2ZIVA

Crystal structure of the mus81-eme1 complex
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
302
structure length
281
Chain Sequence
GWHLSPGSYDIVLCVDLCETTGKQELVKELQRNSVTFDVRKLNVGDFLWVARERVTPVPGQLRPPVGKELVLDYIIERKRMDDLCGSIIDGRFREQKFRLKRCGLRKPIYLVEECGSAAAHLSIPESTLQQAIVNTQVVDGFFVKRVQDAKESAAYLTIMTRYLQKLYQNCTLFCRANLSCSLMAFTEFNYGAIKNKCQTVREVFARQLMQISGVSGDKAAAVLEHYSTVSSLLQAYDKCSSETEKEKLLSSVKYGKLKRNLGPALSRTIYQLYCTRGPLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Mus81 protein
publication title Crystal structure of the Mus81-Eme1 complex
pubmed doi rcsb
source organism Danio rerio
molecule tags Hydrolase
total genus 86
structure length 281
sequence length 302
ec nomenclature
pdb deposition date 2008-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02732 ERCC4 ERCC4 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.670 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2zivA02
4P0QA 2ZIVA 4P0PA 2ZIWA 2ZIVB 2ZIXA 2ZIWB 2ZIUA 4P0PB 2ZIXB 4P0QB 2ZIUB
chains in the Genus database with same CATH superfamily
4ECTA 2BPFA 2W8LA 4M9GA 3N7RC 2YB1A 1SXDA 4PL1A 2NRXA 3G6XA 4Z6CA 4Q8FA 1QLNA 2ISOA 1COOA 4DFMA 5DBCA 1KTQA 1Z19A 3R9KA 3B0YA 3O0FA 2MUTB 1TVAA 2NRWA 3N28A 5EWFA 1WYGA 1ECWA 2HHWA 1VLBA 4I28A 5IIMA 5IIKA 4I2CA 2PKEA 3KD3A 3LK9A 3ZDBA 2OWOA 1OXJA 3ZI4A 5AM4A 2ATLA 3MABA 4M9NA 2KFNA 4I2AA 2YTUA 3N7PD 2HDOA 1ZD2P 4O3PA 4E0DA 4Y2VA 3C23A 3UM9A 4QWAA 2CRXA 3M6KA 3D2QA 1KL9A 2CXYA 3ISDA 2FPMA 4EX7A 2V4RA 4DF8A 4QZAA 4UATA 4I2GA 2KMDA 5F9LA 4ED2A 7ICSA 2KG5A 2K4EA 2AU0A 1TK8A 4YR0A 9ICAA 3PZPA 4EYIB 4GIBA 1WCLA 5J2KA 5C5JA 1DGSA 5ALTA 4Y2XA 3E0FA 2DKZA 1J2NA 4I2HA 9ICJA 5KFEA 9ICCA 1ZQYA 4F5RA 7ICOA 5AM2A 5J0WA 3SMVA 1KEJA 3ZDDA 4MFFA 3RB6A 3FM9A 1MQ3A 4IS7A 1XNSA 4WJ3B 3TANA 2W9AA 2F1HA 2PFPA 2HMXA 3H0RB 4QZFA 2ESEA 4O3OA 3JPOA 8ICQA 2BPCA 2JMGA 2HOFA 1T3QA 3IG5A 2NYVA 2KJ8A 3GQCA 5KAFU 3M9MB 4DSFA 3FAHA 5KG1A 1J97A 1QTMA 4R65A 5J0UA 1H38A 5KFUA 3NVZA 4MF8A 4J9KA 3BS5B 1ZQIA 1KFSA 2DBYA 3FDSA 2LYAA 3WK7A 2K60A 2GLEA 2F3NA 1IIPA 3NVWA 1N5WA 3IM1A 2Y1JA 3HWTA 5KFBA 3IRUA 2ZIVB 2XCAA 4YCXA 1RYRA 2GWSA 4RQ3A 1MC8A 3SV4A 3LYSA 1PZNA 3EYZA 4UARA 2AGPA 2RDIA 3DDHA 2W9MA 3E58A 5AI4A 4QWEA 3L3FX 7ICUA 5ALWA 3GIMA 4MEXA 3WKBA 2RHFA 2BCSA 2E8NA 3T5HA 3Q8MA 3G6YA 2BCQA 4C8KA 2KZMA 8ICKA 3ICXA 4Z6DA 5KFKA 1BPDA 1D8YA 1DXSA 5ALIA 4O5KA 1N2XA 3ALRA 4IQUA 5KFWA 1V38A 3MR3A 3UMBA 3QUCA 5IIJA 2RDJA 2JR5A 3RH5A 1U47A 4KLLA 5AK6A 4RQ5A 3OTQA 3QZ7A 3NGDA 2OEHA 2KN7A 2KSOA 1RYSA 1ZD3A 4DS5A 2R8KA 2HHSA 1FEZA 4Z6FA 5EE1A 3KHRA 4CF3A 2KE7A 3MGIA 3OHBA 5FP0A 4Y2UA 3QEBZ 2WF6A 4ELTA 3MR5A 2BZFA 4J9MA 3RF9A 8ICJA 2KNJA 2C22A 1RDFA 3IDWA 1S0OA 4RPZA 1YT3A 2OH2A 2ZIXA 3SEIA 2R8IA 4F5NA 2LKYA 2BDUA 2ZTCA 2KKPA 4F50A 5DB8A 2Z7JA 5HP4A 3KZXA 2G5HB 1RQNA 4NLCA 2FPLA 3LWLA 7ICIA 1BVSA 5AM5A 2ZJAA 5L1KA 1KRPA 2JEFA 2VJ4A 2P6RA 2HVHA 3PR5B 1DOQA 1MN8A 5AKLA 4ECRA 3QU2A 3PSIA 2XVTA 5L1JA 2ALZA 4GXIA 3T79A 2KV2A 2AHOB 5DG8A 1HEKA 4CNQA 4J9PA 2OM6A 1NKEA 4I2EA 3BQ7A 2IMWP 3NVYA 3GIJA 1C7YA 4G9BA 2H3ZA 3K75D 4O5EA 4OJLA 5CP2A 5DBAA 2XICA 4KLTA 1RG6A 7ICGA 1Z3EB 1XU4A 1PVRA 2XY7A 1TK5A 4I2DA 5IILA 4ED7A 3LVVA 2E1FA 5D4BA 2W03A 4AYBC 4B9TA 3WK5A 4KMOB 3PMLA 3GV8B 4P0PA 5KL8B 4KLQA 5H2FU 4DOCA 4ED8A 5DQGA 3C29A 5CA7A 2JEJA 5KG2A 1ZQAA 4C8OA 5J2JA 4DQQA 1JRPA 1RM6C 2F1JA 2Y9UA 3AM9A 3M6ZA 5EWEA 1LVHA 2PI4A 3D2SA 4AYBF 3L5KA 2ASJA 5JUMA 3A0HU 9ICVA 4F4YA 3TACB 3TI0A 1S0VA 4Y2QA 2I5HA 5D49A 1IXRA 3RRHA 3TAQA 4XQ8A 4QJFB 4KLMA 4BX9C 2IHMA 3UXOA 1ZQWA 4CDGA 1K1QA 1P7DA 1SXEA 4PHEA 3RJJA 1QQ6A 2KJ5A 1ZRMA 5ALSA 3AUOA 3OGUA 4UAWA 4NLKA 9ICOA 5J2FA 1SL2A 3V72A 3CYMA 2ZIWA 1LKYB 2J6SA 4MEYA 1JALA 4KLIA 4Z6EA 4IRCA 4M6WB 3DV9A 2E1EA 2H3IA 5KG7A 2XY5A 4ECUA 4MF2A 1LV5A 3TADA 5JRTA 1UA1A 4YMOA 2KP7A 3RAXA 4XA5A 2DUYA 5KFJA 1XSNA 2WF9A 3RB4A 9ICIA 3SQIA 2Q4TA 5J8YC 4NLBA 4M0AA 5J8YA 2HHXA 2KFZA 3EWAA 2V4QA 1UQVA 2UVUA 2W54A 8ICWA 3PW2A 2PI5A 1KDHA 3RR8A 3QX7A 2L5YA 2RRDA 2B6GA 4M9LA 3WK4A 4F5PA 2PFQA 7ICJA 2QARA 5ALDA 4HYKA 4C8MA 2VA2A 4B9MA 3GIIA 5AK5A 4G3IA 5K4LA 8ICUA 1CEZA 2K89A 1QH9A 4NWIA 4JV0A 1BNPA 3GV7B 8ICPA 2HHVA 3B9JA 3RB3A 5AM0A 4PZOA 1KKXA 3UXPA 2PXIA 4JWMA 2W9CA 3WK8A 2KZ3A 5ALUA 4I2BA 2WF8A 3CW2C 5AKGA 4BXOB 