2K4EA

Solution structure of the hiv-2 unmyristoylated matrix protein
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
134
structure length
134
Chain Sequence
GARNSVLRGKKADELERIRLRPGGKKKYRLKHIVWAANKLDRFGLAESLLESKEGCQKILTVLDPMVPTGSENLKSLFNTVCVIWCIHAEEKVKDTEGAKQIVRRHLVAETGTAEKMPSTSRPTAPSSEKGGNY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the myristylated human immunodeficiency virus type 2 matrix protein and the role of phosphatidylinositol-(4,5)-bisphosphate in membrane targeting.
pubmed doi rcsb
source organism Human immunodeficiency virus type 2
molecule tags Structural protein
molecule keywords HIV-2 unmyristoylated matrix protein
total genus 37
structure length 134
sequence length 134
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-06-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.90 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2k4eA01
2K4EA 2GOLA 2H3VA 4JMUA 1A6SA 2LYAA 2H3ZA 2H3IA 2HMXA 1ED1A 2NV3A 2K4IA 1HIWA 2K4HA 1UPHA 2H3FA 2N1RA 2JMGA 1HEKA 1TAMA 4ICAA 2H3QA 4IC9A 1ECWA 1L6NA 2LYBA
chains in the Genus database with same CATH superfamily
1AROP 1N60A 5KFGA 2KSOA 1WUDA 1ZQVA 2Z7JA 3RB4A 3E58A 4IL6U 1CI4A 4CF5A 3N7SC 5AICA 5ALNA 5DB7A 3M6ZA 4PHEA 2ZXIA 4G3IA 3QU2A 2N1RA 2HHQA 3HILA 5KFNA 1U47A 3C2LA 2BKEA 3G6YA 8ICAA 4YD1A 2Y1JA 1COKA 5JRTA 3GV7B 4MFAA 3CYMA 1BNOA 1N48A 4RUAA 4KMOB 2BPFA 1QTMA 2YMPA 3M9NB 3E2EA 2BPCA 4DOCA 3EPIA 3TI0A 4QJFB 5ALVA 4TQRA 1TK0A 2VA8A 3T5KA 2D6FC 2V4RA 4NXZA 2W9MA 2E1FA 4EBEA 4O3NA 4Y2SA 2FPMA 1UA0A 1NZPA 1PK1A 1OW5A 2I6XA 5L1KA 3I76A 3QU7A 5T14A 1ZQPA 4EZ9A 3MGIA 4JWNA 5KG4A 2VJ4A 2BCQA 3OTQA 3ZDAA 1KKXA 4FZNA 4P4MA 2KHQA 3HKZF 4GC6A 4DFPA 3KD3A 2RDIA 3UXNA 3M6KA 4PHDA 2A1JA 1TKDA 2BCVA 3HJEA 1T7PA 1BPDA 3WK7A 5D4BA 2D3DA 5D46A 3UMCA 1WCNA 3C5GA 1D8LA 1BNPA 4M9GA 2WF8A 4O3QA 3H0MB 4JV1A 1XSLA 4HYKA 2DWQA 1UT8A 2QARB 3NVVA 1QQ7A 4J9SA 9ICLA 2BPGA 7ICMA 2NRTA 1COOA 9ICKA 3T5JA 3H0LB 4DL2A 3ZD9A 4YVZA 1ZRMA 3ZDDA 5ALIA 3PZPA 2EH9A 3F53A 3BJYA 5AKYA 1NJXA 1JALA 1V9PA 5KFPA 1T4GA 2F76X 2AGPA 1GO3F 2VA3A 2VA2A 3C1ZA 3Q8MA 2H3FA 2XGQA 3B9JA 1ZQFA 1TE2A 2JH7A 1D8BA 3PO4A 3EWAA 5EE1A 2OWOA 3FC4A 7ICHA 3PVXA 3OSNA 2MAXA 4LZDA 5KFZA 2G5IB 2FPLA 4KLJA 4QWDA 5EE3A 2W9BB 1ZQHA 4CNQA 5JU5A 2MA1A 4C8OA 1ZQ1C 1L3UA 1N2XA 1Z1VA 5J2AA 3GV5B 3ZDCA 1Q3VA 3ALRA 4Q45A 4U7CA 5FP0A 1ZQAA 4USAA 9ICOA 2ASLA 3GDXA 2XI9A 1Z4NA 2P35A 3C28A 1ZQLA 3PX6A 2BDPA 8ICPA 4KLEA 3C5FA 2VKQA 4IRKA 3C21A 2OYYA 3QU4A 4PL1A 1Q46A 2PMZC 5AKJA 1X9WA 2EAOA 4Z6CA 5EWGA 1TK8A 4QZIA 3H8WA 1NZBA 3OHAA 2NRVA 1KRPA 4DS5A 1B0XA 2ATLA 2JEJA 2IBKA 4B9SA 3FDSA 2BR0A 5KL1B 3S6JA 3QUBA 4K4IA 1V85A 1Q3UA 2GWSA 5HR7A 2ZUDA 3RJEA 1NKEA 3BQ0A 4UARA 4DS4A 2DF4B 1XSPA 3KFUF 3BZCA 4JMUA 2F8LA 1L3SA 3VC8A 3IRUA 3WKAA 4I2JA 1KBUA 3TADC 2KZZA 4DCCA 5J0QA 1RZTA 5KTQA 3RH6A 5KFXA 1V97A 3C23A 2XCPA 3SZ2A 2KKPA 4BGDA 2FI1A 4QIWC 3I28A 1X6IA 4UAVA 2R8IA 4UBCA 4FBTA 3ORYA 4DQIA 5C0YA 4QZEA 3PMLA 4IRCA 5AKHA 3RB3A 2F8KA 4XRHA 5EE9A 4NM2A 1SV4A 2VANA 4PGQA 4RNOA 3PR4A 1S0OA 2YN4A 3T3FA 4EEKA 4O3PA 3AMZA 2XVTA 5ALJA 2B0CA 4PGYA 3CNHA 5J0OA 4R63A 2W7OA 1NK4A 2AGQA 5AKZA 9ICNA 1NK7A 3UPQA 3M8RA 4F93B 5AHXA 1BPEA 5IIOA 2FE9A 2XC9A 2ES6A 4YR3A 3L4PA 2GO7A 3HWTA 3TFSA 2HW3A 7ICEA 3FM9A 5EE0A 3G6XA 3UQ0A 1RXWA 1HEKA 5AKKA 3E0FA 4NL9A 2D8CA 2KP7A 1X9MA 4IC9A 9ICMA 4Y2YA 1ZQCA 2DKXA 8ICNA 1M6YA 5HHIA 3KHHA 4XA5A 2KICA 1JUDA 3GV8B 2PFQA 1A6SA 1ZJMA 1MSWD 5AIAA 3EYZA 2FLPA 4OCZA 4F4KA 7ICSA 3PV8A 4FZLA 5AI8A 3OJSA 4CF3A 1RXVA 1C20A 2CRXA 2KG5A 2HHTA 8ICWA 1TVAA 2OH2A 1K1QA 4DFDA 4RNMA 1IIPA 9ICUA 4F4ZA 1IV8A 1XO1A 2RP5A 1N61A 5B66U 5DQGA 2YX8A 5DGBA 3UXPA 4R8UA 2C2DA 2BHNA 1X66A 2E8MA 3F2BA 4NY8A 5KFYA 7ICFA 3RJHA 4MEYA 5CA7A 4I2CA 3RJKA 4RQ2A 2HHWA 4DQPA 2AU0A 3ICXA 2AQ0A 4RUCA 4PGXA 1YT3A 2WAQF 4P4OA 4J9RA 4OO1J 2EQYA 2M9NA 4OJOA 3IN5A 1RYSA 1ZD5A 5IILA 3KZXA 3QEBZ 4NLZA 1NKCA 4RQ1A 4M9JA 5DB9A 3KHLA 2YMLA 3AQEA 2XGPA 5AK6A 4EENA 3JPSA 3QZ7A 2A3VA 3IM1A 2DGZA 3Q8RB 2P66A 4OJ6A 1JRPA 4C4RA 2MSNA 2RHFA 4F5RA 2BQ3A 2KJ8A 4B9MA 3D2QA 2YMMA 4DSKA 1NI3A 4DFJA 2WHEA 3V7JA 4IQUA 4I2HA 2DPJA 4UB8U 3RRGA 1SXDA 5KL8B 2KJ5A 3GIJA 2KIVA 2KK0A 9ICXA 5KFHA 4YMMA 9ICWA 2E5SA 4PZOA 4G9BA 3N97B 2YMQA 3MR3A 4QW8A 4JK1A 1ED1A 2EZZA 3D2SA 