4DCCA

Crystal structure of had family enzyme bt-2542 from bacteroides thetaiotaomicron (target efi-501088)
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
203
structure length
203
Chain Sequence
KGIKNLLIDLGGVLINLDRERCIENFKKIGFQNIEEKFCTHQLDGIFLQQEKGLITPAEFRDGIREMMGKMVSDKQIDAAWNSFLVDIPTYKLDLLLKLREKYVVYLLSNTNDIHWKWVCKNAFPYRTFKVEDYFEKTYLSYEMKMAKPEPEIFKAVTEDAGIDPKETFFIDDSEINCKVAQELGISTYTPKAGEDWSHLFRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative haloacid dehalogenase-like hydrolase
publication title Crystal Structure of protein Bt-2542 from Bacteroides Thetaiotaomicron (Target Efi-501088)
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
total genus 77
structure length 203
sequence length 203
ec nomenclature
pdb deposition date 2012-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 4dccA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4dccA01
5AM0A 3MMZA 1WR8A 2DQSA 3L0BA 1N8NA 5AK4A 3OCUA 5AW3A 4UM5A 3QUBA 2GHTA 3EF1A 3QUQA 3WK9A 2W11A 3L8FA 3OCVA 3WK8A 4OD0A 3PDWA 3R4CA 3NAMA 3A3YA 1RPZA 2B1RA 3UMBA 3QUTA 2FEAA 4AP9A 4YCLA 1RQLA 2OYCA 4KNWA 1CR6A 4I9FA 2CN1A 1X42A 5JJBA 1YMQA 2C8KA 4Y2PA 3DAOA 1QQ6A 3SHQA 5ALMA 2R8ZA 1RRCA 1LTQA 5AICA 1L7PA 5AI9A 1KYTA 2YJ5A 3OCYA 3RFUA 5IT4A 5AW1A 2R8XA 5ALEA 2G0AA 1U7OA 3WGUA 4Y2YA 2HEGA 4JB3A 3WKAA 5AW4A 4Y2QA 5ALHA 3J7TA 4UATA 4EENA 3ZU6A 4BEVA 3A1EA 4YGYA 1Z5UA 3WK7A 3KDPA 3TLMA 3P96A 5AVTA 1L7OA 4DW8A 3AR2A 3ZVNA 3DV9A 5A3QA 4CNQA 5AI4A 2G08A 3EF0A 4UU1A 1TJ4A 3UM9A 3WK5A 4UMEA 4CE6A 2EATA 4EX7A 4JDPA 3OPXA 1Z5GA 2IOFA 2AGVA 2AMYA 3ZX4A 4KX5A 4C4RA 3WKCA 3ZWDA 5AW9A 5AI8A 2ZOSA 3R09A 4BNDA 2G1AA 4MUMA 4H1WA 3HYCA 2IOHA 1Z4NA 1ZD4A 3AR9A 2ODAA 1LVHA 3E84A 5AKXA 1XP5A 2Q4RA 3KZXA 1WZCA 3QGMA 2FDRA 5AM1A 1VFPA 2Q4TA 4DCCA 5ALYA 3L1VA 1ZRNA 1RKVA 4FE3A 3W5DA 4XQ0A 3AR3A 5AW6A 1RDFA 3I76A 4HGNA 5AVRA 1RLMA 2EAUA 4UAUA 1TJ3A 2P11A 5AK3A 2FPRA 2YJ3A 2YBDA 5AKHA 1YJ5A 2JGAA 3I6BA 3RF6A 1RLTA 2OM6A 3ET5A 5ALLA 4BX2A 3U7FB 4QJBA 3D6JA 5AKEA 5ALGA 2HF7A 2RARA 3ZTWA 3A1CA 2ZBEA 4F71A 1RMYA 2GFHA 2ZXEA 2B8EA 2FUCA 3L8GA 1ZJJA 4KX3A 2YN4A 4OHFA 2HX1A 2WM8A 4RESA 5A3RA 2JAWA 4AS3A 1ZD3A 2BDEA 3R9KA 1ZD5A 4RETA 1L8OA 5IT0A 2HO4A 2R8YA 5ALTA 1J8DA 2G07A 4YCMA 1L7MA 1WPGA 3K1ZA 3NUQA 4UASA 4Y2VA 4HGQA 1SWVA 1NNLA 5AVUA 2D2VA 5ALIA 4FYPA 3SMVA 4G63A 3MC1A 2WF5A 3KC2A 2YMQA 1L7NA 2WF8A 3E58A 3QU4A 3ESRA 3NASA 5ALNA 1TJ5A 3A1DA 1U2TA 2YJ4A 5AK5A 5AKKA 3B8EA 4KYTA 3QU7A 4UMFA 1Z4LA 5AIBA 3QU9A 1MH9A 3VAYA 3CNHA 1NRWA 3N1UA 3ZI4A 2HF2A 4NABA 1QQ5A 2YY6A 5AKGA 5AW8A 4Y2RA 3ZW7A 4L6CA 3KD3A 5AKIA 2YMMA 5AVSA 1RKQA 1Z4QA 4HAIA 5ALZA 3PCTA 3N07A 3QXGA 3SKYA 3U26A 2PQ0A 2P27A 5AVVA 2P69A 3WKBA 1T9ZA 5AW7A 2JAUA 3S6JA 2WF6A 3KOOA 2YJ6A 3N28A 1Z4JA 2FPSA 3U7EB 3QX7A 1Q92A 3AR4A 2B0CA 2C88A 4DFDA 4UU0A 4B6JA 5ALSA 2IOFK 3ZVLA 4EZEA 1T5TA 3FZQA 4YH1A 3UMGA 4XOUA 3BA6A 2PR7A 4NAVA 5ALVA 3L8HA 2OA0A 4Y2XA 2P9JA 3ESQA 4CF5A 3U7HB 4DWOA 4XE5A 3SD7A 4NV0A 2AH5A 3FVVA 1Z4MA 3GYGA 3E81A 2FPUA 3MPOA 5AW2A 1U7PA 5AW0A 2MU2A 4E88A 4IG4A 2ZBGA 1SU4A 5AVXA 1RMTA 1RMQA 3F9RA 4NFLA 3L1UA 4BEWA 2G09A 2FPWA 3B9BA 4ZEVA 5AM5A 5AW5A 5ALWA 2CFTA 1IWOA 1JUDA 2FPXA 2GO7A 4UW9A 5E0OA 5AKLA 2I34A 1ZRMA 1RQNA 2CFSA 2I33A 1FEZA 5AK6A 1S2OA 3N5KA 2G06A 3CZ4A 3UMCA 1EK1A 3FPSA 3MN1A 4GXTA 3QYPA 1ZD2P 1VJ5A 1S8OA 3U7GA 2G80A 2JARA 5T41A 2OBBA 4G9BA 3W5AA 1XVIA 3SF0A 4Y2UA 3U13A 2HCFA 3WK6A 1YS9A 3L7YA 3AR8A 4BX0A 3OCXA 4NWIA 2NYVA 2YFYA 5ALFA 4MWOA 3QUCA 2QLTA 2NO5A 1EK2A 5AESA 4Y2JA 2C4NA 3FM9A 3IB6A 4UARA 2ZBFA 4BYGA 3ZUPA 1Z4PX 1Q91A 4GIBA 3EWIA 4I9GA 4UMVA 2WHEA 4ZEXA 5AM3A 2YMLA 5AHXA 4F72A 2HSZA 3ZVMA 2RBKA 2VKQA 2AUTA 2C9MA 4UAVA 4L57A 2I7DA 2O2XA 5ALUA 2HI0A 5FP0A 4IFTA 3WGVA 1QYIA 4OFZA 1Z4OA 1ZS9A 2MU1A 3W5BA 1L8LA 4XPZA 2GMWA 3AR7A 3NRJA 5AI5A 2ZG6A 2HDOA 4HYTA 3L5KA 1AQ6A 3WKEA 2W43A 3QU2A 5AIAA 2PKEA 1U02A 2I55A 4UM7A 4AS2A 2IYEA 2I54A 1Y8AA 1Z4IA 4YIKA 3OCWA 3ZWKA 4BNDB 4EEKA 3ED5A 5ALJA 1N9KA 3OCZA 4UMDA 3L8EA 4OCZA 5A3SA 1O08A 5IS2A 5AVWA 1VJRA 3FGOA 3ZX5A 1RC8A 5AKJA 2MSNA 3WKDA 3M1YA 2WFAA 2JAOA 2FI1A 4FFDA 2B1QA 2I6XA 2EARA 2Q5EA 4HGOA 2HHLA 5AVQA 1YV9A 3EPRA 3NIWA 2BDUA 3ONNA 3U19A 1QQ7A 1XPJA 2QYHA 3I1YA 3QLEA 2B82A 3AR5A 2IA5A 4ZEWA 1ZOLA 4O8CA 1TE2A 1K1EA 3IRUA 5AKZA 5ALKA 1WVIA 1RKUA 4L6AA 4HGPA 4YCNA 3IJ5A 1RLOA 2ZBDA 3NANA 1J97A 3OTQA 5AI0A 1F5SA 3DDHA 4HGRA 4C4TA 4BKMA 2HOQA 2YMPA 3PGLA 1Z88A 2FUEA 2O9JA 3NALA 1L6RA 4CF4A 3KBBA 4EELA 1PW5A 3AR6A 4QQFA 5AM2A 2C8LA 2CFRA 2R8EA 1NF2A 3QNMA 2B30A 4C4SA 5AVYA 5AI6A 5AVZA 2W4MA 1SWWA 2NO4A 3HLTA 3SLRA 3BWVA 3N8GA 4Y2SA 3W5CA 5ALDA 1T5SA 2GHQA 4J2TA 2RB5A 2B8JA 5ALOA 2RAVA 3E8MA 5ALRA 2WF7A 1YNSA 4BBJA 4PNHA 3ET4A 2BY4A 4BX3A 2WF9A 1U2SA 1Z4KA 1O03A 3M9LA 4J03A 3PGVA 4KNVA 3I28A 4Y2TA 3DNPA 5AKYA 1TA0A 3FPBA 3B9RA 4EX6A 1QH9A 3WK4A 4YIHA 3L0YA 4CF3A 3ZTYA 3QU5A 5ALQA 5ALPA 5AM4A 1CQZA 4KN8A 2X4DA 5ALXA 4Y3UA 3L0CA 3SKXA 1YDFA
chains in the Genus database with same CATH superfamily
