2K4EA

Solution structure of the hiv-2 unmyristoylated matrix protein
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
134
structure length
134
Chain Sequence
b'GARNSVLRGKKADELERIRLRPGGKKKYRLKHIVWAANKLDRFGLAESLLESKEGCQKILTVLDPMVPTGSENLKSLFNTVCVIWCIHAEEKVKDTEGAKQIVRRHLVAETGTAEKMPSTSRPTAPSSEKGGNY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-2 unmyristoylated matrix protein
publication title Structure of the myristylated human immunodeficiency virus type 2 matrix protein and the role of phosphatidylinositol-(4,5)-bisphosphate in membrane targeting.
pubmed doi rcsb
source organism Human immunodeficiency virus type 2
molecule tags Structural protein
total genus 37
structure length 134
sequence length 134
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-06-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.90 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2k4eA01
2GOLA 1L6NA 2H3ZA 2K4IA 2JMGA 2LYBA 4JMUA 2H3IA 4IC9A 1HEKA 2K4HA 2HMXA 2H3FA 1HIWA 4ICAA 2N1RA 1TAMA 2H3VA 1ED1A 1A6SA 2NV3A 1ECWA 2LYAA 2H3QA 2K4EA 1UPHA
chains in the Genus database with same CATH superfamily
7ICTA 3ONNA 1ZQOA 3D6JA 1XO1A 1BPBA 3L5KA 1VJ5A 4LJXA 3HJEA 5IIKA 5L1MA 3UM9A 4ECRA 3RAQA 3WKBA 4PJ0U 3M9NB 4DSIA 7ICHA 5HNKA 3DDHA 5CJ7A 4DOAA 2FLNA 1RXVA 9ICQA 1ZJMA 5J0RA 4QWEA 2M0NA 4KITB 4UB8U 4BX9C 3M6ZA 3AU6A 1N63A 3GIMA 3CNHA 4O5KA 4F4XA 1FEZA 3AU2A 5DGAA 3LK9A 1WCLA 2ESEA 3KOOA 4UASA 5DQGA 4QZ9A 1MN8A 4IRDA 3CW2C 5EOZA 5ALTA 5KFNA 4KLUA 4J03A 4NLZA 8ICLA 1D9FA 4QZBA 1X42A 2ZUBA 1SZHA 1U4BA 2EZXA 2E3TA 7ICOA 4K4GA 2E8PA 7ICFA 4C4SA 2H5XA 5TISU 7ICJA 2NRVA 3NUQA 4DQPA 1WG8A 4M9LA 2BPGA 8ICAA 1L7PA 3ZDBA 1B0XA 2WAQF 1N5WA 2MUTB 4RQNA 1ZQMA 4IC9A 3ZDCA 1XC9A 3K1RB 4QW8A 8ICRA 2XCPA 1IXRA 2PKEA 2ZIUA 2W9BA 1S9FA 5DBCA 4DOCA 4B9UA 2KJ9A 2W43A 2E1EA 5L9XA 3KHLA 1ZQFA 3MFIA 2J6UA 4NLBA 5J2GA 3PSTA 4UB5A 3N7PD 3MDCA 3QEAZ 3QUTA 1RXWA 2WAQC 4GXKA 3MBYA 2UVRA 4YMOA 5AKGA 2Y1JA 2FLLA 2OYYA 2P35A 4J9QA 2YN4A 3PZPA 2EH9A 1SL1A 1TFRA 4YR0A 3EW9A 1Q3UA 2AHOB 1PVRA 2BPFA 2HBMA 2KEYA 1JI7A 1CUKA 1L8OA 2BPCA 2V4RA 4O3OA 2A19A 2YB1A 3T5LA 1NI3A 1AROP 3IP4B 2VJ4A 3A0HU 4ED3A 1QSYA 1ZD2P 4KLGA 1KEJA 4CE6A 2WF9A 1HJPA 5ALNA 3RF9A 2DF4B 3IRUA 2P6UA 3O0FA 2ASJA 1RZTA 5DB6A 1L7MA 1KLNA 3H8WA 5DBBA 1COOA 5DBAA 4P0PB 3SEIA 2YMMA 1KFSA 1AQ6A 1ZQCA 3RRHA 4HYKA 2PI5A 1ZQNA 2CN1A 4KN7A 4M9HA 1S8OA 1TAUA 4F2RA 4Y2XA 1ZQXA 4LZGA 3KHGA 1N62A 2YQEA 3G6YA 1SXEA 3HWTA 5ALHA 5B5EU 3SAFA 3QX7A 4DLEA 4P0QA 2VA2A 4K4HA 4EX6A 1SGGA 1RM6C 2OCEA 5AM3A 5CHGA 3MGIA 5D49A 1QQ5A 4B9MA 9ICGA 2JZBB 5JU5A 2KSOA 5KT7A 3RTVA 1EXNA 1T94A 4JV2A 3AEVA 2EQYA 1OUQA 3IV6A 4GIBA 4FZMA 3BDPA 4C8OA 5AIAA 2XIDA 5DDYA 4DFKA 1D8YA 4ECZA 4DWIA 4RUCA 2KK0A 5KG0A 4BJQA 2WFAA 2F2AB 2PI4A 9ICIA 3UMCA 8ICSA 2BDPA 1UPHA 2EAMA 3FYHA 3ISBA 2R8GA 4QZ8A 2QLTA 3PX0A 5EWFA 4EBCA 2W11A 3K75D 3SENA 5KFFA 3H8MA 2ISOA 2Y0SF 1Z00A 4JV1A 4DCCA 1NKBA 3EZ5A 4Y2SA 4Y2TA 5AI8A 1O03A 4QWAA 2BQUA 4I28A 1C20A 2RDJA 1TV9A 5ALJA 2D3DA 2G07A 2HCFA 4RQ2A 2YY6A 2ZIXB 8ICMA 1X66A 4NY8A 2VA3A 2HOFA 4EELA 5KFZA 4JV0A 4EYIB 5KG6A 1UA1A 1Z1BA 2YMLA 4UARA 2FPKA 5AKHA 2XGQA 2Y0SC 1ZQHA 2GOLA 4DQSA 3NVWA 1XO0A 3B0YA 2XGPA 5J0QA 2VKQA 1X2IA 4PGXA 2K8AA 3E0FA 2ALZA 3EWAA 4O9MA 5KG4A 4M9JA 2KZ3A 2F8LA 3RRGA 5KFCA 3RBEA 1PVPA 2VIXA 4NLGA 2BDUA 3WK5A 1X9XA 8ICVA 2RLTA 2JGAA 2F76X 1YZ6A 4UQGA 2KMDA 3THVA 4F4ZA 3V6KA 1NNLA 1ZQIA 2ZTEA 5D46A 3V6JA 4B9SA 2ZUCA 3JPTA 3EPIA 3QU5A 4RQ3A 2DGZA 1LB2B 2EZZA 4M6WB 5KFSA 2W04A 4RPYA 1U47A 5AK4A 4UW9A 1ZQSA 5HMMA 1KKXA 4ECVA 2W7OA 1SV0A 1X6JA 2JV3A 3OHBA 1ZQRA 5EE3A 3Q8MA 2FLPA 1S0OA 5KFJA 2UVUA 2W55A 2JEFA 3M7DA 1DK3A 3SV4A 4I27A 5J0OA 3ISDA 4KN4A 8ICJA 3LDAA 1SZPA 2LMRA 1JROA 2OH2A 9ICVA 3H7IA 5KFGA 4QWCA 2C28A 2J6TA 4DFMA 2I6XA 1ZQBA 1HUZA 1TK8A 3ICXA 5AKEA 2OWOA 1Z3EB 3TADA 3AN1A 5BOLA 1RG6A 2G5HB 2Q4TA 3QUBA 2AGPA 3ZDDA 3OSPA 2HHSA 2QKQA 4B6JA 4UBCA 5E79U 3SV3A 2BR0A 4YXJA 2LI6A 3ED5A 4O0IA 1BNPA 3MDAA 4NV0A 5ALDA 1X6IA 3G6VA 2W03A 2H3IA 3PR5B 4MFCA 2G09A 2ZIVB 5J2CA 2HHQA 4BWMA 3C2KA 2PFOA 4NXZA 4QZHA 4B9VA 3PO5A 5J0TA 4O3MA 2AU0A 5HR6A 1JALA 1NKCA 1SV4A 1RYSA 2HHUA 4RQ6A 4Z6EA 3MABA 2LYBA 5CA7A 4F8RA 4DSJA 3BS7A 1K1QA 9ICSA 4EEYA 1ZQAA 2MUTA 3BQ1A 4DFPA 3C1ZA 2XY7A 5ALXA 