2RHFA

D. radiodurans recq hrdc domain 3
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
76
structure length
76
Chain Sequence
SHNADLSEALRELRRELMKETGYSAFVVFTNATLEALAARQPRTLAELAEVPGLGEKRIEAYGERILDAINTVLDG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords DNA helicase RecQ
publication title Structure and function of the regulatory C-terminal HRDC domain from Deinococcus radiodurans RecQ.
pubmed doi rcsb
source organism Deinococcus radiodurans
total genus 27
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2007-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00570 HRDC HRDC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.80 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2rhfA00
5C0YA 2HBJA 2RRDA 1GO3F 2HBMA 4QIWF 3SAHA 2HBKA 4CGZA 2E1FA 3SAGA 2DGZA 3SAFA 2MA1A 2RHFA 4NLCA 4OO1J 3CYMA 4QJFB 1YT3A 4NLBA 4O3MA 2CPRA 4CDGA 2KV2A 1WUDA 1D8BA 2HBLA 2E1EA
chains in the Genus database with same CATH superfamily
2Z7JA 2KFZA 3MFIA 1N61A 2OXOA 5J2CA 2W8KA 4CF3A 3JPPA 3GV8B 4IRKA 1IM4A 3RJGA 2KEYA 3EW9A 5J2IA 3RBEA 2HMXA 2IOFA 1COOA 1CI4A 4EELA 5DQIA 5CB1A 2BCRA 5CEHA 3PX4A 3ETLA 2E1EA 1YZ7A 2HW3A 4M9LA 1K1SA 2V4QA 1N62A 3PW4A 1FO4A 1WWUA 3PVXA 3PSFA 9ICVA 2BPGA 1S76D 1JXLA 2DQNB 7ICTA 2KICA 3KKAA 2AXTU 4M9JA 1KEJA 4I27A 8ICOA 1H38A 4F92B 1ZQNA 2C28A 3RR7A 2KTQA 2AJQA 4ED6A 1ZQWA 4GC6A 4UBBA 2W43A 4YMMA 1NK7A 2D3DA 8ICSA 3Q8SB 4CF4A 3BDPA 3H40A 3ICXA 1SZPA 2KZZA 2KD1A 1COKA 1PK1B 3PR5B 2YB4A 5G5HA 2LYAA 4FS2A 3H8MA 1T3NA 4I2DA 5KT2A 4NLKA 5EWEA 4DSKA 1QQ7A 3RH6A 4ZOHC 3QZ8A 1JXEA 4RQ4A 5AM0A 1Y88A 4UAVA 2YTUA 2ALZA 3IM1A 4F72A 3CNHA 4QWEA 1B4FA 4O0IA 2W9BB 5KFGA 3PV8A 3RB0A 3ISBA 1Z4NA 1S8OA 4F3OA 1D8YA 3M9NB 2R8HA 2H3IA 2MSNA 2WB1F 3NS1A 4QWCA 2KHQA 2WAQC 3H8JA 4DSIA 2W7PA 2EZZA 3M9MB 4DQPA 2NRZA 3KZIU 1NJYA 4EZ9A 3M1YA 5HHHA 2A19A 2DWQA 3KKAC 3ZDEA 2JGAA 2C2DA 2PMZC 8ICMA 5KFLA 3UMCA 3D2SA 2F2AB 2L5YA 3BS5A 2ES6A 5HNKA 1XC9A 9ICOA 1WUDA 3CW2C 3RH4A 1U49A 3OJSA 2ODGA 1KQQA 3FYHA 2FPKA 4J9RA 5DDMA 5KL8B 2B0CA 2PMZF 4P0PA 4OO1J 1O08A 5TISU 4RQ6A 1D9DA 3K1ZA 4YN4A 4BDPA 1U4BA 9ICBA 3QU4A 2KIWA 5IIIA 4MFAA 1TVAA 7ICOA 2EQYA 4QWBA 3BQ7A 2JV3A 2HDOA 4C4TA 3VC8A 1L7NA 4YXMA 9ICAA 4P2HA 1SL1A 4KX5A 1UHUA 1Q3UA 2BGWA 1JRPA 1X40A 2HI0A 1YZ6A 1ZXIA 3T5JA 2RP5A 4FS1A 1CUKA 1O03A 2BCQA 5J0RA 2DPIA 3TFRA 1V97A 2JZBB 4CF5A 1B43A 1Z1BA 4KLSA 3QNMA 2KKPA 4RT2A 2K4EA 4DQQA 2YB1A 2DKZA 3KHRA 2K4IA 1N5WA 4DL7A 4M04A 7ICSA 5DKWA 4KX3A 2MAXA 4QZBA 5BOLA 2ZIUA 1KW4A 3GV5B 3I1YA 4NLBA 3F53A 1L3TA 1JUDA 5DB9A 4TUQA 4DL4A 3C1ZA 2XGPA 1PZNA 2XICA 4QZDA 4DS5A 1HUZA 1L3UA 1SKWA 1PVRA 4YFKA 2K4PA 1DGJA 2KZ3A 5EE3A 2AHOB 3IG8A 1ZQSA 5J2BA 8ICVA 8ICRA 4QIWC 5AKKA 3HW8A 2JRZA 3JPNA 3SI8A 7ICVA 2VA3A 4Q44A 3CP8A 2AH5A 3PW5A 5IIJA 5T14A 2Q0ZX 5KFPA 5DQGA 4LZGA 3BQTA 1X6IA 1DXSA 2XCAA 2NRWA 9ICGA 3MFHA 4YR2A 1ZQFA 4PHPA 8ICUA 3HPOA 4O5KA 1X9MA 4UB5A 4PL1A 3RRGA 4US9A 3SAGA 3RBDA 2VKQA 2JXJA 4YMNA 5HR7A 1SIJA 4ECRA 4F50A 1Z00A 3RH5A 2EZXA 1ZQGA 4US8A 4UB4A 1FFVA 3PW7A 1ZQUA 1RXVA 5EE9A 1KTQA 2N1RA 4J9LA 5ALNA 3PW0A 5IILA 1SKRA 2MUTA 5DLGA 1DGSA 4F2RA 5ALLA 4Q45A 1TV9A 3TKAA 8ICZA 2RHFA 1NNLA 3HJEA 2FPMA 4G9BA 4JWNA 5J2DA 5KFAA 5ALVA 4ECWA 4GXJA 4ELVA 2OEHA 2HHSA 1TK8A 3RJHA 1ZQXA 1ZQZA 2LYBA 5EE0A 4U7CA 4RQ3A 2B6GA 2BPCA 2ZIWA 5IIMA 2EANA 4G3IA 3H8WA 4RUCA 2F8KA 4DFJA 2LPEA 5ALJA 2WF8A 2E8OA 9ICNA 4YVZA 2FLPA 4ELUA 2I1QA 1T4GA 1KSPA 1N60A 4M9HA 4QWDA 1SL0A 1ZQQA 4ECUA 4R64A 4F91B 3JPOA 4UAUA 5CJ7A 4J9OA 2XGQA 3IV6A 1ZQOA 4YR0A 4RPYA 3AU2A 2JH7A 4MHVA 2HVHA 2G0AA 4DSFA 3AU6A 1HIWA 9ICIA 4R63A 4OJOA 4P0QB 5J0PA 4DCCA 4FZMA 3QXGA 2D8CA 2W04A 1LKYB 4I2FA 3V7KA 7ICKA 1KFDA 2K4HA 3T5LA 2WTFA 4MFFA 3BQ0A 4NLCA 3HILA 1QLNA 1MN8A 2QKQA 2HHUA 2V4RA 2YMMA 3K4GA 2QB0B 1UQVA 5KG1A 2JEJA 1X2IA 4F2SA 3V6HA 4MF2A 2OWOA 3HX0A 4ED2A 2HHTA 1BGXT 9ICWA 3C21A 5KAFU 4EX7A 4RPZA 3TACB 4O5EA 4E0DA 4XUSA 2LI6A 5J2HA 4YP3A 4O3RA 2AGOA 5EOZA 2BPFA 2ZXHA 1LV5A 1Q46A 2BQRA 4FE3A 1JIHA 1D8BA 1XSNA 1CEZA 5J2GA 1T7PA 9ICFA 3BZCA 3ZI4A 2GH1A 5AI4A 9ICEA 4QZCA 4M6WB 3ZDDA 1HUOA 2HSZA 3Q8PB 2GOLA 4J9KA 2C2EA 3T3FA 3LK9A 3PMNA 1KFSA 3UMGA 2G09A 4DOCA 2BHNA 4OJPA 4DL2A 3Q8KA 3RR8A 2LHTA 1VDVA 1XSPA 5FP0A 1HEKA 2KV2A 3H4DA 1X6JA 4MF8A 2PFQA 