2RHFA

D. radiodurans recq hrdc domain 3
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
76
structure length
76
Chain Sequence
SHNADLSEALRELRRELMKETGYSAFVVFTNATLEALAARQPRTLAELAEVPGLGEKRIEAYGERILDAINTVLDG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA helicase RecQ
publication title Structure and function of the regulatory C-terminal HRDC domain from Deinococcus radiodurans RecQ.
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Hydrolase
total genus 27
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2007-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00570 HRDC HRDC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.80 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2rhfA00
2HBLA 4CGZA 2RHFA 2HBJA 3SAFA 4NLBA 2E1EA 2DGZA 4QIWF 4CDGA 1YT3A 2HBMA 2MA1A 4NLCA 4QJFB 5C0YA 3SAHA 4OO1J 2E1FA 1D8BA 2KV2A 2CPRA 2RRDA 1WUDA 3SAGA 1GO3F 4O3MA 3CYMA 2HBKA
chains in the Genus database with same CATH superfamily
4RPZA 2V9WA 4PPXA 2XY5A 1ZQEA 3D2QA 4I2HA 3PW2A 1A6SA 3KFUF 1CUKA 5CP2A 1N60A 4BWMA 2F1HA 3C2MA 5J2JA 3M9OB 2N1RA 2KG5A 5ALVA 3S6JA 3CYMA 4X5VA 1Q3VA 2K8BB 5ALIA 2W54A 1COKA 3UM9A 5J0YA 4J9SA 3PSPA 1S10A 2IA6A 4DQIA 5J0PA 5HNKA 2BDUA 2BR0A 1SV0C 4R66A 5AKHA 3OJUA 1OW5A 1LV5A 4KLLA 4G3IA 8ICAA 4Q43A 4RT2A 1Z00A 4OJLA 3FM9A 4CNQA 4M9HA 3D6JA 5DDYA 1BPXA 3QUQA 4ED2A 2HOIA 2W9MA 2F3NA 4K4IA 5HMLA 2XGQA 2ZTEA 2KP7A 3AU2A 3BZCA 5JUMA 1N56A 1NI3A 3O0FA 5AK3A 1BNOA 2Q4TA 4B9TA 3KTQA 3QU7A 1JN3A 2W04A 3UMGA 4M47A 5AKKA 2HBLA 1FO4A 4ED8A 3GV5B 4IQTA 5DB6A 3ED5A 2JR5A 2W9BA 3H8JA 1X6JA 5CJ7A 3ZI4A 4UAWA 2RLTA 1NKCA 4PGYA 5F9LA 1SV0A 5JTIA 1C20A 2F77X 1EXNA 2YB4A 2KICA 2ASDA 5K4LA 3QX7A 5J2KA 2LKYA 3EW9A 2GOLA 4PH5A 1F5SA 1PK3A 5DB9A 2JZBA 5ALXA 2K4PA 3WK9A 2I5HA 2KEYA 5B66U 2KE7A 1ZD5A 2RRDA 3PNCA 7ICFA 1KKXA 3T5KA 4NL9A 2KVCA 2W11A 1O08A 5IIIA 3V72A 1SKRA 2KZMA 1MQ3A 2CXYA 4F93B 4MF2A 3MR2A 4KLUA 1BNPA 4RQ8A 3WK4A 4M9LA 4P0QA 4XRHA 1N62A 4RPYA 1KFDA 8ICPA 2DBYA 2LBOA 4O3RA 4QZ8A 1QSSA 2XI9A 4PJ0U 3LYSA 4QWEA 2E3TA 2ZIXA 4RQ5A 5KFHA 1V85A 4C0ZA 1Q3UA 4DSIA 1IM4A 3AMZA 4EX6A 4EYIB 5CRXA 5AI0A 1FEZA 3AN1A 2VJ4A 2BGWA 1FFUA 3F2BA 3C29A 2FMPA 5KG4A 2H3QA 2W7PA 1Z4OA 4C80A 3EPGA 4DOCA 5KFOA 4UB5A 1QTMA 1RYUA 4ECYA 3GV8B 3GILA 4NLNA 2FLNA 1LKYB 4CF3A 3PW5A 1KSPA 4UB1A 3RH6A 3SMVA 4F91B 4KLEA 2ZUDA 2VANA 3NVWA 2Z7JA 4O3MA 3RJIA 9ICKA 3GQCA 2I9GA 3DDHA 3JPTA 5DGAA 2FLLA 3SEIA 5DG8A 2H3FA 4B9UA 3ICXA 5GTIU 4I2AA 1X6IA 1D8LA 5J0TA 3PV8A 1D8YA 2F2AB 2LHTA 3G6XA 5KG5A 3V7KA 3AEVA 4F72A 1BPEA 1X40A 2FPKA 8ICOA 1KDHA 4NJ8A 2KZ3A 3L3FX 3NGDA 5J29A 3NVVA 4CRXA 3PVXA 4DQQA 1L5UA 2HHSA 4EX7A 4C7YA 4UASA 5AI5A 4IR1A 2Y9TA 1X2IA 2DKZA 2IOHA 2WF9A 4UAYA 3E0FA 2NRVA 1RDFA 3V7JA 9ICBA 1JIHA 2KMDA 4UB2A 8ICHA 3PX6A 4NLCA 8ICXA 1PVPA 3QZ8A 4YR0A 4GC7A 2A1JA 2PXIA 2EAOA 3WK7A 4C4SA 8ICGA 4EEYA 4B9SA 3CP8A 3I76A 3BZKA 2C22A 4MFFA 5AM1A 5AIAA 1A0PA 5CHGA 2J6UA 2XY7A 2KK0A 5ALHA 1B4FA 1TAQA 4NXZA 9ICVA 1QSYA 3OGUA 4P4PA 5AI6A 2QLTA 4ED7A 2BZFA 5HHHA 8ICQA 4QW8A 3H0MB 2R8KA 2D3DA 3MABA 2A1AA 5IIKA 5G5GA 5DBCA 5CA7A 2KD1A 1ZQJA 2ZXHA 4GLXA 2FDRA 2FPLA 2BCQA 2KOBA 4DSJA 4I2CA 2K4HA 5F3XB 1T4GA 3AM9A 4JV0A 5ALDA 5DBBA 5DKWA 4KITB 2BCVA 4NLZA 1MC8A 4KLSA 2KFNA 3C5FA 3PO4A 1S0NA 4DQRA 1X9WA 5TISU 9ICEA 4I2JA 2NRWA 3B9JA 1ZQRA 1U47A 4I2GA 5KFQA 2W43A 3HKZC 1U4BA 2KV2A 4P4OA 3ORYA 4RNNA 3TANA 1KLNA 3Q8KA 4BJQA 4DOAA 3N7RC 1KEJA 4Y2UA 4O3NA 4O3QA 5DQIA 4P4MA 5HMMA 5CEHA 2E1EA 1PVRA 3MBYA 1N61A 5L1LA 2EQYA 1WCLA 1M6YA 2WF8A 3C1ZA 2J6SA 3GIMA 5J2IA 1TK5A 1TK8A 3SI8A 1OXJA 1DRGA 3J81j 3BQ0A 1HEKA 2HBKA 5DB7A 1ZQPA 4C8NA 4YMOA 4QWCA 2YMMA 7ICUA 2HBMA 5E79U 2ZJ5A 4F92B 3Q8PB 4KMUA 4EZ9A 3NS1A 3JPOA 2JHDA 1L7MA 2NV3A 9ICPA 1QLNA 7ICPA 3AU6A 4RQ1A 1BPZA 4F4XA 7ICNA 4K4GA 9ICTA 4ACOA 4AP9A 1SKSA 3K1ZA 2ZTDA 3FC4A 2BCSA 4YCXA 5J0RA 3M7DA 3TQ1A 4B9NA 2ZG6A 4GXJA 2HHVA 5J2HA 3RBDA 1S0MA 8ICBA 5KFRA 2ZTCA 3UXOA 5D46A 3K1RB 1D9DA 4FZMA 5CB1A 3TAQA 4OJOA 2XY6A 2OCEA 1NZPA 2IOFK 2PMZC 4JV2A 1ZXIA 3B0YA 3U26A 2GO7A 2XVTA 2FE9A 3PMLA 1NZBA 4O5KA 5KG3A 5EE1A 4M9JA 5JU5A 4M6WB 1RXWA 3N7SC 2PFQA 1J2NA 2AXTU 2K60A 2W8KA 1XWLA 1XSLA 5KFFA 2HHWA 4CCHA 1IV8A 1VJ5A 2EZZA 3QNMA 4DF4A 2W3SA 3BQ1A 3RJEA 2MAXA 4NY8A 2D6FC 4RT3A 2IMWP 