1TAMA

Human immunodeficiency virus, nmr, minimized average structure
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
120
structure length
120
Chain Sequence
MGARASVLSGGELDRWEKIRLRPGGKKKYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNTVATLYCVHQRIEIKDTKEALDKIEEEQNKSKKKAQQAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Refined solution structure of p17, the HIV matrix protein.
pubmed rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Matrix protein
molecule keywords HIV-1 MATRIX PROTEIN
total genus 27
structure length 120
sequence length 120
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1996-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00540 Gag_p17 gag gene protein p17 (matrix protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.90 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 1tamA00
2H3IA 2NV3A 2GOLA 1HIWA 2LYAA 2H3VA 4ICAA 4IC9A 2K4IA 2H3QA 1L6NA 1ECWA 2H3FA 2JMGA 2N1RA 1UPHA 2K4HA 2HMXA 4JMUA 2LYBA 1HEKA 2K4EA 1ED1A 1A6SA 1TAMA 2H3ZA
chains in the Genus database with same CATH superfamily
5G5GA 1MN8A 5DDYA 1NJZA 3B9JA 3BZCA 1J2MA 3LWLA 1D8YA 1FO4A 4YR0A 1KKXA 2Q0ZX 3IM1A 2EZZA 3CW2C 2HHXA 2A3VA 3KZIU 4XUSA 1YT3A 2PMZF 1S77D 3TAQA 4FZMA 2IOFA 3R9KA 3RFAA 4DOBA 3WKAA 4RQ3A 5KFAA 1Q46A 3HX0A 1X9XA 3FYHA 4YR2A 7ICPA 4Z6DA 1UHUA 5AI8A 2KKPA 4QZHA 2KVSA 4KMUA 3NVYA 4O3QA 2JEJA 3HKZC 2OWOA 3GV7B 3SMVA 1KEJA 4YCXA 4F4KA 4ICAA 4GXJA 4QZDA 4U7CA 1WWVA 2BZFA 1XSNA 5J0PA 2HVHA 4US9A 3V6HA 3NRZA 3CYMA 5EOZA 2RDJA 8ICRA 1MSWD 3DEEA 1SZPA 3MC1A 2KIWA 1TVAA 3D2SA 2ZIUA 3TARA 4KLHA 1X6JA 5AIBA 3M9NB 2HBMA 2QB1A 5ALZA 4GC6A 4KLOA 5KFIA 7ICEA 3Q8LA 2HDOA 3H4DA 4DSIA 3M8RA 1ZJNA 1LKYB 1BPXA 3H7IA 1V9PA 1CI4A 2WB1C 2ZXIA 5AK3A 2H3VA 9ICCA 1L6NA 2Y9TA 5ALSA 3RR8A 3PMLA 2ZUCA 4NLCA 2K60A 2BQ3A 3NTUA 2IMWP 4UAUA 4G3IA 2F2AB 4FE3A 4B9UA 3RJHA 5KFMA 2BDPA 3GU3A 4UB2A 1SGGA 1Z4OA 4RNMA 2UVUA 5KG5A 1SXEA 5EWFA 1N60A 4PL2A 1OXJA 1S0VA 4MFCA 4NXZA 2IA6A 4RNNA 4QZGA 1Z00B 1HUZA 2K8AA 1RG6A 2KE7A 4P0QB 1ZQKA 1C20A 4BX9C 3IDWA 1SB3C 1BVSA 2OEHA 2Y1IA 1L3SA 2HOIA 3SENA 4QWDA 2ISPA 4KLIA 4AYBC 1SXDA 5J0OA 2P66A 2G07A 3IG8A 4R66A 4WJ3B 4F50A 1NK9A 9ICMA 3RRGA 4HAIA 2G06A 1Q3VA 2BPFA 2C22A 4Y2RA 2XIDA 2XC9A 1JMSA 4F2RA 2W55A 3QZ7A 5KG7A 4R63A 4OO1J 3C29A 2ZG6A 5CJ7A 4NLGA 5HR7A 2LYBA 1RM6C 3LVWA 3S6JA 3RH5A 8ICGA 2F1JA 4ECYA 4R8UA 1PK1A 2ODGA 4P0PB 2QB0B 2IHMA 4Q8FA 3RF9A 8ICUA 3OSPA 2Y9UA 1KFSA 3KKAA 4TQSA 2ZJ5A 2NV3A 4C4TA 1ZD2P 1HIWA 1RYUA 4J9QA 5IIMA 5HP4A 3LVVA 3HWTA 3F5EA 3C2MA 2PFPA 5D4BA 5BPCA 1N5WA 3N4MB 1JXLA 5G5HA 3QUTA 5KG3A 4EYIB 2WF9A 3K75D 2MSNA 4M6WA 4QZBA 1X6IA 2NRTA 4EZ6A 2H3IA 3JPRA 4K4GA 5JU5A 1Z4NA 3MR6A 4EELA 3BQ0A 3WKEA 9ICTA 3HILA 3ZDCA 3MDAA 3MR3A 2JEFA 3AEVA 4FZLA 5DLFA 8ICTA 3QU7A 4I28A 4M0AA 5GTHU 2LYAA 5D49A 5AIAA 5EE0A 4MHVA 4DSJA 4QZ8A 2R8HA 4UB6U 5ALOA 2ZTEA 4C8LA 4RQ4A 3QU9A 4YMMA 4F8RA 4JV1A 3PVXA 1UT8A 4Z6EA 4IR9A 8ICBA 4KLFA 4I2HA 3RJJA 4UATA 2VA8A 2EANA 5JUMA 8ICNA 4RQNA 3PR5B 3QZ8A 2HHTA 3UQ2A 2HSZA 1S10A 5AHXA 3C1YA 4ECVA 3SAFA 5KFPA 3QU4A 1DK3A 2JRZA 1Z00A 4Q43A 2VANA 5K4LA 4O3OA 2G5IB 5EWEA 3FDSA 4M9GA 3JPNA 3PSIA 3FM9A 2DPIA 4DSKA 1NNLA 8ICHA 3PX0A 3PW2A 2KJ8A 2YMMA 4DQPA 4I2DA 1T8EA 3C2LA 4KLTA 4EENA 2KV2A 4UB1A 2XGPA 3H40A 3BDPA 1JXEA 4JV2A 4M9HA 8ICSA 2EAPA 4I2BA 4B9TA 2F1IA 2VJ4A 2ESEA 4CF4A 3EYZA 2KHQA 2ATLA 5KFZA 4ED3A 2C2EA 1ZQCA 3IHQB 1PUZA 9ICXA 4RPZA 4DSLA 7ICSA 1RQNA 4XQ8A 4QZIA 2KMDA 3E0FA 5IIOA 2ASJA 1ZQQA 4PHEA 3H0LB 3RRHA 3IN5A 3ISCA 4M9LA 3MGIA 3I28A 1UA0A 2G08A 4JUZA 3SZ2A 4DFMA 4QZAA 1PVPA 4I2JA 9ICOA 3D2QA 3WKBA 4F2SA 2NO5A 2HI0A 2E8NA 5J2DA 3TKAA 4YG2A 5EE9A 3UXNA 3ALRA 2ZIVB 2YB4A 4DLEA 5J0RA 1NKEA 1A0PA 7ICHA 4DQQA 3H0RB 2PKEA 5KFUA 4O3RA 4TUQA 1SKSA 5C5JA 4DL4A 1K1QA 3AMZA 4TQRA 2HBJA 2V4RA 1QTMA 3EPIA 1QCKA 4PHAA 2HBKA 5KAIU 1RYRA 1DGJA 5ALMA 7ICUA 2ZJ8A 1QQ6A 1SL1A 2Q4TA 4UAZA 9ICFA 4IL6U 4EX6A 5AKZA 4NLBA 5D46A 4R65A 2WTFA 8ICOA 1D8LA 3KHRA 1CRXA 4UAWA 1XO1A 3T5LA 4DF8A 4RUAA 1MQ2A 5KFBA 1L5UA 4KITB 3K1ZA 4F93B 2F1HA 2MRLA 2P6RA 3JPQA 4USAA 3QE9Y 4YP3A 3TANA 2ZUBA 2LMRA 2DWQA 4JK1A 4Y2UA 5EE1A 5EE3A 3OHBA 4F71A 1ZQ1C 3PSTA 3EW9A 3N7RC 3MGHA 5KG2A 1NK4A 4DSEA 1ZQZA 4DO9A 4NL9C 3KTQA 4QJFB 4PHPA 5AKGA 1NK5A 1N63A 1Q8KA 