4CV1A 2QTVB 4ZD6A 3L0BA 1LVGA 2XJ9A 2X86A 3D6VA 2AUMA 3KKQA 3EFEA 3TOZA 5KOIA 3QELB 2D8MA 4OD0A 2BCQA 3K0AA 4RDCA 4C0LA 3VVBA 2IE8A 5DI9A 4AP9A 3QKTA 3R7LA 5JNVA 1O3YA 1M2OB 2AC4A 2OCYC 2N1MA 4DBLC 5T57A 2JFZA 1QAQA 4ENVA 4C07A 1G4UR 2GRJA 2JZBB 4X94A 3KQTA 4QRDA 1SUAA 1DIAA 2XWJI 5BYBA 2R2AA 3H99A 3E9DA 5AUPB 3WBKA 3BEDA 1XMQB 3OTIA 3WIVA 4OK6A 1DARA 1FRFS 1CQJB 2PU5A 5JANA 4K8OA 4XYBA 1E1DA 3VC1A 1FPQA 3GZNB 3IAXA 1T2DA 5IZ4A 5C1PA 3AVXA 3L02A 4P38A 2FX2A 1DEAA 2FHPA 2BPCA 3M81A 3WGMA 3TNDA 1NUUA 5AK3A 1JSLA 5IAOA 3IL2A 2JRCA 3MS7A 5K3EA 4HDKB 1JDZA 1XZKA 3OEED 3QWAA 4I1OA 1TYCA 5D6OA 1T4CA 3E9EA 2XIJA 4C9BA 3C5EA 2GJ8A 2ZLBA 3IEVA 3I2IA 2IUTA 1RE0A 1CZNA 4Q9NA 3ETDA 1FS5A 2E1RA 1JRLA 5ITZB 4J4HA 1E62A 1RRPA 4P5EA 5CFNA 4P0QB 5ICMA 3DVRX 2GH1A 2AW3A 4A6PA 3R8CA 3I37X 3CU5A 3GAZA 3KD3A 4RZXA 5KQRA 4Z4IA 4RK6A 3CXUA 4D26A 4B47A 1JG7A 2PRJA 3IDWA 3DF7A 3KJIA 4CN9A 1QQTA 7ICHA 1MNQA 1JFFA 2QMQA 3NTOA 2WMNB 3ZQ4A 3PX2A 4BP1A 1P1JA 3SJUA 4P2BA 3G6KA 5IKEA 2ODGA 4JA0A 1OIVA 2VQSA 1X7XA 4W9NC 4O1MA 5LYJA 2KD1A 2VZ9A 3V4ZA 2ZBGA 1CZKA 4CETA 4MQ4A 3UTCA 4Z3KA 4F96A 1KY5A 5DO9A 4L4SA 1UP7A 2ZW9A 3B0XA 4DQQA 2H48A 4Y0NA 1DBIA 3FH0A 2GCGA 4JASB 1OSNA 2CXRA 4QWMA 4ZYLA 4R40A 3WLKX 4WK2B 1TK9A 4EEZA 3C39A 4IJ6A 1M6NA 4L8LA 1JTFA 5J0YA 5JNUA 1S01A 3KQHA 1S8NA 1GNRA 2NQ2C 2HSZA 4XWKA 4AW9A 3V7WA 3FHOA 3AZPA 2I8AA 1X40A 3PWZA 4LG1A 4A10A 4HSGA 4O6VA 5EJFA 5J0UA 3C3WA 3E27A 3AOEC 3OCWA 4MQFA 2RGNC 1Z7BA 3KR0A 4F5RA 2Q5IA 2H8GA 1WXHA 3NBAA 1DFIA 1U3TA 1VJRA 3PNKA 2LGJA 3C21A 1ZN2A 3Q3CA 2Y0SC 4QQRA 2WFAA 3PX6A 4B9AA 1EK5A 2FI1A 1V16A 1R1DA 1X1EA 1SZPA 1IDOA 3F4LA 3WYNA 4X85A 2G9VA 3VDRA 1ENZA 1V26A 1M0WA 4CLHA 5IJXA 2HY7A 4YUXA 1U6IA 2IYUA 1Y6QA 2VLIA 2FZKA 5K8TA 4RZ2A 3ELWA 3EIFA 1K7XB 1Z6XA 4K4GA 5GJVC 1ZQBA 3SOPA 3REFA 4H35A 1HYGA 2ZPTX 1DPFA 2LTAA 3WIDA 1OH8A 5CHYA 2Y2VA 2BTEA 2FZCA 3QVVA 2WTAA 5LQMA 4IL5A 3U0BA 2PGAA 4OH7A 5DRTA 1XTJA 6GPBA 2V7UA 1D6SA 3SJAA 1AGXA 1ZW6A 3LL7A 4W8GA 1P2SA 5JHGB 2WIKA 1I4LD 4Y2TA 3RLIA 4KUEA 1I4WA 5BT9A 4YRNA 4JL8A 2IEGA 3KKOA 3OEHA 3INRA 5J0SA 1QTNA 2W3SA 4LA4A 3SM9A 2P5UA 1M6WA 3W7VA 1SM4A 2EKPA 4I6EA 1W2HA 1GRRA 2FTKE 4WCFB 1XRQA 2X0EA 2B1RA 4OO1J 4YCLA 4NU0A 3D4OA 1HYEA 5JJBA 4DDKA 4L51A 4TMTA 2OCAA 1N61A 1IZ0A 2X0JA 1ECCA 1X77A 3ELBA 3IOCA 1UOEA 4DREA 4E5SA 1SV4A 2VSYA 5H1YA 3BE8A 2IL1A 3X1MA 3ORSA 4YJ3F 2O8CA 1G21E 2Q6VA 2OK8A 4C01A 2BEJA 2ONKA 1RRKA 3DB1A 2LW7A 2VSQA 5L1IA 3UM9A 4B71A 4JWNA 2I6SA 3K8QA 3K9NA 5TY0A 1U7TA 1NUPA 1NN0A 1VGRA 4RH3A 4DQXA 4DIMA 1BX0A 1GPMA 4LZGA 1O8BA 5LUAA 1KJIA 3P5BA 3PY8A 1QZ3A 4EJFA 3GQVA 1BWSA 2WB1F 1Y4SA 1KKLA 2JK1A 2PM8A 2VF8A 9ICBA 1BWQA 3HV2A 5FUWA 1GTMA 5TGTA 3E9YA 1JZQA 3LVFO 4DBZA 1G5RA 5AXAA 4TRNA 4M1QA 1JSRA 1EGMB 2FMKA 4TUPA 4KLZA 8ICVA 4BVEA 2YY7A 3KTOA 5BN4A 3MINA 4BV2A 3KQQA 4DSOA 1MB9A 4FFPA 1O9HA 2IH4A 4WOKA 4QRHA 3K70B 1Z0ZA 2QMHA 5GY7A 4M8SA 3WLJA 1UBHS 3DXZA 4BV3A 3RASA 3EDOA 2XT6A 2BTOA 4J91A 2O8CB 4AMZA 2J5XA 1VBNA 5ICCA 1YVDA 3A4MA 2FSPA 2FPIB 3OETA 2RHOA 1XWIA 1NUHA 4RQUA 1SU6A 1BPZA 4GM0A 3QKSA 2HJVA 4K05A 4C3OB 3T3GA 1Z3CA 1IH8A 1CW2B 2BM8A 3EA0A 3FZYA 1T9ZA 2R66A 1FSFA 5HGXA 5J2JA 2C88A 5EP1A 2IPOA 4N9WA 1UCFA 3UUEA 5TQJA 1RZRA 1ZK3A 4YP3A 2FWPA 4B84A 2FA9A 3HO1A 1TVMA 3WGGA 3KOMA 4XWAA 2CDAA 1TKCA 1Z35A 4B7AA 4OHUA 1L5ZA 2PWBA 4FOLA 4BEWA 2ZJ4A 5BSGA 1Z3IX 3V4SA 1LK5A 1GD1O 1Y3FE 4DCMA 3HUFA 1RQNA 1S97A 3EY4A 1IN8A 4Z7JA 5CFMA 3JASB 3MOGA 2VUHB 4HMOA 1HLDA 2WJVA 1D7AA 3ZDDA 2QG6A 2DY0A 3R0ZA 1LSSA 2YRFA 2M0NA 1J24A 3FVWA 4XJVA 3W8FA 5DGXA 2WINI 5JBNA 1CUVA 4WD3A 2PUTA 3LC1O 3QRWA 2ZEJA 2X7JA 2V7PA 1EWRA 3PGXA 4YA6A 1MEOA 1V2GA 1PRYA 4EKEA 3PC4A 1BCSA 1USUA 2ZSKA 3RSHA 4CKWA 1P75A 3K8OE 2J1LA 4Q1CA 5DCWA 4PHFA 3KE8A 4PYKA 3WQQA 3ISDA 2ZKLA 3MR6A 3F5EA 2JLXA 3KSDO 2WICA 1THZA 3LO5A 3NCTA 3TJMA 2BRUA 1EK0A 1BHJA 3SQDA 5EGNA 3TRJA 3K4HA 4JYCA 3DZFA 3L7NA 4J75A 2HMUA 2ZIXA 2ENUA 3FCXA 3UOGA 3ZW8A 4CDMA 4AMBA 4TMFA 4ZI2A 4UUAA 2HTEA 1ADCA 1XQ6A 5AKZA 3HA3A 3LYUA 1L5NA 2C4WA 5J2EA 3A4LA 1J97A 5JMPA 3ZWAA 3TADA 3LF2A 3HFJA 3V6HA 1PTKA 2RGYA 3IP9A 2W2TA 1OT3A 3TZBA 2R96A 5JMTA 5JYCA 4NDAA 4A26A 2QY9A 4PX9A 3JWHA 5HZGA 4WZ6A 2PJZA 4LQLA 4JI1B 1A3CA 1PVPA 1T24A 1XRPA 4BFSA 521PA 5KWJA 2PNFA 1DT5A 1R8JA 2PUVA 9ICUA 4D3YA 4Z6KA 3EDQA 2VWGA 3D59A 2ZIXB 4O2BB 3DUWA 2DMRA 4X1YB 4WNAA 2X14A 5T8KC 1XCMA 3DCYA 1Y6JA 1X9WA 3BMXA 3BQTA 4YPFA 1YMUA 1B26A 3LW8A 3WGQA 2BBTA 4LVCA 3VPSA 1DWQA 3PHBE 2C8KA 5JD4A 1XZLA 4FOOA 4YV0A 1HFEL 2NZJA 1MJNA 4UPDA 5AW1A 2ID4A 1K68A 4RSHA 3VVCA 1WWKA 1V4NA 3TR0A 4S1PA 2QN1A 3LT5A 4RZHA 2HIAA 2PZEA 3VYWA 1TJYA 4M7OA 1E1QD 2NO6A 1L7OA 3QI7A 3M4XA 2WAAA 4DGQA 3NIBA 4EAAA 4YDSA 3QV2A 4JLOA 2RIRA 4PRZA 2SKDA 3U3DA 4EATA 3OE7D 3NYQA 1Z19A 4KN9S 1E3JA 3NUZA 2HREA 3RAJA 2HLNA 2RDMA 5IZCA 2X15A 3CJTA 3LUDA 3ISJA 4EL5A 1DTSA 4E94A 3RT7A 2HRDA 2BFNA 4ZI7A 2CFIA 2PLAA 4OJNA 1CJTC 1XDSA 4NCBA 1ZA1A 1WM1A 2RARA 4GLXA 3ID6C 1QYRA 2D54A 2XY5A 4Z86A 1MAHA 1HDXA 2JGDB 3OZDA 1KL7A 3RUAA 2OHHA 3EMDA 3D5TA 3DBRA 4YK7A 3VX3A 4FYMA 2NQTA 4Y9RA 3SDSA 4EUHA 1JQEA 1A4UA 3UJ8A 1DXYA 2ISPA 2FSSA 3UXEA 2JANA 2X8LA 1NMQA 4IRKA 4XQCA 4JH0A 3DO6A 3CH5A 3NO4A 1OILA 4DIEA 3QKRA 1CF2O 8ICQA 1VECA 1WCNA 3PF8A 4LHWA 1U2DA 