4DCCA

Crystal structure of had family enzyme bt-2542 from bacteroides thetaiotaomicron (target efi-501088)
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
203
structure length
203
Chain Sequence
KGIKNLLIDLGGVLINLDRERCIENFKKIGFQNIEEKFCTHQLDGIFLQQEKGLITPAEFRDGIREMMGKMVSDKQIDAAWNSFLVDIPTYKLDLLLKLREKYVVYLLSNTNDIHWKWVCKNAFPYRTFKVEDYFEKTYLSYEMKMAKPEPEIFKAVTEDAGIDPKETFFIDDSEINCKVAQELGISTYTPKAGEDWSHLFRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative haloacid dehalogenase-like hydrolase
publication title Crystal Structure of protein Bt-2542 from Bacteroides Thetaiotaomicron (Target Efi-501088)
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
total genus 77
structure length 203
sequence length 203
ec nomenclature
pdb deposition date 2012-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 4dccA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4dccA01
5AK3A 1Z4PX 3IB6A 4F72A 3TLMA 1SU4A 3B9BA 4UMFA 2HOQA 2JAUA 3WGVA 3AR5A 3ZVNA 2EAUA 2QYHA 2PR7A 3PGLA 5AI5A 5ALHA 2NO5A 2C8KA 1FEZA 2R8YA 3ZWDA 4UU1A 4FE3A 1SWWA 3RFUA 5IT4A 2FUCA 5AW1A 3NALA 3R9KA 5IT0A 1PW5A 4BEVA 1O03A 2IOHA 2GMWA 1YJ5A 1U7PA 4B6JA 2YBDA 4C4RA 2YMPA 2ZBFA 3W5BA 5AM1A 5AW5A 3W5DA 2G09A 1XP5A 2FPWA 3MN1A 5AESA 2ZBEA 5AK6A 2CN1A 3QU2A 2EATA 2WF6A 2JAOA 2ZXEA 5AVYA 4HGPA 3I6BA 5AKGA 4EZEA 4MUMA 2CFRA 4EX7A 1VJ5A 1ZOLA 5ALFA 1Z4QA 4UMDA 1Z5GA 4H1WA 1S2OA 4I9FA 5AKZA 3ZI4A 3N8GA 2C9MA 3FGOA 2I7DA 3L8FA 3KC2A 3ESRA 3R4CA 3QYPA 1RLTA 2RB5A 4AP9A 2GHTA 2RARA 3SKXA 4BNDA 2B1QA 3PGVA 4ZEXA 2WM8A 1ZRNA 1EK2A 1RMTA 3GYGA 2PKEA 3B9RA 4UMEA 1QQ7A 4YCNA 1YS9A 2HO4A 4OHFA 5AKKA 4BYGA 2C8LA 4Y2TA 2YJ4A 5AM5A 3I1YA 3WK6A 3ZU6A 3BA6A 2MU2A 3QUTA 3J7TA 5AVUA 3OCVA 1U2TA 4MWOA 4PNHA 3A1DA 3SLRA 3AR2A 4L57A 2RAVA 2HDOA 4BBJA 4JB3A 3L8HA 3ZVMA 1ZD2P 4YIHA 2JGAA 5ALPA 4CE6A 3SKYA 3A3YA 3U13A 2R8EA 5AVWA 5ALOA 3E8MA 2ZBGA 4DW8A 5AKJA 3SHQA 3E84A 3MC1A 2HX1A 3VAYA 3CNHA 4ZEWA 3N28A 1NRWA 5AVVA 3I76A 3WKCA 5ALEA 3AR9A 2WHEA 2W43A 3FZQA 3QX7A 5ALDA 2HCFA 2R8ZA 2X4DA 2WF7A 2G80A 4I9GA 2IA5A 1QH9A 3OPXA 3L7YA 1RKQA 4CF4A 3ZTWA 5AW3A 3M1YA 2WF9A 5AI4A 1Z5UA 3NASA 4YGYA 3ZW7A 4UU0A 2HF2A 2VKQA 4GIBA 1ZS9A 4FYPA 5IS2A 3A1CA 3WKAA 2P27A 1WR8A 3DAOA 3FPBA 2B30A 3IRUA 3AR8A 3ET5A 4CF3A 5AKYA 3WK4A 1RMQA 3EWIA 4BEWA 4UM5A 4OFZA 3K1ZA 1Z4NA 2BDEA 2AGVA 3L0YA 1CQZA 1JUDA 4EENA 3ZWKA 2I55A 3FPSA 4Y2RA 1Z88A 3NIWA 3L0BA 4BX3A 3W5AA 4AS2A 3E58A 1RLMA 1IWOA 5AHXA 2YMLA 2AUTA 5AK4A 4ZEVA 5AW6A 5ALUA 2I6XA 5E0OA 3BWVA 3HLTA 2RBKA 4IFTA 2OA0A 3U7EB 4HGQA 5AI8A 2FDRA 4QJBA 3DDHA 4E88A 2I54A 4EEKA 3UM9A 2FPSA 2YJ6A 2OYCA 3OCYA 3ZX5A 1ZRMA 1AQ6A 1NF2A 2BY4A 2GO7A 2FPUA 4DWOA 2MU1A 1XPJA 5AKEA 3WGUA 3SF0A 1TJ5A 4KNWA 2G06A 5FP0A 1U2SA 3QU9A 3WK7A 2OM6A 4BX0A 5T41A 1CR6A 5ALYA 2YY6A 4DFDA 2B1RA 2JAWA 2P69A 3NANA 5AIAA 3P96A 4AS3A 2Q4RA 1RDFA 3L1UA 1RLOA 5AKHA 4DCCA 4EELA 4BNDB 5ALVA 3QUBA 3IJ5A 4Y2SA 1RQLA 2B0CA 3WKEA 1L7PA 2CFSA 3L8EA 1X42A 2FI1A 5AKLA 1RKVA 5ALXA 5ALKA 4KNVA 4Y2YA 4IG4A 3W5CA 3ZTYA 2MSNA 3NUQA 2R8XA 4Y2XA 4KN8A 3E81A 4Y2VA 4Y2PA 3U19A 2IOFK 1RPZA 1RRCA 1U7OA 2I34A 5AIBA 2B8EA 3KDPA 2P11A 3NRJA 1S8OA 5AK5A 3QU5A 5AVXA 1L8OA 3WK5A 2YMQA 5AVSA 1ZJJA 1J97A 3M9LA 5ALSA 4Y3UA 3QU4A 1XVIA 2C4NA 2YN4A 2JARA 5AI0A 5ALJA 5A3RA 4CNQA 1RKUA 1KYTA 5A3QA 5AKIA 5ALRA 4RESA 2NYVA 3NAMA 1Q92A 5AW4A 4HGRA 1ZD5A 1Q91A 1TA0A 3F9RA 3UMGA 4UAUA 1Z4MA 5ALGA 5AW9A 2YJ3A 3OCZA 4NFLA 5AKXA 3OTQA 3DV9A 1LVHA 2D2VA 4J2TA 3AR3A 3N07A 2FUEA 5A3SA 2WF5A 3L8GA 2GHQA 1TJ3A 3CZ4A 1EK1A 2B82A 3L0CA 3N1UA 4HGOA 3UMCA 5AI6A 5ALNA 1N8NA 4L6CA 3KBBA 3U26A 1RMYA 2OBBA 2GFHA 4FFDA 3SMVA 2IOFA 5AM3A 3FVVA 5AM2A 4YCMA 3AR6A 1Z4KA 2PQ0A 4HGNA 1YV9A 3WKDA 3ED5A 5AW2A 2G1AA 4C4TA 1T9ZA 4UATA 4HAIA 2I33A 2P9JA 3QLEA 4YH1A 4C4SA 1Z4JA 4XQ0A 2NO4A 2BDUA 5AVTA 4QQFA 4Y2QA 1WZCA 2ODAA 3ET4A 1VFPA 3OCWA 1QYIA 5ALLA 3QGMA 1RQNA 1F5SA 3R09A 1ZD3A 4RETA 1T5TA 3RF6A 5AVQA 1WPGA 2YMMA 4UMVA 3WKBA 5AM0A 1J8DA 3A1EA 3EF1A 3QNMA 3HYCA 4J03A 4JDPA 2W11A 3UMBA 3B8EA 4YIKA 3AR7A 1YDFA 5ALQA 4F71A 1Z4LA 5AVZA 3WK9A 1Z4OA 3OCXA 4NAVA 1ZD4A 4UW9A 4XE5A 1Y8AA 4NV0A 2FEAA 3DNPA 3ZUPA 2HHLA 2B8JA 5AW8A 2ZBDA 3KZXA 3SD7A 4O8CA 2G07A 5ALIA 5ALTA 4BX2A 5AVRA 3N5KA 3QUCA 3MMZA 5AI9A 1Z4IA 4NWIA 4G9BA 4UARA 4BKMA 3WK8A 1SWVA 4KX5A 1NNLA 2W4MA 3MPOA 4Y2UA 1O08A 3S6JA 4G63A 1YNSA 2HI0A 2ZOSA 4XPZA 1U02A 4OD0A 3QXGA 2FPRA 3U7HB 4OCZA 3ZX4A 1L6RA 2DQSA 2FPXA 2Q4TA 3ESQA 2AMYA 3EPRA 1YMQA 4L6AA 1QQ5A 4UASA 5ALWA 5JJBA 4HYTA 5ALZA 1LTQA 3KOOA 3L1VA 3ONNA 2ZG6A 2AH5A 3KD3A 3U7GA 2WF8A 1L7MA 2HSZA 5AM4A 2G0AA 4KX3A 5AICA 4Y2JA 2HEGA 3QUQA 1L7NA 1RC8A 1K1EA 2O9JA 1L7OA 1N9KA 2O2XA 5ALMA 1QQ6A 2EARA 4KYTA 2G08A 4UAVA 4XOUA 4CF5A 3OCUA 1T5SA 2CFTA 3PCTA 3U7FB 4GXTA 2Q5EA 2IYEA 3AR4A 3PDWA 1L8LA 4YCLA 2YJ5A 2QLTA 3ZVLA 3I28A 4EX6A 3L5KA 1TJ4A 1WVIA 2HF7A 3FM9A 5AW0A 3QU7A 4UM7A 2C88A 4NABA 3EF0A 3D6JA 1MH9A 1VJRA 2YFYA 2WFAA 1TE2A 5AW7A
chains in the Genus database with same CATH superfamily
