4DCCA

Crystal structure of had family enzyme bt-2542 from bacteroides thetaiotaomicron (target efi-501088)
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
203
structure length
203
Chain Sequence
b'KGIKNLLIDLGGVLINLDRERCIENFKKIGFQNIEEKFCTHQLDGIFLQQEKGLITPAEFRDGIREMMGKMVSDKQIDAAWNSFLVDIPTYKLDLLLKLREKYVVYLLSNTNDIHWKWVCKNAFPYRTFKVEDYFEKTYLSYEMKMAKPEPEIFKAVTEDAGIDPKETFFIDDSEINCKVAQELGISTYTPKAGEDWSHLFRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative haloacid dehalogenase-like hydrolase
publication title Crystal Structure of protein Bt-2542 from Bacteroides Thetaiotaomicron (Target Efi-501088)
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
total genus 77
structure length 203
sequence length 203
ec nomenclature
pdb deposition date 2012-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 4dccA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4dccA01
4YH1A 2CN1A 2AGVA 2ZOSA 3AR8A 3QU4A 2OBBA 3I6BA 3DV9A 5AM5A 3L0YA 1NNLA 4RETA 5IS2A 4Y2YA 1ZOLA 5AKYA 3ZX4A 3KOOA 1L8LA 5ALNA 1Z4IA 4L6AA 3ZUPA 2FDRA 3E81A 4IFTA 2B1QA 3ZVNA 5ALUA 2I33A 4UAVA 3KBBA 1NRWA 2YMMA 3L1VA 3ZVLA 4BBJA 2YBDA 1Z5GA 3IRUA 4HGOA 3MPOA 1N8NA 4Y2SA 1QH9A 2CFRA 2ZXEA 3M9LA 5ALKA 2C9MA 1RC8A 3WK6A 5AICA 4NWIA 5A3SA 3U19A 1TE2A 1N9KA 3WK9A 3OCYA 2BY4A 3L7YA 4OFZA 4F72A 2GO7A 1RKVA 5AW4A 4UM5A 2MU2A 5AVXA 3W5CA 3GYGA 4ZEWA 1QQ7A 1TA0A 1Z4NA 2YJ5A 5ALLA 4HGNA 3ED5A 3ZTYA 1RQNA 4KNVA 2JARA 2IA5A 1RRCA 1K1EA 2CFSA 5AW9A 4OD0A 3DNPA 3U7HB 4AS2A 2R8XA 3QNMA 1L6RA 4DW8A 1RMYA 3NAMA 2WF8A 2YFYA 3CZ4A 4UATA 4EX6A 3EPRA 3U7GA 5AW6A 3EF0A 3BWVA 3CNHA 3PDWA 5AM1A 3FVVA 1AQ6A 5AHXA 5ALRA 4UMDA 5AKHA 5AKEA 2D2VA 3L8FA 2HX1A 1XP5A 2JGAA 4YIHA 4KNWA 3A3YA 5AW2A 1XVIA 1Q92A 4YCNA 5ALPA 4Y2XA 4C4SA 2B8JA 3QUBA 3OTQA 3QUCA 3I76A 3TLMA 1SWVA 1T9ZA 1VJ5A 2QYHA 1JUDA 5ALEA 1FEZA 4EX7A 1ZD5A 1Z4MA 4NAVA 3ET5A 1Y8AA 4KN8A 4BEVA 2HEGA 3QUQA 2G1AA 5ALYA 4UMEA 3N1UA 5AW7A 3W5AA 4F71A 2C8LA 2X4DA 1X42A 3QGMA 4JDPA 1O08A 2WF6A 3R9KA 1Z4LA 4IG4A 5IT4A 2AH5A 3WK5A 4OHFA 2YJ3A 4FE3A 2FUEA 1O03A 4XOUA 5AKJA 2RBKA 1SWWA 3SF0A 1TJ5A 4KYTA 5AK5A 1QQ6A 1YNSA 1YV9A 3UMCA 3W5DA 5AM0A 4ZEVA 1S2OA 2B82A 5ALOA 4NV0A 3SKYA 3EF1A 1EK2A 3E84A 3K1ZA 5AVZA 1Z4KA 2B30A 4DFDA 1Z4OA 3P96A 3U13A 3SMVA 2HCFA 5ALDA 5AKGA 4CE6A 4BX0A 1IWOA 2R8YA 3NIWA 5ALWA 4DCCA 4EZEA 3PGVA 2PKEA 2ZBGA 4UU1A 4UW9A 5AKZA 2NO4A 4GIBA 2WHEA 5E0OA 5AW5A 5AI8A 1EK1A 2MSNA 4I9GA 3WGVA 3AR9A 2O9JA 3B9BA 1L7PA 2G0AA 2ZBDA 1RMQA 3KC2A 2QLTA 2YY6A 1ZRMA 3I28A 4FFDA 4JB3A 3ONNA 4DWOA 3QU9A 4MWOA 1U7OA 4CNQA 1Z4QA 1LVHA 2ZG6A 2W11A 4UMFA 2I54A 4Y2RA 3KD3A 2AUTA 2HF7A 1ZJJA 4C4RA 1QQ5A 3NALA 4UU0A 2JAOA 5AI5A 5FP0A 1VJRA 2HI0A 2B8EA 2RB5A 2RARA 2C88A 5AK3A 2EARA 5ALSA 3F9RA 4XQ0A 4QQFA 3WKBA 1RDFA 4PNHA 3QU5A 4B6JA 5ALHA 5ALTA 3IJ5A 4L57A 2BDUA 3AR5A 2GHQA 4OCZA 4NFLA 4UARA 1J97A 3RF6A 3UMGA 4AS3A 1WZCA 4E88A 5AM4A 3U7FB 4BNDA 4EENA 4MUMA 4ZEXA 1YS9A 2R8EA 3SKXA 4BX3A 5A3QA 2FPXA 3ZWDA 1RQLA 3RFUA 4EEKA 2P9JA 1RKUA 2HDOA 2WF7A 3J7TA 3N07A 2FUCA 4AP9A 3WKCA 1ZS9A 1RLTA 2BDEA 4H1WA 2FI1A 3OPXA 4Y2TA 2NYVA 5AVSA 5T41A 4BX2A 5AVQA 4NABA 3NUQA 3AR7A 2C8KA 1KYTA 5AW1A 2YMPA 2O2XA 3ZVMA 1RLMA 3N5KA 2IYEA 3N28A 5AVUA 5ALXA 1Q91A 5AVTA 2PQ0A 5A3RA 3FZQA 5AKLA 2GFHA 4HYTA 2HO4A 2OM6A 5AKKA 2HOQA 3B9RA 2WM8A 3I1YA 3FPBA 1Z5UA 3SD7A 2G09A 4Y2PA 3QU2A 3QXGA 4EELA 1TJ3A 1WR8A 3ZU6A 2ODAA 3L8EA 4UM7A 1RPZA 3KDPA 1LTQA 1ZD4A 2G06A 2W43A 1QYIA 1YJ5A 2PR7A 4J2TA 2Q5EA 2B0CA 2FPRA 4KX5A 2P11A 4G63A 2FEAA 3E58A 3WK4A 1T5SA 4GXTA 3UMBA 4UMVA 3FM9A 3R4CA 3UM9A 3AR4A 2IOFA 1L7OA 3WKEA 5AIBA 3QU7A 2YMQA 3D6JA 3L0CA 3AR2A 1RMTA 4UASA 2I6XA 1U7PA 4QJBA 2GHTA 3R09A 4HGPA 5AI4A 3A1DA 3B8EA 3VAYA 2WFAA 5ALZA 4BKMA 2GMWA 3QYPA 5AK6A 3S6JA 3WKDA 4HGRA 2IOFK 3M1YA 5ALVA 1Z4PX 5AIAA 3ZI4A 1CQZA 2JAWA 1YDFA 3ESRA 2WF9A 2MU1A 2DQSA 1XPJA 3ESQA 3FPSA 5AESA 2EATA 4Y2JA 1S8OA 1WVIA 4RESA 5AW3A 3PGLA 1U2SA 2YJ4A 4J03A 3WGUA 1Z4JA 3QLEA 2W4MA 3ET4A 3OCUA 5ALIA 3QX7A 2G08A 1RKQA 3E8MA 2YMLA 3IB6A 1L7NA 1SU4A 3EWIA 5AW8A 5AM3A 2G07A 2WF5A 2B1RA 4Y2QA 2G80A 2OYCA 5AKIA 2RAVA 3DAOA 3AR6A 4YGYA 1L7MA 3NRJA 4I9FA 4YCLA 1J8DA 2FPWA 1TJ4A 2OA0A 3FGOA 5AI6A 2ZBFA 2ZBEA 3QUTA 2EAUA 2NO5A 5AVYA 5AI0A 5AK4A 1PW5A 2VKQA 1Z88A 3WK8A 3MC1A 3ZTWA 1L8OA 4XPZA 4CF5A 3ZW7A 3HLTA 4CF3A 1VFPA 5AKXA 5AW0A 3W5BA 1ZRNA 3NASA 2I34A 1U02A 3N8GA 3L0BA 3SLRA 3A1EA 2Q4TA 2P27A 4YCMA 4C4TA 2YJ6A 2FPSA 5AM2A 5AVWA 3WK7A 2I55A 3A1CA 5IT0A 4CF4A 2FPUA 2AMYA 4G9BA 2IOHA 5ALFA 5AVRA 1CR6A 2I7DA 2C4NA 1U2TA 4Y3UA 4O8CA 4BNDB 3U26A 3SHQA 3WKAA 5ALMA 3DDHA 3HYCA 3ZWKA 3PCTA 4Y2UA 4BYGA 4UAUA 1ZD2P 2P69A 5ALGA 1NF2A 1T5TA 5ALJA 1WPGA 5ALQA 1MH9A 4XE5A 4BEWA 5JJBA 3BA6A 4FYPA 2JAUA 1F5SA 3ZX5A 3MN1A 3OCZA 2R8ZA 3NANA 3AR3A 2HF2A 4YIKA 5AVVA 3U7EB 3OCWA 3KZXA 3L5KA 2HSZA 2YN4A 3MMZA 4Y2VA 5AI9A 2Q4RA 3OCVA 4HGQA 4L6CA 4HAIA 3L8GA 3L8HA 1YMQA 2CFTA 3L1UA 2HHLA 1ZD3A 4KX3A 3OCXA 1RLOA
chains in the Genus database with same CATH superfamily
