4DCCA

Crystal structure of had family enzyme bt-2542 from bacteroides thetaiotaomicron (target efi-501088)
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
203
structure length
203
Chain Sequence
KGIKNLLIDLGGVLINLDRERCIENFKKIGFQNIEEKFCTHQLDGIFLQQEKGLITPAEFRDGIREMMGKMVSDKQIDAAWNSFLVDIPTYKLDLLLKLREKYVVYLLSNTNDIHWKWVCKNAFPYRTFKVEDYFEKTYLSYEMKMAKPEPEIFKAVTEDAGIDPKETFFIDDSEINCKVAQELGISTYTPKAGEDWSHLFRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of protein Bt-2542 from Bacteroides Thetaiotaomicron (Target Efi-501088)
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
molecule keywords Putative haloacid dehalogenase-like hydrolase
total genus 77
structure length 203
sequence length 203
ec nomenclature
pdb deposition date 2012-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 4dccA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4dccA01
2G06A 3HLTA 3WKAA 3ED5A 4HGOA 1FEZA 1WPGA 2G1AA 1WR8A 4G9BA 3QUCA 5AM5A 1CQZA 3MN1A 1Z4IA 3QXGA 4NFLA 2G80A 1ZD5A 5AI6A 5A3QA 4EELA 3N07A 4CNQA 1RLMA 1Y8AA 2ZXEA 3OCZA 4FYPA 5AKJA 3EF1A 4Y2TA 2G08A 2ZG6A 3DDHA 5AKKA 3U7HB 1SU4A 3PDWA 1RKVA 4UM7A 1WZCA 2VKQA 4B6JA 5ALDA 1U2TA 2NYVA 1T9ZA 5T41A 2GHTA 3N5KA 2YBDA 4CF4A 4YH1A 3L5KA 3WK6A 2B8JA 1X42A 3FGOA 1NF2A 3I28A 4L6CA 5AVRA 2HI0A 1Z4LA 4OHFA 3W5DA 3PGVA 3AR7A 5ALJA 2WFAA 4BEWA 4Y2XA 5AW4A 2IOFA 5AVVA 1S8OA 3MMZA 2YMMA 4JDPA 1Z5UA 4Y2QA 3OCVA 3IJ5A 2FI1A 4C4RA 3AR8A 3D6JA 3R09A 1RKUA 1AQ6A 3SHQA 3ZVLA 4BBJA 3ET4A 3FZQA 4EZEA 4NV0A 3OTQA 2G07A 5ALGA 2HF7A 5AM3A 3FM9A 3R4CA 1WVIA 3AR2A 2I6XA 4EENA 3L8FA 2AMYA 4KX5A 3UMCA 1L6RA 3F9RA 3L8EA 5ALZA 3QUTA 2EATA 4C4TA 1RMTA 5AW1A 4Y2RA 2JARA 2X4DA 5ALWA 4DFDA 5AW2A 3QGMA 3BA6A 1JUDA 5AVZA 2YY6A 4UASA 4UARA 4L57A 5AW0A 4H1WA 2GMWA 5AW9A 5AKIA 1XP5A 2I55A 2PR7A 2YMPA 1YNSA 2WF5A 5AKEA 5AI0A 2JGAA 5JJBA 4EX6A 2O9JA 1RQLA 4HGRA 2R8YA 3B9BA 3N1UA 2B1QA 4IFTA 2YJ5A 3ZWDA 2ZOSA 4XE5A 2W4MA 5ALRA 2C4NA 4ZEVA 2I54A 3B8EA 4BX0A 5ALHA 3OCYA 2C88A 1ZRMA 3SF0A 4G63A 4UMDA 3ZW7A 2WF7A 3ZI4A 2P69A 5ALEA 1TJ4A 1IWOA 5A3RA 2FUCA 1T5TA 5AVWA 3OCUA 4GIBA 2OBBA 5AVTA 4QJBA 3WKBA 1Z4OA 3AR4A 1L7PA 1U02A 5AM4A 5AI8A 2FUEA 5AESA 5ALMA 3L0BA 5AICA 2MU1A 2YJ6A 2W11A 2G0AA 5AVSA 1Z5GA 2GO7A 1XPJA 2WF9A 4UM5A 4Y2SA 1Z4JA 1EK2A 2YMQA 3VAYA 5AKYA 4CF3A 2WF6A 4RETA 4BKMA 2I33A 3U26A 1Z4PX 2GFHA 1NNLA 4KN8A 2IOHA 4YIHA 3M9LA 2FPWA 1RLTA 1L7NA 3I6BA 3L8HA 2YMLA 3AR9A 1PW5A 5AK4A 5AI4A 3MPOA 2YJ4A 3L8GA 3B9RA 3QU9A 2NO4A 3SKYA 3RFUA 4BNDA 1L7OA 2AUTA 3QUBA 3WK5A 2PQ0A 4KNVA 4KYTA 4I9GA 3WKCA 4OD0A 2C8KA 2C9MA 3NASA 1L8LA 1ZD2P 3L0YA 1VJ5A 4DWOA 1LTQA 3CZ4A 1U7PA 2PKEA 4CE6A 1T5SA 2RARA 2ZBGA 3WK8A 1XVIA 1QQ7A 2HHLA 3A1CA 3QNMA 4Y2JA 1ZOLA 3KC2A 3I1YA 5AVXA 4YIKA 1TJ3A 3PGLA 2BDUA 4Y2PA 1L7MA 5E0OA 3DNPA 4L6AA 3EF0A 3E81A 2IA5A 4OFZA 1N9KA 5A3SA 3QX7A 2CN1A 3WK7A 4YCLA 5ALLA 4ZEWA 1SWVA 2MU2A 2FPSA 1MH9A 5ALIA 1RDFA 5AM1A 1Z88A 4BX2A 2B30A 5ALPA 1RLOA 3RF6A 5AW6A 2RBKA 3TLMA 3FPBA 3ZX4A 3U19A 1VJRA 3L1VA 3SD7A 1F5SA 5ALOA 3A3YA 1NRWA 5AI9A 3UMGA 5AK3A 1Z4NA 3QUQA 5AKLA 3J7TA 3CNHA 3MC1A 2RAVA 5ALNA 2G09A 3KOOA 2JAUA 3QLEA 5AKXA 3QU7A 3ESQA 4IG4A 4I9FA 1RMQA 2I7DA 4AP9A 1J97A 4Y2UA 4NAVA 4YGYA 4JB3A 2R8EA 3AR5A 4HGNA 4E88A 1TE2A 4RESA 1QQ5A 3SMVA 5ALXA 5AVUA 3FPSA 2ZBEA 3K1ZA 1K1EA 4EEKA 2CFTA 5AKZA 2ZBFA 2Q5EA 3BWVA 3HYCA 2B82A 2WM8A 5AK6A 3NRJA 1S2OA 1RC8A 3PCTA 3R9KA 3FVVA 1YJ5A 5AW7A 5AW8A 4ZEXA 3NALA 3UMBA 1ZRNA 3DV9A 3NANA 5AM0A 5FP0A 3AR6A 5AW3A 1Q92A 1YDFA 2HX1A 3ZVMA 2FDRA 2BDEA 3M1YA 4MUMA 1YS9A 2QYHA 3IB6A 3L0CA 2HO4A 3OCWA 2WHEA 4J2TA 3KDPA 4QQFA 4OCZA 4CF5A 3EPRA 3QYPA 4UMVA 2D2VA 3W5AA 4XPZA 1QQ6A 3DAOA 2P27A 3U7FB 4EX7A 5ALKA 3NUQA 4FE3A 5AW5A 1U7OA 3A1EA 3ZTYA 3ZTWA 3SKXA 2CFRA 5AVQA 4MWOA 5AIAA 2EARA 2FPRA 3ZX5A 3ONNA 4DW8A 2B1RA 4AS3A 5IT4A 4KNWA 2O2XA 2YFYA 4UU0A 2R8ZA 2ODAA 2YJ3A 4Y2YA 5IS2A 4HAIA 3KD3A 3WGUA 2W43A 1QYIA 2I34A 1RQNA 1TJ5A 3I76A 4UW9A 2HEGA 1YMQA 5ALFA 2Q4TA 3W5CA 2B8EA 4HYTA 3U7GA 3UM9A 2YN4A 2HOQA 2BY4A 1CR6A 2NO5A 4UAUA 3OPXA 5AIBA 3KBBA 2AH5A 4C4SA 4PNHA 4YCNA 2HSZA 4Y2VA 1ZD4A 3N28A 3ZU6A 4BEVA 3KZXA 2OM6A 3E84A 1O08A 3L1UA 4FFDA 3NAMA 3NIWA 4XQ0A 1RRCA 2Q4RA 4BYGA 3SLRA 2GHQA 3QU2A 3ZUPA 5AI5A 3WKDA 3QU5A 4DCCA 4UMEA 3ZVNA 2FEAA 2P9JA 2FPXA 1LVHA 2JAOA 2MSNA 4J03A 4GXTA 3ET5A 3QU4A 3GYGA 1O03A 3IRUA 1TA0A 1VFPA 2HDOA 4O8CA 2B0CA 3WK4A 4HGQA 2OYCA 3U7EB 2IYEA 3OCXA 3N8GA 1N8NA 1YV9A 4YCMA 2DQSA 2IOFK 1Z4QA 2ZBDA 1RKQA 4KX3A 3EWIA 4F71A 2FPUA 2WF8A 5AHXA 5IT0A 2OA0A 4HGPA 2EAUA 3ZWKA 3WK9A 1ZD3A 1KYTA 4UATA 3WGVA 1SWWA 2CFSA 1Z4KA 5ALSA 4BX3A 4UAVA 2C8LA 1EK1A 3P96A 1ZJJA 2JAWA 1Q91A 2R8XA 3AR3A 4UU1A 2HF2A 1QH9A 3E8MA 1RPZA 4XOUA 5AKHA 1Z4MA 5AK5A 4BNDB 2AGVA 4AS2A 3ESRA 5ALUA 1ZS9A 5AM2A 3L7YA 5ALQA 5ALTA 1U2SA 3U13A 4NABA 3E58A 2RB5A 2P11A 3WKEA 5AKGA 1L8OA 4NWIA 2QLTA 5AVYA 1RMYA 4F72A 4Y3UA 3S6JA 5ALVA 3W5BA 2HCFA 5ALYA 3A1DA 4UMFA 1J8DA
chains in the Genus database with same CATH superfamily
