2KIWA

Solution nmr structure of the domain n-terminal to the integrase domain of sh1003 from staphylococcus haemolyticus. northeast structural genomics consortium target shr105f (64-166).
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
111
structure length
111
Chain Sequence
b'TFKQVADDWLKQYANDVKVSSVRAREKAIQHAIERFNTKPIQTIKKHDYQRFVDDISAQYSKNYVDSIVASTNMIFKYAYDTRLIKAMPSEGIKRPKKKVSVELEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Int protein
publication title Solution NMR structure of the domain N-terminal to the integrase domain of SH1003 from Staphylococcus haemolyticus. Northeast Structural Genomics Consortium Target ShR105F (64-166).
rcsb
source organism Staphylococcus haemolyticus jcsc1435
molecule tags Dna binding protein
total genus 29
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2009-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14659 Phage_int_SAM_3 Phage integrase, N-terminal SAM-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.130 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2kiwA01
1P7DA 3C28A 2KOBA 2OXOA 2KJ9A 2CRXA 2A3VA 1XNSA 1MA7A 4A8EA 1Q3UA 2KEYA 4ACOA 2KHVA 2KD1A 1CRXA 3MGVA 1NZBA 2KIWA 1PVRA 2HOIA 2HOFA 1PVPA 4CRXA 1F44A 1PVQA 2KKVA 1DRGA 1KBUA 2KHQA 3C29A 2KJ5A 3NRWA 1A0PA 5CRXA 1Q3VA 3CRXA 1XO0A 1Z19A 1OUQA 2KJ8A 3LYSA 2KKPA 1Z1BA
chains in the Genus database with same CATH superfamily
1SV0A 5DG8A 4PHPA 4B9TA 4AP9A 3JPTA 2AJQA 2FDRA 2VIXA 5KFQA 4RQ4A 2XVTA 3G6YA 2IHNA 2G08A 1S10A 5J0OA 3QX7A 5KT3A 2HOIA 4F5NA 2EAMA 5IIOA 2BCUA 4IQVA 2EAPA 4QWCA 3TQ1A 2W04A 4GXJA 3Q8KA 3Q8RB 3ZDDA 4B9VA 3F53A 1Z00B 4TURA 1ZQIA 5KT4A 4UAVA 3GILA 4PL2A 9ICOA 4EX6A 3QUCA 1L7MA 1PUZA 2RHFA 4DSJA 5CEHA 4ECXA 4OCZA 2KV2A 1SXEA 2KTQA 2KZZA 1RXWA 3JPOA 1SL0A 3WK4A 5C5JA 4I2HA 1SKWA 9ICTA 4DEZA 2F1JA 3ORYA 5DLFA 1HEKA 3BJYA 2W03A 5AM3A 3M6ZA 1N5WA 9ICBA 4DFPA 4UB8U 3D6JA 4Z6EA 2HOFA 4QWEA 1TK8A 5KT6A 2XGPA 3MR6A 7ICKA 2EANA 2Z7JA 3T5KA 2ZIUA 4FZLA 7ICEA 2V4RA 4DFJA 4FE3A 4PHDA 4GLXA 1DK2A 1JXLA 2PMZC 5KG5A 1NNLA 4RT3A 1XSLA 4R63A 4I2JA 4RQNA 4F93B 1F44A 4FS1A 2I1QA 3EZ5A 1L7NA 2ZIUB 1S9FA 1BVSA 1ZQJA 7ICTA 1X9SA 3T5HA 1KTQA 2G06A 3IDWA 3F2CA 4KLUA 9ICCA 2HVIA 1N5XA 1ZETA 4A8EA 1Q3UA 4Z6FA 5ALFA 5ALOA 2Y1IA 3IRUA 5J2HA 5HHIA 5J8YA 4LVSA 1KW4A 5J0WA 2DKZA 2HDOA 4YXJA 3BQ0A 4CDGA 3WU2U 5F9LA 4R8UA 2YB4A 4NJ8A 5AK3A 3V6KA 4KMUA 3GV7B 4UW9A 5KTQA 2M0NA 2KE7A 3LDAA 5HHHA 2MU2A 2D6FC 5CP2A 2RDJA 4R8UB 1C20A 3EUB2 1TK0A 2LI6A 5AI5A 2NO4A 3RFAA 4B6JA 2N1RA 4J9RA 2OXOA 4OJ5A 2H3VA 2KN7A 5AI0A 4B9SA 3QUBA 2H3FA 4PGQA 2LMRA 4JV1A 4MFFA 1XU4A 1U9LA 4DFKA 2ZTEA 4MFAA 1WYGA 1PVRA 1ZQUA 3PX6A 1KQQA 3IG5A 3NVWA 4Y2YA 1J2NA 3M1YA 1NKBA 2K89A 4J9LA 2OEHA 1RQNA 2XY7A 4F4WA 1L5UA 3AU2A 2JZBB 2XC9A 3AQEA 4Y2PA 1BPEA 2HCFA 3IG8A 2UVWA 3SZ2A 2VKQA 3WK8A 3QU4A 4M04A 3NVZA 4NL9A 1O08A 3UPQA 1IXRA 2EDUA 3M8RA 1KN5A 1HIWA 2E8NA 4ECTA 3ETLA 2MAXA 2MUTA 4XRHA 2PFPA 2IA6A 4PJ0U 1UA0A 5KFFA 5KAIU 2GWSA 4NM2A 4KLJA 2BKEA 2JHDA 2ZTCA 1XSPA 4F4KA 5J0RA 2MUTB 5DG9A 4X5VA 4BWJA 2HHUA 8ICHA 2LYHA 1D9DA 4ED1A 2KVSA 1ZQPA 3NGDA 4F71A 3C2MA 5L1IA 3OJUA 3K1ZA 1NKEA 2K4IA 1RXVA 5TISU 1KFSA 3ZDCA 4IRDA 3OSPA 4C80A 2RQ5A 4NLGA 9ICRA 4IRCA 4QW9A 2DWQA 3EWAA 2HHWA 7ICVA 1DGJA 4CF4A 3ISBA 3F5AA 1BPYA 2VA2A 4O3OA 1X9WA 4P2HA 3LYSA 2ASDA 3AM9A 2XY5A 4UQGA 1K5OA 9ICUA 1WWUA 3WK9A 2FPLA 2EAOA 5AKKA 3SQIA 1ZQKA 2F1IA 5ALSA 8ICFA 5AI6A 5DQHA 5B66U 1BNOA 5D49A 3PR4A 2IBKA 3WKAA 4F92B 1Q46A 4C4TA 2LYAA 4JWMA 1ZQYA 4RNMA 4GC6A 1T4GA 3MR3A 1HJPA 2WF7A 3PW4A 2VJ5A 3QU2A 1RPLA 3TANA 2CPRA 2IOHA 4PHEA 4US8A 2KNJA 1YZ6A 3N4MB 4YD2A 1L8LA 3C2LA 4QZ8A 4YVZA 3HP6A 4DFDA 1D8YA 1TFRA 4OJ6A 2H3IA 3PW7A 3PO4A 2HHSA 1AQ6A 5J2KA 3UMBA 5KFEA 4UB4A 3C29A 2ZIVB 5KFGA 3BS5A 3ALRA 1J2MA 4KTQA 3RF9A 3QEAZ 3PW0A 2E3TA 4DQPA 2NRWA 3QUTA 5EE0A 4RQMA 4PL1A 3C21A 1ZQFA 2HVHA 2B21A 1KL9A 2F44A 4QJFB 3BS5B 1SZPA 2JH1A 3E0FA 3V7JA 4ED6A 7ICFA 2F77X 5KG7A 8ICWA 1S0MA 3QUQA 2W55A 2NRXA 5DLGA 1C7YA 3F5EA 5KG0A 3M9MB 1X6JA 2W8KA 5F9NA 3RJEA 2A3VA 4KLIA 4Y2RA 2W8LA 1ZQGA 2XCAA 5AIAA 5AIBA 3SYZA 2I5HA 3FC4A 5J0UA 4YXMA 1TV9A 4KLGA 5J2GA 3V6HA 2K8AA 1D8LA 5J2AA 4J9NA 2KHVA 3JPSA 2C22A 1SXDA 2F3NA 5KFMA 5KFAA 3CNHA 1N60A 2WFAA 3F2DA 4TUPA 4UAYA 2W9MA 1ZQVA 5ALJA 9ICWA 2HMXA 4ELUA 3M6KA 3RBEA 5J2IA 1XSNA 5ALGA 1ZQSA 