4ZYYA 3ORSA 3BFJA 1AKMA 1YMVA 4YUAA 3DZKA 1H85A 3HWWA 3OQPA 5CVJA 5D46A 2IOQA 2ZQYA 2FSHA 2ISOA 1NP6A 3WE7A 4C0JA 4KWHA 2FB9A 4HWSA 1XN1A 3ASYA 3GFBA 2D5AA 1J2YA 4EYGA 5L40A 2GJ8A 3E05A 1OBFO 4KXLA 4G2TA 4F7DA 5ALLA 4CQLB 4S2UA 5FL7A 3PXAA 5B37A 5HCIA 2PL9A 1XAHA 5G4KB 2PZEA 3ZXUB 3D7NA 1A95A 2WZCA 2H2IA 2YV3A 1X87A 3N8KA 4Y1FA 621PA 3TKAA 2BI8A 1J90A 1K63A 5HX7A 3TLEA 2R11A 1Z7GA 1ZO8A 3O91A 5A0LA 4MK4A 4LISA 4PE5B 5GJWC 4CUKA 4ICIA 4PYNA 2CL7X 2OBFA 1F4LA 3BS7A 5BMOA 5TARA 9ICPA 2IDZA 2UUAB 3QGMA 3FYUB 3EXIB 5AOVA 1VPWA 2B8TA 2J31A 3C3BA 1YL7A 1L1QA 2A1JB 3WO0A 3NVZA 1L8AA 3LCMA 3MTDA 3MT7A 3GGDA 3K71B 2CMHA 4REQA 3NEYA 2GK3A 4Q3DA 3KYIB 2FVYA 2C2EA 3PYMA 2QRJA 3UPDA 4WCFA 3QUSA 1XQ6A 3C3YA 2H4YA 1SULA 3A4TA 3I32A 2PMZC 3GMTA 4DUGA 2Q0SA 3IAM1 2XCSB 2HBKA 1YT5A 4RJJA 2QYTA 4ZO4A 4I36A 2XB4A 1TQ2A 3PUXA 2BCVA 2P4SA 1ZJMA 1Q3UA 1QNFA 3UQ2A 4WY2A 4BN0A 5KFTA 3HN7A 2H2FA 4DA6A 1US8B 3GV8B 1FFXA 1PJ2A 1NA5A 4P58A 1L7BA 4ZU1X 1PKXA 1ZGHA 4ECZA 4QQFA 4NM1A 4ZEOA 2IV2X 5LOVF 3II6X 1CJCA 2OBLA 3U7JA 4X41A 4ZTUB 5JVDF 5BV0A 5F9FA 4G0WA 4XXHA 1R0YA 1TC2A 2IVZA 4HDKB 3DVAB 2IS6A 4E7PA 4UXHA 2QI9C 3GELA 3QVOA 4AP9A 3EPIA 1J4AA 3NPAA 4UD6A 5DGTA 4H7PA 4HDMA 2A67A 4DEVA 2YWEA 1KJWA 3KQUA 2QK4A 1QG2A 3TDNA 3GF4A 4B6GA 3BAFA 4PR0A 2G82A 1ZJ5A 1RI1A 3L8DA 3OPYB 2NUTB 5DISB 5ENVA 5IAEA 1Z56C 3R3VA 1BTOA 5E1OA 4LC1A 1GN9A 3SIWA 3JYLA 2MYPA 3SEIA 1GUFA 4V0SA 3VNQA 1EFDN 1R15A 1AKEA 2DTDA 5LM3A 1CUSA 3KVOA 4GI7A 2I6XA 2NADA 2AQIA 3MJHA 4BUGA 2PWYA 4HC4A 4NDNE 3ETDA 3P9IA 1YT3A 4YPOA 5LDHA 1QRUA 4BVEA 4F06A 4E5VA 3QJYA 4D3DA 4FMCB 3D9QX 5DM0A 1KEEB 4KSBA 1XLVA 4EDFA 1I01A 3G3EA 3WL3A 4LXTA 2B1RA 4BWFB 2BQ3A 1GPWB 2VHUA 3WMRA 2NPOA 1GDHA 1QS0A 1N78A 1M2WA 3G8CA 5EMMA 4C07A 4K6MA 3E9QA 4I6JA 3K0AB 4E5YA 4YEDA 4LBZA 3EDQA 4NPAA 5DRYA 4EWLA 3OPQA 4KR3A 3DE4X 3H4TA 1QJ4A 2NU6A 2XTJA 1HYHA 3HVJA 4TXNA 2PNJA 4EITA 4ZH4A 1QQBA 3UNXA 3NM4A 3KEOA 3ZWKA 1M1YE 2ECKA 2V4QA 1GKUB 1X6JA 4A0QA 2XI4A 3V9PA 4QPJC 5ALQA 1ODSA 5IHXA 1J1IA 3R20A 4AJNA 4KH0A 1OHHA 3ZNNA 4Q1AA 1EGMB 4DJDC 4TWBA 2Y4OA 3VHLB 3G9QA 1JXLA 2R8GA 1JFFA 3QFFA 1DIOB 5KNDA 4L72A 1M2HA 3LPNA 4YRQA 1QE0A 5J0YA 3LP6A 4IY1A 3BHNA 3DZJA 4KWEA 2R6GA 5F3WB 3HR4A 1WPXA 2QX8A 2X9VA 1NUQA 1NKCA 3DULA 4A16A 3KHSA 4X1YB 1VLVA 3W3AA 1N7JA 4MMXB 4OI4A 2HA4A 3LK6A 2WR8A 1VLMA 5ENDA 2LM1A 4BFVA 4CMIA 3SQNA 2OHGA 1QDLB 1QQ7A 1WS6A 4REMA 3RUCA 3PXEA 4U02A 1Y1QA 4I2AA 2P4QA 2FHPA 3WB0A 2Z1DA 1LI5A 4G0OA 4OA8A 1HRKA 2ZJAA 1QV9A 3CBGA 4F4HA 1KYWA 1DEOA 2Q2QA 2NPFA 3K6SB 4FINA 3WWOA 4YA6A 5AVKA 2ILVA 4RZRA 1LKYA 4L8WB 5FJJA 3TLMA 3E5NA 1ZNZA 3ND6A 3MMNA 3PGMA 3R75A 5C80A 4EHLA 2IZOA 2XYQA 2GS9A 1BX1A 3NS7A 3KK0A 5F1KA 4G1UC 3PQ7A 3TM4A 3Q7EA 1PU2A 3KJXA 1Z2EA 2BKXA 3QLUA 4XFKA 1RM3A 4PFKA 1EUYA 1XO1A 2I8LA 3PGA1 1KXZA 1DSSG 5KMGB 3UOGA 1JQEA 3I9JA 5K0SA 2RHFA 1UK6A 3A05A 4JVSB 1A9OA 1PHRA 4O0LA 1VJCA 2X9NA 5KINB 1MEOA 1W4CA 5AI8A 2MSEB 2Y0BA 1K4MA 4L74A 4HJXA 1YBVA 2ADMA 1JALA 5BWMA 4R40A 4J9MA 3M89A 4XRHA 1BS1A 2Q1YA 4UKDA 4F5DA 2IHKA 4FCCA 4BLVA 1GU1A 3SR6A 2NYRA 4AJPA 4LC9A 4CVNA 4P0TA 4UM9D 3G9XA 3TRKA 5JZOA 4Q1CA 1CR0A 5ALSA 3B3JA 3SNKA 1JSZA 2X77A 3KDAA 3QWAA 3CZCA 3WFIA 4GMKA 3N0VA 1L5VA 4NSNA 3LVWA 3CF6R 3FAZA 2A5GA 5K1ZA 1F6BA 5KFSA 5AUQA 2XQVA 4C4OA 2C0PA 4WECA 5K6AA 3MM4A 4DE5A 4RT2A 3L4SO 4Q9LA 3ROMA 4M0MA 5F5NA 3PEFA 1RC1A 3TE6A 4UTVA 3DDCA 2JH9A 3VKUA 1VSBA 4F2RA 4KFTA 1DXOA 4HUTA 1NSFA 2N75A 3LUPA 2NVUA 4DSTA 3JQ6A 1J5EB 3NIBA 4B0OA 2E6UX 3MWLA 4E7OA 3I0ZA 1QR6A 1XJQA 2ZI4A 4XLLA 3I9LA 1P4SA 9GPBA 1YBFA 4HPWA 1L7OA 3HEAA 1VCOA 1IN1A 2R66A 4PM4A 4IIGA 4B8WA 1SMKA 3OBBA 2P1RA 5A5GA 4J9QA 1AZWA 1SQSA 1HKUA 3PJRA 1XEWX 4BO5A 2YTZA 2JI4A 4DM4A 3HNRA 3TX6A 3QLTA 2OXEA 2X6QA 5E38A 3ET4A 3QX7A 2I9GA 5FLXA 1C7FA 2VJ4A 3QIAA 4IDHA 1TU3A 4ESHA 1OFVA 2ZT8A 3GFVA 2AXNA 4MWCA 3UJBA 4CIBA 3EUWA 4NONA 2HXGA 7MDHA 1OLSA 1AZSC 5LP6A 3BTVA 4XFDA 5H1YA 4WHMA 1CQJB 4J49A 1K66A 2COEA 1P2UA 5KFYA 4HLCA 2J09A 3TINA 1XLWA 2A5FA 4HEQA 4O3SA 3GFPA 3K9LA 4X6UA 4IJ5A 3IBSA 2RGBA 3U09A 4C7OB 4BO8A 3TCKA 4FHFA 4UHFA 3SHQA 4MQEB 2DULA 4UHDA 4KHZA 1MR3F 5CA0B 3OIFA 3KEMA 5LN1A 4EEXA 4YR7A 3O3NB 4YALA 4FT2A 4NLCA 2VZ9A 3HYNA 3RHZA 5B2EA 3T5JA 4HGQA 4ARVA 1DC8A 2COUA 1ZD3A 4I28A 721PA 2UZ4A 3CW8X 2XMGA 4JWKA 3K53A 4XLTA 1JX4A 4QATA 1W7AA 5JS7A 4JI1B 3D4OA 2F2TA 4ALIA 3PEWA 3DD5A 3B5JA 2ZT7A 1Z5GA 3RROA 4US1R 4BP1A 4I6GA 4LRQA 1GG5A 4MVJE 4DCNA 3TBFA 1GZVA 3HL4A 1Y88A 1FP2A 2PO5A 4CM5A 1R0LA 4ZHQB 3PWKA 4UAZA 3FG9A 2LKDA 2VWHA 4CQMD 3RVQA 3LX6A 1I1HA 3TTSA 2RDIA 3BWVA 3RJZA 5C9ZA 3RKRA 1ZI9A 4NZYA 1PGQA 2ZYIA 3MRVA 3WYAA 3B70A 4OAPA 3HNPA 2E8OA 5A4FS 3RGWS 4KR6A 2Y9UA 4WKOA 4PPXA 1BE0A 4RTJA 4KU4A 1QE5A 4GOND 2D06A 8ADHA 3PF8A 3IEKA 2OHVA 2GILA 3R9IA 3UJPA 3RIGA 3F7OA 2PGAA 4Q7MB 4PZOA 2J45A 1SWWA 1TM4E 2GEBA 2WAOA 1KDTA 3GUUA 1HA3A 2P9FA 3JQCA 3DD1A 4G97A 1T1SA 3MJ4A 5JDCA 3TD6A 3RH4A 1ZI6A 1IBLB 3LT1A 4WXHA 5JAHA 1XC9A 2V3VA 5JEEA 4W7SA 1ZU5A 2PEZA 221PA 2UZ1B 3CZPA 1ZG3A 2JBAA 1SNYA 4M8NE 521PA 1RWWA 4AY3A 1YI0A 2QL6A 2JJQA 3BMNA 3U4AA 3DM5A 2WD9A 4KVGA 4R9RA 2BGGA 2C9ZA 1TD1A 5HXAA 4QLBA 4UNPA 2ZUBA 1I6KA 2WSYB 5TMEA 4QPNA 3HGQA 3SKXA 5D86A 1CVIA 3M2PA 3QYAA 4DL3A 2O8DB 3KOMA 1E3SA 1EXVA 