5B6PA 3MFHA 2Z3ZA 1Y5LA 2N42A 2J9FA 1MZVA 1KS2A 2OOKA 1WWUA 1KSJA 2I6UA 2R85A 2DJIA 1I1HA 3GMIA 5T14A 1PK7A 3JQQA 3EGDB 3C24A 3N3AC 4MWEA 5CLQA 3ZEIA 4JXXA 1LNQA 1IXKA 1Z1BA 1YZKA 2WC1A 2EQYA 3PDIB 1GQ2A 1KI8A 5C8YB 4I81A 2HZBA 4QIWC 4YRFA 2OBLA 4KKXB 4PH5A 2VT7A 2Q21A 2HIAA 3ZQJA 1ZC3A 4EELA 1UZNA 3TZKA 1W8DA 2HB6A 5L45A 5E2AA 1TUEA 2WKWA 4BNZA 1J0EA 3IUMA 3KHSA 4Z4IA 4PGHA 4U7FA 1ZUWA 1W76A 1ZM7A 4MB0A 2G5HB 3HJNA 2ZRNA 2ZIVB 2Q0ZX 1U3WA 1IUKA 3O93A 3T1YB 2JAQA 4N5NA 1TRHA 3VYRB 4EB6B 3BS7A 1J06A 3K5HA 2GN1A 2ZSHA 4LJ4A 1ZX1A 4P4TA 5INTA 5HQ3B 1VL0A 4JL6A 4GPEA 3ROQA 4TMYA 2O6KA 4ER7A 5JS7A 1K5DA 3D7SA 4EHHA 1HI9A 1O6BA 1CEEA 2UVPB 1ZMXA 3HO8A 2JR5A 2X22A 1JP7A 4JCCA 1DXSA 1JEAA 4M9RA 4NECA 2ATXA 3BXFA 4MRAA 4B4DA 3PGVA 2DKNA 5J63A 2W5UA 1ELOA 4FMDB 3RV3A 4DSFA 1C1DA 1O95D 2XRFA 3HPQA 3IJRA 4LBVA 5DGCA 2UYCA 2UUCB 3NNDA 1LB1B 1HPLA 1UEJA 4YJFB 3AONB 3Q3IA 3TW6A 8LDHA 5DLYA 1GL7A 5HS4A 4P5DA 2MA1A 2VC2B 3UIEA 1GNTA 3GLGA 3DE6X 4FYHA 3VUFA 4ZV9A 3BXHA 4RE6A 2PUDA 4B3RB 2JI6A 1N4DA 2VDPB 3Q10A 3VJKA 4C1NA 3VZSA 3LXXA 3N70A 5AOVA 3TFRA 1SJ9A 1THMA 3NT4A 5C1OA 4QXQA 1KYVA 5C7OO 5KG6A 2FI1A 1DEHA 1HEUA 2VK1A 4Q8EA 4WFIA 2HSEA 1U2PA 5DTMA 3FZQA 4OL9A 3DBVO 2KP7A 1LA2A 1NU6A 1LDGA 3HPRA 4BFTA 4FINA 1WBBA 3BM5A 5JJKA 3DKPA 1AKTA 1BMFA 3WLEA 4BMYA 3FM9A 5DYTA 1TUBB 1JZQA 5IAGA 3SQMA 5JQGB 4KMMA 4TQ9A 3SYLA 3VU1A 5KFIA 2ZWIA 2J4CA 1D1SA 1XB2A 2YIVX 4IV5A 2R1VB 1WQ4A 4JBLA 4MGHA 5EI5A 2HK9A 3K5PA 2HJSA 4OIFA 4QFMA 3RUFA 4E51A 5EJ5A 1CZKA 1ECGA 1SUWA 4ZZ1A 4DS5A 2GN9A 2RHLA 4C6SA 1EA7A 2YV4A 5ALWA 4DFDA 1KFCB 1JT2A 2R9VA 4OK5A 5FL7D 2NMVA 1BXGB 2P7HA 3BXZA 2EERA 1AMOA 1MVLA 1ZUNB 2GFIA 1OXTA 2ZJ0A 3IVRA 3ZEAA 2ECFA 4UARA 4B8WA 1HBJA 2H08A 2ZYAA 4IDOA 2ZQZA 3MAGA 4J4TA 2DECA 1C7RA 4BVFA 1TM5E 4J9NA 4CIBA 1KFSA 4C2UA 1E9EA 3AERA 4MYCA 3KVYA 2MINB 2E3JA 2HHCA 4Q4HA 3OA0A 2JLCA 1UM8A 5L7YA 1F4PA 1XAHA 3QE9Y 2XTAA 4YRJA 4DDWA 1W1UA 2NPOA 4E7OA 8OHMA 1OYVA 1EM8B 5DFAA 3R9WA 4U5QA 4EY6A 4JXZA 2AI1A 2BFNA 2PKQP 2Z5LA 1ACJA 2ATCA 4AJHA 1QH0A 4ZOHC 3DDCA 2YTUA 3CYMA 1J1IA 1AV6A 1RD4A 1RZTA 3SVTA 1TTHA 1CR1A 3WGNA 2P4EA 5BW6B 3FAHA 4NLGA 1VOTA 2Z3WA 1NQAO 4ZVPA 4D8UA 2OAP1 4MUBA 2BGIA 4V38A 1O57A 3DXFA 1CB0A 1NVEA 1LPPA 3I2FA 4ND5A 3ETRA 3G5MA 1JPNA 3LUCA 4PANA 1JAZA 3KKLA 1GZ6A 3NIFB 3AVXA 1EUCB 2VUUA 5A3JA 2XGQA 1TJ4A 5FUQA 1U7TA 1SXJD 3FNQA 3HKDA 4N3GA 2EWVA 1AQIA 2V98A 1Z73A 4R8MA 1ENZA 1OYYA 1T5TA 3L7JA 1OJ7A 5F2OA 5GOTA 4H7HA 1BIFA 4TUQA 4R2JA 1WSBA 3PXGA 1X7YB 4LECA 4XA5A 2X3UA 3IUYA 1UM9A 2DBQA 4YR9A 2HVHA 1THTA 5JZSA 3IDOA 2CHVA 1PGOA 1UWCA 2P6OA 3KCQA 4JC5A 2HJVA 1YONA 3V8NA 2ZUDA 4HX9A 2GCPA 5BN4A 4D0SA 1E1QD 1EK6A 2A1UB 5EC8A 4BAGA 3WS7A 1EWYA 1XVUA 2R60A 3R24A 5F5NA 2C5LA 1IG6A 3MBOA 2MU1A 1DP4A 1HQYE 4P33A 1NBEA 4EO4A 1HDYA 1LKYA 2EOAA 2ZTEA 1R88A 3C1OA 3IUNA 4N18A 2Q5HA 4O4IA 1DRVA 2NU9B 3QKRA 3OFSA 4Y2SA 1P9RA 5E8JA 1XROA 1O0SA 1XVVA 3WZMA 4OVKA 2FZCA 3RUIA 3VAYA 1N4AA 3EXIA 3D8RA 4RMJA 1P8JA 1EM6A 4CF3A 2Q50A 5EVCA 2GLUA 3T1OA 1P7CA 1PE0A 4HAUA 3DV2A 4OYLA 3E7XA 5G0WA 2JFBA 2MR5A 4TMWA 3L18A 2WUGA 3OIVA 2QLJA 2JAXA 3HKEB 4LFBB 1XA0A 2ZQ5A 3FMOB 1WCLA 8ICQA 2FQQA 1C50A 3PXBA 3QEOA 4LSWA 3VC3A 1XRJA 5CM2Z 3ICQB 5D2CA 5IBCA 4FBUA 1Q1NA 2HU7A 3JD0A 3N9IA 1DC6A 2VZ8A 4GZLA 4OBEA 5D84A 5FTKA 1JNYA 2P66A 2Q9UA 4WINA 3RSZA 1PL8A 2HSJA 3EFBA 5IC6A 4BFCA 4C6RA 3ASUA 1ZVKA 3PQ6A 4P2GA 3TLGA 2ID8A 2DH5A 3AUUA 4UE2A 2BE9A 2ZTMA 3T7SA 5I8WA 3RFUA 2Q27A 2I4OA 3IFSA 3PHJA 3JARA 5CJ2A 3RNOA 2IUTA 4BMXA 2ZDGA 1WUTA 3F1KA 3T7TA 1AQNA 2ASEA 2VQ3A 1R9GA 3OSPA 1D4FA 2P9CA 2PCJA 2PSSA 3CLUC 3TW8A 3RCBA 2I1QA 2R7NA 9ICPA 2EKLA 3V7KA 3Q88A 4FPXA 2W0SA 4J3NA 3RBEA 4NLZA 1CUJA 1M2VA 2B3DA 4R8RA 3UGJA 4DWOA 2PJRA 2NO7A 5I7VA 3GRRA 2QPOA 2WWIA 4ZIRB 3TUIC 5KOIA 3TNFA 3BT7A 4RU1A 4CDNA 3AM9A 1ESDA 4NEQA 2E5SA 5DNUA 3O1HB 5DASA 5I9NA 3DDZX 1D7OA 4LSMA 4E07A 5HJEA 3VNVA 2GSWA 2JIQA 3SS7X 2J5KA 2PU7A 2QR5A 3PR4A 4DRXB 2BTOA 4YYZA 4IICA 1H4QA 3UBTA 1XFAA 3GPBA 3RRJA 5KHAA 4NCBA 5DQGA 4B82A 4IIYA 1Z37A 7ICIA 3AESB 1HQCA 1LDNA 3IEPA 1M74A 5DGHA 1JKJB 2B5WA 3JAMA 2CCGA 1BDHA 1C5KA 4K3VA 3AO0B 4EL0A 3YASA 1KC1A 1ZI6A 3OT4A 2M0NA 4RPGA 3PR5B 2FSHA 2WWFA 3FDZB 3DMNA 1NRJB 2L19A 4J7XA 4PS0A 2WIFA 4TVOA 5JAZA 2O0HA 5KYGA 4BVHA 3FYSA 5KYXA 5FBHA 1LI5A 4HZUB 2CN1A 4JJ8A 4ZK6A 1NE7A 2R7MA 1IXRA 1GRQA 1EFHA 1XD8A 3UGTA 3VTAA 2DB3A 1DIRA 4Q9JA 5ALPA 2OXEA 4HPJB 1BS9A 4R4JA 1HE3A 4JLJA 1LTKA 1P1JA 3FPBA 3PG5A 4CPDA 5EE1A 1M2VB 1JIIA 3E0QA 3EEQA 1VJRA 1OTHA 3NBUA 5HBGA 4B3XA 3U19A 4FBGA 2PVCA 1KE2A 5EIAA 1Y8CA 4HH4A 1PLJA 4HZGA 4IFIA 5D8DA 5C1IA 4QT4A 5JC1A 4IXWA 2OGZA 5LVAA 1QYDA 3EF3A 2HVIA 1U8XX 5AK3A 1ORWA 1TTTA 1A71A 4MVJG 3G13A 3ZJ4A 3DT6A 1LBHA 1B6GA 1ISFA 4LWQA 3LT4A 2PV0A 3FN4A 4Q7KA 3TLGB 3T9CA 3KJNA 4N7BA 1VCOA 3ZS8A 2NPIA 2DFPA 1OREA 4HDAA 2G71A 1GKIA 5K01A 3MMNA 2YUIA 4RF2A 3WBKA 1Q15A 2I7DA 4DV4B 1JDVA 3TTWA 1NBMD 1U1GA 1FS4A 1SK9A 2WIJA 4K8RB 1SKAA 4LSZA 4NFHA 4QTXA 5DM70 2WI8A 4QLOA 1PJCA 3KYJB 2QU7A 1Z16A 2JS7A 2NVUB 5CM8B 5K51A 5HX7A 2XCTB 1ORIA 3CLSC 3KTAB 5KQSA 4QGHA 2JPDA 4FDAA 2RGGA 3GFQA 1UQRA 3B38A 4MPDA 3WL3A 4F3RA 4CUZA 4F4UA 5AVUA 2IBTA 2WU4A 2O4UX 3UT5B 2I8CA 3PE3A 4LRTB 1D8YA 1RFLA 4A8JA 3F67A 3DTVD 5K3EA 4EEKA 2CFTA 