1TAMA

Human immunodeficiency virus, nmr, minimized average structure
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
120
structure length
120
Chain Sequence
MGARASVLSGGELDRWEKIRLRPGGKKKYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNTVATLYCVHQRIEIKDTKEALDKIEEEQNKSKKKAQQAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Refined solution structure of p17, the HIV matrix protein.
pubmed rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Matrix protein
molecule keywords HIV-1 MATRIX PROTEIN
total genus 27
structure length 120
sequence length 120
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1996-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00540 Gag_p17 gag gene protein p17 (matrix protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.90 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 1tamA00
2H3VA 2H3QA 1L6NA 2H3ZA 1HIWA 1ED1A 2HMXA 2K4IA 2K4EA 1ECWA 1TAMA 2LYBA 1HEKA 4ICAA 4JMUA 2H3FA 2K4HA 2H3IA 1UPHA 2JMGA 2GOLA 2NV3A 4IC9A 2LYAA 2N1RA 1A6SA
chains in the Genus database with same CATH superfamily
2RHFA 1D8LA 1FO4A 5KFKA 3DDHA 1FFUA 1IIPA 1IM4A 3EWAA 3V7JA 2ZIUB 4GIBA 7ICFA 3C2MA 5AICA 4KITB 4KLGA 2LPEA 4XUSA 1XO1A 5KFRA 3QXGA 4RNOA 1PK1A 5AKEA 1NKCA 2KKVA 4I29A 2B6GA 4PHPA 3T5KA 4F5NA 4UAUA 4ICAA 1KKXA 4NV0A 2G5IB 3QUBA 1Z4NA 2ZIXB 2XY6A 1V97A 3HX0A 4RQ4A 5ALVA 3RJEA 3ETRA 2A1JB 3V72A 4QZ8A 1FFVA 1KN5A 2HHXA 4RQ1A 1KLNA 4FZLA 4F71A 3EPIA 4UB4A 3QZ7A 1ZQVA 1KFTA 3KZXA 1NKEA 1SGGA 2KHQA 5KFYA 2NRXA 4UB2A 1AROP 2FDRA 1JXLA 2D8CA 2BPFA 4EX7A 1SWWA 3GDXA 3PMNA 3TACB 1UHUA 2LHTA 5AKKA 4F4WA 1QCKA 2BGWA 4DS5A 1U9LA 2HBLA 4UATA 3V6KA 5KFTA 9ICNA 4I2JA 3NRWA 4DL2A 3CP8A 5DB7A 5DQHA 2AGPA 2BPCA 5KFPA 5AM1A 1LVHA 2M9NA 1L8OA 3K1ZA 4M6WA 3SMVA 3NVWA 2KICA 1VJ5A 3GFKB 2QARB 1A77A 3WKBA 4OD0A 4YN4A 8ICEA 4BWMA 1O08A 4P4OA 3TARA 3QU7A 4P2HA 4C7YA 3TANA 2AGOA 5B66U 1ZQRA 3CW2C 5HMLA 4ECXA 5IILA 1RXVA 5ALFA 4RT3A 4TUPA 1SZPA 1ZJNA 2ZXHA 4KLQA 1RYSA 3Q8SB 2ZUDA 2XIDA 3ZDCA 1T8EA 2JXJA 4XRHA 5KFLA 1Q3UA 3OGUA 2BCUA 4B9SA 4F5RA 2ISOA 4KLUA 1ZQCA 5D49A 2W9MA 5AI9A 5J0TA 5T14A 2F1IA 3F2BA 5ALOA 4EZ6A 2KTQA 2P6RA 3PO5A 3JPPA 3KTQA 5KL8B 3QU9A 5G5GA 2BQRA 4P4MA 1HUZA 1N5WA 4KLHA 1RZTA 3U26A 3TADA 3C1ZA 2ZG6A 7ICSA 4DSFA 5DBBA 3N28A 1SV0A 4RQ7A 5HHHA 2BPGA 4P0PB 7ICMA 2LYAA 3MR3A 1XSLA 2ASDA 1X6JA 9ICGA 4I2EA 1NI3A 5HR6A 2ZJ8A 2ZIUA 1QTMA 4K4GA 3Q8KA 2J6UA 5L1KA 5KFBA 1JROA 2UVUA 2E8OA 2R8KA 3WKCA 2EZZA 5CEHA 4F5QA 3ZD9A 3RJJA 5GTHU 7ICGA 4R64A 4YMNA 1QQ7A 1SXDA 3I76A 3RH4A 3IP4B 4YD1A 4DFJA 4CF4A 3AU6A 2HOQA 3WK4A 2ZUCA 5AK4A 2EQYA 1KFDA 1KEJA 2YMPA 3LK9A 4F5PA 2PKEA 3OJSA 5AM3A 2HHQA 3MDAA 2DFLA 2DUYA 3PW4A 1ZQLA 8ICTA 2YMMA 5KFXA 4QZIA 4CNQA 4ECYA 1VDVA 9ICBA 5KFFA 4J9NA 1PZNA 1UCVA 4PZOA 2E8NA 4DL7A 2LI6A 2GLEA 1PUZA 2K4EA 4KLMA 1UA1A 3EPGA 5HMMA 1JI7A 1U4BA 3SV4A 1ZQAA 2XY7A 5AI6A 1PVRA 3PX4A 4Y2JA 3MFIA 4QNLA 2F1JA 4EENA 4LVSA 4DQIA 3T5LA 2R8JA 3NVYA 2ISPA 4DQRA 5CB1A 1SV0C 1Q3VA 1BNOA 1VLBA 5AI8A 4J9LA 4Y2XA 2KIVA 3C5GA 4MF8A 4DO9A 4GLXA 4O3NA 2WB1F 3GIMA 2RRDA 4C8NA 1S10A 1L3UA 2RP5A 4F4XA 5IIJA 1L6NA 4YP3A 2VANA 1X9SA 1X9XA 4YXMA 4P0QA 2ZIXA 3B9JA 3UM9A 2C28A 4I27A 5L1JA 4K4IA 3RB4A 1WWVA 2NRWA 4QIWF 3AUOA 3WKEA 4C4TA 2KSOA 5KFEA 1JMSA 3UMBA 4J9MA 3DEEA 4KLJA 2XICA 3KHLA 1J2MA 1L7PA 3F2DA 2EZYA 5J0OA 5ALWA 5J0PA 4RUCA 2AQ0A 2IMWP 3MR6A 3PO4A 4AYBF 8ICYA 1WCNA 5DG9A 4F3OA 1KW4A 1KRPA 4CF3A 2RDJA 3SZ2A 4YMOA 4KLFA 1RQNA 1L7MA 1TAUA 4JUZA 4ECZA 2WB1C 5CR0A 5J0UA 4O3OA 4MEYA 5AKXA 1S9FA 2FLLA 4NLGA 3N97B 1YZ7A 4F92B 8ICGA 2HBKA 3BS7A 4ED6A 1QQ5A 4KLDA 1RDFA 2WF8A 2F76X 2ZIVA 2QARA 2YB4A 3NVVA 4NM2A 3QU2A 3T5JA 3M6ZA 2E8PA 3TAQA 4DSEA 1NJXA 2KVSA 8ICBA 5DGAA 4LJXA 2LMRA 4M6WB 5J2HA 3G6YA 4DL4A 5AKGA 4ECVA 5E79U 3HP6A 3KZIU 1V85A 4DLEA 2EZXA 9ICFA 4Q45A 4TQSA 1D8BA 3RBDA 5D4BA 3ONNA 4KLOA 2YX8A 1KSPA 4UAWA 2AGQA 4O5KA 1L7NA 3PVXA 5DBCA 3JPQA 3LDAA 3M8SA 1N62A 1KTQA 4IQWA 3C21A 1XSNA 1ZD5A 4FFDA 1X9WA 2OWOA 5IIIA 4KX5A 4QIWC 3N7SC 1URJA 2ASLA 3HPOA 2YMQA 1A6SA 1K1QA 5HP4A 4AYBC 4YD2A 1X42A 1U45A 3H4BA 2Y9UA 1UT5A 3H8WA 7ICEA 1PVQA 5CA7A 3M1YA 3BS5B 3TFSA 1KQQA 2YN4A 2Y9TA 4G9BA 1OUQA 2PFPA 4CRXA 3M7DA 5ALPA 4B9UA 4QW9A 3WK7A 2LBOA 2G07A 2W7PA 1NK6A 2PFQA 3AM9A 4E0DA 3QU5A 3GV5B 