5ALJA

Ligand complex structure of soluble epoxide hydrolase
Total Genus 182
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
182
sequence length
546
structure length
523
Chain Sequence
b'TLRAAVFDLDGVLALPAVFGVLGRTEEALALPRGLLNDAFQKGGPEGATTRLMKGEITLSQWIPLMEENCRFSIKEIFDKAISARKINRPMLQAALMLRKKGFTTAILTNTWLDDRAERDGLAQLMCELKMHFDFLIESCQVGMVKPEPQIYKFLLDTLKASPSEVVFLDDIGANLKPARDLGMVTILVQDTDTALKELEKVTGIQLLNTPAPLPTSCNPSDMSHGYVTVKPRVRLHFVELGSGPAVCLCHGFPESWYSWRYQIPALAQAGYRVLAMDMKGYGESSAPPEIEEYCMEVLCKEMVTFLDKLGLSQAVFIGHDWGGMLVWYMALFYPERVRAVASLNTPFIPANPNMSPLEVFDYQLYFQEPGVAEAELEQNLSRTFKSLFRASDESVLVCEAGGLFVNSPEEPSLSRMVTEEEIQFYVQQFKKSGFRGPLNWYRNMERNWKWACKSLGRKILIPALMVTAEKDFVLVPQMSQHMEDWIPHLKRGHIEDCGHWTQMDKPTEVNQILIKWLDSDAR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords BIFUNCTIONAL EPOXIDE HYDROLASE 2
publication title Successful Generation of Structural Information for Fragment-Based Drug Discovery.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 182
structure length 523
sequence length 546
ec nomenclature ec 3.1.3.76: Lipid-phosphate phosphatase.
pdb deposition date 2015-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 5aljA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 5aljA01
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5aljA03
3A3YA 3I2JA 4G5XA 3TGLA 5AI4A 2W11A 4B9AA 3SX4A 4NABA 3GZJA 5K3EA 2YMMA 1XRPA 1G5FA 3LS2A 3QZUA 1CUCA 4S0XA 2YJ4A 5ALFA 1J07A 1NU6A 1ZOLA 3WKDA 3WK8A 2X76A 2HDWA 1XLUA 3M81A 4GWLA 3H2KA 4OB7A 3D6JA 1LPOA 2XUIA 4QWMA 2BFNA 1HKHA 4F71A 4MUMA 3ZWDA 1CQZA 1EINA 1QIEA 3DL4A 2AJCA 5AIAA 5AM0A 3O0DA 3MGAA 1W4LA 2ZBDA 3NALA 4UMFA 1XLVA 3ZVLA 1A8SA 5A7HA 1KYTA 1P0PA 2WFZA 4Q3KA 3SWWA 2OQIA 1BN7A 1Q0ZA 3QU4A 2ZBFA 4G8DA 3N5KA 1GPLA 1SU4A 4RETA 5AH0A 1CVLA 2AMYA 2PPLA 4HAIA 3WKCA 5ALYA 1YSCA 5K3DA 2HSZA 3IB3A 3SC2A 5DYTA 4EY8A 3LCRA 1TRHA 1SCKA 1WPRA 4B82A 2BGNA 4Y2TA 3MUOA 3KBBA 3QPDA 2G80A 3S6JA 1YCDA 5AO9A 4J0IA 1TQHA 1XZEA 3DKRA 1XQVA 4UFOA 5KREA 2QRUA 1ETHA 1RPZA 4HRYA 2ES4A 3W04A 5CT8A 4MWTA 2OYCA 2R8BA 3WKAA 3MN1A 3MPOA 4J0JA 3STXA 2C9MA 3IB6A 2Z5GA 4GW3A 1UXOA 2VJAA 3W5CA 4G8CA 2AJBA 2AJLI 1THGA 1CQWA 1ISPA 4E15A 5AOAA 1YB7A 4X85A 3WK6A 3O9MA 3RLIA 4P92A 4UAVA 1MH9A 1ZS9A 2HA3A 2P69A 1Q92A 1AMNA 3QMMA 5ALXA 2ROQA 1IUOA 1H23A 1EA5A 1LZLA 4KX5A 1YDFA 4B83A 4YH1A 4K2AA 3CN7A 5ESRA 2Y1KA 3F8SA 5D3ZA 2R11A 3YASA 4N5HX 3AR9A 3ZI4A 4NMWA 3L7YA 4V2IA 4W1QA 4HYTA 2B4KA 4IO0A 3WA7A 5AW4A 2FPXA 1XVIA 1IUNA 3O95A 5J3JA 1MX1A 3TLMA 2QLTA 1YMQA 4G9BA 2Y6VA 3B9BA 4P08A 3OTQA 2HU7A 1X42A 2O7RA 5T4FA 3WJ2A 2GBGA 1AX9A 5FKJA 3QYJA 4RE6A 2GFHA 3WMRA 6YASA 1S8OA 3VVLA 3DYIA 4BB0A 2VQ6A 4TVKA 3KWFA 3C70A 4PO3X 2WU3A 5E4TA 3EIOA 3IULA 4OSEA 4IHAA 2MU1A 4G63A 2VJCA 4H77A 4HGRA 1XRMA 4KR0A 3U13A 3FNBA 3MUNA 5E4YA 3AZQA 2PUJA 4GBGA 4WFKA 4BE9A 1R4ZA 4MEAA 3NASA 3STVA 1U7PA 4OB6A 5LLSA 2B8EA 4ZI5A 1YNSA 1EDBA 4KE7A 1VA5A 3RK4A 5A7GA 4GECA 1XRNA 5CH5A 4UBMA 3NUQA 5CT5A 2FPRA 2FJ0A 4HGNA 1A8UA 4I19A 1QGED 4BCBA 2JGEA 5LYYA 1T4MA 5K3CA 1Z68A 2XMGA 3HSSA 4BVLA 2HA6A 4X7BA 3FLBA 3I6MA 3HLTA 2JGKA 2YFYA 3RFUA 2XUOA 3IVMA 2BAGA 3QU5A 4F72A 3FWHA 3PDCA 2IX9A 2WM2A 2CJPA 2HRQA 4CI9A 5ALGA 1CUIA 4U2GA 1XZCA 2HFKA 4KNWA 4FWBA 1G66A 1Y7HA 3AIKA 1RLMA 2C0PA 1CV2A 5CT4A 3L5KA 4PNZA 1LPAB 2AUTA 1XFDA 2HADA 4XOUA 3SHQA 4X97A 4Y2SA 4A23A 1Z4IA 4GDMA 5ALZA 1BEEA 2DHEA 5KWIA 2CEKA 3S8YA 3GROA 1QIDA 5AVUA 4E11A 1ZIXA 1BEZA 3AILA 4Y2VA 3ESBA 4Q1VA 1J2EA 1ZI9A 3QVMA 4U2DA 5CXUA 4WFIA 2B61A 2HU8A 3UUFA 1ODCA 3G9ZA 3ICVA 1U4NA 3DKKA 4YCLA 3FSGA 1LPPA 4AB1A 2DQZA 3G0GA 1CUDA 5AVWA 3OM8A 4OUKX 4MWOA 2XQJA 1CUSA 4BEWA 5AW5A 4DWOA 2P8SA 4BTLA 5HQ3A 1OXMA 1UWCA 4ZV7A 3ET5A 4I4CA 4P9NA 5ALPA 2HRRA 2I78A 4XWGA 3FLEA 5ALMA 4DIUA 1IWOA 5FDFA 4A5SA 4AXBA 3DD5A 1ZRMA 4ZEWA 1DU4A 3QU9A 3UM9A 1XZLA 1LPMA 5AP9A 3F9RA 3ZI7A 3K9BA 4Q3LA 4GHWA 5FOQA 2J4CA 5DTIA 3B12A 3C87A 4LXGA 1Z4OA 2CFRA 5AKIA 3VAYA 2DHCA 1MX5A 2X4DA 3D2BA 4RE5A 4QZVA 2IOHA 5AW1A 1IVYA 2WKWA 1HQDA 5D7BA 1YB6A 4X6YA 3FYUC 3QH4A 5LZ7A 3SLRA 2CZQA 1XZJA 5CURA 3BIXA 2VA9A 4BC1A 5ALDA 2YBDA 1RLOA 7YASA 4F0JA 5JAHA 3E84A 2WIFA 3G7NA 1J8DA 3DDHA 3WWEA 3W05A 2WF8A 3I2HA 5JADA 2JGMA 3N1UA 1RMYA 1K5PA 1LZKA 3PUHA 1XZBA 1JU3A 4TGLA 5A3QA 4W1PA 1SWVA 1JJBA 2JGIA 3OOSA 4FYPA 4G9GA 3V1LA 4UUQA 1YAHA 2HA5A 1G4HA 4BZWA 5DNVA 3KOOA 4EY5A 3AR4A 3PF8A 2G63A 3UUEA 4C4SA 5JZSA 2JF0A 1QQ6A 4G4JA 5DLPA 3AR8A 5CT9A 2B30A 2ZVDA 4HZGA 4JEIA 5EHZA 2C58A 4U2BA 4FLEA 4AP9A 2FX5A 4BCCA 2YMQA 2NW6A 1UKAA 5AI5A 3A2MA 2RIPA 2O9JA 1F0PA 2RHTA 4C89A 1L8LA 3D4LA 1TK3A 3BWXA 3HABA 4XJVA 2IIVA 5BWCA 1L7MA 1AGYA 4FHZA 3C8DA 1XKLA 1Z5UA 3R3WA 2WQZA 3ANSA 1U8EA 4CCYA 1DINA 2CFSA 3ICWA 5D6OA 5LZ2A 4KE6A 2HF2A 1YS1X 1WZCA 1SCQA 2B8JA 5AIBA 4M0FA 3UMCA 2WHQA 4G8BA 3ZX5A 5IS2A 4FFDA 2G06A 4KNVA 4FOLA 4Y2JA 1XLWA 5AW7A 3H0CA 4UHDA 2OXEA 4K6GA 1XZMA 3PCTA 5I7UA 4C87A 3G0BA 3HZOA 4F60A 4J0KA 2OCGA 2J3QA 1JUDA 5YASA 4FNMA 1UKCA 1GT6A 4ETWA 1CUWA 4B9EA 5JD4A 3I2KA 2Y2VA 2G0AA 4Y2XA 2WJ4A 3G0CA 5AVQA 5AK3A 1WM1A 4YGYA 1U2TA 1LBTA 1X70A 5CH8A 5JARA 3IUJA 5DNUA 4MQLA 3NGMA 3AR5A 3AIMA 5LZ9A 2WU4A 3O9VA 1XKTA 2Q4TA 4ARAA 1CR6A 