3GFKB

Crystal structure of bacillus subtilis spx/rna polymerase alpha subunit c-terminal domain complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
76
structure length
76
Chain Sequence
GPHMKEEDQKEKVLEMTIEELDLSVRSYNCLKRAGINTVQELANKTEEDMMKVRNLGRKSLEEVKAKLEELGLGLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/transferase
molecule keywords Regulatory protein spx
publication title Crystal structure of the in vivo-assembled Bacillus subtilis Spx/RNA polymerase alpha subunit C-terminal domain complex
pubmed doi rcsb
source organism Bacillus subtilis
total genus 26
structure length 76
sequence length 76
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2009-02-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3gfkB00
4ECYA 4PPXA 3T5JA 1MSWD 1RYRA 7ICSA 4O5CA 5J2EA 4C8KA 4JV2A 2HHTA 5DQGA 5IIMA 4ECZA 1RXWA 1UT8A 1WCNA 2PFQA 4B9VA 3Q8KA 3ISBA 4DQRA 2R8KA 2P6RA 4QWBA 4EBCA 1A77A 3V7JA 4M9GA 5KFJA 2ATLA 4PHEA 2DPJA 5J2CA 1RZTA 4UB4A 2PFOA 4UAZA 4F2RA 4QZAA 4I29A 4G3IA 1SZPA 4P4PA 2V9WA 5J0SA 5KFPA 4NLKA 8ICBA 4QWAA 5CHGA 3TAQA 2Y1IA 4J9QA 5KFVA 4O5EA 2ASJA 3UXNA 3PO5A 8ICIA 2M9NA 3PMLA 3RR7A 4YMNA 3MR3A 3T5KA 4BXOB 5D46A 4F5QA 4YVZA 3H8SA 4ED8A 1KFTA 2I1QA 2W8KA 4NM2A 3N97B 5CP2A 9ICFA 5KFAA 4RZRA 3M9MB 4QZEA 4ECTA 4ED2A 1ZQYA 2BKEA 4IQUA 5EWFA 4IQVA 2IMWP 4TQRA 4I2HA 4X5VA 3MFHA 3MDCA 4DL6A 1RPLA 2AQ4A 2PFPA 5DGBA 5L1JA 4UB1A 9ICXA 4K4GA 1U48A 1ZQQA 3M9NB 3THVA 4PGYA 1CEZA 1BPDA 3FDSA 1ZJNA 9ICIA 5J29A 2XGQA 3GIIA 5L1IA 3MABA 2C2EA 8ICPA 4JK1A 1S0NA 1ZQRA 3BQ2A 1QSLA 2XY7A 2BHNA 1SL2A 5D4BA 4KLTA 4M6WB 1KFDA 1D9DA 1SL1A 8ICOA 1LV5A 2Q0ZX 2FLPA 1ZQMA 2H5XA 4DS4A 1BPEA 4RNNA 3EZ5A 4PGXA 3QE9Y 1XS9D 1XU4A 3M9OB 2NRTA 4DEZA 5KFBA 1S10A 8ICEA 8ICNA 4EEYA 1S9FA 1ZQBA 4RQ5A 3C21A 3RJFA 2JZBA 3RH4A 2HHWA 1IM4A 1Z00A 1TVAA 2IHMA 1L5UA 2ZTCA 2FMSA 5HHIA 3C2LA 8ICLA 7ICHA 4DLGA 5CWRA 4DF8A 3PVXA 3JPNA 3RRHA 4ECUA 5KFTA 2ZTDA 3ZDBA 7ICNA 1ZQNA 4Q43A 3PR5B 7ICEA 3V6KA 4ECVA 4NM1A 4J9SA 8ICWA 4J9PA 8ICVA 4JWMA 5KG2A 4MFFA 2BCVA 2BCQA 3PX4A 2IBKA 2KFNA 2ALZA 5KG5A 4F92B 5KFCA 5KFRA 5IIJA 4YN4A 2NRXA 5J2HA 3TFRA 1KRPA 4E0DA 4I28A 4DL2A 4KLEA 5DBAA 4O3PA 4KLOA 5L1KA 5KT2A 2C22A 2MUTA 1NK6A 9ICSA 4DL5A 4UQGA 3JPPA 4C8NA 4YCXA 2HHUA 5EWEA 4KLFA 5DG9A 4I27A 4ELVA 1JXLA 5L1LA 4ZH4A 4F4KA 1X2IA 5J0UA 1U45A 2KTQA 1BPYA 1JXEA 4KLMA 1XSPA 4DQIA 1XWLA 1UT5A 4KMUA 3GILA 3QZ7A 2ZTEA 4F5OA 4M9LA 4P4MA 2KFZA 4YMMA 3OJSA 4NY8A 4RPXA 4FS1A 3IHQB 1Z3EB 4GXKA 3M8SA 2W9CA 1RYSA 5KG4A 2A1JA 4Z6EA 1QSYA 1AROP 3FYHA 2V4QA 5DLFA 3BDPA 1TKDA 4RT2A 5IIOA 4C8LA 3UXPA 4ELTA 1X9WA 4M9NA 2R8HA 4DSIA 5KFSA 2FPMA 4B9MA 2ZJAA 4GLXA 7ICLA 4ECQA 4XA5A 1T4GA 5KFNA 4F91B 1JMSA 3RJIA 3EW9A 4J9LA 7ICFA 3RAQA 4RNOA 4NLZA 3EPGA 3JPSA 1HJPA 4JV1A 4QZDA 4J9KA 3KHRA 4C8OA 2AQ0A 2BQ3A 4KLLA 5KG6A 4Q8EA 4DL3A 1MC8A 2FPLA 2HHXA 3LDAA 3SV4A 1S77D 4QZHA 4IQTA 4GC6A 4ED6A 3PNCA 3C5GA 2F1IA 5J0TA 2RDIA 1N48A 4LVSA 5TZVA 4B9UA 4M47A 1ZJMA 1NK5A 4MFAA 1S0VA 5J0RA 9ICEA 4KN4A 1NKBA 4Q45A 2BGWA 1H38A 1ZQOA 4IRKA 5J0WA 3MR5A 4EZ6A 2C2DA 2R8GA 2XY5A 4RT3A 4EYHB 3RBDA 5HNKA 7ICOA 8ICSA 4J9NA 4KLQA 8ICJA 3C2KA 4PHAA 9ICNA 4KTQA 5KT7A 3C1YA 4DSEA 2JEGA 4RQ4A 7ICUA 3TANA 4Q8FA 3ZD8A 5D49A 5CR0A 2W9BB 4ECSA 2ASLA 5KT5A 5IILA 3T3FA 4XQ8A 3PMNA 2XCAA 3BQ0A 3KHLA 4UB3A 2P66A 8ICYA 3NGDA 2DPIA 2JEJA 4BXOA 3B0YA 1NJXA 3PW2A 7ICVA 4UAWA 3GIKA 9ICJA 3RJEA 2PI5A 4I2GA 1ZQVA 4F93B 4XUSA 2ASDA 1TK8A 4K4HA 9ICMA 1L3VA 2BPCA 1JN3A 5DKWA 1TAQA 3NTUA 3RB0A 1TFRA 2HVIA 4DOAA 2XGPA 2F1JA 2BQRA 3RR8A 3UQ0A 4O3RA 3JPQA 4ELUA 5KFXA 9ICAA 3JPTA 3H4DA 2XY6A 4XRHA 4YD2A 5EOZA 5J2AA 4DOBA 8ICRA 8ICGA 3OGUA 7ICGA 4QWCA 1S76D 3TI0A 2J6UA 3RH5A 2UVRA 4DQPA 1WCLA 3Q8QB 4M04A 4C8MA 9ICCA 5KFGA 4QZCA 3LWMA 4M6WA 3Q8MA 8ICCA 8ICTA 1NK0A 1DOQA 4MF8A 3PV8A 1C7YA 4TQSA 2FMQA 3GFKB 2BPGA 3H7IA 3MBYA 5HMLA 5DLGA 3MGHA 5BOLA 4UB2A 4RPZA 3ZD9A 2VANA 2FLNA 5KFIA 2V4RA 4DQSA 3ZDDA 1BPBA 4J9OA 4DFJA 4M2YA 4RQ7A 5DB9A 4ED3A 3N4MB 2ZUCA 4RUCA 1KDHA 3RRGA 2FMPA 4FS2A 5DB8A 9ICLA 5J2DA 1KFSA 4KLHA 4JWNA 1BGXT 1ZQDA 4RNMA 2ZJ5A 3T5LA 2AGOA 4YG2A 1U9LA 9ICUA 4IQWA 3HPOA 4O0IA 1RXVA 3SI8A 4PHDA 3GV8B 3K4GA 4PH5A 4RQ3A 4DO9A 4FBTA 1QLNA 5DBBA 5KTQA 2NRWA 5C5JA 4RUAA 5DB6A 3LK9A 3OHBA 3V7LA 3G6XA 2W8LA 3PO4A 4IRCA 4R66A 5BPCA 1ZQIA 9ICTA 1JIHA 4EYIB 3EWAA 2B21A 3MGIA 2OWOA 3PR4A 4I2DA 5KFHA 3OSNA 2KN7A 4F4XA 3SV3A 4MF2A 4B9LA 4ECRA 4B9NA 1S97A 4KITB 4F4YA 3V72A 3MFIA 1T7PA 2AGPA 5KG7A 1HUZA 3UQ2A 1KLNA 3ETLA 4I2IA 3K75D 2I9GA 2HHQA 1COOA 3H40A 4R63A 2FLLA 3PY8A 3V6JA 2P6UA 3M8RA 4RQ8A 3EPIA 3SYZA 1NK7A 1QSSA 4F4WA 2BR0A 3RJHA 4P2HA 4P4OA 4YD1A 1X9SA 1TV9A 1N56A 4R8UB 8ICMA 5DG7A 4QZFA 5KFKA 4Z6FA 1ZETA 1DGSA 5F9NA 1ZQHA 5KG1A 3AU2A 2C28A 5J2GA 3MR2A 4DSJA 7ICTA 4BGDA 3Q8RB 4FBUA 4QZ9A 3C1ZA 3BQTA 4JV0A 9ICKA 2BCSA 9ICWA 1L3UA 4EBDA 3Q8LA 4YR3A 5CJ7A 4RQ6A 4DL7A 3QEAZ 2AJQA 5KFYA 3B0XA 2F1HA 5J2IA 4J9MA 1U49A 4I2BA 1D8YA 2MAXA 7ICQA 1BVSA 4GXJA 3PW5A 8ICHA 3HP6A 1JX4A 5F9LA 8ICUA 1ZQSA 5IIIA 3T5HA 4F5RA 4DF4A 1BPXA 4HYKA 1NJWA 2ISPA 4YXJA 4F50A 4DSFA 3H8JA 2UVVA 4IR1A 4KLIA 4J9RA 4O3NA 1KEJA 4EBEA 1D8LA 4YR0A 1IXRA 1ZQCA 1NK9A 3RJKA 1SL0A 5JUMA 2J6TA 5IIKA 4LZGA 5J0OA 4O3QA 4EZ9A 3QZ8A 2VA2A 5J0YA 2XC9A 5DGAA 3UPQA 1ZQLA 5J0QA 1NJZA 1ZQPA 2GWSA 1NJYA 4K4IA 1TAUA 4O3OA 4RQ1A 4ED1A 4B9TA 8ICAA 2IHNA 3HW8A 4UBBA 4GXIA 3PX0A 2VA8A 4IRDA 5KT6A 9ICBA 4BDPA 9ICPA 3RJJA 1L3TA 2UVUA 3ZDEA 4QZ8A 3RB6A 3JPRA 1UA1A 3RB3A 4FO6A 2XCPA 1A76A 5KFMA 3GIMA 3OJUA 1MQ2A 2UVWA 9ICRA 4NXZA 3Q8SB 9ICQA 2DFLA 1EXNA 4PHPA 1T3NA 2R8JA 3PW4A 2W9BA 2PXIA 5HP4A 2VA3A 4F8RA 9ICHA 4I2CA 3RJGA 5DB7A 3ZDAA 3HWTA 3RTVA 3JPOA 5IINA 1TK0A 1NKEA 2JEFA 4UBCA 3C23A 4R64A 3GV7B 1XSNA 4ED7A 1QTMA 4NLGA 3AU6A 3KHGA 1ZQFA 1S0MA 4DWIA 3MDAA 4M0AA 4KN7A 3G6YA 4Z6DA 3PW0A 1CUKA 4GC7A 1ZQKA 1ZYQA 1ZQUA 1HUOA 5KG3A 3GDXA 2BDPA 4RQ2A 1S0OA 9ICVA 4ED0A 4UAYA 3H4BA 4F4ZA 4M9HA 1K1SA 3GIJA 4QW8A 2PI4A 4KLUA 4MEXA 5KFEA 4YMOA 2FPKA 5KFLA 9ICOA 1ZQJA 1T8EA 2BPFA 4YXMA 1ZQWA 3HX0A 1MQ3A 3BQ1A 1TK5A 3G6VA 2AU0A 2KZZA 1ZQEA 2ZUDA 3OSPA 7ICIA 5KFOA 2HVHA 1NOMA 4F5NA 1D9FA 2ZJ8A 2IA6A 5DQHA 5KFWA 3TAPA 4RU9A 4ECXA 2ZUBA 5J0XA 3C2MA 4Q44A 1SKSA 3ZDCA 5J2BA 5J2KA 4MEYA 2PFNA 1PZNA 4TUSA 7ICJA 5BOMA 3PW7A 2JZBB 4TUPA 2BCUA 2C2RA 1Y88A 1Z00B 5KFDA 1L3SA 1ZQTA 4DL4A 4DLEA 7ICRA 7ICKA 5KFZA 5KFFA 3LWLA 1UA0A 5KFUA 2JEIA 3ISDA 2NRZA 4DFMA 4YQWA 5EWGA 2Y1JA 1XSLA 4CCHA 3ORYA 5J0PA 1V9PA 3Q8PB 4TUQA 5DBCA 4UB5A 3KTQA 4M9JA 3E2EA 4KLDA 1NKCA 2WTFA 2XO7A 5KT4A 4I2EA 3TQ1A 1B22A 2BQUA 4I2AA 1LB2B 4KLJA 5HMMA 1NK4A 4DSLA 3UXOA 3TFSA 4BWJA 3QEBZ 4DFPA 4KLGA 1ZQAA 4TURA 2MUTB 3GQCA 4DOCA 1XC9A 3H8WA 5KFQA 4F2SA 3IM1A 1NK8A 2HW3A 5J2FA 3OHAA 4PGQA 4LZDA 4QZIA 2KZMA 3RB4A 1U4BA 4KLSA 5DDYA 2NRVA 5CA7A 3HT3A 2R8IA 1BPZA 4DSKA 9ICGA 2KZ3A 1KSPA 4F3OA 3TARA 3V6HA 4IR9A 1SKWA 1SKRA 2ISOA 5DQIA 4RQ0A 5L9XA 1ZQGA 4R65A 4QW9A 5HHHA 3ISCA 8ICFA 1ZQXA 1U47A 2HHVA 5KT3A 2W9CB 4I2FA 4R8UA 3RH6A 2A1JB 3BJYA 4MFCA 1ZQZA 4YFKA 4F5PA 3RAXA 2HHSA 7ICPA 4O5KA 1B43A 4QZBA 4RPYA 5KG0A 3MR6A 3EYZA 8ICZA 4YR2A 4I2JA 1K1QA 8ICXA 4YP3A 3V7KA 2AGQA 5DG8A 1XO1A 3KHHA 4ECWA 8ICQA 3SZ2A 4DS5A 4QWDA 1KTQA 4QWEA 4DQQA 4DFKA 2W9MA 5J2JA 4QZGA 3C5FA 1X9MA 2J6SA 5CB1A 2W9AA 2BCRA 4Z6CA 4O9MA 3AUOA 3GV5B 4BWMA 3PX6A 2RDJA 2LYHA 4JUZA 7ICMA 4O3SA 5DDMA 4B9SA 3RBEA 4NLNA 8ICKA
chains in the Genus database with same CATH superfamily