4KXXA 4XCVA 1FNMA 2I99A 2FLWA 2L2QA 5L1KA 4QU9A 2MT9A 2YXPX 3CNLA 4ZI7F 2CV1A 1S2OA 2H1VA 4EYIB 1D04A 3QLTA 5HGXA 5I9IA 3R9KA 2AXTU 1XXLA 2DM6A 4A16A 3ZHQA 2CEAA 1RP7A 4M0LA 2E87A 4MMZB 4MQUA 2GO1A 1H69A 2CUKA 4YK7A 1V8DA 1QWSA 1ZUD1 5FP0A 2CGEA 3AR6A 3F4KA 1M73E 3I5MA 3OT5A 5LLDA 3ZVMA 4OJQA 1R3DA 1JFVA 1T4CA 1UMDA 3TZEA 5DTQA 3GIWA 1VHQA 1L5RA 1L5FA 1M6WA 4Q15A 1ESEA 1RBMA 4L2IA 2B7LA 2REXB 2VNJA 3AOEC 3IB6A 2C4WA 3QLVC 4KGXA 1XTZA 4TTAA 2ZRMA 3K15A 5J0OA 1DZ3A 2OAEA 2RQ5A 1WQ1R 4FEYA 2OV8A 4HT3B 3OCWA 2H8GA 1KXZA 2J3QA 4P81A 3CWZA 4C4ZA 2NQ2C 1NI4B 4KDEA 4B7XA 4ZZ3A 8ICCA 1DU4A 1HYQA 2YQZA 3UMSA 3H8MA 1XK6A 2CXHA 1K5OA 2CNWA 2D2VA 3L2OB 4H1VA 3GLIE 5ALKA 4XCXA 5IYZF 2OQVA 3MRTA 1R9MA 2IZZA 3EFHA 4JUFA 3BDPA 4YR3A 3A1EA 4UQOA 3ZE1B 2ECQA 2F77X 2WJ6A 1QLWA 4I5GA 1ZQYA 2X4GA 2VKTA 1YR3A 4M1WA 5KMGB 3HDQA 2ZUEA 4NCHA 3RG2A 3SX0A 4UTXA 4CLXA 4D4LA 4DNPA 3HXTA 5AIAA 2F3NA 4F60A 5CH5A 2D1RA 4HDMA 3AKCA 4L50A 4OM7A 2IP4A 3B9QA 1C3XA 4ECQA 3QH4A 2IS1A 2YHSA 2WD7A 3KQTA 4RNOA 1MJNA 2EBFX 3BK1A 4B3DA 1YAJA 2QRKA 2CF6A 2XTNA 3A6JA 2JGFA 4Q34A 5BUSA 2ODAA 2HHAA 3SVLA 3QX3A 1ZKDA 2IS4A 2J46A 2W9XA 3UPQA 1IIBA 3NV7A 1G64A 3N0TA 3UXMA 2NRZA 5J2DA 4DEZA 2FP4A 2W6JD 3LOQA 4BV3A 3N4MB 3GXOA 1JHOA 1W581 3ILXA 3PO4A 3CX8A 1XRNA 1ZBDA 4GXNA 4LFCB 4ALLA 1MNQA 3E7WA 2R2GA 3FPEA 1RRPA 2VWPA 1VYTA 2ZB3A 3Q0IA 1YVEI 1LKYB 2NO5A 1SC1A 2J7PD 4XLLA 3PC4A 5HUJA 5EJ7A 5LQRA 4E33A 4M8NE 3D7NA 1Y8QA 3KSDO 4U02A 3H1BA 3VR4D 3PNMA 4DT1B 4HD8A 1CP3A 4DXDA 1EFDN 4P3XA 4CLOB 4PSKA 4BFUA 4IGAA 3ZHYA 3E84A 1IHUA 4IO0A 3OJWA 5FV4A 3IMGA 3FMPB 3C87A 1KXJA 3IP6A 2R5FA 2J0EA 5DBHX 2XXAB 1X6VA 3ZXXA 2QD1A 4YJGA 5EFOA 1PGJA 4AWBA 5A4MS 1RRCA 3ELBA 3R0XA 3TR5A 3UWMA 4NQZA 4B5KA 3HG7A 3I4FA 5JUMA 5HW0A 4PF1A 4MV4A 3MMPA 4R2IA 1Q3VA 1IONA 3MWYW 1RRVA 2KNJA 3IMEA 3LKDA 1U0JA 3D2AA 3JWJA 3DUWA 3OU7A 2UUBB 4LWZA 3MLEA 1MOQA 4Y9TA 5BVGA 1E8DA 4DBLE 4P54A 4OHMA 1ZW6A 1N1MA 1U0EA 5DKWA 4LZWA 4C6TB 1L5SA 1WNTA 3W06A 3ZIAD 2R7AA 4K28A 3R1IA 4I1VA 4IF6A 2R7LA 1BS2A 3VYUB 2PBLA 3WIOA 1LBEA 2P1RA 1G0OA 4RZUA 2QUZA 3EZ5A 5AH0A 3R2JA 1YRWA 3TJMA 2GZ2A 2YN0A 3P2JA 3AKDA 1DWUA 3DDUA 1EK5A 4YFKA 4TYNA 1XWIA 1WUIS 4HMOA 4TS1A 3GK3A 4NE9A 1LPAB 1ZNQO 2P9TA 4Z9FA 521PA 3TIGA 3ZR4B 4EGJA 2FJPA 3ND5A 3AVWA 4Z6KA 4Y6OA 5GVRA 4UNRA 1UL1X 2A3VA 1HY3A 1VLBA 1XLTC 5LQKA 2JLVA 2A1TS 1W4BA 2B34A 3L04A 1JE1A 3P96A 5H7XA 5J29A 1PS0A 1GT6A 3KZIU 2JIDA 2VDNB 2XEDA 4YT5A 5LMUB 1E0AA 4BO5A 1OIWA 4IIJB 2V45A 1T9HA 1R8QA 1UJ6A 1ZQKA 2J0UA 4EA7A 3PC8A 1AKMA 1KI1A 1V16A 1XAIA 3LP6A 3P52A 1DWQA 4HLCA 4EBBA 3L6CA 4BMVA 4O5CA 1UDAA 2C0PA 3G8AA 1U98A 1NWCA 3HEBA 4RZ2A 5KYYA 3V6JA 1RWXA 3PGJA 3THSA 1T5IA 4ZVMA 3WNQA 3HNPA 5PGMA 2W9CB 3KQPA 4TWJA 1I7PA 1Q20A 1B26A 1KWGA 2QLTA 5AVYA 3A6ZA 1MOZA 3JCZA 3QBVA 2PFKA 5C0YA 5IDXA 3RC1A 2FDCA 4B73A 3FOBA 4F3YA 2JIOA 2PUTA 3HADA 3NDRA 3PQEA 221PA 4EUFA 4EY7A 3DDWA 2ZE5A 1JWBB 4YUWA 1LW6E 4WDQA 1FTNA 1RRFA 3HILA 2Z1DA 3ROZA 3E9NA 3U4HA 3W78A 1FFDA 3SNKA 4YJ2B 3ZGOA 3SOZA 2NW6A 3SGLA 1WR8A 2CSUA 5K0JA 3A58B 3H42B 1OBOA 2B36A 4J2OA 3JQFC 3MN1A 5KTYA 3NDBB 4RQ6A 4RD2A 3X1DA 3N2IA 1Y9EA 1AKQA 4B74A 3O2JA 2WKQA 4WADA 4MKGA 5F7XA 4Y9DA 3T3MB 4FFLA 2Y76A 4IDQA 2P2ZA 1VIDA 4Q45A 2FPOA 2QI9C 3U9SA 3KYBA 4HDRA 6PFKA 4UB2A 2PL1A 4P5PA 1JKJA 3MOGA 4WT7A 4CMEA 2W2KA 4M60A 1JFRA 1QFMA 4ZA2A 5AKJA 4X8LA 9ICKA 1E6LA 2O8FB 1N6KA 3HZHA 5EE5B 3KB8A 1PWXA 1MF7A 4ZFNA 1TK0A 2IDJA 2H7VA 1PR6A 2UYGA 3FCXA 1IK6A 3DDHA 1QIEA 3U7HB 2W7TA 2XMBA 3G5TA 2H00A 5EHXA 1IIPA 1KAOA 1QWOA 2DT5A 1SBZA 4M8IA 3ZI0A 2ZI6A 1AXEA 4JR0A 1NOMA 3KEFA 5ALDA 1P0MA 4IDCA 3TBHA 2J0SA 2NYVA 2O8FA 5TQ2B 2XB8A 3MRVA 2JGDA 4BLSA 2QRUA 3H4IA 1NXWA 5BQOA 4TKUB 5DOVA 4I1PA 4OMUA 3E3AA 4J1QA 3JPNA 1LQ2A 1PFKA 4BNFA 5SY6A 4CFZA 4TM7A 3U1TA 4JASB 1QX3A 3A25A 4UCQA 3G8BA 5F33A 2IY7A 1K0FA 2PX0A 4JOCA 4TV9B 3K92A 1IZ9A 1Z2OX 5KFAA 4B9SA 3NOOA 4BGIA 1CY0A 3L7IA 1NQTA 4LDPA 5FQNA 1F06A 1FCJA 4JSTA 4F4JA 3UNXA 4CFYA 5B4VA 3CJRA 3QOXA 1N2BA 3HYLA 2PZMA 5JYCA 2XUOA 1IB0A 4QU5A 5LOVA 2HQRA 1W5EA 4LNUA 2I66A 4ERXA 3MJVA 5IM4A 3NHLA 3LW7A 3D6JA 4D0RA 1RKUA 1FUEA 2R6JA 3AMVA 3U7JA 5E6SA 1RHQA 5B3LA 1E69A 1KQGA 4D56A 4NZYA 5A5FA 3LDFA 2Y0CA 3PLAE 1TUIA 2B83A 2Z58A 1XQ9A 1G8FA 1L5ZA 3G9UA 4FGSA 1JF8A 4R3NA 2OC9A 3BE6A 1QAMA 1H3FA 5NULA 4TTPA 4RL6A 3V1KA 3KO8A 4CL3A 2WWRA 4GMKA 3OFNA 3QX9A 1PO7A 2PJUA 4F9TA 3U3DA 2XX3A 1Y1KE 2DEUA 1GARA 3K4QA 3TNLA 2Z04A 4JLBA 1IN5A 1YZVA 3MGIA 1L6RA 1ZP6A 1PVRA 2JAPA 5J0SA 1NDHA 2AS0A 5KNDD 5P21A 3LP5A 1JHPA 4RA9A 4CMCA 2ZBUA 3GJZA 2D5CA 3GLSA 4FU0A 4NFSA 1DUSA 1IRXA 3OEWA 4MI6A 3DTTA 3MWKA 1ADCA 4MEJA 4QARA 2QB1A 4N12A 1XLTA 4RADA 5EJ4A 1GDHA 4I1UA 1Y6FA 1S97A 5KFVA 3EUAA 4GW3A 5EMJA 1QS0B 1N2IA 1UM9B 3N5CA 4LBZA 4NCXA 4NTZA 2BM9A 2WU1A 1X1AA 2A1IA 4YQYA 1B22A 1DAMA 3VPCA 4N41A 1USWA 3WHPA 4KQ2A 3I4CA 3KXLA 4WASA 1E6KA 2AMJA 2IYQA 2OWDA 1NUQA 4RV9A 4PAGA 4RK7A 1K1SA 5JWRA 4URHA 1Z8NA 4MEYA 1U9JA 1NL3A 3UXNA 5JJIA 2KS6A 1E1QA 3OQBA 1L8QA 5CURA 3S2UA 2P4UA 4BVJA 2HNAA 4QEDA 4WESA 4D6YA 9ICVA 3LQFA 1J7JA 3BFJA 1HX7A 2CHQA 1DJQA 3TGWA 5TMDA 1XZMA 3T9DA 5BVGB 