3GFKB

Crystal structure of bacillus subtilis spx/rna polymerase alpha subunit c-terminal domain complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
76
structure length
76
Chain Sequence
GPHMKEEDQKEKVLEMTIEELDLSVRSYNCLKRAGINTVQELANKTEEDMMKVRNLGRKSLEEVKAKLEELGLGLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Regulatory protein spx
publication title Crystal structure of the in vivo-assembled Bacillus subtilis Spx/RNA polymerase alpha subunit C-terminal domain complex
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription/transferase
total genus 26
structure length 76
sequence length 76
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2009-02-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3gfkB00
1TV9A 3PW5A 4F8RA 5J2CA 2V4QA 5L1JA 9ICQA 3BQ1A 4UAYA 5J0TA 5EOZA 5J0WA 1TAQA 4F2SA 2IMWP 4K4HA 4EYIB 3T5KA 3V6JA 4JV1A 1LB2B 5J29A 3GV8B 3BQ2A 1JX4A 4IRCA 5KG2A 1A76A 1WCNA 5CP2A 4ECUA 1XS9D 3OHAA 4FBUA 4I28A 4QZDA 3BDPA 5DGBA 3RJEA 2ZUDA 4IQUA 5KFEA 2VA8A 8ICSA 1HUOA 4QZCA 2MAXA 7ICRA 4FO6A 4DFMA 4QW8A 3OHBA 5IIMA 1BPEA 1Z00A 3Q8KA 2VA2A 8ICUA 2AQ0A 4YVZA 5IIJA 3ZDEA 4QWAA 2HHVA 4RU9A 2AGOA 1HJPA 4YQWA 4XA5A 3RJHA 4EZ9A 4DFPA 1RZTA 2DFLA 2B21A 1X9MA 1ZQLA 2PFPA 4IR1A 4KLOA 5DQIA 2ASLA 2AQ4A 2DPJA 2KFNA 3ZDAA 3ZDDA 5J2GA 2R8HA 4F4XA 2RDJA 4F5RA 1ZQBA 2C2EA 5F9LA 8ICTA 4DOCA 7ICGA 2FMQA 3HPOA 1SL2A 3MGHA 3RRGA 1XC9A 4R8UA 4Z6EA 4DQPA 3M9MB 4J9KA 4FS1A 4ECRA 1NK6A 4DL3A 4EEYA 1S9FA 5DB7A 1ZQJA 3PMNA 4DL6A 4YR2A 3JPRA 8ICHA 4RUCA 2R8KA 3K75D 1S10A 5HMMA 4F4KA 8ICRA 5J0UA 2F1IA 4DSIA 1SKWA 4MF8A 2NRXA 9ICKA 4QZGA 2IA6A 2RDIA 3PW7A 9ICSA 1NK0A 2H5XA 4RQ3A 3EZ5A 2P66A 5JUMA 4PHEA 4B9UA 4I2FA 4FS2A 2UVWA 9ICAA 3NGDA 4IQVA 1LV5A 5HHHA 9ICUA 1IXRA 8ICIA 2BHNA 7ICJA 2I1QA 4I2JA 8ICAA 1B43A 1ZETA 1KLNA 4YR3A 1T8EA 4PGQA 4DEZA 3EWAA 4GLXA 4MFFA 4DQRA 4PH5A 7ICVA 3PMLA 1NK5A 4PGYA 3MFHA 1KTQA 1BGXT 2W8KA 2PXIA 4ECQA 3RB3A 3KHGA 3TQ1A 2W9CB 1ZQDA 4FBTA 2BCVA 4DF4A 8ICCA 1JMSA 5BOMA 1U4BA 4KLJA 1TKDA 1ZQCA 4QZIA 3PR4A 4M9LA 5IIIA 3RB0A 4K4IA 1ZQOA 2F1HA 2UVVA 5KT2A 9ICBA 1KDHA 5J2AA 3BQ0A 2W9BB 5KFAA 1Z3EB 4BDPA 4QZBA 3M9OB 4RQ2A 1ZQEA 1NKEA 4JWNA 2GWSA 5IINA 5KG1A 5DGAA 4YMOA 4PGXA 4HYKA 1H38A 4DSEA 4M9HA 9ICWA 7ICEA 4F5NA 3PR5B 4ECZA 4J9MA 4P4PA 4BWMA 3PX4A 4G3IA 3T5HA 4DSJA 4O3SA 1S76D 5DB6A 1XSLA 5DG8A 5DBCA 3JPPA 4MEXA 3NTUA 5KFXA 3SV4A 4DSFA 4Z6CA 4RQ8A 4KLGA 3JPSA 4DFJA 1BPDA 3QZ8A 5J2EA 3KHLA 3EW9A 3UQ2A 4J9PA 4EBCA 4ECVA 4DSKA 2OWOA 4UAZA 2M9NA 3MR3A 1ZQQA 4M9JA 4KLEA 2VA3A 5DB9A 2PI5A 4XUSA 4YR0A 4DF8A 2FPMA 4P4MA 1A77A 2P6UA 1NK8A 4R66A 5IILA 3M8SA 1ZQSA 5J0RA 4DL4A 2WTFA 1ZQGA 5KFBA 5D4BA 2IHMA 5KTQA 5DLGA 1TK0A 2J6SA 4GXIA 2J6UA 2KTQA 3Q8PB 4QWDA 4GXKA 9ICLA 3TARA 5KFVA 4KTQA 4PHDA 4XQ8A 5KFQA 2ASDA 2C2RA 2KZZA 1D8LA 8ICPA 3T5JA 2BCUA 4MFAA 4NY8A 1KEJA 4I2DA 3MR6A 4M47A 4I2GA 8ICWA 2BR0A 2BCRA 1U9LA 3RR7A 2A1JA 3MFIA 4F4WA 5L9XA 2JEGA 1MSWD 9ICCA 4R63A 1DOQA 4M6WA 5KT7A 5J2BA 5KFNA 1N56A 3LK9A 1MC8A 2FMSA 5KFSA 2FPKA 9ICPA 4DLEA 4RQ6A 4Q8FA 4ED7A 1ZQFA 4O3PA 5J0QA 5EWFA 4NLNA 1ZQVA 4O3QA 3PNCA 3Q8QB 3GIIA 4ECWA 2C28A 4B9NA 5DG7A 5HHIA 4C8MA 4DFKA 4O3NA 4NM1A 2ZUBA 4O0IA 1Y88A 1UT8A 2MUTA 5DQHA 2ZJ8A 4BXOA 3Q8RB 2HW3A 4F2RA 4NLKA 1RXVA 2JZBA 2PFOA 3RH6A 1TFRA 4YMMA 4JV2A 1D9DA 2ZTDA 4RQ5A 3QEAZ 3AU2A 1QSLA 4QZ8A 3H8JA 5BOLA 1X2IA 2BQUA 2V9WA 2W9AA 1DGSA 4KLSA 4ECYA 3PVXA 1NJWA 1MQ2A 1X9SA 3OGUA 5KFCA 4RNMA 2XGPA 2I9GA 2P6RA 3H8SA 3V7KA 4J9OA 3EYZA 4MF2A 4C8OA 3SYZA 5KT4A 3LWMA 4TURA 3BJYA 4O5KA 3Q8SB 2AJQA 4Q44A 8ICMA 1B22A 5KG3A 1XU4A 4RQ1A 3E2EA 4B9TA 2Y1IA 1L3SA 4O3OA 3KHRA 3LDAA 4IQTA 1KFTA 4EBEA 2XCPA 1NKCA 4ELTA 1JN3A 3AU6A 4KLMA 5CB1A 2AU0A 2JEIA 2XY5A 5CWRA 5DQGA 3ISCA 4Z6FA 2BGWA 2BQRA 9ICNA 2C2DA 5C5JA 3JPTA 4Q8EA 9ICEA 5J2FA 1NOMA 3HW8A 1BPYA 9ICXA 2FLPA 1XO1A 4C8KA 4ED0A 1V9PA 5DKWA 4QWCA 3OSNA 3OJUA 4ED1A 3SI8A 4PPXA 8ICEA 1ZQMA 5KFHA 2W8LA 2PFNA 3GV7B 4JK1A 3MDCA 3RBDA 3RAQA 2Q0ZX 2ALZA 4DS4A 1ZQKA 7ICMA 4I2AA 2BKEA 4TQRA 3C1YA 4F5QA 3H7IA 4TUPA 1U49A 4B9MA 4TUQA 8ICLA 4EZ6A 4O3RA 4DLGA 4DQIA 1MQ3A 1KRPA 5KFUA 1CUKA 1U48A 2ZTCA 2J6TA 3G6XA 3ETLA 3RH4A 4TQSA 1NJXA 2ISOA 5KFYA 2ZUCA 3EPIA 4Q45A 4KMUA 4LZGA 3M8RA 4PHPA 1SKSA 5D49A 4DL5A 1PZNA 1TK5A 3B0YA 2FPLA 5DDMA 4MEYA 1S0VA 4I2EA 3PW0A 2HHWA 8ICNA 1S97A 1UA0A 5DB8A 2BCSA 4F3OA 4PHAA 5KG7A 1ZQPA 4YD1A 2PI4A 1RYSA 4LVSA 1SL0A 2XY7A 3V6HA 4DQQA 4M2YA 4JV0A 4ELVA 1SZPA 2AGQA 4I2HA 4QZEA 3HWTA 4YP3A 4QWBA 5KG0A 5KT3A 4KN7A 3IM1A 2XC9A 4DS5A 1C7YA 2W9CA 1QTMA 4TUSA 4F91B 4ECTA 4J9LA 5J2KA 4IQWA 4KLFA 4JUZA 4R64A 2PFQA 4RPZA 5DDYA 1L3VA 3KTQA 1IM4A 2ZTEA 3HT3A 5KT5A 1D8YA 4K4GA 7ICHA 4GXJA 5IIKA 3MBYA 9ICHA 4RT2A 4EYHB 1SKRA 1K1QA 4YXJA 7ICNA 2A1JB 4ED2A 5J2JA 5KFZA 4F50A 3ORYA 1S77D 3V72A 3RB6A 1S0OA 2BPGA 1KFSA 4P2HA 3TANA 4IRDA 2IBKA 7ICTA 4ECXA 3C5FA 9ICFA 3ISDA 2NRWA 3GDXA 3RTVA 4RNNA 2BQ3A 3PV8A 3RR8A 5L1KA 4DO9A 4C8LA 3GIJA 1ZQWA 4KN4A 3C21A 4LZDA 2BDPA 3JPOA 4I2CA 8ICXA 1L3TA 4UBBA 1Z00B 1QSYA 2LYHA 3HP6A 2R8JA 4B9VA 9ICTA 1RYRA 4UB5A 1SL1A 4BXOB 2JEJA 5KFPA 3KHHA 4J9NA 2ATLA 4B9LA 2KN7A 3OSPA 9ICJA 2XO7A 2JZBB 1ZQYA 1QLNA 2HVHA 4ECSA 8ICYA 1ZQXA 4Z6DA 1UT5A 1XSPA 5KFKA 5J0XA 3C5GA 3QEBZ 1BPZA 4C8NA 4KLUA 7ICLA 5TZVA 3PO4A 3MR5A 1CEZA 3TFSA 5KFLA 1NK7A 4RT3A 3UXNA 4F4ZA 3Q8MA 5DBBA 2ISPA 4DSLA 3EPGA 1L5UA 3RJFA 3PX6A 5DG9A 4CCHA 4DWIA 8ICFA 4M0AA 4ED3A 4O9MA 4P4OA 4ELUA 4KITB 3G6VA 5KFOA 4R8UB 3ZD9A 3JPNA 4GC7A 2V4RA 3BQTA 3RH5A 2Y1JA 3IHQB 3Q8LA 1ZJNA 4RQ7A 3TAPA 2FMPA 5KFIA 3TFRA 7ICFA 4MFCA 5KFJA 3QZ7A 7ICUA 1ZJMA 4F5OA 1S0MA 1ZQRA 3UXOA 1XWLA 3K4GA 5KT6A 4E0DA 3OJSA 4RZRA 4NXZA 3RBEA 5J0YA 2BPCA 2HHSA 9ICIA 3MABA 5CA7A 3PY8A 2FLLA 3RJKA 4UBCA 3UPQA 2UVRA 4UB2A 1S0NA 4KLDA 2HHTA 8ICGA 1ZQAA 3MR2A 5L1LA 4X5VA 5KFGA 2HHUA 1NKBA 1JXEA 4NM2A 3RB4A 3ZDBA 4UB3A 3TI0A 5KFTA 1ZQHA 8ICJA 4YXMA 1NK9A 1U47A 3GQCA 9ICOA 1ZQUA 4DOAA 5J2HA 3T5LA 2DPIA 7ICPA 5CHGA 3THVA 5DBAA 4R65A 1ZQNA 9ICMA 4NLZA 5KFWA 4B9SA 4J9SA 3AUOA 1XSNA 8ICBA 4I2BA 4ED6A 5J0PA 1AROP 4BGDA 4QW9A 3ZDCA 2NRZA 3FDSA 8ICZA 3GIMA 3PW2A 3UXPA 5KG6A 8ICQA 4I27A 4KLQA 4O5CA 3UQ0A 1HUZA 4YG2A 3RAXA 1ZYQA 4XRHA 5EWGA 1NJYA 3GILA 1TAUA 2BPFA 4F93B 2R8GA 1ZQZA 1TVAA 2C22A 5KG4A 2NRVA 3B0XA 3H4DA 3PX0A 3TAQA 2HHXA 1L3UA 4JWMA 3GIKA 4UAWA 4KLLA 4QZAA 4RNOA 5KFDA 4F4YA 4DL7A 7ICSA 3MGIA 3H8WA 3ISBA 3G6YA 4DOBA 1T3NA 2F1JA 1KFDA 2NRTA 4RQ4A 5EWEA 4KLIA 2JEFA 1U45A 3PO5A 4M04A 2XY6A 5CR0A 4QZHA 3QE9Y 3MDAA 1D9FA 4UQGA 5KG5A 1UA1A 4GC6A 2ZJAA 5J0SA 3RJJA 3C2LA 2KZ3A 5KFMA 1JIHA 4BWJA 4ZH4A 3PW4A 3V7JA 4IRKA 4RPYA 1BVSA 5D46A 1ZQIA 5J2DA 5CJ7A 3H4BA 3V7LA 2KFZA 2W9BA 3SZ2A 1JXLA 4QWEA 3HX0A 4I2IA 4YCXA 4Q43A 5HNKA 5BPCA 2R8IA 3RJGA 4M9GA 4IR9A 3ZD8A 5F9NA 4YD2A 4M6WB 7ICQA 1TK8A 1RXWA 4KLHA 1KSPA 1BPBA 3T3FA 5DLFA 2HHQA 1WCLA 2XCAA 3V6KA 2AGPA 1ZQTA 7ICIA 2HVIA 5HP4A 2ASJA 4YN4A 4O5EA 2KZMA 4DQSA 5HMLA 3FYHA 8ICVA 2W9MA 1NJZA 4YFKA 1X9WA 2IHNA 4QZ9A 5J0OA 1T4GA 4UB4A 4M9NA 3H40A 4UB1A 1K1SA 4QZFA 3M9NB 4J9RA 1BPXA 1T7PA 4F92B 4NLGA 4ED8A 8ICKA 1RPLA 2MUTB 5L1IA 3RJIA 5KFRA 3C1ZA 4RQ0A 4I29A 3C23A 7ICKA 7ICOA 5IIOA 2XGQA 9ICGA 3JPQA 5KFFA 3N97B 4KLTA 9ICVA 1NK4A 4DL2A 3GFKB 3C2MA 2FLNA 5J2IA 1EXNA 4YMNA 2UVUA 1N48A 2ZJ5A 3GV5B 2BCQA 2VANA 9ICRA 1QSSA 1COOA 4J9QA 3LWLA 3RRHA 4EBDA 4RPXA 8ICOA 4RUAA 3N4MB 4F5PA 3C2KA 3SV3A
chains in the Genus database with same CATH superfamily
