2RHFA

D. radiodurans recq hrdc domain 3
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
76
structure length
76
Chain Sequence
SHNADLSEALRELRRELMKETGYSAFVVFTNATLEALAARQPRTLAELAEVPGLGEKRIEAYGERILDAINTVLDG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure and function of the regulatory C-terminal HRDC domain from Deinococcus radiodurans RecQ.
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Hydrolase
molecule keywords DNA helicase RecQ
total genus 27
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2007-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00570 HRDC HRDC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.80 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2rhfA00
3CYMA 2RRDA 2RHFA 5C0YA 1GO3F 4CDGA 2HBLA 2MA1A 2KV2A 1YT3A 1WUDA 4O3MA 2E1FA 2CPRA 2HBJA 4CGZA 2E1EA 3SAHA 2DGZA 4NLBA 3SAGA 1D8BA 2HBKA 4QIWF 3SAFA 4QJFB 4OO1J 2HBMA 4NLCA
chains in the Genus database with same CATH superfamily
2M0NA 3JPQA 1ZQ1C 1L7MA 3O0FA 3N7PD 4UQGA 8ICBA 1NJYA 4FBTA 2KICA 3GV5B 8ICWA 2G5HB 2BZFA 3UMGA 1T3QA 5J8YA 4Y2TA 4QZ9A 4J9MA 4RPXA 2NRVA 1B43A 2B0CA 3I1YA 7ICJA 4C8LA 4IS7A 2EZXA 1N61A 3DEEA 3ZD8A 5KFBA 4RQ5A 4F93B 4RQ2A 2NRZA 5AK3A 1S0NA 2AH5A 5J2JA 8ICOA 1DOQA 4UB4A 4EEYA 1IXRA 4I2AA 3QEAZ 3BZCA 2EAMA 4KN4A 3F53A 4ECYA 1RYRA 3E58A 3KHHA 5CWRA 2Y1JA 3SAGA 2PFPA 1Z1VA 4C80A 3AUOA 5HR6A 4LJXA 3WKBA 4UB6U 5ALUA 2ZIUA 1L3TA 2AQ4A 4O9MA 3H7IA 3WK7A 4F5NA 1X2IA 5DBBA 1S5LU 1U47A 1K1QA 1BNOA 1L7NA 2GLEA 3H8SA 4BDPA 1U45A 3AQFA 3N4MB 2W55A 4ECRA 2H3IA 4F4KA 3WKEA 1JI7A 2NO4A 2QB0A 4I2HA 2I6XA 2YMQA 4FS1A 4F50A 1XU4A 1WUDA 1ZQBA 2AU0A 1WG8A 3G6VA 5DB9A 5A0LA 4DL7A 7ICFA 9ICVA 5L1LA 2EZYA 4PGQA 2FPLA 4J9SA 1ZD5A 3GIKA 1BVSA 7ICHA 5KFJA 4NLKA 2PFQA 3V6HA 4DF4A 1ZRMA 3HW8A 4YR3A 2BQRA 3TADA 1ZQJA 3H8MA 1SV4A 5AK4A 4PGXA 5ALDA 1KN5A 4EEKA 2DPJA 3N28A 1L3UA 4DFJA 4F72A 1AROP 1V38A 3MDAA 2P6RA 3BZKA 5J0XA 1ED1A 1TKDA 3WK5A 4KLHA 4F2RA 3QEBZ 2F1JA 3RR8A 1Z1BA 1QCKA 3EYZA 4Q8EA 2HHVA 5KFXA 1Y88A 2DUYA 4FZLA 2EDUA 3MDCA 1FEZA 5KFAA 3KZXA 3H0LB 5AHXA 2LYHA 4RNOA 2G0AA 4M9LA 5KFCA 5J2AA 2QARA 1UA0A 3N97B 2G07A 3RRHA 1SZPA 4TUPA 1L6NA 2OH2A 2BR0A 9ICMA 1KRPA 5KFNA 4EZ6A 2KOBA 3NRWA 4GLXA 2V4QA 5JUMA 2H5XA 2OYYA 4F71A 4US9A 4C7ZA 5AKJA 3QXGA 4F4YA 4USAA 5AIBA 1JUDA 1D8LA 2E5SA 2DPIA 2PFOA 3V7JA 3RH5A 1XWLA 4QJFB 5CR0A 5HMMA 1NJZA 1Q3VA 1X9XA 5ALHA 2IOFK 3F5EA 3TQ1A 3H0MB 5J0SA 4DFMA 2JRZA 1TK0A 2HBJA 3HP6A 5J0RA 5HR7A 3TKAA 2IMWP 2HVHA 4RUAA 1F0MA 3WKDA 4EX6A 8ICEA 2J6UA 3CNHA 2CXYA 4DSLA 1NZPA 5IIKA 3EUB2 2A1JB 3M1YA 4IQTA 3PMNA 4DOAA 5DBAA 5GTHU 3PO5A 2Q0ZX 5EE0A 2HVIA 4RQ1A 4RQ6A 1NK8A 5KAFU 3RBDA 2KIVA 4JB3A 7ICUA 3A0HU 4I2BA 5J0UA 1UT5A 1V9PA 8ICAA 1XO1A 4NM1A 4FFDA 3TFRA 3EZ5A 2KV2A 4M9NA 2WAQF 4QZIA 1ZXIA 4UAWA 4QZFA 2D3DA 3JPTA 5ALQA 2KFZA 4JV2A 5EWGA 4RPZA 5KG3A 1SKSA 2K4HA 3BQ1A 4QZAA 2QB1A 8ICPA 2Y9UA 5AI4A 2Y0SC 2E8PA 2DBYA 5G5GA 3T5HA 4DEZA 5D4BA 4UB8U 4PZNA 1SL0A 2M9NA 4QIWF 2F1HA 3U26A 1KW4A 1L8OA 4JWNA 3LWMA 3ZDDA 3OHAA 3B0YA 3OJSA 3G6YA 4DFPA 4RQ4A 4YP3A 4BJQA 8ICSA 1PK1B 4Y2RA 4C8MA 5ALMA 2XY7A 4YR2A 3FM9A 3NS1A 1ZQRA 3SENA 1X6IA 1QQ7A 5KG6A 1HUOA 3MFHA 5AKLA 1L7PA 2HSZA 1DGJA 3N7SC 3LK9A 4O5KA 2QB0B 4G9BA 1D8BA 5KT6A 5CRXA 8ICVA 2O6KA 4ELVA 4F92B 3H8WA 3HKZF 1C7YA 2PI5A 3KTQA 1ZJMA 5KFTA 4KITB 3T5LA 1BPEA 4YXJA 3WKCA 1RM6C 4ED3A 3ZI4A 4M9JA 5ALNA 4QZ8A 4C4TA 4ECUA 1QSSA 1QSLA 2MUTA 1FFVA 2H3FA 3RRGA 4PL2A 2HHQA 3WU2U 3SV4A 7ICRA 2JEJA 3IDWA 2ISOA 3Q8LA 3KKAC 1SL1A 4TUQA 4KMOB 5AK6A 4DOCA 2FLPA 2KJ8A 4JWMA 8ICCA 2W54A 3NVWA 5AKYA 5KFFA 2FDRA 2W9AA 4DLEA 4B9NA 3ZDBA 2ZIXB 4IC9A 3GFKB 4DS5A 3QZ8A 4OCZA 9ICHA 1F44A 3ETLA 2XICA 2W9BB 1QTMA 5KG1A 1RQLA 4DLGA 1ZQCA 2DKXA 4EYIB 5CA7A 3V6JA 4P0PA 1UPHA 5CB1A 5EE9A 2WF6A 4KLEA 4YXMA 3MABA 4EX7A 3JPSA 8ICGA 1JXEA 2EAPA 1A77A 5DG9A 3MFIA 4HYKA 3TFSA 4OO1J 3KHLA 3H4DA 4MEXA 3KOOA 4KLOA 4DSFA 3Q8RB 1PK1A 4B9UA 1YZ7A 4R66A 4F5PA 2ASLA 4J9OA 3PW5A 4JV1A 5AKHA 2KTQA 1PZNA 1VLBA 2ASDA 2E3TA 5KFPA 2AGPA 2PMZF 4NLGA 3NVZA 4JMUA 1WCLA 2K60A 5AICA 3E0FA 5IILA 2ZUCA 2D8CA 5DLGA 2HHXA 1OXJA 2MSNA 1ZQNA 2KKPA 4OJ6A 3NGDA 4Q45A 1LKYB 3D2SA 1M6YA 5T14A 2ZIUB 1S8OA 2ZIVB 1KL9A 1IM4A 5B5EU 3IHQB 2JXJA 1XC9A 3D2QA 1QLNA 2W11A 3QYPA 3V7LA 8ICIA 