2K4EA

Solution structure of the hiv-2 unmyristoylated matrix protein
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
134
structure length
134
Chain Sequence
GARNSVLRGKKADELERIRLRPGGKKKYRLKHIVWAANKLDRFGLAESLLESKEGCQKILTVLDPMVPTGSENLKSLFNTVCVIWCIHAEEKVKDTEGAKQIVRRHLVAETGTAEKMPSTSRPTAPSSEKGGNY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords HIV-2 unmyristoylated matrix protein
publication title Structure of the myristylated human immunodeficiency virus type 2 matrix protein and the role of phosphatidylinositol-(4,5)-bisphosphate in membrane targeting.
pubmed doi rcsb
source organism Human immunodeficiency virus type 2
total genus 37
structure length 134
sequence length 134
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-06-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.90 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2k4eA01
2JMGA 2H3ZA 2H3VA 2HMXA 2GOLA 4ICAA 2N1RA 1TAMA 2LYAA 1ECWA 2H3IA 2K4EA 1HIWA 1ED1A 2K4IA 2H3QA 4IC9A 2NV3A 1UPHA 1HEKA 1A6SA 4JMUA 2K4HA 2LYBA 1L6NA 2H3FA
chains in the Genus database with same CATH superfamily
4O3SA 3NVZA 4NL9C 3QUQA 3SENA 1ZQDA 1ZQXA 4IRCA 3FYHA 3V7JA 1JXEA 1ZJNA 4EX6A 2F76X 5K4LA 2PKEA 5AKLA 2NRZA 5JRTA 1HIWA 4YVZA 4NLGA 2ZIWA 3Q8LA 4C8MA 3OJUA 3SZ2A 2AQ4A 4J9KA 1COOA 2NRTA 2DQNB 3LWMA 7ICSA 1ZD3A 5AK5A 3AQEA 1AQ6A 3T79A 5FP0A 2WF7A 1K1QA 1XWLA 5CA7A 1N62A 3RRGA 2A19A 4JV2A 4G3IA 2QLTA 2FPKA 7ICMA 5IINA 5DBCA 2KKVA 4NLZA 3HILA 8ICHA 4RUCA 5DQGA 3ZD9A 2H3QA 3AL0B 4RQ7A 3PR5B 2R8JA 3RJHA 1L8OA 4QZCA 4RQNA 4CGZA 3RRHA 9ICLA 4PGYA 4DL5A 3GILA 1V9PA 2XCAA 5BPCA 2E5SA 2BR0A 1JRPA 2ZIXB 2F3NA 1X9SA 3M9OB 2FMQA 3RBDA 1BVSA 4IQWA 4QZEA 1RG6A 1L7MA 1L3UA 2FMSA 4PHAA 1BPZA 1T3QA 2HOFA 4YMOA 3RF9A 2KFZA 2LYAA 4BWJA 3RJIA 1TAQA 3AUOA 3B9JA 4QJFB 3D2NA 2MU2A 1NKBA 1ZQOA 3K75D 1HUZA 4C8LA 3KHGA 2CRXA 1L8LA 1KSPA 4TQSA 4UB4A 4PZOA 4EBDA 1U48A 3I1YA 5ALMA 2UVUA 1NKCA 2V4RA 5CHGA 4O0IA 1ZQUA 2A3VA 3LVWA 5ALZA 2F1JA 4F4YA 3GIIA 4NLKA 5KFRA 4C7ZA 4JWMA 4C0ZA 3V72A 3Q8SB 4B9LA 2G08A 3PSIA 1S5LU 1NJWA 2OYYA 5CWRA 3PSFA 3QYPA 5EE1A 4Z6FA 2ISOA 4UB5A 4BDPA 3QX7A 3WK7A 4M0AA 5J0XA 2XO7A 8ICGA 3WKBA 4B9NA 2OXOA 5ALRA 3TAPA 1DGSA 4BWMA 4R64A 9ICJA 4DSJA 4C80A 4O5KA 4K4HA 1EXNA 1KEJA 4RZRA 5HHIA 2PFQA 2W55A 3RAQA 2JHDA 1VJ5A 7ICKA 4UB2A 4ICAA 4ED3A 2W7PA 3O0FA 5HHHA 2Y9UA 3OPXA 4YN4A 2Q4TA 1ZJMA 1F5SA 4B9TA 4I2FA 4ECSA 1K5OA 4PJ0U 3RB6A 1A6SA 2KIWA 4DQIA 5IIOA 5KFDA 4B6JA 5KG5A 4TURA 1RQLA 4M9NA 5AI4A 3I28A 1JROA 4ECVA 2D3DA 3G6VA 5J0TA 3UXOA 2JH1A 2BZFA 2LPEA 1Z1BA 4M47A 5H2FU 2VANA 1X6IA 8ICEA 2R8IA 1X40A 2ZIUB 4F3OA 3C1ZA 4I27A 5CRXA 5JUMA 3IM1A 1Y88A 1VDVA 2XGPA 1S0MA 4ED2A 3N7SC 2LKYA 2XCPA 4ED0A 3PW4A 3GIJA 3H4DA 3BDPA 8ICQA 1ZQFA 3CRXA 2V9WA 2ZIVA 3RR8A 2WF5A 5AKKA 1ZETA 2RDIA 4QNLA 4F5NA 4PHEA 4UBCA 2XGQA 2WFAA 5DQIA 1Q3VA 3V7KA 1S0OA 3RB4A 5KFIA 1YT3A 5ALEA 4I2GA 4J03A 2ZG6A 2R8GA 2MRLA 3AN1A 1LVHA 2BCQA 1XU4A 2ASLA 3ISBA 4F71A 1KFSA 4RQ4A 2E8MA 4CF3A 4MFFA 2HVIA 3QU7A 2KVCA 5AIBA 4NM1A 3BQ1A 1T8EA 4R65A 5D49A 2PXIA 2Y0SF 4YR0A 2W9MA 5EWEA 2EQYA 3ONNA 4UB1A 2IMWP 4O5CA 1LKYA 5AM4A 5KAFU 3TKAA 4CCHA 5CB1A 2E3TA 3RJJA 3MDCA 1JALA 1U47A 1X2IA 4R8UB 2JEJA 9ICPA 3SEIA 3M6KA 1B0XA 4ACOA 8ICCA 1Z00B 2ZUDA 2EZZA 5DB7A 2K8BB 4F8RA 3UQ0A 2J6SA 2BQ3A 2GOLA 3RFAA 4UAZA 5J2FA 4KX5A 4RNOA 3ZDAA 4ECQA 2EZYA 3PW5A 2KIVA 1BPDA 1NK7A 4IRKA 1ZQQA 1ZQPA 3BQ7A 2YMQA 4Q43A 1T94A 4KMOB 1K1SA 2KJ8A 4QZIA 2I9GA 3EZ5A 3T3FA 3AU6A 4KLQA 1JI7A 3BS7A 3KZXA 3QZ8A 1UT8A 4QW9A 2HBLA 4YP3A 1F0MA 1N48A 2C28A 4U6PA 5F9NA 5AI8A 4Y2RA 9ICFA 8ICTA 2HHWA 3SAGA 2FMPA 2XY5A 4ECTA 5TISU 4DS4A 2BGWA 3PZPA 4O3PA 5EWFA 2V4QA 3GQCA 2FJ6A 1DXSA 1NK0A 5ALSA 2RQ5A 3ED5A 1QQ5A 4UATA 4F2RA 1WYGA 2BDUA 1IG6A 2WTFA 2DKXA 3GIKA 2QKQA 4I2CA 3HKZF 1WWUA 1QSLA 4YR2A 1SXEA 2H3VA 3RJFA 1D9FA 2Y9TA 1U45A 4YG2A 5KG1A 2KE7A 5KT3A 2K4IA 3C28A 3AM9A 4ED7A 1PK3A 8ICVA 4RNNA 3C2LA 2ZTDA 4EX7A 5KFCA 4HYKA 1ZOLA 5J29A 3JPTA 5ALFA 4QZDA 1XSNA 3SV4A 2KKPA 3BQTA 2LM1A 3BS5A 2KEYA 3QEBZ 5J2GA 4QWBA 2KNJA 2H3IA 1NK6A 2ZIXA 2AGPA 4O5EA 2NO5A 5TZVA 4NM2A 3PX6A 4F93B 5KG6A 5KT6A 3GFKB 1Q46A 3CNHA 2WAQF 3NVWA 3EUB2 4Y2JA 2EZXA 2BQRA 4FS1A 1ZQLA 3QE9Y 5KL8B 3FM9A 2ZIVB 3Q8KA 1N63A 1CUKA 3N7RC 2MUTA 2NV3A 4PPXA 4M2YA 4YXJA 