1PK1A

Hetero sam domain structure of ph and scm.
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
68
structure length
68
Chain Sequence
PPISSWSVDDVSNFIRELPGCQDYVDDFIQQEIDGQALLLLKEKHLVNAMGMKLGPARKIVAKVESIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural organization of a Sex-comb-on-midleg/polyhomeotic copolymer.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription repression
molecule keywords Polyhomeotic-proximal chromatin protein
total genus 19
structure length 68
sequence length 68
chains with identical sequence C
ec nomenclature
pdb deposition date 2003-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07647 SAM_2 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 1pk1A00
4NL9A 2DKXA 5JTIA 2KSOB 4NL9C 2E8NA 3H8MA 2Y9UA 2E8PA 2K4PA 4PZOA 3IDWA 1SV0A 4MHVA 4NJ8A 1V85A 2KG5A 2D3DA 2EAMA 2QB1A 2Y9TA 1OXJA 2QARA 2EAOA 2L5YA 1SV0C 5JU5A 4RQMA 3SEIA 3TADA 1X40A 4IS7A 2KMDA 1Z1VA 1SV4A 2F3NA 1WWVA 3TADC 1LKYB 2LMRA 1JI7A 2QB0B 1WWUA 1B4FA 1PK1B 5KNIA 3KKAC 3BS5A 2E8OA 1UQVA 2DL0A 2EANA 1PK1A 1X66A 2JV3A 1KW4A 4PZNA 3TACB 1F0MA 3K1RB 1LKYA 3BS7A 2YTUA 2ESEA 2QB0A 2FE9A 2KSOA 5F3XB 2B6GA 3BS5B 1V38A 2F8KA 2F44A 2GLEA 2E8MA 1SXDA 5J8YC 1B0XA 5JRTA 1SXEA 2KIVA 1DXSA 1UCVA 1PK3A 2ES6A 3HILA 1COKA 1RG6A 2QARB 2LPEA 2K60A 5J8YA 1OW5A 3BQ7A 3SENA 5L1MA 2D8CA 1X9XA 3KKAA 2KE7A 2QKQA 1SGGA 2EAPA 2DKZA 4RQNA
chains in the Genus database with same CATH superfamily
4IR1A 3M9OB 2ALZA 3TFSA 5KL1B 3SAGA 5DB8A 1QSLA 1ZQWA 2Q0ZX 4DQIA 3C2LA 4M9HA 5KFVA 4EEYA 1NJWA 4F3OA 2D3DA 5J2EA 3WK8A 3PSFA 1CI4A 5IIKA 2QARA 5FP0A 4RQ2A 4Z6CA 1ZQRA 5KFPA 2WB1F 4JB3A 4DSIA 3IV6A 2Y1IA 2MUTA 5HHHA 1MQ2A 4DQSA 3ZDDA 4FBUA 4F50A 1RQNA 1HUOA 5CWRA 4DFJA 2A19A 2RDJA 4NM2A 5GTIU 3T3FA 1ZRMA 4I2AA 3CYMA 4IL6U 4XUSA 1N48A 3V7LA 1Z00A 1F5SA 4ECSA 3FYHA 5J2FA 1ZRNA 2PFOA 2F8LA 2O6KA 4TUQA 9ICCA 3RB0A 1XSLA 2ZUCA 2XICA 3NUQA 3PSTA 1S8OA 3RB3A 2W9BA 3IP4B 5KT3A 3M6KA 1JXEA 3QU4A 5KFEA 3BS5B 4Q8FA 4J9KA 3WK4A 5AIAA 2KJ9A 5KT6A 4QZFA 2UVUA 2AU0A 8ICCA 5KFQA 5J8YC 4FS1A 4G3IA 5KFHA 3T5KA 1X6JA 4MEXA 4P0QB 2ES6A 5TZVA 2ASLA 2XCAA 5J2JA 3SZ2A 4K4HA 1X9WA 2PI4A 4FZNA 1DGJA 3KFUF 1X9XA 4QZAA 4YR3A 5ALZA 4DFKA 3ALRA 3EW9A 5KAIU 3KHHA 3M7DA 3WU2U 3T5LA 4F5OA 1J97A 1NZPA 4NXZA 8ICRA 2W9BB 2FJ6A 4CRXA 2KIWA 1QQ5A 3RR8A 1L5UA 7ICJA 2W9CB 2G08A 2R8GA 2ZIUA 4MHVA 2AQ0A 4USAA 3MABA 5L9XA 5KT7A 1H38A 8ICGA 4US9A 3LWMA 3RAXA 3TARA 3NVVA 2H3IA 2JR5A 2L5YA 7ICPA 1XC9A 2JH1A 4AYBC 1N60A 7ICUA 5D46A 2F3NA 2BCUA 4F2RA 3MFHA 2LBOA 5CR0A 4PGYA 2AQ4A 3FAHA 1JRPA 4QZEA 1JN3A 2DL0A 4UB5A 4UATA 1DGSA 3T5JA 3MC1A 1HJPA 4P4PA 5KAFU 1SZPA 4KLSA 4IC9A 5AI6A 1X9MA 5J2IA 4DCCA 4LJXA 3ISBA 4UB6U 1FO4A 2ZIVA 1B0XA 2UVWA 1NJZA 2IBKA 4DL6A 4F4WA 1ZOLA 5T14A 3EPGA 2ZTDA 5DB7A 3QZ8A 4YCXA 2XIDA 8ICYA 4IRDA 1Z19A 4KLEA 3N28A 2G07A 3IRUA 1S0NA 5AK6A 4GXJA 1X2IA 2G0AA 3L4PA 2WB1C 4I2JA 1ZXIA 2QLTA 5ALNA 4XRHA 5KG0A 4RQ3A 5J2BA 3H8MA 4KLIA 8ICWA 2ODGA 2KZZA 1IV8A 4F5NA 5KFZA 2ZIXA 2Q4TA 4QIWF 4GC7A 3M9NB 5ALYA 3SEIA 1NK5A 2LYAA 4UAWA 3HKZF 2HI0A 2PKEA 4M9LA 4DQRA 1ZJNA 1ZQUA 3UXOA 2OCEA 2IHMA 8ICHA 3QU5A 1L3TA 1BPZA 2DUYA 2F1JA 5J0OA 2HMXA 3NTUA 5KFIA 4F93B 3GV5B 4U6PA 2H3VA 4NLNA 3HWTA 1ZQZA 2LI6A 2HHXA 2CXYA 2BGWA 3AQEA 3NASA 3KD3A 4PL2A 3NRZA 1NKCA 1D8LA 1F0MA 3AUOA 4B9LA 2AGPA 1MQ3A 4CDGA 3GU3A 1KBUA 3PMLA 1NK9A 4Y2QA 4EENA 2HHTA 4BJQA 2W43A 1WYGA 2C28A 5IIMA 5J2GA 5C5JA 3PVXA 4DL4A 1DK3A 4LZDA 3BQTA 4QW8A 1SWVA 3HT3A 3HJEA 3PZPA 2ZIUB 1MSWD 1S0OA 4HYKA 3F5EA 5L1MA 4J9OA 2EZXA 4B9VA 1L3SA 5J0SA 5HHIA 5KFSA 3SAHA 3M1YA 2V4RA 5F9NA 3HKZC 1MA7A 2C22A 7ICEA 5DQHA 4DFPA 4Z6FA 2KHQA 3T5HA 3RFAA 5AKKA 9ICLA 5EWEA 2K89A 2KD1A 3TKAA 3RB4A 2F76X 3WK6A 4WJ3B 1ZQIA 2XCPA 2DWQA 5EOZA 8ICXA 4KTQA 1ZQKA 5DLFA 5DG7A 4M04A 3M8SA 5ALWA 4RQMA 1X40A 4IS7A 4PGQA 2WAQF 1NNLA 2W9MA 4PPXA 2ZG6A 4O3SA 3TADC 3PX4A 1RQLA 1IIPA 4KITB 2ZUBA 4C8MA 1L8LA 1EXNA 3MGVA 1UQVA 1L8OA 4ZOHC 3QE9Y 4YR0A 4EELA 1L7NA 2YX8A 9ICMA 2BZFA 4YVZA 1TAQA 3EZ5A 2CN1A 1KW4A 8ICAA 1NK4A 1N5WA 4QWAA 3RJHA 5AK3A 4O3OA 1TK8A 2JGAA 