2KIWA

Solution nmr structure of the domain n-terminal to the integrase domain of sh1003 from staphylococcus haemolyticus. northeast structural genomics consortium target shr105f (64-166).
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
111
structure length
111
Chain Sequence
b'TFKQVADDWLKQYANDVKVSSVRAREKAIQHAIERFNTKPIQTIKKHDYQRFVDDISAQYSKNYVDSIVASTNMIFKYAYDTRLIKAMPSEGIKRPKKKVSVELEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Int protein
publication title Solution NMR structure of the domain N-terminal to the integrase domain of SH1003 from Staphylococcus haemolyticus. Northeast Structural Genomics Consortium Target ShR105F (64-166).
rcsb
source organism Staphylococcus haemolyticus jcsc1435
molecule tags Dna binding protein
total genus 29
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2009-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14659 Phage_int_SAM_3 Phage integrase, N-terminal SAM-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.130 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2kiwA01
4A8EA 1PVPA 1KBUA 2KOBA 3C29A 1OUQA 2OXOA 2KEYA 1NZBA 2HOIA 2KIWA 1XO0A 2KKPA 2KJ5A 2KJ9A 2KKVA 3MGVA 1Z19A 2A3VA 1DRGA 2KD1A 1MA7A 2CRXA 4ACOA 2KHVA 4CRXA 1Q3UA 2HOFA 1CRXA 1P7DA 2KHQA 1PVRA 5CRXA 3C28A 3CRXA 1A0PA 1Q3VA 2KJ8A 1F44A 3LYSA 1XNSA 3NRWA 1PVQA 1Z1BA
chains in the Genus database with same CATH superfamily
5G5GA 1OUQA 1L8OA 2W9CB 5AI6A 1D9DA 2RHFA 4F93B 3KHRA 3MGVA 1T3QA 4EYHB 4DQRA 4OJ5A 1A77A 2ZUBA 5J0XA 3LVWA 1ZQZA 1TAQA 5CA7A 1BPEA 5K4LA 5AM0A 5B5EU 3KBBA 1DRGA 4Z6CA 2YN4A 3EZ5A 5L1IA 5ALTA 2PMZF 2BPFA 3WK6A 2JEIA 4DO9A 4C4TA 4YP3A 4ECRA 4ECQA 2J6TA 4PL1A 3GIJA 1S0VA 3RAQA 3C1YA 4B9VA 5BOMA 2YMQA 2AJQA 3K1ZA 4R65A 2KD1A 4I2IA 2G5HB 1WWVA 4LVSA 1MQ3A 3V7LA 3ZI4A 3Q8LA 4PHAA 4B6JA 2CPRA 1QSYA 5KFVA 3PSIA 2Y0SC 4F50A 1YZ7A 1KDHA 1ZOLA 3TADA 8ICQA 7ICKA 2Q0ZX 1B22A 1NK4A 1ZQKA 3SMVA 3BS5A 4I2AA 4R64A 4IS7A 4MFCA 2D3DA 4ECUA 4DFMA 3JPQA 1ECWA 4I2EA 5CR0A 4DF8A 3OHBA 2WTFA 4Q8EA 1AQ6A 2UVRA 1T7PA 2GOLA 9ICBA 2JEGA 4MHVA 3MBYA 5DGBA 4MFAA 1TVAA 4ED1A 1TAMA 1NKBA 1X40A 4B9MA 5BOLA 2H3ZA 4XA5A 3MFHA 3RJEA 4BXOA 3OPXA 4IQTA 2DPJA 2KICA 3IG8A 2C2EA 2P6RA 3UXPA 4ED2A 2NRVA 2WFAA 5HMMA 4OJLA 5J0WA 2BZFA 5F9NA 4NLKA 3C21A 3OJSA 3H4DA 8ICBA 4M9GA 3BQ2A 3ICXA 4F2SA 2YQEA 3NS1A 5AI0A 2E8OA 3ZDEA 5J2JA 2FMQA 2MA1A 3ETRA 4RQ4A 3V72A 7ICGA 4Q44A 5EE3A 2M0NA 3N97B 3WKBA 1JXEA 1L7OA 5H2FU 3KZIU 4AYBC 2KJ8A 1SB3C 2HHQA 5KAIU 3CNHA 5AK5A 2R8HA 2F1HA 3KHLA 3C1ZA 3QU5A 1XC9A 2JH1A 3WK4A 4ECTA 5L9XA 4CF5A 3F5EA 1UQVA 1COOA 2GWSA 3C5GA 4O3NA 1F5SA 2HBKA 5AKYA 4F5OA 5CEHA 4JV0A 2IHMA 3LDAA 4ZOHC 1L6NA 4Y2VA 1WUDA 3RF9A 4LZGA 2FDRA 1MQ2A 2LHTA 1QQ7A 4ICAA 3O0FA 2EZXA 4UB2A 2C2RA 4M2YA 4KLGA 7ICNA 3L5KA 4F5QA 3AN1A 2V4RA 1KN5A 3TACB 1KW4A 2W9BB 2PFOA 3R9KA 4IQVA 2BCVA 2ZG6A 3OHAA 2IA6A 5FP0A 2OHFA 3HJEA 5AM2A 3PR4A 2ALZA 3AQEA 2N1RA 5KT4A 1QSSA 3KTQA 1SXEA 4NM1A 4YR0A 2WF6A 3GU3A 4C0ZA 8ICVA 3LVVA 4M04A 2WF8A 1Z4OA 2XVTA 3KKAA 2XCAA 2J6SA 2DBYA 9ICNA 2EZYA 1L7NA 2AGOA 2YB1A 1SV0C 4DFJA 3TAQA 1ZQQA 4DQSA 1ZJMA 4CRXA 1V97A 5KT7A 1ZD2P 2KSOB 5DBAA 7ICJA 2BKEA 5AHXA 5KNIA 3HW8A 1L7PA 1RM6C 3UM9A 1L3VA 3GV7B 2BQUA 5DG8A 2I1QA 4DCCA 2XCPA 1ZQBA 2KP7A 2PFQA 2JGAA 5IIJA 1U47A 2BPCA 2YY6A 3NVWA 4HYKA 3I1YA 2Y1JA 3RR7A 4QIWF 3LYSA 1B43A 4O3SA 4PZOA 5J0SA 1H38A 2RRDA 2EDUA 8ICKA 1DK3A 5D46A 9ICAA 3L3FX 5KAFU 3NGDA 1J2NA 2VJ5A 1Z19A 2IBKA 3N7RC 3SD7A 1JMSA 9ICXA 4P0QA 4KLOA 2AQ0A 1DOQA 4EELA 4U6PA 5EWGA 1ZJNA 2LM4A 4A8EA 2HHWA 1TFRA 4KTQA 4G9BA 2DFLA 5DG9A 3ISDA 1XO1A 2JRZA 1NK9A 5KFZA 4QZ8A 2C22A 2V9WA 2CRXA 3EUB2 3ZDCA 3G6VA 4GFJA 4YQWA 3PMNA 4M47A 1J2MA 3HT3A 4YD1A 3QUTA 3CW2C 2E8NA 4F5NA 2ASDA 4RQ8A 2A1AA 2QARB 3QEAZ 3FAHA 1NNLA 2DF4B 4ECVA 5ALLA 1XSLA 2A1JA 2KIVA 1ZRMA 2E8MA 2FLPA 4JMUA 9ICGA 5J2BA 1ZD4A 2QB0A 9ICWA 4IRCA 4GIBA 4UAYA 4I2GA 4FS1A 3B9JA 5ALRA 2JEJA 3UMCA 3HX0A 3OGUA 4XRHA 2UVWA 4UB6U 2KNJA 2IHNA 5KFHA 4UAVA 3TFSA 4Y2UA 1OW5A 2FI1A 3H8WA 4QZHA 5TISU 3GV5B 1N48A 4YD2A 1KQQA 8ICGA 5DQHA 3OSNA 8ICHA 1NK8A 5AM4A 5IIKA 5J8YC 4B9LA 2WF5A 3TADC 5KFYA 1VLBA 2A3VA 3DEEA 3Q8QB 4EBDA 1JI7A 5KT2A 1ZQJA 3VCBA 2BCUA 2XO7A 1FO4A 4EX6A 4ECWA 1BPZA 4RQ1A 3OTQA 1SL0A 4ECZA 1PVPA 3D2SA 1N5WA 2MUTB 3UMGA 4KLEA 2W9CA 1O03A 5KFOA 3EPGA 3WK5A 2YMPA 2G07A 4EX7A 