2K4EA

Solution structure of the hiv-2 unmyristoylated matrix protein
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
134
structure length
134
Chain Sequence
GARNSVLRGKKADELERIRLRPGGKKKYRLKHIVWAANKLDRFGLAESLLESKEGCQKILTVLDPMVPTGSENLKSLFNTVCVIWCIHAEEKVKDTEGAKQIVRRHLVAETGTAEKMPSTSRPTAPSSEKGGNY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the myristylated human immunodeficiency virus type 2 matrix protein and the role of phosphatidylinositol-(4,5)-bisphosphate in membrane targeting.
pubmed doi rcsb
source organism Human immunodeficiency virus type 2
molecule tags Structural protein
molecule keywords HIV-2 unmyristoylated matrix protein
total genus 37
structure length 134
sequence length 134
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-06-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.90 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2k4eA01
1A6SA 1TAMA 2NV3A 4ICAA 1UPHA 2H3FA 2JMGA 2K4EA 1HIWA 1ECWA 2H3QA 4JMUA 1ED1A 2H3VA 2K4IA 1L6NA 2H3ZA 2K4HA 2HMXA 2LYBA 2GOLA 4IC9A 2N1RA 2H3IA 2LYAA 1HEKA
chains in the Genus database with same CATH superfamily
1UA1A 1PK3A 3LVVA 3Q8QB 2MRLA 4QZFA 8ICWA 2OH2A 3I1YA 1COOA 4UB1A 3V7KA 5F9NA 4NLBA 7ICHA 1ZQNA 1RYSA 2AH5A 3TADC 1FIQA 4DL2A 4XQ8A 2A19A 1ZD2P 2NV3A 5ALIA 4ZOHC 3OJSA 3M8RA 3HWTA 5J8YC 1K1SA 2ZTEA 1SZPA 2AJQA 1Z00B 3N4MB 2KP7A 1N61A 3KHGA 3D2SA 1Q8KA 4F72A 2PFPA 2AGQA 4EYIB 2C2EA 5BOMA 4F4KA 4U6PA 2NO4A 3GIJA 2H3QA 3O0FA 5HR7A 2CXYA 2H5XA 3TAPA 3M6KA 4EX6A 5ALWA 1ZQQA 1XNSA 2LI6A 4Y2UA 2BZFA 4OO1J 1A76A 2G09A 4Q45A 4KLSA 5J2HA 4C80A 2GH1A 5EE9A 2ISPA 3AUOA 3FYHA 4C7YA 1S9FA 4M9NA 1ZQKA 5ALLA 5J2FA 4RPZA 4UBBA 2V4QA 3MC1A 2UVWA 3PY8A 4PGYA 5FP0A 2NRVA 3OGUA 1ECWA 2YB1A 4NWIA 9ICXA 3TKAA 3RR7A 2JGAA 3C5FA 1S77D 1ZXIA 2WHEA 4KMOB 2IOFK 1J97A 3AM9A 4OD0A 9ICOA 2ZIXB 4OJLA 3Q8SB 2KZZA 2KSOA 2JR5A 2EDUA 3RB4A 4NLNA 2BCQA 2HVHA 2GO7A 3C28A 4P4PA 3M9OB 1KLNA 3F5AA 5C0YA 3ZDDA 5KG5A 1BNOA 5J0RA 4QWCA 2RQ5A 4J9RA 1WG8A 5JRTA 4TUPA 4J9MA 4KLJA 1KL9A 1VLBA 1A6SA 5ALYA 1NZBA 2EZZA 1KTQA 2EZYA 1CRXA 5DGBA 4O3MA 2DGZA 5ALPA 4U7CA 3QU2A 2FMSA 4CDGA 4DF8A 5DB7A 2MUTB 4PHPA 3SEIA 5IINA 2A1JB 2XICA 2LKYA 3QUTA 2OWOA 3CRXA 7ICNA 3R9KA 4QWEA 2BPCA 2C22A 3WKBA 1L7OA 1L7PA 3RH5A 3V6KA 3PO5A 1V97A 3EYZA 3TANA 2NRWA 3UMCA 1LVHA 3K1RB 3HRDD 9ICSA 1ZQHA 3M1YA 2KJ5A 4DFKA 3V6HA 4MF2A 2RP5A 2I1QA 2E5SA 2YN4A 2KICA 5A0LA 3UQ0A 3S6JA 4M9LA 5DLFA 3E58A 3HPOA 7ICRA 1TE2A 2IOFA 2OYYA 3NTUA 3IDWA 1XO0A 4I2JA 3OHBA 1Q3UA 3BZCA 4B9NA 3NVYA 4Y2XA 4UB2A 4I2BA 2KK0A 2BHNA 2FPKA 7ICLA 4NLZA 3RB0A 2LM1A 3BDPA 4O5CA 4IQTA 1DK3A 3T3FA 1A0PA 3FDSA 4UAUA 1NK9A 4KLFA 4G9BA 4PJ0U 2KN7A 3TQ1A 4UASA 3L4PA 2OHFA 5KFIA 2HCFA 3PSFA 3MGVA 1RYUA 5AM0A 2KJ8A 4UQGA 2NRTA 3NGDA 1S0OA 3PMLA 1D9FA 5ALEA 2R8IA 1N5WA 3Q8LA 4MF8A 2PI4A 3WKEA 4QZGA 2FPMA 2JH1A 2ASLA 5J0PA 3QXGA 4BWJA 2VA3A 1WWUA 4DFDA 2LM4A 4B9LA 2YMPA 3SV4A 2JZBB 5ALDA 2KZ3A 4ECTA 4TUQA 2IHMA 2XVTA 1LKYA 4EELA 3PW5A 5AM5A 3F5EA 1T3QA 1ZRMA 3D2QA 4UAYA 4Z6FA 5KG2A 3C29A 4O3NA 5J0QA 5F9LA 1XU4A 5HR6A 3ISBA 5ALXA 4US8A 2KZMA 4KLGA 3QU4A 1SWWA 2W55A 2OXOA 2ES6A 2E8OA 4KLOA 4CNQA 4RQMA 4Q43A 2ZIVB 3N7PD 5AKXA 4NLGA 1S10A 5KAIU 4FO6A 3C2MA 2QARA 3PVXA 5KFBA 5KFKA 5KFLA 9ICLA 1BPEA 4BJQA 4ECYA 4M9HA 1N2XA 5TISU 2K8BB 4GIBA 1SKSA 2BCSA 2YMLA 2E8PA 5ALSA 1KN5A 3PX4A 2C28A 4DOAA 1OW5A 4UAWA 4J9OA 3ORYA 3BS5B 7ICOA 2HHWA 4MHVA 2JZBA 4RQ0A 2RHFA 1Z1BA 4ELVA 4YN4A 9ICIA 1N5XA 2MAXA 5KFWA 4B9MA 1V9PA 5CP2A 1SXEA 5DG8A 2QB0B 2R8JA 5KL8B 4NLCA 4C8OA 2KTQA 4P2HA 3QX7A 5L1LA 2ISOA 5ALUA 3NS1A 2BPFA 2HBKA 2MSNA 1X42A 2ATLA 5E79U 8ICMA 3IRUA 4OJ5A 5KFMA 1RXWA 4GXKA 1L8OA 1SV0A 1X9MA 5AI4A 3VCBA 5L1KA 2F76X 2EH9A 2HW3A 2KMDA 2J6SA 1SB3C 3EPGA 4ELTA 2VKQA 4USAA 3T5LA 4YCXA 3ZDCA 1P7DA 2XO7A 2L5YA 4F4WA 4P4OA 1X66A 2JXJA 4PHEA 2E8MA 2F44A 1X9XA 4RZRA 4ECRA 1MA7A 2EAOA 3C21A 3SD7A 5B66U 2Y1JA 1JROA 2JEFA 4PHDA 1XSLA 4M0AA 3RFAA 5CRXA 2ZIUB 4BWMA 1ZD4A 2Z7JA 2NO5A 4X5VA 3N7RC 5KG6A 5AKKA 4PZOA 5DG7A 4ECQA 5KFZA 1FEZA 2IHNA 4C8NA 4YR2A 3F2BA 3THVA 4ECVA 4JV1A 1NOMA 2HSZA 1RXVA 4RNNA 1IM4A 1ZQRA 3GV8B 3F53A 1IXRA 2KHVA 3PSTA 5HNKA 2QB1A 1FFUA 4R64A 1A77A 4AYBC 3SR6A 1TAUA 7ICUA 1N56A 2ASJA 4PGQA 3NASA 4YR3A 2XY7A 4KX3A 4YMMA 4FS2A 4ED1A 2FDRA 3F2DA 