3GFKB

Crystal structure of bacillus subtilis spx/rna polymerase alpha subunit c-terminal domain complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
76
structure length
76
Chain Sequence
GPHMKEEDQKEKVLEMTIEELDLSVRSYNCLKRAGINTVQELANKTEEDMMKVRNLGRKSLEEVKAKLEELGLGLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the in vivo-assembled Bacillus subtilis Spx/RNA polymerase alpha subunit C-terminal domain complex
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription/transferase
molecule keywords Regulatory protein spx
total genus 26
structure length 76
sequence length 76
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2009-02-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3gfkB00
2F1HA 3T5KA 2FLLA 4KLGA 3Q8PB 4EYIB 4ELTA 2RDJA 3AU6A 4TQRA 3C1YA 2C2DA 4EYHB 3C5GA 1Y88A 4DL6A 4DFJA 3N4MB 4KLMA 1TFRA 1IM4A 2FPMA 4YD1A 1ZQGA 2BQUA 2IHNA 9ICHA 1S0NA 4ECRA 4IRDA 3EW9A 8ICIA 4R66A 2BDPA 2ZUDA 2AGPA 4I2AA 8ICXA 3ZDBA 1DGSA 4M6WA 4KLQA 2KZ3A 3ZD9A 2PI4A 2KN7A 5L1IA 2JEGA 3RJJA 1NJYA 3M9MB 2BR0A 3OSNA 3MR5A 4YR3A 3PW5A 1U47A 5J2KA 2XO7A 1U4BA 2BPFA 2OWOA 2ZUCA 1TKDA 2NRWA 5EWFA 5KG7A 4F5OA 4E0DA 4BWJA 3GIIA 3RBEA 3HX0A 3JPQA 1SL0A 3V6JA 1KDHA 1JXLA 1ZQLA 9ICNA 4RU9A 5KT2A 1RXVA 4BXOA 4UB2A 4GXJA 7ICRA 1NKCA 4DSJA 3RJGA 1TK5A 1L3UA 5KFOA 5J0YA 2BQRA 4RNOA 4KMUA 3GV7B 4ED7A 1NK7A 8ICPA 3TAQA 4I2EA 3KHHA 3C21A 3JPOA 1BPZA 4DF8A 2HHUA 4LVSA 3EPIA 4ELUA 2HW3A 1ZQXA 1ZQVA 5KFHA 4EBDA 4XA5A 4ED2A 2Q0ZX 3RTVA 5CP2A 3MFHA 2VA2A 4YN4A 1KLNA 5KFRA 4TQSA 3MFIA 4O5EA 5CA7A 1ZQAA 8ICHA 5KFVA 2IMWP 5KFBA 5J0UA 4DFPA 4DFKA 2ZTEA 1RZTA 5KG6A 4BDPA 4PPXA 3JPNA 2R8KA 4PHEA 4RQ0A 8ICKA 4F5RA 5DGAA 2W9AA 4NM1A 4J9KA 4K4GA 9ICGA 5KFTA 3RAQA 3AUOA 4FBTA 2LYHA 1D8YA 1KFDA 2HHXA 3H7IA 4NY8A 1X9WA 2FLPA 2I1QA 2XY5A 3HP6A 3TARA 3RAXA 2B21A 3RR8A 4DQSA 4I28A 3RJFA 4KLEA 8ICZA 4YMNA 3C1ZA 4QZHA 4ECSA 3JPRA 1AROP 1TAQA 9ICCA 2VANA 4RT3A 5BOMA 3GDXA 2R8IA 5IIMA 3H4DA 1ZQEA 3BDPA 1D8LA 7ICGA 3MR3A 2MUTA 2ZJAA 3ISCA 2XGQA 1N56A 4PGQA 4J9RA 2BHNA 4IQWA 9ICLA 4ECQA 4YQWA 2V4QA 4I2GA 3MGIA 1U9LA 4EEYA 3K75D 4DWIA 2HHSA 1BPBA 2IA6A 5DGBA 4JWNA 8ICBA 1S0MA 2ISPA 4RQ1A 2V4RA 1K1SA 4DSFA 5C5JA 4Z6DA 1BGXT 4J9LA 4R8UA 3PW2A 1BVSA 4M2YA 8ICAA 5J0RA 3ZDDA 2NRVA 1NK6A 3HT3A 3TANA 4EZ9A 4IR1A 5L1KA 3C2MA 4MFAA 3PNCA 4RNMA 3Q8RB 1UA0A 4DF4A 2BCQA 4QW9A 1D9DA 1U45A 1A77A 5EWGA 3V72A 2AU0A 3RH6A 5D4BA 3T5HA 4C8KA 9ICKA 5DLFA 2JZBA 1XSNA 4NLGA 8ICRA 5KFGA 4UAWA 4P4OA 2BGWA 3H8JA 4M0AA 5L1JA 1Z00A 1JXEA 3K4GA 5DBCA 4R63A 4F50A 4PHDA 3V7JA 4RPZA 3TFRA 3PVXA 3OHAA 3LDAA 4FS2A 4YMOA 4QZGA 4DSEA 2J6UA 2UVRA 2UVUA 1ZYQA 9ICXA 4DL2A 2ISOA 7ICQA 2W8KA 9ICQA 3PV8A 4QZAA 4O3RA 1ZQYA 9ICWA 1T8EA 5KFYA 4GXKA 3ZDCA 2HVHA 3PO5A 1U48A 5KFIA 4QW8A 3TQ1A 7ICKA 4J9SA 5DB6A 3QEBZ 9ICOA 4UB5A 1T4GA 5KTQA 5F9NA 5J0PA 1LB2B 1ZQRA 4C8OA 2M9NA 5KFUA 4MFFA 7ICOA 5KG3A 1B43A 7ICJA 1JX4A 2AJQA 5KFKA 3C5FA 1ZQFA 2KTQA 8ICUA 5DLGA 4R8UB 4C8LA 1L5UA 5DB7A 3M9NB 2BCVA 1NOMA 4F92B 3RJHA 4B9MA 3G6XA 3MR2A 4O3SA 4QZ9A 4O3PA 3RB6A 5J2HA 1PZNA 4YMMA 3RRGA 5D49A 1KFTA 5KFWA 4XUSA 4YD2A 2A1JB 4R64A 4EBCA 3RJIA 4F93B 4DQRA 4P4PA 2Y1IA 3ZDEA 1ZQJA 2J6SA 5J29A 1MQ2A 1ZQBA 2PFPA 4PHPA 7ICMA 4QZFA 1WCLA 1QTMA 1DOQA 4YR0A 1TV9A 4DLEA 2Y1JA 1Z00B 3Q8SB 4UB3A 9ICBA 4R65A 1ZETA 1JN3A 2ZUBA 2DPIA 4I2HA 1NK5A 4B9NA 2W9CA 2FPLA 7ICFA 2V9WA 4KLSA 4JWMA 5TZVA 4O3QA 1XO1A 2WTFA 2BPCA 2FLNA 3MABA 4UBCA 2W9BA 3EWAA 5IIIA 5J2CA 1QSSA 4MFCA 1IXRA 5J2GA 2PXIA 1T7PA 3ISDA 2C22A 4PGXA 5KG1A 3PW0A 7ICHA 4I27A 4J9MA 5IIKA 4J9PA 2JEJA 2P6UA 5KT7A 3V6HA 2PI5A 5KG0A 2C2EA 1MC8A 1NK9A 3UQ0A 5J0TA 3PR4A 5J0QA 1H38A 1ZQZA 4YR2A 4EBEA 4DEZA 4I2IA 1NJXA 1MQ3A 1TVAA 3RRHA 3ETLA 1UT8A 2XGPA 4Q45A 4QWBA 4XRHA 4MF2A 4KTQA 1S77D 3IHQB 5D46A 4Z6CA 1XWLA 1HUOA 1BPXA 1KRPA 4DSLA 4O0IA 5KT6A 1UT5A 4Z6FA 1S10A 1ZQPA 5KFFA 3SYZA 3TAPA 4JV2A 1L3SA 4IQTA 4F4WA 1ZQNA 1ZQSA 3UPQA 1ZQKA 4F3OA 5KT4A 4YVZA 4ED8A 3THVA 2BCSA 1D9FA 1CEZA 3GFKB 2ZJ8A 4B9VA 4UBBA 3Q8LA 4RZRA 7ICTA 5CR0A 4F8RA 4KLIA 5IIOA 4DOAA 1ZQQA 2PFOA 2ATLA 3V6KA 1C7YA 3QZ8A 5L9XA 3MR6A 4DS4A 4GXIA 4O5CA 4QZEA 3EZ5A 2F1IA 2IHMA 3BQTA 5HMLA 4UQGA 3EYZA 3OJUA 1NKBA 5KG2A 2J6TA 4PGYA 4ECWA 3RBDA 4LZDA 3RB3A 1RPLA 3GIKA 5EOZA 1L3TA 7ICLA 3RJKA 9ICPA 3C23A 3PX0A 2BCRA 4TURA 4DL3A 7ICPA 3PY8A 1X2IA 5HP4A 4KLUA 4NLZA 3MDAA 5EWEA 5DBBA 4J9QA 3PX4A 2ASLA 4I29A 3RH5A 3M8SA 4O3NA 3NTUA 4MEYA 5DG8A 3RB4A 8ICTA 2VA3A 4DO9A 5KG5A 3RB0A 5J0SA 4M9LA 2KZMA 3RH4A 1U49A 2JEIA 8ICSA 1SKSA 1XSPA 2AQ4A 4ELVA 5DG9A 3C2LA 4QWAA 4ECUA 4RQ6A 1TK8A 2GWSA 4HYKA 1ZQWA 2C28A 5DQGA 2HHTA 3V7KA 5KFAA 3SV4A 2AGOA 1XS9D 1SKRA 5J2JA 1SZPA 4ECXA 4F2RA 4G3IA 3ORYA 4TUSA 2ZJ5A 3PMLA 3G6VA 3T3FA 4DL4A 4DSKA 3KHLA 2UVVA 2W9CB 4YFKA 3RJEA 5DQHA 4Q8FA 2ASDA 4M6WB 1RYSA 8ICYA 2R8JA 3JPPA 5J0XA 1WCNA 3H4BA 2JZBB 2NRTA 2KZZA 3UXPA 4GLXA 4YCXA 3PW4A 5J0WA 4QZDA 1XC9A 3PX6A 9ICVA 3BQ2A 3V7LA 1BPEA 2R8GA 2HHWA 3OJSA 1BPYA 4GC6A 7ICEA 5IILA 8ICWA 4YXJA 4C8MA 5KFDA 4UAZA 2PFQA 4IRCA 4ED0A 4ED3A 9ICMA 5KFQA 3PR5B 3GIJA 4ED1A 1NK0A 4MF8A 1L3VA 4I2BA 9ICTA 1COOA 5DQIA 4M9JA 1S0OA 2RDIA 5KFMA 2DFLA 1ZQTA 4BGDA 1HJPA 4DQPA 4C8NA 1ZJMA 8ICMA 1QSLA 2FMQA 4QZCA 9ICRA 2ZTCA 4Z6EA 2AGQA 1X9SA 4PHAA 5KFJA 1V9PA 3MDCA 4O3OA 3UQ2A 1TK0A 8ICFA 4YP3A 9ICAA 2P66A 2ALZA 2HHVA 2VA8A 4FBUA 3PW7A 3BJYA 4NLKA 3EPGA 1LV5A 3GV5B 1ZQOA 3HW8A 5F9LA 3T5LA 1A76A 3JPTA 5IINA 1KFSA 5HMMA 3LK9A 5DB9A 1X9MA 2DPJA 1SL1A 3MBYA 4KLTA 5HHIA 4UAYA 3HWTA 4RQ7A 2W8LA 3GV8B 4B9SA 1QLNA 2KFNA 1KTQA 4I2DA 3SV3A 1NK8A 1EXNA 4KLOA 2XY7A 1S0VA 3OSPA 4RQ8A 5CJ7A 4BXOB 5J2IA 4DS5A 4MEXA 4RPXA 4NXZA 5BOLA 2MAXA 4KITB 4IR9A 3H8SA 3H40A 4CCHA 4LZGA 4RUCA 2NRXA 4F5QA 4QZIA 1ZQHA 4F4KA 3B0YA 1S76D 4Q44A 9ICIA 9ICSA 1QSYA 4JV0A 4RQ3A 4QWEA 5KFXA 4ECZA 4YXMA 4NLNA 2BKEA 4F5NA 1RYRA 2R8HA 3B0XA 4KN7A 3NGDA 3N97B 3E2EA 2W9MA 4PH5A 3M8RA 3Q8KA 3IM1A 4GC7A 5DG7A 4RNNA 1KSPA 5CHGA 2HHQA 4RQ5A 2XY6A 4DLGA 3Q8QB 1ZJNA 1B22A 2UVWA 2A1JA 2NRZA 5KFPA 4FS1A 1SKWA 2XCAA 3BQ1A 3C2KA 8ICNA 8ICQA 5KT5A 5KFEA 4RPYA 3OHBA 3KHGA 1KEJA 4KLLA 2IBKA 4M9HA 4TUPA 4IRKA 5KFLA 2XC9A 1N48A 5KFNA 3LWMA 4JUZA 2HVIA 9ICFA 4F91B 4QZBA 2PFNA 1MSWD 4KLDA 4QZ8A 3MGHA 8ICJA 4JK1A 1NJZA 5DB8A 4J9NA 4DFMA 2FMPA 1ZQUA 2MUTB 4ECVA 2ZTDA 1S97A 5J2EA 1SL2A 4DQIA 9ICEA 4F4YA 4K4HA 1S9FA 8ICEA 1NKEA 2JEFA 4DL7A 4O5KA 3QEAZ 7ICVA 4QWCA 4DQQA 4RQ4A 4ZH4A 4P4MA 3BQ0A 1UA1A 1BPDA 3SI8A 4RT2A 4QWDA 4UB4A 4ECTA 1NJWA 8ICVA 4Q8EA 5CB1A 2C2RA 3TFSA 1ZQDA 5KG4A 2F1JA 1XSLA 5J2AA 4F4XA 3OGUA 3UXOA 3FDSA 4UB1A 3AU2A 4DOBA 4DL5A 3LWLA 4M9NA 5HNKA 3ISBA 4IQUA 5DDYA 4F4ZA 4B9TA 4JV1A 4M47A 3TI0A 5DDMA 4KLHA 4KLJA 3PMNA 3JPSA 3QE9Y 4XQ8A 3QZ7A 4IQVA 3T5JA 9ICJA 2FMSA 1JMSA 8ICGA 5KFSA 1HUZA 1ZQCA 4P2HA 5DBAA 4FO6A 3GIMA 3KTQA 5KT3A 3M9OB 4I2CA 8ICCA 4K4IA 3FYHA 4ED6A 5HHHA 4EZ6A 1Z3EB 4X5VA 2BQ3A 7ICSA 2ASJA 1NK4A 1CUKA 5JUMA 1ZQIA 3UXNA 5KFCA 3RR7A 4NM2A 4F2SA 4M9GA 5KFZA 3HPOA 3ZD8A 2P6RA 4M04A 4KN4A 8ICLA 4B9LA 4BWMA 1T3NA 2KFZA 2XCPA 4F5PA 7ICUA 5J2FA 7ICIA 2FPKA 1K1QA 3H8WA 4TUQA 5J2BA 3KHRA 4DOCA 5J2DA 5BPCA 3GQCA 2W9BB 2H5XA 2BCUA 4O9MA 4I2JA 1TAUA 1JIHA 3GILA 3PO4A 4DSIA 5IIJA 2BPGA 4KLFA 1XU4A 2I9GA 3Q8MA 4B9UA 4Q43A 4YG2A 7ICNA 3SZ2A 3ZDAA 4RQ2A 9ICUA 1ZQMA 4ECYA 1RXWA 5CWRA 5DKWA 4RUAA 3G6YA 4J9OA 4I2FA 5J0OA 5L1LA 2AQ0A 8ICOA
chains in the Genus database with same CATH superfamily
