4DCCA

Crystal structure of had family enzyme bt-2542 from bacteroides thetaiotaomicron (target efi-501088)
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
203
structure length
203
Chain Sequence
KGIKNLLIDLGGVLINLDRERCIENFKKIGFQNIEEKFCTHQLDGIFLQQEKGLITPAEFRDGIREMMGKMVSDKQIDAAWNSFLVDIPTYKLDLLLKLREKYVVYLLSNTNDIHWKWVCKNAFPYRTFKVEDYFEKTYLSYEMKMAKPEPEIFKAVTEDAGIDPKETFFIDDSEINCKVAQELGISTYTPKAGEDWSHLFRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of protein Bt-2542 from Bacteroides Thetaiotaomicron (Target Efi-501088)
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
molecule keywords Putative haloacid dehalogenase-like hydrolase
total genus 77
structure length 203
sequence length 203
ec nomenclature
pdb deposition date 2012-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 4dccA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4dccA01
3DAOA 1EK2A 2QLTA 2W11A 5AKIA 1RMQA 5ALNA 2FPXA 1JUDA 4Y2RA 1L7PA 3MN1A 3U7HB 3QUCA 2MU1A 2ZOSA 1NF2A 4QJBA 5IS2A 1Z4PX 2YMMA 5E0OA 4UMEA 2VKQA 3P96A 4YCNA 2ZXEA 2C88A 3FGOA 5AI0A 3ZX5A 4KNWA 4IFTA 2W43A 1ZS9A 1ZRMA 1RDFA 1TJ3A 4ZEXA 1O03A 3L8GA 2JAUA 1ZRNA 4NFLA 4YGYA 4HGNA 3N5KA 2I55A 5AW7A 2HHLA 3NAMA 1IWOA 1J8DA 1MH9A 3I76A 5AW1A 3W5CA 3IJ5A 3N8GA 3HLTA 1Z5GA 3QNMA 3S6JA 3WK5A 3KDPA 3QGMA 5AI8A 4UM5A 3L0YA 2YY6A 1YMQA 2OBBA 4RETA 3OCYA 3PCTA 2EAUA 3I1YA 3SMVA 4J2TA 4F72A 5ALSA 5ALEA 5AM2A 4Y2QA 2I33A 1U02A 1FEZA 4Y2SA 5ALIA 3WKDA 2R8XA 4RESA 4GIBA 3ZWDA 3FVVA 3ZUPA 4CE6A 5AIBA 3PDWA 1RLOA 4XOUA 5AM1A 1RRCA 1QYIA 5AVXA 1YDFA 3MMZA 3IB6A 1X42A 4MWOA 1T5TA 1CQZA 5AW9A 2AH5A 5AW0A 3QU2A 2FEAA 3FM9A 3E58A 3FZQA 5AK6A 3SKYA 4YCMA 2OM6A 5AK5A 1J97A 5IT0A 2GO7A 2AMYA 4HGRA 2FDRA 1Z4OA 4EENA 2RARA 4L6CA 4BNDA 3E84A 5AKJA 4C4RA 2QYHA 3L8EA 3NRJA 2GMWA 1Z4QA 1Z4MA 3SHQA 1NNLA 2HO4A 5AI6A 3I6BA 2G09A 2B82A 1RQNA 2HI0A 4J03A 4EX7A 3QXGA 3NANA 1ZD3A 3CNHA 3OCZA 3RFUA 4MUMA 2FPSA 5AKZA 3SD7A 3A3YA 3N28A 2I54A 3BWVA 3OCWA 4GXTA 4UATA 2GHQA 4UM7A 3RF6A 3NUQA 5AM4A 4XQ0A 3AR6A 4Y2UA 2R8ZA 3BA6A 3WKBA 2PR7A 5AK4A 5ALKA 4UASA 1Z88A 3W5BA 2G80A 3EF0A 1Q91A 2ZG6A 3WGVA 3U7GA 3ZWKA 4XE5A 4KN8A 4NABA 4BX0A 3SLRA 2BY4A 2G0AA 3FPSA 3PGLA 5ALUA 3L5KA 3QU9A 2Q4RA 4KX5A 5AW6A 3NASA 3B8EA 2B8EA 2WF5A 2Q4TA 2IOHA 4AS3A 2D2VA 3WKCA 2FI1A 2EATA 4L57A 4CNQA 5AVYA 3L0CA 3M1YA 5IT4A 2G07A 4Y2TA 2MSNA 2YJ4A 2C4NA 2WF7A 4KNVA 1L7MA 3KOOA 5AM0A 5ALWA 2YBDA 1AQ6A 3K1ZA 1N8NA 5A3SA 3L1UA 4HGOA 3IRUA 1L7NA 3OTQA 1QQ6A 2WFAA 2BDEA 4ZEWA 5ALZA 4AP9A 4YIKA 3UMBA 2B1QA 2WHEA 3CZ4A 2FPRA 3ZTWA 1RQLA 5AVWA 4NWIA 4C4TA 3QUBA 4DFDA 3EF1A 2ZBFA 2O2XA 3VAYA 4B6JA 3U13A 1L8LA 4BX2A 4UW9A 3OCUA 4UU1A 5ALOA 4C4SA 4Y2VA 3PGVA 5AVVA 3ED5A 1QQ5A 5ALMA 3ESQA 4Y3UA 3ONNA 5AI9A 5ALHA 4XPZA 1TJ5A 4YIHA 1U7OA 2WM8A 5AKKA 4YCLA 2P27A 2R8YA 1TJ4A 1ZOLA 4OCZA 5AK3A 5ALQA 4OD0A 1U7PA 5ALRA 3TLMA 3A1EA 3W5AA 3WKEA 2YJ5A 5AI4A 3ET5A 4E88A 3R9KA 1N9KA 5AKHA 2CFRA 3QU4A 2YJ6A 3SF0A 2WF6A 3R09A 5AVRA 3ZVNA 5AESA 4KX3A 1T5SA 4YH1A 4BBJA 4UMVA 1RPZA 1YV9A 3KC2A 2AUTA 4HGPA 1QQ7A 4HAIA 3OPXA 3OCXA 5AW4A 5ALJA 3B9RA 5ALTA 1RKUA 1TA0A 3AR3A 5ALXA 2RB5A 1RKQA 4H1WA 4AS2A 1YS9A 3U7EB 2NYVA 2HOQA 4L6AA 1RLMA 3WK9A 2RBKA 4BEWA 3UMCA 1WPGA 3L8FA 5AM5A 3KZXA 2GFHA 1SWVA 3QX7A 4UMFA 2C9MA 4EZEA 3WK8A 4DW8A 3ZW7A 3WGUA 1VJ5A 5A3RA 2JAOA 3WK6A 1O08A 4BYGA 1TE2A 2P9JA 2EARA 3F9RA 4BKMA 4JDPA 3KBBA 1Q92A 1LVHA 5AICA 2I34A 3U26A 3ET4A 1Z5UA 3J7TA 1RLTA 3L7YA 1VFPA 3B9BA 2HF2A 3A1DA 4PNHA 2JGAA 5T41A 2X4DA 4QQFA 2PKEA 1WR8A 3FPBA 4OHFA 2ZBEA 1Y8AA 5AHXA 4UAVA 2IOFA 2MU2A 1L6RA 1SU4A 4IG4A 5ALYA 3AR8A 4EEKA 5AKLA 3L0BA 3QUQA 1YJ5A 4HYTA 2FPUA 4Y2JA 2B30A 5AVSA 4CF4A 4Y2XA 2HCFA 4FE3A 4O8CA 2ZBDA 3KD3A 2RAVA 3R4CA 4JB3A 3MPOA 1ZD2P 3UM9A 1WVIA 2P11A 3ZTYA 3ZVMA 1SWWA 5AW8A 4EELA 2I7DA 3M9LA 3DDHA 2HDOA 4EX6A 1Z4KA 2YFYA 3U7FB 3D6JA 3L8HA 1KYTA 3QU7A 1QH9A 5ALPA 3AR2A 2HF7A 1PW5A 1Z4NA 1L8OA 2PQ0A 4G9BA 3MC1A 2YJ3A 3QUTA 1L7OA 2CFTA 3ESRA 3WKAA 1U2TA 3U19A 2FUCA 4UAUA 2HEGA 2DQSA 3AR5A 5AVUA 2G06A 1U2SA 2HSZA 2G08A 2NO5A 4CF3A 3N07A 2CN1A 5ALDA 3HYCA 4UU0A 5AKXA 3E8MA 2YMPA 2O9JA 5AW5A 5AKYA 3NALA 1NRWA 2B1RA 2JARA 3DNPA 2ODAA 2AGVA 5ALVA 3A1CA 2BDUA 3EPRA 4UMDA 3NIWA 2NO4A 5ALGA 2ZBGA 5JJBA 3AR4A 1XP5A 5AIAA 3N1UA 2GHTA 2YN4A 3E81A 4FYPA 5A3QA 1EK1A 3ZI4A 2G1AA 1ZD5A 1YNSA 4DWOA 5AVZA 3QYPA 2WF9A 4F71A 2P69A 2R8EA 1S2OA 3GYGA 3SKXA 1WZCA 1LTQA 5AKGA 2FUEA 2WF8A 4ZEVA 2IYEA 2I6XA 1Z4JA 3QLEA 2Q5EA 4FFDA 1ZD4A 5ALFA 1XPJA 1RC8A 3W5DA 5ALLA 1ZJJA 2OA0A 3OCVA 3UMGA 4HGQA 2CFSA 3AR7A 4UARA 4OFZA 3ZU6A 3WK4A 1RMTA 2IA5A 5AVTA 5AVQA 4Y2YA 5FP0A 4G63A 5AW3A 1Z4LA 3QU5A 4I9GA 4BNDB 4DCCA 2B8JA 5AKEA 2B0CA 4NV0A 5AM3A 3ZX4A 1S8OA 1RKVA 4NAVA 4I9FA 5AW2A 2YMLA 4KYTA 1VJRA 3AR9A 5AI5A 3L1VA 2C8KA 4BEVA 3WK7A 1F5SA 4CF5A 1XVIA 1CR6A 2C8LA 2HX1A 3I28A 1RMYA 3DV9A 2IOFK 1K1EA 2FPWA 2JAWA 2W4MA 2YMQA 3ZVLA 4BX3A 4Y2PA 3EWIA 1Z4IA 1T9ZA 2OYCA
chains in the Genus database with same CATH superfamily