2GOLA 5KG6A 4MFCA 4M9HA 8ICYA 3V7LA 2YQEA 1PK1B 7ICEA 4DO9A 5KFSA 9ICFA 1X9WA 9ICXA 4UASA 1KBUA 1BNOA 4QZEA 4UB6U 1JROA 5KFTA 2FI1A 5EE9A 4I2FA 5KFFA 3AU6A 8ICSA 4ECWA 4EYHB 4IQVA 1SKSA 2KVSA 4UAVA 1X9MA 4JV2A 3L4PA 4RQ7A 3ETRA 4P2HA 4QZHA 1ZQLA 4O3NA 2HBMA 1GO3F 5KG3A 4LZDA 9ICSA 2C28A 1BPZA 1OUQA 3GU3A 1L3UA 2YN4A 3M7DA 1XSLA 4F91B 1TAMA 1ZQFA 5ALNA 1PVPA 3KHLA 4F5QA 1QSSA 3NTUA 4UQGA 1D8BA 1JIHA 4NV0A 5AK3A 5TZVA 2BQUA 1B43A 2LHTA 3N7SC 5KG4A 2VKQA 5DGBA 3TQ1A 5DGAA 5J2GA 4NLGA 2QKQA 4R8UB 3PV8A 1BPBA 2G09A 4XRHA 3EPGA 4KX3A 5T14A 2BQ3A 4YR3A 2JZBB 1L7PA 2MUTA 3K4GA 5AK4A 2ZIUB 1N63A 1DRGA 1D9DA 1U4BA 3RJHA 2LYHA 8ICHA 4Q43A 3Q8RB 5L1MA 7ICPA 3V7JA 1L7MA 4RQMA 2NRTA 5J0YA 1ZQVA 3IHQB 1UPHA 5ALJA 2FPKA 2HBKA 2KZZA 2NO4A 4I2JA 3EPIA 4DSLA 1CUKA 3M9NB 1HUOA 1N48A 4IC9A 5AI8A 1EXNA 3RH4A 4IR1A 3M9OB 4B9UA 2DGZA 2FMQA 2YMQA 4F3OA 5KFAA 2HBJA 4Y2YA 4QNLA 2I9GA 2O6KA 4R66A 4RQ2A 2AXTU 2C2RA 4RQ1A 4DQSA 2ZJ5A 1ZQGA 4PZNA 3UPQA 4F2RA 3AMZA 2R8GA 3QEAZ 1L5UA 1ZQXA 4F2SA 1XO1A 2K4PA 3SZ2A 4YD2A 5AKIA 1A76A 1KFDA 5KG5A 2YMLA 2G07A 3ISCA 2YMMA 5CJ7A 3LDAA 4ICAA 2XGQA 1A6SA 1FIQA 3N97B 2FJ6A 2E5SA 1S9FA 3K1ZA 1N62A 5KFIA 4NLNA 1T3NA 4UB1A 5AI6A 1RYUA 3BQ2A 2W8KA 1X66A 4RZRA 5AIAA 3NVVA 4DOBA 4Q44A 3QU5A 3BS7A 8ICAA 3ORYA 2W55A 3PW0A 1NJXA 4F4WA 1COKA 4FZMA 3F2DA 3H0MB 2RQ5A 3GILA 2KD1A 1SWWA 2K4IA 7ICTA 3BQTA 4J03A 4LVSA 5J0OA 2BGWA 2CPRA 5F3XB 1QCKA 4RNOA 2KIVA 4GLXA 5KFRA 4QZDA 4OJ6A 4B9VA 2XO7A 4DSEA 2QB0B 3Q8PB 4C0ZA 2W7OA 2HOIA 3BS5A 3KOOA 1ZQKA 2P66A 2M0NA 1T7PA 3HILA 1RXVA 3T5JA 4YR2A 4BWJA 5ALEA 1NJZA 4NJ8A 2MA1A 2ZIVA 3QZ8A 4K4HA 2FMPA 5JTIA 3GDXA 1CI4A 4QW8A 2VANA 2UVWA 1NKBA 4EBCA 5BOLA 4RNNA 3PW4A 4DLGA 4NXZA 5BOMA 4I2IA 2BCUA 3SAFA 4C8NA 4R63A 4DLEA 3PVXA 1K5OA 3NRZA 1C20A 3GV5B 8ICOA 4F8RA 2K8CB 4M47A 5AKHA 1SIJA 4ED3A 3F53A 1ZQQA 2XY6A 4P0QB 4RNMA 1B4FA 3A0BU 3RJEA 3V7KA 5GTHU 3H8SA 1N60A 4DS4A 4CRXA 2D8CA 2BHNA 5DLGA 3IG8A 3KZIU 3HW8A 1QSYA 1N5XA 2A1JA 2JH7A 2PFNA 7ICVA 3OJSA 5L9XA 4AP9A 4RPYA 2P6UA 2EQYA 1NK0A 4B6JA 2KEYA 1XO0A 4KLEA 3C1YA 3PNCA 3DEEA 5AI9A 8ICTA 3CNHA 2ODGA 5HMMA 2EAOA 2BCVA 4YVZA 4QZCA 4F71A 1N56A 1DGJA 3C2MA 3TAPA 4NY8A 2JHDA 5DBBA 2DFLA 5D46A 5AHXA 4RQ4A 3F5EA 8ICBA 1Q3UA 4XUSA 3SD7A 4UB3A 1ZQRA 3AL0B 2F1IA 2FLLA 5HR6A 1JMSA 1ZQJA 2Y9TA 2IOFA 1BGXT 2WTFA 4RPXA 5J2DA 1WWUA 3ZDAA 2FE9A 4BDPA 4FZLA 5AKZA 2NV3A 2HW3A 4ED1A 3PO5A 4DQPA 5KAIU 2ZXHA 2Q0ZX 3Q8QB 4UB4A 5ALFA 5G5HA 4ELVA 1JXEA 3MDAA 2LMRA 5KFXA 2KKVA 5L1LA 4P4MA 3U26A 1TAQA 1Z00B 4PGXA 5J2IA 1J2MA 2E8MA 2Y1IA 2MSNA 2KHQA 1F44A 2KTQA 3B0XA 4PPXA 3IP4B 2FMSA 4KLOA 3M8SA 2LYBA 1X42A 1L8OA 1T4GA 3BJYA 3F5AA 5J0SA 1SB3C 9ICKA 2UVVA 3QXGA 5KT6A 4CE6A 2G08A 4YFKA 3C5FA 1NZBA 1JXLA 2G5IB 1XS9D 2JEIA 1U45A 3CRXA 9ICUA 2B0CA 4KLDA 2WB1C 4O9MA 3RBDA 4B9NA 3OHAA 4QWDA 2D3DA 1X6IA 1XWLA 1XSPA 4UBBA 1ZQHA 1Z1BA 3NRWA 3AEVA 4F93B 1UT5A 4TUPA 3MFIA 4QIWC 1NI3A 5AKKA 4CF4A 1WWVA 4DL3A 4PHAA 4ECQA 5HHIA 2KHVA 2WB1F 1O03A 4DSKA 1TAUA 3GZFA 1ZRNA 4O3SA 1QSLA 3WKCA 2KOBA 2XI9A 3T5KA 5J2AA 2WHEA 4QZBA 3FYHA 3JPNA 4O3MA 3N4MB 8ICGA 4QIWF 4J9QA 2H3FA 3BQ0A 3C21A 3TADC 1NK9A 1U9LA 2LBOA 3WKAA 5J0PA 5KFYA 4ZH4A 4RQNA 2VIXA 4J9RA 4EEKA 5A0LA 4M6WA 4KN4A 4I29A 1S97A 2BKEA 2H3VA 5ALHA 5KFHA 2F77X 5KFDA 4A8EA 3RRGA 1TFRA 3C1ZA 4GC6A 4DSJA 5EE3A 4YMMA 3LVWA 3Q8KA 4QZ8A 2W3RA 2YX8A 4YQWA 7ICMA 3SAHA 4YD1A 1L3VA 5J2EA 3VCBA 3TKAA 5KFLA 5KFMA 4C8LA 5ALYA 4TQSA 1ZETA 7ICRA 1NJWA 4UAYA 3QUTA 4J9SA 1ZQOA 3SYZA 1S0NA 3KKAC 1MSWD 3BQ1A 2EZYA 4DWIA 1Q8KA 3C5GA 3KKAA 4EZ6A 3PX4A 3H8WA 2WFAA 3WK9A 3V6HA 2IA6A 3KTQA 1WG8A 3MBYA 2IBKA 5B66U 4ACOA 4M04A 5KT4A 2W9BA 3H4DA 1TKDA 3HJEA 4B9SA 2BPGA 1V97A 4ZOHC 4RQ6A 4GXKA 2A3VA 4IQTA 3JPPA 3PO4A 3PY8A 2ZTEA 1S8OA 4EELA 5IIOA 4DL7A 2W3SA 1NZPA 2BQRA 4PL2A 5G5GA 4C4SA 1SGGA 4U7CA 5GTIU 5HR7A 1UHUA 2IOFK 3Q8SB 1D9FA 2ZTDA 2JRZA 3QNMA 5HHHA 1V9PA 3WK6A 2EAMA 4BXOA 2K8AA 4C4RA 1ZQDA 1ZQZA 1L7NA 5BPCA 1L3SA 4KLFA 1SZPA 3MDCA 1ZQBA 5KT7A 1PK1A 4RUAA 4QZGA 5ALZA 3IV6A 8ICLA 4KLHA 2AJQA 4KITB 3CP8A 1Q3VA 5CRXA 2HSZA 2IOHA 4K4GA 2YMPA 3MR6A 2E8OA 4NL9C 2BCRA 4USAA 5HMLA 4KLGA 4NL9A 5TISU 2HBLA 4IL6U 4KN7A 8ICVA 5J2BA 2E8PA 1ZD5A 2A1AA 4FS1A 3C28A 1SZHA 4LZGA 2KVCA 2ZUCA 3TFRA 5J2CA 2DF4B 3PW7A 3SR6A 3LWMA 