2K4EA

Solution structure of the hiv-2 unmyristoylated matrix protein
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
134
structure length
134
Chain Sequence
GARNSVLRGKKADELERIRLRPGGKKKYRLKHIVWAANKLDRFGLAESLLESKEGCQKILTVLDPMVPTGSENLKSLFNTVCVIWCIHAEEKVKDTEGAKQIVRRHLVAETGTAEKMPSTSRPTAPSSEKGGNY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the myristylated human immunodeficiency virus type 2 matrix protein and the role of phosphatidylinositol-(4,5)-bisphosphate in membrane targeting.
pubmed doi rcsb
source organism Human immunodeficiency virus type 2
molecule tags Structural protein
molecule keywords HIV-2 unmyristoylated matrix protein
total genus 37
structure length 134
sequence length 134
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-06-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.90 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2k4eA01
2H3FA 1ECWA 2GOLA 2K4EA 4JMUA 2H3VA 4ICAA 1UPHA 2LYBA 1TAMA 1HEKA 2H3ZA 2H3QA 2N1RA 1A6SA 2JMGA 1L6NA 4IC9A 2HMXA 2K4HA 2NV3A 2LYAA 1ED1A 2K4IA 1HIWA 2H3IA
chains in the Genus database with same CATH superfamily
3NGDA 1ZETA 3TI0A 1ZQEA 3B9JA 4ELTA 4G3IA 3THVA 2VA8A 2MUTB 4RQ3A 5KFDA 1ZOLA 4M6WA 4Y2TA 2YX8A 1X9XA 1L7MA 3IHQB 1RDFA 5E79U 3LWMA 8ICXA 5JUMA 3MR3A 4AYBC 4J9QA 3PO4A 3C5FA 5EOZA 2ISOA 4FZNA 2C28A 3HRDD 5DBCA 2HBLA 2ASDA 5D4BA 1K5OA 4YXMA 3NS1A 2W03A 4C8NA 5BPCA 1RZTA 4B9MA 2BCSA 3N7SC 4NWIA 3MBYA 8ICOA 5CWRA 3LVVA 3ISCA 5DGBA 5CA7A 2JV3A 3UQ0A 2LHTA 3RJKA 4Y2JA 3NVZA 4C8OA 3RJGA 4M9JA 4JB3A 4OD0A 4NLGA 5DB6A 1PK1B 3BZCA 4QZIA 4ED0A 5KT4A 4DSKA 1B22A 9ICGA 2FMPA 4DEZA 2KEYA 2WTFA 3HW8A 3BS5B 1SL1A 3PX4A 1QLNA 4R63A 2P35A 2KKPA 1L3SA 5AKKA 1RG6A 5ALHA 4FBTA 8ICVA 5BOLA 3EW9A 7ICPA 2WB1C 3NUQA 8ICQA 4YVZA 2RRDA 4UAWA 8ICAA 3PW0A 1FO4A 3ZD8A 2FI1A 1Q3VA 1DK2A 2EZZA 3TKAA 4DQIA 4DL7A 2HCFA 4XQ8A 4LVSA 1A76A 1P7DA 1U48A 4IQVA 2MAXA 4B6JA 1SV0A 1L7OA 4RQ4A 1BPDA 5KG4A 3PZPA 1O08A 1RPLA 2PI5A 4O3OA 3GQCA 5A0LA 1NK4A 2ZIVB 8ICKA 4UQGA 4Y2QA 7ICKA 1ZQVA 1ED1A 1XU4A 5ALOA 4YR2A 3J81j 4PGYA 2G08A 4RQ5A 2FMSA 2W9AA 1L7NA 1YZ7A 1UT5A 1KW4A 2HDOA 2XCPA 4B9TA 4EYHB 1NJXA 1KFSA 2M9NA 2R8KA 1NJWA 3C5GA 7ICHA 3K75D 3MDAA 5J0QA 2OCEA 3SI8A 1QQ7A 2JH1A 3RH4A 1KFTA 4UAVA 2AXTU 1XO0A 4A8EA 4KLFA 1ZYQA 3AEVA 3UM9A 4KLOA 2VKQA 4ZH4A 5AI6A 2JHDA 2W9CB 8ICEA 1T4GA 2ZG6A 2ZUCA 1JXEA 5F3XB 3K1ZA 2H3IA 9ICLA 1ZQFA 3E2EA 5KG7A 4EBDA 1Q8KA 4I28A 3TAQA 5KFJA 4P4PA 2B6GA 2J6TA 5AM5A 9ICHA 3NVYA 1IV8A 3H8SA 5CB1A 4RQ7A 2DF4B 1FIQA 4IRDA 8ICGA 3M6KA 4LZGA 4RQ6A 4ED7A 3N28A 4F8RA 5J29A 2ESEA 4UB4A 4IQTA 4OJ6A 1D9FA 5ALYA 5FP0A 2ASLA 2AGPA 1JI7A 5AHXA 2NRXA 1B43A 3QU2A 1BPZA 1S0VA 3IG8A 3CW2C 4DOCA 3WK9A 3SV4A 4IS7A 1X2IA 4M47A 2KE7A 4ED8A 4ELUA 1KKXA 1MSWD 1SV0C 2AJQA 4CF5A 3MFIA 5KT6A 2AHOB 1U49A 5AKYA 1PK1A 4J9KA 2W7OA 1PVRA 5GTHU 1XSLA 2ZUDA 8ICFA 3FDSA 4DL4A 1BNOA 2CN1A 2KKVA 2YMPA 2Y9UA 1NNLA 3QE9Y 3L3FX 1A6SA 5KFGA 5AI4A 4FZMA 5AIBA 3RJFA 5DG9A 2BCQA 3ZDDA 3D6JA 2W43A 4KLQA 1LV5A 2Z7JA 1BVSA 1RYUA 2BQ3A 1ZQHA 1PVPA 3N4MB 2P66A 4I2GA 2EZXA 3OTQA 2IOHA 1QTMA 4B9LA 1FFVA 4QZEA 5AKLA 4QWAA 1Z3EB 9ICIA 2E8PA 5J2EA 4P2HA 2NV3A 2ZJ8A 1UHUA 3E58A 3JPPA 1DGJA 1VLBA 1L3VA 5DG8A 2RDIA 2YB4A 5ALWA 2HVIA 8ICYA 5AKIA 1RQNA 3H8JA 1SKRA 5J0OA 3OPXA 2BHNA 5DQIA 4B9UA 1RQLA 2AGQA 2AQ4A 1JXLA 1TE2A 5ALIA 4J9OA 1S0MA 5EWFA 3DEEA 2F1JA 2WAQF 2PFQA 4JUZA 1ZJNA 4P4MA 1OUQA 4DQPA 2KZ3A 5KG1A 2Y0SF 1KL9A 5HR7A 4J9LA 2BQRA 4EX6A 2PFPA 2UVRA 4NM1A 2JZBB 4KN4A 5ALSA 2KSOA 2QB1A 4YN4A 4RZRA 1ZQAA 8ICLA 3TARA 3IP4B 2VANA 5EE9A 1ZQLA 2LM4A 1VDVA 4MEYA 3C1YA 2IBKA 3WKAA 7ICJA 5DDYA 3RF9A 5ALEA 1ZQTA 1ZQQA 3ZDCA 4F5NA 1MQ3A 4DSLA 5KFZA 3QU5A 3RB3A 4QW8A 5AM0A 5KFNA 5KT3A 4O3MA 1Z1BA 5AKGA 1PUZA 3WK4A 3M6ZA 3RH6A 3ICXA 3SYZA 4DO9A 2YTUA 2AGOA 1SL2A 3GILA 2XGQA 4JMUA 4JV1A 4ECRA 1NKEA 3KZXA 1NKBA 4DSIA 2ZXIA 3SAGA 2DL0A 4Y2VA 1NK6A 4QZCA 3GIMA 5KL1B 1TV9A 1KSPA 3OGUA 2ZXHA 3WK6A 4QZBA 4F2SA 3PX0A 4M9NA 4F4ZA 4I2JA 4Z6CA 2W3RA 4YR0A 3GIIA 1LKYB 4R66A 1F5SA 1RYRA 1C20A 2E8OA 2G06A 2W9BA 4UBBA 2WF6A 1H38A 1D8BA 3C21A 2LI6A 3TACB 3RRGA 2OXOA 3PSFA 4F5QA 5C5JA 4IC9A 3EZ5A 1UT8A 4I2HA 1UA1A 2ASJA 4FFDA 2AQ0A 4EX7A 1V85A 2FLLA 4M9HA 8ICSA 2EANA 5IIOA 1M6YA 2HSZA 4XA5A 4YG2A 2G0AA 3PSIA 2KHQA 4I27A 