4DCCA

Crystal structure of had family enzyme bt-2542 from bacteroides thetaiotaomicron (target efi-501088)
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
203
structure length
203
Chain Sequence
KGIKNLLIDLGGVLINLDRERCIENFKKIGFQNIEEKFCTHQLDGIFLQQEKGLITPAEFRDGIREMMGKMVSDKQIDAAWNSFLVDIPTYKLDLLLKLREKYVVYLLSNTNDIHWKWVCKNAFPYRTFKVEDYFEKTYLSYEMKMAKPEPEIFKAVTEDAGIDPKETFFIDDSEINCKVAQELGISTYTPKAGEDWSHLFRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Putative haloacid dehalogenase-like hydrolase
publication title Crystal Structure of protein Bt-2542 from Bacteroides Thetaiotaomicron (Target Efi-501088)
rcsb
source organism Bacteroides thetaiotaomicron
total genus 77
structure length 203
sequence length 203
ec nomenclature
pdb deposition date 2012-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 4dccA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4dccA01
1XVIA 3F9RA 3OCWA 4CF4A 1YV9A 3AR7A 3W5CA 3KZXA 3L5KA 5A3SA 2C9MA 2WF7A 3B9RA 5FP0A 1LTQA 4Y2YA 3QU4A 2YBDA 3ONNA 4ZEWA 3OPXA 1QH9A 4Y2VA 5AIAA 5AVQA 2EAUA 3I6BA 5AW8A 5AW1A 2YY6A 4UMFA 1CR6A 2I7DA 4KNWA 5ALZA 3K1ZA 5ALMA 5AW3A 1RLMA 2P11A 5AW4A 4YGYA 4YIHA 4F72A 3U26A 3ZVLA 2B1QA 3QYPA 5ALJA 5ALVA 4DWOA 3U7FB 5AVYA 4KNVA 2ZXEA 2OYCA 5JJBA 2GO7A 5AW0A 2B30A 2WF5A 2EARA 4UARA 3ESRA 3TLMA 3NRJA 1TJ4A 5AVVA 5AKKA 4UM5A 5AVRA 2OM6A 5AKXA 5ALFA 1RKVA 3W5AA 1RKUA 5ALKA 1EK2A 4BNDA 2G1AA 2OA0A 3ZX5A 3L0BA 2RBKA 4UATA 3DV9A 5IS2A 1L6RA 3U19A 5AKLA 3U7HB 5ALSA 5AW6A 5ALTA 2B8EA 4JDPA 5AI4A 1RQNA 1YS9A 2YN4A 1SWVA 5ALPA 2Q4RA 3EWIA 3AR2A 3KC2A 2NO5A 4JB3A 3PGLA 3L7YA 4RESA 1Q91A 3D6JA 3B8EA 2YJ5A 3L8HA 3ZW7A 2MSNA 3WKBA 3VAYA 3PCTA 5AHXA 4DFDA 4C4SA 1SU4A 4Y2TA 4HYTA 2Q5EA 5ALGA 1L8LA 2EATA 2B8JA 3WK5A 4L6CA 1XP5A 4DW8A 5AK5A 1Z5GA 3W5DA 2B1RA 3U7GA 4ZEVA 4KX3A 3J7TA 4HAIA 5AW5A 2IOFK 4UAUA 4Y2XA 4Y2PA 3QUTA 4J03A 3E81A 3SHQA 2NO4A 3FPSA 3U13A 3MMZA 1Q92A 1IWOA 3GYGA 2WF8A 1RLTA 2JAUA 3BA6A 1CQZA 2CFRA 1Z5UA 3L0YA 5AVTA 4YH1A 5AI8A 2WHEA 3FM9A 2CN1A 1QYIA 1T5SA 4OHFA 1J97A 5AKHA 1K1EA 2G0AA 3OCVA 2FI1A 4UASA 4UMDA 2I55A 1Z4NA 2QYHA 1S2OA 2W43A 1RMTA 5AK6A 1RDFA 2B0CA 3SMVA 4IG4A 3QU5A 5T41A 1NNLA 2C88A 2HF2A 2JGAA 3R9KA 2FPUA 3SKYA 2I33A 3CNHA 2HF7A 5IT0A 3KDPA 1F5SA 5ALOA 2DQSA 2BY4A 3QUQA 5AI9A 1QQ5A 3AR6A 3E8MA 3KD3A 3I28A 2JAWA 5AW9A 4J2TA 1ZOLA 3WK9A 1ZD3A 3FVVA 1Y8AA 2VKQA 3QNMA 4HGOA 2YMLA 2WF9A 3ZX4A 3S6JA 1RPZA 4L6AA 3IJ5A 2B82A 2GHQA 4L57A 1PW5A 4UAVA 4YCMA 1Z88A 3M9LA 1VJ5A 2G07A 4HGQA 2RAVA 2X4DA 2R8XA 4UU0A 1YMQA 4RETA 1TA0A 4XPZA 2PR7A 3WKCA 3QU9A 2P69A 3A1CA 3A1DA 5AESA 2HOQA 3UMBA 3FZQA 2MU2A 2W11A 5AICA 1NF2A 2ZG6A 3WKDA 2R8ZA 4F71A 5AIBA 1ZS9A 5AVZA 2IOHA 3QU7A 5ALYA 4Y2QA 2JARA 2ZBGA 5AM5A 4UM7A 4BX3A 3QU2A 1U7OA 2YMMA 3PDWA 3QXGA 3ZUPA 5AM4A 1Z4IA 2WF6A 4XQ0A 2NYVA 3EPRA 2C4NA 5ALNA 4Y2SA 3I1YA 4BX2A 3KBBA 2ZBEA 4BKMA 4CNQA 1ZRNA 4EENA 1Z4LA 1WR8A 4G9BA 5ALXA 5ALQA 3SF0A 2G80A 4NAVA 5AVUA 5AKYA 1FEZA 2YMQA 3ZVNA 3ZI4A 4AP9A 3FGOA 3L8GA 5AM3A 2W4MA 3W5BA 1WZCA 4DCCA 5AM0A 3OCUA 3BWVA 3QX7A 1JUDA 1RMYA 4GXTA 1N9KA 4NFLA 2HX1A 4CF5A 2BDEA 1Z4QA 2AUTA 3ESQA 3NALA 5ALLA 1SWWA 3RFUA 3A1EA 4IFTA 3OCYA 1VJRA 2R8YA 3L1UA 1XPJA 3OCZA 4YCNA 3WKAA 2FPXA 2HEGA 3DNPA 4KN8A 4E88A 2YJ4A 4PNHA 1X42A 3QGMA 3L8FA 3SD7A 2P27A 1L7PA 2HO4A 4NABA 2C8LA 3RF6A 5ALUA 3OCXA 5AKIA 5A3RA 2YJ3A 1ZD5A 3N5KA 3MN1A 3PGVA 1U02A 3EF1A 1RKQA 5AVSA 5AM2A 3ZWDA 3ZWKA 1L8OA 3QLEA 2FPRA 2HSZA 4C4RA 1U2SA 5AM1A 2AGVA 4UMVA 5A3QA 2HDOA 1Z4OA 4Y2UA 1TJ3A 2RARA 3AR9A 3E84A 3IB6A 3WGUA 4BX0A 3HYCA 2YFYA 2ZOSA 4HGRA 3L8EA 3N07A 4YCLA 2HCFA 2I6XA 4QJBA 2HHLA 4FYPA 4H1WA 4XE5A 4O8CA 5AW7A 4G63A 1Z4PX 4B6JA 3ZVMA 3NUQA 3ZU6A 1U7PA 3AR5A 3L0CA 4CE6A 2D2VA 2G06A 3WK4A 5ALDA 1RQLA 4EX6A 3EF0A 5AKGA 3MC1A 1T5TA 5AI6A 4OD0A 4C4TA 2PKEA 3UMCA 5AKJA 2FUCA 2I54A 1YNSA 1RRCA 4BNDB 3UMGA 2FPSA 3N8GA 5AVXA 2MU1A 1ZD4A 2ODAA 4KX5A 4Y3UA 2O9JA 4EZEA 1ZD2P 3WGVA 2YMPA 3AR8A 3ZTWA 3M1YA 3CZ4A 4BBJA 2CFSA 2FEAA 5ALEA 3ED5A 4FE3A 5ALRA 2P9JA 5ALHA 2GHTA 1N8NA 3MPOA 3NANA 3QUBA 2IOFA 1TJ5A 2O2XA 3R09A 4MUMA 3AR4A 3I76A 3NAMA 4BYGA 4XOUA 1NRWA 2FUEA 2PQ0A 1T9ZA 4CF3A 5AKEA 2R8EA 5AW2A 3OTQA 2ZBFA 2C8KA 2CFTA 1RC8A 4UW9A 1EK1A 2JAOA 2HI0A 1Z4JA 5AI0A 4YIKA 2OBBA 4NV0A 3IRUA 4EELA 4QQFA 1ZRMA 1O08A 1QQ7A 1QQ6A 3HLTA 4KYTA 2RB5A 1TE2A 3A3YA 2AH5A 3WK8A 2G08A 5AVWA 1L7MA 3N1UA 1ZJJA 1WPGA 4ZEXA 1J8DA 4NWIA 5AKZA 3AR3A 4OCZA 2WM8A 3KOOA 1VFPA 4Y2JA 1O03A 2IYEA 1U2TA 1YJ5A 2AMYA 1YDFA 2Q4TA 3ZTYA 5ALWA 4EX7A 2GMWA 5IT4A 1LVHA 2QLTA 4AS2A 5E0OA 2YJ6A 5AI5A 4OFZA 3SKXA 4EEKA 4MWOA 4BEVA 2GFHA 2G09A 3FPBA 3DDHA 5ALIA 1Z4KA 3QUCA 3WKEA 3R4CA 3NIWA 1KYTA 4UU1A 3B9BA 3WK6A 4I9FA 1L7OA 2BDUA 3N28A 3U7EB 3ET5A 1WVIA 4AS3A 3SLRA 3L1VA 1MH9A 2I34A 1L7NA 4FFDA 3P96A 5AK3A 4Y2RA 4HGPA 3ET4A 5AK4A 4BEWA 2WFAA 3UM9A 1RMQA 3DAOA 1RLOA 4I9GA 2IA5A 4UMEA 2ZBDA 2FDRA 4HGNA 3NASA 4GIBA 1Z4MA 2FPWA 3WK7A 1AQ6A 3E58A 1S8OA
chains in the Genus database with same CATH superfamily
