2KIWA

Solution nmr structure of the domain n-terminal to the integrase domain of sh1003 from staphylococcus haemolyticus. northeast structural genomics consortium target shr105f (64-166).
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
111
structure length
111
Chain Sequence
TFKQVADDWLKQYANDVKVSSVRAREKAIQHAIERFNTKPIQTIKKHDYQRFVDDISAQYSKNYVDSIVASTNMIFKYAYDTRLIKAMPSEGIKRPKKKVSVELEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR structure of the domain N-terminal to the integrase domain of SH1003 from Staphylococcus haemolyticus. Northeast Structural Genomics Consortium Target ShR105F (64-166).
rcsb
source organism Staphylococcus haemolyticus jcsc1435
molecule tags Dna binding protein
molecule keywords Int protein
total genus 29
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2009-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14659 Phage_int_SAM_3 Phage integrase, N-terminal SAM-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.130 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2kiwA01
3CRXA 2KHQA 1PVPA 2KJ8A 3LYSA 1Q3UA 1PVRA 3MGVA 3NRWA 2KD1A 4ACOA 2HOFA 1Z1BA 2CRXA 2OXOA 1PVQA 1NZBA 1Z19A 1XNSA 1DRGA 2KKPA 1P7DA 1OUQA 3C28A 1KBUA 1XO0A 3C29A 1F44A 2KJ5A 1MA7A 1A0PA 2HOIA 2KHVA 4A8EA 2A3VA 1Q3VA 2KOBA 2KKVA 1CRXA 2KEYA 2KIWA 2KJ9A 4CRXA 5CRXA
chains in the Genus database with same CATH superfamily
1NK7A 4O0IA 4RQMA 4NLCA 1HIWA 3Q8LA 3UQ0A 2WB1C 3LVVA 3RRHA 1XS9D 1ED1A 4PJ0U 4C0ZA 5EE9A 4DFKA 2W9BA 4Q8EA 4QW9A 1ZQNA 1Z4OA 1UHUA 2EAPA 2YMMA 2XC9A 4RQ6A 3C21A 3WKBA 2KICA 2JXJA 3EPIA 2D6FC 1CEZA 2RP5A 2A1AA 2Y9TA 3N7RC 3SENA 1OXJA 4UW9A 1PZNA 1NJYA 4IRDA 3GV5B 4MFFA 4ECTA 1OUQA 1KBUA 5DB6A 1TAUA 2ODGA 2YB4A 2YMQA 2O6KA 4DFMA 9ICAA 3PV8A 4EEYA 4Q45A 4QZFA 2OYYA 4F5NA 9ICOA 3OHAA 2G09A 3PX4A 4DF8A 7ICIA 5DBCA 1SWWA 4I2DA 2OH2A 4RQ8A 3UXPA 2ISOA 2OHFA 4UATA 3V7LA 3RJEA 2NO4A 3LDAA 4ECVA 4AYBF 9ICXA 1COOA 4F72A 5DB8A 4QWDA 1ECWA 3NVWA 2G0AA 5KL8B 5J2HA 3ZD9A 1DRGA 3EWAA 2ZIUB 2P6RA 4DQIA 4PL1A 5AIBA 4O3SA 3RJIA 9ICFA 4KLDA 2EZYA 4DQQA 3F2BA 4DSEA 1ZQSA 1N2XA 4KLUA 2HBJA 3CW2C 2PFPA 3GV8B 4EENA 4C8KA 3FAHA 1DGSA 4ELVA 5L1JA 5TISU 2YB1A 1N62A 1XSPA 4RZRA 1V38A 3ZDCA 4QZIA 5KG6A 1ZQQA 4QWEA 2IOFA 4JV1A 8ICTA 2WHEA 3TADA 3RJGA 3Q8SB 5BPCA 5D4BA 3HJEA 5FP0A 3QU7A 3IG8A 3GQCA 5CP2A 4R66A 1QSSA 4Z6DA 8ICXA 1A0PA 3JPSA 4QWAA 2FMSA 4R64A 3QUBA 1S76D 3RB0A 1XU4A 1ZQVA 5HR6A 5AI9A 3M7DA 1Z1BA 1KFTA 5J2IA 2N1RA 4PGYA 4TUSA 1TVAA 4J9OA 4NL9C 4IL6U 4C80A 4DF4A 3TQ1A 1A76A 1D9DA 2MUTB 3SD7A 3BQ1A 7ICMA 1ZQLA 2F8KA 4B9NA 7ICGA 4K4HA 2ZJ5A 4KLEA 4F4XA 2K4IA 1ZD5A 4F8RA 2W8LA 1SXEA 2A19A 4U6PA 5ALZA 3SI8A 4I2GA 3EYZA 2I9GA 2LYBA 3NS1A 2BCRA 4DL4A 1BPDA 4KMOB 2W7OA 4KLJA 1QCKA 3M8SA 4GFJA 3PMLA 2UVWA 4NL9A 4O3MA 2RQ5A 2GOLA 4YP3A 3C2LA 3C5FA 3WKEA 3I1YA 1SL1A 3AUOA 4KLGA 1WG8A 2BR0A 8ICLA 3ED5A 7ICTA 3KHHA 3WKDA 9ICEA 8ICWA 3HILA 3EZ5A 3KTQA 3ISCA 5AM3A 2KHQA 1DK3A 3EW9A 2P6UA 4YD1A 5CHGA 4C8NA 4RQ5A 5DQIA 1DXSA 1HEKA 4NJ8A 2ZUDA 2V4RA 1D9FA 1ZQFA 2R8JA 2KKVA 1N61A 3PMNA 3CRXA 5AKZA 4UBBA 3WK6A 4O3OA 2GO7A 4I2EA 1SKWA 2XCAA 2HVIA 5KT3A 2YY6A 1QTMA 1XSNA 1WCNA 5D46A 1ZQYA 3LWMA 4QIWC 1YZ6A 1F5SA 4ECWA 1ZD3A 2VKQA 1TK5A 2M9NA 3V7KA 2YTUA 2ZTEA 2NRVA 4R65A 2KMDA 4C8LA 2HHVA 4I2CA 1ZQRA 3HW8A 1MC8A 7ICFA 1Z00B 2ES6A 3TARA 4DCCA 2C28A 2VA8A 4B9LA 7ICJA 4IQTA 5KFCA 2ZUBA 4C8MA 3SAFA 4NV0A 1L3TA 4KMUA 3UMCA 5J2JA 2IHNA 5J0TA 3RH4A 2KIVA 2K8AA 2KD1A 5ALGA 2E8NA 5J2BA 4I28A 4BXOA 2IA6A 3PR5B 1SIJA 5AKKA 3TAQA 4RQ3A 2W9AA 1NJZA 4K4GA 2Q0ZX 5AK4A 5IILA 5KFGA 5KFDA 3AU6A 5KG3A 2OWOA 2E3TA 1T3NA 5KFLA 2KE7A 4DSKA 2A1JA 4DLGA 5EWEA 3OSNA 4I2AA 2G08A 3PW2A 2BGWA 5KT2A 3KD3A 1KL9A 4KX3A 4EELA 7ICNA 5CWRA 2WF6A 5J0OA 3LK9A 1RYUA 5ALRA 4BDPA 3SYZA 2LYHA 3IV6A 1H38A 2G07A 1WYGA 4C4TA 1JUDA 1L7OA 5J8YC 2RDJA 1ZRMA 1IIPA 5DB9A 1M6YA 4C8OA 4PHEA 5KFKA 2XO7A 2DF4B 3GIIA 2C2RA 1N5XA 2F44A 2AGPA 1SWVA 2FLNA 3QUTA 4DFDA 2AGOA 2HHQA 1NZPA 3PW7A 1NK6A 4HYKA 5L1LA 1QQ6A 2QB0B 4Y2PA 1KKXA 5ALWA 3QU4A 4IS7A 1JX4A 2IOHA 4J9MA 1NKCA 1RYSA 4EZ9A 4R63A 3GDXA 4YMMA 4UB3A 4OJ6A 1PVRA 1DOQA 4M9JA 4PZNA 5AM1A 3I76A 4UB5A 1PVQA 4US8A 4EBCA 2R8GA 1SB3C 4KLSA 4DSJA 2K4PA 4FZMA 1ZQXA 2HW3A 2DGZA 5KFAA 4DQSA 2G06A 4RQ4A 2FPLA 3NGDA 3TKAA 1CUKA 1GO3F 1X9MA 4CCHA 1ZQOA 2KIWA 1U48A 4OJOA 2HSZA 