3GFKB

Crystal structure of bacillus subtilis spx/rna polymerase alpha subunit c-terminal domain complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
76
structure length
76
Chain Sequence
b'GPHMKEEDQKEKVLEMTIEELDLSVRSYNCLKRAGINTVQELANKTEEDMMKVRNLGRKSLEEVKAKLEELGLGLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Regulatory protein spx
publication title Crystal structure of the in vivo-assembled Bacillus subtilis Spx/RNA polymerase alpha subunit C-terminal domain complex
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription/transferase
total genus 26
structure length 76
sequence length 76
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2009-02-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3gfkB00
5CP2A 5J0SA 2ZTDA 4QZGA 2AQ0A 4M9GA 5IIOA 4ED0A 5J2FA 3Q8MA 1V9PA 2PFNA 9ICLA 4QW8A 4DLEA 2BCUA 5KFDA 5DG8A 4F4XA 4DQIA 5DDMA 4RQ6A 4O3PA 3LWLA 3RR7A 4EZ9A 4NLZA 3UXNA 2BCVA 3GV8B 4GXKA 4DSFA 1MQ3A 3PW7A 8ICNA 3V6JA 5DB8A 3HX0A 4GXJA 4IRKA 1ZQDA 2XCPA 1U9LA 7ICOA 8ICTA 5EWFA 1XO1A 3ZD9A 5J0XA 4QWDA 1RYSA 1L3UA 3AUOA 3THVA 8ICUA 5DB7A 1NJZA 2HHQA 2KZMA 2KFNA 1U45A 4DSLA 4MEYA 1S10A 3OSPA 5CB1A 1XC9A 2I1QA 4QWAA 1XSLA 4RQ4A 4F4KA 4Q44A 3G6XA 1BPEA 7ICGA 3ZDBA 1L3SA 4R8UB 5KFCA 3KHRA 4C8MA 5TZVA 3RBDA 2C2EA 2BCRA 9ICAA 8ICQA 3MBYA 1EXNA 3H8WA 5L1JA 2BPFA 3RRHA 4J9MA 2WTFA 3KTQA 2VA8A 7ICIA 2HVIA 1T3NA 1SKWA 5KFXA 1IM4A 5HHIA 3MFHA 4GC6A 4UAYA 5F9LA 4DF4A 1D8YA 1KSPA 2ZTEA 2IBKA 8ICVA 3ZDDA 2MUTA 4M6WA 4ECQA 4KLDA 1KFSA 4JV2A 4PHEA 3ISDA 2R8KA 4JUZA 3JPRA 3PX0A 2C22A 4I2GA 2KZZA 5D49A 1AROP 4DLGA 3TAQA 4QW9A 3EZ5A 4EBEA 5EWEA 4UBCA 4ED8A 2BPCA 2DPIA 3RJHA 1HJPA 1MQ2A 1BPXA 1NOMA 1KEJA 5KFVA 1B43A 2W9CA 4DQSA 2AQ4A 1ZQTA 1NJYA 4Z6EA 5L1KA 3M8RA 1BPYA 1ZQPA 7ICFA 5KT7A 4PHDA 3RH6A 4F5NA 3Q8RB 1BPZA 1TKDA 1ZQKA 4I2BA 1RXWA 4Z6CA 3GDXA 1ZQMA 4ECSA 3QE9Y 4X5VA 2AU0A 1QTMA 3TANA 3V7KA 4YP3A 5J2EA 4ECYA 4IQTA 1ZQBA 5KFIA 4M9LA 7ICSA 4I2FA 7ICQA 3H4DA 4IQUA 4ED2A 4TUQA 4EYHB 4ED1A 4DL3A 1N48A 4J9PA 4YXJA 1SKSA 4YXMA 4YQWA 2AGPA 4DQPA 8ICRA 4M47A 3KHLA 5KG3A 4YMNA 3TQ1A 1LB2B 1KRPA 1K1QA 4QZ9A 1ZQZA 2XGQA 4KLJA 5DBBA 1KFTA 4BGDA 5DBAA 4F4YA 8ICMA 4EEYA 1S0NA 4UQGA 1COOA 4I2IA 4DOAA 4F4ZA 4B9SA 4E0DA 5DBCA 2HHXA 3B0XA 4UAZA 3T3FA 2P6RA 1NK6A 2IHNA 1Z3EB 5J2JA 5KFOA 3Q8SB 4QZBA 2C2DA 4O5KA 4XUSA 4KITB 8ICYA 1QLNA 5DDYA 1ZQCA 5J2KA 1SL1A 2MUTB 4M6WB 3NGDA 2BQUA 2B21A 2ALZA 1RXVA 2ZUCA 1CEZA 3ISBA 2V4RA 1UT8A 2W9BA 4M0AA 1JX4A 4UB4A 4BDPA 3PY8A 4KLHA 9ICBA 5DB9A 1PZNA 3UXPA 4O3QA 1U4BA 4F5QA 4MF2A 2KFZA 3Q8PB 2BCSA 4FS1A 1SL2A 2HW3A 4PH5A 3N4MB 4JK1A 2W9CB 3OHBA 2ISPA 4M04A 7ICNA 3RB6A 5KFGA 4B9TA 4IQWA 7ICUA 2F1IA 4LZGA 4GLXA 3T5LA 2R8GA 1HUOA 3OHAA 8ICCA 4YR0A 4YR3A 3PV8A 2AGQA 1TV9A 4IR9A 5KFBA 1L3TA 5KFNA 1ZQQA 3C1ZA 2BPGA 4RQ1A 1TK5A 4ELVA 4Q43A 5KFHA 1A76A 4Z6FA 2FPLA 3QEAZ 4M9NA 2W8LA 5DLFA 1NKEA 2R8JA 3RJFA 5KG4A 1BVSA 1RZTA 4DOBA 5KT6A 3TI0A 2XY5A 4MF8A 2PI5A 2JEJA 4KLFA 2XO7A 4RQ3A 2ZJ5A 4BXOA 4RUCA 3RH4A 4LZDA 1T8EA 4FBTA 5KFLA 1ZQVA 3JPNA 3TAPA 1S77D 5DB6A 3GQCA 3BQ2A 3SYZA 4O5EA 5KFTA 5IILA 5D4BA 3EYZA 4QZHA 2P6UA 5KFAA 3C2LA 4I2CA 2BHNA 5J2BA 8ICEA 1KTQA 4J9KA 4EBCA 3QZ8A 4DS5A 1D9FA 4M2YA 5CJ7A 4CCHA 8ICLA 8ICZA 3M8SA 4RQ8A 4KLTA 3Q8QB 4ECUA 1ZQFA 1Z00A 4MFAA 1CUKA 3OSNA 3JPSA 4ZH4A 3IM1A 2W9BB 1NJXA 4DL7A 4PHAA 5IIMA 4P4OA 1TAQA 2Y1IA 3PX4A 3PX6A 2BCQA 4C8NA 4KLOA 2I9GA 4QZDA 3H4BA 5KG7A 5KFPA 4F5OA 1U49A 3Q8LA 5EOZA 4NXZA 2ASLA 3FDSA 1LV5A 2PFOA 3RR8A 3FYHA 3T5HA 4TUPA 2FLNA 4P2HA 1RPLA 3UQ2A 1XS9D 1XWLA 4J9OA 2ASJA 2V9WA 2KTQA 9ICQA 5KFRA 3RJJA 5KFFA 4J9NA 4M9JA 4K4HA 8ICSA 5KT4A 4YVZA 4XQ8A 1TK8A 3M9MB 2FPKA 3EPGA 3GILA 4O3SA 2ZTCA 3H8JA 7ICKA 5IINA 3PR4A 4YFKA 5DG7A 4ELTA 1ZJMA 5KT2A 1XU4A 3GIJA 8ICJA 3BDPA 4I2JA 4KN4A 3BQ0A 1ZQWA 4RT2A 1BGXT 4RU9A 3RB4A 8ICOA 2Q0ZX 5IIJA 4F8RA 3C21A 4QZFA 3PVXA 2ZJAA 4DFKA 5J2IA 4B9UA 4I2DA 4K4GA 4YCXA 3V7JA 4KLQA 2HHTA 1Y88A 1S97A 2IMWP 3EWAA 4RNOA 9ICKA 1DOQA 3AU6A 1H38A 4RNMA 1Z00B 3SV4A 3BJYA 8ICXA 4PPXA 7ICMA 4YG2A 1JN3A 3BQTA 4F5PA 3T5JA 2VA2A 5J0TA 4QZ8A 4C8KA 9ICGA 5L1IA 3H8SA 4K4IA 3PW0A 9ICUA 2XCAA 1C7YA 5C5JA 2BKEA 2DFLA 3MFIA 3UQ0A 3TFSA 3N97B 2BGWA 3RJKA 2R8IA 1ZQNA 5D46A 4IRDA 3GIMA 4NLKA 5KFQA 5BPCA 4IQVA 4NY8A 3PMNA 4F93B 4RPYA 3GIKA 1KLNA 4ECXA 3ISCA 2ZUBA 4RQ0A 1JXEA 4DOCA 4DF8A 1S0OA 2UVRA 4RUAA 4RPZA 9ICOA 2A1JA 1UA1A 2UVWA 3RJGA 1JXLA 2FMQA 1SZPA 5J0QA 1ZETA 3GV5B 9ICVA 4ECVA 4XRHA 3M9OB 1ZQOA 3UXOA 4BWJA 3RJEA 1U47A 3H40A 4DEZA 3SZ2A 3V6KA 5J2AA 2MAXA 2BQRA 1X2IA 4YR2A 4DL2A 2RDJA 3RH5A 3MR2A 2F1JA 5DQGA 4UAWA 4DS4A 4DL5A 1ZQSA 2J6UA 4PHPA 3RB3A 4RZRA 3RAQA 1NK7A 5KG1A 3T5KA 1SKRA 3RBEA 2J6SA 4O5CA 4XA5A 5HMLA 4UB5A 4QWBA 3G6YA 4ECZA 1JIHA 4YD1A 4DO9A 1NK9A 4J9SA 4DSEA 3PO4A 4ELUA 3TFRA 4F2SA 2BQ3A 5CWRA 2HVHA 4TQRA 1TAUA 7ICTA 5J0UA 7ICEA 2NRZA 4DFJA 4I2AA 7ICVA 1NK4A 1ZQHA 3JPQA 4DL6A 4TURA 8ICKA 4R63A 2NRVA 4QWEA 4B9VA 3GFKB 5DGBA 1BPBA 5DQHA 2BR0A 3RAXA 4ECWA 7ICLA 4B9NA 3AU2A 3MDAA 4FO6A 3H7IA 2FLPA 4R8UA 3MABA 3JPPA 3HW8A 4I2EA 4EBDA 1ZQEA 5DLGA 2JZBA 2HHVA 4P4PA 3PR5B 2A1JB 4PGQA 2LYHA 4F92B 1S76D 3PO5A 1WCLA 2R8HA 2W9AA 4KLLA 5IIIA 2FLLA 4KLSA 1UT5A 5CA7A 4HYKA 3OJUA 1S0MA 3ORYA 4F50A 1D8LA 1TFRA 3QEBZ 4KLIA 3Q8KA 1UA0A 5BOLA 3ZDAA 1ZQYA 1NKBA 5J0PA 4FS2A 9ICHA 1ZQRA 4Q45A 4YN4A 3PMLA 4M9HA 4QZAA 4O3OA 4KLUA 7ICJA 4MFCA 1L3VA 2UVUA 5L1LA 1XSNA 4TUSA 2BDPA 5DGAA 1L5UA 4B9LA 4DFPA 5IIKA 5EWGA 3KHGA 1ZJNA 4RPXA 4DSJA 2ZUDA 2W8KA 4TQSA 3RRGA 5KG5A 2V4QA 2ISOA 1MSWD 1ZQXA 4R65A 5KT5A 4ED7A 4KLGA 3KHHA 4ECRA 1KDHA 1BPDA 5KFYA 4FBUA 3PW4A 3TARA 4EZ6A 3V6HA 2HHUA 2ASDA 1JMSA 4LVSA 9ICXA 4YD2A 3RJIA 9ICMA 3LK9A 2W9MA 3BQ1A 3LDAA 1X9WA 4G3IA 2VA3A 3OJSA 8ICWA 9ICCA 4RT3A 2ZJ8A 1QSYA 4J9LA 4B9MA 3B0YA 8ICFA 2H5XA 3ZDEA 5J0RA 5J2GA 1X9SA 1WCNA 3EW9A 5F9NA 1RYRA 3NTUA 4BXOB 4Q8FA 5J0OA 4DSIA 5DG9A 2F1HA 2NRWA 4F5RA 1ZQAA 5BOMA 2JZBB 5DQIA 3GIIA 5J2CA 2C2RA 2UVVA 4PGXA 2P66A 3SV3A 2JEIA 4ED3A 4MFFA 8ICGA 3C1YA 2Y1JA 3PNCA 5KFUA 2XGPA 4DSKA 4IR1A 2FMSA 3MR5A 3MGIA 3HP6A 2OWOA 1D9DA 9ICSA 3HWTA 3MGHA 2XY7A 3SI8A 9ICFA 7ICPA 2DPJA 4I27A 4F4WA 4GXIA 1S9FA 3C5FA 3JPTA 5DKWA 5KFWA 5J2DA 3C23A 2RDIA 4MEXA 4IRCA 4RQ2A 2NRTA 5KFSA 2AJQA 3G6VA 1NJWA 4UB3A 3E2EA 1DGSA 2XY6A 4R64A 1S0VA 2JEGA 3OGUA 3ZDCA 4JWNA 2AGOA 3MDCA 4UB2A 3ZD8A 4Z6DA 2KZ3A 2PI4A 4Q8EA 1ZYQA 4DFMA 2PFQA 1MC8A 4UB1A 5HP4A 1TK0A 9ICPA 4C8OA 2PFPA 4F2RA 8ICIA 3PW2A 4RQ5A 1K1SA 2NRXA 5J29A 3HT3A 3PW5A 4YMOA 3C2MA 1ZQGA 4KLEA 1A77A 3ETLA 1B22A 2XC9A 5L9XA 2FPMA 3C2KA 1ZQIA 4KTQA 8ICPA 5KG2A 1ZQJA 5CHGA 4O9MA 9ICRA 4I28A 1U48A 4NLGA 1NK5A 9ICIA 5KT3A 2M9NA 5J0YA 2IHMA 2PXIA 4GC7A 4UBBA 2IA6A 8ICBA 3K75D 4ECTA 8ICHA 4QZEA 1QSLA 2VANA 2ATLA 1HUZA 5J0WA 3JPOA 5HHHA 1QSSA 1NK8A 3MR3A 3C5GA 4DQQA 1N56A 4EYIB 5JUMA 3RTVA 3RB0A 5KFEA 4YMMA 5KFJA 4RNNA 7ICHA 1T7PA 9ICNA 4KN7A 1TVAA 4NM2A 4J9RA 4C8LA 2HHSA 3V7LA 5HNKA 8ICAA 9ICEA 3UPQA 1NKCA 1XSPA 1T4GA 3IHQB 2FMPA 5J2HA 4ED6A 2C28A 5KFZA 4PGYA 4O0IA 3MR6A 4KLMA 4NLNA 7ICRA 4JV0A 5KG6A 5KFMA 9ICTA 1ZQUA 4O3NA 4P4MA 1SL0A 2KN7A 1IXRA 4I2HA 1ZQLA 3K4GA 4I29A 5KFKA 2GWSA 4BWMA 2HHWA 1NK0A 3EPIA 2J6TA 1X9MA 3GV7B 5KG0A 3V72A 3LWMA 4F91B 4JV1A 4KMUA 4QZIA 3M9NB 4J9QA 4DQRA 2JEFA 4F3OA 4O3RA 4QZCA 5HMMA 4R66A 4NM1A 5CR0A 3QZ7A 9ICWA 4DL4A 9ICJA 4RQ7A 4DWIA 1KFDA 4QWCA 5KTQA 3HPOA 4JWMA
chains in the Genus database with same CATH superfamily
