2RHFA

D. radiodurans recq hrdc domain 3
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
76
structure length
76
Chain Sequence
SHNADLSEALRELRRELMKETGYSAFVVFTNATLEALAARQPRTLAELAEVPGLGEKRIEAYGERILDAINTVLDG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA helicase RecQ
publication title Structure and function of the regulatory C-terminal HRDC domain from Deinococcus radiodurans RecQ.
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Hydrolase
total genus 27
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2007-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00570 HRDC HRDC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.80 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2rhfA00
3SAGA 4CGZA 4NLBA 3SAFA 2HBLA 2E1FA 2KV2A 3SAHA 2HBJA 4QIWF 2E1EA 1D8BA 1WUDA 4O3MA 2HBMA 1GO3F 1YT3A 4NLCA 2HBKA 4QJFB 4CDGA 4OO1J 5C0YA 2DGZA 2RHFA 2MA1A 2CPRA 3CYMA 2RRDA
chains in the Genus database with same CATH superfamily
4J9RA 1NZBA 4ED2A 4GXJA 2IA6A 1ZOLA 3OGUA 3M8RA 2ZIVB 4BX9C 5AKXA 2E5SA 2XIDA 5ALQA 4CRXA 1UA1A 3S6JA 3B0YA 5AKEA 3GDXA 3WKEA 4Q8FA 5KFHA 5KFUA 4C8KA 5ALPA 2RDJA 2PMZC 5AI9A 2VA3A 3N4MB 2NRXA 1F44A 1QQ7A 3B0XA 5KFWA 4QNLA 4TUPA 4KN4A 5L1KA 2G08A 3MDCA 1IIPA 3T5JA 2XI9A 3QU2A 5J2JA 4ECRA 5J2GA 1A77A 2MUTB 4O3MA 5KAFU 2EAMA 2XCAA 5KFDA 5DKWA 4M6WA 3CP8A 1RQLA 4QJFB 3D2QA 5KL8B 3IG8A 4NJ8A 2W9BB 1TK8A 5IIMA 2WTFA 2LM1A 3O0FA 3PSTA 4OJ6A 2F77X 2IHNA 2CN1A 4EZ9A 5ALFA 2ZUBA 4ECYA 1TAQA 1YT3A 4QZHA 3RH4A 3QEAZ 1TFRA 1QCKA 4IRCA 2W03A 1QSYA 9ICPA 4MF8A 5J2BA 4P0QA 1KSPA 1T94A 4DL2A 3MR5A 2KFNA 3KOOA 4Z6FA 4BGDA 4O5CA 4YMNA 9ICVA 3PV8A 2BQUA 1SZHA 3RTVA 3V7JA 2IHMA 2Z7JA 2NRVA 4C7YA 1V85A 3D6JA 1RYRA 4R63A 3SAHA 1NOMA 4ZH4A 3N7SC 3ZI4A 1JXEA 1NK8A 3PW4A 4NV0A 3V7KA 4KLDA 2NV3A 2O6KA 3IDWA 1ZQGA 1QTMA 3KHHA 2UVUA 2DGZA 5C5JA 1WYGA 2ZXHA 3DDHA 4F2SA 2LHTA 2DF4B 5CJ7A 2WF7A 4Y2SA 4Y2UA 1SXEA 4QZIA 2BZFA 5CB1A 3HPOA 5CHGA 2K8CB 3PY8A 4WJ3B 2FPMA 5KFMA 2DBYA 4DFMA 4B9TA 4IRDA 4P0QB 1ZQVA 3R9KA 1ZQSA 4QWAA 3H8WA 3H4BA 1JALA 4RQ7A 8ICWA 4KLGA 3T3FA 2ZJ5A 4YVZA 3BZCA 1TAUA 5D46A 2HHUA 3ICXA 1ZQTA 4PZOA 2DQNB 9ICXA 9ICRA 3PO4A 8ICLA 3Q8SB 1JX4A 4NL9C 5KFCA 1B0XA 4E0DA 1XO1A 2F76X 2JEGA 2J6SA 2JGAA 1SB3C 2ZIUA 1D8LA 4KLMA 3SMVA 2W43A 1T8EA 2H5XA 5J0XA 5ALTA 2MSNA 2KIVA 3KKAC 2LM4A 1ZQHA 2AHOB 4O0IA 4QW8A 3PZPA 5JRTA 1A0PA 8ICCA 2AH5A 2GH1A 2OCEA 2XY6A 4JWNA 5EE1A 4O5KA 2K4HA 2F44A 4BJQA 3GQCA 1U9LA 2RP5A 2ASDA 1YZ6A 8ICVA 3ALRA 2IBKA 3NVWA 2KSOA 2V4QA 4DSKA 1IXRA 4R66A 8ICFA 4ECQA 4JUZA 2HSZA 4PGQA 3UXOA 4GC6A 3SYZA 3V7LA 1NK9A 2EQYA 5J0QA 3SR6A 4M47A 3ZDCA 1NJZA 1NJYA 4RPZA 3JPTA 2GWSA 2ZIUB 4UB4A 4LZGA 2OM6A 3MR3A 2W9CA 2KHQA 2KV2A 1LB2B 4F4YA 3BQ0A 2HOIA 2Y9UA 4KLFA 2KVCA 3EZ5A 3UMCA 3CW2C 2KZZA 1VDVA 2FJ6A 2KJ9A 5L9XA 4TURA 4KITB 2HBKA 4DOAA 3AQEA 1KEJA 5EE0A 3H0MB 4HAIA 4DFPA 4O9MA 7ICOA 3RJIA 5KAIU 1JXLA 3TACB 5AM2A 2C2EA 2HDOA 2K4PA 3ZD8A 1Q8KA 2KSOB 2AJQA 3QU7A 1N63A 2C22A 5KFJA 2GLEA 5AKKA 3JPOA 2I6XA 2K60A 2KTQA 1XSNA 3TADA 3RBDA 5G5GA 5DQGA 4I2BA 4R64A 8ICJA 5ALGA 2KVSA 1VJ5A 1S0OA 1JMSA 4KMOB 3WKAA 5J0OA 4BUGA 4FS1A 1MN8A 2YMMA 4JMUA 5DB9A 2KG5A 2AQ0A 2DFLA 1DOQA 2A19A 5J0TA 1KL9A 4X5VA 2MA1A 5CEHA 2W9CB 4PL1A 4BDPA 2JZBB 2W9MA 5KFYA 1LVHA 3GILA 5H2FU 4JV0A 2KEYA 5KG1A 2BPFA 1S10A 3T5LA 3RJGA 5DG7A 5FP0A 3VCBA 3B9JA 3SV4A 1S8OA 5HNKA 1QH9A 2JEIA 1X9MA 4YD2A 2PFQA 3AM9A 4RNMA 3AU6A 5ALHA 1SV0C 1BPDA 2KFZA 1T3NA 1CEZA 4DQRA 5GTIU 3BQ7A 1XNSA 3TKAA 7ICVA 2C2DA 1HEKA 4DEZA 1T3QA 2C28A 4KN7A 4R8UA 8ICIA 4IQVA 4DSIA 4DQIA 1SL0A 2YN4A 1KW4A 4M9HA 1ZRMA 4HYKA 2G07A 1PK3A 4J9PA 5C0YA 4MFFA 3H8JA 3RJKA 3THVA 3UMGA 4KLSA 1B22A 4U6PA 3C1ZA 1RYSA 9ICUA 2WB1F 4IR1A 4YQWA 1NNLA 4QIWF 1N5WA 4CE6A 5DB8A 2BPCA 5IINA 5KT3A 3OJSA 5J0RA 1ZXIA 2W9AA 2QARA 8ICGA 1S97A 4BWJA 3V6JA 2BCVA 4O3SA 2XCPA 2YY6A 4CDGA 2Y9TA 3PSIA 3IG5A 3F5EA 3HKZC 3K75D 4YXJA 3ORYA 5KG0A 2BCSA 4UAVA 5KFAA 3WKCA 4UAYA 3H4DA 1ZQOA 5E79U 1ZYQA 3ISCA 4F3OA 4ZOHC 1WCLA 4M2YA 2KD1A 1IV8A 4GFJA 4KLEA 4F4KA 1BPEA 2KZMA 2XICA 5ALWA 4QWBA 5KFEA 8ICAA 4R8UB 2VIXA 5CP2A 2M9NA 1Z1BA 1ZQIA 5DLGA 1ZRNA 3CRXA 3C5FA 2PI4A 3EW9A 1A76A 2K4IA 4QZEA 2HOFA 5AI0A 1B43A 5IIOA 3ZDEA 4DS4A 4BXOB 1BPXA 1SWVA 3JPNA 2WF5A 1KRPA 9ICLA 8ICPA 