2K8AA 5ALMA 1NJXA 1NK8A 4PPXA 3RRHA 1NK4A 7ICGA 8ICHA 2W8LA 4F2RA 3QUBA 3PR4A 3ISDA 1U48A 2FPLA 4KLQA 3H8WA 4FZLA 3D2NA 9ICKA 5ALQA 1C7YA 2F8LA 3L5KA 4IRDA 4J9NA 1JN3A 5DBCA 4DOBA 3PSIA 4R8UB 3QZ8A 1NNLA 5DQHA 2DKXA 4QZDA 2KJ9A 2EAMA 4A8EA 4YP3A 5L1MA 4P0QA 3E2EA 3HW8A 2KNJA 4RQ1A 3TI0A 1ZQXA 1KFTA 4JB3A 2VIXA 5GTHU 4YXJA 5ALOA 4R66A 4KLMA 1XC9A 4GLXA 2KG5A 2H3FA 4P4MA 5EWEA 2JMGA 1L7NA 7ICTA 1ZQ1C 4DS4A 3BS5A 4QW9A 5JU5A 2FMPA 2H3ZA 4PL2A 2CPRA 1ZQMA 1JMSA 1SV0C 2W3RA 2W43A 2N1RA 1LV5A 4P0PA 4J9PA 4DQPA 3WK7A 1FO4A 4EEKA 4ECWA 4E0DA 2F1JA 4ZH4A 2PMZF 4DLGA 2RRDA 3TFSA 1ZQSA 2W11A 4RQ6A 4JUZA 3AEVA 3SAFA 2F8KA 1NK5A 8ICQA 1CEZA 4PZNA 2V9WA 4EZ9A 2BCRA 3T79A 2HOIA 3IV6A 4O3OA 1V38A 3CW2C 3MBYA 7ICJA 3UMBA 2BPGA 5J2BA 1ZQYA 5AHXA 2WF9A 4DSFA 1QTMA 4FBTA 4GC6A 4F4YA 4B9UA 4IQWA 9ICQA 3SQIA 1X40A 1QSSA 3ONNA 4ED2A 2YB4A 3KD3A 3A0HU 3RJHA 1N60A 4I2AA 3KKAA 4O3RA 5ALFA 5AI9A 5DKWA 2ZUCA 5AIBA 2ZIWB 2GWSA 3WK4A 3G6XA 5AM2A 3MABA 3K1ZA 5DG9A 9ICFA 2FLNA 4BUGA 5KFJA 4RNMA 1QSLA 3ZD8A 1UQVA 8ICLA 1GO3F 4GC7A 2K4HA 1S8OA 3C1ZA 1LKYB 2G0AA 2MU2A 1X2IA 3H0LB 5H2FU 4I29A 4EBDA 1NK7A 3QU9A 5KFXA 3OSNA 2DKZA 1B43A 5AKIA 1ZD5A 4CCHA 3PW0A 5J2AA 2KE7A 2F3NA 3E0FA 1B4FA 3GILA 3C2KA 2RLTA 5HMLA 2RDJA 1ZD3A 2HI0A 3N7SC 3K4GA 1SXDA 4I2CA 1MN8A 3QEAZ 4QZIA 2FLPA 4DOCA 5K4LA 4JMUA 9ICNA 1BPBA 4ACOA 2Y0SC 3HP6A 4Y2RA 5IIIA 4J9LA 1BVSA 3T5HA 1PVPA 4QZHA 2LHTA 3D6JA 8ICTA 5AM4A 5KFVA 4IR9A 2NRXA 3PNCA 2BQUA 1KSPA 8ICPA 1KFSA 2FE9A 3MDAA 2EZXA 4GXIA 4KLEA 3ETRA 4M2YA 4I2GA 1N62A 4F3OA 2DWQA 5DDYA 3KKAC 5IIOA 3SI8A 4M6WB 4DCCA 3RRGA 4TURA 2JEJA 5CB1A 5G5GA 2KSOB 3OSPA 2EQYA 1DGSA 2DUYA 2JH7A 4F50A 4DSEA 4NM2A 3ZI4A 2JHDA 2BKEA 3V72A 1F44A 5L1JA 2LMRA 4I28A 1J2MA 1B22A 3SAGA 1ZQPA 3J81j 2WF7A 9ICHA 3ALRA 2PFOA 1HUZA 1C20A 3OPXA 5AKZA 4F71A 5AKYA 9ICGA 1ZRNA 4FZMA 4QNLA 1ZQWA 2A3VA 3KZIU 1L8LA 3TAQA 3U26A 1T7PA 1AQ6A 3H0RB 9ICEA 5DQGA 3AMZA 5AI0A 4RQ3A 3Q8KA 3Q8PB 2HHQA 1QH9A 5ALKA 2AGPA 4QWBA 4UB3A 4F93B 4LZDA 2BDUA 2ZUDA 8ICJA 1F0MA 3IN5A 2CN1A 2W9BA 1KFDA 2MA1A 2E1EA 5DDMA 3WU2U 2J6UA 2E3TA 3SZ2A 3N97B 4DFJA 3Q8MA 1X9WA 4I2FA 3BQTA 2Y9UA 3BQ0A 1XS9D 1O03A 4CE6A 2KFNA 1JIHA 2H3VA 2DQNB 1S5LU 3L3FX 5AKGA 2UVRA 1SZHA 3M9MB 8ICSA 5KFSA 5KFFA 3EW9A 2W9AA 4LVSA 1ZQZA 2PXIA 3G6VA 2AGOA 2Y0SF 4UBCA 3KHHA 3RJKA 3BZKA 3LWMA 4F5NA 1Z3EB 2FJ6A 3SAHA 1PVRA 1N63A 4YVZA 1L7MA 2ZXIA 4EBEA 1BPXA 4CGZA 4F5OA 2G08A 1UT8A 4DSLA 2W54A 1X6IA 3RJEA 2QKQA 4QWDA 1L3VA 2LBOA 4QZ8A 2F1IA 1SKRA 3PMNA 4Y2PA 3RH4A 2A1JA 3DEEA 5KFUA 5HHIA 3KHRA 4PHAA 4GFJA 2ZTDA 2E1FA 1ZQLA 2E8NA 1T3NA 1K5OA 3H8MA 4EENA 4IRKA 3B0YA 4PL1A 2VJ5A 3F2CA 5D49A 3MDCA 4UAVA 2D8CA 3SENA 1X6JA 1L3TA 2YTUA 1D8YA 5J2KA 2GLEA 3M7DA 4RT3A 1PZNA 4Y2QA 5F3XB 4KLHA 4PGXA 1U9LA 5HHHA 1ZYQA 2QARB 1AROP 1JUDA 2JEIA 2UVVA 4O3SA 4ED6A 5AI6A 4YMOA 2K4PA 3ZD9A 5AK6A 4Q8FA 3QNMA 4J03A 2W04A 3JPOA 2QLTA 7ICVA 4QWAA 9ICUA 1N48A 2F1HA 4RPXA 3WK8A 4QZBA 1S97A 5J0TA 3VC8A 4NY8A 2PI5A 5AM1A 4CF4A 4UB4A 3HKZF 2Q0ZX 4KLLA 3I76A 1K1QA 5J2DA 2J6TA 4DWIA 2KFZA 4EBCA 3WK6A 4ED8A 2HBJA 2KV2A 3ED5A 5KG0A 4BGDA 3KTQA 1RM6C 5DQIA 4F92B 2OCEA 5KT6A 3V7LA 3LK9A 2XY6A 4I2HA 3TARA 4US9A 5ALNA 3LVWA 3HJEA 5AKJA 3GDXA 2WF5A 2KD1A 3GIIA 4KLTA 4DEZA 1SIJA 1ZQVA 1TK0A 1ZQCA 5KFTA 1WCNA 2EANA 1Q3VA 3AU6A 4LJXA 2BQRA 4K4IA 1TK5A 3TADA 2ALZA 3SMVA 5KT3A 5DLGA 2WB1C 3NRZA 1SL0A 5ALZA 3ICXA 3PSPA 3NVZA 1ZQOA 5KT5A 1XSPA 1SKWA 3T5JA 4M04A 3NVWA 1J2NA 2NYVA 3BQ7A 1FFVA 5AM3A 3TFRA 4ECSA 3UQ2A 1T4GA 1V85A 1PK1A 2ZG6A 4O9MA 1SV4A 3H7IA 1NJZA 2G5IB 4RNOA 2KHQA 4RQ5A 4NL9A 4Z6EA 2WFAA 5J2JA 2ZIUA 2KVSA 2XIDA 1YZ7A 2K8CB 1COKA 3OTQA 1NJWA 5D4BA 1ZQGA 7ICKA 5KFHA 1L6NA 4Q8EA 1BPZA 4KMUA 1DK2A 4UW9A 1ZQIA 4C8MA 5CA7A 3HT3A 4C4TA 4O3PA 4EYHB 3Q8RB 8ICVA 1UPHA 3PW4A 1D8LA 8ICCA 5BOLA 3PW2A 1ZETA 3UM9A 4MEYA 1NJYA 1CUKA 1MQ2A 3T5KA 4NM1A 2QB0A 5CJ7A 1BPDA 2WF6A 2BDPA 1NZPA 5KG4A 2H3IA 4XRHA 2M9NA 2LYHA 4YD1A 4KN7A 3UPQA 2IMWP 4DO9A 3GIKA 4DS5A 1Y88A 2W03A 4F2SA 3G6YA 1XO1A 3KBBA 3JPSA 2W3SA 3QU5A 2JRZA 3JPNA 3A0BU 5IILA 1OXJA 5DBAA 4B9SA 2B0CA 4AP9A 3FAHA 4ECUA 2R8HA 2JV3A 4M6WA 3IG5A 4P0QB 4DQIA 4QZCA 3PZPA 2P35A 5EE1A 2PMZC 4DLEA 1DRGA 3RBDA 2OEHA 4K4GA 3RJJA 4KLUA 2V4RA 5AI5A 3K75D 5KFPA 4O5KA 4NL9C 2WAQC 3PV8A 4ELUA 2HDOA 3CYMA 2YMMA 8ICOA 