2RHFA

D. radiodurans recq hrdc domain 3
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
76
structure length
76
Chain Sequence
SHNADLSEALRELRRELMKETGYSAFVVFTNATLEALAARQPRTLAELAEVPGLGEKRIEAYGERILDAINTVLDG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure and function of the regulatory C-terminal HRDC domain from Deinococcus radiodurans RecQ.
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Hydrolase
molecule keywords DNA helicase RecQ
total genus 27
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2007-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00570 HRDC HRDC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.80 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2rhfA00
3CYMA 4CGZA 2HBMA 2DGZA 2E1FA 4QIWF 2HBJA 3SAGA 4OO1J 1GO3F 2E1EA 1D8BA 4NLCA 4CDGA 3SAFA 2MA1A 4NLBA 4QJFB 3SAHA 4O3MA 5C0YA 2RHFA 2CPRA 2HBKA 1YT3A 1WUDA 2RRDA 2KV2A 2HBLA
chains in the Genus database with same CATH superfamily
1L7OA 5J2HA 1SGGA 2DGZA 3NUQA 1YZ7A 1X66A 5DDMA 1L3UA 1Z4NA 4P0PA 3IHQB 3EW9A 3OSNA 3NVVA 1BPZA 3ZDBA 4O3SA 3WKDA 2C22A 3HWTA 4C0ZA 3QXGA 3PSFA 4GC7A 2KJ5A 5J0PA 4YR2A 4B6JA 2DBYA 4M9LA 2GH1A 2Y1JA 4J9RA 2H3FA 1WCNA 4EX6A 3HX0A 1IIPA 4UW9A 4IC9A 8ICHA 3QNMA 3KKAA 1ZQDA 2K4PA 4PJ0U 4FS1A 4CRXA 1T7PA 4TQRA 2HHVA 4JWNA 2NRZA 2FMQA 2YMLA 1YT3A 5HNKA 1FFVA 4JUZA 4IQWA 3PMLA 1YZ6A 4U7CA 5ALHA 4RZRA 2JGAA 1BPBA 4M6WA 5EE0A 3WK9A 3AM9A 4XUSA 2V4RA 1SL2A 4I2DA 9ICVA 3GIJA 4MF2A 4ED8A 3LDAA 1ZQJA 9ICHA 3D2NA 3HP6A 1KKXA 4QWCA 3IG8A 3KHGA 2AQ0A 3PVXA 1J2NA 4ECXA 1PUZA 4C8OA 4I2CA 1HUOA 4EX7A 2HI0A 4Q8FA 4BGDA 2K4HA 1KQQA 2HVHA 3ISDA 1NI3A 2P35A 3PR5B 4OCZA 4ZOHC 1ZQLA 1ZQBA 3RF9A 1BNOA 2W9CA 3PSIA 2E8NA 2XY7A 2KHVA 1MQ3A 1JUDA 1J2MA 4XRHA 3F2BA 9ICQA 4NY8A 2LBOA 2C2DA 2LYAA 3G6YA 2XI9A 5DBAA 2W9AA 1OXJA 4IQTA 2W9BA 1B4FA 3M9MB 4NLZA 5ALGA 4NM2A 5AKEA 1IG6A 2KN7A 2W9MA 4C80A 5CJ7A 1SB3C 7ICGA 4RQ1A 3MFIA 1F44A 5F3XB 3M8RA 2LM1A 3GQCA 1X6IA 1JX4A 4I2JA 4MFCA 3MR5A 3C5GA 2ZTCA 2J6TA 2W11A 4J9KA 4RQ8A 3RAXA 5GTIU 4NL9A 4DFDA 5DB9A 4ECUA 1JROA 1TFRA 1T4GA 4QWEA 2NRVA 5AI6A 2DPIA 4ACOA 1KTQA 1O03A 2Q4TA 1FEZA 5EWFA 3T79A 2PKEA 1O08A 4RQ6A 3JPPA 2R8GA 1ZQYA 7ICVA 1K5OA 1KBUA 2DF4B 4DQPA 2EZZA 5CRXA 5KT3A 1A6SA 3M8SA 3WK4A 5T14A 2H3IA 1U4BA 3RRHA 2G07A 2KZMA 9ICPA 4WJ3B 2LYHA 3FDSA 5HHHA 3SAGA 2OWOA 1VLBA 1ZQHA 4NLBA 2IHMA 5AKZA 5BOLA 5C0YA 3V7LA 3RH5A 4F4YA 3QU7A 1JMSA 4UARA 4UB4A 1ZQTA 1WWUA 5J8YC 2BCSA 3CYMA 4BJQA 1MQ2A 4JV2A 3PMNA 2VIXA 5KFAA 4R65A 2W54A 5KT4A 7ICLA 3BQTA 4USAA 3H7IA 4IR1A 4IRCA 2EAMA 4RNNA 4DQRA 2FLNA 1N60A 1X9SA 1HEKA 3M9OB 3TADA 4DEZA 2HW3A 1WYGA 2EH9A 3BQ0A 2OCEA 2LPEA 2KFNA 4LZDA 5ALKA 5B5EU 3H4DA 4UBCA 1PK1B 4ECRA 1JALA 2ZJ8A 1RYUA 3C21A 3ISCA 1BPEA 4QZFA 4O3PA 2EQYA 1SZPA 4DF8A 3ONNA 3HILA 3GDXA 4UB8U 2I1QA 3M6KA 4R63A 5C5JA 8ICFA 3V6KA 4PGYA 8ICOA 1LVHA 2MSNA 1N5XA 1U9LA 5AHXA 4QWDA 5J8YA 4M9GA 4I2GA 2K4IA 4KLFA 1PVPA 1V9PA 2A1AA 4J9LA 5L1LA 5KFRA 5J2DA 4RQ2A 1S9FA 2C2RA 3WKCA 1S10A 5J29A 4AYBF 5ALVA 3M1YA 1P7DA 1XC9A 3SAFA 2E8OA 1U49A 2IMWP 1TE2A 2BCVA 2KP7A 3L5KA 4DF4A 3SV4A 3GZFA 4DWIA 3I1YA 2B21A 2WFAA 4K4IA 1K1QA 2DQNB 2M0NA 3TKAA 4PL1A 1D8YA 4F72A 4Q44A 4OJOA 3MGIA 1RYRA 7ICUA 2ZIUB 2BCRA 3E2EA 4O5CA 3K1RB 4DFMA 2AH5A 5CWRA 5AK6A 2A1JA 5J2CA 3PSPA 5KAIU 2BCUA 4ICAA 2KV2A 3PO5A 1N48A 7ICSA 2WAQC 4DOCA 2OH2A 5DQHA 5KFGA 1CRXA 3V7JA 9ICCA 3UMBA 1ZJNA 1HUZA 5TZVA 5DKWA 1SKRA 5AM1A 2I5HA 1KEJA 1N56A 3S6JA 2ASDA 2ZXHA 4ED0A 8ICUA 3K1ZA 3EYZA 2EZYA 2PI4A 2H3QA 4YVZA 2FPKA 1UT5A 5J2GA 2EDUA 1QSLA 4F2SA 5BPCA 5CHGA 1Z19A 4Q8EA 8ICEA 1H38A 2FJ6A 1RZTA 1KFDA 5AM2A 4MHVA 1U48A 2HHTA 3DEEA 2XY6A 1QSSA 1SKSA 1EXNA 4MEYA 2IBKA 4RPXA 4YMOA 8ICZA 3AQEA 3QU5A 1ZRNA 5KT6A 5DGAA 7ICFA 1UPHA 2W43A 1XO1A 4EYIB 1KDHA 2KE7A 3OTQA 2ES6A 2KSOA 2K4EA 2W7OA 4MF8A 7ICJA 3LK9A 2WTFA 1QSYA 3KZIU 1NK5A 2OEHA 4CF4A 4JV1A 1V97A 4C4SA 4F3OA 4J9OA 1LKYB 3EWAA 4R8UB 1X9WA 3BS5A 2PFPA 1S76D 4DQIA 2L5YA 3T3FA 4DFPA 5KG5A 4CF3A 4JK1A 1COKA 1A76A 2BGWA 4Y2PA 4G3IA 3RJFA 4IR9A 3IP4B 2HHWA 2KEYA 4KMUA 5KFIA 3WU2U 4KMOB 3M7DA 4M9JA 1DGSA 4QZDA 3RBDA 9ICOA 4HAIA 5J0RA 9ICBA 4DSFA 4P0PB 1RDFA 4P4MA 5J2BA 3PW0A 5IIIA 4DL6A 4KLJA 4NJ8A 2MUTB 3HKZF 4KLLA 1J97A 2V4QA 1S0OA 5ALFA 5AM4A 1T8EA 3TI0A 