2VANA 4B9LA 2G07A 4QZFA 1AROP 4EENA 2QB1A 4DSIA 3VC8A 4G9BA 2F2AB 3SAHA 2DUYA 4LZDA 1D9FA 3U26A 1F0MA 2HI0A 5D46A 4RT2A 1B4FA 1X66A 2DFLA 5KFWA 4Y2UA 1JMSA 3PMNA 5IILA 4DSLA 2OYYA 2IMWP 2LKYA 3MABA 4GXKA 3D2SA 2G5IB 4HYKA 1TAQA 5AKHA 3I28A 4ECQA 2ESEA 1QSLA 3RJHA 4DQQA 2KZMA 3PVXA 2W9BA 1VJ5A 4QZBA 5KNIA 3IN5A 1XC9A 1QQ6A 5DDYA 4PGXA 5BOMA 2YMMA 3RJJA 4GXIA 3PV8A 4I2IA 4ICAA 1IG6A 4IL6U 2W9BB 3RJKA 1SB3C 2ODGA 2HHXA 3NS1A 1DGSA 1UHUA 1U47A 2H3QA 4IR1A 2ZJAA 3ICXA 5IIMA 5AM5A 2F1HA 3RR7A 2KHQA 1UT8A 3RTVA 3AQFA 3RB0A 4UBBA 5GTHU 1BPBA 1S5LU 2IOFA 3HJEA 2GO7A 2ZIWA 4C7YA 5KG4A 2PI5A 5J2DA 3T5JA 2E5SA 2XGQA 4UAZA 3EW9A 3BS7A 3GV8B 5JU5A 5KFRA 2PKEA 1L3SA 3H7IA 1Q3VA 3NTUA 3KHGA 2ZIWB 3KKAA 4J9MA 2AGQA 3M9OB 4P4MA 4F4XA 4KMOB 3JPNA 5G5GA 3ISDA 4ACOA 1SL2A 3AEVA 1TVAA 1Y88A 2ZUBA 5CWRA 4K4HA 3RB4A 4MEXA 3OSNA 5KFUA 3FAHA 3GU3A 4DS4A 4M6WA 2G5HB 3ISCA 4KLEA 4O5KA 5KFLA 3F2BA 1FO4A 2QARA 2WF6A 4UARA 3H4DA 1ZQMA 2DPIA 3PW5A 2Y0SC 4MHVA 4EYIB 4C8LA 4PGYA 4ECZA 4M6WB 1ZQZA 4MEYA 4DWIA 1ZQEA 3K4GA 2ASLA 3KZIU 7ICUA 2NYVA 2QARB 2BR0A 1NI3A 3WK6A 4DQIA 2LYBA 3WK5A 4EEYA 3RRHA 1MN8A 4YMNA 2R8IA 2JH7A 5AI8A 4DOCA 4F5PA 4NL9C 5CB1A 1WG8A 3AMZA 3PSPA 2OCEA 1U48A 4OD0A 2FLNA 2W3SA 2W9CA 3T3FA 4IQUA 1KEJA 1ZQOA 3DDHA 1Q8KA 8ICNA 3RB6A 3Q8SB 2W11A 1PVQA 1DK3A 3ZD8A 5KFOA 4BXOA 1TAMA 3G6VA 3EYZA 8ICXA 3SMVA 4NLBA 1ZQNA 2W9CB 3FM9A 2W7PA 4O3NA 4R65A 1OXJA 1SWVA 3DV9A 5E79U 3LVWA 2FLPA 4NM1A 1Z1VA 3C5FA 5KL1B 3JPPA 4QZDA 4BXOB 1S8OA 4KLLA 5J0QA 1V85A 4RQ6A 5ALEA 4JMUA 9ICEA 3M9NB 3CP8A 1S0OA 8ICSA 3SAGA 4U6PA 5HMMA 4BX9C 5EOZA 4K4IA 4EBDA 2XIDA 2DL0A 2Q0ZX 5KFKA 4YN4A 2XY6A 1YZ7A 2YQEA 4UB1A 2NO5A 4NLCA 1S0VA 2KFNA 4EX7A 3NUQA 8ICAA 4QZHA 2BCSA 4M9LA 2KJ8A 2P35A 3UMGA 5ALMA 5J2FA 4IQWA 1L3UA 4O3SA 5KFHA 2BPCA 4Q8FA 9ICVA 2AXTU 4EZ6A 1MA7A 3TADC 5DG7A 4Y2SA 4BDPA 5EE9A 5J0TA 4XQ8A 4YR3A 5KG6A 3A0BU 3L4PA 1ZQHA 5FP0A 3MBYA 5J2EA 3SD7A 5KFTA 2FMSA 1HUOA 4OJOA 4M9HA 5DBCA 2ZUDA 3QZ7A 4C8KA 1U45A 4JK1A 4O9MA 2LM4A 9ICGA 3RJIA 5J0XA 4YR0A 3OJSA 2ZTDA 4Y2QA 5L1JA 4JV2A 3UMCA 1DXSA 2AGOA 3TARA 1ZQDA 2RDIA 4JB3A 2H3ZA 5GTIU 1HUZA 4F8RA 1DOQA 4DO9A 5IIIA 1SKRA 3L5KA 4B9UA 4C4RA 4ECYA 3KOOA 3RH4A 5KG2A 3HILA 5IIKA 3JPQA 3RH6A 4F5RA 3BDPA 5ALLA 4DL3A 3ZDEA 3FDSA 4FFDA 1SZHA 1ZRMA 5KFPA 5T14A 3NRWA 1QLNA 4EZ9A 5L1MA 4R66A 4C8OA 2JEGA 2KJ9A 4PHAA 2HSZA 2ZJ5A 3RR8A 4RQ7A 2NV3A 3TAQA 7ICJA 5KFZA 2G09A 1UQVA 5ALWA 5B5EU 4P0QA 4J9PA 1ZYQA 3Q8LA 5A0LA 4KLTA 4FO6A 4IC9A 1Z4NA 5KFXA 3QXGA 3SENA 4ECSA 2EH9A 4DOBA 2A1JA 1X9XA 4P0QB 4XUSA 1KBUA 3RBDA 4Q45A 4C0ZA 4ECVA 1ZRNA 1ZQXA 3TAPA 3O0FA 2A1JB 1XO1A 2LHTA 3MDCA 1SIJA 1JXEA 5BPCA 4KN4A 1BPZA 2BQ3A 4RUAA 1EXNA 4OJLA 2ISPA 4OO1J 1D8BA 1ZQWA 2EZXA 4WJ3B 4QZ9A 4Y2JA 5KT7A 1NJXA 2ZUCA 2KVCA 2B6GA 2JGAA 1XNSA 5DBAA 2DBYA 1ED1A 4QIWF 3G6XA 1X9MA 8ICRA 3V7LA 5ALXA 1KKXA 3T79A 3CW2C 2C2DA 1XS9D 1Z3EB 4YQWA 2KK0A 1WWVA 4CE6A 2KG5A 5AKEA 5AKJA 2BGWA 4US9A 2YX8A 4EBEA 3GIIA 4I2FA 3LWMA 3GQCA 2BHNA 4F5QA 2BCQA 2FLLA 1WCNA 3PSIA 1S76D 5EE3A 3PO5A 4YR2A 9ICXA 1JIHA 5K4LA 3PMLA 1QH9A 5AHXA 4I2EA 2NRVA 4ELVA 2F8KA 8ICVA 5J29A 2G0AA 2FPMA 2IOFK 3UQ0A 2ATLA 4M2YA 4B9NA 1ZD2P 4DL7A 9ICLA 4O5EA 4EELA 1N63A 5AKXA 4ZOHC 4EYHB 4F72A 3MDAA 2KICA 5HMLA 3TFSA 3H0RB 3C23A 5HP4A 3N7SC 1COOA 7ICPA 1NZPA 4RNNA 2BPFA 4UATA 4BWMA 4QZGA 3GFKB 2HHVA 1QSSA 5EWGA 2W9AA 1T3QA 4G3IA 3OGUA 4NY8A 2CN1A 4TQRA 4QZIA 4DF4A 2C2RA 4DSKA 2UVUA 2W54A 2KD1A 1ZD4A 1SV0C 3TACB 5HNKA 1LKYA 3LVVA 4ED2A 4QW8A 3HKZF 4F50A 2W3RA 3J81j 4ECWA 5ALIA 7ICGA 3N7PD 2MA1A 4KLSA 4TQSA 4QZAA 3K75D 5F3XB 4RQ1A 1NK0A 7ICSA 1LKYB 2I6XA 2RRDA 3KD3A 4UB6U 3NASA 4QZEA 2FJ6A 1DRGA 1JRPA 1QQ5A 4GC7A 3H8MA 4AYBF 2R8JA 3TI0A 3PX4A 5EWEA 4KX5A 5ALRA 4YMMA 5KFNA 2P6UA 3A0HU 3BQTA 4CGZA 2KMDA 2VJ4A 3MFHA 1BGXT 5C0YA 2WAQF 2ZXHA 3BQ2A 5KFBA 5J0SA 1LVHA 1N62A 4LJXA 1CRXA 4I2CA 4RQ8A 3QZ8A 2XCPA 2ZIXA 1PK1A 3PX0A 4NLZA 5AI4A 1RDFA 4M9GA 5ALVA 3HRDD 2WHEA 4JWNA 3V7KA 2ZIXB 1NK5A 1PK1B 4BJQA 4I2GA 1RYUA 1QQ7A 3LK9A 3C1ZA 2BCVA 4DLGA 4DL6A 1BPDA 4TUQA 2O6KA 5L1LA 5AKIA 2A19A 3RAXA 2AH5A 1YT3A 3PY8A 3PR5B 5CA7A 5AI9A 8ICYA 4KITB 5DQIA 3T5LA 1WUDA 3QNMA 1L3VA 1ZQ1C 2WB1F 4CCHA 5ALNA 3WK7A 4NV0A 2ISOA 1M6YA 4I2DA 3VCBA 1KFDA 4DLEA 3N97B 4J9KA 4O3PA 4RU9A 2ALZA 2HBKA 7ICNA 5J8YC 4M9JA 3I76A 3TKAA 2C2EA 2HBLA 4KLQA 7ICQA 1FFUA 1KRPA 4PPXA 