5AM2A 5KG7A 3D2SA 1J97A 1SIJA 5J0UA 3PVXA 2EANA 5G5HA 4ECRA 3M1YA 3G6XA 4B9UA 5L1IA 3LK9A 2C2EA 1PVQA 3QEAZ 2YB4A 4PHPA 2WF6A 4YFKA 2G06A 4GXIA 5KAIU 4JUZA 4C4SA 5JU5A 3QXGA 1Z19A 4I2EA 3M6ZA 2Y0SC 2D6FC 4US8A 1WCLA 2DPJA 3SYZA 3MDAA 5HMLA 1LB2B 4FE3A 3WU2U 3H8MA 3JPOA 1S9FA 3F53A 4J9QA 2K60A 3H0RB 1RYSA 4OJOA 5J8YA 4Q45A 2YMMA 3H8JA 3MFIA 3SI8A 5L1KA 1V97A 7ICLA 1KTQA 5AI9A 2KMDA 4UAVA 1XO0A 1MQ2A 5IIKA 5ALDA 2W9BB 3H8WA 1BPEA 5JTIA 5HR7A 3UMGA 3MGIA 3D2QA 2K8AA 4FBTA 4ECXA 4I2JA 5DLFA 1RDFA 1ZYQA 2NO4A 4F5RA 2HCFA 4DQRA 1IV8A 3H0LB 4CNQA 2KFNA 4Q8EA 5BOLA 4DSKA 3KHHA 4DFJA 4CRXA 3HW8A 2KHQA 5AKXA 2M0NA 2KVSA 3RJEA 2OHFA 3V6HA 5KFTA 2LI6A 1WUDA 1PVRA 1MSWD 4FFDA 1XSLA 2HSZA 4ELTA 1H38A 8ICYA 4RQ8A 4Y2UA 2W03A 1FIQA 2ZIUA 4RQ1A 1NZBA 3T5HA 2W8LA 3U26A 4K4GA 2BPFA 2FLLA 3AQFA 4R63A 4E0DA 2VJ5A 4GXKA 3SQIA 2F8KA 1JN3A 3RJKA 2VKQA 3Q8RB 3GV8B 3QZ7A 2W9AA 4DFDA 2D8CA 2OCEA 3ISDA 4IQTA 3MR3A 1SL1A 4UB3A 5DG9A 3RB0A 3THVA 4M6WA 3F2CA 4FZMA 4DFKA 1TVAA 3HKZC 1ZQ1C 4DL4A 4M9GA 3K4GA 3UXPA 1A0PA 2ISPA 1JUDA 2CXYA 3PO5A 4OJ5A 4OJPA 5J0RA 2GLEA 1TK5A 1S0NA 3UQ2A 4F4XA 2ZTCA 4P4OA 3MFHA 3WKCA 4TQRA 7ICTA 2LYBA 4WJ3B 1S77D 4QZGA 1N61A 4UW9A 4ECWA 5J0QA 2A1AA 5KFAA 4P0PA 4PL2A 4UAWA 4DF8A 1FO4A 1NJZA 3WK9A 4DL2A 1SKWA 5DB8A 5AM0A 1ZD5A 3BS5B 5D4BA 4R8UA 2WAQC 4ZOHC 3UMBA 5KTQA 1UPHA 4OD0A 1Z00A 5KFUA 4RQMA 4Z6EA 4Y2VA 2KICA 3G6YA 4UAUA 2FDRA 2AJQA 3KZIU 3IG8A 3QU5A 2F8LA 1PZNA 1TK8A 1YZ6A 4JB3A 1KL9A 1N56A 2FLNA 4YR3A 4YMMA 1GO3F 1JMSA 2NRVA 5AKEA 5HR6A 3EWAA 4IR1A 2FPLA 1ZXIA 2F77X 4DOBA 2MUTB 5KFVA 4EENA 9ICGA 2OEHA 2H3ZA 1WWVA 4GC6A 3JPPA 1ZRNA 3K1ZA 5G5GA 1KLNA 2HHVA 3UMCA 2JZBB 2YMLA 2BCSA 2E1FA 3ALRA 4US9A 3T5JA 4DOCA 1RXWA 3KFUF 5AKHA 1ZQIA 1HEKA 1XNSA 5AHXA 5AICA 1X9XA 1DK2A 3NASA 5C5JA 1UQVA 2G0AA 1SXDA 2KJ5A 5ALPA 8ICOA 5J8YC 4MFAA 8ICPA 1CI4A 4ED6A 2XC9A 1CRXA 5J0OA 4RUAA 1S0VA 2Z7JA 4UBBA 2JXJA 5KFLA 1ZQCA 2B21A 4AYBF 2YY6A 3ICXA 8ICSA 2HVHA 3BQ0A 4QIWF 3OGUA 1Q8KA 5ALGA 4NJ8A 3M9NB 1NK8A 1COKA 1UT5A 4PZNA 3CYMA 2W7OA 2WB1F 3QUTA 2AGOA 5J2HA 3V6KA 9ICEA 1BNPA 2AH5A 3JPSA 2KP7A 5DB6A 1NI3A 3MR2A 2MSNA 3T5KA 7ICUA 4F4WA 5GTHU 1V85A 2ESEA 2NRXA 4I2IA 4MF8A 1BGXT 3N28A 4EEKA 3QU9A 2F1HA 2VA2A 3TQ1A 2BCVA 1OUQA 3UM9A 2HBJA 4Q44A 1FFVA 3M8RA 4KLFA 1ZQBA 5HNKA 3WK6A 2XI9A 4DFPA 3C2KA 8ICRA 2P6RA 8ICAA 7ICJA 3QU2A 4KX3A 5B5EU 3L5KA 4DCCA 4AP9A 4P2HA 4QWDA 1A76A 4Y2QA 8ICIA 3QUCA 3DDHA 4IQUA 2KZZA 4G9BA 4M6WB 4CF4A 3M9MB 9ICMA 2HHXA 3JPQA 4BUGA 2WF8A 5KFJA 3SV3A 5D46A 1L3SA 2IOFA 5DKWA 4YQWA 3N4MB 2XY7A 4YXMA 1OXJA 3M8SA 1CEZA 4KLMA 3MR5A 1XC9A 4BJQA 4RNMA 3KBBA 4O9MA 1KFDA 5AM5A 2RDJA 4QZAA 1V38A 3GV7B 3IP4B 3SMVA 5DBBA 1WG8A 4JV0A 3GIMA 3SD7A 1N5XA 3EPGA 5ALHA 5EE9A 3B0YA 1Z3EB 4P0PB 2KHVA 1SKRA 2W9BA 2DUYA 4M9JA 3ETLA 3D6JA 1T4GA 4ECYA 1ZQMA 1KQQA 4FO6A 1Z4OA 3ZD8A 1HJPA 2ZXIA 3OTQA 4CE6A 1NOMA 2EAOA 2EAPA 2BCUA 1B22A 5DDYA 4OJ6A 1Z1VA 1SV0A 3H8SA 4QZFA 2JRZA 9ICUA 4J9LA 4R66A 1U4BA 5ALWA 4KITB 2DFLA 4IC9A 4JV1A 2P35A 5ALNA 5KFKA 2B6GA 3LDAA 8ICBA 4J9PA 4HAIA 1ZQNA 2P66A 5KNIA 4NLCA 4RPYA 3PX4A 7ICFA 4KLHA 1MA7A 5ALJA 1BPYA 2AGQA 3PSPA 5E79U 5J2DA 8ICZA 4ELUA 3PNCA 4RPXA 1LV5A 5ALTA 1TE2A 8ICMA 3ZDCA 4QZHA 1ECWA 5AM3A 1UHUA 2IHNA 1FFUA 2KTQA 1B43A 3QUBA 3RR7A 9ICHA 5KFWA 2FE9A 5F9LA 4I29A 3LVVA 4PGXA 3VC8A 1MQ3A 2G07A 1U9LA 2IOHA 1RPLA 1U49A 1D8BA 1NNLA 3MABA 5J0SA 2AU0A 4AYBC 4KLJA 5KFOA 1URJA 1NKEA 1X9MA 2R18A 4TUPA 2HMXA 1BNOA 4QIWC 5AIAA 3JPRA 4BX9C 2E8OA 4IRDA 4TUQA 4EEYA 2FLPA 2KV2A 2WB1C 3R9KA 2I6XA 2HBKA 2YMPA 3LYSA 4O3OA 3EYZA 3HP6A 4M04A 5CEHA 2ATLA 3HT3A 2ASDA 2EDUA 2RHFA 5DG8A 4EZ6A 2O6KA 2ZXHA 3ZDEA 1JX4A 4BXOB 3NVVA 4PL1A 2BDPA 1S10A 3PMNA 2DWQA 2NYVA 8ICXA 3RB3A 1ZQEA 5ALQA 5L1JA 1KW4A 5B66U 2BKEA 3F2BA 3PW2A 5ALVA 3E58A 9ICNA 4C8KA 1IXRA 4MFCA 4F4ZA 2JZBA 2W04A 3TARA 3NRWA 2N1RA 8ICKA 1L7PA 1TV9A 1C7YA 2KK0A 4KLOA 2ZUCA 3TADA 3HX0A 4F92B 2B0CA 3A0HU 4KN4A 5L9XA 9ICVA 2OM6A 5KG4A 3KKAA 4GFJA 4RQ0A 9ICCA 5KFMA 7ICOA 4UAYA 2E8NA 1QH9A 2JH7A 2Y1IA 5ALKA 2W43A 2KZMA 2CN1A 1IIPA 3N7PD 2P6UA 1KBUA 2AHOB 2E1EA 5J0PA 3HWTA 4UARA 1ZQJA 2AXTU 3ZI4A 4UB8U 4QZBA 3DV9A 3CP8A 4JK1A 3TFSA 1ZQVA 3IDWA 1J2MA 4C7YA 2JMGA 2C22A 1SV0C 4PH5A 3DEEA 1ZQRA 1X42A 2G5IB 5F3XB 8ICLA 3TFRA 4KLTA 4PHDA 1NJXA 1TAMA 1T3NA 1PK1B 