3AHGA 1NASA 3IQFA 3HTXA 1UBSB 1KQ3A 1XTRA 4MQ6A 4TXMA 1QHXA 3CRZA 3RAJA 3NTQA 1JG2A 1W1IA 2DOKA 1Z2NX 1CY1A 2P5YA 2BR4A 4WN9B 3PDIA 1YUNA 3RJ5A 1V85A 2EP7A 3QW2A 2ZIWB 1JWAB 2QXUA 3DHVA 2OZLB 3WA7A 1PUZA 2FMPA 4L5AA 4AN0A 5A4IS 5UKDA 2BGLA 2I22A 2WWXA 1QO0A 4LCJA 2WM8A 5KDOA 3JQ8A 5BV2P 3A8TA 4JT2A 1A1SA 1AUQA 3HE3A 4J7CA 4LSWA 4GAEA 3BH7A 4RKRA 3IR6A 4MR8A 5A2GA 4B4VA 1UOOA 3ONFA 1KJ8A 2QL7A 2CLDX 3PSAA 4EJSB 1NJ1A 4WBSA 2R8EA 3DV0B 3EN0A 2XMQA 3K8YA 4NMXB 5LZ4A 1E7MA 1K2VN 2VWPA 4HD8A 4IV5A 1V48A 4II7A 5KTOA 2JVKA 4YXWA 3B8HA 4KFSA 4MUNA 2HEIA 3MWJA 1DC6A 2DRIA 3E0XA 3WDSA 3LTNC 4MKGA 3BM5A 1HNNA 4ND6A 3TW8B 1E4YA 1T4CA 1R4ZA 1IEWA 4JP3A 2I8AA 4L9RA 3QIAA 1VBFA 4ZQHA 3C3CA 4BGDA 1W6UA 3AF4A 2RGGA 4JJ4A 3MDCA 2RC6A 3C3XA 2R8GA 2NU6B 1DQPA 2ZRDA 2WSBA 4OYYA 4EW6A 1K63A 4LJSA 1S5LU 1PTKA 4DIKA 4TLAA 5K9ZA 3P96A 3LI2A 5DTRA 3ZV5A 3DVSX 4QQKA 2PMDA 2I1LA 1OV4A 5DI3B 3IYLW 3CGGA 2OWDA 2FWPA 2W2XA 5DGIA 2ZIUA 3ZXSA 4ED3A 2X13A 4BJ5A 2WU1A 4JH0A 1P6XA 3IEIA 1NDUA 1L4GA 4BFLA 5A6VA 3S28A 3QU4A 2WFLB 4M98A 4HDOB 3QPUA 4G1CA 2JFFA 2X23A 2XIQA 1CUDA 4IXMA 1K75A 3W0LB 1DRVA 4CL2A 4DF4A 3OZVA 4OQLA 1Y3CE 3P0EA 2YOFA 1UZLA 3AJDA 2CNNA 3OLYA 5BSHA 1IL0A 5G0VA 2B21A 1KU0A 2VP5A 4AMYA 4NL9C 1YBAA 4YCMA 2WWGA 3ETJA 4G0OA 3ED5A 1TA4A 3LJKA 1GKUB 3P9ZA 4CLOA 5KBYA 4DTIA 4U7DA 3G8CA 2YR0A 4GW3A 3VU0A 1RQNA 1MZVA 4MVJM 3IP1A 1UANA 3FOWA 1OXMA 3WJ2A 3EF1A 5FDFA 4NC9A 2RGYA 3AKYA 4IH1A 1ONBA 4RTKA 1E2MA 4PONA 1A04A 2M6LA 4ZI7F 1FXWA 2PVCA 3GH3A 3AEUB 3RJIA 1E1DA 4YAGA 1O96A 4OK5A 5FOSA 3PTAA 1U02A 4MEAA 1J39A 1V1RB 3R5FA 4MGKR 2KIWA 1OV6A 3ABZA 1OWNA 4P92A 3ENVA 2QAGB 2Y1GA 2Z98A 3Q5DA 3MLEA 4IJKA 5DEOA 3CUSA 5L7WA 3AXTA 3FLBA 1JB1A 2HEGA 1E3EA 5B7NA 3ZGXA 3PRHA 1E5TA 9ICNA 2YC4C 2L17A 5K3FA 1ZNQO 4KODA 2FSPA 2XUPA 3ZVLA 4M86A 3B3JA 4O5OA 2GXQA 2FN7A 1QVAA 3BSYA 2ANBA 2ENUA 4X41A 3U6KA 1IY1A 4W5RA 1UPTA 4TKUB 1L8QA 3NTXA 4KK3A 1E79A 4GPTA 1ZQOA 4MO2A 1RE0A 2BOVA 1N7IA 1OAAA 2FCAA 2JI4A 2EAOA 2GESA 5DB8A 1ZZEA 4HZIA 5KTNA 3FR8A 2ZRBA 3EVAA 1DQYA 3QWIA 4B3RB 1H23A 3Q8MA 1U3CA 3A6LA 2QX8A 1LS6A 2FWJA 4G67A 1PQPA 1Z38A 1ZX1A 4HP8A 1SQSA 1J8FA 2XA2A 2N1RA 3NU1A 5IW8A 2R60A 4XVRA 2H1WA 2ZSHA 2W2LA 2D2FA 3SXUA 4DOBA 1XCLA 3H9GA 3K9NA 1C7IA 4HMQA 4KLLA 4IZHA 1OFTA 4M54A 4DV5B 2IODA 3I73A 2YRFA 4ER0A 1VJDA 4QIWC 5EIXA 1L3UA 3VYVA 3B7PA 1T0PA 4ZAXA 3TQHA 4AD8A 4FHGA 3AYZB 3JVUA 5FBLB 4S2EA 5JARA 5JSZA 3E05A 3WYAA 2C9OA 4WLEA 2DHDA 1JEEA 1NY5A 3WKCA 2W43A 1EUYA 4G37A 3LUCA 1PNTA 3SG0A 4FQ5A 4LIPD 3GRKA 2GB4A 2QRNA 3LTEA 2GCOA 3UUGA 2RK6A 2VKQA 3OY7A 3KJQA 3AR8A 3MWDA 1ZVKA 1QGYA 1C9KA 1QTQA 2Q7DA 1F8XA 5JO0A 5BVHA 3SC6A 4P7JA 2MWMA 3L4JA 4GX1A 2QAIA 4LJXA 4WNAA 1OW5A 4RMJA 4O4IA 4MVWA 2ZBVA 4MVJI 3BEOA 1G20E 3H8MA 4AECA 3K6SB 1PTJA 4QUKA 3OZFA 5MN6A 8ICLA 5I9MA 1YZKA 1W5BA 3E9QA 3D7KA 1W52X 3H13A 3CRQA 1NMZA 5E9WA 5J63A 5TZVA 3NHLA 4U9IS 3IJ5A 2R8IA 2ZIZA 3ZZ0A 4Y9DA 5IC5A 2YWBA 1P1HA 4QRDA 3BT7A 3LPMA 4M60A 4RGYA 1WWKA 4DQDA 4RVSA 1CYDA 2SNIE 5AVXA 1X0XA 1L8OA 2NO9A 1H3NA 1GV0A 1OUQA 1WZEA 5IBPA 1FK8A 3F7NA 4RTNA 5DM0A 4DM7A 3F9RA 2ZIXA 4NATA 5JTUA 4AZ3A 2Z1NA 5AKXA 5GQSA 4GRAA 3IFSA 4PZAA 2XOKA 3RYCA 1DX4A 3B1XA 1PEAA 2KKVA 2J0UA 1L4LA 4ME6A 3T1NA 2QL9A 4FK8A 4AJ1A 3PUYA 3BGWA 2DU8A 1WU8A 1A7AA 1QBKC 2HLPA 2AQIA 3A31A 4C1NA 3NB0A 4PLTA 4FT4A 3KQVA 3HK2A 1RHMA 1UK8A 5JADA 2J4FA 4LSZA 1VA5A 4YJ3F 4ZRDA 1PWYE 2AOUA 4MGHA 4D8XA 2ZRIA 4G1VA 2BH2A 2WIFA 3QNMA 2QU8A 3ORHA 1X7HA 2X4IA 1H2EA 2DYKA 3WK9A 1ILEA 5IP5A 3CVUA 3F47A 4MDEA 2XUHA 2AC7A 3Q41A 2YUTA 2GASA 3F96A 1P7DA 1DGQA 4PYJA 4TV8A 1XRSB 4HNQA 1TPYA 4LHYA 2VHTA 2RI1A 1ZHFA 4U9HS 1TK5A 2HHAA 1GM5A 1QSLA 1AF7A 2JJMA 5K99A 1RVDA 4MJLA 1I8TA 3N8NA 2JL1A 2AN9A 4I2EA 3N87A 5F9FA 4BB9A 4PGFA 3FYCA 1QLHA 5CDYA 1KQFA 1IBCA 1JAZA 4HLUC 3WV5A 5HOEA 1RP7A 4N6NA 4NLLA 1JMKC 4J8PA 1VHQA 4G5RA 2O9JA 3EH2A 3UCFA 1ZYQA 4WKNA 2J0EA 4JC5A 1QTMA 4N7BA 1HDRA 2QARB 4QJ4A 1TD9A 3WLTA 3A4YA 3HV2A 4H3KB 2B6HA 5LNK1 2F90A 3FDZB 5CU7A 4YR3A 1UF9A 5HMLA 4Z3KA 2WM2A 4YN4A 4KR7A 3PJFA 1TCCA 3QVXA 2ZRPA 2R1VB 3GQVA 221PA 3PNBA 1XCGB 1F0PA 1GUDA 4FOLA 2KOBA 2IXTA 5EJIA 1MJ5A 5JR3A 3FE2A 4FYYA 4RJ2A 4CHTA 4FOOA 1XDBA 5E4JA 3TJMA 3RSZA 2VI5A 3BGDA 3LP8A 1FU4A 1Z2AA 1XK7A 3MWEA 5TJHA 4KCGA 3H0CA 2IYRA 4LOIA 5F9MA 2IHNA 1J09A 3VO2A 4KXYA 4DA6A 3BBLA 3GIIA 4CMGA 3OZBA 3DE4X 3L07A 1YZFA 2NTYC 4I08A 2VG8A 1D4OA 1HL7A 4M55A 5HJ5A 1NW9B 3ILXA 2QB5A 4W6ZA 3A1DA 5HFNA 4YK7A 1ZIOA 2JIZA 4DLNA 3FLAA 5KAMA 4D9NA 3O8RA 2CB9A 2WM3A 2A57A 1PFVA 1TT5B 3FSRA 4C2UA 2B5OA 1ZLXA 3TQTA 4G9GA 3GCZA 2HRRA 4RHFA 1SC4A 3JX9A 4L4XA 3LF2A 3TXXA 1LK7A 5D7NA 3ZLTA 5J5CA 4YFKA 4NCKA 3HCBA 5FV4A 1NC1A 3AY7A 4MROA 1DBVO 3ET5A 3NP9A 3PYXA 4QREA 2JFOA 4LJ5A 3GUUA 5J23A 4AS2A 4GRDA 3OWXA 1J22A 1I5OA 4CMIA 7ICNA 3TAPA 3LWBA 3IHWA 2EX1A 3O47A 3RWBA 3LF1A 1C3OB 4FQ7A 5JJCA 1LXCA 2HK7A 2VDVE 3TOXA 5FWXA 1TK8A 3OTGA 1QCZA 4DLVA 3CX7A 4OGWA 3SKVA 4TGLA 4G97A 2FAXA 3RT1A 3LBFA 2WJ4A 1SKAA 3PR3A 4BU0A 1PJ3A 2ODQA 3AQIA 1CHDA 3L8EA 3QPBA 4DBZA 2W8BA 5ALKA 1UFKA 3C2KA 1QB7A 4W9RA 2PHZA 3T7KA 2QTBA 2C4MA 3GJ5A 1DDGA 3T5AA 4I99A 3GFFA 5JHGB 4DMGA 1BWSA 9LDBA 2DXIA 1GKIA 5T7BA 5KQRA 3A6KA 3ZH2A 1K68A 2GYWA 2FW6A 1RQPA 4LW8A 2R2AA 4ED2A 4G5SA 