3GFKB

Crystal structure of bacillus subtilis spx/rna polymerase alpha subunit c-terminal domain complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
76
structure length
76
Chain Sequence
GPHMKEEDQKEKVLEMTIEELDLSVRSYNCLKRAGINTVQELANKTEEDMMKVRNLGRKSLEEVKAKLEELGLGLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the in vivo-assembled Bacillus subtilis Spx/RNA polymerase alpha subunit C-terminal domain complex
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription/transferase
molecule keywords Regulatory protein spx
total genus 26
structure length 76
sequence length 76
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2009-02-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3gfkB00
4DLEA 4KLSA 2BPCA 3H7IA 3OHAA 4I2HA 4DSIA 2RDJA 4QZBA 3KTQA 5KFNA 5KFDA 3RRHA 9ICXA 5BOLA 4YD2A 2KZMA 4DOCA 5J0WA 4DFJA 2Q0ZX 1XSLA 1DOQA 4F5NA 3OHBA 4J9LA 1S0NA 4KITB 4Z6FA 1S77D 1TAQA 7ICEA 3Q8KA 4UB4A 4EBEA 5HP4A 4I2FA 8ICNA 1NK4A 2FMQA 5KFPA 2R8HA 4QWDA 9ICJA 5L1JA 1HJPA 5KFQA 3KHLA 4MF2A 4F4WA 1ZQKA 1ZQZA 1SL1A 2VA2A 8ICOA 9ICOA 1PZNA 5KG2A 4PH5A 3IHQB 1NK0A 8ICQA 1KFSA 4KTQA 4UQGA 4IR1A 1RYRA 4UB5A 4IQWA 4GC6A 3SZ2A 5J0XA 4M9NA 2FPMA 4J9QA 3ZDDA 5DB7A 1IXRA 3RR8A 1S0VA 8ICPA 4GXKA 2BCVA 3C23A 1B22A 3RJHA 4ED3A 8ICGA 7ICOA 5DLGA 4RPYA 3ZD8A 4XUSA 1X9WA 2HVHA 5DB8A 1L5UA 5KFBA 3KHHA 3PV8A 7ICKA 2IHMA 4C8OA 5CP2A 3PW4A 1Z3EB 4RQ1A 4XA5A 4F5QA 1X9MA 1BPYA 1KFTA 4PGQA 5CA7A 3PX6A 9ICIA 4Q44A 4ECVA 4KLQA 1TFRA 3JPQA 1BVSA 4MFCA 3PX0A 3BDPA 5KFCA 2Y1JA 1NKEA 1TKDA 8ICFA 8ICIA 3K4GA 4P4OA 4XQ8A 4MFFA 2ZTDA 4UBCA 3N97B 5D46A 4O3RA 2XY5A 3MDCA 1ZJNA 3RTVA 3UXNA 4UAWA 1NJYA 4TQRA 8ICCA 1ZQBA 5KFMA 1BGXT 1T8EA 3NTUA 9ICCA 1S9FA 1COOA 1LB2B 3JPOA 5KFUA 2FMPA 4NY8A 1WCLA 1XS9D 2ZUCA 4QW9A 5L1IA 3MFIA 1XSPA 5KFRA 5DB6A 2M9NA 7ICFA 9ICMA 1CUKA 3GIMA 2JZBB 3C1YA 2ASJA 4ED8A 2XC9A 9ICTA 1QSLA 4KN7A 1XO1A 4JUZA 3RB4A 4MEXA 2F1HA 5HHHA 5KT6A 7ICNA 4I2JA 1ZQQA 1SKWA 4JV2A 2P6UA 3SV3A 1ZQPA 4M9LA 4NLGA 3C2MA 5DQHA 4YR0A 9ICLA 4XRHA 4DSKA 4YXJA 9ICKA 3FDSA 4DFKA 1HUZA 3G6VA 3KHRA 4M0AA 4YR2A 4Q8EA 4QZFA 2R8GA 4C8LA 4YCXA 5KT7A 2ISPA 4I29A 4J9MA 4RQ6A 1S0MA 7ICSA 2NRTA 3H8WA 4YXMA 5KG3A 4DF4A 5HHIA 5DDYA 4F5RA 4HYKA 4O9MA 5J0PA 3T5KA 2BCQA 5KFJA 2I1QA 1ZQLA 3HWTA 4QZHA 1ZQJA 1CEZA 3GV8B 5IILA 4KLMA 4Z6CA 4NLKA 7ICMA 2KN7A 4ECWA 4NLNA 3AUOA 2ASDA 7ICHA 4GXIA 3T5JA 4DFPA 2FPLA 3JPRA 2AGPA 3PW5A 9ICEA 3QEBZ 2R8JA 2XGPA 2AGQA 2BCUA 3C2KA 2W9CB 2W8LA 3T5HA 4C8NA 3M9NB 3TFRA 1ZJMA 8ICAA 2RDIA 2ZTEA 4O0IA 2DPJA 2ZTCA 5KFIA 1KEJA 5J2BA 7ICIA 1ZQUA 4NM2A 5L9XA 2HHVA 5KG0A 5HMMA 3SYZA 4ECTA 3PVXA 2JZBA 3RAXA 2PFPA 4R64A 5DLFA 1ZYQA 3ZDAA 1KFDA 3M9OB 9ICBA 4FS2A 1RYSA 1Z00B 1U49A 3MR3A 2HHUA 9ICFA 2J6SA 1ZQDA 4ED6A 4EBCA 4QZ9A 4KLHA 3V7JA 3C2LA 1D9FA 3GILA 3C21A 3G6XA 4BGDA 3QZ7A 4DSFA 3RJIA 4RZRA 4F5PA 3C1ZA 1KLNA 4QZCA 4O5EA 2XO7A 1N48A 1XSNA 3E2EA 1D9DA 3QZ8A 1K1QA 9ICPA 5EWEA 5KT2A 4UB3A 4KLTA 4ED1A 2UVVA 3RJEA 4DL7A 1S76D 3GIIA 3ISDA 2AGOA 1UT5A 2AQ4A 4QWBA 3PO5A 5DBBA 5IIMA 7ICVA 1NKCA 9ICVA 1BPBA 4O3QA 2BR0A 2NRZA 4M9JA 4ELUA 1U4BA 4YFKA 3IM1A 5KFSA 4EYHB 1C7YA 3EWAA 4RU9A 2XY7A 4R8UB 2VA3A 2W9CA 1MQ2A 1T7PA 1ZQWA 3ISCA 2KFNA 3ZDCA 8ICTA 3BQTA 1Y88A 4YVZA 2PI4A 4EZ6A 1HUOA 4TURA 2FLLA 4ELVA 2XY6A 4K4IA 1L3TA 4B9MA 4DSLA 5BPCA 3HX0A 2JEFA 4DLGA 4K4HA 2HHTA 2HHQA 4DL2A 3RR7A 4JWMA 5J2FA 3MR5A 5J2KA 4DS4A 5KFFA 2BCRA 3H40A 4YMOA 2UVUA 1Z00A 1ZQVA 2BKEA 4DL6A 1ZQXA 3PW2A 8ICJA 4DOBA 2FLNA 3GV7B 3Q8RB 7ICQA 4RQ7A 4QW8A 5DB9A 4UB2A 4KN4A 1TK0A 2FMSA 5CWRA 4ECQA 4LVSA 2A1JA 4QZAA 3OGUA 2W9BA 4KLJA 1RXWA 3ETLA 4MF8A 1NK8A 1ZQEA 4B9VA 3H8JA 3MGIA 5KFTA 4DL5A 3Q8SB 4B9SA 1JMSA 4ECUA 4YR3A 3PNCA 3GIJA 2ISOA 5KFVA 4YD1A 2C28A 4K4GA 4KLOA 5TZVA 1KTQA 3QEAZ 9ICNA 3TANA 3B0YA 4DQQA 3PY8A 4Q43A 4GXJA 4KLDA 1L3VA 4R65A 3FYHA 1H38A 2UVRA 4BWMA 4BXOA 1B43A 2HHWA 1T4GA 2F1JA 5DQGA 4F4XA 4ED0A 4JWNA 5DG8A 4QZIA 1EXNA 2HW3A 5KFYA 9ICGA 1A77A 2KZ3A 2W9MA 2BQRA 2ZUDA 2AU0A 3BQ1A 1ZQAA 2F1IA 1SL0A 4EZ9A 4CCHA 3RH4A 4QZ8A 8ICXA 2FLPA 4EYIB 2J6TA 2BQ3A 5CB1A 2BHNA 5KG6A 3C5GA 4M9GA 2ZJ5A 4M2YA 1RXVA 1ZQSA 2AJQA 5HMLA 3OSPA 4I2DA 5J29A 4TQSA 4ECSA 2I9GA 8ICRA 4MEYA 3MR6A 4KMUA 3UXOA 4GC7A 4ECRA 8ICSA 4IQTA 4DL4A 3TARA 3MABA 1K1SA 4KLEA 1ZQIA 4Q8FA 4BWJA 4RNMA 2ASLA 3BQ0A 1NJZA 4O3OA 2JEIA 3PX4A 3GFKB 3TAQA 2BPFA 4R66A 4EBDA 4PHPA 1ZQTA 3Q8QB 2IMWP 7ICLA 5D49A 4RPZA 3PW7A 4RNNA 1BPXA 1SKSA 5EWFA 3LDAA 1NK7A 4PHDA 4F2SA 1RPLA 2ZJAA 3EPGA 1JN3A 5KFXA 3JPTA 1QLNA 3G6YA 4MFAA 7ICRA 3RB3A 2P6RA 1BPEA 5KFZA 2W9BB 4FS1A 5KT5A 1ZQNA 5KFAA 2DPIA 2C22A 3AU6A 2BCSA 4PHAA 1D8LA 4F92B 4QZDA 1S10A 3V6HA 2HHXA 2BDPA 8ICWA 5JUMA 3ORYA 1MSWD 4P4MA 3V6KA 5CR0A 1JXLA 4ED7A 8ICBA 4GLXA 4YG2A 4FO6A 3LWMA 1MC8A 4RT2A 3PMLA 1NJXA 4QZGA 4PHEA 4KLUA 3JPNA 2H5XA 5IIJA 5DBAA 4ZH4A 4F8RA 2A1JB 1ZQYA 1L3UA 4RUAA 1JXEA 4UAYA 5DKWA 5J2GA 4RPXA 3Q8LA 5J2EA 1XC9A 1ZQFA 4DEZA 5J2JA 1XU4A 5KFOA 5KG5A 4F2RA 4KLGA 3UQ2A 3MFHA 1NK9A 1BPZA 8ICZA 3AU2A 4J9RA 2ALZA 5J0UA 1S0OA 9ICSA 4YP3A 1NJWA 2PFOA 5KFLA 4TUSA 4J9OA 4C8MA 4RT3A 1TVAA 1L3SA 4O3SA 3LWLA 3RAQA 4JV1A 2W8KA 5J0SA 5IIKA 4F5OA 4DOAA 8ICMA 2OWOA 8ICYA 4YQWA 2PI5A 4J9SA 3TI0A 4BDPA 4J9PA 2ZUBA 3GIKA 3GV5B 1QSYA 3OSNA 2FPKA 3PMNA 3M8SA 3H4BA 1NKBA 2KZZA 2JEJA 7ICUA 1SZPA 4R63A 2XCPA 4PPXA 3RB0A 3PR5B 4IQUA 4F93B 3RJFA 2HVIA 4YMNA 1AROP 1BPDA 2ATLA 3RJGA 3EYZA 4PGXA 4RQ2A 4P4PA 3GQCA 1ZETA 3RRGA 4M6WA 4X5VA 1KDHA 5C5JA 4YN4A 2PFNA 4DO9A 3OJSA 4I2IA 5J2HA 5DG9A 4FBTA 2UVWA 2KTQA 1WCNA 4M04A 1RZTA 5IIOA 3V72A 5IINA 2WTFA 5F9NA 5KFGA 5KG7A 4B9LA 5KT3A 4UBBA 3MGHA 2BGWA 1X9SA 1N56A 3RJJA 2MAXA 3NGDA 4DSJA 1XWLA 1U9LA 1NOMA 5J0YA 4O3NA 3V7KA 1A76A 1UA0A 4IRCA 5DG7A 3T3FA 4J9NA 4JV0A 4DQIA 1ZQGA 5CJ7A 3TAPA 1ZQCA 4ELTA 4I2AA 3HT3A 4F4KA 3RB6A 4ED2A 5KFKA 2GWSA 1JX4A 4IRDA 5F9LA 1U47A 2KFZA 5J0TA 4DFMA 4I2GA 4IQVA 1ZQMA 2MUTA 1D8YA 5DDMA 2B21A 1SKRA 1DGSA 1ZQRA 4O3PA 3TQ1A 1ZQOA 5EWGA 9ICQA 2C2EA 3MBYA 3EW9A 5J0RA 4F91B 5CHGA 5L1LA 1S97A 4BXOB 2R8IA 4F3OA 1UT8A 4P2HA 2BPGA 4IRKA 4ECXA 8ICLA 2C2DA 1LV5A 4R8UA 3N4MB 1ZQHA 4KLIA 4F4ZA 2VANA 3THVA 4G3IA 3PR4A 2DFLA 5KT4A 2C2RA 4O5CA 9ICWA 3ISBA 3OJUA 2BQUA 1NK5A 4ECZA 1KRPA 4M6WB 4Q45A 3PO4A 5KFWA 2JEGA 3H8SA 1X2IA 3RJKA 4NM1A 3C5FA 4RQ3A 5IIIA 5KFHA 4RUCA 1U48A 1QTMA 3JPPA 2XGQA 3HW8A 4UAZA 2IBKA 5J2CA 4RQ4A 2V4RA 3KHGA 8ICKA 3QE9Y 4F4YA 3K75D 4DQSA 5J0OA 3T5LA 5KFEA 5J2IA 4NXZA 4LZDA 4DQRA 4B9NA 1KSPA 4YMMA 3GDXA 2Y1IA 5L1KA 4Z6EA 3HPOA 2R8KA 2AQ0A 5KTQA 5KG4A 4DF8A 4LZGA 5DBCA 4I2EA 5DQIA 3PW0A 9ICRA 4C8KA 3UPQA 1JIHA 2ZJ8A 5D4BA 3LK9A 4QWCA 2PXIA 2V4QA 5J2AA 4DSEA 3ZDEA 4E0DA 2J6UA 2NRXA 2HHSA 4RQ5A 2XCAA 3TFSA 4PGYA 2IHNA 4QZEA 3RBDA 3H4DA 1UA1A 4O5KA 4KLLA 1T3NA 3EPIA 4QWEA 4RNOA 1TK8A 4IR9A 8ICVA 5J0QA 3UQ0A 4FBUA 1V9PA 4I27A 4B9TA 3BQ2A 3V7LA 2P66A 4DWIA 5J2DA 4RQ0A 3Q8PB 7ICPA 4QWAA 3SI8A 1SL2A 4I28A 4F50A 4I2BA 3JPSA 3SV4A 2W9AA 1NK6A 7ICJA 2LYHA 4M47A 1QSSA 3RH6A 5DGBA 3EZ5A 3B0XA 4NLZA 3ZDBA 4DL3A 4EEYA 4RQ8A 1TAUA 2PFQA 1IM4A 3M8RA 4I2CA 4M9HA 3BJYA 9ICUA 5BOMA 3V6JA 4UB1A 5DGAA 8ICUA 4J9KA 2NRWA 3UXPA 9ICAA 3ZD9A 1TV9A 4DQPA 4DS5A 3RBEA 5KG1A 4ECYA 8ICEA 3M9MB 1TK5A 8ICHA 3Q8MA 9ICHA 2NRVA 2VA8A 1MQ3A 5HNKA 4TUPA 4Z6DA 4TUQA 2IA6A 4B9UA 3MR2A 7ICGA 7ICTA 2MUTB 2V9WA 4JK1A 3RH5A 4KLFA 1U45A 3MDAA 5EOZA 3HP6A
chains in the Genus database with same CATH superfamily