3ETLA 4F72A 4IQWA 1QH9A 5AI9A 5AKXA 4J9SA 4C7ZA 3V6HA 3GIIA 3Q8LA 2C2RA 4QZCA 5JRTA 2KFZA 1UCVA 2HOFA 5ALUA 3J81j 5DDYA 1NK8A 1ZQHA 2QKQA 1VLBA 4RNMA 1SKSA 4EYIB 2VA3A 3KHLA 5AI5A 3WK9A 2HVIA 4NL9C 8ICZA 3RJJA 2B21A 1AROP 3FC4A 4O5EA 3K1ZA 2KOBA 4IRKA 4I2DA 1DK2A 1L3UA 2WFAA 2OXOA 2YY6A 4DL7A 2VANA 4LVSA 1N62A 5K4LA 1J2MA 3JPNA 2KJ5A 2JMGA 3L5KA 3RBDA 1OXJA 1C20A 4I2IA 4YP3A 4O0IA 3M6ZA 4FZMA 5AI4A 2KJ8A 1S5LU 4O3NA 1BPYA 3PY8A 5EE1A 5J2HA 2FPKA 5DBBA 1S97A 4I2CA 1SV4A 3MR6A 4ICAA 8ICFA 4JWMA 2C2DA 2PFQA 1WWUA 3TI0A 2ISOA 5DB9A 3F2BA 2ZIXB 3KKAC 5AICA 1NKBA 2NRZA 4TUSA 4C8OA 4DL2A 7ICHA 3GV8B 1IG6A 2RQ5A 4NWIA 5KFMA 5GTHU 4UBCA 2HBJA 2KTQA 2YTUA 4Y2TA 5KFUA 4JK1A 3EWAA 4I2GA 9ICXA 4QZ8A 5F9LA 2W7PA 1TKDA 4ED3A 3WKEA 4R64A 4OD0A 4DL3A 3H4BA 4BXOB 1X42A 4DF8A 1Z00B 3QU7A 1ZQOA 3G6YA 2C2EA 4CF3A 5EE0A 2LM1A 2RP5A 1FEZA 2BCSA 3GQCA 1MN8A 2HW3A 3QZ7A 1N61A 3RRGA 2KKPA 3QXGA 5BOMA 4AP9A 4M9JA 4R65A 3HP6A 1S10A 3WKAA 2XI9A 1U4BA 4F71A 1XNSA 2BPCA 5AM1A 4A8EA 4O3MA 5D4BA 4DS4A 2NRWA 3V6KA 5AIBA 5KFGA 1BNPA 5EE9A 1HIWA 2KG5A 5AM0A 3OSPA 4YXJA 2ASJA 1LV5A 5IINA 1Q3VA 4F4YA 2W8LA 1HEKA 3LYSA 4DSFA 3ISDA 1Z1VA 3Q8MA 3O0FA 2R8HA 2LYHA 1BGXT 4RQ7A 3ZI4A 4KMUA 5DG9A 3SD7A 2LYBA 4Q44A 5DDMA 3TFRA 2OWOA 3B0YA 1N63A 2KFNA 3C23A 2G09A 1O08A 7ICVA 3PX0A 4PZNA 4KLMA 2HHVA 3RR7A 1URJA 1TFRA 9ICEA 1PZNA 3PSIA 1T3QA 4UASA 2AHOB 2W11A 1JROA 4RT3A 2P66A 2YB1A 3H7IA 4YN4A 3D2NA 2IA6A 2ZJ8A 4DQPA 4JMUA 3IM1A 3AN1A 3QUQA 4G9BA 3UMBA 2BQ3A 2HHQA 5AK5A 1P7DA 4UQGA 3UQ0A 4C7YA 4C80A 2ZIVB 4QWEA 3HW8A 1WUDA 2K8CB 4BDPA 3PV8A 4MF2A 4ECWA 1O03A 3C28A 4ACOA 5J2KA 3AEVA 2E8NA 2Z7JA 4B9NA 3VCBA 3EYZA 2ZTEA 1KLNA 4RQ4A 1TAMA 2H3FA 1GO3F 2IOFK 2K8AA 4Q8EA 7ICSA 1ZQGA 4QWDA 2AGQA 3JPPA 4F4KA 2ATLA 5J29A 3JPQA 3JPRA 3C2KA 2ZJ5A 3PO5A 4CE6A 1B4FA 5KNIA 2V9WA 1KFTA 7ICGA 4QZ9A 4GXKA 2H3QA 1PVRA 3S6JA 4DSKA 4QZHA 3K4GA 1KKXA 2YB4A 2KK0A 7ICNA 1M6YA 4RZRA 1CRXA 4UAVA 4M0AA 2EANA 1ZQSA 5ALRA 1IM4A 2HHWA 1UT5A 2BCVA 1SL2A 4GLXA 3C1YA 4CF5A 3H8WA 4FO6A 1ZD2P 1Y88A 9ICRA 3MGHA 4RPXA 4O5KA 4TUPA 2LM4A 2MU2A 2J6UA 2F8KA 2YMPA 3OGUA 1ZQDA 2PXIA 3RRHA 3RJEA 1TV9A 4U7CA 5AI0A 3KTQA 3M9MB 9ICJA 5G5HA 2M9NA 1JMSA 2D8CA 2FDRA 3KHGA 2IOHA 1NK6A 2A1AA 5KFRA 1L6NA 4NY8A 5KFLA 5AKHA 4NLZA 2AXTU 2GH1A 4I28A 1VDVA 3V6JA 3GZFA 5DQIA 2XY6A 2K4PA 4KLTA 3C21A 4PZOA 3PO4A 4DLGA 3KHRA 4OJLA 3UQ2A 3RJKA 5KFCA 2YQEA 3PX6A 4LZGA 4RQ6A 3N7RC 5ALFA 8ICMA 4KX5A 3QEBZ 2Y9TA 5L1IA 2GOLA 4YXMA 5ALDA 4MFFA 1LVHA 3PW7A 1K1SA 5KFTA 2KN7A 9ICPA 4KLJA 2D6FC 4QJFB 4US8A 4FS2A 3AL0B 5AKGA 1ZQMA 1A0PA 2B0CA 2EH9A 4DSJA 4BWMA 5ALVA 2R8IA 1RPLA 4RT2A 4Y2VA 3BJYA 1KTQA 4I2HA 2P35A 4M9GA 4IR9A 3DV9A 8ICQA 2I1QA 2VJ5A 2YMMA 3IHQB 2NO5A 5AM2A 1YT3A 3B9JA 2R8KA 3QEAZ 3N4MB 4DEZA 4DF4A 4C8NA 4ED0A 2NO4A 4RQ0A 1U45A 5DQGA 2EZYA 2NRVA 4B9TA 2HOQA 3KZIU 5EE3A 4FE3A 1KSPA 4OO1J 4UB1A 2K60A 5HMMA 5A0LA 5J8YA 1OW5A 3R9KA 2W7OA 5DKWA 4NLKA 2RRDA 2WHEA 4RUCA 1OUQA 2A1JA 2XVTA 2BCRA 3DDHA 5TISU 4I2EA 4C4RA 3F5AA 4IRCA 1ZQXA 3IG5A 4B9SA 2HSZA 1PVQA 4QW9A 7ICKA 4Q45A 2IHNA 4OJ5A 4R66A 4P4MA 5KG1A 4JUZA 2P6RA 3PR4A 4R63A 2QB1A 4J03A 3NRWA 5KFAA 3OHBA 5EWGA 1KDHA 3TADA 4J9QA 3CP8A 4DSLA 4ED2A 4QZBA 1ZD4A 1UPHA 3UXNA 2JZBB 5D49A 4Y2SA 7ICQA 4EYHB 4ED1A 1JI7A 2K4IA 4I2FA 4MFCA 2KV2A 5H2FU 3T79A 1KL9A 3ZDBA 2FPLA 2MAXA 3ZDEA 4KN4A 2E8OA 5L1KA 4F5QA 1QQ6A 5ALKA 4RPZA 1QSSA 1U49A 5HR6A 3BS7A 4EX7A 4C8LA 2JRZA 2FMQA 5DBAA 4R8UA 1XS9D 1RZTA 4KLDA 9ICWA 3MDAA 9ICQA 4ELUA 4DQQA 3WKBA 5DG8A 4RQ5A 4RUAA 1ZQTA 2NYVA 4UB3A 1NZBA 2OH2A 3QX7A 4PJ0U 3IN5A 2BDUA 2UVRA 1ZQAA 1PK3A 5HMLA 3H0MB 5BPCA 2AGOA 2MRLA 4NV0A 1NJYA 1XWLA 4QZDA 3RH5A 4NL9A 2BQRA 3HX0A 1RYRA 5KG6A 3D6JA 5J0RA 3OJUA 2HCFA 4IQTA 2VJ4A 3RH6A 1SV0A 4C8KA 2G5IB 1SL1A 1NK0A 8ICUA 1RYSA 2ZXIA 1ZD3A 1ZQVA 2F1IA 9ICVA 3C5FA 4F2SA 1T4GA 4J9RA 5CA7A 5AI8A 1XSNA 5DLGA 4JWNA 1DRGA 5AM5A 2IOFA 5JU5A 4KLGA 2W55A 4MEYA 4F5PA 5KG7A 2J6TA 3Q8QB 5ALHA 4P2HA 1LKYB 5AKIA 1D8BA 3HRDD 3SYZA 7ICIA 3SAFA 2VA2A 1JXLA 2WF9A 3F2CA 3BS5A 4PHAA 3SQIA 2JZBA 3SI8A 1XO0A 5KG5A 3QUBA 2ZXHA 4YMMA 4EBCA 