2VTDA 3FNRA 3SSOA 2CJFA 2JB9A 1KTQA 1NBIA 2BFEB 2C42A 1CUWA 1B1CA 3P9CA 2OXOA 4FI3F 1GQFA 4LDJA 4KSBA 2GEFA 1BDIA 1ZJ5A 2FLNA 4JLBA 2D8CA 1FYEA 3LP6A 3SHFA 3VVCA 4WFJA 1P2SA 4BUJA 4V38A 1V9CA 4QTUB 3LXUX 4IUBS 2CE2X 5CD1A 4NF2A 1S3SA 1C7YA 1J0EA 4BVJA 5IZCC 2IS4A 1MABB 3DVAA 4EFNA 4ML3A 1SV0C 4RVFA 1ZWKA 3DA8A 3KVVA 4GBJA 5KNDA 1X9IA 1XWIA 4NCNA 4X64B 3GXOA 1FNCA 4WZAE 3D2LA 1GSOA 1WDKA 2GRJA 5ALTA 4KQKA 1ENZA 4E5YA 4AC9A 1ZQNA 5AVRA 4IJVA 2GSDA 5D3MA 5H3HA 4EUHA 3ZEIA 4G63A 2PUGA 5CRIA 2KSOA 3WXBA 2Q28A 5KFQA 2JATA 4KOEC 2BCEA 4RANA 4PO3X 4DIEA 2Z4TA 4ND1A 3AUFA 1YBHA 4EG8A 1V1JA 2XI4A 3IPXA 5GONF 4AF7A 3NH6A 1KY5A 3KQNA 3H97A 2QOEA 3S2ZA 2J1LA 4V0MA 1ZD1A 3CW8X 4YAWA 1ZQAA 2W6PA 4FMCB 3VC2A 3UHPA 4MCHA 1BFUA 1DI0A 4GXTA 3A4IA 4F1KA 4DL3A 2TMYA 1LJLA 1O94D 1SC9A 3VR4H 2XCAA 4B8YA 3C7CB 1T0BA 2BPFA 5CNJA 5AHOA 2DBYA 2AFHE 5EJAA 4R8VA 5DXFA 8ICFA 4W1QA 2EZUA 2DHCA 4ZZIA 4IMIB 4LUCA 3MN1A 1YSCA 5LJIA 8MHTA 2PUDA 2Q29A 4WW0A 4PRKA 1KO5A 4X7RA 4Q37A 2B1GA 1RLTA 5CXXA 5INTA 1WAMA 3OOHA 2PMZF 3NS7A 2CLSA 4HRAA 2KHVA 1RMTA 4ZVSA 4GZLA 2EBHX 1KI6B 3I6ZA 1VCMA 1QQ7A 3LUKA 1HDIA 1YVEI 3DTTA 3C5GA 3RBZA 2X14A 3BWMA 2V9PA 3CURA 3OEHA 4DUPA 4YMGA 4UJ3A 4CE6A 1M2OB 5B57C 1XRQA 4DE5A 4E21A 4Z4FA 5A3JA 2HBJA 2R8ZA 2X4DA 1SO8A 1O94C 4EI9A 3H1AA 4JLOA 4B2YA 1KC3A 1A5BB 2VH1A 3I1IA 3IL2A 5DG9A 2V97A 4I3HA 2QGFA 1ZQCA 1WXIA 3ADBA 4DR6B 4B87A 1JBQA 3VAAA 3V5NA 5AKYA 4I81A 3F6RA 1KZ6A 4L7VA 4HT3B 5JALA 4UUMA 1JUDA 5CNMA 5ICFA 4CM8B 3Q8WA 2DY1A 4HNAA 1HSZA 3NM4A 2VDLB 2BE9A 2DHQA 5KT7A 4YUXA 1YE3A 1RI5A 3RR7A 3DDHA 5J2FA 1PK7A 3EY4A 3VYUB 1FTQA 2CFCA 4ZAZA 1F14A 3NOVA 3WGUA 3ZWBA 2LCIA 4XD7A 2PKRA 3DBVO 2COEA 2G83A 2X0JA 5KJ6A 1QOQB 5B5SA 3D1VA 3URKA 4OVKA 1WKCA 3VPXA 4KNVA 3KPWA 4EFLA 1BWRA 3BGOS 2XY4A 1CEEA 2C99A 2CXNA 4Z7QB 5TGTA 3U7RA 3W8FA 2CVPA 2ZBUA 5CR0A 3KIPA 3VMFA 2WT4A 5TS2A 2WZBA 1T13A 3HA2A 2NW6A 4QWDA 1XCJA 1RKBA 1JR2A 1X13A 1V9PA 4KVFA 4N9QA 2HBYA 2VNSA 3IPYA 2BCQA 4LGVA 3ICXA 1YZ3A 4GBGA 4NU8X 2G63A 1HO3A 4QTXA 3VR5D 4MUHA 1C8LA 3X2SA 1VZ2A 4JP8A 1GAXA 4IV8A 2EW2A 4KXXA 3ZH9B 3GGDA 8ICZA 1NQXA 2IZ7A 5KX5F 3ABQB 3AO0B 1CUFA 3EQ7A 1B14A 3B0YA 1HURA 2C7VA 1Q84A 1FB5A 1P7ZA 4Z4CA 5CXQA 4FGKA 4CIBA 3TRKA 2PS0A 3UQZA 5JRJA 1REQB 2VWHA 2BBOA 2QORA 2YMMA 3PX4A 1T2EA 5CURA 5P21A 2A14A 4ZV9A 3KL2A 1LPAB 1FPMA 3R20A 8ABPA 3N0VA 3C28A 1PNOA 4EHLA 4UW9A 1RLJA 2WR8A 5F35A 2QGZA 1E1QA 2G07A 4GR4A 1N9GB 4DOAA 3VI3B 2O8NA 1ODFA 1S0VA 4QU9A 1DT3A 1UKZA 3BRCA 4OYRA 1H85A 2V7WA 3HCPA 3OU7A 3WV4A 3VUEA 3DBIA 1PE0A 4P3XA 5GGYA 5A05A 1S1CA 4LVCA 3HUFA 3AIOA 3CIFA 3ZI7A 3T5KA 2BC9A 1VSVA 1PG5A 4RK7A 4RU9A 1J7KA 5AM4A 2IF0A 3BVPA 2PUBA 5A4FS 5FUBA 1EDDA 2CV1A 2XGOA 4Q6BA 4D92A 1L7OA 4XIYA 3M9XA 2BN4A 3OJ0A 2RHOA 2NU7B 3RVMA 4R71A 3QFCA 4Q4AB 5FR1A 4YRJA 2E9SA 4W5JA 2FQYA 4QFMA 4P7KA 2Y1LA 4FEEA 2D2XA 2WFAA 3I9V6 4UBJA 2VANA 1GGMA 4E11A 1N3YA 3B9BA 4J9PA 4R1UA 4X9XA 4TURA 5HMMA 2W90A 2PUAA 4DQUA 4DLTA 1F5NA 2GVZC 4NQRA 2WNIA 4ETIA 4IBOA 4CRWB 5REQA 1Z13A 1R4NB 1MENA 2Y1XA 4KH1A 3K8QA 4ANFA 1YR6A 5KFLA 4UXIA 5AM1A 3V4VB 3ALRA 5GV7A 4P0QA 5JUWA 2I4IA 1UXJA 2E4AA 4G0QA 3NC4A 1KFEB 1P5ZB 3KBOA 1YZUA 5EKTA 3L7IA 4GMGA 2IIVA 2P67A 2EWVA 4HWTA 4JIMA 3PQDA 2PMCA 3BB3A 2QEQA 1JB9A 2H59A 2GNAA 4RMIA 3BYZA 3KZKA 3I45A 3AR2A 5AUOB 3F6CA 1I2AA 1TM1E 2OORC 3VZRA 3MQ2A 3CNQS 3FYUC 2Y99A 5M34A 3QXJA 2W3RA 3VPCA 3L7NA 1AROP 1PKXA 4D0GA 4MO9A 3D8HA 3G2QA 2WY2D 1KEPA 5SY6A 5NLLA 1GDTA 1T9AA 5JNRA 1Z5UA 3V7WA 4YDRA 3S1AB 3NRWA 1ZA1A 3PFCA 2ZRGA 4FOPA 2OBLA 5PGMA 4CMHA 3TRHA 3JVVA 4P4OA 1T6ZA 3SYRA 3WHKA 2CL6X 5KFEA 1N6PA 3L8ZA 3V1KA 4IMRA 3PFFA 2O7VA 2VQ6A 4BX3A 3ZBTA 2D62A 1W4AA 4MYUA 4NAUA 1X70A 2DWCA 5AW6A 3ANLA 4UB3A 5EE1A 2XOEA 2XIDA 2AOWA 3RF9A 4UQPA 4RACA 4CKEA 2FB9A 2GXAA 1E6UA 1CY8A 5LP6A 2GJSA 3BDVA 2R6FA 1IAVA 4QXOA 1Q1BA 2FPKA 1KRXA 1A9XA 3DE2X 1N2SA 2DGZA 1E2JA 2QNBA 4ECUA 4P81A 1XX6A 1FSFA 5G1PA 4FFNA 3PK0A 4KWCA 3LX8A 2CWWA 1NLFA 1GNTA 3WMXA 1SUBA 2JLBA 4NU6A 4BE9A 1FFGA 1T1SA 2O8EA 3NORA 4C7OA 3AUXA 5H59A 2GEBA 1Q6ZA 1FC0A 4OB8A 1LSUA 3WE7A 3RRBA 5EPOA 1SPBS 1CXZA 4NPHA 1V43A 1U9ZA 4AXBA 2KJ5A 1R8YA 5IJ0A 2B7CA 5J5AA 2UYGA 1GUZA 1OBVA 1TQHA 2ADFA 3W8RA 2G40A 1X1BA 4CNQA 3QM1A 3H7AA 2X3UA 3KJNA 4ZYWA 3SAJA 5ALGA 4B0OA 2CJPA 1BPDA 2W6MA 3QE3A 4R69A 2VYCA 1JKJA 2EGHA 3B7WA 1UZAA 4YPOA 4JB8A 3GJQA 1FP2A 4E6EA 1SZJG 3CCBA 4YHHB 3HHEA 3HEAA 1QQTA 4C04A 2BFDB 2XWSA 4L8YA 1YWGO 2D2IA 1VCNA 3P5SA 2HLHA 4A1OA 3KU4A 1KTIA 1FYWA 4AJPA 1D9FA 2IPLA 4XDGA 1RG6A 3H9CA 1GL3A 1ZOIA 4NULA 4V24A 5F5LA 1JDVA 2QZSA 5D6NA 3T6KA 4BWGA 1Q20A 2RK4A 5K1ZA 2F43A 1NVBA 3RROA 1EE2A 1H4QA 4NV3A 1H1LB 3X0DA 5K0CA 4BRZA 3FCCA 4RF4A 4JWMA 2DBZA 3KPVA 3VR2D 4K9KA 1FW6A 4JBGA 2IVZA 3JYQA 4ARZB 1OTXA 5THXA 5HUHA 1TKCA 1TKRA 3AI2A 5HZMA 3AINA 2DHRA 5AICA 1YQGA 2D3DA 4JBLA 2NSJA 3U3XA 3CR7A 4E3WA 2G04A 1HDGO 3FSGA 1OAOA 4JOSA 4PC2A 3DLAA 1RJGA 3IE2A 4MLCA 2YHUA 2OEHA 2CVOA 4MIOA 1URPA 2X15A 5JNVA 1G18A 3BMOB 4LYYA 1ADBA 2C5LA 1QRTA 1J56A 1KKUA 3D3QA 4NYMR 4Z1MA 4QWBA 3N2LA 2EU8A 1EVEA 3TOZA 5F1YA 3D81A 3OOSA 3H3XA 5LOVB 1ZEMA 1I1OA 2C3MA 3AM3A 4HQRA 