4NWIA 5ALTA 4DLEA 2BPCA 4KLSA 3H7IA 3OHAA 2WB1F 5AK5A 4KITB 1S77D 1NK4A 2DKZA 5KFQA 4CE6A 1Q3UA 1ZQZA 8ICOA 1PZNA 1FFVA 5KG2A 3IHQB 2KOBA 4IR1A 4GC6A 2FPMA 3RR8A 2HMXA 4UB6U 2BCVA 3C23A 2VIXA 2BDUA 3RJHA 8ICGA 1X9WA 3KKAC 1K5OA 3MGVA 5CP2A 1Z3EB 4PGQA 4Q44A 4ECVA 2R18A 2G09A 4CGZA 1BVSA 1YZ6A 3BDPA 1NKEA 1MN8A 1QH9A 4PZOA 1QQ7A 3K4GA 2ZTDA 3N97B 2XY5A 3UXNA 3QU2A 8ICCA 1BGXT 1PK1A 2ZIWB 4AYBC 1S9FA 1COOA 2ZUCA 2JH1A 5DB6A 2M9NA 3GIMA 2KD1A 3VC8A 2ASJA 4ED8A 2ODGA 9ICTA 4KN7A 1XO1A 2GH1A 3RB4A 5KT6A 5ALYA 2HBKA 2KG5A 4JV2A 3SV3A 3K1RB 9ICKA 2W3RA 1HUZA 3CRXA 4HAIA 2ZIXB 4J9MA 1URJA 3WKBA 7ICSA 2NRTA 4DF4A 5KG3A 4US8A 5HHIA 3T5KA 2BCQA 5KFJA 3HWTA 1CEZA 2EAPA 4NLKA 3HRDD 3QU9A 2ASDA 4GXIA 1WYGA 3QEBZ 2BCUA 2W9CB 8ICAA 2RDIA 2XVTA 1V97A 7ICIA 5KG0A 5HMMA 3SYZA 4ECTA 3M7DA 2KJ8A 3AN1A 3V7JA 1D9FA 1KLNA 3RJIA 1QQ6A 4RZRA 4O5EA 2XO7A 4LJXA 5EWEA 4UB3A 1UHUA 4KLTA 5ALLA 2UVVA 1S76D 4DL7A 2AGOA 2AQ4A 3PO5A 2QARB 1BPBA 2BR0A 4M9JA 4RU9A 2XY7A 3I1YA 4R8UB 2VA3A 2W9CA 1MQ2A 8ICTA 1X9XA 4EX7A 2OCEA 1HUOA 4K4IA 1L3TA 4B9MA 4DSLA 2JEFA 4DLGA 1Z4OA 4DL2A 2F8KA 3D2QA 5J2KA 3NUQA 4EX6A 8ICJA 4DOBA 4QW8A 1SZHA 1RXWA 4B9VA 2RRDA 4DL5A 4B9SA 4ECUA 4YR3A 3PNCA 3TADC 4NJ8A 4K4GA 3QEAZ 4Q43A 1QQ5A 1L3VA 2HBJA 4UB8U 2HHWA 5DQGA 4JWNA 4QZIA 1EXNA 2HW3A 2W9MA 1ZQAA 2KVCA 1Z19A 3AL0B 2BQ3A 2BHNA 2KP7A 2XIDA 4M2YA 5HMLA 2ZIUB 5J29A 3MR6A 3UXOA 5AM0A 4ECRA 4IQTA 3TARA 2RLTA 3MABA 5ALGA 4KLEA 4Q8FA 4BWJA 2JEIA 4O3OA 3PX4A 3TAQA 7ICLA 1KL9A 3PW7A 1NK7A 4F2SA 3AEVA 3KZXA 1QLNA 1JN3A 5ALSA 3RB3A 1BPEA 2W9BB 3ALRA 5B66U 2C22A 2CN1A 3AU6A 4PHAA 1VDVA 4QZDA 1X40A 1PVQA 5AKKA 2QB0A 1MSWD 2G5HB 1NJXA 2PKEA 2E8OA 1JUDA 2A1JB 2K4IA 3PSPA 2DL0A 3R9KA 3WK5A 3MFHA 1NK9A 1BPZA 8ICZA 2ALZA 2PFOA 2KE7A 5KFLA 4RT3A 4O3SA 3RAQA 4JV1A 3QU5A 5J0SA 4OD0A 4DOAA 2G0AA 3TI0A 4BDPA 4J9PA 2ZUBA 1QSYA 2KZZA 2HSZA 3RB0A 4F93B 2A3VA 2HVIA 2LYAA 3EYZA 4PGXA 4P4PA 5CRXA 3GQCA 5J8YA 4M6WA 1KDHA 2F44A 1NZBA 4KMOB 5DG9A 2UVWA 5IIOA 2W54A 4ACOA 5F9NA 5KFGA 5KG7A 1HEKA 4B9LA 3MGHA 1X9SA 1N56A 3NGDA 1XWLA 2D8CA 1U9LA 1UCVA 4O3NA 3V7KA 4J9NA 1SV0C 5CJ7A 2H3ZA 3NVWA 4ELTA 2HDOA 2GWSA 1JX4A 4WJ3B 3RFAA 3SQIA 2QLTA 5EWGA 3MBYA 2YMQA 4F3OA 1UT8A 5E79U 2C2DA 1LV5A 4KLIA 4F4ZA 2VANA 4G3IA 4O5CA 3D6JA 3ISBA 1YT3A 4C4TA 1NK5A 4ECZA 5KFWA 2JEGA 1X2IA 4NM1A 1KW4A 3A0HU 2ZXIA 2KMDA 2I5HA 2IBKA 5J2CA 2P35A 1MA7A 3K75D 2ZG6A 3M6ZA 1ZQ1C 4UASA 5FP0A 4DQRA 1KSPA 3LVVA 2K60A 1SV0A 5L1KA 4DF8A 1Z1VA 4LZGA 5DQIA 2VJ4A 5G5HA 4DSEA 2J6UA 2HHSA 4QZEA 4KLLA 4O5KA 3N7SC 1DRGA 1TK8A 1GO3F 3ED5A 3UQ0A 2DBYA 4I27A 3V7LA 2MSNA 5T14A 2K4PA 4I2BA 3JPSA 3SV4A 3SR6A 1L7MA 4QJFB 3ONNA 1ED1A 4Y2RA 4M47A 1TAMA 4DL3A 4RQ8A 2CXYA 3IRUA 3M8RA 4I2CA 3BJYA 4ICAA 2IOHA 3V6JA 2NRWA 3UXPA 5ALFA 3RBEA 3BS5A 8ICEA 3M9MB 1TK5A 1FIQA 1MQ3A 4B9UA 3MR2A 7ICTA 2KJ9A 1U45A 2RQ5A 3MDAA 3HP6A 5AI9A 3B9JA 4QZBA 4C0ZA 9ICXA 5KFNA 3RRHA 3PSIA 4YD2A 1L6NA 1N61A 5J0WA 4DOCA 2HI0A 1DOQA 4F5NA 4PZNA 1SGGA 4Z6FA 2IOFK 4EENA 4UB4A 4I2FA 8ICNA 2R8HA 9ICJA 1HJPA 4MF2A 1SL1A 9ICOA 8ICQA 3U26A 3CW2C 2KV2A 4IQWA 4J9QA 2K8CB 1S0VA 5AM1A 1B22A 7ICOA 5DLGA 3ZD8A 3I28A 4Y2SA 1L5UA 5KFBA 2WF6A 3PV8A 7ICKA 5AKZA 2IHMA 1KFTA 3PW4A 1BPYA 2RP5A 5CA7A 1L8OA 3JPQA 4B6JA 5KFCA 4BJQA 4XQ8A 3UMCA 4UBCA 5D46A 4O3RA 3MDCA 3RTVA 5AHXA 2YQEA 4UAWA 4TQRA 2AXTU 1IV8A 3D2SA 1T8EA 9ICCA 2FMPA 4NY8A 5AKHA 5ALKA 1XSPA 3MFIA 7ICFA 2JZBB 3C1YA 1LKYB 1QSLA 3KD3A 3F2BA 4PL2A 5ALUA 1SKWA 4Y2UA 2P6UA 4M9LA 1FEZA 3C2MA 4YXJA 3FDSA 4M0AA 3UM9A 2W04A 5KT7A 2ISPA 5EE3A 1L8LA 4F5RA 4HYKA 1ZQLA 2I1QA 4QZHA 4F72A 4KLMA 3VCBA 2KN7A 3QUBA 4US9A 3T5JA 3JPRA 2AGPA 2R8JA 3C2KA 2LM1A 1ZJMA 2ZTEA 4O0IA 5KFIA 1XNSA 1S8OA 1ZQUA 3SEIA 3RAXA 5KL8B 2PFPA 2F2AB 3ZDAA 1KFDA 9ICBA 2E1EA 4P0PB 2J6SA 1ZQDA 3IG5A 4EBCA 4OJPA 2OHFA 4QZ9A 4KLHA 3C2LA 3BQ7A 3G6XA 5JU5A 3C1ZA 1N48A 1A6SA 2EZYA 4ED1A 5DBBA 7ICVA 1WWUA 2MA1A 2KIVA 3A0BU 1U4BA 1C7YA 1J97A 1ZQWA 3BQTA 1Y88A 2PI4A 3I76A 4C7ZA 4Y2JA 4JWMA 5J2FA 1DXSA 1RG6A 1CRXA 4P0QA 1ZQVA 1L7PA 1ZQXA 3F2DA 3T79A 5DB9A 2CPRA 1HIWA 5AK3A 3OGUA 4KLJA 4MF8A 5KFTA 1PK3A 3IG8A 5JTIA 2WB1C 1F44A 4FFDA 3PY8A 1H38A 4KX5A 4ED0A 1A77A 2KZ3A 3SENA 4NV0A 2ZUDA 5AI8A 5JRTA 3BQ1A 2F1IA 1SL0A 4CCHA 8ICXA 2FLPA 5KG6A 4M9GA 2YX8A 5GTHU 4RQNA 1RXVA 3OSPA 4ECSA 2I9GA 2FI1A 5EE9A 2JXJA 2JV3A 2QARA 1K1SA 4CF5A 1ZQIA 4RNMA 1NJZA 2JHDA 2F77X 4R66A 4EBDA 1ZQTA 2IMWP 3RF9A 2K4HA 4PHDA 3EPGA 3CP8A 3N7RC 2P6RA 1ZQNA 4Y2VA 8ICWA 4FZNA 3ORYA 4OCZA 2KHVA 3V6KA 4ED7A 2LKYA 3QUQA 1N5WA 2KEYA 4FO6A 3PMLA 4QZGA 4KLUA 2B6GA 2H5XA 2DWQA 2LMRA 5DBAA 4F8RA 2JMGA 1JXEA 1S5LU 1ZQFA 4DEZA 5J2JA 1XU4A 4KLGA 3UQ2A 5J0UA 1NJWA 4J9OA 3WK7A 3LWLA 3WK6A 3N7PD 2OYYA 4YQWA 2PI5A 1DGJA 3OSNA 3PMNA 2JEJA 4R63A 5C0YA 4PPXA 3PR5B 2WAQC 4YMNA 2ATLA 3RJGA 3RRGA 5C5JA 2PFNA 3HKZC 5GTIU 4I2IA 4C80A 1WCNA 4M04A 2CRXA 3WK4A 4AP9A 3UMGA 1N63A 5AM2A 4DQIA 3TAPA 1JALA 1LVHA 4F4KA 1O08A 3RB6A 4ED2A 2KFZA 4DFMA 4I2GA 1KQQA 3QUTA 1WWVA 1D8YA 1SKRA 2B21A 1DGSA 1ZQRA 5B5EU 3TQ1A 1RQNA 5L1LA 5ALVA 2BPGA 2Y9TA 1TE2A 5KT4A 2WF8A 2KICA 2H3QA 4M6WB 4Q45A 2NV3A 2EQYA 3C5FA 5IIIA 5KFHA 4RUCA 1QTMA 3JPPA 2W11A 3K1ZA 3QUCA 3QE9Y 4DQSA 5J2IA 4NXZA 4LZDA 2OH2A 3GDXA 2E1FA 4BX9C 2AQ0A 2Y0SC 5KG4A 2K89A 5AKIA 4I2EA 2YB4A 1FFUA 2ZJ8A 4QWCA 2PXIA 5KL1B 3ZDEA 2NRXA 4C7YA 4RQ5A 3TFSA 4PGYA 3RBDA 4QWEA 3TADA 4IR9A 8ICVA 5J0QA 4FBUA 5ALWA 2K8AA 3C28A 5J2DA 3OTQA 3PSFA 4QWAA 2EZZA 1PUZA 5CEHA 1NK6A 3RH6A 2B0CA 4CNQA 3EZ5A 4NLZA 3AQEA 4EEYA 1TAUA 2PFQA 3QNMA 4F71A 2YN4A 1ZRNA 2LBOA 8ICUA 4C4SA 4J9KA 3ZD9A 4ECYA 3Q8MA 2EAOA 9ICHA 2VA8A 5HNKA 4Z6DA 2H3IA 4OJ6A 4I2HA 3GZFA 2A1AA 3HKZF 3KTQA 5KFDA 1PVPA 1XSLA 4J9LA 1TAQA 7ICEA 3Q8KA 4EBEA 1KN5A 5HP4A 5KFPA 5L1JA 4EEKA 4F4WA 2VA2A 1NK0A 3ICXA 1KFSA 4UQGA 2H3FA 4UB5A 2KKVA 2YY6A 4O3MA 5J0XA 4M9NA 3UMBA 5ALNA 5DB7A 3TACB 1ZD4A 4ED3A 4RPYA 4RQ1A 4XA5A 3PX6A 9ICIA 1TFRA 4MFCA 2Y1JA 3AMZA 2M0NA 4MFFA 4G9BA 1Z4NA 1ZD2P 5KFMA 2ZIUA 3NTUA 4EELA 2GO7A 1LB2B 3QU4A 3JPOA 1COKA 1XS9D 4QW9A 4KX3A 5AKGA 2XC9A 3HILA 4JUZA 2W7OA 4MEXA 5HHHA 2LI6A 7ICNA 2QB1A 1ZQPA 2BZFA 1N60A 4DSKA 3NRWA 4DFKA 4PJ0U 4YR2A 4YCXA 4UAVA 3H8MA 5ALMA 4RQ6A 3E58A 1S0MA 4YXMA 3F2CA 5DDYA 3IDWA 1ZQJA 3WK9A 3GV8B 2W03A 5IILA 3SAHA 7ICHA 3H0RB 3LYSA 2KK0A 9ICEA 2AGQA 3NVYA 2W8LA 3T5HA 3WKCA 2ZTCA 1KEJA 5J2BA 1FO4A 5L9XA 2HHVA 2OEHA 3CNHA 3PVXA 2JZBA 4R64A 5DLFA 4FS2A 1Z00B 4JMUA 1U49A 4CF3A 3DEEA 4ED6A 5AM3A 4U7CA 3GILA 4DSFA 4BGDA 3QZ7A 9ICLA 1Q3VA 4QZCA 3E2EA 1JROA 1D9DA 5AKXA 4J03A 3GIIA 1UT5A 4QWBA 1NKCA 9ICVA 4O3QA 2NRZA 4ELUA 4YFKA 2PMZF 5KFSA 4EYHB 3EWAA 1NNLA 2KFNA 3ZDCA 4YVZA 3M1YA 4EZ6A 2FLLA 4ELVA 2D6FC 5BPCA 3HX0A 2E5SA 1VJ5A 4ZOHC 1SIJA 3MR5A 2W7PA 1T94A 3H40A 5TISU 1ZOLA 4YMOA 2UVUA 1Z00A 2E8PA 2EDUA 3QX7A 4DL6A 4OJLA 2FLNA 3IV6A 2H3VA 3Q8RB 7ICQA 2HBLA 2DKXA 4ECQA 4QZAA 5HR6A 3L5KA 3H8JA 3MGIA 2FDRA 2DGZA 3Q8SB 1JMSA 5KFVA 4GIBA 2C28A 4KLOA 4QIWC 1KTQA 1V85A 1ZXIA 5TZVA 3PZPA 2UVRA 1B43A 1T4GA 4F4XA 5G5GA 5KFYA 1DK2A 2BQRA 2EZXA 2VKQA 4EZ9A 3RH4A 3KKAA 4QZ8A 4EYIB 2G5IB 2J6TA 5CB1A 1SXEA 2ZJ5A 2AJQA 8ICRA 4MEYA 4GC7A 8ICSA 1J2MA 4DL4A 2NYVA 3BQ0A 3GFKB 2BPFA 3Q8QB 3QXGA 4RNNA 5EWFA 4GFJA 1AQ6A 1RPLA 2ZJAA 7ICRA 3JPTA 2ES6A 5KFZA 5KFAA 2Y9UA 5AI0A 2DPIA 2KIWA 3V6HA 2HHXA 2BDPA 4FZLA 4P4MA 1JXLA 2JRZA 4IS7A 2EH9A 3LWMA 4RT2A 4PHEA 3JPNA 2ZIVA 4OO1J 3PSTA 4ZH4A 2AH5A 1L3UA 4RUAA 4UAYA 4RPXA 5J2EA 5KFOA 5KG5A 3AU2A 2OXOA 4J9RA 5ALQA 1L7NA 4YP3A 3NRZA 3F5EA 4C8MA 1TVAA 1L3SA 5ALHA 2W8KA 5IIKA 4F5OA 5F3XB 3BZKA 2OWOA 3NS1A 4J9SA 3GIKA 1JI7A 3M8SA 2FPKA 7ICUA 1SZPA 4OJ5A 4IQUA 1BPDA 1RDFA 4PL1A 1ZETA 2HOFA 4X5VA 3OJSA 5J2HA 1UQVA 3V72A 5IINA 1IIPA 2WTFA 2WF9A 2YMLA 5KT3A 4UBBA 3WKEA 1X66A 2BGWA 3RJJA 1A76A 4IRCA 5DG7A 3BZCA 2DQNB 5AI6A 4JV0A 2MU2A 5ALIA 1ZQGA 3SMVA 4DCCA 3HT3A 2WF7A 4CF4A 5KFKA 4IRDA 5F9LA 2MUTA 3LVWA 2C2EA 3EW9A 5J0RA 2HCFA 2A19A 4F91B 4Y2TA 1S97A 4BXOB 4P2HA 1LKYA 4IRKA 8ICLA 2YMPA 4C4RA 3EUB2 2HBMA 4UATA 3THVA 3PR4A 2C2RA 1DK3A 9ICWA 3OJUA 1KRPA 3IN5A 1F0MA 3RJKA 4RQ3A 1U48A 4UAZA 1BNOA 4RQ4A 2V4RA 8ICKA 4F4YA 2YTUA 5EE0A 3T5LA 3E0FA 5KFEA 4YMMA 2Y1IA 3HPOA 2R8KA 1WG8A 2Z7JA 4C8KA 5AK6A 3LK9A 3KFUF 2V4QA 5J2AA 2ZXHA 4E0DA 3H0MB 2L5YA 