3LPNA 1EAMA 3QJGA 4W4TA 5BSHA 2HW8A 3CGGA 2F67A 2VTEA 3CCFA 1R37A 2QTBA 4C3UA 1KH3A 1YFKA 3RBZA 3LWLA 2WSMA 3AOGA 1TC1A 4GE0A 4LXYA 3N58A 3WNDA 3BAZA 3ILXA 2YBEA 1RJEA 2PEZA 5A04A 2H3ZA 1FMCA 5B36A 4YMLA 2DLCX 1FDUA 4RJIA 3BCRA 3GH3A 4RZRA 2BRUA 4MTLA 2QRPA 3E9YA 4X44A 3ZS9A 3CPEA 4ZOEA 1UEXC 3FZNA 1Y7IA 3VCBA 4J0DA 1VCNA 5D84A 5H9WA 4ZYYA 1XNHA 3LT4A 3OPYI 3O21A 2A7XA 3PC8C 4D02A 1AGYA 5B53A 2B99A 4QJ5A 3MMZA 2B5WA 2C42A 4Y2HA 4INAA 3JQ8B 4AJ2A 1ZSYA 1YOVB 2SICE 4BVGA 2EAMA 4EPRA 1LV5A 2HTFA 1V48A 3IKJA 3MJTA 3U39A 1K9VF 2EFEB 1FJHA 2PWAA 5K8LA 2NSLA 3HLKA 2X5OA 4AU1A 3RT1A 3AB8A 1P5ZB 5EJIA 3C3BA 2GZAA 4JLDA 2WF9A 4CV2A 1Q6YA 3CC8A 3H6KA 3ADPA 1IG3A 3ZG6A 3DH0A 3EGIA 1HLPA 1S7CA 4UPVA 5C5EA 4LOIA 4DJDC 1C4KA 1M76A 4E11A 5EG5A 3LKVA 4NU5A 4RZUA 1S8FA 3E9RA 3QZUA 3GP8A 2D5AA 3B7GA 1I30A 2UUBB 4H4CA 2E89A 3C45A 3NHYA 1GZ6A 4KL8S 3JCZA 1R16A 4HBGA 4BMVA 3KBBA 4KO1S 4I4IA 1BMDA 1UZNA 2Q2OA 2AMJA 1F7VA 2DPMA 4D3YA 3WGMA 2GEKA 4U7HA 4G3XA 2Y4NA 2EERA 1XGKA 3RVLA 4MVJD 3K0EA 1XYVA 5BOSB 1B2LA 4H18A 5CLIA 2QARB 3RC9A 1S4MA 2LYBA 1DBQA 5BW4A 4KN8A 2DYKA 4BEBA 4E51A 2V55B 1VG8A 4YMOA 1LSUA 3ADKA 3TM5A 1KVSA 2V8BA 2FJ6A 1MA3A 4MGYR 1PNVA 2WYWA 3MTAA 3IS3A 4BVEA 3BUSA 1KS9A 4FFNA 2R6AA 4IMRA 5CPBA 4DSAA 5DG9A 3Q8RB 2PFPA 1GTG1 3PF8A 3N2ZB 4ZT4A 4CCYB 3FF4A 3PEUA 4B6JA 4D9CA 1NVUQ 2DKNA 2AJQA 1TU4A 2NT4A 5C8ZA 5D86A 1NR1A 2C2WA 1E2HA 1U3VA 2W4QA 2G4CA 4Q3AA 5AKGA 4NLKA 3GRUA 4KR2A 4IQTA 1NK0A 4EW1A 3A4IA 5MGBA 4PHDA 1Y6QA 1EZ1A 4QFCA 3HCEA 2QB1A 2FW1A 2VZ0A 1IK6A 5T7BA 1TQDA 3OMXA 1YCDA 4IWYA 2H31A 4MYTA 1I1HA 3M5WA 3QUBA 4LJXA 1QE0A 4QGFA 1GO3F 3KHHA 2F48A 3BPSA 1O77A 5KIAA 5KAMA 5JANA 3RBVA 2DUUA 4KIJA 5DB4A 2JL1A 3GVPA 3OZ7A 4KN5A 4W5RA 3QG1A 3HY6A 5J2TA 5AYVA 1MRNA 2EZTA 2ZRIA 1GA4A 2PMBA 3VGJA 2HMWA 4KAXA 3U09A 3AR3A 1LA2A 5FTMA 4UREA 2I22A 1A7AA 4CG3A 1KO4A 2GZ3A 4BNXA 1E2PA 4JC8A 1CF4A 5TC4A 1ZMOA 5BWLA 4LNAA 3RJ5A 1JU4A 2Z04A 3EPKA 2FWAA 1N57A 2CL7X 4KR0A 3L1VA 3BIWA 3SI7A 1A8PA 4RUCA 3QTBA 4XJXA 4FXPA 2MTBA 3GJ7A 4UE6A 1N9GA 3RADC 2BJVA 5EIAA 5JR3A 4F5EA 2W8LA 1TKCA 3BMQA 4R9NA 2YXPX 1K4MA 3LUJA 2VPZA 3RHSA 5EJ9A 3MRVA 4RVCA 5BUQA 1T10A 3QHQA 4OSOA 1AKWA 2OFPA 4KSYA 4ZTBA 1R6VA 2DWCA 5CDTA 5JSUA 3U26A 2AFVA 3KWMA 4M7WA 1J0BA 1RLIA 4YP7A 1APBA 3NRJA 1YR6A 2FKNA 5DEIA 3OY7A 2G5CA 3QKSA 4NRDA 2JHDA 5I01A 5H02A 4TOIA 1V71A 3KYIB 2FY8A 3H9EO 2VSYA 4C8OA 3PE6A 7ICEA 3CUKA 4P81A 5EHZA 2A19A 5CYPA 2IHYA 4Q01A 1P7ZA 3PC6A 2JAHA 2FQ1A 1QXSA 2HHTA 1MVLA 3QRWA 4PH5A 4GFJA 4KMSA 2VTBA 3TB4A 4NU8X 5L1KA 1FIUA 5E7JA 1YXMA 2LDXA 4E2YA 1SQ5A 1ZUWA 3AU9A 1IUKA 3RAXA 1FXUA 3RODA 5EEGA 3JS5A 4ABTA 1INLA 1NMYA 4QFDA 3W6PA 3AYZB 3IYLW 2PGOA 4UM9B 3MBYA 3WB0A 1H4VB 2WHRA 1EZZA 2IH2A 2W6OA 3EY4A 3RIMA 1KARA 1UMBB 4F3KA 1OPXA 3FSJX 3NWBA 1NDHA 4KK4A 4MCIA 4WZBB 1AOXA 5J0YA 2FETA 5J4HA 3N6VA 3AF1A 3C1AA 2XGGA 4D8VA 1B15A 2IYVA 1JB9A 2XVZA 4OGGA 3IR7A 3C5HA 1B6SA 5DXJA 1A5TA 3C3YA 2I3DA 4YJGB 2O4CA 3IESA 5KFXA 4WI1A 5AH0A 5F4ZA 2XA1A 1ZW1A 1EGVB 3A1TA 4B7CA 1SHUX 4KLCA 1V96A 1Q44A 3KZ1E 1NPTO 2BR3A 1Y8ZA 3ZXSA 1L5WA 4TTTS 4MOWA 1M74A 4S1WA 3W79A 1YZKA 3FYTA 4G1BA 4O2BF 4EEZA 1U0RA 1O4VA 2HHQA 1U1EA 3F5FA 5GV8A 5DF1A 5EL0A 3RE1A 3ZGXA 4PYJA 4FNGA 1C4XA 4BCBA 3B0YA 4RTQA 5HUQA 1RPAA 3I83A 1QDEA 2Z83A 1FJ2A 1U2EA 1YVUA 4Q66C 3QFCA 4O33A 5BSRA 5KFGA 3C6ZA 1PZEA 2GRAA 3QTTA 4Q05A 5HGXA 3DVSX 1DSSG 3UY4A 3G02A 3SENA 2Z2YA 5KFNA 3NQ41 4QT4A 4DSTA 2NZYA 3AVPA 3S44A 3VSBA 4B8ZA 3KJZA 3LUPA 4J0HA 1UT6A 4QPZA 1IAVA 1YGYA 3KQHA 4KPYA 2ZYUX 2CPRA 4KQWA 1RYHA 2O52A 3T3EA 2OTCA 9ICJA 1N0WA 1IBCA 2E9SA 1QO0A 1EWQA 2NVOA 4HLDA 2CD7A 4BBPA 3GN2A 2V7WA 4G41A 1WCV1 3RUDA 3Q7SA 1KHTA 3H1PA 4EG6A 4GVPA 3RIEA 1JMSA 1KEEA 1A95A 5TX7A 1JQBA 4MPRA 5H8WA 4BUZA 4Z1MD 2TMDA 3SEZA 1W5TA 5A2GA 4GMDA 4CIXA 3G82C 3ENKA 3EA4A 3V72A 1N6KA 3W06A 4GD3Q 2GBPA 3QPBA 1X66A 4K5QA 5BNZA 2CSUA 4EWLA 2I7CA 4CN8A 4YDRA 5ISMA 1GUAA 2ZS9A 4RMIA 2F1IA 5AT1A 4LHXA 5CLHA 1IIPA 3OTGA 2W9CB 2QG4A 4RFSB 5ILGA 4KQ6A 4BU0A 3EDYA 2NZ2A 1PNTA 4WGFA 5LM3A 2CV2A 3JQPA 4UCWA 3BZCA 3NBUA 2DG2A 1UPHA 4E5DA 3WJ2A 2D00A 2UDPA 1UBNA 4K26A 2JIDA 2QUZA 3QIVA 1VL8A 4WK0B 5E7QA 4LOJA 3T38A 4YK7A 1X9WA 1OPRA 2O1XA 1RWOA 4Y1FA 4F2RA 2J5RA 2WHXA 4Y2VA 1X9XA 3L46A 2XECA 2WD7B 2CT8A 4GP7A 1XUOA 3C5FA 2FR1A 4H6WA 4GPAA 4JNCA 4KQXA 1GPBA 3NVDA 1Q7GA 5TMEA 1Z5OA 2V7TA 3S2IA 2OOSA 1M72A 2CKMA 1RI3A 4GBED 5REQB 2HA6A 2OBFA 5JV5A 2W6ID 3HRHA 4EIWA 1UZLA 4A0GA 4FN4A 3TMAA 4CF7A 4BFYA 1WOMA 1OIXA 1NTOA 4JWNA 4O4LA 5IINA 3NBQA 4ISBA 4JOBA 3HJTA 4CGYA 5J0QA 3A37A 1VJCA 1S7GA 4DLLA 1QS0B 4Q1CA 2X1MA 3A1VA 3FFXA 1RABA 1B0UA 2GHIA 1NUUA 3VVCA 4UFNA 4DV0B 3WQHA 4GYYA 5C2JB 3ZHTA 2LYHA 2QQFA 3UXMA 4N54A 2QGFA 1D2RA 2BFFA 2PT9A 2HHXA 3LWZA 4O3QA 4KE8A 1BYIA 3VDMA 4S35A 3L3FX 3E0FA 2C88A 5JNSA 5IVKA 2AHRA 1JFLA 3GEBA 2WLSA 2V7XA 2DR0A 2ZJ6A 4QATA 1Q1ZA 1Y7LA 4US1R 1K89A 3ZGZA 3SJZA 3E05A 4LY6A 3RK4A 1BKSB 3ADOA 4F2HA 3UHJA 4YBZA 1JR6A 3DFFA 1NAHA 3OWHA 2ZWAA 3PFHA 9ICSA 5HRAA 4HQKA 1FL9A 1PHRA 2CE7A 4JBXA 2WMDA 2G83A 2C4NA 3ROQA 2GH1A 2P9TA 2VZEA 4Q1DA 3C39A 1JMVA 1HLGA 2ECOA 1WQ3A 3BIJA 1P31A 5BYBA 4OHMA 1GCGA 1JSLA 1GQ2A 2H2WA 5FTKA 4DSKA 3KVYA 4AL4A 2GAIA 3GRVA 3BWVA 2KFNA 4BFTA 2F1HA 1JKIA 2B2XA 3UOGA 3O75A 1Z4QA 2MUTB 4YXWD 4IEFB 3S27A 4Q00A 1Z18A 3RJ9A 3MMPA 5DNWA 4OMUA 1HO3A 1Z19A 5JO0A 1V8PA 1JLKA 3QKWA 1BW9B 1YS7A 3NEAA 4TL7A 1URJA 5DI3A 4A6PA 2A4MA 3QKRA 4L9RA 1IU9A 5KPDA 4QHSA 4M7RA 2L19A 1JLMA 4WXRA 1NXVA 1TJ3A 3E84A 3AG6A 1YA4A 3Q11A 4D8WA 4J9NA 1S2DA 3ISTA 2JLVA 3HKZC 4G8BA 3JALA 1BFDA 4D4LA 2DPYA 3LYSA 1NQTA 3FAZA 4XSGA 5DMXA 4M7PA 1SC9A 1IJEA 5AI6A 2RJNA 2HLDD 2D5IA 1HNNA 3CUEF 1ZD4A 1E0SA 4XGRA 4N5DA 1O8CA 4ZAYA 3CBGA 5HF5A 5FL7D 1LDMA 4FE3A 2P9JA 5KPJA 1RXEA 2QPOA 3NKLA 4ARZB 1NNUA 5LUBA 1M3SA 5FEUA 4DYVA 3P4UA 4ZC8A 3RRZA 4YR7A 1NQ5A 4B6PA 2Y1XA 2BBOA 1S0VA 1TZCA 3JPTA 2KM1A 2OHIA 1SZCA 4RU9A 2C2ZA 2Z4SA 4LW8A 1N2EA 3AI7A 4YUVA 5J2HA 1TYBE 4NU6A 4XUGB 1KI1A 5AVWA 2V0NA 3N1UA 4EJMA 4GHWA 2E55A 2QSZA 3F1LA 4HUJA 9ICRA 4ONEA 4TYNA 4QZEA 1JF8A 4BNLA 2M9NA 4YRRA 4R9SA 3N7UA 1ODKA 1JKJA 4GNKA 4G0VA 1II0A 2ZAYA 1WCIA 3H7IA 5FEMA 1RHJA 4WLNA 5LWHA 3MD0A 2ZRAA 5J1SB 5FNZA 1BIFA 4US9A 3UCFA 2OZLA 4XWWA 3BXOA 4XFDA 3HKDB 3JR3A 3DAOA 2QR2A 4MK4A 3AOEA 3BE8A 4ZV4A 2PZEA 4YA6A 1IUPA 4ER5A 1L1EA 3KR1A 3STXA 2XGMA 4HXGA 1NJXA 2A5FA 3OHBA 1H5UA 3V4FA 3CB2A 5L7WA 1FX0A 4DQUA 4JDUA 3R7FA 1H1LB 1ZHHA 4CODB 1HT2E 4NBUA 4NC9A 3F6SA 2QPAA 4FT2A 4PHTA 2CDNA 2A67A 3GZJA 4L4RA 2JI4A 1H93A 4QYSA 3C3CA 2IEIA 1KK2A 1RRPA 3NIBA 1QKIA 5J4VA 3SVZA 3V48A 5AVRA 2JHFA 3QE4A 2SCUB 3TFSA 4DFJA 1P1BA 1WBJB 4DIOA 3WWEA 4B45A 1BDJA 1YS9A 4E2XA 2EZUA 3MAGA 3RVRA 4RD6A 4CLOA 1UAYA 1XXHE 2ETXA 3ISVA 1XSEA 1Z2DA 1FB5A 3DTNA 3T9EA 1XKTA 2IEGA 2PBZA 4BNKA 2B2NA 3ZH9B 3UK7A 7YASA 4WLEA 4MO2A 4UZFA 1L8LA 2RHGB 2B8JA 3RRJA 4AAYA 2Q2WA 3SI8A 1GRVA 4MKFA 1I2DA 1NJ6A 3K1RB 5LC1A 1W19A 5KOHA 3IJRA 1DK2A 2R8KA 3BRQA 4RKYA 3QVGB 3W1VA 4NZNA 1NDUA 1PR9A 1ZRHA 3O6VA 3KKEA 5BRJA 1C1DB 4BLPA 1JEDA 2KSOA 2X7HA 1ZICA 1XU9A 3OIFA 3HJCA 1N6PA 5LSAA 1AQJA 4TT8A 3A27A 3CNHA 1F20A 4WKBA 4A26A 1KR2A 1J49A 4B3HA 4PR0A 1KZ7B 2JLCA 3KZCA 7AT1A 4UBJA 3M5DA 2IYNA 3SHFA 4HGQA 1L5ZA 3HR4A 4KE6A 3HEAA 4BB9A 3AI2A 5BQ5A 3SM9A 3GLGA 5KO2A 1CZNA 4B4WA 2KP7A 1H0KA 2FRDC 3OJCA 1Z8FA 1WO8A 3AYXB 3T7AA 4BUGA 4RSGA 4FM9A 4OAPA 4DIMA 3CNNA 3G0CA 1KS2A 4Y2SA 3DKIA 3LVFO 5AUQA 4LF5B 4B9MA 1RI4A 1JIUA 4MPDA 5TZVA 2PWZA 3GMIA 3ZHCA 4LGVA 4IIJA 3MR2A 4C5CA 1Y48E 1XI2A 5CJ2A 4BMZA 3MIZA 4QXMA 3DLIA 1PS9A 4OIMA 3PX6A 1S4QA 2P5UA 2HX1A 3BFJA 4HYYA 1VJRA 1YRYE 2PU5A 3WADA 2HT6A 4YGXB 4Z0HO 4EBFA 1S3GA 4C7BA 5CFPA 4OFBA 2AN1A 3DAYA 3EULA 1AUPA 4DSZA 1UR5A 2DUYA 3FYDA 2XHEA 2WD9A 5JSKA 3N70A 2XCOA 4H6VA 5C81A 4BJ3A 5FNVF 2H57A 3GRKA 4RO0A 4UMVA 1P77A 3HBLA 4TTSA 3V8BA 3AR9A 3P9CA 4NX2A 2O8NA 2B78A 1E7WA 2IEDA 3PJRA 3QVTA 1R15A 3GDXA 4H0NA 4YI5A 4KOAA 4QDKA 1YZFA 4IM7A 3LKBA 1BVUA 1C3EA 3FSGD 1UDBA 3OZCA 4DEXA 1P7VA 1J9ZA 3SC2B 1A5ZA 3OPQA 1CFZA 1TFRA 1WJGA 4IJQA 3K96A 4EHAA 5HA5A 1NASA 2HXYA 1BPXA 5DB9A 3TLGB 4X8LA 3VPBA 1Q21A 4YASA 2X42A 5HZGA 1IXKA 4JLSA 1CJCA 4DR5B 3PNPA 1GTMA 5BN3A 3PRHA 3K73O 1T2AA 2OCPA 3S8MA 2HMAA 1U0HC 2NUAB 2LVBA 1GNQA 4AUEA 2WM8A 1YS1X 3GHYA 4JMLA 2VJBA 5EIHA 3E3NA 1W581 4JEIA 2OMEA 4L07A 3LI2A 5TGTA 2LPEA 5TR9A 2E49A 3MWFA 4OHUA 2G5PA 4CBVA 4I2GA 1HDXA 3ZD7A 5K1ZA 3BXPA 4KODA 3D3WA 4X45A 4D82A 2XGOA 2ZYDA 3P94A 3W6NA 2QN2A 4XX0A 3LBYA 1EUYA 4YQYA 4UHCA 1TTTA 5F3WB 4O3PA 4UXIA 4P33A 1AGNA 3QBJA 4BEJA 5DULA 3PICA 5HVNA 1AQ6A 5KWVA 3OCWA 4ZO8A 2DPLA 3B9RA 2QUJA 3QEKA 4B76A 1XPRA 2PJUA 4XUSA 2FSHA 4PN7A 5KOJA 1SOAA 1GRCA 3I04A 1Z12A 2OAP1 3R44A 4MEBA 2WQ7A 1CS0A 2Z3ZA 1B14A 3SHOA 3KOYA 1C81A 1AH2A 1B4FA 4W8OA 5JCPA 1KMNA 5F5NA 5IS2A 5L3QB 2H9YA 1IJBA 4BUCA 2AMFA 1FP4B 1EX6A 3KPJA 3K9LA 1AF4A 3WNCA 2X9NA 3BXGA 4J9UE 2XCAA 2PUGA 2B7LA 2O3TA 1Y82A 4G5SA 5CDHA 4IIGA 1JAIA 2VP4A 1RHKA 3G9UA 1GZ3A 3AEZA 2WAQC 1MQ2A 5TRTA 3FYSA 1JPNA 4ARCA 2Q3LA 5IP5A 4ZQCB 3AERA 3FVRA 4LCEA 3GPDG 4Z4QA 1GAXA 1PG0A 4F3TA 3DCYA 3OF2A 1E99A 1VJGA 4TTVA 3AM5A 1Y1KE 1N6NA 4N6GA 4TV9A 1L5KA 3RSOA 1WM1A 4CQNA 5FUVA 3RYHB 5BQOA 1K3UB 2IF0A 1DOHA 4WCDA 4E3ZA 4KXVA 4JH0A 1VL1A 4W5WA 2I33A 3VJKA 2ZUCA 1YMUA 3OETA 4O3MA 2GJAA 2QD5A 3ZDQA 1ZD3A 3ZNQA 2IU0A 4MDYA 4R1SA 3RFXA 1U28A 3PFGA 3DE4X 1XK6A 1DCFA 2OEPA 2O4UX 3RVOA 5JH7B 4EI9A 4LE1A 4P3NA 1K2WA 3LA8A 5LZ7A 2PUBA 1QGZA 1XRSB 5E4YA 5LOVB 2X9QA 2D8MA 5B4VA 3VKFA 1AS3A 4RYLA 2QRHA 1VDVA 2VF8A 4JKOA 2C2OA 1Q77A 3GIJA 4UM7A 1ADFA 5GTIU 4NZMA 5FR2A 2W5UA 2BFAA 3EOZA 3G2PA 3V33A 1X7WA 1C1YA 1X7ZB 1P5HA 2NQ8A 1FXSA 4FZ5A 1N2BA 3HCWA 3RRYA 2JASA 1OH7A 3TFWA 4ENPA 3L0SA 1EIZA 4GQAA 1JX6A 2J0QA 2Q0ZX 1CQPA 1M10A 2PKXA 4MLDA 3H0LB 1I01A 3CH4B 3HA2A 4X1OA 2FW9A 3W34A 1LBQA 3B3QA 1XPJA 1G8MA 2YWFA 4I9UA 3ZDYB 5DX1A 3I2FA 2QQ0A 3PVZA 3QPDA 4GLOA 1HNZB 5FUMA 3U3RA 1DG3A 4C1BA 2ZJAA 1X7YB 1S1MA 4GXNA 4WLFA 1N62A 1M0TA 1GL9B 3TTXA 4DA7A 4PXYA 2PV7A 3EYWA 2IU6A 4BV9A 4GZLA 3VJMA 4CNBA 4CR6A 1VHLA 3HA3A 3Q3GE 8LDHA 4W9MC 3X2EA 1MKYA 3LWNA 1C0EA 2IXGA 2P9CA 4CTNA 5J2UF 2JCYA 1FU4A 1CE8B 1G9SA 1C3JA 2IHKA 5J23A 1TB4A 1QPGA 1C8VB 1E79D 3KOMA 4UTVA 1ZQOA 1P0PA 2FZVA 2R1VB 3L4PA 1O89A 5IBQA 4ZXFA 4OUDA 5DYGA 1CIVA 4RADA 4DCGA 3TVDA 1T9ZA 3L9XA 2R3SA 5HP4A 1J2YA 2AK2A 2YXDA 3OP4A 3RI3A 4NV0A 3TVTA 4J3NA 2G76A 2CDRA 4MR7B 5A7FA 