3N7RC 4HDSB 2ZJ2A 1CRLA 3IIJA 1NVAA 3IPXA 3AVPA 3LC0A 4Q21A 5DGXA 4JU8A 3CEMA 5IKMA 4N7JA 2HWKA 4BLUA 1QK5A 1SXJA 2IV2X 1ZYUA 4RVDA 4Q9IA 4BO6A 4LKRA 2H5IA 3PFBA 5ENDA 3OTOB 1Z2EA 3F7MA 3TIXB 1M3SA 3DXXA 3GZNB 5AVWA 4JC0A 2D54A 2QTHA 3R20A 5IT5A 4EEYA 1P2DA 2Q6LA 5I01A 3HYRA 4B6EA 5BOLA 3OZSA 1H2YA 2J09A 4IRXA 4ED2A 4F6RB 4JDUA 4I4TF 3ZHRA 2JH8A 2WU8A 4KGVA 3T35A 4BBZA 1BH6A 3BWEA 4RDIA 1AHIA 2I71A 3NTXA 1SHTX 4X1KA 4YFVA 3DOIA 2DCUA 1WRBA 4CDRA 1U02A 1VLJA 5CTAA 4CMGA 3GJXC 5B4TA 4O3QA 1HM5A 2YVLA 2PMBA 4B87A 1QHIA 1XSNA 1U4BA 4IWXA 4IQ0A 1RI2A 2I5HA 3WWEA 5JAQA 1U81A 1WF6A 4P35A 4XEUA 5JATA 4KWIA 5ERYA 5B6JA 1SXQA 1VLLA 3KK0A 4QW9A 1ZM3A 2AZMA 2IVZA 3LYAA 1NV9A 2X23A 4WX2B 1SR8A 1NZDA 5C80A 3LGSA 3AJEA 3DEAA 3A9TA 2F9MA 4JVOA 3SEAA 1GRCA 1GY8A 3KZKA 1LS1A 1EUDA 3W1VA 4AMGA 2OHHA 3E05A 3PW5A 3R5JA 3CCFA 3CZMA 2G1KA 1OFUA 5D85A 1C3EA 2M2IA 1N7GA 1C3VA 4YRZA 2AUMA 3JPTA 1RCFA 1Y1QA 1DINA 3PDHA 2QAGA 2YDXA 1AIPA 3NATA 4JYPA 4ED8A 2AJBA 1XTIA 1R6UA 3PC3A 1HYHA 5F3DA 1BPXA 2XUHA 4OUDB 2O2GA 5AI4A 2P3SA 3IQHX 4MAFA 5A6VA 3LXUX 5K3AA 1ZOSA 3Q7RA 3D7RA 4DE5A 2CVHA 5KNIA 4QUHA 4YCXA 4MIYA 1BXRA 3IESA 4HN9A 1O96B 3D2LA 3QUBA 2HHQA 2JANA 3NDJA 4KNVA 5HQTA 4WERA 4EHFA 4D2IA 5E95A 1TYCA 5LP6B 2FXIA 4WLFA 1NI4A 2V65A 4N5DA 5L4SA 2IXGA 4WXHA 7ICOA 2ZRKA 3MK31 1LTQA 1G55A 1JEEA 3MBKA 2NRXA 4Q4HB 4RPLA 2BAGA 2VP9A 2PKEA 4O5EA 3V4SA 2X3FA 1U8ZA 3SJBA 5CBKA 3VNRA 1N7JA 1D0VA 3TQCA 4Q03A 4B3JA 1R8YA 1SXDA 3OX4A 3GFSA 5A71A 5BNWA 1R27A 2HHLA 4YUYA 5IW8A 4IXMA 3VXKA 2WB2A 1XX6A 1RABA 1D0SA 2O48X 1SCNE 2DUMA 3G2OA 2AOUA 3HKBB 4R5HA 1VM6A 2H85A 4IFEA 1Z0AA 4IRMA 3SJ7A 3SN6A 3I1YA 1N36B 4MW9A 1RWWA 4JB0A 1ISJA 1VZ3A 1UINA 1C8BA 2FZ5A 4NCAA 1T4DA 3M4ZA 3U9LA 2W2MA 5LM3A 4DSUA 4G09A 4RMGA 1ZIPA 1NQVA 2OK7A 3A9RA 3COYA 2AR7A 2IY8A 1BNPA 3GC6A 4HSGA 1F14A 2NRWA 5EWMB 3I8SA 3L5OA 5ITZA 2Q1TA 2ZTVA 4BRWA 4O0IA 1JI7A 4D3ZA 2ZI7A 2BFOA 1MOPA 4MWSA 1V6AA 3MNFA 4IH4A 5CT9A 2FLVA 4P2BA 2FPSA 3PEFA 4CI0B 4WXPA 3H1TA 4TTQA 4M2YA 2NNLD 2GNOA 1KK0A 3UH0A 3WLFA 3VKFA 2ZYTX 4QE3A 1KJNA 3QOWA 1AGPA 2QLMA 1PWHA 2X5JO 1BE0A 3PUZA 5BURA 5CNJA 2F62A 1D6MA 1MX1A 1M2KA 4A0QA 4DYVA 1WB5A 5DB7A 2QRLA 1U3VA 1LSOA 4G0ZA 3A2MA 4NCKA 4YJFA 5D87A 4JUZA 2H4HA 1W2GA 2KMDA 2CWDA 1CS0B 1WMBA 2B1GA 2P2DA 3GN2A 3WWDA 5CITA 1SBIA 5DBEX 1FFEA 4P34A 4OK3A 4HUTA 3QV2A 1MH1A 3L3FX 3RVRA 4YDHB 5JCOC 1JEQA 3PKZA 2ECOA 4KRFA 1F2DA 1LNZA 2REQB 3QLEA 4FEGA 4RKYA 3VO1A 5IKPA 3CUSA 3PMNA 1KZ9A 1WTCA 3GLRA 3NR2A 3ZW9A 1WEKA 3C3WA 3SF8A 3ADBA 3R76A 3W4JA 3OCJA 1JWAB 4I55F 2EX0A 4FDTA 4KN7A 4OMFG 2QARA 1GADO 2JBWA 3QZ7A 1J7KA 3HDTA 1NZFA 2BCVA 3O9MA 4ML3A 5EJ9A 4W9RA 4ZXFA 3I2HA 4DMCA 1Y4UA 5AQEA 4ZI7A 2CCKA 1R8SA 1WW2A 3L7LA 1SCUB 2ZB4A 3FPSA 2ZSJA 1XMSA 5AVKA 4L7QA 5JASA 1AO0A 2ZSBA 5TS2A 2RKBA 4JYZA 3N6RA 3Q3HA 1QLJA 1FP7A 2UXBB 1GAXA 1U80A 1Z15A 2YWRA 1B16A 1P7ZA 1ZQTA 4G81A 4BJ5A 2J3LA 4M9UA 4C7YA 2DU8A 2G8NA 4O1MA 2C78A 3D8NA 3Q85A 4ETMA 3NHRA 1GZUA 1F9EA 1Q50A 2O1EA 4W8HA 2CKMA 5EZQA 2VTBA 5AW8A 3F6SA 2YXLA 1QIHA 2HJHA 5BWBA 2H1CA 5FYDA 3TLYA 3RF9A 2J9FB 4GBMA 4IHAA 1T1SA 2FDRA 3SV4A 3JYQA 4ARZA 4EJSA 2EFHB 2K7ZA 3WDLA 4ZHSA 2ZROA 2IZ1A 4TYPA 4ZVQA 1YS9A 2D8AA 5MFZA 3KHHA 2ZB7A 1A50B 1ZA1A 2AC4A 3A3PA 3PIRA 4FHCA 4QASA 5JANA 3GIIA 4DLSA 1OAKA 4G6ZA 4G85A 2C54A 4QQFA 5SICE 3ETCA 4Z51A 4DFJA 2H4YA 2Y0DA 2ZITA 5AXAA 4CV3A 2IYRA 1N3YA 2NZYA 4F21A 5LMZA 3U7FB 2DFDA 2OVBA 2PD4A 4BS9A 2YX8A 1M2EA 1P60A 1LLUA 4MP8A 2WKSA 4NK4A 4TVKA 2QBYA 1XRRA 4MFFA 2PPLA 3INYA 1R16A 4RH0A 1LV8A 2FNAA 2ZXFA 5HKBA 4PTZA 9ICXA 5JFOA 5AVOA 2YL2A 1N5RA 2XUZA 2XTZA 3M1LA 4HUQA 4JT2A 1Z0ZA 4RLQA 4J16A 1RVV1 1SKYB 2G5TA 5B12A 3F3YA 4K4HA 5IIMA 1ISHA 2QTNA 2WWWA 5CK5A 1I4EB 4JQSA 3P0IA 4CMBA 5EZ5A 3UKJA 1KERA 1N32B 1NXOA 5EY5B 3KQKA 4PYKA 1UJBA 1QH1B 2LXNA 1E6WA 1QAQA 5JEDA 5J2TA 1UC4B 2VH2A 1TPYA 1IL0A 3H7AA 1A77A 2V7UA 3JALA 4EG5A 1OJLA 4F1JA 3CUTA 3OX2A 1ZQEA 4FSHA 4ZT4A 3AMZA 4MS3A 2A67A 2HWUA 4EYGA 2XWQA 3VU3A 8ICLA 5EMNA 3AY7A 3QKRB 4LJ5A 3RE1A 1J21A 4RFSA 3HEMA 2EW2A 1A27A 3ULKA 4LRQA 3RYFA 3GH3A 3HNOA 4XVRA 4C9BA 4DZTA 1G8YA 4ZDWA 2HCRA 4ZVRA 2WJAA 5BOSA 4O25A 3RRNA 4YCNA 1QGED 4JHXA 1ZD4A 4X7MA 3GGSA 5SZIA 2XHEA 3CKMA 3QFRA 5IBRA 2E5FA 2X6QA 4OY3A 4PBSA 4BQOA 5JXJA 2CW5A 2JLRA 1FUKA 1QKKA 3GJSA 3SAJA 2KHVA 4NLBA 1RXWA 4KLGA 3IAAA 4I4CA 4CM3A 2V7WA 3RABA 3TAXA 5B64A 1LK5A 2HPAA 3F4LA 3OEEA 4QUEA 5B2ZA 3DS8A 3ZNOA 2BKLA 2NG1A 1ISGA 1NSYA 1YR6A 4MX8A 2Y1JA 3P2YA 5GP1A 2QVZX 3U60B 2SHKA 4FZVA 1I14A 1PT6A 1SQSA 1XMVA 4C21A 4WFKA 1DADA 1E6CA 4WWHA 3TPZA 5MN4A 1TA0A 2AG8A 3DFMA 2O1SA 2V59A 4TLMB 4V0MA 4LA4A 2FSVC 4C0ZA 4FJ2A 2OYCA 3TUZC 3JQ9A 1D9XA 1HSOA 4R16A 4EJ6A 2G6TA 1FSGA 4KH1A 2KEYA 1E2JA 3CXRA 2W83A 3TOZA 4J75A 1CW2B 4M37A 4CUJA 3BTOA 4AK9A 1OBFO 1Z07A 1JMYA 1N6HA 1TCUA 4N5MA 2F3PA 5JO9A 5TQ0B 1BE8A 1NMYA 3SQDA 2YZNA 5HIAA 5KG0A 3L7OA 2QMYA 4X97A 4X91A 3AP3A 3MOSA 3AI2A 1RAFA 4L74A 2GUWA 3IHWA 4K5QA 4NESA 4WNIA 2Z6UA 3L6OO 2UXDB 1XDWA 1ZD3A 3G0IA 3P9RA 4HTAA 2ROQA 4PL2A 1OWPA 2E4VA 2IYTA 2VXCA 5EKTA 5DN6A 3LU1A 2YVUA 2IHJA 4QYIB 2QXUA 4G5QA 3IPRA 4HI0E 2H5JA 