2ZIVA

Crystal structure of the mus81-eme1 complex
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
302
structure length
281
Chain Sequence
b'GWHLSPGSYDIVLCVDLCETTGKQELVKELQRNSVTFDVRKLNVGDFLWVARERVTPVPGQLRPPVGKELVLDYIIERKRMDDLCGSIIDGRFREQKFRLKRCGLRKPIYLVEECGSAAAHLSIPESTLQQAIVNTQVVDGFFVKRVQDAKESAAYLTIMTRYLQKLYQNCTLFCRANLSCSLMAFTEFNYGAIKNKCQTVREVFARQLMQISGVSGDKAAAVLEHYSTVSSLLQAYDKCSSETEKEKLLSSVKYGKLKRNLGPALSRTIYQLYCTRGPLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Mus81 protein
publication title Crystal structure of the Mus81-Eme1 complex
pubmed doi rcsb
source organism Danio rerio
molecule tags Hydrolase
total genus 86
structure length 281
sequence length 302
ec nomenclature
pdb deposition date 2008-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02732 ERCC4 ERCC4 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.670 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2zivA02
4P0QB 4P0PB 2ZIVB 2ZIUB 4P0QA 2ZIUA 2ZIXB 4P0PA 2ZIVA 2ZIWB 2ZIWA 2ZIXA
chains in the Genus database with same CATH superfamily
5C5JA 3H8SA 4F5PA 3WKEA 2W9AA 1A76A 2JZBA 1HJPA 4NL9A 4UB6U 5KG3A 4FS2A 2F8KA 2HOIA 4CE6A 2JGAA 1B4FA 2K89A 1Z00A 3WK6A 3UXNA 5G5HA 2CRXA 1UHUA 2G5IB 3OSPA 1SV4A 2GO7A 4X5VA 3CYMA 2E8OA 2MAXA 1RQLA 2E8PA 1T3NA 3PSFA 2BPCA 4QWBA 2BKEA 1A0PA 4KX3A 3HILA 5K4LA 5EE9A 8ICAA 3RRGA 4GC7A 1Z4OA 2ZIVB 2YTUA 2BDUA 4ED3A 3L5KA 1SZPA 4MFFA 1RYSA 5ALKA 4KLEA 3AL0B 5KTQA 4M04A 2KJ5A 3PMLA 3F5EA 3ETRA 3G6VA 3QU7A 1SL2A 1X66A 2ZIWA 3ALRA 2YB1A 3K1RB 2HHTA 5AIAA 2V4QA 2M0NA 2W9BB 1COKA 1DOQA 1AROP 1KLNA 4EBCA 5KG7A 4C0ZA 3ZDBA 2DKXA 4UBCA 3F5AA 5AK4A 4O3NA 3UXOA 5AICA 4I2BA 3RJGA 4QZIA 1T8EA 3T5KA 4Y2UA 2WF5A 1X42A 2FLNA 1MQ2A 4RNMA 4UAUA 4CNQA 3VC8A 4JB3A 4YXJA 3HRDD 7ICMA 2HHSA 1BPDA 2KTQA 2W04A 3AU6A 4U7CA 2YMLA 5DLFA 3TAQA 4OJ6A 4YMOA 2F2AB 1RG6A 1L8LA 3EPIA 1ZOLA 3UQ0A 4NJ8A 5CEHA 1PZNA 4BDPA 3Q8MA 5KFMA 4ZH4A 2G08A 2EAOA 4I2JA 9ICCA 1C20A 1ZQVA 3KZXA 1TAMA 5AI6A 4KLUA 5AKLA 2ZIUB 3FC4A 4F5NA 4IS7A 2HCFA 4OCZA 4ED0A 3TFRA 2MUTA 1N5XA 1JI7A 3JPPA 3T5LA 1SXEA 1Z19A 5KG4A 2KE7A 3LK9A 2BZFA 2DPJA 5KFJA 3HPOA 5CB1A 2D3DA 1L7MA 4KLIA 5ALQA 4IRCA 2BDPA 4ECRA 4UAVA 2NRTA 9ICQA 4J9SA 5AK3A 1HIWA 1A77A 2W54A 4F71A 3T5HA 1NK9A 4TURA 1X9XA 3MR5A 1FIQA 3GV5B 3RRHA 4PH5A 3IP4B 2F44A 4EZ9A 2DWQA 2QARB 5DB7A 4RQ0A 4TQSA 1Q3UA 2FDRA 4M9LA 5KG0A 4KLSA 4UB2A 4KLMA 1NJWA 2FMSA 2P66A 3IG5A 4OD0A 1ZQGA 1ZRNA 4RQ2A 1ZJMA 4F5OA 4HYKA 3WKAA 1ZQZA 5J2DA 5KT5A 3V7LA 1CUKA 3KZIU 3PX6A 5KFOA 5DB6A 1U4BA 1IM4A 5KNIA 4JWMA 1VDVA 4QIWF 4R63A 4C8NA 5KG2A 1OUQA 3H4BA 2HHUA 4FO6A 8ICMA 2E8MA 4Z6DA 3GDXA 3BQ7A 1BNPA 3D2NA 4NV0A 1T3QA 2IOHA 5J2CA 3H0LB 3A0HU 4EENA 4YVZA 3LWMA 7ICPA 5AM0A 1XS9D 2F1JA 5ALEA 2BR0A 2YY6A 5KT4A 1RXWA 3V72A 2FLPA 4I28A 5G5GA 3IN5A 1OXJA 1D8LA 7ICNA 4B9TA 2JH1A 3WKDA 3LVWA 5ALNA 3MABA 4J9OA 2F77X 4M9JA 5L9XA 4JMUA 3SENA 4AYBC 8ICSA 2EQYA 3QYPA 2MU2A 4F4KA 2QB0A 1P7DA 5DG9A 3RH6A 1JALA 2LBOA 1RQNA 3ED5A 4DEZA 5J2FA 1BPEA 3ETLA 5ALSA 4ELTA 2KMDA 2ALZA 3H4DA 3U26A 1QTMA 5KFGA 1KW4A 4KLLA 4O5CA 2BPFA 5J2GA 4J9QA 2RDJA 3PNCA 4QWEA 3RJJA 4YG2A 1S0VA 4EBEA 3E2EA 2KEYA 1JXEA 4GIBA 2XY6A 2ISOA 2ZG6A 3BS7A 3L4PA 5DQIA 2KHVA 4OJOA 9ICRA 3PV8A 1Q3VA 1S8OA 1ZQCA 3UMBA 3H8JA 1T4GA 3M1YA 2XCAA 2HBMA 2Y1JA 3TAPA 4QZFA 3GILA 4JK1A 5D49A 2XY5A 2H3VA 1NZBA 2HSZA 4PL1A 2AHOB 2IOFK 3QUBA 3WK9A 4CRXA 2Y9TA 3RBDA 1Y88A 4LVSA 3GIIA 4BWMA 4AP9A 4DQIA 3E58A 2GWSA 2KG5A 1L6NA 4EZ6A 1KBUA 1ED1A 4EEYA 1KFDA 4YMMA 5D4BA 3I1YA 2IBKA 2KOBA 5DB8A 3CW2C 7ICJA 2PKEA 2I1QA 1H38A 2HI0A 4UB8U 4ED2A 3TI0A 4ED6A 3PZPA 1D9DA 2HBLA 4LZDA 3H0RB 2EANA 4ED7A 2NV3A 1V38A 2F76X 2QB1A 5KFPA 4FZNA 5DBBA 1ZETA 4R66A 3SR6A 1KDHA 1TE2A 2N1RA 4ECSA 2KNJA 2HBJA 5JRTA 9ICNA 4DL4A 2EAMA 3Q8LA 1IIPA 2R8GA 3SD7A 1NK0A 3RJKA 9ICWA 4RPZA 2BHNA 3QUTA 2DUYA 5ALJA 3HT3A 2DGZA 2F8LA 1EXNA 5TISU 2OWOA 2WHEA 3SMVA 3R9KA 1SKRA 2KV2A 1L3TA 1F5SA 4YXMA 2ASLA 7ICUA 5ALFA 5KT6A 2NRZA 4KITB 1S77D 1S9FA 1VLBA 3RF9A 3NRZA 4CGZA 1ZQ1C 2ZJ5A 2WFAA 4NM2A 1QQ7A 4BUGA 5ALOA 1ZQXA 1IXRA 2P6UA 5CHGA 1DK3A 5AK5A 3F53A 1X2IA 2YB4A 2XVTA 3JPTA 1U48A 3BJYA 4DF8A 5KT7A 1NOMA 4QZBA 1XSNA 4DO9A 2BCUA 1V85A 2AU0A 4O3PA 1URJA 3C2LA 2ASDA 8ICCA 2E5SA 7ICRA 4JUZA 1XSPA 1JUDA 