4QZGA 1L7NA 3LYSA 4QIWC 2PFNA 4QW8A 3FC4A 1COKA 2MU2A 5DDMA 4P0PA 4NLZA 2BCVA 1MQ3A 1KKXA 1PVRA 4UW9A 3R9KA 2YX8A 5AHXA 2DKXA 4DSLA 1S10A 3OSPA 1ZOLA 5AICA 5CB1A 1XSLA 2LI6A 7ICGA 2EH9A 2RHFA 2K8BB 5L1JA 4AYBC 3QXGA 2WTFA 3WKAA 1SKWA 4UAYA 3ZDDA 2MUTA 4KLDA 1KFSA 4JV2A 2R8KA 2W7PA 3TAQA 4LJXA 3EZ5A 4EBEA 4UBCA 4P0PB 4ED8A 1BPXA 1NOMA 1ZQTA 1B43A 4DQSA 1NJYA 1BPYA 3UMBA 3M8RA 3Q8RB 3QE9Y 1C20A 3MGVA 1ZQBA 5ALFA 2ZXIA 7ICQA 3H4DA 1P7DA 3QU4A 4ED1A 2FJ6A 4YXMA 4YQWA 8ICRA 5JTIA 3KHLA 3TQ1A 1K1QA 2KP7A 2W3RA 1QQ6A 5DBCA 1IG6A 2P6RA 3SAHA 5KFOA 8ICYA 4B6JA 5J2KA 5ALGA 2MUTB 3M1YA 2HOFA 1RXVA 2DF4B 1UT8A 5AKKA 3PY8A 2BCSA 4PH5A 1DRGA 4AP9A 4JK1A 2ISPA 2Y0SC 4B9TA 2F2AB 4PJ0U 5ALSA 2F1IA 4Y2VA 1TV9A 4YR3A 3PV8A 2IOFK 5AKZA 5KFBA 2W04A 1FFVA 2BPGA 4RQ1A 4ELVA 4Z6FA 3QEAZ 3L5KA 2W8LA 3FM9A 1NKEA 3RJFA 4DOBA 2XY5A 4MF8A 2JEJA 4RUCA 1N5XA 3SMVA 5KFTA 5D4BA 2ODGA 3BZKA 5J2BA 1KTQA 8ICZA 4DS5A 4M2YA 4RQMA 3Q8QB 2E1EA 2EZXA 1ZQFA 3JPSA 3OTQA 5ALIA 4ZH4A 2Y1IA 1ZD5A 3PX6A 4Y2PA 4F5OA 3Q8LA 5EOZA 2KHVA 3ICXA 2ASLA 2WF8A 1SV0C 1RPLA 5AM1A 2VIXA 9ICQA 3RJJA 5L1MA 5KFFA 1AQ6A 5K4LA 2WB1C 3EPGA 5EE9A 3H8JA 7ICKA 1PVPA 4MHVA 4YFKA 1T3QA 1ZXIA 2WF7A 1SWWA 3SR6A 5KT2A 8ICJA 3BQ0A 5AKYA 1WWUA 4BX9C 1SXDA 4F8RA 2ZJAA 2K8CB 4B9UA 4I2DA 2F77X 4OJOA 1Y88A 1S97A 2IMWP 1H38A 4Y2UA 2ZIUA 8ICXA 2MRLA 7ICMA 1DGJA 4YG2A 3T5JA 5J0TA 4PL2A 2OHFA 1N60A 4C8KA 3H8SA 2JMGA 4NWIA 4OJ5A 5C5JA 3J81j 3N97B 2G08A 3RJKA 1LVHA 2R8IA 1X42A 5D46A 5KFQA 2YB1A 4RQ0A 2OH2A 3AMZA 4RUAA 4RPZA 3LVWA 2XI9A 3GV5B 3M9OB 4BWJA 3RJEA 4PZOA 3V6KA 5ALOA 5KAFU 4DCCA 2YN4A 2KJ9A 5HR7A 5DQGA 1ZQSA 4DL5A 2J6UA 3RB3A 3RAQA 2J6SA 2W55A 3RBEA 4XA5A 5AM2A 3F2CA 3ED5A 2E5SA 4QWBA 3PO4A 3NRZA 2FI1A 1NK9A 4DSEA 2DWQA 4F2SA 3TFRA 4UB6U 1NZPA 4TQRA 2ZIUB 3TACB 1NK4A 3JPQA 4DL6A 4B9VA 3GFKB 5DGBA 1Z1BA 7ICLA 3HJEA 3JPPA 3HW8A 4I2EA 4CF3A 5J8YC 3PR5B 4PGQA 3NRWA 4F92B 2FLLA 1UT5A 4HYKA 4F50A 2EAPA 3QEBZ 5BOLA 1RDFA 1ZQYA 1ZQRA 4Q45A 1RQNA 4M9HA 3QX7A 2I5HA 1ZJNA 2HI0A 1TE2A 2ZUDA 2W8KA 4TQSA 3RRGA 2V4QA 1MSWD 1ZQXA 2B0CA 4FBUA 3TARA 3V6HA 2RP5A 3NVZA 5GTHU 5JU5A 3M7DA 4YD2A 2W9MA 1B4FA 8ICWA 5AIBA 2YMPA 3IV6A 1Z4NA 3UMGA 5J2GA 1RYRA 4BXOB 5J0OA 4DSIA 2KKPA 3KKAC 2P66A 8ICGA 4ED3A 4MFFA 3E58A 3C1YA 2Y1JA 1SV0A 2XGPA 4IR1A 2PMZC 3QNMA 3MR5A 4Y2SA 1D9DA 1D8BA 3HWTA 3LVVA 2XY7A 9ICFA 4I27A 2ZIWA 4F4WA 2MSNA 4GXIA 4EX7A 5J2DA 2RDIA 2G5IB 2XY6A 1S0VA 2JEGA 1L8LA 4KX5A 1CRXA 2BDUA 2PFQA 2F44A 1K5OA 2QB1A 2PFPA 4F2RA 3PW2A 4RQ5A 1K1SA 2NRXA 5J29A 3PW5A 3C2MA 3ETLA 1B22A 3C2KA 4C7YA 2CPRA 3BZCA 1Q3UA 4I28A 1WG8A 2DUYA 2Q4TA 4GC7A 2IA6A 3K75D 2W3SA 5ALNA 1HUZA 5J0WA 5ALKA 5HHHA 1NK8A 4WJ3B 2VKQA 3M6ZA 5KFJA 4KN7A 4NM2A 1Q46A 1SGGA 5ALLA 1SXEA 2ZIWB 4NLNA 4JV0A 5KFMA 4U6PA 1SL0A 1FIQA 4I2HA 3K4GA 5ALJA 1NK0A 3EPIA 1KBUA 3HKZF 3GV7B 5KG0A 5H2FU 3M9NB 2JH7A 4F3OA 4O3RA 4QZCA 5CR0A 1KFDA 4QWCA 3QU9A 4CDGA 2AQ0A 2EZZA 2M0NA 5EE3A 5J2FA 5FP0A 4DLEA 5AKHA 2BCUA 5KFDA 1MA7A 4F4XA 4DQIA 4USAA 3RR7A 2R18A 3IP4B 2F76X 1PVQA 4GXJA 1QQ7A 7ICOA 8ICTA 3D2SA 5EWFA 3ZD9A 4QWDA 5J8YA 5J0XA 1RYSA 1L3UA 4US8A 3AUOA 2K4HA 3ZI4A 5DB7A 2G09A 1XC9A 5AI8A 1N63A 3S6JA 2F8KA 4RQ4A 3N7PD 4Q44A 1BPEA 8ICQA 5KFCA 4C8MA 2C2EA 2BCRA 2A19A 5EE0A 4OJLA 2BPFA 1JALA 3KTQA 2VA8A 2ZIVA 2HVIA 5KFXA 1IM4A 4GC6A 1WWVA 5F9LA 3F5AA 4Y2QA 1D8YA 8ICVA 4M6WA 4QJFB 3ISDA 4JUZA 3JPRA 2C22A 4JMUA 2KZZA 2K4PA 1AROP 2KK0A 3RJHA 4C8OA 5AI6A 5KFVA 4Z6EA 7ICFA 1ZQKA 4ACOA 1TKDA 4I2BA 4Z6CA 4ECSA 1ECWA 3A0BU 3V7KA 5J2EA 4ECYA 4IQTA 3KKAA 2XIDA 1BNPA 3N7SC 4TUQA 4J9PA 2AGPA 2W7OA 4YMNA 1LB2B 1ZQZA 2XGQA 4BGDA 5DBAA 5ALRA 4EEYA 4UQGA 4GIBA 2ZXHA 3IDWA 5AKGA 4UAZA 5AM4A 2YMMA 3Q8SB 4XUSA 2NV3A 2HBJA 4M6WB 3AEVA 2B21A 2ALZA 2ZUCA 1CEZA 4Y2TA 4M0AA 4BDPA 9ICBA 5DB9A 1PZNA 4O3QA 1U4BA 1PK1B 2KG5A 7ICNA 4M04A 4IQWA 2IOFA 5KFGA 2G0AA 5EE1A 3T5LA 2R8GA 2AGQA 3C1ZA 4Q43A 1A76A 5KG4A 1HIWA 1RZTA 5KT6A 3TI0A 2PI5A 2XO7A 3TAPA 1S77D 3SYZA 5IILA 5GTIU 3EYZA 5CEHA 3PSIA 5ALYA 8ICEA 5ALPA 4J9KA 1D9FA 3AQEA 4CCHA 4ECUA 2MA1A 1NJXA 4IL6U 4PHAA 5IIMA 1TAQA 3U26A 4FZNA 3RR8A 1IV8A 4P2HA 3UQ2A 2KV2A 4J9OA 2ASJA 4J9NA 1J97A 4K4HA 8ICSA 4YVZA 4XQ8A 2FPKA 4OJ6A 4O3SA 2ZTCA 2LM4A 3AM9A 1ZJMA 4O3MA 3GIJA 3SD7A 1ZQWA 5JRTA 4DFKA 2HDOA 4US9A 5KL1B 2QLTA 1YZ6A 1DOQA 3BJYA 5T14A 3BQTA 5AKJA 5L1IA 3PW0A 2XCAA 3MFIA 3UQ0A 3TFSA 2BGWA 3GIMA 5BPCA 1JI7A 1KLNA 3ISCA 4DOCA 1S0OA 2B6GA 2JR5A 2A1JA 1UA1A 2UVWA 2H3IA 4ECVA 3UXOA 4UB8U 3SZ2A 2YMLA 5J2AA 2OM6A 2BQRA 3QUTA 2RDJA 2K4EA 1JRPA 5AM0A 2KEYA 1NK7A 1SKRA 5KG1A 3SEIA 3QU7A 4UB5A 1RYUA 3G6YA 4YD1A 2YB4A 4ECZA 4J9SA 2HVHA 1O03A 2BQ3A 5CWRA 2KKVA 2NRZA 4DFJA 1ZQHA 4OCZA 5AI9A 3GU3A 2EQYA 3RAXA 2KHQA 1N5WA 4ECWA 2HOQA 3QU2A 1RM6C 4R8UA 1O08A 1ZD4A 1ZQEA 5DLGA 4P4PA 2A1JB 1N62A 2R8HA 4KLSA 2LHTA 1S0MA 3WU2U 3IRUA 3Q8KA 1UA0A 5J0PA 2G06A 3CYMA 4KLUA 2UVUA 2BDPA 5IIKA 2XICA 3KHGA 1SWVA 5KT5A 4KLGA 3KBBA 3KHHA 4CF5A 1F0MA 2HHUA 1JMSA 4LVSA 5AM5A 9ICXA 3RJIA 2RRDA 2Y9UA 1UQVA 4CGZA 2KNJA 2VA3A 1ZD2P 2ES6A 9ICCA 2JRZA 2ZJ8A 4CRXA 5B5EU 4B9MA 3B0YA 3WK9A 3ZDEA 2KJ8A 5J0RA 4C4RA 1WCNA 3EW9A 4Q8FA 3NTUA 2KIWA 5DG9A 2NRWA 4F5RA 3NASA 5AI0A 5DQIA 5J2CA 2C2RA 2KVCA 3PNCA 5KFUA 3QU5A 1PUZA 1QH9A 4UAVA 3HP6A 9ICSA 3TKAA 2ZG6A 3SI8A 2DPJA 1IIPA 3C5FA 3JPTA 4RQ2A 4GFJA 2NRTA 1X9XA 5ALEA 2EAMA 4R64A 2OEHA 3DDHA 3ZD8A 4Q8EA 1ZYQA 4DFMA 4KMOB 5HP4A 5ALTA 4C4SA 1TK0A 2W54A 8ICIA 3HT3A 2CXYA 1A77A 2XC9A 3B9JA 4FFDA 2KMDA 4NLGA 1NK5A 4UBBA 4ECTA 2OXOA 1QSLA 2VANA 2ATLA 1QSSA 4DQQA 1N56A 4EYIB 2H3VA 4RNNA 1T7PA 3F2DA 3UPQA 3IHQB 2FMPA 4ED6A 5KFZA 4O0IA 4O3NA 5AK3A 4P4MA 1IXRA 1ZQLA 4I29A 2JHDA 4UATA 3V72A 3LWMA 3RFAA 4PZNA 4FZMA 4J9QA 2JEFA 1ZQ1C 2DBYA 3QZ7A 5AI5A 9ICJA 3HPOA 4CNQA 4JWMA 5IIOA 4ED0A 2KJ5A 4NV0A 2F8LA 4RQ6A 3UXNA 3GV8B 4GXKA 4DSFA 8ICNA 3V6JA 5DB8A 5B66U 4IRKA 1U9LA 3SAFA 8ICUA 5CRXA 4EX6A 4MEYA 4BUGA 4QWAA 4F4KA 1L3SA 3RBDA 9ICAA 3I28A 1Z1VA 4J9MA 2K60A 4DF4A 2ZTEA 2IBKA 1X40A 4EEKA 3F53A 5AK5A 4PHEA 2FDRA 3PX0A 5AKLA 2GH1A 4DLGA 2HBLA 5D49A 2BPCA 2DPIA 1HJPA 3HKZC 3BQ7A 2QARA 1L7MA 4C0ZA 3RH6A 4PHDA 1BPZA 2W11A 3GDXA 1ZQMA 4X5VA 5HR6A 2EAOA 4EELA 7ICSA 4I2FA 4IQUA 4ED2A 4DL3A 1N48A 2CRXA 4YXJA 2AHOB 4DQPA 5KG3A 8ICMA 1S0NA 2NYVA 2O6KA 4I2IA 4F4ZA 4E0DA 3B0XA 3T3FA 1NK6A 2IHNA 1LKYA 4O5KA 5DDYA 2DGZA 2WF5A 4IS7A 1SL1A 3F5EA 1PK3A 2LBOA 2BQUA 2JGAA 4NL9C 3H0MB 2V4RA 2W9BA 3QYPA 1KL9A 2YY6A 2AXTU 4F5QA 2KFZA 1SL2A 2QARB 7ICUA 4CF4A 4GLXA 1HUOA 3OHAA 1ZQQA 1TK5A 5KFHA 4M9NA 2YTUA 5DLFA 3IN5A 3ETRA 2VJ5A 1S8OA 2ZJ5A 2WF6A 3SENA 4FBTA 1ZQVA 3JPNA 3GQCA 4O5EA 2WAQF 2P6UA 1V85A 5KFAA 1LKYB 2BHNA 4I2CA 4EBCA 3C28A 8ICLA 4U7CA 4RQ8A 4KLTA 1Z00A 3OSNA 1CUKA 2W9BB 4DL7A 2BCQA 4P4OA 4QZDA 3H4BA 5KFPA 4NXZA 3FDSA 2PFOA 2KVSA 3L4PA 1QQ5A 3T5HA 4TUPA 1XWLA 5KNIA 2KOBA 4FZLA 2KTQA 5KFRA 3WK8A 3M9MB 2KICA 5AK6A 5IINA 3PR4A 4P0QA 1X66A 1ZRNA 3I1YA 5C0YA 3BDPA 4I2JA 5AM3A 2G5HB 3RF9A 1BGXT 4RU9A 2Z7JA 3RB4A 5IIJA 4C7ZA 4QZFA 3QUBA 4OO1J 2DQNB 5G5HA 4K4GA 4KLQA 2HHTA 3EWAA 4RNOA 9ICKA 3AU6A 1Z00B 3SV4A 4PPXA 3H8MA 4QZ8A 2WHEA 3PSFA 1WUDA 4IRDA 4IQVA 3GIKA 4ECXA 1L8OA 3IG5A 2UVRA 2ZIVB 5ALDA 1YT3A 1SZPA 3NS1A 1ZETA 2A1AA 1ZQOA 3H40A 4DEZA 4P0QB 1NI3A 4C4TA 3WKCA 1XNSA 3RH5A 1CI4A 4DS4A 2EZYA 4RZRA 3T5KA 2QB0A 1JIHA 4ELUA 3AL0B 3SAGA 1TAUA 2D3DA 5J0UA 7ICVA 1BPBA 2L5YA 5DQHA 1J2NA 2GLEA 4B9NA 3AU2A 3MDAA 4NL9A 1L7OA 3H7IA 5AKEA 2FLPA 3O0FA 2E8NA 3NUQA 4EBDA 2JZBA 2HHVA 2LYHA 1S76D 3PO5A 2W9AA 5IIIA 2NO5A 1QCKA 3ORYA 1D8LA 3NVVA 1TFRA 4KLIA 2DKZA 2HCFA 9ICHA 4YN4A 4QZAA 4O3OA 4MFCA 2W43A 5L1LA 1XSNA 4TUSA 4B9LA 1L7PA 4DFPA 3CP8A 2A3VA 4RPXA 5AK4A 2QB0B 5KG5A 4R65A 4ECRA 3TADC 3T79A 1BPDA 1KDHA 4QNLA 5KFYA 2ASDA 9ICMA 3LK9A 3BQ1A 3LDAA 3OJSA 2F3NA 4Y2JA 4RT3A 1QSYA 1X6IA 1X6JA 5F9NA 2OCEA 2F1HA 2H3ZA 1DXSA 2JZBB 2N1RA 3GIIA 4PGXA 2JV3A 4DFDA 2JEIA 2E3TA 2FMSA 2OWOA 2KE7A 3D6JA 3MGHA 7ICPA 1OXJA 2LYBA 1XO0A 2BZFA 2I6XA 4QIWF 5DKWA 4IRCA 1URJA 5A0LA 5KFSA 2KD1A 3VCBA 4UB3A 2CN1A 1DGSA 3E2EA 3SQIA 3DEEA 4JWNA 2AGOA 3MDCA 4UB2A 3E0FA 2PI4A 1MC8A 2YQEA 9ICPA 5F3XB 1M6YA 4JB3A 1JUDA 1OUQA 1UCVA 1ZQIA 8ICPA 4KTQA 5CHGA 9ICRA 1RG6A 5KT3A 2M9NA 5J0YA 8ICHA 2D6FC 4QZEA 4Y2XA 3MR3A 