3H8SA 4OD0A 3ZDDA 2OM6A 5L1JA 4UW9A 1JN3A 3B0XA 5FP0A 1VLBA 4BJQA 1WUDA 1Z19A 2W9CA 4FO6A 2XY6A 3O0FA 3AL0B 2K8BB 2JH1A 2YTUA 1L3UA 2XI9A 1LKYA 1UPHA 2HVIA 4GLXA 4KX5A 4NJ8A 2D3DA 7ICTA 1QSYA 2AXTU 5J2GA 2KTQA 3C21A 9ICNA 2CN1A 3TI0A 2JXJA 4J9OA 2M9NA 5KFXA 1PVRA 2WAQC 1RXWA 1ZJMA 2DF4B 1QSLA 2HHVA 3V6JA 1JIHA 3RJEA 4F5NA 3LDAA 5ALXA 4ECZA 2Z7JA 3C28A 2KP7A 1ED1A 1J2NA 8ICQA 2KHVA 5KFWA 3M6KA 4DL7A 2BPGA 3C1ZA 1DOQA 3FC4A 7ICIA 1XNSA 3ETLA 4IC9A 2ZTDA 3RR7A 2DL0A 4OJPA 3KHHA 3T5KA 2HMXA 2I5HA 2BCSA 4F4WA 3EUB2 5DLGA 1OW5A 3SAHA 1BGXT 5AKHA 8ICMA 4BXOB 1U48A 5J29A 5B66U 1RQLA 1OUQA 1N5XA 4PZNA 2ZXHA 4EYHB 5KFHA 3UM9A 3VC8A 2WF5A 5AICA 4DQRA 3RAXA 4Y2TA 4OJ5A 9ICKA 2E8OA 5DB6A 1L8LA 1PK3A 1S5LU 1ZQLA 2A19A 5AI0A 4BUGA 4M04A 2E1FA 9ICQA 1NOMA 1Y88A 2W3RA 5H2FU 5AI9A 3PMNA 4CDGA 3GZFA 1N62A 2R8JA 1V85A 2V4QA 4BDPA 4F92B 2F76X 3TAPA 2J6TA 5ALWA 4FFDA 5J0XA 4CF3A 2W9BB 5AI5A 2HOFA 5KT7A 3AUOA 4NM2A 1SWWA 2KIVA 1ZETA 2W7PA 5EWGA 1UQVA 4GIBA 4DFDA 1MC8A 1L7PA 4NV0A 2LM4A 5KT3A 5JTIA 2I6XA 4C80A 4GFJA 2WB1F 1S0OA 5DG9A 4E0DA 1COOA 3IP4B 4J9LA 2RLTA 4ECXA 4DEZA 2GOLA 3T3FA 4FZNA 3Q8QB 4BXOA 1ZQEA 1HJPA 4DL6A 2XICA 4IR1A 2EAOA 2JZBB 5ALPA 5J2AA 2RRDA 1NZPA 4NY8A 4K4HA 3PW5A 2DBYA 4Y2QA 1IV8A 4KLLA 5J0TA 7ICVA 5T14A 2BCUA 4RQ2A 2ASLA 3WK6A 5KNIA 3Q8MA 4J9SA 2FLPA 1FIQA 3AN1A 5KFOA 5KFNA 2XO7A 4DLGA 2R8KA 3ZI4A 7ICLA 5AKEA 3CRXA 3PO5A 2B21A 3RH6A 3SAGA 5ALJA 2YMQA 5DQGA 4R64A 3F53A 1YZ7A 1TK0A 3K1RB 5L1IA 5AKYA 2NO4A 1DXSA 2KG5A 3V6KA 3D2NA 3HPOA 4Y2YA 4ECQA 4NLNA 9ICSA 4QIWF 3J81j 3H8MA 4Y2XA 4QNLA 1SZHA 1IM4A 2NRZA 2W11A 1S9FA 2K4EA 4J9RA 4C4SA 1ZQNA 4C8KA 3GDXA 1XS9D 2W8LA 4ED0A 3ZDBA 5AM3A 1ZQDA 1ZXIA 1VDVA 2M0NA 4UAYA 4KN4A 2BKEA 2B0CA 3T79A 4DQSA 3M6ZA 1B4FA 1Q3UA 1S0MA 3N7SC 2W03A 5KTQA 5KT2A 4ED2A 1L3VA 2G5HB 3QUCA 2MA1A 2VA2A 3ICXA 5DGBA 1PVQA 5CB1A 1SL0A 4P4OA 2UVRA 2BDUA 5CHGA 5HHIA 3RJFA 2KZMA 2PI4A 3QUQA 2D6FC 3WK5A 4B9SA 1ZQXA 2VIXA 5DQHA 3ETRA 1JX4A 3TACB 3OGUA 1COKA 3N28A 2H3FA 2K4HA 4I2AA 4J9MA 1M6YA 2R18A 3BJYA 2BPCA 4F72A 4ED7A 2AJQA 3D6JA 2PFOA 4LZDA 3RJKA 3V7JA 2KFNA 1ZQOA 5ALKA 1IXRA 2C2DA 2P6UA 2BHNA 1ZQYA 4RUCA 2R8IA 1QLNA 4PL1A 4HYKA 2IOFK 4QZCA 3H8JA 2GH1A 3IRUA 3QU5A 5ALNA 3NASA 3TADA 1XC9A 4RPYA 5KFKA 3PO4A 2ZJAA 4M2YA 3PSFA 4U6PA 4G9BA 4ELVA 1XWLA 5J0YA 4F5PA 1D9DA 5F9NA 4C8OA 3M9MB 4UQGA 1V38A 5IIJA 2W9AA 2FPMA 4TUSA 4IRDA 2RQ5A 1MQ3A 2QB0A 3OSNA 2N1RA 3DV9A 3G6YA 1WG8A 4I2EA 9ICPA 4XRHA 3WKDA 5ALRA 3SEIA 2KJ5A 2XVTA 2E8PA 2KSOA 5TISU 2JMGA 2IBKA 4ACOA 3IV6A 5J0WA 1KQQA 1H38A 8ICAA 2A1JB 5KFFA 9ICGA 2F8KA 1DRGA 1ZQHA 2KKVA 2W3SA 2GWSA 4KLSA 3C23A 3RH4A 4M47A 4KLEA 4DSFA 5J2CA 4KLJA 7ICJA 5B5EU 1TV9A 1NKCA 3OTQA 8ICVA 5F3XB 4KLGA 5KFVA 2V9WA 7ICGA 2W8KA 5A0LA 4F4XA 3MR2A 1X66A 1SKWA 4UARA 3RBEA 1QQ5A 2NRVA 3AM9A 2BCVA 2O6KA 2GLEA 3RBDA 4C8NA 2MAXA 3QUBA 3TADC 8ICJA 3OPXA 2HBLA 1B22A 4KLMA 2AGQA 1A76A 2DQNB 4ECRA 1O03A 3ZD8A 2QKQA 4LJXA 4CE6A 2JR5A 1NJYA 2J6UA 1BPDA 2Y1JA 4IQTA 4C7YA 1LVHA 1N61A 3PZPA 4QWAA 1ZRNA 4PH5A 5AKLA 5ALIA 2BQUA 2VA3A 1TAMA 5J8YA 1RPLA 4C7ZA 5JRTA 4X5VA 4MFFA 2KZZA 3A0HU 2ASDA 1QH9A 1ZQUA 3ONNA 2PI5A 4Z6CA 4YR3A 4J03A 3QYPA 2WF6A 4CNQA 3AQFA 4UB8U 1WWUA 2C28A 1UA1A 1B43A 4Y2SA 2KSOB 2KFZA 2ZIUB 5AKKA 5AI4A 3RTVA 5AM4A 4RT2A 3LK9A 4EEYA 1MA7A 3BS7A 3LWMA 3H8WA 3HKZF 2EZXA 3G6VA 4O3MA 2FPLA 2DPJA 1EXNA 4QZ9A 4DOCA 4FBUA 3KD3A 4Z6FA 3Q8RB 1URJA 2H3ZA 4I2FA 4DWIA 4YD1A 1CUKA 3U26A 4M9NA 1PK1B 4RQ0A 5AKIA 3TFSA 1T94A 5ALEA 3MDCA 4BWMA 4RQ7A 8ICFA 4QZEA 2C2RA 2Y0SC 2BGWA 2W9MA 2KEYA 2K4IA 3M9OB 1KBUA 4MEYA 4O9MA 2KN7A 4BGDA 4JMUA 1N48A 2WF8A 2KJ9A 2QARA 3WK4A 3V7KA 1ZQTA 5DDMA 3MFHA 2XY7A 3SV3A 1SV0C 3EZ5A 5IIKA 2YMPA 3F2BA 3RB3A 3QXGA 3LYSA 4QZFA 3RB6A 4NLKA 1LV5A 5J2IA 4TURA 5CRXA 2KZ3A 3RJIA 4RQ1A 7ICRA 5J2FA 4DL5A 1NK6A 1K5OA 9ICLA 5ALGA 4FS1A 3PR4A 4UASA 3JPSA 2H3QA 1Z1VA 1TK5A 4J9PA 5GTIU 4KN7A 4ZH4A 4ED6A 4US8A 3KBBA 5KG4A 5DB8A 1NJWA 1U4BA 3JPOA 5J0UA 5KT5A 4Q8EA 5L9XA 2XCAA 3UXOA 7ICOA 1TE2A 1KDHA 3UPQA 3FAHA 2HHQA 2DKZA 9ICRA 5DB9A 3CNHA 1F44A 9ICIA 2K8CB 3WU2U 1X9MA 5AKXA 3OJUA 5KFJA 4EZ9A 7ICQA 1NK8A 1T3NA 3AQEA 5DGAA 1N2XA 1N56A 4C4RA 2AQ0A 2QLTA 3ZD9A 5KFTA 4M6WB 3BQ2A 1JALA 5DB7A 2XY5A 5BOMA 2EZYA 2YY6A 1KW4A 2KOBA 2WHEA 3MGVA 3SD7A 4QW9A 4DCCA 1ZQAA 