1X40A 3WK5A 4FS1A 4NLBA 4Y2TA 4DQPA 4R8UA 3SAGA 2KIVA 5E79U 1YT3A 4YR2A 5HHHA 2V9WA 2R8IA 3QEBZ 4LZGA 2A3VA 4F2RA 4QJFB 4GLXA 3LVVA 5J2EA 1ZQRA 2G0AA 2ZUCA 2EZYA 1J97A 1NI3A 5C0YA 3UMCA 3NASA 4F72A 4J9KA 3AQEA 9ICMA 3M8RA 5EE0A 4NLKA 3AM9A 3OJSA 2UVRA 2FI1A 2W11A 4IQVA 2LM1A 4QWDA 5L1LA 2Z7JA 1UPHA 4OJPA 3M6ZA 4ECYA 4YQWA 1ZXIA 2LMRA 1RDFA 3HW8A 1PK1A 2XI9A 5HP4A 2EZZA 2XGPA 4NY8A 2RRDA 2HHWA 1MC8A 5DBAA 2I5HA 3GV8B 2RP5A 1ZQSA 1TKDA 5IIOA 4DS4A 4I2IA 3ZDDA 2RDIA 3KD3A 2HVIA 1NK7A 5AM4A 5L1KA 2K8BB 1IV8A 3ISDA 8ICTA 5AM5A 1QSYA 2IOFA 1KRPA 1V97A 1BPBA 2K8CB 3TADA 4YR3A 4ECZA 5CJ7A 4CF4A 2KSOB 3QE9Y 4EYIB 3OSNA 2AQ0A 3KKAC 5HR6A 2YX8A 4EBDA 1SL0A 2FPLA 4C4SA 1IG6A 3PSIA 2FMQA 8ICZA 4DSKA 2MSNA 2WTFA 3OPXA 1TFRA 1SZHA 3G6YA 1PVPA 4BXOB 5ALGA 2W3SA 1DXSA 1ZQIA 4C4TA 4ICAA 2OXOA 4QNLA 1QSSA 4BWJA 4RQ1A 4QIWC 4QW8A 3PW5A 2FPKA 4XA5A 3M7DA 4P4OA 4UQGA 1WYGA 4UB3A 5BOLA 8ICBA 4B9UA 5L1IA 2ATLA 1NK5A 1B0XA 1SV0A 5HMMA 5JTIA 1XSLA 4F4XA 4DLGA 4PZNA 5AI9A 3QNMA 3QUQA 2ES6A 5KFWA 1N63A 1L5UA 2HHQA 5J0YA 5KFYA 3SYZA 3BZKA 4M9GA 2LYHA 4Q8FA 4NM1A 3QX7A 5KFVA 3BQ0A 1XWLA 1D8YA 4CF5A 4DSFA 1ZQOA 3PR5B 1KTQA 4ECWA 1O03A 4RZRA 5KFTA 1TAQA 2DBYA 2YMQA 2WF6A 5KFFA 2J6SA 5AI5A 3V7JA 3RR7A 3AEVA 1MSWD 1KEJA 4B9MA 2NRWA 5AI0A 2UVVA 2BPGA 5J0QA 2K4EA 2ZUBA 1XO1A 2BCSA 3MBYA 1NJZA 3OJUA 3C2MA 1D9FA 1ZQYA 2EDUA 2PFNA 4RQMA 4B6JA 5J0UA 4UAWA 2ZTCA 1QH9A 4O3MA 4FZMA 4QW9A 7ICHA 3GU3A 2KVSA 5DGAA 1TV9A 5IIJA 1ZQAA 5KFDA 2AXTU 2LPEA 3RB0A 3MC1A 3NVYA 5BPCA 1ZD4A 1ZQFA 4QZHA 4DF4A 1JMSA 4IQUA 5F9NA 5AK6A 3UQ2A 3SV3A 3NVVA 1BVSA 4IL6U 1JXLA 4YFKA 1L3UA 5IIIA 2ESEA 4NL9C 4YN4A 4J9PA 1J2MA 2UVUA 1U49A 4ELVA 5DLGA 3BS5A 1L7OA 3A0BU 4RQ8A 2W8LA 5KFXA 3PO4A 2YMPA 4PGXA 3PX4A 9ICFA 1Z1VA 3LDAA 1KL9A 4I2GA 3MR6A 3TACB 2OHFA 5KFKA 1ZQKA 4MF2A 3EWAA 2A1JB 3MR3A 2IMWP 8ICQA 3RJIA 2C2RA 5ALHA 4KLTA 4DFMA 5L1JA 1S97A 2OH2A 3MGIA 3JPRA 1SXDA 1HUZA 3I76A 1NK8A 3BZCA 4R8UB 2MRLA 3MGVA 4C8OA 3DV9A 2LI6A 3I28A 5KFRA 4KLOA 4DOBA 9ICLA 5DKWA 4QZAA 4JV0A 5KT3A 4J9RA 3M6KA 1VJ5A 5J8YA 5J2JA 3Q8QB 2XY7A 2DF4B 2JMGA 2ODGA 3AMZA 4C8MA 1X6IA 5DB9A 3GIKA 4G9BA 8ICWA 2KFZA 8ICKA 1WUDA 4C8LA 3K4GA 5AKKA 2D6FC 5EWEA 1NJYA 1AQ6A 1ECWA 3ZI4A 2OM6A 3LWLA 4IQTA 2AQ4A 4MEXA 4P4PA 2EZXA 3Q8SB 1PK1B 3H0MB 8ICNA 3RTVA 3RJFA 8ICVA 1ZQQA 3AN1A 7ICQA 1K5OA 4PJ0U 5KFNA 3ZDCA 1XU4A 3G6XA 4YMNA 4ECQA 2PMZC 1LKYB 4MF8A 2G5HB 3H8WA 4KN4A 3FYHA 4O5KA 4QWAA 1WCNA 3OHAA 2HMXA 2KK0A 5A0LA 2JZBB 1J2NA 2ASJA 2A19A 4UASA 2W8KA 1QCKA 4RNNA 2LKYA 2ZIXA 4EX7A 4F91B 4A8EA 1Z00B 3C21A 4IC9A 1UA0A 4TQRA 4B9SA 2E1FA 8ICOA 2A1AA 4IR1A 4F4YA 1Z1BA 3FDSA 4YP3A 5AKEA 1LVHA 4DQRA 2LM4A 4F50A 4K4GA 1QLNA 3RJEA 4QZGA 4J9NA 5KL8B 2F3NA 3IM1A 3EUB2 4Z6FA 1TK5A 3NUQA 4YD1A 7ICTA 3RAXA 2OYYA 3N28A 9ICAA 2JV3A 4QZEA 2XICA 4PPXA 2W43A 2EH9A 2XCPA 2A1JA 4PGQA 3KFUF 4DL3A 4DSLA 5J2IA 1WCLA 2ZIWB 5J29A 2KJ8A 2NYVA 4J9MA 9ICGA 3DDHA 2R8HA 1NKCA 1WG8A 3SAHA 4Y2JA 3B0YA 2H3ZA 4DL5A 3N7SC 2KZMA 4KLDA 1ZQNA 1FEZA 3ZD8A 4TUSA 1Q8KA 1K1QA 1CEZA 5KFHA 2DL0A 4NLGA 4F93B 5IILA 3QUCA 5AKXA 4DWIA 1X9WA 5TZVA 1FO4A 2K8AA 2R8KA 5IIKA 4GXKA 4GC6A 5AI4A 4QWCA 2ZTEA 5DQHA 4RUAA 3RB6A 4R65A 1SL1A 2KZ3A 2W9BA 2AH5A 5DBCA 4DFJA 1B43A 2MUTB 9ICIA 2NO5A 1RYRA 2PFQA 2BCVA 3D2QA 4B9LA 5EWGA 4RT3A 5ALWA 3GZFA 4DFKA 4ECVA 3C2KA 3AUOA 2QKQA 5JU5A 4RT2A 3TQ1A 5EOZA 3WK4A 2PFPA 3THVA 1BNOA 4O3RA 5EWFA 3E0FA 1ZQBA 4F92B 4JWNA 1WWVA 5ALUA 3VCBA 4DL7A 4JV2A 1ZRMA 1SWVA 4EX6A 2PMZF 3ZD9A 4ED8A 4P2HA 3M9NB 2OEHA 8ICLA 4ELUA 3GFKB 4US8A 1KKXA 4QZ9A 4RQ7A 7ICEA 1PK3A 1YZ7A 1D8BA 4UATA 1U45A 2ZIUA 4DL2A 2VJ4A 3QU4A 2XGQA 9ICTA 1JRPA 3PR4A 2BCRA 4B9NA 2VKQA 4C8KA 9ICSA 4KMUA 1L7PA 4KN7A 4UAYA 2HOFA 5L1MA 1KSPA 3RR8A 1DGSA 4Y2XA 2NRXA 8ICHA 3M9MB 2R8JA 1S0OA 2IHMA 4I2HA 3BQ2A 5KFZA 2YN4A 3B9JA 3N4MB 4C4RA 5KG5A 2K60A 3WK8A 2QLTA 2H3FA 4Y2YA 2PI5A 3PSPA 5AKHA 3OHBA 2J6TA 1COOA 4M9HA 3N97B 3HJEA 3C5GA 5J2BA 2Q4TA 1PVRA 3BDPA 2FPMA 1YZ6A 3PW2A 2QARA 4USAA 1FFUA 1JROA 1JIHA 2LYBA 4Q43A 3CNHA 4O9MA 3Q8PB 5AI8A 4M6WA 5ALYA 3F2BA 3RH5A 8ICXA 4UW9A 3QU5A 1ZQUA 9ICEA 5FP0A 2K4HA 2E1EA 2HW3A 4BX9C 2KICA 2PXIA 4FFDA 3H7IA 4QZDA 3GQCA 1KQQA 8ICRA 3KHRA 1DRGA 1ZJNA 4PHAA 2AGPA 3ISBA 5CWRA 2WF8A 4Y2PA 3CP8A 1X9MA 3UM9A 2ZIXB 4M47A 7ICIA 