLUA 1KU0A 3IJ5A 2AJLI 2BGRA 2CFTA 2VEOA 3R3WA 2I34A 2OGSA 5IVIA 2PSHA 4JDPA 3AILA 2W43A 5K3EA 5AK6A 3CNHA 1NF2A 3L8FA 4X6YA 4GHWA 5CXXA 1N5RA 4UMFA 5K3DA 2PSFA 4A5SA 3BWXA 2QR5A 3L0CA 5A3QA 4HTAA 5AIAA 5AK5A 1KU6A 1T9ZA 3FLAA 1CRLA 4U2CA 1C7JA 5I7UA 3B8EA 4FKBA 4EHBA 3KWFA 2XUDA 4E14A 5CRIA 3PGLA 4UBKA 4ZEWA 1QIDA 1AURA 1LVHA 4DW8A 1P0IA 3WKAA 2WFLB 1JI3A 4J03A 3GA7A 2IITA 4ZEVA 3U13A 5DTJA 4AO8A 4UHEA 4DMHA 4I9FA 1ZOIA 2XE4A 3L1HA 3VISA 2DHDA 5AOBA 1W6RA 1LPSA 2B61A 4RNCA 2Z3ZA 2JAOA 1NX9A 3C70A 4A23A 5A62A 2G5TA 2HU7A 1RDFA 2DSNA 2HFJA 5ALTA 4BEVA 3T52A 1ZRNA 3EIOA 3SKYA 3QGMA 5ALNA 4AS3A 1ZI9A 1E8DA 2QZPA 3HJUA 4Q82A 5CT9A 1ODTC 3BWVA 3ZTYA 1CUUA 4AO6A 2R8YA 5J3JA 2OAGA 2WUEA 5SYMA 1XZJA 1Z4JA 1CUIA 1YAHA 1CPYA 3ZLTA 1XKLA 3RFUA 4KAAA 4HZGA 1VXOA 4H7DA 5HF9A 1S2OA 4KR0A 2WKWA 2PQ0A 5IVHA 4OFZA 1EB9A 4X6XA 1EX9A 3FCYA 3W2TA 3L1IA 4GBGA 3RF6A 2HCFA 2Z8XA 4I4CA 1ZIYA 3BDIA 3QU2A 4OHFA 1TE2A 1UWCA 1OXMA 5CT8A 1LPOA 5LZ7A 3WGVA 5IT4A 1LPMA 1CLEA 1IWOA 1JFRA 4AP9A 4FFDA 3BL8A 3AIOA 2WIGA 1U8EA 1C7IA 5DNUA 3WK8A 4BAGA 4KNVA 3LP5A 4J2TA 2HEGA 3AFIA 4E46A 1ZD4A 3AR9A 4EA6A 5IKXA 1HKHA 1LBSA 4EY7A 1CUYA 5LYYA 2NYVA 3SKXA 3KDPA 3WKDA 2OAEA 2ZYSA 4MJ3A 3R3ZA 4B85A 4J0IA 4W1QA 2XUHA 4N8DA 4EUSA 1WVIA 2JGEA 4DM7A 2PKYX 2WJ3A 4KNWA 4L6CA 4BNDA 1CUGA 2Q4RA 4OUKX 1C4XA 1UZAA 4O8CA 3FVTA 2O7RA 3QVMA 3DDUA 3IRUA 1D07A 1WOMA 2IOHA 1O03A 2IYEA 1WB4A 2BGNA 4IFTA 3WZMA 5JYCA 1Z4MA 4LHEA 4WFIA 4ZREA 3DYIA 1XZBA 2YJ4A 4HGPA 5CH3A 2WF6A 5AM3A 4FNMA 4L57A 1BU8A 3DQZA 3HLTA 1HLGA 5HK9A 3V1NA 2G80A 4J0CA 2RARA 2B8EA 2HL6A 4MQLA 5CURA 1X2BA 3STUA 2YY6A 3IDAA 2ECFA 1XRLA 4J0JA 1BEEA 4L6AA 3CZ4A 3O4IA 2B0CA 2Q5EA 2WM2A 2ZG6A 4RPCA 2FEAA 3WL5A 2J4CA 3TLMA 1OCEA 1B6GA 2LIPA 5E4TA 1UT6A 2HDOA 3FNBA 3ZLVA 3HABA 2WU3A 4K6GA 1CUSA 3G02A 3NIWA 3WL7A 1T5TA 3KD3A 3SHQA 1IVYA 3L0YA 3OC0A 4AO7A 5H3HA 2HHAA 1LPAB 4H18A 4C89A 4W1RA 4ARAA 4EEKA 2C4NA 4BC0A 2G1AA 5LIPA 2W11A 2XI4A 3QPCA 2HDWA 3L5KA 4BX2A 3ET5A 2WHPA 3O0DA 3IUMA 5AKJA 2BFNA 3BF7A 1OILA 3I6YA 1CFJA 5ALOA 4K5QA 5K3CA 4H7JA 1VXRA 4F71A 3F9CA 1QFMA 3FYTA 1J2EA 2QUBA 2HA2A 4PSDA 3C8HA 1EDEA 1F0NA 5CH8A 1W4LA 5ESRA 3GBSA 2EDAA 3F96A 1IZ8A 2EATA 1QIEA 3ESQA 3U0VA 2E3JA 2XQIA 4G1FA 4ZGBA 2GBCA 1JT2A 1I6WA 4B83A 3G0IA 1XZGA 5JALA 3WYDA 2HIHA 2OG1A 5EFZA 4FDMA 1K8QA 5E0OA 3NAMA 1CUJA 4DSZA 4BATA 2YJ5A 1QQ7A 4AXBA 4XIIA 3N5KA 3FYUB 1ZJJA 4G63A 1UFOA 4GWLA 4HVTA 3IUNA 3SC2A 5D6OA 1ZOLA 3VVMA 3C8DA 3QMWA 4B0PA 4B84A 1EA5A 1Z4LA 1H2YA 3MVEA 4BCDA 3OM8A 5AKEA 3WGUA 3Q0TA 5BV7A 3QM1A 1DTEA 3J7TA 4DIUA 1VZ2A 3P2MA 1W1IA 4XE5A 5CBKA 2I6XA 5KWJA 1AUOA 1F6WA 5AW8A 1A88A 4M0MA 4NAVA 3AINA 3C6YA 3O4JA 2WU4A 4A16A 4GIBA 1RLOA 5IT0A 3OCZA 1B41A 1N9KA 2OGTA 3HEAA 3FLBA 2WJ6A 2ZJ7A 1E66A 3QZUA 1IUPA 1MX5A 3WJ1A 2ZSIA 1XZAA 2B1QA 3WKCA 1WB5A 2OXEA 3BJMA 1FEZA 3AJAA 4I3FA 3UMCA 4UU0A 1THTA 2OYCA 1ODCA 5AM1A 2XQKA 5EHXA 4HGRA 5AKHA 3Q8WA 1O6GA 3O95A 4UHFA 3A3YA 1CUHA 2AJ8A 5CT5A 4S0XA 2C5FA 5ALGA 3WZLA 3ZI4A 3DD5A 3WI7A 1IMJA 3I6MA 3AR8A 5D7BA 3GYGA 3ZVLA 1XRPA 5AM0A 1YCDA 1XZEA 2HRRA 3U7GA 3DS8A 2RBKA 1XPJA 4BP9A 2AJDA 1EB8A 5KREA 4XQ0A 4B6JA 3I6ZA 3WK6A 1LNSA 3PE6A 2ZVDA 5LLSA 4P08A 2HA0A 5AVVA 1JU3A 3H2GA 4QDOA 1MAHA 4UBIA 1A7UA 1ZS9A 4UHCA 2V96A 4CF5A 2O9JA 2HM7A 3AZOA 5FPQA 3R4CA 5AI0A 3B5EA 3SWWA 2P27A 3D2AA 4DNQA 2QT9A 2JF0A 1NNLA 2P69A 2AJCA 2H7XA 1QJ4A 4WJLA 3HACA 3D0KA 4KACA 2DQYA 1ISPA 5EGNA 5ALVA 3WK9A 2RAUA 4CNQA 3KD2A 4C4TA 4P93A 3V48A 2C4HA 5DNWA 2BKLA 1F8UA 2OM6A 2FJ0A 4GW3A 3O4GA 3S6JA 3A2NA 4FBMA 4BTLA 2FDRA 1GGVA 4XOUA 1YDFA 4CI9A 3MC1A 5JD4A 1Z5UA 3N07A 4BVKA 4HXEB 3L1UA 3D59A 5HF8A 3VJKA 3AZPA 1YAJA 4UMEA 4CFSA 2B20A 3ZWDA 3ESRA 4MEBA 5HKBA 3D4LA 3UMBA 1DQZA 4UMVA 1RPZA 2BUBA 2JAWA 2H9YA 1TQHA 2MSNA 3AIMA 4AZ3A 2B82A 4FHZA 4DFDA 3H2IA 3I2HA 2PSDA 3WMRA 4XWGA 2ACKA 3H0CA 1FFCA 1R4ZA 2YFYA 1L8OA 3H1BA 3WWOA 3R3XA 1J06A 3AIKA 3JWEA 1SOMA 3OOSA 5AKIA 1RKUA 4DCCA 1UK9A 4X91A 5FP0A 3VVLA 5LZ4A 4EX7A 2WIKA 1XZIA 2WILA 3I76A 3LIPA 2VJDA 1LPNA 2B1RA 2O2XA 1HPLA 2OLEA 4BKMA 2CMFA 5ALPA 1UK7A 4EENA 4EBBA 3I2GA 3D6JA 4Y2QA 1ZI6A 1J1IA 1XKTA 1TJ4A 2PU7A