7ICPA 4FBUA 4P4MA 3BS7A 2LMRA 1RZTA 1KFDA 1N2XA 5D49A 5AKGA 1J2MA 2ZTCA 2LYHA 4P2HA 3PW2A 7ICGA 2JRZA 4ECTA 2KKVA 2K8BB 4R65A 8ICRA 2ODGA 2P6UA 4DCCA 3G6XA 9ICSA 2ZTEA 3ED5A 2HCFA 3UMBA 3AL0B 1ZQNA 4YFKA 4IC9A 3C2MA 4F5PA 2E1FA 4C8NA 3Q8QB 2ASJA 4F71A 8ICBA 4I2HA 2EANA 4DOCA 3HJEA 1SGGA 3Q8PB 2MUTA 4C7ZA 5KFLA 3CYMA 3D2NA 3WK7A 5BOLA 2PMZF 2Y1IA 2HVIA 4DSLA 3MBYA 2JV3A 5EE3A 1WWVA 2F3NA 2A3VA 2W9BA 4I2AA 5HR7A 2B0CA 7ICLA 2D8CA 3QE9Y 4M9JA 3LWLA 4KLIA 1COOA 3IV6A 4BWMA 1XC9A 2PFNA 1SL1A 4LVSA 2W7PA 3MFHA 1NK5A 3D2SA 1S0VA 3ISDA 3QUBA 4DF8A 2E8OA 4KLQA 2FMSA 5KL1B 2J6TA 4QWEA 2FI1A 1L6NA 4DSJA 5KFFA 3SAGA 1CRXA 4DQQA 4TQSA 4YCXA 1U45A 2WF6A 4UBBA 5DG8A 4NXZA 2F8LA 1BPYA 4C4TA 4EENA 3G6YA 4GXKA 3N7PD 3F2BA 3FAHA 7ICQA 4EYHB 3PSPA 4B9UA 5CWRA 4C4SA 3H40A 5J8YA 3FC4A 2LKYA 1UT5A 1Z3EB 4J03A 2H3VA 4RQMA 5AIBA 1OUQA 1XSPA 1RYUA 4YP3A 3K1ZA 4K4GA 8ICTA 2BHNA 4I2GA 3BQ1A 1WCNA 2F1JA 1ZQZA 2R8IA 4IL6U 4KLLA 3GZFA 4RPXA 4ELVA 4MFAA 5J0SA 4UAWA 2ZIWB 5ALKA 4IQTA 3KD3A 5AK6A 3H0RB 3F53A 1H38A 4C0ZA 5J2DA 4YXMA 1XSLA 4UB2A 3SZ2A 2E8MA 5L1MA 1X42A 3HT3A 2HVHA 5CR0A 3C1YA 4UB5A 1PK1A 2IOHA 9ICGA 4XUSA 5CA7A 2KE7A 5F9NA 4FZLA 8ICXA 2ZJ8A 3KBBA 3TFRA 2NRWA 3PX4A 1RDFA 2AQ4A 4JB3A 4RQ0A 3BQTA 2Q0ZX 4ICAA 3NVYA 4ECZA 2B6GA 1D9DA 3OJUA 2ZJAA 2IOFA 4F91B 4O3RA 1MQ3A 5KFTA 4UB1A 3H8MA 3L4PA 4O5EA 4ED0A 3PSFA 2XO7A 1Z00A 2JXJA 2MAXA 5IIIA 3BS5B 4IQWA 2BCUA 4I29A 5EWFA 3LYSA 2D6FC 2R8JA 2XY5A 1ZQPA 3RB6A 5ALXA 4US9A 2Y0SC 1UHUA 1Y88A 2UVVA 1N60A 4PL2A 4ECSA 5ALSA 1ZQ1C 3OHBA 1AROP 5AKZA 4M9NA 2Y1JA 1TK0A 2CXYA 1PK1B 3WK4A 1UQVA 3F2DA 3VC8A 4DL7A 2JH7A 1PVRA 3QUQA 4NLCA 4J9LA 4EX6A 9ICQA 2GO7A 1X9SA 4J9SA 2PFPA 1VLBA 4UATA 3J81j 5AM0A 1KTQA 3GU3A 8ICHA 3BQ2A 2HBLA 4FO6A 4OD0A 5AK5A 3LDAA 2ESEA 5B66U 5DDMA 4IRKA 3QU9A 1J2NA 3RBEA 2ZXIA 4RU9A 5DBBA 4PJ0U 1Z00B 1DGJA 1X6JA 1S5LU 3KHLA 3V72A 2ES6A 4RQ5A 5AK4A 1S0MA 1HUOA 1ED1A 4CF4A 5KFSA 2RQ5A 1TVAA 1RM6C 1L7NA 4C8LA 5IIKA 4TQRA 3HILA 4I2JA 2ALZA 1L7OA 1DRGA 2BPGA 4F72A 3NRZA 7ICRA 3HWTA 4EEYA 4EEKA 2P66A 2V4RA 3OPXA 1KDHA 2JEFA 2DPIA 1JROA 3T79A 2G09A 1ZQFA 2DWQA 4YMMA 3SV3A 2RDIA 3H0LB 3V6HA 2A1JB 1WWUA 2KHVA 2YB4A 1OW5A 1LKYA 4F5OA 4UQGA 4DF4A 2ZUCA 2QKQA 4ECVA 4CF5A 5DQIA 2HHSA 2FPLA 3RFAA 2OH2A 5DBAA 5EOZA 2JZBA 4DL5A 3RJFA 7ICMA 2VA2A 2EAPA 1KN5A 2XGQA 2FE9A 1ZQCA 2M0NA 4F93B 3BDPA 1U48A 2H3QA 4MFCA 4O3QA 3LVVA 3C2KA 1ZQXA 5KG4A 4QWDA 2OWOA 2ASLA 2G5HB 2KKPA 3TFSA 3C23A 5J2CA 4UB8U 1MA7A 5KT5A 4QZ9A 3NS1A 1HJPA 1CI4A 2W3SA 4GIBA 5KFNA 1PUZA 8ICEA 4CF3A 2KMDA 3PNCA 4ED7A 4QZFA 4I2DA 3Q8KA 1Q3VA 1J97A 4B9MA 4MEXA 3M9OB 4ECWA 4EBEA 5KFBA 2YX8A 5KFPA 4KTQA 3NVZA 1LKYB 5AICA 1BPZA 4YMOA 3GIJA 1QQ6A 1F0MA 2EZXA 3KZIU 1K1SA 4Y2VA 5HHIA 3OHAA 4RT3A 1X2IA 3RB3A 2W7OA 5A0LA 2A1AA 2XY7A 2CRXA 3KZXA 2OEHA 1AQ6A 4P4PA 9ICBA 3NUQA 4JV2A 4RQ6A 4DFJA 1IG6A 7ICHA 2AXTU 1NI3A 3G6VA 3SEIA 5AIAA 7ICFA 4YR3A 2EZZA 2H3IA 4CGZA 2AGQA 3KHRA 1SXDA 2I9GA 4RQNA 5JUMA 2H3FA 2HHVA 4J9KA 2W55A 2DUYA 1NK0A 2HI0A 2LI6A 2QB1A 3UQ0A 3MC1A 5KFQA 4YN4A 5L1JA 2FLLA 4IS7A 5AKLA 2LPEA 4KLTA 1NK7A 3ONNA 3SD7A 4TUSA 5AKHA 4BXOA 3HX0A 5AKJA 1NJWA 4B6JA 3BJYA 4B9VA 1SZPA 2HMXA 1PZNA 4YR2A 2JMGA 3QNMA 4NLGA 2RHFA 1T4GA 4Y2RA 5F9LA 1X66A 4OJ5A 1KBUA 3JPQA 3N28A 5GTHU 2W54A 3DV9A 4M04A 3U26A 3RJJA 4PZNA 5IILA 4F5NA 3TAPA 5AI6A 2HW3A 2KK0A 1QQ5A 5KFOA 1COKA 5KFGA 4RNOA 4DLEA 5AM5A 1L7MA 5T14A 4UW9A 3RJEA 3NRWA 3PX0A 1N62A 5J2KA 3WK6A 3PR4A 5KT6A 3SENA 4Y2YA 1NKCA 2XGPA 5AM3A 4RZRA 3C21A 5K4LA 1TE2A 1L3SA 3NGDA 1HIWA 4FZMA 4QWCA 1L3VA 2KNJA 3JPSA 5AM1A 4A8EA 4RUCA 2W04A 5KG7A 4RUAA 2KOBA 1U49A 4ELTA 3RH6A 5IIJA 3UQ2A 4TUQA 4PGXA 4F4ZA 3KTQA 1LV5A 4DSFA 9ICOA 1XWLA 2YMPA 4Y2QA 4JK1A 2NO4A 3BZKA 1KKXA 5KFZA 5L1LA 5DLFA 3UPQA 1UPHA 3L3FX 5F3XB 4I28A 4NL9A 2N1RA 2KZ3A 4Q45A 2FLNA 2ZIXB 1X40A 3RAXA 4I2CA 1URJA 5DG9A 1HUZA 1XO0A 2G0AA 4YD1A 5KT4A 1ZQWA 9ICTA 2OXOA 9ICCA 5AK3A 1ZQQA 3H7IA 1ZQAA 4ELUA 1N5XA 4C80A 3KKAA 2DL0A 5KG5A 5HHHA 1Q46A 4FZNA 3QU5A 1YZ7A 4I27A 1O08A 2RRDA 8ICKA 3QXGA 2W11A 3PO5A 1JI7A 3HW8A 3SI8A 3HRDD 1NK4A 2PXIA 5J2HA 1C20A 1RG6A 7ICKA 4DFKA 4F92B 4DQPA 4M9LA 1EXNA 1ZJMA 3PMLA 2K8AA 2DKZA 4AP9A 4CCHA 1L7PA 2B21A 2W3RA 3QZ8A 4NY8A 5JU5A 4RPYA 5DB7A 2OYYA 3QU4A 1SKSA 1T7PA 5AI5A 2WHEA 2H3ZA 2BQRA 