5C0YA 1DGSA 4YP3A 3LWLA 3T3FA 4ELUA 3UMBA 4ED7A 3NVVA 1SL0A 2YB4A 3V6HA 3H4DA 5KFQA 5KFBA 3C2LA 2ZJ8A 5KFOA 2WHEA 1IIPA 1BPZA 3EPGA 4QZFA 1J97A 4I29A 2G5IB 3RAXA 4F3OA 3C5GA 8ICXA 3I76A 2MU2A 3RFAA 5J2IA 5J0SA 2KJ5A 3WK9A 2AJQA 9ICPA 2ZTCA 2D6FC 1QCKA 2KP7A 4J9MA 3VC8A 1X9SA 4BWJA 1N56A 2LPEA 9ICHA 4CGZA 1DRGA 1F5SA 1SXDA 3JPPA 1A0PA 5GTHU 4X5VA 4YCXA 9ICOA 4TQSA 4ED8A 2LM4A 5AK5A 4RPXA 3JPQA 4MFFA 3T5JA 1TE2A 1Y88A 4J9PA 4KLDA 3RJHA 4PZOA 3TFRA 1N5XA 4J9OA 4KLTA 4M2YA 4UB4A 4UB1A 3I28A 4FZNA 2DQNB 1Q8KA 5D4BA 4CRXA 2F1JA 4P0PA 4KLLA 1VDVA 4Z6FA 2KN7A 1V38A 4C4RA 3MR3A 5AKYA 1S0VA 3TQ1A 1SKSA 2K60A 1PK3A 4QWBA 4OO1J 5AM0A 4BUGA 4PGQA 3BS5B 1X40A 3AUOA 1DXSA 4OJLA 4KLOA 1RQNA 2QB0B 1NOMA 2ZJAA 4Y2QA 4DSKA 3TAPA 2NYVA 3PW4A 3AM9A 4ECQA 4RT2A 3PW7A 4DL5A 1TK0A 3QU4A 4NWIA 4YD2A 2KKPA 3PMLA 2JZBA 4F5RA 3PSFA 4NLKA 2HSZA 1TK5A 4ELTA 4EZ9A 4IQUA 1ZRMA 2LM1A 4PZNA 1XWLA 3TARA 4OD0A 5DG8A 5G5GA 3V7LA 3CP8A 4DQRA 5CR0A 2KZZA 5KFRA 3RR8A 2XY5A 4YMNA 3HRDD 5AKJA 1JRPA 1B22A 5HP4A 4WJ3B 2E8OA 2P66A 2RHFA 3C5FA 3NS1A 1BVSA 4ACOA 4KLEA 1A6SA 3T5HA 3KKAA 3UQ0A 4QZEA 5KFXA 5KT4A 3L4PA 4DL7A 2XICA 4NJ8A 3QZ8A 1WCNA 3LWMA 2QB1A 4I2AA 2KICA 2R8HA 2BKEA 2J6SA 4F2SA 2BCQA 2PXIA 2DL0A 3KFUF 3B0XA 5ALEA 5CRXA 4ZOHC 4F5QA 3AQFA 1S10A 3PMNA 3E2EA 3GDXA 2K8CB 1BPDA 3GV5B 4I2GA 3WKDA 5DB9A 1Z19A 2MAXA 4KLFA 2YX8A 4QW9A 2WF5A 4DO9A 1HIWA 4DL4A 3WKCA 1PVQA 4Q8EA 9ICKA 8ICPA 2F3NA 1L7OA 2ES6A 2AGQA 2RDIA 4RPZA 1ZQLA 1HUOA 3D2SA 3MFHA 4J9LA 3S6JA 1NJXA 2F44A 2AGOA 3JPNA 4EX7A 3H8SA 3IG8A 2PFQA 4AYBC 3SAGA 4YXMA 9ICUA 4U6PA 5HHIA 5AI9A 4JWMA 3MC1A 4BDPA 3V7KA 4OJ5A 4ECYA 5IIOA 3K4GA 7ICGA 4NM2A 1KBUA 4F5NA 7ICKA 5ALMA 1SL2A 2D8CA 4M6WA 4MF2A 5DB8A 5KL8B 5KT2A 2BGWA 4YR3A 1TAMA 3WK8A 4GLXA 1LV5A 4YN4A 4FE3A 2K4IA 4Z6DA 2O6KA 4KLQA 4R66A 2OM6A 4CF3A 3I1YA 5DLGA 1MQ2A 9ICXA 3H0RB 3F5EA 4R8UA 2BCSA 1D9DA 2EZYA 4F4WA 4I2CA 1IV8A 4MHVA 3IG5A 8ICTA 2M9NA 2KIVA 9ICEA 2K4EA 4UAUA 5EE9A 3PSIA 2JMGA 1T3NA 5J0UA 4GC7A 1FFUA 2G08A 2ZTDA 5J0YA 5ALIA 4F92B 1OW5A 1NJWA 4J9NA 5BPCA 4ZH4A 2KFNA 4DFDA 4IQVA 2KOBA 2RQ5A 2ZIVA 4MEXA 3RJGA 2QARB 4C0ZA 4DFJA 4O5EA 1QQ7A 4KLSA 1SB3C 3J81j 4CNQA 4QZCA 1HEKA 1UHUA 4FS1A 5J8YA 4DS4A 2OEHA 3NASA 5EE1A 2W8LA 2KJ8A 5IIIA 2C2EA 5JTIA 4US8A 2XI9A 5KG7A 8ICOA 3PW5A 4P4OA 2ZXIA 5KFWA 2YMQA 3C23A 4RQ7A 4QZAA 4OCZA 5DLFA 5J0PA 5FP0A 9ICNA 5L1JA 2IMWP 2KD1A 1KQQA 4RNMA 4PHPA 2WF7A 2HBLA 3ETRA 3QZ7A 1L3SA 2JEIA 5IIMA 4ED0A 3T5KA 3SQIA 5AKIA 3BQ7A 3F2BA 5KFHA 2JHDA 2DPJA 1S76D 3QU9A 3MR5A 1KFTA 5H2FU 3SD7A 3F2CA 1K1SA 3PX6A 1B43A 2JEGA 2MA1A 3SMVA 7ICVA 1WUDA 5AM2A 4FS2A 2KIWA 2I9GA 1IG6A 3RH4A 3PR4A 4KLIA 1BPXA 4B9LA 3RB3A 3F2DA 1ZOLA 4I2EA 8ICNA 4OJPA 1P7DA 2AQ4A 2AQ0A 5AI5A 2CXYA 2K4PA 4DOBA 4QNLA 1PZNA 2W9BB 3RH5A 2XVTA 3HILA 3Q8QB 2NRWA 3QXGA 3MR2A 3IHQB 3FM9A 1XSLA 4NL9A 2IHMA 1XU4A 4CDGA 3JPOA 4KLJA 3BS5A 1J2MA 9ICWA 4J9KA 2FMSA 2C22A 1UQVA 9ICBA 3T79A 1Q46A 3QU2A 2QB0A 3RR7A 3NRWA 1N61A 2FE9A 4PL2A 2VJ5A 4MF8A 4OJOA 2KHQA 2C2DA 4F72A 4US9A 2G06A 3N7SC 2DUYA 4CF4A 1NJYA 4M9NA 3RB4A 4PHDA 3A0BU 1K5OA 4KMOB 2F1HA 1ZD5A 2NRZA 3N28A 4UAZA 5AKKA 2F77X 5F3XB 2GWSA 3QUQA 8ICHA 1QSSA 3DEEA 4F4KA 5T14A 4C8KA 2XCAA 3CYMA 3HP6A 1NZPA 1CRXA 4UAYA 2KG5A 5ALFA 3ALRA 3UXPA 3TI0A 4O3NA 1ECWA 1RYUA 8ICUA 2XO7A 2IOHA 4IRKA 4FBUA 3Q8KA 2FMPA 3TACB 2H3FA 4GXIA 3QYPA 3RH6A 1RPLA 5J2BA 3GV7B 5IIJA 1U45A 5AI6A 3SI8A 4UATA 5A0LA 1KFDA 4C8LA 2ASLA 3PW0A 7ICRA 4QZDA 4ELVA 4IRCA 2KKVA 4F5PA 1SWVA 2LKYA 4DL6A 8ICEA 4TUSA 1NKEA 4RUAA 1ZQDA 2B21A 2JH7A 1YZ7A 2UVVA 1ZQKA 3KHRA 2HOQA 2A1JB 5J29A 1L6NA 3KTQA 2L5YA 2HDOA 4ECSA 5KG2A 5ALUA 1H38A 2BHNA 2F1IA 3WK7A 3UPQA 2K89A 1QQ6A 5KFAA 5KFUA 3KHHA 1U49A 2NO5A 1BGXT 2ZIWB 1MC8A 3M8SA 5JRTA 1NZBA 2OXOA 4ECUA 9ICTA 4DL3A 1UA0A 1NK9A 2I1QA 2ASDA 4O3QA 1C7YA 1O08A 4UAVA 3NTUA 4TUPA 2KVSA 5ALWA 4RZRA 4C8NA 2B6GA 5KG1A 2EDUA 5KFYA 2BCVA 3Q8SB 1RDFA 2YMPA 2KFZA 2W9MA 1KL9A 1OXJA 3L3FX 5CP2A 4DLGA 3TADC 4P4MA 5KTQA 3LVWA 4ECXA 3IN5A 1NK0A 3Q8RB 4OJ6A 4CF5A 5AI4A 1JX4A 5J2AA 3OJSA 7ICMA 3NGDA 4G9BA 4PH5A 8ICWA 1TKDA 3WK6A 2MRLA 4B9NA 1VLBA 3HPOA 1DK2A 1Z4OA 2K4HA 5ALRA 5CEHA 4QZIA 4FBTA 8ICCA 5JUMA 3OHAA 4USAA 3RJJA 3N4MB 5BOMA 5KAFU 4C4TA 3M6KA 9ICMA 4F71A 1SKRA 4Q8FA 3Q8LA 4ECWA 4RNOA 2WTFA 5AK6A 1Q3VA 4LVSA 