4DCCA

Crystal structure of had family enzyme bt-2542 from bacteroides thetaiotaomicron (target efi-501088)
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
203
structure length
203
Chain Sequence
KGIKNLLIDLGGVLINLDRERCIENFKKIGFQNIEEKFCTHQLDGIFLQQEKGLITPAEFRDGIREMMGKMVSDKQIDAAWNSFLVDIPTYKLDLLLKLREKYVVYLLSNTNDIHWKWVCKNAFPYRTFKVEDYFEKTYLSYEMKMAKPEPEIFKAVTEDAGIDPKETFFIDDSEINCKVAQELGISTYTPKAGEDWSHLFRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of protein Bt-2542 from Bacteroides Thetaiotaomicron (Target Efi-501088)
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
molecule keywords Putative haloacid dehalogenase-like hydrolase
total genus 77
structure length 203
sequence length 203
ec nomenclature
pdb deposition date 2012-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 4dccA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4dccA01
5AI9A 3N5KA 5AKZA 3L0BA 4XE5A 2B82A 5AW5A 2MSNA 5AKYA 1XP5A 4HYTA 4YGYA 3U7GA 2YY6A 2PKEA 3ESQA 1T5SA 2WF5A 5ALKA 1U7PA 4ZEVA 2YJ4A 1RMYA 2VKQA 4OHFA 2P11A 5AK4A 2G1AA 5AI0A 4MWOA 2HOQA 5AM4A 1TJ4A 2YJ3A 5ALSA 5ALLA 5IT0A 4DWOA 4QJBA 3TLMA 3L8GA 5A3QA 2BY4A 4EX7A 3BWVA 4NV0A 2G07A 3SHQA 3B9RA 1FEZA 3EF0A 2R8ZA 3QXGA 1YJ5A 2C8LA 2C8KA 4L6CA 3PGLA 5AVZA 4G63A 5ALJA 2NO5A 2YN4A 4YCLA 2HF7A 1VJRA 4KX5A 3QGMA 3U26A 2GHQA 1LVHA 5AIAA 4HGQA 1U7OA 3QLEA 3W5DA 3WKEA 4FE3A 3WK5A 5A3SA 3HYCA 1U2TA 3WKAA 2B8JA 4EX6A 3U13A 2R8XA 4Y2SA 4CE6A 2B1QA 3ZUPA 2FEAA 4UMDA 4KN8A 3FPSA 4IFTA 3SF0A 5ALVA 1QQ5A 3U7HB 3U7EB 3L1UA 3L7YA 2AUTA 3PGVA 3ZTWA 5AKGA 1L7OA 1Z4KA 4O8CA 4OFZA 4XQ0A 5AW6A 2BDUA 3E8MA 2C88A 4Y2TA 1J97A 1T9ZA 3OCUA 3FM9A 3KBBA 4KNVA 3W5CA 3WK8A 3PDWA 4OD0A 3S6JA 5AW4A 1N8NA 4L6AA 4Y2YA 3ZWDA 3K1ZA 5AI5A 4J03A 4YCNA 3UMCA 2ZXEA 4KNWA 2Q4RA 1EK1A 1JUDA 1YMQA 5AVTA 3SD7A 5ALRA 1RMTA 1S2OA 4G9BA 4E88A 4JDPA 3WK6A 2ZBEA 3ZI4A 1EK2A 2GFHA 3F9RA 4BNDB 3SMVA 3QU7A 2GHTA 2JGAA 2WHEA 3E58A 2P27A 5AW3A 3KDPA 4XOUA 2P9JA 3UMBA 2HDOA 3KZXA 3WKCA 3ZX5A 1RKVA 1SWWA 1RLOA 3AR4A 3L1VA 2AMYA 5AW8A 5AVQA 3A1CA 2ODAA 1VJ5A 2QLTA 3AR3A 3FGOA 2W43A 5ALHA 5AM3A 3AR8A 3U19A 3ET5A 1XVIA 3KC2A 1QH9A 2G06A 5AW9A 3AR2A 1ZD5A 2MU1A 2HI0A 1Q91A 1O08A 2I6XA 1RMQA 2HX1A 4UMVA 2OBBA 4YH1A 2RBKA 3CZ4A 2WFAA 5AM1A 1QQ7A 4UATA 4FFDA 3B8EA 3B9BA 2PQ0A 3ZVMA 4UM5A 1U02A 2FPRA 4NABA 3ZTYA 5AW2A 2AH5A 4C4SA 1WZCA 2ZG6A 1TJ3A 4Y3UA 3KOOA 3DDHA 5ALGA 4NFLA 3L0CA 5FP0A 2IA5A 3M9LA 2BDEA 3QU9A 3N28A 4OCZA 4RESA 4UW9A 3RF6A 2C9MA 5ALPA 1SU4A 3WK7A 1YS9A 2R8EA 3DAOA 3SLRA 1Y8AA 1YV9A 2YBDA 2CN1A 4DCCA 2OA0A 4KX3A 3E84A 1WVIA 5ALWA 1XPJA 3WGVA 2YJ6A 1NNLA 2I7DA 1ZS9A 1T5TA 3L0YA 4UMFA 3ZWKA 2IOFK 3D6JA 3NALA 4UAVA 5AKXA 5ALNA 5IS2A 3QU5A 4HAIA 1ZJJA 3HLTA 1YDFA 2HHLA 3ZW7A 2GO7A 3N07A 3I1YA 3ONNA 4HGRA 2I34A 4BEVA 1ZRNA 3N8GA 2EATA 1QQ6A 2G08A 1S8OA 3QNMA 3QUQA 3M1YA 3SKYA 1Z4NA 4FYPA 2WF8A 3IRUA 5AKKA 2YJ5A 2G80A 3NAMA 3OCYA 2NO4A 2IOHA 3R9KA 4Y2JA 3FPBA 3R4CA 1RKUA 2I33A 1L8LA 4F72A 2B8EA 4UAUA 4Y2RA 3ZVLA 5ALIA 1Z4PX 3ET4A 1J8DA 1L7PA 5AK6A 3QX7A 4UU0A 3IB6A 1Z4OA 3DNPA 2YMPA 3WKDA 5ALDA 1ZD3A 2P69A 4KYTA 5AKJA 5AI6A 3UM9A 4GIBA 4F71A 2OM6A 3QUBA 2JAUA 1TE2A 1N9KA 1YNSA 2W11A 5ALMA 1IWOA 4C4RA 4C4TA 3GYGA 5AM2A 1TA0A 5AVYA 5AICA 4HGOA 5AKIA 1RRCA 3AR5A 2CFTA 2WM8A 4CNQA 2YMLA 5AHXA 3FZQA 4ZEXA 4BNDA 3L8HA 2D2VA 1RLMA 2FDRA 4BBJA 3OCVA 1Q92A 3N1UA 4CF5A 2WF7A 4YIKA 3KD3A 5AI4A 1NRWA 3OPXA 5AW1A 3EWIA 4CF3A 1RQLA 1Z4QA 1TJ5A 1WR8A 3UMGA 1L7MA 3FVVA 4Y2QA 2AGVA 3MMZA 3I76A 5E0OA 2MU2A 3R09A 1U2SA 3ED5A 2FPXA 3A1EA 2OYCA 3AR7A 4BX0A 4BYGA 4HGPA 1L6RA 2GMWA 1RLTA 4NWIA 1PW5A 3OCZA 1QYIA 4I9FA 2I54A 4DW8A 3I28A 1RDFA 1ZOLA 2O9JA 5AIBA 5ALTA 3QU2A 3NIWA 1Z88A 2FUCA 3AR9A 4Y2XA 3QYPA 3OCWA 3ZX4A 5AVSA 3CNHA 4QQFA 5ALOA 5AVUA 4UARA 2ZOSA 2ZBDA 2EAUA 4AS2A 5AK3A 3WKBA 1ZRMA 5ALYA 4YCMA 2HSZA 2ZBGA 1ZD4A 1Z5UA 4IG4A 1WPGA 5ALZA 2B30A 1RQNA 2WF6A 2R8YA 2B0CA 5T41A 4AP9A 4BKMA 2HF2A 3DV9A 3ZU6A 3U7FB 5AVWA 4Y2UA 2Q4TA 4L57A 3W5BA 3WK9A 2FI1A 4UMEA 2W4MA 3L5KA 1CR6A 4JB3A 4EZEA 4MUMA 3OTQA 1SWVA 1RC8A 3MN1A 3P96A 5AVRA 1Z4IA 3ZVNA 2RARA 4DFDA 3VAYA 4BX2A 4UASA 2CFSA 2FPWA 2ZBFA 3EPRA 2CFRA 4Y2PA 3I6BA 4AS3A 2HCFA 2EARA 2YMMA 2X4DA 2HEGA 3IJ5A 4HGNA 5ALFA 2QYHA 1X42A 1ZD2P 3A1DA 1KYTA 2C4NA 5ALEA 3EF1A 5AI8A 1K1EA 2FUEA 5AESA 4EELA 3NRJA 2RAVA 4UM7A 2O2XA 5AKEA 3WK4A 2Q5EA 1AQ6A 4RETA 5JJBA 5A3RA 4H1WA 2G09A 1Z4JA 3PCTA 2JAWA 3QUTA 5AVVA 5AKHA 2WF9A 2G0AA 1Z4MA 2YFYA 4J2TA 3QUCA 5AK5A 2JARA 4EEKA 3NUQA 5AVXA 2NYVA 2PR7A 3E81A 2B1RA 5IT4A 1L8OA 3BA6A 4I9GA 1MH9A 3J7TA 1LTQA 4PNHA 1RKQA 5AM5A 1Z5GA 3W5AA 2RB5A 4EENA 5ALUA 5ALQA 4CF4A 5AKLA 5AW7A 4XPZA 3MPOA 2HO4A 2IYEA 5AW0A 3NASA 2JAOA 3A3YA 3WGUA 5AM0A 3L8FA 3RFUA 1CQZA 4Y2VA 1VFPA 2IOFA 3AR6A 4NAVA 4UU1A 4YIHA 2YMQA 2FPUA 2FPSA 3ESRA 3NANA 5ALXA 2I55A 4GXTA 4ZEWA 3L8EA 3MC1A 1F5SA 1L7NA 1NF2A 3OCXA 1O03A 3QU4A 4B6JA 4BX3A 2DQSA 1RPZA 4BEWA 3SKXA 1Z4LA
chains in the Genus database with same CATH superfamily