5H2FU 3MGHA 4RQ6A 2ZJ8A 4PHDA 5KFBA 1L8OA 4QZCA 1ZD2P 2VJ5A 2W9CA 2BGWA 1NZPA 3AU2A 5ALZA 2QB0B 5KAFU 3IV6A 7ICFA 1UCVA 2KHQA 4JV1A 5BOMA 5J0PA 2AGQA 8ICIA 2W9MA 9ICHA 2B21A 3H8MA 2K4IA 3RBEA 1S0NA 3V6JA 5KT2A 4GXIA 5AIBA 2VA8A 3MFIA 2HDOA 3JPOA 3C1YA 1O08A 4FBTA 2HOQA 7ICVA 1ZQLA 4G3IA 3S6JA 2JEGA 3ONNA 2RLTA 8ICPA 5KL1B 3NGDA 4KLJA 5DDYA 2H5XA 2JXJA 1S5LU 1ZQDA 4CCHA 4RQNA 4BGDA 4UBBA 1LB2B 1KFSA 3IHQB 5HMLA 2B6GA 2CPRA 1N48A 4IQWA 8ICGA 1UT8A 3B0XA 4MHVA 5AKYA 3IG8A 2GH1A 5F3XB 3JPQA 4PHEA 1XNSA 1MA7A 2KJ9A 4RQ4A 3FM9A 4NWIA 2XO7A 3D2SA 4ECXA 4KTQA 1PUZA 3PW4A 4UB5A 5ALXA 2OCEA 4WJ3B 1MN8A 1A6SA 3K75D 5KFCA 3PW0A 4Y2RA 3GIJA 5KAIU 1ZQMA 3Q8KA 3RH4A 1ZD3A 3PVXA 2G09A 5J0TA 4ACOA 3EW9A 4DL6A 2F1IA 2XIDA 5J2KA 2WB1C 3SQIA 1JX4A 5ALVA 1ZQPA 1RYUA 3JPNA 4J9LA 1N61A 1SIJA 3SZ2A 5AM3A 2JRZA 9ICBA 1ZQHA 1U9LA 3V7KA 4DQSA 3NVZA 1L7NA 1B22A 2KP7A 1N56A 4C7YA 1RM6C 3IRUA 3KBBA 2GLEA 4DOAA 3UPQA 3OTQA 4ECUA 2LHTA 1L3VA 1CI4A 1NKBA 2Y0SF 3RAQA 4M0AA 4MFCA 2ZXHA 2BCQA 2UVWA 1ZYQA 2C2EA 5ALRA 4RNOA 3KTQA 3KHHA 5KFIA 3T5JA 3QEAZ 5ALIA 2I9GA 3OGUA 4I2FA 3O0FA 3KOOA 5KFUA 4KMOB 4RU9A 1FFVA 3J81j 4OO1J 3TADC 1S10A 4Y2SA 4OJLA 1BPYA 1Q46A 3WKBA 5GTIU 4I2AA 2AJQA 2B0CA 4CDGA 1UA1A 4I27A 4I2CA 8ICYA 2L5YA 2ZXIA 4P0QA 2VA2A 9ICPA 1N5WA 4PL2A 4DOCA 4MEYA 1K1SA 3Q8RB 2YMMA 4O3SA 4EYHB 5J0OA 2E3TA 5J0RA 3MR2A 3UMGA 3T3FA 2JEIA 3M9OB 1NK4A 4KLGA 4P0PA 5KFAA 5KFEA 5CP2A 3LYSA 4M6WB 1SV0C 3QZ7A 3NTUA 5D46A 2KKVA 3RFAA 5AKJA 3F2DA 3DEEA 2BQRA 2FJ6A 1DK2A 3L3FX 3V6HA 8ICUA 4YR0A 3C28A 2EAPA 4ED1A 3EYZA 7ICGA 3AQFA 4RPXA 3H40A 4DSEA 2Q0ZX 2P6RA 1SGGA 4KLQA 1U47A 4FE3A 4M9NA 9ICOA 3QU2A 3RB3A 4PZOA 3QU9A 3BQTA 2W9CB 2CXYA 2C28A 2HVHA 3NRWA 5F9LA 5EE3A 3HX0A 2DPIA 2WAQC 4F3OA 5AHXA 4Q45A 2WB1F 4DS5A 3CRXA 4DSIA 3PY8A 4LJXA 3C5FA 4Y2QA 4DFPA 4Q8EA 1GO3F 4MFAA 2F1HA 4DQQA 3PX0A 3WU2U 2WF7A 5AKIA 5DQGA 3T79A 5B66U 2DKZA 4F4ZA 2G06A 4F2SA 1CRXA 9ICUA 5ALTA 4DLEA 4I29A 1DGJA 1ZQJA 1NNLA 4O3OA 2YQEA 2Y9UA 2JEJA 1RPLA 4ZOHC 5KG1A 2AGOA 3TFSA 2C2DA 1T7PA 4QZ8A 1PVQA 5KFQA 9ICVA 5J2AA 2HHVA 1V9PA 1N2XA 1X9SA 3EPGA 4F8RA 4RUCA 5ALMA 4F5QA 4IRKA 4US9A 4EELA 4Y2VA 3WK7A 4XQ8A 2W7PA 3D6JA 7ICOA 1QSLA 4YD2A 2BQ3A 5J0WA 3PSTA 5ALPA 2FE9A 4KLHA 2RQ5A 2FLLA 3KHGA 2KSOA 4TUPA 2JHDA 3QXGA 3WKCA 5J0XA 2W3RA 1T94A 5JUMA 3QZ8A 4O3QA 4BJQA 5DG8A 5HR7A 1L3SA 2FMPA 3FAHA 9ICXA 2RHFA 3SV4A 1BGXT 3HKZC 4Q44A 2D8CA 4BXOA 4DSJA 3N7RC 2ZIVA 4I2DA 5AKGA 5J8YC 1SKSA 5HHIA 1RXVA 2I6XA 5DGBA 5CR0A 3BQ1A 4UB4A 2VA3A 1SWWA 2W55A 1TK0A 2MA1A 4RPYA 2M9NA 3V6KA 1F44A 2VIXA 2KZZA 4KLFA 2H3IA 4E0DA 5B5EU 4YCXA 5ALDA 7ICSA 4K4HA 2IA6A 5T14A 1ZQWA 1NKEA 4C7ZA 4KX5A 2HHXA 1XC9A 3TKAA 3RB4A 4IR9A 3GV7B 4F5RA 4J03A 2PFOA 1N60A 2BQUA 5AKZA 2W03A 3HP6A 2KKPA 2ZUDA 4FBUA 7ICLA 4XRHA 4XUSA 3BS5B 1BPXA 4O0IA 2NO4A 1HEKA 4UARA 8ICEA 4RQ5A 1TK8A 5IINA 3HWTA 3N7PD 2WAQF 3PMNA 1C7YA 2E8NA 2P35A 2NRVA 4UAZA 2WF9A 4M2YA 4K4IA 3C1ZA 4FZLA 5AM2A 3M8SA 3F2CA 4Z6EA 2KFNA 3ZDEA 4NLCA 3C23A 2CN1A 1LV5A 3RJHA 4P0QB 1N62A 3PW7A 1TVAA 1X6JA 2ZTDA 5CA7A 5DG7A 4IRDA 3K1ZA 3KKAA 1QQ5A 2ISPA 5CRXA 4ECTA 2XC9A 2JR5A 4OJ5A 4U6PA 3JPSA 2KVCA 4P0PB 4NXZA 1KFTA 4AYBF 1WWUA 1HUOA 1NJXA 1UT5A 2G07A 4GFJA 7ICKA 5EE1A 3ORYA 1TAUA 1QQ6A 4DCCA 2HBKA 5HNKA 3KHLA 1ZQTA 5KFSA 1RZTA 2GOLA 4CF3A 9ICKA 3ISCA 5ALLA 3ICXA 2KN7A 3ZDAA 1OW5A 2JH7A 2J6UA 4C80A 1SKWA 3TANA 2ZJAA 4I2EA 5IIMA 2JEFA 5KG6A 2VANA 3SAFA 1UQVA 1ZD5A 8ICJA 1S76D 4DFDA 1S0MA 3UXPA 2Y0SC 5AM1A 4RQ3A 2KD1A 3MFHA 1JN3A 2O6KA 5J0SA 2W7OA 3HKZF 4P4MA 3C29A 2DFLA 8ICFA 1MQ3A 4GXJA 4R64A 4NLZA 4B9VA 4NLNA 2Y1IA 1NK6A 2R18A 2C22A 3TARA 5DDMA 9ICJA 1SB3C 4PGYA 1Z3EB 4HAIA 4F4WA 3IDWA 3SI8A 3MDCA 1M6YA 2KIWA 3EZ5A 4O5EA 3NS1A 3MDAA 2IHNA 4EEKA 5GTHU 1BPZA 4UB1A 2H3QA 3PO5A 5KFLA 4TUQA 1XO0A 2K4PA 3SEIA 1ZQEA 1F0MA 2PI4A 5J2HA 2DQNB 1Z4NA 2V4RA 2LYAA 1KN5A 1LKYA 3GIMA 4Z6CA 3NVWA 4PHPA
chains in the Genus database with same CATH topology