2DKZA 3Q8PB 4ELTA 1D8BA 2FI1A 4DFJA 1IM4A 2FPMA 4YD1A 1RYUA 2JV3A 1S0NA 3M6KA 4UW9A 3EW9A 4R66A 2BDPA 4I2AA 2O6KA 5EE1A 2XVTA 2F8KA 2KHQA 2KVCA 2KZ3A 2JEGA 4FZNA 3MR5A 2BPFA 4JB3A 3HX0A 3V6JA 1KDHA 1JXLA 9ICNA 5KT2A 4GXJA 1NKCA 4OJ5A 3GU3A 1AQ6A 5KFOA 2BQRA 3GV7B 8ICPA 4I2EA 1SXEA 4LVSA 2HW3A 1ZQXA 2KV2A 2Q0ZX 1URJA 1KLNA 4TQSA 3MFIA 5CA7A 1ZQAA 5KG6A 4BDPA 8ICKA 4G9BA 4NM1A 4CF3A 4J9KA 9ICGA 2WAQC 4FBTA 2LYHA 2F2AB 5ALOA 3LYSA 3H7IA 3MGVA 3TARA 2B21A 3RR8A 3ETRA 3C1ZA 4QZHA 4QNLA 1WUDA 2IOFA 5IIMA 1F44A 3M7DA 4YQWA 2V4QA 4I2GA 3UMCA 2WF9A 5ALJA 1SV4A 2HHSA 4RQNA 1S0MA 5AM0A 5C5JA 4Z6DA 3PW2A 4R8UA 1ZQ1C 2EZYA 3UMGA 3ED5A 2LKYA 3HT3A 3TANA 2W54A 5L1KA 5AKJA 4RNMA 4DF4A 1D9DA 1U45A 3V72A 3T5HA 2JZBA 8ICRA 2G06A 5ALEA 1JXEA 3K4GA 5DBCA 3BQ7A 1P7DA 4RPZA 2UVRA 2UVUA 2KSOA 2G5IB 2ISOA 2W8KA 9ICQA 2W3RA 1ZQYA 5KFYA 2HBLA 2IOHA 3PO5A 1S8OA 5AKKA 5KFIA 2K4PA 9ICOA 1ZQRA 4AP9A 2QLTA 2M9NA 4IL6U 5KFKA 8ICUA 4C8LA 3RJHA 4F92B 4O3SA 3MR2A 4QZ9A 5J2HA 5FP0A 2B6GA 5D49A 1SZHA 1WWUA 4EBCA 2DBYA 4F93B 2AXTU 2OHFA 1ZQJA 5C0YA 2CRXA 2PFPA 3AEVA 7ICMA 3VC8A 1TV9A 1Z00B 4UB3A 5AKHA 4PZOA 4I2HA 2YMLA 2FPLA 7ICFA 2V9WA 4KLSA 1XO1A 2BPCA 2W9BA 2Y9UA 3OTQA 4FZMA 1IXRA 5KG1A 3N7SC 3PW0A 4I27A 2P6UA 4PL1A 3UQ0A 5J0QA 3TKAA 3SMVA 1O03A 1NJXA 1TVAA 3RRHA 5L1MA 1UT8A 1X42A 4KTQA 3NRWA 5AK4A 4F72A 4DSLA 1BPXA 4O0IA 4Z6FA 1L7PA 4F4WA 1ZQSA 3KZIU 4ED8A 1CEZA 2G08A 5IIOA 4Y2YA 2ATLA 3V6KA 2OEHA 1OUQA 1OW5A 1Q46A 3MR6A 1UHUA 4GXIA 1HEKA 3PSFA 3RFAA 5KG2A 2J6TA 4PGYA 4ECWA 2DWQA 5AK3A 2F77X 5KL1B 1Q3UA 2BCRA 3AQEA 4TURA 4DL3A 7ICPA 2H3IA 2Y0SF 4KLUA 5DBBA 2HBMA 3PX4A 2HOIA 2K8AA 4I29A 4O3NA 3I76A 3NTUA 1Q8KA 3RB4A 1WYGA 3QU7A 5ALKA 5KG5A 2D8CA 2JEIA 4ECUA 1V85A 3V7KA 1N5XA 2AGOA 2PMZF 1JROA 5AKYA 2G09A 4TUSA 2ZJ5A 4DSKA 1SV0C 3KHLA 2W9CB 4YFKA 5DQHA 4J03A 1XNSA 3JPPA 5J0XA 4EX7A 1A0PA 5AKEA 3RF9A 3H4BA 2JZBB 5A0LA 3UXPA 4GLXA 4YCXA 3PW4A 3BQ2A 3V7LA 1BPEA 1BPYA 1N5WA 2PFQA 9ICMA 4ED1A 3PR5B 4M9JA 3IN5A 4BGDA 4C8NA 4QZCA 4Z6EA 3SAGA 1J2MA 2VJ5A 2WAQF 1TK0A 1DK3A 2HHVA 1VDVA 5H2FU 3WKDA 1ZQOA 3T5LA 1KFSA 1X9MA 5HHIA 4UAYA 4RQ7A 3GV8B 2K8CB 1KTQA 4I2DA 5AICA 2YB1A 1LKYA 2L5YA 2KNJA 3TADA 4KLOA 1PK3A 4BXOB 5J2IA 4DS5A 2CXYA 3H8SA 3H40A 3QX7A 2KE7A 4F4KA 3B0YA 2K8BB 5CRXA 5AM3A 4JV0A 3WK9A 4YXMA 5AKZA 5T14A 1RYRA 2R8HA 3E58A 1L8LA 5G5HA 3F2BA 2XIDA 3E2EA 2LHTA 2FDRA 2LM1A 3L3FX 3QUTA 1B22A 2NRZA 8ICNA 2XCAA 4ACOA 8ICQA 5KT5A 5KFEA 4RPYA 1KEJA 4TUPA 2AHOB 4NWIA 4QZBA 2KEYA 4KLDA 4UAVA 4J9NA 4DFMA 1ZQUA 4P0QA 1FO4A 1S9FA 4Y2UA 4DL7A 4P4MA 1LVHA 8ICVA 3CRXA 5KG4A 2F1JA 3QXGA 4Y2SA 4CF4A 3OGUA 3FDSA 4UB1A 3AU2A 4DOBA 1SXDA 4M9NA 1ZD4A 4FFDA 3ISBA 3WK5A 2F44A 4IQUA 4M47A 3TI0A 5DDMA 2E3TA 4IQVA 4BUGA 2EQYA 2YX8A 3AM9A 1Z1BA 5DBAA 8ICCA 2ZIXB 5AHXA 3WKCA 2ASJA 1CUKA 4NM2A 3PZPA 4M9GA 3ZD8A 3KD3A 4KN4A 7ICUA 4US8A 1K1QA 5J2BA 4DOCA 2W9BB 2MU2A 5ALRA 4EENA 5ALYA 4O9MA 1JIHA 3E0FA 3DV9A 1XU4A 5ALNA 4C7YA 3Q8MA 1IG6A 1SWVA 1O08A 1RXWA 4RUAA 3G6YA 5L1LA 9ICPA 2FLLA 5CEHA 3H8MA 2QKQA 3CW2C 3BZCA 3AU6A 4TQRA 5EE0A 4EYHB 2P35A 1Y88A 4DL6A 4KLMA 2KIVA 4OCZA 4IRDA 2AGPA 8ICXA 1WG8A 2GO7A 4M6WA 3WK7A 4KLQA 5ALPA 3ZI4A 1PK1A 2KN7A 4EELA 1NJYA 5J2KA 2H3QA 2XO7A 1U4BA 2OWOA 2ZUCA 1TKDA 5EWFA 4F5OA 4B6JA 1SL0A 1RXVA 4BXOA 4DSJA 3RJGA 4OJLA 4RNOA 3TAQA 2ZXIA 3KHHA 3C21A 1BPZA 2HHUA 5KFHA 3RTVA 5CP2A 3D2SA 3MFHA 4YN4A 5KFRA 3F5AA 4O5EA 8ICHA 1CRXA 3HRDD 3A0HU 4DFPA 8ICOA 2WF6A 1J97A 2ZTEA 2WF5A 1X66A 3JPNA 2R8KA 3SENA 4F5RA 2W9AA 2ZIWA 3AUOA 1D8YA 1KFDA 2QB0B 4NY8A 4FZLA 3SR6A 2FLPA 3IDWA 2I1QA 3RAXA 2B0CA 4DQSA 3RJFA 1Z19A 4YMNA 4A8EA 4ECSA 4RT3A 5BOMA 3GDXA 1MA7A 3MR3A 2DKXA 1N56A 2QARA 4IQWA 1ZOLA 3MGIA 1U9LA 3K75D 4DWIA 2MRLA 5DGBA 1JI7A 2JHDA 1BGXT 4J9LA 2FE9A 2HMXA 4NLBA 1PK1B 3PNCA 1PVRA 2BCQA 3KZXA 4Y2VA 3RH6A 3H8JA 3OHAA 3LDAA 4DSEA 2QB1A 2J6UA 2VIXA 7ICQA 4O3RA 9ICWA 2RLTA 2GLEA 3ZDCA 5AM4A 2I5HA 1U48A 3QU2A 3QEBZ 1T4GA 2I6XA 4MFFA 5KG3A 7ICJA 2AJQA 2DQNB 5DLGA 3OPXA 4R8UB 2BCVA 4B9MA 4YMMA 5KFWA 4XUSA 3RJIA 5AK6A 3F5EA 4P4PA 4IC9A 2Y1IA 3ZDEA 4NLCA 5J29A 1QQ7A 1MQ2A 2J6SA 5B5EU 1QTMA 1DOQA 4DLEA 3Q8SB 2LYBA 3NVZA 2LYAA 2E8OA 2DPIA 1UCVA 2OH2A 4C7ZA 4JWMA 3MABA 4UBCA 1RQLA 3EWAA 5AM5A 4J9PA 5KT7A 5KG0A 5J0TA 3PR4A 2EDUA 4I2IA 3FAHA 2NV3A 1S77D 3IHQB 5ALLA 1XWLA 1HUOA 5KT6A 1UT5A 2ZG6A 4JMUA 1UPHA 5KFFA 4G3IA 2RQ5A 1ZQKA 4F3OA 5KT4A 3THVA 2ZJ8A 3Q8LA 7ICTA 5CR0A 4F8RA 4UASA 3NUQA 3QZ8A 3EUB2 2G0AA 4DS4A 2XI9A 4OJ6A 3BQTA 1X40A 4UQGA 3OJUA 1NKBA 2RHFA 3RB3A 1RPLA 2EZZA 1M6YA 1B4FA 1VJ5A 3LVVA 4NLZA 5EWEA 4J9QA 3RH5A 3M8SA 5DG8A 8ICTA 3GZFA 5J0SA 2KZMA 2KK0A 4QIWC 5AM2A 2LI6A 5DG9A 4C4RA 3C2LA 4QWAA 1TK8A 3IV6A 4C4TA 1N2XA 1ZQWA 5DQGA 1SKRA 4GIBA 5J2JA 1SZPA 2LPEA 4ECXA 1C20A 3PMLA 3QU4A 2UVVA 3RJEA 1QQ5A 4M6WB 4U6PA 2R8JA 2KZZA 1L7NA 4LJXA 5KAFU 4EX6A 4CNQA 2QARB 4YXJA 2MSNA 2ES6A 4ED0A 1NK0A 2WB1C 2DFLA 5KFMA 1HJPA 4DQPA 8ICMA 2AGQA 4O3OA 9ICAA 1SB3C 2VA8A 3PSPA 2YMMA 5F9LA 1A76A 1KKXA 4IS7A 2Y0SC 1N63A 3MBYA 2W8LA 1QLNA 5ALFA 5AI6A 2E8MA 1FIQA 1S0VA 1RG6A 1ZD3A 4MEXA 1N62A 4CCHA 4LZGA 1S76D 5EE9A 4KMOB 4QWEA 5KFXA 5ALMA 4ECZA 4F5NA 2W55A 3B0XA 3SEIA 5HR7A 4KN7A 3N97B 3M8RA 1J2NA 4GC7A 3PSIA 5DG7A 4RNNA 1KSPA 2HHQA 4DLGA 1ZJNA 4Y2TA 5KFPA 3C2KA 3KHGA 1LKYB 2IBKA 4M9HA 5KFLA 2XC9A 1ED1A 1N48A 2HVIA 2GOLA 5KNIA 1MSWD 4JK1A 1NJZA 2FMPA 2MUTB 3SD7A 5J2EA 1SL2A 2BZFA 5AKXA 3AQFA 4O3MA 1NKEA 1XO0A 2W11A 4DQQA 4ZH4A 1UA1A 1KL9A 4RT2A 4QWDA 4UB4A 4WJ3B 4Y2RA 3DEEA 5J2AA 3WK4A 1TAMA 3C29A 4JV1A 2E5SA 4KLHA 2Y9TA 3PMNA 1MN8A 8ICGA 1ZQCA 4P2HA 3GIMA 2EAPA 5KT3A 3M9OB 3KTQA 4I2CA 4ED6A 4EZ6A 2PKEA 1Z3EB 2RRDA 4X5VA 7ICSA 5KFCA 3M1YA 4F2SA 5KFZA 3HPOA 2VJ4A 2A3VA 3AL0B 3H0MB 2OYYA 8ICLA 2HDOA 4B9LA 4BWMA 2KFZA 4AYBC 4Y2XA 5J2FA 2FPKA 3H8WA 5BPCA 3GQCA 2E1EA 2Z7JA 4C4SA 2K4EA 2D3DA 1TAUA 1L6NA 3GILA 3PO4A 4DSIA 2I9GA 5AI0A 4B9UA 9ICUA 1ZQMA 4ECYA 3IG5A 5CWRA 5DKWA 4J9OA 4J9MA 5J0OA 2F1HA 3T5KA 4KLGA 2RDJA 3C1YA 3C5GA 3N4MB 1JUDA 2H3FA 2BQUA 2G5HB 2W7PA 3ZDBA 3RJJA 2DGZA 3M9MB 2BR0A 3OSNA 2RP5A 2NRWA 3VCBA 5KG7A 4E0DA 3GIIA 3RBEA 3JPQA 2N1RA 2LMRA 1ZQLA 4RU9A 7ICRA 1SV0A 4UB2A 1RDFA 1TK5A 1L3UA 5J0YA 5ALZA 4ED7A 3S6JA 2YB4A 1ECWA 3EPIA 4NV0A 1ZQVA 4ED2A 2VA2A 4AYBF 2KIWA 2IMWP 5KFBA 5J0UA 2G07A 1RZTA 4PPXA 1DGJA 5DGAA 2EANA 3R9KA 4NJ8A 5KFTA 2HOFA 2HHXA 3IRUA 3QU9A 1X9WA 2XY5A 4I28A 3ONNA 8ICZA 1L8OA 2WB1F 2VANA 2R8IA 4CGZA 3BDPA 7ICGA 2ZJAA 3ISCA 4P0QB 2XGQA 3QNMA 4ECQA 2KJ8A 3NVWA 1S5LU 3TADC 4EEYA 2HOQA 4CRXA 1X6IA 5JRTA 2DF4B 2LM4A 1K1SA 5ALGA 5AKGA 1BVSA 4M2YA 5J0RA 3H0LB 4EZ9A 4IR1A 3A0BU 3C2MA 2IOFK 4MFAA 3WKAA 3Q8RB 2D6FC 1GO3F 4DCCA 2AU0A 5D4BA 4C8KA 5DLFA 3WK6A 4P4OA 3BS7A 5AK5A 2K4HA 5L1JA 3PVXA 3V7JA 1T3QA 4FS2A 3NS1A 4QZGA 1QH9A 9ICXA 1ZYQA 2KICA 3KBBA 4DL2A 4GXKA 2HVHA 7ICKA 2WF7A 4QW8A 3TQ1A 4J9SA 4UB5A 4C8OA 5J0PA 1LB2B 5KFUA 7ICOA 1B43A 1JX4A 3C5FA 1ZQFA 2KTQA 1L5UA 3M9NB 3G6XA 4O3PA 1ZXIA 2KVSA 1KFTA 2KP7A 4R64A 1BNPA 2H3VA 1ZQBA 1K5OA 4QZFA 4U7CA 4YR0A 9ICBA 3K1ZA 2ZUBA 4B9NA 2WTFA 2FLNA 3FM9A 5IIIA 1QSSA 2PXIA 3ISDA 2JEJA 2E1FA 3V6HA 5ALHA 2C2EA 1H38A 1ZQZA 4USAA 2JMGA 4EBEA 1NZBA 2Q4TA 1MQ3A 4QWBA 4MF2A 1QCKA 1ZQPA 2YTUA 4JV2A 4IQTA 3D6JA 1D9FA 1HIWA 5JTIA 4UBBA 4RZRA 2ZIVA 3BS5A 5J8YC 1ZQQA 1C7YA 2ZIWB 5L9XA 4F71A 3AMZA 4O5CA 3EZ5A 5HMLA 2XICA 3RBDA 4OJPA 5EOZA 1L3TA 3RJKA 2JR5A 5AI5A 3NVVA 1X2IA 3MDAA 3M6ZA 3QUQA 4MEYA 1RM6C 4MHVA 3HJEA 2VA3A 4DO9A 3RB0A 2KOBA 2W43A 1U49A 8ICSA 1SKSA 1XSPA 2AQ4A 4ELVA 3KFUF 2H3ZA 2GWSA 4HYKA 2HHTA 5KFAA 3SV4A 1XS9D 2ZIUA 3G6VA 3T3FA 4DL4A 3QUCA 3I1YA 5AI8A 2BDUA 3AN1A 4QJFB 3QU5A 2DUYA 2NRTA 9ICVA 2R8GA 2HHWA 3OJSA 7ICEA 4GC6A 5IILA 3N7RC 4OO1J 4C8MA 5KFDA 4UAZA 2E8NA 3MC1A 3GIJA 1L3VA 4MF8A 1COOA 5DQIA 2RDIA 1ZQTA 2CPRA 3CYMA 1QSLA 2FMQA 9ICRA 4KX5A 1X9SA 5KFJA 1V9PA 8ICFA 3UQ2A 2ALZA 4FBUA 3BJYA 4NLKA 4BJQA 3EPGA 3GV5B 3HW8A 5HMMA 3LK9A 5DB9A 1SL1A 5KAIU 1YZ7A 3HWTA 2KFNA 4B9SA 2JXJA 1BNOA 2XY7A 3OSPA 4RQ8A 4NXZA 5BOLA 1KQQA 4KITB 4IR9A 2R18A 4RUCA 2NRXA 1ZQHA 2ODGA 5E79U 1QSYA 2ESEA 2W3SA 2EZXA 2WHEA 5J8YA 4PH5A 3Q8KA 3IM1A 3J81j 1PUZA 2EAOA 4RQ5A 2OM6A 2XY6A 4HAIA 3Q8QB 2UVWA 2A1JA 3BQ1A 2FJ6A 3OHBA 4KLLA 4IRKA 1N61A 1L7OA 5KFNA 3LWMA 5GTHU 