chains in the Genus database with same CATH superfamily
4XRRA 3A3KA 5HBRA 2R8RA 4MW1A 3SYTA 1X7HA 2DPYA 1LW7A 4LRUA 4JI1B 5KWSA 1SIJA 3D3EA 1TYBE 5MN5A 2WM9B 2OAQ1 3RB4A 3M9LA 1M1YA 1NK5A 1FJHA 2JCGA 3O75A 4S3MA 3U7EB 2OCGA 2H2WA 2NXWA 3NHSA 2Z57A 3RS7A 1A9RA 2H1WA 3X1WA 3AHFA 4DZZA 1E2HA 4KLIA 1EFDN 1VFNA 2X3FA 3DMDA 3L41A 4OUDB 4UBMA 2BFFB 2GEJA 5FNVF 5IXYA 1OPXA 2PL9A 3P2YA 3DEFA 1ZGJA 2O8DB 3Q1KA 4DA4A 1M74A 3EXG1 2L17A 2KKVA 5CEHA 4C2AA 4RPJA 1RKQA 4ZT7A 5TDHA 1E2IA 3WISA 5ALQA 2B36A 3D64A 2FFHA 5AXBA 4CEJB 3R4VA 2AVDA 2CNKA 4O2AB 2PS0A 3NBMA 1QYXA 4RGVA 2GAOA 3TQHA 4E08A 2YIMA 4ZHQF 1A9XA 5HQ3B 4EHJA 4QRIA 4HB0A 3KFVA 5DULA 4YAOA 4BRZA 3PKJA 5G1NA 2O2IA 5L7TA 4P8RA 3O74A 2DGDA 2Q0XA 2W70A 2EKLA 1YWGO 5K51A 3R75A 3WGQA 1R4MA 3VSEA 5L7WA 3EPJA 3KYCA 3R9XA 1QDLB 1JQJC 3AUYA 4MWEA 1Z07A 3A1EA 5B37A 4ZVVA 2ODAA 4R2KA 3VXKA 3LS2A 5JAMA 3KNZA 3B1FA 4LJYA 2HXYA 1QP8A 4ELTA 1CK4A 1ZUD1 3GH3A 5D85A 1QH8A 2NU9A 3K4PA 1H2AS 3P4XA 2W37A 3LCRA 3WAJA 3A1SA 1H93A 3IUJA 3IR7A 1P0PA 2J3IA 2D59A 2JAQA 2R5FA 4J0KA 1G20B 5K45A 3MXTA 4M47A 1W5TA 3M83A 4ZOLA 4B17A 3A8TA 4LYDA 2WD7A 1GZ3A 2R85A 5A6VA 1ST2A 1LD3A 1YFZA 3GO4A 4DMMA 1Q0QA 5CCBA 4O02B 2XOKD 1VMDA 1ZNYA 2QA5A 1FCJA 2V6BA 4FUQA 2MIIA 3JQ7A 5DTEA 2XYGA 3KYIB 1A96A 5DO9A 4F2HA 2CV2A 3EGOA 5LWHA 2HA4A 1XMSA 3U5ZB 2DECA 4KN7A 1OX6A 3PQDA 3PF8A 5BY2A 2OKGA 1SD1A 1ODSA 3LIIA 3OAAA 3T0FA 4DR4B 1PJZA 3M0EA 4BVFA 1UKCA 3VR2A 2IHJA 3KB8A 3MTJA 4UEWA 3RR7A 2WAAA 4XGIA 3RQIA 3TPFA 4BHTA 3Q3IA 4E5NA 2QG4A 3HNRA 3M2PA 1VMAA 1DIHA 4DB2A 1FJXA 1KDZA 1G5IA 4IL5A 2GAAA 2CHEA 3QE3A 2IIVA 1FFGA 1VBKA 3E9QA 1FP4B 3ZJVA 3OZVA 1II8B 2ZJ6A 4B3RB 1QF9A 3K9WA 1R8YA 2VXYA 2YJZA 3EF0A 3LH5A 5ALKA 1U28A 4FOPA 4I1SA 4U0KA 5K3BA 2CRXA 5K8TA 3IIKA 2XVMA 2WUDA 2ZSBA 1E63A 3KZMA 1ZXIA 1YIAA 3LL7A 2X5OA 4JYMA 5CBPA 2ZWVA 3DWFA 4Z8YA 3I4FA 5I9TA 4RK6A 3IAM6 2EF0A 4DLNA 3I32A 1JDUA 5EE9A 4DGQA 2QSYA 4MHTA 4JWKA 5D5HA 3DFFA 2PJRA 1DAPA 1DELA 2V5UA 4K9SA 2EKPA 3U39A 3RYHA 2VWQA 3SQIA 4OLJA 4IDDA 3DVAB 1PVRA 1KY5A 3GRCA 4R5MA 1JMVA 3BREA 1TA0A 3EXEB 4FDTA 2G70A 3DAFA 3RJHA 1EAMA 1O97C 1NKCA 2PRIA 3DBHA 4F11A 5K2OA 4FNGA 1IZYA 4GFJA 1FYFA 2XAUA 2SHKA 1Z4QA 3D7NA 3HRHA 5C4GB 2VT6A 3SEIA 3V6KA 3I9V1 3ZS8A 3HYCA 3KKKA 3ENVA 4YP1A 5EJ4A 5F7OA 1JL3A 3D3JA 1C9DB 3H4VA 3HCNA 3CNEA 1XRNA 3HGTA 4HEQA 1SBCA 4O2BF 5KVAA 4IQVA 1LKYA 1X2EA 4YRJA 3IKJA 5BT9A 1WA5A 2BCJQ 5TS3A 3VZCA 2ENUA 3TPZA 3UPDA 2OR3A 3M6FA 4EX6A 3LUCA 4YR0A 3EXFB 3ZU2A 2O1WA 4OXRA 5JI3E 3AP1A 5LU8A 1IB0A 1MU0A 3EFEA 2Y0SC 1OZGA 3VOBA 1GFIA 2CJFA 4WDRA 3AQFA 1YZLA 4ZEMA 1Q91A 2EJBA 4L4RA 4UTZA 4QPZA 4LEIA 4YFVA 1MGPA 3VNAA 4KQFA 1YI1A 2NU7A 2O2CA 4C43A 1AQ6A 2IC5A 4F8YA 3BS4A 4FFVA 4GZ5A 3OPYI 1Z39A 4TMFA 3TQSA 4F4CA 5AI8A 4N5MA 4YRPA 2F44A 3PHCA 1G0OA 3TTUA 1IY2A 2C7RA 3LPMA 5FPPA 5K8JB 3KZCA 4IJWA 2C2KA 1PT5A 2WTAA 4DCPA 2FJUA 3L8HA 4UPVA 3GELA 5G0SA 3JATB 1ICEA 1Q57A 3AVOA 5EXEA 4PN3A 4ND6A 2J30A 3TOXA 5G40A 2WWRA 3HB5X 1TEHA 4YPVA 1NMSA 1EU1A 2EW8A 3ICVA 3K72B 3IC5A 5F2EA 4BAUA 2CJWA 4KQMA 3UK0A 1R9MA 2G67A 4HNHA 3X2SA 4RH1A 4K6KA 1XSNA 4KRGA 3K75D 2V7GA 4WLUA 3ZHZA 1NVMB 3E9NA 2O0MA 3JYHA 4DLLA 4FTWA 5A0FA 4FBLA 4EKDA 1T3HA 1SHLA 3AP3A 1PAUA 1KY3A 3LXXA 4RYLA 3ACDA 1S9FA 1NZDA 3DEYX 4KDEA 2OCDA 3CUWA 3AEKB 1X40A 3VU8A 1EQ2A 2C4MA 4G1UC 4IHJA 5FUXA 2A58A 3A9UA 5J4VA 1J20A 1DC5A 2OHFA 1PW7A 4ITVA 2IHZA 1V38A 3ISJA 1E1RD 4U2EA 5K4GA 4KR3A 