2ZIVA

Crystal structure of the mus81-eme1 complex
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
302
structure length
281
Chain Sequence
GWHLSPGSYDIVLCVDLCETTGKQELVKELQRNSVTFDVRKLNVGDFLWVARERVTPVPGQLRPPVGKELVLDYIIERKRMDDLCGSIIDGRFREQKFRLKRCGLRKPIYLVEECGSAAAHLSIPESTLQQAIVNTQVVDGFFVKRVQDAKESAAYLTIMTRYLQKLYQNCTLFCRANLSCSLMAFTEFNYGAIKNKCQTVREVFARQLMQISGVSGDKAAAVLEHYSTVSSLLQAYDKCSSETEKEKLLSSVKYGKLKRNLGPALSRTIYQLYCTRGPLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Mus81 protein
publication title Crystal structure of the Mus81-Eme1 complex
pubmed doi rcsb
source organism Danio rerio
total genus 86
structure length 281
sequence length 302
ec nomenclature
pdb deposition date 2008-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02732 ERCC4 ERCC4 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.670 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2zivA02
4P0QA 2ZIVB 2ZIUB 4P0PB 2ZIWB 4P0PA 2ZIVA 2ZIWA 2ZIXB 2ZIUA 4P0QB 2ZIXA
chains in the Genus database with same CATH superfamily
1V97A 5HMLA 5EWEA 3EPGA 4GXKA 1JRPA 5IIOA 5DB8A 1RQLA 4JWNA 2ES6A 5KT4A 3SENA 1A6SA 1WUDA 1SV4A 5ALLA 5FP0A 5KFDA 1JI7A 3F53A 5AKLA 4DQSA 2Y9UA 8ICUA 1VDVA 3WK8A 4ZH4A 3L3FX 3AMZA 1MC8A 1H38A 4KLJA 4BDPA 5KFPA 3GILA 1ZETA 4NWIA 4DSIA 2BDUA 4QW8A 3C1YA 3CYMA 5J2AA 2IOHA 2NYVA 5HMMA 4ECYA 4R8UA 2DWQA 3OJSA 3GZFA 4F4YA 5AM1A 2V4QA 3PW0A 4RPXA 8ICOA 5DKWA 4DL6A 5KFQA 3N28A 3QU5A 4RQ7A 2QB0B 4NLGA 2DQNB 4ELUA 3RH4A 2XY5A 5KFAA 4KLUA 1WCNA 9ICVA 3EW9A 4UB4A 1ZQMA 3B9JA 3RR8A 2OCEA 3AU2A 2HCFA 5ALUA 5DG9A 3RJGA 9ICHA 4I2IA 3PMLA 3GIMA 3PX6A 2BCQA 3AM9A 4JWMA 5H2FU 5JRTA 3KTQA 2GOLA 8ICGA 4UB1A 2KZMA 4M9NA 2Y1JA 3H8WA 4YN4A 3AQFA 5KG3A 3MR2A 2UVUA 4OD0A 3N97B 1WG8A 1S0NA 3RB0A 1QSLA 3H8JA 3BS7A 4PHEA 5ALEA 1KW4A 3PR5B 1NJYA 1T4GA 1SL1A 2LPEA 5KFEA 2Q4TA 4I2HA 4QZ8A 1SIJA 2AGQA 2EZYA 3WKCA 1SKRA 2ZG6A 4DQPA 1ZQRA 4QW9A 4EZ6A 5DQIA 2LYAA 1RYUA 5CRXA 4YVZA 1BGXT 1S9FA 3QZ8A 4DL3A 2AH5A 5BPCA 1ZQBA 1RXWA 4M9JA 5DGAA 4M6WA 2FPMA 3TQ1A 2WFAA 4FBTA 2H3QA 5AKZA 2QKQA 4Z6EA 2ZUDA 5KFOA 2A1JA 4PGQA 3PNCA 1UHUA 2WF6A 1N48A 5IILA 3UQ2A 1S0OA 2IOFK 3K1RB 2BZFA 1Y88A 3M9MB 1UQVA 1PVPA 1GO3F 1SKSA 1TAMA 4F2RA 1KKXA 2QB1A 2EH9A 3H0MB 2DPIA 4ED6A 3MGHA 3EUB2 2Y0SF 4O3QA 4TQSA 1KQQA 5ALZA 4O5EA 4O5CA 2F77X 1Q46A 5J2DA 2LKYA 2ZUCA 4O3SA 3WKDA 5J0PA 3RBDA 1BPZA 7ICFA 2F1JA 5CP2A 3PO4A 4F5RA 1NKBA 1YT3A 2G5IB 3M6ZA 3PSIA 4LZDA 4LZGA 1JALA 2AU0A 4C8NA 2RRDA 3A0HU 4RZRA 3SV4A 3BDPA 3JPRA 5ALYA 2I5HA 5KL8B 3SAGA 1L5UA 4F91B 3M6KA 2MUTB 8ICIA 3QEBZ 1X6JA 3SQIA 3RJFA 5ALQA 1NZPA 1L7PA 2DKZA 2ZJAA 3PSPA 5DDMA 5D49A 3B0YA 4QNLA 3MFIA 1KDHA 3QUTA 5D4BA 4DFJA 3QUBA 4M9LA 1ZQOA 1NK6A 4OJOA 9ICPA 2YB1A 3GIIA 4UAWA 4YMOA 7ICMA 2ZIXB 1SWVA 3LWMA 7ICRA 1UT5A 5AK5A 9ICUA 3V6JA 3QE9Y 2NRVA 3FDSA 1NNLA 1BNPA 1PK1A 2GO7A 3KOOA 4PL2A 5KG4A 3H0LB 4OCZA 4QZGA 1URJA 5KFFA 1RG6A 4DL5A 1ZQWA 3L5KA 5AI8A 2HOIA 2IHNA 2QLTA 2PXIA 1XSLA 5CEHA 4UB3A 1MN8A 5AIAA 5AKXA 2R8HA 3WK5A 1L3VA 4JV2A 8ICQA 5ALPA 4B9SA 4ECWA 4J9PA 3RJJA 2WF5A 4UAUA 5DQHA 5JUMA 4EBCA 2KZZA 2FLLA 2FPKA 4KLLA 4IR1A 4US8A 3SEIA 4BGDA 1ZQEA 2MAXA 1JN3A 1JXEA 4EYHB 2H3ZA 4CE6A 2W9BB 5EWGA 4UB6U 4DOCA 2W8LA 3C28A 4P0QA 4F71A 5ALVA 4DS5A 1ZJNA 2IMWP 3PX0A 3JPOA 5DBBA 4UAZA 2YMQA 5D46A 2ZIWB 4NL9C 3PY8A 4F50A 1S97A 2DPJA 2WB1C 9ICXA 5KFNA 3CP8A 1D9DA 1WCLA 5AM4A 4I28A 3HPOA 1S8OA 2JHDA 2LYHA 3C5FA 4FFDA 5J8YC 1Q8KA 2P6UA 4ICAA 4YQWA 1SZPA 2C22A 2KV2A 2K4HA 8ICNA 4OJ6A 2R8GA 5A0LA 2DFLA 3RB3A 5J0RA 1RDFA 4I2CA 4F5QA 3PSTA 4Y2UA 1SL0A 5AI6A 2HHSA 2JV3A 5KFLA 4Y2SA 2F8KA 4PHDA 3ED5A 3U26A 3IG8A 2KKPA 3ZI4A 4TQRA 1KFSA 4O3NA 3IN5A 3JPNA 4YD1A 5E79U 4C7ZA 3CNHA 2NO5A 5KG2A 2F8LA 2QB0A 9ICSA 4BUGA 2PKEA 5KFKA 4DWIA 4TURA 4EBDA 4Z6DA 4B9VA 2JZBA 2ASJA 3IG5A 1ECWA 4RQMA 1WYGA 2JRZA 2KSOB 3MGVA 3I28A 5ALNA 2RHFA 2DUYA 4ACOA 2KIVA 3BJYA 3RBEA 4KTQA 2FI1A 2JR5A 4UARA 2AGOA 1QQ7A 1U4BA 1QQ6A 4XRHA 3RB6A 4DL7A 4IQWA 1SV0C 3KZXA 3OGUA 1TE2A 3T79A 3GDXA 2XC9A 1RXVA 4ECZA 3NS1A 3BQTA 3RR7A 3F5EA 4C8LA 2XCAA 3WK7A 4PL1A 5AKIA 3OHAA 2C2DA 1WWVA 5ALSA 4B9TA 2EAPA 2KHVA 1SGGA 3UQ0A 1IM4A 4DFMA 1SB3C 1QSYA 4NV0A 1OUQA 4GFJA 4DCCA 3TADC 2AQ0A 4ED2A 1COOA 4XUSA 2G09A 2BR0A 2XIDA 1EXNA 4K4IA 5KG6A 4GIBA 