1ZQJA 3JPPA 3N7RC 4XRHA 4XQ8A 9ICHA 4PHDA 3NVVA 1X9XA 2ZIWA 3MGVA 3TARA 4P0PA 2PKEA 4F50A 2KIWA 1L3TA 1KFTA 9ICIA 4F2RA 4AYBC 1L8OA 2WAQC 8ICZA 5ALEA 3T5HA 4K4IA 1ZQBA 1XU4A 3TADC 5AKIA 4M9GA 5KFRA 2KP7A 3RB0A 1X9WA 2KN7A 3LWMA 2R8GA 5ALOA 2V9WA 4JV1A 8ICMA 1B4FA 3RRHA 4UASA 1D8BA 3HP6A 2P6RA 3A0HU 1ZD3A 1ZQDA 3IP4B 2UVRA 1DGSA 5AHXA 7ICTA 5ALMA 4OJOA 9ICAA 1PVPA 4Q44A 3ZD9A 2LYBA 4U7CA 4QZ8A 3AQFA 2KJ5A 4UB6U 3BS5A 4M0AA 2F2AB 3AU2A 3K4GA 5HMLA 4PPXA 4IQUA 2J6UA 2YMQA 3FM9A 3C28A 4P0PB 3T5KA 4OJPA 4O3NA 2FMPA 3WU2U 1NZPA 2KJ8A 2YB1A 4OJLA 5ALRA 3Q8MA 4NM2A 3Q8LA 2NRTA 4UAUA 4USAA 3TAQA 3MABA 4KLOA 2Y0SF 4NLBA 3WK5A 1D9FA 3JPRA 3OTQA 4RQ4A 3OSNA 1ZETA 2BQ3A 4F8RA 2EH9A 1SV0A 3RAQA 4NLZA 3QYPA 3TI0A 2LBOA 7ICIA 3EUB2 3NTUA 3H8SA 3ZDAA 1ZD4A 1TAMA 3SQIA 9ICFA 1SWWA 1L8LA 1L5UA 2E3TA 4MF2A 4FBTA 2ZTDA 4G9BA 4KLJA 5EWGA 2AGPA 4B9NA 4C4RA 3MR2A 2QLTA 1O03A 4M6WB 5KG2A 2KICA 4K4HA 4I2IA 4DL4A 1K1QA 1L3UA 1NKBA 4Q8EA 1JIHA 4Y2TA 2CPRA 2YTUA 2PI5A 2I1QA 5ALYA 5J0YA 1U47A 3MGIA 3E0FA 3WKDA 2EZYA 4UAZA 1WG8A 5ALUA 1S77D 4J9MA 5ALVA 1BGXT 5ALZA 4F5QA 4DQSA 1ZQKA 3F2CA 2I5HA 1DK2A 2IMWP 1QSLA 3EPIA 2BKEA 4ACOA 4RQ3A 5KT2A 3M1YA 3UXPA 3M8SA 2P35A 2BR0A 1ZQUA 5HMMA 3RH5A 1XS9D 2A1JA 2RLTA 2NRZA 2YMLA 4UARA 1Q3UA 5KT7A 4JWMA 9ICMA 3WKBA 5DGBA 5KG6A 2DKXA 1BVSA 1V97A 3UXNA 1NK6A 2C2RA 4GC7A 1M6YA 4Y2XA 8ICNA 4NWIA 3WK8A 3GIMA 5BOMA 3PW5A 1DXSA 2MU2A 1U4BA 3OSPA 5ALIA 4O3PA 4Y2JA 3E58A 4ED8A 1ZJNA 3GV7B 5ALNA 1ZQLA 2E1EA 9ICWA 3AUOA 5D4BA 4KX5A 2VA8A 4FE3A 5TISU 2IOFK 5AM4A 3M6KA 4B9SA 1ZQRA 4LJXA 5DBCA 2FDRA 2R8KA 2K89A 4RT2A 2BDUA 3IHQB 1N48A 2FMQA 5DGAA 4DLGA 5HR6A 3M9MB 3WK9A 1MC8A 1SKRA 2HHTA 4MHVA 4Y2PA 5EE9A 1S76D 3ZDBA 8ICSA 2ATLA 4ED6A 3RJHA 2VKQA 3CNHA 3F5AA 1K5OA 3ETRA 1FFVA 2WFAA 2HHWA 2EDUA 3RF9A 5KTQA 4QZAA 1F5SA 1KLNA 5AI8A 4DL3A 5L1IA 4DWIA 3ZDDA 4F4WA 4Q43A 5DB6A 4IR9A 3C2LA 4FS2A 1SKWA 5EWEA 2JEJA 1KFSA 4NM1A 5J2AA 4RNNA 2XVTA 4UB3A 4Z6DA 5KG3A 2ISOA 4NLNA 1WUDA 2WF9A 9ICNA 3RB4A 3UM9A 4KX3A 8ICYA 3EWAA 2JHDA 1MQ2A 3KHGA 1Z4OA 3AMZA 2FLPA 5J0WA 2MRLA 3MDAA 4QZDA 2W8LA 1SIJA 5J8YC 4RQ2A 1X6IA 4ECXA 4KMUA 4B9LA 4EELA 1QSSA 2JH1A 7ICNA 4QZGA 1CUKA 5ALLA 2HHQA 3QUTA 2FPKA 1JN3A 4KLHA 1ECWA 3K1RB 1JRPA 3PR5B 1C7YA 4PHAA 3MFIA 3GV8B 4Z6EA 4J9QA 2GOLA 3PX6A 2VJ5A 1RXVA 4YR0A 2AGOA 4I2FA 1DK3A 4C8OA 1NKEA 3PW0A 2G06A 2NYVA 4XA5A 1KQQA 1MSWD 3I1YA 2HOQA 4QZBA 1IM4A 3IN5A 3LK9A 3LVWA 1TK5A 4I2EA 1JUDA 5KFKA 3HKZF 4EBDA 4OCZA 4F5RA 1SL2A 1A6SA 4DOBA 4DO9A 1V38A 2BDPA 5ALDA 3GIKA 3TANA 4PH5A 7ICUA 2QB0A 4F4XA 2ZUDA 3E2EA 8ICOA 9ICKA 4CNQA 3NASA 4EX7A 4O3OA 3PVXA 1BPBA 4QW9A 2YQEA 4MEYA 2VJ4A 4EBCA 1FEZA 5J0PA 7ICJA 4PGYA 3KFUF 2F1IA 8ICQA 5JTIA 1PVQA 3V6KA 1UCVA 3RR7A 5KFVA 1Z19A 2PFOA 2E8PA 3M9NB 1NJXA 1V9PA 4YG2A 2R8HA 3SAFA 4ED3A 2ZIXA 3QZ7A 9ICJA 4DS5A 1D8YA 2AU0A 4KLUA 2HBJA 3DEEA 3IRUA 1ZQYA 2ZG6A 3AN1A 3AEVA 2F1HA 2OHFA 5CRXA 1FFUA 1ZD5A 3ISBA 5G5HA 2Q4TA 1GO3F 1RXWA 2W8KA 3QX7A 3EYZA 1BNPA 5B5EU 3I28A 2WF8A 4US8A 1Z1VA 4GXIA 2R18A 2DPJA 2L5YA 3I76A 1TKDA 2EAOA 4G3IA 2K4EA 1TV9A 1ZQEA 5KFXA 3FYHA 4PHEA 5DQHA 2QB0B 4QZCA 5KNIA 2XC9A 1SV4A 5J0UA 5J2IA 2E8NA 1OXJA 2F8KA 4UBCA 2ISPA 2HHXA 3N97B 3IM1A 2WB1C 5AKYA 3L5KA 7ICEA 4QIWC 3RRGA 2NO5A 5HP4A 1P7DA 1RPLA 1BNOA 3PW7A 2D3DA 1ZD2P 1ZQMA 4OO1J 2JR5A 9ICEA 3QUCA 8ICUA 4RQ1A 5TZVA 4GLXA 7ICSA 3PMNA 2QARB 3C5GA 1UT8A 2LYAA 1Z4NA 2UVWA 4RQ8A 2ZIVA 4NLKA 3FDSA 4EYIB 3ETLA 1S0NA 3M7DA 5KFIA 3C29A 4Z6CA 2WAQF 4AYBF 2BCRA 3A0BU 4LZDA 3MGHA 3TQ1A 4PHPA 2G5IB 1RQNA 3GV5B 5J29A 1S9FA 1N61A 4DFDA 1N56A 4ED1A 4EZ6A 4FFDA 4ECUA 1QLNA 4J9NA 2VANA 3RR8A 5AI4A 4P4OA 5BPCA 3GIIA 5J2FA 3MR6A 5DDYA 3M6ZA 1FO4A 3EPGA 5J2EA 5ALJA 4J9OA 2HBMA 4DSEA 1UA0A 3QEBZ 2BGWA 4C8MA 1FIQA 3GFKB 4DL6A 2BCQA 3Q8RB
chains in the Genus database with same CATH topology