1KEJA 4YR0A 3RJIA 2P6UA 4CF3A 3H0MB 2WAQF 3UMGA 3EPIA 3KFUF 1RDFA 2A1AA 2XGQA 9ICAA 4Y2TA 5KFRA 1UHUA 1NK6A 4QZ9A 3RH6A 2K4IA 3B9JA 2W7PA 3MGIA 2KKPA 2ZTCA 4DL6A 2RDIA 5ALJA 2D6FC 4YMNA 3PW7A 3AQEA 3IM1A 3UXNA 4R63A 1RPLA 2K60A 3MR5A 1NKEA 4M9JA 4F8RA 3SV3A 1RQLA 2GOLA 4PH5A 3IHQB 4UB5A 5IIMA 2LYAA 4R65A 4HYKA 9ICBA 4QZEA 4ICAA 4Z6CA 5DB9A 3GV5B 3GFKB 4G3IA 8ICNA 3H4DA 4C8LA 1NKCA 4OCZA 2ZJ8A 1WCLA 4FZNA 2I5HA 1S76D 2W8KA 5L9XA 1XSNA 1KKXA 2ZIVA 4Q44A 3KZXA 4I2DA 4DSJA 1RYRA 1NI3A 2FMQA 3EUB2 3DV9A 3NVVA 4F4ZA 1WYGA 4DL7A 2WF8A 4JWMA 4GXJA 4EEYA 5DB8A 2P6RA 5J0SA 4RPYA 1S0VA 4O5EA 5KT2A 2HBMA 5KG7A 4IR1A 4CRXA 4OJPA 4RUAA 3KOOA 5J0YA 5ALRA 1ZJMA 2OM6A 4I2EA 4F5PA 4R8UA 8ICBA 4ED0A 3NRWA 2FLLA 3HKZC 5KL1B 4UAZA 3MFHA 2PFNA 1H38A 2M0NA 4Y2JA 5J2IA 1BPYA 4DFPA 3PR5B 1Z4NA 1ZQBA 4XUSA 5J2EA 2VA2A 2BGWA 8ICZA 2ZIXA 2KKVA 4RQ7A 8ICGA 2ZXHA 1BGXT 1LB2B 3GZFA 5DGAA 1XWLA 1RZTA 2LYBA 4TUSA 4AYBF 3DDHA 1YZ6A 5J0WA 5EOZA 3WK5A 1PUZA 5GTIU 3QUCA 5EE3A 7ICFA 3RBEA 3QYPA 1PVQA 1L3SA 3RAXA 4DSKA 1T8EA 4YD2A 4DQQA 2DL0A 3QE9Y 3PO4A 3C23A 4F91B 4BDPA 4JK1A 4QIWF 3JPQA 3ISCA 1VJ5A 3FM9A 1T94A 2BQ3A 1SL2A 2W9CA 4F5RA 4IS7A 1SGGA 4UB6U 4TQRA 4QJFB 5KFOA 5KT4A 2HHXA 2YQEA 4J9QA 4BXOA 7ICMA 5KG1A 2WB1F 1SWVA 4ED3A 5KTQA 2BCUA 2F2AB 5KT7A 3C5GA 3IP4B 1L3UA 4YG2A 4KITB 7ICSA 1NKBA 4J9SA 5D46A 4LZGA 1QLNA 2W9BB 2HVIA 3GU3A 8ICYA 8ICAA 4I27A 1JXEA 4KX5A 1U45A 1JX4A 3JPTA 2ZJ5A 1QCKA 1RG6A 4TQSA 2PFQA 1Z19A 4IL6U 3ZDEA 3V7JA 2XI9A 1RQNA 4F5QA 2HOFA 4NXZA 9ICMA 4C0ZA 2W9CB 4BXOB 3WK9A 1JALA 2Y9TA 1VDVA 1HUOA 5G5HA 1Z00A 3M9NB 4FS1A 4NLKA 1Q46A 1JRPA 7ICIA 2UVUA 4EZ6A 3UXPA 5J2CA 3RF9A 5AK4A 4NV0A 5KFYA 1S0MA 1TAMA 1TAQA 1IV8A 4B6JA 4UB8U 3KHLA 3WKCA 1ZQTA 4FE3A 9ICRA 3AL0B 4I2IA 4DSIA 2B6GA 3LYSA 2AQ0A 1ED1A 3I28A 1QSYA 4BX9C 2XCAA 1KQQA 4KN4A 4IQVA 2HHVA 5AKHA 2ODGA 2KOBA 5BPCA 5KNIA 1HEKA 4M9GA 4Y2SA 1KW4A 5J2GA 4J9KA 2YY6A 4Y2VA 2ESEA 4C4RA 4DFMA 7ICQA 3N28A 1B0XA 3AU2A 4P0PB 3H8JA 3RR8A 2D3DA 2WTFA 5JTIA 1ZQFA 2I6XA 2R18A 3MR3A 4C7ZA 2CRXA 4C4SA 7ICEA 4B9VA 5AK3A 9ICWA 3LDAA 4YQWA 3PX0A 2KVCA 2DFLA 4RQ4A 1SL1A 2K4EA 2ZJAA 4OJ6A 1KDHA 4YFKA 1YT3A 1ZQUA 2C2RA 5AICA 3ZDBA 2R8KA 3M8SA 5DB6A 9ICJA 3ETLA 2NRZA 3RB6A 3C2LA 4ECXA 2HHUA 4Z6DA 3GIMA 2KEYA 2R8GA 3GQCA 1URJA 5CR0A 4DL4A 1TK8A 3QUQA 5KFGA 5KFDA 1KBUA 1D8BA 4UARA 2DPJA 8ICUA 5JUMA 1UT5A 2W7OA 5CHGA 1U4BA 3RAQA 2ZIWA 1WWVA 3MFIA 2JEGA 1WUDA 3SYZA 1ZQJA 5DBBA 4O3QA 3LWLA 3IG8A 8ICRA 1QQ7A 4IRCA 5EWFA 3FC4A 2DPIA 4ECZA 3RB3A 2DBYA 5KG3A 1UCVA 5L1IA 5B5EU 5AK5A 5CWRA 4DQSA 3H8SA 4CF5A 2AU0A 2G06A 3MR6A 4QW8A 2ZUBA 3WKDA 2O6KA 4WJ3B 1MQ3A 2HHSA 4FBUA 3EWAA 2MUTA 2VA8A 3CNHA 3BJYA 4EX7A 1QQ6A 2XY5A 2IA6A 2PKEA 3JPPA 2Y1IA 1TKDA 5AIAA 4KTQA 2HHTA 3OHAA 1U47A 4DF4A 5TZVA 5IIKA 4C8KA 3HILA 4O0IA 2FI1A 5KFAA 5AKEA 2BCVA 1BNPA 1HIWA 1ZOLA 4RQ2A 1UA0A 2XGPA 3RTVA 5J0XA 1DGJA 2DF4B 4RT2A 1CI4A 1HJPA 2F77X 1M6YA 2G07A 1D9DA 2YMQA 1OUQA 3M6ZA 5ALHA 2VANA 5KAFU 1X9SA 5J29A 4MFFA 2C2DA 3V6JA 4MEXA 9ICTA 4NJ8A 3AQFA 4IQUA 2EAPA 7ICPA 4RQNA 5ALTA 1L5UA 2Q4TA 1TVAA 1ZQEA 3RJGA 3WKAA 2AHOB 3QZ7A 4MFAA 4MFCA 2YX8A 1DXSA 4B9TA 3CP8A 1ZQDA 1JXLA 4K4HA 3MR2A 2P66A 2AXTU 4KLIA 4DL5A 4ED7A 4YXMA 3H4BA 4RQ8A 1QQ5A 4DQRA 4UATA 3BS7A 3QEBZ 1DOQA 2K89A 4RUCA 3B0XA 4M47A 2IOHA 5KFCA 1S0NA 5KFQA 5AI8A 2XCPA 3UXOA 9ICVA 8ICEA 5HP4A 5EE0A 2B21A 8ICIA 2XC9A 3C1YA 1NK0A 3HX0A 3AN1A 1JI7A 5J8YA 5KFNA 3H40A 2HMXA 4QIWC 3OJUA 3JPRA 2I9GA 5HMMA 5J0OA 5T14A 3PX6A 2HOQA 5CEHA 3EZ5A 8ICFA 1TV9A 5EWGA 3TACB 1ZJNA 1U49A 2G5HB 5KFEA 4DL3A 2KIVA 5ALGA 8ICXA 1Z4OA 1IIPA 2W9MA 4F4XA 3NUQA 3RJFA 3BQ2A 1KRPA 4JV0A 3QU7A 4IC9A 3ZDAA 4JV2A 4KLDA 5ALVA 2VJ4A 2IBKA 2LPEA 1Z1VA 3MGHA 5C5JA 4Y2YA 1F5SA 4FFDA 9ICCA 4OJOA 4QZAA 1IG6A 4XA5A 1PK1B 5AKLA 1ZQAA 4HAIA 2BR0A 4JWNA 1O08A 2AQ4A 1MC8A 5IIJA 3BQ1A 2KIWA 4RU9A 2ASDA 1MSWD 1TFRA 1EXNA 9ICPA 2HBLA 3GV7B 5J0UA 8ICKA
chains in the Genus database with same CATH topology