2RHFA 4NL9A 2IHNA 1UA1A 2D3DA 1T3NA 3EPIA 1UPHA 3QU7A 4RNOA 3MC1A 2P66A 5AK4A 7ICPA 3SI8A 4I28A 2XI9A 2WF5A 3CYMA 2ESEA 2HOIA 1CI4A 5BOMA 4UB1A 1SV4A 2QB0B 5DGAA 1X6JA 4DQPA 8ICHA 4CDGA 2IA6A 5L1MA 5ALEA 2MUTB 2WAQF 1RM6C 4JK1A 3C29A 3RH5A 2OM6A 4KLFA 5EOZA 2E8NA 3J81j 1X6IA 4DSIA 2RDJA 5ALPA 4USAA 5ALXA 5BOLA 2KZMA 4DFJA 2Q0ZX 3OHBA 2AHOB 1S0NA 5ALJA 2FMQA 2W43A 4QWDA 3KHLA 1ZQKA 4PH5A 2VJ5A 4KTQA 1RYRA 3SZ2A 3ZDDA 1IXRA 8ICPA 4GXKA 2N1RA 3ETRA 4FE3A 1NI3A 4XUSA 2HVHA 5KNIA 2MRLA 5DB8A 3KHHA 4C8OA 1A0PA 4F5QA 1X9MA 1SB3C 4CRXA 1JRPA 4NLBA 4KLQA 3PX0A 1N2XA 1TKDA 8ICFA 8ICIA 4P4OA 3ZI4A 5KAIU 1ZJNA 1NJYA 1ZQBA 1PK1B 2ZIWA 4JB3A 4FZMA 5KFUA 5ALZA 1WCLA 5L1IA 5KFRA 9ICMA 1CUKA 3QYPA 2F1HA 1XO0A 4I2JA 4QNLA 1BNPA 4OJOA 5AI5A 1ZQQA 4NLGA 3FAHA 5DQHA 4YR0A 4XRHA 5AIAA 3G6VA 3KHRA 4Q8EA 1Q8KA 4QZFA 1IG6A 2R8GA 4C8LA 3IP4B 4I29A 2O6KA 2WFAA 3H8WA 4O9MA 2K4EA 5J0PA 1F5SA 2YB1A 2KSOA 4Z6CA 7ICMA 4ECWA 4NLNA 4Y2YA 3OPXA 3AUOA 4DFPA 1ZD5A 2FPLA 3PW5A 2G08A 2XGPA 1ZD3A 1L7OA 4C8NA 3M9NB 3TFRA 2DPJA 2XICA 5ALRA 4NM2A 2LM4A 1ZYQA 2DF4B 3M9OB 5AM4A 1RYSA 3MR3A 4UW9A 1OUQA 2HHUA 9ICFA 1YZ7A 5AKEA 2ZIVB 3C21A 4F5PA 1XSNA 3QZ8A 4IL6U 1K1QA 9ICPA 5KT2A 5KAFU 2KSOB 3RJEA 3ISDA 5IIMA 3BS5B 3IM1A 4Y2QA 2KNJA 1ZRMA 1T7PA 3SD7A 3ISCA 1N62A 4TURA 2XY6A 2Q4TA 2HHTA 4K4HA 5ALDA 2NO5A 4U6PA 4BUGA 2HHQA 2KJ5A 3RR7A 4DS4A 5KFFA 2BCRA 4P0PA 1OXJA 2F3NA 2BKEA 3GU3A 3PW2A 3L3FX 3GV7B 4A8EA 5AIBA 4RQ7A 2PMZC 4UB2A 4KN4A 1TK0A 2FMSA 3O0FA 5CWRA 2KKPA 4LVSA 2A1JA 2W9BA 1SXDA 3FC4A 1J2NA 3ETLA 5EE1A 1NK8A 3HJEA 1ZQEA 3GIJA 2ISOA 4YD1A 3N28A 2W3SA 9ICNA 3TANA 3B0YA 4DQQA 4KLDA 4GXJA 4R65A 3FYHA 3DV9A 4BWMA 4BXOA 2F1JA 2LHTA 5DG8A 4NL9C 9ICGA 2AU0A 1B0XA 2QKQA 5AM5A 3WKAA 3C5GA 1ZQSA 3NVZA 4I2DA 3D2NA 4TQSA 2FE9A 4Y2PA 4KMUA 1KBUA 3AM9A 2EAMA 2JGAA 5AKLA 2ASLA 1T3QA 4PHPA 5H2FU 5D49A 4RPZA 1BPXA 1SKSA 5J8YC 1QCKA 3LDAA 5KFXA 3WU2U 1ECWA 3F53A 4MFAA 3G6YA 2JH7A 5AKJA 4FS1A 5KT5A 2BCSA 2W55A 1D8LA 4F92B 1S10A 5AI4A 5JUMA 2WHEA 2FJ6A 2GOLA 5CR0A 8ICBA 4IC9A 4GLXA 4YG2A 1P7DA 1MC8A 5AKYA 5IIJA 3DDHA 2F8LA 1SWVA 1ZQYA 5DKWA 5J2GA 3NVVA 3Q8LA 1XC9A 4F2RA 9ICSA 1S0OA 3H0LB 4TUSA 5AICA 1D8BA 8ICMA 2I6XA 8ICYA 3GV5B 1NKBA 3H4BA 2XCPA 1OW5A 3RJFA 4RQMA 1AROP 4RQ2A 4MHVA 1RQLA 4YN4A 1B4FA 4DO9A 2Y0SF 2KTQA 2ZIXA 4FBTA 5ALOA 1RZTA 2NO4A 5HR7A 2MAXA 4DSJA 2G06A 1NOMA 5J0YA 1UA0A 3T3FA 2GLEA 3WK8A 1NZPA 1ZQCA 4I2AA 3SAFA 1U47A 3WKDA 5J0TA 4IQVA 1ZQMA 5DDMA 4O3PA 1ZQOA 9ICQA 2KHQA 5CHGA 2DUYA 2R8IA 5K4LA 1Q46A 5A0LA 4ECXA 4R8UA 3N4MB 1ZQHA 4UAUA 2DFLA 3M6KA 2LYBA 2JR5A 1KKXA 2BQUA 3PO4A 3H8SA 3NASA 1PVRA 1O03A 2XGQA 3HW8A 4AYBF 1M6YA 3KHGA 1Z1BA 5J0OA 2E3TA 4B9NA 1SWWA 4Z6EA 5KTQA 2LPEA 5DBCA 9ICRA 3PW0A 4NLCA 2IOFA 2HOQA 3UPQA 1JIHA 5D4BA 3FM9A 1RYUA 2XCAA 3KBBA 3H4DA 2K8BB 4UARA 4QIWF 1X42A 1V9PA 3F5AA 4B9TA 3BQ2A 4DWIA 3BS7A 2F76X 4RQ0A 3Q8PB 1N5XA 3AQFA 3S6JA 1SL2A 4F50A 2W9AA 4P0QB 7ICJA 2LYHA 1QSSA 5DGBA 3B0XA 3ZDBA 1V38A 1IM4A 2YMMA 4M9HA 9ICUA 3SAGA 4DFDA 3KOOA 2KVSA 9ICAA 1TV9A 4Y2XA 4DS5A 5KG1A 3KZIU 2NRVA 2E8MA 4TUPA 1VLBA 1WUDA 3L4PA 4TUQA 7ICGA 2G07A 2V9WA 2EANA 1C20A 3TKAA
chains in the Genus database with same CATH topology
4DLEA 4KLSA 2BPCA 3H7IA 3OHAA 4I2HA 4DSIA 2RDJA 4QZBA 3KTQA 5KFNA 5KFDA 3RRHA 9ICXA 5BOLA 4YD2A 2KZMA 4DOCA 5J0WA 4DFJA 2Q0ZX 1XSLA 1DOQA 4F5NA 3OHBA 4J9LA 1S0NA 4KITB 4Z6FA 1S77D 1TAQA 7ICEA 3Q8KA 4UB4A 4EBEA 5HP4A 4I2FA 8ICNA 1NK4A 2FMQA 5KFPA 2R8HA 4QWDA 9ICJA 5L1JA 1HJPA 5KFQA 3KHLA 4MF2A 4F4WA 1ZQKA 1ZQZA 1SL1A 2VA2A 8ICOA 9ICOA 1PZNA 5KG2A 4PH5A 3IHQB 1NK0A 8ICQA 1KFSA 4KTQA 4UQGA 4IR1A 1RYRA 4UB5A 4IQWA 4GC6A 3SZ2A 5J0XA 4M9NA 2FPMA 4J9QA 3ZDDA 5DB7A 1IXRA 3RR8A 1S0VA 8ICPA 4GXKA 2BCVA 3C23A 1B22A 3RJHA 4ED3A 8ICGA 7ICOA 5DLGA 4RPYA 3ZD8A 4XUSA 1X9WA 2HVHA 5DB8A 1L5UA 5KFBA 3KHHA 3PV8A 7ICKA 2IHMA 4C8OA 5CP2A 3PW4A 1Z3EB 4RQ1A 4XA5A 4F5QA 1X9MA 1BPYA 1KFTA 4PGQA 5CA7A 3PX6A 9ICIA 4Q44A 4ECVA 4KLQA 1TFRA 3JPQA 1BVSA 4MFCA 3PX0A 3BDPA 5KFCA 2Y1JA 1NKEA 1TKDA 8ICFA 8ICIA 3K4GA 4P4OA 4XQ8A 4MFFA 2ZTDA 4UBCA 3N97B 5D46A 4O3RA 2XY5A 3MDCA 1ZJNA 3RTVA 3UXNA 4UAWA 1NJYA 4TQRA 8ICCA 1ZQBA 5KFMA 1BGXT 1T8EA 3NTUA 9ICCA 1S9FA 1COOA 1LB2B 3JPOA 5KFUA 2FMPA 4NY8A 1WCLA 1XS9D 2ZUCA 4QW9A 5L1IA 3MFIA 1XSPA 5KFRA 5DB6A 2M9NA 7ICFA 9ICMA 1CUKA 3GIMA 2JZBB 3C1YA 2ASJA 4ED8A 2XC9A 9ICTA 1QSLA 4KN7A 1XO1A 4JUZA 3RB4A 4MEXA 2F1HA 5HHHA 5KT6A 7ICNA 4I2JA 1ZQQA 1SKWA 4JV2A 2P6UA 3SV3A 1ZQPA 4M9LA 4NLGA 3C2MA 5DQHA 4YR0A 9ICLA 4XRHA 4DSKA 4YXJA 9ICKA 3FDSA 4DFKA 1HUZA 3G6VA 3KHRA 4M0AA 4YR2A 4Q8EA 4QZFA 2R8GA 4C8LA 4YCXA 5KT7A 2ISPA 4I29A 4J9MA 4RQ6A 1S0MA 7ICSA 2NRTA 3H8WA 4YXMA 5KG3A 4DF4A 5HHIA 5DDYA 4F5RA 4HYKA 4O9MA 5J0PA 3T5KA 2BCQA 5KFJA 2I1QA 1ZQLA 3HWTA 4QZHA 1ZQJA 1CEZA 3GV8B 5IILA 4KLMA 4Z6CA 4NLKA 7ICMA 2KN7A 4ECWA 4NLNA 3AUOA 2ASDA 7ICHA 4GXIA 3T5JA 4DFPA 2FPLA 3JPRA 2AGPA 3PW5A 9ICEA 3QEBZ 2R8JA 2XGPA 2AGQA 2BCUA 3C2KA 2W9CB 2W8LA 3T5HA 4C8NA 3M9NB 3TFRA 1ZJMA 8ICAA 2RDIA 2ZTEA 4O0IA 2DPJA 2ZTCA 5KFIA 1KEJA 5J2BA 7ICIA 1ZQUA 4NM2A 5L9XA 2HHVA 5KG0A 5HMMA 3SYZA 4ECTA 3PVXA 2JZBA 3RAXA 2PFPA 4R64A 5DLFA 1ZYQA 3ZDAA 1KFDA 3M9OB 9ICBA 4FS2A 1RYSA 1Z00B 1U49A 3MR3A 2HHUA 9ICFA 2J6SA 1ZQDA 4ED6A 4EBCA 4QZ9A 4KLHA 3V7JA 3C2LA 1D9FA 3GILA 3C21A 3G6XA 4BGDA 3QZ7A 4DSFA 3RJIA 4RZRA 4F5PA 3C1ZA 1KLNA 4QZCA 4O5EA 2XO7A 1N48A 1XSNA 3E2EA 1D9DA 3QZ8A 1K1QA 9ICPA 5EWEA 5KT2A 4UB3A 4KLTA 4ED1A 2UVVA 3RJEA 4DL7A 1S76D 3GIIA 3ISDA 2AGOA 1UT5A 2AQ4A 4QWBA 3PO5A 5DBBA 5IIMA 7ICVA 1NKCA 9ICVA 1BPBA 4O3QA 2BR0A 2NRZA 4M9JA 4ELUA 1U4BA 4YFKA 3IM1A 5KFSA 4EYHB 1C7YA 3EWAA 4RU9A 2XY7A 4R8UB 2VA3A 2W9CA 1MQ2A 1T7PA 1ZQWA 3ISCA 2KFNA 3ZDCA 8ICTA 3BQTA 1Y88A 4YVZA 2PI4A 4EZ6A 1HUOA 4TURA 2FLLA 4ELVA 2XY6A 4K4IA 1L3TA 4B9MA 4DSLA 5BPCA 3HX0A 2JEFA 4DLGA 4K4HA 2HHTA 2HHQA 4DL2A 3RR7A 4JWMA 5J2FA 3MR5A 5J2KA 4DS4A 5KFFA 2BCRA 3H40A 4YMOA 2UVUA 1Z00A 1ZQVA 2BKEA 4DL6A 1ZQXA 3PW2A 8ICJA 4DOBA 2FLNA 3GV7B 3Q8RB 7ICQA 4RQ7A 4QW8A 5DB9A 4UB2A 4KN4A 1TK0A 2FMSA 5CWRA 4ECQA 4LVSA 2A1JA 4QZAA 3OGUA 2W9BA 4KLJA 1RXWA 3ETLA 4MF8A 1NK8A 1ZQEA 4B9VA 3H8JA 3MGIA 5KFTA 4DL5A 3Q8SB 4B9SA 1JMSA 4ECUA 4YR3A 3PNCA 3GIJA 2ISOA 5KFVA 4YD1A 2C28A 4K4GA 4KLOA 5TZVA 1KTQA 3QEAZ 9ICNA 3TANA 3B0YA 4DQQA 3PY8A 4Q43A 4GXJA 4KLDA 1L3VA 4R65A 3FYHA 1H38A 2UVRA 4BWMA 4BXOA 1B43A 2HHWA 1T4GA 2F1JA 5DQGA 4F4XA 4ED0A 4JWNA 5DG8A 4QZIA 1EXNA 2HW3A 5KFYA 9ICGA 1A77A 2KZ3A 2W9MA 2BQRA 2ZUDA 2AU0A 3BQ1A 1ZQAA 2F1IA 1SL0A 4EZ9A 4CCHA 3RH4A 4QZ8A 8ICXA 2FLPA 4EYIB 2J6TA 2BQ3A 5CB1A 2BHNA 5KG6A 3C5GA 4M9GA 2ZJ5A 4M2YA 1RXVA 1ZQSA 2AJQA 5HMLA 3OSPA 4I2DA 5J29A 4TQSA 4ECSA 2I9GA 8ICRA 4MEYA 3MR6A 4KMUA 3UXOA 4GC7A 4ECRA 8ICSA 4IQTA 4DL4A 3TARA 3MABA 1K1SA 4KLEA 1ZQIA 4Q8FA 4BWJA 4RNMA 2ASLA 3BQ0A 1NJZA 4O3OA 2JEIA 3PX4A 3GFKB 3TAQA 2BPFA 4R66A 4EBDA 4PHPA 1ZQTA 3Q8QB 2IMWP 7ICLA 5D49A 4RPZA 3PW7A 4RNNA 1BPXA 1SKSA 5EWFA 3LDAA 1NK7A 4PHDA 4F2SA 1RPLA 2ZJAA 3EPGA 1JN3A 5KFXA 3JPTA 1QLNA 3G6YA 4MFAA 7ICRA 3RB3A 2P6RA 1BPEA 5KFZA 2W9BB 4FS1A 5KT5A 1ZQNA 5KFAA 2DPIA 2C22A 3AU6A 2BCSA 4PHAA 1D8LA 4F92B 4QZDA 1S10A 3V6HA 2HHXA 2BDPA 8ICWA 5JUMA 3ORYA 1MSWD 4P4MA 3V6KA 5CR0A 1JXLA 4ED7A 8ICBA 4GLXA 4YG2A 4FO6A 3LWMA 1MC8A 4RT2A 3PMLA 1NJXA 4QZGA 4PHEA 4KLUA 3JPNA 2H5XA 5IIJA 5DBAA 4ZH4A 4F8RA 2A1JB 1ZQYA 1L3UA 4RUAA 1JXEA 4UAYA 5DKWA 5J2GA 4RPXA 3Q8LA 5J2EA 1XC9A 1ZQFA 4DEZA 5J2JA 1XU4A 5KFOA 5KG5A 4F2RA 4KLGA 3UQ2A 3MFHA 1NK9A 1BPZA 8ICZA 3AU2A 4J9RA 2ALZA 5J0UA 1S0OA 9ICSA 4YP3A 1NJWA 2PFOA 5KFLA 4TUSA 4J9OA 4C8MA 4RT3A 1TVAA 1L3SA 4O3SA 3LWLA 3RAQA 4JV1A 2W8KA 5J0SA 5IIKA 4F5OA 4DOAA 8ICMA 2OWOA 8ICYA 4YQWA 2PI5A 4J9SA 3TI0A 4BDPA 4J9PA 2ZUBA 3GIKA 3GV5B 1QSYA 3OSNA 2FPKA 3PMNA 3M8SA 3H4BA 1NKBA 2KZZA 2JEJA 7ICUA 1SZPA 4R63A 2XCPA 4PPXA 3RB0A 3PR5B 4IQUA 