4RNMA 3EYZA 1JROA 3A0BU 7ICMA 4AP9A 8ICIA 4C7ZA 4JV1A 3MGIA 3I76A 3D2NA 1L6NA 4TQRA 5G5GA 1L7PA 4BXOB 5J0WA 4USAA 2HHXA 3BQ2A 3QUQA 3RJIA 8ICQA 3RF9A 3LWLA 4Y2PA 4PHEA 2RDIA 3RB3A 2JH1A 2WF7A 1IV8A 5J2EA 4UAYA 4J03A 1FEZA 3T5KA 1ZQTA 2ZUCA 1S10A 3DEEA 4IS7A 4EENA 2I5HA 5KFCA 3EPGA 4R8UB 2H3ZA 1WCLA 1DOQA 4KLIA 5ALGA 1XO1A 3GIKA 2MRLA 4HAIA 2KNJA 1L3SA 1QQ5A 2ZJAA 8ICNA 4BGDA 4QZIA 4Y2JA 7ICPA 5A0LA 5JUMA 4FBUA 5JTIA 2A1JB 1RZTA 4C80A 1UA1A 3RJJA 1URJA 7ICRA 2HHVA 5J29A 5J0XA 2F3NA 1A77A 3AQEA 4QW9A 5KG4A 2B21A 4ED8A 4PZOA 1AQ6A 5ALQA 3EUB2 4KLFA 3F5AA 3BQ1A 3T79A 3BJYA 9ICUA 3AN1A 3LVWA 5ALEA 4YD2A 4GFJA 8ICKA 2BR0A 2LM4A 3Q8LA 1N2XA 5DG9A 5AK3A 3SZ2A 3NGDA 5DB6A 4PL2A 2J6SA 5KFSA 3Q8RB 4X5VA 3OHBA 2XIDA 4M9GA 2EAOA 4CRXA 4DQIA 4J9NA 2ZIVA 5D4BA 4RPXA 1S0MA 1V85A 2K8CB 3WK9A 4PZNA 5KFJA 1A0PA 3WKEA 4C0ZA 1TAUA 4HYKA 3NTUA 8ICHA 2W9CB 3M8SA 1Q3VA 1OXJA 2VANA 2JEIA 1A76A 5AICA 1UT5A 3MC1A 3O0FA 5KT3A 1YT3A 5J2KA 4YMOA 5KFRA 1ZQJA 4GXIA 4RQ5A 3K1RB 3M6ZA 2WB1C 3C29A 3QEBZ 2ESEA 3MR5A 1ED1A 3RRHA 3G6XA 3HRDD 2OYYA 4ECYA 3T5HA 1B22A 1RM6C 4DLEA 3MR6A 2E1FA 3I28A 2R8IA 4NLNA 5KFXA 3ISCA 4RQ7A 8ICFA 5J0QA 4QW8A 2FDRA 3TQ1A 4QZ9A 3C2KA 2XCPA 1X9SA 5D49A 5HMLA 1BPZA 5CWRA 4EYHB 3C1YA 3C2MA 1QH9A 3RB4A 3SENA 4F5PA 4QZ8A 2I9GA 2P6UA 5KFUA 2H5XA 3M9OB 2PFPA 5KFDA 1TKDA 3KTQA 5J8YA 4Z6EA 5F9NA 3FDSA 1Z3EB 5KT4A 2EAMA 3Q8MA 3UPQA 5KFTA 5AKLA 1PK1A 3QU5A 5L1MA 3OHAA 2E8MA 3D6JA 1JX4A 3F2DA 1NK5A 4B9UA 4UB6U 3ETRA 2ZG6A 5AI9A 1MQ2A 1SGGA 1S97A 2YY6A 4C8MA 2VIXA 4K4IA 4F8RA 1S0VA 2W8LA 3RFAA 2EDUA 4FFDA 2W9BA 4EBCA 5ALTA 5J2AA 4EBEA 4UQGA 4IRCA 1J2MA 3PO4A 1BPYA 2KSOB 1S5LU 3IP4B 2HHQA 5EWFA 2YN4A 2PFOA 3ZDCA 4KLQA 3D2QA 1S77D 1L5UA 1SXEA 3RAQA 2PFNA 5KFYA 3BS7A 3OTQA 2FE9A 4OJ5A 4NLGA 2HCFA 3WK5A 2PKEA 4IQWA 1PUZA 3WKDA 3MGHA 2GO7A 1QQ6A 4KLTA 1DK2A 5CRXA 2JR5A 9ICQA 4DL6A 4A8EA 5CR0A 8ICWA 4GLXA 3CRXA 3WKCA 3E58A 1RG6A 2K8BB 4IR9A 8ICLA 3N7PD 3RJEA 2ZXIA 4I2IA 4QZHA 2CXYA 1P7DA 2KG5A 3GQCA 5HP4A 4UAZA 4M2YA 4J9PA 1D9FA 4BWMA 2F44A 4RU9A 1ZQIA 2YMLA 3N97B 2FLLA 4ICAA 4F5RA 5J8YC 5AI5A 4PPXA 3RB6A 4F5QA 5AM4A 4KLJA 1J97A 5F9LA 2W3RA 2NRVA 9ICCA 4TUPA 3ONNA 5J0OA 2ASLA 3F2BA 2W9AA 3PW2A 4Q8EA 1Z19A 4OJLA 1BVSA 4PGQA 2Y1JA 2H3VA 3AM9A 2DBYA 2LYHA 4PHAA 5C5JA 4NXZA 1T94A 3MGVA 3AL0B 2HOQA 4NWIA 2I6XA 2G07A 1X9WA 1U47A 1ZQLA 5AHXA 4WJ3B 1BNOA 5KL1B 3WK8A 2JZBA 4BUGA 5DBBA 5DQHA 1V9PA 4RQ1A 9ICKA 5KG2A 4TURA 1WG8A 2AQ0A 5KFOA 1LB2B 1ZQPA 3KBBA 9ICRA 3B9JA 3V72A 3N4MB 2DFLA 1L8OA 4Y2YA 2Y1IA 1ZQDA 1PK3A 1QSYA 1XNSA 3GV7B 1NK0A 4RNOA 3KD3A 5AI0A 5KG6A 5IIOA 3NVWA 2DF4B 4EYIB 4CGZA 4Q43A 1U45A 1U9LA 3SAFA 5DB8A 4DQSA 3IRUA 2AGQA 2E3TA 4UW9A 3THVA 4ZH4A 3LDAA 3SEIA 4RZRA 4K4GA 1SXDA 1PVPA 4IQVA 8ICAA 2KJ9A 3H8SA 2P6RA 7ICUA 5J0TA 7ICQA 4NL9A 3VCBA 4C7YA 2IMWP 3H4BA 4KMOB 2W11A 9ICLA 4M0AA 2NO4A 4PH5A 3EPIA 1ZETA 2DGZA 2VJ4A 7ICGA 3UQ0A 4F93B 2BCUA 1RYRA 2ZJ8A 5EE1A 4DFPA 2G5IB 4PHDA 2OM6A 4UARA 1MQ3A 2ATLA 2ZUBA 2JEFA 3RJFA 2KVSA 1ZJMA 4EEYA 2K89A 1TK0A 1S9FA 4UASA 3C2LA 5JU5A 1UT8A 3UXPA 3PSTA 5ALHA 2HVIA 3FC4A 1RYUA 1NK6A 5F3XB 2ZIXB 1C7YA 2ISPA 1UPHA 5DG7A 1SL2A 4IQTA 4CCHA 2V9WA 4JK1A 4F5OA 1SWWA 5JRTA 1ZQRA 2HHWA 4KLDA 1N48A 4F4WA 2P66A 4KLGA 1ZQMA 4UB8U 2F1HA 2BCSA 3LWMA 2F1JA 1ZQVA 5AM5A 4KTQA 3UQ2A 4DLGA 2ZTCA 2QARA 1L8LA 5H2FU 2DL0A 4AYBC 1GO3F 3E2EA 5KG3A 4C4RA 5E79U 3NVZA 2W3SA 5CP2A 4Y2VA 3ZDBA 1ZOLA 1KDHA 4C8NA 2NO5A 5AIBA 3OSNA 5KFFA 4ECTA 4ECZA 4KLLA 4YXJA 4YD1A 2JHDA 1KN5A 2BDUA 3SYZA 5DLFA 2EAPA 5J2JA 4B9VA 4Z6DA 4BJQA 5ALYA 4AYBF 1NK4A 5AKIA 3HWTA 3IN5A 1NK8A 3GZFA 4ED0A 4UAWA 3TFSA 2GLEA 4NLZA 4NL9C 4Z6CA 1DRGA 3DV9A 4B9MA 1JI7A 3MABA 4EEKA 3TADA 4ECVA 7ICNA 2BZFA 8ICJA 3TARA 5KT5A 4I28A 2FI1A 1D8LA 5KFBA 4YCXA 4P0QA 4I2GA 2KFNA 2HBJA 4Y2SA 1LKYA 3C23A 3F5EA 4QZAA 4F4XA 3AMZA 5KG7A 2IOHA 1J2NA 2KE7A 5DBAA 5ALSA 1XWLA 3SQIA 4ELTA 4B9NA 4DSLA 4PGXA 3PSPA 4ED1A 2JMGA 2KKVA 2QB0A 2YQEA 5AKEA 1IIPA 3GU3A 1ZD4A 7ICEA 2KVCA 3EWAA 5GTHU 4B6JA 1VLBA 1KBUA 8ICCA 2XC9A 4J9SA 1ZRNA 4JWMA 4NM2A 4Y2QA 4Q8FA 2YX8A 4TQSA 3QX7A 2BCVA 4DFKA 5D46A 4OD0A 2K8AA 2IOFK 4TUSA 3IG5A 2XO7A 1L3VA 5HR6A 2R8GA 2YMQA 3WK7A 3B0XA 4R66A 4XQ8A 5J0YA 2Y0SC 3HKZC 3ZD8A 5ALRA 5CHGA 1RPLA 4M6WA 2WF9A 1QSSA 4PJ0U 5ALMA 3SD7A 4O3SA 1N56A 