3C5GA 1Q8KA 3RB0A 3RTVA 4AYBF 7ICHA 9ICNA 1V97A 2HHSA 4C8LA 3V7LA 5HNKA 8ICAA 1NKCA 1XSPA 1T4GA 3D2NA 4ICAA 5J2HA 4KLMA 3MR6A 1ZRMA 1ZQUA 3MC1A 2KN7A 3PSTA 5ALHA 4BWMA 2J6TA 2LM1A 3WK5A 4F91B 4JV1A 2K89A 4DQRA 3CRXA 1T94A 9ICWA 4DL4A 4RQ7A 5KTQA 5CP2A 5J0SA 2ZTDA 4M9GA 3M6KA 3Q8MA 1V9PA 9ICLA 5DG8A 1V38A 1NZBA 3IG8A 2HSZA 3KZXA 2WFAA 4O3PA 3LWLA 4EZ9A 5AKXA 2ESEA 3PW7A 4F72A 2HBKA 3HX0A 1ZD3A 1ZQDA 2XCPA 3KFUF 1XO1A 3THVA 3AQFA 4HAIA 1NJZA 2HHQA 2KZMA 2KFNA 1U45A 5ALQA 3UMCA 2I1QA 3NVYA 3VC8A 1UPHA 2XVTA 3G6XA 3ZDBA 1B0XA 5G5GA 2Y0SF 1MN8A 4R8UB 3KHRA 5TZVA 3MBYA 1EXNA 3H8WA 3RRHA 3WKDA 7ICIA 1T3NA 5HHIA 3BS7A 2LKYA 3PSPA 3WK6A 3MFHA 2KIVA 3TADA 1KSPA 4G9BA 3N7RC 2ZIXA 4ECQA 2LPEA 4I2GA 4QW9A 3GZFA 5EWEA 1MQ2A 1KEJA 1VDVA 2W9CA 2AQ4A 3ONNA 1ZQPA 5L1KA 5KT7A 4F5NA 3NVWA 2K4IA 3H0RB 1RXWA 2AU0A 1QTMA 3TANA 4YP3A 4M9LA 5KFIA 4EYHB 1SKSA 1N61A 4M47A 4UAUA 3ALRA 1KRPA 4QZ9A 2HOIA 4KLJA 3I76A 5DBBA 1KFTA 4F4YA 1COOA 4DOAA 4PL1A 4B9SA 2HHXA 1A6SA 1Z3EB 5J2JA 2C2DA 4QZBA 5ALXA 3BS5A 4KITB 5TISU 1QLNA 1ZQCA 2WB1F 1FEZA 2IOHA 2ZIXB 1SB3C 3NGDA 2GOLA 3ISBA 1JX4A 2W03A 4UB4A 4KLHA 3UXPA 5AKIA 4MF2A 2OYYA 3Q8PB 4FS1A 2HW3A 3N4MB 2W9CB 3OHBA 3RB6A 1JROA 1DK3A 4LZGA 8ICCA 2LYAA 4YR0A 4ZOHC 4IR9A 1L3TA 4CE6A 5KFNA 4C80A 2FPLA 3HILA 1N2XA 4J03A 2EANA 3D2QA 2R8JA 2DL0A 1BVSA 4KLFA 1KN5A 5KL8B 4RQ3A 4BXOA 2RQ5A 3EUB2 5ALZA 4LZDA 3RH4A 1T8EA 4OJPA 5KFLA 5DB6A 3BQ2A 2VJ4A 3K1ZA 1YZ7A 4QZHA 5ALWA 3C2LA 2YMQA 3BS5B 3A0HU 1Z4OA 3QZ8A 5CJ7A 3M8SA 4MFAA 3IM1A 3PX4A 4KLOA 4C8NA 2I9GA 5KG7A 1A0PA 1U49A 5KAIU 4KX3A 1LV5A 3CW2C 3FYHA 2FLNA 1XS9D 4IC9A 2V9WA 4UASA 4M9JA 5KT4A 1TK8A 3GILA 1GO3F 3C29A 5DG7A 4ELTA 1XU4A 4KN4A 1F5SA 4RT2A 2KSOA 8ICOA 4BJQA 2Q0ZX 3C21A 3PVXA 5J2IA 4YCXA 3V7JA 2FE9A 3DV9A 4RNMA 1NNLA 2LMRA 1JN3A 4F5PA 2VA2A 1RQLA 2HBMA 5AI4A 9ICGA 4K4IA 9ICUA 1C7YA 1S5LU 2BKEA 2DFLA 5E79U 4NLBA 1ZQNA 4NLKA 4NY8A 3PMNA 1F44A 2K8AA 1VLBA 2WAQC 2P35A 4F93B 4RPYA 2ZUBA 1JXEA 4DF8A 1OW5A 9ICOA 3RJGA 1JXLA 2FMQA 4EENA 5J0QA 9ICVA 3KOOA 4RQNA 4XRHA 1U47A 2MAXA 3AN1A 1X2IA 4YR2A 4DL2A 3MR2A 2F1JA 2KSOB 4UAWA 3WKEA 4PHPA 2PKEA 1SV4A 4O5CA 5HMLA 1L6NA 4DO9A 2H3QA 5ALVA 4A8EA 7ICTA 2PMZF 7ICEA 4Y2YA 4I2AA 1HEKA 1Z19A 4TURA 1Q3VA 8ICKA 4R63A 2NRVA 4QWEA 4Y2RA 3QUQA 2H3FA 2BR0A 3KD3A 2G07A 4FO6A 3MABA 2E8OA 2E8MA 3WK7A 2JXJA 4NJ8A 1WCLA 4KLLA 5CA7A 2RLTA 3QUCA 3OJUA 2HMXA 3ZDAA 1UHUA 1NKBA 4OD0A 1BNOA 4FS2A 1ED1A 1KQQA 3PMLA 7ICJA 1L3VA 5DGAA 1L5UA 5EWGA 4DSJA 2D8CA 2ISOA 4ED7A 3PW4A 4EZ6A 1X9WA 2AH5A 4G3IA 1WYGA 2NO4A 4FE3A 4J9LA 8ICFA 2H5XA 3FAHA 1X9SA 1SZHA 2GO7A 1ZQAA 5BOMA 2UVVA 3SV3A 3KZIU 3WKBA 4DSKA 3MGIA 3PZPA 4NLCA 3CNHA 1S9FA 3H0LB 5KFWA 3C23A 4MEXA 1TAMA 3WK4A 2AJQA 1KW4A 2E8PA 3G6VA 1NJWA 1PK1A 1VJ5A 2WF9A 3OGUA 3ZDCA 4Z6DA 2KZ3A 4UB1A 5ALUA 1FO4A 1SIJA 4YMOA 1ZQGA 4KLEA 5AIAA 5L9XA 2FPMA 2EDUA 5KG2A 1ZQJA 4O9MA 3HRDD 1U48A 9ICIA 2IHMA 4UARA 2PXIA 2JH1A 8ICBA 4F71A 3K1RB 3JPOA 3UM9A 5JUMA 5KFEA 4YMMA 2E1FA 1FFUA 1TVAA 4J9RA 9ICEA 2C28A 4PGYA 7ICRA 3F2BA 5KG6A 9ICTA 1DK2A 3OPXA 2QKQA 5KFKA 2GWSA 1J2MA 2HHWA 1X9MA 4KMUA 4QZIA 3L3FX 5ALMA 5HMMA 4R66A 4NM1A 2Y9TA 4DWIA 3N28A
chains in the Genus database with same CATH topology
5CP2A 5J0SA 2ZTDA 4QZGA 2AQ0A 4M9GA 5IIOA 4ED0A 5J2FA 3Q8MA 1V9PA 2PFNA 9ICLA 4QW8A 4DLEA 2BCUA 5KFDA 5DG8A 4F4XA 4DQIA 5DDMA 4RQ6A 4O3PA 3LWLA 3RR7A 4EZ9A 4NLZA 3UXNA 2BCVA 3GV8B 4GXKA 4DSFA 1MQ3A 3PW7A 8ICNA 3V6JA 5DB8A 3HX0A 4GXJA 4IRKA 1ZQDA 2XCPA 1U9LA 7ICOA 8ICTA 5EWFA 1XO1A 3ZD9A 5J0XA 4QWDA 1RYSA 1L3UA 3AUOA 3THVA 8ICUA 5DB7A 1NJZA 2HHQA 2KZMA 2KFNA 1U45A 4DSLA 4MEYA 1S10A 3OSPA 5CB1A 1XC9A 2I1QA 4QWAA 1XSLA 4RQ4A 4F4KA 4Q44A 3G6XA 1BPEA 7ICGA 3ZDBA 1L3SA 4R8UB 5KFCA 3KHRA 4C8MA 5TZVA 3RBDA 2C2EA 2BCRA 9ICAA 8ICQA 3MBYA 1EXNA 3H8WA 5L1JA 2BPFA 3RRHA 4J9MA 2WTFA 3KTQA 2VA8A 7ICIA 2HVIA 1T3NA 1SKWA 5KFXA 1IM4A 5HHIA 3MFHA 4GC6A 4UAYA 5F9LA 4DF4A 1D8YA 1KSPA 2ZTEA 2IBKA 8ICVA 3ZDDA 2MUTA 4M6WA 4ECQA 4KLDA 1KFSA 4JV2A 4PHEA 3ISDA 2R8KA 4JUZA 3JPRA 3PX0A 2C22A 4I2GA 2KZZA 5D49A 1AROP 4DLGA 3TAQA 4QW9A 3EZ5A 4EBEA 5EWEA 4UBCA 4ED8A 2BPCA 2DPIA 3RJHA 1HJPA 1MQ2A 1BPXA 1NOMA 1KEJA 5KFVA 1B43A 2W9CA 4DQSA 2AQ4A 1ZQTA 1NJYA 4Z6EA 5L1KA 3M8RA 1BPYA 1ZQPA 7ICFA 5KT7A 4PHDA 3RH6A 4F5NA 3Q8RB 1BPZA 1TKDA 1ZQKA 4I2BA 1RXWA 4Z6CA 3GDXA 1ZQMA 4ECSA 3QE9Y 4X5VA 2AU0A 1QTMA 3TANA 3V7KA 4YP3A 5J2EA 4ECYA 4IQTA 1ZQBA 5KFIA 4M9LA 7ICSA 4I2FA 7ICQA 3H4DA 4IQUA 4ED2A 4TUQA 4EYHB 4ED1A 4DL3A 1N48A 4J9PA 4YXJA 1SKSA 4YXMA 4YQWA 2AGPA 4DQPA 8ICRA 4M47A 3KHLA 5KG3A 4YMNA 3TQ1A 1LB2B 1KRPA 1K1QA 4QZ9A 1ZQZA 2XGQA 4KLJA 5DBBA 1KFTA 4BGDA 5DBAA 4F4YA 8ICMA 4EEYA 1S0NA 4UQGA 1COOA 4I2IA 4DOAA 4F4ZA 4B9SA 4E0DA 5DBCA 2HHXA 3B0XA 4UAZA 3T3FA 2P6RA 1NK6A 2IHNA 1Z3EB 5J2JA 5KFOA 3Q8SB 4QZBA 2C2DA 4O5KA 4XUSA 4KITB 8ICYA 1QLNA 5DDYA 1ZQCA 5J2KA 1SL1A 2MUTB 4M6WB 3NGDA 2BQUA 2B21A 2ALZA 1RXVA 2ZUCA 1CEZA 3ISBA 2V4RA 1UT8A 2W9BA 4M0AA 1JX4A 4UB4A 4BDPA 3PY8A 4KLHA 9ICBA 5DB9A 1PZNA 3UXPA 4O3QA 1U4BA 4F5QA 4MF2A 2KFZA 3Q8PB 2BCSA 4FS1A 1SL2A 2HW3A 4PH5A 3N4MB 4JK1A 2W9CB 3OHBA 2ISPA 4M04A 7ICNA 3RB6A 5KFGA 4B9TA 4IQWA 7ICUA 2F1IA 4LZGA 4GLXA 3T5LA 2R8GA 1HUOA 3OHAA 8ICCA 4YR0A 4YR3A 3PV8A 2AGQA 1TV9A 4IR9A 5KFBA 1L3TA 5KFNA 1ZQQA 3C1ZA 2BPGA 4RQ1A 1TK5A 4ELVA 4Q43A 5KFHA 1A76A 4Z6FA 2FPLA 3QEAZ 4M9NA 2W8LA 5DLFA 1NKEA 2R8JA 3RJFA 5KG4A 1BVSA 1RZTA 4DOBA 5KT6A 3TI0A 2XY5A 4MF8A 2PI5A 2JEJA 4KLFA 2XO7A 4RQ3A 2ZJ5A 4BXOA 4RUCA 3RH4A 4LZDA 1T8EA 4FBTA 5KFLA 1ZQVA 3JPNA 3TAPA 1S77D 5DB6A 3GQCA 3BQ2A 3SYZA 4O5EA 5KFTA 5IILA 5D4BA 3EYZA 4QZHA 2P6UA 5KFAA 3C2LA 4I2CA 2BHNA 5J2BA 8ICEA 1KTQA 4J9KA 4EBCA 3QZ8A 4DS5A 1D9FA 4M2YA 5CJ7A 4CCHA 8ICLA 8ICZA 3M8SA 4RQ8A 4KLTA 3Q8QB 4ECUA 1ZQFA 1Z00A 4MFAA 1CUKA 3OSNA 3JPSA 4ZH4A 3IM1A 2W9BB 1NJXA 4DL7A 4PHAA 5IIMA 4P4OA 1TAQA 2Y1IA 3PX4A 3PX6A 2BCQA 4C8NA 4KLOA 2I9GA 4QZDA 3H4BA 5KG7A 5KFPA 4F5OA 1U49A 3Q8LA 5EOZA 4NXZA 2ASLA 3FDSA 1LV5A 2PFOA 3RR8A 3FYHA 3T5HA 4TUPA 2FLNA 4P2HA 1RPLA 3UQ2A 1XS9D 1XWLA 4J9OA 2ASJA 2V9WA 2KTQA 9ICQA 5KFRA 3RJJA 5KFFA 4J9NA 4M9JA 4K4HA 8ICSA 5KT4A 4YVZA 4XQ8A 1TK8A 3M9MB 2FPKA 3EPGA 3GILA 4O3SA 2ZTCA 3H8JA 7ICKA 5IINA 3PR4A 4YFKA 5DG7A 4ELTA 1ZJMA 5KT2A 1XU4A 3GIJA 8ICJA 3BDPA 4I2JA 4KN4A 3BQ0A 1ZQWA 4RT2A 1BGXT 4RU9A 3RB4A 8ICOA 2Q0ZX 5IIJA 4F8RA 3C21A 4QZFA 3PVXA 2ZJAA 4DFKA 5J2IA 4B9UA 4I2DA 4K4GA 4YCXA 3V7JA 4KLQA 2HHTA 1Y88A 1S97A 2IMWP 3EWAA 4RNOA 9ICKA 1DOQA 3AU6A 1H38A 4RNMA 1Z00B 3SV4A 3BJYA 8ICXA 4PPXA 7ICMA 4YG2A 1JN3A 3BQTA 4F5PA 3T5JA 2VA2A 5J0TA 4QZ8A 4C8KA 9ICGA 5L1IA 3H8SA 4K4IA 3PW0A 9ICUA 2XCAA 1C7YA 5C5JA 2BKEA 2DFLA 3MFIA 3UQ0A 3TFSA 3N97B 2BGWA 3RJKA 2R8IA 1ZQNA 5D46A 4IRDA 3GIMA 4NLKA 5KFQA 5BPCA 4IQVA 4NY8A 3PMNA 4F93B 4RPYA 3GIKA 1KLNA 4ECXA 3ISCA 2ZUBA 4RQ0A 1JXEA 4DOCA 4DF8A 1S0OA 2UVRA 4RUAA 4RPZA 9ICOA 2A1JA 1UA1A 2UVWA 3RJGA 1JXLA 2FMQA 1SZPA 5J0QA 1ZETA 3GV5B 9ICVA 4ECVA 4XRHA 3M9OB 1ZQOA 3UXOA 4BWJA 3RJEA 1U47A 3H40A 4DEZA 3SZ2A 3V6KA 5J2AA 2MAXA 2BQRA 1X2IA 4YR2A 4DL2A 2RDJA 3RH5A 3MR2A 2F1JA 5DQGA 4UAWA 4DS4A 4DL5A 1ZQSA 2J6UA 4PHPA 3RB3A 4RZRA 3RAQA 1NK7A 5KG1A 3T5KA 1SKRA 3RBEA 2J6SA 4O5CA 4XA5A 5HMLA 4UB5A 4QWBA 3G6YA 4ECZA 1JIHA 4YD1A 4DO9A 1NK9A 4J9SA 4DSEA 3PO4A 4ELUA 3TFRA 4F2SA 2BQ3A 5CWRA 2HVHA 4TQRA 1TAUA 7ICTA 5J0UA 7ICEA 2NRZA 4DFJA 4I2AA 7ICVA 1NK4A 1ZQHA 3JPQA 4DL6A 4TURA 8ICKA 4R63A 2NRVA 4QWEA 4B9VA 3GFKB 5DGBA 1BPBA 5DQHA 2BR0A 3RAXA 4ECWA 7ICLA 4B9NA 3AU2A 3MDAA 4FO6A 3H7IA 2FLPA 4R8UA 3MABA 3JPPA 3HW8A 4I2EA 4EBDA 1ZQEA 5DLGA 2JZBA 2HHVA 4P4PA 3PR5B 2A1JB 4PGQA 2LYHA 4F92B 1S76D 3PO5A 1WCLA 2R8HA 2W9AA 4KLLA 5IIIA 2FLLA 4KLSA 1UT5A 5CA7A 4HYKA 3OJUA 1S0MA 3ORYA 4F50A 1D8LA 1TFRA 3QEBZ 4KLIA 3Q8KA 1UA0A 5BOLA 3ZDAA 1ZQYA 1NKBA 5J0PA 4FS2A 9ICHA 1ZQRA 4Q45A 4YN4A 3PMLA 4M9HA 4QZAA 