5IVDA 2XI4A 3AZPA 5AI0A 5AKXA 3NWOA 4EB0A 2HA7A 1FJ2A 1B6GA 3GYGA 3BDIA 5DJ5A 4BCDA 2R8XA 2HOQA 4DMHA 3BE8A 2GBCA 4XQ0A 2IOFK 4B7ZA 1JFRA 4Y7DA 2I3DA 1A7UA 3KDPA 5ALQA 5AI9A 3A2LA 4J0HA 4U2FA 1GPKA 3D0KA 1XZDA 2RAVA 1F5SA 4AO6A 2C5GA 2OPHA 1LPNA 5I8PA 4QDUA 4MYSA 5A2GA 3RKSA 2XUGA 4HTAA 5AOCA 1LLFA 4EENA 1RKUA 4UAUA 1W75A 4UBJA 2GYWA 1RMTA 1WPXA 1RMQA 2XQIA 2NYVA 2YYSA 1EX9A 2QKYA 5JD5A 4C4ZA 4CF5A 2WG1A 4BVJA 1WPGA 1QIGA 3ONNA 1TCCA 3L1HA 4LKOA 3ZX4A 3P2MA 1P0IA 1N8SA 5AKEA 3D2CA 1K63A 3L0YA 1WB6A 2G5PA 4CF4A 1VXOA 5KBYA 3I6BA 1XRQA 5AVRA 1ZIYA 4W1RA 2DHDA 3BA6A 4Q05A 3VJLA 3FVVA 1Y37A 4MXDA 3A1DA 1I6WA 2WTMA 4H7FA 2GBIA 2YMPA 5C8XA 3M83A 1VLQA 4FTWA 1MPXA 3E58A 4IH9A 5HF5A 4UW9A 3FM9A 4B84A 4PW0A 3W2TA 3QU7A 4QDXA 1QQ5A 1YS9A 3DQZA 2B0CA 2VT6A 4C4TA 3RM3A 2AGVA 4ITVA 4BKMA 2VAVA 2VTVA 1R1DA 2EATA 3M1YA 3AZOA 5AKJA 3QUCA 1FEZA 3D59A 1H2XA 3IRUA 3R3ZA 1CUZA 4QDZA 4XX1A 5CW2A 1L8OA 1DQYA 1CUJA 2X8BA 1H2YA 4LIPD 5EIHA 5HFAA 4IQ4A 3D2AA 1MO2A 2JGAA 4KRXA 3V9AA 1K8QA 4QNNA 4L3WA 5AVVA 1VXRA 4GLBA 4CG3A 4FLMA 4Y2YA 2WF9A 1U7OA 3QMVA 3D7RA 1QOZA 4FKBA 3HEAA 1EK2A 3EWIA 4UHBA 2AJ8A 3CNHA 4U2EA 2PKYX 3QUQA 1GQRA 3HJUA 3FPBA 4N8DA 4CG1A 4C4XA 3ESCA 1YAJA 1UOPA 4UU0A 4BNDA 2C4HA 4HGPA 5EIAA 3F96A 1ZOIA 2I3ZA 5FV4A 4QQFA 3KWJA 5JAOA 1VFPA 1ZD5A 2QJWA 5E2IA 2Q0XA 1QIMA 3A6ZA 2QZPA 4O8CA 3CXUA 1QO9A 4BC0A 2XQFA 4B6GA 1QFMA 2B82A 5CH3A 3CCBA 5IVHA 2J3DA 1LPBB 4YCNA 4YPVA 5IH7A 2YN4A 3W9UA 1W6RA 2HU5A 3AIOA 3FCYA 1L7NA 2HEGA 3H04A 4X95A 2Y6UA 1YV9A 4H0CA 2WHEA 3I2GA 3I2FA 3WL6A 3NIWA 1MU0A 1R50A 3L1JA 4E88A 3NAMA 4L57A 2HCFA 2H7XA 1MJ5A 3C6BA 4F21A 5EIEA 1QTIA 2DFPA 1CPYA 2ZXEA 4JH0A 2HO4A 4X00A 5A62A 5ALKA 2VJBA 5AK4A 1QIHA 3L8FA 5AW3A 2ZBGA 1PW5A 3C8HA 3DL7A 1XQWA 2G09A 1C4XA 3AR7A 1FFEA 1KEZA 4N8SA 3SKYA 1T5SA 3VKFA 5ALLA 4H35A 5C8VA 2C5FA 4HGQA 3UMBA 1L7PA 1R9NA 3FYUA 3WWPA 1ZD2P 4UHHA 3V1KA 5IVKA 2AJDA 2NO5A 4Q3OA 1T2NA 3X3HA 5ISMA 2O7VA 1ZD4A 4UATA 2JARA 5CBKA 2WM8A 1HLGA 2I7DA 1Z4MA 1DT3A 1TCAA 5HKAA 1Q84A 1SFRA 4QWWA 2RARA 4LYEA 4ZWNA 5HF6A 2JEYA 2XE4A 1DT5A 3JYHA 2OAEA 3QGMA 1WB5A 4RNCA 4AMYA 1JU4A 3QXGA 3IDAA 1RQLA 3STYA 1WR8A 3QMWA 1N5RA 1O03A 2XMQA 1BCRA 3OPMA 4IH4A 2IOFA 2C4NA 3H19A 4QJBA 2XMBA 4W63A 4HGOA 2I34A 4WY8A 4K6KA 1E66A 3WGVA 4DTCA 2BY4A 3PDWA 1ACLA 5IVIA 4B85A 2OA0A 4MWSA 3PE6A 4WDRA 1QQ7A 5JZBA 4NS4A 3U19A 3AR3A 3OCUA 2BGRA 3GBSA 1ACJA 5AHXA 3H2IA 4J0DA 1ZD3A 3WK9A 1Z88A 4I9GA 1YA4A 2CBGA 4LYDA 1DWOA 4PSUA 2XUHA 3DDUA 5HK8A 1VJ5A 4OCZA 3AFIA 3KXPA 2BJHA 1VA4A 3GELA 1X2EA 2RHWA 1WOMA 2HM7A 2WFAA 1IUPA 3BJRA 3ET4A 1TE2A 1XRRA 2GZSA 4QDTA 2FUCA 1X2BA 5JAPA 4CCWA 3PICA 3DLTA 3H2GA 1TJ5A 1MNAA 1T5TA 4UHFA 1TCBA 3FBWA 4KE9A 1QYIA 5IKXA 4EHBA 5BWBA 2VEOA 1CUVA 2H9YA 2R8ZA 3U7EB 5ALSA 5AVSA 5CMLA 3PGLA 3DOHA 5FPQA 4EBBA 4OFZA 2HF7A 5DNWA 4BP8A 4K5QA 4L6CA 1JT2A 3FYUB 2W6CX 1RYYA 4UFPA 4G4GA 1USWA 3W06A 1TIBA 2HA0A 4Q34A 4EEKA 3K6KA 3AUKA 1Y7IA 3M3DA 4Y2UA 1RRCA 3R9KA 1XP5A 1AQ6A 4RPCA 3V48A 4C01A 3WIOA 4DMFA 1QO7A 4KN8A 1E8DA 4Y2QA 5AKKA 3WYDA 2G1AA 5EFZA 1HBJA 4X3CA 4UBKA 3WK7A 1FFAA 1T9ZA 4AMZA 5AW9A 5AM4A 1XQYA 4AZ3A 3W5DA 1QFSA 4NV0A 1O08A 3BDVA 2PL5A 3L8HA 4EZIA 1UKBA 2QOEA 1GGVA 4IFTA 4XIIA 3W5BA 2VF2A 5ALNA 4N5IX 4EELA 1F0NA 3PI6A 2YMLA 2YJ5A 3LIIA 5ALRA 1WHTA 3IA2A 2FUKA 1LTQA 1L7QA 3DJYA 3C6XA 4DNQA 3PUIA 4OU5A 4WFJA 2RGUA 1CIJA 2XUPA 3FOBA 4AX4A 5K5EA 4E14A 2ECFA 3R41A 3R3UA 1RQNA 3U26A 3SMVA 4E46A 1ZI6A 4C4RA 1NU8A 1ODSA 1DWQA 1CUGA 3QM1A 4BDTA 1C7JA 1E5TA 2WHPA 4C88A 2Z3ZA 3ZUPA 4CG2A 1PFQA 5ALJA 2G08A 4J3JA 1DQZA 1H22A 2WF6A 3G9UA 3JW8A 1MTZA 3H1BA 1BU8A 2OG1A 5DTJA 5LKAA 2B20A 2DQSA 2IYEA 3OCVA 2RI6A 3GA7A 4QLAA 1LVHA 5AVTA 3QITA 3DEAA 1Q83A 1D07A 3R0VA 2PR7A 2WJ3A 1RLTA 2PVSA 3HI4A 1CUBA 2W43A 2ZJ7A 5LZ8A 1JJFA 1YA8A 5T4BA 2GYUA 5K3FA 4UHEA 4QEKA 2PKEA 2FEAA 1OILA 4XVCA 3ESRA 4DMCA 4WJLA 4DCCA 5FUMA 2EDAA 3I1IA 5HQ3B 5AICA 4WY5A 3OCZA 2PU5A 2AH5A 3WK5A 2W4MA 3STTA 1ZGCA 5AK6A 4KACA 1TAHA 4BX0A 1HL7A 3HXKA 2XUFA 3PGVA 4HXGA 1RKVA 2ONCA 4PSDA 1LNSA 4Y9SA 5T4EA 5LIPA 2BUAA 3A1EA 5AW6A 5JIBA 4LXHA 1UK8A 4JNCA 3ZV7A 3R40A 3I6YA 4BX3A 5SYNA 2V9ZA 4BATA 4FNGA 2XMRA 1MT3A 1CUFA 3AJAA 1W1IA 2Z3WA 2WFLA 3OURA 4BAGA 2R8YA 1GKKA 3BJMA 3C5WP 1BE0A 4ZGBA 1A8QA 2I6XA 4AN1A 3MMZA 5F4ZA 3B8EA 2WJ6A 2WILA 5CXXA 3DYVA 2VAXA 4L0CA 2QUBA 4D9JA 3WZMA 3WL8A 2J4FA 3CZ4A 5AW8A 4DFDA 1BCSA 1O6FA 4FMPA 5BV7A 5LZ4A 2MU2A 5FP0A 1THTA 1UK9A 2XUAA 3N8GA 4YCMA 4YIKA 2JAWA 1O6GA 1VE6A 4G4IA 2CUTA 3O4IA 1QIIA 2JAOA 3R3YA 4X93A 3QUTA 2JIDA 1BS9A 2XMZA 1XZHA 4BRSA 1Z4QA 2QUAA 3I2IA 2WHPB 3UMGA 5AKHA 1KU0A 3S2ZA 4OD0A 1E8NA 4KEAA 2I54A 4MYDA 4BAZA 4BBZA 1QIFA 2G5TA 4C6HA 2D5LA 5AKGA 3BXPA 3O4HA 4HXFB 1VKHA 4KAAA 4CF3A 3EF0A 2QR5A 1EH5A 1RP1A 2C7BA 4BTVA 2BDEA 2YXPX 3E0XA 2H7YA 1VJRA 4NVRA 2WG2A 4X90A 1CUXA 2WHRA 4FE3A 4Q82A 2ZJ6A 3DS8A 2ZBEA 4FFVA 3FGOA 3N28A 2D0DA 5HF8A 4J0GA 3M82A 5DYYA 5AW0A 5AKLA 2PM8A 3KD2A 3SKXA 1GKLA 3H18A 5LP1A 2QM0A 3QNMA 2HA2A 2RONA 5D3KA 3VDXA 2ODAA 5DWDA 4CCYB 1CRLA 3BF8A 3UMJA 4LXIA 1CUYA 3AR2A 4ZXFA 2PU7A 1AZWA 3LLCA 1UOQA 4M0EA 1Z4KA 1F8UA 3C6YA 4H7HA 2OBBA 5FRDA 1ZRNA 2OCIA 1DTEA 3WL7A 5T4HA 2XUKA 2XMSA 