2KIWA

Solution nmr structure of the domain n-terminal to the integrase domain of sh1003 from staphylococcus haemolyticus. northeast structural genomics consortium target shr105f (64-166).
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
111
structure length
111
Chain Sequence
TFKQVADDWLKQYANDVKVSSVRAREKAIQHAIERFNTKPIQTIKKHDYQRFVDDISAQYSKNYVDSIVASTNMIFKYAYDTRLIKAMPSEGIKRPKKKVSVELEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Int protein
publication title Solution NMR structure of the domain N-terminal to the integrase domain of SH1003 from Staphylococcus haemolyticus. Northeast Structural Genomics Consortium Target ShR105F (64-166).
rcsb
source organism Staphylococcus haemolyticus jcsc1435
total genus 29
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2009-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14659 Phage_int_SAM_3 Phage integrase, N-terminal SAM-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.130 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2kiwA01
1DRGA 1F44A 3MGVA 2A3VA 4CRXA 1CRXA 2KKVA 1Q3VA 2KIWA 1PVRA 1XNSA 4ACOA 1A0PA 2KJ9A 1OUQA 5CRXA 3NRWA 2HOFA 2KJ8A 3CRXA 3C28A 1P7DA 2KOBA 2KD1A 1NZBA 4A8EA 1Z1BA 2KKPA 2OXOA 2KEYA 2KHVA 1MA7A 3C29A 2KHQA 1XO0A 3LYSA 1Q3UA 2HOIA 2KJ5A 1Z19A 1PVPA 1KBUA 2CRXA 1PVQA
chains in the Genus database with same CATH superfamily
5J0WA 2XY6A 1ZYQA 3PSFA 1ZJMA 3LWMA 5CA7A 3TACB 9ICXA 4WJ3B 4UW9A 1HUZA 4I28A 1NKBA 4DSEA 3ZDCA 4GXKA 4ELUA 2CPRA 1MC8A 1ZQTA 3U26A 3PW4A 3OGUA 4ELVA 3H7IA 3C5GA 3PNCA 4IS7A 3PY8A 2D6FC 3IHQB 4OJPA 5AKEA 4RNMA 1ZQGA 2MRLA 1IG6A 2YTUA 3SENA 4KTQA 1RYRA 4DFKA 4I29A 3M6ZA 3IDWA 1T7PA 5DBAA 2W9BA 1L8OA 1NK4A 5AI5A 3I28A 4Q44A 4CF4A 2ZUCA 2KN7A 2F77X 2Y9TA 2A19A 4J9QA 4JV1A 2WF5A 5ALKA 2E1FA 2F8LA 1IIPA 4DLEA 2HOFA 4EYIB 2IHNA 4GC6A 1QLNA 2AQ4A 3QUCA 3M1YA 2XY5A 1SL1A 4DS5A 4Z6CA 4P0PA 4RUCA 3RAXA 3QU9A 3H0LB 2W3RA 3HP6A 1TV9A 1PK3A 3SMVA 1PZNA 3H8WA 3KTQA 3H40A 4YXMA 3N4MB 4PHEA 4RT2A 2NRXA 5HR6A 3GV5B 2KK0A 5DLGA 1L3VA 3SAFA 5KG3A 4J03A 5A0LA 4P4OA 2W11A 1KRPA 2OEHA 4O5KA 4RQ8A 1XSPA 5J2DA 1X9SA 3D6JA 3F53A 1QSYA 9ICIA 1KL9A 3UQ0A 4I2DA 5KFQA 3RJIA 1ZQVA 1CI4A 3HILA 2G06A 4KLUA 2KP7A 1XO1A 5J0RA 2BQ3A 4MF2A 1ED1A 3N97B 1A76A 2FMQA 3TAPA 4C4RA 1KW4A 4Y2TA 1MA7A 3B0YA 4DOBA 4RQ2A 3CYMA 4O3MA 1AQ6A 3NVZA 4HYKA 1SV4A 2KV2A 5AKKA 4PHDA 4ECQA 2PMZF 4NLKA 4DWIA 4YQWA 4QIWF 1CRXA 3PX4A 1S10A 5D49A 1Q3VA 1COOA 4R64A 1U47A 1A0PA 4JWMA 1KEJA 1X6JA 4RPZA 3ISDA 2V4RA 1SKRA 2K8AA 1NK6A 1B4FA 1UHUA 4RQ6A 5HNKA 5JRTA 2R8IA 2XCAA 1B22A 1RXWA 5J2CA 4UB2A 1O08A 1ZQPA 4O3OA 5KFOA 4F5QA 3ICXA 4KLJA 4G9BA 4P4PA 2EZZA 3MR6A 2WAQC 3RRHA 3PVXA 4AP9A 3WK7A 5L1JA 5DKWA 3AM9A 1BGXT 4Y2SA 2K4EA 1N60A 4OJLA 3LK9A 1XS9D 5KFFA 4TURA 3C2KA 2VKQA 5KL8B 4NLGA 2WF9A 5KT4A 5DG9A 4ECXA 4DL4A 3RR7A 2JH7A 2DKZA 3GQCA 3MDCA 3ISCA 2LPEA 2HHTA 2K4PA 3LDAA 3RRGA 1X9WA 5ALWA 7ICJA 4Z6FA 3V7JA 1NJXA 5ALGA 4QZIA 1ZQJA 3DV9A 3C5FA 2BCRA 2HW3A 2Y1IA 3PMLA 3OSPA 1S0MA 4ED2A 5J2GA 2A1JB 1X2IA 4I2JA 4ICAA 3WKBA 2J6TA 1XSLA 4FZMA 4K4IA 4I2CA 2FPKA 1ZD3A 5KFVA 1KFSA 2ZJ5A 2K8CB 3IM1A 4DF4A 4Y2JA 4KX5A 4NXZA 4R8UA 8ICNA 2W9BB 3PX6A 4PL2A 4RNNA 4YN4A 7ICFA 2BKEA 4TUPA 3PSIA 4QZEA 2XICA 3PR5B 4TUSA 4C8NA 1ZQCA 1DK3A 5DB7A 3D2NA 2EAOA 2GOLA 1D9DA 3QZ8A 4DL7A 4DL6A 2KZMA 1P7DA 2LM1A 5E79U 4I27A 3L3FX 4GLXA 5DBCA 1KFDA 2LI6A 4NY8A 3SV4A 3KKAA 4OJ5A 2E8MA 3IV6A 3K1RB 5B5EU 5KFKA 4O3RA 1RYSA 2FE9A 3OHAA 3RB4A 2JV3A 3T3FA 4KLSA 4C8KA 3QUBA 4XQ8A 1LKYB 3NRWA 4YR2A 4KLLA 4UAZA 4J9OA 5ALVA 1ZQYA 4E0DA 5KNIA 2ZTEA 4BJQA 1NKEA 3C1ZA 3PSPA 1J2MA 3ZD8A 2PKEA 5ALFA 2ZTCA 4UAWA 4F5PA 2W3SA 1NK8A 2IBKA 1LB2B 2HBMA 3M9NB 3RJKA 2B6GA 9ICEA 5HHHA 4UASA 4U6PA 3G6VA 1QH9A 4O3NA 4DQSA 3EPGA 1CEZA 1XU4A 5DDYA 4J9MA 2WF6A 9ICQA 4DO9A 1JXLA 2KJ5A 1SZPA 1BNPA 2RQ5A 2MAXA 4G3IA 3GFKB 3T5JA 4UB6U 2BQUA 3RB3A 3SQIA 4DLGA 1BPDA 3E0FA 4C7YA 2ZJ8A 1QQ6A 2W9AA 4KLEA 4Y2YA 5J8YA 1FFUA 3N7PD 1T8EA 3DEEA 3IRUA 4DF8A 1TE2A 2IOFK 1NK7A 1U49A 3C1YA 4NM1A 5BOMA 1SV0C 3VC8A 3M8RA 5KFUA 4QZ9A 2AGQA 5CWRA 4J9KA 4M9LA 4JK1A 3AEVA 3C21A 4BXOA 4DQIA 4HAIA 5ALJA 8ICRA 1IM4A 2PXIA 1ZQMA 2EANA 3SR6A 1ZQDA 4B9MA 2KIVA 1SZHA 2ZJAA 2MSNA 1CUKA 8ICFA 4P4MA 2HBKA 2RRDA 3KOOA 3UXNA 3WK9A 2FJ6A 5KFNA 2L5YA 2FLPA 4QWDA 1K1QA 1TAUA 2WF8A 2AXTU 3LYSA 1BPEA 1ZQXA 