3L4BC 4KGVA 1U8FO 4F9FA 1TUIA 3ZHSA 2YV5A 2GFQA 5THQA 1N34B 3PLNA 4DLSA 4H1WA 3M9MB 3EUEA 3R4CA 4Z6DA 3NAGA 6CHYA 4C0BA 3QBEA 4YS6A 5DXAA 2ZIEA 1AJEA 2OXRA 3NVAA 1U0EA 3RWMB 4ZGBA 3MELA 5AXAA 1OAKA 4J7UA 4BY9E 4AY2A 4ZAGA 2YXBA 2HO5A 3ACDA 3GARA 4GE3A 3DTYA 3IUNA 1YCDA 2WUEA 1HNZB 3U13A 2AVDA 4LBZA 1WUDA 2FW1A 1UC4B 3CR3C 3PCXA 2R11A 4BNMA 1E2QA 2OILA 3G0CA 2IS6A 1GAEO 5L4LA 1SXHA 1G4UR 1N56A 4JQSA 4WXRA 1QGZA 1CK4A 2J7KA 1W59A 4QWCA 1U2RA 4YRFA 3WK4A 2QPLA 4IGKA 1ENYA 3GDHA 1TIPA 3IAUA 3V6KA 1N2EA 4IEFB 3HKCA 5FOVA 3FMVA 3BHNA 4GLOA 4IFTA 3IMKA 3CNBA 3DBRA 3SIRA 4C78A 4F9GA 3A26A 5KG3A 2XA1A 1P7WA 2Z58A 1E3IA 1TVKB 5AKEA 2PPVA 1WULS 4X1IB 1NLUA 5JXHA 5DBGA 1YHZA 3DD5A 2YWFA 4BQQA 1PK1A 1DQNA 4Q9AA 4JKYA 4S1PA 3GT0A 1GU0A 3T7EA 1ZETA 2PO5A 2I2CA 5DNYB 4G1MB 9ICWA 3UFXA 3KQWA 5C37A 3BD8A 4RNNA 1OB2A 1VL5A 5C7IO 1Q77A 2O0KA 5DGTA 3RFTA 5CG2A 4IXNA 1LKZA 1OR8A 2HBRA 3L1IA 2GO1A 5I4BA 2YRWA 1RWQA 4R1SA 3JD1A 5C8ZA 1E5LA 3TNJA 3PKIA 3PWTA 1AS0A 3PNLA 1AB5A 5CPFA 2V0CA 3B9JA 3Q6NA 1JFVA 4Q4DA 4UAYA 3LLVA 2RGWA 4TZTA 3WQQA 3DNMA 3SS8A 5F52A 5AJXA 3QHAA 4TVKA 1NBEA 1OKKA 4TMYA 2H92A 1GPMA 1UDRA 2GPYA 3KSDO 3P9SA 5JPCA 3ELDA 4PHHA 2YOGA 2ONKA 1R8XA 3MCTA 1ZNYA 1J49A 2OVFA 2OD9A 2AR7A 4ECYA 2YXPX 3G0DA 4I14A 2WAQF 1GUFA 2CZQA 3BTUA 2PMBA 1TC2A 2Y0EA 1N6IA 1V95A 2VJDA 3K1YA 2IYFA 3HDGA 1R6BX 3EYZA 3FC4A 4YJ2B 1DG9A 3H18A 2PT9A 2D59A 2WYHA 2PH7A 1YVUA 4YJ3A 3PQ4A 2SECE 2O07A 3JYPA 5HUJA 1MC8A 4WZBE 2O8FA 3IAFA 3BZCA 3DHYA 4J94A 4W8GA 4LHSA 1X86B 2V5UA 3UN1A 4I1SA 3D2NA 3QLJA 2Q4TA 3ESQA 2Y1JA 2Y1CA 2JCXA 4AY4A 2WVJA 3SDSA 4KACA 3A6JA 3HXKA 3RYIB 2AH5A 1UDAA 1JSLA 1X38A 1RACA 3NGDA 1ORWA 2ZUTA 2QM3A 4TKZA 1DFHA 5C1OA 4B80A 3GLUA 2B7BA 4TT3D 3QZ8A 1ID1A 5C18A 4WOKA 3I28A 4RPJA 4TLCA 4G41A 3TZLA 3REOA 1LJ8A 3ZIDA 3QKSB 2NZWA 1J0XO 2OPBA 4M36A 3T3PB 3S8EA 5HEKA 4BU1A 2FG7C 4LVNA 2W2KA 4Y1EA 1V3TA 3DTVB 5MDHA 1ZSVA 3LQ1A 3WBKA 1RCFA 4UU1A 4MWCA 4MVJA 2QTRA 2YMPA 4F4IA 2QPAA 2KFZA 4AIIA 4DDVA 4H7IA 3SYMA 1QUFA 3NCHA 1BE8A 4TWBA 3TZEA 4C76A 3H4TA 4KJXA 3LPLA 1PZFA 3AUKA 5E6RA 5KFDA 4FS2A 3GMSA 4DOMA 5DWVA 1ZIDA 1EP1B 2P3QA 2PX2A 3PFGA 5AR1A 3HGMA 5KIAA 3ON5A 4NM1A 6LDHA 4CETA 5AHKA 1Z6ZA 1HDZA 1NUUA 3VO1A 3DT8A 1LW6E 4WKGA 2IH4A 1P4HA 1IOWA 2FFBA 2JHPA 4FFSA 3RUIA 2FEWB 1QS0B 3AILA 3WL6A 1T94A 1EGAA 4YP3A 1E1CB 4RQBA 3INGA 4KMOB 5JY1A 1QGUB 4QBKA 3OE7A 1IU9A 3AR9A 3I6MA 2V7XA 4R2LA 2GUGA 3S81A 3C4VA 2W22A 4CFYA 4ZZ2A 2X4LA 1YACA 1LQ2A 5CHGA 4OXKA 4NCAA 4YMUA 1QK5A 4LJ6A 4NJMA 1KYZA 1RZRD 3P9YA 1VBKA 2DC1A 3NHSA 2X4GA 4FONA 4EUEA 4IUCS 2YZ7A 3NT4A 5CDTA 3W6ZA 2O7QA 3FDJA 4DLLA 2HMYB 3L77A 4XJVA 3OA0A 2FDRA 3ROFA 1QFSA 3ZG6A 4NK5A 2OO3A 3DCIA 3G1WA 4X85A 4BP1A 3VMMA 2PQ2A 3D8BA 1FFDA 4LZGA 2YBEA 2XXAB 4WLFA 4X5VA 3SM9A 4HADA 4RS3A 2YHAA 1JIUA 1IVNA 2AMLA 3T9FA 1PWEA 4D42A 9ICJA 1RRVA 4HDRA 2EV9A 2R8XA 5T4HA 3W2EA 4LHVA 1YDGA 3LO5A 5B2FA 3DB1A 1KI3A 4O02B 4M88A 4TS3A 5JH7B 1B3BA 4EG4A 3SI7A 4FS3A 1E60A 3EG9B 3NONA 3QKUA 3SDBA 4IGIA 2W00A 2SICE 5LM3A 3I5YA 1SUAA 3R7WA 4MLZA 3OQIB 3CPHA 1DK3A 3M6FA 3KHHA 1Z0IA 3X2EA 5JASA 1UMDA 4KYUA 2D7DA 1QPBA 1DAPA 2F2AB 5G1NA 1UBRS 2QY6A 4H3VA 1JR3E 2YXNA 3F6EX 3O0DA 3CLUC 1O95C 3HKDA 1MEOA 3DVLA 4ZU1X 2QX6A 2PQ0A 4NOMA 2QI9C 4MKIA 3W5IA 1IRIA 4E46A 1II8B 1XNHA 3U48A 2KJ9A 2Y0DA 4IYJA 4R8RA 1UP4A 3UMJA 1I0IA 2EAMA 2Y2UA 2W7OA 2QIOA 4B9UA 3WBFA 3FYDA 5IN5A 4OTZA 4ESEA 1T9CA 1MSWD 5FNZA 5B36A 3P52A 1B6RA 1JIJA 2G0TA 1OBCA 1BVSA 4RPIA 3LIIA 3RUPA 2ZJ8A 3KU1A 3T7SA 3T35A 2DKXA 3JWPA 4MITA 1AKMA 3SMQA 1PR3A 1XTUA 3Q10A 3IAEA 3VZCA 3H86A 2HHCA 4BUCA 4TUPA 1JYFA 4D5GA 4P4PA 3E9NA 4KIWA 4L3WA 3TTSA 1L7MA 2BSXA 3SZOA 5IKOA 1XKQA 5CR9A 4RQNA 2EBFX 2JGRA 3TEMA 4L2IA 3ZGVA 1Q16A 2VSQA 4QOIA 1MN6A 4PZZA 3KJEA 3H1BA 5GONA 3M6VA 5DX8A 4EDHA 2PS1A 2QLTA 4F2HA 5A5DA 2DL0A 2ZBQA 3AY6A 4MS3A 1MO6A 3HSKA 3NBKA 4HBZA 2Q3HA 4K2AA 1XWFA 3SAGA 3MBKA 1XNSA 2VSOA 3QU7A 3GT3A 1F3OA 1U0HC 2ORYA 3JTEA 5IUJC 3C5FA 2Z9BA 2QSUA 3GYBA 2IE0A 1FRVA 1SU4A 1D1TA 1WW8A 2J48A 1Y7IA 3T52A 2C8KA 1E7YA 4P80A 4KGDA 2EWWA 3IA7A 4IS2A 4M0EA 3FBGA 3GP8A 4G89A 4DLYA 3JQGA 1NJ8A 4X6YA 3CJTA 1RYNA 2HCBA 4KTQA 1A82A 3AM9A 3D1LA 1M75A 4HLNA 3CONA 3ITNA 3SQLA 2O14A 3TFWA 3R9IA 2JMGA 1KAHA 1GV1A 4J29A 1QR2A 1VDMA 3LY7A 2UZ3A 3OA2A 3UMFA 3A1VA 3D7MA 2HGSA 1KDPA 1ZQXA 4CKWB 3K4PA 5C7LO 2FFAA 3STWA 4MUFA 1N2CE 4K6FA 2FHSA 5CH3A 4F4FA 1IZ8A 2YS7A 5IJZA 4CDMA 1ZD2P 4IKEA 1O9BA 4N5NA 5HFAA 3U3KA 3V8EA 3C87A 2YWHA 2O6KA 4RVOA 4JA0A 4WBNB 3MINB 1IN6A 1GNRA 4D2IA 2BGWA 1TGVA 1CYEA 1JQDA 5SZKB 2WF7A 3BL6A 4JLPA 4GX2A 4R8LA 5JO9A 2Q0XA 5D84A 5TQ2A 3GVIA 1TTHA 2IHTA 3TGWA 5J4LA 1NFQA 3AM5A 4OL9A 4MHVA 3SXPA 4H60A 3N76A 1KARA 3PHJA 3IE1A 5EMLA 4JX9A 1CV2A 4ZK2A 4JOBA 2VH5R 3DZJA 4RADA 2JGDA 1QRDA 3HFGA 2FDXA 2QG9A 5A5GA 5FBVB 4BAUA 3KQSA 3HO6A 3UJCA 5CCBA 4LX0A 5HSGA 4WHMA 1F60A 1QF7A 3LFTA 1E9EA 2JAWA 4WI1A 3L7CA 3NBUA 4ZOCA 3O1HB 3AZOA 3MUEA 2H4FA 5FF9A 3GVXA 3KXPA 3L4KA 4ZAYA 2O7RA 2BBSA 3R7LA 4OJKA 2I7XA 1NUQA 3ETNA 3OZEA 3OJEA 4K6KA 4X8OA 4EHIA 3PXEA 9ICQA 2AFIB 4X5OA 3Q0EA 1KXJA 2RAFA 4LNAA 3DJYA 4GXNA 5T6BA 2VSFA 