4I29A 4RQNA 4KLIA 5KG5A 2UVVA 9ICEA 4K4IA 3UXPA 5KT7A 2KIWA 2YB4A 4Z6CA 4BWMA 1RQNA 4NLNA 4J9KA 2VA2A 4TQSA 8ICRA 1KFTA 3PV8A 4QWDA 2LYAA 3THVA 5F3XB 1S9FA 4YN4A 2DL0A 4US8A 4TUSA 2ZG6A 4UAUA 1KFDA 1N5XA 4NY8A 1T94A 4FE3A 2F8KA 9ICJA 3MR3A 2L5YA 1TV9A 2GOLA 4ECQA 5TZVA 2W43A 1OUQA 4I2DA 4O3PA 4DSJA 2QKQA 4ACOA 4F4ZA 5ALFA 3CYMA 4P2HA 4WJ3B 1BNPA 4J9RA 7ICOA 3M8RA 3WKAA 4ECZA 4M6WB 1ZQMA 8ICJA 1K5OA 5L1KA 1S0MA 4QWBA 2XCPA 3K1RB 4YD2A 5DB7A 3RJHA 3I28A 4IQWA 5ALVA 3UMCA 3TACB 2W9CA 3TANA 2KVSA 5KFSA 3HILA 3C21A 1JX4A 2Y0SF 3UXOA 1CI4A 2G08A 2HHWA 1FO4A 2CPRA 2Z7JA 4DO9A 1HEKA 3LVVA 1Z4OA 1NZBA 1O08A 3C29A 1JROA 1TAUA 2ZJAA 4DQSA 4KLMA 3HX0A 4BXOA 3OTQA 3V7KA 2IOHA 4TQRA 3FC4A 3RH6A 3PX6A 4CCHA 8ICYA 3ALRA 4MFCA 2G5IB 2EZZA 1SXEA 4O3RA 5KFQA 5AK5A 2B21A 2KJ5A 2XGPA 2PKEA 1XSLA 7ICQA 2HHSA 5ALEA 1SV0C 3OGUA 1VDVA 2YTUA 3B9JA 3UPQA 3PSTA 4QZHA 5DDMA 2NYVA 2VJ4A 5KG7A 4P0QB 4E0DA 4RQMA 3L3FX 4RT2A 3RAXA 2R8GA 1WYGA 2HCFA 2CN1A 3CW2C 4J9NA 2QLTA 1ZQKA 5AI6A 4U6PA 4KLLA 2HHTA 5J2HA 2DGZA 1SKWA 2BDPA 2PI4A 7ICNA 5E79U 2D6FC 5AM1A 1CRXA 1DXSA 1WWUA 1L7OA 3QU7A 5DDYA 7ICSA 2R8KA 4C7YA 5KT3A 7ICEA 3UQ2A 4M6WA 1ZQFA 4O3MA 3BS5B 2RLTA 5DB8A 1AQ6A 4UARA 3RR7A 4F5RA 4EBDA 4JV0A 1U49A 2Y1IA 4KX5A 4K4HA 4R64A 3SEIA 4YFKA 2V9WA 3MR2A 2KFNA 4AP9A 5J2CA 5IIIA 2K4IA 4KLUA 4I2IA 1SZHA 3BJYA 4Y2JA 3TI0A 2WF7A 4Z6FA 3GU3A 2GWSA 3ETRA 4NLZA 2XC9A 2J6TA 2GO7A 3BQ2A 3K1ZA 3KFUF 3Q8KA 4DCCA 1TVAA 4R8UB 2JEGA 4P0QA 4O0IA 1ZJNA 4DL3A 1N5WA 1O03A 2RRDA 3KBBA 1WWVA 4KLGA 2HOFA 3C2LA 1X9SA 2ASJA 4KLQA 2ZTEA 3HWTA 4O5CA 4Y2VA 4O3SA 3WK9A 3IRUA 3JPPA 3G6XA 5KFVA 2YMPA 3IV6A 2LI6A 2YX8A 4YMMA 3RJKA 8ICKA 3CP8A 3QUCA 3AQEA 1N60A 4NV0A 3PR4A 1N63A 4QWAA 4B9LA 2HHUA 2P6UA 3SV3A 5K4LA 2YQEA 3QU4A 1S0OA 5ALWA 4CF5A 1HUZA 5HHIA 3Q8PB 4I28A 2DKZA 2ZJ5A 1NK6A 2F77X 1DGSA 2LYBA 3RFAA 1NKCA 4F5OA 4EZ9A 1BPBA 2F76X 1RDFA 4MF8A 1IV8A 4MFFA 1WCNA 4PH5A 4F91B 3PX4A 3D2NA 4UB2A 4YMOA 4KLTA 3HRDD 2ZTDA 2ZXHA 3ZDAA 5AM4A 2E1EA 8ICFA 2B6GA 4PZOA 1U9LA 1SL2A 3WK4A 7ICPA 1KSPA 3L5KA 4R8UA 5KFDA 5J2GA 2MU2A 1MN8A 3GQCA 1NK0A 5KG4A 2XI9A 2MRLA 5KL1B 1MSWD 8ICQA 2ZUBA 2WTFA 4C0ZA 5AKEA 1X9MA 5J2KA 3ISCA 1JMSA 4LZDA 2KZMA 2KVCA 4YQWA 5G5HA 9ICPA 4ED0A 2OHFA 4I2FA 2RHFA 4F4WA 1ZQTA 3MR6A 1A0PA 1A6SA 2FE9A 3F5AA 3ORYA 1RXWA 2VKQA 4YVZA 8ICZA 4U7CA 4NM2A 4BUGA 1JN3A 5KT5A 3AM9A 4JK1A 2KHQA 1F5SA 1ZD3A 1ZQXA 3QZ7A 4EELA 4J9LA 3NVYA 3V72A 2AQ0A 1KKXA 1XNSA 1CEZA 1VJ5A 3S6JA 1J2MA 4IL6U 2ZUDA 1UA1A 1UHUA 5DBCA 5KAIU 3HJEA 4ED2A 2ZIXA 1XSPA 5J8YC 1KLNA 7ICIA 4UATA 9ICKA 1RYUA 4OJLA 4KLDA 3H8JA 4NLCA 3CRXA 4ED1A 1BPDA 2VA3A 3NVVA 5AKIA 2VA8A 4PHPA 3LYSA 2C22A 4IQVA 2I1QA 4DL2A 3PSIA 3C2KA 2I9GA 2HMXA 3AU2A 3Q8MA 5EE1A 3SQIA 3GDXA 1URJA 3JPOA 4C4RA 4UW9A 5KG2A 3EPGA 4OJOA 2ZJ8A 5L9XA 1PVRA 1KBUA 4CGZA 4YD1A 1SB3C 5KFWA 3PSFA 2H3QA 4CRXA 5D49A 5CHGA 1LV5A 1P7DA 3QNMA 3MBYA 5TISU 8ICUA 2C2RA 1X42A 2ZIWA 2MAXA 5EWEA 2K8CB 2H3VA 3C2MA 2WF8A 9ICCA 1K1SA 9ICOA 4ZH4A 2JHDA 1ZQYA 2HBKA 5ALKA 4ECXA 8ICMA 3EPIA 5L1MA 5HMLA 2F2AB 1ZQLA 3FDSA 2Y9TA 2K89A 3PZPA 2P66A 3FAHA 4QNLA 2ZXIA 1NKBA 4J9QA 4GXKA 2FLNA 2VANA 3M9OB 1MQ3A 2JH7A 1Q46A 3JPRA 2XY6A 5CEHA 4UB1A 4PHDA 2KMDA 4ZOHC 5AKKA 2KSOB 4P4MA 5KFUA 1YZ6A 3J81j 3TAPA 1LVHA 3BDPA 1U4BA 1ZQEA 1UCVA 4K4GA 1C20A 5DGAA 2WB1C 4EBCA 4O3NA 4DF8A 2YMMA 1H38A 1UT8A 3QE9Y 5ALYA 1RZTA 1Z19A 1ZOLA 4C8KA 2A1JA 1SWWA 5J2BA 2UVUA 4IRKA 3RJFA 1X66A 4EENA 2W3SA 3QUBA 2EH9A 4QW9A 9ICFA 2ZIVA 4DQRA 2F44A 4F3OA 5AI5A 1KDHA 5C5JA 1QQ5A 5KFZA 1XO0A 4GFJA 2FMSA 4I2CA 1Z4NA 3H40A 1JIHA 2ZTCA 4B9SA 2R8HA 2H3ZA 1Z00A 4RZRA 5H2FU 1FFUA 1N2XA 5DKWA 2R18A 3PX0A 3AEVA 2AGOA 4GC6A 2NRXA 5KFIA 3Q8QB 1ZQSA 4I2JA 1ZQIA 2E8MA 3F2DA 3BQ7A 5DG7A 4CDGA 2HBLA 3B0XA 4OJPA 2AXTU 4J9PA 2YY6A 4PHAA 2KZ3A 5L1IA 2MUTB 2ZIWB 2LM4A 4CE6A 3DDHA 3MGIA 1SIJA 3PO4A 2R8IA 4DSIA 5ALPA 4IRDA 2KSOA 1QH9A 2FMQA 2JGAA 1ZQUA 3RB3A 2N1RA 1ZYQA 2HI0A 2W7PA 5KT2A 3BQ0A 4DL6A 1X40A 2ISPA 1SGGA 2FI1A 3EWAA 2BHNA 4GIBA 3Q8SB 2RP5A 3IP4B 4F2SA 4LZGA 3I76A 3KZIU 1U48A 2HOIA 4O3QA 2A19A 2W9MA 2RQ5A 1XS9D 4BGDA 1A76A 3E2EA 4M47A 1ZQDA 2KHVA 3T5JA 3MC1A 2IHNA 3KD3A 3AL0B 5AI0A 5DQGA 4KTQA 1ZQHA 9ICUA 2E8OA 4CF3A 2K8BB 4Y2XA 1B0XA 1NK9A 3ZDCA 2BCVA 2LBOA 4DSKA 3GZFA 1T4GA 2KNJA 5KTQA 