2WAQC 3IG8A 4P0PB 2GH1A 3AL0B 2KEYA 2LYBA 4AYBF 2WB1F 2DGZA 3O0FA 2F8LA 1UPHA 2Z7JA 4OJPA 3CRXA 3M6ZA 2OH2A 2G07A 3D2QA 1XNSA 4GFJA 2G08A 4KMOB 3F2BA 3SMVA 2HOIA 2ZG6A 1MA7A 4OO1J 2KJ9A 2KV2A 2MA1A 2JGAA 1GO3F 3GZFA 4QIWF 5KL8B 2KHVA 4OJOA 2XI9A 3KZXA 2K89A 4NWIA 4OJLA 1F44A 2HBKA 1Q3VA 2VIXA 1OUQA 2MRLA 3D2SA 3MGVA 2K4HA 2RRDA 3T79A 2E1EA 1TAMA 3NUQA 4WJ3B 2H3IA 4BX9C 2GOLA 2KICA 2OYYA 1A6SA 2ZIUB 4CDGA 2XICA 3E0FA 2CRXA 2G06A 2RP5A 1CRXA 2HBMA 3D2NA 4NV0A 2G5IB 3KFUF 3VCBA 1DRGA 3CYMA 3RF9A 2ZXIA 3ICXA 4P0QA 4CGZA 1ZQ1C 3H0LB 2K4EA 4PL2A 2JH7A 5T14A 1Z19A 3CP8A 2PMZF 2G09A 4BUGA 4KX5A 3PSFA 2K8BB 2ZIXB 3M6KA 2H3VA 2ZIWB 4ACOA 2KJ8A 3F53A 1A0PA 2DF4B 2JMGA 4KX3A 2XIDA 3SAFA 1NZBA 2WB1C 2YB4A 3SQIA 2XVTA 4PL1A 2VJ5A 2K8CB 2W03A 2KKPA 1D8BA 2ZIVB 4CRXA 2ZIUA 2BDUA 4FZMA 4O3MA 1WUDA 2Y0SC 3IN5A 2VJ4A 1PVQA 2KD1A 3GU3A 3SAHA 2D6FC 2JH1A 2KHQA 1URJA 4P0PA 2E5SA 2H3ZA 1ECWA 2W7OA 2VKQA 1HEKA 3HKZF 2KJ5A 2OM6A 3LYSA 3C29A 2YX8A 1HIWA 3F5EA 3N7SC 3LVWA 5HR6A 1L6NA 3H0MB 1KBUA 1ED1A 2F77X 2R18A 3N7PD 3PSIA 2K4IA 2KKVA 2WAQF 3RFAA 2HOFA 2ZIWA 4NLBA 2W7PA 3ALRA 3F2DA 2YB1A 3DEEA 3OPXA 2KOBA 1SZHA 4JMUA 3SAGA 1PVPA 1YT3A 2M0NA 4AYBC 3L3FX 4FZLA 3C28A 3F2CA 2PMZC 2HOQA 3PSTA 4C0ZA 4NLCA 3AQFA 1P7DA 2G5HB 3IP4B 2CN1A 2OXOA 4ICAA 4QNLA 4QJFB 3PZPA 2K8AA 3LVVA 1Q3UA 2A3VA 4P0QB 2HBLA 3F5AA 2KIWA 2HMXA 3H0RB 3ONNA 4QIWC 2LHTA 2JHDA 5A0LA 2H3FA 5KL1B 2G0AA 2NV3A 2LBOA 1T94A 2F76X 4FE3A 3PSPA 2Y0SF 3M7DA 4FZNA 2H3QA 5C0YA 4BJQA 3VC8A 5HR7A 2LKYA 2ZIXA 1XO0A 2N1RA 3K1ZA 4A8EA 3IG5A 3AQEA 2ZXHA 2W04A 4U7CA 2RHFA 4IC9A 2KNJA 2HBJA 2DQNB 5CRXA 2CPRA 2Q4TA 3HKZC 4OJ6A 2LYAA 2E1FA 1IIPA 1PVRA 3N7RC 4OJ5A 2F2AB 4U6PA 3NRWA 2ZIVA 1Z1BA 2KVCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P0Q B;  4P0P B;  2ZIV B;  2ZIU B;  4P0Q A;  2ZIU A;  2ZIX B;  4P0P A;  2ZIV A;  2ZIW B;  2ZIW A;  2ZIX A; 
#chains in the Genus database with same CATH topology
 5C5J A;  3H8S A;  4F5P A;  3WKE A;  2W9A A;  1A76 A;  2JZB A;  1HJP A;  4NL9 A;  4UB6 U;  5KG3 A;  4FS2 A;  2F8K A;  2HOI A;  4CE6 A;  2JGA A;  1B4F A;  2K89 A;  1Z00 A;  3WK6 A;  3UXN A;  5G5H A;  2CRX A;  1UHU A;  2G5I B;  3OSP A;  1SV4 A;  2GO7 A;  4X5V A;  3CYM A;  2E8O A;  2MAX A;  1RQL A;  2E8P A;  1T3N A;  3PSF A;  2BPC A;  4QWB A;  2BKE A;  1A0P A;  4KX3 A;  3HIL A;  5K4L A;  5EE9 A;  8ICA A;  3RRG A;  4GC7 A;  1Z4O A;  2ZIV B;  2YTU A;  2BDU A;  4ED3 A;  3L5K A;  1SZP A;  4MFF A;  1RYS A;  5ALK A;  4KLE A;  3AL0 B;  5KTQ A;  4M04 A;  2KJ5 A;  3PML A;  3F5E A;  3ETR A;  3G6V A;  3QU7 A;  1SL2 A;  1X66 A;  2ZIW A;  3ALR A;  2YB1 A;  3K1R B;  2HHT A;  5AIA A;  2V4Q A;  2M0N A;  2W9B B;  1COK A;  1DOQ A;  1ARO P;  1KLN A;  4EBC A;  5KG7 A;  4C0Z A;  3ZDB A;  2DKX A;  4UBC A;  3F5A A;  5AK4 A;  4O3N A;  3UXO A;  5AIC A;  4I2B A;  3RJG A;  4QZI A;  1T8E A;  3T5K A;  4Y2U A;  2WF5 A;  1X42 A;  2FLN A;  1MQ2 A;  4RNM A;  4UAU A;  4CNQ A;  3VC8 A;  4JB3 A;  4YXJ A;  3HRD D;  7ICM A;  2HHS A;  1BPD A;  2KTQ A;  2W04 A;  3AU6 A;  4U7C A;  2YML A;  5DLF A;  3TAQ A;  4OJ6 A;  4YMO A;  2F2A B;  1RG6 A;  1L8L A;  3EPI A;  1ZOL A;  3UQ0 A;  4NJ8 A;  5CEH A;  1PZN A;  4BDP A;  3Q8M A;  5KFM A;  4ZH4 A;  2G08 A;  2EAO A;  4I2J A;  9ICC A;  1C20 A;  1ZQV A;  3KZX A;  1TAM A;  5AI6 A;  4KLU A;  5AKL A;  2ZIU B;  3FC4 A;  4F5N A;  4IS7 A;  2HCF A;  4OCZ A;  4ED0 A;  3TFR A;  2MUT A;  1N5X A;  1JI7 A;  3JPP A;  3T5L A;  1SXE A;  1Z19 A;  5KG4 A;  2KE7 A;  3LK9 A;  2BZF A;  2DPJ A;  5KFJ A;  3HPO A;  5CB1 A;  2D3D A;  1L7M A;  4KLI A;  5ALQ A;  4IRC A;  2BDP A;  4ECR A;  4UAV A;  2NRT A;  9ICQ A;  4J9S A;  5AK3 A;  1HIW A;  1A77 A;  2W54 A;  4F71 A;  3T5H A;  1NK9 A;  4TUR A;  1X9X A;  3MR5 A;  1FIQ A;  3GV5 B;  3RRH A;  4PH5 A;  3IP4 B;  2F44 A;  4EZ9 A;  2DWQ A;  2QAR B;  5DB7 A;  4RQ0 A;  4TQS A;  1Q3U A;  2FDR A;  4M9L A;  5KG0 A;  4KLS A;  4UB2 A;  4KLM A;  1NJW A;  2FMS A;  2P66 A;  3IG5 A;  4OD0 A;  1ZQG A;  1ZRN A;  4RQ2 A;  1ZJM A;  4F5O A;  4HYK A;  3WKA A;  1ZQZ A;  5J2D A;  5KT5 A;  3V7L A;  1CUK A;  3KZI U;  3PX6 A;  5KFO A;  5DB6 A;  1U4B A;  1IM4 A;  5KNI A;  4JWM A;  1VDV A;  4QIW F;  4R63 A;  4C8N A;  5KG2 A;  1OUQ A;  3H4B A;  2HHU A;  4FO6 A;  8ICM A;  2E8M A;  4Z6D A;  3GDX A;  3BQ7 A;  1BNP A;  3D2N A;  4NV0 A;  1T3Q A;  2IOH A;  5J2C A;  3H0L B;  3A0H U;  4EEN A;  4YVZ A;  3LWM A;  7ICP A;  5AM0 A;  1XS9 D;  2F1J A;  5ALE A;  2BR0 A;  2YY6 A;  5KT4 A;  1RXW A;  3V72 A;  2FLP A;  4I28 A;  5G5G A;  3IN5 A;  1OXJ A;  1D8L A;  7ICN A;  4B9T A;  2JH1 A;  