3H8SA 3KZXA 2O6KA 1SZHA 2MAXA 5CRXA 1LB2B 5AIAA 3HILA 2HVIA 2R18A 5CP2A 2HI0A 1ZQGA 5DB7A 4TUQA 2XI9A 3T5LA 3RR8A 5ALOA 1JRPA 8ICXA 4DEZA 4F4WA 2KG5A 3RH4A 2G06A 2FLLA 2G0AA 4O5EA 1V85A 2EAPA 5DBBA 4CCHA 1NKCA 3PSTA 4Y2TA 3C28A 3QUQA 5KFBA 4KLSA 5KFPA 4JV2A 4M6WB 1XS9D 3RJKA 4GC7A 2NO5A 5GTHU 4M0AA 9ICRA 2W11A 2QB0B 2H3QA 5AKJA 4F4XA 1N63A 2W8LA 4IRKA 3ALRA 3RB4A 5EE9A 1KKXA 1JALA 2DUYA 4RUAA 4F71A 2P35A 1L8LA 3M9OB 1ZQMA 1X66A 3SEIA 3QU4A 9ICMA 2K8AA 2E3TA 1ZQAA 3HP6A 3AEVA 3M1YA 7ICRA 5HHIA 2CN1A 5KG0A 2WAQF 4GXJA 4GXKA 1NOMA 3TARA 2DGZA 1ZYQA 8ICRA 1S0OA 3PSFA 3IM1A 3H0RB 3DDHA 2ESEA 3C23A 4RPYA 4DSFA 1T4GA 2E1FA 3QU2A 2W03A 1QLNA 3IV6A 2HHTA 3BQ7A 3V7KA 4BWMA 2QB1A 4PL2A 3RRHA 5ALWA 2HBMA 2Y9TA 1D9FA 4Q8FA 2HSZA 5JRTA 4DWIA 5ALJA 3BQ0A 2ASJA 1QTMA 3JPSA 4RUCA 3G6XA 4QW8A 5F3XB 3KKAC 3T79A 3PO5A 9ICFA 4UQGA 1ZQUA 5ALYA 2XGPA 2V4QA 1D8YA 1ZQRA 2XY6A 2IOHA 1B0XA 3GILA 2KZMA 4NL9A 5KG3A 4I2HA 3RJIA 1N62A 3I28A 1T3NA 4DL3A 2C28A 1QCKA 5AKHA 8ICWA 4UATA 2KFNA 2OH2A 4J9SA 4TUSA 5J2EA 1PZNA 1F44A 4EBEA 1KFSA 1L3TA 3PSPA 2ZIXB 3ISBA 9ICQA 4DL5A 4TUPA 3UXNA 3HPOA 2LMRA 3Q8MA 2P6UA 2K4EA 2JZBB 4DL6A 2BHNA 2HHVA 3KD3A 3MFIA 4R8UB 4DSKA 3B0XA 1P7DA 2ISOA 1X6JA 2OM6A 4FFDA 4I2DA 1DGJA 1SZPA 2WB1C 5AM1A 3VC8A 1QSLA 1JN3A 3WK7A 4NY8A 3C2MA 4MFFA 2W9BA 5J0OA 2LYHA 3HKZF 4BJQA 7ICIA 3WK8A 4HAIA 4ED3A 2HW3A 5ALXA 4C7ZA 4UAWA 3DV9A 1S8OA 1PUZA 4PJ0U 5J2HA 2ZUDA 4K4GA 2BQ3A 2A19A 2ZTCA 4Y2RA 5E79U 2KV2A 4YMNA 5IIOA 3Q8RB 4KLLA 4ELVA 3UQ0A 4DL2A 2RLTA 2R8KA 2NV3A 2KSOA 8ICFA 4P2HA 5DDMA 8ICIA 3V6JA 5ALIA 1S9FA 3BJYA 2XIDA 1BNOA 1RXVA 8ICEA 5KL1B 3NVZA 2HHXA 1BNPA 3A0BU 2W3RA 5J0QA 4RPZA 3FDSA 2F1JA 3ZD9A 1HEKA 2FPLA 3PW2A 3K4GA 1ZQYA 1NJXA 5J2GA 5L1MA 2KFZA 5JUMA 4KLDA 3WKAA 2RQ5A 2K4HA 3D6JA 9ICKA 1X9WA 2OXOA 4YXMA 1F0MA 4X5VA 3ZD8A 1Z00B 1ZQEA 2ODGA 5AM5A 1S0MA 2Q4TA 3RRGA 2KVSA 3JPRA 4CF3A 3PVXA 2PMZC 4QWEA 3GQCA 4O3RA 3MGHA 4KLMA 4TURA 4RT3A 2BCRA 1ZD5A 4YVZA 3L4PA 1ZQSA 1IIPA 3LWMA 5T14A 2FMSA 5KG6A 1UPHA 3AL0B 1QQ5A 5DGAA 4ZH4A 1ZRNA 4DL4A 4DL7A 5KFKA 5KL8B 5AK4A 4CF4A 3IG5A 2PI4A 2QKQA 3AQFA 2VKQA 4NV0A 3HRDD 1RQNA 5AKEA 2QARA 3AM9A 3PW4A 4DOAA 3RB3A 4F2RA 3G6YA 2NYVA 2Y9UA 2XC9A 1ZQCA 9ICIA 3QZ8A 4ECXA 4GXIA 4EEYA 4QZBA 2KTQA 2G5IB 3QE9Y 4WJ3B 1AROP 4F92B 5AIBA 4O5KA 2W9MA 4C4SA 3EPIA 4MEXA 4KX3A 3B0YA 3SZ2A 1GO3F 1OXJA 3F5AA 1ZQPA 2IMWP 3GZFA 5DKWA 3SAFA 2I5HA 2YB4A 1MA7A 3KHGA 5AKXA 3PR5B 3JPPA 4RNMA 4O0IA 1K5OA 3RJHA 4M9LA 3WKEA 2NRXA 5CWRA 2EANA 1Z4NA 2BDUA 4RNNA 2EH9A 4BUGA 2MU2A 3Q8SB 3KOOA 5AKKA 2HVHA 4RU9A 1SKRA 4QZ9A 3H8MA 2K4PA 3OJUA 5ALNA 1X2IA 3D2NA 4KLQA 3THVA 1PK1B 4NM2A 8ICUA 2F2AB 4US9A 4ED7A 1FFUA 4IR9A 3PW5A 4C8KA 5ALDA 5KTQA 4Y2YA 2VJ4A 3C29A 4Y2PA 3UPQA 4I2CA 5AI5A 5ALKA 1ZQDA 2MUTA 3N28A 2ZIVA 3GIKA 3NRZA 1U4BA 3FC4A 1JUDA 2PFNA 4KMUA 1UA0A 5D4BA 2ES6A 4MF8A 4QW9A 4FZNA 4C8NA 4DFKA 4YR3A 4DQIA 2KJ5A 9ICJA 5DQIA 4DSEA 3Q8PB 4J9QA 3E58A 2AHOB 4O3QA 4DS4A 2EAOA 2KMDA 1A0PA 3NVYA 2BCQA 1BPBA 2NRTA 3RTVA 4M9JA 4F4ZA 1ED1A 2XY5A 3OSPA 4M6WA 4UAUA 4PHDA 1MN8A 3TKAA 5B66U 1ZQLA 4NLCA 4UB3A 2H3IA 5ALHA 4NL9C 4K4HA 4PPXA 2DPIA 4NLZA 3AMZA 3WK9A 1JX4A 2W54A 4IRDA 4UB4A 4E0DA 4DF4A 4OJ6A 2H5XA 3QEBZ 4EEKA 1FFVA 3QYPA 1ZQOA 3V7JA 3QU9A 3ZDBA 3BZCA 1S77D 3RJJA 3ORYA 1NK6A 3NTUA 1HUOA 4US8A 7ICUA 2P66A 9ICPA 4DOCA 1UCVA 1TK5A 1X42A 7ICEA 5A0LA 1ZQWA 2BDPA 4YXJA 4YMOA 5IINA 2K89A 3H7IA 7ICOA 4K4IA 2EQYA 4C8MA 3E0FA 4UB1A 4I29A 5J2IA 2WHEA 4LJXA 8ICSA 1JXLA 5KFXA 3F53A 2MSNA 1KEJA 1NI3A 1DGSA 4NLBA 4QNLA 2FPKA 2KN7A 4QIWC 1X9SA 1NZBA 1K1QA 4P4PA 9ICHA 3ISCA 3GIIA 2ZIVB 1NJZA 3H0LB 4RQ7A 1TK0A 4I28A 3SV4A 3SAHA 3IP4B 1JROA 1WCLA 3RB6A 3CRXA 3I76A 1BGXT 2GH1A 4NLGA 2F1IA 4JB3A 3KHHA 3RH6A 4EZ6A 2VIXA 2R8IA 2KIWA 4YR2A 2ZXIA 1UA1A 4PGXA 2HOQA 1XWLA 4UASA 3EWAA 3E2EA 1NK5A 1ZQNA 4KLHA 4KLTA 4DSLA 2EAMA 4O3PA 1FIQA 2YTUA 4DLEA 1U45A 4Y2QA 2ZIXA 2L5YA 5L1KA 2E1EA 4CDGA 3M9MB 2W43A 3T5HA 5KT6A 3CP8A 1N61A 9ICVA 4JUZA 1DXSA 4J9MA 2JZBA 2F3NA 3AUOA 1CEZA 4ED6A 2AQ4A 2DKXA 5C5JA 2JXJA 2KHQA 1CI4A 4R8UA 4F72A 5DBCA 2BCSA 4JWMA 3V6HA 5F9LA 1BPDA 2KE7A 3H0MB 3BQTA 5GTIU 3PW0A 2AGQA 7ICFA 1SV0A 4NWIA 2HBJA 5ALZA 1QH9A 4TQRA 1Y88A 2WB1F 5J2KA 2Y0SF 2ZJ8A 2IOFK 3H4BA 4Y2JA 1X9MA 4FZLA 1SL2A 8ICPA 3Q8KA 2OYYA 4EBCA 1ZETA 3BS7A 1N2XA 3S6JA 1BVSA 1SL1A 3RBDA 2KKPA 1Z3EB 1RQLA 3F2CA 