1QQ6A 4HAIA 5DB6A 4BWJA 4FS2A 2JH1A 5KT4A 2NRWA 2YMLA 4FZMA 4DQIA 2F3NA 3RJIA 1ZQOA 3PW0A 4PGYA 1TFRA 2C2DA 5JTIA 1BPXA 3GILA 2ATLA 8ICXA 2KEYA 3SD7A 1Q3UA 4M0AA 1L3VA 5GTIU 2VJ5A 5J0WA 2IOFA 3UXNA 4UBCA 1ZD2P 3QX7A 2J6SA 4IR9A 1T3NA 2IBKA 3OHBA 9ICRA 4RUCA 3TADC 1PUZA 2BCRA 5ALTA 2KZZA 4B9MA 4RQ8A 5IIMA 1N62A 5D46A 1SKRA 9ICQA 1V97A 5CP2A 1TAMA 1TK5A 2OCEA 3QUQA 3N7RC 3BQTA 2XY5A 3KHRA 2C2EA 4DQQA 5DQIA 2K8AA 3PVXA 1KQQA 2BCUA 3RJEA 5C0YA 1JXLA 3OSPA 3LVWA 2EAOA 5AM2A 3M6ZA 3IG8A 1UQVA 1PK3A 9ICSA 5J2FA 3ICXA 2NV3A 4NWIA 4Q44A 4AYBF 8ICLA 2LM1A 2BGWA 2JZBA 3HT3A 4ED6A 4Y2UA 3VC8A 4G3IA 4P4OA 2R8JA 5KFYA 2BCSA 5B66U 5KFMA 2OXOA 2I5HA 4JUZA 4PHEA 2XCAA 4IRCA 1KFSA 1YT3A 1NK5A 5J2DA 4UBBA 2KN7A 3OSNA 1ZQPA 4ED8A 3SAHA 3PW7A 4ECSA 4UB3A 4TURA 5ALLA 2BPGA 3M6KA 4X5VA 5J0OA 3LWLA 4F4XA 1T7PA 2EANA 4P0PB 3AMZA 3L4PA 4CF4A 4GXIA 9ICWA 4DL4A 1ZQAA 3PR5B 3GIMA 4PL1A 1N56A 1PVQA 2KE7A 3PNCA 3F2BA 2KG5A 3PSPA 4FBUA 1SWVA 4DFDA 1B22A 4DOBA 3HKZC 4Y2PA 2K4PA 1SXDA 4MFAA 5KNIA 2RDIA 3PMLA 4UAZA 1NNLA 3HPOA 5KFEA 3ONNA 2HW3A 4KLJA 4RQ0A 4FZNA 2VIXA 3MGHA 5ALZA 3FYHA 9ICIA 2W7OA 2FPKA 1ZQWA 3ISBA 2WHEA 3OPXA 2GH1A 8ICNA 4Z6EA 2KK0A 5EE3A 3NASA 3SAFA 3M9MB 4O5EA 1DK3A 5KFLA 2ODGA 4QZBA 2K4EA 3QU2A 2G09A 4QZDA 2NO5A 5IIOA 4KN7A 2BQ3A 3GIIA 3SI8A 4M9HA 9ICTA 7ICMA 4YR0A 4A8EA 2BPFA 4B6JA 4Y2YA 1HJPA 2AHOB 4NL9A 5AM5A 2V4RA 2HDOA 4RQ7A 2W04A 3ISDA 3T3FA 1ZQGA 7ICTA 3GV8B 3K4GA 1X9WA 1L8LA 5ALSA 4QW8A 2FMPA 2QARB 2MA1A 5ALXA 5AM3A 4OD0A 5ALIA 4RT3A 1KTQA 5KFRA 5EWFA 3VCBA 2OEHA 1RXVA 3M7DA 4C8NA 2PXIA 4LVSA 4XRHA 3SR6A 3RH4A 3RAQA 4C8OA 1ZQVA 1JRPA 3BS5A 3SZ2A 3M8SA 1HIWA 1GO3F 2LPEA 2IHMA 2DQNB 4I27A 5KFOA 2KJ9A 1MQ2A 4C4SA 3T5KA 1FIQA 4EYHB 3DV9A 4B9VA 4ELUA 2XVTA 1ZQZA 4Y2QA 3NTUA 4J03A 5AKGA 5KL8B 5AKZA 4R65A 2BDUA 2G06A 4I2GA 5KFGA 2BCQA 1X6JA 4UB5A 2JEIA 1LB2B 9ICBA 4PPXA 2W8KA 2KD1A 4XA5A 1RPLA 4ECTA 5F9NA 2ES6A 2WB1F 5J0PA 5AM0A 4M9GA 5F9LA 1ECWA 3C1YA 3RB6A 2IA6A 3RF9A 4ICAA 5ALGA 5DLFA 3LDAA 1L5UA 2PMZC 3M9NB 4KLSA 4YMNA 4F8RA 3KHGA 4RQ3A 1NJWA 4Z6DA 5EOZA 4RNMA 4ECWA 3ED5A 1NK7A 2W8LA 1J2NA 3D6JA 5BOMA 5J0TA 7ICVA 1ZD4A 4GC7A 3A0BU 4NLBA 1Z3EB 4Q43A 2W9CB 4M04A 2UVWA 8ICHA 1EXNA 5CJ7A 2A3VA 5KG0A 7ICGA 1S77D 3T79A 5JRTA 1MC8A 4CNQA 4Y2SA 2AJQA 3EW9A 4YG2A 4IR1A 1KEJA 4Q8FA 3UQ0A 4DSEA 2JEFA 3RBEA 4DFKA 4IQUA 4MHVA 2YN4A 3TAQA 2LKYA 3QU5A 5KFKA 2LHTA 5BPCA 3OJUA 2Q4TA 4KX3A 1MA7A 4BXOB 3F2CA 9ICLA 3V6KA 5J0YA 2NRTA 3AN1A 3TARA 4DL5A 2FPMA 5JU5A 4DWIA 2F1IA 3NUQA 3PW4A 1COOA 8ICTA 5AIAA 4XUSA 9ICAA 5DQHA 4DS4A 2XO7A 1Q8KA 2UVRA 2WF9A 2C28A 2W03A 2WF5A 4QIWC 5ALRA 1DK2A 1T8EA 4BX9C 9ICNA 2F8LA 5J2IA 5DGBA 3RTVA 1D9FA 1NKEA 2BQUA 3GV7B 1CUKA 4NJ8A 2JV3A 5ALOA 4YCXA 1S97A 2YB1A 4XQ8A 1NJXA 4MF2A 1ZQQA 1TE2A 1BPZA 2DF4B 5ALJA 2KKVA 1DRGA 3WK8A 4UAYA 1RG6A 4PJ0U 4M2YA 3MGVA 1S76D 2DWQA 4QZEA 2LMRA 5BOLA 3RJGA 9ICGA 1S10A 4AYBC 1J97A 2OM6A 3H4BA 2EQYA 4KLFA 4EBEA 5J2EA 4FO6A 1SV0A 3K75D 5FP0A 1BPYA 5J0QA 1ZETA 5HP4A 3PW2A 2A1AA 4UASA 4OJ5A 1NOMA 3KKAA 2OWOA 3IN5A 3ZD9A 1TK8A 2JMGA 5HNKA 5AI9A 3JPNA 1ZRNA 3WK6A 2CRXA 3C23A 1B4FA 3C1ZA 2E8NA 1IIPA 2KP7A 2BKEA 5HHHA 9ICXA 3RJJA 4F5QA 4NXZA 2FJ6A 5IINA 2AGQA 2PFNA 1NI3A 2P35A 3BS7A 1D9DA 4I2EA 1NK4A 2W3RA 2HBMA 4R63A 1V85A 2JZBB 1QSYA 3AU6A 5DG8A 3NRZA 1COKA 2FLLA 4GXJA 1JALA 4QZGA 3ZDEA 4QZCA 1D8YA 1TAQA 4NL9C 2ALZA 1N48A 3SYZA 7ICKA 3UM9A 3RB0A 3GIJA 1XSNA 1Z00B 3UMBA 2WAQC 1L3SA 4RNNA 2BPCA 2JR5A 5KFHA 4QWCA 2XGQA 5J29A 4RPYA 2WFAA 3IG5A 3C5FA 5L1JA 5IIJA 4B9TA 4QWEA 3H0RB 5AKXA 3SMVA 2ESEA 4O3OA 4UAVA 1BGXT 3QUTA 5AI8A 4MEYA 4ELTA 2W9BA 2HOQA 3QU9A 2E1FA 4RU9A 3C5GA 2DFLA 7ICLA 3C28A 4DQPA 2RDJA 4KMUA 2XIDA 1LKYA 4ECVA 3MR5A 3IM1A 1PVPA 4ED7A 4P4PA 1RYSA 3PY8A 1OW5A 3RB4A 1IG6A 3R9KA 1S0VA
chains in the Genus database with same CATH topology