5AKZA 1ZQLA 3UXPA 4UARA 2DFLA 3G6YA 3QXGA 4DFMA 4YR3A 4I2DA 2JH1A 5KFVA 4BDPA 3WU2U 4DFKA 1CRXA 4QNLA 2HCFA 3AUOA 4Y2SA 1ZQQA 3ETLA 4EBEA 2FPMA 1UQVA 2DKXA 9ICWA 5EE9A 3UQ0A 3KD3A 3I1YA 3EPIA 1KW4A 4FBUA 1MN8A 3GZFA 3H4BA 2KTQA 1S97A 4DFDA 3T5HA 4JMUA 1F0MA 1PK1B 2L5YA 3GV7B 5KFGA 1ZQVA 3EWAA 7ICRA 3KHLA 3F53A 1ZRMA 1H38A 2PI4A 1ZQUA 1RZTA 2HDOA 2OM6A 5KG2A 3OJSA 1ZQNA 4LJXA 3OSPA 1L3UA 2KHVA 3RAXA 7ICOA 1ZD3A 4DSKA 1L8OA 2BHNA 2DWQA 1TFRA 4O3SA 2JRZA 2KHQA 3QU2A 3ZD8A 3CRXA 3MFHA 2VA2A 4M2YA 2RP5A 1V38A 4MFCA 5KFJA 2NRXA 4DL2A 2JH7A 4F71A 2YTUA 2ALZA 5IIOA 2W8LA 8ICKA 3UPQA 4DQPA 2AGPA 2HI0A 4DF8A 5KG6A 1ZQGA 2HOFA 3HKZF 3GIJA 2PKEA 3KBBA 1D8BA 4AYBC 2CRXA 5KFLA 1T94A 1NK6A 5ALUA 4FZLA 1ZQ1C 4XUSA 4KLOA 3H0RB 3SZ2A 4PHAA 2V4RA 2I1QA 4IRDA 4KLTA 1LKYA 5AM2A 4UB6U 3PW4A 4DWIA 3TAPA 2NRTA 1N48A 4YMMA 9ICUA 4O3OA 2B6GA 3PR4A 1FIQA 3D2NA 5KT3A 1SB3C 1RM6C 2ISOA 1VDVA 8ICNA 2AJQA 1BPYA 3PO5A 5AM4A 3HPOA 3RRGA 2KKVA 5J8YC 4YXMA 4QJFB 2RDIA 5IILA 2H3VA 1SGGA 1T3QA 2Y9UA 1Y88A 2IHMA 5ALWA 1Q8KA 2WF5A 4B9MA 2DUYA 3PMNA 4O9MA 2W7OA 1Q46A 2EH9A 5J2GA 1JMSA 2G5IB 3NUQA 4OJPA 3RJFA 2FJ6A 5AKYA 4DSLA 1ZQDA 2JMGA 2DGZA 4EBCA 4F5NA 4PHPA 1IIPA 5KG7A 2ZUBA 4O3PA 5KG1A 2E8OA 1ZYQA 5ALYA 5KFIA 5ALFA 3KZIU 9ICXA 4RQ4A 1TAUA 2VKQA 4IQVA 4QZFA 1SL2A 1QSLA 4F5RA 4CGZA 9ICQA 3PR5B 2PMZF 2ASLA 5F9NA 2C2RA 3NVYA 3LVVA 4ECVA 1L7OA 8ICFA 2R8JA 5KFTA 4F4ZA 3VC8A 3PSTA 1T8EA 3BJYA 1SIJA 5J8YA 4RQ0A 8ICIA 3T5LA 5AHXA 4GIBA 2D8CA 4TURA 1NK4A 2OEHA 4Y2VA 4CDGA 2NRZA 4FZNA 1ZJMA 4UAZA 1NJWA 1QQ5A 4Z6DA 4KN4A 4ECTA 5EWEA 4NM1A 4IQUA 1JRPA 2CPRA 4M9GA 2XCPA 2W9CB 3GU3A 1L7NA 1WWUA 2V4QA 3ISCA 4J9QA 5KFKA 4PGXA 3PX0A 1RPLA 5KFWA 4YD2A 5AI4A 4F2RA 3ZDDA 4KLMA 2AQ4A 4Y2YA 2K4EA 3OSNA 1J2MA 5BOLA 4QIWC 4Y2QA 1ZJNA 3C23A 5KT4A 4Q44A 1N5XA 2EZXA 4NM2A 2KJ5A 5KT6A 3TADC 3GIIA 1ZQHA 1ZQTA 4DCCA 9ICLA 1PVQA 4BXOB 3QEAZ 3D2SA 4EZ6A 4R63A 9ICAA 2ISPA 1XO0A 3LK9A 2QARB 3E2EA 4ICAA 4NV0A 3V6JA 1ZQIA 8ICTA 9ICRA 1UCVA 2NYVA 1ZQBA 4Y2PA 2A19A 1X9XA 3SR6A 4R64A 1L8LA 3IG5A 1N5WA 2Y1JA 5D4BA 3RBEA 5L1IA 4LZDA 2KSOB 5AKGA 2LMRA 1D9FA 2RDJA 7ICMA 2KIVA 3MR3A 1QCKA 1KTQA 4USAA 2H3IA 2F1JA 2KKPA 2C2EA 4DL6A 3F2CA 2AU0A 4OJ5A 4R8UB 3TFSA 8ICJA 1S76D 4MHVA 2ZJ8A 1SWVA 3OHAA 1JX4A 4C8OA 4FS1A 4AYBF 4KLHA 4YVZA 4PL2A 3QU9A 2GWSA 9ICOA 2ZIWB 1SZPA 3AL0B 3G6VA 3H40A 2XIDA 1HJPA 1T3NA 9ICFA 3RF9A 3LWMA 4JWMA 3FAHA 1NJZA 2HHQA 4DL5A 2MA1A 2LM1A 9ICJA 1Z3EB 4YR2A 3KHHA 5AICA 2R8GA 4PZNA 5DGBA 2XC9A 3HP6A 5L1KA 3IP4B 1RYSA 2HOQA 3BQTA 1KFTA 2OH2A 4LVSA 1ZQYA 4JUZA 3JPQA 4M6WA 5CWRA 1WG8A 5KFBA 1A76A 3KZXA 4XQ8A 8ICYA 2NO4A 4M9NA 4U6PA 9ICGA 2C28A 5DLFA 1KBUA 4QZGA 1AQ6A 2E5SA 3QE9Y 1ECWA 1YT3A 2ZUCA 5KFPA 3RB0A 5KFMA 4QZEA 1JXLA 5L9XA 5G5HA 2ODGA 2C2DA 1NK7A 3Q8RB 3ONNA 2W9AA 3ISDA 2YQEA 5J0OA 4UATA 2BQRA 1XNSA 4TQRA 2CN1A 4WJ3B 1L3TA 5KTQA 4I2IA 4CF5A 9ICNA 1SKWA 1K5OA 2WB1C 3KKAC 1ZQAA 5KFZA 9ICMA 9ICSA 2JXJA 3F5EA 7ICQA 2YMLA 1KRPA 2OWOA 1JROA 4J9NA 2BPFA 4JV1A 3RR7A 3SAGA 1ZQFA 4J03A 2W03A 2WTFA 3DEEA 3ZDAA 1U45A 3MGIA 3Q8QB 1PK1A 3ZDCA 4UBBA 5IIMA 2JGAA 2W55A 2KJ9A 2JV3A 3IHQB 1ZOLA 2K4IA 3EZ5A 5KT2A 4FS2A 4IS7A 2OHFA 5KFDA 1WCNA 3HW8A 5EE0A 3SV3A 4OJ6A 1QH9A 3SV4A 2F8LA 4QIWF 4LZGA 3KOOA 1AROP 3SD7A 4M0AA 1Z1BA 1DK2A 3F5AA 5HHIA 4ELVA 4Q45A 1UT5A 3CNHA 3WKBA 3AQFA 3QUTA 2H5XA 3C2KA 4QWDA 2JEGA 4Z6CA 4QZDA 4ZH4A 2RHFA 1SL1A 4US9A 3AQEA 4HYKA 2VA8A 3C5GA 2JEJA 3IM1A 3UQ2A 5KFUA 1KQQA 4C8LA 4I2BA 3T3FA 4KLIA 3WKEA 4EEKA 1UHUA 4IRCA 2LYAA 2EANA 2EDUA 3V6KA 4IQWA 1OUQA 4Q8FA 1MSWD 1NJXA 2R8HA 5L1JA 3BQ7A 1IXRA 4ELTA 1NOMA 1P7DA 2ZJAA 2IBKA 5J2AA 5J0WA 5DG9A 1VLBA 3WK8A 4EENA 2W3RA 4TUQA 3H7IA 4ECSA 4ED3A 4UAUA 8ICRA 4HAIA 1ZQMA 5T14A 3TKAA 3ISBA 3RJKA 2DQNB 1KFSA 4KX3A 4C8KA 4QZBA 1N2XA 1YZ7A 4J9PA 1QQ6A 1Z4NA 2NO5A 3ZDEA 7ICIA 1B0XA 4DFJA 1JI7A 4QW9A 1NKEA 3N97B 5AI9A 5CR0A 1ZQSA 2BQUA 3H0LB 8ICZA 1S0VA 3QU5A 5KFNA 1MA7A 4ED0A 2FI1A 4YN4A 5J2CA 1BPBA 2LYHA 3IN5A 2H3ZA 1Z19A 3PZPA 2LI6A 4KLDA 7ICGA 4RNMA 5EWFA 3TACB 2YY6A 2P35A 1B43A 3N4MB 4Y2TA 3KHGA 5TZVA 4UB8U 4TQSA 1XO1A 3JPRA 9ICCA 1L3SA 2KFZA 3IV6A 4DSFA 4PZOA 1RG6A 2E8MA 4IRKA 3GIKA 3ZD9A 3K4GA 7ICKA 3MC1A 8ICLA 3N7PD 2OYYA 2UVUA 5KFXA 4UB3A 1HUZA 5L1MA 2AGOA 5BOMA 1ZETA 3HJEA 5IIJA 2XCAA 4F8RA 2PFOA 