1PK1A

Hetero sam domain structure of ph and scm.
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
68
structure length
68
Chain Sequence
PPISSWSVDDVSNFIRELPGCQDYVDDFIQQEIDGQALLLLKEKHLVNAMGMKLGPARKIVAKVESIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural organization of a Sex-comb-on-midleg/polyhomeotic copolymer.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription repression
molecule keywords Polyhomeotic-proximal chromatin protein
total genus 19
structure length 68
sequence length 68
chains with identical sequence C
ec nomenclature
pdb deposition date 2003-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07647 SAM_2 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 1pk1A00
4NL9A 1WWVA 2KSOB 1RG6A 2ES6A 2L5YA 1LKYB 1DXSA 2B6GA 2LPEA 1PK1A 3TACB 2EANA 5JRTA 1PK1B 2KE7A 2E8OA 3HILA 1SV0A 3BS5A 5JU5A 1X40A 2E8NA 3BQ7A 2QARB 2Y9UA 2F3NA 3BS5B 1OXJA 3KKAA 1SGGA 1B0XA 3KKAC 4MHVA 2KIVA 1PK3A 2D3DA 4IS7A 2JV3A 2DKZA 2QB0A 3SENA 2E8PA 2DKXA 1V38A 2K4PA 2D8CA 1SV4A 4NJ8A 1F0MA 1V85A 1WWUA 5JTIA 1LKYA 2ESEA 4PZNA 2FE9A 3SEIA 2QKQA 2E8MA 3K1RB 4RQNA 2GLEA 4NL9C 2EAPA 5L1MA 3H8MA 2LMRA 5KNIA 2EAOA 1KW4A 1X9XA 1SV0C 3TADC 2F44A 2KG5A 2F8KA 2Y9TA 1COKA 2KMDA 4RQMA 1X66A 1UCVA 2EAMA 1Z1VA 1OW5A 2DL0A 3BS7A 1SXEA 2YTUA 2QB0B 2QB1A 5F3XB 3IDWA 5J8YA 2KSOA 5J8YC 1UQVA 1B4FA 3TADA 1SXDA 4PZOA 2K60A 2QARA 1JI7A
chains in the Genus database with same CATH superfamily
7ICRA 4EBCA 5ALVA 1FEZA 4UW9A 2IHMA 3QZ7A 2K8AA 4IQUA 2HHSA 2MA1A 5AICA 1AROP 4DFMA 5DB8A 5KFPA 2V4RA 2AQ4A 4NY8A 2K8CB 2H5XA 3L4PA 5ALNA 2R8HA 3RBDA 1XS9D 2RP5A 1OXJA 3G6YA 5D46A 1B0XA 1U45A 3RR8A 2NO4A 3NS1A 5DBCA 1ZQGA 2P6RA 3G6XA 3I76A 1JRPA 4BGDA 4F5OA 4QWBA 4Q8EA 1NNLA 3R9KA 1TKDA 4CE6A 4NLKA 5DLFA 2A1JA 2K8BB 3RJFA 3D2NA 5IINA 1COOA 1EXNA 2YY6A 4NL9C 2AH5A 3MGIA 1C20A 5KFCA 1K1QA 3QUTA 1MN8A 4LZGA 5CA7A 1QSSA 1F44A 3OHBA 4O3PA 1COKA 8ICKA 2JH1A 5AKJA 2A1JB 2KMDA 3RBEA 5KL8B 3RB3A 3E58A 4FS1A 4QNLA 3K1ZA 8ICGA 2KZMA 3CP8A 2VANA 5DGBA 4M9JA 1KLNA 3T5JA 4YR0A 1MSWD 2EDUA 7ICOA 4NV0A 2HOFA 4UAWA 3KD3A 3G6VA 4UARA 3GIKA 3S6JA 1TAMA 3ALRA 3M6ZA 3MFHA 8ICBA 4DL7A 8ICYA 5ALEA 3RB6A 2AGPA 1QQ6A 2ZJAA 4C4RA 4EYHB 1FIQA 3TI0A 4F71A 3SYZA 1ZJMA 2OHFA 4TUSA 9ICTA 4KMUA 2BCQA 2HDOA 4KLIA 4EEYA 3KKAA 2F76X 1LVHA 2A19A 5ALWA 4EX7A 4RQ2A 5KFZA 3M7DA 3SENA 4AYBC 3IV6A 2HOIA 2JR5A 2YMLA 2GWSA 4ELUA 2ZUDA 4DFJA 2ESEA 1D8BA 1CEZA 4OJPA 5AI5A 3ZDAA 3PSFA 3VC8A 2FDRA 5KFXA 1XNSA 4UAUA 5HMMA 4FS2A 3KHGA 4ICAA 1X9XA 5ALDA 1T3QA 4US8A 3RF9A 1ZQEA 4F4YA 4O3RA 2WTFA 2WF5A 2ZUBA 4C8LA 3HPOA 3K75D 1KQQA 3L3FX 3GV7B 3K4GA 1ZQKA 1JXEA 1ZQPA 4MFFA 5KFRA 3ZDCA 5DDMA 4IR9A 2FI1A 4RUCA 5ALTA 5AKHA 3F2CA 3HJEA 2J6UA 8ICTA 5DG8A 4I2AA 1U48A 2QARA 1JI7A 4U7CA 2IOFA 1IM4A 2ASLA 4F91B 1KEJA 3C29A 3AN1A 2ZIUB 4RT3A 2HW3A 3NVYA 1DGSA 4P0QB 3RJEA 1TK5A 4I27A 3PV8A 2HHQA 2HBKA 3HP6A 3MDAA 1H38A 4P4OA 2ZTDA 9ICXA 4PHEA 2P66A 4BDPA 1N48A 3KZIU 2BQRA 3QNMA 1ZQBA 2W3RA 2KVSA 2G5IB 2LM1A 2XGPA 2H3QA 5J0RA 5BOMA 2W8KA 5DLGA 1KDHA 7ICMA 2KKVA 3EUB2 2KICA 2EZZA 2JEJA 2BR0A 1ZQXA 2NV3A 4ED8A 1L7OA 3C28A 3QU2A 2W03A 4EX6A 5AIBA 1SWWA 3C5GA 4GFJA 1XO1A 1Q3VA 2FMQA 2Q4TA 3N97B 4LJXA 3ETRA 3N28A 1D8YA 4DSLA 2QKQA 2KNJA 1NK5A 3QUBA 1QQ7A 4RQNA 3TARA 1MQ2A 4M2YA 3AMZA 1N61A 3H8MA 3HWTA 1TK0A 3V6KA 5J2CA 2F44A 2F8KA 3JPQA 4JV1A 3ONNA 2D6FC 4EYIB 5J0XA 3JPSA 2OCEA 2KIWA 4F5PA 1S97A 5KFJA 4F3OA 3H8WA 3H0MB 3OPXA 1N56A 4DL5A 3PZPA 5DKWA 2YTUA 1L7MA 4ED1A 4B9LA 3GV8B 4DFKA 5KL1B 5J2DA 1ZQYA 3F2DA 3RJKA 5EE9A 1L6NA 3WKEA 4QZ8A 4IRDA 2A1AA 5ALFA 4Y2YA 1ZJNA 1WWVA 1JX4A 4GC6A 4RNNA 1S0NA 1D8LA 4EEKA 2L5YA 4ECSA 2BPFA 3RRHA 4Y2PA 2M9NA 8ICXA 4NWIA 2KEYA 8ICFA 4Y2JA 4Y2UA 4OO1J 4Z6CA 3IRUA 4I2DA 1X9WA 3AU2A 3QE9Y 2FLPA 3ED5A 4KLSA 2KN7A 4PHAA 1ZQTA 1Z00B 3KOOA 1U9LA 1TK8A 1HUZA 4O3NA 2KP7A 5AK4A 4O3OA 1RDFA 2D8CA 4UB5A 2RDIA 3WKDA 4NXZA 2AHOB 1UA0A 5KFTA 5KFKA 5KT4A 4KLTA 9ICIA 4YQWA 3V6JA 3NGDA 3N7SC 2KZZA 2ZG6A 4OJ5A 1WCLA 1ZQAA 4O9MA 1MQ3A 5J0TA 4F4WA 3QEBZ 4UQGA 4QWAA 9ICCA 2A3VA 3H8SA 4DL2A 3MDCA 1SKWA 