2YV5A 3KKMA 2W0MA 1YQTA 3ES9A 3ND5A 2CB0A 5LMUB 2IHNA 1VCMA 4C80A 4P3YA 1Z5OA 3RK0A 4JI0B 3N4MB 2JHPA 3K6RA 5F1OA 3MJCA 2YWCA 2VKQA 5AICA 3H1GA 4BNTA 4ETNA 4F9TA 1B3BA 2AG5A 3RADC 3NIBA 3RWOA 3ZQUA 2G88A 2I7DA 1KW4A 1RBQA 4LZJA 4TS1A 3VR3A 1NBIA 1SK8A 1WKVA 1TVKA 2AN3A 4Q34A 1R16A 3G8YA 1SWWA 3WG9A 4AY4A 2O8DA 1AKUA 3H0EA 5K0NA 4GLBA 1RABA 1X8KA 4QREA 4XPIB 4B9MA 1Y1QA 1K6EA 2WR8A 1MXHA 2FZLA 1H4SA 1B23P 3W5JA 4OHVA 4RS4A 3VPGA 5E4YA 4CT4B 3ZQKA 4GSYA 5ICMA 3X2FA 1IEQA 1KP9A 2EJTA 2VH2A 4OHZA 4MQMA 4EJSB 4F3YA 1UMBB 4RK5A 2EBFX 3CIFA 4R4JA 1SELA 4FE4A 2C78A 2RGNA 4QU8A 5DGXA 5EWFA 3VUFA 1F8XA 4C7YA 1OFUA 3ZXXA 2FSUA 4OJTA 3JPPA 4O3PA 4Z4IA 2DERA 3ZBTA 2ZP1A 1O5TA 2ZSKA 3CX6A 1UM9A 3I2IA 3K1JA 1V2GA 1IPHA 1MG0A 3M4XA 4HAYA 1FNCA 3HR7A 4J9VA 5LQSA 5I51A 3C28A 2CMGA 3D6HA 3W34A 4BVEA 4PYJA 4WOBA 2Y0EA 3PITA 4DF4A 5H3LA 3LLVA 4J0EA 3IMEA 4P4PA 5EZYF 1VE6A 221PA 2VWHA 3CKLA 4W1PA 5I7OA 3LUJA 2RRDA 4H16A 1IPEA 2ZRQA 4MP3A 4C8LA 4FHEA 4DLTA 1Y3FE 1OR8A 3Q3VA 4E22A 4E2XA 3H2KA 4X1IB 3TLYA 4X1YB 4LZZA 3HN2A 3PY8A 3TYXA 4DSIA 3H11A 5KTMA 5BOVA 4JA2A 1AF7A 1KZ7B 3WDMA 5B3LA 3E0FA 1XZQA 2ZWMA 3ZY3A 3RAEC 4X63A 3JQRA 4O6VA 1UUFA 2PXCA 3COWA 4CKBA 2IIPA 3T3MB 4EHHA 1D2RA 1D5WA 5EIBD 2PX3A 3PE4A 2B6NA 1SIUA 2A3VA 1PJQA 3K5PA 4DWOA 5J2KA 1Z7BA 3SC4A 6REQA 3LLMA 1X1EA 2IDMA 4UAVA 2F64A 4LSGA 4WWHA 1E5TA 4B40A 4C7XA 5LXTA 2O14A 3F67A 3L6BA 4ZVLA 3C5HA 1OLOA 3HCCA 3WP1B 4GS5A 4M89A 4F7WA 3JQAA 1UJMA 2AN9A 3V7FA 4UQGA 2FSSA 3SJ7A 1Z4IA 3K35A 1NUTA 1NDQA 4O2AF 3CWZA 4D99A 2IXEA 2QE7D 1NHWA 4QYIA 4Q3KA 4NE9A 3DUFB 1EFRD 2ZCUA 4RUCA 8ICYA 2KTQA 3G9XA 3NS1A 3LF2A 4DLVA 4NM2A 1P2BA 1N25A 3QOFA 4TL6A 1JQBA 1TKAA 4LY9A 1FYWA 2CFCA 4QZGA 2QWXA 4BLRA 5TX7A 1QKKA 1ENOA 2FAXA 4MSUA 3ZBPA 2A1TR 1FLNA 3OJWA 1KTIA 2WP0A 2AYXA 5I9LA 3G23A 1NLZA 1Q3TA 1LBTA 3KM0A 3V3TA 4D79A 2KICA 1WZUA 2XUAA 3AT1A 4CHTA 4MV3A 3WLHA 2HJSA 4GP9A 3DMTC 3W05A 2JLVA 4EHLA 3ZC3A 2PH3A 4CL3A 1YFLA 3TACB 2R25B 3ZW7A 1JE1A 1MC1A 4MO2A 4XVCA 4YT4A 8ICFA 1XRSB 3C7TA 3L79A 4ODIA 1UJ2A 2XCRB 5HFJA 1KMQA 2YJGA 3EXEA 3GX1A 2OZVA 2OHVA 2ZTCA 1CR1A 3ZZNA 2Q7OE 4WHMA 3ZW9A 2AD5A 3GIJA 4EMBA 2R6R1 5TT1A 4PLTA 4RVDA 2EGUA 1EP2B 3GRAA 1PR9A 2IYSA 5FO1A 2NAFA 3G85A 1WSWA 2B1JA 4F4FA 3Q2KA 4KE8A 2WSYB 4BAZA 1RMTA 4N47A 2QRVA 1XZLA 4OK6A 2K2QB 3OM1A 2QEQA 3THOA 4L5IA 1SQ5A 4A0RA 2ODBA 3AL2A 4HS4A 2PFSA 3DPSA 3FSGA 1IZ7A 1PKXA 1A7AA 5FAKA 5IJ0A 4RC9A 4YAEA 4LZLA 3BZWA 2XCOA 1PZGA 2H3IA 4C8KA 1M8JA 2YN2A 4YB8A 3DG9A 2B7LA 4JBHA 2NU8A 3G8AA 5ELXA 1QYIA 3DFMA 1ECFA 4RMGA 4REQA 4QU0A 4G8CA 1L8XA 5AUPB 1FNDA 4QE3A 3ICXA 4IQUA 4S2UA 2GLXA 2BGTA 1I8TA 3N76A 1B42A 2ZJFA 3R40A 4IWXA 1P1FA 4N40A 5G3YA 4UB8U 4RNDB 3RK4A 5IYZF 3HYSA 4QZIA 4UFNA 3TEMA 3JQ6A 3H8WA 1Z4PX 4PR0A 3MBOA 3RHZA 1FFDA 3I8OA 4RETA 3FNEA 2GPSA 4M83A 5ALYA 5HMLA 1L5UA 4GI2A 1JB1A 3E84A 1M6YA 1VJ1A 4OHOA 1I2ZA 4X20B 2GK3A 4JI2B 2ZR9A 5BUZA 3RARA 5EXSA 2JKYA 4TQGA 1T24A 2QOEA 4OJKA 1DX9A 3O91A 3RVSA 5KL1B 2VK2A 4BUCA 5KFTA 2ZTSA 1Q1ZA 5FBWB 2CXUA 4O4IB 1GLNA 2JIOA 4G24A 3ZHVA 1X6IA 3WLMA 5IJZA 5AXAA 4W1SA 2ZPAA 1W1UA 5CEJA 3I2YX 3RAJA 5M2QA 2YRWA 4QJBA 2FZ5A 2WTFA 1IY0A 1KZGB 2B92A 2IYLD 5JJLA 1EFAA 1NRXA 1S8NA 2XTZA 1KDOA 1XV5A 3RG8A 2AI2A 2A5FA 3M4NA 4MQFA 2O6HA 4J1SA 1AZSC 1KE1A 3ROXA 3RG2A 2P62A 4JA0A 5E3JA 2AKEA 2GBIA 1MHPA 1H94A 2JGNA 2DCMA 1MH1A 1I4OA 1R0KA 1N32B 1UINA 1OW3B 3CEPB 1LLDA 3LX6A 2A2ZA 1U45A 2HHVA 5HBGA 3FZNA 3NTRA 3M6KA 4UNPA 3U80A 3UENA 4UOEA 3B7GA 3NATA 2FEOA 4UUQA 4KLTA 3BN3A 5K3FB 1RJ9B 5TV2A 1BMFA 2AE1A 4AJPA 3K6SA 1MD9A 2LDBA 2GCOB 3UUEA 4D6YA 3AU6A 1SZHA 5C51B 3FVRA 3EPRA 4JMLA 3NHJA 3HR8A 2ZBFA 4JJZA 5KX5B 2AH5A 4L9AA 5KHOC 2AQ0A 4CKCB 1ODJA 3Q3JB 2AE2A 3SF8A 2BEUB 4FHCA 3IPYA 4F2WA 1FFVA 1UIRA 2BMFA 2MRLA 4JKOA 1J2YA 