3SQIA 2OCEA 9ICFA 4QZ8A 1YT3A 1V38A 5DB8A 1IV8A 2ZTDA 1S97A 4PL2A 4DQIA 9ICEA 3HILA 4RQMA 4C80A 4K4HA 8ICEA 1OXJA 4O5KA 3QEAZ 5ALUA 7ICVA 4RQ4A 4US9A 3BQ0A 1KW4A 1NJWA 4ECTA 5AIAA 2HI0A 2YY6A 5CB1A 4Q8EA 3TFSA 3D2NA 1ZQDA 1XSLA 3IG8A 4F4XA 4DL5A 3LWLA 5DDYA 4B9TA 2A19A 3QE9Y 3T5JA 9ICJA 2OXOA 1KBUA 2YN4A 4QIWF 2HCFA 1NNLA 4PZNA 2YMPA 4K4IA 3FYHA 1KN5A 5HHHA 1NK4A 5JUMA 3RR7A 4C0ZA 4M04A 2K60A 1T3NA 1ZRNA 3L4PA 3KHRA 5ALVA 2H5XA 1RQNA 2BCUA 3T79A 2BPGA 5AM1A 1TE2A 4Q43A 3SZ2A 3ZDAA 5AIBA 5ALQA 3U26A 4EYIB 4UARA 2C2DA 1TFRA 1ZQGA 2IHNA 9ICHA 4ECRA 8ICIA 2ZUDA 4CE6A 1DGSA 1SGGA 3ZD9A 1NZPA 5L1IA 2PI4A 3F2CA 3PW5A 4YR3A 1U47A 3UM9A 4BWJA 3QYPA 3IP4B 1JRPA 4UB6U 4CF5A 4KMUA 1NK7A 2KSOB 3BZKA 3JPOA 4DF8A 4ELUA 4EBDA 2MA1A 4XA5A 3N7PD 4BX9C 5KFVA 4DFKA 4PHEA 4RQ0A 3DDHA 3K1RB 2ZIUB 4K4GA 2KHVA 3RAQA 3HP6A 4KLEA 1FFVA 2HSZA 3JPRA 1AROP 1TAQA 9ICCA 1ZQEA 3H4DA 1D8LA 2F76X 3F53A 2MUTA 3TACB 4PGQA 2BHNA 4J9RA 9ICLA 4NL9A 3HKZC 1DK2A 1Q3VA 2KKPA 1BPBA 2IA6A 4JWNA 8ICBA 1YZ6A 3D2QA 2ISPA 4RQ1A 2V4RA 4DSFA 3F2DA 8ICAA 2VKQA 3ZDDA 1F0MA 1Z4NA 2NRVA 4OD0A 1NK6A 3KKAA 1UA0A 4ICAA 4QW9A 1A77A 5EWGA 9ICKA 1XSNA 4P0PB 4NLGA 5KFGA 4UAWA 1X6JA 2BGWA 2JH1A 4M0AA 1Z00A 4R63A 4F50A 4PHDA 3TFRA 3WU2U 1JALA 4YMOA 5AI4A 5ALWA 4DFDA 2A1AA 3PV8A 4QZAA 1T8EA 1ZRMA 1FFUA 5DB6A 5KTQA 5F9NA 2F8LA 3HKZF 3L5KA 2KD1A 2EH9A 5DB7A 1NOMA 2NO5A 5ALDA 5G5GA 3RB6A 3RRGA 1PZNA 3SAFA 2KMDA 4YD2A 2A1JB 4ZOHC 4DQRA 2LBOA 3ICXA 2WF8A 4PHPA 1WCLA 1NI3A 2Y1JA 1QQ6A 1SWWA 5F3XB 3KOOA 4R65A 3NRZA 1ZETA 1JN3A 1NK5A 2W9CA 5HR6A 5TZVA 4O3QA 5J2CA 2KJ5A 4MFCA 2HBJA 5J2GA 1T7PA 2C22A 4PGXA 7ICHA 5IIKA 3WK8A 1A6SA 4Y2PA 1PVQA 2F3NA 1Z4OA 2PI5A 5GTIU 1NK9A 1MC8A 2EAMA 1V97A 4YR2A 4DEZA 5KL8B 3ETLA 2XGPA 4Q45A 4XRHA 3LVWA 5D46A 4Z6CA 1KRPA 1S10A 3SYZA 3TAPA 4FE3A 1L3SA 1ZQNA 3UPQA 1FEZA 4YVZA 2BCSA 2JRZA 3GFKB 4B9VA 2W7OA 4KLIA 3QUBA 4DOAA 2PFOA 5ALTA 4QZEA 2AH5A 2F1IA 2IHMA 3EYZA 5AKIA 2CN1A 5ALXA 4LZDA 3GIKA 4NL9C 7ICLA 3C23A 1L7MA 3PX0A 3PY8A 5HP4A 1DRGA 2ASLA 5K4LA 4UATA 2W04A 3KKAC 1IIPA 2GH1A 4M9LA 3RH4A 2PMZC 1VLBA 5ALSA 3I28A 4RQ6A 2C28A 3N28A 4F2RA 3ORYA 1CI4A 2K89A 4GFJA 5B66U 3UMBA 2HBKA 4Q8FA 2ASDA 2K4IA 1RYSA 3NVYA 8ICYA 2W03A 3SAHA 3H0RB 1N60A 1WCNA 1ZD2P 4P0PA 5J0WA 4QZDA 1XC9A 3PX6A 1T94A 4OJOA 8ICWA 4EEKA 4IRCA 4ED3A 5KFQA 3O0FA 4UAUA 4I2BA 5AI9A 9ICTA 1S0OA 1DXSA 1ZJMA 2ZTCA 4CDGA 4PHAA 3MDCA 2ZIVB 3BS5B 4YP3A 2WFAA 2P66A 3PW7A 1LV5A 2M0NA 3JPTA 5JU5A 5IINA 2DPJA 8ICJA 1UQVA 4KLTA 3B9JA 3SV3A 1NK8A 4KX3A 1EXNA 2NYVA 2ZIXA 5CJ7A 2JGAA 3WKBA 4RPXA 2MAXA 1PVPA 4Y2JA 3WKEA 4F5QA 4QZIA 3FC4A 9ICIA 4Q44A 2KJ9A 9ICSA 3CP8A 4RQ3A 1COKA 3PSTA 4NLNA 2BKEA 2E8PA 2NO4A 3NGDA 2W9MA 1Z1VA 5CHGA 3ALRA 5ALIA 2YMQA 2YQEA 4Y2QA 2QB0A 1SKWA 4FS1A 4JUZA 3NASA 3C28A 4F91B 2PFNA 3MGHA 2JH7A 2DL0A 4ECVA 4F4YA 2JEFA 4QWCA 1BPDA 3SI8A 4UB8U 2C2RA 4PJ0U 3UXOA 5HNKA 4F4ZA 4KLJA 3JPSA 4XQ8A 3CNHA 3QZ7A 1B0XA 2FMSA 1JMSA 5KFSA 1HUZA 1SIJA 2ZXHA 4FO6A 2KKVA 2BQ3A 1ZQIA 3UXNA 1ZD5A 5TISU 1WWVA 2P6RA 1X9XA 2XCPA 4F5PA 7ICIA 4TUQA 5J2DA 1F5SA 4I2JA 2KG5A 5IIJA 4KLFA 7ICNA 4YG2A 4RQ2A 4I2FA 5AKLA 2AQ0A 5EE3A
chains in the Genus database with same CATH topology
2F1HA 3T5KA 2FLLA 4KLGA 3Q8PB 4EYIB 4ELTA 2RDJA 3AU6A 4TQRA 3C1YA 2C2DA 4EYHB 3C5GA 1Y88A 4DL6A 4DFJA 3N4MB 4KLMA 1TFRA 1IM4A 2FPMA 4YD1A 1ZQGA 2BQUA 2IHNA 9ICHA 1S0NA 4ECRA 4IRDA 3EW9A 8ICIA 4R66A 2BDPA 2ZUDA 2AGPA 4I2AA 8ICXA 3ZDBA 1DGSA 4M6WA 4KLQA 2KZ3A 3ZD9A 2PI4A 2KN7A 5L1IA 2JEGA 3RJJA 1NJYA 3M9MB 2BR0A 3OSNA 3MR5A 4YR3A 3PW5A 1U47A 5J2KA 2XO7A 1U4BA 2BPFA 2OWOA 2ZUCA 1TKDA 2NRWA 5EWFA 5KG7A 4F5OA 4E0DA 4BWJA 3GIIA 3RBEA 3HX0A 3JPQA 1SL0A 3V6JA 1KDHA 1JXLA 1ZQLA 9ICNA 4RU9A 5KT2A 1RXVA 4BXOA 4UB2A 4GXJA 7ICRA 1NKCA 4DSJA 3RJGA 1TK5A 1L3UA 5KFOA 5J0YA 2BQRA 4RNOA 4KMUA 3GV7B 4ED7A 1NK7A 8ICPA 3TAQA 4I2EA 3KHHA 3C21A 3JPOA 1BPZA 4DF8A 2HHUA 4LVSA 3EPIA 4ELUA 2HW3A 1ZQXA 1ZQVA 5KFHA 4EBDA 4XA5A 4ED2A 2Q0ZX 3RTVA 5CP2A 3MFHA 2VA2A 4YN4A 1KLNA 5KFRA 4TQSA 3MFIA 4O5EA 5CA7A 1ZQAA 8ICHA 5KFVA 2IMWP 5KFBA 5J0UA 4DFPA 4DFKA 2ZTEA 1RZTA 5KG6A 4BDPA 4PPXA 3JPNA 2R8KA 4PHEA 4RQ0A 8ICKA 4F5RA 5DGAA 2W9AA 4NM1A 4J9KA 4K4GA 9ICGA 5KFTA 3RAQA 3AUOA 4FBTA 2LYHA 1D8YA 1KFDA 2HHXA 3H7IA 4NY8A 1X9WA 2FLPA 2I1QA 2XY5A 3HP6A 3TARA 3RAXA 2B21A 3RR8A 4DQSA 4I28A 3RJFA 4KLEA 8ICZA 4YMNA 3C1ZA 4QZHA 4ECSA 3JPRA 1AROP 1TAQA 9ICCA 2VANA 4RT3A 5BOMA 3GDXA 2R8IA 5IIMA 3H4DA 1ZQEA 3BDPA 1D8LA 7ICGA 3MR3A 2MUTA 2ZJAA 3ISCA 2XGQA 1N56A 4PGQA 4J9RA 2BHNA 4IQWA 9ICLA 4ECQA 4YQWA 2V4QA 4I2GA 3MGIA 1U9LA 4EEYA 3K75D 4DWIA 2HHSA 1BPBA 2IA6A 5DGBA 4JWNA 8ICBA 1S0MA 2ISPA 4RQ1A 2V4RA 1K1SA 4DSFA 5C5JA 4Z6DA 1BGXT 4J9LA 4R8UA 3PW2A 1BVSA 4M2YA 8ICAA 5J0RA 3ZDDA 2NRVA 1NK6A 3HT3A 3TANA 4EZ9A 4IR1A 5L1KA 3C2MA 4MFAA 3PNCA 4RNMA 3Q8RB 1UA0A 4DF4A 2BCQA 4QW9A 1D9DA 1U45A 1A77A 5EWGA 3V72A 2AU0A 3RH6A 5D4BA 3T5HA 4C8KA 9ICKA 5DLFA 2JZBA 1XSNA 4NLGA 8ICRA 5KFGA 4UAWA 4P4OA 2BGWA 3H8JA 4M0AA 5L1JA 1Z00A 1JXEA 3K4GA 5DBCA 4R63A 4F50A 4PHDA 3V7JA 4RPZA 3TFRA 3PVXA 3OHAA 3LDAA 4FS2A 4YMOA 4QZGA 4DSEA 2J6UA 2UVRA 2UVUA 1ZYQA 9ICXA 4DL2A 2ISOA 7ICQA 2W8KA 9ICQA 3PV8A 4QZAA 4O3RA 1ZQYA 9ICWA 1T8EA 5KFYA 4GXKA 3ZDCA 2HVHA 3PO5A 1U48A 5KFIA 4QW8A 3TQ1A 7ICKA 4J9SA 5DB6A 3QEBZ 9ICOA 4UB5A 1T4GA 5KTQA 5F9NA 5J0PA 1LB2B 1ZQRA 4C8OA 2M9NA 5KFUA 4MFFA 7ICOA 5KG3A 1B43A 7ICJA 1JX4A 2AJQA 5KFKA 3C5FA 1ZQFA 2KTQA 8ICUA 5DLGA 4R8UB 4C8LA 1L5UA 5DB7A 3M9NB 2BCVA 1NOMA 4F92B 3RJHA 4B9MA 3G6XA 3MR2A 4O3SA 4QZ9A 4O3PA 3RB6A 5J2HA 1PZNA 4YMMA 3RRGA 5D49A 1KFTA 5KFWA 4XUSA 4YD2A 2A1JB 4R64A 4EBCA 3RJIA 4F93B 4DQRA 4P4PA 2Y1IA 3ZDEA 1ZQJA 2J6SA 5J29A 1MQ2A 1ZQBA 2PFPA 4PHPA 7ICMA 4QZFA 1WCLA 1QTMA 1DOQA 4YR0A 1TV9A 4DLEA 2Y1JA 1Z00B 3Q8SB 4UB3A 9ICBA 4R65A 1ZETA 1JN3A 2ZUBA 2DPIA 4I2HA 1NK5A 4B9NA 2W9CA 2FPLA 7ICFA 2V9WA 4KLSA 4JWMA 5TZVA 4O3QA 1XO1A 2WTFA 2BPCA 2FLNA 3MABA 4UBCA 2W9BA 3EWAA 5IIIA 5J2CA 1QSSA 4MFCA 1IXRA 5J2GA 2PXIA 1T7PA 3ISDA 2C22A 4PGXA 5KG1A 3PW0A 7ICHA 4I27A 4J9MA 5IIKA 4J9PA 2JEJA 2P6UA 5KT7A 3V6HA 2PI5A 5KG0A 2C2EA 1MC8A 1NK9A 3UQ0A 5J0TA 3PR4A 5J0QA 1H38A 1ZQZA 4YR2A 4EBEA 4DEZA 4I2IA 1NJXA 1MQ3A 1TVAA 3RRHA 3ETLA 1UT8A 2XGPA 4Q45A 4QWBA 4XRHA 4MF2A 4KTQA 1S77D 3IHQB 5D46A 4Z6CA 1XWLA 1HUOA 1BPXA 1KRPA 4DSLA 4O0IA 5KT6A 1UT5A 4Z6FA 1S10A 1ZQPA 5KFFA 3SYZA 3TAPA 4JV2A 1L3SA 4IQTA 4F4WA 1ZQNA 1ZQSA 3UPQA 1ZQKA 4F3OA 5KT4A 4YVZA 4ED8A 3THVA 2BCSA 1D9FA 1CEZA 3GFKB 2ZJ8A 4B9VA 4UBBA 3Q8LA 4RZRA 7ICTA 5CR0A 4F8RA 4KLIA 5IIOA 4DOAA 1ZQQA 2PFOA 2ATLA 3V6KA 1C7YA 3QZ8A 5L9XA 3MR6A 4DS4A 4GXIA 4O5CA 4QZEA 3EZ5A 2F1IA 2IHMA 3BQTA 5HMLA 4UQGA 3EYZA 3OJUA 1NKBA 5KG2A 2J6TA 4PGYA 4ECWA 3RBDA 4LZDA 3RB3A 1RPLA 3GIKA 5EOZA 1L3TA 7ICLA 3RJKA 9ICPA 3C23A 3PX0A 2BCRA 4TURA 4DL3A 7ICPA 3PY8A 1X2IA 5HP4A 4KLUA 4NLZA 3MDAA 5EWEA 5DBBA 4J9QA 3PX4A 2ASLA 4I29A 3RH5A 3M8SA 4O3NA 3NTUA 4MEYA 5DG8A 3RB4A 8ICTA 2VA3A 4DO9A 5KG5A 3RB0A 5J0SA 4M9LA 2KZMA 3RH4A 1U49A 2JEIA 8ICSA 1SKSA 1XSPA 2AQ4A 4ELVA 5DG9A 3C2LA 4QWAA 4ECUA 4RQ6A 1TK8A 2GWSA 4HYKA 1ZQWA 2C28A 5DQGA 2HHTA 3V7KA 5KFAA 3SV4A 2AGOA 1XS9D 1SKRA 5J2JA 1SZPA 4ECXA 4F2RA 4G3IA 3ORYA 4TUSA 2ZJ5A 3PMLA 3G6VA 3T3FA 4DL4A 4DSKA 3KHLA 2UVVA 2W9CB 4YFKA 3RJEA 5DQHA 4Q8FA 2ASDA 4M6WB 1RYSA 8ICYA 2R8JA 3JPPA 5J0XA 1WCNA 3H4BA 2JZBB 2NRTA 2KZZA 3UXPA 4GLXA 4YCXA 3PW4A 5J0WA 4QZDA 1XC9A 3PX6A 9ICVA 3BQ2A 3V7LA 1BPEA 2R8GA 2HHWA 3OJSA 1BPYA 4GC6A 7ICEA 5IILA 8ICWA 4YXJA 4C8MA 5KFDA 4UAZA 2PFQA 4IRCA 4ED0A 4ED3A 9ICMA 5KFQA 3PR5B 3GIJA 4ED1A 1NK0A 4MF8A 1L3VA 4I2BA 9ICTA 1COOA 5DQIA 4M9JA 1S0OA 2RDIA 5KFMA 2DFLA 1ZQTA 4BGDA 1HJPA 4DQPA 4C8NA 1ZJMA 8ICMA 1QSLA 2FMQA 4QZCA 9ICRA 2ZTCA 4Z6EA 2AGQA 1X9SA 4PHAA 5KFJA 1V9PA 3MDCA 4O3OA 3UQ2A 1TK0A 8ICFA 4YP3A 9ICAA 2P66A 2ALZA 2HHVA 2VA8A 4FBUA 3PW7A 