4J9SA 1BNPA 2J6TA 1TE2A 4C8MA 3H0MB 4P4OA 4M9NA 1KFTA 2KZ3A 4ED3A 4DS5A 5AM1A 8ICTA 2BDPA 2PFNA 4ED8A 1RYSA 3QU5A 4BGDA 1NK6A 2W7OA 3D2QA 1L3TA 4Z6CA 3MC1A 4Y2VA 2PXIA 1X6IA 2VA3A 5AK6A 2YMLA 3ETRA 2RP5A 1JX4A 4RQ2A 3B0XA 4O3RA 3MGVA 1ZD3A 8ICJA 2AGPA 4F2RA 1KDHA 3BZCA 2AQ0A 3CYMA 4I2BA 1ZD5A 4MF8A 4RNOA 2GOLA 4GIBA 1V97A 8ICUA 3OPXA 1Z00A 2E1FA 1QTMA 2NRTA 9ICQA 4FBTA 4ECUA 4RQ3A 5CHGA 3HPOA 2KSOA 5J2BA 3M7DA 2DQNB 4CF3A 4UAUA 1PK3A 2VA8A 3DEEA 4ZH4A 1N2XA 2GH1A 2B0CA 4QIWC 2FI1A 2FE9A 2V9WA 1TAUA 1O03A 7ICHA 4YCXA 1V38A 3H8WA 2PFOA 2KSOB 1IV8A 1LV5A 3LWLA 4DCCA 5J2JA 4I29A 1NK8A 8ICOA 4YMOA 3H8SA 1ECWA 3ZI4A 3IM1A 7ICRA 1NJZA 3H8JA 1S97A 4USAA 1NK7A 2JRZA 5KFSA 3KBBA 1X42A 3ZD9A 1X40A 5DB9A 2QB0A 4QWBA 3NRZA 4PZOA 2R18A 4ECRA 4YP3A 2XO7A 4QWDA 3MGIA 2XICA 4UB3A 5BOLA 2UVRA 3WKBA 7ICIA 1RZTA 3C2KA 1ZJNA 4KLFA 8ICEA 3OHBA 2QB0B 1SL1A 1N56A 4IQTA 3RAQA 3L3FX 3WKDA 1Z1BA 3C28A 9ICKA 4KLDA 2JXJA 5CJ7A 5DB7A 3D2NA 5G5HA 5ALTA 3GIJA 3UXPA 3SV3A 3PW2A 4EEKA 3GZFA 3OHAA 1K1QA 1IM4A 2BPGA 3ONNA 2KJ5A 2YTUA 5L9XA 1ZQLA 5DQGA 1WCLA 2Y9UA 1FIQA 3UXOA 2K8CB 1UA1A 2BCRA 4I28A 3H0LB 2HOQA 3KZXA 2NRZA 3B0YA 2MRLA 2UVVA 1NK9A 3C1YA 5AKGA 1A0PA 1IIPA 2ZJ8A 2R8HA 1COKA 1FFVA 3KFUF 5ALUA 5HR6A 3PSFA 1UT5A 4RPZA 2J6SA 3KTQA 3HKZC 2QLTA 2QKQA 1TK5A 2D8CA 2EZZA 4FBUA 4DF8A 3E2EA 1VLBA 4YFKA 5AK4A 3H4BA 2A1AA 2KOBA 5DGBA 4MF2A 5KFYA 2JZBA 4XA5A 5ALKA 4DOAA 3N7RC 3RJFA 4B9MA 1UPHA 2JEJA 3ZDAA 1SKSA 4ELTA 2HHQA 1T7PA 1NJYA 5ALDA 4AYBC 4J9OA 4RQ5A 1MC8A 1ZOLA 4I27A 4P0PA 4K4GA 1JI7A 3AN1A 2WAQC 2GLEA 5IINA 3ED5A 3H40A 3FYHA 3SEIA 2HHTA 2ZXIA 5KFVA 5AKZA 3ZDBA 3EPIA 1BPXA 1B0XA 3Q8MA 4Q43A 4JUZA 4RPYA 1CUKA 2V4QA 3KHRA 2DPJA 4P0PB 1NZBA 5J2CA 4YG2A 5KT5A 4RQ0A 2LBOA 4Y2XA 4RPXA 3NVVA 1XO0A 4IS7A 4NXZA 5AK5A 5TZVA 3UXNA 4UBCA 4I2AA 1B22A 2MSNA 2HW3A 2YB1A 2D3DA 5ALHA 4Z6DA 1V9PA 4DFMA 3IHQB 3V6JA 7ICMA 1U4BA 2JEIA 8ICQA 3I1YA 4FZNA 3QEBZ 3Q8QB 3HW8A 2Y1JA 2FMQA 5DB6A 3RH5A 1RQLA 2E1EA 2FMPA 8ICBA 3HT3A 3K1RB 4F4ZA 2ZG6A 4NLKA 2WB1C 2CXYA 2P6RA 3MR5A 1RG6A 3SAFA 4RZRA 4LZGA 3N28A 3SV4A 5KFDA 1K1SA 3E58A 1JROA 4O0IA 2XI9A 5KAFU 5ALQA 2Y0SF 1T94A 1ZQAA 4KLMA 3AL0B 2OHFA 2LPEA 4DL4A 5AKLA 1H38A 3IV6A 4RUCA 1MSWD 2YN4A 1T8EA 2CRXA 2AQ4A 1SWWA 1RM6C 4IRKA 4DQRA 5KL8B 2J6UA 8ICIA 3AU6A 4ED7A 4DQSA 4KLHA 9ICJA 2YMQA 4E0DA 1S0NA 1ZQQA 2AHOB 2W43A 3TADA 2C28A 2R8KA 4TUSA 3JPRA 1T3NA 3S6JA 2OM6A 1KLNA 2KKPA 5AM4A 5JRTA 2M9NA 3GV5B 1VDVA 5J0YA 3QE9Y 3HX0A 2PFQA 1CI4A 2DGZA 2DF4B 4O5CA 1NJWA 2K4HA 3THVA 2I9GA 4BUGA 5D4BA 2E8OA 1ZJMA 3UM9A 1TKDA 1OUQA 2WF9A 2ZIVA 1CEZA 5ALZA 4NWIA 5ALPA 2OH2A 8ICLA 3TFRA 5DBBA 4Y2TA 9ICIA 5KFJA 2PMZF 4F5OA 4Q8EA 1MQ2A 4C8NA 5KFCA 8ICGA 1RYRA 8ICMA 5EWFA 5AM2A 2BZFA 5DGAA 1A76A 1GO3F 4KX3A 3WKCA 3GDXA 2P66A 2BDUA 1MQ3A 1PZNA 2JMGA 3BQ7A 3KKAC 1L7OA 8ICCA 4C7ZA 3IP4B 1L8OA 1JN3A 1L6NA 1P7DA 2DKXA 1QSYA 5ALYA 1UCVA 2H5XA 2EQYA 3UQ2A 1L7PA 4PZNA 4CNQA 4QNLA 3EPGA 5JUMA 9ICPA 3QU7A 4CF5A 5JTIA 2KIVA 4QWAA 5EE1A 5KT2A 4DL5A 3HWTA 4O3QA 4J9QA 3RRGA 5J0PA 3QU9A 3SR6A 1J97A 3QYPA 2YY6A 1OW5A 1NK4A 3PNCA 4J03A 2E8MA 2JR5A 8ICZA 4FS2A 3SI8A 4DSEA 4R64A 1ZQCA 9ICSA 4O3MA 3BQ1A 3KHHA 8ICPA 4U7CA 2OWOA 3GIMA 4NLNA 4M0AA 2JV3A 1S77D 1X2IA 2PI4A 3MGHA 3WKEA 4Q44A 3AUOA 1Z4OA 2K8BB 1ZQTA 5KFIA 2KKVA 2R8GA 3KHLA 5CRXA 2ES6A 3B9JA 4YD1A 3CRXA 2K60A 1F5SA 1Z19A 1JUDA 3RB3A 9ICFA 1QCKA 7ICOA 3PZPA 1N48A 9ICAA 1A77A 4UAWA 5L1KA 2WF8A 5KG1A 4M47A 2FPKA 5KG3A 5AM0A 3NVYA 1LB2B 4UB2A 2RLTA 1ZQRA 1JALA 2BQRA 4C4SA 3GIKA 2Y9TA 4QZCA 2BQUA 4DSFA 5DB8A 2F76X 2WTFA 4F4YA 3MFIA 2F8LA 4F3OA 2KFZA 3PSTA 3OTQA 5CR0A 3R9KA 4F91B 1U49A 1FEZA 2JEFA 5HR7A 3RJGA 4KLOA 4DL2A 2E8PA 1ZQBA 4EBCA 1A6SA 1XWLA 9ICHA 2KP7A 5H2FU 4ED0A 4HAIA 2ASJA 5AKYA 4UASA 5AICA 4FZMA 9ICNA 1SV4A 2AU0A 3M8SA 9ICMA 3V72A 4GFJA 3BZKA 4F2SA 2WF5A 2Q4TA 1PVPA 4PH5A 1NKCA 2LM1A 1KSPA 2HBJA 8ICKA 2L5YA 1NOMA 4KN7A 3C5GA 4JV0A 4OJPA 1N61A 3Q8PB 2YMPA 4MFCA 7ICLA 1URJA 2K4EA 5DKWA 2KEYA 4P4PA 4IR9A 5IIJA 2KIWA 4CRXA 1SGGA 1ZXIA 4UB5A 2IHMA 3MR2A 1B43A 2HBMA 5DDMA 2EZYA 2K4PA
chains in the Genus database with same CATH topology