1UPAA 1EK2A 2QLTA 3FAHA 1K9SA 2A5GA 1IJBA 3A4VA 3KKZA 2A9VA 4LV8B 4H0CA 5KQRA 2NYAA 1QH0A 2WHPA 4I8XA 5FOQA 2WKRA 1JDPA 4TV9A 4WBXC 3TIVA 2Y27A 3ADOA 3EXIA 2M9NA 2ZJ0A 3DE1X 1SUDA 4EBDA 1E8DA 3SXUB 1SUWA 1ZIYA 3I4FA 3UMYA 3QUCA 1IONA 1J8QA 1TLFA 4N3GA 3UJBA 1Y9ZA 2RHBA 2XZDA 3JASA 4GSKA 2FSHA 4GWGA 3I42A 4KVAA 1G6HA 5LDDC 5C2JB 4ARCA 1G9TA 1THZA 4UB3A 2JBAA 2NVUB 3CPJB 4BQPA 1Q15A 2R6JA 1VE9A 2C4MA 4UM9D 2CZGA 4OKSA 3EEFA 1VZ3A 1QTQA 1JEEA 2ZSDA 1HURA 5E2AA 2O4UX 4P3XA 1TF7A 1GRNA 4O3PA 5KPJA 4GAEA 1RIIA 2Z08A 1UBEA 3I5AA 3EUAA 3I45A 2QENA 3C16C 2FWAA 5EJMA 1MX3A 4HH4A 1G66A 4QFMA 1WCWA 1FVOA 4HGNA 3MT0A 3O4JA 1F3OA 2PZMA 1N9GA 4M1ZA 3ZXYA 1GYPA 5JZBA 4UQOA 4GDMA 3KHKA 2Q5QA 5AUOB 4RH3A 4MULA 4BQNA 2DH6A 5LA6F 1OF1A 3UMFA 1MQSA 4J16A 3PSFA 3OQOA 1SQ0A 1QYWA 3N8GA 4ANFA 4L22A 1B6TA 3O26A 1JEAA 4N47A 1KBUA 1EX1A 5C7IO 4B6GA 5A9SA 1QVAA 3QIVA 4YAJA 1M73E 4K6OA 1F4VA 4RJLA 5KTNA 5A02A 3CX7A 3GRAA 1H9AA 3C3AA 3C8ZA 4JOCA 4PC7A 4Q03A 2J0EA 2G1JA 1QFZA 1QGDA 5GWXA 1UDRA 1ZGCA 3Q6MA 4NH0A 5FT9A 4DJEC 4LJXA 2OFPA 1QIFA 1JI0A 3CURA 5JAOA 3PPIA 3QWHA 1HMPA 1ISMA 1YHNA 2WUFA 4D98A 3OIDA 4DKJA 4II7A 1SC4A 1BW9B 2QRVB 3GR6A 4X8MA 5KYUA 3H8JA 1NW9B 2GPBA 1OWMA 1IK6A 3DL4A 2F43A 3HCPA 3J80A 9MHTA 4DLZA 1ZQKA 4FBTA 3B53X 4JP5A 3V4SA 4CDNA 4C7XA 4XTRA 4I2GA 2DKNA 3TQRA 1YDHA 3ANMA 4D41A 1QIDA 2CL0X 2FZKA 3B3JA 2GJAA 3QTLA 2IYOA 5C3MA 2NO7A 1EVEA 1GPNA 2BGWA 3CRVA 4M0KA 4OKIA 4Y0AA 3U80A 3IEIA 1VHLA 1DDGA 2W6JD 5CTAA 1UCVA 1RRCA 2JASA 1QYIA 3ZU2A 5HR6A 2WT9A 4ED1A 3SHOA 3WIOA 3K15A 1CQZA 2PV7A 2O7QA 3CPEA 2BUCA 5AW9A 4BFWA 5LLDA 1U6KA 4N76A 4W9RA 3H0MB 2Y6UA 1O0CA 3K8QA 3P9IA 3TN7A 3I2JA 4MV8A 4L9SA 1BJRE 2G8LA 3FZQA 1F6WA 1GTZA 3CR7A 1VIDA 4HLNA 1VKOA 2HWXA 3LG2A 4QD3A 2HHVA 3MELA 2RP5A 4YCMA 3PX4A 1ISGA 4ALLA 1U5AA 1E1YA 4WCVA 3E4DA 3VJMA 2OBNA 1COKA 3AVXA 3H13A 1A6SA 1EB9A 3UIEA 1MG0A 3HP1A 1E89A 1QLHA 3JYPA 2IS6A 1GAQA 5JUMA 4N5LA 2VSNA 4C0HA 1Z4MA 5JI3E 4B9LA 3SBEA 5F51A 1IXRC 1ACMA 1OIWA 4H7HA 3FUVA 2WQZA 4DMHA 3HR7A 5L3RA 1N0IA 1CRPA 3NFRA 3KLOA 1JHQA 2IU0A 4J03A 3MWFA 4Q21A 3T3FA 1B0PA 1U2EA 4X1IA 3IBSA 2Q3MA 2XQIA 1KZHA 1N3LA 1DRWA 4HNAB 1P62B 1Q0HA 2JAQA 2JA2A 2QXTA 2Q7XA 3MWLA 3A4TA 5EE1A 1JLRA 3LWMA 1O96B 2Y9TA 1YJXA 4GBJA 4O8ZA 3TOSA 3ZN2A 3PEEA 4NLCA 2O6HA 4DDHA 1NXSA 1OILA 1ZN8A 3PUWA 4YMNA 4GXTA 4YEDA 3ZWQA 3F73A 3TACB 2GD1O 1DJQA 5T8KC 2FEWB 1FVXA 3DO8A 5B1IA 3KHSA 5IAKA 5JXWA 3CJTA 3UKDA 2K87A 3S99A 1Y6RA 2WSSA 3BA6A 1X3LA 2JH1A 5J8YA 1W47A 3FE2A 4RZQA 5NLLA 3K35A 2XOKA 5A5EA 4L4SA 2K4HA 1GTVA 2GF9A 1LFAA 1OYWA 1GPWB 3FDXA 3HABA 1OFUX 1W1WA 3MJHA 1VL0A 2VPWA 4QLBA 5CYPA 1ODIA 2CXNA 2ZG6A 4B6QA 5FH9A 4OKNA 2VDRB 3NOQA 4S1WA 2A86A 2ZUBA 3LC1O 2JCXA 4X61A 4DIDA 1QKIA 4LV6A 4I6JA 2R6AA 5JE8A 3VOBA 5CJ2A 5DO9A 4BDSA 1MEJA 4KYIB 3OMLA 1R9GA 2B98A 3WO1A 3HT3A 4NXNB 1YVDA 4X1OA 1ECBA 3T5DA 3DTYA 5LU9A 3DA8A 2H63A 1GKIA 4PZLA 5LXTB 3V4RA 4V1CB 3KLBA 2HW3A 3ONVA 4OYHA 5AR1A 1XMJA 3EVGA 2YYZA 2DGDA 2ZE6A 4KPFC 3TW8A 4EG7A 5KNBA 1VE6A 4TVSA 2A4KA 4D1YA 2ZVJA 3BIFA 1KFDA 1NVAA 3SIPA 1ZJ5A 2CCGA 1Z7BA 2BGRA 5CA0A 4EGAA 1KFEB 3LKBA 1R0CA 4DLAA 2NTEA 3HSSA 4DCSA 4MW1A 1E3DA 1VCNA 2BAGA 2E2WA 1IY0A 4HPJB 2YB4A 1VHDA 2XCOA 1AHPA 1J2NA 4GKBA 1G8AA 2CYCA 3IAAA 3O94A 3LQYA 3MGGA 3FHLA 1UOOA 5TR9A 1FNCA 3TO5A 3DMNA 4N8SA 2XKBA 4HJXA 4HK4A 4C0ZA 3I9OA 3OE7A 5CX1A 3FHTA 5BR4A 4BWYA 1XLVA 4DLUA 3HDHA 4DSIA 3CMMA 5CA1B 3IEKA 4RPJA 3M89A 1V47A 4ZH4A 1O95C 3ASZA 1QHEA 2CJYA 3IDSA 4JL6A 4L5JA 3PEFA 4RHFA 4X1YA 4NESA 5L51A 1QF6A 5AOCA 2EZUA 4H60A 3PLNA 4HQKA 4U2GA 5DYIA 4KWIA 4DFDA 2G63A 1ZNWA 5JIBA 1OHHA 5EWFA 3ZWWA 1ZM3A 9ICCA 5JC8A 5HP4A 2VJYA 3I12A 4JUCA 2X19A 5ALOA 4Y9TA 2R96A 4PHCA 1PNRA 5HTKA 5EKTA 1QVVA 1OQAA 4NF2A 5CCEA 4G5HA 1YZTA 4JLPA 3U44A 2P1ZA 4HUQB 4UQPA 3HE3A 1ZM9A 3VZCA 3AY7A 3PR4A 1BYIA 1QQTA 3C14C 4O25A 3ZI7A 5AJXA 1XZQA 4YPVA 4YV1A 2VHTA 3CLSC 4UAWA 4DQIA 5KSOA 4U63A 3BXPA 5FHRA 3VH2A 2FE1A 3P8ZA 3W2EA 1Y6ZA 4Y6SA 4BMOB 5D1NA 1E3LA 1LBHA 1LPNA 1U2QA 2HCBA 4FI3F 4OBXA 1ZQHA 1B6GA 4BNUA 2GN0A 3L93A 4O5AA 4EUNA 2Y1IA 2J6CA 2R66A 3E9EA 1U4SA 3I9V1 3C45A 2FJUA 1A72A 3M9MB 1ZZEA 3FNIA 4D44A 3EX7C 3ETJA 4UNRA 4R6WA 5C4GB 5FJJA 1NC3A 1PJ2A 3AX6A 2DJ5A 2PX8A 2FEMA 3K72B 3BWEA 4G9GA 1R0XA 4KK3A 3MIZA 1OUQA 4MQFB 4B34A 4DDWA 3D54D 3S8MA 3TFRA 2EJCA 3SENA 2UVWA 2VZ0A 2WIGA 4PPXA 3A1WA 1FTSA 3CB2A 3KKNA 2Z04A 3T5CA 3VDQA 4ZVPA 1H2XA 3DG9A 2CRXA 2AUTA 2G1UA 4KMRA 4IIGA 2D06A 4IV0A 3T5AA 1N1GA 5IANA 1I7QB 3HGMA 3VHXA 1KARA 3WG9A 4WESB 4G0PA 3HU1A 1E1QA 4J0HA 2YZ2A 2QTGA 8ABPA 2XB4A 2OO5C 4B73A 3R5TA 4ZT7A 3N8NA 3W8NA 2GKSA 3L7NA 2DFTA 1V2HE 4G25A 4ZZ1A 4IJMA 3GRPA 1CLEA 1DI0A 1Y7IA 3O2QB 2DSNA 2QRMA 1P2VA 5ILQA 1VXRA 1SXDA 4PSAA 4CM7A 4LJSA 3N0TA 3LHKA 2XGQA 3SLGA 1PWHA 1SBCA 4F4YA 3DF7A 1EE9A 3JW8A 4I1UA 4P58A 3RTBA 2Z2JA 2W55A 1FVHA 1P3DA 4G1FA 1T6BY 2B78A 3LRPA 1T35A 3NIGB 1FX1A 3B52X 3BZWA 5I45A 1UOEA 1KJ9A 1H1LA 3B7WA 4G8BA 4ZDWA 4FS2A 3EEBA 3FNRA 5TC4A 3IEUA 3ZQ6A 4JBNA 3EXG1 1TJPB 1ZDMA 3I39X 4PC3A 5DRYA 5G0WA 4D5EA 4EEZA 1HORA 4WI1A 1H66A 3M4NA 2TMYA 2RKOA 4HLUA 5E8RA 5A04A 3G9TA 4NOKA 1K4KA 2H9IA 2WC1A 3FUCA 9ICOA 2OBXA 5CDFA 1V37A 2WYWA 3KXLA 2D1YA 1Z5UA 3OEHD 1VG9B 3AHJA 3QWIA 5CUQA 5F76A 3TSZA 3WYAA 4ZT4A 