3CP8A 3H0LB 1TAMA 2G08A 4ICAA 3LVVA 2KD1A 2ZIVB 2MRLA 3N7PD 3RFAA 5CRXA 2ZIUB 2OH2A 3ALRA 1PVQA 2H3FA 1WUDA 2JMGA 2OYYA 2W03A 2LBOA 1Q3VA 2Z7JA 1ECWA 2YB1A 4NWIA 1ZQ1C 1XO0A 4FE3A 4NLBA 3AL0B 3N7RC 4BJQA 2JGAA 3SMVA 3OPXA 4FZNA 3LYSA 1Q3UA 2WB1C 3DEEA 3IG8A 1ED1A 4QIWF 2ZIVA 2K8BB 4GFJA 4BX9C 4CGZA 2H3ZA 3KZXA 2CPRA 2E1FA 4FZMA 2K89A 4KMOB 3E0FA 4PL2A 4QNLA 3ICXA 2A3VA 3F2BA 2ZIXB 3PSPA 1T94A 2KOBA 2N1RA 4P0PA 4OJLA 1HEKA 3IG5A 4PL1A 2VJ5A 3N7SC 2NV3A 3H0RB 3F2CA 4P0QB 2PMZF 3PZPA 2RRDA 2PMZC 3C28A 2RHFA 1A0PA 3F53A 1Z1BA 2G06A 1DRGA 3F5AA 3M7DA 4QJFB 3SAFA 5C0YA 2KHVA 3PSTA 4P0PB 4WJ3B 4JMUA 2HBMA 2ZG6A 4AYBC 3PSFA 2Y0SC 4ACOA 2BDUA 3MGVA 5KL8B 2WAQC 3IN5A 4KX3A 2KJ8A 2CN1A 2WB1F 3CYMA 4NLCA 2HMXA 2MA1A 2R18A 2E1EA 4OJPA 4QIWC 2CRXA 4CRXA 1PVPA 3D2SA 3T79A 3F2DA 2HOIA 2G5IB 2K8AA 5T14A 2LHTA 2KHQA 2HOQA 2F2AB 1A6SA 1NZBA 2OM6A 3H0MB 2WAQF 2KVCA 3IP4B 1CRXA 2HBKA 2ZIUA 2G5HB 2XIDA 4O3MA 3KFUF 2K4EA 1HIWA 2DGZA 2JH1A 2K8CB 4OJ6A 2W04A 4U7CA 4U6PA 4CDGA 1IIPA 2H3QA 3NRWA 3O0FA 4OJ5A 1YT3A 3NUQA 3HKZC 4FZLA 5KL1B 2DF4B 5HR7A 2H3VA 3D2NA 2DQNB 2K4IA 2LKYA 2XICA 3SQIA 3L3FX 1L6NA 3VC8A 2W7PA 2F77X 2F8LA 1SZHA 3VCBA 2KKPA 3CRXA 2M0NA 2XVTA 3M6KA 4IC9A 3ONNA 3GU3A 2F76X 2G07A 3HKZF 1XNSA 2YB4A 2KEYA 2VJ4A 3F5EA 3PSIA 1UPHA 1OUQA 4KX5A 3D2QA 3M6ZA 2VKQA 3C29A 1URJA 2Y0SF 4OO1J 2HBJA 2KV2A 1Z19A 2KJ9A 2JH7A 2D6FC 2ZIXA 2XI9A 2HOFA 2G09A 4A8EA 2ZIWB 2KKVA 4OJOA 1P7DA 4C0ZA 1KBUA 2GH1A 3K1ZA 4P0QA 2JHDA 3AQFA 1D8BA 3AQEA 4BUGA 5HR6A 1F44A 2KNJA 2Q4TA 2ZXHA 1GO3F 3SAHA 2KIWA 2K4HA 2KJ5A 3GZFA 2HBLA 1PVRA 2LYBA 1MA7A 2OXOA 2VIXA 2W7OA 2RP5A 3LVWA 3RF9A 2GOLA 2ZXIA 2G0AA 4NV0A 2YX8A 2ZIWA 2E5SA 4AYBF 3SAGA 2H3IA 2LYAA 2KICA 5A0LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A6S A;  1TAM A;  2NV3 A;  4ICA A;  1UPH A;  2H3F A;  2JMG A;  2K4E A;  1HIW A;  1ECW A;  2H3Q A;  4JMU A;  1ED1 A;  2H3V A;  2K4I A;  1L6N A;  2H3Z A;  2K4H A;  2HMX A;  2LYB A;  2GOL A;  4IC9 A;  2N1R A;  2H3I A;  2LYA A;  1HEK A; 
#chains in the Genus database with same CATH topology
 1UA1 A;  1PK3 A;  3LVV A;  3Q8Q B;  2MRL A;  4QZF A;  8ICW A;  2OH2 A;  3I1Y A;  1COO A;  4UB1 A;  3V7K A;  5F9N A;  4NLB A;  7ICH A;  1ZQN A;  1RYS A;  2AH5 A;  3TAD C;  1FIQ A;  4DL2 A;  4XQ8 A;  2A19 A;  1ZD2 P;  2NV3 A;  5ALI A;  4ZOH C;  3OJS A;  3M8R A;  3HWT A;  5J8Y C;  1K1S A;  2ZTE A;  1SZP A;  2AJQ A;  1Z00 B;  3N4M B;  2KP7 A;  1N61 A;  3KHG A;  3D2S A;  1Q8K A;  4F72 A;  2PFP A;  2AGQ A;  4EYI B;  2C2E A;  5BOM A;  4F4K A;  4U6P A;  2NO4 A;  3GIJ A;  2H3Q A;  3O0F A;  5HR7 A;  2CXY A;  2H5X A;  3TAP A;  3M6K A;  4EX6 A;  5ALW A;  1ZQQ A;  1XNS A;  2LI6 A;  4Y2U A;  2BZF A;  4OO1 J;  1A76 A;  2G09 A;  4Q45 A;  4KLS A;  5J2H A;  4C80 A;  2GH1 A;  5EE9 A;  2ISP A;  3AUO A;  3FYH A;  4C7Y A;  1S9F A;  4M9N A;  1ZQK A;  5ALL A;  5J2F A;  4RPZ A;  4UBB A;  2V4Q A;  3MC1 A;  2UVW A;  3PY8 A;  4PGY A;  5FP0 A;  2NRV A;  3OGU A;  1ECW A;  2YB1 A;  4NWI A;  9ICX A;  3TKA A;  3RR7 A;  2JGA A;  3C5F A;  1S77 D;  1ZXI A;  2WHE A;  4KMO B;  2IOF K;  1J97 A;  3AM9 A;  4OD0 A;  9ICO A;  2ZIX B;  4OJL A;  3Q8S B;  2KZZ A;  2KSO A;  2JR5 A;  2EDU A;  3RB4 A;  4NLN A;  2BCQ A;  2HVH A;  2GO7 A;  3C28 A;  4P4P A;  3M9O B;  1KLN A;  3F5A A;  5C0Y A;  3ZDD A;  5KG5 A;  1BNO A;  5J0R A;  4QWC A;  2RQ5 A;  4J9R A;  1WG8 A;  5JRT A;  4TUP A;  4J9M A;  4KLJ A;  1KL9 A;  1VLB A;  1A6S A;  5ALY A;  1NZB A;  2EZZ A;  1KTQ A;  2EZY A;  1CRX A;  5DGB A;  4O3M A;  2DGZ A;  5ALP A;  4U7C A;  3QU2 A;  2FMS A;  4CDG A;  4DF8 A;  5DB7 A;  2MUT B;  4PHP A;  3SEI A;  5IIN A;  2A1J B;  2XIC A;  2LKY A;  3QUT A;  2OWO A;  3CRX A;  7ICN A;  3R9K A;  4QWE A;  2BPC A;  2C22 A;  3WKB A;  1L7O A;  1L7P A;  3RH5 A;  3V6K A;  3PO5 A;  1V97 A;  3EYZ A;  3TAN A;  2NRW A;  3UMC A;  1LVH A;  3K1R B;  3HRD D;  9ICS A;  1ZQH A;  3M1Y A;  2KJ5 A;  4DFK A;  3V6H A;  4MF2 A;  2RP5 A;  2I1Q A;  2E5S A;  2YN4 A;  2KIC A;  5A0L A;  3UQ0 A;  3S6J A;  4M9L A;  5DLF A;  3E58 A;  3HPO A;  7ICR A;  1TE2 A;  2IOF A;  2OYY A;  3NTU A;  3IDW A;  1XO0 A;  4I2J A;  3OHB A;  1Q3U A;  3BZC A;  4B9N A;  3NVY A;  4Y2X A;  4UB2 A;  4I2B A;  2KK0 A;  2BHN A;  2FPK A;  7ICL A;  4NLZ A;  3RB0 A;  2LM1 A;  3BDP A;  4O5C A;  4IQT A;  1DK3 A;  3T3F A;  1A0P A;  3FDS A;  4UAU A;  1NK9 A;  4KLF A;  4G9B A;  4PJ0 U;  2KN7 A;  3TQ1 A;  4UAS A;  3L4P A;  2OHF A;  5KFI A;  2HCF A;  3PSF A;  3MGV A;  1RYU A;  5AM0 A;  2KJ8 A;  4UQG A;  2NRT A;  3NGD A;  1S0O A;  3PML A;  1D9F A;  5ALE A;  2R8I A;  1N5W A;  3Q8L A;  4MF8 A;  2PI4 A;  3WKE A;  