3KHLA 5DG7A 3MR6A 3F5AA 3WK4A 2QB1A 3QU4A 1SWVA 2VA8A 1ZRMA 4NLBA 2DPIA 2VJ4A 1Z4NA 2YTUA 5DB9A 1SKSA 3GV5B 2W3RA 4ELVA 4USAA 5KFPA 3PSTA 2PI5A 3PY8A 4IQVA 5CR0A 5IIIA 2DL0A 3L3FX 4YD1A 3PX0A 2R8KA 3A0BU 4RPZA 2KJ9A 2K89A 2W54A 2A1JB 7ICVA 3GZFA 2F1IA 4A8EA 2K8CB 4F5QA 4IL6U 4MEXA 3PO4A 3LWLA 2JEGA 2K4EA 2LMRA 4KTQA 2ZJ5A 5AK6A 2KSOB 3ORYA 2CPRA 4KLGA 2Y1JA 4RT2A 1S97A 4LJXA 4EBCA 2ZUBA 5EE0A 2QB0B 4LZGA 3KD3A 4Y2XA 3BJYA 1RZTA 4XRHA 4LVSA 3B0XA 3VCBA 5EWGA 2C2DA 4DQPA 4B9VA 1SL2A 4DOAA 2KN7A 1IM4A 2GO7A 5CP2A 1TK0A 3IG5A 1D8YA 4O3MA 2LHTA 2IHMA 2VA3A 2XICA 4DFMA 4P0QB 4P4PA 4RQ5A 5DGAA 7ICIA 9ICTA 5DGBA 2KG5A 1BPXA 2HHTA 4M9LA 2HBMA 4ED1A 1NZPA 1TKDA 5AKIA 2J6TA 5BOMA 2JGAA 4DWIA 3OSNA 2PMZF 1SZHA 3ETRA 5KL1B 3WKDA 2J6UA 4O3QA 4I2BA 3C23A 4DQSA 2EH9A 7ICNA 3MC1A 4DSIA 1ZQZA 4YMNA 4OJLA 5DBAA 3MGVA 3FDSA 4JWNA 3TACB 5IILA 2WF9A 9ICKA 2Q0ZX 4ED8A 4GLXA 3OSPA 2DBYA 1QQ6A 3AMZA 3QNMA 9ICAA 4EBEA 5EOZA 4F72A 2YX8A 8ICNA 4C4TA 3C2MA 4B9MA 2ASJA 3IRUA 3HJEA 5KFYA 3KTQA 3KOOA 4CDGA 2ES6A 3RJGA 4NY8A 1N5WA 1MN8A 3TADC 4K4IA 3WKEA 5J0WA 3KKAC 2XY6A 3GU3A 3RBEA 5DDMA 4C4RA 2QARB 4JMUA 4OO1J 3Q8PB 4QW8A 3OHBA 1L6NA 5HP4A 4DO9A 3C29A 2ZTEA 2G5HB 1X6JA 1KN5A 4ECZA 9ICWA 2WHEA 3NUQA 2GH1A 3WK5A 4DL7A 1QSYA 1L3VA 7ICEA 3PW7A 5KFGA 1PVPA 3ZDDA 4EYIB 4TUSA 4KLUA 3E2EA 3EPIA 5KFEA 4F5OA 3RTVA 2UVRA 4I28A 2UVWA 3M7DA 3UPQA 5KT4A 1S8OA 4GC7A 2I5HA 2W9CA 1NK5A 4J9OA 1YZ7A 1XO1A 3WK8A 2RP5A 1NK9A 3MBYA 1RYRA 1XSPA 1ZD2P 2IA6A 3K1RB 2HHQA 2KD1A 1QCKA 2JEFA 3UXNA 5KT2A 4QZ9A 4FS2A 3ISCA 2JR5A 4J9RA 4Z6DA 9ICBA 2LBOA 4BXOA 3BQ2A 3PMLA 1DRGA 1QSSA 3ZDBA 3AEVA 1SV4A 2RLTA 9ICQA 1SL0A 4F2SA 5KG3A 1L5UA 5ALLA 1O08A 4O3RA 4RQ3A 1MC8A 3RAXA 1QQ7A 1UCVA 2JEIA 4O3NA 1SZPA 5DLGA 9ICIA 2ZIWB 2JV3A 1BPBA 7ICRA 4BGDA 1ZQTA 2ZJAA 1RYUA 4Y2YA 4RQ2A 2OH2A 4QWEA 3F2DA 8ICFA 3RH4A 3TI0A 1A77A 3NRZA 1KFTA 1ZQAA 1DOQA 3F5EA 2AQ0A 1C20A 3S6JA 1X66A 2RRDA 2W8KA 4M9HA 3H7IA 5IIJA 2BPGA 5J2JA 4DS5A 4KLDA 1SB3C 4DEZA 3IV6A 5AI6A 2GWSA 1QLNA 3V6JA 9ICRA 5J2BA 2LYHA 5J2KA 2DGZA 1RXVA 3H4BA 4MF2A 2HHSA 2I1QA 4IR9A 1D8LA 3MGHA 3IHQB 2PMZC 5J2CA 3JPNA 3C5FA 4UB6U 1O03A 4Y2SA 2XVTA 7ICQA 4Z6CA 4C8NA 1SWWA 4P4MA 4DSFA 1PK1A 4NLNA 2ODGA 2LM4A 4YD2A 5GTIU 1OW5A 4GXJA 5J2AA 1Q3UA 5KFQA 1TAUA 1ED1A 1ZD4A 1UA1A 4QZ8A 4J9SA 1N60A 4I2AA 2K4HA 5J2IA 1X9WA 3NVYA 1S76D 1RM6C 2YN4A 4DQQA 1NJYA 5KFNA 5ALYA 3PR4A 9ICSA 3E0FA 4NV0A 3AU2A 1DGJA 4FZNA 2DKZA 4Y2PA 4ZH4A 1F44A 3NGDA 1KRPA 2OWOA 3NTUA 4C8OA 2F44A 5ALXA 1FEZA 2A1JA 1NK4A 4DL3A 2PI4A 4XA5A 4NL9A 1SGGA 1DK3A 3TANA 4QWCA 1ZQYA 5J2EA 2KSOA 1M6YA 4RU9A 1L7OA 4DSEA 3N97B 1UA0A 4B9SA 3OHAA 4FZLA 2H5XA 4IS7A 2QB0A 4PGQA 2L5YA 4XQ8A 4FBUA 1J2NA 2ZJ8A 4GIBA 4F50A 5KG2A 3I76A 3SAHA 1ZQKA 3IN5A 3GDXA 1PUZA 2XIDA 4Q8FA 3EW9A 5AKYA 2BHNA 1JIHA 3H0MB 2W9CB 3RH5A 5L1LA 3SR6A 4P0QA 4XUSA 3BZKA 4YCXA 4F5PA 2W3SA 3OJSA 4NXZA 5KFZA 1VLBA 1AROP 5KFXA 2BPCA 5AKJA 2E8PA 5J0YA 4RQ6A 2PFOA 2FI1A 4EZ9A 7ICGA 4DLEA 2NRWA 1D9DA 2PFPA 5KFFA 3HRDD 5KFSA 4OCZA 2HI0A 2HW3A 2YB1A 4NWIA 4ECUA 5ALIA 4KLIA 5AK4A 5CJ7A 1JXLA 1KKXA 2MA1A 3T5LA 2DF4B 4EELA 3WKAA 2IBKA 5AI0A 4KLEA 2HOQA 5AKZA 4CF5A 5IIMA 1L3TA 3PV8A 2M9NA 4UQGA 5A0LA 1B4FA 5DQHA 2YQEA 5ALOA 2BCRA 4MEYA 2QARA 5L1MA 7ICPA 1P7DA 4QWAA 3C5GA 2KZ3A 1ZQGA 7ICHA 3TAQA 1XS9D 1HUOA 4Y2TA 8ICWA 5AK3A 2FPMA 3FC4A 4J9NA 5KT7A 3C1YA 5KFBA 2K4PA 4KMUA 5KT5A 4DF4A 4LZDA 4MHVA 2EAMA 2ALZA 4U7CA 2KOBA 5AM1A 1QTMA 1KDHA 9ICXA 4KLSA 1WCNA 3Q8QB 4F91B 1ZQHA 1ZQSA 3HPOA 4EYHB 1ZQWA 4DSLA 4KLLA 5KFHA 2HHUA 9ICOA 4X5VA 2R8HA 4RT3A 3BZCA 5HMMA 3J81j 4F4KA 4I2DA 5KG0A 2BQUA 1LKYB 5ALUA 3PW0A 1T7PA 3NS1A 4UASA 2HDOA 5T14A 5EE3A 8ICUA 5AI5A 2MAXA 2H3FA 2HOIA 2UVVA 3RH6A 3KHRA 4J9MA 2PFNA 1RQNA 3Q8MA 4I2HA 2VIXA 1L7NA 3L4PA 4KN7A 1N2XA 2F2AB 3C21A 5C0YA 2IOFK 3CW2C 1TFRA 5AKGA 3H40A 2C2RA 8ICJA 3SAFA 3V7LA 4DL6A 2W11A 4DLGA 3FAHA 2G09A
chains in the Genus database with same CATH topology