1KZ7B 2NTJA 2F3SA 1M0EA 5DBBA 3WHPA 3TIIA 1QHHB 1NNEA 1II8B 3JWJA 5MN6A 4RK0A 1GT6A 5EWEA 1U49A 1GA6A 2CDAA 3NFYA 4IKOA 1U9JA 5B7NA 1J1UA 1H2EA 3F74A 4H18A 2WQ6A 4URXR 3EDYA 2BTOA 3ESXA 2W2PA 4HQLA 1NN1A 4AUMA 3I64A 4WKPA 4C78A 1XJQA 2VSYA 4GKVA 5SICE 4RNOA 3GFBA 3NHFA 4NAUA 3JYLA 4MW0A 3G0OA 3ETLA 1SU4A 3VPGA 3WADA 2G88A 5EKSA 3MLAA 3RT9A 5FWDA 2FJPA 5B37A 4WECA 3BS5B 4PWZA 2FG7C 3VKFA 4LNHA 2QTWB 4ND2A 3B2EA 1UEJA 2NRWA 5M2QA 5DM1A 3KUUA 2FV8A 3BKXA 1JJBA 1UKYA 4O8CA 3IEXA 1N78A 5G2OA 4D9EA 3R4CA 1JI3A 1PJ8A 3K0CA 2W9AA 4EBBA 1ZCAA 1I7DA 2KS6A 5JY1A 4DM7A 5JAPA 3TNJA 4CQJA 3TF5A 1XDGA 4N6NA 3DB2A 1U11A 2QPOA 3O92A 5ARDA 3HFSA 3A0UA 1M10A 2HRZA 1P91A 2ZI9A 5ESWA 4HVAA 4ASUD 1TUBB 2X15A 4OSPA 1E4VA 1USGA 4ZGGA 3U37A 1BA2A 1ZP6A 1KP9A 4JNCA 4KXNA 5T7BA 2NP6A 4QYIA 4H1UA 2ADMA 1MT0A 2EKDA 1W59A 4DV1B 1G8PA 5HYVA 2DFKB 2BQRA 1ACJA 3HDTA 4L3OA 1ZQRA 5ALPA 4ZYTA 3GG2A 1XAHA 1XRJA 2GJ4A 5KJCA 2CK3D 3PIRA 8ICHA 5IWAB 2NXNA 4MS4A 3TM5A 4OM8A 8ICWA 3UQYS 2XVZA 2NV6A 3QYFA 5EP4A 2O8CA 1ZJ4A 1IHPA 4QGGA 4CDRA 5JNTA 4JIMA 3QUTA 5KTOA 4BNFA 1M8FA 1ZR4A 4BJ5A 5K0SA 5DLYA 3H4TA 4A8HA 1Z15A 2F62A 3LXMA 1E5XA 2VOJA 4B3JA 1EFUA 1PEKE 1YQUA 4C0JA 4TPKA 1SUCA 2ZWMA 3EPPA 2HEGA 2E7ZA 3E23A 2BFPA 1AKMA 2C98A 4OJNA 2G7ZA 1SU6A 3AIIA 3AR5A 5AVUA 1YIOA 2QN3A 5F9FA 4ENQA 1WYGA 2QEQA 2Q9BA 3GLFE 1KFJB 4RPCA 2AFIE 3K7EA 4H6VA 1MQ3A 1VIVA 2CLSA 4LOKA 5IM5A 5KX5A 3HYCA 5AKXA 3RNOA 4EG0A 3RUFA 1PHPA 2IYNA 2OCGA 2FXVA 3EDCA 3MBIA 4MR8B 3KOUA 2VRBA 1PVRA 1YI0A 2VH1A 2FZLA 3NAZA 3GI1A 4ALJA 4C7YA 1DEKA 1PX0A 2IV2X 2ZE7A 3A9UA 4J0JA 1ZLXA 2IYLD 3O84A 3UFBA 2R7MA 5HNKA 4KDRA 5T3YA 4HY3A 4K3VA 5HHHA 3D4PA 1F0YA 5J0WA 1INLA 1FFSA 1SVWA 3D3KA 4JU8A 4PSCA 3ROEA 2GZSA 4I9NA 4E2WA 1L9KA 3I1JA 2CVPA 2PKQO 1FU4A 1Z25A 3DP7A 3DT9A 2AD1A 5ENDA 2X6TA 1KOLA 4YMHA 5GV8A 3TVYA 4TZ6A 1PFVA 4IWXA 2I2CA 2ASJA 4GT1A 4RCYA 4BEBA 2Q3JA 4E03A 3FKJA 2PM8A 2AX3A 1VKZA 5K9ZA 1OWLA 1S2OA 4PU0A 3RWOA 2HA2A 3G49A 1CZNA 5HF9A 4JVLA 3ZHYA 4UTOA 2E5LB 3LGAA 4IF6A 3QLEA 7ICTA 5HOEA 3IP5A 1PV1A 1POXA 2FXIA 4L8FA 4HWGA 4ZVMA 5FL7D 5ALFA 2JZBA 4BFUA 5IVIA 1G0OA 2F00A 4IJWA 4CIBA 4AX8A 5CEJA 1H0HA 5IK2A 4HYEA 3ZU4A 1F0KA 4YR0A 2WHQA 4O5CA 4IY1A 1MIOA 3WK4A 3V8PA 3ZU6A 4ABTA 2BDTA 1GFIA 1N62A 2ASDA 1G2PA 4HWSA 5K3EA 1FYDA 4DMLA 1JT2A 4ZCRA 2GJKA 2ZRIA 1VKJA 3UANA 4ELUA 1O0BA 4LHWA 2YQEA 2F1JA 1Z1BA 4GOJA 1YR1A 1C9YA 2AR0A 2DTXA 4NMXB 1Q0RA 2B4YA 2QX9A 2I62A 3NAQA 4CWAA 3FWPA 3WLIA 2GF2A 3DPIA 4GBED 2C2RA 4E51A 4EYSA 1KE1A 2DZDA 3O83A 5KDOA 2UUOA 4MRAA 4PGAA 4D46A 2BCQA 5IKXA 2RGCA 1GQRA 2MT9A 1W4RA 2I4LA 4RKWA 1Y34E 3V8MA 1O57A 4O4HA 1QHNA 2ONCA 3ZVLA 5FADA 2JLZA 4P2BA 3HJHA 1BS1A 1YR9A 4JQOA 3L05A 4PPGA 3KAJA 3C23A 3A26A 3UG6A 2ZJFA 1QP8A 4XDZA 1Q3VA 4PZNA 9ICUA 1U47A 3O8OB 4JLMA 4NFHA 3I5XA 3SNKA 3ICEA 4M55A 3WA7A 1MB3A 4TLEA 3VHXB 3M5WA 3ZIUA 4GG1A 4AUEA 2LPMA 1BD3A 1U7DA 3GLVA 4Q1CA 2VP0A 3CNBA 3JYHA 5E7IA 4RNCA 2FUNB 4K05A 3ROMA 4C8OA 2FW6A 3A2MA 1NUSA 1QJCA 4W5HA 1UA0A 1OFVA 4MR9B 1EWYA 4B3MB 1WX1A 4KP7A 1K1SA 4P7KA 4TWIA 2J30A 4J9SA 1QOQB 3ENZA 2FK7A 4CMJA 5FI3A 3A1VA 3CEJA 5H59A 4EVSA 1PR2A 2KBFA 1N0UA 1V9SA 4AO6A 1LEHA 1IULA 4BWJA 4B9UA 4MVJD 3GEPA 4BWMA 1CDEA 2NTVA 1L7RA 5EP2A 3JPQA 3AQEA 4MYRA 1I10A 2Y2VA 2EWWA 4QHYA 4S2EA 4ZEXA 2HQOA 3FYSA 4TV8A 5I9NA 2AR9A 4JJGA 1BMQA 2ZYGA 3F0TA 1LDNA 3LY9A 4CU5A 2Z5VA 3GDGA 1DEOA 1VCOA 2NU7A 3RFFA 3TSOA 1J8DA 5C8XA 3MDAA 1A9ZA 3IAS1 3AU6A 3R0QA 4FT4A 2CLDX 5T4HA 4ZYLA 1ULBA 2ZS9A 3RSHA 2AB0A 3PNVA 4J3JA 3QMMA 4I4CA 4DVJA 3IJ5A 3EXAA 1D2AA 4XGQA 4LISA 4J1QA 3BFKA 5LMCA 1M0WA 5LQNA 2VTBB 1XO0A 1S7CA 1L5OA 1Z6GA 1Z6ZA 3HU2A 1ZVJA 3IIKA 4KIJA 4WACA 4EHKA 2JJ1D 4V1CI 2BP7B 4LBYA 2Q2OA 3I2FA 2MTBA 1DV1A 2OO5A 1JQLB 4FCVA 4FW9A 3B9JA 1G5FA 3DBLB 4I2AA 3GXBA 1KPGA 3L02A 4GPZA 1I8TA 2K8BB 3LVRE 5G4KB 3EISA 3LWNA 1K86A 1XSNA 1Q95A 4TT3A 1R18A 3QE4A 4RZ2A 2F55A 2W54A 3I1YA 7ICSA 5TGTA 4CODB 1EUYA 2PWBA 1Q7GA 4IRMA 3SCZA 2D0DA 5ALEA 5KG3A 3A14A 1TMGE 4CL3A 3C5GA 2QAGB 2XXAB 4HS4A 3HPRA 2IWHA 2I7VA 1AQYA 4GSYA 1UBOS 1R4NB 1T9BA 2B5WA 3IODA 3QXCA 4L4UA 1VE3A 2C9BA 4P38A 3F8SA 4DLYA 1LNZA 4GIBA 1P0CA 3EXIB 2BEVA 3PUJA 3ACBA 1Y81A 1ZUNB 1GU7A 2I3GA 2I4TA 1EAYA 3SC3A 1N2HA 1C1XB 4MB6A 2VDJA 2DLDA 4XOUA 5ER9A 3TR6A 3VC2A 3ZWOA 5IPFA 3RV3A 4QDXA 2XUGA 3FLEA 4PICA 5CB6A 2JIZA 2AQHA 2F48A 2VHZA 2AI1A 1E5DA 1RLUA 2ORVA 3T7KA 4LVNA 2FEXA 3U7QB 5I7UA 3V3KA 1EEXB 5DB8A 1ECWA 1DT5A 3SX2A 3TW8B 2M2IA 3V6MA 2A94A 4JX8A 1NXOA 3OT1B 1GO3F 1M6VB 2DL0A 2HA4A 3TAXA 3ZVRA 5HKBA 1YK0A 4BNZA 1DCTA 2AMYA 3AJAA 4G65A 3H0LB 3TGWA 3PQ7A 1Z4OA 3C97A 5I7RA 3E2PA 1B8OA 2AS0A 4E4TA 1E9BA 1VDZA 1NV9A 3GRFA 4BKRA 1KETA 3BQNB 3IGFA 3CVWA 4B5KA 4HSEA 2P75A 3ADKA 3REFA 3AFGA 1UMDB 3SHQA 4IQ0A 3K9FC 3QFRA 1AJEA 2D4AA 4TS9A 1U9IC 4DSJA 1N6LA 4O2LA 2FSVA 4GM0A 2A0FA 4I3FA 2GETA 5I47A 4EG5A 4KSBA 1MABA 1BMFD 3DE3X 3ZV4A 5IN4A 3D3NA 3IV7A 4JDUA 2BKAA 3K3PA 4G8DA 4CHTA 5B1YA 1UT5A 1WTAA 3UC9A 3KXIA 3M49A 1XRPA 4HNRA 2JBHA 3BRWA 3LNTA 4UC0A 3RFUA 3ROQA 4PQFA 4AKEA 2FPSA 1FPMA 3MWYW 4I14A 4RFSB 2QRGA 2B8WA 3I09A 3NV7A 3ZWMA 3F3YA 1NFQA 4Q4JB 5C8VA 