4PGXA 4Y2JA 4O3NA 1L7NA 4I2IA 3UMCA 3QEBZ 1XSPA 2RDIA 4A8EA 2VKQA 4QWCA 1UCVA 2KNJA 5CEHA 5HNKA 3SV4A 2F44A 4JWNA 4R8UB 3PW7A 4UB5A 2YX8A 5CA7A 4DFKA 9ICHA 1ZQBA 1JROA 3BS5B 2EQYA 2A1AA 2H5XA 1C7YA 1T3QA 1S8OA 3GILA 2E1EA 2B6GA 4YXMA 3QU2A 2OXOA 2BCQA 3BQTA 2W04A 1ZQGA 8ICKA 3KZXA 1IIPA 2JGAA 2DKXA 1SWVA 3F2CA 3GIMA 1NK0A 3KKAC 2OH2A 1TFRA 4JWMA 5J2BA 4PPXA 3OHAA 3RJGA 9ICUA 1JRPA 1SIJA 4P4MA 3QEAZ 5KL8B 2IHNA 2OYYA 8ICZA 5DG8A 5C0YA 1NKBA 2AHOB 2FPKA 2JHDA 4C0ZA 1ZRMA 3MFIA 2PFNA 3CP8A 4DS4A 4YD2A 5L1KA 2K89A 1KFTA 5DG7A 4DQIA 2WF7A 1U49A 1ZQJA 4F5RA 3UXPA 4EBEA 5KFQA 5HMLA 5ALQA 4I2CA 3TQ1A 5AM5A 4OJ6A 3MR5A 2YB1A 2E5SA 3AU6A 1PZNA 3GIIA 4J9KA 5IILA 3UQ0A 4DOAA 4CF5A 5KFCA 2GO7A 4F91B 1X9SA 2AGPA 2L5YA 1K1SA 4O3SA 4UBBA 3ISDA 4YMNA 4P2HA 1JUDA 3NUQA 1RYSA 1S76D 3GQCA 4NWIA 2FMQA 3GIJA 2DFLA 1S97A 4ECWA 2ZIXA 4J9NA 1KL9A 2AH5A 3UMBA 4IQVA 4DL2A 1FFUA 2WAQF 1L7OA 5HMMA 1KTQA 4DS5A 1TKDA 1B0XA 4MF8A 3RB0A 3E58A 2YMLA 3BS5A 1SL2A 4KMOB 2E8MA 5J2KA 5HHHA 2HCFA 1BNPA 5TZVA 2KICA 2ZIVA 3PW4A 3UMGA 1GO3F 1XSLA 4PHDA 3BQ1A 8ICEA 5IIIA 1KSPA 4JB3A 5CP2A 4PJ0U 1NZBA 4PGYA 2ALZA 8ICWA 4P0PA 5KT6A 2PFQA 1ZD5A 2MUTB 4YXJA 1Z1BA 2LYHA 5BOLA 4FBTA 3G6XA 1BPZA 2KD1A 3L5KA 4ELUA 5J8YC 4F5QA 4O0IA 1O08A 3C5FA 3N7PD 2F77X 1KFDA 2K4PA 4P4PA 4B9LA 4B6JA 1XO0A 3OJSA 2P35A 2LHTA 5KAFU 1IG6A 2JZBA 4F4YA 4QIWC 1HUOA 4RQ5A 1WYGA 1SKRA 2KVCA 1RZTA 4JV0A 2J6SA 3V7LA 1ZQFA 2I9GA 4PZOA 5KFYA 4DF4A 2HHUA 4YVZA 2W9BA 3WK8A 1F5SA 2G09A 1RXVA 2NYVA 4QW8A 3NVWA 3VCBA 1WCLA 4UB4A 4I29A 4DL3A 3EPGA 4O5KA 1U47A 5E79U 4RQMA 5AK6A 5KFGA 1TK8A 2FDRA 1BPBA 4Y2PA 1JI7A 4RQ6A 1X40A 4DFPA 4YFKA 2YN4A 9ICBA 2IOHA 3T5JA 2KK0A 3H0MB 2CRXA 4MF2A 3HJEA 1X9WA 4KTQA 2W43A 5ALLA 4CGZA 5J2JA 1ZQWA 4CCHA 3GIKA 5L1LA 3HRDD 3ISBA 2MU2A 5AI6A 4QWBA 5F9LA 8ICPA 1ECWA 3HW8A 3L3FX 4OJLA 3M1YA 2ZTCA 2D8CA 3PW0A 4CRXA 3BZKA 5DBCA 1AROP 2BCRA 1ZOLA 3WK7A 4B9MA 5KG6A 4UB3A 8ICYA 3I76A 2FI1A 2AU0A 2HOQA 4I27A 7ICFA 5DQIA 2ZIWB 9ICWA 2NRWA 3PSPA 3HP6A 4FS2A 4TUPA 9ICAA 1FEZA 3SR6A 4RT3A 4AP9A 2HW3A 5KFRA 4KLDA 2CPRA 5KFEA 2FLNA 2MUTA 5CWRA 2LKYA 4EEKA 1T7PA 1X42A 3JPTA 4ECUA 1ZQVA 4Q44A 5KFSA 2AGOA 5ALFA 2ZIWA 1L7MA 1L3TA 2DUYA 3PNCA 7ICNA 5L1MA 3RB4A 3RAQA 5HR6A 5J2HA 2HHWA 1RDFA 3ORYA 4GXKA 3THVA 2FLLA 3NVVA 3TFRA 1U45A 4B9NA 2W9CB 4EBCA 1BNOA 1KN5A 3GFKB 1U9LA 2YQEA 5KFLA 4Q45A 4Y2VA 1QSSA 3BQ7A 3ZDAA 1DK2A 4XA5A 5J0QA 4AYBF 1FFVA 1HEKA 4IRKA 3HT3A 1Z3EB 1ZQMA 4YN4A 4NM1A 4O5CA 2JEIA 3SYZA 3L4PA 1UT5A 2OHFA 4IQWA 3SI8A 3KHLA 3QX7A 3M7DA 3PV8A 1VJ5A 3KOOA 5ALYA 2BQRA 4YMOA 5AK4A 4ELTA 2R8GA 2HHSA 5AM0A 5J0SA 2NRXA 4ZOHC 2JEGA 4LZGA 5AM1A 1YZ6A 3C2KA 1A77A 1SV0A 2LBOA 4ED1A 1T4GA 4IRCA 4MEXA 5DBBA 4O5EA 4RNOA 3NGDA 2XCPA 3GV5B 2JV3A 4C8MA 3DDHA 4OJOA 1ZD3A 1ZQIA 5CR0A 1LB2B 2BR0A 3Q8PB 1NK7A 3I1YA 9ICJA 4GC7A 4KLUA 2PXIA 3NS1A 2JH7A 1D8BA 4KLQA 1CEZA 2W54A 3ZDEA 2FMSA 4RZRA 2OCEA 3F5AA 5IINA 4IQUA 1KRPA 7ICMA 1TAUA 5KL1B 2XGQA 1KLNA 4UBCA 2Y0SF 1D9FA 3NRWA 3Q8KA 3GV8B 2ES6A 9ICEA 1ZQRA 1TAQA 3F2DA 1NJXA 2FJ6A 2RHFA 2QARB 2ZUDA 9ICVA 2ISOA 2A1JA 2G0AA 4F4ZA 5KG0A 5ALVA 4DFJA 2LPEA 1DGSA 2CXYA 4RU9A 2EAMA 3N97B 4B9VA 4KX3A 4F3OA 1S0NA 3ED5A 3B0YA 3WK9A 1X2IA 1ZQSA 5KT4A 1BPYA 3M8SA 8ICIA 2LM1A 1A6SA 8ICLA 3PX6A 3T5HA 2RP5A 3H4BA 2UVWA 3MBYA 5AK5A 4ED8A 2F8LA 5J2EA 1NI3A 1J97A 1ZD4A 1V97A 2EDUA 4IS7A 4OCZA 2AQ4A 4LVSA 2ZIXB 4RPXA 3E2EA 2EH9A 3KFUF 7ICKA 1L8OA 2PMZC 5KFDA 5AKJA 8ICCA 4K4IA 3Q8SB 4RQ8A 1BPEA 5DKWA 5DBAA 4MFAA 5KG1A 2E3TA 1SV4A 1F0MA 1QQ7A 3JPPA 2LI6A 4EX7A 3C5GA 5AM2A 4M9JA 2FMPA 4NL9A 2F3NA 3K4GA 5ALDA 4P0QA 4I2GA 5ALHA 4F5OA 4UAVA 3AU2A 2UVVA 3EWAA 4ECSA 3NVZA 2FE9A 3V72A 1P7DA 2VJ5A 1ZQPA 1XU4A 4NLZA 3IG5A 4PGQA 3KHGA 8ICXA 3WKCA 2W7OA 4ECTA 1ZYQA 4YQWA 5ALUA 3QNMA 3PY8A 2I1QA 4O3PA 4EBDA 4GXIA 4BWJA 3SQIA 4QWEA 2WFAA 5ALTA 3MABA 2DGZA 3PX4A 1AQ6A 3A0BU 1WCNA
chains in the Genus database with same CATH topology