4F93B 3RJFA 2HVIA 4YMNA 1AROP 1BPDA 2ATLA 3RJGA 3EYZA 4PGXA 4RQ2A 4P4PA 3GQCA 1ZETA 3RRGA 4M6WA 4X5VA 1KDHA 5C5JA 4YN4A 2PFNA 4DO9A 3OJSA 4I2IA 5J2HA 5DG9A 4FBTA 2UVWA 2KTQA 1WCNA 4M04A 1RZTA 5IIOA 3V72A 5IINA 2WTFA 5F9NA 5KFGA 5KG7A 4B9LA 5KT3A 4UBBA 3MGHA 2BGWA 1X9SA 1N56A 3RJJA 2MAXA 3NGDA 4DSJA 1XWLA 1U9LA 1NOMA 5J0YA 4O3NA 3V7KA 1A76A 1UA0A 4IRCA 5DG7A 3T3FA 4J9NA 4JV0A 4DQIA 1ZQGA 5CJ7A 3TAPA 1ZQCA 4ELTA 4I2AA 3HT3A 4F4KA 3RB6A 4ED2A 5KFKA 2GWSA 1JX4A 4IRDA 5F9LA 1U47A 2KFZA 5J0TA 4DFMA 4I2GA 4IQVA 1ZQMA 2MUTA 1D8YA 5DDMA 2B21A 1SKRA 1DGSA 1ZQRA 4O3PA 3TQ1A 1ZQOA 5EWGA 9ICQA 2C2EA 3MBYA 3EW9A 5J0RA 4F91B 5CHGA 5L1LA 1S97A 4BXOB 2R8IA 4F3OA 1UT8A 4P2HA 2BPGA 4IRKA 4ECXA 8ICLA 2C2DA 1LV5A 4R8UA 3N4MB 1ZQHA 4KLIA 4F4ZA 2VANA 3THVA 4G3IA 3PR4A 2DFLA 5KT4A 2C2RA 4O5CA 9ICWA 3ISBA 3OJUA 2BQUA 1NK5A 4ECZA 1KRPA 4M6WB 4Q45A 3PO4A 5KFWA 2JEGA 3H8SA 1X2IA 3RJKA 4NM1A 3C5FA 4RQ3A 5IIIA 5KFHA 4RUCA 1U48A 1QTMA 3JPPA 2XGQA 3HW8A 4UAZA 2IBKA 5J2CA 4RQ4A 2V4RA 3KHGA 8ICKA 3QE9Y 4F4YA 3K75D 4DQSA 5J0OA 3T5LA 5KFEA 5J2IA 4NXZA 4LZDA 4DQRA 4B9NA 1KSPA 4YMMA 3GDXA 2Y1IA 5L1KA 4Z6EA 3HPOA 2R8KA 2AQ0A 5KTQA 5KG4A 4DF8A 4LZGA 5DBCA 4I2EA 5DQIA 3PW0A 9ICRA 4C8KA 3UPQA 1JIHA 2ZJ8A 5D4BA 3LK9A 4QWCA 2PXIA 2V4QA 5J2AA 4DSEA 3ZDEA 4E0DA 2J6UA 2NRXA 2HHSA 4RQ5A 2XCAA 3TFSA 4PGYA 2IHNA 4QZEA 3RBDA 3H4DA 1UA1A 4O5KA 4KLLA 1T3NA 3EPIA 4QWEA 4RNOA 1TK8A 4IR9A 8ICVA 5J0QA 3UQ0A 4FBUA 1V9PA 4I27A 4B9TA 3BQ2A 3V7LA 2P66A 4DWIA 5J2DA 4RQ0A 3Q8PB 7ICPA 4QWAA 3SI8A 1SL2A 4I28A 4F50A 4I2BA 3JPSA 3SV4A 2W9AA 1NK6A 7ICJA 2LYHA 4M47A 1QSSA 3RH6A 5DGBA 3EZ5A 3B0XA 4NLZA 3ZDBA 4DL3A 4EEYA 4RQ8A 1TAUA 2PFQA 1IM4A 3M8RA 4I2CA 4M9HA 3BJYA 9ICUA 5BOMA 3V6JA 4UB1A 5DGAA 8ICUA 4J9KA 2NRWA 3UXPA 9ICAA 3ZD9A 1TV9A 4DQPA 4DS5A 3RBEA 5KG1A 4ECYA 8ICEA 3M9MB 1TK5A 8ICHA 3Q8MA 9ICHA 2NRVA 2VA8A 1MQ3A 5HNKA 4TUPA 4Z6DA 4TUQA 2IA6A 4B9UA 3MR2A 7ICGA 7ICTA 2MUTB 2V9WA 4JK1A 3RH5A 4KLFA 1U45A 3MDAA 5EOZA 3HP6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DLE A;  4KLS A;  2BPC A;  3H7I A;  3OHA A;  4I2H A;  4DSI A;  2RDJ A;  4QZB A;  3KTQ A;  5KFN A;  5KFD A;  3RRH A;  9ICX A;  5BOL A;  4YD2 A;  2KZM A;  4DOC A;  5J0W A;  4DFJ A;  2Q0Z X;  1XSL A;  1DOQ A;  4F5N A;  3OHB A;  4J9L A;  1S0N A;  4KIT B;  4Z6F A;  1S77 D;  1TAQ A;  7ICE A;  3Q8K A;  4UB4 A;  4EBE A;  5HP4 A;  4I2F A;  8ICN A;  1NK4 A;  2FMQ A;  5KFP A;  2R8H A;  4QWD A;  9ICJ A;  5L1J A;  1HJP A;  5KFQ A;  3KHL A;  4MF2 A;  4F4W A;  1ZQK A;  1ZQZ A;  1SL1 A;  2VA2 A;  8ICO A;  9ICO A;  1PZN A;  5KG2 A;  4PH5 A;  3IHQ B;  1NK0 A;  8ICQ A;  1KFS A;  4KTQ A;  4UQG A;  4IR1 A;  1RYR A;  4UB5 A;  4IQW A;  4GC6 A;  3SZ2 A;  5J0X A;  4M9N A;  2FPM A;  4J9Q A;  3ZDD A;  5DB7 A;  1IXR A;  3RR8 A;  1S0V A;  8ICP A;  4GXK A;  2BCV A;  3C23 A;  1B22 A;  3RJH A;  4ED3 A;  8ICG A;  7ICO A;  5DLG A;  4RPY A;  3ZD8 A;  4XUS A;  1X9W A;  2HVH A;  5DB8 A;  1L5U A;  5KFB A;  3KHH A;  3PV8 A;  7ICK A;  2IHM A;  4C8O A;  5CP2 A;  3PW4 A;  1Z3E B;  4RQ1 A;  4XA5 A;  4F5Q A;  1X9M A;  1BPY A;  1KFT A;  4PGQ A;  5CA7 A;  3PX6 A;  9ICI A;  4Q44 A;  4ECV A;  4KLQ A;  1TFR A;  3JPQ A;  1BVS A;  4MFC A;  3PX0 A;  3BDP A;  5KFC A;  2Y1J A;  1NKE A;  1TKD A;  8ICF A;  8ICI A;  3K4G A;  4P4O A;  4XQ8 A;  4MFF A;  2ZTD A;  4UBC A;  3N97 B;  5D46 A;  4O3R A;  2XY5 A;  3MDC A;  1ZJN A;  3RTV A;  3UXN A;  4UAW A;  1NJY A;  4TQR A;  8ICC A;  1ZQB A;  5KFM A;  1BGX T;  1T8E A;  3NTU A;  9ICC A;  1S9F A;  1COO A;  1LB2 B;  3JPO A;  5KFU A;  2FMP A;  4NY8 A;  1WCL A;  1XS9 D;  2ZUC A;  4QW9 A;  5L1I A;  3MFI A;  1XSP A;  5KFR A;  5DB6 A;  2M9N A;  7ICF A;  9ICM A;  1CUK A;  3GIM A;  2JZB B;  3C1Y A;  2ASJ A;  4ED8 A;  2XC9 A;  9ICT A;  1QSL A;  4KN7 A;  1XO1 A;  4JUZ A;  3RB4 A;  4MEX A;  2F1H A;  5HHH A;  5KT6 A;  7ICN A;  4I2J A;  1ZQQ A;  1SKW A;  4JV2 A;  2P6U A;  3SV3 A;  1ZQP A;  4M9L A;  4NLG A;  3C2M A;  5DQH A;  4YR0 A;  9ICL A;  4XRH A;  4DSK A;  4YXJ A;  9ICK A;  3FDS A;  4DFK A;  1HUZ A;  3G6V A;  3KHR A;  4M0A A;  4YR2 A;  4Q8E A;  4QZF A;  2R8G A;  4C8L A;  4YCX A;  5KT7 A;  2ISP A;  4I29 A;  4J9M A;  4RQ6 A;  1S0M A;  7ICS A;  2NRT A;  3H8W A;  4YXM A;  5KG3 A;  4DF4 A;  5HHI A;  5DDY A;  4F5R A;  4HYK A;  4O9M A;  5J0P A;  3T5K A;  2BCQ A;  5KFJ A;  2I1Q A;  1ZQL A;  3HWT A;  4QZH A;  1ZQJ A;  1CEZ A;  3GV8 B;  5IIL A;  4KLM A;  4Z6C A;  4NLK A;  7ICM A;  2KN7 A;  4ECW A;  4NLN A;  3AUO A;  2ASD A;  7ICH A;  4GXI A;  3T5J A;  4DFP A;  2FPL A;  3JPR A;  2AGP A;  3PW5 A;  9ICE A;  3QEB Z;  2R8J A;  2XGP A;  2AGQ A;  2BCU A;  3C2K A;  2W9C B;  2W8L A;  3T5H A;  4C8N A;  3M9N B;  3TFR A;  1ZJM A;  8ICA A;  2RDI A;  2ZTE A;  4O0I A;  2DPJ A;  2ZTC A;  5KFI A;  1KEJ A;  5J2B A;  7ICI A;  1ZQU A;  4NM2 A;  5L9X A;  2HHV A;  5KG0 A;  5HMM A;  3SYZ A;  4ECT A;  3PVX A;  2JZB A;  3RAX A;  2PFP A;  4R64 A;  5DLF A;  1ZYQ A;  3ZDA A;  1KFD A;  3M9O B;  9ICB A;  4FS2 A;  1RYS A;  1Z00 B;  1U49 A;  3MR3 A;  2HHU A;  9ICF A;  2J6S A;  1ZQD A;  4ED6 A;  4EBC A;  4QZ9 A;  4KLH A;  3V7J A;  3C2L A;  1D9F A;  3GIL A;  3C21 A;  3G6X A;  4BGD A;  3QZ7 A;  4DSF A;  3RJI A;  4RZR A;  4F5P A;  3C1Z A;  1KLN A;  4QZC A;  4O5E A;  2XO7 A;  1N48 A;  1XSN A;  3E2E A;  1D9D A;  3QZ8 A;  1K1Q A;  9ICP A;  5EWE A;  5KT2 A;  4UB3 A;  4KLT A;  4ED1 A;  2UVV A;  3RJE A;  4DL7 A;  1S76 D;  3GII A;  3ISD A;  2AGO A;  1UT5 A;  2AQ4 A;  4QWB A;  3PO5 A;  5DBB A;  5IIM A;  7ICV A;  1NKC A;  9ICV A;  1BPB A;  4O3Q A;  2BR0 A;  2NRZ A;  4M9J A;  4ELU A;  1U4B A;  4YFK A;  3IM1 A;  5KFS A;  4EYH B;  1C7Y A;  3EWA A;  4RU9 A;  2XY7 A;  4R8U B;  2VA3 A;  2W9C A;  1MQ2 A;  1T7P A;  1ZQW A;  3ISC A;  2KFN A;  3ZDC A;  8ICT A;  3BQT A;  1Y88 A;  4YVZ A;  2PI4 A;  4EZ6 A;  1HUO A;  4TUR A;  2FLL A;  4ELV A;  2XY6 A;  4K4I A;  1L3T A;  4B9M A;  4DSL A;  5BPC A;  3HX0 A;  2JEF A;  4DLG A;  4K4H A;  2HHT A;  2HHQ A;  4DL2 A;  3RR7 A;  4JWM A;  5J2F A;  3MR5 A;  5J2K A;  4DS4 A;  5KFF A;  2BCR A;  3H40 A;  4YMO A;  2UVU A;  1Z00 A;  1ZQV A;  2BKE A;  4DL6 A;  1ZQX A;  3PW2 A;  8ICJ A;  4DOB A;  2FLN A;  3GV7 B;  3Q8R B;  7ICQ A;  4RQ7 A;  4QW8 A;  5DB9 A;  4UB2 A;  4KN4 A;  1TK0 A;  2FMS A;  5CWR A;  4ECQ A;  4LVS A;  2A1J A;  4QZA A;  3OGU A;  2W9B A;  4KLJ A;  1RXW A;  3ETL A;  4MF8 A;  1NK8 A;  1ZQE A;  4B9V A;  3H8J A;  3MGI A;  5KFT A;  4DL5 A;  3Q8S B;  4B9S A;  1JMS A;  4ECU A;  4YR3 A;  3PNC A;  3GIJ A;  2ISO A;  5KFV A;  4YD1 A;  2C28 A;  4K4G A;  4KLO A;  5TZV A;  1KTQ A;  3QEA Z;  9ICN A;  3TAN A;  3B0Y A;  4DQQ A;  3PY8 A;  4Q43 A;  4GXJ A;  4KLD A;  1L3V A;  4R65 A;  3FYH A;  1H38 A;  2UVR A;  4BWM A;  4BXO A;  1B43 A;  2HHW A;  1T4G A;  2F1J A;  5DQG A;  4F4X A;  4ED0 A;  4JWN A;  5DG8 A;  4QZI A;  1EXN A;  2HW3 A;  5KFY A;  9ICG A;  1A77 A;  2KZ3 A;  2W9M A;  2BQR A;  2ZUD A;  2AU0 A;  3BQ1 A;  1ZQA A;  2F1I A;  1SL0 A;  4EZ9 A;  4CCH A;  3RH4 A;  4QZ8 A;  8ICX A;  2FLP A;  4EYI B;  2J6T A;  2BQ3 A;  5CB1 A;  2BHN A;  5KG6 A;  3C5G A;  4M9G A;  2ZJ5 A;  4M2Y A;  1RXV A;  1ZQS A;  2AJQ A;  5HML A;  3OSP A;  4I2D A;  5J29 A;  4TQS A;  4ECS A;  2I9G A;  8ICR A;  4MEY A;  3MR6 A;  4KMU A;  3UXO A;  4GC7 A;  4ECR A;  8ICS A;  4IQT A;  4DL4 A;  3TAR A;  3MAB A;  1K1S A;  4KLE A;  1ZQI A;  4Q8F A;  4BWJ A;  4RNM A;  2ASL A;  3BQ0 A;  1NJZ A;  4O3O A;  2JEI A;  3PX4 A;  3GFK B;  3TAQ A;  2BPF A;  4R66 A;  4EBD A;  4PHP A;  1ZQT A;  3Q8Q B;  2IMW P;  7ICL A;  5D49 A;  4RPZ A;  3PW7 A;  4RNN A;  1BPX A;  1SKS A;  5EWF A;  3LDA A;  1NK7 A;  4PHD A;  4F2S A;  1RPL A;  2ZJA A;  3EPG A;  1JN3 A;  5KFX A;  3JPT A;  1QLN A;  3G6Y A;  4MFA A;  7ICR A;  3RB3 A;  2P6R A;  1BPE A;  5KFZ A;  2W9B B;  4FS1 A;  5KT5 A;  1ZQN