4QZG A;  2FPM A;  2JH1 A;  2ASL A;  5J0P A;  3QXG A;  4BWJ A;  2VA3 A;  1WWU A;  4DFD A;  2LM4 A;  4B9L A;  2YMP A;  3SV4 A;  2JZB B;  5ALD A;  2KZ3 A;  4ECT A;  4TUQ A;  2IHM A;  2XVT A;  1LKY A;  4EEL A;  3PW5 A;  5AM5 A;  3F5E A;  1T3Q A;  1ZRM A;  3D2Q A;  4UAY A;  4Z6F A;  5KG2 A;  3C29 A;  4O3N A;  5J0Q A;  5F9L A;  1XU4 A;  5HR6 A;  3ISB A;  5ALX A;  4US8 A;  2KZM A;  4KLG A;  3QU4 A;  1SWW A;  2W55 A;  2OXO A;  2ES6 A;  2E8O A;  4KLO A;  4CNQ A;  4RQM A;  4Q43 A;  2ZIV B;  3N7P D;  5AKX A;  4NLG A;  1S10 A;  5KAI U;  4FO6 A;  3C2M A;  2QAR A;  3PVX A;  5KFB A;  5KFK A;  5KFL A;  9ICL A;  1BPE A;  4BJQ A;  4ECY A;  4M9H A;  1N2X A;  5TIS U;  2K8B B;  4GIB A;  1SKS A;  2BCS A;  2YML A;  2E8P A;  5ALS A;  1KN5 A;  3PX4 A;  2C28 A;  4DOA A;  1OW5 A;  4UAW A;  4J9O A;  3ORY A;  3BS5 B;  7ICO A;  2HHW A;  4MHV A;  2JZB A;  4RQ0 A;  2RHF A;  1Z1B A;  4ELV A;  4YN4 A;  9ICI A;  1N5X A;  2MAX A;  5KFW A;  4B9M A;  1V9P A;  5CP2 A;  1SXE A;  5DG8 A;  2QB0 B;  2R8J A;  5KL8 B;  4NLC A;  4C8O A;  2KTQ A;  4P2H A;  3QX7 A;  5L1L A;  2ISO A;  5ALU A;  3NS1 A;  2BPF A;  2HBK A;  2MSN A;  1X42 A;  2ATL A;  5E79 U;  8ICM A;  3IRU A;  4OJ5 A;  5KFM A;  1RXW A;  4GXK A;  1L8O A;  1SV0 A;  1X9M A;  5AI4 A;  3VCB A;  5L1K A;  2F76 X;  2EH9 A;  2HW3 A;  2KMD A;  2J6S A;  1SB3 C;  3EPG A;  4ELT A;  2VKQ A;  4USA A;  3T5L A;  4YCX A;  3ZDC A;  1P7D A;  2XO7 A;  2L5Y A;  4F4W A;  4P4O A;  1X66 A;  2JXJ A;  4PHE A;  2E8M A;  2F44 A;  1X9X A;  4RZR A;  4ECR A;  1MA7 A;  2EAO A;  3C21 A;  3SD7 A;  5B66 U;  2Y1J A;  1JRO A;  2JEF A;  4PHD A;  1XSL A;  4M0A A;  3RFA A;  5CRX A;  2ZIU B;  4BWM A;  1ZD4 A;  2Z7J A;  2NO5 A;  4X5V A;  3N7R C;  5KG6 A;  5AKK A;  4PZO A;  5DG7 A;  4ECQ A;  5KFZ A;  1FEZ A;  2IHN A;  4C8N A;  4YR2 A;  3F2B A;  3THV A;  4ECV A;  4JV1 A;  1NOM A;  2HSZ A;  1RXV A;  4RNN A;  1IM4 A;  1ZQR A;  3GV8 B;  3F53 A;  1IXR A;  2KHV A;  3PST A;  5HNK A;  2QB1 A;  1FFU A;  4R64 A;  1A77 A;  4AYB C;  3SR6 A;  1TAU A;  7ICU A;  1N56 A;  2ASJ A;  4PGQ A;  3NAS A;  4YR3 A;  2XY7 A;  4KX3 A;  4YMM A;  4FS2 A;  4ED1 A;  2FDR A;  3F2D A;  2K8A A;  5ALM A;  1NJX A;  1NK8 A;  4PPX A;  3RRH A;  1NK4 A;  7ICG A;  8ICH A;  2W8L A;  4F2R A;  3QUB A;  3PR4 A;  3ISD A;  1U48 A;  2FPL A;  4KLQ A;  3H8W A;  4FZL A;  3D2N A;  9ICK A;  5ALQ A;  1C7Y A;  2F8L A;  3L5K A;  4IRD A;  4J9N A;  1JN3 A;  5DBC A;  4DOB A;  3PSI A;  4R8U B;  3QZ8 A;  1NNL A;  5DQH A;  2DKX A;  4QZD A;  2KJ9 A;  2EAM A;  4A8E A;  4YP3 A;  5L1M A;  4P0Q A;  3E2E A;  3HW8 A;  2KNJ A;  4RQ1 A;  3TI0 A;  1ZQX A;  1KFT A;  4JB3 A;  2VIX A;  5GTH U;  4YXJ A;  5ALO A;  4R66 A;  4KLM A;  1XC9 A;  4GLX A;  2KG5 A;  2H3F A;  4P4M A;  5EWE A;  2JMG A;  1L7N A;  7ICT A;  1ZQ1 C;  4DS4 A;  3BS5 A;  4QW9 A;  5JU5 A;  2FMP A;  2H3Z A;  4PL2 A;  2CPR A;  1ZQM A;  1JMS A;  1SV0 C;  2W3R A;  2W43 A;  2N1R A;  1LV5 A;  4P0P A;  4J9P A;  4DQP A;  3WK7 A;  1FO4 A;  4EEK A;  4ECW A;  4E0D A;  2F1J A;  4ZH4 A;  2PMZ F;  4DLG A;  2RRD A;  3TFS A;  1ZQS A;  2W11 A;  4RQ6 A;  4JUZ A;  3AEV A;  3SAF A;  2F8K A;  1NK5 A;  8ICQ A;  1CEZ A;  4PZN A;  2V9W A;  4EZ9 A;  2BCR A;  3T79 A;  2HOI A;  3IV6 A;  4O3O A;  1V38 A;  3CW2 C;  3MBY A;  7ICJ A;  3UMB A;  2BPG A;  5J2B A;  1ZQY A;  5AHX A;  2WF9 A;  4DSF A;  1QTM A;  4FBT A;  4GC6 A;  4F4Y A;  4B9U A;  4IQW A;  9ICQ A;  3SQI A;  1X40 A;  1QSS A;  3ONN A;  4ED2 A;  2YB4 A;  3KD3 A;  3A0H U;  3RJH A;  1N60 A;  4I2A A;  3KKA A;  4O3R A;  5ALF A;  5AI9 A;  5DKW A;  2ZUC A;  5AIB A;  2ZIW B;  2GWS A;  3WK4 A;  3G6X A;  5AM2 A;  3MAB A;  3K1Z A;  5DG9 A;  9ICF A;  2FLN A;  4BUG A;  5KFJ A;  4RNM A;  1QSL A;  3ZD8 A;  1UQV A;  8ICL A;  1GO3 F;  4GC7 A;  2K4H A;  1S8O A;  3C1Z A;  1LKY B;  2G0A A;  2MU2 A;  1X2I A;  3H0L B;  5H2F U;  4I29 A;  4EBD A;  1NK7 A;  3QU9 A;  5KFX A;  3OSN A;  2DKZ A;  1B43 A;  5AKI A;  1ZD5 A;  4CCH A;  3PW0 A;  5J2A A;  2KE7 A;  2F3N A;  3E0F A;  1B4F A;  3GIL A;  3C2K A;  2RLT A;  5HML A;  2RDJ A;  1ZD3 A;  2HI0 A;  3N7S C;  3K4G A;  1SXD A;  4I2C A;  1MN8 A;  3QEA Z;  4QZI A;  2FLP A;  4DOC A;  5K4L A;  4JMU A;  9ICN A;  1BPB A;  4ACO A;  2Y0S C;  3HP6 A;  4Y2R A;  5III A;  4J9L A;  1BVS A;  3T5H A;  1PVP A;  