1NM5C 3PWZA 1ZN2A 4BTLA 2QBYB 2XQKA 4B32A 1E9AA 1XTKA 1L5NA 4RGYA 3NTQA 4ASUA 1KSHA 4N8DA 5AKYA 1N8TA 3H04A 4GMXA 4WERA 4WLVA 3MR5A 3KKAC 2P40A 3UHOA 3EDYA 1JSZA 1MX1A 1QGUB 2YY6A 1E8MA 2GBGA 2ZTVA 1P3DA 3BTUA 3G88A 3M6MD 4WINA 1G3QA 3ESQA 4AZ3A 4RD2A 5CB8A 5I4IA 5KTSA 2ZUDA 3JYOA 4ZEVA 2PGOA 2QZSA 2JDID 2PUHA 1SA0B 5CUQA 3CZPA 4XIYA 1GA6A 1W1IA 4YRRA 1BPDA 4JSRA 1U7ZA 1WB4A 2ETXA 3KSRA 1K66A 4MTCA 2ZSKA 1HZZA 2BZSA 3UWKA 4FB5A 1M34B 3H9GA 2P1RA 2QRZA 4FMCF 3PIIA 3LVQE 4O02B 3M33A 2IU0A 4NSNA 4V1CI 3I42A 1N0UA 5GONB 4KO4S 3R7LA 1DCTA 1I3MA 3ZGZA 1RC0A 1E1CA 1GRQA 2XKAA 3LOPA 1BFUA 2Z4RA 5ALSA 1RM3A 3N7AA 1UMKA 2FJ0A 5GV8A 3TSYA 3HQ4O 3NOQA 4F3RA 4X20B 5IT0A 2F3UA 2QTCA 1HY3A 4LOAA 4OQPA 1PNRA 3GB9A 2NAPA 3X1YA 2J1LA 4K4HA 1VSVA 2VHYA 3L6OO 1MV8A 4I6EA 1E89A 3BWVA 4TROA 1MVNA 1C41A 1XSEA 1JMYA 1X74A 4F45A 3D0QA 1YOVA 1WDKA 4RYDA 4XD7A 1X66A 2K60A 1SQ5A 3DZFA 2ZPUA 4Y9DA 5DW3A 3ER6A 4FBUA 3I6ZA 1B00A 1N9GA 2C8LA 5SZIA 1A9RA 1Y48E 2O2IA 3MUNA 3ZE2B 5AVZA 3NNNA 5JFOA 5JAOA 3ZV3A 1QCCA 3HNPA 5P21A 3SFZA 3W7AA 3WYEA 5K51A 1N2IA 4R51A 5DCUA 1RI2A 4HBGA 4MAMA 4Q3CA 2HF7A 5C5CA 1TM7E 1Y33E 4ECYA 3B6EA 4FBLA 1W4RA 1NW8A 3CZQA 4IHQA 1CBUA 1J00A 2F64A 3EC7A 3UCXA 3L79A 1J2MA 1E3WA 2BEKA 1VGRA 4NFSA 8ICFA 3EGDA 4B81A 1F0NA 1B7GO 1KJNA 4JV5B 3A37A 2PAAA 4R8UA 3OJFA 5A5VA 3HCNA 1VDZA 1X1CA 3DBHB 2L17A 5K2MA 2XMPA 4D98A 1U65A 5KFIA 2YASA 1P7ZA 1U2TA 2O8BB 1JTFA 3WHLA 3GZJA 2FAXA 1VRVA 3EPIA 1JALA 4DCJA 4YAGA 2RGUA 5DH9A 7ICJA 1N0HA 4I5DA 1WBJB 4U9IS 1R15A 2BFCB 1LI5A 3F6PA 1GV0A 2KHQA 1N6OA 4MQEB 3GW8A 2G3YA 4P82A 3IA7A 1K8RA 4NFYA 2H57A 5EJ7A 2B69A 2ZYAA 1LRLA 5FEUA 4KTTE 4Y6OA 4NE7A 1QKKA 3FBTA 3EXFB 3OAAD 4P6VF 1A8UA 5FL7D 2FUNB 2PBZA 3QX3A 1QK4A 4F46A 1U9LA 3FM9A 1ZIDA 4LQ4A 2XUDA 3KVOA 4OSPA 4ZO4A 3TI9A 4ND8A 3VV2A 2ZXUA 2RGRA 1UKBA 2H4WA 3VKFA 4I1IA 3D8BA 3RVLA 3SHVA 5FBWB 2CRXA 1V16B 4CCAA 4XDHA 5J9FA 4CETA 2K4MA 2QZPA 3AWIA 4ZARA 5F3WB 5B30A 2WFLB 1P0FA 1ESMA 3N8HA 3N58A 2JGEA 3LV8A 2IV2X 1MJNA 3JD3A 5KFNA 1DRUA 2H9IA 1LK0A 1XMIA 4I2DA 1JLKA 5KAMA 2PMDA 3FNGA 3H1PA 5CR0A 3I23A 5BSMA 2J33A 1M6NA 3SZUA 4B7UA 1MFPA 3NWOA 3IT3A 4WEOA 5J8YA 3WGYA 2MDTA 2K8CB 1Z0IA 4EZ9A 4QVKA 2OO3A 3B9PA 2RE8A 2WAQC 3R6DA 3FB1A 4Q3LA 3U3OA 2ZS7A 3BMXA 3Q3CA 5IVIA 4OK5A 5EE5B 5G3YA 4XYLA 2B3TA 3B1WA 4NDZA 4UBJA 1G6KA 1GPAA 1TYDE 3AL0B 2GHTA 3BILA 4PZ9A 2HWYA 4FTWA 4N6OA 3A04A 3O4RA 1JBKA 3N7TA 7YASA 4XOUA 3O2SB 7ICVA 1PL8A 1RXCA 4PGMA 5C1OA 2WB2A 2X77A 3W2IA 3O75A 1IN8A 4EGSA 2IU4A 1Y7LA 2V5VA 2KMDA 4QEZA 3NM4A 5E4YA 3RC3A 4W1PA 4EP1A 3BJYA 1JKJB 3JQDA 1JN3A 4BV8A 4EO4A 3FGOA 2PZGA 7ICKA 1S7CA 1X2EA 3DEAA 4V0QA 1PFWA 1T8TA 3K32A 1DIHA 3B1VA 3NT2A 1ZD5A 4N9QA 3SEZA 4XTCS 3T0FA 2WAXA 3TOZA 2HI0A 3M4NA 4F8EA 1X7YA 4EUEA 2Y1CA 2IH4A 1NI3A 1E2NA 2XHZA 3BQ1A 3OM1A 3K30A 1II9A 3FWNA 1EIZA 4RV5A 1XF1A 2FWMX 1B93A 2PL9A 3K6RA 1CZUA 3PT5A 3TEFA 3K9BA 1IB0A 2IVZA 4CVNA 2YVLA 3AJ8A 1QRUA 1G7SA 4NBNA 4C0XA 4MPPA 2IWRA 2PQ0A 2VDLB 2VF2A 4UM5A 1PLKA 2J41A 1JQLB 2DTEA 3TIGA 5A6VA 3NFYA 4YDSA 3ZTYA 2XXAB 3PEYA 3HRDD 1SOWA 2WA1A 5K9ZA 5HGXA 1C7YA 3FKSD 4FGKA 5A0LA 2PWYA 3JYHA 3RIXA 1P75A 1ZJ4A 3A9RA 3DOIA 4HNAB 4MQ6A 3IPAA 2BZFA 3GRRA 3KAKA 4LJYA 2GPBA 2RHJA 2BDEA 4NLKA 3EBLA 1GTJ1 5FPHA 4DIEA 1E9VA 2DPGA 5HYVA 1X2IA 5EWLA 1EDZA 2GILA 2F1RA 4PAOA 1XAGA 3RF6A 2G8NA 4XVHA 4DF3A 5D4BA 3ETNA 1PGOA 2CHQA 4OV6B 3V4RA 1SU4A 3IAS6 5CVDA 1LZKA 4F5DA 2ZYHA 1FLVA 3BK1A 1QOQB 2W6JD 4UBOA 1UBRS 5F33A 1QHFA 2AW3A 3NJ4A 3I01M 3R1IA 4WRRA 1VIVA 2ZTHA 2JF0A 3AFMA 3RTGA 1PR5A 4B34A 1PSZA 4QG3A 1H0KA 4GI5A 4JU8A 4WTOA 3NRWA 4IUCS 1PL7A 3IAUA 4W1QA 4ZAWA 3TUIC 3HC7A 2EZ4A 4QPCA 4LGCA 4JLPA 2O8FB 3F73A 3IVRA 4EM6A 1EFPA 3LPLA 4BQFA 1KDTA 2BUBA 1I2DA 2W5UA 1U9IA 2QNIA 4QXRA 3B85A 1ZH8A 4ZANA 5FPSA 1BWQA 2WD8A 4UEOA 5F73A 3S1AA 3KQWA 3OF5A 1L7QA 3GNTA 3T7AA 3M5WA 3BXXA 2C7RA 1ADCA 3W9UA 2OHJA 2W2KB 4KFCA 2FSHA 3RVQA 5CA1F 5EAIA 1D2RA 3NDBB 1E3IA 1OBHA 4QIWC 1Z68A 1BMQA 1QLJA 3TE6A 4H4EA 3ZQ4A 2IXFA 5KFEA 1DELA 4AZ0B 3ANYB 5IXSA 4ED9A 7ICMA 1BW9A 1FVXA 5LU8A 2QN3A 1FFVA 1E1QA 4JEUA 4EW3A 2ZU6A 2ABWA 1SN7A 3IP7A 4KLDA 3K4HA 4QJ3A 3E03A 3P0JA 1D2EA 4NARA 5I7HA 4P4UA 3A9UA 1B1CA 1P1BA 4PZNA 5EMKA 2NU6B 2HD4A 4PX3A 2QP3A 2NYRA 3OZXA 4IH9A 5JCZA 3SVLA 4RL6A 4MQLA 4TV8A 4H27A 3PXUA 4B85A 1L7EA 4FYPA 1AXEA 3MXTA 1HE3A 3HZHA 3U7IA 2KJ5A 2V96A 2OK8A 3FLAA 4RY9A 5LL6P 3RR2A 4NDNE 2G1KA 4EF5A 1GR0A 2QMQA 1NOJA 2CWWA 2A14A 4GEGA 1RWPA 3VJLA 4DSAA 2BFAA 1KVRA 2D1TA 4NLBA 2FY8A 3V4FA 4DQVA 5C1BA 1I5EA 4KQEA 4E08A 3AUOA 1TAGA 1KAEA 3F6EX 3FYUC 3LI2A 2KNJA 4HDNB 5EUBA 2P41A 5K3SA 4IILA 3ET4A 2POCA 3A14A 3A4TA 1M7HA 1ZN7A 4B9UA 3EGIA 4ZU3A 2VJ5A 1GPKA 2BH2A 3IBGA 3AX6A 4EG0A 1BKSB 3ANLA 2VPYA 1YS1X 2P69A 2OV2A 1YT3A 3OHSX 4O59O 5T6MA 3DEFA 3UTDA 1F8FA 1JYSA 3L02A 3RTAA 3HCCA 2A7QA 1HFKA 2FSIA 2Y8EA 1VMKA 2Z2KA 4IX9A 4KYVA 3ZWOA 4KHZA 4FYYA 4ACAA 4BRUA 4YRBA 5H81A 1W35A 2H4ZA 2PL1A 1C8KA 3V7KA 4J0DA 5AM2A 1BPXA 2VJMB 2ZYRA 1NNEA 1DAGA 1ZQ1C 4QZDA 4BVBA 2DL0A 1HDXA 1XBTA 2E7ZA 3WU2U 3PZBA 2I29A 4IHJA 4WJZA 3VYTB 2XTZA 3ASZA 1I7LA 1ONPA 1Y3CE 3AUFA 4NCNA 4F5QA 1ZH6A 3C7KA 3UK2A 4AYWA 3AYXB 3MLEA 4Q1CA 2FRXA 5KSZA 5CT6A 1BQ3A 2QQ5A 2RKBA 2QUHA 3DPIA 5JUMA 1OFTA 4DL4A 1GYPA 1W34A 1WCXA 