1ORVA 1MNQA 2HL6A 2PQ0A 4I9FA 1E89A 1VOTA 3DAOA 5ALIA 5ALWA 2V97A 4YX9A 1G42A 4BZZA 3U1TA 2WFLB 4UMEA 4ZEVA 4BE4A 1R88A 5AVXA 5IT4A 4DW8A 1UFOA 3WI7A 5JAUA 2O2GA 3FCXA 3H1AA 4XPZA 1L7OA 4BP9A 1DX6A 3ZPXA 1QZ3A 4QE3A 4GXTA 4AS3A 4OYYA 1IZ8A 1FFBA 2WUGA 1XPJA 2V98A 2ACKA 2FPSA 4DMKA 1GQSA 2WFMA 1ZJJA 2GBFA 3OG9A 1AC5A 1RWQA 1MAHA 3E1GA 4H7DA 3AR6A 2WIJA 4IG4A 3DOIA 4MJ3A 2DCMA 2QMQA 2JGFA 1VZ3A 3QBJA 3L8GA 4CE6A 2K2QB 3GUUA 2FI1A 1SOMA 5JYCA 3WJ1A 5ALHA 1Z4PX 4BVKA 3DNPA 2HX1A 5ALEA 5ALTA 4C4YA 3QU2A 1DX4A 3BIWA 1H2ZA 3A2NA 5FPPA 4F5ZA 4FDMA 4X6XA 1NNLA 3WWCA 2ZYHA 2ZJFA 4H1WA 4KE8A 2BKLA 5DYWA 5CTAA 4BRZA 1R9MA 1UOOA 3O4JA 4X91A 2YJ6A 1E3QA 1XQXA 1IZ7A 2VATA 2Y2UA 3ED1A 2CFTA 3IBTA 4KAFA 2UZ0A 1EXWA 3ZLUA 4WDQA 3C45A 1PJAA 5CRIA 1AKNA 3WK4A 5EGNA 3IJ5A 4X6UA 3QYPA 2P27A 2QTBA 1YASA 3D5EA 3NANA 1EI9A 4INZA 3T52A 3WA6A 4DNFA 3IUNA 3EQ7A 4NZZA 4QA9A 4JYPA 2CKMA 1RKQA 3D3NA 5JJBA 4Y2RA 4B80A 2OQVA 3L1IA 1R3DA 3WL5A 3V1MA 1GZ7A 5LZ5A 1EHYA 4Z49A 3F97A 2W22A 5HKBA 4UM7A 2OGSA 3QX7A 3I28A 1QIKA 5ALVA 1EVEA 1E8MA 5IT0A 3DV9A 5A7FA 3WKEA 1K6EA 2ZYRA 4UARA 3OCXA 1Q0RA 1L6RA 1AQLA 2Z8ZA 5ALUA 2D2VA 4BAUA 1L7RA 4JUIA 3C5VA 2EEPA 4EUSA 4Y3UA 5T41A 3L1UA 1CUUA 3H17A 1RDFA 3ZWKA 2HDOA 4UBNA 4I3FA 3WWOA 2FUEA 3HLKA 3K2IA 3TJMA 3ESQA 1K1EA 4BYGA 4J0CA 3R09A 3L0CA 5ALOA 3OC0A 3R4CA 2HHAA 2VT7A 3Q0TA 1MX9A 3IUMA 1CFJA 5JD6A 3EF3A 2C8LA 2GMWA 1JJIA 3ILSA 3IUQA 4BDSA 3C43A 2C0QA 1JMKC 3T4UA 2FPWA 3G0IA 3G8YA 4RESA 5AI8A 5AJHA 3H2JA 5EHXA 4NFLA 2ACEA 2V96A 4FLFA 4DNPA 1TJ4A 2YJ3A 4BNDB 4OU4A 4DLNA 3HYCA 2HFJA 2ZG6A 1F6WA 1W76A 1LGYA 1EB8A 3OCWA 2VSQA 3A1CA 1N8NA 1LBSA 2DQYA 5AM5A 4XE5A 3I6ZA 3E3AA 1DWPA 4BX2A 4UMVA 4OPMA 1N1MA 1AURA 4ROTA 3G9TA 2EDCA 1QIJA 1JI3A 2OLEA 1XRLA 2YASA 4PSCA 5H3HA 3R3XA 4B81A 4KJXA 5EHQA 2P11A 2QJRA 4ARBA 4GIBA 1BRTA 4CNQA 2E3JA 2HI0A 4EY6A 1J97A 2O2HA 2PSEA 5EI5A 3P96A 1HDEA 3A70A 4H7IA 4KX3A 5JZ9A 3WKBA 5FLKA 1GXSA 4CIBA 1B41A 1Q91A 4EX6A 2XUDA 2JGLA 3JWEA 3CN9A 3E8MA 3FAKA 3FYTA 3RARA 2WIGA 5FXMA 3VJMA 3ZVNA 3L1VA 1UZAA 3VJKA 4OYLA 4UM5A 1P0MA 3HYSA 3B5EA 2BCEA 3FVRA 4PV7A 4H7KA 3WLAA 4EA6A 2XDWA 3IIIA 4EX7A 4EY7A 3E4DA 1YR2A 5JATA 4OHFA 1ZJ5A 5LKRA 2CMFA 2G4LA 5KWJA 3F67A 1RC8A 2P9JA 2QYHA 1ODTC 3DNMA 2H7CA 1JMYA 2XT0A 2Z8XA 1XZIA 3L8EA 2WIDA 5C8ZA 5HFNA 4H18A 1SWWA 2WIKA 5HZGA 1YJ5A 1H2WA 1Z5GA 1AUOA 5CT6A 4AO8A 5K3BA 1VE7A 2BUCA 3ZU6A 2WUFA 2IA5A 1NRWA 3WGUA 1QLWA 2PBLA 4ZV9A 1WHSA 4W9RA 1Z4JA 2I03A 4P93A 2DSNA 2GZRA 3EQ8A 5E0OA 4CFSA 1HPLA 3PFCA 1A88A 4AQDA 2ORYA 3STUA 4J2TA 2GHTA 2JGJA 2WUEA 3STWA 1N5MA 2IITA 3KSRA 1FSSA 4UMDA 4O08A 3N0TA 2BUBA 1EK1A 4ZRDA 4ZEXA 3F9CA 5A3RA 2XQKA 3BF7A 1XZAA 4PNHA 1PV1A 3MVEA 1QH9A 1IMJA 3ZVMA 2B1RA 2ZYIA 1C7IA 1GPNA 3SD7A 2FDRA 1CUAA 2B9VA 1EVQA 4AN0A 2QS9A 3ZTYA 3EF1A 2ZSIA 2GHQA 4M0MA 2HIHA 5I9IA 5AOBA 1U2EA 3QPCA 3N07A 2QXTA 5JANA 1NX9A 5C81A 5HK9A 3G02A 4KAJA 4W1SA 1EB9A 1UK7A 2AXEA 3VXKA 4AZ0A 2MSNA 4EZEA 2Q5EA 4JDPA 2YH2A 5A71A 5AKZA 2PX6A 2PSJA 4IH1A 4YK7A 2ZOSA 3J7TA 4DSZA 3N2ZB 1J06A 3M9LA 2O2IA 3FSGD 2NO4A 4DM7A 2VKQA 1CUHA 3FLAA 2QT9A 3ZWQA 4MEBA 3KZXA 3K1ZA 2XLCA 5E4JA 4MQMA 2GYVA 4X92A 4HS9A 1KU6A 1EDDA 5AW2A 4ZREA 4UBIA 3ANTA 1EDEA 3NOXA 3RF6A 2RBKA 4HRXA 1ZGBA 4KYTA 3U7GA 3HRHA 3H2HA 2C8KA 1K4YA 3FZQA 1J1IA 1UT6A 1CUEA 4AS2A 2ZYSA 1XZFA 2WLSA 3LIPA 5AK5A 3KC2A 5C7YA 1CLEA 4X71A 3EBLA 4YASA 4UBLA 4AO7A 4HXEB 3W5AA 1VZ2A 5AM1A 1WCYA 3U7HB 2YY6A 3OPXA 1OCEA 3CCCA 3QUBA 5AM2A 2XLBA 3LP5A 2RAUA 4UU1A 4PF1A 4DNOA 1TA0A 3PFBA 1UK6A 3W9BA 1Z4LA 2WG0A 3EPRA 2CB9A 2CN1A 2QXUA 5AKYA 4PQEA 1M33A 1ZICA 1QE3A 3Q8WA 1U02A 5AVYA 4KYVA 1LPSA 2WF7A 3WQHA 2WF5A 4LHEA 1BROA 4GXNA 4UHCA 2ZSHA 1FFCA 3NUZA 3QPAA 2I55A 3R3VA 5AESA 2HA4A 2JAUA 1NF2A 4G1FA 2WUDA 1XZKA 5A6VA 3B3QA 3IURA 1ZI8A 4BBJA 3ZLVA 4KRYA 2XUJA 2O2XA 4H7EA 2RB5A 1QONA 2JBWA 3U0VA 4QLOA 1ORWA 3HC7A 1QTRA 1BN6A 4DGQA 3BWVA 4J03A 5SYMA 4UBOA 2FJPA 2JEZA 1N9KA 4N8EA 1XROA 1XZGA 4RGYA 1TKRA 4B0PA 3NRJA 1Z4NA 4JYMA 4UFNA 4DYHA 3I1YA 1ZJ4A 1TJ3A 3ESDA 3C6ZA 3KDAA 1FFDA 2PSFA 2DR0A 4WCVA 4A16A 1SC9A 2GO7A 3L0BA 4CIAA 2WTNA 4FBLA 2B1QA 3GFFA 1JKMA 3F98A 4EY4A 2G07A 5AI6A 4TPKA 5AM3A 3SK0A 3EQ9A 3E81A 3WIBA 2VJDA 4GI1A 1WVIA 4UASA 3ZW7A 1SCIA 4FBMA 3KD3A 4BEVA 4Y2PA 2C88A 3VVMA 4J7AA 1WB4A 1Y8AA 5HF9A 2OGZA 1U65A 2WSLA 3VISA 4K6HA 2OM6A 1QJ4A 3HACA 5BOVA 1S2OA 2H1IA 1W52X 1MN6A 4YIHA 5A3SA 2EAUA 2PSHA 2XQGA 2XMDA 5K3FB 2OAGA 2OCKA 4BYMA 3WZLA 2HHLA 3FVTA 4JB3A 3QLEA 3MC1A 2OCLA 3WWDA 1L7AA 2XMCA 4B6JA 1MAAA 3G0DA 2LIPA 5AVZA 2BDUA 3TEJA 3OCYA 3ZLTA 2PSDA 5HCUA 3BL8A 4L6AA 3I76A 3G9XA 3O4GA 4H7JA 3TRDA 2X5XA 3ZTWA 5JASA 5EHNA 2PUHA 4X94A 2XB6A 4QDOA 3WYNA 2EARA 2FPUA 2QVBA 3DCNA 2Q4RA 4NAVA 1P0QA 4UPDA 1U2SA 3AINA 5K3AA 3FPSA 4U2CA 4OB8A 4G9EA 3PF9A 3V1NA 4L9AA 3ESAA 1YS2X 3ED5A 4B0OA 4FFWA 4GEGA 2R8EA 3U7FB 4NWIA 2XUQA 2I33A 3SF0A 2OGTA 4HVTA 4L72A 4DSAA 1CEXA 5JALA 3B9RA
chains in the Genus database with same CATH superfamily
