1TAMA

Human immunodeficiency virus, nmr, minimized average structure
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
120
structure length
120
Chain Sequence
MGARASVLSGGELDRWEKIRLRPGGKKKYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNTVATLYCVHQRIEIKDTKEALDKIEEEQNKSKKKAQQAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Matrix protein
molecule keywords HIV-1 MATRIX PROTEIN
publication title Refined solution structure of p17, the HIV matrix protein.
pubmed rcsb
source organism Hiv-1 m:b_hxb2r
total genus 27
structure length 120
sequence length 120
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1996-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00540 Gag_p17 gag gene protein p17 (matrix protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.90 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 1tamA00
1A6SA 2GOLA 1TAMA 2K4EA 1ED1A 2HMXA 2H3ZA 1L6NA 2K4HA 4IC9A 1HEKA 1ECWA 2H3IA 2K4IA 1UPHA 2LYAA 1HIWA 2LYBA 2H3QA 2H3FA 4ICAA 2NV3A 2JMGA 2H3VA 4JMUA 2N1RA
chains in the Genus database with same CATH superfamily
5KL1B 2XIDA 2A19A 1N2XA 2A1AA 5J2BA 1NKEA 4O3SA 4RUCA 4TQSA 4EEKA 5EOZA 3BQ1A 4IRDA 1H38A 9ICEA 5J0QA 2JRZA 5ALHA 3VCBA 2ESEA 2FPKA 4EEYA 2NRWA 4M9LA 3WKDA 4BWMA 1KL9A 3QEBZ 3ZI4A 1U49A 1C7YA 4M6WB 2RDIA 3PMNA 1F44A 3NASA 5AHXA 3KZXA 1AROP 4DL6A 1HUOA 3HRDD 2PFQA 2CXYA 1V38A 3TADC 1NJXA 5J2DA 1S97A 4KLLA 4FBTA 5KG2A 3Q8MA 3Q8QB 3T5KA 1ZQGA 1ZD4A 2BKEA 4B9VA 1WWUA 2IOFK 3RRGA 4NXZA 9ICHA 5AKJA 2W11A 5AK6A 3M9NB 2KICA 5GTIU 3N4MB 5AKLA 4RQ5A 5ALOA 5KG4A 1JIHA 5DG7A 2A3VA 5KFAA 3RH6A 2YN4A 4F71A 4ICAA 2EDUA 1SV4A 1KKXA 2QARA 5HMLA 3MGIA 1ZQVA 1A77A 2V4RA 5CWRA 2ZJAA 4IC9A 2DBYA 2PXIA 4EELA 3OHAA 2R8GA 2XO7A 4C80A 5EE9A 5TZVA 3H4BA 1XNSA 5J0YA 7ICEA 8ICTA 3F2CA 4NLGA 1KTQA 5IILA 2YMQA 2RQ5A 3N28A 2PI4A 1XU4A 1XWLA 4QZCA 3CW2C 4JWMA 3SQIA 4ECTA 4RQ6A 4EYHB 9ICSA 2ZIVA 3PO4A 4F4YA 2UVRA 1BPDA 1ZQRA 9ICBA 4DSJA 3L4PA 5HR7A 2NV3A 4MFFA 4PGYA 3RJIA 4P4OA 1X42A 4K4GA 4TURA 5TISU 2KMDA 8ICOA 8ICJA 4ED3A 4ECRA 3N97B 4QWAA 3ONNA 3C21A 4DQPA 3UXNA 1BPXA 4YMOA 5HNKA 3NRWA 3NVYA 8ICPA 2G0AA 1QTMA 1FFVA 3QE9Y 4KX3A 4KITB 4YMNA 5AIBA 5DBBA 3E0FA 1SV0C 2V4QA 5ALYA 5AI0A 5KFCA 3N7RC 4CF3A 4NM1A 1Z00A 1X9MA 4R8UA 2LKYA 4Z6CA 5EWFA 1WYGA 1PVRA 2F1IA 5J8YA 3NVVA 2ISOA 5DQHA 4BGDA 4PGQA 2K4EA 4FS1A 3RB3A 3WK7A 3WKEA 5KFOA 4MF8A 4PPXA 2KSOB 5ALKA 3UMBA 1JN3A 1UQVA 4YD1A 4YN4A 1WWVA 1HIWA 4Y2PA 4QW9A 2PFPA 5AKIA 5CEHA 2LYHA 2MUTA 4NJ8A 4O9MA 2JR5A 1QQ5A 2FMSA 2P6RA 3OSPA 4UB2A 4YP3A 2M9NA 5CRXA 3UMCA 2XI9A 4XRHA 2WF5A 1N48A 4UBCA 3MDCA 2QB1A 5AKXA 1DXSA 1D9DA 4JK1A 4OJPA 4F5PA 1NOMA 4RZRA 1KFSA 2FJ6A 3LVWA 2G07A 1YZ6A 5AKKA 4QIWC 2P66A 1KN5A 2LM4A 4QZGA 8ICFA 3MR6A 4FFDA 2C22A 1ZJMA 4LZGA 2JEIA 4KLOA 4F4WA 2BDUA 1ZQAA 4DL5A 3JPSA 2FMPA 2QLTA 3C5GA 3NVZA 1KQQA 2HSZA 1Y88A 4KN7A 1BGXT 1NI3A 3SR6A 5AM2A 3QUBA 2JMGA 4O3RA 5KG5A 1ZQPA 4Y2JA 4I27A 4QW8A 3N7PD 3GZFA 3PR4A 3WK8A 3HPOA 3C29A 3FC4A 5T14A 8ICSA 3RBEA 3TQ1A 4ECSA 3UQ0A 1RYRA 1LVHA 1SGGA 4QZ9A 4KLSA 3ETRA 4RPYA 3RJEA 5DG8A 2BCUA 5DDMA 4IR1A 2PI5A 4DL2A 2AGOA 2W04A 4DQQA 1SZPA 1TE2A 1Q8KA 4I2FA 3RJFA 5D49A 1KEJA 5AICA 4ZH4A 2PKEA 3B9JA 1Z4OA 2OYYA 1VDVA 4BXOA 4MF2A 3GV5B 3T5LA 4KMOB 1YT3A 3D6JA 3GIJA 1MC8A 1RDFA 2ZUBA 3GFKB 4CNQA 3GU3A 8ICCA 1ZQKA 3RR8A 4Q8FA 2BCQA 3EWAA 3KKAA 3V7JA 1MQ3A 1ZD3A 3CRXA 4I29A 4NLNA 3QYPA 3G6YA 4IR9A 5AK3A 4EX6A 2HCFA 4Y2QA 3AUOA 3GQCA 3V72A 1SWVA 3ZDAA 2H3FA 3V6KA 8ICVA 3N7SC 2XY5A 4EENA 2ASJA 3SMVA 1PUZA 4B9NA 4I2EA 7ICRA 3FDSA 2W9CB 3TAQA 4P0QB 1U48A 1N60A 4QWCA 1IIPA 3PMLA 2H3VA 1SKWA 4J9RA 2JGAA 2QB0B 2W9BB 2W9AA 4DS4A 2B6GA 1X40A 3G6XA 8ICEA 1OXJA 4OJOA 1L8OA 3RR7A 2C2RA 5KT6A 5ALLA 2KEYA 3QXGA 5KG0A 4ED6A 2KZMA 2HW3A 4YXMA 1N63A 4PJ0U 5A0LA 1TV9A 2YB1A 4XQ8A 5F9LA 5KFSA 1RYUA 2E1FA 5FP0A 8ICWA 3SI8A 4J9PA 5ALZA 4UAYA 4C8LA 2VA2A 3RJHA 1S8OA 3HJEA 3AU6A 3IN5A 2KVCA 2G08A 4M6WA 4DSKA 3LWLA 1YZ7A 4NLBA 4JV1A 4UQGA 8ICQA 3OSNA 5JTIA 1Z3EB 1B43A 5KFYA 2EZZA 2RLTA 3GV7B 3TFSA 1NZPA 1TAUA 5DB7A 3SENA 5L1IA 5AM4A 3T79A 3RAQA 1K1SA 2G5HB 9ICFA 1B4FA 4OJ6A 2YMPA 2E8MA 8ICBA 3OHBA 3LWMA 3GDXA 4NLCA 1Q46A 4O3OA 2KZ3A 3NRZA 4B9LA 4C0ZA 2BHNA 1C20A 5DB9A 1T8EA 2JV3A 9ICGA 2KVSA 1XO0A 4KLGA 3H8JA 1ZQSA 7ICKA 2MSNA 