2DFLA 7ICUA 4J9QA 4QZAA 4ED1A 4F91B 2RRDA 3ONNA 3HP6A 4FZLA 4R8UB 1L3UA 4DWIA 5F9NA 4Z6EA 1EXNA 1LVHA 5KG4A 1N60A 3TFRA 3HPOA 2HI0A 4OJLA 3A0BU 3F2CA 4E0DA 2YMPA 3H8JA 3UXNA 7ICOA 4RQ0A 1D8BA 3C29A 2K8CB 3N7PD 5L1MA 4AP9A 3ZDAA 5AKLA 2ISPA 2V9WA 1L7MA 5J2KA 1IV8A 2KZMA 5HNKA 5AI6A 4RQNA 5E79U 4F4WA 3IP4B 2VA3A 4J9SA 4EX7A 1NK8A 3IDWA 4RNOA 2ZUCA 1CI4A 4UB8U 1PK3A 2FPKA 4F5RA 2PFNA 5ALIA 1XO0A 1VLBA 8ICCA 3OJUA 3NRZA 8ICVA 4FE3A 2NRXA 2ZXHA 5KFUA 2W3RA 5EE3A 4UBCA 5KFQA 9ICJA 1SV0A 1QSYA 2OM6A 3T79A 2XY5A 5GTIU 3T5KA 2WFAA 1T3QA 1S77D 4ED8A 2Y1JA 2EQYA 3QUCA 4RQ7A 5IIJA 3ZI4A 8ICAA 2G5HB 3M9MB 2JEIA 2F1JA 4UAZA 4GXIA 4JUZA 1SZHA 1TK0A 1Z1VA 3E0FA 2W11A 4JK1A 3KOOA 5K4LA 2MRLA 4YG2A 4EZ6A 1J97A 3PW5A 1TAQA 3DDHA 2ATLA 4ACOA 3ICXA 4Y2XA 1O03A 4PHDA 2OXOA 8ICPA 4M9GA 5KT5A 2H3FA 1ZETA 3WK8A 4Y2QA 4QZ8A 1SV0C 3BDPA 5KFRA 4YVZA 4EEKA 2E1FA 3AEVA 1ZQCA 2KJ8A 3NVZA 3K1RB 2HOFA 1U49A 5IIOA 2ZIUA 2BQ3A 4GIBA 1NKEA 2QLTA 1S9FA 4ECZA 1L3SA 2G5IB 5H2FU 2W04A 2IMWP 5ALVA 5AK3A 3KFUF 1K1QA 2C2DA 2D8CA 9ICWA 1N56A 1DGJA 1UA0A 2NO5A 2K8BB 5AI0A 5CR0A 7ICPA 2V4QA 3MDAA 3G6YA 4YD2A 1A6SA 2J6SA 3PW0A 5ALDA 4YR0A 3MDCA 5CA7A 5CEHA 5EE0A 3V6KA 2EDUA 5ALLA 2BHNA 2MU2A 2OEHA 8ICSA 5ALOA 2ZXIA 1SL0A 4LZDA 4ECSA 3JPNA 4DL5A 4OD0A 1L7PA 2PKEA 1NK4A 2D3DA 4NLNA 4TQSA 1X9SA 4YFKA 3K1ZA 2BCQA 4UARA 1N5WA 4A8EA 4FZNA 4CF5A 4IR1A 1S0NA 2Y0SF 1Z3EB 1S97A 1NI3A 4F3OA 3MFIA 4KLMA 2HHTA 1J2NA 5G5HA 4ECQA 4RUAA 5KFXA 3HKZF 5DG9A 4AYBC 4BUGA 2WAQF 9ICLA 3VCBA 4Z6FA 1MN8A 3QZ7A 4CRXA 2JEFA 1BGXT 4TUPA 4M9HA 3ALRA 4ICAA 2IOFK 2KNJA 1Z00A 4B9SA 2WTFA 3PO4A 2E8OA 2PMZC 1IG6A 2BDUA 4RPYA 2QARA 4Y2VA 4FS1A 2HOIA 4F5PA 3QEBZ 5KFHA 2JEJA 2ZG6A 8ICRA 2E8MA 4P0PB 2KZZA 3R9KA 3PR4A 4NXZA 1A77A 1ZQZA 2AH5A 3H8SA 5KTQA 1QLNA 1C20A 5KFPA 3C1YA 2CRXA 4DL2A 4QNLA 1S10A 3QU2A 4MEYA 3F5AA 3TACB 3RB6A 3FM9A 5CJ7A 4Y2UA 2ZTDA 1RG6A 2AJQA 4Y2RA 5AI8A 1FIQA 1Z4NA 3N4MB 1HJPA 4KLHA 1BPYA 1O08A 2B0CA 5AKEA 1TK8A 9ICIA 4CF3A 2RLTA 3PSFA 9ICNA 4J9RA 4Y2TA 5GTHU 3MGIA 3IG5A 3O0FA 1FO4A 3NTUA 4Q8FA 2LMRA 3D6JA 3BZCA 2DKXA 3PX6A 5EWGA 4M04A 1RXWA 5KFWA 5ALSA 1RYRA 5IIIA 3BS5B 2FE9A 1X40A 3PZPA 3ZD8A 2HBMA 2KV2A 3BJYA 1SKRA 2KSOB 2IBKA 2W54A 4KLOA 5JUMA 3M9OB 2W3SA 3PSPA 1JMSA 5KG0A 5EOZA 4B9MA 1NK5A 3RR7A 1KFSA 3AN1A 3MBYA 1KSPA 3AU2A 3PSTA 4UAYA 4UASA 3QX7A 5JTIA 9ICPA 3IM1A 2ASJA 2QARB 3C5GA 1AROP 4J03A 3RBEA 4I2HA 3KHLA 2HHUA 3SMVA 4I27A 3S6JA 2QB0A 4F4ZA 4IR9A 2GH1A 4ED0A 2JZBB 3H0MB 8ICQA 2AU0A 3RB3A 2BPFA 5F3XB 3JPTA 1JXLA 4DSIA 1SL2A 2KVCA 5KAIU 2BPCA 1XNSA 4DFPA 4ECYA 3RJHA 3GIMA 3L4PA 2PFOA 5KFJA 1U4BA 4B9VA 2JR5A 2KHVA 5AM4A 4O3QA 4PH5A 4DSLA 4YMNA 4F93B 5J0SA 9ICRA 3WK9A 5KFIA 4U7CA 4DL3A 4GLXA 1ZQHA 1X6JA 2DPIA 5HR7A 3PO5A 1X9XA 3T5LA 3H7IA 2HHSA 4J9PA 3HRDD 4NM1A 4XRHA 4IQVA 2P35A 1OW5A 4BJQA 5J29A 4ZOHC 5J2EA 3PX0A 2NRWA 1BVSA 4O5CA 5KT4A 4P0QB 5AKHA 2KOBA 4P4OA 3QXGA 1ZQPA 3MR3A 2DBYA 3SAHA 3Q8QB 2R18A 2I1QA 5CRXA 4M6WA 4JB3A 4GXKA 4JV2A 3MABA 4QWBA 5AKXA 2QKQA 8ICIA 2ZJ8A 9ICMA 4PHPA 3GIKA 2VJ5A 2Z7JA 2HBLA 3RAXA 2HMXA 4MFCA 2QB1A 3C2MA 1RM6C 1ZQ1C 3OJSA 1QQ7A 2FI1A 2WF5A 5L9XA 4UAVA 5B5EU 2A1JB 1J2MA 1SKSA 1JALA 3QU9A 3FDSA 2LM1A 9ICBA 4RT3A 3TANA 4TURA 1B22A 3OPXA 2W9CB 1MA7A 5EE1A 3CP8A 1D8LA 3OHBA 1WWVA 3M6ZA 2WB1F 2GLEA 2DPJA 2FLPA 3H8MA 8ICZA 3MR5A 1ZQBA 4UB2A 5HMLA 1IXRA 4QZHA 1VJ5A 5J0UA 2FDRA 3QEAZ 1TV9A 1NZBA 2W03A 5KFTA 5L1KA 4FO6A 4RPZA 1ZOLA 2XICA 4EX6A 2YX8A 4Y2JA 4YCXA 4LVSA 1L5UA 4ED6A 8ICBA 2PI5A 2XY6A 1FEZA 2K4EA 5AK5A 4NLGA 1VDVA 5IIMA 5ALNA 2F1HA 3HWTA 1KEJA 3IHQB 5KFEA 7ICVA 4ZH4A 5KAFU 2E5SA 4DQPA 2YN4A 3TADC 5J0YA 3RFAA 5KFMA 4DL7A 3EUB2 4IRKA 4MF2A 2LI6A 1Q8KA 5DB7A 1SZPA 5IIKA 4OO1J 2UVRA 8ICKA 5KT6A 4UQGA 3SZ2A 4MF8A 4IRCA 2BKEA 3BQTA 1ZQUA 3KKAC 5ALHA 2B21A 3JPRA 3RTVA 5KNIA 5ALXA 9ICGA 3Q8RB 4RPXA 3U26A 4KITB 5AK6A 3TAPA 9ICKA 1L8OA 1COKA 3V6HA 1U9LA 4GC7A 5J0RA 9ICUA 5G5GA 4EYIB 5J0WA 3WKCA 4P0PA 2F1IA 4TQRA 3BS5A 9ICSA 3NVYA 2EZZA 2H3QA 4F2SA 4YR2A 2Y9UA 3N28A 5AM5A 4NLKA 1LB2B 2EANA 4RQ1A 5ALMA 4YXMA 3Q8PB 2FLLA 5C0YA 2W9BB 3QE9Y 3GU3A 5C5JA 4XQ8A 3HX0A 3PVXA 5BOLA 4DO9A 1FFVA 4DOAA 1L8LA 2HOQA 4CDGA 3T5HA 4F4YA 2DQNB 2KVSA 2GWSA 2C22A 2XVTA 4EYHB 5TZVA 1BPXA 1KLNA 4B9TA 3SV4A 9ICCA 7ICSA 3D2SA 1ZQKA 4DSFA 1Z19A 5KFYA 4DLEA 8ICHA 1LKYA 1UQVA 3NASA 4UB6U 3NVVA 2KFNA 1MSWD 