3RJKA 3RJIA 3H0LB 2JH1A 5AIBA 3PNCA 2RRDA 4KLHA 4F5OA 3HT3A 2DKXA 1L8LA 3GIJA 2W9AA 5DQIA 1NK4A 2H3ZA 4KMUA 3MGVA 4O3SA 2ZJ5A 4I2FA 5J0WA 5AM5A 2XC9A 1KRPA 8ICZA 1N2XA 2QARA 4YG2A 2JRZA 4EENA 2W3RA 3RB0A 4R65A 3PX4A 1L3VA 1B4FA 2I5HA 4PHAA 2RP5A 8ICYA 3N7RC 2WF8A 2R8IA 2DWQA 4DQQA 4BGDA 5DDMA 4P2HA 5IILA 1L7NA 2ZG6A 4XQ8A 1JIHA 2DPIA 4Y2UA 1A77A 2PMZF 3F5AA 1ZD4A 2FMQA 5KFEA 3LYSA 5K4LA 3UMGA 2Q0ZX 1ZQ1C 2KE7A 2IOFK 4DF8A 3JPSA 3BQTA 4EBEA 2E8NA 4Y2VA 2W9CB 4C80A 4R63A 2CPRA 5KAIU 1QLNA 4XA5A 2JR5A 1NK6A 3QUCA 3BJYA 3UQ2A 2Y9UA 1JUDA 2FI1A 7ICUA 2DFLA 5J2DA 2CRXA 4RQ0A 1KTQA 3IDWA 1BNOA 2PMZC 8ICQA 4DS5A 2W7PA 3HW8A 1ZD3A 1XSNA 5DGBA 1FO4A 4CCHA 2ZIXA 1ZXIA 3PY8A 5CWRA 4TQRA 4UAWA 1FFVA 1QH9A 1X9MA 1ZQQA 4Y2JA 1S5LU 2E1FA 9ICJA 4QJFB 4AYBF 3E58A 1JN3A 4TUQA 4O3PA 2LYHA 3KZIU 2HHWA 5L1LA 1T7PA 3RJFA 9ICRA 2ATLA 2H3VA 5KFMA 5KFTA 3ZD8A 2LYAA 3SZ2A 5G5HA 4IR9A 1DGJA 3NRZA 1SKWA 1V97A 3C29A 1ZQZA 5ALVA 3PSPA 2P6RA 2IBKA 4P4PA 1S0NA 5KFLA 2OHFA 2K8BB 3OJUA 1J2NA 1L3UA 3PV8A 4JWNA 5DB7A 1ZJNA 8ICIA 3EYZA 1ZQUA 3KZXA 1U48A 1D8LA 3BQ2A 4BXOB 3RB6A 3C28A 2Y1IA 3F53A 4I2JA 2HBJA 4QZGA 5L1KA 1S0MA 4IL6U 1CI4A 3DV9A 5AK3A 4O3RA 1JXLA 4I2HA 5AM4A 3EUB2 3KKAC 3M9MB 1KN5A 4NM1A 1SIJA 5KG5A 5L1IA 2VA8A 4O5CA 4M04A 4XUSA 2V4QA 3H0MB 4KX3A 4Z6CA 1TAQA 3GU3A 5J2JA 3RJEA 3GV8B 5J2HA 2V9WA 8ICFA 1KSPA 2EAPA 5ALLA 3C21A 4KLMA 5KNIA 4M0AA 2WF6A 2B0CA 1TVAA 5AI0A 3V72A 1Z1VA 2KVCA 1LKYB 3SR6A 4QIWF 4YVZA 2XY6A 2HMXA 3U26A 2BZFA 1PK1B 3KBBA 4DQIA 2BCRA 2Z7JA 2LBOA 3H8JA 4JUZA 1X9WA 5ALZA 5KFDA 1L5UA 3AMZA 4Q44A 5KFKA 2JEJA 3H40A 1ZQVA 4A8EA 4ED6A 4QIWC 2JXJA 4EZ6A 1S77D 2NV3A 3OTQA 1N48A 2R18A 5B66U 2E8MA 3WKEA 2DKZA 5KFIA 5AM1A 3OGUA 2HHVA 1WYGA 5HHHA 4EYHB 5ALSA 2A1JA 2UVWA 4I2IA 2KHVA 1F44A 3M9OB 1DOQA 1UCVA 4XRHA 5EE0A 4UB3A 5J2FA 1URJA 2HHXA 2ZIWA 4RT3A 5KL1B 5ALQA 4KTQA 2F8KA 5KG3A 2FJ6A 4RQ5A 3TKAA 5J2EA 3FAHA 2R8JA 2KZMA 5IINA 4ED1A 2ISPA 3FC4A 4KX5A 2WB1F 3FDSA 1MQ3A 3UXOA 4RQ4A 9ICCA 1ZRNA 4I2BA 3GIIA 2HBKA 5HR7A 1QSLA 4Y2RA 3CRXA 8ICGA 1LVHA 7ICEA 3Q8PB 2W54A 3D2QA 4DSEA 2IOFA 3OSNA 4EEKA 4MEYA 1T3QA 5C5JA 1KW4A 2PFNA 3BZKA 2WB1C 2ZIUB 1ZQTA 3QNMA 3K1ZA 5ALPA 4LZDA 5AICA 2BQRA 4F50A 4RU9A 2FPLA 4F93B 3D2NA 5ALYA 5AKXA 5KFPA 4HAIA 1A76A 5J8YC 1ZQJA 4J9RA 2HW3A 5DKWA 5CB1A 4YFKA 4UB6U 3HX0A 2W8KA 2GLEA 2MSNA 3AL0B 1ZYQA 2KNJA 4R64A 1PUZA 5DG7A 3PVXA 1CEZA 4M47A 7ICQA 3OPXA 2YTUA 1ZQEA 2BQ3A 1ED1A 3G6XA 3KD3A 8ICKA 2DBYA 4DSLA 3QU7A 4MFAA 4UB2A 2KTQA 2W3SA 5KT5A 9ICAA 1JMSA 3SAHA 1N60A 7ICLA 4U7CA 4RQ1A 4NLNA 1MA7A 2GH1A 1NK5A 1WWUA 3GQCA 3GZFA 4G3IA 2VANA 4RQ8A 4R8UB 1WWVA 5AKLA 3PW2A 4B9TA 1ZQGA 2GO7A 2HHTA 4YR2A 4IR1A 4DSFA 1M6YA 2W9CA 1MSWD 5ALOA 4C7YA 3BZCA 3M8RA 1IM4A 2ODGA 4EBDA 3M1YA 4YMMA 5DQHA 4P0QB 3PO4A 5ALKA 8ICBA 1T8EA 4NLCA 1D8BA 4F91B 5F9NA 1SWWA 1Z4NA 1BPYA 3ORYA 1KDHA 2KSOB 1XSPA 2G0AA 3JPRA 1GO3F 4FFDA 3VCBA 4NL9C 1V9PA 1QTMA 1JXEA 5EWGA 4GFJA 4RNNA 5KT6A 2H3QA 3IM1A 4PL1A 1NK8A 2ZUDA 3WK4A 3NVYA 5HMLA 2BCUA 4RQMA 5GTIU 1XS9D 1UT8A 3GIKA 4M9GA 3ETLA 9ICLA 4C7ZA 5J0XA 1SV0C 4JK1A 4Q43A 1ZQPA 3BQ0A 2HVHA 3GFKB 3MGHA 5AHXA 1Z00B 2AH5A 4FZLA 3C1YA 3WKAA 3N97B 4AP9A 2Y9TA 1ZETA 1T4GA 2A3VA 1COKA 2FPMA 2N1RA 3WU2U 7ICSA 4BXOA 2ZXHA 3H4BA 4DL2A 3HKZF 2LHTA 4YQWA 1F0MA 5J2KA 1YT3A 5F9LA 1FIQA 3RBDA 4F4YA 3SYZA 3QEBZ 4PHEA 2IA6A 3NVZA 4Y2YA 3QE9Y 5KFVA 5TZVA 4ICAA 4GXJA 5KT3A 7ICPA 3C2MA 1RYRA 4UBBA 3ZI4A 2E5SA 5DG9A 1UT5A 2HVIA 3ISCA 1RQLA 4PGYA 5ALGA 2NRXA 5EWEA 1NJZA 2KV2A 2FDRA 9ICFA 1BPEA 4IS7A 4JMUA 3HKZC 4IQWA 3UXNA 4JB3A 3LVVA 3GILA 2NRTA 5AKZA 4K4IA 4Q45A 4IQTA 1S97A 4DF4A 1NK7A 3ZD9A 1ZQYA 3TANA 1XNSA 4Y2PA 2IHNA 3AQEA 2PFPA 1LKYA 4ECTA 3TFSA 4J9SA 3B9JA 4QWDA 3ZDAA 4GC6A 1U9LA 2EAOA 1PK1A 2AXTU 4TURA 4FO6A 4DEZA 3V7JA 1L3TA 2HI0A 4I2DA 3ZDEA 7ICIA 7ICNA 4ED2A 4PPXA 2NO4A 2R8KA 3MR6A 1ZQWA 2C2RA 2A1AA 4YD1A 4E0DA 1V85A 2EANA 4C8MA 3TAQA 2HOIA 3R9KA
chains in the Genus database with same CATH topology