3BJYA 4NLKA 3EPGA 1LV5A 3GV5B 1ZQOA 3HW8A 5F9LA 3T5LA 1A76A 3JPTA 5IINA 1KFSA 5HMMA 3LK9A 5DB9A 1X9MA 2DPJA 1SL1A 3MBYA 4KLTA 5HHIA 4UAYA 3HWTA 4RQ7A 2W8LA 3GV8B 4B9SA 1QLNA 2KFNA 1KTQA 4I2DA 3SV3A 1NK8A 1EXNA 4KLOA 2XY7A 1S0VA 3OSPA 4RQ8A 5CJ7A 4BXOB 5J2IA 4DS5A 4MEXA 4RPXA 4NXZA 5BOLA 2MAXA 4KITB 4IR9A 3H8SA 3H40A 4CCHA 4LZGA 4RUCA 2NRXA 4F5QA 4QZIA 1ZQHA 4F4KA 3B0YA 1S76D 4Q44A 9ICIA 9ICSA 1QSYA 4JV0A 4RQ3A 4QWEA 5KFXA 4ECZA 4YXMA 4NLNA 2BKEA 4F5NA 1RYRA 2R8HA 3B0XA 4KN7A 3NGDA 3N97B 3E2EA 2W9MA 4PH5A 3M8RA 3Q8KA 3IM1A 4GC7A 5DG7A 4RNNA 1KSPA 5CHGA 2HHQA 4RQ5A 2XY6A 4DLGA 3Q8QB 1ZJNA 1B22A 2UVWA 2A1JA 2NRZA 5KFPA 4FS1A 1SKWA 2XCAA 3BQ1A 3C2KA 8ICNA 8ICQA 5KT5A 5KFEA 4RPYA 3OHBA 3KHGA 1KEJA 4KLLA 2IBKA 4M9HA 4TUPA 4IRKA 5KFLA 2XC9A 1N48A 5KFNA 3LWMA 4JUZA 2HVIA 9ICFA 4F91B 4QZBA 2PFNA 1MSWD 4KLDA 4QZ8A 3MGHA 8ICJA 4JK1A 1NJZA 5DB8A 4J9NA 4DFMA 2FMPA 1ZQUA 2MUTB 4ECVA 2ZTDA 1S97A 5J2EA 1SL2A 4DQIA 9ICEA 4F4YA 4K4HA 1S9FA 8ICEA 1NKEA 2JEFA 4DL7A 4O5KA 3QEAZ 7ICVA 4QWCA 4DQQA 4RQ4A 4ZH4A 4P4MA 3BQ0A 1UA1A 1BPDA 3SI8A 4RT2A 4QWDA 4UB4A 4ECTA 1NJWA 8ICVA 4Q8EA 5CB1A 2C2RA 3TFSA 1ZQDA 5KG4A 2F1JA 1XSLA 5J2AA 4F4XA 3OGUA 3UXOA 3FDSA 4UB1A 3AU2A 4DOBA 4DL5A 3LWLA 4M9NA 5HNKA 3ISBA 4IQUA 5DDYA 4F4ZA 4B9TA 4JV1A 4M47A 3TI0A 5DDMA 4KLHA 4KLJA 3PMNA 3JPSA 3QE9Y 4XQ8A 3QZ7A 4IQVA 3T5JA 9ICJA 2FMSA 1JMSA 8ICGA 5KFSA 1HUZA 1ZQCA 4P2HA 5DBAA 4FO6A 3GIMA 3KTQA 5KT3A 3M9OB 4I2CA 8ICCA 4K4IA 3FYHA 4ED6A 5HHHA 4EZ6A 1Z3EB 4X5VA 2BQ3A 7ICSA 2ASJA 1NK4A 1CUKA 5JUMA 1ZQIA 3UXNA 5KFCA 3RR7A 4NM2A 4F2SA 4M9GA 5KFZA 3HPOA 3ZD8A 2P6RA 4M04A 4KN4A 8ICLA 4B9LA 4BWMA 1T3NA 2KFZA 2XCPA 4F5PA 7ICUA 5J2FA 7ICIA 2FPKA 1K1QA 3H8WA 4TUQA 5J2BA 3KHRA 4DOCA 5J2DA 5BPCA 3GQCA 2W9BB 2H5XA 2BCUA 4O9MA 4I2JA 1TAUA 1JIHA 3GILA 3PO4A 4DSIA 5IIJA 2BPGA 4KLFA 1XU4A 2I9GA 3Q8MA 4B9UA 4Q43A 4YG2A 7ICNA 3SZ2A 3ZDAA 4RQ2A 9ICUA 1ZQMA 4ECYA 1RXWA 5CWRA 5DKWA 4RUAA 3G6YA 4J9OA 4I2FA 5J0OA 5L1LA 2AQ0A 8ICOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F1H A;  3T5K A;  2FLL A;  4KLG A;  3Q8P B;  4EYI B;  4ELT A;  2RDJ A;  3AU6 A;  4TQR A;  3C1Y A;  2C2D A;  4EYH B;  3C5G A;  1Y88 A;  4DL6 A;  4DFJ A;  3N4M B;  4KLM A;  1TFR A;  1IM4 A;  2FPM A;  4YD1 A;  1ZQG A;  2BQU A;  2IHN A;  9ICH A;  1S0N A;  4ECR A;  4IRD A;  3EW9 A;  8ICI A;  4R66 A;  2BDP A;  2ZUD A;  2AGP A;  4I2A A;  8ICX A;  3ZDB A;  1DGS A;  4M6W A;  4KLQ A;  2KZ3 A;  3ZD9 A;  2PI4 A;  2KN7 A;  5L1I A;  2JEG A;  3RJJ A;  1NJY A;  3M9M B;  2BR0 A;  3OSN A;  3MR5 A;  4YR3 A;  3PW5 A;  1U47 A;  5J2K A;  2XO7 A;  1U4B A;  2BPF A;  2OWO A;  2ZUC A;  1TKD A;  2NRW A;  5EWF A;  5KG7 A;  4F5O A;  4E0D A;  4BWJ A;  3GII A;  3RBE A;  3HX0 A;  3JPQ A;  1SL0 A;  3V6J A;  1KDH A;  1JXL A;  1ZQL A;  9ICN A;  4RU9 A;  5KT2 A;  1RXV A;  4BXO A;  4UB2 A;  4GXJ A;  7ICR A;  1NKC A;  4DSJ A;  3RJG A;  1TK5 A;  1L3U A;  5KFO A;  5J0Y A;  2BQR A;  4RNO A;  4KMU A;  3GV7 B;  4ED7 A;  1NK7 A;  8ICP A;  3TAQ A;  4I2E A;  3KHH A;  3C21 A;  3JPO A;  1BPZ A;  4DF8 A;  2HHU A;  4LVS A;  3EPI A;  4ELU A;  2HW3 A;  1ZQX A;  1ZQV A;  5KFH A;  4EBD A;  4XA5 A;  4ED2 A;  2Q0Z X;  3RTV A;  5CP2 A;  3MFH A;  2VA2 A;  4YN4 A;  1KLN A;  5KFR A;  4TQS A;  3MFI A;  4O5E A;  5CA7 A;  1ZQA A;  8ICH A;  5KFV A;  2IMW P;  5KFB A;  5J0U A;  4DFP A;  4DFK A;  2ZTE A;  1RZT A;  5KG6 A;  4BDP A;  4PPX A;  3JPN A;  2R8K A;  4PHE A;  4RQ0 A;  8ICK A;  4F5R A;  5DGA A;  2W9A A;  4NM1 A;  4J9K A;  4K4G A;  9ICG A;  5KFT A;  3RAQ A;  3AUO A;  4FBT A;  2LYH A;  1D8Y A;  1KFD A;  2HHX A;  3H7I A;  4NY8 A;  1X9W A;  2FLP A;  2I1Q A;  2XY5 A;  3HP6 A;  3TAR A;  3RAX A;  2B21 A;  3RR8 A;  4DQS A;  4I28 A;  3RJF A;  4KLE A;  8ICZ A;  4YMN A;  3C1Z A;  4QZH A;  4ECS A;  3JPR A;  1ARO P;  1TAQ A;  9ICC A;  2VAN A;  4RT3 A;  5BOM A;  3GDX A;  2R8I A;  5IIM A;  3H4D A;  1ZQE A;  3BDP A;  1D8L A;  7ICG A;  3MR3 A;  2MUT A;  2ZJA A;  3ISC A;  2XGQ A;  1N56 A;  4PGQ A;  4J9R A;  2BHN A;  4IQW A;  9ICL A;  4ECQ A;  4YQW A;  2V4Q A;  4I2G A;  3MGI A;  1U9L A;  4EEY A;  3K75 D;  4DWI A;  2HHS A;  1BPB A;  2IA6 A;  5DGB A;  4JWN A;  8ICB A;  1S0M A;  2ISP A;  4RQ1 A;  2V4R A;  1K1S A;  4DSF A;  5C5J A;  4Z6D A;  1BGX T;  4J9L A;  4R8U A;  3PW2 A;  1BVS A;  4M2Y A;  8ICA A;  5J0R A;  3ZDD A;  2NRV A;  1NK6 A;  3HT3 A;  3TAN A;  4EZ9 A;  4IR1 A;  5L1K A;  3C2M A;  4MFA A;  3PNC A;  4RNM A;  3Q8R B;  1UA0 A;  4DF4 A;  2BCQ A;  4QW9 A;  1D9D A;  1U45 A;  1A77 A;  5EWG A;  3V72 A;  2AU0 A;  3RH6 A;  5D4B A;  3T5H A;  4C8K A;  9ICK A;  5DLF A;  2JZB A;  1XSN A;  4NLG A;  8ICR A;  5KFG A;  4UAW A;  4P4O A;  2BGW A;  3H8J A;  4M0A A;  5L1J A;  1Z00 A;  1JXE A;  3K4G A;  5DBC A;  4R63 A;  4F50 A;  4PHD A;  3V7J A;  4RPZ A;  3TFR A;  3PVX A;  3OHA A;  3LDA A;  4FS2 A;  4YMO A;  4QZG A;  4DSE A;  2J6U A;  2UVR A;  2UVU A;  1ZYQ A;  9ICX A;  4DL2 A;  2ISO A;  7ICQ A;  2W8K A;  9ICQ A;  3PV8 A;  4QZA A;  4O3R A;  1ZQY A;  9ICW A;  1T8E A;  5KFY A;  4GXK A;  3ZDC A;  2HVH A;  3PO5 A;  1U48 A;  5KFI A;  4QW8 A;  3TQ1 A;  7ICK A;  4J9S A;  5DB6 A;  3QEB Z;  9ICO A;  4UB5 A;  1T4G A;  5KTQ A;  5F9N A;  5J0P A;  1LB2 B;  1ZQR A;  4C8O A;  2M9N A;  5KFU A;  4MFF A;  7ICO A;  5KG3 A;  1B43 A;  7ICJ A;  1JX4 A;  2AJQ A;  5KFK A;  3C5F A;  1ZQF A;  2KTQ A;  8ICU A;  5DLG A;  4R8U B;  4C8L A;  1L5U A;  5DB7 A;  3M9N B;  2BCV A;  1NOM A;  4F92 B;  3RJH A;  4B9M A;  3G6X A;  3MR2 A;  4O3S A;  4QZ9 A;  4O3P A;  3RB6 A;  5J2H A;  1PZN A;  4YMM A;  3RRG A;  5D49 A;  1KFT A;  5KFW A;  4XUS A;  4YD2 A;  2A1J B;  4R64 A;  4EBC A;  3RJI A;  4F93 B;  4DQR A;  4P4P A;  2Y1I A;  3ZDE A;  1ZQJ A;  2J6S A;  5J29 A;  1MQ2 A;  1ZQB A;  2PFP A;  4PHP A;  7ICM A;  4QZF A;  1WCL A;  1QTM A;  1DOQ A;  4YR0 A;  1TV9 A;  4DLE A;  2Y1J A;  1Z00 B;  3Q8S B;  4UB3 A;  9ICB A;  4R65 A;  1ZET A;  1JN3 A;  2ZUB A;  2DPI A;  4I2H A;  1NK5 A;  4B9N A;  2W9C A;  2FPL A;  7ICF A;  2V9W A;  4KLS A;  4JWM A;  5TZV A;  4O3Q A;  1XO1 A;  2WTF A;  2BPC A;  2FLN A;  3MAB A;  4UBC A;  2W9B A;  3EWA A;  5III A;  5J2C A;  1QSS A;  4MFC A;  1IXR A;  5J2G A;  2PXI A;  1T7P A;  3ISD A;  2C22 A;  4PGX A;  5KG1 A;  3PW0 A;  7ICH A;  4I27 A;  4J9M A;  5IIK A;  4J9P A;  2JEJ A;  2P6U A;  5KT7 A;  3V6H A;  2PI5 A;  5KG0 A;  2C2E A;  1MC8 A;  1NK9 A;  3UQ0 A;  5J0T A;  3PR4 A;  5J0Q A;  1H38 A;  1ZQZ A;  4YR2 A;  4EBE A;  4DEZ A;  4I2I A;  1NJX A;  1MQ3 A;  1TVA A;  3RRH A;  3ETL A;  1UT8 A;  2XGP A;  4Q45 A;  4QWB A;  4XRH A;  4MF2 A;  4KTQ A;  1S77 D;  3IHQ B;  5D46 A;  4Z6C A;  1XWL A;  1HUO A;  1BPX A;  1KRP A;  4DSL A;  4O0I A;  5KT6 A;  1UT5 A;  4Z6F A;  1S10 A;  1ZQP A;  5KFF A;  3SYZ A;  3TAP A;  4JV2 A;  1L3S A;  4IQT A;  4F4W A;  1ZQN A;  1ZQS A;  3UPQ A;  1ZQK A;  4F3O A;  5KT4 A;  4YVZ A;  4ED8 A;  3THV A;  2BCS A;  1D9F A;  1CEZ A;  3GFK B;  2ZJ8 A;  4B9V A;  4UBB A;  3Q8L A;  4RZR A;  7ICT A;  5CR0 A;  4F8R A;  4KLI A;  5IIO A;  4DOA A;  1ZQQ A;  2PFO A;  2ATL A;  3V6K A;  1C7Y A;  3QZ8 A;  5L9X A;  3MR6 A;  4DS4 A;  4GXI A;  4O5C A;  4QZE A;  3EZ5 A;  2F1I A;  2IHM A;  3BQT A;  5HML A;  4UQG A;  3EYZ A;  3OJU A;  1NKB A;  5KG2 A;  2J6T A;  4PGY A;  4ECW A;  3RBD A;  4LZD A;  3RB3 A;  1RPL A;  3GIK A;  5EOZ A;  1L3T A;  7ICL A;  3RJK A;  9ICP A;  3C23 A;  3PX0 A;  2BCR A;  4TUR A;  4DL3 A;  7ICP A;  3PY8 A;  1X2I A;  5HP4 A;  4KLU A;  4NLZ A;  3MDA A;  5EWE A;  5DBB A;  4J9Q A;  3PX4 A;  2ASL A;  4I29 A;  3RH5 A;  3M8S A;  4O3N A;  3NTU A;  4MEY A;  5DG8 A;  3RB4 A;  8ICT A;  2VA3 A;  4DO9 A;  5KG5 A;  3RB0 A;  5J0S A;  4M9L A;  2KZM A;  3RH4 A;  1U49 A;  2JEI A;  8ICS A;  1SKS A;  1XSP A;  2AQ4 A;  4ELV A;  5DG9 A;  3C2L A;  4QWA A;  4ECU A;  4RQ6 A;  1TK8 A;  2GWS