2ZUBA 4XQ8A 5IINA 4MFCA 4QZFA 4F5PA 3LWLA 1ZQZA 3E0FA 4RQ1A 4DQIA 5AM0A 4FE3A 8ICJA 5ALWA 3KBBA 1ZQTA 2E1EA 4JMUA 1HIWA 2YMPA 4C8MA 4DFKA 3SI8A 1DK2A 1ZXIA 4ECXA 1TVAA 1CI4A 3OJUA 1NKEA 4KN4A 2NRTA 1CRXA 1ZQQA 4KLIA 3K4GA 2M0NA 5KFBA 3Q8KA 4YFKA 1FFVA 4RUAA 9ICQA 4UW9A 3BZKA 4PHPA 4DLGA 2K8CB 3T5KA 1PZNA 2OM6A 3FC4A 1LKYB 1A77A 3SAHA 3UXPA 2CN1A 4I2EA 2KZ3A 4KLEA 2YB4A 2H5XA 1BPEA 2MSNA 1NK5A 3IV6A 2LI6A 1PK3A 5J2GA 3ZD8A 1CEZA 4QIWF 2EAMA 2EQYA 2MUTA 1JUDA 1ZQGA 3I1YA 5GTHU 3QXGA 3KHHA 3RJKA 5J0QA 3RJHA 7ICUA 2ZTEA 5J0XA 1AQ6A 2R8IA 5KG5A 2PMZC 4KLGA 3PO5A 1L3TA 5AI5A 3VC8A 2W3RA 5ALTA 2FJ6A 2A1AA 2ASDA 1D9FA 2FLPA 3TACB 5AIBA 1VLBA 4JV1A 1KSPA 5B66U 4PZOA 2XGQA 2EZZA 1UPHA 3MDCA 4EELA 5C5JA 4DSKA 4NLNA 2NRWA 3CRXA 1DGJA 4MHVA 3NVYA 5L1LA 4F4KA 5L1IA 3H40A 1PUZA 2YMLA 2AJQA 4NLCA 4Q8EA 3ZDAA 3WKBA 2IOFA 7ICJA 1NK0A 3SR6A 4KLMA 3Q8QB 4IRDA 4NL9A 5CWRA 1K1QA 4MF2A 4KITB 4UBBA 2I9GA 2BCVA 5KT5A 2LMRA 2G06A 2BQ3A 3S6JA 4ED3A 5AM2A 3JPPA 1TKDA 5J8YA 2NO4A 4I2JA 4B9UA 5ALDA 2A19A 3H4BA 2JH1A 2RDIA 1QSSA 3M8RA 2KJ8A 3C5GA 4J9RA 2QARB 5ALFA 2W9BA 3UM9A 3BQ2A 1RYRA 5HP4A 2YX8A 4ECVA 4M0AA 3WK4A 4UB2A 3OTQA 1V38A 4NLKA 5AI4A 1XSNA 2BDPA 4Z6FA 3TFRA 2ZIWA 1N62A 4PPXA 2XI9A 4QWAA 1ZQSA 4P0PB 2KTQA 2F1IA 3HP6A 3IRUA 4KX3A 5AK3A 3UMBA 1ZQNA 9ICTA 2ZJ5A 5KFTA 9ICEA 4O3OA 4F93B 4O3PA 5KNIA 3OSPA 4QWDA 8ICSA 5ALJA 1F0MA 1O03A 3NVWA 4DFPA 4ECUA 8ICKA 5ALMA 3GFKB 1Z3EB 4UATA 4JB3A 4DQQA 1XC9A 5AKHA 1NJXA 3G6YA 3KFUF 3FM9A 2KHQA 1SV0A 2W8KA 1DXSA 3EPIA 2Q0ZX 3MBYA 2M9NA 1D8LA 3LK9A 3ICXA 4ELTA 1QCKA 4YMMA 4OJLA 2PFNA 1TAQA 4B6JA 7ICGA 4I2GA 2OYYA 7ICOA 2FPLA 2W54A 4YXMA 1JIHA 3K75D 2ASLA 3T5LA 4UB5A 1L7MA 4FZLA 2KSOA 3TFSA 1F5SA 3N7RC 2LBOA 4KLTA 9ICOA 4HYKA 3QZ7A 3ISCA 3QU2A 1SXDA 1ZQYA 1T3QA 1U49A 1N56A 5KG7A 2KVCA 3V72A 4GXJA 3C2LA 2CPRA 4J9LA 2KOBA 3GIJA 4RQ3A 3N4MB 1Q3VA 1JXLA 8ICFA 2HMXA 2I1QA 4F8RA 3WK9A 1RM6C 1BPXA 4J9KA 2JMGA 2FDRA 5AKGA 5KFGA 2UVWA 5KG0A 4AYBF 3BQ1A 5G5HA 3DV9A 1S0MA 2ATLA 3C1ZA 3O0FA 1ZQHA 4PHAA 2YQEA 1UT8A 2HI0A 5DBAA 4DO9A 5IIMA 4GC6A 2EZXA 3H8MA 3RH5A 1QQ5A 3KZIU 3D2QA 1LB2B 3GQCA 3HRDD 2E3TA 5F9NA 3GV8B 4ED1A 4Y2YA 3PX4A 2A3VA 5KFCA 4NJ8A 4C4RA 2F2AB 2O6KA 4RU9A 4UB8U 4FO6A 4NY8A 1IXRA 4QWCA 4RQ8A 3Q8PB 1YZ6A 1COKA 4NLZA 4MFFA 1TK8A 4JK1A 1XNSA 9ICRA 3ISBA 1ZQ1C 5DLGA 2ZIUB 2WB1F 3WKAA 3NRWA 1WWUA 2K4PA 1LKYA 9ICLA 3BS5A 1B43A 4B9MA 1DK3A 4Y2QA 4EYIB 2BPGA 2KMDA 4RNNA 3Q8RB 1KFDA 5AKJA 5ALKA 1A76A 4I27A 3GU3A 2ZIVA 5DQGA 2WF8A 1NOMA 4RQ0A 4RNOA 3SAFA 4I2BA 2DKXA 3RRHA 1Z1BA 2ZXHA 5KT2A 5ALGA 7ICTA 4ECTA 2F3NA 3ORYA 4P2HA 2XCPA 2MU2A 1N61A 4IL6U 1NJZA 1ZQFA 2JXJA 2Y0SC 1OW5A 2D6FC 4F4XA 1BNOA 2B21A 1NK8A 4R65A 1L6NA 2W7OA 5L9XA 1ZQCA 7ICEA 2H3VA 4CRXA 1RYSA 5L1KA 3TAQA 4DSLA 1ZQKA 1TV9A 8ICPA 1NKCA 3PW5A 2K60A 3G6VA 2HOQA 2HVHA 2EDUA 1KEJA 2OHFA 2JH7A 2JGAA 1S0VA 2WF9A 3PZPA 9ICNA 1ZOLA 3ETRA 1S10A 3H4DA 1X6IA 3MR5A 2KKVA 1Q3UA 4O0IA 4DFDA 1J2MA 5KG1A 2HOFA 3OSNA 1SKWA 2KEYA 3C21A 5BOLA 5AHXA 2XY6A 4FZNA 2UVVA 3LVWA 2L5YA 4P4OA 9ICFA 2E8PA 1ZQVA 2WAQC 5KAIU 4F5NA 5F3XB 3V7KA 1ZQAA 1Z19A 1P7DA 2LHTA 1D8YA 2F44A 1ZQIA 3BZCA 2HHWA 3AU6A 2QARA 1MQ3A 4F2SA 4Y2RA 2R8JA 5EWFA 1NK7A 1BPDA 3H8SA 4IRKA 1V9PA 3C23A 3HKZF 2B0CA 2W9MA 2VA3A 1NJWA 2ZJ8A 2FMSA 1XO1A 2XVTA 2IA6A 3MFHA 3EZ5A 4P0PA 3G6XA 3NTUA 8ICEA 2YTUA 3T3FA 1BPBA 3DDHA 4CGZA 1T7PA 3F5AA 3LYSA 3HT3A 2AGPA 2HHQA 1DGSA 3M7DA 4KLQA 1FEZA 4DOBA 5CB1A 1L7NA 1X66A 4DF8A 4BJQA 2P6RA 3QU4A 2OEHA 3IDWA 1X40A 1B4FA 1K5OA 4RQ6A 4Y2VA 2W43A 1U45A 4KLFA 4B9LA 5KFRA 1ZD4A 5ALIA 5KFVA 4KLHA 2B6GA 4E0DA 3F2DA 3UPQA 2BKEA 2IBKA 4QZHA 4YG2A 2ALZA 1PVQA 3IP4B 5KTQA 2A1JB 7ICSA 3KKAC 3TAPA 1ZD3A 5IIKA 8ICAA 4OJPA 8ICLA 2LYBA 3FAHA 2XY7A 4CCHA 5JU5A 3SD7A 4ZOHC 2W7PA 3MR3A 2W04A 8ICXA 1JROA 5ALOA 3IHQB 4O3MA 1N63A 2PMZF 1O08A 3HW8A 1NZBA 5J2JA 5KT6A 3RJIA 1DOQA 5AKYA 4Q8FA 1SZHA 4JV0A 4EX7A 4F3OA 1UA0A 3D2NA 3GV5B 8ICZA 1X9MA 3PMNA 4K4GA 1C20A 2AHOB 4BX9C 5G5GA 4BXOB 4G3IA 1ZD5A 2W9CB 4FBUA 1B22A 3HJEA 4US9A 3BQ0A 2FE9A 3AUOA 4RPZA 1ZRNA 1XS9D 4FS1A 5HR7A 2W9AA 4RQ2A 4J9NA 2Y1IA 5KT7A 2HVIA 4EBEA 3K1ZA 3QU7A 2HHTA 4RNMA 3J81j 1TK0A 2AXTU 4A8EA 3TI0A 3UXNA 3NASA 4C80A 5ALXA 1S76D 3NVVA 1RQNA 4NM2A 9ICGA 5AKEA 1PK1B 1U47A 3PSFA 4I2DA 