2ZIWA 2F76X 2KIWA 5KL1B 3PSIA 1OUQA 2JMGA 2K8CB 2WAQC 1T94A 3ONNA 2LYBA 2MRLA 4FZMA 4OO1J 2G08A 4FZLA 4BUGA 3F2DA 1Z19A 2CRXA 2K4HA 2XIDA 3SAHA 4KX5A 2YX8A 2WB1F 3H0MB 4U7CA 2H3FA 4OJLA 1HIWA 2OYYA 4KX3A 4OJPA 3PZPA 1PVQA 1MA7A 2GH1A 1P7DA 3GU3A 2A3VA 5C0YA 2PMZC 4BJQA 2F2AB 2HBKA 2N1RA 1Q3UA 2W7PA 3M6KA 5HR7A 1PVRA 2HBMA 3GZFA 2KEYA 3CRXA 4QNLA 2KOBA 3D2SA 2ZXHA 2DGZA 2ZIVA 2LHTA 2ZIXA 2XVTA 3HKZF 3D2QA 1UPHA 4C0ZA 5A0LA 2YB4A 2W04A 2M0NA 2E1FA 1Q3VA 1YT3A 4NWIA 4BX9C 3M6ZA 2KKPA 2KKVA 2YB1A 4AYBF 4QJFB 3IP4B 2KVCA 1HEKA 2LKYA 1IIPA 3PSFA 4QIWF 2VJ4A 3IG8A 2W7OA 2HMXA 4AYBC 3SAGA 3H0LB 2G5IB 2JH1A 4U6PA 2RRDA 3RF9A 2Y0SF 3M7DA 4ICAA 4CDGA 3RFAA 2JH7A 2DF4B 2KJ8A 2WB1C 2Z7JA 4P0QB 4OJ5A 2H3VA 2LBOA 2KJ5A 2E5SA 3O0FA 2XI9A 2HOQA 2D6FC 2ZIUB 3T79A 2H3ZA 2LYAA 3VC8A 1L6NA 2OH2A 2ZXIA 3CP8A 3MGVA 3K1ZA 4NLCA 1D8BA 3NRWA 2KV2A 4P0PB 4PL2A 2VJ5A 4JMUA 3HKZC 1SZHA 2G07A 4OJOA 3LVVA 1KBUA 2K89A 3C29A 2KHQA 2ZIXB 4CGZA 3D2NA 3ICXA 3PSPA 1DRGA 2CN1A 4A8EA 2HOFA 1A0PA 2G06A 3N7SC 2ZIWB 2G0AA 5KL8B 1GO3F 3NUQA 3VCBA 4QIWC 4WJ3B 2G5HB 2Q4TA 1NZBA 1Z1BA 1TAMA 2RHFA 2OXOA 1XNSA 4ACOA 2KD1A 2K8BB 3AQEA 2RP5A 2WAQF 4KMOB 2NV3A 1A6SA 4GFJA 2R18A 2Y0SC 3AL0B 2HBLA 2H3QA 3N7RC 2F77X 2GOLA 4PL1A 4FE3A 4NV0A 2K4IA 2KNJA 1XO0A 2XICA 2W03A 3SAFA 3KZXA 2H3IA 2VKQA 4IC9A 2K8AA 4P0QA 3E0FA 2ZG6A 2OM6A 3SQIA 3DEEA 2PMZF 3F5AA 2KICA 2G09A 5T14A 2ZIVB 3LYSA 2ZIUA 3H0RB 3F5EA 3OPXA 4FZNA 2DQNB 2JHDA 3C28A 3F2BA 3F53A 2HBJA 2KHVA 2F8LA 3L3FX 1F44A 3KFUF 3CYMA 1ZQ1C 2KJ9A 3F2CA 2E1EA 4CRXA 4P0PA 3LVWA 5CRXA 2HOIA 4NLBA 3IN5A 2VIXA 3PSTA 1PVPA 1CRXA 3AQFA 1ED1A 2BDUA 2CPRA 2MA1A 3IG5A 3N7PD 4OJ6A 3SMVA 4O3MA 3ALRA 1URJA 1ECWA 1WUDA 5HR6A 2K4EA 2JGAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GOL A;  1L6N A;  2H3Z A;  2K4I A;  2JMG A;  2LYB A;  4JMU A;  2H3I A;  4IC9 A;  1HEK A;  2K4H A;  2HMX A;  2H3F A;  1HIW A;  4ICA A;  2N1R A;  1TAM A;  2H3V A;  1ED1 A;  1A6S A;  2NV3 A;  1ECW A;  2LYA A;  2H3Q A;  2K4E A;  1UPH A; 
#chains in the Genus database with same CATH topology
 7ICT A;  3ONN A;  1ZQO A;  3D6J A;  1XO1 A;  1BPB A;  3L5K A;  1VJ5 A;  4LJX A;  3HJE A;  5IIK A;  5L1M A;  3UM9 A;  4ECR A;  3RAQ A;  3WKB A;  4PJ0 U;  3M9N B;  4DSI A;  7ICH A;  5HNK A;  3DDH A;  5CJ7 A;  4DOA A;  2FLN A;  1RXV A;  9ICQ A;  1ZJM A;  5J0R A;  4QWE A;  2M0N A;  4KIT B;  4UB8 U;  4BX9 C;  3M6Z A;  3AU6 A;  1N63 A;  3GIM A;  3CNH A;  4O5K A;  4F4X A;  1FEZ A;  3AU2 A;  5DGA A;  3LK9 A;  1WCL A;  2ESE A;  3KOO A;  4UAS A;  5DQG A;  4QZ9 A;  1MN8 A;  4IRD A;  3CW2 C;  5EOZ A;  5ALT A;  5KFN A;  4KLU A;  4J03 A;  4NLZ A;  8ICL A;  1D9F A;  4QZB A;  1X42 A;  2ZUB A;  1SZH A;  1U4B A;  2EZX A;  2E3T A;  7ICO A;  4K4G A;  2E8P A;  7ICF A;  4C4S A;  2H5X A;  5TIS U;  7ICJ A;  2NRV A;  3NUQ A;  4DQP A;  1WG8 A;  4M9L A;  2BPG A;  8ICA A;  1L7P A;  3ZDB A;  1B0X A;  2WAQ F;  1N5W A;  2MUT B;  4RQN A;  1ZQM A;  4IC9 A;  3ZDC A;  1XC9 A;  3K1R B;  4QW8 A;  8ICR A;  2XCP A;  1IXR A;  2PKE A;  2ZIU A;  2W9B A;  1S9F A;  5DBC A;  4DOC A;  4B9U A;  2KJ9 A;  2W43 A;  2E1E A;  5L9X A;  3KHL A;  1ZQF A;  3MFI A;  2J6U A;  4NLB A;  5J2G A;  3PST A;  4UB5 A;  3N7P D;  3MDC A;  3QEA Z;  3QUT A;  1RXW A;  2WAQ C;  4GXK A;  3MBY A;  2UVR A;  4YMO A;  5AKG A;  2Y1J A;  2FLL A;  2OYY A;  2P35 A;  4J9Q A;  2YN4 A;  3PZP A;  2EH9 A;  1SL1 A;  1TFR A;  4YR0 A;  3EW9 A;  1Q3U A;  2AHO B;  1PVR A;  2BPF A;  2HBM A;  2KEY A;  1JI7 A;  1CUK A;  1L8O A;  2BPC A;  2V4R A;  4O3O A;  2A19 A;  2YB1 A;  3T5L A;  1NI3 A;  1ARO P;  3IP4 B;  2VJ4 A;  3A0H U;  4ED3 A;  1QSY A;  1ZD2 P;  4KLG A;  1KEJ A;  4CE6 A;  2WF9 A;  1HJP A;  5ALN A;  3RF9 A;  2DF4 B;  3IRU A;  2P6U A;  3O0F A;  2ASJ A;  1RZT A;  5DB6 A;  1L7M A;  1KLN A;  3H8W A;  5DBB A;  1COO A;  5DBA A;  4P0P B;  3SEI A;  2YMM A;  1KFS A;  1AQ6 A;  1ZQC A;  3RRH A;  4HYK A;  2PI5 A;  1ZQN A;  2CN1 A;  4KN7 A;  4M9H A;  1S8O A;  1TAU A;  4F2R A;  4Y2X A;  1ZQX A;  4LZG A;  3KHG A;  1N62 A;  2YQE A;  3G6Y A;  1SXE A;  3HWT A;  5ALH A;  5B5E U;  3SAF A;  3QX7 A;  4DLE A;  4P0Q A;  2VA2 A;  4K4H A;  4EX6 A;  1SGG A;  1RM6 C;  2OCE A;  5AM3 A;  5CHG A;  3MGI A;  5D49 A;  1QQ5 A;  4B9M A;  9ICG A;  2JZB B;  5JU5 A;  2KSO A;  5KT7 A;  3RTV A;  1EXN A;  1T94 A;  4JV2 A;  3AEV A;  2EQY A;  1OUQ A;  3IV6 A;  4GIB A;  4FZM A;  3BDP A;  4C8O A;  5AIA A;  2XID A;  5DDY A;  4DFK A;  1D8Y A;  4ECZ A;  4DWI A;  4RUC A;  2KK0 A;  5KG0 A;  4BJQ A;  2WFA A;  2F2A B;  2PI4 A;  9ICI A;  3UMC A;  8ICS A;  2BDP A;  1UPH A;  2EAM A;  3FYH A;  3ISB A;  2R8G