3OTQA 1ZQ1C 4JV2A 9ICAA 4NM1A 1RYUA 3TACB 2ISPA 5ALJA 2EQYA 4NLBA 3SR6A 2G06A 4M9NA 5ALTA 4PHPA 4DOCA 4KX3A 5B66U 4ECRA 9ICOA 1JUDA 1BPBA 4C4SA 1QLNA 2A3VA 2F44A 4UARA 4O3QA 3V7KA 8ICJA 5DGAA 1TK5A 2VIXA 4BWJA 4C0ZA 4OJOA 4YFKA 3I28A 2W9CA 2LPEA 3ONNA 7ICFA 2NRTA 1L3VA 3BQ7A 1NKEA 4UAUA 3C5GA 5KFKA 2KE7A 1K5OA 2HBMA 3RJGA 3BZKA 2E3TA 5ALMA 1ZQCA 3Q8RB 5J0UA 2Y1JA 5CEHA 4FBTA 1SB3C 2OHFA 1KFSA 1ED1A 4YD2A 2NV3A 3C29A 1S0MA 1Z3EB 3UMGA 1SKRA 3PNCA 1ZETA 2DBYA 1NI3A 4X5VA 2V4QA 1L7OA 3MR3A 1Q3UA 4KLHA 8ICBA 1SZHA 3IG8A 2E1FA 1U9LA 3N97B 3MR2A 4QZGA 1JALA 5HP4A 2KZ3A 4B9UA 4UAZA 4EEKA 1WWVA 1S77D 1NK7A 2W54A 1ZJMA 3FDSA 4AYBF 5KG3A 2PFNA 3H0LB 3KOOA 2WF6A 8ICNA 1N56A 3OHAA 5E79U 2WF5A 3QUTA 2Y0SC 4C4TA 2IMWP 4Y2JA 2E5SA 4DOBA 1TAUA 5J0PA 4O9MA 1A76A 4KLOA 4YD1A 5CRXA 4EX6A 2KSOA 3PSPA 4M6WB 1TE2A 2PMZF 1V38A 1KN5A 2PI5A 1CUKA 3BZCA 5J2AA 2LKYA 4K4IA 2W3SA 3MFIA 1NJXA 1ZD5A 4CGZA 5AKZA 1DXSA 2KHVA 9ICTA 1BPDA 1QSYA 2NRXA 2KZMA 3RH4A 4PHEA 5KTQA 4RNOA 3KKAA 4EZ6A 5EWFA 1Z4OA 1T7PA 3N7SC 2I5HA 3SMVA 3GILA 2GWSA 2E8PA 7ICRA 2N1RA 3QUCA 4DLEA 5ALEA 2XGQA 4QNLA 5J0XA 3OPXA 3BQ0A 5KL8B 4ED7A 2EAOA 2KKVA 2ZIWB 9ICUA 4O5CA 1SV0C 1MC8A 3QU9A 5L1JA 1SL0A 3G6XA 4BGDA 2BHNA 2MSNA 4NLGA 2HHUA 1L7PA 1ECWA 2H5XA 2PMZC 1PK1B 3RJIA 1J2NA 9ICGA 2BR0A 3AMZA 4ED8A 3GFKB 2YN4A 1A77A 3TQ1A 8ICSA 4GIBA 3E58A 1AQ6A 7ICLA 4RQ1A 1NOMA 1FFVA 5CB1A 4CNQA 3UXPA 3E0FA 4UB2A 3QU2A 1U47A 4RQ8A 2FE9A 4E0DA 2FPMA 2BCQA 2RDIA 5F3XB 5KFNA 4RU9A 1UHUA 4ELTA 5KT2A 1V97A 3QYPA 5ALPA 1UA0A 5L1LA 5J0YA 2J6SA 3V72A 1BPXA 5ALIA 2XY5A 4UW9A 2YMQA 2JHDA 4OJ6A 3TAQA 2FI1A 8ICKA 1SGGA 1JIHA 2DKZA 4RQNA 4I29A 2EDUA 5DB6A 1KQQA 4M47A 5KFFA 4DWIA 5JTIA 3Q8KA 8ICPA 1IXRA 2KSOB 2F77X 1ZYQA 4GXIA 2Y9UA 5B5EU 4ELVA 4P0QA 3M8RA 2FLLA 5G5GA 2HHSA 8ICVA 1N2XA 4O3RA 4YQWA 3V7JA 4J9MA 4TQRA 3D2SA 3CW2C 3ZD8A 1ZQEA 3L3FX 3PR5B 2BDPA 2I9GA 2OEHA 2Y0SF 1RM6C 2FMPA 1Z1BA 1FIQA 4TQSA 2QB0B 5CJ7A 2ZJAA 1CEZA 3OJSA 4Y2PA 2JH7A 4ECQA 1X9SA 5CHGA 4YMNA 4UAYA 4M2YA 2W03A 4ECZA 5J2CA 5IIOA 4ECTA 1X66A 1JX4A 2HBLA 2K4EA 2W8KA 3I76A 3RTVA 2H3ZA 1LKYA 1QCKA 4IQVA 2EZZA 5KT5A 3ISCA 2WF8A 4B6JA 4ECXA 1RDFA 1S76D 3GIJA 1SWWA 1D9DA 8ICEA 2B6GA 3UPQA 4J9PA 2HOIA 8ICOA 1ZQYA 4QWBA 1S0VA 4DFMA 4F8RA 3NVZA 3MR5A 9ICBA 2KIVA 4Y2UA 2DQNB 1PVPA 1ZQNA 3U26A 5KFOA 1Q8KA 2XGPA 2XO7A 4PHDA 1Q46A 1KFDA 9ICHA 3AU2A 3GV7B 3SV3A 1YZ6A 4DOAA 4CF4A 4BXOA 2CPRA 4J9NA 5ALLA 2K4HA 4DO9A 3Q8PB 1YZ7A 3IDWA 2FLPA 4ED6A 4KN7A 4F4XA 1F44A 3A0HU 5DBCA 2AH5A 4NJ8A 4IQUA 4JV1A 5HNKA 2W3RA 5KT4A 3ORYA 3LDAA 4UBBA 5AM4A 3LK9A 1ZQJA 2VKQA 2JEJA 4RPYA 2P6UA 2MA1A 5AK4A 1ZQQA 2PFPA 1KEJA 3PW4A 8ICIA 2A1JB 4M6WA 2KMDA 2OYYA 9ICKA 2LMRA 2RHFA 1WG8A 4R8UB 2JEFA 1TVAA 1LB2B 2KVCA 2GO7A 3MGIA 1VJ5A 4BUGA 4TURA 5IIJA 3BDPA 4OJPA 4Y2XA 1XO1A 2HVHA 4O3PA 1XU4A 1S9FA 2FLNA 2BPGA 3ZDAA 5KFYA 5CP2A 4KLFA 3TAPA 1D8YA 2JEIA 3A0BU 3Q8SB 3ICXA 3QNMA 2BKEA 2F2AB 4DS5A 3BQ2A 1TK0A 2M0NA 3NS1A 5AKEA 4YMOA 3H8SA 1SXEA 5KG4A 2W9AA 5IIIA 4F5RA 4ZH4A 1ZQPA 7ICTA 5AKJA 3OSNA 2WAQC 2DF4B 2WTFA 3NGDA 3CNHA 2RLTA 3MBYA 4DFDA 7ICMA 4YR2A 4OCZA 3RB6A 4MFAA 5KFBA 9ICSA 2XY7A 1B22A 3C1ZA 4NLCA 1T8EA 3C2MA 4I2BA 3VC8A 4F92B 3MDCA 1QQ7A 1D9FA 3PMNA 2UVVA 9ICFA 4F4ZA 2EAMA 2E1EA 8ICLA 1T94A 4QZIA 4UB4A 1XSPA 1DOQA 5J0WA 4GC6A 5ALQA 2KEYA 5IILA 4B9MA 4Q43A 1A6SA 3KBBA 4P0PB 3F2DA 5ALGA 2HDOA 4KLUA 3AM9A 3GIMA 4CCHA 3JPSA 1X6IA 1PUZA 5DGBA 1T3NA 4I27A 2LHTA 3LWLA 1BVSA 3KZXA 4UB8U 1HUZA 3H8JA 2MUTB 3EUB2 3DEEA 3GIKA 2YMLA 4P0PA 3K1RB 5AKYA 2W04A 2VA8A 2ESEA 1N5XA 3RBEA 3JPTA 3LVVA 4K4GA 2G5HB 2JXJA 3UM9A 4Y2RA 2XC9A 2R8JA 4BX9C 4ECUA 4YG2A 4DL5A 4ECYA 3UMCA 1KRPA 8ICTA 1BPEA 1U48A 5J0QA 2DPJA 9ICNA 1C7YA 4Y2YA 2FMSA 3H40A 3ZDCA 5AHXA 2F1HA 3HILA 3BQ1A 1RG6A 2QARB 3K75D 3SENA 3WK5A 3WK7A 1WCLA 5KFDA 4HAIA 3JPOA 2CRXA 4QIWC 3ED5A 2DKXA 3FM9A 1ZQFA 3D2QA 5J2DA 3RF9A 3WKCA 1BNOA 4KLQA 4QWCA 2R18A 3RJFA 4XA5A 1ZQLA 2DPIA 5C0YA 3PW5A 1V9PA 4EBEA 1UT8A 2AJQA 5ALXA 1Z4NA 3HPOA 1V85A 7ICOA 4Z6EA 4JV0A 3RAQA 2ASDA 3F53A 1WCNA 2DGZA 4XQ8A 5JUMA 5ALOA 5J0TA 2K8BB 3EPIA 5KG2A 3THVA 4KMOB 1SKWA 5BOLA 4PL1A 2ZTCA 3CRXA 5KFJA 3TANA 3PW0A 2KVSA 4MF8A 3ETRA 2BQUA 4DSEA 4PH5A 9ICIA 3H4DA 2ZIWA 4ECVA 1SIJA 3WKDA 2HBKA 1PK1A 2JV3A 2I6XA 2WF7A 3AQFA 2JEGA 3NVYA 4F91B 4J9LA 1RXVA 1QTMA 4Z6DA 2QB0A 1ZQBA 3GDXA 1FFUA 2DFLA 1COOA 2BPFA 1L7MA 2OM6A 1UA1A 3NVWA 1B43A 2KNJA 1K1QA 5AKLA 4KLLA 1RXWA 5ALSA 2GLEA 4EBDA 2E8MA 2ZUDA 3H0RB 4PGXA 1SXDA 3SV4A 4FZLA 3LVWA 5KFXA 5AM3A 3PW2A 2KP7A 5HR7A 1COKA 3I1YA 3G6VA 3AU6A 3B0XA 4FFDA 3N7PD 4GFJA 4RNNA 3E2EA 5KFWA 4P4OA 2EAPA 3ZD9A 4EZ9A 2KICA