A;  4HYK A;  1ZQW A;  2C28 A;  5DQG A;  2HHT A;  3V7K A;  5KFA A;  3SV4 A;  2AGO A;  1XS9 D;  1SKR A;  5J2J A;  1SZP A;  4ECX A;  4F2R A;  4G3I A;  3ORY A;  4TUS A;  2ZJ5 A;  3PML A;  3G6V A;  3T3F A;  4DL4 A;  4DSK A;  3KHL A;  2UVV A;  2W9C B;  4YFK A;  3RJE A;  5DQH A;  4Q8F A;  2ASD A;  4M6W B;  1RYS A;  8ICY A;  2R8J A;  3JPP A;  5J0X A;  1WCN A;  3H4B A;  2JZB B;  2NRT A;  2KZZ A;  3UXP A;  4GLX A;  4YCX A;  3PW4 A;  5J0W A;  4QZD A;  1XC9 A;  3PX6 A;  9ICV A;  3BQ2 A;  3V7L A;  1BPE A;  2R8G A;  2HHW A;  3OJS A;  1BPY A;  4GC6 A;  7ICE A;  5IIL A;  8ICW A;  4YXJ A;  4C8M A;  5KFD A;  4UAZ A;  2PFQ A;  4IRC A;  4ED0 A;  4ED3 A;  9ICM A;  5KFQ A;  3PR5 B;  3GIJ A;  4ED1 A;  1NK0 A;  4MF8 A;  1L3V A;  4I2B A;  9ICT A;  1COO A;  5DQI A;  4M9J A;  1S0O A;  2RDI A;  5KFM A;  2DFL A;  1ZQT A;  4BGD A;  1HJP A;  4DQP A;  4C8N A;  1ZJM A;  8ICM A;  1QSL A;  2FMQ A;  4QZC A;  9ICR A;  2ZTC A;  4Z6E A;  2AGQ A;  1X9S A;  4PHA A;  5KFJ A;  1V9P A;  3MDC A;  4O3O A;  3UQ2 A;  1TK0 A;  8ICF A;  4YP3 A;  9ICA A;  2P66 A;  2ALZ A;  2HHV A;  2VA8 A;  4FBU A;  3PW7 A;  3BJY A;  4NLK A;  3EPG A;  1LV5 A;  3GV5 B;  1ZQO A;  3HW8 A;  5F9L A;  3T5L A;  1A76 A;  3JPT A;  5IIN A;  1KFS A;  5HMM A;  3LK9 A;  5DB9 A;  1X9M A;  2DPJ A;  1SL1 A;  3MBY A;  4KLT A;  5HHI A;  4UAY A;  3HWT A;  4RQ7 A;  2W8L A;  3GV8 B;  4B9S A;  1QLN A;  2KFN A;  1KTQ A;  4I2D A;  3SV3 A;  1NK8 A;  1EXN A;  4KLO A;  2XY7 A;  1S0V A;  3OSP A;  4RQ8 A;  5CJ7 A;  4BXO B;  5J2I A;  4DS5 A;  4MEX A;  4RPX A;  4NXZ A;  5BOL A;  2MAX A;  4KIT B;  4IR9 A;  3H8S A;  3H40 A;  4CCH A;  4LZG A;  4RUC A;  2NRX A;  4F5Q A;  4QZI A;  1ZQH A;  4F4K A;  3B0Y A;  1S76 D;  4Q44 A;  9ICI A;  9ICS A;  1QSY A;  4JV0 A;  4RQ3 A;  4QWE A;  5KFX A;  4ECZ A;  4YXM A;  4NLN A;  2BKE A;  4F5N A;  1RYR A;  2R8H A;  3B0X A;  4KN7 A;  3NGD A;  3N97 B;  3E2E A;  2W9M A;  4PH5 A;  3M8R A;  3Q8K A;  3IM1 A;  4GC7 A;  5DG7 A;  4RNN A;  1KSP A;  5CHG A;  2HHQ A;  4RQ5 A;  2XY6 A;  4DLG A;  3Q8Q B;  1ZJN A;  1B22 A;  2UVW A;  2A1J A;  2NRZ A;  5KFP A;  4FS1 A;  1SKW A;  2XCA A;  3BQ1 A;  3C2K A;  8ICN A;  8ICQ A;  5KT5 A;  5KFE A;  4RPY A;  3OHB A;  3KHG A;  1KEJ A;  4KLL A;  2IBK A;  4M9H A;  4TUP A;  4IRK A;  5KFL A;  2XC9 A;  1N48 A;  5KFN A;  3LWM A;  4JUZ A;  2HVI A;  9ICF A;  4F91 B;  4QZB A;  2PFN A;  1MSW D;  4KLD A;  4QZ8 A;  3MGH A;  8ICJ A;  4JK1 A;  1NJZ A;  5DB8 A;  4J9N A;  4DFM A;  2FMP A;  1ZQU A;  2MUT B;  4ECV A;  2ZTD A;  1S97 A;  5J2E A;  1SL2 A;  4DQI A;  9ICE A;  4F4Y A;  4K4H A;  1S9F A;  8ICE A;  1NKE A;  2JEF A;  4DL7 A;  4O5K A;  3QEA Z;  7ICV A;  4QWC A;  4DQQ A;  4RQ4 A;  4ZH4 A;  4P4M A;  3BQ0 A;  1UA1 A;  1BPD A;  3SI8 A;  4RT2 A;  4QWD A;  4UB4 A;  4ECT A;  1NJW A;  8ICV A;  4Q8E A;  5CB1 A;  2C2R A;  3TFS A;  1ZQD A;  5KG4 A;  2F1J A;  1XSL A;  5J2A A;  4F4X A;  3OGU A;  3UXO A;  3FDS A;  4UB1 A;  3AU2 A;  4DOB A;  4DL5 A;  3LWL A;  4M9N A;  5HNK A;  3ISB A;  4IQU A;  5DDY A;  4F4Z A;  4B9T A;  4JV1 A;  4M47 A;  3TI0 A;  5DDM A;  4KLH A;  4KLJ A;  3PMN A;  3JPS A;  3QE9 Y;  4XQ8 A;  3QZ7 A;  4IQV A;  3T5J A;  9ICJ A;  2FMS A;  1JMS A;  8ICG A;  5KFS A;  1HUZ A;  1ZQC A;  4P2H A;  5DBA A;  4FO6 A;  3GIM A;  3KTQ A;  5KT3 A;  3M9O B;  4I2C A;  8ICC A;  4K4I A;  3FYH A;  4ED6 A;  5HHH A;  4EZ6 A;  1Z3E B;  4X5V A;  2BQ3 A;  7ICS A;  2ASJ A;  1NK4 A;  1CUK A;  5JUM A;  1ZQI A;  3UXN A;  5KFC A;  3RR7 A;  4NM2 A;  4F2S A;  4M9G A;  5KFZ A;  3HPO A;  3ZD8 A;  2P6R A;  4M04 A;  4KN4 A;  8ICL A;  4B9L A;  4BWM A;  1T3N A;  2KFZ A;  2XCP A;  4F5P A;  7ICU A;  5J2F A;  7ICI A;  2FPK A;  1K1Q A;  3H8W A;  4TUQ A;  5J2B A;  3KHR A;  4DOC A;  5J2D A;  5BPC A;  3GQC A;  2W9B B;  2H5X A;  2BCU A;  4O9M A;  4I2J A;  1TAU A;  1JIH A;  3GIL A;  3PO4 A;  4DSI A;  5IIJ A;  2BPG A;  4KLF A;  1XU4 A;  2I9G A;  3Q8M A;  4B9U A;  4Q43 A;  4YG2 A;  7ICN A;  3SZ2 A;  3ZDA A;  4RQ2 A;  9ICU A;  1ZQM A;  4ECY A;  1RXW A;  5CWR A;  5DKW A;  4RUA A;  3G6Y A;  4J9O A;  4I2F A;  5J0O A;  5L1L A;  2AQ0 A;  8ICO A; 
#chains in the Genus database with same CATH topology
 2DKZ A;  3Q8P B;  4ELT A;  1D8B A;  2FI1 A;  4DFJ A;  1IM4 A;  2FPM A;  4YD1 A;  1RYU A;  2JV3 A;  1S0N A;  3M6K A;  4UW9 A;  3EW9 A;  4R66 A;  2BDP A;  4I2A A;  2O6K A;  5EE1 A;  2XVT A;  2F8K A;  2KHQ A;  2KVC A;  2KZ3 A;  2JEG A;  4FZN A;  3MR5 A;  2BPF A;  4JB3 A;  3HX0 A;  3V6J A;  1KDH A;  1JXL A;  9ICN A;  5KT2 A;  4GXJ A;  1NKC A;  4OJ5 A;  3GU3 A;  1AQ6 A;  5KFO A;  2BQR A;  3GV7 B;  8ICP A;  4I2E A;  1SXE A;  4LVS A;  2HW3 A;  1ZQX A;  2KV2 A;  2Q0Z X;  1URJ A;  1KLN A;  4TQS A;  3MFI A;  5CA7 A;  1ZQA A;  5KG6 A;  4BDP A;  8ICK A;  4G9B A;  4NM1 A;  4CF3 A;  4J9K A;  9ICG A;  2WAQ C;  4FBT A;  2LYH A;  2F2A B;  5ALO A;  3LYS A;  3H7I A;  3MGV A;  3TAR A;  2B21 A;  3RR8 A;  3ETR A;  3C1Z A;  4QZH A;  4QNL A;  1WUD A;  2IOF A;  5IIM A;  1F44 A;  3M7D A;  4YQW A;  2V4Q A;  4I2G A;  3UMC A;  2WF9 A;  5ALJ A;  1SV4 A;  2HHS A;  4RQN A;  1S0M A;  5AM0 A;  5C5J A;  4Z6D A;  3PW2 A;  4R8U A;  1ZQ1 C;  2EZY A;  3UMG A;  3ED5 A;  2LKY A;  3HT3 A;  3TAN A;  2W54 A;  5L1K A;  5AKJ A;  4RNM A;  4DF4 A;  1D9D A;  1U45 A;  3V72 A;  3T5H A;  2JZB A;  8ICR A;  2G06 A;  5ALE A;  1JXE A;  3K4G A;  5DBC A;  3BQ7 A;  1P7D A;  4RPZ A;  2UVR A;  2UVU A;  2KSO A;  2G5I B;  2ISO A;  2W8K A;  9ICQ A;  2W3R A;  1ZQY A;  5KFY A;  2HBL A;  2IOH A;  3PO5 A;  1S8O A;  5AKK A;  5KFI A;  2K4P A;  9ICO A;  1ZQR A;  4AP9 A;  2QLT A;  2M9N A;  4IL6 U;  5KFK A;  8ICU A;  4C8L A;  3RJH A;  4F92 B;  4O3S A;  3MR2 A;  4QZ9 A;  5J2H A;  5FP0 A;  2B6G A;  5D49 A;  1SZH A;  1WWU A;  4EBC A;  2DBY A;  4F93 B;  2AXT U;  2OHF A;  1ZQJ A;  5C0Y A;  2CRX A;  2PFP A;  3AEV A;  7ICM A;  3VC8 A;  1TV9 A;  1Z00 B;  4UB3 A;  5AKH A;  4PZO A;  4I2H A;  2YML A;  2FPL A;  7ICF A;  2V9W A;  4KLS A;  1XO1 A;  2BPC A;  2W9B A;  2Y9U A;  3OTQ A;  4FZM A;  1IXR A;  5KG1 A;  3N7S C;  3PW0 A;  4I27 A;  2P6U A;  4PL1 A;  3UQ0 A;  5J0Q A;  3TKA A;  3SMV A;  1O03 A;  1NJX A;  1TVA A;  3RRH A;  5L1M A;  1UT8 A;  1X42 A;  4KTQ A;  3NRW A;  5AK4 A;  4F72 A;  4DSL A;  1BPX A;  4O0I A;  4Z6F A;  1L7P A;  4F4W A;  1ZQS A;  3KZI U;  4ED8 A;  1CEZ A;  2G08 A;  5IIO A;  4Y2Y A;  2ATL A;  3V6K A;  2OEH A;  1OUQ A;  1OW5 A;  1Q46 A;  3MR6 A;  1UHU A;  4GXI A;  1HEK A;  3PSF A;  3RFA A;  5KG2 A;  2J6T A;  4PGY A;  4ECW A;  2DWQ A;  5AK3 A;  2F77 X;  5KL1 B;  1Q3U A;  2BCR A;  3AQE A;  4TUR A;  4DL3 A;  7ICP A;  2H3I A;  2Y0S F;  4KLU A;  5DBB A;  2HBM A;  3PX4 A;  2HOI A;  2K8A A;  4I29 A;  4O3N A;  3I76 A;  3NTU A;  1Q8K A;  3RB4 A;  1WYG A;  3QU7 A;  5ALK A;  5KG5 A;  2D8C A;  2JEI A;  4ECU A;  1V85 A;  3V7K A;  1N5X A;  2AGO A;  2PMZ F;  1JRO A;  5AKY A;  2G09 A;  4TUS A;  2ZJ5 A;  4DSK A;  1SV0 C;  3KHL A;  2W9C B;  4YFK A;  5DQH A;  4J03 A;  1XNS A;  3JPP A;  5J0X A;  4EX7 A;  1A0P A;  5AKE A;  3RF9 A;  3H4B A;  2JZB B;  5A0L A;  3UXP A;  4GLX A;  4YCX A;  3PW4 A;  3BQ2 A;  3V7L A;  1BPE A;  1BPY A;  1N5W A;  2PFQ A;  9ICM A;  4ED1 A;  3PR5 B;  4M9J A;  3IN5 A;  4BGD A;  4C8N A;  4QZC A;  4Z6E A;  3SAG A;  1J2M A;  2VJ5 A;  2WAQ F;  1TK0 A;  1DK3 A;  2HHV A;  1VDV A;  5H2F U;  3WKD A;  1ZQO A;  3T5L A;  1KFS A;  1X9M A;  5HHI A;  4UAY A;  4RQ7 A;  3GV8 B;  2K8C B;  1KTQ A;  4I2D A;  5AIC A;  2YB1 A;  1LKY A;  2L5Y A;  2KNJ A;  3TAD A;  4KLO A;  1PK3 A;  4BXO B;  5J2I A;  4DS5 A;  2CXY A;  3H8S A;  3H40 A;  3QX7 A;  2KE7 A;  4F4K A;  3B0Y A;  2K8B B;  5CRX A;  5AM3 A;  4JV0 A;  3WK9 A;  4YXM A;  5AKZ A;  5T14 A;  1RYR A;  2R8H A;  3E58 A;  1L8L A;  5G5H A;  3F2B A;  2XID A;  3E2E A;  2LHT A;  2FDR A;  2LM1 A;  3L3F X;  3QUT A;  1B22 