5EWGA 4Q45A 9ICTA 2KJ9A 1ZQ1C 4FS2A 1T8EA 3HKZC 4ECYA 5IINA 4F4KA 2RLTA 3AQEA 9ICPA 2DPIA 4O3QA 1L6NA 4PHDA 4DFDA 2EZZA 3K1RB 1B0XA 4R64A 3GFKB 3TFSA 5DQIA 5AKXA 5ALRA 1T94A 5ALPA 3OSNA 4R8UA 4BGDA 2C2DA 5ALXA 3RTVA 3PMNA 3AU2A 2FDRA 3HKZF 4UB2A 4OJOA 4EEYA 3PX0A 2JZBA 3QU9A 3RJGA 2G0AA 4EBDA 3KHHA 2ZIUA 5C0YA 4OCZA 2XC9A 3OSPA 3RH6A 2K4HA 3D2NA 5AKJA 2LM1A 2ZUDA 3SENA 5AI0A 1ZQSA 4RUCA 9ICMA 4ELUA 4UBCA 2OXOA 3OPXA 8ICXA 3H0LB 5AICA 1RQLA 2N1RA 4LJXA 3ISBA 1FFUA 4O0IA 2WF5A 1ZQEA 1TK0A 4Y2SA 4ED0A 2VJ5A 3AN1A 2GH1A 2NRZA 3AQFA 1V85A 1DK2A 4FE3A 3PW5A 3H8MA 1LB2B 3RAQA 2GO7A 2XIDA 4X5VA 2OHFA 3WKEA 1U48A 2AGOA 7ICQA 4YXJA 2HHQA 1ZYQA 1PUZA 3MGHA 1FO4A 3MR2A 3RB0A 4BUGA 5AM3A 4BWMA 2ES6A 1ZOLA 4FBTA 4DL5A 4ECZA 1TE2A 1KFTA 1S10A 5ALVA 4JK1A 3OJUA 4OD0A 2ZXIA 5DDYA 4GC7A 1KW4A 4OJ5A 5F9NA 2R8JA 3H7IA 2ZUBA 2R18A 2EZXA 2FLPA 2B21A 4JV1A 4P4PA 4QW9A 1BPXA 2JEGA 4JWNA 5E79U 1S0MA 2LI6A 1BPEA 2DL0A 2EANA 1M6YA 3H4BA 3Q8LA 5KFCA 4PGYA 4KLJA 1KQQA 3QU4A 5DKWA 8ICFA 5KTQA 2ASLA 2F44A 3MGVA 3ZDEA 3V6JA 4JUZA 4PH5A 1JUDA 4KTQA 3E2EA 4F4XA 3M8RA 4DCCA 4I27A 1HJPA 1NK7A 2XGPA 4CF5A 4YXMA 3PSPA 1A77A 4UAUA 3QYPA 1MQ2A 2CN1A 2QB0A 2W11A 1RPLA 2A19A 2IHNA 1URJA 1B22A 3JPRA 5KL1B 3UMCA 1RZTA 1KSPA 3BZCA 4CCHA 1NNLA 4F72A 5ALQA 5ALMA 2KICA 1XC9A 3MFHA 1CRXA 3G6VA 3UQ0A 5J0RA 1SWVA 3M1YA 1YZ7A 4PGQA 4DQRA 2F76X 8ICRA 3HX0A 4JMUA 4F5OA 5L1IA 5KFGA 1IM4A 4IRDA 1VJ5A 5KFQA 3I28A 4YP3A 3ETLA 1UA0A 4KLUA 3HRDD 3QUBA 5ALOA 2PFOA 5KT5A 2V9WA 4EENA 5AKYA 4NM1A 2HHTA 2KSOB 1BPYA 4UB5A 2DWQA 4P0QA 9ICBA 1X2IA 2JGAA 2A1JB 1ZQNA 2WAQC 2HHUA 5KFOA 1SKRA 4K4IA 2UVRA 3EUB2 4EZ9A 4OO1J 4OJPA 3H40A 4DL6A 1PVQA 1X9SA 4B9LA 3C2KA 4J9LA 1VDVA 2G06A 5AM1A 3JPTA 4NM2A 2YY6A 2R8HA 4DOAA 5DG7A 5DQHA 4QZ9A 3HP6A 3KFUF 4C80A 4TURA 1ZXIA 4US9A 3THVA 2WAQF 1NJYA 2XCPA 2ZIXB 2M9NA 4O3RA 3EW9A 1KN5A 1UT8A 4PHPA 5AIBA 5B5EU 2HCFA 4JB3A 5DB6A 5KFVA 2H3QA 4TUQA 3RFAA 1IV8A 2ISPA 5CR0A 5DB7A 3GIKA 5EOZA 2D6FC 4UW9A 3KBBA 2MRLA 3SV3A 3TARA 1QQ7A 4US8A 1N61A 1S5LU 2J6TA 3T3FA 1F5SA 9ICLA 1SL1A 3ONNA 5ALGA 5KFZA 5J0QA 4KMUA 2ZJ8A 5J29A 2H5XA 2AGQA 1JX4A 3JPQA 1ZQUA 4QWCA 2DPJA 9ICEA 2I1QA 1U49A 5DDMA 4DF4A 4ECSA 1NK6A 3QU7A 2ASDA 2AQ0A 2P35A 1DK3A 1NKCA 9ICWA 1SL0A 1HUZA 2JXJA 2QLTA 2E3TA 5CEHA 1OW5A 1FFVA 1QQ5A 1AQ6A 2W43A 2RP5A 1Z00A 7ICKA 4YN4A 1PK3A 5CB1A 2BDPA 3EZ5A 2DQNB 4Q8EA 5DLFA 2KIWA 4P0PB 1S76D 2WF7A 2FLNA 3NS1A 3I76A 2VA3A 4GXJA 3NASA 1WUDA 2F8KA 4QWBA 1Y88A 1MA7A 4FO6A 4FFDA 5EE0A 1ZD4A 5ALLA 7ICFA 1SV4A 1K1SA 4TQRA 4IR9A 3PSTA 2NRVA 5AI5A 2VA8A 4KLSA 3ZDCA 5HNKA 2EH9A 2MAXA 1ZQCA 3RR7A 2MU2A 1ZQPA 5CHGA 5KFNA 4RT2A 4DL4A 2F8LA 1Z4OA 2YB4A 5J0TA 4Y2JA 1A0PA 3WU2U 4F4ZA 3QUQA 4YG2A 3IN5A 1YZ6A 5IIIA 4RU9A 7ICLA 4BJQA 4DSIA 3UMGA 3ZD9A 4DFKA 5AKEA 2ZIWB 3F2BA 2AQ4A 2C2EA 4UAZA 1NK4A 4RQ8A 1Z4NA 8ICIA 4M2YA 4KX5A 3MC1A 5KG0A 3BZKA 3S6JA 1X9XA 4J9OA 1LKYA 2NO5A 3JPSA 4RT3A 4YMNA 3ZD8A 5DB9A 3F2CA 1JN3A 3PSFA 4UB8U 4GFJA 3I1YA 3KHGA 1SV0C 4EX6A 4C4TA 1NK5A 2HOQA 3J81j 1SV0A 1HIWA 1ZJNA 2QB1A 1F0MA 1Q46A 4C7YA 2JV3A 3C2LA 8ICZA 4U6PA 1UCVA 8ICCA 2JH1A 5ALKA 3D6JA 2ZG6A 2EAPA 1AROP 4MFAA 3NUQA 4IQWA 1ZJMA 7ICNA 4DQIA 2Y0SC 4Y2PA 9ICGA 2K8BB 2QARB 3FC4A 1JI7A 2HI0A 4C7ZA 3RJKA 1L3TA 4FBUA 4NLZA 1NOMA 1X6JA 4ECVA 5DG9A 2BR0A 4CGZA 5KT2A 3WKDA 5JU5A 2W9BB 8ICEA 9ICHA 2Y0SF 2OYYA 1ZQTA 2W04A 1TV9A 2W9CB 2J6UA 1L7OA 4Y2TA 4Y2RA 1ZQMA 5CWRA 2DKXA 3BDPA 2HVIA 3T5LA 3V6KA 2F2AB 4P4OA 3RBEA 3ED5A 5KFPA 5KNIA 1IG6A 2KK0A 9ICRA 1KLNA 3UQ2A 5KT3A 4M9JA 1ED1A 3PX6A 4PJ0U 1RXWA 8ICNA 4F92B 5J0XA 4ECXA 8ICMA 3QE9Y 3PR4A 4ED6A 3SI8A 4IRKA 1Z1VA 3RJFA 9ICQA 4DFJA 4DL2A 9ICNA 1D8LA 1WCNA 3VC8A 3HT3A 7ICHA 4J9NA 2PMZC 4MHVA 5J2HA 3UXNA 4DEZA 1L8LA 1S77D 2EDUA 4TUSA 4O5CA 1O08A 2OCEA 4RQ0A 4DFPA 2I6XA 2LPEA 1X40A 1SKWA 2LM4A 2W7PA 3HPOA 3RJIA 3H8JA 3SAGA 4FZNA 2AH5A 4EBEA 1NK8A 4QZIA 4HAIA 2PMZF
chains in the Genus database with same CATH topology