4U63A 5KL1B 1XQ6A 1U6JA 2HEIA 3N2IA 3DE4X 5TRTA 3V8QA 4BWGA 2HHCA 4NTZA 3AETA 3LM8A 4N3GA 3ISBA 2CLOB 1XCJA 2YZ2A 5AHWA 3UMVA 4DQIA 2QN7A 1JLHA 1NPYA 5CLJA 1QR6A 4X93A 1SU7A 2Q9UA 3CH6A 2VXOA 1G3IA 1L7AA 1O4VA 1XKQA 3G6KA 4GZ6A 1VG0B 4F5PA 3V1KA 4DJFC 5CA1B 5FTJA 2IEBA 4JNKA 3GXBA 1I0LA 4E13A 4RM2A 1R6VA 1ND5A 1KFBB 3CRNA 1X6VA 4DQLA 5FO0A 2FR8C 2W2QA 5G0WA 4MUGA 3FVVA 4Y2QA 2FFHA 2AU0A 1HGXA 5HIKA 2G9NA 3VPHA 4TN5A 4H60A 3RH4A 2L0XA 1AIPA 2WP8J 2YB4A 5KT3A 1VL2A 3QQ5A 5HK8A 3S8YA 4MLZA 4OAQA 2EBWA 1D4ZA 3ZI0A 4V2IA 5LD2B 2GKSA 1RU3A 3SVTA 1DMSA 1QJ4A 1UBNA 1WMAA 4RD4A 4A2PA 2D7JA 2A4MA 3UK1A 1WP4A 1WD5A 4ENUA 3DOFA 1YL6A 3FYSA 3VKHA 3FCUB 1G20E 5EZQA 5EFOA 4UHJA 1ORTA 1OASA 1N0IA 1OLOA 3HYRA 1JFVA 4RFSA 3PR3A 2FUKA 3JYPA 3KWLA 1HNNA 5JSYA 3I28A 3E9RA 1ZQIA 1RDFA 3GI1A 3ULKA 3GT7A 3U39A 3QU2A 1F2DA 1H6CA 3W1WA 1Y6GA 2H4FA 2FUCA 2C1ZA 2XWPA 3K53A 4X0EA 1LB1B 2JGFA 3S70A 1Y6JA 1DDOA 4WXHA 4B82A 4CI0B 1TI7A 5DXFA 3WAGA 1B0XA 3H1TA 1Z1BA 4F93B 1N5KA 4PLWA 5TNXA 2BGTA 1JHXA 2JD1A 2I3DA 3EZ2A 3QXHA 1O5IA 2CUTA 2UVQA 1OPRA 3RRHA 4I2FA 1E62A 1VKOA 1Y1TA 2JAXA 4LI0A 2Q5HA 1JLSA 3OUUA 4Y6RA 4ZI7F 5F2NA 4OLFA 2PIDA 3NV9A 4I6GA 4DLUA 2PHZA 4OXNA 1YZKA 3AI1A 3KZOA 2G9ZA 1GPLA 5TF0A 4QPPA 1KZ4A 2F3RA 4PSCA 1XRJA 2O2JA 3LUGA 1PP4A 4HNUA 1AOXA 1K75A 2FVXA 2M9MA 4AMGA 4NATA 4KSBA 5KYXA 5J4VA 1C3JA 2PN1A 5HUHA 3FYCA 3U4IA 2FPPA 2YBEA 2C3PA 3D2LA 3AEVA 1PVQA 3SC6A 5BNFA 4DSFA 3BGSA 1RC8A 1V25A 4FGSA 3ZVNA 2OO5C 2Q5CA 1LDEA 3CPHA 2ZYGA 2VWQA 3H0KA 4GMGA 4QDOA 1J06A 1IRXA 4X92A 3VAYA 1P2UA 1OZHA 4BX2A 2P6OA 4WDRA 4PS1A 1COZA 2GM3A 4RXUA 3ZGXA 3PD1A 1SOMA 4YRGA 2WT9A 4PRKA 1JJVA 4RY2A 5CDUA 1S2MA 4M1YA 1NL3A 2X4DA 3S99A 3ZE7A 4XIJA 4DGQA 3JRXA 3BVPA 3HADA 1DP4A 2HLDD 2WVAA 1ZD2P 3QVXA 4KDRA 4DCOA 3R6TA 1JR3E 4JV1A 4GHWA 1L5LA 2FUEA 1LBQA 1ZONA 4BRSA 4F2HA 1EXDA 3NRJA 2GXUA 5KT2A 5IFLA 1QOZA 5HF8A 2HPAA 1IK4A 1U0HC 1JHAA 1K1QA 3ZY3A 5FV4A 3H8SA 2HA2A 3WADA 1OGYA 3JQFA 2NT3A 4RQUA 3TF5A 4XYMA 2JAWA 2ZDQA 2GSWA 4MYTA 5D85A 4CU2A 3IOCA 1F2TB 5T14A 4WBNF 3UH1A 4HWGA 3I5YA 1EDDA 1PS9A 1NXWA 5CAEA 4ECTA 3AFOA 2IPXA 1Y1KE 2AEMA 2ZRNA 5L7TA 2H48A 2FX2A 2RFLA 4YFYA 1MUUA 1XQVA 4M89A 1Q1ZA 4I9GA 4QD3A 2ZUEA 1NBME 1QVWA 3B3AA 3J7TA 3JY6A 1XMXA 2IXAA 3OPVA 2J3EA 2B5OA 1DVRA 4PHCA 4B3HA 4DWWA 3L0DA 4ZIRB 5A0VA 1O97C 2C94A 3NBAA 3LLUA 4QG7A 3ZCXA 4U7CA 1RRPA 3AJAA 1SBZA 3ICOA 3PWKA 4GVLA 1P5JA 4O0MA 3R9IA 3TIIA 3WRXC 1WIWA 3HCOA 4AF7A 2MT9A 4MPTA 1O94C 4RNDB 1P61B 4DCVA 4TVKA 4X9XA 4DVJA 2HO4A 2AUMA 5CW1A 3TSCA 4C0KA 3QPWA 2Y3IA 1NBMD 2BZ1A 5HHHA 4GOJA 5GZ6A 4PVDA 1EX6A 5JNRA 3TCXB 5BV2P 1IY2A 5CFNA 4KAAA 1AKRA 4AM8A 3NHPA 4G84A 4UNQA 1GQSA 5FAKA 2UZAA 3T7TA 2R1ZA 1M83A 4KGVA 5CVVA 4AC9A 1J7KA 1EGMB 1FCJA 1CJCA 2VNSA 4RY8A 4E3WA 1BN7A 3UC5A 1K8ZB 1Z7GA 3LBIA 4J9UE 3E8SA 4HF7A 2Q4DA 4J90A 4ZEWA 1WULS 2QGFA 5DP2A 3ZV4A 4UPDA 4EARA 5AUNB 4DLGA 5HZGA 1UPTA 3Q12A 4FJ1A 5CA0F 2DQSA 1W6RA 5G2OA 1HEIA 2A35A 2XY4A 5DBOA 1CDEA 2H51A 5DK4A 4BVGA 4GRDA 3TNLA 5KTQA 4BWVA 2FQYA 4QGBA 1PSWA 4YQWA 1YCDA 2TECE 3AY6A 3IUQA 4XE5A 5AW5A 4RLSA 1E3EA 4ZJYA 3ND9A 3EQ2A 1F06A 1MVLA 2QG4A 2W2OA 4MV8A 4OX9Y 4TZTA 3HCFA 5IM4A 2WWXA 1CEEA 3FRIA 2R6CA 4X41A 5LA6A 2EFJA 2P4EA 4D4HA 4E5VA 5EJ4A 2A9OA 4BMVA 4WI1A 1LVGA 2VA8A 5AJVB 1X1AA 1YUNA 1AGXA 2JLAA 4PFQA 4BUGA 3ZS9A 4M9ZA 5B5EU 1PWHA 2IPAB 5HM6A 3N53A 3O8DA 4DMKA 2P30A 3EW9A 4M54A 3R40A 1Y8CA 4BZXA 4R2IA 1T8UA 3QWBA 4PANA 5AK4A 2CMFA 2GNOA 2VIXA 5E2BA 3KOUA 3VDQA 1TQ8A 3BD8A 4D2IA 5J2KA 1I6LA 2D4AA 4C5CA 2Z8YA 3QE2A 2OCKA 5AM4A 3GCZA 5KKAA 1UBKS 1WQ1R 5GOTA 3GGCA 1NKTA 4QAJA 1BPBA 9ICBA 1CR1A 2C9BA 3A0RB 3FPHA 4Q93A 4QUDA 5GJCA 5C1PA 1JFLA 2LVBA 1DBQA 4QTXA 1XL1A 2ORED 4GBJA 1CY4A 3L8GA 1SEPA 1RZ3A 3AMVA 3DAGA 3PE4A 2ODGA 5A3QA 1QKJA 2FCAA 1UJ5A 4KQWA 3V1TC 4LQCA 3BKWA 6NULA 1Y3FE 3NB0A 1C81A 2FWPA 2YCLA 3SHQA 6Q21A 4ZV4A 5JT1A 2V7GA 3KKNA 5K8LA 3RSGA 1DE0A 1FNSA 1GNQA 3HVJA 2Q0SA 4WLFA 3QXGA 5KFGA 4BVHA 4L5JA 4R8KA 2HPHA 3TOXA 1A97A 2NADA 3G8BA 3R41A 4RMHA 1O58A 4HSGA 4EYEA 2QUIA 2AC2A 4BV9A 4MEXA 1NJWA 1HLGA 4BJHB 4EY4A 3QI7A 3RIGA 5TGDA 4B3GA 1CQJB 4EI7A 2VANA 2AOUA 1B73A 1LLQA 3JTMA 3TPCA 3JATB 4DC0A 5BMVA 4AUEA 2NO7A 1NHWA 5FLYA 4PLYA 2X19A 1BD3A 3MCVA 4MVJF 3UWOA 3W3ZB 1JEJA 1QAOA 4QXOA 2P66A 3ICEA 4JKYA 4ZVVA 3DO6A 3PFIA 3WKEA 3W5DA 1CF4A 1U8UA 3CVVA 3M6ZA 7ICTA 4H77A 4Z49A 4HVAA 1N1EA 3FOBA 3NVMB 1GNPA 3B6JA 4XLZA 4ZRNA 1Z63A 4BO3A 2AFRA 2WD7B 1N8KA 3ZGOA 5G0SA 5JS2A 4ES6A 3OPNA 1CS4C 4IS3A 2Z9DA 5KOYA 5K0ZA 4BBAA 1MORA 4S2UA 2PKQP 4AYBF 4Y2SA 3RJZA 4CE6A 2DKFA 3CF0A 3NT4A 1IAQA 2FZGA 1F20A 3RTEA 1KZ6A 1EFAA 4TQ9A 1KRHA 4PJ0U 2QD3A 1EGQA 2VTVA 3F4BA 2XA9A 1W4CA 3U7HB 2OPBA 1Y7TA 3VV3A 4Q43A 1PT7A 3QG1A 1RM4A 3KTDA 3LUDA 4PW0A 1L6NA 3KJNA 1V38A 3RM3A 2VTDA 5G1NA 2AN9A 2NVOA 3BE6A 3FUCA 5GY7A 4RHTA 4DM4A 3HUEA 5BV1A 3HBFA 4J9RA 4XUDA 4KV7A 2V7BA 3P1JA 4DBLE 4Y8VA 2CL0X 1GQRA 3LS2A 2CMDA 2WHQA 4LHVA 2ID4A 1EDBA 2QF7A 4KPUB 4OYHA 4E22A 4ZYUA 2G28A 3GA5A 4OMFG 4UBLA 4JT9A 4EB6A 1MAUA 3MGGA 4XQGA 5LFAA 1F38A 1G2QA 4EJ0A 3HP7A 1MVOA 3LWBA 1RC1A 2HTEA 4YFKA 2OMKA 2PKCA 3COVA 3H2IA 