4I28A 5AK4A 4DS4A 3C21A 1ZQOA 4E0DA 3GDXA 3SAHA 1HIWA 1WYGA 2AGQA 5J2FA 1DOQA 4P0PB 3QUBA 4F4KA 2I6XA 1UA1A 2P66A 1L6NA 2W9CA 4FO6A 4RQNA 3K75D 4ECQA 4MEXA 5BPCA 3L5KA 3PY8A 2WB1F 4DS5A 3WKDA 5KFYA 1DGJA 5KL1B 3SYZA 1NNLA 5HP4A 5ALKA 2K8AA 4Y2RA 2HVIA 2IOFA 3EYZA 5H2FU 2BDPA 4RUAA 2B21A 1BGXT 5AK5A 1BVSA 3RRHA 4YMNA 2IHNA 3IG8A 2KNJA 2FMSA 4UW9A 4BXOA 9ICIA 1XU4A 3BS5B 3LWLA 2WFAA 4QWBA 1RXVA 4B6JA 3MGHA 4NL9C 4JWNA 2QARA 2QB0B 5ALLA 3B0XA 4ED6A 1SXEA 4F2SA 2FMQA 4NWIA 4K4HA 1UPHA 5J2DA 4YP3A 2HSZA 2XGPA 4PGQA 7ICSA 1SL0A 4RU9A 2LYBA 4ELUA 2MSNA 2A3VA 2KSOA 4DL4A 1K1QA 1T7PA 4J9RA 4KMOB 5J0QA 4XA5A 1TAMA 2F44A 3IRUA 8ICVA 3A0HU 5JRTA 1DGSA 3M6ZA 8ICMA 5AM3A 5HR7A 3OTQA 3M8RA 4MF8A 4DSEA 3M9MB 2Q0ZX 4R8UA 2OXOA 1SZHA 3Q8LA 4O5CA 1DXSA 4QWAA 2G09A 2UVWA 2DPIA 2KJ8A 2KN7A 3SQIA 4MEYA 3JPNA 1S0OA 4JB3A 3C28A 2VIXA 9ICHA 3R9KA 1PZNA 5ALQA 4C8MA 2ZIWA 1B22A 5AK6A 4I27A 2WF6A 3MDAA 4A8EA 3UXNA 4DL7A 1XC9A 2ASJA 3IDWA 2WAQC 4Z6EA 3OHBA 4IR9A 4OO1J 4KLJA 2BPCA 1ED1A 3RH4A 1ZD2P 4U7CA 2ZIVA 4DLEA 3HX0A 5DLGA 3T79A 1FFVA 4IC9A 3RR8A 3TARA 3QYPA 3PW7A 4EBDA 3OPXA 1ZD4A 2G5HB 1WWVA 4NLKA 3ETRA 4Q8EA 2G08A 2ZIUA 5EWGA 5GTHU 3FDSA 4EYHB 5KAIU 1L3VA 4RNOA 4BWJA 1Z00B 5ALOA 3RJJA 1NK9A 2YMPA 1X66A 2R18A 1XS9D 5EOZA 2ZXIA 4KX5A 5KT7A 1S8OA 2HVHA 3JPPA 5ALTA 2ES6A 4QZ9A 1LB2B 2RQ5A 2M9NA 3H8SA 5AM5A 3PSIA 1SV4A 2ATLA 4KTQA 1DK3A 3MGVA 1WUDA 3C2LA 2HHUA 4GXKA 2WF7A 5EE3A 1NKBA 3PX4A 2UVVA 1COOA 2KIWA 4ECWA 4PHDA 3QUCA 3BQ2A 5KG0A 2W9BB 3GFKB 1TV9A 4DQSA 1RQLA 4JK1A 5J2EA 4C4RA 3Q8SB 3M6KA 1GO3F 5KT5A 1CI4A 5DBAA 3C1YA 5ALMA 4Y2XA 2QKQA 5DDMA 4G9BA 1JXEA 1F44A 3TADA 4KLFA 4CE6A 1QQ7A 2JZBB 3RJHA 4RPXA 2J6TA 1ZRNA 1JUDA 2EAPA 2YB1A 5ALNA 1ZQZA 1ZQWA 4QZHA 2ESEA 2YMQA 5ALZA 4C7ZA 2F8KA 1S9FA 7ICHA 3M9NB 1SWWA 3WK6A 3MDCA 4ECXA 1RQNA 7ICEA 1LVHA 1BPDA 4J9KA 4RQ2A 2BPGA 5AM0A 4DOBA 4OD0A 3I28A 2EZYA 4PL1A 3A0BU 5KAFU 1ZQKA 4O0IA 3H8MA 2GH1A 2PFNA 1Z1VA 4F50A 4FE3A 4YFKA 2VA3A 1YZ6A 5D49A 3RB3A 1L7PA 2ZIVB 4ZOHC 2HMXA 4P0QB 5DG7A 5AKIA 8ICEA 1TK0A 5ALPA 5KNIA 5C5JA 2Y0SC 4F5QA 4DEZA 2ZIXB 2Y1IA 4F4YA 2ZIUB 4RQMA 3M1YA 3WK5A 1IG6A 1ZQXA 4QZCA 4Z6FA 4Y2JA 4ECUA 4KLGA 4DL3A 4RQ7A 1V9PA 5ALSA 7ICTA 4BUGA 7ICVA 3RH5A 3ZDBA 2VJ5A 3CW2C 2PI5A 3RAQA 3TFRA 2FLPA 4QZAA 2AHOB 1U48A 5AKXA 4B9VA 2MRLA 4ECRA 2XO7A 2EAMA 4KLQA 2P6RA 2QB1A 1UT8A 4UB4A 2G07A 1UA0A 3UMBA 2WHEA 4YQWA 4MFAA 2LM4A 4CF4A 1TE2A 3NRZA 5A0LA 5B5EU 1SXDA 3F2DA 3H4DA 5AKEA 1J97A 3HWTA 2DF4B 1CEZA 3LDAA 2K89A 2YN4A 3DV9A 5J0SA 4I2EA 4J9OA 4UBCA 3RTVA 1KL9A 3FYHA 4FFDA 3SENA 4BGDA 1NK5A 3WKCA 4YXJA 3SAFA 2WAQF 4UQGA 3TI0A 5ALRA 4I29A 5C0YA 4QZIA 5IINA 3V7LA 4F4WA 3JPSA 8ICWA 3BDPA 1HUOA 3NVZA 4F5PA 5DB8A 1X9SA 3H8WA 8ICCA 3RJGA 4OCZA 5KFSA 2HHXA 1TKDA 5KFCA 5ALGA 3BS7A 4FBTA 1NK8A 1U9LA 1NK0A 2K8CB 4UAVA 3T5JA 2E8PA 4IL6U 2M0NA 3HILA 2JEIA 2A1JB 1ZQCA 8ICUA 4ED1A 2HHTA 2LPEA 3KKAA 4YG2A 2UVRA 1O03A 5AIBA 4O5EA 2MUTA 2BQ3A 4KN7A 3PW0A 3V6HA 4J9MA 4US8A 3M8SA 4YD1A 4NLBA 4M04A 4DFPA 4DO9A 3HRDD 4GC6A 2AQ0A 3LVWA 7ICLA 4P0PA 2MUTB 4I2FA 3MFIA 4RUCA 3THVA 1K1SA 3E58A 3L4PA 3N28A 1S77D 3ALRA 2GLEA 1S5LU 3VCBA 5ALJA 3UMCA 4NLGA 1XSNA 5FP0A 4P2HA 4F5OA 2KZZA 5J0XA 3RFAA 4BX9C 3RB4A 4GXIA 2G06A 4R65A 3EUB2 1JALA 2BCRA 1U49A 2MU2A 1RYRA 1X42A 2O6KA 3MR5A 2AH5A 4B9LA 3QU4A 5KFAA 2HBJA 1V97A 5HR6A 3BS5A 3WKAA 3KHRA 4C4TA 5KL8B 4TUPA 1A77A 2B0CA 4RQ3A 2QB0A 3QEBZ 2E1FA 1N63A 2BKEA 2BCUA 1C7YA 4DLGA 2F1IA 4GFJA 3NTUA 2XICA 7ICJA 2DL0A 3RB6A 3NRWA 2E8NA 5J2BA 5ALEA 1NJYA 4TUSA 2JEFA 4F3OA 2P6UA 5AKLA 2KVSA 2HW3A 3QZ7A 2R8IA 8ICSA 2YX8A 5DQGA 2Y0SF 1X9MA 5AI8A 1KN5A 1URJA 3Q8MA 3NASA 4RZRA 3HT3A 2PFPA 4RQ6A 4PHEA 4J9LA 1TVAA 2F76X 2DPJA 1MQ2A 5DQHA 5AKJA 4EELA 3PSFA 4ECZA 2G0AA 5KFEA 5J0UA 3MR6A 1PUZA 1XSPA
chains in the Genus database with same CATH topology