4FBUA 5J29A 2ZIUA 3NGDA 4DFPA 1Q3UA 2RRDA 4ELUA 1QCKA 2DKZA 8ICHA 5IIMA 2HBMA 1PVPA 4OJ5A 3HP6A 4QZAA 4YR3A 2AGQA 5AI6A 1UA0A 3IRUA 5L1LA 3FM9A 1DGJA 4R64A 1HEKA 2I5HA 8ICGA 3I76A 4RQMA 4R63A 4EZ9A 3AL0B 5IIJA 1M6YA 1A76A 1ZOLA 4F4ZA 1UA1A 4IQWA 4I2JA 2IA6A 4US8A 5KFEA 3B0YA 2GOLA 1KDHA 3C23A 3ZDDA 3MFHA 2F76X 3ALRA 1V85A 1MA7A 4QZHA 5ALFA 2K4HA 3H8MA 2HOQA 3M1YA 5JRTA 1JX4A 1ZQWA 4MEYA 5G5HA 2XY7A 3PW2A 2ZJ5A 4ECWA 4JWNA 2DKXA 5KFXA 3PNCA 2CPRA 1X66A 1P7DA 4UW9A 1ZD5A 1O08A 2ZG6A 3JPRA 1ZYQA 9ICCA 4Y2TA 4MEXA 2JH7A 1L6NA 3AN1A 3GIKA 8ICKA 1S0NA 1X6JA 4KLUA 2CN1A 3KOOA 5DBCA 1S0VA 3RAXA 4FO6A 5ALIA 4ECXA 1ZQXA 1ZQUA 4B6JA 5CB1A 2WF8A 4C8NA 4ECQA 3CP8A 3HKZF 5IIIA 4OD0A 4M9JA 5HHIA 5ALUA 1MSWD 4RNNA 3RH5A 2KJ8A 3HX0A 5J0RA 3QZ7A 1U47A 4HYKA 3MBYA 2KSOA 4DSFA 8ICZA 5B66U 3ZD9A 2HHWA 1L3SA 1D8BA 3IP4B 3TKAA 1JXLA 4I2AA 2AQ0A 1SXEA 3QU4A 5IIOA 1PK1A 5KFIA 4J9LA 4F3OA 4K4IA 2R18A 3WKCA 8ICXA 3RF9A 2KG5A 4Z6EA 4IRCA 1F0MA 1ZRNA 2P6UA 3F5AA 4UB4A 5DBAA 5BOLA 3KD3A 2KN7A 4IQTA 4DF4A 4EZ6A 2E1EA 2FDRA 3I1YA 3C2MA 1TK0A 8ICNA 2ZTEA 3C28A 4PZOA 3SD7A 1CEZA 5ALDA 3ZDBA 3EUB2 3MGVA 3RJJA 3NVWA 1QLNA 3I28A 1Z1VA 4YCXA 3MC1A 1XS9D 4LJXA 2DF4B 3C2KA 3Q8KA 3J81j 4C4RA 4I2BA 4US9A 2FMQA 3TADA 5KFVA 4Y2SA 4QZIA 1L3TA 4ED1A 2HBJA 2KNJA 4RUAA 3RBDA 4C4TA 1XSNA 3UMGA 2BGWA 4DFMA 2OH2A 3BS5B 2XY6A 5KG6A 9ICWA 4IQUA 2HHQA 3MR2A 2OCEA 2W9MA 5KG1A 2MRLA 4CDGA 4GXJA 1T3QA 4UAZA 2G5IB 7ICPA 5JUMA 4F72A 3DDHA 3WK5A 5DQGA 3T3FA 3JPPA 4J9SA 2WTFA 2VJ4A 5GTHU 5DLGA 4ED0A 5CP2A 4MFAA 3Q8SB 3C1YA 4MHVA 1RZTA 4KX5A 5EE0A 1B0XA 4MFCA 4Y2VA 5D46A 3Q8RB 2HHTA 4F93B 5G5GA 3GILA 3F2BA 3PY8A 2W8KA 3PX6A 3UXOA 3ISCA 3IDWA 4P0PB 4C4SA 1SXDA 1ZQTA 5EWGA 5D4BA 1COOA 2LM1A 2HHSA 1RG6A 3LVVA 1L7NA 1WUDA 5AKYA 2EQYA 4KLFA 2GLEA 4C8MA 1LB2B 3EW9A 4M04A 3G6VA 5J2GA 2W9CA 3H40A 3PW0A 4P0QA 3PX4A 2AQ4A 4DQRA 5C0YA 5ALXA 4ED7A 3NUQA 3C1ZA 2AXTU 5KFMA 2ZUDA 3PVXA 4Q43A 4EBDA 5DLFA 2Q0ZX 1QQ6A 2QB0A 2W9BA 2YX8A 2ZIXB 4I2DA 4F5OA 5J2FA 2KHVA 3BJYA 3MGHA 1RPLA 2BZFA 3F53A 4ELVA 3KBBA 2I9GA 1L7PA 3V6JA 2NO5A 4O3QA 2WB1F 2LBOA 1UT8A 1SV0A 5KFLA 4B9SA 4NY8A 4ECUA 2PMZF 9ICTA 2W43A 1VJ5A 2WF6A 4UAVA 1NKCA 2W55A 2MA1A 2H3IA 4JB3A 2HVHA 2BPCA 3CYMA 5AKZA 1ZQMA 1NNLA 3QU5A 2E3TA 3JPNA 3SYZA 1Z19A 4P4PA 3QUCA 4UB3A 3HT3A 2ZUCA 2KZZA 5KFQA 1Z4NA 5JU5A 3LDAA 4KLMA 4NWIA 7ICSA 2EAOA 4RQ3A 4RPXA 4Q8EA 1CI4A 2D8CA 1RQLA 4B9TA 7ICTA 3RB6A 1ZQQA 3JPQA 4I2GA 3RB0A 4Z6FA 2BR0A 3QU7A 3PW7A 2ASDA 9ICRA 3RH4A 2F1HA 4PHAA 2RHFA 1JXEA 1L8LA 3HKZC 7ICHA 2FLNA 2KJ9A 3FYHA 2JHDA 5AM1A 4C7YA 1U9LA 1GO3F 4JUZA 4X5VA 5HR6A 4DQSA 4KN4A 1XO1A 3IHQB 1ZETA 1F5SA 1T94A 3ZDEA 5F3XB 3C5FA 3TFRA 2ZJ8A 3WK6A 4DQIA 2UVWA 4F4KA 4J9MA 3BQTA 2KK0A 1UT5A 2KOBA 3QEAZ 5J2CA 4DFKA 2H3QA 1ZQFA 1Q3VA 4I2IA 1J97A 1WCLA 2DFLA 2DUYA 2O6KA 2K89A 4J9NA 2CRXA 3GIIA 5KT3A 5KT5A 4NL9C 2EZXA 1KRPA 5ALSA 4UBBA 1NK0A 5L1KA 2WFAA 1T3NA 1FFUA 2V9WA 1BPZA 4CRXA 2BCVA 1S76D 2EAMA 1ZQLA 5KFKA 3PW4A 2DPJA 2AGPA 3QU2A 4XA5A 2MAXA 3F2DA 2OEHA 4KTQA 4LZDA 2DGZA 4PL2A 5L1JA 2P35A 1RM6C 3D2NA 9ICOA 4CE6A 4EX7A 1OW5A 3KHRA 1JMSA 4KLDA 4I2CA 1DOQA 1S5LU 4AP9A 3PZPA 4B9MA 4DSIA 8ICUA 1ZQDA 2JH1A 2BDPA 4ECYA 4GLXA 2QKQA 3U26A 3V7LA 1J2NA 3KHHA 5J0TA 2FPMA 4RT2A 1DRGA 3MR5A 1JALA 9ICXA 5EE3A 4UASA 1DK3A 2NRZA 3M9OB 1WG8A 4M9GA 4CF4A 4UAWA 1L7MA 4NV0A 3M9MB 3QUTA 2RP5A 1X9SA 1L3UA 1NK8A 7ICFA 3TI0A 4J9QA 2ZXIA 4RQ0A 2AU0A 5J2IA 1ZJNA 2FLLA 7ICLA 1RXVA 2GO7A 2XCPA 4RPZA 2W8LA 4C8OA 1J2MA 4BUGA 2JZBB 4F2SA 5B5EU 2BQRA 2ISPA 5HMMA 2NRXA 4O0IA 3RTVA 4PL1A 5K4LA 5ALVA 4C7ZA 1S0MA 3BQ0A 4O3MA 4Q44A 1L3VA 2F8LA 2JEFA 5CHGA 3H0RB 2KKPA 4OJLA 3TACB 2C2EA 1A0PA 4YR0A 3KTQA 1TK5A 3H8SA 4F4XA 4DS5A 3SZ2A 5AI8A 2KIVA 2VA8A 2ZIWB 5J0XA 3E58A 3JPTA 3ICXA 1SKRA 3ISDA 4I28A 2IOFA 3BS5A 3K75D 4F5RA 3PO5A 4O5CA 4RNMA 3SV4A 4DCCA 1O03A 2HHVA 1HUZA 1DK2A 2KIWA 4E0DA 4KLEA 2N1RA 4QWBA 3ETLA 3QUQA 1TVAA 4PZNA 4M2YA 1ZQJA 1U45A 2H3ZA 4FZMA 5AI5A 4O5EA 4OCZA 4UARA 2WB1C 3QX7A 5AK4A 5J0PA 2XVTA 3AM9A 3MDAA 3O0FA 3BS7A 2XCAA 4DWIA 2D6FC 1NK5A 9ICIA 2GH1A 3PR5B 3AQEA 1U4BA 5ALGA 1URJA 4F8RA 1N62A 4RQ1A 2LI6A 4DF8A 2F3NA 5ALNA 2YY6A 2ZXHA 4P0PA 2R8IA 4KLQA 2KJ5A 1T7PA 4LVSA 2LYBA 5AKGA 2BCSA 2EANA 3EPIA 5EE1A 4GC7A 4IL6U 1X6IA 4IRKA 4F91B 2HI0A 2JEGA 1ZRMA 