4O3OA 4KLUA 7ICJA 4MFCA 1L3VA 2UVUA 5L1LA 1XSNA 4TUSA 2BDPA 5DGAA 1L5UA 4B9LA 4DFPA 5IIKA 5EWGA 3KHGA 1ZJNA 4RPXA 4DSJA 2ZUDA 2W8KA 4TQSA 3RRGA 5KG5A 2V4QA 2ISOA 1MSWD 1ZQXA 4R65A 5KT5A 4ED7A 4KLGA 3KHHA 4ECRA 1KDHA 1BPDA 5KFYA 4FBUA 3PW4A 3TARA 4EZ6A 3V6HA 2HHUA 2ASDA 1JMSA 4LVSA 9ICXA 4YD2A 3RJIA 9ICMA 3LK9A 2W9MA 3BQ1A 3LDAA 1X9WA 4G3IA 2VA3A 3OJSA 8ICWA 9ICCA 4RT3A 2ZJ8A 1QSYA 4J9LA 4B9MA 3B0YA 8ICFA 2H5XA 3ZDEA 5J0RA 5J2GA 1X9SA 1WCNA 3EW9A 5F9NA 1RYRA 3NTUA 4BXOB 4Q8FA 5J0OA 4DSIA 5DG9A 2F1HA 2NRWA 4F5RA 1ZQAA 5BOMA 2JZBB 5DQIA 3GIIA 5J2CA 2C2RA 2UVVA 4PGXA 2P66A 3SV3A 2JEIA 4ED3A 4MFFA 8ICGA 3C1YA 2Y1JA 3PNCA 5KFUA 2XGPA 4DSKA 4IR1A 2FMSA 3MR5A 3MGIA 3HP6A 2OWOA 1D9DA 9ICSA 3HWTA 3MGHA 2XY7A 3SI8A 9ICFA 7ICPA 2DPJA 4I27A 4F4WA 4GXIA 1S9FA 3C5FA 3JPTA 5DKWA 5KFWA 5J2DA 3C23A 2RDIA 4MEXA 4IRCA 4RQ2A 2NRTA 5KFSA 2AJQA 3G6VA 1NJWA 4UB3A 3E2EA 1DGSA 2XY6A 4R64A 1S0VA 2JEGA 3OGUA 3ZDCA 4JWNA 2AGOA 3MDCA 4UB2A 3ZD8A 4Z6DA 2KZ3A 2PI4A 4Q8EA 1ZYQA 4DFMA 2PFQA 1MC8A 4UB1A 5HP4A 1TK0A 9ICPA 4C8OA 2PFPA 4F2RA 8ICIA 3PW2A 4RQ5A 1K1SA 2NRXA 5J29A 3HT3A 3PW5A 4YMOA 3C2MA 1ZQGA 4KLEA 1A77A 3ETLA 1B22A 2XC9A 5L9XA 2FPMA 3C2KA 1ZQIA 4KTQA 8ICPA 5KG2A 1ZQJA 5CHGA 4O9MA 9ICRA 4I28A 1U48A 4NLGA 1NK5A 9ICIA 5KT3A 2M9NA 5J0YA 2IHMA 2PXIA 4GC7A 4UBBA 2IA6A 8ICBA 3K75D 4ECTA 8ICHA 4QZEA 1QSLA 2VANA 2ATLA 1HUZA 5J0WA 3JPOA 5HHHA 1QSSA 1NK8A 3MR3A 3C5GA 4DQQA 1N56A 4EYIB 5JUMA 3RTVA 3RB0A 5KFEA 4YMMA 5KFJA 4RNNA 7ICHA 1T7PA 9ICNA 4KN7A 1TVAA 4NM2A 4J9RA 4C8LA 2HHSA 3V7LA 5HNKA 8ICAA 9ICEA 3UPQA 1NKCA 1XSPA 1T4GA 3IHQB 2FMPA 5J2HA 4ED6A 2C28A 5KFZA 4PGYA 4O0IA 3MR6A 4KLMA 4NLNA 7ICRA 4JV0A 5KG6A 5KFMA 9ICTA 1ZQUA 4O3NA 4P4MA 1SL0A 2KN7A 1IXRA 4I2HA 1ZQLA 3K4GA 4I29A 5KFKA 2GWSA 4BWMA 2HHWA 1NK0A 3EPIA 2J6TA 1X9MA 3GV7B 5KG0A 3V72A 3LWMA 4F91B 4JV1A 4KMUA 4QZIA 3M9NB 4J9QA 4DQRA 2JEFA 4F3OA 4O3RA 4QZCA 5HMMA 4R66A 4NM1A 5CR0A 3QZ7A 9ICWA 4DL4A 9ICJA 4RQ7A 4DWIA 1KFDA 4QWCA 5KTQA 3HPOA 4JWMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CP2 A;  5J0S A;  2ZTD A;  4QZG A;  2AQ0 A;  4M9G A;  5IIO A;  4ED0 A;  5J2F A;  3Q8M A;  1V9P A;  2PFN A;  9ICL A;  4QW8 A;  4DLE A;  2BCU A;  5KFD A;  5DG8 A;  4F4X A;  4DQI A;  5DDM A;  4RQ6 A;  4O3P A;  3LWL A;  3RR7 A;  4EZ9 A;  4NLZ A;  3UXN A;  2BCV A;  3GV8 B;  4GXK A;  4DSF A;  1MQ3 A;  3PW7 A;  8ICN A;  3V6J A;  5DB8 A;  3HX0 A;  4GXJ A;  4IRK A;  1ZQD A;  2XCP A;  1U9L A;  7ICO A;  8ICT A;  5EWF A;  1XO1 A;  3ZD9 A;  5J0X A;  4QWD A;  1RYS A;  1L3U A;  3AUO A;  3THV A;  8ICU A;  5DB7 A;  1NJZ A;  2HHQ A;  2KZM A;  2KFN A;  1U45 A;  4DSL A;  4MEY A;  1S10 A;  3OSP A;  5CB1 A;  1XC9 A;  2I1Q A;  4QWA A;  1XSL A;  4RQ4 A;  4F4K A;  4Q44 A;  3G6X A;  1BPE A;  7ICG A;  3ZDB A;  1L3S A;  4R8U B;  5KFC A;  3KHR A;  4C8M A;  5TZV A;  3RBD A;  2C2E A;  2BCR A;  9ICA A;  8ICQ A;  3MBY A;  1EXN A;  3H8W A;  5L1J A;  2BPF A;  3RRH A;  4J9M A;  2WTF A;  3KTQ A;  2VA8 A;  7ICI A;  2HVI A;  1T3N A;  1SKW A;  5KFX A;  1IM4 A;  5HHI A;  3MFH A;  4GC6 A;  4UAY A;  5F9L A;  4DF4 A;  1D8Y A;  1KSP A;  2ZTE A;  2IBK A;  8ICV A;  3ZDD A;  2MUT A;  4M6W A;  4ECQ A;  4KLD A;  1KFS A;  4JV2 A;  4PHE A;  3ISD A;  2R8K A;  4JUZ A;  3JPR A;  3PX0 A;  2C22 A;  4I2G A;  2KZZ A;  5D49 A;  1ARO P;  4DLG A;  3TAQ A;  4QW9 A;  3EZ5 A;  4EBE A;  5EWE A;  4UBC A;  4ED8 A;  2BPC A;  2DPI A;  3RJH A;  1HJP A;  1MQ2 A;  1BPX A;  1NOM A;  1KEJ A;  5KFV A;  1B43 A;  2W9C A;  4DQS A;  2AQ4 A;  1ZQT A;  1NJY A;  4Z6E A;  5L1K A;  3M8R A;  1BPY A;  1ZQP A;  7ICF A;  5KT7 A;  4PHD A;  3RH6 A;  4F5N A;  3Q8R B;  1BPZ A;  1TKD A;  1ZQK A;  4I2B A;  1RXW A;  4Z6C A;  3GDX A;  1ZQM A;  4ECS A;  3QE9 Y;  4X5V A;  2AU0 A;  1QTM A;  3TAN A;  3V7K A;  4YP3 A;  5J2E A;  4ECY A;  4IQT A;  1ZQB A;  5KFI A;  4M9L A;  7ICS A;  4I2F A;  7ICQ A;  3H4D A;  4IQU A;  4ED2 A;  4TUQ A;  4EYH B;  4ED1 A;  4DL3 A;  1N48 A;  4J9P A;  4YXJ A;  1SKS A;  4YXM A;  4YQW A;  2AGP A;  4DQP A;  8ICR A;  4M47 A;  3KHL A;  5KG3 A;  4YMN A;  3TQ1 A;  1LB2 B;  1KRP A;  1K1Q A;  4QZ9 A;  1ZQZ A;  2XGQ A;  4KLJ A;  5DBB A;  1KFT A;  4BGD A;  5DBA A;  4F4Y A;  8ICM A;  4EEY A;  1S0N A;  4UQG A;  1COO A;  4I2I A;  4DOA A;  4F4Z A;  4B9S A;  4E0D A;  5DBC A;  2HHX A;  3B0X A;  4UAZ A;  3T3F A;  2P6R A;  1NK6 A;  2IHN A;  1Z3E B;  5J2J A;  5KFO A;  3Q8S B;  4QZB A;  2C2D A;  4O5K A;  4XUS A;  4KIT B;  8ICY A;  1QLN A;  5DDY A;  1ZQC A;  5J2K A;  1SL1 A;  2MUT B;  4M6W B;  3NGD A;  2BQU A;  2B21 A;  2ALZ A;  1RXV A;  2ZUC A;  1CEZ A;  3ISB A;  2V4R A;  1UT8 A;  2W9B A;  4M0A A;  1JX4 A;  4UB4 A;  4BDP A;  3PY8 A;  4KLH A;  9ICB A;  5DB9 A;  1PZN A;  3UXP A;  4O3Q A;  1U4B A;  4F5Q A;  4MF2 A;  2KFZ A;  3Q8P B;  2BCS A;  4FS1 A;  1SL2 A;  2HW3 A;  4PH5 A;  3N4M B;  4JK1 A;  2W9C B;  3OHB A;  2ISP A;  4M04 A;  7ICN A;  3RB6 A;  5KFG A;  4B9T A;  4IQW A;  7ICU A;  2F1I A;  4LZG A;  4GLX A;  3T5L A;  2R8G A;  1HUO A;  3OHA A;  8ICC A;  4YR0 A;  4YR3 A;  3PV8 A;  2AGQ A;  1TV9 A;  4IR9 A;  5KFB A;  1L3T A;  5KFN A;  1ZQQ A;  3C1Z A;  2BPG A;  4RQ1 A;  1TK5 A;  4ELV A;  4Q43 A;  5KFH A;  1A76 A;  4Z6F A;  2FPL A;  3QEA Z;  4M9N A;  2W8L A;  5DLF A;  1NKE A;  2R8J A;  3RJF A;  5KG4 A;  1BVS A;  1RZT A;  4DOB A;  5KT6 A;  3TI0 A;  2XY5 A;  4MF8 A;  2PI5 A;  2JEJ A;  4KLF A;  2XO7 A;  4RQ3 A;  2ZJ5 A;  4BXO A;  4RUC A;  3RH4 A;  4LZD A;  1T8E A;  4FBT A;  5KFL A;  1ZQV A;  3JPN A;  3TAP A;  1S77 D;  5DB6 A;  3GQC A;  3BQ2 A;  3SYZ A;  4O5E A;  5KFT A;  5IIL A;  5D4B A;  3EYZ A;  4QZH A;  2P6U A;  5KFA A;  3C2L A;  4I2C A;  2BHN A;  5J2B A;  8ICE A;  1KTQ A;  4J9K A;  4EBC A;  3QZ8 A;  4DS5 A;  1D9F A;  4M2Y A;  5CJ7 A;  4CCH A;  8ICL A;  8ICZ A;  3M8S A;  4RQ8 A;  4KLT A;  3Q8Q B;  4ECU A;  1ZQF A;  1Z00 A;  4MFA A;  1CUK A;  3OSN A;  3JPS A;  4ZH4 A;  3IM1 A;  2W9B B;  1NJX A;  4DL7 A;  4PHA A;  5IIM A;  4P4O A;  1TAQ A;  2Y1I A;  3PX4 A;  3PX6 A;  2BCQ A;  4C8N A;  4KLO A;  2I9G A;  4QZD A;  3H4B A;  5KG7 A;  5KFP A;  4F5O A;  1U49 A;  3Q8L A;  5EOZ A;  4NXZ A;  2ASL A;  3FDS A;  1LV5 A;  2PFO A;  3RR8 A;  3FYH A;  3T5H A;  4TUP A;  2FLN A;  4P2H A;  1RPL A;  3UQ2 A;  1XS9 D;  1XWL A;  4J9O A;  2ASJ A;  2V9W A;  2KTQ A;  9ICQ A;  5KFR A;  3RJJ A;  5KFF A;  4J9N A;  4M9J A;  4K4H A;  8ICS A;  5KT4 A;  4YVZ A;  4XQ8 A;  1TK8 A;  3M9M B;  2FPK A;  3EPG A;  3GIL A;  4O3S A;  2ZTC A;  3H8J A;  7ICK A;  5IIN A;  3PR4 A;  4YFK A;  5DG7 A;  4ELT A;  1ZJM A;  5KT2 A;  1XU4 A;  3GIJ A;  8ICJ A;  3BDP A;  4I2J A;  4KN4 A;  3BQ0 A;  1ZQW A;  4RT2 A;  1BGX T;  4RU9 A;  3RB4 A;  8ICO A;  2Q0Z X;  5IIJ A;  4F8R A;  3C21 A;  4QZF A;  3PVX A;  2ZJA A;  4DFK A;  5J2I A;  4B9U A;  4I2D A;  4K4G A;  4YCX A;  3V7J A;  4KLQ A;  2HHT A;  1Y88 A;  1S97 A;  2IMW P;  3EWA A;  4RNO A;  9ICK A;  1DOQ A;  3AU6 A;  1H38 A;  4RNM A;  1Z00 B;  3SV4 A;  3BJY A;  8ICX A;  4PPX A;  7ICM A;  4YG2 A;  1JN3 A;  3BQT A;  4F5P A;  3T5J A;  2VA2 A;  5J0T A;  4QZ8 A;  4C8K A;  9ICG A;  5L1I A;  3H8S A;  4K4I A;  3PW0 A;  9ICU A;  2XCA A;  1C7Y A;  5C5J A;  2BKE A;  2DFL A;  3MFI A;  3UQ0 A;  3TFS A;  3N97 B;  2BGW A;  3RJK A;  2R8I A;  1ZQN A;  5D46 A;  4IRD A;  3GIM A;  4NLK A;  5KFQ A;  5BPC A;  4IQV A;  4NY8 A;  3PMN A;  4F93 B;  4RPY A;  3GIK A;  1KLN A;  4ECX A;  3ISC A;  2ZUB A;  4RQ0 A;  1JXE A;  4DOC A;  4DF8 A;  1S0O A;  2UVR A;  4RUA A;  4RPZ A;  9ICO A;  2A1J A;  1UA1 A;  2UVW A;  3RJG A;  1JXL A;  2FMQ A;  1SZP A;  5J0Q A;  1ZET A;  3GV5 B;  9ICV A;  4ECV A;  4XRH A;  3M9O B;  1ZQO A;  3UXO A;  4BWJ A;  3RJE A;  1U47 A;  3H40 A;  4DEZ A;  3SZ2 A;  3V6K A;  5J2A A;  2MAX A;  2BQR A;  1X2I A;  4YR2 A;  4DL2 A;  2RDJ A;  3RH5 A;  3MR2 A;  2F1J A;  5DQG A;  4UAW