2GJSA 5EUMA 3EGDB 2D2EA 1T2DA 4DB2A 3W2TA 4C06A 4FWBA 1RXWA 4PW0A 4D79A 3ZBPA 3AEYA 2PGJA 3LT4A 4EDHA 3ML1A 5KTQA 4BFSA 4MAFA 2C98A 4QU9A 3IN5A 1E0AA 3F97A 3K5PA 3L0IB 3PW2A 1RPZA 2JG3A 1JPNA 2AYZA 1VMAA 3NOVA 4RD2A 5TMBA 3I6IA 2YR0A 4MGEA 3BQNB 5K4LA 2WM2A 4B3CA 1PD0A 1VMDA 3CE6A 5H0IA 4QGBA 1V9LA 1XEWY 3ACCA 1UFVA 2HMSA 3WQBA 2RJOA 4N3GA 3JPYA 1NMQA 3PTZA 1J5XA 5LKRA 2MYNA 4EKNB 4RESA 1EK0A 1F6WA 2LPEA 3U1TA 3EIHA 4WLFA 4MEYA 1L7MA 5AJXA 5L53A 4HFRA 4J0CA 3WHLA 1X7ZA 3FX2A 5BSWA 3EF3A 3SOPA 1WP9A 4MW4A 1DP4A 4QU8A 3NNNA 2C54A 2YJ6A 1ZKDA 1XDWA 2DC1A 4DR1B 2JIBA 1CR6A 4A6XA 1W2GA 3DM9B 3OHBA 4HWKA 1T3ZA 3D6HA 1UXOA 4JOBA 2CZCA 2Y0CA 2DETA 4F38A 5HGJA 2C2MA 4R2MA 5DB9A 5AUNB 2YV1A 3SZLA 3MWKA 2YZ2A 4XM2A 1E1CA 3OCVA 4QO7A 1RPAA 1DC5A 3T8YA 1E3DA 3QI2A 1DQYA 3W7VA 3LCUA 4N3NA 2ZJ1A 4LPSA 3RYFB 3RDPA 1ZJNA 2QX6A 1J25A 4GSYA 3SFVA 2FDRA 4CIVA 4DILA 1EVLA 5U4XA 2FFJA 4OM8A 5I4KA 1XQYA 1FS4A 2KKVA 1G8AA 3E3AA 2BY4A 2JKVA 4JWTA 4C01A 2DQ4A 3CZRA 4X84A 4Y2GA 3RRYA 2JFXA 1ETHA 3CT4A 3U5ZB 2QW8A 3PNQA 2QZSA 4HNUA 3OD5A 4PFQA 4B6SA 1HQCA 2PPLA 2Q0QA 3SYNA 3WFJA 3RVMA 1W75A 1Z68A 1DQRA 2H2GA 3LUFA 4FJ0A 3HYTA 3PW4A 2Q5IA 4Q21A 3TEJA 4ETNA 4WFKA 2IU6A 2AWOA 4GG1A 3RS9A 4GMXA 2QYHA 3PWSA 1FNNA 3AN1A 2Y9TA 3IDZA 5AHOA 3TNYA 3GA0A 1D07A 3JVVA 3BULA 1P4GA 2XTZA 1T29A 1UBGA 3TE7A 4I4IA 2HHQA 1CUUA 2GKGA 5G1PA 2AXTU 2IEYA 2HJSA 4PVCA 2VC2B 1AVTA 4OQXA 1W59A 2ETVA 4J1SA 2PHZA 2PBLA 3RU3A 4I1SA 4DFDA 2RMKA 1W87A 3GDWA 4ND8B 2BMWA 4TTPA 1WXQA 3PGVA 4LF5B 2NO4A 1JR2A 4CMCA 3TAXA 1K86A 1BIFA 1QVAA 2I4OA 2GN0A 4Z8XA 1T2AA 4AICA 1GQSA 3E0XA 5EY5B 1PSDA 3ONNA 5C5JA 2E8MA 5KB3A 2K87A 2P7IA 3HB9A 4ER5A 3KUCA 4MJLA 3NALA 4YJDA 1V4BA 1GZ4A 3EGWA 4AFNA 4DMGA 1KAOA 7ICVA 4FS1A 3MB5A 2EBUA 2ZLBA 3TL2A 2XO7A 1TB4A 2DPMA 5KG7A 5CFMA 2QUBA 2HRQA 3AHFA 3KT8A 1OI2A 3PX2A 5E6UA 5GPBA 2REOA 4RVDA 1RLTA 1SGGA 3ICPA 3FPHA 1WKCA 4BE7B 2WVAA 3R5TA 3IX7A 1ORTA 4CCHA 2P2NA 2QRKA 1VDMA 3CO5A 5IVIA 2GFHA 2PKXA 2QZPA 4GZLA 3L0ZA 5TT0A 3S81A 2XSZD 1E9BA 4R2XA 3K5IA 4H3VA 5I4IA 3OSZA 4YT2A 3LHKA 5EHXA 1U1EA 2IYRA 3RARA 2V96A 4RY9A 1W9HA 3G2NA 1NAHA 2CHGA 2E1PA 4J0JA 5A05A 1NE2A 3IDWA 4L95C 5C2JB 1ZQXA 4GT1A 3E03A 3VC8A 3LECA 3UYKA 4FWIB 2J4DA 3OZVA 1V95A 1KI4A 5EJ8A 1BRTA 1KSGA 3RODA 4HTFB 5BMVF 3ESQA 4TL6A 5BUQA 1GQFA 10MHA 2AE2A 3UCFA 4LJLA 3H6KA 2HBJA 2RH8A 5CJ2A 4NNJA 4HH1A 2EFCB 4KPGA 2AN3A 5I4CA 2ZBPA 1AY0A 1TTHA 5EWJA 1ULBA 4MVXA 5CA1B 3ETHA 3K0FA 4FHZA 5ULLA 3AW8A 3A9TA 4OBEA 1F2TB 2WWWA 3LQ4A 3SDZA 1EX7A 4MLPA 4U3JB 1XTVA 3H5VA 3V8QA 5JBIA 2ZP1A 1ICEA 1SC9A 1N1MA 4MW9A 1QRAA 3Q6IA 1XJCA 4RY8A 2JCSA 2NPIA 4OB6A 5KTKA 3PNVA 3RYIB 5B1IA 1SHTX 2IUUA 3WMEA 1NFQA 1CRXA 1KVTA 2BSQA 5HQ3A 1XPOA 1OH5A 4BMZA 1EK6A 1AUVA 3H17A 4ASUA 1ZQIA 4AU1A 2AR0A 3T6KA 3QMWA 1NUTA 2VDWA 3TARA 4MV9A 1ZH8A 2GH1A 2WAMA 3RSCA 5DH9A 4LECA 2CVFA 1IC6A 2ZUDA 1A2BA 5E7IA 3I53A 3K9NA 5HMLA 1BWQA 3C6XA 3W5CA 4HLDA 5IKXA 4P2HA 1FZQA 5IF9A 1IEQA 4QTXA 4I1VA 2W8LA 4MQUA 2A1TS 2O4UX 2P67A 4GQIA 3FROA 4ZREA 4GBED 2JGRA 3SDBA 4DA0A 2EIXA 1Q14A 2A2ZA 1FSFA 4F93B 4Y2XA 1ZJ6A 4TN5A 1RM6C 3M6ZA 2BDPA 3SC2A 3FNGA 1WU8A 3MVEA 5TPZD 9ICHA 7ICGA 4L76A 2WJ4A 3TMKA 4FUTA 4DR2B 3PW0A 4ZPXA 3ZW9A 1CF2O 4RQ3A 1T8EA 1I4EB 1LNZA 5BN3B 2J3QA 3CZ5A 2IS2A 4ZEVA 4GI1A 4EFKA 3EF1A 1JFTA 2W6MA 3KYBA 4O2AB 4U5XA 4K1XA 3DTTA 3VJMA 5HOEA 5L6LB 4JLWA 4F5PA 4JNKA 4D9MA 2R1VB 4BX0A 3R5FA 3H0KA 5IXJA 3EJWA 1JSLA 1CZHA 1DJNA 3JQ8A 8ICXA 3EFEA 5FUWA 1EM6A 4HQOA 1QWSA 2ZB4A 4AZVA 4HADA 3C97A 1XSPA 4KHPB 3WMFA 2VR1A 2HLPA 1I0LA 2ZG6A 3IP3A 1TFRA 2FPIB 2ZRKA 1FX1A 2YVQA 8GPBA 4LZJA 4D96A 3Q3IA 4F2GA 4P4SB 3QSYA 2HK9A 1Z6GA 1D9XA 4P7BA 2QV0A 5KFHA 4DL9A 2L69A 2GSDA 3OTIA 3S5UA 4AYTA 4KBFA 3NWPA 5BW8A 4C89A 4BX2A 1NT2A 1LF5A 2PAAA 2O6KA 2TSYB 5DHPA 2IYEA 1J6UA 4TSFA 3GVIA 1TJNA 1OPXA 2P6NA 3EZ9A 1OFHA 4WESA 4EIWA 1PJSA 4ENVA 4Z9BA 2G09A 5A9SB 3IAHA 4RIHA 1VMIA 3RJMA 4RY2A 3K4PA 1E1YA 5TF0A 2BI4A 4MYCA 4RPCA 2C5AA 5E79U 1PGNA 1OR8A 1UK8A 2HMWA 3PICA 4EO7A 2YW2A 1V4NA 3DC7A 3WAJA 1M1NB 3LDUA 4X0EA 4HLUC 2XDWA 4YRSA 1SO8A 3T9EA 1E2HA 2BGNA 3WDMA 5IN4A 3PSTA 3MBKA 3DMGA 1ZQJA 4ELVA 3L7KA 3K8QA 2YMLA 3VO1A 2JCVA 1N5JA 4YRTA 1HTWA 1DXQA 3ZY6A 2A5JA 3RAXA 3QBEA 5F5LA 4UXJA 1OI7A 4V0LA 4NCJA 4A92A 1ZXXA 4JK1A 2PFGA 3AERB 2Z5GA 1B0UA 4WZBB 2OORA 1N2BA 3DTYA 4FVTA 3JVDA 4MFCA 3L7OA 2PWBA 4C2BA 2P0EA 2QGZA 3WLLA 5ELXA 2RCNA 2JJYA 2AG6A 4KLCA 1KVRA 4L0MA 4OQEA 1F60A 3A27A 3O4FA 4GM0A 3HCNA 3U26A 1OTXA 2ILTA 1TK9A 2BEVA 1KY5A 5CW2A 4EYKA 2CL5A 3PXDA 1BCSB 3NX4A 4E22A 1QQAA 1TM5E 3G6YA 5JAZA 4MMYB 3KZXA 1PBNA 1Z5PA 3UVEA 3OC0A 2ZK7A 5IIOA 5IUNC 1SQFA 3IIJA 4LNUA 4M87A 1Y82A 3DHWC 2NO1A 3I12A 2CUZA 3FCOA 4IIVA 1QWOA 3FIUA 1QOZA 1W47A 2KJ5A 3KT0A 4EBDA 3OE5A 3AY3A 3ZCRA 2C9MA 5B30A 2D00A 4BFZA 1XAIA 1W6RA 4M0CA 1D4OA 1V26A 3AWIA 2OFFA 1XDZA 4DOBA 1F8XA 1BPYA 1M7HA 3RR8A 3O4HA 1WCIB 4A15A 1WRBA 2W93A 5K0BA 2R84A 2RHRA 5KQLA 4FE7A 1Z74A 3DOCA 3ED5A 2JLZA 4IRCA 1OZ0A 2GD1O 2Y0PA 3NGXA 1DO2A 7ADHA 3S2IA 5DLQC 3KP1A 1I4LD 4EH1A 1PLLA 5B4TA 3ETEA 3SY8A 1KNXA 2B2CA 3VPXA 1ZGBA 1PF7E 4DT1A 4QECA 1U0LA 2TRSB 