3L79A 4W9NA 2V6BA 4Q4LA 5AW9A 3ASZA 3Q1LA 3ESDA 3V2UA 2WICA 3C16C 3C74A 2HHWA 3DQZA 2J0QA 1PL6A 3C39A 1YRQA 3B51X 1GA1A 1D04A 1S3GA 2UYQA 2FSFA 5F1OA 1KMQA 4PYRA 1W49A 2AKAB 4IF6A 2AK3A 3QLEA 4MHOA 2QD5A 1XNJA 5CHEA 2NO4A 4HVAA 3X44A 1WZCA 5K3AA 4K40A 5HR5A 2R7LA 1AGRA 4HWGA 1X7WA 1U7DA 2WD7A 3KT3A 4CM4B 5KX5A 1KHTA 1T9GS 4NOKA 5ALQA 3T34A 4C7MA 1OH7A 4FHFA 1Z1VA 2Q5FA 1FFXA 3ZU3A 4WN3A 4FGZA 4FMDB 1QPGA 3ITKA 3DOJA 2D5LA 2GEJA 1IB0A 4QYIB 4PH5A 3MPOA 2QK4A 4Y1RA 3VZQA 4EAQA 1FRZA 2WSMA 3WFZA 2FWIA 4RE5A 2J5BA 2RJ3A 1Z06A 3AFIA 5BYJA 3BXHA 3VQTA 2PH3A 3BWEA 1OHHA 4I2VA 4C5CA 5L3QA 2ZG6A 2IA6A 1GPH1 5A1TA 3KWJA 4CV0A 1HQKA 3JY6A 4FTWA 4YRPA 1KYYA 5B6JA 3PO4A 1RC8A 4KRXA 3O4JA 2GZHA 1A76A 2VEDA 3LUHA 2DUUA 4PC3A 1ZR4A 2CFOA 2CUKA 2ACKA 1XHEA 4CQLB 2NVWA 1WSWA 3SQDA 3Q3IA 3R3SA 3ZOZA 1Q14A 3NDRA 2AGOA 2O50A 4NARA 2P6MA 3WR5A 1T3NA 2BUCA 1V16B 5ALHA 1QSGA 4KL8S 4D9GA 5CVVA 3SSNA 3IUJA 1ODKA 5BUQA 5FLXA 1XLWA 3GBPA 4BS9A 2Z3ZA 4YCAA 4V0SA 2XODA 1MQAA 1NG9A 1YI1A 2P9CA 4QC2A 3BSFA 2VAXA 2P4SA 1BN6A 1MA7A 4PTYA 3NRZA 1EK2A 4IJUA 1TAMA 1LA2A 3NUGA 4TLMB 5ICEA 4YAUA 1WSBA 4FCCA 3R3ZA 4HWOA 3MCVA 3AP2A 2QN2A 1XKLA 1XZHA 4K4IA 3PXCX 4DRZA 5HYVA 3ZKWB 1R0YA 1XGKA 2V5AA 3T99A 5B64A 1TIBA 1VMDA 9ICRA 4IWXA 2Z2JA 4CI0B 3JTMA 5HA5A 1DPGA 2ZUVA 1M2VA 1JDNA 1NI4A 1UM9A 5IKEA 3FDFA 3C6QA 4EEZA 5AW3A 4DLEA 2FLLA 5AHRA 3DE7X 5B1EA 1S9FA 4CHGA 1AD2A 4JR1A 2E1PA 5I7HA 1HETA 5DOZA 4FB5A 2FPIA 2ZSDA 2W6CX 1XV5A 3MHTA 3GRVA 1Z88A 3ZNQA 3UMSA 2WA1A 3QKRB 4M22A 1T3GA 3SOZA 3W6OA 2GAIA 3I05A 1PVQA 3K3PA 3T15A 3IB3A 4BL5A 1SCDA 4JCCA 4F92B 1K8QA 2JGNA 4A8TA 1C1DB 4NKRA 3FRJA 1A72A 1IQ0A 1RDFA 4K6GA 2WUFA 3RDPA 3RTGA 1AKVA 1LW7A 1HEUA 5IEJA 4BJ6A 1CUUA 2ZREA 3OF2A 5JLAA 3CEPB 2G7MC 3RS3A 3JAKB 2QN3A 1WCLA 4G4SO 1GGVA 4KLOA 5AFSA 5I01A 4X93A 5J3JA 4R01A 3UB2A 1T25A 3SEQA 5J2UA 2OXFA 1XMJA 1ONNA 1YKSA 2JARA 1A4UA 1XYGA 4G0YA 2IP1A 2JLCA 1EFRA 4IGAA 4RQ6A 4OFWA 5IBQA 1BHSA 3SZRA 3OVMA 4FR5A 1XF1A 4FR2A 2BLNA 1ZLYA 5DDIP 2LMRA 3IBCA 3UANA 1DBQA 2MTBA 2FSUA 2KJ8A 3ZE7A 1XDWA 2C7QA 1SCJA 3L0DA 1NW8A 1ZQPA 2PNFA 4TX1A 2LZ0A 3BKWA 3LUPA 5HTKA 4ZVQA 1AKRA 2HCJB 3K73O 2ORED 2DTEA 1ECJA 1ARZA 5KNCA 1EDOA 3WX0A 2DH5A 4NLNA 3W4IA 5C52B 1CEZA 1ZEJA 2BAGA 3L4SO 2XKJE 3INNA 1QIIA 4EY5A 2CXSA 5COQA 1IN4A 2OAP1 4G1UC 2H1LA 1ZQMA 3U4IA 2IXFA 2A7QA 3L01A 5C31A 3QLUA 2GYYA 5FTKA 1JKFA 1KEEB 4GZMA 1I3MA 5J58A 4U9UA 2Q4OA 3VHXB 4UEWA 4P3KA 3L7LA 4TTTS 4ZA2A 1Z74A 1YGYA 1DCFA 1E9RA 2VKTA 4M4SA 3HLYA 4NP6A 4OQ4A 2PUHA 3U3ZA 4CEHA 1HYQA 2VNIA 4GO1A 1W75A 4B71A 5J2JA 1LY1A 2RDMA 4OM7A 3JQBC 4YDSA 3VJLA 3ACCA 4O3RA 1CRWG 2X8WA 2HJGA 4JKOA 2BTEA 2AL7A 1YRHA 2IC5A 2ZT7A 3UVEA 3V8MA 3DZDA 4BX8A 2PWPA 1PW5A 3CB4A 4KFTA 1Z68A 3A4VA 3W5BA 3TOSA 3MGHA 2G09A 3PNMA 1AVTA 4OHCA 2NN3C 2VP0A 3W8EA 4IIJB 1B4FA 4EQ6B 1E3DA 1SUWA 2HFKA 1TV9A 1IONA 5KTKA 1G0OA 1QAOA 3CG4A 2QLBA 4LF4B 3GYGA 4MMZB 2EKDA 2WKRA 4ARUA 1Z7GA 4EEYA 5A0FA 2AK2A 2JLVA 1WV1A 4RQ1A 6YASA 1LPSA 2ZJ5A 2GWHA 3AFNA 4DZTA 1XYYA 1U8UA 2XUJA 1IXZA 1DQZA 4MGIR 2DBVO 1C20A 5FNVA 4KLZA 3T7AA 5L1LA 4BO5A 3WRYC 1QZTA 1U8TA 1U3GA 2IV7A 1DTEA 4MPTA 4BMXA 5KFAA 3I09A 3LPCA 3E1SA 4QGFA 4HLDA 4BGIA 3UT6A 3WBBA 7ICIA 3H4MA 3F49S 2QXYA 1AUOA 4A10A 4JUZA 1BWQA 1CR2A 1G3IA 1JP7A 5BRJA 1CDOA 3EWIA 4URUR 1A5ZA 1VYTA 3SV4A 3UXEA 1G5HA 3I39X 1F48A 2AJTA 4KN4A 3GBVA 1PX0A 3GI1A 3PHIA 3NGXA 4JK1A 4OUDB 5ELMA 3JS5A 4FDUA 5EFZA 3I8XA 2HIMA 5KFUA 4PGGA 1FYFA 1OSNA 4UCXA 5BURA 2R8JA 1QP0A 3E22B 1K89A 3KVRA 3QSYA 2QVBA 4M1OA 1ZJ4A 3S2FA 1NMYA 1GQRA 5LQMA 3FFTA 4JL5A 4POAA 3WKEA 3O73A 3DEZA 3GA0A 1OI3A 4RIEA 5EZSA 2K8BB 4RJKA 5LBIA 3GLFB 4G23A 5JANA 4B4DA 4JI3B 3M4XA 1E1YA 1XOIA 3AVPA 3QFSA 2HHQA 3KDPA 1G5IA 2ZBPA 5EKDA 5IX8A 1KL7A 5JAOA 3S3TA 3MGBA 4R2HA 4UB8U 5CNIA 3WYDA 3EXIA 2PAAA 3STTA 3RFFA 1NP7A 4KQFA 1VG9B 1E1KA 1Z28A 3H2GA 4GZ5A 2W37A 3P9QA 2M32A 4Q1BA 1CWUA 5JFOA 1G60A 1WV0A 2OCBA 3U1BA 5KFRA 1V8PA 3ABOB 1G55A 1Z3EB 1MAAA 1KR2A 5AM3A 4RA9A 2R84A 3ODPA 4GLBA 4HFMA 4KR2A 2FZCA 3WKDA 5JAHA 4TUQA 4E15A 2O2GA 3HRIA 4DV0B 1C8BA 4EG5A 2YWJA 3LBNA 2XDAA 2Z4SA 3KHKA 3IP9A 1SBHA 1RXYA 3ZDDA 1WMDA 3H11A 1TCAA 2AEEA 5LUBA 4XGQA 1X39A 3HFRA 4OHXA 3CRRA 1CJKC 3TNYA 2IHZA 5E7JA 1ISIA 2VDRB 4BX2A 3QUCA 3LC7O 4O0MA 4GR9A 4BBZA 3IERA 3N2GB 1TUBA 1YZGA 5EA2A 3SN6A 4O3PA 2B94A 1LBHA 4ZAVA 4G0ZA 2FPXA 5C5CA 1JT2A 1VLBA 2R18A 3AY0A 3IXLA 1Y9DA 3Q7SA 4ZKEA 2A84A 1CS4C 1DJQA 4RKEA 3SYTA 5ILGA 4QEKA 3UAWA 1RYEA 4QPDA 3OLCX 4ZWNA 3ZDYB 2KJQA 1SVWA 2OCIA 1ZGBA 4OY3A 2R6CA 4DB4A 5T8KA 4ACOA 3B13B 2PZ8A 4EX6A 4HMOA 4GMXA 3KHGA 4WSOA 4AJNA 1CJVC 1N2ZA 1UJ6A 3NLLA 2EOAA 5CYFA 1GQSA 6ABPA 5ILQA 4NENB 2MSKA 2Q2VA 2QB0B 4DSAA 2QTCA 2AB0A 5KMGA 3F74A 2BEKA 4BZPA 3IXMA 1SVNA 1SQ0A 2WF6A 2DWUA 4MRMA 1GDDA 4GI1A 2BBWA 3NIDB 1RKXA 2IH5A 2Q2OA 4OXIA 4K05A 1BEUB 2E4ZA 3H16A 4CQMA 3OT4A 2G4LA 1GITA 8ATCA 3LA6A 5HJ2A 1BXGA 1JEAA 1ZRNA 2CNDA 3A4NA 4H7DA 4ND2A 1BHJA 3CWCA 2OH2A 5H9VA 4DPMA 4AJJA 2QA5A 3L82B 3KYCA 2Q4DA 4AX8A 3I8SA 4NU5A 4FJ1A 1A2OA 2HYDA 4ZIRA 4IX1A 1N2IA 2I9KA 2X2EA 4Z0PA 4NLGA 1TJPB 4US8A 1ZBQA 1DT5A 1Z39A 1NUTA 1COZA 