4F8RA 3PW5A 5J2CA 3KKAC 2LM4A 5L1JA 5EOZA 4F2SA 4JV1A 3FC4A 4FBUA 3BDPA 5AM5A 4QZCA 5IIMA 1Z00A 3NASA 2AGOA 5AM1A 2JRZA 5AIBA 3N7PD 1CRXA 4AYBF 4JMUA 2JV3A 1S5LU 2DPJA 2KFNA 3ZDDA 2E8MA 4EENA 4DOCA 7ICGA 4C4TA 1OXJA 1XC9A 3VC8A 2GOLA 2LYAA 3M9MB 1ZQJA 3PMNA 3JPRA 3WKDA 4RUCA 2VJ4A 3K75D 1S10A 2F1IA 4MF8A 2K4EA 2IA6A 3PW7A 1NK0A 2H5XA 3J81j 4B9UA 2EZXA 2KNJA 2UVWA 9ICAA 4UB6U 5HHHA 8ICIA 2I1QA 4YR3A 4PGQA 4DEZA 3EWAA 1A0PA 3PMLA 1NK5A 3RB3A 1ZQDA 2K8BB 2BCVA 1U4BA 4RQNA 1TKDA 1ZQCA 3HKZC 3PR4A 3RB0A 2F1HA 3I28A 2RLTA 5J2AA 4BDPA 1N2XA 3I76A 4QZBA 3M9OB 1NKEA 2E8PA 4WJ3B 2YB1A 3N7SC 2WAQC 4PGXA 4HYKA 4DSEA 2LYBA 7ICEA 3CW2C 4P4PA 4BWMA 2K4IA 4O3SA 5DB6A 3JPPA 1FIQA 4DFJA 4PJ0U 3EW9A 2KOBA 2OWOA 5AHXA 4PL2A 1XNSA 4YR0A 5CEHA 1A77A 2P6UA 1NK8A 4F71A 5IILA 1ZQSA 1PK1B 4DL4A 2IHMA 2J6SA 2NO4A 1TK0A 3KOOA 4GXIA 2KTQA 4QWDA 9ICLA 5AI5A 4KTQA 4PHDA 4XQ8A 5EE0A 4MFAA 1LVHA 4CGZA 2EAOA 4I2GA 4BJQA 2BR0A 2BCRA 1NNLA 3MFIA 1MSWD 3S6JA 3KFUF 3B9JA 3IRUA 5KFNA 2FMSA 4Q8FA 2W7OA 5J0QA 5ALUA 1O03A 4OJLA 5EWFA 1ZQVA 3MC1A 1Y88A 4RQMA 5DQHA 2ZJ8A 2HW3A 4NLKA 3RH6A 4JV2A 4C7ZA 3H0RB 5AKEA 3LVVA 5BOLA 2V9WA 1DGSA 4ECYA 4AYBC 2KJ9A 3OGUA 1ZXIA 2H3ZA 2XGPA 3NVYA 4C8OA 3LWMA 2F77X 2LI6A 5HR6A 5ALOA 3LDAA 4IQTA 4EBEA 1NKCA 1IV8A 4KLMA 3GZFA 3SEIA 2XY5A 1YZ6A 2RQ5A 4NL9A 2BGWA 9ICNA 4Q8EA 3BZCA 1DRGA 1XO1A 5T14A 2F2AB 3FM9A 4ED1A 5KFHA 4JK1A 2P35A 3RAQA 1ZQKA 4QJFB 2KK0A 2BKEA 3C1YA 4F5QA 3H7IA 4O3RA 1KRPA 5KFUA 1CUKA 1N63A 1Z1BA 5AM4A 5AK6A 2ZG6A 3D2NA 4QIWF 4Q45A 3M8RA 4PHPA 5D49A 1RM6C 3F2BA 4Y2YA 5ALWA 5DDMA 4MEYA 2JR5A 3PW0A 4OCZA 1NZPA 3TACB 1ZQPA 4YD1A 1RYSA 4LVSA 5ALHA 2XY7A 2KIVA 4I2HA 4MHVA 4YP3A 1QTMA 2DQNB 5KT3A 4KN7A 2XC9A 2PMZC 4EELA 4F91B 5J2KA 4IQWA 2ZIVB 4JUZA 4R64A 4RPZA 3KTQA 1IM4A 4K4GA 4RT2A 5KFZA 4F50A 1S77D 2KJ8A 1F0MA 1T94A 3AQFA 1KFSA 4P2HA 3TANA 4ECXA 2NRWA 2ZIXA 5FP0A 3OTQA 2BQ3A 4CE6A 1MA7A 3GIJA 3C21A 4CDGA 4GIBA 1N5WA 4UB5A 4B9LA 1JROA 9ICJA 2KN7A 1QLNA 2HVHA 2OEHA 1XSPA 4KLUA 5J0XA 3QEBZ 3PO4A 3HILA 5K4LA 2H3FA 2VKQA 1N60A 2ISPA 2W04A 4CCHA 4P4OA 5KFOA 2V4RA 3LVWA 4NLCA 2Y1JA 1ZJNA 4RQ7A 5KFIA 7ICFA 5GTHU 3RF9A 3OJSA 4RZRA 4NXZA 3RBEA 2XVTA 2WB1F 2FLLA 4OD0A 3RJKA 1NI3A 1S0NA 2HHTA 1NKBA 2HDOA 4CNQA 3ZDBA 3TI0A 1KL9A 1ZQHA 8ICJA 1NK9A 1JI7A 1U47A 2DPIA 1WWUA 5ALYA 3THVA 2W54A 4ED6A 1AROP 3IG8A 4BGDA 2K89A 2NRZA 3SENA 3GIMA 2QB0A 2CRXA 4I27A 2E5SA 5EWGA 3GILA 4QIWC 1ZQZA 2D6FC 2NRVA 2W11A 2E1EA 1L3UA 3ETRA 3GIKA 4RNOA 2KVCA 2LMRA 7ICSA 3MGIA 1B4FA 2NV3A 4DOBA 5ALSA 4KLIA 2JEFA 1U45A 3PO5A 4M04A 2ZXHA 4QZHA 3MDAA 5KG5A 2LHTA 3K1ZA 2G09A 4ZH4A 3V7JA 4IRKA 5D46A 3K1RB 3H4BA 4Q43A 2R8IA 3RJGA 4IR9A 5F9NA 1RXWA 3L3FX 1KSPA 3T3FA 1WCLA 5EE9A 4CF3A 3V6KA 1KQQA 7ICIA 2HVIA 4DQSA 5HMLA 4YFKA 5EE3A 1X42A 4M9NA 4LJXA 1BPXA 2KP7A 2EAPA 3AL0B 1L7MA 1RPLA 7ICOA 5KFRA 4RQ0A 5IIOA 2KICA 3N97B 4KLTA 9ICVA 3H0LB 3C2MA 2FLNA 5J2IA 1XO0A 4YMNA 2UVUA 1N48A 3GV5B 2WFAA 3LWLA 1L8LA 3C2KA 1VDVA 4UAYA 2KSOA 5J0TA 5J0WA 4U7CA 4EYIB 3T5KA 4J03A 1LB2B 1Z4NA 1JX4A 3BQ2A 4IRCA 1XS9D 1A76A 1WCNA 5CP2A 3OHAA 4IC9A 5DGBA 3RJEA 4IQUA 8ICSA 1HUOA 3CNHA 2EANA 2OH2A 2FJ6A 3Q8KA 2AQ0A 2HCFA 2GLEA 3SAHA 4YQWA 3RJHA 4EZ9A 2WB1C 5ALTA 1X9MA 4KLOA 2AQ4A 3ZDAA 2I6XA 1URJA 4F5RA 1ZQBA 2CN1A 4R8UA 2ES6A 4DQPA 4FS1A 4ECRA 1NK6A 3F2DA 4DL3A 1S9FA 8ICRA 5J0UA 1SKWA 4US8A 2NRXA 1YT3A 5F3XB 1B0XA 4OO1J 3NRWA 1YZ7A 2RDIA 2YB4A 2IOFK 3H0MB 4Y2SA 1TE2A 5ALJA 2G0AA 1B43A 4GLXA 4DQRA 3MFHA 2PXIA 4FBTA 4ECQA 2W9CB 2LM1A 4OJPA 1JMSA 3QX7A 4KLJA 4Y2XA 4M9LA 5IIIA 2QLTA 2W9BB 4G9BA 1ZQEA 4EX6A 2GWSA 5IINA 1ZD4A 2GH1A 3PSFA 4F5NA 4UB8U 4MEXA 5DG8A 3NTUA 3SV4A 4DSFA 1IIPA 4Z6CA 4RQ8A 2AH5A 3JPSA 4KLGA 1ZRMA 4EBCA 1V38A 2M9NA 3MR3A 1ZQQA 4M9JA 4KLEA 5J8YC 5DB9A 4XUSA 4DF8A 5J0RA 2WTFA 1ZQGA 2KKVA 3F53A 3Q8PB 3CYMA 5KFQA 2HOIA 5ALPA 4Y2QA 3T5JA 1V97A 1LKYA 1U9LA 3KKAA 4ICAA 2KE7A 2A1JA 4FZNA 3M7DA 1ZD2P 1DOQA 4M6WA 5KT7A 3L5KA 3DDHA 2FPKA 4NLNA 3GIIA 2C28A 1J97A 3L4PA 2KEYA 5HHIA 2R18A 2LKYA 3SQIA 4NM1A 2E8NA 4QNLA 4F2RA 5AKHA 2PFOA 2FDRA 3WKAA 3AU2A 2PKEA 5AI9A 1X2IA 4KLSA 3PVXA 3GU3A 5KFCA 4RNMA 2I9GA 3H8SA 3V7KA 3EYZA 4MF2A 1SXEA 4Y2PA 3AMZA 5KT4A 4TURA 2XI9A 3Q8SB 2AJQA 2DKXA 1J2NA 2YN4A 3UMCA 1KKXA 1L3SA 3KHRA 2EZYA 2XCPA 2YQEA 1JN3A 3AU6A 3T79A 2HBKA 5DQGA 2C2DA 2LPEA 9ICEA 1NOMA 1BPYA 2FLPA 4C8KA 1ZD5A 4ED0A 4Y2TA 4PPXA 8ICEA 1ZQMA 2PFNA 3MDCA 3RBDA 2ALZA 7ICMA 1WYGA 5G5HA 4TUPA 1U49A 1MN8A 4B9MA 1FFUA 4TUQA 1O08A 4EZ6A 8ICLA 1U48A 2ZTCA 3G6XA 4TQSA 5KFYA 2KKPA 2ZUCA 3WK5A 4KMUA 1SKSA 3B0YA 3H8MA 1FFVA 5AKJA 1BNOA 4F3OA 4CF5A 5B5EU 1SL0A 4M2YA 5AKZA 4ELVA 2AGQA 3HWTA 4QWBA 5KG0A 2KMDA 1C7YA 4DS5A 4J9LA 4KLFA 5AI8A 5DDYA 1HEKA 1X66A 3O0FA 5AKLA 1SKRA 1K1QA 2F8KA 4IS7A 3WK7A 3V72A 3RB6A 4IRDA 9ICFA 2E3TA 3GDXA 1F5SA 4Y2RA 2G5HB 2MA1A 3PV8A 3RR8A 3QU7A 1Z1VA 4C8LA 4KN4A 4I2CA 3JPOA 4NLBA 3D2SA 1L3TA 4B9VA 1RYRA 5KFPA 2ATLA 3OSPA 2ZIUA 2XO7A 4C0ZA 3BS5A 4Z6DA 2EAMA 1PK1A 4C8NA 1UCVA 3M6KA 1RYUA 3MR5A 1RQLA 5KFLA 3TFSA 1NK7A 1CEZA 3Q8MA 4OJ6A 4DSLA 3EPGA 1L5UA 3RJFA 3PX6A 4DWIA 3WKEA 2HBLA 3NVZA 1L7NA 4GC7A 3RH5A 1D8BA 4USAA 5GTIU 3TAPA 5KFJA 2QB1A 1SV0A 2K60A 3K4GA 5KT6A 2QARB 1SV0C 1RDFA 5CA7A 4UARA 2YMQA 2DKZA 4UB2A 5L1LA 2G06A 3RB4A 3NVVA 5KFTA 2H3VA 2ZIWA 3GQCA 3WK9A 3E58A 5J2HA 3T5LA 2JH7A 3QUTA 3NVWA 1DGJA 5DBAA 1ZQNA 4BX9C 4B9SA 4J9SA 1XSNA 8ICBA 2RRDA 4QW9A 2G08A 8ICQA 1ZOLA 4YG2A 5ALVA 1NJYA 3QNMA 1TAUA 2EQYA 2BPFA 4AP9A 4F93B 1TVAA 3H4DA 3B0XA 3PX0A 2F44A 2KIWA 4F4YA 5KFDA 3IDWA 3LYSA 3H8WA 1WWVA 3G6YA 2F1JA 2HHVA 5EWEA 3QUQA 4UQGA 5AKXA 3U26A 1UA1A 5J0SA 2EH9A 2D8CA 3ICXA 3D2QA 3PW4A 3A0HU 4OJ5A 1Q46A 1PVRA 2ZIXB 1JXLA 4QWEA 4C4RA 1SXDA 5HNKA 4YD2A 4KLHA 5KL1B 2RHFA 5DLFA 3C28A 4YN4A 8ICVA 2W9MA 3WKBA 3H40A 4PZNA 4UB1A 1K1SA 3M9NB 4J9RA 2EZZA 4NLGA 4ED8A 1RQNA 7ICKA 2MUTB 5L1IA 9ICGA 4KX5A 3C23A 5JU5A 5KFFA 2KG5A 2ZIVA 4UATA 2BCQA 2VANA 9ICRA 8ICOA 5KAFU 4RUAA 4F5PA 4PZOA 5EE1A 2V4QA 4KMOB 3SAFA 3BQ1A 2OM6A 1TAQA 4P0QA 2IMWP 4K4HA 3SD7A 3GV8B 3AEVA 4ECUA 4I28A 5KFEA 2VA8A 2OCEA 7ICRA 3IV6A 3OHBA 2VA2A 1ECWA 5IIJA 3ZDEA 5B66U 4QWAA 4UAVA 1RZTA 2YMPA 5AI6A 2MRLA 2ASLA 2WF9A 2R8HA 4F4XA 2RDJA 3FAHA 2FMQA 5KNIA 3MGHA 1ED1A 2DF4B 4Z6EA 2QB0B 4J9KA 2R8KA 4P0PB 3DV9A 5ALNA 1SGGA 5HMMA 4F4KA 4DSIA 9ICKA 1L7OA 1JALA 4RQ3A 3EZ5A 5G5GA 3WKCA 4PHEA 3NUQA 4FS2A 2WF8A 1LV5A 9ICUA 2YTUA 1QQ7A 4I2JA 7ICVA 2WF6A 1KTQA 1BGXT 2W8KA 4PL1A 5BOMA 2YMMA 5KT2A 1WG8A 3BQ0A 1KDHA 1PK3A 1GO3F 3ALRA 1AQ6A 5KG1A 4YMOA 1H38A 2K4HA 4M9HA 2BDUA 3KD3A 4Y2JA 3QYPA 2E1FA 4G3IA 3T5HA 4DSJA 1S76D 5AI0A 1XSLA 2HHSA 5DBCA 2Y9UA 4FZLA 1BPDA 3QZ8A 4J9PA 4UAZA 2VA3A 2M0NA 2FPMA 2W3SA 4P4MA 2DUYA 4R66A 1FO4A 2ZXIA 5D4BA 5KTQA 5DLGA 3PSTA 2J6UA 4GXKA 2WF7A 5KFVA 2C2RA 2ASDA 1SZHA 2KJ5A 4NY8A 4M47A 2HBMA 8ICWA 5AK4A 1HIWA 2JEGA 1N56A 3LK9A 1MC8A 4RQ6A 2BZFA 1SIJA 3I1YA 4O3PA 4O3QA 3Q8QB 4ECWA 5DG7A 4DFKA 2WF5A 4O3NA 4O0IA 1UT8A 1L8OA 4BXOA 1CI4A 1RXVA 2JZBA 4YMMA 1D9DA 3IP4B 2YMLA 2ZTDA 3BS7A 4JB3A 5HR7A 4QZ8A 3H8JA 2BQUA 1N5XA 1KBUA 1NJWA 1MQ2A 1X9SA 2K8CB 2Q4TA 3SYZA 8ICXA 4Q44A 4F72A 1B22A 1VLBA 5KG3A 1XU4A 5JRTA 4B9TA 2Y1IA 5AKYA 4ELTA 1BNPA 5CB1A 4U6PA 5C0YA 3AN1A 2JEIA 5CWRA 3ISCA 4Z6FA 1Q8KA 3QUCA 3HW8A 1K5OA 2E8OA 9ICXA 2EDUA 1V9PA 5DKWA 4QWCA 3OJUA 3SI8A 2KVSA 3GV7B 2Q0ZX 3EUB2 4DS4A 4I2AA 4TQRA 2IOFA 1OUQA 1MQ3A 3RFAA 1N61A 1J2MA 1KW4A 3RH4A 3ETLA 1NJXA 2ISOA 4LZGA 5AKKA 3SAGA 4DL5A 1PZNA 1TK5A 3AQEA 3HRDD 1S0VA 5DB8A 2BCSA 4PHAA 2DL0A 2W55A 3V6HA 5AM2A 4DQQA 5J8YA 2JGAA 2JMGA 2W9CA 5AM3A 2DWQA 1L3VA 3HT3A 5KT5A 1OW5A 5AKIA 7ICHA 4DFDA 2FE9A 9ICHA 4EYHB 4YXJA 7ICNA 1DK2A 2A1JB 3ORYA 1COKA 1S0OA 2IBKA 2F8LA 4RNNA 2Z7JA 5L1KA 3SMVA 4UAUA 3BQ7A 1ZQWA 3E0FA 1Z00B 4A8EA 2LYHA 3HP6A 1Z19A 9ICTA 4I29A 1SL1A 4MFCA 2JEJA 4J9NA 4C4SA 4GFJA 5ALEA 4ECSA 1ZQXA 5KFKA 2HOFA 1BPZA 7ICLA 4RT3A 5DBBA 5DG9A 4M0AA 4CRXA 2F3NA 2QKQA 3G6VA 2JXJA 4KITB 2KHVA 3JPNA 5ALDA 1M6YA 3IHQB 3N28A 1PVPA 2FMPA 3QZ7A 1ZJMA 1S0MA 1ZQRA 3VCBA 3PY8A 4KLDA 3QUBA 3M1YA 8ICGA 3MR2A 4X5VA 4O3MA 4UB3A 2Y9TA 3BZKA 4YXMA 2H3IA 5KL8B 3C29A 2LBOA 4R65A 5ALIA 4B6JA 5KFWA 1SV4A 3AUOA 4I2BA 4NV0A 2K8AA 8ICZA 3PW2A 3UXPA 5AI4A 2B0CA 4KLQA 4HAIA 3RAXA 