2M0NA 1ZQ1C 2RRDA 2ZIWA 3D2QA 3O0FA 3T79A 2RHFA 3ALRA 3N7PD 2ZIXB 2CRXA 2G5IB 4IC9A 1Q3VA 2KICA 2MA1A 2K8CB 2HOFA 3F5EA 2G5HB 2KEYA 3H0MB 1IIPA 1A0PA 1XO0A 4GFJA 1Q3UA 2KJ5A 4BJQA 2H3VA 1A6SA 4P0PB 2HBJA 3VCBA 2VJ5A 3F5AA 2VKQA 3M7DA 2H3ZA 3PSTA 5HR7A 2JHDA 2YX8A 4U7CA 1F44A 4BUGA 2LKYA 2R18A 2HBKA 2XICA 2KHQA 3CP8A 2LHTA 2VJ4A 2KIWA 2Q4TA 3AQEA 4KX3A 4PL1A 2YB4A 3DEEA 4NV0A 3F2CA 1MA7A 2F2AB 2HBMA 4P0QB 1PVQA 1XNSA 3L3FX 1HIWA 2K89A 3F2DA 3PZPA 1GO3F 2LYAA 4CDGA 2DQNB 2HBLA 4OJPA 4QNLA 2ZXIA 2KJ9A 2CN1A 3F2BA 1ED1A 4P0PA 1UPHA 3NUQA 2ZG6A 3PSPA 4CRXA 1T94A 1TAMA 2F77X 2JH7A 3F53A 2LYBA 4FE3A 4U6PA 2ZIWB 3RFAA 2XVTA 3N7SC 2DGZA 3HKZC 3SAGA 3N7RC 2ZIXA 5CRXA 1D8BA 2D6FC 2GOLA 2W03A 2F76X 5KL8B 1OUQA 5HR6A 1Z1BA 4QIWC 4OJLA 2K8AA 2BDUA 1CRXA 4OO1J 3HKZF 4ACOA 4NLCA 3CYMA 2JGAA 2G06A 3CRXA 4WJ3B 4FZLA 3ONNA 2N1RA 1PVRA 2WAQC 4FZNA 2W7PA 5C0YA 3KZXA 2VIXA 3D2NA 3H0LB 2F8LA 4BX9C 2ZIUA 3LVWA 3AL0B 2KV2A 3M6ZA 3IG8A 4O3MA 2KD1A 2W7OA 2ZXHA 2WAQF 3IG5A 3LYSA 2G0AA 3ICXA 2E1EA 2NV3A 2YB1A 2WB1F 4NWIA 2RP5A 3OPXA 4AYBF 3IP4B 3H0RB 2GH1A 2DF4B 3PSIA 3SMVA 1ECWA 2KKVA 3VC8A 4KX5A 2PMZF 4JMUA 1DRGA 2HMXA 3AQFA 3SAFA 2WB1C 2HOIA 3RF9A 2G07A 4ICAA 3MGVA 3SQIA 3E0FA 2OXOA 2H3IA 2PMZC 1L6NA 2K4EA 2H3FA 2OH2A 1URJA 2G09A 2K4IA 2Y0SF 4AYBC 1SZHA 2KOBA 2K4HA 2KHVA 4PL2A 2HOQA 2G08A 1YT3A 2OM6A 3NRWA 4OJOA 1WUDA 2OYYA 2E1FA 2CPRA 2KKPA 2XI9A 4OJ6A 2Y0SC 2MRLA 2Z7JA 1HEKA 3GU3A 3LVVA 4A8EA 3C28A 1Z19A 1NZBA 1KBUA 4CGZA 3D2SA 2XIDA 2K8BB 5KL1B 3SAHA 5A0LA 4KMOB 5T14A 4NLBA 3PSFA 2H3QA 2LBOA 3C29A 3K1ZA 1PVPA 3GZFA 2KJ8A 2KNJA 2ZIUB 4OJ5A 4C0ZA 4QIWF 3KFUF 1P7DA 2E5SA 2ZIVA 2ZIVB 2W04A 2JH1A 3IN5A 2JMGA 2KVCA 4FZMA 4QJFB 4P0QA 3M6KA 2A3VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CYM A;  2RRD A;  2RHF A;  5C0Y A;  1GO3 F;  4CDG A;  2HBL A;  2MA1 A;  2KV2 A;  1YT3 A;  1WUD A;  4O3M A;  2E1F A;  2CPR A;  2HBJ A;  4CGZ A;  2E1E A;  3SAH A;  2DGZ A;  4NLB A;  3SAG A;  1D8B A;  2HBK A;  4QIW F;  3SAF A;  4QJF B;  4OO1 J;  2HBM A;  4NLC A; 
#chains in the Genus database with same CATH topology
 2M0N A;  3JPQ A;  1ZQ1 C;  1L7M A;  3O0F A;  3N7P D;  4UQG A;  8ICB A;  1NJY A;  4FBT A;  2KIC A;  3GV5 B;  8ICW A;  2G5H B;  2BZF A;  3UMG A;  1T3Q A;  5J8Y A;  4Y2T A;  4QZ9 A;  4J9M A;  4RPX A;  2NRV A;  1B43 A;  2B0C A;  3I1Y A;  7ICJ A;  4C8L A;  4IS7 A;  2EZX A;  1N61 A;  3DEE A;  3ZD8 A;  5KFB A;  4RQ5 A;  4F93 B;  4RQ2 A;  2NRZ A;  5AK3 A;  1S0N A;  2AH5 A;  5J2J A;  8ICO A;  1DOQ A;  4UB4 A;  4EEY A;  1IXR A;  4I2A A;  3QEA Z;  3BZC A;  2EAM A;  4KN4 A;  3F53 A;  4ECY A;  1RYR A;  3E58 A;  3KHH A;  5CWR A;  2Y1J A;  3SAG A;  2PFP A;  1Z1V A;  4C80 A;  3AUO A;  5HR6 A;  4LJX A;  3WKB A;  4UB6 U;  5ALU A;  2ZIU A;  1L3T A;  2AQ4 A;  4O9M A;  3H7I A;  3WK7 A;  4F5N A;  1X2I A;  5DBB A;  1S5L U;  1U47 A;  1K1Q A;  1BNO A;  1L7N A;  2GLE A;  3H8S A;  4BDP A;  1U45 A;  3AQF A;  3N4M B;  2W55 A;  4ECR A;  2H3I A;  4F4K A;  3WKE A;  1JI7 A;  2NO4 A;  2QB0 A;  4I2H A;  2I6X A;  2YMQ A;  4FS1 A;  4F50 A;  1XU4 A;  1WUD A;  1ZQB A;  2AU0 A;  1WG8 A;  3G6V A;  5DB9 A;  5A0L A;  4DL7 A;  7ICF A;  9ICV A;  5L1L A;  2EZY A;  4PGQ A;  2FPL A;  4J9S A;  1ZD5 A;  3GIK A;  1BVS A;  7ICH A;  5KFJ A;  4NLK A;  2PFQ A;  3V6H A;  4DF4 A;  1ZRM A;  3HW8 A;  4YR3 A;  2BQR A;  3TAD A;  1ZQJ A;  3H8M A;  1SV4 A;  5AK4 A;  4PGX A;  5ALD A;  1KN5 A;  4EEK A;  2DPJ A;  3N28 A;  1L3U A;  4DFJ A;  4F72 A;  1ARO P;  1V38 A;  3MDA A;  2P6R A;  3BZK A;  5J0X A;  1ED1 A;  1TKD A;  3WK5 A;  4KLH A;  4F2R A;  3QEB Z;  2F1J A;  3RR8 A;  1Z1B A;  1QCK A;  3EYZ A;  4Q8E A;  2HHV A;  5KFX A;  1Y88 A;  2DUY A;  4FZL A;  2EDU A;  3MDC A;  1FEZ A;  5KFA A;  3KZX A;  3H0L B;  5AHX A;  2LYH A;  4RNO A;  2G0A A;  4M9L A;  5KFC A;  5J2A A;  2QAR A;  1UA0 A;  3N97 B;  2G07 A;  3RRH A;  1SZP A;  4TUP A;  1L6N A;  2OH2 A;  2BR0 A;  9ICM A;  1KRP A;  5KFN A;  4EZ6 A;  2KOB A;  3NRW A;  4GLX A;  2V4Q A;  5JUM A;  2H5X A;  2OYY A;  4F71 A;  4US9 A;  4C7Z A;  5AKJ A;  3QXG A;  4F4Y A;  4USA A;  5AIB A;  1JUD A;  1D8L A;  2E5S A;  2DPI A;  2PFO A;  3V7J A;  3RH5 A;  1XWL A;  4QJF B;  5CR0 A;  5HMM A;  1NJZ A;  1Q3V A;  1X9X A;  5ALH A;  2IOF K;  3F5E A;  3TQ1 A;  3H0M B;  5J0S A;  4DFM A;  2JRZ A;  1TK0 A;  2HBJ A;  3HP6 A;  5J0R A;  5HR7 A;  3TKA A;  2IMW P;  2HVH A;  4RUA A;  1F0M A;  3WKD A;  4EX6 A;  8ICE A;  2J6U A;  3CNH A;  2CXY A;  4DSL A;  1NZP A;  5IIK A;  3EUB 2;  2A1J B;  3M1Y A;  4IQT A;  3PMN A;  4DOA A;  5DBA A;  5GTH U;  3PO5 A;  2Q0Z X;  5EE0 A;  2HVI A;  4RQ1 A;  4RQ6 A;  1NK8 A;  5KAF U;  3RBD A;  2KIV A;  4JB3 A;  7ICU A;  3A0H U;  4I2B A;  5J0U A;  1UT5 A;  