1S77D 8ICZA 3SZ2A 1KRPA 1NZPA 4I2FA 3ONNA 3IM1A 1EXNA 1O03A 5KFXA 8ICPA 2A19A 3H4BA 3C2KA 5KFIA 5DDMA 1ZRMA 5J0PA 3RAQA 5KFQA 1NKCA 2KJ5A 7ICIA 4ED1A 3TAPA 2FPKA 5J2BA 3K1RB 1NK0A 2VIXA 4DL3A 4USAA 1LKYA 3H0MB 4R8UA 1N60A 2D3DA 3ISBA 1MN8A 2JMGA 4KLLA 3RH5A 4QZFA 1FEZA 3KZIU 9ICAA 3DV9A 3UMGA 3M8SA 2KIVA 4ECVA 3M9NB 4CCHA 4K4HA 1KTQA 5KFMA 4ED2A 3DDHA 1JX4A 4Q8FA 2G09A 2W3SA 3A0HU 4J9SA 3SENA 4KX5A 4R64A 4P0QA 3QUTA 4UAYA 5CRXA 3QEBZ 3UQ2A 5JTIA 3C28A 3B0YA 3CNHA 4DFMA 1K1QA 2I9GA 3RB4A 1WG8A 3M7DA 3NRWA 2DWQA 1TK5A 2D8CA 3Q8QB 3UMCA 5ALTA 2XC9A 5B5EU 3E0FA 3AMZA 2H3FA 4EZ9A 5T14A 1V38A 3D2NA 5EE0A 2F3NA 3N97B 2FPLA 4RUCA 3KBBA 1WCLA 2LPEA 4O5KA 4UAZA 3JPTA 5IINA 2ZJAA 2P6RA 8ICRA 3CRXA 3HKZF 5AK4A 2F77X 1WYGA 5ALQA 4QWCA 4F5OA 1DGSA 1U45A 1WWUA 1N63A 9ICWA 3GDXA 2KP7A 4Y2SA 4F2RA 4PHPA 1N2XA 1KDHA 5D49A 4RNMA 5D46A 4DS4A 1KBUA 2VA2A 1ZQGA 4Y2YA 3BS5A 4PH5A 2Q4TA 4RPXA 5JU5A 2RQ5A 2UVWA 2ODGA 4C8KA 4BWJA 3Q8RB 4M0AA 1SB3C 2DBYA 5KFBA 3LVWA 4FS2A 4DFJA 3H40A 4DOBA 2PMZC 4CDGA 1N5XA 3FAHA 3V7LA 3OSPA 4Q43A 5ALUA 7ICGA 2ZTEA 4TUQA 2ZIXA 4I2EA 2QARB 4DFPA 5G5GA 2JH7A 3F5AA 2ZIWB 1Z00B 2PKEA 1L5UA 2MA1A 1OW5A 5H2FU 4KLTA 3NVWA 4NL9A 2NO5A 1SV4A 3MFHA 9ICBA 9ICVA 4F93B 4DQSA 4OJLA 5EE3A 2KVCA 2FE9A 1X66A 5DKWA 3KKAA 3OJUA 2NYVA 4MF8A 3KD3A 1CRXA 2HBMA 2DFLA 3EPGA 4UAUA 4PZNA 4HYKA 2B0CA 3V6HA 2M0NA 4NLCA 1KFDA 2BDUA 2BCRA 2BPCA 1JUDA 4US9A 4EYIB 3TQ1A 2MU2A 4PHDA 2IOFA 2K8CB 4FZLA 4RQ8A 2FDRA 3QYPA 4EEKA 8ICIA 1SGGA 5IIJA 5KT5A 1JALA 3F53A 4NLZA 3RR8A 4KMUA 3H8MA 7ICMA 3T5JA 1KN5A 2BCVA 4KX3A 3OHAA 3Q8SB 1UCVA 3IV6A 2DUYA 1DXSA 2LBOA 3SD7A 4FBUA 1ZQYA 2KG5A 5HMLA 3WK5A 4ECWA 5ALRA 1ZD5A 2DKXA 4DSEA 2ES6A 2FMQA 2FLNA 4EZ6A 2K4EA 1ZQZA 3PSPA 3MDCA 4DL6A 1N56A 4M9LA 5HHHA 3D2SA 3RB0A 1IG6A 2RP5A 3BQTA 4DOAA 4OCZA 4O5EA 1D8YA 4NLKA 3ORYA 3F2CA 2CRXA 4BXOB 1NK5A 2HOQA 7ICEA 4J9MA 4F4WA 2XO7A 1S10A 3GU3A 5ALNA 4P0QB 2YN4A 3F2DA 4QWDA 4IL6U 1JROA 4B9SA 2BZFA 1ZQOA 4ECQA 2FJ6A 1MA7A 7ICQA 3HT3A 5EWEA 5KG2A 1WWVA 4QWBA 1YZ6A 5J2AA 2LKYA 4M04A 1ZRNA 1RXVA 5EE1A 3JPNA 5HHIA 4J9RA 2A3VA 7ICTA 4C4RA 3H7IA 2J6SA 2Y0SC 2QB0B 4C0ZA 2YMMA 1IIPA 5AKZA 1ZQCA 4DSFA 2EAPA 1D9DA 1QH9A 2HHXA 3QU9A 4Y2UA 2IHMA 3UXOA 3PMNA 3MGVA 1ZQRA 4C80A 5KFAA 1F0MA 4O3SA 5DB9A 2H3QA 3UMBA 3N7RC 3D2QA 2W7PA 2RLTA 2HHUA 4UB8U 3C2LA 4YR3A 3QX7A 4EENA 7ICSA 2KICA 4TQRA 1Z4OA 5DB7A 1KLNA 1T94A 5ALXA 3RAXA 1NK7A 4ED6A 4CF4A 3RJHA 4F50A 2ISPA 3GV7B 4UBCA 4F5PA 3C1ZA 5J0TA 2WAQC 4YD1A 1ZD2P 4PL2A 3SR6A 2KOBA 3RJJA 4B9NA 4ELVA 1YT3A 1HUZA 1SKWA 4UB5A 1JIHA 4K4GA 1ZQNA 5AKEA 2PI4A 9ICRA 1IXRA 4GIBA 3HJEA 4MF2A 4DS5A 5ALJA 5EWGA 2ATLA 2DGZA 5KFCA 1CI4A 4RNOA 1TKDA 9ICCA 2R18A 1X9WA 1V9PA 5L9XA 4RUAA 4C4SA 3BS7A 9ICKA 4RPYA 2VJ4A 3C2MA 9ICOA 1SZHA 5KFOA 2QB0A 3QUBA 4KLSA 1V97A 2HOIA 3BQ0A 2JEFA 5AM4A 9ICXA 8ICUA 4AP9A 4UB6U 1X9SA 2W9BB 3F2BA 2KFNA 2XCAA 3KFUF 3QEAZ 2JEJA 5ALDA 5GTIU 3RJIA 5ALKA 1UPHA 2DKZA 5J2FA 5KFFA 4M9GA 1J2NA 1NK9A 4ACOA 3PW2A 4Q44A 2KZZA 1DK3A 1DOQA 4C4TA 1XNSA 4NV0A 3T3FA 4KLGA 3ZI4A 8ICJA 3PSTA 4CE6A 5KFYA 1B0XA 2H5XA 4O5CA 3HWTA 5KFWA 2CPRA 5IILA 4KITB 5AI5A 4UB1A 7ICRA 4K4IA 4DLEA 2HOFA 4I29A 3QU4A 3CP8A 2EAOA 5DBAA 3GZFA 3MR6A 1TVAA 2KVSA 3JPQA 2A1JB 4YD2A 3BQ1A 5HP4A 3H0LB 3AUOA 3H0RB 3QUQA 3SMVA 1T7PA 1NK8A 2C2DA 4YMMA 5KFVA 3PW7A 4JWNA 3FC4A 4QZGA 3ZDEA 4Z6FA 1L6NA 1ZQBA 1D8LA 2HVHA 3FM9A 1SKSA 1XSPA 3OSNA 3AL0B 1N48A 3TADA 5KAFU 2EDUA 2HHQA 3M8RA 1L8LA 1ZQKA 3PY8A 4MFCA 4O3PA 3BZKA 5L1KA 2F2AB 5CR0A 4F4YA 2MRLA 1A77A 3G6YA 2NO4A 3AU2A 3PW5A 4RQ1A 5DLGA 4PGXA 1TAUA 1ZQJA 4UATA 4TURA 2DPIA 1DRGA 3RJEA 5AI8A 5J2KA 3L4PA 4UASA 1Z4NA 3NRZA 8ICHA 4P0PB 4GC6A 1MC8A 9ICQA 5TZVA 4UB3A 3WU2U 2NRWA 8ICTA 4OJOA 3SAFA 5AK6A 2QKQA 4CGZA 3HILA 1ZQXA 3LYSA 2HMXA 2K4IA 1HIWA 4QZ9A 3PMLA 4FS1A 1TAQA 4BWMA 9ICNA 3UXPA 2E1EA 3AU6A 4PGQA 1X6IA 4GXIA 4CNQA 3VCBA 1ZD3A 2HI0A 2AU0A 4JWMA 4BXOA 5AK5A 2UVVA 3LDAA 2Y1JA 2ZIWA 5L1LA 4BUGA 2JEIA 2RDJA 2W54A 2W04A 9ICFA 1PK3A 3ED5A 3MGIA 1NOMA 4YFKA 4QWEA 2KMDA 1L7PA 5AICA 1MQ2A 3M1YA 2E8MA 3A0BU 3BQ2A 4IR1A 2MUTA 4NXZA 5AIAA 2XICA 4NL9C 3ISDA 2IMWP 1HEKA 3WK8A 5DGAA 4IRKA 4QNLA 2V4RA 8ICBA 3BQ7A 1UQVA 4RNNA 4XRHA 5KG3A 3HP6A 7ICVA 3Q8KA 9ICUA 2K89A 1QQ5A 1QCKA 5J2GA 4TUPA 2B21A 3G6XA 3KTQA 7ICNA 5ALLA 2BR0A 