3LYHA 4RYDA 4LN1A 2YXBA 3AUJB 3RVNA 3HBJA 2YCLA 1ZJ6A 1T2UA 4IZIA 4I2IA 3ETNA 2IP4A 4LSMA 5IM4A 1GPMA 1AXGA 1X1QA 3ANYB 4UEKA 2KSQA 2JFOA 3LI2A 2QQEA 5E1DA 5CH5A 3ABQB 2MR5A 5IHPA 2QTAA 1X9MA 3U5TA 3BICA 5FWXA 5EVJA 1KYTA 4RS3A 4OMUA 3KOWA 4R2WA 2VA9A 2R8HA 1BA3A 1W34A 3A31A 3BGIA 5JFGA 1XROA 2Y4NA 2BMVA 2HQOA 3OTIA 4C04A 4CM4A 4ZYTA 1LBIA 2GDZA 2OEPA 4PNEA 3H7IA 4X41A 1E3MA 1Y1RA 3CNOA 3IPXA 4JYBA 2CL0X 1ZCBA 521PA 3BBLA 3BRSA 1XTQA 2O07A 2WPNA 2Y9PB 4R9SA 4AK9A 3TQOA 4BQPA 5EUMA 1XEAA 2ATLA 5DYGA 4B45A 1JIKA 1K88A 2R4TA 3RYFB 2EIXA 1HYHA 2HWUA 1FK8A 1IU9A 3FSGD 5B1YA 1JH8A 3ZY5A 1KTQA 2WHRA 4DSLA 3F78A 3CG0A 3SHOA 1YCFA 2R87A 1OVGA 3OQIA 3VAAA 1MSWD 1O0BA 5AW7A 1ABFA 1FNBA 1TVAA 2WTXA 1M8FA 3LT0A 3VO2A 2J3JA 1NZFA 4X7RA 2H63A 4MW4A 2GT1A 2YASA 4JJ4A 2MINA 4X8MA 3MMPA 4GKJB 1N7JA 1SUIA 2CV1A 1BDMA 6REQB 3K1ZA 1H4TA 4LK3A 4CT5A 5J2UB 4JI4B 4KTQA 1SQ0A 3C4QA 3Q15C 5K09A 4FR0A 3D2NA 2EP7A 2ZDHA 3IJRA 1OREA 3N3AC 1QTIA 4RPZA 6Q21A 4I2JA 1DDIA 4P3PA 3KKNA 2FYTA 3SDZA 2A1JB 3OZBA 4TRNA 3E7XA 4Y0AA 3WQRA 1ZIOA 1NMQA 2AJTA 2PUWA 2WJVA 3OD5A 1WUJS 3DP7A 1Z2NX 3ELUA 5DNCA 4HN4B 3ZWWA 5BOMA 3H1FA 4LOJA 3WFJA 3QJ5A 2RHTA 4FFWA 1NW7A 1XOIA 4B4KA 4RHUA 4JV1A 8ICHA 2LIVA 5JPIA 4QTUB 1QZ3A 3RUHA 3I37X 1D8TA 2LTAA 3P0JA 5MN6A 4BUZA 1IJEA 4KBYA 1YASA 5F2OA 3SZRA 3TOZA 4LF8B 2IV3A 2PGLA 3D8BA 1REQB 4HEJA 5J0XA 2NG1A 3M81A 4AKIA 4GZ6A 1JBQA 1KJ9A 4G8BA 1WE2A 4UVDA 3ED5A 1AVTA 2JGLA 1GNPA 3TRKA 2A5DA 1VYVA 2YHAA 3OU2A 5DWDA 2XRZA 3BMCB 4BVGA 3VMMA 3GQVA 2QJWA 4QXMA 5HQJA 2HVIA 2BE7A 1OZFA 2BZGA 2X4DA 1QO7A 3INTA 3WL8A 5IKMA 4KODA 4DL4A 2TMGA 3IKMB 4IPTA 2M9MA 2FPRA 3PFCA 3QMMA 1FX0A 3EVGA 1DV1A 3T1YB 2KHVA 4UBJA 4ZCPA 3AUAA 4YALA 5IKEA 3MWEA 1XDSA 2C0PA 1H2HA 4RWZA 2HF2A 4FYJA 3LT2A 1NJFA 2MYNA 1PUJA 3B1YA 1MB4A 1EFHA 2XKBA 4G25A 1GKKA 3OZRA 3PD1A 1V8PA 3KSMA 3OQHA 2DYKA 2XDQA 3H5TA 3UMYA 8ICSA 4MI1A 3UW1A 1R64A 2BKAA 1X7YA 1QFJA 2YMMA 4PZYA 4UTPA 1U8ZA 2EKBA 2H4ZA 2V4RA 3OD1A 5GV8A 5EMKA 4D9FA 2B9EA 4IDQA 1XZFA 2VZ9A 4QLAA 4WH0A 3KXDA 3D0QA 5ADWA 1MMFB 1RQ2A 1QFZA 1TQ2A 2FUEA 2O1SA 2ZJYA 3DMRA 5HFNA 1NF9A 2XKAA 3E2EA 3LBAA 1SU7A 5J9FA 4BBAA 3KXIA 1PV1A 3VYWA 3CR7A 5JD5A 2W71A 3MGIA 6LDHA 4J3NA 1AX9A 1I80A 3ORRA 4OQZA 4ENPA 5IJ9A 5HCUA 1RHQA 3OUZA 5FXMA 2QTBA 1X7DA 2EDCA 1Z4NA 3TRFA 3QSYA 1EHIA 1SOVA 2ZRCA 3X1ZA 5C8ZA 1USIA 3SQLA 5TMPA 1G41A 2I03A 3VBEA 2YNMA 2JIRA 3F73A 4K4IA 3COJA 2FPXA 1Z82A 2GLTA 1DLJA 2HSEA 2FWAA 2RGUA 4X20A 3V2GA 3A9RA 5LJLA 1GN8A 3L8GA 1CJCA 1K3UB 1WMDA 2ES4A 3MUOA 3SHFA 4DDTA 3W5BA 3IQIX 3D7RA 3RSGA 5FYQA 3QU7A 4OLBA 1WP4A 1U2EA 4RK1A 3A28A 3HSSA 2ZIWA 4K3UA 5HKKD 3KOZA 2PN1A 1IQUA 2F17A 4B3BA 1NW9B 2VHZA 3H97A 3ZCQA 1XDWA 1O0CA 3ETHA 2W6IA 4IH4A 3AU8A 4Q4AA 4HB3A 3UATA 2PMKA 5JS6A 1YR8A 1ZJYA 2XA2A 2O7VA 3A6LA 2IQIA 3ABRB 3GJQA 4HDQB 4L4SA 1P7VA 3QITA 5GM2A 3VA7A 2JLYA 3O8OA 4B6SA 4XSVA 5I9IA 3C43A 4PQFA 1M2FA 1UA1A 3BMOB 121PA 2BPFA 3C5FA 3MDCA 1EJ2A 3PWZA 4Q48A 3TTTA 3R24A 4BRUA 2Y0SF 4FM9A 1RKXA 4EB8A 1Z2EA 2JNWA 2AXEA 2BFPA 4J3FA 3AM9A 2EBWA 4BMSA 3DDWA 4MF8A 3ZV3A 3B48A 2RGXA 4BNIA 1F1BA 1Q1AA 3UV7A 4JEIA 4KV9A 2IDJA 1VCHA 4BTEA 3MFYA 4ECSA 2BGIA 3SP1A 2XNDD 2HK6A 2HX1A 3OEED 2YCBA 2A8YA 3LC7O 1IM5A 3OSNA 3CF4A 2JEYA 2AV6A 3TXXA 1UPFA 1XQXA 1SKSA 2Z2JA 3CNLA 1VG9B 1Z6GA 4TYYA 3AERB 3LQYA 1NVVR 4B3JA 2C0CA 5J2IA 3U6BA 1R3DA 4M8LA 4QBIA 4EQ6B 1P5ZB 1GPAA 2ZULA 4LYJA 4C3UA 4C4YA 5BWBA 5TISU 2QDKA 3RRBA 2GBLC 4WZZA 1KAGA 1SOUA 1PYDA 1N2GA 2ZI9A 1CQPA 3SOPA 4V2IA 3P9PA 4GECA 1HL7A 4K2AA 5TMDA 5B1SA 4DR1B 5K8IA 4DYHA 3VTKA 1GPKA 3TSOA 4M21A 1X13A 1JA9A 1SRRA 1IDOA 1T29A 3DDCA 3EDQA 3G7SA 4M04A 3K32A 5K3AA 4D9BA 1VJRA 5JLAA 9ICSA 1WUYA 3L18A 4IVPA 3W90A 2R8XA 4LSWA 3WKBA 1HMPA 4BOYA 4FZMA 4YP5A 3WQQA 4PO1A 1EHYA 4P53A 