2ZIVA

Crystal structure of the mus81-eme1 complex
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
302
structure length
281
Chain Sequence
GWHLSPGSYDIVLCVDLCETTGKQELVKELQRNSVTFDVRKLNVGDFLWVARERVTPVPGQLRPPVGKELVLDYIIERKRMDDLCGSIIDGRFREQKFRLKRCGLRKPIYLVEECGSAAAHLSIPESTLQQAIVNTQVVDGFFVKRVQDAKESAAYLTIMTRYLQKLYQNCTLFCRANLSCSLMAFTEFNYGAIKNKCQTVREVFARQLMQISGVSGDKAAAVLEHYSTVSSLLQAYDKCSSETEKEKLLSSVKYGKLKRNLGPALSRTIYQLYCTRGPLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the Mus81-Eme1 complex
pubmed doi rcsb
source organism Danio rerio
molecule tags Hydrolase
molecule keywords Mus81 protein
total genus 86
structure length 281
sequence length 302
ec nomenclature
pdb deposition date 2008-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02732 ERCC4 ERCC4 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.670 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2zivA02
2ZIVA 2ZIUA 2ZIXA 4P0PA 4P0QB 2ZIWB 2ZIWA 2ZIXB 4P0QA 4P0PB 2ZIUB 2ZIVB
chains in the Genus database with same CATH superfamily
4RPXA 3RFAA 4Q43A 2KK0A 4JV2A 1NKBA 3J81j 1UA1A 4UBCA 1N48A 3ONNA 4RNNA 1ZQBA 5J2EA 2XICA 2QB1A 2G5HB 1ZQGA 5DB8A 3ZI4A 2H3QA 2F44A 4DFMA 4CF5A 2PKEA 1TK8A 4DL7A 1WCLA 4PHAA 1JIHA 3N7SC 3TI0A 2JZBA 3A0HU 1D8YA 2F76X 5KFYA 1NZPA 3JPPA 1Z4NA 5D49A 3BJYA 5AM3A 2R18A 4Y2VA 5J0PA 3BZCA 4F5NA 1XU4A 4O9MA 4I2DA 1KKXA 1S0OA 3ORYA 3GQCA 2ALZA 1SL1A 2H3VA 1RYSA 2K4IA 4ED7A 3MC1A 4DO9A 1NJXA 3NRWA 3BZKA 5DGBA 7ICEA 2YB1A 1BGXT 8ICVA 3Q8QB 1PVQA 3OJSA 3H0RB 2WFAA 4MEXA 2O6KA 3WKDA 4KLDA 4EBDA 5KG1A 8ICMA 4KLHA 1ZQRA 4QIWC 3S6JA 4FS1A 8ICIA 4DFJA 2ZIVB 3LVVA 2E8OA 1A76A 2MU2A 5L1KA 1TK0A 3UMBA 1SIJA 4WJ3B 2HBLA 2P6UA 4YXMA 3ZDBA 1S10A 1ED1A 1UHUA 5DDMA 4J9QA 1U48A 3C5FA 4FBUA 3RB6A 1ZOLA 3N7PD 1HIWA 3MGIA 1JALA 3D6JA 3RBEA 3CYMA 2W9CA 2VA8A 3ED5A 1XS9D 1NJZA 9ICPA 5AK6A 3SV4A 8ICCA 4M9GA 4TQSA 1V38A 2ISPA 1HUZA 5IINA 3NVYA 3MFIA 4PGQA 3SD7A 4UB5A 2R8HA 1KQQA 2LBOA 1TAUA 4QZ9A 4ELTA 4CGZA 2KKVA 2QARB 2LHTA 5GTIU 3WU2U 4M47A 5KAIU 1TV9A 1ZQMA 4UAUA 5J0UA 3ISDA 4GC6A 1YT3A 2A1JB 3L5KA 2PFNA 1BPXA 2WF5A 1NK4A 1X6IA 3QZ8A 5KFHA 3WK4A 4KLIA 4UB8U 5J0YA 2E5SA 3B0YA 5KFSA 4M9LA 1S0NA 2GWSA 8ICHA 3N97B 8ICKA 1ZQPA 4BJQA 9ICMA 3GDXA 1LB2B 2QB0B 3I28A 4DEZA 4F4WA 2FLPA 3GIIA 2YMMA 2RHFA 3EYZA 5G5GA 3E2EA 5KT2A 4QZDA 5AM5A 2ESEA 5KTQA 5J2HA 4FFDA 5F9LA 1J2NA 4IRCA 3M1YA 3HKZF 4IL6U 7ICLA 3TKAA 1SL0A 1WYGA 1COOA 2IBKA 4DS5A 4I2GA 3TQ1A 5AI9A 1NK5A 2DBYA 4C80A 2F3NA 4PGYA 2YQEA 4NL9A 2P35A 1RXWA 1IIPA 3QU9A 4KMUA 3PW4A 4RU9A 1ZD4A 3ZDEA 5KG6A 3TANA 2BCSA 5BOMA 3KKAC 2LYHA 2AGPA 2K60A 9ICCA 2NRTA 4DL2A 4QZCA 3B0XA 2KSOB 1ZXIA 5D46A 5KG5A 4LVSA 3EPIA 1SZHA 4O3NA 2W9CB 4F4XA 1KW4A 3RJGA 4YMOA 4NY8A 4AYBC 1NJWA 1C20A 3SEIA 2KIWA 3SAHA 5ALOA 2FDRA 5E79U 3NVWA 4DOAA 1TKDA 4P0PA 3C1ZA 2K8BB 3KKAA 3WKCA 3H4BA 4UAWA 2Z7JA 5DDYA 4PHEA 1UT8A 1GO3F 3HT3A 1JXLA 2A3VA 2DL0A 2H3IA 1VJ5A 4TUSA 1L6NA 2PMZC 4ECTA 1NK0A 1ZQCA 3DEEA 5DG7A 1WWUA 5J0WA 1M6YA 4K4IA 3T3FA 2KIVA 3QUBA 5DLFA 4O5KA 1URJA 4F3OA 7ICHA 1S0VA 4DF8A 2DWQA 1L7OA 3KHHA 1L8LA 4J9OA 4IR9A 1BPYA 4NM2A 2XVTA 1D9FA 5CA7A 3ZDDA 4F71A 2HBJA 5B66U 5F9NA 1XSLA 2EAOA 2ZUBA 1ZJMA 3EWAA 4NJ8A 2GH1A 2MSNA 3NRZA 5CP2A 4M0AA 5J0OA 4FZMA 4NLZA 4RQ5A 4PZNA 2E3TA 2DPIA 1NK6A 4I2JA 1BPZA 8ICZA 5JTIA 2VA2A 3RTVA 8ICTA 1V9PA 2ATLA 2RDIA 5KFVA 3PMLA 3KOOA 2K4EA 3JPRA 5B5EU 3KFUF 9ICJA 1KFSA 5KFWA 2XY6A 3PW0A 3HX0A 1Z3EB 2KTQA 3H8MA 5DKWA 4KLOA 2HW3A 2W54A 3PW5A 4F93B 4DSEA 3PX6A 3RB0A 3LVWA 2RLTA 3C21A 1JRPA 3RRHA 2W55A 2AGQA 1T7PA 4F5RA 2KD1A 4I29A 2C2DA 1S76D 4ECWA 5DG8A 1TK5A 2XI9A 3FM9A 2XY5A 3AUOA 4M6WA 5EE3A 1UPHA 2IOFK 5KFQA 1X9SA 1X2IA 5HHHA 1B4FA 4R8UA 4J9NA 2YN4A 3ETRA 7ICKA 4Y2JA 9ICSA 2OWOA 1T3QA 4BX9C 3MDAA 9ICWA 5KT7A 9ICUA 2JMGA 5HP4A 3BS7A 4ED0A 4DQRA 5DB9A 3AL0B 4F92B 2W03A 4ACOA 2WAQF 3OHBA 3HILA 4YR2A 4US9A 5CEHA 1JI7A 1SGGA 3UQ0A 2ES6A 1JXEA 4JV0A 5AM2A 3PNCA 2RP5A 2ZIXB 4RT3A 4QIWF 4DWIA 4QNLA 4F2RA 3M9MB 2G09A 1SWVA 4I2CA 3PO5A 4DSKA 4J9MA 3KHGA 3QUCA 3H4DA 4PJ0U 1ZQQA 2KJ5A 2MRLA 3RAQA 2XGPA 4F2SA 2KFNA 5ALJA 2AQ0A 4RQ7A 2JH1A 1RYRA 2F1JA 1NKCA 2G0AA 4M9JA 3THVA 4J9PA 1AROP 4UAYA 4A8EA 4O3OA 3AU2A 3AN1A 4USAA 3KTQA 1NJYA 3WKBA 2Y9TA 4KLTA 2ZJAA 4O3PA 4F5OA 