2WB1C 3KFUF 2KNJA 2ZIWB 2KVCA 3F2CA 3PZPA 3SAFA 5HR6A 4KMOB 1GO3F 4KX3A 3LVWA 3PSFA 2CN1A 3VC8A 2JGAA 2VIXA 1XNSA 2XVTA 2JHDA 1WUDA 4A8EA 2BDUA 1ZQ1C 2G08A 3HKZC 1ED1A 2WB1F 4QIWF 1Q3UA 4ACOA 2KD1A 2F2AB 5KL1B 3SAHA 4NV0A 2JMGA 4OJ6A 2HOIA 2H3IA 3T79A 3VCBA 2XI9A 1SZHA 3LVVA 3HKZF 1ECWA 2Y0SF 5T14A 1T94A 3C29A 3IP4B 3NRWA 3GU3A 2ZIVB 2F76X 4JMUA 3AL0B 2HBKA 2G5HB 4CDGA 2F8LA 3N7PD 2W04A 2MA1A 2OYYA 2LKYA 1L6NA 3CP8A 1P7DA 3SAGA 3K1ZA 2KOBA 3F53A 3D2SA 2YB4A 2K4IA 3ALRA 4U6PA 3PSTA 4BX9C 2G5IB 3F2BA 2KJ9A 2CRXA 3RF9A 2YX8A 2HBLA 2XIDA 3N7RC 1UPHA 2R18A 5KL8B 4PL2A 2RRDA 3H0MB 2XICA 2Y0SC 2M0NA 2RHFA 2NV3A 4NLCA 5HR7A 4QNLA 4AYBC 4PL1A 3F5AA 2KV2A 2G09A 3IN5A 3NUQA 1DRGA 1A6SA 4QJFB 2D6FC 4P0PA 3E0FA 2JH1A 4P0QA 2F77X 2OM6A 4AYBF 2W7OA 3D2QA 2WAQC 2KJ8A 3LYSA 3PSIA 1HEKA 2KKPA 3L3FX 3F5EA 4ICAA 4KX5A 5A0LA 3C28A 1Z1BA 3RFAA 2LYBA 2N1RA 2OXOA 2ZXIA 4IC9A 4CGZA 4OJ5A 3D2NA 2H3VA 2VJ4A 2A3VA 5C0YA 2W03A 4FZMA 2H3FA 2DGZA 2DF4B 3M6ZA 1MA7A 2WAQF 2ZXHA 2RP5A 3GZFA 2K4HA 4GFJA 2G0AA 1CRXA 2H3QA 2JH7A 4P0PB 3MGVA 2ZIXA 2Q4TA 1PVRA 1NZBA 3ICXA 2W7PA 1PVPA 2HOFA 4P0QB 3ONNA 3IG5A 2LBOA 1KBUA 4BUGA 2KHQA 3SQIA 2HBJA 2KJ5A 3CYMA 2K89A 4OJOA 1XO0A 3AQFA 4O3MA 2Z7JA 3PSPA 2K8AA 4C0ZA 1OUQA 2ZIVA 2ZIUA 4OJPA 2KHVA 2GOLA 4FZLA 3AQEA 2K8CB 3IG8A 4NWIA 2OH2A 4FE3A 4U7CA 2VKQA 3OPXA 2KICA 2PMZC 3H0RB 2YB1A 1URJA 2E1FA 2K4EA 2ZIWA 3H0LB 3O0FA 2HOQA 2ZIXB 2KEYA 2LYAA 3N7SC 4QIWC 3F2DA 3KZXA 4BJQA 2LHTA 2E5SA 4FZNA 1HIWA 2MRLA 2KIWA 2PMZF 2K8BB 3M7DA 1F44A 2DQNB 2H3ZA 1PVQA 4CRXA 2HMXA 2KKVA 2VJ5A 3M6KA 1TAMA 2ZIUB 4OJLA 1A0PA 5CRXA 3DEEA 4OO1J 1D8BA 3SMVA 1IIPA 1Q3VA 2E1EA 3CRXA 4NLBA 2CPRA 1Z19A 4WJ3B 1YT3A 2HBMA 2G07A 2GH1A 2ZG6A 2G06A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P7D A;  3C28 A;  2KOB A;  2OXO A;  2KJ9 A;  2CRX A;  2A3V A;  1XNS A;  1MA7 A;  4A8E A;  1Q3U A;  2KEY A;  4ACO A;  2KHV A;  2KD1 A;  1CRX A;  3MGV A;  1NZB A;  2KIW A;  1PVR A;  2HOI A;  2HOF A;  1PVP A;  4CRX A;  1F44 A;  1PVQ A;  2KKV A;  1DRG A;  1KBU A;  2KHQ A;  3C29 A;  2KJ5 A;  3NRW A;  1A0P A;  5CRX A;  1Q3V A;  3CRX A;  1XO0 A;  1Z19 A;  1OUQ A;  2KJ8 A;  3LYS A;  2KKP A;  1Z1B A; 
#chains in the Genus database with same CATH topology
 1SV0 A;  5DG8 A;  4PHP A;  4B9T A;  4AP9 A;  3JPT A;  2AJQ A;  2FDR A;  2VIX A;  5KFQ A;  4RQ4 A;  2XVT A;  3G6Y A;  2IHN A;  2G08 A;  1S10 A;  5J0O A;  3QX7 A;  5KT3 A;  2HOI A;  4F5N A;  2EAM A;  5IIO A;  2BCU A;  4IQV A;  2EAP A;  4QWC A;  3TQ1 A;  2W04 A;  4GXJ A;  3Q8K A;  3Q8R B;  3ZDD A;  4B9V A;  3F53 A;  1Z00 B;  4TUR A;  1ZQI A;  5KT4 A;  4UAV A;  3GIL A;  4PL2 A;  9ICO A;  4EX6 A;  3QUC A;  1L7M A;  1PUZ A;  2RHF A;  4DSJ A;  5CEH A;  4ECX A;  4OCZ A;  2KV2 A;  1SXE A;  2KTQ A;  2KZZ A;  1RXW A;  3JPO A;  1SL0 A;  3WK4 A;  5C5J A;  4I2H A;  1SKW A;  9ICT A;  4DEZ A;  2F1J A;  3ORY A;  5DLF A;  1HEK A;  3BJY A;  2W03 A;  5AM3 A;  3M6Z A;  1N5W A;  9ICB A;  4DFP A;  4UB8 U;  3D6J A;  4Z6E A;  2HOF A;  4QWE A;  1TK8 A;  5KT6 A;  2XGP A;  3MR6 A;  7ICK A;  2EAN A;  2Z7J A;  3T5K A;  2ZIU A;  4FZL A;  7ICE A;  2V4R A;  4DFJ A;  4FE3 A;  4PHD A;  4GLX A;  1DK2 A;  1JXL A;  2PMZ C;  5KG5 A;  1NNL A;  4RT3 A;  1XSL A;  4R63 A;  4I2J A;  4RQN A;  4F93 B;  1F44 A;  4FS1 A;  2I1Q A;  3EZ5 A;  1L7N A;  2ZIU B;  1S9F A;  1BVS A;  1ZQJ A;  7ICT A;  1X9S A;  3T5H A;  1KTQ A;  2G06 A;  3IDW A;  3F2C A;  4KLU A;  9ICC A;  2HVI A;  1N5X A;  1ZET A;  4A8E A;  1Q3U A;  4Z6F A;  5ALF A;  5ALO A;  2Y1I A;  3IRU A;  5J2H A;  5HHI A;  5J8Y A;  4LVS A;  1KW4 A;  5J0W A;  2DKZ A;  2HDO A;  4YXJ A;  3BQ0 A;  4CDG A;  3WU2 U;  5F9L A;  4R8U A;  2YB4 A;  4NJ8 A;  5AK3 A;  3V6K A;  4KMU A;  3GV7 B;  4UW9 A;  5KTQ A;  2M0N A;  2KE7 A;  3LDA A;  5HHH A;  2MU2 A;  2D6F C;  5CP2 A;  2RDJ A;  4R8U B;  1C20 A;  3EUB 2;  1TK0 A;  2LI6 A;  5AI5 A;  2NO4 A;  3RFA A;  4B6J A;  2N1R A;  4J9R A;  2OXO A;  4OJ5 A;  2H3V A;  2KN7 A;  5AI0 A;  4B9S A;  3QUB A;  2H3F A;  4PGQ A;  2LMR A;  4JV1 A;  4MFF A;  1XU4 A;  1U9L A;  4DFK A;  2ZTE A;  4MFA A;  1WYG A;  1PVR A;  1ZQU A;  3PX6 A;  1KQQ A;  3IG5 A;  3NVW A;  4Y2Y A;  1J2N A;  3M1Y A;  1NKB A;  2K89 A;  4J9L A;  2OEH A;  1RQN A;  2XY7 A;  4F4W A;  1L5U A;  3AU2 A;  2JZB B;  2XC9 A;  3AQE A;  4Y2P A;  1BPE A;  2HCF A;  3IG8 A;  2UVW A;  3SZ2 A;  2VKQ A;  3WK8 A;  3QU4 A;  4M04 A;  3NVZ A;  4NL9 A;  1O08 A;  3UPQ A;  1IXR A;  2EDU A;  3M8R A;  1KN5 A;  1HIW A;  2E8N A;  4ECT A;  3ETL A;  2MAX A;  2MUT A;  4XRH A;  2PFP A;  2IA6 A;  4PJ0 U;  