1G7CA 1C3VA 2OHOA 5AMXA 5EHIA 1JXEA 1W1IA 5AVSA 5I7VA 3DE0X 1PJBA 3H13A 3PGA1 2MYUA 1BMDA 1U1EA 1L1QA 2LRHA 1E3IA 2RKWA 1D2EA 1YR7A 3OX4A 4HAVA 3QE2A 3Q5GA 4Y1GA 5A6SB 1C8BA 2ST1A 1X1SA 2P6PA 3C1UA 2BUBA 3M3DA 4QGBA 4Y1RA 4FS1A 2AFHB 2H7VA 4N40A 3O31A 4OOEA 4GR4A 4RPXA 1ZK2A 3R0QA 4ZDWA 3IUPA 2JHFA 2BFFA 2UVRA 3ZE2B 1USGA 3T3MB 4PIMA 2FE9A 2NSLA 1C7YA 3G6XA 4BKUA 5C8ZA 1F4LA 3AU6A 3AWIA 5TQ2B 3C4VA 3EXAA 2FQQA 3SM3A 1O0BA 3RSCA 1LJLA 1DIGA 2FP3A 3D3WA 3TQHA 1JR6A 2JGLA 2BEUA 5LIRA 5THQA 1BFDA 4F72A 1ENYA 4FDAA 1A9YA 3LDAA 3Q9NA 3THRA 1HZZA 5BYKA 1TZKA 1MQSA 2HRZA 1I1HA 3C2QA 2QPOA 1KAOA 4UVHA 3DWIA 5KTKA 3UEOA 1RJDA 1P8JA 4C4XA 4RA9B 2CD7A 3G02A 3L7KA 2C4VA 2H57A 5C1BA 2ZE7A 2G77B 5CJ7A 2NGRA 3PW5A 2BFEA 3IVAA 2GZDA 2BFFB 4H1HA 3CLRC 3EZ7A 3IR6A 2FDCA 3DBLA 1T26A 4PICA 5KQLA 5F5LA 5LZ4A 4RTOA 4IQVA 5TZVA 3R9WA 2GD1O 4DL2A 1T3NA 1Z7EA 3AH8A 3NANA 3ZHBA 2ZTMA 4Q47A 2A0WA 3TFWA 3H8WA 1ZSYA 1RTKA 4N01A 4ARCA 2AE2A 2GN8A 4QQFA 4LOJA 1Q6YA 1R9JA 3NVMB 3R0IA 3H6HA 4K5QA 1S2GA 1OXSC 3QNMA 5K2OA 3HLTA 1QCKA 2QIOA 5JYBA 4ED8A 2XXJA 1T1GA 1WTAA 2DGDA 4MRRA 5LBUA 3DDZX 1PWYE 2OENG 4Y7CA 5FNVA 1CUSA 5E2BA 1LS6A 3H2JA 1DK2A 4DNQA 3AKYA 4X1IA 3H8MA 4Z0TA 2AZXA 4YAEA 3W9SA 1AKVA 3EF1A 1P2VA 3HBAA 1FTGA 1NVVR 4E09A 2FWIA 1TTQB 2A94A 5GQSA 2O8EA 2HGSA 1HSZA 5EQFA 4EYHB 1QGAA 4RV5A 5FWDA 3T5PA 1YR2A 3UAVA 2ETVA 2Q6IA 4X8HA 5IX8A 2XZLA 1QF6A 3ESCA 1M7GA 3KZOA 1CQWA 4OA5A 1MR3F 1Z0FA 1OYYA 3DT6A 3I52A 2H3HA 4EENA 3A1EA 5MFZA 1G291 2I03A 1U0FA 1Z56C 3RFVA 1P18A 2H4HA 2H1HA 1N33B 3OPYI 4Q24A 4BNLA 3GFPA 3EVGA 1XR3A 1V8DA 1K2VN 2ZP1A 1MV8A 5A71A 2ZOSA 1NURA 2R1TA 3KJNA 1Z5PA 3STVA 1K9SA 2ORYA 4B8WA 4JBIA 4IHJB 1PK7A 2LDBA 4DV2B 1M2NA 3U6BA 2Q4BA 3O3MB 1EGQA 2P11A 2PWYA 4F4YA 4LJ9A 2B1GA 4TKVA 4ZOLF 3OQNA 4X5OA 5T4FA 2XUJA 4EUNA 5CB4A 2K87A 3RG2A 3M8KA 4M2LA 1ZQEA 1KGSA 2CXSA 2FPLA 2Q5JA 1U7UA 5E2AA 3QVGB 2A3VA 3I53A 3UXMA 3GGJA 3Q8KA 5JXIA 2D3TA 3NBUA 5CG1A 4YQWA 3A1TA 4UHCA 4JP5A 2XCAA 1YTLA 3O3CA 5KG5A 4ZYUA 2J59A 4M0DA 5JT1A 3BRWA 2WSSA 1TQ6A 1TIPA 1XNQB 1XJ0A 3KVNA 2XGGA 3WQBA 4ZTZB 3ES9A 1TM1E 4GAEA 3B1JA 4YAIA 3TTWA 2X9QA 1Y7HA 3HDHA 2GEUA 3MAJA 2B94A 2RE8A 3H5NA 1DO2A 3JQBA 1ZOSA 1OLOA 4ECZA 2G7ZA 3B1VA 4H3HB 5DKWA 3E61A 1FW8A 2FY8A 1SEVA 1L4GA 3GJ0A 3TPFA 3PTZA 3V4FA 2CFTA 5G2OA 3B60A 2KB0A 2M6RA 1ZITA 1T9KA 2ZTSA 1HT0A 3R24A 5K9ZA 1PK3A 5DULA 1SXIA 8ICRA 1FE8A 3DCIA 3MYRA 4BDTA 3IMKA 2A0FA 3HZHA 3VU3A 3U13A 3T4EA 3UH1A 5IZCC 3KU4A 3L6UA 4HUQA 4MITA 3N9IA 3OZ7A 5IANA 4HRXA 4C0QC 1QHFA 2ASVA 3TSWA 1HG1A 4ZCSA 1R64A 2A9FA 5KDDA 2YWFA 1QYIA 3FWPA 4BNMA 4I2EA 3OEHD 2R6JA 3R1IA 2NUTB 4NZ9A 4DL4A 2EHDA 2B20A 2XNDA 3EZ6A 1QPGA 2HBZA 4DXDA 3STXA 2X7HA 2ONYA 4BNJA 1UWKA 3FGNA 4ES6A 2R7MA 4W9RA 2A0UA 1E4EB 5F64A 4C76A 4EHIA 3IUBA 2G04A 1R0BA 4I50B 3JQAA 4XEHA 2JEFA 3CT6A 1U2DC 4WLEA 5JAPA 4ACAA 1JEJA 3WYBA 3I5UA 4RHCA 3ZU3A 1YR1A 4AI6A 2Q3CA 1N2JA 1RHUA 3GDHA 3W9UA 4LOAA 3IXLA 1DC6A 4GDFA 3PC6A 1D4OA 4BKMA 2ASEA 2W93A 1E6CA 2OEPA 2CF5A 1WCWA 2R5WA 4DMFA 1N34B 2BFCB 1H2BA 5A0VA 2IBKA 2YH2A 4C29A 4NBTA 4JQSA 3WSWA 3T5GA 1TMKA 3RI3A 2HPVA 4H7DA 3TI0A 3PSTA 5ALOA 1SRQA 3LQQA 3VHXB 1KERA 3TARA 2YJNA 2RIPA 1Z4KA 1VHWA 1BU5A 2WMOB 3W9YA 3WLHA 4L4RA 2ZETA 3OLXA 1N32B 5CDGA 5LA6F 4YONB 1GPYA 1T9GR 3C5VA 3DXYA 2RRDA 1JT2A 3G49A 1S3GA 5CUQA 5DM0A 5B4UA 3COVA 4MVJI 3UB3A 4LDJA 4L15A 1DKUA 4IR9A 1Z6PA 1O77A 2IITA 1ZOOA 4EF5A 2W55A 3GLFA 1BE1A 4GI1A 4R9NA 5F52A 4NY8A 4O0IA 1WHSB 4XM2A 3OC0A 1RRCA 5BWMA 3CLRD 4CF6A 2X9NA 4EMSA 1DQRA 3GDFA 4O29A 3CRMA 1DMSA 5EZYF 5EPUA 1H22A 2G83A 2EJUA 3IO3A 4CKCA 2QL6A 2HL6A 4N6GA 4BUZA 1HTTA 5ANRB 3P9CA 2RK6A 2D0OB 3P45A 4G5YA 3VAAA 1DLIA 1O97C 3T5AA 4J7CA 3ABZA 3ANLA 1OIXA 4NBKA 5JSFA 3DOJA 2NO1A 3AUXA 1RZRD 1GUBA 4QZDA 3LKBA 3C45A 4I4IA 4FOSA 2JGNA 3ODPA 4G1VA 1L3TA 5C35A 1T7PA 2OG2A 1FNCA 2H3IA 5CB0A 3S2YA 1RZ3A 4DEZA 4ZHQB 2IYLD 2YYYA 5EWJB 4BKQA 3V7KA 4P5PA 2VPQA 4LFBB 3HC7A 3T1VA 3WQRA 1CJBA 3JPPA 4HNUA 3L9WA 4CMEC 3HR8A 2Q5QA 2RAPA 2OVBA 4KE7A 4KMOA 4OQZA 2F59A 5CMLA 4FK8A 4QFBA 4BQSA 5CTAA 4QT4A 3PD0A 1OY1A 2G07A 4ZO4A 4RABA 2JD0A 4MCAA 3WMXA 2O52A 4IO0A 1DHTA 4P82A 3NASA 1RVDA 1KFSA 3L7AA 4JLSA 5BPHA 3KZCA 2YY6A 3RUCA 5K09A 4JU9A 1X38A 2IV3A 4NJEA 3WO1A 1CUGA 1RKQA 4RKRA 4DLRA 3CGGA 3JZFA 3HR7A 2C22A 1P4RA 1SCIA 3NVVA 1RM3A 3NNDA 4QODA 2W2KB 3RFTA 3TD2A 4LQDA 2IC5A 3O1HB 3B85A 4TYYA 4D9HA 3CXRA 1Y63A 2DERA 4ZVMA 3WLIA 3KFXA 2MYNA 3SFVA 3CWZA 2UYQA 3PW4A 4DMKA 4YAUA 4TV9B 1J4AA 4KR0A 3BF7A 3SXUA 2PX6A 4EI7A 5KYWA 2QD1A 5T4HA 1CU1A 1DELA 1Q7BA 2QAGA 2ZR8A 4U7JA 5IP5A 2CFSA 4GWLA 4WLNA 1FFEA 3NS1A 2PL1A 3EIXA 3ZZTA 1ICEA 1M54A 1MLDA 2QX4A 4GM1A 8ICLA 3BDAA 1DJMA 4R2XA 5D7NA 4PG7A 3CF6R 4OGFA 1L4MA 4YAJA 5CFZA 1JEOA 4OHPA 5K0ZA 1Z6YA 2PMCA 2HNAA 4AQ7A 4KLAA 3TLBA 2EYUA 4KQKA 4JZYA 2Y0BA 1CNEA 5SYNA 4L3OA 4LEIA 4J9KA 2OPBA 5LD2C 3W5BA 1VLVA 4MQ5A 3VBCA 3NNSA 4Q7QA 2EXXA 3I2YX 2YS6A 2PKEA 1TM2A 4MEXA 2XB8A 2DWPA 3EPHA 3U9LA 3N70A 3TNJA 2R3SA 3DBHB 4KBGA 3R3ZA 3WYDA 5I7HA 1TNDA 2IXDA 4OCZA 4MLCA 3ANMA 3C8MA 1GA1A 3GJ7A 2QB0B 4KGXA 1I2AA 4ARZB 1QUFA 3EEFA 2DKOA 3BDIA 5K4LA 3SC2B 