1PK1A

Hetero sam domain structure of ph and scm.
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
68
structure length
68
Chain Sequence
PPISSWSVDDVSNFIRELPGCQDYVDDFIQQEIDGQALLLLKEKHLVNAMGMKLGPARKIVAKVESIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription repression
molecule keywords Polyhomeotic-proximal chromatin protein
publication title Structural organization of a Sex-comb-on-midleg/polyhomeotic copolymer.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 19
structure length 68
sequence length 68
chains with identical sequence C
ec nomenclature
pdb deposition date 2003-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07647 SAM_2 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 1pk1A00
1PK1B 2DKXA 3HILA 4MHVA 2EAPA 2JV3A 3SENA 3TADA 1OW5A 2EANA 1F0MA 4PZNA 2Y9TA 5KNIA 1PK3A 3SEIA 5J8YA 1COKA 1B0XA 1X66A 2QKQA 4NL9A 2QB0A 3BS5B 4IS7A 1WWVA 4RQNA 3TADC 1X40A 2GLEA 2DL0A 2E8NA 2KMDA 2KSOB 2QB1A 2D3DA 1OXJA 2KIVA 1SGGA 2E8PA 1V85A 2LPEA 1LKYA 2YTUA 1B4FA 2B6GA 4NL9C 1SV4A 5JTIA 1KW4A 1SV0A 2ESEA 2K4PA 4NJ8A 5L1MA 3BQ7A 2FE9A 3KKAA 1RG6A 1SXEA 2L5YA 2F3NA 1UQVA 2EAOA 2EAMA 2QARA 2D8CA 2LMRA 1DXSA 1PK1A 2QB0B 5J8YC 5JU5A 1SV0C 1UCVA 1JI7A 2E8MA 5F3XB 2F44A 3IDWA 1X9XA 3BS7A 1LKYB 2KG5A 5JRTA 3K1RB 2KE7A 1SXDA 2K60A 3BS5A 1V38A 2E8OA 3H8MA 3TACB 1WWUA 2F8KA 2Y9UA 1Z1VA 2DKZA 2ES6A 2KSOA 4PZOA 3KKAC 4RQMA 2QARB
chains in the Genus database with same CATH superfamily
5L1LA 3ORYA 1Z3EB 3NVVA 1KDHA 4DWIA 4AP9A 2PI4A 2AU0A 4PJ0U 1QSLA 5KNIA 2WF8A 1KFTA 4DS5A 5AM0A 8ICQA 3WKBA 4YD1A 4UB6U 5KFAA 9ICNA 1D9DA 1U48A 5KFIA 3Q8PB 1SGGA 2E8PA 3SD7A 2F1HA 2FLNA 1QSSA 9ICTA 5AI6A 1KSPA 2B21A 1XWLA 3FDSA 4ECXA 4UB3A 2ESEA 1QLNA 4ACOA 4AYBC 4ECSA 4ECQA 5J0QA 2EH9A 5HR7A 7ICVA 2FDRA 1TKDA 1WUDA 3KKAA 1KBUA 1Z1BA 1KRPA 1NK9A 4P0PA 1ZD5A 1T7PA 5ALQA 2AGOA 9ICSA 5AM2A 5AIAA 3TI0A 4P4MA 2F1JA 1ECWA 4Y2VA 4ED8A 5IIOA 1XO1A 3V7KA 3QU4A 5DQHA 3PW5A 4M04A 3ISDA 2FJ6A 3QU2A 2W7OA 5ALRA 4B6JA 1BPYA 1N5XA 5ALJA 5CP2A 3L5KA 2BZFA 4F5QA 4RQ6A 4C8LA 4QZ8A 4RQ4A 4QJFB 4P0PB 2ZIUA 2W7PA 3M1YA 3PX6A 4IR1A 4ZOHC 4HYKA 3S6JA 1FFUA 1DOQA 3G6VA 4IC9A 5C5JA 3MBYA 5CRXA 3D2SA 3M9MB 4YR2A 1X66A 4B9MA 3AN1A 3KD3A 2W9AA 3MR3A 2HVHA 1XSLA 4JB3A 3PW4A 1SKRA 1ZD4A 1MC8A 3UMCA 3MDCA 2P6UA 1V85A 2LBOA 1LKYA 1TVAA 2IOFA 5KFUA 4GXJA 2ZIUB 2WB1F 3H0LB 4YR0A 2Q0ZX 2C2DA 4NJ8A 4Z6CA 4IQVA 2QLTA 5AKZA 2VA2A 2UVWA 5KT6A 2HHSA 1Z4OA 3QUCA 2ZTEA 9ICBA 5ALXA 2G0AA 3IV6A 3OTQA 2D8CA 2I6XA 3WK8A 4EX7A 1L3TA 4J9OA 4OJLA 3PW2A 4F92B 1L7PA 3T5LA 5EOZA 4ED1A 2HVIA 9ICMA 1SB3C 3UXNA 1J2MA 1LKYB 7ICGA 1L7OA 3BZKA 3F2DA 5JRTA 4KLGA 1ZQHA 3K1RB 4B9NA 3TKAA 2VKQA 5ALEA 2V4RA 4F72A 4QWBA 5CJ7A 2ALZA 1XC9A 1ZETA 8ICVA 4UB5A 3VCBA 3OGUA 1ZQTA 2DKZA 5CA7A 3HJEA 3AMZA 1S0MA 2GOLA 1BGXT 4Y2PA 5KFWA 4RQMA 3T5KA 2XCAA 3RBEA 2HOFA 8ICLA 3ETRA 3UXPA 3QU5A 1NJXA 1HUOA 7ICSA 3TADA 4IRDA 3RH4A 1XSPA 1UA1A 2N1RA 4FZNA 3GDXA 4PHAA 4RZRA 5HMMA 1Z4NA 1B0XA 1ZQUA 4RNNA 4NLZA 1NKEA 3HT3A 4NL9A 5D49A 1K1QA 1KL9A 5KG4A 5L1JA 4NLNA 1ZQEA 1CUKA 2KTQA 2W8KA 4KX5A 8ICPA 1OXJA 2AQ0A 1N56A 3RH6A 4UAYA 3QU7A 2KFNA 8ICKA 4QZBA 3C5FA 3WKDA 1NK0A 3LWMA 4Q8EA 1KEJA 4QZGA 1ZQPA 1WCNA 4C8KA 3TANA 2WF9A 3EWAA 2ZTDA 1D8YA 3QEAZ 2BDPA 1QQ7A 2DQNB 2L5YA 3C1ZA 1K1SA 2RDIA 3C2MA 3H7IA 3C5GA 5AI8A 3JPTA 5ALIA 5J0UA 3OPXA 3DEEA 1X2IA 1B43A 5J2IA 4OJ5A 1HIWA 3V7JA 5KT7A 5KT2A 2DF4B 3E0FA 4BJQA 3PZPA 3C21A 2HW3A 9ICCA 4YXMA 3ZDCA 3NVWA 3TAQA 2B0CA 3AL0B 2PKEA 4DLGA 1M6YA 3NASA 2G09A 8ICAA 2DKXA 4F4XA 4QIWF 3BZCA 2DPJA 5KFPA 2BKEA 3M8SA 5EE3A 4HAIA 1RXVA 7ICUA 4TURA 4FS2A 4IR9A 4DFPA 2VIXA 3D2NA 5J8YA 5AM4A 4R8UA 1QCKA 2NRWA 2EQYA 4C8OA 4MEXA 2JRZA 8ICTA 3N7SC 4DL2A 1A6SA 2QB1A 4O3MA 2WB1C 3PSIA 3N7RC 1LB2B 5J2KA 2V9WA 1NKBA 2W8LA 2K4HA 3EYZA 4YCXA 2KHVA 4DL5A 4USAA 5DB8A 4CF4A 4M2YA 4IQWA 4UB4A 1SV0A 4CGZA 1ZQ1C 3UXOA 4Y2YA 3NRZA 1JIHA 3GV8B 3ZDEA 3QE9Y 2KOBA 2HCFA 5KAIU 5AI5A 9ICGA 2EAOA 5KG3A 9ICFA 1J97A 2HSZA 4R8UB 1DXSA 2J6UA 4O9MA 4OO1J 3RRGA 1FEZA 3GQCA 2HBJA 4UAWA 4CE6A 3BQTA 4I2JA 3AEVA 4C0ZA 1NK4A 