3N2IA 3EQ9A 2R86A 3RG8A 2OXTA 3L77A 5J5VA 4EX7A 2RAPA 4WADA 3VAAA 5FO0A 1XAJA 2XOXA 2ENUA 2OBLA 3ELWA 4KLJA 2ZVQX 2W0MA 2QM3A 2VSOA 2WZDA 1NW8A 2IZOA 3ZD8A 4HAUA 3JAKB 2PYDA 5SV2A 4NS1A 3HJGA 4ACOA 2CVHA 5FI1B 4ZHQB 3ZHQA 5IG2A 2KHVA 1TK9A 1KI7A 3AR7A 1ZHFA 2WF7A 3B2EA 1P19A 3DHYA 1OSNA 1H8EA 1ZCFA 4HLUC 4F4XA 5L4LA 4MRAA 4RX1A 1N8KA 4D46A 4D96A 1NVXQ 4X95A 4EB6B 2ZI4A 3Q8WA 1ID8A 4HN9A 1TEZA 1JEQA 2LE0A 1UOEA 4HNAB 4ZQFA 3PHGA 1BRTA 1E9FA 1AY0A 4S04A 5JOQA 1WHTB 1IN8A 4K8RB 5BSFA 4MUNA 2IBSA 4O3OA 1TQ4A 1ST2A 2Y71A 2BFEA 1EK6A 1SWVA 1SK8A 2ERCA 2IE8A 2RBEA 4CIDA 4REQB 2RHDA 4WQMA 3AM9A 4DANA 3P9NA 1E63A 1ZWLA 1NFFA 4R6WA 1YCGA 4IHQA 1Q74A 4LVOA 2GPSA 4ZVPA 4C29A 3NPMA 2X8WA 2XY4A 1LB1B 4F4HA 4ICAA 2Q41A 4CM4B 1EXMA 3D8HA 2IIBA 2Q5JA 1U0EA 2FXVA 4C7OA 3MGVA 1VL6A 3OIUA 4BUJA 2J5KA 1ZMTA 1E2GA 3NAQA 1QQAA 1RCTE 3INTA 5D01A 3A0RB 1ZOLA 3RO7A 3WK9A 4HRXA 4TLDA 5FL3A 3IHTA 1XDDA 3HZHA 1KAMA 4YUYA 2I7XA 3RFVA 3RR7A 4IZHA 5IABA 3PA6A 3KKQA 4QREA 3JV7A 4GW3A 4UAGA 1UAAA 5FO1A 4YRCA 1UFQA 3FFTA 1UAGA 1L1QA 3IAS6 3SS7X 2HDWA 3ILHA 1QJ4A 1ENYA 3THVA 4YLGA 1UM9B 2PO5A 3V42A 1KYIA 2FRXA 1IZZA 1A98A 1D9DA 1PGOA 5KYWA 1TLFA 3ASVA 3PNBA 2ZSFA 4DVJA 4J9RA 3AKZA 2J41A 4GXTA 3FKJA 1RNLA 4O2AA 5K0NA 1E77A 4QOGA 3NBKA 1G3MA 2FPPB 4PS0A 2WFLA 3FI9A 5KSOA 2V0GA 4JAVC 5EEHA 1TYZA 3B8HA 5ERGB 5IJXA 2A1UB 1PP4A 4EARA 2O8DB 5DHRA 3TAPA 2ALJA 3T5TA 1A1VA 3KVOA 1W94A 4BIMA 1K92A 5DGHA 2VDRB 3PQCA 3E9NA 4LGCA 1UOOA 2M1XA 1XCPA 1SKRA 3OTIA 1JQDA 2ST1A 1PLJA 3OT5A 1SIBE 3A25A 4KGXA 3MRSA 1LBHA 3NUQA 5KNCD 3OSPA 1CYDA 4DSLA 3TK1A 2E8OA 4R8LA 2B69A 3IG5A 7ICUA 3KJHA 1RIFA 2HIHA 4RF2A 4Q34A 3ER6A 2A5LA 1WCXA 2DC1A 4NZOA 1YRQA 2VOJA 3ZXYA 2ZYAA 3W8RA 1TIBA 2WJHA 2P90A 3HXLA 2JAOA 3NVKI 1GYRA 5JZBA 3U7IA 2Y0SF 4BE9A 1WY5A 5BPHA 2XIDA 2QN3A 3EZ5A 1C8LA 3AKCA 4XYLA 2IGBA 3VR0A 5EESA 4IGFA 5HRCA 4EUHA 3D6VA 1UKYA 3VAZA 1M2JA 3MT9A 3ZK7A 1T24A 2H4FA 4W9NA 3R0JA 2FZCA 2PS9A 4M21A 1NUQA 4IR7A 1A2BA 4BMSA 2GXSA 3NWPA 1Q0UA 4OU4A 5JXHA 2BBWA 2I62A 3TXAA 3U7QA 1Z00B 1JG2A 3FTPA 1KWKA 2AA3A 2YNMD 1ULUA 5LQKA 5CJ7A 2FE9A 2GQ0A 5L7TA 5BR8B 4KACA 3QVSA 2Y93A 2RGXA 1H3NA 1JJIA 3O3CA 1TECE 2ASVA 2QW1A 5K03A 5AVYA 3VSDA 4F7DA 4Q0MA 3AVWA 4LX8A 4MF2A 3DBLA 5JNWA 1P1FA 3IDZA 1KP9A 1LRLA 4YY3B 4QZ9A 4DFPA 1XRNA 2XUHA 3G17A 3AVTA 4FBUA 3QKUA 1VI6A 4WKGA 2J7KA 2VWPA 5ARBA 2R1UA 2VHJA 1P9OA 2YICA 3RAEC 4H4EA 3VC3A 5TDHA 2Y1FA 1YZ6A 2OXOA 4WVLA 4F84A 3P0HA 1K75A 4L2IA 4HDNA 1T3TA 1UA0A 3PXBA 3K0AB 5L3VA 1LLFA 2Y77A 1Y3BE 1HDYA 3BQ0A 3ZHBA 3LE8A 2EEPA 4ZRNA 2EP7A 1QQBA 2PJDA 3QA9A 5JQGA 2LIVA 3B85A 3HPQA 1D3AA 1T29A 1I7QB 1B16A 4RQ3A 4B4KA 2MMGA 3CV3A 5EE1A 3NAZA 1NV8A 4CTMA 4ZI5A 5EJ4A 3WYAA 3LECA 1QQ5A 2BF7A 4KLMA 3A11A 5D87A 1IXRA 3L5OA 3IV7A 1U4OA 3W2IA 3ETGA 4WD3A 3WNBA 3CVJA 2PU7A 4JYCA 5JRDS 1JAZA 3GLIB 2C59A 5AQEA 4UB1A 1AM4D 1KF0A 2I4RA 4OQNA 3EW9A 1YE8A 4XQ9A 2F2AB 2ZWVA 2CJPA 4COOA 2Y27A 5HR6A 4JC0A 4OLAA 4WBSA 4EY4A 3NC0C 3OE7A 5ALYA 2FQYA 4J9VA 2QTWB 1TPYA 4RPLA 3FYUB 5CG2A 1GGKA 2X14A 4B3GA 5L95A 2I2BA 5BSTA 2HLPA 4FGLA 4BKMA 4DADA 3IT3A 1RT9A 2HHWA 1NSYA 4XD7D 4DDUA 3I9V6 2ZJOA 4O59O 1P3JA 4M1ZA 1W5BA 1Y4UA 1FNSA 4LFBB 1Z8NA 2ZB8A 4IICA 2QGZA 2P2GA 4BWGA 2W71A 3A9VA 4HQNA 4D4KA 4QYWA 3CW2C 1JZQA 1IHYA 4XWYA 1JMKC 1HYBA 1G8GA 1BN7A 4ZXPA 3QX8A 4RQ5A 4K6HA 3KTFA 1USVA 1ILEA 1COOA 2EFYA 4AMGA 4R4JA 3A4YA 2RAFA 5JJKA 4JQYA 2H3HA 1P60A 4TUPA 3HUUA 4PZ0A 2JJ1D 4Q7LA 4M9QA 4P83A 2FPRA 4FHCA 2M0NA 5J9FA 2VDVE 1RM0A 5EYPA 1V5GA 3OIWA 5DLYA 4ZGBA 3V1YA 3L7LA 3FZGA 4LV6A 1UUFA 4WNAB 3NS7A 4A8EA 2NVWA 5CA1F 1G20B 3DKVA 3T7CA 1JIKA 1OV6A 3BEDA 2PKEA 2RH5A 4NCXA 1CY7A 2LUOA 4PINA 3ZU4A 4UTRA 3LM8A 3RWBA 7ICRA 3C4QA 3RBEA 3F6YA 2C5AA 1YQTA 2W58A 1E1YA 2IGTA 3Q1KA 4AKHA 1O1YA 5FWNA 1ZIYA 2QZ9A 3COVA 2D06A 1KRPA 1WU8A 2JFWA 4MQ5A 3SDSA 2LKCA 1TVEA 5TQ2A 3QIAA 1BFUA 3ZXXA 5DB7A 3BG5A 4CDGA 2D6FA 2DWUA 2EGHA 1N33B 3PVCA 4FB4A 5DCUA 4ZOBA 2UVRA 3UH0A 3JARA 4GI1A 1P0MA 1VGRA 1RQXA 1EFPA 1LSSA 3NOOA 4C3OB 3WMEA 1JHYA 2VRBA 2OB1A 1HOXA 2P9YA 1CZKA 4G8CA 4JMUA 1X2EA 2FEPA 4QYIA 1Z16A 4L95C 4AZ0A 4I1PA 1N77A 1A71A 1HMPA 2FAXA 1VKNA 3DBHB 3OX4A 1BFKA 4LSWA 1YK0A 2RBGA 3HCOA 3JSXA 4BEWA 3NDPA 3FJYA 4RPIA 1H05A 5JS8A 2HDNB 1B0PA 1YC2A 1ZKDA 4TWJA 2PLAA 4AWXA 1ICEA 4JHXA 7REQB 2ZROA 4JX9A 2GLEA 2OKGA 1XVIA 2Q50A 3DLAA 1RC1A 4M2LA 4TUSA 3QE3A 4JA2A 1P2SA 4AUKA 1B1AA 5JNLA 2WPDA 2A1IA 2D1QA 2PIDA 1GFIA 4BKRA 4K6FA 3KXLA 5AW4A 2G6BA 3PXGA 5HGJA 4OQQA 4P0QA 4QZBA 2WD8A 1DAEA 3KS9A 3UBTA 3V32A 1Q8KA 3QVUA 2MSWA 2WHPB 3M0EA 2XUQA 3O4JA 4LXUA 5A1TA 1T1JA 3PDIA 4OYYA 3OE5A 4AKIA 1V45E 3O8OB 4UVEA 3BCHA 4EW6A 2BN4A 2PZGA 3Q5EA 1YQ9A 4HTFA 1UPCA 1LPMA 3SNKA 2GI4A 3GP5A 2MSNA 2X86A 5T3UA 3PPIA 2GPAA 5CR9A 5EVJA 1MC5A 3EY9A 1WMDA 1GT91 1E58A 1TQHA 3H17A 3RTVA 2W55A 4C2BA 3A9TA 4IMPA 4BNNA 4MR8A 3LT0A 2PGDA 3D7SA 2YR0A 4J0JA 3KKKA 3OZVA 2WWIA 1S9DA 2DPIA 4KAAA 4N9QA 1R8JA 1M9NA 3ZKWA 3DL2A 1WQ1R 3VDQA 1PGPA 2BFBB 3KLBA 4J1TA 4NU0A 1EG7A 3MRTA 1ODJA 3OFND 5ETJA 4PYMA 3V4PB 1SUBA 4AF6A 2BGJA 2EU8A 4OTZA 2JDIA 2IX9A 1YT5A 3VDNB 3E0XA 4J2OA 3IJ5A 4A10A 3JVUA 