1WY5A 3UXHA 2I2DA 4F0JA 4YCXA 2H4ZA 4PZYA 3TRHA 5DNUA 1NOIA 2F1RA 2XX3A 2HQBA 5EUBA 4BN5A 3NHRA 2CCJA 2KJQA 4G65A 4WBNA 4WESA 3N2EA 3D3JA 2K4MA 1BHQ1 3VO8A 3JQBC 2HOQA 1KYYA 1EVQA 1ZRSA 5KFRA 1Z25A 4BAGA 1PT7A 1DOZA 2DX7A 4IRCA 1KI9A 2SCUB 4FMDF 2Q4EA 2LYHA 3GUYA 4MYHA 1U1DA 2RAVA 2XT0A 5B5EU 4DZZA 4P0PA 4EG6A 2RH4A 3Q8XB 4Y6QA 5FL7A 3IT2A 2J5RA 4LDAA 3AKDA 1NYQA 1U8ZA 4JR2A 5JAZA 2ZULA 5DYWA 3SENA 1SURA 2A59A 3ZHUA 1OOEA 3ZGYA 1XXHA 1JFRA 4MYRA 2VATA 3EGEA 4LUCA 3KXPA 1F1JA 2YRWA 3R7WA 3V8MA 2Y0EA 1WMFA 2J9FA 1QP4A 2HK9A 1QO9A 4LC1A 1W581 3EJ6A 1I6LA 1EGAA 2VPYA 2JLSA 4QBGB 1Z16A 3K1AA 4DHWA 4FYKA 1JN3A 5DGTA 5AR1A 1T6YA 2QRJA 4MV8A 3LZ6A 3TIXB 3IODA 2PBZA 3ENZA 2WFMA 2XZOA 2XY7A 3UN1A 3BA1A 2XUPA 2Z0MA 1J8YF 1EJ6A 1BU8A 2FG6C 1VRCA 4BX9A 1GVHA 4PZDA 1LQUA 2IUUA 2CB0A 3VJMA 5C37A 3K2IA 3EIEA 1Q12A 3L7IA 1I9GA 2D2FA 1JT9A 1T8TA 2YJ3A 1GYQA 1E1NA 3CM0A 4BE7B 1VSUA 4RENA 1I14A 1U7ZA 5FWYB 4GBJA 1X1RA 5HX7A 5JU5A 4HNRA 1NT2A 4FZMA 3UHPA 2YRXA 4EB0A 5GM2A 4AX4A 2MR6A 9ICPA 1JDBB 4KQ9A 2O8DB 1E6EA 1R15A 2Q9BA 5B5SA 5KYUB 1XQYA 5KFUA 1PGJA 2BTQA 2Q27A 1ZQQA 1VC2A 3PPVA 1FFBA 4OFWA 2HV9A 1TK8A 1V9PA 1CUJA 5IBCA 5FLEX 1FFWA 4RMHA 5AKGA 2XUFA 4AUMA 2YXPX 1EESA 1CULC 3G0HA 4EHAA 4FMCF 2EZTA 5CNIA 4O3MA 1KO8A 4MS1B 1UBRS 5J2TF 1NT4A 4OFXA 1SXDA 4ZT6A 1DX9A 1ZGCA 1O97D 1OZAA 5HXAA 4CIXA 1L1FA 2F9MA 1NP3A 1D09A 2C82A 4FKMA 2DEUA 3IPCA 1WV0A 3RS3A 3EXG1 4X84A 2IK8A 3CUYA 4BQNA 1M0SA 2VWPA 3QMWA 4IZOA 3T12A 3TOCA 2RQ5A 4QNRA 4GICA 3R6DA 1O6BA 3S2EA 3UWSA 2HVHA 1GRVA 1ZCBA 4M47A 1JDNA 4U8GA 2C31A 1V9CA 3TJRA 2OCGA 3H5WA 4OQEA 3FKSA 3OZFA 3JQEA 1W49A 3KT0A 1SBQA 4EY6A 2YMLA 3DHVA 2ZR9A 1KY3A 1BDIA 4RQAA 3TXAA 1K6IA 5AJXA 5ES4B 4D8XA 1DRGA 1ESDA 1NW7A 1J0BA 3RVJA 1BKDR 3E82A 2E5WA 3BXFA 3MS4A 5DP2A 5BSHA 5KX5F 4CIVA 1AHHA 3B9JA 5GV8A 4C43A 4S04A 1YGYA 1TVEA 4YRGA 3P9NA 5J2AA 2IYOA 5TF4A 1A5AB 3JPNA 3PL1A 4I14A 4PHEA 4URHA 2KSOB 4ETIA 3RH4A 1IM5A 3G2QA 3IPAA 3B89A 4G5RA 4PX3A 1PG2A 3CX4A 3I1YA 2C57A 1VYVA 2XUOA 1OTXA 3DLTA 1KNQA 2YXLA 3LPAA 5KO2A 2PL5A 5J47A 1ZZGA 5HJEA 1VE3A 2QQ0A 1XBTA 4PGAA 5LM3A 1XELA 1WKCA 3V97A 4HDCA 4BN0A 3VZPA 1OCEA 4YP5A 4LY6A 1Q1ZA 4A0RA 1LFDB 1DKMA 4OSEA 4QUIA 1NC1A 2QTHA 4BBJA 3OOWA 3QW4B 1Q7GA 1HNWB 5LJLA 1QQBA 1LBTA 1WABA 3PGVA 3NXSA 1OV4A 3WGZA 4RQ6A 1XEAA 1D6NA 2W9XA 1W96A 1IQUA 2GJ4A 4OJMX 2Y1WA 3RTCA 2JZCA 1M73E 1FYFA 2W6ZA 1BCRB 4J90A 7ICIA 3DR3A 1MB0A 3WJ2A 2J4FA 1D8AA 1VSBA 4F9EA 2JL1A 3CF2A 3DKIA 3BRWD 4AKIA 1X66A 2WSSD 1G60A 3ER6A 3AG6A 3IEIA 3DYBA 4N48A 3OGUA 3DE2X 2VWQA 4QZIA 1QDUA 1B1AA 2DHQA 3GEHA 3P96A 2NX2A 1BYUA 4AM8A 3H2GA 3DV9A 3JQ6A 2QQFA 1RKBA 1Z5GA 4K0RA 5AHRA 3RUPA 1EE2A 1XA4A 2BN4A 1KAGA 4GBMA 2C3PA 3S1AB 2BCRA 3K4GA 1L9KA 3PZBA 4BGVA 3OO1A 1E3TA 1U3FA 1WF3A 5FHQA 4IH1A 1K0FA 5G0TA 2Z5GA 1XRSB 4IOKA 3T79A 5KFHA 3T95A 4J6FA 2IDMA 4KPFC 4A15A 4XASA 3R9KA 1S4MA 4DA7A 4FFBA 1YQQA 1MOPA 1NQAO 5GONA 4UQOA 5KYKA 1E7QA 5ITVA 5DE3A 3RRFA 1TMGE 1K6JA 2A1UA 5E4JA 1DK3A 4CCAA 2WB4A 1W1UA 1ELOA 2XUIA 4IKPA 4NE7A 3E03A 2C97A 4BUCA 1VP9A 2ONJA 3IPYA 2JHAA 2NRWA 2P27A 4YUZA 5CT9A 5IKOA 2H2HA 5GJWC 3ROPA 1YL6A 3R7NA 1DGJA 1JMKC 3BCRA 3M4YA 1W6RA 2G5PA 4MV7A 4A2WA 3F78A 1J0DA 2QTVA 4DWIA 9ICAA 3IRVA 3JQAD 1PX0A 3VPDA 3ZJTA 1T1IA 4WLUA 5JJLA 4B6EA 1Q3KA 3EPJA 3BGSA 1M2OA 3ML1A 2I33A 4LOIA 2BYTA 5CBPA 3SMQA 1G8JA 5D87A 4FYIA 3HCPA 4NPCA 2JZBA 4BX9C 1RHQA 2OXRA 1S96A 2AU0A 1SB3C 1SVUA 4RQ8A 5CA0F 1LF5A 2D06A 1YI0A 4L4UA 2A5DA 4PYRA 2HXSA 1CQJA 4KXUA 4N3BA 3TE7A 5I9SA 5DM60 2WWRA 3GZNA 1KDYA 3PFIA 4Z7QB 4BDSA 1K6MA 1YZ3A 1J2JA 4TSRA 1KBUA 2B92A 3BJRA 3ZLUA 1K97A 5TIIA 1DCMA 4EB3A 1NMYA 1GPLA 4N18A 3IQFA 3HZZA 1P0MA 2DCMA 4QUDA 1XMSA 4HDKA 2IKQA 1E3MA 2CVOA 2Y1OA 3JSAA 3CPEA 3M2PA 3MGGA 4ON9A 1F2VA 2BBWA 7REQB 4Q44A 5CBPB 4G5SA 3OJLA 1ZQUA 2EQYA 4BTEA 4CLEA 2RI0A 5ITZA 2DPJA 5DBCA 5E6SB 2WM2A 2GLTA 4R1TA 4L0DA 4P0QA 1I51A 1U63A 1GQ2A 3ZZ1A 1OI2A 2X1HA 1CY2A 1YJXA 1EXNA 1XUOA 3NDBB 3IP5A 2KICA 2ADOA 3QYFA 2CFRA 2XE8A 4FZVA 1X1BA 2W4MA 4H7FA 1SXJB 1XZAA 4TRMA 1EM6A 1L5HB 4YI3A 3S1LA 2IXEA 1FMJA 1KZ6A 4QJ5A 1OGYA 5EERA 4ZYZA 5I8WA 4J0IA 5DQGA 3IMFA 3FUUA 4F4ZA 1DC7A 1QG6A 1K63A 1Z18A 2Q8NA 4ZZ0A 4ZVKA 3F8SA 2FOLA 3E7PA 3C3PA 2ZR7A 3DLIA 3B52X 1SMKA 3ISVA 2GBCA 3RJ9A 4AY4A 3SFZA 2XAAA 5JIBA 1C7RA 3MLBA 3B6JA 4REQB 1ZQAA 2Z4SA 3I92A 4NF2A 1E1MA 3PNQA 3RHSA 3ZE0B 1Q7CA 4IXMA 3HVIA 1V5GA 5JNRA 3K5HA 2YIJA 4D5EA 4QELA 3UMFA 3H05A 3OQHA 5LQKA 2ERCA 1EZZA 4IIXA 4QBFA 2VNJA 3B1XA 1JHRA 4BKOA 4GPEA 3ZV7A 1H0KA 4B3GA 3C16C 1XDWA 2D59A 4MV9A 4O9MA 1WCIB 5J5VA 4W1RA 4NK4A 3SP1A 4ND5A 3QFCA 1NKTA 3HYCA 4M55A 5KYXB 1KPIA 1RRFA 2O1SA 2Y8EA 1ZI9A 2PMZC 4X44A 4O59O 2WE7A 2I78A 1F12A 2PSSA 3MWGA 5ECGC 1S1MA 2ADFA 5EI5A 3CZ9A 2VSFA 4LZDA 2XNSA 2X0RA 2F3NA 3MJVA 1NVVQ 4PW0A 4YG2A 3SJBA 2X41A 1L5MA 1WYGA 1XCPA 4YB8A 1V45E 3D4PA 2FSFA 2YWDA 5LP6F 2RHGB 5JV5A 2D2VA 4G1MB 2YOHA 3VCBA 3ZCXA 3KHKA 5C52B 2W2VA 1K5PA 3OJ0A 2DBZA 3NONA 3COJA 3RIGA 3A6LA 2PLNA 3TF5A 2QPLA 4N5LA 3GIKA 1MZPA 3FAKA 2ILVA 4BNKA 2Q2QA 2CNOA 3BXEA 4BO1A 3B51X 2C00A 3WKBA 3UWKA 2QMOA 4D02A 3O8DA 4UU0A 1QU2A 3T34A 