4AYBF 3M6KA 4RU9A 4Q43A 4PHPA 4J9QA 1NK5A 4RPYA 1S97A 1SKWA 2W54A 3RJJA 1D8BA 2KZ3A 3DDHA 2H3VA 4QZEA 4Y2SA 4O3NA 3KZIU 3ZDDA 4RPZA 5KFGA 1IG6A 5T14A 5F9NA 7ICIA 3T5JA 3Q8KA 4U6PA 3ONNA 2KZMA 2YMQA 3QNMA 3FAHA 4Q45A 4M9LA 2PFNA 8ICHA 3B0YA 4PZNA 1Q8KA 3MABA 1T8EA 4KLEA 5IIIA 2LM1A 3H8SA 1SZHA 5KT3A 2QB0A 3AUOA 1NJYA 4RQNA 4RPXA 2JEIA 3C1YA 5DDMA 2HOIA 3V7LA 3E2EA 5ALTA 5DLGA 4F50A 3G6XA 4P2HA 2FI1A 4XA5A 4YVZA 1N2XA 5JTIA 9ICEA 3QX7A 4Z6FA 3Q8MA 5AKKA 4PHDA 2KJ9A 4C8MA 5CWRA 3PSPA 2IHNA 2VA3A 2ZUDA 4I2HA 4I2GA 1IIPA 2UVVA 4K4HA 3EZ5A 5IIJA 3PX4A 3F5AA 3SAHA 2QB0B 4QWEA 1COOA 5HHIA 2MAXA 2YY6A 5KT4A 3LK9A 1AROP 3O0FA 4M6WA 2JMGA 4ELUA 4JV2A 3DV9A 3JPOA 4ICAA 2Y1JA 2C28A 5KFQA 4DQIA 4O0IA 1IV8A 4Z6DA 4KLFA 8ICRA 2W11A 1WG8A 3ED5A 2NRVA 5KL1B 5H2FU 5IIKA 4F5OA 2ES6A 3IP4B 3THVA 7ICFA 3WK6A 4Y2RA 4RT2A 3Q8QB 3L4PA 1XS9D 4US8A 5KFZA 4EELA 3HILA 1PZNA 1ZQRA 4F3OA 3LWLA 4IRKA 5J0OA 4M6WB 1JN3A 2DFLA 2K4EA 4DFKA 1BPEA 5AK5A 2C22A 5EE1A 4GXIA 1ZOLA 4IRCA 2I5HA 2ISPA 4JK1A 1NOMA 3PO5A 4U7CA 1UT8A 5EWFA 1ZJMA 4Y2UA 2P6RA 5AI9A 9ICLA 2A1JA 3EW9A 5AI0A 9ICQA 2LHTA 4X5VA 3ALRA 3TADC 4C4RA 5KFJA 2Y1IA 2IOHA 1TK0A 8ICWA 3F2CA 4B9VA 1D9FA 3F53A 1ZQZA 3UQ2A 4ZH4A 4ECWA 4NL9C 4QZCA 4TUPA 3C23A 4JV0A 1KW4A 1A0PA 1WCLA 4PH5A 3QEBZ 3IG8A 1HJPA 1XSNA 2BCUA 4DLEA 4ELTA 9ICUA 1O03A 2KKPA 4YFKA 2MU2A 3IN5A 3UM9A 4RQ3A 4F5RA 4O5KA 4EZ6A 3BJYA 1RYUA 2WHEA 2A1JB 2W9CA 4EENA 4I2DA 4UB2A 2KJ5A 2WTFA 3IDWA 5J2GA 2YX8A 2K89A 5J0WA 3WK4A 1Q3UA 4M9GA 1S5LU 4I2CA 3SMVA 5ALWA 2JGAA 4O3RA 1O08A 4YMNA 3SV3A 3H0MB 1WWUA 1F44A 4BWMA 1SKSA 5AM5A 2KN7A 2XY7A 2LI6A 4QZIA 3WK5A 2ZUBA 2YB4A 4GC7A 4J9SA 3KHRA 3ZI4A 4LZGA 2WF5A 8ICNA 2PMZC 1ZQOA 3H8WA 2W9CB 4DS4A 2FLPA 4CNQA 1RYRA 2KK0A 4JWNA 3PNCA 1PUZA 1NZBA 3MGVA 2BCRA 1XO0A 2PFOA 5KTQA 3CNHA 4KLHA 4UQGA 4K4IA 2ZJAA 4KLSA 1LVHA 3V72A 4BWJA 4EEKA 5KFEA 2R8IA 1T94A 4G3IA 3RH5A 3JPPA 9ICOA 3PVXA 2KMDA 2D3DA 4NM2A 4DQQA 3NGDA 7ICJA 2E1FA 2C2EA 2A1AA 2C2RA 4DL7A 4KLIA 3RB3A 5KG2A 1JX4A 4DSEA 4F5PA 3H8JA 2JEJA 1YZ7A 4PHEA 2XO7A 2FE9A 5J2BA 2F2AB 4XRHA 2ZIWA 4GFJA 1YT3A 5DB7A 3KHHA 1T3QA 2JH7A 3RAQA 2LMRA 4UB8U 1SV0C 2NO4A 5AKEA 1TAUA 4DO9A 5L1KA 7ICPA 2LYAA 5DGBA 4DOBA 5FP0A 1ZQLA 1MSWD 2R8HA 1JROA 2CRXA 5HR6A 1J2NA 5KT5A 1PVRA 4OJ6A 3SZ2A 4BX9C 4WJ3B 1V38A 2E8OA 2EZXA 5ALUA 2HBKA 4C4TA 2BGWA 2LKYA 1VDVA 1BVSA 2ZIWB 4F91B 5KG1A 5ALPA 4DL4A 3K75D 2YQEA 3QUQA 2WF6A 3Q8SB 5L9XA 4CRXA 1L3UA 5CEHA 3QUBA 2HBLA 1F0MA 2VANA 4LVSA 4KITB 1RYSA 4ECUA 1TK5A 7ICQA 2QKQA 3PW0A 4UATA 2DBYA 2GLEA 2HHUA 2K8CB 2I1QA 2EDUA 1KFSA 4IL6U 5GTIU 1YZ6A 4DL6A 4NY8A 3SR6A 4UAUA 5L1IA 1IXRA 1RQNA 5DKWA 4ED6A 4OCZA 2V4QA 1F5SA 1URJA 2OYYA 3H4BA 2DUYA 4O3OA 4Y2TA 4Z6EA 1N63A 2YN4A 1D8LA 3ICXA 2QARA 3ZDAA 2W03A 2IMWP 2UVUA 4KLMA 2E8MA 2PI5A 2R18A 5F3XB 3KBBA 5ALZA 4R63A 5IILA 3SAFA 3D2QA 4UBCA 4ED0A 5J0RA 2E1EA 4DFDA 2RLTA 2XY6A 2KZZA 2GH1A 5B5EU 2K8BB 3B9JA 4BGDA 3UMBA 3K4GA 2XCPA 3AU2A 2Y9UA 2BQ3A 2KSOA 2RQ5A 4MF8A 1JMSA 4XUSA 1H38A 3WKCA 2QARB 2J6SA 3MR6A 4KMOB 2FMQA 1TK8A 3MR5A 1ZQBA 1ZD2P 4PL1A 4MFCA 5DG7A 3QU9A 5DBCA 2JV3A 9ICRA 5AK6A 1SZPA 1B22A 4NWIA 2EANA 2HBMA 2CPRA 3PX0A 2F1IA 2H3ZA 3D6JA 2ZXHA 3J81j 1TAQA 4EYIB 5DGAA 4KN4A 4DF4A 3F5EA 3MGHA 4FE3A 2A3VA 4NM1A 3FC4A 3CP8A 3GIIA 2KSOB 1KFDA 3MR2A 4O5CA 5KFDA 4TUQA 3BDPA 1ED1A 2YTUA 2Y0SF 7ICKA 3Q8RB 4KLJA 3Q8LA 1BPXA 5B66U 1HEKA 4C8NA 3A0BU 9ICHA 3U26A 5L1MA 3BQ7A 1HUZA 4Q8FA 1FIQA 3R9KA 1T4GA 3GILA 2XICA 4J9KA 3MC1A 2HOQA 4P4PA 5AK3A 3IM1A 4KLQA 4KTQA 3NRWA 4I2IA 2KEYA 1ZQSA 3KOOA 3LVVA 3CW2C 1NKCA 3MDAA 2XIDA 4KLTA 2HHQA 1KKXA 3BS7A 5G5GA 3L3FX 3ZD9A 5KFMA 1UT5A 4PPXA 8ICJA 4CF3A 1SXDA 4RT3A 4K4GA 2KP7A 4RQ8A 1U47A 1X6IA 1S0NA 1ZQWA 1SL0A 3TACB 2ISOA 3T3FA 2F8KA 2G07A 2YMLA 4F2SA 1U4BA 1L5UA 3GIKA 4O5EA 2Q4TA 3NVZA 5KFVA 1ZQDA 3KKAC 3GV7B 4KLOA 9ICXA 1CEZA 4OJOA 4QW9A 5KG5A 4I2EA 3QUTA 4P0QA 4EBDA 5KG0A 5J0XA 4GLXA 2ZIVA 3SENA 2P35A 4NV0A 5KAFU 2WF7A 1SIJA 7ICEA 3QZ8A 4O3QA 1NK8A 3N28A 3N97B 1COKA 1U9LA 3GIMA 5ALKA 5J2FA 2VA8A 4YXJA 4R64A 2ZIXA 3C29A 3RB0A 2E8NA 1ZQIA 2KIVA 5BOMA 1ZQYA 1ZRMA 