3EVTA 4XZ3A 5LQKA 2JKYA 3GFKB 4ECAA 3NWBA 4MVJI 5LMZA 4GBED 5C5CA 1FS4A 3ER6A 3IYLW 4WBNF 3PDIA 4BQOA 1I13A 2ZI4A 4JJGA 1YZLA 4GWLA 3ZHQA 4EVQA 1C1XA 3QKRB 4I5GA 4FOSA 5A0TA 3C8UA 1T5HX 3ER9A 5KJEA 4ECZA 4W82A 3WHLA 2QX4A 4ZOLA 4D9CA 2VHJA 1U8FO 5HZKA 5AH0A 2VSNA 1SXDA 1T2VA 1LSJA 2HSZA 3EPPA 3C1OA 3KBBA 1G16A 3S6JA 3SXJA 2IQIA 1TQHA 1GUFA 1OVMA 4QHTA 1J33A 2Y1IA 4YYEA 2VDJA 2IIBA 3GVXA 3MWEB 1TAUA 3F6RA 3KYBA 4K9MA 1SELA 3MTAA 4LOHA 1FMTA 2X77A 3WGNA 2EAPA 1I33A 5KFBA 5GP1A 2WKSA 3KYIB 1UXKA 5D84A 1H23A 4MJ7A 2MSDB 2PMZC 3FC4A 2XT9A 3LL4A 3IT2A 5ELMA 5HIIA 1HM5A 4QECA 2JIZD 3O95A 1SVSA 3H1PA 2WTFA 2Z5FA 4DL4A 4L51A 2CBZA 2L2QA 4Q3BA 5EXDA 2PKRA 3N0VA 3PNYA 4X41A 3H16A 3E8SA 3DULA 2YZGA 3KHUA 4NE9A 3VHXA 2DHRA 4OSEA 2VJCA 1XRMA 3LC1O 3JASA 1XEAA 4CCSA 2FQXA 2BFEB 1NXWA 3PI7A 4BE9A 4F9GA 2A1UB 2YVLA 1K97A 3LRTA 1G2PA 1IM4A 3MS7A 2AGOA 1X6JA 1O0SA 2DR3A 1CY8A 2JW5A 3JVDA 2I65A 4PSKA 4PFKA 1M1NB 1YDEA 2IYOA 4BBAA 4PG4A 1Q7GA 2C82A 2J6CA 2ZIXB 4B4KA 4I2FA 3UA3A 1GRVA 3ZKWA 4GG1A 5K0EA 3KTAB 2P6PA 1J39A 2G9VA 3ETDA 4Y0AA 2YJGA 2ESEA 4C05A 1ZY2A 1KMQA 5FPSA 4PZAA 4LBZA 3J81j 4Y2SA 5C46F 3AEQB 3IHLA 4AZWA 5IXYA 1HGXA 5A5VA 1QIDA 3HO1A 2PYZA 4ZQBA 5K09A 4U2DA 2B61A 4M0DA 2YOFA 4HF7A 4AD8A 3A6FA 3M34A 3UBTA 4ZV7A 1PFVA 5MF6A 3LMKA 2XCSB 4XKJA 2F9MA 3NW9A 2BTEA 4PLTA 4BFTA 1P6UA 1N6OA 1N0IA 1BXZA 1X9GA 5ES4B 1EP3B 4BLOA 2J9RA 4NU8X 1TZ2A 3AW8A 2IP1A 4G8JA 1SN7A 3GP5A 4DA6A 5D51S 4G0ZA 4OQQA 4A1OA 1FUIA 1W35A 3I53A 1GNRA 4UTXA 4UCWA 4F4IA 2GXQA 2EKQA 4HVLA 3TQIA 7ICTA 2H1WA 1TM2A 3QWFA 2XEDA 5ICGA 3T3DA 1ZK2A 1JJBA 4DRXB 3ICQB 3GXOA 2OBMA 1Y1QA 5HVNA 5DBAA 1DUIA 4NCHA 4DV7B 1HE2A 4EYSA 1JS1X 5TISU 3B0YA 2FA9A 4U2BA 2YWHA 1XAGA 4R01A 2Y4NA 4U6QA 3A2MA 4US8A 1F0PA 3TD6A 1UBRS 1PKXA 5BWCA 3EUB2 1PDOA 2YY7A 3TADC 5KFVA 3UWPA 4HWKA 2WQZA 3OJCA 1MIOA 5LQMA 3TKYA 2OHVA 4MV7A 1QRDA 1ORRA 1GNVA 3UMCA 4GICA 3B82A 4M0PA 1HDIA 2DFKB 4AKTA 4W5HA 2GERA 2H2HA 1XLWA 5AW7A 3RBEA 1V8FA 3OSUA 3OZCA 4D4LA 1IK4A 4RK4A 5BN4B 1W7AA 4MV8A 3BS5A 5YASA 1HLDA 1I36A 4B9EA 4ASUD 4CHGA 3CWZA 4MHOA 5J2TB 4C0KA 2J6TA 2NP7A 3O9VA 4WJZA 2VL7A 2QT0A 2XY6A 4DCNA 4RENA 4KQGA 3HILA 4BQSA 3MOIA 4D3FA 1KY4A 2CB0A 2C4VA 2GEKA 5J4YA 5LN1A 2G7MC 3HYTA 2H2WA 4AMBA 3RUAA 4TKVA 1G8HA 1ZD1A 4EEZA 3H4DA 2OWEA 4IL6U 2ZI9A 5CB0A 1UINA 3ANYB 1RMQA 2EX1A 4AM8A 4EG4A 1UEIA 4ROSA 3NOVA 1T5LA 1T5BA 4LKOA 3O47A 3OJ0A 2FJUA 1W2HA 4TL7A 2Q0HA 4O2AA 3L0YA 1FTQA 3WBKA 1AD2A 4I6JA 4W1RA 1ECPA 1Z17A 2R1VB 3P8ZA 5BY2A 4MXDA 3A1DA 3SHWA 3A6LA 4QU8A 2WTMA 2AWOA 3FMPB 2XY5A 3SEZA 2B6GA 1N9ZA 3FGPA 5KAMA 5H02A 3LRPA 4KLLA 1XDBA 2JLCA 3RO7A 2WHXA 2OG2A 2EKLA 2ODBA 4IUYA 2PL9A 1C9JA 5TPZA 1DQYA 1CUJA 3SEAA 1W19A 1DO2A 1E3MA 3WX0A 1KI1A 1C20A 1G63A 5DWQA 3N74A 2RDIA 3VCBA 4Z6KA 1K8QA 2AGQA 4GLBA 1Q50A 2JBAA 1P44A 1W59A 3ECSA 1ZQVA 2GO1A 3TINA 3LHKA 4TZKA 3O90A 4JIMA 1G21A 2YYYA 4XUEA 4AURA 1SB8A 1WAMA 5FV4A 1URPA 3RJIA 3UUWA 3LQFA 1F38A 3AB7A 3BA1A 3OIVA 2AW5A 4MX8A 4OP3A 5H4GA 5IVHA 1LPBB 4DOMA 4NSNA 4FHFA 3VSDA 2ZKIA 1C81A 3X1DA 3TRIA 4LYFA 2VJQA 2QD5A 1EWQA 5F3RA 3L7MA 4OMCA 2AMJA 4QUGA 1UBJS 3LGAA 1RZRD 3RYFA 2VJBA 2CFIA 3BIJA 5JS8A 1KOGA 1QFJA 3ZU4A 3OLZA 3KT6A 2C4UA 1XGKA 2HHWA 2G09A 2IYYA 2KV2A 1M7HA 3SQXA 5JWRA 1J0BA 2C5FA 3BQMB 2PGLA 1Q0QA 1ZQZA 3Q87B 1GOTA 3O2JA 2WD7A 4B3CA 2M2IA 3P94A 2I7DA 4PIVA 4TROA 1Z82A 2YXNA 5HKAA 3GT0A 4DL3A 3BHJA 1SUAA 3OTHA 2IYRA 4PGXA 1WB5A 2ILTA 1Q3VA 2WKRA 5EQTA 4FYMA 2XE8A 3VR3A 4W5OA 4A15A 5CFMA 1N5RA 2OE2A 5DKWA 3GT4A 3L1KA 5KFOA 1Y9EA 4DMUB 4PGGA 1GVHA 1U4BA 1P1HA 4DQVA 5DIFA 1E4YA 5J0OA 4MIYA 3QTLA 5B3JC 2OA0A 4NU5A 2F00A 4FX5A 4BFZA 3TADA 4ENWA 1OBHA 4PTYA 1OE0A 4N01A 2OO3A 1CS4C 2F76X 1GAJA 1H0SA 2PQ6A 1XHFA 5EWMA 3GFTA 4TV8F 2O1SA 1FP1D 5IKXA 4I8IA 2GHRA 2CXXA 1WZEA 4BVFA 4OYRA 2W7PA 4V1CI 5KTTA 4DLRA 1PHPA 1ZQWA 1UP7A 3M5WA 2W6CX 3DJFA 1QGAA 2JFZA 1XCGB 1PJZA 3MGCA 1OVGA 1YRAA 3FKSD 2DWQA 1VC2A 3TECE 2CK3D 2Y1LA 4XARA 4KQCA 3KV1A 3V6JA 5GZ3A 4NV0A 1RHRA 2AMFA 3LECA 4NQZA 3SVLA 1SXQA 4YRCA 5JBQA 1WCV1 5ALNA 2C3YA 4E0DA 1KDTA 4RVUA 2ZIWA 2OHIA 3AVTA 1OI3A 3F6SA 4QYTA 1PUXA 3T34A 3A9VA 2ZSUA 4RUKA 1QRTA 2Z8YA 4JSRA 1RQNA 4NCNA 1ODSA 1R6DA 3CB4A 1CUGA 1ADFA 4XH9B 3GZFA 4GOMD 1KZ9A 4EBFA 4KLMA 4Q4HA 2I5HA 1WSAA 5IMSA 2ZRNA 4MFFA 3CSSA 5LUAA 1ZH4A 1BE8A 1TK9A 2RI6A 4GLFA 1L5KA 1WD7A 3GLFB 4Y2HA 4E31A 5BV2P 4A36A 1BVUA 2HIAA 2OILA 3RJMA 2RD2A 2Z57A 1FXUA 2PR7A 2WJ3A 2IEAA 2RGAA 2I80A 1XMJA 3W8DA 4NJOA 5HQ3B 3OCZA 3HB0A 2PU5A 5L3VA 4ZJUA 2W4MA 2IZ1A 1TAHA 1Q0PA 1HYBA 1OYOA 5JLAA 3NO4A 3PGVA 1CKEA 2ONCA 3OOHA 5JIBA 4UDOA 3TXYA 3EVBA 1CQIB 3NV9A 3T41A 2IE8A 3JQBC 4BATA 1MT3A 3PWKA 3V00A 5IYZF 5I7WA 3MTGA 1U47A 3C14C 4A91A 5FLYA 2CLCX 3TN7A 4M49A 2N3ZA 4IZIA 1OT5A 2KE5A 5BR4A 7ICUA 1O6FA 5LP6F 2B4RO 3CF2A 3EIFA 3IBCA 1JHDA 4G1MB 5L7WA 4WA7A 1CWUA 2PNFA 3P9IA 4EYHB 4WW0A 4FGWA 1JSRA 1KU0A 4TTAA 4GL2A 1HQCA 1QCYA 2LPMA 1T1GA 1K6IA 1ZQNA 3NI2A 1L8AA 4Q01A 4ND8A 4IL5A 4YCCA 1U7DA 1TD9A 2Y0BA 1WVGA 1J49A 1GIAA 3O2SB 1P2VA 2ZBEA 3FGOA 2GD6A 5A5GA 5AW0A 4CUJA 1WYGA 3NHLA 1ZH2A 1Z2PX 3T3GA 3H5AA 4LRUA 4KMMA 2C2DA 1QHIA 4YR3A 4NBKA 2O2SA 3TIFA 2ZRHA 5MFPA 5IXSA 2VYVD 2IYVA 3H9GA 4E2ZA 3CMCO 3RTDA 2OCIA 3WL7A 3O1LA 2CVOA 2HL6A 4I27A 1CY6A 3R3HA 3CEPB 1DEKA 3DAOA 2BHTA 4LAFA 2WFLB 2FWPA 3FTFA 1NY6A 2WZQA 4RPZA 4HDNA 3RHFA 5B3JA 4Z5XA 3F3MA 5I47A 4E1VA 2BI8A 5CPBA 5CAEA 