1CEZA 2MUTA 8ICWA 3WKAA 5D46A 3C2KA 2ASJA 2W55A 1UCVA 1WG8A 1SV0A 5KT5A 1A0PA 5KFUA 1Q3VA 1TAMA 3OSPA 2NO5A 3FAHA 3F5AA 3RJHA 2ZUDA 8ICLA 5AKHA 4XQ8A 2JZBA 4YXJA 4EBDA 4U6PA 3SD7A 1X40A 2DFLA 3BJYA 3AQFA 5J0XA 4HYKA 2HBJA 2XCPA 4EZ6A 5AIBA 1PVQA 3JPSA 3JPTA 1SZHA 2WHEA 1Q46A 3ORYA 1S97A 1ZOLA 4RQMA 3V6JA 5KG3A 3ZDAA 9ICAA 3EPGA 4F5OA 3H0RB 2FPMA 2ISOA 2FMPA 3JPNA 4EBEA 1FIQA 5J2FA 3N4MB 3C2MA 1HIWA 4Y2QA 3PX0A 2I9GA 3FC4A 3ETLA 1SXDA 5EE1A 3GV8B 1C20A 4P4PA 4KLMA 3PX6A 1QTMA 2XVTA 4J9MA 1V38A 4ECVA 9ICXA 2G5HB 3AU2A 4G9BA 4JV0A 2R8KA 3ZDEA 1S0VA 3V72A 7ICTA 1SV4A 5AI8A 2RDJA 3NVYA 4ED3A 3MDCA 3K75D 5AIAA 5FP0A 5AI4A 5KFQA 2K89A 4RQ5A 1JRPA 4EELA 2KMDA 4Z6CA 4C7YA 3PW2A 4FZLA 2AU0A 1NK7A 4GXIA 4DFKA 4QZHA 1DRGA 8ICRA 4RUAA 4ECZA 1DOQA 5AI0A 4PHEA 1N5WA 2YTUA 3BQ2A 2F8KA 3BQ1A 5KG0A 7ICNA 5DG9A 3A0BU 1T94A 1NK9A 2BHNA 1SV0C 5J2EA 1OUQA 4B9NA 3PW7A 4FZMA 3HRDD 2W3SA 4ED1A 2ODGA 1NOMA 2HMXA 1DK3A 4RNOA 4Y2JA 2XO7A 4YFKA 2BZFA 2F3NA 4F93B 3UXPA 2F1JA 4B9UA 1ZQSA 4RQ0A 3SAHA 9ICUA 2CPRA 2BQUA 2HBKA 3RJJA 5CEHA 1JXLA 3LWLA 1FO4A 1SIJA 3T5HA 2KZ3A 3PNCA 5DGBA 5CP2A 1B43A 4DL5A 1MN8A 2LM4A 4C8KA 4QZAA 2ZIWA 4JWMA 5HHIA 5G5GA 2EANA 2A1JB 5L1JA 4EEYA 8ICBA 2JEJA 4I2AA 3SYZA 2ZUCA 5TISU 1LB2B 2O6KA 8ICQA 4UATA 5IIOA 8ICTA 2RRDA 1KLNA 1UT8A 3UM9A 2MU2A 2XCAA 4F2RA 4DOBA 2KZZA 4FZNA 3HKZC 4NLCA 4ED2A 4QW9A 3LVVA 2Q0ZX 4RQ3A 5KFEA 4Y2VA 2WAQF 2BPFA 4QZGA 3OJSA 1KSPA 4IRDA 4I2BA 3KBBA 2ZIVA 2DL0A 4NV0A 1UQVA 4JMUA 4EEKA 4I2HA 2KFZA 1X2IA 1N62A 3H8JA 4UQGA 2YN4A 2DKXA 1RYSA 1LKYA 1S0MA 2UVUA 3EPIA 1S77D 1JI7A 5KFOA 3RR7A 5ALNA 1QLNA 4NLGA 3F5EA 8ICMA 2KICA 2W9CB 2J6SA 5CR0A 4ED6A 3GV5B 4ELTA 2FDRA 3KOOA 4UAVA 2AQ4A 4DLEA 2ZIXB 1SWVA 5DB8A 3ALRA 1NKBA 4KLSA 2XICA 2HOQA 1KFSA 5AICA 2YB4A 1TV9A 5J2IA 3ISBA 4ELUA 1KN5A 4I2FA 1DK2A 1L7PA 4OJPA 5J0YA 3JPOA 2EAOA 1MSWD 2QB0B 2AXTU 2W03A 5KFYA 3B0XA 1L6NA 4QJFB 3IV6A 9ICJA 5KG2A 4DS5A 4F5PA 4J9QA 4UAWA 3NASA 1S8OA 1HJPA 1SL0A 1ZQVA 5KFPA 1XS9D 5E79U 4B9LA 2WF6A 4DSEA 1TK8A 1PVRA 1ED1A 4KN7A 5D4BA 7ICOA 1CI4A 2G09A 3QE9Y 3Q8RB 1DXSA 2JEFA 2G08A 3NRWA 2G5IB 5ALDA 2H3ZA 1NKEA 1A77A 2GO7A 4I27A 3Q8LA 4OD0A 3Q8MA 4Y2YA 4ZH4A 4QIWC 2F8LA 3IM1A 3AMZA 1OW5A 3C28A 1RM6C 3MFHA 2HHQA 2VA3A 2H3VA 3RH6A 3IDWA 3CP8A 4QWAA 4NM1A 9ICWA 4FBTA 2ZIUA 1BPYA 7ICPA 4KLEA 2UVWA 4DO9A 3O0FA 4KLDA 4KITB 3HW8A 3RFAA 3B9JA 1L7MA 1SL1A 4NLNA 5ALUA 3KHHA 1ZQXA 5L9XA 5ALQA 4ECWA 4NLKA 2QARA 7ICEA 5J2JA 2HHUA 4XA5A 2PFOA 2DUYA 2E8MA 3TAQA 1ZQZA 3KD3A 2NYVA 3K4GA 4LJXA 4FO6A 4DL2A 3MR2A 2YQEA 5KFNA 3L4PA 2RHFA 3SZ2A 5KG1A 4UB3A 1L3SA 5G5HA 3H0LB 5KFJA 4RPYA 2HOIA 3OGUA 4IS7A 8ICKA 2D6FC 3MDAA 5AI9A 2E8PA 1ZD4A 1Z00A 1D8LA 2BQ3A 2F44A 5DQIA 1Z4OA 2I6XA 1VJ5A 4DS4A 4LZGA 5KFLA 1BNPA 5AKXA 1NZBA 5HR7A 3AU6A 2ZXIA 5A0LA 2VANA 4UB5A 5AKYA 3RB6A 4DSKA 1ZQKA 4ECYA 4P4OA 5J2KA 3I28A 2Y9UA 4F4WA 4TURA 1NJXA 2W7PA 1BPDA 5KFCA 2KOBA 8ICJA 3IN5A 4QIWF 4OJ5A 5F9NA 3EZ5A 5ALXA 3I76A 3KZXA 2Y0SF 3PSTA 2IOFA 4PH5A 1UA0A 2Y0SC 1ZQUA 3QX7A 1RXWA 4FFDA 1Q3UA 4Z6DA 1QQ6A 2K60A 3A0HU 9ICKA 1S5LU 2N1RA 4QZCA 2A3VA 5J0TA 3TFRA 2HBMA 4F91B 2LYBA 2IOFK 4DQQA 4OJ6A 4PHPA 4F50A 2NV3A 3UXNA 2VKQA 2MA1A 3IRUA 4GC6A 9ICFA 3KHRA 1SKWA 2JXJA 1ZQOA 2GLEA 2ZTEA 2IHNA 2HHSA 3PX4A 4JB3A 1BGXT 2YX8A 2UVRA 3PY8A 4P0QB 1F5SA 2W8LA 1ZD2P 1L8LA 2ZTDA 7ICQA 1TAUA 3T5KA 2BPCA 2FLPA 4PHAA 4A8EA 4Z6FA 5GTHU 2WF8A 4YN4A 8ICPA 3TFSA 3RRGA 2AGPA 1TKDA 1KW4A 2DWQA 1KL9A 4CDGA 8ICIA 4B9VA 2LMRA 4O3MA 4TUQA 5AM3A 4RT3A 4KTQA 3BS7A 4UAYA 4YD1A 4KN4A 4PGQA 4US9A 4ECQA 3KHLA 1ZETA 2RP5A 3TAPA 3QU2A 2Y1IA 3FYHA 4DQSA 2NRWA 8ICCA 3R9KA 5EOZA 4M2YA 1XWLA 4I2IA 4YMNA 4C4TA 2AGQA 4EZ9A 2CXYA 4R64A 2AHOB 2JH1A 3MABA 4Q45A 3SV3A 3H8MA 4I29A 1XSPA 4QNLA 2KD1A 4UB1A 3G6XA 5DG7A 2K8BB 3UXOA 2VA8A 3H40A 4J9SA 3H8SA 3IG5A 4KX5A 3F2DA 7ICIA 4QW8A 2OXOA 5CB1A 3M9NB 1X9XA 3N7PD 5DLGA 2KJ8A 4QZIA 2OYYA 1MC8A 3WK5A 2XGPA 3PV8A 3GV7B 4O9MA 2XIDA 2KIWA 9ICRA 5EWGA 2FI1A 4YCXA 3GIMA 2R8JA 2MRLA 4YQWA 3QU4A 4EENA 3OJUA 4DL4A 2WF7A 2G0AA 3GU3A 2C2EA 5KG6A 5KFFA 2A19A 3UMGA 3ZDDA 5KFMA 2JH7A 5IIKA 2E1FA 5KFBA 4Z6EA 1ZQIA 4CCHA 4M6WB 3TARA 3AN1A 3FM9A 4IQVA 4M9HA 4F4XA 3SQIA 4Y2TA 3N7SC 4DL7A 3UPQA 8ICNA 1ZJMA 2ALZA 2GWSA 1QCKA 3MBYA 3T5LA 2PI5A 4F92B 2KIVA 2QARB 2ZIXA 