5J2EA 2LM4A 4C80A 2W9BA 2A3VA 1ZQQA 4JB3A 3M9MB 2WTFA 2GWSA 1SL1A 4PZNA 3JPNA 4O3RA 1F0MA 4QZGA 4OJOA 5ALMA 5DQGA 3E58A 3EW9A 4CGZA 5AHXA 5H2FU 8ICPA 5DLGA 3BDPA 5ALTA 3AEVA 2R8IA 1A76A 1Z3EB 4CDGA 5HR7A 2OM6A 3QU4A 3IN5A 2EAMA 5BOLA 5J0WA 4M0AA 5ALQA 3I1YA 1JALA 1SB3C 5ALLA 1RQLA 4FZMA 2H3ZA 1Z1BA 3KKAA 2VA3A 5KFDA 3SQIA 3SV3A 4Q8EA 4B6JA 4USAA 3OSPA 1ZQXA 1ZOLA 4UB6U 4PGQA 4QZHA 4F91B 4EBEA 4Y2QA 1DGSA 1ZQWA 3JPTA 3PV8A 4UB8U 1WG8A 4O3PA 2CN1A 2WF9A 5KFGA 3NTUA 4O0IA 2F8LA 3SR6A 1Z19A 2MSNA 4IRCA 5J2FA 3L3FX 1Z1VA 2KZMA 7ICUA 4ELTA 1S77D 1C7YA 5DLFA 4C8LA 3KFUF 4EELA 2KJ9A 5BPCA 4O9MA 5AKYA 2H3QA 4ED3A 1MQ2A 9ICMA 4NL9A 2DKXA 3D2QA 3NVZA 3Q8RB 2DQNB 4CF5A 2BDUA 7ICVA 4TUSA 2F44A 2JZBA 4R65A 4ED2A 4EBCA 5F9NA 3RAXA 4PL1A 4EYHB 2KEYA 3GU3A 2DBYA 1ZQKA 3B0YA 4BGDA 4PHDA 9ICUA 3HKZF 4B9TA 4Z6EA 4M2YA 2KFZA 3T79A 2KSOB 1S0OA 2W9BB 2DPJA 3OSNA 4EX6A 3F53A 1NK8A 3ETLA 3SD7A 2I6XA 7ICJA 3HWTA 3IHQB 1ZQBA 5J2AA 1MC8A 3MR5A 2OHFA 5J2CA 4BXOA 5B5EU 5KG0A 3H40A 4NM1A 4KLEA 5F3XB 4R66A 1ZD2P 3NUQA 1S97A 4RT2A 2CRXA 3D2SA 2HHTA 4ECRA 4J03A 2O6KA 5ALSA 2QKQA 1COOA 2AJQA 1ED1A 1LKYA 3WKDA 4M9HA 7ICTA 4Y2TA 4Y2VA 2NYVA 2WF6A 2MUTB 4DOAA 1XC9A 9ICKA 1X9MA 1TK0A 2BKEA 3AN1A 1ZQTA 3RB6A 2KIWA 4F5OA 1P7DA 4RQ8A 2PXIA 5AM2A 3RFAA 4J9KA 4IRDA 3QE9Y 2W43A 5IIOA 1L7OA 5DDYA 5EWGA 4NLCA 5AIBA 2C22A 1ZQJA 4EEKA 2VJ4A 4YMMA 4P0QB 3BJYA 4HYKA 3Q8QB 3LWLA 3H8JA 4KLTA 4RQNA 5DB8A 4F2SA 5KG6A 3M9NB 7ICPA 2H5XA 3J81j 2AHOB 2KKPA 4DF4A 2ES6A 2DWQA 3PX0A 5KT7A 1D9DA 3KHRA 2F1HA 2HVHA 3H8MA 4B9NA 9ICWA 2XGQA 5AK6A 3C1YA 2LYHA 2BCQA 3PW0A 2HI0A 8ICMA 2JHDA 5ALNA 5AKJA 7ICOA 2YTUA 3FAHA 8ICUA 4GXJA 4CE6A 4K4HA 2JEJA 4UAZA 7ICRA 4Y2YA 1QSLA 3Q8LA 4YFKA 1SKSA 5DGBA 2AQ4A 3MDCA 3EZ5A 4LZGA 1RXWA 8ICRA 8ICSA 2ZUBA 4MHVA 5EWFA 1EXNA 1UA0A 1ZQ1C 5DKWA 1QLNA 2WF5A 3RF9A 7ICKA 2XY5A 5DBAA 1NK5A 2F3NA 4OJ6A 1JXEA 1ZQDA 1B4FA 5TISU 2VA2A 1Z00B 3HILA 4AP9A 1B0XA 2Q0ZX 1L3SA 2KFNA 4US9A 5ALYA 3KHGA 2PFOA 3PSFA 3NS1A 2IA6A 4QWEA 5CP2A 2E5SA 1N61A 4KX3A 1TE2A 1TAMA 2G08A 3NGDA 1WYGA 1C20A 2MRLA 1S0VA 3I28A 2NRVA 3RJKA 1X6IA 1Q8KA 4BWJA 3BZKA 5KNIA 3AQEA 4TURA 2W54A 1S0NA 3IDWA 2W9CA 4GFJA 2G5HB 3VC8A 5J2DA 3BQ1A 4RNNA 1X40A 2JV3A 1JIHA 1N48A 1F44A 1NJZA 2KNJA 3GIKA 2E1FA 3R9KA 5KT2A 4IQUA 2K89A 1BPXA 3BS5A 5DG7A 4M9LA 1QQ6A 4Q43A 4O3MA 3V7KA 3PW5A 2W3SA 1LKYB 4DSLA 3GIJA 4P0PA 4QJFB 4Y2PA 3CRXA 4UARA 4ELUA 2HHSA 1OXJA 3IG5A 3SAFA 2ZIWB 4DFKA 3L5KA 5KG7A 2YMLA 1ECWA 4IR1A 2NO4A 2VA8A 1SZHA 9ICLA 3PX6A 4R63A 3HRDD 3JPSA 2HHUA 3QZ8A 4YXJA 4C8MA 1DK3A 2K8BB 1OW5A 1RYUA 4DL6A 1NZBA 2A1JA 2FE9A 2ODGA 3QEAZ 4YR2A 1TV9A 5EE1A 3UMCA 4FS1A 1XWLA 3MABA 2GO7A 2IHMA 8ICXA 4UQGA 2QB1A 2OEHA 3RJIA 3CNHA 4F8RA 4ED8A 5KFZA 3L4PA 5CHGA 4UBCA 4IC9A 8ICZA 3QEBZ 4KLSA 2QLTA 1TKDA 1V38A 4F72A 9ICEA 1HJPA 1TAQA 4J9PA 2E1EA 3MGIA 5AIAA 4KLLA 1T7PA 1QSSA 4NY8A 4DOBA 5ALJA 1MQ3A 2R8GA 5FP0A 3WK8A 4JWNA 2PI5A 4C8KA 1IV8A 1TFRA 4QWCA 2K60A 3HJEA 3QX7A 4Y2UA 1ZQPA 4KN7A 5J2BA 1RYRA 4OJ5A 3ZDDA 1RM6C 3F5EA 4JWMA 4DFMA 2H3VA 4KLIA 4M9NA 1ZQNA 1F5SA 1S0MA 5JTIA 2F2AB 1HUOA 3UXOA 3GQCA 4B9LA 1X66A 1SWVA 4I2CA 2WAQF 5KT5A 5KL1B 2BCVA 4DL3A 5KFWA 4F4KA 4RQ3A 3C2KA 4DOCA 2JMGA 9ICVA 2AXTU 5L1LA 1MSWD 4YR3A 5ALEA 4DSKA 3QUTA 1ZQYA 9ICAA 8ICHA 3TQ1A 1QH9A 4UBBA 1T4GA 4UW9A 4ECTA 1GO3F 2K4IA 3AL0B 4RPYA 4KMUA 1T3NA 2PFNA 4C4SA 2BDPA 2PI4A 4ECQA 3K75D 4DS4A 2JGAA 1BGXT 2JH7A 1T94A 8ICAA 3RRHA 2JRZA 2I9GA 3JPRA 2J6SA 3GZFA 4F4YA 4P4PA 4R8UB 3RJGA 1O03A 4QWDA 4NLBA 2M0NA 5IINA 3ZI4A 2KN7A 3PSTA 1JRPA 4F2RA 3WK6A 1S5LU 3RJFA 2E3TA 4PHEA 2A1AA 5KFCA 2E8MA 7ICLA 4DEZA 1U49A 2ZXIA 4O3SA 1WCLA 3H4DA 5KFQA 1BNPA 3RJHA 1ZRNA 2V9WA 4NLZA 5J2IA 1KFSA 8ICCA 4DFPA 3BQ2A 5EOZA 2HSZA 5L1IA 2IOHA 7ICHA 1BPYA 4KTQA 4M47A 1SIJA 2D6FC 4I2DA 5EE9A 5AKLA 5AK3A 3IRUA 5J8YA 3OJUA 3D6JA 1BPBA 1IXRA 2DGZA 3FC4A 3RBEA 1QSYA 2WF7A 9ICCA 4R8UA 2KV2A 4X5VA 1NNLA 2VKQA 2CPRA 2K4PA 2FLPA 3BQTA 3GV7B 2H3FA 2K4HA 2PMZC 5KG2A 5G5HA 2QB0B 2KZ3A 5J0YA 1ZXIA 3NASA 5KFVA 2YB1A 3H0LB 1CRXA 3MGVA 3WKAA 1XS9D 2FI1A 3IV6A 1D9FA 1SL2A 4I2BA 5JUMA 4NXZA 3H7IA 3GV8B 1UQVA 4NLNA 2NRTA 4I2GA 2W9AA 5EWEA 4UB3A 4XA5A 4BDPA 5AKIA 3DV9A 4DCCA 2HHVA 2ASJA 4DF8A 4BXOB 1K5OA 3MGHA 2EANA 2W03A 1ZJMA 1XO0A 3PR4A 4G3IA 1SV4A 5KT6A 4QW8A 1SXEA 