4XEHA 2VJNA 3OX4A 1G19A 2IEIA 4R8LA 4RPHA 4PIVA 1C7JA 2XUJA 4Z2AA 2P6PA 5BPHA 1MRSA 4L4YA 1CQPA 3ZE0B 1AO0A 2JI8A 5L1IA 4HI0E 1VSTA 4B3HA 2C9CA 4HNUA 4DV7B 3IAUA 1X9IA 5LD2C 2BRUA 1W0KD 3TINA 4ZJUA 4BVBA 3OTOB 4JJ6A 3AXSA 2FN4A 4WXMA 3W79A 3ZCXA 1LK5A 2V3WA 2WAAA 3L4BC 4IIJF 2EQ5A 2OFFA 3AERA 4IUYA 3RQSA 2EFYA 2O8CB 2YZNA 1K2WA 1DJNA 2FWMX 2X9QA 3B89A 3NLLA 4MZXA 2A1JA 1WMFA 5JSYA 4PM4A 3VR2A 4ESOA 5BOSA 1B8NA 1IC6A 2Z57A 3QPCA 3AUOA 2QG6A 2R1VA 1PZGA 2VRNA 2FWPA 4ZWNA 1E3SA 3VBCA 1P9WA 4QOGA 4FS1A 2FSSA 3G6YA 1U8UA 1Z75A 1LGYA 3GEDA 4LG1A 3UT5B 1HEKA 1RPJA 2O14A 3NYWA 1BD4A 2WAXA 4B3IA 3KR2A 4D8UA 4ZGWA 5H2FU 3GGGA 1XCPA 1Y82A 3KQYA 1WCIA 1FJHA 1GP2A 1TAHA 2GZHA 1EI9A 2DUNA 4D9FA 2B6NA 5DKWA 3QPWA 4ZCIA 1T43A 5BORA 2FI1A 3T3DA 3TTXA 4ZOBA 4ZU3A 2G3YA 3E3AA 2V7QA 1GSHA 1AO3A 4QSHA 3EASA 4E5YA 5TY0A 1ADJA 3WNBA 3GJ0A 2IOQA 1JDTA 4U2FA 4DUGA 1M9NA 2ON6A 2Q28A 2CDCA 1YS4A 2K4IA 4Z6FA 5IAEA 2YBDA 4GLLA 4LDQA 3A8TA 3I9LA 4OAOA 3MUEA 2BONA 2GHRA 4LK3A 5IJ9B 4XQ8A 1SVNA 1ODSA 1L7NA 3FH0A 3G0GA 4GEKA 4D9BA 1KL7A 4MMXB 2BFDA 2QTVB 4NP6A 3TZ6A 2J9RA 5ICEA 4EAAA 4O2AA 4NWIA 1UXOA 2ZI4A 2X1LA 2X22A 3DHVA 3KWLA 4J7UA 1TC1A 4KDFA 1NRXA 3MMPA 4ZU6X 2X0DA 3UV3A 5LWQA 3THWA 4OX9Y 1JEYA 1HYHA 4MV6A 3SE0A 1DO0A 4O4JA 3NH9A 3OLZA 1ECFA 4J3FA 4NECA 4WZZA 1N33B 2N0SA 3AEYA 3CZ5A 3KB8A 4HDKB 1RWWA 5AXDA 3DWFA 2R1TB 4ML3A 4D25A 2EBUA 4YHBA 2ZQZA 5AI9A 5CHGA 2HMVA 2UVDA 1MOZA 2GUGA 1ATZA 3F53A 3L7MA 3HBAA 3DMDA 4KIGA 3T38A 4JLUA 2Y1DA 3DOOA 4QPZA 1D5CA 3EMVA 5AKKA 1ZJWA 4UBNA 1AF4A 2R8YA 4II3A 1OA0A 1JG4A 4XD2A 4FEAA 5CDSA 2JV3A 4RSMA 4EG3A 4ZO8A 1DBWA 2C2GA 4B35A 1EM8A 4PBRA 5B1SA 4BLSA 3EGXB 3O3NB 1RAGA 4JIGA 4NKRA 4B3XA 5CMLA 4FBMA 1SB8A 1T36A 2TS1A 1KU0A 4AY4A 3EFOA 4C0KA 3BICA 5HUJA 3RS9A 1G5RA 4DG9A 1V7PC 2H8KA 3KALA 4DSEA 1BVYF 2J3MA 4FZJA 2ZSBA 1EGMB 1R66A 1LRLA 3OOSA 2BP7A 2W0SA 3PD1A 5T4EA 3TD2A 3D6FA 4HAZA 3PB3A 4IKEA 4UREA 1G16A 4B6PA 5LBIA 4A8JA 3M1AA 4UHHA 2VYCA 1L5YA 3Q72A 3TKYA 1DAEA 2JGNA 1GEEA 2Y4OA 2F44A 4JAVC 4ZVSA 4MHVA 3JX9A 4P36A 2J48A 4MMZB 1GFWA 1T91A 3PRKE 4M8IA 1QQ7A 3ETRA 4A0QA 1Z07A 2GOLA 1PR9A 2B2XA 2Q6LA 4TV8B 2HU2A 1RKUA 4LVCA 4ZQHA 4TV9B 4E15A 1MVOA 1P0IA 1XC7A 2XNJA 3GJ3A 1RADA 9ICVA 1HL3A 4OMCA 4NJ8A 3UGTA 2FFJA 3DVQX 4YMTA 5CXSA 1SVIA 2W8LA 2GCNA 3R5FA 4G5QA 3WK9A 4NPAA 5E9QA 3ONWA 4OL0A 4R2LA 1ZQPA 4Q16A 5C1OA 4JJIA 5JD5A 3TGPA 2QB1A 1E1CA 5KFRA 4QNMA 3KUDA 4IS2A 4JI8B 1C30B 3H4MA 3QX7A 5TV2A 4KPEC 3OLXA 5IUKC 3QMPA 4J1NA 1QE3A 3PZBA 4BL5A 3LJKA 1MTOA 3LSYA 5F1KA 3A1SA 5A3RA 3WK6A 3ZHSA 2RH5A 4JI7B 2C59A 5HKAA 1A7AA 3QKSA 5CBPB 1GSOA 2DQ4A 5IAOA 1R9NA 2HZBA 2OG2A 4DIMA 4JGIA 4KGVA 2GTPA 2XWBF 5J58A 1EH5A 1LVHA 1XJ0A 3G5UA 1HO3A 1ZU4A 4LX8A 4ZYXA 1CJTC 1E0SA 3WAGA 3LHDA 3WDLA 4I1PA 1Z7GA 3J7TA 1JHUA 3R20A 4XWWA 1Z6YA 4R8UA 7ICQA 3WLMA 2B1GA 1TJYA 2IEZA 5L3SA 3VHLB 1KFBB 1W581 3DEAA 4UFNA 5L1KA 3KB1A 2ZRLA 2P5TB 3BJEA 3FTCA 3QVLA 5KNBH 1X1CA 5KFLA 2Z2KA 1O54A 1CXZA 3AY3A 2W2KB 3IQFA 3N75A 1Y9JA 2EG9A 1BRMA 1Z6QA 4H4EA 4BHTA 4N5HX 3GEIA 3QVKA 2R7AA 2VJOA 2Z1MA 4PIPA 4UAVA 4CKWA 1N8SA 3RAXA 2OUKA 4Y7CA 2IOFA 3D7LA 4MUGA 1W1UA 5ECYA 3O38A 5SYAA 2CNKA 4IG4A 4HDNA 3DONA 2BPCA 4IQWA 2I1WA 3A6DA 4HYTA 4N5DA 4UCFA 1W5EA 5DTEA 3CNQS 2ZITA 1V1RB 2PUWA 2I2BA 5BSRA 5A5VA 3O3CA 3UHJA 4AX4A 1O8BA 4YUAA 2BFWA 3CU5A 5DN6D 4PGXA 2C2KA 2A67A 2GBPA 4EGFA 3ETCA 4BNKA 2XYHA 4PGMA 2JH7A 4AQ7A 4KVGA 1LD3A 5G1OA 3HMKA 2JEIA 1NA5A 2WWRA 5KWSA 4GXRA 4YRTA 5K7SA 4PNZA 1GPAA 3A3KA 3C8MA 5JRDS 4S12A 3ZBTA 1UXGA 1VMDA 4A16A 5FXMA 3RTDA 1ZNYA 3N2KA 2G7MC 5LLTA 1S2NA 2BHTA 3C3JA 4WIAA 3L6OO 1EFAA 2N46A 4OL9A 1NW8A 1E2PA 1YJQA 4R3UC 3SF8A 2WOOA 1GN9A 3V34A 4IOJA 1U4NA 2XDAA 1H65A 1L3TA 4OATA 3BH6A 1RCTE 3UOWA 5FYDA 1E9AA 3KJNA 1LF0A 2QK4A 4G07A 4LY6A 2IYYA 3TG2A 5IVHA 3HFGA 3RVNA 2F67A 4UVGA 1PGOA 1RG6A 1ODJA 3HP7A 4BFVA 5JROA 2ESRA 3UPUA 2J3QA 1D7OA 1GUDA 3W4JA 2O7NA 2VWPA 5DULA 1QM5A 2Z2IA 5JS6A 4WPGA 1DBRA 1R0YA 5DZSA 1Y33E 4DRYA 1Z2AA 8ICKA 1UBUS 3AEZA 4JBGA 4ZRDA 3ZLBA 5FWNA 4G3IA 4OYRA 3GVXA 5HHIA 3M8KA 2VJKA 1RRMA 2XVMA 1IXSB 1YB7A 2P5SA 2P2ZA 2X3YA 2XYVA 3ILVA 1V5GA 1PTKA 3JD4A 1E3JA 1JECA 1O96A 2NO5A 1SVOA 1ZGJA 2OCYC 3L6BA 2QGZA 1SZCA 4GS5A 1V43A 3TI0A 1NN0A 4MUYA 5HFJA 4E2XA 3C6KA 4N48A 4PSDA 1KO1A 3LP8A 2PYZA 3IN5A 3D3JA 4WLNA 3CW2C 2F3RA 2QAJA 3KWMA 4IOKA 1AGRA 1Z45A 5DSZA 5FOXA 5H3LA 5SZHB 1QWSA 3BGWA 1ZA2A 1YU6A 3FFXA 3MTJA 4HRAA 4N3NA 5PGMA 5A5GA 5HSGA 1HZJA 1HSZA 4RSHA 3F49S 1GNLA 3LUBA 4XPIA 5FPYA 1AMNA 2ZATA 4XJVA 1I4OA 2EAMA 4CMHA 4CFYA 2QTMA 2N9UA 4QZAA 2RHJA 1W75A 3C85A 3W6NA 4L8GA 3MINB 2NO4A 3ZZMA 4ATNA 3TDNA 3O8RA 3AR4A 3AI3A 2ZTDA 4R1OA 1PJAA 2PTHA 1FLVA 4DLEA 5KFTA 2BFFB 2NVWA 4MS4B 5I9IA 3C7DB 4E5NA 1M2WA 3ZE8A 1BIFA 2I91A 3DO5A 2WJYA 3QI2A 3K09C 2PY6A 3EGWA 3EMDA 2OZVA 1P7VA 4DS3A 4ARIA 1QAQA 3ND8A 3EZLA 2FW0A 1YACA 5H4HA 3L4PA 3ITNA 2OCEA 1VM6A 4UBBA 3K0BA 4CMIA 1C81A 4J4TA 5HR5A 1QVZA 4DWWA 3BHNA 1NYQA 1ZSVA 4RY2A 3E18A 1JL3A 4EKDA 1MHTA 4QDZA 4R2WA 2VHEA 4AECA 4DA7A 4AL4A 1ETUA 3HB9A 3K0SA 3WLOA 2I9PA 1R7RA 2AQ0A 1W52X 1YVUA 2GHIA 2O0HA 2YV5A 2QQFA 2XAAA 3N5CA 