A;  4QZ8 A;  2QLT A;  3PX0 A;  5EWF A;  4EBC A;  2W11 A;  3K75 D;  3SEN A;  5KFF A;  3H8M A;  2ISO A;  2Y0S F;  1Z00 A;  4JV1 A;  4DCC A;  1NKB A;  3EZ5 A;  4Y2S A;  4Y2T A;  5AI8 A;  1O03 A;  4QWA A;  2BQU A;  4I28 A;  1C20 A;  2RDJ A;  1TV9 A;  5ALJ A;  2D3D A;  2G07 A;  2HCF A;  4RQ2 A;  2YY6 A;  2ZIX B;  8ICM A;  1X66 A;  4NY8 A;  2VA3 A;  2HOF A;  4EEL A;  5KFZ A;  4JV0 A;  4EYI B;  5KG6 A;  1UA1 A;  1Z1B A;  2YML A;  4UAR A;  2FPK A;  5AKH A;  2XGQ A;  2Y0S C;  1ZQH A;  2GOL A;  4DQS A;  3NVW A;  1XO0 A;  3B0Y A;  2XGP A;  5J0Q A;  2VKQ A;  1X2I A;  4PGX A;  2K8A A;  3E0F A;  2ALZ A;  3EWA A;  4O9M A;  5KG4 A;  4M9J A;  2KZ3 A;  2F8L A;  3RRG A;  5KFC A;  3RBE A;  1PVP A;  2VIX A;  4NLG A;  2BDU A;  3WK5 A;  1X9X A;  8ICV A;  2RLT A;  2JGA A;  2F76 X;  1YZ6 A;  4UQG A;  2KMD A;  3THV A;  4F4Z A;  3V6K A;  1NNL A;  1ZQI A;  2ZTE A;  5D46 A;  3V6J A;  4B9S A;  2ZUC A;  3JPT A;  3EPI A;  3QU5 A;  4RQ3 A;  2DGZ A;  1LB2 B;  2EZZ A;  4M6W B;  5KFS A;  2W04 A;  4RPY A;  1U47 A;  5AK4 A;  4UW9 A;  1ZQS A;  5HMM A;  1KKX A;  4ECV A;  2W7O A;  1SV0 A;  1X6J A;  2JV3 A;  3OHB A;  1ZQR A;  5EE3 A;  3Q8M A;  2FLP A;  1S0O A;  5KFJ A;  2UVU A;  2W55 A;  2JEF A;  3M7D A;  1DK3 A;  3SV4 A;  4I27 A;  5J0O A;  3ISD A;  4KN4 A;  8ICJ A;  3LDA A;  1SZP A;  2LMR A;  1JRO A;  2OH2 A;  9ICV A;  3H7I A;  5KFG A;  4QWC A;  2C28 A;  2J6T A;  4DFM A;  2I6X A;  1ZQB A;  1HUZ A;  1TK8 A;  3ICX A;  5AKE A;  2OWO A;  1Z3E B;  3TAD A;  3AN1 A;  5BOL A;  1RG6 A;  2G5H B;  2Q4T A;  3QUB A;  2AGP A;  3ZDD A;  3OSP A;  2HHS A;  2QKQ A;  4B6J A;  4UBC A;  5E79 U;  3SV3 A;  2BR0 A;  4YXJ A;  2LI6 A;  3ED5 A;  4O0I A;  1BNP A;  3MDA A;  4NV0 A;  5ALD A;  1X6I A;  3G6V A;  2W03 A;  2H3I A;  3PR5 B;  4MFC A;  2G09 A;  2ZIV B;  5J2C A;  2HHQ A;  4BWM A;  3C2K A;  2PFO A;  4NXZ A;  4QZH A;  4B9V A;  3PO5 A;  5J0T A;  4O3M A;  2AU0 A;  5HR6 A;  1JAL A;  1NKC A;  1SV4 A;  1RYS A;  2HHU A;  4RQ6 A;  4Z6E A;  3MAB A;  2LYB A;  5CA7 A;  4F8R A;  4DSJ A;  3BS7 A;  1K1Q A;  9ICS A;  4EEY A;  1ZQA A;  2MUT A;  3BQ1 A;  4DFP A;  3C1Z A;  2XY7 A;  5ALX A;  5C0Y A;  1DGS A;  4YP3 A;  3LWL A;  3T3F A;  4ELU A;  3UMB A;  4ED7 A;  3NVV A;  1SL0 A;  2YB4 A;  3V6H A;  3H4D A;  5KFQ A;  5KFB A;  3C2L A;  2ZJ8 A;  5KFO A;  2WHE A;  1IIP A;  1BPZ A;  3EPG A;  4QZF A;  1J97 A;  4I29 A;  2G5I B;  3RAX A;  4F3O A;  3C5G A;  8ICX A;  3I76 A;  2MU2 A;  3RFA A;  5J2I A;  5J0S A;  2KJ5 A;  3WK9 A;  2AJQ A;  9ICP A;  2ZTC A;  2D6F C;  1QCK A;  2KP7 A;  4J9M A;  3VC8 A;  1X9S A;  4BWJ A;  1N56 A;  2LPE A;  9ICH A;  4CGZ A;  1DRG A;  1F5S A;  1SXD A;  3JPP A;  1A0P A;  5GTH U;  4X5V A;  4YCX A;  9ICO A;  4TQS A;  4ED8 A;  2LM4 A;  5AK5 A;  4RPX A;  3JPQ A;  4MFF A;  3T5J A;  1TE2 A;  1Y88 A;  4J9P A;  4KLD A;  3RJH A;  4PZO A;  3TFR A;  1N5X A;  4J9O A;  4KLT A;  4M2Y A;  4UB4 A;  4UB1 A;  3I28 A;  4FZN A;  2DQN B;  1Q8K A;  5D4B A;  4CRX A;  2F1J A;  4P0P A;  4KLL A;  1VDV A;  4Z6F A;  2KN7 A;  1V38 A;  4C4R A;  3MR3 A;  5AKY A;  1S0V A;  3TQ1 A;  1SKS A;  2K60 A;  1PK3 A;  4QWB A;  4OO1 J;  5AM0 A;  4BUG A;  4PGQ A;  3BS5 B;  1X40 A;  3AUO A;  1DXS A;  4OJL A;  4KLO A;  1RQN A;  2QB0 B;  1NOM A;  2ZJA A;  4Y2Q A;  4DSK A;  3TAP A;  2NYV A;  3PW4 A;  3AM9 A;  4ECQ A;  4RT2 A;  3PW7 A;  4DL5 A;  1TK0 A;  3QU4 A;  4NWI A;  4YD2 A;  2KKP A;  3PML A;  2JZB A;  4F5R A;  3PSF A;  4NLK A;  2HSZ A;  1TK5 A;  4ELT A;  4EZ9 A;  4IQU A;  1ZRM A;  2LM1 A;  4PZN A;  1XWL A;  3TAR A;  4OD0 A;  5DG8 A;  5G5G A;  3V7L A;  3CP8 A;  4DQR A;  5CR0 A;  2KZZ A;  5KFR A;  3RR8 A;  2XY5 A;  4YMN A;  3HRD D;  5AKJ A;  1JRP A;  1B22 A;  5HP4 A;  4WJ3 B;  2E8O A;  2P66 A;  2RHF A;  3C5F A;  3NS1 A;  1BVS A;  4ACO A;  4KLE A;  1A6S A;  3T5H A;  3KKA A;  3UQ0 A;  4QZE A;  5KFX A;  5KT4 A;  3L4P A;  4DL7 A;  2XIC A;  4NJ8 A;  3QZ8 A;  1WCN A;  3LWM A;  2QB1 A;  4I2A A;  2KIC A;  2R8H A;  2BKE A;  2J6S A;  4F2S A;  2BCQ A;  2PXI A;  2DL0 A;  3KFU F;  3B0X A;  5ALE A;  5CRX A;  4ZOH C;  4F5Q A;  3AQF A;  1S10 A;  3PMN A;  3E2E A;  3GDX A;  2K8C B;  1BPD A;  3GV5 B;  4I2G A;  3WKD A;  5DB9 A;  1Z19 A;  2MAX A;  4KLF A;  2YX8 A;  4QW9 A;  2WF5 A;  4DO9 A;  1HIW A;  4DL4 A;  3WKC A;  1PVQ A;  4Q8E