1ZYQA 1V85A 5ALLA 2R8GA 4ZOHC 2C22A 2HOQA 4KLLA 4QZAA 3ISBA 1T3QA 3ONNA 1ZD3A 1T3NA 1KFDA 2NRTA 3QXGA 4RQ4A 2XY6A 5CR0A 5AK5A 3QE9Y 2CXYA 5AM0A 3NRZA 1Z4OA 3KZIU 3UMGA 2KZ3A 2L5YA 3SR6A 4BWJA 5KFMA 1ZQIA 4IL6U 2KFZA 3SZ2A 3HX0A 4I2IA 4YCXA 4EX7A 4M9GA 3ZD8A 7ICQA 1TK8A 2XCAA 2PMZF 2AGPA 1ZQTA 2Y0SF 5HP4A 3F5EA 2ZIUB 3FYHA 4UASA 1NJZA 2IOHA 3BS5B 1X9WA 4QZ9A 4UB4A 4F92B 8ICKA 3C1ZA 3TKAA 2KV2A 1EXNA 2A1AA 2OHFA 1QSSA 1COOA 4J9QA 1ZQFA 3SV3A 1TV9A 3RRGA 9ICQA 2AHOB 3ZI4A 2OXOA 3DEEA 3V6JA 5J29A 5KG2A 5AKGA 2YY6A 4QZDA 2ZUDA 2MAXA 4FO6A 4DFMA 4QW8A 1BPEA 3R9KA 1WUDA 8ICUA 1X40A 3CP8A 4YVZA 3TADA 4RU9A 2A3VA 1HJPA 3TADC 4Y2VA 4XA5A 2ZIWB 4DFPA 2DFLA 1QH9A 2B21A 2PFPA 2HBJA 5DQIA 1JRPA 1Q3UA 5J2GA 8ICTA 2C2EA 5F9LA 5AIAA 4BUGA 3HPOA 1SL2A 2XICA 3QU2A 1FEZA 4EEYA 5DB7A 4DL6A 4YR2A 8ICHA 5AICA 4QZGA 2QARA 9ICSA 4DCCA 2P66A 5JUMA 4I2FA 4NL9C 3NGDA 4IQVA 5ALZA 1IXRA 2BHNA 7ICJA 4KX3A 8ICAA 1ZETA 5AK3A 1KLNA 1T8EA 4MFFA 1QQ6A 4PH5A 2HHQA 4PGYA 1KFTA 3KHGA 3TQ1A 2O6KA 1P7DA 4FFDA 4DF4A 8ICCA 4QZIA 4K4IA 1ZQOA 2UVVA 9ICBA 5KFAA 1Z3EB 2JHDA 2F76X 4RQ2A 4JWNA 5DGAA 4ACOA 9ICWA 3PR5B 4ECZA 4FE3A 4J9MA 3PX4A 1KN5A 2ODGA 2W43A 5KFXA 3KHLA 3UQ2A 5J2EA 4DSKA 3F2CA 4ECVA 2ESEA 2PI5A 3KZXA 2Y0SC 3M8SA 4EEKA 5KFBA 1SB3C 3TARA 2KZZA 1X9XA 1D8LA 4P0QB 2BCUA 1KEJA 1UHUA 4I2DA 3MR6A 2MU2A 3RR7A 4F4WA 5L9XA 2B6GA 9ICCA 4R63A 5J2BA 5ALKA 2NYVA 9ICPA 5KFSA 3AM9A 4DLEA 1N62A 4ED7A 2DBYA 3PNCA 2W03A 3PSIA 4B9NA 2NO5A 4C8MA 2ZUBA 2MUTA 3Q8RB 1X6JA 1TFRA 3HJEA 4RQ5A 3QEAZ 1QSLA 2G5IB 2W9AA 2P6RA 4J9OA 8ICMA 8ICPA 3BJYA 4O5KA 1L6NA 2YX8A 3D6JA 5KAIU 4RQ1A 2H3QA 3QU5A 5ALMA 2HSZA 5A0LA 3PZPA 3E2EA 4FZMA 3WK4A 4O3OA 2WHEA 2AU0A 1ZQ1C 2VJ5A 2BQRA 5C5JA 3JPTA 4C80A 5J2FA 2G07A 3OSNA 3ED5A 2W8LA 1DXSA 4DLGA 4DQIA 2FI1A 3IN5A 5CRXA 3WK8A 2J6TA 4NJ8A 5H2FU 4P0PA 3EPIA 1VJ5A 3F5AA 5L1MA 2FPLA 4C7YA 3MGVA 4I2EA 5ALQA 2HHWA 8ICNA 1S97A 1UA0A 5KG7A 2PI4A 5ALRA 4JV0A 1SZPA 4QZEA 1SWVA 1ZQLA 4IR1A 3IM1A 4OJOA 5ALXA 4TUSA 4ECTA 2PFQA 5JTIA 2ZTEA 1D8YA 4GXJA 5IIKA 3MBYA 1RG6A 4ED2A 5J2JA 5ALFA 1QCKA 2KSOB 2AXTU 2KD1A 2BPGA 7ICTA 3C5FA 3ISDA 3RTVA 2D3DA 2MSNA 4DO9A 3UM9A 4LZDA 2BDPA 3NS1A 4UBBA 1QSYA 2R8JA 4BXOB 3KHHA 2JZBB 1ZQYA 1F44A 8ICYA 5ALGA 1UT5A 3WK6A 1PUZA 3C5GA 1NZBA 5TZVA 3M6ZA 3UXNA 4F4ZA 2GO7A 8ICFA 3KBBA 4ED3A 4O9MA 3UMBA 4ELUA 4R8UB 4US9A 3ZD9A 3BQTA 3Q8LA 3PSPA 4NWIA 2KHQA 3TFRA 5TISU 7ICUA 4F5OA 1X6IA 3UXOA 1XWLA 2N1RA 4E0DA 5J0YA 2BPCA 3N7RC 9ICIA 3MABA 4UW9A 3WU2U 3QU9A 4UBCA 3UPQA 2UVRA 2OYYA 1ZQAA 2HHUA 5KFGA 2VIXA 1JXEA 4NM2A 1A6SA 3CRXA 1Q3VA 9ICOA 1ZQUA 4DOAA 7ICPA 5CHGA 2K4PA 9ICMA 4NLZA 5J0PA 1ZRNA 3ZDCA 3FDSA 1DK3A 2DGZA 5KG6A 4O5CA 3UQ0A 1HUZA 4XRHA 1L7PA 1JUDA 5KG4A 3TAQA 2HHXA 4JWMA 3HKZF 2W3RA 4UAWA 1SWWA 4DL7A 2HMXA 1D9FA 3OPXA 2RP5A 2WAQF 2JH1A 4GC6A 3A0BU 2ZJAA 4CF4A 3RJJA 3C2LA 1JIHA 1TAMA 4RPYA 1BVSA 1PVQA 5J2DA 2I5HA 1LKYB 2HI0A 5E79U 5CJ7A 3QU4A 3V7LA 2W9BA 1UPHA 1UQVA 2XIDA 1IG6A 5BPCA 4M6WB 1S8OA 1BPBA 2W7PA 3IG5A 2ASJA 4O5EA 2KZMA 2CPRA 2IHNA 5J0OA 1T4GA 4QZFA 1T7PA 3RJIA 1C20A 2XGQA 3JPQA 1QQ5A 1NK4A 4DL2A 3GFKB 4Y2UA 2ZJ5A 2A19A 3RRHA 4EBDA 4RPXA 3N4MB
chains in the Genus database with same CATH topology
1TV9A 3PW5A 4F8RA 5J2CA 2V4QA 5L1JA 9ICQA 3BQ1A 4UAYA 5J0TA 5EOZA 5J0WA 1TAQA 4F2SA 2IMWP 4K4HA 4EYIB 3T5KA 3V6JA 4JV1A 1LB2B 5J29A 3GV8B 3BQ2A 1JX4A 4IRCA 5KG2A 1A76A 1WCNA 5CP2A 4ECUA 1XS9D 3OHAA 4FBUA 4I28A 4QZDA 3BDPA 5DGBA 3RJEA 2ZUDA 4IQUA 5KFEA 2VA8A 8ICSA 1HUOA 4QZCA 2MAXA 7ICRA 4FO6A 4DFMA 4QW8A 3OHBA 5IIMA 1BPEA 1Z00A 3Q8KA 2VA2A 8ICUA 2AQ0A 4YVZA 5IIJA 3ZDEA 4QWAA 2HHVA 4RU9A 2AGOA 1HJPA 4YQWA 4XA5A 3RJHA 4EZ9A 4DFPA 1RZTA 2DFLA 2B21A 1X9MA 1ZQLA 2PFPA 4IR1A 4KLOA 5DQIA 2ASLA 2AQ4A 2DPJA 2KFNA 3ZDAA 3ZDDA 5J2GA 2R8HA 4F4XA 2RDJA 4F5RA 1ZQBA 2C2EA 5F9LA 8ICTA 4DOCA 7ICGA 2FMQA 3HPOA 1SL2A 3MGHA 3RRGA 1XC9A 4R8UA 4Z6EA 4DQPA 3M9MB 4J9KA 4FS1A 4ECRA 1NK6A 4DL3A 4EEYA 1S9FA 5DB7A 1ZQJA 3PMNA 4DL6A 4YR2A 3JPRA 8ICHA 4RUCA 2R8KA 3K75D 1S10A 5HMMA 4F4KA 8ICRA 5J0UA 2F1IA 4DSIA 1SKWA 4MF8A 2NRXA 9ICKA 4QZGA 2IA6A 2RDIA 3PW7A 9ICSA 1NK0A 2H5XA 4RQ3A 3EZ5A 2P66A 5JUMA 4PHEA 4B9UA 4I2FA 4FS2A 2UVWA 9ICAA 3NGDA 4IQVA 1LV5A 5HHHA 9ICUA 1IXRA 8ICIA 2BHNA 7ICJA 2I1QA 4I2JA 8ICAA 1B43A 1ZETA 1KLNA 4YR3A 1T8EA 4PGQA 4DEZA 3EWAA 4GLXA 4MFFA 4DQRA 4PH5A 7ICVA 3PMLA 1NK5A 4PGYA 3MFHA 1KTQA 1BGXT 2W8KA 2PXIA 4ECQA 3RB3A 3KHGA 3TQ1A 2W9CB 1ZQDA 4FBTA 2BCVA 4DF4A 8ICCA 1JMSA 5BOMA 1U4BA 4KLJA 1TKDA 1ZQCA 4QZIA 3PR4A 4M9LA 5IIIA 3RB0A 4K4IA 1ZQOA 2F1HA 2UVVA 5KT2A 9ICBA 1KDHA 5J2AA 3BQ0A 2W9BB 5KFAA 1Z3EB 4BDPA 4QZBA 3M9OB 4RQ2A 1ZQEA 1NKEA 4JWNA 2GWSA 5IINA 5KG1A 5DGAA 4YMOA 4PGXA 4HYKA 1H38A 4DSEA 4M9HA 9ICWA 7ICEA 4F5NA 3PR5B 4ECZA 4J9MA 4P4PA 4BWMA 3PX4A 4G3IA 3T5HA 4DSJA 4O3SA 1S76D 5DB6A 1XSLA 5DG8A 5DBCA 3JPPA 4MEXA 3NTUA 5KFXA 3SV4A 4DSFA 4Z6CA 4RQ8A 4KLGA 3JPSA 4DFJA 1BPDA 3QZ8A 5J2EA 3KHLA 3EW9A 3UQ2A 4J9PA 4EBCA 4ECVA 4DSKA 2OWOA 4UAZA 2M9NA 3MR3A 1ZQQA 4M9JA 4KLEA 2VA3A 5DB9A 2PI5A 4XUSA 4YR0A 4DF8A 2FPMA 4P4MA 1A77A 2P6UA 1NK8A 4R66A 5IILA 3M8SA 1ZQSA 5J0RA 4DL4A 2WTFA 1ZQGA 5KFBA 5D4BA 2IHMA 5KTQA 5DLGA 1TK0A 2J6SA 4GXIA 2J6UA 2KTQA 3Q8PB 4QWDA 4GXKA 9ICLA 3TARA 5KFVA 4KTQA 4PHDA 4XQ8A 5KFQA 2ASDA 2C2RA 2KZZA 1D8LA 8ICPA 3T5JA 2BCUA 4MFAA 4NY8A 1KEJA 4I2DA 3MR6A 4M47A 4I2GA 8ICWA 2BR0A 2BCRA 1U9LA 3RR7A 2A1JA 3MFIA 4F4WA 5L9XA 2JEGA 1MSWD 9ICCA 4R63A 1DOQA 4M6WA 5KT7A 5J2BA 5KFNA 1N56A 3LK9A 1MC8A 2FMSA 5KFSA 2FPKA 9ICPA 4DLEA 4RQ6A 4Q8FA 4ED7A 1ZQFA 4O3PA 5J0QA 5EWFA 4NLNA 1ZQVA 4O3QA 3PNCA 3Q8QB 3GIIA 4ECWA 2C28A 4B9NA 5DG7A 5HHIA 4C8MA 4DFKA 4O3NA 4NM1A 2ZUBA 4O0IA 1Y88A 1UT8A 2MUTA 5DQHA 2ZJ8A 4BXOA 3Q8RB 2HW3A 4F2RA 4NLKA 1RXVA 2JZBA 2PFOA 3RH6A 1TFRA 4YMMA 4JV2A 1D9DA 2ZTDA 4RQ5A 3QEAZ 3AU2A 1QSLA 4QZ8A 3H8JA 5BOLA 1X2IA 2BQUA 2V9WA 2W9AA 1DGSA 4KLSA 4ECYA 3PVXA 1NJWA 1MQ2A 1X9SA 3OGUA 5KFCA 4RNMA 2XGPA 2I9GA 2P6RA 3H8SA 3V7KA 4J9OA 3EYZA 4MF2A 4C8OA 3SYZA 5KT4A 3LWMA 4TURA 3BJYA 4O5KA 3Q8SB 2AJQA 4Q44A 8ICMA 1B22A 5KG3A 1XU4A 4RQ1A 3E2EA 4B9TA 2Y1IA 1L3SA 4O3OA 3KHRA 3LDAA 4IQTA 1KFTA 4EBEA 2XCPA 1NKCA 4ELTA 1JN3A 3AU6A 4KLMA 5CB1A 2AU0A 2JEIA 2XY5A 5CWRA 5DQGA 3ISCA 4Z6FA 2BGWA 2BQRA 9ICNA 2C2DA 5C5JA 3JPTA 4Q8EA 9ICEA 5J2FA 1NOMA 3HW8A 1BPYA 9ICXA 2FLPA 1XO1A 4C8KA 4ED0A 1V9PA 5DKWA 4QWCA 3OSNA 3OJUA 4ED1A 3SI8A 4PPXA 8ICEA 1ZQMA 5KFHA 2W8LA 2PFNA 3GV7B 4JK1A 3MDCA 3RBDA 3RAQA 2Q0ZX 2ALZA 4DS4A 1ZQKA 7ICMA 4I2AA 2BKEA 4TQRA 3C1YA 4F5QA 3H7IA 4TUPA 1U49A 4B9MA 4TUQA 8ICLA 4EZ6A 4O3RA 4DLGA 4DQIA 1MQ3A 1KRPA 5KFUA 1CUKA 1U48A 2ZTCA 2J6TA 3G6XA 3ETLA 3RH4A 4TQSA 1NJXA 2ISOA 5KFYA 2ZUCA 3EPIA 4Q45A 4KMUA 4LZGA 3M8RA 4PHPA 1SKSA 5D49A 4DL5A 1PZNA 1TK5A 3B0YA 2FPLA 5DDMA 4MEYA 1S0VA 4I2EA 3PW0A 2HHWA 8ICNA 1S97A 1UA0A 5DB8A 2BCSA 4F3OA 4PHAA 5KG7A 1ZQPA 4YD1A 2PI4A 1RYSA 4LVSA 1SL0A 2XY7A 3V6HA 4DQQA 4M2YA 4JV0A 4ELVA 1SZPA 2AGQA 4I2HA 4QZEA 3HWTA 4YP3A 4QWBA 5KG0A 5KT3A 4KN7A 3IM1A 2XC9A 4DS5A 1C7YA 2W9CA 1QTMA 4TUSA 4F91B 4ECTA 4J9LA 5J2KA 4IQWA 4KLFA 4JUZA 4R64A 2PFQA 4RPZA 5DDYA 1L3VA 3KTQA 1IM4A 2ZTEA 3HT3A 5KT5A 1D8YA 4K4GA 7ICHA 4GXJA 5IIKA 3MBYA 9ICHA 4RT2A 4EYHB 1SKRA 1K1QA 4YXJA 7ICNA 2A1JB 4ED2A 5J2JA 5KFZA 4F50A 3ORYA 1S77D 3V72A 3RB6A 1S0OA 2BPGA 1KFSA 4P2HA 3TANA 4IRDA 2IBKA 7ICTA 4ECXA 3C5FA 9ICFA 3ISDA 2NRWA 3GDXA 3RTVA 4RNNA 2BQ3A 3PV8A 3RR8A 5L1KA 4DO9A 4C8LA 3GIJA 1ZQWA 4KN4A 3C21A 4LZDA 2BDPA 3JPOA 4I2CA 8ICXA 1L3TA 4UBBA 1Z00B 1QSYA 2LYHA 3HP6A 2R8JA 4B9VA 9ICTA 1RYRA 4UB5A 1SL1A 4BXOB 2JEJA 5KFPA 3KHHA 4J9NA 2ATLA 4B9LA 2KN7A 3OSPA 9ICJA 2XO7A 2JZBB 1ZQYA 1QLNA 2HVHA 4ECSA 8ICYA 1ZQXA 4Z6DA 1UT5A 1XSPA 5KFKA 5J0XA 3C5GA 3QEBZ 1BPZA 4C8NA 4KLUA 7ICLA 5TZVA 3PO4A 3MR5A 1CEZA 3TFSA 5KFLA 1NK7A 4RT3A 3UXNA 4F4ZA 3Q8MA 5DBBA 2ISPA 4DSLA 3EPGA 