4HB3A 3AM9A 1OZGA 2XIQA 1CUXA 1RYEA 2REXB 3CBGA 1XV5A 4RK7A 4RKEA 4BQEA 4HGQA 3UTDA 4B17A 1NYLA 2XMQA 4OGGA 4MIKA 3CX6A 1VRWA 3ZR4B 1WW8A 1BG6A 4P9NA 5G1NA 3MTBA 1CUFA 4A91A 4BLPA 3GRYA 1P1JA 2AR7A 3IA7A 4IFBA 3U3OA 5A4MS 3KB6A 3N2GB 4UAJA 4WNYA 2I6FA 1T3TA 1U63A 4IH9A 4UXIA 4XI9A 1FBTA 2GPSA 1PHRA 4FCWA 2IYWA 1BOOA 1NW4A 4X1KB 3R6DA 3T1QA 5LMUB 4DC0A 2VSOA 4DLTA 2V9PA 2CMGA 3LUHA 4H31A 5AOBA 5CVTA 4J43A 5FV7A 1VBFA 1X1DA 1PS9A 2FGJA 3CLRD 1T0HB 4AZ3B 1B41A 1NASA 1ZK1A 2W2KA 2EU8A 1O6ZA 5CW1A 1FXWA 1Q83A 3G0CA 4Z1MA 3U3KA 4FB4A 2AOWA 1CRLA 2VQEB 2IOFK 2PRZA 4RLQA 2XMSA 4G5RA 4ND1A 2JVIA 5EZYB 4AKHA 5HMMA 1ZQVA 1I3MA 1C0IA 3QPVA 2DUJA 3Q9NA 1IBSA 5J2UA 2LRHA 2BLNA 4PZEA 2QYOA 4GP9A 1JIJA 3SEQA 3VH4A 1QF9A 3EAGA 3PJEA 5EOVA 2G5PA 3ANTA 4LEIA 4X54A 1GZUA 4YN4A 4HFNA 2CHVA 4WY2A 2YWXA 4Y2RA 5BN5B 5FBZA 1C3EA 5FBQB 2FG5A 1HMYA 1RLJA 3F8TA 3KR1A 2GESA 5JYEA 4JLBA 1DADA 1MC5A 1RZVA 1KOGA 2CPRA 5AJUA 5DGDA 4YR2A 2FN8A 1NDQA 4IO1A 4QJBA 1DQPA 1GVHA 3D02A 1VBNA 4U7FA 4BUCA 1ZQBA 3OM1A 3UT0A 5ADVA 3HA7A 2XDYA 3PX7A 1OV4A 3RB6A 1HKHA 3KCQA 2ZXEA 2WVJA 3OF2A 4YK7A 1SXGA 1H2HA 1XD2A 4K81B 3LVVA 2IBMA 1ENOA 5D01A 4Z99A 2Y2UA 5KG7A 4R8RA 5DSTA 2NMVA 1DOAA 5E6RA 3PTZA 1MW8X 1B43A 4KLOA 1D1PA 3H18A 1RDFA 1T5OA 5JC1A 5BV2P 1C7IA 2J3IA 2VHJA 1JF8A 3RE1A 4L08A 4UE2A 4WEQA 3PX6A 4ECUA 4EM6A 2Y1OA 3UXMA 3W8EA 4R2KA 2CVZA 2H5LA 3BMCA 1BPEA 3D7KA 1C3VA 3C39A 3ZWPA 3RSQA 3ZQKA 2BEUA 2R8BA 1QC5A 1W2WB 1U99A 4GYJA 4I2VA 4BVKA 3WOHA 4EY8A 4KREA 3R77A 1TI7A 3EZYA 3HN7A 1Z5GA 3ZW8A 4G4GA 2K7ZA 1RJWA 3P9ZA 4EH1A 4RKRA 3ZDQA 4EWLA 5CVVA 4HZIA 1PNVA 2NQ2C 4HZGA 2YOGA 4IQFA 3T9AA 4DCGA 3O8CA 1TTTA 4QHTA 3FLAA 5C8YA 1CQWA 1HDCA 2F2AB 1RWMA 1P4HA 4QBGB 3PUXA 4EBCA 4QYIB 4YAWA 3V4VB 1GYQA 2WIAA 4B3BA 4Z3OA 4HMQA 4Z4IA 2SICE 1QHYA 3CZPA 1V26A 1R88A 2LR0A 4RJIA 1P2FA 2IS4A 4JB8A 5AM2A 1SFRA 3DBLA 1AA6A 2V6JA 4FZRA 3V6JA 2HM7A 3PFHA 1VOTA 2E89A 1HTBA 3GBVA 1E77A 3NP9A 4KGXA 3RBZA 3T54A 1BAPA 2VDLB 1BQ3A 1QUEA 2VQ6A 2OH2A 3VO8A 3UMSA 2HGZA 1YUBA 4YRLA 5J4KA 4YVFA 2E8PA 4A6XA 3R3XA 2XUPA 1K5GA 1UPUA 4I4NA 4XWTA 2O2YA 4FQ5A 4JYMA 2W04A 3PSPA 2XAUA 1GUFA 3LTEA 3PXEA 4XRGA 2WAYA 3QKWA 1YDFA 1RJGA 1K2VN 4AZWA 1C80A 2O3QA 3LWBA 4A03A 2UZ1A 5K8IA 4JJ4A 1FTYA 1LV8A 3W5VA 3M83A 4HBZA 4UCWA 4C7MA 9ICXA 4E32A 3VR1A 1JG2A 1JEDA 3O75A 1HNXB 3DQQA 5DP1A 3STXA 3HG7A 3OPNA 3ONDA 1XMSA 3KP1A 2Y0DA 3LHIA 5DWQA 2YCLA 1KI6B 1NI3A 1C4WA 4D4IA 1YR2A 2ID8A 1GNPA 4I8IA 1W19A 1ZKMA 4RPXA 2MR5A 4DWJA 1KIFA 1K27A 2GO1A 1I3CA 2A58A 2QL9A 1KORA 5LKRA 3UB4A 1XCMA 4G97A 2VA8A 1RRVA 3R0VA 4PLZA 4ZQIA 5ER6A 3L8MA 3LWLA 1IB0A 2XODA 4EARA 3P0HA 3O0FA 5CWRA 1AZLA 1HETA 1JHPA 2NLOA 2R25B 4HNHA 1L5KA 2VPQA 3O3OB 3C21A 1KP3A 2DPLA 2JF0A 4HLDA 1FA9A 1JR3A 4LJ4A 1RHQA 3MGVA 4A5OA 4BNJA 3PK0A 1QHFA 1NSTA 2QSYA 1Q1BA 2ODNA 1F8YA 2W6CX 3M9NB 1W0CA 4RVOA 4UKDA 3EB9A 3NANA 1ZD3A 3G1UA 4XGNA 1T6ZA 2O2SA 2CUKA 4B4UA 1N63A 3F5QA 2ZCUA 4ACAA 2H3QA 2KI5A 4MUAA 5JCJA 3TQOA 1E63A 2O2HA 1ZQMA 5KKCA 1BVSA 1DARA 5C8ZA 3HYTA 3EGOA 4EHLA 2C83A 3CVUA 3QVTA 5A3JA 1KO5A 1SZPA 1KRHA 3D3QA 2WEKA 1GGHA 2PD6A 3D3EA 1TM4E 2XRYA 1W0JD 3N0XA 4FN4A 1TYZA 3I30X 2PGXA 3ORHA 4BFYA 4DAOA 3KQPA 1ZGBA 3M5CA 1N25A 2GNAA 2IPXA 2WD7B 2XT9A 3DR3A 1AUVA 2JAPA 3EF0A 2OGTA 4CLDA 2BBOA 4JEIA 3VR6A 1PR5A 4Z54A 2AZXA 2QD1A 3EK2A 3GUYA 2YV3A 3SZUA 2EZYA 4QXQA 4A0GA 5KYWB 4CM9D 4KLGA 1OH5A 2GEKA 5KFHA 3NP7A 4DJDC 1Q2UA 3EXEA 1Q1EA 3V1UA 2QLLA 3ORQA 3MJCA 4O3RA 3EHDA 3M6KA 4QG3A 5LPNA 3C28A 2HSEA 2RCYA 3H05A 1CY7A 3RVSA 3M9XA 2R6FA 4Q1BA 4EDHA 1NOMA 2VJPA 2FZVA 2WJVA 4LPSA 4XDHA 3LVQE 1P6XA 1ZMTA 1PLLA 3RU2A 1K75A 3WRYC 4HT3B 2WJ6A 4G1MB 2Q27A 2ZSEA 3FFAA 2F64A 4BTEA 5IT4A 4UZSA 2H3ZA 1KJ8A 1KA9H 3ETHA 4N9WA 2KMDA 1PTJC 2ZIZA 2BKVA 4ZMRA 3L1HA 1W5TA 3INGA 3O74A 1NXXA 1K63A 4K4GA 4RQ2A 1NLUA 2H08A 5AM0A 3H75A 3T6KA 3T7CA 5EG5A 9ICQA 1RBZA 1X80B 1YCFA 2D4HA 2GYVA 4AS1A 1QZTA 3RB3A 3KD2A 1N8NA 3THOA 3IUYA 5J2TA 1PGNA 2YRFA 4DV0B 2FDCA 1OXVA 5DXFA 3EWAA 4EPRA 2O8DB 1TGVA 1XMQB 3BS7A 4QWCA 3UUWA 1NR5A 4TWRA 1GU0A 2Q6IA 2DR3A 3CO0S 1SHUX 3AEKB 1SPXA 3FETA 3GJ7A 3G6KA 3K5PA 1ISIA 3H5OA 4PQEA 3TXXA 3TQQA 4E1BA 4M0FA 4ZTBA 1YWGO 1W7AA 1WBBA 4BCCA 4OMFG 4DCNA 5DBGA 2QPTA 4DN6A 2R8IA 4F93B 1J5XA 2PE5A 2ZBFA 3VAYA 2O6KA 3EBLA 4IPTA 4UUMA 3PQFA 3W05A 4IQ4A 2KN7A 4ACBA 2K89A 1Z74A 1KZ1A 1LTHR 3QKTA 2HHHB 2JEGA 1YD7A 1JU4A 5C35A 4FW8A 3E7FA 1FRVA 4MVJA 4D3FA 4MP3A 4P93A 2Y0BA 1R4MA 3Q6IA 3LQRA 5A6SB 3DEFA 3BQ0A 4TWAA 2HDNB 4Q34A 4JBWA 2WHPB 2V3VA 3REQA 3T4UA 3ZWYA 5GZ3A 4BASA 2FMFA 1PE0A 4PCAA 5K0TA 3CQ9A 3AW9A 1IOVA 4F6RA 4CCHA 3MGCA 1ZYQA 1KAOA 1TVCA 1FXSA 3EXHA 1PLJA 2LI6A 2D3DA 1KSHA 2FK8A 1SKQA 3QK7A 4TTVA 1RC0A 3I2IA 4B75A 5DYYA 5J47A 1SL0A 1EUQA 1E59A 4AF7A 4BKQA 1VDVA 1ZITA 3L8YA 4LQ4A 4F5ZA 1W6RA 1HXHA 5BSTA 2CL5A 1C7ZA 2CLOB 3H65A 2ZRDA 1S4MA 5KYWA 3RJKA 2YJ5A 3GN2A 2XRMA 1WZEA 4MI9A 3GDHA 4E88A 3MHTA 1R3DA 3ABIA 2KWIA 2YIDA 1N9KA 5FA5A 4R41A 4GPTA 5LXTA 3GQCA 2HIMA 2O0JA 2Y9PB 1R8JA 3N0VA 1NKBA 1LH0A 1VG1A 2XT6A 1ZQ1C 4J7XA 1PNOA 1ZH0A 1KVQA 1N34B 4F5NA 1D2NA 1WMEA 2EJVA 4NEHB 4RNNA 1NVVR 3HNOA 4HDMB 