2KJ5A 2WB1C 2G5HB 2XVTA 3PSIA 2ZIUB 2NV3A 2ZXIA 1XNSA 2OXOA 2MA1A 2GOLA 1HIWA 2H3VA 3ICXA 3K1ZA 4FZNA 3LVVA 2W04A 4IC9A 3F5EA 2H3QA 2MRLA 4KX3A 1L6NA 3H0MB 1PVQA 2JMGA 2KJ8A 4OJPA 2CRXA 3KZXA 2HMXA 2XICA 4ACOA 1MA7A 1IIPA 2BDUA 2KV2A 3HKZF 4KMOB 4AYBF 2JGAA 2A3VA 4O3MA 4NLCA 1DRGA 1YT3A 1HEKA 2PMZF 3F2CA 2F2AB 2RRDA 4FZMA 2KKVA 3SAHA 4FE3A 1A6SA 2KICA 2ZIVA 2OH2A 4CGZA 3RFAA 2D6FC 1URJA 1GO3F 2RP5A 2H3ZA 5T14A 1OUQA 2VJ4A 1ZQ1C 3GU3A 2H3IA 2VIXA 2KHQA 3PSTA 2F8LA 3N7RC 5KL8B 2ZXHA 3M7DA 4PL2A 2OYYA 1ECWA 1NZBA 2H3FA 3E0FA 1F44A 2ZIXB 3L3FX 4OJLA 2K4HA 2KKPA 4P0PA 2K8CB 3VC8A 5C0YA 4QJFB 3CRXA 5A0LA 2K8AA 3SAGA 1Z1BA 4CRXA 2R18A 2JHDA 3KFUF 2OM6A 4OJ5A 4C0ZA 3H0LB 4P0QB 3CP8A 3IN5A 2KD1A 4BX9C 2PMZC 2K89A 2LBOA 3F53A 2G08A 3AQEA 2HOQA 2ZIWB 3HKZC 4BJQA 4FZLA 1WUDA 1PVPA 1Z19A 1T94A 3PSPA 3SMVA 3OPXA 3D2QA 2HBLA 2HOIA 4BUGA 2E1FA 3O0FA 3N7PD 2LYAA 2Y0SC 2F77X 3D2NA 4ICAA 3AL0B 2KEYA 2DQNB 2K4IA 2JH1A 2K8BB 4PL1A 1KBUA 2XI9A 4U7CA 4OJOA 3ALRA 4AYBC 2ZIVB 2YB4A 1UPHA 4JMUA 1XO0A 2GH1A 4QIWF 4OJ6A 2LHTA 4P0QA 4QNLA 2KJ9A 4CDGA 2G07A 1A0PA 3GZFA 3IG8A 4KX5A 1SZHA 3PZPA 2CPRA 2KOBA 2YB1A 3H0RB 4QIWC 4WJ3B 2LKYA 2E5SA 2K4EA 3CYMA 3MGVA 2KVCA 2JH7A 2F76X 3DEEA 1D8BA 3PSFA 2HBJA 4U6PA 3F5AA 1P7DA 1TAMA 3F2BA 2VJ5A 2KIWA 2CN1A 2G06A 3IG5A 3LYSA 1Q3VA 3D2SA 2HBKA 2HOFA 2ZIUA 2W7OA 5KL1B 2XIDA 4A8EA 2VKQA 2W7PA 2G09A 2Y0SF 2ZIWA 2M0NA 3NRWA 1PVRA 2WAQC 2DF4B 2HBMA 2KNJA 3NUQA 2N1RA 5CRXA 2Q4TA 3VCBA 3SAFA 3C29A 3F2DA 3ONNA 2ZG6A 4OO1J 5HR7A 4NWIA 2YX8A 2LYBA 2RHFA 3T79A 3SQIA 4NV0A 4NLBA 3LVWA 2Z7JA 3M6ZA 3C28A 1Q3UA 3AQFA 2G0AA 1ED1A 2DGZA 2KHVA 4P0PB 3N7SC 5HR6A 2ZIXA 3M6KA 1CRXA 2W03A 4GFJA 2G5IB 2WB1F 3RF9A 3IP4B 2WAQF 2E1EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H3I A;  2NV3 A;  2GOL A;  1HIW A;  2LYA A;  2H3V A;  4ICA A;  4IC9 A;  2K4I A;  2H3Q A;  1L6N A;  1ECW A;  2H3F A;  2JMG A;  2N1R A;  1UPH A;  2K4H A;  2HMX A;  4JMU A;  2LYB A;  1HEK A;  2K4E A;  1ED1 A;  1A6S A;  1TAM A;  2H3Z A; 
#chains in the Genus database with same CATH topology
 5G5G A;  1MN8 A;  5DDY A;  1NJZ A;  3B9J A;  3BZC A;  1J2M A;  3LWL A;  1D8Y A;  1FO4 A;  4YR0 A;  1KKX A;  2Q0Z X;  3IM1 A;  2EZZ A;  3CW2 C;  2HHX A;  2A3V A;  3KZI U;  4XUS A;  1YT3 A;  2PMZ F;  1S77 D;  3TAQ A;  4FZM A;  2IOF A;  3R9K A;  3RFA A;  4DOB A;  3WKA A;  4RQ3 A;  5KFA A;  1Q46 A;  3HX0 A;  1X9X A;  3FYH A;  4YR2 A;  7ICP A;  4Z6D A;  1UHU A;  5AI8 A;  2KKP A;  4QZH A;  2KVS A;  4KMU A;  3NVY A;  4O3Q A;  2JEJ A;  3HKZ C;  2OWO A;  3GV7 B;  3SMV A;  1KEJ A;  4YCX A;  4F4K A;  4ICA A;  4GXJ A;  4QZD A;  4U7C A;  1WWV A;  2BZF A;  1XSN A;  5J0P A;  2HVH A;  4US9 A;  3V6H A;  3NRZ A;  3CYM A;  5EOZ A;  2RDJ A;  8ICR A;  1MSW D;  3DEE A;  1SZP A;  3MC1 A;  2KIW A;  1TVA A;  3D2S A;  2ZIU A;  3TAR A;  4KLH A;  1X6J A;  5AIB A;  3M9N B;  2HBM A;  2QB1 A;  5ALZ A;  4GC6 A;  4KLO A;  5KFI A;  7ICE A;  3Q8L A;  2HDO A;  3H4D A;  4DSI A;  3M8R A;  1ZJN A;  1LKY B;  1BPX A;  3H7I A;  1V9P A;  1CI4 A;  2WB1 C;  2ZXI A;  5AK3 A;  2H3V A;  9ICC A;  1L6N A;  2Y9T A;  5ALS A;  3RR8 A;  3PML A;  2ZUC A;  4NLC A;  2K60 A;  2BQ3 A;  3NTU A;  2IMW P;  4UAU A;  4G3I A;  2F2A B;  4FE3 A;  4B9U A;  3RJH A;  5KFM A;  2BDP A;  3GU3 A;  4UB2 A;  1SGG A;  1Z4O A;  4RNM A;  2UVU A;  5KG5 A;  1SXE A;  5EWF A;  1N60 A;  4PL2 A;  1OXJ A;  1S0V A;  4MFC A;  4NXZ A;  2IA6 A;  4RNN A;  4QZG A;  1Z00 B;  1HUZ A;  2K8A A;  1RG6 A;  2KE7 A;  4P0Q B;  1ZQK A;  1C20 A;  4BX9 C;  3IDW A;  1SB3 C;  1BVS A;  2OEH A;  2Y1I A;  1L3S A;  2HOI A;  3SEN A;  4QWD A;  2ISP A;  4KLI A;  4AYB C;  1SXD A;  5J0O A;  2P66 A;  2G07 A;  3IG8 A;  4R66 A;  4WJ3 B;  4F50 A;  1NK9 A;  9ICM A;  3RRG A;  4HAI A;  2G06 A;  1Q3V A;  2BPF A;  2C22 A;  4Y2R A;  2XID A;  2XC9 A;  1JMS A;  4F2R A;  2W55 A;  3QZ7 A;  5KG7 A;  4R63 A;  4OO1 J;  3C29 A;  2ZG6 A;  5CJ7 A;  4NLG A;  5HR7 A;  2LYB A;  1RM6 C;  3LVW A;  3S6J A;  3RH5 A;  8ICG A;  2F1J A;  4ECY A;  4R8U A;  1PK1 A;  2ODG A;  4P0P B;  2QB0 B;  2IHM A;  4Q8F A;  3RF9 A;  8ICU A;  3OSP A;  2Y9U A;  1KFS A;  3KKA A;  4TQS A;  2ZJ5 A;  2NV3 A;  4C4T A;  1ZD2 P;  1HIW A;  1RYU A;  4J9Q A;  5IIM A;  5HP4 A;  3LVV A;  3HWT A;  3F5E A;  3C2M A;  2PFP A;  5D4B A;  5BPC A;  1N5W A;  3N4M B;  1JXL A;  5G5H A;  3QUT A;  5KG3 A;  4EYI B;  2WF9 A;  3K75 D;  2MSN A;  4M6W A;  4QZB A;  1X6I A;  2NRT A;  4EZ6 A;  2H3I A;  3JPR A;  4K4G A;  5JU5 A;  1Z4N A;  3MR6 A;  4EEL A;  3BQ0 A;  3WKE A;  9ICT A;  3HIL A;  3ZDC A;  3MDA A;  3MR3 A;  2JEF A;  3AEV A;  4FZL A;  5DLF A;  8ICT A;  3QU7 A;  4I28 A;  