3D6JA 4J03A 1Z00B 3UXOA 2KICA 3ALRA 5J2FA 7ICIA 2E1FA 3M9OB 2WF7A 2ZIXA 8ICCA 3EWAA 5J0UA 4C8OA 9ICKA 3V6HA 1N5WA 1SL2A 4IQUA 4U7CA 4DSEA 3TKAA 2RP5A 5IIJA 5J0TA 2DF4B 2KD1A 7ICHA 7ICVA 3T5HA 4CF5A 3MDAA 4DLEA 2KJ5A 1F44A 5CA7A 3HWTA 4C7YA 4MEYA 1FIQA 2HW3A 1MQ2A 2KFZA 3VCBA 1IIPA 4YCXA 1YZ7A 3M9NB 2HDOA 3AEVA 3BQ7A 4DL4A 2ESEA 4DL2A 3Q8LA 2YMMA 1S5LU 5AM5A 4YR2A 8ICWA 4G9BA 4RQ4A 4EENA 2VKQA 3Q8SB 4EX6A 2VJ5A 4MEXA 4CDGA 4GXIA 5B5EU 1N2XA 4IR9A 2HBMA 4DOAA 4RPYA 2MA1A 1X42A 4QIWC 3ZDEA 4DS4A 2JEIA 3KHRA 5KT3A 1FFUA 3WK6A 5KFUA 2BQRA 2BCRA 5F9LA 2KVSA 2RQ5A 4I2FA 1ZD2P 2N1RA 4NM1A 5HNKA 2Z7JA 2E5SA 2JEFA 2PI4A 4Y2JA 8ICBA 5DG8A 2DBYA 2V4RA 3E58A 1XSPA 2LM4A 3HILA 3RF9A 2NRZA 2CRXA 1A0PA 2D3DA 1ED1A 2C28A 2VA2A 2UVRA 2JZBB 4LJXA 5DB7A 1ZQDA 1XO0A 4M04A 2J6SA 2Y9TA 4PJ0U 2G07A 5J29A 4F72A 2IHMA 3UMGA 3ZDDA 1X9SA 1XWLA 1ZRMA 3ONNA 4QZAA 2FLNA 2AQ4A 5DG7A 2KJ9A 2PFQA 2R8KA 5EE3A 3WKEA 4XA5A 1FO4A 4PZNA 4YP3A 4WJ3B 5DDYA 5KAFU 1QTMA 2F1HA 5KFXA 3RB4A 9ICMA 4TUQA 4EZ9A 3M1YA 3KKAA 2LM1A 4DSFA 4LVSA 1L3SA 4F92B 5DBCA 3MR6A 3TADA 1KLNA 1X9XA 1UA1A 1ZJMA 4DQRA 1T94A 2HHVA 4ECSA 2VIXA 2I6XA 4NXZA 2NRXA 5DB6A 4CF3A 5BOMA 2DGZA 1HUOA 4IS7A 5J0OA 4PGXA 4OO1J 3LDAA 7ICPA 4QZBA 3JPSA 4Y2PA 5L1MA 4J9MA 3V6KA 4QZCA 4UQGA 5AKKA 4I2AA 4MF8A 1D8BA 1HEKA 2HBJA 1BVSA 3LVVA 5T14A 2E8MA 1KL9A 3C2KA 9ICWA 2G08A 5AK4A 1VJ5A 3ZD9A 5J2CA 4BWMA 4M2YA 3D2SA 2GH1A 2WTFA 2EAOA 1TK5A 5DGBA 1QLNA 2RDJA 4HAIA 1KRPA 5KFIA 8ICRA 1HJPA 1T8EA 3QUQA 5J2HA 4MFAA 3I76A 9ICIA 9ICJA 4BXOA 1AROP 2VJ4A 2W9CA 2YN4A 4BWJA 3RAQA 1U48A 1J2NA 1K1SA 1KFTA 4Q44A 3OPXA 2YY6A 3RTVA 3NGDA 3QEAZ 5CR0A 3OHBA 4C4TA 5DB9A 9ICAA 1U9LA 1RZTA 4KMUA 5J0WA 4RQ5A 1DRGA 2K4IA 2MRLA 3RAXA 1PVRA 1S77D 3M8SA 1MSWD 3H0RB 4YD2A 2HSZA 4C4SA 5KFWA 4GC7A 2K8BB 4F4WA 2WAQF 5EE9A 4TUPA 3SV3A 4R63A 2HHUA 5JTIA 3NUQA 1ZQLA 4C8KA 1KTQA 1KN5A 4ED7A 8ICTA 3MC1A 1Z00A 4AYBC 4U6PA 3Q8MA 3RJEA 3UMCA 4QWBA 5KFSA 1NK4A 4UAYA 3QX7A 1L8OA 2K89A 1SWWA 5IIIA 3JPTA 2OXOA 5GTIU 4M9HA 5HR6A 3C2MA 4RUCA 3L4PA 5KFJA 3PW2A 5C0YA 3SMVA 3PR4A 4NLBA 2FMQA 4RQNA 4R64A 5ALHA 4UAVA 5KL1B 1N5XA 4K4HA 2W3SA 3H7IA 3DEEA 1LV5A 4CF4A 3A0BU 4J9OA 2C2EA 4R8UB 4KLDA 3RFAA 3C29A 2P66A 5J2IA 1ZQPA 2F76X 2J6TA 2W55A 4PGYA 3QYPA 4KLOA 4KX5A 5TZVA 4UASA 4M9GA 3JPQA 2JEGA 2GWSA 3PV8A 5AI9A 5AK6A 2RLTA 4J9SA 2KN7A 5EE1A 5J0SA 4USAA 5HHIA 5TISU 2NV3A 2G0AA 4GLXA 4ED8A 3THVA 2V9WA 4QWEA 4P4MA 3RRGA 4FS2A 5J0YA 3EYZA 2P35A 3ISDA 2CXYA 3GV7B 2G5HB 4DF4A 2KP7A 2H3FA 2H3IA 4B9NA 1KBUA 2OWOA 2R18A 2XICA 1X2IA 2J6UA 3F2CA 1JX4A 4ECRA 3MGIA 2BQUA 3V7LA 1XU4A 4Q45A 2ZXIA 2KFNA 1L3UA 3SYZA 3IM1A 4QZEA 2KG5A 4UBCA 4R66A 2C2RA 1Z4NA 1C7YA 4RT2A 1JMSA 2BHNA 3N7PD 1ZYQA 5KFHA 4EEYA 8ICHA 4FZMA 4DEZA 2PFOA 4RT3A 2BGWA 3NRZA 1M6YA 5ALRA 5AI0A 2JEJA 2VANA 2GLEA 3AN1A 4M6WB 4QZIA 3KHGA 3FYHA 5KFZA 2XGPA 3CW2C 3PW7A 1L7OA 1ZQXA 3B0XA 3WU2U 1T3NA 7ICLA 2ZTDA 8ICVA 3HX0A 3RH6A 5EOZA 4KN7A 4Z6CA 2W11A 5EE0A 2HBLA 3R9KA 4EEKA 3TARA 1TAUA 2FMPA 4JUZA 3PW4A 4QJFB 5J2EA 1BPYA 2ODGA 4KMOB 4IC9A 4F4ZA 2K4EA 3ZDCA 2D8CA 3ETLA 4F5OA 2VA8A 2BPCA 2ISPA 8ICYA 1Z1VA 3PVXA 3HKZC 7ICQA 2DL0A 4ELVA 2KNJA 3V7JA 4ECQA 1X9WA 4QZ9A 4IRCA 2HHXA 4TUSA 4OJ5A 5K4LA 1RPLA 1NK9A 2K8AA 5AM3A 1TFRA 4I29A 4Q43A 4AP9A 2ZTCA 7ICNA 5J2KA 4M47A 2PFPA 1LVHA 2E8OA 4DSJA 4YR3A 3F2BA 5L1JA 1B0XA 3E2EA 2KK0A 5KFYA 2KIWA 3AQEA 5CJ7A 1L8LA 1NI3A 2W03A 1HUZA 1SXEA 4PH5A 5HHHA 3AL0B 2BPFA 1OXJA 1IG6A 3GIKA 3TANA 1ZQUA 3SZ2A 4X5VA 5AICA 3BS5B 4O5KA 4CNQA 2ISOA 4YMNA 4J9QA 4YXJA 2ZIVB 4ED0A 2PI5A 5DLFA 4KLSA 9ICBA 1UCVA 2HBKA 2KE7A 4O9MA 1N60A 2WHEA 4IQVA 3ZDBA 2ZIUA 5CHGA 3NVZA 4IQTA 4YR0A 8ICMA 1Z4OA 3KD3A 3KHLA 4P4PA 2OH2A 9ICCA 4C0ZA 1MA7A 3MABA 2XO7A 2EANA 3QUCA 1IV8A 1V85A 2BCSA 3QNMA 5J2BA 2BCUA 1QH9A 4O3RA 1J97A 1ZQJA 5KFMA 3QU9A 4QZDA 3N7SC 7ICKA 4Y2XA 4Y2TA 3T5JA 1CUKA 2E8NA 4P0QB
chains in the Genus database with same CATH topology