1K1QA 1PVRA 2FMQA 5AK3A 1YZ7A 3ETLA 4P4MA 3DDHA 4P4PA 3RB3A 1RYUA 2KHVA 3B9JA 3EUB2 4DOCA 7ICNA 5J29A 9ICXA 3GILA 7ICSA 3GIMA 4DQPA 1N56A 8ICFA 8ICXA 2E8MA 4DL6A 3CP8A 1ZQUA 4ECVA 5AI5A 4PHDA 4B9MA 2V9WA 2HHWA 5DBAA 2WAQC 5KL8B 4KLEA 2ZJ8A 3EPGA 2Y1IA 2R8JA 4J9KA 5C0YA 2XC9A 1S9FA 2Y0SC 9ICIA 3F5EA 2LI6A 3QUQA 3TFSA 5EE0A 5KFOA 3IV6A 2D6FC 2EANA 2CPRA 2AQ4A 1IM4A 8ICNA 1ZJNA 4F5QA 3I76A 4RQMA 4XQ8A 4O3RA 2ZG6A 3MGVA 1XSPA 1QSYA 2LMRA 3WK5A 1U45A 2G06A 1DK2A 5DBCA 1DK3A 2W11A 5BOLA 2NRVA 2OH2A 4MEYA 3PSIA 5J8YA 2ZUCA 5ALMA 4ECYA 2WHEA 3K75D 2ZJ5A 5EWFA 2AXTU 4QZFA 4RPYA 2UVVA 3OHAA 4U6PA 2MA1A 4DSIA 5J2AA 5KFAA 3RJHA 3N7RC 4GXIA 7ICOA 2D8CA 5C5JA 5DG9A 2FI1A 2IHMA 5J0XA 3HJEA 2HHVA 3TACB 4RNMA 1ZQ1C 2DKXA 3OGUA 4GIBA 1U9LA 3JPTA 2AU0A 4KLSA 1V97A 5ALSA 3IDWA 5ALNA 5T14A 2ZTDA 2WF6A 4ICAA 4OCZA 1CRXA 4JWNA 3SAFA 1RM6C 5DGAA 1RZTA 2BPGA 5EWGA 2JGAA 2ZTEA 5KT6A 2BGWA 4ECUA 4B9VA 1UT5A 3C23A 2FLNA 2W8KA 3V7KA 3PW7A 4M2YA 2QARA 2DFLA 2C2EA 2LYBA 3LDAA 4J03A 1SV0A 4HYKA 4RQ0A 4YD2A 4LZGA 1PZNA 8ICPA 5KT5A 2B0CA 4EYHB 1T4GA 2BCUA 1MN8A 3C2KA 1Y88A 3HPOA 1RG6A 3NTUA 4QWAA 4Z6FA 1SZPA 2VJ4A 4RNOA 2FPKA 1XNSA 2HHSA 3L4PA 2NO5A 2PI5A 2BQRA 2JZBB 3M9NB 4F4ZA 2UVUA 5AIBA 3PW2A 3NVZA 2BPCA 3WK6A 1ZETA 5L1IA 3NS1A 5FP0A 2DPJA 4EEKA 5KFXA 3V7LA 4C4TA 5EE1A 2F8KA 1QQ6A 1X6JA 4TUPA 3RH4A 4ED6A 3RAXA 3MABA 3UXNA 3ZD8A 4QZGA 5ALXA 4PHPA 3A0BU 1JX4A 9ICTA 4QZAA 4NLNA 2JEIA 1O03A 3RBDA 5KG7A 2W8LA 1ZQJA 9ICRA 2I9GA 3SV3A 4OD0A 4O5CA 1DOQA 1ZQDA 4QWBA 2W43A 5KFUA 2DKZA 1ZQYA 4GXKA 5A0LA 2HHQA 3UM9A 3WK8A 4US8A 5J0RA 3IRUA 4U7CA 4PL1A 1J97A 8ICEA 2D3DA 2EAPA 2ZTCA 4ECZA 1SXEA 4EBCA 9ICEA 2XO7A 3KD3A 4P4OA 2KJ9A 5ALPA 4PH5A 4BWMA 2W04A 3SR6A 1SWWA 3C29A 3TARA 1ZYQA 2DQNB 2HSZA 8ICQA 4XRHA 4M9NA 5AI6A 2KN7A 1KEJA 1ZQVA 3H0LB 4P2HA 5AKXA 3C28A 3ISBA 3SAGA 2I1QA 1Z00A 3D2NA 1X42A 2W7OA 3M8RA 2N1RA 4PL2A 4O0IA 1ECWA 3RJJA 1UQVA 2BDPA 5J2FA 4UB1A 4O5EA 5J2JA 3PMNA 5CWRA 2KG5A 2W9BB 3ALRA 1Z1BA 1S8OA 5KFTA 4EELA 5DBBA 1X66A 2K89A 1NKEA 1Q3UA 2QB0A 2XY7A 2AHOB 3SZ2A 3BDPA 2Y9UA 5KFKA 1A0PA 4EBEA 1ZQOA 4UASA 3T5LA 5AKJA 3RJFA 4CDGA 4KX3A 3QXGA 2LPEA 4UAVA 4X5VA 1SL2A 1U4BA 1BNPA 1KL9A 1IG6A 5ALIA 4EEYA 3RF9A 1PVPA 4RZRA 5AI4A 1P7DA 1COKA 1KFTA 3QNMA 5IIIA 4B9NA 2L5YA 4BWJA 1X40A 4NLGA 5KFBA 5DLGA 5KFCA 3QX7A 2WF9A 4KMOB 1S97A 3BQ2A 3SYZA 9ICGA 3SMVA 2KNJA 2H5XA 1B0XA 5ALGA 2JEGA 2A19A 3FAHA 2K4PA 3V6JA 4RUAA 8ICAA 2F8LA 2FPMA 3IG5A 8ICYA 3GIKA 3C5GA 4RQ4A 4I2FA 1RQNA 1K5OA 4RUCA 2EDUA 4DSFA 5AI0A 4KLMA 3PSTA 3HRDD 3Q8PB 2JR5A 2RQ5A 4F8RA 4JWMA 5L1LA 1SKSA 2E1FA 4Y2UA 4NV0A 1U47A 2K8AA 2YTUA 2G07A 9ICFA 3AQFA 2PFQA 4QWEA 2XIDA 4C0ZA 2HVHA 5KAFU 3CW2C 4UATA 3RR7A 4Z6EA 3IN5A 1ZQXA 2Q4TA 3M6KA 9ICLA 1Z1VA 3UMGA 1NK9A 4C8LA 2E1EA 3QU5A 9ICBA 2M9NA 4M04A 1QQ7A 2AJQA 4DFDA 4QWCA 3H0MB 2I5HA 4EZ9A 4PPXA 8ICWA 9ICHA 1D9DA 3GIJA 4EYIB 3T5HA 4I2HA 3LYSA 2G5IB 4C8OA 1Z4OA 1ZQTA 3C2MA 5ALVA 2K8CB 1F0MA 3FYHA 2JEJA 4OJPA 4FBTA 2YB4A 3WK9A 3AMZA 3T5JA 3RJKA 3VCBA 4DSLA 3K1RB 2KSOA 1N5XA 2B21A 2EAMA 3C2LA 3UXOA 1F44A 4KLQA 1LVHA 4E0DA 5KFGA 5GTHU 8ICUA 1X9MA 1Z00B 4F72A 1OXJA 4DFKA 3ISCA 1BNOA 4Y2XA 5ALWA 2DF4B 3MDCA 8ICJA 1ZQSA 4PZOA 3HW8A 3H40A 2KVSA 3RJIA 1KDHA 1FEZA 1J2MA 5JRTA 2W9MA 5DQHA 2IOHA 4JV1A 2FLLA 4C8KA 4EENA 2UVRA 2ZUDA 2ASDA 1JUDA 4XA5A 4EX6A 2C28A 4ELVA 4IQTA 8ICOA 4RT2A 4OJ6A 2FPLA 1IXRA 1XWLA 4F50A 3ZDAA 5ALLA 7ICJA 3DV9A 1WUDA 4DSJA 3PSFA 1SKWA 4GC7A 1U49A 2DGZA 1TE2A 2NYVA 3Q8KA 5ALHA 4JK1A 3JPNA 2UVWA 4DFPA 1MSWD 1L5UA 5ALZA 4P0PB 3KZIU 3GV5B 1F5SA 1FFUA 5AICA 5TZVA 2ZIWA 5ALDA 8ICRA 2HI0A 5KG0A 5J2KA 5J0SA 3PV8A 1X9WA 1EXNA 5HMMA 2ZXHA 3LK9A 4O3MA 4QJFB 1KLNA 2MUTA 5IIMA 4CNQA 4OJLA 2VANA 2Q0ZX 8ICBA 5KFIA 4OJ5A 5H2FU 3TADC 2R8GA 2P6RA 1UA0A 3LWMA 5F3XB 2JXJA 3BS5A 4CCHA 2YMQA 5CRXA 2HHXA 5ALQA 2ZIXA 4UB6U 5KFRA 3FDSA 2XCAA 2KZZA 4KN4A 1TVAA 2BQUA 3WK7A 4K4HA 1XO0A 4IRKA 4Y2PA 4RQ2A 5AKYA 2BQ3A 4UB2A 3RH5A 2HBMA 5ALKA 3MFHA 4DLEA 1NK8A 7ICPA 3SI8A 2CN1A 1XC9A 5KFDA 3KHLA 1NZBA 2OM6A 2V4QA 4KLFA 4I28A 5J0QA 4M6WB 4MFFA 4C8MA 4UARA 2NV3A 2HOFA 4YR3A 5AKGA 1XO1A 4RQ3A 3I1YA 4MF2A 7ICTA 1TAQA 3KBBA 4RQ6A 4ED2A 5KG2A 3UXPA 2ZIVA 3QYPA 5HR7A 5KT3A 4KN7A 3SQIA 2WF7A 4C4SA 3HKZC 4C7YA 4F4YA 4I2EA 4B9SA 4FE3A 4UAZA 