2WB1F 3D2NA 2KICA 2KD1A 2W03A 2XIDA 3RF9A 4JMUA 3K1ZA 3ALRA 2ZXHA 3D2QA 3DEEA 5KL1B 2LKYA 3VCBA 4A8EA 2GOLA 2KOBA 2KKVA 1F44A 2K4EA 1A6SA 2MA1A 4QJFB 3KFUF 2H3VA 2JGAA 5A0LA 2H3FA 2KJ9A 3F53A 2K4HA 2WAQC 3ICXA 3M7DA 2ZG6A 3RFAA 4BX9C 4QIWC 2K8AA 3F2DA 4OO1J 2YB1A 2G06A 1ED1A 2K4IA 2KEYA 2DF4B 2OM6A 3H0LB 4U7CA 2ZIVA 2RRDA 2F2AB 2K89A 2LHTA 1MA7A 2N1RA 2KHVA 4FZMA 2KJ5A 4OJOA 2W7OA 3CYMA 4OJ6A 3T79A 1Q3VA 2KVCA 4IC9A 3IG8A 2K8BB 2KNJA 2G5IB 3NUQA 4OJPA 2F8LA 2HBJA 3OPXA 3SAFA 2G5HB 1PVQA 3IN5A 2JMGA 2KHQA 5HR6A 2DGZA 2G08A 3PSPA 2ZIUA 2WAQF 4QIWF 3D2SA 2PMZC 3L3FX 2H3ZA 1Z19A 1IIPA 2BDUA 4PL1A 3PZPA 4CRXA 5C0YA 5KL8B 3IP4B 3CRXA 2GH1A 2XVTA 2HOQA 2OH2A 1NZBA 2RP5A 1XO0A 1Z1BA 3F5AA 4ICAA 2E1FA 4NV0A 3HKZC 4FE3A 2KV2A 3E0FA 3AQFA 3N7SC 2ZIVB 2JH7A 3KZXA 2HMXA 4P0QA 4P0QB 4GFJA 2XICA 4BJQA 3N7RC 4OJLA 2VKQA 4CGZA 2R18A 2LBOA 4NWIA 4U6PA 3NRWA 2ZXIA 4KX5A 1UPHA 2RHFA 2PMZF 2XI9A 3LYSA 1KBUA 2Y0SC 2HOIA 3IG5A 2K8CB 2ZIXA 2E5SA 2ZIXB 2E1EA 3AQEA 1PVRA 1ECWA 1YT3A 3LVVA 2D6FC 2ZIUB 4NLCA 4C0ZA 1Q3UA 3O0FA 1PVPA 2LYBA 2HOFA 3HKZF 2A3VA 2M0NA 3VC8A 3N7PD 5CRXA 3PSTA 3ONNA 2OYYA 2Q4TA 3PSIA 1D8BA 3CP8A 4KMOB 2VJ4A 4AYBC 2CRXA 3MGVA 3F2BA 2W04A 2JH1A 1T94A 3C29A 1TAMA 1WUDA 2YX8A 1DRGA 2H3IA 2LYAA 1XNSA 2KKPA 2CN1A 4FZLA 1CRXA 2H3QA 1ZQ1C 1HEKA 4QNLA 2HBKA 2Y0SF 4WJ3B 2HBLA 3M6ZA 2W7PA 3F2CA 1OUQA 2KIWA 5HR7A 3H0RB 1URJA 4BUGA 4OJ5A 2WB1C 4NLBA 2OXOA 2VJ5A 1P7DA 1SZHA 4CDGA 2HBMA 4FZNA 1A0PA 2G09A 2KJ8A 3SQIA 3F5EA 3SAHA 1HIWA 2JHDA 3LVWA 2NV3A 4AYBF 3C28A 2VIXA 4P0PA 4P0PB 2F76X 3SMVA 3GZFA 5T14A 3PSFA 2CPRA 4PL2A 3H0MB 1L6NA 2MRLA 2ZIWA 2ZIWB 3M6KA 3SAGA 2Z7JA 2F77X 3GU3A 1GO3F 2DQNB 2G0AA 4O3MA 3AL0B 2YB4A 4KX3A 2G07A 4ACOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HBL A;  4CGZ A;  2RHF A;  2HBJ A;  3SAF A;  4NLB A;  2E1E A;  2DGZ A;  4QIW F;  4CDG A;  1YT3 A;  2HBM A;  2MA1 A;  4NLC A;  4QJF B;  5C0Y A;  3SAH A;  4OO1 J;  2E1F A;  1D8B A;  2KV2 A;  2CPR A;  2RRD A;  1WUD A;  3SAG A;  1GO3 F;  4O3M A;  3CYM A;  2HBK A; 
#chains in the Genus database with same CATH topology
 4RPZ A;  2V9W A;  4PPX A;  2XY5 A;  1ZQE A;  3D2Q A;  4I2H A;  3PW2 A;  1A6S A;  3KFU F;  1CUK A;  5CP2 A;  1N60 A;  4BWM A;  2F1H A;  3C2M A;  5J2J A;  3M9O B;  2N1R A;  2KG5 A;  5ALV A;  3S6J A;  3CYM A;  4X5V A;  1Q3V A;  2K8B B;  5ALI A;  2W54 A;  1COK A;  3UM9 A;  5J0Y A;  4J9S A;  3PSP A;  1S10 A;  2IA6 A;  4DQI A;  5J0P A;  5HNK A;  2BDU A;  2BR0 A;  1SV0 C;  4R66 A;  5AKH A;  3OJU A;  1OW5 A;  1LV5 A;  4KLL A;  4G3I A;  8ICA A;  4Q43 A;  4RT2 A;  1Z00 A;  4OJL A;  3FM9 A;  4CNQ A;  4M9H A;  3D6J A;  5DDY A;  1BPX A;  3QUQ A;  4ED2 A;  2HOI A;  2W9M A;  2F3N A;  4K4I A;  5HML A;  2XGQ A;  2ZTE A;  2KP7 A;  3AU2 A;  3BZC A;  5JUM A;  1N56 A;  1NI3 A;  3O0F A;  5AK3 A;  1BNO A;  2Q4T A;  4B9T A;  3KTQ A;  3QU7 A;  1JN3 A;  2W04 A;  3UMG A;  4M47 A;  5AKK A;  2HBL A;  1FO4 A;  4ED8 A;  3GV5 B;  4IQT A;  5DB6 A;  3ED5 A;  2JR5 A;  2W9B A;  3H8J A;  1X6J A;  5CJ7 A;  3ZI4 A;  4UAW A;  2RLT A;  1NKC A;  4PGY A;  5F9L A;  1SV0 A;  5JTI A;  1C20 A;  2F77 X;  1EXN A;  2YB4 A;  2KIC A;  2ASD A;  5K4L A;  3QX7 A;  5J2K A;  2LKY A;  3EW9 A;  2GOL A;  4PH5 A;  1F5S A;  1PK3 A;  5DB9 A;  2JZB A;  5ALX A;  2K4P A;  3WK9 A;  2I5H A;  2KEY A;  5B66 U;  2KE7 A;  1ZD5 A;  2RRD A;  3PNC A;  7ICF A;  1KKX A;  3T5K A;  4NL9 A;  2KVC A;  2W11 A;  1O08 A;  5III A;  3V72 A;  1SKR A;  2KZM A;  1MQ3 A;  2CXY A;  4F93 B;  4MF2 A;  3MR2 A;  4KLU A;  1BNP A;  4RQ8 A;  3WK4 A;  4M9L A;  4P0Q A;  4XRH A;  1N62 A;  4RPY A;  1KFD A;  8ICP A;  2DBY A;  2LBO A;  4O3R A;  4QZ8 A;  1QSS A;  2XI9 A;  4PJ0 U;  3LYS A;  4QWE A;  2E3T A;  2ZIX A;  4RQ5 A;  5KFH A;  1V85 A;  4C0Z A;  1Q3U A;  4DSI A;  1IM4 A;  3AMZ A;  4EX6 A;  4EYI B;  5CRX A;  5AI0 A;  1FEZ A;  3AN1 A;  2VJ4 A;  2BGW A;  1FFU A;  3F2B A;  3C29 A;  2FMP A;  5KG4 A;  2H3Q A;  2W7P A;  1Z4O A;  4C80 A;  3EPG A;  4DOC A;  5KFO A;  4UB5 A;  1QTM A;  1RYU A;  4ECY A;  3GV8 B;  3GIL A;  4NLN A;  2FLN A;  1LKY B;  4CF3 A;  3PW5 A;  1KSP A;  4UB1 A;  3RH6 A;  3SMV A;  4F91 B;  4KLE A;  2ZUD A;  2VAN A;  3NVW A;  2Z7J A;  4O3M A;  3RJI A;  9ICK A;  3GQC A;  2I9G A;  3DDH A;  3JPT A;  5DGA A;  2FLL A;  3SEI A;  5DG8 A;  2H3F A;  4B9U A;  3ICX A;  5GTI U;  4I2A A;  1X6I A;  1D8L A;  5J0T A;  3PV8 A;  1D8Y A;  2F2A B;  2LHT A;  3G6X A;  5KG5 A;  3V7K A;  3AEV A;  4F72 A;  1BPE A;  1X40 A;  2FPK A;  8ICO A;  1KDH A;  4NJ8 A;  2KZ3 A;  3L3F X;  3NGD A;  5J29 A;  3NVV A;  4CRX A;  3PVX A;  4DQQ A;  1L5U A;  2HHS A;  4EX7 A;  4C7Y A;  4UAS A;  5AI5 A;  4IR1 A;  2Y9T A;  1X2I A;  2DKZ A;  2IOH A;  2WF9 A;  4UAY A;  