A;  5KFA A;  2DPI A;  2C22 A;  3AU6 A;  2BCS A;  4PHA A;  1D8L A;  4F92 B;  4QZD A;  1S10 A;  3V6H A;  2HHX A;  2BDP A;  8ICW A;  5JUM A;  3ORY A;  1MSW D;  4P4M A;  3V6K A;  5CR0 A;  1JXL A;  4ED7 A;  8ICB A;  4GLX A;  4YG2 A;  4FO6 A;  3LWM A;  1MC8 A;  4RT2 A;  3PML A;  1NJX A;  4QZG A;  4PHE A;  4KLU A;  3JPN A;  2H5X A;  5IIJ A;  5DBA A;  4ZH4 A;  4F8R A;  2A1J B;  1ZQY A;  1L3U A;  4RUA A;  1JXE A;  4UAY A;  5DKW A;  5J2G A;  4RPX A;  3Q8L A;  5J2E A;  1XC9 A;  1ZQF A;  4DEZ A;  5J2J A;  1XU4 A;  5KFO A;  5KG5 A;  4F2R A;  4KLG A;  3UQ2 A;  3MFH A;  1NK9 A;  1BPZ A;  8ICZ A;  3AU2 A;  4J9R A;  2ALZ A;  5J0U A;  1S0O A;  9ICS A;  4YP3 A;  1NJW A;  2PFO A;  5KFL A;  4TUS A;  4J9O A;  4C8M A;  4RT3 A;  1TVA A;  1L3S A;  4O3S A;  3LWL A;  3RAQ A;  4JV1 A;  2W8K A;  5J0S A;  5IIK A;  4F5O A;  4DOA A;  8ICM A;  2OWO A;  8ICY A;  4YQW A;  2PI5 A;  4J9S A;  3TI0 A;  4BDP A;  4J9P A;  2ZUB A;  3GIK A;  3GV5 B;  1QSY A;  3OSN A;  2FPK A;  3PMN A;  3M8S A;  3H4B A;  1NKB A;  2KZZ A;  2JEJ A;  7ICU A;  1SZP A;  4R63 A;  2XCP A;  4PPX A;  3RB0 A;  3PR5 B;  4IQU A;  4F93 B;  3RJF A;  2HVI A;  4YMN A;  1ARO P;  1BPD A;  2ATL A;  3RJG A;  3EYZ A;  4PGX A;  4RQ2 A;  4P4P A;  3GQC A;  1ZET A;  3RRG A;  4M6W A;  4X5V A;  1KDH A;  5C5J A;  4YN4 A;  2PFN A;  4DO9 A;  3OJS A;  4I2I A;  5J2H A;  5DG9 A;  4FBT A;  2UVW A;  2KTQ A;  1WCN A;  4M04 A;  1RZT A;  5IIO A;  3V72 A;  5IIN A;  2WTF A;  5F9N A;  5KFG A;  5KG7 A;  4B9L A;  5KT3 A;  4UBB A;  3MGH A;  2BGW A;  1X9S A;  1N56 A;  3RJJ A;  2MAX A;  3NGD A;  4DSJ A;  1XWL A;  1U9L A;  1NOM A;  5J0Y A;  4O3N A;  3V7K A;  1A76 A;  1UA0 A;  4IRC A;  5DG7 A;  3T3F A;  4J9N A;  4JV0 A;  4DQI A;  1ZQG A;  5CJ7 A;  3TAP A;  1ZQC A;  4ELT A;  4I2A A;  3HT3 A;  4F4K A;  3RB6 A;  4ED2 A;  5KFK A;  2GWS A;  1JX4 A;  4IRD A;  5F9L A;  1U47 A;  2KFZ A;  5J0T A;  4DFM A;  4I2G A;  4IQV A;  1ZQM A;  2MUT A;  1D8Y A;  5DDM A;  2B21 A;  1SKR A;  1DGS A;  1ZQR A;  4O3P A;  3TQ1 A;  1ZQO A;  5EWG A;  9ICQ A;  2C2E A;  3MBY A;  3EW9 A;  5J0R A;  4F91 B;  5CHG A;  5L1L A;  1S97 A;  4BXO B;  2R8I A;  4F3O A;  1UT8 A;  4P2H A;  2BPG A;  4IRK A;  4ECX A;  8ICL A;  2C2D A;  1LV5 A;  4R8U A;  3N4M B;  1ZQH A;  4KLI A;  4F4Z A;  2VAN A;  3THV A;  4G3I A;  3PR4 A;  2DFL A;  5KT4 A;  2C2R A;  4O5C A;  9ICW A;  3ISB A;  3OJU A;  2BQU A;  1NK5 A;  4ECZ A;  1KRP A;  4M6W B;  4Q45 A;  3PO4 A;  5KFW A;  2JEG A;  3H8S A;  1X2I A;  3RJK A;  4NM1 A;  3C5F A;  4RQ3 A;  5III A;  5KFH A;  4RUC A;  1U48 A;  1QTM A;  3JPP A;  2XGQ A;  3HW8 A;  4UAZ A;  2IBK A;  5J2C A;  4RQ4 A;  2V4R A;  3KHG A;  8ICK A;  3QE9 Y;  4F4Y A;  3K75 D;  4DQS A;  5J0O A;  3T5L A;  5KFE A;  5J2I A;  4NXZ A;  4LZD A;  4DQR A;  4B9N A;  1KSP A;  4YMM A;  3GDX A;  2Y1I A;  5L1K A;  4Z6E A;  3HPO A;  2R8K A;  2AQ0 A;  5KTQ A;  5KG4 A;  4DF8 A;  4LZG A;  5DBC A;  4I2E A;  5DQI A;  3PW0 A;  9ICR A;  4C8K A;  3UPQ A;  1JIH A;  2ZJ8 A;  5D4B A;  3LK9 A;  4QWC A;  2PXI A;  2V4Q A;  5J2A A;  4DSE A;  3ZDE A;  4E0D A;  2J6U A;  2NRX A;  2HHS A;  4RQ5 A;  2XCA A;  3TFS A;  4PGY A;  2IHN A;  4QZE A;  3RBD A;  3H4D A;  1UA1 A;  4O5K A;  4KLL A;  1T3N A;  3EPI A;  4QWE A;  4RNO A;  1TK8 A;  4IR9 A;  8ICV A;  5J0Q A;  3UQ0 A;  4FBU A;  1V9P A;  4I27 A;  4B9T A;  3BQ2 A;  3V7L A;  2P66 A;  4DWI A;  5J2D A;  4RQ0 A;  3Q8P B;  7ICP A;  4QWA A;  3SI8 A;  1SL2 A;  4I28 A;  4F50 A;  4I2B A;  3JPS A;  3SV4 A;  2W9A A;  1NK6 A;  7ICJ A;  2LYH A;  4M47 A;  1QSS A;  3RH6 A;  5DGB A;  3EZ5 A;  3B0X A;  4NLZ A;  3ZDB A;  4DL3 A;  4EEY A;  4RQ8 A;  1TAU A;  2PFQ A;  1IM4 A;  3M8R A;  4I2C A;  4M9H A;  3BJY A;  9ICU A;  5BOM A;  3V6J A;  4UB1 A;  5DGA A;  8ICU A;  4J9K A;  2NRW A;  3UXP A;  9ICA A;  3ZD9 A;  1TV9 A;  4DQP A;  4DS5 A;  3RBE A;  5KG1 A;  4ECY A;  8ICE A;  3M9M B;  1TK5 A;  8ICH A;  3Q8M A;  9ICH A;  2NRV A;  2VA8 A;  1MQ3 A;  5HNK A;  4TUP A;  4Z6D A;  4TUQ A;  2IA6 A;  4B9U A;  3MR2 A;  7ICG A;  7ICT A;  2MUT B;  2V9W A;  4JK1 A;  3RH5 A;  4KLF A;  1U45 A;  3MDA A;  5EOZ A;  3HP6 A; 
#chains in the Genus database with same CATH topology
 4NWI A;  5ALT A;  4DLE A;  2BPC A;  4KLS A;  3H7I A;  3OHA A;  2WB1 F;  5AK5 A;  4KIT B;  1S77 D;  1NK4 A;  2DKZ A;  5KFQ A;  4CE6 A;  1Q3U A;  1ZQZ A;  8ICO A;  1PZN A;  1FFV A;  5KG2 A;  3IHQ B;  2KOB A;  4IR1 A;  4GC6 A;  2FPM A;  3RR8 A;  2HMX A;  4UB6 U;  2BCV A;  3C23 A;  2VIX A;  2BDU A;  3RJH A;  8ICG A;  1X9W A;  3KKA C;  1K5O A;  3MGV A;  5CP2 A;  1Z3E B;  4PGQ A;  4Q44 A;  4ECV A;  2R18 A;  2G09 A;  4CGZ A;  1BVS A;  1YZ6 A;  3BDP A;  1NKE A;  1MN8 A;  1QH9 A;  4PZO A;  1QQ7 A;  3K4G A;  2ZTD A;  3N97 B;  2XY5 A;  3UXN A;  3QU2 A;  8ICC A;  1BGX T;  1PK1 A;  2ZIW B;  4AYB C;  1S9F A;  1COO A;  2ZUC A;  2JH1 A;  5DB6 A;  2M9N A;  3GIM A;  2KD1 A;  3VC8 A;  2ASJ A;  4ED8 A;  2ODG A;  9ICT A;  4KN7 A;  1XO1 A;  2GH1 A;  3RB4 A;  5KT6 A;  5ALY A;  2HBK A;  2KG5 A;  4JV2 A;  3SV3 A;  3K1R B;  9ICK A;  2W3R A;  1HUZ A;  3CRX A;  4HAI A;  2ZIX B;  4J9M A;  1URJ A;  3WKB A;  7ICS A;  2NRT A;  4DF4 A;  5KG3 A;  4US8 A;  5HHI A;  3T5K A;  2BCQ A;  5KFJ A;  3HWT A;  1CEZ A;  2EAP A;  4NLK A;  3HRD D;  3QU9 A;  2ASD A;  4GXI A;  1WYG A;  3QEB Z;  2BCU A;  2W9C B;  8ICA A;  2RDI A;  2XVT A;  1V97 A;  7ICI A;  5KG0 A;  5HMM A;  3SYZ A;  4ECT A;  3M7D A;  2KJ8 A;  3AN1 A;  3V7J A;  1D9F A;  1KLN A;  3RJI A;  1QQ6 A;  4RZR A;  4O5E A;  2XO7 A;  4LJX A;  5EWE A;  4UB3 A;  1UHU A;  4KLT A;  5ALL A;  2UVV A;  1S76 D;  4DL7 A;  2AGO A;  2AQ4 A;  3PO5 A;  2QAR B;  1BPB A;  2BR0 A;  4M9J A;  4RU9 A;  2XY7 A;  3I1Y A;  4R8U B;  2VA3 A;  2W9C A;  1MQ2 A;  8ICT A;  1X9X A;  4EX7 A;  2OCE A;  1HUO A;  4K4I A;  1L3T A;  4B9M A;  4DSL A;  2JEF A;  4DLG A;  1Z4O A;  4DL2 A;  2F8K A;  3D2Q A;  5J2K A;  3NUQ A;  4EX6 A;  8ICJ A;  4DOB A;  4QW8 A;  1SZH A;  1RXW A;  4B9V A;  2RRD A;  4DL5 A;  4B9S A;  4ECU A;  4YR3 A;  3PNC A;  3TAD C;  4NJ8 A;  4K4G A;  3QEA Z;  4Q43 A;  1QQ5 A;  1L3V A;  2HBJ A;  4UB8 U;  2HHW A;  5DQG A;  4JWN A;  4QZI A;  1EXN A;  2HW3 A;  2W9M A;  1ZQA A;  2KVC A;  1Z19 A;  3AL0 B;  2BQ3 A;  2BHN A;  2KP7 A;  2XID A;  4M2Y A;  5HML A;  2ZIU B;  5J29 A;  3MR6 A;  3UXO A;  5AM0 A;  4ECR A;  4IQT A;  3TAR A;  2RLT A;  3MAB A;  5ALG A;  4KLE A;  4Q8F A;  4BWJ A;  2JEI A;  4O3O A;  3PX4 A;  3TAQ A;  7ICL A;  1KL9 A;  3PW7 A;  1NK7 A;  4F2S A;  3AEV A;  3KZX A;  1QLN A;  1JN3 A;  5ALS A;  3RB3 A;  1BPE A;  2W9B B;  3ALR A;  5B66 U;  2C22 A;  2CN1 A;  3AU6 A;  4PHA A;  1VDV A;  4QZD A;  1X40 A;  1PVQ A;  5AKK A;  2QB0 A;  1MSW D;  2G5H B;  1NJX A;  2PKE A;  2E8O A;  1JUD A;  2A1J B;  2K4I A;  3PSP A;  2DL0 A;  3R9K A;  3WK5 A;  3MFH A;  1NK9 A;  1BPZ A;  8ICZ A;  2ALZ A;  2PFO A;  2KE7 A;  5KFL A;  4RT3 A;  4O3S A;  3RAQ A;  4JV1 A;  3QU5 A;  5J0S A;  4OD0 A;  4DOA A;  2G0A A;  3TI0 A;  4BDP A;  4J9P A;  2ZUB A;  1QSY A;  2KZZ A;  2HSZ A;  3RB0 A;  4F93 B;  2A3V A;  2HVI A;  2LYA A;  3EYZ A;  4PGX A;  4P4P A;  5CRX A;  3GQC A;  5J8Y A;  4M6W A;  1KDH A;  2F44 A;  1NZB A;  4KMO B;  5DG9 A;  2UVW A;  5IIO A;  2W54 A;  4ACO A;  5F9N A;  5KFG A;  5KG7 A;  1HEK A;  4B9L A;  3MGH A;  1X9S A;  1N56 A;  3NGD A;  1XWL A;  2D8C A;  1U9L A;  1UCV A;  4O3N A;  3V7K A;  4J9N A;  1SV0 C;  5CJ7 A;  2H3Z A;  3NVW A;  4ELT A;  2HDO A;  2GWS A;  1JX4 A;  4WJ3 B;  3RFA A;  3SQI A;  2QLT A;  5EWG A;  3MBY A;  2YMQ A;  4F3O A;  1UT8 A;  5E79 U;  2C2D A;  1LV5 A;  4KLI A;  4F4Z A;  2VAN A;  4G3I A;  4O5C A;  3D6J A;  3ISB A;  1YT3 A;  4C4T A;  1NK5 A;  4ECZ A;  5KFW A;  2JEG A;  1X2I A;  4NM1 A;  1KW4 A;  3A0H U;  2ZXI A;  2KMD A;  2I5H A;  2IBK A;  5J2C A;  2P35 A;  1MA7 A;  3K75 D;  2ZG6 A;  3M6Z