3DHEA 4IEEA 4CMKA 1AKNA 2C8LA 1CE8A 3D3EA 4HH3C 1YQEA 2RHCA 2WJJA 4ZV9A 4Z4HA 1V7CA 2VP9A 3K5WA 1MH1A 3VXKA 3WLOA 4IL5A 5HTKA 4B46A 2Z8YM 4FR5A 2GUWA 2JA2A 3P1JA 5M34A 2CLSA 5I7WA 3W1WA 5E6RA 5ALDA 5D3MB 1JA1A 5AD1A 4PQFA 1L4UA 2MT9A 1QSLA 2ZSBA 2YUTA 5DHQA 3BE8A 3MTBA 5DW3A 3ZE1B 5B7NA 2XHZA 2R3SA 1OX6A 4NKRA 3QEBZ 3IILA 1H0SA 2IXEA 1N6IA 4AZ0B 3HHEA 3NHFA 1KBOA 1XRMA 3UTDA 4XZ3A 3EPJA 2BEUA 3GFTA 3NBXX 3GFSA 2ZB2A 4J16C 4RLFA 4TZKA 1DU4A 2BONA 5JCPA 1IH8A 4KO2S 2EJWA 4TRNA 1WYGA 3F9RA 1RHUA 4Q9NA 1NXWA 2JCBA 4XQ8A 4NL4H 2E5LB 4IJKA 2BBTA 2NZVG 2ZB3A 3HBMA 2ZDQA 2Q4OA 3G1WA 1JDNA 1LDNA 1UXKA 3I52A 4DCVA 5CH3A 4JT8A 2OQRA 1MVNA 1NRXA 4IM7A 4Y6OA 5FWDA 4QLOA 2VHXA 4DOAA 3RRXA 5KOYA 5C35A 4YJGA 4RKEA 3R40A 3C5FA 4LOJA 1ZDMA 3VYTB 2P3LA 1Z7WA 3EZ7A 2YN0A 3GA5A 5JMOA 2AZMA 5CB0A 1NBAA 5BSRA 3GPLA 2XRMA 2OCIA 4MWZA 1Y3CE 1QOQB 1HGXA 3UGQA 3CJQA 2X5NA 3RJGA 1MAUA 1DAKA 4FCVA 4CM9A 2ECFA 1PQ4A 3EB9A 3KZMA 3O2JA 4M9UA 4OFWA 1F14A 1HL7A 1U31A 2V7PA 1HEYA 1PR0A 1MCZA 2FOXA 1JLRA 5E4JA 5BNTA 3K1JA 1C7RA 3IBTA 1ZM4A 3I9NA 3TBKA 2BCJQ 4IW3B 2F3NA 1CQZA 1MIOB 5ADVA 3DMFA 4M1TA 3W05A 3PNSA 1T3SA 5A03A 4WGFA 1O0BA 1SU4A 3Q8WA 3KR1A 4OIFA 3MCTA 4JEUA 3GROA 4XGKA 3FF1A 3AEKB 1MC1A 5L3RA 4PAWA 1NJZA 1EX1A 1UKCA 3TLGB 1XT6A 1FMTA 1PCXA 4JYZA 3IR5A 2ZYWX 2ZU6A 4FGJA 1P3DA 1ONNA 3AY7A 3S2YA 2GD6A 4WERA 2DH5A 1E92A 2OFPA 3VJLA 2OHOA 3TQRA 4PIMA 4DXAA 2DKOA 2UUCB 4GQBA 2DFPA 2IOHA 4ZAGA 5AXBA 4HHEA 5FO1A 3WKAA 4DLXA 5FD8A 2VRCD 1V11B 4B7XA 3DL2A 4X45A 4MHVA 3ZY3A 2PUAA 2BH9A 1KH3A 4YWJA 4WN9A 2B1JA 3E7WA 4GC9A 4AZTA 1X13A 1KSPA 3EWSA 1QVRA 1XRNA 4OQFA 1TCAA 3EXG2 5K7SA 4C4AA 3KR9A 4LBYA 1CNEA 3KJFA 2V3WA 5CRXA 1JLLA 4BJHB 3P45A 5EHZA 3OZTA 1ILEA 3HDTA 1YE3A 2PR2A 1CYDA 2QN9A 1AD2A 3H0RB 4PYKA 2J5XA 1TE2A 1Z06A 5I7HA 4OFZA 1E6CA 1KFJB 2ZRAA 4F45A 3AM3A 4ITUA 2DJ5A 2HHSA 5KTNA 1YQUA 2WM9B 3A9VA 2MU2A 4YUVA 1WSWA 3ICEA 3CPHA 1ZGCA 1NI4B 1PQUA 5TR9A 5CM2Z 8ICTA 3MAGA 4PS0A 3A7DA 3A58B 3NHZA 1VYTA 3HPRA 5IFLA 1N7GA 1OX4B 3OM0A 3TNFA 2CNNA 5BOSA 3TJMA 3R6LA 3C16C 2AOWA 1TD9A 4KDFA 1KY3A 3C1AA 2HX1A 1E5XA 2FUKA 3UT5A 2W6QA 4GEGA 5KAFU 2WVHA 3QUBA 1N5LA 2A3NA 1R37A 3V80A 1NYTA 4G5SA 4CRXA 9ICRA 3IDQA 5D8DA 4BQFA 1PJZA 1DXHA 4QDJA 3BQMB 4FFLA 5A1JA 4RANA 3BL5A 4XOUA 4D3YA 5HF5A 2YBEA 1QHEA 1CJKC 5CA0F 1K27A 5BUSA 2I6QA 4JR0A 3U5TA 3NC0C 2K7FA 4EG6A 1EZZA 2K6GA 2G67A 1GPH1 2W3SA 4INJA 2ESEA 5CB6A 4HCJA 4JITA 3I42A 4FM9A 3ESBA 5TIIA 2FZ4A 2V3CC 1MJGM 1T6BY 2AK2A 5CR0A 2F6RA 3IAM6 2FW9A 4NZNA 4HAVA 3T1NA 2ZWPA 1FDIA 1P33A 1YIAA 3CXUA 5JBNA 1IHYA 4JA2A 2F00A 4UTXA 1GUBA 1HPLA 1DIBA 8ICSA 1U0OC 3PLNA 3E5HA 5J0RA 5J0XA 2YHUA 3P7MA 1OFUA 1Y7IA 1UUFA 1OWLA 2BUBA 2H3FA 4ZHQF 5H5JA 2GPAA 1W36D 2V9WA 1ZJYA 4OCZA 4MHSA 1OJLA 1G5IA 4Q9JA 4TMXA 4UNQA 3PJEA 4PLTA 4O0MA 3NJRA 2E9SA 3D4IA 3RWMB 1ST2A 1GQQA 3BJRA 2DB3A 2QMUA 3QPAA 4MR9A 2FZ5A 1DFGA 2VSQA 1QF7A 3K4GA 1EVKA 4NE9A 4RJIA 3JYPA 2JGLA 4UPDA 3KLOA 3PITA 4DSOA 3PT5A 4HDSA 2H4ZA 2KG5A 1TIKA 2H5IA 4AWXA 4MGKR 1PWYE 2OGZA 4AF6A 4FILA 1C4XA 2CE7A 2Y68A 5BO5A 4TGLA 3O0TA 4D8TA 3D8SA 2WTMA 2YMQA 3USZA 2DJIA 1KI1A 3CG0A 3SXPA 1UXJA 4XX1A 3CKKA 1ZX1A 2Q21A 3C41J 4H16A 3WKDA 2A9RA 4LN1A 1QTNA 3OZUA 3ZI4A 1BE8A 1WY7A 4YRDA 2E2WA 1J2MA 5AW3A 3WC4A 3I01A 4ZAWA 4D6YA 4IGIA 4P86A 2C2XA 3ND7A 1OE0A 1RLJA 1WD7A 4PLYA 3PJFA 4PAQA 1P2FA 5IUKC 2FLKA 3AK4A 1DGQA 4G1EB 1FLVA 2DBYA 4DLAA 2F59A 4YRPA 1P1BA 2C94A 1B6TA 3L0DA 3TQOA 3N8DA 3SSOA 3KJQA 1Y1SA 3OLVA 2YY7A 4ZRNA 2FZGA 1NJXA 4R54A 1BA2A 3S1SA 4H7JA 4EF6A 5LWQA 3N8IA 2BTQA 3G8AA 1NF2A 4M7WA 3IQXA 3D6UA 2QR5A 2MSDB 3KG2A 5CEHA 3RREA 3LY7A 3AOEA 1N7HA 3F98A 1MO5A 2Q5CA 1ULAA 1YL6A 4BN4A 5J0QA 3F73A 4MKRA 4YDSA 4TV9B 1RZRA 1UBRS 2ISQA 4FGUA 3QY0A 2ZIFA 4TRJA 5HKAA 3MJSA 1CRLA 5F3XB 1VI5A 3RYCB 4WEQA 5D6NA 2C57A 4TLDA 2PNFA 4A8TA 2LBPA 1J22A 4Q4HB 3UJ9A 1SRRA 2PQ6A 2EGGA 1Q83A 1MNAA 4HYKA 2Z2JA 5ALKA 3ACBA 3IHWA 3EVFA 3OOEA 4Q3KA 2WDPA 2P40A 4PZZA 2VTKA 4QZIA 1OF1A 2PUDA 2FDXA 2BGKA 4QAJA 2IV3A 4HVTA 2ZS9A 2FR8C 4K4GA 4UBJA 1PR9A 2DTEA 2IF2A 4BVFA 4J3FA 1WDTA 3THYA 4FLFA 4UUBA 4UTRA 1AM4D 2XWSA 3G13A 2HK6A 3ESCA 3B7WA 3TVYA 1H6CA 5CEJA 2VYVA 2ADFA 1Y1PA 4ZT5A 1C1XA 4BO6A 2QD5A 3GG2A 4YR3A 1XVIA 4M9SA 5LB4A 1MW8X 1NI5A 1UQVA 2FG5A 2CVHA 3C7CB 4KAJA 5TRTA 3T5MA 1UEJA 5ITWA 1TJPB 1X7WB 2CDCA 5HJ5A 3FVTA 1KAGA 3ZJ4A 1GG2A 3TADC 5EVCA 3ZBTA 2PL5A 4DC0A 2VH5R 5J0WA 1G21A 5EWLA 4YDQA 2VQFB 2XZPA 4B09A 1WMSA 1H2FA 2TS1A 1DDOA 3GGCA 2EQAA 4ED9A 4WJLA 3QZ8A 4N7MA 2PFSA 1HRDA 1REQB 2OC9A 5HPYB 4Q5IA 1SUWA 2H2DA 1Z3EB 3QKUA 1X8LA 2E0IA 2R8HA 3IBYA 3NOXA 1F12A 1BYIA 4PF1A 1Y42X 1IN7A 2PH7A 3U6KA 5F7JA 4A0HA 1V43A 4J9PA 1N6KA 4YROA 3JATB 5KHLB 1RMQA 2KE7A 3D5EA 1SIBE 3MT9A 3NHPA 5DLEA 2ZM5A 3DE6X 1TGYA 2JZCA 3UJ6A 4GZMA 4PZCA 4OGGA 4CTKA 3CLRD 3V7NA 1W5TA 1EP2B 4DYHA 4JDUA 5BVHB 4B80A 2CK3A 4MKFA 2RI0A 3C43A 3TFWA 4PHAA 2BR4A 3EQ8A 4ZJYA 1FRFS 2QMEA 2AA3A 4ALMA 4EKEA 2XMZA 3CH4B 4YXFA 3HGTA 3B2EA 1SV0C 3O8LA 3U7FB 5BUCA 121PA 5CDSA 3RUPA 4U7PB 2ZWVA 5DW0A 4ZEXA 4JI3B 3HCWA 3LWZA 2Y1KA 4ZPJA 3JWIA 1V7QA 3H9JA 4I2BA 2C3UA 2UZAA 3VA7A 4DR6B 1KH2A 1MRZA 