4ECYA 4PPXA 4O5CA 4C8KA 2JH1A 4ECZA 1F0MA 3Q8KA 1Q3UA 5J8YC 2P6RA 4M9GA 2ATLA 5J2CA 2PFOA 1V85A 5AI0A 3KBBA 3NVZA 5KFPA 4QWAA 2KOBA 2Y1IA 2ASJA 1QCKA 2ZIUB 1VLBA 2M9NA 3PMLA 4YMNA 4BXOB 4F5QA 4ED8A 2W8KA 3IG8A 5CP2A 9ICFA 4ED2A 1ZQYA 2E8MA 4IQUA 2YN4A 4TQRA 4DL6A 5AM5A 3M9NB 4PGYA 3GIIA 1FO4A 5L1IA 3MABA 1S0NA 3BQ2A 3VC8A 4DFDA 1SL2A 5D4BA 4KLTA 2FLPA 2EAMA 4RNNA 1YZ6A 1SWWA 4UAVA 2H3QA 1XS9D 1XU4A 2NRTA 4EEYA 3RH4A 1IM4A 1L5UA 2ZTCA 2LHTA 3FC4A 1SV4A 4DF8A 3AMZA 3JPNA 4CDGA 4LJXA 3ZDBA 7ICNA 7ICEA 1ECWA 3A0HU 3UMBA 4JWMA 2KK0A 2BCQA 5KFRA 4YN4A 2NRXA 4I28A 4KLEA 5DBAA 5L1KA 2YMLA 9ICSA 4YCXA 1JXLA 1X6JA 3AQFA 4F4KA 1U45A 1XSPA 4QNLA 4DQIA 4F72A 2IOFK 1UT5A 4F5OA 2ZTEA 3M6ZA 1OUQA 2NYVA 5AM2A 3NASA 4Z6EA 3I76A 3FYHA 1TKDA 3QYPA 5IIOA 1ZRNA 2G09A 2R8HA 4AP9A 5ALSA 5KFSA 2K4HA 4GLXA 4NLZA 1HJPA 4EENA 5ALYA 3DDHA 2AQ0A 4Q8EA 2FPLA 3LDAA 1S77D 4GC6A 4ED6A 2F8KA 2F1IA 4EX6A 2DUYA 1CRXA 5J0RA 1NKBA 5J0WA 3IG5A 3QUQA 4J9NA 2YQEA 9ICNA 2P35A 7ICUA 1IV8A 2GLEA 3NVWA 3WK5A 3ZD8A 5D49A 2KVSA 3T3FA 3PMNA 5AK4A 1L7MA 4UB3A 3KHLA 2DPIA 7ICVA 3PW2A 5ALXA 3GIKA 3RJEA 2JRZA 2ZIVA 4US9A 1JN3A 1TFRA 2HVIA 5AKIA 5ALLA 4DOAA 2XGPA 2KG5A 2BQRA 3QX7A 3RR8A 3UQ0A 3L5KA 3JPQA 5KFXA 4RQNA 4YD2A 2ZIWB 5EOZA 4DOBA 3OGUA 1S76D 4DQPA 4OJ5A 4C8MA 3LWMA 4M6WA 3RFAA 1NK0A 2GOLA 5HMLA 5G5GA 5DLGA 2W11A 3MGHA 4EELA 4UB2A 5E79U 1SWVA 4RQ7A 3RRGA 1MA7A 1Z1VA 5DB8A 3GZFA 9ICLA 4C80A 3TKAA 2WB1F 2HMXA 2NO5A 4IQWA 1V97A 3K4GA 5C5JA 3LK9A 3OHBA 2W8LA 3V7LA 2CRXA 4EYIB 3MGIA 5KFHA 4F4XA 2M0NA 3MGVA 3UQ2A 1KLNA 5AKGA 4ACOA 2D6FC 1COOA 2FLLA 1N62A 3V6JA 3EPIA 1NK7A 3RJHA 4QZFA 1ZETA 1DGSA 5KG1A 3AU2A 5J2GA 7ICTA 2EZZA 2FJ6A 3S6JA 4CF3A 2AJQA 3B0XA 3H8MA 2F1HA 5J2IA 8ICHA 2ZIXA 5F9LA 1ZQSA 4UB6U 4F5RA 2LM1A 2K4EA 4IR1A 4O3NA 1Z1BA 1IXRA 1WYGA 1NK9A 5JUMA 2QARA 5J0OA 2XC9A 3UPQA 4U6PA 5J0QA 1NJZA 2B6GA 4O3OA 1VDVA 2VA8A 9ICPA 3ZDEA 3JPRA 1GO3F 1A76A 5AHXA 5KFMA 3Q8SB 2DFLA 1EXNA 4NV0A 4PHPA 4F8RA 2W9BA 2PXIA 5HP4A 3SAHA 1TK0A 3C23A 5ALEA 4ED7A 2YB4A 3KHGA 3M1YA 1ZQFA 3MDAA 1FFVA 1QH9A 4KN7A 3PSPA 2Y9UA 4UAUA 1ZYQA 5KG3A 2BDPA 4BX9C 4UAYA 4M9HA 2PI4A 4MEXA 5KFEA 5F3XB 3WKEA 1B0XA 2RHFA 2G5HB 1ZQEA 3OSPA 3LVVA 7ICIA 2HVHA 4F5NA 5AI4A 1SV0C 3TAPA 4RU9A 3KKAC 4ECXA 5BOMA 3N7RC 1Y88A 5KFDA 1ZQTA 7ICRA 3ISDA 2Y1JA 3NUQA 4US8A 4KLDA 2F3NA 2WTFA 4I2EA 1PK3A 2BQUA 4P0QB 3UXOA 3QEBZ 3WKDA 4DFPA 1J2NA 4C4SA 3GQCA 1PUZA 3IM1A 1JUDA 3OHAA 4PGQA 4QZIA 1U4BA 5DDYA 1RYUA 2NRVA 5ALVA 3HT3A 4DSKA 1BPZA 3V6HA 1SXEA 5DQIA 4QW9A 3H0MB 2HOIA 4YFKA 2A3VA 4RPYA 5KG0A 8ICZA 1X6IA 2VJ5A 3E58A 4ZOHC 2AGQA 2W04A 3KHHA 4A8EA 8ICQA 1KTQA 3SD7A 5J2JA 2J6SA 2KIVA 2F44A 4Z6CA 3AUOA 3GV5B 3PX6A 2LYHA 3J81j 5ALHA 3QUBA 3T5JA 1RYRA 5J2EA 2HHTA 5DQGA 1UT8A 4WJ3B 3TADA 4Y2PA 3N7SC 1LVHA 2PMZC 2ZXIA 5AK3A 3V7JA 2H3VA 5EE9A 5KFJA 2DPJA 2EAOA 2XI9A 4F2RA 3L3FX 4PJ0U 4G3IA 4P4PA 2CPRA 3BS5A 4NLKA 5CHGA 3WK9A 2E8OA 3UXNA 5ALNA 3RR7A 8ICIA 3T5KA 4YVZA 1KFTA 2I1QA 2WF8A 3K1ZA 4NM2A 3N97B 4G9BA 1X42A 3D6JA 4RZRA 2ZIVB 3M9MB 4ECTA 2Y0SF 4ICAA 2BKEA 4HAIA 2AQ4A 4PL1A 3MDCA 1RPLA 5DGBA 5L1JA 3I28A 1U48A 1ZQQA 2QB1A 1BPDA 5AI6A 4JK1A 3PZPA 2BHNA 4M6WB 1KFDA 3H0RB 3HKZF 3QU7A 5GTIU 4EEKA 1SL1A 2AHOB 4DS4A 1BPEA 4RQMA 4DEZA 8ICEA 8ICNA 1ZQBA 2DWQA 1TVAA 3NRWA 4P0PA 2FMSA 7ICHA 3QUCA 3PVXA 2XICA 4OJ6A 1ZQNA 2RLTA 1QQ7A 4ECVA 5HR6A 3GU3A 4J9SA 2KIWA 8ICVA 3F2BA 5KG2A 1L6NA 2BCVA 4F92B 4CGZA 5IIJA 4KLOA 1NK6A 4UQGA 3JPPA 4C8NA 4KLFA 4ELVA 4ZH4A 1JXEA 3GILA 4M9LA 2KFZA 2WHEA 3OJSA 4NY8A 5JU5A 2YTUA 3HILA 3M8SA 2W9CA 2D8CA 1PK1A 2A1JA 5DLFA 4RT2A 4C8LA 2K4IA 4F71A 5ALPA 4ELTA 1X9WA 4M9NA 2LPEA 2FPMA 2ZJAA 1T4GA 5KFNA 3SEIA 3EW9A 1YZ7A 5AM4A 2OYYA 3KHRA 1L7PA 5KG6A 2ZIXB 4DL3A 2HHXA 4QZHA 4IQTA 3C5GA 1FFUA 2RDIA 3SMVA 2QARB 1SXDA 4B9UA 4M47A 1ZJMA 1NK5A 1S0VA 9ICEA 4KN4A 3NS1A 3MR5A 4CRXA 3CRXA 8ICSA 4UATA 4KTQA 4KX5A 4RQ4A 3TANA 4Q8FA 2W9BB 3OTQA 2XCAA 8ICYA 3B0YA 2PI5A 4I2GA 1ZQVA 4F93B 2XVTA 4XUSA 2ASDA 1L3VA 2BPCA 4O3RA 3AM9A 5G5HA 4AYBF 5JRTA 3JPTA 3H4DA 2KJ9A 4XRHA 8ICGA 5ALKA 8ICRA 4QWCA 1NI3A 5K4LA 4QZCA 2HOFA 1DOQA 3HRDD 4MF8A 4NLBA 5T14A 1KBUA 3GFKB 1S5LU 3H7IA 2JH7A 3ZD9A 2VJ4A 4DQSA 4J9OA 4ED3A 2K89A 4FS2A 3WKAA 1ZQDA 4NL9A 4RNMA 1U9LA 9ICUA 3M7DA 3HPOA 4O0IA 3SI8A 3GV8B 4DO9A 2NRWA 4RUAA 3G6XA 4R66A 5BPCA 1ZQIA 1CI4A 9ICTA 1JIHA 2WB1C 4I2DA 5ALJA 3OSNA 1COKA 4ECRA 4B9NA 1S97A 3AQEA 4KITB 2AGPA 5AICA 5KG7A 1HUZA 3ETLA 3K75D 3H40A 4R63A 1V38A 3PY8A 3M8RA 4P2HA 4YD1A 1X9SA 8ICMA 2LMRA 4Y2TA 1JI7A 2C28A 2IOHA 2MU2A 3Q8RB 9ICKA 4QZ9A 3BQTA 2KJ8A 4EBDA 5CJ7A 3ZI4A 3QEAZ 1N5XA 3RF9A 7ICQA 1D8YA 2MAXA 1JX4A 5IIIA 3T5HA 1BPXA 2ISPA 3H8JA 2UVVA 4J9RA 3RJKA 2K8CB 2E1EA 4LZGA 4O3QA 3U26A 1ZQPA 1NJYA 1TAUA 2AXTU 4RQ1A 4B9TA 2DGZA 2IHNA 1P7DA 4GXIA 3PX0A 4IRDA 1HEKA 2JXJA 2UVUA 3SENA 1KFSA 1K5OA 4GIBA 2UVWA 1OW5A 3BS5B 2KICA 3RJGA 5DB7A 3ZDAA 5AKEA 3RTVA 3JPOA 5IINA 2JEFA 1NKEA 2H3IA 2KE7A 4DWIA 4BUGA 3H0LB 3IRUA 4CE6A 3G6YA 3PW0A 4IL6U 1HUOA 5AI5A 5AM0A 4OJOA 3H4BA 4NL9C 1ZD3A 3KD3A 4QW8A 3WK7A 2FPKA 4JB3A 1ZQJA 2BPFA 1ZQWA 3HX0A 1MQ3A 1B4FA 1TK5A 5L1MA 4FE3A 2IA6A 5KFWA 3QXGA 2ZUBA 3ZDCA 1SKSA 1Q8KA 3BZCA 7ICJA 3M6KA 3PW7A 2BCUA 2C2RA 4P0PB 3CYMA 5KFUA 4DFMA 3E0FA 5J0PA 3Q8PB 4TUQA 5DBCA 3KTQA 3E2EA 2Z7JA 1DXSA 1B22A 1LB2B 4JMUA 1NK4A 1BNPA 4KLGA 1ZQAA 3WK8A 4DOCA 4Y2RA 5KFQA 5AM3A 3BS7A 4LZDA 2KZMA 5CA7A 1PVRA 2KZ3A 1SKWA 3EUB2 2ISOA 4RQ0A 1UHUA 4R65A 1T3QA 3CP8A 5KT3A 2W9CB 2A1JB 3BJYA 4MFCA 2HHSA 2LYBA 3RAXA 3UMGA 4O5KA 4QZBA 3MR6A 3EYZA 4YR2A 1K1QA 3DEEA 1UCVA 1N63A 3LYSA 3V7KA 1PVPA 1WG8A 2WF5A 4DS5A 4QWDA 5AKXA 4DQQA 4QWEA 4QZGA 3C5FA 2WFAA 3IDWA 1SB3C 5B66U 4O9MA 2HBMA 4BWMA 2RDJA 2DF4B 4JUZA 5DDMA 4B9SA 4CNQA 7ICSA 4Y2JA 4JV2A 5IIMA 1RXWA 2PFQA 4B9VA 1YT3A 3ISBA 2K60A 1F44A 1A77A 1LKYA 4PHEA 4UB4A 4IS7A 4UAZA 3FAHA 2A19A 4QZAA 4I29A 2JMGA 1SZPA 2G08A 5J0SA 2KV2A 3TAQA 4J9QA 5KFVA 5ALIA 5D46A 2WF6A 4QZEA 2KVCA 2KEYA 5EWFA 2IMWP 4IQVA 4K4IA 5ALGA 4X5VA 3MFHA 4I2HA 3QUTA 4UB1A 9ICXA 1Q3VA 2K8AA 1ZJNA 2W7OA 2C2EA 1ZQRA 2KSOA 4QIWF 2Y0SC 1QSLA 2XY7A 1RG6A 2KP7A 5ALRA 5ALTA 8ICOA 1LV5A 2Q0ZX 2EZXA 1ZQMA 1KN5A 4OJLA 1S10A 5KFBA 1S9FA 2JZBA 1Z00A 8ICLA 1NZBA 4C4RA 3HKZC 4ECUA 5KFTA 2ZTDA 4OJPA 2EDUA 4Q43A 3V6KA 4MFFA 2IBKA 3PX4A 2ESEA 2KFNA 5KG5A 5KFCA 3TFRA 1KRPA 4O3PA 2MUTA 5DG9A 4I27A 5L1LA 1X2IA 2KTQA 1BPYA 2DBYA 1A0PA 5AK6A 1XWLA 3K1RB 4KMUA 4P4MA 2G5IB 4FZLA 1QSYA 5KG4A 2V4QA 4KX3A 3BDPA 2FE9A 3NVVA 4UARA 2KKVA 4C7ZA 4DSIA 1WWUA 1TE2A 4ECQA 1JMSA 3RJIA 4J9LA 2WAQC 3EPGA 4JV1A 4QZDA 4KLLA 5HR7A 2KD1A 1MC8A 2R18A 2DQNB 3FM9A 3PNCA 5J0TA 1WUDA 3UMCA 4MFAA 1H38A 1ZQOA 2R8GA 2XY5A 4EYHB 3RBDA 5HNKA 7ICOA 1ZD2P 2EANA 3C2KA 1DGJA 4PHAA 5KT7A 3F5EA 1RQLA 4DCCA 5CR0A 5KT5A 4XQ8A 2P66A 3NGDA 1DRGA 4NJ8A 4UAWA 3WK6A 1TK8A 2OHFA 3RB0A 2YMMA 3CW2C 3QU9A 9ICAA 2XY6A 2NO4A 2W55A 2J6UA 1WCLA 3Q8QB 9ICCA 1T94A 8ICTA 3PV8A 2FMQA 2BPGA 4AYBC 3MBYA 5ALWA 5BOLA 2FLNA 5KFIA 2V4RA 2W3SA 1KDHA 2GO7A 3QU2A 5J2DA 3ONNA 4KLHA 2ZJ5A 3DV9A 3T5LA 4U7CA 4OCZA 4PHDA 4RQ3A 4FBTA 1RDFA 1QLNA 3O0FA 5KTQA 5DBBA 2LI6A 2A1AA 3SAFA 5DB6A 4IRCA 3PO4A 1A6SA 1X9XA 3EWAA 2B21A 3QU5A 4Y2QA 1TAMA 3SV3A 4MF2A 4F4YA 2RP5A 3V72A 3MFIA 3IV6A 3SR6A 2I9GA 4OD0A 2HHQA 4FFDA 4C4TA 2WAQF 3TADC 2P6UA 4RQ8A 1OXJA 2BR0A 4P4OA 1N56A 1TV9A 5DG7A 5KFKA 1ZQHA 4DSJA 2HI0A 3C1ZA 4JV0A 2HBKA 9ICWA 3Q8LA 2W7PA 2YMPA 5ALQA 4DL7A 2HSZA 3PSIA 2DL0A 4J9MA 1U49A 4I2BA 3AN1A 4GXJA 2ODGA 2YX8A 4DF4A 4GFJA 4HYKA 2ZG6A 4KLIA 4DSFA 4F50A 4QJFB 5A0LA 4EBEA 4YR0A 2JHDA 3L4PA 1SL0A 4EZ9A 3QZ8A 2VA2A 1FEZA 1ZQLA 2HBJA 5KAFU 8ICAA 3I1YA 2OEHA 1LKYB 9ICBA 1O03A 4BDPA 3RJJA 1UA1A 3RB3A 2XCPA 3GIMA 9ICRA 5EE0A 4NXZA 1D8BA 4Y2YA 1T3NA 3PW4A 9ICHA 1Z4OA 3HWTA 4Y2VA 3C29A 1DK3A 3GV7B 1MN8A 3HJEA 1QTMA 4NLGA 3MC1A 5ALFA 2BDUA 5ALOA 4Z6DA 1CUKA 1Z19A 1ZQKA 1ZQUA 4UASA 3GDXA 2F8LA 4RQ2A 3IP4B 3GIJA 4KLUA 2OM6A 4YMOA 9ICOA 5KFLA 5CRXA 2PKEA 3IN5A 2KSOB 2QB0A 4YXMA 2HBLA 2W3RA 3G6VA 2AU0A 3F53A 3AL0B 5KFOA 3WKCA 1D9FA 2ZJ8A 5DQHA 1PZNA 4TUSA 3QU4A 2JZBB 1HIWA 1Z00B 4BJQA 4DLEA 7ICKA 5KFZA 2JEIA 2MSNA 5EWGA 4CCHA 3ORYA 4UB5A 4M9JA 1NKCA 2XO7A 3TQ1A 1JALA 1QQ5A 4KLJA 5HMMA 4DSLA 5AKLA 4BWJA 1URJA 3R9KA 