2PMZF 3EPGA 4B9UA 2ODGA 5ALOA 4P0QB 1S9FA 3I28A 1Z19A 2K4PA 2IHMA 2ZIVB 3RBDA 4KX3A 1S0OA 4DOCA 2MUTA 3RAXA 2BCVA 3BQ1A 4J9MA 4YN4A 1SXEA 1KLNA 4J9LA 3N4MB 1NNLA 5D46A 3RR7A 2IOFK 2P66A 2EAMA 2XVTA 2AGQA 1ZXIA 5ALNA 7ICRA 5J2HA 4RUAA 5C0YA 5KFYA 3RB6A 2G06A 2ZIXB 2F44A 1TV9A 4IQTA 2OHFA 3FM9A 3KHGA 1X42A 9ICPA 4DSLA 2Z7JA 2HMXA 3OSPA 4F93B 2KV2A 1NZPA 5KFCA 7ICMA 1WYGA 2MUTB 3M6ZA 3NVYA 5ALFA 1Z1VA 1NK7A 1CRXA 5AKHA 4P4OA 4US9A 5J29A 2H5XA 4DQRA 1BPZA 4TUSA 2W04A 4RQ2A 3PMLA 5AM1A 2EZYA 2H3QA 1ZQMA 2BQUA 5DB9A 2JZBA 2W9MA 9ICAA 2JXJA 2M0NA 4Y2XA 2GWSA 2HHXA 5J2EA 1LV5A 4DSKA 4J9NA 1JXEA 1RPLA 3HKZC 1SWWA 2AJQA 5KG6A 3T5HA 2KNJA 3E58A 4PL2A 2NRXA 1X9SA 5AICA 4TQSA 4FS1A 1EXNA 3F2BA 2Y0SC 4XQ8A 3RRHA 3QYPA 1ZQGA 4Y2QA 3EUB2 1B4FA 2FMSA 1ZQNA 2YMMA 5J2JA 3ETLA 5HHHA 3PMNA 2XGQA 1MQ2A 1C20A 3PSFA 2JZBB 3ZD8A 1Q3VA 2HI0A 3V6KA 1Q46A 4QZFA 4RQ7A 5JU5A 2FPLA 1JI7A 3AU6A 2K8AA 4EX6A 1N62A 2G08A 4UARA 4FFDA 4BUGA 2D6FC 2W3SA 1RDFA 5CHGA 5AKXA 2RP5A 4EZ9A 2E5SA 2KE7A 1A76A 4KN7A 1X9WA 1ZQVA 4I29A 4I2AA 1NJWA 4TQRA 9ICJA 3RJGA 9ICIA 2CN1A 2XGPA 9ICWA 3BQ2A 2KJ8A 1PVPA 2HDOA 1IM4A 1RZTA 4KMUA 3IG5A 2FMPA 2KICA 3HX0A 1L3VA 4M0AA 4FBTA 2RHFA 1OW5A 1ZQKA 4EBCA 7ICHA 4GC6A 4ECTA 2G5IB 3SEIA 2G5HB 2W3RA 1DGSA 4ELVA 2AGPA 1WWVA 4J9PA 1XNSA 2DPIA 1DRGA 1X40A 4MEYA 3UQ0A 3M7DA 1RQLA 5ALMA 1S0VA 1C7YA 8ICUA 3SV4A 1MN8A 5TISU 4B9TA 5BOLA 1Y88A 3ZDBA 1BPDA 1UPHA 3QXGA 3TQ1A 1S77D 2KFZA 4NXZA 8ICZA 2IA6A 2H3IA 4NLBA 3NUQA 3PR5B 3H4DA 4QWDA 3RFAA 2NO5A 5KFBA 4QZAA 3GIJA 3ISBA 2H3FA 3TAPA 5J8YC 1ZJNA 4F8RA 1N61A 2LYBA 4DEZA 2PFPA 3OSNA 3OHBA 5ALSA 4UASA 4DSIA 3HP6A 2KG5A 5KFHA 2FPKA 2RDJA 5JUMA 5J0PA 3T79A 4B9LA 2NYVA 5AKLA 2OCEA 3JPSA 5EWEA 2HHVA 5KFFA 1P7DA 1U49A 4DCCA 3JPQA 8ICIA 4FZLA 2BPFA 4C4SA 4C7YA 2MRLA 4J03A 3JPNA 4RNMA 4FZMA 3OJUA 4ED3A 2ASJA 3PW7A 2EAPA 2OXOA 2ZXIA 3SAGA 5KFLA 1PK3A 3KFUF 3SQIA 5CR0A 4UB1A 2JEFA 4C80A 8ICBA 1OUQA 4QZ9A 4JMUA 3KTQA 3NS1A 4EEYA 3OJSA 4CDGA 4YMMA 4F5NA 1ZQCA 2PFQA 1N48A 2J6TA 3HWTA 3RJHA 4QWAA 2WAQF 2OWOA 2MSNA 3CRXA 5AKYA 4M9JA 4QZHA 5KG7A 4DF8A 5EE0A 5EE9A 3KZXA 4NLKA 1U45A 5AKIA 3HPOA 4JWMA 5AI4A 4RNOA 5HMLA 1L8LA 2DWQA 4I28A 4RQ0A 4F4KA 3GV5B 1DK3A 3C28A 5J2CA 3G6YA 4M47A 3RTVA 2BQRA 4KLLA 7ICTA 3N7PD 4YD2A 2BR0A 1S10A 2YMPA 2AH5A 4M9NA 5AKJA 2JHDA 3TFRA 3RR8A 1ZD3A 4FBUA 1L3SA 4YMOA 3WKAA 4DSJA 4Q44A 5J2DA 5ALVA 4UW9A 4I27A 2LM4A 4E0DA 1A77A 5AHXA 2W43A 2KVCA 3AQEA 5TZVA 5BPCA 4QWCA 5D4BA 5DB6A 1VJ5A 3GFKB 1L7MA 3I76A 2PXIA 3IHQB 2BCQA 2GO7A 1ZQJA 2Y9TA 5IINA 2HHWA 2W9BA 4DQPA 1JUDA 4LJXA 3V6HA 3NTUA 4UAZA 3C2KA 3B0XA 4I2FA 4ED2A 4IS7A 5ALGA 4O3PA 4R65A 3PSTA 3WKEA 2O6KA 3RJFA 3RB4A 4EBEA 2AQ4A 4YG2A 3WK9A 4BDPA 2LPEA 2BHNA 3AQFA 5AM3A 2B6GA 5DBAA 1DGJA 5J0TA 4F4ZA 1KQQA 3LVWA 4NLGA 4F4YA 5J0YA 5DLFA 2ASLA 1MA7A 5ALHA 7ICNA 3LYSA 4DOAA 3MFIA 1RG6A 1VLBA 1ZYQA 1ZQAA 2LYHA 3RJKA 2W9BB 3UPQA 4QZDA 3HKZF 4PGQA 3M9NB 1N5WA 2OEHA 1PK1A 5A0LA 8ICOA 1L8OA 4B9SA 8ICSA 3GU3A 3WU2U 5F9LA 4DSFA 1JRPA 1DK2A 4OD0A 5EWGA 1JXLA 5ALYA 4O3SA 4DQSA 2JR5A 3ISCA 2KIWA 8ICXA 3PO4A 3RF9A 3GZFA 4Y2JA 2AHOB 3V6JA 3MFHA 3BS5A 4JV1A 4DFJA 2ZJ5A 1ZQXA 2R8GA 2K4IA 2M9NA 2CXYA 4PZOA 1X9MA 1TAMA 1ZQQA 1CI4A 1PK1B 1UA0A 2BPCA 4MHVA 3WK7A 3HW8A 5KFOA 4ECVA 4MFFA 5DQGA 5DDYA 3BQ0A 4J9RA 2HHTA 4ECYA 5HNKA 1SL2A 3BS5B 3UMGA 5IIMA 4M9HA 1V97A 3TFSA 1K5OA 2F76X 2XY5A 2WAQC 1SL1A 1RXWA 9ICKA 2ATLA 1PVQA 1BNPA 3M8RA 2EZZA 4C7ZA 4EYHB 3C2LA 3PY8A 2ZG6A 4R66A 4RQ1A 4FO6A 1NI3A 2NRTA 3H0RB 5AIBA 1UQVA 3M9OB 3PV8A 2BCSA 4G9BA 4NLCA 1XU4A 8ICCA 5ALDA 5KFXA 4F71A 2F8LA 2KHQA 1UCVA 5KFKA 5J0SA 2ZTCA 2UVRA 2OH2A 1S8OA 4MFAA 1KN5A 3IRUA 1X9XA 4GXKA 1Z00A 4LZDA 3KHLA 9ICVA 1L7NA 2KD1A 4F2RA 1ZRNA 4MF2A 3H8MA 4ECRA 8ICEA 2BDUA 5DBBA 4UBBA 2ASDA 5KFNA 1QH9A 7ICOA 3RJIA 4UAVA 1UHUA 5E79U 1ZQFA 2RRDA 1NJZA 1S76D 4BXOA 4CF5A 1BNOA 2WFAA 2KVSA 1QQ6A 3HRDD 4YP3A 4DFMA 8ICGA 3A0HU 4PGXA 4KLDA 4F4WA 1Z00B 5AKGA 2ZJ8A 1BPBA 2F77X 1V9PA 1L6NA 2IBKA 5K4LA 1N60A 4QNLA 4ED7A 1QTMA 4I2BA 5KFSA 2BPGA 1MQ3A 2DL0A 2JEGA 5AK4A 8ICFA 3I1YA 4DL3A 3PR4A 5G5HA 5CB1A 5HP4A 1SWVA 2XC9A 8ICMA 3CYMA 2VJ5A 1T3NA 2DGZA 3LDAA 1SV4A 1FO4A 1NK6A 2E3TA 3VC8A 5DG9A 2JH1A 4BXOB 4RUCA 1AQ6A 3QZ7A 2NV3A 3AM9A 4PGYA 3MGIA 2KKVA 2W55A 5DG8A 4RQ5A 1JALA 2F3NA 1FFVA 1QSYA 3JPRA 2FPMA 4ECZA 2A19A 4JUZA 4YQWA 4YR3A 1RM6C 3K1ZA 4IQUA 2ZUCA 5J2AA 2AXTU 1GO3F 3OHAA 3TARA 4QIWC 1QQ5A 5ALLA 4A8EA 2VJ4A 2NRZA 5GTHU 2R8KA 2MA1A 7ICLA 1TE2A 3SI8A 4CCHA 5KFTA 2K60A 5KL8B 3H40A 5KFRA 2I9GA 2YB1A 3EPIA 1KTQA 4KLUA 2FLLA 8ICYA 2XI9A 3RJEA 5DQIA 1X6JA 4GIBA 3FYHA 1TFRA 2OM6A 4OJPA 2R8JA 4QW8A 3SYZA