3I73A 5BWBA 3GLGE 4W82A 2X2PA 1JUDA 3MGBA 4KIJA 2RBEA 2Y0DA 4Q21A 1WL8A 2DE0X 2KX7A 5DI9A 1I33A 2QTGA 4C05A 1ZJWA 1JG6A 1V7PC 3SLGA 2C2DA 3HBJA 1L3VA 1CZLA 2G5PA 2Q9AA 4JDPA 2XKBA 4LY3A 4UBNA 3F7NA 2OH2A 1FTNA 2BBOA 2VRCD 4MCIA 3W78A 3BS5B 1JXMA 2DCMA 3ZHOA 4EJSA 3O8CA 1TPYA 2E5LB 3SQNA 4PQFA 2GAAA 3RREA 3INRA 1NF3A 3R3VA 3BA1A 4KXVA 1X7GA 4NOKA 1WW2A 3RSLA 1ZM4A 5HFNA 5TC4A 1DWUA 1HMYA 1AHNA 2VDUE 2BGKA 1X8LA 5ARDA 1NI4A 2JIOA 3M3DA 2YV3A 1T9DA 4LI3X 2OHIA 4NS4A 1U28C 2D2EA 3PI6A 3VX4A 4R71A 1O54A 3MJFA 4MGIR 2R1UA 5CLFA 3SDZA 2R1VA 4H4DA 2HM7A 3HLKA 2RBGA 5ALHA 5AM3A 3FNQA 2ATVA 2EJUA 2PX4A 2YIMA 4KYUA 4AX4A 1IU9A 3D6FA 4LSWA 3GDHA 2BFMA 1VP9A 9ICSA 4H1HA 3E7PA 1SZPA 1MB0A 3FWYA 4NC9A 3HHEA 5JQWA 4TLMB 3HGTA 4NHOA 3ETRA 2E6KA 4U9HS 3SGLA 4CG1A 3UWPA 5FUMA 5JCOC 2WFAA 3M34A 3VKGA 1V3VA 4PLGA 5GADl 4BC1A 5CIYA 3B8EA 1I6WA 1G5HA 2Z2JA 3ZVMA 1YE8A 2GCOA 1CHNA 2V5UA 4J4BA 2ZJ0A 1W1UA 4FFVA 2RB4A 1C7FA 3AKDA 4HXYA 2OCEA 2UYGA 4GS5A 1ETHA 4NHEA 3NKFA 1JWBB 2ZG6A 3GEMA 1AGPA 2Y9MB 3C0KA 3UBTA 4LX0A 3DDHA 4MW1A 3IVCA 2FSSA 1E2DA 3FR7A 4G5FA 4F9FA 3TXAA 1UBJS 2AR9A 4HQNA 1W4AA 2GZ3A 1FNDA 2BSAA 3DL0A 5I8WA 2O8EB 1MZVA 1TK8A 4CM9D 3A3OA 4IRXA 1ZH0A 1DEHA 4HDCA 5C7IO 4JYZA 2R8GA 2YY5A 2LP4Y 3G0HA 1ZU4A 3LTEA 3BFJA 5DX1A 3QEMA 3AT1A 4F4CA 1FX1A 4KGXA 4D0NA 1QP4A 1QRRA 2HUNA 4P33A 3AONB 4X61A 5BSWA 4DCCA 4IJQA 3AU6A 1NUQA 1B42A 2CLDX 2GBCA 2W2VA 3OIYA 4EJ2A 3IP1A 1ZQUA 1CW2B 4MPDA 4S24A 2AOTB 3TH5A 3FOCA 1Z12A 4XWOA 4Y0VA 4DV3B 1I0ZA 1V4VA 2YTZA 121PA 4RQ6A 3FOAA 4MR9B 2MSLA 4I66A 1N2CE 2PT7A 2CCJA 3OTGA 2OD9A 3ZU5A 1MW8X 1CZRA 4ZU6X 4B80A 2VRBA 1OAOC 3DOJA 1A7UA 2X86A 3C5VA 3AVQA 1FC0A 4MYSA 1WWKA 4UMFA 2PO7A 2IOFK 4MUHA 4UAZA 1L7BA 3CR7A 4NZNA 4ZAGA 3SQXA 3IESA 4Q05A 1GAEO 1QUEA 2OZVA 3HA2A 3EIEA 4R1LA 1KXJA 3QVJA 4HGYA 4Q19A 2HHLA 1OVMA 1XJQA 2Y27A 4KBYA 4OUDA 4DGSA 4OXQA 4AMVA 1SV4A 1T2UA 3OMWA 1E7SA 4LXGA 1I32A 1CXZA 1LX6A 2FQWA 1H0HA 3E82A 1TT7A 4QOEA 4X1KB 1X7XA 4GBGA 3W8DA 5I7UA 2H3IA 4OFWA 2UYHA 1ZIPA 4IS7A 2B99A 4EPWA 3DE1X 3U0VA 2KYRA 1T3QA 4YP3A 1A2OA 3PSPA 1U2DC 2AX4A 2NPIA 3A1UA 3EGWA 3MTEA 4K5QA 4X84A 4KDCA 1DPFA 4BATA 5E9JA 1NMQA 1PT9A 4NBRA 3ZBQA 4DA0A 4Q82A 3RRFA 1EE1A 4P3OA 3OMLA 2JFOA 2P4QA 2WHXA 4QNRA 2QV7A 1MMFB 1V2HE 2NVWA 3VR6A 3GLVA 3N75A 3PNKA 4NZZA 3GVIA 5BSTA 1KC1A 4F4DA 1R4NB 3GBPA 3A6EA 1AMNA 1X3LA 2QS9A 2HB6A 1Q6ZA 2W58A 3HRIA 4G67A 4MV6A 4V0RA 1O94D 1Y81A 1RWVA 3A6KA 3I53A 3R76A 3GWGA 3QX7A 5AJWA 1Q0ZA 1JZTA 2H5EA 3MWFA 3VR1A 2LCIA 3KBOA 1IYZA 2H54A 5ALDA 3N76A 4URXR 4N7JA 3RS4A 2XDWA 1L8XA 3IKJA 4UDOA 4KYIB 1E1YA 1Y3IA 2IOQA 4F71A 2O1SA 2PVPA 3GFGA 3BMOB 4K0RA 2OM6A 2VF4X 4KPYA 1E60A 1ZQCA 1J2EA 3O9VA 3P9PA 3SICE 1QX4A 2K5UA 1DHRA 2RK3A 5KG7A 3A05A 2NSDA 4OSEA 5G02A 1Q7GA 1UM9B 2XB2A 4B2LA 4YJ3A 2P9TA 3G5LA 4XB2A 4G23A 4C4TA 1LH0A 4FGWA 4KI7A 1D1QA 4O4LF 1FE8A 1MXHA 1G6OA 4LZOA 3B7WA 4LYHA 4I4CA 4Q4CA 2NRXA 2OC9A 4DRXA 1QUFA 5KVSA 3FZQA 4ABTA 3ZXSA 4DIUA 4QEDA 2JI9A 3UJBA 4YUXA 9LDBA 5C0YA 1OXUA 4RX1A 1LLDA 4E70A 2IYAA 2ZUFA 2YC4C 2NRWA 3RYFA 1G0NA 1EM8A 1IXRC 3DKIA 2GJAA 4CN9A 9ATCA 3A6PC 3EEFA 1BU5A 2QKYA 3OHAA 4YRIA 4NMXB 1PJ4A 1RKXA 1KEJA 2GPAA 3A70A 4B9NA 3OE1A 5EUCA 4ZYZA 4UXJA 4LNUA 1AGRA 4RKWA 2R1TA 3C8DA 3PSAA 1U8CB 2AVDA 2OKCA 4NBWA 2LM1A 4DMMA 3T7KA 4H7HA 4TYQA 4FGLA 3F9CA 4RPHA 5K4AA 5LZ4A 4NS1A 1ZCAA 4Q4AB 1JSXA 5J1TB 2QJWA 1XVVA 4H59A 4PLPA 4WADA 3PPXA 1AMOA 1JIIA 1XALA 2IIVA 4ZYYA 2Q3BA 2CXOA 1G20B 3L7NA 4J0GA 3SR3A 2QRVA 4MW0A 5M34A 4EY7A 3EPHA 5H9WA 1P91A 2FNAA 1FXUA 4J9SA 1PQUA 2IE8A 2ZROA 3ECCA 3M83A 5ULLA 4KPFC 1OOEA 3LLMA 1E5DA 2G7ZA 2BYTA 2ODWA 4M9QA 3UWDA 3HVRA 5J0RA 1J24A 3HBNA 1BJRE 4XARA 4MS1B 5G1OA 1NLYA 1QYXA 2ZXFA 2CBZA 3WXMA 4Z2YA 3SEFA 1ONOA 4ENWA 3UB4A 4OTZA 1IXRA 2UUCB 2ZYWX 3OCZA 3ED1A 3FMIA 4K9LA 1HT2E 4KOAA 5BNZA 1NPDA 1KJ8A 3ZZ1A 4B6QA 3C1TA 3P8ZA 4URUR 1TX4B 3WL3A 5EIBC 1A77A 2XSZA 4GYWA 4LSGA 2BSXA 5A7GA 1DIAA 2YH2A 4MW9A 4WY8A 1OU4A 2D5AA 1AQIA 2PGNA 3CIFA 4RQ5A 4MVXA 1IBKB 4MX8A 4KQHA 4TKVA 2XECA 4L5IA 3RC2A 1YD7A 2WJ4A 2JIMA 3H9UA 2B1GA 1FDRA 2OBXA 1ECLA 3IEMA 5KYYB 4IZ6A 4AX8A 2NU8A 2HA0A 3NT5A 3VC3A 1WP9A 2AHOB 2IKQA 4PQEA 4RNCA 3ICCA 4RT3A 2GCEA 3IEIA 1RYEA 1AN0A 5F76A 3UYLA 1IM5A 1X7XB 2JJ8A 2RH4A 3ZCPA 3NH6A 2FDCA 4ARSA 5B3KA 1V6SA 1KARA 3R0VA 2GK3A 4UMEA 2ORIA 3CLUD 3NYIA 4YJFA 3BSWA 3KT8A 1QIGA 1B8UA 3CG4A 3OPQA 4E4RA 4MUMA 2XTNA 4H7DA 1YU9A 4HAWA 4ZVPA 1SB8A 1N5LA 1Z4IA 4RE6A 5FTMA 5NULA 1FJHA 3ENKA 4Q9HA 2AG6A 2QORA 4RFVA 3NAZA 3W7VA 1N3LA 3R6LA 2YHIA 3L8CA 5EWMB 4F6RA 4MUAA 4JI8B 3CT4A 4ZEMA 2IS1A 3JPSA 4YXMA 2HADA 1H4SA 4Y2PA 4Z6CA 3W79A 4G1FA 5JSZA 1DOHA 2D1FA 2AFVA 3KKOA 1IN5A 3K31A 2BIFA 3UG6A 3A4IA 4Q1BA 2HEGA 2M98A 1NBWB 1Z7YA 4IZIA 4NY1A 4KO2S 3OQHA 4KLGA 1FMCA 2DBQA 2C3OA 4G6ZA 3L6EA 1OILA 2VF5X 1N78A 3V72A 3AESB 2RAVA 4KI0A 3U4CA 3T3OA 4F4YA 2H3FA 1E5XA 3EJWA 1C14A 2VSOA 4PRLA 4MIEA 1D03A 2ESRA 2R3SA 4RLFA 1QGED 3TRIA 4RQ8A 1FUYB 3MWEB 4UEQA 1L4LA 1R4AA 1G8SA 1XD2B 1PGNA 3ETCA 1U3UA 4KQFA 4RH3A 2ZT5A 4E6EA 5T3YA 4E15A 5AVVA 2XIDA 4LFBB 1OXMA 1C30B 4JP2A 2PS3A 2IYZA 1CUDA 4R7ZA 4BNUA 4N7BA 