4P0QA 2MUTB 3H8WA 4FZMA 2E8PA 1ZOLA 2I5HA 3RB4A 4KLSA 2W43A 3LVWA 1IG6A 2R8IA 9ICGA 2D3DA 3KZXA 1KSPA 3TARA 4IR9A 1SKRA 1ZQGA 3ISCA 8ICFA 1U47A 2HHVA 4R8UA 2VKQA 1B43A 2W03A 8ICXA 4YP3A 3SZ2A 1L8LA 1X9MA 1ZXIA 5KL1B 5CB1A 2W9AA 5AKZA 2BCRA 1PVQA 2KHQA 2HDOA 4UB8U 1IIPA 5EE1A 1M6YA 4NLNA 2EZYA 1C20A 1MSWD 2MRLA 2H3ZA 1WCNA 2AH5A 4DQRA 3T79A 2R8KA 2EQYA 4QWBA 4EBCA 1XO0A 1KW4A 1Z4NA 5AI8A 1RZTA 2LM4A 2V9WA 3OPXA 5AKYA 8ICBA 4PZNA 2OXOA 4PZOA 4O3MA 2XIDA 4O5EA 3PO5A 3MR3A 3H8SA 1F5SA 3N7PD 5KFAA 1WWVA 3KFUF 2PFPA 5AK5A 2JV3A 3PSFA 4K4GA 3THVA 1CEZA 3B9JA 3FDSA 4OO1J 5J29A 2XGQA 9ICIA 8ICPA 3WK4A 2RQ5A 1D9DA 1ZD5A 2H5XA 2Q4TA 3EZ5A 4PGXA 3QE9Y 3M9OB 1X40A 4RQ5A 4QIWC 3C21A 2YY6A 3RJFA 1S8OA 2HHWA 3WU2U 2IHMA 5HHIA 3C2LA 1NNLA 4DLGA 5CWRA 4NWIA 3RRHA 3PR5B 5TISU 3UM9A 4NM1A 8ICWA 4J9PA 3PSTA 2ALZA 2YB1A 5J2HA 4E0DA 4DL2A 3ICXA 5KT2A 2C22A 2BZFA 4DL5A 5JTIA 3ED5A 2HHUA 5EWEA 1O08A 5J0UA 1JROA 5AM1A 1SV0A 3KKAA 4KLMA 1J97A 3QZ7A 1PK1B 4YMMA 4Y2XA 2LBOA 3NVYA 4RPXA 4FS1A 3IHQB 1Z3EB 3AEVA 4GXKA 1RYSA 3D2NA 1AROP 5ALDA 2KHVA 2E5SA 3NRZA 2LYAA 3UXPA 2E3TA 4B9MA 7ICLA 4XA5A 4F91B 7ICFA 3F2DA 3A0BU 4IC9A 3RAQA 4RNOA 2K8BB 3JPSA 3N28A 4J9KA 4C8OA 2BQ3A 2EAPA 3SV4A 2HCFA 1ED1A 1JRPA 1N48A 4LVSA 2KKPA 5TZVA 3BQ7A 4Q45A 2BGWA 4IRKA 4NLCA 2F77X 2FDRA 2C2DA 4EZ6A 4B6JA 4RT3A 1BNOA 1SZHA 4KLQA 8ICJA 3ETRA 5C0YA 3C1YA 4DSEA 2JEGA 4ECSA 2ASLA 3D2SA 2ZIUA 5IILA 3BQ0A 4BXOA 2JEJA 1NJXA 9ICJA 4K4HA 9ICMA 2WF7A 2DKXA 5DKWA 1TAQA 3NTUA 1X66A 1QQ6A 2F1JA 1ZQ1C 4ELUA 3TACB 2OH2A 5J2AA 4C7YA 7ICGA 3CNHA 3TI0A 2UVRA 3RH5A 2N1RA 4M04A 5KFGA 2QB0B 3Q8MA 8ICCA 5CEHA 2K4PA 5AIBA 2F76X 1C7YA 4KMOB 4TQSA 1XNSA 1N60A 1L7NA 2DKZA 1KL9A 3SQIA 4RPZA 2VANA 4UW9A 4M2YA 3ZDDA 1BPBA 4DFJA 5DB9A 3N4MB 2ZUCA 4RUCA 2FMPA 4JWNA 1BGXT 4EX7A 2AGOA 4YG2A 1RXVA 4PH5A 1RM6C 4CF4A 2F2AB 5AI9A 5AIAA 2OWOA 4CF5A 3PR4A 2KN7A 2MA1A 4B9LA 3SAGA 4USAA 3ALRA 1T7PA 1Q46A 4I2IA 3SYZA 1QSSA 4F4WA 5AKHA 4R8UB 2G07A 2JGAA 4Z6FA 5F9NA 2KMDA 3MR2A 4BGDA 4FBUA 1DK2A 1SIJA 2BCSA 1L3UA 1FIQA 1NZPA 4YR3A 4RQ6A 5KFYA 1AQ6A 2KJ5A 2O6KA 1BVSA 3PW5A 8ICUA 2E1FA 3HP6A 1VJ5A 2G06A 1UQVA 1NJWA 4YXJA 3D2QA 1KEJA 1D8LA 2W54A 1ZQCA 2I6XA 2QLTA 2J6TA 1N5WA 5GTHU 5IIKA 3VCBA 5J0YA 5DGAA 5EE3A 2CN1A 2GWSA 2KNJA 4ED1A 4MHVA 3HW8A 4UBBA 3C28A 5KT6A 2OCEA 1KKXA 1L3TA 4QZ8A 3RB6A 1MQ2A 4FO6A 4C0ZA 3OJUA 9ICQA 2R8JA 2VA3A 4I2CA 4UBCA 4R64A 1XSNA 2HOQA 2EH9A 4J03A 3AU6A 2YMQA 1RQNA 5J8YA 2Y9TA 1S0MA 4M0AA 4GC7A 1L7OA 2RRDA 5ALZA 2CXYA 1S0OA 2JR5A 4ED0A 2ZIWA 9ICVA 4F4ZA 5B5EU 2GH1A 1K1SA 3F2CA 1T8EA 2WF9A 3BQ1A 2KZZA 2G0AA 2ZUDA 1NOMA 1N2XA 5KAIU 5J0XA 3C2MA 1N61A 4Q44A 5J2BA 5J2KA 1L8OA 4MEYA 1KQQA 4FZNA 2PFNA 4TUPA 1L3SA 2L5YA 4DL4A 5KFFA 3LWLA 1UA0A 2NRZA 4YQWA 1XSLA 3WKBA 1V9PA 2QKQA 5ALMA 5KT4A 5AKJA 4I2AA 3BZKA 3TFSA 3F5AA 4TURA 1XC9A 4F2SA 5FP0A 2HW3A 1NK8A 5J2FA 1SGGA 2ZXHA 2E8NA 4F3OA 2NV3A 2H3FA 5L9XA 4PL2A 5HHHA 1ZQXA 5KL8B 4I2FA 3RH6A 2B0CA 1J2MA 1ZQZA 5AKKA 4F5PA 7ICPA 1ZD4A 2IOFA 1UPHA 5KNIA 4I2JA 5DG8A 1XO1A 4ECWA 2LKYA 2ES6A 3KZIU 1ZRMA 4DFKA 2W9MA 4Y2UA 5H2FU 2FI1A 4Y2SA 2PMZF 2VIXA 3KOOA 5ALUA 4O3SA 7ICMA 3QNMA 3RBEA 8ICKA
chains in the Genus database with same CATH topology
4ECYA 4PPXA 3T5JA 1MSWD 1RYRA 7ICSA 4O5CA 5J2EA 4C8KA 4JV2A 2HHTA 5DQGA 5IIMA 4ECZA 1RXWA 1UT8A 1WCNA 2PFQA 4B9VA 3Q8KA 3ISBA 4DQRA 2R8KA 2P6RA 4QWBA 4EBCA 1A77A 3V7JA 4M9GA 5KFJA 2ATLA 4PHEA 2DPJA 5J2CA 1RZTA 4UB4A 2PFOA 4UAZA 4F2RA 4QZAA 4I29A 4G3IA 1SZPA 4P4PA 2V9WA 5J0SA 5KFPA 4NLKA 8ICBA 4QWAA 5CHGA 3TAQA 2Y1IA 4J9QA 5KFVA 4O5EA 2ASJA 3UXNA 3PO5A 8ICIA 2M9NA 3PMLA 3RR7A 4YMNA 3MR3A 3T5KA 4BXOB 5D46A 4F5QA 4YVZA 3H8SA 4ED8A 1KFTA 2I1QA 2W8KA 4NM2A 3N97B 5CP2A 9ICFA 5KFAA 4RZRA 3M9MB 4QZEA 4ECTA 4ED2A 1ZQYA 2BKEA 4IQUA 5EWFA 4IQVA 2IMWP 4TQRA 4I2HA 4X5VA 3MFHA 3MDCA 4DL6A 1RPLA 2AQ4A 2PFPA 5DGBA 5L1JA 4UB1A 9ICXA 4K4GA 1U48A 1ZQQA 3M9NB 3THVA 4PGYA 1CEZA 1BPDA 3FDSA 1ZJNA 9ICIA 5J29A 2XGQA 3GIIA 5L1IA 3MABA 2C2EA 8ICPA 4JK1A 1S0NA 1ZQRA 3BQ2A 1QSLA 2XY7A 2BHNA 1SL2A 5D4BA 4KLTA 4M6WB 1KFDA 1D9DA 1SL1A 8ICOA 1LV5A 2Q0ZX 2FLPA 1ZQMA 2H5XA 4DS4A 1BPEA 4RNNA 3EZ5A 4PGXA 3QE9Y 1XS9D 1XU4A 3M9OB 2NRTA 4DEZA 5KFBA 1S10A 8ICEA 8ICNA 4EEYA 1S9FA 1ZQBA 4RQ5A 3C21A 3RJFA 2JZBA 3RH4A 2HHWA 1IM4A 1Z00A 1TVAA 2IHMA 1L5UA 2ZTCA 2FMSA 5HHIA 3C2LA 8ICLA 7ICHA 4DLGA 5CWRA 4DF8A 3PVXA 3JPNA 3RRHA 4ECUA 5KFTA 2ZTDA 3ZDBA 7ICNA 1ZQNA 4Q43A 3PR5B 7ICEA 3V6KA 4ECVA 4NM1A 4J9SA 8ICWA 4J9PA 8ICVA 4JWMA 5KG2A 4MFFA 2BCVA 2BCQA 3PX4A 2IBKA 2KFNA 2ALZA 5KG5A 4F92B 5KFCA 5KFRA 5IIJA 4YN4A 2NRXA 5J2HA 3TFRA 1KRPA 4E0DA 4I28A 4DL2A 4KLEA 5DBAA 4O3PA 4KLOA 5L1KA 5KT2A 2C22A 2MUTA 1NK6A 9ICSA 4DL5A 4UQGA 3JPPA 4C8NA 4YCXA 2HHUA 5EWEA 4KLFA 5DG9A 4I27A 4ELVA 1JXLA 5L1LA 4ZH4A 4F4KA 1X2IA 5J0UA 1U45A 2KTQA 1BPYA 1JXEA 4KLMA 1XSPA 4DQIA 1XWLA 1UT5A 4KMUA 3GILA 3QZ7A 2ZTEA 4F5OA 4M9LA 4P4MA 2KFZA 4YMMA 3OJSA 4NY8A 4RPXA 4FS1A 3IHQB 1Z3EB 4GXKA 3M8SA 2W9CA 1RYSA 5KG4A 2A1JA 4Z6EA 1QSYA 1AROP 3FYHA 2V4QA 5DLFA 3BDPA 1TKDA 4RT2A 5IIOA 4C8LA 3UXPA 4ELTA 1X9WA 4M9NA 2R8HA 4DSIA 5KFSA 2FPMA 4B9MA 2ZJAA 4GLXA 7ICLA 4ECQA 4XA5A 1T4GA 5KFNA 4F91B 1JMSA 3RJIA 3EW9A 4J9LA 7ICFA 3RAQA 4RNOA 4NLZA 3EPGA 3JPSA 1HJPA 4JV1A 4QZDA 4J9KA 3KHRA 4C8OA 2AQ0A 2BQ3A 4KLLA 5KG6A 4Q8EA 4DL3A 1MC8A 2FPLA 2HHXA 3LDAA 3SV4A 1S77D 4QZHA 4IQTA 4GC6A 4ED6A 3PNCA 3C5GA 2F1IA 5J0TA 2RDIA 1N48A 4LVSA 5TZVA 4B9UA 4M47A 1ZJMA 1NK5A 4MFAA 1S0VA 5J0RA 9ICEA 4KN4A 1NKBA 4Q45A 2BGWA 1H38A 1ZQOA 4IRKA 5J0WA 3MR5A 4EZ6A 2C2DA 2R8GA 2XY5A 4RT3A 4EYHB 3RBDA 5HNKA 7ICOA 8ICSA 4J9NA 4KLQA 8ICJA 3C2KA 4PHAA 9ICNA 4KTQA 5KT7A 3C1YA 4DSEA 2JEGA 4RQ4A 7ICUA 3TANA 4Q8FA 3ZD8A 5D49A 5CR0A 2W9BB 4ECSA 2ASLA 5KT5A 5IILA 3T3FA 4XQ8A 3PMNA 2XCAA 3BQ0A 3KHLA 4UB3A 2P66A 8ICYA 3NGDA 2DPIA 2JEJA 4BXOA 3B0YA 1NJXA 3PW2A 7ICVA 4UAWA 3GIKA 9ICJA 3RJEA 2PI5A 4I2GA 1ZQVA 4F93B 4XUSA 2ASDA 1TK8A 4K4HA 9ICMA 1L3VA 2BPCA 1JN3A 5DKWA 1TAQA 3NTUA 3RB0A 1TFRA 2HVIA 4DOAA 2XGPA 2F1JA 2BQRA 3RR8A 3UQ0A 4O3RA 3JPQA 4ELUA 5KFXA 9ICAA 3JPTA 3H4DA 2XY6A 4XRHA 4YD2A 5EOZA 5J2AA 4DOBA 8ICRA 8ICGA 3OGUA 7ICGA 4QWCA 1S76D 3TI0A 2J6UA 3RH5A 2UVRA 4DQPA 1WCLA 3Q8QB 4M04A 4C8MA 9ICCA 5KFGA 4QZCA 3LWMA 4M6WA 3Q8MA 8ICCA 8ICTA 1NK0A 1DOQA 4MF8A 3PV8A 1C7YA 4TQSA 2FMQA 3GFKB 2BPGA 3H7IA 3MBYA 5HMLA 5DLGA 3MGHA 5BOLA 4UB2A 4RPZA 3ZD9A 2VANA 2FLNA 5KFIA 2V4RA 4DQSA 3ZDDA 1BPBA 4J9OA 4DFJA 4M2YA 4RQ7A 5DB9A 4ED3A 3N4MB 2ZUCA 4RUCA 1KDHA 3RRGA 2FMPA 4FS2A 5DB8A 9ICLA 5J2DA 1KFSA 4KLHA 4JWNA 1BGXT 1ZQDA 4RNMA 2ZJ5A 3T5LA 2AGOA 4YG2A 1U9LA 9ICUA 4IQWA 3HPOA 4O0IA 1RXVA 3SI8A 4PHDA 3GV8B 3K4GA 4PH5A 4RQ3A 4DO9A 4FBTA 1QLNA 5DBBA 5KTQA 2NRWA 5C5JA 4RUAA 5DB6A 3LK9A 3OHBA 3V7LA 3G6XA 2W8LA 3PO4A 4IRCA 4R66A 5BPCA 1ZQIA 9ICTA 1JIHA 4EYIB 3EWAA 2B21A 3MGIA 2OWOA 3PR4A 4I2DA 5KFHA 3OSNA 2KN7A 4F4XA 3SV3A 4MF2A 4B9LA 4ECRA 4B9NA 1S97A 4KITB 4F4YA 3V72A 3MFIA 1T7PA 2AGPA 5KG7A 1HUZA 3UQ2A 1KLNA 3ETLA 4I2IA 3K75D 2I9GA 2HHQA 1COOA 3H40A 4R63A 2FLLA 3PY8A 3V6JA 2P6UA 3M8RA 4RQ8A 3EPIA 3SYZA 1NK7A 1QSSA 4F4WA 2BR0A 3RJHA 4P2HA 4P4OA 4YD1A 1X9SA 1TV9A 1N56A 4R8UB 8ICMA 5DG7A 4QZFA 5KFKA 4Z6FA 1ZETA 1DGSA 5F9NA 1ZQHA 5KG1A 3AU2A 2C28A 5J2GA 3MR2A 4DSJA 7ICTA 4BGDA 3Q8RB 4FBUA 4QZ9A 3C1ZA 3BQTA 4JV0A 9ICKA 2BCSA 9ICWA 1L3UA 4EBDA 3Q8LA 4YR3A 5CJ7A 4RQ6A 4DL7A 3QEAZ 2AJQA 5KFYA 3B0XA 2F1HA 5J2IA 4J9MA 1U49A 4I2BA 1D8YA 2MAXA 7ICQA 1BVSA 4GXJA 3PW5A 8ICHA 3HP6A 1JX4A 5F9LA 8ICUA 1ZQSA 5IIIA 3T5HA 4F5RA 4DF4A 1BPXA 4HYKA 1NJWA 2ISPA 4YXJA 4F50A 4DSFA 3H8JA 2UVVA 4IR1A 4KLIA 4J9RA 4O3NA 1KEJA 4EBEA 1D8LA 4YR0A 1IXRA 1ZQCA 1NK9A 3RJKA 1SL0A 5JUMA 2J6TA 5IIKA 4LZGA 5J0OA 4O3QA 4EZ9A 3QZ8A 2VA2A 5J0YA 2XC9A 5DGAA 3UPQA 1ZQLA 5J0QA 1NJZA 1ZQPA 2GWSA 1NJYA 4K4IA 1TAUA 4O3OA 4RQ1A 4ED1A 4B9TA 8ICAA 2IHNA 