4P5PA 2DPJA 3VKVA 3EDQA 2G83A 2I65A 2I22A 4X41A 4IXTA 4BP9A 1U90A 5DHUA 1EDOA 5HRCA 1QGUB 4IIYA 1RPAA 5B64A 3HEBA 1HDEA 2NU7B 3TW0A 5HF5A 2WAQC 4EI8A 5LB2A 2DVMA 1IY1A 2QN7A 2CHGA 1WW2A 2VWQA 3B70A 1PR6A 2VP9A 1IUPA 2RJOA 3IFSA 4KAXA 4NMMA 5EP1A 1S01A 1S0VA 2CVHA 1MC1A 2NXCA 1FL9A 4PGYA 2V7UA 1A2BA 3LXXA 4A2CA 4A2QA 1PYDA 3C3XA 3ZG6A 4A92A 2NVUA 3NBUA 3L8FA 3WQBA 3PQ3A 4UDOA 4MFCA 3AFHA 1I4DD 4HWKA 1G1AA 3SZLA 1HE5A 2LCFA 4N5IX 7ICVA 1FK8A 1QCZA 2PR2A 2GCGA 2FZ4A 2UZ0A 3E9CA 3EQ9A 2VPTA 4RIHA 4D0LB 4ESHA 4AN1A 3HMQA 3WIEA 4ECAA 1DINA 2GX6A 4NYIQ 2PGDA 1PT6A 1KS9A 2AU0A 4TWBA 3B5EA 3LVBA 3SEAA 3FJ1A 1JPVA 1CF2O 2C57A 1DKLA 4FNMA 1J2EA 4BWVA 5IC5A 5HK9A 4POAA 2D8CA 3OZFA 3WSVA 5AICA 1ED1A 1QO7A 2C5BA 2C0QA 1OBHA 1KKLA 5ESXA 1CC1S 1DLIA 2AF4C 2ZYHA 4HEA6 3A6KA 1N6IA 3OLWA 1PEAA 4OXQA 3RH0A 3ZYCA 3ZJ5A 4IRXA 1NJ8A 2LGJA 3IPXA 3PC2A 3I9MA 1DKPA 1TADA 1I33A 1K3TA 1TQ8A 1SHLA 2WV7A 3CRW1 1DXSA 4QQFA 5FUQA 4L3VA 4R9VA 4OHFA 5TXGA 4IC9A 2GXAA 1V39A 2W6ZA 2QTCA 3U7JA 3RODA 4ER3A 3RAFC 3IERA 1C1DB 1UP7A 4E1VA 3N6XA 1HRDA 2VK8A 2PI4A 2KM1A 1H3FA 4TTQA 2DRIA 2AYZA 4BVFA 4Y2JA 2D00A 4HRXA 1UFOA 5AVSA 3GLGE 1F6DA 4Q4HA 3GLGB 1CUEA 2GZDA 2ZSUA 1I14A 1LC0A 5CDHA 1LV5A 1P61B 4JB3A 1WMDA 2R48A 2RI6A 1RT9A 1L1RA 4CTNA 2NO1A 2PPVA 1C9EA 1YA4A 1IZZA 1CWUA 1U3FA 1VPEA 2ZR0A 3CY6A 3OQPA 3PX0A 1RI2A 2JFPA 1DG1G 4IIEA 2W6JA 4OM7A 2EFHB 3T7TA 1XXHE 9ICJA 3WL8A 4BQQA 2EV9A 1C8BA 4M21A 1A8PA 2KZZA 4PH5A 3AESA 3IULA 3OZUA 3OOJA 1W5FA 5EHZA 1D7AA 1P0FA 4UB1A 3COVA 4DQKA 2GPTA 3CJRA 1JB1A 4WXRA 5FBRB 4NBWA 2WHYA 2WINI 3M6LA 4BVAA 3RYTC 4B32A 5FI5A 4NCHA 2HY7A 4AMGA 2M98A 4ARBA 2W22A 1AN9A 4HP8A 2Z95A 4FU0A 3LE8A 4WJ3B 4GYYA 4MR7A 4HUTA 4YXWD 1BTOA 4C8KA 4EQ6A 2QV0A 4IEIA 4FJ2A 1R0SA 1U8AA 5DBOA 3HLKA 3P0JA 1T5BA 3AT1A 4NMHA 2IIQA 2CFTA 1YCGA 2Y8EA 5I9SA 1I3LA 1A8SA 5AHKA 2GAAA 3D6TB 3DL7A 4DOAA 2LM4A 2XVTA 5IXSA 4J94A 1U2TA 4UDNA 3TW6A 4HNTA 3IQWA 5TGDA 1R4AA 3F2IA 4UZFA 1F4LA 3WGGA 5IBRA 2A14A 4QLAA 3V8BA 2HCJB 4B84A 1S02A 1T4MA 4Q44A 1Z0AA 3BWXA 3GK3A 4FKMA 4B3CA 4BMXA 1ZEMA 4B7CA 2MA1A 5M34A 3L79A 3IUQA 5IDWA 5JD6A 1W48A 1QU2A 1R15A 3JYNA 1JFRA 1MEEA 1MNQA 5FWYB 4I50B 1O5TA 1F38A 3DDUA 5JCOA 3WGOA 3DNMA 3DWGA 1L4HA 1FFCA 4IIJA 2C29D 1XTUA 4NZOA 3DMTC 5DGHA 2F1RA 5JJIA 3IT0A 1JS1X 1FLAA 2B1RA 3LIPA 2J0VA 5FNVB 3WFZA 4BX9A 4E13A 3DBHB 1RWOA 4CM9A 3H2JA 4IQUA 2Q9CA 1USKA 3TJZA 3L3BA 3MNFA 4M0PA 1L6IA 4ZC1A 4RO0A 4KZKA 2JH8A 4Q8FA 5JDIC 1B16A 5M5BA 1RAAA 2IUYA 2YHUA 2Z58A 3HEAA 3KZNA 4Q3LA 3HZRA 3F2CA 4WA7A 5DGBA 2IYPA 2OD2A 3LVFO 3QBJA 2O19A 1GILA 3VYWA 3G23A 1GL6A 2EOAA 1JILA 2KOBA 1RM6C 4DQSA 4MV5A 4MVJE 4UCXA 5GJVC 3T9BA 5I7VA 4CQNA 1ZD5A 2QKYA 4RACA 4A82A 1EIWA 3RROA 1ZETA 3L6EA 1DQNA 4B79A 3IHQB 3C6QA 3IIJA 1CQJA 1N5RA 2Z2YA 1MAHA 2LXNA 4L02A 4Q4JA 4MYTA 4PZ9A 3EXFA 1J8YF 2FUEA 2WUGA 4MB2A 1XP8A 4RKYA 5TJHA 2HADA 3W2TA 3LV8A 1NJ2A 4UOEA 2A8YA 4WCDA 1Y1LA 3MEQA 2HRRA 4YXJA 4GM1A 1M66A 3UAYA 1C4KA 3PNSA 4OUKX 3SOZA 1Y1PA 2JI6A 3VNUA 2XZLA 1MOQA 4U0JA 3C6BA 4NZPA 4RIEA 3ZE1B 1IPFA 4YRAA 2H4YA 1GNVA 5CD1A 4XRRA 1LI7A 2IY8A 3MTEA 1VTKA 2D1FA 2FMKA 3O90A 3C3DA 4PLHA 2Y1WA 4EI9A 1XJ5A 2EFCB 3U6KA 3FYUA 2JIOA 4GU5A 2B3DA 3W90A 1ECCA 4RA6A 1ZYUA 2HLDA 3K1TA 4XFJA 4XWYA 1FZTA 2I6QA 4RT2A 2A5LA 1EWVA 2VF7A 1FYFA 1NAIA 2I66A 2YC2C 5EA2A 1WCXA 4BNDB 3CN9A 3OM0A 3LLVA 3Q5DA 1UIMA 1L7BA 4MTCA 1OFTA 3F3MA 1IMOA 2W93A 4MHTA 3EVDA 4ZC8A 1P4AA 1TYDE 2VWHA 3PR3A 4US8A 1F44A 2CNDA 3GHYA 2HUNA 4P1ZA 2X3UA 1SXEA 2YHIB 3C3PA 3D8TA 3FPHA 2V6FA 3MGBA 4LWPA 4ZCPA 5C0OE 5H70A 4CR7A 5A5DA 1WB9A 3FBWA 4X94A 1PP4A 3EG9B 4BVJA 1N48A 1JTFA 2W4MA 3RVBA 3O4IA 3MRXA 4TTIA 1IUOA 1ZNXA 5BVHA 3KPYA 1VGQA 2IV3A 2N42A 1G8GA 3AUTA 3BGSA 4M49A 1PKXA 1HRKA 2AEEA 2IYSA 4PY2A 2YJTD 4DQXA 5C1DA 4A0HA 4YJHB 1JTEA 4TQ9A 1FYVA 4N3BA 3B3AA 1WY5A 4OIFA 3TPFA 4Q7QA 1RM0A 3MGKA 4EW2A 3E53A 4DILA 2V96A 3NCHA 5KT2A 4BLUA 5MGBA 4INOA 3CUWA 1AG9A 2R85A 2AWNA 4IDPA 3QXJA 1SL2A 1T0JB 2Y3IA 3UCEA 1GO2A 3NRZA 5EMJA 2FB9A 5E0OA 4MPRA 5L1LA 2PBZA 1K08A 2R79A 3WL4A 4JC5A 5ENZA 1T1RA 2NRZA 2BPGA 1HDOA 4DQQA 2W98A 2X8LA 4R1TA 2C88A 4RAOA 1ZQWA 4WZBA 2VPZA 4Q3OA 4RF2A 1CDDA 1U0SY 5EIBD 1KQOA 1J6UA 1S3FA 4HSGA 1DMRA 5K45A 3G88A 2IJGX 4EP1A 2EX0A 2JLBA 3AHEA 1OX6A 2AXTU 5I01A 4PINA 3DFKA 4UEWA 4WESA 2V3CC 4D4GA 3AF6A 2I55A 4HKTA 3NVDA 4PC6A 2R18A 1IWOA 4X8OA 4EMUA 1YZQA 3CT4A 4UBMA 3HTXA 5EP3A 1OX5A 1ZWKA 1NK5A 2JR5A 4KLCA 2LYHA 4FLEA 3JQEA 3PT5A 2XUOA 5H4GA 1E1QD 1YH3A 1Z73A 4XYGA 4KE8A 4B4WA 3EIHA 1XDUA 2X41A 2I2AA 2R87A 2PUDA 3HN6A 2J33A 3EIQA 4QQKA 1UBGA 3L0YA 3A6JA 4QT0A 3KB2A 4Q43A 3KAPA 4EL0A 2AFIB 3NEAA 4DR2B 4MVXA 3VSDA 2H7XA 5HVNA 1I3KA 1N5DA 1ESNA 2P3SA 1U2GA 3TMKA 4QYSA 2CWWA 3ETNA 1QIEA 1CIVA 2Q3LA 3VZBA 1ABEA 1QRDA 3IP8A 1YRHA 3ZKWA 3M6VA 4KQ1A 3EIUA 1U9IA 4Q9LA 4YY3B 2FKNA 3TG8A 3PFWO 4EUSA 3PWSA 3HBFA 5SYMA 3PCRB 2X1MA 4QUDA 2HPVA 3U0BA 5KOIA 4JXXA 4OQPA 5IIJA 1FP6A 1HT3A 5BN4B 4BE7B 4F4WA 1U8FO 3ZWDA 1TQ6A 4MA4A 4KR3A 1I01A 2QE7D 2VEDA 4PLPA 4YMLA 3G89A 2PX6A 2RGUA 4YJFA 4ZI3A 5BNZA 3TX2A 2F3QA 4QPDA 4CIWA 4YUVA 2QUJA 3OCXA 1T5TA 8ICXA 1YBMA 2LUOA 