5AI6A 4RNMA 5A0LA 8ICMA 3CRXA 1UPHA 4O5CA 2DQNB 1D9DA 5EWEA 4DO9A 3NASA 5AM5A 2KV2A 4RQ8A 5L1IA 1NK7A 1RPLA 4C7ZA 1NOMA 4CGZA 3PW5A 8ICZA 1UT5A 2KSOA 1UQVA 5IIKA 4GLXA 3M9OB 4GXIA 3DDHA 2ZIVA 4JB3A 9ICAA 4K4GA 4QWCA 1ZRMA 4DSKA 3KTQA 2MSNA 4DQRA 5BOLA 2C22A 3AL0B 3C2LA 1LKYB 1XU4A 3M8SA 4B9TA 5JRTA 1XSNA 5AIAA 2F8LA 3C1ZA 2Y0SF 2MUTA 1HUOA 3KBBA 4QIWC 1ZETA 2BZFA 3JPTA 4M9GA 1VJ5A 5AKYA 9ICWA 2DBYA 4F4ZA 3QX7A 3QEAZ 2W04A 4F5RA 5AI4A 4P0PA 1SKSA 3PNCA 3WKCA 1N2XA 2CRXA 5AK6A 2I5HA 2Z7JA 4RPYA 4RPZA 4QZIA 4CDGA 5DBAA 3H40A 3WKAA 3KFUF 2E1FA 5B66U 4RUAA 3GV5B 5KFDA 1L3TA 8ICCA 3F5AA 1TVAA 2EAPA 2EZYA 1J97A 2NYVA 1U47A 5AM2A 3DV9A 2XICA 5T14A 2P6UA 3PMNA 2E5SA 2OH2A 3UMGA 2G06A 1PVQA 3LWMA 2BCRA 3MFIA 4YMMA 3QU4A 4ECVA 1JIHA 1ZQFA 2WB1C 3HRDD 2LYHA 1ZOLA 4Q43A 4JUZA 4C0ZA 3FAHA 3BZCA 2MU2A 3Q8LA 4UAZA 2JZBA 5ALOA 4UB4A 5EOZA 3PW4A 4MEYA 1JUDA 2PMZC 4KLQA 3TKAA 2ES6A 4EZ6A 1DK2A 4KLLA 4UB3A 1JALA 2UVUA 3VCBA 3RFAA 2CXYA 1NZPA 2ZTCA 2E8NA 2BCSA 5J2EA 4ED6A 2PMZF 1ZYQA 1URJA 2PFNA 4BXOB 2KJ8A 2R8GA 4OJ6A 2ZIVB 4Y2RA 1N63A 2WAQF 3GDXA 1P7DA 9ICUA 2FLLA 3ZDBA 3OJSA 2C2RA 4MEXA 5KT2A 3SAHA 1XSLA 3RJHA 1WWUA 4AYBF 3IP4B 2BPGA 3NRZA 4KLJA 4FBTA 3SEIA 2XC9A 2V4QA 2XVTA 2R18A 1KFDA 1ZQDA 1U49A 2JXJA 2R8JA 3M9NB 9ICKA 4Q45A 5IIMA 2G08A 4Z6FA 3H8JA 2JEIA 2WHEA 1L5UA 1QSLA 7ICJA 3CW2C 2IOFK 1ZQCA 1MC8A 2ZXIA 2HHVA 3TAQA 1BPEA 1ZXIA 1FFUA 5J0UA 4DL6A 1IXRA 2W9AA 4YXMA 5J8YC 2F1JA 2YB4A 2ZTEA 5EE0A 4DSEA 5KG0A 5DG7A 1SXDA 2KJ5A 1ZQLA 3OSPA 4LZDA 5H2FU 3QU7A 4KLGA 5TZVA 4CF5A 3BQ1A 2HVIA 3Q8KA 2VIXA 3V6HA 2KHVA 4FZLA 2OM6A 4Z6EA 5AM1A 1QSYA 3ISBA 5DQGA 3EYZA 4M6WB 3BDPA 2AJQA 1M6YA 1SZPA 2P35A 4J9LA 1S76D 3N4MB 5KFMA 7ICKA 4BJQA 5AM3A 2ALZA 4IQVA 3RAQA 2VJ4A 4MHVA 4YMNA 5L1LA 1IIPA 4R8UB 2KFZA 3EZ5A 4M9NA 1K1SA 4EENA 3IM1A 2DKXA 2HOQA 1IG6A 2ZJ8A 1Z19A 2AU0A 3SD7A 2DGZA 1TAUA 1L7NA 5KG6A 1BPXA 9ICHA 1V85A 1RXWA 2HCFA 3WKBA 2YQEA 3LVWA 5F9LA 7ICIA 2O6KA 4ZH4A 4I2JA 3ICXA 5KT5A 2E8MA 5L1JA 1S77D 1J2MA 1L3VA 3TANA 4DQSA 3MBYA 1QTMA 4LVSA 5J2JA 4ECRA 3NUQA 4UB8U 5EE3A 4TQSA 2FMSA 4WJ3B 2RHFA 1S8OA 4GXKA 2KG5A 1BGXT 1RZTA 4KLHA 4RQMA 4QWDA 1UCVA 3C5FA 2YX8A 1BPDA 2LM4A 1CI4A 5FP0A 4M47A 2BQUA 7ICEA 4C4SA 4KMOB 1FO4A 2KKPA 3QUCA 5DGAA 3WK8A 4PH5A 1ZQUA 2ISOA 5J8YA 4EBEA 3O0FA 4DFPA 4X5VA 5AK3A 2CN1A 2YN4A 1ZQHA 1WG8A 3B9JA 2K4IA 4ACOA 1SKRA 2HI0A 1NK4A 1S0MA 3BQTA 5AKXA 2LI6A 5L1KA 3PX4A 4GIBA 2IBKA 5GTIU 3T79A 5AKKA 3AUOA 8ICJA 2DWQA 4DOBA 1ZD3A 4PJ0U 1S0OA 1KBUA 5J29A 3M6KA 4R64A 4C8NA 4KTQA 1Z3EB 4YD2A 4YR2A 3PMLA 2FJ6A 4IS7A 3PVXA 4DLGA 3RTVA 3L5KA 2XY5A 2E8PA 3AM9A 1NI3A 3BZKA 4R63A 1BPBA 2WB1F 5JTIA 2EZXA 4PZNA 2Q0ZX 4A8EA 1X2IA 4UATA 7ICVA 2HBJA 4DL4A 3OTQA 2EAOA 3OJUA 2HMXA 1N60A 3RH6A 2C28A 3QU9A 5KFAA 2NRTA 4IR1A 4RQ3A 9ICBA 3M9MB 5J2BA 4QZ9A 3SI8A 4EELA 2RDJA 1N5XA 3Q8MA 3BS7A 4CRXA 2F1HA 3LK9A 4MFAA 1A76A 8ICNA 4F5QA 2Y0SC 3WK9A 9ICRA 3F2BA 3TADA 4YCXA 2WAQC 2KFNA 2WF9A 4ED7A 2UVRA 3TAPA 1NKEA 4NL9A 3UMBA 4I29A 7ICQA 1L8LA 1NJZA 4QIWF 1FFVA 1ZQ1C 4C8KA 3HW8A 5CB1A 4PGYA 4YP3A 4P0QA 2B6GA 1L3SA 2M0NA 2C2DA 4PGQA 4M9LA 1Q8KA 2PFOA 4KLOA 2MRLA 3BS5A 2ODGA 5KFIA 3B0YA 2NO5A 2CPRA 9ICEA 5KT3A 3D2QA 1B22A 5CEHA 5DQHA 2IMWP 5KFBA 4USAA 5KAFU 2JMGA 2YMQA 1YT3A 3WK6A 4DL3A 1YZ6A 2DPIA 4FE3A 2EQYA 1RYUA 5G5GA 1KN5A 5KFOA 5KG2A 3NVZA 4RQ1A 8ICLA 3EW9A 4F72A 2IA6A 4F2SA 5J2AA 4KLEA 1ZRNA 4F50A 1PZNA 2LYAA 2YMPA 9ICJA 1MA7A 2VJ5A 2XY6A 2LMRA 5L9XA 3MGHA 1A77A 3UXPA 2J6TA 1QQ5A 4DCCA 3MR6A 5CHGA 2NRZA 3J81j 4F4XA 3H0LB 3QU5A 2HBLA 3LWLA 3MC1A 3ZD8A 5AK5A 4NM1A 4DSIA 2I1QA 4O5KA 4JWMA 1UA1A 2NRXA 4IL6U 5HHHA 5KFYA 4KLMA 1Z1VA 4B9UA 4QW9A 4YG2A 1DOQA 5ALXA 4CCHA 7ICUA 1HJPA 2QB1A 4F5NA 4C8MA 3Q8RB 2Y1JA 1ZD5A 5HP4A 3UMCA 3PSPA 3PW2A 3RJIA 1HEKA 4R8UA 4I2BA 2BDUA 4RQ5A 4P2HA 5KTQA 2V9WA 3FDSA 1T8EA 7ICSA 3GIMA 3HILA 2XGQA 1CRXA 2QARB 5AHXA 5JUMA 3NVVA 2Y9UA 4QZCA 4GXJA 3UXOA 1X6IA 5KG3A 4IRKA 3BQ2A 3E2EA 3UPQA 2BCUA 3KHLA 9ICLA 5KT7A 4P4MA 8ICQA 4FZMA 5AKGA 2W54A 5ALQA 2WFAA 4QZAA 3JPNA 1NK9A 8ICIA 1LKYA 4F4KA 2FE9A 3V7LA 1K5OA 2DF4B 5ALKA 3ETLA 