3MFHA 5JU5A 4C7ZA 5J2AA 4EBEA 3E2EA 4IC9A 4PGXA 4NLZA 4C7YA 2H5XA 2EAMA 3HT3A 3RH5A 4O3RA 4QWCA 9ICVA 1XO1A 3H0LB 4QZEA 1BPBA 1KTQA 2LBOA 4LJXA 5DG7A 4O3NA 3T3FA 4DQRA 3ISDA 2PI4A 3KHRA 2FJ6A 1HUZA 3FYHA 5ALFA 3N7SC 2JHDA 2BZFA 2KJ5A 2MAXA 1QQ5A 3Q8MA 4RUCA 3L5KA 1L7NA 3I28A 3GIJA 3RJJA 2MUTA 5KG2A 3UMGA 2BDPA 2HBKA 4OCZA 4F5QA 2W7PA 2K4HA 3H0RB 3UMBA 1QH9A 2RHFA 2AGQA 2H3IA 4DEZA 2IHMA 1X66A 4K4IA 2AXTU 3UM9A 1V97A 3V72A 2WF8A 4O3PA 3KZXA 4C4RA 4ED2A 4I2JA 1Q3UA 1LV5A 2AHOB 2R8HA 1F0MA 5J0XA 2VA2A 5ALUA 2JGAA 4XA5A 5AKYA 4HAIA 2VJ4A 3QU5A 3JPOA 3V6JA 1X6IA 4WJ3B 1T94A 3BS7A 2W9CA 5DGAA 2YQEA 2CXYA 1KN5A 5KFVA 3TI0A 4QZBA 4X5VA 3GZFA 2VIXA 3MGHA 8ICOA 2ALZA 1JROA 4QIWF 3V7JA 4Q44A 3BQ0A 3BZKA 4M0AA 2XGPA 4CGZA 2ASLA 2Q4TA 1RPLA 2E1EA 4F50A 2Y0SC 4QZ9A 3MR2A 4KLQA 1ZQMA 4IQUA 5DLGA 4KLTA 5J0QA 8ICYA 9ICQA 3HKZC 3ZDDA 4CF4A 3D2NA 9ICHA 1IM4A 1ZYQA 3DV9A 7ICLA 3MGVA 4F4KA 1NK9A 1JI7A 1ZD2P 2AQ4A 2B6GA 2JZBA 1ZJMA 1PUZA 3GV7B 5ALTA 1S5LU 2HCFA 2HDOA 2CPRA 4BX9C 4EBDA 2BCVA 2WF9A 2PMZF 1NK0A 1BNPA 3SQIA 3H4DA 5T14A 3LYSA 2PFQA 4J9LA 4GXJA 2W8KA 2WF7A 4YXJA 2NYVA 3F2DA 4F2RA 4GC6A 1JN3A 4BWMA 3G6VA 2ESEA 5J2DA 4UB4A 2K60A 2KZ3A 1ZQGA 5HP4A 2K89A 5ALYA 4ECUA 2DKZA 5ALJA 1S8OA 1RDFA 4JMUA 4PHAA 3AM9A 4M47A 2ZIXB 2JRZA 2DL0A 2JEGA 4Q43A 2A3VA 1FFUA 5AI5A 1KRPA 3B9JA 5DBBA 3MR6A 3F53A 1JXEA 2WAQC 1TE2A 3PW4A 2BPGA 1X42A 4FFDA 4KLFA 5AICA 2JH7A 2PXIA 4LZGA 1Y88A 5DQHA 1KQQA 3J81j 1NOMA 4C4SA 3CYMA 1N48A 5DDYA 4PGQA 2BQRA 4NLBA 1ZQAA 5J2GA 1RXVA 3WK7A 1B4FA 5DQGA 5DGBA 3B0XA 2XGQA 2F8LA 2JMGA 3UQ2A 1B0XA 8ICUA 3L3FX 5AKJA 7ICKA 2ZTCA 5J0PA 5KFOA 1NJWA 1U47A 5AM0A 1YT3A 3N97B 3PSIA 1HUOA 3H8WA 5JRTA 3FC4A 1T7PA 1BPEA 2NV3A 4F92B 3RBDA 1JIHA 3UXOA 4FBUA 2F2AB 4Y2YA 1QSLA 1WCLA 4QZGA 3C2KA 2KKPA 2BCSA 5J2CA 1MQ2A 3DEEA 5KFBA 1ZQDA 3H4BA 1TFRA 4UAWA 2EZXA 1V85A 4I2FA 2KEYA 5ALKA 1TKDA 3BQ2A 4ED7A 2RDIA 5AKGA 2HHWA 4M9LA 5HHHA 5AIAA 4DS5A 5KG5A 2XY7A 1UCVA 5L1IA 2R8IA 3A0HU 2OCEA 2KG5A 2LHTA 4XUSA 1X2IA 5D49A 4YN4A 4CNQA 2P66A 4MEXA 5F9LA 3K4GA 5KFNA 3ETRA 5KL1B 4YMOA 1UA1A 1RQNA 1UT8A 2NRTA 4FS2A 4F5OA 8ICEA 3E58A 4G9BA 4KN7A 3EPGA 3NRWA 8ICNA 3K75D 1Q46A 3ISBA 4NM2A 2MSNA 4I2BA 3CNHA 1S0VA 2W55A 1U45A 3RJFA 1NJXA 1KW4A 2W43A 5AI4A 2ZIVA 4JWNA 4UB1A 2F3NA 1B43A 1URJA 1XC9A 5AHXA 2MA1A 3PNCA 4QZDA 3LVWA 4F71A 5ALPA 2XI9A 2LPEA 4B9UA 4UAUA 3AQFA 3IN5A 5KG1A 5A0LA 5KFZA 2LM4A 1L6NA 1X9WA 3C28A 3M6KA 1NKBA 2J6TA 1ZXIA 3RJKA 1L3VA 3OSPA 1ZQJA 4NY8A 2YMLA 1JRPA 2BQUA 1SV4A 1ZD4A 5DDMA 4FBTA 1YZ7A 4QJFB 3RR8A 2NRZA 1PVPA 5KG7A 4JWMA 4OJ5A 1BPZA 2H3VA 2ZIWB 3UPQA 1K5OA 3C23A 2I6XA 3KHGA 4P4PA 3RH6A 1MQ3A 4KLIA 2XCPA 2ZIWA 5AM2A 2ZJAA 2M0NA 2JH1A 4ED3A 1WWUA 4MFAA 3LWLA 1N63A 3BQ7A 5AKIA 1DK2A 1K1SA 7ICQA 4USAA 2FMPA 5J2FA 3F5EA 1ZQIA 8ICFA 5CB1A 4ECRA 3KKAA 2R8KA 2I5HA 5J8YA 3MC1A 4RT2A 4J9NA 4DOCA 3RB4A 3GFKB 1SXDA 4O5EA 1SGGA 4YQWA 1S0OA 2Y1IA 4M9NA 1ZQTA 4BXOB 1UPHA 2KK0A 4ELTA 2ASDA 1F44A 4DFJA 3SR6A 4M6WB 1AQ6A 3NUQA 5BOMA 3GILA 3QNMA 3THVA 3QYPA 1RQLA 2EH9A 1NNLA 4ECXA 1BNOA 4QW8A 3ETLA 4US9A 4P0QA 3ZDEA 3Q8KA 3G6XA 4I29A 4P4MA 1T4GA 1ZRNA 2HVHA 3JPQA 1XWLA 2LYAA 5DLFA 3QUQA 2JV3A 2ZIXA 4NWIA 2EAOA 4Y2SA 4R8UA 3WU2U 1ZQWA 5KT7A 2C2EA 2BCUA 4YR3A 2W9MA 3TFSA 1CRXA 2DWQA 5HMMA 4M2YA 2ZIVB 4ELUA 4G3IA 3AQEA 2KTQA 3AMZA 7ICEA 1PK1A 3T5JA 8ICMA 7ICHA 3OGUA 4KTQA 1WUDA 1D8YA 1P7DA 5KFSA 5HHIA 2LKYA 2KN7A 1UT5A 4RNNA 1S0MA 2UVVA 2H3ZA 3C1ZA 4JV0A 2KSOA 3QZ8A 3M1YA 4I2IA 4MHVA 3JPPA 2FMQA 3WK4A 1V9PA 8ICGA 3M8RA 3VC8A 2AQ0A 1ZQEA 4KN4A 4Z6CA 3B0YA 1XSLA 2VANA 3SAGA 4DS4A 4CE6A 4PPXA 1KFDA 4RNMA 3RF9A 3PY8A 5DBAA 1Q3VA 1KDHA 3IRUA 2FPMA 3M9NB 2XIDA 3ZDBA 4O5KA 2CN1A 2L5YA 4RQ2A 3H40A 3KBBA 2F76X 4KLLA 3D2QA 5ALEA 4J9KA 4PL2A 2DUYA 5DKWA 3RRGA 9ICTA 1ZJNA 1C7YA 2KFZA 1TAMA 3SEIA 4QZCA 1PK1B 2J6UA 4DL6A 8ICJA 2KP7A 3WKAA 4OJPA 3KZIU 5DG8A 1LKYB 2E8PA 2UVUA 2F77X 4BGDA 4PZOA 3AL0B 4DOBA 3SV3A 3RAQA 5KFFA 1RZTA 4O9MA 4RU9A 5IINA 4P2HA 4B6JA 3WK5A 4TUQA 3OTQA 4KX5A 4BWJA 5B66U 3ORYA 4IQWA 7ICRA 2HHXA 1T8EA 2KJ9A 5ALQA 5EWFA
chains in the Genus database with same CATH topology