A;  9ICK A;  8ICP A;  2F3N A;  1L7O A;  2ES6 A;  2AGQ A;  2RDI A;  4RPZ A;  1ZQL A;  1HUO A;  3D2S A;  3MFH A;  4J9L A;  3S6J A;  1NJX A;  2F44 A;  2AGO A;  3JPN A;  4EX7 A;  3H8S A;  3IG8 A;  2PFQ A;  4AYB C;  3SAG A;  4YXM A;  9ICU A;  4U6P A;  5HHI A;  5AI9 A;  4JWM A;  3MC1 A;  4BDP A;  3V7K A;  4OJ5 A;  4ECY A;  5IIO A;  3K4G A;  7ICG A;  4NM2 A;  1KBU A;  4F5N A;  7ICK A;  5ALM A;  1SL2 A;  2D8C A;  4M6W A;  4MF2 A;  5DB8 A;  5KL8 B;  5KT2 A;  2BGW A;  4YR3 A;  1TAM A;  3WK8 A;  4GLX A;  1LV5 A;  4YN4 A;  4FE3 A;  2K4I A;  4Z6D A;  2O6K A;  4KLQ A;  4R66 A;  2OM6 A;  4CF3 A;  3I1Y A;  5DLG A;  1MQ2 A;  9ICX A;  3H0R B;  3F5E A;  4R8U A;  2BCS A;  1D9D A;  2EZY A;  4F4W A;  4I2C A;  1IV8 A;  4MHV A;  3IG5 A;  8ICT A;  2M9N A;  2KIV A;  9ICE A;  2K4E A;  4UAU A;  5EE9 A;  3PSI A;  2JMG A;  1T3N A;  5J0U A;  4GC7 A;  1FFU A;  2G08 A;  2ZTD A;  5J0Y A;  5ALI A;  4F92 B;  1OW5 A;  1NJW A;  4J9N A;  5BPC A;  4ZH4 A;  2KFN A;  4DFD A;  4IQV A;  2KOB A;  2RQ5 A;  2ZIV A;  4MEX A;  3RJG A;  2QAR B;  4C0Z A;  4DFJ A;  4O5E A;  1QQ7 A;  4KLS A;  1SB3 C;  3J81 j;  4CNQ A;  4QZC A;  1HEK A;  1UHU A;  4FS1 A;  5J8Y A;  4DS4 A;  2OEH A;  3NAS A;  5EE1 A;  2W8L A;  2KJ8 A;  5III A;  2C2E A;  5JTI A;  4US8 A;  2XI9 A;  5KG7 A;  8ICO A;  3PW5 A;  4P4O A;  2ZXI A;  5KFW A;  2YMQ A;  3C23 A;  4RQ7 A;  4QZA A;  4OCZ A;  5DLF A;  5J0P A;  5FP0 A;  9ICN A;  5L1J A;  2IMW P;  2KD1 A;  1KQQ A;  4RNM A;  4PHP A;  2WF7 A;  2HBL A;  3ETR A;  3QZ7 A;  1L3S A;  2JEI A;  5IIM A;  4ED0 A;  3T5K A;  3SQI A;  5AKI A;  3BQ7 A;  3F2B A;  5KFH A;  2JHD A;  2DPJ A;  1S76 D;  3QU9 A;  3MR5 A;  1KFT A;  5H2F U;  3SD7 A;  3F2C A;  1K1S A;  3PX6 A;  1B43 A;  2JEG A;  2MA1 A;  3SMV A;  7ICV A;  1WUD A;  5AM2 A;  4FS2 A;  2KIW A;  2I9G A;  1IG6 A;  3RH4 A;  3PR4 A;  4KLI A;  1BPX A;  4B9L A;  3RB3 A;  3F2D A;  1ZOL A;  4I2E A;  8ICN A;  4OJP A;  1P7D A;  2AQ4 A;  2AQ0 A;  5AI5 A;  2CXY A;  2K4P A;  4DOB A;  4QNL A;  1PZN A;  2W9B B;  3RH5 A;  2XVT A;  3HIL A;  3Q8Q B;  2NRW A;  3QXG A;  3MR2 A;  3IHQ B;  3FM9 A;  1XSL A;  4NL9 A;  2IHM A;  1XU4 A;  4CDG A;  3JPO A;  4KLJ A;  3BS5 A;  1J2M A;  9ICW A;  4J9K A;  2FMS A;  2C22 A;  1UQV A;  9ICB A;  3T79 A;  1Q46 A;  3QU2 A;  2QB0 A;  3RR7 A;  3NRW A;  1N61 A;  2FE9 A;  4PL2 A;  2VJ5 A;  4MF8 A;  4OJO A;  2KHQ A;  2C2D A;  4F72 A;  4US9 A;  2G06 A;  3N7S C;  2DUY A;  4CF4 A;  1NJY A;  4M9N A;  3RB4 A;  4PHD A;  3A0B U;  1K5O A;  4KMO B;  2F1H A;  1ZD5 A;  2NRZ A;  3N28 A;  4UAZ A;  5AKK A;  2F77 X;  5F3X B;  2GWS A;  3QUQ A;  8ICH A;  1QSS A;  3DEE A;  4F4K A;  5T14 A;  4C8K A;  2XCA A;  3CYM A;  3HP6 A;  1NZP A;  1CRX A;  4UAY A;  2KG5 A;  5ALF A;  3ALR A;  3UXP A;  3TI0 A;  4O3N A;  1ECW A;  1RYU A;  8ICU A;  2XO7 A;  2IOH A;  4IRK A;  4FBU A;  3Q8K A;  2FMP A;  3TAC B;  2H3F A;  4GXI A;  3QYP A;  3RH6 A;  1RPL A;  5J2B A;  3GV7 B;  5IIJ A;  1U45 A;  5AI6 A;  3SI8 A;  4UAT A;  5A0L A;  1KFD A;  4C8L A;  2ASL A;  3PW0 A;  7ICR A;  4QZD A;  4ELV A;  4IRC A;  2KKV A;  4F5P A;  1SWV A;  2LKY A;  4DL6 A;  8ICE A;  4TUS A;  1NKE A;  4RUA A;  1ZQD A;  2B21 A;  2JH7 A;  1YZ7 A;  2UVV A;  1ZQK A;  3KHR A;  2HOQ A;  2A1J B;  5J29 A;  1L6N A;  3KTQ A;  2L5Y A;  2HDO A;  4ECS A;  5KG2 A;  5ALU A;  1H38 A;  2BHN A;  2F1I A;  3WK7 A;  3UPQ A;  2K89 A;  1QQ6 A;  5KFA A;  5KFU A;  3KHH A;  1U49 A;  2NO5 A;  1BGX T;  2ZIW B;  1MC8 A;  3M8S A;  5JRT A;  1NZB A;  2OXO A;  4ECU A;  9ICT A;  4DL3 A;  1UA0 A;  1NK9 A;  2I1Q A;  2ASD A;  4O3Q A;  1C7Y A;  1O08 A;  4UAV A;  3NTU A;  4TUP A;  2KVS A;  5ALW A;  4RZR A;  4C8N A;  2B6G A;  5KG1 A;  2EDU A;  5KFY A;  2BCV A;  3Q8S B;  1RDF A;  2YMP A;  2KFZ A;  2W9M A;  1KL9 A;  1OXJ A;  3L3F X;  5CP2 A;  4DLG A;  3TAD C;  4P4M A;  5KTQ A;  3LVW A;  4ECX A;  3IN5 A;  1NK0 A;  3Q8R B;  4OJ6 A;  4CF5 A;  5AI4 A;  1JX4 A;  5J2A A;  3OJS A;  7ICM A;  3NGD A;  4G9B A;  4PH5 A;  8ICW A;  1TKD A;  3WK6 A;  2MRL A;  4B9N A;  1VLB A;  3HPO A;  1DK2 A;  1Z4O A;  2K4H A;  5ALR A;  5CEH A;  4QZI A;  4FBT A;  8ICC A;  5JUM A;  3OHA A;  4USA A;  3RJJ A;  3N4M B;  5BOM A;  5KAF U;  4C4T A;  3M6K A;  9ICM A;  4F71 A;  1SKR A;  4Q8F A;  3Q8L A;  4ECW A;  4RNO A;  2WTF A;  5AK6 A;  1Q3V A;  