2Y68A 5KYUA 3RVOA 4FIDA 5IJ0B 5AVXA 2ZIFA 3WV4A 2N9UA 1DT5A 1JXOA 4BNFA 4C4AA 3CH4B 3AL3A 2W70A 1L8OA 4MFFA 3BA6A 1JHVA 1FNBA 2AFHE 1KZYC 1VLVA 3IKVA 3OOHA 4HZUA 3FTCA 4P7GA 3PHIA 4PNHA 3MWJA 1CUVA 1GILA 2RHFA 3TFRA 1ISRA 4HDOB 4RHUA 1H93A 3BXEA 2WILA 4JEIA 4RSGA 4WOBA 5D3MA 2MAXA 4WNAA 3T1NA 4UZEA 3ROEA 5KSOA 1NZDA 3C8MA 3IP4B 1KMCA 1V8PA 4YR7A 5AW7A 3RB0A 2ATLA 4M60A 1OLUA 2QM8A 3EQ6A 3EWNA 3C8ZA 1CUEA 3GMDA 2RC6A 3PVSA 4FDLA 4GNKA 3DULA 4HHEA 4INJA 3R3UA 4A8HA 3DW1X 1Z33A 1F9AA 2IZ7A 4F5EA 2NV6A 4B2PA 4JMPA 3UFXB 4FSDA 4JASB 1B26A 4FO6A 2GARA 1XXHB 2ZWPA 4QO8A 2ZS8A 3N8KA 5EHIA 4ZT5A 3RUFA 3SBXA 3W5SA 1MW9X 4B46A 4ENPA 4KR3A 2GETA 1ILEA 1E3MA 3UJDA 3DZCA 3G0BA 4DFKA 1Y8QA 3HA5A 4JHLA 4XGRA 4JYBA 4Q48A 5FIUA 4MQ5A 5C7YA 1T0PA 4RZHA 3DMNA 2F76X 3CRXA 2ADMA 1NF2A 3PC6A 1DEKA 2KSOB 3G9ZA 4BO5A 2YWXA 4CTMA 5F7ZA 4JI7B 3L93A 4PPGA 5JWHA 1TM3E 2P65A 2ZJBA 3ETEA 2UZ4A 1W6UA 4OP2A 1VA4A 4ND2A 1QH1A 1HYEA 3GWZA 3MERA 1K6XA 4YO8A 2ZB3A 1N1DA 1QVVA 1JL3A 1Z8FA 1E0JA 1HYQA 2O14A 2BCVA 5J8YC 3IE0A 3GGJA 4MVJG 2ZIAA 4V0NA 1PK1B 4GOKA 2JGJA 4WZBB 1H5NA 1M10A 2PRSA 2VRNA 3W9YA 3WRYC 2X4LA 2P8SA 2B92A 2PKEA 1MDFA 2FZKA 4FLMA 3LDHA 4H0NA 4OBBA 2WF5A 4NOJA 1Q7BA 3PLNA 4TMKA 4RDIA 2G4CA 5J2GA 1NW3A 5F12A 5FTWA 4EFMA 3IIEA 3HWWA 1Q0QA 3WYGA 5LQUA 4AQ7A 2EZ9A 1WDLA 1Y1RA 4ECEA 1W85A 1ZM7A 4ICAA 1JA1A 1GL6A 3O31A 4U8HA 4DJDC 1A4UA 4PHTA 4ALNA 5EPUA 4Q4HA 2XA2A 4BZQA 1VPVA 1I6KA 4WFJA 4WNIA 1SCBA 1E4EB 1QZZA 1EFKA 4C20A 1WZ2A 1GRVA 3M4XA 1UPAA 1A9YA 1HE4A 3QM1A 4B76A 4POOA 3RVRA 2PWAA 3GROA 2BBSA 2W2MA 2I87A 4UVGA 3ZOZA 1FFWA 2R5WA 3PLAE 1LNZA 2VO1A 2VQSA 1IZYA 5LD2C 2DOKA 1BXGB 4BWJA 4EX7A 3ADOA 4TQRA 2VP6A 5E6SB 3PMNA 2JB9A 2WUDA 4N7MA 1L9KA 4Q3KA 5TR9A 1H3EA 2V7WA 4PZLA 2VUUA 3FDFA 4ED8A 1E2BA 3RVBA 4NZ9A 3L82B 3PGLA 4MS3A 4PBSA 3DLHA 2MUTB 2XJ4A 2H85A 4OG2A 3VPSA 3DBRB 5BR8B 3ORYA 1U6IA 2ATCA 5FDFA 1YDWA 5ICCA 5GOZA 2O8FA 2ZRMA 3D2AA 3ZV6A 2J08A 4M8KA 2JJ2A 5LZ5A 2WTFA 1DO8A 3OT1A 4HWKA 3M81A 2BM8A 3QGMA 5GM1A 4E4YA 4FIZA 5JTUA 4MRPA 2ZCUA 4FCWA 1P6XA 4LTMA 7REQB 3MJCA 4RPGA 3L3FX 3C2QA 1X94A 1WXGA 3W04A 5B57C 1UFKA 3L7BA 4ED0A 2R6AA 1VKRA 2FSGA 2R8RA 4YJHB 4V3CA 1W2HA 1TVEA 3REQA 2C2KA 2RGWA 3K0BA 3HYCA 5CFOA 3HCWA 1BPYA 5BN4A 2OGZA 1UP7A 5IC5A 3T7EA 1OJ7A 4Q24A 1LPOA 4UB6U 2JAPA 2EQYA 2WWGA 3KKZA 4KLTA 5K4GA 3HJUA 4ZU1X 4OL9A 4IQ4A 5CLLA 1H1DA 3ZIUA 4AJJA 1KP3A 4D9MA 1J07A 2CJWA 2VUTA 3K5HA 3UGQA 1MNQA 5LM3A 5TIIA 3QTTA 3LYUA 4IVQA 3L1UA 4XFDA 5CHYA 3MUOA 2NXJA 1S9FA 4HX5A 3PGVA 5H3HA 4CUZA 5EXDA 4KZPA 1SKWA 4OMUA 1YDHA 4DB4A 2BPCA 1EJ0A 4YT8A 5IUKC 4DREA 3TPZA 1K4MA 1RPJA 2Y1LA 4POAA 4IFIA 3E2PA 5IUJC 3NHZA 4J7CA 4UUPA 5TGZA 1YWGO 4FWBA 4G86A 1IAVA 4OK6A 2H3ZA 3HN6A 3V6JA 4QDKA 1DQZA 5LN1A 4CF7A 1N8NA 3EGXB 2QLBA 4GU5A 4Z7JA 6PFKA 4PR3A 4ZYWA 4IV0A 4F1KA 3PNOA 1JB1A 5LQJA 3L0ZA 2C95A 1D9DA 4FNGA 4HEQA 3I72A 5LMNB 1FS5A 3Q10A 4MLCA 3WAKA 2BHRA 3SEQA 1K2WA 1C1YA 2JD2A 2JGLA 4G85A 4M9CA 1YMQA 1ULBA 5H1YA 4FGUA 2XVXA 4IZHA 1W88A 3DQQA 1JT9A 2ADFA 2YDXA 2XWSA 4L16A 4N5DA 4E88A 1IOLA 1ZCBA 5A1JA 2XUPA 4D41A 1W76A 1N5JA 4BNDB 2DJ5A 3EA0A 4KE8A 2OXIA 3RVMA 5JRDS 1LX7A 5BSHA 3NBKA 1EH5A 4GD3Q 2O54A 3T15A 3SR6A 1TIBA 2X13A 3IVMA 4J76A 4OFXA 4RACA 5DM4A 3UT0A 5TMDA 4YQFA 1W47A 3D6HA 2OFOA 4JQCA 4KR2A 3GT0A 8ATCA 1PWYE 1IOVA 3AR4A 3C5WP 4C7ZA 3IHWA 5AT1A 3CLUC 4W63A 1C9JA 5EQFA 4DYHA 5HIMA 5CA0B 5K5EA 2AC7A 3W34A 1IN1A 1UJMA 2QTAA 2FN4A 4IQ0A 4MR8B 4O2BB 4FSXA 1SXIA 5JRZA 1ECJA 1DFHA 2G06A 3O7MA 5KFQA 3D4BA 3K1JA 4HFJA 4JJGA 2I6XA 2Q2QA 1IB6A 1OZFA 1UKYA 3L1KA 3VR4H 2ZRFA 2FG5A 3F6BX 4DADA 1GR1A 2CCGA 5A62A 1DGQA 5CT5A 3NORA 1WG8A 1TPZA 5COBA 3HJNA 2VP5A 1QO7A 3OIWA 3TW0A 5BVGA 1MIOB 5J2EA 2VUIB 3H1GA 3EFOA 2RHBA 2QU7A 3CINA 3QEMB 4R69A 4IL6U 3IUPA 5CNKA 2WB1F 4FFDA 1KZ1A 3NIDB 4IUYA 1Y1LA 3PXDA 4DKXA 3H75A 1UFOA 1YQ9A 1EP3B 2OXEA 3II6X 3UQ0A 4IGIA 2WTUA 4DQXA 1R88A 1R64A 3K9NA 1FMJA 2VAMA 1FUIA 2FMPA 4JJ7A 4OXIA 4R66A 1Z47A 4YRDA 5ELLA 4NENA 4YT2A 1ZNQO 5COQA 1TJ3A 2AW5A 5I7OA 1JPJA 4FFLA 3PDIA 1W8DA 3DXXA 2R8JA 5KJ1A 3NM5A 3HJEA 3TX6A 3OZDA 3C6QA 4WLOA 3TTUA 2A9PA 2ATXA 2WVHA 1IQPA 1WXIA 3OT4A 4H0FA 4OJYA 1O6FA 5AH0A 5DBIA 1RJDA 4BKPA 3AVUA 7ICNA 1XWWA 4AYXA 3C29A 4DAEA 3KIPA 1R5OA 5ETJA 4BFWA 1VKJA 4WZAB 1TEXA 5EKTA 2R8EA 1LV8A 3EDQA 4PG4A 1G5IA 2B4TO 2Q5QA 1XDWA 1GTG1 4IIYA 4W8OA 2WTEA 5GP1A 5JZMA 4ND6A 2A9FA 5DGIA 3URMA 4GOND 2GH1A 4KLIA 3VCBA 3PPIA 4IIBA 3X1WA 1QRTA 4W5WA 2FQXA 2D06A 2ORVA 3HU5A 2WQ6A 1I4OA 3P5SA 2RGAA 2R7LA 1U2GC 4CR6A 3U4QB 1NUSA 1LGYA 4ZHQA 3ASUA 3EDRA 3R3YA 3R9WA 4QU8A 4G81A 4BP9A 1CRQA 2VRWA 4E1AA 1XPOA 4N8EA 1QGUA 2FR1A 2BELA 3LFTA 3ZWKA 3I4CA 4ZTBA 3HMQA 1YOVB 2QR2A 4F5OA 2BOVA 4UUMA 5G0UA 1Q95A 1LPNA 2XYRA 3UK7A 3WC4A 4BCDA 5IIOA 4I46A 4FNAA 2GCNA 2C58A 4N1AA 5HVNA 4MVJM 3LTNC 4RQ2A 2BGUA 2AJLI 2R7KA 3ZW7A 3U3RA 1QF7A 3B60A 2IY7A 3M49A 1Q7TA 1YSCA 4MSUA 1SQ6A 4NENB 2Q2WA 4AF6A 4GDMA 4MQ4A 3A4MA 1P4JA 3N8GA 3V34A 5B1HA 2NYUA 2P6MA 4Z9AA 1S8OA 3ANMA 1XROA 5IXJA 3TG8A 4DCSA 5FPYA 3GRFA 3D0RA 4MKHA 2EFEB 3AM5A 2WMNB 4EYGA 2AXTU 2IW3A 3TLBA 3VHXA 1RI3A 1JT2A 4DSLA 2DTXA 