1D9DA 4C8KA 3VCBA 4QIWF 3WKCA 1MQ2A 3JPPA 4FS1A 4I2AA 2QARA 2JEIA 1SGGA 2HI0A 3PSPA 4KLFA 2C2EA 8ICJA 2WF6A 2P6UA 1PVRA 7ICQA 4RQ0A 5CWRA 1Z00B 3PR5B 1KFSA 2KFNA 1KSPA 2ZIUB 1UPHA 3BS5B 2JMGA 3KBBA 3TACB 3MR2A 4O0IA 4YXMA 2MRLA 4RPZA 9ICIA 3IP4B 2I5HA 1ZD4A 4DLEA 5KG3A 2BCSA 4FFDA 1L7OA 2GOLA 3T5LA 5BOMA 3LWMA 5AM1A 4O5EA 1L8LA 2C28A 5KFJA 2JH1A 1ZQRA 1CEZA 4KLSA 4BWJA 3T5HA 5KG6A 1FFUA 2BQUA 2LKYA 3HX0A 1ZQUA 1ZOLA 4DSFA 9ICFA 2JV3A 5KFTA 3RR8A 1PK3A 1L5UA 7ICNA 1PVQA 5ALRA 5D49A 2CXYA 2OM6A 4Z6FA 3TARA 3ETLA 4C4SA 4QNLA 4NLCA 3N28A 3Q8KA 1VLBA 1MA7A 3QU5A 3PW0A 5CJ7A 3UQ2A 2ZG6A 4ECRA 1IM4A 2LM4A 4C0ZA 1QH9A 2ZIXB 1SB3C 1ZQEA 4Z6EA 2ZIWB 4RNNA 2K8CB 4EEYA 2VJ5A 2LMRA 9ICBA 5JUMA 5ALXA 3PW2A 3D6JA 3ZDEA 4M2YA 2G5HB 5KFBA 2CPRA 3C1YA 1N62A 8ICMA 4U6PA 1SZHA 4C4TA 2ZUBA 5HHHA 1FEZA 1IXRA 4FO6A 4CRXA 3JPTA 1ZJNA 1WWUA 2KIWA 5KT2A 3SD7A 2HOFA 3AEVA 3K1ZA 9ICEA 9ICGA 4UQGA 2KEYA 2R8KA 3M9MB 5CB1A 3PNCA 4FE3A 8ICKA 9ICCA 3HT3A 2ZIUA 4QWCA 4P2HA 4IRDA 5ALZA 3F2DA 3AN1A 5ALYA 2R8JA 2RQ5A 5CEHA 4ECVA 3ISCA 2WTFA 1WWVA 4J9OA 1DOQA 5DBAA 1DXSA 5HNKA 2ASDA 1NK0A 1Z19A 5AKEA 5H2FU 1ZQGA 5IINA 2ASJA 3ISBA 1XWLA 5J0TA 4DL6A 2XY7A 3TADA 4AYBC 2Y0SC 4F4WA 2EZYA 1JIHA 5J0XA 4J9NA 2HHUA 3ETRA 3MGVA 4J9PA 4CE6A 4DF4A 2K8AA 1S0VA 4DFMA 4B9TA 3IHQB 2F77X 5ALWA 2LI6A 5BOLA 2ZIVA 5J0RA 2AXTU 3MDAA 2WAQC 1QSYA 2V9WA 4F4XA 5HP4A 5AK3A 2ESEA 5AKGA 2W9AA 3KOOA 4YG2A 1L7PA 4EZ6A 3JPQA 4MFCA 4E0DA 4RPXA 1ZXIA 4YCXA 1ZD2P 4LJXA 4I2FA 5ALMA 3LK9A 3V72A 3N7RC 2NRWA 4BWMA 3NVZA 3V6JA 8ICZA 2OXOA 5L1IA 1SIJA 5HR6A 3KHGA 1UA1A 2A1AA 3QUQA 2RDJA 3O0FA 5J2FA 4F5QA 3RTVA 5A0LA 1QCKA 4BDPA 2Q0ZX 7ICUA 3MGHA 4UW9A 2H3ZA 4Y2XA 5KFFA 5AM3A 2PFOA 3GQCA 3AU6A 3H0RB 2V4QA 4YD2A 4GC7A 3LVWA 1ZQBA 4R64A 4AYBF 5EWFA 1NK5A 1KEJA 3HW8A 2ZIVB 3OHBA 2I1QA 2K4EA 2KHVA 5AI9A 3QX7A 5J0SA 1SV0C 5C5JA 4F5NA 5KNIA 3MR6A 5AM4A 2H3IA 3SAGA 3GFKB 2KZMA 1D9FA 1S0MA 4YP3A 1S0NA 4DL5A 3SMVA 4NLNA 3BQTA 1F5SA 3R9KA 3EUB2 3GILA 1B43A 5AI5A 2KTQA 3BQ1A 4KLLA 1QSSA 1ZYQA 4JV0A 1RG6A 2RLTA 1X40A 4NLGA 4C8MA 5KFRA 4RQ7A 1PZNA 2KMDA 5DB6A 1S10A 1S5LU 4UAUA 2BCRA 2W04A 2EAPA 3PSIA 3L3FX 9ICRA 4KLUA 1XS9D 3IDWA 4DFKA 5L1MA 5J2DA 3Q8QB 5ALUA 5DB8A 3RAQA 3QNMA 4KX3A 4UAYA 3KZIU 4ED8A 4F5OA 1URJA 4RT3A 8ICQA 3WK6A 4ELVA 3TFRA 2ALZA 1U45A 4F3OA 3UMGA 1XC9A 2W43A 3AQFA 4NLKA 2XCAA 2O6KA 5L1JA 4DOAA 4DF8A 4J9MA 5J2IA 4Z6DA 4ECUA 1YZ6A 1X2IA 1NJWA 3RH4A 2H3VA 1Z1BA 1QQ5A 2FLLA 4FS2A 3WKBA 3C2MA 2W9BA 3MFIA 1J97A 3L5KA 4P0PB 3NTUA 2K4HA 1JX4A 5CR0A 3F5EA 1RM6C 5J2KA 4YR0A 2UVWA 4Y2JA 4I29A 4GIBA 2HCFA 3IV6A 5KFIA 4DSEA 2AQ4A 1DK3A 4UAWA 2QB0A 2NV3A 7ICKA 2AJQA 4UB1A 3PX4A 2KZ3A 4PJ0U 1TFRA 3WKDA 1KTQA 1SXEA 4F71A 2E3TA 3QXGA 1KQQA 8ICLA 3KTQA 3V7KA 5DG8A 4YFKA 3D2NA 8ICHA 3Q8SB 4C7ZA 2ODGA 4O9MA 3RAXA 5DDYA 4ECYA 3AU2A 4TQSA 3K75D 3SI8A 2UVRA 3BQ7A 5KT3A 2KKVA 4J9KA 8ICEA 5KAIU 3WU2U 9ICPA 1KL9A 5J2BA 1RQNA 5KFEA 3TAQA 4YR2A 4QWAA 2JHDA 3AL0B 5KFMA 5F9LA 4DL7A 5KFOA 3GIKA 5E79U 1RPLA 1L7NA 1A0PA 4DOBA 2W55A 1BPXA 2JRZA 3PSFA 4UATA 3OPXA 4Y2QA 3OSPA 1RYRA 2Y0SF 2NO4A 4Y2TA 1OXJA 4JV2A 5KAFU 5ALHA 3NGDA 1OUQA 5KG2A 4K4HA 4PZNA 2WF9A 1RYUA 2Y9TA 4EBCA 3RB0A 2HBMA 5ALFA 3DV9A 5L1LA 4O5KA 2XICA 2PFNA 1PK1B 4YQWA 5EOZA 2KJ9A 5AIBA 2QB0B 2KVSA 3M9OB 5AKLA 5CP2A 3MR5A 4RQ3A 2ISPA 4RQNA 1HJPA 5TISU 5KG5A 5AK5A 3QZ8A 4RQ6A 1LV5A 4NLBA 4DSJA 1DGSA 3HRDD 1QLNA 4O3OA 4PPXA 2Y9UA 2E1EA 1RQLA 1WYGA 3NRWA 2HSZA 2NYVA 4KLDA 2KNJA 1U48A 2QLTA 1BPBA 4B9LA 5J0YA 4XQ8A 4F4YA 1ZQNA 2ZTDA 3DEEA 4IQVA 2EAMA 2F1IA 7ICGA 4QZ9A 4IR9A 4RQMA 4F72A 3MC1A 2UVVA 4M6WB 4DQQA 5KFSA 1X9SA 1LKYB 2JZBB 1NKBA 4MHVA 1EXNA 1LVHA 1S9FA 1JN3A 2ZJAA 2OHFA 8ICTA 4DO9A 1ZQZA 1BPYA 2DL0A 4EYHB 2C2RA 2QB1A 8ICXA 2A19A 4BJQA 5GTIU 1ZQQA 4NM1A 1J2NA 8ICVA 5KFWA 1T3NA 3UM9A 4PH5A 5IIMA 4RZRA 2IOFA 4EX6A 1NNLA 8ICFA 4KLTA 3BQ2A 1SKSA 3OGUA 1FIQA 1JXEA 2K89A 4O3MA 2P6RA 1S97A 2WB1C 4UB5A 3TQ1A 4F2SA 1BGXT 3RJIA 3V6HA 2FMPA 2YQEA 3CP8A 3PW4A 4EX7A 1HUOA 2OEHA 5KFLA 5DDMA 2YB4A 4F50A 1ZETA 4DL4A 4YMOA 1L3VA 3M7DA 2K8BB 4LVSA 2FLNA 2XO7A 4EELA 5F3XB 1QSLA 2W11A 4C8NA 3M8SA 9ICHA 5KFDA 4JB3A 2K60A 3QU9A 5J2JA 2B6GA 2JGAA 2YTUA 3BDPA 1HIWA 1N5WA 4TURA 3SV3A 2DBYA 5J2HA 2J6TA 2W9CA 3RF9A 3F2CA 2ZUCA 5KFAA 4Q44A 5AM5A 3RJJA 2IOHA 5DQIA 3PO5A 