3E0F A;  2NRV A;  1RDF A;  3V7J A;  9ICB A;  1JIH A;  2KMD A;  4UB2 A;  8ICH A;  3PX6 A;  4NLC A;  8ICX A;  1PVP A;  3QZ8 A;  4YR0 A;  4GC7 A;  2A1J A;  2PXI A;  2EAO A;  3WK7 A;  4C4S A;  8ICG A;  4EEY A;  4B9S A;  3CP8 A;  3I76 A;  3BZK A;  2C22 A;  4MFF A;  5AM1 A;  5AIA A;  1A0P A;  5CHG A;  2J6U A;  2XY7 A;  2KK0 A;  5ALH A;  1B4F A;  1TAQ A;  4NXZ A;  9ICV A;  1QSY A;  3OGU A;  4P4P A;  5AI6 A;  2QLT A;  4ED7 A;  2BZF A;  5HHH A;  8ICQ A;  4QW8 A;  3H0M B;  2R8K A;  2D3D A;  3MAB A;  2A1A A;  5IIK A;  5G5G A;  5DBC A;  5CA7 A;  2KD1 A;  1ZQJ A;  2ZXH A;  4GLX A;  2FDR A;  2FPL A;  2BCQ A;  2KOB A;  4DSJ A;  4I2C A;  2K4H A;  5F3X B;  1T4G A;  3AM9 A;  4JV0 A;  5ALD A;  5DBB A;  5DKW A;  4KIT B;  2BCV A;  4NLZ A;  1MC8 A;  4KLS A;  2KFN A;  3C5F A;  3PO4 A;  1S0N A;  4DQR A;  1X9W A;  5TIS U;  9ICE A;  4I2J A;  2NRW A;  3B9J A;  1ZQR A;  1U47 A;  4I2G A;  5KFQ A;  2W43 A;  3HKZ C;  1U4B A;  2KV2 A;  4P4O A;  3ORY A;  4RNN A;  3TAN A;  1KLN A;  3Q8K A;  4BJQ A;  4DOA A;  3N7R C;  1KEJ A;  4Y2U A;  4O3N A;  4O3Q A;  5DQI A;  4P4M A;  5HMM A;  5CEH A;  2E1E A;  1PVR A;  3MBY A;  1N61 A;  5L1L A;  2EQY A;  1WCL A;  1M6Y A;  2WF8 A;  3C1Z A;  2J6S A;  3GIM A;  5J2I A;  1TK5 A;  1TK8 A;  3SI8 A;  1OXJ A;  1DRG A;  3J81 j;  3BQ0 A;  1HEK A;  2HBK A;  5DB7 A;  1ZQP A;  4C8N A;  4YMO A;  4QWC A;  2YMM A;  7ICU A;  2HBM A;  5E79 U;  2ZJ5 A;  4F92 B;  3Q8P B;  4KMU A;  4EZ9 A;  3NS1 A;  3JPO A;  2JHD A;  1L7M A;  2NV3 A;  9ICP A;  1QLN A;  7ICP A;  3AU6 A;  4RQ1 A;  1BPZ A;  4F4X A;  7ICN A;  4K4G A;  9ICT A;  4ACO A;  4AP9 A;  1SKS A;  3K1Z A;  2ZTD A;  3FC4 A;  2BCS A;  4YCX A;  5J0R A;  3M7D A;  3TQ1 A;  4B9N A;  2ZG6 A;  4GXJ A;  2HHV A;  5J2H A;  3RBD A;  1S0M A;  8ICB A;  5KFR A;  2ZTC A;  3UXO A;  5D46 A;  3K1R B;  1D9D A;  4FZM A;  5CB1 A;  3TAQ A;  4OJO A;  2XY6 A;  2OCE A;  1NZP A;  2IOF K;  2PMZ C;  4JV2 A;  1ZXI A;  3B0Y A;  3U26 A;  2GO7 A;  2XVT A;  2FE9 A;  3PML A;  1NZB A;  4O5K A;  5KG3 A;  5EE1 A;  4M9J A;  5JU5 A;  4M6W B;  1RXW A;  3N7S C;  2PFQ A;  1J2N A;  2AXT U;  2K60 A;  2W8K A;  1XWL A;  1XSL A;  5KFF A;  2HHW A;  4CCH A;  1IV8 A;  1VJ5 A;  2EZZ A;  3QNM A;  4DF4 A;  2W3S A;  3BQ1 A;  3RJE A;  2MAX A;  4NY8 A;  2D6F C;  4RT3 A;  2IMW P;  5AKZ A;  1ZQL A;  3UXP A;  4UAR A;  2DFL A;  3G6Y A;  3QXG A;  4DFM A;  4YR3 A;  4I2D A;  2JH1 A;  5KFV A;  4BDP A;  3WU2 U;  4DFK A;  1CRX A;  4QNL A;  2HCF A;  3AUO A;  4Y2S A;  1ZQQ A;  3ETL A;  4EBE A;  2FPM A;  1UQV A;  2DKX A;  9ICW A;  5EE9 A;  3UQ0 A;  3KD3 A;  3I1Y A;  3EPI A;  1KW4 A;  4FBU A;  1MN8 A;  3GZF A;  3H4B A;  2KTQ A;  1S97 A;  4DFD A;  3T5H A;  4JMU A;  1F0M A;  1PK1 B;  2L5Y A;  3GV7 B;  5KFG A;  1ZQV A;  3EWA A;  7ICR A;  3KHL A;  3F53 A;  1ZRM A;  1H38 A;  2PI4 A;  1ZQU A;  1RZT A;  2HDO A;  2OM6 A;  5KG2 A;  3OJS A;  1ZQN A;  4LJX A;  3OSP A;  1L3U A;  2KHV A;  3RAX A;  7ICO A;  1ZD3 A;  4DSK A;  1L8O A;  2BHN A;  2DWQ A;  1TFR A;  4O3S A;  2JRZ A;  2KHQ A;  3QU2 A;  3ZD8 A;  3CRX A;  3MFH A;  2VA2 A;  4M2Y A;  2RP5 A;  1V38 A;  4MFC A;  5KFJ A;  2NRX A;  4DL2 A;  2JH7 A;  4F71 A;  2YTU A;  2ALZ A;  5IIO A;  2W8L A;  8ICK A;  3UPQ A;  4DQP A;  2AGP A;  2HI0 A;  4DF8 A;  5KG6 A;  1ZQG A;  2HOF A;  3HKZ F;  3GIJ A;  2PKE A;  3KBB A;  1D8B A;  4AYB C;  2CRX A;  5KFL A;  1T94 A;  1NK6 A;  5ALU A;  4FZL A;  1ZQ1 C;  4XUS A;  4KLO A;  3H0R B;  3SZ2 A;  4PHA A;  2V4R A;  2I1Q A;  4IRD A;  4KLT A;  1LKY A;  5AM2 A;  4UB6 U;  3PW4 A;  4DWI A;  3TAP A;  2NRT A;  1N48 A;  4YMM A;  9ICU A;  4O3O A;  2B6G A;  3PR4 A;  1FIQ A;  3D2N A;  5KT3 A;  1SB3 C;  1RM6 C;  2ISO A;  1VDV A;  8ICN A;  2AJQ A;  1BPY A;  3PO5 A;  5AM4 A;  3HPO A;  3RRG A;  2KKV A;  5J8Y C;  4YXM A;  4QJF B;  2RDI A;  5IIL A;  2H3V A;  1SGG A;  1T3Q A;  2Y9U A;  1Y88 A;  2IHM A;  5ALW A;  1Q8K A;  2WF5 A;  4B9M A;  2DUY A;  3PMN A;  4O9M A;  2W7O A;  1Q46 A;  2EH9 A;  5J2G A;  1JMS A;  2G5I B;  3NUQ A;  4OJP A;  3RJF A;  2FJ6 A;  5AKY A;  4DSL A;  1ZQD A;  2JMG A;  2DGZ A;  4EBC A;  4F5N A;  4PHP A;  1IIP A;  5KG7 A;  2ZUB A;  4O3P A;  5KG1 A;  2E8O A;  1ZYQ A;  5ALY A;  5KFI A;  5ALF A;  3KZI U;  9ICX A;  4RQ4 A;  1TAU A;  2VKQ A;  4IQV A;  4QZF A;  1SL2 