chains in the Genus database with same CATH topology
1PK1B 2DKXA 3HILA 4MHVA 2EAPA 2JV3A 3SENA 3TADA 1OW5A 2EANA 1F0MA 4PZNA 2Y9TA 5KNIA 1PK3A 3SEIA 5J8YA 1COKA 1B0XA 1X66A 2QKQA 4NL9A 2QB0A 3BS5B 4IS7A 1WWVA 4RQNA 3TADC 1X40A 2GLEA 2DL0A 2E8NA 2KMDA 2KSOB 2QB1A 2D3DA 1OXJA 2KIVA 1SGGA 2E8PA 1V85A 2LPEA 1LKYA 2YTUA 1B4FA 2B6GA 4NL9C 1SV4A 5JTIA 1KW4A 1SV0A 2ESEA 2K4PA 4NJ8A 5L1MA 3BQ7A 2FE9A 3KKAA 1RG6A 1SXEA 2L5YA 2F3NA 1UQVA 2EAOA 2EAMA 2QARA 2D8CA 2LMRA 1DXSA 1PK1A 2QB0B 5J8YC 5JU5A 1SV0C 1UCVA 1JI7A 2E8MA 5F3XB 2F44A 3IDWA 1X9XA 3BS7A 1LKYB 2KG5A 5JRTA 3K1RB 2KE7A 1SXDA 2K60A 3BS5A 1V38A 2E8OA 3H8MA 3TACB 1WWUA 2F8KA 2Y9UA 1Z1VA 2DKZA 2ES6A 2KSOA 4PZOA 3KKAC 4RQMA 2QARB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PK1 B;  2DKX A;  3HIL A;  4MHV A;  2EAP A;  2JV3 A;  3SEN A;  3TAD A;  1OW5 A;  2EAN A;  1F0M A;  4PZN A;  2Y9T A;  5KNI A;  1PK3 A;  3SEI A;  5J8Y A;  1COK A;  1B0X A;  1X66 A;  2QKQ A;  4NL9 A;  2QB0 A;  3BS5 B;  4IS7 A;  1WWV A;  4RQN A;  3TAD C;  1X40 A;  2GLE A;  2DL0 A;  2E8N A;  2KMD A;  2KSO B;  2QB1 A;  2D3D A;  1OXJ A;  2KIV A;  1SGG A;  2E8P A;  1V85 A;  2LPE A;  1LKY A;  2YTU A;  1B4F A;  2B6G A;  4NL9 C;  1SV4 A;  5JTI A;  1KW4 A;  1SV0 A;  2ESE A;  2K4P A;  4NJ8 A;  5L1M A;  3BQ7 A;  2FE9 A;  3KKA A;  1RG6 A;  1SXE A;  2L5Y A;  2F3N A;  1UQV A;  2EAO A;  2EAM A;  2QAR A;  2D8C A;  2LMR A;  1DXS A;  1PK1 A;  2QB0 B;  5J8Y C;  5JU5 A;  1SV0 C;  1UCV A;  1JI7 A;  2E8M A;  5F3X B;  2F44 A;  3IDW A;  1X9X A;  3BS7 A;  1LKY B;  2KG5 A;  5JRT A;  3K1R B;  2KE7 A;  1SXD A;  2K60 A;  3BS5 A;  1V38 A;  2E8O A;  3H8M A;  3TAC B;  1WWU A;  2F8K A;  2Y9U A;  1Z1V A;  2DKZ A;  2ES6 A;  2KSO A;  4PZO A;  3KKA C;  4RQM A;  2QAR B; 
#chains in the Genus database with same CATH topology
 5L1L A;  3ORY A;  1Z3E B;  3NVV A;  1KDH A;  4DWI A;  4AP9 A;  2PI4 A;  2AU0 A;  4PJ0 U;  1QSL A;  5KNI A;  2WF8 A;  1KFT A;  4DS5 A;  5AM0 A;  8ICQ A;  3WKB A;  4YD1 A;  4UB6 U;  5KFA A;  9ICN A;  1D9D A;  1U48 A;  5KFI A;  3Q8P B;  1SGG A;  2E8P A;  3SD7 A;  2F1H A;  2FLN A;  1QSS A;  9ICT A;  5AI6 A;  1KSP A;  2B21 A;  1XWL A;  3FDS A;  4ECX A;  4UB3 A;  2ESE A;  1QLN A;  4ACO A;  4AYB C;  4ECS A;  4ECQ A;  5J0Q A;  2EH9 A;  5HR7 A;  7ICV A;  2FDR A;  1TKD A;  1WUD A;  3KKA A;  1KBU A;  1Z1B A;  1KRP A;  1NK9 A;  4P0P A;  1ZD5 A;  1T7P A;  5ALQ A;  2AGO A;  9ICS A;  5AM2 A;  5AIA A;  3TI0 A;  4P4M A;  2F1J A;  1ECW A;  4Y2V A;  4ED8 A;  5IIO A;  1XO1 A;  3V7K A;  3QU4 A;  5DQH A;  3PW5 A;  4M04 A;  3ISD A;  2FJ6 A;  3QU2 A;  2W7O A;  5ALR A;  4B6J A;  1BPY A;  1N5X A;  5ALJ A;  5CP2 A;  3L5K A;  2BZF A;  4F5Q A;  4RQ6 A;  4C8L A;  4QZ8 A;  4RQ4 A;  4QJF B;  4P0P B;  2ZIU A;  2W7P A;  3M1Y A;  3PX6 A;  4IR1 A;  4ZOH C;  4HYK A;  3S6J A;  1FFU A;  1DOQ A;  3G6V A;  4IC9 A;  5C5J A;  3MBY A;  5CRX A;  3D2S A;  3M9M B;  4YR2 A;  1X66 A;  4B9M A;  3AN1 A;  3KD3 A;  2W9A A;  3MR3 A;  2HVH A;  1XSL A;  4JB3 A;  3PW4 A;  1SKR A;  1ZD4 A;  1MC8 A;  3UMC A;  3MDC A;  2P6U A;  1V85 A;  2LBO A;  1LKY A;  1TVA A;  2IOF A;  5KFU A;  4GXJ A;  2ZIU B;  2WB1 F;  3H0L B;  4YR0 A;  2Q0Z X;  2C2D A;  4NJ8 A;  4Z6C A;  4IQV A;  2QLT A;  5AKZ A;  2VA2 A;  2UVW A;  5KT6 A;  2HHS A;  1Z4O A;  3QUC A;  2ZTE A;  9ICB A;  5ALX A;  2G0A A;  3IV6 A;  3OTQ A;  2D8C A;  2I6X A;  3WK8 A;  4EX7 A;  1L3T A;  4J9O A;  4OJL A;  3PW2 A;  4F92 B;  1L7P A;  3T5L A;  5EOZ A;  4ED1 A;  2HVI A;  9ICM A;  1SB3 C;  3UXN A;  1J2M A;  1LKY B;  7ICG A;  1L7O A;  