3C29A 5HR7A 2Z7JA 4AYBC 2JH7A 3IP4B 1URJA 2G5HB 2K8BB 4AYBF 2CN1A 3D2QA 2R18A 2K8AA 1IIPA 4P0PA 2HMXA 3ICXA 2KKPA 3N7PD 2JH1A 3SMVA 2GOLA 3RFAA 4QIWC 4PL2A 2HOFA 1Z1BA 2KEYA 2E1EA 5A0LA 3RF9A 1KBUA 2OH2A 4QIWF 4BX9C 2LYAA 2F76X 3H0LB 2GH1A 3NUQA 4KX5A 2KNJA 2H3IA 3F2DA 2ZIXA 1HIWA 4P0PB 2KV2A 2WB1C 3VCBA 1PVPA 2KHVA 2ZIUB 3CYMA 2HBKA 2WAQC 2W7OA 2WB1F 1P7DA 4QJFB 1UPHA 3D2NA 2ZIWA 3F5EA 2WAQF 3LYSA 3CP8A 4FZLA 4CRXA 5CRXA 2KHQA 2KICA 3IG5A 2DQNB 2M0NA 2ZXIA 4O3MA 3N7SC 2JMGA 2LKYA 2RRDA 2LHTA 3M7DA 1WUDA 4OJ6A 2XICA 1PVRA 3IG8A 3SAHA 2CRXA 3DEEA 4P0QB 3IN5A 3AQEA 2G5IB 2XIDA 3CRXA 2ZIVA 2F8LA 1T94A 2RHFA 5KL8B 3T79A 4KMOB 2W03A 1TAMA 2ZIUA 2KOBA 4U7CA 2HBMA 1NZBA 2ZIVB 2DGZA 2KJ8A 4QNLA 2ZXHA 3N7RC 2A3VA 2RP5A 3KZXA 4IC9A 1GO3F 2NV3A 3H0MB 3LVWA 3F5AA 2HBLA 3AQFA 4PL1A 5HR6A 2PMZC 3D2SA 2JGAA 2VJ5A 2F77X 1Q3VA 2PMZF 5KL1B 1SZHA 1OUQA 2HBJA 4U6PA 3SQIA 2KD1A 4NLBA 2VJ4A 4P0QA 2XVTA 1YT3A 4C0ZA 2H3ZA 2KKVA 3SAGA 2XI9A 1PVQA 2VKQA 2G08A 3PSIA 4NLCA 3K1ZA 4OJLA 3PZPA 2ZG6A 2YB4A 3PSTA 2OYYA 2MRLA 2G06A 3MGVA 1MA7A 4WJ3B 3PSFA 4KX3A 1Q3UA 1ED1A 2LBOA 3PSPA 2E1FA 3ALRA 3KFUF 2OXOA 2H3QA 5T14A 1DRGA 1HEKA 3AL0B 3F2BA 3F2CA 2BDUA 2K4HA 1XNSA 4FZMA 1Z19A 2KVCA 3L3FX 3M6ZA 2YX8A 3HKZC 2Y0SC 1ZQ1C 2D6FC 2H3FA 1ECWA 1L6NA 3HKZF 2HOIA 2Y0SF 2YB1A 1A0PA 2JHDA 2KJ9A 3ONNA 2K89A 4FE3A 4CGZA 3F53A 4NWIA 4BUGA 2H3VA 4CDGA 2W04A 3GZFA 3H0RB 4ICAA 2K8CB 4A8EA 2G0AA 3E0FA 3NRWA 2N1RA 2VIXA 4OJ5A 4OJPA 4OJOA 2W7PA 2KJ5A 2ZIWB 3LVVA 3O0FA 3OPXA 2F2AB 2K4EA 2Q4TA 2MA1A 2DF4B 3VC8A 4NV0A 2G07A 5C0YA 2K4IA 4BJQA 2E5SA 3C28A 2CPRA 2OM6A 2ZIXB 3GU3A 3SAFA 2KIWA 4FZNA 1XO0A 1CRXA 1A6SA 1D8BA 4JMUA 4OO1J 4GFJA 2LYBA 1F44A 4ACOA 3M6KA 2G09A 2HOQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JMG A;  2H3Z A;  2H3V A;  2HMX A;  2GOL A;  4ICA A;  2N1R A;  1TAM A;  2LYA A;  1ECW A;  2H3I A;  2K4E A;  1HIW A;  1ED1 A;  2K4I A;  2H3Q A;  4IC9 A;  2NV3 A;  1UPH A;  1HEK A;  1A6S A;  4JMU A;  2K4H A;  2LYB A;  1L6N A;  2H3F A; 
#chains in the Genus database with same CATH topology
 4O3S A;  3NVZ A;  4NL9 C;  3QUQ A;  3SEN A;  1ZQD A;  1ZQX A;  4IRC A;  3FYH A;  3V7J A;  1JXE A;  1ZJN A;  4EX6 A;  2F76 X;  5K4L A;  2PKE A;  5AKL A;  2NRZ A;  5JRT A;  1HIW A;  4YVZ A;  4NLG A;  2ZIW A;  3Q8L A;  4C8M A;  3OJU A;  3SZ2 A;  2AQ4 A;  4J9K A;  1COO A;  2NRT A;  2DQN B;  3LWM A;  7ICS A;  1ZD3 A;  5AK5 A;  3AQE A;  1AQ6 A;  3T79 A;  5FP0 A;  2WF7 A;  1K1Q A;  1XWL A;  5CA7 A;  1N62 A;  3RRG A;  2A19 A;  4JV2 A;  4G3I A;  2QLT A;  2FPK A;  7ICM A;  5IIN A;  5DBC A;  2KKV A;  4NLZ A;  3HIL A;  8ICH A;  4RUC A;  5DQG A;  3ZD9 A;  2H3Q A;  3AL0 B;  4RQ7 A;  3PR5 B;  2R8J A;  3RJH A;  1L8O A;  4QZC A;  4RQN A;  4CGZ A;  3RRH A;  9ICL A;  4PGY A;  4DL5 A;  3GIL A;  1V9P A;  2XCA A;  5BPC A;  2E5S A;  2BR0 A;  1JRP A;  2ZIX B;  2F3N A;  1X9S A;  3M9O B;  2FMQ A;  3RBD A;  1BVS A;  4IQW A;  4QZE A;  1RG6 A;  1L7M A;  1L3U A;  2FMS A;  4PHA A;  1BPZ A;  1T3Q A;  2HOF A;  4YMO A;  3RF9 A;  2KFZ A;  2LYA A;  4BWJ A;  3RJI A;  1TAQ A;  3AUO A;  3B9J A;  4QJF B;  3D2N A;  2MU2 A;  1NKB A;  1ZQO A;  3K75 D;  1HUZ A;  4C8L A;  3KHG A;  2CRX A;  1L8L A;  1KSP A;  4TQS A;  4UB4 A;  4PZO A;  4EBD A;  1U48 A;  3I1Y A;  5ALM A;  2UVU A;  1NKC A;  2V4R A;  5CHG A;  4O0I A;  1ZQU A;  2A3V A;  3LVW A;  5ALZ A;  2F1J A;  4F4Y A;  3GII A;  4NLK A;  5KFR A;  4C7Z A;  4JWM A;  4C0Z A;  3V72 A;  3Q8S B;  4B9L A;  2G08 A;  3PSI A;  1S5L U;  1NJW A;  2OYY A;  5CWR A;  3PSF A;  3QYP A;  5EE1 A;  4Z6F A;  2ISO A;  4UB5 A;  4BDP A;  3QX7 A;  3WK7 A;  4M0A A;  5J0X A;  2XO7 A;  8ICG A;  3WKB A;  4B9N A;  2OXO A;  5ALR A;  3TAP A;  1DGS A;  4BWM A;  4R64 A;  9ICJ A;  4DSJ A;  4C80 A;  4O5K A;  4K4H A;  1EXN A;  1KEJ A;  4RZR A;  5HHI A;  2PFQ A;  2W55 A;  3RAQ A;  2JHD A;  1VJ5 A;  7ICK A;  4UB2 A;  4ICA A;  4ED3 A;  2W7P A;  3O0F A;  5HHH A;  2Y9U A;  3OPX A;  4YN4 A;  2Q4T A;  1ZJM A;  1F5S A;  4B9T A;  4I2F A;  4ECS A;  1K5O A;  4PJ0 U;  3RB6 A;  1A6S A;  2KIW A;  4DQI A;  5IIO A;  5KFD A;  4B6J A;  5KG5 A;  4TUR A;  1RQL A;  4M9N A;  5AI4 A;  3I28 A;  1JRO A;  4ECV A;  2D3D A;  3G6V A;  5J0T A;  3UXO A;  2JH1 A;  2BZF A;  2LPE A;  1Z1B A;  4M47 A;  5H2F U;  2VAN A;  1X6I A;  8ICE A;  2R8I A;  1X40 A;  2ZIU B;  4F3O A;  3C1Z A;  4I27 A;  5CRX A;  5JUM A;  3IM1 A;  1Y88 A;  1VDV A;  2XGP A;  1S0M A;  4ED2 A;  3N7S C;  2LKY A;  2XCP A;  4ED0 A;  3PW4 A;  3GIJ A;  3H4D A;  3BDP A;  8ICQ A;  1ZQF A;  3CRX A;  2V9W A;  2ZIV A;  3RR8 A;  2WF5 A;  5AKK A;  1ZET A;  2RDI A;  4QNL A;  4F5N A;  4PHE A;  