2DWOA 4AS3A 1QDEA 1WMDA 4M88A 1BSVA 3QVWA 3ZWBA 4V3CA 2O8CA 3OZSA 5HP4A 1E77A 4YDQA 1RXSA 3T0GA 2PI4A 2VO1A 3UAOA 3PNCA 5JC8A 2SHKA 1QHHA 3C48A 2H3VA 3Q7IA 2GN9A 3GO4A 4HMPA 4RHEA 3U3RA 4L73A 2P2SA 3NS7A 1R9MA 3ONDA 2F2TA 1LRLA 5LL6P 2IIQA 4KN9S 3ZBUA 4KAFA 1SUDA 2ZBRA 3C45A 3LQ2A 4PHHA 2RGRA 4PZ0A 3GILA 2O8FA 2W6ID 3D5EA 4TLAA 5CA0A 3WA6A 4Y6QA 1VB3A 3WYCA 3TYXA 4G5GA 2CUNA 5AJTA 3T7JA 5LU8A 2VQEB 1NMYA 1TPZA 4F12A 1Z06A 4HDSB 3KKEA 4N5NA 5ALVA 1NK8A 2EAMA 4UE2A 1NKTA 4Q9IA 1EM8A 1TQ6A 2X5NA 4XB2A 3C5VA 1Z8HA 1O8BA 3D1VA 1R4MB 4F2RA 3FYHA 4LZPA 1C3OA 1LK5A 3I09A 2C5BA 2O0JA 4DRYA 4QIWC 2VT7A 3N2EA 4R5HA 5EPUA 3A1WA 2H4JA 3Q1KA 3EUAA 1TLTA 1D2RA 2XYQA 2ZWMA 4BDSA 4ELUA 4MFCA 1T29A 4KQXA 4WWHA 4QVKA 2A1JB 4PRLA 4BXOB 1P1BA 3V4VB 4FYIA 3BTOA 2O0KA 2Z95A 1BE6A 3RF7A 2VSQA 2PLAA 4OJLA 4X8OA 3EODA 4GLLA 1MAUA 5B6JA 3BB1A 2QQ5A 4P2GA 5LR6A 1SVUA 1H2HA 1BQEA 3A6KA 5L1IA 2IZ0A 1OBFO 1XTSA 3F2VA 2ISSD 1X74A 3GIIA 1DNPA 4IILA 3JQBA 3W6PA 3GY0A 1JG6A 5C8YA 3IIIA 5CJ7A 3LH5A 1FNCA 3FDIA 2QY9A 5B2FA 3PA8A 3L8EA 3ILVA 5E1DA 2ECPA 4AMGA 1YJ5A 1JLMA 4S1NA 5EZYF 2BUCA 3HYRA 5BQOA 3BJEA 2JEJA 1D8TA 1GKIA 3D8HA 1ULZA 3L7IA 2ORYA 3STUA 5IF3A 4Z3DA 4EI9A 1UWVA 1KYVA 3AF1A 1LQ2A 5HG0A 3AGPA 2GZ3A 2Y1EA 3PDUA 4EG6A 3KPYA 2PSSA 1BCRB 1L5OA 2FDRA 1EVQA 1QP4A 3EF1A 2HCRA 3ICCA 2RRDA 5IXJA 2XRFA 3HCEA 1V26A 2BEWA 3F1KA 1H2RS 3OQMA 4M53A 4L4ZA 1JDVA 1OPXA 1G21E 4O4HB 2PX6A 1Z1VA 1OHHA 4ER5A 2C00A 1AA6A 3W3ZB 5FQNA 1EFLA 1CU1A 1K8ZB 3DV0A 2OGWA 2C7PA 2Q7DA 3RR8A 2HRZA 3T7DA 3K1ZA 4OHBA 4BU0A 4X92A 2WTAA 1U0OC 3H75A 4M0LA 3P9PA 2PCLA 1Z45A 4KLIA 3AETB 1HMPA 4DA4A 3H2HA 1GTL1 2FSGA 3ZHBA 1JF8A 2ENUA 3JWPA 4ALJA 1RYSA 6REQA 2O7QA 3CF0A 2NADA 3UTCA 1MA7A 5KL1B 3GK3A 1OU4A 4C0HA 3N6XA 4M1MA 1BDMA 3S4YA 1VCHA 3RIHA 3IEVA 4KXMA 3RRMA 2FWMX 3H0EA 3GIKA 2CB9A 2XA2A 3UXPA 1SRQA 4TZ0A 1QFZA 5C5EA 1NKVA 2JIRA 2A4MA 1FFCA 3E03A 4AL4A 4G1FA 1AU9A 3TLEA 2OXRA 4F4ZA 4FVTA 3KELA 1D2MA 3O31A 3C21A 1ISMA 1EIWA 4JEHA 4DMRA 4UNPA 4JYAB 1SGGA 5SYMA 3SAJA 4RVFA 1Y9DA 2ZLBA 3IELA 1VMDA 1X9XA 1WG8A 1DC7A 5DXJA 2JEGA 2IUUA 3R5SA 4BLTA 4YR9A 2DR0A 4A16A 2M0NA 3RG2A 1NBIA 2BJVA 3Q3GE 4OIFA 4NV1A 2DGZA 4FIZA 1Z0FA 3L04A 1BXRA 4D8VA 3RH6A 3ABIA 2VJDA 3QVLA 1TMKA 1E7RA 3NHSA 3ZU3A 2C22A 5BN3B 1D6NA 4WGGA 4O9MA 1SG9A 3TRHA 3H1TA 4FQ7A 4DL9A 2P5UA 1TYCA 3ONVA 3KKZA 1BPBA 3EPIA 1MN6A 2PSHA 3LP8A 4QZFA 4NF2A 5KVCA 1RJFA 4B8YA 3QLEA 2FN8A 7MDHA 3MC1A 4FHDA 2XMCA 4BLPA 1X86B 3OPQA 4XA8A 1PR9A 2FRVA 1TKBA 3C6KA 3UXHA 4DS3A 5REQB 1Q17A 3AINA 1WUIS 3EFHA 5B3AA 3EGXB 4OB8A 1AQUA 3USCS 2GH1A 3U7FB 1RR6A 1GSOA 1M66A 3O82A 2B3DA 2P9GA 3WGIA 1JKJA 1WCIB 4L5JA 3SX4A 4ZPXA 4GXQA 1UBNA 3LS2A 2CMHA 4NAUA 1E1RA 4LS3A 3FOFC 1E2PA 3U3MA 2X9LA 3C5HA 1CD5A 1FS6A 4FZNA 5DK6A 5HBGA 4Q12A 3IH5A 1Q5PA 4TOIA 4EHJA 1YRQA 5DHFA 3A1NA 2DVMA 3AT1A 1Z35A 1EBBA 1ZN8A 2GILA 2I62A 5K4AA 5M3BA 5K0CA 1IMOA 1XAJA 3I01A 3SKVA 4KZKA 1H3NA 1KKMA 3DTYA 1Z36A 3HSYA 3BH7A 3OFJA 1J0AA 3UHAA 3AY0A 5J2CA 4I9NA 1VJDA 7MHTA 1PTJC 4ILEA 2HREA 2JI9A 4LUCA 1N36B 3AERB 5L6LB 4QDJA 4WN3A 1F44A 4IRDA 4CM1A 1THGA 4ND4A 1R5NA 5TQ2B 1UBOS 3RU2A 4DILA 1VP3A 4MF2A 2HUPA 5IEJA 1NW5A 2H63A 2VRWA 3CQ9A 4ZYXA 5I6DA 3OZWA 4P34A 3NC4A 1VIAA 4I1UA 4G9BA 1KYZA 6YASA 4M7RA 2OBFA 2JFHA 3HMKA 3JV7A 2GZAA 2YHIA 4JHLA 1Y6FA 3DVLA 5FEUA 1XPUA 1TMYA 3JATA 2CPRA 1ESMA 3FN4A 4EOGA 4MEAA 5EOVA 3STVA 2P35A 4PGQA 1QG0A 3M2PA 4K26A 1H6AA 2IMWP 1MV5A 4G86A 2B4AA 3FB4A 4QPNA 4R1OA 3VR6D 3NUQA 2NTNA 4MRMB 2FJ0A 1SKAA 3PKZA 1T4MA 2XMGA 5F2OA 1RBQA 1HDCA 2IU0A 1L8QA 2BAGA 3TPZA 2HJSA 4QULA 1T3HA 4ZZ0A 3Q3VA 3DTTA 4DL6A 3T61A 5I7EA 5G5GA 4C0LA 4IFEA 2Q7OE 4LXUA 2YC2C 1ZJNA 2GYYA 2Q8NA 1LPAB 4YPFA 3FMVA 2YZ7A 1Z2CA 3EIXA 4XIFA 4GDMA 3KHSA 4JX9A 4Y1RB 1IQRA 2A9VA 5CLQA 2RGWA 3UKJA 3TAQA 1NN0A 4IEEA 5FD8A 4RU9A 2PKXA 3I2YX 2RCNA 4YCLA 4GYWA 3FSGA 4RSHA 5EWLA 4CKZA 4OREX 4AG6A 2QD2A 4DWOA 3VVCA 2WAMA 1XDWA 5JD3A 2I78A 4GZ5A 3UPQA 5C3MA 4ZVNA 3CJQA 4YDRA 4K2HA 2JLVA 2X42A 3QU9A 4C7MA 1ONOA 5FJIA 1Z47A 1H9AA 4HLCA 2RE8A 1YT3A 3FUXA 5FOQA 1JN0A 1WL8A 1CZUA 4QZVA 1FMLA 3TLBA 4PYQA 1DFHA 1HH4A 4YVZA 1KC3A 1PJQA 4MVJD 1NK7A 3BULA 4QGGA 2HV8A 3JWJA 1WCXA 5EWEA 5AQEA 4R9NA 1S2MA 2N1MA 5KNDH 5HUJA 3IDSA 4ZO6A 3Q1LA 4ED0A 1ZU4A 3VPSA 2BDTA 5KCMA 2BT4A 2R1UA 3BT7A 1ZQQA 3AUAA 4FB5A 4MS4B 1SM4A 4CLHA 2PDAA 3V5NA 4PN7A 2HB6A 4YJ2B 2FEWB 5FWAA 4JEIA 5EHZA 2BQUA 2GEVA 2H1SA 2VHXA 1NTRA 2PXIA 2PKQP 3U56A 2I9GA 2RHTA 2ZRKA 1TK3A 3EWSA 4OV6B 3PYXA 3IPXA 1T5OA 3HDGA 5CDFA 1KQQA 2IEZA 2C7RA 4EM6A 4RV5A 5KNBD 3PPWA 3CUUA 5LOVF 3TF5A 4G24A 2QVCA 2IOYA 2ERCA 4G8BA 4X65B 5JXWA 2BR0A 2X5JO 2OXEA 1OXXK 2QJFA 2OFWA 4X20B 1PF7E 5HZHA 1XD2B 3QWIA 2HBQA 3E2IA 4DQIA 4U2KA 4GYKA 1ZQBA 4RK5A 1JPJA 2G0AA 5F35A 5FR2A 1VJ1A 5AVQA 4RMIA 3BYZA 3UH0A 1LBTA 3DM9B 3KU1A 4N3NA 2RI1A 1Z7WA 5E95A 1JJ7A 2QVXX 1UDAA 5JXHA 2OOKA 3GUHA 1HUOA 4KPUB 1PTJA 1GCUA 5HTKA 4PRKA 2ZRIA 5I7SA 4IJUA 4BCDA 3HUEA 2UZ4A 1U1FA 2FN7A 3SLKA 4DCTA 3TEFA 1VL1A 5G1OA 4IIFA 5A2GA 2C4TA 3WHKA 2XRZA 3NHPA 4K9LA 4E2WA 1Y1SA 2GYWA 2EKZA 1REQA 4MYHA 4KWEA 1MA0A 2QKYA 3RBXA 2PRYA 4LQDA 2D13A 4KXXA 4ETNA 3PW2A 1UEXC 3CNQS 4RU1A 5L7YA 4L95C 