2G72A 4BMNA 3HZOA 5AOVA 1A5BB 4BGDA 1P80A 2RAUA 4FEEA 2HGZA 5BXQC 1DAKA 4H18A 4B8ZA 4YDHB 3L0DA 1IMOA 2NU7B 2OZEA 4WCFA 1JB9A 4U7DA 1PVQA 2A92A 2N1BA 2G09A 5B7QA 1JG2A 1O1YA 1B93A 1Y5MA 2PCLA 1E2HA 2GO7A 3ST7A 3FXAA 5KFOA 2Q7XA 4RVFA 2WYOA 1SVNA 3ND7A 3EXEB 1R3UA 2LHTA 1EYZA 3EZYA 4RNNA 1TFUA 4IV0A 4RJ2A 3E9ZA 1CR0A 2WNIA 2OWOA 1MPTA 2V7WA 3D2AA 1N57A 1QGUB 3GA7A 4GWGA 1V8OA 1LGYA 3OP4A 2VXYA 2PFSA 2O6KA 4BJ5A 5DBEX 3TE6A 4NLLA 1F14A 3K72B 3FNGA 1HL7A 1RR6A 2W04A 5FL7D 4FWBA 3WKEA 3O1JC 1HWYA 2QTGA 3LUKA 4AS2A 5HBRA 2IYEA 1SXQA 3PDCA 1RSZA 2PPLA 4RTMA 3H9CA 5IC4A 3AYZB 3OCZA 1TYBE 3K0CA 2QAJA 2GPWA 3HFRA 2HR1A 2VEOA 2CEKA 4WK0B 4BLQA 3HP7A 5CLLA 4KQIA 1ZQGA 3RDPA 4ZT7A 1KOGA 4WH0A 4HLCA 4KFSA 3CNOA 3KZNA 3AONB 1KTIA 4FBMA 1JMSA 2FPIA 4JUFA 3BJIC 5BRAA 5FI5A 5A7HA 4B81A 2I6QA 5AOBA 2PKCA 3DDHA 4EPVA 3SQWA 5CDTA 4PR0A 4M87A 2WJ3A 3BIFA 1RAHA 3IOYA 5FTKA 2QK4A 2HK7A 3GG2A 4C8OA 8ICMA 1G6HA 3G9UA 1TTTA 4TMXA 4QW8A 2FLWA 4Q18A 4OAOA 4R5HA 1JXLA 1FLDA 1YBAA 2IX9A 1H93A 1J9GA 4P1ZA 1T0IA 3PD1A 3KTDA 3Q9UA 2AMVA 1C50A 1SK8A 3B9RA 4PRLA 3KQKA 3BQ2A 4H3KB 3BFKA 1R0ZA 2KJ9A 1Q1QA 4WI1A 3FTNA 3M9MB 4P7JA 3QSYA 2E8PA 4DV1B 3R0XA 2J0VA 2Q1YA 4U9HS 4H7KA 2PD4A 3OY7A 2ZCJA 1FMFA 4EZ6A 2L69A 4AS1A 3T5TA 2HSJA 4D9KA 1NULA 3UZUA 3E5MA 1G8MA 3JASA 4AF7A 1E9BA 4UC0A 4TS4A 5LYYA 4BFYA 1QR2A 1KQOA 2MOKA 5F2OA 2XQVA 1FP4B 1SKQA 3K6SB 1KJJA 3I42A 4JJ4A 1YA4A 5JNLA 3V1UA 3U4GA 1ZWLA 3TKYA 3STTA 1QNFA 4Q4HB 5DPMA 2XI9A 5BORA 3REQB 3AWDA 3UAWA 1U90A 4WIAA 1YZQA 4YRPA 4Q8FA 2VDMB 3KHRA 1DQSA 4BVGA 1K4YA 1UAGA 3FSRA 2I2XB 5FBWB 5JHHB 2Z43A 4XD7D 5A5EA 2RGWA 2N75A 2JA2A 3EZLA 4WK6A 4AULA 1OX5A 3ANSA 3NHLA 1KI7A 1USVA 2XITA 2WJWA 3KSMA 4YMTA 3LXRA 3CRVA 1KL9A 5CK5A 3C1ZA 2KFNA 3CO5A 2BFBB 1YAHA 3OQ1A 1FS4A 3A05A 2PKQP 3FKSD 1WZ2A 5A5VA 4BLPA 3OFJA 1T5LA 1N5KA 3SJZA 1HT3A 2XUGA 4LF4B 1T5IA 3FWNA 4NJ8A 5A4MS 2A9VA 4KO8A 3N07A 3N7SC 4U8HA 3ZGLA 4GL2A 5J8YA 1T1EA 3IIJA 3FFTA 1QRUA 3UMGA 2QSYA 3DVQX 4O2BA 3AJ9A 2JEGA 1EA5A 1TVKB 1NQWA 3KYBA 3QMMA 4RQMA 2QX6A 1NAHA 3ZCUA 4X1YA 3GBVA 3K2BA 4D0RA 4FFNA 5BSWA 2P2CA 2ZJZA 2QTAA 3DG9A 3L1UA 1JX4A 1G2PA 3M9XA 4TTSA 3ONVA 1C7EA 4CUZA 1PZNA 4P2HA 1Z2NX 2HSDA 3H2SA 2NZVG 4QGAA 4EA7A 3FCEA 4NBLA 2D2EA 4AG6A 1CEYA 3OJXA 4G9BA 2P3OA 4D3SA 3OJUA 1HC7A 4XD2A 4RDXA 3G8DA 2A5YB 4PC2A 4ZK6A 4QJ3A 4QZ9A 1E4VA 4GP9A 2ZSJA 2P0YA 2P66A 4IRMA 3G6WA 3I5XA 1KK2A 2MTBA 2E21A 4EYGA 3NKLA 3IE1A 1UK6A 3LKZA 1G8AA 4MW4A 2Z3VA 4EGQA 2MMCA 2H3VA 4N7RA 3A6EA 2JGDA 3C6XA 1N5LA 4UU7A 3AP2A 1GGFA 2A1IA 2J3QA 3KWFA 1DZ3A 2BI7A 2FPPB 2L42A 1EFDN 3LNTA 3HPOA 3WNDA 3C3DA 2WJZB 5KAPA 2RJNA 4GG1A 1KLNA 3K5IA 5DP1A 4GBED 3I0MA 1WBDA 2H3EA 1WXQA 1U7DA 2A7XA 2LVBA 3NTQA 5I3CA 1NK6A 1KQQA 3QKWA 2JKZA 1V3UA 3DW3X 3H75A 2GNPA 2CY0A 3QYJA 2AXTU 5DLDA 1ORDA 4WCFC 1GPBA 3GFBA 7GPBA 1OZ0A 3FDSA 1UPHA 4J76A 4WVLA 2J41A 2PMWB 5IMSA 2YVUA 5A6SA 1MPXA 4PLPA 1G17A 1KGDA 2XOKD 1PQYA 2DSTA 2AFHA 1E63A 3ZTTA 2P9GA 5HCIA 3T99A 1OWNA 4IZIA 3F5FA 3S2UA 4HPWA 2R6FA 1F9EA 4Q9AA 4R01A 3IIMA 4BIMA 1RS0A 2ZWAA 4ZAXA 3PDWA 3HRHA 2OH2A 1IN4A 3FSGA 5FF9A 2ZBQA 3C87A 1A4XA 1CERA 5TQ2A 2HT1A 4A8JB 5DB7A 4EYOA 2AJQA 2AA3A 4UAYA 1V7QA 4DSIA 1NJFA 3PR1A 3U3JA 3DC2A 4CODB 4F8JA 2C9BA 4PNZA 2OLKA 2ATVA 3T1YB 4UB2A 3PD7A 3SR6A 1N2XA 1FP6A 4QW9A 2H0AA 3PW2A 4HLNA 1WB4A 1Z5UA 1M6HA 2R87A 4NAUA 3K0CC 2GS9A 2ZTLA 2CWWA 4Q4LA 3AJAA 2JFYA 3CRZA 3OPXA 1PN3A 1PBTA 4OGGA 3K70C 5K3CA 4MRAA 2D0PB 1G0OA 1XVUA 4RA9A 1KJWA 1DC5A 1EA7A 4JGBA 3CUTA 3HBNA 5I4IA 1Z4NA 2G7MC 5KFEA 2IUEA 3E84A 1VHQA 4C80A 4Q3BA 1OH6A 2EH9A 1W8IA 2OD9A 4MQUA 4DOAA 4AN1A 1L8QA 3C74A 1FUIA 3S5UA 2VK1A 3N2NA 1K7CA 5DG7A 3PFCA 3A1CA 5EXDA 2Z2IA 2BIFA 2B8EA 4UU8A 4L5IA 1TM3E 1JPUA 7MHTA 1NVBA 3OKPA 2WSBA 1TUEA 4YAFA 1QVAA 4HGQA 4DOCA 4GGPA 1FQOA 4YRKA 3GLHB 4AN0A 1QIEA 1KMHB 1K88A 13PKA 3E58A 4W7SA 5HMLA 2YWCA 3VC2A 4US2R 2X1VA 3C3KA 1TCUA 1ULSA 1MTZA 3KKMA 2AIRA 1NBHA 1S3FA 2B2NA 2KYRA 3D3EA 2O06A 1ONOA 2NRTA 1SUCA 4C21A 2RC6A 1G8SA 4DLTA 3A9WA 1A7KA 2LIVA 3OZTA 4WOJA 3H42B 2O14A 1F48A 1T1SA 4NDNE 1MTOA 5FOXA 1O7JA 3BPSA 3SEZA 1SPXA 2LBPA 4ZTUB 3KV1A 2AUNA 5J63A 4OSOA 2ZJ3A 1V43A 1PSWA 2POCA 2IWRA 1X7ZB 2I7CA 3FI0A 5IYZB 4M9JA 4BMCA 2YWHA 2Q2OA 2CNKA 2RC5A 1PTJA 4M0UA 1SL0A 3Q2OA 2G06A 4C8KA 4JU8A 1YULA 3COZA 1C7QA 4JDUA 4LHXA 2R0QC 3UV6A 1Q1NA 2F44A 4F2SA 2WKRA 4DCVA 3ZXIA 4U02A 1OW5A 1Y7LA 2HOFA 3N59A 1JKMA 3IJPA 4M21A 4OAPA 1EXWA 4GYYA 4DNPA 4F11A 1L6IA 3H0KA 2OAP1 5AM3A 4DIKA 3M7DA 2EAPA 5JADA 3DAFA 1MJ5A 2N46A 1JU9A 2HPZA 2DAPA 1UPBA 5BOMA 4IHJA 4Q9LA 1DV2A 2I55A 4HRYA 3OM0A 3CCBA 4O33A 4FS3A 2VJPA 4JJZA 4ZU6X 4A6DA 2AF4C 1EDEA 3WV4A 2V4MA 4AK9A 3RCBA 4PQEA 2V0GA 3O8OB 5L3ZA 1O08A 4OQ4A 3VOBA 1P0CA 2XGOA 4NQZA 3QVGA 5DWVA 3CRQA 3NZEA 3H1AA 5U4XA 1YV9A 2QDXA 1XD8A 4UDXX 3SZRA 3L4JA 5HFNA 5CVCA 4XIYA 2BRUC 4UB3A 1TC1A 3ZR4B 2NZ8A 1A2BA 5IVDA 1U0RA 4AKEA 2VP2A 4DDTA 3SR0A 3EB9A 1Z34A 5DX1A 4YAKA 2JFUA 4KMUA 3CLKA 2BMAA 4B87A 1PW5A 2P0EA 2FFRA 2NVBA 1KMIY 4HS4A 2QXUA 4YJKA 1XC9A 3AEXA 3LKVA 4A0QA 1YQ9A 2PAAA 3EG9B 2ON6A 5C53B 3QEMB 2D1QA 3ZCRA 2UVVA 3CMCO 1JKXA 3TADC 3D54D 