3BZK A;  3F2D A;  5JRT A;  4KLG A;  1ZQH A;  3K1R B;  4B9N A;  3TKA A;  2VKQ A;  5ALE A;  2V4R A;  4F72 A;  4QWB A;  5CJ7 A;  2ALZ A;  1XC9 A;  1ZET A;  8ICV A;  4UB5 A;  3VCB A;  3OGU A;  1ZQT A;  2DKZ A;  5CA7 A;  3HJE A;  3AMZ A;  1S0M A;  2GOL A;  1BGX T;  4Y2P A;  5KFW A;  4RQM A;  3T5K A;  2XCA A;  3RBE A;  2HOF A;  8ICL A;  3ETR A;  3UXP A;  3QU5 A;  1NJX A;  1HUO A;  7ICS A;  3TAD A;  4IRD A;  3RH4 A;  1XSP A;  1UA1 A;  2N1R A;  4FZN A;  3GDX A;  4PHA A;  4RZR A;  5HMM A;  1Z4N A;  1B0X A;  1ZQU A;  4RNN A;  4NLZ A;  1NKE A;  3HT3 A;  4NL9 A;  5D49 A;  1K1Q A;  1KL9 A;  5KG4 A;  5L1J A;  4NLN A;  1ZQE A;  1CUK A;  2KTQ A;  2W8K A;  4KX5 A;  8ICP A;  1OXJ A;  2AQ0 A;  1N56 A;  3RH6 A;  4UAY A;  3QU7 A;  2KFN A;  8ICK A;  4QZB A;  3C5F A;  3WKD A;  1NK0 A;  3LWM A;  4Q8E A;  1KEJ A;  4QZG A;  1ZQP A;  1WCN A;  4C8K A;  3TAN A;  2WF9 A;  3EWA A;  2ZTD A;  1D8Y A;  3QEA Z;  2BDP A;  1QQ7 A;  2DQN B;  2L5Y A;  3C1Z A;  1K1S A;  2RDI A;  3C2M A;  3H7I A;  3C5G A;  5AI8 A;  3JPT A;  5ALI A;  5J0U A;  3OPX A;  3DEE A;  1X2I A;  1B43 A;  5J2I A;  4OJ5 A;  1HIW A;  3V7J A;  5KT7 A;  5KT2 A;  2DF4 B;  3E0F A;  4BJQ A;  3PZP A;  3C21 A;  2HW3 A;  9ICC A;  4YXM A;  3ZDC A;  3NVW A;  3TAQ A;  2B0C A;  3AL0 B;  2PKE A;  4DLG A;  1M6Y A;  3NAS A;  2G09 A;  8ICA A;  2DKX A;  4F4X A;  4QIW F;  3BZC A;  2DPJ A;  5KFP A;  2BKE A;  3M8S A;  5EE3 A;  4HAI A;  1RXV A;  7ICU A;  4TUR A;  4FS2 A;  4IR9 A;  4DFP A;  2VIX A;  3D2N A;  5J8Y A;  5AM4 A;  4R8U A;  1QCK A;  2NRW A;  2EQY A;  4C8O A;  4MEX A;  2JRZ A;  8ICT A;  3N7S C;  4DL2 A;  1A6S A;  2QB1 A;  4O3M A;  2WB1 C;  3PSI A;  3N7R C;  1LB2 B;  5J2K A;  2V9W A;  1NKB A;  2W8L A;  2K4H A;  3EYZ A;  4YCX A;  2KHV A;  4DL5 A;  4USA A;  5DB8 A;  4CF4 A;  4M2Y A;  4IQW A;  4UB4 A;  1SV0 A;  4CGZ A;  1ZQ1 C;  3UXO A;  4Y2Y A;  3NRZ A;  1JIH A;  3GV8 B;  3ZDE A;  3QE9 Y;  2KOB A;  2HCF A;  5KAI U;  5AI5 A;  9ICG A;  2EAO A;  5KG3 A;  9ICF A;  1J97 A;  2HSZ A;  4R8U B;  1DXS A;  2J6U A;  4O9M A;  4OO1 J;  3RRG A;  1FEZ A;  3GQC A;  2HBJ A;  4UAW A;  4CE6 A;  3BQT A;  4I2J A;  3AEV A;  4C0Z A;  1NK4 A;  4AYB F;  3M6K A;  4RU9 A;  4Q43 A;  4PHP A;  4J9Q A;  1NK5 A;  4RPY A;  1S97 A;  1SKW A;  2W54 A;  3RJJ A;  1D8B A;  2KZ3 A;  3DDH A;  2H3V A;  4QZE A;  4Y2S A;  4O3N A;  3KZI U;  3ZDD A;  4RPZ A;  5KFG A;  1IG6 A;  5T14 A;  5F9N A;  7ICI A;  3T5J A;  3Q8K A;  4U6P A;  3ONN A;  2KZM A;  2YMQ A;  3QNM A;  3FAH A;  4Q45 A;  4M9L A;  2PFN A;  8ICH A;  3B0Y A;  4PZN A;  1Q8K A;  3MAB A;  1T8E A;  4KLE A;  5III A;  2LM1 A;  3H8S A;  1SZH A;  5KT3 A;  2QB0 A;  3AUO A;  1NJY A;  4RQN A;  4RPX A;  2JEI A;  3C1Y A;  5DDM A;  2HOI A;  3V7L A;  3E2E A;  5ALT A;  5DLG A;  4F50 A;  3G6X A;  4P2H A;  2FI1 A;  4XA5 A;  4YVZ A;  1N2X A;  5JTI A;  9ICE A;  3QX7 A;  4Z6F A;  3Q8M A;  5AKK A;  4PHD A;  2KJ9 A;  4C8M A;  5CWR A;  3PSP A;  2IHN A;  2VA3 A;  2ZUD A;  4I2H A;  4I2G A;  1IIP A;  2UVV A;  4K4H A;  3EZ5 A;  5IIJ A;  3PX4 A;  3F5A A;  3SAH A;  2QB0 B;  4QWE A;  1COO A;  5HHI A;  2MAX A;  2YY6 A;  5KT4 A;  3LK9 A;  1ARO P;  3O0F A;  4M6W A;  2JMG A;  4ELU A;  4JV2 A;  3DV9 A;  3JPO A;  4ICA A;  2Y1J A;  2C28 A;  5KFQ A;  4DQI A;  4O0I A;  1IV8 A;  4Z6D A;  4KLF A;  8ICR A;  2W11 A;  1WG8 A;  3ED5 A;  2NRV A;  5KL1 B;  5H2F U;  5IIK A;  4F5O A;  2ES6 A;  3IP4 B;  3THV A;  7ICF A;  3WK6 A;  4Y2R A;  4RT2 A;  3Q8Q B;  3L4P A;  1XS9 D;  4US8 A;  5KFZ A;  4EEL A;  3HIL A;  1PZN A;  1ZQR A;  4F3O A;  3LWL A;  4IRK A;  5J0O A;  4M6W B;  1JN3 A;  2DFL A;  2K4E A;  4DFK A;  1BPE A;  5AK5 A;  2C22 A;  5EE1 A;  4GXI A;  1ZOL A;  4IRC A;  2I5H A;  2ISP A;  4JK1 A;  1NOM A;  3PO5 A;  4U7C A;  1UT8 A;  5EWF A;  1ZJM A;  4Y2U A;  2P6R A;  5AI9 A;  9ICL A;  2A1J A;  3EW9 A;  5AI0 A;  9ICQ A;  2LHT A;  4X5V A;  3ALR A;  3TAD C;  4C4R A;  5KFJ A;  2Y1I A;  2IOH A;  1TK0 A;  8ICW A;  3F2C A;  4B9V A;  1D9F A;  3F53 A;  1ZQZ A;  3UQ2 A;  4ZH4 A;  4ECW A;  4NL9 C;  4QZC A;  4TUP A;  3C23 A;  4JV0 A;  1KW4 A;  1A0P A;  