1DXSA 1YZ6A 5G5HA 3PO4A 4RQ8A 2Y0SF 4P0QB 3JPSA 1QH9A 4B9UA 3Q8MA 2MAXA 9ICNA 1A77A 5K4LA 4LJXA 4QZHA 1ZRNA 4UB4A 5IIOA 1T94A 5CB1A 5D4BA 3F5AA 5CHGA 2BCVA 4DQSA 2FJ6A 3E0FA 4Q8FA 1SXDA 2KOBA 3Q8SB 4GLXA 1LKYA 1H38A 3QEAZ 1KSPA 3RB4A 3PX0A 2HHUA 2FMPA 1IV8A 1DGSA 4DLGA 2LYAA 5L1MA 4YXJA 4OJOA 4IRDA 4NM1A 3MR3A 4YP3A 3QUTA 2KP7A 3T5KA 3TAPA 5AM1A 1SV0C 2ASJA 7ICMA 1CUKA 1L8OA 4CRXA 4DL5A 2BCRA 2JEFA 2B6GA 4QWDA 3N28A 3F2CA 5AM4A 5AK4A 2LKYA 1ZQIA 4DL4A 4DF4A 4Q8EA 4UQGA 4I2BA 4F5PA 1SV4A 4I27A 3OJUA 1QCKA 2KV2A 2MUTB 2E8PA 3JPQA 4J9LA 5ALUA 4ELUA 2V4RA 3T79A 1S77D 1N2XA 2YMPA 5J0TA 4KLJA 2E8NA 3IM1A 2QKQA 5KL1B 1L7NA 2ZIWB 5AKIA 1A6SA 1JN3A 1NNLA 2PFOA 2OXOA 5KFZA 1MQ3A 3UQ2A 3PR5B 1FFVA 1KTQA 4KX5A 3ICXA 3BQ7A 4BUGA 4P0QA 3QU2A 5CJ7A 5KFFA 3HWTA 2C22A 2GOLA 4TUQA 4PGXA 4OO1J 1QSLA 3IP4B 2GLEA 2RDJA 5BPCA 5KT4A 5KG3A 2W7PA 4YR0A 1K1SA 5KFLA 3K1ZA 2WB1C 5HR6A 2BCQA 4YN4A 4RPZA 1L3UA 2A1AA 1ZQFA 2JHDA 2EZXA 1BPEA 2H3ZA 4ED8A 2R8IA 1WWVA 2IOFA 1KRPA 4KLUA 5KFPA 5L1JA 3RRGA 2PI4A 2HCFA 4Q44A 9ICOA 3V72A 3M9OB 5KG4A 3U26A 3GV7B 2HDOA 2BPFA 4EX7A 4ZH4A 8ICSA 3PVXA 8ICGA 2M0NA 5J2BA 4JMUA 2ASLA 2EQYA 9ICQA 5AI8A 2AH5A 1AQ6A 4EZ6A 4KLLA 4Q45A 2H3FA 4ZOHC 2AGOA 4Y2YA 4YVZA 4KITB 4UB3A 3AQEA 5AM0A 4QZIA 4YMMA 4FO6A 4DOBA 1TAMA 1QLNA 2JRZA 2K4HA 7ICUA 4MF8A 4XUSA 4KLGA 4IQWA 4K4GA 1WCNA 1ZD2P 1D8BA 4IC9A 3BQ0A 1N62A 3G6XA 1L7PA 2EZZA 5DB6A 3D2SA 7ICRA 3E58A 2JV3A 5AKZA 4Y2QA 2IHNA 4I2IA 1QQ5A 1T3NA 2NO4A 4B6JA 4KTQA 3PR4A 2WB1F 3G6YA 7ICIA 4I2AA 2GO7A 1CI4A 2OYYA 5ALRA 1BVSA 2KICA 4GXJA 4MHVA 2F1HA 1D8LA 4F91B 5J2IA 5ALTA 3D2QA 4DS4A 1LV5A 2KZ3A 1T8EA 4AP9A 2W3SA 2OEHA 3LWLA 2KVCA 2HBKA 3M7DA 4QW8A 1SB3C 2ZIUB 2KJ8A 4HAIA 3FC4A 5IIKA 3CRXA 4QZBA 1ZQAA 4J9SA 4ECXA 4C4RA 1S0MA 3F2BA 3QU4A 3WKAA 4CE6A 2VIXA 1L7MA 5HHIA 2BHNA 3H8JA 1PK3A 4C7ZA 2PMZF 1ZQEA 7ICVA 3F2DA 2NRXA 1ZD3A 3GFKB 5KFEA 3EW9A 2OHFA 2W9BA 1NI3A 2ISOA 3G6VA 2ZIUA 5JU5A 4Y2RA 3TFRA 2I6XA 1KN5A 4R8UB 4ECRA 3V7JA 1BPDA 4DQQA 4QZEA 2BR0A 4NLKA 4NLCA 5AKLA 1KBUA 7ICGA 2KKPA 1X9XA 1FIQA 2KMDA 4FZNA 3AM9A 4QZ8A 2KFZA 1RDFA 4Y2TA 2VA3A 4R66A 4YCXA 5DQGA 5HMLA 2OCEA 4IQUA 4QW9A 3V6HA 5ALEA 3Q8LA 4BDPA 2LM1A 4DL3A 4F4KA 3MR2A 1KFDA 5J2CA 3PX4A 3OPXA 3IG8A 3OSPA 1QTMA 3HP6A 5KFNA 3PZPA 2A1JA 3IHQB 5JUMA 4YFKA 3MR5A 2PFPA 2Y1JA 3NVVA 2DUYA 3JPOA 4BXOB 5EWEA 8ICLA 1N60A 2HVIA 1MA7A 1N5WA 5HNKA 2IMWP 5AKHA 2HHTA 1MC8A 3MGHA 3EZ5A 3QE9Y 2KZMA 1ZQWA 4ECSA 2HOQA 5ALFA 7ICQA 1CEZA 2F1IA 4IS7A 4ED3A 3N4MB 5DB7A 1OUQA 1MQ2A 1FO4A 3BQTA 3ZD9A 4YG2A 5CR0A 4O3SA 2G08A 1RQLA 3Q8RB 4JB3A 3TAQA 4YQWA 3RH6A 2KEYA 5AKKA 2VJ5A 2CRXA 1N61A 2EH9A 3M6ZA 3NASA 2BDUA 5AK5A 3K4GA 1PUZA 2J6TA 9ICKA 4TURA 1JMSA 4G3IA 3RJEA 4C8NA 4DCCA 5KFMA 4NLBA 1S5LU 4ED1A 3RR8A 3KZXA 2J6SA 3MR6A 1LKYB 4CF3A 3SENA 4BGDA 1VDVA 7ICFA 1TFRA 5AHXA 4FS2A 2KE7A 5J2DA 1UCVA 4R65A 2VKQA 2FE9A 3L3FX 1ZQKA 5TISU 3R9KA 4Y2SA 2LM4A 2QLTA 3VC8A 1NK7A 5J8YC 1DRGA 1HJPA 3GZFA 4IQVA 3QZ7A 2HOIA 3MBYA 2JH7A 5AIAA 5IILA 1C7YA 2NRZA 1ZQLA 1V85A 1JROA 3AEVA 4NXZA 1B43A 2KHQA 4JUZA 3ZDCA 4ECQA 1RPLA 5ALYA 1VLBA 1ZQHA 1L3TA 2W9AA 3H8SA 4YD1A 3GV8B 3NUQA 3TADA 9ICAA 3UPQA 4R64A 2F2AB 2R8KA 2XGQA 5AKEA 1HEKA 4J9RA 4O3QA 4Z6DA 2NRWA 2ODGA 2ZXIA 4MFAA 3OTQA 4NL9C 5KNIA 2EZYA 4UW9A 4R63A 2BZFA 2HMXA 4B9TA 3QU7A 4CF4A 3C1YA 2C2RA 3CNHA 4YMNA 1BPBA 3OSNA 2IA6A 3V6KA 4IR1A 4M9HA 4G9BA 3F53A 3BQ1A 1Z19A 1SKRA 4MFCA 1DGJA 1ZD5A 3H8WA 5EE9A 4DQIA 3PSPA 4RQNA 4TQRA 3PY8A 3KHRA 4AYBF 4BXOA 1HUOA 1OW5A 4LZDA 1PK1A 1Q8KA 1N63A 2YMLA 4Z6CA 1ZRMA 4GFJA 5EOZA 2YY6A 1B22A 2BKEA 3H7IA 5IIJA 2J6UA 2WTFA 9ICVA 3WKEA 1O08A 5J2GA 1NOMA 2PXIA 4FZLA 5KFJA 1RXVA 4RQ1A 3M8SA 2W3RA 1XSNA 2FMSA 1L3VA 1L3SA 4B9LA 2WF8A 4NWIA 2P66A 1PK1B 1ZQNA 1WG8A 4UBBA 3GU3A 5L9XA 2F77X 2CXYA 3BS5B 2YX8A 5DQIA 3O0FA 1Q3VA 2XCPA 3AU6A 3QEBZ 1ZQZA 2RRDA 3UMCA 1QSSA 3NGDA 1Q46A
chains in the Genus database with same CATH topology