4KMUA 3BZKA 1ED1A 1ZQBA 2IMWP 3V6HA 5CR0A 4XUSA 2BCRA 4FS2A 4JV2A 3KZIU 4TUSA 4Z6DA 4TUPA 2XC9A 1S77D 4O3PA 1A6SA 2ZIXA 2IBKA 3H0MB 4DEZA 2VA3A 3MABA 4BWJA 4FZNA 2RDJA 2AJQA 8ICRA 2HBKA 1ZXIA 4A8EA 4DLGA 1L5UA 2K8CB 4BX9C 2R8HA 1BPEA 5KTQA 7ICMA 1NKBA 1D8LA 1LKYB 1PVQA 1ECWA 1K1QA 4AYBF 3QZ8A 5KFTA 3WK4A 4Y2RA 3BZCA 1SL2A 1N5XA 3M8SA 1D8YA 3KHLA 2BQ3A 2AH5A 2I1QA 5KFDA 1NK7A 1NK6A 5KAFU 1MQ2A 1SZHA 3ISBA 1X2IA 3VC8A 2KKVA 5F9NA 1PK3A 4RQ2A 2W03A 4C8KA 1SIJA 5ALMA 1KW4A 4BDPA 4CCHA 3L3FX 3RFAA 5KT2A 4M9NA 4I2HA 2ZTDA 2ZIUB 5KT7A 4RQNA 2OWOA 3PV8A 4RQ4A 4FE3A 1ZQEA 2BPGA 3SAHA 2A1JB 5CJ7A 2F2AB 4NLZA 2JEJA 2ATLA 2HBLA 3PW5A 4QJFB 4YXJA 5J0UA 2YB4A 4QWDA 5AKHA 1NJWA 3UPQA 5KFGA 3NTUA 1UCVA 3M7DA 4UB5A 3ZD8A 3GIMA 1X9XA 9ICPA 3OTQA 1COKA 5KT4A 2F77X 3AQFA 5AM0A 2YMLA 3FAHA 5J8YC 5J2KA 3BQ7A 3BQ2A 2WF9A 7ICQA 2K60A 3SEIA 1ZQ1C 2YTUA 1RQNA 1MN8A 2KE7A 4DLEA 4B9UA 3QNMA 3LYSA 3KFUF 3EPGA 3ZDCA 2DPIA 5ALQA 2JXJA 4TQRA 1SKSA 1ZD2P 1NK4A 3JPOA 4M0AA 3H0LB 5DB8A 5ALJA 1JUDA 4DSEA 1D9FA 2IHNA 3EYZA 4DSLA 3S6JA 3WKBA 5ALTA 3B0XA 4NM2A 1AQ6A 3OPXA 3PSIA 2XGPA 2ASLA 4M9HA 4YR2A 2XGQA 4NLKA 1KBUA 1NZBA 3IG5A 1IXRA 4OO1J 2DWQA 5KFFA 2VIXA 4RT3A 3CNHA 4J03A 1DGSA 2WAQF 3WKAA 1KSPA 4HAIA 2XICA 2ES6A 3TANA 3D2QA 3PSPA 2M0NA 2Y0SF 1SL0A 1FIQA 2NYVA 2HHUA 1NJZA 3AMZA 3OJSA 1TFRA 1PK1B 5J0SA 3D2SA 3OJUA 2KHQA 1TAMA 2IHMA 5KAIU 1SB3C 2NRVA 1BVSA 1XSPA 4YVZA 2UVVA 5C5JA 4UATA 3DEEA 1JROA 2W3SA 4ED8A 3ED5A 2NO4A 4EBEA 4UAUA 3DV9A 4KLHA 2WF7A 4F92B 5KNIA 3LK9A 3RJKA 2JZBA 5J2AA 3K1RB 5J2JA 3F5EA 4KLIA 4TUQA 2VJ5A 4RQ7A 3M6ZA 4YG2A 5IINA 3QU9A 3C2LA 3RB4A 2Y1IA 1K5OA 1L7OA 2NRTA 4QNLA 5DQIA 2QARB 8ICAA 4DFJA 4K4HA 2E8NA 4GFJA 4EBCA 1QSSA 5KG3A 5ALEA 2Z7JA 4YD2A 1TK8A 4QZEA 1NJYA 4YFKA 3KKAC 5DGBA 4CGZA 2YQEA 9ICQA 1RXWA 1IM4A 7ICGA 2OM6A 2J6UA 2ZIWA 9ICUA 2BPFA 2DQNB 4DO9A 7ICJA 4Y2XA 7ICVA 2J6TA 3L5KA 4JV0A 1IG6A 2Y1JA 3IM1A 2VKQA 1ZQNA 2VANA 1OUQA 1FO4A 3T5HA 5IIKA 5HHHA 4QZBA 1QSYA 4KLTA 9ICLA 1RYSA 5DB6A 2ZIVB 5CA7A 4ECZA 3Q8LA 7ICIA 9ICMA 8ICYA 3WU2U 4FZLA 1ZQOA 4O5KA 3MR3A 5DDYA 3PX0A 5H2FU 4USAA 2GWSA 3GV8B 4J9OA 4F5NA 4F2RA 3UM9A 4BJQA 1KFTA 5KFZA 1JRPA 4JMUA 2F8KA 4QZDA 1QSLA 4GIBA 1S0OA 1ZQCA 2KTQA 1V9PA 4G3IA 4M47A 4PHDA 1TAQA 1UPHA 4AYBC 5AI4A 5ALWA 3ORYA 4WJ3B 9ICJA 2HDOA 3K1ZA 3H4DA 4F5QA 2Q4TA 4U6PA 4J9KA 2LPEA 4DOCA 4Y2UA 4U7CA 2YMMA 5AKEA 2DL0A 4O3NA 2OHFA 1Z00B 4R8UB 4GC6A 2C28A 3TAPA 3OGUA 3NS1A 3PSTA 4G9BA 2K4IA 3UQ2A 4ACOA 4RQ8A 1N5WA 2HVIA 1LV5A 3HILA 5ALPA 2KP7A 2KD1A 4DOAA 3T5JA 2HOIA 1FEZA 4QZ8A 5KFPA 1T4GA 5KL8B 4QZFA 5E79U 5AK5A 2J6SA 3TARA 1HJPA 2Y9TA 3BDPA 3H8WA 4NL9A 3Q8PB 1TKDA 3RRHA 1CRXA 2FLPA 4EYIB 2ZTCA 4UB8U 2LMRA 1NK9A 1UHUA 5L1MA 2MUTB 4PHEA 7ICOA 1BPBA 2LHTA 4UB6U 2MU2A 2K8AA 1CUKA 3M6KA 2K4PA 2IOHA 2EZYA 4DFDA 4KLJA 4R65A 2E8OA 1XSLA 2FPLA 7ICUA 5AI9A 2R8KA 3SAFA 4PGXA 1VLBA 5KFJA 2G06A 5J2EA 2PFNA 2LYAA 4ELTA 1LKYA 2ODGA 3SV3A 2HHXA 1KFDA 2FI1A 2I6XA 2KFNA 4YMMA 1PZNA 8ICIA 4RU9A 4RNOA 4PH5A 3RJGA 9ICAA 2D3DA 3A0BU 5DG9A 5L9XA 1ZQYA 4IS7A 1BPYA 3H7IA 3PSFA 9ICKA 2B0CA 1EXNA 5KFWA 3M8RA 1KLNA 3R9KA 2B21A 5EWEA 2W3RA 3MFIA 1N61A 4P4MA 1QH9A 1BNOA 1ZQHA 1WCNA 5DKWA 4DL7A 1ZQZA 3IG8A 4PHPA 4ED2A 2KFZA 1X9WA 5AIAA 1SWWA 3V7KA 1B22A 5KG7A 4QWEA 2G09A 1S9FA 4GXIA 5KFBA 1V97A 9ICNA 2W7PA 4DOBA 5BPCA 2BQUA 4ZOHC 3IV6A 5AM5A 2Y9UA 1IV8A 2EAPA 2R8JA 2W7OA 2A1JA 4Y2YA 8ICLA 2EH9A 2H5XA 2F44A 5KFNA 5BOMA 3HW8A 5J2HA 4UB1A 1ZQIA 4BXOB 2HMXA 4Q45A 2K8BB 4DL4A 2WAQC 5J0WA 2UVUA 2L5YA 4IQVA 5AM3A 2F1JA 4CF5A 2Y0SC 8ICMA 2FE9A 2KV2A 2C2DA 2PMZC 4ECVA 4DL3A 4GXKA 3WK9A 4F50A 4QIWF 9ICVA 2PFOA 1S10A 3K4GA 3AEVA 4R66A 3AU2A 7ICNA 5KFRA 3KHGA 3THVA 2AHOB 2W54A 5KFHA 2E5SA 3UXPA 1Z1BA 5HP4A 1N56A 3EZ5A 2ALZA 2E8PA 5KFUA 3SAGA 5ALRA 1QQ7A 1JI7A 2WHEA 1XC9A 4P2HA 4YQWA 2HOFA 3HWTA 5DGAA 3A0HU 3E2EA 1SL1A 1BNPA 5J0OA 2OXOA
chains in the Genus database with same CATH topology