3UPQA 2HOFA 5DB9A 3K4GA 2IHNA 3RR8A 4OJPA 2MUTA 9ICXA 3T5HA 4ED7A 2ESEA 4J9SA 1M6YA 5AM5A 2W8KA 5AI5A 3PNCA 4ZOHC 2KOBA 1L8LA 2W04A 4RQ2A 3F2CA 2W9CB 2IBKA 2KP7A 5HNKA 5J0RA 3OHBA 3LWMA 4GC6A 4IQTA 2QB0A 2MU2A 3ZDEA 5J2JA 4RPZA 1IG6A 4C4RA 5J0QA 3GILA 1DGJA 2GOLA 4FO6A 1JX4A 2I1QA 3KOOA 4DSIA 4RQ6A 1DXSA 5KFAA 4QZ9A 4IL6U 3K1RB 1DOQA 3UXPA 4MEXA 5KFHA 3RR7A 2W3RA 4BX9C 8ICNA 1KBUA 2FMSA 1XNSA 5J2KA 3RRGA 4PHAA 2V4RA 2V4QA 3NRZA 3V6JA 2DF4B 4IQVA 8ICQA 2ZIWA 5ALIA 1ZRMA 3FDSA 2Y1JA 2UVVA 3QUCA 4IR9A 3WK9A 2F8KA 5J2GA 3OHAA 1HEKA 2LM1A 4FE3A 8ICJA 4TUQA 4FZNA 2HHWA 2K8CB 3KHHA 3IG8A 5EE0A 9ICQA 5ALXA 2P66A 4B9MA 2AU0A 3ISBA 3C2LA 1N63A 4F50A 4ECSA 4RQ5A 3N4MB 5KFUA 4DFDA 5GTIU 2W7OA 1ZQHA 8ICFA 3RH5A 3EUB2 3KKAC 5ALUA 3GIIA 4M04A 1WUDA 2DKZA 4OCZA 2XCAA 2C2DA 2WHEA 4XQ8A 4DL5A 2EAPA 3T3FA 2JEIA 2JH1A 4ED1A 1B22A 1BPDA 4O3QA 4Z6FA 4OO1J 3WU2U 1DK2A 4YR0A 4BJQA 1NK7A 2D3DA 3EYZA 4EZ9A 4C8OA 2DPIA 7ICIA 4U6PA 4Q44A 1ZQUA 4QWAA 2BQUA 3N7PD 4UB1A 2JEFA 4A8EA 3Q8MA 4JK1A 3OPXA 2B0CA 2JEGA 3QUQA 4QZDA 4DQQA 5AKZA 1MA7A 2EDUA 1XU4A 2FMQA 1ZYQA 2BCSA 9ICRA 4MFAA 5KAIU 4LZDA 5F9LA 3ICXA 1LB2B 4UAVA 1YZ6A 4JV0A 4F93B 9ICSA 2KK0A 4QWBA 2ZTEA 4Y2SA 2BCRA 5KG4A 9ICOA 2FPLA 4IRKA 2KVCA 5ALZA 5C0YA 2HOIA 3PW2A 2OH2A 1ZETA 3RB0A 2G06A 2EH9A 2LKYA 3N7RC 3ZDBA 5CRXA 5KFSA 2Q4TA 1S76D 7ICQA 4NJ8A 5ALRA 3C5FA 4ECWA 9ICPA 4DLGA 8ICVA 4YQWA 4B9VA 3SAHA 2ZJAA 3AU2A 1K1SA 5D46A 2OYYA 1L5UA 5J0XA 3SI8A 3M8RA 5C5JA 3PMLA 4FBUA 1KL9A 8ICIA 2HDOA 3UXNA 5ALDA 4EEYA 2PMZF 3E2EA 3JPOA 1AQ6A 4ED0A 3TAPA 3A0BU 3CYMA 5AM4A 5DG8A 3HW8A 4QZEA 4GXIA 4KN4A 5KT3A 2KMDA 5CWRA 2FJ6A 1CUKA 2RLTA 2RQ5A 2VJ5A 2P6UA 1N5XA 1PVPA 2VIXA 2C2EA 4J9OA 1BVSA 4FBTA 3H0MB 1Z00A 2KJ5A 5KT4A 4QZAA 4I2IA 4I28A 5KFNA 3LVWA 1YT3A 1LV5A 4RZRA 5KG3A 2LYBA 3C29A 3QNMA 2HBMA 5CJ7A 1ZQEA 1X2IA 4YCXA 3PSIA 4PJ0U 2JZBB 3ORYA 5JU5A 5KFMA 4UASA 2G0AA 4NWIA 5IIKA 1KDHA 2EAOA 1COKA 5DDMA 3BZCA 4MFCA 2Z7JA 3RH6A 8ICKA 2OCEA 4OJLA 7ICNA 2BZFA 5ALGA 3S6JA 3LYSA 1ZQSA 5JRTA 4TQRA 2XCPA 2W8LA 1ZQOA 5J0SA 2CXYA 1U48A 2UVRA 2AH5A 3TI0A 2GH1A 1FEZA 2WFAA 5AI4A 5A0LA 2XO7A 3O0FA 2HW3A 3ED5A 2J6TA 4EYIB 2ZTDA 3WK5A 3SAGA 2L5YA 1HIWA 2HBJA 9ICJA 4I2HA 3KBBA 2KZZA 3TFRA 1NZPA 4QZFA 3ISDA 3RB3A 2G09A 1JUDA 2BHNA 3MR2A 4F4ZA 1UPHA 1Y88A 2Y1IA 1A0PA 2KD1A 3C23A 4CCHA 1CEZA 2W55A 1ZQGA 3HT3A 5KG5A 1D8YA 2P35A 8ICLA 4QZBA 2XGPA 1N56A 3F5AA 2ZIVB 1NK4A 3A0HU 5AM0A 3MC1A 1XSPA 5ALHA 2WAQC 4PGYA 2B21A 9ICHA 4GC7A 4KMOB 1S8OA 3MFHA 2FPKA 1CI4A 4QZCA 1L3TA 3ISCA 4RNMA 5KFIA 4DSJA 1FIQA 2ATLA 5HHIA 2BQ3A 2Y0SF 2MAXA 5KAFU 4WJ3B 5ALKA 1ZD4A 3B0XA 1TVAA 4NLKA 9ICTA 3V6HA 1B43A 3G6XA 3ALRA 2HVIA 3Q8PB 2NV3A 2FLNA 2XI9A 2K8AA 4Y2RA 4M9GA 1N60A 2DL0A 3VCBA 3MBYA 3AMZA 3RTVA 1NJWA 5BOMA 3M6KA 3D2NA 2YQEA 3LVVA 2UVWA 1ZD3A 5L1MA 2BR0A 4DQPA 3FYHA 1J97A 1NK9A 5AI0A 2C2RA 3FM9A 2ZTCA 4U7CA 1U47A 2XC9A 5K4LA 4PL2A 2W11A 2N1RA 4GXKA 5J8YC 9ICIA 4J9RA 3H0RB 4ACOA 3HKZC 3TADC 3H8SA 3SENA 1T3QA 1J2NA 1MN8A 4JMUA 1NOMA 4US8A 5DB6A 2FPMA 4O5EA 3PR5B 3RAQA 3SEIA 3UMGA 3BQ0A 1NK0A 2IOFA 4ELVA 4EBDA 2IOFK 1NKBA 5KFOA 4Z6CA 4IS7A 2OXOA 3PW7A 1SKWA 1ZQFA 8ICOA 2HMXA 4ZH4A 2A19A 1H38A 2HCFA 3THVA 1TK8A 5L9XA 2XVTA 1RG6A 4BUGA 4NL9C 2NO5A 4O5CA 1Z4OA 4RPXA 5KTQA 1ZQMA 1DRGA 1V9PA 2KE7A 5KFJA 3M9OB 3C28A 4J9QA 5IIMA 2KG5A 4MFFA 1SKRA 3UQ2A 2KHVA 3QYPA 5KG1A 1Q46A 2I5HA 3OTQA 3UQ0A 2Y0SC 4C7ZA 1WWUA 1L3VA 4JV2A 3PY8A 4PGXA 4I2AA 1N2XA 1RPLA 4ECUA 2ALZA 1PK1B 1BPEA 2RDIA 3PZPA 1NJYA 1UT8A 4RQMA 4RU9A 3ZD8A 1PK3A 3V7LA 5TZVA 3E0FA 4YVZA 2YY6A 1BPZA 2R18A 1TK5A 1ZQIA 4M9JA 1SL0A 4I2FA 4JV1A 4UB5A 3IM1A 5AKHA 4DWIA 2R8HA 2ZJ5A 2NRZA 8ICWA 4Q8FA 2MA1A 5AK5A 4MF2A 3AQFA 3TKAA 4DQSA 4YG2A 4PH5A 5EE3A 4RQ0A 2KJ8A 4FS2A 2FMPA 4HAIA 3G6VA 2H3IA 3PSPA 3BQ7A 3SYZA 4UAYA 4RUAA 2F77X 1JN3A 3KD3A 2JR5A 3ZDAA 4PPXA 5DQIA 5J29A 4Z6DA 4C0ZA 1ZQZA
chains in the Genus database with same CATH topology