chains in the Genus database with same CATH topology
4NL9A 2DKXA 5JTIA 2KSOB 4NL9C 2E8NA 3H8MA 2Y9UA 2E8PA 2K4PA 4PZOA 3IDWA 1SV0A 4MHVA 4NJ8A 1V85A 2KG5A 2D3DA 2EAMA 2QB1A 2Y9TA 1OXJA 2QARA 2EAOA 2L5YA 1SV0C 5JU5A 4RQMA 3SEIA 3TADA 1X40A 4IS7A 2KMDA 1Z1VA 1SV4A 2F3NA 1WWVA 3TADC 1LKYB 2LMRA 1JI7A 2QB0B 1WWUA 1B4FA 1PK1B 5KNIA 3KKAC 3BS5A 2E8OA 1UQVA 2DL0A 2EANA 1PK1A 1X66A 2JV3A 1KW4A 4PZNA 3TACB 1F0MA 3K1RB 1LKYA 3BS7A 2YTUA 2ESEA 2QB0A 2FE9A 2KSOA 5F3XB 2B6GA 3BS5B 1V38A 2F8KA 2F44A 2GLEA 2E8MA 1SXDA 5J8YC 1B0XA 5JRTA 1SXEA 2KIVA 1DXSA 1UCVA 1PK3A 2ES6A 3HILA 1COKA 1RG6A 2QARB 2LPEA 2K60A 5J8YA 1OW5A 3BQ7A 3SENA 5L1MA 2D8CA 1X9XA 3KKAA 2KE7A 2QKQA 1SGGA 2EAPA 2DKZA 4RQNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NL9 A;  2DKX A;  5JTI A;  2KSO B;  4NL9 C;  2E8N A;  3H8M A;  2Y9U A;  2E8P A;  2K4P A;  4PZO A;  3IDW A;  1SV0 A;  4MHV A;  4NJ8 A;  1V85 A;  2KG5 A;  2D3D A;  2EAM A;  2QB1 A;  2Y9T A;  1OXJ A;  2QAR A;  2EAO A;  2L5Y A;  1SV0 C;  5JU5 A;  4RQM A;  3SEI A;  3TAD A;  1X40 A;  4IS7 A;  2KMD A;  1Z1V A;  1SV4 A;  2F3N A;  1WWV A;  3TAD C;  1LKY B;  2LMR A;  1JI7 A;  2QB0 B;  1WWU A;  1B4F A;  1PK1 B;  5KNI A;  3KKA C;  3BS5 A;  2E8O A;  1UQV A;  2DL0 A;  2EAN A;  1PK1 A;  1X66 A;  2JV3 A;  1KW4 A;  4PZN A;  3TAC B;  1F0M A;  3K1R B;  1LKY A;  3BS7 A;  2YTU A;  2ESE A;  2QB0 A;  2FE9 A;  2KSO A;  5F3X B;  2B6G A;  3BS5 B;  1V38 A;  2F8K A;  2F44 A;  2GLE A;  2E8M A;  1SXD A;  5J8Y C;  1B0X A;  5JRT A;  1SXE A;  2KIV A;  1DXS A;  1UCV A;  1PK3 A;  2ES6 A;  3HIL A;  1COK A;  1RG6 A;  2QAR B;  2LPE A;  2K60 A;  5J8Y A;  1OW5 A;  3BQ7 A;  3SEN A;  5L1M A;  2D8C A;  1X9X A;  3KKA A;  2KE7 A;  2QKQ A;  1SGG A;  2EAP A;  2DKZ A;  4RQN A; 
#chains in the Genus database with same CATH topology
 4IR1 A;  3M9O B;  2ALZ A;  3TFS A;  5KL1 B;  3SAG A;  5DB8 A;  1QSL A;  1ZQW A;  2Q0Z X;  4DQI A;  3C2L A;  4M9H A;  5KFV A;  4EEY A;  1NJW A;  4F3O A;  2D3D A;  5J2E A;  3WK8 A;  3PSF A;  1CI4 A;  5IIK A;  2QAR A;  5FP0 A;  4RQ2 A;  4Z6C A;  1ZQR A;  5KFP A;  2WB1 F;  4JB3 A;  4DSI A;  3IV6 A;  2Y1I A;  2MUT A;  5HHH A;  1MQ2 A;  4DQS A;  3ZDD A;  4FBU A;  4F50 A;  1RQN A;  1HUO A;  5CWR A;  4DFJ A;  2A19 A;  2RDJ A;  4NM2 A;  5GTI U;  3T3F A;  1ZRM A;  4I2A A;  3CYM A;  4IL6 U;  4XUS A;  1N48 A;  3V7L A;  1Z00 A;  1F5S A;  4ECS A;  3FYH A;  5J2F A;  1ZRN A;  2PFO A;  2F8L A;  2O6K A;  4TUQ A;  9ICC A;  3RB0 A;  1XSL A;  2ZUC A;  2XIC A;  3NUQ A;  3PST A;  1S8O A;  3RB3 A;  2W9B A;  3IP4 B;  5KT3 A;  3M6K A;  1JXE A;  3QU4 A;  5KFE A;  3BS5 B;  4Q8F A;  4J9K A;  3WK4 A;  5AIA A;  2KJ9 A;  5KT6 A;  4QZF A;  2UVU A;  2AU0 A;  8ICC A;  5KFQ A;  5J8Y C;  4FS1 A;  4G3I A;  5KFH A;  3T5K A;  1X6J A;  4MEX A;  4P0Q B;  2ES6 A;  5TZV A;  2ASL A;  2XCA A;  5J2J A;  3SZ2 A;  4K4H A;  1X9W A;  2PI4 A;  4FZN A;  1DGJ A;  3KFU F;  1X9X A;  4QZA A;  4YR3 A;  5ALZ A;  4DFK A;  3ALR A;  3EW9 A;  5KAI U;  3KHH A;  3M7D A;  3WU2 U;  3T5L A;  4F5O A;  1J97 A;  1NZP A;  4NXZ A;  8ICR A;  2W9B B;  2FJ6 A;  4CRX A;  2KIW A;  1QQ5 A;  3RR8 A;  1L5U A;  7ICJ A;  2W9C B;  2G08 A;  2R8G A;  2ZIU A;  4MHV A;  2AQ0 A;  4USA A;  3MAB A;  5L9X A;  5KT7 A;  1H38 A;  8ICG A;  4US9 A;  3LWM A;  3RAX A;  3TAR A;  3NVV A;  2H3I A;  2JR5 A;  2L5Y A;  7ICP A;  1XC9 A;  2JH1 A;  4AYB C;  1N60 A;  7ICU A;  5D46 A;  2F3N A;  2BCU A;  4F2R A;  3MFH A;  2LBO A;  5CR0 A;  4PGY A;  2AQ4 A;  3FAH A;  1JRP A;  4QZE A;  1JN3 A;  2DL0 A;  4UB5 A;  4UAT A;  1DGS A;  3T5J