1TKDA 4I2EA 1N62A 2BDUA 3UMGA 4ED7A 2RDJA 3HW8A 5FP0A 1Z00A 1TAMA 4O5CA 3PMNA 1ZD4A 2QLTA 1S0NA 3O0FA 4UARA 3MGHA 3M7DA 4BX9C 4PPXA 8ICQA 1PK1B 4J9RA 5AKLA 3ONNA 1ZQUA 1N48A 5J2JA 1Y88A 2ZIWA 5J2FA 1S97A 1S77D 4M9HA 5IIOA 2YMMA 9ICCA 4PHPA 4NL9A 5ALHA 2JZBA 4EBEA 1JIHA 2F44A 2KG5A 5KFJA 3FC4A 4RQMA 4R8UB 4YD2A 5ALNA 3L5KA 5KFIA 3JPSA 2F2AB 2Q4TA 1NJZA 3QZ7A 8ICIA 4J9PA 5J2KA 7ICVA 2EZXA 5J0PA 1ZQBA 4F4XA 5CHGA 5J0TA 7ICNA 3A0BU 2PI5A 3H0MB 3GIMA 2RP5A 2NO5A 8ICTA 1PUZA 3A0HU 3THVA 1HUOA 1YZ7A 4J9SA 5JU5A 5KG4A 9ICNA 9ICPA 2ZIXA 7ICSA 2ASDA 1V85A 3EW9A 1V9PA 1UA1A 2WAQF 1ZQAA 2ESEA 4F2RA 1ZD5A 4BGDA 4ECRA 4DQQA 2LHTA 3K4GA 5AK4A 3TADA 3H4BA 1WCNA 5C5JA 2EAMA 5JTIA 4QZBA 3QUQA 1JXEA 3QE9Y 2NYVA 3Q8LA 2D3DA 1VJ5A 3M8SA 2YN4A 4IR1A 4DQRA 5ALXA 4IR9A 2W04A 2P6RA 3T5LA 3QNMA 4ECSA 3QU7A 3AU2A 2DGZA 4UB4A 2IOFA 2KKVA 2KFNA 5EE3A 9ICAA 2W43A 4IRKA 4AYBC 3PO5A 2IA6A 2WB1C 3Q8QB 1M6YA 2Q0ZX 4DSKA 1WWVA 2BZFA 2QB0A 8ICXA 2ZIVA 3QU2A 4IQTA 4Q8EA 3PV8A 2G5IB 3QU4A 2BCSA 9ICBA 1Z4OA 1UA0A 2W9CA 5CB1A 1ZQOA 1T3NA 4EX6A 3H0RB 4KLQA 3EWAA 1SKWA 4MEYA 4BXOB 2KD1A 3V6KA 3RB0A 4NM2A 3QXGA 4F71A 4C7ZA 3C29A 4YMNA 2ASLA 2XGPA 5AM5A 8ICJA 1HIWA 2A1AA 3FDSA 2MU2A 4M6WA 2B21A 2LMRA 2K60A 3IG8A 1YZ6A 4EYHB 5KFDA 3Q8RB 3AQEA 3GV8B 2LKYA 4Q45A 2FMSA 4QW9A 3SI8A 3N7RC 1HJPA 1JROA 4KMOB 5KFCA 4F2SA 4B9NA 1SWVA 4NJ8A 8ICHA 2Y0SC 3EUB2 4ZH4A 3SD7A 2FDRA 4LJXA 4GC7A 3N7SC 2KJ9A 4QW8A 4UBBA 3CRXA 3WK8A 1JI7A 1RYUA 2KVSA 4ECUA 1BPBA 2I1QA 1H38A 2DWQA 5TISU 1A6SA 1L7OA 1X9XA 3KKAC 2F76X 2G5HB 4C80A 4BWMA 8ICAA 1F44A 1TFRA 1V38A 2C2RA 1ZQNA 4QZHA 4PHAA 4ACOA 2E8OA 2WHEA 3MR5A 2QKQA 5KFRA 4ECZA 4OCZA 3KHGA 1ZQLA 4DSLA 3V7LA 5DLFA 4EBDA 2ISPA 5ALPA 4PGQA 2PI4A 5KFWA 1PVQA 8ICEA 3MGIA 5IILA 3GZFA 4QWAA 3ZDDA 4FZLA 2J6UA 5KAIU 5ALRA 2ZIUA 3N28A 4IQUA 1U9LA 2IHMA 1JALA 3QU5A 1BNOA 3MFIA 1BPZA 4FO6A 2DPIA 4B9VA 2FPMA 4F4ZA 4DOCA 4MFFA 2ZIXB 2N1RA 3WKEA 3HT3A 1GO3F 5EE0A 4JV2A 2R18A 1ZQEA 4UB3A 4QJFB 1QSLA 3J81j 4C4TA 2YY6A 2VANA 3HWTA 5L9XA 2BPFA 3E2EA 3Q8KA 5KL1B 1D8BA 3V6JA 4I2HA 2KKPA 5KT7A 2R8JA 5J8YC 2MUTA 7ICIA 5KG1A 5AI0A 4EEKA 4O0IA 3TQ1A 2KICA 5D4BA 5EWEA 1HEKA 3MGVA 4EZ6A 4F4KA 2NRWA 4O5EA 1QQ5A 4QZAA 4YXJA 4P0QA 3OPXA 5IIMA 4C8MA 1L3SA 5HMMA 4NLZA 4NV0A 1TK5A 5KT3A 3VCBA 1PVPA 1SIJA 4OJ6A 2VA2A 3I1YA 2I6XA 4RQ0A 4PH5A 5G5HA 2WF7A 3C28A 2PFQA 5KFYA 2VJ4A 1DOQA 2QB0B 1L3TA 1J97A 2KZ3A 2ZIVB 2JMGA 2KHQA 1Q3UA 4EX7A 1UPHA 3ZD9A 1RDFA 2EZYA 5DQHA 1RQLA 5J2EA 4FS1A 4CNQA 4Y2PA 1NNLA 3TANA 2GWSA 4MFCA 2LM4A 2JRZA 5AM1A 3SAGA 3M9OB 2W7OA 3PW7A 4RPXA 7ICTA 2KZZA 4K4HA 2E8NA 2DF4B 1F0MA 5KFHA 1XO0A 3NVWA 3HJEA 4EENA 7ICKA 3GU3A 8ICZA 3BQ1A 2YB4A 1DRGA 1B43A 4B6JA 4ELTA 3BQTA 4US9A 1SB3C 4RQ5A 2R8KA 5ALOA 5AKHA 2CN1A 4IL6U 4YMOA 1RG6A 1UCVA 4KX3A 5KFXA 4NL9C 1KLNA 4RPYA 1DK2A 4KLDA 4P0PB 2ZUDA 2BCQA 1V97A 1Z19A 4F93B 3ZDAA 1RM6C 3T79A 4KN4A 2ES6A 4JMUA 4DOAA 5ALEA 4UB8U 1JUDA 5T14A 5CJ7A 2W03A 4QZGA 3RJHA 4I2IA 4YP3A 3FAHA 2W54A 4O3SA 4TQSA 1LV5A 4PZOA 2OWOA 1X6IA 3RBDA 2ODGA 2GO7A 2RDIA 2F1IA 4GXJA 5L1MA 3Q8MA 1N2XA 3PW2A 3HX0A 3FM9A 5KFMA 3BDPA 1Z3EB 4IQVA 4DL5A 3AN1A 4KLGA 3BJYA 2P66A 3TADC 3QEBZ 4RU9A 4DL2A 2KSOA 2NRVA 3RF9A 5ALIA 2P6UA 4AYBF 4I2BA 3HRDD 5ALMA 3ZDEA 3BQ0A 4NLCA 4FFDA 1LVHA 2WB1F 2XC9A 1QTMA 1FIQA 1TAQA 1NJYA 4ED0A 5AKIA 3Q8SB 2F1JA 2HBLA 2YQEA 4FBUA 7ICUA 2NV3A 1F5SA 1VLBA 4M9JA 5J0SA 1K1SA 1DGJA 5IIKA 3PX0A 4IRCA 1KN5A 2C28A 2DUYA 1ZQKA 4YG2A 1KBUA 4F4WA 5J2BA 4EELA 4P0QB 5L1IA 3V7KA 1WYGA 3TAQA 4F5RA 3RJEA 1UQVA 5ALZA 2JGAA 4XA5A 9ICUA 9ICHA 1X9MA 2NRZA 4O3PA 3AU6A 4KLMA 2C2DA 2ZG6A 5KFAA 1ZOLA 4DSIA 7ICPA 5DBBA 2NO4A 3S6JA 2XI9A 7ICRA 2Y0SF 2JH1A 3AMZA 2HHSA 5JUMA 4M9NA 1BVSA 2I5HA 2OCEA 1T4GA 3EZ5A 5AI4A 4DFJA 5KT5A 1L6NA 5GTHU 4DFMA 2UVVA 4M47A 2BCVA 5DG8A 4R63A 3KZXA 1VDVA 3KHHA 3WU2U 5KG2A 5DG7A 2BPCA 3F2BA 2HHWA 4B9TA 1DXSA 2R8HA 1N63A 4ECYA 5ALYA 2HMXA 2HHVA 1IV8A 1TVAA 1EXNA 1YT3A 2VIXA 3JPQA 3MR3A 3PSTA 3HPOA 3B9JA 3WKDA 2KFZA 1ZQZA 4DSFA 2XO7A 5J0UA 5KFTA 5AM3A 3MDAA 5AKXA 5J2IA 1NK0A 3H8SA 4NLBA 5CRXA 3JPNA 2DPJA 2RLTA 3LVWA 4Y2XA 1NZPA 2C22A 9ICVA 1WWUA 2JXJA 2HOIA 2JHDA 1SKSA 4O9MA 2KMDA 2AQ0A 4DS4A 1N61A 4FS2A 1WUDA 4Y2RA 4RQ3A 2E8PA 4Y2VA 2H3FA 1MSWD 3GILA 5AICA 2ZXIA 4O3QA 4M9GA 5AI8A 2W55A 2W8KA 1NZBA 3SZ2A 3KBBA 3PO4A 4EBCA 1QSSA 5DQGA 2W7PA 1RQNA 3TFRA 