A;  1ZQ1 C;  4UAS A;  5FP0 A;  4DQR A;  1KSP A;  3LVV A;  2K60 A;  1SV0 A;  5L1K A;  4DF8 A;  1Z1V A;  4LZG A;  5DQI A;  2VJ4 A;  5G5H A;  4DSE A;  2J6U A;  2HHS A;  4QZE A;  4KLL A;  4O5K A;  3N7S C;  1DRG A;  1TK8 A;  1GO3 F;  3ED5 A;  3UQ0 A;  2DBY A;  4I27 A;  3V7L A;  2MSN A;  5T14 A;  2K4P A;  4I2B A;  3JPS A;  3SV4 A;  3SR6 A;  1L7M A;  4QJF B;  3ONN A;  1ED1 A;  4Y2R A;  4M47 A;  1TAM A;  4DL3 A;  4RQ8 A;  2CXY A;  3IRU A;  3M8R A;  4I2C A;  3BJY A;  4ICA A;  2IOH A;  3V6J A;  2NRW A;  3UXP A;  5ALF A;  3RBE A;  3BS5 A;  8ICE A;  3M9M B;  1TK5 A;  1FIQ A;  1MQ3 A;  4B9U A;  3MR2 A;  7ICT A;  2KJ9 A;  1U45 A;  2RQ5 A;  3MDA A;  3HP6 A;  5AI9 A;  3B9J A;  4QZB A;  4C0Z A;  9ICX A;  5KFN A;  3RRH A;  3PSI A;  4YD2 A;  1L6N A;  1N61 A;  5J0W A;  4DOC A;  2HI0 A;  1DOQ A;  4F5N A;  4PZN A;  1SGG A;  4Z6F A;  2IOF K;  4EEN A;  4UB4 A;  4I2F A;  8ICN A;  2R8H A;  9ICJ A;  1HJP A;  4MF2 A;  1SL1 A;  9ICO A;  8ICQ A;  3U26 A;  3CW2 C;  2KV2 A;  4IQW A;  4J9Q A;  2K8C B;  1S0V A;  5AM1 A;  1B22 A;  7ICO A;  5DLG A;  3ZD8 A;  3I28 A;  4Y2S A;  1L5U A;  5KFB A;  2WF6 A;  3PV8 A;  7ICK A;  5AKZ A;  2IHM A;  1KFT A;  3PW4 A;  1BPY A;  2RP5 A;  5CA7 A;  1L8O A;  3JPQ A;  4B6J A;  5KFC A;  4BJQ A;  4XQ8 A;  3UMC A;  4UBC A;  5D46 A;  4O3R A;  3MDC A;  3RTV A;  5AHX A;  2YQE A;  4UAW A;  4TQR A;  2AXT U;  1IV8 A;  3D2S A;  1T8E A;  9ICC A;  2FMP A;  4NY8 A;  5AKH A;  5ALK A;  1XSP A;  3MFI A;  7ICF A;  2JZB B;  3C1Y A;  1LKY B;  1QSL A;  3KD3 A;  3F2B A;  4PL2 A;  5ALU A;  1SKW A;  4Y2U A;  2P6U A;  4M9L A;  1FEZ A;  3C2M A;  4YXJ A;  3FDS A;  4M0A A;  3UM9 A;  2W04 A;  5KT7 A;  2ISP A;  5EE3 A;  1L8L A;  4F5R A;  4HYK A;  1ZQL A;  2I1Q A;  4QZH A;  4F72 A;  4KLM A;  3VCB A;  2KN7 A;  3QUB A;  4US9 A;  3T5J A;  3JPR A;  2AGP A;  2R8J A;  3C2K A;  2LM1 A;  1ZJM A;  2ZTE A;  4O0I A;  5KFI A;  1XNS A;  1S8O A;  1ZQU A;  3SEI A;  3RAX A;  5KL8 B;  2PFP A;  2F2A B;  3ZDA A;  1KFD A;  9ICB A;  2E1E A;  4P0P B;  2J6S A;  1ZQD A;  3IG5 A;  4EBC A;  4OJP A;  2OHF A;  4QZ9 A;  4KLH A;  3C2L A;  3BQ7 A;  3G6X A;  5JU5 A;  3C1Z A;  1N48 A;  1A6S A;  2EZY A;  4ED1 A;  5DBB A;  7ICV A;  1WWU A;  2MA1 A;  2KIV A;  3A0B U;  1U4B A;  1C7Y A;  1J97 A;  1ZQW A;  3BQT A;  1Y88 A;  2PI4 A;  3I76 A;  4C7Z A;  4Y2J A;  4JWM A;  5J2F A;  1DXS A;  1RG6 A;  1CRX A;  4P0Q A;  1ZQV A;  1L7P A;  1ZQX A;  3F2D A;  3T79 A;  5DB9 A;  2CPR A;  1HIW A;  5AK3 A;  3OGU A;  4KLJ A;  4MF8 A;  5KFT A;  1PK3 A;  3IG8 A;  5JTI A;  2WB1 C;  1F44 A;  4FFD A;  3PY8 A;  1H38 A;  4KX5 A;  4ED0 A;  1A77 A;  2KZ3 A;  3SEN A;  4NV0 A;  2ZUD A;  5AI8 A;  5JRT A;  3BQ1 A;  2F1I A;  1SL0 A;  4CCH A;  8ICX A;  2FLP A;  5KG6 A;  4M9G A;  2YX8 A;  5GTH U;  4RQN A;  1RXV A;  3OSP A;  4ECS A;  2I9G A;  2FI1 A;  5EE9 A;  2JXJ A;  2JV3 A;  2QAR A;  1K1S A;  4CF5 A;  1ZQI A;  4RNM A;  1NJZ A;  2JHD A;  2F77 X;  4R66 A;  4EBD A;  1ZQT A;  2IMW P;  3RF9 A;  2K4H A;  4PHD A;  3EPG A;  3CP8 A;  3N7R C;  2P6R A;  1ZQN A;  4Y2V A;  8ICW A;  4FZN A;  3ORY A;  4OCZ A;  2KHV A;  3V6K A;  4ED7 A;  2LKY A;  3QUQ A;  1N5W A;  2KEY A;  4FO6 A;  3PML A;  4QZG A;  4KLU A;  2B6G A;  2H5X A;  2DWQ A;  2LMR A;  5DBA A;  4F8R A;  2JMG A;  1JXE A;  1S5L U;  1ZQF A;  4DEZ A;  5J2J A;  1XU4 A;  4KLG A;  3UQ2 A;  5J0U A;  1NJW A;  4J9O A;  3WK7 A;  3LWL A;  3WK6 A;  3N7P D;  2OYY A;  4YQW A;  2PI5 A;  1DGJ A;  3OSN A;  3PMN A;  2JEJ A;  4R63 A;  5C0Y A;  4PPX A;  3PR5 B;  2WAQ C;  4YMN A;  2ATL A;  3RJG A;  3RRG A;  5C5J A;  2PFN A;  3HKZ C;  5GTI U;  4I2I A;  4C80 A;  1WCN A;  4M04 A;  2CRX A;  3WK4 A;  4AP9 A;  3UMG A;  1N63 A;  5AM2 A;  4DQI A;  3TAP A;  1JAL A;  1LVH A;  4F4K A;  1O08 A;  3RB6 A;  4ED2 A;  2KFZ A;  4DFM A;  4I2G A;  1KQQ A;  3QUT A;  1WWV A;  1D8Y A;  1SKR A;  2B21 A;  1DGS A;  1ZQR A;  5B5E U;  3TQ1 A;  1RQN A;  5L1L A;  5ALV A;  2BPG A;  2Y9T A;  1TE2 A;  5KT4 A;  2WF8 A;  2KIC A;  2H3Q A;  4M6W B;  4Q45 A;  2NV3 A;  2EQY A;  3C5F A;  5III A;  5KFH A;  4RUC A;  1QTM A;  3JPP A;  2W11 A;  3K1Z A;  3QUC A;  3QE9 Y;  4DQS A;  5J2I A;  4NXZ A;  4LZD A;  2OH2 A;  3GDX A;  2E1F A;  4BX9 C;  2AQ0 A;  2Y0S C;  5KG4 A;  2K89 A;  5AKI A;  4I2E A;  2YB4 A;  1FFU A;  2ZJ8 A;  4QWC A;  2PXI A;  5KL1 B;  3ZDE A;  2NRX A;  4C7Y A;  4RQ5 A;  3TFS A;  4PGY A;  3RBD A;  4QWE A;  3TAD A;  4IR9 A;  8ICV A;  5J0Q A;  4FBU A;  5ALW A;  2K8A A;  3C28 A;  5J2D A;  3OTQ A;  3PSF A;  4QWA A;  2EZZ A;  1PUZ A;  5CEH A;  1NK6 A;  3RH6 A;  2B0C A;  4CNQ A;  3EZ5 A;  4NLZ A;  3AQE A;  4EEY A;  1TAU A;  2PFQ A;  3QNM A;  4F71 A;  2YN4 A;  1ZRN A;  2LBO A;  8ICU A;  4C4S A;  4J9K A;  3ZD9 A;  4ECY A;  3Q8M A;  2EAO A;  9ICH A;  2VA8 A;  5HNK A;  4Z6D A;  2H3I A;  4OJ6 A;  4I2H A;  3GZF A;  2A1A A;  3HKZ F;  3KTQ A;  5KFD A;  1PVP A;  1XSL A;  4J9L A;  1TAQ A;  7ICE A;  3Q8K A;  4EBE A;  1KN5 A;  5HP4 A;  5KFP A;  5L1J A;  4EEK A;  4F4W A;  2VA2 A;  1NK0 A;  3ICX A;  1KFS A;  4UQG A;  2H3F A;  4UB5 A;  2KKV A;  2YY6 A;  4O3M A;  5J0X A;  4M9N A;  3UMB A;  5ALN A;  5DB7 A;  3TAC B;  1ZD4 A;  4ED3 A;  4RPY A;  4RQ1 A;  4XA5 A;  3PX6 A;  9ICI A;  1TFR A;  4MFC A;  2Y1J A;  3AMZ A;  2M0N A;  4MFF A;  4G9B A;  1Z4N A;  1ZD2 P;  5KFM A;  2ZIU A;  3NTU A;  4EEL A;  2GO7 A;  1LB2 B;  3QU4 A;  3JPO A;  1COK A;  1XS9 D;  4QW9 A;  4KX3 A;  5AKG A;  2XC9 A;  3HIL A;  4JUZ A;  2W7O A;  4MEX A;  5HHH A;  2LI6 A;  7ICN A;  2QB1 A;  1ZQP A;  2BZF A;  1N60 A;  4DSK A;  3NRW A;  4DFK A;  4PJ0 U;  4YR2 A;  4YCX A;  4UAV A;  3H8M A;  5ALM A;  4RQ6 A;  3E58 A;  1S0M A;  4YXM A;  3F2C A;  5DDY A;  3IDW A;  1ZQJ A;  3WK9 A;  3GV8 B;  2W03 A;  5IIL A;  3SAH A;  7ICH A;  3H0R B;  3LYS A;  2KK0 A;  9ICE A;  2AGQ A;  3NVY A;  2W8L A;  3T5H A;  3WKC A;  2ZTC A;  1KEJ A;  5J2B A;  1FO4 A;  5L9X A;  2HHV A;  2OEH A;  3CNH A;  3PVX A;  2JZB A;  4R64 A;  5DLF A;  4FS2 A;  1Z00 B;  4JMU A;  1U49 A;  4CF3 A;  3DEE A;  4ED6 A;  5AM3 A;  4U7C A;  3GIL A;  4DSF A;  4BGD A;  3QZ7 A;  9ICL A;  1Q3V A;  4QZC A;  3E2E A;  1JRO A;  1D9D A;  5AKX A;  4J03 A;  3GII A;  1UT5 A;  4QWB A;  1NKC A;  9ICV A;  4O3Q A;  2NRZ A;  4ELU A;  4YFK A;  2PMZ F;  5KFS A;  4EYH B;  3EWA A;  1NNL A;  2KFN A;  3ZDC A;  4YVZ A;  3M1Y A;  4EZ6 A;  2FLL A;  4ELV A;  2D6F C;  5BPC A;  3HX0 A;  2E5S A;  1VJ5 A;  4ZOH C;  1SIJ A;  3MR5 A;  2W7P A;  1T94 A;  3H40 A;  5TIS U;  1ZOL A;  4YMO A;  2UVU A;  1Z00 A;  2E8P A;  2EDU A;  3QX7 A;  4DL6 A;  4OJL A;  2FLN A;  3IV6 A;  2H3V A;  3Q8R B;  7ICQ A;  2HBL A;  2DKX A;  4ECQ A;  4QZA A;  5HR6 A;  3L5K A;  3H8J A;  3MGI A;  2FDR A;  2DGZ A;  3Q8S B;  1JMS A;  5KFV A;  4GIB A;  2C28 A;  4KLO A;  4QIW C;  1KTQ A;  1V85 A;  1ZXI A;  5TZV A;  3PZP A;  2UVR A;  1B43 A;  1T4G A;  4F4X A;  5G5G A;  5KFY A;  1DK2 A;  2BQR A;  2EZX A;  2VKQ A;  4EZ9 A;  3RH4 A;  3KKA A;  4QZ8 A;  4EYI B;  2G5I B;  2J6T A;  5CB1 A;  1SXE A;  2ZJ5 A;  2AJQ A;  8ICR A;  4MEY A;  4GC7 A;  8ICS A;  1J2M A;  4DL4 A;  2NYV A;  3BQ0 A;  3GFK B;  2BPF A;  3Q8Q B;  3QXG A;  4RNN A;  5EWF A;  4GFJ A;  1AQ6 A;  1RPL A;  2ZJA A;  7ICR A;  3JPT A;  2ES6 A;  5KFZ A;  5KFA A;  2Y9U A;  5AI0 A;  2DPI A;  2KIW A;  3V6H A;  2HHX A;  2BDP A;  4FZL A;  4P4M A;  1JXL A;  2JRZ A;  4IS7 A;  2EH9 A;  3LWM A;  4RT2 A;  4PHE A;  3JPN A;  2ZIV A;  4OO1 J;  3PST A;  4ZH4 A;  2AH5 A;  1L3U A;  4RUA A;  4UAY A;  4RPX A;  5J2E A;  5KFO A;  5KG5 A;  3AU2 A;  2OXO A;  4J9R A;  5ALQ A;  1L7N A;  4YP3 A;  3NRZ A;  3F5E A;  4C8M A;  1TVA A;  1L3S A;  5ALH A;  2W8K A;  5IIK A;  4F5O A;  5F3X B;  3BZK A;  2OWO A;  3NS1 A;  4J9S A;  3GIK A;  1JI7 A;  3M8S A;  2FPK A;  7ICU A;  1SZP A;  4OJ5 A;  4IQU A;  1BPD A;  1RDF A;  4PL1 A;  1ZET A;  2HOF