A;  2NRZ A;  8ICN A;  2XCA A;  4ACO A;  8ICQ A;  5KT5 A;  5KFE A;  4RPY A;  1KEJ A;  4TUP A;  2AHO B;  4NWI A;  4QZB A;  2KEY A;  4KLD A;  4UAV A;  4J9N A;  4DFM A;  1ZQU A;  4P0Q A;  1FO4 A;  1S9F A;  4Y2U A;  4DL7 A;  4P4M A;  1LVH A;  8ICV A;  3CRX A;  5KG4 A;  2F1J A;  3QXG A;  4Y2S A;  4CF4 A;  3OGU A;  3FDS A;  4UB1 A;  3AU2 A;  4DOB A;  1SXD A;  4M9N A;  1ZD4 A;  4FFD A;  3ISB A;  3WK5 A;  2F44 A;  4IQU A;  4M47 A;  3TI0 A;  5DDM A;  2E3T A;  4IQV A;  4BUG A;  2EQY A;  2YX8 A;  3AM9 A;  1Z1B A;  5DBA A;  8ICC A;  2ZIX B;  5AHX A;  3WKC A;  2ASJ A;  1CUK A;  4NM2 A;  3PZP A;  4M9G A;  3ZD8 A;  3KD3 A;  4KN4 A;  7ICU A;  4US8 A;  1K1Q A;  5J2B A;  4DOC A;  2W9B B;  2MU2 A;  5ALR A;  4EEN A;  5ALY A;  4O9M A;  1JIH A;  3E0F A;  3DV9 A;  1XU4 A;  5ALN A;  4C7Y A;  3Q8M A;  1IG6 A;  1SWV A;  1O08 A;  1RXW A;  4RUA A;  3G6Y A;  5L1L A;  9ICP A;  2FLL A;  5CEH A;  3H8M A;  2QKQ A;  3CW2 C;  3BZC A;  3AU6 A;  4TQR A;  5EE0 A;  4EYH B;  2P35 A;  1Y88 A;  4DL6 A;  4KLM A;  2KIV A;  4OCZ A;  4IRD A;  2AGP A;  8ICX A;  1WG8 A;  2GO7 A;  4M6W A;  3WK7 A;  4KLQ A;  5ALP A;  3ZI4 A;  1PK1 A;  2KN7 A;  4EEL A;  1NJY A;  5J2K A;  2H3Q A;  2XO7 A;  1U4B A;  2OWO A;  2ZUC A;  1TKD A;  5EWF A;  4F5O A;  4B6J A;  1SL0 A;  1RXV A;  4BXO A;  4DSJ A;  3RJG A;  4OJL A;  4RNO A;  3TAQ A;  2ZXI A;  3KHH A;  3C21 A;  1BPZ A;  2HHU A;  5KFH A;  3RTV A;  5CP2 A;  3D2S A;  3MFH A;  4YN4 A;  5KFR A;  3F5A A;  4O5E A;  8ICH A;  1CRX A;  3HRD D;  3A0H U;  4DFP A;  8ICO A;  2WF6 A;  1J97 A;  2ZTE A;  2WF5 A;  1X66 A;  3JPN A;  2R8K A;  3SEN A;  4F5R A;  2W9A A;  2ZIW A;  3AUO A;  1D8Y A;  1KFD A;  2QB0 B;  4NY8 A;  4FZL A;  3SR6 A;  2FLP A;  3IDW A;  2I1Q A;  3RAX A;  2B0C A;  4DQS A;  3RJF A;  1Z19 A;  4YMN A;  4A8E A;  4ECS A;  4RT3 A;  5BOM A;  3GDX A;  1MA7 A;  3MR3 A;  2DKX A;  1N56 A;  2QAR A;  4IQW A;  1ZOL A;  3MGI A;  1U9L A;  3K75 D;  4DWI A;  2MRL A;  5DGB A;  1JI7 A;  2JHD A;  1BGX T;  4J9L A;  2FE9 A;  2HMX A;  4NLB A;  1PK1 B;  3PNC A;  1PVR A;  2BCQ A;  3KZX A;  4Y2V A;  3RH6 A;  3H8J A;  3OHA A;  3LDA A;  4DSE A;  2QB1 A;  2J6U A;  2VIX A;  7ICQ A;  4O3R A;  9ICW A;  2RLT A;  2GLE A;  3ZDC A;  5AM4 A;  2I5H A;  1U48 A;  3QU2 A;  3QEB Z;  1T4G A;  2I6X A;  4MFF A;  5KG3 A;  7ICJ A;  2AJQ A;  2DQN B;  5DLG A;  3OPX A;  4R8U B;  2BCV A;  4B9M A;  4YMM A;  5KFW A;  4XUS A;  3RJI A;  5AK6 A;  3F5E A;  4P4P A;  4IC9 A;  2Y1I A;  3ZDE A;  4NLC A;  5J29 A;  1QQ7 A;  1MQ2 A;  2J6S A;  5B5E U;  1QTM A;  1DOQ A;  4DLE A;  3Q8S B;  2LYB A;  3NVZ A;  2LYA A;  2E8O A;  2DPI A;  1UCV A;  2OH2 A;  4C7Z A;  4JWM A;  3MAB A;  4UBC A;  1RQL A;  3EWA A;  5AM5 A;  4J9P A;  5KT7 A;  5KG0 A;  5J0T A;  3PR4 A;  2EDU A;  4I2I A;  3FAH A;  2NV3 A;  1S77 D;  3IHQ B;  5ALL A;  1XWL A;  1HUO A;  5KT6 A;  1UT5 A;  2ZG6 A;  4JMU A;  1UPH A;  5KFF A;  4G3I A;  2RQ5 A;  1ZQK A;  4F3O A;  5KT4 A;  3THV A;  2ZJ8 A;  3Q8L A;  7ICT A;  5CR0 A;  4F8R A;  4UAS A;  3NUQ A;  3QZ8 A;  3EUB 2;  2G0A A;  4DS4 A;  2XI9 A;  4OJ6 A;  3BQT A;  1X40 A;  4UQG A;  3OJU A;  1NKB A;  2RHF A;  3RB3 A;  1RPL A;  2EZZ A;  1M6Y A;  1B4F A;  1VJ5 A;  3LVV A;  4NLZ A;  5EWE A;  4J9Q A;  3RH5 A;  3M8S A;  5DG8 A;  8ICT A;  3GZF A;  5J0S A;  2KZM A;  2KK0 A;  4QIW C;  5AM2 A;  2LI6 A;  5DG9 A;  4C4R A;  3C2L A;  4QWA A;  1TK8 A;  3IV6 A;  4C4T A;  1N2X A;  1ZQW A;  5DQG A;  1SKR A;  4GIB A;  5J2J A;  1SZP A;  2LPE A;  4ECX A;  1C20 A;  3PML A;  3QU4 A;  2UVV A;  3RJE A;  1QQ5 A;  4M6W B;  4U6P A;  2R8J A;  2KZZ A;  1L7N A;  4LJX A;  5KAF U;  4EX6 A;  4CNQ A;  2QAR B;  4YXJ A;  2MSN A;  2ES6 A;  4ED0 A;  1NK0 A;  2WB1 C;  2DFL A;  5KFM A;  1HJP A;  4DQP A;  8ICM A;  2AGQ A;  4O3O A;  9ICA A;  1SB3 C;  2VA8 A;  3PSP A;  2YMM A;  5F9L A;  1A76 A;  1KKX A;  4IS7 A;  2Y0S C;  1N63 A;  3MBY A;  2W8L A;  1QLN A;  5ALF A;  5AI6 A;  2E8M A;  1FIQ A;  1S0V A;  1RG6 A;  1ZD3 A;  4MEX A;  1N62 A;  4CCH A;  4LZG A;  1S76 D;  5EE9 A;  4KMO B;  4QWE A;  5KFX A;  5ALM A;  4ECZ A;  4F5N A;  2W55 A;  3B0X A;  3SEI A;  5HR7 A;  4KN7 A;  3N97 B;  3M8R A;  1J2N A;  4GC7 A;  3PSI A;  5DG7 A;  4RNN A;  1KSP A;  2HHQ A;  4DLG A;  1ZJN A;  4Y2T A;  5KFP A;  3C2K A;  3KHG A;  1LKY B;  2IBK A;  4M9H A;  5KFL A;  2XC9 A;  1ED1 A;  1N48 A;  2HVI A;  2GOL A;  5KNI A;  1MSW D;  4JK1 A;  1NJZ A;  2FMP A;  2MUT B;  3SD7 A;  5J2E A;  1SL2 A;  2BZF A;  5AKX A;  3AQF A;  4O3M A;  1NKE A;  1XO0 A;  2W11 A;  4DQQ A;  4ZH4 A;  1UA1 A;  1KL9 A;  4RT2 A;  4QWD A;  4UB4 A;  4WJ3 B;  4Y2R A;  3DEE A;  5J2A A;  3WK4 A;  1TAM A;  3C29 A;  4JV1 A;  2E5S A;  4KLH A;  2Y9T A;  3PMN A;  1MN8 A;  8ICG A;  1ZQC A;  4P2H A;  3GIM A;  2EAP A;  5KT3 A;  3M9O B;  3KTQ A;  4I2C A;  4ED6 A;  4EZ6 A;  2PKE A;  1Z3E B;  2RRD A;  4X5V A;  7ICS A;  5KFC A;  3M1Y A;  4F2S A;  5KFZ A;  3HPO A;  2VJ4 A;  2A3V A;  3AL0 B;  3H0M B;  2OYY A;  8ICL A;  2HDO A;  4B9L A;  4BWM A;  2KFZ A;  4AYB C;  4Y2X A;  5J2F A;  2FPK A;  3H8W A;  5BPC A;  3GQC A;  2E1E A;  2Z7J A;  4C4S A;  2K4E A;  2D3D A;  1TAU A;  1L6N A;  3GIL A;  3PO4 A;  4DSI A;  2I9G A;  5AI0 A;  4B9U A;  9ICU A;  1ZQM A;  4ECY A;  3IG5 A;  5CWR A;  5DKW A;  4J9O A;  4J9M A;  5J0O A;  2F1H A;  3T5K A;  4KLG A;  2RDJ A;  3C1Y A;  3C5G A;  3N4M B;  1JUD A;  2H3F A;  2BQU A;  2G5H B;  2W7P A;  3ZDB A;  3RJJ A;  2DGZ A;  3M9M B;  2BR0 A;  3OSN A;  2RP5 A;  2NRW A;  3VCB A;  5KG7 A;  4E0D A;  3GII A;  3RBE A;  3JPQ A;  2N1R A;  2LMR A;  1ZQL A;  4RU9 A;  7ICR A;  1SV0 A;  4UB2 A;  1RDF A;  1TK5 A;  1L3U A;  5J0Y A;  5ALZ A;  4ED7 A;  3S6J A;  2YB4 A;  1ECW A;  3EPI A;  4NV0 A;  1ZQV A;  4ED2 A;  2VA2 A;  4AYB F;  2KIW A;  2IMW P;  5KFB A;  5J0U A;  2G07 A;  1RZT A;  4PPX A;  1DGJ A;  5DGA A;  2EAN A;  3R9K A;  4NJ8 A;  5KFT A;  2HOF A;  2HHX A;  3IRU A;  3QU9 A;  1X9W A;  2XY5 A;  4I28 A;  3ONN A;  8ICZ A;  1L8O A;  2WB1 F;  2VAN A;  2R8I A;  4CGZ A;  3BDP A;  7ICG A;  2ZJA A;  3ISC A;  4P0Q B;  2XGQ A;  3QNM A;  4ECQ A;  2KJ8 A;  3NVW A;  1S5L U;  3TAD C;  4EEY A;  2HOQ A;  4CRX A;  1X6I A;  5JRT A;  2DF4 B;  2LM4 A;  1K1S A;  5ALG A;  5AKG A;  1BVS A;  4M2Y A;  5J0R A;  3H0L B;  4EZ9 A;  4IR1 A;  3A0B U;  3C2M A;  2IOF K;  4MFA A;  3WKA A;  3Q8R B;  2D6F C;  1GO3 F;  4DCC A;  2AU0 A;  5D4B A;  4C8K A;  5DLF A;  3WK6 A;  4P4O A;  3BS7 A;  5AK5 A;  2K4H A;  5L1J A;  3PVX A;  3V7J A;  1T3Q A;  4FS2 A;  3NS1 A;  4QZG A;  1QH9 A;  9ICX A;  1ZYQ A;  2KIC A;  3KBB A;  4DL2 A;  4GXK A;  2HVH A;  7ICK A;  2WF7 A;  4QW8 A;  3TQ1 A;  4J9S A;  4UB5 A;  4C8O A;  5J0P A;  1LB2 B;  5KFU A;  7ICO A;  1B43 A;  1JX4 A;  3C5F A;  1ZQF A;  2KTQ A;  1L5U A;  3M9N B;  3G6X A;  4O3P A;  1ZXI A;  2KVS A;  1KFT A;  2KP7 A;  4R64 A;  1BNP A;  2H3V A;  1ZQB A;  1K5O A;  4QZF A;  4U7C A;  4YR0 A;  9ICB A;  3K1Z A;  2ZUB A;  4B9N A;  2WTF A;  2FLN A;  3FM9 A;  5III A;  1QSS A;  2PXI A;  3ISD A;  2JEJ A;  2E1F A;  3V6H A;  5ALH A;  2C2E A;  1H38 A;  1ZQZ A;  4USA A;  2JMG A;  4EBE A;  1NZB A;  2Q4T A;  1MQ3 A;  4QWB A;  4MF2 A;  1QCK A;  1ZQP A;  2YTU A;  4JV2 A;  4IQT A;  3D6J A;  1D9F A;  1HIW A;  5JTI A;  4UBB A;  4RZR A;  2ZIV A;  3BS5 A;  5J8Y C;  1ZQQ A;  1C7Y A;  2ZIW B;  5L9X A;  4F71 A;  3AMZ A;  4O5C A;  3EZ5 A;  5HML A;  2XIC A;  3RBD A;  4OJP A;  5EOZ A;  1L3T A;  3RJK A;  2JR5 A;  5AI5 A;  3NVV A;  1X2I A;  3MDA A;  3M6Z A;  3QUQ A;  4MEY A;  1RM6 C;  4MHV A;  3HJE A;  2VA3 A;  4DO9 A;  3RB0 A;  2KOB A;  2W43 A;  1U49 A;  8ICS A;  1SKS A;  1XSP A;  2AQ4 A;  4ELV A;  3KFU F;  2H3Z A;  2GWS A;  4HYK A;  2HHT A;  5KFA A;  3SV4 A;  1XS9 D;  2ZIU A;  3G6V A;  3T3F A;  4DL4 A;  3QUC A;  3I1Y A;  5AI8 A;  2BDU A;  3AN1 A;  4QJF B;  3QU5 A;  2DUY A;  2NRT A;  9ICV