4KLTA 4RDCA 4PPGA 5GVSA 1NA5A 1Q91A 3K5IA 1HG0A 4KCGA 3UTDA 1MQ2A 1ZAKA 5JXGA 1DJOA 1YR1A 3VYVA 3ORHA 3GMSA 3RYHA 3TRKA 2NQ8A 5J2UB 2W4QA 1ONOA 1G16A 1T3SA 4GI1A 3STXA 2FMHA 1MB2A 2NLOA 1PJZA 3WG9A 1O94D 2AT1A 2MAXA 2H3EA 3EG9A 5ESXA 1YXMA 3O92A 2C92A 4RZXA 4FVTA 2VNAA 4XIJA 1V6SA 1MA3A 3DC2A 4O2BB 5TGTA 2M6KA 4PRLA 3LHIA 1BQ4A 4MCHA 3CRZA 3E3MA 1V1MB 3EHEA 1XWLA 2Q5OA 4PW0A 1DI0A 4BP1A 3VKWA 1VRVA 1TJPB 4OHWA 3X0DA 4NAHA 4TLCA 3SK0A 1HT1E 4BZWA 5D3KA 2GJSA 3MFIA 4U2GA 2BI8A 3BFKA 3NC1C 4FGUA 4CMJA 4I3HA 5BYBA 1TK3A 2WHXA 1MTZA 4YJGB 5C1DA 1U0FA 5DEIA 4BTEA 2QZ9A 2NOAA 4IC9A 1K2WA 1JDBC 4MW0A 3UJHA 5FX2A 1QO0A 2CNDA 1JA0A 4G9BA 1FMLA 3D8HA 3V2IA 4DBVO 2CLOB 3QF4A 3UWPA 3UVEA 2XE8A 2FWBA 3FTQA 5A0FA 4LDJA 4TZKA 4O9MA 3SSAA 2P0EA 5L1LA 2PLNA 3K1TA 3SICE 6NULA 5LR6A 3LQRA 4IKPA 4K9NA 5DYNA 1Y63A 3HK2A 2HMWA 2QYTA 3OCCA 4PR3A 4QEZA 3ZGZA 4J7CA 3UQ2A 1ZK4A 1ESCA 4F4ZA 1SVSA 1C7EA 4I8XA 4K81B 5H3CA 3JPYA 5IYZA 3QG5A 4IWNA 3G6XA 4UAGA 5EMLA 5T4HA 2PMZC 4MDFA 4DR4B 2J0VA 1Z6XA 5DK6A 5TVKA 3ZE9A 4BEJA 4IBOA 1GDTA 3EARA 4K6FA 5AKKA 2O2JA 4YJ3A 1R18A 4MJ7A 2HY7A 4ZTBA 3W5VA 2HMYB 5KWJA 4RTRA 4RAOA 2B69A 3WDSA 4ZANA 4H6WA 3RRGA 1KEUA 4E09A 1EGAA 5L40A 1GDDA 1MTOA 1OI2A 3I0NA 1U48A 3PFHA 4LTMA 4S1OA 5IBQA 3G59A 3N5KA 1T1GA 3QYJA 4Q00A 5SY9A 1SGWA 4BFZA 4CF4A 3JQ7B 5A4KA 3ESCA 5G1NA 5KQRA 2NNWB 3OWXA 1YRLA 3TLZA 4B09A 4Z1MD 1E2IA 5EJIA 1BHO1 2ZTCA 2WUEA 5K3SA 4EEXA 5A2QA 3MUFA 2EZXA 2CUTA 3FTDA 3BJYA 2ISPA 5DHAA 3X2SA 2HBJA 2WG0A 2QK4A 1JEYA 4TUYA 3TXXA 1LLCA 3A6GA 3L8ZA 2IPOA 1AQYA 2WUWE 2HUPA 5L4LA 2P90A 4MRSA 4EZ6A 4MYHA 6LDHA 1CLUA 1OVMA 2YFKA 4NDNE 3JWHA 1ZYQA 4E94A 3T1QA 3UJ9A 4H15A 2YX1A 4R31A 3AR8A 1OLOA 1V1JA 2C4VA 1ILWA 4EYKA 3DXYA 3N2GB 4EZEA 1V4BA 1QP4A 3CVOA 2C3YA 3TR0A 3UMVA 4IP0A 4QOSA 4PC2A 3EVFA 1JXLA 1GTZA 1K7SN 1RI4A 2Z8YM 1QV7A 3FZNA 3KJIA 3NHSA 1FYFA 3Q41A 5KSOA 1FDOA 3N7SC 1G5FA 4UE3S 4CM6A 2AUNA 3F2CA 1FFXB 1NUHA 5HS6A 1UDBA 4C8MA 2J3KA 3NWJA 1AX9A 4JQYA 1NAHA 4M7WA 2H59A 5EPOA 3X2FA 2O0MA 3RYFB 3ORQA 2XCOA 5LQNA 1ZGCA 2OORA 5FL3A 1LXCA 4QHTA 5LLSA 4POOA 7REQB 2ACKA 3ACBA 2Q4BA 4PGFA 3T1VA 2A3NA 3WY9A 5L3SA 2XBMA 3TWOA 3W2GA 3ENKA 2YY6A 5CIYA 2IPLA 2ZRQA 1GNLA 3G6VA 2M32A 4TX1A 5IULC 4HV4A 3W3AD 2GMWA 3PFIA 3S2EA 3L05A 5DHSA 1UJNA 3DOOA 5BYKA 5B2FA 4LQLA 1SOVA 4QUBA 2ZM6B 4G0WA 2EQ5A 5FOWA 4JIGA 2BGNA 3ZLVA 5K0SA 2HIGA 3A1NA 3C8DA 1A69A 1J49A 2YFHA 4UHBA 4EW3A 2ZOSA 4HUQB 4IINA 4MUEA 3MCAA 5J23A 3RC8A 1W88A 2PZGA 1G8GA 1HRKA 4HVLA 1JECA 4U0KA 3BXEA 3RVLA 4A8PA 3P9XA 2A14A 3MWDB 3D6MA 3FPHA 4QXPA 5AW0A 3JARB 5BSRA 1JQEA 2XGPA 4CV1A 1NJZA 2OO7A 4PN3A 1F3LA 3I1FA 2IU3A 1VQ1A 5F35A 2DFLA 3SF0A 4DL5A 1U9YA 4UMDA 3UT6A 1B3BA 1GPDG 1QPZA 3JYNA 1XNGA 5JO0A 5IH3A 3HBMA 1MC8A 2IEYA 2VJAA 1ZA2A 3K70D 3H75A 3JD1A 4EKIA 4DFMA 3PZPA 4MQEB 2E1PA 3GUCA 3BHNA 3DYIA 4I1RA 4J0IA 3WHLA 4OK6A 1AE1A 2YVKA 2FMKA 3WJAA 4F5DA 3G89A 2G9QA 4HC4A 3VKHA 1X3SA 2C57A 4R98A 2NTYC 5DNYB 1GKUB 2DOKA 1P29A 2O5RA 3OX3A 4BMPB 5CDFE 4GVPA 4J76A 2AOXA 2ETVA 4UDYX 2H2HA 2XQJA 3GA7A 3EXIB 3IBCA 1H6AA 4C30A 2WFMA 2YXDA 5H70A 4C0QC 4WLEA 3SR6A 4RVOA 1W94A 3ESZA 3L0BA 3VSBA 4K9RA 2R87A 2VDOB 3ORRA 4ZO7A 5CJ7A 3PUIA 2TECE 1VLVA 4BB5A 3WYGA 1TOAA 5KL8B 5F64A 3TW0A 4UM5A 1EFAA 3QWIA 2IH5A 2HHWA 5K8LA 3ACCA 3HN7A 1TIBA 3O8LA 2Y77A 4XD7D 4BMOB 1JG2A 3I62A 1A4XA 2FN9A 1GNVA 2D62A 2ACVA 2QF7A 3BGOS 4KTQA 3GUUA 2PEYA 4WUTA 4YLEA 3TF5A 2H1HA 5KNBH 2ZJAA 1BN6A 2DY0A 3HS3A 4FOOA 1PFVA 4O3OA 1XTTA 1VPDA 2ADOA 1PSZA 2I80A 3CZPA 3R0JA 1F60A 4KN8A 4OATA 2N1BA 2XVYA 4OYHA 2VNSA 2PXXA 5C1PA 4GICA 2NVWA 4KJXA 5LD2C 2JFNA 2ZAGA 2Q49A 3M9LA 2VJDA 3H3FA 4N3BA 1RLTA 1SVOA 2VSFA 5BV1A 5IXJA 1VDVA 2X9QA 3ZNPA 3T4PA 2E7ZA 1FRVA 2Y68A 3GVPA 2FETA 3GZJA 3L8GA 2O7QA 3TCKA 3EISA 1FXUA 1P5JA 1QONA 4Z0TA 2H2GA 3FUXA 1T0JB 2AQ4A 1S3SA 2GJ4A 3KALA 4R40A 1X6IA 3OKPA 4U39A 4C05A 5JMOA 3L1KA 4RTQA 3EX7C 4EGQA 5TZVA 1L7VC 1DDIA 5DCWA 5CYGA 1UPXA 2GEUA 5P8WA 1P31A 3QKSB 3DMTA 4P7BA 4P3KA 5B5EU 1EFKA 1OUQA 3MZ0A 1ZD2P 1UC8A 1WXWA 1GGVA 1YBMA 2BBWA 4I4LA 3QEMA 5CXXA 2KIVA 4D3SA 3VH3A 3O4IA 5CFQA 2QX6A 2Y1EA 4QFCA 5J9FA 3LT0A 4V0SA 4UBJA 1HFJA 3SM9A 3T7JA 4HHEA 4DZZA 2IHNA 4X71A 4BLWA 4IJVA 5JARA 3VM6A 1RCUA 5LUBA 2K60A 1YS1X 2G17A 2BP7A 3BGDA 2PKRA 4L08A 5DWQA 3H4VA 4KODA 3RK0A 2RGAA 5JW6A 3DBOB 4MS4A 2CNKA 4J0QA 4OQZA 3ZCQA 3FOWA 3ZDDA 4H18A 3P19A 3SQLA 5KX5B 2Q4OA 4MWZA 1QF6A 1E1NA 3D0RA 1E18A 5EZYF 4AS1A 4I2EA 1HFWA 4A9AA 4CETA 1R4MA 4UC0A 3ITNA 1L5WA 2C2BA 4C89A 4U6QA 1SEPA 2OYYA 3D7LA 4HCJA 4DIEA 2QD2A 1PFUA 2PU5A 2GAJA 2GN4A 3QA3E 3V7LA 3EFOB 4RWZA 4WCFC 4F2WA 1DJMA 3ETEA 1IBCA 3LYLA 3VR2A 1SWVA 1RXEA 1SOWA 4R9VA 2X2OA 4N0PA 1HDRA 5JBNA 4UD6A 3V1NA 4RC9A 3RSSA 5BMOA 3UPTA 4E5UA 3NJ4A 1UMCA 4CCYB 2IQIA 4GQBA 3H5AA 2F8LA 3ZX4A 3KKMA 5A0TA 3WISA 3VR1A 1Z00A 2PGIA 5LXTF 3GDWA 2CZGA 4WKPA 1P0IA 4FLMA 3GLGB 1VJ0A 2LR0A 2YDYA 1I3OA 3JYPA 5H8WA 3ZIUA 3ENWA 5ESRA 3Q3JB 4M9GA 3SHWA 1JFFA 4DG9A 2P6NA 3IAM1 1JTEA 4D1YA 3MC1A 2G63A 1XA3A 4I2HA 3FJOA 1TZMA 4WN9B 5B1HA 3RYIB 4KLOA 3GMTA 5MF6A 2BKUA 2F3SA 3KHRA 1Z82A 3KETA 2FZ4A 1FVXA 2PBFA 3KUXA 3HB0A 