2PFPA 1KTQA 4KITB 3ETLA 4EEYA 2J6SA 3QUTA 4YR0A 3PW5A 3MC1A 3RJJA 5BPCA 1UT8A 3B0XA 1NOMA 3NVYA 4C0ZA 4GIBA 2VA3A 1K5OA 2EH9A 2YB1A 5AK3A 4RT3A 9ICGA 4QZFA 5J2AA 4NWIA 1ZETA 8ICGA 2DFLA 4YFKA 3RTVA 2KSOB 1KSPA 5J29A 3LVVA 4PJ0U 3IP4B 3HKZC 8ICWA 2DQNB 2HSZA 3NGDA 5KFPA 3PZPA 5ALLA 2F8KA 3RBEA 2Y9UA 2M0NA 3F2DA 4CRXA 3GDXA 1N5XA 3UMCA 2H3IA 3BS7A 9ICRA 2Z7JA 4QNLA 1KKXA 4F8RA 1PVRA 2KTQA 4LZGA 2ISOA 5CP2A 5EWFA 9ICJA 1S0VA 1NK9A 4KLOA 2YX8A 2Y1JA 4RQ1A 4RUAA 3EYZA 5KFGA 3ORYA 1NK5A 1SL2A 4FBTA 4ED8A 2A1JA 3I76A 1B0XA 1ZRMA 3WK6A 2KIWA 5KT2A 4M04A 2KE7A 2P35A 5J2HA 1U48A 1ZQFA 4IC9A 5KG6A 5KTQA 5DGAA 1JRPA 8ICLA 4J9NA 1L8LA 2K8BB 1JN3A 3BQ7A 3R9KA 4F91B 4OO1J 4KLHA 2O6KA 3GV7B 2XCPA 5HP4A 5D46A 5J0OA 3KZIU 1Z00B 2H3QA 8ICSA 1Z1VA 5H2FU 3QX7A 5HHIA 5BOLA 2C2EA 4RQNA 4DFPA 4DEZA 2IMWP 2AJQA 2YMQA 5AKZA 3RAQA 5F9NA 4PGXA 2A3VA 2ZIWB 2BCUA 4R65A 4RNOA 4F50A 7ICLA 2F1HA 2JZBB 4BDPA 1LKYA 3M6KA 3SAHA 2ZXHA 2LYHA 5CR0A 3MBYA 2M9NA 3TKAA 1ZXIA 5ALUA 4ECTA 2OM6A 4PL1A 4MF8A 1L7NA 3G6YA 9ICLA 1Q46A 3RJGA 2CRXA 4B9SA 4DQPA 3T5KA 2B0CA 2H3VA 4K4GA 3NRZA 2K4IA 3BS5A 1J2NA 9ICWA 3NS1A 4RZRA 5J0YA 4UQGA 4KLTA 1D9FA 3JPOA 3KHLA 3GIKA 2KEYA 5AI9A 5IIIA 4QZ8A 4Z6DA 3SEIA 4QZCA 3KHRA 2JEGA 5J0QA 2NRTA 4ECWA 3CW2C 4IRDA 4DFDA 4BWJA 3TFSA 1DGSA 7ICOA 2JEFA 4KMUA 3NUQA 5F9LA 4CF5A 4DCCA 3KFUF 2AH5A 1X40A 1ZQHA 2KVCA 2W9MA 2VJ5A 3WKAA 4DL3A 5ALQA 3TARA 4X5VA 2V9WA 3QYPA 3AL0B 2R8GA 4C4SA 3KD3A 3V6HA 4NLNA 3SV3A 3WKCA 3RH6A 2WFAA 2G09A 1U45A 4XUSA 3PW0A 5KAFU 1C20A 2K4HA 4CE6A 1ZD2P 1UT5A 2FPLA 3BZKA 4Y2UA 4UB5A 2LBOA 2FLLA 2AGOA 1KQQA 9ICKA 2F3NA 3IN5A 7ICHA 1SGGA 4MHVA 5DGBA 4OD0A 5AKGA 5DB9A 4F5OA 9ICOA 2V4QA 1KDHA 5EOZA 2QB1A 1ZQRA 2I9GA 4YCXA 4R66A 1Z1BA 2HVHA 1OXJA 3AQFA 3ALRA 3ZI4A 3C23A 4U7CA 3NTUA 3EPIA 1ZQWA 3RJFA 4C8OA 4JV0A 1IXRA 2YMLA 4OJOA 2DL0A 2G0AA 8ICUA 2W9CB 3AUOA 4F92B 2UVRA 1XNSA 9ICSA 2CXYA 5KG0A 1OUQA 5AI6A 4ECVA 5L1LA 2HCFA 3RFAA 2HDOA 4YVZA 4CDGA 3D2SA 5EE9A 2G08A 8ICMA 2MA1A 1PK1A 8ICVA 8ICKA 1BPXA 4JUZA 5C0YA 1RPLA 1MN8A 2FLNA 2BDPA 1C7YA 5DDMA 4M6WB 2YMPA 4JB3A 4M0AA 5G5GA 3H8MA 7ICEA 2KJ8A 3ETRA 3WK5A 5CEHA 2JR5A 1MQ2A 3MR2A 1S5LU 8ICOA 3CNHA 3OJUA 4MFAA 4USAA 2HHUA 1QCKA 5DB8A 3MFHA 3H8JA 1X42A 3L4PA 2W8LA 4CGZA 2EDUA 4RQ7A 2ALZA 5KFEA 5KG5A 5J0XA 1RXVA 4Z6EA 3WK4A 8ICPA 9ICFA 2QARA 4F3OA 1N5WA 1L7PA 3K75D 3UXOA 2BGWA 2EQYA 4ED6A 9ICMA 4UB1A 3UPQA 1NJWA 3UQ2A 4UBCA 2HI0A 2RHFA 4PZNA 2ATLA 2DKXA 3RH4A 1ZJNA 1U4BA 2H3ZA 5EWGA 3BS5B 4C8LA 5KFBA 4YR3A 3GIIA 5DB6A 4IQWA 1QQ7A 2ZIUB 5AIBA 1NI3A 3H4DA 1JMSA 1WCLA 5AIAA 2BPGA 3HKZF 4QWEA 4B9LA 2BR0A 1BPYA 3F5AA 2GLEA 1D8YA 2PFOA 2KHVA 2BQRA 4KN7A 4TUQA 2AU0A 1X66A 2UVWA 2PMZC 1L7MA 4QIWC 2K89A 4UATA 5L1KA 5ALSA 1D8LA 4I2FA 4ED1A 2JEJA 2DBYA 1ZQ1C 5HR7A 1S8OA 4B9UA 1Q8KA 8ICBA 4ED3A 1ZQIA 1ZRNA 2MUTB 3JPPA 1URJA 4F72A 4US8A 4FZNA 1WG8A 4J9LA 3NVVA 3RH5A 1S9FA 1S76D 4TQRA 4I2AA 1L3UA 3Q8PB 2HHQA 3K1ZA 1ZQSA 2KOBA 5B66U 5F3XB 2ZUBA 1ECWA 2HVIA 1SXEA 2OXOA 2E1EA 1JX4A 2LYAA 5AKJA 5AM4A 2GH1A 3F5EA 5KG7A 2AGPA 4I2GA 2UVUA 4P2HA 3ISBA 4YMMA 3JPTA 5AK5A 2EAPA 3F2CA 4RQ4A 2OHFA 2E3TA 2BHNA 1T94A 1T3QA 2LYBA 1COKA 1SWWA 1OW5A 2H5XA 2ZTDA 3BZCA 3OHBA 2FMPA 1NKCA 5AM0A 5AKYA 4Y2QA 4XRHA 3BQ2A 2IOHA 2HOQA 4PGYA 4Q43A 3RR8A 4KLIA 5AM2A 4LVSA 4ZOHC 2PFNA 5EE1A 2AHOB 2HHXA 3E58A 5KFZA 2OH2A 3QEAZ 3RB6A 5KFSA 5TZVA 4EZ9A 2XY7A 3JPRA 8ICYA 4F4YA 5IINA 4CCHA 1MQ3A 1XWLA 7ICGA 2E5SA 2HBJA 4M2YA 3MABA 1XSNA 2XGQA 1O03A 2OYYA 4GXIA 1FO4A 3C2LA 5ALDA 3NASA 1ZQQA 4YD1A 2XIDA 5KFLA 1RZTA 1TK8A 1A77A 4BUGA 4UAYA 4FE3A 3T5HA 5ALTA 3OTQA 1Z4NA 4KLFA 3M9MB 3D2QA 7ICMA 4UAUA 4CF3A 8ICCA 1S0OA 5GTIU 1FEZA 4MEXA 5DQIA 5IIJA 1SL0A 1XC9A 4GFJA 4LZDA 4QZDA 5KT6A 1L5UA 2QARB 5K4LA 1KFTA 1FFVA 3UXPA 2VA8A 4QWBA 2KNJA 3C2MA 2FI1A 3FYHA 3GIJA 2JEIA 5HMLA 3LWLA 5AHXA 3G6XA 3TI0A 4DSJA 7ICQA 2ASJA 1AROP 3UMBA 5AK6A 9ICTA 4Q8FA 3PR4A 3OJSA 2WTFA 1SXDA 4F5NA 3ED5A 3CP8A 1N56A 2XVTA 2D8CA 3SYZA 1TK0A 3ZDBA 3UM9A 4JWNA 3DDHA 3V72A 4A8EA 3OSNA 4QWCA 2G07A 3IG5A 4UAVA 1SV0A
chains in the Genus database with same CATH topology