4PHPA 3K1RB 4F8RA 2XY7A 2JGAA 3F53A 4DS4A 5CR0A 5KFFA 2UVWA 2NRWA 2ZXHA 2LBOA 3RAXA 2KD1A 1SL1A 4TQRA 3SZ2A 3MR2A 5J0OA 5IIOA 1Q46A 2AGOA 4JMUA 3ISDA 2BDPA 1JN3A 9ICPA 4C80A 1T3NA 3D6JA 1SB3C 2DL0A 4Z6DA 1O03A 4MF8A 1SXEA 2N1RA 1ZQRA 3H0RB 9ICGA 2QB0B 5F3XB 3IDWA 3QUQA 2DFLA 1L7PA 1B4FA 2W11A 3HT3A 2F2AB 1V9PA 4PZOA 1KKXA 3PO5A 2G09A 1ZQSA 4ED2A 5HMLA 3ZD9A 2WF8A 2UVVA 4J9OA 1S0VA 2BGWA 4ELVA 2HHXA 4OCZA 5KFQA 2IHNA 2PI5A 4AP9A 4BX9C 1PK1B 5E79U 1Q3UA 4US9A 5JU5A 4EZ9A 2C2EA 2KTQA 3A0BU 5D4BA 2OXOA 2G5HB 4UAYA 3TFSA 1OUQA 4J03A 4MFCA 4JWNA 2R8IA 2QB0A 5KT6A 1V38A 1Y88A 4MF2A 1TFRA 3KZXA 5J0WA 4PL1A 3UQ2A 3N7PD 2HBMA 5ALGA 3MGVA 5TISU 5ALIA 1ZQNA 3IG8A 1ZQZA 4NLGA 3SAFA 4ECZA 5J0SA 5KFLA 3GU3A 4DFDA 4R66A 3CNHA 2FPKA 1J2NA 1O08A 3H4DA 3PX6A 2W9MA 3M1YA 1IV8A 9ICOA 2XI9A 4RNOA 4QZDA 2KHQA 3RJJA 4I2IA 2XO7A 1TE2A 3SAGA 5AKLA 2EAMA 4M9HA 3MR3A 4F93B 3AU6A 4ECTA 5KFWA 3SV3A 2F77X 4O3MA 2HHUA 2GH1A 5KG4A 8ICSA 1NJYA 5EE1A 4OJOA 4DLEA 2AGQA 1S5LU 4I2FA 4HAIA 4P0PB 4FZNA 4YN4A 4I2GA 2MAXA 1BVSA 3SV4A 2K60A 5J2GA 5IIIA 3ISCA 1AQ6A 3I28A 4DSFA 3PW0A 2K89A 2RLTA 3LVVA 2G0AA 5B5EU 4QW8A 3PSIA 8ICPA 1WCNA 4PL2A 1X9MA 4PPXA 5AI9A 1SWVA 3AQFA 1XC9A 2W9CB 2E3TA 3T5LA 3C2KA 1VDVA 5KFEA 2AXTU 2E1EA 4J9QA 5KG7A 2ZIXB 2JV3A 1T94A 5CRXA 4IQTA 1ZQOA 4KLFA 3WU2U 1L8OA 4BUGA 2XCAA 2G07A 4ECXA 4DEZA 5J0YA 3OGUA 8ICHA 2HSZA 4XRHA 3SMVA 4QZFA 3T5KA 3RB0A 2VKQA 4C4TA 2RRDA 1PUZA 5KNIA 3C23A 2I6XA 4JV0A 2BQ3A 3N7RC 1BPZA 1WYGA 3UXNA 4RT2A 4Y2TA 3TADC 2QLTA 5AKEA 1T7PA 9ICQA 2Y9TA 1F5SA 5AI8A 5ALPA 3AEVA 4B9NA 4KX3A 2ZUCA 3Q8SB 3H4BA 4C8OA 4P4PA 4B9MA 8ICAA 3RB4A 5ALLA 4UB6U 1S10A 1UHUA 5CWRA 5ALMA 4O5EA 3ZDEA 7ICNA 1HIWA 4K4HA 8ICOA 1JXLA 2W9CA 5IIJA 7ICHA 2JRZA 3DEEA 2HVHA 2AQ0A 2KSOB 3C2MA 4JV2A 5J0QA 3EPIA 1NK0A 2PKEA 3SR6A 3JPPA 1KFTA 4NLNA 4DF4A 1ZD4A 1PK1A 3SQIA 2EANA 3UM9A 2KE7A 4RQ4A 3T5HA 2E8OA 1RYSA 3RH5A 2PFPA 3FYHA 1X40A 4QZEA 4TUQA 1XO0A 1XWLA 2YMMA 4UAVA 2W55A 1A6SA 4CNQA 1CUKA 1U4BA 4O3QA 1V97A 4XQ8A 3Q8PB 1RYRA 4O0IA 2K4PA 1SV4A 4QJFB 4NJ8A 8ICEA 4B6JA 4I28A 1QLNA 2WF7A 4CF3A 1T4GA 2HHTA 2K4HA 2BCVA 4UBBA 3EPGA 2ISPA 2W8LA 5HR6A 1KW4A 2GOLA 2K4EA 3D2SA 2ATLA 4IQWA 2JH7A 2KJ9A 7ICLA 3KHHA 3MABA 3BJYA 1DRGA 2OYYA 4RQ6A 1X66A 1NK8A 4BWJA 4R65A 4I2HA 9ICMA 2F1IA 2KK0A 4K4IA 5KG5A 1TV9A 2JZBB 3LYSA 7ICTA 5DQIA 5DBBA 5KFVA 4PHDA 3GZFA 4NLBA 4B9VA 1RG6A 2EH9A 4FBUA 5J2KA 4YFKA 5AI0A 2YB1A 3WK7A 4DF8A 4RU9A 1DXSA 3IN5A 5J2HA 4YXJA 1BNPA 4BXOA 1S9FA 1JROA 1NJXA 4FFDA 5HHIA 2J6SA 5AM0A 3PR4A 2ASDA 3M8RA 3FC4A 3BS5B 4YMOA 4QZHA 3V7JA 1Z00A 5ALSA 1SGGA 4I2EA 2ASJA 1Z1BA 3RJGA 2KIVA 1BNOA 1PK3A 4OD0A 4CF4A 3TQ1A 4KLDA 1XSPA 5K4LA 1NKCA 3U26A 4M6WA 2XIDA 5J2IA 3PO4A 2W7PA 1LB2B 5DB6A 2RQ5A 4J9MA 4ED0A 1SL0A 3HKZC 1LV5A 2PXIA 4KN4A 8ICUA 4ZOHC 4J9SA 1RQLA 2JHDA 3ZDDA 5CP2A 1WUDA 3PW7A 4J9RA 2GLEA 2WF6A 5KFGA 3FM9A 5HR7A 1X42A 3NTUA 3QYPA 2KOBA 1SV0C 3HKZF 4QZBA 4ECQA 3ORYA 1NK6A 3JPOA 4RQ0A 2FMPA 4RZRA 4RPXA 4Y2XA 3WK5A 1PVPA 4DOCA 4GC7A 3WK4A 4FO6A 1SIJA 3A0HU 5D49A 5G5HA 1ZQQA 1D9FA 1QCKA 3F5EA 2NRVA 7ICFA 2BPCA 5HNKA 1ZQIA 1NJWA 3OSNA 5AKIA 4QZGA 1Z4OA 5ALRA 5J2FA 2B21A 2VA8A 3TFRA 4B9SA 3ZI4A 1A0PA 5KFUA 3CYMA 4DQIA 4UASA 3H7IA 5EWFA 4DS5A 2FLNA 2Y1IA 1QH9A 5J0PA 2H3IA 1KL9A 2DUYA 9ICNA 4UB1A 3IG5A 3EWAA 4BWMA 2FPLA 4F2RA 3HX0A 2H3VA 4TURA 2PFQA 4TUPA 1ECWA 1NKBA 2W3SA 2GO7A 5KAIU 4KLUA 2VA3A 4M0AA 4EBDA 2IOHA 2LHTA 3GILA 1N62A 2ZJ5A 3Q8QB 3I1YA 4DQPA 3GFKB 1TAQA 3T3FA 2R8KA 1KTQA 1X9SA 2LKYA 1RM6C 2ZIUA 4J9PA 2W7OA 4KX5A 1BPYA 4PGXA 1X6JA 4Q44A 3GQCA 4HYKA 1UT8A 3QZ8A 5EWGA 8ICVA 7ICGA 1ZQWA 3B0XA 5ALHA 2H3FA 4O3SA 4C7YA 4UBCA 3BQ0A 1VLBA 4G9BA 4XUSA 4J9KA 3V7KA 3LDAA 3V72A 2JEFA 2W43A 3C1YA 4NLZA 3RRGA 2ZIXA 4I2CA 3QXGA 4YD1A 5BPCA 1L3UA 2KVCA 5C0YA 3C21A 5DB7A 8ICWA 3THVA 5C5JA 2I9GA 1KSPA 2B0CA 1RQNA 4NLCA 1DK3A 4DQQA 3RH4A 4F92B 1GO3F 1Z4NA 4ECWA 7ICPA 2BHNA 2LPEA 1NZBA 3TACB 4QWEA 5DG9A 2KZ3A 1DGJA 4YVZA 1SV0A 4ED3A 1KRPA 3BQ7A 3GIIA 4E0DA 3GIJA 1YZ7A 5DB9A 4ECYA 4IRCA 2F3NA 4DWIA 3E0FA 1B43A 1ZQVA 9ICFA 5ALUA 3KKAC 1C7YA 3NVWA 2DPJA 2VA2A 2D3DA 2DKZA 5AM4A 2W9BB 4KITB 2ZIWB 3PY8A 4RQ7A 2LYBA 4G3IA 2BKEA 4YR3A 3PSTA 1SL2A 4DSJA 4OJLA 5KG1A 4ELTA 1F0MA 3RR7A 2ZIWA 2FPMA 4ECUA 4Y2VA 2W9BA 2OWOA 4JK1A 5DDYA 5KFSA 1N5WA 5L1MA 4Y2SA 5ALYA 4IC9A 3AQEA 1ZQJA 4J9NA 9ICSA 3KHRA 2XCPA 1JMSA 4Y2QA 5GTHU 2H3ZA 2HHWA 1PVRA 5ALJA 4DOAA 3PX0A 5F9NA 1ED1A 2PI4A 2OEHA 3PR5B 1ZD2P 3UQ0A 5KFHA 1OW5A 5AKZA 5ALZA 3MR5A 4Q8FA 1SZHA 2JEGA 4U6PA 4XA5A 5CJ7A 3OHAA 4NM2A 5KFNA 1RXVA 4KN7A 8ICRA 3JPRA 1KFSA 4UB2A 3IHQB 1ZQMA 3NRWA 9ICVA 5IILA 4M04A 2MUTB