A;  4DS4 A;  4DL5 A;  1ZQS A;  2J6U A;  4PHP A;  3RB3 A;  4RZR A;  3RAQ A;  1NK7 A;  5KG1 A;  3T5K A;  1SKR A;  3RBE A;  2J6S A;  4O5C A;  4XA5 A;  5HML A;  4UB5 A;  4QWB A;  3G6Y A;  4ECZ A;  1JIH A;  4YD1 A;  4DO9 A;  1NK9 A;  4J9S A;  4DSE A;  3PO4 A;  4ELU A;  3TFR A;  4F2S A;  2BQ3 A;  5CWR A;  2HVH A;  4TQR A;  1TAU A;  7ICT A;  5J0U A;  7ICE A;  2NRZ A;  4DFJ A;  4I2A A;  7ICV A;  1NK4 A;  1ZQH A;  3JPQ A;  4DL6 A;  4TUR A;  8ICK A;  4R63 A;  2NRV A;  4QWE A;  4B9V A;  3GFK B;  5DGB A;  1BPB A;  5DQH A;  2BR0 A;  3RAX A;  4ECW A;  7ICL A;  4B9N A;  3AU2 A;  3MDA A;  4FO6 A;  3H7I A;  2FLP A;  4R8U A;  3MAB A;  3JPP A;  3HW8 A;  4I2E A;  4EBD A;  1ZQE A;  5DLG A;  2JZB A;  2HHV A;  4P4P A;  3PR5 B;  2A1J B;  4PGQ A;  2LYH A;  4F92 B;  1S76 D;  3PO5 A;  1WCL A;  2R8H A;  2W9A A;  4KLL A;  5III A;  2FLL A;  4KLS A;  1UT5 A;  5CA7 A;  4HYK A;  3OJU A;  1S0M A;  3ORY A;  4F50 A;  1D8L A;  1TFR A;  3QEB Z;  4KLI A;  3Q8K A;  1UA0 A;  5BOL A;  3ZDA A;  1ZQY A;  1NKB A;  5J0P A;  4FS2 A;  9ICH A;  1ZQR A;  4Q45 A;  4YN4 A;  3PML A;  4M9H A;  4QZA A;  4O3O A;  4KLU A;  7ICJ A;  4MFC A;  1L3V A;  2UVU A;  5L1L A;  1XSN A;  4TUS A;  2BDP A;  5DGA A;  1L5U A;  4B9L A;  4DFP A;  5IIK A;  5EWG A;  3KHG A;  1ZJN A;  4RPX A;  4DSJ A;  2ZUD A;  2W8K A;  4TQS A;  3RRG A;  5KG5 A;  2V4Q A;  2ISO A;  1MSW D;  1ZQX A;  4R65 A;  5KT5 A;  4ED7 A;  4KLG A;  3KHH A;  4ECR A;  1KDH A;  1BPD A;  5KFY A;  4FBU A;  3PW4 A;  3TAR A;  4EZ6 A;  3V6H A;  2HHU A;  2ASD A;  1JMS A;  4LVS A;  9ICX A;  4YD2 A;  3RJI A;  9ICM A;  3LK9 A;  2W9M A;  3BQ1 A;  3LDA A;  1X9W A;  4G3I A;  2VA3 A;  3OJS A;  8ICW A;  9ICC A;  4RT3 A;  2ZJ8 A;  1QSY A;  4J9L A;  4B9M A;  3B0Y A;  8ICF A;  2H5X A;  3ZDE A;  5J0R A;  5J2G A;  1X9S A;  1WCN A;  3EW9 A;  5F9N A;  1RYR A;  3NTU A;  4BXO B;  4Q8F A;  5J0O A;  4DSI A;  5DG9 A;  2F1H A;  2NRW A;  4F5R A;  1ZQA A;  5BOM A;  2JZB B;  5DQI A;  3GII A;  5J2C A;  2C2R A;  2UVV A;  4PGX A;  2P66 A;  3SV3 A;  2JEI A;  4ED3 A;  4MFF A;  8ICG A;  3C1Y A;  2Y1J A;  3PNC A;  5KFU A;  2XGP A;  4DSK A;  4IR1 A;  2FMS A;  3MR5 A;  3MGI A;  3HP6 A;  2OWO A;  1D9D A;  9ICS A;  3HWT A;  3MGH A;  2XY7 A;  3SI8 A;  9ICF A;  7ICP A;  2DPJ A;  4I27 A;  4F4W A;  4GXI A;  1S9F A;  3C5F A;  3JPT A;  5DKW A;  5KFW A;  5J2D A;  3C23 A;  2RDI A;  4MEX A;  4IRC A;  4RQ2 A;  2NRT A;  5KFS A;  2AJQ A;  3G6V A;  1NJW A;  4UB3 A;  3E2E A;  1DGS A;  2XY6 A;  4R64 A;  1S0V A;  2JEG A;  3OGU A;  3ZDC A;  4JWN A;  2AGO A;  3MDC A;  4UB2 A;  3ZD8 A;  4Z6D A;  2KZ3 A;  2PI4 A;  4Q8E A;  1ZYQ A;  4DFM A;  2PFQ A;  1MC8 A;  4UB1 A;  5HP4 A;  1TK0 A;  9ICP A;  4C8O A;  2PFP A;  4F2R A;  8ICI A;  3PW2 A;  4RQ5 A;  1K1S A;  2NRX A;  5J29 A;  3HT3 A;  3PW5 A;  4YMO A;  3C2M A;  1ZQG A;  4KLE A;  1A77 A;  3ETL A;  1B22 A;  2XC9 A;  5L9X A;  2FPM A;  3C2K A;  1ZQI A;  4KTQ A;  8ICP A;  5KG2 A;  1ZQJ A;  5CHG A;  4O9M A;  9ICR A;  4I28 A;  1U48 A;  4NLG A;  1NK5 A;  9ICI A;  5KT3 A;  2M9N A;  5J0Y A;  2IHM A;  2PXI A;  4GC7 A;  4UBB A;  2IA6 A;  8ICB A;  3K75 D;  4ECT A;  8ICH A;  4QZE A;  1QSL A;  2VAN A;  2ATL A;  1HUZ A;  5J0W A;  3JPO A;  5HHH A;  1QSS A;  1NK8 A;  3MR3 A;  3C5G A;  4DQQ A;  1N56 A;  4EYI B;  5JUM A;  3RTV A;  3RB0 A;  5KFE A;  4YMM A;  5KFJ A;  4RNN A;  7ICH A;  1T7P A;  9ICN A;  4KN7 A;  1TVA A;  4NM2 A;  4J9R A;  4C8L A;  2HHS A;  3V7L A;  5HNK A;  8ICA A;  9ICE A;  3UPQ A;  1NKC A;  1XSP A;  1T4G A;  3IHQ B;  2FMP A;  5J2H A;  4ED6 A;  2C28 A;  5KFZ A;  4PGY A;  4O0I A;  3MR6 A;  4KLM A;  4NLN A;  7ICR A;  4JV0 A;  5KG6 A;  5KFM A;  9ICT A;  1ZQU A;  4O3N A;  4P4M A;  1SL0 A;  2KN7 A;  1IXR A;  4I2H A;  1ZQL A;  3K4G A;  4I29 A;  5KFK A;  2GWS A;  4BWM A;  2HHW A;  1NK0 A;  3EPI A;  2J6T A;  1X9M A;  3GV7 B;  5KG0 A;  3V72 A;  3LWM A;  4F91 B;  4JV1 A;  4KMU A;  4QZI A;  3M9N B;  4J9Q A;  4DQR A;  2JEF A;  4F3O A;  4O3R A;  4QZC A;  5HMM A;  4R66 A;  4NM1 A;  5CR0 A;  3QZ7 A;  9ICW A;  4DL4 A;  9ICJ A;  4RQ7 A;  4DWI A;  1KFD A;  4QWC A;  5KTQ A;  3HPO A;  4JWM A; 
#chains in the Genus database with same CATH topology
 4QZG A;  1L7N A;  3LYS A;  4QIW C;  2PFN A;  4QW8 A;  3FC4 A;  1COK A;  2MU2 A;  5DDM A;  4P0P A;  4NLZ A;  2BCV A;  1MQ3 A;  1KKX A;  1PVR A;  4UW9 A;  3R9K A;  2YX8 A;  5AHX A;  2DKX A;  4DSL A;  1S10 A;  3OSP A;  1ZOL A;  5AIC A;  5CB1 A;  1XSL A;  2LI6 A;  7ICG A;  2EH9 A;  2RHF A;  2K8B B;  5L1J A;  4AYB C;  3QXG A;  2WTF A;  3WKA A;  1SKW A;  4UAY A;  3ZDD A;  2MUT A;  4KLD A;  1KFS A;  4JV2 A;  2R8K A;  2W7P A;  3TAQ A;  4LJX A;  3EZ5 A;  4EBE A;  4UBC A;  4P0P B;  4ED8 A;  1BPX A;  1NOM A;  1ZQT A;  1B43 A;  4DQS A;  1NJY A;  1BPY A;  3UMB A;  3M8R A;  3Q8R B;  3QE9 Y;  1C20 A;  3MGV A;  1ZQB A;  5ALF A;  2ZXI A;  7ICQ A;  3H4D A;  1P7D A;  3QU4 A;  4ED1 A;  2FJ6 A;  4YXM A;  4YQW A;  8ICR A;  5JTI A;  3KHL A;  3TQ1 A;  1K1Q A;  2KP7 A;  2W3R A;  1QQ6 A;  5DBC A;  1IG6 A;  2P6R A;  3SAH A;  5KFO A;  8ICY A;  4B6J A;  5J2K A;  5ALG A;  2MUT B;  3M1Y A;  2HOF A;  1RXV A;  2DF4 B;  1UT8 A;  5AKK A;  3PY8 A;  2BCS A;  4PH5 A;  1DRG A;  4AP9 A;  4JK1 A;  2ISP A;  2Y0S C;  4B9T A;  2F2A B;  4PJ0 U;  5ALS A;  2F1I A;  4Y2V A;  1TV9 A;  4YR3 A;  3PV8 A;  2IOF K;  5AKZ A;  5KFB A;  2W04 A;  1FFV A;  2BPG A;  4RQ1 A;  4ELV A;  4Z6F A;  3QEA Z;  3L5K A;  2W8L A;  3FM9 A;  1NKE A;  3RJF A;  4DOB A;  2XY5 A;  4MF8 A;  2JEJ A;  4RUC A;  1N5X A;  3SMV A;  5KFT A;  5D4B A;  2ODG A;  3BZK A;  5J2B A;  1KTQ A;  8ICZ A;  4DS5 A;  4M2Y A;  4RQM A;  3Q8Q B;  2E1E A;  2EZX A;  1ZQF A;  3JPS A;  3OTQ A;  5ALI A;  4ZH4 A;  2Y1I A;  1ZD5 A;  3PX6 A;  4Y2P A;  4F5O A;  3Q8L A;  5EOZ A;  2KHV A;  3ICX A;  2ASL A;  2WF8 A;  1SV0 C;  1RPL A;  5AM1 A;  2VIX A;  9ICQ A;  3RJJ A;  5L1M A;  5KFF A;  1AQ6 A;  5K4L A;  2WB1 C;  3EPG A;  5EE9 A;  3H8J A;  7ICK A;  1PVP A;  4MHV A;  4YFK A;  1T3Q A;  1ZXI A;  2WF7 A;  1SWW A;  3SR6 A;  5KT2 A;  8ICJ A;  3BQ0 A;  5AKY A;  1WWU A;  4BX9 C;  1SXD A;  4F8R A;  2ZJA A;  2K8C B;  4B9U A;  4I2D A;  2F77 X;  4OJO A;  1Y88 A;  1S97 A;  2IMW P;  1H38 A;  4Y2U A;  2ZIU A;  8ICX A;  2MRL A;  7ICM A;  1DGJ A;  4YG2 A;  3T5J A;  5J0T A;  4PL2 A;  2OHF A;  1N60 A;  4C8K A;  3H8S A;  2JMG A;  4NWI A;  4OJ5 A;  5C5J A;  3J81 j;  3N97 B;  2G08 A;  3RJK A;  1LVH A;  2R8I A;  1X42 A;  5D46 A;  5KFQ A;  2YB1 A;  4RQ0 A;  2OH2 A;  3AMZ A;  4RUA A;  4RPZ A;  3LVW A;  2XI9 A;  3GV5 B;  3M9O B;  4BWJ A;  3RJE A;  4PZO A;  3V6K A;  5ALO A;  5KAF U;  4DCC A;  2YN4 A;  2KJ9 A;  5HR7 A;  5DQG A;  1ZQS A;  4DL5 A;  2J6U A;  3RB3 A;  3RAQ A;  2J6S A;  2W55 A;  3RBE A;  4XA5 A;  5AM2 A;  3F2C A;  3ED5 A;  2E5S A;  4QWB A;  3PO4 A;  3NRZ A;  2FI1 A;  1NK9 A;  4DSE A;  2DWQ A;  4F2S A;  3TFR A;  4UB6 U;  1NZP A;  4TQR A;  2ZIU B;  3TAC B;  1NK4 A;  3JPQ A;  4DL6 A;  4B9V A;  3GFK B;  5DGB A;  1Z1B A;  7ICL A;  3HJE A;  3JPP A;  3HW8 A;  4I2E A;  4CF3 A;  5J8Y C;  3PR5 B;  4PGQ A;  3NRW A;  4F92 B;  2FLL A;  1UT5 A;  4HYK A;  4F50 A;  2EAP A;  3QEB Z;  5BOL A;  1RDF A;  1ZQY A;  1ZQR A;  4Q45 A;  1RQN A;  4M9H A;  3QX7 A;  2I5H A;  1ZJN A;  2HI0 A;  1TE2 A;  2ZUD A;  2W8K A;  4TQS A;  3RRG A;  2V4Q A;  1MSW D;  1ZQX A;  2B0C A;  4FBU A;  3TAR A;  3V6H A;  2RP5 A;  3NVZ A;  5GTH U;  5JU5 A;  3M7D A;  4YD2 A;  2W9M A;  1B4F A;  8ICW A;  5AIB A;  2YMP A;  3IV6 A;  1Z4N A;  3UMG A;  5J2G A;  1RYR A;  4BXO B;  5J0O A;  4DSI A;  2KKP A;  3KKA C;  2P66 A;  8ICG A;  4ED3 A;  4MFF A;  3E58 A;  3C1Y A;  2Y1J A;  1SV0 A;  2XGP A;  4IR1 A;  2PMZ C;  3QNM A;  3MR5 A;  4Y2S A;  1D9D A;  1D8B A;  3HWT A;  3LVV A;  2XY7 A;  9ICF A;  4I27 A;  2ZIW A;  4F4W A;  2MSN A;  4GXI A;  4EX7 A;  5J2D