5G1PA 2ZCUA 3W5BA 2QTZA 5AOAA 1GPMA 1OFGA 5TF4A 4IZOA 4YUZA 2D7CA 1N60A 1UCFA 1RWVA 2SCUB 4H35A 2DQKA 5DIZA 2C99A 2H52A 3LE8A 2IYFA 4N65A 1IU9A 2DKFA 4M22A 5H4HA 3DE7X 4MR9A 3W6OA 1ZK2A 3KKEA 2YS7A 4E88A 4EB8A 1Z0SA 3BDVA 1YWGO 4HLUA 4KW7A 4M88A 4KOAA 2PSJA 4PC7A 5ALXA 1V47A 2K8AA 1CULC 4J0HA 1Q1AA 2JFQA 2C3PA 3ZHVA 1BCRA 3EUFA 1JJ7A 2Y66A 3BQMB 4AZ3A 4NJMA 4AYBC 4OO1J 3K8QA 3ER6A 5KTKA 3CPJB 3DZIA 5E6RB 4O29A 1R4MB 3TIVA 3UWSA 5KWIA 4BO0A 2ZVJA 5J0RA 5IABA 3KSRA 5C2JB 2ZK7A 2J9XB 5FPYA 2PI4A 5LA6A 1U8FO 3M7DA 3ZDBA 2UYYA 2E21A 4M49A 1ZH2A 5I5EA 5CXSA 3FSGA 2KJ5A 2DSNA 1ZQMA 3IV9A 1ZRNA 1TK5A 2WJPA 1J23A 4MVJE 4RHUA 4W1PA 5TV2A 3SC6A 2JASA 2XCIA 5JZ9A 4RQ1A 1T8RA 1H2XA 3CNEA 5JECA 2BFDB 3DZJA 4MQ6A 5MN6A 2BQUA 1JH9A 1I5RA 3ONWA 3OVMA 4UU8A 3IR6A 3CLRD 4IJWA 3M1YA 2PY6A 4MF8A 4QDUA 1J2EA 1X40A 2AKYA 3NBYC 7ICNA 2O0KA 3PDCA 4J0FA 3L49A 4R83A 4FS1A 5EIBC 4E5VA 5IANA 3IUBA 1XDSA 2ODPA 1MQ8B 2NVOA 2VDQB 2ZR9A 2LRHA 4DTCA 4OCZA 2ZRAA 4KLEA 1EP1B 2W6ZA 2GS9A 1S96A 4C03A 3GZ4A 2VTKA 3A0UA 4G0YA 5CX1B 2IF2A 4ZOQI 3DQPA 5LQJA 1TW3A 3NUQA 4Q39A 3RLFA 1PK1A 2ZCJA 3KZOA 4JA2A 1EXVA 1G21A 1P19A 3EUB2 1TVKB 4BRSA 4NYJR 3ZTYA 1FDWA 3SAGA 2X5OA 4JXKA 3LHKA 4X45A 5DYYA 2XVXA 1L3IA 2Q2OA 4JLDA 4MWOA 4Q4JA 4BATA 5C1BA 1JA9A 4RKEA 1BRMA 2Z43A 1KKLA 3H9GA 2QY6A 3EAQA 4JNKA 3HGQA 2EJVA 1EVQA 1BRTA 1RPNA 2XJ9A 1OLSB 3Q9UA 2BFMA 4OU5A 4UJ5A 3ONNA 1YU6A 3QW2A 3SXJA 4JGGA 3OMLA 1C41A 4TS3A 3TI9A 4QTYA 5FUYA 1UBMS 5EWFA 2Y6UA 3E5RA 4TZ6A 4KQHA 1DDOA 3V1TC 3C5CA 4B84A 2R8ZA 1BPYA 1ESNA 2GPJA 3C8MA 4QTZA 3PSHA 5KVCA 5DNWA 2BGUA 2F7SA 2O8CB 1A0PA 2W43A 1L4KA 2B99A 2I34A 2RDMA 3L0IB 4JWKA 3WL8A 4XYLA 4CHTA 5JBQA 3NRBA 1CNEA 1TAMA 3CNNA 1IMOA 2GOLA 3QYFA 3ELUA 3CZQA 2HCJB 2QB0A 1IN8A 1BWQA 2B8EA 4DPMA 4EYEA 5BSFA 2B61A 1Q2XA 5AK0A 5HF5A 3P94A 5TPZD 4Y1FA 1ZJYA 2PAAA 3DBLA 4GT1A 4II3A 3KBBA 5L1JA 3ROMA 5IAJA 3Q12A 3WFIA 3HSYA 4ZAWA 4JI1B 1VA4A 1C3LA 3AYZB 1FFAA 2V55B 3HN6A 4F6LA 2R6R1 2XQIA 4D4GA 1SBQA 3H13A 3GV0A 3I01M 3VR5H 4I2FA 2B4QA 5IIKA 5EIXA 3C8ZA 3OZBA 4JC4A 4PG4A 2C42A 1CY8A 2FYTA 3JD3A 5JC8A 3ZCPA 3I04A 4O5OA 5CD1A 4YWJA 1XNRB 3CR8A 1ANKA 4BYGA 1HLPA 1MX3A 2JCXA 2RH4A 3LNTA 3QU5A 2Y2VA 4B3IA 1I2MA 3QI7A 5TGZA 1H0HA 5K2OA 3TRIA 2FPXA 2BFCB 1EFLA 2MSNA 2C9BA 2CNNA 2IKQA 3GZTB 4XIIA 3SZGA 4ZCMA 3R6DA 2G1JA 2P67A 1IEWA 1ODTC 3U7IA 1U9IA 5KFOA 4PPNA 4R1UA 2G4LA 3RYCA 3CO5A 1PDOA 3EIXA 4O0MA 3KR1A 2ZIWB 2F4NA 1V97A 4G5RA 4PLPA 3T5GA 3UMFA 3QMWA 5KFTA 1Z34A 4UAWA 1TQ2A 3I3SR 3IKMB 1LC0A 1QTRA 7MDHA 5C51B 4AYBF 3O2NA 4OQYA 3VH1A 3NO4A 4AIRA 5CA1B 4YX9A 3AFMA 2Y67A 3BGSA 3R0IA 5UKDA 3FHOA 5JXWA 1AA9A 2BFFB 2WVAA 5IC4A 3MR6A 5KDLA 4P2HA 1ODCA 1TYDE 1HDOA 3TFWA 4NYJQ 2GBIA 3GP3A 3NAQA 3C6ZA 4MR7B 4Y1RB 4MO9A 2OA0A 3VO8A 1SVLA 1J9EA 1N9GB 3CR3C 3N7TA 2XI9A 1IH8A 1PN3A 4L5CA 3ZWKA 3B1KA 2L42A 3PJEA 3CIOA 2LVBA 1KRXA 3M6LA 3DTNA 4CKCA 2EXXA 5A4AA 4HG2A 4CT5A 1K3FA 3KZVA 3TSCA 2XIDA 2R1TA 4I55A 2JH3A 3AFGA 2PMKA 3FAKA 5H5JA 5B7PA 3H0LB 2Z1NA 1J25A 4TMFA 3Q9LA 3PQ3A 1K8YB 3LVQE 4PJ0U 3OUTA 2A5DA 3UCXA 1X2BA 2J45A 4XVQA 4EKDA 3BX1A 3IH5A 5AK5A 3HW8A 1FYEA 2A30A 1C4OA 2QRVB 4L7VA 4X6YA 3ISBA 4C8KA 2Z9DA 4L4ZA 3WGOA 4I2GA 1LPBB 1X7ZA 3B1WA 3GEIA 4FEAA 1ZOPA 1ZGZA 4IJMA 1TVAA 1GPH1 2WDZA 4EPXA 4MVJD 5IFLA 4TPKA 4JR2A 4EF6A 4H0NA 3M3DA 3SC3A 3WRWA 4NXMB 3INTA 4ZCQA 2Q2NA 2FVXA 3W3AA 4ND8B 2CSXA 3IQGX 4BKRA 4LRUA 3U44B 5EJEA 3WMXA 5TGDA 1N3IA 3R3UA 4DLXA 4M9HA 2ZWVA 4RANA 2EBWA 2P2YA 4QO7A 4AJOA 4UQLA 3HBAA 8ICBA 2Q7DA 4F1WA 4MKIA 2OGSA 4LHXA 4D4MA 2HRCA 1ENPA 2L0XA 3M6XA 3NBFA 4RQAA 2WJJA 1E0KA 3BL5A 4FNAA 3RFFA 1Z2AA 1BWSA 1XGKA 2QW0X 4MVJM 4HNHA 5HR6A 1E63A 5L8VA 4DUGA 1ZBQA 3BYZA 1F1JA 4TUYB 5THXA 2BDPA 4PN7A 1VHJA 3H18A 2BQ3A 3ANYB 4MLZA 2HFKA 1WUYA 3JAWA 3K0FA 2W2LD 2Y0EA 3ABSB 3L0OA 3H87A 3RC3A 3ZGLA 3JVUA 1VL5A 2VQ6A 1YB5A 3M3HA 4KVGA 4O2AB 3U48A 5A4JA 2V0GA 4AN4A 3N07A 5CLHA 1RLMA 2AC2A 1C0LA 2M9MA 3DM5A 3GD7A 2W22A 1ADFA 1KYYA 4GF5A 5D7NA 4MJXA 2AG0A 3O47A 4AULA 1M2HA 2CEKA 1KY2A 2P2GA 4Y2TA 2WYVA 4DJDC 2COUA 3GLTA 4QPNA 3WLIA 2GF9A 1X66A 3DMRA 3RDPA 1FJHA 1LJUA 2ZYUX 4Z9XA 4MVCA 3V6MA 4BMCA 2OYSA 4EA8A 4YRTA 3G7UA 2PGLA 2I2BA 2XVZA 2YV2A 2A33A 2CC2A 3GJ0A 5AR1A 3TPFA 3HE3A 5REQA 2RE8A 2ZPAA 2JGLA 3AB7A 3KHLA 1IHOA 1IZZA 4EQ6A 3IHLA 4HVAA 1Y3BE 3UXPA 2VT2A 5IKOA 3W7BA 2HI0A 4JJKA 5FO0A 1YTLA 3IBFA 4RO0A 5COAA 3GRKA 1RAEA 2XDWA 3EIEA 1PZEA 4WKBA 4U7CA 1AHHA 1AY0A 3AI3A 3GHHA 4WK0B 3MXTA 4RHEA 4XM1A 5HG0A 2P5SA 4TGLA 1Q16A 4AZSA 2PZFA 1PD0A 3ZE0B 5AW4A 3ETDA 5TMPA 4R63A 1UOOA 4B4OA 3DEEA 1DAKA 1BWPA 1JHDA 2AI2A 3BCRA 5HDQA 2OMKA 1YKFA 3AUTA 4G97A 5JPIA 3O8QB 4J94A 4TYMA 3G0HA 1J0DA 1F17A 2V4QA 3D3WA 4KRXA 1RLIA 2R96A 2RONA 1KRPA 1WMEA 2AOTA 2PSDA 4GL2A 4OKNA 5THQA 2ZTSA 2FWIA 2VK2A 4FMDF 3WIBA 3IEMA 2D74A 2HMVA 1U49A 3SHQA 3C6QA 3D54D 3EUEA 1NGSA 3EGOA 4N0QA 3R8CA 3D6HA 1MX5A 1X8LA 2V7XA 4Y67A 5IVDA 4G24A 1RTTA 721PA 3M2TA 1HRDA 3EGWA 2V8BA 2VK4A 3R4CA 4I9UA 2OCBA 3H8SA 2O07A 1SKUA 3EY9A 1XD2B 2IJGX 3H0RB 2QB5A 5EXXA 1HT2E 4C3ZA 1OYWA 1KTIA 3Q5EA 1F5NA 4C2AA 4L8FA 3R7SA 1P7WA 2O7RA 4HRYA 4U0JA 3W7AA 1O4WA 