A;  1QSL A;  4F5R A;  4CGZ A;  9ICQ A;  3PR5 B;  2PMZ F;  2ASL A;  5F9N A;  2C2R A;  3NVY A;  3LVV A;  4ECV A;  1L7O A;  8ICF A;  2R8J A;  5KFT A;  4F4Z A;  3VC8 A;  3PST A;  1T8E A;  3BJY A;  1SIJ A;  5J8Y A;  4RQ0 A;  8ICI A;  3T5L A;  5AHX A;  4GIB A;  2D8C A;  4TUR A;  1NK4 A;  2OEH A;  4Y2V A;  4CDG A;  2NRZ A;  4FZN A;  1ZJM A;  4UAZ A;  1NJW A;  1QQ5 A;  4Z6D A;  4KN4 A;  4ECT A;  5EWE A;  4NM1 A;  4IQU A;  1JRP A;  2CPR A;  4M9G A;  2XCP A;  2W9C B;  3GU3 A;  1L7N A;  1WWU A;  2V4Q A;  3ISC A;  4J9Q A;  5KFK A;  4PGX A;  3PX0 A;  1RPL A;  5KFW A;  4YD2 A;  5AI4 A;  4F2R A;  3ZDD A;  4KLM A;  2AQ4 A;  4Y2Y A;  2K4E A;  3OSN A;  1J2M A;  5BOL A;  4QIW C;  4Y2Q A;  1ZJN A;  3C23 A;  5KT4 A;  4Q44 A;  1N5X A;  2EZX A;  4NM2 A;  2KJ5 A;  5KT6 A;  3TAD C;  3GII A;  1ZQH A;  1ZQT A;  4DCC A;  9ICL A;  1PVQ A;  4BXO B;  3QEA Z;  3D2S A;  4EZ6 A;  4R63 A;  9ICA A;  2ISP A;  1XO0 A;  3LK9 A;  2QAR B;  3E2E A;  4ICA A;  4NV0 A;  3V6J A;  1ZQI A;  8ICT A;  9ICR A;  1UCV A;  2NYV A;  1ZQB A;  4Y2P A;  2A19 A;  1X9X A;  3SR6 A;  4R64 A;  1L8L A;  3IG5 A;  1N5W A;  2Y1J A;  5D4B A;  3RBE A;  5L1I A;  4LZD A;  2KSO B;  5AKG A;  2LMR A;  1D9F A;  2RDJ A;  7ICM A;  2KIV A;  3MR3 A;  1QCK A;  1KTQ A;  4USA A;  2H3I A;  2F1J A;  2KKP A;  2C2E A;  4DL6 A;  3F2C A;  2AU0 A;  4OJ5 A;  4R8U B;  3TFS A;  8ICJ A;  1S76 D;  4MHV A;  2ZJ8 A;  1SWV A;  3OHA A;  1JX4 A;  4C8O A;  4FS1 A;  4AYB F;  4KLH A;  4YVZ A;  4PL2 A;  3QU9 A;  2GWS A;  9ICO A;  2ZIW B;  1SZP A;  3AL0 B;  3G6V A;  3H40 A;  2XID A;  1HJP A;  1T3N A;  9ICF A;  3RF9 A;  3LWM A;  4JWM A;  3FAH A;  1NJZ A;  2HHQ A;  4DL5 A;  2MA1 A;  2LM1 A;  9ICJ A;  1Z3E B;  4YR2 A;  3KHH A;  5AIC A;  2R8G A;  4PZN A;  5DGB A;  2XC9 A;  3HP6 A;  5L1K A;  3IP4 B;  1RYS A;  2HOQ A;  3BQT A;  1KFT A;  2OH2 A;  4LVS A;  1ZQY A;  4JUZ A;  3JPQ A;  4M6W A;  5CWR A;  1WG8 A;  5KFB A;  1A76 A;  3KZX A;  4XQ8 A;  8ICY A;  2NO4 A;  4M9N A;  4U6P A;  9ICG A;  2C28 A;  5DLF A;  1KBU A;  4QZG A;  1AQ6 A;  2E5S A;  3QE9 Y;  1ECW A;  1YT3 A;  2ZUC A;  5KFP A;  3RB0 A;  5KFM A;  4QZE A;  1JXL A;  5L9X A;  5G5H A;  2ODG A;  2C2D A;  1NK7 A;  3Q8R B;  3ONN A;  2W9A A;  3ISD A;  2YQE A;  5J0O A;  4UAT A;  2BQR A;  1XNS A;  4TQR A;  2CN1 A;  4WJ3 B;  1L3T A;  5KTQ A;  4I2I A;  4CF5 A;  9ICN A;  1SKW A;  1K5O A;  2WB1 C;  3KKA C;  1ZQA A;  5KFZ A;  9ICM A;  9ICS A;  2JXJ A;  3F5E A;  7ICQ A;  2YML A;  1KRP A;  2OWO A;  1JRO A;  4J9N A;  2BPF A;  4JV1 A;  3RR7 A;  3SAG A;  1ZQF A;  4J03 A;  2W03 A;  2WTF A;  3DEE A;  3ZDA A;  1U45 A;  3MGI A;  3Q8Q B;  1PK1 A;  3ZDC A;  4UBB A;  5IIM A;  2JGA A;  2W55 A;  2KJ9 A;  2JV3 A;  3IHQ B;  1ZOL A;  2K4I A;  3EZ5 A;  5KT2 A;  4FS2 A;  4IS7 A;  2OHF A;  5KFD A;  1WCN A;  3HW8 A;  5EE0 A;  3SV3 A;  4OJ6 A;  1QH9 A;  3SV4 A;  2F8L A;  4QIW F;  4LZG A;  3KOO A;  1ARO P;  3SD7 A;  4M0A A;  1Z1B A;  1DK2 A;  3F5A A;  5HHI A;  4ELV A;  4Q45 A;  1UT5 A;  3CNH A;  3WKB A;  3AQF A;  3QUT A;  2H5X A;  3C2K A;  4QWD A;  2JEG A;  4Z6C A;  4QZD A;  4ZH4 A;  2RHF A;  1SL1 A;  4US9 A;  3AQE A;  4HYK A;  2VA8 A;  3C5G A;  2JEJ A;  3IM1 A;  3UQ2 A;  5KFU A;  1KQQ A;  4C8L A;  4I2B A;  3T3F A;  4KLI A;  3WKE A;  4EEK A;  1UHU A;  4IRC A;  2LYA A;  2EAN A;  2EDU A;  3V6K A;  4IQW A;  1OUQ A;  4Q8F A;  1MSW D;  1NJX A;  2R8H A;  5L1J A;  3BQ7 A;  1IXR A;  4ELT A;  1NOM A;  1P7D A;  2ZJA A;  2IBK A;  5J2A A;  5J0W A;  5DG9 A;  1VLB A;  3WK8 A;  4EEN A;  2W3R A;  4TUQ A;  3H7I A;  4ECS A;  4ED3 A;  4UAU A;  8ICR A;  4HAI A;  1ZQM A;  5T14 A;  3TKA A;  3ISB A;  3RJK A;  2DQN B;  1KFS A;  4KX3 A;  4C8K A;  4QZB A;  1N2X A;  1YZ7 A;  4J9P A;  1QQ6 A;  1Z4N A;  2NO5 A;  3ZDE A;  7ICI A;  1B0X A;  4DFJ A;  1JI7 A;  4QW9 A;  1NKE A;  3N97 B;  5AI9 A;  5CR0 A;  1ZQS A;  2BQU A;  3H0L B;  8ICZ A;  1S0V A;  3QU5 A;  5KFN A;  1MA7 A;  4ED0 A;  2FI1 A;  4YN4 A;  5J2C A;  1BPB A;  2LYH A;  3IN5 A;  2H3Z A;  1Z19 A;  3PZP A;  2LI6 A;  4KLD A;  7ICG A;  4RNM A;  5EWF A;  3TAC B;  2YY6 A;  2P35 A;  1B43 A;  3N4M B;  4Y2T A;  3KHG A;  5TZV A;  4UB8 U;  4TQS A;  1XO1 A;  3JPR A;  9ICC A;  1L3S A;  2KFZ A;  3IV6 A;  4DSF A;  4PZO A;  1RG6 A;  2E8M A;  4IRK A;  3GIK A;  3ZD9 A;  