3N7SC 4CNQA 2ZIUB 1MC8A 4FE3A 7ICVA 3M7DA 4RQ0A 3M9NB 5DLFA 8ICOA 3C2LA 3NVVA 4BDPA 5J2CA 1XNSA 3M8SA 4OJOA 2LBOA 4RQ2A 4RQMA 2JR5A 1C7YA 9ICCA 4CE6A 4F8RA 3U26A 3UQ2A 2MRLA 1N60A 4B9TA 3GV8B 4O3OA 5KFSA 2GO7A 4M9HA 9ICTA 4F4YA 1ZD3A 5DLGA 3RBEA 5J2FA 7ICQA 5ALFA 1C20A 1CUKA 4DS5A 4ELUA 4CGZA 2AU0A 2Y1IA 5ALSA 5AK6A 1JIHA 5KFUA 3WKDA 3D2QA 3AU6A 1Z00A 4ED8A 4ELTA 3RH5A 1V9PA 3PY8A 1A6SA 4NLNA 1WCNA 2NO4A 4R63A 3JPOA 4B9UA 1L3UA 2FLNA 4YN4A 4P0PB 3GIMA 7ICHA 4PHEA 4NXZA 5ALEA 1ZQXA 4YMMA 5AM3A 4I2BA 1D8LA 2LYBA 4XUSA 4U7CA 2D6FC 3MABA 5CB1A 5HR6A 4AYBF 4JV1A 3GDXA 2EZZA 5KFQA 4IC9A 5TZVA 3CYMA 4OJPA 5J2AA 4DFPA 3WKCA 1SKSA 3JPNA 3RB0A 1RXWA 5KFMA 2IOFA 5CJ7A 2JEFA 4IQUA 1KSPA 1LKYA 4IL6U 4IQWA 4MF2A 2R8JA 1DK2A 8ICYA 2ZIWB 2RDIA 3QZ7A 2GLEA 1SGGA 2HBLA 5IILA 2DWQA 1XSPA 1QQ6A 5J8YA 4GC6A 2WAQC 4KX5A 5DQGA 5DB6A 1HJPA 4RQ6A 2B21A 5G5HA 4PGYA 4EZ9A 4Z6EA 3JPTA 1N5XA 4DQPA 5KFLA 3C5FA 3PZPA 1YT3A 3PX6A 2AXTU 2F76X 1NJYA 3MR6A 4O5CA 2ZUCA 4PGQA 1IV8A 3H8JA 3MDCA 4KLUA 4KLFA 9ICOA 3ED5A 2RDJA 2H3FA 2BGWA 8ICAA 4KITB 9ICLA 2QLTA 3RFAA 2NRWA 4QWCA 5J29A 4IR1A 4RQNA 4B9NA 3LWLA 4OD0A 1PK1A 1S97A 1RYUA 2KHVA 4QZCA 1NKEA 1SKWA 3NRWA 2PI5A 4F4KA 5KFTA 3SV3A 4GLXA 3RJGA 2I9GA 2F8LA 2HDOA 2PFPA 5AKGA 1SV4A 2K8BB 3IDWA 4QWAA 2WF7A 4OO1J 3MC1A 3QU7A 5AKIA 5ALUA 3A0HU 5KFEA 4R66A 3SQIA 4FBUA 1LVHA 1YZ6A 1IM4A 3EYZA 4UARA 2JMGA 5AKZA 2LM1A 5AI4A 4C80A 2LYAA 4DFDA 3MR5A 9ICSA 1T94A 1BPXA 4NJ8A 5ALQA 4P4OA 2HOIA 4PHPA 1ZQVA 3ETLA 3TANA 2G09A 3UXOA 3T3FA 8ICNA 3RAXA 1S76D 4Y2XA 2XGQA 1KTQA 1MSWD 4USAA 2RP5A 1VJ5A 3SYZA 4QZDA 3AU2A 4Q43A 2FMPA 5KG4A 5KT5A 2HMXA 3HWTA 2KZ3A 2ZJ5A 4JWNA 2BR0A 1UT8A 1COKA 4C4RA 4MEYA 2FE9A 4JK1A 2KJ9A 4P4MA 2LI6A 1LKYB 1ZQFA 1Q8KA 1TAUA 4KN7A 4EENA 4DOBA 4KLJA 1PVRA 3HKZC 3RJFA 2R8GA 3EW9A 2VA2A 3IHQB 4QWDA 3PW7A 2H3VA 8ICZA 4BWJA 3BS5B 4QZEA 4PZNA 1NZPA 4F3OA 3TI0A 4C7YA 2B0CA 2DQNB 3ZDDA 3PO4A 5ALPA 5D49A 1IXRA 4ED0A 3TAPA 4DSJA 4UAZA 4ECSA 1M6YA 2UVUA 7ICTA 3QUCA 1L5UA 2VANA 3GFKB 2KVCA 1U49A 5EOZA 1TK8A 3M6ZA 4Y2SA 2B6GA 1A76A 1XO0A 1RPLA 1HUZA 4DQQA 2KKVA 5KFIA 5J0UA 5KG1A 2VA3A 5KFFA 3MDAA 1UT5A 1PK3A 4FS2A 5AICA 5KFRA 2E5SA 5KFCA 4BXOB 1S0NA 1J97A 1FEZA 4QZAA 2W7PA 3M6KA 2HCFA 1SIJA 3N7PD 4J9NA 2YMMA 3F2DA 2F8KA 2W9AA 2ASLA 4I2FA 2FJ6A 3MR2A 4RQ5A 2VA8A 4J9RA 9ICUA 2NRZA 3FYHA 1RYSA 2KEYA 2ZTEA 1TV9A 1U48A 2XY7A 4J03A 2M9NA 3BQ1A 3T5JA 4RNOA 3SR6A 4YG2A 2LKYA 2HHSA 3FM9A 2J6UA 1D8BA 3PX4A 4F91B 5KFWA 4UBBA 7ICLA 7ICMA 5EE0A 3TQ1A 2AH5A 3M8RA 1SXDA 4FBTA 2LPEA 5EWEA 1TE2A 3SI8A 3UMBA 3QUBA 4G3IA 2D8CA 4ECYA 4Z6DA 2XICA 2PKEA 5EE1A 4KMOB 1L3SA 1U9LA 2F44A 2K4IA 5DB8A 1WYGA 4EYIB 2JHDA 5AK3A 4J9PA 1RDFA 3IRUA 2W55A 4Z6FA 4LZDA 1N56A 4YFKA 2HOFA 8ICMA 3NUQA 4DLGA 1NJWA 1EXNA 4QZFA 4UBCA 4C8OA 1ZXIA 3V6KA 2DL0A 2WF9A 4FO6A 1T8EA 3QXGA 4BX9C 5JU5A 5L1LA 3PX0A 2ISPA 1TKDA 4O9MA 3ZDAA 3F2BA 2ZXHA 1VDVA 2Z7JA 3MR3A 5KFGA 4J9LA 2ZIUA 4QWBA 1Q46A 5HNKA 5EWFA 1V38A 2DKZA 4F5RA 4C8LA 8ICLA 1KFDA 1Q3VA 4I27A 5AI8A 3PV8A 2ATLA 4J9KA 4AP9A 5AI9A 2W7OA 2OEHA 4Q45A 1X9XA 5HMLA 5HHHA 1ZQTA 4KLIA 4FZMA 3J81j 4O3MA 1XU4A 4QJFB 4M9NA 2K60A 3MGIA 1Z1VA 5HP4A 5KFJA 2W3SA 1BPYA 8ICJA 4YCXA 2UVVA 1ZQHA 3IN5A 3SENA 3KFUF 3K1RB 2JV3A 2BQRA 4RQ3A 1HIWA 1NK0A 5DB9A 1WWUA 5J0RA 2G08A 2HHUA 4I2JA 2ZTDA 9ICEA 4BGDA 5J0TA 4KN4A 4P0QB 3ONNA 1Q3UA 8ICTA 1CRXA 7ICSA 1KLNA 5J0PA 1KFTA 5KG5A 3C2KA 4P0PA 4UB5A 3N4MB 1URJA 5DDYA 4UB8U 5IIMA 3SAGA 4J9OA 1IG6A 5KFDA 3QX7A 5BPCA 3PMLA 1KRPA 4RPXA 2KZZA 4TQSA 5AKLA 3BZKA 2KK0A 5IIIA 5JTIA 1NK7A 7ICPA 2JH7A 4RZRA 5ALGA 5C0YA 5ALMA 4OCZA 3H40A 2A1JB 2I6XA 1XSNA 4B9SA 1ZQ1C 2W04A 3NASA 4ACOA 1KL9A 5KFAA 2C2DA 2ZIWA 1SWVA 2AGPA 3T5KA 5KG7A 1PVQA 5HR7A 5KFNA 1ZQIA 2KOBA 2K8CB 4QZIA 2W8KA 2E8PA 3WU2U 5ALVA 2OCEA 3K75D 3QNMA 4XQ8A 4UW9A 1WG8A 5DG7A 4QZGA 1S10A 2YMLA 2YX8A 8ICCA 5KT3A 4RT2A 2CXYA 1RG6A 1S5LU 1SWWA 5CHGA 1RYRA 1LV5A 2F77X 1UHUA 1Z1BA 2FPMA 1KBUA 3TFRA 4DSIA 5J2DA 3PNCA 1L7MA 2BPGA 1K1SA 4F5PA 1B4FA 5J0YA 5KG2A 1X6IA 1RZTA 2OWOA 1O08A 4PH5A 5L1JA 2ZJAA 2PXIA 3BDPA 3LK9A
chains in the Genus database with same CATH topology