3GU3A 5T14A 2HBKA 3LYSA 4NLCA 4OJ6A 1PVPA 1PVRA 2F2AB 4OJ5A 1HIWA 2K8AA 2KD1A 2W7PA 3AQEA 2H3VA 2K4HA 2K8BB 2KVCA 2ZXHA 2ZIWB 3H0RB 4GFJA 2CRXA 2WB1C 3LVVA 1PVQA 1NZBA 2W03A 4QNLA 1XNSA 1WUDA 2RHFA 4O3MA 2YB1A 2KKPA 1ED1A 2GOLA 2H3IA 3F5AA 4C0ZA 1P7DA 1A6SA 2LKYA 3F2DA 3DEEA 2XICA 4FZMA 2HOQA 2DGZA 4CDGA 2KHVA 2YX8A 2H3ZA 2OM6A 2G06A 2DQNB 3T79A 2K4EA 4U7CA 1GO3F 3KZXA 2KEYA 2XVTA 2ZIWA 2KIWA 2KICA 2ZXIA 2D6FC 2M0NA 4OJOA 3VC8A 2K89A 2KHQA 2JH1A 5HR7A 2RP5A 1Q3UA 3IG8A 2G5HB 3N7RC 3PSFA 2RRDA 2LHTA 3ONNA 3SAGA 2E5SA 3D2SA 2JGAA 3IG5A 3O0FA 4FZLA 1Z19A 2VJ4A 4BJQA 3K1ZA 4JMUA 2G08A 1OUQA 3RFAA 1KBUA 1HEKA 4P0QB 1T94A 2ZIXB 4WJ3B 3RF9A 5KL1B 1A0PA 2YB4A 1SZHA 4A8EA 3F5EA 1Q3VA 4KX3A 2KOBA 4FZNA 2A3VA 2XIDA 3E0FA 2KKVA 2CN1A 2Y0SF 3PZPA 3F53A 3SAHA 2R18A 5CRXA 5HR6A 2MRLA 3GZFA 2OYYA 4OJLA 4OO1J 2F76X 2VIXA 3D2QA 2WAQC 3CRXA 2HBMA 2KV2A 4QIWF 4PL2A 3M7DA 3NRWA 4ACOA 3ICXA 1Z1BA 3F2CA 4CGZA 2N1RA 2Q4TA 4IC9A 2G09A 2E1EA 2G07A 2JH7A 2OXOA 1TAMA 2Y0SC 1UPHA 3HKZF 2VJ5A 2Z7JA 3PSPA 2H3FA 1F44A 4AYBC 4BUGA 2WAQF 2K8CB 3C29A 1D8BA 4OJPA 4QIWC 1IIPA 2HBLA 3NUQA 3N7PD 2HMXA 3H0LB 2VKQA 3CYMA 2ZIVA 3VCBA 2OH2A 2DF4B 2LBOA 4NLBA 3HKZC 1ZQ1C 1URJA 3PSTA 2F77X 2MA1A 4P0QA 4AYBF 4CRXA 3AL0B 3D2NA 3IP4B 2E1FA 3LVWA 2XI9A 2F8LA 2KJ8A 1ECWA 2JMGA 2G0AA 5KL8B 3MGVA 3ALRA 4ICAA 3L3FX 2HOFA 4P0PA 3AQFA 2ZIUA 3IN5A 2KNJA 5A0LA 1DRGA 2ZIUB 2LYAA 2H3QA 1L6NA 3SMVA 2PMZC 2K4IA 3M6KA 3N7SC 3C28A 2BDUA 2G5IB 1XO0A 4U6PA 2JHDA 4KX5A 2KJ5A 3OPXA 1YT3A 2GH1A 2W04A 2ZIXA 3PSIA 4NWIA 4PL1A 1MA7A 2HOIA 2CPRA 3CP8A 3H0MB 4BX9C 3SAFA 4NV0A 2ZG6A 4P0PB 3KFUF 2LYBA 3M6ZA 1CRXA 2NV3A 2WB1F 2KJ9A 2PMZF 4QJFB 3F2BA 4FE3A 4KMOB 2W7OA 5C0YA 2ZIVB 2HBJA 3SQIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CRX A;  2KHQ A;  1PVP A;  2KJ8 A;  3LYS A;  1Q3U A;  1PVR A;  3MGV A;  3NRW A;  2KD1 A;  4ACO A;  2HOF A;  1Z1B A;  2CRX A;  2OXO A;  1PVQ A;  1NZB A;  1Z19 A;  1XNS A;  1DRG A;  2KKP A;  1P7D A;  1OUQ A;  3C28 A;  1KBU A;  1XO0 A;  3C29 A;  1F44 A;  2KJ5 A;  1MA7 A;  1A0P A;  2HOI A;  2KHV A;  4A8E A;  2A3V A;  1Q3V A;  2KOB A;  2KKV A;  1CRX A;  2KEY A;  2KIW A;  2KJ9 A;  4CRX A;  5CRX A; 
#chains in the Genus database with same CATH topology
 1NK7 A;  4O0I A;  4RQM A;  4NLC A;  1HIW A;  3Q8L A;  3UQ0 A;  2WB1 C;  3LVV A;  3RRH A;  1XS9 D;  1ED1 A;  4PJ0 U;  4C0Z A;  5EE9 A;  4DFK A;  2W9B A;  4Q8E A;  4QW9 A;  1ZQN A;  1Z4O A;  1UHU A;  2EAP A;  2YMM A;  2XC9 A;  4RQ6 A;  3C21 A;  3WKB A;  2KIC A;  2JXJ A;  3EPI A;  2D6F C;  1CEZ A;  2RP5 A;  2A1A A;  2Y9T A;  3N7R C;  3SEN A;  1OXJ A;  4UW9 A;  1PZN A;  1NJY A;  4IRD A;  3GV5 B;  4MFF A;  4ECT A;  1OUQ A;  1KBU A;  5DB6 A;  1TAU A;  2ODG A;  2YB4 A;  2YMQ A;  2O6K A;  4DFM A;  9ICA A;  3PV8 A;  4EEY A;  4Q45 A;  4QZF A;  2OYY A;  4F5N A;  9ICO A;  3OHA A;  2G09 A;  3PX4 A;  4DF8 A;  7ICI A;  5DBC A;  1SWW A;  4I2D A;  2OH2 A;  4RQ8 A;  3UXP A;  2ISO A;  2OHF A;  4UAT A;  3V7L A;  3RJE A;  2NO4 A;  3LDA A;  4ECV A;  4AYB F;  9ICX A;  1COO A;  4F72 A;  5DB8 A;  4QWD A;  1ECW A;  3NVW A;  2G0A A;  5KL8 B;  5J2H A;  3ZD9 A;  1DRG A;  3EWA A;  2ZIU B;  2P6R A;  4DQI A;  4PL1 A;  5AIB A;  4O3S A;  3RJI A;  9ICF A;  4KLD A;  2EZY A;  4DQQ A;  3F2B A;  4DSE A;  1ZQS A;  1N2X A;  4KLU A;  2HBJ A;  3CW2 C;  2PFP A;  3GV8 B;  4EEN A;  4C8K A;  3FAH A;  1DGS A;  4ELV A;  5L1J A;  5TIS U;  2YB1 A;  1N62 A;  1XSP A;  4RZR A;  1V38 A;  3ZDC A;  4QZI A;  5KG6 A;  1ZQQ A;  4QWE A;  2IOF A;  4JV1 A;  8ICT A;  2WHE A;  3TAD A;  3RJG A;  3Q8S B;  5BPC A;  5D4B A;  3HJE A;  5FP0 A;  3QU7 A;  3IG8 A;  3GQC A;  5CP2 A;  4R66 A;  1QSS A;  4Z6D A;  8ICX A;  1A0P A;  3JPS A;  4QWA A;  2FMS A;  4R64 A;  3QUB A;  1S76 D;  3RB0 A;  1XU4 A;  1ZQV A;  5HR6 A;  5AI9 A;  3M7D A;  1Z1B A;  1KFT A;  5J2I A;  2N1R A;  4PGY A;  4TUS A;  1TVA A;  4J9O A;  4NL9 C;  4IL6 U;  4C80 A;  4DF4 A;  3TQ1 A;  1A76 A;  1D9D A;  2MUT B;  3SD7 A;  3BQ1 A;  7ICM A;  1ZQL A;  2F8K A;  4B9N A;  7ICG A;  4K4H A;  2ZJ5 A;  4KLE A;  4F4X A;  2K4I A;  1ZD5 A;  4F8R A;  2W8L A;  1SXE A;  2A19 A;  4U6P A;  5ALZ A;  3SI8 A;  4I2G A;  3EYZ A;  2I9G A;  2LYB A;  3NS1 A;  2BCR A;  4DL4 A;  1BPD A;  4KMO B;  2W7O A;  4KLJ A;  1QCK A;  3M8S A;  4GFJ A;  3PML A;  2UVW A;  4NL9 A;  4O3M A;  2RQ5 A;  2GOL A;  4YP3 A;  3C2L A;  3C5F A;  3WKE A;  3I1Y A;  1SL1 A;  3AUO A;  4KLG A;  1WG8 A;  2BR0 A;  8ICL A;  3ED5 A;  7ICT A;  3KHH A;  3WKD A;  9ICE A;  8ICW A;  3HIL A;  3EZ5 A;  3KTQ A;  3ISC A;  5AM3 A;  2KHQ A;  1DK3 