chains in the Genus database with same CATH topology
4NL9A 1WWVA 2KSOB 1RG6A 2ES6A 2L5YA 1LKYB 1DXSA 2B6GA 2LPEA 1PK1A 3TACB 2EANA 5JRTA 1PK1B 2KE7A 2E8OA 3HILA 1SV0A 3BS5A 5JU5A 1X40A 2E8NA 3BQ7A 2QARB 2Y9UA 2F3NA 3BS5B 1OXJA 3KKAA 1SGGA 1B0XA 3KKAC 4MHVA 2KIVA 1PK3A 2D3DA 4IS7A 2JV3A 2DKZA 2QB0A 3SENA 2E8PA 2DKXA 1V38A 2K4PA 2D8CA 1SV4A 4NJ8A 1F0MA 1V85A 1WWUA 5JTIA 1LKYA 2ESEA 4PZNA 2FE9A 3SEIA 2QKQA 2E8MA 3K1RB 4RQNA 2GLEA 4NL9C 2EAPA 5L1MA 3H8MA 2LMRA 5KNIA 2EAOA 1KW4A 1X9XA 1SV0C 3TADC 2F44A 2KG5A 2F8KA 2Y9TA 1COKA 2KMDA 4RQMA 1X66A 1UCVA 2EAMA 1Z1VA 1OW5A 2DL0A 3BS7A 1SXEA 2YTUA 2QB0B 2QB1A 5F3XB 3IDWA 5J8YA 2KSOA 5J8YC 1UQVA 1B4FA 3TADA 1SXDA 4PZOA 2K60A 2QARA 1JI7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NL9 A;  1WWV A;  2KSO B;  1RG6 A;  2ES6 A;  2L5Y A;  1LKY B;  1DXS A;  2B6G A;  2LPE A;  1PK1 A;  3TAC B;  2EAN A;  5JRT A;  1PK1 B;  2KE7 A;  2E8O A;  3HIL A;  1SV0 A;  3BS5 A;  5JU5 A;  1X40 A;  2E8N A;  3BQ7 A;  2QAR B;  2Y9U A;  2F3N A;  3BS5 B;  1OXJ A;  3KKA A;  1SGG A;  1B0X A;  3KKA C;  4MHV A;  2KIV A;  1PK3 A;  2D3D A;  4IS7 A;  2JV3 A;  2DKZ A;  2QB0 A;  3SEN A;  2E8P A;  2DKX A;  1V38 A;  2K4P A;  2D8C A;  1SV4 A;  4NJ8 A;  1F0M A;  1V85 A;  1WWU A;  5JTI A;  1LKY A;  2ESE A;  4PZN A;  2FE9 A;  3SEI A;  2QKQ A;  2E8M A;  3K1R B;  4RQN A;  2GLE A;  4NL9 C;  2EAP A;  5L1M A;  3H8M A;  2LMR A;  5KNI A;  2EAO A;  1KW4 A;  1X9X A;  1SV0 C;  3TAD C;  2F44 A;  2KG5 A;  2F8K A;  2Y9T A;  1COK A;  2KMD A;  4RQM A;  1X66 A;  1UCV A;  2EAM A;  1Z1V A;  1OW5 A;  2DL0 A;  3BS7 A;  1SXE A;  2YTU A;  2QB0 B;  2QB1 A;  5F3X B;  3IDW A;  5J8Y A;  2KSO A;  5J8Y C;  1UQV A;  1B4F A;  3TAD A;  1SXD A;  4PZO A;  2K60 A;  2QAR A;  1JI7 A; 
#chains in the Genus database with same CATH topology
 7ICR A;  4EBC A;  5ALV A;  1FEZ A;  4UW9 A;  2IHM A;  3QZ7 A;  2K8A A;  4IQU A;  2HHS A;  2MA1 A;  5AIC A;  1ARO P;  4DFM A;  5DB8 A;  5KFP A;  2V4R A;  2AQ4 A;  4NY8 A;  2K8C B;  2H5X A;  3L4P A;  5ALN A;  2R8H A;  3RBD A;  1XS9 D;  2RP5 A;  1OXJ A;  3G6Y A;  5D46 A;  1B0X A;  1U45 A;  3RR8 A;  2NO4 A;  3NS1 A;  5DBC A;  1ZQG A;  2P6R A;  3G6X A;  3I76 A;  1JRP A;  4BGD A;  4F5O A;  4QWB A;  4Q8E A;  1NNL A;  3R9K A;  1TKD A;  4CE6 A;  4NLK A;  5DLF A;  2A1J A;  2K8B B;  3RJF A;  3D2N A;  5IIN A;  1COO A;  1EXN A;  2YY6 A;  4NL9 C;  2AH5 A;  3MGI A;  1C20 A;  5KFC A;  1K1Q A;  3QUT A;  1MN8 A;  4LZG A;  5CA7 A;  1QSS A;  1F44 A;  3OHB A;  4O3P A;  1COK A;  8ICK A;  2JH1 A;  5AKJ A;  2A1J B;  2KMD A;  3RBE A;  5KL8 B;  3RB3 A;  3E58 A;  4FS1 A;  4QNL A;  3K1Z A;  8ICG A;  2KZM A;  3CP8 A;  2VAN A;  5DGB A;  4M9J A;  1KLN A;  3T5J A;  4YR0 A;  1MSW D;  2EDU A;  7ICO A;  4NV0 A;  2HOF A;  4UAW A;  3KD3 A;  3G6V A;  4UAR A;  3GIK A;  3S6J A;  1TAM A;  3ALR A;  3M6Z A;  3MFH A;  8ICB A;  4DL7 A;  8ICY A;  5ALE A;  3RB6 A;  2AGP A;  1QQ6 A;  2ZJA A;  4C4R A;  4EYH B;  1FIQ A;  3TI0 A;  4F71 A;  3SYZ A;  1ZJM A;  2OHF A;  4TUS A;  9ICT A;  4KMU A;  2BCQ A;  2HDO A;  4KLI A;  4EEY A;  3KKA A;  2F76 X;  1LVH A;  2A19 A;  5ALW A;  4EX7 A;  4RQ2 A;  5KFZ A;  3M7D A;  3SEN A;  4AYB C;  3IV6 A;  2HOI A;  2JR5 A;  2YML A;  2GWS A;  4ELU A;  2ZUD A;  4DFJ A;  2ESE A;  1D8B A;  1CEZ A;  4OJP A;  5AI5 A;  3ZDA A;  3PSF A;  3VC8 A;  2FDR A;  5KFX A;  1XNS A;  4UAU A;  5HMM A;  4FS2 A;  3KHG A;  4ICA A;  1X9X A;  5ALD A;  1T3Q A;  4US8 A;  3RF9 A;  1ZQE A;  4F4Y A;  4O3R A;  2WTF A;  2WF5 A;  2ZUB A;  4C8L A;  3HPO A;  3K75 D;  1KQQ A;  3L3F