3WKD A;  3LVW A;  5ALN A;  3MAB A;  4J9O A;  2F77 X;  4M9J A;  5L9X A;  4JMU A;  3SEN A;  4AYB C;  8ICS A;  2EQY A;  3QYP A;  2MU2 A;  4F4K A;  2QB0 A;  1P7D A;  5DG9 A;  3RH6 A;  1JAL A;  2LBO A;  1RQN A;  3ED5 A;  4DEZ A;  5J2F A;  1BPE A;  3ETL A;  5ALS A;  4ELT A;  2KMD A;  2ALZ A;  3H4D A;  3U26 A;  1QTM A;  5KFG A;  1KW4 A;  4KLL A;  4O5C A;  2BPF A;  5J2G A;  4J9Q A;  2RDJ A;  3PNC A;  4QWE A;  3RJJ A;  4YG2 A;  1S0V A;  4EBE A;  3E2E A;  2KEY A;  1JXE A;  4GIB A;  2XY6 A;  2ISO A;  2ZG6 A;  3BS7 A;  3L4P A;  5DQI A;  2KHV A;  4OJO A;  9ICR A;  3PV8 A;  1Q3V A;  1S8O A;  1ZQC A;  3UMB A;  3H8J A;  1T4G A;  3M1Y A;  2XCA A;  2HBM A;  2Y1J A;  3TAP A;  4QZF A;  3GIL A;  4JK1 A;  5D49 A;  2XY5 A;  2H3V A;  1NZB A;  2HSZ A;  4PL1 A;  2AHO B;  2IOF K;  3QUB A;  3WK9 A;  4CRX A;  2Y9T A;  3RBD A;  1Y88 A;  4LVS A;  3GII A;  4BWM A;  4AP9 A;  4DQI A;  3E58 A;  2GWS A;  2KG5 A;  1L6N A;  4EZ6 A;  1KBU A;  1ED1 A;  4EEY A;  1KFD A;  4YMM A;  5D4B A;  3I1Y A;  2IBK A;  2KOB A;  5DB8 A;  3CW2 C;  7ICJ A;  2PKE A;  2I1Q A;  1H38 A;  2HI0 A;  4UB8 U;  4ED2 A;  3TI0 A;  4ED6 A;  3PZP A;  1D9D A;  2HBL A;  4LZD A;  3H0R B;  2EAN A;  4ED7 A;  2NV3 A;  1V38 A;  2F76 X;  2QB1 A;  5KFP A;  4FZN A;  5DBB A;  1ZET A;  4R66 A;  3SR6 A;  1KDH A;  1TE2 A;  2N1R A;  4ECS A;  2KNJ A;  2HBJ A;  5JRT A;  9ICN A;  4DL4 A;  2EAM A;  3Q8L A;  1IIP A;  2R8G A;  3SD7 A;  1NK0 A;  3RJK A;  9ICW A;  4RPZ A;  2BHN A;  3QUT A;  2DUY A;  5ALJ A;  3HT3 A;  2DGZ A;  2F8L A;  1EXN A;  5TIS U;  2OWO A;  2WHE A;  3SMV A;  3R9K A;  1SKR A;  2KV2 A;  1L3T A;  1F5S A;  4YXM A;  2ASL A;  7ICU A;  5ALF A;  5KT6 A;  2NRZ A;  4KIT B;  1S77 D;  1S9F A;  1VLB A;  3RF9 A;  3NRZ A;  4CGZ A;  1ZQ1 C;  2ZJ5 A;  2WFA A;  4NM2 A;  1QQ7 A;  4BUG A;  5ALO A;  1ZQX A;  1IXR A;  2P6U A;  5CHG A;  1DK3 A;  5AK5 A;  3F53 A;  1X2I A;  2YB4 A;  2XVT A;  3JPT A;  1U48 A;  3BJY A;  4DF8 A;  5KT7 A;  1NOM A;  4QZB A;  1XSN A;  4DO9 A;  2BCU A;  1V85 A;  2AU0 A;  4O3P A;  1URJ A;  3C2L A;  2ASD A;  8ICC A;  2E5S A;  7ICR A;  4JUZ A;  1XSP A;  1JUD A;  1X40 A;  3WK5 A;  4FS1 A;  4NLB A;  4Y2T A;  4DQP A;  4R8U A;  3SAG A;  2KIV A;  5E79 U;  1YT3 A;  4YR2 A;  5HHH A;  2V9W A;  2R8I A;  3QEB Z;  4LZG A;  2A3V A;  4F2R A;  4QJF B;  4GLX A;  3LVV A;  5J2E A;  1ZQR A;  2G0A A;  2ZUC A;  2EZY A;  1J97 A;  1NI3 A;  5C0Y A;  3UMC A;  3NAS A;  4F72 A;  4J9K A;  3AQE A;  9ICM A;  3M8R A;  5EE0 A;  4NLK A;  3AM9 A;  3OJS A;  2UVR A;  2FI1 A;  2W11 A;  4IQV A;  2LM1 A;  4QWD A;  5L1L A;  2Z7J A;  1UPH A;  4OJP A;  3M6Z A;  4ECY A;  4YQW A;  1ZXI A;  2LMR A;  1RDF A;  3HW8 A;  1PK1 A;  2XI9 A;  5HP4 A;  2EZZ A;  2XGP A;  4NY8 A;  2RRD A;  2HHW A;  1MC8 A;  5DBA A;  2I5H A;  3GV8 B;  2RP5 A;  1ZQS A;  1TKD A;  5IIO A;  4DS4 A;  4I2I A;  3ZDD A;  2RDI A;  3KD3 A;  2HVI A;  1NK7 A;  5AM4 A;  5L1K A;  2K8B B;  1IV8 A;  3ISD A;  8ICT A;  5AM5 A;  1QSY A;  2IOF A;  1KRP A;  1V97 A;  1BPB A;  2K8C B;  3TAD A;  4YR3 A;  4ECZ A;  5CJ7 A;  4CF4 A;  2KSO B;  3QE9 Y;  4EYI B;  3OSN A;  2AQ0 A;  3KKA C;  5HR6 A;  2YX8 A;  4EBD A;  1SL0 A;  2FPL A;  4C4S A;  1IG6 A;  3PSI A;  2FMQ A;  8ICZ A;  4DSK A;  2MSN A;  2WTF A;  3OPX A;  1TFR A;  1SZH A;  3G6Y A;  1PVP A;  4BXO B;  5ALG A;  2W3S A;  1DXS A;  1ZQI A;  4C4T A;  4ICA A;  2OXO A;  4QNL A;  1QSS A;  4BWJ A;  4RQ1 A;  4QIW C;  4QW8 A;  3PW5 A;  2FPK A;  4XA5 A;  3M7D A;  4P4O A;  4UQG A;  1WYG A;  4UB3 A;  5BOL A;  8ICB A;  4B9U A;  5L1I A;  2ATL A;  1NK5 A;  1B0X A;  1SV0 A;  5HMM A;  5JTI A;  1XSL A;  4F4X A;  4DLG A;  4PZN A;  5AI9 A;  3QNM A;  3QUQ A;  2ES6 A;  5KFW A;  1N63 A;  1L5U A;  2HHQ A;  5J0Y A;  5KFY A;  3SYZ A;  3BZK A;  4M9G A;  2LYH A;  4Q8F A;  4NM1 A;  3QX7 A;  5KFV A;  3BQ0 A;  1XWL A;  1D8Y A;  4CF5 A;  4DSF A;  1ZQO A;  3PR5 B;  1KTQ A;  4ECW A;  1O03 A;  4RZR A;  5KFT A;  1TAQ A;  2DBY A;  2YMQ A;  2WF6 A;  5KFF A;  2J6S A;  5AI5 A;  3V7J A;  3RR7 A;  3AEV A;  1MSW D;  1KEJ A;  4B9M A;  2NRW A;  5AI0 A;  2UVV A;  2BPG A;  5J0Q A;  2K4E A;  2ZUB A;  1XO1 A;  2BCS A;  3MBY A;  1NJZ A;  3OJU A;  3C2M A;  1D9F A;  1ZQY A;  2EDU A;  2PFN A;  4RQM A;  4B6J A;  5J0U A;  4UAW A;  2ZTC A;  1QH9 A;  4O3M A;  