A;  3MC1 A;  1HJP A;  4P4P A;  5KAF U;  1SZP A;  4KLS A;  4IC9 A;  5AI6 A;  1X9M A;  5J2I A;  4DCC A;  4LJX A;  3ISB A;  4UB6 U;  1FO4 A;  2ZIV A;  1B0X A;  2UVW A;  1NJZ A;  2IBK A;  4DL6 A;  4F4W A;  1ZOL A;  5T14 A;  3EPG A;  2ZTD A;  5DB7 A;  3QZ8 A;  4YCX A;  2XID A;  8ICY A;  4IRD A;  1Z19 A;  4KLE A;  3N28 A;  2G07 A;  3IRU A;  1S0N A;  5AK6 A;  4GXJ A;  1X2I A;  2G0A A;  3L4P A;  2WB1 C;  4I2J A;  1ZXI A;  2QLT A;  5ALN A;  4XRH A;  5KG0 A;  4RQ3 A;  5J2B A;  3H8M A;  4KLI A;  8ICW A;  2ODG A;  2KZZ A;  1IV8 A;  4F5N A;  5KFZ A;  2ZIX A;  2Q4T A;  4QIW F;  4GC7 A;  3M9N B;  5ALY A;  3SEI A;  1NK5 A;  2LYA A;  4UAW A;  3HKZ F;  2HI0 A;  2PKE A;  4M9L A;  4DQR A;  1ZJN A;  1ZQU A;  3UXO A;  2OCE A;  2IHM A;  8ICH A;  3QU5 A;  1L3T A;  1BPZ A;  2DUY A;  2F1J A;  5J0O A;  2HMX A;  3NTU A;  5KFI A;  4F93 B;  3GV5 B;  4U6P A;  2H3V A;  4NLN A;  3HWT A;  1ZQZ A;  2LI6 A;  2HHX A;  2CXY A;  2BGW A;  3AQE A;  3NAS A;  3KD3 A;  4PL2 A;  3NRZ A;  1NKC A;  1D8L A;  1F0M A;  3AUO A;  4B9L A;  2AGP A;  1MQ3 A;  4CDG A;  3GU3 A;  1KBU A;  3PML A;  1NK9 A;  4Y2Q A;  4EEN A;  2HHT A;  4BJQ A;  2W43 A;  1WYG A;  2C28 A;  5IIM A;  5J2G A;  5C5J A;  3PVX A;  4DL4 A;  1DK3 A;  4LZD A;  3BQT A;  4QW8 A;  1SWV A;  3HT3 A;  3HJE A;  3PZP A;  2ZIU B;  1MSW D;  1S0O A;  4HYK A;  3F5E A;  5L1M A;  4J9O A;  2EZX A;  4B9V A;  1L3S A;  5J0S A;  5HHI A;  5KFS A;  3SAH A;  3M1Y A;  2V4R A;  5F9N A;  3HKZ C;  1MA7 A;  2C22 A;  7ICE A;  5DQH A;  4DFP A;  4Z6F A;  2KHQ A;  3T5H A;  3RFA A;  5AKK A;  9ICL A;  5EWE A;  2K89 A;  2KD1 A;  3TKA A;  3RB4 A;  2F76 X;  3WK6 A;  4WJ3 B;  1ZQI A;  2XCP A;  2DWQ A;  5EOZ A;  8ICX A;  4KTQ A;  1ZQK A;  5DLF A;  5DG7 A;  4M04 A;  3M8S A;  5ALW A;  4RQM A;  1X40 A;  4IS7 A;  4PGQ A;  2WAQ F;  1NNL A;  2W9M A;  4PPX A;  2ZG6 A;  4O3S A;  3TAD C;  3PX4 A;  1RQL A;  1IIP A;  4KIT B;  2ZUB A;  4C8M A;  1L8L A;  1EXN A;  3MGV A;  1UQV A;  1L8O A;  4ZOH C;  3QE9 Y;  4YR0 A;  4EEL A;  1L7N A;  2YX8 A;  9ICM A;  2BZF A;  4YVZ A;  1TAQ A;  3EZ5 A;  2CN1 A;  1KW4 A;  8ICA A;  1NK4 A;  1N5W A;  4QWA A;  3RJH A;  5AK3 A;  4O3O A;  1TK8 A;  2JGA A;  3ETL A;  4F72 A;  4IQW A;  1QH9 A;  5AI9 A;  5AKX A;  4J9S A;  4C7Z A;  3V6H A;  3GII A;  3Q8L A;  2C2R A;  4QZC A;  5JRT A;  2KFZ A;  1UCV A;  2HOF A;  5ALU A;  3J81 j;  5DDY A;  1NK8 A;  1ZQH A;  2QKQ A;  1VLB A;  4RNM A;  1SKS A;  4EYI B;  2VA3 A;  3KHL A;  5AI5 A;  3WK9 A;  2HVI A;  4NL9 C;  8ICZ A;  3RJJ A;  2B21 A;  1ARO P;  3FC4 A;  4O5E A;  3K1Z A;  2KOB A;  4IRK A;  4I2D A;  1DK2 A;  1L3U A;  2WFA A;  2OXO A;  2YY6 A;  4DL7 A;  2VAN A;  4LVS A;  1N62 A;  5K4L A;  1J2M A;  3JPN A;  2KJ5 A;  2JMG A;  3L5K A;  3RBD A;  1OXJ A;  1C20 A;  4I2I A;  4YP3 A;  4O0I A;  3M6Z A;  4FZM A;  5AI4 A;  2KJ8 A;  1S5L U;  4O3N A;  1BPY A;  3PY8 A;  5EE1 A;  5J2H A;  2FPK A;  5DBB A;  1S97 A;  4I2C A;  1SV4 A;  3MR6 A;  4ICA A;  8ICF A;  4JWM A;  2C2D A;  2PFQ A;  1WWU A;  3TI0 A;  2ISO A;  5DB9 A;  3F2B A;  2ZIX B;  3KKA C;  5AIC A;  1NKB A;  2NRZ A;  4TUS A;  4C8O A;  4DL2 A;  7ICH A;  3GV8 B;  1IG6 A;  2RQ5 A;  4NWI A;  5KFM A;  5GTH U;  4UBC A;  2HBJ A;  2KTQ A;  2YTU A;  4Y2T A;  5KFU A;  4JK1 A;  3EWA A;  4I2G A;  9ICX A;  4QZ8 A;  5F9L A;  2W7P A;  1TKD A;  4ED3 A;  3WKE A;  4R64 A;  4OD0 A;  4DL3 A;  3H4B A;  4BXO B;  1X42 A;  4DF8 A;  1Z00 B;  3QU7 A;  1ZQO A;  3G6Y A;  2C2E A;  4CF3 A;  5EE0 A;  2LM1 A;  2RP5 A;  1FEZ A;  2BCS A;  3GQC A;  1MN8 A;  2HW3 A;  3QZ7 A;  1N61 A;  3RRG A;  2KKP A;  3QXG A;  5BOM A;  4AP9 A;  4M9J A;  4R65 A;  3HP6 A;  1S10 A;  3WKA A;  2XI9 A;  1U4B A;  4F71 A;  1XNS A;  2BPC A;  5AM1 A;  4A8E A;  4O3M A;  5D4B A;  4DS4 A;  2NRW A;  3V6K A;  5AIB A;  5KFG A;  1BNP A;  5EE9 A;  1HIW A;  2KG5 A;  5AM0 A;  3OSP A;  4YXJ A;  2ASJ A;  1LV5 A;  5IIN A;  1Q3V A;  4F4Y A;  2W8L A;  1HEK A;  3LYS A;  4DSF A;  3ISD A;  1Z1V A;  3Q8M A;  3O0F A;  2R8H A;  2LYH A;  1BGX T;  4RQ7 A;  3ZI4 A;  4KMU A;  5DG9 A;  3SD7 A;  2LYB A;  4Q44 A;  5DDM A;  3TFR A;  2OWO