3QU7A 3Q8PB 2Y1IA 3B0XA 1IM4A 2PFNA 2GLEA 3BJYA 3GV5B 1HUOA 4F91B 3TFSA 2I1QA 2ALZA 4JV0A 4RQ0A 4YMNA 4R65A 2ZIXB 5AI0A 5KT7A 3HKZC 2KJ8A 4OJ5A 3PR4A 2F1HA 2UVUA 4M6WB 2QLTA 1JMSA 5ALZA 3NVVA 1L8OA 4TQSA 2EAMA 5DQGA 2WF7A 3S6JA 9ICEA 4AYBF 4ICAA 4LJXA 4DLGA 2KHVA 2YMLA 2JEGA 1QSSA 1VJ5A 1Y88A 3TADC 1NZBA 2XVTA 4ECTA 4DQQA 1U47A 4PL1A 4YCXA 1ZJMA 2LYAA 4C7YA 3QNMA 3RR7A 4PHEA 2E1FA 4KTQA 2YB1A 2VJ5A 5K4LA 4CF3A 2HW3A 2BQUA 4B9VA 2G5HB 3RTVA 2PMZF 2Q0ZX 4F4KA 3RFAA 1HJPA 4LZDA 2ZIUB 1NJYA 2K60A 4X5VA 1Z19A 1T8EA 3VC8A 3UPQA 1ZQPA 5ALGA 4Q45A 4OO1J 2WF9A 2KK0A 4YQWA 3RRHA 1BPXA 4Q8EA 5HR6A 3ALRA 5AK3A 2K4PA 2F76X 2XY6A 4NLBA 5KFUA 2WB1F 4I2AA 7ICUA 5J2CA 1X6JA 5KFEA 3SQIA 3ETLA 3SAHA 2K4HA 8ICMA 4DQRA 3IRUA 1SXEA 2PFOA 3OJSA 4FO6A 4O3RA 5J2HA 3PW4A 2YQEA 1COOA 1S0NA 5JRTA 1BNPA 2W9CA 5KT2A 5KFRA 3O0FA 4Z6EA 4GXKA 3WK7A 4E0DA 3G6VA 1COKA 5DQHA 4F72A 1X42A 5J0SA 4BX9C 4YMOA 1L3UA 3HPOA 1J2MA 2E3TA 2HBKA 1SZPA 4DL2A 2R8IA 4QIWF 3MGHA 1RM6C 5KFKA 2K8BB 5KTQA 3EPIA 1N5WA 1LB2B 5C0YA 3ETRA 5IIKA 2LM1A 4KLHA 9ICPA 4QW9A 4MEXA 1S76D 2D6FC 3H8WA 4I2IA 9ICJA 3I76A 3AN1A 3PNCA 5AM1A 4NJ8A 4P4OA 1AROP 1ZQWA 5KL8B 5AM2A 3I28A 1KEJA 2HHWA 4I2DA 3NASA 1X9MA 2BCUA 1QSLA 3U26A 4RT3A 1BPEA 4HAIA 4UARA 2IA6A 4MFFA 4O3QA 2E5SA 2W55A 5KG0A 3T5HA 1Q46A 2OM6A 1XS9D 2ZUBA 3GV8B 5B66U 1KQQA 2W8LA 5L1JA 5J2DA 1C7YA 4WJ3B 2BGWA 2XIDA 2AH5A 1CEZA 1XO1A 5HNKA 4O3NA 2XY5A 2W8KA 4P0PA 9ICMA 4YP3A 3PX6A 5CHGA 2OEHA 2ZTCA 2KIWA 3N7PD 3PO5A 4F4XA 4KLEA 1AQ6A 4ECSA 1GO3F 2K8AA 4GFJA 5J2IA 2JR5A 8ICWA 3IG5A 1F44A 4ECXA 1ZQDA 1ZXIA 4EELA 2HHVA 5KFLA 3LK9A 2BKEA 3JPRA 2KNJA 4F92B 4ECUA 4Z6DA 3QZ8A 3V72A 3Q8MA 2YMQA 4F3OA 4GXJA 1N61A 2MSNA 4KLJA 5HMMA 3RBDA 2Y9TA 2EQYA 2P6UA 3V6KA 3KHLA 3WKDA 3V7JA 3PVXA 4CRXA 4UW9A 4EEYA 4KLUA 1S0OA 1ZQ1C 5AI9A 3C29A 1ZQUA 3V7KA 3JPOA 2F8LA 4IQWA 2R8GA 4C8LA 3EYZA 1ECWA 4DL5A 2QARA 4KMOB 2H3VA 3WKCA 1XC9A 2F44A 2L5YA 2YY6A 2OHFA 2XGPA 2R8JA 4PPXA 1BPBA 5J8YC 1ZQMA 4RT2A 2BDPA 5ALVA 2LMRA 2OYYA 4ZOHC 5AKXA 1J97A 2ZIUA 3QUCA 4JV2A 4KLDA 2HHSA 4KLMA 2CXYA 4J9PA 5KG6A 2GWSA 9ICSA 5J0WA 5J0RA 3KKAC 4U6PA 2ZJ5A 1T3NA 2O6KA 1UA0A 4QZDA 1S97A 3ZDBA 4BGDA 3QZ7A 5IIIA 1BGXT 4QIWC 3RBEA 2IHNA 1JRPA 1SIJA 2FLPA 2KFZA 4U7CA 3SEIA 3AM9A 5J0UA 2ZIVA 3SV3A 2C22A 2BPFA 4KN7A 4ECYA 1SWVA 2C2EA 3KOOA 2KJ9A 3LWLA 2KN7A 1B4FA 3BDPA 1JN3A 2OH2A 2WF5A 2NRVA 4EBEA 4G9BA 1XSNA 4C8MA 5J0YA 3ZDAA 5KFHA 1TK8A 1Q3UA 5J0XA 2KSOB 5TISU 3TANA 4BDPA 4J9NA 2F1IA 5CP2A 4TUSA 2C2RA 3MABA 2GH1A 2W9MA 2H3ZA 4RQMA 4US8A 4I2BA 5CEHA 1S8OA 3L5KA 1WCNA 5L1MA 2A1AA 3GIJA 2F8KA 2DQNB 2NRZA 4Y2PA 3Q8LA 4J03A 5G5HA 7ICLA 1ZQSA 1QSYA 1BPYA 4RQ2A 2LYHA 5KFTA 5KG5A 3JPSA 4JK1A 4ECZA 1ZD4A 4O9MA 2N1RA 3T79A 5F9NA 1X40A 2PXIA 8ICCA 2EZYA 4GLXA 5DB8A 2KD1A 4F5RA 2NRTA 4F71A 3IN5A 4IQUA 2OWOA 1FFUA 4DFKA 4QJFB 4NY8A 1Z00A 3M9MB 4QZ8A 1PVQA 4PZOA 5DBBA 2IOFK 9ICTA 4C7ZA 3T5LA 4BJQA 4QZHA 4M2YA 2KV2A 4XUSA 5AM3A 1SWWA 4DF8A 2DPJA 3CYMA 3UXNA 1XWLA 5BOMA 3I1YA 4IR9A 3PV8A 5ALFA 4RPZA 2W11A 4QZAA 1TAMA 1URJA 5KNIA 3MR2A 2ZTDA 2I5HA 5AKJA 3EWAA 5AKHA 2R8HA 2E8NA 5DG7A 4KLIA 1PZNA 3ZD9A 5J8YA 3FYHA 3OHBA 4FE3A 3GFKB 3KHGA 2I6XA 1RXWA 1Z1VA 5CJ7A 2WHEA 4O0IA 3MR5A 3MC1A 7ICOA 2J6UA 3PR5B 4DFDA 1OXJA 2GO7A 4PHAA 3R9KA 2EH9A 1U9LA 3T5KA 5DLFA 3WKEA 4DSJA 4NM2A 8ICNA 2FPMA 5L1IA 4MFAA 2G07A 3F5EA 1U4BA 2LYBA 1S9FA 1TFRA 1RYSA 3KHRA 5ALMA 5F9LA 1T3QA 2VA3A 3QXGA 4I2CA 4Y2RA 5KAIU 5J2JA 4RQNA 2XY7A 5KFSA 3RB6A 3V6JA 3AQEA 1A0PA 1LVHA 1QQ6A 7ICFA 1CUKA 2V9WA 1SXDA 4DF4A 2GOLA 3K4GA 2JRZA 3M9OB 1L3TA 2JXJA 1NJZA 4EBCA 5KFPA 4Y2XA 4R8UB 1SL0A 4GC7A 3EUB2 2HBJA 2KZMA 4RU9A 1K1SA 4PJ0U 2JZBA 4OJPA 5IIMA 4UB2A 4NLNA 2HHTA 2RHFA 3GIKA 1N62A 2BPGA 2XI9A 3H4DA 1NI3A 4DCCA 2JGAA 3WKBA 1ZQIA 2A1JA 4ED3A 1TK0A 2WF8A 2G5IB 3KHHA 4YXJA 1S5LU 3C23A 2KTQA 3IDWA 1WUDA 3TFRA 3HX0A 3NTUA 4MHVA 5ALPA 2V4QA 2WFAA 4DWIA 3AQFA 4IRCA
chains in the Genus database with same CATH topology