4TT8A 4ZYZA 1ZU5A 3LFHA 1A2BA 5GVSA 3ZQ6A 3PJRA 4R16A 1UIMA 1VA5A 3Q7QA 4YH1A 4YRRA 5E9JA 3TQRA 2AS0A 2WICA 3ANMA 3WMGA 3FGNA 4FOSA 2NT3A 4WZBA 1FTNA 3IXMA 2FE9A 1P2UA 3EEYA 1N60A 1EBFA 2GN6A 3SM3A 4ZI5A 3CP8A 5FEMA 1CVIA 4OPMA 1A9SA 1F12A 1JWBB 2ETVA 5F7ZA 4PGMA 5JCJD 3UT0A 4QDXA 4FEAA 1U8AA 2X8BA 4JP2A 1L9KA 1N5WA 3FW1A 3T5LA 1RAIA 3AUOA 2MINB 3RIMA 3VAZA 5ENZA 4DMFA 3WLAA 4HYTA 2A5GA 4FZRA 2XBLA 9ICAA 1SGWA 3DONA 4LE2A 4E5UA 1J1UA 4IIGA 3JZIA 2WB1F 1ZQAA 4A8JC 5KFOA 1HTTA 1S3FA 1V45E 1WXGA 1XQ1A 3E2PA 4OHXA 3KEOA 4QUHA 4UREA 3IERA 3NETA 1ZN2A 4G5RA 4BN0A 4DXAA 1Q11A 4I1VA 1O8CA 3GGSA 5EOVA 3T7RA 1DFGA 1YL7A 3CN7A 5AW2A 1CS4C 1E64A 2Y0PA 4TYMA 5CB4F 5C9ZA 2Z8ZA 3UMGA 2Q5IA 4UPEA 3THRA 5KTOA 1D03A 1JS1X 4BE7B 4HQFA 2M1XA 3DMYA 2H1CA 2FSPA 2H65A 3K0HA 2PUHA 5CVVA 3VR0A 3OTWA 1G5PA 1UDWA 1TUGA 5KNBA 5DX0A 2OCEA 3UXHA 1ORDA 2ZTVA 2GZDA 5EXXA 2JFVA 4O4JB 1NG1A 4M6WB 5CTAA 3AFMA 3C45A 3IMFA 4WNYA 2UVPA 1MIOB 2I55A 3GCDA 5H68A 1IBSA 5AI4A 2DHCA 3G1UA 2VHEA 5AIBA 3AJEA 4JUFA 3CVJA 3CF4G 2RDJA 4FMBB 4B74A 3R5KA 3E27A 3VR3D 4QSMA 2AGPA 1JR6A 2RGDA 4G5YA 3CEAA 1QVWA 3EH2A 4MV0A 4AG5A 2QN3A 3UPUA 2QSUA 4ZYWA 5B3AA 3BFKA 2ECQA 3X2EA 2XTJA 1XHFA 2BM8A 2VXCA 3RU7A 2JK0A 1Y33E 3WWCA 1U98A 3K1TA 3VZPA 1UBNA 5B6JA 2MMCA 4KCGA 5GJCA 3N8DA 2Y6UA 4ZCTA 3VHQA 4MRMB 3BCRA 3WK7A 4IY1A 1E0DA 2WF7A 4Y2PA 3F49S 1A9XB 4RHYA 5CVTA 1Q1GA 2FSVC 5JAQA 3TZLA 2NV6A 1GQSA 4HLCA 4R9VA 4QUJA 5BYJA 1GNSA 2P75A 2XDQB 3NM4A 1MXFA 4I9GA 1VCOA 5KYWA 2UVUA 4L50A 5GJBA 4G81A 2ZXIA 3FB4A 3NRCA 1JPNA 2H0AA 4JJEA 2VJ5A 2WMOB 1QG2A 4JH0A 4DSAA 4TLCA 1T2EA 3I9JA 1J22A 3T3FA 4MIKA 1H6DA 1R12A 1E9RA 2ID9A 5KG5A 3AYXB 3B53X 2XNSA 1U4BA 1SKYB 4TV9B 3RANA 1ZJMA 2KHZA 3G13A 4DWWA 3CLTD 3Q1LA 1QGUB 4TTPA 3T5DA 2H1SA 3G82C 2IYVA 5JTTA 1QRRA 3RIGA 4UM7A 2V7VA 1XMQB 5CLQA 1CQWA 1L5OA 1R8SA 5FHRA 3QYPA 4QOFA 5KVSA 1KVQA 2Q1XA 1JB9A 3BE8A 5DCWA 1WYGA 4G0WA 4TZ6A 1DJPA 3M5PA 4CBVA 4DJEC 4F5PA 1PDVA 1QBGA 3KX2A 4UCFA 4HLNA 5DYTA 1QCKA 4PIPA 3HJAA 1D0VA 3EDOA 2GBFA 4YLYA 3PCTA 1M6WA 1TO2E 3K1RB 3MTAA 1R0XA 1OC2A 1KZ6A 2PKQO 1AQIA 2GFQA 2Q29A 1Y1PA 3CX7A 5BOSA 1XMOB 4NXMB 2P4HX 2I33A 3MB8A 4HRXA 2CLCX 4P5PA 1KJWA 1PK7A 3PX4A 1S7CA 2OWEA 4HXYA 4OHMA 2PFGA 4ZVOA 1N62A 2XOEA 4BQIA 5E1BA 2XB4A 4QDKA 2G83A 5JOQA 3W06A 3RVPA 1VL2A 2HTEA 2OFXA 1SZDA 4DLSA 3PNVA 2JC3A 1U2ZA 3NHKA 4OFXA 3RTEA 5AOCA 3UXOA 2Z9DA 5EQFA 3TCKA 2BFCA 3TI7A 3QXGA 2VPTA 1Z88A 5J8YA 3HW8A 4IDFA 4EH1A 3DOFA 5EIAA 4ARCA 5FRDA 4EVSA 3QQ5A 3SD7A 4UBOA 4G6ZA 1BROA 4Q4CA 5LD2C 1UJ6A 3MW8A 2EOAA 4L07A 1TFRA 2ZIVA 1UFKA 5EWMB 4FYKA 1Y5RA 4BE4A 1HLFA 3GZTB 4EW3A 5BSTA 2NIPA 1OXBB 3BDAA 1FFXA 2GCGA 2AOTA 3EUFA 3EVEA 2EFYA 2R6DA 3QY0A 3SICE 4YV2A 3O3NB 2J4DA 2QI9F 1DAFA 3DUWA 3RJKA 1ZNQO 1MNAA 2XUFA 3G49A 4IX1A 1TTQB 1A27A 3HHPA 2OFWA 4PGGA 4WRRA 1HDYA 3H13A 4HTFA 1M6VA 4MYCA 4DR3B 5CX1A 3MS2A 3O9VA 4D0SA 4RENA 1R0ZA 4EHAA 4DOAA 1H6AA 3V8RA 3U62A 2I8LA 2JIZA 5CGZA 5K6AA 2V6JA 4J9KA 2QIPA 3EYWA 3H9EO 2ZXHA 1HUOA 1DQPA 1SXJC 3ESCA 3MTDA 4X97A 4EY5A 3GLGE 4XFKA 3LVFO 1TO6A 3FPAA 5AVJA 4DIKA 4GR5A 4H0FA 1JLMA 1G7CA 3NPMA 3R77A 2Y9UA 4Z53A 4UMDA 3WYNA 1B0XA 4Q7MB 3C6QA 3FTPA 3DPUA 3MLEA 4FFLA 4JKYA 4UTOA 2VA2A 1XXHB 1M5TA 3TIFA 1VJDA 2G9VA 5DRTA 4R8KA 5FTKA 3SX0A 2IX9A 3HC7A 4O5KA 3V34A 4DYVA 3NU1A 2D0DA 2O2JA 1UPTA 1OJLA 5TY0A 1B2LA 1GQYA 3S5UA 1U2GC 4HDAA 1ZGBA 2H0QA 2XADA 4BFVA 4OBWA 4CL8A 1NR7A 3RSZA 1UEJA 5TJHA 2X77A 5K0ZA 4BGDA 2P2DA 2PTHA 3OU7A 3B6EA 1WPGA 3LLUA 3Q12A 2JI4A 3DR3A 1F5NA 4G4SP 3N28A 5JZVA 1UC4B 2C4UA 3M8RA 4MUIA 1GVHA 4NEHB 5JVDA 1S8FA 2Y1KA 3ZU6A 4R81A 4BFXA 2WVGA 4HZUA 2NSLA 3UWMA 3K20A 4RHCA 5EP4A 3D3KA 4TZKA 4QRHA 3EBOA 1P9LA 3ZWYA 1QZZA 3PDJA 3DPIA 3QNUA 1G5RA 2UZ1B 2PV0A 2H4WA 3C6BA 2YMQA 3HRDD 1GTJ1 2MWMA 2YINC 