2WB1C 2H3VA 2PMZC 4CRXA 4A8EA 3CP8A 2KHVA 3SQIA 2H3FA 2H3IA 2MA1A 3NUQA 4QIWC 2JHDA 4OJ5A 1KBUA 4BJQA 2R18A 3PSPA 3VC8A 2XICA 4NV0A 2K8AA 1OUQA 4QNLA 4GFJA 1A6SA 1WUDA 2DGZA 2Q4TA 2HOQA 4ICAA 3F2CA 2JH7A 3D2QA 3F53A 4AYBC 4U6PA 2JGAA 2G09A 2KV2A 4OO1J 2N1RA 2XIDA 4OJOA 2W7OA 2Z7JA 2ZXIA 3PSFA 2K4HA 2YB1A 2E5SA 2ZG6A 3PZPA 3L3FX 2ZIXB 4OJ6A 1UPHA 3F2DA 5A0LA 2LYAA 3F2BA 5CRXA 1D8BA 1HEKA 2HBJA 1PVQA 3E0FA 3CRXA 2A3VA 3LVVA 3PSTA 2K89A 3IP4B 4FE3A 3KFUF 2KICA 2KIWA 2KHQA 5HR6A 2OXOA 4NWIA 3ALRA 5T14A 3AQEA 3N7PD 4PL2A 2W03A 2F2AB 2KKVA 3H0LB 4NLCA 2E1EA 4JMUA 3RF9A 1Q3UA 5C0YA 1HIWA 2BDUA 2E1FA 1URJA 3ICXA 2ZIXA 4NLBA 4OJPA 2LYBA 4FZMA 3SMVA 2CRXA 3IG8A 2HOFA 2G08A 2KKPA 1A0PA 3CYMA 2KEYA 4OJLA 2HOIA 2H3QA 4FZNA 1ED1A 3D2SA 2GH1A 2OYYA 3LVWA 5KL1B 3IN5A 1XNSA 2W7PA 2WAQC 2W04A 1ZQ1C 4U7CA 2ZIVB 1XO0A 2RP5A 2ZIUB 1CRXA 2WB1F 3GZFA 4O3MA 2F8LA 1Z19A 2PMZF 4BUGA 1P7DA 2G06A 2LHTA 2M0NA 2DF4B 2KD1A 3DEEA 2G07A 1NZBA 2HBKA 1GO3F 1PVPA 3NRWA 1TAMA 4FZLA 3N7RC 1SZHA 2KJ5A 3H0MB 3D2NA 3RFAA 2LBOA 1F44A 2JH1A 2VJ4A 2K8CB 3ONNA 2OM6A 2Y0SF 3GU3A 2ZIVA 3C29A 2DQNB 3IG5A 1ECWA 2ZIUA 2KJ8A 2F76X 3SAFA 2F77X 2KJ9A 1Z1BA 4KX5A 3OPXA 2ZXHA 3HKZF 2LKYA 3VCBA 3MGVA 1IIPA 2OH2A 2KVCA 2RHFA 4BX9C 2CN1A 2YX8A 2HBLA 3SAHA 4ACOA 2XVTA 4C0ZA 1MA7A 2CPRA 2YB4A 2KOBA 4P0PA 4WJ3B 4QJFB 3AL0B 2H3ZA 1Q3VA 1YT3A 2G5IB 3KZXA 3M6ZA 4KMOB 4QIWF 4IC9A 2ZIWA 2HMXA 2VKQA 3PSIA 3T79A 2NV3A 2G0AA 2Y0SC 3C28A 2K4EA 2RRDA 4P0QA 2XI9A 1DRGA 4CGZA 5HR7A 2K4IA 2MRLA 2JMGA 3F5AA 4P0PB 3LYSA 1PVRA 2D6FC 2GOLA 2VJ5A 3F5EA 3N7SC 5KL8B 4CDGA 3SAGA 3HKZC 3H0RB 4KX3A 4PL1A 4AYBF 3K1ZA 3AQFA 3M6KA 3M7DA 1T94A 2ZIWB 2G5HB 2VIXA 2KNJA 2K8BB 1L6NA 2HBMA 4P0QB 2WAQF 3O0FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P0Q A;  2ZIV B;  2ZIU B;  4P0P B;  2ZIW B;  4P0P A;  2ZIV A;  2ZIW A;  2ZIX B;  2ZIU A;  4P0Q B;  2ZIX A; 
#chains in the Genus database with same CATH topology
 1V97 A;  5HML A;  5EWE A;  3EPG A;  4GXK A;  1JRP A;  5IIO A;  5DB8 A;  1RQL A;  4JWN A;  2ES6 A;  5KT4 A;  3SEN A;  1A6S A;  1WUD A;  1SV4 A;  5ALL A;  5FP0 A;  5KFD A;  1JI7 A;  3F53 A;  5AKL A;  4DQS A;  2Y9U A;  8ICU A;  1VDV A;  3WK8 A;  4ZH4 A;  3L3F X;  3AMZ A;  1MC8 A;  1H38 A;  4KLJ A;  4BDP A;  5KFP A;  3GIL A;  1ZET A;  4NWI A;  4DSI A;  2BDU A;  4QW8 A;  3C1Y A;  3CYM A;  5J2A A;  2IOH A;  2NYV A;  5HMM A;  4ECY A;  4R8U A;  2DWQ A;  3OJS A;  3GZF A;  4F4Y A;  5AM1 A;  2V4Q A;  3PW0 A;  4RPX A;  8ICO A;  5DKW A;  4DL6 A;  5KFQ A;  3N28 A;  3QU5 A;  4RQ7 A;  2QB0 B;  4NLG A;  2DQN B;  4ELU A;  3RH4 A;  2XY5 A;  5KFA A;  4KLU A;  1WCN A;  9ICV A;  3EW9 A;  4UB4 A;  1ZQM A;  3B9J A;  3RR8 A;  2OCE A;  3AU2 A;  2HCF A;  5ALU A;  5DG9 A;  3RJG A;  9ICH A;  4I2I A;  3PML A;  3GIM A;  3PX6 A;  2BCQ A;  3AM9 A;  4JWM A;  5H2F U;  5JRT A;  3KTQ A;  2GOL A;  8ICG A;  4UB1 A;  2KZM A;  4M9N A;  2Y1J A;  3H8W A;  4YN4 A;  3AQF A;  5KG3 A;  3MR2 A;  2UVU A;  4OD0 A;  3N97 B;  1WG8 A;  1S0N A;  3RB0 A;  1QSL A;  3H8J A;  3BS7 A;  4PHE A;  5ALE A;  1KW4 A;  3PR5 B;  1NJY A;  1T4G A;  1SL1 A;  2LPE A;  5KFE A;  2Q4T A;  4I2H A;  4QZ8 A;  1SIJ A;  2AGQ A;  2EZY A;  3WKC A;  1SKR A;  2ZG6 A;  4DQP A;  1ZQR A;  4QW9 A;  4EZ6 A;  5DQI A;  2LYA A;  1RYU A;  5CRX A;  4YVZ A;  1BGX T;  1S9F A;  3QZ8 A;  4DL3 A;  2AH5 A;  5BPC A;  1ZQB A;  1RXW A;  4M9J A;  5DGA A;  4M6W A;  2FPM A;  3TQ1 A;  2WFA A;  4FBT A;  2H3Q A;  5AKZ A;  2QKQ A;  4Z6E A;  2ZUD A;  5KFO A;  2A1J A;  4PGQ A;  3PNC A;  1UHU A;  2WF6 A;  1N48 A;  5IIL A;  3UQ2 A;  1S0O A;  2IOF K;  3K1R B;  2BZF A;  1Y88 A;  3M9M B;  1UQV A;  1PVP A;  1GO3 F;  1SKS A;  1TAM A;  4F2R A;  1KKX A;  2QB1 A;  2EH9 A;  3H0M B;  2DPI A;  4ED6 A;  3MGH A;  3EUB 2;  2Y0S F;  4O3Q A;  4TQS A;  1KQQ A;  5ALZ A;  4O5E A;  4O5C A;  2F77 X;  1Q46 A;  5J2D A;  2LKY A;  2ZUC A;  4O3S A;  3WKD A;  5J0P A;  3RBD A;  1BPZ A;  7ICF A;  2F1J A;  5CP2 A;  3PO4 A;  4F5R A;  1NKB A;  1YT3 A;  2G5I B;  3M6Z A;  3PSI A;  4LZD A;  4LZG A;  1JAL A;  2AU0 A;  4C8N A;  2RRD A;  3A0H U;  4RZR A;  3SV4 A;  3BDP A;  3JPR A;  5ALY A;  2I5H A;  5KL8 B;  3SAG A;  1L5U A;  4F91 B;  3M6K A;  2MUT B;  8ICI A;  3QEB Z;  1X6J A;  3SQI A;  3RJF A;  5ALQ A;  1NZP A;  1L7P A;  2DKZ A;  2ZJA A;  3PSP A;  5DDM A;  5D49 A;  3B0Y A;  4QNL A;  3MFI A;  1KDH A;  3QUT A;  5D4B A;  4DFJ A;  3QUB A;  4M9L A;  1ZQO A;  1NK6 A;  4OJO A;  9ICP A;  2YB1 A;  3GII A;  4UAW A;  4YMO A;  7ICM A;  2ZIX B;  1SWV A;  3LWM A;  7ICR A;  1UT5 A;  5AK5 A;  9ICU A;  3V6J A;  3QE9 Y;  2NRV A;  3FDS