1DE0A 1UANA 4WBNB 4BE4A 4NABA 4C05A 5DBAA 1GRCA 3H7AA 3PX3A 4LXHA 4F9TA 4RXUA 3CVJA 3ROZA 4LZPA 3DLTA 4FDUA 3ZXYA 2PKWA 4BEJA 2JBWA 2AEFA 2GTHA 1T8RA 2PRJA 3P97A 1NVVQ 3FTDA 3T06B 2CFCA 1M2EA 4M86A 3LQQA 1ZD4A 3PQEA 1LY1A 2MINB 3PQ5A 3IUQA 2PUWA 1QBGA 3GCDA 3VKWA 2JFGA 3GHHA 1UOQA 2Z1NA 1ZCBA 3UJ3X 1QLJA 2PY6A 4MYTA 1LU9A 1PG2A 2QGNA 4KDRA 4MX8A 5EJ9A 1L5LA 2R25B 4ETWA 3LCVB 1VBKA 5J2JA 2I91A 4XPIB 1U0GA 2MU1A 4DL4A 4CNBA 3DTVA 4MKGA 2D6FC 1HT0A 1VTKA 3AFMA 3O94A 3H05A 1FMLA 2C5HA 1GPAA 3LW7A 4QFDA 1ZA1A 5F4ZA 3AU9A 3FJ1A 3OU2A 3H40A 3VCBA 1Z7YA 4YJ3B 2ZRJA 2XAUA 4ARSA 3T1OA 1K7YA 1M8GA 2I4IA 3E9MA 1ZLYA 4Z5XA 3ZGNA 4YPFA 3O74A 2ATIA 3F5MA 1UCFA 4EO9A 4H17A 4D45A 1R9GA 3VFDA 4V1CB 3HBJA 1DJMA 2ZYHA 4C3UA 4O25A 1UDXA 1Y5IA 5J2FA 3LQ2A 4RQ2A 1ZA2A 2QN3A 1W88B 1XZGA 5FBRB 3OQJA 4ZT3A 2HRCA 4UCFA 1IHDA 3GLIA 1GGKA 3Q1LA 5BSMA 1COWA 3AX6A 5G2OA 3EEYA 1OY1A 2PUHA 2VRNA 3Q7TA 5KWVA 1RE0A 1XZFA 1ATZA 4M0PA 1ULZA 4C4XA 4U7CA 2XYVA 3PLRA 3F5DA 1E5DA 4OEHA 1JQKA 4BUJA 3QX8A 1V5EA 2HSDA 4NS4A 2JDID 1O0CA 2ZUWA 1NQAO 3HFGA 2Z57A 4ZCLA 4Y2SA 1ZUWA 4JFRA 2QB0B 1RPTA 2Q4EA 2DFDA 1PSWA 4Q39A 5DTIA 1CCWA 2YWXA 2H63A 3IPAA 2ZI7A 4FSXA 4NFSA 3THVA 5KFNA 3TFSA 3N0WA 3GUVA 3ZYZA 3V4SA 3ILSA 2QM3A 4IQWA 1Y9EA 3ETJA 2FFAA 3KZCA 3R5KA 2NQTA 1T8PA 4CKCA 1I6MA 1O4VA 1O6FA 5JAUA 3STUA 4G9GA 5FCDA 3PC7A 3QUQA 3JQ7B 1RYRA 4J9OA 2NOAA 4IIJB 2O05A 3T3PB 4N1AA 2YJTD 4Q44A 4HX2A 2QTHA 3T0IA 4M3NA 3U7QA 3MBYA 1X6IA 2KICA 4Z51A 5KFCA 1XZQA 2HU8A 3VSDA 2HR1A 3AF5A 1JRPA 5DBCA 2GGSA 5BRJA 3Q8XB 4G0NA 1ODFA 2ZJ6A 1MBZA 1OXBB 2FX5A 2WP8J 5IC4A 5L1KA 1PJLA 2AJDA 1XTUA 4K9RA 5FPYA 3WGGA 1UJBA 3SIRA 4DS5A 4ZQEA 4EQ6B 4C80A 3W5UA 1LVHA 4Q16A 1LGYA 1ESMA 2Q6TA 3JSXA 1QQ5A 3KR2A 1R50A 1QHGA 5AI5A 3KTDA 2VP5A 2EQ5A 2B8EA 3GR6A 4PTYA 4QBHA 4B3TB 1TT7A 3M0EA 2EBWA 5C5DA 3N2GB 4B6JA 3DR3A 4FI3F 4IUBS 1I80A 2FWBA 1LW7A 1ZZEA 4D3ZA 4D92A 7ICHA 2JFWA 2GR9A 3IT3A 3R3WA 5F35A 1KI2A 2B99A 1BXZA 3N3BC 1OH8A 4ND7A 1BHJA 1URJA 3B89A 2B6HA 1ONPA 5HFJA 3Q8MA 4D46A 3FR7A 1ZINA 1DBQA 4R71A 2B4QA 2A1AA 4U6NA 3EOBI 4N5IX 3AQFA 3JALA 2EIHA 2JW5A 4DARA 1D03A 3PL5A 3GLHA 4PX2A 4QXOA 2GYYA 5K3CA 1FE8A 3EFBA 2BM1A 3GJ7A 1A9RA 2GZ1A 1XTIA 4O2AF 1LQTA 4AX8A 1E9EA 4U2DA 4PJ0U 3TQCA 1MB4A 8ICGA 5ECYA 1PFWA 4X65B 4QGGA 3WOHA 1GCAA 1MC5A 2VZ0A 5CCDA 4GR4A 4L2IA 1YZVA 2C4TA 4FSHA 1N2EA 2PJDA 2CZQA 1E5QA 1I2AA 1DQZA 2A7QA 1Z34A 3CPEA 1RKQA 2ONCA 1N2OA 4YRAA 5HVNA 3NORA 3A9SA 1DJOA 4ZA2A 1T1RA 3QWBA 1SL2A 3QFTA 5E7QA 4ENTA 3LD9A 1F0NA 1XL1A 1XYYA 3G7SA 1GQYA 1V0JA 3FTNA 3ITKA 1HQDA 1S01A 5AOAA 3KB8A 1ZIXA 3LCJA 2WTEA 5LMUB 1ZITA 3CONA 2ZR9A 1WHTA 3IUYA 4WQMA 1EFUA 1QIDA 3AM9A 5B3KA 2KWIA 4O2LA 4C29A 2PV0A 1OXSC 3LYSA 3C28A 1KEVA 3NBKA 2W2LA 4G26A 2C5SA 5CEFA 4Z3KA 2PKQP 1ZWKA 2WJHA 2ODNA 1CDEA 2QLNA 3ZQ6A 2F9FA 5F7XA 1E9RA 2O2IA 2YCBA 1P0FA 3LXMA 4MAAA 4WDRA 4M47A 4IDBA 2BP7B 1MO6A 1T5LA 4PX9A 4PHTA 4RMIA 4F2PA 2LYBA 1P5FA 4QX6A 4RWZA 1XYGA 2W2VA 2YMMA 1NJ5A 1JPVA 1K2VN 4MR8A 1ZC4A 1VLJA 1A50B 1GPYA 4GBMA 3A4VA 5B58T 4QTZA 4PRKA 5AW4A 4N40A 3SVZA 4DQIA 3K9CA 1FP4B 5DTMA 3F6CA 2R7NA 4LWQA 2PSDA 3NIDB 5L3QB 1X8JA 2E4UA 1QTRA 1J21A 2PUVA 1JIKA 2OR3A 1Q0PA 4L3VA 2I03A 4FPXA 2HHHB 4HFJA 1A8PA 4E2WA 5ICSA 2FW6A 2C29D 3HVHA 4PC6A 4KKVA 3DPIA 2QUAA 2WWFA 3RK1A 5AHXA 3Q3GE 2G88A 2PSHA 4OV6B 1HZJA 2G6BA 3DBOB 3AJEA 5G0SA 3VNBA 4YFKA 2NRTA 2GX6A 2QG9A 4C8NA 4L5IA 1F3OA 1OREA 2Y0EA 1VRCA 2IF0A 4PEVA 2YDXA 5IU6A 3CLUC 1Y37A 2W6IA 3WIVA 5B3AA 1NDHA 2A59A 3AKDA 1MXFA 3HZOA 3PHCA 4QBGB 3NGMA 4ED3A 3GV0A 4DHWA 3GVPA 4G0ZA 5FTKA 5SYMA 1JDVA 3K0CC 2WWYA 3Q9NA 5CUQA 1YIDA 4DCCA 5KS2A 3EIQA 1DTWB 3G1TA 1SD1A 4HAUA 1B6GA 3DE1X 1Z17A 3O8OB 3T3IA 1K75A 1U48A 2XWJI 2GARA 3SEAA 2O0JA 3RSHA 1YJXA 1Q19A 2R6CA 3UXOA 2OMKA 4M2LA 4CU2A 1PE0A 2UVDA 4ZVUA 3AHGA 1KRHA 4UFNA 3RS7A 3Q0IA 2Q3EA 4DZRA 4K9NA 5FYQA 4I1YA 3EUAA 2H3ZA 3EZ2A 5BNFA 5LBIA 4GLLA 4BQQA 5KNBD 4QXMA 1PK9A 4P9NA 1PWXA 1MB2A 3HWX1 3LBFA 4AS3A 2YC2C 5AM4A 3O6VA 3EBLA 4ECRA 3RS2A 4Y7CA 2ZU0C 3NFRA 3DR5A 3DXYA 2ZEJA 4HRVA 4QYIA 2YIDA 2PTGA 2KZMA 3EDRA 3JQ9C 4N0MA 3HU3A 5LPNA 2GXUA 4YACA 3H1FA 3ZIDA 1BPZA 2A1UB 1Q15A 1ZCJA 1QKJA 2HXYA 4NG4A 1ZQ1A 4ABYA 1FFGA 3WL7A 4MHTA 4CLXA 4TKUA 2XV1A 2J48A 3OESA 1JHMA 1D1PA 3WYBA 5FPKA 4RCYA 5LDDC 1DG1G 4DLKA 5JJKA 4U0KA 4ECTA 4DV5B 5M3BA 1GZ3A 3IERA 2A9QA 1SR8A 3H0MB 1UXIA 3WYCA 5FPQA 3WL4A 3PFBA 2IHVA 1RWOA 4CM1A 1JSCA 5LYJF 2H3EA 4J0IA 5F78A 3P9CA 4OJTA 2I2BA 1FJHA 1OCEA 2G08A 2JFZA 1MDFA 1PV1A 1SXDA 5DEIA 1K8QA 3ZKWA 1SXGA 1PR5A 3GPIA 4MWGA 2OG1A 1JFSA 2H52A 1GZSA 3GG9A 3V00A 3ZZUA 4K6FA 5CG1A 3KKMA 3R7SA 3U9SA 4OO1J 2ZZKA 5BQOA 3H13A 1VFPA 4QTUB 2OBNA 4AD8A 2DPXA 3VKGA 4PZUA 2A14A 1Q0HA 3CWQA 4P7FA 2BBSA 1QZZA 2A8YA 2J0SA 4LV8B 4DV6B 4EP1A 1WXDA 2FN9A 1J70A 1QRSA 2A0UA 2BR3A 3Q41A 4DV3B 2I0FA 4CCYA 4NL9A 3L5KA 1GTVA 4O4HB 5CXUA 3CW2A 5J2TB 1M0EA 3E22A 3BL6A 2H7CA 5H4GA 4WTOA 2IXAA 2OBBA 1EFVB 1E96A 3TPCA 1SZCA 2I5PO 1F4VA 4DCUA 4IF6A 3RSOA 4NCKA 3LXXA 3ASUA 4RPKA 2ZRQA 3RK4A 5ALUA 2G63A 4WVFA 3TFRA 5EFOA 1H2AS 2VTBA 1NR5A 4EZBA 1SQ6A 2VPYA 2DWQA 2FN7A 4EJ6A 1TYBE 2HSWA 2XUZA 