A;  2R8G A;  2HHW A;  3OJS A;  7ICE A;  4GC6 A;  5IIL A;  3N7R C;  4OO1 J;  4C8M A;  5KFD A;  4UAZ A;  2E8N A;  3MC1 A;  3GIJ A;  1L3V A;  4MF8 A;  1COO A;  5DQI A;  2RDI A;  1ZQT A;  2CPR A;  3CYM A;  1QSL A;  2FMQ A;  9ICR A;  4KX5 A;  1X9S A;  5KFJ A;  1V9P A;  8ICF A;  3UQ2 A;  2ALZ A;  4FBU A;  3BJY A;  4NLK A;  4BJQ A;  3EPG A;  3GV5 B;  3HW8 A;  5HMM A;  3LK9 A;  5DB9 A;  1SL1 A;  5KAI U;  1YZ7 A;  3HWT A;  2KFN A;  4B9S A;  2JXJ A;  1BNO A;  2XY7 A;  3OSP A;  4RQ8 A;  4NXZ A;  5BOL A;  1KQQ A;  4KIT B;  4IR9 A;  2R18 A;  4RUC A;  2NRX A;  1ZQH A;  2ODG A;  5E79 U;  1QSY A;  2ESE A;  2W3S A;  2EZX A;  2WHE A;  5J8Y A;  4PH5 A;  3Q8K A;  3IM1 A;  3J81 j;  1PUZ A;  2EAO A;  4RQ5 A;  2OM6 A;  2XY6 A;  4HAI A;  3Q8Q B;  2UVW A;  2A1J A;  3BQ1 A;  2FJ6 A;  3OHB A;  4KLL A;  4IRK A;  1N61 A;  1L7O A;  5KFN A;  3LWM A;  5GTH U;  3SQI A;  2OCE A;  9ICF A;  4QZ8 A;  1YT3 A;  1V38 A;  5DB8 A;  1IV8 A;  2ZTD A;  1S97 A;  4PL2 A;  4DQI A;  9ICE A;  3HIL A;  4RQM A;  4C80 A;  4K4H A;  8ICE A;  1OXJ A;  4O5K A;  3QEA Z;  5ALU A;  7ICV A;  4RQ4 A;  4US9 A;  3BQ0 A;  1KW4 A;  1NJW A;  4ECT A;  5AIA A;  2HI0 A;  2YY6 A;  5CB1 A;  4Q8E A;  3TFS A;  3D2N A;  1ZQD A;  1XSL A;  3IG8 A;  4F4X A;  4DL5 A;  3LWL A;  5DDY A;  4B9T A;  2A19 A;  3QE9 Y;  3T5J A;  9ICJ A;  2OXO A;  1KBU A;  2YN4 A;  4QIW F;  2HCF A;  1NNL A;  4PZN A;  2YMP A;  4K4I A;  3FYH A;  1KN5 A;  5HHH A;  1NK4 A;  5JUM A;  3RR7 A;  4C0Z A;  4M04 A;  2K60 A;  1T3N A;  1ZRN A;  3L4P A;  3KHR A;  5ALV A;  2H5X A;  1RQN A;  2BCU A;  3T79 A;  2BPG A;  5AM1 A;  1TE2 A;  4Q43 A;  3SZ2 A;  3ZDA A;  5AIB A;  5ALQ A;  3U26 A;  4EYI B;  4UAR A;  2C2D A;  1TFR A;  1ZQG A;  2IHN A;  9ICH A;  4ECR A;  8ICI A;  2ZUD A;  4CE6 A;  1DGS A;  1SGG A;  3ZD9 A;  1NZP A;  5L1I A;  2PI4 A;  3F2C A;  3PW5 A;  4YR3 A;  1U47 A;  3UM9 A;  4BWJ A;  3QYP A;  3IP4 B;  1JRP A;  4UB6 U;  4CF5 A;  4KMU A;  1NK7 A;  2KSO B;  3BZK A;  3JPO A;  4DF8 A;  4ELU A;  4EBD A;  2MA1 A;  4XA5 A;  3N7P D;  4BX9 C;  5KFV A;  4DFK A;  4PHE A;  4RQ0 A;  3DDH A;  3K1R B;  2ZIU B;  4K4G A;  2KHV A;  3RAQ A;  3HP6 A;  4KLE A;  1FFV A;  2HSZ A;  3JPR A;  1ARO P;  1TAQ A;  9ICC A;  1ZQE A;  3H4D A;  1D8L A;  2F76 X;  3F53 A;  2MUT A;  3TAC B;  4PGQ A;  2BHN A;  4J9R A;  9ICL A;  4NL9 A;  3HKZ C;  1DK2 A;  1Q3V A;  2KKP A;  1BPB A;  2IA6 A;  4JWN A;  8ICB A;  1YZ6 A;  3D2Q A;  2ISP A;  4RQ1 A;  2V4R A;  4DSF A;  3F2D A;  8ICA A;  2VKQ A;  3ZDD A;  1F0M A;  1Z4N A;  2NRV A;  4OD0 A;  1NK6 A;  3KKA A;  1UA0 A;  4ICA A;  4QW9 A;  1A77 A;  5EWG A;  9ICK A;  1XSN A;  4P0P B;  4NLG A;  5KFG A;  4UAW A;  1X6J A;  2BGW A;  2JH1 A;  4M0A A;  1Z00 A;  4R63 A;  4F50 A;  4PHD A;  3TFR A;  3WU2 U;  1JAL A;  4YMO A;  5AI4 A;  5ALW A;  4DFD A;  2A1A A;  3PV8 A;  4QZA A;  1T8E A;  1ZRM A;  1FFU A;  5DB6 A;  5KTQ A;  5F9N A;  2F8L A;  3HKZ F;  3L5K A;  2KD1 A;  2EH9 A;  5DB7 A;  1NOM A;  2NO5 A;  5ALD A;  5G5G A;  3RB6 A;  3RRG A;  1PZN A;  3SAF A;  2KMD A;  4YD2 A;  2A1J B;  4ZOH C;  4DQR A;  2LBO A;  3ICX A;  2WF8 A;  4PHP A;  1WCL A;  1NI3 A;  2Y1J A;  1QQ6 A;  1SWW A;  5F3X B;  3KOO A;  4R65 A;  3NRZ A;  1ZET A;  1JN3 A;  1NK5 A;  2W9C A;  5HR6 A;  5TZV A;  4O3Q A;  5J2C A;  2KJ5 A;  4MFC A;  2HBJ A;  5J2G A;  1T7P A;  2C22 A;  4PGX A;  7ICH A;  5IIK A;  3WK8 A;  1A6S A;  4Y2P A;  1PVQ A;  2F3N A;  1Z4O A;  2PI5 A;  5GTI U;  1NK9 A;  1MC8 A;  2EAM A;  1V97 A;  4YR2 A;  4DEZ A;  5KL8 B;  3ETL A;  2XGP A;  4Q45 A;  4XRH A;  3LVW A;  5D46 A;  4Z6C A;  1KRP A;  1S10 A;  3SYZ A;  3TAP A;  4FE3 A;  1L3S A;  1ZQN A;  3UPQ A;  1FEZ A;  4YVZ A;  2BCS A;  2JRZ A;  3GFK B;  4B9V A;  2W7O A;  4KLI A;  3QUB A;  4DOA A;  2PFO A;  5ALT A;  4QZE A;  2AH5 A;  2F1I A;  2IHM A;  3EYZ A;  5AKI A;  2CN1 A;  5ALX A;  4LZD A;  3GIK A;  4NL9 C;  7ICL A;  3C23 A;  1L7M A;  3PX0 A;  3PY8 A;  5HP4 A;  1DRG A;  2ASL A;  5K4L A;  4UAT A;  2W04 A;  3KKA C;  1IIP A;  2GH1 A;  4M9L A;  3RH4 A;  2PMZ C;  1VLB A;  5ALS A;  3I28 A;  4RQ6 A;  2C28 A;  3N28 A;  4F2R A;  3ORY A;  1CI4 A;  2K89 A;  4GFJ A;  5B66 U;  3UMB A;  2HBK A;  4Q8F A;  2ASD A;  2K4I A;  1RYS A;  3NVY A;  8ICY A;  2W03 A;  3SAH A;  3H0R B;  1N60 A;  1WCN A;  1ZD2 P;  4P0P A;  5J0W A;  4QZD A;  1XC9 A;  3PX6 A;  1T94 A;  4OJO A;  8ICW A;  4EEK A;  4IRC A;  4ED3 A;  5KFQ A;  3O0F A;  4UAU A;  4I2B A;  5AI9 A;  9ICT A;  1S0O A;  1DXS A;  1ZJM A;  2ZTC A;  4CDG A;  4PHA A;  3MDC A;  2ZIV B;  3BS5 B;  4YP3 A;  2WFA A;  2P66 A;  3PW7 A;  1LV5 A;  2M0N A;  3JPT A;  5JU5 A;  5IIN A;  2DPJ A;  8ICJ A;  1UQV A;  4KLT A;  3B9J A;  3SV3 A;  1NK8 A;  4KX3 A;  1EXN A;  2NYV A;  2ZIX A;  5CJ7 A;  2JGA A;  3WKB A;  4RPX A;  2MAX A;  1PVP A;  4Y2J A;  3WKE A;  4F5Q A;  4QZI A;  3FC4 A;  9ICI A;  4Q44 A;  2KJ9 A;  9ICS A;  3CP8 A;  4RQ3 A;  1COK A;  3PST A;  4NLN A;  2BKE A;  2E8P A;  2NO4 A;  3NGD A;  2W9M A;  1Z1V A;  5CHG A;  3ALR A;  5ALI A;  2YMQ A;  2YQE A;  4Y2Q A;  2QB0 A;  1SKW A;  4FS1 A;  4JUZ A;  3NAS A;  3C28 A;  4F91 B;  2PFN A;  3MGH A;  2JH7 A;  2DL0 A;  4ECV A;  4F4Y A;  2JEF A;  4QWC A;  1BPD A;  3SI8 A;  4UB8 U;  2C2R A;  4PJ0 U;  3UXO A;  5HNK A;  4F4Z A;  4KLJ A;  3JPS A;  4XQ8 A;  3CNH A;  3QZ7 A;  1B0X A;  2FMS A;  1JMS A;  5KFS A;  1HUZ A;  1SIJ A;  2ZXH A;  4FO6 A;  2KKV A;  2BQ3 A;  1ZQI A;  3UXN A;  1ZD5 A;  5TIS U;  1WWV A;  2P6R A;  1X9X A;  2XCP A;  4F5P A;  7ICI A;  4TUQ A;  5J2D A;  1F5S A;  4I2J A;  2KG5 A;  5IIJ A;  4KLF A;  7ICN A;  4YG2 A;  4RQ2 A;  4I2F A;  5AKL A;  2AQ0 A;  5EE3 A; 
#chains in the Genus database with same CATH homology
 2F1H A;  3T5K A;  2FLL A;  4KLG A;  3Q8P B;  4EYI B;  4ELT A;  2RDJ A;  3AU6 A;  4TQR A;  3C1Y A;  2C2D A;  4EYH B;  3C5G A;  1Y88 A;  4DL6 A;  4DFJ A;  3N4M B;  4KLM A;  1TFR A;  1IM4 A;  2FPM A;  4YD1 A;  1ZQG A;  2BQU A;  2IHN A;  9ICH A;  1S0N A;  4ECR A;  4IRD A;  3EW9 A;  8ICI A;  4R66 A;  2BDP A;  2ZUD A;  2AGP A;  4I2A A;  8ICX A;  3ZDB A;  1DGS A;  4M6W A;  4KLQ A;  2KZ3 A;  3ZD9 A;  2PI4 A;  2KN7 A;  5L1I A;  2JEG A;  3RJJ A;  1NJY A;  3M9M B;  2BR0 A;  3OSN A;  3MR5 A;  4YR3 A;  3PW5 A;  1U47 A;  5J2K A;  2XO7 A;  1U4B A;  2BPF A;  2OWO A;  2ZUC A;  1TKD A;  2NRW A;  5EWF A;  5KG7 A;  4F5O A;  4E0D A;  4BWJ A;  3GII A;  3RBE A;  3HX0 A;  3JPQ A;  1SL0 A;  3V6J A;  1KDH A;  1JXL A;  1ZQL A;  9ICN A;  4RU9 A;  5KT2 A;  1RXV A;  4BXO A;  4UB2 A;  4GXJ A;  7ICR A;  1NKC A;  4DSJ A;  3RJG A;  1TK5 A;  1L3U A;  5KFO A;  5J0Y A;  2BQR A;  4RNO A;  4KMU A;  3GV7 B;  4ED7 A;  1NK7 A;  8ICP A;  3TAQ A;  4I2E A;  3KHH A;  3C21 A;  3JPO A;  1BPZ A;  4DF8 A;  2HHU A;  4LVS A;  3EPI A;  4ELU A;  2HW3 A;  1ZQX A;  1ZQV A;  5KFH A;  4EBD A;  4XA5 A;  4ED2 A;  2Q0Z X;  3RTV A;  5CP2 A;  3MFH A;  2VA2 A;  4YN4 A;  1KLN A;  5KFR A;  4TQS A;  3MFI A;  4O5E A;  5CA7 A;  1ZQA A;  8ICH A;  5KFV A;  2IMW P;  5KFB A;  5J0U A;  4DFP A;  4DFK A;  2ZTE A;  1RZT A;  5KG6 A;  4BDP A;  4PPX A;  3JPN A;  2R8K A;  4PHE A;  4RQ0 A;  8ICK A;  4F5R A;  5DGA A;  2W9A A;  4NM1 A;  4J9K A;  4K4G A;  9ICG A;  5KFT A;  3RAQ A;  3AUO A;  4FBT A;  2LYH A;  1D8Y A;  1KFD A;  2HHX A;  3H7I A;  4NY8 A;  1X9W A;  2FLP A;  2I1Q A;  2XY5 A;  3HP6 A;  3TAR A;  3RAX A;  2B21 A;  3RR8 A;  4DQS A;  4I28 A;  3RJF A;  4KLE A;  8ICZ A;  4YMN A;  3C1Z A;  4QZH A;  4ECS A;  3JPR A;  1ARO P;  1TAQ A;  9ICC A;  2VAN A;  4RT3 A;  5BOM A;  3GDX A;  2R8I A;  5IIM A;  3H4D A;  1ZQE A;  3BDP A;  1D8L A;  7ICG A;  3MR3 A;  2MUT A;  2ZJA A;  3ISC A;  2XGQ A;  1N56 A;  4PGQ A;  4J9R A;  2BHN A;  4IQW A;  9ICL A;  4ECQ A;  4YQW A;  2V4Q A;  4I2G A;  3MGI A;  1U9L A;  4EEY A;  3K75 D;  4DWI A;  2HHS A;  1BPB A;  2IA6 A;  5DGB A;  4JWN A;  8ICB