4F4YA 3KHSA 1ATZA 4UUPA 3EG5A 3CH6A 4IDCA 5K0NA 4KU4A 4CLXA 2A9PA 3FSJX 4HDKB 2OY0A 4BKRA 3V7YA 2Y71A 3RABA 4P0TA 1ZOSA 5LCXA 2IYUA 3EC2A 2SBTA 4MKZA 5CVCA 4J16A 2Q6OA 2DVMA 3P2YA 5CLQA 4PR0A 3ZYCA 4ZO6A 1GGJA 3UWSA 1Q3KA 2CVFA 1CF2O 1LTHR 2FMFA 3UK1A 5FT9A 1RWPA 2IY9A 4MQEA 1WB6A 2YINC 1M6YA 4D80A 1QHHB 1OROA 3PSPA 4BPRA 1YZVA 4HUQA 1GPKA 4JXKA 4B17A 1P1CA 4YFVA 3JYLA 1NULA 3D8UA 1JG3A 3D9QX 3D5QA 4C07A 1EP2B 1BIFA 3V8VA 3AI3A 4BVBA 5BO5A 2VZ9A 3C3PA 2CWDA 2R25B 1SMKA 4NNOA 1E0DA 1EFTA 3MMXA 5CLLA 4RA6A 4EB8A 2RDIA 3SJZA 2AA3A 2Z09A 4EKDA 4G6ZA 3QXXA 3KB2A 5L4SA 1IOVA 3UK2A 2DETA 3TPZA 3PNQA 4TROA 3CVWA 1S3IA 3RNOA 4RCYA 1WO8A 2FN9A 3EUFA 4RNMA 1K6EA 5DISB 3TANA 1Q92A 4B85A 5IH7A 4JVOA 3H0RB 4XSVA 5KWJA 1N5WA 4D3ZA 2JIDA 4BV2A 1DE0A 2WF5A 3QVGB 5A3VA 2G70A 3V32A 2V7BA 2CXUA 4J4BA 3TSAA 2DJIA 1GQ2A 2P2YA 4N47A 1PR9A 3PF8A 3T5DA 1VIMA 2C2GA 5AW2A 4FGSA 1DIAA 2IU6A 5ERYA 1PVPA 1ZNWA 4WVFA 4AO8A 5JEDA 4YP1A 3P1JA 3C6MA 1BKYA 1PLLA 4FS8A 4ERXA 4WLVA 1JJAA 1V7QA 3CZ9A 4F5YA 1AQJA 2XWBF 2HH9A 1W9HA 2I9PA 2XTAA 5E7QA 2ZGVA 3G8YA 4OGKA 4CM7A 1UODA 4ICAA 2QY9A 3WTCA 3E8SA 5CHYA 1ISPA 2UZAA 4R0VA 4L51A 3BDAA 3E2PA 4ALJA 3BKXA 4ZMBA 4DLPA 4QPPA 4L6AA 5DM60 4I3FA 1TK9A 2QM7A 3UQ0A 2ANCA 5HF6A 3V4OA 1JWBB 5I7SA 4Z7OB 4ECSA 2I4MA 3V72A 2WWRA 3WBJA 4RXMA 1YRYE 2OV6A 2EW1A 5HR7A 5T5QA 4GOND 2W8LA 5DNAA 3HJEA 4GI3A 4XGNA 4F5PA 3SIWA 4F2DA 8GPBA 2AKYA 3GDXA 3U9SA 1MPTA 4OHMA 2QV0A 1WW2A 4DQIA 3H6HA 5KQGA 4P5DA 4JITA 3ZIAA 3UPUA 2ZRQA 4M6WA 2WSLA 4W7IA 3TZCA 2ZYTX 2ZQYA 1YGPA 5EJ4A 1GGFA 2VLBA 4RSHA 2Z6UA 4F72A 3OAAA 4EA7A 4XLTA 3LZ6A 1Z6XA 1E89A 8ICPA 5TPWB 2F1IA 5BN4A 1YFJA 1OXSC 1GCAA 1I7NA 3F6SA 3KO8A 1F6WA 4J9NA 2P5UA 2WV9A 4P7FA 3RO7A 3CQ9A 3MJEA 2O2IA 4C4RA 1U4NA 2Y0SF 2VUSA 2D4HA 1KRWA 1SC3A 4LZZA 4BMCA 3KE9A 3E35A 2KQUA 4ZMSA 3G7SA 3RKUA 4RIGA 3WGKA 3PX3A 3LOUA 4N1AA 4R6WA 4ESOA 1BD4A 4ZEXA 1GA4A 2H4ZA 1N25A 3CVYA 2NADA 3LUFA 4RZUA 5HKBA 3HPOA 4UMEA 1D1PA 4I2HA 5TNXA 8ICAA 2P1ZA 1OBHA 1ORTA 2XQFA 3KQMA 2A0FA 4OKNA 1GAQA 1X40A 3O1IC 3QFRA 2JR5A 4GPZA 1W88B 1XSEA 1WMAA 3EQZA 5A5VA 4RM2A 4B3CA 1YR7A 2AVNA 2XMPA 3PXAA 5K0SA 4JAVC 4EY3A 1L3TA 4YRNA 3FHCB 5BN3A 1XYVA 1T10A 4NCXA 1RWXA 3OPXA 5TISU 4HQ0A 1Z25A 2N75A 5EWMB 4KQXA 1SGWA 2MYPA 4OU5A 1YJBA 4Y0VA 3AP3A 3KALA 3B1WA 6PFKA 4FYPA 3RW9A 2FUG6 1YA8A 4M87A 1OLXA 2YVUA 2QF7A 4QIHA 5I9LA 2WAMA 2HSEA 3D6UA 1G5FA 1IE3A 4PG7A 1JNXX 3MUFA 3UNXA 1ZQ1C 3TRDA 1JKIA 3K0SA 1M1XB 2XMDA 1SOAA 3BMXA 3VYRB 4E88A 1MC1A 3D6FA 2BR3A 1AK1A 3I9OA 1I51A 1JR3D 4XUEA 2A9RA 1NQUA 4ER3A 1XBTA 1UKEA 5IXYA 3T12A 3WK7A 1L7BA 2QMQA 1C8KA 3COPA 2E3TA 1ND6A 2OHFA 3BXPA 3DAGA 1XRRA 4E5VA 5CX4A 3O8CA 3TTVA 1F2UB 2VDWA 2EYUA 2E4VA 1FMTA 3LQ2A 3DOEA 1JDBC 3BC1A 4UNQA 4A0RA 4C30A 4DA7A 3W5CA 4XQ8A 3T5HA 2OWOA 5A9SA 5FB3A 3P4YA 1GSHA 4DSNA 3M6UA 3HKEB 3VRHA 4ZI7A 2GYVA 4UTXA 5EMNA 2IXGA 5FI1B 3BA1A 4G5QA 1X2BA 3PTLA 4DV1B 9ICSA 3PEFA 2W2TA 3O8DA 2BR5A 5HS4A 4RESA 2NXCA 4Q93A 3S7TA 2JFZA 1OXUA 2RB4A 1OLOA 4UHHA 3PLRA 1H2BA 2P9YA 1U99A 1OLSB 4KDFA 3TQFA 2UKDA 1WS6A 3ETCA 3IEVA 2FMHA 1NVFA 1P4JA 3E0QA 4UB6U 1X1DA 3GVPA 1TD1A 2QRKA 5ALNA 3ROZA 1P5HA 4YV2A 4BVFA 1A7JA 4WXHA 3GILA 4XYMA 3DOUA 1M5UA 1EXDA 4JZYA 4DZZA 1Z4JA 4DB2A 1STOA 2ID7A 1DQSA 3LVQE 3ZY2A 3SJUA 5EWGA 1N6NA 1KJ9A 4HQOA 3CW2A 1JDUA 5T4EA 2J9ZB 3PDIB 1XLTC 2XVTA 1VSBA 5J0WA 1T2FA 4CMBA 2BV3A 5FEUA 3C1OA 2A1TS 1UCVA 4AZSA 3MMZA 1M7HA 3RASA 4Y2UA 1H5UA 1EHCA 1PGJA 4KXWA 4OD0A 1J9GA 4QGSA 2YB1A 4R1OA 3K09A 4N0PA 1W0KA 1JTFA 4GPAA 3E7WA 1DBIA 2NXJA 4JJIA 4ZOLF 1SKBA 1V11A 2IIBA 2RHJA 2JH9A 1PGNA 1QOZA 4JKIA 4F6LA 1VRCA 4CRXA 4INJA 3KZNA 3GBSA 2EARA 2YOHA 4DJDC 2MAXA 4ABYA 1OBFO 2FA9A 1BGWA 1IDOA 2CMDA 3UA3A 2AF4C 4JCOA 3SVLA 2ZKLA 1XALA 5KSPA 2K4PA 4GGMX 3KAPA 4BGEA 1UHUA 1JHXA 3B2EA 1RQXA 3BAFA 4BO8A 4BWJA 3L18A 4HI0E 4ITRC 4DEVA 1MJFA 4WJ3B 4NCJA 3AESB 4NJ8A 3CVVA 1R0WA 1X1EA 3VHQA 4C6TA 1K6IA 3C3AA 3OUZA 2C00A 4YT8A 1VSUA 4KFRA 4U7WA 3ADDA 1EQAA 2C58A 4P54A 1DOHA 3PP8A 4BJ1A 3NXKA 4YUYA 1Q12A 2X3FA 3NYIA 1FX0B 4BLUA 1Q0LA 1ST3A 1XB2A 2PS9A 5DBEX 2WD9A 3T7TA 3WB1A 4EI8A 1TL7C 1EIZA 1DKUA 1M6NA 5JY6A 2VQFB 2RHBA 3QVJA 2WB2A 3JQ9A 2EF0A 3D0OA 4KO1S 4DO9A 3M34A 1Y4DE 2DUWA 3FMGA 2WLSA 4BNGA 4OV6B 5HHHA 5A71A 2O1EA 4IRMA 3EGXB 2Q9CA 2H00A 2ATIA 1IQRA 3N0WA 3R5XA 2JFYA 3B38A 3NFYA 3OSZA 4PTLA 4TLDA 2R5WA 1BCSB 3DXXA 3TIFA 1XC9A 3IQXA 3L0IB 3EPHA 4IH9A 3JQFA 2D5CA 5EINA 1H94A 5KQLA 2QAJA 4KVZA 4RULA 3IEUA 5L3RA 1PEKE 1PEDA 1L1FA 2YYSA 4NE7A 2RP5A 1WB5A 4CLOB 3B60A 2WJGA 2FF5A 2G7ZA 3FMFA 5BV0A 2HHVA 3VDQA 4D57A 1U2QA 3ORRA 4EPRA 4WCFC 4AMZA 4ZYYA 3WYFA 3WLFA 3ZZUA 4DG5A 4B3TB 4HLQB 2ICAA 2G4VA 4F0JA 4DDMA 1H9AA 4WK0B 1DBRA 1CHNA 4YY3B 3UAVA 1DC5A 4ODIA 4KNWA 3AETA 2PCJA 3QH4A 5CBKA 3GZNB 1VHLA 2R6R1 7ICLA 1N5JA 4ZCQA 4Z4HA 2ISSD 4AS3A 5CTAA 2QDXA 2DULA 3FRIA 2JI9A 2OECA 2FQQA 5ALXA 2FP4A 4QNMA 1L3CA 1P1BA 4J9VA 5KINB 5KT6A 1PBNA 4E1AA 2B8EA 1HTWA 4ZGGA 1SK9A 1OBOA 2ASEA 3I4CA 3KDAA 1NBOA 3A9CA 3K71B 4BMDA 4C3VA 2V98A 3B3QA 1NFFA 3GNLA 4HAYA 3A9UA 5EEHA 1EUDB 4XVCA 2C1EA 1X1RA 3KQQA 1LNQA 3ID6C 3HADA 5G0SA 2UYCA 1CR4A 