3IG5A 2HOQA 2CPRA 3CRXA 2H3ZA 1HEKA 2ZIXA 3RFAA 1ED1A 2DF4B 2GH1A 2ZXIA 3N7PD 1HIWA 2LYAA 3PSTA 3F2BA 3H0LB 3ONNA 4FZMA 2RP5A 2ZIXB 1IIPA 4OJOA 2VIXA 4QIWF 2XICA 1OUQA 3C28A 1XO0A 2ZG6A 3CYMA 4QNLA 2G5HB 3SAGA 3MGVA 2HMXA 2VJ4A 2PMZF 1XNSA 2E1FA 2G09A 3D2NA 4NV0A 2G08A 3F2DA 2K8AA 2W7OA 2G06A 2H3QA 2N1RA 4PL2A 2G07A 2KEYA 1ECWA 3AQFA 2HBMA 2KJ5A 2MRLA 2XIDA 4C0ZA 2OH2A 2VJ5A 2ZIUA 3F53A 2LBOA 3M6ZA 1Z19A 2CRXA 4CRXA 3PSIA 2BDUA 4CGZA 3N7SC 2KKVA 2JH1A 2M0NA 3ALRA 3F2CA 2K4EA 4JMUA 2CN1A 2LHTA 3PSPA 3IN5A 3KFUF 2LKYA 2F76X 1Z1BA 2G0AA 1NZBA 1SZHA 2Q4TA 2OM6A 4A8EA 3M6KA 4AYBF 2H3FA 4NLCA 1KBUA 2R18A 2K89A 2KKPA 4U6PA 2KV2A 2MA1A 4NLBA 1Q3UA 2E1EA 3AQEA 4FZNA 3KZXA 3T79A 1YT3A 4AYBC 2NV3A 2HOFA 4OJ6A 1TAMA 3N7RC 2K4HA 1A0PA 3LVWA 5KL1B 3H0MB 2KIWA 2ZIWB 2H3VA 3SAHA 1PVRA 4CDGA 1WUDA 4KX3A 1D8BA 4IC9A 2E5SA 1ZQ1C 2K4IA 1A6SA 3PSFA 2KHVA 2VKQA 4GFJA 2D6FC 2WAQF 4P0PA 2DGZA 2OXOA 2KD1A 3L3FX 3LYSA 3VC8A 3D2SA 2K8BB 2G5IB 3RF9A 1PVPA 3NRWA 4BJQA 2ZIVA 5HR7A 2Z7JA 1P7DA 2XI9A 1GO3F 2K8CB 3SQIA 2YB1A 1DRGA 2A3VA 4P0PB 4FZLA 2H3IA 4KX5A 3GZFA 3HKZC 1PVQA 2HOIA 3ICXA 5A0LA 5T14A 4BUGA 1L6NA 4ICAA 4OJPA 2ZIWA 2RHFA 3H0RB 3IG8A 2JH7A 2PMZC 2WB1F 1UPHA 3OPXA 4FE3A 2YB4A 4P0QA 4PL1A 4U7CA 1CRXA 3CP8A 3SAFA 2Y0SF 3DEEA 4P0QB 4NWIA 3VCBA 2GOLA 2ZXHA 4QIWC 3PZPA 4OO1J 2JGAA 3IP4B 4O3MA 2OYYA 4QJFB 2KICA 2WAQC 3GU3A 5KL8B 1URJA 4OJLA 4KMOB 2KHQA 2KJ9A 2W7PA 3HKZF 1T94A 2F77X 2ZIVB 3D2QA 3LVVA 4BX9C 1MA7A 1F44A 3K1ZA 2JMGA 2KNJA 3F5AA 3SMVA 2WB1C 5HR6A 2YX8A 4OJ5A 2W04A 5C0YA 3C29A 3O0FA 1Q3VA 2XVTA 2Y0SC 3AL0B 3F5EA 2HBJA 2W03A 3NUQA 3E0FA 2JHDA 2HBKA 2KVCA 2LYBA 2RRDA 3M7DA 2F2AB 2HBLA 2KOBA 2DQNB 4ACOA 2F8LA 4WJ3B 2ZIUB 2KJ8A 5CRXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZIV A;  2ZIU A;  2ZIX A;  4P0P A;  4P0Q B;  2ZIW B;  2ZIW A;  2ZIX B;  4P0Q A;  4P0P B;  2ZIU B;  2ZIV B; 
#chains in the Genus database with same CATH topology
 4RPX A;  3RFA A;  4Q43 A;  2KK0 A;  4JV2 A;  1NKB A;  3J81 j;  1UA1 A;  4UBC A;  1N48 A;  3ONN A;  4RNN A;  1ZQB A;  5J2E A;  2XIC A;  2QB1 A;  2G5H B;  1ZQG A;  5DB8 A;  3ZI4 A;  2H3Q A;  2F44 A;  4DFM A;  4CF5 A;  2PKE A;  1TK8 A;  4DL7 A;  1WCL A;  4PHA A;  1JIH A;  3N7S C;  3TI0 A;  2JZB A;  3A0H U;  1D8Y A;  2F76 X;  5KFY A;  1NZP A;  3JPP A;  1Z4N A;  5D49 A;  3BJY A;  5AM3 A;  2R18 A;  4Y2V A;  5J0P A;  3BZC A;  4F5N A;  1XU4 A;  4O9M A;  4I2D A;  1KKX A;  1S0O A;  3ORY A;  3GQC A;  2ALZ A;  1SL1 A;  2H3V A;  1RYS A;  2K4I A;  4ED7 A;  3MC1 A;  4DO9 A;  1NJX A;  3NRW A;  3BZK A;  5DGB A;  7ICE A;  2YB1 A;  1BGX T;  8ICV A;  3Q8Q B;  1PVQ A;  3OJS A;  3H0R B;  2WFA A;  4MEX A;  2O6K A;  3WKD A;  4KLD A;  4EBD A;  5KG1 A;  8ICM A;  4KLH A;  1ZQR A;  4QIW C;  3S6J A;  4FS1 A;  8ICI A;  4DFJ A;  2ZIV B;  3LVV A;  2E8O A;  1A76 A;  2MU2 A;  5L1K A;  1TK0 A;  3UMB A;  1SIJ A;  4WJ3 B;  2HBL A;  2P6U A;  4YXM A;  3ZDB A;  1S10 A;  1ED1 A;  1UHU A;  5DDM A;  4J9Q A;  1U48 A;  3C5F A;  4FBU A;  3RB6 A;  1ZOL A;  3N7P D;  1HIW A;  3MGI A;  1JAL A;  3D6J A;  3RBE A;  3CYM A;  2W9C A;  2VA8 A;  3ED5 A;  1XS9 D;  1NJZ A;  9ICP A;  5AK6 A;  3SV4 A;  8ICC A;  4M9G A;  4TQS A;  1V38 A;  2ISP A;  1HUZ A;  5IIN A;  3NVY A;  3MFI A;  4PGQ A;  3SD7 A;  4UB5 A;  2R8H A;  1KQQ A;  2LBO A;  1TAU A;  4QZ9 A;  4ELT A;  4CGZ A;  2KKV A;  2QAR B;  2LHT A;  5GTI U;  3WU2 U;  4M47 A;  5KAI U;  1TV9 A;  1ZQM A;  4UAU A;  5J0U A;  3ISD A;  4GC6 A;  1YT3 A;  2A1J B;  3L5K A;  2PFN A;  1BPX A;  2WF5 A;  1NK4 A;  1X6I A;  3QZ8 A;  5KFH A;  3WK4 A;  4KLI A;  4UB8 U;  5J0Y A;  2E5S A;  3B0Y A;  5KFS A;  4M9L A;  1S0N A;  2GWS A;  8ICH A;  3N97 B;  8ICK A;  1ZQP A;  4BJQ A;  9ICM A;  3GDX A;  1LB2 B;  2QB0 B;  3I28 A;  4DEZ A;  4F4W A;  2FLP A;  3GII A;  2YMM A;  2RHF A;  3EYZ A;  5G5G A;  3E2E A;  5KT2 A;  4QZD A;  5AM5 A;  2ESE A;  5KTQ A;  5J2H A;  4FFD A;  5F9L A;  1J2N A;  4IRC A;  3M1Y A;  3HKZ F;  4IL6 U;  7ICL A;  3TKA A;  1SL0 A;  1WYG A;  1COO A;  2IBK A;  4DS5 A;  4I2G A;  3TQ1 A;  5AI9 A;  1NK5 A;  2DBY A;  4C80 A;  2F3N A;  4PGY A;  2YQE A;  4NL9 A;  2P35 A;  1RXW A;  1IIP A;  3QU9 A;  4KMU A;  3PW4 A;  4RU9 A;  1ZD4 A;  3ZDE A;  5KG6 A;  3TAN A;  2BCS A;  5BOM A;  3KKA C;  2LYH A;  2AGP A;  2K60 A;  9ICC A;  2NRT A;  4DL2 A;  4QZC A;  3B0X A;  2KSO B;  1ZXI A;  5D46 A;  5KG5 A;  4LVS A;  3EPI A;  1SZH A;  4O3N A;  2W9C B;  4F4X A;  1KW4 A;  3RJG A;  4YMO A;  4NY8 A;  4AYB C;  1NJW A;  1C20 A;  3SEI A;  2KIW A;  3SAH A;  5ALO A;  2FDR A;  5E79 U;  3NVW A;  4DOA A;  1TKD A;  4P0P A;  3C1Z