A;  3EW9 A;  2P6U A;  4YD1 A;  5CHG A;  4C8N A;  4RQ5 A;  5DQI A;  1DXS A;  1HEK A;  4NJ8 A;  2ZUD A;  2V4R A;  1D9F A;  1ZQF A;  2R8J A;  2KKV A;  1N61 A;  3PMN A;  3CRX A;  5AKZ A;  4UBB A;  3WK6 A;  4O3O A;  2GO7 A;  4I2E A;  1SKW A;  2XCA A;  2HVI A;  5KT3 A;  2YY6 A;  1QTM A;  1XSN A;  1WCN A;  5D46 A;  1ZQY A;  3LWM A;  4QIW C;  1YZ6 A;  1F5S A;  4ECW A;  1ZD3 A;  2VKQ A;  1TK5 A;  2M9N A;  3V7K A;  2YTU A;  2ZTE A;  2NRV A;  4R65 A;  2KMD A;  4C8L A;  2HHV A;  4I2C A;  1ZQR A;  3HW8 A;  1MC8 A;  7ICF A;  1Z00 B;  2ES6 A;  3TAR A;  4DCC A;  2C28 A;  2VA8 A;  4B9L A;  7ICJ A;  4IQT A;  5KFC A;  2ZUB A;  4C8M A;  3SAF A;  4NV0 A;  1L3T A;  4KMU A;  3UMC A;  5J2J A;  2IHN A;  5J0T A;  3RH4 A;  2KIV A;  2K8A A;  2KD1 A;  5ALG A;  2E8N A;  5J2B A;  4I28 A;  4BXO A;  2IA6 A;  3PR5 B;  1SIJ A;  5AKK A;  3TAQ A;  4RQ3 A;  2W9A A;  1NJZ A;  4K4G A;  2Q0Z X;  5AK4 A;  5IIL A;  5KFG A;  5KFD A;  3AU6 A;  5KG3 A;  2OWO A;  2E3T A;  1T3N A;  5KFL A;  2KE7 A;  4DSK A;  2A1J A;  4DLG A;  5EWE A;  3OSN A;  4I2A A;  2G08 A;  3PW2 A;  2BGW A;  5KT2 A;  3KD3 A;  1KL9 A;  4KX3 A;  4EEL A;  7ICN A;  5CWR A;  2WF6 A;  5J0O A;  3LK9 A;  1RYU A;  5ALR A;  4BDP A;  3SYZ A;  2LYH A;  3IV6 A;  1H38 A;  2G07 A;  1WYG A;  4C4T A;  1JUD A;  1L7O A;  5J8Y C;  2RDJ A;  1ZRM A;  1IIP A;  5DB9 A;  1M6Y A;  4C8O A;  4PHE A;  5KFK A;  2XO7 A;  2DF4 B;  3GII A;  2C2R A;  1N5X A;  2F44 A;  2AGP A;  1SWV A;  2FLN A;  3QUT A;  4DFD A;  2AGO A;  2HHQ A;  1NZP A;  3PW7 A;  1NK6 A;  4HYK A;  5L1L A;  1QQ6 A;  2QB0 B;  4Y2P A;  1KKX A;  5ALW A;  3QU4 A;  4IS7 A;  1JX4 A;  2IOH A;  4J9M A;  1NKC A;  1RYS A;  4EZ9 A;  4R63 A;  3GDX A;  4YMM A;  4UB3 A;  4OJ6 A;  1PVR A;  1DOQ A;  4M9J A;  4PZN A;  5AM1 A;  3I76 A;  4UB5 A;  1PVQ A;  4US8 A;  4EBC A;  2R8G A;  1SB3 C;  4KLS A;  4DSJ A;  2K4P A;  4FZM A;  1ZQX A;  2HW3 A;  2DGZ A;  5KFA A;  4DQS A;  2G06 A;  4RQ4 A;  2FPL A;  3NGD A;  3TKA A;  1CUK A;  1GO3 F;  1X9M A;  4CCH A;  1ZQO A;  2KIW A;  1U48 A;  4OJO A;  2HSZ A;  2DFL A;  7ICU A;  4J9Q A;  4QZA A;  4ED1 A;  4F91 B;  2RRD A;  3ONN A;  3HP6 A;  4FZL A;  4R8U B;  1L3U A;  4DWI A;  5F9N A;  4Z6E A;  1EXN A;  1LVH A;  5KG4 A;  1N60 A;  3TFR A;  3HPO A;  2HI0 A;  4OJL A;  3A0B U;  3F2C A;  4E0D A;  2YMP A;  3H8J A;  3UXN A;  7ICO A;  4RQ0 A;  1D8B A;  3C29 A;  2K8C B;  3N7P D;  5L1M A;  4AP9 A;  3ZDA A;  5AKL A;  2ISP A;  2V9W A;  1L7M A;  5J2K A;  1IV8 A;  2KZM A;  5HNK A;  5AI6 A;  4RQN A;  5E79 U;  4F4W A;  3IP4 B;  2VA3 A;  4J9S A;  4EX7 A;  1NK8 A;  3IDW A;  4RNO A;  2ZUC A;  1CI4 A;  4UB8 U;  1PK3 A;  2FPK A;  4F5R A;  2PFN A;  5ALI A;  1XO0 A;  1VLB A;  8ICC A;  3OJU A;  3NRZ A;  8ICV A;  4FE3 A;  2NRX A;  2ZXH A;  5KFU A;  2W3R A;  5EE3 A;  4UBC A;  5KFQ A;  9ICJ A;  1SV0 A;  1QSY A;  2OM6 A;  3T79 A;  2XY5 A;  5GTI U;  3T5K A;  2WFA A;  1T3Q A;  1S77 D;  4ED8 A;  2Y1J A;  2EQY A;  3QUC A;  4RQ7 A;  5IIJ A;  3ZI4 A;  8ICA A;  2G5H B;  3M9M B;  2JEI A;  2F1J A;  4UAZ A;  4GXI A;  4JUZ A;  1SZH A;  1TK0 A;  1Z1V A;  3E0F A;  2W11 A;  4JK1 A;  3KOO A;  5K4L A;  2MRL A;  4YG2 A;  4EZ6 A;  1J97 A;  3PW5 A;  1TAQ A;  3DDH A;  2ATL A;  4ACO A;  3ICX A;  4Y2X A;  1O03 A;  4PHD A;  2OXO A;  8ICP A;  4M9G A;  5KT5 A;  2H3F A;  1ZET A;  3WK8 A;  4Y2Q A;  4QZ8 A;  1SV0 C;  3BDP A;  5KFR A;  4YVZ A;  4EEK A;  2E1F A;  3AEV A;  1ZQC A;  2KJ8 A;  3NVZ A;  3K1R B;  2HOF A;  1U49 A;  5IIO A;  2ZIU A;  2BQ3 A;  4GIB A;  1NKE A;  2QLT A;  1S9F A;  4ECZ A;  1L3S A;  2G5I B;  5H2F U;  2W04 A;  2IMW P;  5ALV A;  5AK3 A;  3KFU F;  1K1Q A;  2C2D A;  2D8C A;  9ICW A;  1N56 A;  1DGJ A;  1UA0 A;  2NO5 A;  2K8B B;  5AI0 A;  5CR0 A;  7ICP A;  2V4Q A;  3MDA A;  3G6Y A;  4YD2 A;  1A6S A;  2J6S A;  3PW0 A;  5ALD A;  4YR0 A;  3MDC A;  5CA7 A;  5CEH A;  5EE0 A;  3V6K A;  2EDU A;  5ALL A;  2BHN A;  2MU2 A;  2OEH A;  8ICS A;  5ALO A;  2ZXI A;  1SL0 A;  4LZD A;  4ECS A;  3JPN A;  4DL5 A;  4OD0 A;  1L7P A;  2PKE A;  1NK4 A;  2D3D A;  4NLN A;  4TQS A;  1X9S A;  4YFK A;  3K1Z A;  2BCQ A;  4UAR A;  1N5W A;  4A8E A;  4FZN A;  4CF5 A;  4IR1 A;  1S0N A;  2Y0S F;  1Z3E B;  1S97 A;  1NI3 A;  4F3O A;  3MFI A;  4KLM A;  2HHT A;  1J2N A;  5G5H A;  4ECQ A;  4RUA A;  5KFX A;  3HKZ F;  5DG9 A;  4AYB C;  4BUG A;  2WAQ F;  9ICL A;  3VCB