4UBC A;  2XGQ A;  2WFA A;  5DQI A;  1Q3V A;  3V7K A;  1S0O A;  3RB4 A;  5KFI A;  1YT3 A;  5ALE A;  4I2G A;  4J03 A;  2ZG6 A;  2R8G A;  2MRL A;  3AN1 A;  1LVH A;  2BCQ A;  1XU4 A;  2ASL A;  3ISB A;  4F71 A;  1KFS A;  4RQ4 A;  2E8M A;  4CF3 A;  4MFF A;  2HVI A;  3QU7 A;  2KVC A;  5AIB A;  4NM1 A;  3BQ1 A;  1T8E A;  4R65 A;  5D49 A;  2PXI A;  2Y0S F;  4YR0 A;  2W9M A;  5EWE A;  2EQY A;  3ONN A;  4UB1 A;  2IMW P;  4O5C A;  1LKY A;  5AM4 A;  5KAF U;  3TKA A;  4CCH A;  5CB1 A;  2E3T A;  3RJJ A;  3MDC A;  1JAL A;  1U47 A;  1X2I A;  4R8U B;  2JEJ A;  9ICP A;  3SEI A;  3M6K A;  1B0X A;  4ACO A;  8ICC A;  1Z00 B;  2ZUD A;  2EZZ A;  5DB7 A;  2K8B B;  4F8R A;  3UQ0 A;  2J6S A;  2BQ3 A;  2GOL A;  3RFA A;  4UAZ A;  5J2F A;  4KX5 A;  4RNO A;  3ZDA A;  4ECQ A;  2EZY A;  3PW5 A;  2KIV A;  1BPD A;  1NK7 A;  4IRK A;  1ZQQ A;  1ZQP A;  3BQ7 A;  2YMQ A;  4Q43 A;  1T94 A;  4KMO B;  1K1S A;  2KJ8 A;  4QZI A;  2I9G A;  3EZ5 A;  3T3F A;  3AU6 A;  4KLQ A;  1JI7 A;  3BS7 A;  3KZX A;  3QZ8 A;  1UT8 A;  4QW9 A;  2HBL A;  4YP3 A;  1F0M A;  1N48 A;  2C28 A;  4U6P A;  5F9N A;  5AI8 A;  4Y2R A;  9ICF A;  8ICT A;  2HHW A;  3SAG A;  2FMP A;  2XY5 A;  4ECT A;  5TIS U;  4DS4 A;  2BGW A;  3PZP A;  4O3P A;  5EWF A;  2V4Q A;  3GQC A;  2FJ6 A;  1DXS A;  1NK0 A;  5ALS A;  2RQ5 A;  3ED5 A;  1QQ5 A;  4UAT A;  4F2R A;  1WYG A;  2BDU A;  1IG6 A;  2WTF A;  2DKX A;  3GIK A;  2QKQ A;  4I2C A;  3HKZ F;  1WWU A;  1QSL A;  4YR2 A;  1SXE A;  2H3V A;  3RJF A;  1D9F A;  2Y9T A;  1U45 A;  4YG2 A;  5KG1 A;  2KE7 A;  5KT3 A;  2K4I A;  3C28 A;  3AM9 A;  4ED7 A;  1PK3 A;  8ICV A;  4RNN A;  3C2L A;  2ZTD A;  4EX7 A;  5KFC A;  4HYK A;  1ZOL A;  5J29 A;  3JPT A;  5ALF A;  4QZD A;  1XSN A;  3SV4 A;  2KKP A;  3BQT A;  2LM1 A;  3BS5 A;  2KEY A;  3QEB Z;  5J2G A;  4QWB A;  2KNJ A;  2H3I A;  1NK6 A;  2ZIX A;  2AGP A;  4O5E A;  2NO5 A;  5TZV A;  4NM2 A;  3PX6 A;  4F93 B;  5KG6 A;  5KT6 A;  3GFK B;  1Q46 A;  3CNH A;  2WAQ F;  3NVW A;  3EUB 2;  4Y2J A;  2EZX A;  2BQR A;  4FS1 A;  1ZQL A;  3QE9 Y;  5KL8 B;  3FM9 A;  2ZIV B;  3Q8K A;  1N63 A;  1CUK A;  3N7R C;  2MUT A;  2NV3 A;  4PPX A;  4M2Y A;  4YXJ A;  5AM2 A;  5KG7 A;  3D2S A;  1J97 A;  1SIJ A;  5J0U A;  3PVX A;  2EAN A;  5G5H A;  4ECR A;  3M1Y A;  3G6X A;  4B9U A;  5L1I A;  3LK9 A;  2C2E A;  1PVQ A;  3QEA Z;  2YB4 A;  4PHP A;  2WF6 A;  4YFK A;  2G06 A;  4GXI A;  5KAI U;  4JUZ A;  4C4S A;  5JU5 A;  3QXG A;  1Z19 A;  4I2E A;  3M6Z A;  2Y0S C;  2D6F C;  4US8 A;  1WCL A;  2DPJ A;  3SYZ A;  3MDA A;  5HML A;  1LB2 B;  4FE3 A;  3WU2 U;  3H8M A;  3JPO A;  1S9F A;  3F53 A;  4J9Q A;  2K60 A;  3H0R B;  1RYS A;  4OJO A;  5J8Y A;  4Q45 A;  2YMM A;  3H8J A;  3MFI A;  3SI8 A;  5L1K A;  1V97 A;  7ICL A;  1KTQ A;  5AI9 A;  2KMD A;  4UAV A;  1XO0 A;  1MQ2 A;  5IIK A;  5ALD A;  2W9B B;  3H8W A;  1BPE A;  5JTI A;  5HR7 A;  3UMG A;  3MGI A;  3D2Q A;  2K8A A;  4FBT A;  4ECX A;  4I2J A;  5DLF A;  1RDF A;  1ZYQ A;  2NO4 A;  4F5R A;  2HCF A;  4DQR A;  1IV8 A;  3H0L B;  4CNQ A;  2KFN A;  4Q8E A;  5BOL A;  4DSK A;  3KHH A;  4DFJ A;  4CRX A;  3HW8 A;  2KHQ A;  5AKX A;  2M0N A;  2KVS A;  3RJE A;  2OHF A;  3V6H A;  5KFT A;  2LI6 A;  1WUD A;  1PVR A;  1MSW D;  4FFD A;  1XSL A;  2HSZ A;  4ELT A;  1H38 A;  8ICY A;  4RQ8 A;  4Y2U A;  2W03 A;  1FIQ A;  2ZIU A;  4RQ1 A;  1NZB A;  3T5H A;  2W8L A;  3U26 A;  4K4G A;  2BPF A;  2FLL A;  3AQF A;  4R63 A;  4E0D A;  2VJ5 A;  4GXK A;  3SQI A;  2F8K A;  1JN3 A;  3RJK A;  2VKQ A;  3Q8R B;  3GV8 B;  3QZ7 A;  2W9A A;  4DFD A;  2D8C A;  2OCE A;  3ISD A;  4IQT A;  3MR3 A;  1SL1 A;  4UB3 A;  5DG9 A;  3RB0 A;  3THV A;  4M6W A;  3F2C A;  4FZM A;  4DFK A;  1TVA A;  3HKZ C;  1ZQ1 C;  4DL4 A;  4M9G A;  3K4G A;  3UXP A;  1A0P A;  2ISP A;  1JUD A;  2CXY A;  3PO5 A;  4OJ5 A;  4OJP A;  5J0R A;  2GLE A;  1TK5 A;  1S0N A;  3UQ2 A;  4F4X A;  2ZTC A;  4P4O A;  3MFH A;  3WKC A;  4TQR A;  7ICT A;  2LYB A;  4WJ3 B;  1S77 D;  4QZG A;  1N61 A;  4UW9 A;  4ECW A;  5J0Q A;  2A1A A;  5KFA A;  4P0P A;  4PL2 A;  4UAW A;  4DF8 A;  1FO4 A;  1NJZ A;  3WK9 A;  4DL2 A;  1SKW A;  5DB8 A;  5AM0 A;  1ZD5 A;  3BS5 B;  5D4B A;  4R8U A;  2WAQ C;  4ZOH C;  3UMB A;  5KTQ A;  1UPH A;  4OD0 A;  1Z00 A;  5KFU A;  4RQM A;  4Z6E A;  4Y2V A;  2KIC A;  3G6Y A;  