4BX9C 4P0QA 3F2CA 2ZG6A 3F5EA 4U7CA 1ZQ1C 5KL1B 2VJ5A 5C0YA 2XIDA 2RHFA 1DRGA 2H3ZA 3HKZC 3M6ZA 2DF4B 2G09A 2JH7A 2KJ9A 3LYSA 3NUQA 4FZMA 1L6NA 3CRXA 1PVQA 3KFUF 1ECWA 4AYBF 2CPRA 2JHDA 3T79A 3SQIA 2A3VA 3PSTA 1GO3F 2ZIVA 2K4IA 4QNLA 2WB1C 2CN1A 5CRXA 5HR6A 2XI9A 2XVTA 4ACOA 2G5HB 2W7PA 3O0FA 4OJ6A 3VCBA 4GFJA 3H0LB 2YX8A 2ZIXB 2D6FC 2Z7JA 4NV0A 2KD1A 2H3FA 2GH1A 2HOIA 2HBJA 5HR7A 2KNJA 2KHVA 2NV3A 2W7OA 4OJPA 5KL8B 2RP5A 3AQEA 1T94A 3CP8A 3N7SC 4NLCA 4CGZA 1URJA 3LVWA 2G07A 2ZXIA 3HKZF 2HMXA 2OH2A 4QIWC 1SZHA 2K8BB 2OM6A 3F53A 4C0ZA 1F44A 2ZIWA 2WAQC 3KZXA 2DQNB 3OPXA 3VC8A 2WB1F 1XO0A 3PSIA 3SMVA 1CRXA 2KJ8A 2KKVA 2LBOA 4BUGA 2ZIUA 2ZXHA 1NZBA 1KBUA 1Q3UA 2MRLA 3IG5A 2BDUA 2RRDA 4P0PA 4CDGA 2KOBA 2Y0SC 2W03A 3ONNA 4P0QB 2PMZF 2KJ5A 4OO1J 2VKQA 2G5IB 2HBMA 2H3QA 2LHTA 2LYBA 4PL1A 1PVPA 4OJ5A 1OUQA 2KV2A 2K8AA 2VIXA 1IIPA 2PMZC 3L3FX 2JMGA 3RFAA 3M6KA 2H3VA 1Q3VA 4O3MA 3N7PD 4QIWF 3IP4B 3NRWA 2K89A 2ZIUB 2ZIVB 3GZFA 2CRXA 1D8BA 2G0AA 2WAQF 1ED1A 2VJ4A 2KICA 4KX3A 3C29A 2JGAA 2F8LA 5T14A 4FZLA 3SAFA 2MA1A 2XICA 1HEKA 2H3IA 3E0FA 4FE3A 4KX5A 4CRXA 3D2QA 2R18A 2G06A 3PSPA 2M0NA 4OJOA 2Y0SF 3CYMA 3H0RB 2KKPA 4OJLA 3SAHA 3N7RC 2LYAA 2F2AB 3RF9A 1P7DA 1A0PA 2KEYA 2HBLA 3AL0B 2LKYA 4QJFB 1Z19A 4BJQA 3F2DA 3F5AA 4ICAA 2YB4A 2ZIWB 1PVRA 2E5SA 1Z1BA 2W04A 2DGZA 4JMUA 4PL2A 5A0LA 3F2BA 3D2SA 2YB1A 1A6SA 2GOLA 2E1FA 2KHQA 1TAMA 3D2NA 3M7DA 2ZIXA 2E1EA 3SAGA 2K4EA 2F76X 3PSFA 4P0PB 3ALRA 1MA7A 3H0MB 3ICXA 2K4HA 4FZNA 4IC9A 2HOQA 3C28A 2HOFA 2F77X 3AQFA 3DEEA 2OYYA 2KVCA 1UPHA 2G08A 4NWIA 3IN5A 4AYBC 3LVVA 4NLBA 1WUDA 2HBKA 4KMOB 1YT3A 1HIWA 3PZPA 4WJ3B 4A8EA 1XNSA 3MGVA 2JH1A 3K1ZA 2KIWA 3GU3A 3IG8A 2Q4TA 4U6PA 2K8CB 2OXOA 2N1RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A6S A;  2GOL A;  1TAM A;  2K4E A;  1ED1 A;  2HMX A;  2H3Z A;  1L6N A;  2K4H A;  4IC9 A;  1HEK A;  1ECW A;  2H3I A;  2K4I A;  1UPH A;  2LYA A;  1HIW A;  2LYB A;  2H3Q A;  2H3F A;  4ICA A;  2NV3 A;  2JMG A;  2H3V A;  4JMU A;  2N1R A; 
#chains in the Genus database with same CATH topology
 5KL1 B;  2XID A;  2A19 A;  1N2X A;  2A1A A;  5J2B A;  1NKE A;  4O3S A;  4RUC A;  4TQS A;  4EEK A;  5EOZ A;  3BQ1 A;  4IRD A;  1H38 A;  9ICE A;  5J0Q A;  2JRZ A;  5ALH A;  3VCB A;  2ESE A;  2FPK A;  4EEY A;  2NRW A;  4M9L A;  3WKD A;  4BWM A;  1KL9 A;  3QEB Z;  3ZI4 A;  1U49 A;  1C7Y A;  4M6W B;  2RDI A;  3PMN A;  1F44 A;  3NAS A;  5AHX A;  3KZX A;  1ARO P;  4DL6 A;  1HUO A;  3HRD D;  2PFQ A;  2CXY A;  1V38 A;  3TAD C;  1NJX A;  5J2D A;  1S97 A;  4KLL A;  4FBT A;  5KG2 A;  3Q8M A;  3Q8Q B;  3T5K A;  1ZQG A;  1ZD4 A;  2BKE A;  4B9V A;  1WWU A;  2IOF K;  3RRG A;  4NXZ A;  9ICH A;  5AKJ A;  2W11 A;  5AK6 A;  3M9N B;  2KIC A;  5GTI U;  3N4M B;  5AKL A;  4RQ5 A;  5ALO A;  5KG4 A;  1JIH A;  5DG7 A;  2A3V A;  5KFA A;  3RH6 A;  2YN4 A;  4F71 A;  4ICA A;  2EDU A;  1SV4 A;  1KKX A;  2QAR A;  5HML A;  3MGI A;  1ZQV A;  1A77 A;  2V4R A;  5CWR A;  2ZJA A;  4IC9 A;  2DBY A;  2PXI A;  4EEL A;  3OHA A;  2R8G A;  2XO7 A;  4C80 A;  5EE9 A;  5TZV A;  3H4B A;  1XNS A;  5J0Y A;  7ICE A;  8ICT A;  3F2C A;  4NLG A;  1KTQ A;  5IIL A;  2YMQ A;  2RQ5 A;  3N28 A;  2PI4 A;  1XU4 A;  1XWL A;  4QZC A;  3CW2 C;  4JWM A;  3SQI A;  4ECT A;  4RQ6 A;  4EYH B;  9ICS A;  2ZIV A;  3PO4 A;  4F4Y A;  2UVR A;  1BPD A;  1ZQR A;  9ICB A;  4DSJ A;  3L4P A;  5HR7 A;  2NV3 A;  4MFF A;  4PGY A;  3RJI A;  4P4O A;  1X42 A;  4K4G A;  4TUR A;  5TIS U;  2KMD A;  8ICO A;  8ICJ A;  4ED3 A;  4ECR A;  3N97 B;  4QWA A;  3ONN A;  3C21 A;  4DQP A;  3UXN A;  1BPX A;  4YMO A;  5HNK A;  3NRW A;  3NVY A;  8ICP A;  2G0A A;  1QTM A;  1FFV A;  3QE9 Y;  4KX3 A;  4KIT B;  4YMN A;  5AIB A;  5DBB A;  3E0F A;  1SV0 C;  2V4Q A;  5ALY A;  5AI0 A;  5KFC A;  3N7R C;  4CF3 A;  4NM1 A;  1Z00 A;  1X9M A;  4R8U A;  2LKY A;  4Z6C A;  5EWF A;  1WYG A;  1PVR A;  2F1I A;  5J8Y A;  3NVV A;  2ISO A;  5DQH A;  4BGD A;  4PGQ A;  2K4E A;  4FS1 A;  3RB3 A;  3WK7 A;  3WKE A;  5KFO A;  4MF8 A;  4PPX A;  2KSO B;  5ALK A;  3UMB A;  1JN3 A;  1UQV A;  4YD1 A;  4YN4 A;  1WWV A;  1HIW A;  4Y2P A;  4QW9 A;  2PFP A;  5AKI A;  5CEH A;  2LYH A;  2MUT A;  4NJ8 A;  4O9M A;  2JR5 A;  1QQ5 A;  2FMS A;  2P6R A;  3OSP A;  4UB2 A;  4YP3 A;  2M9N A;  5CRX A;  3UMC A;  2XI9 A;  4XRH A;  2WF5 A;  1N48 A;  4UBC A;  3MDC A;  2QB1 A;  5AKX A;  1DXS A;  1D9D A;  4JK1 A;  4OJP A;  4F5P A;  1NOM A;  4RZR A;  1KFS A;  2FJ6 A;  3LVW A;  2G07 A;  1YZ6 A;  5AKK A;  4QIW C;  2P66 A;  1KN5 A;  2LM4 A;  4QZG A;  8ICF A;  3MR6 A;  4FFD A;  2C22 A;  1ZJM A;  4LZG A;  2JEI A;  4KLO A;  4F4W A;  2BDU A;  1ZQA A;  