A;  1NNL A;  1BNP A;  1PK1 A;  2GO7 A;  3KOO A;  4PL2 A;  5KG4 A;  3H0L B;  4OCZ A;  4QZG A;  1URJ A;  5KFF A;  1RG6 A;  4DL5 A;  1ZQW A;  3L5K A;  5AI8 A;  2HOI A;  2IHN A;  2QLT A;  2PXI A;  1XSL A;  5CEH A;  4UB3 A;  1MN8 A;  5AIA A;  5AKX A;  2R8H A;  3WK5 A;  1L3V A;  4JV2 A;  8ICQ A;  5ALP A;  4B9S A;  4ECW A;  4J9P A;  3RJJ A;  2WF5 A;  4UAU A;  5DQH A;  5JUM A;  4EBC A;  2KZZ A;  2FLL A;  2FPK A;  4KLL A;  4IR1 A;  4US8 A;  3SEI A;  4BGD A;  1ZQE A;  2MAX A;  1JN3 A;  1JXE A;  4EYH B;  2H3Z A;  4CE6 A;  2W9B B;  5EWG A;  4UB6 U;  4DOC A;  2W8L A;  3C28 A;  4P0Q A;  4F71 A;  5ALV A;  4DS5 A;  1ZJN A;  2IMW P;  3PX0 A;  3JPO A;  5DBB A;  4UAZ A;  2YMQ A;  5D46 A;  2ZIW B;  4NL9 C;  3PY8 A;  4F50 A;  1S97 A;  2DPJ A;  2WB1 C;  9ICX A;  5KFN A;  3CP8 A;  1D9D A;  1WCL A;  5AM4 A;  4I28 A;  3HPO A;  1S8O A;  2JHD A;  2LYH A;  3C5F A;  4FFD A;  5J8Y C;  1Q8K A;  2P6U A;  4ICA A;  4YQW A;  1SZP A;  2C22 A;  2KV2 A;  2K4H A;  8ICN A;  4OJ6 A;  2R8G A;  5A0L A;  2DFL A;  3RB3 A;  5J0R A;  1RDF A;  4I2C A;  4F5Q A;  3PST A;  4Y2U A;  1SL0 A;  5AI6 A;  2HHS A;  2JV3 A;  5KFL A;  4Y2S A;  2F8K A;  4PHD A;  3ED5 A;  3U26 A;  3IG8 A;  2KKP A;  3ZI4 A;  4TQR A;  1KFS A;  4O3N A;  3IN5 A;  3JPN A;  4YD1 A;  5E79 U;  4C7Z A;  3CNH A;  2NO5 A;  5KG2 A;  2F8L A;  2QB0 A;  9ICS A;  4BUG A;  2PKE A;  5KFK A;  4DWI A;  4TUR A;  4EBD A;  4Z6D A;  4B9V A;  2JZB A;  2ASJ A;  3IG5 A;  1ECW A;  4RQM A;  1WYG A;  2JRZ A;  2KSO B;  3MGV A;  3I28 A;  5ALN A;  2RHF A;  2DUY A;  4ACO A;  2KIV A;  3BJY A;  3RBE A;  4KTQ A;  2FI1 A;  2JR5 A;  4UAR A;  2AGO A;  1QQ7 A;  1U4B A;  1QQ6 A;  4XRH A;  3RB6 A;  4DL7 A;  4IQW A;  1SV0 C;  3KZX A;  3OGU A;  1TE2 A;  3T79 A;  3GDX A;  2XC9 A;  1RXV A;  4ECZ A;  3NS1 A;  3BQT A;  3RR7 A;  3F5E A;  4C8L A;  2XCA A;  3WK7 A;  4PL1 A;  5AKI A;  3OHA A;  2C2D A;  1WWV A;  5ALS A;  4B9T A;  2EAP A;  2KHV A;  1SGG A;  3UQ0 A;  1IM4 A;  4DFM A;  1SB3 C;  1QSY A;  4NV0 A;  1OUQ A;  4GFJ A;  4DCC A;  3TAD C;  2AQ0 A;  4ED2 A;  1COO A;  4XUS A;  2G09 A;  2BR0 A;  2XID A;  1EXN A;  4K4I A;  5KG6 A;  4GIB A;  2ZUB A;  4XQ8 A;  5IIN A;  4MFC A;  4QZF A;  4F5P A;  3LWL A;  1ZQZ A;  3E0F A;  4RQ1 A;  4DQI A;  5AM0 A;  4FE3 A;  8ICJ A;  5ALW A;  3KBB A;  1ZQT A;  2E1E A;  4JMU A;  1HIW A;  2YMP A;  4C8M A;  4DFK A;  3SI8 A;  1DK2 A;  1ZXI A;  4ECX A;  1TVA A;  1CI4 A;  3OJU A;  1NKE A;  4KN4 A;  2NRT A;  1CRX A;  1ZQQ A;  4KLI A;  3K4G A;  2M0N A;  5KFB A;  3Q8K A;  4YFK A;  1FFV A;  4RUA A;  9ICQ A;  4UW9 A;  3BZK A;  4PHP A;  4DLG A;  2K8C B;  3T5K A;  1PZN A;  2OM6 A;  3FC4 A;  1LKY B;  1A77 A;  3SAH A;  3UXP A;  2CN1 A;  4I2E A;  2KZ3 A;  4KLE A;  2YB4 A;  2H5X A;  1BPE A;  2MSN A;  1NK5 A;  3IV6 A;  2LI6 A;  1PK3 A;  5J2G A;  3ZD8 A;  1CEZ A;  4QIW F;  2EAM A;  2EQY A;  2MUT A;  1JUD A;  1ZQG A;  3I1Y A;  5GTH U;  3QXG A;  3KHH A;  3RJK A;  5J0Q A;  3RJH A;  7ICU A;  2ZTE A;  5J0X A;  1AQ6 A;  2R8I A;  5KG5 A;  2PMZ C;  4KLG A;  3PO5 A;  1L3T A;  5AI5 A;  3VC8 A;  2W3R A;  5ALT A;  2FJ6 A;  2A1A A;  2ASD A;  1D9F A;  2FLP A;  3TAC B;  5AIB A;  1VLB A;  4JV1 A;  1KSP A;  5B66 U;  4PZO A;  2XGQ A;  2EZZ A;  1UPH A;  3MDC A;  4EEL A;  5C5J A;  4DSK A;  4NLN A;  2NRW A;  3CRX A;  1DGJ A;  4MHV A;  3NVY A;  5L1L A;  4F4K A;  5L1I A;  3H40 A;  1PUZ A;  2YML A;  2AJQ A;  4NLC A;  4Q8E A;  3ZDA A;  3WKB A;  2IOF A;  7ICJ A;  1NK0 A;  3SR6 A;  4KLM A;  3Q8Q B;  4IRD A;  4NL9 A;  5CWR A;  1K1Q A;  4MF2 A;  4KIT B;  4UBB A;  2I9G A;  2BCV A;  5KT5 A;  2LMR A;  2G06 A;  2BQ3 A;  3S6J A;  4ED3 A;  5AM2 A;  3JPP A;  1TKD A;  5J8Y A;  2NO4 A;  4I2J A;  4B9U A;  5ALD A;  2A19 A;  3H4B A;  2JH1 A;  2RDI A;  1QSS A;  3M8R A;  2KJ8 A;  3C5G A;  4J9R A;  2QAR B;  5ALF A;  2W9B A;  3UM9 A;  3BQ2 A;  1RYR A;  5HP4 A;  2YX8 A;  4ECV A;  4M0A A;  3WK4 A;  4UB2 A;  3OTQ A;  1V38 A;  4NLK A;  5AI4 A;  1XSN A;  2BDP A;  4Z6F A;  3TFR A;  2ZIW A;  1N62 A;  4PPX A;  2XI9 A;  4QWA A;  1ZQS A;  4P0P B;  2KTQ A;  2F1I A;  3HP6 A;  3IRU A;  4KX3 A;  5AK3 A;  3UMB A;  1ZQN A;  9ICT A;  2ZJ5 A;  5KFT A;  9ICE A;  4O3O A;  4F93 B;  4O3P A;  5KNI A;  3OSP A;  4QWD A;  8ICS A;  5ALJ A;  1F0M A;  1O03 A;  3NVW A;  