1UA0 A;  5KFF A;  5KAI U;  2GWS A;  4NM2 A;  4KLJ A;  2BKE A;  2JHD A;  2ZTC A;  1XSP A;  4F4K A;  5J0R A;  2MUT B;  5DG9 A;  4X5V A;  4BWJ A;  2HHU A;  8ICH A;  2LYH A;  1D9D A;  4ED1 A;  2KVS A;  1ZQP A;  3NGD A;  4F71 A;  3C2M A;  5L1I A;  3OJU A;  3K1Z A;  1NKE A;  2K4I A;  1RXV A;  5TIS U;  1KFS A;  3ZDC A;  4IRD A;  3OSP A;  4C80 A;  2RQ5 A;  4NLG A;  9ICR A;  4IRC A;  4QW9 A;  2DWQ A;  3EWA A;  2HHW A;  7ICV A;  1DGJ A;  4CF4 A;  3ISB A;  3F5A A;  1BPY A;  2VA2 A;  4O3O A;  1X9W A;  4P2H A;  3LYS A;  2ASD A;  3AM9 A;  2XY5 A;  4UQG A;  1K5O A;  9ICU A;  1WWU A;  3WK9 A;  2FPL A;  2EAO A;  5AKK A;  3SQI A;  1ZQK A;  2F1I A;  5ALS A;  8ICF A;  5AI6 A;  5DQH A;  5B66 U;  1BNO A;  5D49 A;  3PR4 A;  2IBK A;  3WKA A;  4F92 B;  1Q46 A;  4C4T A;  2LYA A;  4JWM A;  1ZQY A;  4RNM A;  4GC6 A;  1T4G A;  3MR3 A;  1HJP A;  2WF7 A;  3PW4 A;  2VJ5 A;  3QU2 A;  1RPL A;  3TAN A;  2CPR A;  2IOH A;  4PHE A;  4US8 A;  2KNJ A;  1YZ6 A;  3N4M B;  4YD2 A;  1L8L A;  3C2L A;  4QZ8 A;  4YVZ A;  3HP6 A;  4DFD A;  1D8Y A;  1TFR A;  4OJ6 A;  2H3I A;  3PW7 A;  3PO4 A;  2HHS A;  1AQ6 A;  5J2K A;  3UMB A;  5KFE A;  4UB4 A;  3C29 A;  2ZIV B;  5KFG A;  3BS5 A;  3ALR A;  1J2M A;  4KTQ A;  3RF9 A;  3QEA Z;  3PW0 A;  2E3T A;  4DQP A;  2NRW A;  3QUT A;  5EE0 A;  4RQM A;  4PL1 A;  3C21 A;  1ZQF A;  2HVH A;  2B21 A;  1KL9 A;  2F44 A;  4QJF B;  3BS5 B;  1SZP A;  2JH1 A;  3E0F A;  3V7J A;  4ED6 A;  7ICF A;  2F77 X;  5KG7 A;  8ICW A;  1S0M A;  3QUQ A;  2W55 A;  2NRX A;  5DLG A;  1C7Y A;  3F5E A;  5KG0 A;  3M9M B;  1X6J A;  2W8K A;  5F9N A;  3RJE A;  2A3V A;  4KLI A;  4Y2R A;  2W8L A;  1ZQG A;  2XCA A;  5AIA A;  5AIB A;  3SYZ A;  2I5H A;  3FC4 A;  5J0U A;  4YXM A;  1TV9 A;  4KLG A;  5J2G A;  3V6H A;  2K8A A;  1D8L A;  5J2A A;  4J9N A;  2KHV A;  3JPS A;  2C22 A;  1SXD A;  2F3N A;  5KFM A;  5KFA A;  3CNH A;  1N60 A;  2WFA A;  3F2D A;  4TUP A;  4UAY A;  2W9M A;  1ZQV A;  5ALJ A;  9ICW A;  2HMX A;  4ELU A;  3M6K A;  3RBE A;  5J2I A;  1XSN A;  5ALG A;  1ZQS A;  2VAN A;  4B9L A;  2G07 A;  4QZF A;  1ARO P;  4EEN A;  2QB1 A;  4DSI A;  3VC8 A;  4G9B A;  2F2A B;  3SAH A;  2DUY A;  4LZD A;  1D9F A;  3U26 A;  1F0M A;  2HI0 A;  5D46 A;  4RT2 A;  1B4F A;  1X66 A;  2DFL A;  5KFW A;  4Y2U A;  1JMS A;  3PMN A;  5IIL A;  4DSL A;  2OYY A;  2IMW P;  2LKY A;  3MAB A;  4GXK A;  3D2S A;  2G5I B;  4HYK A;  1TAQ A;  5AKH A;  3I28 A;  4ECQ A;  2ESE A;  1QSL A;  3RJH A;  4DQQ A;  2KZM A;  3PVX A;  2W9B A;  1VJ5 A;  4QZB A;  5KNI A;  3IN5 A;  1XC9 A;  1QQ6 A;  5DDY A;  4PGX A;  5BOM A;  2YMM A;  3RJJ A;  4GXI A;  3PV8 A;  4I2I A;  4ICA A;  1IG6 A;  4IL6 U;  2W9B B;  3RJK A;  1SB3 C;  2ODG A;  2HHX A;  3NS1 A;  1DGS A;  1UHU A;  1U47 A;  2H3Q A;  4IR1 A;  2ZJA A;  3ICX A;  5IIM A;  5AM5 A;  2F1H A;  3RR7 A;  2KHQ A;  1UT8 A;  3RTV A;  3AQF A;  3RB0 A;  4UBB A;  5GTH U;  1BPB A;  1S5L U;  2IOF A;  3HJE A;  2GO7 A;  2ZIW A;  4C7Y A;  5KG4 A;  2PI5 A;  5J2D A;  3T5J A;  2E5S A;  2XGQ A;  4UAZ A;  3EW9 A;  3BS7 A;  3GV8 B;  5JU5 A;  5KFR A;  2PKE A;  1L3S A;  3H7I A;  1Q3V A;  3NTU A;  3KHG A;  2ZIW B;  3KKA A;  4J9M A;  2AGQ A;  3M9O B;  4P4M A;  4F4X A;  4KMO B;  3JPN A;  5G5G A;  3ISD A;  4ACO A;  1SL2 A;  3AEV A;  1TVA A;  1Y88 A;  2ZUB A;  5CWR A;  4K4H A;  3RB4 A;  4MEX A;  3OSN A;  5KFU A;  3FAH A;  3GU3 A;  4DS4 A;  4M6W A;  2G5H B;  3ISC A;  4KLE A;  4O5K A;  5KFL A;  3F2B A;  1FO4 A;  2QAR A;  2WF6 A;  4UAR A;  3H4D A;  1ZQM A;  2DPI A;  3PW5 A;  2Y0S C;  4MHV A;  4EYI B;  4C8L A;  4PGY A;  4ECZ A;  4M6W B;  1ZQZ A;  4MEY A;  4DWI A;  1ZQE A;  3K4G A;  2ASL A;  3KZI U;  7ICU A;  2NYV A;  2QAR B;  2BR0 A;  1NI3 A;  3WK6 A;  4DQI A;  2LYB A;  3WK5 A;  4EEY A;  3RRH A;  1MN8 A;  4YMN A;  2R8I A;  2JH7 A;  5AI8 A;  4DOC A;  4F5P A;  4NL9 C;  5CB1 A;  1WG8 A;  3AMZ A;  3PSP A;  2OCE A;  1U48 A;  4OD0 A;  2FLN A;  2W3S A;  2W9C A;  3T3F A;  4IQU A;  1KEJ A;  1ZQO A;  3DDH A;  1Q8K A;  8ICN A;  3RB6 A;  3Q8S B;  2W11 A;  1PVQ A;  1DK3 A;  3ZD8 A;  5KFO A;  4BXO A;  1TAM A;  3G6V A;  3EYZ A;  8ICX A;  3SMV A;  4NLB A;  1ZQN A;  2W9C B;  3FM9 A;  2W7P A;  4O3N A;  4R65 A;  1OXJ A;  1SWV A;  3DV9 A;  5E79 U;  3LVW A;  2FLP A;  4NM1 A;  1Z1V A;  3C5F A;  5KL1 B;  3JPP A;  4QZD A;  4BXO B;  1S8O A;  4KLL A;  5J0Q A;  1V85 A;  