3HW8A 4UBBA 4GXIA 3PX0A 2VA8A 4IRDA 5KT6A 9ICBA 4BDPA 9ICPA 3RJJA 1L3TA 2UVUA 3ZDEA 4QZ8A 3RB6A 3JPRA 1UA1A 3RB3A 4FO6A 2XCPA 1A76A 5KFMA 3GIMA 3OJUA 1MQ2A 2UVWA 9ICRA 4NXZA 3Q8SB 9ICQA 2DFLA 1EXNA 4PHPA 1T3NA 2R8JA 3PW4A 2W9BA 2PXIA 5HP4A 2VA3A 4F8RA 9ICHA 4I2CA 3RJGA 5DB7A 3ZDAA 3HWTA 3RTVA 3JPOA 5IINA 1TK0A 1NKEA 2JEFA 4UBCA 3C23A 4R64A 3GV7B 1XSNA 4ED7A 1QTMA 4NLGA 3AU6A 3KHGA 1ZQFA 1S0MA 4DWIA 3MDAA 4M0AA 4KN7A 3G6YA 4Z6DA 3PW0A 1CUKA 4GC7A 1ZQKA 1ZYQA 1ZQUA 1HUOA 5KG3A 3GDXA 2BDPA 4RQ2A 1S0OA 9ICVA 4ED0A 4UAYA 3H4BA 4F4ZA 4M9HA 1K1SA 3GIJA 4QW8A 2PI4A 4KLUA 4MEXA 5KFEA 4YMOA 2FPKA 5KFLA 9ICOA 1ZQJA 1T8EA 2BPFA 4YXMA 1ZQWA 3HX0A 1MQ3A 3BQ1A 1TK5A 3G6VA 2AU0A 2KZZA 1ZQEA 2ZUDA 3OSPA 7ICIA 5KFOA 2HVHA 1NOMA 4F5NA 1D9FA 2ZJ8A 2IA6A 5DQHA 5KFWA 3TAPA 4RU9A 4ECXA 2ZUBA 5J0XA 3C2MA 4Q44A 1SKSA 3ZDCA 5J2BA 5J2KA 4MEYA 2PFNA 1PZNA 4TUSA 7ICJA 5BOMA 3PW7A 2JZBB 4TUPA 2BCUA 2C2RA 1Y88A 1Z00B 5KFDA 1L3SA 1ZQTA 4DL4A 4DLEA 7ICRA 7ICKA 5KFZA 5KFFA 3LWLA 1UA0A 5KFUA 2JEIA 3ISDA 2NRZA 4DFMA 4YQWA 5EWGA 2Y1JA 1XSLA 4CCHA 3ORYA 5J0PA 1V9PA 3Q8PB 4TUQA 5DBCA 4UB5A 3KTQA 4M9JA 3E2EA 4KLDA 1NKCA 2WTFA 2XO7A 5KT4A 4I2EA 3TQ1A 1B22A 2BQUA 4I2AA 1LB2B 4KLJA 5HMMA 1NK4A 4DSLA 3UXOA 3TFSA 4BWJA 3QEBZ 4DFPA 4KLGA 1ZQAA 4TURA 2MUTB 3GQCA 4DOCA 1XC9A 3H8WA 5KFQA 4F2SA 3IM1A 1NK8A 2HW3A 5J2FA 3OHAA 4PGQA 4LZDA 4QZIA 2KZMA 3RB4A 1U4BA 4KLSA 5DDYA 2NRVA 5CA7A 3HT3A 2R8IA 1BPZA 4DSKA 9ICGA 2KZ3A 1KSPA 4F3OA 3TARA 3V6HA 4IR9A 1SKWA 1SKRA 2ISOA 5DQIA 4RQ0A 5L9XA 1ZQGA 4R65A 4QW9A 5HHHA 3ISCA 8ICFA 1ZQXA 1U47A 2HHVA 5KT3A 2W9CB 4I2FA 4R8UA 3RH6A 2A1JB 3BJYA 4MFCA 1ZQZA 4YFKA 4F5PA 3RAXA 2HHSA 7ICPA 4O5KA 1B43A 4QZBA 4RPYA 5KG0A 3MR6A 3EYZA 8ICZA 4YR2A 4I2JA 1K1QA 8ICXA 4YP3A 3V7KA 2AGQA 5DG8A 1XO1A 3KHHA 4ECWA 8ICQA 3SZ2A 4DS5A 4QWDA 1KTQA 4QWEA 4DQQA 4DFKA 2W9MA 5J2JA 4QZGA 3C5FA 1X9MA 2J6SA 5CB1A 2W9AA 2BCRA 4Z6CA 4O9MA 3AUOA 3GV5B 4BWMA 3PX6A 2RDJA 2LYHA 4JUZA 7ICMA 4O3SA 5DDMA 4B9SA 3RBEA 4NLNA 8ICKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ECY A;  4PPX A;  3T5J A;  1MSW D;  1RYR A;  7ICS A;  4O5C A;  5J2E A;  4C8K A;  4JV2 A;  2HHT A;  5DQG A;  5IIM A;  4ECZ A;  1RXW A;  1UT8 A;  1WCN A;  2PFQ A;  4B9V A;  3Q8K A;  3ISB A;  4DQR A;  2R8K A;  2P6R A;  4QWB A;  4EBC A;  1A77 A;  3V7J A;  4M9G A;  5KFJ A;  2ATL A;  4PHE A;  2DPJ A;  5J2C A;  1RZT A;  4UB4 A;  2PFO A;  4UAZ A;  4F2R A;  4QZA A;  4I29 A;  4G3I A;  1SZP A;  4P4P A;  2V9W A;  5J0S A;  5KFP A;  4NLK A;  8ICB A;  4QWA A;  5CHG A;  3TAQ A;  2Y1I A;  4J9Q A;  5KFV A;  4O5E A;  2ASJ A;  3UXN A;  3PO5 A;  8ICI A;  2M9N A;  3PML A;  3RR7 A;  4YMN A;  3MR3 A;  3T5K A;  4BXO B;  5D46 A;  4F5Q A;  4YVZ A;  3H8S A;  4ED8 A;  1KFT A;  2I1Q A;  2W8K A;  4NM2 A;  3N97 B;  5CP2 A;  9ICF A;  5KFA A;  4RZR A;  3M9M B;  4QZE A;  4ECT A;  4ED2 A;  1ZQY A;  2BKE A;  4IQU A;  5EWF A;  4IQV A;  2IMW P;  4TQR A;  4I2H A;  4X5V A;  3MFH A;  3MDC A;  4DL6 A;  1RPL A;  2AQ4 A;  2PFP A;  5DGB A;  5L1J A;  4UB1 A;  9ICX A;  4K4G A;  1U48 A;  1ZQQ A;  3M9N B;  3THV A;  4PGY A;  1CEZ A;  1BPD A;  3FDS A;  1ZJN A;  9ICI A;  5J29 A;  2XGQ A;  3GII A;  5L1I A;  3MAB A;  2C2E A;  8ICP A;  4JK1 A;  1S0N A;  1ZQR A;  3BQ2 A;  1QSL A;  2XY7 A;  2BHN A;  1SL2 A;  5D4B A;  4KLT A;  4M6W B;  1KFD A;  1D9D A;  1SL1 A;  8ICO A;  1LV5 A;  2Q0Z X;  2FLP A;  1ZQM A;  2H5X A;  4DS4 A;  1BPE A;  4RNN A;  3EZ5 A;  4PGX A;  3QE9 Y;  1XS9 D;  1XU4 A;  3M9O B;  2NRT A;  4DEZ A;  5KFB A;  1S10 A;  8ICE A;  8ICN A;  4EEY A;  1S9F A;  1ZQB A;  4RQ5 A;  3C21 A;  3RJF A;  2JZB A;  3RH4 A;  2HHW A;  1IM4 A;  1Z00 A;  1TVA A;  2IHM A;  1L5U A;  2ZTC A;  2FMS A;  5HHI A;  3C2L A;  8ICL A;  7ICH A;  4DLG A;  5CWR A;  4DF8 A;  3PVX A;  3JPN A;  3RRH A;  4ECU A;  5KFT A;  2ZTD A;  3ZDB A;  7ICN A;  1ZQN A;  4Q43 A;  3PR5 B;  7ICE A;  3V6K A;  4ECV A;  4NM1 A;  4J9S A;  8ICW A;  4J9P A;  8ICV A;  4JWM A;  5KG2 A;  4MFF A;  2BCV A;  2BCQ A;  3PX4 A;  2IBK A;  2KFN A;  2ALZ A;  5KG5 A;  4F92 B;  5KFC A;  5KFR A;  5IIJ A;  4YN4 A;  2NRX A;  5J2H A;  3TFR A;  1KRP A;  4E0D A;  4I28 A;  4DL2 A;  4KLE A;  5DBA A;  4O3P A;  4KLO A;  5L1K A;  5KT2 A;  2C22 A;  2MUT A;  1NK6 A;  9ICS A;  4DL5 A;  4UQG A;  3JPP A;  4C8N A;  4YCX A;  2HHU A;  5EWE A;  4KLF A;  5DG9 A;  4I27 A;  4ELV A;  1JXL A;  5L1L A;  4ZH4 A;  4F4K A;  1X2I A;  5J0U A;  1U45 A;  2KTQ A;  1BPY A;  1JXE A;  4KLM A;  1XSP A;  4DQI A;  1XWL A;  1UT5 A;  4KMU A;  3GIL A;  3QZ7 A;  2ZTE A;  4F5O A;  4M9L A;  4P4M A;  2KFZ A;  4YMM A;  3OJS A;  4NY8 A;  4RPX A;  4FS1 A;  3IHQ B;  1Z3E B;  4GXK A;  3M8S A;  2W9C A;  1RYS A;  5KG4 A;  2A1J A;  4Z6E A;  1QSY A;  1ARO P;  3FYH A;  2V4Q A;  5DLF A;  3BDP A;  1TKD A;  4RT2 A;  5IIO A;  4C8L A;  3UXP A;  4ELT A;  1X9W A;  4M9N A;  2R8H A;  4DSI A;  5KFS A;  2FPM A;  4B9M A;  2ZJA A;  4GLX A;  7ICL A;  4ECQ A;  4XA5 A;  1T4G A;  5KFN A;  4F91 B;  1JMS A;  3RJI A;  3EW9 A;  4J9L A;  7ICF A;  3RAQ A;  4RNO A;  4NLZ A;  3EPG A;  3JPS A;  1HJP A;  4JV1 A;  4QZD A;  4J9K A;  3KHR A;  4C8O A;  2AQ0 A;  2BQ3 A;  4KLL A;  5KG6 A;  4Q8E A;  4DL3 A;  1MC8 A;  2FPL A;  2HHX A;  3LDA A;  3SV4 A;  1S77 D;  4QZH A;  4IQT A;  4GC6 A;  4ED6 A;  3PNC A;  3C5G A;  2F1I A;  5J0T A;  2RDI A;  1N48 A;  4LVS A;  5TZV A;  4B9U A;  4M47 A;  1ZJM A;  1NK5 A;  4MFA A;  1S0V A;  5J0R A;  9ICE A;  4KN4 A;  1NKB A;  4Q45 A;  2BGW A;  1H38 A;  1ZQO A;  4IRK A;  5J0W A;  3MR5 A;  4EZ6 A;  2C2D A;  2R8G A;  2XY5 A;  4RT3 A;  4EYH B;  3RBD A;  5HNK A;  7ICO A;  8ICS A;  4J9N A;  4KLQ A;  8ICJ A;  3C2K A;  4PHA A;  9ICN A;  4KTQ A;  5KT7 A;  3C1Y A;  4DSE A;  2JEG A;  4RQ4 A;  7ICU A;  3TAN A;  4Q8F A;  3ZD8 A;  5D49 A;  5CR0 A;  2W9B B;  4ECS A;  2ASL A;  5KT5 A;  5IIL A;  3T3F A;  4XQ8 A;  3PMN A;  2XCA A;  3BQ0 A;  3KHL A;  4UB3 A;  2P66 A;  8ICY A;  3NGD A;  2DPI A;  2JEJ A;  4BXO A;  3B0Y A;  1NJX A;  3PW2 A;  7ICV A;  4UAW A;  3GIK A;  9ICJ A;  3RJE A;  2PI5 A;  4I2G A;  1ZQV A;  4F93 B;  4XUS A;  2ASD A;  1TK8 A;  4K4H A;  9ICM A;  1L3V A;  2BPC A;  1JN3 A;  5DKW A;  1TAQ A;  3NTU A;  3RB0 A;  1TFR A;  2HVI A;  4DOA A;  2XGP A;  2F1J A;  2BQR A;  3RR8 A;  3UQ0 A;  4O3R A;  3JPQ A;  4ELU A;  5KFX A;  9ICA A;  3JPT A;  3H4D A;  2XY6 A;  4XRH A;  4YD2 A;  5EOZ A;  5J2A A;  4DOB A;  8ICR A;  8ICG A;  3OGU A;  7ICG A;  4QWC A;  1S76 D;  3TI0 A;  2J6U A;  3RH5 A;  2UVR A;  4DQP A;  1WCL A;  3Q8Q B;  4M04 A;  4C8M A;  9ICC A;  5KFG A;  4QZC A;  3LWM A;  4M6W A;  3Q8M A;  8ICC A;  8ICT A;  1NK0 A;  1DOQ A;  4MF8 A;  3PV8 A;  1C7Y A;  4TQS A;  2FMQ A;  3GFK B;  2BPG A;  3H7I A;  3MBY A;  5HML A;  5DLG A;  3MGH A;  5BOL A;  4UB2 A;  4RPZ A;  3ZD9 A;  2VAN A;  2FLN A;  5KFI A;  2V4R A;  4DQS A;  3ZDD A;  1BPB A;  4J9O A;  4DFJ A;  4M2Y A;  4RQ7 A;  5DB9 A;  4ED3 A;  3N4M B;  2ZUC A;  4RUC A;  1KDH A;  3RRG A;  2FMP A;  4FS2 A;  5DB8 A;  9ICL A;  5J2D A;  1KFS A;  4KLH A;  4JWN A;  1BGX T;  1ZQD A;  4RNM A;  2ZJ5 A;  3T5L A;  2AGO A;  4YG2 A;  1U9L A;  9ICU A;  4IQW A;  3HPO A;  4O0I A;  1RXV A;  3SI8 A;  4PHD A;  3GV8 B;  3K4G A;  4PH5 A;  4RQ3 A;  4DO9 A;  4FBT A;  1QLN A;  5DBB A;  5KTQ A;  2NRW A;  5C5J A;  4RUA A;  5DB6 A;  3LK9 A;  3OHB A;  3V7L A;  3G6X A;  2W8L A;  3PO4 A;  4IRC A;  4R66 A;  5BPC A;  1ZQI A;  9ICT A;  1JIH A;  4EYI B;  3EWA A;  2B21 A;  3MGI A;  2OWO A;  3PR4 A;  4I2D A;  5KFH A;  3OSN A;  2KN7 A;  4F4X A;  3SV3 A;  4MF2 A;  4B9L A;  4ECR A;  4B9N A;  1S97 A;  4KIT B;  4F4Y A;  3V72 A;  3MFI A;  1T7P A;  2AGP A;  5KG7 A;  1HUZ A;  3UQ2 A;  1KLN A;  3ETL A;  4I2I A;  3K75 D;  2I9G A;  2HHQ A;  1COO A;  3H40 A;  4R63 A;  2FLL A;  3PY8 A;  3V6J A;  2P6U A;  3M8R A;  4RQ8 A;  3EPI A;  3SYZ A;  1NK7 A;  