2WP8J 4V39A 1FMTA 5C5CA 4Z0NA 1RMTA 3L1HA 4AU1A 4CCHA 3QSGA 1VB5A 3O4FA 4YT8A 1CDEA 1GD1O 4FNGA 1I0LA 2C7PA 1NK6A 5HF6A 4H1WA 3Q8MA 1RC0A 3Q0EA 3ZXUB 5JS8A 4A8JC 2BF7A 3QZUA 4HRXA 4YP6A 4YRGA 2ESRA 4DSZA 3HYSA 3E3LA 4YCDA 1RQLA 5T64A 2VP0A 3BBPA 4GC6A 3HV2A 1G9TA 1HE2A 4ZAVA 4RUAA 3OQIA 5K8IA 2QP3A 4BB6A 1Z28A 4IHJF 3EPHA 1PQUA 2XAAA 2NVBA 5EKSA 1AMNA 2CLKB 2C4NA 2GJ9A 3HJRA 3B8EA 4CQMB 3NUGA 2R8RA 4UNNA 3DV0B 5B58C 3CF4G 1YU9A 3Q15C 1WO8A 4IWYA 1OH5A 3P5BA 1N5JA 5BV8A 2LGJA 5F3RA 2OKGA 4O3PA 1PZMA 3TTSA 1M66A 1JGTA 1ICEA 5JHGB 2WMOB 2CE7A 4CU5A 4ECAA 1DIGA 4NMWA 4P4NA 1G8PA 3CJTA 1E3JA 1NZJA 2H4ZA 2OCKA 2VHUA 4FE4A 1MSWD 4G5SA 3TRFA 4PBTA 5HF8A 2Z5FA 4N47A 3PV0A 2WOJA 5SZKB 2JG3A 1Y88A 1LU9A 2NV0A 1JMVA 3B3AA 4RV4A 3AVTA 4YASA 1PNVA 4LYEA 4BNGA 2Q3CA 3RHSA 2EG5A 1IK4A 2IIBA 3P9YA 4LCBA 1Y4SA 1RM6C 4PZDA 4XWYA 3FTFA 2OUIA 5HUQA 5C5JA 4DSTA 3L82B 2BTEA 1Z4OA 2X7XA 4ZMRA 1TPZA 2BEUB 2AFHB 4KQIA 4AJLA 4A15A 3A7EA 4JVMA 3CVXA 4RORA 4JGBA 5HIMA 5J2GA 3PX6A 3RJHA 2HBMA 1IM8A 1ST2A 1YDWA 2JBHA 1E32A 4QX6A 3FOFC 4P4PA 1XZ8A 1YE5A 3V4OA 3M4YA 1Y33E 1JYEA 3M6MD 2BHNA 1IQ0A 3V1LA 4GPZA 5FOQA 5EUCA 5FLXA 2XDYA 3OUZA 5AKYA 1K7CA 2CXSA 2OCAA 4HXFB 3NEJA 3OJ0A 3O9VA 4MWDA 1II8A 4FX5A 4RPKA 4CLHA 1SEVA 3DCNA 2BEVA 3C8HA 4GZMA 5LDGA 4RKQA 3QVJA 2XB9A 2FWJA 4L3VA 121PA 3JQGA 4ROSA 3RTDA 2GUGA 1ZCJA 3W04A 3TR6A 4OHBA 1CQIA 4D9EA 3HYNA 1PYDA 3NOVA 3ICCA 3FYTA 2EEPA 3BJEA 5DCYA 1DC7A 3JAKB 4O4LA 4PYIA 3T79A 1MV8A 4WOBA 1KIFA 2K89A 4LVCA 3M6ZA 2E1FA 3MTGA 1XEWY 2PAFA 1KY4A 3DVAA 1L4YA 1RYNA 2VXYA 3HWRA 4C2BA 4KLSA 5HWSA 3NRZA 1W9HA 1KDTA 1RPAA 4X63A 1YBHA 1NW8A 3ZDCA 3GLVA 1GLNA 4OXNA 1H9AA 5IDVA 4YMUA 5DTIA 1OH7A 3V3KA 3G6KA 1U11A 4BO7A 2BC9A 2PUGA 1RU3A 1MQSA 3AP2A 3H16A 3R0QA 1IZYA 5GJCA 1E0DA 2ZSFA 1NXTA 2ODQA 3PGA1 2Y8EA 2CPRA 1I3MA 5IJZA 1ABFA 1FYDA 1B00A 3H2YA 1FYWA 2EF1A 3JYHA 1SPXA 3PSIA 4I9GA 4LNAA 2CUZA 2XGGA 5KTQA 2C8KA 2R84A 2XMRA 3E15A 3KOMA 4KVFA 4U2KA 4LF8B 3A6KA 4BZZA 1WZ2A 3LLVA 3MBYA 3ZZ0A 3P20A 4JWNA 1QB8A 1HMPA 3C3MA 5BYJA 3QFFA 4R1SA 2YB1A 3GFBA 1I7NA 2WK1A 3QYAA 4F6CA 2JJ8A 2WWTA 4UU7A 3GNQA 2ZBGA 1ZRHA 4MEBA 3WU2U 1IMJA 2J9GA 2WE7A 3L02A 3UV7A 4S1NA 2E6KA 3P8ZA 4JLOA 3HZRA 1YR7A 1QDUA 2OBXA 4Q16A 5L3QA 4JKIA 1AHPA 1DLIA 3M8KA 2QWXA 1ML4A 3GO4A 3C28A 3EVNA 1XSEA 1ACMA 4RSRA 2D4HA 4HSEA 2J9YB 2C2HA 2ZAMA 3HXLA 1PNOA 4RLFA 3IJPA 4L4YA 4OJPA 4G4GA 3LVVA 2Z2JA 4FMCF 4WOKA 3GN1A 3HJGA 4UZFA 1BFDA 3LCJA 3OUUA 5FQOA 3RUEA 1M2GA 1XF1A 4LJAA 4X00A 1JTVA 4R1LA 2C2RA 2JW5A 2FKNA 3DYVA 3P2IA 2ZBPA 2W8BA 2CVQA 4HNQA 4JY7A 4PZLA 5AJTA 1KEEA 5ALLA 1RJDA 1Z6QA 3VOSA 5ARCA 1TL7C 1ZHFA 2QP4A 4CMKA 3VAZA 5JDIC 2CMKA 2HSGA 4YMWA 4MW4A 5F2KA 2ALZA 4RCYA 5F5XA 2EZTA 3RR8A 1KH1A 3JWEA 3CRXA 3SIRA 3OD5A 5HMMA 4H7PA 2HA2A 1U47A 4YB8A 2V9WA 4KDCA 2PSEA 4HDQB 3THOA 4D79A 3GLHA 4P0PA 2OSVA 3FHTA 2AOVA 3SD7A 4WCDA 4BGEA 4TXJA 4MUNA 2AFIB 2ERCA 1NRWA 5AI9A 3D8TA 2AWOA 3HRKA 1HUQA 3UMGA 3Q87B 4N8SA 4RK0A 4XIGS 2NZ8A 4RU9A 1U2GC 2XUPA 1QRTA 3A0RB 3I72A 4PZOA 1J6UA 2A9PA 3P2KA 2P4SA 4FFNA 3EZYA 1WCIA 4GOOD 4L07A 4OEHA 4KIJA 1NVBA 1ULZA 3LL7A 4V3CA 3RYIA 4E46A 1RMQA 3HSSA 4H4DA 4ZV4A 3HN2A 5L1MA 3JVIA 4KVZA 2F3UA 3D2QA 1SXGA 3FYDA 3GX1A 1NW7A 1SXJE 2KYRA 2R8EA 3KU1A 3KUUA 4FFMA 4FMCB 3ZV6A 3L0DA 2XYQA 3P9KA 3G8DA 1LLFA 2RK3A 3JV7A 3NGMA 4XJSA 5AO9A 2C2WA 1SD5A 4J9SA 4WZBE 5EZYA 3I1IA 4ZP1A 4DF8A 2C8VA 4CCWA 3TVYA 3OT1A 4JR1A 2CV0A 4K6GA 5IDWA 4XYGA 1RJEA 3MWEA 4DCPA 1XTRA 2I3BA 5BT9A 3S28A 1TMYA 2YHIA 4BVLA 4M0KA 3TVDA 1C2TA 3H5VA 5HKAA 1UOQA 1A97A 1N25A 2EKPA 2EAPA 2QV7A 2WM8A 3OMXA 5TJHA 1JXQA 4ILKA 2EJTA 3M6WA 4E32A 3LF2A 2FPGA 4IQVA 2JI8A 1P0FA 9ICFA 4FO6A 1XZEA 4QA9A 2QTRA 3EGXB 1NYQA 1QBGA 4B9AA 1ZISA 3IBYA 4R1QA 2GD6A 3WWCA 3C6KA 5AW3A 1P72A 1VSUA 2HK6A 3IN5A 2LKDA 2KSOB 4P7FA 5I7HA 5LXTA 2PWPA 5MHTA 3N0RA 3LD9A 4RQBA 1BVSA 1JX4A 4NICA 1L4NA 4ZT7A 2WTMA 4P80A 2BOVA 4WNAA 4B3MB 3O74A 1IAQA 3E9DA 2ZRPA 3LPNA 4R54A 1DKMA 3EZ7A 2WY2D 2FX5A 5DTRA 4LZJA 1XOIA 3FNGA 1WQ3A 4J2TA 4RNMA 1NR1A 2X6TA 3PI7A 4W6ZA 5ELLA 4WXYB 5TEWA 4EO7A 5EMMA 4F86A 4JT9A 4HB3A 3FTEA 3PYLA 2EKZA 2X7HA 4A2QA 5FTNA 5JZMA 3GU3A 1PVQA 4AN1A 1H2FA 1H2RS 4AUKA 3LIPA 4RYDA 2RRDA 4NS4A 2AG1A 4F46A 2PZAA 4F5YA 1X1DA 3KP1A 4HMPA 4KXMA 3DZFA 1GNSA 1N1DA 2ZUBA 4WH0A 1T3LA 1A1SA 2KHQA 1IUPA 1TZBA 4RTMA 3PICA 4IAOA 1A9YA 4CEJA 3V8VA 3JW8A 3PRHA 4AS3A 3COZA 1GUZA 1ZJWA 2XE6A 3AM1A 1ZQIA 3VR3A 1E92A 2P6PA 2JH7A 5CLIA 3GW8A 5I7AA 4KRGA 2ZJ6A 1LPOA 1XQVA 4BLPA 1BHJA 4C78A 4GHWA 1N2ZA 1NJXA 2V7EA 3TTUA 4ARCA 3CSDA 4FMPA 3UAZA 1DEOA 5KO2A 4Z0HO 4IGKA 1ZONA 1OA1A 2CLFB 3JWGA 1G98A 3KPVA 4HDNB 5E6UA 2ADFA 2LWIA 4IVRA 1GQFA 3G17A 1VE3A 4JJ4A 4KE9A 5BNFA 4JQZA 4LKOA 5E79U 4NSNA 4C80A 3FB1A 5DB4A 1P0CA 3INNA 1Z0FA 4F9FA 5EJFA 1Z75A 5J58A 4N5HX 5KPDA 3AVYA 3G2HA 1GZ7A 4ND2A 2YS6A 4M98A 4LWPA 4MNTA 4CM5A 1MJGA 1Q1ZA 1GZ5A 2AFHE 2GBLC 1UDRA 2O3SA 4QUAA 3KQYA 4BEBA 2ZYRA 5IDQA 3RVDA 4R8UB 2VT6A 1GSIA 2MR6A 5AJYA 3IO3A 2RHWA 2HUNA 3DAFA 1OBCA 3NGXA 4ZKEA 3GT7A 4PFSA 1L5HB 1M6HA 3WR5A 3KCNA 5K9ZA 3MG9A 4GKJB 4KMOA 4MPTA 1X7XB 2BI7A 5LSAA 3OLXA 4UMEA 1BMTA 