5LQJA 4Z4FA 4W1SA 2NAPA 3H87A 3TK1A 4KXUA 1FMJA 1HDEA 1PW7A 1FYFA 3L84A 4X5OA 1W6UA 5FOUA 4QRIA 1IVNA 4EX6A 3PGKA 1AQUA 5AW6A 3GIIA 5B58C 1GUZA 2CE2X 4UBCA 2WRZA 2X4GA 4NESA 3O9ZA 1UPXA 3S8EA 3I2YX 1P18A 1CZKA 1PTKA 4AVYA 3C24A 1RRGA 3MRTA 1BRMA 3L0PA 1UPUA 3KLPX 2RSLA 1QH1B 4AYBF 4TS3A 5J2AA 1MAHA 3FWPA 1SM4A 3B8HA 5DCYA 1TEHA 3AV3A 3RF9A 3DAFA 3SHWA 1XJWA 1PDVA 2B4TO 2BHTA 2GCEA 1P5HA 1S2OA 3AG5A 2G0TA 2ID7A 4R2JA 4A6PA 1ZWLA 2P2LA 1X19A 4URYR 1M2NA 3FVWA 4MV7A 5KOJA 1Y4ZA 3NTRA 1YR2A 2JGDB 4DNPA 2PM8A 3QI7A 1GNTA 1LS6A 2O2HA 4NS1A 2X8LA 3C7TA 4CEHA 4F4FA 1B2RA 3VC3A 1OIWA 2RD2A 3QEOA 2ZSAA 2FMHA 2BMJA 4E15A 4HB2A 1V25A 2QPTA 1M6HA 1N32B 4DCGA 4BFWA 3TSWA 1K3TA 1G3MA 3H2SA 4K86A 1V8OA 1BCRA 3O3OB 4AUEA 3AF1A 5KJ1A 1A2KC 4I2VA 4XQ0A 1EUCB 1B16A 2QWXA 4IOKA 3SMQA 4TS1A 4BGVA 3KL4A 3L6OO 1K8XB 3L7IA 3VAZA 3GIKA 1ZUNB 4V0ME 4HLNA 4RSRA 3QVTA 1PI3A 3NBUA 4DL2A 5I7RA 2K2WA 1RAHA 5JHGB 5CLHA 3KO8A 4AG3A 1JIVA 1C3JA 5GAJA 5T41A 2H1SA 2UVPB 4I29A 4ZI7B 3FBGA 4KLFA 3OWXA 2HRRA 2RQ5A 3BJEA 4ED7A 2H0RA 2IZZA 5B66U 4U2FA 2R9VA 2QU7A 3IDFA 1X0XA 3R23A 1T3NA 1W85B 4IRKA 2HOQA 2QAIA 1QGUA 5G1NA 1Q0ZA 1SOUA 3IKVA 1G8KA 3UN1A 3W4IA 1GD1O 4WASA 2J87A 2HHAA 5E4FA 2BSXA 1H6DA 4PH5A 3G8DA 2VP3A 1HFEL 3DE3X 2WFLB 3DJFA 9ICUA 3IP9A 5GP1A 3GJ6A 5KU1A 3DF9A 2CNWD 4YP9A 1HTBA 5ALZA 1Y9AA 1L7DA 1QDUA 4Q66C 4R3WA 1BJTA 2ZYAA 2CDNA 3ICWA 3K30A 4YUZA 1ADFA 1O95A 5KKAA 2ASDA 1QC5A 1X9HA 4JJ7A 3OPMA 1USKA 3SICE 4OAOA 1WBBA 3BAZA 2JJMA 4NNPA 1JAXA 1I5OA 4PVDA 1JIXA 1XG5A 1FBNA 1L7AA 5FDFA 4RD1A 1WP4A 1EFLA 3LP8A 4WNAA 5CD1A 5MFPA 3O95A 3VPCA 3N97B 2CJWB 3G2MA 4NRDA 5IAAA 1S0OA 1MOPA 1LRJA 4W1QA 3V1NA 4E51A 1I4OA 3C5EA 1B42A 1O8BA 2FMSA 2O3JA 1ZSVA 2C7BA 1E2NA 1WNFA 1VSQA 2F3QA 2ZTCA 2O8VA 4URVR 3UH0A 2XNCA 2Z4TA 1XLTC 1PUIA 3Q9UA 3MA0A 1FVFA 3SQIA 4KVZA 1WPGA 3L9XA 2ZCJA 1KOFA 3A32A 1L4GA 1YZQA 2AOVA 1AK9A 1L0BA 2CNOA 4XWTA 2N9UA 4PSCA 4N8SA 4ZU3A 2AE1A 4YCJA 4IGFA 1SURA 3IP4B 1L5QA 4NU6A 4YP1A 3R9XB 1Z4IA 3DOIA 3C74A 3PMNA 2H5EA 3EIXA 1Z07A 3BTSA 3KYCA 3W06A 1BHQ1 1JX6A 1CV2A 4B4UA 5AICA 1RM4A 4KODA 5J43A 3IIEA 1QFZA 3VSCA 1H4SA 2G7ZA 4KIGA 4QDTA 1NZDA 2YJ5A 5KFGA 3TZEA 1MABB 1X9IA 3C70A 3FWHA 5FQNA 1QGED 2P9YA 1L1EA 2WF8A 1V3UA 4L4SA 2PLFA 2AXQA 3OP4A 5JALA 3T9CA 1IN8A 5CW1A 1NG1A 3CCFA 2N1BA 3FCXA 3PXBA 1WMDA 2WKPA 4CT0A 1M0TA 3X2EA 4E70A 2E21A 5K5EA 4GX1A 5IZCA 4R41A 3A1NA 1Q1QA 3E0FA 1EFPB 4PYOA 4QRDA 2RB4A 1KJNA 3RTVA 3CVXA 4BN5A 4CLOB 2J7PD 1NW9B 2MUTA 3CMMA 4TMYA 1DV2A 2FZVA 1M1ZA 2W2KB 1ORHA 3DBHA 4KRGA 4E5PA 1AUXA 3UMCA 2C2HA 2X8JB 4KN4A 3TANA 2QENA 3HPQA 2MAXA 3UF0A 3CLHA 4TMKA 4DLSA 5IK2D 3ZBUA 1RVDA 4OJOA 1X2BA 1QO0D 3ISJA 4DF3A 2MTBA 4D9IA 3D6NB 3HV0A 2W9BA 1OYOA 3GLQA 4XCXA 2VWQA 1X15A 4IFIA 5BSGA 3JD4A 5E9QA 4ZN6A 1H2HA 1KDRA 1BVSA 2IYWA 5LXTA 2ZKLA 2Q9BA 2JLCA 2OYRA 1Y3HA 3WL6A 3CH5A 4KOAA 4EVSA 2BGRA 3Q7SA 4I27A 1SZDA 4JC5A 3E9YA 1VXRA 2J0QA 5JNSA 4N65A 3MTEA 4BNGA 5KVSA 4D9FA 4R1OA 2NP7A 2YXNA 4LDJA 3RUEA 4H1WA 5CTJA 1A27A 3OPXA 1SU8A 4E30A 4BQSA 4IKOA 4V03A 1RTKA 3V32A 2CMFA 3VKFA 2YWFA 2OVBA 1P80A 3ZCPA 2QE6A 3MINA 5ADHA 2GASA 2JFVA 5DM70 4LJRA 3CX3A 5LZ9A 1V3VA 3BSWA 4EL5A 4MPDA 1YAHA 1UC4B 2PRZA 1WIWA 3ZHXA 2NUPA 3LBHA 3EULA 2APJA 3W9UA 4N39A 1PFGA 1PSZA 2OK7A 2V59A 3HJCA 3FPLA 1EWQA 8ICWA 2FWNA 4G25A 2IODA 2ODEA 3E7XA 4KLOA 2H9IA 1W29A 1WD5A 2PKYX 4JI5B 3AEZA 1CEEA 3P9NA 3ZI7A 5LIPA 4MKXA 1H4QA 3EVZA 3V8MA 3QF4A 2W6OA 3H16A 4FMCF 5BSUA 1L3BA 8ICFA 4KQMA 4Y0AA 4V2IA 3CSSA 4BATA 1XRRA 2YIMA 3AO0B 5M5BA 1GRNA 4O3OA 4OTZA 4FS3A 4RPGA 2RGDA 3I5UA 5HS4A 4QWBA 1UBMS 1ZVMA 2C61A 1LPBB 2I34A 4O8ZA 1CQIA 1HURA 5G0UA 2PX0A 2W48A 4IDOA 1UQRA 3LY8A 4RHTA 8ICZA 3K9BA 4BUZA 4WBNF 2BFDB 3RG8A 4LDZA 3CC8A 3JZMA 5EIHA 1Z83A 3X1DA 2XCAA 3CZ9A 3F6EX 1M7GA 3ZH9B 2F3SA 3CIFA 4YP0A 3PQ4A 1KS2A 3IBFA 4II3A 3MRXA 4DLZA 1SIWA 1E7WA 3DBRB 3GGSA 4YRZA 4FJ1A 1G20A 3DV9A 3V9AA 4JROA 1G7TA 4XVRA 2YVLA 2ZXUA 1H0HA 3MR2A 3KAKA 5EE0A 1HTTA 2DBVO 3RB8A 1SN7A 3R24A 2W83A 4CKBA 2QTVA 4Y67A 3MUEA 1P74A 1MX1A 4NWIA 4FDLA 2PJRA 1M6VA 4RM3A 1XX6A 3ORYA 2W9CB 2ERYA 1RP1A 2I80A 3OZCA 4QYTA 5TNXA 2BR0A 4KNVA 1GVHA 4HVCA 4Q0MA 3W9YA 3JAKA 2JMGA 3LKBA 1XZPA 3EDMA 4NENA 2PFOA 3L8FA 3HU2A 1XP5A 2JGAA 5KTOA 1P9NA 1LDYA 4ZI2A 4C4SA 1WBDA 3B9QA 2B25A 1HJPA 4EEYA 3ET5A 1P2TA 4ZCMA 1ZK1A 1EVQA 2WOJA 2PT6A 4PXYA 1M54A 1PZFA 1FW8A 4D4GA 2W00A 2E82A 3MBOA 4E5NA 2B9VA 2FKAA 1U9CA 3REQB 4EZ6A 4WKPA 3FDJA 1CF4A 1KP3A 3MJTA 4C6TB 3DB2A 1CZLA 3PV8A 1VKZA 3THXB 1WQ1R 4MLZA 8ICYA 4ETIA 2REBA 3TTUA 2SKEA 3I2HA 5DULA 3OE7A 1KL9A 5KNBH 2FTKE 2DHEA 1RW4A 3EBPA 1NXOA 1F8YA 3H4MA 4IWXA 3FDXA 1C9JA 4CBVA 2H29A 2F77X 2C31A 4WA8A 4WCDA 1L4HA 5JPDA 3RJHA 3VR6A 2ZJ3A 5ISMA 1KL7A 2WVJA 3V8PA 2BKLA 1OGIA 4GC6A 3DFFA 4B6QA 4IQUA 5BN4B 2CBZA 5FL3A 2W2XA 3QSGA 4AG5A 3ID6C 2ZYGA 2C1XA 1EJBA 5EINA 1SQGA 4JL8A 2GJ9A 4IZIA 3IGFA 1U9JA 3Q0EA 1B1CA 2ETXA 2B4AA 4DAOA 1ZQDA 1N2SA 4KQEA 1FB5A 3BFXA 1E79D 2P5SA 3PC8C 3UXMA 2HN9A 3N07A 4UB5A 1NBMD 4P3YA 6CHYA 1DCTA 4M9CA 3N28A 4CMEC 1TEXA 1V39A 3NH9A 4DJFC 3Q8KA 4R1QA 1IJFA 2CB9A 5JIBA 3PT9A 3MLAA 4IIJF 2ABWA 3PRHA 