4WIAA 1JFTA 1T2NA 5A6SA 4U02A 4DR2B 1IVSA 1AUQA 2D7DA 1GKLA 2FR8A 1XLWA 4PSUA 5U4XA 2GOLA 5C0YA 5TIIA 4M9CA 2RBGA 1TAQA 3B5JA 2ZUDA 3ICCA 4JJFA 4BGUA 2IHBA 3DVQX 1HDXA 1TAUA 4G26A 1NUSA 4XEUA 4B4DA 3IB3A 4B6GA 3GRFA 4KRYA 1FLAA 4ZI7B 1FXWF 3H2BA 4EG3A 5HRUA 1Z6PA 2GEUA 4Z6KA 2O8FB 1XB2A 5ITVA 5AI9A 2QTGA 3H17A 3GNLA 5IUKC 2B3TA 3AP2A 3DF9A 3UB2A 5HWSA 3L46A 4DZTA 3NTLA 4RD6A 2BL4A 2GCEA 1VYHA 3R5SA 3DKKA 4ARZB 1RHJA 1E3WB 4PHEA 4RQ4A 1LLFA 2PYIA 4E30A 1UDCA 1X38A 4AY3A 2DB3A 3ET4A 2W9CA 1TAMA 1XWFA 4DMLA 2AOVA 1O97D 1T36A 1OFGA 1M34E 1XX6A 3PZBA 2C3UA 4J7CA 5A4FS 4KRXA 5I8PA 3QKRB 1BXRB 3H75A 3DHYA 1U3FA 1A5BB 4NU6A 3ZI7A 3G2JA 3N7UA 3VYVA 4P36A 1YRHA 4CF3A 2OVFA 1E2BA 1MIOA 5DG9A 5JNSA 1HV8A 3AF2A 4F3KA 3TNJA 3VR6A 3TAXA 2JHCA 3ZK9A 4CI0B 3C5WP 3QW2A 5ISMA 1UEXC 4IOMA 1Q2XA 4G0YA 5K2MA 5KAMA 1D2AA 1VGRA 1Y5LA 4QYTA 4ZDJA 5AESA 2HHHB 1PWZA 4DADA 5JPDA 2OCBA 4B9EA 4NCBA 2QXTA 3IP5A 4OJLA 4JR0A 4IM7A 3QVXA 4XZ3A 4B73A 1U7OA 2PFQA 5E7JA 1M7GA 4XWKA 4KOEC 4H1TA 4Q9KA 3EEQA 5ITZA 5A9RA 1KRWA 4EY4A 2PMBA 4CDMA 4C07A 4NJEB 5DCLA 2ZBUA 3MBKA 1RYUA 1JYFA 2KFNA 2V0NA 3ILYA 1N5XA 4QVIA 2UU9B 1Y1LA 3RF9A 2ZJ1A 4MQBA 1AS0A 3UWKA 2JL1A 3L1VA 2E49A 1R6XA 2Q8NA 2XNJA 1ZXBA 3LVBA 1R9NA 3A58B 3DHWC 2GLUA 1A4RA 2VNSA 1H05A 1J9ZA 3B5IA 2GCNA 4EI7A 4F1KA 2HPHA 5CXQA 2QRQA 1X1TA 1ZGCA 2VRCD 2QUAA 3I2FA 3SX2A 3TR6A 2Z7JA 4Q21A 5IIKA 3RVLA 4YXMA 1EPUA 1MX3A 3GL9A 4FT2A 3AR7A 2YTZA 3DE7X 4H0CA 1V25A 5ECDA 3SR0A 4BDPA 3DW1X 3I9V6 2R96A 1RU3A 2BFWA 1Y80A 3ZHRA 3V1LA 5C8XA 2LYBA 1I5EA 4RSHA 4B3XA 1Q21A 3WL4A 4GWGA 4MTLA 2NYUA 1KEZA 3G17A 1BVSA 1BO6A 5BNIA 5JYEA 2PXHA 3IIEA 2WNSA 1H85A 3DXXA 5JV5A 5G02A 3I1JA 4X92A 7ICMA 4TTAA 2R18A 3CCBA 4W7HA 2IZ6A 4Q47A 5JAUA 4WVFA 4NWIA 2BFBB 2XKJE 3DDZX 5C8VA 3M5CA 5JVDF 1UDRA 2CNNA 3NVZA 3KTFA 1BCSA 2G28A 3O4VA 4GMHA 4H6VA 5GOTA 5TJ9A 4EFNA 3DXZA 3K0AB 3CVYA 3S99A 3SGLA 2VTDA 5KC9A 3BH7A 1J9EA 3GLSA 3HB0A 3HCPA 4QJ3A 2JD0A 1W49A 3QNMA 2OHOA 5A1TA 3F3KA 1UP4A 5C8YF 1T9DA 3R3UA 4WAUA 5CDSA 1KFTA 1YZTA 1KEWA 2JAHA 3BHNA 3EUWA 3MTBA 2CFRA 4L78A 1TF5A 4KQ2A 3TNFA 5JWHA 1ZSNA 1JQAA 3HJRA 3OLCX 4L72A 4YFYA 1OWNA 3FOFC 1FP6A 3PJDA 3MJFA 1QGOA 1ZUHA 4YO7A 4AN1A 4I2NA 2I67A 5SY4A 3FPCA 4LJAA 1EQUA 4WFJA 4AJ2A 4ERNA 3OGUA 1S8OA 3L0ZA 3E9MA 4NZNA 4LKOA 3EZGA 1ZA1A 1CR4A 2WMNB 3G8CA 4FFSA 2YHSA 2FSFA 4F4ZA 1T4BA 2CZGA 4R98A 2VNJA 5J40A 5K8LA 5LDDC 3VAYA 5FOSA 2R11A 1GTMA 3Q7PA 1E1CA 5DCUA 1ZL0A 1FQWA 1ZRHA 3ZPXA 4YMLA 3O26A 3TECE 1WV0A 4HB4A 1PJ4A 1CY7A 2EFHB 2G25A 4PWZA 1C3OB 1GCUA 3V7LA 2HLHA 2HYDA 4RLSA 4E5DA 1TB4A 2E4ZA 1ZK4A 1QHEA 1K66A 2EYQA 1GFWA 2LBPA 3FPJA 4UEQA 2GWSA 1IN7A 1VG0B 2EARA 3A26A 3F3YA 2QTHA 3BIXA 2VUIB 2PGIA 4H1WA 1A8SA 2ZS9A 1KFKB 2FPMA 3AR4A 3D5TA 2AW3A 1MFPA 2OESA 4YA6A 3ELYA 4NYJQ 5C0OE 3NAQA 2QRMA 4X84A 1AXEA 2VYVA 2Q6VA 3NDJA 4KYIB 1CDOA 3QKSB 1TM4E 3V00A 4ALNA 5DM60 2ZS7A 4M1EA 5E1MA 4E4TA 1RWWA 1K6IA 4AD8A 3C7DB 4I08A 4UTVA 2Y1LA 1KPGA 4IYJA 1U6JA 1JKFA 1BN7A 4K8RB 4EHIA 2H0RA 1BG6A 4OGLA 5FJJA 1H8EA 3A1FA 4CCAA 1U31A 2OBLA 3S70A 3WIBA 4NLCA 3GFRA 4ZANA 3K8QA 1R6TA 1ZJWA 5D1NA 1U6IA 3NHZA 2OPHA 5IZCA 1F0YA 4ZAFA 2YVLA 1LLCA 4OK5A 1HBJA 4ZN6A 3EWNA 3JVEA 4BX0A 1OXJA 4DLXA 4NONA 4OIMA 1YMUA 2HHUA 2CVOA 4Q3DA 4EO7A 2I65A 4QZVA 3BMXA 1Q95A 3MK31 4TMTA 1RYNA 4ZP1A 3SQXA 1XNJA 3QWAA 4C4PA 3EPHA 1Q0UA 3BERA 2QT1A 4J6EA 2XYRA 3OSZA 4MB6A 2EP8A 2C2ZA 4QAJA 4MR9A 2IV7A 3TD6A 3HJGA 3WYBA 1TNDA 1FXWA 2QB0A 1KBQA 1RM5A 3GJ0A 4ARSA 1Q7BA 2LGJA 4L1KA 3T5CA 5H4HA 3K1YA 3MAAC 4C30A 1KI6A 2SCUB 2RB5A 1M72A 1X1SA 4URWR 2QLMA 1ZKDA 5HR7A 1OBHA 4G1CA 5E38A 3NRJA 5GGYA 1YNOA 3EFOA 3HFGA 4B2YA 2G1PA 3AHEA 3ECAA 3WOVA 3PHIA 3SZOA 3UAVA 4XM0A 3OPVA 1QU2A 4WZAE 3SC2B 1NE2A 3QPAA 1I2CA 1Y88A 1YRBA 4KXFB 1I3OA 4WUTA 1KH3A 4BS9A 