2PMZF 3F5EA 3HKZC 3LVVA 2VKQA 2G0AA 3E0FA 3IP4B 3PZPA 2WB1C 3IN5A 1XO0A 3GU3A 3ONNA 2ZIWB 3F5AA 1A0PA 2OXOA 3LVWA 2GH1A 2G5HB 2HBLA 4QIWC 2KKPA 4OJOA 3H0RB 3F53A 3SAHA 3HKZF 1PVPA 2LYBA 2K4HA 2ZIVB 3N7SC 4KMOB 4BJQA 4BX9C 4C0ZA 3F2CA 1MA7A 1P7DA 2E5SA 2XIDA 4U7CA 4CRXA 3RF9A 4BUGA 2A3VA 2RP5A 4JMUA 4NV0A 1A6SA 3AQFA 2HMXA 2KJ5A 3ALRA 2NV3A 5HR7A 2JMGA 2ZXIA 2PMZC 4ACOA 2F2AB 2KD1A 4FZNA 4GFJA 4OO1J 2DGZA 2RHFA 2MA1A 2RRDA 2ZXHA 4PL1A 2XICA 4OJ5A 1KBUA 1F44A 4FZLA 2LHTA 1Q3VA 2DF4B 4QNLA 3C28A 2KEYA 1Q3UA 4P0PB 2G08A 1IIPA 2VJ4A 2XVTA 2W7PA 1ED1A 2XI9A 3D2SA 2VIXA 4OJPA 1Z1BA 2YX8A 3VCBA 2LYAA 1WUDA 2K8AA 3KFUF 4ICAA 2W7OA 4O3MA 3CRXA 2ZIVA 1PVQA 2K4IA 4KX3A 2HOFA 2K8CB 2JHDA 2KJ8A 4WJ3B 2YB1A 4OJLA 1Z19A 3CP8A 1DRGA 5KL1B 2OYYA 1L6NA 5T14A 4QJFB 3M7DA 3NRWA 3C29A 4P0QB 3D2QA 4NWIA 2H3ZA 2ZIUB 5KL8B 3SAGA 3PSFA 1NZBA 1CRXA 2OM6A 2MRLA 2WAQF 3IG8A 2Y0SF 4AYBF 3PSIA 4NLBA 5A0LA 3OPXA 2ZIXA 3SAFA 1XNSA 2KHQA 2KV2A 3N7RC 2CRXA 3O0FA 3KZXA 2G5IB 3PSTA 2F8LA 3GZFA 3T79A 1HEKA 2HOIA 2G09A 2ZIWA 2HBJA 2KVCA 3DEEA 3NUQA 2JH1A 4OJ6A 2E1EA 3N7PD 2ZG6A 3MGVA 4P0PA 2F77X 3F2BA 2CN1A 1HIWA 3LYSA 3ICXA 4FZMA 2KNJA 2KIWA 2D6FC 2LBOA 2DQNB 3H0LB 3PSPA 4A8EA 4KX5A 2W04A 5CRXA 2KJ9A 2KKVA 2KOBA 1YT3A 2K8BB 4FE3A 2HBKA 3M6KA 2KHVA 3AQEA 2YB4A 2Q4TA 2WAQC 1ECWA 2G07A 2Y0SC 3H0MB 4AYBC 5C0YA 1TAMA 3SQIA 1GO3F 1URJA 4PL2A 3AL0B 2W03A 2F76X 2H3IA 4CGZA 2LKYA 2K89A 4U6PA 2BDUA 2JGAA 2GOLA 2R18A 2VJ5A 4IC9A 4P0QA 3M6ZA 3RFAA 1ZQ1C 2E1FA 2H3VA 1OUQA 2ZIUA 2H3FA 2OH2A 2K4EA 2WB1F 1T94A 3K1ZA 5HR6A 4QIWF 1D8BA 3SMVA 2KICA 2HBMA 3F2DA 2G06A 2M0NA 3VC8A 1SZHA 2JH7A 1PVRA 1UPHA 3L3FX 4NLCA 2Z7JA 2H3QA 2N1RA 2ZIXB 4CDGA 2CPRA 3CYMA 2HOQA 3IG5A 3D2NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SAG A;  4CGZ A;  4NLB A;  3SAF A;  2HBL A;  2E1F A;  2KV2 A;  3SAH A;  2HBJ A;  4QIW F;  2E1E A;  1D8B A;  1WUD A;  4O3M A;  2HBM A;  1GO3 F;  1YT3 A;  4NLC A;  2HBK A;  4QJF B;  4CDG A;  4OO1 J;  5C0Y A;  2DGZ A;  2RHF A;  2MA1 A;  2CPR A;  3CYM A;  2RRD A; 
#chains in the Genus database with same CATH topology
 4J9R A;  1NZB A;  4ED2 A;  4GXJ A;  2IA6 A;  1ZOL A;  3OGU A;  3M8R A;  2ZIV B;  4BX9 C;  5AKX A;  2E5S A;  2XID A;  5ALQ A;  4CRX A;  1UA1 A;  3S6J A;  3B0Y A;  5AKE A;  3GDX A;  3WKE A;  4Q8F A;  5KFH A;  5KFU A;  4C8K A;  5ALP A;  2RDJ A;  2PMZ C;  5AI9 A;  2VA3 A;  3N4M B;  2NRX A;  1F44 A;  1QQ7 A;  3B0X A;  5KFW A;  4QNL A;  4TUP A;  4KN4 A;  5L1K A;  2G08 A;  3MDC A;  1IIP A;  3T5J A;  2XI9 A;  3QU2 A;  5J2J A;  4ECR A;  5J2G A;  1A77 A;  2MUT B;  4O3M A;  5KAF U;  2EAM A;  2XCA A;  5KFD A;  5DKW A;  4M6W A;  3CP8 A;  1RQL A;  4QJF B;  3D2Q A;  5KL8 B;  3IG8 A;  4NJ8 A;  2W9B B;  1TK8 A;  5IIM A;  2WTF A;  2LM1 A;  3O0F A;  3PST A;  4OJ6 A;  2F77 X;  2IHN A;  2CN1 A;  4EZ9 A;  5ALF A;  2ZUB A;  4ECY A;  1TAQ A;  1YT3 A;  4QZH A;  3RH4 A;  3QEA Z;  1TFR A;  1QCK A;  4IRC A;  2W03 A;  1QSY A;  9ICP A;  4MF8 A;  5J2B A;  4P0Q A;  1KSP A;  1T94 A;  4DL2 A;  3MR5 A;  2KFN A;  3KOO A;  4Z6F A;  4BGD A;  4O5C A;  4YMN A;  9ICV A;  3PV8 A;  2BQU A;  1SZH A;  3RTV A;  3V7J A;  2IHM A;  2Z7J A;  2NRV A;  4C7Y A;  1V85 A;  3D6J A;  1RYR A;  4R63 A;  3SAH A;  1NOM A;  4ZH4 A;  3N7S C;  3ZI4 A;  1JXE A;  1NK8 A;  3PW4 A;  4NV0 A;  3V7K A;  4KLD A;  2NV3 A;  2O6K A;  3IDW A;  1ZQG A;  1QTM A;  3KHH A;  2UVU A;  2DGZ A;  5C5J A;  1WYG A;  2ZXH A;  3DDH A;  4F2S A;  2LHT A;  2DF4 B;  5CJ7 A;  2WF7 A;  4Y2S A;  4Y2U A;  1SXE A;  4QZI A;  2BZF A;  5CB1 A;  3HPO A;  5CHG A;  2K8C B;  3PY8 A;  4WJ3 B;  2FPM A;  5KFM A;  2DBY A;  4DFM A;  4B9T A;  4IRD A;  4P0Q B;  1ZQV A;  3R9K A;  1ZQS A;  4QWA A;  3H8W A;  3H4B A;  1JAL A;  4RQ7 A;  8ICW A;  4KLG A;  3T3F A;  2ZJ5 A;  4YVZ A;  3BZC A;  1TAU A;  5D46 A;  2HHU A;  3ICX A;  1ZQT A;  4PZO A;  2DQN B;  9ICX A;  9ICR A;  3PO4 A;  8ICL A;  3Q8S B;  1JX4 A;  4NL9 C;  5KFC A;  1B0X A;  4E0D A;  1XO1 A;  2F76 X;  2JEG A;  2J6S A;  2JGA A;  1SB3 C;  2ZIU A;  1D8L A;  4KLM A;  3SMV A;  2W43 A;  1T8E A;  2H5X A;  5J0X A;  5ALT A;  2MSN A;  2KIV A;  3KKA C;  2LM4 A;  1ZQH A;  2AHO B;  4O0I A;  4QW8 A;  3PZP A;  5JRT A;  1A0P A;  8ICC A;  2AH5 A;  2GH1 A;  2OCE A;  2XY6 A;  4JWN A;  5EE1 A;  4O5K A;  2K4H A;  2F44 A;  4BJQ A;  3GQC A;  1U9L A;  2RP5 A;  2ASD A;  1YZ6 A;  8ICV A;  3ALR A;  2IBK A;  3NVW A;  2KSO A;  2V4Q A;  4DSK A;  1IXR A;  4R66 A;  8ICF A;  4ECQ A;  4JUZ A;  2HSZ A;  4PGQ A;  3UXO A;  4GC6 A;  3SYZ A;  3V7L A;  1NK9 A;  2EQY A;  5J0Q A;  3SR6 A;  4M47 A;  3ZDC A;  1NJZ A;  1NJY A;  4RPZ A;  3JPT A;  2GWS A;  2ZIU B;  4UB4 A;  4LZG A;  2OM6 A;  3MR3 A;  2W9C A;  2KHQ A;  2KV2 A;  1LB2 B;  