4DL5 A;  3JPS A;  2FMP A;  2QLT A;  3C5G A;  3NVZ A;  1KQQ A;  2HSZ A;  1Y88 A;  4KN7 A;  1BGX T;  1NI3 A;  3SR6 A;  5AM2 A;  3QUB A;  2JMG A;  4O3R A;  5KG5 A;  1ZQP A;  4Y2J A;  4I27 A;  4QW8 A;  3N7P D;  3GZF A;  3PR4 A;  3WK8 A;  3HPO A;  3C29 A;  3FC4 A;  5T14 A;  8ICS A;  3RBE A;  3TQ1 A;  4ECS A;  3UQ0 A;  1RYR A;  1LVH A;  1SGG A;  4QZ9 A;  4KLS A;  3ETR A;  4RPY A;  3RJE A;  5DG8 A;  2BCU A;  5DDM A;  4IR1 A;  2PI5 A;  4DL2 A;  2AGO A;  2W04 A;  4DQQ A;  1SZP A;  1TE2 A;  1Q8K A;  4I2F A;  3RJF A;  5D49 A;  1KEJ A;  5AIC A;  4ZH4 A;  2PKE A;  3B9J A;  1Z4O A;  2OYY A;  1VDV A;  4BXO A;  4MF2 A;  3GV5 B;  3T5L A;  4KMO B;  1YT3 A;  3D6J A;  3GIJ A;  1MC8 A;  1RDF A;  2ZUB A;  3GFK B;  4CNQ A;  3GU3 A;  8ICC A;  1ZQK A;  3RR8 A;  4Q8F A;  2BCQ A;  3EWA A;  3KKA A;  3V7J A;  1MQ3 A;  1ZD3 A;  3CRX A;  4I29 A;  4NLN A;  3QYP A;  3G6Y A;  4IR9 A;  5AK3 A;  4EX6 A;  2HCF A;  4Y2Q A;  3AUO A;  3GQC A;  3V72 A;  1SWV A;  3ZDA A;  2H3F A;  3V6K A;  8ICV A;  3N7S C;  2XY5 A;  4EEN A;  2ASJ A;  3SMV A;  1PUZ A;  4B9N A;  4I2E A;  7ICR A;  3FDS A;  2W9C B;  3TAQ A;  4P0Q B;  1U48 A;  1N60 A;  4QWC A;  1IIP A;  3PML A;  2H3V A;  1SKW A;  4J9R A;  2JGA A;  2QB0 B;  2W9B B;  2W9A A;  4DS4 A;  2B6G A;  1X40 A;  3G6X A;  8ICE A;  1OXJ A;  4OJO A;  1L8O A;  3RR7 A;  2C2R A;  5KT6 A;  5ALL A;  2KEY A;  3QXG A;  5KG0 A;  4ED6 A;  2KZM A;  2HW3 A;  4YXM A;  1N63 A;  4PJ0 U;  5A0L A;  1TV9 A;  2YB1 A;  4XQ8 A;  5F9L A;  5KFS A;  1RYU A;  2E1F A;  5FP0 A;  8ICW A;  3SI8 A;  4J9P A;  5ALZ A;  4UAY A;  4C8L A;  2VA2 A;  3RJH A;  1S8O A;  3HJE A;  3AU6 A;  3IN5 A;  2KVC A;  2G08 A;  4M6W A;  4DSK A;  3LWL A;  1YZ7 A;  4NLB A;  4JV1 A;  4UQG A;  8ICQ A;  3OSN A;  5JTI A;  1Z3E B;  1B43 A;  5KFY A;  2EZZ A;  2RLT A;  3GV7 B;  3TFS A;  1NZP A;  1TAU A;  5DB7 A;  3SEN A;  5L1I A;  5AM4 A;  3T79 A;  3RAQ A;  1K1S A;  2G5H B;  9ICF A;  1B4F A;  4OJ6 A;  2YMP A;  2E8M A;  8ICB A;  3OHB A;  3LWM A;  3GDX A;  4NLC A;  1Q46 A;  4O3O A;  2KZ3 A;  3NRZ A;  4B9L A;  4C0Z A;  2BHN A;  1C20 A;  5DB9 A;  1T8E A;  2JV3 A;  9ICG A;  2KVS A;  1XO0 A;  4KLG A;  3H8J A;  1ZQS A;  7ICK A;  2MSN A;  4FBU A;  5J29 A;  2ZIU A;  3NGD A;  4DFP A;  1Q3U A;  2RRD A;  4ELU A;  1QCK A;  2DKZ A;  8ICH A;  5IIM A;  2HBM A;  1PVP A;  4OJ5 A;  3HP6 A;  4QZA A;  4YR3 A;  2AGQ A;  5AI6 A;  1UA0 A;  3IRU A;  5L1L A;  3FM9 A;  1DGJ A;  4R64 A;  1HEK A;  2I5H A;  8ICG A;  3I76 A;  4RQM A;  4R63 A;  4EZ9 A;  3AL0 B;  5IIJ A;  1M6Y A;  1A76 A;  1ZOL A;  4F4Z A;  1UA1 A;  4IQW A;  4I2J A;  2IA6 A;  4US8 A;  5KFE A;  3B0Y A;  2GOL A;  1KDH A;  3C23 A;  3ZDD A;  3MFH A;  2F76 X;  3ALR A;  1V85 A;  1MA7 A;  4QZH A;  5ALF A;  2K4H A;  3H8M A;  2HOQ A;  3M1Y A;  5JRT A;  1JX4 A;  1ZQW A;  4MEY A;  5G5H A;  2XY7 A;  3PW2 A;  2ZJ5 A;  4ECW A;  4JWN A;  2DKX A;  5KFX A;  3PNC A;  2CPR A;  1X66 A;  1P7D A;  4UW9 A;  1ZD5 A;  1O08 A;  2ZG6 A;  3JPR A;  1ZYQ A;  9ICC A;  4Y2T A;  4MEX A;  2JH7 A;  1L6N A;  3AN1 A;  3GIK A;  8ICK A;  1S0N A;  1X6J A;  4KLU A;  2CN1 A;  3KOO A;  5DBC A;  1S0V A;  3RAX A;  4FO6 A;  5ALI A;  4ECX A;  1ZQX A;  1ZQU A;  4B6J A;  5CB1 A;  2WF8 A;  4C8N A;  4ECQ A;  3CP8 A;  3HKZ F;  5III A;  4OD0 A;  4M9J A;  5HHI A;  5ALU A;  1MSW D;  4RNN A;  3RH5 A;  2KJ8 A;  3HX0 A;  5J0R A;  3QZ7 A;  1U47 A;  4HYK A;  3MBY A;  2KSO A;  4DSF A;  8ICZ A;  5B66 U;  3ZD9 A;  2HHW A;  1L3S A;  1D8B A;  3IP4 B;  3TKA A;  1JXL A;  4I2A A;  2AQ0 A;  1SXE A;  3QU4 A;  5IIO A;  1PK1 A;  5KFI A;  4J9L A;  4F3O A;  4K4I A;  2R18 A;  3WKC A;  8ICX A;  3RF9 A;  2KG5 A;  4Z6E A;  4IRC A;  1F0M A;  1ZRN A;  2P6U A;  3F5A A;  4UB4 A;  5DBA A;  5BOL A;  3KD3 A;  2KN7 A;  4IQT A;  4DF4 A;  4EZ6 A;  2E1E A;  2FDR A;  3I1Y A;  3C2M A;  1TK0 A;  8ICN A;  2ZTE A;  3C28 A;  4PZO A;  3SD7 A;  1CEZ A;  5ALD A;  3ZDB A;  3EUB 2;  3MGV A;  3RJJ A;  3NVW A;  1QLN A;  3I28 A;  1Z1V A;  4YCX A;  3MC1 A;  1XS9 D;  4LJX A;  2DF4 B;  3C2K A;  3Q8K A;  3J81 j;  4C4R A;  4I2B A;  4US9 A;  2FMQ A;  3TAD A;  5KFV A;  4Y2S A;  4QZI A;  1L3T A;  4ED1 A;  2HBJ A;  2KNJ A;  4RUA A;  3RBD A;  4C4T A;  1XSN A;  3UMG A;  2BGW A;  4DFM A;  2OH2 A;  3BS5 B;  2XY6 A;  5KG6 A;  9ICW A;  4IQU A;  2HHQ A;  