1UZUA 2J3HA 1DKLA 1Q0QA 1NW5A 3I5XA 1ZQHA 1LI5A 3BULA 3SI8A 3KZOA 5K6AC 2JZNA 5HDQA 4K81B 3ZY5A 1LDNA 1SC6A 5HGXA 1QX4A 1XNRB 2NRTA 5JSHA 1TIKA 2KTQA 3UJDA 1QYRA 4DMCA 4D9MA 3VNQA 5EPEA 4UBBA 2CT8A 2L69A 1TVAA 1NN0A 3SHTA 4BNTA 4N82A 2IYYA 1CZHA 1S7GA 5J4HA 4BZQA 1M6VA 2A19A 3BFXA 1P8JA 5K05A 2FEAA 2VJ4A 1X6IA 2NVUA 4DT1B 3KZXA 3SD7A 2CJWA 1K5GA 5CIQA 4BWVA 4BFZA 3EIUA 3QX3A 4G8JA 3SXUB 1E2LA 3DWGA 2CVQA 4RT2A 2PUEA 4B81A 4F45A 1NXQA 3IDZA 2E1FA 4DAOA 2FN3A 3HM2A 3OQ1A 1YMQA 3JW8A 4RPXA 1ZXIA 3HP4A 4O3NA 1U7TA 3W06A 3OJOA 1XD2A 1SD1A 4NXMB 4L22A 2YHIA 3V97A 2XD9A 4QFBA 3OZIA 4D9IA 5KYWA 3TFRA 1YZNA 1ZQYA 4BQFA 4MS1A 3NNDA 5E95A 3VR6H 3PDWA 2R9VA 1HZJA 1YCHA 4IQ0A 1R0CA 1U7XA 2GCOB 1WQ1R 1XUOA 2V6JA 3HO8A 4PYNA 1UPHA 1PR0A 1NJ5A 3HGTA 3MWDB 5B3KA 1FBTA 4J0IA 3CY6A 3SLKA 2BVNA 2HCTA 1COWA 2RGEA 5BVHB 1ZJWA 3EFHA 2P2DA 3RC7A 5TE9A 3CLUD 1O95D 2XBMA 4RY9A 4H7JA 4WNAB 4UZEA 3L7DA 3P0RA 3DE0X 2HRBA 2NUPA 2XPCA 1K5HA 4D8YA 2RHGB 4C0SA 4DJEC 4DQLA 2IHKA 2PFGA 1NF9A 3KYIB 5JD4A 2D8AA 5KNBD 3H17A 1PJQA 4KYVA 1U90A 4XTCS 3Q4GA 3QX8A 2W6JD 4UFNA 3H1FA 5LLSA 1BJKA 3BK7A 3ZY4A 1AQUA 4IVQA 3K0HA 3K6RA 1O0SA 1LKYA 2O0MA 3SEZA 1N2GA 5CMLA 3ZJYA 3PCRB 3RSCA 5JRTA 1YMUA 3T5MA 2NAPA 3S1SA 1YFKA 3IAM1 2D8MA 1WBJB 2ZIXB 4JVSB 3LNCA 1TFRA 3CCFA 4Y6QA 1DHTA 4UXHA 4LN1A 4LISA 3L7YA 5K0TA 3RYCB 2NU8B 2XEDA 1Z3CA 3BILA 4Y6OA 1JV2B 1K1QA 3WLOA 4PL2A 3W1VA 1AMOA 3AUSA 2QT0A 3HJGA 2PRYA 4ZZ3A 4C4OA 2MCFA 2Q9BA 3NEJA 3IAS6 1R27A 4C01A 1XG5A 8OHMA 4W6QA 2KMLA 3QZUA 3OJCA 2ALJA 2AOUB 1OH8A 3SVTA 5EJ9A 4LK3A 3TIVA 1Y7HA 2H48A 3IDFA 3IP5A 2V8OA 2LPEA 3K4QA 4A03A 1QDUA 3R3VA 3KUKA 1DJMA 1R6UA 3KSZO 3QVUA 5EOVA 3QEOA 5CT5A 5GIOE 3DMTA 2JA1A 5KTMA 4M1MA 4C87A 5GJBA 1JE1A 3KUUA 4TV8B 5TF0A 2PO7A 1ORIA 3F7OA 3W2TA 3OC6A 2TS1A 2P4EA 2OQ2A 1G7TA 3U81A 2IS1A 3F2BA 2DLCX 2G5IB 3HB7A 4R8SA 1TRHA 1M34E 4Y7DA 4A3SA 4KWIA 4PVCA 3A9WA 1EYZA 4DQVA 3W05A 5JJ5A 4OO1J 3E9EA 3DT6A 1O3YA 4FW8A 1B43A 4O4JF 2HTFA 4I4IA 4NAHA 1DRGA 2VA8A 4WBXC 4C3UA 1SUSA 3GY0A 1Q2UA 4KAXA 2G8LA 3CF2A 4E1BA 3A7DA 1P4RA 4C0ZA 3PD1A 3WQSB 1FFCA 2V9ZA 4NZMA 5H9WA 2ODWA 1NR1A 3L93A 3NTLA 1HT2E 2XVXA 3QEBZ 2QJRA 2XT0A 3HKZC 1EG2A 2ZYAA 5LB2A 2PVPA 3RK4A 8ICRA 4WASA 3AHEA 1BXRA 3TLZA 3MWEB 1YF3A 2FDCA 1YKGA 3FWYA 1UMCA 4MW5A 4HB3A 3O82A 4C5BA 2Z2KA 1ZKDA 4QYWA 3SX2A 3VYWA 1PVOA 4HNSA 5EY5B 1W4CA 2GCEA 2BHLA 5HHIA 2IDJA 3D8TA 1QOPB 3JCZA 4OCZA 1V38A 1YKFA 1Z83A 2X42A 2Z7JA 1FL9A 2GBPA 4A8PA 4JY7A 4O2AB 1F0NA 5K8IA 2F17A 2WV7A 1SXJA 3BE8A 1NONA 4NG4A 1QZXA 1CY2A 3S0JA 2AZXA 4QWEA 3B12A 3DR5A 4YRAA 2YS6A 1Y89A 3GJ8A 2BEUA 1E5XA 1AQNA 5EKUA 2VP4A 2CFTA 2NYRA 4BVKA 4DBVO 3T4XA 3COVA 4QE3A 1DKRA 1NPDA 1VM6A 2C77A 4LYDA 3R7NA 3M1IA 2PUTA 1MFZA 2QWXA 4N40A 4M9LA 1AU9A 4MI3A 4KLEA 1OIXA 1TRKA 2AHRA 2BJHA 2CYBA 2OD2A 1RRGA 5JD5A 5FI0B 3UQ2A 3EUWA 3NT5A 1VSQA 4LJAA 3UCEA 4CMIB 3BFVA 3TPCA 3R6LA 2PPLA 1JAHA 3NAQA 5H82A 3VI4B 1P2UA 3HXQA 3HB4X 3NVKI 2O3RA 4D6YA 3QMMA 5DX0A 1GGEA 5HIKA 4C6RA 1R4MB 4QEDA 3TPFA 1E1RA 1JLKA 5BWMA 3SQOA 3Q3CA 1GD1O 3JWJA 1UKCA 1F0MA 1YASA 3SKXA 2W8BB 4L5YA 1HE8B 3D31A 3IDWA 3U9LA 1M0WA 3KETA 1VKJA 4LBVA 3RC8A 3LG2A 3E2IA 3M6KA 3LWNA 5JAQA 2IHYA 2C2OA 3C6BA 1Q1GA 4DCSA 3AOEC 4FYXA 2XZLA 2XAUA 1QG0A 4FFLA 3L8HA 1RYUA 1E6WA 3CKYA 1XSLA 1IY2A 2CVHA 2F1JA 4DW8A 5CLJA 3O4RA 2BTOA 2QD1A 1X3LA 3VNBA 4HJXA 3QVTA 2NGRA 1U28C 1GO3F 3VPSA 3WMGA 2V7GA 4QO8A 1PQWA 3NI2A 4EZ9A 1P6UA 3DP9A 4IZIA 1QMPA 2WJHA 2GBLC 3DAOA 1DUIA 2C3UA 1BWPA 2J32A 2RGAA 4D0LB 3LUAA 4UPEA 3WGGA 4R83A 3AEQB 3KVYA 4WECA 4DLGA 4RNCA 3DVAB 5EOZA 2GERA 3QPVA 4LOHA 3GLIE 4KSCA 4H6VA 5K2OA 1NF2A 2COUA 2NTVA 5KNIA 1YZ6A 1Z8HA 2XYPA 3PNPA 3VC7A 2DPGA 5DX1A 3KZ1E 2JA2A 4ZOEA 4Z4GA 1F6DA 2NUTA 1X7YA 2KSOB 3MJCA 3MFQA 5DNEA 2PGAA 1NK9A 3H2KA 2GCNA 3FUVA 3KXLA 2BIFA 1VMEA 1L3SA 2I6UA 3GAZA 1XN4A 4O2RA 2VK2A 1XAIA 2YWEA 2PX3A 1X74A 1C7JA 4KQWA 2E2WA 4HB4A 3FUCA 4HFRA 5ALSA 4DR3B 1PG2A 4EY8A 3C21A 5SYAA 1N0HA 1KMIY 2IBSA 3NS1A 5JATA 4FYWA 2AS0A 4N5DA 2ZSKA 4REQB 3IIIA 5JROA 3UXNA 4P33A 1MX1A 3AMVA 3G2NA 1T4DA 1LSOA 2GTHA 4Y0AA 5IAJA 5E3HA 2X40A 3H4DA 4D4IA 4MINA 5F76A 5A7FA 3CUEF 4J0KA 5FLKA 1SZHA 3AF6A 4MWZA 2W9XA 1AN0A 1VFPA 1PK8A 3W3AA 3BIFA 4PCUA 3CHYA 1FQJA 4UTNA 2B1JA 1UOQA 5G5GA 4GEGA 3PD0A 1YB6A 1T8EA 2ORIA 1GFIA 4FKZA 1IHYA 3DBHA 8ICKA 4WK4B 3UK0A 5C0OE 4Q44A 1J8VA 4LMBA 3VKGA 3FPLA 3FNIA 3X3HA 5DASA 4D02A 1Y7LA 3M5PA 2G9UA 3PPYA 3FVWA 1KAMA 3EGDA 4W99A 2DY0A 3NO4A 3U31A 4IMPA 3QA3E 4URVR 2XIJA 2R65A 5J4YA 4NLCA 3V4ZA 1YFZA 3A9SA 3KCQA 1PUIA 2CDBA 4IDDA 3Q98A 1WG8A 2DFLA 4GOMD 1T5SA 4X84A 3PYLA 4EF5A 4PHAA 4U3JB 2VWQA 4XIJA 1GADO 1NKCA 1RHUA 3ZOKA 4W1RA 2BDPA 1XF9A 1E63A 1C2YA 2BZGA 1Z22A 2LKYA 3OZCA 2V58A 1USGA 2HBKA 1R0SA 3QKWA 2NIPA 1Z8NA 1V9LA 4MQMA 4HNAB 2EAUA 4Q03A 4YLEA 2Y1IA 5EZYF 2NXWA 3TR0A 4BO6A 2QZ9A 4C1BA 4CV2A 5GJWC 3UQYS 1M8GA 3NW9A 4AUNA 4LMRA 3TSOA 3JQRA 4WNIA 1P8AA 4PU0A 1EFDN 2JVJA 4JC4A 1GTRA 2VF8A 4D74A 1Y5NA 3CZPA 3HVKA 1M8FA 3N97B 2IEBA 5EIBC 4BKQA 3NJRA 1WPRA 4F4XA 2V7UA 4YBRA 2X0IA 3JQQA 1YS7A 3AKEA 3M9WA 3DBOB 1M5RA 4J0EA 2K7FA 1N3BA 3SICE 2PVSA 1NBME 4JOQA 