3K4G A;  7ICK A;  3MC1 A;  8ICL A;  3N7P D;  2OYY A;  2UVU A;  5KFX A;  4UB3 A;  1HUZ A;  5L1M A;  2AGO A;  5BOM A;  1ZET A;  3HJE A;  5IIJ A;  2XCA A;  4F8R A;  2PFO A;  4I28 A;  5AK4 A;  4DS4 A;  3C21 A;  1ZQO A;  4E0D A;  3GDX A;  3SAH A;  1HIW A;  1WYG A;  2AGQ A;  5J2F A;  1DOQ A;  4P0P B;  3QUB A;  4F4K A;  2I6X A;  1UA1 A;  2P66 A;  1L6N A;  2W9C A;  4FO6 A;  4RQN A;  3K75 D;  4ECQ A;  4MEX A;  5BPC A;  3L5K A;  3PY8 A;  2WB1 F;  4DS5 A;  3WKD A;  5KFY A;  1DGJ A;  5KL1 B;  3SYZ A;  1NNL A;  5HP4 A;  5ALK A;  2K8A A;  4Y2R A;  2HVI A;  2IOF A;  3EYZ A;  5H2F U;  2BDP A;  4RUA A;  2B21 A;  1BGX T;  5AK5 A;  1BVS A;  3RRH A;  4YMN A;  2IHN A;  3IG8 A;  2KNJ A;  2FMS A;  4UW9 A;  4BXO A;  9ICI A;  1XU4 A;  3BS5 B;  3LWL A;  2WFA A;  4QWB A;  1RXV A;  4B6J A;  3MGH A;  4NL9 C;  4JWN A;  2QAR A;  2QB0 B;  5ALL A;  3B0X A;  4ED6 A;  1SXE A;  4F2S A;  2FMQ A;  4NWI A;  4K4H A;  1UPH A;  5J2D A;  4YP3 A;  2HSZ A;  2XGP A;  4PGQ A;  7ICS A;  1SL0 A;  4RU9 A;  2LYB A;  4ELU A;  2MSN A;  2A3V A;  2KSO A;  4DL4 A;  1K1Q A;  1T7P A;  4J9R A;  4KMO B;  5J0Q A;  4XA5 A;  1TAM A;  2F44 A;  3IRU A;  8ICV A;  3A0H U;  5JRT A;  1DGS A;  3M6Z A;  8ICM A;  5AM3 A;  5HR7 A;  3OTQ A;  3M8R A;  4MF8 A;  4DSE A;  3M9M B;  2Q0Z X;  4R8U A;  2OXO A;  1SZH A;  3Q8L A;  4O5C A;  1DXS A;  4QWA A;  2G09 A;  2UVW A;  2DPI A;  2KJ8 A;  2KN7 A;  3SQI A;  4MEY A;  3JPN A;  1S0O A;  4JB3 A;  3C28 A;  2VIX A;  9ICH A;  3R9K A;  1PZN A;  5ALQ A;  4C8M A;  2ZIW A;  1B22 A;  5AK6 A;  4I27 A;  2WF6 A;  3MDA A;  4A8E A;  3UXN A;  4DL7 A;  1XC9 A;  2ASJ A;  3IDW A;  2WAQ C;  4Z6E A;  3OHB A;  4IR9 A;  4OO1 J;  4KLJ A;  2BPC A;  1ED1 A;  3RH4 A;  1ZD2 P;  4U7C A;  2ZIV A;  4DLE A;  3HX0 A;  5DLG A;  3T79 A;  1FFV A;  4IC9 A;  3RR8 A;  3TAR A;  3QYP A;  3PW7 A;  4EBD A;  3OPX A;  1ZD4 A;  2G5H B;  1WWV A;  4NLK A;  3ETR A;  4Q8E A;  2G08 A;  2ZIU A;  5EWG A;  5GTH U;  3FDS A;  4EYH B;  5KAI U;  1L3V A;  4RNO A;  4BWJ A;  1Z00 B;  5ALO A;  3RJJ A;  1NK9 A;  2YMP A;  1X66 A;  2R18 A;  1XS9 D;  5EOZ A;  2ZXI A;  4KX5 A;  5KT7 A;  1S8O A;  2HVH A;  3JPP A;  5ALT A;  2ES6 A;  4QZ9 A;  1LB2 B;  2RQ5 A;  2M9N A;  3H8S A;  5AM5 A;  3PSI A;  1SV4 A;  2ATL A;  4KTQ A;  1DK3 A;  3MGV A;  1WUD A;  3C2L A;  2HHU A;  4GXK A;  2WF7 A;  5EE3 A;  1NKB A;  3PX4 A;  2UVV A;  1COO A;  2KIW A;  4ECW A;  4PHD A;  3QUC A;  3BQ2 A;  5KG0 A;  2W9B B;  3GFK B;  1TV9 A;  4DQS A;  1RQL A;  4JK1 A;  5J2E A;  4C4R A;  3Q8S B;  3M6K A;  1GO3 F;  5KT5 A;  1CI4 A;  5DBA A;  3C1Y A;  5ALM A;  4Y2X A;  2QKQ A;  5DDM A;  4G9B A;  1JXE A;  1F44 A;  3TAD A;  4KLF A;  4CE6 A;  1QQ7 A;  2JZB B;  3RJH A;  4RPX A;  2J6T A;  1ZRN A;  1JUD A;  2EAP A;  2YB1 A;  5ALN A;  1ZQZ A;  1ZQW A;  4QZH A;  2ESE A;  2YMQ A;  5ALZ A;  4C7Z A;  2F8K A;  1S9F A;  7ICH A;  3M9N B;  1SWW A;  3WK6 A;  3MDC A;  4ECX A;  1RQN A;  7ICE A;  1LVH A;  1BPD A;  4J9K A;  4RQ2 A;  2BPG A;  5AM0 A;  4DOB A;  4OD0 A;  3I28 A;  2EZY A;  4PL1 A;  3A0B U;  5KAF U;  1ZQK A;  4O0I A;  3H8M A;  2GH1 A;  2PFN A;  1Z1V A;  4F50 A;  4FE3 A;  4YFK A;  2VA3 A;  1YZ6 A;  5D49 A;  3RB3 A;  1L7P A;  2ZIV B;  4ZOH C;  2HMX A;  4P0Q B;  5DG7 A;  5AKI A;  8ICE A;  1TK0 A;  5ALP A;  5KNI A;  5C5J A;  2Y0S C;  4F5Q A;  4DEZ A;  2ZIX B;  2Y1I A;  4F4Y A;  2ZIU B;  4RQM A;  3M1Y A;  3WK5 A;  1IG6 A;  1ZQX A;  4QZC A;  4Z6F A;  4Y2J A;  4ECU A;  4KLG A;  4DL3 A;  4RQ7 A;  1V9P A;  5ALS A;  7ICT A;  4BUG A;  7ICV A;  3RH5 A;  3ZDB A;  2VJ5 A;  3CW2 C;  2PI5 A;  3RAQ A;  3TFR A;  2FLP A;  4QZA A;  2AHO B;  1U48 A;  5AKX A;  4B9V A;  2MRL A;  4ECR A;  2XO7 A;  2EAM A;  4KLQ A;  2P6R A;  2QB1 A;  1UT8 A;  4UB4 A;  2G07 A;  1UA0 A;  3UMB A;  2WHE A;  4YQW A;  4MFA A;  2LM4 A;  4CF4 A;  1TE2 A;  3NRZ A;  5A0L A;  5B5E U;  1SXD A;  3F2D A;  3H4D A;  5AKE A;  1J97 A;  3HWT A;  2DF4 B;  1CEZ A;  3LDA A;  2K89 A;  2YN4 A;  3DV9 A;  5J0S A;  4I2E A;  4J9O A;  4UBC A;  3RTV A;  1KL9 A;  3FYH A;  4FFD A;  3SEN A;  4BGD A;  1NK5 A;  3WKC A;  4YXJ A;  3SAF A;  2WAQ F;  4UQG A;  3TI0 A;  5ALR A;  4I29 A;  5C0Y A;  4QZI A;  5IIN A;  3V7L A;  4F4W A;  3JPS A;  8ICW A;  3BDP A;  1HUO A;  3NVZ A;  4F5P A;  5DB8 A;  1X9S A;  3H8W A;  8ICC