1KYZA 3QBDA 3TG8A 3JAMA 2VHTA 1T26A 3A6JA 3GCGA 1YZVA 2RGRA 1EEHA 3S68A 1SKWA 1HNNA 2XUZA 1I13A 2LKDA 3LO8A 1GZDA 4HFNA 4ND8B 1QLJA 3I0NA 2QNIA 4FQ8A 5M5BA 2M6LA 4NG5A 3T5JA 2PGXA 5IIMA 1KO1A 2ZI6A 3BMNB 3ESXA 4Q3OA 5HG0A 5JSZA 5JQGA 5LVAA 2AMVA 4FWBA 3FYDA 4IDGA 5EJ5A 1YS2X 1P4RA 4EM6A 2K7FA 4P92A 3UWDA 7ICHA 2Q3CA 3I9FA 3OE7A 4TRJA 3D2LA 4JUIA 3VQTA 1P19A 3M5WA 3T0IA 1DG3A 5EAIA 2CT8A 3O2SB 3DZBA 3KK0A 4K26A 1N2OA 2HHTA 2HU8A 3DZCA 4KX3A 3SOZA 2HBLA 2ZSEA 4R3NA 4ICAA 2Y76A 4CM8A 4Q9IA 2HRCA 1MRNA 4OBEA 1LF0A 3PV8A 2JVJA 5GZ6A 4OA5A 5AKLA 2NYRA 1PP4A 4KP7A 2GI4A 2VN8A 8ABPA 1YQDA 2FHSA 2WG1A 4X6LA 2Q5OA 2Y77A 1OBFO 1RMQA 3MSCA 4PLFA 3NAZA 1JLKA 1OBOA 2COUA 2OORC 3LUPA 2Y1OA 2HU5A 3I1YA 1JJ7A 4WCFC 3THWA 2XXAA 5E6UA 1K7XB 2FGJA 1LDYA 5ITZB 3IOBA 3SS9X 3TR5A 2XIDA 1LI5A 1VBNA 3MWYW 4ZAZA 5GJVC 3AL3A 3KOOA 4GKBA 1PL8A 1YC5A 3OOJA 5BXYA 4P98A 5KBYA 5DTMA 5A3RA 2OLKA 1OAOC 2P9YA 4DS3A 4XWWA 3BF8A 1PK1B 2NO6A 4C78A 4I1UA 1S3IA 2CGEA 2FZKA 2DX7A 3P0RA 3OZ7A 2O3JA 3GLKA 3U17A 4E5SA 1Y6JA 4CGZA 1PVDA 2HNKA 2W6ID 2YWHA 4O5OA 3WGIA 1C30B 3FCAA 2V4ZA 1YDMA 2IUTA 1S96A 3U31A 2IF0A 2AW5A 2JIPA 5CBPB 2DLNA 2UKDA 1R88A 2J5BA 4DQKA 2GZSA 3FWNA 3GLHE 4HGQA 5F51A 3T7EA 4UUPA 3R8XA 1NW6A 2V7EA 2DAPA 4C1BA 1TK8A 1QYRA 1WZ2A 1XEXB 3MSXA 3ZIAD 2AF3C 1LGYA 4KWTA 3ZV6A 3IPAA 3G5LA 3UGJA 3PWSA 5WRFA 4OIFA 3A0RB 5AT1A 4LY0A 3CT6A 2PQ6A 3NKVA 2DQ4A 3MPUA 4KAFA 4M60A 5LZ2A 5KFEA 3RRJA 3BL5A 1PT9A 1XZKA 3QI7A 4XB2A 4KYUA 2Q6KA 4GLJA 4HPWA 1RZVA 4JK3A 1ONOA 3AMVA 3FAKA 3BOSA 4PCLA 2JLQA 3ZD6A 1J2JA 3OJFA 2ISSD 1AKEA 3PYMA 3FOBA 3GUUA 7ABPA 5J2UA 4OLHA 3ITKA 4X45A 1GG8A 4MPTA 4ZOEA 2FW9A 3GLHA 1AZWA 4K1XA 1XRRA 2X0EA 4M7PA 4F3RA 5AVRA 3KQLA 3RAGA 2E5SA 4FW9A 5DXJA 4ESEA 2A1JA 5AK4A 1ZZGA 1DO2A 1AH2A 5T4FA 1CRZA 2X2EA 5A7HA 1YQWA 1KDTA 2XUPA 3AJ9A 2WYUA 4NCXA 1KMMA 1QH1B 1QZXA 1XJ0A 3DAYA 4M0DA 3WJ7A 1RI4A 1CZLA 4KVFA 4MGHA 2DPXA 1WG8A 1HE1C 3OQJA 4IGIA 1S4MA 2VK4A 2GYVA 2FWRA 2X4IA 5BV8A 4ME6A 4YIKA 4OCZA 1IZ0A 1Y7PA 3K3PA 4MVJM 5M29A 2PXIA 4OQFA 1MJGA 4L7VA 2D8CA 1SIBE 2OHJA 3EA4A 5GMOA 1YA8A 1D4AA 3ID6C 3NBQA 4DLBA 4OI0A 3FR8A 1J0BA 2J6TA 3L4SO 3ICQB 1A5SB 3PQ2A 4HNRA 4FEGA 1S0NA 5CDUA 1V5EA 2BQUA 4MI6A 3ENWA 1Z45A 3UJHA 2DHEA 4KTVE 4OH7A 4RIHA 4YJ2F 1L4HA 5C1OA 2IBTA 1YUMA 3JAWB 1U2SA 4OI4A 5LB4A 5JWOA 1FSPA 1ENYA 2BR5A 3WGTA 4JLBA 1RQNA 3E9DA 4ZQBA 2WZCA 3I92A 3K05A 4KYVA 1C3EA 1DTWA 2F3QA 3JSXA 4DARA 5AH0A 2Q5FA 4TMYA 2NSJA 1KSFX 4JJ7A 1MB9A 4Q3EA 4ENQA 5BRAA 1J5PA 4OY3A 4RKQA 3VX4A 3PLRA 5IAAA 4F5OA 2FQYA 1X7ZA 1XDZA 3TAUA 1EK0A 3QLVC 2JLXA 3GRUA 1KIAA 1RQ7A 3K7EA 3OUTA 4HDKA 4LZPA 4Q1VA 4RA9B 4ZMBA 7ICVA 5EKXA 3MMSA 5AKYA 1ZVVA 5E2BA 1KHTA 2G0NA 3OKFA 3HKEB 1L3UA 4YXWD 4ZU1X 3JPQA 1ECCA 1M66A 3SJAA 4UU8A 1PT8A 3UT5A 1CKEA 4R1SA 3ACBA 3BTUA 3LHFA 1KI1A 3NCHA 3ZNPA 5CGQB 1CT9A 2QRUA 1PU2A 2AHOB 1IXSB 1IC6A 4TTVA 1Z36A 1NK9A 2C07A 3A2MA 3RASA 1WMEA 1YUBA 3WWYA 4U2DA 5LSAA 1ZC4A 4UXJA 1QR6A 1L7BA 1GY8A 3FGZA 5B7NA 3HCRA 3IBTA 4AS2A 4EG6A 4CV2A 5EGSA 4A03A 1DGSA 4KR6A 3PX0A 3OM0A 1TGYA 1Z2PX 3ADPA 3EVBA 2VQFB 1HC7A 4L9RA 4ZVRA 4GMXA 3R41A 4DLKA 1ADJA 2REBA 1MEOA 1Q84A 2R68A 2A0KA 2CJYA 3NNSA 2H31A 2GWRA 5I8ZA 3U3XA 3W7AA 4Z1MD 2XMPA 1E5LA 1ZQ1A 3RS4A 3HZOA 3MJVA 4MB0A 2XMDA 3KLNA 1ONPA 2OA0A 3QLUC 4ZZ0A 4PS1A 1E60A 3FLEA 3IPLA 3R3YA 2GNPA 4C0KA 4FXOA 2XA9A 3C7AA 1YD7A 1MZVA 2NSHA 3C15C 3G5UA 3RRGA 4ZTZB 3QU4A 3QF4A 1Z34A 4MS3A 3CR3C 5LCXA 4X44A 4RTQA 1BHQ1 3ETDA 1GVNB 3R23A 3BXHA 4R0VA 1H2BA 2IWHA 4RK7A 3RH0A 3W6ZA 2F2AB 1BGXT 1JAHA 4DS5A 1X7WA 1RJDA 1KSPA 5JQGB 4EFDA 2HF8A 4PFKA 2PA3A 4QQNA 1Z0UA 3STVA 4HGYA 4DV6B 5AI5A 1BKSB 1TRKA 1LF5A 4I9NA 1IH8A 1E3LA 5BWNA 1B93A 1JDNA 2FW7A 5DXAA 5ES3A 1D5CA 5DMXA 2CNWA 2ZIEA 3W5HA 5AVSA 1XTKA 5BUSA 5KSYA 1PX0A 4B48A 