4QZH A;  2LHT A;  3D6J A;  8ICT A;  5AM4 A;  5KFV A;  4IR9 A;  2NRX A;  3PNC A;  2BQU A;  1KSP A;  8ICP A;  1KFS A;  2FE9 A;  3MDA A;  2EZX A;  4GXI A;  4KLE A;  3ETR A;  4M2Y A;  4I2G A;  1N62 A;  4F3O A;  2DWQ A;  5DDY A;  3KKA C;  5IIO A;  3SI8 A;  4M6W B;  4DCC A;  3RRG A;  4TUR A;  2JEJ A;  5CB1 A;  5G5G A;  2KSO B;  3OSP A;  2EQY A;  1DGS A;  2DUY A;  2JH7 A;  4F50 A;  4DSE A;  4NM2 A;  3ZI4 A;  2JHD A;  2BKE A;  3V72 A;  1F44 A;  5L1J A;  2LMR A;  4I28 A;  1J2M A;  1B22 A;  3SAG A;  1ZQP A;  3J81 j;  2WF7 A;  9ICH A;  3ALR A;  2PFO A;  1HUZ A;  1C20 A;  3OPX A;  5AKZ A;  4F71 A;  5AKY A;  9ICG A;  1ZRN A;  4FZM A;  4QNL A;  1ZQW A;  2A3V A;  3KZI U;  1L8L A;  3TAQ A;  3U26 A;  1T7P A;  1AQ6 A;  3H0R B;  9ICE A;  5DQG A;  3AMZ A;  5AI0 A;  4RQ3 A;  3Q8K A;  3Q8P B;  2HHQ A;  1QH9 A;  5ALK A;  2AGP A;  4QWB A;  4UB3 A;  4F93 B;  4LZD A;  2BDU A;  2ZUD A;  8ICJ A;  1F0M A;  3IN5 A;  2CN1 A;  2W9B A;  1KFD A;  2MA1 A;  2E1E A;  5DDM A;  3WU2 U;  2J6U A;  2E3T A;  3SZ2 A;  3N97 B;  4DFJ A;  3Q8M A;  1X9W A;  4I2F A;  3BQT A;  2Y9U A;  3BQ0 A;  1XS9 D;  1O03 A;  4CE6 A;  2KFN A;  1JIH A;  2H3V A;  2DQN B;  1S5L U;  3L3F X;  5AKG A;  2UVR A;  1SZH A;  3M9M B;  8ICS A;  5KFS A;  5KFF A;  3EW9 A;  2W9A A;  4LVS A;  1ZQZ A;  2PXI A;  3G6V A;  2AGO A;  2Y0S F;  4UBC A;  3KHH A;  3RJK A;  3BZK A;  3LWM A;  4F5N A;  1Z3E B;  2FJ6 A;  3SAH A;  1PVR A;  1N63 A;  4YVZ A;  1L7M A;  2ZXI A;  4EBE A;  1BPX A;  4CGZ A;  4F5O A;  2G08 A;  1UT8 A;  4DSL A;  2W54 A;  1X6I A;  3RJE A;  2QKQ A;  4QWD A;  1L3V A;  2LBO A;  4QZ8 A;  2F1I A;  1SKR A;  3PMN A;  4Y2P A;  3RH4 A;  2A1J A;  3DEE A;  5KFU A;  5HHI A;  3KHR A;  4PHA A;  4GFJ A;  2ZTD A;  2E1F A;  1ZQL A;  2E8N A;  1T3N A;  1K5O A;  3H8M A;  4EEN A;  4IRK A;  3B0Y A;  4PL1 A;  2VJ5 A;  3F2C A;  5D49 A;  3MDC A;  4UAV A;  2D8C A;  3SEN A;  1X6J A;  1L3T A;  2YTU A;  1D8Y A;  5J2K A;  2GLE A;  3M7D A;  4RT3 A;  1PZN A;  4Y2Q A;  5F3X B;  4KLH A;  4PGX A;  1U9L A;  5HHH A;  1ZYQ A;  2QAR B;  1ARO P;  1JUD A;  2JEI A;  2UVV A;  4O3S A;  4ED6 A;  5AI6 A;  4YMO A;  2K4P A;  3ZD9 A;  5AK6 A;  4Q8F A;  3QNM A;  4J03 A;  2W04 A;  3JPO A;  2QLT A;  7ICV A;  4QWA A;  9ICU A;  1N48 A;  2F1H A;  4RPX A;  3WK8 A;  4QZB A;  1S97 A;  5J0T A;  3VC8 A;  4NY8 A;  2PI5 A;  5AM1 A;  4CF4 A;  4UB4 A;  3HKZ F;  2Q0Z X;  4KLL A;  3I76 A;  1K1Q A;  5J2D A;  2J6T A;  4DWI A;  2KFZ A;  4EBC A;  3WK6 A;  4ED8 A;  2HBJ A;  2KV2 A;  3ED5 A;  5KG0 A;  4BGD A;  3KTQ A;  1RM6 C;  5DQI A;  4F92 B;  2OCE A;  5KT6 A;  3V7L A;  3LK9 A;  2XY6 A;  4I2H A;  3TAR A;  4US9 A;  5ALN A;  3LVW A;  3HJE A;  5AKJ A;  3GDX A;  2WF5 A;  2KD1 A;  3GII A;  4KLT A;  4DEZ A;  1SIJ A;  1ZQV A;  1TK0 A;  1ZQC A;  5KFT A;  1WCN A;  2EAN A;  1Q3V A;  3AU6 A;  4LJX A;  2BQR A;  4K4I A;  1TK5 A;  3TAD A;  2ALZ A;  3SMV A;  5KT3 A;  5DLG A;  2WB1 C;  3NRZ A;  1SL0 A;  5ALZ A;  3ICX A;  3PSP A;  3NVZ A;  1ZQO A;  5KT5 A;  1XSP A;  1SKW A;  3T5J A;  4M04 A;  3NVW A;  1J2N A;  2NYV A;  3BQ7 A;  1FFV A;  5AM3 A;  3TFR A;  4ECS A;  3UQ2 A;  1T4G A;  1V85 A;  1PK1 A;  2ZG6 A;  4O9M A;  1SV4 A;  3H7I A;  1NJZ A;  2G5I B;  4RNO A;  2KHQ A;  4RQ5 A;  4NL9 A;  4Z6E A;  2WFA A;  5J2J A;  2ZIU A;  2KVS A;  2XID A;  1YZ7 A;  2K8C B;  1COK A;  3OTQ A;  1NJW A;  5D4B A;  1ZQG A;  7ICK A;  5KFH A;  1L6N A;  4Q8E A;  1BPZ A;  4KMU A;  1DK2 A;  4UW9 A;  1ZQI A;  4C8M A;  5CA7 A;  3HT3 A;  4C4T A;  4O3P A;  4EYH B;  3Q8R B;  8ICV A;  1UPH A;  3PW4 A;  1D8L A;  8ICC A;  5BOL A;  3PW2 A;  1ZET A;  3UM9 A;  4MEY A;  1NJY A;  1CUK A;  1MQ2 A;  3T5K A;  4NM1 A;  2QB0 A;  5CJ7 A;  1BPD A;  2WF6 A;  2BDP A;  1NZP A;  5KG4 A;  2H3I A;  4XRH A;  2M9N A;  2LYH A;  4YD1 A;  4KN7 A;  3UPQ A;  2IMW P;  4DO9 A;  3GIK A;  4DS5 A;  1Y88 A;  2W03 A;  4F2S A;  3G6Y A;  1XO1 A;  3KBB A;  3JPS A;  2W3S A;  3QU5 A;  2JRZ A;  3JPN A;  3A0B U;  5IIL A;  1OXJ A;  5DBA A;  4B9S A;  2B0C A;  4AP9 A;  3FAH A;  4ECU A;  2R8H A;  2JV3 A;  4M6W A;  3IG5 A;  4P0Q B;  4DQI A;  4QZC A;  3PZP A;  2P35 A;  5EE1 A;  2PMZ C;  4DLE A;  1DRG A;  3RBD A;  2OEH A;  4K4G A;  3RJJ A;  4KLU A;  2V4R A;  5AI5 A;  3K75 D;  5KFP A;  4O5K A;  4NL9 C;  2WAQ C;  3PV8 A;  4ELU A;  2HDO A;  3CYM