A;  4Z6F A;  1MN8 A;  3QZ7 A;  4CRX A;  2JEF A;  1BGX T;  4TUP A;  4M9H A;  3ALR A;  4ICA A;  2IOF K;  2KNJ A;  1Z00 A;  4B9S A;  2WTF A;  3PO4 A;  2E8O A;  2PMZ C;  1IG6 A;  2BDU A;  4RPY A;  2QAR A;  4Y2V A;  4FS1 A;  2HOI A;  4F5P A;  3QEB Z;  5KFH A;  2JEJ A;  2ZG6 A;  8ICR A;  2E8M A;  4P0P B;  2KZZ A;  3R9K A;  3PR4 A;  4NXZ A;  1A77 A;  1ZQZ A;  2AH5 A;  3H8S A;  5KTQ A;  1QLN A;  1C20 A;  5KFP A;  3C1Y A;  2CRX A;  4DL2 A;  4QNL A;  1S10 A;  3QU2 A;  4MEY A;  3F5A A;  3TAC B;  3RB6 A;  3FM9 A;  5CJ7 A;  4Y2U A;  2ZTD A;  1RG6 A;  2AJQ A;  4Y2R A;  5AI8 A;  1FIQ A;  1Z4N A;  3N4M B;  1HJP A;  4KLH A;  1BPY A;  1O08 A;  2B0C A;  5AKE A;  1TK8 A;  9ICI A;  4CF3 A;  2RLT A;  3PSF A;  9ICN A;  4J9R A;  4Y2T A;  5GTH U;  3MGI A;  3IG5 A;  3O0F A;  1FO4 A;  3NTU A;  4Q8F A;  2LMR A;  3D6J A;  3BZC A;  2DKX A;  3PX6 A;  5EWG A;  4M04 A;  1RXW A;  5KFW A;  5ALS A;  1RYR A;  5III A;  3BS5 B;  2FE9 A;  1X40 A;  3PZP A;  3ZD8 A;  2HBM A;  2KV2 A;  3BJY A;  1SKR A;  2KSO B;  2IBK A;  2W54 A;  4KLO A;  5JUM A;  3M9O B;  2W3S A;  3PSP A;  1JMS A;  5KG0 A;  5EOZ A;  4B9M A;  1NK5 A;  3RR7 A;  1KFS A;  3AN1 A;  3MBY A;  1KSP A;  3AU2 A;  3PST A;  4UAY A;  4UAS A;  3QX7 A;  5JTI A;  9ICP A;  3IM1 A;  2ASJ A;  2QAR B;  3C5G A;  1ARO P;  4J03 A;  3RBE A;  4I2H A;  3KHL A;  2HHU A;  3SMV A;  4I27 A;  3S6J A;  2QB0 A;  4F4Z A;  4IR9 A;  2GH1 A;  4ED0 A;  2JZB B;  3H0M B;  8ICQ A;  2AU0 A;  3RB3 A;  2BPF A;  5F3X B;  3JPT A;  1JXL A;  4DSI A;  1SL2 A;  2KVC A;  5KAI U;  2BPC A;  1XNS A;  4DFP A;  4ECY A;  3RJH A;  3GIM A;  3L4P A;  2PFO A;  5KFJ A;  1U4B A;  4B9V A;  2JR5 A;  2KHV A;  5AM4 A;  4O3Q A;  4PH5 A;  4DSL A;  4YMN A;  4F93 B;  5J0S A;  9ICR A;  3WK9 A;  5KFI A;  4U7C A;  4DL3 A;  4GLX A;  1ZQH A;  1X6J A;  2DPI A;  5HR7 A;  3PO5 A;  1X9X A;  3T5L A;  3H7I A;  2HHS A;  4J9P A;  3HRD D;  4NM1 A;  4XRH A;  4IQV A;  2P35 A;  1OW5 A;  4BJQ A;  5J29 A;  4ZOH C;  5J2E A;  3PX0 A;  2NRW A;  1BVS A;  4O5C A;  5KT4 A;  4P0Q B;  5AKH A;  2KOB A;  4P4O A;  3QXG A;  1ZQP A;  3MR3 A;  2DBY A;  3SAH A;  3Q8Q B;  2R18 A;  2I1Q A;  5CRX A;  4M6W A;  4JB3 A;  4GXK A;  4JV2 A;  3MAB A;  4QWB A;  5AKX A;  2QKQ A;  8ICI A;  2ZJ8 A;  9ICM A;  4PHP A;  3GIK A;  2VJ5 A;  2Z7J A;  2HBL A;  3RAX A;  2HMX A;  4MFC A;  2QB1 A;  3C2M A;  1RM6 C;  1ZQ1 C;  3OJS A;  1QQ7 A;  2FI1 A;  2WF5 A;  5L9X A;  4UAV A;  5B5E U;  2A1J B;  1J2M A;  1SKS A;  1JAL A;  3QU9 A;  3FDS A;  2LM1 A;  9ICB A;  4RT3 A;  3TAN A;  4TUR A;  1B22 A;  3OPX A;  2W9C B;  1MA7 A;  5EE1 A;  3CP8 A;  1D8L A;  3OHB A;  1WWV A;  3M6Z A;  2WB1 F;  2GLE A;  2DPJ A;  2FLP A;  3H8M A;  8ICZ A;  3MR5 A;  1ZQB A;  4UB2 A;  5HML A;  1IXR A;  4QZH A;  1VJ5 A;  5J0U A;  2FDR A;  3QEA Z;  1TV9 A;  1NZB A;  2W03 A;  5KFT A;  5L1K A;  4FO6 A;  4RPZ A;  1ZOL A;  2XIC A;  4EX6 A;  2YX8 A;  4Y2J A;  4YCX A;  4LVS A;  1L5U A;  4ED6 A;  8ICB A;  2PI5 A;  2XY6 A;  1FEZ A;  2K4E A;  5AK5 A;  4NLG A;  1VDV A;  5IIM A;  5ALN A;  2F1H A;  3HWT A;  1KEJ A;  3IHQ B;  5KFE A;  7ICV A;  4ZH4 A;  5KAF U;  2E5S A;  4DQP A;  2YN4 A;  3TAD C;  5J0Y A;  3RFA A;  5KFM A;  4DL7 A;  3EUB 2;  4IRK A;  4MF2 A;  2LI6 A;  1Q8K A;  5DB7 A;  1SZP A;  5IIK A;  4OO1 J;  2UVR A;  8ICK A;  5KT6 A;  4UQG A;  3SZ2 A;  4MF8 A;  4IRC A;  2BKE A;  3BQT A;  1ZQU A;  3KKA C;  5ALH A;  2B21 A;  3JPR A;  3RTV A;  5KNI A;  5ALX A;  9ICG A;  3Q8R B;  4RPX A;  3U26 A;  4KIT B;  5AK6 A;  3TAP A;  9ICK A;  1L8O A;  1COK A;  3V6H A;  1U9L A;  4GC7 A;  5J0R A;  9ICU A;  5G5G A;  4EYI B;  5J0W A;  3WKC A;  4P0P A;  2F1I A;  4TQR A;  3BS5 A;  9ICS A;  3NVY A;  2EZZ A;  2H3Q A;  4F2S A;  4YR2 A;  2Y9U A;  3N28 A;  5AM5 A;  4NLK A;  1LB2 B;  2EAN A;  4RQ1 A;  5ALM A;  4YXM A;  3Q8P B;  2FLL A;  5C0Y A;  2W9B B;  3QE9 Y;  3GU3 A;  5C5J A;  4XQ8 A;  3HX0 A;  3PVX A;  5BOL A;  4DO9 A;  1FFV A;  4DOA A;  1L8L A;  2HOQ A;  4CDG A;  3T5H A;  4F4Y A;  2DQN B;  2KVS A;  2GWS A;  2C22 A;  2XVT A;  4EYH B;  5TZV A;  1BPX A;  1KLN A;  4B9T A;  3SV4 A;  9ICC A;  7ICS A;  3D2S A;  1ZQK A;  4DSF A;  1Z19 A;  5KFY A;  4DLE A;  8ICH A;  1LKY A;  1UQV A;  3NAS A;  4UB6 U;  3NVV A;  2KFN A;  1MSW D;  3MFH A;  5JU5 A;  4C7Z A;  5J2A A;  4EBE A;  3E2E A;  4IC9 A;  4PGX A;  4NLZ A;  4C7Y A;  2H5X A;  2EAM