5HWSA 1DIRA 2G80A 2VUHB 1QHNA 1C2TA 5BOSA 1MIOA 4KNYA 1T0JB 2Q1SA 3AOEA 4KDFA 5K3DA 3E9NA 1XLTA 1ZA2A 2NYAA 3L9WA 5D3KA 3C4QA 4JYCA 4NZPA 3DF9A 3LUBA 2B8EA 5JW6A 2FPKA 2JKZA 2W22A 3FCYA 1PVRA 3PFWO 4K6MA 3L4PA 5CLHA 2EH9A 5ILQA 1I2BA 3BCSA 3H2BA 4DWJA 2ACVA 5MFPA 3T5LA 1ZOOA 1F3OA 2VAVA 3W2HA 4OM8A 5KOIA 4DPMA 4UTRA 2ASVA 5JTIA 4DL2A 2WZCA 5DV9A 2BGNA 3UN1A 1G8GA 1VHQA 3RD5A 1YQUA 3G5TA 1JI0A 3BERA 4IDFA 4IKEA 2GASA 1IVNA 3N2GB 1ZW6A 4F97A 3DV2A 5FULA 4UUQA 4F85A 5B4TA 4YJ3F 4QASA 4E21A 4KVFA 4KVGA 1CJVC 3AFHA 1LTHR 2OTCA 1LDNA 2JCVA 1K5DA 3AY7A 3FPAA 4QWMA 2CXPA 5JR3A 2W8LA 1MN6A 4KRXA 2CNOA 1IM4A 2XYVA 3KEGA 1T9GS 1RWOA 3GJ3A 4L6IA 2WM8A 3KLOA 4HSEA 4DCMA 4EJSB 4DPKA 3MIZA 1EWQA 4EY6A 3N2ZB 2ERCA 1U2QA 2FDRA 1EFTA 1OBCA 4BBJA 3OWHA 4EQZA 1OT3A 2MSDB 1RXVA 5DT9A 1H85A 2MHCA 2PLWA 2WB4A 3EAFA 2Z2ZA 2ZQZA 1BHO1 5HOQA 5BOSB 1UOPA 6GPBA 2AF3C 3IB3A 1WHTA 5D87A 3TYXA 2JFZA 2PVCA 1YA4A 1WCIA 4OH1A 1MOZA 2BSQA 1EKXA 1F2UA 5T8KC 1Y5LA 1Q44A 3V8MA 3CRMA 1WWVA 1FTYA 4FOPA 2GD6A 1TQ4A 2ZULA 3HM2A 4I3GA 3H4DA 2I2BA 2IS2A 4CM6A 2DM6A 2E8PA 3S8MA 4JOSA 2Z6QA 1X0VA 2PSDA 4GM4A 2CHEA 5I7FA 4X66B 4R0NA 3DD1A 4AWBA 4O3RA 3TKYA 3KL2A 1RI1A 3DM9B 1SKAA 3DJYA 4OJOA 2FPLA 5KFSA 1LB2B 3BS5A 4I2AA 2YN2A 4MB0A 5CVUA 4TSKA 3IMCA 1UADA 2C1EA 1FZTA 4OOEA 4OK3A 3K4QA 4IGFA 3FN4A 4E5DA 4ETIA 2OGSA 4EKYA 2OOSA 2PG3A 1FNMA 3FYUB 3I9OA 3RSOA 4IJKA 4LCBA 4UQOA 1IONA 2DPMA 2F1IA 5E4TA 1NR1A 1RJ9A 1Y0BA 3EA4A 3WWCA 2JJYA 3VKUA 2DR2A 1KLNA 1ZIOA 2W2TA 5KI6A 1C7ZA 5G5GA 2VNIA 4E11A 2BT4A 4ENTA 4BNZA 2J6IA 4IDAA 1EFUA 3BD9A 5IARA 3MGKA 3QK7A 1LKYB 3JRWA 3V6KA 1T9AA 3DVAB 1FK8A 2OESA 1RYMA 1XHFA 3I5UA 1N1MA 2NVBA 1NR5A 4FYHA 5EEHA 1IXZA 2C77A 2NMVA 4R2JA 1N9GB 4M1WA 4AS2A 3FCAA 1O6BA 3QE3A 5FWYA 2X0FA 2EU8A 2V3CC 4WJLA 3NTRA 1M8KA 4Q9LA 3SNHA 5CMLA 1J2UA 1FP4A 1ZUIA 4EYKA 3HKEB 4DY6A 2KKVA 2QP4A 2E37A 5ALZA 2JK0A 3LIIA 4ZOLA 2J7PA 1ZQDA 3GFTA 2HMUA 1JIHA 2FEMA 2YWJA 4QW9A 2QG9A 1QGYA 2Y9TA 1P2VA 3DKVA 4KQMA 1UXJA 4BKOA 3U1VA 2YKGA 4BB5A 1QHIA 4KLAA 4G01B 4KR9A 4Z3KA 5AVWA 4LZJA 2Y0EA 1K98A 4G0NA 3K2IA 3N74A 3QV2A 4G1CA 3EIQA 1O97D 1CUIA 3AG5A 4BPBA 4O1IA 2QZZA 4MVJE 4TWBA 4JB3A 3ZHXA 4ZICA 1KEWA 3V6HA 1ZAYA 2XQFA 2QVYX 2IYFA 4Y0AA 1KQFA 4G8DA 4TQGA 1ODKA 3H4TA 5IH3A 5C3UA 3G2NA 3NJRA 3B1JA 1XNJA 3CLHA 1MA0A 3EMDA 1WY5A 1ZUD1 3GP3A 1PBTA 2W2KA 2XUOA 5KNBA 2NTNA 4HRAA 1RZRA 4H6WA 2WOJA 3L2OB 3OP1A 4Q00A 2XEDA 3LY8A 2OQ2A 3RYIA 5CJ2A 1KO8A 3ZHSA 4YP5A 4AKIA 1SIUA 4RHFA 4YQZA 2WWVD 3V7FA 3WSVA 3EW7A 2PMEA 1P2DA 3DR5A 2PT9A 4C0JA 5ALFA 4ZMBA 3LUPA 4IIEA 2GA8A 3AV3A 5ECYA 4ZC1A 3TX2A 4GC5A 5EP4A 4AFNA 1KYTA 4JI2B 3L0SA 1P7PA 1KEVA 3KFVA 3DHYA 3ZK7A 2DUJA 3X1DA 4F84A 2PD4A 5EWMA 4CW7A 4UB4A 1G9TA 3GFFA 4Q9IA 3TQCA 4BQRA 3TXXA 3OETA 2WYWA 1MO5A 3CX4A 3O83A 1GKKA 2HYDA 2PH7A 2YICA 1NUPA 3QTBA 4AKSA 5TT1A 4EB3A 3OJEA 2OMEA 3K70C 3H2ZA 5HKLA 2P2YA 8ICZA 4OQFA 4LJKA 5I9NA 3RR8A 3RRGA 7ICEA 1YBMA 2XI4A 3MTGA 5J2TA 2IZZA 5KT6A 3BMCB 4OHKA 3TTSA 1TM2A 1I7PA 1OD6A 4OVKA 2ZSIA 1FFAA 1V4BA 2O4CA 4RQNA 1TCUA 3QEKA 5KYWA 2JBWA 4DLSA 2V0GA 3ZY6A 2ATIA 1JAZA 1XZLA 4OGGA 4A91A 1Z5GA 3PVXA 1Y6RA 1HH4A 1B3RA 5AMXA 3WL7A 1IQUA 1MGPA 1SRRA 2JGKA 2O3QA 2VHQA 3BRWD 3IQXA 2CLKB 2JHFA 4G5SA 4NYMQ 2GPSA 2JK1A 2PV0A 1GUYA 3H9QA 3LPNA 3PRYA 3T1QA 3ALRA 3SZ2A 1MJHA 1I51A 3BQMB 4L8VA 4YMMA 1KPGA 1TAHA 2IYEA 2P5TB 2X3YA 4PYIA 3RYIB 3SOPA 3TZCA 3LVBA 3ABIA 4YTEA 1HSZA 1T0UA 3KK0A 2AZTA 4C7YA 3CX6A 4UNRA 5CCXA 1QMGA 1I13A 1U90A 2P3LA 2YX1A 2WPNA 3L8FA 4F96A 4HLUA 1VFPA 2XY7A 2FPGA 2PXAA 3DEZA 3ILXA 4HWPA 4WEQA 4YJ2F 1IH8A 1Z6PA 1AM4D 3SXUB 2RH9B 1B15A 3VYSB 1MRNA 4XIFA 4EG3A 4D9KA 4F1JA 4F3KA 1YASA 5T5QA 3OVMA 5J29A 3E0FA 4MQBA 1NW7A 2GDZA 3L8EA 1L4YA 1ZQLA 2VDJA 2E5SA 3OCXA 1VOTA 4XYBA 1EUCA 1PR4A 3IMGA 5KWVA 2O5VA 4JWMA 4NV3A 5DHAA 4HAYA 4L5BA 5DYWA 4RTNA 3VJRA 3ZGLA 3T4XA 2OKGA 1L7DA 2TS1A 2ORYA 4IXTA 4D5EA 1E58A 2XUFA 4FBGA 4QJFB 1JP7A 1U3FA 3NXSA 3REQB 3TZLA 4B83A 1OB5A 2MSNA 1XS9D 2D6FC 1ZWLA 2PL5A 1PUJA 4GF5A 1NMEA 4HYTA 5D3QA 3AF6A 3HDHA 4EEYA 4C08A 1W7AA 4PHFA 4QUIA 5JCPA 5E9AA 1KEKA 2I91A 4ER6A 3UXEA 5LQAA 3AUXA 2IUEA 2KV2A 2H1OA 3V6LA 1AK1A 9ICIA 1EE9A 1OFHA 1ZITA 3PK0A 2BMWA 1N6NA 5JRTA 1DOAA 1SZDA 1XZFA 3G59A 4MJLA 1JDNA 5A7HA 4J0QA 3ZU4A 4C0QC 4CQLB 4F3NA 2XH8A 4B6GA 3WGKA 1TLTA 2YHAA 3E9MA 5TE9A 1HDZA 5A5FA 4CF6A 1CUHA 2PRJA 3ZHRA 4DNOA 1WU8A 2UKDA 5FT9A 1EUDA 5BXQC 1D4FA 2NV3A 2PE5A 3B6IA 2QD5A 4R40A 1DG3A 4U3JB 4XZ3A 5B4VA 1YVEI 4BHTA 4ETWA 3P0FA 2IYRA 3VPGA 1XWLA 1CUCA 3DZKA 4IMRA 1T24A 4QJBA 4UU8A 4CR7A 2H92A 1VDVA 2RH5A 1JX6A 1JJFA 2FUG1 3UOGA 1SVIA 2BY4A 2WWWA 4MUNA 4FSHA 8ICBA 2G07A 1O89A 4JYMA 3TSAA 1U7XA 3QPBA 3V46A 4ITRC 3WGHA 3L01A 2HCJB 1YO6A 4JODA 2IYVA 1YS6A 1JIXA 5KYYA 5DO9A 3ROFA 1RQGA 1LLUA 3DL7A 5JCOA 1MTZA 2A9RA 4HDNA 4ZYTA 2FN3A 4YDQA 5M7EA 3P4YA 2MYPA 3QSYA 5C32A 1KI6B 1WXWA 3D7SA 5B1DA 4BN5A 3TEJA 4J4HA 1L4UA 2YN4A 2HNKA 2C3YA 2OOKA 2B9EA 2D8AA 4IW3B 3C3DA 4L51A 3ZOKA 4E5MA 3C3YA 2E3TA 3DVQX 4O9MA 3OZAA 1X7DA 1KTVA 2JCGA 1CTQA 4ZCPA 1P72A 1T13A 3KR1A 2LHTA 3AILA 3VC2A 3DTTA 1M1YB 4AICA 1Z7EA 4C7MA 1M5TA 4FE3A 