4F4Y A;  3BQ0 A;  2HOI A;  2Y9U A;  4KLF A;  2KVC A;  3EZ5 A;  3UMC A;  3CW2 C;  2KZZ A;  1VDV A;  2FJ6 A;  2KJ9 A;  5L9X A;  4TUR A;  4KIT B;  2HBK A;  4DOA A;  3AQE A;  1KEJ A;  5EE0 A;  3H0M B;  4HAI A;  4DFP A;  4O9M A;  7ICO A;  3RJI A;  5KAI U;  1JXL A;  3TAC B;  5AM2 A;  2C2E A;  2HDO A;  2K4P A;  3ZD8 A;  1Q8K A;  2KSO B;  2AJQ A;  3QU7 A;  1N63 A;  2C22 A;  5KFJ A;  2GLE A;  5AKK A;  3JPO A;  2I6X A;  2K60 A;  2KTQ A;  1XSN A;  3TAD A;  3RBD A;  5G5G A;  5DQG A;  4I2B A;  4R64 A;  8ICJ A;  5ALG A;  2KVS A;  1VJ5 A;  1S0O A;  1JMS A;  4KMO B;  3WKA A;  5J0O A;  4BUG A;  4FS1 A;  1MN8 A;  2YMM A;  4JMU A;  5DB9 A;  2KG5 A;  2AQ0 A;  2DFL A;  1DOQ A;  2A19 A;  5J0T A;  1KL9 A;  4X5V A;  2MA1 A;  5CEH A;  2W9C B;  4PL1 A;  4BDP A;  2JZB B;  2W9M A;  5KFY A;  1LVH A;  3GIL A;  5H2F U;  4JV0 A;  2KEY A;  5KG1 A;  2BPF A;  1S10 A;  3T5L A;  3RJG A;  5DG7 A;  5FP0 A;  3VCB A;  3B9J A;  3SV4 A;  1S8O A;  5HNK A;  1QH9 A;  2JEI A;  1X9M A;  4YD2 A;  2PFQ A;  3AM9 A;  4RNM A;  3AU6 A;  5ALH A;  1SV0 C;  1BPD A;  2KFZ A;  1T3N A;  1CEZ A;  4DQR A;  5GTI U;  3BQ7 A;  1XNS A;  3TKA A;  7ICV A;  2C2D A;  1HEK A;  4DEZ A;  1T3Q A;  2C28 A;  4KN7 A;  4R8U A;  8ICI A;  4IQV A;  4DSI A;  4DQI A;  1SL0 A;  2YN4 A;  1KW4 A;  4M9H A;  1ZRM A;  4HYK A;  2G07 A;  1PK3 A;  4J9P A;  5C0Y A;  4MFF A;  3H8J A;  3RJK A;  3THV A;  3UMG A;  4KLS A;  1B22 A;  4U6P A;  3C1Z A;  1RYS A;  9ICU A;  2WB1 F;  4IR1 A;  4YQW A;  1NNL A;  4QIW F;  1N5W A;  4CE6 A;  5DB8 A;  2BPC A;  5IIN A;  5KT3 A;  3OJS A;  5J0R A;  1ZXI A;  2W9A A;  2QAR A;  8ICG A;  1S97 A;  4BWJ A;  3V6J A;  2BCV A;  4O3S A;  2XCP A;  2YY6 A;  4CDG A;  2Y9T A;  3PSI A;  3IG5 A;  3F5E A;  3HKZ C;  3K75 D;  4YXJ A;  3ORY A;  5KG0 A;  2BCS A;  4UAV A;  5KFA A;  3WKC A;  4UAY A;  3H4D A;  1ZQO A;  5E79 U;  1ZYQ A;  3ISC A;  4F3O A;  4ZOH C;  1WCL A;  4M2Y A;  2KD1 A;  1IV8 A;  4GFJ A;  4KLE A;  4F4K A;  1BPE A;  2KZM A;  2XIC A;  5ALW A;  4QWB A;  5KFE A;  8ICA A;  4R8U B;  2VIX A;  5CP2 A;  2M9N A;  1Z1B A;  1ZQI A;  5DLG A;  1ZRN A;  3CRX A;  3C5F A;  2PI4 A;  3EW9 A;  1A76 A;  2K4I A;  4QZE A;  2HOF A;  5AI0 A;  1B43 A;  5IIO A;  3ZDE A;  4DS4 A;  4BXO B;  1BPX A;  1SWV A;  3JPN A;  2WF5 A;  1KRP A;  9ICL A;  8ICP A;  7ICP A;  4FBU A;  4P4M A;  3BS7 A;  2LMR A;  1RZT A;  1KFD A;  1N2X A;  5D49 A;  5AKG A;  1J2M A;  2ZTC A;  2LYH A;  4P2H A;  3PW2 A;  7ICG A;  2JRZ A;  4ECT A;  2KKV A;  2K8B B;  4R65 A;  8ICR A;  2ODG A;  2P6U A;  4DCC A;  3G6X A;  9ICS A;  2ZTE A;  3ED5 A;  2HCF A;  3UMB A;  3AL0 B;  1ZQN A;  4YFK A;  4IC9 A;  3C2M A;  4F5P A;  2E1F A;  4C8N A;  3Q8Q B;  2ASJ A;  4F71 A;  8ICB A;  4I2H A;  2EAN A;  4DOC A;  3HJE A;  1SGG A;  3Q8P B;  2MUT A;  4C7Z A;  5KFL A;  3CYM A;  3D2N A;  3WK7 A;  5BOL A;  2PMZ F;  2Y1I A;  2HVI A;  4DSL A;  3MBY A;  2JV3 A;  5EE3 A;  1WWV A;  2F3N A;  2A3V A;  2W9B A;  4I2A A;  5HR7 A;  2B0C A;  7ICL A;  2D8C A;  3QE9 Y;  4M9J A;  3LWL A;  4KLI A;  1COO A;  3IV6 A;  4BWM A;  1XC9 A;  2PFN A;  1SL1 A;  4LVS A;  2W7P A;  3MFH A;  1NK5 A;  3D2S A;  1S0V A;  3ISD A;  3QUB A;  4DF8 A;  2E8O A;  4KLQ A;  2FMS A;  5KL1 B;  2J6T A;  4QWE A;  2FI1 A;  1L6N A;  4DSJ A;  5KFF A;  3SAG A;  1CRX A;  4DQQ A;  4TQS A;  4YCX A;  1U45 A;  2WF6 A;  4UBB A;  5DG8 A;  4NXZ A;  2F8L A;  1BPY A;  4C4T A;  4EEN A;  3G6Y A;  4GXK A;  3N7P D;  3F2B A;  3FAH A;  7ICQ A;  4EYH B;  3PSP A;  4B9U A;  5CWR A;  4C4S A;  3H40 A;  5J8Y A;  3FC4 A;  2LKY A;  1UT5 A;  1Z3E B;  4J03 A;  2H3V A;  4RQM A;  5AIB A;  1OUQ A;  1XSP A;  1RYU A;  4YP3 A;  3K1Z A;  4K4G A;  8ICT A;  2BHN A;  4I2G A;  3BQ1 A;  1WCN A;  2F1J A;  1ZQZ A;  2R8I A;  4IL6 U;  4KLL A;  3GZF A;  4RPX A;  4ELV A;  4MFA A;  5J0S A;  4UAW A;  2ZIW B;  5ALK A;  4IQT A;  3KD3 A;  5AK6 A;  3H0R B;  3F53 A;  1H38 A;  4C0Z A;  5J2D A;  4YXM A;  1XSL A;  4UB2 A;  3SZ2 A;  2E8M A;  5L1M A;  1X42 A;  3HT3 A;  2HVH A;  5CR0 A;  3C1Y A;  4UB5 A;  1PK1 A;  2IOH A;  9ICG A;  4XUS A;  5CA7 A;  2KE7 A;  5F9N A;  4FZL A;  8ICX A;  2ZJ8 A;  3KBB A;  3TFR A;  2NRW A;  3PX4 A;  1RDF A;  2AQ4 A;  4JB3 A;  4RQ0 A;  3BQT A;  2Q0Z X;  4ICA A;  3NVY A;  4ECZ A;  2B6G A;  1D9D A;  3OJU A;  2ZJA A;  2IOF