5L7WA 3D2SA 2DJ5A 1P9NA 4IS3A 3W9UA 1SL1A 2JC3A 3A2KA 1JDUA 1NONA 2C4KA 4YMMA 4MKHA 5EXTA 2UZ1A 3JPQA 4CMIA 5CFZA 2I2CA 4YP5A 4IHJB 3UJ6A 3CRNA 2VSYA 3U3MA 5L7TA 4I2NA 1M6EX 4K86A 4E2ZA 1XMJA 3QE4A 3MHTA 2HJGA 1FSFA 2JJ1A 3H1PA 1CUUA 3BXOA 1CEQA 4BAUA 2APJA 2FWNA 2DQSA 1LJLA 4EUHA 4G84A 3ZLUA 4LHWA 2BR5A 5JALA 4GBGA 4BNVA 3D5EA 1ORTA 3L4SO 5HIJA 2YNMC 3L07A 2HD4A 1VGVA 4BUCA 4H3HB 1ZH6A 3U61B 2E89A 3MQ4A 1BW9B 1RI3A 1N5WA 1XL0A 2QTGA 1LPSA 4Q3BA 1TLTA 4OQMA 3TB4A 1LDEA 2VBIA 5DLGA 2SICE 4R2WA 4JWMA 4JI5B 3AM3A 1T1JA 2CFSA 3PPVA 1Q22A 5C32A 2KLHA 4B85A 1X8JA 2YY7A 4RUKA 3UAOA 2GZDA 4RA9B 4RBNA 4JL5A 5D3MB 1UKZA 1A8UA 3GIKA 1O2DA 2RGWA 3QVGB 4KIUA 1PYOA 1VSQA 1R66A 3ONEA 1VPVA 4HMQA 4IMIB 3KX2A 4WIAA 3ZH2A 3BQ7A 4PCVA 3T1NA 3TVTA 1FX0B 4F92B 2DVMA 2JEZA 1PUJA 3A05A 1KQQA 2E1RA 3WLQA 2ZFUA 1GM5A 3KLNA 4DY4A 5AM2A 3LVRE 3MGGA 4JBGA 5ALTA 2X5NA 3CZRA 1QZZA 1L7AA 4A26A 4DA8A 4ZHQF 3PEVA 2RB5A 1G5QA 3GPCA 2WTAA 3OOHA 2YW9A 1DHTA 5EWJA 1J8FA 3OLQA 2VYQA 5LA6F 4E11A 5G2OA 1FSSA 4KTVE 1FL9A 3G5AA 1YRYE 5JMWA 1P6UA 2FN4A 2ZIAA 4MW2A 3QEJA 4R51A 2WZCA 1L3CA 1F2UA 2RHCA 2C2DA 1GZ3A 2ZREA 1ZD8A 1QF9A 3N8DA 1YJQA 4H4EA 3TOVA 5CAEB 2G7MC 2NXJA 1EX1A 2AJQA 1W48A 1VHWA 4ARIA 3ZVRA 4IDEA 3RAXA 2YXNA 3JATA 4ZTZB 2C61A 3K6SA 3KOXA 4FJ0A 3PQ8A 4FUQA 4MK4A 4BRZA 5J2AA 1CQZA 3PP8A 2Z7JA 3QXGA 2C7GA 3OKFA 3OQJA 5KYWA 3O0TA 4MVJI 1UANA 3PRKE 4IOMA 4NFLA 1XE3A 2G80A 3AYXB 1F0MA 1JQ5A 2LIVA 3OQVA 4YECA 4RMIA 1PHPA 2HBLA 2YIDA 1I7QB 3IDSA 4DL2A 4WECA 1VG1A 2QHXA 1A8QA 4U3JB 2QZJA 2Q3LA 5EUBA 3NHKA 3W6PA 2XEXA 3OZFA 1DTSA 2A9RA 1GR1A 3LWDA 4M3NA 5DP2A 4RGBA 1SC6A 4AO7A 4S12A 1QO9A 2CXTA 1HEKA 3THYB 5A6SA 2OWOA 1AK9A 4UVEA 2G08A 5KOHB 4E2YA 5F7OA 5LKRA 1E1LA 1UBGA 1K6JA 2IEBA 2O5CA 3WYDA 1NLMA 2IZ6A 1XJCA 3LUPA 1NHWA 1P18A 2PUFA 4L22A 2LDXA 2HHTA 1QO7A 1U8UA 3RJKA 3OM0A 3TAHA 5A03A 3ROPA 2W3SA 4PIPA 1PZNA 3H1EA 1T26A 1VBFA 3WLHA 4ZJPA 2E8OA 1JAIA 3DEKA 5K3BA 2ZRGA 3HBLA 3KDSE 2NP6A 4MLPA 1J24A 3QEKA 4WCFB 4HNUA 4WA7A 3I23A 3S2ZA 3PK0A 3UFXB 1MNAA 3MRXA 3ORYA 5DF1A 4BNMA 3GLQA 5DG7A 4XASA 3CT4A 3JQEA 1Y6GA 1SELA 4TVBA 4X7BA 5EIFA 3HABA 1GL3A 1S8OA 3RB4A 3VI3B 1WULS 2FQXA 3A2LA 2QV0A 2ZT6A 1QC5A 1D2MA 2VJQA 1KR5A 4UBMA 2AR0A 4FTWA 1X13A 2XTJA 2ZJ7A 2XY7A 4HDKB 4KU4A 2J6IA 2V7VA 4DV5B 4QVKA 2I67A 5CG2A 4AKHA 3L6UA 4QAJA 2E37A 3ZWMA 2O8BB 5H3HA 1RWPA 3QLUC 5FV7A 1JBEA 1KEZA 3V7UA 2A0WA 3S40A 4BNTA 1T13A 4RH3A 3V97A 5KYYB 1QHEA 3AR2A 2C0QA 1E2EA 2EFDB 1NR5A 2OUKA 2VUHB 5A4DA 2QR3A 1NTOA 3F5EA 2Q5IA 3DG9A 1RHMA 4MB2A 3B52X 4WY8A 4HWKA 3JZDA 3WLMA 4DAEA 4B71A 3PIIA 2F55A 2VZ0A 3KEQA 1CHDA 3K1YA 3BOSA 2I03A 2ATVA 2PFSA 3QVXA 3ZY5A 1RYSA 4E12A 3ZYCA 3LX4A 5C5DA 5J47A 2ZWOA 3AF4A 5K6TA 1W1WA 3PVSA 3UA4A 3AQIA 3NS1A 1GSAA 1ZQOA 1IEQA 2H9AA 2P9BA 4BVKA 2GEJA 4KQCA 4NXZA 3NUZA 1F0PA 3D31A 4IRCA 1W5BA 2C4TA 2COEA 3GGPA 4U7GA 4Z7NB 4GPBA 2NU8A 3HU1A 1NLUA 4XVCA 2ZJ8A 4KXQA 3WGZA 3LQQA 1PTJC 5L3RA 5DHUA 4D97A 1KOJA 2QMHA 5EXSA 2F1RA 1K5HA 1DK2A 2VHYA 5A1JA 1JHZA 1WKCA 2XBUA 3FCSB 1V8FA 4GZ3A 4EX6A 2XADA 4M47A 4LI0A 5HP4A 1CS4C 5AUNB 1PV2A 1JVNA 5J0QA 3WTCA 4X62B 1XF9A 4XE5A 4CKEA 5H2FU 4XQ8A 1GSOA 2PE5A 2PWBA 2ZYSA 3GFTA 3CH6A 3MUEA 3TO5A 4BNIA 3QW4B 3IQXA 3GWZA 3RC2A 1PQ4A 4C7BA 4DDHA 3I9OA 1E4VA 3I4LA 5ALHA 3OCYA 5GTIU 4PHDA 4X1IA 5DI3B 4L02A 4YPVA 4TWRA 3G3EA 1PD1A 1ZQSA 1QZXA 2ORED 2Q1XA 4IJ5A 1EJ6A 1P4HA 1ZGHA 4ZWNA 1CJSA 2HM7A 4MGYR 1CTQA 5E3JA 5JU6A 2BPCA 4PSDA 2PDAA 2BFBA 4YONB 4N3AA 4B0OA 2P9QA 4C0WA 2Z08A 2ZCVA 1J8VA 2VDWB 3TMKA 4UB5A 3QLVA 4RMHA 5J0UA 4UCWA 2ACWA 3UCEA 3IUEA 1JXOA 3PFWO 5AJHA 4JP8A 4AF8A 3DTVB 2LD4A 1OBHA 1US8A 5CEHA 4DEYA 3LK6A 1ZQ1A 5JNSA 4TYYA 1NN0A 1B8VA 2Z5VA 4RKRA 5IG2A 2YICA 2BCRA 4RZIA 4MS1B 3NHFA 1RP1A 4GIBA 1ZESA 4I6EA 3GDXA 3HFSA 2BZFA 3TJZA 4Q6WA 1I9CA 5BN3A 4IH9A 3PXCX 1KHHA 1UXKA 3QTTA 3OZWA 5L4NA 3W7VA 4ENTA 4K9KA 1BGVA 2JGRA 4PSVA 1ZO8A 1J0BA 1V26A 3BB4A 3ZV7A 4JUDX 3EC7A 2GLTA 4X92A 4YCJA 2FSGA 3PV8A 1YHZA 2H92A 4OV6B 1QG6A 1QOZA 4LMBA 4DQ0A 1RM5A 3M4JA 1OQAA 2AGPA 2LPMA 1PJLA 3G2QA 4YALA 4ZYZA 1SQ5A 3VSEA 1WHTB 1DCKA 1BX3A 4MVYA 3D81A 4A03A 3LBHA 3S55A 3BS4A 4UPDA 1QCZA 5ANRB 1EDZA 4BUGA 1CUGA 1EK0A 1MO2A 3L4BA 4I8IA 4KDFA 2I4NA 1GTJ1 2XIQA 5A5DA 3RODA 4GEKA 4XRGA 4KPYA 3TECE 1WV0A 2XGOA 1C30B 3LO5A 5BW8A 4F2PA 3S2YA 4BP3A 2P40A 4KLUA 1TIKA 2VJ4A 1NNLA 1Z2NX 3LW8A 1UBKS 4KLFA 2VPQA 4N82A 1P1FA 3KU4A 3TG8A 1USVA 2FMPA 1G7CA 2F6RA 3OPVA 4GBJA 4UEOA 5HJ2A 3RD5A 4YC7A 4XTCS 3BG5A 5K20A 1MAUA 1TO2E 5ELMA 2BZ1A 4ECEA 2DFKB 3Q98A 4CNBA 4PYJA 2XXJA 2R66A 3LBYA 3MYYA 3SYKA 3BWXA 2AN3A 2C4UA 2CHGA 2GD2A 2YV3A 4JJFA 5B1IA 4J7AA 1OB5A 1XIVA 3H1FA 3H9JA 5LZ7A 4KN4A 3WHIA 4BNDA 1ZCFA 1SBNE 4NE7A 1J2UA 1MAWA 3B1VA 4LY9A 1QPGA 4REQA 3ZHBA 4RXUA 1CR4A 4PGQA 3ESDA 4GD3Q 5BSMA 4YRSA 4OD0A 2XZOA 4KAJA 1BGWA 4EKNB 4RA6A 3PL5A 1KI6B 5JXIA 1F8UA 4ABTA 1Q0SA 4JT8A 3I42A 3ZD7A 4RQ0A 1Q11A 2ZJOA 2H2IA 1PG2A 2PMDA 3AV3A 3DC7A 3FYUB 2IODA 4E5YA 3L3BA 4F9EA 2ZDQA 3E9ZA 4GX2A 4OXIA 3D0KA 3LLUA 1DT5A 4O4JB 4CFSA 3MMXA 1ZQBA 2LBPA 4LJ7A 1W25A 2BBTA 4C87A 2B9EA 1Y4ZA 4MDYA 3W4KA 1UPAA 1SN7A 1TMGE 2GPSA