2RHFA 3F5EA 3H0MB 2KJ5A 4FZMA 2H3VA 2OXOA 1L6NA 5HR6A 2KV2A 2H3ZA 4A8EA 1Z1BA 2ZIUA 3SQIA 3OPXA 1IIPA 2HBLA 2HMXA 2VKQA 2CPRA 3LVWA 1YT3A 4P0QA 4O3MA 2F2AB 2ZIXA 2LYBA 3C29A 3F5AA 2ZIVB 2HBMA 2H3FA 2K4HA 2PMZC 2XVTA 2ZIUB 3NRWA 1MA7A 2WAQF 4QIWF 3PSIA 4BX9C 5KL1B 4BUGA 3CP8A 3NUQA 1KBUA 2WAQC 4KX5A 4QIWC 2YB1A 2G0AA 4NWIA 2CRXA 3H0LB 3N7SC 1CRXA 1XNSA 3D2SA 1DRGA 1URJA 2JMGA 4P0PA 3MGVA 3DEEA 4QJFB 2XICA 3ICXA 4KMOB 3CRXA 3K1ZA 3F2DA 2DF4B 3SMVA 2KICA 2KKVA 2ZIWA 3C28A 1A6SA 3IG5A 2CN1A 3IP4B 3SAFA 2ZIWB 1ZQ1C 1ED1A 2HOQA 3RF9A 1GO3F 2K4IA 4AYBC 3AL0B 2KHVA 1ECWA 2F8LA 2Y0SF 2Z7JA 1Z19A 2KVCA 4AYBF 1HEKA 4ICAA 4FE3A 4WJ3B 4OJ6A 1SZHA 2HOIA 2Y0SC 5C0YA 4NV0A 4OJLA 2OH2A 2JGAA 2G5IB 1PVQA 2JH7A 1T94A 4FZNA 3L3FX 2K8BB 2G06A 3LYSA 1NZBA 2LKYA 3N7RC 2K8CB 2KIWA 1P7DA 2ZIXB 3ALRA 3GZFA 2NV3A 3IG8A 1OUQA 2W03A 2XI9A 2K8AA 4C0ZA 3M7DA 4CRXA 3RFAA 5CRXA 3KFUF 3PSFA 2KJ9A 3VCBA 1XO0A 3PZPA 2Q4TA 4NLBA 2M0NA 2H3QA 2E5SA 3D2NA 3M6KA 3LVVA 3D2QA 2ZXHA 3ONNA 2DQNB 2WB1C 4KX3A 2LBOA 2G07A 3PSTA 2BDUA 3SAHA 2W7PA 2K4EA 3E0FA 1TAMA 4NLCA 2HOFA 2XIDA 2R18A 2OYYA 2W7OA 1Q3UA 2G08A 2GH1A 4FZLA 4OJPA 2VJ4A 1PVRA 2MRLA 4U7CA 4P0QB 4PL1A 4QNLA 1WUDA 2A3VA 2HBKA 2KEYA 5A0LA 2ZXIA 3GU3A 3O0FA 3KZXA 4IC9A 4PL2A 5T14A 3AQEA 2F76X 2N1RA 2ZIVA 2KHQA 1Q3VA 3F2BA 2YB4A 3HKZF 3H0RB 2MA1A 4OJOA 2PMZF 3SAGA 4ACOA 3M6ZA 3T79A 3AQFA 1HIWA 3HKZC 2HBJA 2KOBA 2W04A 2KKPA 4GFJA 2E1EA 5KL8B 3F2CA 4CGZA 2JH1A 2G5HB 3VC8A 3F53A 2KJ8A 3CYMA 4JMUA 4OO1J 4CDGA 5HR7A 2H3IA 2OM6A 3PSPA 1F44A 2D6FC 2G09A 2WB1F 3IN5A 2ZG6A 2KNJA 4BJQA 2F77X 2LHTA 2VJ5A 1UPHA 1A0PA 2RRDA 2E1FA 2RP5A 2GOLA 4P0PB 1PVPA 2VIXA 2DGZA 4U6PA 1D8BA 2KD1A 2LYAA 2K89A 3N7PD 4OJ5A 2YX8A 2JHDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H3V A;  2H3Q A;  1L6N A;  2H3Z A;  1HIW A;  1ED1 A;  2HMX A;  2K4I A;  2K4E A;  1ECW A;  1TAM A;  2LYB A;  1HEK A;  4ICA A;  4JMU A;  2H3F A;  2K4H A;  2H3I A;  1UPH A;  2JMG A;  2GOL A;  2NV3 A;  4IC9 A;  2LYA A;  2N1R A;  1A6S A; 
#chains in the Genus database with same CATH topology
 2RHF A;  1D8L A;  1FO4 A;  5KFK A;  3DDH A;  1FFU A;  1IIP A;  1IM4 A;  3EWA A;  3V7J A;  2ZIU B;  4GIB A;  7ICF A;  3C2M A;  5AIC A;  4KIT B;  4KLG A;  2LPE A;  4XUS A;  1XO1 A;  5KFR A;  3QXG A;  4RNO A;  1PK1 A;  5AKE A;  1NKC A;  2KKV A;  4I29 A;  2B6G A;  4PHP A;  3T5K A;  4F5N A;  4UAU A;  4ICA A;  1KKX A;  4NV0 A;  2G5I B;  3QUB A;  1Z4N A;  2ZIX B;  2XY6 A;  1V97 A;  3HX0 A;  4RQ4 A;  5ALV A;  3RJE A;  3ETR A;  2A1J B;  3V72 A;  4QZ8 A;  1FFV A;  1KN5 A;  2HHX A;  4RQ1 A;  1KLN A;  4FZL A;  4F71 A;  3EPI A;  4UB4 A;  3QZ7 A;  1ZQV A;  1KFT A;  3KZX A;  1NKE A;  1SGG A;  2KHQ A;  5KFY A;  2NRX A;  4UB2 A;  1ARO P;  2FDR A;  1JXL A;  2D8C A;  2BPF A;  4EX7 A;  1SWW A;  3GDX A;  3PMN A;  3TAC B;  1UHU A;  2LHT A;  5AKK A;  4F4W A;  1QCK A;  2BGW A;  4DS5 A;  1U9L A;  2HBL A;  4UAT A;  3V6K A;  5KFT A;  9ICN A;  4I2J A;  3NRW A;  4DL2 A;  3CP8 A;  5DB7 A;  5DQH A;  2AGP A;  2BPC A;  5KFP A;  5AM1 A;  1LVH A;  2M9N A;  1L8O A;  3K1Z A;  4M6W A;  3SMV A;  3NVW A;  2KIC A;  1VJ5 A;  3GFK B;  2QAR B;  1A77 A;  3WKB A;  4OD0 A;  4YN4 A;  8ICE A;  4BWM A;  1O08 A;  4P4O A;  3TAR A;  3QU7 A;  4P2H A;  4C7Y A;  3TAN A;  2AGO A;  5B66 U;  1ZQR A;  3CW2 C;  5HML A;  4ECX A;  5IIL A;  1RXV A;  5ALF A;  4RT3 A;  4TUP A;  1SZP A;  1ZJN A;  2ZXH A;  4KLQ A;  1RYS A;  3Q8S B;  2ZUD A;  2XID A;  3ZDC A;  1T8E A;  2JXJ A;  4XRH A;  5KFL A;  1Q3U A;  3OGU A;  2BCU A;  4B9S A;  4F5R A;  2ISO A;  4KLU A;  1ZQC A;  5D49 A;  2W9M A;  5AI9 A;  5J0T A;  5T14 A;  2F1I A;  3F2B A;  5ALO A;  4EZ6 A;  2KTQ A;  2P6R A;  3PO5 A;  3JPP A;  3KTQ A;  5KL8 B;  3QU9 A;  5G5G A;  2BQR A;  4P4M A;  1HUZ A;  1N5W A;  4KLH A;  1RZT A;  3U26 A;  3TAD A;  3C1Z A;  2ZG6 A;  7ICS A;  4DSF A;  5DBB A;  3N28 A;  1SV0 A;  4RQ7 A;  5HHH A;  2BPG A;  4P0P B;  7ICM A;  2LYA A;  3MR3 A;  1XSL A;  2ASD A;  1X6J A;  9ICG A;  4I2E A;  1NI3 A;  5HR6 A;  2ZJ8 A;  2ZIU A;  1QTM A;  4K4G A;  3Q8K A;  2J6U A;  5L1K A;  5KFB A;  1JRO A;  2UVU A;  2E8O A;  2R8K A;  3WKC A;  2EZZ A;  5CEH A;  4F5Q A;  3ZD9 A;  3RJJ A;  5GTH U;  7ICG A;  4R64 A;  4YMN A;  1QQ7 A;  1SXD A;  3I76 A;  3RH4 A;  3IP4 B;  4YD1 A;  4DFJ A;  4CF4 A;  3AU6 A;  2HOQ A;  3WK4 A;  2ZUC A;  5AK4 A;  2EQY A;  1KFD A;  1KEJ A;  2YMP A;  3LK9 A;  4F5P A;  2PKE A;  3OJS A;  5AM3 A;  2HHQ A;  3MDA A;  2DFL A;  2DUY A;  3PW4 A;  1ZQL A;  8ICT A;  2YMM A;  5KFX A;  4QZI A;  4CNQ A;  4ECY A;  1VDV A;  9ICB A;  5KFF A;  4J9N A;  1PZN A;  1UCV A;  4PZO A;  2E8N A;  4DL7 A;  2LI6 A;  