X;  3GV7 B;  3K4G A;  1ZQK A;  1JXE A;  1ZQP A;  4MFF A;  5KFR A;  3ZDC A;  5DDM A;  4IR9 A;  2FI1 A;  4RUC A;  5ALT A;  5AKH A;  3F2C A;  3HJE A;  2J6U A;  8ICT A;  5DG8 A;  4I2A A;  1U48 A;  2QAR A;  1JI7 A;  4U7C A;  2IOF A;  1IM4 A;  2ASL A;  4F91 B;  1KEJ A;  3C29 A;  3AN1 A;  2ZIU B;  4RT3 A;  2HW3 A;  3NVY A;  1DGS A;  4P0Q B;  3RJE A;  1TK5 A;  4I27 A;  3PV8 A;  2HHQ A;  2HBK A;  3HP6 A;  3MDA A;  1H38 A;  4P4O A;  2ZTD A;  9ICX A;  4PHE A;  2P66 A;  4BDP A;  1N48 A;  3KZI U;  2BQR A;  3QNM A;  1ZQB A;  2W3R A;  2KVS A;  2G5I B;  2LM1 A;  2XGP A;  2H3Q A;  5J0R A;  5BOM A;  2W8K A;  5DLG A;  1KDH A;  7ICM A;  2KKV A;  3EUB 2;  2KIC A;  2EZZ A;  2JEJ A;  2BR0 A;  1ZQX A;  2NV3 A;  4ED8 A;  1L7O A;  3C28 A;  3QU2 A;  2W03 A;  4EX6 A;  5AIB A;  1SWW A;  3C5G A;  4GFJ A;  1XO1 A;  1Q3V A;  2FMQ A;  2Q4T A;  3N97 B;  4LJX A;  3ETR A;  3N28 A;  1D8Y A;  4DSL A;  2QKQ A;  2KNJ A;  1NK5 A;  3QUB A;  1QQ7 A;  4RQN A;  3TAR A;  1MQ2 A;  4M2Y A;  3AMZ A;  1N61 A;  3H8M A;  3HWT A;  1TK0 A;  3V6K A;  5J2C A;  2F44 A;  2F8K A;  3JPQ A;  4JV1 A;  3ONN A;  2D6F C;  4EYI B;  5J0X A;  3JPS A;  2OCE A;  2KIW A;  4F5P A;  1S97 A;  5KFJ A;  4F3O A;  3H8W A;  3H0M B;  3OPX A;  1N56 A;  4DL5 A;  3PZP A;  5DKW A;  2YTU A;  1L7M A;  4ED1 A;  4B9L A;  3GV8 B;  4DFK A;  5KL1 B;  5J2D A;  1ZQY A;  3F2D A;  3RJK A;  5EE9 A;  1L6N A;  3WKE A;  4QZ8 A;  4IRD A;  2A1A A;  5ALF A;  4Y2Y A;  1ZJN A;  1WWV A;  1JX4 A;  4GC6 A;  4RNN A;  1S0N A;  1D8L A;  4EEK A;  2L5Y A;  4ECS A;  2BPF A;  3RRH A;  4Y2P A;  2M9N A;  8ICX A;  4NWI A;  2KEY A;  8ICF A;  4Y2J A;  4Y2U A;  4OO1 J;  4Z6C A;  3IRU A;  4I2D A;  1X9W A;  3AU2 A;  3QE9 Y;  2FLP A;  3ED5 A;  4KLS A;  2KN7 A;  4PHA A;  1ZQT A;  1Z00 B;  3KOO A;  1U9L A;  1TK8 A;  1HUZ A;  4O3N A;  2KP7 A;  5AK4 A;  4O3O A;  1RDF A;  2D8C A;  4UB5 A;  2RDI A;  3WKD A;  4NXZ A;  2AHO B;  1UA0 A;  5KFT A;  5KFK A;  5KT4 A;  4KLT A;  9ICI A;  4YQW A;  3V6J A;  3NGD A;  3N7S C;  2KZZ A;  2ZG6 A;  4OJ5 A;  1WCL A;  1ZQA A;  4O9M A;  1MQ3 A;  5J0T A;  4F4W A;  3QEB Z;  4UQG A;  4QWA A;  9ICC A;  2A3V A;  3H8S A;  4DL2 A;  3MDC A;  1SKW A;  5AI6 A;  4RNM A;  5A0L A;  8ICM A;  3CRX A;  1UPH A;  4O5C A;  2DQN B;  1D9D A;  5EWE A;  4DO9 A;  3NAS A;  5AM5 A;  2KV2 A;  4RQ8 A;  5L1I A;  1NK7 A;  1RPL A;  4C7Z A;  1NOM A;  4CGZ A;  3PW5 A;  8ICZ A;  1UT5 A;  2KSO A;  1UQV A;  5IIK A;  4GLX A;  3M9O B;  4GXI A;  3DDH A;  2ZIV A;  4JB3 A;  9ICA A;  4K4G A;  4QWC A;  1ZRM A;  4DSK A;  3KTQ A;  2MSN A;  4DQR A;  5BOL A;  2C22 A;  3AL0 B;  3C2L A;  1LKY B;  1XU4 A;  3M8S A;  4B9T A;  5JRT A;  1XSN A;  5AIA A;  2F8L A;  3C1Z A;  2Y0S F;  2MUT A;  1HUO A;  3KBB A;  4QIW C;  1ZET A;  2BZF A;  3JPT A;  4M9G A;  1VJ5 A;  5AKY A;  9ICW A;  2DBY A;  4F4Z A;  3QX7 A;  3QEA Z;  2W04 A;  4F5R A;  5AI4 A;  4P0P A;  1SKS A;  3PNC A;  3WKC A;  1N2X A;  2CRX A;  5AK6 A;  2I5H A;  2Z7J A;  4RPY A;  4RPZ A;  4QZI A;  4CDG A;  5DBA A;  3H40 A;  3WKA A;  3KFU F;  2E1F A;  5B66 U;  4RUA A;  3GV5 B;  5KFD A;  1L3T A;  8ICC A;  3F5A A;  1TVA A;  2EAP A;  2EZY A;  1J97 A;  2NYV A;  1U47 A;  5AM2 A;  3DV9 A;  2XIC A;  5T14 A;  2P6U A;  3PMN A;  2E5S A;  2OH2 A;  3UMG A;  2G06 A;  1PVQ A;  3LWM A;  2BCR A;  3MFI A;  4YMM A;  3QU4 A;  4ECV A;  1JIH A;  1ZQF A;  2WB1 C;  3HRD D;  2LYH A;  1ZOL A;  4Q43 A;  4JUZ A;  4C0Z A;  3FAH A;  3BZC A;  2MU2 A;  3Q8L A;  4UAZ A;  2JZB A;  5ALO A;  4UB4 A;  5EOZ A;  3PW4 A;  4MEY A;  1JUD A;  2PMZ C;  4KLQ A;  3TKA A;  2ES6 A;  4EZ6 A;  1DK2 A;  4KLL A;  4UB3 A;  1JAL A;  2UVU A;  3VCB A;  3RFA A;  2CXY A;  1NZP A;  2ZTC A;  2E8N A;  2BCS A;  5J2E A;  4ED6 A;  2PMZ F;  1ZYQ A;  1URJ A;  2PFN A;  4BXO B;  2KJ8 A;  2R8G A;  4OJ6 A;  2ZIV B;  4Y2R A;  1N63 A;  2WAQ F;  3GDX A;  1P7D A;  9ICU A;  2FLL A;  3ZDB A;  3OJS A;  2C2R A;  4MEX A;  5KT2 A;  3SAH A;  1XSL A;  3RJH A;  1WWU A;  4AYB F;  3IP4 B;  2BPG A;  3NRZ A;  4KLJ A;  4FBT A;  3SEI A;  2XC9 A;  2V4Q A;  2XVT A;  2R18 A;  1KFD A;  1ZQD A;  1U49 A;  2JXJ A;  2R8J A;  3M9N B;  9ICK A;  4Q45 A;  5IIM A;  2G08 A;  4Z6F A;  3H8J A;  2JEI A;  2WHE A;  1L5U A;  1QSL A;  7ICJ A;  3CW2 C;  2IOF K;  1ZQC A;  1MC8 A;  2ZXI A;  2HHV A;  3TAQ A;  1BPE A;  1ZXI A;  1FFU A;  5J0U A;  4DL6 A;  1IXR A;  2W9A A;  4YXM A;  5J8Y C;  2F1J A;  2YB4 A;  2ZTE A;  5EE0 A;  4DSE A;  5KG0 A;  5DG7 A;  1SXD A;  2KJ5 A;  1ZQL A;  3OSP A;  4LZD A;  5H2F U;  3QU7 A;  4KLG A;  5TZV A;  4CF5 A;  3BQ1 A;  2HVI A;  3Q8K A;  2VIX A;  3V6H A;  2KHV A;  4FZL A;  2OM6 A;  4Z6E A;  5AM1 A;  1QSY A;  3ISB A;  5DQG A;  3EYZ A;  4M6W B;  3BDP A;  2AJQ A;  1M6Y A;  1SZP A;  2P35 A;  4J9L A;  1S76 D;  3N4M B;  5KFM A;  7ICK A;  4BJQ A;  5AM3 A;  2ALZ A;  4IQV A;  3RAQ A;  2VJ4 A;  4MHV A;  4YMN A;  5L1L A;  1IIP A;  4R8U B;  2KFZ A;  3EZ5 A;  4M9N A;  1K1S A;  4EEN A;  3IM1 A;  2DKX A;  2HOQ A;  1IG6 A;  2ZJ8 A;  1Z19 A;  2AU0 A;  3SD7 A;  2DGZ A;  1TAU A;  1L7N A;  5KG6 A;  1BPX A;  9ICH A;  1V85 A;  1RXW A;  2HCF A;  3WKB A;  2YQE A;  3LVW A;  5F9L A;  7ICI A;  2O6K A;  4ZH4 A;  4I2J A;  3ICX A;  5KT5 A;  2E8M A;  5L1J A;  1S77 D;  1J2M A;  1L3V A;  3TAN A;  4DQS A;  3MBY A;  1QTM A;  4LVS A;  5J2J A;  4ECR A;  3NUQ A;  4UB8 U;  5EE3 A;  4TQS A;  2FMS A;  4WJ3 B;  2RHF A;  1S8O A;  4GXK A;  2KG5 A;  1BGX T;  1RZT A;  4KLH A;  4RQM A;  4QWD A;  1UCV A;  3C5F A;  2YX8 A;  1BPD A;  2LM4 A;  1CI4 A;  5FP0 A;  4M47 A;  2BQU A;  7ICE A;  4C4S A;  4KMO B;  1FO4 A;  2KKP A;  3QUC A;  5DGA A;  3WK8 A;  4PH5 A;  1ZQU A;  2ISO A;  5J8Y A;  4EBE A;  3O0F A;  4DFP A;  4X5V A;  5AK3 A;  2CN1 A;  2YN4 A;  1ZQH A;  1WG8 A;  3B9J A;  2K4I A;  4ACO A;  1SKR A;  2HI0 A;  1NK4 A;  1S0M A;  3BQT A;  5AKX A;  2LI6 A;  5L1K A;  3PX4 A;  4GIB A;  2IBK A;  5GTI U;  3T79 A;  5AKK A;  3AUO A;  8ICJ A;  2DWQ A;  4DOB A;  1ZD3 A;  4PJ0 U;  1S0O A;  1KBU A;  5J29 A;  3M6K A;  4R64 A;  4C8N A;  4KTQ A;  1Z3E B;  4YD2 A;  4YR2 A;  3PML A;  2FJ6 A;  4IS7 A;  3PVX A;  4DLG A;  3RTV A;  3L5K A;  2XY5 A;  2E8P A;  3AM9 A;  1NI3 A;  3BZK A;  4R63 A;  1BPB A;  2WB1 F;  5JTI A;  2EZX A;  4PZN A;  2Q0Z X;  4A8E A;  1X2I A;  4UAT A;  7ICV A;  2HBJ A;  4DL4 A;  3OTQ A;  2EAO A;  3OJU A;  2HMX A;  1N60 A;  3RH6 A;  2C28 A;  3QU9 A;  5KFA A;  2NRT A;  4IR1 A;  4RQ3 A;  9ICB A;  3M9M B;  5J2B A;  4QZ9 A;  3SI8 A;  4EEL A;  2RDJ A;  1N5X A;  3Q8M A;  3BS7 A;  4CRX A;  2F1H A;  3LK9 A;  4MFA A;  1A76 A;  8ICN A;  4F5Q A;  2Y0S C;  3WK9 A;  9ICR A;  3F2B A;  3TAD A;  4YCX A;  2WAQ C;  2KFN A;  2WF9 A;  4ED7 A;  2UVR A;  3TAP A;  1NKE A;  4NL9 A;  3UMB A;  4I29 A;  7ICQ A;  1L8L A;  1NJZ A;  4QIW F;  1FFV A;  1ZQ1 C;  4C8K A;  3HW8 A;  5CB1 A;  4PGY A;  4YP3 A;  4P0Q A;  2B6G A;  1L3S A;  2M0N A;  2C2D A;  4PGQ A;  4M9L A;  1Q8K A;  2PFO A;  4KLO A;  2MRL A;  3BS5 A;  2ODG A;  5KFI A;  3B0Y A;  2NO5 A;  2CPR A;  9ICE A;  5KT3 A;  3D2Q A;  1B22 A;  5CEH A;  5DQH A;  2IMW P;  5KFB A;  4USA A;  5KAF U;  2JMG A;  2YMQ A;  1YT3 A;  3WK6 A;  4DL3 A;  1YZ6 A;  2DPI A;  4FE3 A;  2EQY A;  1RYU A;  5G5G A;  1KN5 A;  5KFO A;  5KG2 A;  3NVZ A;  4RQ1 A;  8ICL A;  3EW9 A;  4F72 A;  2IA6 A;  4F2S A;  5J2A A;  4KLE A;  1ZRN A;  4F50 A;  1PZN A;  2LYA A;  2YMP A;  9ICJ A;  1MA7 A;  2VJ5 A;  2XY6 A;  2LMR A;  5L9X A;  3MGH A;  1A77 A;  3UXP A;  2J6T A;  1QQ5 A;  4DCC A;  3MR6 A;  5CHG A;  2NRZ A;  3J81 j;  4F4X A;  3H0L B;  3QU5 A;  2HBL A;  3LWL A;  3MC1 A;  3ZD8 A;  5AK5 A;  4NM1 A;  4DSI A;  2I1Q A;  4O5K A;  4JWM A;  1UA1 A;  2NRX A;  4IL6 U;  5HHH A;  5KFY A;  4KLM A;  1Z1V A;  4B9U A;  4QW9 A;  4YG2 A;  1DOQ A;  5ALX A;  4CCH A;  7ICU A;  1HJP A;  2QB1 A;  4F5N A;  4C8M A;  3Q8R B;  2Y1J A;  1ZD5 A;  5HP4 A;  3UMC A;  3PSP A;  3PW2 A;  3RJI A;  1HEK A;  4R8U A;  4I2B A;  2BDU A;  4RQ5 A;  4P2H A;  5KTQ A;  2V9W A;  3FDS A;  1T8E A;  7ICS A;  3GIM A;  3HIL A;  2XGQ A;  1CRX A;  2QAR B;  5AHX A;  5JUM A;  3NVV A;  2Y9U A;  4QZC A;  4GXJ A;  3UXO A;  1X6I A;  5KG3 A;  4IRK A;  3BQ2 A;  3E2E A;  3UPQ A;  2BCU A;  3KHL A;  9ICL A;  5KT7 A;  4P4M A;  8ICQ A;  4FZM A;  5AKG