A;  4F91 B;  4O3R A;  1MQ3 A;  5KFT A;  4UB1 A;  3H8M A;  3L4P A;  4O5E A;  4ED0 A;  3PSF A;  2XO7 A;  1Z00 A;  2JXJ A;  2MAX A;  5III A;  3BS5 B;  4IQW A;  2BCU A;  4I29 A;  5EWF A;  3LYS A;  2D6F C;  2R8J A;  2XY5 A;  1ZQP A;  3RB6 A;  5ALX A;  4US9 A;  2Y0S C;  1UHU A;  1Y88 A;  2UVV A;  1N60 A;  4PL2 A;  4ECS A;  5ALS A;  1ZQ1 C;  3OHB A;  1ARO P;  5AKZ A;  4M9N A;  2Y1J A;  1TK0 A;  2CXY A;  1PK1 B;  3WK4 A;  1UQV A;  3F2D A;  3VC8 A;  4DL7 A;  2JH7 A;  1PVR A;  3QUQ A;  4NLC A;  4J9L A;  4EX6 A;  9ICQ A;  2GO7 A;  1X9S A;  4J9S A;  2PFP A;  1VLB A;  4UAT A;  3J81 j;  5AM0 A;  1KTQ A;  3GU3 A;  8ICH A;  3BQ2 A;  2HBL A;  4FO6 A;  4OD0 A;  5AK5 A;  3LDA A;  2ESE A;  5B66 U;  5DDM A;  4IRK A;  3QU9 A;  1J2N A;  3RBE A;  2ZXI A;  4RU9 A;  5DBB A;  4PJ0 U;  1Z00 B;  1DGJ A;  1X6J A;  1S5L U;  3KHL A;  3V72 A;  2ES6 A;  4RQ5 A;  5AK4 A;  1S0M A;  1HUO A;  1ED1 A;  4CF4 A;  5KFS A;  2RQ5 A;  1TVA A;  1RM6 C;  1L7N A;  4C8L A;  5IIK A;  4TQR A;  3HIL A;  4I2J A;  2ALZ A;  1L7O A;  1DRG A;  2BPG A;  4F72 A;  3NRZ A;  7ICR A;  3HWT A;  4EEY A;  4EEK A;  2P66 A;  2V4R A;  3OPX A;  1KDH A;  2JEF A;  2DPI A;  1JRO A;  3T79 A;  2G09 A;  1ZQF A;  2DWQ A;  4YMM A;  3SV3 A;  2RDI A;  3H0L B;  3V6H A;  2A1J B;  1WWU A;  2KHV A;  2YB4 A;  1OW5 A;  1LKY A;  4F5O A;  4UQG A;  4DF4 A;  2ZUC A;  2QKQ A;  4ECV A;  4CF5 A;  5DQI A;  2HHS A;  2FPL A;  3RFA A;  2OH2 A;  5DBA A;  5EOZ A;  2JZB A;  4DL5 A;  3RJF A;  7ICM A;  2VA2 A;  2EAP A;  1KN5 A;  2XGQ A;  2FE9 A;  1ZQC A;  2M0N A;  4F93 B;  3BDP A;  1U48 A;  2H3Q A;  4MFC A;  4O3Q A;  3LVV A;  3C2K A;  1ZQX A;  5KG4 A;  4QWD A;  2OWO A;  2ASL A;  2G5H B;  2KKP A;  3TFS A;  3C23 A;  5J2C A;  4UB8 U;  1MA7 A;  5KT5 A;  4QZ9 A;  3NS1 A;  1HJP A;  1CI4 A;  2W3S A;  4GIB A;  5KFN A;  1PUZ A;  8ICE A;  4CF3 A;  2KMD A;  3PNC A;  4ED7 A;  4QZF A;  4I2D A;  3Q8K A;  1Q3V A;  1J97 A;  4B9M A;  4MEX A;  3M9O B;  4ECW A;  4EBE A;  5KFB A;  2YX8 A;  5KFP A;  4KTQ A;  3NVZ A;  1LKY B;  5AIC A;  1BPZ A;  4YMO A;  3GIJ A;  1QQ6 A;  1F0M A;  2EZX A;  3KZI U;  1K1S A;  4Y2V A;  5HHI A;  3OHA A;  4RT3 A;  1X2I A;  3RB3 A;  2W7O A;  5A0L A;  2A1A A;  2XY7 A;  2CRX A;  3KZX A;  2OEH A;  1AQ6 A;  4P4P A;  9ICB A;  3NUQ A;  4JV2 A;  4RQ6 A;  4DFJ A;  1IG6 A;  7ICH A;  2AXT U;  1NI3 A;  3G6V A;  3SEI A;  5AIA A;  7ICF A;  4YR3 A;  2EZZ A;  2H3I A;  4CGZ A;  2AGQ A;  3KHR A;  1SXD A;  2I9G A;  4RQN A;  5JUM A;  2H3F A;  2HHV A;  4J9K A;  2W55 A;  2DUY A;  1NK0 A;  2HI0 A;  2LI6 A;  2QB1 A;  3UQ0 A;  3MC1 A;  5KFQ A;  4YN4 A;  5L1J A;  2FLL A;  4IS7 A;  5AKL A;  2LPE A;  4KLT A;  1NK7 A;  3ONN A;  3SD7 A;  4TUS A;  5AKH A;  4BXO A;  3HX0 A;  5AKJ A;  1NJW A;  4B6J A;  3BJY A;  4B9V A;  1SZP A;  2HMX A;  1PZN A;  4YR2 A;  2JMG A;  3QNM A;  4NLG A;  2RHF A;  1T4G A;  4Y2R A;  5F9L A;  1X66 A;  4OJ5 A;  1KBU A;  3JPQ A;  3N28 A;  5GTH U;  2W54 A;  3DV9 A;  4M04 A;  3U26 A;  3RJJ A;  4PZN A;  5IIL A;  4F5N A;  3TAP A;  5AI6 A;  2HW3 A;  2KK0 A;  1QQ5 A;  5KFO A;  1COK A;  5KFG A;  4RNO A;  4DLE A;  5AM5 A;  1L7M A;  5T14 A;  4UW9 A;  3RJE A;  3NRW A;  3PX0 A;  1N62 A;  5J2K A;  3WK6 A;  3PR4 A;  5KT6 A;  3SEN A;  4Y2Y A;  1NKC A;  2XGP A;  5AM3 A;  4RZR A;  3C21 A;  5K4L A;  1TE2 A;  1L3S A;  3NGD A;  1HIW A;  4FZM A;  4QWC A;  1L3V A;  2KNJ A;  3JPS A;  5AM1 A;  4A8E A;  4RUC A;  2W04 A;  5KG7 A;  4RUA A;  2KOB A;  1U49 A;  4ELT A;  3RH6 A;  5IIJ A;  3UQ2 A;  4TUQ A;  4PGX A;  4F4Z A;  3KTQ A;  1LV5 A;  4DSF A;  9ICO A;  1XWL A;  2YMP A;  4Y2Q A;  4JK1 A;  2NO4 A;  3BZK A;  1KKX A;  5KFZ A;  5L1L A;  5DLF A;  3UPQ A;  1UPH A;  3L3F X;  5F3X B;  4I28 A;  4NL9 A;  2N1R A;  2KZ3 A;  4Q45 A;  2FLN A;  2ZIX B;  1X40 A;  3RAX A;  4I2C A;  1URJ A;  5DG9 A;  1HUZ A;  1XO0 A;  2G0A A;  4YD1 A;  5KT4 A;  1ZQW A;  9ICT A;  2OXO A;  9ICC A;  5AK3 A;  1ZQQ A;  3H7I A;  1ZQA A;  4ELU A;  1N5X A;  4C80 A;  3KKA A;  2DL0 A;  5KG5 A;  5HHH A;  1Q46 A;  4FZN A;  3QU5 A;  1YZ7 A;  4I27 A;  1O08 A;  2RRD A;  8ICK A;  3QXG A;  2W11 A;  3PO5 A;  1JI7 A;  3HW8 A;  3SI8 A;  3HRD D;  1NK4 A;  2PXI A;  5J2H A;  1C20 A;  1RG6 A;  7ICK A;  4DFK A;  4F92 B;  4DQP A;  4M9L A;  1EXN A;  1ZJM A;  3PML A;  2K8A A;  