4RQ6 A;  5ALE A;  4JMU A;  9ICE A;  3M9N B;  3CP8 A;  1S0O A;  8ICS A;  3SAG A;  4U6P A;  5HMM A;  4BX9 C;  5EOZ A;  4K4I A;  4EBD A;  2XID A;  2DL0 A;  2Q0Z X;  5KFK A;  4YN4 A;  2XY6 A;  1YZ7 A;  2YQE A;  4UB1 A;  2NO5 A;  4NLC A;  1S0V A;  2KFN A;  4EX7 A;  3NUQ A;  8ICA A;  4QZH A;  2BCS A;  4M9L A;  2KJ8 A;  2P35 A;  3UMG A;  5ALM A;  5J2F A;  4IQW A;  1L3U A;  4O3S A;  5KFH A;  2BPC A;  4Q8F A;  9ICV A;  2AXT U;  4EZ6 A;  1MA7 A;  3TAD C;  5DG7 A;  4Y2S A;  4BDP A;  5EE9 A;  5J0T A;  4XQ8 A;  4YR3 A;  5KG6 A;  3A0B U;  3L4P A;  1ZQH A;  5FP0 A;  3MBY A;  5J2E A;  3SD7 A;  5KFT A;  2FMS A;  1HUO A;  4OJO A;  4M9H A;  5DBC A;  2ZUD A;  3QZ7 A;  4C8K A;  1U45 A;  4JK1 A;  4O9M A;  2LM4 A;  9ICG A;  3RJI A;  5J0X A;  4YR0 A;  3OJS A;  2ZTD A;  4Y2Q A;  5L1J A;  4JV2 A;  3UMC A;  1DXS A;  2AGO A;  3TAR A;  1ZQD A;  2RDI A;  4JB3 A;  2H3Z A;  5GTI U;  1HUZ A;  4F8R A;  1DOQ A;  4DO9 A;  5III A;  1SKR A;  3L5K A;  4B9U A;  4C4R A;  4ECY A;  3KOO A;  3RH4 A;  5KG2 A;  3HIL A;  5IIK A;  3JPQ A;  3RH6 A;  4F5R A;  3BDP A;  5ALL A;  4DL3 A;  3ZDE A;  3FDS A;  4FFD A;  1SZH A;  1ZRM A;  5KFP A;  5T14 A;  3NRW A;  1QLN A;  4EZ9 A;  5L1M A;  4R66 A;  4C8O A;  2JEG A;  2KJ9 A;  4PHA A;  2HSZ A;  2ZJ5 A;  3RR8 A;  4RQ7 A;  2NV3 A;  3TAQ A;  7ICJ A;  5KFZ A;  2G09 A;  1UQV A;  5ALW A;  5B5E U;  4P0Q A;  4J9P A;  1ZYQ A;  3Q8L A;  5A0L A;  4KLT A;  4FO6 A;  4IC9 A;  1Z4N A;  5KFX A;  3QXG A;  3SEN A;  4ECS A;  2EH9 A;  4DOB A;  2A1J A;  1X9X A;  4P0Q B;  4XUS A;  1KBU A;  3RBD A;  4Q45 A;  4C0Z A;  4ECV A;  1ZRN A;  1ZQX A;  3TAP A;  3O0F A;  2A1J B;  1XO1 A;  2LHT A;  3MDC A;  1SIJ A;  1JXE A;  5BPC A;  4KN4 A;  1BPZ A;  2BQ3 A;  4RUA A;  1EXN A;  4OJL A;  2ISP A;  4OO1 J;  1D8B A;  1ZQW A;  2EZX A;  4WJ3 B;  4QZ9 A;  4Y2J A;  5KT7 A;  1NJX A;  2ZUC A;  2KVC A;  2B6G A;  2JGA A;  1XNS A;  5DBA A;  2DBY A;  1ED1 A;  4QIW F;  3G6X A;  1X9M A;  8ICR A;  3V7L A;  5ALX A;  1KKX A;  3T79 A;  3CW2 C;  2C2D A;  1XS9 D;  1Z3E B;  4YQW A;  2KK0 A;  1WWV A;  4CE6 A;  2KG5 A;  5AKE A;  5AKJ A;  2BGW A;  4US9 A;  2YX8 A;  4EBE A;  3GII A;  4I2F A;  3LWM A;  3GQC A;  2BHN A;  4F5Q A;  2BCQ A;  2FLL A;  1WCN A;  3PSI A;  1S76 D;  5EE3 A;  3PO5 A;  4YR2 A;  9ICX A;  1JIH A;  5K4L A;  3PML A;  1QH9 A;  5AHX A;  4I2E A;  2NRV A;  4ELV A;  2F8K A;  8ICV A;  5J29 A;  2G0A A;  2FPM A;  2IOF K;  3UQ0 A;  2ATL A;  4M2Y A;  4B9N A;  1ZD2 P;  4DL7 A;  9ICL A;  4O5E A;  4EEL A;  1N63 A;  5AKX A;  4ZOH C;  4EYH B;  4F72 A;  3MDA A;  2KIC A;  5HML A;  3TFS A;  3H0R B;  3C23 A;  5HP4 A;  3N7S C;  1COO A;  7ICP A;  1NZP A;  4RNN A;  2BPF A;  4UAT A;  4BWM A;  4QZG A;  3GFK B;  2HHV A;  1QSS A;  5EWG A;  2W9A A;  1T3Q A;  4G3I A;  3OGU A;  4NY8 A;  2CN1 A;  4TQR A;  4QZI A;  4DF4 A;  2C2R A;  4DSK A;  2UVU A;  2W54 A;  2KD1 A;  1ZD4 A;  1SV0 C;  3TAC B;  5HNK A;  1LKY A;  3LVV A;  4ED2 A;  4QW8 A;  3HKZ F;  4F50 A;  2W3R A;  3J81 j;  4ECW A;  5ALI A;  7ICG A;  3N7P D;  2MA1 A;  4KLS A;  4TQS A;  4QZA A;  3K75 D;  5F3X B;  4RQ1 A;  1NK0 A;  7ICS A;  1LKY B;  2I6X A;  2RRD A;  3KD3 A;  4UB6 U;  3NAS A;  4QZE A;  2FJ6 A;  1DRG A;  1JRP A;  1QQ5 A;  4GC7 A;  3H8M A;  4AYB F;  2R8J A;  3TI0 A;  3PX4 A;  5EWE A;  4KX5 A;  5ALR A;  4YMM A;  5KFN A;  2P6U A;  3A0H U;  3BQT A;  4CGZ A;  2KMD A;  2VJ4 A;  3MFH A;  1BGX T;  5C0Y A;  2WAQ F;  2ZXH A;  3BQ2 A;  5KFB A;  5J0S A;  1LVH A;  1N62 A;  4LJX A;  1CRX A;  4I2C A;  4RQ8 A;  3QZ8 A;  2XCP A;  2ZIX A;  1PK1 A;  3PX0 A;  4NLZ A;  5AI4 A;  1RDF A;  4M9G A;  5ALV A;  3HRD D;  2WHE A;  4JWN A;  3V7K A;  2ZIX B;  1NK5 A;  1PK1 B;  4BJQ A;  4I2G A;  1RYU A;  1QQ7 A;  3LK9 A;  3C1Z A;  2BCV A;  4DLG A;  4DL6 A;  1BPD A;  4TUQ A;  2O6K A;  5L1L A;  5AKI A;  2A19 A;  3RAX A;  2AH5 A;  1YT3 A;  3PY8 A;  3PR5 B;  5CA7 A;  5AI9 A;  8ICY A;  4KIT B;  5DQI A;  3T5L A;  1WUD A;  3QNM A;  1L3V A;  1ZQ1 C;  2WB1 F;  4CCH A;  5ALN A;  3WK7 A;  4NV0 A;  2ISO A;  1M6Y A;  4I2D A;  3VCB A;  1KFD A;  4DLE A;  3N97 B;  4J9K A;  4O3P A;  4RU9 A;  2ALZ A;  2HBK A;  7ICN A;  5J8Y C;  4M9J A;  3I76 A;  3TKA A;  2C2E A;  2HBL A;  4KLQ A;  7ICQ A;  1FFU A;  1KRP A;  4PPX A;  4J9S A;  1BNP A;  2J6T A;  1TE2 A;  4C8M A;  3H0M B;  4P4O A;  4M9N A;  1KFT A;  2KZ3 A;  4ED3 A;  4DS5 A;  5AM1 