4FZM A;  4QW9 A;  7ICH A;  3GU3 A;  2KVS A;  5DGA A;  1TV9 A;  5IIJ A;  1ZQA A;  5KFD A;  2AXT U;  2LPE A;  3RB0 A;  3MC1 A;  3NVY A;  5BPC A;  1ZD4 A;  1ZQF A;  4QZH A;  4DF4 A;  1JMS A;  4IQU A;  5F9N A;  5AK6 A;  3UQ2 A;  3SV3 A;  3NVV A;  1BVS A;  4IL6 U;  1JXL A;  4YFK A;  1L3U A;  5III A;  2ESE A;  4NL9 C;  4YN4 A;  4J9P A;  1J2M A;  2UVU A;  1U49 A;  4ELV A;  5DLG A;  3BS5 A;  1L7O A;  3A0B U;  4RQ8 A;  2W8L A;  5KFX A;  3PO4 A;  2YMP A;  4PGX A;  3PX4 A;  9ICF A;  1Z1V A;  3LDA A;  1KL9 A;  4I2G A;  3MR6 A;  3TAC B;  2OHF A;  5KFK A;  1ZQK A;  4MF2 A;  3EWA A;  2A1J B;  3MR3 A;  2IMW P;  8ICQ A;  3RJI A;  2C2R A;  5ALH A;  4KLT A;  4DFM A;  5L1J A;  1S97 A;  2OH2 A;  3MGI A;  3JPR A;  1SXD A;  1HUZ A;  3I76 A;  1NK8 A;  3BZC A;  4R8U B;  2MRL A;  3MGV A;  4C8O A;  3DV9 A;  2LI6 A;  3I28 A;  5KFR A;  4KLO A;  4DOB A;  9ICL A;  5DKW A;  4QZA A;  4JV0 A;  5KT3 A;  4J9R A;  3M6K A;  1VJ5 A;  5J8Y A;  5J2J A;  3Q8Q B;  2XY7 A;  2DF4 B;  2JMG A;  2ODG A;  3AMZ A;  4C8M A;  1X6I A;  5DB9 A;  3GIK A;  4G9B A;  8ICW A;  2KFZ A;  8ICK A;  1WUD A;  4C8L A;  3K4G A;  5AKK A;  2D6F C;  5EWE A;  1NJY A;  1AQ6 A;  1ECW A;  3ZI4 A;  2OM6 A;  3LWL A;  4IQT A;  2AQ4 A;  4MEX A;  4P4P A;  2EZX A;  3Q8S B;  1PK1 B;  3H0M B;  8ICN A;  3RTV A;  3RJF A;  8ICV A;  1ZQQ A;  3AN1 A;  7ICQ A;  1K5O A;  4PJ0 U;  5KFN A;  3ZDC A;  1XU4 A;  3G6X A;  4YMN A;  4ECQ A;  2PMZ C;  1LKY B;  4MF8 A;  2G5H B;  3H8W A;  4KN4 A;  3FYH A;  4O5K A;  4QWA A;  1WCN A;  3OHA A;  2HMX A;  2KK0 A;  5A0L A;  2JZB B;  1J2N A;  2ASJ A;  2A19 A;  4UAS A;  2W8K A;  1QCK A;  4RNN A;  2LKY A;  2ZIX A;  4EX7 A;  4F91 B;  4A8E A;  1Z00 B;  3C21 A;  4IC9 A;  1UA0 A;  4TQR A;  4B9S A;  2E1F A;  8ICO A;  2A1A A;  4IR1 A;  4F4Y A;  1Z1B A;  3FDS A;  4YP3 A;  5AKE A;  1LVH A;  4DQR A;  2LM4 A;  4F50 A;  4K4G A;  1QLN A;  3RJE A;  4QZG A;  4J9N A;  5KL8 B;  2F3N A;  3IM1 A;  3EUB 2;  4Z6F A;  1TK5 A;  3NUQ A;  4YD1 A;  7ICT A;  3RAX A;  2OYY A;  3N28 A;  9ICA A;  2JV3 A;  4QZE A;  2XIC A;  4PPX A;  2W43 A;  2EH9 A;  2XCP A;  2A1J A;  4PGQ A;  3KFU F;  4DL3 A;  4DSL A;  5J2I A;  1WCL A;  2ZIW B;  5J29 A;  2KJ8 A;  2NYV A;  4J9M A;  9ICG A;  3DDH A;  2R8H A;  1NKC A;  1WG8 A;  3SAH A;  4Y2J A;  3B0Y A;  2H3Z A;  4DL5 A;  3N7S C;  2KZM A;  4KLD A;  1ZQN A;  1FEZ A;  3ZD8 A;  4TUS A;  1Q8K A;  1K1Q A;  1CEZ A;  5KFH A;  2DL0 A;  4NLG A;  4F93 B;  5IIL A;  3QUC A;  5AKX A;  4DWI A;  1X9W A;  5TZV A;  1FO4 A;  2K8A A;  2R8K A;  5IIK A;  4GXK A;  4GC6 A;  5AI4 A;  4QWC A;  2ZTE A;  5DQH A;  4RUA A;  3RB6 A;  4R65 A;  1SL1 A;  2KZ3 A;  2W9B A;  2AH5 A;  5DBC A;  4DFJ A;  1B43 A;  2MUT B;  9ICI A;  2NO5 A;  1RYR A;  2PFQ A;  2BCV A;  3D2Q A;  4B9L A;  5EWG A;  4RT3 A;  5ALW A;  3GZF A;  4DFK A;  4ECV A;  3C2K A;  3AUO A;  2QKQ A;  5JU5 A;  4RT2 A;  3TQ1 A;  5EOZ A;  3WK4 A;  2PFP A;  3THV A;  1BNO A;  4O3R A;  5EWF A;  3E0F A;  1ZQB A;  4F92 B;  4JWN A;  1WWV A;  5ALU A;  3VCB A;  4DL7 A;  4JV2 A;  1ZRM A;  1SWV A;  4EX6 A;  2PMZ F;  3ZD9 A;  4ED8 A;  4P2H A;  3M9N B;  2OEH A;  8ICL A;  4ELU A;  3GFK B;  4US8 A;  1KKX A;  4QZ9 A;  4RQ7 A;  7ICE A;  1PK3 A;  1YZ7 A;  1D8B A;  4UAT A;  1U45 A;  2ZIU A;  4DL2 A;  2VJ4 A;  3QU4 A;  2XGQ A;  9ICT A;  1JRP A;  3PR4 A;  2BCR A;  4B9N A;  2VKQ A;  4C8K A;  9ICS A;  4KMU A;  1L7P A;  4KN7 A;  4UAY A;  2HOF A;  5L1M A;  1KSP A;  3RR8 A;  1DGS A;  4Y2X A;  2NRX A;  8ICH A;  3M9M B;  2R8J A;  1S0O A;  2IHM A;  4I2H A;  3BQ2 A;  5KFZ A;  2YN4 A;  3B9J A;  3N4M B;  4C4R A;  5KG5 A;  2K60 A;  3WK8 A;  2QLT A;  2H3F A;  4Y2Y A;  2PI5 A;  3PSP A;  5AKH A;  3OHB A;  2J6T A;  1COO A;  4M9H A;  3N97 B;  3HJE A;  3C5G A;  5J2B A;  2Q4T A;  1PVR A;  3BDP A;  2FPM A;  1YZ6 A;  3PW2 A;  2QAR A;  4USA A;  1FFU A;  1JRO A;  1JIH A;  2LYB A;  4Q43 A;  3CNH A;  4O9M A;  3Q8P B;  5AI8 A;  4M6W A;  5ALY A;  3F2B A;  3RH5 A;  8ICX A;  4UW9 A;  3QU5 A;  1ZQU A;  9ICE A;  5FP0 A;  2K4H A;  2E1E A;  2HW3 A;  4BX9 C;  2KIC A;  2PXI A;  4FFD A;  3H7I A;  4QZD A;  3GQC A;  1KQQ A;  8ICR A;  3KHR A;  1DRG A;  1ZJN A;  4PHA A;  2AGP A;  3ISB A;  5CWR A;  2WF8 A;  4Y2P A;  3CP8 A;  1X9M A;  3UM9 A;  2ZIX B;  4M47 A;  7ICI A;  5H2F