2DKZ A;  4AP9 A;  4CCH A;  1L7P A;  2B21 A;  2W3R A;  3QZ8 A;  4NY8 A;  5JU5 A;  4RPY A;  5DB7 A;  2OYY A;  3QU4 A;  1SKS A;  1T7P A;  5AI5 A;  2WHE A;  2H3Z A;  2BQR A;  1ZQJ A;  3JPP A;  3N7R C;  4XRH A;  4XQ8 A;  9ICH A;  4PHD A;  3NVV A;  1X9X A;  2ZIW A;  3MGV A;  3TAR A;  4P0P A;  2PKE A;  4F50 A;  2KIW A;  1L3T A;  1KFT A;  9ICI A;  4F2R A;  4AYB C;  1L8O A;  2WAQ C;  8ICZ A;  5ALE A;  3T5H A;  4K4I A;  1ZQB A;  1XU4 A;  3TAD C;  5AKI A;  4M9G A;  5KFR A;  2KP7 A;  3RB0 A;  1X9W A;  2KN7 A;  3LWM A;  2R8G A;  5ALO A;  2V9W A;  4JV1 A;  8ICM A;  1B4F A;  3RRH A;  4UAS A;  1D8B A;  3HP6 A;  2P6R A;  3A0H U;  1ZD3 A;  1ZQD A;  3IP4 B;  2UVR A;  1DGS A;  5AHX A;  7ICT A;  5ALM A;  4OJO A;  9ICA A;  1PVP A;  4Q44 A;  3ZD9 A;  2LYB A;  4U7C A;  4QZ8 A;  3AQF A;  2KJ5 A;  4UB6 U;  3BS5 A;  4M0A A;  2F2A B;  3AU2 A;  3K4G A;  5HML A;  4PPX A;  4IQU A;  2J6U A;  2YMQ A;  3FM9 A;  3C28 A;  4P0P B;  3T5K A;  4OJP A;  4O3N A;  2FMP A;  3WU2 U;  1NZP A;  2KJ8 A;  2YB1 A;  4OJL A;  5ALR A;  3Q8M A;  4NM2 A;  3Q8L A;  2NRT A;  4UAU A;  4USA A;  3TAQ A;  3MAB A;  4KLO A;  2Y0S F;  4NLB A;  3WK5 A;  1D9F A;  3JPR A;  3OTQ A;  4RQ4 A;  3OSN A;  1ZET A;  2BQ3 A;  4F8R A;  2EH9 A;  1SV0 A;  3RAQ A;  4NLZ A;  3QYP A;  3TI0 A;  2LBO A;  7ICI A;  3EUB 2;  3NTU A;  3H8S A;  3ZDA A;  1ZD4 A;  1TAM A;  3SQI A;  9ICF A;  1SWW A;  1L8L A;  1L5U A;  2E3T A;  4MF2 A;  4FBT A;  2ZTD A;  4G9B A;  4KLJ A;  5EWG A;  2AGP A;  4B9N A;  4C4R A;  3MR2 A;  2QLT A;  1O03 A;  4M6W B;  5KG2 A;  2KIC A;  4K4H A;  4I2I A;  4DL4 A;  1K1Q A;  1L3U A;  1NKB A;  4Q8E A;  1JIH A;  4Y2T A;  2CPR A;  2YTU A;  2PI5 A;  2I1Q A;  5ALY A;  5J0Y A;  1U47 A;  3MGI A;  3E0F A;  3WKD A;  2EZY A;  4UAZ A;  1WG8 A;  5ALU A;  1S77 D;  4J9M A;  5ALV A;  1BGX T;  5ALZ A;  4F5Q A;  4DQS A;  1ZQK A;  3F2C A;  2I5H A;  1DK2 A;  2IMW P;  1QSL A;  3EPI A;  2BKE A;  4ACO A;  4RQ3 A;  5KT2 A;  3M1Y A;  3UXP A;  3M8S A;  2P35 A;  2BR0 A;  1ZQU A;  5HMM A;  3RH5 A;  1XS9 D;  2A1J A;  2RLT A;  2NRZ A;  2YML A;  4UAR A;  1Q3U A;  5KT7 A;  4JWM A;  9ICM A;  3WKB A;  5DGB A;  5KG6 A;  2DKX A;  1BVS A;  1V97 A;  3UXN A;  1NK6 A;  2C2R A;  4GC7 A;  1M6Y A;  4Y2X A;  8ICN A;  4NWI A;  3WK8 A;  3GIM A;  5BOM A;  3PW5 A;  1DXS A;  2MU2 A;  1U4B A;  3OSP A;  5ALI A;  4O3P A;  4Y2J A;  3E58 A;  4ED8 A;  1ZJN A;  3GV7 B;  5ALN A;  1ZQL A;  2E1E A;  9ICW A;  3AUO A;  5D4B A;  4KX5 A;  2VA8 A;  4FE3 A;  5TIS U;  2IOF K;  5AM4 A;  3M6K A;  4B9S A;  1ZQR A;  4LJX A;  5DBC A;  2FDR A;  2R8K A;  2K89 A;  4RT2 A;  2BDU A;  3IHQ B;  1N48 A;  2FMQ A;  5DGA A;  4DLG A;  5HR6 A;  3M9M B;  3WK9 A;  1MC8 A;  1SKR A;  2HHT A;  4MHV A;  4Y2P A;  5EE9 A;  1S76 D;  3ZDB A;  8ICS A;  2ATL A;  4ED6 A;  3RJH A;  2VKQ A;  3CNH A;  3F5A A;  1K5O A;  3ETR A;  1FFV A;  2WFA A;  2HHW A;  2EDU A;  3RF9 A;  5KTQ A;  4QZA A;  1F5S A;  1KLN A;  5AI8 A;  4DL3 A;  5L1I A;  4DWI A;  3ZDD A;  4F4W A;  4Q43 A;  5DB6 A;  4IR9 A;  3C2L A;  4FS2 A;  1SKW A;  5EWE A;  2JEJ A;  1KFS A;  4NM1 A;  5J2A A;  4RNN A;  2XVT A;  4UB3 A;  4Z6D A;  5KG3 A;  2ISO A;  4NLN A;  1WUD A;  2WF9 A;  9ICN A;  3RB4 A;  3UM9 A;  4KX3 A;  8ICY A;  3EWA A;  2JHD A;  1MQ2 A;  3KHG A;  1Z4O A;  3AMZ A;  2FLP A;  5J0W A;  2MRL A;  3MDA A;  4QZD A;  2W8L A;  1SIJ A;  5J8Y C;  4RQ2 A;  1X6I A;  4ECX A;  4KMU A;  4B9L A;  4EEL A;  1QSS A;  2JH1 A;  7ICN A;  4QZG A;  1CUK A;  5ALL A;  2HHQ A;  3QUT A;  2FPK A;  1JN3 A;  4KLH A;  1ECW A;  3K1R B;  1JRP A;  3PR5 B;  1C7Y A;  4PHA A;  3MFI A;  3GV8 B;  4Z6E A;  4J9Q A;  2GOL A;  3PX6 A;  2VJ5 A;  1RXV A;  4YR0 A;  2AGO A;  4I2F A;  1DK3 A;  4C8O A;  1NKE A;  3PW0 A;  2G06 A;  2NYV A;  4XA5 A;  1KQQ A;  1MSW D;  3I1Y A;  2HOQ A;  4QZB A;  1IM4 A;  3IN5 A;  3LK9 A;  3LVW A;  1TK5 A;  4I2E A;  1JUD A;  5KFK A;  3HKZ F;  4EBD A;  4OCZ A;  4F5R A;  1SL2 A;  1A6S A;  4DOB A;  4DO9 A;  1V38 A;  2BDP A;  5ALD A;  3GIK A;  3TAN A;  4PH5 A;  7ICU A;  2QB0 A;  4F4X A;  2ZUD A;  3E2E A;  8ICO A;  9ICK A;  4CNQ A;  3NAS A;  4EX7 A;  4O3O A;  3PVX A;  1BPB A;  4QW9 A;  2YQE A;  4MEY A;  2VJ4 A;  4EBC A;  1FEZ A;  5J0P A;  7ICJ A;  4PGY A;  3KFU F;  2F1I A;  8ICQ A;  5JTI A;  1PVQ A;  3V6K A;  1UCV