2KICA 5C0YA 3T79A 1HEKA 3F53A 2PMZC 3MGVA 4JMUA 1WUDA 2BDUA 4QIWC 2K89A 3PSFA 2HBMA 2Y0SC 4P0QB 2KIWA 4P0QA 3N7SC 2G06A 2KJ9A 3OPXA 5T14A 4U6PA 1TAMA 1ZQ1C 2H3FA 2W03A 2OH2A 2KJ8A 3CRXA 5HR7A 2ZXIA 2CPRA 1ED1A 4NV0A 1NZBA 2JGAA 3O0FA 1Z19A 2E5SA 3M7DA 4IC9A 4BX9C 2HBJA 3NUQA 2W04A 1MA7A 2W7PA 3KFUF 2ZG6A 3CYMA 4O3MA 3VCBA 1A6SA 2KJ5A 1URJA 2OYYA 1PVPA 4ICAA 2K8BB 3ONNA 2F76X 2G5HB 2KV2A 4OO1J 4FZNA 2D6FC 1F44A 2KVCA 2PMZF 4FZMA 2XIDA 2VJ5A 2ZIWA 2XI9A 4OJ6A 4QIWF 2DGZA 4OJPA 3SQIA 1CRXA 2Y0SF 2JH1A 2KKVA 4BUGA 2H3QA 1Q3VA 3AL0B 3E0FA 4ACOA 2MRLA 1A0PA 4FE3A 2K8CB 4CGZA 4AYBC 3K1ZA 3C28A 2KOBA 3D2QA 3M6ZA 2G09A 3N7PD 4KX5A 1ECWA 2VJ4A 2WB1C 1L6NA 2OXOA 3DEEA 2K4HA 4PL2A 2E1EA 4GFJA 2ZIVB 2JMGA 2KHQA 2LBOA 2K8AA 2F2AB 2Q4TA 2ZIVA 4C0ZA 1PVRA 1Q3UA 2YB1A 1UPHA 3KZXA 1PVQA 3PSIA 3IN5A 3GZFA 2XICA 4NWIA 2LYAA 2G5IB 3F2BA 4FZLA 2ZIWB 2A3VA 2F77X 3VC8A 2KNJA 2E1FA 3D2NA 2F8LA 3ICXA 1IIPA 2GOLA 2GH1A 2ZIUA 3LVVA 2HMXA 3RF9A 3M6KA 3SAHA 3H0RB 3SAGA 2W7OA 3F5EA 2ZXHA 3IP4B 2HOFA 3HKZC 4AYBF 1P7DA 2RHFA 2WAQC 2DQNB 2KD1A 3L3FX 4NLCA 1YT3A 2VIXA 2DF4B 2WB1F 3PSTA 3PZPA 1Z1BA 3AQFA 3ALRA 2OM6A 4PL1A 4OJ5A 3C29A 3H0MB 2M0NA 3F2CA 1XO0A 4P0PA 4U7CA 2K4EA 2H3ZA 2RP5A 3F2DA 3GU3A 2CRXA 4CRXA 3H0LB 4OJOA 2H3IA 1SZHA 2YB4A 3CP8A 4OJLA 1DRGA 2H3VA 2G0AA 1HIWA 2Z7JA 2XVTA 4QNLA 2HBLA 2K4IA 2N1RA 2ZIXB 3SMVA 1T94A 2ZIXA 2LYBA 1GO3F 1XNSA 2VKQA 3IG8A 2CN1A 2NV3A 2ZIUB 2R18A 4NLBA 5KL8B 1OUQA 5CRXA 4QJFB 3NRWA 2HBKA 2RRDA 4KX3A 3HKZF 3RFAA 3LVWA 5HR6A 4CDGA 2WAQF 5KL1B 3AQEA 3F5AA 4A8EA 4BJQA 3SAFA 2YX8A 3D2SA 1D8BA 2KEYA 2KKPA 2JH7A 3PSPA 5A0LA 4WJ3B 2G08A 2KHVA 2G07A 2LKYA 2MA1A 4P0PB 3IG5A 2HOQA 3LYSA 2HOIA 2JHDA 3N7RC 2LHTA 1KBUA 4KMOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DRG A;  1F44 A;  3MGV A;  2A3V A;  4CRX A;  1CRX A;  2KKV A;  1Q3V A;  2KIW A;  1PVR A;  1XNS A;  4ACO A;  1A0P A;  2KJ9 A;  1OUQ A;  5CRX A;  3NRW A;  2HOF A;  2KJ8 A;  3CRX A;  3C28 A;  1P7D A;  2KOB A;  2KD1 A;  1NZB A;  4A8E A;  1Z1B A;  2KKP A;  2OXO A;  2KEY A;  2KHV A;  1MA7 A;  3C29 A;  2KHQ A;  1XO0 A;  3LYS A;  1Q3U A;  2HOI A;  2KJ5 A;  1Z19 A;  1PVP A;  1KBU A;  2CRX A;  1PVQ A; 
#chains in the Genus database with same CATH topology
 5J0W A;  2XY6 A;  1ZYQ A;  3PSF A;  1ZJM A;  3LWM A;  5CA7 A;  3TAC B;  9ICX A;  4WJ3 B;  4UW9 A;  1HUZ A;  4I28 A;  1NKB A;  4DSE A;  3ZDC A;  4GXK A;  4ELU A;  2CPR A;  1MC8 A;  1ZQT A;  3U26 A;  3PW4 A;  3OGU A;  4ELV A;  3H7I A;  3C5G A;  3PNC A;  4IS7 A;  3PY8 A;  2D6F C;  3IHQ B;  4OJP A;  5AKE A;  4RNM A;  1ZQG A;  2MRL A;  1IG6 A;  2YTU A;  3SEN A;  4KTQ A;  1RYR A;  4DFK A;  4I29 A;  3M6Z A;  3IDW A;  1T7P A;  5DBA A;  2W9B A;  1L8O A;  1NK4 A;  5AI5 A;  3I28 A;  4Q44 A;  4CF4 A;  2ZUC A;  2KN7 A;  2F77 X;  2Y9T A;  2A19 A;  4J9Q A;  4JV1 A;  2WF5 A;  5ALK A;  2E1F A;  2F8L A;  1IIP A;  4DLE A;  2HOF A;  4EYI B;  2IHN A;  4GC6 A;  1QLN A;  2AQ4 A;  3QUC A;  3M1Y A;  2XY5 A;  1SL1 A;  4DS5 A;  4Z6C A;  4P0P A;  4RUC A;  3RAX A;  3QU9 A;  3H0L B;  2W3R A;  3HP6 A;  1TV9 A;  1PK3 A;  3SMV A;  1PZN A;  3H8W A;  3KTQ A;  3H40 A;  4YXM A;  3N4M B;  4PHE A;  4RT2 A;  2NRX A;  5HR6 A;  3GV5 B;  2KK0 A;  5DLG A;  1L3V A;  3SAF A;  5KG3 A;  4J03 A;  5A0L A;  4P4O A;  2W11 A;  1KRP A;  2OEH A;  4O5K A;  4RQ8 A;  1XSP A;  5J2D A;  1X9S A;  3D6J A;  3F53 A;  1QSY A;  9ICI A;  1KL9 A;  3UQ0 A;  4I2D A;  5KFQ A;  3RJI A;  1ZQV A;  1CI4 A;  3HIL A;  2G06 A;  4KLU A;  2KP7 A;  1XO1 A;  5J0R A;  2BQ3 A;  4MF2 A;  1ED1 A;  3N97 B;  1A76 A;  2FMQ A;  3TAP A;  4C4R A;  1KW4 A;  4Y2T A;  1MA7 A;  3B0Y A;  4DOB A;  4RQ2 A;  3CYM A;  4O3M A;  1AQ6 A;  3NVZ A;  4HYK A;  1SV4 A;  2KV2 A;  5AKK A;  4PHD A;  4ECQ A;  2PMZ F;  4NLK A;  4DWI A;  4YQW A;  4QIW F;  1CRX A;  3PX4 A;  1S10 A;  5D49 A;  1Q3V A;  1COO A;  4R64 A;  1U47 A;  1A0P A;  4JWM A;  1KEJ A;  1X6J A;  4RPZ A;  3ISD A;  2V4R A;  1SKR A;  2K8A A;  1NK6 A;  1B4F A;  1UHU A;  4RQ6 A;  5HNK A;  5JRT A;  2R8I A;  2XCA A;  1B22 A;  1RXW A;  5J2C A;  4UB2 A;  1O08 A;  1ZQP A;  4O3O A;  5KFO A;  4F5Q A;  3ICX A;  4KLJ A;  4G9B A;  4P4P A;  2EZZ A;  3MR6 A;  2WAQ C;  3RRH A;  3PVX A;  4AP9 A;  3WK7 A;  5L1J A;  5DKW A;  3AM9 A;  1BGX T;  4Y2S A;  2K4E A;  1N60 A;  4OJL A;  3LK9 A;  1XS9 D;  5KFF A;  4TUR A;  3C2K A;  2VKQ A;  5KL8 B;  4NLG A;  2WF9 A;  5KT4 A;  5DG9 A;  4ECX A;  4DL4 A;  3RR7 A;  2JH7 A;  2DKZ A;  3GQC A;  3MDC A;  3ISC A;  2LPE A;  2HHT A;  2K4P A;  3LDA A;  3RRG A;  1X9W A;  5ALW A;  7ICJ A;  4Z6F A;  3V7J A;  1NJX A;  