A;  2W54 A;  5ALQ A;  2WFA A;  4QZA A;  3JPN A;  1NK9 A;  8ICI A;  1LKY A;  4F4K A;  2FE9 A;  3V7L A;  1K5O A;  2DF4 B;  5ALK A;  3ETL A;  4PHP A;  3K1R B;  4F8R A;  2XY7 A;  2JGA A;  3F53 A;  4DS4 A;  5CR0 A;  5KFF A;  2UVW A;  2NRW A;  2ZXH A;  2LBO A;  3RAX A;  2KD1 A;  1SL1 A;  4TQR A;  3SZ2 A;  3MR2 A;  5J0O A;  5IIO A;  1Q46 A;  2AGO A;  4JMU A;  3ISD A;  2BDP A;  1JN3 A;  9ICP A;  4C80 A;  1T3N A;  3D6J A;  1SB3 C;  2DL0 A;  4Z6D A;  1O03 A;  4MF8 A;  1SXE A;  2N1R A;  1ZQR A;  3H0R B;  9ICG A;  2QB0 B;  5F3X B;  3IDW A;  3QUQ A;  2DFL A;  1L7P A;  1B4F A;  2W11 A;  3HT3 A;  2F2A B;  1V9P A;  4PZO A;  1KKX A;  3PO5 A;  2G09 A;  1ZQS A;  4ED2 A;  5HML A;  3ZD9 A;  2WF8 A;  2UVV A;  4J9O A;  1S0V A;  2BGW A;  4ELV A;  2HHX A;  4OCZ A;  5KFQ A;  2IHN A;  2PI5 A;  4AP9 A;  4BX9 C;  1PK1 B;  5E79 U;  1Q3U A;  4US9 A;  5JU5 A;  4EZ9 A;  2C2E A;  2KTQ A;  3A0B U;  5D4B A;  2OXO A;  2G5H B;  4UAY A;  3TFS A;  1OUQ A;  4J03 A;  4MFC A;  4JWN A;  2R8I A;  2QB0 A;  5KT6 A;  1V38 A;  1Y88 A;  4MF2 A;  1TFR A;  3KZX A;  5J0W A;  4PL1 A;  3UQ2 A;  3N7P D;  2HBM A;  5ALG A;  3MGV A;  5TIS U;  5ALI A;  1ZQN A;  3IG8 A;  1ZQZ A;  4NLG A;  3SAF A;  4ECZ A;  5J0S A;  5KFL A;  3GU3 A;  4DFD A;  4R66 A;  3CNH A;  2FPK A;  1J2N A;  1O08 A;  3H4D A;  3PX6 A;  2W9M A;  3M1Y A;  1IV8 A;  9ICO A;  2XI9 A;  4RNO A;  4QZD A;  2KHQ A;  3RJJ A;  4I2I A;  2XO7 A;  1TE2 A;  3SAG A;  5AKL A;  2EAM A;  4M9H A;  3MR3 A;  4F93 B;  3AU6 A;  4ECT A;  5KFW A;  3SV3 A;  2F77 X;  4O3M A;  2HHU A;  2GH1 A;  5KG4 A;  8ICS A;  1NJY A;  5EE1 A;  4OJO A;  4DLE A;  2AGQ A;  1S5L U;  4I2F A;  4HAI A;  4P0P B;  4FZN A;  4YN4 A;  4I2G A;  2MAX A;  1BVS A;  3SV4 A;  2K60 A;  5J2G A;  5III A;  3ISC A;  1AQ6 A;  3I28 A;  4DSF A;  3PW0 A;  2K89 A;  2RLT A;  3LVV A;  2G0A A;  5B5E U;  4QW8 A;  3PSI A;  8ICP A;  1WCN A;  4PL2 A;  1X9M A;  4PPX A;  5AI9 A;  1SWV A;  3AQF A;  1XC9 A;  2W9C B;  2E3T A;  3T5L A;  3C2K A;  1VDV A;  5KFE A;  2AXT U;  2E1E A;  4J9Q A;  5KG7 A;  2ZIX B;  2JV3 A;  1T94 A;  5CRX A;  4IQT A;  1ZQO A;  4KLF A;  3WU2 U;  1L8O A;  4BUG A;  2XCA A;  2G07 A;  4ECX A;  4DEZ A;  5J0Y A;  3OGU A;  8ICH A;  2HSZ A;  4XRH A;  3SMV A;  4QZF A;  3T5K A;  3RB0 A;  2VKQ A;  4C4T A;  2RRD A;  1PUZ A;  5KNI A;  3C23 A;  2I6X A;  4JV0 A;  2BQ3 A;  3N7R C;  1BPZ A;  1WYG A;  3UXN A;  4RT2 A;  4Y2T A;  3TAD C;  2QLT A;  5AKE A;  1T7P A;  9ICQ A;  2Y9T A;  1F5S A;  5AI8 A;  5ALP A;  3AEV A;  4B9N A;  4KX3 A;  2ZUC A;  3Q8S B;  3H4B A;  4C8O A;  4P4P A;  4B9M A;  8ICA A;  3RB4 A;  5ALL A;  4UB6 U;  1S10 A;  1UHU A;  5CWR A;  5ALM A;  4O5E A;  3ZDE A;  7ICN A;  1HIW A;  4K4H A;  8ICO A;  1JXL A;  2W9C A;  5IIJ A;  7ICH A;  2JRZ A;  3DEE A;  2HVH A;  2AQ0 A;  2KSO B;  3C2M A;  4JV2 A;  5J0Q A;  3EPI A;  1NK0 A;  2PKE A;  3SR6 A;  3JPP A;  1KFT A;  4NLN A;  4DF4 A;  1ZD4 A;  1PK1 A;  3SQI A;  2EAN A;  3UM9 A;  2KE7 A;  4RQ4 A;  3T5H A;  2E8O A;  1RYS A;  3RH5 A;  2PFP A;  3FYH A;  1X40 A;  4QZE A;  4TUQ A;  1XO0 A;  1XWL A;  2YMM A;  4UAV A;  2W55 A;  1A6S A;  4CNQ A;  1CUK A;  1U4B A;  4O3Q A;  1V97 A;  4XQ8 A;  3Q8P B;  1RYR A;  4O0I A;  2K4P A;  1SV4 A;  4QJF B;  4NJ8 A;  8ICE A;  4B6J A;  4I28 A;  1QLN A;  2WF7 A;  4CF3 A;  1T4G A;  2HHT A;  2K4H A;  2BCV A;  4UBB A;  3EPG A;  2ISP A;  2W8L A;  5HR6 A;  1KW4 A;  2GOL A;  2K4E A;  3D2S A;  2ATL A;  4IQW A;  2JH7 A;  2KJ9 A;  7ICL A;  3KHH A;  3MAB A;  3BJY A;  1DRG A;  2OYY A;  4RQ6 A;  1X66 A;  1NK8 A;  4BWJ A;  4R65 A;  4I2H A;  9ICM A;  2F1I A;  2KK0 A;  4K4I A;  5KG5 A;  1TV9 A;  2JZB B;  3LYS A;  7ICT A;  5DQI A;  5DBB A;  5KFV A;  4PHD A;  3GZF A;  4NLB A;  4B9V A;  1RG6 A;  2EH9 A;  4FBU A;  5J2K A;  4YFK A;  5AI0 A;  2YB1 A;  3WK7 A;  4DF8 A;  4RU9 A;  1DXS A;  3IN5 A;  5J2H A;  4YXJ A;  1BNP A;  4BXO A;  1S9F A;  1JRO A;  1NJX A;  4FFD A;  5HHI A;  2J6S A;  5AM0 A;  3PR4 A;  2ASD A;  3M8R A;  3FC4 A;  3BS5 B;  4YMO A;  4QZH A;  3V7J A;  1Z00 A;  5ALS A;  1SGG A;  4I2E A;  2ASJ A;  1Z1B A;  3RJG A;  2KIV