4DFP A;  4ECU A;  8ICK A;  5ALM A;  3GFK B;  1Z3E B;  4UAT A;  4JB3 A;  4DQQ A;  1XC9 A;  5AKH A;  1NJX A;  3G6Y A;  3KFU F;  3FM9 A;  2KHQ A;  1SV0 A;  2W8K A;  1DXS A;  3EPI A;  2Q0Z X;  3MBY A;  2M9N A;  1D8L A;  3LK9 A;  3ICX A;  4ELT A;  1QCK A;  4YMM A;  4OJL A;  2PFN A;  1TAQ A;  4B6J A;  7ICG A;  4I2G A;  2OYY A;  7ICO A;  2FPL A;  2W54 A;  4YXM A;  1JIH A;  3K75 D;  2ASL A;  3T5L A;  4UB5 A;  1L7M A;  4FZL A;  2KSO A;  3TFS A;  1F5S A;  3N7R C;  2LBO A;  4KLT A;  9ICO A;  4HYK A;  3QZ7 A;  3ISC A;  3QU2 A;  1SXD A;  1ZQY A;  1T3Q A;  1U49 A;  1N56 A;  5KG7 A;  2KVC A;  3V72 A;  4GXJ A;  3C2L A;  2CPR A;  4J9L A;  2KOB A;  3GIJ A;  4RQ3 A;  3N4M B;  1Q3V A;  1JXL A;  8ICF A;  2HMX A;  2I1Q A;  4F8R A;  3WK9 A;  1RM6 C;  1BPX A;  4J9K A;  2JMG A;  2FDR A;  5AKG A;  5KFG A;  2UVW A;  5KG0 A;  4AYB F;  3BQ1 A;  5G5H A;  3DV9 A;  1S0M A;  2ATL A;  3C1Z A;  3O0F A;  1ZQH A;  4PHA A;  2YQE A;  1UT8 A;  2HI0 A;  5DBA A;  4DO9 A;  5IIM A;  4GC6 A;  2EZX A;  3H8M A;  3RH5 A;  1QQ5 A;  3KZI U;  3D2Q A;  1LB2 B;  3GQC A;  3HRD D;  2E3T A;  5F9N A;  3GV8 B;  4ED1 A;  4Y2Y A;  3PX4 A;  2A3V A;  5KFC A;  4NJ8 A;  4C4R A;  2F2A B;  2O6K A;  4RU9 A;  4UB8 U;  4FO6 A;  4NY8 A;  1IXR A;  4QWC A;  4RQ8 A;  3Q8P B;  1YZ6 A;  1COK A;  4NLZ A;  4MFF A;  1TK8 A;  4JK1 A;  1XNS A;  9ICR A;  3ISB A;  1ZQ1 C;  5DLG A;  2ZIU B;  2WB1 F;  3WKA A;  3NRW A;  1WWU A;  2K4P A;  1LKY A;  9ICL A;  3BS5 A;  1B43 A;  4B9M A;  1DK3 A;  4Y2Q A;  4EYI B;  2BPG A;  2KMD A;  4RNN A;  3Q8R B;  1KFD A;  5AKJ A;  5ALK A;  1A76 A;  4I27 A;  3GU3 A;  2ZIV A;  5DQG A;  2WF8 A;  1NOM A;  4RQ0 A;  4RNO A;  3SAF A;  4I2B A;  2DKX A;  3RRH A;  1Z1B A;  2ZXH A;  5KT2 A;  5ALG A;  7ICT A;  4ECT A;  2F3N A;  3ORY A;  4P2H A;  2XCP A;  2MU2 A;  1N61 A;  4IL6 U;  1NJZ A;  1ZQF A;  2JXJ A;  2Y0S C;  1OW5 A;  2D6F C;  4F4X A;  1BNO A;  2B21 A;  1NK8 A;  4R65 A;  1L6N A;  2W7O A;  5L9X A;  1ZQC A;  7ICE A;  2H3V A;  4CRX A;  1RYS A;  5L1K A;  3TAQ A;  4DSL A;  1ZQK A;  1TV9 A;  8ICP A;  1NKC A;  3PW5 A;  2K60 A;  3G6V A;  2HOQ A;  2HVH A;  2EDU A;  1KEJ A;  2OHF A;  2JH7 A;  2JGA A;  1S0V A;  2WF9 A;  3PZP A;  9ICN A;  1ZOL A;  3ETR A;  1S10 A;  3H4D A;  1X6I A;  3MR5 A;  2KKV A;  1Q3U A;  4O0I A;  4DFD A;  1J2M A;  5KG1 A;  2HOF A;  3OSN A;  1SKW A;  2KEY A;  3C21 A;  5BOL A;  5AHX A;  2XY6 A;  4FZN A;  2UVV A;  3LVW A;  2L5Y A;  4P4O A;  9ICF A;  2E8P A;  1ZQV A;  2WAQ C;  5KAI U;  4F5N A;  5F3X B;  3V7K A;  1ZQA A;  1Z19 A;  1P7D A;  2LHT A;  1D8Y A;  2F44 A;  1ZQI A;  3BZC A;  2HHW A;  3AU6 A;  2QAR A;  1MQ3 A;  4F2S A;  4Y2R A;  2R8J A;  5EWF A;  1NK7 A;  1BPD A;  3H8S A;  4IRK A;  1V9P A;  3C23 A;  3HKZ F;  2B0C A;  2W9M A;  2VA3 A;  1NJW A;  2ZJ8 A;  2FMS A;  1XO1 A;  2XVT A;  2IA6 A;  3MFH A;  3EZ5 A;  4P0P A;  3G6X A;  3NTU A;  8ICE A;  2YTU A;  3T3F A;  1BPB A;  3DDH A;  4CGZ A;  1T7P A;  3F5A A;  3LYS A;  3HT3 A;  2AGP A;  2HHQ A;  1DGS A;  3M7D A;  4KLQ A;  1FEZ A;  4DOB A;  5CB1 A;  1L7N A;  1X66 A;  4DF8 A;  4BJQ A;  2P6R A;  3QU4 A;  2OEH A;  3IDW A;  1X40 A;  1B4F A;  1K5O A;  4RQ6 A;  4Y2V A;  2W43 A;  1U45 A;  4KLF A;  4B9L A;  5KFR A;  1ZD4 A;  5ALI A;  5KFV A;  4KLH A;  2B6G A;  4E0D A;  3F2D A;  3UPQ A;  2BKE A;  2IBK A;  4QZH A;  4YG2 A;  2ALZ A;  1PVQ A;  3IP4 B;  5KTQ A;  2A1J B;  7ICS A;  3KKA C;  3TAP A;  1ZD3 A;  5IIK A;  8ICA A;  4OJP A;  8ICL A;  2LYB A;  3FAH A;  2XY7 A;  4CCH A;  5JU5 A;  3SD7 A;  4ZOH C;  2W7P A;  3MR3 A;  2W04 A;  8ICX A;  1JRO A;  5ALO A;  3IHQ B;  4O3M A;  1N63 A;  2PMZ F;  1O08 A;  3HW8 A;  1NZB A;  5J2J A;  5KT6 A;  3RJI A;  1DOQ A;  5AKY A;  4Q8F A;  1SZH A;  4JV0 A;  4EX7 A;  4F3O A;  1UA0 A;  3D2N A;  3GV5 B;  8ICZ A;  1X9M A;  3PMN A;  4K4G A;  1C20 A;  2AHO B;  4BX9 C;  5G5G A;  4BXO B;  4G3I A;  1ZD5 A;  2W9C B;  4FBU A;  1B22 A;  3HJE A;  4US9 A;  3BQ0 A;  2FE9 A;  3AUO A;  4RPZ A;  1ZRN A;  1XS9 D;  4FS1 A;  5HR7 A;  2W9A A;  4RQ2 A;  4J9N A;  2Y1I A;  5KT7 A;  2HVI A;  4EBE A;  3K1Z A;  3QU7 A;  2HHT A;  4RNM A;  3J81 j;  1TK0 A;  2AXT U;  4A8E A;  3TI0 A;  3UXN A;  3NAS A;  4C80 A;  5ALX A;  1S76 D;  3NVV A;  1RQN A;  4NM2 A;  9ICG A;  5AKE A;  1PK1 B;  1U47 A;  