2C2RA 9ICPA 3CYMA 5DB7A 2O6KA 2W7OA 3MDAA 8ICBA 2FPLA 4I2HA 1KFTA 4JUZA 3MR2A 2Y0SF 3HKZF 4DL3A 2OHFA 1MA7A 8ICXA 3NASA 2OCEA 3L3FX 4NJ8A 3WU2U 4BXOA 3JPQA 4BX9C 4QZFA 4OJ6A 4KLOA 3GILA 3QU7A 3Q8QB 2BQUA 1NZBA 4KLMA 3UXNA 1LVHA 5J0SA 3TADC 5C0YA 1T3QA 2PI5A 5L1KA 4DSEA 1NI3A 1X66A 2F8LA 1EXNA 9ICTA 1ZYQA 1TAQA 1KL9A 1PVQA 3OJUA 4DEZA 3AQFA 2Y9UA 4R8UA 2GWSA 4DOAA 3N28A 4DF8A 2IHNA 4UATA 5DG8A 3PX6A 3GIMA 4C8OA 3C5GA 5ALKA 2P35A 5AM2A 3V6JA 3PSIA 4EX6A 4F4YA 2FMPA 2HBKA 2J6TA 3TI0A 3H7IA 2F76X 2Q4TA 2M9NA 5ALWA 3WKAA 2A1JA 4I2AA 1KLNA 4M9NA 3ED5A 4O3MA 1JN3A 4ED7A 4KN7A 3QZ7A 2XY7A 5CA7A 5BPCA 4U6PA 3IDWA 4I2CA 4RQMA 3LYSA 4Y2XA 2G06A 4MFCA 1KRPA 2IBKA 1ZD3A 5KFZA 3GDXA 5KT6A 2ZTEA 4ECQA 1MC8A 2W9MA 5AK6A 3BS5B 4RQ8A 4O3PA 2UVVA 2Y9TA 3N7SC 4LZDA 2WHEA 2HBLA 2NRTA 4NV0A 2F77X 4KITB 5AIAA 1ZQEA 3A0HU 2W55A 2OH2A 3SV4A 3SAHA 1TK5A 4P0PB 2WF5A 4I2EA 1BPXA 1SZHA 1BNPA 3G6YA 1RXWA 4J9QA 1UA0A 2HOIA 2W03A 1ECWA 3HT3A 2VJ5A 3FM9A 2QLTA 2YMPA 2ASDA 4FZLA 4Y2TA 1ZQBA 3AEVA 5KFQA 3N7RC 2KJ8A 5KFMA 4CE6A 4O5CA 4DL5A 2W9CA 4LJXA 5B5EU 3V7LA 4UB3A 9ICMA 4QZGA 1OW5A 2LM1A 1K5OA 2A3VA 4GIBA 3SR6A 2PXIA 4B9TA 1KKXA 2EH9A 5KNIA 3PX0A 5ALXA 1L7OA 3QEAZ 1NKBA 5AM1A 3TAPA 3UM9A 2WAQF 1WCNA 2H3FA 3WK4A 2ISOA 4RT3A 2ZIUB 5ALFA 2XY5A 1RQLA 5AKXA 3B0YA 5KFNA 2F1IA 3QU2A 1TE2A 1QSLA 1VJ5A 3E0FA 2VA8A 2NYVA 3ORYA 2XY6A 2RRDA 5KT7A 4MEYA 2WF6A 3V6KA 1IG6A 2BKEA 1RQNA 2HOFA 4KMUA 5KG0A 2WFAA 1V38A 3QU9A 1ZQYA 2JEGA 3JPTA 2M0NA 3WKBA 3OPXA 4KLEA 5BOMA 2FJ6A 3QE9Y 4EZ6A 4I2BA 1SWVA 1ZQHA 1XO0A 4YR3A 4C8LA 3BZKA 2LBOA 9ICXA 2D6FC 1K1QA 8ICPA 1NJZA 5KAIU 1Z1VA 4YG2A 5DGBA 2FMSA 3ZD9A 5TZVA 4B9SA 3M7DA 5DGAA 3KFUF 5AKYA 3AUOA 4P4PA 3C5FA 4CNQA 2EZYA 4CDGA 2C22A 3KHGA 3NVVA 4DQRA 4ED3A 1AROP 5J0UA 3PO5A 5J2FA 3PY8A 4P4MA 1Z00B 3NRZA 4EBDA 2FLNA 5B66U 5KFHA 1N5XA 1SV0A 1FIQA 3GIIA 2KP7A 4F4ZA 4DFMA 4B9LA 3QUBA 2CPRA 2KSOA 1NJWA 4DWIA 4QNLA 2W54A 5ALIA 2MUTB 2KMDA 2KIVA 4IL6U 5KFVA 4LVSA 2BQ3A 3ALRA 4O9MA 3H0LB 4QZEA 3F2CA 2ASJA 9ICSA 1MSWD 4RQ0A 1Q8KA 5AKGA 2MA1A 3J81j 4DSJA 7ICFA 3RJKA 8ICYA 5HHIA 3KOOA 4JV0A 3FAHA 5KFEA 2PI4A 1BPEA 1UCVA 2ZIWB 4JB3A 3KHHA 1N63A 2LMRA 8ICTA 4M47A 1XSLA 3UMBA 3JPRA 2LKYA 4QWAA 2R8JA 4PGYA 2RQ5A 3QYPA 2RLTA 4UB2A 5AK5A 2VA2A 2H3QA 2QB1A 5DDYA 4XRHA 1A6SA 1OUQA 1ZD2P 2G5HB 2R8KA 2HBMA 3MDCA 4QIWF 2CN1A 2KJ5A 3KZXA 5AKJA 7ICJA 2AU0A 4RQNA 2BDPA 1ZD5A 1S0OA 1L7MA 5AI6A 3MR3A 3RAXA 4JV2A 5KTQA 2IHMA 4KLUA 1BPDA 2ZTDA 5AKZA 4ACOA 2NV3A 4FO6A 7ICHA 2IA6A 5DBCA 4O3OA 3PMLA 4O3QA 1M6YA 4RUAA 4Z6FA 8ICEA 3KHLA 4XA5A 4F71A 4QJFB 2QARB 2E8NA 1QTMA 5L9XA 5ALOA 1SV0C 5ALDA 3PNCA 4I29A 7ICIA 4RNNA 4IC9A 4DF4A 1RDFA 2ZUDA 4F4KA 4KN4A 2RDJA 2XVTA 5AK4A 3K75D 3R9KA 1BPBA 1HJPA 9ICJA 3ISDA 3L5KA 2KOBA 2AQ4A 1ZQKA 1B0XA 3M8RA 1XU4A 4KLHA 3SMVA 4GC7A 1DK3A 3C28A 3HP6A 2AGPA 1TFRA 3WK6A 1ZQCA 3OSPA 4JMUA 1SB3C 1IXRA 3ZDAA 2KHVA 1CRXA 4IR1A 9ICHA 1NZPA 1ZQ1C 5AM3A 2G08A 3S6JA 2K60A 4BWJA 1X42A 2DKXA 4IRDA 1SKSA 1ZQAA 3H0RB 4F5NA 4ECXA 2UVUA 1X9XA 5L1JA 2FMQA 1F0MA 3IHQB 3GIJA 3V7JA 4FZNA 2MU2A 5L1LA 3QUTA 3NUQA 1NJXA 4C8KA 4GXKA 4UB1A 2E8PA 5IINA 1F5SA 2KN7A 3U26A 4K4HA 3RTVA 4Y2RA 5ALUA 3PZPA 2R18A 2ZIXA 1WYGA 2XI9A 4UBCA 5EWGA 3DDHA 4DS4A 1XS9D 3JPSA 1JALA 5HMMA 8ICGA 5KFIA 1JMSA 3OGUA 1S0NA 1ZJNA 1U48A 1ZRMA 1RYSA 4MEXA 1NK9A 4O3NA 3L4PA 1FFUA 4FBTA 1QCKA 3H0MB 2NRXA 1NOMA 3G6VA 7ICLA 1SV4A 3M6KA 2KK0A 3NVYA 1WWVA 4NM1A 5AI8A 3SV3A 1NKEA 2DPJA 3MBYA 2ZJ5A 2UVWA 4Y2UA 4R65A 5KG5A 5AKHA 3TAQA 4P4OA 5L1IA 4IQUA 1NKCA 1T8EA 3UXOA 3EZ5A 4ECSA 4NY8A 4I2JA 5IIKA 5GTIU 3QUCA 2E5SA 5ALPA 2J6UA 2A1AA 3LVVA 2DUYA 5ALZA 2ZIVB 1C20A 3NRWA 2UVRA 2KZMA 4C4SA 4DOBA 4YQWA 3PR4A 3GFKB 1Z4OA 5KFWA 5K4LA 4J9MA 4DO9A 5KFKA 4RQ2A 3TANA 4DFDA 1TAMA 1F44A 2CRXA 4OCZA
chains in the Genus database with same CATH topology