2WB1F 3ICXA 3SMVA 3HKZF 1MA7A 2DGZA 2H3ZA 3N7RC 2HBJA 3GZFA 2MA1A 2YB1A 3ALRA 2ZIVA 4QNLA 4OJOA 4OJLA 3MGVA 3KFUF 1XNSA 2XICA 4FZLA 4WJ3B 2KOBA 2G0AA 2XI9A 4PL1A 3PSTA 4PL2A 2NV3A 2WAQF 4U7CA 2ZIUA 5C0YA 2ZIXB 5HR7A 4O3MA 4CGZA 2K4HA 3D2NA 1PVRA 2ZXHA 3SQIA 4QIWF 2Q4TA 2K8AA 2H3FA 2E1FA 2HMXA 3H0RB 3LVVA 1Z19A 2Y0SF 2OYYA 2KHVA 2H3QA 2W03A 2W04A 2OXOA 3O0FA 3OPXA 4NLBA 3H0LB 4AYBC 3PSPA 3RFAA 3SAFA 2F8LA 4KMOB 2KKVA 2HBMA 2LBOA 2N1RA 2CN1A 1GO3F 2K8CB 2D6FC 2JMGA 2G07A 2YB4A 2HOFA 4P0PA 5KL8B 1OUQA 2VIXA 1A0PA 2MRLA 3GU3A 3IG5A 3F53A 4ICAA 3IN5A 1ECWA 2RRDA 3CP8A 1Q3VA 3M7DA 5A0LA 5CRXA 2KJ8A 2F2AB 3C29A 4BJQA 4P0QB 1URJA 3ONNA 2VJ5A 1TAMA 1A6SA 2GH1A 3AQFA 5KL1B 1PVPA 2ZIWB 3F2BA 2KHQA 2E5SA 1F44A 2H3VA 3K1ZA 3M6ZA 1ED1A 2F77X 2KICA 3IP4B 3RF9A 4AYBF 4CRXA 3D2SA 4KX5A 4FE3A 4A8EA 1D8BA 4NV0A 2KNJA 2LYBA 3IG8A 1CRXA 2HBLA 3LVWA 2LYAA 2XIDA 2YX8A 2K89A 2LHTA 3F5AA 1YT3A 3N7SC 2VKQA 2JH7A 4NWIA 2ZIXA 1IIPA 2OH2A 2F76X 3N7PD 1SZHA 2LKYA 3C28A 2BDUA 2G08A 2KVCA 2KKPA 3SAHA 2KEYA 2G09A 4QJFB 2Z7JA 4JMUA 4BX9C 4CDGA 4KX3A 3VCBA 2DF4B 2ZIVB 5T14A 1P7DA 3KZXA 1XO0A 2G5HB 4FZMA 4NLCA 3VC8A 1NZBA 3F2DA 3LYSA 2KJ5A 4BUGA 3DEEA 2ZIUB 2CRXA 3F2CA 3H0MB 3M6KA 2KD1A 2G5IB 3D2QA 1DRGA 3PSFA 2KJ9A 4GFJA 3CRXA 2RP5A 1ZQ1C 2PMZC 2WB1C 2K4IA 2HOQA 3HKZC 1HIWA 2ZXIA 3L3FX 2GOLA 2CPRA 4P0QA 3AQEA 4U6PA 2K4EA 4OJ5A 2JHDA 2VJ4A 2JGAA 1UPHA 2JH1A 2RHFA 2ZIWA 3CYMA 2DQNB 3NRWA 4OJ6A 1Z1BA 1L6NA 2ZG6A 2WAQC 2KIWA 2R18A 3PZPA 4ACOA 2HBKA 4P0PB 4C0ZA 3F5EA 2XVTA 3PSIA 2W7OA 1Q3UA 2W7PA 2HOIA 3T79A 2M0NA 2KV2A 3NUQA 4QIWC 3SAGA 4FZNA 3AL0B 5HR6A 1T94A 1HEKA 4IC9A 4OJPA 1KBUA 2E1EA 2H3IA 2OM6A 2A3VA 4OO1J 1PVQA 2Y0SC 3E0FA 1WUDA 2K8BB 2G06A 2PMZF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P0Q A;  2ZIV A;  4P0P A;  2ZIW A;  2ZIV B;  2ZIX A;  2ZIW B;  2ZIU A;  4P0P B;  2ZIX B;  4P0Q B;  2ZIU B; 
#chains in the Genus database with same CATH topology
 4ECT A;  2BPF A;  2W8L A;  4M9G A;  3N7R C;  2YB1 A;  1SXD A;  4PL1 A;  2NRX A;  3G6X A;  4Z6C A;  4Q8F A;  1QLN A;  2ISO A;  1COO A;  4DFM A;  5DBC A;  1KTQ A;  1Z19 A;  3R9K A;  3B0Y A;  3O0F A;  2MUT B;  1TVA A;  2NRW A;  3N28 A;  5EWF A;  1WYG A;  1ECW A;  2HHW A;  1VLB A;  4I28 A;  5IIM A;  5IIK A;  4I2C A;  2PKE A;  3KD3 A;  3LK9 A;  3ZDB A;  2OWO A;  1OXJ A;  3ZI4 A;  5AM4 A;  2ATL A;  3MAB A;  4M9N A;  2KFN A;  4I2A A;  2YTU A;  3N7P D;  2HDO A;  1ZD2 P;  4O3P A;  4E0D A;  4Y2V A;  3C23 A;  3UM9 A;  4QWA A;  2CRX A;  3M6K A;  3D2Q A;  1KL9 A;  2CXY A;  3ISD A;  2FPM A;  4EX7 A;  2V4R A;  4DF8 A;  4QZA A;  4UAT A;  4I2G A;  2KMD A;  5F9L A;  4ED2 A;  7ICS A;  2KG5 A;  2K4E A;  2AU0 A;  1TK8 A;  4YR0 A;  9ICA A;  3PZP A;  4EYI B;  4GIB A;  1WCL A;  5J2K A;  5C5J A;  1DGS A;  5ALT A;  4Y2X A;  3E0F A;  2DKZ A;  1J2N A;  4I2H A;  9ICJ A;  5KFE A;  9ICC A;  1ZQY A;  4F5R A;  7ICO A;  5AM2 A;  5J0W A;  3SMV A;  1KEJ A;  3ZDD A;  4MFF A;  3RB6 A;  3FM9 A;  1MQ3 A;  4IS7 A;  1XNS A;  4WJ3 B;  3TAN A;  2W9A A;  2F1H A;  2PFP A;  2HMX A;  3H0R B;  4QZF A;  2ESE A;  4O3O A;  3JPO A;  8ICQ A;  2BPC A;  2JMG A;  2HOF A;  1T3Q A;  3IG5 A;  2NYV A;  2KJ8 A;  3GQC A;  5KAF U;  3M9M B;  4DSF A;  3FAH A;  5KG1 A;  1J97 A;  1QTM A;  4R65 A;  5J0U A;  1H38 A;  5KFU A;  3NVZ A;  4MF8 A;  4J9K A;  3BS5 B;  1ZQI A;  1KFS A;  2DBY A;  3FDS A;  2LYA A;  3WK7 A;  2K60 A;  2GLE A;  2F3N A;  1IIP A;  3NVW A;  1N5W A;  3IM1 A;  2Y1J A;  3HWT A;  5KFB A;  3IRU A;  2ZIV B;  2XCA A;  4YCX A;  1RYR A;  2GWS A;  4RQ3 A;  1MC8 A;  3SV4 A;  3LYS A;  1PZN A;  3EYZ A;  4UAR A;  2AGP A;  2RDI A;  3DDH A;  2W9M A;  3E58 A;  5AI4 A;  4QWE A;  3L3F X;  7ICU A;  5ALW A;  3GIM A;  4MEX A;  3WKB A;  2RHF A;  2BCS A;  2E8N A;  3T5H A;  3Q8M A;  3G6Y A;  2BCQ A;  4C8K A;  2KZM A;  8ICK A;  3ICX A;  4Z6D A;  5KFK A;  1BPD A;  1D8Y A;  1DXS A;  5ALI A;  4O5K A;  1N2X A;  3ALR A;  4IQU A;  5KFW A;  1V38 A;  3MR3 A;  3UMB A;  3QUC A;  5IIJ A;  2RDJ A;  2JR5 A;  3RH5 A;  1U47 A;  4KLL A;  5AK6 A;  4RQ5 A;  3OTQ A;  3QZ7 A;  3NGD A;  2OEH A;  2KN7 A;  2KSO A;  1RYS A;  1ZD3 A;  4DS5 A;  2R8K A;  2HHS A;  1FEZ A;  4Z6F A;  5EE1 A;  3KHR A;  4CF3 A;  2KE7 A;  3MGI A;  3OHB A;  5FP0 A;  4Y2U A;  3QEB Z;  2WF6 A;  4ELT A;  3MR5 A;  2BZF A;  4J9M A;  3RF9 A;  8ICJ A;  2KNJ A;  2C22 A;  1RDF A;  3IDW A;  1S0O A;  4RPZ A;  1YT3 A;  2OH2 A;  2ZIX A;  3SEI A;  2R8I A;  4F5N A;  2LKY A;  2BDU A;  2ZTC A;  2KKP A;  4F50 A;  5DB8 A;  2Z7J A;  5HP4 A;  3KZX A;  2G5H B;  1RQN A;  4NLC A;  2FPL A;  3LWL A;  7ICI A;  1BVS