1C1HA 4TQSA 2B25A 3RGGA 1TUBB 4N3AA 4BO4A 1WZUA 3CM0A 3L0IB 2WVGA 3WICA 3IP5A 1QU3A 1KTQA 5DM60 5HZMA 2OGWA 2J3KA 4ZVQA 4PGGA 2QTWB 1CLUA 4F5ZA 4BGDA 4F5RA 2IDJA 1XJ5A 1I2ZA 3E18A 3QPUA 1V2GA 4Z8XA 3S2IA 3SF0A 1CEZA 3UJCA 2PMBA 2YXEA 2H08A 2OCBA 2VDVE 4LHXA 4Y1RB 2X0EA 5CM2Z 4HDAA 3QLJA 5HCUA 2ONYA 1EBFA 1INLA 4IFBA 5JEEA 5DKWA 1L7OA 2WNHA 1FRNA 2QVCA 4XQ0A 3E8MA 4M3NA 4DMLA 2WNSA 3CFYA 2DWOA 4QHYA 5U1PA 3UANA 2GD2A 1JEQB 3STHA 1JXEA 3JD2A 3QENA 4NBKA 3T5PA 4KLCA 4EKIA 2IF0A 3BD7A 4OMCA 4RIGA 2E3JA 2W71A 1AB5A 1VLZA 3H2KA 4HYEA 4IH1A 1TKBA 4PZEA 5FB3A 2X76A 1Z3CA 3D0OA 4YAOA 2IWHA 4DG5A 5I9TA 2PYZA 3PC8A 1DCKA 4GPIB 1P18A 4ZDKA 4QWAA 2ONZA 2VDWA 2PQMA 2A67A 3T5TA 4AYTA 5KQMA 4ZODA 5F1KA 4UZSA 3AY0A 5EUMA 1DQNA 2GVNA 1XTPA 2CMHA 2FG7C 3O92A 1ZM2A 1M1XB 1RBYA 4W9NA 4K6KA 1JU9A 1EVIA 1WKBA 3RNLA 4HT3B 4S05A 2JLVA 3X3HA 5GAJA 4JBGA 5FPQA 1YTLA 4R3UC 4RNNA 1Q1AA 2RCNA 1KF0A 1PJ3A 1TVKB 4UB3A 1SVKA 2W6ZA 1XNSA 2CNDA 3ILVA 2FQQA 2BCQA 3IMFA 3WIDA 3EHEA 5KNDH 1UBSB 4YJ3B 3HGMA 4OHVA 5TPWA 1YUMA 2Q2OA 1XZJA 4QZHA 1NIJA 4FONA 2CXYA 3ZN2A 2H1HA 1ZZEA 4MUXA 4J1TC 1KPIA 3G7UA 1X1BA 1VI2A 3M6LA 2V7UA 1XCLA 4TL8A 4J9KA 4EZ6A 1I24A 3UCEA 3ML1A 3WMGA 1XZQA 3VC7A 4OFBA 1O2DA 2ODAA 2OXFA 3ORQA 4R31A 5D86A 1OXJA 4ND3A 5ILGA 5DCWA 1OE0A 2QYOA 4AXXA 2CL6X 2WV7A 1Y9ZA 1WBDA 2JRCA 3F7TA 1CJKC 3F1LA 3GEBA 3QWFA 5CXXA 3H13A 1DOZA 3S7ZA 3E1GA 3QKTA 2YZMA 4GGPA 2JA2A 3M2TA 3PI7A 3OE4A 2F90A 5ICGA 2OY0A 4IDQA 4R1SA 4Y1FA 5EKDA 1K6EA 5IJ9A 1AG9A 3H42B 1U4BA 4O4IB 1AN9A 4Z0TA 4UTNA 3FHLA 2RGYA 4MCAA 4LSMA 1AA6A 9ICMA 3CE6A 2QOEA 1QIMA 2QM7A 4GLOA 2IOYA 3BS4A 5BSUA 2EKQA 1U49A 2GKOA 2FEOA 3GILA 4JLSA 2HRBA 4CCWA 2ENWA 3R5KA 4PYRA 3PO4A 1JFRA 1DEAA 1T34A 2AN5A 3H9BA 4B87A 3GFKB 4A92A 3Q1KA 3VR0A 1ABFA 3A7DA 2ZTDA 3AI7A 3B6KA 3LXXA 4UEJA 4B9TA 16PKA 3KTFA 4K86A 4A8JB 3NVVA 3QKRA 2CSUA 3L8YA 1VBFA 4GPD1 1UMDB 3WLFA 3AL0C 1V11B 2J8ZA 3ZK9A 5FP0A 3W8NA 3MK31 4C3OB 3N28A 5JHGB 2EW2A 4MEBA 4S1NA 4W6QA 1ULSA 2QBYA 4L5CA 4XRRA 3P5BA 4WK6A 2X2FA 3W2TA 3S8EA 4JJAA 4C7XA 2QENA 3OY7A 1TTTA 4ENQA 1XLVA 1KBUA 2H5LA 2VH1A 5KDLA 4CM1A 2PX2A 4ECRA 5FH9A 4JC8A 4HAUA 1Z34A 3HUDA 3U1TA 4O33A 2OA0A 1OTXA 3V8EA 1W5AA 2JEJA 1XCOA 1TT5A 3L05A 4GMHA 4RKRA 3ADBA 5ALWA 3M6FA 1A1VA 3ESAA 3QEJA 3QLVA 4RE5A 5CR9A 3T61A 2YJ6A 1Z82A 3F3KA 4NOLA 1LI7A 3I5MA 4YJGA 5CX1A 2WHPB 5DIZA 3OURA 1LWOA 5CYGA 4FMPA 1QANA 3N2EA 1QDLB 1KDYA 1EB8A 3SC2A 4DMHA 3TZKA 2FMSA 4PAQA 4BNVA 7ABPA 3LD9A 3DE2X 4X6YA 5LB2A 3G9TA 2A1JA 1TK5A 2C7VA 2GVZC 2CK3A 2O7QA 1UM8A 3USES 2C9YA 2QAJA 4YMIA 5MFZA 1E5VA 2XZDA 3QH4A 1A1SA 2O6LA 1R74A 3N07A 1H2WA 3L7AA 3SJ7A 3HE3A 4B75A 2FF5A 3D8HA 1ZRNA 3S44A 3CUYA 4IO1A 2OHFA 2WZDA 1U81A 3X44A 1IY0A 2AVNA 1SR8A 3QXSA 2DYKA 5J47A 4PZPA 4E03A 4KE6A 2Y4OA 1BXGA 2B20A 1WV0A 5JAQA 4HD8A 5IC6A 3OQIB 1XO1A 4JLMA 3VNQA 2ASJA 1JE1A 3D6MA 3QEOA 3VZDA 3ORHA 3PTLA 1YRQA 3AV0B 5GTDA 2DQYA 4RZSA 3E7WA 5ER6A 3I05A 5J2IA 3WLQA 3IRUA 2I4LA 5J2BA 2IEZA 3QLVC 4D4MA 2YJ5A 1E66A 5JVDF 5IIIA 5IIMA 1E96A 1OC4A 3E4CA 1YGYA 1ECFA 3FFWA 5GONA 1R10A 3IAM1 5KG3A 1PGJA 4FFWA 5CTAA 2WM9B 5BQOA 3WGNA 3R4CA 4C7KA 1UPBA 4OXKA 3RRNA 4CT4B 1CF2O 4E30A 3UJ6A 3I9FA 4KLZA 1I5OA 2PDAA 4IWXA 1E6LA 4I29A 1TL7C 1V26A 2WM2A 3MTAA 2OENG 5A71A 2Q7OE 3KE9A 4FHEA 3GLHA 4HFMA 1ISSA 4X1IB 4JX8A 1V96A 2RHWA 2D2FA 3JPOA 3WKDA 2XDYA 3LQRA 2GFIA 5BUCA 4RK6A 1T7PA 3SZGA 4EHLA 2CB9A 1NW4A 3DDOA 3SDSA 2BGGA 2PQ6A 4HNAA 3S7TA 3DMYA 4KL8S 3B6MA 4XGQA 5KYGA 1BCRB 2WSIA 1T1EA 1E2HA 3G9UA 1BDMA 3CF4A 5JZ9A 2JAUA 1Y89A 3N0WA 3NDJA 2W8ZA 1H4QA 3GH3A 3I83A 1G0OA 1NA5A 2CXSA 1AUOA 2PZMA 5AD1A 5FJIA 1U9IC 2SKDA 1ZYQA 3GJSA 2HMAA 3FWHA 3D2NA 5JSUA 1UC5B 2BFEB 2CLFB 1OSNA 3DZDA 3E5HA 3KVVA 4MA4A 4UHKA 4YRFA 5LIRA 4Z53A 4FYKA 1IJBA 4XD7D 4LE2A 6REQB 1RRCA 1NXTA 1IXSB 2KVSA 2CXHA 1XRNA 2CFTA 1DCFA 3BXZA 4O4HF 5DDIP 4BNDA 2QA5A 2Y1EA 3C6ZA 1YA6A 3H0LB 3ZWMA 1XB2A 1YDMA 1Z19A 3M2PA 1QHHB 5DYNA 4YB8A 3OCVA 4GO1A 2EG5A 4JVNA 5EYPA 2GWRA 2IPNA 2WDPA 2XGOA 2YR0A 4EKGA 3KT6A 2IHJA 3IPCA 2B4YA 1LDBA 3OA2A 5EXPA 5HG0A 3OF3A 3DLAA 4BO2A 4TZ0A 3HZOA 3K73O 5DI3B 1NRWA 2WIFA 5AW1A 3ABOB 3MNFA 4RYLA 5KCMA 3EF3A 5DT2A 2QB0B 2H63A 4XQEA 3CW2A 1M1NB 5FBLB 4GWKA 1K8XB 2DZDA 2ORWA 3BFKA 5ADHA 1QRAA 1WR8A 2AEJA 1ISGA 3JQBA 5EIHA 1Q21A 3DTVD 2VG8A 4QSMA 4DIOA 3E2MA 1CJSA 1EVKA 3MBOA 3MMZA 4QZCA 9ICFA 4L73A 4R7GA 1XAJA 2KKPA 3QVOA 2G4VA 4US9A 1QTIA 4WAUA 2E89A 1FP7A 4PHPA 4NJEB 3DONA 3C3BA 5IAOA 5IVPA 1CX9B 3N6RA 3QW2A 1B6RA 1V41E 1SQ0A 1YHZA 2YC2C 4TRNA 5U4XA 1Q14A 2EP5A 1PU2A 2XCPA 5A4DA 2OCYC 4BYGA 3CEAA 1P0CA 4IS2A 4L0MA 1WQ4A 2J9YB 3RSSA 4DR2B 4R0VA 2WC1A 3OIVA 5C8XA 3AKYA 1NG1A 2M1ZA 1NK4A 4C0AC 3QF7A 1CE8B 3RS0A 4B4DA 2QLFA 1M34A 4D8TA 5JMWA 3CW9A 5K0TA 1Q0LA 1QGDA 2QTBA 4LJSA 1OC2A 3DG9A 2B94A 1ONNA 2GCPA 3IEPA 1X1EA 4DW8A 5KAIU 1WXFA 4HVCA 3G5AA 4ID9A 5K0FA 3R4VA 4B9LA 2SKCA 3S29A 3F5FA 2C4WA 4TOIA 4HB4A 5K0SA 2PUGA 3EX7C 5EWEA 5JE8A 5JVDB 1V7ZA 2QR5A 2FRDA 2GKGA 4M9NA 3UB2A 3CU5A 2Y2UA 3BXFA 3EMKA 4PX2A 4CM8A 5AVUA 5KX5F 3I1JA 1O96B 1TM5E 4C8KA 2WWIA 3SXPA 5JJCA 1IUPA 2EV9A 1U7WA 3WKBA 2X8AA 1TJYA 2H9AA 