4M0A A;  5GTH U;  2LYA A;  5D49 A;  5AIA A;  5EE0 A;  4MHV A;  4DSJ A;  4QZ8 A;  2R8H A;  4UB6 U;  5ALO A;  2ZTE A;  4C8L A;  4RQ4 A;  3QU9 A;  4YMM A;  4F8R A;  4JV1 A;  3PVX A;  1UT8 A;  4Z6E A;  4IR9 A;  8ICB A;  4KLF A;  4I2H A;  3RJJ A;  4UAT A;  2VA8 A;  2EAN A;  5JUM A;  8ICN A;  4RQN A;  3PR5 B;  3QZ8 A;  2HHT A;  3UQ2 A;  2HSZ A;  1S10 A;  5AHX A;  3C1Y A;  4ECV A;  3SAF A;  5KFP A;  3QU4 A;  1DK3 A;  2JRZ A;  1Z00 A;  4Q43 A;  2VAN A;  5K4L A;  4O3O A;  2G5I B;  5EWE A;  3FDS A;  4M9G A;  3JPN A;  3PSI A;  3FM9 A;  2DPI A;  4DSK A;  1NNL A;  8ICH A;  3PX0 A;  3PW2 A;  2KJ8 A;  2YMM A;  4DQP A;  4I2D A;  1T8E A;  3C2L A;  4KLT A;  4EEN A;  2KV2 A;  4UB1 A;  2XGP A;  3H40 A;  3BDP A;  1JXE A;  4JV2 A;  4M9H A;  8ICS A;  2EAP A;  4I2B A;  4B9T A;  2F1I A;  2VJ4 A;  2ESE A;  4CF4 A;  3EYZ A;  2KHQ A;  2ATL A;  5KFZ A;  4ED3 A;  2C2E A;  1ZQC A;  3IHQ B;  1PUZ A;  9ICX A;  4RPZ A;  4DSL A;  7ICS A;  1RQN A;  4XQ8 A;  4QZI A;  2KMD A;  3E0F A;  5IIO A;  2ASJ A;  1ZQQ A;  4PHE A;  3H0L B;  3RRH A;  3IN5 A;  3ISC A;  4M9L A;  3MGI A;  3I28 A;  1UA0 A;  2G08 A;  4JUZ A;  3SZ2 A;  4DFM A;  4QZA A;  1PVP A;  4I2J A;  9ICO A;  3D2Q A;  3WKB A;  4F2S A;  2NO5 A;  2HI0 A;  2E8N A;  5J2D A;  3TKA A;  4YG2 A;  5EE9 A;  3UXN A;  3ALR A;  2ZIV B;  2YB4 A;  4DLE A;  5J0R A;  1NKE A;  1A0P A;  7ICH A;  4DQQ A;  3H0R B;  2PKE A;  5KFU A;  4O3R A;  4TUQ A;  1SKS A;  5C5J A;  4DL4 A;  1K1Q A;  3AMZ A;  4TQR A;  2HBJ A;  2V4R A;  1QTM A;  3EPI A;  1QCK A;  4PHA A;  2HBK A;  5KAI U;  1RYR A;  1DGJ A;  5ALM A;  7ICU A;  2ZJ8 A;  1QQ6 A;  1SL1 A;  2Q4T A;  4UAZ A;  9ICF A;  4IL6 U;  4EX6 A;  5AKZ A;  4NLB A;  5D46 A;  4R65 A;  2WTF A;  8ICO A;  1D8L A;  3KHR A;  1CRX A;  4UAW A;  1XO1 A;  3T5L A;  4DF8 A;  4RUA A;  1MQ2 A;  5KFB A;  1L5U A;  4KIT B;  3K1Z A;  4F93 B;  2F1H A;  2MRL A;  2P6R A;  3JPQ A;  4USA A;  3QE9 Y;  4YP3 A;  3TAN A;  2ZUB A;  2LMR A;  2DWQ A;  4JK1 A;  4Y2U A;  5EE1 A;  5EE3 A;  3OHB A;  4F71 A;  1ZQ1 C;  3PST A;  3EW9 A;  3N7R C;  3MGH A;  5KG2 A;  1NK4 A;  4DSE A;  1ZQZ A;  4DO9 A;  4NL9 C;  3KTQ A;  4QJF B;  4PHP A;  5AKG A;  1NK5 A;  1N63 A;  1Q8K A;  3H8S A;  4OD0 A;  3ZDD A;  2OM6 A;  5L1J A;  4UW9 A;  1JN3 A;  3B0X A;  5FP0 A;  1VLB A;  4BJQ A;  1WUD A;  1Z19 A;  2W9C A;  4FO6 A;  2XY6 A;  3O0F A;  3AL0 B;  2K8B B;  2JH1 A;  2YTU A;  1L3U A;  2XI9 A;  1LKY A;  1UPH A;  2HVI A;  4GLX A;  4KX5 A;  4NJ8 A;  2D3D A;  7ICT A;  1QSY A;  2AXT U;  5J2G A;  2KTQ A;  3C21 A;  9ICN A;  2CN1 A;  3TI0 A;  2JXJ A;  4J9O A;  2M9N A;  5KFX A;  1PVR A;  2WAQ C;  1RXW A;  1ZJM A;  2DF4 B;  1QSL A;  2HHV A;  3V6J A;  1JIH A;  3RJE A;  4F5N A;  3LDA A;  5ALX A;  4ECZ A;  2Z7J A;  3C28 A;  2KP7 A;  1ED1 A;  1J2N A;  8ICQ A;  2KHV A;  5KFW A;  3M6K A;  4DL7 A;  2BPG A;  3C1Z A;  1DOQ A;  3FC4 A;  7ICI A;  1XNS A;  3ETL A;  4IC9 A;  2ZTD A;  3RR7 A;  2DL0 A;  4OJP A;  3KHH A;  3T5K A;  2HMX A;  2I5H A;  2BCS A;  4F4W A;  3EUB 2;  5DLG A;  1OW5 A;  3SAH A;  1BGX T;  5AKH A;  8ICM A;  4BXO B;  1U48 A;  5J29 A;  5B66 U;  1RQL A;  1OUQ A;  1N5X A;  4PZN A;  2ZXH A;  4EYH B;  5KFH A;  3UM9 A;  3VC8 A;  2WF5 A;  5AIC A;  4DQR A;  3RAX A;  4Y2T A;  4OJ5 A;  9ICK A;  2E8O A;  5DB6 A;  1L8L A;  1PK3 A;  1S5L U;  1ZQL A;  2A19 A;  5AI0 A;  4BUG A;  4M04 A;  2E1F A;  9ICQ A;  1NOM A;  1Y88 A;  2W3R A;  5H2F U;  5AI9 A;  3PMN A;  4CDG A;  3GZF A;  1N62 A;  2R8J A;  1V85 A;  2V4Q A;  4BDP A;  4F92 B;  2F76 X;  3TAP A;  2J6T A;  5ALW A;  4FFD A;  5J0X A;  4CF3 A;  2W9B B;  5AI5 A;  2HOF A;  5KT7 A;  3AUO A;  4NM2 A;  1SWW A;  2KIV A;  1ZET A;  2W7P A;  5EWG A;  1UQV A;  4GIB A;  4DFD A;  1MC8 A;  1L7P A;  4NV0 A;  2LM4 A;  5KT3 A;  5JTI A;  2I6X A;  4C80 A;  4GFJ A;  2WB1 F;  1S0O A;  5DG9 A;  4E0D A;  1COO A;  3IP4 B;  4J9L A;  2RLT A;  4ECX A;  4DEZ A;  2GOL A;  3T3F A;  4FZN A;  3Q8Q B;  4BXO A;  1ZQE A;  1HJP A;  4DL6 A;  2XIC A;  4IR1 A;  2EAO A;  2JZB B;  5ALP A;  5J2A A;  2RRD A;  1NZP A;  4NY8 A;  4K4H A;  3PW5 A;  2DBY A;  4Y2Q A;  1IV8 A;  4KLL A;  5J0T A;  7ICV A;  5T14 A;  2BCU A;  4RQ2 A;  2ASL A;  3WK6 A;  5KNI A;  3Q8M A;  4J9S A;  2FLP A;  1FIQ A;  3AN1 A;  5KFO A;  5KFN A;  2XO7 A;  4DLG A;  2R8K A;  3ZI4 A;  