4UAU A;  2FDR A;  2AJQ A;  3KZI U;  3IG8 A;  3QU5 A;  2F8L A;  1PZN A;  1TK8 A;  1YZ6 A;  4JB3 A;  1KL9 A;  1N56 A;  2FLN A;  4YR3 A;  4YMM A;  1GO3 F;  1JMS A;  2NRV A;  5AKE A;  5HR6 A;  3EWA A;  4IR1 A;  2FPL A;  1ZXI A;  2F77 X;  4DOB A;  2MUT B;  5KFV A;  4EEN A;  9ICG A;  2OEH A;  2H3Z A;  1WWV A;  4GC6 A;  3JPP A;  1ZRN A;  3K1Z A;  5G5G A;  1KLN A;  2HHV A;  3UMC A;  2JZB B;  2YML A;  2BCS A;  2E1F A;  3ALR A;  4US9 A;  3T5J A;  4DOC A;  1RXW A;  3KFU F;  5AKH A;  1ZQI A;  1HEK A;  1XNS A;  5AHX A;  5AIC A;  1X9X A;  1DK2 A;  3NAS A;  5C5J A;  1UQV A;  2G0A A;  1SXD A;  2KJ5 A;  5ALP A;  8ICO A;  5J8Y C;  4MFA A;  8ICP A;  1CI4 A;  4ED6 A;  2XC9 A;  1CRX A;  5J0O A;  4RUA A;  1S0V A;  2Z7J A;  4UBB A;  2JXJ A;  5KFL A;  1ZQC A;  2B21 A;  4AYB F;  2YY6 A;  3ICX A;  8ICS A;  2HVH A;  3BQ0 A;  4QIW F;  3OGU A;  1Q8K A;  5ALG A;  4NJ8 A;  3M9N B;  1NK8 A;  1COK A;  1UT5 A;  4PZN A;  3CYM A;  2W7O A;  2WB1 F;  3QUT A;  2AGO A;  5J2H A;  3V6K A;  9ICE A;  1BNP A;  2AH5 A;  3JPS A;  2KP7 A;  5DB6 A;  1NI3 A;  3MR2 A;  2MSN A;  3T5K A;  7ICU A;  4F4W A;  5GTH U;  1V85 A;  2ESE A;  2NRX A;  4I2I A;  4MF8 A;  1BGX T;  3N28 A;  4EEK A;  3QU9 A;  2F1H A;  2VA2 A;  3TQ1 A;  2BCV A;  1OUQ A;  3UM9 A;  2HBJ A;  4Q44 A;  1FFV A;  3M8R A;  4KLF A;  1ZQB A;  5HNK A;  3WK6 A;  2XI9 A;  4DFP A;  3C2K A;  8ICR A;  2P6R A;  8ICA A;  7ICJ A;  3QU2 A;  4KX3 A;  5B5E U;  3L5K A;  4DCC A;  4AP9 A;  4P2H A;  4QWD A;  1A76 A;  4Y2Q A;  8ICI A;  3QUC A;  3DDH A;  4IQU A;  2KZZ A;  4G9B A;  4M6W B;  4CF4 A;  3M9M B;  9ICM A;  2HHX A;  3JPQ A;  4BUG A;  2WF8 A;  5KFJ A;  3SV3 A;  5D46 A;  1L3S A;  2IOF A;  5DKW A;  4YQW A;  3N4M B;  2XY7 A;  4YXM A;  1OXJ A;  3M8S A;  1CEZ A;  4KLM A;  3MR5 A;  1XC9 A;  4BJQ A;  4RNM A;  3KBB A;  4O9M A;  1KFD A;  5AM5 A;  2RDJ A;  4QZA A;  1V38 A;  3GV7 B;  3IP4 B;  3SMV A;  5DBB A;  1WG8 A;  4JV0 A;  3GIM A;  3SD7 A;  1N5X A;  3EPG A;  5ALH A;  5EE9 A;  3B0Y A;  1Z3E B;  4P0P B;  2KHV A;  1SKR A;  2W9B A;  2DUY A;  4M9J A;  3ETL A;  3D6J A;  1T4G A;  4ECY A;  1ZQM A;  1KQQ A;  4FO6 A;  1Z4O A;  3ZD8 A;  1HJP A;  2ZXI A;  3OTQ A;  4CE6 A;  1NOM A;  2EAO A;  2EAP A;  2BCU A;  1B22 A;  5DDY A;  4OJ6 A;  1Z1V A;  1SV0 A;  3H8S A;  4QZF A;  2JRZ A;  9ICU A;  4J9L A;  4R66 A;  1U4B A;  5ALW A;  4KIT B;  2DFL A;  4IC9 A;  4JV1 A;  2P35 A;  5ALN A;  5KFK A;  2B6G A;  3LDA A;  8ICB A;  4J9P A;  4HAI A;  1ZQN A;  2P66 A;  5KNI A;  4NLC A;  4RPY A;  3PX4 A;  7ICF A;  4KLH A;  1MA7 A;  5ALJ A;  1BPY A;  2AGQ A;  3PSP A;  5E79 U;  5J2D A;  8ICZ A;  4ELU A;  3PNC A;  4RPX A;  1LV5 A;  5ALT A;  1TE2 A;  8ICM A;  3ZDC A;  4QZH A;  1ECW A;  5AM3 A;  1UHU A;  2IHN A;  1FFU A;  2KTQ A;  1B43 A;  3QUB A;  3RR7 A;  9ICH A;  5KFW A;  2FE9 A;  5F9L A;  4I29 A;  3LVV A;  4PGX A;  3VC8 A;  1MQ3 A;  2G07 A;  1U9L A;  2IOH A;  1RPL A;  1U49 A;  1D8B A;  1NNL A;  3MAB A;  5J0S A;  2AU0 A;  4AYB C;  4KLJ A;  5KFO A;  1URJ A;  1NKE A;  1X9M A;  2R18 A;  4TUP A;  2HMX A;  1BNO A;  4QIW C;  5AIA A;  3JPR A;  4BX9 C;  2E8O A;  4IRD A;  4TUQ A;  4EEY A;  2FLP A;  2KV2 A;  2WB1 C;  3R9K A;  2I6X A;  2HBK A;  2YMP A;  3LYS A;  4O3O A;  3EYZ A;  3HP6 A;  4M04 A;  5CEH A;  2ATL A;  3HT3 A;  2ASD A;  2EDU A;  2RHF A;  5DG8 A;  4EZ6 A;  2O6K A;  2ZXH A;  3ZDE A;  1JX4 A;  4BXO B;  3NVV A;  4PL1 A;  2BDP A;  1S10 A;  3PMN A;  2DWQ A;  2NYV A;  8ICX A;  3RB3 A;  1ZQE A;  5ALQ A;  5L1J A;  1KW4 A;  5B66 U;  2BKE A;  3F2B A;  3PW2 A;  5ALV A;  3E58 A;  9ICN A;  4C8K A;  1IXR A;  4MFC A;  4F4Z A;  2JZB A;  2W04 A;  3TAR A;  3NRW A;  2N1R A;  8ICK A;  1L7P A;  1TV9 A;  1C7Y A;  2KK0 A;  4KLO A;  2ZUC A;  3TAD A;  3HX0 A;  4F92 B;  2B0C A;  3A0H U;  4KN4 A;  5L9X A;  9ICV A;  2OM6 A;  5KG4 A;  3KKA A;  4GFJ A;  4RQ0 A;  9ICC A;  5KFM A;  7ICO A;  4UAY A;  2E8N A;  1QH9 A;  2JH7 A;  2Y1I A;  5ALK A;  2W43 A;  2KZM A;  2CN1 A;  1IIP A;  3N7P D;  2P6U A;  1KBU A;  2AHO B;  2E1E A;  5J0P A;  3HWT A;  4UAR A;  1ZQJ A;  2AXT U;  3ZI4 A;  4UB8 U;  4QZB A;  3DV9 A;  3CP8 A;  4JK1 A;  3TFS A;  1ZQV A;  3IDW A;  1J2M A;  4C7Y A;  2JMG A;  2C22 A;  1SV0 C;  4PH5 A;  3DEE A;  1ZQR A;  1X42 A;  2G5I B;  5F3X B;  8ICL A;  3TFR A;  4KLT A;  4PHD A;  