1PK1A

Hetero sam domain structure of ph and scm.
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
68
structure length
68
Chain Sequence
PPISSWSVDDVSNFIRELPGCQDYVDDFIQQEIDGQALLLLKEKHLVNAMGMKLGPARKIVAKVESIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polyhomeotic-proximal chromatin protein
publication title Structural organization of a Sex-comb-on-midleg/polyhomeotic copolymer.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription repression
total genus 19
structure length 68
sequence length 68
chains with identical sequence C
ec nomenclature
pdb deposition date 2003-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07647 SAM_2 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 1pk1A00
2JV3A 2QARB 2K4PA 1SV4A 1WWUA 2EAPA 3SEIA 2YTUA 2EAOA 1JI7A 2E8OA 3SENA 3H8MA 2ES6A 2DKXA 1SXEA 1PK1B 5JTIA 2KE7A 2Y9TA 2EANA 1X9XA 2E8MA 2QB0B 2QARA 4RQMA 3KKAC 3TADC 2E8PA 4PZOA 1RG6A 2K60A 3K1RB 1KW4A 1OXJA 5J8YA 2KSOB 3BQ7A 2LPEA 1PK1A 2F3NA 4RQNA 5F3XB 1UCVA 2QB0A 2QKQA 5KNIA 4NL9A 1SV0A 5JU5A 1X40A 1V38A 1F0MA 2QB1A 2DKZA 1COKA 2EAMA 2Y9UA 4PZNA 4IS7A 3BS7A 5L1MA 1PK3A 2KSOA 1LKYB 2LMRA 2KG5A 2DL0A 1WWVA 1SXDA 2KIVA 4NJ8A 5JRTA 3BS5B 2D8CA 1SGGA 2F8KA 4MHVA 1OW5A 1LKYA 2B6GA 2FE9A 5J8YC 1Z1VA 2D3DA 3KKAA 1DXSA 1B4FA 1B0XA 3TADA 2L5YA 2F44A 2ESEA 2KMDA 1V85A 4NL9C 1SV0C 3BS5A 2GLEA 2E8NA 3TACB 1UQVA 1X66A 3IDWA 3HILA
chains in the Genus database with same CATH superfamily
3T5LA 5J0XA 7ICFA 4QZEA 2JZBA 3THVA 3C29A 4DSEA 2OHFA 3PMLA 3NS1A 3K1ZA 5C5JA 1O08A 4YFKA 5FP0A 3F2DA 3KHLA 5J2KA 3KTQA 3EW9A 2RHFA 1TKDA 2VJ5A 1RYUA 1X9XA 3F5EA 2E8MA 9ICAA 3VC8A 2JMGA 2Q0ZX 1ZQZA 4J9PA 2P35A 5KT2A 2BPGA 4RUAA 1ZQKA 1J97A 5J2CA 3UMCA 5KFSA 1Q8KA 3AMZA 1S0OA 4UAVA 4B9SA 4DQQA 4B9TA 4HYKA 2Y0SF 5D46A 4CDGA 4UB8U 4ED1A 1X40A 1NZBA 4BXOB 1COKA 1ZQSA 2OWOA 1X2IA 1TE2A 2H3VA 4RQ1A 3TAPA 5ALPA 2J6UA 1FEZA 2P66A 2K4IA 1VDVA 3J81j 1PZNA 5AI8A 3HWTA 4NM1A 3MC1A 8ICHA 1RXWA 2EDUA 5B66U 4F50A 1NKEA 4P0PA 3L3FX 3N4MB 2G5HB 4A8EA 3C28A 4I2FA 2XC9A 1KDHA 3AL0B 1B4FA 2N1RA 4RPYA 1ZD3A 3LDAA 1KFSA 4WJ3B 2FPKA 8ICVA 8ICIA 4DSJA 1X6IA 4YN4A 5J2BA 3S6JA 4RPXA 4MF2A 3UQ0A 2BQRA 2W9BB 3M1YA 3F5AA 1NNLA 5ALGA 1IM4A 1IXRA 2V9WA 3SENA 3GIIA 2PFNA 4Y2RA 5CA7A 5DLFA 5L1KA 1X9SA 4TQRA 3H0RB 3H8JA 3MR3A 1KTQA 1D9FA 4DEZA 3TADC 3N7SC 7ICOA 4DFKA 2YMQA 4M2YA 4Q43A 3PW0A 4FBTA 4YMNA 5J8YA 5CB1A 5KAFU 1SKRA 1L6NA 3AQEA 4FS1A 4RQ4A 3GIMA 5ALDA 5ALVA 2F1HA 3Q8KA 3OTQA 1KRPA 2E3TA 5KL1B 1B22A 1S97A 4JUZA 2Y9UA 9ICLA 4Y2QA 9ICUA 4M0AA 5CRXA 4P4MA 4O3RA 5AM0A 4DOAA 4DLEA 1L8OA 4QZBA 4DSFA 3M9OB 3D2SA 2JH1A 5AI9A 4YCXA 3PX4A 1MQ3A 3TKAA 1CEZA 3V7LA 4F4KA 3OSNA 5KG6A 3B9JA 2JEFA 2RP5A 1A76A 3D6JA 4EELA 4R65A 2CRXA 4LJXA 3H4BA 4J9NA 2ZTCA 2BCRA 4DOCA 4ECYA 1TV9A 2HHSA 5AM2A 5DG7A 3KBBA 4O3PA 5KFXA 1JUDA 9ICWA 4Z6FA 4C8OA 1S0VA 2ZIUA 3A0HU 4UBCA 3RH4A 2R18A 7ICQA 5AKYA 2IBKA 2YQEA 4GC7A 3RBEA 1XS9D 1U47A 4CF5A 1SB3C 8ICFA 4DL2A 4QZ8A 5KL8B 4KLHA 9ICIA 3WK6A 3RFAA 3SV4A 2DPJA 4I28A 3PR4A 3MFHA 1MC8A 2ASLA 4IQWA 3MR2A 1T4GA 5HMLA 8ICLA 4UAYA 3MR6A 3GZFA 1U49A 2ISOA 2HBMA 1PK1A 4DO9A 3OSPA 3JPOA 3ETLA 5ALHA 5CR0A 4NL9A 5GTHU 3AM9A 2KJ5A 5AI5A 3TANA 2PKEA 3AU2A 4EX6A 5ALFA 3UMGA 2EZYA 3ONNA 4ECSA 5L1MA 3HW8A 5J2IA 4RNMA 3EZ5A 1ED1A 2LYBA 1DOQA 5KTQA 3UXPA 5ALQA 1KSPA 2QLTA 4JB3A 1U45A 4F5RA 5KG3A 7ICPA 3G6VA 3SAGA 3ISBA 3BS5B 3TAQA 4ECRA 4F5OA 9ICVA 4KLQA 4DCCA 3CNHA 4Y2XA 1Z1VA 4FZNA 3EWAA 5HHHA 4IR1A 2FLLA 3OJUA 4YMOA 4RQ6A 1T8EA 2KVSA 1NKCA 2VKQA 1QSLA 5DDYA 1CI4A 5DB8A 1ZQNA 3IDWA 2JEJA 2F1JA 5AKZA 3T5KA 2WF7A 1Y88A 3QU2A 2F76X 2LM1A 2EAOA 1NK7A 5DBBA 2YMLA 1FO4A 4KLSA 3QZ7A 3UQ2A 3FC4A 2BQ3A 4M9LA 5EE1A 2NRTA 5AKKA 2XCAA 3QUQA 3GDXA 4RU9A 4KLJA 3ISCA 1BPDA 1TK0A 2DPIA 1BVSA 3K1RB 1OXJA 2Z7JA 1Z00B 4RQ3A 2ZIWA 3NRWA 3KOOA 3MBYA 4O3MA 5AKXA 4YR2A 4FFDA 1D8BA 2DBYA 5AM3A 2IMWP 2PFPA 4M9HA 4ECWA 2EAMA 4FZMA 3HPOA 4ED2A 4UB6U 4RT3A 4UASA 4U6PA 1JMSA 4R8UA 3MDCA 4CNQA 2IOHA 