A;  1BNO A;  1PK3 A;  4OD0 A;  4CF4 A;  3TQ1 A;  4KLD A;  1XSP A;  5K4L A;  1NKC A;  3U26 A;  4M6W A;  2XID A;  5J2I A;  3PO4 A;  2W7P A;  1LB2 B;  5DB6 A;  2RQ5 A;  4J9M A;  4ED0 A;  1SL0 A;  3HKZ C;  1LV5 A;  2PXI A;  4KN4 A;  8ICU A;  4ZOH C;  4J9S A;  1RQL A;  2JHD A;  3ZDD A;  5CP2 A;  1WUD A;  3PW7 A;  4J9R A;  2GLE A;  2WF6 A;  5KFG A;  3FM9 A;  5HR7 A;  1X42 A;  3NTU A;  3QYP A;  2KOB A;  1SV0 C;  3HKZ F;  4QZB A;  4ECQ A;  3ORY A;  1NK6 A;  3JPO A;  4RQ0 A;  2FMP A;  4RZR A;  4RPX A;  4Y2X A;  3WK5 A;  1PVP A;  4DOC A;  4GC7 A;  3WK4 A;  4FO6 A;  1SIJ A;  3A0H U;  5D49 A;  5G5H A;  1ZQQ A;  1D9F A;  1QCK A;  3F5E A;  2NRV A;  7ICF A;  2BPC A;  5HNK A;  1ZQI A;  1NJW A;  3OSN A;  5AKI A;  4QZG A;  1Z4O A;  5ALR A;  5J2F A;  2B21 A;  2VA8 A;  3TFR A;  4B9S A;  3ZI4 A;  1A0P A;  5KFU A;  3CYM A;  4DQI A;  4UAS A;  3H7I A;  5EWF A;  4DS5 A;  2FLN A;  2Y1I A;  1QH9 A;  5J0P A;  2H3I A;  1KL9 A;  2DUY A;  9ICN A;  4UB1 A;  3IG5 A;  3EWA A;  4BWM A;  2FPL A;  4F2R A;  3HX0 A;  2H3V A;  4TUR A;  2PFQ A;  4TUP A;  1ECW A;  1NKB A;  2W3S A;  2GO7 A;  5KAI U;  4KLU A;  2VA3 A;  4M0A A;  4EBD A;  2IOH A;  2LHT A;  3GIL A;  1N62 A;  2ZJ5 A;  3Q8Q B;  3I1Y A;  4DQP A;  3GFK B;  1TAQ A;  3T3F A;  2R8K A;  1KTQ A;  1X9S A;  2LKY A;  1RM6 C;  2ZIU A;  4J9P A;  2W7O A;  4KX5 A;  1BPY A;  4PGX A;  1X6J A;  4Q44 A;  3GQC A;  4HYK A;  1UT8 A;  3QZ8 A;  5EWG A;  8ICV A;  7ICG A;  1ZQW A;  3B0X A;  5ALH A;  2H3F A;  4O3S A;  4C7Y A;  4UBC A;  3BQ0 A;  1VLB A;  4G9B A;  4XUS A;  4J9K A;  3V7K A;  3LDA A;  3V72 A;  2JEF A;  2W43 A;  3C1Y A;  4NLZ A;  3RRG A;  2ZIX A;  4I2C A;  3QXG A;  4YD1 A;  5BPC A;  1L3U A;  2KVC A;  5C0Y A;  3C21 A;  5DB7 A;  8ICW A;  3THV A;  5C5J A;  2I9G A;  1KSP A;  2B0C A;  1RQN A;  4NLC A;  1DK3 A;  4DQQ A;  3RH4 A;  4F92 B;  1GO3 F;  1Z4N A;  4ECW A;  7ICP A;  2BHN A;  2LPE A;  1NZB A;  3TAC B;  4QWE A;  5DG9 A;  2KZ3 A;  1DGJ A;  4YVZ A;  1SV0 A;  4ED3 A;  1KRP A;  3BQ7 A;  3GII A;  4E0D A;  3GIJ A;  1YZ7 A;  5DB9 A;  4ECY A;  4IRC A;  2F3N A;  4DWI A;  3E0F A;  1B43 A;  1ZQV A;  9ICF A;  5ALU A;  3KKA C;  1C7Y A;  3NVW A;  2DPJ A;  2VA2 A;  2D3D A;  2DKZ A;  5AM4 A;  2W9B B;  4KIT B;  2ZIW B;  3PY8 A;  4RQ7 A;  2LYB A;  4G3I A;  2BKE A;  4YR3 A;  3PST A;  1SL2 A;  4DSJ A;  4OJL A;  5KG1 A;  4ELT A;  1F0M A;  3RR7 A;  2ZIW A;  2FPM A;  4ECU A;  4Y2V A;  2W9B A;  2OWO A;  4JK1 A;  5DDY A;  5KFS A;  1N5W A;  5L1M A;  4Y2S A;  5ALY A;  4IC9 A;  3AQE A;  1ZQJ A;  4J9N A;  9ICS A;  3KHR A;  2XCP A;  1JMS A;  4Y2Q A;  5GTH U;  2H3Z A;  2HHW A;  1PVR A;  5ALJ A;  4DOA A;  3PX0 A;  5F9N A;  1ED1 A;  2PI4 A;  2OEH A;  3PR5 B;  1ZD2 P;  3UQ0 A;  5KFH A;  1OW5 A;  5AKZ A;  5ALZ A;  3MR5 A;  4Q8F A;  1SZH A;  2JEG A;  4U6P A;  4XA5 A;  5CJ7 A;  3OHA A;  4NM2 A;  5KFN A;  1RXV A;  4KN7 A;  8ICR A;  3JPR A;  1KFS A;  4UB2 A;  3IHQ B;  1ZQM A;  3NRW A;  9ICV A;  5IIL A;  4M04 A;  2MUT B; 
#chains in the Genus database with same CATH homology
 4NL9 A;  1WWV A;  2KSO B;  1RG6 A;  2ES6 A;  2L5Y A;  1LKY B;  1DXS A;  2B6G A;  2LPE A;  1PK1 A;  3TAC B;  2EAN A;  5JRT A;  1PK1 B;  2KE7 A;  2E8O A;  3HIL A;  1SV0 A;  3BS5 A;  5JU5 A;  1X40 A;  2E8N A;  3BQ7 A;  2QAR B;  2Y9U A;  2F3N A;  3BS5 B;  1OXJ A;  3KKA A;  1SGG A;  1B0X A;  3KKA C;  4MHV A;  2KIV A;  1PK3 A;  2D3D A;  4IS7 A;  2JV3 A;  2DKZ A;  2QB0 A;  3SEN A;  2E8P A;  2DKX A;  1V38 A;  2K4P A;  2D8C A;  1SV4 A;  4NJ8 A;  1F0M A;  1V85 A;  1WWU A;  5JTI A;  1LKY A;  2ESE A;  4PZN A;  2FE9 A;  3SEI A;  2QKQ A;  2E8M A;  3K1R B;  4RQN A;  2GLE A;  4NL9 C;  2EAP A;  5L1M A;  3H8M A;  2LMR A;  5KNI A;  2EAO A;  1KW4 A;  1X9X A;  1SV0 C;  3TAD C;  2F44 A;  2KG5 A;  2F8K A;  2Y9T A;  1COK A;  2KMD A;  4RQM A;  1X66 A;  1UCV A;  2EAM A;  1Z1V A;  1OW5 A;  2DL0 A;  3BS7 A;  1SXE A;  2YTU A;  2QB0 B;  2QB1 A;  5F3X B;  3IDW A;  5J8Y A;  2KSO A;  5J8Y C;  1UQV A;  1B4F A;  3TAD A;  1SXD A;  4PZO A;  2K60 A;  2QAR A;  1JI7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...