1QSS A;  4F4W A;  2BR0 A;  3RJH A;  4P2H A;  4P4O A;  4YD1 A;  1X9S A;  1TV9 A;  1N56 A;  4R8U B;  8ICM A;  5DG7 A;  4QZF A;  5KFK A;  4Z6F A;  1ZET A;  1DGS A;  5F9N A;  1ZQH A;  5KG1 A;  3AU2 A;  2C28 A;  5J2G A;  3MR2 A;  4DSJ A;  7ICT A;  4BGD A;  3Q8R B;  4FBU A;  4QZ9 A;  3C1Z A;  3BQT A;  4JV0 A;  9ICK A;  2BCS A;  9ICW A;  1L3U A;  4EBD A;  3Q8L A;  4YR3 A;  5CJ7 A;  4RQ6 A;  4DL7 A;  3QEA Z;  2AJQ A;  5KFY A;  3B0X A;  2F1H A;  5J2I A;  4J9M A;  1U49 A;  4I2B A;  1D8Y A;  2MAX A;  7ICQ A;  1BVS A;  4GXJ A;  3PW5 A;  8ICH A;  3HP6 A;  1JX4 A;  5F9L A;  8ICU A;  1ZQS A;  5III A;  3T5H A;  4F5R A;  4DF4 A;  1BPX A;  4HYK A;  1NJW A;  2ISP A;  4YXJ A;  4F50 A;  4DSF A;  3H8J A;  2UVV A;  4IR1 A;  4KLI A;  4J9R A;  4O3N A;  1KEJ A;  4EBE A;  1D8L A;  4YR0 A;  1IXR A;  1ZQC A;  1NK9 A;  3RJK A;  1SL0 A;  5JUM A;  2J6T A;  5IIK A;  4LZG A;  5J0O A;  4O3Q A;  4EZ9 A;  3QZ8 A;  2VA2 A;  5J0Y A;  2XC9 A;  5DGA A;  3UPQ A;  1ZQL A;  5J0Q A;  1NJZ A;  1ZQP A;  2GWS A;  1NJY A;  4K4I A;  1TAU A;  4O3O A;  4RQ1 A;  4ED1 A;  4B9T A;  8ICA A;  2IHN A;  3HW8 A;  4UBB A;  4GXI A;  3PX0 A;  2VA8 A;  4IRD A;  5KT6 A;  9ICB A;  4BDP A;  9ICP A;  3RJJ A;  1L3T A;  2UVU A;  3ZDE A;  4QZ8 A;  3RB6 A;  3JPR A;  1UA1 A;  3RB3 A;  4FO6 A;  2XCP A;  1A76 A;  5KFM A;  3GIM A;  3OJU A;  1MQ2 A;  2UVW A;  9ICR A;  4NXZ A;  3Q8S B;  9ICQ A;  2DFL A;  1EXN A;  4PHP A;  1T3N A;  2R8J A;  3PW4 A;  2W9B A;  2PXI A;  5HP4 A;  2VA3 A;  4F8R A;  9ICH A;  4I2C A;  3RJG A;  5DB7 A;  3ZDA A;  3HWT A;  3RTV A;  3JPO A;  5IIN A;  1TK0 A;  1NKE A;  2JEF A;  4UBC A;  3C23 A;  4R64 A;  3GV7 B;  1XSN A;  4ED7 A;  1QTM A;  4NLG A;  3AU6 A;  3KHG A;  1ZQF A;  1S0M A;  4DWI A;  3MDA A;  4M0A A;  4KN7 A;  3G6Y A;  4Z6D A;  3PW0 A;  1CUK A;  4GC7 A;  1ZQK A;  1ZYQ A;  1ZQU A;  1HUO A;  5KG3 A;  3GDX A;  2BDP A;  4RQ2 A;  1S0O A;  9ICV A;  4ED0 A;  4UAY A;  3H4B A;  4F4Z A;  4M9H A;  1K1S A;  3GIJ A;  4QW8 A;  2PI4 A;  4KLU A;  4MEX A;  5KFE A;  4YMO A;  2FPK A;  5KFL A;  9ICO A;  1ZQJ A;  1T8E A;  2BPF A;  4YXM A;  1ZQW A;  3HX0 A;  1MQ3 A;  3BQ1 A;  1TK5 A;  3G6V A;  2AU0 A;  2KZZ A;  1ZQE A;  2ZUD A;  3OSP A;  7ICI A;  5KFO A;  2HVH A;  1NOM A;  4F5N A;  1D9F A;  2ZJ8 A;  2IA6 A;  5DQH A;  5KFW A;  3TAP A;  4RU9 A;  4ECX A;  2ZUB A;  5J0X A;  3C2M A;  4Q44 A;  1SKS A;  3ZDC A;  5J2B A;  5J2K A;  4MEY A;  2PFN A;  1PZN A;  4TUS A;  7ICJ A;  5BOM A;  3PW7 A;  2JZB B;  4TUP A;  2BCU A;  2C2R A;  1Y88 A;  1Z00 B;  5KFD A;  1L3S A;  1ZQT A;  4DL4 A;  4DLE A;  7ICR A;  7ICK A;  5KFZ A;  5KFF A;  3LWL A;  1UA0 A;  5KFU A;  2JEI A;  3ISD A;  2NRZ A;  4DFM A;  4YQW A;  5EWG A;  2Y1J A;  1XSL A;  4CCH A;  3ORY A;  5J0P A;  1V9P A;  3Q8P B;  4TUQ A;  5DBC A;  4UB5 A;  3KTQ A;  4M9J A;  3E2E A;  4KLD A;  1NKC A;  2WTF A;  2XO7 A;  5KT4 A;  4I2E A;  3TQ1 A;  1B22 A;  2BQU A;  4I2A A;  1LB2 B;  4KLJ A;  5HMM A;  1NK4 A;  4DSL A;  3UXO A;  3TFS A;  4BWJ A;  3QEB Z;  4DFP A;  4KLG A;  1ZQA A;  4TUR A;  2MUT B;  3GQC A;  4DOC A;  1XC9 A;  3H8W A;  5KFQ A;  4F2S A;  3IM1 A;  1NK8 A;  2HW3 A;  5J2F A;  3OHA A;  4PGQ A;  4LZD A;  4QZI A;  2KZM A;  3RB4 A;  1U4B A;  4KLS A;  5DDY A;  2NRV A;  5CA7 A;  3HT3 A;  2R8I A;  1BPZ A;  4DSK A;  9ICG A;  2KZ3 A;  1KSP A;  4F3O A;  3TAR A;  3V6H A;  4IR9 A;  1SKW A;  1SKR A;  2ISO A;  5DQI A;  4RQ0 A;  5L9X A;  1ZQG A;  4R65 A;  4QW9 A;  5HHH A;  3ISC A;  8ICF A;  1ZQX A;  1U47 A;  2HHV A;  5KT3 A;  2W9C B;  4I2F A;  4R8U A;  3RH6 A;  2A1J B;  3BJY A;  4MFC A;  1ZQZ A;  4YFK A;  4F5P A;  3RAX A;  2HHS A;  7ICP A;  4O5K A;  1B43 A;  4QZB A;  4RPY A;  5KG0 A;  3MR6 A;  3EYZ A;  8ICZ A;  4YR2 A;  4I2J A;  1K1Q A;  8ICX A;  4YP3 A;  3V7K A;  2AGQ A;  5DG8 A;  1XO1 A;  3KHH A;  4ECW A;  8ICQ A;  3SZ2 A;  4DS5 A;  4QWD A;  1KTQ A;  4QWE A;  4DQQ A;  4DFK A;  2W9M A;  5J2J A;  4QZG A;  3C5F A;  1X9M A;  2J6S A;  5CB1 A;  2W9A A;  2BCR A;  4Z6C A;  4O9M A;  3AUO A;  3GV5 B;  4BWM A;  3PX6 A;  2RDJ A;  2LYH A;  4JUZ A;  7ICM A;  4O3S A;  5DDM A;  4B9S A;  3RBE A;  4NLN A;  8ICK A; 
#chains in the Genus database with same CATH topology
 4ECY A;  4PPX A;  4O5C A;  4C8K A;  2JH1 A;  4ECZ A;  1F0M A;  3Q8K A;  1Q3U A;  5J8Y C;  2P6R A;  4M9G A;  2ATL A;  5J2C A;  2PFO A;  1V85 A;  5AI0 A;  3KBB A;  3NVZ A;  5KFP A;  4QWA A;  2KOB A;  2Y1I A;  2ASJ A;  1QCK A;  2ZIU B;  1VLB A;  2M9N A;  3PML A;  4YMN A;  4BXO B;  4F5Q A;  4ED8 A;  2W8K A;  3IG8 A;  5CP2 A;  9ICF A;  4ED2 A;  1ZQY A;  2E8M A;  4IQU A;  2YN4 A;  4TQR A;  4DL6 A;  5AM5 A;  3M9N B;  4PGY A;  3GII A;  1FO4 A;  5L1I A;  3MAB A;  1S0N A;  3BQ2 A;  3VC8 A;  4DFD A;  1SL2 A;  5D4B A;  4KLT A;  2FLP A;  2EAM A;  4RNN A;  1YZ6 A;  1SWW A;  4UAV A;  2H3Q A;  1XS9 D;  1XU4 A;  2NRT A;  4EEY A;  3RH4 A;  1IM4 A;  1L5U A;  2ZTC A;  2LHT A;  3FC4 A;  1SV4 A;  4DF8 A;  3AMZ A;  3JPN A;  4CDG A;  4LJX A;  3ZDB A;  7ICN A;  7ICE A;  1ECW A;  3A0H U;  3UMB A;  4JWM A;  2KK0 A;  2BCQ A;  5KFR A;  4YN4 A;  2NRX A;  4I28 A;  4KLE A;  5DBA A;  5L1K A;  2YML A;  9ICS A;  4YCX A;  1JXL A;  1X6J A;  3AQF A;  4F4K A;  1U45 A;  1XSP A;  4QNL A;  4DQI A;  4F72 A;  2IOF K;  1UT5 A;  4F5O A;  2ZTE A;  3M6Z A;  1OUQ A;  2NYV A;  5AM2 A;  3NAS A;  4Z6E A;  3I76 A;  3FYH A;  1TKD A;  3QYP A;  5IIO A;  1ZRN A;  2G09 A;  2R8H A;  4AP9 A;  5ALS A;  5KFS A;  2K4H A;  4GLX A;  4NLZ A;  1HJP A;  4EEN A;  5ALY A;  3DDH A;  2AQ0 A;  4Q8E A;  2FPL A;  3LDA A;  1S77 D;  4GC6 A;  4ED6 A;  2F8K A;  2F1I A;  4EX6 A;  2DUY A;  1CRX A;  5J0R A;  1NKB A;  5J0W A;  3IG5 A;  3QUQ A;  4J9N A;  2YQE A;  9ICN A;  2P35 A;  7ICU A;  1IV8 A;  2GLE A;  3NVW A;  3WK5 A;  3ZD8 A;  5D49 A;  2KVS A;  3T3F A;  3PMN A;  5AK4 A;  1L7M A;  4UB3 A;  3KHL A;  2DPI A;  7ICV A;  3PW2 A;  5ALX A;  3GIK A;  3RJE A;  2JRZ A;  2ZIV A;  4US9 A;  1JN3 A;  1TFR A;  2HVI A;  5AKI A;  5ALL A;  4DOA A;  2XGP A;  2KG5 A;  2BQR A;  3QX7 A;  3RR8 A;  3UQ0 A;  3L5K A;  3JPQ A;  5KFX A;  4RQN A;  4YD2 A;  2ZIW B;  5EOZ A;  4DOB A;  3OGU A;  1S76 D;  4DQP A;  4OJ5 A;  4C8M A;  3LWM A;  4M6W A;  3RFA A;  1NK0 A;  2GOL A;  5HML A;  5G5G A;  5DLG A;  2W11 A;  3MGH A;  4EEL A;  4UB2 A;  5E79 U;  1SWV A;  4RQ7 A;  3RRG A;  1MA7 A;  1Z1V A;  5DB8 A;  3GZF A;  9ICL A;  4C80 A;  3TKA A;  2WB1 F;  2HMX A;  2NO5 A;  4IQW A;  1V97 A;  3K4G A;  5C5J A;  3LK9 A;  3OHB A;  2W8L A;  3V7L A;  2CRX A;  4EYI B;  3MGI A;  5KFH A;  4F4X A;  2M0N A;  3MGV A;  3UQ2 A;  1KLN A;  5AKG A;  4ACO A;  2D6F C;  1COO A;  2FLL A;  1N62 A;  3V6J A;  3EPI A;  1NK7 A;  3RJH A;  4QZF A;  1ZET A;  1DGS A;  5KG1 A;  3AU2 A;  5J2G A;  7ICT A;  2EZZ A;  2FJ6 A;  3S6J A;  4CF3 A;  2AJQ A;  3B0X A;  3H8M A;  2F1H A;  5J2I A;  8ICH A;  2ZIX A;  5F9L A;  1ZQS A;  4UB6 U;  4F5R A;  2LM1 A;  2K4E A;  4IR1 A;  4O3N A;  1Z1B A;  1IXR A;  1WYG A;  1NK9 A;  5JUM A;  2QAR A;  5J0O A;  2XC9 A;  3UPQ A;  4U6P A;  5J0Q A;  1NJZ A;  2B6G A;  4O3O A;  1VDV A;  2VA8 A;  9ICP A;  3ZDE A;  3JPR A;  1GO3 F;  1A76 A;  5AHX A;  5KFM A;  3Q8S B;  2DFL A;  1EXN A;  4NV0 A;  4PHP A;  4F8R A;  2W9B A;  2PXI A;  5HP4 A;  3SAH A;  1TK0 A;  3C23 A;  5ALE A;  4ED7 A;  2YB4 A;  3KHG A;  3M1Y A;  1ZQF A;  3MDA A;  1FFV A;  1QH9 A;  4KN7 A;  3PSP A;  2Y9U A;  4UAU A;  1ZYQ A;  5KG3 A;  2BDP A;  4BX9 C;  4UAY A;  4M9H A;  2PI4 A;  4MEX A;  5KFE A;  5F3X B;  3WKE A;  1B0X A;  2RHF A;  2G5H B;  1ZQE A;  3OSP A;  3LVV A;  7ICI A;  2HVH A;  4F5N A;  5AI4 A;  1SV0 C;  3TAP A;  4RU9 A;  3KKA C;  4ECX A;  5BOM A;  3N7R C;  1Y88 A;  5KFD A;  1ZQT A;  7ICR A;  3ISD A;  2Y1J A;  3NUQ A;  4US8 A;  4KLD A;  2F3N A;  2WTF A;  4I2E A;  1PK3 A;  2BQU A;  4P0Q B;  3UXO A;  3QEB Z;  3WKD A;  4DFP A;  1J2N