1AQ6A 3B0YA 2G06A 3PW4A 1AROP 3RB0A 5ALRA 2W9BB 1RQLA 2B0CA 3UQ0A 5ALWA 1L8OA 2W04A 3PZPA 3RJEA 3RB3A 1NK4A 4K4GA 3Q8KA 7ICMA 3RR8A 3H4BA 4PHDA 4BDPA 1COOA 3PR4A 1GO3F 2JR5A 1SXEA 2JMGA 2D3DA 5KFXA 1ZQMA 5L1MA 1T3NA 3BDPA 2PFQA 4KLQA 2JZBB 1FFUA 1T3QA 5BOMA 4F5QA 5KL8B 5ALJA 3MR6A 3F2CA 5AKKA 2XGQA 1D9DA 5ALMA 3UQ2A 4TQSA 5KG4A 5JTIA 1Z1VA 1ZYQA 1RQNA 5DDYA 3SENA 4Y2UA 3MR3A 1NZPA 3WK7A 2PMZF 9ICMA 3TACB 2ZIWB 1XNSA 3VCBA 3DV9A 4FE3A 3NS1A 4F8RA 5DQGA 3LVWA 1XSNA 5HMLA 2ISPA 1ECWA 3E58A 5AKJA 3ETRA 4C8MA 4CGZA 5J0OA 3RJIA 3G6VA 3Q8QB 1N61A 2WB1F 5EWEA 3RB4A 2PXIA 3D2SA 1UA1A 3CRXA 4KLIA 2DPJA 4LVSA 2KJ9A 2F1HA 3GIKA 1X9MA 2KTQA 2EZXA 2YMPA 4MFAA 7ICKA 3D2QA 5EE9A 2BDUA 1IV8A 5IIJA 2ZJAA 4GFJA 2P6RA 2C28A 4B9TA 2ESEA 2R8HA 4KLGA 2KK0A 2KSOB 1ZQQA 2YB1A 1IXRA 2P66A 9ICSA 5KT7A 2P6UA 1URJA 3RBEA 1ZQCA 4RT2A 1Z1BA 1MA7A 4RQ7A 5J0UA 4DOAA 3KFUF 4C4RA 3TANA 3AEVA 4BWMA 1VDVA 3V7KA 2RDIA 1UHUA 4YR0A 3Q8SB 4K4HA 3CW2C 2XY5A 5KFHA 5IIMA 1L5UA 2QKQA 2E3TA 5F9LA 4X5VA 3ICXA 4PPXA 3GFKB 4J03A 9ICIA 3QZ8A 3T5JA 4YMMA 4BWJA 7ICRA 1L7NA 2Z7JA 7ICHA 4ECSA 9ICGA 1Q8KA 2J6UA 2OHFA 2Y9TA 4QWBA 4UASA 1C7YA 4YD2A 4P0QA 5B66U 5H2FU 4EYHB 2BCQA 5AK4A 1ZQRA 5AK3A 2HOFA 4RU9A 2HVIA 8ICVA 3UMCA 4KX3A 4M9NA 1TVAA 3M6ZA 4B9SA 5J0SA 3BZCA 2RLTA 5ALOA 5IINA 1CUKA 3C1ZA 3MC1A 3GIIA 5J2AA 1X6JA 4O3QA 1B22A 2AJQA 2HDOA 1D8BA 1TK5A 3HPOA 2W3RA 2LI6A 4J9PA 4BUGA 3Q8PB 3RTVA 4BXOA 1WUDA 4E0DA 2FE9A 3OHBA 1X42A 1N2XA 4NL9C 4R8UA 5L1IA 3LWMA 2M9NA 3QUQA 4RQNA 4J9NA 2BPGA 1ZRMA 3MGVA 5AKIA 2MAXA 3KKAC 4UAUA 2IA6A 9ICEA 3C23A 2E5SA 3WK6A 5AKGA 4UAZA 2PMZC 2KVCA 2JRZA 3H0MB 3SR6A 4UB6U 3U26A 3C2LA 2FPLA 2QB1A 5AI5A 3QEBZ 2JHDA 4DCCA 3E0FA 4O0IA 3QUTA 4DSLA 4Y2XA 5ALPA 2YMQA 3SI8A 4RNMA 1F0MA 3WKBA 1ZQWA 3C5FA 3OHAA 3WK8A 5ALEA 4UB2A 2NRTA 5IILA 5HR6A 2NO4A 1NJZA 1L3VA 5HP4A 3D6JA 5ALIA 4C8LA 5DB7A 2YMMA 1JIHA 5DBBA 3AL0B 5JU5A 4P2HA 3CNHA 3KTQA 1QQ7A 1ZQPA 1WWVA 4M47A 1RXVA 4GXKA 4ELVA 2XC9A 1Z00B 2EAPA 3C29A 2ZUBA 2VA2A 3LYSA 5J0WA 3HT3A 3THVA 2BKEA 2F76X 4GIBA 9ICTA 5JUMA 4DL3A 5L1KA 4I2EA 3V6HA 5KFWA 2HSZA 2F2AB 3AUOA 2H5XA 1XSLA 3EUB2 1ZXIA 2JEGA 5KG7A 4IL6U 1ZD3A 4KLUA 2K8CB 2RQ5A 1NNLA 2CRXA 2GOLA 4MEXA 4M0AA 2PFNA 5AKLA 3PO4A 4DSJA 4YG2A 4YXMA 4RPZA 3JPQA 1L3TA 1IM4A 4PL2A 4PZOA 2KKPA 1ZQ1C 2W8KA 4BX9C 2KNJA 9ICNA 5DB6A 1TK0A 4Y2RA 2KG5A 4CE6A 2FMSA 2F77X 3PW5A 1V85A 2HBLA 1XU4A 3H8WA 5JRTA 3HJEA 3ZD9A 4YP3A 1BPXA 2ZJ5A 1S0NA 4O5EA 1M6YA 1ZQNA 5AM0A 5KNIA 1NKCA 2ZG6A 4GLXA 4AP9A 4GXJA 1N63A 1ZQAA 2WF5A 4QZEA 2IOHA 5DG8A 2JEIA 4FS2A 2AGOA 2HHXA 3RH4A 5KFSA 2KHQA 3N28A 4Q43A 4NWIA 5KFVA 4QZBA 4F5RA 4M04A 3QEAZ 4O5KA 4CNQA 4IRKA 3C1YA 4UBBA 5DLFA 4CF5A 4R66A 4KLTA 2NRXA 4NXZA 5AK5A 2WB1C 1U47A 8ICSA 3QYPA 4BXOB 8ICXA 3N7RC 5HMMA 1ZQGA 3BQ7A 4PGXA 4RQ4A 3JPRA 3NGDA 2QLTA 1BVSA 4PZNA 3QUBA 3DDHA 2LHTA 2K8AA 4ECTA 5ALSA 3BS5B 3TADC 2R8IA 2KKVA 1B0XA 4QZ9A 5D49A 1QQ5A 4RUCA 1ZD5A 4F5NA 2CN1A 2D8CA 3N97B 1JN3A 5DBCA 4OO1J 2DKZA 4DFJA 4O3OA 4FBUA 4F4ZA 3MGHA 3QZ7A 1PZNA 2JV3A 1KFTA 4MFFA 5KFTA 3RJKA 4EBCA 1JXEA 2LKYA 1K1SA 1SWWA 3SMVA 1PK3A 3QU9A 2QB0A 3J81j 4C7ZA 4IQUA 5ALLA 3ED5A 1XO0A 1PK1A 1ZQFA 1U45A 5ALYA 4B9MA 4QZ8A 5KAFU 2ZIVB 1ZQEA 2BQRA 5KL1B 5ALZA 5J0QA 2ATLA 3GILA 4YR3A 3NVZA 5ALTA 3ZD8A 2FLLA 5KFKA 4DSIA 2OM6A 1LV5A 5KT2A 2BDPA 5AM5A 8ICGA 5KFDA 1NK0A 3ZI4A 4US8A 5KTQA 1DGJA 4ED7A 5KFZA 8ICYA 3NRZA 1WCLA 2WF9A 4I28A 1NK6A 1D9FA 4O3RA 1RPLA 4Y2SA 2B6GA 1Z3EB 1RG6A 5K4LA 3WKEA 1KRPA 2E1EA 3L3FX 3NVWA 1QH9A 4OJLA 4KLHA 3ZDCA 2HCFA 3VC8A 1TAQA 3RJGA 2BR0A 3QUCA 3SEIA 5EE3A 3NTUA 4AYBC 4O3NA 3F53A 1NJWA 4KLOA 2V9WA 4F4KA 3BZKA 4TUPA 4TUSA 8ICAA 2VJ5A 2UVVA 1NJYA 2R18A 4F71A 4C8NA 2ASLA 1Y88A 2YY6A 3TQ1A 3RAQA 2VJ4A 2KVSA 9ICLA 1NK8A 2F1IA 4DLGA 5CA7A 3OPXA
chains in the Genus database with same CATH topology