A;  2RDI A;  2G5I B;  2XY6 A;  1S0V A;  2JEG A;  1L8L A;  4KX5 A;  1CRX A;  2BDU A;  2PFQ A;  2F44 A;  1K5O A;  2QB1 A;  2PFP A;  4F2R A;  3PW2 A;  4RQ5 A;  1K1S A;  2NRX A;  5J29 A;  3PW5 A;  3C2M A;  3ETL A;  1B22 A;  3C2K A;  4C7Y A;  2CPR A;  3BZC A;  1Q3U A;  4I28 A;  1WG8 A;  2DUY A;  2Q4T A;  4GC7 A;  2IA6 A;  3K75 D;  2W3S A;  5ALN A;  1HUZ A;  5J0W A;  5ALK A;  5HHH A;  1NK8 A;  4WJ3 B;  2VKQ A;  3M6Z A;  5KFJ A;  4KN7 A;  4NM2 A;  1Q46 A;  1SGG A;  5ALL A;  1SXE A;  2ZIW B;  4NLN A;  4JV0 A;  5KFM A;  4U6P A;  1SL0 A;  1FIQ A;  4I2H A;  3K4G A;  5ALJ A;  1NK0 A;  3EPI A;  1KBU A;  3HKZ F;  3GV7 B;  5KG0 A;  5H2F U;  3M9N B;  2JH7 A;  4F3O A;  4O3R A;  4QZC A;  5CR0 A;  1KFD A;  4QWC A;  3QU9 A;  4CDG A;  2AQ0 A;  2EZZ A;  2M0N A;  5EE3 A;  5J2F A;  5FP0 A;  4DLE A;  5AKH A;  2BCU A;  5KFD A;  1MA7 A;  4F4X A;  4DQI A;  4USA A;  3RR7 A;  2R18 A;  3IP4 B;  2F76 X;  1PVQ A;  4GXJ A;  1QQ7 A;  7ICO A;  8ICT A;  3D2S A;  5EWF A;  3ZD9 A;  4QWD A;  5J8Y A;  5J0X A;  1RYS A;  1L3U A;  4US8 A;  3AUO A;  2K4H A;  3ZI4 A;  5DB7 A;  2G09 A;  1XC9 A;  5AI8 A;  1N63 A;  3S6J A;  2F8K A;  4RQ4 A;  3N7P D;  4Q44 A;  1BPE A;  8ICQ A;  5KFC A;  4C8M A;  2C2E A;  2BCR A;  2A19 A;  5EE0 A;  4OJL A;  2BPF A;  1JAL A;  3KTQ A;  2VA8 A;  2ZIV A;  2HVI A;  5KFX A;  1IM4 A;  4GC6 A;  1WWV A;  5F9L A;  3F5A A;  4Y2Q A;  1D8Y A;  8ICV A;  4M6W A;  4QJF B;  3ISD A;  4JUZ A;  3JPR A;  2C22 A;  4JMU A;  2KZZ A;  2K4P A;  1ARO P;  2KK0 A;  3RJH A;  4C8O A;  5AI6 A;  5KFV A;  4Z6E A;  7ICF A;  1ZQK A;  4ACO A;  1TKD A;  4I2B A;  4Z6C A;  4ECS A;  1ECW A;  3A0B U;  3V7K A;  5J2E A;  4ECY A;  4IQT A;  3KKA A;  2XID A;  1BNP A;  3N7S C;  4TUQ A;  4J9P A;  2AGP A;  2W7O A;  4YMN A;  1LB2 B;  1ZQZ A;  2XGQ A;  4BGD A;  5DBA A;  5ALR A;  4EEY A;  4UQG A;  4GIB A;  2ZXH A;  3IDW A;  5AKG A;  4UAZ A;  5AM4 A;  2YMM A;  3Q8S B;  4XUS A;  2NV3 A;  2HBJ A;  4M6W B;  3AEV A;  2B21 A;  2ALZ A;  2ZUC A;  1CEZ A;  4Y2T A;  4M0A A;  4BDP A;  9ICB A;  5DB9 A;  1PZN A;  4O3Q A;  1U4B A;  1PK1 B;  2KG5 A;  7ICN A;  4M04 A;  4IQW A;  2IOF A;  5KFG A;  2G0A A;  5EE1 A;  3T5L A;  2R8G A;  2AGQ A;  3C1Z A;  4Q43 A;  1A76 A;  5KG4 A;  1HIW A;  1RZT A;  5KT6 A;  3TI0 A;  2PI5 A;  2XO7 A;  3TAP A;  1S77 D;  3SYZ A;  5IIL A;  5GTI U;  3EYZ A;  5CEH A;  3PSI A;  5ALY A;  8ICE A;  5ALP A;  4J9K A;  1D9F A;  3AQE A;  4CCH A;  4ECU A;  2MA1 A;  1NJX A;  4IL6 U;  4PHA A;  5IIM A;  1TAQ A;  3U26 A;  4FZN A;  3RR8 A;  1IV8 A;  4P2H A;  3UQ2 A;  2KV2 A;  4J9O A;  2ASJ A;  4J9N A;  1J97 A;  4K4H A;  8ICS A;  4YVZ A;  4XQ8 A;  2FPK A;  4OJ6 A;  4O3S A;  2ZTC A;  2LM4 A;  3AM9 A;  1ZJM A;  4O3M A;  3GIJ A;  3SD7 A;  1ZQW A;  5JRT A;  4DFK A;  2HDO A;  4US9 A;  5KL1 B;  2QLT A;  1YZ6 A;  1DOQ A;  3BJY A;  5T14 A;  3BQT A;  5AKJ A;  5L1I A;  3PW0 A;  2XCA A;  3MFI A;  3UQ0 A;  3TFS A;  2BGW A;  3GIM A;  5BPC A;  1JI7 A;  1KLN A;  3ISC A;  4DOC A;  1S0O A;  2B6G A;  2JR5 A;  2A1J A;  1UA1 A;  2UVW A;  2H3I A;  4ECV A;  3UXO A;  4UB8 U;  3SZ2 A;  2YML A;  5J2A A;  2OM6 A;  2BQR A;  3QUT A;  2RDJ A;  2K4E A;  1JRP A;  5AM0 A;  2KEY A;  1NK7 A;  1SKR A;  5KG1 A;  3SEI A;  3QU7 A;  4UB5 A;  1RYU A;  3G6Y A;  4YD1 A;  2YB4 A;  4ECZ A;  4J9S A;  2HVH A;  1O03 A;  2BQ3 A;  5CWR A;  2KKV A;  2NRZ A;  4DFJ A;  1ZQH A;  4OCZ A;  5AI9 A;  3GU3 A;  2EQY A;  3RAX A;  2KHQ A;  1N5W A;  4ECW A;  2HOQ A;  3QU2 A;  1RM6 C;  4R8U A;  1O08 A;  1ZD4 A;  1ZQE A;  5DLG A;  4P4P A;  2A1J B;  1N62 A;  2R8H A;  4KLS A;  2LHT A;  1S0M A;  3WU2 U;  3IRU A;  3Q8K A;  1UA0 A;  5J0P A;  2G06 A;  3CYM A;  4KLU A;  2UVU A;  2BDP A;  5IIK A;  2XIC A;  3KHG A;  1SWV A;  5KT5 A;  4KLG A;  3KBB A;  3KHH A;  4CF5 A;  1F0M A;  2HHU A;  1JMS A;  4LVS A;  5AM5 A;  9ICX A;  3RJI A;  2RRD A;  2Y9U A;  1UQV A;  4CGZ A;  2KNJ A;  2VA3 A;  1ZD2 P;  2ES6 A;  9ICC A;  2JRZ A;  2ZJ8 A;  4CRX A;  5B5E U;  4B9M A;  3B0Y A;  3WK9 A;  3ZDE A;  2KJ8 A;  5J0R A;  4C4R A;  1WCN A;  3EW9 A;  4Q8F A;  3NTU A;  2KIW A;  5DG9 A;  2NRW A;  4F5R A;  3NAS A;  5AI0 A;  5DQI A;  5J2C A;  2C2R A;  2KVC A;  3PNC A;  5KFU A;  3QU5 A;  1PUZ A;  1QH9 A;  4UAV A;  3HP6 A;  9ICS A;  3TKA A;  2ZG6 A;  3SI8 A;  2DPJ A;  1IIP A;  3C5F A;  3JPT A;  4RQ2 A;  4GFJ A;  2NRT A;  1X9X A;  5ALE A;  2EAM A;  4R64 A;  2OEH A;  3DDH A;  3ZD8 A;  4Q8E A;  1ZYQ A;  4DFM A;  4KMO B;  5HP4 A;  5ALT A;  4C4S A;  1TK0 A;  2W54 A;  8ICI A;  3HT3 A;  2CXY A;  1A77 A;  2XC9 A;  3B9J A;  4FFD A;  2KMD A;  4NLG A;  1NK5 A;  4UBB A;  4ECT A;  2OXO A;  1QSL A;  2VAN A;  2ATL A;  1QSS A;  4DQQ A;  1N56 A;  4EYI B;  2H3V A;  4RNN A;  1T7P A;  3F2D A;  3UPQ A;  3IHQ B;  2FMP A;  4ED6 A;  5KFZ A;  4O0I A;  4O3N A;  5AK3 A;  4P4M A;  1IXR A;  1ZQL A;  4I29 A;  2JHD A;  4UAT A;  3V72 A;  3LWM A;  3RFA A;  4PZN A;  4FZM A;  4J9Q A;  2JEF A;  1ZQ1 C;  2DBY A;  3QZ7 A;  5AI5 A;  9ICJ A;  3HPO A;  4CNQ A;  4JWM A;  5IIO A;  4ED0 A;  2KJ5 A;  4NV0 A;  2F8L A;  4RQ6 A;  3UXN A;  3GV8 B;  4GXK A;  4DSF A;  8ICN A;  3V6J A;  5DB8 A;  5B66 U;  4IRK A;  1U9L A;  3SAF A;  8ICU A;  5CRX A;  4EX6 A;  4MEY A;  4BUG A;  4QWA A;  4F4K A;  1L3S A;  3RBD A;  9ICA A;  3I28 A;  1Z1V A;  4J9M A;  2K60 A;  4DF4 A;  2ZTE A;  2IBK A;  1X40 A;  4EEK A;  3F53 A;  5AK5 A;  4PHE A;  2FDR A;  3PX0 A;  5AKL A;  2GH1 A;  4DLG A;  2HBL A;  5D49 A;  2BPC A;  2DPI A;  1HJP A;  3HKZ C;  3BQ7 A;  2QAR A;  1L7M A;  4C0Z A;  3RH6 A;  4PHD A;  1BPZ A;  2W11 A;  3GDX A;  1ZQM A;  4X5V A;  5HR6 A;  2EAO A;  4EEL A;  7ICS A;  4I2F A;  4IQU A;  4ED2 A;  4DL3 A;  1N48 A;  2CRX A;  4YXJ A;  2AHO B;  4DQP A;  5KG3 A;  8ICM A;  1S0N A;  2NYV A;  2O6K A;  4I2I A;  4F4Z A;  4E0D A;  3B0X A;  3T3F A;  1NK6 A;  2IHN A;  1LKY A;  4O5K A;  5DDY A;  2DGZ A;  2WF5 A;  4IS7 A;  1SL1 A;  3F5E A;  1PK3 A;  2LBO A;  2BQU A;  2JGA A;  4NL9 C;  3H0M B;  2V4R A;  2W9B A;  3QYP A;  1KL9 A;  2YY6 A;  2AXT U;  4F5Q A;  2KFZ A;  1SL2 A;  2QAR B;  7ICU A;  4CF4 A;  4GLX A;  1HUO A;  3OHA A;  1ZQQ A;  1TK5 A;  5KFH A;  4M9N A;  2YTU A;  5DLF A;  3IN5 A;  3ETR A;  2VJ5 A;  1S8O A;  2ZJ5 A;  2WF6 A;  3SEN A;  4FBT A;  1ZQV A;  3JPN A;  3GQC A;  4O5E A;  2WAQ F;  2P6U A;  1V85 A;  5KFA A;  1LKY B;  2BHN A;  4I2C A;  4EBC A;  3C28 A;  8ICL A;  4U7C A;  4RQ8 A;  4KLT A;  1Z00 A;  3OSN A;  1CUK A;  2W9B B;  4DL7 A;  2BCQ A;  4P4O A;  4QZD A;  3H4B A;  5KFP A;  4NXZ A;  3FDS A;  2PFO A;  2KVS A;  3L4P A;  1QQ5 A;  3T5H A;  4TUP A;  1XWL A;  5KNI A;  2KOB A;  4FZL A;  2KTQ A;  5KFR A;  3WK8 A;  3M9M B;  2KIC A;  5AK6 A;  5IIN A;  3PR4 A;  4P0Q A;  1X66 A;  1ZRN A;  3I1Y A;  5C0Y A;  3BDP A;  4I2J A;  5AM3 A;  2G5H B;  3RF9 A;  1BGX T;  4RU9 A;  2Z7J A;  3RB4 A;  5IIJ A;  4C7Z A;  4QZF A;  3QUB A;  4OO1 J;  2DQN B;  5G5H A;  4K4G A;  4KLQ A;  2HHT A;  3EWA A;  4RNO A;  9ICK A;  3AU6 A;  1Z00 B;  3SV4 A;  4PPX A;  3H8M A;  4QZ8 A;  2WHE A;  3PSF A;  1WUD A;  4IRD A;  4IQV A;  3GIK A;  4ECX A;  1L8O A;  3IG5 A;  2UVR A;  2ZIV B;  5ALD A;  1YT3 A;  1SZP A;  3NS1 A;  1ZET A;  2A1A A;  1ZQO A;  3H40 A;  4DEZ A;  4P0Q B;  1NI3 A;  4C4T A;  3WKC A;  1XNS A;  3RH5 A;  1CI4 A;  4DS4 A;  2EZY A;  4RZR A;  3T5K A;  2QB0 A;  1JIH A;  4ELU A;  3AL0 B;  3SAG A;  1TAU A;  2D3D A;  5J0U A;  7ICV A;  1BPB A;  2L5Y A;  5DQH A;  1J2N A;  2GLE A;  4B9N A;  3AU2 A;  3MDA A;  4NL9 A;  1L7O A;  3H7I A;  5AKE A;  2FLP A;  3O0F A;  2E8N A;  3NUQ A;  4EBD A;  2JZB A;  2HHV A;  2LYH A;  1S76 D;  3PO5 A;  2W9A A;  5III A;  2NO5 A;  1QCK A;  3ORY A;  1D8L A;  3NVV A;  1TFR A;  4KLI A;  2DKZ A;  2HCF A;  9ICH A;  4YN4 A;  4QZA A;  4O3O A;  4MFC A;  2W43 A;  5L1L A;  1XSN A;  4TUS A;  4B9L A;  1L7P A;  4DFP A;  3CP8 A;  2A3V A;  