4GXJA 4IL6U 5EOZA 1TAQA 4NXZA 1L3UA 2LYHA 1K1SA 2KFZA 5ALSA 2ODGA 5KFHA 2IOFK 8ICTA 3HKZF 5KFYA 3UPQA 4UARA 1OW5A 4EYHB 2HVHA 8ICJA 1BPBA 1ZD5A 2JZBB 3E2EA 3TFSA 4Z6EA 2E1EA 2C2EA 4KLTA 1KL9A 1F5SA 1YT3A 4PGYA 1NZPA 2KKVA 8ICZA 5J0RA 3C2KA 1V9PA 3RJKA 1U9LA 3FM9A 2JR5A 3MGIA 4K4IA 5AKIA 1MSWD 2MRLA 3RAQA 2BCUA 5DB9A 4I2DA 1ZYQA 4NLCA 3SR6A 5DG8A 8ICOA 3SEIA 4FZLA 1JI7A 2ES6A 5A0LA 2PXIA 2ZJ8A 5CWRA 4PL1A 3B0XA 2BDUA 3UXNA 5DQIA 4RQ7A 4RUCA 2AHOB 3C1YA 5KFVA 5KFUA 1NK0A 4PZOA 1IIPA 3V7JA 1K5OA 4YR3A 2W9AA 5GTIU 2UVWA 1LV5A 3FYHA 4NM2A 9ICEA 1NK9A 3KHRA 4KLDA 5BPCA 4DWIA 2HW3A 2QB0A 2QKQA 2I5HA 5KFLA 2R8HA 5L1LA 4QWCA 5JU5A 5D4BA 4P0PB 3BS7A 2AJQA 3RRHA 5ALXA 1Z19A 2A1JA 4CCHA 1QSYA 5J0UA 5IINA 3QU7A 4HAIA 2KIVA 3ZI4A 5JRTA 5KG2A 2A1AA 4YXJA 1XSNA 4Q8EA 1S0NA 1NK4A 3HT3A 3NVZA 4MFFA 2D8CA 2KVCA 2W11A 5KFOA 4XQ8A 3N97B 1LKYA 1ZD2P 3L4PA 5J0QA 4QIWF 4C0ZA 1UT5A 4BX9C 3RBDA 5KFQA 1S5LU 3E58A 5HR6A 5AK6A 5KT3A 2NRVA 4FBUA 9ICSA 2K89A 2GH1A 3NVYA 2ZIXA 1K1QA 3C5GA 3BZKA 3PMNA 3WKAA 2V4QA 2XY5A 3PW2A 3OHAA 5KT7A 2K4PA 1N56A 1RQLA 3EPGA 2FMSA 1QQ5A 4BWJA 1XNSA 2XGPA 4BUGA 4OJ6A 3H8SA 1RQNA 2ZXIA 2NV3A 5IIJA 1MQ2A 1H38A 4MF8A 3RJEA 2E1FA 4NWIA 4ED8A 4Y2JA 2KN7A 3KKAC 3KHGA 3RJFA 5AM5A 4J9SA 1ZQIA 2KKPA 3ZDAA 1KFDA 3IN5A 3F53A 3DDHA 2WF8A 3PSFA 4RQNA 1AROP 2NRWA 2JEIA 4O3OA 1SV0A 2QB1A 1F0MA 5C0YA 2DKZA 2AGOA 5KFNA 2R8GA 4EZ6A 3QU5A 5EE0A 2LYAA 1T7PA 4DQRA 4QW9A 2NO4A 4ECUA 5AKEA 2W9MA 2KNJA 4O0IA 5ALEA 4KN4A 4YG2A 4ZOHC 2MUTA 3PSPA 2DF4B 7ICJA 1N63A 4XA5A 2OH2A 8ICYA 4QJFB 3AEVA 3GIJA 2H3ZA 2ZIUB 1RXVA 4C7YA 3QYPA 4QWAA 7ICKA 3ORYA 1F44A 5KAIU 2Y1JA 2H5XA 2H3IA 4ECQA 2KV2A 5KFBA 3VCBA 2NRZA 4E0DA 5KFIA 1ZQWA 1ZJNA 4F2RA 4EEKA 4K4GA 1ZQGA 5AKLA 1WWUA 1JXLA 3M8RA 4DFJA 1HUOA 1SL1A 3FDSA 1PK1B 3HRDD 2IOFA 5ALKA 3H0LB 3PY8A 8ICCA 2EANA 4TUPA 1RM6C 5DBCA 4DQPA 3WU2U 4O9MA 2UVUA 4RPZA 3NUQA 3PO4A 2J6SA 5AM4A 5KFRA 5AHXA 2WB1F 1PVQA 4Y2TA 1ZQVA 3PX6A 2RQ5A 3RB6A 5L1IA 4XUSA 1QLNA 3ALRA 3QXGA 2BGWA 1DK3A 1JROA 4CF4A 5DG9A 2BQUA 3MGVA 2MU2A 5AKHA 2FDRA 2WF5A 3HJEA 4J9KA 3PO5A 2MAXA 1MA7A 4DL3A 2P6RA 3H8WA 2C2DA 2HHVA 1PK3A 3PNCA 8ICAA 2M0NA 4FO6A 1TK5A 4KLOA 2R8IA 4ECZA 4U7CA 1S0MA 4KLEA 1N48A 4LVSA 3WK4A 1ZETA 4DOBA 2Y0SC 1D9DA 2K4EA 1C7YA 1SZPA 1ZQCA 3SAFA 5ALZA 3SAHA 4JV0A 3TARA 3D2QA 3AUOA 1SGGA 3CYMA 2YN4A 1Q3VA 4B9LA 2B6GA 4UB2A 2FE9A 5J2FA 4TQSA 4NLKA 4DS4A 3T79A 1WCLA 5AI0A 3IHQB 2ZTEA 3H7IA 2KMDA 2LKYA 9ICNA 1FFVA 5KG5A 3H4DA 4PGXA 3QUBA 2JGAA 3PSTA 1N60A 2JRZA 3RB4A 4NLZA 4DFDA 5HNKA 3GILA 5F9LA 4ICAA 5L9XA 1AQ6A 2M9NA 1V97A 4K4HA 4M47A 2XVTA 3BJYA 4P2HA 1SXEA 2F77X 8ICUA 1ZQQA 2ZIWB 4GXIA 4ELVA 2AU0A 2BZFA 5JTIA 2ZJ5A 4RQMA 1QCKA 3EYZA 2AGQA 4OD0A 1ZQRA 3RAXA 2XY7A 3RF9A 2C28A 3R9KA 1RDFA 2KTQA 1JXEA 1CUKA 3O0FA 3WK7A 4R8UB 3C5FA 1YZ6A 2F1IA 2EQYA 3FAHA 2PI4A 1SKSA 5CP2A 1PVPA 1SKWA 4JV1A 5J29A 1T3NA 1BPXA 3ETRA 4MFCA 3ED5A 4OO1J 3NVWA 3EPIA 1SXDA 4IR9A 2WAQC 1S8OA 1BPEA 5IIOA 2G08A 3QZ8A 4JWNA 1NK5A 5CJ7A 1CRXA 3DV9A 1SL0A 3GU3A 4F72A 1UA1A 5J8YC 2VA8A 2BCQA 4DQSA 8ICKA 4JWMA 5J0YA 1V85A 5K4LA 3LVWA 4CRXA 2W7PA 2DGZA 2BPCA 1N5WA 4UQGA 4Y2VA 1ZOLA 4MEYA 1XSPA 4YR0A 3JPRA 4TUSA 2ZJAA 3UXOA 3NGDA 2KFNA 5KT4A 2JV3A 1QSSA 5DQGA 4LZDA 3RH6A 5KFWA 3RR8A 4B9UA 2YTUA 2YB4A 4F2SA 9ICOA 4YVZA 1S77D 2DKXA 2BCVA 5J2DA 1C20A 1RYRA 2OYYA 4IQTA 8ICQA 4C7ZA 2HI0A 3HP6A 2KE7A 3IG5A 5KFPA 2XO7A 2QB0B 2FPMA 5HMMA 4IRDA 3KD3A 4KITB 3QEAZ 2KICA 5DB7A 3G6XA 1NI3A 3F2BA 4YXMA 5TZVA 3NVVA 3IP4B 3KZIU 2A1JB 4QNLA 3QUCA 9ICGA 3PVXA 2V4RA 1UCVA 2KZZA 4DL4A 1DGJA 1V38A 3RRGA 5AK4A 3WK8A 5DGAA 4UB3A 4OJLA 3CW2C 5L1JA 4LZGA 1LKYB 4FE3A 1JN3A 4YD2A 4GXKA 3T3FA 2IHMA 4M9NA 2I1QA 3LWMA 2AQ4A 3ZDDA 2KOBA 4RQ8A 5HP4A 1ZRNA 4DQIA 3GV5B 2ZIXB 5J2HA 5KG1A 3C2LA 1RYSA 2W54A 2LI6A 3GV7B 1BGXT 1ZQYA 1HJPA 3AN1A 5JUMA 5B5EU 2ZXHA 9ICPA 4NL9C 2PFOA 1B43A 9ICMA 2W8KA 4ED6A 1D8YA 4DL7A 3TACB 1ZQFA 3BQ2A 4KLFA 2W43A 1WCNA 5KFZA 3LWLA 5CEHA 1J2NA 2Q4TA 3NTUA 4B6JA 3N28A 3KZXA 