2KHVA 3CYMA 4BJQA 2OXOA 2HBMA 3ICXA 4OJPA 3F2BA 2DGZA 3NUQA 1XO0A 2LYBA 2JHDA 2DQNB 2M0NA 3E0FA 2LBOA 3N7PD 4OJ6A 4P0PA 4PL1A 2LYAA 2KJ8A 2VIXA 2W03A 2ZIWA 4OJOA 2NV3A 2XI9A 1HIWA 2VKQA 2ZIVB 2PMZF 2ZIUB 2OYYA 2MA1A 1L6NA 4QJFB 2Z7JA 5KL1B 2ZIWB 2XIDA 4C0ZA 2KIWA 3VCBA 1XNSA 4FE3A 3PSFA 2RHFA 2MRLA 2ZG6A 3PSPA 2XVTA 2KJ5A 2G0AA 3LVWA 5HR6A 2RRDA 3GU3A 3H0LB 4ICAA 1ECWA 4P0QA 2KV2A 2GH1A 1HEKA 2H3FA 2G5HB 2A3VA 3IP4B 2WAQC 4CGZA 2KEYA 2YX8A 2OM6A 2OH2A 4P0QB 4KMOB 3MGVA 1IIPA 2JH7A 2E1FA 1CRXA 2HOFA 4IC9A 1F44A 3M7DA 2HOIA 3AL0B 2D6FC 2KHQA 4FZNA 4NWIA 1PVRA 3HKZC 2WB1F 4NLCA 4P0PB 4KX3A 3LVVA 1ED1A 4CRXA 3M6ZA 2G09A 2WAQF 3SQIA 3D2SA 2K89A 3N7SC 2G08A 3NRWA 2ZIVA 4A8EA 3C29A 3CRXA 2G5IB 2H3ZA 4NV0A 3LYSA 1YT3A 3HKZF 2ZXHA 2WB1C 4FZLA 4JMUA 2KJ9A 3K1ZA 4U7CA 1NZBA 2F76X 2JGAA 3ONNA 2H3QA 1DRGA 3N7RC 5HR7A 3M6KA 4ACOA 2ZXIA 2ZIXA 2E1EA 5A0LA 3L3FX 2Q4TA 2G06A 3T79A 1D8BA 3D2QA 2F2AB 1A0PA 2BDUA 4CDGA 1Q3VA 1TAMA 4OJLA 3F5AA 2LHTA 4GFJA 1Z19A 4O3MA 2K8AA 3VC8A 1KBUA 4QIWC 1T94A 2DF4B 2F8LA 2YB1A 4BUGA 2W04A 1OUQA 5CRXA 1A6SA 2K4IA 3C28A 2K8CB 2KKVA 2CRXA 3DEEA 2RP5A 2GOLA 2W7PA 4U6PA 4FZMA 3PZPA 1PVPA 1WUDA 2H3IA 3D2NA 2H3VA 3F5EA 1URJA 2G07A 5T14A 2KICA 2KOBA 3IG8A 4AYBC 3CP8A 1Z1BA 1MA7A 4WJ3B 3F53A 3IN5A 2HMXA 2CN1A 2ZIUA 3AQFA 3F2CA 4QIWF 2HBJA 3SAGA 3KFUF 4OO1J 1GO3F 4OJ5A 3AQEA 4AYBF 2JMGA 1PVQA 1SZHA 1P7DA 3O0FA 2ZIXB 4PL2A 3SAFA 3KZXA 2VJ5A 2Y0SF 3PSTA 4NLBA 1UPHA 2JH1A 2K4HA 3ALRA 2KKPA 2R18A 3RFAA 4QNLA 2KD1A 1ZQ1C 3SAHA 2XICA 2HOQA 2Y0SC 2YB4A 2LKYA 4BX9C 5C0YA 2E5SA 2KNJA 2CPRA 2VJ4A 3RF9A 3SMVA 1Q3UA 2K8BB 2K4EA 3GZFA 2HBKA 2W7OA 3PSIA 3IG5A 5KL8B 4KX5A 2PMZC 2KVCA 3F2DA 2F77X 3H0MB 3OPXA 2N1RA 3H0RB 2HBLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CYM A;  4CGZ A;  2HBM A;  2DGZ A;  2E1F A;  4QIW F;  2HBJ A;  3SAG A;  4OO1 J;  1GO3 F;  2E1E A;  1D8B A;  4NLC A;  4CDG A;  3SAF A;  2MA1 A;  4NLB A;  4QJF B;  3SAH A;  4O3M A;  5C0Y A;  2RHF A;  2CPR A;  2HBK A;  1YT3 A;  1WUD A;  2RRD A;  2KV2 A;  2HBL A; 
#chains in the Genus database with same CATH topology
 1L7O A;  5J2H A;  1SGG A;  2DGZ A;  3NUQ A;  1YZ7 A;  1X66 A;  5DDM A;  1L3U A;  1Z4N A;  4P0P A;  3IHQ B;  3EW9 A;  3OSN A;  3NVV A;  1BPZ A;  3ZDB A;  4O3S A;  3WKD A;  2C22 A;  3HWT A;  4C0Z A;  3QXG A;  3PSF A;  4GC7 A;  2KJ5 A;  5J0P A;  4YR2 A;  4B6J A;  2DBY A;  4M9L A;  2GH1 A;  2Y1J A;  4J9R A;  2H3F A;  1WCN A;  4EX6 A;  3HX0 A;  1IIP A;  4UW9 A;  4IC9 A;  8ICH A;  3QNM A;  3KKA A;  1ZQD A;  2K4P A;  4PJ0 U;  4FS1 A;  4CRX A;  1T7P A;  4TQR A;  2HHV A;  4JWN A;  2NRZ A;  2FMQ A;  2YML A;  1YT3 A;  5HNK A;  1FFV A;  4JUZ A;  4IQW A;  3PML A;  1YZ6 A;  4U7C A;  5ALH A;  4RZR A;  2JGA A;  1BPB A;  4M6W A;  5EE0 A;  3WK9 A;  3AM9 A;  4XUS A;  2V4R A;  1SL2 A;  4I2D A;  9ICV A;  3GIJ A;  4MF2 A;  4ED8 A;  3LDA A;  1ZQJ A;  9ICH A;  3D2N A;  3HP6 A;  1KKX A;  4QWC A;  3IG8 A;  3KHG A;  2AQ0 A;  3PVX A;  1J2N A;  4ECX A;  1PUZ A;  4C8O A;  4I2C A;  1HUO A;  4EX7 A;  2HI0 A;  4Q8F A;  4BGD A;  2K4H A;  1KQQ A;  2HVH A;  3ISD A;  1NI3 A;  2P35 A;  3PR5 B;  4OCZ A;  4ZOH C;  1ZQL A;  1ZQB A;  3RF9 A;  1BNO A;  2W9C A;  3PSI A;  2E8N A;  2XY7 A;  2KHV A;  1MQ3 A;  1JUD A;  1J2M A;  4XRH A;  3F2B A;  9ICQ A;  4NY8 A;  2LBO A;  2C2D A;  2LYA A;  3G6Y A;  2XI9 A;  5DBA A;  2W9A A;  1OXJ A;  4IQT A;  2W9B A;  1B4F A;  3M9M B;  4NLZ A;  5ALG A;  4NM2 A;  5AKE A;  1IG6 A;  2KN7 A;  2W9M A;  4C80 A;  5CJ7 A;  1SB3 C;  7ICG A;  4RQ1 A;  3MFI A;  1F44 A;  5F3X B;  3M8R A;  2LM1 A;  3GQC A;  1X6I A;  1JX4 A;  4I2J A;  4MFC A;  3MR5 A;  3C5G A;  2ZTC A;  2J6T A;  2W11 A;  4J9K A;  4RQ8 A;  3RAX A;  5GTI U;  4NL9 A;  4DFD A;  5DB9 A;  4ECU A;  1JRO A;  1TFR A;  1T4G A;  4QWE A;  2NRV A;  5AI6 A;  2DPI A;  4ACO A;  1KTQ A;  1O03 A;  2Q4T A;  1FEZ A;  5EWF A;  3T79 A;  2PKE A;  1O08 A;  4RQ6 A;  3JPP A;  2R8G A;  1ZQY A;  7ICV A;  1K5O A;  1KBU A;  2DF4 B;  4DQP A;  2EZZ A;  5CRX A;  5KT3 A;  1A6S A;  3M8S A;  3WK4 A;  5T14 A;  2H3I A;  1U4B A;  3RRH A;  2G07 A;  2KZM A;  9ICP A;  4WJ3 B;  2LYH A;  3FDS A;  5HHH A;  3SAG A;  2OWO A;  1VLB A;  1ZQH A;  4NLB A;  2IHM A;  5AKZ A;  5BOL A;  5C0Y A;  3V7L A;  3RH5 A;  4F4Y A;  3QU7 A;  1JMS A;  4UAR A;  4UB4 A;  1ZQT A;  1WWU A;  5J8Y C;  2BCS A;  3CYM A;  4BJQ A;  1MQ2 A;  4JV2 A;  3PMN A;  2VIX A;  5KFA A;  4R65 A;  2W54 A;  5KT4 A;  7ICL A;  3BQT A;  4USA A;  3H7I A;  4IR1 A;  4IRC A;  2EAM A;  4RNN A;  4DQR A;  2FLN A;  1N60 A;  1X9S A;  1HEK A;  3M9O B;  3TAD A;  4DEZ A;  2HW3 A;  1WYG A;  2EH9 A;  3BQ0 A;  2OCE A;  2LPE A;  2KFN A;  4LZD A;  5ALK A;  5B5E U;  3H4D A;  4UBC A;  1PK1 B;  4ECR A;  