A;  3RJG A;  4OCZ A;  5KFS A;  2HHX A;  1TKD A;  5KFC A;  5ALG A;  3BS7 A;  4FBT A;  1NK8 A;  1U9L A;  1NK0 A;  2K8C B;  4UAV A;  3T5J A;  2E8P A;  4IL6 U;  2M0N A;  3HIL A;  2JEI A;  2A1J B;  1ZQC A;  8ICU A;  4ED1 A;  2HHT A;  2LPE A;  3KKA A;  4YG2 A;  2UVR A;  1O03 A;  5AIB A;  4O5E A;  2MUT A;  2BQ3 A;  4KN7 A;  3PW0 A;  3V6H A;  4J9M A;  4US8 A;  3M8S A;  4YD1 A;  4NLB A;  4M04 A;  4DFP A;  4DO9 A;  3HRD D;  4GC6 A;  2AQ0 A;  3LVW A;  7ICL A;  4P0P A;  2MUT B;  4I2F A;  3MFI A;  4RUC A;  3THV A;  1K1S A;  3E58 A;  3L4P A;  3N28 A;  1S77 D;  3ALR A;  2GLE A;  1S5L U;  3VCB A;  5ALJ A;  3UMC A;  4NLG A;  1XSN A;  5FP0 A;  4P2H A;  4F5O A;  2KZZ A;  5J0X A;  3RFA A;  4BX9 C;  3RB4 A;  4GXI A;  2G06 A;  4R65 A;  3EUB 2;  1JAL A;  2BCR A;  1U49 A;  2MU2 A;  1RYR A;  1X42 A;  2O6K A;  3MR5 A;  2AH5 A;  4B9L A;  3QU4 A;  5KFA A;  2HBJ A;  1V97 A;  5HR6 A;  3BS5 A;  3WKA A;  3KHR A;  4C4T A;  5KL8 B;  4TUP A;  1A77 A;  2B0C A;  4RQ3 A;  2QB0 A;  3QEB Z;  2E1F A;  1N63 A;  2BKE A;  2BCU A;  1C7Y A;  4DLG A;  2F1I A;  4GFJ A;  3NTU A;  2XIC A;  7ICJ A;  2DL0 A;  3RB6 A;  3NRW A;  2E8N A;  5J2B A;  5ALE A;  1NJY A;  4TUS A;  2JEF A;  4F3O A;  2P6U A;  5AKL A;  2KVS A;  2HW3 A;  3QZ7 A;  2R8I A;  8ICS A;  2YX8 A;  5DQG A;  2Y0S F;  1X9M A;  5AI8 A;  1KN5 A;  1URJ A;  3Q8M A;  3NAS A;  4RZR A;  3HT3 A;  2PFP A;  4RQ6 A;  4PHE A;  4J9L A;  1TVA A;  2F76 X;  2DPJ A;  1MQ2 A;  5DQH A;  5AKJ A;  4EEL A;  3PSF A;  4ECZ A;  2G0A A;  5KFE A;  5J0U A;  3MR6 A;  1PUZ A;  1XSP A; 
#chains in the Genus database with same CATH homology
 2WB1 F;  3D2N A;  2KIC A;  2KD1 A;  2W03 A;  2XID A;  3RF9 A;  4JMU A;  3K1Z A;  3ALR A;  2ZXH A;  3D2Q A;  3DEE A;  5KL1 B;  2LKY A;  3VCB A;  4A8E A;  2GOL A;  2KOB A;  2KKV A;  1F44 A;  2K4E A;  1A6S A;  2MA1 A;  4QJF B;  3KFU F;  2H3V A;  2JGA A;  5A0L A;  2H3F A;  2KJ9 A;  3F53 A;  2K4H A;  2WAQ C;  3ICX A;  3M7D A;  2ZG6 A;  3RFA A;  4BX9 C;  4QIW C;  2K8A A;  3F2D A;  4OO1 J;  2YB1 A;  2G06 A;  1ED1 A;  2K4I A;  2KEY A;  2DF4 B;  2OM6 A;  3H0L B;  4U7C A;  2ZIV A;  2RRD A;  2F2A B;  2K89 A;  2LHT A;  1MA7 A;  2N1R A;  2KHV A;  4FZM A;  2KJ5 A;  4OJO A;  2W7O A;  3CYM A;  4OJ6 A;  3T79 A;  1Q3V A;  2KVC A;  4IC9 A;  3IG8 A;  2K8B B;  2KNJ A;  2G5I B;  3NUQ A;  4OJP A;  2F8L A;  2HBJ A;  3OPX A;  3SAF A;  2G5H B;  1PVQ A;  3IN5 A;  2JMG A;  2KHQ A;  5HR6 A;  2DGZ A;  2G08 A;  3PSP A;  2ZIU A;  2WAQ F;  4QIW F;  3D2S A;  2PMZ C;  3L3F X;  2H3Z A;  1Z19 A;  1IIP A;  2BDU A;  4PL1 A;  3PZP A;  4CRX A;  5C0Y A;  5KL8 B;  3IP4 B;  3CRX A;  2GH1 A;  2XVT A;  2HOQ A;  2OH2 A;  1NZB A;  2RP5 A;  1XO0 A;  1Z1B A;  3F5A A;  4ICA A;  2E1F A;  4NV0 A;  3HKZ C;  4FE3 A;  2KV2 A;  3E0F A;  3AQF A;  3N7S C;  2ZIV B;  2JH7 A;  3KZX A;  2HMX A;  4P0Q A;  4P0Q B;  4GFJ A;  2XIC A;  4BJQ A;  3N7R C;  4OJL A;  2VKQ A;  4CGZ A;  2R18 A;  2LBO A;  4NWI A;  4U6P A;  3NRW A;  2ZXI A;  4KX5 A;  1UPH A;  2RHF A;  2PMZ F;  2XI9 A;  3LYS A;  1KBU A;  2Y0S C;  2HOI A;  3IG5 A;  2K8C B;  2ZIX A;  2E5S A;  2ZIX B;  2E1E A;  3AQE A;  1PVR A;  1ECW A;  1YT3 A;  3LVV A;  2D6F C;  2ZIU B;  4NLC A;  4C0Z A;  1Q3U A;  3O0F A;  1PVP A;  2LYB A;  2HOF A;  3HKZ F;  2A3V A;  2M0N A;  3VC8 A;  3N7P D;  5CRX A;  3PST A;  3ONN A;  2OYY A;  2Q4T A;  3PSI A;  1D8B A;  3CP8 A;  4KMO B;  2VJ4 A;  4AYB C;  2CRX A;  3MGV A;  3F2B A;  2W04 A;  2JH1 A;  1T94 A;  3C29 A;  1TAM A;  1WUD A;  2YX8 A;  1DRG A;  2H3I A;  2LYA A;  1XNS A;  2KKP A;  2CN1 A;  4FZL A;  1CRX A;  2H3Q A;  1ZQ1 C;  1HEK A;  4QNL A;  2HBK A;  2Y0S F;  4WJ3 B;  2HBL A;  3M6Z A;  2W7P A;  3F2C A;  1OUQ A;  2KIW A;  5HR7 A;  3H0R B;  1URJ A;  4BUG A;  4OJ5 A;  2WB1 C;  4NLB A;  2OXO A;  2VJ5 A;  1P7D A;  1SZH A;  4CDG A;  2HBM A;  4FZN A;  1A0P A;  2G09 A;  2KJ8 A;  3SQI A;  3F5E A;  3SAH A;  1HIW A;  2JHD A;  3LVW A;  2NV3 A;  4AYB F;  3C28 A;  2VIX A;  4P0P A;  4P0P B;  2F76 X;  3SMV A;  3GZF A;  5T14 A;  3PSF A;  2CPR A;  4PL2 A;  3H0M B;  1L6N A;  2MRL A;  2ZIW A;  2ZIW B;  3M6K A;  3SAG A;  2Z7J A;  2F77 X;  3GU3 A;  1GO3 F;  2DQN B;  2G0A A;  4O3M A;  3AL0 B;  2YB4 A;  4KX3 A;  2G07 A;  4ACO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...