A;  4C4S A;  3GQC A;  1PUZ A;  3IM1 A;  1JUD A;  3OHA A;  4PGQ A;  4QZI A;  1U4B A;  5DDY A;  1RYU A;  2NRV A;  5ALV A;  3HT3 A;  4DSK A;  1BPZ A;  3V6H A;  1SXE A;  5DQI A;  4QW9 A;  3H0M B;  2HOI A;  4YFK A;  2A3V A;  4RPY A;  5KG0 A;  8ICZ A;  1X6I A;  2VJ5 A;  3E58 A;  4ZOH C;  2AGQ A;  2W04 A;  3KHH A;  4A8E A;  8ICQ A;  1KTQ A;  3SD7 A;  5J2J A;  2J6S A;  2KIV A;  2F44 A;  4Z6C A;  3AUO A;  3GV5 B;  3PX6 A;  2LYH A;  3J81 j;  5ALH A;  3QUB A;  3T5J A;  1RYR A;  5J2E A;  2HHT A;  5DQG A;  1UT8 A;  4WJ3 B;  3TAD A;  4Y2P A;  3N7S C;  1LVH A;  2PMZ C;  2ZXI A;  5AK3 A;  3V7J A;  2H3V A;  5EE9 A;  5KFJ A;  2DPJ A;  2EAO A;  2XI9 A;  4F2R A;  3L3F X;  4PJ0 U;  4G3I A;  4P4P A;  2CPR A;  3BS5 A;  4NLK A;  5CHG A;  3WK9 A;  2E8O A;  3UXN A;  5ALN A;  3RR7 A;  8ICI A;  3T5K A;  4YVZ A;  1KFT A;  2I1Q A;  2WF8 A;  3K1Z A;  4NM2 A;  3N97 B;  4G9B A;  1X42 A;  3D6J A;  4RZR A;  2ZIV B;  3M9M B;  4ECT A;  2Y0S F;  4ICA A;  2BKE A;  4HAI A;  2AQ4 A;  4PL1 A;  3MDC A;  1RPL A;  5DGB A;  5L1J A;  3I28 A;  1U48 A;  1ZQQ A;  2QB1 A;  1BPD A;  5AI6 A;  4JK1 A;  3PZP A;  2BHN A;  4M6W B;  1KFD A;  3H0R B;  3HKZ F;  3QU7 A;  5GTI U;  4EEK A;  1SL1 A;  2AHO B;  4DS4 A;  1BPE A;  4RQM A;  4DEZ A;  8ICE A;  8ICN A;  1ZQB A;  2DWQ A;  1TVA A;  3NRW A;  4P0P A;  2FMS A;  7ICH A;  3QUC A;  3PVX A;  2XIC A;  4OJ6 A;  1ZQN A;  2RLT A;  1QQ7 A;  4ECV A;  5HR6 A;  3GU3 A;  4J9S A;  2KIW A;  8ICV A;  3F2B A;  5KG2 A;  1L6N A;  2BCV A;  4F92 B;  4CGZ A;  5IIJ A;  4KLO A;  1NK6 A;  4UQG A;  3JPP A;  4C8N A;  4KLF A;  4ELV A;  4ZH4 A;  1JXE A;  3GIL A;  4M9L A;  2KFZ A;  2WHE A;  3OJS A;  4NY8 A;  5JU5 A;  2YTU A;  3HIL A;  3M8S A;  2W9C A;  2D8C A;  1PK1 A;  2A1J A;  5DLF A;  4RT2 A;  4C8L A;  2K4I A;  4F71 A;  5ALP A;  4ELT A;  1X9W A;  4M9N A;  2LPE A;  2FPM A;  2ZJA A;  1T4G A;  5KFN A;  3SEI A;  3EW9 A;  1YZ7 A;  5AM4 A;  2OYY A;  3KHR A;  1L7P A;  5KG6 A;  2ZIX B;  4DL3 A;  2HHX A;  4QZH A;  4IQT A;  3C5G A;  1FFU A;  2RDI A;  3SMV A;  2QAR B;  1SXD A;  4B9U A;  4M47 A;  1ZJM A;  1NK5 A;  1S0V A;  9ICE A;  4KN4 A;  3NS1 A;  3MR5 A;  4CRX A;  3CRX A;  8ICS A;  4UAT A;  4KTQ A;  4KX5 A;  4RQ4 A;  3TAN A;  4Q8F A;  2W9B B;  3OTQ A;  2XCA A;  8ICY A;  3B0Y A;  2PI5 A;  4I2G A;  1ZQV A;  4F93 B;  2XVT A;  4XUS A;  2ASD A;  1L3V A;  2BPC A;  4O3R A;  3AM9 A;  5G5H A;  4AYB F;  5JRT A;  3JPT A;  3H4D A;  2KJ9 A;  4XRH A;  8ICG A;  5ALK A;  8ICR A;  4QWC A;  1NI3 A;  5K4L A;  4QZC A;  2HOF A;  1DOQ A;  3HRD D;  4MF8 A;  4NLB A;  5T14 A;  1KBU A;  3GFK B;  1S5L U;  3H7I A;  2JH7 A;  3ZD9 A;  2VJ4 A;  4DQS A;  4J9O A;  4ED3 A;  2K89 A;  4FS2 A;  3WKA A;  1ZQD A;  4NL9 A;  4RNM A;  1U9L A;  9ICU A;  3M7D A;  3HPO A;  4O0I A;  3SI8 A;  3GV8 B;  4DO9 A;  2NRW A;  4RUA A;  3G6X A;  4R66 A;  5BPC A;  1ZQI A;  1CI4 A;  9ICT A;  1JIH A;  2WB1 C;  4I2D A;  5ALJ A;  3OSN A;  1COK A;  4ECR A;  4B9N A;  1S97 A;  3AQE A;  4KIT B;  2AGP A;  5AIC A;  5KG7 A;  1HUZ A;  3ETL A;  3K75 D;  3H40 A;  4R63 A;  1V38 A;  3PY8 A;  3M8R A;  4P2H A;  4YD1 A;  1X9S A;  8ICM A;  2LMR A;  4Y2T A;  1JI7 A;  2C28 A;  2IOH A;  2MU2 A;  3Q8R B;  9ICK A;  4QZ9 A;  3BQT A;  2KJ8 A;  4EBD A;  5CJ7 A;  3ZI4 A;  3QEA Z;  1N5X A;  3RF9 A;  7ICQ A;  1D8Y A;  2MAX A;  1JX4 A;  5III A;  3T5H A;  1BPX A;  2ISP A;  3H8J A;  2UVV A;  4J9R A;  3RJK A;  2K8C B;  2E1E A;  4LZG A;  4O3Q A;  3U26 A;  1ZQP A;  1NJY A;  1TAU A;  2AXT U;  4RQ1 A;  4B9T A;  2DGZ A;  2IHN A;  1P7D A;  4GXI A;  3PX0 A;  4IRD A;  1HEK A;  2JXJ A;  2UVU A;  3SEN A;  1KFS A;  1K5O A;  4GIB A;  2UVW A;  1OW5 A;  3BS5 B;  2KIC A;  3RJG A;  5DB7 A;  3ZDA A;  5AKE A;  3RTV A;  3JPO A;  5IIN A;  2JEF A;  1NKE A;  2H3I A;  2KE7 A;  4DWI A;  4BUG A;  3H0L B;  3IRU A;  4CE6 A;  3G6Y A;  3PW0 A;  4IL6 U;  1HUO A;  5AI5 A;  5AM0 A;  4OJO A;  3H4B A;  4NL9 C;  1ZD3 A;  3KD3 A;  4QW8 A;  3WK7 A;  2FPK A;  4JB3 A;  1ZQJ A;  2BPF A;  1ZQW A;  3HX0 A;  1MQ3 A;  1B4F A;  1TK5 A;  5L1M A;  4FE3 A;  2IA6 A;  5KFW A;  3QXG A;  2ZUB A;  3ZDC A;  1SKS A;  1Q8K A;  3BZC A;  7ICJ A;  3M6K A;  3PW7 A;  2BCU A;  2C2R A;  4P0P B;  3CYM A;  5KFU A;  4DFM A;  3E0F A;  5J0P A;  3Q8P B;  4TUQ A;  5DBC A;  3KTQ A;  3E2E A;  2Z7J A;  1DXS A;  1B22 A;  1LB2 B;  4JMU A;  1NK4 A;  1BNP A;  4KLG A;  1ZQA A;  3WK8 A;  4DOC A;  4Y2R A;  5KFQ A;  5AM3 A;  3BS7 A;  4LZD A;  2KZM A;  5CA7 A;  1PVR A;  2KZ3 A;  1SKW A;  3EUB 2;  2ISO A;  4RQ0 A;  1UHU A;  4R65 A;  1T3Q A;  3CP8 A;  5KT3 A;  2W9C B;  2A1J B;  3BJY A;  4MFC A;  2HHS A;  2LYB A;  3RAX A;  3UMG A;  4O5K A;  4QZB A;  3MR6 A;  3EYZ A;  4YR2 A;  1K1Q A;  3DEE A;  1UCV A;  1N63 A;  3LYS A;  3V7K A;  1PVP A;  1WG8 A;  2WF5 A;  4DS5 A;  4QWD A;  5AKX A;  4DQQ A;  4QWE A;  4QZG A;  3C5F A;  2WFA A;  3IDW A;  1SB3 C;  5B66 U;  4O9M A;  2HBM A;  4BWM A;  2RDJ A;  2DF4 B;  4JUZ A;  5DDM A;  4B9S A;  4CNQ A;  7ICS A;  4Y2J A;  4JV2 A;  5IIM A;  1RXW A;  2PFQ A;  4B9V A;  1YT3 A;  3ISB A;  2K60 A;  1F44 A;  1A77 A;  1LKY A;  4PHE A;  4UB4 A;  4IS7 A;  4UAZ A;  3FAH A;  2A19 A;  4QZA A;  4I29 A;  2JMG A;  1SZP A;  2G08 A;  5J0S A;  2KV2 A;  3TAQ A;  4J9Q A;  5KFV A;  5ALI A;  5D46 A;  2WF6 A;  4QZE A;  2KVC A;  2KEY A;  5EWF A;  2IMW P;  4IQV A;  4K4I A;  5ALG A;  4X5V A;  3MFH A;  4I2H A;  3QUT A;  4UB1 A;  9ICX A;  1Q3V A;  2K8A A;  1ZJN A;  2W7O A;  2C2E A;  1ZQR A;  2KSO A;  4QIW F;  2Y0S C;  1QSL A;  2XY7 A;  1RG6 A;  2KP7 A;  5ALR A;  5ALT A;  8ICO A;  1LV5 A;  2Q0Z X;  2EZX A;  1ZQM A;  1KN5 A;  4OJL A;  1S10 A;  5KFB A;  1S9F A;  2JZB A;  1Z00 A;  8ICL A;  1NZB A;  4C4R A;  3HKZ C;  4ECU A;  5KFT A;  2ZTD A;  4OJP A;  2EDU A;  4Q43 A;  3V6K A;  4MFF A;  2IBK A;  3PX4 A;  2ESE A;  2KFN A;  5KG5 A;  5KFC A;  3TFR A;  1KRP A;  4O3P A;  2MUT A;  5DG9 A;  4I27 A;  5L1L A;  1X2I A;  2KTQ A;  1BPY A;  2DBY A;  1A0P A;  5AK6 A;  1XWL A;  3K1R B;  4KMU A;  4P4M A;  2G5I B;  4FZL A;  1QSY A;  5KG4 A;  2V4Q A;  4KX3 A;  3BDP A;  2FE9 A;  3NVV A;  4UAR A;  2KKV A;  4C7Z A;  4DSI A;  1WWU A;  1TE2 A;  4ECQ A;  1JMS A;  3RJI A;  4J9L A;  2WAQ C;  3EPG A;  4JV1 A;  4QZD A;  4KLL A;  5HR7 A;  2KD1 A;  1MC8 A;  2R18 A;  2DQN B;  3FM9 A;  3PNC A;  5J0T A;  1WUD A;  3UMC A;  4MFA A;  1H38 A;  1ZQO A;  2R8G A;  2XY5 A;  4EYH B;  3RBD A;  5HNK A;  7ICO A;  1ZD2 P;  2EAN A;  3C2K A;  1DGJ A;  4PHA A;  5KT7 A;  3F5E A;  1RQL A;  4DCC A;  5CR0 A;  5KT5 A;  4XQ8 A;  2P66 A;  3NGD A;  1DRG A;  4NJ8 A;  4UAW A;  3WK6 A;  1TK8 A;  2OHF A;  3RB0 A;  2YMM A;  3CW2 C;  3QU9 A;  9ICA A;  2XY6 A;  2NO4 A;  2W55 A;  2J6U A;  1WCL A;  3Q8Q B;  9ICC A;  1T94 A;  8ICT A;  3PV8 A;  2FMQ A;  2BPG A;  4AYB C;  3MBY A;  5ALW A;  5BOL A;  2FLN A;  5KFI A;  2V4R A;  2W3S A;  1KDH A;  2GO7 A;  3QU2 A;  5J2D A;  3ONN A;  4KLH A;  2ZJ5 A;  3DV9 A;  3T5L A;  4U7C A;  4OCZ A;  4PHD A;  4RQ3 A;  4FBT A;  1RDF A;  1QLN A;  3O0F A;  5KTQ A;  5DBB A;  2LI6 A;  2A1A A;  3SAF A;  5DB6 A;  4IRC A;  3PO4 A;  1A6S A;  1X9X A;  3EWA A;  2B21 A;  3QU5 A;  4Y2Q A;  1TAM A;  3SV3 A;  4MF2 A;  4F4Y A;  2RP5 A;  3V72 A;  3MFI A;  3IV6 A;  3SR6 A;  2I9G A;  4OD0 A;  2HHQ A;  4FFD A;  4C4T A;  2WAQ F;  3TAD C;  2P6U A;  4RQ8 A;  1OXJ A;  2BR0 A;  4P4O A;  1N56 A;  1TV9 A;  5DG7 A;  5KFK A;  1ZQH A;  4DSJ A;  2HI0 A;  3C1Z A;  4JV0 A;  2HBK A;  9ICW A;  3Q8L A;  2W7P A;  2YMP A;  5ALQ A;  4DL7 A;  2HSZ A;  3PSI A;  2DL0 A;  4J9M A;  1U49 A;  4I2B A;  3AN1 A;  4GXJ A;  2ODG A;  2YX8 A;  4DF4 A;  4GFJ A;  4HYK A;  2ZG6 A;  4KLI A;  4DSF A;  4F50 A;  4QJF B;  5A0L A;  4EBE A;  4YR0 A;  2JHD A;  3L4P A;  1SL0 A;  4EZ9 A;  3QZ8 A;  2VA2 A;  1FEZ A;  1ZQL A;  2HBJ A;  5KAF U;  8ICA A;  3I1Y A;  2OEH A;  1LKY B;  9ICB A;  