5ALG A;  4QZI A;  1ZQJ A;  3DV9 A;  3C5F A;  2BCR A;  2HW3 A;  2Y1I A;  3PML A;  3OSP A;  1S0M A;  4ED2 A;  5J2G A;  2A1J B;  1X2I A;  4I2J A;  4ICA A;  3WKB A;  2J6T A;  1XSL A;  4FZM A;  4K4I A;  4I2C A;  2FPK A;  1ZD3 A;  5KFV A;  1KFS A;  2ZJ5 A;  2K8C B;  3IM1 A;  4DF4 A;  4Y2J A;  4KX5 A;  4NXZ A;  4R8U A;  8ICN A;  2W9B B;  3PX6 A;  4PL2 A;  4RNN A;  4YN4 A;  7ICF A;  2BKE A;  4TUP A;  3PSI A;  4QZE A;  2XIC A;  3PR5 B;  4TUS A;  4C8N A;  1ZQC A;  1DK3 A;  5DB7 A;  3D2N A;  2EAO A;  2GOL A;  1D9D A;  3QZ8 A;  4DL7 A;  4DL6 A;  2KZM A;  1P7D A;  2LM1 A;  5E79 U;  4I27 A;  3L3F X;  4GLX A;  5DBC A;  1KFD A;  2LI6 A;  4NY8 A;  3SV4 A;  3KKA A;  4OJ5 A;  2E8M A;  3IV6 A;  3K1R B;  5B5E U;  5KFK A;  4O3R A;  1RYS A;  2FE9 A;  3OHA A;  3RB4 A;  2JV3 A;  3T3F A;  4KLS A;  4C8K A;  3QUB A;  4XQ8 A;  1LKY B;  3NRW A;  4YR2 A;  4KLL A;  4UAZ A;  4J9O A;  5ALV A;  1ZQY A;  4E0D A;  5KNI A;  2ZTE A;  4BJQ A;  1NKE A;  3C1Z A;  3PSP A;  1J2M A;  3ZD8 A;  2PKE A;  5ALF A;  2ZTC A;  4UAW A;  4F5P A;  2W3S A;  1NK8 A;  2IBK A;  1LB2 B;  2HBM A;  3M9N B;  3RJK A;  2B6G A;  9ICE A;  5HHH A;  4UAS A;  4U6P A;  3G6V A;  1QH9 A;  4O3N A;  4DQS A;  3EPG A;  1CEZ A;  1XU4 A;  5DDY A;  4J9M A;  2WF6 A;  9ICQ A;  4DO9 A;  1JXL A;  2KJ5 A;  1SZP A;  1BNP A;  2RQ5 A;  2MAX A;  4G3I A;  3GFK B;  3T5J A;  4UB6 U;  2BQU A;  3RB3 A;  3SQI A;  4DLG A;  1BPD A;  3E0F A;  4C7Y A;  2ZJ8 A;  1QQ6 A;  2W9A A;  4KLE A;  4Y2Y A;  5J8Y A;  1FFU A;  3N7P D;  1T8E A;  3DEE A;  3IRU A;  4DF8 A;  1TE2 A;  2IOF K;  1NK7 A;  1U49 A;  3C1Y A;  4NM1 A;  5BOM A;  1SV0 C;  3VC8 A;  3M8R A;  5KFU A;  4QZ9 A;  2AGQ A;  5CWR A;  4J9K A;  4M9L A;  4JK1 A;  3AEV A;  3C21 A;  4BXO A;  4DQI A;  4HAI A;  5ALJ A;  8ICR A;  1IM4 A;  2PXI A;  1ZQM A;  2EAN A;  3SR6 A;  1ZQD A;  4B9M A;  2KIV A;  1SZH A;  2ZJA A;  2MSN A;  1CUK A;  8ICF A;  4P4M A;  2HBK A;  2RRD A;  3KOO A;  3UXN A;  3WK9 A;  2FJ6 A;  5KFN A;  2L5Y A;  2FLP A;  4QWD A;  1K1Q A;  1TAU A;  2WF8 A;  2AXT U;  3LYS A;  1BPE A;  1ZQX A;  1TKD A;  4I2E A;  1N62 A;  2BDU A;  3UMG A;  4ED7 A;  2RDJ A;  3HW8 A;  5FP0 A;  1Z00 A;  1TAM A;  4O5C A;  3PMN A;  1ZD4 A;  2QLT A;  1S0N A;  3O0F A;  4UAR A;  3MGH A;  3M7D A;  4BX9 C;  4PPX A;  8ICQ A;  1PK1 B;  4J9R A;  5AKL A;  3ONN A;  1ZQU A;  1N48 A;  5J2J A;  1Y88 A;  2ZIW A;  5J2F A;  1S97 A;  1S77 D;  4M9H A;  5IIO A;  2YMM A;  9ICC A;  4PHP A;  4NL9 A;  5ALH A;  2JZB A;  4EBE A;  1JIH A;  2F44 A;  2KG5 A;  5KFJ A;  3FC4 A;  4RQM A;  4R8U B;  4YD2 A;  5ALN A;  3L5K A;  5KFI A;  3JPS A;  2F2A B;  2Q4T A;  1NJZ A;  3QZ7 A;  8ICI A;  4J9P A;  5J2K A;  7ICV A;  2EZX A;  5J0P A;  1ZQB A;  4F4X A;  5CHG A;  5J0T A;  7ICN A;  3A0B U;  2PI5 A;  3H0M B;  3GIM A;  2RP5 A;  2NO5 A;  8ICT A;  1PUZ A;  3A0H U;  3THV A;  1HUO A;  1YZ7 A;  4J9S A;  5JU5 A;  5KG4 A;  9ICN A;  9ICP A;  2ZIX A;  7ICS A;  2ASD A;  1V85 A;  3EW9 A;  1V9P A;  1UA1 A;  2WAQ F;  1ZQA A;  2ESE A;  4F2R A;  1ZD5 A;  4BGD A;  4ECR A;  4DQQ A;  2LHT A;  3K4G A;  5AK4 A;  3TAD A;  3H4B A;  1WCN A;  5C5J A;  2EAM A;  5JTI A;  4QZB A;  3QUQ A;  1JXE A;  3QE9 Y;  2NYV A;  3Q8L A;  2D3D A;  1VJ5 A;  3M8S A;  2YN4 A;  4IR1 A;  4DQR A;  5ALX A;  4IR9 A;  2W04 A;  2P6R A;  3T5L A;  3QNM A;  4ECS A;  3QU7 A;  3AU2 A;  2DGZ A;  4UB4 A;  2IOF A;  2KKV A;  2KFN A;  5EE3 A;  9ICA A;  2W43 A;  4IRK A;  4AYB C;  3PO5 A;  2IA6 A;  2WB1 C;  3Q8Q B;  1M6Y A;  2Q0Z X;  4DSK A;  1WWV A;  2BZF A;  2QB0 A;  8ICX A;  2ZIV A;  3QU2 A;  4IQT A;  4Q8E A;  3PV8 A;  2G5I B;  3QU4 A;  2BCS A;  9ICB A;  1Z4O A;  1UA0 A;  2W9C A;  5CB1 A;  1ZQO A;  1T3N A;  4EX6 A;  3H0R B;  4KLQ A;  3EWA A;  1SKW A;  4MEY A;  4BXO B;  2KD1 A;  3V6K A;  3RB0 A;  4NM2 A;  3QXG A;  4F71 A;  4C7Z A;  3C29 A;  4YMN A;  2ASL A;  2XGP A;  5AM5 A;  8ICJ A;  1HIW A;  2A1A A;  3FDS A;  2MU2 A;  4M6W A;  2B21 A;  2LMR A;  2K60 A;  3IG8 A;  1YZ6 A;  4EYH B;  5KFD A;  3Q8R B;  3AQE A;  3GV8 B;  2LKY A;  4Q45 A;  2FMS A;  4QW9 A;  3SI8 A;  3N7R C;  1HJP A;  1JRO A;  4KMO B;  5KFC A;  4F2S A;  4B9N A;  1SWV A;  4NJ8 A;  8ICH A;  2Y0S C;  3EUB 2;  4ZH4 A;  3SD7 A;  2FDR A;  4LJX A;  4GC7 A;  3N7S C;  2KJ9 A;  4QW8 A;  4UBB A;  3CRX A;  3WK8 A;  1JI7 A;  1RYU A;  2KVS A;  4ECU A;  1BPB A;  2I1Q A;  1H38 