A;  2K8B B;  3KKA A;  3WKC A;  3H4B A;  4UAW A;  2Z7J A;  5DDY A;  4PHE A;  1UT8 A;  1GO3 F;  3HT3 A;  1JXL A;  2A3V A;  2DL0 A;  2H3I A;  1VJ5 A;  4TUS A;  1L6N A;  2PMZ C;  4ECT A;  1NK0 A;  1ZQC A;  3DEE A;  5DG7 A;  1WWU A;  5J0W A;  1M6Y A;  4K4I A;  3T3F A;  2KIV A;  3QUB A;  5DLF A;  4O5K A;  1URJ A;  4F3O A;  7ICH A;  1S0V A;  4DF8 A;  2DWQ A;  1L7O A;  3KHH A;  1L8L A;  4J9O A;  4IR9 A;  1BPY A;  4NM2 A;  2XVT A;  1D9F A;  5CA7 A;  3ZDD A;  4F71 A;  2HBJ A;  5B66 U;  5F9N A;  1XSL A;  2EAO A;  2ZUB A;  1ZJM A;  3EWA A;  4NJ8 A;  2GH1 A;  2MSN A;  3NRZ A;  5CP2 A;  4M0A A;  5J0O A;  4FZM A;  4NLZ A;  4RQ5 A;  4PZN A;  2E3T A;  2DPI A;  1NK6 A;  4I2J A;  1BPZ A;  8ICZ A;  5JTI A;  2VA2 A;  3RTV A;  8ICT A;  1V9P A;  2ATL A;  2RDI A;  5KFV A;  3PML A;  3KOO A;  2K4E A;  3JPR A;  5B5E U;  3KFU F;  9ICJ A;  1KFS A;  5KFW A;  2XY6 A;  3PW0 A;  3HX0 A;  1Z3E B;  2KTQ A;  3H8M A;  5DKW A;  4KLO A;  2HW3 A;  2W54 A;  3PW5 A;  4F93 B;  4DSE A;  3PX6 A;  3RB0 A;  3LVW A;  2RLT A;  3C21 A;  1JRP A;  3RRH A;  2W55 A;  2AGQ A;  1T7P A;  4F5R A;  2KD1 A;  4I29 A;  2C2D A;  1S76 D;  4ECW A;  5DG8 A;  1TK5 A;  2XI9 A;  3FM9 A;  2XY5 A;  3AUO A;  4M6W A;  5EE3 A;  1UPH A;  2IOF K;  5KFQ A;  1X9S A;  1X2I A;  5HHH A;  1B4F A;  4R8U A;  4J9N A;  2YN4 A;  3ETR A;  7ICK A;  4Y2J A;  9ICS A;  2OWO A;  1T3Q A;  4BX9 C;  3MDA A;  9ICW A;  5KT7 A;  9ICU A;  2JMG A;  5HP4 A;  3BS7 A;  4ED0 A;  4DQR A;  5DB9 A;  3AL0 B;  4F92 B;  2W03 A;  4ACO A;  2WAQ F;  3OHB A;  3HIL A;  4YR2 A;  4US9 A;  5CEH A;  1JI7 A;  1SGG A;  3UQ0 A;  2ES6 A;  1JXE A;  4JV0 A;  5AM2 A;  3PNC A;  2RP5 A;  2ZIX B;  4RT3 A;  4QIW F;  4DWI A;  4QNL A;  4F2R A;  3M9M B;  2G09 A;  1SWV A;  4I2C A;  3PO5 A;  4DSK A;  4J9M A;  3KHG A;  3QUC A;  3H4D A;  4PJ0 U;  1ZQQ A;  2KJ5 A;  2MRL A;  3RAQ A;  2XGP A;  4F2S A;  2KFN A;  5ALJ A;  2AQ0 A;  4RQ7 A;  2JH1 A;  1RYR A;  2F1J A;  1NKC A;  2G0A A;  4M9J A;  3THV A;  4J9P A;  1ARO P;  4UAY A;  4A8E A;  4O3O A;  3AU2 A;  3AN1 A;  4USA A;  3KTQ A;  1NJY A;  3WKB A;  2Y9T A;  4KLT A;  2ZJA A;  4O3P A;  4F5O A;  1K1Q A;  1PVR A;  2FMQ A;  5AK3 A;  1YZ7 A;  3ETL A;  4P4M A;  3DDH A;  4P4P A;  3RB3 A;  1RYU A;  2KHV A;  3B9J A;  3EUB 2;  4DOC A;  7ICN A;  5J29 A;  9ICX A;  3GIL A;  7ICS A;  3GIM A;  4DQP A;  1N56 A;  8ICF A;  8ICX A;  2E8M A;  4DL6 A;  3CP8 A;  1ZQU A;  4ECV A;  5AI5 A;  4PHD A;  4B9M A;  2V9W A;  2HHW A;  5DBA A;  2WAQ C;  5KL8 B;  4KLE A;  2ZJ8 A;  3EPG A;  2Y1I A;  2R8J A;  4J9K A;  5C0Y A;  2XC9 A;  1S9F A;  2Y0S C;  9ICI A;  3F5E A;  2LI6 A;  3QUQ A;  3TFS A;  5EE0 A;  5KFO A;  3IV6 A;  2D6F C;  2EAN A;  2CPR A;  2AQ4 A;  1IM4 A;  8ICN A;  1ZJN A;  4F5Q A;  3I76 A;  4RQM A;  4XQ8 A;  4O3R A;  2ZG6 A;  3MGV A;  1XSP A;  1QSY A;  2LMR A;  3WK5 A;  1U45 A;  2G06 A;  1DK2 A;  5DBC A;  1DK3 A;  2W11 A;  5BOL A;  2NRV A;  2OH2 A;  4MEY A;  3PSI A;  5J8Y A;  2ZUC A;  5ALM A;  4ECY A;  2WHE A;  3K75 D;  2ZJ5 A;  5EWF A;  2AXT U;  4QZF A;  4RPY A;  2UVV A;  3OHA A;  4U6P A;  2MA1 A;  4DSI A;  5J2A A;  5KFA A;  3RJH A;  3N7R C;  4GXI A;  7ICO A;  2D8C A;  5C5J A;  5DG9 A;  2FI1 A;  2IHM A;  5J0X A;  3HJE A;  2HHV A;  3TAC B;  4RNM A;  1ZQ1 C;  2DKX A;  3OGU A;  4GIB A;  1U9L A;  3JPT A;  2AU0 A;  4KLS A;  1V97 A;  5ALS A;  3IDW A;  5ALN A;  5T14 A;  2ZTD A;  2WF6 A;  4ICA A;  4OCZ A;  1CRX A;  4JWN A;  3SAF A;  1RM6 C;  5DGA A;  1RZT A;  2BPG A;  5EWG A;  2JGA A;  2ZTE A;  5KT6 A;  2BGW A;  4ECU A;  4B9V A;  1UT5 A;  3C23 A;  2FLN A;  2W8K A;  3V7K A;  3PW7 A;  4M2Y A;  2QAR A;  2DFL A;  2C2E A;  2LYB A;  3LDA A;  4J03 A;  1SV0 A;  4HYK A;  4RQ0 A;  4YD2 A;  4LZG A;  1PZN A;  8ICP A;  5KT5 A;  2B0C A;  4EYH B;  1T4G A;  2BCU A;  1MN8 A;  3C2K A;  1Y88 A;  3HPO A;  1RG6 A;  3NTU A;  4QWA A;  4Z6F A;  1SZP A;  2VJ4 A;  4RNO A;  2FPK A;  1XNS A;  2HHS A;  3L4P A;  2NO5 A;  2PI5 A;  2BQR A;  2JZB B;  3M9N B;  4F4Z A;  2UVU A;  5AIB A;  3PW2 A;  3NVZ A;  2BPC A;  3WK6 A;  1ZET A;  5L1I A;  3NS1 A;  5FP0 A;  2DPJ A;  4EEK A;  5KFX A;  3V7L A;  4C4T A;  5EE1 A;  2F8K A;  1QQ6 A;  1X6J A;  4TUP A;  3RH4 A;  4ED6 A;  3RAX A;  3MAB A;  3UXN A;  3ZD8 A;  4QZG A;  5ALX A;  4PHP A;  3A0B U;  