1V9P A;  8ICA A;  1XO1 A;  4NM1 A;  4FFD A;  3TFR A;  3EZ5 A;  2KV2 A;  4M9N A;  2WAQ F;  4QZI A;  1ZXI A;  4UAW A;  4QZF A;  2D3D A;  3JPT A;  5ALQ A;  2KFZ A;  4JV2 A;  5EWG A;  4RPZ A;  5KG3 A;  1SKS A;  2K4H A;  3BQ1 A;  4QZA A;  2QB1 A;  8ICP A;  2Y9U A;  5AI4 A;  2Y0S C;  2E8P A;  2DBY A;  5G5G A;  3T5H A;  4DEZ A;  5D4B A;  4UB8 U;  4PZN A;  1SL0 A;  2M9N A;  4QIW F;  2F1H A;  3U26 A;  1KW4 A;  1L8O A;  4JWN A;  3LWM A;  3ZDD A;  3OHA A;  3B0Y A;  3OJS A;  3G6Y A;  4DFP A;  4RQ4 A;  4YP3 A;  4BJQ A;  8ICS A;  1PK1 B;  4Y2R A;  4C8M A;  5ALM A;  2XY7 A;  4YR2 A;  3FM9 A;  3NS1 A;  1ZQR A;  3SEN A;  1X6I A;  1QQ7 A;  5KG6 A;  1HUO A;  3MFH A;  5AKL A;  1L7P A;  2HSZ A;  1DGJ A;  3N7S C;  3LK9 A;  4O5K A;  2QB0 B;  4G9B A;  1D8B A;  5KT6 A;  5CRX A;  8ICV A;  2O6K A;  4ELV A;  4F92 B;  3H8W A;  3HKZ F;  1C7Y A;  2PI5 A;  3KTQ A;  1ZJM A;  5KFT A;  4KIT B;  3T5L A;  1BPE A;  4YXJ A;  3WKC A;  1RM6 C;  4ED3 A;  3ZI4 A;  4M9J A;  5ALN A;  4QZ8 A;  4C4T A;  4ECU A;  1QSS A;  1QSL A;  2MUT A;  1FFV A;  2H3F A;  3RRG A;  4PL2 A;  2HHQ A;  3WU2 U;  3SV4 A;  7ICR A;  2JEJ A;  3IDW A;  2ISO A;  3Q8L A;  3KKA C;  1SL1 A;  4TUQ A;  4KMO B;  5AK6 A;  4DOC A;  2FLP A;  2KJ8 A;  4JWM A;  8ICC A;  2W54 A;  3NVW A;  5AKY A;  5KFF A;  2FDR A;  2W9A A;  4DLE A;  4B9N A;  3ZDB A;  2ZIX B;  4IC9 A;  3GFK B;  4DS5 A;  3QZ8 A;  4OCZ A;  9ICH A;  1F44 A;  3ETL A;  2XIC A;  2W9B B;  1QTM A;  5KG1 A;  1RQL A;  4DLG A;  1ZQC A;  2DKX A;  4EYI B;  5CA7 A;  3V6J A;  4P0P A;  1UPH A;  5CB1 A;  5EE9 A;  2WF6 A;  4KLE A;  4YXM A;  3MAB A;  4EX7 A;  3JPS A;  8ICG A;  1JXE A;  2EAP A;  1A77 A;  5DG9 A;  3MFI A;  4HYK A;  3TFS A;  4OO1 J;  3KHL A;  3H4D A;  4MEX A;  3KOO A;  4KLO A;  4DSF A;  3Q8R B;  1PK1 A;  4B9U A;  1YZ7 A;  4R66 A;  4F5P A;  2ASL A;  4J9O A;  3PW5 A;  4JV1 A;  5AKH A;  2KTQ A;  1PZN A;  1VLB A;  2ASD A;  2E3T A;  5KFP A;  2AGP A;  2PMZ F;  4NLG A;  3NVZ A;  4JMU A;  1WCL A;  2K60 A;  5AIC A;  3E0F A;  5IIL A;  2ZUC A;  2D8C A;  5DLG A;  2HHX A;  1OXJ A;  2MSN A;  1ZQN A;  2KKP A;  4OJ6 A;  3NGD A;  4Q45 A;  1LKY B;  3D2S A;  1M6Y A;  5T14 A;  2ZIU B;  1S8O A;  2ZIV B;  1KL9 A;  1IM4 A;  5B5E U;  3IHQ B;  2JXJ A;  1XC9 A;  3D2Q A;  1QLN A;  2W11 A;  3QYP A;  3V7L A;  8ICI A;  4I29 A;  4RQN A;  4KLI A;  5KG5 A;  2UVV A;  9ICE A;  4K4I A;  3UXP A;  5KT7 A;  2KIW A;  2YB4 A;  4Z6C A;  4BWM A;  1RQN A;  4NLN A;  4J9K A;  2VA2 A;  4TQS A;  8ICR A;  1KFT A;  3PV8 A;  4QWD A;  2LYA A;  3THV A;  5F3X B;  1S9F A;  4YN4 A;  2DL0 A;  4US8 A;  4TUS A;  2ZG6 A;  4UAU A;  1KFD A;  1N5X A;  4NY8 A;  1T94 A;  4FE3 A;  2F8K A;  9ICJ A;  3MR3 A;  2L5Y A;  1TV9 A;  2GOL A;  4ECQ A;  5TZV A;  2W43 A;  1OUQ A;  4I2D A;  4O3P A;  4DSJ A;  2QKQ A;  4ACO A;  4F4Z A;  5ALF A;  3CYM A;  4P2H A;  4WJ3 B;  1BNP A;  4J9R A;  7ICO A;  3M8R A;  3WKA A;  4ECZ A;  4M6W B;  1ZQM A;  8ICJ A;  1K5O A;  5L1K A;  1S0M A;  4QWB A;  2XCP A;  3K1R B;  4YD2 A;  5DB7 A;  3RJH A;  3I28 A;  4IQW A;  5ALV A;  3UMC A;  3TAC B;  2W9C A;  3TAN A;  2KVS A;  5KFS A;  3HIL A;  3C21 A;  1JX4 A;  2Y0S F;  3UXO A;  1CI4 A;  2G08 A;  2HHW A;  1FO4 A;  2CPR A;  2Z7J A;  4DO9 A;  1HEK A;  3LVV A;  1Z4O A;  1NZB A;  1O08 A;  3C29 A;  1JRO A;  1TAU A;  2ZJA A;  4DQS A;  4KLM A;  3HX0 A;  4BXO A;  3OTQ A;  3V7K A;  2IOH A;  4TQR A;  3FC4 A;  3RH6 A;  3PX6 A;  4CCH A;  8ICY A;  3ALR A;  4MFC A;  2G5I B;  2EZZ A;  1SXE A;  4O3R A;  5KFQ A;  5AK5 A;  2B21 A;  2KJ5 A;  2XGP A;  2PKE A;  1XSL A;  7ICQ A;  2HHS A;  5ALE A;  1SV0 C;  3OGU A;  1VDV A;  2YTU A;  3B9J A;  3UPQ A;  3PST A;  4QZH A;  5DDM A;  2NYV A;  2VJ4 A;  5KG7 A;  4P0Q B;  4E0D A;  4RQM A;  3L3F X;  4RT2 A;  3RAX A;  2R8G A;  1WYG A;  2HCF A;  2CN1 A;  3CW2 C;  4J9N A;  2QLT A;  1ZQK A;  5AI6 A;  4U6P A;  4KLL A;  2HHT A;  5J2H A;  2DGZ A;  1SKW A;  2BDP A;  2PI4 A;  7ICN A;  5E79 U;  2D6F C;  5AM1 A;  1CRX A;  1DXS A;  1WWU A;  1L7O A;  3QU7 A;  5DDY A;  7ICS A;  2R8K A;  4C7Y A;  5KT3 A;  7ICE A;  3UQ2 A;  4M6W A;  1ZQF A;  4O3M A;  3BS5 B;  2RLT A;  5DB8 A;  1AQ6 A;  4UAR A;  3RR7 A;  4F5R A;  4EBD A;  4JV0 A;  1U49 A;  2Y1I A;  4KX5 A;  4K4H A;  4R64 A;  3SEI A;  4YFK A;  2V9W A;  3MR2 A;  2KFN