1HIWA 5AM1A 4US9A 4EEYA 1SV4A 4JV2A 2KJ8A 1ZRMA 3I76A 3WKEA 3PSIA 4BGDA 2BR0A 3PW5A 2OCEA 3QNMA 1EXNA 1ZQDA 2F8LA 1X9MA 4ECTA 4DFPA 4US8A 2R8JA 3H0MB 2FLNA 1KW4A 4DSKA 2VANA 8ICRA 2GO7A 3RR7A 5BOMA 5AK3A 2OM6A 2G5IB 4NV0A 1UPHA 3SMVA 2YY6A 1JALA 4EZ9A 2MUTB 2BHNA 2CPRA 4UATA 2XY6A 5KT6A 4EBCA 2BCSA 1FIQA 1WWVA 1N61A 4I29A 4DS5A 3AQFA 1IV8A 3TQ1A 2H3FA 3ZDEA 3MFIA 2K8CB 1N62A 5KFMA 3DEEA 3RJIA 3JPNA 2HOIA 4RQ5A 3GFKB 4C8NA 4J9LA 4NLGA 3PX0A 1B0XA 3HX0A 3C23A 9ICRA 2ESEA 4KX5A 4UAZA 2FMQA 5AKGA 3Q8PB 3BQ0A 1OUQA 2HVIA 2UVRA 2JHDA 3N7PD 5J0OA 1PVRA 2E8NA 4YD1A 4P0QA 4KLGA 9ICHA 2CXYA 1UQVA 4I2BA 5TISU 2WF6A 1A77A 4CE6A 5IILA 1L3VA 5ALNA 4J9OA 3A0BU 2HHXA 3H8MA 2HSZA 1L5UA 3PR5B 1Q46A 2ATLA 4I2CA 5J0TA 2W3SA 7ICSA 4EX7A 9ICXA 5ALIA 4F4XA 4C4SA 1ZQLA 3KFUF 2FJ6A 2QARA 1UA0A 9ICJA 4QZDA 5EWGA 2KHVA 4EBEA 1COOA 1TAUA 2ISPA 3QUTA 3ZDBA 4ECVA 4I2HA 4ECXA 2C2RA 4KLUA 2ZUDA 2F3NA 5AKJA 3Q8LA 2XI9A 5KFCA 5J0PA 2W55A 2ZG6A 4QZGA 8ICGA 3RJHA 2A3VA 2EZZA 4ZH4A 4PPXA 4NY8A 3C2MA 4R66A 2HHWA 2W7OA 2HOFA 5EE9A 2ZUCA 3SZ2A 2K8BB 5KFFA 4CGZA 5DDMA 2W9CA 2KSOA 1BNOA 1TFRA 1URJA 4PHDA 1ZQJA 2DWQA 8ICWA 5KFDA 2H3QA 4O5CA 7ICEA 2DFLA 2K8AA 1NJYA 2G09A 2KP7A 4MHVA 2PFQA 3IRUA 4OJ5A 7ICNA 9ICFA 5EWEA 1ZQAA 3TADA 2EZXA 2L5YA 2O6KA 2BPFA 5ALLA 3M6KA 2HHQA 8ICMA 3BQTA 2K4HA 1JX4A 1S76D 5KG4A 5AIBA 4QIWC 3SQIA 1XSLA 4B9NA 4B9MA 5HR7A 5ALWA 1ZQBA 3PW7A 1UHUA 3D2NA 3TI0A 2KZMA 4YQWA 4UB5A 1LVHA 2GWSA 2JEGA 1ZQTA 3RJGA 1P7DA 8ICNA 2PMZC 2ZTDA 4BJQA 2Y9TA 4IRKA 2R8KA 4DL5A 4I2JA 2ZIVA 3BDPA 5ALTA 2W8LA 7ICRA 4M9GA 4TUQA 5DGBA 9ICKA 1U48A 4PH5A 3SI8A 2HMXA 3V7KA 2YMPA 4UB1A 4R63A 4G9BA 3Q8RB 4KMUA 1HEKA 1ZXIA 5AIAA 1BPZA 2ALZA 3QX7A 3MR5A 2YMMA 3RB3A 3C1ZA 4AYBC 1ZQXA 1VLBA 3QU4A 3WKBA 2LMRA 4I2AA 2AH5A 7ICGA 4M6WA 4OJOA 1TAMA 4QWBA 2J6TA 3V6JA 7ICHA 4GC6A 2MSNA 3CP8A 4F93B 2OEHA 5H2FU 1O03A 2HCFA 3GIKA 3BZCA 2D3DA 4PHEA 1DXSA 1L3TA 5KFKA 4C80A 2F44A 4ELTA 8ICSA 4GIBA 5J2JA 4QZHA 1S10A 1SV0C 3IM1A 1KFTA 4F4ZA 2HBLA 1NJWA 2AGPA 5HHIA 4F4YA 2D6FC 4DL6A 3L5KA 3HILA 1XO0A 4RQ2A 4UB4A 2WHEA 4C8LA 2GOLA 5BOLA 3K75D 1VJ5A 5ALUA 4DF8A 3OHBA 5AICA 9ICCA 2E8OA 5G5GA 2WAQF 1S9FA 3Q8MA 3ZD9A 3LVVA 1ZQ1C 2FMPA 2JXJA 3MGHA 2C22A 3MDAA 1L8LA 5ALOA 4ED7A 1N5XA 1NKBA 1L7NA 2BKEA 2LPEA 4UAUA 5DBAA 3PZPA 1NOMA 2IHNA 1ZQUA 1JRPA 1XU4A 2AXTU 2ZUBA 5KNIA 2FI1A 1YZ7A 2HHUA 1LB2B 1ZQPA 4F91B 4F5NA 4F4WA 3LYSA 1SIJA 3UM9A 5D49A 3NASA 5IIMA 2WB1C 2XICA 3I28A 2BDPA 5KG0A 4O3SA 2KJ9A 3SV3A 3Q8SB 4BXOA 4KTQA 4CF3A 4PHPA 4QZCA 2UVVA 5F9NA 4FS2A 1MN8A 1SZHA 4F5PA 4M04A 3V6HA 5AI4A 9ICQA 5KFAA 8ICEA 3QE9Y 3TFRA 2HHTA 1X42A 5IIIA 4Z6DA 5EE3A 1SWWA 4QZIA 4EENA 4ELUA 3UMBA 4G3IA 1SL2A 2PI5A 1DRGA 4Q45A 2IA6A 5DKWA 2KD1A 3M9NB 5KFEA 4QWEA 3I1YA 2E5SA 4OCZA 4PJ0U 1Q3UA 4O3QA 2DQNB 1KEJA 1TK8A 3JPQA 1JIHA 2MA1A 5G5HA 2HBJA 1Z1BA 2CN1A 7ICLA 1X6JA 3LK9A 3JPTA 3CRXA 2G06A 1TVAA 2W9BA 5J0SA 2Y1IA 2KHQA 4P4PA 1ZQOA 4QZ9A 1RG6A 1XC9A 1IG6A 7ICTA 2WTFA 4KLLA 4J9MA 4GFJA 3T5JA 5KT5A 1QQ7A 4IQUA 1M6YA 3V72A 4KLMA 4F71A 2LM4A 9ICBA 3M7DA 2LHTA 3AU6A 4PZNA 4EBDA 2YB1A 4IS7A 2ASJA 4BDPA 3JPSA 2NRXA 4UBBA 3ZDCA 1ZD4A 3F2CA 2KK0A 4I2GA 4KLIA 4PGQA 3PW4A 1GO3F 2WF9A 4UW9A 4X5VA 4Z6CA 4TURA 4KX3A 4I2IA 4F3OA 1WG8A 3Q8QB 3V6KA 4J9QA 4P0QB 1U4BA 1XO1A 5ALRA 4IRCA 1L7MA 3E0FA 9ICTA 2DUYA 2LBOA 1KN5A 5AI6A 3OGUA 5AK5A 4M9JA 4RQ0A 4YP3A 1BPYA 2QARB 5KG7A 1D8LA 2F2AB 4J9RA 3RH5A 2OXOA 1ZQHA 1DK2A 4DF4A 2I9GA 2W04A 3ZD8A 1KBUA 2VIXA 5J2GA 3WK5A 1WUDA 5J2EA 4DSLA 5T14A 2XIDA 4JMUA 8ICXA 1KLNA 4F92B 4O5EA 4P4OA 5KFTA 3GV8B 4IQVA 1T94A 1Z4OA 2KIWA 1DGSA 4PHAA 4IC9A 2E8PA 4Y2YA 4Y2UA 1Z4NA 7ICIA 2W9CB 2KSOB 5DB6A 3BQ7A 3OJSA 2KZ3A 2B21A 2I6XA 4I27A 2NO5A 4KMOB 4MEXA 1QH9A 1T3QA 8ICPA 2AQ0A 4RNOA 1XWLA 5DLGA 4RZRA 2HBKA 2P6UA 4KN7A 3WKCA 3G6YA 4Y2SA 3M9MB 3RB0A 3C21A 3T5HA 2G07A 3RTVA 4B9VA 2XCPA 5KFJA 2DL0A 1NJZA 4EYIB 4NJ8A 1A0PA 1ECWA 1KQQA 3OPXA 2W03A 1SWVA 2FPLA 2A19A 3IG8A 1QTMA 4YMMA 4Q44A 3GQCA 4ED3A 2WFAA 3WK9A 4F5QA 