4LVS A;  3RJK A;  3RJI A;  3H0L B;  2JH1 A;  5AIB A;  3PNC A;  2RRD A;  4KLH A;  4F5O A;  3HT3 A;  2DKX A;  1L8L A;  3GIJ A;  2W9A A;  5DQI A;  1NK4 A;  2H3Z A;  4KMU A;  3MGV A;  4O3S A;  2ZJ5 A;  4I2F A;  5J0W A;  5AM5 A;  2XC9 A;  1KRP A;  8ICZ A;  1N2X A;  2QAR A;  4YG2 A;  2JRZ A;  4EEN A;  2W3R A;  3RB0 A;  4R65 A;  3PX4 A;  1L3V A;  1B4F A;  2I5H A;  4PHA A;  2RP5 A;  8ICY A;  3N7R C;  2WF8 A;  2R8I A;  2DWQ A;  4DQQ A;  4BGD A;  5DDM A;  4P2H A;  5IIL A;  1L7N A;  2ZG6 A;  4XQ8 A;  1JIH A;  2DPI A;  4Y2U A;  1A77 A;  2PMZ F;  3F5A A;  1ZD4 A;  2FMQ A;  5KFE A;  3LYS A;  5K4L A;  3UMG A;  2Q0Z X;  1ZQ1 C;  2KE7 A;  2IOF K;  4DF8 A;  3JPS A;  3BQT A;  4EBE A;  2E8N A;  4Y2V A;  2W9C B;  4C80 A;  4R63 A;  2CPR A;  5KAI U;  1QLN A;  4XA5 A;  2JR5 A;  1NK6 A;  3QUC A;  3BJY A;  3UQ2 A;  2Y9U A;  1JUD A;  2FI1 A;  7ICU A;  2DFL A;  5J2D A;  2CRX A;  4RQ0 A;  1KTQ A;  3IDW A;  1BNO A;  2PMZ C;  8ICQ A;  4DS5 A;  2W7P A;  3HW8 A;  1ZD3 A;  1XSN A;  5DGB A;  1FO4 A;  4CCH A;  2ZIX A;  1ZXI A;  3PY8 A;  5CWR A;  4TQR A;  4UAW A;  1FFV A;  1QH9 A;  1X9M A;  1ZQQ A;  4Y2J A;  1S5L U;  2E1F A;  9ICJ A;  4QJF B;  4AYB F;  3E58 A;  1JN3 A;  4TUQ A;  4O3P A;  2LYH A;  3KZI U;  2HHW A;  5L1L A;  1T7P A;  3RJF A;  9ICR A;  2ATL A;  2H3V A;  5KFM A;  5KFT A;  3ZD8 A;  2LYA A;  3SZ2 A;  5G5H A;  4IR9 A;  1DGJ A;  3NRZ A;  1SKW A;  1V97 A;  3C29 A;  1ZQZ A;  5ALV A;  3PSP A;  2P6R A;  2IBK A;  4P4P A;  1S0N A;  5KFL A;  2OHF A;  2K8B B;  3OJU A;  1J2N A;  1L3U A;  3PV8 A;  4JWN A;  5DB7 A;  1ZJN A;  8ICI A;  3EYZ A;  1ZQU A;  3KZX A;  1U48 A;  1D8L A;  3BQ2 A;  4BXO B;  3RB6 A;  3C28 A;  2Y1I A;  3F53 A;  4I2J A;  2HBJ A;  4QZG A;  5L1K A;  1S0M A;  4IL6 U;  1CI4 A;  3DV9 A;  5AK3 A;  4O3R A;  1JXL A;  4I2H A;  5AM4 A;  3EUB 2;  3KKA C;  3M9M B;  1KN5 A;  4NM1 A;  1SIJ A;  5KG5 A;  5L1I A;  2VA8 A;  4O5C A;  4M04 A;  4XUS A;  2V4Q A;  3H0M B;  4KX3 A;  4Z6C A;  1TAQ A;  3GU3 A;  5J2J A;  3RJE A;  3GV8 B;  5J2H A;  2V9W A;  8ICF A;  1KSP A;  2EAP A;  5ALL A;  3C21 A;  4KLM A;  5KNI A;  4M0A A;  2WF6 A;  2B0C A;  1TVA A;  5AI0 A;  3V72 A;  1Z1V A;  2KVC A;  1LKY B;  3SR6 A;  4QIW F;  4YVZ A;  2XY6 A;  2HMX A;  3U26 A;  2BZF A;  1PK1 B;  3KBB A;  4DQI A;  2BCR A;  2Z7J A;  2LBO A;  3H8J A;  4JUZ A;  1X9W A;  5ALZ A;  5KFD A;  1L5U A;  3AMZ A;  4Q44 A;  5KFK A;  2JEJ A;  3H40 A;  1ZQV A;  4A8E A;  4ED6 A;  4QIW C;  2JXJ A;  4EZ6 A;  1S77 D;  2NV3 A;  3OTQ A;  1N48 A;  2R18 A;  5B66 U;  2E8M A;  3WKE A;  2DKZ A;  5KFI A;  5AM1 A;  3OGU A;  2HHV A;  1WYG A;  5HHH A;  4EYH B;  5ALS A;  2A1J A;  2UVW A;  4I2I A;  2KHV A;  1F44 A;  3M9O B;  1DOQ A;  1UCV A;  4XRH A;  5EE0 A;  4UB3 A;  5J2F A;  1URJ A;  2HHX A;  2ZIW A;  4RT3 A;  5KL1 B;  5ALQ A;  4KTQ A;  2F8K A;  5KG3 A;  2FJ6 A;  4RQ5 A;  3TKA A;  5J2E A;  3FAH A;  2R8J A;  2KZM A;  5IIN A;  4ED1 A;  2ISP A;  3FC4 A;  4KX5 A;  2WB1 F;  3FDS A;  1MQ3 A;  3UXO A;  4RQ4 A;  9ICC A;  1ZRN A;  4I2B A;  3GII A;  2HBK A;  5HR7 A;  1QSL A;  4Y2R A;  3CRX A;  8ICG A;  1LVH A;  7ICE A;  3Q8P B;  2W54 A;  3D2Q A;  4DSE A;  2IOF A;  3OSN A;  4EEK A;  4MEY A;  1T3Q A;  5C5J A;  1KW4 A;  2PFN A;  3BZK A;  2WB1 C;  2ZIU B;  1ZQT A;  3QNM A;  3K1Z A;  5ALP A;  4LZD A;  5AIC A;  2BQR A;  4F50 A;  4RU9 A;  2FPL A;  4F93 B;  3D2N A;  5ALY A;  5AKX A;  5KFP A;  4HAI A;  1A76 A;  5J8Y C;  1ZQJ A;  4J9R A;  2HW3 A;  5DKW A;  5CB1 A;  4YFK A;  4UB6 U;  3HX0 A;  2W8K A;  2GLE A;  2MSN A;  3AL0 B;  1ZYQ A;  2KNJ A;  4R64 A;  1PUZ A;  5DG7 A;  3PVX A;  1CEZ A;  4M47 A;  7ICQ A;  3OPX A;  2YTU A;  1ZQE A;  2BQ3 A;  1ED1 A;  3G6X A;  3KD3 A;  8ICK A;  2DBY A;  4DSL A;  3QU7 A;  4MFA A;  4UB2 A;  2KTQ A;  2W3S A;  5KT5 A;  9ICA A;  1JMS A;  3SAH A;  1N60 A;  7ICL A;  4U7C A;  4RQ1 A;  4NLN A;  1MA7 A;  2GH1 A;  1NK5 A;  1WWU A;  3GQC A;  3GZF A;  4G3I A;  2VAN A;  4RQ8 A;  4R8U B;  1WWV A;  5AKL A;  3PW2 A;  4B9T A;  1ZQG A;  2GO7 A;  2HHT A;  4YR2 A;  4IR1 A;  4DSF A;  1M6Y A;  2W9C A;  1MSW D;  5ALO A;  4C7Y A;  3BZC A;  3M8R A;  1IM4 A;  2ODG A;  4EBD A;  3M1Y A;  4YMM A;  5DQH A;  4P0Q B;  3PO4 A;  5ALK A;  8ICB A;  1T8E A;  4NLC A;  1D8B A;  4F91 B;  5F9N A;  1SWW A;  1Z4N A;  1BPY A;  3ORY A;  1KDH