2GH1A 2DUYA 1F0MA 1L7MA 5KG7A 3EW9A 1UT5A 3ONNA 4ED2A 3QYPA 1O03A 3V6KA 8ICRA 2UVUA 4EBDA 2KN7A 2F3NA 4QZFA 3KHRA 1L8OA 1SKWA 3RJGA 1ZQYA 4GXJA 1BPZA 5KT6A 3J81j 1FO4A 4Y2UA 4ELUA 1S76D 4CGZA 1L3TA 4KN7A 2G07A 3WK8A 4TUQA 5AKXA 3FAHA 9ICQA 5KT5A 5KFCA 5J0WA 3PMNA 2E8PA 4C80A 3NVYA 3KKAA 3WKEA 4FZMA 5J0PA 5J2EA 4RQ5A 2HHVA 2IA6A 1ECWA 2C22A 4UB6U 3HKZC 3V7LA 3H40A 4ECQA 1TV9A 8ICGA 5DLGA 4KTQA 3RR7A 5J2CA 1Z3EB 3CRXA 2HMXA 3NUQA 1PUZA 3QEAZ 1A76A 5B5EU 4US9A 2KVCA 8ICSA 3Q8LA 3LYSA 4QZ8A 4QZGA 3MFHA 3SYZA 2KV2A 3WK9A 9ICTA 2DPIA 4M6WA 5DG9A 4I2EA 1Z00A 2DQNB 2W3RA 5CHGA 4P0QA 2W3SA 1V38A 3K4GA 3TKAA 4F2RA 2BQRA 1MN8A 1ZQOA 3RB6A 4KLHA 1SV0A 1UQVA 5KFQA 7ICLA 5ALDA 2JEGA 4Q43A 1PVPA 5AI0A 2G0AA 2MUTA 1KW4A 3WK5A 5J8YC 2HBKA 2WFAA 1B22A 2B21A 1CUKA 3SQIA 2FDRA 3TAPA 1CRXA 4C8LA 3H8MA 1X42A 4DEZA 4TUPA 2W54A 3GIMA 3RBDA 8ICIA 1SZPA 2ZIWA 8ICOA 4QWEA 2E8NA 5F9NA 5ALGA 4DSLA 4KLIA 2EZXA 4KLQA 4J03A 4O3RA 1WCLA 2FJ6A 7ICTA 1K1SA 1XO0A 1WG8A 3ED5A 2YY6A 2F2AB 4WJ3B 8ICUA 2K4IA 5DBBA 5JTIA 5IIKA 2L5YA 2JEFA 3GIIA 2W7PA 2PI4A 3IG5A 4O3SA 2H3QA 2GLEA 2LYBA 2QKQA 2KSOB 3RFAA 1X9XA 1T3QA 1ZQDA 5ALTA 1NJYA 3WK4A 2FMQA 2E8OA 4R65A 4RPYA 4ELTA 4PHAA 1KN5A 4NV0A 3KKAC 3NASA 3RJFA 2LM1A 4ZH4A 5ALEA 1HUZA 3SR6A 2EDUA 1N56A 3M1YA 8ICBA 1XSNA 2IHNA 4DWIA 4MF2A 5GTHU 4UAZA 4QWBA 4UB3A 2H5XA 4I2IA 1TAUA 5ALOA 4F92B 1U4BA 4I2BA 1O08A 3OJUA 4F91B 4AP9A 2F1JA 4Y2PA 4YXJA 4ED3A 2ZXHA 1ZQTA 3EPGA 4P0PA 2HVIA 2G08A 1AQ6A 1T8EA 8ICYA 1JXLA 4BX9C 2HOQA 5KFKA 4RT2A 3H7IA 5HMMA 2W8LA 4NWIA 1A77A 1XNSA 3ISDA 4ECSA 1NJZA 4XUSA 3NRZA 4ACOA 2YB1A 9ICVA 2XY5A 2RRDA 3PW7A 2I9GA 4NJ8A 4C7YA 1Z4OA 2LHTA 5DBCA 2PXIA 2ZIXA 2M0NA 3RH5A 2KFZA 4ED1A 3QE9Y 3FYHA 7ICIA 5KG0A 2J6UA 4JWMA 4B9VA 2KOBA 3LVVA 2NRXA 2VIXA 1S77D 1XU4A 2G09A 4CDGA 5BPCA 4Q8EA 3JPRA 3N7PD 1NK9A 4PHPA 1C7YA 4M0AA 1ZQMA 3K1RB 1B4FA 4OD0A 4GXKA 2MU2A 4OJPA 4CF4A 5AI6A 2BGWA 4O5CA 4Y2RA 4MFFA 2HHXA 2FPKA 9ICSA 2ZJ5A 5AM0A 4I28A 3RBEA 5KFUA 9ICAA 4P0QB 5EWEA 4KMUA 4F5PA 1MQ3A 4I2DA 5KG1A 4GXIA 2LBOA 4GLXA 3PSTA 2CN1A 1MC8A 4UB2A 1JMSA 4RQ8A 3SV4A 5J29A 4UB4A 3G6VA 4R8UB 5IIJA 4ED6A 4J9QA 1QQ6A 1FFVA 5AI4A 2MUTB 3H8JA 2IOFK 5DLFA 4KLMA 2WF7A 5DG7A 1ZQXA 1LKYA 2JZBA 5DQHA 3BS5A 1X6JA 3PX0A 4HAIA 4ECWA 3HPOA 4YMNA 3PY8A 3UMBA 5ALKA 7ICPA 4A8EA 4BXOB 4Q8FA 4R66A 1DGJA 2BZFA 3LDAA 5HMLA 1ZQWA 4X5VA 2AH5A 3U26A 4DQRA 4DQSA 1KDHA 2LYAA 3A0HU 4KX5A 2ISOA 1ZRNA 1KFDA 1KFTA 4DSIA 4IQTA 1TAMA 4ICAA 4TUSA 1U9LA 1IG6A 2ZJ8A 2PMZF 2K4PA 1DK2A 1JROA 2JR5A 9ICJA 3SAFA 1BVSA 7ICRA 4IS7A 1D8YA 1NK8A 5G5HA 1Y88A 2R18A 5DKWA 2EANA 5AKIA 1VJ5A 1J2MA 1ZQJA 4M9HA 3UXOA 2FMSA 4M04A 2KE7A 5J0UA 1SL2A 2WB1F 7ICVA 4QZAA 1SL0A 1SWVA 4KITB 1RDFA 2AGOA 4PL2A 1SWWA 2DFLA 2NRZA 2PKEA 3JPOA 1SL1A 2G06A 2HBJA 1KLNA 3QUTA 3ZI4A 4NL9C 2HVHA 2W9CB 1F44A 4QZHA 4QZCA 5ALSA 1UCVA 2HHSA 2F44A 5AK4A 4CCHA 2R8HA 5TZVA 5ALQA 3GZFA 3RRHA 5CRXA 3CW2C 3H4DA 2XY6A 2HDOA 1K5OA 3T79A 4M9LA 3AM9A 3F5AA 4ECZA 1JI7A 5J8YA 1YZ7A 4UBBA 4OJ5A 5J2GA 3IG8A 3N4MB 3PW5A 1L6NA 4QZBA 1Q8KA 3ZD8A 4P4PA 2HOIA 3Q8PB 3NVWA 4I2GA 5KT4A 4IR1A 4F8RA 2PFPA 3BZKA 1H38A 4OJLA 4ED0A 1ZQIA 2F1HA 3MBYA 3C2KA 3SAHA 4ED7A 8ICCA 4YN4A 3C29A 4RQ4A 3MDCA 4B6JA 4QZDA 2LYHA 4MF8A 5L9XA 4BUGA 5G5GA 3EZ5A 4ECXA 2XIDA 3ZDBA 4EYIB 5KT7A 3TANA 5ALPA 3MABA 1N5XA 3I1YA 3BS7A 7ICJA 4FBUA 3GU3A 5K4LA 3LWLA 4K4GA 1ZQSA 4B9NA 4DLGA 2BDUA 4B9UA 3DDHA 2AHOB 3HP6A 4KLGA 3SENA 5DGAA 2NO5A 2KD1A 1ZD3A 3JPNA 2OCEA 1U49A 2IMWP 5AM2A 4KLOA 2HBLA 4DL3A 4Y2VA 2Y1IA 1NK6A 4I27A 1DRGA 1LB2B 7ICOA 4QW9A 3AUOA 4BXOA 1TAQA 4J9LA 4IQWA 2A1JB 4MEXA 5IIIA 2LPEA 1P7DA 1UHUA 2Q4TA 4GFJA 2WF5A 2ZTCA 3QUCA 1S8OA 1N63A 2IHMA 3H4BA 3SEIA 5KFVA 4M47A 3H8SA 2J6SA 1SKRA 1NOMA 4ECTA 5ALLA 2W8KA 2R8GA 4US8A 4M9NA 2PI5A 4RU9A 4UASA 1ZQKA 3B0XA 3NS1A 1T94A 1VDVA 2W03A 2JXJA 2DKZA 3A0BU 4KN4A 1TK5A 4LZGA 3B0YA 4ZOHC 2ZTEA 4JUZA 2BCUA 3THVA
chains in the Genus database with same CATH topology