4DKXA 4YN3A 3SXUA 2D5LA 1II8A 2ALZA 4XLZA 2NTEA 1S10A 2GHRA 3C1OA 3A28A 4LHSA 4FJ2A 1RQXA 2DFTA 1L1FA 2W58A 1VI6A 3V4PB 4ZK2A 2IPLA 3KZVA 3MJDA 2XVXA 4IS2A 1JDSA 1U0NA 2GHTA 5KQRA 2VUSA 3ABOB 4JV0A 4ROSA 1CQPA 4G86A 5JASA 5F4BA 4OJLA 3CINA 2JD0A 4C87A 2BZFA 2ONZA 1XPUA 4QGHA 2YASA 5HUJA 1T15A 2NVBA 2DRIA 2Q1WA 3QKSA 3W0LB 4R5HA 4KN5A 2ZVJA 1HETA 1KMNA 3AIIA 4MJ7A 4OSOA 2BTOA 1AGPA 4ZOEA 1YJCA 1UIMA 3ZCTA 2BKEA 2C5BA 1NK4A 5JCOA 3O7WA 4ZDWA 1WW3A 4KREA 1EFRD 3OQIB 1Y1RA 4D0GA 4BMXA 2WWRA 3DCYA 3WP1B 5HJEA 3EGCA 5KOHB 4IHKA 5B1DA 4LDNA 2YQEA 3UBMA 3FBTA 3GY0A 4U7FA 1E2UA 3FYDA 3EEBA 2YRXA 4HNTA 3S29A 5JNVA 2P69A 4JGBA 3NP9A 3NC1C 4RBNA 2AOTA 4U7JA 4U1RA 1BPDA 4H1VA 1TYCA 1SC4A 4ER7A 2P2CA 2P6RA 4P5PA 5LU8A 2HHLA 4I66A 1UJ4A 2YJGA 1NJGA 1NNEA 3FNIA 4YXWD 2V1XA 1OIVA 5THXA 5K05A 2FP4B 4NYIR 4HV4A 2JJ2D 5CMLA 2GCOA 4PTZA 2YS7A 2P3QA 5HA5A 3AKZA 1UMCB 1U04A 3ESAA 1PEKE 4BC1A 3RBVA 3WK9A 1JB1A 1FUUA 2MOKA 2J9FA 2WU0A 2ZXFA 1YBAA 1U4OA 3VOSA 2ZVQX 4KGXA 3LYLA 3ZVRA 2RHGB 1RRVA 3F96A 2HSJA 4QUIA 1JEQB 3L5OA 2WHXA 4AL4A 4EA7A 2JARA 2BLNA 5BVGB 3BIXA 5LNK1 3Q6NA 4OYHA 3HKZF 1NRJB 1RQ2A 4LHVA 1ZAKA 4YCNA 2C97A 1M1YB 3WR5A 3VU3A 4R1TA 1USVA 4PQYA 5LC1A 1UP7A 3NH6A 3TTXA 4DS4A 2NNLD 2H1HA 1XQXA 3UMMA 2FQYA 1ENZA 2CWDA 3HR8A 2F1IA 1EDDA 2FPGB 4ZHSA 4I8XA 3RRBA 1JTFA 3MDCA 5JTUA 4DKJA 3VR5D 3LUDA 4NMLA 5I7AA 3ZHSA 3TG8A 2IW3A 5LMCA 2C3MA 2IPAB 5HJ7A 5EPEA 3GP3A 4YCXA 3M1AA 3TF5A 2A5DA 4RYDA 1C8KA 2V7WA 2Z1MA 9ICNA 2Y8EA 1FFCA 4QG7A 3N05A 2REQA 1SKWA 1ZU4A 4LBVA 4OVKA 3CTMA 5JWOA 3OO1A 4WACA 4C0LA 1EM8A 1NQTA 2ZE5A 3UJ7A 2JAOA 3AU8A 2FNAA 5DLFA 1I5EA 4E94A 2H2AA 5F1OA 2FSVC 3FHJA 3ZBQA 5F98A 2FJ6A 4R3NA 3MJCA 3P9YA 5L3VA 3OQOA 1DKNA 2V8OA 4F4DA 3NOQA 2A0FA 4GC7A 4HP8A 1F7VA 4K8RB 2VBIA 4RD6A 4QBFA 1VHJA 1WDWB 2P9ZA 3NHAA 4BFYA 1HEUA 3MSCA 4YJHA 3TEFA 4TKZA 2G4VA 4TZTA 1UH5A 2GXAA 3VI3B 5KFJA 3OX4A 4DGQA 4H2DA 4QYXA 2HO4A 3EQ2A 4Q24A 1KP2A 1G55A 3OQNA 1T13A 3I1YA 1RWXA 4Y2PA 2CXUA 5IIMA 3OSPA 5C31A 1FFUA 4R81A 4FYKA 3A4IA 3H9GA 2CPRA 4EUSA 2GZSA 4IP0A 2RGNC 2HCRA 3EFOB 2LHTA 4BNWA 1LV7A 2OTCA 3R09A 4AXBA 2JGIA 2QQGA 1A2OA 2JHPA 3N87A 3ERCA 5IAOA 1MV5A 3S6JA 4ZARA 5KSPA 3HXKA 4BZPA 1SUSA 3RS5A 1C9MA 1BN7A 3KSRA 5JWHA 1CIVA 3ORHA 1GAQA 4CCSA 5KDDA 2F2AB 1KKLA 3TLYA 2XA1A 4MV1A 2OYCA 4XM0A 4EPVA 4ARZB 2WYVA 5IPFA 1RYFA 3EEIA 1DWUA 2NU7B 3RANA 3BRCA 3KLMX 1DIGA 1JXEA 4XA8A 4C0KA 3LC0A 3FSEA 3T7KA 4BCDA 4TUYA 3GJ3A 3QFCA 1NULA 2CXHA 4NY1A 1XSEA 3OIWA 3RIXA 2C4HA 4O33A 3GWGA 4PLWA 3HEMA 3FUTA 4FC6A 3TZCA 4EB6B 3EUB2 2OC4A 1R64A 3NANA 3OAAD 4BNFA 5CDFA 1C4WA 3GFOA 3NWBA 1NYQA 3OCWA 2Q50A 3WGNA 1K98A 5B5EU 3R5HA 2AR9A 2XMSA 1JDBC 4K2AA 3M34A 1J0EA 4O1HA 1LH0A 3HLKA 1SBNE 3VGPA 5COQA 4HZUB 4E2XA 1XVUA 3OZAA 2CLKB 1G0NA 1ZOOA 1UADA 1BKYA 3PHJA 3P2OA 3WIBA 1O6CA 5B2FA 1NUUA 3GRFA 1DBVO 3AHJA 3O73A 4J7AA 3BD7A 4W5JA 1EP3B 1W46A 1R0RE 4GI5A 5LCXA 1MD9A 2G5IB 2FSPA 4QZFA 3T3OA 1U3UA 2VG8A 4N6NA 3MCUA 4XTRA 4O4LB 1XQ9A 4F2DA 3FRJA 4LJSA 5EZYB 1KAMA 3D43A 1SKQA 1J8VA 1CUYA 1ZEMA 3TAQA 1NT4A 5A4JA 4RNCA 1YE5A 3OLQA 3ZH2A 1AGNA 4BWMA 1BYUA 1NVWQ 2O6LA 3QXHA 3IT2A 3SCZA 1VL0A 1Y0BA 4NMMA 4MWBA 2Y1DA 3I1JA 3QPBA 3VX4A 1MSWD 1U1IA 2ZJZA 2O57A 1VDZA 1I0ZA 2UUOA 4N8DA 3AL3A 2O0MA 2IZ5A 3CV3A 2HHUA 2J3KA 4R1PA 1W30A 1CY8A 3B6JA 4E5MA 4FFWA 3GFFA 2NZWA 1DFHA 4O4HF 5J2TF 1RYZA 2FG6C 5T6MA 1L4MA 3FNFA 3IQFA 4C1NA 1GNPA 4HUQB 4EBFA 4TMTA 5KTRA 2AOUB 5KYYB 1KZGB 4AG6A 5EWGA 1S3SA 4YNBA 1SRQA 5ECGC 1I0IA 2XTMA 2HA0A 5B4UA 3QW4B 1YR7A 4JT4A 4MWSA 3MMSA 4JJEA 2AHOB 3HZZA 4C3OB 4P4MA 1X9GA 3COSA 1EVIA 3EXHC 3QE2A 4XAQA 3JQRA 1TRHA 1S2GA 1OJ7A 1RFLA 7ICNA 3DZ8A 1C9YA 4MFAA 4K5QA 1LI7A 3FOBA 4N7JA 3OU6A 1OLUA 3DMHA 2DHRA 3FN4A 5ARDA 1RVV1 4JELA 2HIHA 3AIKA 1SCJA 4CV2A 4FYVA 3E0QA 5KT6A 2O0KA 2AKEA 3VTAA 4LRTB 3T7TA 3EG9B 2JVKA 4UHKA 4TV8B 2Z56A 1DEXA 2FPXA 1IE3A 1JZSA 2IWRA 4QUGA 3D4NA 3V2GA 1PZXA 4DRYA 1STOA 2BGJA 1VC2A 3E7PA 3L7LA 3UK2A 4LF4B 2ZW9A 1JQBA 1KRXA 3GL9A 3HCAA 3IE1A 1ZK3A 4BLTA 5AVTA 2WZBA 2J9YB 4R1SA 5CP8A 1G6HA 1T6NA 2QAGC 5EJMA 3MERA 3JR3A 4OATA 4JBHA 2PGDA 3FXAA 2XJ4A 4BAZA 1B8OA 2I3BA 2YYZA 1A9QA 1Z0JA 4I5GA 3PHHA 4X5VA 2C84A 2X2EA 3PB3A 3A0BU 1EBBA 1NXTA 3TTYA 2RBGA 2OGSA 3IKMB 3ZWMA 2IYXA 1BXGB 2J32A 2BEWA 4GMFA 4LVNA 4P4GA 2UZ0A 4MEXA 4R16A 2WTBA 1A8IA 1XTZA 3L7JA 2W2MA 4EYQA 5EJ4A 5JE8A 4ZXFA 4GMGA 4FGZA 5JI2E 4RACA 2JRZA 4TX1A 2J0EA 5CCXA 3BRWA 4N0PA 3W6UA 1XCBA 2EV9A 1LLQA 4MIYA 3EVDA 5LJIA 1X9MA 4JNCA 3IJRA 3LKZA 4Z1MA 4LUCA 4NF2A 4EHJA 3UUFA 4OHMA 5EUBA 5KAIU 3DVLA 1Z45A 4ZVNA 5K0LA 4Q4JB 4BL5A 3OIGA 4QDKA 3VR4D 3LI2A 1OYYA 5IYZB 5CA1F 1YOVA 1YZTA 3OLYA 3TQHA 2I55A 1T0IA 2FN8A 3DV2A 1XXHE 2BGUA 1SA0B 2LP4Y 3BTOA 2AT1A 2AQKA 1AMOA 1Z3CA 3NT4A 1TK0A 2QVBA 4LRUA 1R1DA 1CY1A 3CVYA 8ICQA 4FDTA 1QLNA 3VZDA 4AULA 4NK4A 4F60A 4V0QA 4TLEA 3EHDA 9ICKA 1VA4A 4W6QA 2B3DA 2ZTVA 3F5QA 2UYHA 1PX2A 3KJGA 3J80A 5FA8A 1YBHA 3JTEA 5T3UA 2X6RA 2CHQA 4TLBA 3LLVA 4W5RA 5KNIA 3T4XA 1UBJS 2DUMA 3MQ2A 2Z09A 1YWGO 2J41A 3ILXA 3QE4A 3VNAA 3M9LA 1W52X 5C53B 1AN9A 4FGSA 2AC7A 3O93A 3ADOA 2ZCVA 4I4LA 4TMVA 5JCJA 1T91A 4S04A 4JLMA 