A;  2DWQ A;  5TIS U;  1A6S A;  1L7O A;  1X9X A;  3KKA C;  2F76 X;  2G5H B;  4C80 A;  4BWM A;  8ICA A;  1F44 A;  1TFR A;  1V38 A;  2C2R A;  1ZQN A;  4QZH A;  4PHA A;  4ACO A;  2E8O A;  2WHE A;  3MR5 A;  2QKQ A;  5KFR A;  4ECZ A;  4OCZ A;  3KHG A;  1ZQL A;  4DSL A;  3V7L A;  5DLF A;  4EBD A;  2ISP A;  5ALP A;  4PGQ A;  2PI4 A;  5KFW A;  1PVQ A;  8ICE A;  3MGI A;  5IIL A;  3GZF A;  4QWA A;  3ZDD A;  4FZL A;  2J6U A;  5KAI U;  5ALR A;  2ZIU A;  3N28 A;  4IQU A;  1U9L A;  2IHM A;  1JAL A;  3QU5 A;  1BNO A;  3MFI A;  1BPZ A;  4FO6 A;  2DPI A;  4B9V A;  2FPM A;  4F4Z A;  4DOC A;  4MFF A;  2ZIX B;  2N1R A;  3WKE A;  3HT3 A;  1GO3 F;  5EE0 A;  4JV2 A;  2R18 A;  1ZQE A;  4UB3 A;  4QJF B;  1QSL A;  3J81 j;  4C4T A;  2YY6 A;  2VAN A;  3HWT A;  5L9X A;  2BPF A;  3E2E A;  3Q8K A;  5KL1 B;  1D8B A;  3V6J A;  4I2H A;  2KKP A;  5KT7 A;  2R8J A;  5J8Y C;  2MUT A;  7ICI A;  5KG1 A;  5AI0 A;  4EEK A;  4O0I A;  3TQ1 A;  2KIC A;  5D4B A;  5EWE A;  1HEK A;  3MGV A;  4EZ6 A;  4F4K A;  2NRW A;  4O5E A;  1QQ5 A;  4QZA A;  4YXJ A;  4P0Q A;  3OPX A;  5IIM A;  4C8M A;  1L3S A;  5HMM A;  4NLZ A;  4NV0 A;  1TK5 A;  5KT3 A;  3VCB A;  1PVP A;  1SIJ A;  4OJ6 A;  2VA2 A;  3I1Y A;  2I6X A;  4RQ0 A;  4PH5 A;  5G5H A;  2WF7 A;  3C28 A;  2PFQ A;  5KFY A;  2VJ4 A;  1DOQ A;  2QB0 B;  1L3T A;  1J97 A;  2KZ3 A;  2ZIV B;  2JMG A;  2KHQ A;  1Q3U A;  4EX7 A;  1UPH A;  3ZD9 A;  1RDF A;  2EZY A;  5DQH A;  1RQL A;  5J2E A;  4FS1 A;  4CNQ A;  4Y2P A;  1NNL A;  3TAN A;  2GWS A;  4MFC A;  2LM4 A;  2JRZ A;  5AM1 A;  3SAG A;  3M9O B;  2W7O A;  3PW7 A;  4RPX A;  7ICT A;  2KZZ A;  4K4H A;  2E8N A;  2DF4 B;  1F0M A;  5KFH A;  1XO0 A;  3NVW A;  3HJE A;  4EEN A;  7ICK A;  3GU3 A;  8ICZ A;  3BQ1 A;  2YB4 A;  1DRG A;  1B43 A;  4B6J A;  4ELT A;  3BQT A;  4US9 A;  1SB3 C;  4RQ5 A;  2R8K A;  5ALO A;  5AKH A;  2CN1 A;  4IL6 U;  4YMO A;  1RG6 A;  1UCV A;  4KX3 A;  5KFX A;  4NL9 C;  1KLN A;  4RPY A;  1DK2 A;  4KLD A;  4P0P B;  2ZUD A;  2BCQ A;  1V97 A;  1Z19 A;  4F93 B;  3ZDA A;  1RM6 C;  3T79 A;  4KN4 A;  2ES6 A;  4JMU A;  4DOA A;  5ALE A;  4UB8 U;  1JUD A;  5T14 A;  5CJ7 A;  2W03 A;  4QZG A;  3RJH A;  4I2I A;  4YP3 A;  3FAH A;  2W54 A;  4O3S A;  4TQS A;  1LV5 A;  4PZO A;  2OWO A;  1X6I A;  3RBD A;  2ODG A;  2GO7 A;  2RDI A;  2F1I A;  4GXJ A;  5L1M A;  3Q8M A;  1N2X A;  3PW2 A;  3HX0 A;  3FM9 A;  5KFM A;  3BDP A;  1Z3E B;  4IQV A;  4DL5 A;  3AN1 A;  4KLG A;  3BJY A;  2P66 A;  3TAD C;  3QEB Z;  4RU9 A;  4DL2 A;  2KSO A;  2NRV A;  3RF9 A;  5ALI A;  2P6U A;  4AYB F;  4I2B A;  3HRD D;  5ALM A;  3ZDE A;  3BQ0 A;  4NLC A;  4FFD A;  1LVH A;  2WB1 F;  2XC9 A;  1QTM A;  1FIQ A;  1TAQ A;  1NJY A;  4ED0 A;  5AKI A;  3Q8S B;  2F1J A;  2HBL A;  2YQE A;  4FBU A;  7ICU A;  2NV3 A;  1F5S A;  1VLB A;  4M9J A;  5J0S A;  1K1S A;  1DGJ A;  5IIK A;  3PX0 A;  4IRC A;  1KN5 A;  2C28 A;  2DUY A;  1ZQK A;  4YG2 A;  1KBU A;  4F4W A;  5J2B A;  4EEL A;  4P0Q B;  5L1I A;  3V7K A;  1WYG A;  3TAQ A;  4F5R A;  3RJE A;  1UQV A;  5ALZ A;  2JGA A;  4XA5 A;  9ICU A;  9ICH A;  1X9M A;  2NRZ A;  4O3P A;  3AU6 A;  4KLM A;  2C2D A;  2ZG6 A;  5KFA A;  1ZOL A;  4DSI A;  7ICP A;  5DBB A;  2NO4 A;  3S6J A;  2XI9 A;  7ICR A;  2Y0S F;  2JH1 A;  3AMZ A;  2HHS A;  5JUM A;  4M9N A;  1BVS A;  2I5H A;  2OCE A;  1T4G A;  3EZ5 A;  5AI4 A;  4DFJ A;  5KT5 A;  1L6N A;  5GTH U;  4DFM A;  2UVV A;  4M47 A;  2BCV A;  5DG8 A;  4R63 A;  3KZX A;  1VDV A;  3KHH A;  3WU2 U;  5KG2 A;  5DG7 A;  2BPC A;  3F2B A;  2HHW A;  4B9T A;  1DXS A;  2R8H A;  1N63 A;  4ECY A;  5ALY A;  2HMX A;  2HHV A;  1IV8 A;  1TVA A;  1EXN A;  1YT3 A;  2VIX A;  3JPQ A;  3MR3 A;  3PST A;  3HPO A;  3B9J A;  3WKD A;  2KFZ A;  1ZQZ A;  4DSF A;  2XO7 A;  5J0U A;  5KFT A;  5AM3 A;  3MDA A;  5AKX A;  5J2I A;  1NK0 A;  3H8S A;  4NLB A;  5CRX A;  3JPN A;  2DPJ A;  2RLT A;  3LVW A;  4Y2X A;  1NZP A;  2C22 A;  9ICV A;  1WWU A;  2JXJ A;  2HOI A;  2JHD A;  1SKS A;  4O9M A;  2KMD A;  2AQ0 A;  4DS4 A;  1N61 A;  4FS2 A;  1WUD A;  4Y2R A;  4RQ3 A;  2E8P A;  4Y2V A;  2H3F A;  1MSW D;  3GIL A;  5AIC A;  2ZXI A;  4O3Q A;  4M9G A;  5AI8 A;  2W55 A;  2W8K A;  1NZB A;  3SZ2 A;  3KBB A;  3PO4 A;  4EBC A;  1QSS A;  5DQG A;  2W7P A;  1RQN A;  3TFR A;  2PFP A;  1KTQ A;  4KIT B;  3ETL A;  4EEY A;  2J6S A;  3QUT A;  4YR0 A;  3PW5 A;  3MC1 