1JAL A;  2ZJ8 A;  1RYU A;  3C21 A;  3ISC A;  1BPE A;  4QZF A;  4O3P A;  2EQY A;  1SZP A;  4DF8 A;  3ONN A;  3HIL A;  3GDX A;  4UB8 U;  2I1Q A;  3M6K A;  4R63 A;  5C5J A;  8ICF A;  3V6K A;  4PGY A;  8ICO A;  1LVH A;  2MSN A;  1N5X A;  1U9L A;  5AHX A;  4QWD A;  5J8Y A;  4M9G A;  4I2G A;  2K4I A;  4KLF A;  1PVP A;  1V9P A;  2A1A A;  4J9L A;  5L1L A;  5KFR A;  5J2D A;  4RQ2 A;  1S9F A;  2C2R A;  3WKC A;  1S10 A;  5J29 A;  4AYB F;  5ALV A;  3M1Y A;  1P7D A;  1XC9 A;  3SAF A;  2E8O A;  1U49 A;  2IMW P;  1TE2 A;  2BCV A;  2KP7 A;  3L5K A;  4DF4 A;  3SV4 A;  3GZF A;  4DWI A;  3I1Y A;  2B21 A;  2WFA A;  4K4I A;  1K1Q A;  2DQN B;  2M0N A;  3TKA A;  4PL1 A;  1D8Y A;  4F72 A;  4Q44 A;  4OJO A;  3MGI A;  1RYR A;  7ICU A;  2ZIU B;  2BCR A;  3E2E A;  4O5C A;  3K1R B;  4DFM A;  2AH5 A;  5CWR A;  5AK6 A;  2A1J A;  5J2C A;  3PSP A;  5KAI U;  2BCU A;  4ICA A;  2KV2 A;  3PO5 A;  1N48 A;  7ICS A;  2WAQ C;  4DOC A;  2OH2 A;  5DQH A;  5KFG A;  1CRX A;  3V7J A;  9ICC A;  3UMB A;  1ZJN A;  1HUZ A;  5TZV A;  5DKW A;  1SKR A;  5AM1 A;  2I5H A;  1KEJ A;  1N56 A;  3S6J A;  2ASD A;  2ZXH A;  4ED0 A;  8ICU A;  3K1Z A;  3EYZ A;  2EZY A;  2PI4 A;  2H3Q A;  4YVZ A;  2FPK A;  1UT5 A;  5J2G A;  2EDU A;  1QSL A;  4F2S A;  5BPC A;  5CHG A;  1Z19 A;  4Q8E A;  8ICE A;  1H38 A;  2FJ6 A;  1RZT A;  1KFD A;  5AM2 A;  4MHV A;  1U48 A;  2HHT A;  3DEE A;  2XY6 A;  1QSS A;  1SKS A;  1EXN A;  4MEY A;  2IBK A;  4RPX A;  4YMO A;  8ICZ A;  3AQE A;  3QU5 A;  1ZRN A;  5KT6 A;  5DGA A;  7ICF A;  1UPH A;  2W43 A;  1XO1 A;  4EYI B;  1KDH A;  2KE7 A;  3OTQ A;  2ES6 A;  2KSO A;  2K4E A;  2W7O A;  4MF8 A;  7ICJ A;  3LK9 A;  2WTF A;  1QSY A;  3KZI U;  1NK5 A;  2OEH A;  4CF4 A;  4JV1 A;  1V97 A;  4C4S A;  4F3O A;  4J9O A;  1LKY B;  3EWA A;  4R8U B;  1X9W A;  3BS5 A;  2PFP A;  1S76 D;  4DQI A;  2L5Y A;  3T3F A;  4DFP A;  5KG5 A;  4CF3 A;  4JK1 A;  1COK A;  1A76 A;  2BGW A;  4Y2P A;  4G3I A;  3RJF A;  4IR9 A;  3IP4 B;  2HHW A;  2KEY A;  4KMU A;  5KFI A;  3WU2 U;  4KMO B;  3M7D A;  4M9J A;  1DGS A;  4QZD A;  3RBD A;  9ICO A;  4HAI A;  5J0R A;  9ICB A;  4DSF A;  4P0P B;  1RDF A;  4P4M A;  5J2B A;  3PW0 A;  5III A;  4DL6 A;  4KLJ A;  4NJ8 A;  2MUT B;  3HKZ F;  4KLL A;  1J97 A;  2V4Q A;  1S0O A;  5ALF A;  5AM4 A;  1T8E A;  3TI0 A;  1CEZ A;  2MUT A;  8ICW A;  3WKA A;  5D46 A;  3C2K A;  2ASJ A;  2W55 A;  1UCV A;  1WG8 A;  1SV0 A;  5KT5 A;  1A0P A;  5KFU A;  1Q3V A;  1TAM A;  3OSP A;  2NO5 A;  3FAH A;  3F5A A;  3RJH A;  2ZUD A;  8ICL A;  5AKH A;  4XQ8 A;  2JZB A;  4YXJ A;  4EBD A;  4U6P A;  3SD7 A;  1X40 A;  2DFL A;  3BJY A;  3AQF A;  5J0X A;  4HYK A;  2HBJ A;  2XCP A;  4EZ6 A;  5AIB A;  1PVQ A;  3JPS A;  3JPT A;  1SZH A;  2WHE A;  1Q46 A;  3ORY A;  1S97 A;  1ZOL A;  4RQM A;  3V6J A;  5KG3 A;  3ZDA A;  9ICA A;  3EPG A;  4F5O A;  3H0R B;  2FPM A;  2ISO A;  2FMP A;  3JPN A;  4EBE A;  1FIQ A;  5J2F A;  3N4M B;  3C2M A;  1HIW A;  4Y2Q A;  3PX0 A;  2I9G A;  3FC4 A;  3ETL A;  1SXD A;  5EE1 A;  3GV8 B;  1C20 A;  4P4P A;  4KLM A;  3PX6 A;  1QTM A;  2XVT A;  4J9M A;  1V38 A;  4ECV A;  9ICX A;  2G5H B;  3AU2 A;  4G9B A;  4JV0 A;  2R8K A;  3ZDE A;  1S0V A;  3V72 A;  7ICT A;  1SV4 A;  5AI8 A;  2RDJ A;  3NVY A;  4ED3 A;  3MDC A;  3K75 D;  5AIA A;  5FP0 A;  5AI4 A;  5KFQ A;  2K89 A;  4RQ5 A;  1JRP A;  4EEL A;  2KMD A;  4Z6C A;  4C7Y A;  3PW2 A;  4FZL A;  2AU0 A;  1NK7 A;  4GXI A;  4DFK A;  4QZH A;  1DRG A;  8ICR A;  4RUA A;  4ECZ A;  1DOQ A;  5AI0 A;  4PHE A;  1N5W A;  2YTU A;  3BQ2 A;  2F8K A;  3BQ1 A;  5KG0 A;  7ICN A;  5DG9 A;  3A0B U;  1T94 A;  1NK9 A;  2BHN A;  1SV0 C;  5J2E A;  1OUQ A;  4B9N A;  3PW7 A;  4FZM A;  3HRD D;  2W3S A;  4ED1 A;  2ODG A;  1NOM A;  2HMX A;  1DK3 A;  4RNO A;  4Y2J A;  2XO7 A;  4YFK A;  2BZF A;  2F3N A;  4F93 B;  3UXP A;  2F1J A;  4B9U A;  1ZQS A;  4RQ0 A;  3SAH A;  9ICU A;  2CPR A;  2BQU A;  2HBK A;  3RJJ A;  5CEH A;  1JXL A;  3LWL A;  1FO4 A;  1SIJ A;  3T5H A;  2KZ3 A;  3PNC A;  5DGB A;  5CP2 A;  1B43 A;  4DL5 A;  1MN8 A;  2LM4 A;  4C8K A;  4QZA A;  2ZIW A;  4JWM A;  5HHI A;  5G5G A;  2EAN A;  2A1J B;  5L1J A;  4EEY A;  8ICB A;  2JEJ A;  4I2A A;  3SYZ A;  2ZUC A;  5TIS U;  1LB2 B;  2O6K A;  8ICQ A;  4UAT A;  5IIO A;  8ICT A;  2RRD A;  1KLN