A;  1S0M A;  2ISP A;  4RQ1 A;  2V4R A;  1K1S A;  4DSF A;  5C5J A;  4Z6D A;  1BGX T;  4J9L A;  4R8U A;  3PW2 A;  1BVS A;  4M2Y A;  8ICA A;  5J0R A;  3ZDD A;  2NRV A;  1NK6 A;  3HT3 A;  3TAN A;  4EZ9 A;  4IR1 A;  5L1K A;  3C2M A;  4MFA A;  3PNC A;  4RNM A;  3Q8R B;  1UA0 A;  4DF4 A;  2BCQ A;  4QW9 A;  1D9D A;  1U45 A;  1A77 A;  5EWG A;  3V72 A;  2AU0 A;  3RH6 A;  5D4B A;  3T5H A;  4C8K A;  9ICK A;  5DLF A;  2JZB A;  1XSN A;  4NLG A;  8ICR A;  5KFG A;  4UAW A;  4P4O A;  2BGW A;  3H8J A;  4M0A A;  5L1J A;  1Z00 A;  1JXE A;  3K4G A;  5DBC A;  4R63 A;  4F50 A;  4PHD A;  3V7J A;  4RPZ A;  3TFR A;  3PVX A;  3OHA A;  3LDA A;  4FS2 A;  4YMO A;  4QZG A;  4DSE A;  2J6U A;  2UVR A;  2UVU A;  1ZYQ A;  9ICX A;  4DL2 A;  2ISO A;  7ICQ A;  2W8K A;  9ICQ A;  3PV8 A;  4QZA A;  4O3R A;  1ZQY A;  9ICW A;  1T8E A;  5KFY A;  4GXK A;  3ZDC A;  2HVH A;  3PO5 A;  1U48 A;  5KFI A;  4QW8 A;  3TQ1 A;  7ICK A;  4J9S A;  5DB6 A;  3QEB Z;  9ICO A;  4UB5 A;  1T4G A;  5KTQ A;  5F9N A;  5J0P A;  1LB2 B;  1ZQR A;  4C8O A;  2M9N A;  5KFU A;  4MFF A;  7ICO A;  5KG3 A;  1B43 A;  7ICJ A;  1JX4 A;  2AJQ A;  5KFK A;  3C5F A;  1ZQF A;  2KTQ A;  8ICU A;  5DLG A;  4R8U B;  4C8L A;  1L5U A;  5DB7 A;  3M9N B;  2BCV A;  1NOM A;  4F92 B;  3RJH A;  4B9M A;  3G6X A;  3MR2 A;  4O3S A;  4QZ9 A;  4O3P A;  3RB6 A;  5J2H A;  1PZN A;  4YMM A;  3RRG A;  5D49 A;  1KFT A;  5KFW A;  4XUS A;  4YD2 A;  2A1J B;  4R64 A;  4EBC A;  3RJI A;  4F93 B;  4DQR A;  4P4P A;  2Y1I A;  3ZDE A;  1ZQJ A;  2J6S A;  5J29 A;  1MQ2 A;  1ZQB A;  2PFP A;  4PHP A;  7ICM A;  4QZF A;  1WCL A;  1QTM A;  1DOQ A;  4YR0 A;  1TV9 A;  4DLE A;  2Y1J A;  1Z00 B;  3Q8S B;  4UB3 A;  9ICB A;  4R65 A;  1ZET A;  1JN3 A;  2ZUB A;  2DPI A;  4I2H A;  1NK5 A;  4B9N A;  2W9C A;  2FPL A;  7ICF A;  2V9W A;  4KLS A;  4JWM A;  5TZV A;  4O3Q A;  1XO1 A;  2WTF A;  2BPC A;  2FLN A;  3MAB A;  4UBC A;  2W9B A;  3EWA A;  5III A;  5J2C A;  1QSS A;  4MFC A;  1IXR A;  5J2G A;  2PXI A;  1T7P A;  3ISD A;  2C22 A;  4PGX A;  5KG1 A;  3PW0 A;  7ICH A;  4I27 A;  4J9M A;  5IIK A;  4J9P A;  2JEJ A;  2P6U A;  5KT7 A;  3V6H A;  2PI5 A;  5KG0 A;  2C2E A;  1MC8 A;  1NK9 A;  3UQ0 A;  5J0T A;  3PR4 A;  5J0Q A;  1H38 A;  1ZQZ A;  4YR2 A;  4EBE A;  4DEZ A;  4I2I A;  1NJX A;  1MQ3 A;  1TVA A;  3RRH A;  3ETL A;  1UT8 A;  2XGP A;  4Q45 A;  4QWB A;  4XRH A;  4MF2 A;  4KTQ A;  1S77 D;  3IHQ B;  5D46 A;  4Z6C A;  1XWL A;  1HUO A;  1BPX A;  1KRP A;  4DSL A;  4O0I A;  5KT6 A;  1UT5 A;  4Z6F A;  1S10 A;  1ZQP A;  5KFF A;  3SYZ A;  3TAP A;  4JV2 A;  1L3S A;  4IQT A;  4F4W A;  1ZQN A;  1ZQS A;  3UPQ A;  1ZQK A;  4F3O A;  5KT4 A;  4YVZ A;  4ED8 A;  3THV A;  2BCS A;  1D9F A;  1CEZ A;  3GFK B;  2ZJ8 A;  4B9V A;  4UBB A;  3Q8L A;  4RZR A;  7ICT A;  5CR0 A;  4F8R A;  4KLI A;  5IIO A;  4DOA A;  1ZQQ A;  2PFO A;  2ATL A;  3V6K A;  1C7Y A;  3QZ8 A;  5L9X A;  3MR6 A;  4DS4 A;  4GXI A;  4O5C A;  4QZE A;  3EZ5 A;  2F1I A;  2IHM A;  3BQT A;  5HML A;  4UQG A;  3EYZ A;  3OJU A;  1NKB A;  5KG2 A;  2J6T A;  4PGY A;  4ECW A;  3RBD A;  4LZD A;  3RB3 A;  1RPL A;  3GIK A;  5EOZ A;  1L3T A;  7ICL A;  3RJK A;  9ICP A;  3C23 A;  3PX0 A;  2BCR A;  4TUR A;  4DL3 A;  7ICP A;  3PY8 A;  1X2I A;  5HP4 A;  4KLU A;  4NLZ A;  3MDA A;  5EWE A;  5DBB A;  4J9Q A;  3PX4 A;  2ASL A;  4I29 A;  3RH5 A;  3M8S A;  4O3N A;  3NTU A;  4MEY A;  5DG8 A;  3RB4 A;  8ICT A;  2VA3 A;  4DO9 A;  5KG5 A;  3RB0 A;  5J0S A;  4M9L A;  2KZM A;  3RH4 A;  1U49 A;  2JEI A;  8ICS A;  1SKS A;  1XSP A;  2AQ4 A;  4ELV A;  5DG9 A;  3C2L A;  4QWA A;  4ECU A;  4RQ6 A;  1TK8 A;  2GWS A;  4HYK A;  1ZQW A;  2C28 A;  5DQG A;  2HHT A;  3V7K A;  5KFA A;  3SV4 A;  2AGO A;  1XS9 D;  1SKR A;  5J2J A;  1SZP A;  4ECX A;  4F2R A;  4G3I A;  3ORY A;  4TUS A;  2ZJ5 A;  3PML A;  3G6V A;  3T3F A;  4DL4 A;  4DSK A;  3KHL A;  2UVV A;  2W9C B;  4YFK A;  3RJE A;  5DQH A;  4Q8F A;  2ASD A;  4M6W B;  1RYS A;  8ICY A;  2R8J A;  3JPP A;  5J0X A;  1WCN A;  3H4B A;  2JZB B;  2NRT A;  2KZZ A;  3UXP A;  4GLX A;  4YCX A;  3PW4 A;  5J0W A;  4QZD A;  1XC9 A;  3PX6 A;  9ICV A;  3BQ2 A;  3V7L A;  1BPE A;  2R8G A;  2HHW A;  3OJS A;  1BPY A;  4GC6 A;  7ICE A;  5IIL A;  8ICW A;  4YXJ A;  4C8M A;  5KFD A;  4UAZ A;  2PFQ A;  4IRC A;  4ED0 A;  4ED3 A;  9ICM A;  5KFQ A;  3PR5 B;  3GIJ A;  4ED1 A;  1NK0 A;  4MF8 A;  1L3V A;  4I2B A;  9ICT A;  1COO A;  5DQI A;  4M9J A;  1S0O A;  2RDI A;  5KFM A;  2DFL A;  1ZQT A;  4BGD A;  1HJP A;  4DQP A;  4C8N A;  1ZJM A;  8ICM A;  1QSL A;  2FMQ A;  4QZC A;  9ICR A;  2ZTC A;  4Z6E A;  2AGQ A;  1X9S A;  4PHA A;  5KFJ A;  1V9P A;  3MDC A;  4O3O A;  3UQ2 A;  1TK0 A;  8ICF A;  4YP3 A;  9ICA A;  2P66 A;  2ALZ A;  2HHV A;  2VA8 A;  4FBU A;  3PW7 A;  3BJY A;  4NLK A;  3EPG A;  1LV5 A;  3GV5 B;  1ZQO A;  3HW8 A;  5F9L A;  3T5L A;  1A76 A;  3JPT A;  5IIN A;  1KFS A;  5HMM A;  3LK9 A;  5DB9 A;  1X9M A;  2DPJ A;  1SL1 A;  3MBY A;  4KLT A;  5HHI A;  4UAY A;  3HWT A;  4RQ7 A;  2W8L A;  3GV8 B;  4B9S A;  1QLN A;  2KFN A;  1KTQ A;  4I2D A;  3SV3 A;  1NK8 A;  1EXN A;  4KLO A;  2XY7 A;  1S0V A;  3OSP A;  4RQ8 A;  5CJ7 A;  4BXO B;  5J2I A;  4DS5 A;  4MEX A;  4RPX A;  4NXZ A;  5BOL A;  2MAX A;  4KIT B;  4IR9 A;  3H8S A;  3H40 A;  4CCH A;  4LZG A;  4RUC A;  2NRX A;  4F5Q A;  4QZI A;  1ZQH A;  4F4K A;  3B0Y A;  1S76 D;  4Q44 A;  9ICI A;  9ICS A;  1QSY A;  4JV0 A;  4RQ3 A;  4QWE A;  5KFX A;  4ECZ A;  4YXM A;  4NLN A;  2BKE A;  4F5N A;  1RYR A;  2R8H A;  3B0X A;  4KN7 A;  3NGD A;  3N97 B;  3E2E A;  2W9M A;  4PH5 A;  3M8R A;  3Q8K A;  3IM1 A;  4GC7 A;  5DG7 A;  4RNN A;  1KSP A;  5CHG A;  2HHQ A;  4RQ5 A;  2XY6 A;  4DLG A;  3Q8Q B;  1ZJN A;  1B22 A;  2UVW A;  2A1J A;  2NRZ A;  5KFP A;  4FS1 A;  1SKW A;  2XCA A;  3BQ1 A;  3C2K A;  8ICN A;  8ICQ A;  5KT5 A;  5KFE A;  4RPY A;  3OHB A;  3KHG A;  1KEJ A;  4KLL A;  2IBK A;  4M9H A;  4TUP A;  4IRK A;  5KFL A;  2XC9 A;  1N48 A;  5KFN A;  3LWM A;  4JUZ A;  2HVI A;  9ICF A;  4F91 B;  4QZB A;  2PFN A;  1MSW D;  4KLD A;  4QZ8 A;  3MGH A;  8ICJ A;  4JK1 A;  1NJZ A;  5DB8 A;  4J9N A;  4DFM A;  2FMP A;  1ZQU A;  2MUT B;  4ECV A;  2ZTD A;  1S97 A;  5J2E A;  1SL2 A;  4DQI A;  9ICE A;  4F4Y A;  4K4H A;  1S9F A;  8ICE A;  1NKE A;  2JEF A;  4DL7 A;  4O5K A;  3QEA Z;  7ICV A;  4QWC A;  4DQQ A;  4RQ4 A;  4ZH4 A;  4P4M A;  3BQ0 A;  1UA1 A;  1BPD A;  3SI8 A;  4RT2 A;  4QWD A;  4UB4 A;  4ECT A;  1NJW A;  8ICV A;  4Q8E A;  5CB1 A;  2C2R A;  3TFS A;  1ZQD A;  5KG4 A;  2F1J A;  1XSL A;  5J2A A;  4F4X A;  3OGU A;  3UXO A;  3FDS A;  4UB1 A;  3AU2 A;  4DOB A;  4DL5 A;  3LWL A;  4M9N A;  5HNK A;  3ISB A;  4IQU A;  5DDY A;  4F4Z A;  4B9T A;  4JV1 A;  4M47 A;  3TI0 A;  5DDM A;  4KLH A;  4KLJ A;  3PMN A;  3JPS A;  3QE9 Y;  4XQ8 A;  3QZ7 A;  4IQV A;  3T5J A;  9ICJ A;  2FMS A;  1JMS A;  8ICG A;  5KFS A;  1HUZ A;  1ZQC A;  4P2H A;  5DBA A;  4FO6 A;  3GIM A;  3KTQ A;  5KT3 A;  3M9O B;  4I2C A;  8ICC A;  4K4I A;  3FYH A;  4ED6 A;  5HHH A;  4EZ6 A;  1Z3E B;  4X5V A;  2BQ3 A;  7ICS A;  2ASJ A;  1NK4 A;  1CUK A;  5JUM A;  1ZQI A;  3UXN A;  5KFC A;  3RR7 A;  4NM2 A;  4F2S A;  4M9G A;  5KFZ A;  3HPO A;  3ZD8 A;  2P6R A;  4M04 A;  4KN4 A;  8ICL A;  4B9L A;  4BWM A;  1T3N A;  2KFZ A;  2XCP A;  4F5P A;  7ICU A;  5J2F A;  7ICI A;  2FPK A;  1K1Q A;  3H8W A;  4TUQ A;  5J2B A;  3KHR A;  4DOC A;  5J2D A;  5BPC A;  3GQC A;  2W9B B;  2H5X A;  2BCU A;  4O9M A;  4I2J A;  1TAU A;  1JIH A;  3GIL A;  3PO4 A;  4DSI A;  5IIJ A;  2BPG A;  4KLF A;  1XU4 A;  2I9G A;  3Q8M A;  4B9U A;  4Q43 A;  4YG2 A;  7ICN A;  3SZ2 A;  3ZDA A;  4RQ2 A;  9ICU A;  1ZQM A;  4ECY A;  1RXW A;  5CWR A;  5DKW A;  4RUA A;  3G6Y A;  4J9O A;  4I2F A;  5J0O A;  5L1L A;  2AQ0 A;  8ICO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...