2JH1A 2W04A 2Z7JA 5C0YA 2HBJA 3N7RC 4OJLA 2KJ8A 4PL1A 2OXOA 2VIXA 4KX5A 3NUQA 3F5EA 2H3VA 1Q3VA 2K4HA 3DEEA 3RFAA 1Q3UA 2F8LA 3SAGA 2VKQA 5HR7A 2K89A 3SQIA 4C0ZA 4NLCA 1T94A 2KEYA 2RP5A 2A3VA 3PSTA 3MGVA 1PVQA 4QJFB 3AL0B 2HMXA 3O0FA 3PSPA 2HOQA 1YT3A 2H3ZA 4NWIA 3AQFA 2ZIXB 2G07A 2JMGA 3PZPA 2CPRA 2R18A 3IP4B 2N1RA 2KKVA 3M6ZA 2ZIXA 4QNLA 2WB1C 2XI9A 3C29A 2H3IA 2E1EA 1UPHA 2WB1F 1ED1A 1IIPA 2MRLA 4WJ3B 3GU3A 2KNJA 1Z1BA 2OYYA 2KHQA 3D2QA 5KL1B 3ALRA 1NZBA 2KVCA 2KKPA 4BUGA 1KBUA 2WAQC 2K4EA 3H0LB 3F2CA 2WAQF 2H3FA 2YB1A 3PSIA 4FZLA 4IC9A 2HBKA 2W7PA 4OJ5A 2K4IA 2E1FA 5A0LA 2MA1A 2F76X 2Q4TA 2RHFA 2ZIUB 2YX8A 1URJA 4KX3A 2ZIUA 2XVTA 2K8AA 3PSFA 3H0MB 2ZXHA 3AQEA 5HR6A 3IG5A 4NLBA 3E0FA 4O3MA 2DQNB 3F53A 4FE3A 4FZNA 2KICA 5CRXA 1D8BA 4A8EA 1XNSA 2GH1A 2KOBA 4U6PA 3CRXA 3M6KA 4AYBC 2RRDA 2Y0SC 2ZIWB 3HKZC 1GO3F 2G06A 3LYSA 2LYBA 3F5AA 2GOLA 4U7CA 3T79A 2DF4B 2ZIWA 2XICA 3SMVA 2HOFA 2K8BB 3LVWA 2JGAA 3N7PD 4CGZA 2PMZC 3C28A 3SAFA 2G09A 2LKYA 2ZXIA 2M0NA 3OPXA 4OJPA 1P7DA 1PVRA 4GFJA 3D2SA 3CYMA 2F2AB 2LHTA 4JMUA 2W7OA 3N7SC 2JHDA 1XO0A 1HEKA 2BDUA 2H3QA 1PVPA 2KV2A 1WUDA 2KHVA 2HBLA 4NV0A 1CRXA 2KJ9A 3IG8A 1Z19A 2LBOA 2F77X 1A6SA 4PL2A 2D6FC 2E5SA 3VCBA 3ICXA 1ZQ1C 1OUQA 2G5HB 4KMOB 2HBMA 4QIWC 4BJQA 2OH2A 4AYBF 4QIWF 2G08A 2CN1A 2KD1A 2Y0SF 3HKZF 2XIDA 2KJ5A 3KZXA 3LVVA 4ICAA 3SAHA 2YB4A 5KL8B 3D2NA 2ZIVB 3IN5A 3GZFA 2LYAA 4P0PB 4CRXA 2DGZA 3NRWA 1L6NA 3CP8A 1MA7A 2ZIVA 1DRGA 1SZHA 2PMZF 2VJ4A 4P0PA 3H0RB 4OO1J 3L3FX 3M7DA 3KFUF 5T14A 4BX9C 3K1ZA 2JH7A 2KIWA 2G0AA 2K8CB 2CRXA 3F2DA 2HOIA 2W03A 1HIWA 2G5IB 4OJ6A 1ECWA 4OJOA 2VJ5A 4CDGA 4P0QB 1TAMA 1F44A 1A0PA 2OM6A 3ONNA 3RF9A 3VC8A 4ACOA 3F2BA 4FZMA 2ZG6A 4P0QA 2NV3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C0Y A;  2HBJ A;  2RRD A;  1GO3 F;  2HBM A;  4QIW F;  3SAH A;  2HBK A;  4CGZ A;  2E1F A;  3SAG A;  2DGZ A;  3SAF A;  2MA1 A;  2RHF A;  4NLC A;  4OO1 J;  3CYM A;  4QJF B;  1YT3 A;  4NLB A;  4O3M A;  2CPR A;  4CDG A;  2KV2 A;  1WUD A;  1D8B A;  2HBL A;  2E1E A; 
#chains in the Genus database with same CATH topology
 2Z7J A;  2KFZ A;  3MFI A;  1N61 A;  2OXO A;  5J2C A;  2W8K A;  4CF3 A;  3JPP A;  3GV8 B;  4IRK A;  1IM4 A;  3RJG A;  2KEY A;  3EW9 A;  5J2I A;  3RBE A;  2HMX A;  2IOF A;  1COO A;  1CI4 A;  4EEL A;  5DQI A;  5CB1 A;  2BCR A;  5CEH A;  3PX4 A;  3ETL A;  2E1E A;  1YZ7 A;  2HW3 A;  4M9L A;  1K1S A;  2V4Q A;  1N62 A;  3PW4 A;  1FO4 A;  1WWU A;  3PVX A;  3PSF A;  9ICV A;  2BPG A;  1S76 D;  1JXL A;  2DQN B;  7ICT A;  2KIC A;  3KKA A;  2AXT U;  4M9J A;  1KEJ A;  4I27 A;  8ICO A;  1H38 A;  4F92 B;  1ZQN A;  2C28 A;  3RR7 A;  2KTQ A;  2AJQ A;  4ED6 A;  1ZQW A;  4GC6 A;  4UBB A;  2W43 A;  4YMM A;  1NK7 A;  2D3D A;  8ICS A;  3Q8S B;  4CF4 A;  3BDP A;  3H40 A;  3ICX A;  1SZP A;  2KZZ A;  2KD1 A;  1COK A;  1PK1 B;  3PR5 B;  2YB4 A;  5G5H A;  2LYA A;  4FS2 A;  3H8M A;  1T3N A;  4I2D A;  5KT2 A;  4NLK A;  5EWE A;  4DSK A;  1QQ7 A;  3RH6 A;  4ZOH C;  3QZ8 A;  1JXE A;  4RQ4 A;  5AM0 A;  1Y88 A;  4UAV A;  2YTU A;  2ALZ A;  3IM1 A;  4F72 A;  3CNH A;  4QWE A;  1B4F A;  4O0I A;  2W9B B;  5KFG A;  3PV8 A;  3RB0 A;  3ISB A;  1Z4N A;  1S8O A;  4F3O A;  1D8Y A;  3M9N B;  2R8H A;  2H3I A;  2MSN A;  2WB1 F;  3NS1 A;  4QWC A;  2KHQ A;  2WAQ C;  3H8J A;  4DSI A;  2W7P A;  2EZZ A;  3M9M B;  4DQP A;  2NRZ A;  3KZI U;  1NJY A;  4EZ9 A;  3M1Y A;  5HHH A;  2A19 A;  2DWQ A;  3KKA C;  3ZDE A;  2JGA A;  2C2D A;  2PMZ C;  8ICM A;  5KFL A;  3UMC A;  3D2S A;  2F2A B;  2L5Y A;  3BS5 A;  2ES6 A;  5HNK A;  1XC9 A;  9ICO A;  1WUD A;  3CW2 C;  3RH4 A;  1U49 A;  3OJS A;  2ODG A;  1KQQ A;  3FYH A;  2FPK A;  4J9R A;  5DDM A;  5KL8 B;  2B0C A;  2PMZ F;  4P0P A;  4OO1 J;  1O08 A;  5TIS U;  4RQ6 A;  1D9D A;  3K1Z A;  4YN4 A;  4BDP A;  1U4B A;  9ICB A;  3QU4 A;  2KIW A;  5III A;  4MFA A;  1TVA A;  7ICO A;  2EQY A;  4QWB A;  3BQ7 A;  2JV3 A;  2HDO A;  4C4T A;  3VC8 A;  1L7N A;  4YXM A;  9ICA A;  4P2H A;  1SL1 A;  4KX5 A;  1UHU A;  1Q3U A;  2BGW A;  1JRP A;  1X40 A;  2HI0 A;  1YZ6 A;  1ZXI A;  3T5J A;  2RP5 A;  4FS1 A;  1CUK A;  1O03 A;  2BCQ A;  5J0R A;  2DPI A;  3TFR A;  1V97 A;  2JZB B;  4CF5 A;  1B43 A;  1Z1B A;  4KLS A;  3QNM A;  2KKP A;  4RT2 A;  2K4E A;  4DQQ A;  2YB1 A;  2DKZ A;  3KHR A;  2K4I A;  1N5W A;  4DL7 A;  4M04 A;  7ICS A;  5DKW A;  4KX3 A;  2MAX A;  4QZB A;  5BOL A;  2ZIU A;  1KW4 A;  3GV5 B;  3I1Y A;  4NLB A;  3F53 A;  1L3T A;  1JUD A;  5DB9 A;  4TUQ A;  4DL4 A;  3C1Z A;  2XGP A;  1PZN A;  2XIC A;  4QZD A;  4DS5 A;  1HUZ A;  1L3U A;  1SKW A;  1PVR A;  4YFK A;  2K4P A;  1DGJ A;  2KZ3 A;  5EE3 A;  2AHO B;  3IG8 A;  1ZQS A;  5J2B A;  8ICV A;  8ICR A;  4QIW C;  5AKK A;  