A;  3B0Y A;  1N63 A;  2KFN A;  3C23 A;  2G09 A;  1O08 A;  7ICV A;  3PX0 A;  4PZN A;  4KLM A;  2HHV A;  3RR7 A;  1URJ A;  1TFR A;  9ICE A;  1PZN A;  3PSI A;  1T3Q A;  4UAS A;  2AHO B;  2W11 A;  1JRO A;  4RT3 A;  2P66 A;  2YB1 A;  3H7I A;  4YN4 A;  3D2N A;  2IA6 A;  2ZJ8 A;  4DQP A;  4JMU A;  3IM1 A;  3AN1 A;  3QUQ A;  4G9B A;  3UMB A;  2BQ3 A;  2HHQ A;  5AK5 A;  1P7D A;  4UQG A;  3UQ0 A;  4C7Y A;  4C80 A;  2ZIV B;  4QWE A;  3HW8 A;  1WUD A;  2K8C B;  4BDP A;  3PV8 A;  4MF2 A;  4ECW A;  1O03 A;  3C28 A;  4ACO A;  5J2K A;  3AEV A;  2E8N A;  2Z7J A;  4B9N A;  3VCB A;  3EYZ A;  2ZTE A;  1KLN A;  4RQ4 A;  1TAM A;  2H3F A;  1GO3 F;  2IOF K;  2K8A A;  4Q8E A;  7ICS A;  1ZQG A;  4QWD A;  2AGQ A;  3JPP A;  4F4K A;  2ATL A;  5J29 A;  3JPQ A;  3JPR A;  3C2K A;  2ZJ5 A;  3PO5 A;  4CE6 A;  1B4F A;  5KNI A;  2V9W A;  1KFT A;  7ICG A;  4QZ9 A;  4GXK A;  2H3Q A;  1PVR A;  3S6J A;  4DSK A;  4QZH A;  3K4G A;  1KKX A;  2YB4 A;  2KK0 A;  7ICN A;  1M6Y A;  4RZR A;  1CRX A;  4UAV A;  4M0A A;  2EAN A;  1ZQS A;  5ALR A;  1IM4 A;  2HHW A;  1UT5 A;  2BCV A;  1SL2 A;  4GLX A;  3C1Y A;  4CF5 A;  3H8W A;  4FO6 A;  1ZD2 P;  1Y88 A;  9ICR A;  3MGH A;  4RPX A;  4O5K A;  4TUP A;  2LM4 A;  2MU2 A;  2J6U A;  2F8K A;  2YMP A;  3OGU A;  1ZQD A;  2PXI A;  3RRH A;  3RJE A;  1TV9 A;  4U7C A;  5AI0 A;  3KTQ A;  3M9M B;  9ICJ A;  5G5H A;  2M9N A;  1JMS A;  2D8C A;  2FDR A;  3KHG A;  2IOH A;  1NK6 A;  2A1A A;  5KFR A;  1L6N A;  4NY8 A;  5KFL A;  5AKH A;  4NLZ A;  2AXT U;  2GH1 A;  4I28 A;  1VDV A;  3V6J A;  3GZF A;  5DQI A;  2XY6 A;  2K4P A;  4KLT A;  3C21 A;  4PZO A;  3PO4 A;  4DLG A;  3KHR A;  4OJL A;  3UQ2 A;  3RJK A;  5KFC A;  2YQE A;  3PX6 A;  4LZG A;  4RQ6 A;  3N7R C;  5ALF A;  8ICM A;  4KX5 A;  3QEB Z;  2Y9T A;  5L1I A;  2GOL A;  4YXM A;  5ALD A;  4MFF A;  1LVH A;  3PW7 A;  1K1S A;  5KFT A;  2KN7 A;  9ICP A;  4KLJ A;  2D6F C;  4QJF B;  4US8 A;  4FS2 A;  3AL0 B;  5AKG A;  1ZQM A;  1A0P A;  2B0C A;  2EH9 A;  4DSJ A;  4BWM A;  5ALV A;  2R8I A;  1RPL A;  4RT2 A;  4Y2V A;  3BJY A;  1KTQ A;  4I2H A;  2P35 A;  4M9G A;  4IR9 A;  3DV9 A;  8ICQ A;  2I1Q A;  2VJ5 A;  2YMM A;  3IHQ B;  2NO5 A;  5AM2 A;  1YT3 A;  3B9J A;  2R8K A;  3QEA Z;  3N4M B;  4DEZ A;  4DF4 A;  4C8N A;  4ED0 A;  2NO4 A;  4RQ0 A;  1U45 A;  5DQG A;  2EZY A;  2NRV A;  4B9T A;  2HOQ A;  3KZI U;  5EE3 A;  4FE3 A;  1KSP A;  4OO1 J;  4UB1 A;  2K60 A;  5HMM A;  5A0L A;  5J8Y A;  1OW5 A;  3R9K A;  2W7O A;  5DKW A;  4NLK A;  2RRD A;  2WHE A;  4RUC A;  1OUQ A;  2A1J A;  2XVT A;  2BCR A;  3DDH A;  5TIS U;  4I2E A;  4C4R A;  3F5A A;  4IRC A;  1ZQX A;  3IG5 A;  4B9S A;  2HSZ A;  1PVQ A;  4QW9 A;  7ICK A;  4Q45 A;  2IHN A;  4OJ5 A;  4R66 A;  4P4M A;  5KG1 A;  4JUZ A;  2P6R A;  3PR4 A;  4R63 A;  2QB1 A;  4J03 A;  3NRW A;  5KFA A;  3OHB A;  5EWG A;  1KDH A;  3TAD A;  4J9Q A;  3CP8 A;  4DSL A;  4ED2 A;  4QZB A;  1ZD4 A;  1UPH A;  3UXN A;  2JZB B;  5D49 A;  4Y2S A;  7ICQ A;  4EYH B;  4ED1 A;  1JI7 A;  2K4I A;  4I2F A;  4MFC A;  2KV2 A;  5H2F U;  3T79 A;  1KL9 A;  3ZDB A;  2FPL A;  2MAX A;  3ZDE A;  4KN4 A;  2E8O A;  5L1K A;  4F5Q A;  1QQ6 A;  5ALK A;  4RPZ A;  1QSS A;  1U49 A;  5HR6 A;  3BS7 A;  4EX7 A;  4C8L A;  2JRZ A;  2FMQ A;  5DBA A;  4R8U A;  1XS9 D;  1RZT A;  4KLD A;  9ICW A;  3MDA A;  9ICQ A;  4ELU A;  4DQQ A;  3WKB A;  5DG8 A;  4RQ5 A;  4RUA A;  1ZQT A;  2NYV A;  4UB3 A;  1NZB A;  2OH2 A;  3QX7 A;  4PJ0 U;  3IN5 A;  2BDU A;  2UVR A;  1ZQA A;  1PK3 A;  5HML A;  3H0M B;  5BPC A;  2AGO A;  2MRL A;  4NV0 A;  1NJY A;  1XWL A;  4QZD A;  3RH5 A;  4NL9 A;  2BQR A;  3HX0 A;  1RYR A;  5KG6 A;  3D6J A;  5J0R A;  3OJU A;  2HCF A;  4IQT A;  2VJ4 A;  3RH6 A;  1SV0 A;  4C8K A;  2G5I B;  1SL1 A;  1NK0 A;  8ICU A;  1RYS A;  2ZXI A;  1ZD3 A;  1ZQV A;  2F1I A;  9ICV A;  3C5F A;  4F2S A;  1T4G A;  4J9R A;  5CA7 A;  5AI8 A;  1XSN A;  5DLG A;  4JWN A;  1DRG A;  5AM5 A;  2IOF A;  5JU5 A;  4KLG A;  2W55 A;  4MEY A;  4F5P A;  5KG7 A;  2J6T A;  3Q8Q B;  5ALH A;  4P2H A;  1LKY B;  5AKI A;  1D8B A;  3HRD D;  3SYZ A;  7ICI A;  3SAF