A;  5AM5 A;  2ZJA A;  5L1K A;  1KRP A;  2JEF A;  2VJ4 A;  2P6R A;  2HVH A;  3PR5 B;  1DOQ A;  1MN8 A;  5AKL A;  4ECR A;  3QU2 A;  3PSI A;  2XVT A;  5L1J A;  2ALZ A;  4GXI A;  3T79 A;  2KV2 A;  2AHO B;  5DG8 A;  1HEK A;  4CNQ A;  4J9P A;  2OM6 A;  1NKE A;  4I2E A;  3BQ7 A;  2IMW P;  3NVY A;  3GIJ A;  1C7Y A;  4G9B A;  2H3Z A;  3K75 D;  4O5E A;  4OJL A;  5CP2 A;  5DBA A;  2XIC A;  4KLT A;  1RG6 A;  7ICG A;  1Z3E B;  1XU4 A;  1PVR A;  2XY7 A;  1TK5 A;  4I2D A;  5IIL A;  4ED7 A;  3LVV A;  2E1F A;  5D4B A;  2W03 A;  4AYB C;  4B9T A;  3WK5 A;  4KMO B;  3PML A;  3GV8 B;  4P0P A;  5KL8 B;  4KLQ A;  5H2F U;  4DOC A;  4ED8 A;  5DQG A;  3C29 A;  5CA7 A;  2JEJ A;  5KG2 A;  1ZQA A;  4C8O A;  5J2J A;  4DQQ A;  1JRP A;  1RM6 C;  2F1J A;  2Y9U A;  3AM9 A;  3M6Z A;  5EWE A;  1LVH A;  2PI4 A;  3D2S A;  4AYB F;  3L5K A;  2ASJ A;  5JUM A;  3A0H U;  9ICV A;  4F4Y A;  3TAC B;  3TI0 A;  1S0V A;  4Y2Q A;  2I5H A;  5D49 A;  1IXR A;  3RRH A;  3TAQ A;  4XQ8 A;  4QJF B;  4KLM A;  4BX9 C;  2IHM A;  3UXO A;  1ZQW A;  4CDG A;  1K1Q A;  1P7D A;  1SXE A;  4PHE A;  3RJJ A;  1QQ6 A;  2KJ5 A;  1ZRM A;  5ALS A;  3AUO A;  3OGU A;  4UAW A;  4NLK A;  9ICO A;  5J2F A;  1SL2 A;  3V72 A;  3CYM A;  2ZIW A;  1LKY B;  2J6S A;  4MEY A;  1JAL A;  4KLI A;  4Z6E A;  4IRC A;  4M6W B;  3DV9 A;  2E1E A;  2H3I A;  5KG7 A;  2XY5 A;  4ECU A;  4MF2 A;  1LV5 A;  3TAD A;  5JRT A;  1UA1 A;  4YMO A;  2KP7 A;  3RAX A;  4XA5 A;  2DUY A;  5KFJ A;  1XSN A;  2WF9 A;  3RB4 A;  9ICI A;  3SQI A;  2Q4T A;  5J8Y C;  4NLB A;  4M0A A;  5J8Y A;  2HHX A;  2KFZ A;  3EWA A;  2V4Q A;  1UQV A;  2UVU A;  2W54 A;  8ICW A;  3PW2 A;  2PI5 A;  1KDH A;  3RR8 A;  3QX7 A;  2L5Y A;  2RRD A;  2B6G A;  4M9L A;  3WK4 A;  4F5P A;  2PFQ A;  7ICJ A;  2QAR A;  5ALD A;  4HYK A;  4C8M A;  2VA2 A;  4B9M A;  3GII A;  5AK5 A;  4G3I A;  5K4L A;  8ICU A;  1CEZ A;  2K89 A;  1QH9 A;  4NWI A;  4JV0 A;  1BNP A;  3GV7 B;  8ICP A;  2HHV A;  3B9J A;  3RB3 A;  5AM0 A;  4PZO A;  1KKX A;  3UXP A;  2PXI A;  4JWM A;  2W9C A;  3WK8 A;  2KZ3 A;  5ALU A;  4I2B A;  2WF8 A;  3CW2 C;  5AKG A;  4BXO B;  2GOL A;  5KG6 A;  4MFC A;  4M9H A;  8ICY A;  3V7L A;  2YQE A;  1PK1 B;  7ICE A;  4DO9 A;  5KFS A;  9ICF A;  1X9W A;  9ICX A;  4UAS A;  1KBU A;  1BNO A;  4QZE A;  4UB6 U;  1JRO A;  5KFT A;  2FI1 A;  5EE9 A;  4I2F A;  5KFF A;  3AU6 A;  8ICS A;  4ECW A;  4EYH B;  4IQV A;  1SKS A;  2KVS A;  4UAV A;  1X9M A;  4JV2 A;  3L4P A;  4RQ7 A;  3ETR A;  4P2H A;  4QZH A;  1ZQL A;  4O3N A;  2HBM A;  1GO3 F;  5KG3 A;  4LZD A;  9ICS A;  2C28 A;  1BPZ A;  1OUQ A;  3GU3 A;  1L3U A;  2YN4 A;  3M7D A;  1XSL A;  4F91 B;  1TAM A;  1ZQF A;  5ALN A;  1PVP A;  3KHL A;  4F5Q A;  1QSS A;  3NTU A;  4UQG A;  1D8B A;  1JIH A;  4NV0 A;  5AK3 A;  5TZV A;  2BQU A;  1B43 A;  2LHT A;  3N7S C;  5KG4 A;  2VKQ A;  5DGB A;  3TQ1 A;  5DGA A;  5J2G A;  4NLG A;  2QKQ A;  4R8U B;  3PV8 A;  1BPB A;  2G09 A;  4XRH A;  3EPG A;  4KX3 A;  5T14 A;  2BQ3 A;  4YR3 A;  2JZB B;  1L7P A;  2MUT A;  3K4G A;  5AK4 A;  2ZIU B;  1N63 A;  1DRG A;  1D9D A;  1U4B A;  3RJH A;  2LYH A;  8ICH A;  4Q43 A;  3Q8R B;  5L1M A;  7ICP A;  3V7J A;  1L7M A;  4RQM A;  2NRT A;  5J0Y A;  1ZQV A;  3IHQ B;  1UPH A;  5ALJ A;  2FPK A;  2HBK A;  2KZZ A;  2NO4 A;  4I2J A;  3EPI A;  4DSL A;  1CUK A;  3M9N B;  1HUO A;  1N48 A;  4IC9 A;  5AI8 A;  1EXN A;  3RH4 A;  4IR1 A;  3M9O B;  4B9U A;  2DGZ A;  2FMQ A;  2YMQ A;  4F3O A;  5KFA A;  2HBJ A;  4Y2Y A;  4QNL A;  2I9G A;  2O6K A;  4R66 A;  4RQ2 A;  2AXT U;  2C2R A;  4RQ1 A;  4DQS A;  2ZJ5 A;  1ZQG A;  4PZN A;  3UPQ A;  4F2R A;  3AMZ A;  2R8G A;  3QEA Z;  1L5U A;  1ZQX A;  4F2S A;  1XO1 A;  2K4P A;  3SZ2 A;  4YD2 A;  5AKI A;  1A76 A;  1KFD A;  5KG5 A;  2YML A;  2G07 A;  3ISC A;  2YMM A;  5CJ7 A;  3LDA A;  4ICA A;  2XGQ A;  1A6S A;  1FIQ A;  3N97 B;  2FJ6 A;  2E5S A;  1S9F A;  3K1Z A;  1N62 A;  5KFI A;  4NLN A;  1T3N A;  4UB1 A;  5AI6 A;  1RYU A;  3BQ2 A;  2W8K A;  1X66 A;  4RZR A;  5AIA A;  3NVV A;  4DOB A;  4Q44 A;  3QU5 A;  3BS7 A;  8ICA A;  3ORY A;  2W55 A;  3PW0 A;  1NJX A;  4F4W A;  1COK A;  4FZM A;  3F2D A;  3H0M B;  2RQ5 A;  3GIL A;  2KD1 A;  1SWW A;  2K4I A;  7ICT A;  3BQT A;  4J03 A;  4LVS A;  5J0O A;  2BGW A;  2CPR A;  5F3X B;  