4PE5B 1SXJA 4E2ZA 4B09A 5KNBH 1ZVVA 3CB4A 3M9LA 2OCKA 3OSUA 1NF8A 4HH1A 5JPIA 2X5NA 4GX2A 1XIVA 3FZQA 3VOBA 3TGWA 4AVYA 3V5NA 1GNLA 2RKBA 1T0PA 1NXQA 4HQ0A 3GBVA 1QK4A 3GG2A 4DCJA 3EBLA 4TRMA 3QXGA 4XDZA 3PBKA 1E1MA 1E2FA 4EENA 3B1YA 1RLUA 1DDOA 1FEZA 1ABBA 1Q1BA 3E7WA 3FGOA 4EO7A 1YBMA 3FX2A 4ASUD 2LKDA 3VOTA 3GFPA 5DYTA 4OK6A 1Z0JA 3IMCA 1TADA 4L5IA 4MVCA 3S5UA 3M5CA 1UKCA 4YAFA 2JD0A 4IFTA 3K1AA 2QU7A 3AVYA 3I9JA 1ISIA 1NT4A 2Z5VA 3R75A 3UGQA 3PRJA 5JJCA 1JVNA 1SR8A 4L0QA 2PMZF 4PRYA 4KIFA 3KJIA 2F77X 3QVJA 4J0KA 4RNNA 3TWOA 3TJMA 2EHJA 4EDHA 1D6MA 2AQIA 2IHBA 4CQLA 1IQ0A 4Q93A 2DWQA 4MS3B 3UKOA 3GEMA 1W6UA 4XE5A 1P9NA 3UFBA 2XZOA 1ZK1A 3VKGA 3LO8A 2RI6A 2O8VA 4UBBA 3UMCA 3IKVA 4QUBA 1NZJA 1FRZA 1U8XX 5DNEA 2ZIWB 4JB8A 2PMCA 1Z73A 2A58A 2O8FA 3QPCA 3T34A 2BEJA 3JPYA 1YAJA 1QP0A 2O2XA 4LV8B 5FPTA 3F2BA 4DMKA 3EJ6A 3IAM1 4UW9A 2R8JA 4MB2A 3DAFA 3PNMA 2F3NA 3M6FA 4FHFA 1WWUA 3CRRA 4GOND 1O4WA 9ICGA 1FMFA 1Y4ZA 1CETA 1PSDA 2K89A 1KP3A 3M2TA 4RY2A 3BD6A 2FOIA 5CEEA 1JJFA 3LIIA 4YRMA 3N97B 5HKOA 2XGQA 1VPWA 1DJMA 3IQXA 4X0EA 3V3KA 1C3VA 4GOJA 1KJQA 1KI6B 1V7QA 3M5PA 1QFMA 1LUAA 8AT1A 5EWMA 1PZGA 1DEOA 1KJWA 4GS5A 5LYJA 1JNYA 4CQJA 2V96A 2Q1YA 3GT3A 1CUCA 3LAWA 2CZCA 4XQCA 5A3VA 3H4DA 2PA3A 4N5LA 3IE1A 2LD4A 4M9CA 4DS4A 1Q0TA 4D99A 1TJPB 4TQGA 1AD2A 1NJWA 4YXJA 1W0KD 2DQZA 3NRBA 3B9JA 4S12A 3U40A 4C88A 4BNVA 4X65B 2GWSA 3H11A 3KKAA 3K1ZA 2AR0A 2BDTA 4ED3A 1PTJC 2ZBUA 4TUYF 1DRJA 2R6DA 3FN4A 3KFVA 2XODA 3L01A 3L1IA 4Y1RB 2VRCA 4RZIA 3HXKA 4JITA 3MT7A 4FFWA 5ULLA 5AJXA 1G6KA 4ND8B 2XVTA 3DOIA 4MLPA 3IP9A 4MPTA 1J56A 3U56A 2UV8A 2I9KA 3OAAD 4YP0A 4A6EA 4XXHA 2VCEA 4LI0A 4N6NA 4X97A 3ZBUA 1DPGA 3P20A 4DPMA 2X77A 2WJWA 3NBMA 3L02A 2PN1A 2CJYA 2WT9A 4ZVVA 3AWDA 4E5NA 4E6PA 4K9QA 5EXXA 3SQOA 3NHUA 3KZOA 2CN1A 1N7HA 4YAJA 2J9FB 3GIIA 4ZTUB 2ZI9A 6YASA 4EM6A 1IUOA 3KDAA 3WXMA 4LBWA 3M9NB 1ISRA 3S1SA 4YAKA 2R7AA 2G67A 3SKYA 4LTMA 3PNKA 2JIZD 3RVKA 1UPAA 3FVVA 3TYXA 2E8NA 4HEA6 1XZHA 4V0RA 3S7TA 2QU8A 5HQ3A 2NRVA 1QP8A 4Z4FA 2E3TA 5FOQA 1E1CA 3ZOKA 3CT6A 1SBIA 2HSDA 3C16C 1AHNA 5SYNA 4CUKA 3LY9A 2V3WA 3WLQA 4J9LA 2PFGA 2OWEA 1MGPA 2MWMA 1QAQA 2NU8B 1DAGA 1LNSA 4CKXA 3GIDA 1D4OA 2GB4A 4RJKA 4GOKA 2YOGA 3JASB 4HV4A 2RGGA 4X6LA 3Q10A 3A3PA 4N0DA 1Y1RA 4P4LA 4YEDA 1H9CA 4BV8A 4DB2A 3ADDA 4JV1A 1ACMA 1QB7A 3EPPA 2X0NA 4LYEA 5JDIC 3MMNA 4V02A 5CXUA 3MK31 4HDCA 3ESQA 2OO5A 2NZWA 1E5VA 1F8UA 3DWGA 2BKAA 1GHTA 4ZOCA 3UA3A 1AUVA 3UGJA 3UHAA 4UB8U 3CHYA 4MV5A 3T5MA 1SV0A 1XNQB 4HB4A 3R3ZA 2PMEA 4HFRA 1T9GS 3CZPA 3O90A 1PBNA 3IB6A 4ZVLA 3ICOA 1RWQA 1E2KA 4EA7A 4LVCA 5KC8A 1CJKC 3OF3A 1ECJA 1W1IA 4WY5A 3DYVA 2V6BA 2GPBA 1FFWA 2JHPA 4KLUA 4Q1AA 2A1AA 5HDQA 5K4GA 1ZQWA 5DOVA 2WSBA 5L40A 4YHBA 5C3MA 3B3FA 3EWNA 4Q9JA 3VU9A 1IXYA 2P0AA 3JR7A 5JATA 2A9RA 4G5XA 4BWJA 5KT2A 1W36B 5F77A 2WOOA 3LRTA 4OJ5A 4CG0A 3EG9B 1YACA 1P1JA 1NDQA 2A0YA 3OE4A 1U8EA 3UAVA 1VA4A 4D0SA 4U9UA 3S55A 2CLOB 2YC4C 1GL7A 2UAGA 2JAPA 3OSNA 5GM1A 3UMSA 4S0ZA 3SM3A 1FS5A 4TKUA 4Z6EA 1OBFO 3L4SO 1COWD 3OJ0A 4QGHA 3WYNA 1UMKA 5KFQA 1PLLA 3HNOA 2R9VA 3OJLA 3TPZA 5HHTA 2VXBA 5TT1A 3O8LA 3O0TA 4P53A 1FNCA 2F17A 2BR5A 5FRDA 1J00A 2H8KA 2VSXA 2EBHX 3HDTA 5DBFA 4L4SA 3ZY2A 2BEUB 4U0KA 2Y1LA 1X8KA 4GMGA 2IEZA 2WINI 1L3UA 4F5ZA 5LP6A 4KPEC 4I4TF 4WEOA 3AKEA 4U1RA 1XZEA 4MRSA 3FI0A 2EZZA 1WD7A 5EHXA 4TXJA 1VP9A 4MW0A 4H08A 4XLZA 2PDAA 5J43A 3K0FB 3C3MA 3SU8A 4KQ2A 3NW9A 4BKPA 1RLMA 3NHWA 3K6SA 4MW4A 4AYWA 4YRZA 3WG9A 4EHIA 3NO4A 2OYCA 3RYIA 4K7JA 4F4IA 1SCDA 4GZ6A 1EK2A 1XEXA 2HPAA 2I80A 3AW9A 3U44A 1E6LA 4ZH4A 5AJTA 2VWHA 1TD9A 1XTKA 3A9RA 4V03A 4PYOA 3N4MB 2E5SA 4QG7A 1RYYA 3KT6A 1JEEA 3MGBA 3LQ1A 3ULKA 2KSQA 4JB0A 2H48A 4OQEA 4BB6A 4OXYA 2FMXA 4M87A 1ST3A 1KDYA 3C8MA 2ZLBA 4QJ3A 2JEJA 3O0FA 1ADJA 3ICQB 5E1BA 3G1TA 1G3QA 1ISSA 4E5SA 4N3NA 1A7JA 1N34B 4KLQA 2WYUA 3DFKA 4QEZA 2E4WA 2YW2A 1YQEA 1HC7A 1J33A 3ESBA 2I55A 3WLIA 1K4YA 4V0QA 1LJ8A 2ZZMA 1FJXA 4NZYA 1O96B 4QPDA 4IJ6A 1HL3A 1NBMA 1Y8AA 2IP2A 2HMUA 1WKVA 2IYZA 3K9QO 2JBHA 2HBYA 3ZE8A 5HCIA 3O8RA 4JENA 3ASYA 1OLUA 3KZNA 4XPIA 4FYKA 4NI5A 3JRWA 3T7SA 4QULA 3WJAA 2OBXA 3D3KA 4EB3A 1WL8A 1GDDA 5DLEA 3OZSA 2C5LA 3FOWA 2VDLB 3PPVA 1VLBA 4MW6A 4PSAA 1NJGA 3COJA 3O0DA 3FC4A 2VJ5A 4PQFA 3K4GA 3K1TA 1MB2A 4LYDA 4DLNA 1Z17A 5ALXA 1SCIA 2VUHB 1BYUA 1MAHA 5DXFA 3EA5A 1NLZA 3HN6A 5HS4A 3FB1A 4RVSA 1SKAA 1U1FA 2AFRA 3QVVA 1YONA 2PZMA 4WDRA 5CM9C 4J0QA 3ZWVA 1YB1A 1ZJ6A 4EHKA 3F8SA 4EAAA 4HGYA 3I34X 4OHRA 1WMAA 4Q8EA 1PZMA 3T3DA 3WB9A 4PZUA 2G5IB 3FVTA 2KVSA 3EFBA 5IAOA 5CPFA 4UAJA 3NGLA 2X3UA 4HATA 2R7LA 3ZWDA 2HSZA 3GLFB 2EFCB 2P9BA 1KZ4A 5C8DA 3I1IA 1DCMA 3RH4A 2IYSA 1CDEA 5FOTA 1D2AA 5H2FU 4AXXA 2WTBA 3I73A 3T61A 2MHCA 1JLLA 2KJ9A 4ISCA 1G3RA 4DZZA 3IDSA 5AHKA 2YMPA 4A16A 3F5EA 2ZS7A 1CP2A 2Y67A 3RSLA 1QIDA 4BO3A 1N1EA 1LSJA 5SZHB 1PYDA 3FMVA 4DARA 4AJNA 1O6FA 3IX7A 3ZCQA 4YUXA 3WY9A 3R2JA 2QTGA 2P2YA 2VHUA 1EK1A 3X1ZA 2F8KA 4UUNA 1CXZA 3IRUA 4UBKA 3CEHA 4EG0A 3ROFA 3WHKA 3AMZA 3BHJA 4UQOA 1I3LA 3R3SA 4Q9AA 3C1ZA 3AXTA 1KKLA 1G59A 4IKOA 3GA5A 2CLCX 2P1ZA 4KO3S 3MW8A 3UUWA 3AZPA 2NVUB 1HYHA 2WAXA 