2GBFA 2I4OA 5DBBA 1NW6A 2I3BA 2NV6A 5F78A 5CWRA 2WFZA 2I4RA 1XTPA 2NWQA 2WM3A 3BS5B 2OCKA 3I3SR 2D8CA 1D1QA 3PIRA 7ICSA 2GJ9A 4UNRA 3IPRA 2B8WA 1HFJA 1P7ZA 1KO1A 2NT3A 1ACLA 1M0TA 4UVDA 1BQ4A 5KU7A 2FEAA 3ANTA 4CGZA 4IXDA 2ORED 1Y1LA 4IQTA 3NT2A 5D5HA 4B17A 3T3EA 2X8AA 1XU7A 4YRRA 3ZD7A 4J4BA 4UQLA 4QBKA 4U5XA 5E9WA 1HORA 1L5KA 3AQ4A 1N5XA 1PYOA 4U9IS 1HOXA 3PNLA 5I4CA 3HE3A 5IJ9B 1G9TA 2R44A 3HKEB 1FVXA 2XVAA 4KPUB 2NUTA 1U4BA 4DWJA 3KWJA 3PJFA 1L3VA 3U39A 1FBNA 5TDHA 5DXFA 4M49A 2LP4Y 1E4EA 4XR4A 2H4JA 4I50A 3HU2A 4KU4A 2I67A 4UHHA 4XFDA 5HDBB 4URZR 3U3OA 1E0KA 3OQMA 4O4IF 1XQXA 4PSKA 1TD9A 4P4TA 2AN3A 1ZD5A 4F12A 1UM8A 2CNNA 1J8DA 1L7MA 1QQAA 4KAXA 2HU5A 3RTBA 1CIJA 4EW3A 2QM3A 2VA2A 3FOAA 2ZWMA 2V0CA 2IELA 4RLSA 3A1DA 2CB9A 2HRBA 2BFCA 2Z2YA 3T5DA 5G3YA 1N5JA 1K06A 3CNHA 4C0BA 1ZPDA 3BSSA 1C1XB 5AD1A 2P62A 4LZJA 3SR3A 3VHXA 1NJZA 1GR1A 5IH7A 4HAIA 3LW7A 3GROA 1ZQPA 2GF9A 4F91B 3WG9A 5BSFA 1JAYA 3AVOA 2WWTA 2O5CA 1CQIA 1UIRA 3I4FA 3NS7A 1XOIA 1KDZA 3ZV3A 4C7MA 4OMCA 4KL8S 1S9HA 3K70D 4AKGA 2VP4A 2Q0SA 2TMGA 3AW9A 3W05A 3FY4A 1W52X 2P2DA 1J2MA 3L6DA 3EEBA 4YLYA 1YJQA 4ZCLA 1KMNA 1WHSA 2CBZA 421PA 1IM2A 5BRNA 3CPHA 3PRKE 3IG8A 1JMYA 2I91A 3M3HA 3I6QA 1YI8A 2KK0A 3CE9A 2GJSA 5J2HA 4QUEA 3T5MA 1ZBQA 9ICIA 2XUZA 1IEXA 1XK6A 3EQZA 2AGOA 3JY6A 1VXRA 4KLRA 4YFYA 3TEJA 1SD5A 4HYQA 4BCCA 4F06A 4Q3OA 1PR1A 1USIA 2GCEA 1CQIB 4NL9A 4RQNA 4FX5A 3H9QA 3KKPA 4B3XA 4G9EA 2I3ZA 3G5UA 3TIGA 1JE1A 4K9RA 2BJVA 1CEZA 4XPZA 4E5NA 2EHJA 2VJDA 1ZGAA 4C7KA 4ZHQA 4XB1A 1N7JA 3H19A 5EWJA 3QU2A 2QENA 1U02A 3BL6A 3QVWA 4PYLA 1GQSA 2B61A 4JS0A 2Y6UA 4Q7EA 3LCRA 1P91A 1HZZC 1ILEA 3DDCA 5HOQA 1HMYA 1CYEA 2QE7A 4O2AF 5DVZA 3VHLB 3W3AH 5AVQA 1CJVC 3NIWA 4G84A 4YYEA 2C04A 4E7OA 2IA5A 5BQOA 4D96A 3OE4A 3JQQA 3TNFA 4X60A 1BROA 3S8MA 1SXHA 4KO2S 2V58A 2B98A 4HNQA 1LPMA 2ZB2A 4RU9A 3D2SA 3FPFA 3IHKA 2C2RA 3SBDA 4CM1A 3E53A 1YHNA 2QZZA 4N6NA 2QZSA 3ZOZA 4JX9A 5LNK6 1NW3A 2OR3A 4OI1A 4R3WA 4HAOA 1I3LA 4IDAA 2W2KA 2BR3A 1RJ9B 4IMJB 3RWOA 1L7VC 1GGVA 3M6IA 5DSXA 3A1VA 3UQ2A 4WKPA 3Q2KA 1KHHA 1LZLA 2ZYSA 4TV9A 1L6NA 2K4IA 4GEKA 3B6ZA 3N0TA 2JIMA 5LMUB 5EJIA 4ZODA 3NHPA 3GNSA 2ZITA 1C7ZA 2ROQA 5ECYA 3DE4X 2UUPA 3R4CA 5HEKA 3VKUA 1J90A 4NMWA 4FNMA 5CLHA 4FU0A 1MRSA 1L4NA 3KS9A 2PTHA 1FTNA 3D8TA 1BYIA 1FFSA 1BO6A 5IT4A 3VNSA 3DMDA 4JC0A 1GUDA 3ZS9A 4WY2A 1NATA 1M1YE 2ZJAA 1BSVA 4DCOA 1YJCA 3HZRA 2NO0A 4B3FX 1PQPA 4WEQA 2CL7X 4LYFA 4KZKA 4TLLB 5CFOA 4LVNA 5FTNA 3G2PA 3I72A 4R81A 3DBHA 4R3NA 4EHJA 1NR5A 2N9UA 3VH2A 3D4LA 2J3KA 4JKOA 3LPNA 2C83A 2QB0A 4ARZA 2O8BB 2IZZA 5CNJA 1V4VA 3O9VA 2J5BA 3SC2A 5L6MB 1T9DA 1XDGA 2ANBA 4Z6CA 2JIPA 2R1UA 4C87A 3A6FA 4A16A 1AGPA 4Q1VA 3WICA 3CV3A 2EF1A 3RIHA 4OXIA 2VP0A 1NW8A 3AGPA 2EOAA 1T0BA 1UJNA 4YMWA 1P2TA 1Z2PX 2DG2A 4WOBA 1UFRA 5FQNA 5LU8A 4O4JB 4DLAA 2FN7A 3R5TA 3FD8A 2SCUA 2EJTA 4FKBA 2DQKA 1ZUD1 3D7MA 4FD2A 2QNRA 2YWGA 2I66A 4IP0A 1TF2A 4O08A 2QUZA 3C5FA 2AJLI 2OMKA 3BTUA 3SZOA 2BFDB 2EP8A 3FOEC 2EAOA 4E1VA 5BSKA 3USCS 2P9JA 2BMEA 2G5CA 1EXMA 3SAGA 2KVCA 1D9DA 2GKGA 4FP9A 2I1VB 3R6LA 1U7PA 3IPXA 2QRUA 1JGTA 1K0UA 4KSYA 3BD6A 2BKUA 1DFHA 1RWMA 5HR7A 4C1BA 1C80A 1NJYA 2K60A 4D8UA 2ZB7A 3RJZA 4QAJA 2O7RA 2PSHA 3F97A 2JH1A 5EIAA 5EUCA 3OEYA 4NE2A 2H00A 4YCAA 2VHCA 1TAUA 4J2OA 1WXDA 5EVJA 1QMPA 3TQFA 4XGQA 1XU9A 2LIPA 4HXFB 3AHIA 4MW0A 4LFAB 3A0HU 2WHPB 3R5XA 5FH9A 5L95A 4LWOA 1PZEA 1CLEA 3CUKA 1RI4A 3TCXB 1GR0A 2JGEA 3TS1A 4H4EA 3N0VA 4BBPA 3D8BA 3T9FA 4J9SA 3TD9A 5D3KA 5FWYA 1Z82A 3VU9B 4J9QA 4DA8A 2P7IA 2J48A 2O8DA 1J09A 3M6XA 4MVCA 5KYUA 3V8NA 2I3AA 3VR4H 3QLEA 4CIAA 1IG3A 2GEKA 3V4LA 1WTCA 4PYMA 4RWEA 3QE0A 1PCXA 1X92A 4MICA 1P9WA 1TXGA 4N0EA 4N3AA 4E0DA 1P0IA 1ORIA 2C92A 2R84A 3T1NA 2XNHA 3SHOA 1KP9A 3Q5DA 4MI9A 4YUVA 2NNWB 2R86A 4MS1A 4LJ8A 1PNRA 1PDWA 4F6CA 1NV9A 3OKFA 3TVTA 3L4PA 2B8JA 3F47A 3L4BA 1PUXA 1RI1A 3RTDA 5COAA 1W5EA 4HF7A 3H17A 2G88A 4QG3A 3KOXA 4RLFA 3EDCA 1EFHA 4KRFA 1SUEA 4NZYA 4ZMSA 4QZFA 1THTA 3QNUA 5IG2A 1LPAB 3CLVA 3WDLA 3G5LA 2LMRA 3EEQA 1BJKA 1SEPA 3K9GA 5T4EA 3VYUB 4YRFA 5H3CA 4MHSA 3QEKA 5I01A 3TD6A 3NAMA 4OKIA 2UVPB 3W9BA 3RSQA 2NOAA 1GU7A 4GU5A 4OBBA 1T3GA 5JAOA 5F2EA 3SHQA 2J33A 5KAIU 4UBJA 3BIXA 1MXHA 2JLQA 1VHJA 5M04A 4BMZA 3LOQA 3H2ZA 4JLAA 4TROA 4LGVA 2GK4A 2VHZA 2J0QA 1NRJB 5FPYA 5HE8A 3W2EA 1EZ1A 4DL5A 2WD9A 1O57A 1KZGB 3UWOA 1YK0A 1SOVA 5BVGB 4MLDA 1NSTA 5K3BA 3AJEA 4L02A 1OLUB 3AFMA 1EIWA 2WQ6A 4FE3A 4XFKA 3AR3A 2KSOA 2J5QA 4RCVA 1Y3IA 2EJBA 4QOGA 2J45A 3ET5A 1K66A 5CXUA 4UTNA 2OECA 4DRZA 1Y3HA 3QBEA 5TGDA 2NRXA 1T2FA 2W98A 3SNKA 1ZD3A 5CCEA 2YZMA 1JQKA 3EAFA 1E6UA 4O3OA 3L7JA 2FLVA 4ZANA 1E2IA 2MSEB 5A2GA 5JVDB 2BKVA 5E7JA 3RRMA 1ONBA 3LWBA 3WGIA 4KYTA 2JASA 3EGXB 2B2CA 3HGTA 4XQ8A 3PR4A 4IWXA 2FU5C 3MR3A 3DCNA 2VRCA 5DXJA 2GZ1A 4LZOA 3E1GA 2MHCA 1YBFA 1L4FA 4ZQEA 1D9XA 1S5PA 2KJ5A 1QONA 2F3PA 1UCVA 3A31A 2EW8A 3T38A 2NZXA 3DEFA 3H4VA 2HHUA 1NFRA 4DA4A 4W5JA 2NVWA 2VAPA 1GZ3A 3L49A 1Z0KA 5CX1B 1OW3B 5PGMA 3OO0A 2D1SA 2OA0A 5G4LA 4DJAA 1MO4A 1NI3A 3FRJA 2HBKA 1YBHA 1JG4A 2EG5A 1UK7A 4NPAA 3FYUB 1BCRA 3P9KA 2I4MA 4JBNA 4YMOA 3Q8LA 3RSLA 