1G2OA 1L1EA 2E49A 3FX2A 1I6WA 3P4YA 2ZWVA 3G2KA 4IAOA 3AHGA 5HF5A 3ROKA 4O4IF 1H5UA 4XCVA 4I2CA 3ZLBA 1PV2A 3T0FA 1TK5A 3EK2A 4EYOA 2PZEA 1RXVA 2VT6A 3RM3A 5AJVB 5KVAA 1W8IA 4DG5A 2XEXA 3A3KA 3QUCA 1FEZA 2W9AA 3AOGA 4MS1A 4FWTA 3LWMA 1UMCA 2Q0SA 2G5GX 3VFDA 1OAOA 3SIPA 4EIWA 2YIDA 2HKIA 5AVKA 4DSIA 1JDBC 4TKLA 4BMCA 5CXSA 4L5CA 2D2IA 2GKSA 5EQFA 2R7NA 4EFLA 2ZTDA 1MH1A 3FCEA 4QNNA 1M34E 5IUKC 2IHMA 1CSEE 3B6EA 3K30A 3IDQA 4LFCB 4BNDA 4DQLA 4C0XA 1C9EA 3F96A 1XJWA 1WTCA 3TSYA 4DR1B 4YRRA 5KNLA 1KEJA 4L02A 2BHRA 1E7QA 4O8CA 3QQ5A 3J7AC 4D6YA 2O48X 4FYKA 2P4HX 2P2DA 4URYR 4KLGA 3IALA 2WBLC 4L57A 3MILA 4FMDB 1DEHA 5LYJB 3FVQA 3RYCA 2J9GA 2VDQB 2VP4A 3RDPA 1KVRA 3AR7A 2VZ9A 4RTRA 2FXVA 3WLFA 4EJ2A 2Y1OA 2XC9A 1U0LA 4BQPA 2QTVA 2IPXA 2HHTA 4YT2A 2QRMA 3CP8A 3OI7A 3T4EA 1RAIA 2H7VA 5KT4A 1N2CB 1E2IA 4MPPA 1PVVA 1JU4A 1XO1A 3IDAA 4F06A 3JY6A 1SK8A 4MR7B 3OX3A 3KKMA 2IOFA 2R1TB 3JXEA 3MJVA 3W7AA 3JAMA 2HT1A 2PT9A 3PDWA 4M8NE 3GZNB 1HK7A 2Y0CA 3U3DA 2GAFA 4UVEA 4DLEA 4PPFA 4D0GA 5JSKA 3THXA 4RXUA 1YZ3A 3C3XA 2QX6A 5G0UA 4E5NA 1UPBA 1V6AA 1QUFA 1L7DA 2W3RA 1KRPA 4LWPA 2IBSA 3RFVA 2IZ7A 4D26A 4UHFA 2RP5A 3AEZA 821PA 3K31A 4IGFA 5BSGA 4OQMA 4RC9A 3RHZA 1EZZA 1GLVA 4URUR 4NJ8A 1UJMA 3FYUB 2TMGA 3H5LA 3GPCA 4G4GA 3OP1A 4MV0A 4A0HA 2O3TA 3WNVA 1KE1A 3ZZMA 2DUJA 1ZBDA 2FMXA 2PRSA 2R66A 4LWQA 3BGWA 1LBHA 1F0YA 2CVPA 1W85A 3NC0C 4XAQA 3T5MA 3G2LA 3O8CA 4EF6A 4EBEA 1G17A 4B6EA 1O08A 2PL5A 3ANXA 2XT6A 2ZZNA 2I6QA 2DYKA 2X1LA 2BZFA 2RH9B 2P9BA 3GNSA 1VGVA 3BAZA 5I7AA 3H11A 2UUAB 4ZTBA 3NT4A 4KQ9A 1Q1QA 3ETCA 1C41A 1DAKA 4WFJA 2OP1A 2OCPA 5HFJA 2GDJA 1L5GB 4QVGA 4OXNA 2R5WA 4RD3A 3S70A 3FUUA 3AF6A 2A4KA 2EANA 3B6IA 1PFQA 5FL7A 4I4IA 3SDBA 3HCWA 5BNIA 4BGIA 3T5DA 4P3NA 3UGJA 2XVXA 3DFMA 1Z3CA 3QITA 1ATIA 1LDBA 3CURA 2EWMA 2G83A 4HAUA 3I58A 3HI4A 4LSZA 5T4BA 3M6XA 1KDPA 2QF7A 4MRVA 4EPWA 4DMCA 1G8KA 1QB8A 4A27A 2VDRB 4XX0A 1SC3A 3IXMA 2AH5A 2VPZA 5G0WA 1HL7A 2JLYA 3WNDA 4DZTA 1L3CA 1PZFA 2ASLA 3QG5A 3I05A 3ZV7A 3HDJA 1T10A 3FNFA 4DVGA 5FUXA 2FMPA 1UBMS 5BSHA 4RAQA 1O5IA 3Q8MA 1N6PA 4GPD1 3GEIA 4L07A 1VLJA 2IBKA 3M89A 3A6GA 4CM8B 1J56A 2B94A 3AEUA 1JG2A 5EZQA 1VE6A 3DF7A 5AVJA 1NG1A 2FW0A 4D0LB 4BRSA 1RHKA 2R18A 2DFDA 4P4NA 3FUWA 2ZITA 3AY3A 4KBYA 2VPTA 1UT8A 1Q7RA 1R0WA 3AL0C 2IYLD 4JJ6A 4BMXA 4EB3A 3KXLA 3MIZA 4RIHA 3UPDA 1XMOB 3ZE8A 2WZBA 4YMUA 2F4VB 1G7TA 4I2IA 5DMXA 1KGDA 2BZ1A 5U4XA 1D2CA 1XN4A 4EVRA 3D3JA 2RONA 1JKFA 4RA9B 1LSUA 2A0XA 3H84A 2AWNA 3ZH2A 3SFTA 2GN8A 2ZYGA 1V97A 3QVGA 4M9CA 4NKRA 4IJ6A 2NVWA 5JS1A 3EW9A 1NRIA 3U1TA 1UZMA 3EDYA 3KKPA 4Z1MD 2WP0A 2M6KA 1UFOA 5E6UB 3W1EA 1CIPA 3WXMA 1ZVMA 4QZHA 3DWIA 3EH1A 2ONZA 4PLPA 2QDXA 4IIJF 2P4UA 1G1MA 2J3JA 3HJRA 1JEQA 1YIAA 3E1GA 3K4QA 2IXEA 5FOXA 2I2XB 1YC5A 4CU5A 4ENUA 2YXBA 4YJ3B 4CGZA 1HT0A 2WJWA 4XW2A 4BGUA 3M3HA 3BICA 4TLMB 2H2IA 5EMLA 2ZDQA 2ZJFA 1NF3A 2BKLA 2HRCA 4KRFA 4YR0A 2L0XA 2ONJA 2F4NA 2HJ9A 9ATCA 1NOIA 1YCHA 3AF0A 4OAPA 1AHHA 2CKMA 3USZA 2NU6A 5J0WA 3I12A 1DOAA 3K72B 5J5VA 4U3JA 5CDFE 2PGOA 1U81A 3NVVA 4KCGA 2Q27A 1V95A 3G7UA 1UPCA 1O57A 4UE6A 4PWZA 5BSVA 3UBMA 4B3IA 3L1UA 1L4MA 3HXTA 4LV6A 2PUBA 4TRJA 2HDOA 4ZVVA 2WK1A 5TF4A 2JNWA 1NVKA 2GAOA 1H8HA 3DB2A 2K89A 1ZOPA 3BL6A 4ETMA 5EWFA 1VE3A 2Y0PA 5ALOA 2BBTA 2WWYA 1OXSC 2EU8A 4KI0A 4IIUA 3RC1A 5CEEA 2FUG6 2GMWA 1FXWF 1BNCA 1P0FA 4UM9D 3C43A 1TUGA 5JE8A 1P1FA 5AI8A 3WYFA 2HW8A 3B2QA 4E03A 4J7CA 1R8QA 4DNPA 3NCHA 4M0UA 4DLNA 5KFLA 4OK3A 3JWIA 2ZXHA 4P5EA 3VDMA 3ZQ4A 3G5UA 1Y8RB 2PKWA 5IABA 5TS3A 1IRIA 3LFHA 5FI3A 5BXYA 4HADA 2J3KA 2A0WA 4MV1A 5LLDA 3ZU5A 1K8YB 4BU1A 2IEDA 2E3JA 3FNIA 4HQNA 2MTBA 2AXNA 1L5FA 1N1EA 1QGUA 1Q3KA 2CLSA 4DV4B 4WLNA 5JCOC 2BCEA 2Q3BA 4H7KA 3GJYA 1SBCA 3M9MB 3CNOA 4GI5A 4FYHA 5K05A 2Q41A 1SHLA 3WMXA 1TK8A 3OAAD 2Z83A 5LKRA 1TXGA 4ENVA 3DDCA 1KGSA 1KQOA 1V6SA 4DV0B 1XZIA 5A1JA 2G0TA 2NUPA 1Y8QA 1S10A 2E5FA 3RRJA 1BH2A 1AUOA 4GAEA 4RABA 1KRHA 4G23A 1BD4A 3KRTA 3DTVB 4FSDA 4TUPA 3HNRA 1E7YA 4ND2A 4KHPB 3DCIA 2R84A 4F4WA 3PNBA 5EJFA 2DQKA 1RBZA 4RVDA 4JYBA 4XDGA 1JP7A 4UUOA 5TEWA 3CCFA 3DUFA 5ECGC 4BKUA 1XJQA 2F8TA 1GSIA 3IO5A 5TQ0A 4NXNB 3ACDA 4OATA 2W6OA 1E5VA 3G68A 1PLJA 4BN0A 3HADA 2WNSA 3QEMB 5AKZA 2DPJA 4YT5A 4MKZA 3IERA 3EEIA 1T9KA 5FT9A 2BQ3A 5HKKD 1F2VA 2H0AA 3O8NA 1U0NA 3WFZA 2ZUDA 4FYWA 2BSAA 2FX2A 1ZGBA 4KYTA 1HIWA 3IXQA 4QBIA 2FJ6A 3S2FA 3I23A 1UKEA 2C83A 3E18A 4UBCA 1CY4A 3O21A 3GEGA 1I10A 4FS3A 4C7ZA 1MVLA 3HBFA 3LCJA 2HSGA 2VPPA 4YJDA 3S27A 3C23A 3ZZ0A 1NVXQ 3AESB 5K4HA 4IJVA 2QXUA 3N0RA 5KFGA 3B8HA 3LX4A 1VSVA 4IF6A 1EJ0A 4WV3A 2F3PA 2JAUA 2H18A 3CNLA 3GGDA 4JMUA 5EN4A 4LJAA 3RFFA 1KVSA 1I4WA 1ORWA 5CYOA 5GTDA 3VBEA 4G0OA 3Q9LA 4TM7A 4AZ0B 3SJUA 1JLKA 4BNKA 3JRXA 3NCTA 4QPDA 1ZQXA 2H3QA 1P4RA 3LA6A 2DC1A 5DZSA 3OJSA 4IQGA 2WWHA 3QKRA 1GPMA 2F43A 3WOVA 3DFFA 1PJSA 5BURA 1WS6A 4LCJA 4GI1A 1SCIA 2V6BA 2ERXA 1G5PA 5EQJB 2DWUA 1MRNA 5JSYA 3TOCA 5HF9A 2GM9A 3VISA 1G6Q1 4RTOA 4RLQA 1ZITA 1PR1A 3OQIA 4AMUA 3GLUA 1I1QB 2QI9C 1ZSYA 1QVRA 1L7AA 3AL2A 4EZ9A 2LIPA 2C5LA 1ABBA 2XDAA 2JFOA 5DBIA 2E6UX 1EHCA 2VXBA 1I6KA 5EHNA 4REOA 2BJWA 4B3SB 1RRPA 4D0RA 2IBTA 3FPSA 3ZYZA 3IVGA 4NCXA 2K4HA 1MJGM 4B0OA 