5BVGA 1F2TB 4O59O 5IP5A 1KH1A 1XMOB 1XF1A 3FWNA 3VFDA 1QYCA 2FR0A 1D2EA 1JJVA 2IPOA 2ZTVA 3WHKA 2HYIC 4G41A 5DSXA 3RTEA 2QMOA 1MC8A 4H15A 5K6AA 3K94A 1TKRA 3U4CA 5J2UF 4BP3A 2W2OA 4G2NA 3PUIA 5ANRB 1YOVA 4OLHA 4QU8A 1SG6A 3QEMB 5ILOA 1EHYA 4LIPD 1DX9A 5T4BA 3JYOA 4ZVUA 4ZEOA 3DQPA 2I29A 1IVNA 1EVZA 1LQ2A 3FAKA 3NOOA 3WLRA 1GL9B 1G3RA 1H94A 1O95D 1DOHA 3FPCA 3KIPA 1W36B 2H2DA 3JPOA 4QZ8A 3A9VA 1Y6QA 4K6FA 1XFDA 2HO4A 1GG8A 4P4GA 3VR4A 3ZLTA 2NU6A 3O9MA 4DL6A 1AGPA 2C7BA 1KI2A 4M6WB 1E9FA 2HI0A 1XCLA 2HAEA 4LRTB 4EX7A 3ROZA 1W2GA 4ABYA 3RG2A 3QXGA 3IDWA 4B7XA 4E08A 4ZYVA 3GPIA 5HF6A 4IVNA 2V7GA 2H57A 2B83A 2E8NA 5KFBA 2C9DA 5DTMA 1EDZA 3FA2A 1IIBA 1NG1A 3HKBB 3DOIA 2XC9A 4GMGA 4RTLA 1KSPA 1BC5A 3BWVA 3RRMA 3DXXA 3OO0A 4UATA 1S8FA 3EZ6A 1CJKC 1Q1ZA 4YT2A 4MKRA 4KC0A 4OAQA 2OVFA 1O1YA 3NV9A 4ND6A 1Y1QA 4RZUA 2XCRB 2R8ZA 4YMVA 2VP4A 4XUDA 2GWSA 3PBKA 4MKHA 5F5XA 3TAUA 3UMMA 1UBTS 3M6IA 3N2LA 4OV6B 4GPD1 2KSQA 4C8NA 1R6UA 1AM4D 1GTG1 1NMYA 1YKSA 2FX2A 3I2KA 2JFBA 4AQDA 2OHOA 4C0SA 1L4MA 1NQUA 4MRNA 4G8CA 2BC9A 4IRDA 4QUIA 3H97A 4XFKA 3CLTD 3TBHA 3KQHA 3BZCA 2E85A 2GZ3A 1BVHA 2EP5A 1IIRA 1SG9A 1WSBA 2A1TR 2ABWA 3LL7A 2QLBA 1A9SA 1JQKA 1NI4B 4QLOA 1CETA 5HKKA 4I2FA 1D1SA 1JHRA 2PFGA 2AEJA 4ISBA 4OJMX 3FBTA 3G02A 1R0BA 4YUYA 2PUJA 4MQEA 1TO1E 2ZUCA 1YZ7A 2B8EA 2QJOA 4KTQA 3DDOA 1ZQLA 1GFSA 4WKNA 1TIBA 4MUFA 1GGMA 4MV7A 5BV1A 1CDOA 3HL0A 2X8BA 1W96A 1FNDA 3L0CA 4LHYA 3SDZA 2PGAA 5C7OO 1NYTA 4RIIA 2VO1A 1FP7A 3V1YA 4ROTA 4MINA 5DLGA 4TMVA 2NT4A 3NC1C 5FCDA 4DBZA 1KSJA 5I5EA 4KNVA 1WPXA 1ZK3A 1ZJNA 3CR8A 4JU9A 3H19A 2WUDA 4QTZA 4KFUA 1E6CA 4CMGA 2O57A 2JIQA 1EXMA 3D6HA 3RR8A 1AQ6A 3W5UA 1EB8A 1PKEA 4L16A 2R7NA 4RHXA 2FQ1A 2PQ6A 4CEJA 1A4UA 4CCSA 2JFXA 1T9CA 2Y67A 2F3UA 4M1TA 5KQLA 1OA1A 5CPFA 3EAFA 4GLBA 4HVCA 1AUQA 4K40A 3J7AC 1YL6A 2OHIA 5J0YA 2UVRA 4C4TA 2VP2A 3GQVA 1BWPA 1IH8A 3TJMA 1X9GA 1P4RA 3SDSA 2O2XA 4POOA 1E2BA 4E70A 1DGSA 4TGLA 4DJJA 5CBKA 3GUCA 3NTUA 3FYCA 1HM5A 1JWBB 3N0WA 5EWJA 3K31A 1XTBA 1NGSA 3G59A 3KPJA 3M1LA 9ICTA 5EEGA 4CCYA 1YZ3A 2YVKA 2ZRJA 2JIMA 4HAWA 4GLXA 4Y3UA 3VKWA 5H9WA 1R3UA 3DEKA 1QG4A 2QMHA 3JD0A 4B87A 5FDFA 1W8IA 3R75A 4AYWA 1A0PA 5EGNA 3HL4A 4JBXA 2CLFB 4N7RA 2C5FA 1K3FA 3AYZB 1WHTA 3KE8A 4TYYA 3M7DA 3PQ6A 2D62A 4W6ZA 1QH1A 3JQBC 5AVKA 4DTCA 4F85A 3K8YA 3OM9A 1QZXA 5F7XA 4KHPB 4O4JB 3RK0A 1U2ZA 4KXLA 2Q0XA 4FFBA 2VTKA 3P9XA 5CIQA 1HYQA 3B0YA 1ICIA 2O1WA 2VJQA 5A0FA 4G81A 4JT8A 4QZGA 2RAPA 5DW3A 1Y3FE 2VP3A 2BDPA 2O20A 2BKUA 3W6OA 3WIUA 4C2TA 4OA5A 1UADA 2VZLA 2QA5A 3ZQUA 4TV8F 4RNDB 4DR6B 3QUSA 1VFNA 5AESA 3K0HA 3CRXA 3D5TA 3WO0A 1PVOA 5BXYA 2DWUA 4PG6A 1ZXXA 3TAQA 3KXDA 4JHXA 1JHMA 3R9IA 3HCWA 3PPVA 4YV7A 2JCYA 4A0SA 1KK0A 2GNPA 5ALJA 2C96A 1T9DA 4IL6U 2I6UA 1JHAA 3H0RB 2QUAA 3A3OA 1ZK2A 2X7HA 3JTEA 4TROA 4WOKA 2NT3A 3ZGVA 3KKAC 1Q84A 5GIOE 1W8DA 2NYVA 1OMOA 3GMIA 1LWOA 3F5DA 5F5LA 1X74A 4GDFA 1YRQA 3TZEA 3RF9A 4RL6A 1V96A 1BPBA 3L8ZA 4C87A 2ECKA 1Q3KA 2OLKA 4R16A 2NU8B 2O07A 2J5KA 1H8HD 3KZXA 2GFHA 5DWDA 1PZNA 1SWVA 1RCUA 1YAJA 2A78A 3AL0B 2BW0A 1QDEA 3KTFA 3TQTA 5C31A 4DW8A 1EBFA 2XW6A 4JBIA 2OFOA 5ERGB 2WWYA 4UU7A 2XOKD 3L1JA 3O03A 2SCUA 5DGXA 4XWOA 2Q2VA 2FMIA 1P7DA 2GSDA 3QTTA 3UYLA 2XMBA 3ZJYA 1WWUA 3BQ1A 4M9RA 1WZUA 4MKIA 2X0FA 5G0TA 1KO8A 2C2MA 1VMEA 5ADUS 1TV9A 1Q92A 1QS0A 3KJXA 2V74B 3GFPA 5K6RA 1KU6A 2V0GA 3V32A 4BLVA 1VMKA 1F2VA 1PX2A 1R5BA 2KPOA 2P1DA 3A05A 4MRMA 4NYIR 4V0SA 4F11A 4YJ3A 4MPDA 4TUSA 5FI1B 1UKBA 2O2ZA 1JR3D 3ME5A 2V7VA 1QIGA 1SBTA 3CUUA 4WN9A 3O9VA 4LCBA 3ZOKA 4Q3KA 4BC0A 3B2QA 1GR1A 5DN9A 3ADDA 4KLMA 2YW2A 1FMCA 5BN3B 3WSWA 3QMVA 2ZVQX 3CE6A 4OIMA 3EJWA 3GV7B 1SVKA 4RL4A 5C18A 2KZMA 2H1FA 1C41A 4XWAA 3HU5A 4A4DA 4R9RA 4CT0A 2BFBA 2J5XA 3IOCA 4IJKA 2KMLA 4CPDA 3ADCA 1JXAA 1OTYA 3EYZA 4IILA 3TOZA 3BTUA 4EDFA 4D4HA 2ZAMA 1OFIA 2I87A 2OSVA 3KLMX 4TLLB 1L5NA 2VHYA 1MTZA 3TDMA 1Y4DE 1Y48E 1YZHA 1BQEA 4MVJF 3SBOA 3DCNA 2YVUA 1OFUA 1W0JA 3AHGA 2PMKA 3A4NA 2BF4A 3GRUA 3CH5A 4RH1A 3WMFA 2UVPB 3EFBA 4FSHA 4JJZA 1XTIA 3EMBA 5FPSA 1T4BA 4A8TA 3MFIA 2QD5A 4JY7A 2WSYB 4MR7B 4Q3BA 3TEFA 2FOIA 4XUEA 3GLTA 5BSGA 1MLDA 1Q14A 4V0LA 4F4CA 4L2IB 4LNUA 1YUMA 5EXTA 2QW8A 2BMDA 3VVMA 4KMUA 3ZKWB 5JZSA 1RM5A 1YR3A 3VTFA 2ADFA 3CO5A 3K96A 4JLNA 1EDBA 2XUKA 4HYYA 3G2NA 3THSA 3HXOA 3PKJA 8ICQA 1MJFA 1QBGA 1UM8A 4B33A 3OJ0A 1H2WA 4BFLA 2WKWA 3GIMA 2XGGA 3G6VA 1J5EB 1CB0A 3QV1A 5CFOA 3JPYA 3RUAA 3SP1A 1MGPA 4P4MA 5AJYA 5KI6A 3PVXA 2OK7A 1JKJB 2B4AA 4JEUA 4KOAA 2XLCA 2Q46A 2VRCD 3Q15C 2X2FA 4NJMB 1NZBA 1J09A 4ED9A 3EZ2A 3GP8A 2XV1A 2ZRGA 1U8XX 4XR4A 1JH9A 1CP3A 4YT4A 5IXYA 1E5QA 3BORA 3IAFA 5DGTA 1O3YA 4LYHA 4Q9NA 2CF5A 4F96A 4ZHQB 1JALA 1TCCA 5FX2A 1KZ6A 4QEKA 3BMNB 4EZBA 1SA0A 2PJRA 5F23A 4YRDA 2FW7A 1G8SA 2NZVG 3K1JA 1AKNA 2RKBA 4ETMA 5A62A 2W9BA 4RQ7A 3DAPA 4KRYA 4QUBA 1RRGA 2AOVA 3UAXA 2O9JA 3HCAA 3I8OA 4IV8A 1H6AA 3HJFA 2AGOA 1NY5A 2CLEB 4MQ6A 1SD2A 2ZDGA 3W77A 3VU8A 4ZHQA 2ZYAA 2F4VB 1DO2A 1VJ0A 2PKYX 4LK2A 2WT8A 3ETGA 3RG8A 2ISPA 2ATIA 3QVGA 2BDUA 1L5WA 5G3YA 5JALA 3SX4A 3WYNA 3QFHA 4V0ME 1SXHA 1H4TA 2HBYA 4RE5A 5LYJF 5ADHA 1SURA 4HWTA 2R8KA 