1QCK A;  4RNO A;  2KIV A;  4GLX A;  5KFR A;  4QZD A;  4OJ6 A;  4B9V A;  2XO7 A;  4DSE A;  2QB0 B;  3Q8P B;  4C0Z A;  2W7O A;  2HOI A;  3BS5 A;  3KOO A;  1ZQK A;  2P66 A;  2M0N A;  1T7P A;  3HIL A;  1RXV A;  3T5J A;  4YR2 A;  4BWJ A;  5ALE A;  1NJZ A;  4NJ8 A;  2MA1 A;  2ZIV A;  3QZ8 A;  4K4H A;  2FMP A;  5JTI A;  3GDX A;  1CI4 A;  4QW8 A;  2VAN A;  2UVW A;  1NKB A;  4EBC A;  5BOL A;  4RNN A;  3PW4 A;  4DLG A;  4NXZ A;  5BOM A;  4I2I A;  2BCU A;  3SAF A;  4C8N A;  4R63 A;  4DLE A;  3PVX A;  1K5O A;  3NRZ A;  1C20 A;  3GV5 B;  8ICO A;  4F8R A;  2K8C B;  4M47 A;  5AKH A;  1SIJ A;  4ED3 A;  3F53 A;  1ZQQ A;  2XY6 A;  4P0Q B;  4RNM A;  1B4F A;  3A0B U;  3RJE A;  3V7K A;  5GTH U;  3H8S A;  1N60 A;  4DS4 A;  4CRX A;  2D8C A;  2BHN A;  5DLG A;  3IG8 A;  3KZI U;  3HW8 A;  1QSY A;  1N5X A;  2A1J A;  2JH7 A;  2PFN A;  7ICV A;  3OJS A;  5L9X A;  4AP9 A;  4RPY A;  2P6U A;  2EQY A;  1NK0 A;  4B6J A;  2KEY A;  1XO0 A;  4KLE A;  3C1Y A;  3PNC A;  3DEE A;  5AI9 A;  8ICT A;  3CNH A;  2ODG A;  5HMM A;  2EAO A;  2BCV A;  4YVZ A;  4QZC A;  4F71 A;  1N56 A;  1DGJ A;  3C2M A;  3TAP A;  4NY8 A;  2JHD A;  5DBB A;  2DFL A;  5D46 A;  5AHX A;  4RQ4 A;  3F5E A;  8ICB A;  1Q3U A;  4XUS A;  3SD7 A;  4UB3 A;  1ZQR A;  3AL0 B;  2F1I A;  2FLL A;  5HR6 A;  1JMS A;  1ZQJ A;  2Y9T A;  2IOF A;  1BGX T;  2WTF A;  4RPX A;  5J2D A;  1WWU A;  3ZDA A;  2FE9 A;  4BDP A;  4FZL A;  5AKZ A;  2NV3 A;  2HW3 A;  4ED1 A;  3PO5 A;  4DQP A;  5KAI U;  2ZXH A;  2Q0Z X;  3Q8Q B;  4UB4 A;  5ALF A;  5G5H A;  4ELV A;  1JXE A;  3MDA A;  2LMR A;  5KFX A;  2KKV A;  5L1L A;  4P4M A;  3U26 A;  1TAQ A;  1Z00 B;  4PGX A;  5J2I A;  1J2M A;  2E8M A;  2Y1I A;  2MSN A;  2KHQ A;  1F44 A;  2KTQ A;  3B0X A;  4PPX A;  3IP4 B;  2FMS A;  4KLO A;  3M8S A;  2LYB A;  1X42 A;  1L8O A;  1T4G A;  3BJY A;  3F5A A;  5J0S A;  1SB3 C;  9ICK A;  2UVV A;  3QXG A;  5KT6 A;  4CE6 A;  2G08 A;  4YFK A;  3C5F A;  1NZB A;  1JXL A;  2G5I B;  1XS9 D;  2JEI A;  1U45 A;  3CRX A;  9ICU A;  2B0C A;  4KLD A;  2WB1 C;  4O9M A;  3RBD A;  4B9N A;  3OHA A;  4QWD A;  2D3D A;  1X6I A;  1XWL A;  1XSP A;  4UBB A;  1ZQH A;  1Z1B A;  3NRW A;  3AEV A;  4F93 B;  1UT5 A;  4TUP A;  3MFI A;  4QIW C;  1NI3 A;  5AKK A;  4CF4 A;  1WWV A;  4DL3 A;  4PHA A;  4ECQ A;  5HHI A;  2KHV A;  2WB1 F;  1O03 A;  4DSK A;  1TAU A;  3GZF A;  1ZRN A;  4O3S A;  1QSL A;  3WKC A;  2KOB A;  2XI9 A;  3T5K A;  5J2A A;  2WHE A;  4QZB A;  3FYH A;  3JPN A;  4O3M A;  3N4M B;  8ICG A;  4QIW F;  4J9Q A;  2H3F A;  3BQ0 A;  3C21 A;  3TAD C;  1NK9 A;  1U9L A;  2LBO A;  3WKA A;  5J0P A;  5KFY A;  4ZH4 A;  4RQN A;  2VIX A;  4J9R A;  4EEK A;  5A0L A;  4M6W A;  4KN4 A;  4I29 A;  1S97 A;  2BKE A;  2H3V A;  5ALH A;  5KFH A;  2F77 X;  5KFD A;  4A8E A;  3RRG A;  1TFR A;  3C1Z A;  4GC6 A;  4DSJ A;  5EE3 A;  4YMM A;  3LVW A;  3Q8K A;  4QZ8 A;  2W3R A;  2YX8 A;  4YQW A;  7ICM A;  3SAH A;  4YD1 A;  1L3V A;  5J2E A;  3VCB A;  3TKA A;  5KFL A;  5KFM A;  4C8L A;  5ALY A;  4TQS A;  1ZET A;  7ICR A;  1NJW A;  4UAY A;  3QUT A;  4J9S A;  1ZQO A;  3SYZ A;  1S0N A;  3KKA C;  1MSW D;  3BQ1 A;  2EZY A;  4DWI A;  1Q8K A;  3C5G A;  3KKA A;  4EZ6 A;  3PX4 A;  3H8W A;  2WFA A;  3WK9 A;  3V6H A;  2IA6 A;  3KTQ A;  1WG8 A;  3MBY A;  2IBK A;  5B66 U;  4ACO A;  4M04 A;  5KT4 A;  2W9B A;  3H4D A;  1TKD A;  3HJE A;  4B9S A;  2BPG A;  1V97 A;  4ZOH C;  4RQ6 A;  4GXK A;  2A3V A;  4IQT A;  3JPP A;  3PO4 A;  3PY8 A;  2ZTE A;  1S8O A;  4EEL A;  5IIO A;  4DL7 A;  2W3S A;  1NZP A;  2BQR A;  4PL2 A;  5G5G A;  4C4S A;  1SGG A;  4U7C A;  5GTI U;  5HR7 A;  1UHU A;  2IOF K;  3Q8S B;  1D9F A;  2ZTD A;  2JRZ A;  3QNM A;  5HHH A;  1V9P A;  3WK6 A;  2EAM A;  4BXO A;  2K8A A;  4C4R A;  1ZQD A;  1ZQZ A;  1L7N A;  5BPC A;  1L3S A;  4KLF A;  1SZP A;  3MDC A;  1ZQB A;  5KT7 A;  1PK1 A;  4RUA A;  4QZG A;  5ALZ A;  3IV6 A;  8ICL A;  4KLH A;  2AJQ A;  4KIT B;  3CP8 A;  1Q3V A;  5CRX A;  2HSZ A;  2IOH A;  4K4G A;  2YMP A;  3MR6 A;  2E8O A;  4NL9 C;  2BCR A;  4USA A;  5HML A;  4KLG A;  4NL9 A;  5TIS U;  2HBL A;  4IL6 U;  4KN7 A;  8ICV A;  5J2B A;  2E8P A;  1ZD5 A;  2A1A A;  4FS1 A;  3C28 A;  1SZH A;  4LZG A;  2KVC A;  2ZUC A;  3TFR A;  5J2C A;  2DF4 B;  3PW7 A;  3SR6 A;  3LWM A;  5EWG A;  4Q45 A;  9ICT A;  2KJ9 A;  1ZQ1 C;  4FS2 A;  1T8E A;  3HKZ C;  4ECY A;  5IIN A;  4F4K A;  2RLT A;  3AQE A;  9ICP A;  2DPI A;  4O3Q A;  1L6N A;  4PHD A;  4DFD A;  2EZZ A;  3K1R B;  1B0X A;  4R64 A;  3GFK B;  3TFS A;  5DQI A;  5AKX A;  5ALR A;  1T94 A;  5ALP A;  3OSN A;  4R8U A;  4BGD A;  2C2D A;  5ALX A;  3RTV A;  3PMN A;  3AU2 A;  2FDR A;  3HKZ F;  4UB2 A;  4OJO A;  4EEY A;  3PX0 A;  2JZB A;  3QU9 A;  3RJG A;  2G0A A;  4EBD A;  3KHH A;  2ZIU A;  5C0Y A;  4OCZ A;  2XC9 A;  3OSP A;  3RH6 A;  2K4H A;  3D2N A;  5AKJ A;  2LM1 A;  2ZUD A;  3SEN A;  5AI0 A;  1ZQS A;  4RUC A;  9ICM A;  4ELU A;  4UBC A;  2OXO A;  3OPX A;  8ICX A;  3H0L B;  5AIC A;  1RQL A;  2N1R A;  4LJX A;  3ISB A;  1FFU A;  4O0I A;  2WF5 A;  1ZQE A;  1TK0 A;  4Y2S A;  4ED0 A;  2VJ5 A;  3AN1 A;  2GH1 A;  2NRZ A;  3AQF A;  1V85 A;  1DK2 A;  4FE3 A;  3PW5 A;  3H8M A;  1LB2 B;  3RAQ A;  2GO7 A;  2XID A;  4X5V A;  2OHF A;  3WKE A;  1U48 A;  2AGO A;  7ICQ A;  4YXJ A;  2HHQ A;  1ZYQ A;  1PUZ A;  3MGH A;  1FO4 A;  3MR2 A;  3RB0 A;  4BUG A;  5AM3 A;  4BWM A;  2ES6 A;  1ZOL A;  4FBT A;  4DL5 A;  4ECZ A;  1TE2 A;  1KFT A;  1S10 A;  5ALV A;  4JK1 A;  3OJU A;  4OD0 A;  2ZXI A;  5DDY A;  4GC7 A;  1KW4 A;  4OJ5 A;  5F9N A;  2R8J A;  3H7I A;  2ZUB A;  2R18 A;  2EZX A;  2FLP A;  2B21 A;  4JV1 A;  4P4P A;  4QW9 A;  1BPX A;  2JEG A;  4JWN A;  5E79 U;  1S0M A;  2LI6 A;  1BPE A;  2DL0 A;  2EAN A;  1M6Y A;  3H4B A;  3Q8L A;  5KFC A;  4PGY A;  4KLJ A;  1KQQ A;  3QU4 A;  5DKW A;  8ICF A;  5KTQ A;  2ASL A;  2F44 A;  3MGV A;  3ZDE A;  3V6J A;  4JUZ A;  4PH5 A;  1JUD A;  4KTQ A;  3E2E A;  4F4X A;  3M8R A;  4DCC A;  4I27 A;  1HJP A;  1NK7 A;  2XGP A;  4CF5 A;  4YXM A;  3PSP A;  1A77 A;  4UAU A;  3QYP A;  1MQ2 A;  2CN1 A;  2QB0 A;  2W11 A;  1RPL A;  2A19 A;  2IHN A;  1URJ A;  1B22 A;  3JPR A;  5KL1 B;  3UMC A;  1RZT A;  1KSP A;  3BZC A;  4CCH A;  1NNL A;  4F72 A;  5ALQ A;  5ALM A;  2KIC A;  1XC9 A;  3MFH A;  1CRX A;  3G6V A;  3UQ0 A;  5J0R A;  1SWV A;  3M1Y A;  1YZ7 A;  4PGQ A;  4DQR A;  2F76 X;  8ICR A;  3HX0 A;  4JMU A;  4F5O A;  5L1I A;  5KFG A;  1IM4 A;  4IRD A;  1VJ5 A;  5KFQ A;  3I28 A;  4YP3 A;  3ETL A;  1UA0 A;  4KLU A;  3HRD D;  3QUB A;  5ALO A;  2PFO A;  5KT5 A;  2V9W A;  4EEN A;  5AKY A;  4NM1 A;  2HHT A;  2KSO B;  1BPY A;  4UB5 A;  2DWQ A;  4P0Q A;  9ICB A;  1X2I A;  2JGA A;  2A1J B;  1ZQN A;  2WAQ C;  2HHU A;  5KFO A;  1SKR A;  4K4I A;  2UVR A;  3EUB 2;  4EZ9 A;  4OO1 J;  4OJP A;  3H40 A;  4DL6 A;  1PVQ A;  1X9S A;  4B9L A;  3C2K A;  4J9L A;  1VDV A;  2G06 A;  5AM1 A;  3JPT A;  4NM2 A;  2YY6 A;  2R8H A;  4DOA A;  5DG7 A;  5DQH A;  4QZ9 A;  3HP6 A;  3KFU F;  4C80 A;  4TUR A;  1ZXI A;  4US9 A;  3THV A;  2WAQ F;  1NJY A;  2XCP A;  2ZIX B;  2M9N A;  4O3R A;  3EW9 A;  1KN5 A;  1UT8 A;  4PHP A;  5AIB A;  5B5E U;  2HCF A;  4JB3 A;  5DB6 A;  5KFV A;  2H3Q A;  4TUQ A;  3RFA A;  1IV8 A;  2ISP A;  5CR0 A;  5DB7 A;  3GIK A;  5EOZ A;  2D6F C;  4UW9 A;  3KBB A;  2MRL A;  3SV3 A;  3TAR A;  1QQ7 A;  4US8 A;  1N61 A;  1S5L U;  2J6T A;  3T3F A;  1F5S A;  9ICL A;  1SL1 A;  3ONN A;  5ALG A;  5KFZ A;  5J0Q A;  4KMU A;  2ZJ8 A;  5J29 A;  2H5X A;  2AGQ A;  1JX4 A;  3JPQ A;  1ZQU A;  4QWC A;  2DPJ A;  9ICE A;  2I1Q A;  1U49 A;  5DDM A;  4DF4 A;  4ECS A;  1NK6 A;  3QU7 A;  2ASD A;  2AQ0 A;  2P35 A;  1DK3 A;  1NKC A;  9ICW A;  1SL0 A;  1HUZ A;  2JXJ A;  2QLT A;  2E3T A;  5CEH A;  1OW5 A;  1FFV A;  1QQ5 A;  1AQ6 A;  2W43 A;  2RP5 A;  1Z00 A;  7ICK A;  4YN4 A;  1PK3 A;  5CB1 A;  2BDP A;  3EZ5 A;  2DQN B;  4Q8E A;  5DLF A;  2KIW A;  4P0P B;  1S76 D;  2WF7 A;  2FLN A;  3NS1 A;  3I76 A;  2VA3 A;  4GXJ A;  3NAS A;  1WUD A;  2F8K A;  4QWB A;  1Y88 A;  1MA7 A;  4FO6 A;  4FFD A;  5EE0 A;  1ZD4 A;  5ALL A;  7ICF A;  1SV4 A;  1K1S A;  4TQR A;  4IR9 A;  3PST A;  2NRV A;  5AI5 A;  2VA8 A;  4KLS A;  3ZDC A;  5HNK A;  2EH9 A;  2MAX A;  1ZQC A;  3RR7 A;  2MU2 A;  1ZQP A;  5CHG A;  5KFN A;  4RT2 A;  4DL4 A;  2F8L A;  1Z4O A;  2YB4 A;  5J0T A;  4Y2J A;  1A0P A;  3WU2 U;  4F4Z A;  3QUQ A;  4YG2 A;  3IN5 A;  1YZ6 A;  5III A;  4RU9 A;  7ICL A;  4BJQ A;  4DSI A;  3UMG A;  3ZD9 A;  4DFK A;  5AKE A;  2ZIW B;  3F2B A;  2AQ4 A;  2C2E A;  4UAZ A;  1NK4 A;  4RQ8 A;  1Z4N A;  8ICI A;  4M2Y