3HW8 A;  2JRZ A;  3JPN A;  3SI8 A;  7ICV A;  2VA3 A;  4Q44 A;  3CP8 A;  2AH5 A;  3PW5 A;  5IIJ A;  5T14 A;  2Q0Z X;  5KFP A;  5DQG A;  4LZG A;  3BQT A;  1X6I A;  1DXS A;  2XCA A;  2NRW A;  9ICG A;  3MFH A;  4YR2 A;  1ZQF A;  4PHP A;  8ICU A;  3HPO A;  4O5K A;  1X9M A;  4UB5 A;  4PL1 A;  3RRG A;  4US9 A;  3SAG A;  3RBD A;  2VKQ A;  2JXJ A;  4YMN A;  5HR7 A;  1SIJ A;  4ECR A;  4F50 A;  1Z00 A;  3RH5 A;  2EZX A;  1ZQG A;  4US8 A;  4UB4 A;  1FFV A;  3PW7 A;  1ZQU A;  1RXV A;  5EE9 A;  1KTQ A;  2N1R A;  4J9L A;  5ALN A;  3PW0 A;  5IIL A;  1SKR A;  2MUT A;  5DLG A;  1DGS A;  4F2R A;  5ALL A;  4Q45 A;  1TV9 A;  3TKA A;  8ICZ A;  2RHF A;  1NNL A;  3HJE A;  2FPM A;  4G9B A;  4JWN A;  5J2D A;  5KFA A;  5ALV A;  4ECW A;  4GXJ A;  4ELV A;  2OEH A;  2HHS A;  1TK8 A;  3RJH A;  1ZQX A;  1ZQZ A;  2LYB A;  5EE0 A;  4U7C A;  4RQ3 A;  2B6G A;  2BPC A;  2ZIW A;  5IIM A;  2EAN A;  4G3I A;  3H8W A;  4RUC A;  2F8K A;  4DFJ A;  2LPE A;  5ALJ A;  2WF8 A;  2E8O A;  9ICN A;  4YVZ A;  2FLP A;  4ELU A;  2I1Q A;  1T4G A;  1KSP A;  1N60 A;  4M9H A;  4QWD A;  1SL0 A;  1ZQQ A;  4ECU A;  4R64 A;  4F91 B;  3JPO A;  4UAU A;  5CJ7 A;  4J9O A;  2XGQ A;  3IV6 A;  1ZQO A;  4YR0 A;  4RPY A;  3AU2 A;  2JH7 A;  4MHV A;  2HVH A;  2G0A A;  4DSF A;  3AU6 A;  1HIW A;  9ICI A;  4R63 A;  4OJO A;  4P0Q B;  5J0P A;  4DCC A;  4FZM A;  3QXG A;  2D8C A;  2W04 A;  1LKY B;  4I2F A;  3V7K A;  7ICK A;  1KFD A;  2K4H A;  3T5L A;  2WTF A;  4MFF A;  3BQ0 A;  4NLC A;  3HIL A;  1QLN A;  1MN8 A;  2QKQ A;  2HHU A;  2V4R A;  2YMM A;  3K4G A;  2QB0 B;  1UQV A;  5KG1 A;  2JEJ A;  1X2I A;  4F2S A;  3V6H A;  4MF2 A;  2OWO A;  3HX0 A;  4ED2 A;  2HHT A;  1BGX T;  9ICW A;  3C21 A;  5KAF U;  4EX7 A;  4RPZ A;  3TAC B;  4O5E A;  4E0D A;  4XUS A;  2LI6 A;  5J2H A;  4YP3 A;  4O3R A;  2AGO A;  5EOZ A;  2BPF A;  2ZXH A;  1LV5 A;  1Q46 A;  2BQR A;  4FE3 A;  1JIH A;  1D8B A;  1XSN A;  1CEZ A;  5J2G A;  1T7P A;  9ICF A;  3BZC A;  3ZI4 A;  2GH1 A;  5AI4 A;  9ICE A;  4QZC A;  4M6W B;  3ZDD A;  1HUO A;  2HSZ A;  3Q8P B;  2GOL A;  4J9K A;  2C2E A;  3T3F A;  3LK9 A;  3PMN A;  1KFS A;  3UMG A;  2G09 A;  4DOC A;  2BHN A;  4OJP A;  4DL2 A;  3Q8K A;  3RR8 A;  2LHT A;  1VDV A;  1XSP A;  5FP0 A;  1HEK A;  2KV2 A;  3H4D A;  1X6J A;  4MF8 A;  2PFQ A;  4RNM A;  3EYZ A;  1JRO A;  3A0B U;  7ICM A;  4AP9 A;  8ICI A;  4C7Z A;  4JV1 A;  3MGI A;  3I76 A;  3D2N A;  1L6N A;  4TQR A;  5G5G A;  1L7P A;  4BXO B;  5J0W A;  4USA A;  2HHX A;  3BQ2 A;  3QUQ A;  3RJI A;  8ICQ A;  3RF9 A;  3LWL A;  4Y2P A;  4PHE A;  2RDI A;  3RB3 A;  2JH1 A;  2WF7 A;  1IV8 A;  5J2E A;  4UAY A;  4J03 A;  1FEZ A;  3T5K A;  1ZQT A;  2ZUC A;  1S10 A;  3DEE A;  4IS7 A;  4EEN A;  2I5H A;  5KFC A;  3EPG A;  4R8U B;  2H3Z A;  1WCL A;  1DOQ A;  4KLI A;  5ALG A;  1XO1 A;  3GIK A;  2MRL A;  4HAI A;  2KNJ A;  1L3S A;  1QQ5 A;  2ZJA A;  8ICN A;  4BGD A;  4QZI A;  4Y2J A;  7ICP A;  5A0L A;  5JUM A;  4FBU A;  5JTI A;  2A1J B;  1RZT A;  4C80 A;  1UA1 A;  3RJJ A;  1URJ A;  7ICR A;  2HHV A;  5J29 A;  5J0X A;  2F3N A;  1A77 A;  3AQE A;  4QW9 A;  5KG4 A;  2B21 A;  4ED8 A;  4PZO A;  1AQ6 A;  5ALQ A;  3EUB 2;  4KLF A;  3F5A A;  3BQ1 A;  3T79 A;  3BJY A;  9ICU A;  3AN1 A;  3LVW A;  5ALE A;  4YD2 A;  4GFJ A;  8ICK A;  2BR0 A;  2LM4 A;  3Q8L A;  1N2X A;  5DG9 A;  5AK3 A;  3SZ2 A;  3NGD A;  5DB6 A;  4PL2 A;  2J6S A;  5KFS A;  3Q8R B;  4X5V A;  3OHB A;  2XID A;  4M9G A;  2EAO A;  4CRX A;  4DQI A;  4J9N A;  2ZIV A;  5D4B A;  4RPX A;  1S0M A;  1V85 A;  2K8C B;  3WK9 A;  4PZN A;  5KFJ A;  1A0P A;  3WKE A;  4C0Z A;  1TAU A;  4HYK A;  3NTU A;  8ICH A;  2W9C B;  3M8S A;  1Q3V A;  1OXJ A;  2VAN A;  2JEI A;  1A76 A;  5AIC A;  1UT5 A;  3MC1 A;  3O0F A;  5KT3 A;  1YT3 A;  5J2K A;  4YMO A;  5KFR A;  1ZQJ A;  4GXI A;  4RQ5 A;  3K1R B;  3M6Z A;  2WB1 C;  3C29 A;  3QEB Z;  2ESE A;  3MR5 A;  1ED1 A;  3RRH A;  3G6X A;  3HRD D;  2OYY A;  4ECY A;  3T5H A;  1B22 A;  1RM6 C;  4DLE A;  3MR6 A;  2E1F A;  3I28 A;  2R8I A;  4NLN A;  5KFX A;  3ISC A;  4RQ7 A;  8ICF A;  5J0Q A;  4QW8 A;  2FDR A;  3TQ1 A;  4QZ9 A;  3C2K A;  2XCP A;  1X9S A;  5D49 A;  5HML A;  1BPZ A;  5CWR A;  4EYH B;  3C1Y A;  3C2M A;  1QH9 A;  3RB4 A;  3SEN A;  4F5P A;  4QZ8 A;  2I9G A;  2P6U A;  5KFU