5FKJA 1GADO 5K03A 2ZCJA 1CEYA 4YJDA 1KEVA 2OAQ1 4EHIA 4M1SA 3T1NA 1Z2NX 3TW4A 1ZM2A 3LHSA 1NPYA 3CISA 1MQAA 2HBRA 3DMHA 2G36A 3OAAA 3OY7A 3TAHA 3TCNA 4GZMA 1UWLA 2IKSA 4OAPA 1HV8A 2BUBA 1GCGA 2QLJA 2WDPA 2G25A 2G67A 3BGDA 3LUPA 3OX2A 4P3YA 3BD6A 3LK9A 3IDZA 2F43B 1PUZA 3RVOA 5CVJA 3VPCA 3BXOA 1HE1C 1PI3A 2Q8NA 4NJOA 4EB0A 4ZOLA 4LYGA 4A9AA 1LPBB 1TKBA 1ZL2A 2GCIA 2XCQA 3W04A 3RVKA 1FE8A 5AKGA 2FCRA 2QTBA 3EULA 3I0NA 3K9WA 2WF8A 4BO4A 1N7IA 3PC8C 1RACA 1JYFA 3ZY5A 2A9KA 2OK8A 4RGQA 1ZM4A 5DH9A 3ZS8A 4B4OA 4BGDA 4MQEB 1L3UA 4FFDA 4XOIA 3UAOA 1ZD4A 3PNMA 4XQCA 1VL5A 3VR5A 5KOJA 1Y6FA 2AZTA 1H42A 2OEHA 2YQ4A 4JK1A 3RAQA 4QW9A 1KWKA 1XVVA 2V7QD 3VRHA 4RTSA 1MABB 1BKSB 2WVHA 2FETA 3I6IA 4J7AA 1XA0A 1NMQA 3SYMA 2IA5A 2ENUA 4LKRA 3BBPA 3I37X 3V9AA 1JWAB 4CFZA 1IEQA 1N2IA 1MX1A 4QSMA 1FSGA 3HHEA 2CV1A 5JSQA 1QO9A 3FNQA 3HYSA 4MAFA 1NPTO 3DMYA 3HQ4O 3DL2A 3I2GA 1ZKDA 1TZMA 3AF2A 1CQXA 2X8JB 1L5VA 2WA2A 5AM3A 1LQTA 1PS0A 2RHDA 3FUUA 2G70A 2HN9A 1K7FB 4NAVA 2OENG 2GBFA 1OVMA 3HB5X 2DETA 1YZ6A 2AJLI 1OBFO 2C20A 2O3UA 3L41A 3L46A 4GGOA 4L4ZA 4YRKA 5MFZA 1UJ6A 2XADA 3GNTA 2Q2NA 1BGXT 4B0OA 3SQIA 5DEIA 2O8FA 1UKEA 2P3LA 1HBJA 2P5YA 2QMUA 1KE2A 5JD4A 2P6NA 2PUCA 2Q07A 2W2VA 4FS3A 3JASB 3TADA 3P9PA 5D5HA 2QLMA 1RI3A 1G21B 1YQGA 3WZLA 4BS9A 4E21A 4YRSA 1U7WA 1D1TA 5E8JA 2ZIVB 2JI4A 1Z4IA 1FB5A 2V55B 4FHCA 2EZTA 3DV2A 2NV0A 4G6ZA 2Q6TA 3PWTA 5FBWB 1UINA 3V2UA 4QEZA 5AKIA 4GZ5A 2DKOA 3SHVA 2HC9A 1K7YA 3GJ6A 2HRDA 1P45A 5J2BA 1NVWQ 4HC4A 3ZDEA 4QELA 3OD1A 2CVOA 2UKDA 4B81A 3IEMA 1I6LA 1B6SA 3ZU5A 3OH8A 4AIRA 1WLSA 3P27A 5C8YF 3R5HA 3JQAA 2AE1A 2J0SA 4YRZA 2YXBA 5A0TA 3J81A 4I66A 3ZXXA 5KFEA 2ZOSA 3G6WA 3KU1A 4MVWA 5JJLA 4WLVA 3SM9A 3UAZA 3I1IA 3IBGA 5D51S 3B6ZA 3IHWA 4M1KA 4AG3A 2KLHA 5KFWA 3KUKA 3ACCA 3OE7D 4ND5A 5ESDA 2NU8A 3LYHA 3UXOA 1Q7BA 4FFPA 3DKVA 1VYTA 2F4NA 3KTAB 2HA3A 1EFRA 3QKIA 1CF4A 4N0DA 1A5ZA 4CU2A 4L27A 4P5EA 4U9HS 3EZ9A 2GTHA 1O03A 3L4KA 3GCWA 3H5TA 3OFKA 3GFFA 3ZCVA 3TOCA 3H9UA 1JAZA 1P2DA 4MFFA 5J2CA 3BE8A 4H27A 3G2OA 5AW7A 3SFVA 5L3SB 3OU6A 4Q0MA 3BJRA 4XB2A 2JGRA 1F3LA 1GKUB 5TPWB 3ENKA 4AYXA 4RK4A 2JHAA 1C8LA 2OB2A 2X5KO 3OFJA 2COKA 4G5YA 2XBMA 2YHAA 2G9RA 1EK0A 1RYUA 3A2NA 1QANA 1BPYA 2QUKA 5BN4A 3QNMA 1QH8B 3ELDA 1N6RA 1Z7EA 4KXVA 5JH7F 5FPPA 2ZUTA 4RQ5A 3V8QA 1OWOA 1YBVA 4RM3A 3F5EA 2BMEA 4RETA 1PL8A 5K8JB 2AFHB 4HDKA 1MVLA 1JDBB 3GZJA 2VQ3A 3LP5A 3OZSA 2HSDA 2VBGA 2YHSA 1ZVMA 2OBLA 1OUMA 4PSVA 3NEYA 2PO5A 1RYNA 3UGKA 5GZ1A 1B0UA 1XVTA 2AFIA 1GUBA 3ELWA 5FUWA 2WTEA 2GAFA 5KOHA 1NQAO 5C7YA 3NIBA 2FF5A 2X23A 4F5PA 1ZSNA 3LKZA 3ORSA 5CCBA 3HXQA 4BE9A 4B8YA 2QBYB 2H3FA 1W5AA 4NZYA 1QLJA 2I6TA 5EWGA 1BMTA 2VBCA 4N12A 3ZUPA 3FVWA 5DHFA 5AIBA 2Q9UA 1E8NA 1JPUA 4DM4A 4F46A 2JRZA 1Y0BA 1C1YA 3IXQA 4ICAA 2X42A 2PVSA 4G5SA 4C01A 3MMZA 1WDWB 3DEHA 1D2GA 3KJGA 5DQIA 1PLKA 3H84A 1DRUA 3OIYA 4QQRA 1HWYA 4GP7A 3UJPA 1NMZA 4C7ZA 1V8FA 1NX6A 4ZVQA 3WWPA 1KEEA 5DJ5A 3DXYA 4RUAA 4EAQA 2IHTA 4DG8A 5K0NA 7GPBA 2XLBA 4AMVA 3D5QA 4QGHA 4YDHB 3ISCA 3A6HA 3JARA 4OHOA 3OTIA 5ELXA 3AWDA 3E3LA 4UB5A 4ODIA 4N41A 1NDUA 4ESEA 1V11B 2YN2A 4IDDA 2JLQA 3FOCA 2G77B 3UBTA 4LUCA 2IXGA 4YFYA 5DRTA 5EMKA 1YA8A 3RVPA 1YB6A 1Y7PA 4MW9A 4P53A 5LP6F 2QX7A 3L6DA 1IIPA 1X80A 1RWBA 2I99A 2RARA 3EODA 5LYYA 2YVAA 5IMBA 3ZZ1A 5KEIA 1PUXA 1FTQA 2HA5A 2QYHA 3L8EA 3SS9X 3ZTWA 4ER6A 4AZVA 2VS1A 2A7XA 2KLBA 3E7PA 4HB0A 4U3JB 1E4EB 3OEED 1VL6A 3ZUGA 4DL2A 2PAFA 2FOLA 4L8YA 1O97D 4KXXA 1S96A 2WU4A 4DSZA 3AU2A 5ECWA 2YRWA 2GZAA 4B0PA 4OQZA 2XIJA 2IZOA 1AUOA 3USZA 5JISA 3AYXB 4NHOA 3EQ8A 3PGKA 4USAA 2E21A 2VDNB 4K6HA 3NG1A 3SPXA 3JR3A 2QP9X 3OCZA 4BJ6A 2VXBA 2QL7A 4MUMA 4JC0A 2H1WA 2G8NA 1ZD1A 4IS7A 1GXSA 2QD4A 3O6VA 4LGYA 2MYTA 3H0EA 4ZREA 2DGZA 3KFUF 2GM5A 1KY3A 4KBYA 3IMEA 3E9MA 3A9RA 3E5NA 4GRDA 4HXYA 2W8BB 1S10A 4EEYA 1PTJA 5D7BA 5A2GA 1N32B 3V2HA 3PFFA 2AI3A 3BFXA 4WFQA 1PL6A 2ZYUX 3GCGA 3HM2A 4EO4A 5LU8A 1BOFA 3MIIA 1QZ3A 1RLIA 2AC7A 3OC0A 4L74A 5F7ZA 5LJIA 4D45A 2ISSD 1TQDA 1SXJA 2WUVA 2ZSFA 3D6VA 2BHNA 3DFUA 4OXXA 5CDTA 5JT1A 1QFSA 8ICIA 1JAXA 1P1CA 2C3OA 3QVJA 1DBVO 4OPMA 1T25A 3SFTA 3STHA 1U3GA 3NKFA 1WW3A 4P4SB 4Q1FA 4BX0A 2XQJA 1JU9A 4ZCLA 3CLVA 3FZNA 3B1ZA 4V0RA 1X6VA 1G7RA 1Y88A 4H77A 3S81A 1QRUA 3EGVA 3FPSA 5FLXA 2GOYA 3WWOA 4MYSA 5KAPA 1GPJA 1J06A 3PD7A 1PD0A 4EECA 1T2NA 3WIVA 2GDZA 4C03A 5KZMB 3ABOB 4EEXA 1TM5E 1JLLB 2JLAA 1NWCA 8ICJA 3OE4A 1DQYA 1OI4A 3FCUB 4G26A 2OCXA 3W4KA 4CL2A 2E55A 2XMPA 3NGXA 3SC4A 3OSUA 1QMPA 4X3CA 1Y80A 1P77A 2ZUDA 1MIHA 3HV2A 4F3OA 2WSIA 3ZD7A 4BB6A 2ZI5A 3OCCA 2MSNA 3OPYB 4KQCA 2IBTA 2NU6B 1JX4A 1Y4SA 2WF7A 1ZY2A 1JEJA 5CNIA 1SU8A 4KOEC 3EPLA 5EINA 1EE1A 1N8KA 1ESZA 1I2DA 1EM6A 4Q37A 5HIIA 4UFOA 1P7CA 4P3KA 1X14A 1ZQEA 2VVTA 3N97B 2JJ1A 1XDWA 2V65A 4D8WA 4OVKA 4HGOA 4I7EA 5KFUA 4XA5A 1KQFA 3SBDA 3FG9A 3W2IA 3IV6A 1GSAA 1XCGB 1E1LA 2HBZA 5J2GA 3FNBA 2XVAA 5FFMA 1SCUB 2PMZC 3F7MA 5TNXA 3T3PB 1KMMA 3WWCA 1Q0PA 3KNZA 5AVWA 1SU7A 1XPOA 2O1EA 3ICVA 1RBMA 1X7GA 3G8BA 4KE6A 4UTRA 5A0LA 4Q9AA 3FCOA 2O1XA 3EVNA 4B6JA 2C0PA 4OB6A 3SXPA 1VHWA 2CY0A 4EI7A 1C7RA 4UW9A 2JH9A 4JI3B 1H5UA 1SOWA