3IP4B 2PMZF 3L3FX 3PSIA 2PMZC 1WUDA 2KIWA 1YT3A 2Z7JA 4BUGA 2WAQF 3SAFA 2KOBA 2HOFA 2XIDA 4OO1J 1A0PA 1NZBA 3K1ZA 3LVVA 1XO0A 4OJOA 3IN5A 4CGZA 3PSFA 2GOLA 2VIXA 2KEYA 3N7SC 3OPXA 2G07A 3KZXA 4KX3A 2R18A 2Y0SF 2G09A 2F2AB 3M6ZA 3N7RC 4CDGA 2ZXIA 3H0LB 1URJA 4WJ3B 5KL1B 4FE3A 3N7PD 2K4IA 2N1RA 1HEKA 2OXOA 1OUQA 2ZIUA 3AQEA 3E0FA 2K89A 1Q3UA 3GU3A 2W7PA 2JH1A 4O3MA 5HR6A 3F2DA 3IG5A 3PZPA 2HBMA 3F53A 4FZMA 2A3VA 2H3QA 3AQFA 4IC9A 5HR7A 1ECWA 2BDUA 2WB1C 2LYBA 2LKYA 2XICA 4OJPA 2WB1F 3HKZC 3O0FA 2DGZA 4OJ6A 3RFAA 5A0LA 2KICA 4PL2A 2DF4B 2RHFA 3CYMA 2KJ9A 3KFUF 3CP8A 4KMOB 2KD1A 2H3VA 1Z1BA 4NV0A 4P0QB 2KJ8A 4JMUA 2G06A 2F8LA 2HBJA 3CRXA 1A6SA 3VC8A 2H3ZA 2F76X 2HMXA 1GO3F 3D2QA 3NUQA 2HBLA 2YB4A 1PVQA 4P0PB 2LBOA 2K4HA 1KBUA 2H3FA 3PSTA 2CN1A 4QJFB 3H0RB 1F44A 1Z19A 2KVCA 2OM6A 3LVWA 4FZLA 1DRGA 3F5EA 2D6FC 3M7DA 2K8BB 4AYBF 4QNLA 2JH7A 3LYSA 2E1FA 1D8BA 5KL8B 4NLCA 2KJ5A 2ZIVB 3GZFA 1MA7A 2K4EA 2KV2A 2KHVA 2CRXA 2KKPA 5CRXA 4QIWC 4NLBA 2ZG6A 4AYBC 2E5SA 2DQNB 2Y0SC 1P7DA 2OH2A 2G5IB 2Q4TA 4GFJA 5T14A 1IIPA 2E1EA 4P0QA 2H3IA 2ZXHA 3SAGA 1ED1A 2NV3A 3T79A 3D2SA 2JGAA 4C0ZA 2ZIXB 5C0YA 1HIWA 3F5AA 3NRWA 2MA1A 4P0PA 3VCBA 1ZQ1C 2G08A 2RP5A 2VJ4A 4QIWF 2ZIWB 3MGVA 2KNJA 4OJ5A 1Q3VA 4BX9C 2YX8A 2K8AA 3ALRA 3RF9A 2HOQA 4U7CA 3F2CA 3IG8A 3SMVA 4FZNA 2KHQA 2K8CB 2VJ5A 1L6NA 1PVPA 2F77X 3HKZF 4A8EA 3DEEA 2G0AA 4NWIA 3D2NA 1XNSA 3F2BA 2XI9A 2ZIVA 2GH1A 3M6KA 2G5HB 2HOIA 3PSPA 4ACOA 2XVTA 3C28A 1PVRA 2WAQC 2HBKA 2YB1A 1T94A 2RRDA 2W7OA 2CPRA 2W03A 2LYAA 4KX5A 3ONNA 3SQIA 2KKVA 1CRXA 2VKQA 2LHTA 4OJLA 2ZIUB 1UPHA 2JMGA 1SZHA 4U6PA 2ZIXA 3SAHA 2OYYA 1TAMA 4ICAA 2M0NA 3ICXA 2MRLA 4PL1A 2W04A 2ZIWA 3H0MB 3C29A 4BJQA 2JHDA 3AL0B 4CRXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K4E A;  2GOL A;  2H3V A;  4JMU A;  1A6S A;  2LYA A;  2H3Z A;  2H3I A;  2HMX A;  1ED1 A;  2NV3 A;  2K4I A;  1HIW A;  2K4H A;  1UPH A;  2H3F A;  2N1R A;  2JMG A;  1HEK A;  1TAM A;  4ICA A;  2H3Q A;  4IC9 A;  1ECW A;  1L6N A;  2LYB A; 
#chains in the Genus database with same CATH topology
 1ARO P;  1N60 A;  5KFG A;  2KSO A;  1WUD A;  1ZQV A;  2Z7J A;  3RB4 A;  3E58 A;  4IL6 U;  1CI4 A;  4CF5 A;  3N7S C;  5AIC A;  5ALN A;  5DB7 A;  3M6Z A;  4PHE A;  2ZXI A;  4G3I A;  3QU2 A;  2N1R A;  2HHQ A;  3HIL A;  5KFN A;  1U47 A;  3C2L A;  2BKE A;  3G6Y A;  8ICA A;  4YD1 A;  2Y1J A;  1COK A;  5JRT A;  3GV7 B;  4MFA A;  3CYM A;  1BNO A;  1N48 A;  4RUA A;  4KMO B;  2BPF A;  1QTM A;  2YMP A;  3M9N B;  3E2E A;  2BPC A;  4DOC A;  3EPI A;  3TI0 A;  4QJF B;  5ALV A;  4TQR A;  1TK0 A;  2VA8 A;  3T5K A;  2D6F C;  2V4R A;  4NXZ A;  2W9M A;  2E1F A;  4EBE A;  4O3N A;  4Y2S A;  2FPM A;  1UA0 A;  1NZP A;  1PK1 A;  1OW5 A;  2I6X A;  5L1K A;  3I76 A;  3QU7 A;  5T14 A;  1ZQP A;  4EZ9 A;  3MGI A;  4JWN A;  5KG4 A;  2VJ4 A;  2BCQ A;  3OTQ A;  3ZDA A;  1KKX A;  4FZN A;  4P4M A;  2KHQ A;  3HKZ F;  4GC6 A;  4DFP A;  3KD3 A;  2RDI A;  3UXN A;  3M6K A;  4PHD A;  2A1J A;  1TKD A;  2BCV A;  3HJE A;  1T7P A;  1BPD A;  3WK7 A;  5D4B A;  2D3D A;  5D46 A;  3UMC A;  1WCN A;  3C5G A;  1D8L A;  1BNP A;  4M9G A;  2WF8 A;  4O3Q A;  3H0M B;  4JV1 A;  1XSL A;  4HYK A;  2DWQ A;  1UT8 A;  2QAR B;  3NVV A;  1QQ7 A;  4J9S A;  9ICL A;  2BPG A;  7ICM A;  2NRT A;  1COO A;  9ICK A;  3T5J A;  3H0L B;  4DL2 A;  3ZD9 A;  4YVZ A;  1ZRM A;  3ZDD A;  5ALI A;  3PZP A;  2EH9 A;  3F53 A;  3BJY A;  5AKY A;  1NJX A;  1JAL A;  1V9P A;  5KFP A;  1T4G A;  2F76 X;  2AGP A;  1GO3 F;  2VA3 A;  2VA2 A;  3C1Z A;  3Q8M A;  2H3F A;  2XGQ A;  3B9J A;  1ZQF A;  1TE2 A;  2JH7 A;  1D8B A;  3PO4 A;  3EWA A;  5EE1 A;  2OWO A;  3FC4 A;  7ICH A;  3PVX A;  3OSN A;  2MAX A;  4LZD A;  5KFZ A;  2G5I B;  2FPL A;  4KLJ A;  4QWD A;  5EE3 A;  2W9B B;  1ZQH A;  4CNQ A;  5JU5 A;  2MA1 A;  4C8O A;  1ZQ1 C;  1L3U A;  1N2X A;  1Z1V A;  5J2A A;  3GV5 B;  3ZDC A;  1Q3V A;  3ALR A;  4Q45 A;  4U7C A;  5FP0 A;  1ZQA A;  4USA A;  9ICO A;  2ASL A;  3GDX A;  2XI9 A;  1Z4N A;  2P35 A;  3C28 A;  1ZQL A;  3PX6 A;  2BDP A;  8ICP A;  4KLE A;  3C5F A;  2VKQ A;  4IRK A;  3C21 A;  2OYY A;  3QU4 A;  4PL1 A;  1Q46 A;  2PMZ C;  5AKJ A;  1X9W A;  2EAO A;  4Z6C A;  5EWG A;  1TK8 A;  4QZI A;  3H8W A;  1NZB A;  3OHA A;  2NRV A;  1KRP A;  4DS5 A;  1B0X A;  2ATL A;  2JEJ A;  2IBK A;  4B9S A;  3FDS A;  2BR0 A;  5KL1 B;  3S6J A;  3QUB A;  4K4I A;  1V85 A;  1Q3U A;  2GWS A;  5HR7 A;  2ZUD A;  3RJE A;  1NKE A;  3BQ0 A;  4UAR A;  4DS4 A;  2DF4 B;  1XSP A;  3KFU F;  3BZC A;  4JMU A;  2F8L A;  1L3S A;  3VC8 A;  3IRU A;  3WKA A;  4I2J A;  1KBU A;  3TAD C;  2KZZ A;  4DCC A;  5J0Q A;  