1L5UA 3RJFA 3PX6A 5DG9A 4CCHA 4DWIA 8ICFA 4M0AA 4ED3A 4O9MA 4P4OA 4ELUA 4KITB 3G6VA 5KFOA 4R8UB 3ZD9A 3JPNA 4GC7A 2V4RA 3BQTA 3RH5A 2Y1JA 3IHQB 3Q8LA 1ZJNA 4RQ7A 3TAPA 2FMPA 5KFIA 3TFRA 7ICFA 4MFCA 5KFJA 3QZ7A 7ICUA 1ZJMA 4F5OA 1S0MA 1ZQRA 3UXOA 1XWLA 3K4GA 5KT6A 4E0DA 3OJSA 4RZRA 4NXZA 3RBEA 5J0YA 2BPCA 2HHSA 9ICIA 3MABA 5CA7A 3PY8A 2FLLA 3RJKA 4UBCA 3UPQA 2UVRA 4UB2A 1S0NA 4KLDA 2HHTA 8ICGA 1ZQAA 3MR2A 5L1LA 4X5VA 5KFGA 2HHUA 1NKBA 1JXEA 4NM2A 3RB4A 3ZDBA 4UB3A 3TI0A 5KFTA 1ZQHA 8ICJA 4YXMA 1NK9A 1U47A 3GQCA 9ICOA 1ZQUA 4DOAA 5J2HA 3T5LA 2DPIA 7ICPA 5CHGA 3THVA 5DBAA 4R65A 1ZQNA 9ICMA 4NLZA 5KFWA 4B9SA 4J9SA 3AUOA 1XSNA 8ICBA 4I2BA 4ED6A 5J0PA 1AROP 4BGDA 4QW9A 3ZDCA 2NRZA 3FDSA 8ICZA 3GIMA 3PW2A 3UXPA 5KG6A 8ICQA 4I27A 4KLQA 4O5CA 3UQ0A 1HUZA 4YG2A 3RAXA 1ZYQA 4XRHA 5EWGA 1NJYA 3GILA 1TAUA 2BPFA 4F93B 2R8GA 1ZQZA 1TVAA 2C22A 5KG4A 2NRVA 3B0XA 3H4DA 3PX0A 3TAQA 2HHXA 1L3UA 4JWMA 3GIKA 4UAWA 4KLLA 4QZAA 4RNOA 5KFDA 4F4YA 4DL7A 7ICSA 3MGIA 3H8WA 3ISBA 3G6YA 4DOBA 1T3NA 2F1JA 1KFDA 2NRTA 4RQ4A 5EWEA 4KLIA 2JEFA 1U45A 3PO5A 4M04A 2XY6A 5CR0A 4QZHA 3QE9Y 3MDAA 1D9FA 4UQGA 5KG5A 1UA1A 4GC6A 2ZJAA 5J0SA 3RJJA 3C2LA 2KZ3A 5KFMA 1JIHA 4BWJA 4ZH4A 3PW4A 3V7JA 4IRKA 4RPYA 1BVSA 5D46A 1ZQIA 5J2DA 5CJ7A 3H4BA 3V7LA 2KFZA 2W9BA 3SZ2A 1JXLA 4QWEA 3HX0A 4I2IA 4YCXA 4Q43A 5HNKA 5BPCA 2R8IA 3RJGA 4M9GA 4IR9A 3ZD8A 5F9NA 4YD2A 4M6WB 7ICQA 1TK8A 1RXWA 4KLHA 1KSPA 1BPBA 3T3FA 5DLFA 2HHQA 1WCLA 2XCAA 3V6KA 2AGPA 1ZQTA 7ICIA 2HVIA 5HP4A 2ASJA 4YN4A 4O5EA 2KZMA 4DQSA 5HMLA 3FYHA 8ICVA 2W9MA 1NJZA 4YFKA 1X9WA 2IHNA 4QZ9A 5J0OA 1T4GA 4UB4A 4M9NA 3H40A 4UB1A 1K1SA 4QZFA 3M9NB 4J9RA 1BPXA 1T7PA 4F92B 4NLGA 4ED8A 8ICKA 1RPLA 2MUTB 5L1IA 3RJIA 5KFRA 3C1ZA 4RQ0A 4I29A 3C23A 7ICKA 7ICOA 5IIOA 2XGQA 9ICGA 3JPQA 5KFFA 3N97B 4KLTA 9ICVA 1NK4A 4DL2A 3GFKB 3C2MA 2FLNA 5J2IA 1EXNA 4YMNA 2UVUA 1N48A 2ZJ5A 3GV5B 2BCQA 2VANA 9ICRA 1QSSA 1COOA 4J9QA 3LWLA 3RRHA 4EBDA 4RPXA 8ICOA 4RUAA 3N4MB 4F5PA 3C2KA 3SV3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TV9 A;  3PW5 A;  4F8R A;  5J2C A;  2V4Q A;  5L1J A;  9ICQ A;  3BQ1 A;  4UAY A;  5J0T A;  5EOZ A;  5J0W A;  1TAQ A;  4F2S A;  2IMW P;  4K4H A;  4EYI B;  3T5K A;  3V6J A;  4JV1 A;  1LB2 B;  5J29 A;  3GV8 B;  3BQ2 A;  1JX4 A;  4IRC A;  5KG2 A;  1A76 A;  1WCN A;  5CP2 A;  4ECU A;  1XS9 D;  3OHA A;  4FBU A;  4I28 A;  4QZD A;  3BDP A;  5DGB A;  3RJE A;  2ZUD A;  4IQU A;  5KFE A;  2VA8 A;  8ICS A;  1HUO A;  4QZC A;  2MAX A;  7ICR A;  4FO6 A;  4DFM A;  4QW8 A;  3OHB A;  5IIM A;  1BPE A;  1Z00 A;  3Q8K A;  2VA2 A;  8ICU A;  2AQ0 A;  4YVZ A;  5IIJ A;  3ZDE A;  4QWA A;  2HHV A;  4RU9 A;  2AGO A;  1HJP A;  4YQW A;  4XA5 A;  3RJH A;  4EZ9 A;  4DFP A;  1RZT A;  2DFL A;  2B21 A;  1X9M A;  1ZQL A;  2PFP A;  4IR1 A;  4KLO A;  5DQI A;  2ASL A;  2AQ4 A;  2DPJ A;  2KFN A;  3ZDA A;  3ZDD A;  5J2G A;  2R8H A;  4F4X A;  2RDJ A;  4F5R A;  1ZQB A;  2C2E A;  5F9L A;  8ICT A;  4DOC A;  7ICG A;  2FMQ A;  3HPO A;  1SL2 A;  3MGH A;  3RRG A;  1XC9 A;  4R8U A;  4Z6E A;  4DQP A;  3M9M B;  4J9K A;  4FS1 A;  4ECR A;  1NK6 A;  4DL3 A;  4EEY A;  1S9F A;  5DB7 A;  1ZQJ A;  3PMN A;  4DL6 A;  4YR2 A;  3JPR A;  8ICH A;  4RUC A;  2R8K A;  3K75 D;  1S10 A;  5HMM A;  4F4K A;  8ICR A;  5J0U A;  2F1I A;  4DSI A;  1SKW A;  4MF8 A;  2NRX A;  9ICK A;  4QZG A;  2IA6 A;  2RDI A;  3PW7 A;  9ICS A;  1NK0 A;  2H5X A;  4RQ3 A;  3EZ5 A;  2P66 A;  5JUM A;  4PHE A;  4B9U A;  4I2F A;  4FS2 A;  2UVW A;  9ICA A;  3NGD A;  4IQV A;  1LV5 A;  5HHH A;  9ICU A;  1IXR A;  8ICI A;  2BHN A;  7ICJ A;  2I1Q A;  4I2J A;  8ICA A;  1B43 A;  1ZET A;  1KLN A;  4YR3 A;  1T8E A;  4PGQ A;  4DEZ A;  3EWA A;  4GLX A;  4MFF A;  4DQR A;  4PH5 A;  7ICV A;  3PML A;  1NK5 A;  4PGY A;  3MFH A;  1KTQ A;  1BGX T;  2W8K A;  2PXI A;  4ECQ A;  3RB3 A;  3KHG A;  3TQ1 A;  2W9C B;  1ZQD A;  4FBT A;  2BCV A;  4DF4 A;  8ICC A;  1JMS A;  5BOM A;  1U4B A;  4KLJ A;  1TKD A;  1ZQC A;  4QZI A;  3PR4 A;  4M9L A;  5III A;  3RB0 A;  4K4I A;  1ZQO A;  2F1H A;  2UVV A;  5KT2 A;  9ICB A;  1KDH A;  5J2A A;  3BQ0 A;  2W9B B;  5KFA A;  1Z3E B;  4BDP A;  4QZB A;  3M9O B;  4RQ2 A;  1ZQE A;  1NKE A;  4JWN A;  2GWS A;  5IIN A;  5KG1 A;  5DGA A;  4YMO A;  4PGX A;  4HYK A;  1H38 A;  4DSE A;  4M9H A;  9ICW A;  7ICE A;  4F5N A;  3PR5 B;  4ECZ A;  4J9M A;  4P4P A;  4BWM A;  3PX4 A;  4G3I A;  3T5H A;  4DSJ A;  4O3S A;  1S76 D;  5DB6 A;  1XSL A;  5DG8 A;  5DBC A;  3JPP A;  4MEX A;  3NTU A;  5KFX A;  3SV4 A;  4DSF A;  4Z6C A;  4RQ8 A;  4KLG A;  3JPS A;  4DFJ A;  1BPD A;  3QZ8 A;  5J2E A;  3KHL A;  3EW9 A;  3UQ2 A;  4J9P A;  4EBC A;  4ECV A;  4DSK A;  2OWO A;  4UAZ A;  2M9N A;  3MR3 A;  1ZQQ A;  4M9J A;  4KLE A;  2VA3 A;  5DB9 A;  2PI5 A;  4XUS A;  4YR0 A;  4DF8 A;  2FPM A;  4P4M A;  1A77 A;  2P6U A;  1NK8 A;  4R66 A;  5IIL A;  3M8S A;  1ZQS A;  5J0R A;  4DL4 A;  2WTF A;  1ZQG A;  5KFB A;  5D4B A;  2IHM A;  5KTQ A;  5DLG A;  1TK0 A;  2J6S A;  4GXI A;  2J6U A;  2KTQ A;  3Q8P B;  4QWD A;  4GXK A;  9ICL A;  3TAR A;  5KFV A;  4KTQ A;  4PHD A;  4XQ8 A;  5KFQ A;  2ASD A;  2C2R A;  2KZZ A;  1D8L A;  8ICP A;  3T5J A;  2BCU A;  4MFA A;  4NY8 A;  1KEJ A;  4I2D A;  3MR6 A;  4M47 A;  4I2G A;  8ICW A;  2BR0 A;  2BCR A;  1U9L A;  3RR7 A;  2A1J A;  3MFI A;  4F4W A;  5L9X A;  2JEG A;  1MSW D;  9ICC A;  4R63 A;  1DOQ A;  4M6W A;  5KT7 A;  5J2B A;  5KFN A;  1N56 A;  3LK9 A;  1MC8 A;  2FMS A;  5KFS A;  2FPK A;  9ICP A;  4DLE A;  4RQ6 A;  4Q8F A;  4ED7 A;  1ZQF A;  4O3P A;  5J0Q A;  5EWF A;  4NLN A;  1ZQV A;  4O3Q A;  3PNC A;  3Q8Q B;  3GII A;  4ECW A;  2C28 A;  4B9N A;  5DG7 A;  5HHI A;  4C8M A;  4DFK A;  4O3N A;  4NM1 A;  2ZUB A;  4O0I A;  1Y88 A;  1UT8 A;  2MUT A;  5DQH A;  2ZJ8 A;  4BXO A;  3Q8R B;  2HW3 A;  4F2R A;  4NLK A;  1RXV A;  2JZB A;  2PFO A;  3RH6 A;  1TFR A;  4YMM A;  4JV2 A;  1D9D A;  2ZTD A;  4RQ5 A;  3QEA Z;  3AU2 A;  1QSL A;  4QZ8 A;  3H8J A;  5BOL A;  1X2I A;  2BQU A;  2V9W A;  2W9A A;  1DGS A;  4KLS A;  4ECY A;  3PVX A;  1NJW A;  1MQ2 A;  1X9S A;  3OGU A;  5KFC A;  4RNM A;  2XGP A;  2I9G A;  2P6R A;  3H8S A;  3V7K A;  4J9O A;  3EYZ A;  4MF2 A;  4C8O A;  3SYZ A;  5KT4 A;  3LWM A;  4TUR A;  3BJY A;  4O5K A;  3Q8S B;  2AJQ A;  4Q44 A;  8ICM A;  1B22 A;  5KG3 A;  1XU4 A;  4RQ1 A;  3E2E A;  4B9T A;  2Y1I A;  1L3S A;  4O3O A;  3KHR A;  3LDA A;  4IQT A;  1KFT A;  4EBE A;  2XCP A;  1NKC A;  4ELT A;  1JN3 A;  3AU6 A;  4KLM A;  5CB1 A;  2AU0 A;  2JEI A;  2XY5 A;  5CWR A;  5DQG A;  3ISC A;  4Z6F A;  2BGW A;  2BQR A;  9ICN A;  2C2D A;  5C5J A;  3JPT A;  4Q8E A;  9ICE A;  5J2F A;  1NOM A;  3HW8 A;  1BPY A;  9ICX A;  2FLP A;  1XO1 A;  4C8K A;  4ED0 A;  1V9P A;  5DKW A;  4QWC A;  3OSN A;  3OJU A;  4ED1 A;  3SI8 A;  4PPX A;  8ICE A;  1ZQM A;  5KFH A;  2W8L A;  2PFN A;  3GV7 B;  4JK1 A;  3MDC A;  3RBD A;  3RAQ A;  2Q0Z X;  2ALZ A;  4DS4 A;  1ZQK A;  7ICM A;  4I2A A;  2BKE A;  4TQR A;  3C1Y A;  4F5Q A;  3H7I A;  4TUP A;  1U49 A;  4B9M A;  4TUQ A;  8ICL A;  4EZ6 A;  4O3R A;  4DLG A;  4DQI A;  1MQ3 A;  1KRP A;  5KFU A;  1CUK A;  1U48 A;  2ZTC A;  2J6T A;  3G6X A;  3ETL A;  3RH4 A;  4TQS A;  1NJX A;  2ISO A;  5KFY A;  2ZUC A;  3EPI A;  4Q45 A;  4KMU A;  4LZG A;  3M8R A;  4PHP A;  1SKS A;  5D49 A;  4DL5 A;  1PZN A;  1TK5 A;  3B0Y A;  2FPL A;  5DDM A;  4MEY A;  1S0V A;  4I2E A;  3PW0 A;  2HHW A;  8ICN A;  1S97 A;  1UA0 A;  5DB8 A;  2BCS A;  4F3O A;  4PHA A;  5KG7 A;  1ZQP A;  4YD1 A;  2PI4 A;  1RYS A;  4LVS A;  1SL0 A;  2XY7 A;  3V6H A;  4DQQ A;  4M2Y A;  4JV0 A;  4ELV A;  1SZP A;  2AGQ A;  4I2H A;  4QZE A;  3HWT A;  4YP3 A;  4QWB A;  5KG0 A;  5KT3 A;  4KN7 A;  3IM1 A;  2XC9 A;  4DS5 A;  1C7Y A;  2W9C A;  1QTM A;  4TUS A;  4F91 B;  4ECT A;  4J9L A;  5J2K A;  4IQW A;  4KLF A;  4JUZ A;  4R64 