A;  8ICT A;  2BDP A;  2PFN A;  4ED8 A;  1RYS A;  3QU5 A;  4BGD A;  1NK6 A;  2W7O A;  3D2Q A;  1L3T A;  4Z6C A;  3MC1 A;  4Y2V A;  2PXI A;  1X6I A;  2VA3 A;  5AK6 A;  2YML A;  3ETR A;  2RP5 A;  1JX4 A;  4RQ2 A;  3B0X A;  4O3R A;  3MGV A;  1ZD3 A;  8ICJ A;  2AGP A;  4F2R A;  1KDH A;  3BZC A;  2AQ0 A;  3CYM A;  4I2B A;  1ZD5 A;  4MF8 A;  4RNO A;  2GOL A;  4GIB A;  1V97 A;  8ICU A;  3OPX A;  1Z00 A;  2E1F A;  1QTM A;  2NRT A;  9ICQ A;  4FBT A;  4ECU A;  4RQ3 A;  5CHG A;  3HPO A;  2KSO A;  5J2B A;  3M7D A;  2DQN B;  4CF3 A;  4UAU A;  1PK3 A;  2VA8 A;  3DEE A;  4ZH4 A;  1N2X A;  2GH1 A;  2B0C A;  4QIW C;  2FI1 A;  2FE9 A;  2V9W A;  1TAU A;  1O03 A;  7ICH A;  4YCX A;  1V38 A;  3H8W A;  2PFO A;  2KSO B;  1IV8 A;  1LV5 A;  3LWL A;  4DCC A;  5J2J A;  4I29 A;  1NK8 A;  8ICO A;  4YMO A;  3H8S A;  1ECW A;  3ZI4 A;  3IM1 A;  7ICR A;  1NJZ A;  3H8J A;  1S97 A;  4USA A;  1NK7 A;  2JRZ A;  5KFS A;  3KBB A;  1X42 A;  3ZD9 A;  1X40 A;  5DB9 A;  2QB0 A;  4QWB A;  3NRZ A;  4PZO A;  2R18 A;  4ECR A;  4YP3 A;  2XO7 A;  4QWD A;  3MGI A;  2XIC A;  4UB3 A;  5BOL A;  2UVR A;  3WKB A;  7ICI A;  1RZT A;  3C2K A;  1ZJN A;  4KLF A;  8ICE A;  3OHB A;  2QB0 B;  1SL1 A;  1N56 A;  4IQT A;  3RAQ A;  3L3F X;  3WKD A;  1Z1B A;  3C28 A;  9ICK A;  4KLD A;  2JXJ A;  5CJ7 A;  5DB7 A;  3D2N A;  5G5H A;  5ALT A;  3GIJ A;  3UXP A;  3SV3 A;  3PW2 A;  4EEK A;  3GZF A;  3OHA A;  1K1Q A;  1IM4 A;  2BPG A;  3ONN A;  2KJ5 A;  2YTU A;  5L9X A;  1ZQL A;  5DQG A;  1WCL A;  2Y9U A;  1FIQ A;  3UXO A;  2K8C B;  1UA1 A;  2BCR A;  4I28 A;  3H0L B;  2HOQ A;  3KZX A;  2NRZ A;  3B0Y A;  2MRL A;  2UVV A;  1NK9 A;  3C1Y A;  5AKG A;  1A0P A;  1IIP A;  2ZJ8 A;  2R8H A;  1COK A;  1FFV A;  3KFU F;  5ALU A;  5HR6 A;  3PSF A;  1UT5 A;  4RPZ A;  2J6S A;  3KTQ A;  3HKZ C;  2QLT A;  2QKQ A;  1TK5 A;  2D8C A;  2EZZ A;  4FBU A;  4DF8 A;  3E2E A;  1VLB A;  4YFK A;  5AK4 A;  3H4B A;  2A1A A;  2KOB A;  5DGB A;  4MF2 A;  5KFY A;  2JZB A;  4XA5 A;  5ALK A;  4DOA A;  3N7R C;  3RJF A;  4B9M A;  1UPH A;  2JEJ A;  3ZDA A;  1SKS A;  4ELT A;  2HHQ A;  1T7P A;  1NJY A;  5ALD A;  4AYB C;  4J9O A;  4RQ5 A;  1MC8 A;  1ZOL A;  4I27 A;  4P0P A;  4K4G A;  1JI7 A;  3AN1 A;  2WAQ C;  2GLE A;  5IIN A;  3ED5 A;  3H40 A;  3FYH A;  3SEI A;  2HHT A;  2ZXI A;  5KFV A;  5AKZ A;  3ZDB A;  3EPI A;  1BPX A;  1B0X A;  3Q8M A;  4Q43 A;  4JUZ A;  4RPY A;  1CUK A;  2V4Q A;  3KHR A;  2DPJ A;  4P0P B;  1NZB A;  5J2C A;  4YG2 A;  5KT5 A;  4RQ0 A;  2LBO A;  4Y2X A;  4RPX A;  3NVV A;  1XO0 A;  4IS7 A;  4NXZ A;  5AK5 A;  5TZV A;  3UXN A;  4UBC A;  4I2A A;  1B22 A;  2MSN A;  2HW3 A;  2YB1 A;  2D3D A;  5ALH A;  4Z6D A;  1V9P A;  4DFM A;  3IHQ B;  3V6J A;  7ICM A;  1U4B A;  2JEI A;  8ICQ A;  3I1Y A;  4FZN A;  3QEB Z;  3Q8Q B;  3HW8 A;  2Y1J A;  2FMQ A;  5DB6 A;  3RH5 A;  1RQL A;  2E1E A;  2FMP A;  8ICB A;  3HT3 A;  3K1R B;  4F4Z A;  2ZG6 A;  4NLK A;  2WB1 C;  2CXY A;  2P6R A;  3MR5 A;  1RG6 A;  3SAF A;  4RZR A;  4LZG A;  3N28 A;  3SV4 A;  5KFD A;  1K1S A;  3E58 A;  1JRO A;  4O0I A;  2XI9 A;  5KAF U;  5ALQ A;  2Y0S F;  1T94 A;  1ZQA A;  4KLM A;  3AL0 B;  2OHF A;  2LPE A;  4DL4 A;  5AKL A;  1H38 A;  3IV6 A;  4RUC A;  1MSW D;  2YN4 A;  1T8E A;  2CRX A;  2AQ4 A;  1SWW A;  1RM6 C;  4IRK A;  4DQR A;  5KL8 B;  2J6U A;  8ICI A;  3AU6 A;  4ED7 A;  4DQS A;  4KLH A;  9ICJ A;  2YMQ A;  4E0D A;  1S0N A;  1ZQQ A;  2AHO B;  2W43 A;  3TAD A;  2C28 A;  2R8K A;  4TUS A;  3JPR A;  1T3N A;  3S6J A;  2OM6 A;  1KLN A;  2KKP A;  5AM4 A;  5JRT A;  2M9N A;  3GV5 B;  1VDV A;  5J0Y A;  3QE9 Y;  3HX0 A;  2PFQ A;  1CI4 A;  2DGZ A;  2DF4 B;  4O5C A;  1NJW A;  2K4H A;  3THV A;  2I9G A;  4BUG A;  5D4B A;  2E8O A;  1ZJM A;  3UM9 A;  1TKD A;  1OUQ A;  2WF9 A;  2ZIV A;  1CEZ A;  5ALZ A;  4NWI A;  5ALP A;  2OH2 A;  8ICL A;  3TFR A;  5DBB A;  4Y2T A;  9ICI A;  5KFJ A;  2PMZ F;  4F5O A;  4Q8E A;  1MQ2 A;  4C8N A;  5KFC A;  8ICG A;  1RYR A;  8ICM A;  5EWF A;  5AM2 A;  2BZF A;  5DGA A;  1A76 A;  1GO3 F;  4KX3 A;  3WKC A;  3GDX A;  2P66 A;  2BDU A;  1MQ3 A;  1PZN A;  2JMG A;  3BQ7 A;  3KKA C;  1L7O A;  8ICC A;  4C7Z A;  3IP4 B;  1L8O A;  1JN3 A;  1L6N A;  1P7D A;  2DKX A;  1QSY A;  5ALY A;  1UCV A;  2H5X A;  2EQY A;  3UQ2 A;  1L7P A;  4PZN A;  4CNQ A;  4QNL A;  3EPG A;  5JUM A;  9ICP A;  3QU7 A;  4CF5 A;  5JTI