1RZT A;  5KTQ A;  3RH6 A;  5KFX A;  1V97 A;  3C23 A;  2XCP A;  3SZ2 A;  2KKP A;  4BGD A;  2FI1 A;  4QIW C;  3I28 A;  1X6I A;  4UAV A;  2R8I A;  4UBC A;  4FBT A;  3ORY A;  4DQI A;  5C0Y A;  4QZE A;  3PML A;  4IRC A;  5AKH A;  3RB3 A;  2F8K A;  4XRH A;  5EE9 A;  4NM2 A;  1SV4 A;  2VAN A;  4PGQ A;  4RNO A;  3PR4 A;  1S0O A;  2YN4 A;  3T3F A;  4EEK A;  4O3P A;  3AMZ A;  2XVT A;  5ALJ A;  2B0C A;  4PGY A;  3CNH A;  5J0O A;  4R63 A;  2W7O A;  1NK4 A;  2AGQ A;  5AKZ A;  9ICN A;  1NK7 A;  3UPQ A;  3M8R A;  4F93 B;  5AHX A;  1BPE A;  5IIO A;  2FE9 A;  2XC9 A;  2ES6 A;  4YR3 A;  3L4P A;  2GO7 A;  3HWT A;  3TFS A;  2HW3 A;  7ICE A;  3FM9 A;  5EE0 A;  3G6X A;  3UQ0 A;  1RXW A;  1HEK A;  5AKK A;  3E0F A;  4NL9 A;  2D8C A;  2KP7 A;  1X9M A;  4IC9 A;  9ICM A;  4Y2Y A;  1ZQC A;  2DKX A;  8ICN A;  1M6Y A;  5HHI A;  3KHH A;  4XA5 A;  2KIC A;  1JUD A;  3GV8 B;  2PFQ A;  1A6S A;  1ZJM A;  1MSW D;  5AIA A;  3EYZ A;  2FLP A;  4OCZ A;  4F4K A;  7ICS A;  3PV8 A;  4FZL A;  5AI8 A;  3OJS A;  4CF3 A;  1RXV A;  1C20 A;  2CRX A;  2KG5 A;  2HHT A;  8ICW A;  1TVA A;  2OH2 A;  1K1Q A;  4DFD A;  4RNM A;  1IIP A;  9ICU A;  4F4Z A;  1IV8 A;  1XO1 A;  2RP5 A;  1N61 A;  5B66 U;  5DQG A;  2YX8 A;  5DGB A;  3UXP A;  4R8U A;  2C2D A;  2BHN A;  1X66 A;  2E8M A;  3F2B A;  4NY8 A;  5KFY A;  7ICF A;  3RJH A;  4MEY A;  5CA7 A;  4I2C A;  3RJK A;  4RQ2 A;  2HHW A;  4DQP A;  2AU0 A;  3ICX A;  2AQ0 A;  4RUC A;  4PGX A;  1YT3 A;  2WAQ F;  4P4O A;  4J9R A;  4OO1 J;  2EQY A;  2M9N A;  4OJO A;  3IN5 A;  1RYS A;  1ZD5 A;  5IIL A;  3KZX A;  3QEB Z;  4NLZ A;  1NKC A;  4RQ1 A;  4M9J A;  5DB9 A;  3KHL A;  2YML A;  3AQE A;  2XGP A;  5AK6 A;  4EEN A;  3JPS A;  3QZ7 A;  2A3V A;  3IM1 A;  2DGZ A;  3Q8R B;  2P66 A;  4OJ6 A;  1JRP A;  4C4R A;  2MSN A;  2RHF A;  4F5R A;  2BQ3 A;  2KJ8 A;  4B9M A;  3D2Q A;  2YMM A;  4DSK A;  1NI3 A;  4DFJ A;  2WHE A;  3V7J A;  4IQU A;  4I2H A;  2DPJ A;  4UB8 U;  3RRG A;  1SXD A;  5KL8 B;  2KJ5 A;  3GIJ A;  2KIV A;  2KK0 A;  9ICX A;  5KFH A;  4YMM A;  9ICW A;  2E5S A;  4PZO A;  4G9B A;  3N97 B;  2YMQ A;  3MR3 A;  4QW8 A;  4JK1 A;  1ED1 A;  2EZZ A;  3D2S A;  1D9D A;  4C8K A;  3VCB A;  4QIW F;  3WKC A;  1MQ2 A;  3JPP A;  4FS1 A;  4I2A A;  2QAR A;  2JEI A;  1SGG A;  2HI0 A;  3PSP A;  4KLF A;  2C2E A;  8ICJ A;  2WF6 A;  2P6U A;  1PVR A;  7ICQ A;  4RQ0 A;  5CWR A;  1Z00 B;  3PR5 B;  1KFS A;  2KFN A;  1KSP A;  2ZIU B;  1UPH A;  3BS5 B;  2JMG A;  3KBB A;  3TAC B;  3MR2 A;  4O0I A;  4YXM A;  2MRL A;  4RPZ A;  9ICI A;  3IP4 B;  2I5H A;  1ZD4 A;  4DLE A;  5KG3 A;  2BCS A;  4FFD A;  1L7O A;  2GOL A;  3T5L A;  5BOM A;  3LWM A;  5AM1 A;  4O5E A;  1L8L A;  2C28 A;  5KFJ A;  2JH1 A;  1ZQR A;  1CEZ A;  4KLS A;  4BWJ A;  3T5H A;  5KG6 A;  1FFU A;  2BQU A;  2LKY A;  3HX0 A;  1ZQU A;  1ZOL A;  4DSF A;  9ICF A;  2JV3 A;  5KFT A;  3RR8 A;  1PK3 A;  1L5U A;  7ICN A;  1PVQ A;  5ALR A;  5D49 A;  2CXY A;  2OM6 A;  4Z6F A;  3TAR A;  3ETL A;  4C4S A;  4QNL A;  4NLC A;  3N28 A;  3Q8K A;  1VLB A;  1MA7 A;  3QU5 A;  3PW0 A;  5CJ7 A;  3UQ2 A;  2ZG6 A;  4ECR A;  1IM4 A;  2LM4 A;  4C0Z A;  1QH9 A;  2ZIX B;  1SB3 C;  1ZQE A;  4Z6E A;  2ZIW B;  4RNN A;  2K8C B;  4EEY A;  2VJ5 A;  2LMR A;  9ICB A;  5JUM A;  5ALX A;  3PW2 A;  3D6J A;  3ZDE A;  4M2Y A;  2G5H B;  5KFB A;  2CPR A;  3C1Y A;  1N62 A;  8ICM A;  4U6P A;  1SZH A;  4C4T A;  2ZUB A;  5HHH A;  1FEZ A;  1IXR A;  4FO6 A;  4CRX A;  3JPT A;  1ZJN A;  1WWU A;  2KIW A;  5KT2 A;  3SD7 A;  2HOF A;  3AEV A;  3K1Z A;  9ICE A;  9ICG A;  4UQG A;  2KEY A;  2R8K A;  3M9M B;  5CB1 A;  3PNC A;  4FE3 A;  8ICK A;  9ICC A;  3HT3 A;  2ZIU A;  4QWC A;  4P2H A;  4IRD A;  5ALZ A;  3F2D A;  3AN1 A;  5ALY A;  2R8J A;  2RQ5 A;  5CEH A;  4ECV A;  3ISC A;  2WTF A;  1WWV A;  4J9O A;  1DOQ A;  5DBA A;  1DXS A;  5HNK A;  2ASD A;  1NK0 A;  1Z19 A;  5AKE A;  5H2F U;  1ZQG A;  5IIN A;  2ASJ A;  3ISB A;  1XWL A;  5J0T A;  4DL6 A;  2XY7 A;  3TAD A;  4AYB C;  2Y0S C;  4F4W A;  2EZY A;  1JIH A;  5J0X A;  4J9N A;  2HHU A;  3ETR A;  3MGV A;  4J9P A;  4CE6 A;  4DF4 A;  2K8A A;  1S0V A;  4DFM A;  4B9T A;  3IHQ B;  2F77 X;  5ALW A;  2LI6 A;  5BOL A;  2ZIV A;  5J0R A;  2AXT U;  3MDA A;  2WAQ C;  1QSY A;  2V9W A;  4F4X A;  5HP4 A;  5AK3 A;  2ESE A;  5AKG A;  