A;  2YMM A;  8ICO A;  1KEJ A;  4YR0 A;  3RJI A;  2P6U A;  4CF3 A;  3H0M B;  2WAQ F;  3UMG A;  3EPI A;  3KFU F;  1RDF A;  2A1A A;  2XGQ A;  9ICA A;  4Y2T A;  5KFR A;  1UHU A;  1NK6 A;  4QZ9 A;  3RH6 A;  2K4I A;  3B9J A;  2W7P A;  3MGI A;  2KKP A;  2ZTC A;  4DL6 A;  2RDI A;  5ALJ A;  2D6F C;  4YMN A;  3PW7 A;  3AQE A;  3IM1 A;  3UXN A;  4R63 A;  1RPL A;  2K60 A;  3MR5 A;  1NKE A;  4M9J A;  4F8R A;  3SV3 A;  1RQL A;  2GOL A;  4PH5 A;  3IHQ B;  4UB5 A;  5IIM A;  2LYA A;  4R65 A;  4HYK A;  9ICB A;  4QZE A;  4ICA A;  4Z6C A;  5DB9 A;  3GV5 B;  3GFK B;  4G3I A;  8ICN A;  3H4D A;  4C8L A;  1NKC A;  4OCZ A;  2ZJ8 A;  1WCL A;  4FZN A;  2I5H A;  1S76 D;  2W8K A;  5L9X A;  1XSN A;  1KKX A;  2ZIV A;  4Q44 A;  3KZX A;  4I2D A;  4DSJ A;  1RYR A;  1NI3 A;  2FMQ A;  3EUB 2;  3DV9 A;  3NVV A;  4F4Z A;  1WYG A;  4DL7 A;  2WF8 A;  4JWM A;  4GXJ A;  4EEY A;  5DB8 A;  2P6R A;  5J0S A;  4RPY A;  1S0V A;  4O5E A;  5KT2 A;  2HBM A;  5KG7 A;  4IR1 A;  4CRX A;  4OJP A;  4RUA A;  3KOO A;  5J0Y A;  5ALR A;  1ZJM A;  2OM6 A;  4I2E A;  4F5P A;  4R8U A;  8ICB A;  4ED0 A;  3NRW A;  2FLL A;  3HKZ C;  5KL1 B;  4UAZ A;  3MFH A;  2PFN A;  1H38 A;  2M0N A;  4Y2J A;  5J2I A;  1BPY A;  4DFP A;  3PR5 B;  1Z4N A;  1ZQB A;  4XUS A;  5J2E A;  2VA2 A;  2BGW A;  8ICZ A;  2ZIX A;  2KKV A;  4RQ7 A;  8ICG A;  2ZXH A;  1BGX T;  1LB2 B;  3GZF A;  5DGA A;  1XWL A;  1RZT A;  2LYB A;  4TUS A;  4AYB F;  3DDH A;  1YZ6 A;  5J0W A;  5EOZ A;  3WK5 A;  1PUZ A;  5GTI U;  3QUC A;  5EE3 A;  7ICF A;  3RBE A;  3QYP A;  1PVQ A;  1L3S A;  3RAX A;  4DSK A;  1T8E A;  4YD2 A;  4DQQ A;  2DL0 A;  3QE9 Y;  3PO4 A;  3C23 A;  4F91 B;  4BDP A;  4JK1 A;  4QIW F;  3JPQ A;  3ISC A;  1VJ5 A;  3FM9 A;  1T94 A;  2BQ3 A;  1SL2 A;  2W9C A;  4F5R A;  4IS7 A;  1SGG A;  4UB6 U;  4TQR A;  4QJF B;  5KFO A;  5KT4 A;  2HHX A;  2YQE A;  4J9Q A;  4BXO A;  7ICM A;  5KG1 A;  2WB1 F;  1SWV A;  4ED3 A;  5KTQ A;  2BCU A;  2F2A B;  5KT7 A;  3C5G A;  3IP4 B;  1L3U A;  4YG2 A;  4KIT B;  7ICS A;  1NKB A;  4J9S A;  5D46 A;  4LZG A;  1QLN A;  2W9B B;  2HVI A;  3GU3 A;  8ICY A;  8ICA A;  4I27 A;  1JXE A;  4KX5 A;  1U45 A;  1JX4 A;  3JPT A;  2ZJ5 A;  1QCK A;  1RG6 A;  4TQS A;  2PFQ A;  1Z19 A;  4IL6 U;  3ZDE A;  3V7J A;  2XI9 A;  1RQN A;  4F5Q A;  2HOF A;  4NXZ A;  9ICM A;  4C0Z A;  2W9C B;  4BXO B;  3WK9 A;  1JAL A;  2Y9T A;  1VDV A;  1HUO A;  5G5H A;  1Z00 A;  3M9N B;  4FS1 A;  4NLK A;  1Q46 A;  1JRP A;  7ICI A;  2UVU A;  4EZ6 A;  3UXP A;  5J2C A;  3RF9 A;  5AK4 A;  4NV0 A;  5KFY A;  1S0M A;  1TAM A;  1TAQ A;  1IV8 A;  4B6J A;  4UB8 U;  3KHL A;  3WKC A;  1ZQT A;  4FE3 A;  9ICR A;  3AL0 B;  4I2I A;  4DSI A;  2B6G A;  3LYS A;  2AQ0 A;  1ED1 A;  3I28 A;  1QSY A;  4BX9 C;  2XCA A;  1KQQ A;  4KN4 A;  4IQV A;  2HHV A;  5AKH A;  2ODG A;  2KOB A;  5BPC A;  5KNI A;  1HEK A;  4M9G A;  4Y2S A;  1KW4 A;  5J2G A;  4J9K A;  2YY6 A;  4Y2V A;  2ESE A;  4C4R A;  4DFM A;  7ICQ A;  3N28 A;  1B0X A;  3AU2 A;  4P0P B;  3H8J A;  3RR8 A;  2D3D A;  2WTF A;  5JTI A;  1ZQF A;  2I6X A;  2R18 A;  3MR3 A;  4C7Z A;  2CRX A;  4C4S A;  7ICE A;  4B9V A;  5AK3 A;  9ICW A;  3LDA A;  4YQW A;  3PX0 A;  2KVC A;  2DFL A;  4RQ4 A;  1SL1 A;  2K4E A;  2ZJA A;  4OJ6 A;  1KDH A;  4YFK A;  1YT3 A;  1ZQU A;  2C2R A;  5AIC A;  3ZDB A;  2R8K A;  3M8S A;  5DB6 A;  9ICJ A;  3ETL A;  2NRZ A;  3RB6 A;  3C2L A;  4ECX A;  2HHU A;  4Z6D A;  3GIM A;  2KEY A;  2R8G A;  3GQC A;  1URJ A;  5CR0 A;  4DL4 A;  1TK8 A;  3QUQ A;  5KFG A;  5KFD A;  1KBU A;  1D8B A;  4UAR A;  2DPJ A;  8ICU A;  5JUM A;  1UT5 A;  2W7O A;  5CHG A;  1U4B A;  3RAQ A;  2ZIW A;  1WWV A;  3MFI A;  2JEG A;  1WUD A;  3SYZ A;  1ZQJ A;  5DBB A;  4O3Q A;  3LWL A;  3IG8 A;  8ICR A;  1QQ7 A;  4IRC A;  5EWF A;  3FC4 A;  2DPI A;  4ECZ A;  3RB3 A;  2DBY A;  5KG3 A;  1UCV A;  5L1I A;  5B5E U;  5AK5 A;  5CWR A;  4DQS A;  3H8S A;  4CF5 A;  2AU0 A;  2G06 A;  3MR6 A;  4QW8 A;  2ZUB A;  3WKD A;  2O6K A;  4WJ3 B;  1MQ3 A;  2HHS A;  4FBU A;  3EWA A;  2MUT A;  2VA8 A;  3CNH A;  3BJY A;  4EX7 A;  1QQ6 A;  2XY5 A;  2IA6 A;  2PKE A;  3JPP A;  2Y1I A;  1TKD A;  5AIA A;  4KTQ A;  2HHT A;  3OHA A;  1U47 A;  4DF4 A;  5TZV A;  5IIK A;  4C8K A;  3HIL A;  4O0I A;  2FI1 A;  5KFA A;  5AKE A;  2BCV A;  1BNP A;  1HIW A;  1ZOL