A;  2VA2 A;  1JXL A;  2WF9 A;  3F2C A;  3BS5 A;  4PHA A;  3SQI A;  2JZB A;  3SI8 A;  1XO0 A;  5KG5 A;  3QUB A;  2ZXH A;  4YMM A;  4EBC A;  3OTQ A;  1ZQ1 C;  4JV2 A;  9ICA A;  4NM1 A;  1RYU A;  3TAC B;  2ISP A;  5ALJ A;  2EQY A;  4NLB A;  3SR6 A;  2G06 A;  4M9N A;  5ALT A;  4PHP A;  4DOC A;  4KX3 A;  5B66 U;  4ECR A;  9ICO A;  1JUD A;  1BPB A;  4C4S A;  1QLN A;  2A3V A;  2F44 A;  4UAR A;  4O3Q A;  3V7K A;  8ICJ A;  5DGA A;  1TK5 A;  2VIX A;  4BWJ A;  4C0Z A;  4OJO A;  4YFK A;  3I28 A;  2W9C A;  2LPE A;  3ONN A;  7ICF A;  2NRT A;  1L3V A;  3BQ7 A;  1NKE A;  4UAU A;  3C5G A;  5KFK A;  2KE7 A;  1K5O A;  2HBM A;  3RJG A;  3BZK A;  2E3T A;  5ALM A;  1ZQC A;  3Q8R B;  5J0U A;  2Y1J A;  5CEH A;  4FBT A;  1SB3 C;  2OHF A;  1KFS A;  1ED1 A;  4YD2 A;  2NV3 A;  3C29 A;  1S0M A;  1Z3E B;  3UMG A;  1SKR A;  3PNC A;  1ZET A;  2DBY A;  1NI3 A;  4X5V A;  2V4Q A;  1L7O A;  3MR3 A;  1Q3U A;  4KLH A;  8ICB A;  1SZH A;  3IG8 A;  2E1F A;  1U9L A;  3N97 B;  3MR2 A;  4QZG A;  1JAL A;  5HP4 A;  2KZ3 A;  4B9U A;  4UAZ A;  4EEK A;  1WWV A;  1S77 D;  1NK7 A;  2W54 A;  1ZJM A;  3FDS A;  4AYB F;  5KG3 A;  2PFN A;  3H0L B;  3KOO A;  2WF6 A;  8ICN A;  1N56 A;  3OHA A;  5E79 U;  2WF5 A;  3QUT A;  2Y0S C;  4C4T A;  2IMW P;  4Y2J A;  2E5S A;  4DOB A;  1TAU A;  5J0P A;  4O9M A;  1A76 A;  4KLO A;  4YD1 A;  5CRX A;  4EX6 A;  2KSO A;  3PSP A;  4M6W B;  1TE2 A;  2PMZ F;  1V38 A;  1KN5 A;  2PI5 A;  1CUK A;  3BZC A;  5J2A A;  2LKY A;  4K4I A;  2W3S A;  3MFI A;  1NJX A;  1ZD5 A;  4CGZ A;  5AKZ A;  1DXS A;  2KHV A;  9ICT A;  1BPD A;  1QSY A;  2NRX A;  2KZM A;  3RH4 A;  4PHE A;  5KTQ A;  4RNO A;  3KKA A;  4EZ6 A;  5EWF A;  1Z4O A;  1T7P A;  3N7S C;  2I5H A;  3SMV A;  3GIL A;  2GWS A;  2E8P A;  7ICR A;  2N1R A;  3QUC A;  4DLE A;  5ALE A;  2XGQ A;  4QNL A;  5J0X A;  3OPX A;  3BQ0 A;  5KL8 B;  4ED7 A;  2EAO A;  2KKV A;  2ZIW B;  9ICU A;  4O5C A;  1SV0 C;  1MC8 A;  3QU9 A;  5L1J A;  1SL0 A;  3G6X A;  4BGD A;  2BHN A;  2MSN A;  4NLG A;  2HHU A;  1L7P A;  1ECW A;  2H5X A;  2PMZ C;  1PK1 B;  3RJI A;  1J2N A;  9ICG A;  2BR0 A;  3AMZ A;  4ED8 A;  3GFK B;  2YN4 A;  1A77 A;  3TQ1 A;  8ICS A;  4GIB A;  3E58 A;  1AQ6 A;  7ICL A;  4RQ1 A;  1NOM A;  1FFV A;  5CB1 A;  4CNQ A;  3UXP A;  3E0F A;  4UB2 A;  3QU2 A;  1U47 A;  4RQ8 A;  2FE9 A;  4E0D A;  2FPM A;  2BCQ A;  2RDI A;  5F3X B;  5KFN A;  4RU9 A;  1UHU A;  4ELT A;  5KT2 A;  1V97 A;  3QYP A;  5ALP A;  1UA0 A;  5L1L A;  5J0Y A;  2J6S A;  3V72 A;  1BPX A;  5ALI A;  2XY5 A;  4UW9 A;  2YMQ A;  2JHD A;  4OJ6 A;  3TAQ A;  2FI1 A;  8ICK A;  1SGG A;  1JIH A;  2DKZ A;  4RQN A;  4I29 A;  2EDU A;  5DB6 A;  1KQQ A;  4M47 A;  5KFF A;  4DWI A;  5JTI A;  3Q8K A;  8ICP A;  1IXR A;  2KSO B;  2F77 X;  1ZYQ A;  4GXI A;  2Y9U A;  5B5E U;  4ELV A;  4P0Q A;  3M8R A;  2FLL A;  5G5G A;  2HHS A;  8ICV A;  1N2X A;  4O3R A;  4YQW A;  3V7J A;  4J9M A;  4TQR A;  3D2S A;  3CW2 C;  3ZD8 A;  1ZQE A;  3L3F X;  3PR5 B;  2BDP A;  2I9G A;  2OEH A;  2Y0S F;  1RM6 C;  2FMP A;  1Z1B A;  1FIQ A;  4TQS A;  2QB0 B;  5CJ7 A;  2ZJA A;  1CEZ A;  3OJS A;  4Y2P A;  2JH7 A;  4ECQ A;  1X9S A;  5CHG A;  4YMN A;  4UAY A;  4M2Y A;  2W03 A;  4ECZ A;  5J2C A;  5IIO A;  4ECT A;  1X66 A;  1JX4 A;  2HBL A;  2K4E A;  2W8K A;  3I76 A;  3RTV A;  2H3Z A;  1LKY A;  1QCK A;  4IQV A;  2EZZ A;  5KT5 A;  3ISC A;  2WF8 A;  4B6J A;  4ECX A;  1RDF A;  1S76 D;  3GIJ A;  1SWW A;  1D9D A;  8ICE A;  2B6G A;  3UPQ A;  4J9P A;  2HOI A;  8ICO A;  1ZQY A;  4QWB A;  1S0V A;  4DFM A;  4F8R A;  3NVZ A;  3MR5 A;  9ICB A;  2KIV A;  4Y2U A;  2DQN B;  1PVP A;  1ZQN A;  3U26 A;  5KFO A;  1Q8K A;  2XGP A;  2XO7 A;  4PHD A;  1Q46 A;  1KFD A;  9ICH A;  3AU2 A;  3GV7 B;  3SV3 A;  1YZ6 A;  4DOA A;  4CF4 A;  4BXO A;  2CPR A;  4J9N A;  5ALL A;  2K4H A;  4DO9 A;  3Q8P B;  1YZ7 A;  3IDW A;  2FLP A;  4ED6 A;  4KN7 A;  4F4X A;  1F44 A;  3A0H U;  5DBC A;  2AH5 A;  4NJ8 A;  4IQU A;  4JV1 A;  5HNK A;  2W3R A;  5KT4 A;  3ORY A;  3LDA A;  4UBB A;  5AM4 A;  3LK9 A;  1ZQJ A;  2VKQ A;  2JEJ A;  4RPY A;  2P6U A;  2MA1 A;  5AK4 