1JX4 A;  9ICT A;  4QZA A;  4NLN A;  2JEI A;  1O03 A;  3RBD A;  5KG7 A;  2W8L A;  1ZQJ A;  9ICR A;  2I9G A;  3SV3 A;  4OD0 A;  4O5C A;  1DOQ A;  1ZQD A;  4QWB A;  2W43 A;  5KFU A;  2DKZ A;  1ZQY A;  4GXK A;  5A0L A;  2HHQ A;  3UM9 A;  3WK8 A;  4US8 A;  5J0R A;  3IRU A;  4U7C A;  4PL1 A;  1J97 A;  8ICE A;  2D3D A;  2EAP A;  2ZTC A;  4ECZ A;  1SXE A;  4EBC A;  9ICE A;  2XO7 A;  3KD3 A;  4P4O A;  2KJ9 A;  5ALP A;  4PH5 A;  4BWM A;  2W04 A;  3SR6 A;  1SWW A;  3C29 A;  3TAR A;  1ZYQ A;  2DQN B;  2HSZ A;  8ICQ A;  4XRH A;  4M9N A;  5AI6 A;  2KN7 A;  1KEJ A;  1ZQV A;  3H0L B;  4P2H A;  5AKX A;  3C28 A;  3ISB A;  3SAG A;  2I1Q A;  1Z00 A;  3D2N A;  1X42 A;  2W7O A;  3M8R A;  2N1R A;  4PL2 A;  4O0I A;  1ECW A;  3RJJ A;  1UQV A;  2BDP A;  5J2F A;  4UB1 A;  4O5E A;  5J2J A;  3PMN A;  5CWR A;  2KG5 A;  2W9B B;  3ALR A;  1Z1B A;  1S8O A;  5KFT A;  4EEL A;  5DBB A;  1X66 A;  2K89 A;  1NKE A;  1Q3U A;  2QB0 A;  2XY7 A;  2AHO B;  3SZ2 A;  3BDP A;  2Y9U A;  5KFK A;  1A0P A;  4EBE A;  1ZQO A;  4UAS A;  3T5L A;  5AKJ A;  3RJF A;  4CDG A;  4KX3 A;  3QXG A;  2LPE A;  4UAV A;  4X5V A;  1SL2 A;  1U4B A;  1BNP A;  1KL9 A;  1IG6 A;  5ALI A;  4EEY A;  3RF9 A;  1PVP A;  4RZR A;  5AI4 A;  1P7D A;  1COK A;  1KFT A;  3QNM A;  5III A;  4B9N A;  2L5Y A;  4BWJ A;  1X40 A;  4NLG A;  5KFB A;  5DLG A;  5KFC A;  3QX7 A;  2WF9 A;  4KMO B;  1S97 A;  3BQ2 A;  3SYZ A;  9ICG A;  3SMV A;  2KNJ A;  2H5X A;  1B0X A;  5ALG A;  2JEG A;  2A19 A;  3FAH A;  2K4P A;  3V6J A;  4RUA A;  8ICA A;  2F8L A;  2FPM A;  3IG5 A;  8ICY A;  3GIK A;  3C5G A;  4RQ4 A;  4I2F A;  1RQN A;  1K5O A;  4RUC A;  2EDU A;  4DSF A;  5AI0 A;  4KLM A;  3PST A;  3HRD D;  3Q8P B;  2JR5 A;  2RQ5 A;  4F8R A;  4JWM A;  5L1L A;  1SKS A;  2E1F A;  4Y2U A;  4NV0 A;  1U47 A;  2K8A A;  2YTU A;  2G07 A;  9ICF A;  3AQF A;  2PFQ A;  4QWE A;  2XID A;  4C0Z A;  2HVH A;  5KAF U;  3CW2 C;  4UAT A;  3RR7 A;  4Z6E A;  3IN5 A;  1ZQX A;  2Q4T A;  3M6K A;  9ICL A;  1Z1V A;  3UMG A;  1NK9 A;  4C8L A;  2E1E A;  3QU5 A;  9ICB A;  2M9N A;  4M04 A;  1QQ7 A;  2AJQ A;  4DFD A;  4QWC A;  3H0M B;  2I5H A;  4EZ9 A;  4PPX A;  8ICW A;  9ICH A;  1D9D A;  3GIJ A;  4EYI B;  3T5H A;  4I2H A;  3LYS A;  2G5I B;  4C8O A;  1Z4O A;  1ZQT A;  3C2M A;  5ALV A;  2K8C B;  1F0M A;  3FYH A;  2JEJ A;  4OJP A;  4FBT A;  2YB4 A;  3WK9 A;  3AMZ A;  3T5J A;  3RJK A;  3VCB A;  4DSL A;  3K1R B;  2KSO A;  1N5X A;  2B21 A;  2EAM A;  3C2L A;  3UXO A;  1F44 A;  4KLQ A;  1LVH A;  4E0D A;  5KFG A;  5GTH U;  8ICU A;  1X9M A;  1Z00 B;  4F72 A;  1OXJ A;  4DFK A;  3ISC A;  1BNO A;  4Y2X A;  5ALW A;  2DF4 B;  3MDC A;  8ICJ A;  1ZQS A;  4PZO A;  3HW8 A;  3H40 A;  2KVS A;  3RJI A;  1KDH A;  1FEZ A;  1J2M A;  5JRT A;  2W9M A;  5DQH A;  2IOH A;  4JV1 A;  2FLL A;  4C8K A;  4EEN A;  2UVR A;  2ZUD A;  2ASD A;  1JUD A;  4XA5 A;  4EX6 A;  2C28 A;  4ELV A;  4IQT A;  8ICO A;  4RT2 A;  4OJ6 A;  2FPL A;  1IXR A;  1XWL A;  4F50 A;  3ZDA A;  5ALL A;  7ICJ A;  3DV9 A;  1WUD A;  4DSJ A;  3PSF A;  1SKW A;  4GC7 A;  1U49 A;  2DGZ A;  1TE2 A;  2NYV A;  3Q8K A;  5ALH A;  4JK1 A;  3JPN A;  2UVW A;  4DFP A;  1MSW D;  1L5U A;  5ALZ A;  4P0P B;  3KZI U;  3GV5 B;  1F5S A;  1FFU A;  5AIC A;  5TZV A;  2ZIW A;  5ALD A;  8ICR A;  2HI0 A;  5KG0 A;  5J2K A;  5J0S A;  3PV8 A;  1X9W A;  1EXN A;  5HMM A;  2ZXH A;  3LK9 A;  4O3M A;  4QJF B;  1KLN A;  2MUT A;  5IIM A;  4CNQ A;  4OJL A;  2VAN A;  2Q0Z X;  8ICB A;  5KFI A;  4OJ5 A;  5H2F U;  3TAD C;  2R8G A;  2P6R A;  1UA0 A;  3LWM A;  5F3X B;  2JXJ A;  3BS5 A;  4CCH A;  2YMQ A;  5CRX A;  2HHX A;  5ALQ A;  2ZIX A;  4UB6 U;  5KFR A;  3FDS A;  2XCA A;  2KZZ A;  4KN4 A;  1TVA A;  2BQU A;  3WK7 A;  4K4H A;  1XO0 A;  4IRK A;  4Y2P A;  4RQ2 A;  5AKY A;  2BQ3 A;  4UB2 A;  3RH5 A;  2HBM A;  5ALK A;  3MFH A;  4DLE A;  1NK8 A;  7ICP A;  3SI8 A;  2CN1 A;  1XC9 A;  5KFD A;  3KHL A;  1NZB A;  2OM6 A;  2V4Q A;  4KLF A;  4I28 A;  5J0Q A;  4M6W B;  4MFF A;  4C8M A;  4UAR A;  2NV3 A;  2HOF A;  4YR3 A;  5AKG A;  1XO1 A;  4RQ3 A;  3I1Y A;  4MF2 A;  7ICT A;  1TAQ A;  3KBB A;  4RQ6 A;  4ED2 A;  5KG2 A;  3UXP A;  2ZIV A;  3QYP A;  5HR7 A;  5KT3 A;  4KN7 A;  3SQI A;  2WF7 A;  4C4S A;  3HKZ C;  4C7Y A;  4F4Y A;  4I2E A;  4B9S A;  