1WCL A;  4PH5 A;  3QEB Z;  3IG8 A;  1HJP A;  1XSN A;  2BCU A;  4DLE A;  4ELT A;  9ICU A;  1O03 A;  2KKP A;  4YFK A;  2MU2 A;  3IN5 A;  3UM9 A;  4RQ3 A;  4F5R A;  4O5K A;  4EZ6 A;  3BJY A;  1RYU A;  2WHE A;  2A1J B;  2W9C A;  4EEN A;  4I2D A;  4UB2 A;  2KJ5 A;  2WTF A;  3IDW A;  5J2G A;  2YX8 A;  2K89 A;  5J0W A;  3WK4 A;  1Q3U A;  4M9G A;  1S5L U;  4I2C A;  3SMV A;  5ALW A;  2JGA A;  4O3R A;  1O08 A;  4YMN A;  3SV3 A;  3H0M B;  1WWU A;  1F44 A;  4BWM A;  1SKS A;  5AM5 A;  2KN7 A;  2XY7 A;  2LI6 A;  4QZI A;  3WK5 A;  2ZUB A;  2YB4 A;  4GC7 A;  4J9S A;  3KHR A;  3ZI4 A;  4LZG A;  2WF5 A;  8ICN A;  2PMZ C;  1ZQO A;  3H8W A;  2W9C B;  4DS4 A;  2FLP A;  4CNQ A;  1RYR A;  2KK0 A;  4JWN A;  3PNC A;  1PUZ A;  1NZB A;  3MGV A;  2BCR A;  1XO0 A;  2PFO A;  5KTQ A;  3CNH A;  4KLH A;  4UQG A;  4K4I A;  2ZJA A;  4KLS A;  1LVH A;  3V72 A;  4BWJ A;  4EEK A;  5KFE A;  2R8I A;  1T94 A;  4G3I A;  3RH5 A;  3JPP A;  9ICO A;  3PVX A;  2KMD A;  2D3D A;  4NM2 A;  4DQQ A;  3NGD A;  7ICJ A;  2E1F A;  2C2E A;  2A1A A;  2C2R A;  4DL7 A;  4KLI A;  3RB3 A;  5KG2 A;  1JX4 A;  4DSE A;  4F5P A;  3H8J A;  2JEJ A;  1YZ7 A;  4PHE A;  2XO7 A;  2FE9 A;  5J2B A;  2F2A B;  4XRH A;  2ZIW A;  4GFJ A;  1YT3 A;  5DB7 A;  3KHH A;  1T3Q A;  2JH7 A;  3RAQ A;  2LMR A;  4UB8 U;  1SV0 C;  2NO4 A;  5AKE A;  1TAU A;  4DO9 A;  5L1K A;  7ICP A;  2LYA A;  5DGB A;  4DOB A;  5FP0 A;  1ZQL A;  1MSW D;  2R8H A;  1JRO A;  2CRX A;  5HR6 A;  1J2N A;  5KT5 A;  1PVR A;  4OJ6 A;  3SZ2 A;  4BX9 C;  4WJ3 B;  1V38 A;  2E8O A;  2EZX A;  5ALU A;  2HBK A;  4C4T A;  2BGW A;  2LKY A;  1VDV A;  1BVS A;  2ZIW B;  4F91 B;  5KG1 A;  5ALP A;  4DL4 A;  3K75 D;  2YQE A;  3QUQ A;  2WF6 A;  3Q8S B;  5L9X A;  4CRX A;  1L3U A;  5CEH A;  3QUB A;  2HBL A;  1F0M A;  2VAN A;  4LVS A;  4KIT B;  1RYS A;  4ECU A;  1TK5 A;  7ICQ A;  2QKQ A;  3PW0 A;  4UAT A;  2DBY A;  2GLE A;  2HHU A;  2K8C B;  2I1Q A;  2EDU A;  1KFS A;  4IL6 U;  5GTI U;  1YZ6 A;  4DL6 A;  4NY8 A;  3SR6 A;  4UAU A;  5L1I A;  1IXR A;  1RQN A;  5DKW A;  4ED6 A;  4OCZ A;  2V4Q A;  1F5S A;  1URJ A;  2OYY A;  3H4B A;  2DUY A;  4O3O A;  4Y2T A;  4Z6E A;  1N63 A;  2YN4 A;  1D8L A;  3ICX A;  2QAR A;  3ZDA A;  2W03 A;  2IMW P;  2UVU A;  4KLM A;  2E8M A;  2PI5 A;  2R18 A;  5F3X B;  3KBB A;  5ALZ A;  4R63 A;  5IIL A;  3SAF A;  3D2Q A;  4UBC A;  4ED0 A;  5J0R A;  2E1E A;  4DFD A;  2RLT A;  2XY6 A;  2KZZ A;  2GH1 A;  5B5E U;  2K8B B;  3B9J A;  4BGD A;  3UMB A;  3K4G A;  2XCP A;  3AU2 A;  2Y9U A;  2BQ3 A;  2KSO A;  2RQ5 A;  4MF8 A;  1JMS A;  4XUS A;  1H38 A;  3WKC A;  2QAR B;  2J6S A;  3MR6 A;  4KMO B;  2FMQ A;  1TK8 A;  3MR5 A;  1ZQB A;  1ZD2 P;  4PL1 A;  4MFC A;  5DG7 A;  3QU9 A;  5DBC A;  2JV3 A;  9ICR A;  5AK6 A;  1SZP A;  1B22 A;  4NWI A;  2EAN A;  2HBM A;  2CPR A;  3PX0 A;  2F1I A;  2H3Z A;  3D6J A;  2ZXH A;  3J81 j;  1TAQ A;  4EYI B;  5DGA A;  4KN4 A;  4DF4 A;  3F5E A;  3MGH A;  4FE3 A;  2A3V A;  4NM1 A;  3FC4 A;  3CP8 A;  3GII A;  2KSO B;  1KFD A;  3MR2 A;  4O5C A;  5KFD A;  4TUQ A;  3BDP A;  1ED1 A;  2YTU A;  2Y0S F;  7ICK A;  3Q8R B;  4KLJ A;  3Q8L A;  1BPX A;  5B66 U;  1HEK A;  4C8N A;  3A0B U;  9ICH A;  3U26 A;  5L1M A;  3BQ7 A;  1HUZ A;  4Q8F A;  1FIQ A;  3R9K A;  1T4G A;  3GIL A;  2XIC A;  4J9K A;  3MC1 A;  2HOQ A;  4P4P A;  5AK3 A;  3IM1 A;  4KLQ A;  4KTQ A;  3NRW A;  4I2I A;  2KEY A;  1ZQS A;  3KOO A;  3LVV A;  3CW2 C;  1NKC A;  3MDA A;  2XID A;  4KLT A;  2HHQ A;  1KKX A;  3BS7 A;  5G5G A;  3L3F X;  3ZD9 A;  5KFM A;  1UT5 A;  4PPX A;  8ICJ A;  4CF3 A;  1SXD A;  4RT3 A;  4K4G A;  2KP7 A;  4RQ8 A;  1U47 A;  1X6I A;  1S0N A;  1ZQW A;  1SL0 A;  3TAC B;  2ISO A;  3T3F A;  2F8K A;  2G07 A;  2YML A;  4F2S A;  1U4B A;  1L5U A;  3GIK A;  4O5E A;  2Q4T A;  3NVZ A;  5KFV A;  1ZQD A;  3KKA C;  3GV7 B;  4KLO A;  9ICX A;  1CEZ A;  4OJO A;  4QW9 A;  5KG5 A;  4I2E A;  3QUT A;  4P0Q A;  4EBD A;  5KG0 A;  5J0X A;  4GLX A;  2ZIV A;  3SEN A;  2P35 A;  4NV0 A;  5KAF U;  2WF7 A;  1SIJ A;  7ICE A;  3QZ8 A;  4O3Q A;  1NK8 A;  3N28 A;  3N97 B;  1COK A;  1U9L A;  3GIM