2XICA 2VJ4A 4A8EA 1PVPA 4KMOB 3D2SA 1URJA 3H0MB 2F8LA 2KVCA 3C29A 2K89A 1OUQA 3M6ZA 2RHFA 2K4IA 2LYBA 2E1FA 2K8BB 3E0FA 1XO0A 3SAGA 2ZG6A 1IIPA 4U7CA 5T14A 4NWIA 2GOLA 2JHDA 2W03A 4OO1J 2HBJA 2KKVA 1UPHA 2ZIVA 3MGVA 2D6FC 2G07A 5HR6A 3SQIA 3AL0B 3F2CA 2CRXA 3HKZF 4AYBF 4OJ5A 3KZXA 4BJQA 3F53A 2WB1F 1TAMA 4PL2A 3AQEA 5KL8B 4GFJA 2E5SA 2HBMA 2N1RA 3LVWA 2HOFA 1SZHA 2JMGA 2Y0SF 3IG5A 5CRXA 4IC9A 2H3ZA 3NUQA 3CYMA 3GU3A 4NLBA 3AQFA 4QNLA 3OPXA 4FZLA 2VKQA 4OJPA 4NV0A 2LYAA 2JH7A 4C0ZA 2W7PA 3M6KA 2OYYA 1T94A 4QIWC 5C0YA 2KICA 4FZNA 3IG8A 2R18A 2DF4B 3LVVA 1NZBA 4BX9C 2HOIA 2XI9A 1DRGA 2XVTA 3N7PD 2KKPA 2KJ5A 2ZIVB 2G09A 1ZQ1C 4JMUA 2W04A 3H0LB 2G06A 2ZIUB 2ZXHA 2G0AA 2Z7JA 3N7SC 2YB1A 4FE3A 4OJLA 3M7DA 3F2BA 2KV2A 4ACOA 2ZIUA 3SAHA 3T79A 3IP4B 4CRXA 2RP5A 2PMZF 2ZIWB 3PSTA 2G5IB 3C28A 2HBLA 3CRXA 3ICXA 1A0PA 2NV3A 2ZIWA 1Q3VA 4WJ3B 2GH1A 1XNSA 2WAQC 1PVQA 4KX5A 1ED1A 5HR7A 2HMXA 4KX3A 4PL1A 4OJOA 2LBOA 2KOBA 2K8CB 2VIXA 2W7OA 2KEYA 2XIDA 1GO3F 2MA1A 2KIWA 3F5AA 2ZXIA 4NLCA 2H3IA 4O3MA 4FZMA 3GZFA 2KJ9A 3K1ZA 2JGAA 5KL1B 2KNJA 1YT3A 3SAFA 3PZPA 2HOQA 2YB4A 4QJFB 2MRLA 2KD1A 2M0NA 1MA7A 2G5HB 2H3QA 2F76X 2YX8A 2OH2A 3F2DA 2LKYA 3ALRA 1PVRA 1HEKA 3HKZC 4AYBC 2KJ8A 4QIWF 2CPRA 3LYSA 3IN5A 1F44A 4CGZA 3KFUF 3PSIA 3PSPA 1D8BA 2BDUA 2Y0SC 2F77X 2RRDA 2ZIXB 4BUGA 1Z1BA 1HIWA 4OJ6A 2K4HA 2ZIXA 1KBUA 2H3FA 2JH1A 2E1EA 2OXOA 4CDGA 3RFAA 2H3VA 3CP8A 3F5EA 3D2NA 3L3FX 2G08A 2K4EA 2VJ5A 2K8AA 3D2QA 2HBKA 3SMVA 1Z19A 2A3VA 3DEEA 2DQNB 2Q4TA 3N7RC 4P0QB 2KHVA 1A6SA 2F2AB 3VCBA 1L6NA 2CN1A 3ONNA 4P0QA 1Q3UA 1CRXA 1WUDA 3RF9A 2WAQF 2KHQA 1P7DA 2OM6A 4P0PB 2DGZA 2LHTA 1ECWA 3NRWA 3O0FA 2PMZC 2WB1C 3PSFA 4ICAA 5A0LA 4P0PA 3H0RB 3VC8A 4U6PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A8E A;  1PVP A;  1KBU A;  2KOB A;  3C29 A;  1OUQ A;  2OXO A;  2KEY A;  1NZB A;  2HOI A;  2KIW A;  1XO0 A;  2KKP A;  2KJ5 A;  2KJ9 A;  2KKV A;  3MGV A;  1Z19 A;  2A3V A;  1DRG A;  2KD1 A;  1MA7 A;  2CRX A;  4ACO A;  2KHV A;  4CRX A;  1Q3U A;  2HOF A;  1CRX A;  1P7D A;  2KHQ A;  1PVR A;  5CRX A;  3C28 A;  3CRX A;  1A0P A;  1Q3V A;  2KJ8 A;  1F44 A;  3LYS A;  1XNS A;  3NRW A;  1PVQ A;  1Z1B A; 
#chains in the Genus database with same CATH topology
 5G5G A;  1OUQ A;  1L8O A;  2W9C B;  5AI6 A;  1D9D A;  2RHF A;  4F93 B;  3KHR A;  3MGV A;  1T3Q A;  4EYH B;  4DQR A;  4OJ5 A;  1A77 A;  2ZUB A;  5J0X A;  3LVW A;  1ZQZ A;  1TAQ A;  5CA7 A;  1BPE A;  5K4L A;  5AM0 A;  5B5E U;  3KBB A;  1DRG A;  4Z6C A;  2YN4 A;  3EZ5 A;  5L1I A;  5ALT A;  2PMZ F;  2BPF A;  3WK6 A;  2JEI A;  4DO9 A;  4C4T A;  4YP3 A;  4ECR A;  4ECQ A;  2J6T A;  4PL1 A;  3GIJ A;  1S0V A;  3RAQ A;  3C1Y A;  4B9V A;  5BOM A;  2YMQ A;  2AJQ A;  3K1Z A;  4R65 A;  2KD1 A;  4I2I A;  2G5H B;  1WWV A;  4LVS A;  1MQ3 A;  3V7L A;  3ZI4 A;  3Q8L A;  4PHA A;  4B6J A;  2CPR A;  1QSY A;  5KFV A;  3PSI A;  2Y0S C;  4F50 A;  1YZ7 A;  1KDH A;  1ZOL A;  3TAD A;  8ICQ A;  7ICK A;  2Q0Z X;  1B22 A;  1NK4 A;  1ZQK A;  3SMV A;  3BS5 A;  4I2A A;  4R64 A;  4IS7 A;  4MFC A;  2D3D A;  4ECU A;  4DFM A;  3JPQ A;  1ECW A;  4I2E A;  5CR0 A;  4DF8 A;  3OHB A;  2WTF A;  4Q8E A;  1AQ6 A;  2UVR A;  1T7P A;  2GOL A;  9ICB A;  2JEG A;  4MHV A;  3MBY A;  5DGB A;  4MFA A;  1TVA A;  4ED1 A;  1TAM A;  1NKB A;  1X40 A;  4B9M A;  5BOL A;  2H3Z A;  4XA5 A;  3MFH A;  3RJE A;  4BXO A;  3OPX A;  4IQT A;  2DPJ A;  2KIC A;  3IG8 A;  2C2E A;  2P6R A;  3UXP A;  4ED2 A;  2NRV A;  2WFA A;  5HMM A;  4OJL A;  5J0W A;  2BZF A;  5F9N A;  4NLK A;  3C21 A;  3OJS A;  3H4D A;  8ICB A;  4M9G A;  3BQ2 A;  3ICX A;  4F2S A;  2YQE A;  3NS1 A;  5AI0 A;  2E8O A;  3ZDE A;  5J2J A;  2FMQ A;  2MA1 A;  3ETR A;  4RQ4 A;  3V72 A;  7ICG A;  4Q44 A;  5EE3 A;  2M0N A;  3N97 B;  3WKB A;  1JXE A;  1L7O A;  5H2F U;  3KZI U;  4AYB C;  2KJ8 A;  1SB3 C;  2HHQ A;  5KAI U;  3CNH A;  5AK5 A;  2R8H A;  2F1H A;  3KHL A;  3C1Z A;  3QU5 A;  1XC9 A;  2JH1 A;  3WK4 A;  4ECT A;  5L9X A;  4CF5 A;  3F5E A;  1UQV A;  1COO A;  2GWS A;  3C5G A;  4O3N A;  1F5S A;  2HBK A;  5AKY A;  4F5O A;  5CEH A;  4JV0 A;  2IHM A;  3LDA A;  4ZOH C;  1L6N A;  4Y2V A;  1WUD A;  3RF9 A;  4LZG A;  2FDR A;  1MQ2 A;  2LHT A;  1QQ7 A;  4ICA A;  3O0F A;  2EZX A;  4UB2 A;  2C2R A;  4M2Y A;  4KLG A;  7ICN A;  3L5K A;  4F5Q A;  3AN1 A;  2V4R A;  1KN5 A;  3TAC B;  1KW4 A;  2W9B B;  2PFO A;  3R9K A;  4IQV A;  2BCV A;  2ZG6 A;  3OHA A;  2IA6 A;  5FP0 A;  2OHF A;  3HJE A;  5AM2 A;  3PR4 A;  2ALZ A;  3AQE A;  2N1R A;  5KT4 A;  1QSS A;  3KTQ A;  1SXE A;  4NM1 A;  4YR0 A;  