A;  4KX5 A;  3MC1 A;  5KG0 A;  3BZK A;  3S6J A;  1X9X A;  4J9O A;  1LKY A;  2NO5 A;  3JPS A;  4RT3 A;  4YMN A;  3ZD8 A;  5DB9 A;  3F2C A;  1JN3 A;  3PSF A;  4UB8 U;  4GFJ A;  3I1Y A;  3KHG A;  1SV0 C;  4EX6 A;  4C4T A;  1NK5 A;  2HOQ A;  3J81 j;  1SV0 A;  1HIW A;  1ZJN A;  2QB1 A;  1F0M A;  1Q46 A;  4C7Y A;  2JV3 A;  3C2L A;  8ICZ A;  4U6P A;  1UCV A;  8ICC A;  2JH1 A;  5ALK A;  3D6J A;  2ZG6 A;  2EAP A;  1ARO P;  4MFA A;  3NUQ A;  4IQW A;  1ZJM A;  7ICN A;  4DQI A;  2Y0S C;  4Y2P A;  9ICG A;  2K8B B;  2QAR B;  3FC4 A;  1JI7 A;  2HI0 A;  4C7Z A;  3RJK A;  1L3T A;  4FBU A;  4NLZ A;  1NOM A;  1X6J A;  4ECV A;  5DG9 A;  2BR0 A;  4CGZ A;  5KT2 A;  3WKD A;  5JU5 A;  2W9B B;  8ICE A;  9ICH A;  2Y0S F;  2OYY A;  1ZQT A;  2W04 A;  1TV9 A;  2W9C B;  2J6U A;  1L7O A;  4Y2T A;  4Y2R A;  1ZQM A;  5CWR A;  2DKX A;  3BDP A;  2HVI A;  3T5L A;  3V6K A;  2F2A B;  4P4O A;  3RBE A;  3ED5 A;  5KFP A;  5KNI A;  1IG6 A;  2KK0 A;  9ICR A;  1KLN A;  3UQ2 A;  5KT3 A;  4M9J A;  1ED1 A;  3PX6 A;  4PJ0 U;  1RXW A;  8ICN A;  4F92 B;  5J0X A;  4ECX A;  8ICM A;  3QE9 Y;  3PR4 A;  4ED6 A;  3SI8 A;  4IRK A;  1Z1V A;  3RJF A;  9ICQ A;  4DFJ A;  4DL2 A;  9ICN A;  1D8L A;  1WCN A;  3VC8 A;  3HT3 A;  7ICH A;  4J9N A;  2PMZ C;  4MHV A;  5J2H A;  3UXN A;  4DEZ A;  1L8L A;  1S77 D;  2EDU A;  4TUS A;  4O5C A;  1O08 A;  2OCE A;  4RQ0 A;  4DFP A;  2I6X A;  2LPE A;  1X40 A;  1SKW A;  2LM4 A;  2W7P A;  3HPO A;  3RJI A;  3H8J A;  3SAG A;  4FZN A;  2AH5 A;  4EBE A;  1NK8 A;  4QZI A;  4HAI A;  2PMZ F; 
#chains in the Genus database with same CATH homology
 2WB1 F;  3ICX A;  3SMV A;  3HKZ F;  1MA7 A;  2DGZ A;  2H3Z A;  3N7R C;  2HBJ A;  3GZF A;  2MA1 A;  2YB1 A;  3ALR A;  2ZIV A;  4QNL A;  4OJO A;  4OJL A;  3MGV A;  3KFU F;  1XNS A;  2XIC A;  4FZL A;  4WJ3 B;  2KOB A;  2G0A A;  2XI9 A;  4PL1 A;  3PST A;  4PL2 A;  2NV3 A;  2WAQ F;  4U7C A;  2ZIU A;  5C0Y A;  2ZIX B;  5HR7 A;  4O3M A;  4CGZ A;  2K4H A;  3D2N A;  1PVR A;  2ZXH A;  3SQI A;  4QIW F;  2Q4T A;  2K8A A;  2H3F A;  2E1F A;  2HMX A;  3H0R B;  3LVV A;  1Z19 A;  2Y0S F;  2OYY A;  2KHV A;  2H3Q A;  2W03 A;  2W04 A;  2OXO A;  3O0F A;  3OPX A;  4NLB A;  3H0L B;  4AYB C;  3PSP A;  3RFA A;  3SAF A;  2F8L A;  4KMO B;  2KKV A;  2HBM A;  2LBO A;  2N1R A;  2CN1 A;  1GO3 F;  2K8C B;  2D6F C;  2JMG A;  2G07 A;  2YB4 A;  2HOF A;  4P0P A;  5KL8 B;  1OUQ A;  2VIX A;  1A0P A;  2MRL A;  3GU3 A;  3IG5 A;  3F53 A;  4ICA A;  3IN5 A;  1ECW A;  2RRD A;  3CP8 A;  1Q3V A;  3M7D A;  5A0L A;  5CRX A;  2KJ8 A;  2F2A B;  3C29 A;  4BJQ A;  4P0Q B;  1URJ A;  3ONN A;  2VJ5 A;  1TAM A;  1A6S A;  2GH1 A;  3AQF A;  5KL1 B;  1PVP A;  2ZIW B;  3F2B A;  2KHQ A;  2E5S A;  1F44 A;  2H3V A;  3K1Z A;  3M6Z A;  1ED1 A;  2F77 X;  2KIC A;  3IP4 B;  3RF9 A;  4AYB F;  4CRX A;  3D2S A;  4KX5 A;  4FE3 A;  4A8E A;  1D8B A;  4NV0 A;  2KNJ A;  2LYB A;  3IG8 A;  1CRX A;  2HBL A;  3LVW A;  2LYA A;  2XID A;  2YX8 A;  2K89 A;  2LHT A;  3F5A A;  1YT3 A;  3N7S C;  2VKQ A;  2JH7 A;  4NWI A;  2ZIX A;  1IIP A;  2OH2 A;  2F76 X;  3N7P D;  1SZH A;  2LKY A;  3C28 A;  2BDU A;  2G08 A;  2KVC A;  2KKP A;  3SAH A;  2KEY A;  2G09 A;  4QJF B;  2Z7J A;  4JMU A;  4BX9 C;  4CDG A;  4KX3 A;  3VCB A;  2DF4 B;  2ZIV B;  5T14 A;  1P7D A;  3KZX A;  1XO0 A;  2G5H B;  4FZM A;  4NLC A;  3VC8 A;  1NZB A;  3F2D A;  3LYS A;  2KJ5 A;  4BUG A;  3DEE A;  2ZIU B;  2CRX A;  3F2C A;  3H0M B;  3M6K A;  2KD1 A;  2G5I B;  3D2Q A;  1DRG A;  3PSF A;  2KJ9 A;  4GFJ A;  3CRX A;  2RP5 A;  1ZQ1 C;  2PMZ C;  2WB1 C;  2K4I A;  2HOQ A;  3HKZ C;  1HIW A;  2ZXI A;  3L3F X;  2GOL A;  2CPR A;  4P0Q A;  3AQE A;  4U6P A;  2K4E A;  4OJ5 A;  2JHD A;  2VJ4 A;  2JGA A;  1UPH A;  2JH1 A;  2RHF A;  2ZIW A;  3CYM A;  2DQN B;  3NRW A;  4OJ6 A;  1Z1B A;  1L6N A;  2ZG6 A;  2WAQ C;  2KIW A;  2R18 A;  3PZP A;  4ACO A;  2HBK A;  4P0P B;  4C0Z A;  3F5E A;  2XVT A;  3PSI A;  2W7O A;  1Q3U A;  2W7P A;  2HOI A;  3T79 A;  2M0N A;  2KV2 A;  3NUQ A;  4QIW C;  3SAG A;  4FZN A;  3AL0 B;  5HR6 A;  1T94 A;  1HEK A;  4IC9 A;  4OJP A;  1KBU A;  2E1E A;  2H3I A;  2OM6 A;  2A3V A;  4OO1 J;  1PVQ A;  2Y0S C;  3E0F A;  1WUD A;  2K8B B;  2G06 A;  2PMZ F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...