1G3IA 5EKTA 2O7VA 1AK2A 4HB2A 4MZXA 2OORC 1C7QA 4B82A 5AK3A 1RMQA 2WIFA 2YIVX 2HPVA 2YUTA 2NYAA 3QITA 2J3HA 1OD6A 4BO8A 1C9JA 2KNJA 2O7NA 3HR8A 1R7RA 4NL9A 3ONNA 2JG3A 1JGTA 4XB1A 1SIOA 4A8HA 4I3HA 2X6RA 3Q3EA 4YLYA 4RDIA 4OGLA 4AY5A 5TV2A 2YZ2A 1K8XB 5KT4A 4HLQB 3LZ6A 3D31A 5KDOA 3LNCA 3TGLA 4IL5A 1FJGB 2OWOA 1O58A 3OOSA 4MQEB 2ATIA 5EOZA 3GH1A 1ECPA 1Z0SA 5EQJB 5C1PA 4IQFA 2XBUA 1EESA 3R76A 2NP6A 4WBXC 1WRBA 3DMDA 2RHFA 1G8PA 4KV7A 2JBAB 2ZIUB 1HBJA 1W5FA 5CIYA 3WK5A 3JVDA 3LMKA 2HR1A 1QZUA 2WJ6A 4Q19A 1L1FA 4R84A 1QG4A 4W6ZA 4W63A 2CFRA 2FEWB 2O5RA 2VCYA 4H60A 2A9FA 4C05A 3VPAA 1GRQA 2HHCA 4JN6B 3OUTA 5HF6A 2Q3CA 3AQFA 1DBIA 1PCXA 3WV5A 4DS3A 3G2IA 3GROA 13PKA 3EN0A 1PT9A 4RV9A 5FPHA 3THYA 3NGDA 1F5SA 1UBCA 1M7GA 5I9SA 2DRIA 3JQRA 3BAFA 3JWEA 5LXTF 1RXSA 4L4YA 4MRPA 1VJ5A 4FX2A 2OFXA 2BTOA 3JX9A 2PR7A 1ZGAA 4I1IA 4XUDA 5K01A 3STTA 4FCCA 5AVZA 2E4UA 2C78A 3KLNA 4IGEA 3QU2A 3FW1A 1WX1A 4TZ0A 2EYQA 2GBLA 2VAWA 2AEMA 5ER9A 3QBVA 3T1NA 3MR3A 4FFPA 2DPJA 4DM7A 1VDZA 1ZLYA 1E3EA 2OXEA 4LHSA 3VUEA 3WICA 4G9BA 1T9CA 4BOYA 9ICKA 3DCIA 2GVZC 1Y6FA 2YXNA 1VJDA 3A6FA 4G4SP 3ZJYA 2NAPA 2VSQA 1XFDA 1RCFA 1CNFA 3PR4A 4LHZA 2ZUFA 1AQLA 2PE5A 1UBKS 3A0HU 4NFLA 4UFOA 4J29A 1JN0A 4JXZA 1UT8A 3BGIA 5DCYA 5DN6D 3NVMB 4TL9A 1IH8A 1JG4A 4MV0A 1KERA 2ILVA 2K4PA 5TISU 1V25A 3VR2A 4JKYA 4IQ0A 5JD5A 4YCJA 4WGGA 2DQ4A 5AKIA 4WA8A 1QLWA 5JTIA 3N0WA 1G42A 4GX1A 3LVBA 1XMJA 4INOA 2HJ9A 2AB0A 2RHWA 3IOYA 2JJYA 4DPLA 1G19A 1ZYUA 3TZ6A 3GIKA 1Z6TA 1AN9A 3IVXA 3WDMA 1Z1BA 2EKDA 2JFUA 3RTBA 3GLGE 3RNOA 4ER6A 2QL6A 5IJWA 3UJ3X 4M1TA 2W2XA 1ETUA 4I5DA 1T4CB 4KQ1A 1HEIA 4PRZA 3KQKA 3CNBA 3NTVA 2A33A 4C80A 3Q15C 3N8GA 4PGFA 1NKEA 4DSFA 1XU4A 2RC5A 4PM4A 2C7RA 2W6PA 1V43A 4F4FA 2H1SA 1DE0A 2AOVA 1LKYB 4A03A 4HMQA 3ZQ6A 5TIIA 5HBRA 3EVGA 5BORA 2GS9A 4MGIR 3W8DA 1DJLA 3B7PA 2XDQA 4Q3OA 2ATLA 1AZLA 3GI1A 4P7BA 2J5XA 3AKYA 2R85A 2W2KB 2WVJA 4QJFB 1JFFA 4L4ZA 3Q40A 1JFRA 4NM2A 2NXCA 4PQGA 3N53A 3TVYA 5LB2A 5FPQA 3C14C 1KXZA 1WTCA 4M0UA 1VP3A 1SZHA 2GCGA 3FF1A 1TUBB 3CT4A 1QIKA 4HUQB 2ZI6A 1Z9BA 1PX2A 3D59A 5BMOA 4UHJA 4UTZA 3VSCA 3NYWA 2ZRJA 1N4AA 3WGGA 1KP2A 5DLGA 1N2GA 4E1BA 4AYBC 4DC9A 2HLDA 4UMEA 4ZOQI 1W36C 1CBUA 3I8OA 3S5JA 5U9CA 3VZCA 5FL7A 2GPWA 3R3XA 3FHTA 4MV1A 1ZQQA 5DGDA 4RVGA 1XRQA 2XAAA 3SJCA 3BJYA 5FPYA 3F7TA 2AXNA 4N5NA 4NXNB 2VI5A 5JAIA 2PEYA 3FPLA 5C8YF 3MWEB 2B1QA 1SUSA 1P62B 3TZHA 1NNI1 1P17A 3LBHA 5KWEA 1E59A 1M1UA 2J0UB 4P3OA 3PJDA 5KFWA 1SCUB 3TAQA 1V95A 2F55A 1SV4A 5KFSA 4KQJA 3L0BA 2AC2A 1ZJWA 3OWXA 3W9SA 3TQTA 1YWGO 3Q7TA 2FLPA 2PZFA 3BQ9A 2G77B 3OPVA 4NIMA 3S28A 3UAWA 3SBDA 4XLTA 4BGUA 2VJDA 4MW9A 2VKTA 1XX6A 1SU4A 3O2JA 4K40A 3P7MA 3KFUF 3WZLA 5IFKA 1SCJA 2G63A 4MQFB 3N76A 4D3SA 1R0KA 4IQUA 4JT2A 2IU4A 4F4DA 1GN8A 1UP4A 2GPYA 1RXYA 1T5SA 1VIYA 1J97A 4WK2B 3UW1A 3WMGA 1RRFA 4FS3A 4CMCA 4EG8A 4LYHA 3F71A 1ONNA 2BE7A 2XCUA 4I55F 5T41A 3P19A 3GYBA 5G4LA 1NK9A 1M6EX 2JNWA 1BTOA 1T0JB 3KDPA 5ALOA 3IVCA 4CIWA 5DIFA 1F2TA 3SBXA 2QD4A 4E09A 3FDZB 5BO5A 4MYSA 5C1OA 5BR4A 4OEHA 1QU2A 3DCJA 2P7IA 1F6BA 4DYHA 2D1SA 1DC6A 2BGGA 1L4EA 1KSFX 5AUOB 5ANRB 2HU2A 2JJQA 5H5JA 1PVOA 4LDZA 3CF2A 1QVAA 6Q21A 6REQB 1XG5A 4RA6B 5KX5B 2QLLA 3P4YA 4FYWA 4DDKA 4J7AA 3EPJA 2ACEA 1QNLA 4HFNA 1Q7BA 1MA7A 3U4CA 4PZNA 7ICJA 1UBLS 4XIYA 2H2IA 3TX6A 3G68A 2HNBA 1RP7A 2VO1A 3AJRA 3T54A 2JW5A 4LY0A 4OYRA 1JR3D 4JMPA 4YJ3F 3RBAA 2C9CA 2G9NA 5CDUA 2ZAGA 4EL5A 2J6HA 4QJIA 2PLWA 1CQJB 1NKTA 4LC9A 5B6PA 1XTJA 3AUFA 3T7TA 4EBDA 3UC5A 3P0IA 2V4ZA 3IIEA 4QEKA 3GDWA 3PW0A 4LI3X 4PYLA 2QI9C 2WLTA 2V4RA 4HDMB 1WSAA 2OHHA 2VYQA 5KSYA 1L3CA 4WJKB 2HBQA 3LWBA 2A57A 2AGVA 2AGQA 1E2NA 5EUBA 2AUNA 2JFVA 1XSNA 3RLIA 4URXR 5DO9A 2AOXA 1KOFA 1Q2UA 2PH3A 4CE6A 1ULSA 4Q9NA 4QAJA 2OCAA 3TTTA 4HDRB 4BVKA 3Q3CA 3RWMB 4L8YA 3SEFA 5KFPA 5CD9A 1NJ5A 4GP9A 4CEIA 2AXTU 5DBGA 3CO5A 5FBHA 2VF2A 3NANA 4NMXB 1UC5B 3K5HA 2DHQA 1E9VA 1ELOA 1T4MA 1UQUA 3H0MB 4F9EA 4CMEC 2EX0A 5KDLA 1QGDA 1FDIA 4PX9A 2YQEA 1IB0A 1JR4A 1E9BA 3FHCB 1UKZA 1DAHA 3HBMA 1DIOB 1P0QA 4QO8A 1Q20A 2YWEA 3CCCA 3E9EA 4NYIR 4BP8A 3UUFA 2HXGA 4IRMA 3VR6A 5D8DA 3R7LA 3QPUA 1I94B 1TTQB 4F7WA 1IEQA 2OCBA 2PMDA 1G6HA 1MIOB 3N2EA 1U0GA 1ONOA 2CVFA 1UHUA 2QVYX 3EZ9A 1JSZA 1CNMA 3FUWA 1WXHA 4BZWA 1ULHA 3VYVA 1QHFA 2Q3EA 1GKLA 1L4BA 3FSGA 3MS4A 3AEXA 3OESA 4AG6A 4KO2S 4RVNA 3AUOA 4EVSA 1R4MA 1Y98A 3KWLA 4E08A 2FG7C 2PSFA 1GFSA 1MR3F 4IILA 3D0RA 4M1QA 4LBZA 1QH9A 5AIAA 1N2IA 4PAGA 5FADA 4LTDA 4OO3A 2I7DA 4NNPA 4DAOA 4D42A 1R0RE 4JP1A 3OPMA 1EUDA 2K8BB 2B4TO 2Q45A 4CLRA 5CK5A 1UBSB 5LQAA 5KAIU 1JH8A 4H4DA 5CH3A 3MMXA 5IWAB 1HFJA 4KPUB 4JXJA 3Q9NA 4LDQA 4BNFA 4PC2A 3B9PA 2IV7A 4YRAA 3EYZA 5FORA 1IQPA 4DFDA 5JEEA 2VDJA 1SRQA 3Q8QB 1RAEA 2C2HA 4R54A 1GM5A 2R2GA 3PGKA 2PZLA 2N75A 2CXSA 4GXJA 5JMTA 1VRWA 3JYHA 2Z4RA 3W4JA 5I7EA 1WUDA 1Y7HA 3ONFA 4FFSA 2PTHA 4YFKA 1PWZA 4D9MA 3GEIA 3IH5A 3RB3A 4ZI7B 5CK4A 1OI3A 4CYMA 4LRTB 3ZZ1A 3NT2A 4JL6A 1IM8A 3IUSA 1G7SA 5GM2A 3SYTA 4YC7A 3WZMA 1B73A 5L4NA 1YZ3A 3HVJA 3T9CA 4NICA 5DTJA 3BREA 4HDAA 1MFPA 3TINA 1XCOA 1WMSA 4HMOA 2JPDA 2P3OA 1PJ3A 2AW3A 3HWTA 1C20A 1W8IA 3K31A 