2WF6 A;  3GU3 A;  4C0Z A;  8ICV A;  3LVV A;  4M04 A;  2WF8 A;  1Z4O A;  2XVT A;  3KKA A;  2XCA A;  2J6S A;  2DBY A;  9ICN A;  2EZY A;  1L7N A;  2AGO A;  2YB1 A;  1SV0 C;  4DFJ A;  3TAQ A;  1ZQQ A;  4DQS A;  1ZJM A;  4CRX A;  1V97 A;  5KT7 A;  1ZD2 P;  2KSO B;  5DBA A;  7ICJ A;  2BKE A;  5AHX A;  5KNI A;  3HW8 A;  1L7P A;  1RM6 C;  3UM9 A;  1L3V A;  3GV7 B;  2BQU A;  5DG8 A;  2I1Q A;  4DCC A;  2XCP A;  1ZQB A;  2KP7 A;  2PFQ A;  2JGA A;  5IIJ A;  1U47 A;  2BPC A;  2YY6 A;  3NVW A;  4HYK A;  3I1Y A;  2Y1J A;  3RR7 A;  4QIW F;  3LYS A;  1B43 A;  4O3S A;  4PZO A;  5J0S A;  1H38 A;  2RRD A;  2EDU A;  8ICK A;  1DK3 A;  5D46 A;  9ICA A;  3L3F X;  5KAF U;  3NGD A;  1J2N A;  2VJ5 A;  1Z19 A;  2IBK A;  3N7R C;  3SD7 A;  1JMS A;  9ICX A;  4P0Q A;  4KLO A;  2AQ0 A;  1DOQ A;  4EEL A;  4U6P A;  5EWG A;  1ZJN A;  2LM4 A;  4A8E A;  2HHW A;  1TFR A;  4KTQ A;  4G9B A;  2DFL A;  5DG9 A;  3ISD A;  1XO1 A;  2JRZ A;  1NK9 A;  5KFZ A;  4QZ8 A;  2C22 A;  2V9W A;  2CRX A;  3EUB 2;  3ZDC A;  3G6V A;  4GFJ A;  4YQW A;  3PMN A;  4M47 A;  1J2M A;  3HT3 A;  4YD1 A;  3QUT A;  3CW2 C;  2E8N A;  4F5N A;  2ASD A;  4RQ8 A;  2A1A A;  2QAR B;  3QEA Z;  3FAH A;  1NNL A;  2DF4 B;  4ECV A;  5ALL A;  1XSL A;  2A1J A;  2KIV A;  1ZRM A;  2E8M A;  2FLP A;  4JMU A;  9ICG A;  5J2B A;  1ZD4 A;  2QB0 A;  9ICW A;  4IRC A;  4GIB A;  4UAY A;  4I2G A;  4FS1 A;  3B9J A;  5ALR A;  2JEJ A;  3UMC A;  3HX0 A;  3OGU A;  4XRH A;  2UVW A;  4UB6 U;  2KNJ A;  2IHN A;  5KFH A;  4UAV A;  3TFS A;  4Y2U A;  1OW5 A;  2FI1 A;  3H8W A;  4QZH A;  5TIS U;  3GV5 B;  1N48 A;  4YD2 A;  1KQQ A;  8ICG A;  5DQH A;  3OSN A;  8ICH A;  1NK8 A;  5AM4 A;  5IIK A;  5J8Y C;  4B9L A;  2WF5 A;  3TAD C;  5KFY A;  1VLB A;  2A3V A;  3DEE A;  3Q8Q B;  4EBD A;  1JI7 A;  5KT2 A;  1ZQJ A;  3VCB A;  2BCU A;  2XO7 A;  1FO4 A;  4EX6 A;  4ECW A;  1BPZ A;  4RQ1 A;  3OTQ A;  1SL0 A;  4ECZ A;  1PVP A;  3D2S A;  1N5W A;  2MUT B;  3UMG A;  4KLE A;  2W9C A;  1O03 A;  5KFO A;  3EPG A;  3WK5 A;  2YMP A;  2G07 A;  4EX7 A;  3H8S A;  3KZX A;  2O6K A;  1SZH A;  2MAX A;  5CRX A;  1LB2 B;  5AIA A;  3HIL A;  2HVI A;  2R18 A;  5CP2 A;  2HI0 A;  1ZQG A;  5DB7 A;  4TUQ A;  2XI9 A;  3T5L A;  3RR8 A;  5ALO A;  1JRP A;  8ICX A;  4DEZ A;  4F4W A;  2KG5 A;  3RH4 A;  2G06 A;  2FLL A;  2G0A A;  4O5E A;  1V85 A;  2EAP A;  5DBB A;  4CCH A;  1NKC A;  3PST A;  4Y2T A;  3C28 A;  3QUQ A;  5KFB A;  4KLS A;  5KFP A;  4JV2 A;  4M6W B;  1XS9 D;  3RJK A;  4GC7 A;  2NO5 A;  5GTH U;  4M0A A;  9ICR A;  2W11 A;  2QB0 B;  2H3Q A;  5AKJ A;  4F4X A;  1N63 A;  2W8L A;  4IRK A;  3ALR A;  3RB4 A;  5EE9 A;  1KKX A;  1JAL A;  2DUY A;  4RUA A;  4F71 A;  2P35 A;  1L8L A;  3M9O B;  1ZQM A;  1X66 A;  3SEI A;  3QU4 A;  9ICM A;  2K8A A;  2E3T A;  1ZQA A;  3HP6 A;  3AEV A;  3M1Y A;  7ICR A;  5HHI A;  2CN1 A;  5KG0 A;  2WAQ F;  4GXJ A;  4GXK A;  1NOM A;  3TAR A;  2DGZ A;  1ZYQ A;  8ICR A;  1S0O A;  3PSF A;  3IM1 A;  3H0R B;  3DDH A;  2ESE A;  3C23 A;  4RPY A;  4DSF A;  1T4G A;  2E1F A;  3QU2 A;  2W03 A;  1QLN A;  3IV6 A;  2HHT A;  3BQ7 A;  3V7K A;  4BWM A;  2QB1 A;  4PL2 A;  3RRH A;  5ALW A;  2HBM A;  2Y9T A;  1D9F A;  4Q8F A;  2HSZ A;  5JRT A;  4DWI A;  5ALJ A;  3BQ0 A;  2ASJ A;  1QTM A;  3JPS A;  4RUC A;  3G6X A;  4QW8 A;  5F3X B;  3KKA C;  3T79 A;  3PO5 A;  9ICF A;  4UQG A;  1ZQU A;  5ALY A;  2XGP A;  2V4Q A;  1D8Y A;  1ZQR A;  2XY6 A;  2IOH A;  1B0X A;  3GIL A;  2KZM A;  4NL9 A;  5KG3 A;  4I2H A;  3RJI A;  1N62 A;  3I28 A;  1T3N A;  4DL3 A;  2C28 A;  1QCK A;  5AKH A;  8ICW A;  4UAT A;  2KFN A;  2OH2 A;  4J9S A;  4TUS A;  5J2E A;  1PZN A;  1F44 A;  4EBE A;  1KFS A;  1L3T A;  3PSP A;  2ZIX B;  3ISB A;  9ICQ A;  4DL5 A;  4TUP A;  3UXN A;  3HPO A;  2LMR A;  3Q8M A;  2P6U A;  2K4E A;  2JZB B;  4DL6 A;  2BHN A;  2HHV A;  3KD3 A;  3MFI A;  4R8U B;  4DSK A;  3B0X A;  1P7D A;  2ISO A;  1X6J A;  2OM6 A;  4FFD A;  4I2D A;  1DGJ A;  1SZP A;  2WB1 C;  5AM1 A;  3VC8 A;  1QSL A;  1JN3 A;  3WK7 A;  4NY8 A;  3C2M A;  4MFF A;  2W9B A;  5J0O A;  2LYH A;  3HKZ F;  4BJQ A;  7ICI A;  3WK8 A;  4HAI A;  4ED3 A;  2HW3 A;  5ALX A;  4C7Z A;  4UAW A;  3DV9 A;  1S8O A;  1PUZ A;  4PJ0 U;  5J2H A;  2ZUD A;  4K4G A;  2BQ3 A;  2A19 A;  2ZTC A;  4Y2R A;  5E79 U;  2KV2 A;  4YMN A;  5IIO A;  3Q8R B;  4KLL A;  4ELV A;  3UQ0 A;  4DL2 A;  