1PK1A

Hetero sam domain structure of ph and scm.
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
68
structure length
68
Chain Sequence
b'PPISSWSVDDVSNFIRELPGCQDYVDDFIQQEIDGQALLLLKEKHLVNAMGMKLGPARKIVAKVESIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polyhomeotic-proximal chromatin protein
publication title Structural organization of a Sex-comb-on-midleg/polyhomeotic copolymer.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription repression
total genus 19
structure length 68
sequence length 68
chains with identical sequence C
ec nomenclature
pdb deposition date 2003-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07647 SAM_2 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 1pk1A00
2QKQA 1SV0A 1COKA 4RQNA 2QB0B 2QARB 2KSOA 1JI7A 1DXSA 2Y9TA 2DKZA 5J8YA 2DKXA 2ESEA 2KMDA 2QB1A 3BS7A 1X40A 2E8PA 1WWVA 2QARA 1UQVA 1V38A 2K4PA 1V85A 1LKYA 2GLEA 1RG6A 1SV0C 2F44A 3TADA 2LMRA 3SEIA 5JTIA 3KKAA 5J8YC 2E8OA 2E8MA 1WWUA 1SXDA 2KIVA 2L5YA 2QB0A 2KE7A 1PK3A 2EAPA 1PK1B 2FE9A 3BS5B 2EANA 2K60A 2JV3A 4IS7A 1KW4A 3TADC 3HILA 2D3DA 2EAOA 1SV4A 1X66A 1X9XA 3SENA 5JRTA 5JU5A 2EAMA 2KSOB 2F3NA 3KKAC 2DL0A 2ES6A 2Y9UA 4RQMA 2KG5A 2LPEA 1F0MA 3K1RB 4PZNA 4NL9A 5KNIA 4PZOA 2B6GA 2YTUA 3H8MA 1OW5A 1LKYB 1SGGA 1UCVA 3BQ7A 5F3XB 2D8CA 3IDWA 1B4FA 1SXEA 4MHVA 1Z1VA 3TACB 2F8KA 1PK1A 4NJ8A 4NL9C 1B0XA 3BS5A 2E8NA 5L1MA 1OXJA
chains in the Genus database with same CATH superfamily
2HDOA 2JEGA 4KLOA 2ZIUA 4DSIA 5AI6A 2FLNA 2G5IB 4AP9A 1ZQRA 7ICSA 4KLSA 5C0YA 3AU6A 1NNLA 2O6KA 4DLGA 4ED2A 3M7DA 1XC9A 4QZIA 4UAWA 3RJHA 2GOLA 2B21A 3FDSA 3ISDA 1SV0C 4PGXA 2V9WA 2ZIWB 2KZZA 1BGXT 4KLIA 2BCQA 5KFUA 5D4BA 5J2CA 1U4BA 2DPJA 3M6KA 3RB4A 1WCNA 3LK9A 3HKZF 9ICJA 3BS5B 3RRHA 4F3OA 3RB6A 1TVAA 1X66A 5FP0A 2HHWA 1ZOLA 2ES6A 3VCBA 1ZQWA 4MFFA 5DQHA 5J0QA 3QU7A 1VJ5A 3GIJA 4I29A 5KG7A 3H0LB 4M6WA 3HJEA 5AM4A 1FFUA 1ZJNA 4CF5A 2FJ6A 3RBDA 4QZEA 4ELVA 2KHQA 2OEHA 2C22A 4O3SA 5AKJA 3BDPA 1U9LA 5KG4A 3EZ5A 3LWLA 3RR7A 1ZRNA 2JH1A 2BDUA 4RUCA 2HVHA 5L1MA 2CN1A 1RYRA 4I27A 3T3FA 3PY8A 2FPKA 3GZFA 3M1YA 4PHAA 3V6JA 4YMNA 1A76A 3TFSA 4A8EA 4F2SA 7ICRA 4O5CA 4RQ1A 4IQWA 2ZIXA 3AQEA 5J0XA 4XQ8A 3TADA 2MSNA 4UATA 1RPLA 4YD1A 3OGUA 3C5FA 3K75D 4RU9A 3ED5A 5AK5A 2C2EA 4C0ZA 2IHNA 2VJ4A 1JMSA 2JHDA 4YCXA 8ICUA 2WF7A 2K60A 1RQNA 3RJEA 4B9SA 5AM0A 1X9XA 3Q8SB 9ICAA 5KT3A 4DOAA 2BCUA 2H3FA 3B0YA 1NK5A 3PW7A 2Y1IA 3PSTA 3EPGA 2I9GA 4BDPA 1XO0A 4GFJA 1S0OA 4C8LA 5KFAA 7ICKA 3NTUA 9ICFA 1Q8KA 4RZRA 3CW2C 4M0AA 2PMZC 4I28A 5ALJA 4ED0A 2HBKA 4I2CA 4TQSA 2P6RA 2H3VA 1TK8A 1V97A 2W9CB 5G5HA 3TACB 4YQWA 4NJ8A 2KP7A 1O03A 3OHAA 3PZPA 5KFXA 4F5QA 2JR5A 4AYBC 3H8SA 2I1QA 1SV0A 1JALA 5EE3A 3RF9A 2QARB 5ALYA 4I2DA 2DUYA 2KSOA 4FS1A 3F5AA 2HBLA 1QSSA 5IIIA 3RB3A 3RBEA 3UPQA 1DK2A 3TARA 2EZXA 5KFOA 1T3QA 4F91B 3B9JA 5AHXA 3NRZA 2KFZA 3C21A 5KFWA 4MF8A 2BDPA 3IG8A 1L8LA 1V38A 3GV8B 3N97B 2F44A 4X5VA 3NASA 2VA3A 4C4RA 2LMRA 4YR0A 5DKWA 3A0HU 2WF6A 5KFMA 1N62A 4TUQA 4JWNA 3WKEA 5IIOA 2BZFA 4RNMA 1ZQEA 3IV6A 3Q8KA 5DDYA 4ECYA 4ECUA 8ICPA 3MC1A 2G07A 2R8GA 4IR9A 2OXOA 1JXLA 4O5EA 1N2XA 4OJLA 4NLBA 1D8YA 1LV5A 4DSJA 1DRGA 4KN7A 1HIWA 5IIMA 5AI0A 3RH5A 2PMZF 2ZIUB 2BKEA 2LYBA 2ISOA 5F9NA 3ZD9A 2LPEA 4Q45A 4J9PA 4DL6A 2F8LA 3UXOA 5A0LA 3CP8A 3MBYA 1ZQQA 8ICWA 4ICAA 4B9TA 3EW9A 4YXJA 2V4RA 5KT4A 4FE3A 1KDHA 4C4TA 3KHRA 2ATLA 2C28A 4NLZA 4AYBF 2FDRA 2YMQA 2DQNB 4DOBA 4RQ6A 4QZBA 2W9BA 4NLKA 2KV2A 1D8LA 1X9WA 3RAQA 1JXEA 5ALIA 3Q8QB 2RDJA 3PMLA 1JIHA 2ZXIA 1JN3A 3JPRA 4B9UA 4UB3A 4PHDA 5J2BA 2WHEA 5DBCA 4EEKA 3PW2A 2UVUA 4RT3A 5J2AA 1DXSA 4KLGA 1KN5A 2EH9A 2F2AB 4Z6FA 4M2YA 4F8RA 5J2KA 5KT2A 1C7YA 2Q0ZX 3IRUA 3QUTA 2W7PA 4LZDA 2HCFA 4UB6U 4Q43A 3MDAA 4M6WB 4DFPA 1RG6A 3RAXA 4YMMA 5L1IA 4DQRA 1X2IA 1F44A 5DQGA 5KFQA 3RJFA 2F76X 4F2RA 1X6JA 4QNLA 3HW8A 2WF9A 1SXDA 5T14A 3I28A 1IV8A 3WKDA 4NWIA 3SV3A 4TURA 1PVQA 2XY6A 2ZUBA 1KFDA 2YY6A 1BPZA 2D3DA 3KHGA 1S0MA 7ICGA 3LDAA 2W3RA 2EDUA 1CI4A 1LB2B 8ICSA 5E79U 1ZQCA 4J9KA 3WK4A 2Y9UA 3EWAA 1FO4A 2KG5A 3ETRA 3UMBA 1N48A 2KJ5A 1ZJMA 