7ICL A;  5AKE A;  3CRX A;  3PO5 A;  2B21 A;  3RH6 A;  3SAG A;  5ALJ A;  2YMQ A;  5DQG A;  4R64 A;  3F53 A;  1YZ7 A;  1TK0 A;  3K1R B;  5L1I A;  5AKY A;  2NO4 A;  1DXS A;  2KG5 A;  3V6K A;  3D2N A;  3HPO A;  4Y2Y A;  4ECQ A;  4NLN A;  9ICS A;  4QIW F;  3J81 j;  3H8M A;  4Y2X A;  4QNL A;  1SZH A;  1IM4 A;  2NRZ A;  2W11 A;  1S9F A;  2K4E A;  4J9R A;  4C4S A;  1ZQN A;  4C8K A;  3GDX A;  1XS9 D;  2W8L A;  4ED0 A;  3ZDB A;  5AM3 A;  1ZQD A;  1ZXI A;  1VDV A;  2M0N A;  4UAY A;  4KN4 A;  2BKE A;  2B0C A;  3T79 A;  4DQS A;  3M6Z A;  1B4F A;  1Q3U A;  1S0M A;  3N7S C;  2W03 A;  5KTQ A;  5KT2 A;  4ED2 A;  1L3V A;  2G5H B;  3QUC A;  2MA1 A;  2VA2 A;  3ICX A;  5DGB A;  1PVQ A;  5CB1 A;  1SL0 A;  4P4O A;  2UVR A;  2BDU A;  5CHG A;  5HHI A;  3RJF A;  2KZM A;  2PI4 A;  3QUQ A;  2D6F C;  3WK5 A;  4B9S A;  1ZQX A;  2VIX A;  5DQH A;  3ETR A;  1JX4 A;  3TAC B;  3OGU A;  1COK A;  3N28 A;  2H3F A;  2K4H A;  4I2A A;  4J9M A;  1M6Y A;  2R18 A;  3BJY A;  2BPC A;  4F72 A;  4ED7 A;  2AJQ A;  3D6J A;  2PFO A;  4LZD A;  3RJK A;  3V7J A;  2KFN A;  1ZQO A;  5ALK A;  1IXR A;  2C2D A;  2P6U A;  2BHN A;  1ZQY A;  4RUC A;  2R8I A;  1QLN A;  4PL1 A;  4HYK A;  2IOF K;  4QZC A;  3H8J A;  2GH1 A;  3IRU A;  3QU5 A;  5ALN A;  3NAS A;  3TAD A;  1XC9 A;  4RPY A;  5KFK A;  3PO4 A;  2ZJA A;  4M2Y A;  3PSF A;  4U6P A;  4G9B A;  4ELV A;  1XWL A;  5J0Y A;  4F5P A;  1D9D A;  5F9N A;  4C8O A;  3M9M B;  4UQG A;  1V38 A;  5IIJ A;  2W9A A;  2FPM A;  4TUS A;  4IRD A;  2RQ5 A;  1MQ3 A;  2QB0 A;  3OSN A;  2N1R A;  3DV9 A;  3G6Y A;  1WG8 A;  4I2E A;  9ICP A;  4XRH A;  3WKD A;  5ALR A;  3SEI A;  2KJ5 A;  2XVT A;  2E8P A;  2KSO A;  5TIS U;  2JMG A;  2IBK A;  4ACO A;  3IV6 A;  5J0W A;  1KQQ A;  1H38 A;  8ICA A;  2A1J B;  5KFF A;  9ICG A;  2F8K A;  1DRG A;  1ZQH A;  2KKV A;  2W3S A;  2GWS A;  4KLS A;  3C23 A;  3RH4 A;  4M47 A;  4KLE A;  4DSF A;  5J2C A;  4KLJ A;  7ICJ A;  5B5E U;  1TV9 A;  1NKC A;  3OTQ A;  8ICV A;  5F3X B;  4KLG A;  5KFV A;  2V9W A;  7ICG A;  2W8K A;  5A0L A;  4F4X A;  3MR2 A;  1X66 A;  1SKW A;  4UAR A;  3RBE A;  1QQ5 A;  2NRV A;  3AM9 A;  2BCV A;  2O6K A;  2GLE A;  3RBD A;  4C8N A;  2MAX A;  3QUB A;  3TAD C;  8ICJ A;  3OPX A;  2HBL A;  1B22 A;  4KLM A;  2AGQ A;  1A76 A;  2DQN B;  4ECR A;  1O03 A;  3ZD8 A;  2QKQ A;  4LJX A;  4CE6 A;  2JR5 A;  1NJY A;  2J6U A;  1BPD A;  2Y1J A;  4IQT A;  4C7Y A;  1LVH A;  1N61 A;  3PZP A;  4QWA A;  1ZRN A;  4PH5 A;  5AKL A;  5ALI A;  2BQU A;  2VA3 A;  1TAM A;  5J8Y A;  1RPL A;  4C7Z A;  5JRT A;  4X5V A;  4MFF A;  2KZZ A;  3A0H U;  2ASD A;  1QH9 A;  1ZQU A;  3ONN A;  2PI5 A;  4Z6C A;  4YR3 A;  4J03 A;  3QYP A;  2WF6 A;  4CNQ A;  3AQF A;  4UB8 U;  1WWU A;  2C28 A;  1UA1 A;  1B43 A;  4Y2S A;  2KSO B;  2KFZ A;  2ZIU B;  5AKK A;  5AI4 A;  3RTV A;  5AM4 A;  4RT2 A;  3LK9 A;  4EEY A;  1MA7 A;  3BS7 A;  3LWM A;  3H8W A;  3HKZ F;  2EZX A;  3G6V A;  4O3M A;  2FPL A;  2DPJ A;  1EXN A;  4QZ9 A;  4DOC A;  4FBU A;  3KD3 A;  4Z6F A;  3Q8R B;  1URJ A;  2H3Z A;  4I2F A;  4DWI A;  4YD1 A;  1CUK A;  3U26 A;  4M9N A;  1PK1 B;  4RQ0 A;  5AKI A;  3TFS A;  1T94 A;  5ALE A;  3MDC A;  4BWM A;  4RQ7 A;  8ICF A;  4QZE A;  2C2R A;  2Y0S C;  2BGW A;  2W9M A;  2KEY A;  2K4I A;  3M9O B;  1KBU A;  4MEY A;  4O9M A;  2KN7 A;  4BGD A;  4JMU A;  1N48 A;  2WF8 A;  2KJ9 A;  2QAR A;  3WK4 A;  3V7K A;  1ZQT A;  5DDM A;  3MFH A;  2XY7 A;  3SV3 A;  1SV0 C;  3EZ5 A;  5IIK A;  2YMP A;  3F2B A;  3RB3 A;  3QXG A;  3LYS A;  4QZF A;  3RB6 A;  4NLK A;  1LV5 A;  5J2I A;  4TUR A;  5CRX A;  2KZ3 A;  3RJI A;  4RQ1 A;  7ICR A;  5J2F A;  4DL5 A;  1NK6 A;  1K5O A;  9ICL A;  5ALG A;  4FS1 A;  3PR4 A;  4UAS A;  3JPS A;  2H3Q A;  1Z1V A;  1TK5 A;  4J9P A;  5GTI U;  4KN7 A;  4ZH4 A;  4ED6 A;  4US8 A;  3KBB A;  5KG4 A;  5DB8 A;  1NJW A;  1U4B A;  3JPO A;  5J0U A;  5KT5 A;  4Q8E A;  5L9X A;  2XCA A;  3UXO A;  7ICO A;  1TE2 A;  1KDH A;  3UPQ A;  3FAH A;  2HHQ A;  2DKZ A;  9ICR A;  5DB9 A;  3CNH A;  1F44 A;  9ICI A;  2K8C B;  3WU2 U;  1X9M A;  5AKX A;  3OJU A;  5KFJ A;  4EZ9 A;  7ICQ A;  1NK8 A;  1T3N A;  3AQE A;  5DGA A;  1N2X A;  1N56 A;  4C4R A;  2AQ0 A;  2QLT A;  3ZD9 A;  5KFT A;  4M6W B;  3BQ2 A;  1JAL A;  5DB7 A;  2XY5 A;  5BOM A;  2EZY A;  2YY6 A;  1KW4 A;  2KOB