2RLT A;  2R8K A;  2NV3 A;  2KSO A;  8ICF A;  4P2H A;  5DDM A;  8ICI A;  3V6J A;  5ALI A;  1S9F A;  3BJY A;  2XID A;  1BNO A;  1RXV A;  8ICE A;  5KL1 B;  3NVZ A;  2HHX A;  1BNP A;  3A0B U;  2W3R A;  5J0Q A;  4RPZ A;  3FDS A;  2F1J A;  3ZD9 A;  1HEK A;  2FPL A;  3PW2 A;  3K4G A;  1ZQY A;  1NJX A;  5J2G A;  5L1M A;  2KFZ A;  5JUM A;  4KLD A;  3WKA A;  2RQ5 A;  2K4H A;  3D6J A;  9ICK A;  1X9W A;  2OXO A;  4YXM A;  1F0M A;  4X5V A;  3ZD8 A;  1Z00 B;  1ZQE A;  2ODG A;  5AM5 A;  1S0M A;  2Q4T A;  3RRG A;  2KVS A;  3JPR A;  4CF3 A;  3PVX A;  2PMZ C;  4QWE A;  3GQC A;  4O3R A;  3MGH A;  4KLM A;  4TUR A;  4RT3 A;  2BCR A;  1ZD5 A;  4YVZ A;  3L4P A;  1ZQS A;  1IIP A;  3LWM A;  5T14 A;  2FMS A;  5KG6 A;  1UPH A;  3AL0 B;  1QQ5 A;  5DGA A;  4ZH4 A;  1ZRN A;  4DL4 A;  4DL7 A;  5KFK A;  5KL8 B;  5AK4 A;  4CF4 A;  3IG5 A;  2PI4 A;  2QKQ A;  3AQF A;  2VKQ A;  4NV0 A;  3HRD D;  1RQN A;  5AKE A;  2QAR A;  3AM9 A;  3PW4 A;  4DOA A;  3RB3 A;  4F2R A;  3G6Y A;  2NYV A;  2Y9U A;  2XC9 A;  1ZQC A;  9ICI A;  3QZ8 A;  4ECX A;  4GXI A;  4EEY A;  4QZB A;  2KTQ A;  2G5I B;  3QE9 Y;  4WJ3 B;  1ARO P;  4F92 B;  5AIB A;  4O5K A;  2W9M A;  4C4S A;  3EPI A;  4MEX A;  4KX3 A;  3B0Y A;  3SZ2 A;  1GO3 F;  1OXJ A;  3F5A A;  1ZQP A;  2IMW P;  3GZF A;  5DKW A;  3SAF A;  2I5H A;  2YB4 A;  1MA7 A;  3KHG A;  5AKX A;  3PR5 B;  3JPP A;  4RNM A;  4O0I A;  1K5O A;  3RJH A;  4M9L A;  3WKE A;  2NRX A;  5CWR A;  2EAN A;  1Z4N A;  2BDU A;  4RNN A;  2EH9 A;  4BUG A;  2MU2 A;  3Q8S B;  3KOO A;  5AKK A;  2HVH A;  4RU9 A;  1SKR A;  4QZ9 A;  3H8M A;  2K4P A;  3OJU A;  5ALN A;  1X2I A;  3D2N A;  4KLQ A;  3THV A;  1PK1 B;  4NM2 A;  8ICU A;  2F2A B;  4US9 A;  4ED7 A;  1FFU A;  4IR9 A;  3PW5 A;  4C8K A;  5ALD A;  5KTQ A;  4Y2Y A;  2VJ4 A;  3C29 A;  4Y2P A;  3UPQ A;  4I2C A;  5AI5 A;  5ALK A;  1ZQD A;  2MUT A;  3N28 A;  2ZIV A;  3GIK A;  3NRZ A;  1U4B A;  3FC4 A;  1JUD A;  2PFN A;  4KMU A;  1UA0 A;  5D4B A;  2ES6 A;  4MF8 A;  4QW9 A;  4FZN A;  4C8N A;  4DFK A;  4YR3 A;  4DQI A;  2KJ5 A;  9ICJ A;  5DQI A;  4DSE A;  3Q8P B;  4J9Q A;  3E58 A;  2AHO B;  4O3Q A;  4DS4 A;  2EAO A;  2KMD A;  1A0P A;  3NVY A;  2BCQ A;  1BPB A;  2NRT A;  3RTV A;  4M9J A;  4F4Z A;  1ED1 A;  2XY5 A;  3OSP A;  4M6W A;  4UAU A;  4PHD A;  1MN8 A;  3TKA A;  5B66 U;  1ZQL A;  4NLC A;  4UB3 A;  2H3I A;  5ALH A;  4NL9 C;  4K4H A;  4PPX A;  2DPI A;  4NLZ A;  3AMZ A;  3WK9 A;  1JX4 A;  2W54 A;  4IRD A;  4UB4 A;  4E0D A;  4DF4 A;  4OJ6 A;  2H5X A;  3QEB Z;  4EEK A;  1FFV A;  3QYP A;  1ZQO A;  3V7J A;  3QU9 A;  3ZDB A;  3BZC A;  1S77 D;  3RJJ A;  3ORY A;  1NK6 A;  3NTU A;  1HUO A;  4US8 A;  7ICU A;  2P66 A;  9ICP A;  4DOC A;  1UCV A;  1TK5 A;  1X42 A;  7ICE A;  5A0L A;  1ZQW A;  2BDP A;  4YXJ A;  4YMO A;  5IIN A;  2K89 A;  3H7I A;  7ICO A;  4K4I A;  2EQY A;  4C8M A;  3E0F A;  4UB1 A;  4I29 A;  5J2I A;  2WHE A;  4LJX A;  8ICS A;  1JXL A;  5KFX A;  3F53 A;  2MSN A;  1KEJ A;  1NI3 A;  1DGS A;  4NLB A;  4QNL A;  2FPK A;  2KN7 A;  4QIW C;  1X9S A;  1NZB A;  1K1Q A;  4P4P A;  9ICH A;  3ISC A;  3GII A;  2ZIV B;  1NJZ A;  3H0L B;  4RQ7 A;  1TK0 A;  4I28 A;  3SV4 A;  3SAH A;  3IP4 B;  1JRO A;  1WCL A;  3RB6 A;  3CRX A;  3I76 A;  1BGX T;  2GH1 A;  4NLG A;  2F1I A;  4JB3 A;  3KHH A;  3RH6 A;  4EZ6 A;  2VIX A;  2R8I A;  2KIW A;  4YR2 A;  2ZXI A;  1UA1 A;  4PGX A;  2HOQ A;  1XWL A;  4UAS A;  3EWA A;  3E2E A;  1NK5 A;  1ZQN A;  4KLH A;  4KLT A;  4DSL A;  2EAM A;  4O3P A;  1FIQ A;  2YTU A;  4DLE A;  1U45 A;  4Y2Q A;  2ZIX A;  2L5Y A;  5L1K A;  2E1E A;  4CDG A;  3M9M B;  2W43 A;  3T5H A;  5KT6 A;  3CP8 A;  1N61 A;  9ICV A;  4JUZ A;  1DXS A;  4J9M A;  2JZB A;  2F3N A;  3AUO A;  1CEZ A;  4ED6 A;  2AQ4 A;  2DKX A;  5C5J A;  2JXJ A;  2KHQ A;  1CI4 A;  4R8U A;  4F72 A;  5DBC A;  2BCS A;  4JWM A;  3V6H A;  5F9L A;  1BPD A;  2KE7 A;  3H0M B;  3BQT A;  5GTI U;  3PW0 A;  2AGQ A;  7ICF A;  1SV0 A;  4NWI A;  2HBJ A;  5ALZ A;  1QH9 A;  4TQR A;  1Y88 A;  2WB1 F;  5J2K A;  2Y0S F;  2ZJ8 A;  2IOF K;  3H4B A;  4Y2J A;  1X9M A;  4FZL A;  1SL2 A;  8ICP A;  3Q8K A;  2OYY A;  4EBC A;  1ZET A;  3BS7 A;  1N2X A;  3S6J A;  1BVS A;  1SL1 A;  3RBD A;  2KKP A;  1Z3E B;  1RQL A;  3F2C A;  3N7S C;  4CNQ A;  2ZIU B;  1MC8 A;  4FE3 A;  7ICV A;  3M7D A;  4RQ0 A;  3M9N B;  5DLF A;  8ICO A;  3C2L A;  3NVV