2KNJA 4OJ6A 2E1EA 2KICA 2K4EA 4FE3A 1P7DA 2Y0SF 5HR7A 3PSPA 1T94A 4AYBF 4ICAA 2HBKA 3LVWA 2G06A 3VCBA 2KHVA 2CPRA 3PZPA 4QIWF 3IG8A 2PMZC 2HOFA 2GH1A 3D2SA 1D8BA 5A0LA 4CDGA 2H3ZA 2K8BB 2RP5A 2XVTA 2ZIVB 3CP8A 1NZBA 2YX8A 2OXOA 4CRXA 5C0YA 1ZQ1C 3PSFA 2WAQC 2ZIWA 4PL1A 2G09A 3C29A 4IC9A 4BUGA 3F2CA 3GZFA 4PL2A 2LYAA 2W04A 1ED1A 2F8LA 2KOBA 2CRXA 2DQNB 2D6FC 3IP4B 4KX5A 2ZIXA 2HOQA 4P0QA 2W7OA 2E1FA 4AYBC 2YB1A 1ECWA 1PVRA 5CRXA 2G07A 2VJ5A 4KMOB 1YT3A 2H3VA 2G08A 2JH7A 3F5EA 3H0LB 3F5AA 3C28A 3H0RB 2ZIWB 4FZNA 2MA1A 2G5HB 3GU3A 2LYBA 2PMZF 2HBLA 3SMVA 2XICA 4P0QB 3RF9A 3RFAA 5KL8B 2CN1A 1HEKA 2KKVA 2ZIUB 3M7DA 4QNLA 3F2DA 2N1RA 2W03A 3NRWA 1Z19A 3L3FX 3T79A 4OJLA 3VC8A 1A6SA 2KVCA 1L6NA 2DGZA 2OYYA 3N7SC 4NWIA 4OO1J 2E5SA 4FZMA 3AQEA 1A0PA 2G0AA 2R18A 2OM6A 1MA7A 2ZIUA 3AL0B 2KD1A 3LVVA 3E0FA 3IN5A 2H3FA 3PSIA 2JH1A 1CRXA 2GOLA 2HBMA 5HR6A 2LKYA 2KHQA 2Z7JA 3ALRA 4QJFB 2K89A 2LHTA 5T14A 2VJ4A 3ONNA 2F76X 3D2NA 4NLBA 1PVPA 4WJ3B 2XIDA 2M0NA 2WB1F 4NLCA 2BDUA 1Z1BA 1XO0A 4O3MA 2A3VA 1SZHA 1PVQA 4A8EA 3M6ZA 2Y0SC 4U6PA 4C0ZA 3ICXA 2HOIA 2F2AB 4P0PA 3CRXA 3HKZF 2K8CB 2HBJA 4FZLA 4BJQA 1IIPA 2KEYA 2MRLA 2F77X 2VKQA 3SQIA 4QIWC 2KV2A 4OJPA 2JHDA 2NV3A 2K4HA 3SAHA 2KIWA 3N7PD 3F2BA 4U7CA 3KFUF 2ZG6A 2KKPA 2RHFA 1DRGA 3K1ZA 2H3IA 3F53A 2KJ5A 2XI9A 3CYMA 2ZIVA 2YB4A 2JGAA 4JMUA 4P0PB 2WB1C 1GO3F 1UPHA 2K8AA 2VIXA 4GFJA 3NUQA 3KZXA 3H0MB 2G5IB 3OPXA 3IG5A 2KJ9A 3MGVA 2RRDA 1TAMA 2ZXIA 2ZIXB 3SAGA 4KX3A 3HKZC 1F44A 2DF4B 3O0FA 2KJ8A 4OJ5A 4OJOA 3SAFA 4ACOA 1URJA 3M6KA 2H3QA 1Q3VA 1WUDA 1KBUA 4CGZA 3N7RC 2OH2A 3D2QA 2JMGA 5KL1B 2Q4TA 2W7PA 3DEEA 3LYSA 2LBOA 2HMXA 2WAQF 1XNSA 4BX9C 4NV0A 2ZXHA 2K4IA 1HIWA 3AQFA 1Q3UA 1OUQA 3PSTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H3F A;  1ECW A;  2GOL A;  2K4E A;  4JMU A;  2H3V A;  4ICA A;  1UPH A;  2LYB A;  1TAM A;  1HEK A;  2H3Z A;  2H3Q A;  2N1R A;  1A6S A;  2JMG A;  1L6N A;  4IC9 A;  2HMX A;  2K4H A;  2NV3 A;  2LYA A;  1ED1 A;  2K4I A;  1HIW A;  2H3I A; 
#chains in the Genus database with same CATH topology
 3NGD A;  1ZET A;  3TI0 A;  1ZQE A;  3B9J A;  4ELT A;  4G3I A;  3THV A;  2VA8 A;  2MUT B;  4RQ3 A;  5KFD A;  1ZOL A;  4M6W A;  4Y2T A;  2YX8 A;  1X9X A;  1L7M A;  3IHQ B;  1RDF A;  5E79 U;  3LWM A;  8ICX A;  5JUM A;  3MR3 A;  4AYB C;  4J9Q A;  3PO4 A;  3C5F A;  5EOZ A;  2ISO A;  4FZN A;  2C28 A;  3HRD D;  5DBC A;  2HBL A;  2ASD A;  5D4B A;  1K5O A;  4YXM A;  3NS1 A;  2W03 A;  4C8N A;  5BPC A;  1RZT A;  4B9M A;  2BCS A;  3N7S C;  4NWI A;  3MBY A;  8ICO A;  5CWR A;  3LVV A;  3ISC A;  5DGB A;  5CA7 A;  2JV3 A;  3UQ0 A;  2LHT A;  3RJK A;  4Y2J A;  3NVZ A;  4C8O A;  3RJG A;  4M9J A;  4JB3 A;  4OD0 A;  4NLG A;  5DB6 A;  1PK1 B;  3BZC A;  4QZI A;  4ED0 A;  5KT4 A;  4DSK A;  1B22 A;  9ICG A;  2FMP A;  4DEZ A;  2KEY A;  2WTF A;  3HW8 A;  3BS5 B;  1SL1 A;  3PX4 A;  1QLN A;  4R63 A;  2P35 A;  2KKP A;  1L3S A;  5AKK A;  1RG6 A;  5ALH A;  4FBT A;  8ICV A;  5BOL A;  3EW9 A;  7ICP A;  2WB1 C;  3NUQ A;  8ICQ A;  4YVZ A;  2RRD A;  4UAW A;  8ICA A;  3PW0 A;  1FO4 A;  3ZD8 A;  2FI1 A;  1Q3V A;  1DK2 A;  2EZZ A;  3TKA A;  4DQI A;  4DL7 A;  2HCF A;  4XQ8 A;  4LVS A;  1A76 A;  1P7D A;  1U48 A;  4IQV A;  2MAX A;  4B6J A;  1SV0 A;  1L7O A;  4RQ4 A;  1BPD A;  5KG4 A;  3PZP A;  1O08 A;  1RPL A;  2PI5 A;  4O3O A;  3GQC A;  5A0L A;  1NK4 A;  2ZIV B;  8ICK A;  4UQG A;  4Y2Q A;  7ICK A;  1ZQV A;  1ED1 A;  1XU4 A;  5ALO A;  4YR2 A;  3J81 j;  4PGY A;  2G08 A;  4RQ5 A;  2FMS A;  2W9A A;  1L7N A;  1YZ7 A;  1UT5 A;  1KW4 A;  2HDO A;  2XCP A;  4B9T A;  4EYH B;  1NJX A;  1KFS A;  2M9N A;  2R8K A;  1NJW A;  3C5G A;  7ICH A;  3K75 D;  3MDA A;  5J0Q A;  2OCE A;  3SI8 A;  1QQ7 A;  2JH1 A;  3RH4 A;  1KFT A;  4UAV A;  2AXT U;  1XO0 A;  4A8E A;  4KLF A;  1ZYQ A;  3AEV A;  3UM9 A;  4KLO A;  2VKQ A;  4ZH4 A;  5AI6 A;  2JHD A;  2W9C B;  8ICE A;  1T4G A;  2ZG6 A;  2ZUC A;  1JXE A;  5F3X B;  3K1Z A;  2H3I A;  9ICL A;  1ZQF A;  3E2E A;  5KG7 A;  4EBD A;  1Q8K A;  4I28 A;  3TAQ A;  5KFJ A;  4P4P A;  2B6G A;  2J6T A;  5AM5 A;  9ICH A;  3NVY A;  1IV8 A;  3H8S A;  5CB1 A;  4RQ7 A;  2DF4 B;  1FIQ A;  4IRD A;  8ICG A;  3M6K A;  4LZG A;  4RQ6 A;  4ED7 A;  3N28 A;  4F8R A;  5J29 A;  2ESE A;  4UB4 A;  4IQT A;  4OJ6 A;  1D9F A;  5ALY A;  5FP0 A;  2ASL A;  2AGP A;  1JI7 A;  5AHX A;  2NRX A;  1B43 A;  3QU2 A;  1BPZ A;  1S0V A;  3IG8 A;  3CW2 C;  4DOC A;  3WK9 A;  3SV4 A;  4IS7 A;  1X2I A;  4M47 A;  2KE7 A;  4ED8 A;  4ELU A;  1KKX A;  1MSW D;  1SV0 C;  2AJQ A;  4CF5 A;  3MFI A;  5KT6 A;  2AHO B;  1U49 A;  5AKY A;  1PK1 A;  4J9K A;  