A;  2PFQ A;  4RPZ A;  5DDY A;  1L3V A;  3KTQ A;  1IM4 A;  2ZTE A;  3HT3 A;  5KT5 A;  1D8Y A;  4K4G A;  7ICH A;  4GXJ A;  5IIK A;  3MBY A;  9ICH A;  4RT2 A;  4EYH B;  1SKR A;  1K1Q A;  4YXJ A;  7ICN A;  2A1J B;  4ED2 A;  5J2J A;  5KFZ A;  4F50 A;  3ORY A;  1S77 D;  3V72 A;  3RB6 A;  1S0O A;  2BPG A;  1KFS A;  4P2H A;  3TAN A;  4IRD A;  2IBK A;  7ICT A;  4ECX A;  3C5F A;  9ICF A;  3ISD A;  2NRW A;  3GDX A;  3RTV A;  4RNN A;  2BQ3 A;  3PV8 A;  3RR8 A;  5L1K A;  4DO9 A;  4C8L A;  3GIJ A;  1ZQW A;  4KN4 A;  3C21 A;  4LZD A;  2BDP A;  3JPO A;  4I2C A;  8ICX A;  1L3T A;  4UBB A;  1Z00 B;  1QSY A;  2LYH A;  3HP6 A;  2R8J A;  4B9V A;  9ICT A;  1RYR A;  4UB5 A;  1SL1 A;  4BXO B;  2JEJ A;  5KFP A;  3KHH A;  4J9N A;  2ATL A;  4B9L A;  2KN7 A;  3OSP A;  9ICJ A;  2XO7 A;  2JZB B;  1ZQY A;  1QLN A;  2HVH A;  4ECS A;  8ICY A;  1ZQX A;  4Z6D A;  1UT5 A;  1XSP A;  5KFK A;  5J0X A;  3C5G A;  3QEB Z;  1BPZ A;  4C8N A;  4KLU A;  7ICL A;  5TZV A;  3PO4 A;  3MR5 A;  1CEZ A;  3TFS A;  5KFL A;  1NK7 A;  4RT3 A;  3UXN A;  4F4Z A;  3Q8M A;  5DBB A;  2ISP A;  4DSL A;  3EPG A;  1L5U A;  3RJF A;  3PX6 A;  5DG9 A;  4CCH A;  4DWI A;  8ICF A;  4M0A A;  4ED3 A;  4O9M A;  4P4O A;  4ELU A;  4KIT B;  3G6V A;  5KFO A;  4R8U B;  3ZD9 A;  3JPN A;  4GC7 A;  2V4R A;  3BQT A;  3RH5 A;  2Y1J A;  3IHQ B;  3Q8L A;  1ZJN A;  4RQ7 A;  3TAP A;  2FMP A;  5KFI A;  3TFR A;  7ICF A;  4MFC A;  5KFJ A;  3QZ7 A;  7ICU A;  1ZJM A;  4F5O A;  1S0M A;  1ZQR A;  3UXO A;  1XWL A;  3K4G A;  5KT6 A;  4E0D A;  3OJS A;  4RZR A;  4NXZ A;  3RBE A;  5J0Y A;  2BPC A;  2HHS A;  9ICI A;  3MAB A;  5CA7 A;  3PY8 A;  2FLL A;  3RJK A;  4UBC A;  3UPQ A;  2UVR A;  4UB2 A;  1S0N A;  4KLD A;  2HHT A;  8ICG A;  1ZQA A;  3MR2 A;  5L1L A;  4X5V A;  5KFG A;  2HHU A;  1NKB A;  1JXE A;  4NM2 A;  3RB4 A;  3ZDB A;  4UB3 A;  3TI0 A;  5KFT A;  1ZQH A;  8ICJ A;  4YXM A;  1NK9 A;  1U47 A;  3GQC A;  9ICO A;  1ZQU A;  4DOA A;  5J2H A;  3T5L A;  2DPI A;  7ICP A;  5CHG A;  3THV A;  5DBA A;  4R65 A;  1ZQN A;  9ICM A;  4NLZ A;  5KFW A;  4B9S A;  4J9S A;  3AUO A;  1XSN A;  8ICB A;  4I2B A;  4ED6 A;  5J0P A;  1ARO P;  4BGD A;  4QW9 A;  3ZDC A;  2NRZ A;  3FDS A;  8ICZ A;  3GIM A;  3PW2 A;  3UXP A;  5KG6 A;  8ICQ A;  4I27 A;  4KLQ A;  4O5C A;  3UQ0 A;  1HUZ A;  4YG2 A;  3RAX A;  1ZYQ A;  4XRH A;  5EWG A;  1NJY A;  3GIL A;  1TAU A;  2BPF A;  4F93 B;  2R8G A;  1ZQZ A;  1TVA A;  2C22 A;  5KG4 A;  2NRV A;  3B0X A;  3H4D A;  3PX0 A;  3TAQ A;  2HHX A;  1L3U A;  4JWM A;  3GIK A;  4UAW A;  4KLL A;  4QZA A;  4RNO A;  5KFD A;  4F4Y A;  4DL7 A;  7ICS A;  3MGI A;  3H8W A;  3ISB A;  3G6Y A;  4DOB A;  1T3N A;  2F1J A;  1KFD A;  2NRT A;  4RQ4 A;  5EWE A;  4KLI A;  2JEF A;  1U45 A;  3PO5 A;  4M04 A;  2XY6 A;  5CR0 A;  4QZH A;  3QE9 Y;  3MDA A;  1D9F A;  4UQG A;  5KG5 A;  1UA1 A;  4GC6 A;  2ZJA A;  5J0S A;  3RJJ A;  3C2L A;  2KZ3 A;  5KFM A;  1JIH A;  4BWJ A;  4ZH4 A;  3PW4 A;  3V7J A;  4IRK A;  4RPY A;  1BVS A;  5D46 A;  1ZQI A;  5J2D A;  5CJ7 A;  3H4B A;  3V7L A;  2KFZ A;  2W9B A;  3SZ2 A;  1JXL A;  4QWE A;  3HX0 A;  4I2I A;  4YCX A;  4Q43 A;  5HNK A;  5BPC A;  2R8I A;  3RJG A;  4M9G A;  4IR9 A;  3ZD8 A;  5F9N A;  4YD2 A;  4M6W B;  7ICQ A;  1TK8 A;  1RXW A;  4KLH A;  1KSP A;  1BPB A;  3T3F A;  5DLF A;  2HHQ A;  1WCL A;  2XCA A;  3V6K A;  2AGP A;  1ZQT A;  7ICI A;  2HVI A;  5HP4 A;  2ASJ A;  4YN4 A;  4O5E A;  2KZM A;  4DQS A;  5HML A;  3FYH A;  8ICV A;  2W9M A;  1NJZ A;  4YFK A;  1X9W A;  2IHN A;  4QZ9 A;  5J0O A;  1T4G A;  4UB4 A;  4M9N A;  3H40 A;  4UB1 A;  1K1S A;  4QZF A;  3M9N B;  4J9R A;  1BPX A;  1T7P A;  4F92 B;  4NLG A;  4ED8 A;  8ICK A;  1RPL A;  2MUT B;  5L1I A;  3RJI A;  5KFR A;  3C1Z A;  4RQ0 A;  4I29 A;  3C23 A;  7ICK A;  7ICO A;  5IIO A;  2XGQ A;  9ICG A;  3JPQ A;  5KFF A;  3N97 B;  4KLT A;  9ICV A;  1NK4 A;  4DL2 A;  3GFK B;  3C2M A;  2FLN A;  5J2I A;  1EXN A;  4YMN A;  2UVU A;  1N48 A;  2ZJ5 A;  3GV5 B;  2BCQ A;  2VAN A;  9ICR A;  1QSS A;  1COO A;  4J9Q A;  3LWL A;  3RRH A;  4EBD A;  4RPX A;  8ICO A;  4RUA A;  3N4M B;  4F5P A;  3C2K A;  3SV3 A; 
#chains in the Genus database with same CATH topology
 4F8R A;  3PW5 A;  5J2C A;  3KKA C;  2LM4 A;  5L1J A;  5EOZ A;  4F2S A;  4JV1 A;  3FC4 A;  4FBU A;  3BDP A;  5AM5 A;  4QZC A;  5IIM A;  1Z00 A;  3NAS A;  2AGO A;  5AM1 A;  2JRZ A;  5AIB A;  3N7P D;  1CRX A;  4AYB F;  4JMU A;  2JV3 A;  1S5L U;  2DPJ A;  2KFN A;  3ZDD A;  2E8M A;  4EEN A;  4DOC A;  7ICG A;  4C4T A;  1OXJ A;  1XC9 A;  3VC8 A;  2GOL A;  2LYA A;  3M9M B;  1ZQJ A;  3PMN A;  3JPR A;  3WKD A;  4RUC A;  2VJ4 A;  3K75 D;  1S10 A;  2F1I A;  4MF8 A;  2K4E A;  2IA6 A;  3PW7 A;  1NK0 A;  2H5X A;  3J81 j;  4B9U A;  2EZX A;  2KNJ A;  2UVW A;  9ICA A;  4UB6 U;  5HHH A;  8ICI A;  2I1Q A;  4YR3 A;  4PGQ A;  4DEZ A;  3EWA A;  1A0P A;  3PML A;  1NK5 A;  3RB3 A;  1ZQD A;  2K8B B;  2BCV A;  1U4B A;  4RQN A;  1TKD A;  1ZQC A;  3HKZ C;  3PR4 A;  3RB0 A;  2F1H A;  3I28 A;  2RLT A;  5J2A A;  4BDP A;  1N2X A;  3I76 A;  4QZB A;  3M9O B;  1NKE A;  2E8P A;  4WJ3 B;  2YB1 A;  3N7S C;  2WAQ C;  4PGX A;  4HYK A;  4DSE A;  2LYB A;  7ICE A;  3CW2 C;  4P4P A;  4BWM A;  2K4I A;  4O3S A;  5DB6 A;  3JPP A;  1FIQ A;  4DFJ A;  4PJ0 U;  3EW9 A;  2KOB A;  2OWO A;  5AHX A;  4PL2 A;  1XNS A;  4YR0 A;  5CEH A;  1A77 A;  2P6U A;  1NK8 A;  4F71 A;  5IIL A;  1ZQS A;  1PK1 B;  4DL4 A;  2IHM A;  2J6S A;  2NO4 A;  1TK0 A;  3KOO A;  4GXI A;  2KTQ A;  4QWD A;  9ICL A;  5AI5 A;  4KTQ A;  4PHD A;  4XQ8 A;  5EE0 A;  4MFA A;  1LVH A;  4CGZ A;  2EAO A;  4I2G A;  4BJQ A;  2BR0 A;  2BCR A;  1NNL A;  3MFI A;  1MSW D;  3S6J A;  3KFU F;  3B9J A;  3IRU A;  5KFN A;  2FMS A;  4Q8F A;  2W7O A;  5J0Q A;  5ALU A;  1O03 A;  4OJL A;  5EWF A;  1ZQV A;  3MC1 A;  1Y88 A;  4RQM A;  5DQH A;  2ZJ8 A;  2HW3 A;  4NLK A;  3RH6 A;  4JV2 A;  4C7Z A;  3H0R B;  5AKE A;  3LVV A;  5BOL A;  2V9W A;  1DGS A;  4ECY A;  4AYB C;  2KJ9 A;  3OGU A;  1ZXI A;  2H3Z A;  2XGP A;  3NVY A;  4C8O A;  3LWM A;  2F77 X;  2LI6 A;  5HR6 A;  5ALO A;  3LDA A;  4IQT A;  4EBE A;  1NKC A;  1IV8 A;  4KLM A;  3GZF A;  3SEI A;  2XY5 A;  1YZ6 A;  2RQ5 A;  4NL9 A;  2BGW A;  9ICN A;  4Q8E A;  3BZC A;  1DRG A;  1XO1 A;  5T14 A;  2F2A B;  3FM9 A;  4ED1 A;  5KFH A;  4JK1 A;  2P35 A;  3RAQ A;  1ZQK A;  4QJF B;  2KK0 A;  2BKE A;  3C1Y A;  4F5Q A;  3H7I A;  4O3R A;  1KRP A;  5KFU A;  1CUK A;  1N63 A;  1Z1B A;  5AM4 A;  5AK6 A;  2ZG6 A;  3D2N A;  4QIW F;  4Q45 A;  3M8R A;  4PHP A;  5D49 A;  1RM6 C;  3F2B A;  4Y2Y A;  5ALW A;  5DDM A;  4MEY A;  2JR5 A;  3PW0 A;  4OCZ A;  1NZP A;  3TAC B;  1ZQP A;  4YD1 A;  1RYS A;  4LVS A;  5ALH A;  2XY7 A;  2KIV A;  4I2H A;  4MHV A;  4YP3 A;  1QTM A;  2DQN B;  5KT3 A;  4KN7 A;  2XC9 A;  2PMZ C;  4EEL A;  4F91 B;  5J2K A;  4IQW A;  2ZIV B;  4JUZ A;  4R64 A;  4RPZ A;  3KTQ A;  1IM4 A;  4K4G A;  4RT2 A;  5KFZ A;  4F50 A;  1S77 D;  2KJ8 A;  1F0M A;  1T94 A;  3AQF A;  1KFS A;  4P2H A;  3TAN A;  4ECX A;  2NRW A;  2ZIX A;  5FP0 A;  3OTQ A;  2BQ3 A;  4CE6 A;  1MA7 A;  3GIJ A;  3C21 A;  4CDG A;  4GIB A;  1N5W A;  4UB5 A;  4B9L A;  1JRO A;  9ICJ A;  2KN7 A;  1QLN A;  2HVH A;  2OEH A;  1XSP A;  4KLU A;  5J0X A;  3QEB Z;  3PO4 A;  3HIL A;  5K4L A;  2H3F A;  2VKQ A;  1N60 A;  2ISP A;  2W04 A;  4CCH A;  4P4O A;  5KFO A;  2V4R A;  3LVW A;  4NLC A;  2Y1J A;  1ZJN A;  4RQ7 A;  5KFI A;  7ICF A;  5GTH U;  3RF9 A;  3OJS A;  4RZR A;  4NXZ A;  3RBE A;  2XVT A;  2WB1 F;  2FLL A;  4OD0 A;  3RJK A;  1NI3 A;  1S0N A;  2HHT A;  1NKB A;  2HDO A;  4CNQ A;  3ZDB A;  3TI0 A;  1KL9 A;  1ZQH A;  8ICJ A;  1NK9 A;  1JI7 A;  1U47 A;  2DPI A;  1WWU A;  5ALY A;  3THV A;  2W54 A;  4ED6 A;  1ARO P;  3IG8 A;  4BGD A;  2K89 A;  2NRZ A;  3SEN A;  3GIM A;  2QB0 A;  2CRX A;  4I27 A;  