A;  2WHE A;  3MGV A;  3SD7 A;  4QW9 A;  4DCC A;  1ZQA A;  4PGX A;  4Y2J A;  4O3N A;  1L7N A;  4I2I A;  3UMC A;  3QEB Z;  1XSP A;  2RDI A;  4A8E A;  2VKQ A;  4QWC A;  1UCV A;  2KNJ A;  5CEH A;  5HNK A;  3SV4 A;  2F44 A;  4JWN A;  4R8U B;  3PW7 A;  4UB5 A;  2YX8 A;  5CA7 A;  4DFK A;  9ICH A;  1ZQB A;  1JRO A;  3BS5 B;  2EQY A;  2A1A A;  2H5X A;  1C7Y A;  1T3Q A;  1S8O A;  3GIL A;  2E1E A;  2B6G A;  4YXM A;  3QU2 A;  2OXO A;  2BCQ A;  3BQT A;  2W04 A;  1ZQG A;  8ICK A;  3KZX A;  1IIP A;  2JGA A;  2DKX A;  1SWV A;  3F2C A;  3GIM A;  1NK0 A;  3KKA C;  2OH2 A;  1TFR A;  4JWM A;  5J2B A;  4PPX A;  3OHA A;  3RJG A;  9ICU A;  1JRP A;  1SIJ A;  4P4M A;  3QEA Z;  5KL8 B;  2IHN A;  2OYY A;  8ICZ A;  5DG8 A;  5C0Y A;  1NKB A;  2AHO B;  2FPK A;  2JHD A;  4C0Z A;  1ZRM A;  3MFI A;  2PFN A;  3CP8 A;  4DS4 A;  4YD2 A;  5L1K A;  2K89 A;  1KFT A;  5DG7 A;  4DQI A;  2WF7 A;  1U49 A;  1ZQJ A;  4F5R A;  3UXP A;  4EBE A;  5KFQ A;  5HML A;  5ALQ A;  4I2C A;  3TQ1 A;  5AM5 A;  4OJ6 A;  3MR5 A;  2YB1 A;  2E5S A;  3AU6 A;  1PZN A;  3GII A;  4J9K A;  5IIL A;  3UQ0 A;  4DOA A;  4CF5 A;  5KFC A;  2GO7 A;  4F91 B;  1X9S A;  2AGP A;  2L5Y A;  1K1S A;  4O3S A;  4UBB A;  3ISD A;  4YMN A;  4P2H A;  1JUD A;  3NUQ A;  1RYS A;  1S76 D;  3GQC A;  4NWI A;  2FMQ A;  3GIJ A;  2DFL A;  1S97 A;  4ECW A;  2ZIX A;  4J9N A;  1KL9 A;  2AH5 A;  3UMB A;  4IQV A;  4DL2 A;  1FFU A;  2WAQ F;  1L7O A;  5HMM A;  1KTQ A;  4DS5 A;  1TKD A;  1B0X A;  4MF8 A;  3RB0 A;  3E58 A;  2YML A;  3BS5 A;  1SL2 A;  4KMO B;  2E8M A;  5J2K A;  5HHH A;  2HCF A;  1BNP A;  5TZV A;  2KIC A;  2ZIV A;  3PW4 A;  3UMG A;  1GO3 F;  1XSL A;  4PHD A;  3BQ1 A;  8ICE A;  5III A;  1KSP A;  4JB3 A;  5CP2 A;  4PJ0 U;  1NZB A;  4PGY A;  2ALZ A;  8ICW A;  4P0P A;  5KT6 A;  2PFQ A;  1ZD5 A;  2MUT B;  4YXJ A;  1Z1B A;  2LYH A;  5BOL A;  4FBT A;  3G6X A;  1BPZ A;  2KD1 A;  3L5K A;  4ELU A;  5J8Y C;  4F5Q A;  4O0I A;  1O08 A;  3C5F A;  3N7P D;  2F77 X;  1KFD A;  2K4P A;  4P4P A;  4B9L A;  4B6J A;  1XO0 A;  3OJS A;  2P35 A;  2LHT A;  5KAF U;  1IG6 A;  2JZB A;  4F4Y A;  4QIW C;  1HUO A;  4RQ5 A;  1WYG A;  1SKR A;  2KVC A;  1RZT A;  4JV0 A;  2J6S A;  3V7L A;  1ZQF A;  2I9G A;  4PZO A;  5KFY A;  4DF4 A;  2HHU A;  4YVZ A;  2W9B A;  3WK8 A;  1F5S A;  2G09 A;  1RXV A;  2NYV A;  4QW8 A;  3NVW A;  3VCB A;  1WCL A;  4UB4 A;  4I29 A;  4DL3 A;  3EPG A;  4O5K A;  1U47 A;  5E79 U;  4RQM A;  5AK6 A;  5KFG A;  1TK8 A;  2FDR A;  1BPB A;  4Y2P A;  1JI7 A;  4RQ6 A;  1X40 A;  4DFP A;  4YFK A;  2YN4 A;  9ICB A;  2IOH A;  3T5J A;  2KK0 A;  3H0M B;  2CRX A;  4MF2 A;  3HJE A;  1X9W A;  4KTQ A;  2W43 A;  5ALL A;  4CGZ A;  5J2J A;  1ZQW A;  4CCH A;  3GIK A;  5L1L A;  3HRD D;  3ISB A;  2MU2 A;  5AI6 A;  4QWB A;  5F9L A;  8ICP A;  1ECW A;  3HW8 A;  3L3F X;  4OJL A;  3M1Y A;  2ZTC A;  2D8C A;  3PW0 A;  4CRX A;  3BZK A;  5DBC A;  1ARO P;  2BCR A;  1ZOL A;  3WK7 A;  4B9M A;  5KG6 A;  4UB3 A;  8ICY A;  3I76 A;  2FI1 A;  2AU0 A;  2HOQ A;  4I27 A;  7ICF A;  5DQI A;  2ZIW B;  9ICW A;  2NRW A;  3PSP A;  3HP6 A;  4FS2 A;  4TUP A;  9ICA A;  1FEZ A;  3SR6 A;  4RT3 A;  4AP9 A;  2HW3 A;  5KFR A;  4KLD A;  2CPR A;  5KFE A;  2FLN A;  2MUT A;  5CWR A;  2LKY A;  4EEK A;  1T7P A;  1X42 A;  3JPT A;  4ECU A;  1ZQV A;  4Q44 A;  5KFS A;  2AGO A;  5ALF A;  2ZIW A;  1L7M A;  1L3T A;  2DUY A;  3PNC A;  7ICN A;  5L1M A;  3RB4 A;  3RAQ A;  5HR6 A;  5J2H A;  2HHW A;  1RDF A;  3ORY A;  4GXK A;  3THV A;  2FLL A;  3NVV A;  3TFR A;  1U45 A;  4B9N A;  2W9C B;  4EBC A;  1BNO A;  1KN5 A;  3GFK B;  1U9L A;  2YQE A;  5KFL A;  4Q45 A;  4Y2V A;  1QSS A;  3BQ7 A;  3ZDA A;  1DK2 A;  4XA5 A;  5J0Q A;  4AYB F;  1FFV A;  1HEK A;  4IRK A;  3HT3 A;  1Z3E B;  1ZQM A;  4YN4 A;  4NM1 A;  4O5C A;  2JEI A;  3SYZ A;  3L4P A;  1UT5 A;  2OHF A;  4IQW A;  3SI8 A;  3KHL A;  3QX7 A;  3M7D A;  3PV8 A;  1VJ5 A;  3KOO A;  5ALY A;  2BQR A;  4YMO A;  5AK4 A;  4ELT A;  2R8G A;  2HHS A;  5AM0 A;  5J0S A;  2NRX A;  4ZOH C;  2JEG A;  4LZG A;  5AM1 A;  1YZ6 A;  3C2K A;  1A77 A;  1SV0 A;  2LBO A;  4ED1 A;  1T4G A;  4IRC A;  4MEX A;  5DBB A;  4O5E A;  4RNO A;  3NGD A;  2XCP A;  3GV5 B;  2JV3 A;  4C8M A;  3DDH A;  4OJO A;  1ZD3 A;  1ZQI A;  5CR0 A;  1LB2 B;  2BR0 A;  3Q8P B;  1NK7 A;  