2W7O A;  1PVR A;  5GTH U;  1XSL A;  2ZUD A;  8ICF A;  3FDS A;  4DL4 A;  1BNO A;  2CN1 A;  2KKV A;  2YMP A;  2Y9U A;  1NNL A;  3QE9 Y;  3L3F X;  1A6S A;  5KFG A;  5AI4 A;  4FZM A;  5AIB A;  3RJF A;  5DG9 A;  2BCQ A;  3ZDD A;  3D6J A;  2W43 A;  4KLQ A;  1LV5 A;  2Z7J A;  1BVS A;  1RYU A;  2BQ3 A;  1ZQH A;  1PVP A;  3N4M B;  2P66 A;  4I2G A;  2EZX A;  3OTQ A;  2IOH A;  1QTM A;  4B9L A;  1FFV A;  4QZE A;  5AKL A;  4QWA A;  1Z3E B;  9ICI A;  2E8P A;  5J2E A;  4P2H A;  2NV3 A;  2ZJ8 A;  1UHU A;  3E58 A;  3JPP A;  1DGJ A;  1VLB A;  1L3V A;  5DG8 A;  2RDI A;  2YB4 A;  5ALW A;  2HVI A;  8ICY A;  5AKI A;  1RQN A;  3H8J A;  1SKR A;  5J0O A;  3OPX A;  2BHN A;  5DQI A;  4B9U A;  1RQL A;  2AGQ A;  2AQ4 A;  1JXL A;  1TE2 A;  5ALI A;  4J9O A;  1S0M A;  5EWF A;  3DEE A;  2F1J A;  2WAQ F;  2PFQ A;  4JUZ A;  1ZJN A;  4P4M A;  1OUQ A;  4DQP A;  2KZ3 A;  5KG1 A;  2Y0S F;  1KL9 A;  5HR7 A;  4J9L A;  2BQR A;  4EX6 A;  2PFP A;  2UVR A;  4NM1 A;  2JZB B;  4KN4 A;  5ALS A;  2KSO A;  2QB1 A;  4YN4 A;  4RZR A;  1ZQA A;  8ICL A;  3TAR A;  3IP4 B;  2VAN A;  5EE9 A;  1ZQL A;  2LM4 A;  1VDV A;  4MEY A;  3C1Y A;  2IBK A;  3WKA A;  7ICJ A;  5DDY A;  3RF9 A;  5ALE A;  1ZQT A;  1ZQQ A;  3ZDC A;  4F5N A;  1MQ3 A;  4DSL A;  5KFZ A;  3QU5 A;  3RB3 A;  4QW8 A;  5AM0 A;  5KFN A;  5KT3 A;  4O3M A;  1Z1B A;  5AKG A;  1PUZ A;  3WK4 A;  3M6Z A;  3RH6 A;  3ICX A;  3SYZ A;  4DO9 A;  2YTU A;  2AGO A;  1SL2 A;  3GIL A;  2XGQ A;  4JMU A;  4JV1 A;  4ECR A;  1NKE A;  3KZX A;  1NKB A;  4DSI A;  2ZXI A;  3SAG A;  2DL0 A;  4Y2V A;  1NK6 A;  4QZC A;  3GIM A;  5KL1 B;  1TV9 A;  1KSP A;  3OGU A;  2ZXH A;  3WK6 A;  4QZB A;  4F2S A;  3PX0 A;  4M9N A;  4F4Z A;  4I2J A;  4Z6C A;  2W3R A;  4YR0 A;  3GII A;  1LKY B;  4R66 A;  1F5S A;  1RYR A;  1C20 A;  2E8O A;  2G06 A;  2W9B A;  4UBB A;  2WF6 A;  1H38 A;  1D8B A;  3C21 A;  2LI6 A;  3TAC B;  3RRG A;  2OXO A;  3PSF A;  4F5Q A;  5C5J A;  4IC9 A;  3EZ5 A;  1UT8 A;  4I2H A;  1UA1 A;  2ASJ A;  4FFD A;  2AQ0 A;  4EX7 A;  1V85 A;  2FLL A;  4M9H A;  8ICS A;  2EAN A;  5IIO A;  1M6Y A;  2HSZ A;  4XA5 A;  4YG2 A;  2G0A A;  3PSI A;  2KHQ A;  4I27 A;  1S77 D;  8ICZ A;  3SZ2 A;  1KRP A;  1NZP A;  4I2F A;  3ONN A;  3IM1 A;  1EXN A;  1O03 A;  5KFX A;  8ICP A;  2A19 A;  3H4B A;  3C2K A;  5KFI A;  5DDM A;  1ZRM A;  5J0P A;  3RAQ A;  5KFQ A;  1NKC A;  2KJ5 A;  7ICI A;  4ED1 A;  3TAP A;  2FPK A;  5J2B A;  3K1R B;  1NK0 A;  2VIX A;  4DL3 A;  4USA A;  1LKY A;  3H0M B;  4R8U A;  1N60 A;  2D3D A;  3ISB A;  1MN8 A;  2JMG A;  4KLL A;  3RH5 A;  4QZF A;  1FEZ A;  3KZI U;  9ICA A;  3DV9 A;  3UMG A;  3M8S A;  2KIV A;  4ECV A;  3M9N B;  4CCH A;  4K4H A;  1KTQ A;  5KFM A;  4ED2 A;  3DDH A;  1JX4 A;  4Q8F A;  2G09 A;  2W3S A;  3A0H U;  4J9S A;  3SEN A;  4KX5 A;  4R64 A;  4P0Q A;  3QUT A;  4UAY A;  5CRX A;  3QEB Z;  3UQ2 A;  5JTI A;  3C28 A;  3B0Y A;  3CNH A;  4DFM A;  1K1Q A;  2I9G A;  3RB4 A;  1WG8 A;  3M7D A;  3NRW A;  2DWQ A;  1TK5 A;  2D8C A;  3Q8Q B;  3UMC A;  5ALT A;  2XC9 A;  5B5E U;  3E0F A;  3AMZ A;  2H3F A;  4EZ9 A;  5T14 A;  1V38 A;  3D2N A;  5EE0 A;  2F3N A;  3N97 B;  2FPL A;  4RUC A;  3KBB A;  1WCL A;  2LPE A;  4O5K A;  4UAZ A;  3JPT A;  5IIN A;  2ZJA A;  2P6R A;  8ICR A;  3CRX A;  3HKZ F;  5AK4 A;  2F77 X;  1WYG A;  5ALQ A;  4QWC A;  4F5O A;  1DGS A;  1U45 A;  1WWU A;  1N63 A;  9ICW A;  3GDX A;  2KP7 A;  4Y2S A;  4F2R A;  4PHP A;  1N2X A;  1KDH A;  5D49 A;  4RNM A;  5D46 A;  4DS4 A;  1KBU A;  2VA2 A;  1ZQG A;  4Y2Y A;  3BS5 A;  4PH5 A;  2Q4T A;  4RPX A;  5JU5 A;  2RQ5 A;  2UVW A;  2ODG A;  4C8K A;  4BWJ A;  3Q8R B;  4M0A A;  1SB3 C;  2DBY A;  5KFB A;  3LVW A;  4FS2 A;  4DFJ A;  3H40 A;  4DOB A;  2PMZ C;  4CDG A;  1N5X A;  3FAH A;  3V7L A;  3OSP A;  4Q43 A;  5ALU A;  7ICG A;  2ZTE A;  4TUQ A;  2ZIX A;  4I2E A;  2QAR B;  4DFP A;  5G5G A;  2JH7 A;  3F5A A;  2ZIW B;  1Z00 B;  2PKE A;  1L5U A;  2MA1 A;  1OW5 A;  5H2F U;  4KLT A;  3NVW A;  4NL9 A;  2NO5 A;  1SV4 A;  3MFH A;  9ICB A;  9ICV A;  4F93 B;  4DQS A;  4OJL A;  5EE3 A;  2KVC A;  2FE9 A;  1X66 A;  5DKW A;  3KKA A;  3OJU A;  2NYV A;  4MF8 A;  3KD3 A;  1CRX A;  2HBM A;  2DFL A;  3EPG A;  4UAU A;  4PZN A;  4HYK A;  2B0C A;  3V6H A;  2M0N A;  4NLC A;  1KFD A;  2BDU A;  2BCR A;  2BPC A;  1JUD