2V96A 3U6KA 2O2DA 4DB2A 5BV2P 3OQJA 4G0XA 2I2FA 1EE9A 2LV8A 2B7BA 4UBOA 4P32A 1RLIA 5ULLA 3EULA 2Y1JA 2JCGA 2CKMA 4DXAA 2XPCA 3AL0C 1XZHA 1ZWKA 3ECSA 5EHXA 2ZREA 4RUKA 4NLCA 4FM9A 4IQGA 2QAGC 2GDJA 4L8GA 4DQIA 4NG4A 3OM1A 3DVAB 1PT6A 1VB5A 3V3KA 3JWJA 2J6SA 4KN6A 3S1AA 1XALA 5JY1A 4EBFA 2PANA 5EJ5A 2SHKA 2QP4A 4R2JA 4HP8A 2BMWA 4HVCA 3JSXA 1BMFA 3PX4A 1CWUA 2A88A 2QT9A 4I5FA 3HYLA 1N7GA 1KWGA 1KIAA 4MWSA 1HF3A 4R8VA 2HFJA 2JAOA 3E2MA 3CT4A 4LJKA 4L28A 3UAYA 1G20E 2VSXA 1E1CB 5TXGA 1JEYB 2EC5A 1Q77A 3BMOB 3PI6A 4ZYWA 9ATCA 4ZVUA 4MWGA 1J8VA 4ZEWA 2WTMA 2H7CA 3O82A 2QMUA 1Q57A 1CZOA 2OBNA 5DBOA 1VBKA 5F9NA 4L22A 3NQ41 4Y9TA 3HUDA 3IX7A 3TCKA 2A9KA 2VHTA 3F3MA 3FDIA 3LBNA 3S1SA 1S0NA 1EUDB 2XYVA 1O58A 3R3SA 5FPTA 4S1WA 2RG7A 4QWWA 3FYHA 5DGBA 3DZ8A 3UANA 1ZC4A 2B99A 5TJ9A 2J6BA 2DE0X 3RG8A 5AJWA 3EYZA 3W2FA 3IAHA 1QIIA 2IUSA 2IPAB 1VPWA 1YF3A 4FYVA 1YRYE 1D2AA 3WK9A 1FVHA 1PW7A 4ZT4A 3CFYA 5LDHA 2C9YA 2IY9A 3DKKA 4TYMA 3A3OA 4XARA 4NLKA 1U8CB 4OHRA 2BI4A 1XCLA 3LF1A 1YL7A 2C58A 1PFKA 4CMKA 3A6GA 2XNDD 1T9HA 2FN9A 2XDQB 4M0CA 3KU1A 4P2GA 4S1NA 4YUAA 4BNUA 3THXB 1PJ2A 2HA3A 5FOTA 3KB8A 5TF0A 1GAXA 1JDBC 5JAUA 1A2QA 1Y7TA 5ERGB 3IHQB 1NKCA 4C88A 4G2TA 3K9BA 2EWWA 1CFZA 2HBLA 4ARSA 3VDNB 2VP3A 5EZ5A 4ZWNA 3IAS6 5FA6A 1RCUA 3SQIA 5F1YA 7REQA 2ZJ1A 5AT1A 3V7UA 3QWHA 5CB8A 1O87A 2HHAA 2P2LA 5E6SA 1BPDA 1JXMA 4GVLA 2Y99A 4JJGA 2FUCA 1U0SY 3VU1A 3PCRB 4L9RA 5T14A 3NUQA 1QE5A 2IU6A 3L4BC 3EUAA 3IBFA 5CR0A 1THMA 5I7RA 1ZUWA 4M9ZA 2FSVA 3A4TA 1JHVA 3FDZB 3KP1A 1IJEA 2O4UX 1UAYA 2JIOA 4BVBA 1HKUA 1NONA 1SXJA 1HTBA 3TRIA 5K99A 2PIAA 4C89A 1LDYA 1L5HA 1NWHA 5KHLB 2QTRA 3W2IA 1S2DA 4OP1A 1VL0A 4OP2A 4HS9A 1Q92A 2QVLA 4DNOA 5B1HA 5IARA 3FVQA 3EFHA 3W3ZB 1I32A 4IG9A 1JX6A 4TTIA 1V3QE 1M7BA 1JF8A 3I2FA 3OURA 2PNJA 4E88A 4DRYA 2QM7A 4OLBA 2P5TB 2AC7A 4REQA 1PKXA 5EHGA 4RHFA 2CYAA 3RB6A 1FC0A 5IABA 4TLBA 2DTXA 2WU4A 1KI4A 2DSNA 2DH6A 3MILA 2LKYA 3NFYA 1NY6A 4PJ0U 2JJ2A 1IRIA 4XGNA 3BYZA 5THKA 3IQEA 5JS6A 4EG7A 4OIFA 1NRXA 3U61B 3FWZA 1PT9A 5I7WA 2XVYA 1ODLA 3JQ7B 1SHTX 2RKBA 4GOLD 5KUTA 2FN3A 4E31A 1WCIA 1I3NA 3MJHA 2OGUA 1FP7A 4G5FA 4UHDA 5GTHU 1Z62A 5KYXA 5FWNA 1DGSA 2JZOA 3BK7A 2ZTDA 3K73O 5JZSA 1K9VF 4JB8A 1OGJA 3JYHA 1A4RA 5J1SB 4GC5A 4RPZA 1LRKA 4LQCA 3O38A 4WK4B 4J9UE 5HDQA 4PYOA 3TQOA 5FD8A 4KV9A 2XMQA 2WYHA 3A27A 4QULA 2EANA 2R8BA 4YXFA 1IC6A 4IW3B 3RBZA 1M1XB 5C8YB 4Z4EA 3ZJYA 1CBUA 3NRZA 2WUWE 4TSFA 2D2IA 2QDKA 1PL7A 3UAXA 2A4MA 3CKLA 2BDUA 4RK7A 1TYDE 1RRVA 3MJSA 1MAWA 5KJ6A 3GDGA 1YZUA 5EMJA 3DS8A 2XHZA 4BAZA 5KTSA 2KTQA 3A37A 1NDHA 1G19A 1DLJA 4B4VA 1YB6A 5JYEA 3C3YA 1N7HA 4G6ZA 3GRYA 1PGPA 1E4YA 3RVPA 4UDOA 5K4GA 4KPEC 4U2FA 2HD4A 4ZV7A 4QUKA 4QDOA 2ZXUA 3I6ZA 2G36A 2JIDA 1TTPB 4CL8A 4GGOA 4EKGA 4BLWA 1ZESA 3ICQB 4I1SA 5AKYA 1RZTA 4CF3A 2NU7A 4M0EA 2AT1A 3ZHYA 3MQ2A 4MPPA 3QXSA 3E2EA 2O7VA 3ASVA 3BTOA 4MGIR 4B79A 3IVRA 4AN4A 2V4ZA 3NJ4A 4MRPA 4DZRA 2OYSA 2ZWPA 5CCBA 3EXEA 5DWDA 1SUWA 4WNCA 3KG2A 1F6WA 3VR2A 1XTRA 2OYCA 3M6AA 5LPNA 4GE0A 2QX8A 2VBIA 2GTHA 2J3HA 1KQGA 5JXGA 3PLRA 4KPYA 1QGUA 5LSAA 1Z47A 4TQAA 1NR7A 4FWIB 3HHEA 4O4LF 2GZMA 1ZL2A 1I3KA 3N6RA 3BL8A 1T35A 3IDZA 4EKIA 1E3LA 2NP7A 3VPGA 1KI3A 1CZLA 2VCEA 1KR5A 4K03A 3EZGA 8ICPA 1SBCA 2VXOA 3QPWA 2UAGA 4QQKA 1Z33A 1MOSA 3NATA 1ZD4A 3NHZA 4F4WA 5E0KB 2LDXA 1N6LA 5AM1A 1ZQRA 2HHTA 4BHTA 4MIYA 3IUJA 1PQUA 1GZ4A 4FILA 4BNVA 3MUFA 4BMOB 1Z9BA 1N5WA 3P2EA 4RELA 3HKZF 2EKQA 1BDHA 1HDOA 1BS9A 2ZBEA 3UGJA 5A5DA 4HMPA 4BV8A 2H1WA 4PPNA 3KO8A 5TSDA 4RD0A 4PINA 3RRXA 1EE1A 2PXXA 2FQYA 2RHHA 1AKRA 1RFLA 3W5VA 5DTEA 4CG3A 1V85A 3GW8A 4J7UA 2BI8A 1JIIA 1U1IA 4HWKA 2WF5A 1FTQA 4AY5A 1FDWA 1QR6A 1SC3A 1VJGA 3KUKA 1C4XA 3L41A 4UFNA 1DBQA 4BVAA 3GJXC 4HWSA 2Y68A 2M2IA 2JPDA 4NJOA 2VL7A 1M1NB 4FSDA 2AN4A 2BFMA 3AUTA 4ZP1A 5JH7F 4EQZA 1SD1A 1KZ1A 1PFGA 4IQ4A 4KAJA 4CIBA 4BJ3A 2OESA 4GSYA 3L0OA 1JW9B 9GPBA 4V24A 2FHSA 2DUUA 5BN1A 5HRCA 3PMLA 3KT8A 1PU2A 1ES9A 1UJCA 5AW5A 4Q00A 1ZD1A 4NI5A 2XCQA 2E49A 2CUKA 1SUPA 1FP4A 1X70A 1T4BA 1K1SA 1H2ZA 3P19A 1YB1A 3K6SA 4LHVA 2BMDA 4HLDA 5J58A 2XA2A 4O3FA 4XUGB 5HW0A 4BBZA 3W3AA 5E79U 2Y3IA 2C2EA 4Q4HA 4BX0A 1G7RA 3REQA 3PHJA 4XGIA 1Q7EA 3THYB 1H9AA 4YP6A 1BX1A 3T3NA 3BORA 3PFFA 3MCWA 3EZ5A 2VZ8A 3IB3A 1U4NA 3GH3A 3D6MA 4P3NA 2KHZA 4RMGA 4BX8A 4TZ0A 1F0MA 4MUIA 3KZVA 3WWOA 2ZG6A 4BV9A 1A5SB 2PSFA 4DKXA 4GE3A 1AMOA 2FQXA 1GPWB 5JLJA 1IB0A 3EVBA 1U9CA 5HE9A 4OJ5A 3OTHA 1L5WA 2FH5B 2XMPA 1E32A 4ITUA 3CUSA 3AHJA 2FSVC 1T3TA 1NXSA 4G97A 2XGMA 2D5CA 1SXJC 1P44A 1DKLA 2BFBA 3FTFA 3ND5A 4D82A 1GFSA 1TQDA 3Q9LA 1NA5A 3IJRA 1VJ1A 3DH0A 5BMVF 1QG2A 4MHVA 4Q4JB 5JLAA 2PA0A 3AUFA 3BGOS 3GARA 1PR2A 2D5AA 2IY8A 2XD9A 3AF0A 3SG0A 4US0R 2VH1A 3NH9A 1RIFA 2FG7C 3R3HA 1AC5A 1GTZA 1O89A 3G2MA 2RI6A 4AYTA 1R12A 3IUMA 2MWMA 4QIWF 4ML3A 4NNJA 1FJHA 1EQ2A 3ABSB 2B1JA 2GLUA 3P4YA 3LP6A 1RYSA 4G85A 3HTXA 4OHWA 1PQWA 4F5YA 3CCCA 2V9CA 3WAJA 1T5SA 4JUCA 2CVFA 3JQFA 3O4IA 1TVKA 4MW6A 3AMVA 1VBMA 5EJAA 1N6OA 4GI3A 2A57A 2X0NA 1KSJA 1ZFNA 4AD8A 1O94A 2ZB4A 1I30A 2WAXA 3J81k 4PY2A 1EVLA 5I7UA 2V4QA 3UCFA 2V5UA 1AB5A 1VE5A 1V25A 1KK0A 1Z63A 