2GHTA 4L51A 4QEZA 1YMQA 3BK7A 2NRTA 1FXUA 1GNRA 1GR0A 2OBXA 2OLJA 1H1LA 4QDZA 5LZ8A 1L5KA 3ZXIA 1FYVA 5KWIA 1NA5A 1HDCA 3JQAD 4LE0A 5HCNA 2ZR0A 5INTA 4QWAA 1TC1A 2XODA 4HHEA 1NU6A 2P91A 2X5XA 2BGJA 1XLVA 1WDKA 3IAUA 3I42A 4JLPA 4QUDA 4TPKA 4AT1A 2VAPA 1RM0A 4R41A 2GN0A 3SKVA 4Q1EA 4DABA 2VNAA 4PTLA 3VR5H 4ZIRB 3KFLA 1QV9A 1ANKA 1RCFA 5DP1A 1EWKA 3QV1A 2BFFA 3BS5B 2LM1A 1N8KA 3FOWA 3HCBA 3UMRA 4EW1A 5CIYA 3BVPA 2AXNA 1W25A 1NP3A 2I2FA 2ZSJA 3HXTA 1YCHA 3JVIA 2J3DA 1PK9A 2AQKA 1RT9A 1XQ9A 3C1AA 1NUAA 3K9LA 2VTBA 4JJ6A 5P21A 2IFTA 4AJIA 3QPVA 5CVEA 3SFZA 3GDHA 2DFNA 3DZHA 3H16A 3VU9B 1KFCB 2Z5VA 4ZA2A 3NC1C 1KU0A 1Z8HA 1KO4A 2I6SA 2QARB 3TZBA 1GA4A 3MG9A 4YFKA 5IKOA 5CTJA 2CFTA 4AURA 2G71A 3KHKA 1X9SA 1CNMA 2M9NA 1J21A 1E7SA 1ZH6A 1QJCA 1FDRA 2HC9A 2OGSA 2PSHA 3N2KB 4PFSA 1R4MB 2W43A 3TTWA 9ICFA 1SBYA 2NV0A 4ZYXA 5H9WA 4EZBA 3ZOZA 4LGVA 5BVHB 1OA0A 2FR1A 3GP8A 1LBHA 2PT6A 2GA9A 2IZZA 3MUEA 2F2TA 4RTPA 5FI1B 2OFFA 3PUWA 4DJ5X 4DY4A 1H8ED 1NJ6A 3HYRA 1XCLA 3KPVA 4LMRA 4QUBA 1H2FA 1Y3IA 2Q49A 3LE8A 3WLOA 1P31A 1ZH0A 1NSFA 5DBIA 3M6ZA 3RJFA 3DLCA 3G0OA 3W5SA 3BWXA 3IRVA 1ZONA 4A5SA 2MSKA 3FPGA 2Y3IA 5ESDA 4HTAA 4EG0A 1CP3A 1IJFA 1DRKA 1RXYA 2QJTA 3PNCA 9ICUA 1KU6A 2XTNA 3OKAA 4I8XA 1XXLA 3VPXA 2CE7A 1CRLA 1USUA 1YJ8A 3OA0A 3AEXA 4KMMA 5I7UA 4CQMA 3B8EA 2W8KA 3TFSA 2F76X 4YQWA 4EHBA 2W9BA 1T9BA 3R7DA 1Z1BA 2XC9A 1U3UA 1YDEA 4F93B 3HV2A 3KU1A 3P2KA 3Q2IA 4J91A 5CRIA 4RFSA 1OH5A 3K8YA 3LECA 1LVHA 1OV4A 3OC6A 4MGZR 4JP1A 4I55A 2YOHA 3LCJA 2IE0A 4IS7A 5DQGA 1PEAA 2D74A 2JI6A 3OO1A 3PC6A 4H0NA 3WKAA 2BE9A 1D9FA 1G2QA 3L9XA 1DO0A 4LI0A 3REQB 4QFBA 2WFLB 3D3WA 3QHAA 3GDXA 1XE3A 4J03A 4HEHA 4YCSA 3HN7A 2ZRPA 2C2YA 3U13A 5IM5A 1ZC3A 5HIKA 1OIXA 1G1AA 1K5HA 3GGCA 1YU6A 2Q9BA 3VZQA 5IF9A 2XE4A 2WABA 4DSUA 1X6VA 4F6LA 2WP8J 1JHDA 3GN2A 3BEOA 3GEIA 4HNSA 2X0FA 4W5JA 1C8VB 4IFIA 1R8JA 1GL9B 4PFJA 4EPWA 3OTHA 5LM3A 9ICRA 1SPBS 2JAOA 3T12A 4MQEA 4TMWA 1RDFA 2DSNA 1ZMBA 4MHSA 2QN8A 2VZ8A 5ALTA 3T52A 4ZXPA 3AX6A 1KZ4A 2XNDA 4I5GA 3ZEIA 1B3RA 3E7FA 2YWJA 2ZE5A 1HDZA 4MMXB 2CKDA 3RV3A 1J1ZA 3K0FA 4TS9A 1G6Q1 1IY9A 3BRWD 3R74A 1R5BA 4OQXA 4YRBA 3WRWA 4F4WA 3D9QX 5L4LA 4HC4A 4WOJA 2F8KA 5JH7B 4NHOA 4NENA 4HJRA 2I1QA 5AFSA 1ADFA 1E1LA 3HPQA 4ENSA 4PGQA 1G63A 1UMDA 4QZ8A 1CUUA 1HLPA 3NM5A 4KKVA 4KIUA 4ON9A 1N75A 5DQHA 5J3JA 2LUOA 3G89A 4FILA 4P32A 3BMQA 2W9AA 4MRMA 4IQFA 1N6IA 3M1LA 4ESVA 2F3UA 4RUKA 1BQ4A 8ICKA 1XKLA 3L6OO 5KREA 5J2HA 3RFUA 3HJTA 1U1IA 4KAAA 1SXIA 2P78A 4DJFC 2PIAA 1XDDA 3BTOA 4GOMD 2GD1O 4QJ5A 5HF9A 5HKKA 1S2OA 2VSNA 5IU6A 2VF8A 4KR0A 4I1YA 2ZSAA 4C21A 5C4MA 2OYSA 1X87A 1SC3A 1NUHA 4AYBC 1WXQA 5AXDA 1BCRB 1X92A 3A10A 1GL3A 2V1XA 2WKPA 3AU9A 5FTMA 1J0XO 3LHKA 4X6XA 1OU4A 3M9NB 2ZUTA 4A91A 3FCYA 4C6SA 3LKBA 1L5QA 1VDMA 3D1VA 4WEQA 1U3WA 3BK2A 4GBGA 4Y0NA 3RF6A 2HCFA 1YCGA 1XEWY 1A69A 1PV4A 4BX9C 1UQUA 4AUNA 3IP1A 1G5TA 4OHFA 3IEUA 3FTQA 4RZXA 3GC6A 4EPYA 4BLTA 2V8BA 7REQB 3N97B 2SKDA 2VIIA 2XZLA 5CYFA 3PFKA 4BZQA 3WGVA 1XTJA 1CG6A 3BGSA 4DAEA 2X9VA 1T5OA 4CMEC 5IT4A 3KSBC 1PR3A 3QELA 2X8WA 5GIOE 4YMVA 5KTPA 1OI4A 3MCWA 3E6AA 1C7IA 1GUFA 3SIPA 4YR2A 4CLOA 4KHZA 4BAGA 1Z2DA 1GZ6A 4K8OA 4YDQA 1C1DA 3OKPA 3R6GA 1K4MA 3G3EA 4KNVA 4XQCA 2FN8A 5E8JA 2OSBA 5CB0A 4DPMA 1PEDA 4K81B 4YCJA 4PE5B 5DWVA 1ZD4A 2RHHA 3AR9A 1WUKS 3NYQA 3W1VA 5HYVA 4ZALA 1UBJS 5J2DA 1J0EA 3M7IA 4QHYA 1YF3A 4P34A 1C50A 4G23A 4BNUA 3HKDA 1YJQA 3A1TA 3KDPA 3HNOA 3ZE7A 3A27A 3IVRA 4J4BA 4M1WA 2ZT6A 4MVJI 4BLOA 1Y9ZA 4Z51A 5J2TA 4KO1S 3OQMA 2CDRA 1QWOA 5TR9A 2P5SA 3HR4A 3HBFA 3PGXA 3RC1A 1L5LA 1D1QA 3GLRA 4OQMA 3M9OB 5SZJA 1V9CA 1ZU4A 5L1LA 3OJXA 4LTDA 4AWXA 1KWGA 3HXOA 1Y8CA 3PEUA 4MZDA 4PGFA 3FOZA 4ZAXA 2V6IA 1CUGA 3LJKA 3JXEA 4BVAA 2Q4RA 1YMVA 2ZSFA 2ZIXA 2WVJA 1JVNA 3OESA 4JASB