A;  4US9 A;  4EYI B;  3TQ1 A;  2MU2 A;  4PHD A;  2IOF A;  2K8C B;  4FZL A;  4RQ8 A;  2FDR A;  3QYP A;  4EEK A;  8ICI A;  1SGG A;  5IIJ A;  5KT5 A;  1JAL A;  3F53 A;  4NLZ A;  3RR8 A;  4KMU A;  3H8M A;  7ICM A;  3T5J A;  1KN5 A;  2BCV A;  4KX3 A;  3OHA A;  3Q8S B;  1UCV A;  3IV6 A;  2DUY A;  1DXS A;  2LBO A;  3SD7 A;  4FBU A;  1ZQY A;  2KG5 A;  5HML A;  3WK5 A;  4ECW A;  5ALR A;  1ZD5 A;  2DKX A;  4DSE A;  2ES6 A;  2FMQ A;  2FLN A;  4EZ6 A;  2K4E A;  1ZQZ A;  3PSP A;  3MDC A;  4DL6 A;  1N56 A;  4M9L A;  5HHH A;  3D2S A;  3RB0 A;  1IG6 A;  2RP5 A;  3BQT A;  4DOA A;  4OCZ A;  4O5E A;  1D8Y A;  4NLK A;  3ORY A;  3F2C A;  2CRX A;  4BXO B;  1NK5 A;  2HOQ A;  7ICE A;  4J9M A;  4F4W A;  2XO7 A;  1S10 A;  3GU3 A;  5ALN A;  4P0Q B;  2YN4 A;  3F2D A;  4QWD A;  4IL6 U;  1JRO A;  4B9S A;  2BZF A;  1ZQO A;  4ECQ A;  2FJ6 A;  1MA7 A;  7ICQ A;  3HT3 A;  5EWE A;  5KG2 A;  1WWV A;  4QWB A;  1YZ6 A;  5J2A A;  2LKY A;  4M04 A;  1ZRN A;  1RXV A;  5EE1 A;  3JPN A;  5HHI A;  4J9R A;  2A3V A;  7ICT A;  4C4R A;  3H7I A;  2J6S A;  2Y0S C;  2QB0 B;  4C0Z A;  2YMM A;  1IIP A;  5AKZ A;  1ZQC A;  4DSF A;  2EAP A;  1D9D A;  1QH9 A;  2HHX A;  3QU9 A;  4Y2U A;  2IHM A;  3UXO A;  3PMN A;  3MGV A;  1ZQR A;  4C80 A;  5KFA A;  1F0M A;  4O3S A;  5DB9 A;  2H3Q A;  3UMB A;  3N7R C;  3D2Q A;  2W7P A;  2RLT A;  2HHU A;  4UB8 U;  3C2L A;  4YR3 A;  3QX7 A;  4EEN A;  7ICS A;  2KIC A;  4TQR A;  1Z4O A;  5DB7 A;  1KLN A;  1T94 A;  5ALX A;  3RAX A;  1NK7 A;  4ED6 A;  4CF4 A;  3RJH A;  4F50 A;  2ISP A;  3GV7 B;  4UBC A;  4F5P A;  3C1Z A;  5J0T A;  2WAQ C;  4YD1 A;  1ZD2 P;  4PL2 A;  3SR6 A;  2KOB A;  3RJJ A;  4B9N A;  4ELV A;  1YT3 A;  1HUZ A;  1SKW A;  4UB5 A;  1JIH A;  4K4G A;  1ZQN A;  5AKE A;  2PI4 A;  9ICR A;  1IXR A;  4GIB A;  3HJE A;  4MF2 A;  4DS5 A;  5ALJ A;  5EWG A;  2ATL A;  2DGZ A;  5KFC A;  1CI4 A;  4RNO A;  1TKD A;  9ICC A;  2R18 A;  1X9W A;  1V9P A;  5L9X A;  4RUA A;  4C4S A;  3BS7 A;  9ICK A;  4RPY A;  2VJ4 A;  3C2M A;  9ICO A;  1SZH A;  5KFO A;  2QB0 A;  3QUB A;  4KLS A;  1V97 A;  2HOI A;  3BQ0 A;  2JEF A;  5AM4 A;  9ICX A;  8ICU A;  4AP9 A;  4UB6 U;  1X9S A;  2W9B B;  3F2B A;  2KFN A;  2XCA A;  3KFU F;  3QEA Z;  2JEJ A;  5ALD A;  5GTI U;  3RJI A;  5ALK A;  1UPH A;  2DKZ A;  5J2F A;  5KFF A;  4M9G A;  1J2N A;  1NK9 A;  4ACO A;  3PW2 A;  4Q44 A;  2KZZ A;  1DK3 A;  1DOQ A;  4C4T A;  1XNS A;  4NV0 A;  3T3F A;  4KLG A;  3ZI4 A;  8ICJ A;  3PST A;  4CE6 A;  5KFY A;  1B0X A;  2H5X A;  4O5C A;  3HWT A;  5KFW A;  2CPR A;  5IIL A;  4KIT B;  5AI5 A;  4UB1 A;  7ICR A;  4K4I A;  4DLE A;  2HOF A;  4I29 A;  3QU4 A;  3CP8 A;  2EAO A;  5DBA A;  3GZF A;  3MR6 A;  1TVA A;  2KVS A;  3JPQ A;  2A1J B;  4YD2 A;  3BQ1 A;  5HP4 A;  3H0L B;  3AUO A;  3H0R B;  3QUQ A;  3SMV A;  1T7P A;  1NK8 A;  2C2D A;  4YMM A;  5KFV A;  3PW7 A;  4JWN A;  3FC4 A;  4QZG A;  3ZDE A;  4Z6F A;  1L6N A;  1ZQB A;  1D8L A;  2HVH A;  3FM9 A;  1SKS A;  1XSP A;  3OSN A;  3AL0 B;  1N48 A;  3TAD A;  5KAF U;  2EDU A;  2HHQ A;  3M8R A;  1L8L A;  1ZQK A;  3PY8 A;  4MFC A;  4O3P A;  3BZK A;  5L1K A;  2F2A B;  5CR0 A;  4F4Y A;  2MRL A;  1A77 A;  3G6Y A;  2NO4 A;  3AU2 A;  3PW5 A;  4RQ1 A;  5DLG A;  4PGX A;  1TAU A;  1ZQJ A;  4UAT A;  4TUR A;  2DPI A;  1DRG A;  3RJE A;  5AI8 A;  5J2K A;  3L4P A;  4UAS A;  1Z4N A;  3NRZ A;  8ICH A;  4P0P B;  4GC6 A;  1MC8 A;  9ICQ A;  5TZV A;  4UB3 A;  3WU2 U;  2NRW A;  8ICT A;  4OJO A;  3SAF A;  5AK6 A;  2QKQ A;  4CGZ A;  3HIL A;  1ZQX A;  3LYS A;  2HMX A;  2K4I A;  1HIW A;  4QZ9 A;  3PML A;  4FS1 A;  1TAQ A;  4BWM A;  9ICN A;  3UXP A;  2E1E A;  3AU6 A;  4PGQ A;  1X6I A;  4GXI A;  4CNQ A;  3VCB A;  1ZD3 A;  2HI0 A;  2AU0 A;  4JWM A;  4BXO A;  5AK5 A;  2UVV A;  3LDA A;  2Y1J A;  2ZIW A;  5L1L A;  4BUG A;  2JEI A;  2RDJ A;  2W54 A;  2W04 A;  9ICF A;  1PK3 A;  3ED5 A;  3MGI A;  1NOM A;  4YFK A;  4QWE A;  2KMD A;  1L7P A;  5AIC A;  1MQ2 A;  3M1Y A;  2E8M A;  3A0B U;  3BQ2 A;  4IR1 A;  2MUT A;  4NXZ A;  5AIA A;  2XIC A;  4NL9 C;  3ISD A;  2IMW P;  1HEK A;  3WK8 A;  5DGA A;  4IRK A;  4QNL A;  2V4R A;  8ICB A;  3BQ7 A;  1UQV A;  4RNN A;  4XRH A;  5KG3 A;  3HP6 A;  7ICV A;  3Q8K A;  9ICU A;  2K89 A;  1QQ5 A;  1QCK A;  5J2G A;  4TUP A;  2B21 A;  3G6X A;  3KTQ A;  7ICN