A;  5ALK A;  5J2F A;  2VA8 A;  4YXJ A;  4R64 A;  2ZIX A;  3C29 A;  3RB0 A;  2E8N A;  1ZQI A;  2KIV A;  5BOM A;  1ZQY A;  1ZRM A;  2PMZ F;  3EPG A;  4B9U A;  2ODG A;  5ALO A;  4P0Q B;  1S9F A;  3I28 A;  1Z19 A;  2K4P A;  2IHM A;  2ZIV B;  3RBD A;  4KX3 A;  1S0O A;  4DOC A;  2MUT A;  3RAX A;  2BCV A;  3BQ1 A;  4J9M A;  4YN4 A;  1SXE A;  1KLN A;  4J9L A;  3N4M B;  1NNL A;  5D46 A;  3RR7 A;  2IOF K;  2P66 A;  2EAM A;  2XVT A;  2AGQ A;  1ZXI A;  5ALN A;  7ICR A;  5J2H A;  4RUA A;  5C0Y A;  5KFY A;  3RB6 A;  2G06 A;  2ZIX B;  2F44 A;  1TV9 A;  4IQT A;  2OHF A;  3FM9 A;  3KHG A;  1X42 A;  9ICP A;  4DSL A;  2Z7J A;  2HMX A;  3OSP A;  4F93 B;  2KV2 A;  1NZP A;  5KFC A;  7ICM A;  1WYG A;  2MUT B;  3M6Z A;  3NVY A;  5ALF A;  1Z1V A;  1NK7 A;  1CRX A;  5AKH A;  4P4O A;  4US9 A;  5J29 A;  2H5X A;  4DQR A;  1BPZ A;  4TUS A;  2W04 A;  4RQ2 A;  3PML A;  5AM1 A;  2EZY A;  2H3Q A;  1ZQM A;  2BQU A;  5DB9 A;  2JZB A;  2W9M A;  9ICA A;  2JXJ A;  2M0N A;  4Y2X A;  2GWS A;  2HHX A;  5J2E A;  1LV5 A;  4DSK A;  4J9N A;  1JXE A;  1RPL A;  3HKZ C;  1SWW A;  2AJQ A;  5KG6 A;  3T5H A;  2KNJ A;  3E58 A;  4PL2 A;  2NRX A;  1X9S A;  5AIC A;  4TQS A;  4FS1 A;  1EXN A;  3F2B A;  2Y0S C;  4XQ8 A;  3RRH A;  3QYP A;  1ZQG A;  4Y2Q A;  3EUB 2;  1B4F A;  2FMS A;  1ZQN A;  2YMM A;  5J2J A;  3ETL A;  5HHH A;  3PMN A;  2XGQ A;  1MQ2 A;  1C20 A;  3PSF A;  2JZB B;  3ZD8 A;  1Q3V A;  2HI0 A;  3V6K A;  1Q46 A;  4QZF A;  4RQ7 A;  5JU5 A;  2FPL A;  1JI7 A;  3AU6 A;  2K8A A;  4EX6 A;  1N62 A;  2G08 A;  4UAR A;  4FFD A;  4BUG A;  2D6F C;  2W3S A;  1RDF A;  5CHG A;  5AKX A;  2RP5 A;  4EZ9 A;  2E5S A;  2KE7 A;  1A76 A;  4KN7 A;  1X9W A;  1ZQV A;  4I29 A;  4I2A A;  1NJW A;  4TQR A;  9ICJ A;  3RJG A;  9ICI A;  2CN1 A;  2XGP A;  9ICW A;  3BQ2 A;  2KJ8 A;  1PVP A;  2HDO A;  1IM4 A;  1RZT A;  4KMU A;  3IG5 A;  2FMP A;  2KIC A;  3HX0 A;  1L3V A;  4M0A A;  4FBT A;  2RHF A;  1OW5 A;  1ZQK A;  4EBC A;  7ICH A;  4GC6 A;  4ECT A;  2G5I B;  3SEI A;  2G5H B;  2W3R A;  1DGS A;  4ELV A;  2AGP A;  1WWV A;  4J9P A;  1XNS A;  2DPI A;  1DRG A;  1X40 A;  4MEY A;  3UQ0 A;  3M7D A;  1RQL A;  5ALM A;  1S0V A;  1C7Y A;  8ICU A;  3SV4 A;  1MN8 A;  5TIS U;  4B9T A;  5BOL A;  1Y88 A;  3ZDB A;  1BPD A;  1UPH A;  3QXG A;  3TQ1 A;  1S77 D;  2KFZ A;  4NXZ A;  8ICZ A;  2IA6 A;  2H3I A;  4NLB A;  3NUQ A;  3PR5 B;  3H4D A;  4QWD A;  3RFA A;  2NO5 A;  5KFB A;  4QZA A;  3GIJ A;  3ISB A;  2H3F A;  3TAP A;  5J8Y C;  1ZJN A;  4F8R A;  1N61 A;  2LYB A;  4DEZ A;  2PFP A;  3OSN A;  3OHB A;  5ALS A;  4UAS A;  4DSI A;  3HP6 A;  2KG5 A;  5KFH A;  2FPK A;  2RDJ A;  5JUM A;  5J0P A;  3T79 A;  4B9L A;  2NYV A;  5AKL A;  2OCE A;  3JPS A;  5EWE A;  2HHV A;  5KFF A;  1P7D A;  1U49 A;  4DCC A;  3JPQ A;  8ICI A;  4FZL A;  2BPF A;  4C4S A;  4C7Y A;  2MRL A;  4J03 A;  3JPN A;  4RNM A;  4FZM A;  3OJU A;  4ED3 A;  2ASJ A;  3PW7 A;  2EAP A;  2OXO A;  2ZXI A;  3SAG A;  5KFL A;  1PK3 A;  3KFU F;  3SQI A;  5CR0 A;  4UB1 A;  2JEF A;  4C80 A;  8ICB A;  1OUQ A;  4QZ9 A;  4JMU A;  3KTQ A;  3NS1 A;  4EEY A;  3OJS A;  4CDG A;  4YMM A;  4F5N A;  1ZQC A;  2PFQ A;  1N48 A;  2J6T A;  3HWT A;  3RJH A;  4QWA A;  2WAQ F;  2OWO A;  2MSN A;  3CRX A;  5AKY A;  4M9J A;  4QZH A;  5KG7 A;  4DF8 A;  5EE0 A;  5EE9 A;  3KZX A;  4NLK A;  1U45 A;  5AKI A;  3HPO A;  4JWM A;  5AI4 A;  4RNO A;  5HML A;  1L8L A;  2DWQ A;  4I28 A;  4RQ0 A;  4F4K A;  3GV5 B;  1DK3 A;  3C28 A;  5J2C A;  3G6Y A;  4M47 A;  3RTV A;  2BQR A;  4KLL A;  7ICT A;  3N7P D;  4YD2 A;  2BR0 A;  1S10 A;  2YMP A;  2AH5 A;  4M9N A;  5AKJ A;  2JHD A;  3TFR A;  3RR8 A;  1ZD3 A;  4FBU A;  1L3S A;  4YMO A;  3WKA A;  4DSJ A;  4Q44 A;  5J2D A;  5ALV A;  4UW9 A;  4I27 A;  2LM4 A;  4E0D A;  1A77 A;  5AHX A;  2W43 A;  2KVC A;  3AQE A;  5TZV A;  5BPC A;  4QWC A;  5D4B A;  5DB6 A;  1VJ5 A;  3GFK B;  1L7M A;  3I76 A;  2PXI A;  3IHQ B;  2BCQ A;  2GO7 A;  1ZQJ A;  2Y9T A;  5IIN A;  2HHW A;  2W9B A;  4DQP A;  1JUD A;  4LJX A;  3V6H A;  3NTU A;  4UAZ A;  3C2K A;  3B0X A;  4I2F A;  4ED2 A;  4IS7 A;  5ALG