4FE3 A;  4UAZ A;  1DXS A;  1YZ6 A;  5G5H A;  3PO4 A;  4RQ8 A;  2Y0S F;  4P0Q B;  3JPS A;  1QH9 A;  4B9U A;  3Q8M A;  2MAX A;  9ICN A;  1A77 A;  5K4L A;  4LJX A;  4QZH A;  1ZRN A;  4UB4 A;  5IIO A;  1T94 A;  5CB1 A;  5D4B A;  3F5A A;  5CHG A;  2BCV A;  4DQS A;  2FJ6 A;  3E0F A;  4Q8F A;  1SXD A;  2KOB A;  3Q8S B;  4GLX A;  1LKY A;  1H38 A;  3QEA Z;  1KSP A;  3RB4 A;  3PX0 A;  2HHU A;  2FMP A;  1IV8 A;  1DGS A;  4DLG A;  2LYA A;  5L1M A;  4YXJ A;  4OJO A;  4IRD A;  4NM1 A;  3MR3 A;  4YP3 A;  3QUT A;  2KP7 A;  3T5K A;  3TAP A;  5AM1 A;  1SV0 C;  2ASJ A;  7ICM A;  1CUK A;  1L8O A;  4CRX A;  4DL5 A;  2BCR A;  2JEF A;  2B6G A;  4QWD A;  3N28 A;  3F2C A;  5AM4 A;  5AK4 A;  2LKY A;  1ZQI A;  4DL4 A;  4DF4 A;  4Q8E A;  4UQG A;  4I2B A;  4F5P A;  1SV4 A;  4I27 A;  3OJU A;  1QCK A;  2KV2 A;  2MUT B;  2E8P A;  3JPQ A;  4J9L A;  5ALU A;  4ELU A;  2V4R A;  3T79 A;  1S77 D;  1N2X A;  2YMP A;  5J0T A;  4KLJ A;  2E8N A;  3IM1 A;  2QKQ A;  5KL1 B;  1L7N A;  2ZIW B;  5AKI A;  1A6S A;  1JN3 A;  1NNL A;  2PFO A;  2OXO A;  5KFZ A;  1MQ3 A;  3UQ2 A;  3PR5 B;  1FFV A;  1KTQ A;  4KX5 A;  3ICX A;  3BQ7 A;  4BUG A;  4P0Q A;  3QU2 A;  5CJ7 A;  5KFF A;  3HWT A;  2C22 A;  2GOL A;  4TUQ A;  4PGX A;  4OO1 J;  1QSL A;  3IP4 B;  2GLE A;  2RDJ A;  5BPC A;  5KT4 A;  5KG3 A;  2W7P A;  4YR0 A;  1K1S A;  5KFL A;  3K1Z A;  2WB1 C;  5HR6 A;  2BCQ A;  4YN4 A;  4RPZ A;  1L3U A;  2A1A A;  1ZQF A;  2JHD A;  2EZX A;  1BPE A;  2H3Z A;  4ED8 A;  2R8I A;  1WWV A;  2IOF A;  1KRP A;  4KLU A;  5KFP A;  5L1J A;  3RRG A;  2PI4 A;  2HCF A;  4Q44 A;  9ICO A;  3V72 A;  3M9O B;  5KG4 A;  3U26 A;  3GV7 B;  2HDO A;  2BPF A;  4EX7 A;  4ZH4 A;  8ICS A;  3PVX A;  8ICG A;  2M0N A;  5J2B A;  4JMU A;  2ASL A;  2EQY A;  9ICQ A;  5AI8 A;  2AH5 A;  1AQ6 A;  4EZ6 A;  4KLL A;  4Q45 A;  2H3F A;  4ZOH C;  2AGO A;  4Y2Y A;  4YVZ A;  4KIT B;  4UB3 A;  3AQE A;  5AM0 A;  4QZI A;  4YMM A;  4FO6 A;  4DOB A;  1TAM A;  1QLN A;  2JRZ A;  2K4H A;  7ICU A;  4MF8 A;  4XUS A;  4KLG A;  4IQW A;  4K4G A;  1WCN A;  1ZD2 P;  1D8B A;  4IC9 A;  3BQ0 A;  1N62 A;  3G6X A;  1L7P A;  2EZZ A;  5DB6 A;  3D2S A;  7ICR A;  3E58 A;  2JV3 A;  5AKZ A;  4Y2Q A;  2IHN A;  4I2I A;  1QQ5 A;  1T3N A;  2NO4 A;  4B6J A;  4KTQ A;  3PR4 A;  2WB1 F;  3G6Y A;  7ICI A;  4I2A A;  2GO7 A;  1CI4 A;  2OYY A;  5ALR A;  1BVS A;  2KIC A;  4GXJ A;  4MHV A;  2F1H A;  1D8L A;  4F91 B;  5J2I A;  5ALT A;  3D2Q A;  4DS4 A;  1LV5 A;  2KZ3 A;  1T8E A;  4AP9 A;  2W3S A;  2OEH A;  3LWL A;  2KVC A;  2HBK A;  3M7D A;  4QW8 A;  1SB3 C;  2ZIU B;  2KJ8 A;  4HAI A;  3FC4 A;  5IIK A;  3CRX A;  4QZB A;  1ZQA A;  4J9S A;  4ECX A;  4C4R A;  1S0M A;  3F2B A;  3QU4 A;  3WKA A;  4CE6 A;  2VIX A;  1L7M A;  5HHI A;  2BHN A;  3H8J A;  1PK3 A;  4C7Z A;  2PMZ F;  1ZQE A;  7ICV A;  3F2D A;  2NRX A;  1ZD3 A;  3GFK B;  5KFE A;  3EW9 A;  2OHF A;  2W9B A;  1NI3 A;  2ISO A;  3G6V A;  2ZIU A;  5JU5 A;  4Y2R A;  3TFR A;  2I6X A;  1KN5 A;  4R8U B;  4ECR A;  3V7J A;  1BPD A;  4DQQ A;  4QZE A;  2BR0 A;  4NLK A;  4NLC A;  5AKL A;  1KBU A;  7ICG A;  2KKP A;  1X9X A;  1FIQ A;  2KMD A;  4FZN A;  3AM9 A;  4QZ8 A;  2KFZ A;  1RDF A;  4Y2T A;  2VA3 A;  4R66 A;  4YCX A;  5DQG A;  5HML A;  2OCE A;  4IQU A;  4QW9 A;  3V6H A;  5ALE A;  3Q8L A;  4BDP A;  2LM1 A;  4DL3 A;  4F4K A;  3MR2 A;  1KFD A;  5J2C A;  3PX4 A;  3OPX A;  3IG8 A;  3OSP A;  1QTM A;  3HP6 A;  5KFN A;  3PZP A;  2A1J A;  3IHQ B;  5JUM A;  4YFK A;  3MR5 A;  2PFP A;  2Y1J A;  3NVV A;  2DUY A;  3JPO A;  4BXO B;  5EWE A;  8ICL A;  1N60 A;  2HVI A;  1MA7 A;  1N5W A;  5HNK A;  2IMW P;  5AKH A;  2HHT A;  1MC8 A;  3MGH A;  3EZ5 A;  3QE9 Y;  2KZM A;  1ZQW A;  4ECS A;  2HOQ A;  5ALF A;  7ICQ A;  1CEZ A;  2F1I A;  4IS7 A;  4ED3 A;  3N4M B;  5DB7 A;  1OUQ A;  1MQ2 A;  1FO4 A;  3BQT A;  3ZD9 A;  4YG2 A;  5CR0 A;  4O3S A;  2G08 A;  1RQL A;  3Q8R B;  4JB3 A;  3TAQ A;  4YQW A;  3RH6 A;  2KEY A;  5AKK A;  2VJ5 A;  2CRX A;  1N61 A;  2EH9 A;  3M6Z A;  3NAS A;  2BDU A;  5AK5 A;  3K4G A;  1PUZ A;  2J6T A;  9ICK A;  4TUR A;  1JMS A;  4G3I A;  3RJE A;  4C8N A;  4DCC A;  5KFM A;  4NLB A;  1S5L U;  4ED1 A;  3RR8 A;  3KZX A;  2J6S A;  3MR6 A;  1LKY B;  4CF3 A;  3SEN A;  4BGD A;  1VDV A;  7ICF A;  1TFR A;  5AHX