4KLDA 3RB0A 4YFKA 2Z7JA 4F92B 1X6IA 2ZIXB 3MABA 5DBAA 4Y2VA 4FZMA 1DOQA 1SGGA 4K4HA 4DL5A 3NUQA 4YG2A 2G09A 4C8KA 3IG5A 3AN1A 1B4FA 2XY7A 2WF5A 5BOLA 5AM3A 2KZMA 2OCEA 4P4OA 2OWOA 2DGZA 3V7LA 1COKA 3PX0A 5HNKA 5HMLA 3V7JA 3RJGA 5DB9A 1HJPA 4FZLA 5ALZA 1KLNA 3H8JA 3PX4A 4KLMA 2XICA 1BPDA 2OYYA 4F5PA 3M9NB 1SL2A 2FLLA 5ALOA 4DL3A 4IR1A 2HHTA 1KEJA 2J6TA 1NOMA 1B22A 2NYVA 1IM4A 4UAYA 3H0RB 1RYUA 5EWEA 2JMGA 1KSPA 4KLQA 3N7PD 1N61A 1NK6A 3SEIA 3HP6A 8ICVA 1D9FA 3N7SC 5J8YC 1YZ7A 3MGIA 5KFSA 3C1YA 2E8MA 3AM9A 2P6UA 2HMXA 2KIVA 2KVSA 1K1QA 3Q8MA 2KJ8A 2GWSA 4F5RA 2ZJ5A 4KITB 9ICRA 3V7KA 1BPBA 5BPCA 4OD0A 1XU4A 9ICEA 4B9NA 3KOOA 4I2GA 2G0AA 2HOQA 2KSOB 8ICXA 1RYSA 3RJJA 4CF4A 4DFDA 2JZBA 3H40A 5ALVA 5KFPA 3WKBA 1QQ6A 8ICQA 1Q46A 4CCHA 3DV9A 4I2EA 1CRXA 2YB4A 1S97A 2LKYA 2KK0A 3ZDAA 3ICXA 1S0NA 1FIQA 4O0IA 1EXNA 4JV2A 2K4HA 2J6SA 3AUOA 4ED8A 4DQPA 3ONNA 9ICHA 2BQ3A 4ED1A 1TAMA 4NL9C 1Z1BA 2JH7A 3SQIA 5F9LA 4TUPA 3SV4A 1JI7A 2LBOA 3JPQA 3HWTA 4IQUA 4ECSA 3JPPA 2A1JA 1UHUA 2MU2A 5ALLA 2DKXA 4KMUA 4DQSA 4BX9C 4Y2PA 5CB1A 3UQ0A 2A3VA 2AU0A 3C2MA 2W3SA 9ICVA 2DWQA 1JUDA 3MR3A 3N4MB 2A19A 1LKYA 2GLEA 5KT7A 5EWFA 4ELUA 3WU2U 1SKWA 1BNPA 8ICAA 4G9BA 3C28A 3OJSA 3OSPA 4GC7A 1U49A 5CRXA 2HHXA 5AI5A 1K1SA 2VKQA 4DWIA 3MGHA 5J0WA 3AMZA 4ACOA 1ZQHA 1Q3VA 4OJ6A 3TAQA 2EAOA 9ICLA 4KLFA 1N63A 2B0CA 3GQCA 9ICBA 5B66U 4QZ9A 4PZNA 1Z19A 3T5HA 2F1JA 5DDMA 4BUGA 4NLNA 3F2CA 2YTUA 4MEYA 2NO5A 1S9FA 5KFZA 4E0DA 2ISPA 3TAPA 3M9MB 1KTQA 3ZD8A 3NVVA 3AU2A 1N60A 5AKZA 1A0PA 5C5JA 1PK1A 3ALRA 4Z6EA 4PGYA 4ECTA 5IIKA 2I6XA 2QLTA 1NJXA 5KFBA 2EZYA 5KFHA 3ZDCA 5J8YA 4CDGA 1NZPA 7ICVA 4C7YA 4UAUA 2W9AA 4DQQA 8ICFA 5ALPA 4M04A 5TZVA 4YMOA 4DEZA 4UAZA 2Q4TA 4DQIA 1WWVA 2BCSA 4KLTA 7ICPA 3D2SA 1T3NA 2JEIA 1ZQAA 5KFEA 3L3FX 3RRGA 4M9LA 1TE2A 3BQ0A 4NY8A 1UA0A 1BPYA 3AQFA 3Q8RB 4ED3A 4FZNA 4JK1A 2ZTEA 1HUOA 5ALHA 4UARA 2CPRA 3F2BA 2KEYA 4QWDA 3U26A 1XSLA 1PK3A 4PH5A 8ICIA 4QW8A 4YN4A 4MF2A 4UB5A 4FBUA 3C23A 2W8KA 3HILA 3E58A 4QZGA 7ICJA 2VIXA 4Y2RA 3Q8LA 3CNHA 5AKIA 3OTQA 2GO7A 1SKRA 3PR5B 3KZXA 5IINA 4O3PA 4DO9A 3SZ2A 1YT3A 4LVSA 3PO5A 2XO7A 4B9LA 1MQ3A 3R9KA 4NL9A 4DF8A 5K4LA 1X42A 4RPXA 4R64A 3ORYA 2BPFA 2KOBA 1HUZA 1QLNA 1KKXA 5L9XA 2A1AA 3QUQA 4J9NA 1BNOA 2PXIA 1NK4A 1XS9D 3BQ7A 3PW5A 1XWLA 1KBUA 2HOFA 4NLGA 3Q8PB 2AHOB 1ZD3A 5AK6A 4EBEA 4RQ7A 2YMLA 1S77D 2ZIVA 1Z4OA 2Y1JA 3AL0B 4BWMA 5AM1A 3VC8A 1X9SA 5DBBA 2G08A 1MSWD 1ZQXA 4I2JA 2AGOA 1TAUA 2Y9TA 2H5XA 3QX7A 5J2JA 2I5HA 2V4QA 4MEXA 4ELTA 2N1RA 2KJ9A 4JMUA 5EWGA 4Q44A 5J2EA 2JZBB 1CEZA 4IRCA 4RPZA 1D8BA 3C29A 1FEZA 3T5LA 4ECZA 5J2DA 3UM9A 5AI8A 3IM1A 4F4ZA 3PVXA 8ICYA 1MQ2A 1QQ7A 5H2FU 5ALTA 1NK8A 4KLUA 4C8MA 1NKEA 1QSLA 1KFSA 3RJKA 2BPCA 2WFAA 3GFKB 3PV8A 4OO1J 1JX4A 3SAGA 3BZCA 4Q8FA 1SL1A 5BOMA 4EZ6A 3H4DA 2A1JB 5J2IA 5KFLA 4Y2QA 1B43A 1F0MA 1UT8A 3M6ZA 1MN8A 2ASJA 4RPYA 3NVYA 5KL1B 4J03A 3C2KA 5DLGA 4EELA 1LKYB 2LHTA 1ZQYA 5J0YA 1UA1A 4QIWC 4P0QA 4XA5A 3RJIA 3IDWA 4OJOA 3JPNA 1JRPA 9ICMA 2AQ4A 4P0PA 1ZQVA 5KL8B 3NS1A 1OXJA 4UBCA 2ASLA 3IP4B 5J0PA 4MFCA 3TFRA 5KG3A 3GILA 4M9NA 2HHUA 1T8EA 1TV9A 8ICCA 3G6VA 2YQEA 1VDVA 2XI9A 4C7ZA 1Q3UA 4EEYA 4YXMA 4DSLA 3O0FA 2JEJA 3LVWA 3EYZA 4IRKA 5KFFA 2XVTA 5GTHU 3TKAA 4CGZA 5L1KA 4IQTA 1L5UA 1DGSA 1IIPA 2PFOA 2E5SA 1ZQIA 3M8RA 3V72A 1F5SA 1SWWA 1GO3F 5J29A 2XC9A 1PUZA 5AM2A 1S10A 2E1FA 1KFTA 4B9MA 2HHSA 3S6JA 2E8OA 3C5GA 7ICUA 1WWUA 2W7OA 2AJQA 4R66A 2BQUA 2W9MA 3ISCA 3RR8A 9ICXA 1ZQZA 1T4GA 7ICEA 3NRWA 1PK1B 4PHPA 1RZTA 2JV3A 3T5KA 1ZQLA 4JV1A 5KG1A 2KIWA 2NRXA 1ZQSA 4QIWF 5AK3A 4M9HA 3QYPA 2J6UA 1ZQDA 3N7RC 3BQ1A 2H3ZA 3PO4A 5KNIA 1H38A 2OH2A 4NLCA 4PZOA 3H0MB 2KFNA 1N5XA 2F77X 7ICMA 3WK8A 4XUSA 3F5EA 5KG0A 3GIIA 4FO6A 1Y88A 3CYMA 1AROP 5CWRA 2IOHA 4Y2UA 3IN5A 1NK0A 1V9PA 4EX7A 2FMQA 4DFKA 2F8KA 2NRTA 3ETLA 4O3MA 5AKHA 1TFRA 1Z00A 5KAIU 3UXNA 2FMSA 4RQNA 3ZI4A 3BJYA 5ALDA 2LM1A 2HBJA 5CP2A 2JGAA 2KNJA 3SAHA 1NJZA 1ZQNA 3MFHA 4WJ3B 3QNMA 2R8HA 4QZCA 1L3TA 5HHIA 2RDIA 2IA6A 2ZG6A 3GIMA 4J9OA 5KFIA 4QWAA 1K5OA 9ICWA 4K4GA 2NV3A 1ZQJA 5J2HA 2MUTA 9ICQA 3QU4A 5AIAA 