A;  1UT8 A;  3UM9 A;  2MU2 A;  2XCA A;  4F2R A;  4DOB A;  2KZZ A;  4FZN A;  3HKZ C;  4NLC A;  4ED2 A;  4QW9 A;  3LVV A;  2Q0Z X;  4RQ3 A;  5KFE A;  4Y2V A;  2WAQ F;  2BPF A;  4QZG A;  3OJS A;  1KSP A;  4IRD A;  4I2B A;  3KBB A;  2ZIV A;  2DL0 A;  4NV0 A;  1UQV A;  4JMU A;  4EEK A;  4I2H A;  2KFZ A;  1X2I A;  1N62 A;  3H8J A;  4UQG A;  2YN4 A;  2DKX A;  1RYS A;  1LKY A;  1S0M A;  2UVU A;  3EPI A;  1S77 D;  1JI7 A;  5KFO A;  3RR7 A;  5ALN A;  1QLN A;  4NLG A;  3F5E A;  8ICM A;  2KIC A;  2W9C B;  2J6S A;  5CR0 A;  4ED6 A;  3GV5 B;  4ELT A;  2FDR A;  3KOO A;  4UAV A;  2AQ4 A;  4DLE A;  2ZIX B;  1SWV A;  5DB8 A;  3ALR A;  1NKB A;  4KLS A;  2XIC A;  2HOQ A;  1KFS A;  5AIC A;  2YB4 A;  1TV9 A;  5J2I A;  3ISB A;  4ELU A;  1KN5 A;  4I2F A;  1DK2 A;  1L7P A;  4OJP A;  5J0Y A;  3JPO A;  2EAO A;  1MSW D;  2QB0 B;  2AXT U;  2W03 A;  5KFY A;  3B0X A;  1L6N A;  4QJF B;  3IV6 A;  9ICJ A;  5KG2 A;  4DS5 A;  4F5P A;  4J9Q A;  4UAW A;  3NAS A;  1S8O A;  1HJP A;  1SL0 A;  1ZQV A;  5KFP A;  1XS9 D;  5E79 U;  4B9L A;  2WF6 A;  4DSE A;  1TK8 A;  1PVR A;  1ED1 A;  4KN7 A;  5D4B A;  7ICO A;  1CI4 A;  2G09 A;  3QE9 Y;  3Q8R B;  1DXS A;  2JEF A;  2G08 A;  3NRW A;  2G5I B;  5ALD A;  2H3Z A;  1NKE A;  1A77 A;  2GO7 A;  4I27 A;  3Q8L A;  4OD0 A;  3Q8M A;  4Y2Y A;  4ZH4 A;  4QIW C;  2F8L A;  3IM1 A;  3AMZ A;  1OW5 A;  3C28 A;  1RM6 C;  3MFH A;  2HHQ A;  2VA3 A;  2H3V A;  3RH6 A;  3IDW A;  3CP8 A;  4QWA A;  4NM1 A;  9ICW A;  4FBT A;  2ZIU A;  1BPY A;  7ICP A;  4KLE A;  2UVW A;  4DO9 A;  3O0F A;  4KLD A;  4KIT B;  3HW8 A;  3RFA A;  3B9J A;  1L7M A;  1SL1 A;  4NLN A;  5ALU A;  3KHH A;  1ZQX A;  5L9X A;  5ALQ A;  4ECW A;  4NLK A;  2QAR A;  7ICE A;  5J2J A;  2HHU A;  4XA5 A;  2PFO A;  2DUY A;  2E8M A;  3TAQ A;  1ZQZ A;  3KD3 A;  2NYV A;  3K4G A;  4LJX A;  4FO6 A;  4DL2 A;  3MR2 A;  2YQE A;  5KFN A;  3L4P A;  2RHF A;  3SZ2 A;  5KG1 A;  4UB3 A;  1L3S A;  5G5H A;  3H0L B;  5KFJ A;  4RPY A;  2HOI A;  3OGU A;  4IS7 A;  8ICK A;  2D6F C;  3MDA A;  5AI9 A;  2E8P A;  1ZD4 A;  1Z00 A;  1D8L A;  2BQ3 A;  2F44 A;  5DQI A;  1Z4O A;  2I6X A;  1VJ5 A;  4DS4 A;  4LZG A;  5KFL A;  1BNP A;  5AKX A;  1NZB A;  5HR7 A;  3AU6 A;  2ZXI A;  5A0L A;  2VAN A;  4UB5 A;  5AKY A;  3RB6 A;  4DSK A;  1ZQK A;  4ECY A;  4P4O A;  5J2K A;  3I28 A;  2Y9U A;  4F4W A;  4TUR A;  1NJX A;  2W7P A;  1BPD A;  5KFC A;  2KOB A;  8ICJ A;  3IN5 A;  4QIW F;  4OJ5 A;  5F9N A;  3EZ5 A;  5ALX A;  3I76 A;  3KZX A;  2Y0S F;  3PST A;  2IOF A;  4PH5 A;  1UA0 A;  2Y0S C;  1ZQU A;  3QX7 A;  1RXW A;  4FFD A;  1Q3U A;  4Z6D A;  1QQ6 A;  2K60 A;  3A0H U;  9ICK A;  1S5L U;  2N1R A;  4QZC A;  2A3V A;  5J0T A;  3TFR A;  2HBM A;  4F91 B;  2LYB A;  2IOF K;  4DQQ A;  4OJ6 A;  4PHP A;  4F50 A;  2NV3 A;  3UXN A;  2VKQ A;  2MA1 A;  3IRU A;  4GC6 A;  9ICF A;  3KHR A;  1SKW A;  2JXJ A;  1ZQO A;  2GLE A;  2ZTE A;  2IHN A;  2HHS A;  3PX4 A;  4JB3 A;  1BGX T;  2YX8 A;  2UVR A;  3PY8 A;  4P0Q B;  1F5S A;  2W8L A;  1ZD2 P;  1L8L A;  2ZTD A;  7ICQ A;  1TAU A;  3T5K A;  2BPC A;  2FLP A;  4PHA A;  4A8E A;  4Z6F A;  5GTH U;  2WF8 A;  4YN4 A;  8ICP A;  3TFS A;  3RRG A;  2AGP A;  1TKD A;  1KW4 A;  2DWQ A;  1KL9 A;  4CDG A;  8ICI A;  4B9V A;  2LMR A;  4O3M A;  4TUQ A;  5AM3 A;  4RT3 A;  4KTQ A;  3BS7 A;  4UAY A;  4YD1 A;  4KN4 A;  4PGQ A;  4US9 A;  4ECQ A;  3KHL A;  1ZET A;  2RP5 A;  3TAP A;  3QU2 A;  2Y1I A;  3FYH A;  4DQS A;  2NRW A;  8ICC A;  3R9K A;  5EOZ A;  4M2Y A;  1XWL A;  4I2I A;  4YMN A;  4C4T A;  2AGQ A;  4EZ9 A;  2CXY A;  4R64 A;  2AHO B;  2JH1 A;  3MAB A;  4Q45 A;  3SV3 A;  3H8M A;  4I29 A;  1XSP A;  4QNL A;  2KD1 A;  4UB1 A;  3G6X A;  5DG7 A;  2K8B B;  3UXO A;  2VA8 A;  3H40 A;  4J9S A;  3H8S A;  3IG5 A;  4KX5 A;  3F2D A;  7ICI A;  4QW8 A;  2OXO A;  5CB1 A;  3M9N B;  1X9X A;  3N7P D;  5DLG A;  2KJ8 A;  4QZI A;  2OYY A;  1MC8 A;  3WK5 A;  2XGP A;  3PV8 A;  3GV7 B;  4O9M A;  2XID A;  2KIW A;  9ICR A;  5EWG A;  2FI1 A;  4YCX A;  3GIM A;  2R8J A;  2MRL A;  4YQW A;  3QU4 A;  4EEN A;  3OJU A;  4DL4 A;  2WF7 A;  2G0A A;  3GU3 A;  2C2E A;  5KG6 A;  5KFF A;  2A19 A;  3UMG A;  3ZDD A;  5KFM A;  2JH7 A;  5IIK A;  2E1F A;  5KFB A;  4Z6E A;  1ZQI A;  4CCH A;  4M6W B;  3TAR A;  3AN1 A;  3FM9 A;  4IQV A;  4M9H A;  4F4X A;  3SQI A;  4Y2T A;  3N7S C;  4DL7 A;  3UPQ A;  8ICN A;  1ZJM A;  2ALZ A;  2GWS A;  1QCK A;  3MBY A;  3T5L A;  2PI5 A;  4F92 B;  2KIV A;  2QAR B;  2ZIX A;  1AQ6 A;  3B0Y A;  2G06 A;  3PW4 A;  1ARO P;  3RB0 A;  5ALR A;  2W9B B;  1RQL A;  2B0C A;  3UQ0 A;  5ALW A;  1L8O A;  2W04 A;  3PZP A;  3RJE A;  3RB3 A;  1NK4 A;  4K4G A;  3Q8K A;  7ICM A;  3RR8 A;  3H4B A;  4PHD A;  4BDP A;  1COO A;  3PR4 A;  1GO3 F;  2JR5 A;  1SXE A;  2JMG A;  2D3D A;  5KFX A;  1ZQM A;  5L1M A;  1T3N A;  3BDP A;  2PFQ A;  4KLQ A;  2JZB B;  1FFU A;  1T3Q A;  5BOM A;  4F5Q A;  5KL8 B;  5ALJ A;  3MR6 A;  3F2C A;  5AKK A;  2XGQ A;  1D9D A;  5ALM A;  3UQ2 A;  4TQS A;  5KG4 A;  5JTI A;  1Z1V A;  1ZYQ A;  1RQN A;  5DDY A;  3SEN A;  4Y2U A;  3MR3 A;  1NZP A;  3WK7 A;  2PMZ F;  9ICM A;  3TAC B;  2ZIW B;  1XNS A;  3VCB A;  3DV9 A;  4FE3 A;  3NS1 A;  4F8R A;  5DQG A;  3LVW A;  1XSN A;  5HML A;  2ISP A;  1ECW A;  3E58 A;  5AKJ A;  3ETR A;  4C8M A;  4CGZ A;  5J0O A;  3RJI A;  3G6V A;  3Q8Q B;  1N61 A;  2WB1 F;  5EWE A;  3RB4 A;  2PXI A;  3D2S A;  1UA1 A;  3CRX A;  4KLI A;  2DPJ A;  4LVS A;  2KJ9 A;  2F1H A;  3GIK A;  1X9M A;  2KTQ A;  2EZX A;  2YMP A;  4MFA A;  7ICK A;  3D2Q A;  5EE9 A;  2BDU A;  1IV8 A;  5IIJ A;  2ZJA A;  4GFJ A;  2P6R A;  2C28 A;  4B9T A;  2ESE A;  2R8H A;  4KLG A;  2KK0 A;  2KSO B;  1ZQQ A;  2YB1 A;  1IXR A;  2P66 A;  9ICS A;  5KT7 A;  2P6U A;  1URJ A;  3RBE A;  1ZQC A;  4RT2 A;  1Z1B A;  1MA7 A;  4RQ7 A;  5J0U A;  4DOA A;  3KFU F;  4C4R A;  3TAN A;  3AEV A;  4BWM A;  1VDV A;  3V7K A;  2RDI A;  1UHU A;  4YR0 A;  3Q8S B;  4K4H A;  3CW2 C;  2XY5 A;  5KFH A;  5IIM A;  1L5U A;  2QKQ A;  2E3T A;  5F9L A;  4X5V A;  3ICX A;  4PPX A;  3GFK B;  4J03 A;  9ICI A;  3QZ8 A;  3T5J A;  4YMM A;  4BWJ A;  7ICR A;  1L7N A;  2Z7J A;  7ICH A;  4ECS A;  9ICG A;  1Q8K A;  2J6U A;  2OHF A;  2Y9T A;  4QWB A;  4UAS A;  1C7Y A;  4YD2 A;  4P0Q A;  5B66 U;  5H2F U;  4EYH B;  2BCQ A;  5AK4 A;  1ZQR A;  5AK3 A;  2HOF A;  4RU9 A;  2HVI A;  8ICV A;  3UMC A;  4KX3 A;  4M9N A;  1TVA A;  3M6Z A;  4B9S A;  5J0S A;  3BZC A;  2RLT A;  5ALO A;  5IIN A;  1CUK A;  3C1Z A;  3MC1 A;  3GII A;  5J2A A;  1X6J A;  4O3Q A;  1B22 A;  2AJQ A;  2HDO A;  1D8B A;  1TK5 A;  3HPO A;  2W3R A;  2LI6 A;  4J9P A;  4BUG A;  3Q8P B;  3RTV A;  4BXO A;  1WUD A;  4E0D A;  2FE9 A;  3OHB A;  1X42 A;  1N2X A;  4NL9 C;  4R8U A;  5L1I A;  3LWM A;  2M9N A;  3QUQ A;  4RQN A;  4J9N A;  2BPG A;  1ZRM A;  3MGV A;  5AKI A;  2MAX A;  3KKA C;  4UAU A;  2IA6 A;  9ICE A;  3C23 A;  2E5S A;  3WK6 A;  5AKG A;  4UAZ A;  2PMZ C;  2KVC A;  2JRZ A;  3H0M B;  3SR6 A;  4UB6 U;  3U26 A;  3C2L A;  2FPL A;  2QB1 A;  5AI5 A;  3QEB Z;  2JHD A;  4DCC A;  3E0F A;  4O0I A;  3QUT A;  4DSL A;  4Y2X A;  5ALP A;  2YMQ A;  3SI8 A;  4RNM A;  1F0M A;  3WKB A;  1ZQW A;  3C5F A;  3OHA A;  3WK8 A;  5ALE A;  4UB2 A;  2NRT A;  5IIL A;  5HR6 A;  2NO4 A;  1NJZ A;  1L3V A;  5HP4 A;  3D6J A;  5ALI A;  4C8L A;  5DB7 A;  2YMM A;  1JIH A;  5DBB A;  3AL0 B;  5JU5 A;  4P2H A;  3CNH A;  3KTQ A;  1QQ7 A;  1ZQP A;  1WWV A;  4M47 A;  1RXV A;  4GXK A;  4ELV A;  2XC9 A;  1Z00 B;  2EAP A;  3C29 A;  2ZUB A;  2VA2 A;  3LYS A;  5J0W A;  3HT3 A;  3THV A;  2BKE A;  2F76 X;  4GIB A;  9ICT A;  5JUM A;  4DL3 A;  5L1K A;  4I2E A;  3V6H A;  5KFW A;  2HSZ A;  2F2A B;  3AUO A;  2H5X A;  1XSL A;  3EUB 2;  1ZXI A;  2JEG A;  5KG7 A;  4IL6 U;  1ZD3 A;  4KLU A;  2K8C B;  2RQ5 A;  1NNL A;  2CRX A;  2GOL A;  4MEX A;  4M0A A;  2PFN A;  5AKL A;  3PO4 A;  4DSJ A;  4YG2 A;  4YXM A;  4RPZ A;  3JPQ A;  1L3T A;  1IM4 A;  4PL2 A;  4PZO A;  2KKP A;  1ZQ1 C;  2W8K A;  4BX9 C;  2KNJ A;  9ICN A;  5DB6 A;  1TK0 A;  4Y2R A;  2KG5 A;  4CE6 A;  2FMS A;  2F77 X;  3PW5 A;  1V85 A;  2HBL A;  1XU4 A;  3H8W A;  5JRT A;  3HJE A;  3ZD9 A;  4YP3 A;  1BPX A;  2ZJ5 A;  1S0N A;  4O5E A;  1M6Y A;  1ZQN A;  5AM0 A;  5KNI A;  1NKC A;  2ZG6 A;  4GLX A;  4AP9 A;  4GXJ A;  1N63 A;  1ZQA A;  2WF5 A;  4QZE A;  2IOH A;  5DG8 A;  2JEI A;  4FS2 A;  2AGO A;  2HHX A;  3RH4 A;  5KFS A;  2KHQ A;  3N28 A;  4Q43 A;  4NWI A;  5KFV A;  4QZB A;  4F5R A;  4M04 A;  3QEA Z;  4O5K A;  4CNQ A;  4IRK A;  3C1Y A;  4UBB A;  5DLF A;  4CF5 A;  4R66 A;  4KLT A;  2NRX A;  4NXZ A;  5AK5 A;  2WB1 