4LOLA 2VP3A 1E0KA 4BFCA 1QIFA 3MOSA 3ZTTA 1EGQA 2I8CA 4P3XA 1EA5A 4ZVNA 4DC1A 3REQA 2DT8A 1XTIA 4FD3A 3VZRA 2BLNA 1SN7A 2O3QA 5ELLA 3WL8A 4CCWA 3EWAA 5KTOA 2J59A 2RG7A 3OOJA 3TIXB 4F4CA 3KELA 2JIQA 3OCUA 2XI4A 1EBBA 2G82A 5CBKA 1S2MA 3QJYA 1UOQA 1OFGA 3JYQA 3MJVA 3DULA 1CULC 5BRNA 1D8LA 3CRW1 4DQQA 4UUQA 4NPCA 5C4IA 1OT3A 3E5RA 4M0EA 5DDIP 5D7BA 3H5TA 1UBJS 1JHDA 3DMYA 1G7RA 1AUOA 1IZ8A 4G0YA 2WIDA 1U2GA 2XO7A 4MHOA 4RNCA 5KTQA 3GJ4A 3GN1A 1EXDA 1PR0A 1D4ZA 5CNIA 4RQ4A 3M6XA 3C4JA 2EBUA 1XZBA 3DTVB 2H1OA 2R6GA 2Q3HA 5A4AA 4JQCA 4ZQHA 2RK3A 3NBYC 5KSPA 4EI2A 5HFAA 3RNLA 3U4HA 2PL9A 4Q9IA 1CNEA 4XIGS 3AL2A 2WP0A 2OV6A 2RDJA 1QDUA 4QOSA 2QNIA 3TX2A 1VPVA 1N3IA 3OZBA 3CR7A 2YRFA 1M2OA 2PXAA 3AI3A 3AESA 1ZN8A 3UMRA 2F2TA 4C30A 4NLLA 5C8XA 4GC5A 4X3PA 1P61B 1Q0ZA 1K97A 2Q6OA 1E2LA 1JHQA 4PAMA 4RPXA 2YTZA 2NP7A 1WPQA 1L3SA 5TPWA 4ALJA 3EEIA 2EBWA 3RTGA 3RRMA 1H22A 4IZIA 2GCIA 2P67A 5GONF 1RE1A 3JPOA 1NVGA 4IIEA 2BCRA 3PHCA 4IJMA 5EWEA 2GJ4A 3BJMA 3TQSA 3HU5A 5DYWA 1L7MA 4U3JA 4F5YA 2G72A 3U3ZA 3NM5A 5T4EA 5KCZA 2C1EA 1QIGA 2ZYVX 1MABA 2F3SA 4B8YA 3BRSA 3K53A 4RELA 4DWJA 1SUIA 3L7DA 3TR0A 5JC8A 1UFOA 2NUPA 4XVHA 4OJQA 2HV9A 5JRJA 1UXIA 4MSUA 5JD6A 2RJ3A 4FKMA 3T9AA 4A5OA 5K3SA 4M6WA 5TMDA 4LK3A 1ZQJA 1X40A 4F1JA 4JBIA 1IBMB 4G5OA 1FDTA 7ICQA 2YY6A 3C4VA 4OKIA 1H9BA 1R0WA 4RQ2A 3KYDA 2JIBA 2UVUA 5EWLB 1KFDA 4E0DA 4X8HA 4CM8A 1BMFD 4ND5A 4YRTA 4KC0A 1HYEA 1SVWA 2C3OA 2HQBA 5FBKA 3D8SA 4BWVA 4QRDA 2Y6UA 2UVDA 2W4IA 3GA0A 4R7TA 5FWYA 1ND5A 4Y6GB 5L7YA 1H94A 4BVJA 1NRIA 3HM2A 3WTBA 3EVFA 3V6KA 1L4FA 4BVLA 1G98A 1J8VA 3G7UA 4H3KB 3KTDA 2CHUA 2YJ5A 2ECFA 1SGWA 4CQMA 4GGPA 4R2LA 1ZM3A 4YPVA 3OZRA 5CA0A 2HV8A 3NHAA 2ZETA 4UB2A 3OZDA 1BKDR 5B58T 4KSBA 5CIWA 2C3PA 2A84A 4WBNB 4TXLA 2AT1A 2JGLA 2GNOA 4Y0VA 4HG2A 2IVFA 4NXMB 5L9AA 2OWDA 2NOAA 1K68A 8ICMA 1QYIA 1ACLA 3LJKA 4C0SA 4I50B 1MOZA 4UBMA 1YQDA 3O4GA 3KEGA 3G8AA 3FMFA 1A9XB 4NG5A 4CUZA 4JLWA 1F38A 4NTZA 4W5QA 4I1YA 4O25A 1E20A 2DSNA 3K7EA 2XMCA 1K6IA 3CLSC 1HT0A 4ZRDA 1G3UA 3P2MA 1KY3A 2ZEJA 3GJZA 1AG9A 5TY0A 5COQA 5IIJA 4F9GA 5K45A 5B3JA 3STVA 2YY5A 3U7RA 1JP7A 2ZSAA 3BS5B 3W6ZA 1PT5A 4IOKA 1MDBA 4QWDA 1U8CB 1SXQA 2REOA 4G3IA 3HO8A 3PR1A 2ACWA 5FDFA 1RRKA 4WACA 3L7JA 1KMMA 2W98A 4JKIA 1ZVJA 1X9SA 1P3DA 4KXYA 4ZFNA 4I2IA 2HSEA 4ROSA 5JHGB 2J31A 5LR6A 3RFTA 7ADHA 2OR3A 4HVCA 1PZNA 1KEUA 2JIRA 2J9YB 1KAEA 4AYXA 3PO5A 3RK0A 4BVAA 3BA1A 3O3NB 3E5NA 3VKWA 1LI4A 1I7LA 3OQBA 3N6XA 3P97A 5LNK6 2A3RA 5JCJD 1R6XA 2OP1A 3ZY4A 1NJ1A 3S8YA 1JU9A 4UHFA 2YJ3A 2V1UA 1MIHA 1KPGA 3IEMA 3SFZA 3NHRA 5K2OA 4IDAA 4DIBA 5AM1A 1X1BA 3VPSA 1RWKA 3PQ4A 1VIDA 1SVIA 1FSZA 1HUOA 3ABRB 3KLPX 2C9YA 5GOZA 3DEYX 3X1DA 2C57A 5FAXA 5IANA 2IZ7A 4MAMA 3ZU3A 1K88A 3A1WA 4XAQA 1ZC3A 1EDOA 3PFNA 4Y3UA 1CIJA 2X0KA 3DVQX 1Z0FA 4TURA 2WVAA 3BK2A 2WNIA 1SQFA 1LDBA 1Z3CA 5EZYF 2EIHA 5GTHU 1V8OA 4GPZA 2E8MA 3BH7A 2SHKA 2I3GA 5A9SB 1K08A 1ZFNA 3I6IA 3WWZA 3MJFA 1TK3A 4HTAA 3UHPA 1SY7A 2QX7A 3JWIA 3Q1LA 1FK8A 1EGHA 3D6AA 1QV7A 3A1FA 1NJYA 3BWMA 4MFAA 3BWDD 4Q7EA 2QQEA 1XZJA 5KOYA 1DZIA 4E21A 3AHHA 4DQSA 4DNQA 2IS4A 3TQRA 2WJAA 1YJ5A 3LP6A 3SAHA 4ZD6A 1ZQTA 1RZ3A 3TGPA 5BUZA 3C3KA 2QV7A 4Y6LA 2CXHA 2R47A 3PKIA 4L76A 2FQWA 4UNSA 4ECQA 3Q9SA 2J0SA 4Q6BA 3G2MA 1RWXA 3DW1X 1N5KA 5ITZA 5KNCA 1U9YA 5ELMA 1XF9A 3CX8A 2VUUA 4Z7JA 5IH3A 5IJ9B 1I14A 4TMWA 3ZZUA 2Z8YA 5JG7A 1ZQIA 1T35A 4BTLA 4FIDA 4EB0A 2OBNA 4EJ2A 4ZVQA 4M98A 3BQMB 3O31A 3RVPA 3TR6A 3UOAB 4EG3A 2FP4B 9ICCA 1GVNB 1RU3A 4YJ2A 1OKKD 2XWSA 1JXLA 5D5PA 4KNVA 5F9HA 4CKEA 4P4MA 1YRWA 2QJTA 2FVYA 2BYTA 5FYDA 5ALFA 4NF2A 1V5FA 2H08A 4WZZA 3I2KA 2AGPA 4NOLA 8ICEA 1ODIA 2IF2A 3T3MB 1GAWA 1XMXA 2W93A 1NZPA 2AZXA 4BGVA 3O8BA 2C2KA 2ROQA 2HC9A 3IAHA 1GSOA 5GJBA 4WLUA 1E8DA 2OL4A 1RHUA 3G7NA 3WBKA 2X9LA 2F3UA 1DBVO 2VP9A 4HL6A 8ICHA 4HCJA 3QEAZ 3LF2A 3SHVA 4C21A 4YP3A 5CYGA 1CY2A 1EGAA 2WSSA 5HF8A 4ZMRA 3H5IA 1YUBA 1Z1VA 3G8BA 3EFOA 4NYIQ 3FFWA 1NNLA 2CKDA 4D3FA 2ZTHA 3KTAA 4DJ5X 4C6TA 3IBSA 4GZ5A 1GSIA 2ZAMA 4J94A 3IE2A 2RFLA 4E1AA 3HB7A 2GOLA 2JIMA 4F2DA 3OT1A 4M8KA 1EA7A 1BH2A 2Q2QA 1HK7A 1E3TA 2QORA 3FWKA 4XWGA 2LP4Y 5A5FA 1D6SA 5KNDD 4NEGA 4INZA 1DLJA 2I4TA 2ID8A 4R7ZA 2K5UA 4AJIA 1PWXA 2JARA 2KIWA 3O2NA 8ICWA 4BC1A 1Z4IA 1K7XB 4DMHA 1YZGA 3KT3A 3COPA 3NV7A 1U0SY 2WAYA 1KBZA 4YJFA 1UJCA 3I9KA 3PSAA 4BMNA 2OV3A 4KYIB 1Q57A 3N7RC 1VOTA 2VK1A 1ONBA 4DSEA 3MGAA 2B1IA 2PRZA 1GR1A 4POOA 3ZV7A 1QH8A 3NVZA 4RXTA 2RGDA 4RE5A 3UMYA 3QFRA 3PUXA 3JD2A 3E5MA 3QZ7A 1M67A 1SXJE 1USIA 4FMBB 1W46A 1XZQA 1LWOA 1MC1A 1SHKA 1XDUA 5KTTA 2YV2A 2Q9AA 2O6LA 4X85A 1YASA 4MQUA 2R96A 8OHMA 1GGMA 1GNTA 1QBKC 4MYCA 1FFBA 1GXSB 5J5AA 4S2EA 1F9EA 1L2TA 5LMCA 1NW4A 2RI0A 2FSFA 3K4PA 3VX4A 4R9RA 5JCOA 4EITA 4E7PA 3G6XA 4BRSA 1NN3A 3WJ7A 4M0CA 3N8NA 1LFDB 3ZBPA 4KO8A 2DFTA 2X8LA 4EKGA 1O94C 3LXRA 4RHCA 3AEKB 4Q03A 1ZJNA 2P66A 2XLCA 3DKRA 2AQHA 5E6SA 4RK0A 3TACB 5EQDA 4ERNA 2XVXA 1VYTA 5G4KA 3U3KA 2ZT7A 1FUUA 2FK7A 4WPGA 4FQ5A 2CXXA 4KE7A 3QWHA 3DE3X 1Y8RA 4FHEA 3JU3A 1X80A 1TE2A 1O6ZA 3EJWA 4A1OA 2FVXA 4EBBA 2VHQA 3DF7A 3ZC3A 1YHYA 1DARA 4KLEA 2JRLA 2JJ1A 1SHTX 1YDFA 