A;  5ALL A;  2BR0 A;  3QU7 A;  3Q8P B;  2Y1I A;  3B0X A;  1IM4 A;  2PFN A;  2GLE A;  3BJY A;  3GV5 B;  1HUO A;  4F91 B;  3TFS A;  2I1Q A;  2ALZ A;  4JV0 A;  4RQ0 A;  4YMN A;  4R65 A;  2ZIX B;  5AI0 A;  5KT7 A;  3HKZ C;  2KJ8 A;  4OJ5 A;  3PR4 A;  2F1H A;  2UVU A;  4M6W B;  2QLT A;  1JMS A;  5ALZ A;  3NVV A;  1L8O A;  4TQS A;  2EAM A;  5DQG A;  2WF7 A;  3S6J A;  9ICE A;  4AYB F;  4ICA A;  4LJX A;  4DLG A;  2KHV A;  2YML A;  2JEG A;  1QSS A;  1VJ5 A;  1Y88 A;  3TAD C;  1NZB A;  2XVT A;  4ECT A;  4DQQ A;  1U47 A;  4PL1 A;  4YCX A;  1ZJM A;  2LYA A;  4C7Y A;  3QNM A;  3RR7 A;  4PHE A;  2E1F A;  4KTQ A;  2YB1 A;  2VJ5 A;  5K4L A;  4CF3 A;  2HW3 A;  2BQU A;  4B9V A;  2G5H B;  3RTV A;  2PMZ F;  2Q0Z X;  4F4K A;  3RFA A;  1HJP A;  4LZD A;  2ZIU B;  1NJY A;  2K60 A;  4X5V A;  1Z19 A;  1T8E A;  3VC8 A;  3UPQ A;  1ZQP A;  5ALG A;  4Q45 A;  4OO1 J;  2WF9 A;  2KK0 A;  4YQW A;  3RRH A;  1BPX A;  4Q8E A;  5HR6 A;  3ALR A;  5AK3 A;  2K4P A;  2F76 X;  2XY6 A;  4NLB A;  5KFU A;  2WB1 F;  4I2A A;  7ICU A;  5J2C A;  1X6J A;  5KFE A;  3SQI A;  3ETL A;  3SAH A;  2K4H A;  8ICM A;  4DQR A;  3IRU A;  1SXE A;  2PFO A;  3OJS A;  4FO6 A;  4O3R A;  5J2H A;  3PW4 A;  2YQE A;  1COO A;  1S0N A;  5JRT A;  1BNP A;  2W9C A;  5KT2 A;  5KFR A;  3O0F A;  4Z6E A;  4GXK A;  3WK7 A;  4E0D A;  3G6V A;  1COK A;  5DQH A;  4F72 A;  1X42 A;  5J0S A;  4BX9 C;  4YMO A;  1L3U A;  3HPO A;  1J2M A;  2E3T A;  2HBK A;  1SZP A;  4DL2 A;  2R8I A;  4QIW F;  3MGH A;  1RM6 C;  5KFK A;  2K8B B;  5KTQ A;  3EPI A;  1N5W A;  1LB2 B;  5C0Y A;  3ETR A;  5IIK A;  2LM1 A;  4KLH A;  9ICP A;  4QW9 A;  4MEX A;  1S76 D;  2D6F C;  3H8W A;  4I2I A;  9ICJ A;  3I76 A;  3AN1 A;  3PNC A;  5AM1 A;  4NJ8 A;  4P4O A;  1ARO P;  1ZQW A;  5KL8 B;  5AM2 A;  3I28 A;  1KEJ A;  2HHW A;  4I2D A;  3NAS A;  1X9M A;  2BCU A;  1QSL A;  3U26 A;  4RT3 A;  1BPE A;  4HAI A;  4UAR A;  2IA6 A;  4MFF A;  4O3Q A;  2E5S A;  2W55 A;  5KG0 A;  3T5H A;  1Q46 A;  2OM6 A;  1XS9 D;  2ZUB A;  3GV8 B;  5B66 U;  1KQQ A;  2W8L A;  5L1J A;  5J2D A;  1C7Y A;  4WJ3 B;  2BGW A;  2XID A;  2AH5 A;  1CEZ A;  1XO1 A;  5HNK A;  4O3N A;  2XY5 A;  2W8K A;  4P0P A;  9ICM A;  4YP3 A;  3PX6 A;  5CHG A;  2OEH A;  2ZTC A;  2KIW A;  3N7P D;  3PO5 A;  4F4X A;  4KLE A;  1AQ6 A;  4ECS A;  1GO3 F;  2K8A A;  4GFJ A;  5J2I A;  2JR5 A;  8ICW A;  3IG5 A;  1F44 A;  4ECX A;  1ZQD A;  1ZXI A;  4EEL A;  2HHV A;  5KFL A;  3LK9 A;  2BKE A;  3JPR A;  2KNJ A;  4F92 B;  4ECU A;  4Z6D A;  3QZ8 A;  3V72 A;  3Q8M A;  2YMQ A;  4F3O A;  4GXJ A;  1N61 A;  2MSN A;  4KLJ A;  5HMM A;  3RBD A;  2Y9T A;  2EQY A;  2P6U A;  3V6K A;  3KHL A;  3WKD A;  3V7J A;  3PVX A;  4CRX A;  4UW9 A;  4EEY A;  4KLU A;  1S0O A;  1ZQ1 C;  5AI9 A;  3C29 A;  1ZQU A;  3V7K A;  3JPO A;  2F8L A;  4IQW A;  2R8G A;  4C8L A;  3EYZ A;  1ECW A;  4DL5 A;  2QAR A;  4KMO B;  2H3V A;  3WKC A;  1XC9 A;  2F44 A;  2L5Y A;  2YY6 A;  2OHF A;  2XGP A;  2R8J A;  4PPX A;  1BPB A;  5J8Y C;  1ZQM A;  4RT2 A;  2BDP A;  5ALV A;  2LMR A;  2OYY A;  4ZOH C;  5AKX A;  1J97 A;  2ZIU A;  3QUC A;  4JV2 A;  4KLD A;  2HHS A;  4KLM A;  2CXY A;  4J9P A;  5KG6 A;  2GWS A;  9ICS A;  5J0W A;  5J0R A;  3KKA C;  4U6P A;  2ZJ5 A;  1T3N A;  2O6K A;  1UA0 A;  4QZD A;  1S97 A;  3ZDB A;  4BGD A;  3QZ7 A;  5III A;  1BGX T;  4QIW C;  3RBE A;  2IHN A;  1JRP A;  1SIJ A;  2FLP A;  2KFZ A;  4U7C A;  3SEI A;  3AM9 A;  5J0U A;  2ZIV A;  3SV3 A;  2C22 A;  2BPF A;  4KN7 A;  4ECY A;  1SWV A;  2C2E A;  3KOO A;  2KJ9 A;  3LWL A;  2KN7 A;  1B4F A;  3BDP A;  1JN3 A;  2OH2 A;  2WF5 A;  2NRV A;  4EBE A;  4G9B A;  1XSN A;  4C8M A;  5J0Y A;  3ZDA A;  5KFH A;  1TK8 A;  1Q3U A;  5J0X A;  2KSO B;  5TIS U;  3TAN A;  4BDP A;  4J9N A;  2F1I A;  5CP2 A;  4TUS A;  2C2R A;  3MAB A;  2GH1 A;  2W9M A;  2H3Z A;  4RQM A;  4US8 A;  4I2B A;  5CEH A;  1S8O A;  3L5K A;  1WCN A;  5L1M A;  2A1A A;  3GIJ A;  2F8K A;  2DQN B;  2NRZ A;  4Y2P A;  3Q8L A;  4J03 A;  5G5H A;  7ICL A;  1ZQS A;  1QSY A;  1BPY A;  4RQ2 A;  2LYH A;  5KFT A;  5KG5 A;  3JPS A;  4JK1 A;  4ECZ A;  1ZD4 A;  4O9M A;  2N1R A;  3T79 A;  5F9N A;  1X40 A;  2PXI A;  8ICC A;  2EZY A;  4GLX A;  5DB8 A;  2KD1 A;  4F5R A;  2NRT A;  4F71 A;  3IN5 A;  4IQU A;  2OWO A;  1FFU A;  4DFK A;  4QJF B;  4NY8 