3DEEA 5CEHA 1P7DA 3OSNA 1SZHA 5CJ7A 1QTMA 2FLPA 8ICRA 4F4KA 4Y2SA 4R63A 1IXRA 4QWEA 2F1IA 3ZDBA 2W04A 2FE9A 2ZIVB 4GXJA 3BZKA 3JPOA 3L4PA 2EAMA 2F3NA 4FS2A 2PFNA 2IMWP 5HP4A 2YMMA 9ICCA 2ZXHA 2YB1A 5KAFU 3TI0A 1DGJA 3PX6A 5AKKA 1QSYA 2NRVA 4DL4A 4KX5A 3HT3A 1KL9A 2G5HB 2BQRA 4FFDA 3SYZA 3K1ZA 2WAQC 3QUBA 3THVA 5KFTA 4IRDA 1L7NA 7ICTA 7ICFA 5HHHA 4UB4A 1N5WA 1S76D 4KX3A 1TKDA 4P4PA 4ZOHC 3C2LA 5DB7A 3TANA 2EQYA 3QU5A 4RQ3A 1L3UA 2EZZA 2MRLA 4RNNA 2LYAA 4O3NA 5L1JA 2QARA 5ALSA 5IIJA 1BPEA 2KVCA 2K4PA 4US8A 1QCKA 3E2EA 3DDHA 2P66A 2AXTU 4QWCA 2UVRA 1LVHA 4PL1A 4C80A 4KLHA 4RQ8A 5AKXA 2RLTA 2RQ5A 5ALRA 4RNOA 4P0QB 4NV0A 3PNCA 4QZHA 5HMMA 4MFAA 5AI4A 3AEVA 4YR2A 1NK7A 4QJFB 1KRPA 4EENA 2QB0A 3LYSA 2M0NA 4P0PB 4CNQA 2KTQA 4O3OA 4IC9A 1RM6C 4HAIA 3SAFA 9ICKA 1Z4NA 4KLJA 3KKAC 2KICA 3HX0A 2DL0A 4Y2TA 1RXWA 2W9BB 4EBCA 3BQ2A 4KN4A 2WAQF 1ZQUA 3QZ8A 3E0FA 3QEBZ 4R8UA 1NJYA 5J0UA 3MR5A 2C2RA 2RP5A 4F4WA 3H8MA 2JEFA 1KQQA 2C2DA 3BQTA 4UB2A 1AQ6A 4Z6CA 5DGBA 5DB8A 2E1EA 3QUCA 4OCZA 1SXEA 9ICTA 2YMPA 2UVVA 5J0RA 4IL6U 4XRHA 7ICIA 4CF3A 4F71A 3JPTA 1NJWA 2JRZA 1SL0A 1COOA 3RTVA 4DF4A 2XCAA 2DKZA 5ALXA 3WK6A 4CE6A 3MFIA 5AIBA 1L7MA 2E8PA 2XY5A 4BXOA 2DBYA 1ECWA 2DPIA 3I1YA 1UQVA 3PW0A 4PJ0U 2KKVA 4NM2A 1L6NA 5ALFA 4RT2A 9ICOA 2ASDA 2LM4A 4EYIB 4I2AA 7ICNA 3LWMA 4ZH4A 5J2FA 4F72A 2YN4A 3KD3A 4I2BA 9ICIA 4QZFA 5KG6A 5AM5A 1VLBA 3QU9A 2XIDA 3KHLA 2VA8A 5ALEA 3QEAZ 5D46A 1XNSA 2KKPA 1XSNA 5KFRA 4I2HA 5HR6A 1QQ5A 2EANA 5EOZA 2ZUCA 4IS7A 1Z00B 2IBKA 1L7OA 2PFPA 1U48A 3SENA 4P2HA 2H3IA 1NK9A 2CXYA 2YX8A 4J9QA 2K4EA 1NKCA 3QXGA 2ODGA 2WB1C 2ZTDA 5KFYA 2MA1A 1NKBA 4Z6DA 8ICMA 2W11A 2LI6A 2B6GA 2MUTB 4KTQA 8ICGA 1ZQGA 1RXVA 1SZPA 4TQRA 4F4YA 2D6FC 3RFAA 4PHEA 2FPMA 5EE9A 2W03A 2XGQA 3ZDEA 8ICEA 3NVWA 2BHNA 2HSZA 4JB3A 3MDCA 1ZQOA 1MA7A 3GU3A 4TUSA 2HW3A 2E8NA 1S5LU 3GIKA 2ZTCA 8ICHA 1L3VA 1N56A 2M9NA 4JV0A 5KFKA 3KTQA 3QU2A 1IG6A 4FBTA 1X9MA 3QE9Y 4P4MA 1S0VA 4GLXA 3V6KA 1CUKA 1ZD4A 2K8CB 2Y0SC 5ALNA 3GDXA 2OHFA 5JTIA 5KFJA 5J0OA 3PSFA 8ICNA 4QZ8A 2VA2A 3KKAA 2WTFA 4QWBA 3V6HA 2AQ0A 4DFMA 2KZ3A 4F5NA 3C1ZA 4YP3A 3WKCA 1QH9A 3OHBA 4KLLA 2KE7A 3TQ1A 3RH4A 2WB1F 5CR0A 4UQGA 3QZ7A 1ZD2P 5IILA 3GV7B 4USAA 5DG7A 2OM6A 5TISU 5KG2A 5JRTA 1SB3C 4EBDA 3MR6A 3OJUA 1O08A 1M6YA 3F2DA 3K1RB 1JROA 1J97A 4GC6A 4J9SA 4JUZA 2JXJA 4F5OA 1U47A 1NI3A 3FC4A 5DLFA 2AGQA 5F3XB 5KT6A 5B5EU 8ICBA 4DFJA 4ECVA 1B0XA 2NRZA 1HEKA 3RH6A 8ICLA 2PI4A 1WUDA 3NVZA 5AK4A 5AKYA 2QKQA 3F53A 4EYHB 3H8WA 2QB0B 1L7PA 4HYKA 4F4XA 3T5JA 2IHMA 2Y0SF 2ESEA 3MGVA 2KMDA 8ICKA 1X40A 2FMPA 3SI8A 5ALWA 2PI5A 4UASA 3H7IA 2K8BB 2W43A 1TAQA 1V85A 5KFVA 4RQ5A 4R8UB 2W54A 1D9DA 3HRDD 1J2NA 8ICJA 1TK0A 9ICNA 5AKEA 2UVWA 3WK9A 2RHFA 5J0TA 1ZYQA 8ICOA 3J81j 1T7PA 3JPSA 4LJXA 2FPLA 7ICLA 1Z3EB 5HR7A 3WK5A 4DOCA 2DFLA 1BVSA 1A77A 4GXKA 4O9MA 1U45A 9ICGA 1OUQA 4DSEA 4DS4A 2BCRA 2BCVA 4JWMA 4G3IA 3LVVA 5CA7A 4RQMA 1ED1A 1NZBA 2MAXA 5ALQA 4BXOB 2NRWA 2ZIWA 1RDFA 2R8IA 5ALKA 3FM9A 4Y2XA 2PFQA 5DG9A 3WK7A 2R18A 4UB1A 5J2GA 2VANA 1L8OA 5KFCA 2ZUDA 3FYHA 4ECWA 4MHVA 2NO4A 1Z1VA 4QW9A 4DL7A 4DSKA 4DL2A 4O3RA 3EUB2 4QZDA 4Y2YA 5DGAA 3BS5A 4UBBA 3ISBA 3PMNA 3PSPA 2ZJAA 4O5KA 2H3QA 1UT5A 2FI1A 1ZQMA 2KN7A 3MR2A 3UMCA 1RQLA 4DSFA 1WCLA 3UXPA 2QB1A 4EX6A 4C8NA 5AI9A 8ICTA 4OJPA 4F93B 1ZRMA 3HPOA 1ZQ1C 5EE0A 4UAVA 2WF8A 5KG5A 2BR0A 2RRDA 2DF4B 3PR4A 5EE1A 5DB6A 4I2FA 2AGPA 1L3SA 1PVRA 2KHVA 2ALZA 1WG8A 4UB8U 3PSIA 3KHHA 3KZIU 3ZDDA 2P35A 1PZNA 3B0XA 3D2QA 9ICUA 4OJ5A 4I2IA 4O3QA 4U7CA 3PW4A 2EAPA 4RQ0A 5KFDA 1SWVA 2CRXA 1UPHA 1KW4A 4EZ9A 4J9RA 5KT5A 5JU5A 2F1HA 1ZXIA 3SR6A 3L5KA 3M9OB 4PGQA 1SIJA 4DS5A 4B9VA 5KFGA 4PPXA 3N28A 2PKEA 1XO1A 4BJQA 5KTQA 2BGWA 3CRXA 4DLEA 3FAHA 3A0BU 9ICSA 4BWJA 4IQVA 3M8SA 5DG8A 2HVIA 4B6JA 4M9JA 2D8CA 5GTIU 7ICOA 5ALUA 1XSPA 4ED7A 3OPXA 4LZGA 4UW9A 4BGDA 3UMGA 1MC8A 1J2MA 4YD2A 5DQIA 1ZQFA 4PL2A 3SMVA 2HHVA 9ICPA 4CRXA 1PVPA 3I76A 2W55A 2ZJ8A 5J0SA 4DCCA 4RUAA 3BS7A 3WKAA 1ZD5A 2VJ5A 4Y2JA 5AKLA 4NXZA 4YR3A 4Q8EA 3H4BA 4GIBA 8ICZA 4M9GA 2HBMA 5ALGA 1T94A 1YZ6A 3EPIA 2BPGA 1BPXA 4J9LA 2AH5A 1DK3A 4QZAA 1C20A 1URJA 4YVZA 4NM1A 4C8OA 3KBBA 1ZQPA 2W9CA 4GXIA 1TK5A 3G6XA 2K4IA 1ZQTA 3SD7A 4ED6A 4ECXA 3UQ2A 2G06A 3D6JA 2L5YA 2R8KA 2R8JA 2IOFA 5L1LA 5JUMA 2IOFK 3IHQB 7ICHA 1WYGA 2E3TA 3T79A 3K4GA 3G6YA 4US9A 2KD1A 3TADC 3NGDA 3D2NA 1SV4A 5KFNA 5D49A 4F50A 4U6PA 2XGPA 4RQ4A 7ICQA 4R65A 2HOIA 4KMOB 4J9MA 2LYHA 4M47A 4ECQA 2GH1A 5AICA 3HKZC 3GV5B 1ZQBA 3KFUF 4RQ2A 4KLEA 2HI0A 1FFVA 2K89A 5AKGA 1S8OA 1OW5A 1ZQKA 1UCVA 4K4IA 5G5GA 2W8LA 5ALMA 2K8AA 1A6SA 5CHGA 1SKSA 2HHQA 2XCPA 4ECRA 4C4SA 1ZETA