2E5S A;  5EWG A;  3GIL A;  4QIW C;  1ZQZ A;  2D6F C;  2NRV A;  2W11 A;  2E1E A;  1L3U A;  3ETR A;  3GIK A;  4RNO A;  2KVC A;  2LMR A;  7ICS A;  3MGI A;  1B4F A;  2NV3 A;  4DOB A;  5ALS A;  4KLI A;  2JEF A;  1U45 A;  3PO5 A;  4M04 A;  2ZXH A;  4QZH A;  3MDA A;  5KG5 A;  2LHT A;  3K1Z A;  2G09 A;  4ZH4 A;  3V7J A;  4IRK A;  5D46 A;  3K1R B;  3H4B A;  4Q43 A;  2R8I A;  3RJG A;  4IR9 A;  5F9N A;  1RXW A;  3L3F X;  1KSP A;  3T3F A;  1WCL A;  5EE9 A;  4CF3 A;  3V6K A;  1KQQ A;  7ICI A;  2HVI A;  4DQS A;  5HML A;  4YFK A;  5EE3 A;  1X42 A;  4M9N A;  4LJX A;  1BPX A;  2KP7 A;  2EAP A;  3AL0 B;  1L7M A;  1RPL A;  7ICO A;  5KFR A;  4RQ0 A;  5IIO A;  2KIC A;  3N97 B;  4KLT A;  9ICV A;  3H0L B;  3C2M A;  2FLN A;  5J2I A;  1XO0 A;  4YMN A;  2UVU A;  1N48 A;  3GV5 B;  2WFA A;  3LWL A;  1L8L A;  3C2K A;  1VDV A;  4UAY A;  2KSO A;  5J0T A;  5J0W A;  4U7C A;  4EYI B;  3T5K A;  4J03 A;  1LB2 B;  1Z4N A;  1JX4 A;  3BQ2 A;  4IRC A;  1XS9 D;  1A76 A;  1WCN A;  5CP2 A;  3OHA A;  4IC9 A;  5DGB A;  3RJE A;  4IQU A;  8ICS A;  1HUO A;  3CNH A;  2EAN A;  2OH2 A;  2FJ6 A;  3Q8K A;  2AQ0 A;  2HCF A;  2GLE A;  3SAH A;  4YQW A;  3RJH A;  4EZ9 A;  2WB1 C;  5ALT A;  1X9M A;  4KLO A;  2AQ4 A;  3ZDA A;  2I6X A;  1URJ A;  4F5R A;  1ZQB A;  2CN1 A;  4R8U A;  2ES6 A;  4DQP A;  4FS1 A;  4ECR A;  1NK6 A;  3F2D A;  4DL3 A;  1S9F A;  8ICR A;  5J0U A;  1SKW A;  4US8 A;  2NRX A;  1YT3 A;  5F3X B;  1B0X A;  4OO1 J;  3NRW A;  1YZ7 A;  2RDI A;  2YB4 A;  2IOF K;  3H0M B;  4Y2S A;  1TE2 A;  5ALJ A;  2G0A A;  1B43 A;  4GLX A;  4DQR A;  3MFH A;  2PXI A;  4FBT A;  4ECQ A;  2W9C B;  2LM1 A;  4OJP A;  1JMS A;  3QX7 A;  4KLJ A;  4Y2X A;  4M9L A;  5III A;  2QLT A;  2W9B B;  4G9B A;  1ZQE A;  4EX6 A;  2GWS A;  5IIN A;  1ZD4 A;  2GH1 A;  3PSF A;  4F5N A;  4UB8 U;  4MEX A;  5DG8 A;  3NTU A;  3SV4 A;  4DSF A;  1IIP A;  4Z6C A;  4RQ8 A;  2AH5 A;  3JPS A;  4KLG A;  1ZRM A;  4EBC A;  1V38 A;  2M9N A;  3MR3 A;  1ZQQ A;  4M9J A;  4KLE A;  5J8Y C;  5DB9 A;  4XUS A;  4DF8 A;  5J0R A;  2WTF A;  1ZQG A;  2KKV A;  3F53 A;  3Q8P B;  3CYM A;  5KFQ A;  2HOI A;  5ALP A;  4Y2Q A;  3T5J A;  1V97 A;  1LKY A;  1U9L A;  3KKA A;  4ICA A;  2KE7 A;  2A1J A;  4FZN A;  3M7D A;  1ZD2 P;  1DOQ A;  4M6W A;  5KT7 A;  3L5K A;  3DDH A;  2FPK A;  4NLN A;  3GII A;  2C28 A;  1J97 A;  3L4P A;  2KEY A;  5HHI A;  2R18 A;  2LKY A;  3SQI A;  4NM1 A;  2E8N A;  4QNL A;  4F2R A;  5AKH A;  2PFO A;  2FDR A;  3WKA A;  3AU2 A;  2PKE A;  5AI9 A;  1X2I A;  4KLS A;  3PVX A;  3GU3 A;  5KFC A;  4RNM A;  2I9G A;  3H8S A;  3V7K A;  3EYZ A;  4MF2 A;  1SXE A;  4Y2P A;  3AMZ A;  5KT4 A;  4TUR A;  2XI9 A;  3Q8S B;  2AJQ A;  2DKX A;  1J2N A;  2YN4 A;  3UMC A;  1KKX A;  1L3S A;  3KHR A;  2EZY A;  2XCP A;  2YQE A;  1JN3 A;  3AU6 A;  3T79 A;  2HBK A;  5DQG A;  2C2D A;  2LPE A;  9ICE A;  1NOM A;  1BPY A;  2FLP A;  4C8K A;  1ZD5 A;  4ED0 A;  4Y2T A;  4PPX A;  8ICE A;  1ZQM A;  2PFN A;  3MDC A;  3RBD A;  2ALZ A;  7ICM A;  1WYG A;  5G5H A;  4TUP A;  1U49 A;  1MN8 A;  4B9M A;  1FFU A;  4TUQ A;  1O08 A;  4EZ6 A;  8ICL A;  1U48 A;  2ZTC A;  3G6X A;  4TQS A;  5KFY A;  2KKP A;  2ZUC A;  3WK5 A;  4KMU A;  1SKS A;  3B0Y A;  3H8M A;  1FFV A;  5AKJ A;  1BNO A;  4F3O A;  4CF5 A;  5B5E U;  1SL0 A;  4M2Y A;  5AKZ A;  4ELV A;  2AGQ A;  3HWT A;  4QWB A;  5KG0 A;  2KMD A;  1C7Y A;  4DS5 A;  4J9L A;  4KLF A;  5AI8 A;  5DDY A;  1HEK A;  1X66 A;  3O0F A;  5AKL A;  1SKR A;  1K1Q A;  2F8K A;  4IS7 A;  3WK7 A;  3V72 A;  3RB6 A;  4IRD A;  9ICF A;  2E3T A;  3GDX A;  1F5S A;  4Y2R A;  2G5H B;  2MA1 A;  3PV8 A;  3RR8 A;  3QU7 A;  1Z1V A;  4C8L A;  4KN4 A;  4I2C A;  3JPO A;  4NLB A;  3D2S A;  1L3T A;  4B9V A;  1RYR A;  5KFP A;  2ATL A;  3OSP A;  2ZIU A;  2XO7 A;  4C0Z A;  3BS5 A;  4Z6D A;  2EAM A;  1PK1 A;  4C8N A;  1UCV A;  3M6K A;  1RYU A;  3MR5 A;  1RQL A;  5KFL A;  3TFS A;  1NK7 A;  1CEZ A;  3Q8M A;  4OJ6 A;  4DSL A;  3EPG A;  1L5U A;  3RJF A;  3PX6 A;  4DWI A;  3WKE A;  2HBL A;  3NVZ A;  1L7N A;  4GC7 A;  3RH5 A;  1D8B A;  4USA A;  5GTI U;  3TAP A;  5KFJ A;  2QB1 A;  1SV0 A;  2K60 A;  3K4G A;  5KT6 A;  2QAR B;  1SV0 C;  1RDF A;  5CA7 A;  4UAR A;  2YMQ A;  2DKZ A;  4UB2 A;  5L1L A;  2G06 A;  3RB4 A;  3NVV A;  5KFT A;  2H3V A;  2ZIW A;  3GQC A;  3WK9 A;  3E58 A;  5J2H A;  3T5L A;  2JH7 A;  3QUT A;  3NVW A;  1DGJ A;  5DBA A;  1ZQN A;  4BX9 C;  4B9S A;  4J9S A;  1XSN A;  8ICB A;  2RRD A;  4QW9 A;  2G08 A;  8ICQ A;  1ZOL A;  4YG2 A;  5ALV A;  1NJY A;  3QNM A;  1TAU A;  2EQY A;  2BPF A;  4AP9 A;  4F93 B;  1TVA A;  3H4D A;  3B0X A;  3PX0 A;  2F44 A;  2KIW A;  4F4Y A;  5KFD A;  3IDW A;  3LYS A;  3H8W A;  1WWV A;  3G6Y A;  2F1J A;  2HHV A;  5EWE A;  3QUQ A;  4UQG A;  5AKX A;  3U26 A;  1UA1 A;  5J0S A;  2EH9 A;  2D8C A;  3ICX A;  3D2Q A;  3PW4 A;  3A0H U;  4OJ5 A;  1Q46 A;  1PVR A;  2ZIX B;  1JXL A;  4QWE A;  4C4R A;  1SXD A;  5HNK A;  4YD2 A;  4KLH A;  5KL1 B;  2RHF A;  5DLF A;  3C28 A;  4YN4 A;  8ICV A;  2W9M A;  3WKB A;  3H40 A;  4PZN A;  4UB1 A;  1K1S A;  3M9N B;  4J9R A;  2EZZ A;  4NLG A;  4ED8 A;  1RQN A;  7ICK A;  2MUT B;  5L1I A;  9ICG A;  4KX5 A;  3C23 A;  5JU5 A;  5KFF A;  2KG5 A;  2ZIV A;  4UAT A;  2BCQ A;  2VAN A;  9ICR A;  8ICO A;  5KAF U;  4RUA A;  4F5P A;  4PZO A;  5EE1 A;  2V4Q A;  4KMO B;  3SAF A;  3BQ1 A;  2OM6 A;  1TAQ A;  4P0Q A;  2IMW P;  4K4H A;  3SD7 A;  3GV8 B;  3AEV A;  4ECU A;  4I28 A;  5KFE A;  2VA8 A;  2OCE A;  7ICR A;  3IV6 A;  3OHB A;  2VA2 A;  1ECW A;  5IIJ A;  3ZDE A;  5B66 U;  4QWA A;  4UAV A;  1RZT A;  2YMP A;  5AI6 A;  2MRL A;  2ASL A;  2WF9 A;  2R8H A;  4F4X A;  2RDJ A;  3FAH A;  2FMQ A;  5KNI A;  3MGH A;  1ED1 A;  2DF4 B;  4Z6E A;  2QB0 B;  4J9K A;  2R8K A;  4P0P B;  3DV9 A;  5ALN A;  1SGG A;  5HMM A;  4F4K A;  4DSI A;  9ICK A;  1L7O A;  1JAL A;  4RQ3 A;  3EZ5 A;  5G5G A;  3WKC A;  4PHE A;  3NUQ A;  4FS2 A;  2WF8 A;  1LV5 A;  9ICU A;  2YTU A;  1QQ7 A;  4I2J A;  7ICV A;  2WF6 A;  1KTQ A;  1BGX T;  2W8K A;  4PL1 A;  5BOM A;  2YMM A;  5KT2 A;  1WG8 A;  3BQ0 A;  1KDH A;  1PK3 A;  1GO3 F;  3ALR A;  1AQ6 A;  5KG1 A;  4YMO A;  1H38 A;  2K4H A;  4M9H A;  2BDU A;  3KD3 A;  4Y2J A;  3QYP A;  2E1F A;  4G3I A;  3T5H A;  4DSJ A;  1S76 D;  5AI0 A;  1XSL A;  2HHS A;  5DBC A;  2Y9U A;  4FZL A;  1BPD A;  3QZ8 A;  4J9P A;  4UAZ A;  2VA3 A;  2M0N A;  2FPM A;  2W3S A;  4P4M A;  2DUY A;  4R66 A;  1FO4 A;  2ZXI A;  5D4B A;  5KTQ A;  5DLG A;  3PST A;  2J6U A;  4GXK A;  2WF7 A;  5KFV A;  2C2R A;  2ASD A;  1SZH A;  2KJ5 A;  4NY8 A;  4M47 A;  2HBM A;  8ICW A;  5AK4 A;  1HIW A;  2JEG A;  1N56 A;  3LK9 A;  1MC8 A;  4RQ6 A;  2BZF A;  1SIJ A;  3I1Y A;  4O3P A;  4O3Q A;  3Q8Q B;  4ECW A;  5DG7 A;  4DFK A;  2WF5 A;  4O3N A;  4O0I A;  1UT8 A;  1L8O A;  4BXO A;  1CI4 A;  1RXV A;  2JZB A;  4YMM A;  1D9D A;  3IP4 B;  2YML A;  2ZTD A;  3BS7 A;  4JB3 A;  5HR7 A;  4QZ8 A;  3H8J A;  2BQU A;  1N5X A;  1KBU A;  1NJW A;  1MQ2 A;  1X9S A;  2K8C B;  2Q4T A;  3SYZ A;  8ICX A;  4Q44 A;  4F72 A;  1B22 A;  1VLB A;  5KG3 A;  1XU4 A;  5JRT A;  4B9T A;  2Y1I A;  5AKY A;  4ELT A;  1BNP A;  5CB1 A;  4U6P A;  5C0Y A;  3AN1 A;  2JEI A;  5CWR A;  3ISC A;  4Z6F A;  1Q8K A;  3QUC A;  3HW8 A;  1K5O A;  2E8O A;  9ICX A;  2EDU A;  1V9P A;  5DKW A;  4QWC A;  3OJU A;  3SI8 A;  2KVS A;  3GV7 B;  2Q0Z X;  3EUB 2;  4DS4 A;  4I2A A;  4TQR A;  2IOF A;  1OUQ A;  1MQ3 A;  3RFA A;  1N61 A;  1J2M A;  1KW4 A;  3RH4 A;  3ETL A;  1NJX A;  2ISO A;  4LZG A;  5AKK A;  3SAG A;  4DL5 A;  1PZN A;  1TK5 A;  3AQE A;  3HRD D;  1S0V A;  5DB8 A;  2BCS A;  4PHA A;  2DL0 A;  2W55 A;  3V6H A;  5AM2 A;  4DQQ A;  5J8Y A;  2JGA A;  2JMG A;  2W9C A;  5AM3 A;  2DWQ A;  1L3V A;  3HT3 A;  5KT5 A;  1OW5 A;  5AKI A;  7ICH A;  4DFD A;  2FE9 A;  9ICH A;  4EYH B;  4YXJ A;  