1NJX A;  1TAM A;  1T3N A;  1PK1 B;  3KHL A;  5DG7 A;  3MR6 A;  3F5A A;  3WK4 A;  2QB1 A;  3QU4 A;  1SWV A;  2VA8 A;  1ZRM A;  4NLB A;  2DPI A;  2VJ4 A;  1Z4N A;  2YTU A;  5DB9 A;  1SKS A;  3GV5 B;  2W3R A;  4ELV A;  4USA A;  5KFP A;  3PST A;  2PI5 A;  3PY8 A;  4IQV A;  5CR0 A;  5III A;  2DL0 A;  3L3F X;  4YD1 A;  3PX0 A;  2R8K A;  3A0B U;  4RPZ A;  2KJ9 A;  2K89 A;  2W54 A;  2A1J B;  7ICV A;  3GZF A;  2F1I A;  4A8E A;  2K8C B;  4F5Q A;  4IL6 U;  4MEX A;  3PO4 A;  3LWL A;  2JEG A;  2K4E A;  2LMR A;  4KTQ A;  2ZJ5 A;  5AK6 A;  2KSO B;  3ORY A;  2CPR A;  4KLG A;  2Y1J A;  4RT2 A;  1S97 A;  4LJX A;  4EBC A;  2ZUB A;  5EE0 A;  2QB0 B;  4LZG A;  3KD3 A;  4Y2X A;  3BJY A;  1RZT A;  4XRH A;  4LVS A;  3B0X A;  3VCB A;  5EWG A;  2C2D A;  4DQP A;  4B9V A;  1SL2 A;  4DOA A;  2KN7 A;  1IM4 A;  2GO7 A;  5CP2 A;  1TK0 A;  3IG5 A;  1D8Y A;  4O3M A;  2LHT A;  2IHM A;  2VA3 A;  2XIC A;  4DFM A;  4P0Q B;  4P4P A;  4RQ5 A;  5DGA A;  7ICI A;  9ICT A;  5DGB A;  2KG5 A;  1BPX A;  2HHT A;  4M9L A;  2HBM A;  4ED1 A;  1NZP A;  1TKD A;  5AKI A;  2J6T A;  5BOM A;  2JGA A;  4DWI A;  3OSN A;  2PMZ F;  1SZH A;  3ETR A;  5KL1 B;  3WKD A;  2J6U A;  4O3Q A;  4I2B A;  3C23 A;  4DQS A;  2EH9 A;  7ICN A;  3MC1 A;  4DSI A;  1ZQZ A;  4YMN A;  4OJL A;  5DBA A;  3MGV A;  3FDS A;  4JWN A;  3TAC B;  5IIL A;  2WF9 A;  9ICK A;  2Q0Z X;  4ED8 A;  4GLX A;  3OSP A;  2DBY A;  1QQ6 A;  3AMZ A;  3QNM A;  9ICA A;  4EBE A;  5EOZ A;  4F72 A;  2YX8 A;  8ICN A;  4C4T A;  3C2M A;  4B9M A;  2ASJ A;  3IRU A;  3HJE A;  5KFY A;  3KTQ A;  3KOO A;  4CDG A;  2ES6 A;  3RJG A;  4NY8 A;  1N5W A;  1MN8 A;  3TAD C;  4K4I A;  3WKE A;  5J0W A;  3KKA C;  2XY6 A;  3GU3 A;  3RBE A;  5DDM A;  4C4R A;  2QAR B;  4JMU A;  4OO1 J;  3Q8P B;  4QW8 A;  3OHB A;  1L6N A;  5HP4 A;  4DO9 A;  3C29 A;  2ZTE A;  2G5H B;  1X6J A;  1KN5 A;  4ECZ A;  9ICW A;  2WHE A;  3NUQ A;  2GH1 A;  3WK5 A;  4DL7 A;  1QSY A;  1L3V A;  7ICE A;  3PW7 A;  5KFG A;  1PVP A;  3ZDD A;  4EYI B;  4TUS A;  4KLU A;  3E2E A;  3EPI A;  5KFE A;  4F5O A;  3RTV A;  2UVR A;  4I28 A;  2UVW A;  3M7D A;  3UPQ A;  5KT4 A;  1S8O A;  4GC7 A;  2I5H A;  2W9C A;  1NK5 A;  4J9O A;  1YZ7 A;  1XO1 A;  3WK8 A;  2RP5 A;  1NK9 A;  3MBY A;  1RYR A;  1XSP A;  1ZD2 P;  2IA6 A;  3K1R B;  2HHQ A;  2KD1 A;  1QCK A;  2JEF A;  3UXN A;  5KT2 A;  4QZ9 A;  4FS2 A;  3ISC A;  2JR5 A;  4J9R A;  4Z6D A;  9ICB A;  2LBO A;  4BXO A;  3BQ2 A;  3PML A;  1DRG A;  1QSS A;  3ZDB A;  3AEV A;  1SV4 A;  2RLT A;  9ICQ A;  1SL0 A;  4F2S A;  5KG3 A;  1L5U A;  5ALL A;  1O08 A;  4O3R A;  4RQ3 A;  1MC8 A;  3RAX A;  1QQ7 A;  1UCV A;  2JEI A;  4O3N A;  1SZP A;  5DLG A;  9ICI A;  2ZIW B;  2JV3 A;  1BPB A;  7ICR A;  4BGD A;  1ZQT A;  2ZJA A;  1RYU A;  4Y2Y A;  4RQ2 A;  2OH2 A;  4QWE A;  3F2D A;  8ICF A;  3RH4 A;  3TI0 A;  1A77 A;  3NRZ A;  1KFT A;  1ZQA A;  1DOQ A;  3F5E A;  2AQ0 A;  1C20 A;  3S6J A;  1X66 A;  2RRD A;  2W8K A;  4M9H A;  3H7I A;  5IIJ A;  2BPG A;  5J2J A;  4DS5 A;  4KLD A;  1SB3 C;  4DEZ A;  3IV6 A;  5AI6 A;  2GWS A;  1QLN A;  3V6J A;  9ICR A;  5J2B A;  2LYH A;  5J2K A;  2DGZ A;  1RXV A;  3H4B A;  4MF2 A;  2HHS A;  2I1Q A;  4IR9 A;  1D8L A;  3MGH A;  3IHQ B;  2PMZ C;  5J2C A;  3JPN A;  3C5F A;  4UB6 U;  1O03 A;  4Y2S A;  2XVT A;  7ICQ A;  4Z6C A;  4C8N A;  1SWW A;  4P4M A;  4DSF A;  1PK1 A;  4NLN A;  2ODG A;  2LM4 A;  4YD2 A;  5GTI U;  1OW5 A;  4GXJ A;  5J2A A;  1Q3U A;  5KFQ A;  1TAU A;  1ED1 A;  1ZD4 A;  1UA1 A;  4QZ8 A;  4J9S A;  1N60 A;  4I2A A;  2K4H A;  5J2I A;  1X9W A;  3NVY A;  1S76 D;  1RM6 C;  2YN4 A;  4DQQ A;  1NJY A;  5KFN A;  5ALY A;  3PR4 A;  9ICS A;  3E0F A;  4NV0 A;  3AU2 A;  1DGJ A;  4FZN A;  2DKZ A;  4Y2P A;  4ZH4 A;  1F44 A;  3NGD A;  1KRP A;  2OWO A;  3NTU A;  4C8O A;  2F44 A;  5ALX A;  1FEZ A;  2A1J A;  1NK4 A;  4DL3 A;  2PI4 A;  4XA5 A;  4NL9 A;  1SGG A;  1DK3 A;  3TAN A;  4QWC A;  1ZQY A;  5J2E A;  2KSO A;  1M6Y A;  4RU9 A;  1L7O A;  4DSE A;  3N97 B;  1UA0 A;  4B9S A;  3OHA A;  4FZL A;  2H5X A;  4IS7 A;  2QB0 A;  4PGQ A;  2L5Y A;  4XQ8 A;  4FBU A;  1J2N A;  2ZJ8 A;  4GIB A;  4F50 A;  5KG2 A;  3I76 A;  3SAH A;  1ZQK A;  3IN5 A;  3GDX A;  1PUZ A;  2XID A;  4Q8F A;  3EW9 A;  5AKY A;  2BHN A;  1JIH A;  3H0M B;  2W9C B;  3RH5 A;  5L1L A;  