3I1Y A;  9ICJ A;  4GC7 A;  4KLU A;  2PXI A;  3NS1 A;  2JH7 A;  1D8B A;  4KLQ A;  1CEZ A;  2W54 A;  3ZDE A;  2FMS A;  4RZR A;  2OCE A;  3F5A A;  5IIN A;  4IQU A;  1KRP A;  7ICM A;  1TAU A;  5KL1 B;  2XGQ A;  1KLN A;  4UBC A;  2Y0S F;  1D9F A;  3NRW A;  3Q8K A;  3GV8 B;  2ES6 A;  9ICE A;  1ZQR A;  1TAQ A;  3F2D A;  1NJX A;  2FJ6 A;  2RHF A;  2QAR B;  2ZUD A;  9ICV A;  2ISO A;  2A1J A;  2G0A A;  4F4Z A;  5KG0 A;  5ALV A;  4DFJ A;  2LPE A;  1DGS A;  2CXY A;  4RU9 A;  2EAM A;  3N97 B;  4B9V A;  4KX3 A;  4F3O A;  1S0N A;  3ED5 A;  3B0Y A;  3WK9 A;  1X2I A;  1ZQS A;  5KT4 A;  1BPY A;  3M8S A;  8ICI A;  2LM1 A;  1A6S A;  8ICL A;  3PX6 A;  3T5H A;  2RP5 A;  3H4B A;  2UVW A;  3MBY A;  5AK5 A;  4ED8 A;  2F8L A;  5J2E A;  1NI3 A;  1J97 A;  1ZD4 A;  1V97 A;  2EDU A;  4IS7 A;  4OCZ A;  2AQ4 A;  4LVS A;  2ZIX B;  4RPX A;  3E2E A;  2EH9 A;  3KFU F;  7ICK A;  1L8O A;  2PMZ C;  5KFD A;  5AKJ A;  8ICC A;  4K4I A;  3Q8S B;  4RQ8 A;  1BPE A;  5DKW A;  5DBA A;  4MFA A;  5KG1 A;  2E3T A;  1SV4 A;  1F0M A;  1QQ7 A;  3JPP A;  2LI6 A;  4EX7 A;  3C5G A;  5AM2 A;  4M9J A;  2FMP A;  4NL9 A;  2F3N A;  3K4G A;  5ALD A;  4P0Q A;  4I2G A;  5ALH A;  4F5O A;  4UAV A;  3AU2 A;  2UVV A;  3EWA A;  4ECS A;  3NVZ A;  2FE9 A;  3V72 A;  1P7D A;  2VJ5 A;  1ZQP A;  1XU4 A;  4NLZ A;  3IG5 A;  4PGQ A;  3KHG A;  8ICX A;  3WKC A;  2W7O A;  4ECT A;  1ZYQ A;  4YQW A;  5ALU A;  3QNM A;  3PY8 A;  2I1Q A;  4O3P A;  4EBD A;  4GXI A;  4BWJ A;  3SQI A;  4QWE A;  2WFA A;  5ALT A;  3MAB A;  2DGZ A;  3PX4 A;  1AQ6 A;  3A0B U;  1WCN A; 
#chains in the Genus database with same CATH homology
 2KJ5 A;  2WB1 C;  2G5H B;  2XVT A;  3PSI A;  2ZIU B;  2NV3 A;  2ZXI A;  1XNS A;  2OXO A;  2MA1 A;  2GOL A;  1HIW A;  2H3V A;  3ICX A;  3K1Z A;  4FZN A;  3LVV A;  2W04 A;  4IC9 A;  3F5E A;  2H3Q A;  2MRL A;  4KX3 A;  1L6N A;  3H0M B;  1PVQ A;  2JMG A;  2KJ8 A;  4OJP A;  2CRX A;  3KZX A;  2HMX A;  2XIC A;  4ACO A;  1MA7 A;  1IIP A;  2BDU A;  2KV2 A;  3HKZ F;  4KMO B;  4AYB F;  2JGA A;  2A3V A;  4O3M A;  4NLC A;  1DRG A;  1YT3 A;  1HEK A;  2PMZ F;  3F2C A;  2F2A B;  2RRD A;  4FZM A;  2KKV A;  3SAH A;  4FE3 A;  1A6S A;  2KIC A;  2ZIV A;  2OH2 A;  4CGZ A;  3RFA A;  2D6F C;  1URJ A;  1GO3 F;  2RP5 A;  2H3Z A;  5T14 A;  1OUQ A;  2VJ4 A;  1ZQ1 C;  3GU3 A;  2H3I A;  2VIX A;  2KHQ A;  3PST A;  2F8L A;  3N7R C;  5KL8 B;  2ZXH A;  3M7D A;  4PL2 A;  2OYY A;  1ECW A;  1NZB A;  2H3F A;  3E0F A;  1F44 A;  2ZIX B;  3L3F X;  4OJL A;  2K4H A;  2KKP A;  4P0P A;  2K8C B;  3VC8 A;  5C0Y A;  4QJF B;  3CRX A;  5A0L A;  2K8A A;  3SAG A;  1Z1B A;  4CRX A;  2R18 A;  2JHD A;  3KFU F;  2OM6 A;  4OJ5 A;  4C0Z A;  3H0L B;  4P0Q B;  3CP8 A;  3IN5 A;  2KD1 A;  4BX9 C;  2PMZ C;  2K89 A;  2LBO A;  3F53 A;  2G08 A;  3AQE A;  2HOQ A;  2ZIW B;  3HKZ C;  4BJQ A;  4FZL A;  1WUD A;  1PVP A;  1Z19 A;  1T94 A;  3PSP A;  3SMV A;  3OPX A;  3D2Q A;  2HBL A;  2HOI A;  4BUG A;  2E1F A;  3O0F A;  3N7P D;  2LYA A;  2Y0S C;  2F77 X;  3D2N A;  4ICA A;  3AL0 B;  2KEY A;  2DQN B;  2K4I A;  2JH1 A;  2K8B B;  4PL1 A;  1KBU A;  2XI9 A;  4U7C A;  4OJO A;  3ALR A;  4AYB C;  2ZIV B;  2YB4 A;  1UPH A;  4JMU A;  1XO0 A;  2GH1 A;  4QIW F;  4OJ6 A;  2LHT A;  4P0Q A;  4QNL A;  2KJ9 A;  4CDG A;  2G07 A;  1A0P A;  3GZF A;  3IG8 A;  4KX5 A;  1SZH A;  3PZP A;  2CPR A;  2KOB A;  2YB1 A;  3H0R B;  4QIW C;  4WJ3 B;  2LKY A;  2E5S A;  2K4E A;  3CYM A;  3MGV A;  2KVC A;  2JH7 A;  2F76 X;  3DEE A;  1D8B A;  3PSF A;  2HBJ A;  4U6P A;  3F5A A;  1P7D A;  1TAM A;  3F2B A;  2VJ5 A;  2KIW A;  2CN1 A;  2G06 A;  3IG5 A;  3LYS A;  1Q3V A;  3D2S A;  2HBK A;  2HOF A;  2ZIU A;  2W7O A;  5KL1 B;  2XID A;  4A8E A;  2VKQ A;  2W7P A;  2G09 A;  2Y0S F;  2ZIW A;  2M0N A;  3NRW A;  1PVR A;  2WAQ C;  2DF4 B;  2HBM A;  2KNJ A;  3NUQ A;  2N1R A;  5CRX A;  2Q4T A;  3VCB A;  3SAF A;  3C29 A;  3F2D A;  3ONN A;  2ZG6 A;  4OO1 J;  5HR7 A;  4NWI A;  2YX8 A;  2LYB A;  2RHF A;  3T79 A;  3SQI A;  4NV0 A;  4NLB A;  3LVW A;  2Z7J A;  3M6Z A;  3C28 A;  1Q3U A;  3AQF A;  2G0A A;  1ED1 A;  2DGZ A;  2KHV A;  4P0P B;  3N7S C;  5HR6 A;  2ZIX A;  3M6K A;  1CRX A;  2W03 A;  4GFJ A;  2G5I B;  2WB1 F;  3RF9 A;  3IP4 B;  2WAQ F;  2E1E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...