5IIKA 4R64A 4QZFA 1ZQMA 3U26A 1KKXA 3KKAA 4QWDA 8ICBA 2HDOA 1N2XA 1X9WA 4XRHA 4RT2A 2KEYA 3SYZA 4BWMA 2EH9A 2XGQA 3BS5A 2GLEA 2VA2A 4UAWA 1BNPA 1J2MA 3WKDA 5F3XB 5E79U 3M8SA 2ZIVB 2YX8A 2EAPA 2HOQA 3EUB2 1A6SA 1RPLA 3SD7A 2RRDA 1ZQEA 2W3RA 2B0CA 2NYVA 1Z3EB 1L3SA 4J03A 4JK1A 4QZAA 3HKZC 4AP9A 4C4RA 5J0WA 1NK6A 2ASDA 4C8MA 5CHGA 1ZJMA 2VA3A 5ALJA 3B0YA 4MFAA 2K60A 4PL2A 2G0AA 3ICXA 1UT8A 4M6WB 5KFGA 3NRZA 1WYGA 1NK8A 1FFUA 3RJJA 4NLBA 1QQ6A 4DFMA 1Z00A 4OJPA 4GLXA 3H40A 3QU9A 3K4GA 2KG5A 4F8RA 2JH7A 2RDIA 2PMZF 4DLGA 4NLNA 1NJXA 5ALMA 3N7RC 4ED0A 3KHHA 4Y2PA 3BQ1A 4I2EA 4C8KA 4C4TA 1HUZA 2F8KA 4USAA 4ACOA 3IV6A 5ALYA 2RLTA 1PUZA 3JPPA 1L7OA 3QEBZ 3PV8A 3M6ZA 5J2AA 4O5KA 2RDJA 7ICVA 4DSIA 5EWFA 2FLPA 3ISDA 4RNNA 7ICMA 1L7PA 3MABA 7ICUA 4QW8A 4O3NA 2VJ4A 5DQHA 4Q8FA 1X66A 4AYBF 1RZTA
chains in the Genus database with same CATH topology
2JV3A 2QARB 2K4PA 1SV4A 1WWUA 2EAPA 3SEIA 2YTUA 2EAOA 1JI7A 2E8OA 3SENA 3H8MA 2ES6A 2DKXA 1SXEA 1PK1B 5JTIA 2KE7A 2Y9TA 2EANA 1X9XA 2E8MA 2QB0B 2QARA 4RQMA 3KKAC 3TADC 2E8PA 4PZOA 1RG6A 2K60A 3K1RB 1KW4A 1OXJA 5J8YA 2KSOB 3BQ7A 2LPEA 1PK1A 2F3NA 4RQNA 5F3XB 1UCVA 2QB0A 2QKQA 5KNIA 4NL9A 1SV0A 5JU5A 1X40A 1V38A 1F0MA 2QB1A 2DKZA 1COKA 2EAMA 2Y9UA 4PZNA 4IS7A 3BS7A 5L1MA 1PK3A 2KSOA 1LKYB 2LMRA 2KG5A 2DL0A 1WWVA 1SXDA 2KIVA 4NJ8A 5JRTA 3BS5B 2D8CA 1SGGA 2F8KA 4MHVA 1OW5A 1LKYA 2B6GA 2FE9A 5J8YC 1Z1VA 2D3DA 3KKAA 1DXSA 1B4FA 1B0XA 3TADA 2L5YA 2F44A 2ESEA 2KMDA 1V85A 4NL9C 1SV0C 3BS5A 2GLEA 2E8NA 3TACB 1UQVA 1X66A 3IDWA 3HILA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JV3 A;  2QAR B;  2K4P A;  1SV4 A;  1WWU A;  2EAP A;  3SEI A;  2YTU A;  2EAO A;  1JI7 A;  2E8O A;  3SEN A;  3H8M A;  2ES6 A;  2DKX A;  1SXE A;  1PK1 B;  5JTI A;  2KE7 A;  2Y9T A;  2EAN A;  1X9X A;  2E8M A;  2QB0 B;  2QAR A;  4RQM A;  3KKA C;  3TAD C;  2E8P A;  4PZO A;  1RG6 A;  2K60 A;  3K1R B;  1KW4 A;  1OXJ A;  5J8Y A;  2KSO B;  3BQ7 A;  2LPE A;  1PK1 A;  2F3N A;  4RQN A;  5F3X B;  1UCV A;  2QB0 A;  2QKQ A;  5KNI A;  4NL9 A;  1SV0 A;  5JU5 A;  1X40 A;  1V38 A;  1F0M A;  2QB1 A;  2DKZ A;  1COK A;  2EAM A;  2Y9U A;  4PZN A;  4IS7 A;  3BS7 A;  5L1M A;  1PK3 A;  2KSO A;  1LKY B;  2LMR A;  2KG5 A;  2DL0 A;  1WWV A;  1SXD A;  2KIV A;  4NJ8 A;  5JRT A;  3BS5 B;  2D8C A;  1SGG A;  2F8K A;  4MHV A;  1OW5 A;  1LKY A;  2B6G A;  2FE9 A;  5J8Y C;  1Z1V A;  2D3D A;  3KKA A;  1DXS A;  1B4F A;  1B0X A;  3TAD A;  2L5Y A;  2F44 A;  2ESE A;  2KMD A;  1V85 A;  4NL9 C;  1SV0 C;  3BS5 A;  2GLE A;  2E8N A;  3TAC B;  1UQV A;  1X66 A;  3IDW A;  3HIL A; 
#chains in the Genus database with same CATH topology
 3T5L A;  5J0X A;  7ICF A;  4QZE A;  2JZB A;  3THV A;  3C29 A;  4DSE A;  2OHF A;  3PML A;  3NS1 A;  3K1Z A;  5C5J A;  1O08 A;  4YFK A;  5FP0 A;  3F2D A;  3KHL A;  5J2K A;  3KTQ A;  3EW9 A;  2RHF A;  1TKD A;  2VJ5 A;  1RYU A;  1X9X A;  3F5E A;  2E8M A;  9ICA A;  3VC8 A;  2JMG A;  2Q0Z X;  1ZQZ A;  4J9P A;  2P35 A;  5KT2 A;  2BPG A;  4RUA A;  1ZQK A;  1J97 A;  5J2C A;  3UMC A;  5KFS A;  1Q8K A;  3AMZ A;  1S0O A;  4UAV A;  4B9S A;  4DQQ A;  4B9T A;  4HYK A;  2Y0S F;  5D46 A;  4CDG A;  4UB8 U;  4ED1 A;  1X40 A;  1NZB A;  4BXO B;  1COK A;  1ZQS A;  2OWO A;  1X2I A;  1TE2 A;  2H3V A;  4RQ1 A;  3TAP A;  5ALP A;  2J6U A;  1FEZ A;  2P66 A;  2K4I A;  1VDV A;  3J81 j;  1PZN A;  5AI8 A;  3HWT A;  4NM1 A;  3MC1 A;  8ICH A;  1RXW A;  2EDU A;  5B66 U;  4F50 A;  1NKE A;  4P0P A;  3L3F X;  3N4M B;  2G5H B;  4A8E A;  3C28 A;  4I2F A;  2XC9 A;  1KDH A;  3AL0 B;  1B4F A;  2N1R A;  4RPY A;  1ZD3 A;  3LDA A;  1KFS A;  4WJ3 B;  2FPK A;  8ICV A;  8ICI A;  4DSJ A;  1X6I A;  4YN4 A;  5J2B A;  3S6J A;  4RPX A;  4MF2 A;  3UQ0 A;  2BQR A;  2W9B B;  3M1Y A;  3F5A A;  1NNL A;  5ALG A;  1IM4 A;  1IXR A;  2V9W A;  3SEN A;  3GII A;  2PFN A;  4Y2R A;  5CA7 A;  5DLF A;  5L1K A;  1X9S A;  4TQR A;  3H0R B;  3H8J A;  3MR3 A;  1KTQ A;  1D9F A;  4DEZ A;  3TAD C;  3N7S C;  7ICO A;  4DFK