1O03 A;  4BDP A;  3RJJ A;  1UA1 A;  3RB3 A;  2XCP A;  3GIM A;  9ICR A;  5EE0 A;  4NXZ A;  1D8B A;  4Y2Y A;  1T3N A;  3PW4 A;  9ICH A;  1Z4O A;  3HWT A;  4Y2V A;  3C29 A;  1DK3 A;  3GV7 B;  1MN8 A;  3HJE A;  1QTM A;  4NLG A;  3MC1 A;  5ALF A;  2BDU A;  5ALO A;  4Z6D A;  1CUK A;  1Z19 A;  1ZQK A;  1ZQU A;  4UAS A;  3GDX A;  2F8L A;  4RQ2 A;  3IP4 B;  3GIJ A;  4KLU A;  2OM6 A;  4YMO A;  9ICO A;  5KFL A;  5CRX A;  2PKE A;  3IN5 A;  2KSO B;  2QB0 A;  4YXM A;  2HBL A;  2W3R A;  3G6V A;  2AU0 A;  3F53 A;  3AL0 B;  5KFO A;  3WKC A;  1D9F A;  2ZJ8 A;  5DQH A;  1PZN A;  4TUS A;  3QU4 A;  2JZB B;  1HIW A;  1Z00 B;  4BJQ A;  4DLE A;  7ICK A;  5KFZ A;  2JEI A;  2MSN A;  5EWG A;  4CCH A;  3ORY A;  4UB5 A;  4M9J A;  1NKC A;  2XO7 A;  3TQ1 A;  1JAL A;  1QQ5 A;  4KLJ A;  5HMM A;  4DSL A;  5AKL A;  4BWJ A;  1URJ A;  3R9K A;  4P0Q A;  2MUT B;  3H8W A;  4FZM A;  2E8P A;  1ZOL A;  2I5H A;  3RB4 A;  4KLS A;  2W43 A;  3LVW A;  1IG6 A;  2R8I A;  9ICG A;  2D3D A;  3KZX A;  1KSP A;  3TAR A;  4IR9 A;  1SKR A;  1ZQG A;  3ISC A;  8ICF A;  1U47 A;  2HHV A;  4R8U A;  2VKQ A;  1B43 A;  2W03 A;  8ICX A;  4YP3 A;  3SZ2 A;  1L8L A;  1X9M A;  1ZXI A;  5KL1 B;  5CB1 A;  2W9A A;  5AKZ A;  2BCR A;  1PVQ A;  2KHQ A;  2HDO A;  4UB8 U;  1IIP A;  5EE1 A;  1M6Y A;  4NLN A;  2EZY A;  1C20 A;  1MSW D;  2MRL A;  2H3Z A;  1WCN A;  2AH5 A;  4DQR A;  3T79 A;  2R8K A;  2EQY A;  4QWB A;  4EBC A;  1XO0 A;  1KW4 A;  1Z4N A;  5AI8 A;  1RZT A;  2LM4 A;  2V9W A;  3OPX A;  5AKY A;  8ICB A;  4PZN A;  2OXO A;  4PZO A;  4O3M A;  2XID A;  4O5E A;  3PO5 A;  3MR3 A;  3H8S A;  1F5S A;  3N7P D;  5KFA A;  1WWV A;  3KFU F;  2PFP A;  5AK5 A;  2JV3 A;  3PSF A;  4K4G A;  3THV A;  1CEZ A;  3B9J A;  3FDS A;  4OO1 J;  5J29 A;  2XGQ A;  9ICI A;  8ICP A;  3WK4 A;  2RQ5 A;  1D9D A;  1ZD5 A;  2H5X A;  2Q4T A;  3EZ5 A;  4PGX A;  3QE9 Y;  3M9O B;  1X40 A;  4RQ5 A;  4QIW C;  3C21 A;  2YY6 A;  3RJF A;  1S8O A;  2HHW A;  3WU2 U;  2IHM A;  5HHI A;  3C2L A;  1NNL A;  4DLG A;  5CWR A;  4NWI A;  3RRH A;  3PR5 B;  5TIS U;  3UM9 A;  4NM1 A;  8ICW A;  4J9P A;  3PST A;  2ALZ A;  2YB1 A;  5J2H A;  4E0D A;  4DL2 A;  3ICX A;  5KT2 A;  2C22 A;  2BZF A;  4DL5 A;  5JTI A;  3ED5 A;  2HHU A;  5EWE A;  1O08 A;  5J0U A;  1JRO A;  5AM1 A;  1SV0 A;  3KKA A;  4KLM A;  1J97 A;  3QZ7 A;  1PK1 B;  4YMM A;  4Y2X A;  2LBO A;  3NVY A;  4RPX A;  4FS1 A;  3IHQ B;  1Z3E B;  3AEV A;  4GXK A;  1RYS A;  3D2N A;  1ARO P;  5ALD A;  2KHV A;  2E5S A;  3NRZ A;  2LYA A;  3UXP A;  2E3T A;  4B9M A;  7ICL A;  4XA5 A;  4F91 B;  7ICF A;  3F2D A;  3A0B U;  4IC9 A;  3RAQ A;  4RNO A;  2K8B B;  3JPS A;  3N28 A;  4J9K A;  4C8O A;  2BQ3 A;  2EAP A;  3SV4 A;  2HCF A;  1ED1 A;  1JRP A;  1N48 A;  4LVS A;  2KKP A;  5TZV A;  3BQ7 A;  4Q45 A;  2BGW A;  4IRK A;  4NLC A;  2F77 X;  2FDR A;  2C2D A;  4EZ6 A;  4B6J A;  4RT3 A;  1BNO A;  1SZH A;  4KLQ A;  8ICJ A;  3ETR A;  5C0Y A;  3C1Y A;  4DSE A;  2JEG A;  4ECS A;  2ASL A;  3D2S A;  2ZIU A;  5IIL A;  3BQ0 A;  4BXO A;  2JEJ A;  1NJX A;  9ICJ A;  4K4H A;  9ICM A;  2WF7 A;  2DKX A;  5DKW A;  1TAQ A;  3NTU A;  1X66 A;  1QQ6 A;  2F1J A;  1ZQ1 C;  4ELU A;  3TAC B;  2OH2 A;  5J2A A;  4C7Y A;  7ICG A;  3CNH A;  3TI0 A;  2UVR A;  3RH5 A;  2N1R A;  4M04 A;  5KFG A;  2QB0 B;  3Q8M A;  8ICC A;  5CEH A;  2K4P A;  5AIB A;  2F76 X;  1C7Y A;  4KMO B;  4TQS A;  1XNS A;  1N60 A;  1L7N A;  2DKZ A;  1KL9 A;  3SQI A;  4RPZ A;  2VAN A;  4UW9 A;  4M2Y A;  3ZDD A;  1BPB A;  4DFJ A;  5DB9 A;  3N4M B;  2ZUC A;  4RUC A;  2FMP A;  4JWN A;  1BGX T;  4EX7 A;  2AGO A;  4YG2 A;  1RXV A;  4PH5 A;  1RM6 C;  4CF4 A;  2F2A B;  5AI9 A;  5AIA A;  2OWO A;  4CF5 A;  3PR4 A;  2KN7 A;  2MA1 A;  4B9L A;  3SAG A;  4USA A;  3ALR A;  1T7P A;  1Q46 A;  4I2I A;  3SYZ A;  1QSS A;  4F4W A;  5AKH A;  4R8U B;  2G07 A;  2JGA A;  4Z6F A;  5F9N A;  2KMD A;  3MR2 A;  4BGD A;  4FBU A;  1DK2 A;  1SIJ A;  2BCS A;  1L3U A;  1FIQ A;  1NZP A;  4YR3 A;  4RQ6 A;  5KFY A;  1AQ6 A;  2KJ5 A;  2O6K A;  1BVS A;  3PW5 A;  8ICU A;  2E1F A;  3HP6 A;  1VJ5 A;  2G06 A;  1UQV A;  1NJW A;  4YXJ A;  3D2Q A;  1KEJ A;  1D8L A;  2W54 A;  1ZQC A;  2I6X A;  2QLT A;  2J6T A;  1N5W A;  5GTH U;  5IIK A;  3VCB A;  5J0Y A;  5DGA A;  5EE3 A;  2CN1 A;  2GWS A;  2KNJ A;  4ED1 A;  4MHV A;  3HW8 A;  4UBB A;  3C28 A;  5KT6 A;  2OCE A;  1KKX A;  1L3T A;  4QZ8 A;  3RB6 A;  1MQ2 A;  4FO6 A;  4C0Z A;  3OJU A;  9ICQ A;  2R8J A;  2VA3 A;  4I2C A;  4UBC A;  4R64 A;  1XSN A;  2HOQ A;  2EH9 A;  4J03 A;  3AU6 A;  2YMQ A;  1RQN A;  5J8Y A;  2Y9T A;  1S0M A;  4M0A A;  4GC7 A;  1L7O A;  2RRD A;  5ALZ A;  2CXY A;  1S0O A;  2JR5 A;  4ED0 A;  2ZIW A;  9ICV A;  4F4Z A;  5B5E U;  2GH1 A;  1K1S A;  3F2C A;  1T8E A;  2WF9 A;  3BQ1 A;  2KZZ A;  2G0A A;  2ZUD A;  1NOM A;  1N2X A;  5KAI U;  5J0X A;  3C2M A;  1N61 A;  4Q44 A;  5J2B A;  5J2K A;  1L8O A;  4MEY A;  1KQQ A;  4FZN A;  2PFN A;  4TUP A;  1L3S A;  2L5Y A;  4DL4 A;  5KFF A;  3LWL A;  1UA0 A;  2NRZ A;  4YQW A;  1XSL A;  3WKB A;  1V9P A;  2QKQ A;  5ALM A;  5KT4 A;  5AKJ A;  4I2A A;  3BZK A;  3TFS A;  3F5A A;  4TUR A;  1XC9 A;  4F2S A;  5FP0 A;  2HW3 A;  1NK8 A;  5J2F A;  1SGG A;  2ZXH A;  2E8N A;  4F3O A;  2NV3 A;  2H3F A;  5L9X A;  4PL2 A;  5HHH A;  1ZQX A;  5KL8 B;  4I2F A;  3RH6 A;  2B0C A;  1J2M A;  1ZQZ A;  5AKK A;  4F5P A;  7ICP A;  1ZD4 A;  2IOF A;  1UPH A;  5KNI A;  4I2J A;  5DG8 A;  1XO1 A;  4ECW A;  2LKY A;  2ES6 A;  3KZI U;  1ZRM A;  4DFK A;  2W9M A;  4Y2U A;  5H2F U;  2FI1 A;  4Y2S A;  2PMZ F;  2VIX A;  3KOO A;  5ALU A;  4O3S A;  7ICM A;  3QNM A;  3RBE A;  8ICK A; 
#chains in the Genus database with same CATH homology
 4ECY A;  4PPX A;  3T5J A;  1MSW D;  1RYR A;  7ICS A;  4O5C A;  5J2E A;  4C8K A;  4JV2 A;  2HHT A;  5DQG A;  5IIM A;  4ECZ A;  1RXW A;  1UT8 A;  1WCN A;  2PFQ A;  4B9V A;  3Q8K A;  3ISB A;  4DQR A;  2R8K A;  2P6R A;  4QWB A;  4EBC A;  1A77 A;  3V7J A;  4M9G A;  5KFJ A;  2ATL A;  4PHE A;  2DPJ A;  5J2C A;  1RZT A;  4UB4 A;  2PFO A;  4UAZ A;  4F2R A;  4QZA A;  4I29 A;  4G3I A;  1SZP A;  4P4P A;  2V9W A;  5J0S A;  5KFP A;  4NLK A;  8ICB A;  4QWA A;  5CHG A;  3TAQ A;  2Y1I A;  4J9Q A;  5KFV A;  4O5E A;  2ASJ A;  3UXN A;  3PO5 A;  8ICI A;  2M9N A;  3PML A;  3RR7 A;  4YMN A;  3MR3 A;  3T5K A;  4BXO B;  5D46 A;  4F5Q A;  4YVZ A;  3H8S A;  4ED8 A;  1KFT A;  2I1Q A;  2W8K A;  4NM2 A;  3N97 B;  5CP2 A;  9ICF A;  5KFA A;  4RZR A;  3M9M B;  4QZE A;  4ECT A;  4ED2 A;  1ZQY A;  2BKE A;  4IQU A;  5EWF A;  4IQV A;  2IMW P;  4TQR A;  4I2H A;  4X5V A;  3MFH A;  3MDC A;  4DL6 A;  1RPL A;  2AQ4 A;  2PFP A;  5DGB A;  5L1J A;  4UB1 A;  9ICX A;  4K4G A;  1U48 A;  1ZQQ A;  3M9N B;  3THV A;  4PGY A;  1CEZ A;  1BPD A;  3FDS A;  1ZJN A;  9ICI A;  5J29 A;  2XGQ A;  3GII A;  5L1I A;  3MAB A;  2C2E A;  8ICP A;  4JK1 A;  1S0N A;  1ZQR A;  3BQ2 A;  1QSL A;  2XY7 A;  2BHN A;  1SL2 A;  5D4B A;  4KLT A;  4M6W B;  1KFD A;  1D9D A;  1SL1 A;  8ICO A;  1LV5 A;  2Q0Z X;  2FLP A;  1ZQM A;  2H5X A;  4DS4 A;  1BPE A;  4RNN A;  3EZ5 A;  4PGX A;  3QE9 Y;  1XS9 D;  1XU4 A;  3M9O B;  2NRT A;  4DEZ A;  5KFB A;  1S10 A;  8ICE A;  8ICN A;  4EEY A;  1S9F A;  1ZQB A;  4RQ5 A;  3C21 A;  3RJF A;  2JZB A;  3RH4 A;  2HHW A;  1IM4 A;  1Z00 A;  1TVA A;  2IHM A;  1L5U A;  2ZTC A;  2FMS A;  5HHI A;  3C2L A;  8ICL A;  7ICH A;  4DLG A;  5CWR A;  4DF8 A;  3PVX A;  3JPN A;  3RRH A;  4ECU A;  5KFT A;  2ZTD A;  3ZDB A;  7ICN A;  1ZQN A;  4Q43 A;  3PR5 B;  7ICE A;  3V6K A;  4ECV A;  4NM1 A;  4J9S A;  8ICW A;  4J9P A;  8ICV A;  4JWM A;  5KG2 A;  4MFF A;  2BCV A;  2BCQ A;  3PX4 A;  2IBK A;  2KFN A;  2ALZ A;  5KG5 A;  4F92 B;  5KFC A;  5KFR A;  5IIJ A;  4YN4 A;  2NRX A;  5J2H A;  3TFR A;  1KRP A;  4E0D A;  4I28 A;  4DL2 A;  4KLE A;  5DBA A;  4O3P A;  