4RPX A;  5AK4 A;  2QB0 B;  5KG5 A;  4R65 A;  4ECR A;  3TAD C;  3T79 A;  1BPD A;  1KDH A;  4QNL A;  5KFY A;  2ASD A;  9ICM A;  3LK9 A;  3BQ1 A;  3LDA A;  3OJS A;  2F3N A;  4Y2J A;  4RT3 A;  1QSY A;  1X6I A;  1X6J A;  5F9N A;  2OCE A;  2F1H A;  2H3Z A;  1DXS A;  2JZB B;  2N1R A;  3GII A;  4PGX A;  2JV3 A;  4DFD A;  2JEI A;  2E3T A;  2FMS A;  2OWO A;  2KE7 A;  3D6J A;  3MGH A;  7ICP A;  1OXJ A;  2LYB A;  1XO0 A;  2BZF A;  2I6X A;  4QIW F;  5DKW A;  4IRC A;  1URJ A;  5A0L A;  5KFS A;  2KD1 A;  3VCB A;  4UB3 A;  2CN1 A;  1DGS A;  3E2E A;  3SQI A;  3DEE A;  4JWN A;  2AGO A;  3MDC A;  4UB2 A;  3E0F A;  2PI4 A;  1MC8 A;  2YQE A;  9ICP A;  5F3X B;  1M6Y A;  4JB3 A;  1JUD A;  1OUQ A;  1UCV A;  1ZQI A;  8ICP A;  4KTQ A;  5CHG A;  9ICR A;  1RG6 A;  5KT3 A;  2M9N A;  5J0Y A;  8ICH A;  2D6F C;  4QZE A;  4Y2X A;  3MR3 A;  3C5G A;  1Q8K A;  3RB0 A;  3RTV A;  4AYB F;  7ICH A;  9ICN A;  1V97 A;  2HHS A;  4C8L A;  3V7L A;  5HNK A;  8ICA A;  1NKC A;  1XSP A;  1T4G A;  3D2N A;  4ICA A;  5J2H A;  4KLM A;  3MR6 A;  1ZRM A;  1ZQU A;  3MC1 A;  2KN7 A;  3PST A;  5ALH A;  4BWM A;  2J6T A;  2LM1 A;  3WK5 A;  4F91 B;  4JV1 A;  2K89 A;  4DQR A;  3CRX A;  1T94 A;  9ICW A;  4DL4 A;  4RQ7 A;  5KTQ A;  5CP2 A;  5J0S A;  2ZTD A;  4M9G A;  3M6K A;  3Q8M A;  1V9P A;  9ICL A;  5DG8 A;  1V38 A;  1NZB A;  3IG8 A;  2HSZ A;  3KZX A;  2WFA A;  4O3P A;  3LWL A;  4EZ9 A;  5AKX A;  2ESE A;  3PW7 A;  4F72 A;  2HBK A;  3HX0 A;  1ZD3 A;  1ZQD A;  2XCP A;  3KFU F;  1XO1 A;  3THV A;  3AQF A;  4HAI A;  1NJZ A;  2HHQ A;  2KZM A;  2KFN A;  1U45 A;  5ALQ A;  3UMC A;  2I1Q A;  3NVY A;  3VC8 A;  1UPH A;  2XVT A;  3G6X A;  3ZDB A;  1B0X A;  5G5G A;  2Y0S F;  1MN8 A;  4R8U B;  3KHR A;  5TZV A;  3MBY A;  1EXN A;  3H8W A;  3RRH A;  3WKD A;  7ICI A;  1T3N A;  5HHI A;  3BS7 A;  2LKY A;  3PSP A;  3WK6 A;  3MFH A;  2KIV A;  3TAD A;  1KSP A;  4G9B A;  3N7R C;  2ZIX A;  4ECQ A;  2LPE A;  4I2G A;  4QW9 A;  3GZF A;  5EWE A;  1MQ2 A;  1KEJ A;  1VDV A;  2W9C A;  2AQ4 A;  3ONN A;  1ZQP A;  5L1K A;  5KT7 A;  4F5N A;  3NVW A;  2K4I A;  3H0R B;  1RXW A;  2AU0 A;  1QTM A;  3TAN A;  4YP3 A;  4M9L A;  5KFI A;  4EYH B;  1SKS A;  1N61 A;  4M47 A;  4UAU A;  3ALR A;  1KRP A;  4QZ9 A;  2HOI A;  4KLJ A;  3I76 A;  5DBB A;  1KFT A;  4F4Y A;  1COO A;  4DOA A;  4PL1 A;  4B9S A;  2HHX A;  1A6S A;  1Z3E B;  5J2J A;  2C2D A;  4QZB A;  5ALX A;  3BS5 A;  4KIT B;  5TIS U;  1QLN A;  1ZQC A;  2WB1 F;  1FEZ A;  2IOH A;  2ZIX B;  1SB3 C;  3NGD A;  2GOL A;  3ISB A;  1JX4 A;  2W03 A;  4UB4 A;  4KLH A;  3UXP A;  5AKI A;  4MF2 A;  2OYY A;  3Q8P B;  4FS1 A;  2HW3 A;  3N4M B;  2W9C B;  3OHB A;  3RB6 A;  1JRO A;  1DK3 A;  4LZG A;  8ICC A;  2LYA A;  4YR0 A;  4ZOH C;  4IR9 A;  1L3T A;  4CE6 A;  5KFN A;  4C80 A;  2FPL A;  3HIL A;  1N2X A;  4J03 A;  2EAN A;  3D2Q A;  2R8J A;  2DL0 A;  1BVS A;  4KLF A;  1KN5 A;  5KL8 B;  4RQ3 A;  4BXO A;  2RQ5 A;  3EUB 2;  5ALZ A;  4LZD A;  3RH4 A;  1T8E A;  4OJP A;  5KFL A;  5DB6 A;  3BQ2 A;  2VJ4 A;  3K1Z A;  1YZ7 A;  4QZH A;  5ALW A;  3C2L A;  2YMQ A;  3BS5 B;  3A0H U;  1Z4O A;  3QZ8 A;  5CJ7 A;  3M8S A;  4MFA A;  3IM1 A;  3PX4 A;  4KLO A;  4C8N A;  2I9G A;  5KG7 A;  1A0P A;  1U49 A;  5KAI U;  4KX3 A;  1LV5 A;  3CW2 C;  3FYH A;  2FLN A;  1XS9 D;  4IC9 A;  2V9W A;  4UAS A;  4M9J A;  5KT4 A;  1TK8 A;  3GIL A;  1GO3 F;  3C29 A;  5DG7 A;  4ELT A;  1XU4 A;  4KN4 A;  1F5S A;  4RT2 A;  2KSO A;  8ICO A;  4BJQ A;  2Q0Z X;  3C21 A;  3PVX A;  5J2I A;  4YCX A;  3V7J A;  2FE9 A;  3DV9 A;  4RNM A;  1NNL A;  2LMR A;  1JN3 A;  4F5P A;  2VA2 A;  1RQL A;  2HBM A;  5AI4 A;  9ICG A;  4K4I A;  9ICU A;  1C7Y A;  1S5L U;  2BKE A;  2DFL A;  5E79 U;  4NLB A;  1ZQN A;  4NLK A;  4NY8 A;  3PMN A;  1F44 A;  2K8A A;  1VLB A;  2WAQ C;  2P35 A;  4F93 B;  4RPY A;  2ZUB A;  1JXE A;  4DF8 A;  1OW5 A;  9ICO A;  3RJG A;  1JXL A;  2FMQ A;  4EEN A;  5J0Q A;  9ICV A;  3KOO A;  4RQN A;  4XRH A;  1U47 A;  2MAX A;  3AN1 A;  1X2I A;  4YR2 A;  4DL2 A;  3MR2 A;  2F1J A;  2KSO B;  4UAW A;  3WKE A;  4PHP A;  2PKE A;  1SV4 A;  4O5C A;  5HML A;  1L6N A;  4DO9 A;  2H3Q A;  5ALV A;  4A8E A;  7ICT A;  2PMZ F;  7ICE A;  4Y2Y A;  4I2A A;  1HEK A;  1Z19 A;  4TUR A;  1Q3V A;  8ICK A;  4R63 A;  2NRV A;  4QWE A;  4Y2R A;  3QUQ A;  2H3F A;  2BR0 A;  3KD3 A;  2G07 A;  4FO6 A;  3MAB A;  2E8O A;  2E8M A;  3WK7 A;  2JXJ A;  4NJ8 A;  1WCL A;  4KLL A;  5CA7 A;  2RLT A;  3QUC A;  3OJU A;  2HMX A;  3ZDA A;  1UHU A;  1NKB A;  4OD0 A;  1BNO A;  4FS2 A;  1ED1 A;  1KQQ A;  3PML A;  7ICJ A;  1L3V A;  5DGA A;  1L5U A;  5EWG A;  4DSJ A;  2D8C A;  2ISO A;  4ED7 A;  3PW4 A;  4EZ6 A;  1X9W A;  2AH5 A;  4G3I A;  1WYG A;  2NO4 A;  4FE3 A;  4J9L A;  8ICF A;  2H5X A;  3FAH A;  1X9S A;  1SZH A;  2GO7 A;  1ZQA A;  5BOM A;  2UVV A;  3SV3 A;  3KZI U;  3WKB A;  4DSK A;  3MGI A;  3PZP A;  4NLC A;  3CNH A;  1S9F A;  3H0L B;  5KFW A;  3C23 A;  4MEX A;  1TAM A;  3WK4 A;  2AJQ A;  1KW4 A;  2E8P A;  3G6V A;  1NJW A;  1PK1 A;  1VJ5 A;  2WF9 A;  3OGU A;  3ZDC A;  4Z6D A;  2KZ3 A;  4UB1 A;  5ALU A;  1FO4 A;  1SIJ A;  4YMO A;  1ZQG A;  4KLE A;  5AIA A;  5L9X A;  2FPM A;  2EDU A;  5KG2 A;  1ZQJ A;  4O9M A;  3HRD D;  1U48 A;  9ICI A;  2IHM A;  4UAR A;  2PXI A;  2JH1 A;  8ICB A;  4F71 A;  3K1R B;  3JPO A;  3UM9 A;  5JUM A;  5KFE A;  4YMM A;  2E1F A;  1FFU A;  1TVA A;  4J9R A;  9ICE A;  2C28 A;  4PGY A;  7ICR A;  3F2B A;  5KG6 A;  9ICT A;  1DK2 A;  3OPX A;  2QKQ A;  5KFK A;  2GWS A;  1J2M A;  2HHW A;  1X9M A;  4KMU A;  4QZI A;  3L3F X;  5ALM A;  5HMM A;  4R66 A;  4NM1 A;  2Y9T A;  4DWI A;  3N28 A; 
#chains in the Genus database with same CATH homology
 5CP2 A;  5J0S A;  2ZTD A;  4QZG A;  2AQ0 A;  4M9G A;  5IIO A;  4ED0 A;  5J2F A;  3Q8M A;  1V9P A;  2PFN A;  9ICL A;  4QW8 A;  4DLE A;  2BCU A;  5KFD A;  5DG8 A;  4F4X A;  4DQI A;  5DDM A;  4RQ6 A;  4O3P A;  3LWL A;  3RR7 A;  4EZ9 A;  4NLZ A;  3UXN A;  2BCV A;  3GV8 B;  4GXK A;  4DSF A;  1MQ3 A;  3PW7 A;  8ICN A;  3V6J A;  5DB8 A;  3HX0 A;  4GXJ A;  4IRK A;  1ZQD A;  2XCP A;  1U9L A;  7ICO A;  8ICT A;  5EWF A;  1XO1 A;  3ZD9 A;  5J0X A;  4QWD A;  1RYS A;  1L3U A;  3AUO A;  3THV A;  8ICU A;  5DB7 A;  1NJZ A;  2HHQ A;  2KZM A;  2KFN A;  1U45 A;  4DSL A;  4MEY A;  1S10 A;  3OSP A;  5CB1 A;  1XC9 A;  2I1Q A;  4QWA A;  1XSL A;  4RQ4 A;  4F4K A;  4Q44 A;  3G6X A;  1BPE A;  7ICG A;  3ZDB A;  1L3S A;  4R8U B;  5KFC A;  3KHR A;  4C8M A;  5TZV A;  3RBD A;  2C2E A;  2BCR A;  9ICA A;  8ICQ A;  3MBY A;  1EXN A;  3H8W A;  5L1J A;  2BPF A;  3RRH A;  4J9M A;  2WTF A;  3KTQ A;  2VA8 A;  7ICI A;  2HVI A;  1T3N A;  1SKW A;  5KFX A;  1IM4 A;  5HHI A;  3MFH A;  4GC6 A;  4UAY A;  5F9L A;  4DF4 A;  1D8Y A;  1KSP A;  2ZTE A;  2IBK A;  8ICV A;  3ZDD A;  2MUT A;  4M6W A;  4ECQ A;  4KLD A;  1KFS A;  4JV2 A;  4PHE A;  3ISD A;  2R8K A;  4JUZ A;  3JPR A;  3PX0 A;  2C22 A;  4I2G A;  2KZZ A;  5D49 A;  1ARO P;  4DLG A;  3TAQ A;  4QW9 A;  3EZ5 A;  4EBE A;  5EWE A;  4UBC A;  4ED8 A;  2BPC A;  2DPI A;  3RJH A;  1HJP A;  1MQ2 A;  1BPX A;  1NOM A;  1KEJ A;  5KFV A;  1B43 A;  2W9C A;  4DQS A;  2AQ4 A;  1ZQT A;  1NJY A;  4Z6E A;  5L1K A;  3M8R A;  1BPY A;  1ZQP A;  7ICF A;  5KT7 A;  4PHD A;  3RH6 A;  4F5N A;  3Q8R B;  1BPZ A;  1TKD A;  1ZQK A;  4I2B A;  1RXW A;  4Z6C A;  3GDX A;  1ZQM A;  4ECS A;  3QE9 Y;  4X5V A;  2AU0 A;  1QTM A;  3TAN A;  3V7K A;  4YP3 A;  5J2E A;  4ECY A;  4IQT A;  1ZQB A;  5KFI A;  4M9L A;  7ICS A;  4I2F A;  7ICQ A;  3H4D A;  4IQU A;  4ED2 A;  4TUQ A;  4EYH B;  4ED1 A;  4DL3 A;  1N48 A;  4J9P A;  4YXJ A;  1SKS A;  4YXM A;  4YQW A;  2AGP A;  4DQP A;  8ICR A;  4M47 A;  3KHL A;  5KG3 A;  4YMN A;  3TQ1 A;  1LB2 B;  1KRP A;  1K1Q A;  4QZ9 A;  1ZQZ A;  2XGQ A;  4KLJ A;  5DBB A;  1KFT A;  4BGD A;  5DBA A;  4F4Y