A;  2YMQ A;  4M2Y A;  4Q43 A;  3PW0 A;  4FBT A;  4YMN A;  5J8Y A;  5CB1 A;  5KAF U;  1SKR A;  1L6N A;  3AQE A;  4FS1 A;  4RQ4 A;  3GIM A;  5ALD A;  5ALV A;  2F1H A;  3Q8K A;  3OTQ A;  1KRP A;  2E3T A;  5KL1 B;  1B22 A;  1S97 A;  4JUZ A;  2Y9U A;  9ICL A;  4Y2Q A;  9ICU A;  4M0A A;  5CRX A;  4P4M A;  4O3R A;  5AM0 A;  4DOA A;  4DLE A;  1L8O A;  4QZB A;  4DSF A;  3M9O B;  3D2S A;  2JH1 A;  5AI9 A;  4YCX A;  3PX4 A;  1MQ3 A;  3TKA A;  1CEZ A;  3V7L A;  4F4K A;  3OSN A;  5KG6 A;  3B9J A;  2JEF A;  2RP5 A;  1A76 A;  3D6J A;  4EEL A;  4R65 A;  2CRX A;  4LJX A;  3H4B A;  4J9N A;  2ZTC A;  2BCR A;  4DOC A;  4ECY A;  1TV9 A;  2HHS A;  5AM2 A;  5DG7 A;  3KBB A;  4O3P A;  5KFX A;  1JUD A;  9ICW A;  4Z6F A;  4C8O A;  1S0V A;  2ZIU A;  3A0H U;  4UBC A;  3RH4 A;  2R18 A;  7ICQ A;  5AKY A;  2IBK A;  2YQE A;  4GC7 A;  3RBE A;  1XS9 D;  1U47 A;  4CF5 A;  1SB3 C;  8ICF A;  4DL2 A;  4QZ8 A;  5KL8 B;  4KLH A;  9ICI A;  3WK6 A;  3RFA A;  3SV4 A;  2DPJ A;  4I28 A;  3PR4 A;  3MFH A;  1MC8 A;  2ASL A;  4IQW A;  3MR2 A;  1T4G A;  5HML A;  8ICL A;  4UAY A;  3MR6 A;  3GZF A;  1U49 A;  2ISO A;  2HBM A;  1PK1 A;  4DO9 A;  3OSP A;  3JPO A;  3ETL A;  5ALH A;  5CR0 A;  4NL9 A;  5GTH U;  3AM9 A;  2KJ5 A;  5AI5 A;  3TAN A;  2PKE A;  3AU2 A;  4EX6 A;  5ALF A;  3UMG A;  2EZY A;  3ONN A;  4ECS A;  5L1M A;  3HW8 A;  5J2I A;  4RNM A;  3EZ5 A;  1ED1 A;  2LYB A;  1DOQ A;  5KTQ A;  3UXP A;  5ALQ A;  1KSP A;  2QLT A;  4JB3 A;  1U45 A;  4F5R A;  5KG3 A;  7ICP A;  3G6V A;  3SAG A;  3ISB A;  3BS5 B;  3TAQ A;  4ECR A;  4F5O A;  9ICV A;  4KLQ A;  4DCC A;  3CNH A;  4Y2X A;  1Z1V A;  4FZN A;  3EWA A;  5HHH A;  4IR1 A;  2FLL A;  3OJU A;  4YMO A;  4RQ6 A;  1T8E A;  2KVS A;  1NKC A;  2VKQ A;  1QSL A;  5DDY A;  1CI4 A;  5DB8 A;  1ZQN A;  3IDW A;  2JEJ A;  2F1J A;  5AKZ A;  3T5K A;  2WF7 A;  1Y88 A;  3QU2 A;  2F76 X;  2LM1 A;  2EAO A;  1NK7 A;  5DBB A;  2YML A;  1FO4 A;  4KLS A;  3QZ7 A;  3UQ2 A;  3FC4 A;  2BQ3 A;  4M9L A;  5EE1 A;  2NRT A;  5AKK A;  2XCA A;  3QUQ A;  3GDX A;  4RU9 A;  4KLJ A;  3ISC A;  1BPD A;  1TK0 A;  2DPI A;  1BVS A;  3K1R B;  1OXJ A;  2Z7J A;  1Z00 B;  4RQ3 A;  2ZIW A;  3NRW A;  3KOO A;  3MBY A;  4O3M A;  5AKX A;  4YR2 A;  4FFD A;  1D8B A;  2DBY A;  5AM3 A;  2IMW P;  2PFP A;  4M9H A;  4ECW A;  2EAM A;  4FZM A;  3HPO A;  4ED2 A;  4UB6 U;  4RT3 A;  4UAS A;  4U6P A;  1JMS A;  4R8U A;  3MDC A;  4CNQ A;  2IOH A;  4GXJ A;  4IL6 U;  5EOZ A;  1TAQ A;  4NXZ A;  1L3U A;  2LYH A;  1K1S A;  2KFZ A;  5ALS A;  2ODG A;  5KFH A;  2IOF K;  8ICT A;  3HKZ F;  5KFY A;  3UPQ A;  4UAR A;  1OW5 A;  4EYH B;  2HVH A;  8ICJ A;  1BPB A;  1ZD5 A;  2JZB B;  3E2E A;  3TFS A;  4Z6E A;  2E1E A;  2C2E A;  4KLT A;  1KL9 A;  1F5S A;  1YT3 A;  4PGY A;  1NZP A;  2KKV A;  8ICZ A;  5J0R A;  3C2K A;  1V9P A;  3RJK A;  1U9L A;  3FM9 A;  2JR5 A;  3MGI A;  4K4I A;  5AKI A;  1MSW D;  2MRL A;  3RAQ A;  2BCU A;  5DB9 A;  4I2D A;  1ZYQ A;  4NLC A;  3SR6 A;  5DG8 A;  8ICO A;  3SEI A;  4FZL A;  1JI7 A;  2ES6 A;  5A0L A;  2PXI A;  2ZJ8 A;  5CWR A;  4PL1 A;  3B0X A;  2BDU A;  3UXN A;  5DQI A;  4RQ7 A;  4RUC A;  2AHO B;  3C1Y A;  5KFV A;  5KFU A;  1NK0 A;  4PZO A;  1IIP A;  3V7J A;  1K5O A;  4YR3 A;  2W9A A;  5GTI U;  2UVW A;  1LV5 A;  3FYH A;  4NM2 A;  9ICE A;  1NK9 A;  3KHR A;  4KLD A;  5BPC A;  4DWI A;  2HW3 A;  2QB0 A;  2QKQ A;  2I5H A;  5KFL A;  2R8H A;  5L1L A;  4QWC A;  5JU5 A;  5D4B A;  4P0P B;  3BS7 A;  2AJQ A;  3RRH A;  5ALX A;  1Z19 A;  2A1J A;  4CCH A;  1QSY A;  5J0U A;  5IIN A;  3QU7 A;  4HAI A;  2KIV A;  3ZI4 A;  5JRT A;  5KG2 A;  2A1A A;  4YXJ A;  1XSN A;  4Q8E A;  1S0N A;  1NK4 A;  3HT3 A;  3NVZ A;  4MFF A;  2D8C A;  2KVC A;  2W11 A;  5KFO A;  4XQ8 A;  3N97 B;  1LKY A;  1ZD2 P;  3L4P A;  5J0Q A;  4QIW F;  4C0Z A;  1UT5 A;  4BX9 C;  3RBD A;  5KFQ A;  1S5L U;  3E58 A;  5HR6 A;  5AK6 A;  5KT3 A;  2NRV A;  4FBU A;  9ICS A;  2K89 A;  2GH1 A;  3NVY A;  2ZIX A;  1K1Q A;  3C5G A;  3BZK A;  3PMN A;  