1LLUA 2ES6A 3QUAA 3L1JA 2I4TA 2VPWA 1NF8A 1L3VA 1RM3A 2QLFA 4V0NA 3GLGB 1E77A 3VCBA 1VPEA 2Y9UA 2WTNA 2D13A 2XBLA 2IYLD 3G6XA 3I2JA 3U5TA 2QBYB 4LF6B 2WHQA 1VLQA 4BQIA 5I7RA 3WLQA 1SVIA 1P18A 3WXMA 1FVXA 4GOJA 3M8RA 5CT4A 1R3UA 4PHDA 4HY3A 2P5SA 3RAFC 4D43A 3L0YA 3GGPA 3THVA 1FF9A 4OJ5A 3H9UA 2PZFA 5KYNA 2Y66A 1T29A 1QNLA 5E0OA 5LZ9A 2OFOA 1EXNA 1U2GA 5CJ2A 2DKZA 1V8OA 2FPUA 4MARA 4KLNA 2IOYA 3KKNA 3LXXA 3MBIA 2JIQA 3TAQA 4DCPA 3C15C 1KFJB 4BIIA 1DC7A 4DV4B 2ZSAA 2JF0A 3ELBA 1S2LA 2F77X 1E2PA 4W5QA 1UK6A 1GKYA 4RZ3A 1SXDA 4BWMA 3KKKA 2YX8A 2IWRA 4HAOA 4HXEB 5JZ9A 2POCA 3ZBQA 4TRMA 3GRUA 2P62A 1PJ4A 1RAEA 3IVGA 1KJIA 5DG8A 3U4MA 2QJOA 2I3AA 1DQRA 1R0RE 2DPYA 5AI0A 4QECA 4AZ0A 1QIEA 2HMWA 4WCVA 4ZN6A 1QRSA 1ULTA 5C81A 4V02A 2ZE8A 2ZUWA 1JN3A 3OTQA 5BV7A 4ALIA 2R8OA 1VOTA 2BKUA 3UMCA 3OJFA 3RLFA 1U2PA 4JI0B 3CKKA 3WDKA 3ITDA 1PWZA 5REQB 1JR4A 1XTVA 4OB6A 4QIWF 3E1KA 2F62A 4IR1A 2EZXA 2C2HA 2VCHA 3WL4A 5B6IA 3SC3A 2C31A 4BNNA 3CUTA 3PA6A 2Q5QA 4BNFA 4P0QB 3HP1A 2ONYA 2W6ZA 1B8PA 2PFSA 3QUSA 2BMWA 1VBNA 1LF0A 1QLWA 1HYBA 2X5OA 1ZONA 4OLAA 4LEIA 3K2EA 1SCIA 3P9KA 1ANKA 3T3DA 4ZCTA 1EFHA 3M9OB 3L4PA 3HB5X 2RFLA 2OGTA 4P22A 4RH3A 1PHPA 2RQ5A 3QXGA 1RYFA 5E6SB 3RT7A 2J6IA 3I01M 4Q8EA 3RBXA 4XYGA 3A0BU 3JXEA 5C8DA 2X76A 1MO4A 4US1R 2BE7A 2DF4B 4OO3A 1R5OA 3IIMA 3CP8A 2ZB3A 2ATEA 3QVLA 1CY0A 2ZTDA 1KA9H 1XTQA 1X3SA 4J49A 1FRQA 2OQIA 2PJZA 2CJXA 2WJ6A 4TQ9A 2ZSUA 4MQFA 4I2IA 2VP2A 1QLNA 3QF7A 3PSFA 2UZ4A 2YY7A 4QUJA 1J0DA 4ZOLA 1JGTA 1ZK1A 1TJ4A 1ZESA 4KRGA 5KTYA 4PQEA 1XMIA 4XM0A 3OO1A 1JPJA 2HHSA 5LU8A 4CT0A 2RHFA 5LU9A 5KYXA 4BX9C 4A8HA 1J8MF 4BNUA 2ENWA 4OJPA 2PBLA 4LG1A 1WB9A 2WAOA 1E2KA 4LY6A 2Z2ZA 4BB6A 1MO2A 2IU3A 1DAIA 5LP6B 5CGZA 2JKVA 4LKOA 3AJRA 3WYCA 4ADSG 3QU2A 1U8XX 1IK6A 3FI9A 3H8WA 4FD3A 3MJTA 2YXDA 3DYVA 2EJUA 2DBQA 4I2GA 1IZ0A 4NDNE 5ECGC 2O8EB 3F1LA 1I3OA 5DQGA 4C7OB 3M3PA 1G6Q1 3EX7C 1W36B 1VQ1A 1QE0A 4H35A 1V5FA 2ETVA 2IPOA 5EWJA 1OI7A 2V65A 4WE3A 1D7AA 4RQ3A 4RCZA 5F33A 3TAHA 5IJ0B 2EFEB 2ZAIA 2H1SA 4EVSA 5ALPA 4L5IA 2AOXA 1N1DA 5B7PA 4IC9A 1TC1A 4MZXA 1U1FA 4TTRA 3E3AA 2CEAA 4L5CA 1G7SA 3E9ZA 4OIMA 5DB9A 1XZPA 2J87A 2IDZA 4TKMA 4WXEA 1QK4A 3VDNB 1M0TA 4MB0A 1TPZA 4K26A 4RF3A 2E87A 1D5CA 2Z30A 3DZKA 1PJCA 4UPDA 1KIMA 2O1XA 5KTSA 1WDWB 1HDOA 3KEOA 1XTSA 1XVTA 4JR2A 1FFVA 2H3IA 3T9AA 1KAOA 2A1IA 2GDZA 2XX3A 4DIOA 1OFUA 1Y8RA 2GF2A 3S2EA 2F43B 3K6KA 5JTIA 1QX3A 4QRIA 3T5PA 3FDIA 3K70D 7ICGA 2C2MA 1NK8A 1I2ZA 2ESEA 1OZFA 2Y77A 1WDTA 4A2PA 2G71A 2R1UA 3W90A 1KPIA 3ZHOA 2VDQB 4R2KA 5EXSA 1MX5A 1Q17A 4Q3LA 2O6HA 2AN5A 4G0WA 4KR0A 4FC6A 4HX9A 5HKAA 5BOSA 1G5QA 2FMQA 2I6FA 2YW2A 2JLRA 1L7AA 3OJXA 2YJZA 3E9YA 2O05A 2P9BA 2C54A 3PR5B 2R751 1PJ8A 4R05A 2W71A 1LU9A 2VS1A 2D1TA 1NSYA 4NFLA 1B0AA 5C9ZA 3ZTTA 3C2QA 2N46A 4MGYR 2P7IA 1I4WA 2QM0A 1Q7TA 1UBNA 3FVVA 4U7GA 1EINA 1BJRE 4I46A 1X87A 4DQQA 5HM8A 1P7VA 2PA0A 4LXGA 4K0KB 3D5TA 1D03A 3BIXA 2R87A 4XCQA 2ODGA 3JASB 4PFSA 1W8DA 1QMGA 3R2JA 1O89A 4XE5A 4BLPA 3OQOA 2NNLD 1UT8A 3KKAC 3K70C 2JFUA 1VC2A 2VCEA 4BNXA 3EVEA 1YQEA 4MPJA 3BIJA 1VL1A 3H1EA 4XYEA 3MWYW 2IF2A 3ILYA 4HFNA 3VH2A 5JD6A 3AMZA 1G19A 1QV6A 3NTOA 2FW8A 1Y4ZA 4NBWA 1OFIA 4FSHA 4PG5A 1M9NA 3H5OA 3RJFA 2VNAA 4OLHA 2ID9A 2W7PA 4C06A 5CB0A 3ZY6A 3LRXA 1XZEA 3GJZA 3G49A 1XWWA 4RTRA 5ENDA 4RTSA 1NN3A 1ZM2A 4RELA 1MQ8B 4K8RB 1XE3A 1PS9A 2R1TB 2FLPA 1KQGA 4GU5A 1Q5PA 1IRXA 5EIWA 2GPNA 3GVCA 2PUFA 2ZJFA 2YJ5A 4MMYB 3H2BA 3ORFA 1BS2A 4AJEA 4E6PA 1THZA 5HILA 1GZHB 4IIFA 2DMRA 1J1UA 2NX2A 4J3FA 1TEHA 5D6OA 1COOA 3RAGA 2LBPA 3PDCA 3WGLA 1P4AA 3OOWA 3DBRB 4FGLA 3ZD8A 4J1SA 2DFTA 2J31A 4ZHQF 3C3JA 5HG0A 1YS6A 2CN1A 2ERYA 2H7CA 5K8LA 5KOYA 3RAXA 2ONCA 2P4QA 1Z4QA 1PK1B 4Z9FA 4EMBA 1JEYB 1ZGAA 1XTPA 4ZVTA 1XRMA 3ZHQA 4R2WA 4I1UA 1Y8QA 1JIKA 1KERA 2X8JA 1LDGA 3WIDA 3LH5A 5D1HA 4YT5A 3B6MA 1W6RA 4PAGA 2C2ZA 1GYQA 4ND4A 3F8TA 5K4LA 1EDZA 4U2BA 5FPTA 2REOA 1QBGA 3DSRA 4JJKA 3VHRA 5BW5A 2QTNA 4N12A 1T24A 4ZCPA 4WOCA 5AVKA 3C4QA 2HHTA 3SYNA 5H80A 8ICSA 3OIWA 2VTKA 4JHLA 1QGAA 4PWYA 4XSHA 4RVDA 3AU2A 1FNSA 3MTEA 4C2BA 4IRUB 1XAHA 1CDEA 2JHFA 4DSLA 5LDGA 4C0XA 5LQNA 4YUVA 1EK0A 1E3SA 2CLOB 4YREA 3PEUA 3P9RA 5GMOA 3H1PA 2YIMA 3IUSA 5EZ6B 4MW9A 1BTOA 2BGMA 1I2MA 3IO3A 2PRIA 4MGEA 4GMFA 4RK4A 1E7RA 1ED1A 5BPCA 1AK2A 4BNHA 2NPFA 1OASA 2B99A 1WDLA 1E3LA 3GP5A 3ZK8A 4OXNA 3GFOA 5IHXA 1ESZA 1RJ9A 1E98A 2HRZA 4YJ3B 1KWKA 3RJZA 1XQ6A 3VJRA 5FOQA 5G5HA 5BW4A 3UK7A 2RHDA 2NZYA 4AF8A 2OYYA 4R2XA 1UEJA 3LCJA 2J3QA 3EW9A 4KE7A 3A6PC 3FHJA 3QP9A 2H5EA 4XX0A 3JV7A 3R6WA 5BV1A 3E9MA 4FDLA 9ICVA 5AIBA 3RTBA 5C4IA 1TU4A 4KK4A 3QLVC 2R6ZA 4A2WA 1Z12A 1J24A 4J2HA 4AICA 4J76A 5HNKA 4LX8A 5J0SA 1C30A 4DM4A 1IXRA 2YICA 4NYIR 3VBEA 3FKSA 5TX7A 5DLQC 2XQVA 2FMXA 5DNCA 4LVSA 1XJ5A 5GJCA 1ZH0A 5EJGA 3FTPA 3KFLA 2XQJA 2ZTCA 1KOLA 2JEYA 1WRBA 5BQPA 3PF9A 4WD3A 1EA5A 2W2KB 5ES4B 1BGVA 4F96A 5IT9A 1XXHA 4JB2A 4JIGA 2BSQA 4YH1A 3OJUA 4XX1A 5AOAA 1DAOA 2XMZA 3BQTA 3N6RA 4YRZA 2ERXA 3L0OA 4AKGA 2XKAA 1Z2DA 3OQJA 2J67A 3Q8QB 5JMOA 5E6RB 1SVSA 3CMCO 1Z4OA 1G8HA 2J7PD 1ZITA 2G17A 3LQYA 2H3HA 2NUAA 2ON6A 4YB8A 1TB4A 4PIPA