3PSF A;  4I2D A;  3D6J A;  4J03 A;  1Z00 B;  3UXO A;  2KIC A;  3ALR A;  5J2F A;  7ICI A;  2E1F A;  3M9O B;  2WF7 A;  2ZIX A;  8ICC A;  3EWA A;  5J0U A;  4C8O A;  9ICK A;  3V6H A;  1N5W A;  1SL2 A;  4IQU A;  4U7C A;  4DSE A;  3TKA A;  2RP5 A;  5IIJ A;  5J0T A;  2DF4 B;  2KD1 A;  7ICH A;  7ICV A;  3T5H A;  4CF5 A;  3MDA A;  4DLE A;  2KJ5 A;  1F44 A;  5CA7 A;  3HWT A;  4C7Y A;  4MEY A;  1FIQ A;  2HW3 A;  1MQ2 A;  2KFZ A;  3VCB A;  1IIP A;  4YCX A;  1YZ7 A;  3M9N B;  2HDO A;  3AEV A;  3BQ7 A;  4DL4 A;  2ESE A;  4DL2 A;  3Q8L A;  2YMM A;  1S5L U;  5AM5 A;  4YR2 A;  8ICW A;  4G9B A;  4RQ4 A;  4EEN A;  2VKQ A;  3Q8S B;  4EX6 A;  2VJ5 A;  4MEX A;  4CDG A;  4GXI A;  5B5E U;  1N2X A;  4IR9 A;  2HBM A;  4DOA A;  4RPY A;  2MA1 A;  1X42 A;  4QIW C;  3ZDE A;  4DS4 A;  2JEI A;  3KHR A;  5KT3 A;  1FFU A;  3WK6 A;  5KFU A;  2BQR A;  2BCR A;  5F9L A;  2KVS A;  2RQ5 A;  4I2F A;  1ZD2 P;  2N1R A;  4NM1 A;  5HNK A;  2Z7J A;  2E5S A;  2JEF A;  2PI4 A;  4Y2J A;  8ICB A;  5DG8 A;  2DBY A;  2V4R A;  3E58 A;  1XSP A;  2LM4 A;  3HIL A;  3RF9 A;  2NRZ A;  2CRX A;  1A0P A;  2D3D A;  1ED1 A;  2C28 A;  2VA2 A;  2UVR A;  2JZB B;  4LJX A;  5DB7 A;  1ZQD A;  1XO0 A;  4M04 A;  2J6S A;  2Y9T A;  4PJ0 U;  2G07 A;  5J29 A;  4F72 A;  2IHM A;  3UMG A;  3ZDD A;  1X9S A;  1XWL A;  1ZRM A;  3ONN A;  4QZA A;  2FLN A;  2AQ4 A;  5DG7 A;  2KJ9 A;  2PFQ A;  2R8K A;  5EE3 A;  3WKE A;  4XA5 A;  1FO4 A;  4PZN A;  4YP3 A;  4WJ3 B;  5DDY A;  5KAF U;  1QTM A;  2F1H A;  5KFX A;  3RB4 A;  9ICM A;  4TUQ A;  4EZ9 A;  3M1Y A;  3KKA A;  2LM1 A;  4DSF A;  4LVS A;  1L3S A;  4F92 B;  5DBC A;  3MR6 A;  3TAD A;  1KLN A;  1X9X A;  1UA1 A;  1ZJM A;  4DQR A;  1T94 A;  2HHV A;  4ECS A;  2VIX A;  2I6X A;  4NXZ A;  2NRX A;  5DB6 A;  4CF3 A;  5BOM A;  2DGZ A;  1HUO A;  4IS7 A;  5J0O A;  4PGX A;  4OO1 J;  3LDA A;  7ICP A;  4QZB A;  3JPS A;  4Y2P A;  5L1M A;  4J9M A;  3V6K A;  4QZC A;  4UQG A;  5AKK A;  4I2A A;  4MF8 A;  1D8B A;  1HEK A;  2HBJ A;  1BVS A;  3LVV A;  5T14 A;  2E8M A;  1KL9 A;  3C2K A;  9ICW A;  2G08 A;  5AK4 A;  1VJ5 A;  3ZD9 A;  5J2C A;  4BWM A;  4M2Y A;  3D2S A;  2GH1 A;  2WTF A;  2EAO A;  1TK5 A;  5DGB A;  1QLN A;  2RDJ A;  4HAI A;  1KRP A;  5KFI A;  8ICR A;  1HJP A;  1T8E A;  3QUQ A;  5J2H A;  4MFA A;  3I76 A;  9ICI A;  9ICJ A;  4BXO A;  1ARO P;  2VJ4 A;  2W9C A;  2YN4 A;  4BWJ A;  3RAQ A;  1U48 A;  1J2N A;  1K1S A;  1KFT A;  4Q44 A;  3OPX A;  2YY6 A;  3RTV A;  3NGD A;  3QEA Z;  5CR0 A;  3OHB A;  4C4T A;  5DB9 A;  9ICA A;  1U9L A;  1RZT A;  4KMU A;  5J0W A;  4RQ5 A;  1DRG A;  2K4I A;  2MRL A;  3RAX A;  1PVR A;  1S77 D;  3M8S A;  1MSW D;  3H0R B;  4YD2 A;  2HSZ A;  4C4S A;  5KFW A;  4GC7 A;  2K8B B;  4F4W A;  2WAQ F;  5EE9 A;  4TUP A;  3SV3 A;  4R63 A;  2HHU A;  5JTI A;  3NUQ A;  1ZQL A;  4C8K A;  1KTQ A;  1KN5 A;  4ED7 A;  8ICT A;  3MC1 A;  1Z00 A;  4AYB C;  4U6P A;  3Q8M A;  3RJE A;  3UMC A;  4QWB A;  5KFS A;  1NK4 A;  4UAY A;  3QX7 A;  1L8O A;  2K89 A;  1SWW A;  5III A;  3JPT A;  2OXO A;  5GTI U;  4M9H A;  5HR6 A;  3C2M A;  4RUC A;  3L4P A;  5KFJ A;  3PW2 A;  5C0Y A;  3SMV A;  3PR4 A;  4NLB A;  2FMQ A;  4RQN A;  4R64 A;  5ALH A;  4UAV A;  5KL1 B;  1N5X A;  4K4H A;  2W3S A;  3H7I A;  3DEE A;  1LV5 A;  4CF4 A;  3A0B U;  4J9O A;  2C2E A;  4R8U B;  4KLD A;  3RFA A;  3C29 A;  2P66 A;  5J2I A;  1ZQP A;  2F76 X;  2J6T A;  2W55 A;  4PGY A;  3QYP A;  4KLO A;  4KX5 A;  5TZV A;  4UAS A;  4M9G A;  3JPQ A;  2JEG A;  2GWS A;  3PV8 A;  5AI9 A;  5AK6 A;  2RLT A;  4J9S A;  2KN7 A;  5EE1 A;  5J0S A;  4USA A;  5HHI A;  5TIS U;  2NV3 A;  2G0A A;  4GLX A;  4ED8 A;  3THV A;  2V9W A;  4QWE A;  4P4M A;  3RRG A;  4FS2 A;  5J0Y A;  3EYZ A;  2P35 A;  3ISD A;  2CXY A;  3GV7 B;  2G5H B;  4DF4 A;  2KP7 A;  2H3F A;  2H3I A;  4B9N A;  1KBU A;  2OWO A;  2R18 A;  2XIC A;  1X2I A;  2J6U A;  3F2C A;  1JX4 A;  4ECR A;  3MGI A;  2BQU A;  3V7L A;  1XU4 A;  4Q45 A;  2ZXI A;  2KFN A;  1L3U A;  3SYZ A;  3IM1 A;  4QZE A;  2KG5 A;  4UBC A;  4R66 A;  2C2R A;  1Z4N A;  1C7Y A;  4RT2 A;  1JMS A;  2BHN A;  3N7P D;  1ZYQ A;  5KFH A;  4EEY A;  8ICH A;  4FZM A;  4DEZ A;  2PFO A;  4RT3 A;  2BGW A;  3NRZ A;  1M6Y A;  5ALR A;  5AI0 A;  2JEJ A;  2VAN A;  2GLE A;  3AN1 A;  4M6W B;  4QZI