2GLE A;  1PUZ A;  2K4E A;  4KLM A;  1UA1 A;  3EPG A;  5HMM A;  1JI7 A;  1U4B A;  3SV4 A;  1ZQA A;  2XY7 A;  5AI6 A;  1PVR A;  3PX4 A;  4Y2J A;  3MFI A;  4QNL A;  2F1J A;  4EEN A;  4LVS A;  4DQI A;  3T5L A;  2R8J A;  3NVY A;  2ISP A;  4DQR A;  5CB1 A;  1SV0 C;  1Q3V A;  1BNO A;  1VLB A;  5AI8 A;  4J9L A;  4Y2X A;  2KIV A;  3C5G A;  4MF8 A;  4DO9 A;  4GLX A;  4O3N A;  2WB1 F;  3GIM A;  2RRD A;  4C8N A;  1S10 A;  1L3U A;  2RP5 A;  4F4X A;  5IIJ A;  1L6N A;  4YP3 A;  2VAN A;  1X9S A;  1X9X A;  4YXM A;  4P0Q A;  2ZIX A;  3B9J A;  3UM9 A;  2C28 A;  4I27 A;  5L1J A;  4K4I A;  3RB4 A;  1WWV A;  2NRW A;  4QIW F;  3AUO A;  3WKE A;  4C4T A;  2KSO A;  5KFE A;  1JMS A;  3UMB A;  4J9M A;  3DEE A;  4KLJ A;  2XIC A;  3KHL A;  1J2M A;  1L7P A;  3F2D A;  2EZY A;  5J0O A;  5ALW A;  5J0P A;  4RUC A;  2AQ0 A;  2IMW P;  3MR6 A;  3PO4 A;  4AYB F;  8ICY A;  1WCN A;  5DG9 A;  4F3O A;  1KW4 A;  1KRP A;  4CF3 A;  2RDJ A;  3SZ2 A;  4YMO A;  4KLF A;  1RQN A;  1L7M A;  1TAU A;  4JUZ A;  4ECZ A;  2WB1 C;  5CR0 A;  5J0U A;  4O3O A;  4MEY A;  5AKX A;  1S9F A;  2FLL A;  4NLG A;  3N97 B;  1YZ7 A;  4F92 B;  8ICG A;  2HBK A;  3BS7 A;  4ED6 A;  1QQ5 A;  4KLD A;  1RDF A;  2WF8 A;  2F76 X;  2ZIV A;  2QAR A;  2YB4 A;  3NVV A;  4NM2 A;  3QU2 A;  3T5J A;  3M6Z A;  2E8P A;  3TAQ A;  4DSE A;  1NJX A;  2KVS A;  8ICB A;  5DGA A;  4LJX A;  2LMR A;  4M6W B;  5J2H A;  3G6Y A;  4DL4 A;  5AKG A;  4ECV A;  5E79 U;  3HP6 A;  3KZI U;  1V85 A;  4DLE A;  2EZX A;  9ICF A;  4Q45 A;  4TQS A;  1D8B A;  3RBD A;  5D4B A;  3ONN A;  4KLO A;  2YX8 A;  1KSP A;  4UAW A;  2AGQ A;  4O5K A;  1L7N A;  3PVX A;  5DBC A;  3JPQ A;  3LDA A;  3M8S A;  1N62 A;  1KTQ A;  4IQW A;  3C21 A;  1XSN A;  1ZD5 A;  4FFD A;  1X9W A;  2OWO A;  5III A;  4KX5 A;  4QIW C;  3N7S C;  1URJ A;  2ASL A;  3HPO A;  2YMQ A;  1A6S A;  1K1Q A;  5HP4 A;  4AYB C;  4YD2 A;  1X42 A;  1U45 A;  3H4B A;  2Y9U A;  1UT5 A;  3H8W A;  7ICE A;  1PVQ A;  5CA7 A;  3M1Y A;  3BS5 B;  3TFS A;  1KQQ A;  2YN4 A;  2Y9T A;  4G9B A;  1OUQ A;  2PFP A;  4CRX A;  3M7D A;  5ALP A;  4B9U A;  4QW9 A;  3WK7 A;  2LBO A;  2G07 A;  2W7P A;  1NK6 A;  2PFQ A;  3AM9 A;  4E0D A;  3QU5 A;  3GV5 B;  5J2E A;  2LM4 A;  4C80 A;  2W9B A;  2A3V A;  1ZQQ A;  4JB3 A;  3M9M B;  2WTF A;  2GWS A;  1SL1 A;  4PZN A;  3JPN A;  4O3R A;  1F0M A;  4QZG A;  4OJO A;  5ALM A;  5DQG A;  3E58 A;  3EW9 A;  4CGZ A;  5AHX A;  5H2F U;  8ICP A;  5DLG A;  3BDP A;  5ALT A;  3AEV A;  2R8I A;  1A76 A;  1Z3E B;  4CDG A;  5HR7 A;  2OM6 A;  3QU4 A;  3IN5 A;  2EAM A;  5BOL A;  5J0W A;  4M0A A;  5ALQ A;  3I1Y A;  1JAL A;  1SB3 C;  5ALL A;  1RQL A;  4FZM A;  2H3Z A;  1Z1B A;  3KKA A;  2VA3 A;  5KFD A;  3SQI A;  3SV3 A;  4Q8E A;  4B6J A;  4USA A;  3OSP A;  1ZQX A;  1ZOL A;  4UB6 U;  4PGQ A;  4QZH A;  4F91 B;  4EBE A;  4Y2Q A;  1DGS A;  1ZQW A;  3JPT A;  3PV8 A;  4UB8 U;  1WG8 A;  4O3P A;  2CN1 A;  2WF9 A;  5KFG A;  3NTU A;  4O0I A;  2F8L A;  3SR6 A;  1Z19 A;  2MSN A;  4IRC A;  5J2F A;  3L3F X;  1Z1V A;  2KZM A;  7ICU A;  4ELT A;  1S77 D;  1C7Y A;  5DLF A;  4C8L A;  3KFU F;  4EEL A;  2KJ9 A;  5BPC A;  4O9M A;  5AKY A;  2H3Q A;  4ED3 A;  1MQ2 A;  9ICM A;  4NL9 A;  2DKX A;  3D2Q A;  3NVZ A;  3Q8R B;  2DQN B;  4CF5 A;  2BDU A;  7ICV A;  4TUS A;  2F44 A;  2JZB A;  4R65 A;  4ED2 A;  4EBC A;  5F9N A;  3RAX A;  4PL1 A;  4EYH B;  2KEY A;  3GU3 A;  2DBY A;  1ZQK A;  3B0Y A;  4BGD A;  4PHD A;  9ICU A;  3HKZ F;  4B9T A;  4Z6E A;  4M2Y A;  2KFZ A;  3T79 A;  2KSO B;  1S0O A;  2W9B B;  2DPJ A;  3OSN A;  4EX6 A;  3F53 A;  1NK8 A;  3ETL A;  3SD7 A;  2I6X A;  7ICJ A;  3HWT A;  3IHQ B;  1ZQB A;  5J2A A;  1MC8 A;  3MR5 A;  2OHF A;  5J2C A;  4BXO A;  5B5E U;  5KG0 A;  3H40 A;  4NM1 A;  4KLE A;  5F3X B;  4R66 A;  1ZD2 P;  3NUQ A;  1S97 A;  4RT2 A;  2CRX A;  3D2S A;  2HHT A;  4ECR A;  4J03 A;  2O6K A;  5ALS A;  2QKQ A;  1COO A;  2AJQ A;  1ED1 A;  1LKY A;  3WKD A;  4M9H A;  7ICT A;  4Y2T A;  4Y2V A;  2NYV A;  2WF6 A;  2MUT B;  4DOA A;  1XC9 A;  9ICK A;  1X9M A;  1TK0 A;  2BKE A;  3AN1 A;  1ZQT A;  3RB6 A;  2KIW A;  4F5O A;  1P7D A;  4RQ8 A;  2PXI A;  5AM2 A;  3RFA A;  4J9K A;  4IRD A;  3QE9 Y;  2W43 A;  5IIO A;  1L7O A;  5DDY A;  5EWG A;  4NLC A;  5AIB A;  2C22 A;  1ZQJ A;  4EEK A;  2VJ4 A;  4YMM A;  