A;  3RJJ A;  5BPC A;  1UT8 A;  3B0X A;  1NOM A;  3NVY A;  4C0Z A;  4GIB A;  2VA3 A;  1K5O A;  2EH9 A;  2YB1 A;  5AK3 A;  4RT3 A;  9ICG A;  4QZF A;  5J2A A;  4NWI A;  1ZET A;  8ICG A;  2DFL A;  4YFK A;  3RTV A;  2KSO B;  1KSP A;  5J29 A;  3LVV A;  4PJ0 U;  3IP4 B;  3HKZ C;  8ICW A;  2DQN B;  2HSZ A;  3NGD A;  5KFP A;  3PZP A;  5ALL A;  2F8K A;  3RBE A;  2Y9U A;  2M0N A;  3F2D A;  4CRX A;  3GDX A;  1N5X A;  3UMC A;  2H3I A;  3BS7 A;  9ICR A;  2Z7J A;  4QNL A;  1KKX A;  4F8R A;  1PVR A;  2KTQ A;  4LZG A;  2ISO A;  5CP2 A;  5EWF A;  9ICJ A;  1S0V A;  1NK9 A;  4KLO A;  2YX8 A;  2Y1J A;  4RQ1 A;  4RUA A;  3EYZ A;  5KFG A;  3ORY A;  1NK5 A;  1SL2 A;  4FBT A;  4ED8 A;  2A1J A;  3I76 A;  1B0X A;  1ZRM A;  3WK6 A;  2KIW A;  5KT2 A;  4M04 A;  2KE7 A;  2P35 A;  5J2H A;  1U48 A;  1ZQF A;  4IC9 A;  5KG6 A;  5KTQ A;  5DGA A;  1JRP A;  8ICL A;  4J9N A;  1L8L A;  2K8B B;  1JN3 A;  3BQ7 A;  3R9K A;  4F91 B;  4OO1 J;  4KLH A;  2O6K A;  3GV7 B;  2XCP A;  5HP4 A;  5D46 A;  5J0O A;  3KZI U;  1Z00 B;  2H3Q A;  8ICS A;  1Z1V A;  5H2F U;  3QX7 A;  5HHI A;  5BOL A;  2C2E A;  4RQN A;  4DFP A;  4DEZ A;  2IMW P;  2AJQ A;  2YMQ A;  5AKZ A;  3RAQ A;  5F9N A;  4PGX A;  2A3V A;  2ZIW B;  2BCU A;  4R65 A;  4RNO A;  4F50 A;  7ICL A;  2F1H A;  2JZB B;  4BDP A;  1LKY A;  3M6K A;  3SAH A;  2ZXH A;  2LYH A;  5CR0 A;  3MBY A;  2M9N A;  3TKA A;  1ZXI A;  5ALU A;  4ECT A;  2OM6 A;  4PL1 A;  4MF8 A;  1L7N A;  3G6Y A;  9ICL A;  1Q46 A;  3RJG A;  2CRX A;  4B9S A;  4DQP A;  3T5K A;  2B0C A;  2H3V A;  4K4G A;  3NRZ A;  2K4I A;  3BS5 A;  1J2N A;  9ICW A;  3NS1 A;  4RZR A;  5J0Y A;  4UQG A;  4KLT A;  1D9F A;  3JPO A;  3KHL A;  3GIK A;  2KEY A;  5AI9 A;  5III A;  4QZ8 A;  4Z6D A;  3SEI A;  4QZC A;  3KHR A;  2JEG A;  5J0Q A;  2NRT A;  4ECW A;  3CW2 C;  4IRD A;  4DFD A;  4BWJ A;  3TFS A;  1DGS A;  7ICO A;  2JEF A;  4KMU A;  3NUQ A;  5F9L A;  4CF5 A;  4DCC A;  3KFU F;  2AH5 A;  1X40 A;  1ZQH A;  2KVC A;  2W9M A;  2VJ5 A;  3WKA A;  4DL3 A;  5ALQ A;  3TAR A;  4X5V A;  2V9W A;  3QYP A;  3AL0 B;  2R8G A;  4C4S A;  3KD3 A;  3V6H A;  4NLN A;  3SV3 A;  3WKC A;  3RH6 A;  2WFA A;  2G09 A;  1U45 A;  4XUS A;  3PW0 A;  5KAF U;  1C20 A;  2K4H A;  4CE6 A;  1ZD2 P;  1UT5 A;  2FPL A;  3BZK A;  4Y2U A;  4UB5 A;  2LBO A;  2FLL A;  2AGO A;  1KQQ A;  9ICK A;  2F3N A;  3IN5 A;  7ICH A;  1SGG A;  4MHV A;  5DGB A;  4OD0 A;  5AKG A;  5DB9 A;  4F5O A;  9ICO A;  2V4Q A;  1KDH A;  5EOZ A;  2QB1 A;  1ZQR A;  2I9G A;  4YCX A;  4R66 A;  1Z1B A;  2HVH A;  1OXJ A;  3AQF A;  3ALR A;  3ZI4 A;  3C23 A;  4U7C A;  3NTU A;  3EPI A;  1ZQW A;  3RJF A;  4C8O A;  4JV0 A;  1IXR A;  2YML A;  4OJO A;  2DL0 A;  2G0A A;  8ICU A;  2W9C B;  3AUO A;  4F92 B;  2UVR A;  1XNS A;  9ICS A;  2CXY A;  5KG0 A;  1OUQ A;  5AI6 A;  4ECV A;  5L1L A;  2HCF A;  3RFA A;  2HDO A;  4YVZ A;  4CDG A;  3D2S A;  5EE9 A;  2G08 A;  8ICM A;  2MA1 A;  1PK1 A;  8ICV A;  8ICK A;  1BPX A;  4JUZ A;  5C0Y A;  1RPL A;  1MN8 A;  2FLN A;  2BDP A;  1C7Y A;  5DDM A;  4M6W B;  2YMP A;  4JB3 A;  4M0A A;  5G5G A;  3H8M A;  7ICE A;  2KJ8 A;  3ETR A;  3WK5 A;  5CEH A;  2JR5 A;  1MQ2 A;  3MR2 A;  1S5L U;  8ICO A;  3CNH A;  3OJU A;  4MFA A;  4USA A;  2HHU A;  1QCK A;  5DB8 A;  3MFH A;  3H8J A;  1X42 A;  3L4P A;  2W8L A;  4CGZ A;  2EDU A;  4RQ7 A;  2ALZ A;  5KFE A;  5KG5 A;  5J0X A;  1RXV A;  4Z6E A;  3WK4 A;  8ICP A;  9ICF A;  2QAR A;  4F3O A;  1N5W A;  1L7P A;  3K75 D;  3UXO A;  2BGW A;  2EQY A;  4ED6 A;  9ICM A;  4UB1 A;  3UPQ A;  1NJW A;  3UQ2 A;  4UBC A;  2HI0 A;  2RHF A;  4PZN A;  2ATL A;  2DKX A;  3RH4 A;  1ZJN A;  1U4B A;  2H3Z A;  5EWG A;  3BS5 B;  4C8L A;  5KFB A;  4YR3 A;  3GII A;  5DB6 A;  4IQW A;  1QQ7 A;  2ZIU B;  5AIB A;  1NI3 A;  3H4D A;  1JMS A;  1WCL A;  5AIA A;  2BPG A;  3HKZ F;  4QWE A;  4B9L A;  2BR0 A;  1BPY A;  3F5A A;  2GLE A;  1D8Y A;  2PFO A;  2KHV A;  2BQR A;  4KN7 A;  4TUQ A;  2AU0 A;  1X66 A;  2UVW A;  2PMZ C;  1L7M A;  4QIW C;  2K89 A;  4UAT A;  5L1K A;  5ALS A;  1D8L A;  4I2F A;  4ED1 A;  2JEJ A;  2DBY A;  1ZQ1 C;  5HR7 A;  1S8O A;  4B9U A;  1Q8K A;  8ICB A;  4ED3 A;  1ZQI A;  1ZRN A;  2MUT B;  3JPP A;  1URJ A;  4F72 A;  4US8 A;  4FZN A;  1WG8 A;  4J9L A;  3NVV A;  3RH5 A;  1S9F A;  1S76 D;  4TQR A;  4I2A A;  1L3U A;  3Q8P B;  2HHQ A;  3K1Z A;  1ZQS A;  2KOB A;  