3SR6 A;  4P0Q A;  4XUS A;  3BZK A;  4YCX A;  4F5P A;  2W3S A;  3OJS A;  4NXZ A;  5KFZ A;  1VLB A;  1ARO P;  5KFX A;  2BPC A;  5AKJ A;  2E8P A;  5J0Y A;  4RQ6 A;  2PFO A;  2FI1 A;  4EZ9 A;  7ICG A;  4DLE A;  2NRW A;  1D9D A;  2PFP A;  5KFF A;  3HRD D;  5KFS A;  4OCZ A;  2HI0 A;  2HW3 A;  2YB1 A;  4NWI A;  4ECU A;  5ALI A;  4KLI A;  5AK4 A;  5CJ7 A;  1JXL A;  1KKX A;  2MA1 A;  3T5L A;  2DF4 B;  4EEL A;  3WKA A;  2IBK A;  5AI0 A;  4KLE A;  2HOQ A;  5AKZ A;  4CF5 A;  5IIM A;  1L3T A;  3PV8 A;  2M9N A;  4UQG A;  5A0L A;  1B4F A;  5DQH A;  2YQE A;  5ALO A;  2BCR A;  4MEY A;  2QAR A;  5L1M A;  7ICP A;  1P7D A;  4QWA A;  3C5G A;  2KZ3 A;  1ZQG A;  7ICH A;  3TAQ A;  1XS9 D;  1HUO A;  4Y2T A;  8ICW A;  5AK3 A;  2FPM A;  3FC4 A;  4J9N A;  5KT7 A;  3C1Y A;  5KFB A;  2K4P A;  4KMU A;  5KT5 A;  4DF4 A;  4LZD A;  4MHV A;  2EAM A;  2ALZ A;  4U7C A;  2KOB A;  5AM1 A;  1QTM A;  1KDH A;  9ICX A;  4KLS A;  1WCN A;  3Q8Q B;  4F91 B;  1ZQH A;  1ZQS A;  3HPO A;  4EYH B;  1ZQW A;  4DSL A;  4KLL A;  5KFH A;  2HHU A;  9ICO A;  4X5V A;  2R8H A;  4RT3 A;  3BZC A;  5HMM A;  3J81 j;  4F4K A;  4I2D A;  5KG0 A;  2BQU A;  1LKY B;  5ALU A;  3PW0 A;  1T7P A;  3NS1 A;  4UAS A;  2HDO A;  5T14 A;  5EE3 A;  8ICU A;  5AI5 A;  2MAX A;  2H3F A;  2HOI A;  2UVV A;  3RH6 A;  3KHR A;  4J9M A;  2PFN A;  1RQN A;  3Q8M A;  4I2H A;  2VIX A;  1L7N A;  3L4P A;  4KN7 A;  1N2X A;  2F2A B;  3C21 A;  5C0Y A;  2IOF K;  3CW2 C;  1TFR A;  5AKG A;  3H40 A;  2C2R A;  8ICJ A;  3SAF A;  3V7L A;  4DL6 A;  2W11 A;  4DLG A;  3FAH A;  2G09 A; 
#chains in the Genus database with same CATH homology
 3C29 A;  5HR7 A;  2Z7J A;  4AYB C;  2JH7 A;  3IP4 B;  1URJ A;  2G5H B;  2K8B B;  4AYB F;  2CN1 A;  3D2Q A;  2R18 A;  2K8A A;  1IIP A;  4P0P A;  2HMX A;  3ICX A;  2KKP A;  3N7P D;  2JH1 A;  3SMV A;  2GOL A;  3RFA A;  4QIW C;  4PL2 A;  2HOF A;  1Z1B A;  2KEY A;  2E1E A;  5A0L A;  3RF9 A;  1KBU A;  2OH2 A;  4QIW F;  4BX9 C;  2LYA A;  2F76 X;  3H0L B;  2GH1 A;  3NUQ A;  4KX5 A;  2KNJ A;  2H3I A;  3F2D A;  2ZIX A;  1HIW A;  4P0P B;  2KV2 A;  2WB1 C;  3VCB A;  1PVP A;  2KHV A;  2ZIU B;  3CYM A;  2HBK A;  2WAQ C;  2W7O A;  2WB1 F;  1P7D A;  4QJF B;  1UPH A;  3D2N A;  2ZIW A;  3F5E A;  2WAQ F;  3LYS A;  3CP8 A;  4FZL A;  4CRX A;  5CRX A;  2KHQ A;  2KIC A;  3IG5 A;  2DQN B;  2M0N A;  2ZXI A;  4O3M A;  3N7S C;  2JMG A;  2LKY A;  2RRD A;  2LHT A;  3M7D A;  1WUD A;  4OJ6 A;  2XIC A;  1PVR A;  3IG8 A;  3SAH A;  2CRX A;  3DEE A;  4P0Q B;  3IN5 A;  3AQE A;  2G5I B;  2XID A;  3CRX A;  2ZIV A;  2F8L A;  1T94 A;  2RHF A;  5KL8 B;  3T79 A;  4KMO B;  2W03 A;  1TAM A;  2ZIU A;  2KOB A;  4U7C A;  2HBM A;  1NZB A;  2ZIV B;  2DGZ A;  2KJ8 A;  4QNL A;  2ZXH A;  3N7R C;  2A3V A;  2RP5 A;  3KZX A;  4IC9 A;  1GO3 F;  2NV3 A;  3H0M B;  3LVW A;  3F5A A;  2HBL A;  3AQF A;  4PL1 A;  5HR6 A;  2PMZ C;  3D2S A;  2JGA A;  2VJ5 A;  2F77 X;  1Q3V A;  2PMZ F;  5KL1 B;  1SZH A;  1OUQ A;  2HBJ A;  4U6P A;  3SQI A;  2KD1 A;  4NLB A;  2VJ4 A;  4P0Q A;  2XVT A;  1YT3 A;  4C0Z A;  2H3Z A;  2KKV A;  3SAG A;  2XI9 A;  1PVQ A;  2VKQ A;  2G08 A;  3PSI A;  4NLC A;  3K1Z A;  4OJL A;  3PZP A;  2ZG6 A;  2YB4 A;  3PST A;  2OYY A;  2MRL A;  2G06 A;  3MGV A;  1MA7 A;  4WJ3 B;  3PSF A;  4KX3 A;  1Q3U A;  1ED1 A;  2LBO A;  3PSP A;  2E1F A;  3ALR A;  3KFU F;  2OXO A;  2H3Q A;  5T14 A;  1DRG A;  1HEK A;  3AL0 B;  3F2B A;  3F2C A;  2BDU A;  2K4H A;  1XNS A;  4FZM A;  1Z19 A;  2KVC A;  3L3F X;  3M6Z A;  2YX8 A;  3HKZ C;  2Y0S C;  1ZQ1 C;  2D6F C;  2H3F A;  1ECW A;  1L6N A;  3HKZ F;  2HOI A;  2Y0S F;  2YB1 A;  1A0P A;  2JHD A;  2KJ9 A;  3ONN A;  2K89 A;  4FE3 A;  4CGZ A;  3F53 A;  4NWI A;  4BUG A;  2H3V A;  4CDG A;  2W04 A;  3GZF A;  3H0R B;  4ICA A;  2K8C B;  4A8E A;  2G0A A;  3E0F A;  3NRW A;  2N1R A;  2VIX A;  4OJ5 A;  4OJP A;  4OJO A;  2W7P A;  2KJ5 A;  2ZIW B;  3LVV A;  3O0F A;  3OPX A;  2F2A B;  2K4E A;  2Q4T A;  2MA1 A;  2DF4 B;  3VC8 A;  4NV0 A;  2G07 A;  5C0Y A;  2K4I A;  4BJQ A;  2E5S A;  3C28 A;  2CPR A;  2OM6 A;  2ZIX B;  3GU3 A;  3SAF A;  2KIW A;  4FZN A;  1XO0 A;  1CRX A;  1A6S A;  1D8B A;  4JMU A;  4OO1 J;  4GFJ A;  2LYB A;  1F44 A;  4ACO A;  3M6K A;  2G09 A;  2HOQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...