A;  4FS2 A;  2KE7 A;  5J2D A;  1UCV A;  4R65 A;  2VKQ A;  2FE9 A;  3L3F X;  1ZQK A;  5TIS U;  3R9K A;  4Y2S A;  2LM4 A;  2QLT A;  3VC8 A;  1NK7 A;  5J8Y C;  1DRG A;  1HJP A;  3GZF A;  4IQV A;  3QZ7 A;  2HOI A;  3MBY A;  2JH7 A;  5AIA A;  5IIL A;  1C7Y A;  2NRZ A;  1ZQL A;  1V85 A;  1JRO A;  3AEV A;  4NXZ A;  1B43 A;  2KHQ A;  4JUZ A;  3ZDC A;  4ECQ A;  1RPL A;  5ALY A;  1VLB A;  1ZQH A;  1L3T A;  2W9A A;  3H8S A;  4YD1 A;  3GV8 B;  3NUQ A;  3TAD A;  9ICA A;  3UPQ A;  4R64 A;  2F2A B;  2R8K A;  2XGQ A;  5AKE A;  1HEK A;  4J9R A;  4O3Q A;  4Z6D A;  2NRW A;  2ODG A;  2ZXI A;  4MFA A;  3OTQ A;  4NL9 C;  5KNI A;  2EZY A;  4UW9 A;  4R63 A;  2BZF A;  2HMX A;  4B9T A;  3QU7 A;  4CF4 A;  3C1Y A;  2C2R A;  3CNH A;  4YMN A;  1BPB A;  3OSN A;  2IA6 A;  3V6K A;  4IR1 A;  4M9H A;  4G9B A;  3F53 A;  3BQ1 A;  1Z19 A;  1SKR A;  4MFC A;  1DGJ A;  1ZD5 A;  3H8W A;  5EE9 A;  4DQI A;  3PSP A;  4RQN A;  4TQR A;  3PY8 A;  3KHR A;  4AYB F;  4BXO A;  1HUO A;  1OW5 A;  4LZD A;  1PK1 A;  1Q8K A;  1N63 A;  2YML A;  4Z6C A;  1ZRM A;  4GFJ A;  5EOZ A;  2YY6 A;  1B22 A;  2BKE A;  3H7I A;  5IIJ A;  2J6U A;  2WTF A;  9ICV A;  3WKE A;  1O08 A;  5J2G A;  1NOM A;  2PXI A;  4FZL A;  5KFJ A;  1RXV A;  4RQ1 A;  3M8S A;  2W3R A;  1XSN A;  2FMS A;  1L3V A;  1L3S A;  4B9L A;  2WF8 A;  4NWI A;  2P66 A;  1PK1 B;  1ZQN A;  1WG8 A;  4UBB A;  3GU3 A;  5L9X A;  2F77 X;  2CXY A;  3BS5 B;  2YX8 A;  5DQI A;  3O0F A;  1Q3V A;  2XCP A;  3AU6 A;  3QEB Z;  1ZQZ A;  2RRD A;  3UMC A;  1QSS A;  3NGD A;  1Q46 A; 
#chains in the Genus database with same CATH homology
 3IG5 A;  2HOQ A;  2CPR A;  3CRX A;  2H3Z A;  1HEK A;  2ZIX A;  3RFA A;  1ED1 A;  2DF4 B;  2GH1 A;  2ZXI A;  3N7P D;  1HIW A;  2LYA A;  3PST A;  3F2B A;  3H0L B;  3ONN A;  4FZM A;  2RP5 A;  2ZIX B;  1IIP A;  4OJO A;  2VIX A;  4QIW F;  2XIC A;  1OUQ A;  3C28 A;  1XO0 A;  2ZG6 A;  3CYM A;  4QNL A;  2G5H B;  3SAG A;  3MGV A;  2HMX A;  2VJ4 A;  2PMZ F;  1XNS A;  2E1F A;  2G09 A;  3D2N A;  4NV0 A;  2G08 A;  3F2D A;  2K8A A;  2W7O A;  2G06 A;  2H3Q A;  2N1R A;  4PL2 A;  2G07 A;  2KEY A;  1ECW A;  3AQF A;  2HBM A;  2KJ5 A;  2MRL A;  2XID A;  4C0Z A;  2OH2 A;  2VJ5 A;  2ZIU A;  3F53 A;  2LBO A;  3M6Z A;  1Z19 A;  2CRX A;  4CRX A;  3PSI A;  2BDU A;  4CGZ A;  3N7S C;  2KKV A;  2JH1 A;  2M0N A;  3ALR A;  3F2C A;  2K4E A;  4JMU A;  2CN1 A;  2LHT A;  3PSP A;  3IN5 A;  3KFU F;  2LKY A;  2F76 X;  1Z1B A;  2G0A A;  1NZB A;  1SZH A;  2Q4T A;  2OM6 A;  4A8E A;  3M6K A;  4AYB F;  2H3F A;  4NLC A;  1KBU A;  2R18 A;  2K89 A;  2KKP A;  4U6P A;  2KV2 A;  2MA1 A;  4NLB A;  1Q3U A;  2E1E A;  3AQE A;  4FZN A;  3KZX A;  3T79 A;  1YT3 A;  4AYB C;  2NV3 A;  2HOF A;  4OJ6 A;  1TAM A;  3N7R C;  2K4H A;  1A0P A;  3LVW A;  5KL1 B;  3H0M B;  2KIW A;  2ZIW B;  2H3V A;  3SAH A;  1PVR A;  4CDG A;  1WUD A;  4KX3 A;  1D8B A;  4IC9 A;  2E5S A;  1ZQ1 C;  2K4I A;  1A6S A;  3PSF A;  2KHV A;  2VKQ A;  4GFJ A;  2D6F C;  2WAQ F;  4P0P A;  2DGZ A;  2OXO A;  2KD1 A;  3L3F X;  3LYS A;  3VC8 A;  3D2S A;  2K8B B;  2G5I B;  3RF9 A;  1PVP A;  3NRW A;  4BJQ A;  2ZIV A;  5HR7 A;  2Z7J A;  1P7D A;  2XI9 A;  1GO3 F;  2K8C B;  3SQI A;  2YB1 A;  1DRG A;  2A3V A;  4P0P B;  4FZL A;  2H3I A;  4KX5 A;  3GZF A;  3HKZ C;  1PVQ A;  2HOI A;  3ICX A;  5A0L A;  5T14 A;  4BUG A;  1L6N A;  4ICA A;  4OJP A;  2ZIW A;  2RHF A;  3H0R B;  3IG8 A;  2JH7 A;  2PMZ C;  2WB1 F;  1UPH A;  3OPX A;  4FE3 A;  2YB4 A;  4P0Q A;  4PL1 A;  4U7C A;  1CRX A;  3CP8 A;  3SAF A;  2Y0S F;  3DEE A;  4P0Q B;  4NWI A;  3VCB A;  2GOL A;  2ZXH A;  4QIW C;  3PZP A;  4OO1 J;  2JGA A;  3IP4 B;  4O3M A;  2OYY A;  4QJF B;  2KIC A;  2WAQ C;  3GU3 A;  5KL8 B;  1URJ A;  4OJL A;  4KMO B;  2KHQ A;  2KJ9 A;  2W7P A;  3HKZ F;  1T94 A;  2F77 X;  2ZIV B;  3D2Q A;  3LVV A;  4BX9 C;  1MA7 A;  1F44 A;  3K1Z A;  2JMG A;  2KNJ A;  3F5A A;  3SMV A;  2WB1 C;  5HR6 A;  2YX8 A;  4OJ5 A;  2W04 A;  5C0Y A;  3C29 A;  3O0F A;  1Q3V A;  2XVT A;  2Y0S C;  3AL0 B;  3F5E A;  2HBJ A;  2W03 A;  3NUQ A;  3E0F A;  2JHD A;  2HBK A;  2KVC A;  2LYB A;  2RRD A;  3M7D A;  2F2A B;  2HBL A;  2KOB A;  2DQN B;  4ACO A;  2F8L A;  4WJ3 B;  2ZIU B;  2KJ8 A;  5CRX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...