3WKA A;  2V4Q A;  2XY5 A;  3PW2 A;  3OHA A;  5KT7 A;  2K4P A;  1N56 A;  1RQL A;  3EPG A;  2FMS A;  1QQ5 A;  4BWJ A;  1XNS A;  2XGP A;  4BUG A;  4OJ6 A;  3H8S A;  1RQN A;  2ZXI A;  2NV3 A;  5IIJ A;  1MQ2 A;  1H38 A;  4MF8 A;  3RJE A;  2E1F A;  4NWI A;  4ED8 A;  4Y2J A;  2KN7 A;  3KKA C;  3KHG A;  3RJF A;  5AM5 A;  4J9S A;  1ZQI A;  2KKP A;  3ZDA A;  1KFD A;  3IN5 A;  3F53 A;  3DDH A;  2WF8 A;  3PSF A;  4RQN A;  1ARO P;  2NRW A;  2JEI A;  4O3O A;  1SV0 A;  2QB1 A;  1F0M A;  5C0Y A;  2DKZ A;  2AGO A;  5KFN A;  2R8G A;  4EZ6 A;  3QU5 A;  5EE0 A;  2LYA A;  1T7P A;  4DQR A;  4QW9 A;  2NO4 A;  4ECU A;  5AKE A;  2W9M A;  2KNJ A;  4O0I A;  5ALE A;  4KN4 A;  4YG2 A;  4ZOH C;  2MUT A;  3PSP A;  2DF4 B;  7ICJ A;  1N63 A;  4XA5 A;  2OH2 A;  8ICY A;  4QJF B;  3AEV A;  3GIJ A;  2H3Z A;  2ZIU B;  1RXV A;  4C7Y A;  3QYP A;  4QWA A;  7ICK A;  3ORY A;  1F44 A;  5KAI U;  2Y1J A;  2H5X A;  2H3I A;  4ECQ A;  2KV2 A;  5KFB A;  3VCB A;  2NRZ A;  4E0D A;  5KFI A;  1ZQW A;  1ZJN A;  4F2R A;  4EEK A;  4K4G A;  1ZQG A;  5AKL A;  1WWU A;  1JXL A;  3M8R A;  4DFJ A;  1HUO A;  1SL1 A;  3FDS A;  1PK1 B;  3HRD D;  2IOF A;  5ALK A;  3H0L B;  3PY8 A;  8ICC A;  2EAN A;  4TUP A;  1RM6 C;  5DBC A;  4DQP A;  3WU2 U;  4O9M A;  2UVU A;  4RPZ A;  3NUQ A;  3PO4 A;  2J6S A;  5AM4 A;  5KFR A;  5AHX A;  2WB1 F;  1PVQ A;  4Y2T A;  1ZQV A;  3PX6 A;  2RQ5 A;  3RB6 A;  5L1I A;  4XUS A;  1QLN A;  3ALR A;  3QXG A;  2BGW A;  1DK3 A;  1JRO A;  4CF4 A;  5DG9 A;  2BQU A;  3MGV A;  2MU2 A;  5AKH A;  2FDR A;  2WF5 A;  3HJE A;  4J9K A;  3PO5 A;  2MAX A;  1MA7 A;  4DL3 A;  2P6R A;  3H8W A;  2C2D A;  2HHV A;  1PK3 A;  3PNC A;  8ICA A;  2M0N A;  4FO6 A;  1TK5 A;  4KLO A;  2R8I A;  4ECZ A;  4U7C A;  1S0M A;  4KLE A;  1N48 A;  4LVS A;  3WK4 A;  1ZET A;  4DOB A;  2Y0S C;  1D9D A;  2K4E A;  1C7Y A;  1SZP A;  1ZQC A;  3SAF A;  5ALZ A;  3SAH A;  4JV0 A;  3TAR A;  3D2Q A;  3AUO A;  1SGG A;  3CYM A;  2YN4 A;  1Q3V A;  4B9L A;  2B6G A;  4UB2 A;  2FE9 A;  5J2F A;  4TQS A;  4NLK A;  4DS4 A;  3T79 A;  1WCL A;  5AI0 A;  3IHQ B;  2ZTE A;  3H7I A;  2KMD A;  2LKY A;  9ICN A;  1FFV A;  5KG5 A;  3H4D A;  4PGX A;  3QUB A;  2JGA A;  3PST A;  1N60 A;  2JRZ A;  3RB4 A;  4NLZ A;  4DFD A;  5HNK A;  3GIL A;  5F9L A;  4ICA A;  5L9X A;  1AQ6 A;  2M9N A;  1V97 A;  4K4H A;  4M47 A;  2XVT A;  3BJY A;  4P2H A;  1SXE A;  2F77 X;  8ICU A;  1ZQQ A;  2ZIW B;  4GXI A;  4ELV A;  2AU0 A;  2BZF A;  5JTI A;  2ZJ5 A;  4RQM A;  1QCK A;  3EYZ A;  2AGQ A;  4OD0 A;  1ZQR A;  3RAX A;  2XY7 A;  3RF9 A;  2C28 A;  3R9K A;  1RDF A;  2KTQ A;  1JXE A;  1CUK A;  3O0F A;  3WK7 A;  4R8U B;  3C5F A;  1YZ6 A;  2F1I A;  2EQY A;  3FAH A;  2PI4 A;  1SKS A;  5CP2 A;  1PVP A;  1SKW A;  4JV1 A;  5J29 A;  1T3N A;  1BPX A;  3ETR A;  4MFC A;  3ED5 A;  4OO1 J;  3NVW A;  3EPI A;  1SXD A;  4IR9 A;  2WAQ C;  1S8O A;  1BPE A;  5IIO A;  2G08 A;  3QZ8 A;  4JWN A;  1NK5 A;  5CJ7 A;  1CRX A;  3DV9 A;  1SL0 A;  3GU3 A;  4F72 A;  1UA1 A;  5J8Y C;  2VA8 A;  2BCQ A;  4DQS A;  8ICK A;  4JWM A;  5J0Y A;  1V85 A;  5K4L A;  3LVW A;  4CRX A;  2W7P A;  2DGZ A;  2BPC A;  1N5W A;  4UQG A;  4Y2V A;  1ZOL A;  4MEY A;  1XSP A;  4YR0 A;  3JPR A;  4TUS A;  2ZJA A;  3UXO A;  3NGD A;  2KFN A;  5KT4 A;  2JV3 A;  1QSS A;  5DQG A;  4LZD A;  3RH6 A;  5KFW A;  3RR8 A;  4B9U A;  2YTU A;  2YB4 A;  4F2S A;  9ICO A;  4YVZ A;  1S77 D;  2DKX A;  2BCV A;  5J2D A;  1C20 A;  1RYR A;  2OYY A;  4IQT A;  8ICQ A;  4C7Z A;  2HI0 A;  3HP6 A;  2KE7 A;  3IG5 A;  5KFP A;  2XO7 A;  2QB0 B;  2FPM A;  5HMM A;  4IRD A;  3KD3 A;  4KIT B;  3QEA Z;  2KIC A;  5DB7 A;  3G6X A;  1NI3 A;  3F2B A;  4YXM A;  5TZV A;  3NVV A;  3IP4 B;  3KZI U;  2A1J B;  4QNL A;  3QUC A;  9ICG A;  3PVX A;  2V4R A;  1UCV A;  2KZZ A;  4DL4 A;  1DGJ A;  1V38 A;  3RRG A;  5AK4 A;  3WK8 A;  5DGA A;  4UB3 A;  4OJL A;  3CW2 C;  5L1J A;  4LZG A;  1LKY B;  4FE3 A;  1JN3 A;  4YD2 A;  4GXK A;  3T3F A;  2IHM A;  4M9N A;  2I1Q A;  3LWM A;  2AQ4 