U;  3MGH A;  4RQ6 A;  2ZJ8 A;  4PHD A;  5KFB A;  1L8O A;  4QZC A;  1ZD2 P;  2VJ5 A;  2W9C A;  2BGW A;  1NZP A;  3AU2 A;  5ALZ A;  2QB0 B;  5KAF U;  3IV6 A;  7ICF A;  1UCV A;  2KHQ A;  4JV1 A;  5BOM A;  5J0P A;  2AGQ A;  8ICI A;  2W9M A;  9ICH A;  2B21 A;  3H8M A;  2K4I A;  3RBE A;  1S0N A;  3V6J A;  5KT2 A;  4GXI A;  5AIB A;  2VA8 A;  3MFI A;  2HDO A;  3JPO A;  3C1Y A;  1O08 A;  4FBT A;  2HOQ A;  7ICV A;  1ZQL A;  4G3I A;  3S6J A;  2JEG A;  3ONN A;  2RLT A;  8ICP A;  5KL1 B;  3NGD A;  4KLJ A;  5DDY A;  2H5X A;  2JXJ A;  1S5L U;  1ZQD A;  4CCH A;  4RQN A;  4BGD A;  4UBB A;  1LB2 B;  1KFS A;  3IHQ B;  5HML A;  2B6G A;  2CPR A;  1N48 A;  4IQW A;  8ICG A;  1UT8 A;  3B0X A;  4MHV A;  5AKY A;  3IG8 A;  2GH1 A;  5F3X B;  3JPQ A;  4PHE A;  1XNS A;  1MA7 A;  2KJ9 A;  4RQ4 A;  3FM9 A;  4NWI A;  2XO7 A;  3D2S A;  4ECX A;  4KTQ A;  1PUZ A;  3PW4 A;  4UB5 A;  5ALX A;  2OCE A;  4WJ3 B;  1MN8 A;  1A6S A;  3K75 D;  5KFC A;  3PW0 A;  4Y2R A;  3GIJ A;  5KAI U;  1ZQM A;  3Q8K A;  3RH4 A;  1ZD3 A;  3PVX A;  2G09 A;  5J0T A;  4ACO A;  3EW9 A;  4DL6 A;  2F1I A;  2XID A;  5J2K A;  2WB1 C;  3SQI A;  1JX4 A;  5ALV A;  1ZQP A;  1RYU A;  3JPN A;  4J9L A;  1N61 A;  1SIJ A;  3SZ2 A;  5AM3 A;  2JRZ A;  9ICB A;  1ZQH A;  1U9L A;  3V7K A;  4DQS A;  3NVZ A;  1L7N A;  1B22 A;  2KP7 A;  1N56 A;  4C7Y A;  1RM6 C;  3IRU A;  3KBB A;  2GLE A;  4DOA A;  3UPQ A;  3OTQ A;  4ECU A;  2LHT A;  1L3V A;  1CI4 A;  1NKB A;  2Y0S F;  3RAQ A;  4M0A A;  4MFC A;  2ZXH A;  2BCQ A;  2UVW A;  1ZYQ A;  2C2E A;  5ALR A;  4RNO A;  3KTQ A;  3KHH A;  5KFI A;  3T5J A;  3QEA Z;  5ALI A;  2I9G A;  3OGU A;  4I2F A;  3O0F A;  3KOO A;  5KFU A;  4KMO B;  4RU9 A;  1FFV A;  3J81 j;  4OO1 J;  3TAD C;  1S10 A;  4Y2S A;  4OJL A;  1BPY A;  1Q46 A;  3WKB A;  5GTI U;  4I2A A;  2AJQ A;  2B0C A;  4CDG A;  1UA1 A;  4I27 A;  4I2C A;  8ICY A;  2L5Y A;  2ZXI A;  4P0Q A;  2VA2 A;  9ICP A;  1N5W A;  4PL2 A;  4DOC A;  4MEY A;  1K1S A;  3Q8R B;  2YMM A;  4O3S A;  4EYH B;  5J0O A;  2E3T A;  5J0R A;  3MR2 A;  3UMG A;  3T3F A;  2JEI A;  3M9O B;  1NK4 A;  4KLG A;  4P0P A;  5KFA A;  5KFE A;  5CP2 A;  3LYS A;  4M6W B;  1SV0 C;  3QZ7 A;  3NTU A;  5D46 A;  2KKV A;  3RFA A;  5AKJ A;  3F2D A;  3DEE A;  2BQR A;  2FJ6 A;  1DK2 A;  3L3F X;  3V6H A;  8ICU A;  4YR0 A;  3C28 A;  2EAP A;  4ED1 A;  3EYZ A;  7ICG A;  3AQF A;  4RPX A;  3H40 A;  4DSE A;  2Q0Z X;  2P6R A;  1SGG A;  4KLQ A;  1U47 A;  4FE3 A;  4M9N A;  9ICO A;  3QU2 A;  3RB3 A;  4PZO A;  3QU9 A;  3BQT A;  2W9C B;  2CXY A;  2C28 A;  2HVH A;  3NRW A;  5F9L A;  5EE3 A;  3HX0 A;  2DPI A;  2WAQ C;  4F3O A;  5AHX A;  4Q45 A;  2WB1 F;  4DS5 A;  3CRX A;  4DSI A;  3PY8 A;  4LJX A;  3C5F A;  4Y2Q A;  4DFP A;  4Q8E A;  1GO3 F;  4MFA A;  2F1H A;  4DQQ A;  3PX0 A;  3WU2 U;  2WF7 A;  5AKI A;  5DQG A;  3T79 A;  5B66 U;  2DKZ A;  4F4Z A;  2G06 A;  4F2S A;  1CRX A;  9ICU A;  5ALT A;  4DLE A;  4I29 A;  1DGJ A;  1ZQJ A;  1NNL A;  4O3O A;  2YQE A;  2Y9U A;  2JEJ A;  1RPL A;  4ZOH C;  5KG1 A;  2AGO A;  3TFS A;  2C2D A;  1T7P A;  4QZ8 A;  1PVQ A;  5KFQ A;  9ICV A;  5J2A A;  2HHV A;  1V9P A;  1N2X A;  1X9S A;  3EPG A;  4F8R A;  4RUC A;  5ALM A;  4F5Q A;  4IRK A;  4US9 A;  4EEL A;  4Y2V A;  3WK7 A;  4XQ8 A;  2W7P A;  3D6J A;  7ICO A;  1QSL A;  4YD2 A;  2BQ3 A;  5J0W A;  3PST A;  5ALP A;  2FE9 A;  4KLH A;  2RQ5 A;  2FLL A;  3KHG A;  2KSO A;  4TUP A;  2JHD A;  3QXG A;  3WKC A;  5J0X A;  2W3R A;  1T94 A;  5JUM A;  3QZ8 A;  4O3Q A;  4BJQ A;  5DG8 A;  5HR7 A;  1L3S A;  2FMP A;  3FAH A;  9ICX A;  2RHF A;  3SV4 A;  1BGX T;  3HKZ C;  4Q44 A;  2D8C A;  4BXO A;  4DSJ A;  3N7R C;  2ZIV A;  4I2D A;  5AKG A;  5J8Y C;  1SKS A;  5HHI A;  1RXV A;  2I6X A;  5DGB A;  5CR0 A;  3BQ1 A;  4UB4 A;  2VA3 A;  1SWW A;  2W55 A;  1TK0 A;  2MA1 A;  4RPY A;  2M9N A;  3V6K A;  1F44 A;  2VIX A;  2KZZ A;  4KLF A;  2H3I A;  4E0D A;  5B5E U;  4YCX A;  5ALD A;  7ICS A;  4K4H A;  2IA6 A;  5T14 A;  1ZQW A;  1NKE A;  4C7Z A;  4KX5 A;  2HHX A;  1XC9 A;  3TKA A;  3RB4 A;  4IR9 A;  3GV7 B;  4F5R A;  4J03 A;  2PFO A;  1N60 A;  2BQU A;  5AKZ A;  2W03 A;  3HP6 A;  2KKP A;  2ZUD A;  4FBU A;  7ICL A;  4XRH A;  4XUS A;  3BS5 B;  1BPX A;  4O0I A;  2NO4 A;  1HEK A;  4UAR A;  8ICE A;  4RQ5 A;  