4P0Q B;  3BJY A;  4HYK A;  3Q8Q B;  3LWL A;  3H8J A;  4KLT A;  4RQN A;  5DB8 A;  4F2S A;  5KG6 A;  3M9N B;  7ICP A;  2H5X A;  3J81 j;  2AHO B;  2KKP A;  4DF4 A;  2ES6 A;  2DWQ A;  3PX0 A;  5KT7 A;  1D9D A;  3KHR A;  2F1H A;  2HVH A;  3H8M A;  4B9N A;  9ICW A;  2XGQ A;  5AK6 A;  3C1Y A;  2LYH A;  2BCQ A;  3PW0 A;  2HI0 A;  8ICM A;  2JHD A;  5ALN A;  5AKJ A;  7ICO A;  2YTU A;  3FAH A;  8ICU A;  4GXJ A;  4CE6 A;  4K4H A;  2JEJ A;  4UAZ A;  7ICR A;  4Y2Y A;  1QSL A;  3Q8L A;  4YFK A;  1SKS A;  5DGB A;  2AQ4 A;  3MDC A;  3EZ5 A;  4LZG A;  1RXW A;  8ICR A;  8ICS A;  2ZUB A;  4MHV A;  5EWF A;  1EXN A;  1UA0 A;  1ZQ1 C;  5DKW A;  1QLN A;  2WF5 A;  3RF9 A;  7ICK A;  2XY5 A;  5DBA A;  1NK5 A;  2F3N A;  4OJ6 A;  1JXE A;  1ZQD A;  1B4F A;  5TIS U;  2VA2 A;  1Z00 B;  3HIL A;  4AP9 A;  1B0X A;  2Q0Z X;  1L3S A;  2KFN A;  4US9 A;  5ALY A;  3KHG A;  2PFO A;  3PSF A;  3NS1 A;  2IA6 A;  4QWE A;  5CP2 A;  2E5S A;  1N61 A;  4KX3 A;  1TE2 A;  1TAM A;  2G08 A;  3NGD A;  1WYG A;  1C20 A;  2MRL A;  1S0V A;  3I28 A;  2NRV A;  3RJK A;  1X6I A;  1Q8K A;  4BWJ A;  3BZK A;  5KNI A;  3AQE A;  4TUR A;  2W54 A;  1S0N A;  3IDW A;  2W9C A;  4GFJ A;  2G5H B;  3VC8 A;  5J2D A;  3BQ1 A;  4RNN A;  1X40 A;  2JV3 A;  1JIH A;  1N48 A;  1F44 A;  1NJZ A;  2KNJ A;  3GIK A;  2E1F A;  3R9K A;  5KT2 A;  4IQU A;  2K89 A;  1BPX A;  3BS5 A;  5DG7 A;  4M9L A;  1QQ6 A;  4Q43 A;  4O3M A;  3V7K A;  3PW5 A;  2W3S A;  1LKY B;  4DSL A;  3GIJ A;  4P0P A;  4QJF B;  4Y2P A;  3CRX A;  4UAR A;  4ELU A;  2HHS A;  1OXJ A;  3IG5 A;  3SAF A;  2ZIW B;  4DFK A;  3L5K A;  5KG7 A;  2YML A;  1ECW A;  4IR1 A;  2NO4 A;  2VA8 A;  1SZH A;  9ICL A;  3PX6 A;  4R63 A;  3HRD D;  3JPS A;  2HHU A;  3QZ8 A;  4YXJ A;  4C8M A;  1DK3 A;  2K8B B;  1OW5 A;  1RYU A;  4DL6 A;  1NZB A;  2A1J A;  2FE9 A;  2ODG A;  3QEA Z;  4YR2 A;  1TV9 A;  5EE1 A;  3UMC A;  4FS1 A;  1XWL A;  3MAB A;  2GO7 A;  2IHM A;  8ICX A;  4UQG A;  2QB1 A;  2OEH A;  3RJI A;  3CNH A;  4F8R A;  4ED8 A;  5KFZ A;  3L4P A;  5CHG A;  4UBC A;  4IC9 A;  8ICZ A;  3QEB Z;  4KLS A;  2QLT A;  1TKD A;  1V38 A;  4F72 A;  9ICE A;  1HJP A;  1TAQ A;  4J9P A;  2E1E A;  3MGI A;  5AIA A;  4KLL A;  1T7P A;  1QSS A;  4NY8 A;  4DOB A;  5ALJ A;  1MQ3 A;  2R8G A;  5FP0 A;  3WK8 A;  4JWN A;  2PI5 A;  4C8K A;  1IV8 A;  1TFR A;  4QWC A;  2K60 A;  3HJE A;  3QX7 A;  4Y2U A;  1ZQP A;  4KN7 A;  5J2B A;  1RYR A;  4OJ5 A;  3ZDD A;  1RM6 C;  3F5E A;  4JWM A;  4DFM A;  2H3V A;  4KLI A;  4M9N A;  1ZQN A;  1F5S A;  1S0M A;  5JTI A;  2F2A B;  1HUO A;  3UXO A;  3GQC A;  4B9L A;  1X66 A;  1SWV A;  4I2C A;  2WAQ F;  5KT5 A;  5KL1 B;  2BCV A;  4DL3 A;  5KFW A;  4F4K A;  4RQ3 A;  3C2K A;  4DOC A;  2JMG A;  9ICV A;  2AXT U;  5L1L A;  1MSW D;  4YR3 A;  5ALE A;  4DSK A;  3QUT A;  1ZQY A;  9ICA A;  8ICH A;  3TQ1 A;  1QH9 A;  4UBB A;  1T4G A;  4UW9 A;  4ECT A;  1GO3 F;  2K4I A;  3AL0 B;  4RPY A;  4KMU A;  1T3N A;  2PFN A;  4C4S A;  2BDP A;  2PI4 A;  4ECQ A;  3K75 D;  4DS4 A;  2JGA A;  1BGX T;  2JH7 A;  1T94 A;  8ICA A;  3RRH A;  2JRZ A;  2I9G A;  3JPR A;  2J6S A;  3GZF A;  4F4Y A;  4P4P A;  4R8U B;  3RJG A;  1O03 A;  4QWD A;  4NLB A;  2M0N A;  5IIN A;  3ZI4 A;  2KN7 A;  3PST A;  1JRP A;  4F2R A;  3WK6 A;  1S5L U;  3RJF A;  2E3T A;  4PHE A;  2A1A A;  5KFC A;  2E8M A;  7ICL A;  4DEZ A;  1U49 A;  2ZXI A;  4O3S A;  1WCL A;  3H4D A;  5KFQ A;  1BNP A;  3RJH A;  1ZRN A;  2V9W A;  4NLZ A;  5J2I A;  1KFS A;  8ICC A;  4DFP A;  3BQ2 A;  5EOZ A;  2HSZ A;  5L1I A;  2IOH A;  7ICH A;  1BPY A;  4KTQ A;  4M47 A;  1SIJ A;  2D6F C;  4I2D A;  5EE9 A;  5AKL A;  5AK3 A;  3IRU A;  5J8Y A;  3OJU A;  3D6J A;  1BPB A;  1IXR A;  2DGZ A;  3FC4 A;  3RBE A;  1QSY A;  2WF7 A;  9ICC A;  4R8U A;  2KV2 A;  4X5V A;  1NNL A;  2VKQ A;  2CPR A;  2K4P A;  2FLP A;  3BQT A;  3GV7 B;  2H3F A;  2K4H A;  2PMZ C;  5KG2 A;  5G5H A;  2QB0 B;  2KZ3 A;  5J0Y A;  1ZXI A;  3NAS A;  5KFV A;  2YB1 A;  3H0L B;  1CRX A;  3MGV A;  3WKA A;  1XS9 D;  2FI1 A;  3IV6 A;  1D9F A;  1SL2 A;  4I2B A;  5JUM A;  4NXZ A;  3H7I A;  3GV8 B;  1UQV A;  4NLN A;  2NRT A;  4I2G A;  2W9A A;  5EWE A;  4UB3 A;  4XA5 A;  4BDP A;  5AKI A;  3DV9 A;  4DCC A;  2HHV A;  2ASJ A;  4DF8 A;  4BXO B;  1K5O A;  3MGH A;  2EAN A;  2W03 A;  1ZJM A;  1XO0 