A;  4O3P A;  4R65 A;  3PST A;  3WKE A;  2O6K A;  3RJF A;  3RB4 A;  4EBE A;  2AQ4 A;  4YG2 A;  3WK9 A;  4BDP A;  2LPE A;  2BHN A;  3AQF A;  5AM3 A;  2B6G A;  5DBA A;  1DGJ A;  5J0T A;  4F4Z A;  1KQQ A;  3LVW A;  4NLG A;  4F4Y A;  5J0Y A;  5DLF A;  2ASL A;  1MA7 A;  5ALH A;  7ICN A;  3LYS A;  4DOA A;  3MFI A;  1RG6 A;  1VLB A;  1ZYQ A;  1ZQA A;  2LYH A;  3RJK A;  2W9B B;  3UPQ A;  4QZD A;  3HKZ F;  4PGQ A;  3M9N B;  1N5W A;  2OEH A;  1PK1 A;  5A0L A;  8ICO A;  1L8O A;  4B9S A;  8ICS A;  3GU3 A;  3WU2 U;  5F9L A;  4DSF A;  1JRP A;  1DK2 A;  4OD0 A;  5EWG A;  1JXL A;  5ALY A;  4O3S A;  4DQS A;  2JR5 A;  3ISC A;  2KIW A;  8ICX A;  3PO4 A;  3RF9 A;  3GZF A;  4Y2J A;  2AHO B;  3V6J A;  3MFH A;  3BS5 A;  4JV1 A;  4DFJ A;  2ZJ5 A;  1ZQX A;  2R8G A;  2K4I A;  2M9N A;  2CXY A;  4PZO A;  1X9M A;  1TAM A;  1ZQQ A;  1CI4 A;  1PK1 B;  1UA0 A;  2BPC A;  4MHV A;  3WK7 A;  3HW8 A;  5KFO A;  4ECV A;  4MFF A;  5DQG A;  5DDY A;  3BQ0 A;  4J9R A;  2HHT A;  4ECY A;  5HNK A;  1SL2 A;  3BS5 B;  3UMG A;  5IIM A;  4M9H A;  1V97 A;  3TFS A;  1K5O A;  2F76 X;  2XY5 A;  2WAQ C;  1SL1 A;  1RXW A;  9ICK A;  2ATL A;  1PVQ A;  1BNP A;  3M8R A;  2EZZ A;  4C7Z A;  4EYH B;  3C2L A;  3PY8 A;  2ZG6 A;  4R66 A;  4RQ1 A;  4FO6 A;  1NI3 A;  2NRT A;  3H0R B;  5AIB A;  1UQV A;  3M9O B;  3PV8 A;  2BCS A;  4G9B A;  4NLC A;  1XU4 A;  8ICC A;  5ALD A;  5KFX A;  4F71 A;  2F8L A;  2KHQ A;  1UCV A;  5KFK A;  5J0S A;  2ZTC A;  2UVR A;  2OH2 A;  1S8O A;  4MFA A;  1KN5 A;  3IRU A;  1X9X A;  4GXK A;  1Z00 A;  4LZD A;  3KHL A;  9ICV A;  1L7N A;  2KD1 A;  4F2R A;  1ZRN A;  4MF2 A;  3H8M A;  4ECR A;  8ICE A;  2BDU A;  5DBB A;  4UBB A;  2ASD A;  5KFN A;  1QH9 A;  7ICO A;  3RJI A;  4UAV A;  1UHU A;  5E79 U;  1ZQF A;  2RRD A;  1NJZ A;  1S76 D;  4BXO A;  4CF5 A;  1BNO A;  2WFA A;  2KVS A;  1QQ6 A;  3HRD D;  4YP3 A;  4DFM A;  8ICG A;  3A0H U;  4PGX A;  4KLD A;  4F4W A;  1Z00 B;  5AKG A;  2ZJ8 A;  1BPB A;  2F77 X;  1V9P A;  1L6N A;  2IBK A;  5K4L A;  1N60 A;  4QNL A;  4ED7 A;  1QTM A;  4I2B A;  5KFS A;  2BPG A;  1MQ3 A;  2DL0 A;  2JEG A;  5AK4 A;  8ICF A;  3I1Y A;  4DL3 A;  3PR4 A;  5G5H A;  5CB1 A;  5HP4 A;  1SWV A;  2XC9 A;  8ICM A;  3CYM A;  2VJ5 A;  1T3N A;  2DGZ A;  3LDA A;  1SV4 A;  1FO4 A;  1NK6 A;  2E3T A;  3VC8 A;  5DG9 A;  2JH1 A;  4BXO B;  4RUC A;  1AQ6 A;  3QZ7 A;  2NV3 A;  3AM9 A;  4PGY A;  3MGI A;  2KKV A;  2W55 A;  5DG8 A;  4RQ5 A;  1JAL A;  2F3N A;  1FFV A;  1QSY A;  3JPR A;  2FPM A;  4ECZ A;  2A19 A;  4JUZ A;  4YQW A;  4YR3 A;  1RM6 C;  3K1Z A;  4IQU A;  2ZUC A;  5J2A A;  2AXT U;  1GO3 F;  3OHA A;  3TAR A;  4QIW C;  1QQ5 A;  5ALL A;  4A8E A;  2VJ4 A;  2NRZ A;  5GTH U;  2R8K A;  2MA1 A;  7ICL A;  1TE2 A;  3SI8 A;  4CCH A;  5KFT A;  2K60 A;  5KL8 B;  3H40 A;  5KFR A;  2I9G A;  2YB1 A;  3EPI A;  1KTQ A;  4KLU A;  2FLL A;  8ICY A;  2XI9 A;  3RJE A;  5DQI A;  1X6J A;  4GIB A;  3FYH A;  1TFR A;  2OM6 A;  4OJP A;  2R8J A;  4QW8 A;  3SYZ A; 
#chains in the Genus database with same CATH homology
 1PK1 B;  2DKX A;  3HIL A;  4MHV A;  2EAP A;  2JV3 A;  3SEN A;  3TAD A;  1OW5 A;  2EAN A;  1F0M A;  4PZN A;  2Y9T A;  5KNI A;  1PK3 A;  3SEI A;  5J8Y A;  1COK A;  1B0X A;  1X66 A;  2QKQ A;  4NL9 A;  2QB0 A;  3BS5 B;  4IS7 A;  1WWV A;  4RQN A;  3TAD C;  1X40 A;  2GLE A;  2DL0 A;  2E8N A;  2KMD A;  2KSO B;  2QB1 A;  2D3D A;  1OXJ A;  2KIV A;  1SGG A;  2E8P A;  1V85 A;  2LPE A;  1LKY A;  2YTU A;  1B4F A;  2B6G A;  4NL9 C;  1SV4 A;  5JTI A;  1KW4 A;  1SV0 A;  2ESE A;  2K4P A;  4NJ8 A;  5L1M A;  3BQ7 A;  2FE9 A;  3KKA A;  1RG6 A;  1SXE A;  2L5Y A;  2F3N A;  1UQV A;  2EAO A;  2EAM A;  2QAR A;  2D8C A;  2LMR A;  1DXS A;  1PK1 A;  2QB0 B;  5J8Y C;  5JU5 A;  1SV0 C;  1UCV A;  1JI7 A;  2E8M A;  5F3X B;  2F44 A;  3IDW A;  1X9X A;  3BS7 A;  1LKY B;  2KG5 A;  5JRT A;  3K1R B;  2KE7 A;  1SXD A;  2K60 A;  3BS5 A;  1V38 A;  2E8O A;  3H8M A;  3TAC B;  1WWU A;  2F8K A;  2Y9U A;  1Z1V A;  2DKZ A;  2ES6 A;  2KSO A;  4PZO A;  3KKA C;  4RQM A;  2QAR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...