A;  3RR7 A;  5KFV A;  1Z19 A;  2PFO A;  2E8P A;  3M9N B;  1NJX A;  1V9P A;  4YG2 A;  2R8H A;  3SAF A;  4ED3 A;  2ZIX A;  3QZ7 A;  9ICJ A;  4DS5 A;  1D8Y A;  2AU0 A;  4KLU A;  2HBJ A;  3DEE A;  3IRU A;  1ZQY A;  2ZG6 A;  3AN1 A;  3AEV A;  2F1H A;  2OHF A;  5CRX A;  1FFU A;  1ZD5 A;  3ISB A;  5G5H A;  2Q4T A;  1GO3 F;  1RXW A;  2W8K A;  3QX7 A;  3EYZ A;  1BNP A;  5B5E U;  3I28 A;  2WF8 A;  4US8 A;  1Z1V A;  4GXI A;  2R18 A;  2DPJ A;  2L5Y A;  3I76 A;  1TKD A;  2EAO A;  4G3I A;  2K4E A;  1TV9 A;  1ZQE A;  5KFX A;  3FYH A;  4PHE A;  5DQH A;  2QB0 B;  4QZC A;  5KNI A;  2XC9 A;  1SV4 A;  5J0U A;  5J2I A;  2E8N A;  1OXJ A;  2F8K A;  4UBC A;  2ISP A;  2HHX A;  3N97 B;  3IM1 A;  2WB1 C;  5AKY A;  3L5K A;  7ICE A;  4QIW C;  3RRG A;  2NO5 A;  5HP4 A;  1P7D A;  1RPL A;  1BNO A;  3PW7 A;  2D3D A;  1ZD2 P;  1ZQM A;  4OO1 J;  2JR5 A;  9ICE A;  3QUC A;  8ICU A;  4RQ1 A;  5TZV A;  4GLX A;  7ICS A;  3PMN A;  2QAR B;  3C5G A;  1UT8 A;  2LYA A;  1Z4N A;  2UVW A;  4RQ8 A;  2ZIV A;  4NLK A;  3FDS A;  4EYI B;  3ETL A;  1S0N A;  3M7D A;  5KFI A;  3C29 A;  4Z6C A;  2WAQ F;  4AYB F;  2BCR A;  3A0B U;  4LZD A;  3MGH A;  3TQ1 A;  4PHP A;  2G5I B;  1RQN A;  3GV5 B;  5J29 A;  1S9F A;  1N61 A;  4DFD A;  1N56 A;  4ED1 A;  4EZ6 A;  4FFD A;  4ECU A;  1QLN A;  4J9N A;  2VAN A;  3RR8 A;  5AI4 A;  4P4O A;  5BPC A;  3GII A;  5J2F A;  3MR6 A;  5DDY A;  3M6Z A;  1FO4 A;  3EPG A;  5J2E A;  5ALJ A;  4J9O A;  2HBM A;  4DSE A;  1UA0 A;  3QEB Z;  2BGW A;  4C8M A;  1FIQ A;  3GFK B;  4DL6 A;  2BCQ A;  3Q8R B; 
#chains in the Genus database with same CATH homology
 2PMZ F;  3F5E A;  3HKZ C;  3LVV A;  2VKQ A;  2G0A A;  3E0F A;  3IP4 B;  3PZP A;  2WB1 C;  3IN5 A;  1XO0 A;  3GU3 A;  3ONN A;  2ZIW B;  3F5A A;  1A0P A;  2OXO A;  3LVW A;  2GH1 A;  2G5H B;  2HBL A;  4QIW C;  2KKP A;  4OJO A;  3H0R B;  3F53 A;  3SAH A;  3HKZ F;  1PVP A;  2LYB A;  2K4H A;  2ZIV B;  3N7S C;  4KMO B;  4BJQ A;  4BX9 C;  4C0Z A;  3F2C A;  1MA7 A;  1P7D A;  2E5S A;  2XID A;  4U7C A;  4CRX A;  3RF9 A;  4BUG A;  2A3V A;  2RP5 A;  4JMU A;  4NV0 A;  1A6S A;  3AQF A;  2HMX A;  2KJ5 A;  3ALR A;  2NV3 A;  5HR7 A;  2JMG A;  2ZXI A;  2PMZ C;  4ACO A;  2F2A B;  2KD1 A;  4FZN A;  4GFJ A;  4OO1 J;  2DGZ A;  2RHF A;  2MA1 A;  2RRD A;  2ZXH A;  4PL1 A;  2XIC A;  4OJ5 A;  1KBU A;  1F44 A;  4FZL A;  2LHT A;  1Q3V A;  2DF4 B;  4QNL A;  3C28 A;  2KEY A;  1Q3U A;  4P0P B;  2G08 A;  1IIP A;  2VJ4 A;  2XVT A;  2W7P A;  1ED1 A;  2XI9 A;  3D2S A;  2VIX A;  4OJP A;  1Z1B A;  2YX8 A;  3VCB A;  2LYA A;  1WUD A;  2K8A A;  3KFU F;  4ICA A;  2W7O A;  4O3M A;  3CRX A;  2ZIV A;  1PVQ A;  2K4I A;  4KX3 A;  2HOF A;  2K8C B;  2JHD A;  2KJ8 A;  4WJ3 B;  2YB1 A;  4OJL A;  1Z19 A;  3CP8 A;  1DRG A;  5KL1 B;  2OYY A;  1L6N A;  5T14 A;  4QJF B;  3M7D A;  3NRW A;  3C29 A;  4P0Q B;  3D2Q A;  4NWI A;  2H3Z A;  2ZIU B;  5KL8 B;  3SAG A;  3PSF A;  1NZB A;  1CRX A;  2OM6 A;  2MRL A;  2WAQ F;  3IG8 A;  2Y0S F;  4AYB F;  3PSI A;  4NLB A;  5A0L A;  3OPX A;  2ZIX A;  3SAF A;  1XNS A;  2KHQ A;  2KV2 A;  3N7R C;  2CRX A;  3O0F A;  3KZX A;  2G5I B;  3PST A;  2F8L A;  3GZF A;  3T79 A;  1HEK A;  2HOI A;  2G09 A;  2ZIW A;  2HBJ A;  2KVC A;  3DEE A;  3NUQ A;  2JH1 A;  4OJ6 A;  2E1E A;  3N7P D;  2ZG6 A;  3MGV A;  4P0P A;  2F77 X;  3F2B A;  2CN1 A;  1HIW A;  3LYS A;  3ICX A;  4FZM A;  2KNJ A;  2KIW A;  2D6F C;  2LBO A;  2DQN B;  3H0L B;  3PSP A;  4A8E A;  4KX5 A;  2W04 A;  5CRX A;  2KJ9 A;  2KKV A;  2KOB A;  1YT3 A;  2K8B B;  4FE3 A;  2HBK A;  3M6K A;  2KHV A;  3AQE A;  2YB4 A;  2Q4T A;  2WAQ C;  1ECW A;  2G07 A;  2Y0S C;  3H0M B;  4AYB C;  5C0Y A;  1TAM A;  3SQI A;  1GO3 F;  1URJ A;  4PL2 A;  3AL0 B;  2W03 A;  2F76 X;  2H3I A;  4CGZ A;  2LKY A;  2K89 A;  4U6P A;  2BDU A;  2JGA A;  2GOL A;  2R18 A;  2VJ5 A;  4IC9 A;  4P0Q A;  3M6Z A;  3RFA A;  1ZQ1 C;  2E1F A;  2H3V A;  1OUQ A;  2ZIU A;  2H3F A;  2OH2 A;  2K4E A;  2WB1 F;  1T94 A;  3K1Z A;  5HR6 A;  4QIW F;  1D8B A;  3SMV A;  2KIC A;  2HBM A;  3F2D A;  2G06 A;  2M0N A;  3VC8 A;  1SZH A;  2JH7 A;  1PVR A;  1UPH A;  3L3F X;  4NLC A;  2Z7J A;  2H3Q A;  2N1R A;  2ZIX B;  4CDG A;  2CPR A;  3CYM A;  2HOQ A;  3IG5 A;  3D2N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...