2W9A A;  3KOO A;  4YG2 A;  1L7P A;  4EZ6 A;  3JPQ A;  4MFC A;  4E0D A;  4RPX A;  1ZXI A;  4YCX A;  1ZD2 P;  4LJX A;  4I2F A;  5ALM A;  3LK9 A;  3V72 A;  3N7R C;  2NRW A;  4BWM A;  3NVZ A;  3V6J A;  8ICZ A;  2OXO A;  5L1I A;  1SIJ A;  5HR6 A;  3KHG A;  1UA1 A;  2A1A A;  3QUQ A;  2RDJ A;  3O0F A;  5J2F A;  4F5Q A;  3RTV A;  5A0L A;  1QCK A;  4BDP A;  2Q0Z X;  7ICU A;  3MGH A;  4UW9 A;  2H3Z A;  4Y2X A;  5KFF A;  5AM3 A;  2PFO A;  3GQC A;  3AU6 A;  3H0R B;  2V4Q A;  4YD2 A;  4GC7 A;  3LVW A;  1ZQB A;  4R64 A;  4AYB F;  5EWF A;  1NK5 A;  1KEJ A;  3HW8 A;  2ZIV B;  3OHB A;  2I1Q A;  2K4E A;  2KHV A;  5AI9 A;  3QX7 A;  5J0S A;  1SV0 C;  5C5J A;  4F5N A;  5KNI A;  3MR6 A;  5AM4 A;  2H3I A;  3SAG A;  3GFK B;  2KZM A;  1D9F A;  1S0M A;  4YP3 A;  1S0N A;  4DL5 A;  3SMV A;  4NLN A;  3BQT A;  1F5S A;  3R9K A;  3EUB 2;  3GIL A;  1B43 A;  5AI5 A;  2KTQ A;  3BQ1 A;  4KLL A;  1QSS A;  1ZYQ A;  4JV0 A;  1RG6 A;  2RLT A;  1X40 A;  4NLG A;  4C8M A;  5KFR A;  4RQ7 A;  1PZN A;  2KMD A;  5DB6 A;  1S10 A;  1S5L U;  4UAU A;  2BCR A;  2W04 A;  2EAP A;  3PSI A;  3L3F X;  9ICR A;  4KLU A;  1XS9 D;  3IDW A;  4DFK A;  5L1M A;  5J2D A;  3Q8Q B;  5ALU A;  5DB8 A;  3RAQ A;  3QNM A;  4KX3 A;  4UAY A;  3KZI U;  4ED8 A;  4F5O A;  1URJ A;  4RT3 A;  8ICQ A;  3WK6 A;  4ELV A;  3TFR A;  2ALZ A;  1U45 A;  4F3O A;  3UMG A;  1XC9 A;  2W43 A;  3AQF A;  4NLK A;  2XCA A;  2O6K A;  5L1J A;  4DOA A;  4DF8 A;  4J9M A;  5J2I A;  4Z6D A;  4ECU A;  1YZ6 A;  1X2I A;  1NJW A;  3RH4 A;  2H3V A;  1Z1B A;  1QQ5 A;  2FLL A;  4FS2 A;  3WKB A;  3C2M A;  2W9B A;  3MFI A;  1J97 A;  3L5K A;  4P0P B;  3NTU A;  2K4H A;  1JX4 A;  5CR0 A;  3F5E A;  1RM6 C;  5J2K A;  4YR0 A;  2UVW A;  4Y2J A;  4I29 A;  4GIB A;  2HCF A;  3IV6 A;  5KFI A;  4DSE A;  2AQ4 A;  1DK3 A;  4UAW A;  2QB0 A;  2NV3 A;  7ICK A;  2AJQ A;  4UB1 A;  3PX4 A;  2KZ3 A;  4PJ0 U;  1TFR A;  3WKD A;  1KTQ A;  1SXE A;  4F71 A;  2E3T A;  3QXG A;  1KQQ A;  8ICL A;  3KTQ A;  3V7K A;  5DG8 A;  4YFK A;  3D2N A;  8ICH A;  3Q8S B;  4C7Z A;  2ODG A;  4O9M A;  3RAX A;  5DDY A;  4ECY A;  3AU2 A;  4TQS A;  3K75 D;  3SI8 A;  2UVR A;  3BQ7 A;  5KT3 A;  2KKV A;  4J9K A;  8ICE A;  5KAI U;  3WU2 U;  9ICP A;  1KL9 A;  5J2B A;  1RQN A;  5KFE A;  3TAQ A;  4YR2 A;  4QWA A;  2JHD A;  3AL0 B;  5KFM A;  5F9L A;  4DL7 A;  5KFO A;  3GIK A;  5E79 U;  1RPL A;  1L7N A;  1A0P A;  4DOB A;  2W55 A;  1BPX A;  2JRZ A;  3PSF A;  4UAT A;  3OPX A;  4Y2Q A;  3OSP A;  1RYR A;  2Y0S F;  2NO4 A;  4Y2T A;  1OXJ A;  4JV2 A;  5KAF U;  5ALH A;  3NGD A;  1OUQ A;  5KG2 A;  4K4H A;  4PZN A;  2WF9 A;  1RYU A;  2Y9T A;  4EBC A;  3RB0 A;  2HBM A;  5ALF A;  3DV9 A;  5L1L A;  4O5K A;  2XIC A;  2PFN A;  1PK1 B;  4YQW A;  5EOZ A;  2KJ9 A;  5AIB A;  2QB0 B;  2KVS A;  3M9O B;  5AKL A;  5CP2 A;  3MR5 A;  4RQ3 A;  2ISP A;  4RQN A;  1HJP A;  5TIS U;  5KG5 A;  5AK5 A;  3QZ8 A;  4RQ6 A;  1LV5 A;  4NLB A;  4DSJ A;  1DGS A;  3HRD D;  1QLN A;  4O3O A;  4PPX A;  2Y9U A;  2E1E A;  1RQL A;  1WYG A;  3NRW A;  2HSZ A;  2NYV A;  4KLD A;  2KNJ A;  1U48 A;  2QLT A;  1BPB A;  4B9L A;  5J0Y A;  4XQ8 A;  4F4Y A;  1ZQN A;  2ZTD A;  3DEE A;  4IQV A;  2EAM A;  2F1I A;  7ICG A;  4QZ9 A;  4IR9 A;  4RQM A;  4F72 A;  3MC1 A;  2UVV A;  4M6W B;  4DQQ A;  5KFS A;  1X9S A;  1LKY B;  2JZB B;  1NKB A;  4MHV A;  1EXN A;  1LVH A;  1S9F A;  1JN3 A;  2ZJA A;  2OHF A;  8ICT A;  4DO9 A;  1ZQZ A;  1BPY A;  2DL0 A;  4EYH B;  2C2R A;  2QB1 A;  8ICX A;  2A19 A;  4BJQ A;  5GTI U;  1ZQQ A;  4NM1 A;  1J2N A;  8ICV A;  5KFW A;  1T3N A;  3UM9 A;  4PH5 A;  5IIM A;  4RZR A;  2IOF A;  4EX6 A;  1NNL A;  8ICF A;  4KLT A;  3BQ2 A;  1SKS A;  3OGU A;  1FIQ A;  1JXE A;  2K89 A;  4O3M A;  2P6R A;  1S97 A;  2WB1 C;  4UB5 A;  3TQ1 A;  4F2S A;  1BGX T;  3RJI A;  3V6H A;  2FMP A;  2YQE A;  3CP8 A;  3PW4 A;  4EX7 A;  1HUO A;  2OEH A;  5KFL A;  5DDM A;  2YB4 A;  4F50 A;  1ZET A;  4DL4 A;  4YMO A;  1L3V A;  3M7D A;  2K8B B;  4LVS A;  2FLN A;  2XO7 A;  4EEL A;  5F3X B;  1QSL A;  2W11 A;  4C8N A;  3M8S A;  9ICH A;  5KFD A;  4JB3 A;  2K60 A;  3QU9 A;  5J2J A;  2B6G A;  2JGA A;  2YTU A;  3BDP A;  1HIW A;  1N5W A;  4TUR A;  3SV3 A;  2DBY A;  5J2H A;  2J6T A;  2W9C A;  3RF9 A;  3F2C A;  2ZUC A;  5KFA A;  4Q44 A;  5AM5 A;  3RJJ A;  2IOH