A;  3KHG A;  3FYH A;  5KFZ A;  2XGP A;  3CW2 C;  3PW7 A;  1L7O A;  1ZQX A;  3B0X A;  3WU2 U;  1T3N A;  7ICL A;  2ZTD A;  8ICV A;  3HX0 A;  3RH6 A;  5EOZ A;  4KN7 A;  4Z6C A;  2W11 A;  5EE0 A;  2HBL A;  3R9K A;  4EEK A;  3TAR A;  1TAU A;  2FMP A;  4JUZ A;  3PW4 A;  4QJF B;  5J2E A;  1BPY A;  2ODG A;  4KMO B;  4IC9 A;  4F4Z A;  2K4E A;  3ZDC A;  2D8C A;  3ETL A;  4F5O A;  2VA8 A;  2BPC A;  2ISP A;  8ICY A;  1Z1V A;  3PVX A;  3HKZ C;  7ICQ A;  2DL0 A;  4ELV A;  2KNJ A;  3V7J A;  4ECQ A;  1X9W A;  4QZ9 A;  4IRC A;  2HHX A;  4TUS A;  4OJ5 A;  5K4L A;  1RPL A;  1NK9 A;  2K8A A;  5AM3 A;  1TFR A;  4I29 A;  4Q43 A;  4AP9 A;  2ZTC A;  7ICN A;  5J2K A;  4M47 A;  2PFP A;  1LVH A;  2E8O A;  4DSJ A;  4YR3 A;  3F2B A;  5L1J A;  1B0X A;  3E2E A;  2KK0 A;  5KFY A;  2KIW A;  3AQE A;  5CJ7 A;  1L8L A;  1NI3 A;  2W03 A;  1HUZ A;  1SXE A;  4PH5 A;  5HHH A;  3AL0 B;  2BPF A;  1OXJ A;  1IG6 A;  3GIK A;  3TAN A;  1ZQU A;  3SZ2 A;  4X5V A;  5AIC A;  3BS5 B;  4O5K A;  4CNQ A;  2ISO A;  4YMN A;  4J9Q A;  4YXJ A;  2ZIV B;  4ED0 A;  2PI5 A;  5DLF A;  4KLS A;  9ICB A;  1UCV A;  2HBK A;  2KE7 A;  4O9M A;  1N60 A;  2WHE A;  4IQV A;  3ZDB A;  2ZIU A;  5CHG A;  3NVZ A;  4IQT A;  4YR0 A;  8ICM A;  1Z4O A;  3KD3 A;  3KHL A;  4P4P A;  2OH2 A;  9ICC A;  4C0Z A;  1MA7 A;  3MAB A;  2XO7 A;  2EAN A;  3QUC A;  1IV8 A;  1V85 A;  2BCS A;  3QNM A;  5J2B A;  2BCU A;  1QH9 A;  4O3R A;  1J97 A;  1ZQJ A;  5KFM A;  3QU9 A;  4QZD A;  3N7S C;  7ICK A;  4Y2X A;  4Y2T A;  3T5J A;  1CUK A;  2E8N A;  4P0Q B; 
#chains in the Genus database with same CATH homology
 2WB1 C;  2H3V A;  2PMZ C;  4CRX A;  4A8E A;  3CP8 A;  2KHV A;  3SQI A;  2H3F A;  2H3I A;  2MA1 A;  3NUQ A;  4QIW C;  2JHD A;  4OJ5 A;  1KBU A;  4BJQ A;  2R18 A;  3PSP A;  3VC8 A;  2XIC A;  4NV0 A;  2K8A A;  1OUQ A;  4QNL A;  4GFJ A;  1A6S A;  1WUD A;  2DGZ A;  2Q4T A;  2HOQ A;  4ICA A;  3F2C A;  2JH7 A;  3D2Q A;  3F53 A;  4AYB C;  4U6P A;  2JGA A;  2G09 A;  2KV2 A;  4OO1 J;  2N1R A;  2XID A;  4OJO A;  2W7O A;  2Z7J A;  2ZXI A;  3PSF A;  2K4H A;  2YB1 A;  2E5S A;  2ZG6 A;  3PZP A;  3L3F X;  2ZIX B;  4OJ6 A;  1UPH A;  3F2D A;  5A0L A;  2LYA A;  3F2B A;  5CRX A;  1D8B A;  1HEK A;  2HBJ A;  1PVQ A;  3E0F A;  3CRX A;  2A3V A;  3LVV A;  3PST A;  2K89 A;  3IP4 B;  4FE3 A;  3KFU F;  2KIC A;  2KIW A;  2KHQ A;  5HR6 A;  2OXO A;  4NWI A;  3ALR A;  5T14 A;  3AQE A;  3N7P D;  4PL2 A;  2W03 A;  2F2A B;  2KKV A;  3H0L B;  4NLC A;  2E1E A;  4JMU A;  3RF9 A;  1Q3U A;  5C0Y A;  1HIW A;  2BDU A;  2E1F A;  1URJ A;  3ICX A;  2ZIX A;  4NLB A;  4OJP A;  2LYB A;  4FZM A;  3SMV A;  2CRX A;  3IG8 A;  2HOF A;  2G08 A;  2KKP A;  1A0P A;  3CYM A;  2KEY A;  4OJL A;  2HOI A;  2H3Q A;  4FZN A;  1ED1 A;  3D2S A;  2GH1 A;  2OYY A;  3LVW A;  5KL1 B;  3IN5 A;  1XNS A;  2W7P A;  2WAQ C;  2W04 A;  1ZQ1 C;  4U7C A;  2ZIV B;  1XO0 A;  2RP5 A;  2ZIU B;  1CRX A;  2WB1 F;  3GZF A;  4O3M A;  2F8L A;  1Z19 A;  2PMZ F;  4BUG A;  1P7D A;  2G06 A;  2LHT A;  2M0N A;  2DF4 B;  2KD1 A;  3DEE A;  2G07 A;  1NZB A;  2HBK A;  1GO3 F;  1PVP A;  3NRW A;  1TAM A;  4FZL A;  3N7R C;  1SZH A;  2KJ5 A;  3H0M B;  3D2N A;  3RFA A;  2LBO A;  1F44 A;  2JH1 A;  2VJ4 A;  2K8C B;  3ONN A;  2OM6 A;  2Y0S F;  3GU3 A;  2ZIV A;  3C29 A;  2DQN B;  3IG5 A;  1ECW A;  2ZIU A;  2KJ8 A;  2F76 X;  3SAF A;  2F77 X;  2KJ9 A;  1Z1B A;  4KX5 A;  3OPX A;  2ZXH A;  3HKZ F;  2LKY A;  3VCB A;  3MGV A;  1IIP A;  2OH2 A;  2KVC A;  2RHF A;  4BX9 C;  2CN1 A;  2YX8 A;  2HBL A;  3SAH A;  4ACO A;  2XVT A;  4C0Z A;  1MA7 A;  2CPR A;  2YB4 A;  2KOB A;  4P0P A;  4WJ3 B;  4QJF B;  3AL0 B;  2H3Z A;  1Q3V A;  1YT3 A;  2G5I B;  3KZX A;  3M6Z A;  4KMO B;  4QIW F;  4IC9 A;  2ZIW A;  2HMX A;  2VKQ A;  3PSI A;  3T79 A;  2NV3 A;  2G0A A;  2Y0S C;  3C28 A;  2K4E A;  2RRD A;  4P0Q A;  2XI9 A;  1DRG A;  4CGZ A;  5HR7 A;  2K4I A;  2MRL A;  2JMG A;  3F5A A;  4P0P B;  3LYS A;  1PVR A;  2D6F C;  2GOL A;  2VJ5 A;  3F5E A;  3N7S C;  5KL8 B;  4CDG A;  3SAG A;  3HKZ C;  3H0R B;  4KX3 A;  4PL1 A;  4AYB F;  3K1Z A;  3AQF A;  3M6K A;  3M7D A;  1T94 A;  2ZIW B;  2G5H B;  2VIX A;  2KNJ A;  2K8B B;  1L6N A;  2HBM A;  4P0Q B;  2WAQ F;  3O0F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...