4D98A 5KNDA 2D7JA 1EX7A 2ZYUX 2PV0A 5K20A 4WPGA 2QTRA 2W11A 1CG6A 4KIWA 3BEOA 1SL0A 3WOHA 2QVGA 4JP2A 2POQX 4PYNA 3FHLA 4Y0VA 2J59A 5KQSA 3Q6NA 4AKSA 2B0JA 5JCOA 4OB7A 1IIBA 4TKZA 2VAPA 2NTVA 3R8FA 4MUMA 2VCYA 5AIAA 1LFDB 1U9CA 4LDQA 3LDUA 4DF3A 4LI3X 4UUNA 3QVTA 4N3CA 1DRUA 3B2NA 2A1UA 4EFKA 3RIEA 1Q0ZA 3HUFA 1KETA 1TGYA 1CVLA 3R9XB 1MEOA 4DXDA 4WVFA 4JMPA 3TB4A 3CYFA 4WEQA 3CKLA 2OFFA 5EKUA 3IG5A 1TRHA 4BGEA 1G3MA 1SCKA 3RAXA 4L4XA 1Z6XA 1M1NA 3A58B 2PD4A 1OY1A 2RH5A 4KQFA 2QG4A 3BDPA 2ZIXA 5KREA 3CO5A 4MWTA 1N0HA 3MPOA 3STXA 5KQRA 3KTAA 3PNLA 5E4FA 3S8MA 1SEVA 3CZRA 5DHQA 5FUYA 4TUYB 3PC4A 1IJEA 1U8XX 3ZIDA 4H6PA 3V4LA 1PR4A 4N7JA 4HNVA 2NIPA 3QELA 4IOJA 2Y1KA 2R11A 4UAYA 4F04A 1U9ZA 4W1QA 3HB9A 3TUIC 4OFXA 4NBWA 1H1TA 2ET6A 4JI8B 5G3YA 4Q4DA 4F7DA 3WJ2A 5FKJA 1SB9A 5ADVA 3K7EA 1KK0A 4TVKA 1RLJA 1BDJA 1HSOA 3IHKA 2CKDA 2QX7A 1VL2A 3CX8A 4I9UA 3TVTA 5JVDF 1KSJA 2PUJA 3EVFA 4FQ8A 4QXAA 3DM5A 1C2TA 1VBMA 1ZQFA 1XTRA 3LU1A 2E5SA 4PG5A 1A8IA 3C39A 2E4AA 2KHZA 1YZQA 1WU7A 4H0FA 3B3AA 3P45A 3N2GB 1QSGA 3FWPA 4F2GA 3BHIA 3OWOA 3ZLJA 4EJMA 4CMGA 2HHCA 2YOGA 2PWBA 2SICE 1BWPA 4KLOA 3SENA 1GGJA 3VZCA 3LYLA 1NSTA 4LF4B 1UL1X 1UPAA 4HCJA 1I7LA 5KWIA 1I2BA 3IIEA 1WV0A 2O6LA 3AILA 3ICOA 1XCOA 1T9GR 2X19A 3D4BA 2XQJA 3D81A 3MS4A 1W4BA 4NK4A 3I5MA 4P2HA 4OI0A 2LXNA 5T57A 4NECA 1IHXA 2P3LA 3H5RA 3ETGA 2J5QA 4R05A 1BDBA 3RTVA 4H6XA 2WA2A 1S76D 4UKDA 2RAFA 4LF5B 4GWKA 2KD1A 2X4DA 1BHSA 2X0NA 4HAZA 1KDHA 3JZDA 1W8DA 3VNUA 4FGUA 4M1EA 5JQGF 1I4LD 4IVNA 4BB9A 3T7AA 1OXKB 1RJ9B 2A6PA 3NNSA 3KQQA 4MCHA 1J21A 2CUZA 1Z29A 1OUMA 2BR5A 3EISA 1F14A 1Z2NX 3ETJA 1AS2A 3K1RB 3R8XA 1X0XA 1NQVA 5DLPA 3IP8A 1TJPB 3NTOA 4HZGA 4YMVA 1D6SA 1DXSA 4PYIA 3L0SA 2NW6A 3EXEA 4NXZA 4LVSA 1KMHB 1QYVA 2NGRA 5E2AA 1GYRA 2X8JB 4OQFA 3CX3A 3H4TA 1FO4A 5E6SA 3PUZA 2VBCA 2R1VA 4W5WA 2WHQA 2ZIZA 5E9JA 3NHZA 4F5EA 4FFLA 1JLLA 1V7ZA 3CC8A 4H27A 5FHQA 1QBKC 5JLJA 3BBLA 3HZOA 4GGOA 4US0R 3C74A 3GPBA 4OJ5A 3COPA 4INPA 5CVUA 4XM2A 5KX5B 2IDMA 4WXMA 4IEFB 1JALA 1M2HA 3WB2A 1DTWA 3KZ1E 2C3MA 5JARA 3QEBZ 4QOHA 4HLUC 2XI4A 3AZPA 3R3JA 4AFNA 2WJVA 5PGMA 4Y9TA 4ECEA 2IOFK 4ZI2A 2CNLA 3R3SA 5C4GB 1IATA 2IA6A 2PO7A 3C7CB 1QC5B 3OFVA 4HEHA 1D2AA 2Z43A 3WDSA 3NVZA 1UH5A 4MYSA 5F9HA 4BNTA 3KQNA 5CCXA 1PK9A 4UAUA 1NVWQ 2OXIA 4AY6A 1RQRA 5KTKA 2IZ6A 3PT5A 3W9SA 4KXVA 2XE7A 3L8YA 3ZXIA 3GI1A 3P27A 3NDJA 4QWEA 3SQDA 4CF4A 4Q1DA 1P2TA 2QR3A 2TMKA 3V1YA 4UTPA 2JZNA 1Y37A 1ZFNA 3N8NA 4IH9A 1X92A 2I4MA 1GPAA 3FM9A 3W2TA 9ICJA 3G85A 5DCLA 4C3VA 3EAFA 4HNHA 4LNUA 4BKMA 3WQBA 3TLKA 4OSPA 4M0AA 1EJ6A 4FGJA 5L45A 1AS3A 2YX1A 1L8OA 1B43A 4N48A 2DH5A 4OJOA 1EG2A 4QZGA 3KT8A 4Q18A 4Q1CA 4ZYTA 1KKXA 2O07A 2ZXIA 1NE7A 4RK7A 3HFGA 4WKNA 3D7RA 3C3KA 1NY5A 2VXOA 3HCBA 2AFRA 5EE5B 1H9BA 4CG1A 4MWDA 5DBCA 1LF5A 3NBMA 3TDNA 4UZSA 4L78A 3N9IA 1WWVA 4PGYA 5IK2D 2GN2A 4EITA 2JLXA 3L7KA 4GMGA 2ZJYA 1L4HA 5GIPE 3P2YA 5BOSB 3VBCA 4XVUA 1QFMA 1NUAA 1QRRA 4YCNA 4MQ6A 2VTBB 1L7NA 2HEGA 3DLCA 3TNLA 2PWZA 1A5BB 3WMGA 3I2FA 3FYDA 4D82A 3L1JA 3RAGA 4E88A 3R6TA 3N2YA 4R1QA 5A4FS 1LQUA 3ZVKA 1O95D 2V0NA 4IKOA 3T94A 5ALKA 5AW3A 2DPHA 3GFBA 5TSDA 1C4XA 3ZV6A 1J8FA 4NYIR 2O7SA 5ELLA 5ALLA 1PJCA 2CYBA 1Z7GA 3UMBA 3VNQA 3WWPA 4UHHA 3RRYA 3C29A 5KHOC 2P2YA 1I01A 4Q3OA 3H5TA 2PXHA 3UW3A 1WRBA 1DT3A 4LJ5A 4DIMA 1L5VA 1Q84A 1SFRA 3T5GA 3A32A 4RCYA 3RSSA 1ISSA 5HS6A 2WSIA 3OFNA 5E9WA 1SV4A 4IMJB 3QXGA 2OV6A 2EQAA 1UMDB 1ESNA 3RVDA 4M9SA 2C1ZA 4FT4A 1CP2A 4DWWA 4L22A 5G41A 1ZHHA 2Q7XA 4K6KA 3SFZA 3P9QA 2X0IA 1QHGA 3MCAA 4WDRA 1X1BA 3U19A 3ORQA 3NOQA 3KUDA 3G49A 1RCUA 1SD5A 1ZD3A 2DU8A 2XPCA 2WFAA 2W2VA 2CXTA 4CCWA 4PLWA 3RCBA 1LB2B 1QYIA 4EHBA 1A2OA 3MDAA 5LPNA 3U7EB 2J7PA 3OQVA 1T1EA 3ZIAD 2AEEA 2RHJA 4ZI3A 4HQOA 4YV2A 1SUBA 2OV3A 2I67A 1MABB 3PUJA 1Y7TA 2V9WA 5KCZA 1HX7A 4HLUA 4XDYA 1SCUA 1RABA 3L7OA 2WJYA 1KDOA 1HBJA 4X3CA 3HJHA 4UBKA 4O2BF 4DCJA 3NRCA 3VH3A 5DN6A 4P7KA 3TL3A 2XNDD 5T3UA 4PLCA 3ROQA 3AONB 4L08A 2FW8A 2VF2A 2QL6A 1G6HA 3O84A 3PV0A 5CLJA 1M0EA 2OEHA 3R1IA 1A8PA 3EHDA 3ZE2B 4DNQA 3CMMA 3AFOA 1GARA 4TQ9A 1XTZA 1F6DA 1VPWA 3ZD9A 5LDHA 4D9FA 4R3UC 3FOBA 5K5EA 2PMFA 3K9FC 1ZI6A 5CLGA 1H66A 4C4RA 3GLVA 5THXA 1M34A 4DPKA 3D2SA 1IM8A 3RSFA 3K35A 3T7KA 3U9SA 2JATA 3KHLA 1Z07A 2WIAA 3DR3A 4EB8A 5DM60 3QKTA 5EKSA 5IILA 4WUVA 2QJOA 3HXMA 4FS8A 1OROA 5KVVA 1CUBA 3CLSC 1JJFA 5B4UA 3V32A 3NGDA 1G18A 1OILA 3UEOA 1XTIA 4FOTA 3ZJ5A 1XU9A 3HBNA 4O1MA 1B0UA 4C7OA 3GT3A 3DT8A 1M7GA 1CQJB 2X3UA 4ND1A 1DXOA 2HUNA 1GZ5A 4PSDA 3BQ2A 4EW2A 4A6DA 3A1EA 4L5BA 4ZYYA 1ULTA 1A2QA 3I6YA 1XNSA 5MN4A 2WFLA 3AFGA 3BE5A 1L5MA 1CJKC 3GRYA 3UGQA 3KYCB 2Z9CA 2WJ6A 1PGJA 4ZOQI 3REQB 3ICEA 1DKLA 4PHDA 4QZAA 1DOQA 4CKBB 4PCLA 3X1JA 4ZDWA 1RRMA 4KKVA 1B22A 3RSGA 4J6FA 4FHGA 1JPVA 1RZVA 3LG2A 4TSKA 5GM1A 1YDGA 3IQDB 5AKGA 3KALA 1HUQA 3TFQA 3A7DA 1YQDA 1VJRA 1G60A 4OKIA 1B26A 1Z74A 4NLKA 3KQMA 4OHXA 4FE3A 1UPUA 1HTWA 4LZAA 4J0GA 5K0LA 2V7EA 3A6DA 1N5JA 4D41A 3AVXA 2ILVA 2W8BA 2ZUFA 4GO1A 4PVDA 1WSWA 5WRFA 4JV1A 3HEBA 4CCYB 3K9WA 3DKIA 3JTEA 2VAWA 1IHDA 2PY6A 4E2XA 2LI6A 4HDSA 4DFKA 5U4QA 5BWOA 2J5RA 1Z2OX 3WADA 4YX9A 1AA9A 2PX8A 1R4MA 3DKVA 3N8DA 1LBIA 1U7UA 