A;  3ZDD A;  2KOB A;  4RQ8 A;  5HP4 A;  1ZRN A;  4DQI A;  3GV5 B;  2ZIX B;  5J2H A;  5KG1 A;  3C2L A;  1RYS A;  2W54 A;  2LI6 A;  3GV7 B;  1BGX T;  1ZQY A;  1HJP A;  3AN1 A;  5JUM A;  5B5E U;  2ZXH A;  9ICP A;  4NL9 C;  2PFO A;  1B43 A;  9ICM A;  2W8K A;  4ED6 A;  1D8Y A;  4DL7 A;  3TAC B;  1ZQF A;  3BQ2 A;  4KLF A;  2W43 A;  1WCN A;  5KFZ A;  3LWL A;  5CEH A;  1J2N A;  2Q4T A;  3NTU A;  4B6J A;  3N28 A;  3KZX A;  1HIW A;  5AM1 A;  4US9 A;  4EEY A;  1SV4 A;  4JV2 A;  2KJ8 A;  1ZRM A;  3I76 A;  3WKE A;  3PSI A;  4BGD A;  2BR0 A;  3PW5 A;  2OCE A;  3QNM A;  1EXN A;  1ZQD A;  2F8L A;  1X9M A;  4ECT A;  4DFP A;  4US8 A;  2R8J A;  3H0M B;  2FLN A;  1KW4 A;  4DSK A;  2VAN A;  8ICR A;  2GO7 A;  3RR7 A;  5BOM A;  5AK3 A;  2OM6 A;  2G5I B;  4NV0 A;  1UPH A;  3SMV A;  2YY6 A;  1JAL A;  4EZ9 A;  2MUT B;  2BHN A;  2CPR A;  4UAT A;  2XY6 A;  5KT6 A;  4EBC A;  2BCS A;  1FIQ A;  1WWV A;  1N61 A;  4I29 A;  4DS5 A;  3AQF A;  1IV8 A;  3TQ1 A;  2H3F A;  3ZDE A;  3MFI A;  2K8C B;  1N62 A;  5KFM A;  3DEE A;  3RJI A;  3JPN A;  2HOI A;  4RQ5 A;  3GFK B;  4C8N A;  4J9L A;  4NLG A;  3PX0 A;  1B0X A;  3HX0 A;  3C23 A;  9ICR A;  2ESE A;  4KX5 A;  4UAZ A;  2FMQ A;  5AKG A;  3Q8P B;  3BQ0 A;  1OUQ A;  2HVI A;  2UVR A;  2JHD A;  3N7P D;  5J0O A;  1PVR A;  2E8N A;  4YD1 A;  4P0Q A;  4KLG A;  9ICH A;  2CXY A;  1UQV A;  4I2B A;  5TIS U;  2WF6 A;  1A77 A;  4CE6 A;  5IIL A;  1L3V A;  5ALN A;  4J9O A;  3A0B U;  2HHX A;  3H8M A;  2HSZ A;  1L5U A;  3PR5 B;  1Q46 A;  2ATL A;  4I2C A;  5J0T A;  2W3S A;  7ICS A;  4EX7 A;  9ICX A;  5ALI A;  4F4X A;  4C4S A;  1ZQL A;  3KFU F;  2FJ6 A;  2QAR A;  1UA0 A;  9ICJ A;  4QZD A;  5EWG A;  2KHV A;  4EBE A;  1COO A;  1TAU A;  2ISP A;  3QUT A;  3ZDB A;  4ECV A;  4I2H A;  4ECX A;  2C2R A;  4KLU A;  2ZUD A;  2F3N A;  5AKJ A;  3Q8L A;  2XI9 A;  5KFC A;  5J0P A;  2W55 A;  2ZG6 A;  4QZG A;  8ICG A;  3RJH A;  2A3V A;  2EZZ A;  4ZH4 A;  4PPX A;  4NY8 A;  3C2M A;  4R66 A;  2HHW A;  2W7O A;  2HOF A;  5EE9 A;  2ZUC A;  3SZ2 A;  2K8B B;  5KFF A;  4CGZ A;  5DDM A;  2W9C A;  2KSO A;  1BNO A;  1TFR A;  1URJ A;  4PHD A;  1ZQJ A;  2DWQ A;  8ICW A;  5KFD A;  2H3Q A;  4O5C A;  7ICE A;  2DFL A;  2K8A A;  1NJY A;  2G09 A;  2KP7 A;  4MHV A;  2PFQ A;  3IRU A;  4OJ5 A;  7ICN A;  9ICF A;  5EWE A;  1ZQA A;  3TAD A;  2EZX A;  2L5Y A;  2O6K A;  2BPF A;  5ALL A;  3M6K A;  2HHQ A;  8ICM A;  3BQT A;  2K4H A;  1JX4 A;  1S76 D;  5KG4 A;  5AIB A;  4QIW C;  3SQI A;  1XSL A;  4B9N A;  4B9M A;  5HR7 A;  5ALW A;  1ZQB A;  3PW7 A;  1UHU A;  3D2N A;  3TI0 A;  2KZM A;  4YQW A;  4UB5 A;  1LVH A;  2GWS A;  2JEG A;  1ZQT A;  3RJG A;  1P7D A;  8ICN A;  2PMZ C;  2ZTD A;  4BJQ A;  2Y9T A;  4IRK A;  2R8K A;  4DL5 A;  4I2J A;  2ZIV A;  3BDP A;  5ALT A;  2W8L A;  7ICR A;  4M9G A;  4TUQ A;  5DGB A;  9ICK A;  1U48 A;  4PH5 A;  3SI8 A;  2HMX A;  3V7K A;  2YMP A;  4UB1 A;  4R63 A;  4G9B A;  3Q8R B;  4KMU A;  1HEK A;  1ZXI A;  5AIA A;  1BPZ A;  2ALZ A;  3QX7 A;  3MR5 A;  2YMM A;  3RB3 A;  3C1Z A;  4AYB C;  1ZQX A;  1VLB A;  3QU4 A;  3WKB A;  2LMR A;  4I2A A;  2AH5 A;  7ICG A;  4M6W A;  4OJO A;  1TAM A;  4QWB A;  2J6T A;  3V6J A;  7ICH A;  4GC6 A;  2MSN A;  3CP8 A;  4F93 B;  2OEH A;  5H2F U;  1O03 A;  2HCF A;  3GIK A;  3BZC A;  2D3D A;  4PHE A;  1DXS A;  1L3T A;  5KFK A;  4C80 A;  2F44 A;  4ELT A;  8ICS A;  4GIB A;  5J2J A;  4QZH A;  1S10 A;  1SV0 C;  3IM1 A;  1KFT A;  4F4Z A;  2HBL A;  1NJW A;  2AGP A;  5HHI A;  4F4Y A;  2D6F C;  4DL6 A;  3L5K A;  3HIL A;  1XO0 A;  4RQ2 A;  4UB4 A;  2WHE A;  4C8L A;  2GOL A;  5BOL A;  3K75 D;  1VJ5 A;  5ALU A;  4DF8 A;  3OHB A;  5AIC A;  9ICC A;  2E8O A;  5G5G A;  2WAQ F;  1S9F A;  3Q8M A;  3ZD9 A;  3LVV A;  1ZQ1 C;  2FMP A;  2JXJ A;  3MGH A;  2C22 A;  3MDA A;  1L8L A;  5ALO A;  4ED7 A;  1N5X A;  1NKB A;  1L7N A;  2BKE A;  2LPE A;  4UAU A;  5DBA A;  3PZP A;  1NOM A;  2IHN A;  1ZQU A;  1JRP A;  1XU4 A;  2AXT U;  2ZUB A;  5KNI A;  2FI1 A;  1YZ7 A;  