A;  5DQI A;  3PO5 A;  2GH1 A;  2DUY A;  1F0M A;  1L7M A;  5KG7 A;  3EW9 A;  1UT5 A;  3ONN A;  4ED2 A;  3QYP A;  1O03 A;  3V6K A;  8ICR A;  2UVU A;  4EBD A;  2KN7 A;  2F3N A;  4QZF A;  3KHR A;  1L8O A;  1SKW A;  3RJG A;  1ZQY A;  4GXJ A;  1BPZ A;  5KT6 A;  3J81 j;  1FO4 A;  4Y2U A;  4ELU A;  1S76 D;  4CGZ A;  1L3T A;  4KN7 A;  2G07 A;  3WK8 A;  4TUQ A;  5AKX A;  3FAH A;  9ICQ A;  5KT5 A;  5KFC A;  5J0W A;  3PMN A;  2E8P A;  4C80 A;  3NVY A;  3KKA A;  3WKE A;  4FZM A;  5J0P A;  5J2E A;  4RQ5 A;  2HHV A;  2IA6 A;  1ECW A;  2C22 A;  4UB6 U;  3HKZ C;  3V7L A;  3H40 A;  4ECQ A;  1TV9 A;  8ICG A;  5DLG A;  4KTQ A;  3RR7 A;  5J2C A;  1Z3E B;  3CRX A;  2HMX A;  3NUQ A;  1PUZ A;  3QEA Z;  1A76 A;  5B5E U;  4US9 A;  2KVC A;  8ICS A;  3Q8L A;  3LYS A;  4QZ8 A;  4QZG A;  3MFH A;  3SYZ A;  2KV2 A;  3WK9 A;  9ICT A;  2DPI A;  4M6W A;  5DG9 A;  4I2E A;  1Z00 A;  2DQN B;  2W3R A;  5CHG A;  4P0Q A;  2W3S A;  1V38 A;  3K4G A;  3TKA A;  4F2R A;  2BQR A;  1MN8 A;  1ZQO A;  3RB6 A;  4KLH A;  1SV0 A;  1UQV A;  5KFQ A;  7ICL A;  5ALD A;  2JEG A;  4Q43 A;  1PVP A;  5AI0 A;  2G0A A;  2MUT A;  1KW4 A;  3WK5 A;  5J8Y C;  2HBK A;  2WFA A;  1B22 A;  2B21 A;  1CUK A;  3SQI A;  2FDR A;  3TAP A;  1CRX A;  4C8L A;  3H8M A;  1X42 A;  4DEZ A;  4TUP A;  2W54 A;  3GIM A;  3RBD A;  8ICI A;  1SZP A;  2ZIW A;  8ICO A;  4QWE A;  2E8N A;  5F9N A;  5ALG A;  4DSL A;  4KLI A;  2EZX A;  4KLQ A;  4J03 A;  4O3R A;  1WCL A;  2FJ6 A;  7ICT A;  1K1S A;  1XO0 A;  1WG8 A;  3ED5 A;  2YY6 A;  2F2A B;  4WJ3 B;  8ICU A;  2K4I A;  5DBB A;  5JTI A;  5IIK A;  2L5Y A;  2JEF A;  3GII A;  2W7P A;  2PI4 A;  3IG5 A;  4O3S A;  2H3Q A;  2GLE A;  2LYB A;  2QKQ A;  2KSO B;  3RFA A;  1X9X A;  1T3Q A;  1ZQD A;  5ALT A;  1NJY A;  3WK4 A;  2FMQ A;  2E8O A;  4R65 A;  4RPY A;  4ELT A;  4PHA A;  1KN5 A;  4NV0 A;  3KKA C;  3NAS A;  3RJF A;  2LM1 A;  4ZH4 A;  5ALE A;  1HUZ A;  3SR6 A;  2EDU A;  1N56 A;  3M1Y A;  8ICB A;  1XSN A;  2IHN A;  4DWI A;  4MF2 A;  5GTH U;  4UAZ A;  4QWB A;  4UB3 A;  2H5X A;  4I2I A;  1TAU A;  5ALO A;  4F92 B;  1U4B A;  4I2B A;  1O08 A;  3OJU A;  4F91 B;  4AP9 A;  2F1J A;  4Y2P A;  4YXJ A;  4ED3 A;  2ZXH A;  1ZQT A;  3EPG A;  4P0P A;  2HVI A;  2G08 A;  1AQ6 A;  1T8E A;  8ICY A;  1JXL A;  4BX9 C;  2HOQ A;  5KFK A;  4RT2 A;  3H7I A;  5HMM A;  2W8L A;  4NWI A;  1A77 A;  1XNS A;  3ISD A;  4ECS A;  1NJZ A;  4XUS A;  3NRZ A;  4ACO A;  2YB1 A;  9ICV A;  2XY5 A;  2RRD A;  3PW7 A;  2I9G A;  4NJ8 A;  4C7Y A;  1Z4O A;  2LHT A;  5DBC A;  2PXI A;  2ZIX A;  2M0N A;  3RH5 A;  2KFZ A;  4ED1 A;  3QE9 Y;  3FYH A;  7ICI A;  5KG0 A;  2J6U A;  4JWM A;  4B9V A;  2KOB A;  3LVV A;  2NRX A;  2VIX A;  1S77 D;  1XU4 A;  2G09 A;  4CDG A;  5BPC A;  4Q8E A;  3JPR A;  3N7P D;  1NK9 A;  4PHP A;  1C7Y A;  4M0A A;  1ZQM A;  3K1R B;  1B4F A;  4OD0 A;  4GXK A;  2MU2 A;  4OJP A;  4CF4 A;  5AI6 A;  2BGW A;  4O5C A;  4Y2R A;  4MFF A;  2HHX A;  2FPK A;  9ICS A;  2ZJ5 A;  5AM0 A;  4I28 A;  3RBE A;  5KFU A;  9ICA A;  4P0Q B;  5EWE A;  4KMU A;  4F5P A;  1MQ3 A;  4I2D A;  5KG1 A;  4GXI A;  2LBO A;  4GLX A;  3PST A;  2CN1 A;  1MC8 A;  4UB2 A;  1JMS A;  4RQ8 A;  3SV4 A;  5J29 A;  4UB4 A;  3G6V A;  4R8U B;  5IIJ A;  4ED6 A;  4J9Q A;  1QQ6 A;  1FFV A;  5AI4 A;  2MUT B;  3H8J A;  2IOF K;  5DLF A;  4KLM A;  2WF7 A;  5DG7 A;  1ZQX A;  1LKY A;  2JZB A;  5DQH A;  3BS5 A;  1X6J A;  3PX0 A;  4HAI A;  4ECW A;  3HPO A;  4YMN A;  3PY8 A;  3UMB A;  5ALK A;  7ICP A;  4A8E A;  4BXO B;  4Q8F A;  4R66 A;  1DGJ A;  2BZF A;  3LDA A;  5HML A;  1ZQW A;  4X5V A;  2AH5 A;  3U26 A;  4DQR A;  4DQS A;  1KDH A;  2LYA A;  3A0H U;  4KX5 A;  2ISO A;  1ZRN A;  1KFD A;  1KFT A;  4DSI A;  4IQT A;  1TAM A;  4ICA A;  4TUS A;  1U9L A;  1IG6 A;  2ZJ8 A;  2PMZ F;  2K4P A;  1DK2 A;  1JRO A;  2JR5 A;  9ICJ A;  3SAF A;  1BVS A;  7ICR A;  4IS7 A;  1D8Y A;  1NK8 A;  5G5H A;  1Y88 A;  2R18 A;  5DKW A;  2EAN A;  5AKI A;  1VJ5 A;  1J2M A;  1ZQJ A;  4M9H A;  3UXO A;  2FMS A;  4M04 A;  2KE7 A;  5J0U A;  1SL2 A;  2WB1 F;  7ICV A;  4QZA A;  1SL0 A;  1SWV A;  4KIT B;  1RDF A;  2AGO A;  4PL2 A;  1SWW A;  2DFL A;  2NRZ A;  2PKE A;  3JPO A;  1SL1 A;  2G06 A;  2HBJ A;  1KLN A;  3QUT A;  3ZI4 A;  4NL9 C;  2HVH A;  2W9C B;  1F44 A;  4QZH A;  4QZC A;  5ALS