A;  4AP9 A;  5J2C A;  5III A;  2K4I A;  4KLU A;  4I2I A;  1SZH A;  3BJY A;  4Y2J A;  3TI0 A;  2WF7 A;  4Z6F A;  3GU3 A;  2GWS A;  3ETR A;  4NLZ A;  2XC9 A;  2J6T A;  2GO7 A;  3BQ2 A;  3K1Z A;  3KFU F;  3Q8K A;  4DCC A;  1TVA A;  4R8U B;  2JEG A;  4P0Q A;  4O0I A;  1ZJN A;  4DL3 A;  1N5W A;  1O03 A;  2RRD A;  3KBB A;  1WWV A;  4KLG A;  2HOF A;  3C2L A;  1X9S A;  2ASJ A;  4KLQ A;  2ZTE A;  3HWT A;  4O5C A;  4Y2V A;  4O3S A;  3WK9 A;  3IRU A;  3JPP A;  3G6X A;  5KFV A;  2YMP A;  3IV6 A;  2LI6 A;  2YX8 A;  4YMM A;  3RJK A;  8ICK A;  3CP8 A;  3QUC A;  3AQE A;  1N60 A;  4NV0 A;  3PR4 A;  1N63 A;  4QWA A;  4B9L A;  2HHU A;  2P6U A;  3SV3 A;  5K4L A;  2YQE A;  3QU4 A;  1S0O A;  5ALW A;  4CF5 A;  1HUZ A;  5HHI A;  3Q8P B;  4I28 A;  2DKZ A;  2ZJ5 A;  1NK6 A;  2F77 X;  1DGS A;  2LYB A;  3RFA A;  1NKC A;  4F5O A;  4EZ9 A;  1BPB A;  2F76 X;  1RDF A;  4MF8 A;  1IV8 A;  4MFF A;  1WCN A;  4PH5 A;  4F91 B;  3PX4 A;  3D2N A;  4UB2 A;  4YMO A;  4KLT A;  3HRD D;  2ZTD A;  2ZXH A;  3ZDA A;  5AM4 A;  2E1E A;  8ICF A;  2B6G A;  4PZO A;  1U9L A;  1SL2 A;  3WK4 A;  7ICP A;  1KSP A;  3L5K A;  4R8U A;  5KFD A;  5J2G A;  2MU2 A;  1MN8 A;  3GQC A;  1NK0 A;  5KG4 A;  2XI9 A;  2MRL A;  5KL1 B;  1MSW D;  8ICQ A;  2ZUB A;  2WTF A;  4C0Z A;  5AKE A;  1X9M A;  5J2K A;  3ISC A;  1JMS A;  4LZD A;  2KZM A;  2KVC A;  4YQW A;  5G5H A;  9ICP A;  4ED0 A;  2OHF A;  4I2F A;  2RHF A;  4F4W A;  1ZQT A;  3MR6 A;  1A0P A;  1A6S A;  2FE9 A;  3F5A A;  3ORY A;  1RXW A;  2VKQ A;  4YVZ A;  8ICZ A;  4U7C A;  4NM2 A;  4BUG A;  1JN3 A;  5KT5 A;  3AM9 A;  4JK1 A;  2KHQ A;  1F5S A;  1ZD3 A;  1ZQX A;  3QZ7 A;  4EEL A;  4J9L A;  3NVY A;  3V72 A;  2AQ0 A;  1KKX A;  1XNS A;  1CEZ A;  1VJ5 A;  3S6J A;  1J2M A;  4IL6 U;  2ZUD A;  1UA1 A;  1UHU A;  5DBC A;  5KAI U;  3HJE A;  4ED2 A;  2ZIX A;  1XSP A;  5J8Y C;  1KLN A;  7ICI A;  4UAT A;  9ICK A;  1RYU A;  4OJL A;  4KLD A;  3H8J A;  4NLC A;  3CRX A;  4ED1 A;  1BPD A;  2VA3 A;  3NVV A;  5AKI A;  2VA8 A;  4PHP A;  3LYS A;  2C22 A;  4IQV A;  2I1Q A;  4DL2 A;  3PSI A;  3C2K A;  2I9G A;  2HMX A;  3AU2 A;  3Q8M A;  5EE1 A;  3SQI A;  3GDX A;  1URJ A;  3JPO A;  4C4R A;  4UW9 A;  5KG2 A;  3EPG A;  4OJO A;  2ZJ8 A;  5L9X A;  1PVR A;  1KBU A;  4CGZ A;  4YD1 A;  1SB3 C;  5KFW A;  3PSF A;  2H3Q A;  4CRX A;  5D49 A;  5CHG A;  1LV5 A;  1P7D A;  3QNM A;  3MBY A;  5TIS U;  8ICU A;  2C2R A;  1X42 A;  2ZIW A;  2MAX A;  5EWE A;  2K8C B;  2H3V A;  3C2M A;  2WF8 A;  9ICC A;  1K1S A;  9ICO A;  4ZH4 A;  2JHD A;  1ZQY A;  2HBK A;  5ALK A;  4ECX A;  8ICM A;  3EPI A;  5L1M A;  5HML A;  2F2A B;  1ZQL A;  3FDS A;  2Y9T A;  2K89 A;  3PZP A;  2P66 A;  3FAH A;  4QNL A;  2ZXI A;  1NKB A;  4J9Q A;  4GXK A;  2FLN A;  2VAN A;  3M9O B;  1MQ3 A;  2JH7 A;  1Q46 A;  3JPR A;  2XY6 A;  5CEH A;  4UB1 A;  4PHD A;  2KMD A;  4ZOH C;  5AKK A;  2KSO B;  4P4M A;  5KFU A;  1YZ6 A;  3J81 j;  3TAP A;  1LVH A;  3BDP A;  1U4B A;  1ZQE A;  1UCV A;  4K4G A;  1C20 A;  5DGA A;  2WB1 C;  4EBC A;  4O3N A;  4DF8 A;  2YMM A;  1H38 A;  1UT8 A;  3QE9 Y;  5ALY A;  1RZT A;  1Z19 A;  1ZOL A;  4C8K A;  2A1J A;  1SWW A;  5J2B A;  2UVU A;  4IRK A;  3RJF A;  1X66 A;  4EEN A;  2W3S A;  3QUB A;  2EH9 A;  4QW9 A;  9ICF A;  2ZIV A;  4DQR A;  2F44 A;  4F3O A;  5AI5 A;  1KDH A;  5C5J A;  1QQ5 A;  5KFZ A;  1XO0 A;  4GFJ A;  2FMS A;  4I2C A;  1Z4N A;  3H40 A;  1JIH A;  2ZTC A;  4B9S A;  2R8H A;  2H3Z A;  1Z00 A;  4RZR A;  5H2F U;  1FFU A;  1N2X A;  5DKW A;  2R18 A;  3PX0 A;  3AEV A;  2AGO A;  4GC6 A;  2NRX A;  5KFI A;  3Q8Q B;  1ZQS A;  4I2J A;  1ZQI A;  2E8M A;  3F2D A;  3BQ7 A;  5DG7 A;  4CDG A;  2HBL A;  3B0X A;  4OJP A;  2AXT U;  4J9P A;  2YY6 A;  4PHA A;  2KZ3 A;  5L1I A;  2MUT B;  2ZIW B;  2LM4 A;  4CE6 A;  3DDH A;  3MGI A;  1SIJ A;  3PO4 A;  2R8I A;  4DSI A;  5ALP A;  4IRD A;  2KSO A;  1QH9 A;  2FMQ A;  2JGA A;  1ZQU A;  3RB3 A;  2N1R A;  1ZYQ A;  2HI0 A;  2W7P A;  5KT2 A;  3BQ0 A;  4DL6 A;  1X40 A;  2ISP A;  1SGG A;  2FI1 A;  3EWA A;  2BHN A;  4GIB A;  3Q8S B;  2RP5 A;  3IP4 B;  4F2S A;  4LZG A;  3I76 A;  3KZI U;  1U48 A;  2HOI A;  4O3Q A;  2A19 A;  2W9M A;  2RQ5 A;  1XS9 D;  4BGD A;  1A76 A;  3E2E A;  4M47 A;  1ZQD A;  2KHV A;  3T5J A;  3MC1 A;  2IHN A;  3KD3 A;  3AL0 B;  5AI0 A;  5DQG A;  4KTQ A;  1ZQH A;  9ICU A;  2E8O A;  4CF3 A;  2K8B B;  4Y2X A;  1B0X A;  1NK9 A;  3ZDC A;  2BCV A;  2LBO A;  4DSK A;  3GZF A;  1T4G A;  2KNJ A;  5KTQ A;  1QQ6 A;  4HAI A;  5DB6 A;  4BWJ A;  4FS2 A;  2JH1 A;  5KT4 A;  2NRW A;  2YML A;  4FZM A;  4DQI A;  2F3N A;  3RJI A;  1ZQO A;  3PW0 A;  4PGY A;  1TFR A;  2C2D A;  5JTI A;  1BPX A;  3GIL A;  2ATL A;  8ICX A;  2KEY A;  3SD7 A;  1Q3U A;  4M0A A;  1L3V A;  5GTI U;  2VJ5 A;  5J0W A;  2IOF A;  3UXN A;  4UBC A;  1ZD2 P;  3QX7 A;  2J6S A;  4IR9 A;  1T3N A;  2IBK A;  3OHB A;  9ICR A;  4RUC A;  3TAD C;  1PUZ A;  2BCR A;  5ALT A;  2KZZ A;  4B9M A;  4RQ8 A;  5IIM A;  1N62 A;  5D46 A;  1SKR A;  9ICQ A;  1V97 A;  5CP2 A;  1TAM A;  1TK5 A;  2OCE A;  3QUQ A;  3N7R C;  3BQT A;  2XY5 A;  3KHR A;  2C2E A;  4DQQ A;  5DQI A;  2K8A A;  3PVX A;  1KQQ A;  2BCU A;  3RJE A;  5C0Y A;  1JXL A;  3OSP A;  3LVW A;  2EAO A;  5AM2 A;  3M6Z A;  3IG8 A;  1UQV A;  1PK3 A;  9ICS A;  5J2F A;  3ICX A;  2NV3 A;  4NWI A;  4Q44 A;  4AYB F;  8ICL A;  2LM1 A;  2BGW A;  2JZB A;  3HT3 A;  4ED6 A;  4Y2U A;  3VC8 A;  4G3I A;  4P4O A;  2R8J A;  5KFY A;  2BCS A;  5B66 U;  5KFM A;  2OXO A;  2I5H A;  4JUZ A;  4PHE A;  2XCA A;  4IRC A;  1KFS A;  1YT3 A;  1NK5 A;  5J2D A;  4UBB A;  2KN7 A;  3OSN A;  1ZQP A;  4ED8 A;  3SAH A;  3PW7 A;  4ECS A;  4UB3 A;  4TUR A;  5ALL A;  2BPG A;  3M6K A;  4X5V A;  5J0O A;  3LWL A;  4F4X A;  1T7P A;  2EAN A;  4P0P B;  3AMZ A;  3L4P A;  4CF4 A;  4GXI A;  9ICW A;  4DL4 A;  1ZQA A;  3PR5 B;  3GIM A;  4PL1 A;  1N56 A;  1PVQ A;  2KE7 A;  3PNC A;  3F2B A;  2KG5 A;  3PSP A;  4FBU A;  1SWV A;  4DFD A;  1B22 A;  4DOB A;  3HKZ C;  4Y2P A;  2K4P A;  1SXD A;  4MFA A;  5KNI A;  2RDI A;  3PML A;  4UAZ A;  1NNL A;  3HPO A;  5KFE A;  3ONN A;  2HW3 A;  4KLJ A;  4RQ0 A;  4FZN A;  2VIX A;  3MGH A;  5ALZ A;  3FYH A;  9ICI A;  2W7O A;  2FPK A;  1ZQW A;  3ISB A;  2WHE A;  3OPX A;  2GH1 A;  8ICN A;  4Z6E A;  2KK0 A;  5EE3 A;  3NAS A;  3SAF A;  3M9M B;  4O5E A;  1DK3 A;  5KFL A;  2ODG A;  4QZB A;  2K4E A;  3QU2 A;  2G09 A;  4QZD A;  2NO5 A;  5IIO A;  4KN7 A;  2BQ3 A;  3GII A;  3SI8 A;  4M9H A;  9ICT A;  7ICM A;  4YR0 A;  4A8E A;  2BPF A;  4B6J A;  4Y2Y A;  1HJP A;  2AHO B;  4NL9 A;  5AM5 A;  2V4R A;  2HDO A;  4RQ7 A;  2W04 A;  3ISD A;  3T3F A;  1ZQG A;  7ICT A;  3GV8 B;  3K4G A;  1X9W A;  1L8L A;  5ALS A;  4QW8 A;  2FMP A;  2QAR B;  2MA1 A;  5ALX A;  5AM3 A;  4OD0 A;  5ALI A;  4RT3 A;  1KTQ A;  5KFR A;  5EWF A;  3VCB A;  2OEH A;  1RXV A;  3M7D A;  4C8N A;  2PXI A;  4LVS A;  4XRH A;  3SR6 A;  3RH4 A;  3RAQ A;  4C8O A;  1ZQV A;  1JRP A;  3BS5 A;  3SZ2 A;  3M8S A;  1HIW A;  1GO3 F;  2LPE A;  2IHM A;  2DQN B;  4I27 A;  5KFO A;  2KJ9 A;  1MQ2 A;  4C4S A;  3T5K A;  1FIQ A;  4EYH B;  3DV9 A;  4B9V A;  4ELU A;  2XVT A;  1ZQZ A;  4Y2Q A;  3NTU A;  4J03 A;  5AKG A;  5KL8 B;  5AKZ A;  4R65 A;  2BDU A;  2G06 A;  4I2G A;  5KFG A;  2BCQ A;  1X6J A;  4UB5 A;  2JEI A;  1LB2 B;  9ICB A;  4PPX A;  2W8K A;  2KD1 A;  4XA5 A;  1RPL A;  4ECT A;  5F9N A;  2ES6 A;  2WB1 F;  5J0P A;  5AM0 A;  4M9G A;  5F9L A;  1ECW A;  3C1Y A;  3RB6 A;  2IA6 A;  3RF9 A;  4ICA A;  5ALG A;  5DLF A;  3LDA A;  1L5U A;  2PMZ C;  3M9N B;  4KLS A;  4YMN A;  4F8R A;  3KHG A;  4RQ3 A;  1NJW A;  4Z6D A;  5EOZ A;  4RNM A;  4ECW A;  3ED5 A;  1NK7 A;  2W8L A;  1J2N A;  3D6J A;  5BOM A;  5J0T A;  7ICV A;  1ZD4 A;  4GC7 A;  3A0B U;  4NLB A;  1Z3E B;  4Q43 A;  2W9C B;  4M04 A;  2UVW A;  8ICH A;  1EXN A;  5CJ7 A;  2A3V A;  5KG0 A;  7ICG A;  1S77 D;  3T79 A;  5JRT A;  1MC8 A;  4CNQ A;  4Y2S A;  2AJQ A;  3EW9 A;  4YG2 A;  4IR1 A;  1KEJ A;  4Q8F A;  3UQ0 A;  4DSE A;  2JEF A;  3RBE A;  4DFK A;  4IQU A;  4MHV A;  2YN4 A;  3TAQ A;  2LKY A;  3QU5 A;  5KFK A;  2LHT A;  5BPC A;  3OJU A;  2Q4T A;  4KX3 A;  1MA7 A;  4BXO B;  3F2C A;  9ICL A;  3V6K A;  5J0Y A;  2NRT A;  3AN1 A;  3TAR A;  4DL5 A;  2FPM A;  5JU5 A;  4DWI A;  2F1I A;  3NUQ A;  3PW4 A;  1COO A;  8ICT A;  5AIA A;  4XUS A;  9ICA A;  5DQH A;  4DS4 A;  2XO7 A;  1Q8K A;  2UVR A;  2WF9 A;  2C28 A;  2W03 A;  2WF5 A;  4QIW C;  5ALR A;  1DK2 A;  1T8E A;  4BX9 C;  9ICN A;  2F8L A;  5J2I A;  5DGB A;  3RTV A;  1D9F A;  1NKE A;  2BQU A;  3GV7 B;  1CUK A;  4NJ8 A;  2JV3 A;  5ALO A;  4YCX