3MR2 A;  2OCE A;  2W9M A;  5KG1 A;  2MRL A;  4CDG A;  4GXJ A;  1T3Q A;  4UAZ A;  2G5I B;  7ICP A;  5JUM A;  4F72 A;  3DDH A;  3WK5 A;  5DQG A;  3T3F A;  3JPP A;  4J9S A;  2WTF A;  2VJ4 A;  5GTH U;  5DLG A;  4ED0 A;  5CP2 A;  4MFA A;  3Q8S B;  3C1Y A;  4MHV A;  1RZT A;  4KX5 A;  5EE0 A;  1B0X A;  4MFC A;  4Y2V A;  5D46 A;  3Q8R B;  2HHT A;  4F93 B;  5G5G A;  3GIL A;  3F2B A;  3PY8 A;  2W8K A;  3PX6 A;  3UXO A;  3ISC A;  3IDW A;  4P0P B;  4C4S A;  1SXD A;  1ZQT A;  5EWG A;  5D4B A;  1COO A;  2LM1 A;  2HHS A;  1RG6 A;  3LVV A;  1L7N A;  1WUD A;  5AKY A;  2EQY A;  4KLF A;  2GLE A;  4C8M A;  1LB2 B;  3EW9 A;  4M04 A;  3G6V A;  5J2G A;  2W9C A;  3H40 A;  3PW0 A;  4P0Q A;  3PX4 A;  2AQ4 A;  4DQR A;  5C0Y A;  5ALX A;  4ED7 A;  3NUQ A;  3C1Z A;  2AXT U;  5KFM A;  2ZUD A;  3PVX A;  4Q43 A;  4EBD A;  5DLF A;  2Q0Z X;  1QQ6 A;  2QB0 A;  2W9B A;  2YX8 A;  2ZIX B;  4I2D A;  4F5O A;  5J2F A;  2KHV A;  3BJY A;  3MGH A;  1RPL A;  2BZF A;  3F53 A;  4ELV A;  3KBB A;  2I9G A;  1L7P A;  3V6J A;  2NO5 A;  4O3Q A;  2WB1 F;  2LBO A;  1UT8 A;  1SV0 A;  5KFL A;  4B9S A;  4NY8 A;  4ECU A;  2PMZ F;  9ICT A;  2W43 A;  1VJ5 A;  2WF6 A;  4UAV A;  1NKC A;  2W55 A;  2MA1 A;  2H3I A;  4JB3 A;  2HVH A;  2BPC A;  3CYM A;  5AKZ A;  1ZQM A;  1NNL A;  3QU5 A;  2E3T A;  3JPN A;  3SYZ A;  1Z19 A;  4P4P A;  3QUC A;  4UB3 A;  3HT3 A;  2ZUC A;  2KZZ A;  5KFQ A;  1Z4N A;  5JU5 A;  3LDA A;  4KLM A;  4NWI A;  7ICS A;  2EAO A;  4RQ3 A;  4RPX A;  4Q8E A;  1CI4 A;  2D8C A;  1RQL A;  4B9T A;  7ICT A;  3RB6 A;  1ZQQ A;  3JPQ A;  4I2G A;  3RB0 A;  4Z6F A;  2BR0 A;  3QU7 A;  3PW7 A;  2ASD A;  9ICR A;  3RH4 A;  2F1H A;  4PHA A;  2RHF A;  1JXE A;  1L8L A;  3HKZ C;  7ICH A;  2FLN A;  2KJ9 A;  3FYH A;  2JHD A;  5AM1 A;  4C7Y A;  1U9L A;  1GO3 F;  4JUZ A;  4X5V A;  5HR6 A;  4DQS A;  4KN4 A;  1XO1 A;  3IHQ B;  1ZET A;  1F5S A;  1T94 A;  3ZDE A;  5F3X B;  3C5F A;  3TFR A;  2ZJ8 A;  3WK6 A;  4DQI A;  2UVW A;  4F4K A;  4J9M A;  3BQT A;  2KK0 A;  1UT5 A;  2KOB A;  3QEA Z;  5J2C A;  4DFK A;  2H3Q A;  1ZQF A;  1Q3V A;  4I2I A;  1J97 A;  1WCL A;  2DFL A;  2DUY A;  2O6K A;  2K89 A;  4J9N A;  2CRX A;  3GII A;  5KT3 A;  5KT5 A;  4NL9 C;  2EZX A;  1KRP A;  5ALS A;  4UBB A;  1NK0 A;  5L1K A;  2WFA A;  1T3N A;  1FFU A;  2V9W A;  1BPZ A;  4CRX A;  2BCV A;  1S76 D;  2EAM A;  1ZQL A;  5KFK A;  3PW4 A;  2DPJ A;  2AGP A;  3QU2 A;  4XA5 A;  2MAX A;  3F2D A;  2OEH A;  4KTQ A;  4LZD A;  2DGZ A;  4PL2 A;  5L1J A;  2P35 A;  1RM6 C;  3D2N A;  9ICO A;  4CE6 A;  4EX7 A;  1OW5 A;  3KHR A;  1JMS A;  4KLD A;  4I2C A;  1DOQ A;  1S5L U;  4AP9 A;  3PZP A;  4B9M A;  4DSI A;  8ICU A;  1ZQD A;  2JH1 A;  2BDP A;  4ECY A;  4GLX A;  2QKQ A;  3U26 A;  3V7L A;  1J2N A;  3KHH A;  5J0T A;  2FPM A;  4RT2 A;  1DRG A;  3MR5 A;  1JAL A;  9ICX A;  5EE3 A;  4UAS A;  1DK3 A;  2NRZ A;  3M9O B;  1WG8 A;  4M9G A;  4CF4 A;  4UAW A;  1L7M A;  4NV0 A;  3M9M B;  3QUT A;  2RP5 A;  1X9S A;  1L3U A;  1NK8 A;  7ICF A;  3TI0 A;  4J9Q A;  2ZXI A;  4RQ0 A;  2AU0 A;  5J2I A;  1ZJN A;  2FLL A;  7ICL A;  1RXV A;  2GO7 A;  2XCP A;  4RPZ A;  2W8L A;  4C8O A;  1J2M A;  4BUG A;  2JZB B;  4F2S A;  5B5E U;  2BQR A;  2ISP A;  5HMM A;  2NRX A;  4O0I A;  3RTV A;  4PL1 A;  5K4L A;  5ALV A;  4C7Z A;  1S0M A;  3BQ0 A;  4O3M A;  4Q44 A;  1L3V A;  2F8L A;  2JEF A;  5CHG A;  3H0R B;  2KKP A;  4OJL A;  3TAC B;  2C2E A;  1A0P A;  4YR0 A;  3KTQ A;  1TK5 A;  3H8S A;  4F4X A;  4DS5 A;  3SZ2 A;  5AI8 A;  2KIV A;  2VA8 A;  2ZIW B;  5J0X A;  3E58 A;  3JPT A;  3ICX A;  1SKR A;  3ISD A;  4I28 A;  2IOF A;  3BS5 A;  3K75 D;  4F5R A;  3PO5 A;  4O5C A;  4RNM A;  3SV4 A;  4DCC A;  1O03 A;  2HHV A;  1HUZ A;  1DK2 A;  2KIW A;  4E0D A;  4KLE A;  2N1R A;  4QWB A;  3ETL A;  3QUQ A;  1TVA A;  4PZN A;  4M2Y A;  1ZQJ A;  1U45 A;  2H3Z A;  4FZM A;  5AI5 A;  4O5E A;  4OCZ A;  4UAR A;  2WB1 C;  3QX7 A;  5AK4 A;  5J0P A;  2XVT A;  3AM9 A;  3MDA A;  3O0F A;  3BS7 A;  2XCA A;  4DWI A;  2D6F C;  1NK5 A;  9ICI A;  2GH1 A;  3PR5 B;  3AQE A;  1U4B A;  5ALG A;  1URJ A;  4F8R A;  1N62 A;  4RQ1 A;  2LI6 A;  4DF8 A;  2F3N A;  5ALN A;  2YY6 A;  2ZXH A;  4P0P A;  2R8I A;  4KLQ A;  2KJ5 A;  1T7P A;  4LVS A;  2LYB A;  5AKG A;  2BCS A;  2EAN A;  3EPI A;  5EE1 A;  4GC7 A;  4IL6 