5KU1A 4J49A 3U17A 5JSHA 2OENG 3CH7A 3F73A 1WB9A 4Z9XA 4N40A 4IC9A 4OYYA 4IWNA 1BCSB 3PR5B 2FPSA 4MRRA 3L5OA 1M6HA 1RWQA 1IBSA 5FA8A 2DCMA 1T4GA 1ZR2A 3DV2A 2PX5A 1CS0B 2G71A 1ZGGA 2QXYA 5D85A 3O7MA 3ISCA 1EFTA 4LK3A 2ISPA 5FPTA 4H1WA 4FJ2A 1ECGA 4MWEA 1ISRA 3ZC3A 1WXGA 1XQXA 3FD8A 3AUOA 1CHNA 5C34B 3WC4A 5HUQA 2HLDA 1AKNA 4KDRA 2JD2A 1H8EA 2RIRA 3NP9A 4R8UB 5ESXA 2O1EA 1OB2A 3OPYI 5C9ZA 3EQ7A 5CUQA 1N0WA 2RG7A 3SJAA 3EVNA 3D3NA 4B80A 2OQVA 3L1IA 1LRKA 1GZ7A 2RHLA 2BFPA 1SUEA 1EG7A 2EGHA 4OIMA 1PNTA 4QGFA 3TG8A 2HCTA 2XHEA 4KWCA 4E21A 3I1FA 2I4IA 3DVSX 1UBCA 5JNVA 4IIBA 2PZLA 1P1IA 3EGWA 3WWOA 4ID9A 2WDZA 3U5ZB 3UAGA 1E79D 1KZ6A 3DD1A 1Z39A 2OOSA 1M8JA 1C0PA 3R4CA 4Q1BA 4S0ZA 4RF4A 3N7PD 3ILSA 3UFXA 2HMUA 4MCAA 2V7QA 1K88A 3E9DA 1ZP6A 2HU2A 4ED3A 2ZVQX 1NNI1 3AP1A 3BTUA 4JP3A 3HQ4O 2F90A 2XODA 2HK8A 5CFQA 1ZL0A 1UPFA 3C5EA 5KSPA 1LV8A 2VA3A 5JJKA 7AT1A 1F12A 3MWJA 2OXTA 5JU6A 2C8JA 3D5TA 4TLEA 2X9NA 5BW8A 1EHIA 2DPGA 2V4ZA 2VYQA 2E0IA 4ZVMA 3AETA 3LKZA 3I8XA 4MQFA 2OHJA 5FUBA 4HX2A 1G0OA 1ODTC 1IEVA 4EARA 1NVUQ 2JIPA 4OYHA 5CT6A 2QRKA 5K3BA 4TYPA 2WUFA 3ZU6A 4W9RA 3I32A 4XGQA 4ZOCA 1NIPA 4BP1A 2ZRPA 1N5MA 4DQSA 3TKLA 1N77A 2YDYA 1C8BA 1XZAA 2ZJZA 4JC0A 1EUYA 1T8YA 4Z7NB 1N6NA 4BY9E 1K8RA 1U7XA 1T4CA 3CR8A 3VO8A 3MWKA 2Q0QA 2ZTEA 1U2EA 4C2BA 5HS4A 3L6OO 3BFJA 4FX2A 1ATZA 4LF8B 4DJTA 4IGIA 2WM3A 1QXSA 3ZDQA 4CQJA 4J0QA 4JDPA 2AG5A 3QPWA 4DSZA 3IPYA 1KP9A 3M7IA 1LX7A 3H7AA 2Z9DA 1IG3A 4EJFA 5JAMA 1CE8A 2EAOA 5BW6B 1D2HA 3Q7QA 2C8KA 3MB8A 5BN3A 4HX5A 3PX6A 2FGKA 3ROZA 3C7DB 1EK6A 1P7WA 5KOJA 3M1IA 1N92A 4DLKA 3Q72A 4A0GA 2HIMA 1XDZA 4B8ZA 4WZBB 4KVZA 1C3JA 2P9ZA 1HEIA 2E85A 5DLEA 4M9QA 1WUTA 4C76A 5B37A 1V71A 2XGJA 1DIOB 1ZICA 4X3PA 1S3GA 5REQA 1Q1ZA 4QM7A 2VJPA 3EGXA 1E3DA 4ZHQB 1QONA 3NEYA 4O6VA 1Y3CE 5JZVA 4FGZA 4ATNA 1X94A 1GTVA 1WCIA 4DPMA 3HCOA 2XKBA 3KUCA 3V2GA 3QIAA 3BQNB 2QG9A 3DHNA 3KDAA 2PSFA 1OSNA 4NI5A 4FBLA 2B1QA 4L75A 5AI6A 4BOYA 4ZODA 1CY7A 3D8TA 1H5NA 2ZB3A 5KFIA 4QT0A 4PAGA 1IY8A 1E4VA 4OHZA 3VU8A 1T1SA 5H81A 1U65A 2WSLA 5BOVA 2BFWA 2A9JA 1Z2AA 1E20A 4WD3A 3OQOA 1X7XB 1RTKA 2JBHA 2FTKE 2O8DB 4C2UA 1RYBA 1B8UA 2M9MA 4R9VA 3AKZA 2ASEA 4IX9A 4XDHA 3IDWA 3O4GA 1W48A 2WJGA 3QHAA 4YR7A 2OSBA 2V7PA 2A0FA 4CVNA 1VLMA 4NAVA 7GPBA 5K3AA 4EKEA 4G9EA 3PF9A 3H5NA 1P1KA 3G82C 5COAA 3K6RA 5B1YA 3K9GA 2UVQA 4HVTA 2XAUA 1CUKA 4B9AA 1XALA 2YMMA 1CZOA 1GPUA 1A95A 1I0IA 2YJ4A 2X1VA 4PPGA 4CYMA 3WRWA 3WK8A 5EVCA 1XLUA 3M81A 3O91A 1ZQUA 3PRYA 5DX0A 3A9SA 1VI5A 1T5IA 3IUPA 2XCRB 1MXFA 4JX8A 1KYTA 4YGXB 4TXLA 4Q3KA 1DFIA 1WQ1R 1J5EB 3OZXA 4OQDA 1Q0LA 3DZFA 4OXXA 1E3EA 1LS1A 1X38A 5DYTA 1EYZA 2BWJA 1JAYA 3GJ7A 3MUOA 3WL4A 3K05A 1YCDA 1QRAA 2RH4A 4WOBA 3TW8B 1RPZA 3REGA 3PQ7A 5DMHA 4JVSB 5CT8A 4DYDA 2FUNB 4DLTA 5EERA 2R8BA 4P36A 2PO5A 1K4KA 1XMXA 2ORED 4TTTS 4UAVA 2E8NA 3OE7A 1EK5A 2HA3A 9ICVA 3ENNA 3EIQA 1VHQA 3E3LA 4XXHA 3KIPA 1PTKA 3SP1A 4L15A 4MA4A 1P7CA 3HBMA 3SIXA 2QE7D 4YAIA 3ORHA 4PBTA 1YMQA 3IIMA 1NYRA 1Z34A 2FR0A 4DIOA 1X42A 4HYYA 1FSFA 3GMIA 5FI5A 3D4NA 2GBGA 3BSSA 2C20A 2BGIA 2F3TA 2O57A 4BB0A 3LI2A 2Q4DA 5K01A 4CLRB 1T8TA 1T8EA 4GX0A 4R1TA 1RJDA 1XHLA 4KR0A 1IU9A 1LU9A 2AHOB 3IEIA 4IV0A 4P7GA 1AQNA 4DSLA 3BKXA 3WJ7A 3FR8A 1UCVA 3FVWA 2JGEA 3PSTA 3N8IA 3HCPA 1FVHA 1BVYF 3HWSA 4F72A 2IUEA 1VG0B 3UMFA 1KR5A 4H3KB 2IX9A 1XVLA 4ZRNA 4HQFA 3HN7A 3ZIUA 2C2XA 4KNWA 4DIFA 1G66A 5BPCA 4ACAA 3MTDA 5KMGB 1VE5A 4MS4A 2OD9A 4YJ2A 4C9BA 2AUTA 1OXBB 1L1RA 3R0JA 3W8EA 4EYEA 4NMLA 4DR3B 1SKMA 1G9XA 3KKNA 5K7SA 2H5IA 2CEKA 3UT5B 4LDPA 4NEGA 5B30A 5J4LA 1U4NA 1LPPA 2LCFA 3CG0A 4XQ9A 1SOWA 4I4CA 4ELTA 3PEVA 3WGLA 3DD5A 1QH8A 1ZRMA 2ST1A 4AWBA 1XZLA 1E6WA 4OFBA 1PT9A 3BD9A 2RGYA 3OE5A 5AP9A 4FE7A 3B12A 3DOEA 3UT0A 3JARB 1MX5A 1FUKA 4FT2A 2ID9A 4G4SO 3JQ7B 1NVAA 2NQ8A 2BFCA 3FYUC 3CZMA 4PYLA 2CZQA 4TS3A 1P4HA 4JBWA 5SY4A 4PJ0U 2HF8A 2ZRDA 4HD8A 4Q7QA 5SY9A 1AK2A 3GRZA 4UHKA 1XNRB 3A28A 2FMKA 3ZWWA 4I8DA 3KPUA 4G9GA 1U0HC 4FKMA 3G1TA 4C29A 1RC1A 3AR4A 1T91A 1QQ6A 5ER9A 5CT9A 3VYWA 1AB6A 1I1NA 1PJRA 3CH5A 2PQMA 2PFKA 3C7KA 5K99A 5DKFA 5EL0A 1FYXA 1BEUB 2YL2A 3A9RA 4O02B 3T9FA 4ZQGA 1W44A 3PDHA 4R66A 4KE6A 2OMKA 1QVZA 2C3UA 5EE3A 1K9VF 9ICMA 4M0FA 1IY9A 2UV8A 1HFWA 3TXXA 2IS4A 5ELXA 3DBVO 5DG9A 4MTCA 1MQ2A 2NZJA 3LP6A 5I48A 3RVJA 1HR0B 4J0KA 1JFSA 3K0EA 2J3QA 2ID4A 3DC2A 3KQWA 2B92A 1XQ6A 2WIBA 5B3LA 2ADFA 3HA2A 2XF2A 8ICVA 2PT6A 1CNEA 3FPGA 5IW8A 1L3VA 2JCYA 4XGNA 4RWZA 5IVDA 3RSQA 1JHOA 3SBDA 4IQWA 3GYGA 3G6XA 3HR7A 1P7YA 1HE3A 3VM6A 3TI9A 1S4QA 2REBA 2I3DA 4RTLA 2ENWA 1GPKA 2ZCVA 2YR0A 1F5SA 1PT8A 4HP8A 2XVZA 2PRIA 1LLFA 1FFHA 4UBJA 2HIGA 3WGMA 3NGLA 4WHMA 3STHA 3DBRA 4D9BA 1P0IA 3IBSA 1BX0A 1OGYA 1UM9B 2CXOA 3D2CA 1SEPA 4YXMA 1X8JA 2SKEA 1S02A 1E2JA 5J2AA 2GN6A 2J48A 4Q05A 1ZQOA 2ODPA 3ABSB 4G2NA 1Y1KE 4G26A 2GBIA 2CGEA 4B31A 5HM6A 2X22A 4Q93A 4YI3A 3ENWA 4GFJA 3WTBA 3BFKA 1FC0A 2XF8A 1JVSA 1T0BA 5J2FA 2PFSA 2VTVA 4CL2A 5AKJA 3CLVA 4PC7A 2GD2A 2DLCX 4QJIA 4QDZA 4R81A 2VG8A 2AB0A 4GI2A 4XX1A 2JFNA 4OVKA 3QSYA 3OZFA 3SPXA 1UDWA 521PA 5I8ZA 4URWR 1N2CA 4ZOLF 3QMVA 2Z6AA 3H65A 3I4LA 4UHBA 3T54A 5K4LA 1P33A 3FPBA 4MR7A 4C4XA 4J9KA 1SG0A 4YRQA 3NHUA