A;  4X5V A;  3OJS A;  5J2H A;  1UQV A;  3V72 A;  5IIN A;  1IIP A;  2WTF A;  2WF9 A;  2YML A;  5KT3 A;  4UBB A;  3WKE A;  1X66 A;  2BGW A;  3RJJ A;  1A76 A;  4IRC A;  5DG7 A;  3BZC A;  2DQN B;  5AI6 A;  4JV0 A;  2MU2 A;  5ALI A;  1ZQG A;  3SMV A;  4DCC A;  3HT3 A;  2WF7 A;  4CF4 A;  5KFK A;  4IRD A;  5F9L A;  2MUT A;  3LVW A;  2C2E A;  3EW9 A;  5J0R A;  2HCF A;  2A19 A;  4F91 B;  4Y2T A;  1S97 A;  4BXO B;  4P2H A;  1LKY A;  4IRK A;  8ICL A;  2YMP A;  4C4R A;  3EUB 2;  2HBM A;  4UAT A;  3THV A;  3PR4 A;  2C2R A;  1DK3 A;  9ICW A;  3OJU A;  1KRP A;  3IN5 A;  1F0M A;  3RJK A;  4RQ3 A;  1U48 A;  4UAZ A;  1BNO A;  4RQ4 A;  2V4R A;  8ICK A;  4F4Y A;  2YTU A;  5EE0 A;  3T5L A;  3E0F A;  5KFE A;  4YMM A;  2Y1I A;  3HPO A;  2R8K A;  1WG8 A;  2Z7J A;  4C8K A;  5AK6 A;  3LK9 A;  3KFU F;  2V4Q A;  5J2A A;  2ZXH A;  4E0D A;  3H0M B;  2L5Y A;  2RHF A;  4NL9 A;  2IHN A;  1UA1 A;  2D3D A;  1T3N A;  3EPI A;  1UPH A;  3QU7 A;  4RNO A;  3MC1 A;  2P66 A;  5AK4 A;  7ICP A;  3SI8 A;  4I28 A;  2XI9 A;  2WF5 A;  3CYM A;  2ESE A;  2HOI A;  1CI4 A;  5BOM A;  4UB1 A;  1SV4 A;  2QB0 B;  5DGA A;  1X6J A;  4DQP A;  8ICH A;  4CDG A;  2IA6 A;  5L1M A;  5ALE A;  2MUT B;  2WAQ F;  1RM6 C;  4JK1 A;  3C29 A;  3RH5 A;  2OM6 A;  4KLF A;  5EOZ A;  2E8N A;  3J81 j;  1X6I A;  4DSI A;  2RDJ A;  5ALP A;  4USA A;  5ALX A;  5BOL A;  2KZM A;  4DFJ A;  2Q0Z X;  3OHB A;  2AHO B;  1S0N A;  5ALJ A;  2FMQ A;  2W43 A;  4QWD A;  3KHL A;  1ZQK A;  4PH5 A;  2VJ5 A;  4KTQ A;  1RYR A;  3SZ2 A;  3ZDD A;  1IXR A;  8ICP A;  4GXK A;  2N1R A;  3ETR A;  4FE3 A;  1NI3 A;  4XUS A;  2HVH A;  5KNI A;  2MRL A;  5DB8 A;  3KHH A;  4C8O A;  1A0P A;  4F5Q A;  1X9M A;  1SB3 C;  4CRX A;  1JRP A;  4NLB A;  4KLQ A;  3PX0 A;  1N2X A;  1TKD A;  8ICF A;  8ICI A;  4P4O A;  3ZI4 A;  5KAI U;  1ZJN A;  1NJY A;  1ZQB A;  1PK1 B;  2ZIW A;  4JB3 A;  4FZM A;  5KFU A;  5ALZ A;  1WCL A;  5L1I A;  5KFR A;  9ICM A;  1CUK A;  3QYP A;  2F1H A;  1XO0 A;  4I2J A;  4QNL A;  1BNP A;  4OJO A;  5AI5 A;  1ZQQ A;  4NLG A;  3FAH A;  5DQH A;  4YR0 A;  4XRH A;  5AIA A;  3G6V A;  3KHR A;  4Q8E A;  1Q8K A;  4QZF A;  1IG6 A;  2R8G A;  4C8L A;  3IP4 B;  4I29 A;  2O6K A;  2WFA A;  3H8W A;  4O9M A;  2K4E A;  5J0P A;  1F5S A;  2YB1 A;  2KSO A;  4Z6C A;  7ICM A;  4ECW A;  4NLN A;  4Y2Y A;  3OPX A;  3AUO A;  4DFP A;  1ZD5 A;  2FPL A;  3PW5 A;  2G08 A;  2XGP A;  1ZD3 A;  1L7O A;  4C8N A;  3M9N B;  3TFR A;  2DPJ A;  2XIC A;  5ALR A;  4NM2 A;  2LM4 A;  1ZYQ A;  2DF4 B;  3M9O B;  5AM4 A;  1RYS A;  3MR3 A;  4UW9 A;  1OUQ A;  2HHU A;  9ICF A;  1YZ7 A;  5AKE A;  2ZIV B;  3C21 A;  4F5P A;  1XSN A;  3QZ8 A;  4IL6 U;  1K1Q A;  9ICP A;  5KT2 A;  5KAF U;  2KSO B;  3RJE A;  3ISD A;  5IIM A;  3BS5 B;  3IM1 A;  4Y2Q A;  2KNJ A;  1ZRM A;  1T7P A;  3SD7 A;  3ISC A;  1N62 A;  4TUR A;  2XY6 A;  2Q4T A;  2HHT A;  4K4H A;  5ALD A;  2NO5 A;  4U6P A;  4BUG A;  2HHQ A;  2KJ5 A;  3RR7 A;  4DS4 A;  5KFF A;  2BCR A;  4P0P A;  1OXJ A;  2F3N A;  2BKE A;  3GU3 A;  3PW2 A;  3L3F X;  3GV7 B;  4A8E A;  5AIB A;  4RQ7 A;  2PMZ C;  4UB2 A;  4KN4 A;  1TK0 A;  2FMS A;  3O0F A;  5CWR A;  2KKP A;  4LVS A;  2A1J A;  2W9B A;  1SXD A;  3FC4 A;  1J2N A;  3ETL A;  5EE1 A;  1NK8 A;  3HJE A;  1ZQE A;  3GIJ A;  2ISO A;  4YD1 A;  3N28 A;  2W3S A;  9ICN A;  3TAN A;  3B0Y A;  4DQQ A;  4KLD A;  4GXJ A;  4R65 A;  3FYH A;  3DV9 A;  4BWM A;  4BXO A;  2F1J A;  2LHT A;  5DG8 A;  4NL9 C;  9ICG A;  2AU0 A;  1B0X A;  2QKQ A;  5AM5 A;  3WKA A;  3C5G A;  1ZQS A;  3NVZ A;  4I2D A;  3D2N A;  4TQS A;  2FE9 A;  4Y2P A;  4KMU A;  1KBU A;  3AM9 A;  2EAM A;  2JGA A;  5AKL A;  2ASL A;  1T3Q A;  4PHP A;  5H2F U;  5D49 A;  4RPZ A;  1BPX A;  1SKS A;  5J8Y C;  1QCK A;  3LDA A;  5KFX A;  3WU2 U;  1ECW A;  3F53 A;  4MFA A;  3G6Y A;  2JH7 A;  5AKJ A;  4FS1 A;  5KT5 A;  2BCS A;  2W55 A;  1D8L A;  4F92 B;  1S10 A;  5AI4 A;  5JUM A;  2WHE A;  2FJ6 A;  2GOL A;  5CR0 A;  8ICB A;  4IC9 A;  4GLX A;  4YG2 A;  1P7D A;  1MC8 A;  5AKY A;  5IIJ A;  3DDH A;  2F8L A;  1SWV A;  1ZQY A;  5DKW A;  5J2G A;  3NVV A;  3Q8L A;  1XC9 A;  4F2R A;  9ICS A;  1S0O A;  3H0L B;  4TUS A;  5AIC A;  1D8B A;  8ICM A;  2I6X A;  8ICY A;  3GV5 B;  1NKB A;  3H4B A;  2XCP A;  1OW5 A;  3RJF A;  4RQM A;  1ARO P;  4RQ2 A;  4MHV A;  1RQL A;  4YN4 A;  1B4F A;  4DO9 A;  2Y0S F;  2KTQ A;  2ZIX A;  4FBT A;  5ALO A;  1RZT A;  2NO4 A;  5HR7 A;  2MAX A;  4DSJ A;  2G06 A;  1NOM A;  5J0Y A;  1UA0 A;  3T3F A;  2GLE A;  3WK8 A;  1NZP A;  1ZQC A;  4I2A A;  3SAF A;  1U47 A;  3WKD A;  5J0T A;  4IQV A;  1ZQM A;  5DDM A;  4O3P A;  1ZQO A;  9ICQ A;  2KHQ A;  5CHG A;  2DUY A;  2R8I A;  5K4L A;  1Q46 A;  5A0L A;  4ECX A;  4R8U A;  3N4M B;  1ZQH A;  4UAU A;  2DFL A;  3M6K A;  2LYB A;  2JR5 A;  1KKX A;  2BQU A;  3PO4 A;  3H8S A;  3NAS A;  1PVR A;  1O03 A;  2XGQ A;  3HW8 A;  4AYB F;  1M6Y A;  3KHG A;  1Z1B A;  5J0O A;  2E3T A;  4B9N A;  1SWW A;  4Z6E A;  5KTQ A;  2LPE A;  5DBC A;  9ICR A;  3PW0 A;  4NLC A;  2IOF A;  2HOQ A;  3UPQ A;  1JIH A;  5D4B A;  3FM9 A;  1RYU A;  2XCA A;  3KBB A;  3H4D A;  2K8B B;  4UAR A;  4QIW F;  1X42 A;  1V9P A;  3F5A A;  4B9T A;  3BQ2 A;  4DWI A;  3BS7 A;  2F76 X;  4RQ0 A;  3Q8P B;  1N5X A;  3AQF A;  3S6J A;  1SL2 A;  4F50 A;  2W9A A;  4P0Q B;  7ICJ A;  2LYH A;  1QSS A;  5DGB A;  3B0X A;  3ZDB A;  1V38 A;  1IM4 A;  2YMM A;  4M9H A;  9ICU A;  3SAG A;  4DFD A;  3KOO A;  2KVS A;  9ICA A;  1TV9 A;  4Y2X A;  4DS5 A;  5KG1 A;  3KZI U;  2NRV A;  2E8M A;  4TUP A;  1VLB A;  1WUD A;  3L4P A;  4TUQ A;  7ICG A;  2G07 A;  2V9W A;  2EAN A;  1C20 A;  3TKA A; 
#chains in the Genus database with same CATH homology
 4DLE A;  4KLS A;  2BPC A;  3H7I A;  3OHA A;  4I2H A;  4DSI A;  2RDJ A;  4QZB A;  3KTQ A;  5KFN A;  5KFD A;  3RRH A;  9ICX A;  5BOL A;  4YD2 A;  2KZM A;  4DOC A;  5J0W A;  4DFJ A;  2Q0Z X;  1XSL A;  1DOQ A;  4F5N A;  3OHB A;  4J9L A;  1S0N A;  4KIT B;  4Z6F A;  1S77 D;  1TAQ A;  7ICE A;  3Q8K A;  4UB4 A;  4EBE A;  5HP4 A;  4I2F A;  8ICN A;  1NK4 A;  2FMQ A;  5KFP A;  2R8H A;  4QWD A;  9ICJ A;  5L1J A;  1HJP A;  5KFQ A;  3KHL A;  4MF2 A;  4F4W A;  1ZQK A;  1ZQZ A;  1SL1 A;  2VA2 A;  8ICO A;  9ICO A;  1PZN A;  5KG2 A;  4PH5 A;  3IHQ B;  1NK0 A;  8ICQ A;  1KFS A;  4KTQ A;  4UQG A;  4IR1 A;  1RYR A;  4UB5 A;  4IQW A;  4GC6 A;  3SZ2 A;  5J0X A;  4M9N A;  2FPM A;  4J9Q A;  3ZDD A;  5DB7 A;  1IXR A;  3RR8 A;  1S0V A;  8ICP A;  4GXK A;  2BCV A;  3C23 A;  1B22 A;  3RJH A;  4ED3 A;  8ICG A;  7ICO A;  5DLG A;  4RPY A;  3ZD8 A;  4XUS A;  1X9W A;  2HVH A;  5DB8 A;  1L5U A;  5KFB A;  3KHH A;  3PV8 A;  7ICK A;  2IHM A;  4C8O A;  5CP2 A;  3PW4 A;  1Z3E B;  4RQ1 A;  4XA5 A;  4F5Q A;  1X9M A;  1BPY A;  1KFT A;  4PGQ A;  5CA7 A;  3PX6 A;  9ICI A;  4Q44 A;  4ECV A;  4KLQ A;  1TFR A;  3JPQ A;  1BVS A;  4MFC A;  3PX0 A;  3BDP A;  5KFC A;  2Y1J A;  1NKE A;  1TKD A;  8ICF A;  8ICI A;  3K4G A;  4P4O A;  4XQ8 A;  4MFF A;  2ZTD A;  4UBC A;  3N97 B;  5D46 A;  4O3R A;  2XY5 A;  3MDC A;  1ZJN A;  3RTV A;  3UXN A;  4UAW A;  1NJY A;  4TQR A;  8ICC A;  1ZQB A;  5KFM A;  1BGX T;  1T8E A;  3NTU A;  9ICC A;  1S9F A;  1COO A;  1LB2 B;  3JPO A;  5KFU A;  2FMP A;  4NY8 A;  1WCL A;  1XS9 D;  2ZUC A;  4QW9 A;  5L1I A;  3MFI A;  1XSP A;  5KFR A;  5DB6 A;  2M9N A;  7ICF A;  9ICM A;  1CUK A;  3GIM A;  2JZB B;  3C1Y A;  2ASJ A;  4ED8 A;  2XC9 A;  9ICT A;  1QSL A;  4KN7 A;  1XO1 A;  4JUZ A;  3RB4 A;  4MEX A;  2F1H A;  5HHH A;  5KT6 A;  7ICN A;  4I2J A;  1ZQQ A;  1SKW A;  4JV2 A;  2P6U A;  3SV3 A;  1ZQP A;  4M9L A;  4NLG A;  3C2M A;  5DQH A;  4YR0 A;  9ICL A;  4XRH A;  4DSK A;  4YXJ A;  9ICK A;  3FDS A;  4DFK A;  1HUZ A;  3G6V A;  3KHR A;  4M0A A;  4YR2 A;  4Q8E A;  4QZF A;  2R8G A;  4C8L A;  4YCX A;  5KT7 A;  2ISP A;  4I29 A;  4J9M