A;  3HT3 A;  3RH5 A;  4O3R A;  4QWC A;  9ICV A;  1XO1 A;  3H0L B;  4QZE A;  1BPB A;  1KTQ A;  2LBO A;  4LJX A;  5DG7 A;  4O3N A;  3T3F A;  4DQR A;  3ISD A;  2PI4 A;  3KHR A;  2FJ6 A;  1HUZ A;  3FYH A;  5ALF A;  3N7S C;  2JHD A;  2BZF A;  2KJ5 A;  2MAX A;  1QQ5 A;  3Q8M A;  4RUC A;  3L5K A;  1L7N A;  3I28 A;  3GIJ A;  3RJJ A;  2MUT A;  5KG2 A;  3UMG A;  2BDP A;  2HBK A;  4OCZ A;  4F5Q A;  2W7P A;  2K4H A;  3H0R B;  3UMB A;  1QH9 A;  2RHF A;  2AGQ A;  2H3I A;  4DEZ A;  2IHM A;  1X66 A;  4K4I A;  2AXT U;  3UM9 A;  1V97 A;  3V72 A;  2WF8 A;  4O3P A;  3KZX A;  4C4R A;  4ED2 A;  4I2J A;  1Q3U A;  1LV5 A;  2AHO B;  2R8H A;  1F0M A;  5J0X A;  2VA2 A;  5ALU A;  2JGA A;  4XA5 A;  5AKY A;  4HAI A;  2VJ4 A;  3QU5 A;  3JPO A;  3V6J A;  1X6I A;  4WJ3 B;  1T94 A;  3BS7 A;  2W9C A;  5DGA A;  2YQE A;  2CXY A;  1KN5 A;  5KFV A;  3TI0 A;  4QZB A;  4X5V A;  3GZF A;  2VIX A;  3MGH A;  8ICO A;  2ALZ A;  1JRO A;  4QIW F;  3V7J A;  4Q44 A;  3BQ0 A;  3BZK A;  4M0A A;  2XGP A;  4CGZ A;  2ASL A;  2Q4T A;  1RPL A;  2E1E A;  4F50 A;  2Y0S C;  4QZ9 A;  3MR2 A;  4KLQ A;  1ZQM A;  4IQU A;  5DLG A;  4KLT A;  5J0Q A;  8ICY A;  9ICQ A;  3HKZ C;  3ZDD A;  4CF4 A;  3D2N A;  9ICH A;  1IM4 A;  1ZYQ A;  3DV9 A;  7ICL A;  3MGV A;  4F4K A;  1NK9 A;  1JI7 A;  1ZD2 P;  2AQ4 A;  2B6G A;  2JZB A;  1ZJM A;  1PUZ A;  3GV7 B;  5ALT A;  1S5L U;  2HCF A;  2HDO A;  2CPR A;  4BX9 C;  4EBD A;  2BCV A;  2WF9 A;  2PMZ F;  1NK0 A;  1BNP A;  3SQI A;  3H4D A;  5T14 A;  3LYS A;  2PFQ A;  4J9L A;  4GXJ A;  2W8K A;  2WF7 A;  4YXJ A;  2NYV A;  3F2D A;  4F2R A;  4GC6 A;  1JN3 A;  4BWM A;  3G6V A;  2ESE A;  5J2D A;  4UB4 A;  2K60 A;  2KZ3 A;  1ZQG A;  5HP4 A;  2K89 A;  5ALY A;  4ECU A;  2DKZ A;  5ALJ A;  1S8O A;  1RDF A;  4JMU A;  4PHA A;  3AM9 A;  4M47 A;  2ZIX B;  2JRZ A;  2DL0 A;  2JEG A;  4Q43 A;  2A3V A;  1FFU A;  5AI5 A;  1KRP A;  3B9J A;  5DBB A;  3MR6 A;  3F53 A;  1JXE A;  2WAQ C;  1TE2 A;  3PW4 A;  2BPG A;  1X42 A;  4FFD A;  4KLF A;  5AIC A;  2JH7 A;  2PXI A;  4LZG A;  1Y88 A;  5DQH A;  1KQQ A;  3J81 j;  1NOM A;  4C4S A;  3CYM A;  1N48 A;  5DDY A;  4PGQ A;  2BQR A;  4NLB A;  1ZQA A;  5J2G A;  1RXV A;  3WK7 A;  1B4F A;  5DQG A;  5DGB A;  3B0X A;  2XGQ A;  2F8L A;  2JMG A;  3UQ2 A;  1B0X A;  8ICU A;  3L3F X;  5AKJ A;  7ICK A;  2ZTC A;  5J0P A;  5KFO A;  1NJW A;  1U47 A;  5AM0 A;  1YT3 A;  3N97 B;  3PSI A;  1HUO A;  3H8W A;  5JRT A;  3FC4 A;  1T7P A;  1BPE A;  2NV3 A;  4F92 B;  3RBD A;  1JIH A;  3UXO A;  4FBU A;  2F2A B;  4Y2Y A;  1QSL A;  1WCL A;  4QZG A;  3C2K A;  2KKP A;  2BCS A;  5J2C A;  1MQ2 A;  3DEE A;  5KFB A;  1ZQD A;  3H4B A;  1TFR A;  4UAW A;  2EZX A;  1V85 A;  4I2F A;  2KEY A;  5ALK A;  1TKD A;  3BQ2 A;  4ED7 A;  2RDI A;  5AKG A;  2HHW A;  4M9L A;  5HHH A;  5AIA A;  4DS5 A;  5KG5 A;  2XY7 A;  1UCV A;  5L1I A;  2R8I A;  3A0H U;  2OCE A;  2KG5 A;  2LHT A;  4XUS A;  1X2I A;  5D49 A;  4YN4 A;  4CNQ A;  2P66 A;  4MEX A;  5F9L A;  3K4G A;  5KFN A;  3ETR A;  5KL1 B;  4YMO A;  1UA1 A;  1RQN A;  1UT8 A;  2NRT A;  4FS2 A;  4F5O A;  8ICE A;  3E58 A;  4G9B A;  4KN7 A;  3EPG A;  3NRW A;  8ICN A;  3K75 D;  1Q46 A;  3ISB A;  4NM2 A;  2MSN A;  4I2B A;  3CNH A;  1S0V A;  2W55 A;  1U45 A;  3RJF A;  1NJX A;  1KW4 A;  2W43 A;  5AI4 A;  2ZIV A;  4JWN A;  4UB1 A;  2F3N A;  1B43 A;  1URJ A;  1XC9 A;  5AHX A;  2MA1 A;  3PNC A;  4QZD A;  3LVW A;  4F71 A;  5ALP A;  2XI9 A;  2LPE A;  4B9U A;  4UAU A;  3AQF A;  3IN5 A;  5KG1 A;  5A0L A;  5KFZ A;  2LM4 A;  1L6N A;  1X9W A;  3C28 A;  3M6K A;  1NKB A;  2J6T A;  1ZXI A;  3RJK A;  1L3V A;  3OSP A;  1ZQJ A;  4NY8 A;  2YML A;  1JRP A;  2BQU A;  1SV4 A;  1ZD4 A;  5DDM A;  4FBT A;  1YZ7 A;  4QJF B;  3RR8 A;  2NRZ A;  1PVP A;  5KG7 A;  4JWM A;  4OJ5 A;  1BPZ A;  2H3V A;  2ZIW B;  3UPQ A;  1K5O A;  3C23 A;  2I6X A;  3KHG A;  4P4P A;  3RH6 A;  1MQ3 A;  4KLI A;  2XCP A;  2ZIW A;  5AM2 A;  2ZJA A;  2M0N A;  2JH1 A;  4ED3 A;  1WWU A;  4MFA A;  3LWL A;  1N63 A;  3BQ7 A;  5AKI A;  1DK2 A;  1K1S A;  7ICQ A;  4USA A;  2FMP A;  5J2F A;  3F5E A;  1ZQI A;  8ICF A;  5CB1 A;  4ECR A;  3KKA A;  2R8K A;  2I5H A;  5J8Y A;  3MC1 A;  4RT2 A;  4J9N A;  4DOC A;  3RB4 A;  3GFK B;  1SXD A;  4O5E A;  1SGG A;  4YQW A;  1S0O A;  2Y1I A;  4M9N A;  1ZQT A;  4BXO B;  1UPH A;  2KK0 A;  4ELT A;  2ASD A;  1F44 A;  4DFJ A;  3SR6 A;  4M6W B;  1AQ6 A;  3NUQ A;  5BOM A;  3GIL A;  3QNM A;  3THV A;  3QYP A;  1RQL A;  2EH9 A;  1NNL A;  4ECX A;  1BNO A;  4QW8 A;  3ETL A;  4US9 A;  4P0Q A;  3ZDE A;  3Q8K A;  3G6X A;  4I29 A;  4P4M A;  1T4G A;  1ZRN A;  2HVH A;  3JPQ A;  1XWL A;  2LYA A;  5DLF A;  3QUQ A;  2JV3 A;  2ZIX A;  4NWI A;  2EAO A;  4Y2S A;  4R8U A;  3WU2 U;  1ZQW A;  5KT7 A;  2C2E A;  2BCU A;  4YR3 A;  2W9M A;  3TFS A;  1CRX A;  2DWQ A;  5HMM A;  4M2Y A;  2ZIV B;  4ELU A;  4G3I A;  3AQE A;  2KTQ A;  3AMZ A;  7ICE A;  1PK1 A;  3T5J A;  8ICM A;  7ICH A;  3OGU A;  4KTQ A;  1WUD A;  1D8Y A;  1P7D A;  5KFS A;  5HHI A;  2LKY A;  2KN7 A;  1UT5 A;  4RNN A;  1S0M A;  2UVV A;  2H3Z A;  3C1Z A;  4JV0 A;  2KSO A;  3QZ8 A;  3M1Y A;  4I2I A;  4MHV A;  3JPP A;  2FMQ A;  3WK4 A;  1V9P A;  8ICG A;  3M8R A;  3VC8 A;  2AQ0 A;  1ZQE A;  4KN4 A;  4Z6C A;  3B0Y A;  1XSL A;  2VAN A;  3SAG A;  4DS4 A;  4CE6 A;  4PPX A;  1KFD A;  4RNM A;  3RF9 A;  3PY8 A;  5DBA A;  1Q3V A;  1KDH A;  3IRU A;  2FPM A;  3M9N B;  2XID A;  3ZDB A;  4O5K A;  2CN1 A;  2L5Y A;  4RQ2 A;  3H40 A;  3KBB A;  2F76 X;  4KLL A;  3D2Q A;  5ALE A;  4J9K A;  4PL2 A;  2DUY A;  5DKW A;  3RRG A;  9ICT A;  1ZJN A;  1C7Y A;  2KFZ A;  1TAM A;  3SEI A;  4QZC A;  1PK1 B;  2J6U A;  4DL6 A;  8ICJ A;  2KP7 A;  3WKA A;  4OJP A;  3KZI U;  5DG8 A;  1LKY B;  2E8P A;  2UVU A;  2F77 X;  4BGD A;  4PZO A;  3AL0 B;  4DOB A;  3SV3 A;  3RAQ A;  5KFF A;  1RZT A;  4O9M A;  4RU9 A;  5IIN A;  4P2H A;  4B6J A;  3WK5 A;  4TUQ A;  3OTQ A;  4KX5 A;  4BWJ A;  5B66 U;  3ORY A;  4IQW A;  7ICR A;  2HHX A;  1T8E A;  2KJ9 A;  5ALQ A;  5EWF A; 
#chains in the Genus database with same CATH homology
 3GU3 A;  5T14 A;  2HBK A;  3LYS A;  4NLC A;  4OJ6 A;  1PVP A;  1PVR A;  2F2A B;  4OJ5 A;  1HIW A;  2K8A A;  2KD1 A;  2W7P A;  3AQE A;  2H3V A;  2K4H A;  2K8B B;  2KVC A;  2ZXH A;  2ZIW B;  3H0R B;  4GFJ A;  2CRX A;  2WB1 C;  3LVV A;  1PVQ A;  1NZB A;  2W03 A;  4QNL A;  1XNS A;  1WUD A;  2RHF A;  4O3M A;  2YB1 A;  2KKP A;  1ED1 A;  2GOL A;  2H3I A;  3F5A A;  4C0Z A;  1P7D A;  1A6S A;  2LKY A;  3F2D A;  3DEE A;  2XIC A;  4FZM A;  2HOQ A;  2DGZ A;  4CDG A;  2KHV A;  2YX8 A;  2H3Z A;  2OM6 A;  2G06 A;  2DQN B;  3T79 A;  2K4E A;  4U7C A;  1GO3 F;  3KZX A;  2KEY A;  2XVT A;  2ZIW A;  2KIW A;  2KIC A;  2ZXI A;  2D6F C;  2M0N A;  4OJO A;  3VC8 A;  2K89 A;  2KHQ A;  2JH1 A;  5HR7 A;  2RP5 A;  1Q3U A;  3IG8 A;  2G5H B;  3N7R C;  3PSF A;  2RRD A;  2LHT A;  3ONN A;  3SAG A;  2E5S A;  3D2S A;  2JGA A;  3IG5 A;  3O0F A;  4FZL A;  1Z19 A;  2VJ4 A;  4BJQ A;  3K1Z A;  4JMU A;  2G08 A;  1OUQ A;  3RFA A;  1KBU A;  1HEK A;  4P0Q B;  1T94 A;  2ZIX B;  4WJ3 B;  3RF9 A;  5KL1 B;  1A0P A;  2YB4 A;  1SZH A;  4A8E A;  3F5E A;  1Q3V A;  4KX3 A;  2KOB A;  4FZN A;  2A3V A;  2XID A;  3E0F A;  2KKV A;  2CN1 A;  2Y0S F;  3PZP A;  3F53 A;  3SAH A;  2R18 A;  5CRX A;  5HR6 A;  2MRL A;  3GZF A;  2OYY A;  4OJL A;  4OO1 J;  2F76 X;  2VIX A;  3D2Q A;  2WAQ C;  3CRX A;  2HBM A;  2KV2 A;  4QIW F;  4PL2 A;  3M7D A;  3NRW A;  4ACO A;  3ICX A;  1Z1B A;  3F2C A;  4CGZ A;  2N1R A;  2Q4T A;  4IC9 A;  2G09 A;  2E1E A;  2G07 A;  2JH7 A;  2OXO A;  1TAM A;  2Y0S C;  1UPH A;  3HKZ F;  2VJ5 A;  2Z7J A;  3PSP A;  2H3F A;  1F44 A;  4AYB C;  4BUG A;  2WAQ F;  2K8C B;  3C29 A;  1D8B A;  4OJP A;  4QIW C;  1IIP A;  2HBL A;  3NUQ A;  3N7P D;  2HMX A;  3H0L B;  2VKQ A;  3CYM A;  2ZIV A;  3VCB A;  2OH2 A;  2DF4 B;  2LBO A;  4NLB A;  3HKZ C;  1ZQ1 C;  1URJ A;  3PST A;  2F77 X;  2MA1 A;  4P0Q A;  4AYB F;  4CRX A;  3AL0 B;  3D2N A;  3IP4 B;  2E1F A;  3LVW A;  2XI9 A;  2F8L A;  2KJ8 A;  1ECW A;  2JMG A;  2G0A A;  5KL8 B;  3MGV A;  3ALR A;  4ICA A;  3L3F X;  2HOF A;  4P0P A;  3AQF A;  2ZIU A;  3IN5 A;  2KNJ A;  5A0L A;  1DRG A;  2ZIU B;  2LYA A;  2H3Q A;  1L6N A;  3SMV A;  2PMZ C;  2K4I A;  3M6K A;  3N7S C;  3C28 A;  2BDU A;  2G5I B;  1XO0 A;  4U6P A;  2JHD A;  4KX5 A;  2KJ5 A;  3OPX A;  1YT3 A;  2GH1 A;  2W04 A;  2ZIX A;  3PSI A;  4NWI A;  4PL1 A;  1MA7 A;  2HOI A;  2CPR A;  3CP8 A;  3H0M B;  4BX9 C;  3SAF A;  4NV0 A;  2ZG6 A;  4P0P B;  3KFU F;  2LYB A;  3M6Z A;  1CRX A;  2NV3 A;  2WB1 F;  2KJ9 A;  2PMZ F;  4QJF B;  3F2B A;  4FE3 A;  4KMO B;  2W7O A;  5C0Y A;  2ZIV B;  2HBJ A;  3SQI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...