C;  1U47 A;  8ICS A;  3QYP A;  4BXO B;  8ICX A;  3N7R C;  5HMM A;  1ZQG A;  3BQ7 A;  4PGX A;  4RQ4 A;  3JPR A;  3NGD A;  2QLT A;  1BVS A;  4PZN A;  3QUB A;  3DDH A;  2LHT A;  2K8A A;  4ECT A;  5ALS A;  3BS5 B;  3TAD C;  2R8I A;  2KKV A;  1B0X A;  4QZ9 A;  5D49 A;  1QQ5 A;  4RUC A;  1ZD5 A;  4F5N A;  2CN1 A;  2D8C A;  3N97 B;  1JN3 A;  5DBC A;  4OO1 J;  2DKZ A;  4DFJ A;  4O3O A;  4FBU A;  4F4Z A;  3MGH A;  3QZ7 A;  1PZN A;  2JV3 A;  1KFT A;  4MFF A;  5KFT A;  3RJK A;  4EBC A;  1JXE A;  2LKY A;  1K1S A;  1SWW A;  3SMV A;  1PK3 A;  3QU9 A;  2QB0 A;  3J81 j;  4C7Z A;  4IQU A;  5ALL A;  3ED5 A;  1XO0 A;  1PK1 A;  1ZQF A;  1U45 A;  5ALY A;  4B9M A;  4QZ8 A;  5KAF U;  2ZIV B;  1ZQE A;  2BQR A;  5KL1 B;  5ALZ A;  5J0Q A;  2ATL A;  3GIL A;  4YR3 A;  3NVZ A;  5ALT A;  3ZD8 A;  2FLL A;  5KFK A;  4DSI A;  2OM6 A;  1LV5 A;  5KT2 A;  2BDP A;  5AM5 A;  8ICG A;  5KFD A;  1NK0 A;  3ZI4 A;  4US8 A;  5KTQ A;  1DGJ A;  4ED7 A;  5KFZ A;  8ICY A;  3NRZ A;  1WCL A;  2WF9 A;  4I28 A;  1NK6 A;  1D9F A;  4O3R A;  1RPL A;  4Y2S A;  2B6G A;  1Z3E B;  1RG6 A;  5K4L A;  3WKE A;  1KRP A;  2E1E A;  3L3F X;  3NVW A;  1QH9 A;  4OJL A;  4KLH A;  3ZDC A;  2HCF A;  3VC8 A;  1TAQ A;  3RJG A;  2BR0 A;  3QUC A;  3SEI A;  5EE3 A;  3NTU A;  4AYB C;  4O3N A;  3F53 A;  1NJW A;  4KLO A;  2V9W A;  4F4K A;  3BZK A;  4TUP A;  4TUS A;  8ICA A;  2VJ5 A;  2UVV A;  1NJY A;  2R18 A;  4F71 A;  4C8N A;  2ASL A;  1Y88 A;  2YY6 A;  3TQ1 A;  3RAQ A;  2VJ4 A;  2KVS A;  9ICL A;  1NK8 A;  2F1I A;  4DLG A;  5CA7 A;  3OPX A; 
#chains in the Genus database with same CATH homology
 2KHV A;  3CYM A;  4BJQ A;  2OXO A;  2HBM A;  3ICX A;  4OJP A;  3F2B A;  2DGZ A;  3NUQ A;  1XO0 A;  2LYB A;  2JHD A;  2DQN B;  2M0N A;  3E0F A;  2LBO A;  3N7P D;  4OJ6 A;  4P0P A;  4PL1 A;  2LYA A;  2KJ8 A;  2VIX A;  2W03 A;  2ZIW A;  4OJO A;  2NV3 A;  2XI9 A;  1HIW A;  2VKQ A;  2ZIV B;  2PMZ F;  2ZIU B;  2OYY A;  2MA1 A;  1L6N A;  4QJF B;  2Z7J A;  5KL1 B;  2ZIW B;  2XID A;  4C0Z A;  2KIW A;  3VCB A;  1XNS A;  4FE3 A;  3PSF A;  2RHF A;  2MRL A;  2ZG6 A;  3PSP A;  2XVT A;  2KJ5 A;  2G0A A;  3LVW A;  5HR6 A;  2RRD A;  3GU3 A;  3H0L B;  4ICA A;  1ECW A;  4P0Q A;  2KV2 A;  2GH1 A;  1HEK A;  2H3F A;  2G5H B;  2A3V A;  3IP4 B;  2WAQ C;  4CGZ A;  2KEY A;  2YX8 A;  2OM6 A;  2OH2 A;  4P0Q B;  4KMO B;  3MGV A;  1IIP A;  2JH7 A;  2E1F A;  1CRX A;  2HOF A;  4IC9 A;  1F44 A;  3M7D A;  2HOI A;  3AL0 B;  2D6F C;  2KHQ A;  4FZN A;  4NWI A;  1PVR A;  3HKZ C;  2WB1 F;  4NLC A;  4P0P B;  4KX3 A;  3LVV A;  1ED1 A;  4CRX A;  3M6Z A;  2G09 A;  2WAQ F;  3SQI A;  3D2S A;  2K89 A;  3N7S C;  2G08 A;  3NRW A;  2ZIV A;  4A8E A;  3C29 A;  3CRX A;  2G5I B;  2H3Z A;  4NV0 A;  3LYS A;  1YT3 A;  3HKZ F;  2ZXH A;  2WB1 C;  4FZL A;  4JMU A;  2KJ9 A;  3K1Z A;  4U7C A;  1NZB A;  2F76 X;  2JGA A;  3ONN A;  2H3Q A;  1DRG A;  3N7R C;  5HR7 A;  3M6K A;  4ACO A;  2ZXI A;  2ZIX A;  2E1E A;  5A0L A;  3L3F X;  2Q4T A;  2G06 A;  3T79 A;  1D8B A;  3D2Q A;  2F2A B;  1A0P A;  2BDU A;  4CDG A;  1Q3V A;  1TAM A;  4OJL A;  3F5A A;  2LHT A;  4GFJ A;  1Z19 A;  4O3M A;  2K8A A;  3VC8 A;  1KBU A;  4QIW C;  1T94 A;  2DF4 B;  2F8L A;  2YB1 A;  4BUG A;  2W04 A;  1OUQ A;  5CRX A;  1A6S A;  2K4I A;  3C28 A;  2K8C B;  2KKV A;  2CRX A;  3DEE A;  2RP5 A;  2GOL A;  2W7P A;  4U6P A;  4FZM A;  3PZP A;  1PVP A;  1WUD A;  2H3I A;  3D2N A;  2H3V A;  3F5E A;  1URJ A;  2G07 A;  5T14 A;  2KIC A;  2KOB A;  3IG8 A;  4AYB C;  3CP8 A;  1Z1B A;  1MA7 A;  4WJ3 B;  3F53 A;  3IN5 A;  2HMX A;  2CN1 A;  2ZIU A;  3AQF A;  3F2C A;  4QIW F;  2HBJ A;  3SAG A;  3KFU F;  4OO1 J;  1GO3 F;  4OJ5 A;  3AQE A;  4AYB F;  2JMG A;  1PVQ A;  1SZH A;  1P7D A;  3O0F A;  2ZIX B;  4PL2 A;  3SAF A;  3KZX A;  2VJ5 A;  2Y0S F;  3PST A;  4NLB A;  1UPH A;  2JH1 A;  2K4H A;  3ALR A;  2KKP A;  2R18 A;  3RFA A;  4QNL A;  2KD1 A;  1ZQ1 C;  3SAH A;  2XIC A;  2HOQ A;  2Y0S C;  2YB4 A;  2LKY A;  4BX9 C;  5C0Y A;  2E5S A;  2KNJ A;  2CPR A;  2VJ4 A;  3RF9 A;  3SMV A;  1Q3U A;  2K8B B;  2K4E A;  3GZF A;  2HBK A;  2W7O A;  3PSI A;  3IG5 A;  5KL8 B;  4KX5 A;  2PMZ C;  2KVC A;  3F2D A;  2F77 X;  3H0M B;  3OPX A;  2N1R A;  3H0R B;  2HBL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...