A;  4RQ2 A;  1UA0 A;  2XGP A;  3RTV A;  5J0X A;  1DGJ A;  2DF4 B;  4RT2 A;  1CI4 A;  1HJP A;  2F77 X;  1M6Y A;  2G07 A;  1D9D A;  2YMQ A;  1OUQ A;  3M6Z A;  5ALH A;  2VAN A;  5KAF U;  1X9S A;  5J29 A;  4MFF A;  2C2D A;  3V6J A;  4MEX A;  9ICT A;  4NJ8 A;  3AQF A;  4IQU A;  2EAP A;  7ICP A;  4RQN A;  5ALT A;  1L5U A;  2Q4T A;  1TVA A;  1ZQE A;  3RJG A;  3WKA A;  2AHO B;  3QZ7 A;  4MFA A;  4MFC A;  2YX8 A;  1DXS A;  4B9T A;  3CP8 A;  1ZQD A;  1JXL A;  4K4H A;  3MR2 A;  2P66 A;  2AXT U;  4KLI A;  4DL5 A;  4ED7 A;  4YXM A;  3H4B A;  4RQ8 A;  1QQ5 A;  4DQR A;  4UAT A;  3BS7 A;  3QEB Z;  1DOQ A;  2K89 A;  4RUC A;  3B0X A;  4M47 A;  2IOH A;  5KFC A;  1S0N A;  5KFQ A;  5AI8 A;  2XCP A;  3UXO A;  9ICV A;  8ICE A;  5HP4 A;  5EE0 A;  2B21 A;  8ICI A;  2XC9 A;  3C1Y A;  1NK0 A;  3HX0 A;  3AN1 A;  1JI7 A;  5J8Y A;  5KFN A;  3H40 A;  2HMX A;  4QIW C;  3OJU A;  3JPR A;  2I9G A;  5HMM A;  5J0O A;  5T14 A;  3PX6 A;  2HOQ A;  5CEH A;  3EZ5 A;  8ICF A;  1TV9 A;  5EWG A;  3TAC B;  1ZJN A;  1U49 A;  2G5H B;  5KFE A;  4DL3 A;  2KIV A;  5ALG A;  8ICX A;  1Z4O A;  1IIP A;  2W9M A;  4F4X A;  3NUQ A;  3RJF A;  3BQ2 A;  1KRP A;  4JV0 A;  3QU7 A;  4IC9 A;  3ZDA A;  4JV2 A;  4KLD A;  5ALV A;  2VJ4 A;  2IBK A;  2LPE A;  1Z1V A;  3MGH A;  5C5J A;  4Y2Y A;  1F5S A;  4FFD A;  9ICC A;  4OJO A;  4QZA A;  1IG6 A;  4XA5 A;  1PK1 B;  5AKL A;  1ZQA A;  4HAI A;  2BR0 A;  4JWN A;  1O08 A;  2AQ4 A;  1MC8 A;  5IIJ A;  3BQ1 A;  2KIW A;  4RU9 A;  2ASD A;  1MSW D;  1TFR A;  1EXN A;  9ICP A;  2HBL A;  3GV7 B;  5J0U A;  8ICK A; 
#chains in the Genus database with same CATH homology
 3CP8 A;  3H0L B;  1TAM A;  2G08 A;  4ICA A;  3LVV A;  2KD1 A;  2ZIV B;  2MRL A;  3N7P D;  3RFA A;  5CRX A;  2ZIU B;  2OH2 A;  3ALR A;  1PVQ A;  2H3F A;  1WUD A;  2JMG A;  2OYY A;  2W03 A;  2LBO A;  1Q3V A;  2Z7J A;  1ECW A;  2YB1 A;  4NWI A;  1ZQ1 C;  1XO0 A;  4FE3 A;  4NLB A;  3AL0 B;  3N7R C;  4BJQ A;  2JGA A;  3SMV A;  3OPX A;  4FZN A;  3LYS A;  1Q3U A;  2WB1 C;  3DEE A;  3IG8 A;  1ED1 A;  4QIW F;  2ZIV A;  2K8B B;  4GFJ A;  4BX9 C;  4CGZ A;  2H3Z A;  3KZX A;  2CPR A;  2E1F A;  4FZM A;  2K89 A;  4KMO B;  3E0F A;  4PL2 A;  4QNL A;  3ICX A;  2A3V A;  3F2B A;  2ZIX B;  3PSP A;  1T94 A;  2KOB A;  2N1R A;  4P0P A;  4OJL A;  1HEK A;  3IG5 A;  4PL1 A;  2VJ5 A;  3N7S C;  2NV3 A;  3H0R B;  3F2C A;  4P0Q B;  2PMZ F;  3PZP A;  2RRD A;  2PMZ C;  3C28 A;  2RHF A;  1A0P A;  3F53 A;  1Z1B A;  2G06 A;  1DRG A;  3F5A A;  3M7D A;  4QJF B;  3SAF A;  5C0Y A;  2KHV A;  3PST A;  4P0P B;  4WJ3 B;  4JMU A;  2HBM A;  2ZG6 A;  4AYB C;  3PSF A;  2Y0S C;  4ACO A;  2BDU A;  3MGV A;  5KL8 B;  2WAQ C;  3IN5 A;  4KX3 A;  2KJ8 A;  2CN1 A;  2WB1 F;  3CYM A;  4NLC A;  2HMX A;  2MA1 A;  2R18 A;  2E1E A;  4OJP A;  4QIW C;  2CRX A;  4CRX A;  1PVP A;  3D2S A;  3T79 A;  3F2D A;  2HOI A;  2G5I B;  2K8A A;  5T14 A;  2LHT A;  2KHQ A;  2HOQ A;  2F2A B;  1A6S A;  1NZB A;  2OM6 A;  3H0M B;  2WAQ F;  2KVC A;  3IP4 B;  1CRX A;  2HBK A;  2ZIU A;  2G5H B;  2XID A;  4O3M A;  3KFU F;  2K4E A;  1HIW A;  2DGZ A;  2JH1 A;  2K8C B;  4OJ6 A;  2W04 A;  4U7C A;  4U6P A;  4CDG A;  1IIP A;  2H3Q A;  3NRW A;  3O0F A;  4OJ5 A;  1YT3 A;  3NUQ A;  3HKZ C;  4FZL A;  5KL1 B;  2DF4 B;  5HR7 A;  2H3V A;  3D2N A;  2DQN B;  2K4I A;  2LKY A;  2XIC A;  3SQI A;  3L3F X;  1L6N A;  3VC8 A;  2W7P A;  2F77 X;  2F8L A;  1SZH A;  3VCB A;  2KKP A;  3CRX A;  2M0N A;  2XVT A;  3M6K A;  4IC9 A;  3ONN A;  3GU3 A;  2F76 X;  2G07 A;  3HKZ F;  1XNS A;  2YB4 A;  2KEY A;  2VJ4 A;  3F5E A;  3PSI A;  1UPH A;  1OUQ A;  4KX5 A;  3D2Q A;  3M6Z A;  2VKQ A;  3C29 A;  1URJ A;  2Y0S F;  4OO1 J;  2HBJ A;  2KV2 A;  1Z19 A;  2KJ9 A;  2JH7 A;  2D6F C;  2ZIX A;  2XI9 A;  2HOF A;  2G09 A;  4A8E A;  2ZIW B;  2KKV A;  4OJO A;  1P7D A;  4C0Z A;  1KBU A;  2GH1 A;  3K1Z A;  4P0Q A;  2JHD A;  3AQF A;  1D8B A;  3AQE A;  4BUG A;  5HR6 A;  1F44 A;  2KNJ A;  2Q4T A;  2ZXH A;  1GO3 F;  3SAH A;  2KIW A;  2K4H A;  2KJ5 A;  3GZF A;  2HBL A;  1PVR A;  2LYB A;  1MA7 A;  2OXO A;  2VIX A;  2W7O A;  2RP5 A;  3LVW A;  3RF9 A;  2GOL A;  2ZXI A;  2G0A A;  4NV0 A;  2YX8 A;  2ZIW A;  2E5S A;  4AYB F;  3SAG A;  2H3I A;  2LYA A;  2KIC A;  5A0L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...