A;  2H5X A;  3M9O B;  2PFP A;  5KFD A;  1TKD A;  3KTQ A;  5J8Y A;  4Z6E A;  5F9N A;  3FDS A;  1Z3E B;  5KT4 A;  2EAM A;  3Q8M A;  3UPQ A;  5KFT A;  5AKL A;  1PK1 A;  3QU5 A;  5L1M A;  3OHA A;  2E8M A;  3D6J A;  1JX4 A;  3F2D A;  1NK5 A;  4B9U A;  4UB6 U;  3ETR A;  2ZG6 A;  5AI9 A;  1MQ2 A;  1SGG A;  1S97 A;  2YY6 A;  4C8M A;  2VIX A;  4K4I A;  4F8R A;  1S0V A;  2W8L A;  3RFA A;  2EDU A;  4FFD A;  2W9B A;  4EBC A;  5ALT A;  5J2A A;  4EBE A;  4UQG A;  4IRC A;  1J2M A;  3PO4 A;  1BPY A;  2KSO B;  1S5L U;  3IP4 B;  2HHQ A;  5EWF A;  2YN4 A;  2PFO A;  3ZDC A;  4KLQ A;  3D2Q A;  1S77 D;  1L5U A;  1SXE A;  3RAQ A;  2PFN A;  5KFY A;  3BS7 A;  3OTQ A;  2FE9 A;  4OJ5 A;  4NLG A;  2HCF A;  3WK5 A;  2PKE A;  4IQW A;  1PUZ A;  3WKD A;  3MGH A;  2GO7 A;  1QQ6 A;  4KLT A;  1DK2 A;  5CRX A;  2JR5 A;  9ICQ A;  4DL6 A;  4A8E A;  5CR0 A;  8ICW A;  4GLX A;  3CRX A;  3WKC A;  3E58 A;  1RG6 A;  2K8B B;  4IR9 A;  8ICL A;  3N7P D;  3RJE A;  2ZXI A;  4I2I A;  4QZH A;  2CXY A;  1P7D A;  2KG5 A;  3GQC A;  5HP4 A;  4UAZ A;  4M2Y A;  4J9P A;  1D9F A;  4BWM A;  2F44 A;  4RU9 A;  1ZQI A;  2YML A;  3N97 B;  2FLL A;  4ICA A;  4F5R A;  5J8Y C;  5AI5 A;  4PPX A;  3RB6 A;  4F5Q A;  5AM4 A;  4KLJ A;  1J97 A;  5F9L A;  2W3R A;  2NRV A;  9ICC A;  4TUP A;  3ONN A;  5J0O A;  2ASL A;  3F2B A;  2W9A A;  3PW2 A;  4Q8E A;  1Z19 A;  4OJL A;  1BVS A;  4PGQ A;  2Y1J A;  2H3V A;  3AM9 A;  2DBY A;  2LYH A;  4PHA A;  5C5J A;  4NXZ A;  1T94 A;  3MGV A;  3AL0 B;  2HOQ A;  4NWI A;  2I6X A;  2G07 A;  1X9W A;  1U47 A;  1ZQL A;  5AHX A;  4WJ3 B;  1BNO A;  5KL1 B;  3WK8 A;  2JZB A;  4BUG A;  5DBB A;  5DQH A;  1V9P A;  4RQ1 A;  9ICK A;  5KG2 A;  4TUR A;  1WG8 A;  2AQ0 A;  5KFO A;  1LB2 B;  1ZQP A;  3KBB A;  9ICR A;  3B9J A;  3V72 A;  3N4M B;  2DFL A;  1L8O A;  4Y2Y A;  2Y1I A;  1ZQD A;  1PK3 A;  1QSY A;  1XNS A;  3GV7 B;  1NK0 A;  4RNO A;  3KD3 A;  5AI0 A;  5KG6 A;  5IIO A;  3NVW A;  2DF4 B;  4EYI B;  4CGZ A;  4Q43 A;  1U45 A;  1U9L A;  3SAF A;  5DB8 A;  4DQS A;  3IRU A;  2AGQ A;  2E3T A;  4UW9 A;  3THV A;  4ZH4 A;  3LDA A;  3SEI A;  4RZR A;  4K4G A;  1SXD A;  1PVP A;  4IQV A;  8ICA A;  2KJ9 A;  3H8S A;  2P6R A;  7ICU A;  5J0T A;  7ICQ A;  4NL9 A;  3VCB A;  4C7Y A;  2IMW P;  3H4B A;  4KMO B;  2W11 A;  9ICL A;  4M0A A;  2NO4 A;  4PH5 A;  3EPI A;  1ZET A;  2DGZ A;  2VJ4 A;  7ICG A;  3UQ0 A;  4F93 B;  2BCU A;  1RYR A;  2ZJ8 A;  5EE1 A;  4DFP A;  2G5I B;  4PHD A;  2OM6 A;  4UAR A;  1MQ3 A;  2ATL A;  2ZUB A;  2JEF A;  3RJF A;  2KVS A;  1ZJM A;  4EEY A;  2K89 A;  1TK0 A;  1S9F A;  4UAS A;  3C2L A;  5JU5 A;  1UT8 A;  3UXP A;  3PST A;  5ALH A;  2HVI A;  3FC4 A;  1RYU A;  1NK6 A;  5F3X B;  2ZIX B;  1C7Y A;  2ISP A;  1UPH A;  5DG7 A;  1SL2 A;  4IQT A;  4CCH A;  2V9W A;  4JK1 A;  4F5O A;  1SWW A;  5JRT A;  1ZQR A;  2HHW A;  4KLD A;  1N48 A;  4F4W A;  2P66 A;  4KLG A;  1ZQM A;  4UB8 U;  2F1H A;  2BCS A;  3LWM A;  2F1J A;  1ZQV A;  5AM5 A;  4KTQ A;  3UQ2 A;  4DLG A;  2ZTC A;  2QAR A;  1L8L A;  5H2F U;  2DL0 A;  4AYB C;  1GO3 F;  3E2E A;  5KG3 A;  4C4R A;  5E79 U;  3NVZ A;  2W3S A;  5CP2 A;  4Y2V A;  3ZDB A;  1ZOL A;  1KDH A;  4C8N A;  2NO5 A;  5AIB A;  3OSN A;  5KFF A;  4ECT A;  4ECZ A;  4KLL A;  4YXJ A;  4YD1 A;  2JHD A;  1KN5 A;  2BDU A;  3SYZ A;  5DLF A;  2EAP A;  5J2J A;  4B9V A;  4Z6D A;  4BJQ A;  5ALY A;  4AYB F;  1NK4 A;  5AKI A;  3HWT A;  3IN5 A;  1NK8 A;  3GZF A;  4ED0 A;  4UAW A;  3TFS A;  2GLE A;  4NLZ A;  4NL9 C;  4Z6C A;  1DRG A;  3DV9 A;  4B9M A;  1JI7 A;  3MAB A;  4EEK A;  3TAD A;  4ECV A;  7ICN A;  2BZF A;  8ICJ A;  3TAR A;  5KT5 A;  4I28 A;  2FI1 A;  1D8L A;  5KFB A;  4YCX A;  4P0Q A;  4I2G A;  2KFN A;  2HBJ A;  4Y2S A;  1LKY A;  3C23 A;  3F5E A;  4QZA A;  4F4X A;  3AMZ A;  5KG7 A;  2IOH A;  1J2N A;  2KE7 A;  5DBA A;  5ALS A;  1XWL A;  3SQI A;  4ELT A;  4B9N A;  4DSL A;  4PGX A;  3PSP A;  4ED1 A;  2JMG A;  2KKV A;  2QB0 A;  2YQE A;  5AKE A;  1IIP A;  3GU3 A;  1ZD4 A;  7ICE A;  2KVC A;  3EWA A;  5GTH U;  4B6J A;  1VLB A;  1KBU A;  8ICC A;  2XC9 A;  4J9S A;  1ZRN A;  4JWM A;  4NM2 A;  4Y2Q A;  4Q8F A;  2YX8 A;  4TQS A;  3QX7 A;  2BCV A;  4DFK A;  5D46 A;  4OD0 A;  2K8A A;  2IOF K;  4TUS A;  3IG5 A;  2XO7 A;  1L3V A;  5HR6 A;  2R8G A;  2YMQ A;  