U;  1X6I A;  4IRK A;  4F91 B;  2HI0 A;  2JEG A;  1ZRM A;  4KMU A;  3BZK A;  1ED1 A;  1ZQB A;  2IMW P;  3V6H A;  5CR0 A;  4XUS A;  2BCR A;  4FS2 A;  4JV2 A;  3KZI U;  4TUS A;  4Z6D A;  4TUP A;  2XC9 A;  1S77 D;  4O3P A;  1A6S A;  2ZIX A;  2IBK A;  3H0M B;  4DEZ A;  2VA3 A;  3MAB A;  4BWJ A;  4FZN A;  2RDJ A;  2AJQ A;  8ICR A;  2HBK A;  1ZXI A;  4A8E A;  4DLG A;  1L5U A;  2K8C B;  4BX9 C;  2R8H A;  1BPE A;  5KTQ A;  7ICM A;  1NKB A;  1D8L A;  1LKY B;  1PVQ A;  1ECW A;  1K1Q A;  4AYB F;  3QZ8 A;  5KFT A;  3WK4 A;  4Y2R A;  3BZC A;  1SL2 A;  1N5X A;  3M8S A;  1D8Y A;  3KHL A;  2BQ3 A;  2AH5 A;  2I1Q A;  5KFD A;  1NK7 A;  1NK6 A;  5KAF U;  1MQ2 A;  1SZH A;  3ISB A;  1X2I A;  3VC8 A;  2KKV A;  5F9N A;  1PK3 A;  4RQ2 A;  2W03 A;  4C8K A;  1SIJ A;  5ALM A;  1KW4 A;  4BDP A;  4CCH A;  3L3F X;  3RFA A;  5KT2 A;  4M9N A;  4I2H A;  2ZTD A;  2ZIU B;  5KT7 A;  4RQN A;  2OWO A;  3PV8 A;  4RQ4 A;  4FE3 A;  1ZQE A;  2BPG A;  3SAH A;  2A1J B;  5CJ7 A;  2F2A B;  4NLZ A;  2JEJ A;  2ATL A;  2HBL A;  3PW5 A;  4QJF B;  4YXJ A;  5J0U A;  2YB4 A;  4QWD A;  5AKH A;  1NJW A;  3UPQ A;  5KFG A;  3NTU A;  1UCV A;  3M7D A;  4UB5 A;  3ZD8 A;  3GIM A;  1X9X A;  9ICP A;  3OTQ A;  1COK A;  5KT4 A;  2F77 X;  3AQF A;  5AM0 A;  2YML A;  3FAH A;  5J8Y C;  5J2K A;  3BQ7 A;  3BQ2 A;  2WF9 A;  7ICQ A;  2K60 A;  3SEI A;  1ZQ1 C;  2YTU A;  1RQN A;  1MN8 A;  2KE7 A;  4DLE A;  4B9U A;  3QNM A;  3LYS A;  3KFU F;  3EPG A;  3ZDC A;  2DPI A;  5ALQ A;  2JXJ A;  4TQR A;  1SKS A;  1ZD2 P;  1NK4 A;  3JPO A;  4M0A A;  3H0L B;  5DB8 A;  5ALJ A;  1JUD A;  4DSE A;  1D9F A;  2IHN A;  3EYZ A;  4DSL A;  3S6J A;  3WKB A;  5ALT A;  3B0X A;  4NM2 A;  1AQ6 A;  3OPX A;  3PSI A;  2XGP A;  2ASL A;  4M9H A;  4YR2 A;  2XGQ A;  4NLK A;  1KBU A;  1NZB A;  3IG5 A;  1IXR A;  4OO1 J;  2DWQ A;  5KFF A;  2VIX A;  4RT3 A;  3CNH A;  4J03 A;  1DGS A;  2WAQ F;  3WKA A;  1KSP A;  4HAI A;  2XIC A;  2ES6 A;  3TAN A;  3D2Q A;  3PSP A;  2M0N A;  2Y0S F;  1SL0 A;  1FIQ A;  2NYV A;  2HHU A;  1NJZ A;  3AMZ A;  3OJS A;  1TFR A;  1PK1 B;  5J0S A;  3D2S A;  3OJU A;  2KHQ A;  1TAM A;  2IHM A;  5KAI U;  1SB3 C;  2NRV A;  1BVS A;  1XSP A;  4YVZ A;  2UVV A;  5C5J A;  4UAT A;  3DEE A;  1JRO A;  2W3S A;  4ED8 A;  3ED5 A;  2NO4 A;  4EBE A;  4UAU A;  3DV9 A;  4KLH A;  2WF7 A;  4F92 B;  5KNI A;  3LK9 A;  3RJK A;  2JZB A;  5J2A A;  3K1R B;  5J2J A;  3F5E A;  4KLI A;  4TUQ A;  2VJ5 A;  4RQ7 A;  3M6Z A;  4YG2 A;  5IIN A;  3QU9 A;  3C2L A;  3RB4 A;  2Y1I A;  1K5O A;  1L7O A;  2NRT A;  4QNL A;  5DQI A;  2QAR B;  8ICA A;  4DFJ A;  4K4H A;  2E8N A;  4GFJ A;  4EBC A;  1QSS A;  5KG3 A;  5ALE A;  2Z7J A;  4YD2 A;  1TK8 A;  4QZE A;  1NJY A;  4YFK A;  3KKA C;  5DGB A;  4CGZ A;  2YQE A;  9ICQ A;  1RXW A;  1IM4 A;  7ICG A;  2OM6 A;  2J6U A;  2ZIW A;  9ICU A;  2BPF A;  2DQN B;  4DO9 A;  7ICJ A;  4Y2X A;  7ICV A;  2J6T A;  3L5K A;  4JV0 A;  1IG6 A;  2Y1J A;  3IM1 A;  2VKQ A;  1ZQN A;  2VAN A;  1OUQ A;  1FO4 A;  3T5H A;  5IIK A;  5HHH A;  4QZB A;  1QSY A;  4KLT A;  9ICL A;  1RYS A;  5DB6 A;  2ZIV B;  5CA7 A;  4ECZ A;  3Q8L A;  7ICI A;  9ICM A;  8ICY A;  3WU2 U;  4FZL A;  1ZQO A;  4O5K A;  3MR3 A;  5DDY A;  3PX0 A;  5H2F U;  4USA A;  2GWS A;  3GV8 B;  4J9O A;  4F5N A;  4F2R A;  3UM9 A;  4BJQ A;  1KFT A;  5KFZ A;  1JRP A;  4JMU A;  2F8K A;  4QZD A;  1QSL A;  4GIB A;  1S0O A;  1ZQC A;  2KTQ A;  1V9P A;  4G3I A;  4M47 A;  4PHD A;  1TAQ A;  1UPH A;  4AYB C;  5AI4 A;  5ALW A;  3ORY A;  4WJ3 B;  9ICJ A;  2HDO A;  3K1Z A;  3H4D A;  4F5Q A;  2Q4T A;  4U6P A;  4J9K A;  2LPE A;  4DOC A;  4Y2U A;  4U7C A;  2YMM A;  5AKE A;  2DL0 A;  4O3N A;  2OHF A;  1Z00 B;  4R8U B;  4GC6 A;  2C28 A;  3TAP A;  3OGU A;  3NS1 A;  3PST A;  4G9B A;  2K4I A;  3UQ2 A;  4ACO A;  4RQ8 A;  1N5W A;  2HVI A;  1LV5 A;  3HIL A;  5ALP A;  2KP7 A;  2KD1 A;  4DOA A;  3T5J A;  2HOI A;  1FEZ A;  4QZ8 A;  5KFP A;  1T4G A;  5KL8 B;  4QZF A;  5E79 U;  5AK5 A;  2J6S A;  3TAR A;  1HJP A;  2Y9T A;  3BDP A;  3H8W A;  4NL9 A;  3Q8P B;  1TKD A;  3RRH A;  1CRX A;  2FLP A;  4EYI B;  2ZTC A;  4UB8 U;  2LMR A;  1NK9 A;  1UHU A;  5L1M A;  2MUT B;  4PHE A;  7ICO A;  1BPB A;  2LHT A;  4UB6 U;  2MU2 A;  2K8A A;  1CUK A;  3M6K A;  2K4P A;  2IOH A;  2EZY A;  4DFD A;  4KLJ A;  