1TK8 A;  5IIN A;  3HWT A;  3N7P D;  2WAQ F;  3PMN A;  1C7Y A;  2E8N A;  2P35 A;  2NRV A;  4UAZ A;  2WF9 A;  4M2Y A;  4K4I A;  3C1Z A;  4FZL A;  5AM2 A;  3M8S A;  3F2C A;  4Z6E A;  2KFN A;  3ZDE A;  4NLC A;  3C23 A;  2CN1 A;  1LV5 A;  3RJH A;  4P0Q B;  1N62 A;  3PW7 A;  1TVA A;  1X6J A;  2ZTD A;  5CA7 A;  5DG7 A;  4IRD A;  3K1Z A;  3KKA A;  1QQ5 A;  2ISP A;  5CRX A;  4ECT A;  2XC9 A;  2JR5 A;  4OJ5 A;  4U6P A;  3JPS A;  2KVC A;  4P0P B;  4NXZ A;  1KFT A;  4AYB F;  1WWU A;  1HUO A;  1NJX A;  1UT5 A;  2G07 A;  4GFJ A;  7ICK A;  5EE1 A;  3ORY A;  1TAU A;  1QQ6 A;  4DCC A;  2HBK A;  5HNK A;  3KHL A;  1ZQT A;  5KFS A;  1RZT A;  2GOL A;  4CF3 A;  9ICK A;  3ISC A;  5ALL A;  3ICX A;  2KN7 A;  3ZDA A;  1OW5 A;  2JH7 A;  2J6U A;  4C80 A;  1SKW A;  3TAN A;  2ZJA A;  4I2E A;  5IIM A;  2JEF A;  5KG6 A;  2VAN A;  3SAF A;  1UQV A;  1ZD5 A;  8ICJ A;  1S76 D;  4DFD A;  1S0M A;  3UXP A;  2Y0S C;  5AM1 A;  4RQ3 A;  2KD1 A;  3MFH A;  1JN3 A;  2O6K A;  5J0S A;  2W7O A;  3HKZ F;  4P4M A;  3C29 A;  2DFL A;  8ICF A;  1MQ3 A;  4GXJ A;  4R64 A;  4NLZ A;  4B9V A;  4NLN A;  2Y1I A;  1NK6 A;  2R18 A;  2C22 A;  3TAR A;  5DDM A;  9ICJ A;  1SB3 C;  4PGY A;  1Z3E B;  4HAI A;  4F4W A;  3IDW A;  3SI8 A;  3MDC A;  1M6Y A;  2KIW A;  3EZ5 A;  4O5E A;  3NS1 A;  3MDA A;  2IHN A;  4EEK A;  5GTH U;  1BPZ A;  4UB1 A;  2H3Q A;  3PO5 A;  5KFL A;  4TUQ A;  1XO0 A;  2K4P A;  3SEI A;  1ZQE A;  1F0M A;  2PI4 A;  5J2H A;  2DQN B;  1Z4N A;  2V4R A;  2LYA A;  1KN5 A;  1LKY A;  3GIM A;  4Z6C A;  3NVW A;  4PHP A; 
#chains in the Genus database with same CATH homology
 2WAQ C;  3IG8 A;  4P0P B;  2GH1 A;  3AL0 B;  2KEY A;  2LYB A;  4AYB F;  2WB1 F;  2DGZ A;  3O0F A;  2F8L A;  1UPH A;  2Z7J A;  4OJP A;  3CRX A;  3M6Z A;  2OH2 A;  2G07 A;  3D2Q A;  1XNS A;  4GFJ A;  2G08 A;  4KMO B;  3F2B A;  3SMV A;  2HOI A;  2ZG6 A;  1MA7 A;  4OO1 J;  2KJ9 A;  2KV2 A;  2MA1 A;  2JGA A;  1GO3 F;  3GZF A;  4QIW F;  5KL8 B;  2KHV A;  4OJO A;  2XI9 A;  3KZX A;  2K89 A;  4NWI A;  4OJL A;  1F44 A;  2HBK A;  1Q3V A;  2VIX A;  1OUQ A;  2MRL A;  3D2S A;  3MGV A;  2K4H A;  2RRD A;  3T79 A;  2E1E A;  1TAM A;  3NUQ A;  4WJ3 B;  2H3I A;  4BX9 C;  2GOL A;  2KIC A;  2OYY A;  1A6S A;  2ZIU B;  4CDG A;  2XIC A;  3E0F A;  2CRX A;  2G06 A;  2RP5 A;  1CRX A;  2HBM A;  3D2N A;  4NV0 A;  2G5I B;  3KFU F;  3VCB A;  1DRG A;  3CYM A;  3RF9 A;  2ZXI A;  3ICX A;  4P0Q A;  4CGZ A;  1ZQ1 C;  3H0L B;  2K4E A;  4PL2 A;  2JH7 A;  5T14 A;  1Z19 A;  3CP8 A;  2PMZ F;  2G09 A;  4BUG A;  4KX5 A;  3PSF A;  2K8B B;  2ZIX B;  3M6K A;  2H3V A;  2ZIW B;  4ACO A;  2KJ8 A;  3F53 A;  1A0P A;  2DF4 B;  2JMG A;  4KX3 A;  2XID A;  3SAF A;  1NZB A;  2WB1 C;  2YB4 A;  3SQI A;  2XVT A;  4PL1 A;  2VJ5 A;  2K8C B;  2W03 A;  2KKP A;  1D8B A;  2ZIV B;  4CRX A;  2ZIU A;  2BDU A;  4FZM A;  4O3M A;  1WUD A;  2Y0S C;  3IN5 A;  2VJ4 A;  1PVQ A;  2KD1 A;  3GU3 A;  3SAH A;  2D6F C;  2JH1 A;  2KHQ A;  1URJ A;  4P0P A;  2E5S A;  2H3Z A;  1ECW A;  2W7O A;  2VKQ A;  1HEK A;  3HKZ F;  2KJ5 A;  2OM6 A;  3LYS A;  3C29 A;  2YX8 A;  1HIW A;  3F5E A;  3N7S C;  3LVW A;  5HR6 A;  1L6N A;  3H0M B;  1KBU A;  1ED1 A;  2F77 X;  2R18 A;  3N7P D;  3PSI A;  2K4I A;  2KKV A;  2WAQ F;  3RFA A;  2HOF A;  2ZIW A;  4NLB A;  2W7P A;  3ALR A;  3F2D A;  2YB1 A;  3DEE A;  3OPX A;  2KOB A;  1SZH A;  4JMU A;  3SAG A;  1PVP A;  1YT3 A;  2M0N A;  4AYB C;  3L3F X;  4FZL A;  3C28 A;  3F2C A;  2PMZ C;  2HOQ A;  3PST A;  4C0Z A;  4NLC A;  3AQF A;  1P7D A;  2G5H B;  3IP4 B;  2CN1 A;  2OXO A;  4ICA A;  4QNL A;  4QJF B;  3PZP A;  2K8A A;  3LVV A;  1Q3U A;  2A3V A;  4P0Q B;  2HBL A;  3F5A A;  2KIW A;  2HMX A;  3H0R B;  3ONN A;  4QIW C;  2LHT A;  2JHD A;  5A0L A;  2H3F A;  5KL1 B;  2G0A A;  2NV3 A;  2LBO A;  1T94 A;  2F76 X;  4FE3 A;  3PSP A;  2Y0S F;  3M7D A;  4FZN A;  2H3Q A;  5C0Y A;  4BJQ A;  3VC8 A;  5HR7 A;  2LKY A;  2ZIX A;  1XO0 A;  2N1R A;  3K1Z A;  4A8E A;  3IG5 A;  3AQE A;  2ZXH A;  2W04 A;  4U7C A;  2RHF A;  4IC9 A;  2KNJ A;  2HBJ A;  2DQN B;  5CRX A;  2CPR A;  2Q4T A;  3HKZ C;  4OJ6 A;  2LYA A;  2E1F A;  1IIP A;  1PVR A;  3N7R C;  4OJ5 A;  2F2A B;  4U6P A;  3NRW A;  2ZIV A;  1Z1B A;  2KVC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...