3D2BA 3GLKA 1AGRA 1RRCA 4OD0A 2KK0A 4DTIA 2YFYA 2JATA 2AU0A 4JVLA 5TPWA 4UUAA 3IPXA 3KFLA 5I3ZA 2PRYA 4BAGA 1SOAA 1UWCA 2FKNA 3WI7A 1JROA 3OSUA 4QNLA 1R4MA 3OJSA 1V48A 3AJDA 1GLNA 4E5SA 1YONA 1NWHA 1UZAA 2QN8A 4ZT6A 4J91A 2ZIAA 1X42A 4AMVA 1X8KA 4K26A 3ZS8A 1TAQA 4U2EA 4FHDA 5I9SA 4R5MA 3WLEA 1NKSA 2BEJA 1O9GA 1HH4A 3ROGA 2XB9A 2XGSA 4HX9A 1FZTA 1UZLA 4IDQA 4AYWA 3O1IC 2JIMA 4MV6A 4A0GA 4FLMA 2DY0A 1ZXBA 2EKDA 4XUDA 2NSJA 1L6NA 3T4UA 1NQXA 4WSOA 3RH6A 3SVTA 4ZALA 2O4CA 3KC2A 3TMYA 3FAKA 3EC2A 1E2MA 2JLWA 1Y7PA 1U6IA 1UEXC 4DCSA 4JJAA 1Q22A 3E53A 2EKBA 4XASA 2HKIA 2RGEA 4G8BA 4UD2A 3B20A 4C0BA 4TQ9A 3T7AA 1IUPA 4H1HA 4UB1A 5JAOA 5FUBA 3SFZA 4DL7A 3AI3A 1BDJA 1NUAA 3RBDA 1QAQA 4WZAA 1ZUHA 4M88A 2WIJA 3KU4A 3TI0A 4D9JA 5JD6A 4MUJA 3PNOA 3W6PA 2W22A 3OLZA 2XAAA 1RRMA 3HG7A 4NJ8A 2NM0A 4OLFA 4N76A 3NUQA 2FJ0A 4U9UA 4ECSA 5KKCA 3ZVMA 3EVBA 2ACVA 3DZIA 3EEQA 1J2NA 3GLFA 4CG1A 1Q91A 1QGAA 1Y89A 3T5LA 3IS3A 5SYAA 3TSCA 5JPCA 4KMRA 5FLEX 1P62B 3PDUA 4QJ5A 4R0NA 3ZQ4A 4Z0HO 2WB4A 3ENQA 1IJEA 1I3CA 3L8EA 1WZ2A 4P4LA 5D51S 2P75A 3LNCA 1UPTA 2FAXA 2E8PA 1YB5A 2HOIA 4ALLA 1YB7A 4B0PA 4RABA 1ZRHA 1FNSA 3DYIA 4ZV4A 4ZANA 1T0BA 3UAYA 5AI4A 5I48A 5BPCA 3RB3A 4KUGA 2CRXA 2XADA 5JQWA 1TUIA 3JASB 3G7UA 1QHIA 4R8UB 1BZYA 3NNDA 2G8NA 1OZHA 2H1IA 2UYYA 2JZBB 1L3UA 2GERA 2L18A 3BDIA 5DTRA 3OHSX 3A2KA 2H4WA 1J9GA 4M9JA 2VHYA 2VPXA 4OKSA 1PW5A 4N48A 3L6UA 2N1RA 3AF6A 3A1VA 2AVDA 3L0OA 2QXUA 4B3IA 4BMNA 1Q74A 2EQBA 4U2CA 3ZVKA 4NPHA 1R5JA 1ELOA 1F7UA 2DTXA 4HWTA 1Z2CA 4Z2YA 2G4CA 4FSDA 2C9CA 1Y3DE 4O8CA 3HA7A 5CXQA 1G8MA 1SCIA 3VH2A 4Q1BA 4RTKA 5CVDA 4C0AC 1X74A 1ABFA 3G2KA 3T3EA 4RL4A 1OZAA 3ZK7A 4BLOA 3DZBA 3MWEA 4EKYA 1NW5A 2WJPA 3FFWA 2GM3A 4P3PA 2KFZA 2IDKA 4HDRA 4YMOA 1QH8B 1M83A 4UNIA 4DQKA 4GXQA 1MZPA 3E3LA 2PE5A 2GD2A 3CB4A 3ZPXA 1YACA 1Q7CA 4O4IB 1MVOA 1UL1X 3OEWA 4OHYA 1KE2A 4ERNA 3T4EA 1FFVA 5IM4F 1LLUA 1JBEA 4HDNA 3F5SA 1VIDA 1UAGA 4ARIA 2R85A 4W6ZA 3GHYA 3S7ZA 2XUJA 1CERA 4TKVB 2VPZA 4NLNA 5B1SA 5K20A 4V39A 1IIRA 4RV4A 5EQFA 2EWWA 2AN4A 4PC3A 1R6AA 1H8HD 3QNMA 2KYRA 4K88A 2O2ZA 3VR5H 4JUAA 4AZWA 5JJIA 1USWA 2I3AA 3FVVA 2HBYA 1Z6ZA 7GPBA 3EUFA 4KG7A 4USAA 3TGLA 3WBKA 2OHIA 5TY0A 1AK2A 5KFIA 1N5XA 3C0KA 3L2OB 1G4HA 1KJ9A 2E4VA 2O06A 1XWWA 3DB1A 2G1PA 2XNKA 4KP7A 1CUDA 5F2EA 3R0IA 4A8PA 1VLBA 3IULA 4Q48A 3ELWA 2XB8A 5BW6B 3DMNA 4BDPA 4KXWA 3FR8A 2IP2A 4WXRA 3I4LA 4JJKA 5CWRA 1ND5A 1FVXA 1PJ8A 4YMSA 2J3EA 2H7VA 3IQWA 3L92A 3L3FX 1THGA 3H3JA 4QUEA 2PMZF 1SHUX 1IZZA 5CVVA 3HKBB 5DB6A 1E6WA 4WIAA 3RIMA 3OBIA 2J1LA 3Q8RB 1YZUA 1WWVA 2EZUA 4L0DA 2XUIA 5ARCA 3HXMA 2YVAA 3INRA 2PA0A 3STTA 1QV7A 1P2SA 2FMUA 3RU2A 1XA3A 2W7PA 2H9YA 1IK4A 5M04A 1DHTA 3B7PA 1BW9A 1I24A 5FOSA 2HLDD 3A6EA 3BCUA 5JO0A 1I30A 3TUJC 3E3NA 3D8UA 1V5GA 4QUDA 3V7LA 3KPVA 2VWPA 4H7HA 3WKBA 4RNNA 5CX1A 1WZNA 1VPDA 3M9WA 4NFLA 4W7IA 2C2RA 2W6JA 2QI9F 2I7VA 5KG6A 3AFNA 1GL6A 3RR7A 4ZGBA 1SG0A 2K7ZA 1RQGA 2ENUA 3U62A 3QVUA 1KO5A 1P0IA 2OMEA 3EZYA 2ERXA 1KH1A 1J1UA 3HSKA 4UE2A 2C8KA 4FBUA 1FVHA 3NHUA 3HDVA 4XH9B 3THWA 3IRVA 3EHEA 2UYCA 4Q3BA 2II6A 4JH0A 1ENPA 2BI7A 4CV3A 3GNQA 3Q2OA 4MUGA 3KETA 1VIVA 1YJ5A 3C48A 3NHYA 1JDUA 1T8YA 1QHHB 1CKEA 2GTPA 3IEVA 2WNIA 3PPYA 1E9FA 4JLBA 3O47A 1DMSA 5CM9C 3KKAC 1JR3D 1U7PA 2EP7A 1C30A 3D3JA 1JIQA 3OPYI 3I3SR 2BM9A 1ZQRA 1DK2A 2B2NA 3CT6A 4BOYA 3KPYA 2Z0MA 2CLMB 5A0FA 4KN9S 3C6YA 2D7DA 1NUSA 2Q6OA 3LXUX 3TG2A 1FBTA 3NHKA 1ADCA 3PGLA 2D2FA 4E5DA 2ISSD 5SV2A 4ODIA 4LVCA 4P81A 7ICIA 1PNVA 1W0JA 5FWXB 3X0DA 4FN4A 3BB1A 4D74A 1AQJA 4RFSB 2WAQC 1K8YB 4TZ0A 5AW0A 2C96A 2GCNA 4ZJZA 1EXNA 2R7KA 2XMRA 4TT3D 5AVWA 5CFOA 5BP7A 4J9UE 3BS4A 3K70D 4NC9A 4F8YA 3LGAA 5BRAA 4N3BA 3W6ZA 4NHEA 4KQ6A 4HB4A 1NJYA 2JAUA 3DZHA 3BXHA 2LNDA 3B3FA 1L5MA 4TVOA 1L5NA 5TQ0B 4DS3A 4LTMA 3G68A 2YRWA 2X1MA 2J4CA 4XEHA 4IH1A 1XS9D 3I1FA 4MVJM 1SZJG 2ZIXB 4YH1A 4UAWA 1YXMA 5ITVA 2P9GA 1PVPA 1NNLA 3C5HA 1JG6A 2XVMA 2WOOA 3ZVNA 2R5NA 2K4IA 4DIUA 3DEIA 4A7PA 2CFRA 2VP4A 5IAGA 3MGAA 4Q8EA 4OP3A 2JAPA 2X8WA 3FYHA 3GAFA 1EB8A 1PWHA 5CPBA 3UB4A 1CFJA 3QVGB 3CX4A 1Z5WA 1JXMA 3Q1KA 4RK5A 5EIEA 2P5TB 4RQ5A 4J9VA 1H3FA 1D6NA 1YNOA 1ULHA 3DUWA 4I1PA 3D4LA 4Q03A 2D3WA 3MCVA 2O2EA 2GN2A 2JLRA 1EGHA 9LDBA 1WVGA 4TLLB 3O26A 3DMPA 4FYMA 4OHUA 3GJ8A 1SWVA 4IQVA 1DC3A 2AEJA 2IH2A 2DSTA 4ZQFA 3PDIA 4V1CI 3S7TA 3TAHA 5FWAA 3OT1A 4NBTA 1VCHA 1E6MA 3M6XA 4EPRA 4DV2B 2DFLA 3PHBE 3ELBA 1J39A 2J5KA 5JI3E 4C2AA 3EA0A 5SY9A 1TQ4A 4N5HX 3KKPA 3B9JA 1DBPA 5FTLA 3AZQA 4X20A 1AQYA 3C5GA 5K3BA 1ZCAA 2VDLB 3CUSA 5A62A 3DZFA 1AN0A 1E4EA 3NWJA 3I28A 1PGJA 4YV2A 3KEQA 1YTLA 1OC2A 3UAXA 2B4KA 1XROA 1XO0A 4NYJQ 2HQSA 4Y30A 3JD0A 2XQKA 3BPSA 3Q3EA 4M04A 5GIPE 1S89A 3LYHA 2OV6A 2RDJA 4BBPA 2XQFA 4J43A 5KFRA 1UFOA 4DDVA 1C7YA 3COVA 2WMDA 1JF8A 3WGOA 4NICA 3AR5A 3QXSA 4NBUA 1X7YB 1RHJA 2VUIB 3M3DA 3RT7A 4Q3CA 5EMNA 4MYDA 3ZLTA 3JQAB 2HOFA 3KJNA 1Q95A 4RLHA 4II7A 1PK1A 2UVVA 3HKDA 4Z8YA 2QIOA 4RTOA 4DLNA 4KLIA 2WMYA 3AH8A 1QFYA 2AFIE 4DCMA 3TNJA 4DSAA 3RH5A 2YV4A 2H65A 4GRIA 1T2UA 4MEBA 2Z6VA 5GQSA 1W35A 2HCBA 4C1BA 3PR2B 5HFAA 3UXHA 3DOEA 4EZ9A 3RVDA 3KDPA 3E23A 2G4LA