A;  4BDP A;  5J2C A;  1XNS A;  3M8S A;  4OJO A;  2LBO A;  4RQ2 A;  4RQM A;  2JR5 A;  1C7Y A;  9ICC A;  4CE6 A;  4F8R A;  3U26 A;  3UQ2 A;  2MRL A;  1N60 A;  4B9T A;  3GV8 B;  4O3O A;  5KFS A;  2GO7 A;  4M9H A;  9ICT A;  4F4Y A;  1ZD3 A;  5DLG A;  3RBE A;  5J2F A;  7ICQ A;  5ALF A;  1C20 A;  1CUK A;  4DS5 A;  4ELU A;  4CGZ A;  2AU0 A;  2Y1I A;  5ALS A;  5AK6 A;  1JIH A;  5KFU A;  3WKD A;  3D2Q A;  3AU6 A;  1Z00 A;  4ED8 A;  4ELT A;  3RH5 A;  1V9P A;  3PY8 A;  1A6S A;  4NLN A;  1WCN A;  2NO4 A;  4R63 A;  3JPO A;  4B9U A;  1L3U A;  2FLN A;  4YN4 A;  4P0P B;  3GIM A;  7ICH A;  4PHE A;  4NXZ A;  5ALE A;  1ZQX A;  4YMM A;  5AM3 A;  4I2B A;  1D8L A;  2LYB A;  4XUS A;  4U7C A;  2D6F C;  3MAB A;  5CB1 A;  5HR6 A;  4AYB F;  4JV1 A;  3GDX A;  2EZZ A;  5KFQ A;  4IC9 A;  5TZV A;  3CYM A;  4OJP A;  5J2A A;  4DFP A;  3WKC A;  1SKS A;  3JPN A;  3RB0 A;  1RXW A;  5KFM A;  2IOF A;  5CJ7 A;  2JEF A;  4IQU A;  1KSP A;  1LKY A;  4IL6 U;  4IQW A;  4MF2 A;  2R8J A;  1DK2 A;  8ICY A;  2ZIW B;  2RDI A;  3QZ7 A;  2GLE A;  1SGG A;  2HBL A;  5IIL A;  2DWQ A;  1XSP A;  1QQ6 A;  5J8Y A;  4GC6 A;  2WAQ C;  4KX5 A;  5DQG A;  5DB6 A;  1HJP A;  4RQ6 A;  2B21 A;  5G5H A;  4PGY A;  4EZ9 A;  4Z6E A;  3JPT A;  1N5X A;  4DQP A;  5KFL A;  3C5F A;  3PZP A;  1YT3 A;  3PX6 A;  2AXT U;  2F76 X;  1NJY A;  3MR6 A;  4O5C A;  2ZUC A;  4PGQ A;  1IV8 A;  3H8J A;  3MDC A;  4KLU A;  4KLF A;  9ICO A;  3ED5 A;  2RDJ A;  2H3F A;  2BGW A;  8ICA A;  4KIT B;  9ICL A;  2QLT A;  3RFA A;  2NRW A;  4QWC A;  5J29 A;  4IR1 A;  4RQN A;  4B9N A;  3LWL A;  4OD0 A;  1PK1 A;  1S97 A;  1RYU A;  2KHV A;  4QZC A;  1NKE A;  1SKW A;  3NRW A;  2PI5 A;  4F4K A;  5KFT A;  3SV3 A;  4GLX A;  3RJG A;  2I9G A;  2F8L A;  2HDO A;  2PFP A;  5AKG A;  1SV4 A;  2K8B B;  3IDW A;  4QWA A;  2WF7 A;  4OO1 J;  3MC1 A;  3QU7 A;  5AKI A;  5ALU A;  3A0H U;  5KFE A;  4R66 A;  3SQI A;  4FBU A;  1LVH A;  1YZ6 A;  1IM4 A;  3EYZ A;  4UAR A;  2JMG A;  5AKZ A;  2LM1 A;  5AI4 A;  4C80 A;  2LYA A;  4DFD A;  3MR5 A;  9ICS A;  1T94 A;  1BPX A;  4NJ8 A;  5ALQ A;  4P4O A;  2HOI A;  4PHP A;  1ZQV A;  3ETL A;  3TAN A;  2G09 A;  3UXO A;  3T3F A;  8ICN A;  3RAX A;  1S76 D;  4Y2X A;  2XGQ A;  1KTQ A;  1MSW D;  4USA A;  2RP5 A;  1VJ5 A;  3SYZ A;  4QZD A;  3AU2 A;  4Q43 A;  2FMP A;  5KG4 A;  5KT5 A;  2HMX A;  3HWT A;  2KZ3 A;  2ZJ5 A;  4JWN A;  2BR0 A;  1UT8 A;  1COK A;  4C4R A;  4MEY A;  2FE9 A;  4JK1 A;  2KJ9 A;  4P4M A;  2LI6 A;  1LKY B;  1ZQF A;  1Q8K A;  1TAU A;  4KN7 A;  4EEN A;  4DOB A;  4KLJ A;  1PVR A;  3HKZ C;  3RJF A;  2R8G A;  3EW9 A;  2VA2 A;  3IHQ B;  4QWD A;  3PW7 A;  2H3V A;  8ICZ A;  4BWJ A;  3BS5 B;  4QZE A;  4PZN A;  1NZP A;  4F3O A;  3TI0 A;  4C7Y A;  2B0C A;  2DQN B;  3ZDD A;  3PO4 A;  5ALP A;  5D49 A;  1IXR A;  4ED0 A;  3TAP A;  4DSJ A;  4UAZ A;  4ECS A;  1M6Y A;  2UVU A;  7ICT A;  3QUC A;  1L5U A;  2VAN A;  3GFK B;  2KVC A;  1U49 A;  5EOZ A;  1TK8 A;  3M6Z A;  4Y2S A;  2B6G A;  1A76 A;  1XO0 A;  1RPL A;  1HUZ A;  4DQQ A;  2KKV A;  5KFI A;  5J0U A;  5KG1 A;  2VA3 A;  5KFF A;  3MDA A;  1UT5 A;  1PK3 A;  4FS2 A;  5AIC A;  5KFR A;  2E5S A;  5KFC A;  4BXO B;  1S0N A;  1J97 A;  1FEZ A;  4QZA A;  2W7P A;  3M6K A;  2HCF A;  1SIJ A;  3N7P D;  4J9N A;  2YMM A;  3F2D A;  2F8K A;  2W9A A;  2ASL A;  4I2F A;  2FJ6 A;  3MR2 A;  4RQ5 A;  2VA8 A;  4J9R A;  9ICU A;  2NRZ A;  3FYH A;  1RYS A;  2KEY A;  2ZTE A;  1TV9 A;  1U48 A;  2XY7 A;  4J03 A;  2M9N A;  3BQ1 A;  3T5J A;  4RNO A;  3SR6 A;  4YG2 A;  2LKY A;  2HHS A;  3FM9 A;  2J6U A;  1D8B A;  3PX4 A;  4F91 B;  5KFW A;  4UBB A;  7ICL A;  7ICM A;  5EE0 A;  3TQ1 A;  2AH5 A;  3M8R A;  1SXD A;  4FBT A;  2LPE A;  5EWE A;  1TE2 A;  3SI8 A;  3UMB A;  3QUB A;  4G3I A;  2D8C A;  4ECY A;  4Z6D A;  2XIC A;  2PKE A;  5EE1 A;  4KMO B;  1L3S A;  1U9L A;  2F44 A;  2K4I A;  5DB8 A;  1WYG A;  4EYI B;  2JHD A;  5AK3 A;  4J9P A;  1RDF A;  3IRU A;  2W55 A;  4Z6F A;  4LZD A;  1N56 A;  4YFK A;  2HOF A;  8ICM A;  3NUQ A;  4DLG A;  1NJW A;  1EXN A;  4QZF A;  4UBC A;  4C8O A;  1ZXI A;  3V6K A;  2DL0 A;  2WF9 A;  4FO6 A;  1T8E A;  3QXG A;  4BX9 C;  5JU5 A;  5L1L A;  3PX0 A;  2ISP A;  1TKD A;  4O9M A;  3ZDA A;  3F2B A;  2ZXH A;  1VDV A;  2Z7J A;  3MR3 A;  5KFG A;  4J9L A;  2ZIU A;  4QWB A;  1Q46 A;  5HNK A;  5EWF A;  1V38 A;  2DKZ A;  4F5R