A;  1UCV A;  2HHS A;  2F44 A;  5AK4 A;  4CCH A;  2R8H A;  5TZV A;  5ALQ A;  3GZF A;  3RRH A;  5CRX A;  3CW2 C;  3H4D A;  2XY6 A;  2HDO A;  1K5O A;  3T79 A;  4M9L A;  3AM9 A;  3F5A A;  4ECZ A;  1JI7 A;  5J8Y A;  1YZ7 A;  4UBB A;  4OJ5 A;  5J2G A;  3IG8 A;  3N4M B;  3PW5 A;  1L6N A;  4QZB A;  1Q8K A;  3ZD8 A;  4P4P A;  2HOI A;  3Q8P B;  3NVW A;  4I2G A;  5KT4 A;  4IR1 A;  4F8R A;  2PFP A;  3BZK A;  1H38 A;  4OJL A;  4ED0 A;  1ZQI A;  2F1H A;  3MBY A;  3C2K A;  3SAH A;  4ED7 A;  8ICC A;  4YN4 A;  3C29 A;  4RQ4 A;  3MDC A;  4B6J A;  4QZD A;  2LYH A;  4MF8 A;  5L9X A;  4BUG A;  5G5G A;  3EZ5 A;  4ECX A;  2XID A;  3ZDB A;  4EYI B;  5KT7 A;  3TAN A;  5ALP A;  3MAB A;  1N5X A;  3I1Y A;  3BS7 A;  7ICJ A;  4FBU A;  3GU3 A;  5K4L A;  3LWL A;  4K4G A;  1ZQS A;  4B9N A;  4DLG A;  2BDU A;  4B9U A;  3DDH A;  2AHO B;  3HP6 A;  4KLG A;  3SEN A;  5DGA A;  2NO5 A;  2KD1 A;  1ZD3 A;  3JPN A;  2OCE A;  1U49 A;  2IMW P;  5AM2 A;  4KLO A;  2HBL A;  4DL3 A;  4Y2V A;  2Y1I A;  1NK6 A;  4I27 A;  1DRG A;  1LB2 B;  7ICO A;  4QW9 A;  3AUO A;  4BXO A;  1TAQ A;  4J9L A;  4IQW A;  2A1J B;  4MEX A;  5III A;  2LPE A;  1P7D A;  1UHU A;  2Q4T A;  4GFJ A;  2WF5 A;  2ZTC A;  3QUC A;  1S8O A;  1N63 A;  2IHM A;  3H4B A;  3SEI A;  5KFV A;  4M47 A;  3H8S A;  2J6S A;  1SKR A;  1NOM A;  4ECT A;  5ALL A;  2W8K A;  2R8G A;  4US8 A;  4M9N A;  2PI5 A;  4RU9 A;  4UAS A;  1ZQK A;  3B0X A;  3NS1 A;  1T94 A;  1VDV A;  2W03 A;  2JXJ A;  2DKZ A;  3A0B U;  4KN4 A;  1TK5 A;  4LZG A;  3B0Y A;  4ZOH C;  2ZTE A;  4JUZ A;  2BCU A;  3THV A; 
#chains in the Genus database with same CATH homology
 3IP4 B;  2PMZ F;  3L3F X;  3PSI A;  2PMZ C;  1WUD A;  2KIW A;  1YT3 A;  2Z7J A;  4BUG A;  2WAQ F;  3SAF A;  2KOB A;  2HOF A;  2XID A;  4OO1 J;  1A0P A;  1NZB A;  3K1Z A;  3LVV A;  1XO0 A;  4OJO A;  3IN5 A;  4CGZ A;  3PSF A;  2GOL A;  2VIX A;  2KEY A;  3N7S C;  3OPX A;  2G07 A;  3KZX A;  4KX3 A;  2R18 A;  2Y0S F;  2G09 A;  2F2A B;  3M6Z A;  3N7R C;  4CDG A;  2ZXI A;  3H0L B;  1URJ A;  4WJ3 B;  5KL1 B;  4FE3 A;  3N7P D;  2K4I A;  2N1R A;  1HEK A;  2OXO A;  1OUQ A;  2ZIU A;  3AQE A;  3E0F A;  2K89 A;  1Q3U A;  3GU3 A;  2W7P A;  2JH1 A;  4O3M A;  5HR6 A;  3F2D A;  3IG5 A;  3PZP A;  2HBM A;  3F53 A;  4FZM A;  2A3V A;  2H3Q A;  3AQF A;  4IC9 A;  5HR7 A;  1ECW A;  2BDU A;  2WB1 C;  2LYB A;  2LKY A;  2XIC A;  4OJP A;  2WB1 F;  3HKZ C;  3O0F A;  2DGZ A;  4OJ6 A;  3RFA A;  5A0L A;  2KIC A;  4PL2 A;  2DF4 B;  2RHF A;  3CYM A;  2KJ9 A;  3KFU F;  3CP8 A;  4KMO B;  2KD1 A;  2H3V A;  1Z1B A;  4NV0 A;  4P0Q B;  2KJ8 A;  4JMU A;  2G06 A;  2F8L A;  2HBJ A;  3CRX A;  1A6S A;  3VC8 A;  2H3Z A;  2F76 X;  2HMX A;  1GO3 F;  3D2Q A;  3NUQ A;  2HBL A;  2YB4 A;  1PVQ A;  4P0P B;  2LBO A;  2K4H A;  1KBU A;  2H3F A;  3PST A;  2CN1 A;  4QJF B;  3H0R B;  1F44 A;  1Z19 A;  2KVC A;  2OM6 A;  3LVW A;  4FZL A;  1DRG A;  3F5E A;  2D6F C;  3M7D A;  2K8B B;  4AYB F;  4QNL A;  2JH7 A;  3LYS A;  2E1F A;  1D8B A;  5KL8 B;  4NLC A;  2KJ5 A;  2ZIV B;  3GZF A;  1MA7 A;  2K4E A;  2KV2 A;  2KHV A;  2CRX A;  2KKP A;  5CRX A;  4QIW C;  4NLB A;  2ZG6 A;  4AYB C;  2E5S A;  2DQN B;  2Y0S C;  1P7D A;  2OH2 A;  2G5I B;  2Q4T A;  4GFJ A;  5T14 A;  1IIP A;  2E1E A;  4P0Q A;  2H3I A;  2ZXH A;  3SAG A;  1ED1 A;  2NV3 A;  3T79 A;  3D2S A;  2JGA A;  4C0Z A;  2ZIX B;  5C0Y A;  1HIW A;  3F5A A;  3NRW A;  2MA1 A;  4P0P A;  3VCB A;  1ZQ1 C;  2G08 A;  2RP5 A;  2VJ4 A;  4QIW F;  2ZIW B;  3MGV A;  2KNJ A;  4OJ5 A;  1Q3V A;  4BX9 C;  2YX8 A;  2K8A A;  3ALR A;  3RF9 A;  2HOQ A;  4U7C A;  3F2C A;  3IG8 A;  3SMV A;  4FZN A;  2KHQ A;  2K8C B;  2VJ5 A;  1L6N A;  1PVP A;  2F77 X;  3HKZ F;  4A8E A;  3DEE A;  2G0A A;  4NWI A;  3D2N A;  1XNS A;  3F2B A;  2XI9 A;  2ZIV A;  2GH1 A;  3M6K A;  2G5H B;  2HOI A;  3PSP A;  4ACO A;  2XVT A;  3C28 A;  1PVR A;  2WAQ C;  2HBK A;  2YB1 A;  1T94 A;  2RRD A;  2W7O A;  2CPR A;  2W03 A;  2LYA A;  4KX5 A;  3ONN A;  3SQI A;  2KKV A;  1CRX A;  2VKQ A;  2LHT A;  4OJL A;  2ZIU B;  1UPH A;  2JMG A;  1SZH A;  4U6P A;  2ZIX A;  3SAH A;  2OYY A;  1TAM A;  4ICA A;  2M0N A;  3ICX A;  2MRL A;  4PL1 A;  2W04 A;  2ZIW A;  3H0M B;  3C29 A;  4BJQ A;  2JHD A;  3AL0 B;  4CRX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...