chains in the Genus database with same CATH topology
2QKQA 1SV0A 1COKA 4RQNA 2QB0B 2QARB 2KSOA 1JI7A 1DXSA 2Y9TA 2DKZA 5J8YA 2DKXA 2ESEA 2KMDA 2QB1A 3BS7A 1X40A 2E8PA 1WWVA 2QARA 1UQVA 1V38A 2K4PA 1V85A 1LKYA 2GLEA 1RG6A 1SV0C 2F44A 3TADA 2LMRA 3SEIA 5JTIA 3KKAA 5J8YC 2E8OA 2E8MA 1WWUA 1SXDA 2KIVA 2L5YA 2QB0A 2KE7A 1PK3A 2EAPA 1PK1B 2FE9A 3BS5B 2EANA 2K60A 2JV3A 4IS7A 1KW4A 3TADC 3HILA 2D3DA 2EAOA 1SV4A 1X66A 1X9XA 3SENA 5JRTA 5JU5A 2EAMA 2KSOB 2F3NA 3KKAC 2DL0A 2ES6A 2Y9UA 4RQMA 2KG5A 2LPEA 1F0MA 3K1RB 4PZNA 4NL9A 5KNIA 4PZOA 2B6GA 2YTUA 3H8MA 1OW5A 1LKYB 1SGGA 1UCVA 3BQ7A 5F3XB 2D8CA 3IDWA 1B4FA 1SXEA 4MHVA 1Z1VA 3TACB 2F8KA 1PK1A 4NJ8A 4NL9C 1B0XA 3BS5A 2E8NA 5L1MA 1OXJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QKQ A;  1SV0 A;  1COK A;  4RQN A;  2QB0 B;  2QAR B;  2KSO A;  1JI7 A;  1DXS A;  2Y9T A;  2DKZ A;  5J8Y A;  2DKX A;  2ESE A;  2KMD A;  2QB1 A;  3BS7 A;  1X40 A;  2E8P A;  1WWV A;  2QAR A;  1UQV A;  1V38 A;  2K4P A;  1V85 A;  1LKY A;  2GLE A;  1RG6 A;  1SV0 C;  2F44 A;  3TAD A;  2LMR A;  3SEI A;  5JTI A;  3KKA A;  5J8Y C;  2E8O A;  2E8M A;  1WWU A;  1SXD A;  2KIV A;  2L5Y A;  2QB0 A;  2KE7 A;  1PK3 A;  2EAP A;  1PK1 B;  2FE9 A;  3BS5 B;  2EAN A;  2K60 A;  2JV3 A;  4IS7 A;  1KW4 A;  3TAD C;  3HIL A;  2D3D A;  2EAO A;  1SV4 A;  1X66 A;  1X9X A;  3SEN A;  5JRT A;  5JU5 A;  2EAM A;  2KSO B;  2F3N A;  3KKA C;  2DL0 A;  2ES6 A;  2Y9U A;  4RQM A;  2KG5 A;  2LPE A;  1F0M A;  3K1R B;  4PZN A;  4NL9 A;  5KNI A;  4PZO A;  2B6G A;  2YTU A;  3H8M A;  1OW5 A;  1LKY B;  1SGG A;  1UCV A;  3BQ7 A;  5F3X B;  2D8C A;  3IDW A;  1B4F A;  1SXE A;  4MHV A;  1Z1V A;  3TAC B;  2F8K A;  1PK1 A;  4NJ8 A;  4NL9 C;  1B0X A;  3BS5 A;  2E8N A;  5L1M A;  1OXJ A; 
#chains in the Genus database with same CATH topology
 2HDO A;  2JEG A;  4KLO A;  2ZIU A;  4DSI A;  5AI6 A;  2FLN A;  2G5I B;  4AP9 A;  1ZQR A;  7ICS A;  4KLS A;  5C0Y A;  3AU6 A;  1NNL A;  2O6K A;  4DLG A;  4ED2 A;  3M7D A;  1XC9 A;  4QZI A;  4UAW A;  3RJH A;  2GOL A;  2B21 A;  3FDS A;  3ISD A;  1SV0 C;  4PGX A;  2V9W A;  2ZIW B;  2KZZ A;  1BGX T;  4KLI A;  2BCQ A;  5KFU A;  5D4B A;  5J2C A;  1U4B A;  2DPJ A;  3M6K A;  3RB4 A;  1WCN A;  3LK9 A;  3HKZ F;  9ICJ A;  3BS5 B;  3RRH A;  4F3O A;  3RB6 A;  1TVA A;  1X66 A;  5FP0 A;  2HHW A;  1ZOL A;  2ES6 A;  3VCB A;  1ZQW A;  4MFF A;  5DQH A;  5J0Q A;  3QU7 A;  1VJ5 A;  3GIJ A;  4I29 A;  5KG7 A;  3H0L B;  4M6W A;  3HJE A;  5AM4 A;  1FFU A;  1ZJN A;  4CF5 A;  2FJ6 A;  3RBD A;  4QZE A;  4ELV A;  2KHQ A;  2OEH A;  2C22 A;  4O3S A;  5AKJ A;  3BDP A;  1U9L A;  5KG4 A;  3EZ5 A;  3LWL A;  3RR7 A;  1ZRN A;  2JH1 A;  2BDU A;  4RUC A;  2HVH A;  5L1M A;  2CN1 A;  1RYR A;  4I27 A;  3T3F A;  3PY8 A;  2FPK A;  3GZF A;  3M1Y A;  4PHA A;  3V6J A;  4YMN A;  1A76 A;  3TFS A;  4A8E A;  4F2S A;  7ICR A;  4O5C A;  4RQ1 A;  4IQW A;  2ZIX A;  3AQE A;  5J0X A;  4XQ8 A;  3TAD A;  2MSN A;  4UAT A;  1RPL A;  4YD1 A;  3OGU A;  3C5F A;  3K75 D;  4RU9 A;  3ED5 A;  5AK5 A;  2C2E A;  4C0Z A;  2IHN A;  2VJ4 A;  1JMS A;  2JHD A;  4YCX A;  8ICU A;  2WF7 A;  2K60 A;  1RQN A;  3RJE A;  4B9S A;  5AM0 A;  1X9X A;  3Q8S B;  9ICA A;  5KT3 A;  4DOA A;  2BCU A;  2H3F A;  3B0Y A;  1NK5 A;  3PW7 A;  2Y1I A;  3PST A;  3EPG A;  2I9G A;  4BDP A;  1XO0 A;  4GFJ A;  1S0O A;  4C8L A;  5KFA A;  7ICK A;  3NTU A;  9ICF A;  1Q8K A;  4RZR A;  3CW2 C;  4M0A A;  2PMZ C;  4I28 A;  5ALJ A;  4ED0 A;  2HBK A;  4I2C A;  4TQS A;  2P6R A;  2H3V A;  1TK8 A;  1V97 A;  2W9C B;  5G5H A;  3TAC B;  