2XGGA 4LYDA 1SCQA 1VLBA 5C35A 2K8BB 1YMUA 2ZBGA 3CN7A 3NJ8A 5T57A 4Z1OA 4PL1A 2LGJA 4BNNA 1RAHA 1AF7A 4KOEC 9ICAA 3HN2A 1Z3IX 3G85A 4OEHA 1V1RB 1OW5A 2F6RA 5I5GA 2ZI6A 1SC9A 2ZVQX 1WVMA 5T41A 2UV8A 3U3XA 4BLQA 3QVGA 4AO8A 1G41A 1P62B 3PW7A 4Q02A 4GP9A 5CP8A 4E5UA 1H2ZA 3KZ1E 4L57A 1KY3A 3EPGA 1L8AA 1F17A 4NCAA 5D8DA 4CDNA 5FEMA 3PWTA 3KS9A 4XX0B 4JR2A 4MYRA 3SIPA 5B6JA 5DB6A 1WNTA 4EZEA 1RM5A 4D7AA 4MP3A 3TQQA 1FUEA 2YCBA 4JKIA 4B4WA 3OICA 4TRRA 1E5LA 1I30A 3RB3A 3KV3O 2BCEA 4Q47A 4EMSA 4KR7A 1RCTE 1UFVA 1R00A 2XZTA 3LQ1A 3OX4A 3IIJA 1SXPA 3FNFA 3H4VA 3NMUF 4NKRA 1JSCA 4L7VA 4B4UA 4YCCA 1U0FA 4AJ2A 3K8OE 1RT9A 4I2BA 3EZYA 1XVLA 5HNKA 3IJ5A 4KR0A 2NVUA 5KAFU 3IG5A 5FD8A 4EF4A 2NW6A 1XPRA 1O94A 2HLDA 4NMLA 3EMBA 3UK0A 2WLSA 5JZOA 3RJIA 4CG3A 3TW4A 4G26A 3LDAA 3UBMA 3NTUA 1XUOA 1WMFA 2HBRA 1S3SA 2O2XA 3VJKA 3BCHA 4CL0A 2QIOA 1W0KD 5IINA 3U7QA 1RYYA 1DUIA 5KG0A 4KLNA 1KP2A 2BTQB 3GQVA 2PKRA 1QIDA 1X0XA 2QRUA 2VQDA 2IHTA 2WQZA 1D3AA 1M2HA 3C85A 3IHKA 5DYIA 5JC8A 2KIWA 2G25A 2VVTA 2B5VA 1ZNZA 1R6DA 1HFEL 4RDXA 4URHA 5HW0A 3KALA 3M3HA 5ESXA 4LDQA 3C28A 2FMUA 2PR7A 3EXHC 1FS6A 3E81A 4L4ZA 3C5GA 3FI0A 4ZCQA 3ZQJA 4BZWA 4EDFA 2ZCJA 5EXTA 2IGBA 3ANTA 1Y7PA 3BHJA 4RCVA 1DKLA 1DRVA 1YVPA 4D42A 2RHHA 2R11A 2XSZD 3IPXA 1W94A 3MBKA 2Z08A 4WCFB 1WMSA 4EIWA 1Z56C 5ARBA 3ITNA 4WUVA 2JCXA 4P2GA 1B6TA 2F1KA 2YZ7A 1JJBA 4KWIA 4YYZA 2RB5A 4GPBA 1IZ0A 4FZMA 4AY5A 2OLJA 2XUAA 1VQ1A 1LBHA 2C2WA 3K9QO 3KHHA 2ZT7A 4O2AF 2JIZA 1BYIA 2XOEA 3CF4G 3HG7A 3MJVA 4PXYA 3OEEA 1XRPA 3V1UA 3V7UA 1USKA 2IF2A 3V33A 2O50A 2UZ3A 1BNCA 3BPSA 4Q12A 3U4AA 4BQNA 2PUEA 1Z2OX 3DM5A 3RFUA 1O5OA 2NLOA 1QCYA 4IDHA 3VTZA 3FMVA 4YAIA 4YIHA 3NZEA 3D2QA 2FX3A 3RFTA 3V2IA 1CS0B 1TGVA 2GZSA 5A0TA 2HKIA 5MN5A 2IHKA 3B82A 3M1IA 3EEIA 2Y1KA 2N1MA 2FEWB 3QELA 2GQ0A 1R2QA 1S2IA 2IXBA 3GLIB 1D8TA 3DAPA 3QXJA 3AEQB 1P6UA 2Q07A 4JLWA 5IAKA 1ADFA 2R86A 3BWBA 3H0EA 1C3OB 1NJFA 3PQDA 4B8YA 3U31A 2ALJA 4FC7A 3KEMA 2BONA 1J21A 4FBTA 2V0NA 3KHTA 4TS3A 5CIQA 4DJAA 3W5UA 2E85A 3N5KA 4U39A 4RQMA 3LQ2A 3L0BA 3ZE1B 1F14A 3O2QB 4QPZA 3CR3C 1YOBA 3F3MA 1U8FO 1ZNXA 4CDMA 2KTQA 1RNLA 4HAXA 3V4VB 2NZYA 2B34A 5CBPA 2VFAA 3V4LA 1E94E 3MT0A 4L75A 5EXEA 4DJEC 2FH5B 5JVDA 5HMMA 1YZ6A 4DFJA 1ZINA 3ICPA 4JITA 4KLSA 5ALKA 1UQUA 1UXHA 2VXYA 3JXEA 4Y6SA 1FY2A 2D0DA 3E35A 1I14A 3SNKA 3QBEA 3EVZA 4L08A 1U3WA 4PSUA 1DAEA 2Q1XA 1PFYA 4OH7A 4Q3OA 4TT8A 4RVDA 3KSAC 1HNWB 2RLTA 1GSIA 2II6A 1JMSA 4MO9A 4U6PA 1YONA 2JFBA 4HADA 3C5CA 3UUFA 3OECA 2XMBA 4JHXA 5D51S 3GMSA 2ZR9A 3IUEA 2H07A 4PE5B 5ERYA 2R7MA 3RYHB 2XCRB 2VP2A 2ZAIA 4TVSA 1NWHA 1R12A 3P0HA 4EHBA 4DANA 3SZRA 2YHBA 5KNCA 1A3CA 1JU3A 2ZRAA 3I9V1 4KMOB 1P9OA 2G77B 2VYVD 1P8AA 3L8MA 5C5DA 5A03A 2MJLA 1NPTO 5JQGF 2QSJA 1L0BA 4FR5A 3B9RA 1Y42X 1HLFA 1NIPA 4UREA 1JKFA 4DSTA 3Q11A 2P9CA 3CCCA 3EF0A 2BTEA 3N8IA 5HQ3B 2HZ7A 3VPAA 2JASA 1Y4UA 2I6UA 4GPTA 4I2JA 3BQNB 3S1AB 3SENA 1SUFA 3U4GA 5GM2A 5L9XA 4YX9A 1J56A 3CG0A 1SZHA 4PO9A 1KFDA 4RF3A 1K97A 4MCHA 3I09A 2XMZA 1WOMA 2H59A 2W98A 1E2JA 1HFWA 3ZQUA 1ZGBA 3H0RB 4BFZA 1W85B 2FEKA 1GY8A 2AE2A 2F8KA 2WTAA 4WQMA 1CUAA 1JEQA 1WMBA 3QXXA 4HGQA 4YRJA 5CHEA 1ILWA 3EXEA 2ZYDA 1XKLA 3ZBUA 2M32A 3PC7A 3ZG6A 3JD0A 1A76A 1RYFA 2YINC 1GKUB 1PDVA 3RDPA 1CUWA 4EX6A 3T1VA 4F9TA 2WMDA 1ZMRA 4RJIA 4AY4A 2C5GA 4AY2A 3GIKA 1WEHA 2WHRA 4YAJA 3ZHBA 4LBWA 3COJA 2C5EA 4N40A 3NCHA 1ITZA 4I8IA 2NSLA 4XDYA 3V7NA 4F6RB 3UAWA 1P3Y1 3U7EB 2PX3A 3WXBA 2LR0A 3OSNA 2VJMA 1HDGO 4J2OA 4QT4A 2AUTA 3RODA 1JN0A 1M5UA 2W55A 2Z57A 3LDGA 3I5XA 4DJTA 4LY6A 1W36D 5CW2A 5F23A 2XT9A 3K6KA 4ZH4A 1O6ZA 3A25A 5JG7A 2X23A 1E4VA 1CIJA 3PDJA 1JR6A 3L40A 1UP6A 4ON9A 4RD0A 2R6ZA 5DOVA 5HZKA 5KHAA 4I2IA 2HF9A 1EG2A 1HRKA 3K1ZA 3HCBA 5I6DA 3F98A 2RSLA 2YX8A 3PX6A 3PQ2A 4H6XA 5H16A 4BFUA 2XQVA 3TFQA 3VH1A 2NTYC 3WZLA 2ZXEA 4WZAE 4KNWA 4XEHA 4AP6A 1JFSA 3WMXA 1Z6TA 4DV6B 3RUIA 1VDMA 4R9RA 5EIWA 4P9NA 2XGQA 3VPFA 3N7PD 1ZMTA 4RBNA 8ICAA 4WWHA 4DEXA 3PGJA 5EWFA 3R7SA 3ROKA 3B3FA 8ICSA 1H69A 1U3VA 4I5GA 4MS1A 5L53A 3HY3A 4PO1A 4TV9A 3FI9A 4ZO8A 3STVA 4OLAA 5C18A 4WJ3B 1TC1A 1UMBB 3UKDA 4DFMA 4DUYB 5CIWA 4WOPA 4DV1B 4Z1MA 2X7HA 1BWPA 1GZHB 2BJHA 4LISA 3DNMA 2B83A 4ND5A 1V1MA 4ZD6A 1PV4A 2AK2A 5AQEA 1KWKA 1DJLA 1P74A 3OPYA 2GBLC 4IF6A 5IASA 1XLTC 2HHHB 3RK0A 2LCFA 1MC8A 3M1AA 3RBZA 3N2YA 5AW8A 1OLXA 2ZAMA 3ANSA 1WWUA 3IGFA 2FE4A 1CY0A 2ZI9A 4NXZA 2D5BA 3ESCA 4ZV9A 2VZ0A 1UZNA 4HX2A 4O8ZA 2YIJA 1L5MA 4O3NA 4JEHA 2W7PA 4FMDF 4M38A 4U2CA 3KHLA 4YI5A 5FOSA 4DIBA 5BN4B 3DA8A 1TFUA 3CYMA 2C0PA 2QKQA 4YXWA 3U40A 3C3EA 4BJ1A 1N7HA 1FMTA 4JJEA 2YWEA 3W5IA 1ADYA 1QTMA 1TZCA 3ZNQA 4YP0A 5MGBA 3U61B 3GG9A 1X1DA 3RPEA 4DIDA 3K75D 3PFFA 5C5IA 4DLZA 3MRSA 5EESA 4B3FX 2FQ1A 4U2GA 1XF9A 3IIMA 4LVUA 3RSQA 4HS4A 5M2QA 4K05A 2CLSA 2QK4A 4XH9B 4R2LA 4BVEA 3N8DA 3RW9A 2NU6A 3UKJA 1VLHA 2YNMC 3CSUA 1WW8A 1XVTA 2BCJQ 3KJXA 4H18A 4TMZA 1TA9A 2PO5A 3A1WA 1N8SA 2VJNA 3RB6A 3PR2B 4FEAA 4I55B 1F4PA 1V1JA 4IWNA 4ZAXA 3WB1A 4BB6A 4U5XA 4JLKA 2WAYA 3SY8A 1VE9A 5AP9A 5FXMA 2IZ5A 5LQDA 3O4JA 4Y1RA 4F92B 2IYYA 4GBMA 2VQFB 5EHXA 1Z5NA 2NO9A 3PGA1 3S4YA 1R7RA 5DWQA