A;  1ZQQ A;  2PFP A;  1KEJ A;  3PW4 A;  8ICI A;  2A1J B;  4M6W A;  2KMD A;  2OYY A;  9ICK A;  2LMR A;  2RHF A;  1WG8 A;  4R8U B;  2JEF A;  1TVA A;  1LB2 B;  2KVC A;  2GO7 A;  3MGI A;  1VJ5 A;  4BUG A;  4TUR A;  5IIJ A;  3BDP A;  4OJP A;  4Y2X A;  1XO1 A;  2HVH A;  4O3P A;  1XU4 A;  1S9F A;  2FLN A;  2BPG A;  3ZDA A;  5KFY A;  5CP2 A;  4KLF A;  3TAP A;  1D8Y A;  2JEI A;  3A0B U;  3Q8S B;  3ICX A;  3QNM A;  2BKE A;  2F2A B;  4DS5 A;  3BQ2 A;  1TK0 A;  2M0N A;  3NS1 A;  5AKE A;  4YMO A;  3H8S A;  1SXE A;  5KG4 A;  2W9A A;  5III A;  4F5R A;  4ZH4 A;  1ZQP A;  7ICT A;  5AKJ A;  3OSN A;  2WAQ C;  2DF4 B;  2WTF A;  3NGD A;  3CNH A;  2RLT A;  3MBY A;  4DFD A;  7ICM A;  4YR2 A;  4OCZ A;  3RB6 A;  4MFA A;  5KFB A;  9ICS A;  2XY7 A;  1B22 A;  3C1Z A;  4NLC A;  1T8E A;  3C2M A;  4I2B A;  3VC8 A;  4F92 B;  3MDC A;  1QQ7 A;  1D9F A;  3PMN A;  2UVV A;  9ICF A;  4F4Z A;  2EAM A;  2E1E A;  8ICL A;  1T94 A;  4QZI A;  4UB4 A;  1XSP A;  1DOQ A;  5J0W A;  4GC6 A;  5ALQ A;  2KEY A;  5IIL A;  4B9M A;  4Q43 A;  1A6S A;  3KBB A;  4P0P B;  3F2D A;  5ALG A;  2HDO A;  4KLU A;  3AM9 A;  3GIM A;  4CCH A;  3JPS A;  1X6I A;  1PUZ A;  5DGB A;  1T3N A;  4I27 A;  2LHT A;  3LWL A;  1BVS A;  3KZX A;  4UB8 U;  1HUZ A;  3H8J A;  2MUT B;  3EUB 2;  3DEE A;  3GIK A;  2YML A;  4P0P A;  3K1R B;  5AKY A;  2W04 A;  2VA8 A;  2ESE A;  1N5X A;  3RBE A;  3JPT A;  3LVV A;  4K4G A;  2G5H B;  2JXJ A;  3UM9 A;  4Y2R A;  2XC9 A;  2R8J A;  4BX9 C;  4ECU A;  4YG2 A;  4DL5 A;  4ECY A;  3UMC A;  1KRP A;  8ICT A;  1BPE A;  1U48 A;  5J0Q A;  2DPJ A;  9ICN A;  1C7Y A;  4Y2Y A;  2FMS A;  3H40 A;  3ZDC A;  5AHX A;  2F1H A;  3HIL A;  3BQ1 A;  1RG6 A;  2QAR B;  3K75 D;  3SEN A;  3WK5 A;  3WK7 A;  1WCL A;  5KFD A;  4HAI A;  3JPO A;  2CRX A;  4QIW C;  3ED5 A;  2DKX A;  3FM9 A;  1ZQF A;  3D2Q A;  5J2D A;  3RF9 A;  3WKC A;  1BNO A;  4KLQ A;  4QWC A;  2R18 A;  3RJF A;  4XA5 A;  1ZQL A;  2DPI A;  5C0Y A;  3PW5 A;  1V9P A;  4EBE A;  1UT8 A;  2AJQ A;  5ALX A;  1Z4N A;  3HPO A;  1V85 A;  7ICO A;  4Z6E A;  4JV0 A;  3RAQ A;  2ASD A;  3F53 A;  1WCN A;  2DGZ A;  4XQ8 A;  5JUM A;  5ALO A;  5J0T A;  2K8B B;  3EPI A;  5KG2 A;  3THV A;  4KMO B;  1SKW A;  5BOL A;  4PL1 A;  2ZTC A;  3CRX A;  5KFJ A;  3TAN A;  3PW0 A;  2KVS A;  4MF8 A;  3ETR A;  2BQU A;  4DSE A;  4PH5 A;  9ICI A;  3H4D A;  2ZIW A;  4ECV A;  1SIJ A;  3WKD A;  2HBK A;  1PK1 A;  2JV3 A;  2I6X A;  2WF7 A;  3AQF A;  2JEG A;  3NVY A;  4F91 B;  4J9L A;  1RXV A;  1QTM A;  4Z6D A;  2QB0 A;  1ZQB A;  3GDX A;  1FFU A;  2DFL A;  1COO A;  2BPF A;  1L7M A;  2OM6 A;  1UA1 A;  3NVW A;  1B43 A;  2KNJ A;  1K1Q A;  5AKL A;  4KLL A;  1RXW A;  5ALS A;  2GLE A;  4EBD A;  2E8M A;  2ZUD A;  3H0R B;  4PGX A;  1SXD A;  3SV4 A;  4FZL A;  3LVW A;  5KFX A;  5AM3 A;  3PW2 A;  2KP7 A;  5HR7 A;  1COK A;  3I1Y A;  3G6V A;  3AU6 A;  3B0X A;  4FFD A;  3N7P D;  4GFJ A;  4RNN A;  3E2E A;  5KFW A;  4P4O A;  2EAP A;  3ZD9 A;  4EZ9 A;  2KIC A; 
#chains in the Genus database with same CATH homology
 4NL9 A;  2DKX A;  5JTI A;  2KSO B;  4NL9 C;  2E8N A;  3H8M A;  2Y9U A;  2E8P A;  2K4P A;  4PZO A;  3IDW A;  1SV0 A;  4MHV A;  4NJ8 A;  1V85 A;  2KG5 A;  2D3D A;  2EAM A;  2QB1 A;  2Y9T A;  1OXJ A;  2QAR A;  2EAO A;  2L5Y A;  1SV0 C;  5JU5 A;  4RQM A;  3SEI A;  3TAD A;  1X40 A;  4IS7 A;  2KMD A;  1Z1V A;  1SV4 A;  2F3N A;  1WWV A;  3TAD C;  1LKY B;  2LMR A;  1JI7 A;  2QB0 B;  1WWU A;  1B4F A;  1PK1 B;  5KNI A;  3KKA C;  3BS5 A;  2E8O A;  1UQV A;  2DL0 A;  2EAN A;  1PK1 A;  1X66 A;  2JV3 A;  1KW4 A;  4PZN A;  3TAC B;  1F0M A;  3K1R B;  1LKY A;  3BS7 A;  2YTU A;  2ESE A;  2QB0 A;  2FE9 A;  2KSO A;  5F3X B;  2B6G A;  3BS5 B;  1V38 A;  2F8K A;  2F44 A;  2GLE A;  2E8M A;  1SXD A;  5J8Y C;  1B0X A;  5JRT A;  1SXE A;  2KIV A;  1DXS A;  1UCV A;  1PK3 A;  2ES6 A;  3HIL A;  1COK A;  1RG6 A;  2QAR B;  2LPE A;  2K60 A;  5J8Y A;  1OW5 A;  3BQ7 A;  3SEN A;  5L1M A;  2D8C A;  1X9X A;  3KKA A;  2KE7 A;  2QKQ A;  1SGG A;  2EAP A;  2DKZ A;  4RQN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...