4YQW A;  4NJ8 A;  2KP7 A;  1O03 A;  3OHA A;  3PZP A;  5KFX A;  4F5Q A;  2JR5 A;  4AYB C;  3H8S A;  2I1Q A;  1SV0 A;  1JAL A;  5EE3 A;  3RF9 A;  2QAR B;  5ALY A;  4I2D A;  2DUY A;  2KSO A;  4FS1 A;  3F5A A;  2HBL A;  1QSS A;  5III A;  3RB3 A;  3RBE A;  3UPQ A;  1DK2 A;  3TAR A;  2EZX A;  5KFO A;  1T3Q A;  4F91 B;  3B9J A;  5AHX A;  3NRZ A;  2KFZ A;  3C21 A;  5KFW A;  4MF8 A;  2BDP A;  3IG8 A;  1L8L A;  1V38 A;  3GV8 B;  3N97 B;  2F44 A;  4X5V A;  3NAS A;  2VA3 A;  4C4R A;  2LMR A;  4YR0 A;  5DKW A;  3A0H U;  2WF6 A;  5KFM A;  1N62 A;  4TUQ A;  4JWN A;  3WKE A;  5IIO A;  2BZF A;  4RNM A;  1ZQE A;  3IV6 A;  3Q8K A;  5DDY A;  4ECY A;  4ECU A;  8ICP A;  3MC1 A;  2G07 A;  2R8G A;  4IR9 A;  2OXO A;  1JXL A;  4O5E A;  1N2X A;  4OJL A;  4NLB A;  1D8Y A;  1LV5 A;  4DSJ A;  1DRG A;  4KN7 A;  1HIW A;  5IIM A;  5AI0 A;  3RH5 A;  2PMZ F;  2ZIU B;  2BKE A;  2LYB A;  2ISO A;  5F9N A;  3ZD9 A;  2LPE A;  4Q45 A;  4J9P A;  4DL6 A;  2F8L A;  3UXO A;  5A0L A;  3CP8 A;  3MBY A;  1ZQQ A;  8ICW A;  4ICA A;  4B9T A;  3EW9 A;  4YXJ A;  2V4R A;  5KT4 A;  4FE3 A;  1KDH A;  4C4T A;  3KHR A;  2ATL A;  2C28 A;  4NLZ A;  4AYB F;  2FDR A;  2YMQ A;  2DQN B;  4DOB A;  4RQ6 A;  4QZB A;  2W9B A;  4NLK A;  2KV2 A;  1D8L A;  1X9W A;  3RAQ A;  1JXE A;  5ALI A;  3Q8Q B;  2RDJ A;  3PML A;  1JIH A;  2ZXI A;  1JN3 A;  3JPR A;  4B9U A;  4UB3 A;  4PHD A;  5J2B A;  2WHE A;  5DBC A;  4EEK A;  3PW2 A;  2UVU A;  4RT3 A;  5J2A A;  1DXS A;  4KLG A;  1KN5 A;  2EH9 A;  2F2A B;  4Z6F A;  4M2Y A;  4F8R A;  5J2K A;  5KT2 A;  1C7Y A;  2Q0Z X;  3IRU A;  3QUT A;  2W7P A;  4LZD A;  2HCF A;  4UB6 U;  4Q43 A;  3MDA A;  4M6W B;  4DFP A;  1RG6 A;  3RAX A;  4YMM A;  5L1I A;  4DQR A;  1X2I A;  1F44 A;  5DQG A;  5KFQ A;  3RJF A;  2F76 X;  4F2R A;  1X6J A;  4QNL A;  3HW8 A;  2WF9 A;  1SXD A;  5T14 A;  3I28 A;  1IV8 A;  3WKD A;  4NWI A;  3SV3 A;  4TUR A;  1PVQ A;  2XY6 A;  2ZUB A;  1KFD A;  2YY6 A;  1BPZ A;  2D3D A;  3KHG A;  1S0M A;  7ICG A;  3LDA A;  2W3R A;  2EDU A;  1CI4 A;  1LB2 B;  8ICS A;  5E79 U;  1ZQC A;  4J9K A;  3WK4 A;  2Y9U A;  3EWA A;  1FO4 A;  2KG5 A;  3ETR A;  3UMB A;  1N48 A;  2KJ5 A;  1ZJM A;  4KLD A;  3RB0 A;  4YFK A;  2Z7J A;  4F92 B;  1X6I A;  2ZIX B;  3MAB A;  5DBA A;  4Y2V A;  4FZM A;  1DOQ A;  1SGG A;  4K4H A;  4DL5 A;  3NUQ A;  4YG2 A;  2G09 A;  4C8K A;  3IG5 A;  3AN1 A;  1B4F A;  2XY7 A;  2WF5 A;  5BOL A;  5AM3 A;  2KZM A;  2OCE A;  4P4O A;  2OWO A;  2DGZ A;  3V7L A;  1COK A;  3PX0 A;  5HNK A;  5HML A;  3V7J A;  3RJG A;  5DB9 A;  1HJP A;  4FZL A;  5ALZ A;  1KLN A;  3H8J A;  3PX4 A;  4KLM A;  2XIC A;  1BPD A;  2OYY A;  4F5P A;  3M9N B;  1SL2 A;  2FLL A;  5ALO A;  4DL3 A;  4IR1 A;  2HHT A;  1KEJ A;  2J6T A;  1NOM A;  1B22 A;  2NYV A;  1IM4 A;  4UAY A;  3H0R B;  1RYU A;  5EWE A;  2JMG A;  1KSP A;  4KLQ A;  3N7P D;  1N61 A;  1NK6 A;  3SEI A;  3HP6 A;  8ICV A;  1D9F A;  3N7S C;  5J8Y C;  1YZ7 A;  3MGI A;  5KFS A;  3C1Y A;  2E8M A;  3AM9 A;  2P6U A;  2HMX A;  2KIV A;  2KVS A;  1K1Q A;  3Q8M A;  2KJ8 A;  2GWS A;  4F5R A;  2ZJ5 A;  4KIT B;  9ICR A;  3V7K A;  1BPB A;  5BPC A;  4OD0 A;  1XU4 A;  9ICE A;  4B9N A;  3KOO A;  4I2G A;  2G0A A;  2HOQ A;  2KSO B;  8ICX A;  1RYS A;  3RJJ A;  4CF4 A;  4DFD A;  2JZB A;  3H40 A;  5ALV A;  5KFP A;  3WKB A;  1QQ6 A;  8ICQ A;  1Q46 A;  4CCH A;  3DV9 A;  4I2E A;  1CRX A;  2YB4 A;  1S97 A;  2LKY A;  2KK0 A;  3ZDA A;  3ICX A;  1S0N A;  1FIQ A;  4O0I A;  1EXN A;  4JV2 A;  2K4H A;  2J6S A;  3AUO A;  4ED8 A;  4DQP A;  3ONN A;  9ICH A;  2BQ3 A;  4ED1 A;  1TAM A;  4NL9 C;  1Z1B A;  2JH7 A;  3SQI A;  5F9L A;  4TUP A;  3SV4 A;  1JI7 A;  2LBO A;  3JPQ A;  3HWT A;  4IQU A;  4ECS A;  3JPP A;  2A1J A;  1UHU A;  2MU2 A;  5ALL A;  2DKX A;  4KMU A;  4DQS A;  4BX9 C;  4Y2P A;  5CB1 A;  3UQ0 A;  2A3V A;  2AU0 A;  3C2M A;  2W3S A;  9ICV A;  2DWQ A;  1JUD A;  3MR3 A;  3N4M B;  2A19 A;  1LKY A;  2GLE A;  5KT7 A;  5EWF A;  4ELU A;  3WU2 U;  1SKW A;  1BNP A;  8ICA A;  4G9B A;  3C28 A;  3OJS A;  3OSP A;  4GC7 A;  1U49 A;  5CRX A;  2HHX A;  5AI5 A;  1K1S A;  2VKQ A;  4DWI A;  3MGH A;  5J0W A;  3AMZ A;  4ACO A;  1ZQH A;  1Q3V A;  4OJ6 A;  3TAQ A;  2EAO A;  9ICL A;  4KLF A;  1N63 A;  2B0C A;  3GQC A;  9ICB A;  5B66 U;  4QZ9 A;  4PZN A;  1Z19 A;  3T5H A;  2F1J A;  5DDM A;  4BUG A;  4NLN A;  3F2C A;  2YTU A;  4MEY A;  2NO5 A;  1S9F A;  5KFZ A;  4E0D A;  2ISP A;  3TAP A;  3M9M B;  1KTQ A;  3ZD8 A;  3NVV A;  3AU2 A;  1N60 A;  5AKZ A;  1A0P A;  5C5J A;  1PK1 A;  3ALR A;  4Z6E A;  4PGY A;  4ECT A;  5IIK A;  2I6X A;  2QLT A;  1NJX A;  5KFB A;  2EZY A;  5KFH A;  3ZDC A;  5J8Y A;  4CDG A;  1NZP A;  7ICV A;  4C7Y A;  4UAU A;  2W9A A;  4DQQ A;  8ICF A;  5ALP A;  4M04 A;  5TZV A;  4YMO A;  4DEZ A;  4UAZ A;  2Q4T A;  4DQI A;  1WWV A;  2BCS A;  4KLT A;  7ICP A;  3D2S A;  1T3N A;  2JEI A;  1ZQA A;  5KFE A;  3L3F X;  3RRG A;  4M9L A;  1TE2 A;  3BQ0 A;  4NY8 A;  1UA0 A;  1BPY A;  3AQF A;  3Q8R B;  4ED3 A;  4FZN A;  4JK1 A;  2ZTE A;  1HUO A;  5ALH A;  4UAR A;  2CPR A;  3F2B A;  2KEY A;  4QWD A;  3U26 A;  1XSL A;  1PK3 A;  4PH5 A;  8ICI A;  4QW8 A;  4YN4 A;  4MF2 A;  4UB5 A;  4FBU A;  3C23 A;  2W8K A;  3HIL A;  3E58 A;  4QZG A;  7ICJ A;  2VIX A;  4Y2R A;  3Q8L A;  3CNH A;  5AKI A;  3OTQ A;  2GO7 A;  1SKR A;  3PR5 B;  3KZX A;  5IIN A;  4O3P A;  4DO9 A;  3SZ2 A;  1YT3 A;  4LVS A;  3PO5 A;  2XO7 A;  4B9L A;  1MQ3 A;  3R9K A;  4NL9 A;  4DF8 A;  5K4L A;  1X42 A;  4RPX A;  4R64 A;  3ORY A;  2BPF A;  2KOB A;  1HUZ A;  1QLN A;  1KKX A;  5L9X A;  2A1A A;  3QUQ A;  4J9N A;  1BNO A;  2PXI A;  1NK4 A;  1XS9 D;  3BQ7 A;  3PW5 A;  1XWL A;  1KBU A;  2HOF A;  4NLG A;  3Q8P B;  2AHO B;  1ZD3 A;  5AK6 A;  4EBE A;  4RQ7 A;  2YML A;  1S77 D;  2ZIV A;  1Z4O A;  2Y1J A;  3AL0 B;  4BWM A;  5AM1 A;  3VC8 A;  1X9S A;  5DBB A;  2G08 A;  1MSW D;  1ZQX A;  4I2J A;  2AGO A;  1TAU A;  2Y9T A;  2H5X A;  3QX7 A;  5J2J A;  2I5H A;  2V4Q A;  4MEX A;  4ELT A;  2N1R A;  2KJ9 A;  4JMU A;  5EWG A;  4Q44 A;  5J2E A;  2JZB B;  1CEZ A;  4IRC A;  4RPZ A;  1D8B A;  3C29 A;  1FEZ A;  3T5L A;  4ECZ A;  5J2D A;  3UM9 A;  5AI8 A;  3IM1 A;  4F4Z A;  3PVX A;  8ICY A;  1MQ2 A;  1QQ7 A;  5H2F U;  5ALT A;  1NK8 A;  4KLU A;  4C8M A;  1NKE A;  1QSL A;  1KFS A;  3RJK A;  2BPC A;  2WFA A;  3GFK B;  3PV8 A;  4OO1 J;  1JX4 A;  3SAG A;  3BZC A;  4Q8F A;  1SL1 A;  5BOM A;  4EZ6 A;  3H4D A;  2A1J B;  5J2I A;  5KFL A;  4Y2Q A;  1B43 A;  1F0M A;  1UT8 A;  3M6Z A;  1MN8 A;  2ASJ A;  4RPY A;  3NVY A;  5KL1 B;  4J03 A;  3C2K A;  5DLG A;  4EEL A;  1LKY B;  2LHT A;  1ZQY A;  5J0Y A;  1UA1 A;  4QIW C;  4P0Q A;  4XA5 A;  3RJI A;  3IDW A;  4OJO A;  3JPN A;  1JRP A;  9ICM A;  2AQ4 A;  4P0P A;  1ZQV A;  5KL8 B;  3NS1 A;  1OXJ A;  4UBC A;  2ASL A;  3IP4 B;  5J0P A;  4MFC A;  3TFR A;  5KG3 A;  3GIL A;  4M9N A;  2HHU A;  1T8E A;  1TV9 A;  8ICC A;  3G6V A;  2YQE A;  1VDV A;  2XI9 A;  4C7Z A;  1Q3U A;  4EEY A;  4YXM A;  4DSL A;  3O0F A;  2JEJ A;  3LVW A;  3EYZ A;  4IRK A;  5KFF A;  2XVT A;  5GTH U;  3TKA A;  4CGZ A;  5L1K A;  4IQT A;  1L5U A;  1DGS A;  1IIP A;  2PFO A;  2E5S A;  1ZQI A;  3M8R A;  3V72 A;  1F5S A;  1SWW A;  1GO3 F;  5J29 A;  2XC9 A;  1PUZ A;  5AM2 A;  1S10 A;  2E1F A;  1KFT A;  4B9M A;  2HHS A;  3S6J A;  2E8O A;  3C5G A;  7ICU A;  1WWU A;  2W7O A;  2AJQ A;  4R66 A;  2BQU A;  2W9M A;  3ISC A;  3RR8 A;  9ICX A;  1ZQZ A;  1T4G A;  7ICE A;  3NRW A;  1PK1 B;  4PHP A;  1RZT A;  2JV3 A;  3T5K A;  1ZQL A;  4JV1 A;  5KG1 A;  2KIW A;  2NRX A;  1ZQS A;  4QIW F;  5AK3 A;  4M9H A;  3QYP A;  2J6U A;  1ZQD A;  3N7R C;  3BQ1 A;  2H3Z A;  3PO4 A;  5KNI A;  1H38 A;  2OH2 A;  4NLC A;  4PZO A;  3H0M B;  2KFN A;  1N5X A;  2F77 X;  7ICM A;  3WK8 A;  4XUS A;  3F5E A;  5KG0 A;  3GII A;  4FO6 A;  1Y88 A;  3CYM A;  1ARO P;  5CWR A;  2IOH A;  4Y2U A;  3IN5 A;  1NK0 A;  1V9P A;  4EX7 A;  2FMQ A;  4DFK A;  2F8K A;  2NRT A;  3ETL A;  4O3M A;  5AKH A;  1TFR A;  1Z00 A;  5KAI U;  3UXN A;  2FMS A;  4RQN A;  3ZI4 A;  3BJY A;  5ALD A;  2LM1 A;  2HBJ A;  5CP2 A;  2JGA A;  2KNJ A;  3SAH A;  1NJZ A;  1ZQN A;  3MFH A;  4WJ3 B;  3QNM A;  2R8H A;  4QZC A;  1L3T A;  5HHI A;  2RDI A;  2IA6 A;  2ZG6 