A;  8ICM A;  4EEY A;  1S0N A;  4UQG A;  1COO A;  4I2I A;  4DOA A;  4F4Z A;  4B9S A;  4E0D A;  5DBC A;  2HHX A;  3B0X A;  4UAZ A;  3T3F A;  2P6R A;  1NK6 A;  2IHN A;  1Z3E B;  5J2J A;  5KFO A;  3Q8S B;  4QZB A;  2C2D A;  4O5K A;  4XUS A;  4KIT B;  8ICY A;  1QLN A;  5DDY A;  1ZQC A;  5J2K A;  1SL1 A;  2MUT B;  4M6W B;  3NGD A;  2BQU A;  2B21 A;  2ALZ A;  1RXV A;  2ZUC A;  1CEZ A;  3ISB A;  2V4R A;  1UT8 A;  2W9B A;  4M0A A;  1JX4 A;  4UB4 A;  4BDP A;  3PY8 A;  4KLH A;  9ICB A;  5DB9 A;  1PZN A;  3UXP A;  4O3Q A;  1U4B A;  4F5Q A;  4MF2 A;  2KFZ A;  3Q8P B;  2BCS A;  4FS1 A;  1SL2 A;  2HW3 A;  4PH5 A;  3N4M B;  4JK1 A;  2W9C B;  3OHB A;  2ISP A;  4M04 A;  7ICN A;  3RB6 A;  5KFG A;  4B9T A;  4IQW A;  7ICU A;  2F1I A;  4LZG A;  4GLX A;  3T5L A;  2R8G A;  1HUO A;  3OHA A;  8ICC A;  4YR0 A;  4YR3 A;  3PV8 A;  2AGQ A;  1TV9 A;  4IR9 A;  5KFB A;  1L3T A;  5KFN A;  1ZQQ A;  3C1Z A;  2BPG A;  4RQ1 A;  1TK5 A;  4ELV A;  4Q43 A;  5KFH A;  1A76 A;  4Z6F A;  2FPL A;  3QEA Z;  4M9N A;  2W8L A;  5DLF A;  1NKE A;  2R8J A;  3RJF A;  5KG4 A;  1BVS A;  1RZT A;  4DOB A;  5KT6 A;  3TI0 A;  2XY5 A;  4MF8 A;  2PI5 A;  2JEJ A;  4KLF A;  2XO7 A;  4RQ3 A;  2ZJ5 A;  4BXO A;  4RUC A;  3RH4 A;  4LZD A;  1T8E A;  4FBT A;  5KFL A;  1ZQV A;  3JPN A;  3TAP A;  1S77 D;  5DB6 A;  3GQC A;  3BQ2 A;  3SYZ A;  4O5E A;  5KFT A;  5IIL A;  5D4B A;  3EYZ A;  4QZH A;  2P6U A;  5KFA A;  3C2L A;  4I2C A;  2BHN A;  5J2B A;  8ICE A;  1KTQ A;  4J9K A;  4EBC A;  3QZ8 A;  4DS5 A;  1D9F A;  4M2Y A;  5CJ7 A;  4CCH A;  8ICL A;  8ICZ A;  3M8S A;  4RQ8 A;  4KLT A;  3Q8Q B;  4ECU A;  1ZQF A;  1Z00 A;  4MFA A;  1CUK A;  3OSN A;  3JPS A;  4ZH4 A;  3IM1 A;  2W9B B;  1NJX A;  4DL7 A;  4PHA A;  5IIM A;  4P4O A;  1TAQ A;  2Y1I A;  3PX4 A;  3PX6 A;  2BCQ A;  4C8N A;  4KLO A;  2I9G A;  4QZD A;  3H4B A;  5KG7 A;  5KFP A;  4F5O A;  1U49 A;  3Q8L A;  5EOZ A;  4NXZ A;  2ASL A;  3FDS A;  1LV5 A;  2PFO A;  3RR8 A;  3FYH A;  3T5H A;  4TUP A;  2FLN A;  4P2H A;  1RPL A;  3UQ2 A;  1XS9 D;  1XWL A;  4J9O A;  2ASJ A;  2V9W A;  2KTQ A;  9ICQ A;  5KFR A;  3RJJ A;  5KFF A;  4J9N A;  4M9J A;  4K4H A;  8ICS A;  5KT4 A;  4YVZ A;  4XQ8 A;  1TK8 A;  3M9M B;  2FPK A;  3EPG A;  3GIL A;  4O3S A;  2ZTC A;  3H8J A;  7ICK A;  5IIN A;  3PR4 A;  4YFK A;  5DG7 A;  4ELT A;  1ZJM A;  5KT2 A;  1XU4 A;  3GIJ A;  8ICJ A;  3BDP A;  4I2J A;  4KN4 A;  3BQ0 A;  1ZQW A;  4RT2 A;  1BGX T;  4RU9 A;  3RB4 A;  8ICO A;  2Q0Z X;  5IIJ A;  4F8R A;  3C21 A;  4QZF A;  3PVX A;  2ZJA A;  4DFK A;  5J2I A;  4B9U A;  4I2D A;  4K4G A;  4YCX A;  3V7J A;  4KLQ A;  2HHT A;  1Y88 A;  1S97 A;  2IMW P;  3EWA A;  4RNO A;  9ICK A;  1DOQ A;  3AU6 A;  1H38 A;  4RNM A;  1Z00 B;  3SV4 A;  3BJY A;  8ICX A;  4PPX A;  7ICM A;  4YG2 A;  1JN3 A;  3BQT A;  4F5P A;  3T5J A;  2VA2 A;  5J0T A;  4QZ8 A;  4C8K A;  9ICG A;  5L1I A;  3H8S A;  4K4I A;  3PW0 A;  9ICU A;  2XCA A;  1C7Y A;  5C5J A;  2BKE A;  2DFL A;  3MFI A;  3UQ0 A;  3TFS A;  3N97 B;  2BGW A;  3RJK A;  2R8I A;  1ZQN A;  5D46 A;  4IRD A;  3GIM A;  4NLK A;  5KFQ A;  5BPC A;  4IQV A;  4NY8 A;  3PMN A;  4F93 B;  4RPY A;  3GIK A;  1KLN A;  4ECX A;  3ISC A;  2ZUB A;  4RQ0 A;  1JXE A;  4DOC A;  4DF8 A;  1S0O A;  2UVR A;  4RUA A;  4RPZ A;  9ICO A;  2A1J A;  1UA1 A;  2UVW A;  3RJG A;  1JXL A;  2FMQ A;  1SZP A;  5J0Q A;  1ZET A;  3GV5 B;  9ICV A;  4ECV A;  4XRH A;  3M9O B;  1ZQO A;  3UXO A;  4BWJ A;  3RJE A;  1U47 A;  3H40 A;  4DEZ A;  3SZ2 A;  3V6K A;  5J2A A;  2MAX A;  2BQR A;  1X2I A;  4YR2 A;  4DL2 A;  2RDJ A;  3RH5 A;  3MR2 A;  2F1J A;  5DQG A;  4UAW A;  4DS4 A;  4DL5 A;  1ZQS A;  2J6U A;  4PHP A;  3RB3 A;  4RZR A;  3RAQ A;  1NK7 A;  5KG1 A;  3T5K A;  1SKR A;  3RBE A;  2J6S A;  4O5C A;  4XA5 A;  5HML A;  4UB5 A;  4QWB A;  3G6Y A;  4ECZ A;  1JIH A;  4YD1 A;  4DO9 A;  1NK9 A;  4J9S A;  4DSE A;  3PO4 A;  4ELU A;  3TFR A;  4F2S A;  2BQ3 A;  5CWR A;  2HVH A;  4TQR A;  1TAU A;  7ICT A;  5J0U A;  7ICE A;  2NRZ A;  4DFJ A;  4I2A A;  7ICV A;  1NK4 A;  1ZQH A;  3JPQ A;  4DL6 A;  4TUR A;  8ICK A;  4R63 A;  2NRV A;  4QWE A;  4B9V A;  3GFK B;  5DGB A;  1BPB A;  5DQH A;  2BR0 A;  3RAX A;  4ECW A;  7ICL A;  4B9N A;  3AU2 A;  3MDA A;  4FO6 A;  3H7I A;  2FLP A;  4R8U A;  3MAB A;  3JPP A;  3HW8 A;  4I2E A;  4EBD A;  1ZQE A;  5DLG A;  2JZB A;  2HHV A;  4P4P A;  3PR5 B;  2A1J B;  4PGQ A;  2LYH A;  4F92 B;  1S76 D;  3PO5 A;  1WCL A;  2R8H A;  2W9A A;  4KLL A;  5III A;  2FLL A;  4KLS A;  1UT5 A;  5CA7 A;  4HYK A;  3OJU A;  1S0M A;  3ORY A;  4F50 A;  1D8L A;  1TFR A;  3QEB Z;  4KLI A;  3Q8K A;  1UA0 A;  5BOL A;  3ZDA A;  1ZQY A;  1NKB A;  5J0P A;  4FS2 A;  9ICH A;  1ZQR A;  4Q45 A;  4YN4 A;  3PML A;  4M9H A;  4QZA A;  4O3O A;  4KLU A;  7ICJ A;  4MFC A;  1L3V A;  2UVU A;  5L1L A;  1XSN A;  4TUS A;  2BDP A;  5DGA A;  1L5U A;  4B9L A;  4DFP A;  5IIK A;  5EWG A;  3KHG A;  1ZJN A;  4RPX A;  4DSJ A;  2ZUD A;  2W8K A;  4TQS A;  3RRG A;  5KG5 A;  2V4Q A;  2ISO A;  1MSW D;  1ZQX A;  4R65 A;  5KT5 A;  4ED7 A;  4KLG A;  3KHH A;  4ECR A;  1KDH A;  1BPD A;  5KFY A;  4FBU A;  3PW4 A;  3TAR A;  4EZ6 A;  3V6H A;  2HHU A;  2ASD A;  1JMS A;  4LVS A;  9ICX A;  4YD2 A;  3RJI A;  9ICM A;  3LK9 A;  2W9M A;  3BQ1 A;  3LDA A;  1X9W A;  4G3I A;  2VA3 A;  3OJS A;  8ICW A;  9ICC A;  4RT3 A;  2ZJ8 A;  1QSY A;  4J9L A;  4B9M A;  3B0Y A;  8ICF A;  2H5X A;  3ZDE A;  5J0R A;  5J2G A;  1X9S A;  1WCN A;  3EW9 A;  5F9N A;  1RYR A;  3NTU A;  4BXO B;  4Q8F A;  5J0O A;  4DSI A;  5DG9 A;  2F1H A;  2NRW A;  4F5R A;  1ZQA A;  5BOM A;  2JZB B;  5DQI A;  3GII A;  5J2C A;  2C2R A;  2UVV A;  4PGX A;  2P66 A;  3SV3 A;  2JEI A;  4ED3 A;  4MFF A;  8ICG A;  3C1Y A;  2Y1J A;  3PNC A;  5KFU A;  2XGP A;  4DSK A;  4IR1 A;  2FMS A;  3MR5 A;  3MGI A;  3HP6 A;  2OWO A;  1D9D A;  9ICS A;  3HWT A;  3MGH A;  2XY7 A;  3SI8 A;  9ICF A;  7ICP A;  2DPJ A;  4I27 A;  4F4W A;  4GXI A;  1S9F A;  3C5F A;  3JPT A;  5DKW A;  5KFW A;  5J2D A;  3C23 A;  2RDI A;  4MEX A;  4IRC A;  4RQ2 A;  2NRT A;  5KFS A;  2AJQ A;  3G6V A;  1NJW A;  4UB3 A;  3E2E A;  1DGS A;  2XY6 A;  4R64 A;  1S0V A;  2JEG A;  3OGU A;  3ZDC A;  4JWN A;  2AGO A;  3MDC A;  4UB2 A;  3ZD8 A;  4Z6D A;  2KZ3 A;  2PI4 A;  4Q8E A;  1ZYQ A;  4DFM A;  2PFQ A;  1MC8 A;  4UB1 A;  5HP4 A;  1TK0 A;  9ICP A;  4C8O A;  2PFP A;  4F2R A;  8ICI A;  3PW2 A;  4RQ5 A;  1K1S A;  2NRX A;  5J29 A;  3HT3 A;  3PW5 A;  4YMO A;  3C2M A;  1ZQG A;  4KLE A;  1A77 A;  3ETL A;  1B22 A;  2XC9 A;  5L9X A;  2FPM A;  3C2K A;  1ZQI A;  4KTQ A;  8ICP A;  5KG2 A;  1ZQJ A;  5CHG A;  4O9M A;  9ICR A;  4I28 A;  1U48 A;  4NLG A;  1NK5 A;  9ICI A;  5KT3 A;  2M9N A;  5J0Y A;  2IHM A;  2PXI A;  4GC7 A;  4UBB A;  2IA6 A;  8ICB A;  3K75 D;  4ECT A;  8ICH A;  4QZE A;  1QSL A;  2VAN A;  2ATL A;  1HUZ A;  5J0W A;  3JPO A;  5HHH A;  1QSS A;  1NK8 A;  3MR3 A;  3C5G A;  4DQQ A;  1N56 A;  4EYI B;  5JUM A;  3RTV A;  3RB0 A;  5KFE A;  4YMM A;  5KFJ A;  4RNN A;  7ICH A;  1T7P A;  9ICN A;  4KN7 A;  1TVA A;  4NM2 A;  4J9R A;  4C8L A;  2HHS A;  3V7L A;  5HNK A;  8ICA A;  9ICE A;  3UPQ A;  1NKC A;  1XSP A;  1T4G A;  3IHQ B;  2FMP A;  5J2H A;  4ED6 A;  2C28 A;  5KFZ A;  4PGY A;  4O0I A;  3MR6 A;  4KLM A;  4NLN A;  7ICR A;  4JV0 A;  5KG6 A;  5KFM A;  9ICT A;  1ZQU A;  4O3N A;  4P4M A;  1SL0 A;  2KN7 A;  1IXR A;  4I2H A;  1ZQL A;  3K4G A;  4I29 A;  5KFK A;  2GWS A;  4BWM A;  2HHW A;  1NK0 A;  3EPI A;  2J6T A;  1X9M A;  3GV7 B;  5KG0 A;  3V72 A;  3LWM A;  4F91 B;  4JV1 A;  4KMU A;  4QZI A;  3M9N B;  4J9Q A;  4DQR A;  2JEF A;  4F3O A;  4O3R A;  4QZC A;  5HMM A;  4R66 A;  4NM1 A;  5CR0 A;  3QZ7 A;  9ICW A;  4DL4 A;  9ICJ A;  4RQ7 A;  4DWI A;  1KFD A;  4QWC A;  5KTQ A;  3HPO A;  4JWM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...