4R65 A;  2E8O A;  1XSL A;  2FPL A;  7ICU A;  5AI9 A;  2R8K A;  3SAF A;  4PGX A;  1VLB A;  5KFJ A;  2G06 A;  5J2E A;  2PFN A;  2LYA A;  4ELT A;  1LKY A;  2ODG A;  3SV3 A;  2HHX A;  1KFD A;  2FI1 A;  2I6X A;  2KFN A;  4YMM A;  1PZN A;  8ICI A;  4RU9 A;  4RNO A;  4PH5 A;  3RJG A;  9ICA A;  2D3D A;  3A0B U;  5DG9 A;  5L9X A;  1ZQY A;  4IS7 A;  1BPY A;  3H7I A;  3PSF A;  9ICK A;  2B0C A;  1EXN A;  5KFW A;  3M8R A;  1KLN A;  3R9K A;  2B21 A;  5EWE A;  2W3R A;  3MFI A;  1N61 A;  4P4M A;  1QH9 A;  1BNO A;  1ZQH A;  1WCN A;  5DKW A;  4DL7 A;  1ZQZ A;  3IG8 A;  4PHP A;  4ED2 A;  2KFZ A;  1X9W A;  5AIA A;  1SWW A;  3V7K A;  1B22 A;  5KG7 A;  4QWE A;  2G09 A;  1S9F A;  4GXI A;  5KFB A;  1V97 A;  9ICN A;  2W7P A;  4DOB A;  5BPC A;  2BQU A;  4ZOH C;  3IV6 A;  5AM5 A;  2Y9U A;  1IV8 A;  2EAP A;  2R8J A;  2W7O A;  2A1J A;  4Y2Y A;  8ICL A;  2EH9 A;  2H5X A;  2F44 A;  5KFN A;  5BOM A;  3HW8 A;  5J2H A;  4UB1 A;  1ZQI A;  4BXO B;  2HMX A;  4Q45 A;  2K8B B;  4DL4 A;  2WAQ C;  5J0W A;  2UVU A;  2L5Y A;  4IQV A;  5AM3 A;  2F1J A;  4CF5 A;  2Y0S C;  8ICM A;  2FE9 A;  2KV2 A;  2C2D A;  2PMZ C;  4ECV A;  4DL3 A;  4GXK A;  3WK9 A;  4F50 A;  4QIW F;  9ICV A;  2PFO A;  1S10 A;  3K4G A;  3AEV A;  4R66 A;  3AU2 A;  7ICN A;  5KFR A;  3KHG A;  3THV A;  2AHO B;  2W54 A;  5KFH A;  2E5S A;  3UXP A;  1Z1B A;  5HP4 A;  1N56 A;  3EZ5 A;  2ALZ A;  2E8P A;  5KFU A;  3SAG A;  5ALR A;  1QQ7 A;  1JI7 A;  2WHE A;  1XC9 A;  4P2H A;  4YQW A;  2HOF A;  3HWT A;  5DGA A;  3A0H U;  3E2E A;  1SL1 A;  1BNP A;  5J0O A;  2OXO A; 
#chains in the Genus database with same CATH homology
 4BX9 C;  4P0Q A;  3F2C A;  2ZG6 A;  3F5E A;  4U7C A;  1ZQ1 C;  5KL1 B;  2VJ5 A;  5C0Y A;  2XID A;  2RHF A;  1DRG A;  2H3Z A;  3HKZ C;  3M6Z A;  2DF4 B;  2G09 A;  2JH7 A;  2KJ9 A;  3LYS A;  3NUQ A;  4FZM A;  1L6N A;  3CRX A;  1PVQ A;  3KFU F;  1ECW A;  4AYB F;  2CPR A;  2JHD A;  3T79 A;  3SQI A;  2A3V A;  3PST A;  1GO3 F;  2ZIV A;  2K4I A;  4QNL A;  2WB1 C;  2CN1 A;  5CRX A;  5HR6 A;  2XI9 A;  2XVT A;  4ACO A;  2G5H B;  2W7P A;  3O0F A;  4OJ6 A;  3VCB A;  4GFJ A;  3H0L B;  2YX8 A;  2ZIX B;  2D6F C;  2Z7J A;  4NV0 A;  2KD1 A;  2H3F A;  2GH1 A;  2HOI A;  2HBJ A;  5HR7 A;  2KNJ A;  2KHV A;  2NV3 A;  2W7O A;  4OJP A;  5KL8 B;  2RP5 A;  3AQE A;  1T94 A;  3CP8 A;  3N7S C;  4NLC A;  4CGZ A;  1URJ A;  3LVW A;  2G07 A;  2ZXI A;  3HKZ F;  2HMX A;  2OH2 A;  4QIW C;  1SZH A;  2K8B B;  2OM6 A;  3F53 A;  4C0Z A;  1F44 A;  2ZIW A;  2WAQ C;  3KZX A;  2DQN B;  3OPX A;  3VC8 A;  2WB1 F;  1XO0 A;  3PSI A;  3SMV A;  1CRX A;  2KJ8 A;  2KKV A;  2LBO A;  4BUG A;  2ZIU A;  2ZXH A;  1NZB A;  1KBU A;  1Q3U A;  2MRL A;  3IG5 A;  2BDU A;  2RRD A;  4P0P A;  4CDG A;  2KOB A;  2Y0S C;  2W03 A;  3ONN A;  4P0Q B;  2PMZ F;  2KJ5 A;  4OO1 J;  2VKQ A;  2G5I B;  2HBM A;  2H3Q A;  2LHT A;  2LYB A;  4PL1 A;  1PVP A;  4OJ5 A;  1OUQ A;  2KV2 A;  2K8A A;  2VIX A;  1IIP A;  2PMZ C;  3L3F X;  2JMG A;  3RFA A;  3M6K A;  2H3V A;  1Q3V A;  4O3M A;  3N7P D;  4QIW F;  3IP4 B;  3NRW A;  2K89 A;  2ZIU B;  2ZIV B;  3GZF A;  2CRX A;  1D8B A;  2G0A A;  2WAQ F;  1ED1 A;  2VJ4 A;  2KIC A;  4KX3 A;  3C29 A;  2JGA A;  2F8L A;  5T14 A;  4FZL A;  3SAF A;  2MA1 A;  2XIC A;  1HEK A;  2H3I A;  3E0F A;  4FE3 A;  4KX5 A;  4CRX A;  3D2Q A;  2R18 A;  2G06 A;  3PSP A;  2M0N A;  4OJO A;  2Y0S F;  3CYM A;  3H0R B;  2KKP A;  4OJL A;  3SAH A;  3N7R C;  2LYA A;  2F2A B;  3RF9 A;  1P7D A;  1A0P A;  2KEY A;  2HBL A;  3AL0 B;  2LKY A;  4QJF B;  1Z19 A;  4BJQ A;  3F2D A;  3F5A A;  4ICA A;  2YB4 A;  2ZIW B;  1PVR A;  2E5S A;  1Z1B A;  2W04 A;  2DGZ A;  4JMU A;  4PL2 A;  5A0L A;  3F2B A;  3D2S A;  2YB1 A;  1A6S A;  2GOL A;  2E1F A;  2KHQ A;  1TAM A;  3D2N A;  3M7D A;  2ZIX A;  2E1E A;  3SAG A;  2K4E A;  2F76 X;  3PSF A;  4P0P B;  3ALR A;  1MA7 A;  3H0M B;  3ICX A;  2K4H A;  4FZN A;  4IC9 A;  2HOQ A;  3C28 A;  2HOF A;  2F77 X;  3AQF A;  3DEE A;  2OYY A;  2KVC A;  1UPH A;  2G08 A;  4NWI A;  3IN5 A;  4AYB C;  3LVV A;  4NLB A;  1WUD A;  2HBK A;  4KMO B;  1YT3 A;  1HIW A;  3PZP A;  4WJ3 B;  4A8E A;  1XNS A;  3MGV A;  2JH1 A;  3K1Z A;  2KIW A;  3GU3 A;  3IG8 A;  2Q4T A;  4U6P A;  2K8C B;  2OXO A;  2N1R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...