5B66 U;  5F3X B;  2ZUB A;  1ECW A;  2HVI A;  1SXE A;  2OXO A;  2E1E A;  1JX4 A;  2LYA A;  5AKJ A;  5AM4 A;  2GH1 A;  3F5E A;  5KG7 A;  2AGP A;  4I2G A;  2UVU A;  4P2H A;  3ISB A;  4YMM A;  3JPT A;  5AK5 A;  2EAP A;  3F2C A;  4RQ4 A;  2OHF A;  2E3T A;  2BHN A;  1T94 A;  1T3Q A;  2LYB A;  1COK A;  1SWW A;  1OW5 A;  2H5X A;  2ZTD A;  3BZC A;  3OHB A;  2FMP A;  1NKC A;  5AM0 A;  5AKY A;  4Y2Q A;  4XRH A;  3BQ2 A;  2IOH A;  2HOQ A;  4PGY A;  4Q43 A;  3RR8 A;  4KLI A;  5AM2 A;  4LVS A;  4ZOH C;  2PFN A;  5EE1 A;  2AHO B;  2HHX A;  3E58 A;  5KFZ A;  2OH2 A;  3QEA Z;  3RB6 A;  5KFS A;  5TZV A;  4EZ9 A;  2XY7 A;  3JPR A;  8ICY A;  4F4Y A;  5IIN A;  4CCH A;  1MQ3 A;  1XWL A;  7ICG A;  2E5S A;  2HBJ A;  4M2Y A;  3MAB A;  1XSN A;  2XGQ A;  1O03 A;  2OYY A;  4GXI A;  1FO4 A;  3C2L A;  5ALD A;  3NAS A;  1ZQQ A;  4YD1 A;  2XID A;  5KFL A;  1RZT A;  1TK8 A;  1A77 A;  4BUG A;  4UAY A;  4FE3 A;  3T5H A;  5ALT A;  3OTQ A;  1Z4N A;  4KLF A;  3M9M B;  3D2Q A;  7ICM A;  4UAU A;  4CF3 A;  8ICC A;  1S0O A;  5GTI U;  1FEZ A;  4MEX A;  5DQI A;  5IIJ A;  1SL0 A;  1XC9 A;  4GFJ A;  4LZD A;  4QZD A;  5KT6 A;  1L5U A;  2QAR B;  5K4L A;  1KFT A;  1FFV A;  3UXP A;  2VA8 A;  4QWB A;  2KNJ A;  3C2M A;  2FI1 A;  3FYH A;  3GIJ A;  2JEI A;  5HML A;  3LWL A;  5AHX A;  3G6X A;  3TI0 A;  4DSJ A;  7ICQ A;  2ASJ A;  1ARO P;  3UMB A;  5AK6 A;  9ICT A;  4Q8F A;  3PR4 A;  3OJS A;  2WTF A;  1SXD A;  4F5N A;  3ED5 A;  3CP8 A;  1N56 A;  2XVT A;  2D8C A;  3SYZ A;  1TK0 A;  3ZDB A;  3UM9 A;  4JWN A;  3DDH A;  3V72 A;  4A8E A;  3OSN A;  4QWC A;  2G07 A;  3IG5 A;  4UAV A;  1SV0 A; 
#chains in the Genus database with same CATH homology
 2KIC A;  5C0Y A;  3T79 A;  1HEK A;  3F53 A;  2PMZ C;  3MGV A;  4JMU A;  1WUD A;  2BDU A;  4QIW C;  2K89 A;  3PSF A;  2HBM A;  2Y0S C;  4P0Q B;  2KIW A;  4P0Q A;  3N7S C;  2G06 A;  2KJ9 A;  3OPX A;  5T14 A;  4U6P A;  1TAM A;  1ZQ1 C;  2H3F A;  2W03 A;  2OH2 A;  2KJ8 A;  3CRX A;  5HR7 A;  2ZXI A;  2CPR A;  1ED1 A;  4NV0 A;  1NZB A;  2JGA A;  3O0F A;  1Z19 A;  2E5S A;  3M7D A;  4IC9 A;  4BX9 C;  2HBJ A;  3NUQ A;  2W04 A;  1MA7 A;  2W7P A;  3KFU F;  2ZG6 A;  3CYM A;  4O3M A;  3VCB A;  1A6S A;  2KJ5 A;  1URJ A;  2OYY A;  1PVP A;  4ICA A;  2K8B B;  3ONN A;  2F76 X;  2G5H B;  2KV2 A;  4OO1 J;  4FZN A;  2D6F C;  1F44 A;  2KVC A;  2PMZ F;  4FZM A;  2XID A;  2VJ5 A;  2ZIW A;  2XI9 A;  4OJ6 A;  4QIW F;  2DGZ A;  4OJP A;  3SQI A;  1CRX A;  2Y0S F;  2JH1 A;  2KKV A;  4BUG A;  2H3Q A;  1Q3V A;  3AL0 B;  3E0F A;  4ACO A;  2MRL A;  1A0P A;  4FE3 A;  2K8C B;  4CGZ A;  4AYB C;  3K1Z A;  3C28 A;  2KOB A;  3D2Q A;  3M6Z A;  2G09 A;  3N7P D;  4KX5 A;  1ECW A;  2VJ4 A;  2WB1 C;  1L6N A;  2OXO A;  3DEE A;  2K4H A;  4PL2 A;  2E1E A;  4GFJ A;  2ZIV B;  2JMG A;  2KHQ A;  2LBO A;  2K8A A;  2F2A B;  2Q4T A;  2ZIV A;  4C0Z A;  1PVR A;  1Q3U A;  2YB1 A;  1UPH A;  3KZX A;  1PVQ A;  3PSI A;  3IN5 A;  3GZF A;  2XIC A;  4NWI A;  2LYA A;  2G5I B;  3F2B A;  4FZL A;  2ZIW B;  2A3V A;  2F77 X;  3VC8 A;  2KNJ A;  2E1F A;  3D2N A;  2F8L A;  3ICX A;  1IIP A;  2GOL A;  2GH1 A;  2ZIU A;  3LVV A;  2HMX A;  3RF9 A;  3M6K A;  3SAH A;  3H0R B;  3SAG A;  2W7O A;  3F5E A;  2ZXH A;  3IP4 B;  2HOF A;  3HKZ C;  4AYB F;  1P7D A;  2RHF A;  2WAQ C;  2DQN B;  2KD1 A;  3L3F X;  4NLC A;  1YT3 A;  2VIX A;  2DF4 B;  2WB1 F;  3PST A;  3PZP A;  1Z1B A;  3AQF A;  3ALR A;  2OM6 A;  4PL1 A;  4OJ5 A;  3C29 A;  3H0M B;  2M0N A;  3F2C A;  1XO0 A;  4P0P A;  4U7C A;  2K4E A;  2H3Z A;  2RP5 A;  3F2D A;  3GU3 A;  2CRX A;  4CRX A;  3H0L B;  4OJO A;  2H3I A;  1SZH A;  2YB4 A;  3CP8 A;  4OJL A;  1DRG A;  2H3V A;  2G0A A;  1HIW A;  2Z7J A;  2XVT A;  4QNL A;  2HBL A;  2K4I A;  2N1R A;  2ZIX B;  3SMV A;  1T94 A;  2ZIX A;  2LYB A;  1GO3 F;  1XNS A;  2VKQ A;  3IG8 A;  2CN1 A;  2NV3 A;  2ZIU B;  2R18 A;  4NLB A;  5KL8 B;  1OUQ A;  5CRX A;  4QJF B;  3NRW A;  2HBK A;  2RRD A;  4KX3 A;  3HKZ F;  3RFA A;  3LVW A;  5HR6 A;  4CDG A;  2WAQ F;  5KL1 B;  3AQE A;  3F5A A;  4A8E A;  4BJQ A;  3SAF A;  2YX8 A;  3D2S A;  1D8B A;  2KEY A;  2KKP A;  2JH7 A;  3PSP A;  5A0L A;  4WJ3 B;  2G08 A;  2KHV A;  2G07 A;  2LKY A;  2MA1 A;  4P0P B;  3IG5 A;  2HOQ A;  3LYS A;  2HOI A;  2JHD A;  3N7R C;  2LHT A;  1KBU A;  4KMO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...