A;  3GIM A;  4J9O A;  5KFI A;  4QWA A;  1K5O A;  9ICW A;  4K4G A;  2NV3 A;  1ZQJ A;  5J2H A;  2MUT A;  9ICQ A;  3QU4 A;  5AIA A;  3DEE A;  5CEH A;  1P7D A;  3OSN A;  1SZH A;  5CJ7 A;  1QTM A;  2FLP A;  8ICR A;  4F4K A;  4Y2S A;  4R63 A;  1IXR A;  4QWE A;  2F1I A;  3ZDB A;  2W04 A;  2FE9 A;  2ZIV B;  4GXJ A;  3BZK A;  3JPO A;  3L4P A;  2EAM A;  2F3N A;  4FS2 A;  2PFN A;  2IMW P;  5HP4 A;  2YMM A;  9ICC A;  2ZXH A;  2YB1 A;  5KAF U;  3TI0 A;  1DGJ A;  3PX6 A;  5AKK A;  1QSY A;  2NRV A;  4DL4 A;  4KX5 A;  3HT3 A;  1KL9 A;  2G5H B;  2BQR A;  4FFD A;  3SYZ A;  3K1Z A;  2WAQ C;  3QUB A;  3THV A;  5KFT A;  4IRD A;  1L7N A;  7ICT A;  7ICF A;  5HHH A;  4UB4 A;  1N5W A;  1S76 D;  4KX3 A;  1TKD A;  4P4P A;  4ZOH C;  3C2L A;  5DB7 A;  3TAN A;  2EQY A;  3QU5 A;  4RQ3 A;  1L3U A;  2EZZ A;  2MRL A;  4RNN A;  2LYA A;  4O3N A;  5L1J A;  2QAR A;  5ALS A;  5IIJ A;  1BPE A;  2KVC A;  2K4P A;  4US8 A;  1QCK A;  3E2E A;  3DDH A;  2P66 A;  2AXT U;  4QWC A;  2UVR A;  1LVH A;  4PL1 A;  4C80 A;  4KLH A;  4RQ8 A;  5AKX A;  2RLT A;  2RQ5 A;  5ALR A;  4RNO A;  4P0Q B;  4NV0 A;  3PNC A;  4QZH A;  5HMM A;  4MFA A;  5AI4 A;  3AEV A;  4YR2 A;  1NK7 A;  4QJF B;  1KRP A;  4EEN A;  2QB0 A;  3LYS A;  2M0N A;  4P0P B;  4CNQ A;  2KTQ A;  4O3O A;  4IC9 A;  1RM6 C;  4HAI A;  3SAF A;  9ICK A;  1Z4N A;  4KLJ A;  3KKA C;  2KIC A;  3HX0 A;  2DL0 A;  4Y2T A;  1RXW A;  2W9B B;  4EBC A;  3BQ2 A;  4KN4 A;  2WAQ F;  1ZQU A;  3QZ8 A;  3E0F A;  3QEB Z;  4R8U A;  1NJY A;  5J0U A;  3MR5 A;  2C2R A;  2RP5 A;  4F4W A;  3H8M A;  2JEF A;  1KQQ A;  2C2D A;  3BQT A;  4UB2 A;  1AQ6 A;  4Z6C A;  5DGB A;  5DB8 A;  2E1E A;  3QUC A;  4OCZ A;  1SXE A;  9ICT A;  2YMP A;  2UVV A;  5J0R A;  4IL6 U;  4XRH A;  7ICI A;  4CF3 A;  4F71 A;  3JPT A;  1NJW A;  2JRZ A;  1SL0 A;  1COO A;  3RTV A;  4DF4 A;  2XCA A;  2DKZ A;  5ALX A;  3WK6 A;  4CE6 A;  3MFI A;  5AIB A;  1L7M A;  2E8P A;  2XY5 A;  4BXO A;  2DBY A;  1ECW A;  2DPI A;  3I1Y A;  1UQV A;  3PW0 A;  4PJ0 U;  2KKV A;  4NM2 A;  1L6N A;  5ALF A;  4RT2 A;  9ICO A;  2ASD A;  2LM4 A;  4EYI B;  4I2A A;  7ICN A;  3LWM A;  4ZH4 A;  5J2F A;  4F72 A;  2YN4 A;  3KD3 A;  4I2B A;  9ICI A;  4QZF A;  5KG6 A;  5AM5 A;  1VLB A;  3QU9 A;  2XID A;  3KHL A;  2VA8 A;  5ALE A;  3QEA Z;  5D46 A;  1XNS A;  2KKP A;  1XSN A;  5KFR A;  4I2H A;  5HR6 A;  1QQ5 A;  2EAN A;  5EOZ A;  2ZUC A;  4IS7 A;  1Z00 B;  2IBK A;  1L7O A;  2PFP A;  1U48 A;  3SEN A;  4P2H A;  2H3I A;  1NK9 A;  2CXY A;  2YX8 A;  4J9Q A;  2K4E A;  1NKC A;  3QXG A;  2ODG A;  2WB1 C;  2ZTD A;  5KFY A;  2MA1 A;  1NKB A;  4Z6D A;  8ICM A;  2W11 A;  2LI6 A;  2B6G A;  2MUT B;  4KTQ A;  8ICG A;  1ZQG A;  1RXV A;  1SZP A;  4TQR A;  4F4Y A;  2D6F C;  3RFA A;  4PHE A;  2FPM A;  5EE9 A;  2W03 A;  2XGQ A;  3ZDE A;  8ICE A;  3NVW A;  2BHN A;  2HSZ A;  4JB3 A;  3MDC A;  1ZQO A;  1MA7 A;  3GU3 A;  4TUS A;  2HW3 A;  2E8N A;  1S5L U;  3GIK A;  2ZTC A;  8ICH A;  1L3V A;  1N56 A;  2M9N A;  4JV0 A;  5KFK A;  3KTQ A;  3QU2 A;  1IG6 A;  4FBT A;  1X9M A;  3QE9 Y;  4P4M A;  1S0V A;  4GLX A;  3V6K A;  1CUK A;  1ZD4 A;  2K8C B;  2Y0S C;  5ALN A;  3GDX A;  2OHF A;  5JTI A;  5KFJ A;  5J0O A;  3PSF A;  8ICN A;  4QZ8 A;  2VA2 A;  3KKA A;  2WTF A;  4QWB A;  3V6H A;  2AQ0 A;  4DFM A;  2KZ3 A;  4F5N A;  3C1Z A;  4YP3 A;  3WKC A;  1QH9 A;  3OHB A;  4KLL A;  2KE7 A;  3TQ1 A;  3RH4 A;  2WB1 F;  5CR0 A;  4UQG A;  3QZ7 A;  1ZD2 P;  5IIL A;  3GV7 B;  4USA A;  5DG7 A;  2OM6 A;  5TIS U;  5KG2 A;  5JRT A;  1SB3 C;  4EBD A;  3MR6 A;  3OJU A;  1O08 A;  1M6Y A;  3F2D A;  3K1R B;  1JRO A;  1J97 A;  4GC6 A;  4J9S A;  4JUZ A;  2JXJ A;  4F5O A;  1U47 A;  1NI3 A;  3FC4 A;  5DLF A;  2AGQ A;  5F3X B;  5KT6 A;  5B5E U;  8ICB A;  4DFJ A;  4ECV A;  1B0X A;  2NRZ A;  1HEK A;  3RH6 A;  8ICL A;  2PI4 A;  1WUD A;  3NVZ A;  5AK4 A;  5AKY A;  2QKQ A;  3F53 A;  4EYH B;  3H8W A;  2QB0 B;  1L7P A;  4HYK A;  4F4X A;  3T5J A;  2IHM A;  2Y0S F;  2ESE A;  3MGV A;  2KMD A;  8ICK A;  1X40 A;  2FMP A;  3SI8 A;  5ALW A;  2PI5 A;  4UAS A;  3H7I A;  2K8B B;  2W43 A;  1TAQ A;  1V85 A;  5KFV A;  4RQ5 A;  4R8U B;  2W54 A;  1D9D A;  3HRD D;  1J2N A;  8ICJ A;  1TK0 A;  9ICN A;  5AKE A;  2UVW A;  3WK9 A;  2RHF A;  5J0T A;  1ZYQ A;  8ICO A;  3J81 j;  1T7P A;  3JPS A;  4LJX A;  2FPL A;  7ICL A;  1Z3E B;  5HR7 A;  3WK5 A;  4DOC A;  2DFL A;  1BVS A;  1A77 A;  4GXK A;  4O9M A;  1U45 A;  9ICG A;  1OUQ A;  4DSE A;  4DS4 A;  2BCR A;  2BCV A;  4JWM A;  4G3I A;  3LVV A;  5CA7 A;  4RQM A;  1ED1 A;  1NZB A;  2MAX A;  5ALQ A;  4BXO B;  2NRW A;  2ZIW A;  1RDF A;  2R8I A;  5ALK A;  3FM9 A;  4Y2X A;  2PFQ A;  5DG9 A;  3WK7 A;  2R18 A;  4UB1 A;  5J2G A;  2VAN A;  1L8O A;  5KFC A;  2ZUD A;  3FYH A;  4ECW A;  4MHV A;  2NO4 A;  1Z1V A;  4QW9 A;  4DL7 A;  4DSK A;  4DL2 A;  4O3R A;  3EUB 2;  4QZD A;  4Y2Y A;  5DGA A;  3BS5 A;  4UBB A;  3ISB A;  3PMN A;  3PSP A;  2ZJA A;  4O5K A;  2H3Q A;  1UT5 A;  2FI1 A;  1ZQM A;  2KN7 A;  3MR2 A;  3UMC A;  1RQL A;  4DSF A;  1WCL A;  3UXP A;  2QB1 A;  4EX6 A;  4C8N A;  5AI9 A;  8ICT A;  4OJP A;  4F93 B;  1ZRM A;  3HPO A;  1ZQ1 C;  5EE0 A;  4UAV A;  2WF8 A;  5KG5 A;  2BR0 A;  2RRD A;  2DF4 B;  3PR4 A;  5EE1 A;  5DB6 A;  4I2F A;  2AGP A;  1L3S A;  1PVR A;  2KHV A;  2ALZ A;  1WG8 A;  4UB8 U;  3PSI A;  3KHH A;  3KZI U;  3ZDD A;  2P35 A;  1PZN A;  3B0X A;  3D2Q A;  9ICU A;  4OJ5 A;  4I2I A;  4O3Q A;  4U7C A;  3PW4 A;  2EAP A;  4RQ0 A;  5KFD A;  1SWV A;  2CRX A;  1UPH A;  1KW4 A;  4EZ9 A;  4J9R A;  5KT5 A;  5JU5 A;  2F1H A;  1ZXI A;  3SR6 A;  3L5K A;  3M9O B;  4PGQ A;  1SIJ A;  4DS5 A;  4B9V A;  5KFG A;  4PPX A;  3N28 A;  2PKE A;  1XO1 A;  4BJQ A;  5KTQ A;  2BGW A;  3CRX A;  4DLE A;  3FAH A;  3A0B U;  9ICS A;  4BWJ A;  4IQV A;  3M8S A;  5DG8 A;  2HVI A;  4B6J A;  4M9J A;  2D8C A;  5GTI U;  7ICO A;  5ALU A;  1XSP A;  4ED7 A;  3OPX A;  4LZG A;  4UW9 A;  4BGD A;  3UMG A;  1MC8 A;  1J2M A;  4YD2 A;  5DQI A;  1ZQF A;  4PL2 A;  3SMV A;  2HHV A;  9ICP A;  4CRX A;  1PVP A;  3I76 A;  2W55 A;  2ZJ8 A;  5J0S A;  4DCC A;  4RUA A;  3BS7 A;  3WKA A;  1ZD5 A;  2VJ5 A;  4Y2J A;  5AKL A;  4NXZ A;  4YR3 A;  4Q8E A;  3H4B A;  4GIB A;  8ICZ A;  4M9G A;  2HBM A;  5ALG A;  1T94 A;  1YZ6 A;  3EPI A;  2BPG A;  1BPX A;  4J9L A;  2AH5 A;  1DK3 A;  4QZA A;  1C20 A;  1URJ A;  4YVZ A;  4NM1 A;  4C8O A;  3KBB A;  1ZQP A;  2W9C A;  4GXI A;  1TK5 A;  3G6X A;  2K4I A;  1ZQT A;  3SD7 A;  4ED6 A;  4ECX A;  3UQ2 A;  2G06 A;  3D6J A;  2L5Y A;  2R8K A;  2R8J A;  2IOF A;  5L1L A;  5JUM A;  2IOF K;  3IHQ B;  7ICH A;  1WYG A;  2E3T A;  3T79 A;  3K4G A;  3G6Y A;  4US9 A;  2KD1 A;  3TAD C;  3NGD A;  3D2N A;  1SV4 A;  5KFN A;  5D49 A;  4F50 A;  4U6P A;  2XGP A;  4RQ4 A;  7ICQ A;  4R65 A;  2HOI A;  4KMO B;  4J9M A;  2LYH A;  4M47 A;  4ECQ A;  2GH1 A;  5AIC A;  3HKZ C;  3GV5 B;  1ZQB A;  3KFU F;  4RQ2 A;  4KLE A;  2HI0 A;  1FFV A;  2K89 A;  5AKG A;  1S8O A;  1OW5 A;  1ZQK A;  1UCV A;  4K4I A;  5G5G A;  2W8L A;  5ALM A;  2K8A A;  1A6S A;  5CHG A;  1SKS A;  2HHQ A;  2XCP A;  4ECR A;  4C4S A;  1ZET A; 
#chains in the Genus database with same CATH homology
 2QKQ A;  1SV0 A;  1COK A;  4RQN A;  2QB0 B;  2QAR B;  2KSO A;  1JI7 A;  1DXS A;  2Y9T A;  2DKZ A;  5J8Y A;  2DKX A;  2ESE A;  2KMD A;  2QB1 A;  3BS7 A;  1X40 A;  2E8P A;  1WWV A;  2QAR A;  1UQV A;  1V38 A;  2K4P A;  1V85 A;  1LKY A;  2GLE A;  1RG6 A;  1SV0 C;  2F44 A;  3TAD A;  2LMR A;  3SEI A;  5JTI A;  3KKA A;  5J8Y C;  2E8O A;  2E8M A;  1WWU A;  1SXD A;  2KIV A;  2L5Y A;  2QB0 A;  2KE7 A;  1PK3 A;  2EAP A;  1PK1 B;  2FE9 A;  3BS5 B;  2EAN A;  2K60 A;  2JV3 A;  4IS7 A;  1KW4 A;  3TAD C;  3HIL A;  2D3D A;  2EAO A;  1SV4 A;  1X66 A;  1X9X A;  3SEN A;  5JRT A;  5JU5 A;  2EAM A;  2KSO B;  2F3N A;  3KKA C;  2DL0 A;  2ES6 A;  2Y9U A;  4RQM A;  2KG5 A;  2LPE A;  1F0M A;  3K1R B;  4PZN A;  4NL9 A;  5KNI A;  4PZO A;  2B6G A;  2YTU A;  3H8M A;  1OW5 A;  1LKY B;  1SGG A;  1UCV A;  3BQ7 A;  5F3X B;  2D8C A;  3IDW A;  1B4F A;  1SXE A;  4MHV A;  1Z1V A;  3TAC B;  2F8K A;  1PK1 A;  4NJ8 A;  4NL9 C;  1B0X A;  3BS5 A;  2E8N A;  5L1M A;  1OXJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...