A;  2KSO B;  1XSP A;  2G0A A;  3JPR A;  1GO3 F;  4FFD A;  3VCB A;  4NL9 C;  1V9P A;  1QTM A;  1JXE A;  5EWG A;  4GFJ A;  4RNN A;  5KT6 A;  2H3Q A;  3IM1 A;  4PL1 A;  1NK8 A;  2ZUD A;  3WK4 A;  3NVY A;  5HML A;  2BCU A;  4RQM A;  5GTI U;  1XS9 D;  1UT8 A;  3GIK A;  4M9G A;  3ETL A;  9ICL A;  4C7Z A;  5J0X A;  1SV0 C;  4JK1 A;  4Q43 A;  1ZQP A;  3BQ0 A;  2HVH A;  3GFK B;  3MGH A;  5AHX A;  1Z00 B;  2AH5 A;  4FZL A;  3C1Y A;  3WKA A;  3N97 B;  4AP9 A;  2Y9T A;  1ZET A;  1T4G A;  2A3V A;  1COK A;  2FPM A;  2N1R A;  3WU2 U;  7ICS A;  4BXO A;  2ZXH A;  3H4B A;  4DL2 A;  3HKZ F;  2LHT A;  4YQW A;  1F0M A;  5J2K A;  1YT3 A;  5F9L A;  1FIQ A;  3RBD A;  4F4Y A;  3SYZ A;  3QEB Z;  4PHE A;  2IA6 A;  3NVZ A;  4Y2Y A;  3QE9 Y;  5KFV A;  5TZV A;  4ICA A;  4GXJ A;  5KT3 A;  7ICP A;  3C2M A;  1RYR A;  4UBB A;  3ZI4 A;  2E5S A;  5DG9 A;  1UT5 A;  2HVI A;  3ISC A;  1RQL A;  4PGY A;  5ALG A;  2NRX A;  5EWE A;  1NJZ A;  2KV2 A;  2FDR A;  9ICF A;  1BPE A;  4IS7 A;  4JMU A;  3HKZ C;  4IQW A;  3UXN A;  4JB3 A;  3LVV A;  3GIL A;  2NRT A;  5AKZ A;  4K4I A;  4Q45 A;  4IQT A;  1S97 A;  4DF4 A;  1NK7 A;  3ZD9 A;  1ZQY A;  3TAN A;  1XNS A;  4Y2P A;  2IHN A;  3AQE A;  2PFP A;  1LKY A;  4ECT A;  3TFS A;  4J9S A;  3B9J A;  4QWD A;  3ZDA A;  4GC6 A;  1U9L A;  2EAO A;  1PK1 A;  2AXT U;  4TUR A;  4FO6 A;  4DEZ A;  3V7J A;  1L3T A;  2HI0 A;  4I2D A;  3ZDE A;  7ICI A;  7ICN A;  4ED2 A;  4PPX A;  2NO4 A;  2R8K A;  3MR6 A;  1ZQW A;  2C2R A;  2A1A A;  4YD1 A;  4E0D A;  1V85 A;  2EAN A;  4C8M A;  3TAQ A;  2HOI A;  3R9K A; 
#chains in the Genus database with same CATH homology
 2ZIW A;  2F76 X;  2KIW A;  5KL1 B;  3PSI A;  1OUQ A;  2JMG A;  2K8C B;  2WAQ C;  1T94 A;  3ONN A;  2LYB A;  2MRL A;  4FZM A;  4OO1 J;  2G08 A;  4FZL A;  4BUG A;  3F2D A;  1Z19 A;  2CRX A;  2K4H A;  2XID A;  3SAH A;  4KX5 A;  2YX8 A;  2WB1 F;  3H0M B;  4U7C A;  2H3F A;  4OJL A;  1HIW A;  2OYY A;  4KX3 A;  4OJP A;  3PZP A;  1PVQ A;  1MA7 A;  2GH1 A;  1P7D A;  3GU3 A;  2A3V A;  5C0Y A;  2PMZ C;  4BJQ A;  2F2A B;  2HBK A;  2N1R A;  1Q3U A;  2W7P A;  3M6K A;  5HR7 A;  1PVR A;  2HBM A;  3GZF A;  2KEY A;  3CRX A;  4QNL A;  2KOB A;  3D2S A;  2ZXH A;  2DGZ A;  2ZIV A;  2LHT A;  2ZIX A;  2XVT A;  3HKZ F;  3D2Q A;  1UPH A;  4C0Z A;  5A0L A;  2YB4 A;  2W04 A;  2M0N A;  2E1F A;  1Q3V A;  1YT3 A;  4NWI A;  4BX9 C;  3M6Z A;  2KKP A;  2KKV A;  2YB1 A;  4AYB F;  4QJF B;  3IP4 B;  2KVC A;  1HEK A;  2LKY A;  1IIP A;  3PSF A;  4QIW F;  2VJ4 A;  3IG8 A;  2W7O A;  2HMX A;  4AYB C;  3SAG A;  3H0L B;  2G5I B;  2JH1 A;  4U6P A;  2RRD A;  3RF9 A;  2Y0S F;  3M7D A;  4ICA A;  4CDG A;  3RFA A;  2JH7 A;  2DF4 B;  2KJ8 A;  2WB1 C;  2Z7J A;  4P0Q B;  4OJ5 A;  2H3V A;  2LBO A;  2KJ5 A;  2E5S A;  3O0F A;  2XI9 A;  2HOQ A;  2D6F C;  2ZIU B;  3T79 A;  2H3Z A;  2LYA A;  3VC8 A;  1L6N A;  2OH2 A;  2ZXI A;  3CP8 A;  3MGV A;  3K1Z A;  4NLC A;  1D8B A;  3NRW A;  2KV2 A;  4P0P B;  4PL2 A;  2VJ5 A;  4JMU A;  3HKZ C;  1SZH A;  2G07 A;  4OJO A;  3LVV A;  1KBU A;  2K89 A;  3C29 A;  2KHQ A;  2ZIX B;  4CGZ A;  3D2N A;  3ICX A;  3PSP A;  1DRG A;  2CN1 A;  4A8E A;  2HOF A;  1A0P A;  2G06 A;  3N7S C;  2ZIW B;  2G0A A;  5KL8 B;  1GO3 F;  3NUQ A;  3VCB A;  4QIW C;  4WJ3 B;  2G5H B;  2Q4T A;  1NZB A;  1Z1B A;  1TAM A;  2RHF A;  2OXO A;  1XNS A;  4ACO A;  2KD1 A;  2K8B B;  3AQE A;  2RP5 A;  2WAQ F;  4KMO B;  2NV3 A;  1A6S A;  4GFJ A;  2R18 A;  2Y0S C;  3AL0 B;  2HBL A;  2H3Q A;  3N7R C;  2F77 X;  2GOL A;  4PL1 A;  4FE3 A;  4NV0 A;  2K4I A;  2KNJ A;  1XO0 A;  2XIC A;  2W03 A;  3SAF A;  3KZX A;  2H3I A;  2VKQ A;  4IC9 A;  2K8A A;  4P0Q A;  3E0F A;  2ZG6 A;  2OM6 A;  3SQI A;  3DEE A;  2PMZ F;  3F5A A;  2KIC A;  2G09 A;  5T14 A;  2ZIV B;  3LYS A;  2ZIU A;  3H0R B;  3F5E A;  3OPX A;  4FZN A;  2DQN B;  2JHD A;  3C28 A;  3F2B A;  3F53 A;  2HBJ A;  2KHV A;  2F8L A;  3L3F X;  1F44 A;  3KFU F;  3CYM A;  1ZQ1 C;  2KJ9 A;  3F2C A;  2E1E A;  4CRX A;  4P0P A;  3LVW A;  5CRX A;  2HOI A;  4NLB A;  3IN5 A;  2VIX A;  3PST A;  1PVP A;  1CRX A;  3AQF A;  1ED1 A;  2BDU A;  2CPR A;  2MA1 A;  3IG5 A;  3N7P D;  4OJ6 A;  3SMV A;  4O3M A;  3ALR A;  1URJ A;  1ECW A;  1WUD A;  5HR6 A;  2K4E A;  2JGA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...