A;  4C8L A;  8ICL A;  1KFD A;  1Q3V A;  4I27 A;  5AI8 A;  3PV8 A;  2ATL A;  4J9K A;  4AP9 A;  5AI9 A;  2W7O A;  2OEH A;  4Q45 A;  1X9X A;  5HML A;  5HHH A;  1ZQT A;  4KLI A;  4FZM A;  3J81 j;  4O3M A;  1XU4 A;  4QJF B;  4M9N A;  2K60 A;  3MGI A;  1Z1V A;  5HP4 A;  5KFJ A;  2W3S A;  1BPY A;  8ICJ A;  4YCX A;  2UVV A;  1ZQH A;  3IN5 A;  3SEN A;  3KFU F;  3K1R B;  2JV3 A;  2BQR A;  4RQ3 A;  1HIW A;  1NK0 A;  5DB9 A;  1WWU A;  5J0R A;  2G08 A;  2HHU A;  4I2J A;  2ZTD A;  9ICE A;  4BGD A;  5J0T A;  4KN4 A;  4P0Q B;  3ONN A;  1Q3U A;  8ICT A;  1CRX A;  7ICS A;  1KLN A;  5J0P A;  1KFT A;  5KG5 A;  3C2K A;  4P0P A;  4UB5 A;  3N4M B;  1URJ A;  5DDY A;  4UB8 U;  5IIM A;  3SAG A;  4J9O A;  1IG6 A;  5KFD A;  3QX7 A;  5BPC A;  3PML A;  1KRP A;  4RPX A;  2KZZ A;  4TQS A;  5AKL A;  3BZK A;  2KK0 A;  5III A;  5JTI A;  1NK7 A;  7ICP A;  2JH7 A;  4RZR A;  5ALG A;  5C0Y A;  5ALM A;  4OCZ A;  3H40 A;  2A1J B;  2I6X A;  1XSN A;  4B9S A;  1ZQ1 C;  2W04 A;  3NAS A;  4ACO A;  1KL9 A;  5KFA A;  2C2D A;  2ZIW A;  1SWV A;  2AGP A;  3T5K A;  5KG7 A;  1PVQ A;  5HR7 A;  5KFN A;  1ZQI A;  2KOB A;  2K8C B;  4QZI A;  2W8K A;  2E8P A;  3WU2 U;  5ALV A;  2OCE A;  3K75 D;  3QNM A;  4XQ8 A;  4UW9 A;  1WG8 A;  5DG7 A;  4QZG A;  1S10 A;  2YML A;  2YX8 A;  8ICC A;  5KT3 A;  4RT2 A;  2CXY A;  1RG6 A;  1S5L U;  1SWW A;  5CHG A;  1RYR A;  1LV5 A;  2F77 X;  1UHU A;  1Z1B A;  2FPM A;  1KBU A;  3TFR A;  4DSI A;  5J2D A;  3PNC A;  1L7M A;  2BPG A;  1K1S A;  4F5P A;  1B4F A;  5J0Y A;  5KG2 A;  1X6I A;  1RZT A;  2OWO A;  1O08 A;  4PH5 A;  5L1J A;  2ZJA A;  2PXI A;  3BDP A;  3LK9 A; 
#chains in the Genus database with same CATH homology
 2XIC A;  2VJ4 A;  4A8E A;  1PVP A;  4KMO B;  3D2S A;  1URJ A;  3H0M B;  2F8L A;  2KVC A;  3C29 A;  2K89 A;  1OUQ A;  3M6Z A;  2RHF A;  2K4I A;  2LYB A;  2E1F A;  2K8B B;  3E0F A;  1XO0 A;  3SAG A;  2ZG6 A;  1IIP A;  4U7C A;  5T14 A;  4NWI A;  2GOL A;  2JHD A;  2W03 A;  4OO1 J;  2HBJ A;  2KKV A;  1UPH A;  2ZIV A;  3MGV A;  2D6F C;  2G07 A;  5HR6 A;  3SQI A;  3AL0 B;  3F2C A;  2CRX A;  3HKZ F;  4AYB F;  4OJ5 A;  3KZX A;  4BJQ A;  3F53 A;  2WB1 F;  1TAM A;  4PL2 A;  3AQE A;  5KL8 B;  4GFJ A;  2E5S A;  2HBM A;  2N1R A;  3LVW A;  2HOF A;  1SZH A;  2JMG A;  2Y0S F;  3IG5 A;  5CRX A;  4IC9 A;  2H3Z A;  3NUQ A;  3CYM A;  3GU3 A;  4NLB A;  3AQF A;  4QNL A;  3OPX A;  4FZL A;  2VKQ A;  4OJP A;  4NV0 A;  2LYA A;  2JH7 A;  4C0Z A;  2W7P A;  3M6K A;  2OYY A;  1T94 A;  4QIW C;  5C0Y A;  2KIC A;  4FZN A;  3IG8 A;  2R18 A;  2DF4 B;  3LVV A;  1NZB A;  4BX9 C;  2HOI A;  2XI9 A;  1DRG A;  2XVT A;  3N7P D;  2KKP A;  2KJ5 A;  2ZIV B;  2G09 A;  1ZQ1 C;  4JMU A;  2W04 A;  3H0L B;  2G06 A;  2ZIU B;  2ZXH A;  2G0A A;  2Z7J A;  3N7S C;  2YB1 A;  4FE3 A;  4OJL A;  3M7D A;  3F2B A;  2KV2 A;  4ACO A;  2ZIU A;  3SAH A;  3T79 A;  3IP4 B;  4CRX A;  2RP5 A;  2PMZ F;  2ZIW B;  3PST A;  2G5I B;  3C28 A;  2HBL A;  3CRX A;  3ICX A;  1A0P A;  2NV3 A;  2ZIW A;  1Q3V A;  4WJ3 B;  2GH1 A;  1XNS A;  2WAQ C;  1PVQ A;  4KX5 A;  1ED1 A;  5HR7 A;  2HMX A;  4KX3 A;  4PL1 A;  4OJO A;  2LBO A;  2KOB A;  2K8C B;  2VIX A;  2W7O A;  2KEY A;  2XID A;  1GO3 F;  2MA1 A;  2KIW A;  3F5A A;  2ZXI A;  4NLC A;  2H3I A;  4O3M A;  4FZM A;  3GZF A;  2KJ9 A;  3K1Z A;  2JGA A;  5KL1 B;  2KNJ A;  1YT3 A;  3SAF A;  3PZP A;  2HOQ A;  2YB4 A;  4QJF B;  2MRL A;  2KD1 A;  2M0N A;  1MA7 A;  2G5H B;  2H3Q A;  2F76 X;  2YX8 A;  2OH2 A;  3F2D A;  2LKY A;  3ALR A;  1PVR A;  1HEK A;  3HKZ C;  4AYB C;  2KJ8 A;  4QIW F;  2CPR A;  3LYS A;  3IN5 A;  1F44 A;  4CGZ A;  3KFU F;  3PSI A;  3PSP A;  1D8B A;  2BDU A;  2Y0S C;  2F77 X;  2RRD A;  2ZIX B;  4BUG A;  1Z1B A;  1HIW A;  4OJ6 A;  2K4H A;  2ZIX A;  1KBU A;  2H3F A;  2JH1 A;  2E1E A;  2OXO A;  4CDG A;  3RFA A;  2H3V A;  3CP8 A;  3F5E A;  3D2N A;  3L3F X;  2G08 A;  2K4E A;  2VJ5 A;  2K8A A;  3D2Q A;  2HBK A;  3SMV A;  1Z19 A;  2A3V A;  3DEE A;  2DQN B;  2Q4T A;  3N7R C;  4P0Q B;  2KHV A;  1A6S A;  2F2A B;  3VCB A;  1L6N A;  2CN1 A;  3ONN A;  4P0Q A;  1Q3U A;  1CRX A;  1WUD A;  3RF9 A;  2WAQ F;  2KHQ A;  1P7D A;  2OM6 A;  4P0P B;  2DGZ A;  2LHT A;  1ECW A;  3NRW A;  3O0F A;  2PMZ C;  2WB1 C;  3PSF A;  4ICA A;  5A0L A;  4P0P A;  3H0R B;  3VC8 A;  4U6P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...