A;  3PR4 A;  4G3I A;  1SV4 A;  5KT6 A;  4QW8 A;  1SXE A;  3UPQ A;  2HOF A;  5DB9 A;  3K4G A;  2IHN A;  3RR8 A;  4OJP A;  2MUT A;  9ICX A;  3T5H A;  4ED7 A;  2ESE A;  4J9S A;  1M6Y A;  5AM5 A;  2W8K A;  5AI5 A;  3PNC A;  4ZOH C;  2KOB A;  1L8L A;  2W04 A;  4RQ2 A;  3F2C A;  2W9C B;  2IBK A;  2KP7 A;  5HNK A;  5J0R A;  3OHB A;  3LWM A;  4GC6 A;  4IQT A;  2QB0 A;  2MU2 A;  3ZDE A;  5J2J A;  4RPZ A;  1IG6 A;  4C4R A;  5J0Q A;  3GIL A;  1DGJ A;  2GOL A;  4FO6 A;  1JX4 A;  2I1Q A;  3KOO A;  4DSI A;  4RQ6 A;  1DXS A;  5KFA A;  4QZ9 A;  4IL6 U;  3K1R B;  1DOQ A;  3UXP A;  4MEX A;  5KFH A;  3RR7 A;  2W3R A;  4BX9 C;  8ICN A;  1KBU A;  2FMS A;  1XNS A;  5J2K A;  3RRG A;  4PHA A;  2V4R A;  2V4Q A;  3NRZ A;  3V6J A;  2DF4 B;  4IQV A;  8ICQ A;  2ZIW A;  5ALI A;  1ZRM A;  3FDS A;  2Y1J A;  2UVV A;  3QUC A;  4IR9 A;  3WK9 A;  2F8K A;  5J2G A;  3OHA A;  1HEK A;  2LM1 A;  4FE3 A;  8ICJ A;  4TUQ A;  4FZN A;  2HHW A;  2K8C B;  3KHH A;  3IG8 A;  5EE0 A;  9ICQ A;  5ALX A;  2P66 A;  4B9M A;  2AU0 A;  3ISB A;  3C2L A;  1N63 A;  4F50 A;  4ECS A;  4RQ5 A;  3N4M B;  5KFU A;  4DFD A;  5GTI U;  2W7O A;  1ZQH A;  8ICF A;  3RH5 A;  3EUB 2;  3KKA C;  5ALU A;  3GII A;  4M04 A;  1WUD A;  2DKZ A;  4OCZ A;  2XCA A;  2C2D A;  2WHE A;  4XQ8 A;  4DL5 A;  2EAP A;  3T3F A;  2JEI A;  2JH1 A;  4ED1 A;  1B22 A;  1BPD A;  4O3Q A;  4Z6F A;  4OO1 J;  3WU2 U;  1DK2 A;  4YR0 A;  4BJQ A;  1NK7 A;  2D3D A;  3EYZ A;  4EZ9 A;  4C8O A;  2DPI A;  7ICI A;  4U6P A;  4Q44 A;  1ZQU A;  4QWA A;  2BQU A;  3N7P D;  4UB1 A;  2JEF A;  4A8E A;  3Q8M A;  4JK1 A;  3OPX A;  2B0C A;  2JEG A;  3QUQ A;  4QZD A;  4DQQ A;  5AKZ A;  1MA7 A;  2EDU A;  1XU4 A;  2FMQ A;  1ZYQ A;  2BCS A;  9ICR A;  4MFA A;  5KAI U;  4LZD A;  5F9L A;  3ICX A;  1LB2 B;  4UAV A;  1YZ6 A;  4JV0 A;  4F93 B;  9ICS A;  2KK0 A;  4QWB A;  2ZTE A;  4Y2S A;  2BCR A;  5KG4 A;  9ICO A;  2FPL A;  4IRK A;  2KVC A;  5ALZ A;  5C0Y A;  2HOI A;  3PW2 A;  2OH2 A;  1ZET A;  3RB0 A;  2G06 A;  2EH9 A;  2LKY A;  3N7R C;  3ZDB A;  5CRX A;  5KFS A;  2Q4T A;  1S76 D;  7ICQ A;  4NJ8 A;  5ALR A;  3C5F A;  4ECW A;  9ICP A;  4DLG A;  8ICV A;  4YQW A;  4B9V A;  3SAH A;  2ZJA A;  3AU2 A;  1K1S A;  5D46 A;  2OYY A;  1L5U A;  5J0X A;  3SI8 A;  3M8R A;  5C5J A;  3PML A;  4FBU A;  1KL9 A;  8ICI A;  2HDO A;  3UXN A;  5ALD A;  4EEY A;  2PMZ F;  3E2E A;  3JPO A;  1AQ6 A;  4ED0 A;  3TAP A;  3A0B U;  3CYM A;  5AM4 A;  5DG8 A;  3HW8 A;  4QZE A;  4GXI A;  4KN4 A;  5KT3 A;  2KMD A;  5CWR A;  2FJ6 A;  1CUK A;  2RLT A;  2RQ5 A;  2VJ5 A;  2P6U A;  1N5X A;  1PVP A;  2VIX A;  2C2E A;  4J9O A;  1BVS A;  4FBT A;  3H0M B;  1Z00 A;  2KJ5 A;  5KT4 A;  4QZA A;  4I2I A;  4I28 A;  5KFN A;  3LVW A;  1YT3 A;  1LV5 A;  4RZR A;  5KG3 A;  2LYB A;  3C29 A;  3QNM A;  2HBM A;  5CJ7 A;  1ZQE A;  1X2I A;  4YCX A;  3PSI A;  4PJ0 U;  2JZB B;  3ORY A;  5JU5 A;  5KFM A;  4UAS A;  2G0A A;  4NWI A;  5IIK A;  1KDH A;  2EAO A;  1COK A;  5DDM A;  3BZC A;  4MFC A;  2Z7J A;  3RH6 A;  8ICK A;  2OCE A;  4OJL A;  7ICN A;  2BZF A;  5ALG A;  3S6J A;  3LYS A;  1ZQS A;  5JRT A;  4TQR A;  2XCP A;  2W8L A;  1ZQO A;  5J0S A;  2CXY A;  1U48 A;  2UVR A;  2AH5 A;  3TI0 A;  2GH1 A;  1FEZ A;  2WFA A;  5AI4 A;  5A0L A;  2XO7 A;  3O0F A;  2HW3 A;  3ED5 A;  2J6T A;  4EYI B;  2ZTD A;  3WK5 A;  3SAG A;  2L5Y A;  1HIW A;  2HBJ A;  9ICJ A;  4I2H A;  3KBB A;  2KZZ A;  3TFR A;  1NZP A;  4QZF A;  3ISD A;  3RB3 A;  2G09 A;  1JUD A;  2BHN A;  3MR2 A;  4F4Z A;  1UPH A;  1Y88 A;  2Y1I A;  1A0P A;  2KD1 A;  3C23 A;  4CCH A;  1CEZ A;  2W55 A;  1ZQG A;  3HT3 A;  5KG5 A;  1D8Y A;  2P35 A;  8ICL A;  4QZB A;  2XGP A;  1N56 A;  3F5A A;  2ZIV B;  1NK4 A;  3A0H U;  5AM0 A;  3MC1 A;  1XSP A;  5ALH A;  2WAQ C;  4PGY A;  2B21 A;  9ICH A;  4GC7 A;  4KMO B;  1S8O A;  3MFH A;  2FPK A;  1CI4 A;  4QZC A;  1L3T A;  3ISC A;  4RNM A;  5KFI A;  4DSJ A;  1FIQ A;  2ATL A;  5HHI A;  2BQ3 A;  2Y0S F;  2MAX A;  5KAF U;  4WJ3 B;  5ALK A;  1ZD4 A;  3B0X A;  1TVA A;  4NLK A;  9ICT A;  3V6H A;  1B43 A;  3G6X A;  3ALR A;  2HVI A;  3Q8P B;  2NV3 A;  2FLN A;  2XI9 A;  2K8A A;  4Y2R A;  4M9G A;  1N60 A;  2DL0 A;  3VCB A;  3MBY A;  3AMZ A;  3RTV A;  1NJW A;  5BOM A;  3M6K A;  3D2N A;  2YQE A;  3LVV A;  2UVW A;  1ZD3 A;  5L1M A;  