A;  2KIV A;  4QWA A;  5EE1 A;  5KT2 A;  4DL5 A;  3HWT A;  4O3Q A;  4J9Q A;  3RRG A;  5J0P A;  3QU9 A;  3SR6 A;  1J97 A;  3QYP A;  2YY6 A;  1OW5 A;  1NK4 A;  3PNC A;  4J03 A;  2E8M A;  2JR5 A;  8ICZ A;  4FS2 A;  3SI8 A;  4DSE A;  4R64 A;  1ZQC A;  9ICS A;  4O3M A;  3BQ1 A;  3KHH A;  8ICP A;  4U7C A;  2OWO A;  3GIM A;  4NLN A;  4M0A A;  2JV3 A;  1S77 D;  1X2I A;  2PI4 A;  3MGH A;  3WKE A;  4Q44 A;  3AUO A;  1Z4O A;  2K8B B;  1ZQT A;  5KFI A;  2KKV A;  2R8G A;  3KHL A;  5CRX A;  2ES6 A;  3B9J A;  4YD1 A;  3CRX A;  2K60 A;  1F5S A;  1Z19 A;  1JUD A;  3RB3 A;  9ICF A;  1QCK A;  7ICO A;  3PZP A;  1N48 A;  9ICA A;  1A77 A;  4UAW A;  5L1K A;  2WF8 A;  5KG1 A;  4M47 A;  2FPK A;  5KG3 A;  5AM0 A;  3NVY A;  1LB2 B;  4UB2 A;  2RLT A;  1ZQR A;  1JAL A;  2BQR A;  4C4S A;  3GIK A;  2Y9T A;  4QZC A;  2BQU A;  4DSF A;  5DB8 A;  2F76 X;  2WTF A;  4F4Y A;  3MFI A;  2F8L A;  4F3O A;  2KFZ A;  3PST A;  3OTQ A;  5CR0 A;  3R9K A;  4F91 B;  1U49 A;  1FEZ A;  2JEF A;  5HR7 A;  3RJG A;  4KLO A;  4DL2 A;  2E8P A;  1ZQB A;  4EBC A;  1A6S A;  1XWL A;  9ICH A;  2KP7 A;  5H2F U;  4ED0 A;  4HAI A;  2ASJ A;  5AKY A;  4UAS A;  5AIC A;  4FZM A;  9ICN A;  1SV4 A;  2AU0 A;  3M8S A;  9ICM A;  3V72 A;  4GFJ A;  3BZK A;  4F2S A;  2WF5 A;  2Q4T A;  1PVP A;  4PH5 A;  1NKC A;  2LM1 A;  1KSP A;  2HBJ A;  8ICK A;  2L5Y A;  1NOM A;  4KN7 A;  3C5G A;  4JV0 A;  4OJP A;  1N61 A;  3Q8P B;  2YMP A;  4MFC A;  7ICL A;  1URJ A;  2K4E A;  5DKW A;  2KEY A;  4P4P A;  4IR9 A;  5IIJ A;  2KIW A;  4CRX A;  1SGG A;  1ZXI A;  4UB5 A;  2IHM A;  3MR2 A;  1B43 A;  2HBM A;  5DDM A;  2EZY A;  2K4P A; 
#chains in the Genus database with same CATH homology
 2WB1 C;  3KFU F;  2KNJ A;  2ZIW B;  2KVC A;  3F2C A;  3PZP A;  3SAF A;  5HR6 A;  4KMO B;  1GO3 F;  4KX3 A;  3LVW A;  3PSF A;  2CN1 A;  3VC8 A;  2JGA A;  2VIX A;  1XNS A;  2XVT A;  2JHD A;  1WUD A;  4A8E A;  2BDU A;  1ZQ1 C;  2G08 A;  3HKZ C;  1ED1 A;  2WB1 F;  4QIW F;  1Q3U A;  4ACO A;  2KD1 A;  2F2A B;  5KL1 B;  3SAH A;  4NV0 A;  2JMG A;  4OJ6 A;  2HOI A;  2H3I A;  3T79 A;  3VCB A;  2XI9 A;  1SZH A;  3LVV A;  3HKZ F;  1ECW A;  2Y0S F;  5T14 A;  1T94 A;  3C29 A;  3IP4 B;  3NRW A;  3GU3 A;  2ZIV B;  2F76 X;  4JMU A;  3AL0 B;  2HBK A;  2G5H B;  4CDG A;  2F8L A;  3N7P D;  2W04 A;  2MA1 A;  2OYY A;  2LKY A;  1L6N A;  3CP8 A;  1P7D A;  3SAG A;  3K1Z A;  2KOB A;  3F53 A;  3D2S A;  2YB4 A;  2K4I A;  3ALR A;  4U6P A;  3PST A;  4BX9 C;  2G5I B;  3F2B A;  2KJ9 A;  2CRX A;  3RF9 A;  2YX8 A;  2HBL A;  2XID A;  3N7R C;  1UPH A;  2R18 A;  5KL8 B;  4PL2 A;  2RRD A;  3H0M B;  2XIC A;  2Y0S C;  2M0N A;  2RHF A;  2NV3 A;  4NLC A;  5HR7 A;  4QNL A;  4AYB C;  4PL1 A;  3F5A A;  2KV2 A;  2G09 A;  3IN5 A;  3NUQ A;  1DRG A;  1A6S A;  4QJF B;  2D6F C;  4P0P A;  3E0F A;  2JH1 A;  4P0Q A;  2F77 X;  2OM6 A;  4AYB F;  2W7O A;  3D2Q A;  2WAQ C;  2KJ8 A;  3LYS A;  3PSI A;  1HEK A;  2KKP A;  3L3F X;  3F5E A;  4ICA A;  4KX5 A;  5A0L A;  3C28 A;  1Z1B A;  3RFA A;  2LYB A;  2N1R A;  2OXO A;  2ZXI A;  4IC9 A;  4CGZ A;  4OJ5 A;  3D2N A;  2H3V A;  2VJ4 A;  2A3V A;  5C0Y A;  2W03 A;  4FZM A;  2H3F A;  2DGZ A;  2DF4 B;  3M6Z A;  1MA7 A;  2WAQ F;  2ZXH A;  2RP5 A;  3GZF A;  2K4H A;  4GFJ A;  2G0A A;  1CRX A;  2H3Q A;  2JH7 A;  4P0P B;  3MGV A;  2ZIX A;  2Q4T A;  1PVR A;  1NZB A;  3ICX A;  2W7P A;  1PVP A;  2HOF A;  4P0Q B;  3ONN A;  3IG5 A;  2LBO A;  1KBU A;  4BUG A;  2KHQ A;  3SQI A;  2HBJ A;  2KJ5 A;  3CYM A;  2K89 A;  4OJO A;  1XO0 A;  3AQF A;  4O3M A;  2Z7J A;  3PSP A;  2K8A A;  4C0Z A;  1OUQ A;  2ZIV A;  2ZIU A;  4OJP A;  2KHV A;  2GOL A;  4FZL A;  3AQE A;  2K8C B;  3IG8 A;  4NWI A;  2OH2 A;  4FE3 A;  4U7C A;  2VKQ A;  3OPX A;  2KIC A;  2PMZ C;  3H0R B;  2YB1 A;  1URJ A;  2E1F A;  2K4E A;  2ZIW A;  3H0L B;  3O0F A;  2HOQ A;  2ZIX B;  2KEY A;  2LYA A;  3N7S C;  4QIW C;  3F2D A;  3KZX A;  4BJQ A;  2LHT A;  2E5S A;  4FZN A;  1HIW A;  2MRL A;  2KIW A;  2PMZ F;  2K8B B;  3M7D A;  1F44 A;  2DQN B;  2H3Z A;  1PVQ A;  4CRX A;  2HMX A;  2KKV A;  2VJ5 A;  3M6K A;  1TAM A;  2ZIU B;  4OJL A;  1A0P A;  5CRX A;  3DEE A;  4OO1 J;  1D8B A;  3SMV A;  1IIP A;  1Q3V A;  2E1E A;  3CRX A;  4NLB A;  2CPR A;  1Z19 A;  4WJ3 B;  1YT3 A;  2HBM A;  2G07 A;  2GH1 A;  2ZG6 A;  2G06 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...