A;  1Z00 A;  3M9M B;  4QZ8 A;  1PVQ A;  4PZO A;  5DBB A;  2IOF K;  9ICT A;  4C7Z A;  3T5L A;  4BJQ A;  4QZH A;  4M2Y A;  2KV2 A;  4XUS A;  5AM3 A;  1SWW A;  4DF8 A;  2DPJ A;  3CYM A;  3UXN A;  1XWL A;  5BOM A;  3I1Y A;  4IR9 A;  3PV8 A;  5ALF A;  4RPZ A;  2W11 A;  4QZA A;  1TAM A;  1URJ A;  5KNI A;  3MR2 A;  2ZTD A;  2I5H A;  5AKJ A;  3EWA A;  5AKH A;  2R8H A;  2E8N A;  5DG7 A;  4KLI A;  1PZN A;  3ZD9 A;  5J8Y A;  3FYH A;  3OHB A;  4FE3 A;  3GFK B;  3KHG A;  2I6X A;  1RXW A;  1Z1V A;  5CJ7 A;  2WHE A;  4O0I A;  3MR5 A;  3MC1 A;  7ICO A;  2J6U A;  3PR5 B;  4DFD A;  1OXJ A;  2GO7 A;  4PHA A;  3R9K A;  2EH9 A;  1U9L A;  3T5K A;  5DLF A;  3WKE A;  4DSJ A;  4NM2 A;  8ICN A;  2FPM A;  5L1I A;  4MFA A;  2G07 A;  3F5E A;  1U4B A;  2LYB A;  1S9F A;  1TFR A;  1RYS A;  3KHR A;  5ALM A;  5F9L A;  1T3Q A;  2VA3 A;  3QXG A;  4I2C A;  4Y2R A;  5KAI U;  5J2J A;  4RQN A;  2XY7 A;  5KFS A;  3RB6 A;  3V6J A;  3AQE A;  1A0P A;  1LVH A;  1QQ6 A;  7ICF A;  1CUK A;  2V9W A;  1SXD A;  4DF4 A;  2GOL A;  3K4G A;  2JRZ A;  3M9O B;  1L3T A;  2JXJ A;  1NJZ A;  4EBC A;  5KFP A;  4Y2X A;  4R8U B;  1SL0 A;  4GC7 A;  3EUB 2;  2HBJ A;  2KZM A;  4RU9 A;  1K1S A;  4PJ0 U;  2JZB A;  4OJP A;  5IIM A;  4UB2 A;  4NLN A;  2HHT A;  2RHF A;  3GIK A;  1N62 A;  2BPG A;  2XI9 A;  3H4D A;  1NI3 A;  4DCC A;  2JGA A;  3WKB A;  1ZQI A;  2A1J A;  4ED3 A;  1TK0 A;  2WF8 A;  2G5I B;  3KHH A;  4YXJ A;  1S5L U;  3C23 A;  2KTQ A;  3IDW A;  1WUD A;  3TFR A;  3HX0 A;  3NTU A;  4MHV A;  5ALP A;  2V4Q A;  2WFA A;  4DWI A;  3AQF A;  4IRC A; 
#chains in the Genus database with same CATH homology
 2KNJ A;  4OJ6 A;  2E1E A;  2KIC A;  2K4E A;  4FE3 A;  1P7D A;  2Y0S F;  5HR7 A;  3PSP A;  1T94 A;  4AYB F;  4ICA A;  2HBK A;  3LVW A;  2G06 A;  3VCB A;  2KHV A;  2CPR A;  3PZP A;  4QIW F;  3IG8 A;  2PMZ C;  2HOF A;  2GH1 A;  3D2S A;  1D8B A;  5A0L A;  4CDG A;  2H3Z A;  2K8B B;  2RP5 A;  2XVT A;  2ZIV B;  3CP8 A;  1NZB A;  2YX8 A;  2OXO A;  4CRX A;  5C0Y A;  1ZQ1 C;  3PSF A;  2WAQ C;  2ZIW A;  4PL1 A;  2G09 A;  3C29 A;  4IC9 A;  4BUG A;  3F2C A;  3GZF A;  4PL2 A;  2LYA A;  2W04 A;  1ED1 A;  2F8L A;  2KOB A;  2CRX A;  2DQN B;  2D6F C;  3IP4 B;  4KX5 A;  2ZIX A;  2HOQ A;  4P0Q A;  2W7O A;  2E1F A;  4AYB C;  2YB1 A;  1ECW A;  1PVR A;  5CRX A;  2G07 A;  2VJ5 A;  4KMO B;  1YT3 A;  2H3V A;  2G08 A;  2JH7 A;  3F5E A;  3H0L B;  3F5A A;  3C28 A;  3H0R B;  2ZIW B;  4FZN A;  2MA1 A;  2G5H B;  3GU3 A;  2LYB A;  2PMZ F;  2HBL A;  3SMV A;  2XIC A;  4P0Q B;  3RF9 A;  3RFA A;  5KL8 B;  2CN1 A;  1HEK A;  2KKV A;  2ZIU B;  3M7D A;  4QNL A;  3F2D A;  2N1R A;  2W03 A;  3NRW A;  1Z19 A;  3L3F X;  3T79 A;  4OJL A;  3VC8 A;  1A6S A;  2KVC A;  1L6N A;  2DGZ A;  2OYY A;  3N7S C;  4NWI A;  4OO1 J;  2E5S A;  4FZM A;  3AQE A;  1A0P A;  2G0A A;  2R18 A;  2OM6 A;  1MA7 A;  2ZIU A;  3AL0 B;  2KD1 A;  3LVV A;  3E0F A;  3IN5 A;  2H3F A;  3PSI A;  2JH1 A;  1CRX A;  2GOL A;  2HBM A;  5HR6 A;  2LKY A;  2KHQ A;  2Z7J A;  3ALR A;  4QJF B;  2K89 A;  2LHT A;  5T14 A;  2VJ4 A;  3ONN A;  2F76 X;  3D2N A;  4NLB A;  1PVP A;  4WJ3 B;  2XID A;  2M0N A;  2WB1 F;  4NLC A;  2BDU A;  1Z1B A;  1XO0 A;  4O3M A;  2A3V A;  1SZH A;  1PVQ A;  4A8E A;  3M6Z A;  2Y0S C;  4U6P A;  4C0Z A;  3ICX A;  2HOI A;  2F2A B;  4P0P A;  3CRX A;  3HKZ F;  2K8C B;  2HBJ A;  4FZL A;  4BJQ A;  1IIP A;  2KEY A;  2MRL A;  2F77 X;  2VKQ A;  3SQI A;  4QIW C;  2KV2 A;  4OJP A;  2JHD A;  2NV3 A;  2K4H A;  3SAH A;  2KIW A;  3N7P D;  3F2B A;  4U7C A;  3KFU F;  2ZG6 A;  2KKP A;  2RHF A;  1DRG A;  3K1Z A;  2H3I A;  3F53 A;  2KJ5 A;  2XI9 A;  3CYM A;  2ZIV A;  2YB4 A;  2JGA A;  4JMU A;  4P0P B;  2WB1 C;  1GO3 F;  1UPH A;  2K8A A;  2VIX A;  4GFJ A;  3NUQ A;  3KZX A;  3H0M B;  2G5I B;  3OPX A;  3IG5 A;  2KJ9 A;  3MGV A;  2RRD A;  1TAM A;  2ZXI A;  2ZIX B;  3SAG A;  4KX3 A;  3HKZ C;  1F44 A;  2DF4 B;  3O0F A;  2KJ8 A;  4OJ5 A;  4OJO A;  3SAF A;  4ACO A;  1URJ A;  3M6K A;  2H3Q A;  1Q3V A;  1WUD A;  1KBU A;  4CGZ A;  3N7R C;  2OH2 A;  3D2Q A;  2JMG A;  5KL1 B;  2Q4T A;  2W7P A;  3DEE A;  3LYS A;  2LBO A;  2HMX A;  2WAQ F;  1XNS A;  4BX9 C;  4NV0 A;  2ZXH A;  2K4I A;  1HIW A;  3AQF A;  1Q3U A;  1OUQ A;  3PST A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...