3WK7 A;  3B0X A;  4R66 A;  4XQ8 A;  5J0Y A;  2Y0S C;  3HKZ C;  3ZD8 A;  5ALR A;  5CHG A;  1RPL A;  4M6W A;  2WF9 A;  1QSS A;  4PJ0 U;  5ALM A;  3SD7 A;  4O3S A;  1N56 A;  2C2R A;  9ICP A;  3CYM A;  5DB7 A;  2O6K A;  2W7O A;  3MDA A;  8ICB A;  2FPL A;  4I2H A;  1KFT A;  4JUZ A;  3MR2 A;  2Y0S F;  3HKZ F;  4DL3 A;  2OHF A;  1MA7 A;  8ICX A;  3NAS A;  2OCE A;  3L3F X;  4NJ8 A;  3WU2 U;  4BXO A;  3JPQ A;  4BX9 C;  4QZF A;  4OJ6 A;  4KLO A;  3GIL A;  3QU7 A;  3Q8Q B;  2BQU A;  1NZB A;  4KLM A;  3UXN A;  1LVH A;  5J0S A;  3TAD C;  5C0Y A;  1T3Q A;  2PI5 A;  5L1K A;  4DSE A;  1NI3 A;  1X66 A;  2F8L A;  1EXN A;  9ICT A;  1ZYQ A;  1TAQ A;  1KL9 A;  1PVQ A;  3OJU A;  4DEZ A;  3AQF A;  2Y9U A;  4R8U A;  2GWS A;  4DOA A;  3N28 A;  4DF8 A;  2IHN A;  4UAT A;  5DG8 A;  3PX6 A;  3GIM A;  4C8O A;  3C5G A;  5ALK A;  2P35 A;  5AM2 A;  3V6J A;  3PSI A;  4EX6 A;  4F4Y A;  2FMP A;  2HBK A;  2J6T A;  3TI0 A;  3H7I A;  2F76 X;  2Q4T A;  2M9N A;  5ALW A;  3WKA A;  2A1J A;  4I2A A;  1KLN A;  4M9N A;  3ED5 A;  4O3M A;  1JN3 A;  4ED7 A;  4KN7 A;  3QZ7 A;  2XY7 A;  5CA7 A;  5BPC A;  4U6P A;  3IDW A;  4I2C A;  4RQM A;  3LYS A;  4Y2X A;  2G06 A;  4MFC A;  1KRP A;  2IBK A;  1ZD3 A;  5KFZ A;  3GDX A;  5KT6 A;  2ZTE A;  4ECQ A;  1MC8 A;  2W9M A;  5AK6 A;  3BS5 B;  4RQ8 A;  4O3P A;  2UVV A;  2Y9T A;  3N7S C;  4LZD A;  2WHE A;  2HBL A;  2NRT A;  4NV0 A;  2F77 X;  4KIT B;  5AIA A;  1ZQE A;  3A0H U;  2W55 A;  2OH2 A;  3SV4 A;  3SAH A;  1TK5 A;  4P0P B;  2WF5 A;  4I2E A;  1BPX A;  1SZH A;  1BNP A;  3G6Y A;  1RXW A;  4J9Q A;  1UA0 A;  2HOI A;  2W03 A;  1ECW A;  3HT3 A;  2VJ5 A;  3FM9 A;  2QLT A;  2YMP A;  2ASD A;  4FZL A;  4Y2T A;  1ZQB A;  3AEV A;  5KFQ A;  3N7R C;  2KJ8 A;  5KFM A;  4CE6 A;  4O5C A;  4DL5 A;  2W9C A;  4LJX A;  5B5E U;  3V7L A;  4UB3 A;  9ICM A;  4QZG A;  1OW5 A;  2LM1 A;  1K5O A;  2A3V A;  4GIB A;  3SR6 A;  2PXI A;  4B9T A;  1KKX A;  2EH9 A;  5KNI A;  3PX0 A;  5ALX A;  1L7O A;  3QEA Z;  1NKB A;  5AM1 A;  3TAP A;  3UM9 A;  2WAQ F;  1WCN A;  2H3F A;  3WK4 A;  2ISO A;  4RT3 A;  2ZIU B;  5ALF A;  2XY5 A;  1RQL A;  5AKX A;  3B0Y A;  5KFN A;  2F1I A;  3QU2 A;  1TE2 A;  1QSL A;  1VJ5 A;  3E0F A;  2VA8 A;  2NYV A;  3ORY A;  2XY6 A;  2RRD A;  5KT7 A;  4MEY A;  2WF6 A;  3V6K A;  1IG6 A;  2BKE A;  1RQN A;  2HOF A;  4KMU A;  5KG0 A;  2WFA A;  1V38 A;  3QU9 A;  1ZQY A;  2JEG A;  3JPT A;  2M0N A;  3WKB A;  3OPX A;  4KLE A;  5BOM A;  2FJ6 A;  3QE9 Y;  4EZ6 A;  4I2B A;  1SWV A;  1ZQH A;  1XO0 A;  4YR3 A;  4C8L A;  3BZK A;  2LBO A;  9ICX A;  2D6F C;  1K1Q A;  8ICP A;  1NJZ A;  5KAI U;  1Z1V A;  4YG2 A;  5DGB A;  2FMS A;  3ZD9 A;  5TZV A;  4B9S A;  3M7D A;  5DGA A;  3KFU F;  5AKY A;  3AUO A;  4P4P A;  3C5F A;  4CNQ A;  2EZY A;  4CDG A;  2C22 A;  3KHG A;  3NVV A;  4DQR A;  4ED3 A;  1ARO P;  5J0U A;  3PO5 A;  5J2F A;  3PY8 A;  4P4M A;  1Z00 B;  3NRZ A;  4EBD A;  2FLN A;  5B66 U;  5KFH A;  1N5X A;  1SV0 A;  1FIQ A;  3GII A;  2KP7 A;  4F4Z A;  4DFM A;  4B9L A;  3QUB A;  2CPR A;  2KSO A;  1NJW A;  4DWI A;  4QNL A;  2W54 A;  5ALI A;  2MUT B;  2KMD A;  2KIV A;  4IL6 U;  5KFV A;  4LVS A;  2BQ3 A;  3ALR A;  4O9M A;  3H0L B;  4QZE A;  3F2C A;  2ASJ A;  9ICS A;  1MSW D;  4RQ0 A;  1Q8K A;  5AKG A;  2MA1 A;  3J81 j;  4DSJ A;  7ICF A;  3RJK A;  8ICY A;  5HHI A;  3KOO A;  4JV0 A;  3FAH A;  5KFE A;  2PI4 A;  1BPE A;  1UCV A;  2ZIW B;  4JB3 A;  3KHH A;  1N63 A;  2LMR A;  8ICT A;  4M47 A;  1XSL A;  3UMB A;  3JPR A;  2LKY A;  4QWA A;  2R8J A;  4PGY A;  2RQ5 A;  3QYP A;  2RLT A;  4UB2 A;  5AK5 A;  2VA2 A;  2H3Q A;  2QB1 A;  5DDY A;  4XRH A;  1A6S A;  1OUQ A;  1ZD2 P;  2G5H B;  2R8K A;  2HBM A;  3MDC A;  4QIW F;  2CN1 A;  2KJ5 A;  3KZX A;  5AKJ A;  7ICJ A;  2AU0 A;  4RQN A;  2BDP A;  1ZD5 A;  1S0O A;  1L7M A;  5AI6 A;  3MR3 A;  3RAX A;  4JV2 A;  5KTQ A;  2IHM A;  4KLU A;  1BPD A;  2ZTD A;  5AKZ A;  4ACO A;  2NV3 A;  4FO6 A;  7ICH A;  2IA6 A;  5DBC A;  4O3O A;  3PML A;  4O3Q A;  1M6Y A;  4RUA A;  4Z6F A;  8ICE A;  3KHL A;  4XA5 A;  4F71 A;  4QJF B;  2QAR B;  2E8N A;  1QTM A;  5L9X A;  5ALO A;  1SV0 C;  5ALD A;  3PNC A;  4I29 A;  7ICI A;  4RNN A;  4IC9 A;  4DF4 A;  1RDF A;  2ZUD A;  4F4K A;  4KN4 A;  2RDJ A;  2XVT A;  5AK4 A;  3K75 D;  3R9K A;  1BPB