A;  1S97 A;  2YB1 A;  4XQ8 A;  1NJX A;  4MF2 A;  1ZQQ A;  1TE2 A;  1BPZ A;  2DF4 B;  5ALJ A;  2KKV A;  1DRG A;  3WK8 A;  4UAY A;  1RG6 A;  4PJ0 U;  4M2Y A;  3MGV A;  1S76 D;  2DWQ A;  4QZE A;  2LMR A;  5BOL A;  3RJG A;  9ICG A;  1S10 A;  4AYB C;  1J97 A;  2OM6 A;  3H4B A;  2EQY A;  4KLF A;  4EBE A;  5J2E A;  4FO6 A;  1SV0 A;  3K75 D;  5FP0 A;  1BPY A;  5J0Q A;  1ZET A;  5HP4 A;  3PW2 A;  2A1A A;  4UAS A;  4OJ5 A;  1NOM A;  3KKA A;  2OWO A;  3IN5 A;  3ZD9 A;  1TK8 A;  2JMG A;  5HNK A;  5AI9 A;  3JPN A;  1ZRN A;  3WK6 A;  2CRX A;  3C23 A;  1B4F A;  3C1Z A;  2E8N A;  1IIP A;  2KP7 A;  2BKE A;  5HHH A;  9ICX A;  3RJJ A;  4F5Q A;  4NXZ A;  2FJ6 A;  5IIN A;  2AGQ A;  2PFN A;  1NI3 A;  2P35 A;  3BS7 A;  1D9D A;  4I2E A;  1NK4 A;  2W3R A;  2HBM A;  4R63 A;  1V85 A;  2JZB B;  1QSY A;  3AU6 A;  5DG8 A;  3NRZ A;  1COK A;  2FLL A;  4GXJ A;  1JAL A;  4QZG A;  3ZDE A;  4QZC A;  1D8Y A;  1TAQ A;  4NL9 C;  2ALZ A;  1N48 A;  3SYZ A;  7ICK A;  3UM9 A;  3RB0 A;  3GIJ A;  1XSN A;  1Z00 B;  3UMB A;  2WAQ C;  1L3S A;  4RNN A;  2BPC A;  2JR5 A;  5KFH A;  4QWC A;  2XGQ A;  5J29 A;  4RPY A;  2WFA A;  3IG5 A;  3C5F A;  5L1J A;  5IIJ A;  4B9T A;  4QWE A;  3H0R B;  5AKX A;  3SMV A;  2ESE A;  4O3O A;  4UAV A;  1BGX T;  3QUT A;  5AI8 A;  4MEY A;  4ELT A;  2W9B A;  2HOQ A;  3QU9 A;  2E1F A;  4RU9 A;  3C5G A;  2DFL A;  7ICL A;  3C28 A;  4DQP A;  2RDJ A;  4KMU A;  2XID A;  1LKY A;  4ECV A;  3MR5 A;  3IM1 A;  1PVP A;  4ED7 A;  4P4P A;  1RYS A;  3PY8 A;  1OW5 A;  3RB4 A;  1IG6 A;  3R9K A;  1S0V A; 
#chains in the Genus database with same CATH homology
 2M0N A;  1ZQ1 C;  2RRD A;  2ZIW A;  3D2Q A;  3O0F A;  3T79 A;  2RHF A;  3ALR A;  3N7P D;  2ZIX B;  2CRX A;  2G5I B;  4IC9 A;  1Q3V A;  2KIC A;  2MA1 A;  2K8C B;  2HOF A;  3F5E A;  2G5H B;  2KEY A;  3H0M B;  1IIP A;  1A0P A;  1XO0 A;  4GFJ A;  1Q3U A;  2KJ5 A;  4BJQ A;  2H3V A;  1A6S A;  4P0P B;  2HBJ A;  3VCB A;  2VJ5 A;  3F5A A;  2VKQ A;  3M7D A;  2H3Z A;  3PST A;  5HR7 A;  2JHD A;  2YX8 A;  4U7C A;  1F44 A;  4BUG A;  2LKY A;  2R18 A;  2HBK A;  2XIC A;  2KHQ A;  3CP8 A;  2LHT A;  2VJ4 A;  2KIW A;  2Q4T A;  3AQE A;  4KX3 A;  4PL1 A;  2YB4 A;  3DEE A;  4NV0 A;  3F2C A;  1MA7 A;  2F2A B;  2HBM A;  4P0Q B;  1PVQ A;  1XNS A;  3L3F X;  1HIW A;  2K89 A;  3F2D A;  3PZP A;  1GO3 F;  2LYA A;  4CDG A;  2DQN B;  2HBL A;  4OJP A;  4QNL A;  2ZXI A;  2KJ9 A;  2CN1 A;  3F2B A;  1ED1 A;  4P0P A;  1UPH A;  3NUQ A;  2ZG6 A;  3PSP A;  4CRX A;  1T94 A;  1TAM A;  2F77 X;  2JH7 A;  3F53 A;  2LYB A;  4FE3 A;  4U6P A;  2ZIW B;  3RFA A;  2XVT A;  3N7S C;  2DGZ A;  3HKZ C;  3SAG A;  3N7R C;  2ZIX A;  5CRX A;  1D8B A;  2D6F C;  2GOL A;  2W03 A;  2F76 X;  5KL8 B;  1OUQ A;  5HR6 A;  1Z1B A;  4QIW C;  4OJL A;  2K8A A;  2BDU A;  1CRX A;  4OO1 J;  3HKZ F;  4ACO A;  4NLC A;  3CYM A;  2JGA A;  2G06 A;  3CRX A;  4WJ3 B;  4FZL A;  3ONN A;  2N1R A;  1PVR A;  2WAQ C;  4FZN A;  2W7P A;  5C0Y A;  3KZX A;  2VIX A;  3D2N A;  3H0L B;  2F8L A;  4BX9 C;  2ZIU A;  3LVW A;  3AL0 B;  2KV2 A;  3M6Z A;  3IG8 A;  4O3M A;  2KD1 A;  2W7O A;  2ZXH A;  2WAQ F;  3IG5 A;  3LYS A;  2G0A A;  3ICX A;  2E1E A;  2NV3 A;  2YB1 A;  2WB1 F;  4NWI A;  2RP5 A;  3OPX A;  4AYB F;  3IP4 B;  3H0R B;  2GH1 A;  2DF4 B;  3PSI A;  3SMV A;  1ECW A;  2KKV A;  3VC8 A;  4KX5 A;  2PMZ F;  4JMU A;  1DRG A;  2HMX A;  3AQF A;  3SAF A;  2WB1 C;  2HOI A;  3RF9 A;  2G07 A;  4ICA A;  3MGV A;  3SQI A;  3E0F A;  2OXO A;  2H3I A;  2PMZ C;  1L6N A;  2K4E A;  2H3F A;  2OH2 A;  1URJ A;  2G09 A;  2K4I A;  2Y0S F;  4AYB C;  1SZH A;  2KOB A;  2K4H A;  2KHV A;  4PL2 A;  2HOQ A;  2G08 A;  1YT3 A;  2OM6 A;  3NRW A;  4OJO A;  1WUD A;  2OYY A;  2E1F A;  2CPR A;  2KKP A;  2XI9 A;  4OJ6 A;  2Y0S C;  2MRL A;  2Z7J A;  1HEK A;  3GU3 A;  3LVV A;  4A8E A;  3C28 A;  1Z19 A;  1NZB A;  1KBU A;  4CGZ A;  3D2S A;  2XID A;  2K8B B;  5KL1 B;  3SAH A;  5A0L A;  4KMO B;  5T14 A;  4NLB A;  3PSF A;  2H3Q A;  2LBO A;  3C29 A;  3K1Z A;  1PVP A;  3GZF A;  2KJ8 A;  2KNJ A;  2ZIU B;  4OJ5 A;  4C0Z A;  4QIW F;  3KFU F;  1P7D A;  2E5S A;  2ZIV A;  2ZIV B;  2W04 A;  2JH1 A;  3IN5 A;  2JMG A;  2KVC A;  4FZM A;  4QJF B;  4P0Q A;  3M6K A;  2A3V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...