4KLO A;  5L1K A;  5KT2 A;  2C22 A;  2MUT A;  1NK6 A;  9ICS A;  4DL5 A;  4UQG A;  3JPP A;  4C8N A;  4YCX A;  2HHU A;  5EWE A;  4KLF A;  5DG9 A;  4I27 A;  4ELV A;  1JXL A;  5L1L A;  4ZH4 A;  4F4K A;  1X2I A;  5J0U A;  1U45 A;  2KTQ A;  1BPY A;  1JXE A;  4KLM A;  1XSP A;  4DQI A;  1XWL A;  1UT5 A;  4KMU A;  3GIL A;  3QZ7 A;  2ZTE A;  4F5O A;  4M9L A;  4P4M A;  2KFZ A;  4YMM A;  3OJS A;  4NY8 A;  4RPX A;  4FS1 A;  3IHQ B;  1Z3E B;  4GXK A;  3M8S A;  2W9C A;  1RYS A;  5KG4 A;  2A1J A;  4Z6E A;  1QSY A;  1ARO P;  3FYH A;  2V4Q A;  5DLF A;  3BDP A;  1TKD A;  4RT2 A;  5IIO A;  4C8L A;  3UXP A;  4ELT A;  1X9W A;  4M9N A;  2R8H A;  4DSI A;  5KFS A;  2FPM A;  4B9M A;  2ZJA A;  4GLX A;  7ICL A;  4ECQ A;  4XA5 A;  1T4G A;  5KFN A;  4F91 B;  1JMS A;  3RJI A;  3EW9 A;  4J9L A;  7ICF A;  3RAQ A;  4RNO A;  4NLZ A;  3EPG A;  3JPS A;  1HJP A;  4JV1 A;  4QZD A;  4J9K A;  3KHR A;  4C8O A;  2AQ0 A;  2BQ3 A;  4KLL A;  5KG6 A;  4Q8E A;  4DL3 A;  1MC8 A;  2FPL A;  2HHX A;  3LDA A;  3SV4 A;  1S77 D;  4QZH A;  4IQT A;  4GC6 A;  4ED6 A;  3PNC A;  3C5G A;  2F1I A;  5J0T A;  2RDI A;  1N48 A;  4LVS A;  5TZV A;  4B9U A;  4M47 A;  1ZJM A;  1NK5 A;  4MFA A;  1S0V A;  5J0R A;  9ICE A;  4KN4 A;  1NKB A;  4Q45 A;  2BGW A;  1H38 A;  1ZQO A;  4IRK A;  5J0W A;  3MR5 A;  4EZ6 A;  2C2D A;  2R8G A;  2XY5 A;  4RT3 A;  4EYH B;  3RBD A;  5HNK A;  7ICO A;  8ICS A;  4J9N A;  4KLQ A;  8ICJ A;  3C2K A;  4PHA A;  9ICN A;  4KTQ A;  5KT7 A;  3C1Y A;  4DSE A;  2JEG A;  4RQ4 A;  7ICU A;  3TAN A;  4Q8F A;  3ZD8 A;  5D49 A;  5CR0 A;  2W9B B;  4ECS A;  2ASL A;  5KT5 A;  5IIL A;  3T3F A;  4XQ8 A;  3PMN A;  2XCA A;  3BQ0 A;  3KHL A;  4UB3 A;  2P66 A;  8ICY A;  3NGD A;  2DPI A;  2JEJ A;  4BXO A;  3B0Y A;  1NJX A;  3PW2 A;  7ICV A;  4UAW A;  3GIK A;  9ICJ A;  3RJE A;  2PI5 A;  4I2G A;  1ZQV A;  4F93 B;  4XUS A;  2ASD A;  1TK8 A;  4K4H A;  9ICM A;  1L3V A;  2BPC A;  1JN3 A;  5DKW A;  1TAQ A;  3NTU A;  3RB0 A;  1TFR A;  2HVI A;  4DOA A;  2XGP A;  2F1J A;  2BQR A;  3RR8 A;  3UQ0 A;  4O3R A;  3JPQ A;  4ELU A;  5KFX A;  9ICA A;  3JPT A;  3H4D A;  2XY6 A;  4XRH A;  4YD2 A;  5EOZ A;  5J2A A;  4DOB A;  8ICR A;  8ICG A;  3OGU A;  7ICG A;  4QWC A;  1S76 D;  3TI0 A;  2J6U A;  3RH5 A;  2UVR A;  4DQP A;  1WCL A;  3Q8Q B;  4M04 A;  4C8M A;  9ICC A;  5KFG A;  4QZC A;  3LWM A;  4M6W A;  3Q8M A;  8ICC A;  8ICT A;  1NK0 A;  1DOQ A;  4MF8 A;  3PV8 A;  1C7Y A;  4TQS A;  2FMQ A;  3GFK B;  2BPG A;  3H7I A;  3MBY A;  5HML A;  5DLG A;  3MGH A;  5BOL A;  4UB2 A;  4RPZ A;  3ZD9 A;  2VAN A;  2FLN A;  5KFI A;  2V4R A;  4DQS A;  3ZDD A;  1BPB A;  4J9O A;  4DFJ A;  4M2Y A;  4RQ7 A;  5DB9 A;  4ED3 A;  3N4M B;  2ZUC A;  4RUC A;  1KDH A;  3RRG A;  2FMP A;  4FS2 A;  5DB8 A;  9ICL A;  5J2D A;  1KFS A;  4KLH A;  4JWN A;  1BGX T;  1ZQD A;  4RNM A;  2ZJ5 A;  3T5L A;  2AGO A;  4YG2 A;  1U9L A;  9ICU A;  4IQW A;  3HPO A;  4O0I A;  1RXV A;  3SI8 A;  4PHD A;  3GV8 B;  3K4G A;  4PH5 A;  4RQ3 A;  4DO9 A;  4FBT A;  1QLN A;  5DBB A;  5KTQ A;  2NRW A;  5C5J A;  4RUA A;  5DB6 A;  3LK9 A;  3OHB A;  3V7L A;  3G6X A;  2W8L A;  3PO4 A;  4IRC A;  4R66 A;  5BPC A;  1ZQI A;  9ICT A;  1JIH A;  4EYI B;  3EWA A;  2B21 A;  3MGI A;  2OWO A;  3PR4 A;  4I2D A;  5KFH A;  3OSN A;  2KN7 A;  4F4X A;  3SV3 A;  4MF2 A;  4B9L A;  4ECR A;  4B9N A;  1S97 A;  4KIT B;  4F4Y A;  3V72 A;  3MFI A;  1T7P A;  2AGP A;  5KG7 A;  1HUZ A;  3UQ2 A;  1KLN A;  3ETL A;  4I2I A;  3K75 D;  2I9G A;  2HHQ A;  1COO A;  3H40 A;  4R63 A;  2FLL A;  3PY8 A;  3V6J A;  2P6U A;  3M8R A;  4RQ8 A;  3EPI A;  3SYZ A;  1NK7 A;  1QSS A;  4F4W A;  2BR0 A;  3RJH A;  4P2H A;  4P4O A;  4YD1 A;  1X9S A;  1TV9 A;  1N56 A;  4R8U B;  8ICM A;  5DG7 A;  4QZF A;  5KFK A;  4Z6F A;  1ZET A;  1DGS A;  5F9N A;  1ZQH A;  5KG1 A;  3AU2 A;  2C28 A;  5J2G A;  3MR2 A;  4DSJ A;  7ICT A;  4BGD A;  3Q8R B;  4FBU A;  4QZ9 A;  3C1Z A;  3BQT A;  4JV0 A;  9ICK A;  2BCS A;  9ICW A;  1L3U A;  4EBD A;  3Q8L A;  4YR3 A;  5CJ7 A;  4RQ6 A;  4DL7 A;  3QEA Z;  2AJQ A;  5KFY A;  3B0X A;  2F1H A;  5J2I A;  4J9M A;  1U49 A;  4I2B A;  1D8Y A;  2MAX A;  7ICQ A;  1BVS A;  4GXJ A;  3PW5 A;  8ICH A;  3HP6 A;  1JX4 A;  5F9L A;  8ICU A;  1ZQS A;  5III A;  3T5H A;  4F5R A;  4DF4 A;  1BPX A;  4HYK A;  1NJW A;  2ISP A;  4YXJ A;  4F50 A;  4DSF A;  3H8J A;  2UVV A;  4IR1 A;  4KLI A;  4J9R A;  4O3N A;  1KEJ A;  4EBE A;  1D8L A;  4YR0 A;  1IXR A;  1ZQC A;  1NK9 A;  3RJK A;  1SL0 A;  5JUM A;  2J6T A;  5IIK A;  4LZG A;  5J0O A;  4O3Q A;  4EZ9 A;  3QZ8 A;  2VA2 A;  5J0Y A;  2XC9 A;  5DGA A;  3UPQ A;  1ZQL A;  5J0Q A;  1NJZ A;  1ZQP A;  2GWS A;  1NJY A;  4K4I A;  1TAU A;  4O3O A;  4RQ1 A;  4ED1 A;  4B9T A;  8ICA A;  2IHN A;  3HW8 A;  4UBB A;  4GXI A;  3PX0 A;  2VA8 A;  4IRD A;  5KT6 A;  9ICB A;  4BDP A;  9ICP A;  3RJJ A;  1L3T A;  2UVU A;  3ZDE A;  4QZ8 A;  3RB6 A;  3JPR A;  1UA1 A;  3RB3 A;  4FO6 A;  2XCP A;  1A76 A;  5KFM A;  3GIM A;  3OJU A;  1MQ2 A;  2UVW A;  9ICR A;  4NXZ A;  3Q8S B;  9ICQ A;  2DFL A;  1EXN A;  4PHP A;  1T3N A;  2R8J A;  3PW4 A;  2W9B A;  2PXI A;  5HP4 A;  2VA3 A;  4F8R A;  9ICH A;  4I2C A;  3RJG A;  5DB7 A;  3ZDA A;  3HWT A;  3RTV A;  3JPO A;  5IIN A;  1TK0 A;  1NKE A;  2JEF A;  4UBC A;  3C23 A;  4R64 A;  3GV7 B;  1XSN A;  4ED7 A;  1QTM A;  4NLG A;  3AU6 A;  3KHG A;  1ZQF A;  1S0M A;  4DWI A;  3MDA A;  4M0A A;  4KN7 A;  3G6Y A;  4Z6D A;  3PW0 A;  1CUK A;  4GC7 A;  1ZQK A;  1ZYQ A;  1ZQU A;  1HUO A;  5KG3 A;  3GDX A;  2BDP A;  4RQ2 A;  1S0O A;  9ICV A;  4ED0 A;  4UAY A;  3H4B A;  4F4Z A;  4M9H A;  1K1S A;  3GIJ A;  4QW8 A;  2PI4 A;  4KLU A;  4MEX A;  5KFE A;  4YMO A;  2FPK A;  5KFL A;  9ICO A;  1ZQJ A;  1T8E A;  2BPF A;  4YXM A;  1ZQW A;  3HX0 A;  1MQ3 A;  3BQ1 A;  1TK5 A;  3G6V A;  2AU0 A;  2KZZ A;  1ZQE A;  2ZUD A;  3OSP A;  7ICI A;  5KFO A;  2HVH A;  1NOM A;  4F5N A;  1D9F A;  2ZJ8 A;  2IA6 A;  5DQH A;  5KFW A;  3TAP A;  4RU9 A;  4ECX A;  2ZUB A;  5J0X A;  3C2M A;  4Q44 A;  1SKS A;  3ZDC A;  5J2B A;  5J2K A;  4MEY A;  2PFN A;  1PZN A;  4TUS A;  7ICJ A;  5BOM A;  3PW7 A;  2JZB B;  4TUP A;  2BCU A;  2C2R A;  1Y88 A;  1Z00 B;  5KFD A;  1L3S A;  1ZQT A;  4DL4 A;  4DLE A;  7ICR A;  7ICK A;  5KFZ A;  5KFF A;  3LWL A;  1UA0 A;  5KFU A;  2JEI A;  3ISD A;  2NRZ A;  4DFM A;  4YQW A;  5EWG A;  2Y1J A;  1XSL A;  4CCH A;  3ORY A;  5J0P A;  1V9P A;  3Q8P B;  4TUQ A;  5DBC A;  4UB5 A;  3KTQ A;  4M9J A;  3E2E A;  4KLD A;  1NKC A;  2WTF A;  2XO7 A;  5KT4 A;  4I2E A;  3TQ1 A;  1B22 A;  2BQU A;  4I2A A;  1LB2 B;  4KLJ A;  5HMM A;  1NK4 A;  4DSL A;  3UXO A;  3TFS A;  4BWJ A;  3QEB Z;  4DFP A;  4KLG A;  1ZQA A;  4TUR A;  2MUT B;  3GQC A;  4DOC A;  1XC9 A;  3H8W A;  5KFQ A;  4F2S A;  3IM1 A;  1NK8 A;  2HW3 A;  5J2F A;  3OHA A;  4PGQ A;  4LZD A;  4QZI A;  2KZM A;  3RB4 A;  1U4B A;  4KLS A;  5DDY A;  2NRV A;  5CA7 A;  3HT3 A;  2R8I A;  1BPZ A;  4DSK A;  9ICG A;  2KZ3 A;  1KSP A;  4F3O A;  3TAR A;  3V6H A;  4IR9 A;  1SKW A;  1SKR A;  2ISO A;  5DQI A;  4RQ0 A;  5L9X A;  1ZQG A;  4R65 A;  4QW9 A;  5HHH A;  3ISC A;  8ICF A;  1ZQX A;  1U47 A;  2HHV A;  5KT3 A;  2W9C B;  4I2F A;  4R8U A;  3RH6 A;  2A1J B;  3BJY A;  4MFC A;  1ZQZ A;  4YFK A;  4F5P A;  3RAX A;  2HHS A;  7ICP A;  4O5K A;  1B43 A;  4QZB A;  4RPY A;  5KG0 A;  3MR6 A;  3EYZ A;  8ICZ A;  4YR2 A;  4I2J A;  1K1Q A;  8ICX A;  4YP3 A;  3V7K A;  2AGQ A;  5DG8 A;  1XO1 A;  3KHH A;  4ECW A;  8ICQ A;  3SZ2 A;  4DS5 A;  4QWD A;  1KTQ A;  4QWE A;  4DQQ A;  4DFK A;  2W9M A;  5J2J A;  4QZG A;  3C5F A;  1X9M A;  2J6S A;  5CB1 A;  2W9A A;  2BCR A;  4Z6C A;  4O9M A;  3AUO A;  3GV5 B;  4BWM A;  3PX6 A;  2RDJ A;  2LYH A;  4JUZ A;  7ICM A;  4O3S A;  5DDM A;  4B9S A;  3RBE A;  4NLN A;  8ICK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...