7ICN A;  1DK2 A;  2A1J B;  3ORY A;  1COK A;  1S0O A;  2IBK A;  2F8L A;  4RNN A;  2Z7J A;  5L1K A;  3SMV A;  4UAU A;  3BQ7 A;  1ZQW A;  3E0F A;  1Z00 B;  4A8E A;  2LYH A;  3HP6 A;  1Z19 A;  9ICT A;  4I29 A;  1SL1 A;  4MFC A;  2JEJ A;  4J9N A;  4C4S A;  4GFJ A;  5ALE A;  4ECS A;  1ZQX A;  5KFK A;  2HOF A;  1BPZ A;  7ICL A;  4RT3 A;  5DBB A;  5DG9 A;  4M0A A;  4CRX A;  2F3N A;  2QKQ A;  3G6V A;  2JXJ A;  4KIT B;  2KHV A;  3JPN A;  5ALD A;  1M6Y A;  3IHQ B;  3N28 A;  1PVP A;  2FMP A;  3QZ7 A;  1ZJM A;  1S0M A;  1ZQR A;  3VCB A;  3PY8 A;  4KLD A;  3QUB A;  3M1Y A;  8ICG A;  3MR2 A;  4X5V A;  4O3M A;  4UB3 A;  2Y9T A;  3BZK A;  4YXM A;  2H3I A;  5KL8 B;  3C29 A;  2LBO A;  4R65 A;  5ALI A;  4B6J A;  5KFW A;  1SV4 A;  3AUO A;  4I2B A;  4NV0 A;  2K8A A;  8ICZ A;  3PW2 A;  3UXP A;  5AI4 A;  2B0C A;  4KLQ A;  4HAI A;  3RAX A;  1ZYQ A;  1V85 A;  5ALL A;  2R8G A;  4ZOH C;  2C22 A;  2HOQ A;  4KLL A;  4QZA A;  3ISB A;  1T3Q A;  3ONN A;  1ZD3 A;  1T3N A;  1KFD A;  2NRT A;  3QXG A;  4RQ4 A;  2XY6 A;  5CR0 A;  5AK5 A;  3QE9 Y;  2CXY A;  5AM0 A;  3NRZ A;  1Z4O A;  3KZI U;  3UMG A;  2KZ3 A;  2L5Y A;  3SR6 A;  4BWJ A;  5KFM A;  1ZQI A;  4IL6 U;  2KFZ A;  3SZ2 A;  3HX0 A;  4I2I A;  4YCX A;  4EX7 A;  4M9G A;  3ZD8 A;  7ICQ A;  1TK8 A;  2XCA A;  2PMZ F;  2AGP A;  1ZQT A;  2Y0S F;  5HP4 A;  3F5E A;  2ZIU B;  3FYH A;  4UAS A;  1NJZ A;  2IOH A;  3BS5 B;  1X9W A;  4QZ9 A;  4UB4 A;  4F92 B;  8ICK A;  3C1Z A;  3TKA A;  2KV2 A;  1EXN A;  2A1A A;  2OHF A;  1QSS A;  1COO A;  4J9Q A;  1ZQF A;  3SV3 A;  1TV9 A;  3RRG A;  9ICQ A;  2AHO B;  3ZI4 A;  2OXO A;  3DEE A;  3V6J A;  5J29 A;  5KG2 A;  5AKG A;  2YY6 A;  4QZD A;  2ZUD A;  2MAX A;  4FO6 A;  4DFM A;  4QW8 A;  1BPE A;  3R9K A;  1WUD A;  8ICU A;  1X40 A;  3CP8 A;  4YVZ A;  3TAD A;  4RU9 A;  2A3V A;  1HJP A;  3TAD C;  4Y2V A;  4XA5 A;  2ZIW B;  4DFP A;  2DFL A;  1QH9 A;  2B21 A;  2PFP A;  2HBJ A;  5DQI A;  1JRP A;  1Q3U A;  5J2G A;  8ICT A;  2C2E A;  5F9L A;  5AIA A;  4BUG A;  3HPO A;  1SL2 A;  2XIC A;  3QU2 A;  1FEZ A;  4EEY A;  5DB7 A;  4DL6 A;  4YR2 A;  8ICH A;  5AIC A;  4QZG A;  2QAR A;  9ICS A;  4DCC A;  2P66 A;  5JUM A;  4I2F A;  4NL9 C;  3NGD A;  4IQV A;  5ALZ A;  1IXR A;  2BHN A;  7ICJ A;  4KX3 A;  8ICA A;  1ZET A;  5AK3 A;  1KLN A;  1T8E A;  4MFF A;  1QQ6 A;  4PH5 A;  2HHQ A;  4PGY A;  1KFT A;  3KHG A;  3TQ1 A;  2O6K A;  1P7D A;  4FFD A;  4DF4 A;  8ICC A;  4QZI A;  4K4I A;  1ZQO A;  2UVV A;  9ICB A;  5KFA A;  1Z3E B;  2JHD A;  2F76 X;  4RQ2 A;  4JWN A;  5DGA A;  4ACO A;  9ICW A;  3PR5 B;  4ECZ A;  4FE3 A;  4J9M A;  3PX4 A;  1KN5 A;  2ODG A;  2W43 A;  5KFX A;  3KHL A;  3UQ2 A;  5J2E A;  4DSK A;  3F2C A;  4ECV A;  2ESE A;  2PI5 A;  3KZX A;  2Y0S C;  3M8S A;  4EEK A;  5KFB A;  1SB3 C;  3TAR A;  2KZZ A;  1X9X A;  1D8L A;  4P0Q B;  2BCU A;  1KEJ A;  1UHU A;  4I2D A;  3MR6 A;  2MU2 A;  3RR7 A;  4F4W A;  5L9X A;  2B6G A;  9ICC A;  4R63 A;  5J2B A;  5ALK A;  2NYV A;  9ICP A;  5KFS A;  3AM9 A;  4DLE A;  1N62 A;  4ED7 A;  2DBY A;  3PNC A;  2W03 A;  3PSI A;  4B9N A;  2NO5 A;  4C8M A;  2ZUB A;  2MUT A;  3Q8R B;  1X6J A;  1TFR A;  3HJE A;  4RQ5 A;  3QEA Z;  1QSL A;  2G5I B;  2W9A A;  2P6R A;  4J9O A;  8ICM A;  8ICP A;  3BJY A;  4O5K A;  1L6N A;  2YX8 A;  3D6J A;  5KAI U;  4RQ1 A;  2H3Q A;  3QU5 A;  5ALM A;  2HSZ A;  5A0L A;  3PZP A;  3E2E A;  4FZM A;  3WK4 A;  4O3O A;  2WHE A;  2AU0 A;  1ZQ1 C;  2VJ5 A;  2BQR A;  5C5J A;  3JPT A;  4C80 A;  5J2F A;  2G07 A;  3OSN A;  3ED5 A;  2W8L A;  1DXS A;  4DLG A;  4DQI A;  2FI1 A;  3IN5 A;  5CRX A;  3WK8 A;  2J6T A;  4NJ8 A;  5H2F U;  4P0P A;  3EPI A;  1VJ5 A;  3F5A A;  5L1M A;  2FPL A;  4C7Y A;  3MGV A;  4I2E A;  5ALQ A;  2HHW A;  8ICN A;  1S97 A;  1UA0 A;  5KG7 A;  2PI4 A;  5ALR A;  4JV0 A;  1SZP A;  4QZE A;  1SWV A;  1ZQL A;  4IR1 A;  3IM1 A;  4OJO A;  5ALX A;  4TUS A;  4ECT A;  2PFQ A;  5JTI A;  2ZTE A;  1D8Y A;  4GXJ A;  5IIK A;  3MBY A;  1RG6 A;  4ED2 A;  5J2J A;  5ALF A;  1QCK A;  2KSO B;  2AXT U;  2KD1 A;  2BPG A;  7ICT A;  3C5F A;  3ISD A;  3RTV A;  2D3D A;  2MSN A;  4DO9 A;  3UM9 A;  4LZD A;  2BDP A;  3NS1 A;  4UBB A;  1QSY A;  2R8J A;  4BXO B;  3KHH A;  2JZB B;  1ZQY A;  1F44 A;  8ICY A;  5ALG A;  1UT5 A;  3WK6 A;  1PUZ A;  3C5G A;  1NZB A;  5TZV A;  3M6Z A;  3UXN A;  4F4Z A;  2GO7 A;  8ICF A;  3KBB A;  4ED3 A;  4O9M A;  3UMB A;  4ELU A;  4R8U B;  4US9 A;  3ZD9 A;  3BQT A;  3Q8L A;  3PSP A;  4NWI A;  2KHQ A;  3TFR A;  5TIS U;  7ICU A;  4F5O A;  1X6I A;  3UXO A;  1XWL A;  2N1R A;  4E0D A;  5J0Y A;  2BPC A;  3N7R C;  9ICI A;  3MAB A;  4UW9 A;  3WU2 U;  3QU9 A;  4UBC A;  3UPQ A;  2UVR A;  2OYY A;  1ZQA A;  2HHU A;  5KFG A;  2VIX A;  1JXE A;  4NM2 A;  1A6S A;  3CRX A;  1Q3V A;  9ICO A;  1ZQU A;  4DOA A;  7ICP A;  5CHG A;  2K4P A;  9ICM A;  4NLZ A;  5J0P A;  1ZRN A;  3ZDC A;  3FDS A;  1DK3 A;  2DGZ A;  5KG6 A;  4O5C A;  3UQ0 A;  1HUZ A;  4XRH A;  1L7P A;  1JUD A;  5KG4 A;  3TAQ A;  2HHX A;  4JWM A;  3HKZ F;  2W3R A;  4UAW A;  1SWW A;  4DL7 A;  2HMX A;  1D9F A;  3OPX A;  2RP5 A;  2WAQ F;  2JH1 A;  4GC6 A;  3A0B U;  2ZJA A;  4CF4 A;  3RJJ A;  3C2L A;  1JIH A;  1TAM A;  4RPY A;  1BVS A;  1PVQ A;  5J2D A;  2I5H A;  1LKY B;  2HI0 A;  5E79 U;  5CJ7 A;  3QU4 A;  3V7L A;  2W9B A;  1UPH A;  1UQV A;  2XID A;  1IG6 A;  5BPC A;  4M6W B;  1S8O A;  1BPB A;  2W7P A;  3IG5 A;  2ASJ A;  4O5E A;  2KZM A;  2CPR A;  2IHN A;  5J0O A;  1T4G A;  4QZF A;  1T7P A;  3RJI A;  1C20 A;  2XGQ A;  3JPQ A;  1QQ5 A;  1NK4 A;  4DL2 A;  3GFK B;  4Y2U A;  2ZJ5 A;  2A19 A;  3RRH A;  4EBD A;  4RPX A;  3N4M B; 
#chains in the Genus database with same CATH homology
 1TV9 A;  3PW5 A;  4F8R A;  5J2C A;  2V4Q A;  5L1J A;  9ICQ A;  3BQ1 A;  4UAY A;  5J0T A;  5EOZ A;  5J0W A;  1TAQ A;  4F2S A;  2IMW P;  4K4H A;  4EYI B;  3T5K A;  3V6J A;  4JV1 A;  1LB2 B;  5J29 A;  3GV8 B;  3BQ2 A;  1JX4 A;  4IRC A;  5KG2 A;  1A76 A;  1WCN A;  5CP2 A;  4ECU A;  1XS9 D;  3OHA A;  4FBU A;  4I28 A;  4QZD A;  3BDP A;  5DGB A;  3RJE A;  2ZUD A;  4IQU A;  5KFE A;  2VA8 A;  8ICS A;  1HUO A;  4QZC A;  2MAX A;  7ICR A;  4FO6 A;  4DFM A;  4QW8 A;  3OHB A;  5IIM A;  1BPE A;  1Z00 A;  3Q8K A;  2VA2 A;  8ICU A;  2AQ0 A;  4YVZ A;  5IIJ A;  3ZDE A;  4QWA A;  2HHV A;  4RU9 A;  2AGO A;  1HJP A;  4YQW A;  4XA5 A;  3RJH A;  4EZ9 A;  4DFP A;  1RZT A;  2DFL A;  2B21 A;  1X9M A;  1ZQL A;  2PFP A;  4IR1 A;  4KLO A;  5DQI A;  2ASL A;  2AQ4 A;  2DPJ A;  2KFN A;  3ZDA A;  3ZDD A;  5J2G A;  2R8H A;  4F4X A;  2RDJ A;  4F5R A;  1ZQB A;  2C2E A;  5F9L A;  8ICT A;  4DOC A;  7ICG A;  2FMQ A;  3HPO A;  1SL2 A;  3MGH A;  3RRG A;  1XC9 A;  4R8U A;  4Z6E A;  4DQP A;  3M9M B;  4J9K A;  4FS1 A;  4ECR A;  1NK6 A;  4DL3 A;  4EEY A;  1S9F A;  5DB7 A;  1ZQJ A;  3PMN A;  4DL6 A;  4YR2 A;  3JPR A;  8ICH A;  4RUC A;  2R8K A;  3K75 D;  1S10 A;  5HMM A;  4F4K A;  8ICR A;  5J0U A;  2F1I A;  4DSI A;  1SKW A;  4MF8 A;  2NRX A;  9ICK A;  4QZG A;  2IA6 A;  2RDI A;  3PW7 A;  9ICS A;  1NK0 A;  2H5X A;  4RQ3 A;  3EZ5 A;  2P66 A;  5JUM A;  4PHE A;  4B9U A;  4I2F A;  4FS2 A;  2UVW A;  9ICA A;  3NGD A;  4IQV A;  1LV5 A;  5HHH A;  9ICU A;  1IXR A;  8ICI A;  2BHN A;  7ICJ A;  2I1Q A;  4I2J A;  8ICA A;  1B43 A;  1ZET A;  1KLN A;  4YR3 A;  1T8E A;  4PGQ A;  4DEZ A;  3EWA A;  4GLX A;  4MFF A;  4DQR A;  4PH5 A;  7ICV A;  3PML A;  1NK5 A;  4PGY A;  3MFH A;  1KTQ A;  1BGX T;  2W8K A;  2PXI A;  4ECQ A;  3RB3 A;  3KHG A;  3TQ1 A;  2W9C B;  1ZQD A;  4FBT A;  2BCV A;  4DF4 A;  8ICC A;  1JMS A;  5BOM A;  1U4B A;  4KLJ A;  1TKD A;  1ZQC A;  4QZI A;  3PR4 A;  4M9L A;  5III A;  3RB0 A;  4K4I A;  1ZQO A;  2F1H A;  2UVV A;  5KT2 A;  9ICB A;  1KDH A;  5J2A A;  3BQ0 A;  2W9B B;  5KFA A;  1Z3E B;  4BDP A;  4QZB A;  3M9O B;  4RQ2 A;  1ZQE A;  1NKE