5M34A 1EFCA 5ENZA 4FHZA 3W78A 5HIMA 1M2FA 2CRXA 3GI1A 1EJBA 4L9SA 3LPCA 4TT8A 1WX1A 3SDBA 1UC5B 1N2CE 3MRSA 3NAZA 3NTUA 1VCHA 4RULA 2J87A 2VRCD 3H2YA 1EZ4A 3LD9A 3VC3A 5B1SA 4YCBA 1JQ3A 4QO8A 2QKYA 3N2GB 4ZC8A 5DNWA 2QTBA 1ZOIA 4OXYA 3AF1A 3W5UA 4DR3B 1T8EA 2WHXA 3RVSA 1WE2A 3RH6A 4KHZA 1N2BA 4FFLA 2XVMA 1MO5A 2JNWA 3PW7A 1NUAA 2BF4A 2AKAB 5KTTA 2FPPA 3FBTA 4X3PA 3S55A 4C4PA 1LKZA 2CT8A 1JQAA 3NKVA 2YZGA 4Q6WA 3BVPA 3HQ4O 4PVDA 3IBYA 4CBVA 4K26A 5CNKA 2F7SA 5K8JB 4DCGA 3HXPA 3G9ZA 4MI1A 1XNRB 3MC1A 2HJ9A 4J3JA 2OVFA 3B6IA 3TUJC 5C5CA 4R6XA 4F3OA 1VBFA 1QQ5A 4OYLA 4Q39A 3Q3EA 2Y4NA 3RT9A 2G25A 3ZHQA 3KYJB 2ZAGA 2ZYUX 1PSZA 5E4FA 1MT0A 4XSHA 2W9AA 5ALZA 2QN7A 1A04A 1BMFD 3S2ZA 3ZH9B 3BCHA 1KE1A 2WIAA 5E3HA 1RPNA 3HJCA 4NZNA 1V4BA 3ESQA 3BBPA 4NXZA 3SD7A 1XGKA 3DFIA 1W19A 2BGKA 2QT1A 4CEIB 3GVCA 4EPTA 2O5EA 1K7EB 3SEIA 1QG0A 3MXOA 1HDGO 3AB7A 4A8JA 3GAFA 4L5JA 1DC3A 1Q8KA 5JNSA 4DF4A 2Y0DA 1EEXB 4DC0A 2C07A 2PRKA 4OQLA 1QF9A 1K4MA 4BFCA 4H3VA 3VR4A 5E8RA 3E70C 4E11A 4H60A 1Y98A 2CHVA 4JLUA 3IHWA 3RS8A 1G41A 3ITDA 1IVNA 2WE8A 4B46A 1BXRB 1UEXC 3L84A 1A8QA 4TXMA 3O9ZA 4GR5A 4LHSA 2BGMA 5B53A 5KINB 1DAGA 4C6RA 2H3QA 5IIJA 3R3YA 4NAHA 2FE4A 1H2EA 1WEKA 5J0OA 3JZMA 1H69A 1KJQA 1B76A 1W0KA 2XEDA 3C8UA 3TL6A 2VTVA 4UE6A 3RU7A 2GILA 3GLHA 1E7YA 1KMHA 3HCNA 4CM7A 2NPFA 2B0JA 1OWLA 2GTPA 5A6VA 4HGPA 3K3PA 2W5UA 1T5OA 1KQFA 2YWBA 3ESXA 1ZM3A 1U8UA 1Y8RB 2FFHA 4UZEA 2VAVA 4K9SA 3JQ8A 4G1FA 4N8DA 5LNK1 1KS2A 1UDBA 2ZIFA 4KXFB 3H0MB 2BKXA 3KHTA 3MMSA 3K5PA 4U1RA 3V3TA 3CBQA 3F2IA 4ZO9A 3M49A 4IC9A 1TT5B 3D31A 4ENSA 3D2NA 5TQ0B 2CHGA 2HVIA 5ADHA 3RB3A 2OGWA 3L6OO 3I34X 2TSYB 3L0CA 5F35A 1X7ZA 1LLDA 1P8AA 4F86A 1DXOA 3A10A 3PNSA 2PX5A 5IYZA 3SEQA 2GEFA 1UA1A 4HDRB 5J2IA 1FRNA 1KOJA 1MENA 1CDZA 3VZDA 5FO0A 2OHFA 3GQBB 2ZYRA 2QUAA 1SH7A 3IE0A 5F98A 3MGIA 2IDJA 3UK0A 1BVRA 6ABPA 1FNSA 1SXJD 4MV4A 3JQ8B 4YXWA 4ECSA 3P9QA 3LWMA 4PPYA 4KOAA 4X3OA 3RRZA 4EUKA 3OJWA 4XCXA 2B1IA 3TOXA 3RF7A 2AZMA 1TRKA 3ISTA 5H3LA 2X4GA 1YVRA 3VKHA 4EJMA 3T41A 2M9MA 3O8OA 2GZHA 2OORA 4HNVA 4G5XA 1NPYA 1IWBB 2NRZA 1BDMA 1YC2A 4KWIA 5K8LA 4TN5A 4L6IA 4WXYB 1XN4A 4KO1S 3C4QA 2DBRA 1SXEA 1IONA 4BU0A 1R50A 2IZ1A 4TVSA 1PI3A 2FEKA 1KO7A 4AJJA 4JXXA 4POOA 5LQJA 3GLUA 4B44A 4NK5A 3E48A 4DQLA 1AUXA 5C81A 2F64A 2JJ2D 4G0ZA 2GVNA 4RE5A 2VYNA 1TAGA 1U8AA 3JQFC 4Q9DA 2G5HB 4MYSA 5JG7A 2GNOA 2IW1A 1TJ5A 3IP6A 2HJSA 3ZDYB 5IDYA 3EG9A 3VSAA 1N6KA 1O94C 5DQIA 3QEMA 2XMDA 1K27A 2WJYA 5L4SA 3H4BA 1T3HA 2H51A 1K7YA 5KFAA 2WG1A 4I4TB 2SBTA 3MERA 3FSJX 5FHRA 1N9ZA 3V34A 1P6QA 3RYIB 3BS5A 2PA3A 4RNDB 3SE7A 4PIPA 3ADKA 2QS9A 2VDPB 1U3GA 2EL9A 3GLRA 3OFNA 3V48A 1MW9X 4D1YA 1ZK4A 4GC6A 1OWPA 3FCSB 3DHWC 2G9RA 1VDMA 1X0XA 2B69A 3OU2A 3BL5A 4UNIA 1ZHOA 4TSFD 1X3SA 1OXJA 4JI7B 5FAXA 4QT0A 4ALMA 4MW9A 4XIIA 5J8YC 4IKEA 2DR0A 2I8CA 3B9BA 1CUHA 3DV0B 4I2AA 4LJ4A 4DC1A 4XWGA 5LCXA 5AKLA 3D2BA 4M1ZA 4AKTA 1SULA 2Y2UA 4EJ2A 1NTRA 2HA2A 2X0DA 5E6UB 1GUFA 4ELUA 1M2HA 1TGYA 4Q3DA 4B3BA 4XVRA 2KFZA 4YMGA 4L5CA 3VTAA 3WRXA 4MLPA 4QSMA 2ZI3A 4MWOA 5IJ9A 1V38A 1I24A 3HKEA 4Z7OB 4OHCA 5FUXA 4KPUA 1A9SA 3PFHA 2XE4A 4IDBA 2MMGA 3MBIA 2GPAA 4XIJA 2H29A 2OFXA 3MRTA 1BFUA 1CUAA 3ZE8A 1X1CA 3G8YA 3ZXSA 5TARA 3GV0A 3H97A 2GBIA 4AB1A 3SBOA 3QJ5A 3W4IA 2B21A 1UXKA 3A36A 1RC8A 3VR2D 4FGLA 2WWVD 5FJIA 3D8NA 1JDTA 1U98A 3C2LA 1FYXA 4PGMA 3TLGB 2H06A 1XEWX 4DXHA 2QMYA 3U56A 2WILA 4RD3A 4TSKA 4R0MA 1D5WA 4JLVA 5JC1A 1JH9A 1J2NA 3B48A 3WTBA 1C1XA 3E3MA 1XZGA 1XMOB 2YMPA 1JLLB 3MK31 4HQNA 2DFPA 3LS2A 1Z73A 2ZB8A 2WVGA 3PQCA 4ZQGA 1J5EB 4CQNA 2CHFA 2E7ZA 4HNSA 5ALRA 3VJRA 1Y81A 4A8JC 3C43A 1DE0A 4M9SA 1R16A 3DBIA 5FYQA 2BC9A 1GSHA 4RHYA 1W59A 1MX5A 4AZ3A 4LJLA 1IDN1 1XIVA 3V4RA 1XYGA 3OLCX 4QREA 2WPNA 3MMZA 1HOTA 4CV2A 5H68A 1E69A 3B1FA 1MV5A 4ICIA 1LH0A 1TD1A 3EIQA 3VC7A 2CXPA 1AKTA 2FSUA 3Q5EA 4KV7A 3ENNA 3E4CA 5F2KA 1QFMA 1C3LA 3UTDA 3HN7A 4XQEA 4P7FA 2DFVA 3TK1A 3KXDA 3MJFA 3KPYA 4Y2QA 1XEXB 5ADUS 1GNVA 2XDYA 4Y6RA 3U3KA 1T2CA 4MWZA 3VZSA 2F8LA 1F8FA 1KPGA 4JDPA 3TNYA 3OZSA 4KX5A 4J43A 3B1KA 3CNEA 2VT6A 1QG4A 4AZ3B 3H0CA 2G9QA 2G1AA 4MUMA 4AJNA 3ICWA 4B6PA 4ZVNA 1WZCA 2VYQA 4PZ9A 1P2BA 2C03A 4DA0A 1Q3VA 4LF6B 2GAIA 2QUBA 2JGAA 5EKSA 4TWBA 4ACBA 3CZRA 2V6BA 4K9QA 2NV3A 2EG9A 3CUVA 5CEEA 1P0PA 2CLHB 3W3AD 1HX7A 2TMYA 4LDZA 1OPXA 1QYWA 3B20A 3BGDA 4JLDA 1LBQA 3MRXA 5C31A 1A0OA 1CP2A 4G63A 5IULC 3QU4A 2YV5A 3LUAA 4M1TA 5B30A 3L6CA 3LVBA 3KCNA 3SC4A 4P4PA 4OOFA 1NXTA 1A8PA 2ACEA 1NZJA 4Q3LA 1T6BY 1RJ9A 2PD6A 3UH0A 5AKIA 2EKZA 1AV6A 4TZKA 1A5ZA 1Z4QA 4DV3B 2BBOA 4BL5A 5FBHA 3T1TA 2PUBA 1MG0A 2UV8A 3OHSX 3CNLA 3KHUA 1YRHA 2NNLD 4WT7A 4IFIA 2FMSA 1E94E 3S0JA 3RC1A 1K5OA 4LGYA 1E2DA 4I8DA 4LVOA 2ZIVB 2PJUA 4LKOA 4JV5B 4DWOA 3HDTA 3N7TA 2J67A 4FOTA 2IXFA 1HQYE 3FVVA 4PR3A 3RD5A 2C7PA 3TOSA 3BSWA 2EP7A 1LDNA 3RC3A 2I5PO 3GLIE 4HDSB 4UDNA 3GLTA 4HNHA 2V8OA 1NQOA 4TGLA 1ULZA 4LRQA 2X40A 3C6BA 4R8LA 1XL0A 2HLPA 4HWGA 1N6RA 3FG9A 3RBXA 2AI1A 5KFNA 2YNMA 1M76A 1FSGA 5E1MA 2DUJA 5JU6A 3COSA 1AXRA 4LDNA 4Q45A 2GF2A 1PTJC 3U9TA 2YDXA 4GX0A 4DSEA 5FDFA 4L57A 2QUJA 2I7DA 1UOOA 4IFTA 2OY0A