A;  4RQ6 A;  1S0M A;  7ICS A;  2NRT A;  3H8W A;  4YXM A;  5KG3 A;  4DF4 A;  5HHI A;  5DDY A;  4F5R A;  4HYK A;  4O9M A;  5J0P A;  3T5K A;  2BCQ A;  5KFJ A;  2I1Q A;  1ZQL A;  3HWT A;  4QZH A;  1ZQJ A;  1CEZ A;  3GV8 B;  5IIL A;  4KLM A;  4Z6C A;  4NLK A;  7ICM A;  2KN7 A;  4ECW A;  4NLN A;  3AUO A;  2ASD A;  7ICH A;  4GXI A;  3T5J A;  4DFP A;  2FPL A;  3JPR A;  2AGP A;  3PW5 A;  9ICE A;  3QEB Z;  2R8J A;  2XGP A;  2AGQ A;  2BCU A;  3C2K A;  2W9C B;  2W8L A;  3T5H A;  4C8N A;  3M9N B;  3TFR A;  1ZJM A;  8ICA A;  2RDI A;  2ZTE A;  4O0I A;  2DPJ A;  2ZTC A;  5KFI A;  1KEJ A;  5J2B A;  7ICI A;  1ZQU A;  4NM2 A;  5L9X A;  2HHV A;  5KG0 A;  5HMM A;  3SYZ A;  4ECT A;  3PVX A;  2JZB A;  3RAX A;  2PFP A;  4R64 A;  5DLF A;  1ZYQ A;  3ZDA A;  1KFD A;  3M9O B;  9ICB A;  4FS2 A;  1RYS A;  1Z00 B;  1U49 A;  3MR3 A;  2HHU A;  9ICF A;  2J6S A;  1ZQD A;  4ED6 A;  4EBC A;  4QZ9 A;  4KLH A;  3V7J A;  3C2L A;  1D9F A;  3GIL A;  3C21 A;  3G6X A;  4BGD A;  3QZ7 A;  4DSF A;  3RJI A;  4RZR A;  4F5P A;  3C1Z A;  1KLN A;  4QZC A;  4O5E A;  2XO7 A;  1N48 A;  1XSN A;  3E2E A;  1D9D A;  3QZ8 A;  1K1Q A;  9ICP A;  5EWE A;  5KT2 A;  4UB3 A;  4KLT A;  4ED1 A;  2UVV A;  3RJE A;  4DL7 A;  1S76 D;  3GII A;  3ISD A;  2AGO A;  1UT5 A;  2AQ4 A;  4QWB A;  3PO5 A;  5DBB A;  5IIM A;  7ICV A;  1NKC A;  9ICV A;  1BPB A;  4O3Q A;  2BR0 A;  2NRZ A;  4M9J A;  4ELU A;  1U4B A;  4YFK A;  3IM1 A;  5KFS A;  4EYH B;  1C7Y A;  3EWA A;  4RU9 A;  2XY7 A;  4R8U B;  2VA3 A;  2W9C A;  1MQ2 A;  1T7P A;  1ZQW A;  3ISC A;  2KFN A;  3ZDC A;  8ICT A;  3BQT A;  1Y88 A;  4YVZ A;  2PI4 A;  4EZ6 A;  1HUO A;  4TUR A;  2FLL A;  4ELV A;  2XY6 A;  4K4I A;  1L3T A;  4B9M A;  4DSL A;  5BPC A;  3HX0 A;  2JEF A;  4DLG A;  4K4H A;  2HHT A;  2HHQ A;  4DL2 A;  3RR7 A;  4JWM A;  5J2F A;  3MR5 A;  5J2K A;  4DS4 A;  5KFF A;  2BCR A;  3H40 A;  4YMO A;  2UVU A;  1Z00 A;  1ZQV A;  2BKE A;  4DL6 A;  1ZQX A;  3PW2 A;  8ICJ A;  4DOB A;  2FLN A;  3GV7 B;  3Q8R B;  7ICQ A;  4RQ7 A;  4QW8 A;  5DB9 A;  4UB2 A;  4KN4 A;  1TK0 A;  2FMS A;  5CWR A;  4ECQ A;  4LVS A;  2A1J A;  4QZA A;  3OGU A;  2W9B A;  4KLJ A;  1RXW A;  3ETL A;  4MF8 A;  1NK8 A;  1ZQE A;  4B9V A;  3H8J A;  3MGI A;  5KFT A;  4DL5 A;  3Q8S B;  4B9S A;  1JMS A;  4ECU A;  4YR3 A;  3PNC A;  3GIJ A;  2ISO A;  5KFV A;  4YD1 A;  2C28 A;  4K4G A;  4KLO A;  5TZV A;  1KTQ A;  3QEA Z;  9ICN A;  3TAN A;  3B0Y A;  4DQQ A;  3PY8 A;  4Q43 A;  4GXJ A;  4KLD A;  1L3V A;  4R65 A;  3FYH A;  1H38 A;  2UVR A;  4BWM A;  4BXO A;  1B43 A;  2HHW A;  1T4G A;  2F1J A;  5DQG A;  4F4X A;  4ED0 A;  4JWN A;  5DG8 A;  4QZI A;  1EXN A;  2HW3 A;  5KFY A;  9ICG A;  1A77 A;  2KZ3 A;  2W9M A;  2BQR A;  2ZUD A;  2AU0 A;  3BQ1 A;  1ZQA A;  2F1I A;  1SL0 A;  4EZ9 A;  4CCH A;  3RH4 A;  4QZ8 A;  8ICX A;  2FLP A;  4EYI B;  2J6T A;  2BQ3 A;  5CB1 A;  2BHN A;  5KG6 A;  3C5G A;  4M9G A;  2ZJ5 A;  4M2Y A;  1RXV A;  1ZQS A;  2AJQ A;  5HML A;  3OSP A;  4I2D A;  5J29 A;  4TQS A;  4ECS A;  2I9G A;  8ICR A;  4MEY A;  3MR6 A;  4KMU A;  3UXO A;  4GC7 A;  4ECR A;  8ICS A;  4IQT A;  4DL4 A;  3TAR A;  3MAB A;  1K1S A;  4KLE A;  1ZQI A;  4Q8F A;  4BWJ A;  4RNM A;  2ASL A;  3BQ0 A;  1NJZ A;  4O3O A;  2JEI A;  3PX4 A;  3GFK B;  3TAQ A;  2BPF A;  4R66 A;  4EBD A;  4PHP A;  1ZQT A;  3Q8Q B;  2IMW P;  7ICL A;  5D49 A;  4RPZ A;  3PW7 A;  4RNN A;  1BPX A;  1SKS A;  5EWF A;  3LDA A;  1NK7 A;  4PHD A;  4F2S A;  1RPL A;  2ZJA A;  3EPG A;  1JN3 A;  5KFX A;  3JPT A;  1QLN A;  3G6Y A;  4MFA A;  7ICR A;  3RB3 A;  2P6R A;  1BPE A;  5KFZ A;  2W9B B;  4FS1 A;  5KT5 A;  1ZQN A;  5KFA A;  2DPI A;  2C22 A;  3AU6 A;  2BCS A;  4PHA A;  1D8L A;  4F92 B;  4QZD A;  1S10 A;  3V6H A;  2HHX A;  2BDP A;  8ICW A;  5JUM A;  3ORY A;  1MSW D;  4P4M A;  3V6K A;  5CR0 A;  1JXL A;  4ED7 A;  8ICB A;  4GLX A;  4YG2 A;  4FO6 A;  3LWM A;  1MC8 A;  4RT2 A;  3PML A;  1NJX A;  4QZG A;  4PHE A;  4KLU A;  3JPN A;  2H5X A;  5IIJ A;  5DBA A;  4ZH4 A;  4F8R A;  2A1J B;  1ZQY A;  1L3U A;  4RUA A;  1JXE A;  4UAY A;  5DKW A;  5J2G A;  4RPX A;  3Q8L A;  5J2E A;  1XC9 A;  1ZQF A;  4DEZ A;  5J2J A;  1XU4 A;  5KFO A;  5KG5 A;  4F2R A;  4KLG A;  3UQ2 A;  3MFH A;  1NK9 A;  1BPZ A;  8ICZ A;  3AU2 A;  4J9R A;  2ALZ A;  5J0U A;  1S0O A;  9ICS A;  4YP3 A;  1NJW A;  2PFO A;  5KFL A;  4TUS A;  4J9O A;  4C8M A;  4RT3 A;  1TVA A;  1L3S A;  4O3S A;  3LWL A;  3RAQ A;  4JV1 A;  2W8K A;  5J0S A;  5IIK A;  4F5O A;  4DOA A;  8ICM A;  2OWO A;  8ICY A;  4YQW A;  2PI5 A;  4J9S A;  3TI0 A;  4BDP A;  4J9P A;  2ZUB A;  3GIK A;  3GV5 B;  1QSY A;  3OSN A;  2FPK A;  3PMN A;  3M8S A;  3H4B A;  1NKB A;  2KZZ A;  2JEJ A;  7ICU A;  1SZP A;  4R63 A;  2XCP A;  4PPX A;  3RB0 A;  3PR5 B;  4IQU A;  4F93 B;  3RJF A;  2HVI A;  4YMN A;  1ARO P;  1BPD A;  2ATL A;  3RJG A;  3EYZ A;  4PGX A;  4RQ2 A;  4P4P A;  3GQC A;  1ZET A;  3RRG A;  4M6W A;  4X5V A;  1KDH A;  5C5J A;  4YN4 A;  2PFN A;  4DO9 A;  3OJS A;  4I2I A;  5J2H A;  5DG9 A;  4FBT A;  2UVW A;  2KTQ A;  1WCN A;  4M04 A;  1RZT A;  5IIO A;  3V72 A;  5IIN A;  2WTF A;  5F9N A;  5KFG A;  5KG7 A;  4B9L A;  5KT3 A;  4UBB A;  3MGH A;  2BGW A;  1X9S A;  1N56 A;  3RJJ A;  2MAX A;  3NGD A;  4DSJ A;  1XWL A;  1U9L A;  1NOM A;  5J0Y A;  4O3N A;  3V7K A;  1A76 A;  1UA0 A;  4IRC A;  5DG7 A;  3T3F A;  4J9N A;  4JV0 A;  4DQI A;  1ZQG A;  5CJ7 A;  3TAP A;  1ZQC A;  4ELT A;  4I2A A;  3HT3 A;  4F4K A;  3RB6 A;  4ED2 A;  5KFK A;  2GWS A;  1JX4 A;  4IRD A;  5F9L A;  1U47 A;  2KFZ A;  5J0T A;  4DFM A;  4I2G A;  4IQV A;  1ZQM A;  2MUT A;  1D8Y A;  5DDM A;  2B21 A;  1SKR A;  1DGS A;  1ZQR A;  4O3P A;  3TQ1 A;  1ZQO A;  5EWG A;  9ICQ A;  2C2E A;  3MBY A;  3EW9 A;  5J0R A;  4F91 B;  5CHG A;  5L1L A;  1S97 A;  4BXO B;  2R8I A;  4F3O A;  1UT8 A;  4P2H A;  2BPG A;  4IRK A;  4ECX A;  8ICL A;  2C2D A;  1LV5 A;  4R8U A;  3N4M B;  1ZQH A;  4KLI A;  4F4Z A;  2VAN A;  3THV A;  4G3I A;  3PR4 A;  2DFL A;  5KT4 A;  2C2R A;  4O5C A;  9ICW A;  3ISB A;  3OJU A;  2BQU A;  1NK5 A;  4ECZ A;  1KRP A;  4M6W B;  4Q45 A;  3PO4 A;  5KFW A;  2JEG A;  3H8S A;  1X2I A;  3RJK A;  4NM1 A;  3C5F A;  4RQ3 A;  5III A;  5KFH A;  4RUC A;  1U48 A;  1QTM A;  3JPP A;  2XGQ A;  3HW8 A;  4UAZ A;  2IBK A;  5J2C A;  4RQ4 A;  2V4R A;  3KHG A;  8ICK A;  3QE9 Y;  4F4Y A;  3K75 D;  4DQS A;  5J0O A;  3T5L A;  5KFE A;  5J2I A;  4NXZ A;  4LZD A;  4DQR A;  4B9N A;  1KSP A;  4YMM A;  3GDX A;  2Y1I A;  5L1K A;  4Z6E A;  3HPO A;  2R8K A;  2AQ0 A;  5KTQ A;  5KG4 A;  4DF8 A;  4LZG A;  5DBC A;  4I2E A;  5DQI A;  3PW0 A;  9ICR A;  4C8K A;  3UPQ A;  1JIH A;  2ZJ8 A;  5D4B A;  3LK9 A;  4QWC A;  2PXI A;  2V4Q A;  5J2A A;  4DSE A;  3ZDE A;  4E0D A;  2J6U A;  2NRX A;  2HHS A;  4RQ5 A;  2XCA A;  3TFS A;  4PGY A;  2IHN A;  4QZE A;  3RBD A;  3H4D A;  1UA1 A;  4O5K A;  4KLL A;  1T3N A;  3EPI A;  4QWE A;  4RNO A;  1TK8 A;  4IR9 A;  8ICV A;  5J0Q A;  3UQ0 A;  4FBU A;  1V9P A;  4I27 A;  4B9T A;  3BQ2 A;  3V7L A;  2P66 A;  4DWI A;  5J2D A;  4RQ0 A;  3Q8P B;  7ICP A;  4QWA A;  3SI8 A;  1SL2 A;  4I28 A;  4F50 A;  4I2B A;  3JPS A;  3SV4 A;  2W9A A;  1NK6 A;  7ICJ A;  2LYH A;  4M47 A;  1QSS A;  3RH6 A;  5DGB A;  3EZ5 A;  3B0X A;  4NLZ A;  3ZDB A;  4DL3 A;  4EEY A;  4RQ8 A;  1TAU A;  2PFQ A;  1IM4 A;  3M8R A;  4I2C A;  4M9H A;  3BJY A;  9ICU A;  5BOM A;  3V6J A;  4UB1 A;  5DGA A;  8ICU A;  4J9K A;  2NRW A;  3UXP A;  9ICA A;  3ZD9 A;  1TV9 A;  4DQP A;  4DS5 A;  3RBE A;  5KG1 A;  4ECY A;  8ICE A;  3M9M B;  1TK5 A;  8ICH A;  3Q8M A;  9ICH A;  2NRV A;  2VA8 A;  1MQ3 A;  5HNK A;  4TUP A;  4Z6D A;  4TUQ A;  2IA6 A;  4B9U A;  3MR2 A;  7ICG A;  7ICT A;  2MUT B;  2V9W A;  4JK1 A;  3RH5 A;  4KLF A;  1U45 A;  3MDA A;  5EOZ A;  3HP6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...