5FPSA 4J9QA 4Z9FA 4RH0A 3MJDA 1B43A 3LBIA 4OAQA 2NSJA 4D43A 2ERXA 4ND1A 5I9MA 5CD1A 1BHSA 3O83A 2HMTA 2YCLA 1V41E 2E5LB 3ZNPA 1CK4A 4TMVA 3GB9A 4GXQA 4POAA 1DIAA 1NX9A 3FSEA 4RFLA 4D45A 5E1MA 3BTSA 1H6DA 2Q0HA 3I3OA 3GV8B 1VMEA 1L4KA 5CXXA 1FSGA 1XO0A 4BP9A 2Z6VA 4OB8A 1GU0A 5FA6A 5KFKA 1TPZA 1GZVA 3B1XA 2BT4A 2NU6A 2VPTA 3R77A 4KLGA 3CH5A 1KRHA 1JTVA 3RC7A 4B7UA 2OXCA 2O19A 4RULA 2FZLA 3ABQB 1NN0A 4G0PA 1JBQA 3C23A 5AW0A 2A1TS 3RTAA 3C1TA 4D4MA 4WZAA 4R8UA 4IIVA 2VPYA 3FLBA 2PD4A 1G0OA 3L1KA 4LIPD 1BS2A 2PVCA 4B5KA 5IM4A 2O6HA 4JDPA 2Y1IA 4LKOA 2Q5IA 3ANYB 1PKEA 2X4LA 3D1LA 3GMDA 5JDCA 4BPBA 3K8ZA 1WCNA 1GPYA 1CVIA 4FVTA 2SKEA 3PGJA 2FH5B 4Z86A 4QAQA 1OJLA 3JYPA 1TJYA 1U3TA 3B89A 3I92A 3SHQA 4JU8A 2X0JA 4KMOA 2H1VA 1XEWX 4BXOA 4W7HA 3E4DA 3R8CA 1OZGA 1YJXA 1J24A 1BROA 3ZQ4A 8ICOA 4QNMA 4IBOA 3H8JA 4C89A 4UQLA 2Y1DA 1X6VA 5IVIA 2OQ2A 1JQJC 1LBSA 1A4RA 2YIJA 2X8AA 5FJIA 1RPJA 4LJKA 3R40A 3FTEA 4CU2A 3PW2A 3E5HA 3SQMA 3LC2O 1AV6A 1NZFA 1V1MA 4O4JF 4PZLA 2MINB 3FYUC 5FXMA 3F2DA 4MITA 2AX4A 4P4OA 5HK9A 2EGGA 1SOWA 4J0FA 2FN9A 4BATA 4XA8A 3JQ9A 3N7AA 3N87A 2QUHA 3SG0A 4Z4EA 4XTRA 4HS9A 4FFBA 1PK7A 1J42A 2ZUWA 4ZOLA 2AFIA 5GJCA 4Q3CA 2AOTA 4OK3A 1OLXA 4CIBA 2WWWA 3QUAA 4N5HX 4BU1A 4MVJA 3NUGA 5WRFA 1EUZA 4G6ZA 4FLMA 2Y9TA 3NFYA 3K6JA 2QE6A 3EXFA 2ZJ4A 3L6BA 2XMGA 6LDHA 4ZODA 2GETA 4XGNA 2CXPA 1XXHB 1BE6A 3GGOA 3EK2A 2PUAA 1U0TA 1NF9A 2HPHA 4OHZA 1MT0A 1XSLA 3AHDA 5IM5A 3SJUA 2VDMB 3K92A 4PHEA 5LBTA 3IXQA 5GY7A 3B3JA 1GRNA 1Q12A 4HZIA 1QAOA 1A0OA 4NBKA 4F5RA 3CZRA 1P2BA 5CJPA 4I5IA 4DL6A 1GIAA 1SOUA 2EKQA 3WIDA 3LGXA 2Z2KA 4KN6A 1BDMA 5F35A 4MVJP 1ENPA 4O02B 5KHOC 1Z4OA 2ZR9A 3MTQA 4DV3B 3Q4GA 4Y18A 2G7MC 4NECA 4QWCA 5JAQA 3JZFA 2Y9PB 1T9KA 2PL3A 1IVYA 3A4LA 3EISA 4LOHA 4DBVO 3NTOA 4EA9A 1QG0A 1LLCA 3M1YA 4DMMA 4QDUA 5B55A 3TOSA 1T9GR 1M54A 1V6AA 2J3LA 3INRA 2Z1DA 1ZQUA 2WVHA 1DXYA 1D8YA 1FZTA 1JYSA 2Y9MB 3IHLA 4QA9A 3OTQA 3R5SA 3WYDA 3HZRA 4R83A 1C0IA 4WKOA 1OU0A 2CJWA 4GBMA 1H0HA 1N92A 1ZGCA 2XBLA 1KIMA 3UHFA 1JLHA 3STYA 4L72A 1O0SA 4U39A 2GUWA 1NKCA 1GGHA 1UXHA 1I3KA 1R9MA 4H1HA 4I27A 4DN6A 2G0TA 3PD1A 3VFDA 3HDQA 3MFIA 1WVIA 5EUCA 4FSDA 1HE3A 1HDIA 3FCAA 4LJSA 3X1YA 3AXSA 2IXDA 2FDRA 2YX1A 2AE1A 4MS4B 3HL4A 1VCOA 4MKRA 1BPDA 3CN7A 3EZ6A 4CN9A 2BCGY 2G71A 2NPIA 3V9PA 4Y1EA 2CZGA 4BQPA 1GPAA 4MA5A 1KMHB 3C6YA 5JNUA 5CHGA 2FSVA 1UWCA 4TKZA 4NFSA 2JAQA 1DOZA 1J39A 1PO7A 5DZSA 5HIJA 4JA0A 1EVEA 3LHDA 3O38A 5HHHA 3AFNA 4PVDA 3MWYW 3PQ3A 1V37A 2WM3A 4XFKA 5IBPA 4U7TB 3HA5A 5JXWA 2R65A 4P38A 1I1QB 2P0YA 4JCCA 5ECYA 3QHAA 3H2IA 4RQNA 5DQHA 4QKQA 5IN4A 2CLKB 4ZCQA 5GVSA 1I4DD 3QMWA 4FYYA 3JWHA 4L8VA 1KJIA 5KKAA 4XVCA 4P4TA 4LKRA 2Y1OA 4E5VA 2JFYA 3CLTD 3ZCTA 2PIAA 3B6EA 2CNWD 3Q98A 3BF8A 4F6RB 2QBYA 2NO4A 1XQ9A 5DNDA 1ZGBA 4MI1A 4A0RA 1Y4SA 4CTJA 2RIPA 3QLVC 2UXDB 1OLSB 2QENA 3TOCA 1FLNA 3X0DA 4M1SA 2FYTA 3DZDA 3KTOA 3IBCA 1FXWF 2QY6A 1MJFA 1W85A 3ETHA 2GA9A 5JT1A 3LLCA 5IIMA 3HI6A 4II3A 3LY5A 1GQFA 2A1JB 5DK4A 1SEPA 1Q0QA 1BHQ1 2Q7DA 5AHRA 4ZGWA 1JSCA 2ZYHA 2Z98A 2FUG6 2G4LA 3RBDA 4MJXA 3ABIA 4K9SA 4X20B 2OBMA 5DTMA 1N78A 3QVWA 1DKOA 3MTBA 4QQ8A 4P7FA 3AHEA 3OAAA 2VA8A 1PV1A 4BX3A 4DQVA 1Y3DE 2YJNA 2Z1NA 2KBEA 3V2HA 2KFZA 3C6BA 3SFVA 4BMDA 4HRAA 5JISA 5CT9A 3GD7A 1RXIA 4JI6B 3E2EA 1PFKA 1ZOIA 3A9SA 1KSGA 1MAUA 1CF9A 3AVVA 2JH3A 3C3EA 2OC4A 1AXRA 1X0VA 1CUEA 4DCCA 3FHOA 2GX6A 1P0CA 3G2NA 4EBCA 5DW0A 2W2VA 2R1TA 2GEUA 2WKWA 4NMMA 4R2KA 1HG1A 3ZIAD 4ECWA 2DHDA 1GNPA 2Q1XA 1B7GO 1OTXA 4CT0A 1NBME 5NULA 3JPRA 2ZK7A 5ESWA 1QVZA 4BB5A 3KT8A 2A0WA 4I0WB 4QTTB 4TROA 1D9ZA 4M0PA 5CDSA 1E5LA 2OK7A 4M4SA 4Z8YA 3RVNA 4JSTA 1E1NA 1UCFA 1SD1A 1W96A 3WNVA 1ZH8A 3Q6IA 3JSAA 3K9WA 2XUZA 1MO6A 3HDGA 5KSWB 1NWCA 2E2WA 3KPYA 2W6MA 3SQDA 3G6YA 2NUTB 4AIIA 4F38A 4BNDB 2BKVA 1ZOSA 4Z1MA 4N5MA 3ZU2A 4AKTA 4BO6A 3CZ4A 1U5BA 1PT7A 1U9LA 5K0TA 1A72A 2Y1EA 4FQ7A 3KIPA 1X7XB 3ZBTA 4N7MA 4GOMD 1HV8A 2J4DA 4EVRA 4Z53A 3HKCA 2ZXHA 1P74A 2YXBA 2ONZA 2FSSA 4M22A 4P08A 4CGZA 1UKBA 4V39A 3RC2A 3MGCA 5IXYA 2JGNA 1GP2A 3D0KA 5C53B 4FHGA 4UEQA 5HJ5A 2H5XA 1MFZA 2GMWA 1HLDA 2OT3B 4OOFA 2K8AA 5JU5A 3U3JA 4WFQA 4RDXA 3MUOA 3KOUA 2LWIA 3MJEA 4WXYB 5CA7A 1G1AA 5IUJC 4G07A 4E31A 5LMNB 4LDPA 1DXSA 4QJ4A 2P9GA 3GNQA 1AZWA 5CGZA 1Z2PX 2COUA 3Q8KA 2XTAA 4DIEA 1GAEO 4GIBA 1C7YA 4CV0A 1R0SA 3WBBA 2O6KA 3T1TA 1BWSA 3UPQA 5IJ0A 3W5CA 4PGQA 2VEOA 5IYZF 2J7PD 4CMBA 4MQ4A 3WQSB 5IRCD 3PNVA 5AW1A 2Q7XA 2XTZA 3N39C 4YXFA 4IZ6A 1B8PA 2OY0A 1AGXA 2VHXA 3FBWA 2RDMA 4WASA 2A94A 1GVHA 1GL6A 9GPBA 3QKIA 1J8FA 2W6IA 1SK9A 5JZSA 1PT8A 3T1VA 4XGIA 3ESZA 4D9FA 3ZDBA 3PXEA 1FLAA 2QTTA 3RBXA 1QP4A 1A7UA 4FK8A 4RD3A 3JQAB 2H7VA 3OKPA 2KD1A 1WXGA 1GGJA 2AEFA 2PHZA 4K05A 3D7LA 2VHCA 4CKYA 1I6WA 1M6NA 4TGLA 5GMOA 5HZKA 3BD9A 2IZ0A 3EEFA 2KG5A 4J03A 3FTCA 4PFKA 1U7TA 2C07A 4BJ5A 2VA3A 1V2HE 4AJ1A 3EGDB 1T0HB 1OU4A 1Z47A 3OUZA 2B34A 3IP6A 3K8QA 4RE6A 3CWZA 3SIXA 5JD4A 4DS5A 3UN1A 2JMGA 5FBZA 3PWTA 2FJ0A 3KVRA 4YV2A 2L2QA 4C0QC 3V4ZA 4PSKA 4DXHA 4EA8A 3QTLA 3E8MA 3T94A 3MWJA 3U1VA 4O3SA 4NSNA 3EDOA 3VHLB 3ANTA 5E9QA 1VI5A 5LA6F 2ZUEA 4I2CA 2V45A 1JIJA 1Z2EA <