A;  4JWN A;  2GWS A;  5IIN A;  5KG1 A;  5DGA A;  4YMO A;  4PGX A;  4HYK A;  1H38 A;  4DSE A;  4M9H A;  9ICW A;  7ICE A;  4F5N A;  3PR5 B;  4ECZ A;  4J9M A;  4P4P A;  4BWM A;  3PX4 A;  4G3I A;  3T5H A;  4DSJ A;  4O3S A;  1S76 D;  5DB6 A;  1XSL A;  5DG8 A;  5DBC A;  3JPP A;  4MEX A;  3NTU A;  5KFX A;  3SV4 A;  4DSF A;  4Z6C A;  4RQ8 A;  4KLG A;  3JPS A;  4DFJ A;  1BPD A;  3QZ8 A;  5J2E A;  3KHL A;  3EW9 A;  3UQ2 A;  4J9P A;  4EBC A;  4ECV A;  4DSK A;  2OWO A;  4UAZ A;  2M9N A;  3MR3 A;  1ZQQ A;  4M9J A;  4KLE A;  2VA3 A;  5DB9 A;  2PI5 A;  4XUS A;  4YR0 A;  4DF8 A;  2FPM A;  4P4M A;  1A77 A;  2P6U A;  1NK8 A;  4R66 A;  5IIL A;  3M8S A;  1ZQS A;  5J0R A;  4DL4 A;  2WTF A;  1ZQG A;  5KFB A;  5D4B A;  2IHM A;  5KTQ A;  5DLG A;  1TK0 A;  2J6S A;  4GXI A;  2J6U A;  2KTQ A;  3Q8P B;  4QWD A;  4GXK A;  9ICL A;  3TAR A;  5KFV A;  4KTQ A;  4PHD A;  4XQ8 A;  5KFQ A;  2ASD A;  2C2R A;  2KZZ A;  1D8L A;  8ICP A;  3T5J A;  2BCU A;  4MFA A;  4NY8 A;  1KEJ A;  4I2D A;  3MR6 A;  4M47 A;  4I2G A;  8ICW A;  2BR0 A;  2BCR A;  1U9L A;  3RR7 A;  2A1J A;  3MFI A;  4F4W A;  5L9X A;  2JEG A;  1MSW D;  9ICC A;  4R63 A;  1DOQ A;  4M6W A;  5KT7 A;  5J2B A;  5KFN A;  1N56 A;  3LK9 A;  1MC8 A;  2FMS A;  5KFS A;  2FPK A;  9ICP A;  4DLE A;  4RQ6 A;  4Q8F A;  4ED7 A;  1ZQF A;  4O3P A;  5J0Q A;  5EWF A;  4NLN A;  1ZQV A;  4O3Q A;  3PNC A;  3Q8Q B;  3GII A;  4ECW A;  2C28 A;  4B9N A;  5DG7 A;  5HHI A;  4C8M A;  4DFK A;  4O3N A;  4NM1 A;  2ZUB A;  4O0I A;  1Y88 A;  1UT8 A;  2MUT A;  5DQH A;  2ZJ8 A;  4BXO A;  3Q8R B;  2HW3 A;  4F2R A;  4NLK A;  1RXV A;  2JZB A;  2PFO A;  3RH6 A;  1TFR A;  4YMM A;  4JV2 A;  1D9D A;  2ZTD A;  4RQ5 A;  3QEA Z;  3AU2 A;  1QSL A;  4QZ8 A;  3H8J A;  5BOL A;  1X2I A;  2BQU A;  2V9W A;  2W9A A;  1DGS A;  4KLS A;  4ECY A;  3PVX A;  1NJW A;  1MQ2 A;  1X9S A;  3OGU A;  5KFC A;  4RNM A;  2XGP A;  2I9G A;  2P6R A;  3H8S A;  3V7K A;  4J9O A;  3EYZ A;  4MF2 A;  4C8O A;  3SYZ A;  5KT4 A;  3LWM A;  4TUR A;  3BJY A;  4O5K A;  3Q8S B;  2AJQ A;  4Q44 A;  8ICM A;  1B22 A;  5KG3 A;  1XU4 A;  4RQ1 A;  3E2E A;  4B9T A;  2Y1I A;  1L3S A;  4O3O A;  3KHR A;  3LDA A;  4IQT A;  1KFT A;  4EBE A;  2XCP A;  1NKC A;  4ELT A;  1JN3 A;  3AU6 A;  4KLM A;  5CB1 A;  2AU0 A;  2JEI A;  2XY5 A;  5CWR A;  5DQG A;  3ISC A;  4Z6F A;  2BGW A;  2BQR A;  9ICN A;  2C2D A;  5C5J A;  3JPT A;  4Q8E A;  9ICE A;  5J2F A;  1NOM A;  3HW8 A;  1BPY A;  9ICX A;  2FLP A;  1XO1 A;  4C8K A;  4ED0 A;  1V9P A;  5DKW A;  4QWC A;  3OSN A;  3OJU A;  4ED1 A;  3SI8 A;  4PPX A;  8ICE A;  1ZQM A;  5KFH A;  2W8L A;  2PFN A;  3GV7 B;  4JK1 A;  3MDC A;  3RBD A;  3RAQ A;  2Q0Z X;  2ALZ A;  4DS4 A;  1ZQK A;  7ICM A;  4I2A A;  2BKE A;  4TQR A;  3C1Y A;  4F5Q A;  3H7I A;  4TUP A;  1U49 A;  4B9M A;  4TUQ A;  8ICL A;  4EZ6 A;  4O3R A;  4DLG A;  4DQI A;  1MQ3 A;  1KRP A;  5KFU A;  1CUK A;  1U48 A;  2ZTC A;  2J6T A;  3G6X A;  3ETL A;  3RH4 A;  4TQS A;  1NJX A;  2ISO A;  5KFY A;  2ZUC A;  3EPI A;  4Q45 A;  4KMU A;  4LZG A;  3M8R A;  4PHP A;  1SKS A;  5D49 A;  4DL5 A;  1PZN A;  1TK5 A;  3B0Y A;  2FPL A;  5DDM A;  4MEY A;  1S0V A;  4I2E A;  3PW0 A;  2HHW A;  8ICN A;  1S97 A;  1UA0 A;  5DB8 A;  2BCS A;  4F3O A;  4PHA A;  5KG7 A;  1ZQP A;  4YD1 A;  2PI4 A;  1RYS A;  4LVS A;  1SL0 A;  2XY7 A;  3V6H A;  4DQQ A;  4M2Y A;  4JV0 A;  4ELV A;  1SZP A;  2AGQ A;  4I2H A;  4QZE A;  3HWT A;  4YP3 A;  4QWB A;  5KG0 A;  5KT3 A;  4KN7 A;  3IM1 A;  2XC9 A;  4DS5 A;  1C7Y A;  2W9C A;  1QTM A;  4TUS A;  4F91 B;  4ECT A;  4J9L A;  5J2K A;  4IQW A;  4KLF A;  4JUZ A;  4R64 A;  2PFQ A;  4RPZ A;  5DDY A;  1L3V A;  3KTQ A;  1IM4 A;  2ZTE A;  3HT3 A;  5KT5 A;  1D8Y A;  4K4G A;  7ICH A;  4GXJ A;  5IIK A;  3MBY A;  9ICH A;  4RT2 A;  4EYH B;  1SKR A;  1K1Q A;  4YXJ A;  7ICN A;  2A1J B;  4ED2 A;  5J2J A;  5KFZ A;  4F50 A;  3ORY A;  1S77 D;  3V72 A;  3RB6 A;  1S0O A;  2BPG A;  1KFS A;  4P2H A;  3TAN A;  4IRD A;  2IBK A;  7ICT A;  4ECX A;  3C5F A;  9ICF A;  3ISD A;  2NRW A;  3GDX A;  3RTV A;  4RNN A;  2BQ3 A;  3PV8 A;  3RR8 A;  5L1K A;  4DO9 A;  4C8L A;  3GIJ A;  1ZQW A;  4KN4 A;  3C21 A;  4LZD A;  2BDP A;  3JPO A;  4I2C A;  8ICX A;  1L3T A;  4UBB A;  1Z00 B;  1QSY A;  2LYH A;  3HP6 A;  2R8J A;  4B9V A;  9ICT A;  1RYR A;  4UB5 A;  1SL1 A;  4BXO B;  2JEJ A;  5KFP A;  3KHH A;  4J9N A;  2ATL A;  4B9L A;  2KN7 A;  3OSP A;  9ICJ A;  2XO7 A;  2JZB B;  1ZQY A;  1QLN A;  2HVH A;  4ECS A;  8ICY A;  1ZQX A;  4Z6D A;  1UT5 A;  1XSP A;  5KFK A;  5J0X A;  3C5G A;  3QEB Z;  1BPZ A;  4C8N A;  4KLU A;  7ICL A;  5TZV A;  3PO4 A;  3MR5 A;  1CEZ A;  3TFS A;  5KFL A;  1NK7 A;  4RT3 A;  3UXN A;  4F4Z A;  3Q8M A;  5DBB A;  2ISP A;  4DSL A;  3EPG A;  1L5U A;  3RJF A;  3PX6 A;  5DG9 A;  4CCH A;  4DWI A;  8ICF A;  4M0A A;  4ED3 A;  4O9M A;  4P4O A;  4ELU A;  4KIT B;  3G6V A;  5KFO A;  4R8U B;  3ZD9 A;  3JPN A;  4GC7 A;  2V4R A;  3BQT A;  3RH5 A;  2Y1J A;  3IHQ B;  3Q8L A;  1ZJN A;  4RQ7 A;  3TAP A;  2FMP A;  5KFI A;  3TFR A;  7ICF A;  4MFC A;  5KFJ A;  3QZ7 A;  7ICU A;  1ZJM A;  4F5O A;  1S0M A;  1ZQR A;  3UXO A;  1XWL A;  3K4G A;  5KT6 A;  4E0D A;  3OJS A;  4RZR A;  4NXZ A;  3RBE A;  5J0Y A;  2BPC A;  2HHS A;  9ICI A;  3MAB A;  5CA7 A;  3PY8 A;  2FLL A;  3RJK A;  4UBC A;  3UPQ A;  2UVR A;  4UB2 A;  1S0N A;  4KLD A;  2HHT A;  8ICG A;  1ZQA A;  3MR2 A;  5L1L A;  4X5V A;  5KFG A;  2HHU A;  1NKB A;  1JXE A;  4NM2 A;  3RB4 A;  3ZDB A;  4UB3 A;  3TI0 A;  5KFT A;  1ZQH A;  8ICJ A;  4YXM A;  1NK9 A;  1U47 A;  3GQC A;  9ICO A;  1ZQU A;  4DOA A;  5J2H A;  3T5L A;  2DPI A;  7ICP A;  5CHG A;  3THV A;  5DBA A;  4R65 A;  1ZQN A;  9ICM A;  4NLZ A;  5KFW A;  4B9S A;  4J9S A;  3AUO A;  1XSN A;  8ICB A;  4I2B A;  4ED6 A;  5J0P A;  1ARO P;  4BGD A;  4QW9 A;  3ZDC A;  2NRZ A;  3FDS A;  8ICZ A;  3GIM A;  3PW2 A;  3UXP A;  5KG6 A;  8ICQ A;  4I27 A;  4KLQ A;  4O5C A;  3UQ0 A;  1HUZ A;  4YG2 A;  3RAX A;  1ZYQ A;  4XRH A;  5EWG A;  1NJY A;  3GIL A;  1TAU A;  2BPF A;  4F93 B;  2R8G A;  1ZQZ A;  1TVA A;  2C22 A;  5KG4 A;  2NRV A;  3B0X A;  3H4D A;  3PX0 A;  3TAQ A;  2HHX A;  1L3U A;  4JWM A;  3GIK A;  4UAW A;  4KLL A;  4QZA A;  4RNO A;  5KFD A;  4F4Y A;  4DL7 A;  7ICS A;  3MGI A;  3H8W A;  3ISB A;  3G6Y A;  4DOB A;  1T3N A;  2F1J A;  1KFD A;  2NRT A;  4RQ4 A;  5EWE A;  4KLI A;  2JEF A;  1U45 A;  3PO5 A;  4M04 A;  2XY6 A;  5CR0 A;  4QZH A;  3QE9 Y;  3MDA A;  1D9F A;  4UQG A;  5KG5 A;  1UA1 A;  4GC6 A;  2ZJA A;  5J0S A;  3RJJ A;  3C2L A;  2KZ3 A;  5KFM A;  1JIH A;  4BWJ A;  4ZH4 A;  3PW4 A;  3V7J A;  4IRK A;  4RPY A;  1BVS A;  5D46 A;  1ZQI A;  5J2D A;  5CJ7 A;  3H4B A;  3V7L A;  2KFZ A;  2W9B A;  3SZ2 A;  1JXL A;  4QWE A;  3HX0 A;  4I2I A;  4YCX A;  4Q43 A;  5HNK A;  5BPC A;  2R8I A;  3RJG A;  4M9G A;  4IR9 A;  3ZD8 A;  5F9N A;  4YD2 A;  4M6W B;  7ICQ A;  1TK8 A;  1RXW A;  4KLH A;  1KSP A;  1BPB A;  3T3F A;  5DLF A;  2HHQ A;  1WCL A;  2XCA A;  3V6K A;  2AGP A;  1ZQT A;  7ICI A;  2HVI A;  5HP4 A;  2ASJ A;  4YN4 A;  4O5E A;  2KZM A;  4DQS A;  5HML A;  3FYH A;  8ICV A;  2W9M A;  1NJZ A;  4YFK A;  1X9W A;  2IHN A;  4QZ9 A;  5J0O A;  1T4G A;  4UB4 A;  4M9N A;  3H40 A;  4UB1 A;  1K1S A;  4QZF A;  3M9N B;  4J9R A;  1BPX A;  1T7P A;  4F92 B;  4NLG A;  4ED8 A;  8ICK A;  1RPL A;  2MUT B;  5L1I A;  3RJI A;  5KFR A;  3C1Z A;  4RQ0 A;  4I29 A;  3C23 A;  7ICK A;  7ICO A;  5IIO A;  2XGQ A;  9ICG A;  3JPQ A;  5KFF A;  3N97 B;  4KLT A;  9ICV A;  1NK4 A;  4DL2 A;  3GFK B;  3C2M A;  2FLN A;  5J2I A;  1EXN A;  4YMN A;  2UVU A;  1N48 A;  2ZJ5 A;  3GV5 B;  2BCQ A;  2VAN A;  9ICR A;  1QSS A;  1COO A;  4J9Q A;  3LWL A;  3RRH A;  4EBD A;  4RPX A;  8ICO A;  4RUA A;  3N4M B;  4F5P A;  3C2K A;  3SV3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...