A;  1HJP A;  9ICJ A;  3ISD A;  3L5K A;  2KOB A;  2AQ4 A;  1ZQK A;  1B0X A;  3M8R A;  1XU4 A;  4KLH A;  3SMV A;  4GC7 A;  1DK3 A;  3C28 A;  3HP6 A;  2AGP A;  1TFR A;  3WK6 A;  1ZQC A;  3OSP A;  4JMU A;  1SB3 C;  1IXR A;  3ZDA A;  2KHV A;  1CRX A;  4IR1 A;  9ICH A;  1NZP A;  1ZQ1 C;  5AM3 A;  2G08 A;  3S6J A;  2K60 A;  4BWJ A;  1X42 A;  2DKX A;  4IRD A;  1SKS A;  1ZQA A;  3H0R B;  4F5N A;  4ECX A;  2UVU A;  1X9X A;  5L1J A;  2FMQ A;  1F0M A;  3IHQ B;  3GIJ A;  3V7J A;  4FZN A;  2MU2 A;  5L1L A;  3QUT A;  3NUQ A;  1NJX A;  4C8K A;  4GXK A;  4UB1 A;  2E8P A;  5IIN A;  1F5S A;  2KN7 A;  3U26 A;  4K4H A;  3RTV A;  4Y2R A;  5ALU A;  3PZP A;  2R18 A;  2ZIX A;  1WYG A;  2XI9 A;  4UBC A;  5EWG A;  3DDH A;  4DS4 A;  1XS9 D;  3JPS A;  1JAL A;  5HMM A;  8ICG A;  5KFI A;  1JMS A;  3OGU A;  1S0N A;  1ZJN A;  1U48 A;  1ZRM A;  1RYS A;  4MEX A;  1NK9 A;  4O3N A;  3L4P A;  1FFU A;  4FBT A;  1QCK A;  3H0M B;  2NRX A;  1NOM A;  3G6V A;  7ICL A;  1SV4 A;  3M6K A;  2KK0 A;  3NVY A;  1WWV A;  4NM1 A;  5AI8 A;  3SV3 A;  1NKE A;  2DPJ A;  3MBY A;  2ZJ5 A;  2UVW A;  4Y2U A;  4R65 A;  5KG5 A;  5AKH A;  3TAQ A;  4P4O A;  5L1I A;  4IQU A;  1NKC A;  1T8E A;  3UXO A;  3EZ5 A;  4ECS A;  4NY8 A;  4I2J A;  5IIK A;  5GTI U;  3QUC A;  2E5S A;  5ALP A;  2J6U A;  2A1A A;  3LVV A;  2DUY A;  5ALZ A;  2ZIV B;  1C20 A;  3NRW A;  2UVR A;  2KZM A;  4C4S A;  4DOB A;  4YQW A;  3PR4 A;  3GFK B;  1Z4O A;  5KFW A;  5K4L A;  4J9M A;  4DO9 A;  5KFK A;  4RQ2 A;  3TAN A;  4DFD A;  1TAM A;  1F44 A;  2CRX A;  4OCZ A; 
#chains in the Genus database with same CATH homology
 2JH1 A;  2W04 A;  2Z7J A;  5C0Y A;  2HBJ A;  3N7R C;  4OJL A;  2KJ8 A;  4PL1 A;  2OXO A;  2VIX A;  4KX5 A;  3NUQ A;  3F5E A;  2H3V A;  1Q3V A;  2K4H A;  3DEE A;  3RFA A;  1Q3U A;  2F8L A;  3SAG A;  2VKQ A;  5HR7 A;  2K89 A;  3SQI A;  4C0Z A;  4NLC A;  1T94 A;  2KEY A;  2RP5 A;  2A3V A;  3PST A;  3MGV A;  1PVQ A;  4QJF B;  3AL0 B;  2HMX A;  3O0F A;  3PSP A;  2HOQ A;  1YT3 A;  2H3Z A;  4NWI A;  3AQF A;  2ZIX B;  2G07 A;  2JMG A;  3PZP A;  2CPR A;  2R18 A;  3IP4 B;  2N1R A;  2KKV A;  3M6Z A;  2ZIX A;  4QNL A;  2WB1 C;  2XI9 A;  3C29 A;  2H3I A;  2E1E A;  1UPH A;  2WB1 F;  1ED1 A;  1IIP A;  2MRL A;  4WJ3 B;  3GU3 A;  2KNJ A;  1Z1B A;  2OYY A;  2KHQ A;  3D2Q A;  5KL1 B;  3ALR A;  1NZB A;  2KVC A;  2KKP A;  4BUG A;  1KBU A;  2WAQ C;  2K4E A;  3H0L B;  3F2C A;  2WAQ F;  2H3F A;  2YB1 A;  3PSI A;  4FZL A;  4IC9 A;  2HBK A;  2W7P A;  4OJ5 A;  2K4I A;  2E1F A;  5A0L A;  2MA1 A;  2F76 X;  2Q4T A;  2RHF A;  2ZIU B;  2YX8 A;  1URJ A;  4KX3 A;  2ZIU A;  2XVT A;  2K8A A;  3PSF A;  3H0M B;  2ZXH A;  3AQE A;  5HR6 A;  3IG5 A;  4NLB A;  3E0F A;  4O3M A;  2DQN B;  3F53 A;  4FE3 A;  4FZN A;  2KIC A;  5CRX A;  1D8B A;  4A8E A;  1XNS A;  2GH1 A;  2KOB A;  4U6P A;  3CRX A;  3M6K A;  4AYB C;  2RRD A;  2Y0S C;  2ZIW B;  3HKZ C;  1GO3 F;  2G06 A;  3LYS A;  2LYB A;  3F5A A;  2GOL A;  4U7C A;  3T79 A;  2DF4 B;  2ZIW A;  2XIC A;  3SMV A;  2HOF A;  2K8B B;  3LVW A;  2JGA A;  3N7P D;  4CGZ A;  2PMZ C;  3C28 A;  3SAF A;  2G09 A;  2LKY A;  2ZXI A;  2M0N A;  3OPX A;  4OJP A;  1P7D A;  1PVR A;  4GFJ A;  3D2S A;  3CYM A;  2F2A B;  2LHT A;  4JMU A;  2W7O A;  3N7S C;  2JHD A;  1XO0 A;  1HEK A;  2BDU A;  2H3Q A;  1PVP A;  2KV2 A;  1WUD A;  2KHV A;  2HBL A;  4NV0 A;  1CRX A;  2KJ9 A;  3IG8 A;  1Z19 A;  2LBO A;  2F77 X;  1A6S A;  4PL2 A;  2D6F C;  2E5S A;  3VCB A;  3ICX A;  1ZQ1 C;  1OUQ A;  2G5H B;  4KMO B;  2HBM A;  4QIW C;  4BJQ A;  2OH2 A;  4AYB F;  4QIW F;  2G08 A;  2CN1 A;  2KD1 A;  2Y0S F;  3HKZ F;  2XID A;  2KJ5 A;  3KZX A;  3LVV A;  4ICA A;  3SAH A;  2YB4 A;  5KL8 B;  3D2N A;  2ZIV B;  3IN5 A;  3GZF A;  2LYA A;  4P0P B;  4CRX A;  2DGZ A;  3NRW A;  1L6N A;  3CP8 A;  1MA7 A;  2ZIV A;  1DRG A;  1SZH A;  2PMZ F;  2VJ4 A;  4P0P A;  3H0R B;  4OO1 J;  3L3F X;  3M7D A;  3KFU F;  5T14 A;  4BX9 C;  3K1Z A;  2JH7 A;  2KIW A;  2G0A A;  2K8C B;  2CRX A;  3F2D A;  2HOI A;  2W03 A;  1HIW A;  2G5I B;  4OJ6 A;  1ECW A;  4OJO A;  2VJ5 A;  4CDG A;  4P0Q B;  1TAM A;  1F44 A;  1A0P A;  2OM6 A;  3ONN A;  3RF9 A;  3VC8 A;  4ACO A;  3F2B A;  4FZM A;  2ZG6 A;  4P0Q A;  2NV3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...