2BR0 A;  4DQP A;  3FYH A;  1J97 A;  1NK9 A;  5AI0 A;  2C2R A;  3FM9 A;  2ZTC A;  4U7C A;  1U47 A;  2XC9 A;  5K4L A;  4PL2 A;  2W11 A;  2N1R A;  4GXK A;  5J8Y C;  9ICI A;  4J9R A;  3H0R B;  4ACO A;  3HKZ C;  3TAD C;  3H8S A;  3SEN A;  1T3Q A;  1J2N A;  1MN8 A;  4JMU A;  1NOM A;  4US8 A;  5DB6 A;  2FPM A;  4O5E A;  3PR5 B;  3RAQ A;  3SEI A;  3UMG A;  3BQ0 A;  1NK0 A;  2IOF A;  4ELV A;  4EBD A;  2IOF K;  1NKB A;  5KFO A;  4Z6C A;  4IS7 A;  2OXO A;  3PW7 A;  1SKW A;  1ZQF A;  8ICO A;  2HMX A;  4ZH4 A;  2A19 A;  1H38 A;  2HCF A;  3THV A;  1TK8 A;  5L9X A;  2XVT A;  1RG6 A;  4BUG A;  4NL9 C;  2NO5 A;  4O5C A;  1Z4O A;  4RPX A;  5KTQ A;  1ZQM A;  1DRG A;  1V9P A;  2KE7 A;  5KFJ A;  3M9O B;  3C28 A;  4J9Q A;  5IIM A;  2KG5 A;  4MFF A;  1SKR A;  3UQ2 A;  2KHV A;  3QYP A;  5KG1 A;  1Q46 A;  2I5H A;  3OTQ A;  3UQ0 A;  2Y0S C;  4C7Z A;  1WWU A;  1L3V A;  4JV2 A;  3PY8 A;  4PGX A;  4I2A A;  1N2X A;  1RPL A;  4ECU A;  2ALZ A;  1PK1 B;  1BPE A;  2RDI A;  3PZP A;  1NJY A;  1UT8 A;  4RQM A;  4RU9 A;  3ZD8 A;  1PK3 A;  3V7L A;  5TZV A;  3E0F A;  4YVZ A;  2YY6 A;  1BPZ A;  2R18 A;  1TK5 A;  1ZQI A;  4M9J A;  1SL0 A;  4I2F A;  4JV1 A;  4UB5 A;  3IM1 A;  5AKH A;  4DWI A;  2R8H A;  2ZJ5 A;  2NRZ A;  8ICW A;  4Q8F A;  2MA1 A;  5AK5 A;  4MF2 A;  3AQF A;  3TKA A;  4DQS A;  4YG2 A;  4PH5 A;  5EE3 A;  4RQ0 A;  2KJ8 A;  4FS2 A;  2FMP A;  4HAI A;  3G6V A;  2H3I A;  3PSP A;  3BQ7 A;  3SYZ A;  4UAY A;  4RUA A;  2F77 X;  1JN3 A;  3KD3 A;  2JR5 A;  3ZDA A;  4PPX A;  5DQI A;  5J29 A;  4Z6D A;  4C0Z A;  1ZQZ A; 
#chains in the Genus database with same CATH homology
 2RHF A;  3F5E A;  3H0M B;  2KJ5 A;  4FZM A;  2H3V A;  2OXO A;  1L6N A;  5HR6 A;  2KV2 A;  2H3Z A;  4A8E A;  1Z1B A;  2ZIU A;  3SQI A;  3OPX A;  1IIP A;  2HBL A;  2HMX A;  2VKQ A;  2CPR A;  3LVW A;  1YT3 A;  4P0Q A;  4O3M A;  2F2A B;  2ZIX A;  2LYB A;  3C29 A;  3F5A A;  2ZIV B;  2HBM A;  2H3F A;  2K4H A;  2PMZ C;  2XVT A;  2ZIU B;  3NRW A;  1MA7 A;  2WAQ F;  4QIW F;  3PSI A;  4BX9 C;  5KL1 B;  4BUG A;  3CP8 A;  3NUQ A;  1KBU A;  2WAQ C;  4KX5 A;  4QIW C;  2YB1 A;  2G0A A;  4NWI A;  2CRX A;  3H0L B;  3N7S C;  1CRX A;  1XNS A;  3D2S A;  1DRG A;  1URJ A;  2JMG A;  4P0P A;  3MGV A;  3DEE A;  4QJF B;  2XIC A;  3ICX A;  4KMO B;  3CRX A;  3K1Z A;  3F2D A;  2DF4 B;  3SMV A;  2KIC A;  2KKV A;  2ZIW A;  3C28 A;  1A6S A;  3IG5 A;  2CN1 A;  3IP4 B;  3SAF A;  2ZIW B;  1ZQ1 C;  1ED1 A;  2HOQ A;  3RF9 A;  1GO3 F;  2K4I A;  4AYB C;  3AL0 B;  2KHV A;  1ECW A;  2F8L A;  2Y0S F;  2Z7J A;  1Z19 A;  2KVC A;  4AYB F;  1HEK A;  4ICA A;  4FE3 A;  4WJ3 B;  4OJ6 A;  1SZH A;  2HOI A;  2Y0S C;  5C0Y A;  4NV0 A;  4OJL A;  2OH2 A;  2JGA A;  2G5I B;  1PVQ A;  2JH7 A;  1T94 A;  4FZN A;  3L3F X;  2K8B B;  2G06 A;  3LYS A;  1NZB A;  2LKY A;  3N7R C;  2K8C B;  2KIW A;  1P7D A;  2ZIX B;  3ALR A;  3GZF A;  2NV3 A;  3IG8 A;  1OUQ A;  2W03 A;  2XI9 A;  2K8A A;  4C0Z A;  3M7D A;  4CRX A;  3RFA A;  5CRX A;  3KFU F;  3PSF A;  2KJ9 A;  3VCB A;  1XO0 A;  3PZP A;  2Q4T A;  4NLB A;  2M0N A;  2H3Q A;  2E5S A;  3D2N A;  3M6K A;  3LVV A;  3D2Q A;  2ZXH A;  3ONN A;  2DQN B;  2WB1 C;  4KX3 A;  2LBO A;  2G07 A;  3PST A;  2BDU A;  3SAH A;  2W7P A;  2K4E A;  3E0F A;  1TAM A;  4NLC A;  2HOF A;  2XID A;  2R18 A;  2OYY A;  2W7O A;  1Q3U A;  2G08 A;  2GH1 A;  4FZL A;  4OJP A;  2VJ4 A;  1PVR A;  2MRL A;  4U7C A;  4P0Q B;  4PL1 A;  4QNL A;  1WUD A;  2A3V A;  2HBK A;  2KEY A;  5A0L A;  2ZXI A;  3GU3 A;  3O0F A;  3KZX A;  4IC9 A;  4PL2 A;  5T14 A;  3AQE A;  2F76 X;  2N1R A;  2ZIV A;  2KHQ A;  1Q3V A;  3F2B A;  2YB4 A;  3HKZ F;  3H0R B;  2MA1 A;  4OJO A;  2PMZ F;  3SAG A;  4ACO A;  3M6Z A;  3T79 A;  3AQF A;  1HIW A;  3HKZ C;  2HBJ A;  2KOB A;  2W04 A;  2KKP A;  4GFJ A;  2E1E A;  5KL8 B;  3F2C A;  4CGZ A;  2JH1 A;  2G5H B;  3VC8 A;  3F53 A;  2KJ8 A;  3CYM A;  4JMU A;  4OO1 J;  4CDG A;  5HR7 A;  2H3I A;  2OM6 A;  3PSP A;  1F44 A;  2D6F C;  2G09 A;  2WB1 F;  3IN5 A;  2ZG6 A;  2KNJ A;  4BJQ A;  2F77 X;  2LHT A;  2VJ5 A;  1UPH A;  1A0P A;  2RRD A;  2E1F A;  2RP5 A;  2GOL A;  4P0P B;  1PVP A;  2VIX A;  2DGZ A;  4U6P A;  1D8B A;  2KD1 A;  2LYA A;  2K89 A;  3N7P D;  4OJ5 A;  2YX8 A;  2JHD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...