2HHU A;  1LB2 B;  1ZQP A;  4F91 B;  4F5N A;  4F4W A;  3LYS A;  1SIJ A;  3UM9 A;  5D49 A;  3NAS A;  5IIM A;  2WB1 C;  2XIC A;  3I28 A;  2BDP A;  5KG0 A;  4O3S A;  2KJ9 A;  3SV3 A;  3Q8S B;  4BXO A;  4KTQ A;  4CF3 A;  4PHP A;  4QZC A;  2UVV A;  5F9N A;  4FS2 A;  1MN8 A;  1SZH A;  4F5P A;  4M04 A;  3V6H A;  5AI4 A;  9ICQ A;  5KFA A;  8ICE A;  3QE9 Y;  3TFR A;  2HHT A;  1X42 A;  5III A;  4Z6D A;  5EE3 A;  1SWW A;  4QZI A;  4EEN A;  4ELU A;  3UMB A;  4G3I A;  1SL2 A;  2PI5 A;  1DRG A;  4Q45 A;  2IA6 A;  5DKW A;  2KD1 A;  3M9N B;  5KFE A;  4QWE A;  3I1Y A;  2E5S A;  4OCZ A;  4PJ0 U;  1Q3U A;  4O3Q A;  2DQN B;  1KEJ A;  1TK8 A;  3JPQ A;  1JIH A;  2MA1 A;  5G5H A;  2HBJ A;  1Z1B A;  2CN1 A;  7ICL A;  1X6J A;  3LK9 A;  3JPT A;  3CRX A;  2G06 A;  1TVA A;  2W9B A;  5J0S A;  2Y1I A;  2KHQ A;  4P4P A;  1ZQO A;  4QZ9 A;  1RG6 A;  1XC9 A;  1IG6 A;  7ICT A;  2WTF A;  4KLL A;  4J9M A;  4GFJ A;  3T5J A;  5KT5 A;  1QQ7 A;  4IQU A;  1M6Y A;  3V72 A;  4KLM A;  4F71 A;  2LM4 A;  9ICB A;  3M7D A;  2LHT A;  3AU6 A;  4PZN A;  4EBD A;  2YB1 A;  4IS7 A;  2ASJ A;  4BDP A;  3JPS A;  2NRX A;  4UBB A;  3ZDC A;  1ZD4 A;  3F2C A;  2KK0 A;  4I2G A;  4KLI A;  4PGQ A;  3PW4 A;  1GO3 F;  2WF9 A;  4UW9 A;  4X5V A;  4Z6C A;  4TUR A;  4KX3 A;  4I2I A;  4F3O A;  1WG8 A;  3Q8Q B;  3V6K A;  4J9Q A;  4P0Q B;  1U4B A;  1XO1 A;  5ALR A;  4IRC A;  1L7M A;  3E0F A;  9ICT A;  2DUY A;  2LBO A;  1KN5 A;  5AI6 A;  3OGU A;  5AK5 A;  4M9J A;  4RQ0 A;  4YP3 A;  1BPY A;  2QAR B;  5KG7 A;  1D8L A;  2F2A B;  4J9R A;  3RH5 A;  2OXO A;  1ZQH A;  1DK2 A;  4DF4 A;  2I9G A;  2W04 A;  3ZD8 A;  1KBU A;  2VIX A;  5J2G A;  3WK5 A;  1WUD A;  5J2E A;  4DSL A;  5T14 A;  2XID A;  4JMU A;  8ICX A;  1KLN A;  4F92 B;  4O5E A;  4P4O A;  5KFT A;  3GV8 B;  4IQV A;  1T94 A;  1Z4O A;  2KIW A;  1DGS A;  4PHA A;  4IC9 A;  2E8P A;  4Y2Y A;  4Y2U A;  1Z4N A;  7ICI A;  2W9C B;  2KSO B;  5DB6 A;  3BQ7 A;  3OJS A;  2KZ3 A;  2B21 A;  2I6X A;  4I27 A;  2NO5 A;  4KMO B;  4MEX A;  1QH9 A;  1T3Q A;  8ICP A;  2AQ0 A;  4RNO A;  1XWL A;  5DLG A;  4RZR A;  2HBK A;  2P6U A;  4KN7 A;  3WKC A;  3G6Y A;  4Y2S A;  3M9M B;  3RB0 A;  3C21 A;  3T5H A;  2G07 A;  3RTV A;  4B9V A;  2XCP A;  5KFJ A;  2DL0 A;  1NJZ A;  4EYI B;  4NJ8 A;  1A0P A;  1ECW A;  1KQQ A;  3OPX A;  2W03 A;  1SWV A;  2FPL A;  2A19 A;  3IG8 A;  1QTM A;  4YMM A;  4Q44 A;  3GQC A;  4ED3 A;  2WFA A;  3WK9 A;  4F5Q A;  5IIK A;  4R64 A;  4QZF A;  1ZQM A;  3U26 A;  1KKX A;  3KKA A;  4QWD A;  8ICB A;  2HDO A;  1N2X A;  1X9W A;  4XRH A;  4RT2 A;  2KEY A;  3SYZ A;  4BWM A;  2EH9 A;  2XGQ A;  3BS5 A;  2GLE A;  2VA2 A;  4UAW A;  1BNP A;  1J2M A;  3WKD A;  5F3X B;  5E79 U;  3M8S A;  2ZIV B;  2YX8 A;  2EAP A;  2HOQ A;  3EUB 2;  1A6S A;  1RPL A;  3SD7 A;  2RRD A;  1ZQE A;  2W3R A;  2B0C A;  2NYV A;  1Z3E B;  1L3S A;  4J03 A;  4JK1 A;  4QZA A;  3HKZ C;  4AP9 A;  4C4R A;  5J0W A;  1NK6 A;  2ASD A;  4C8M A;  5CHG A;  1ZJM A;  2VA3 A;  5ALJ A;  3B0Y A;  4MFA A;  2K60 A;  4PL2 A;  2G0A A;  3ICX A;  1UT8 A;  4M6W B;  5KFG A;  3NRZ A;  1WYG A;  1NK8 A;  1FFU A;  3RJJ A;  4NLB A;  1QQ6 A;  4DFM A;  1Z00 A;  4OJP A;  4GLX A;  3H40 A;  3QU9 A;  3K4G A;  2KG5 A;  4F8R A;  2JH7 A;  2RDI A;  2PMZ F;  4DLG A;  4NLN A;  1NJX A;  5ALM A;  3N7R C;  4ED0 A;  3KHH A;  4Y2P A;  3BQ1 A;  4I2E A;  4C8K A;  4C4T A;  1HUZ A;  2F8K A;  4USA A;  4ACO A;  3IV6 A;  5ALY A;  2RLT A;  1PUZ A;  3JPP A;  1L7O A;  3QEB Z;  3PV8 A;  3M6Z A;  5J2A A;  4O5K A;  2RDJ A;  7ICV A;  4DSI A;  5EWF A;  2FLP A;  3ISD A;  4RNN A;  7ICM A;  1L7P A;  3MAB A;  7ICU A;  4QW8 A;  4O3N A;  2VJ4 A;  5DQH A;  4Q8F A;  1X66 A;  4AYB F;  1RZT A; 
#chains in the Genus database with same CATH homology
 2JV3 A;  2QAR B;  2K4P A;  1SV4 A;  1WWU A;  2EAP A;  3SEI A;  2YTU A;  2EAO A;  1JI7 A;  2E8O A;  3SEN A;  3H8M A;  2ES6 A;  2DKX A;  1SXE A;  1PK1 B;  5JTI A;  2KE7 A;  2Y9T A;  2EAN A;  1X9X A;  2E8M A;  2QB0 B;  2QAR A;  4RQM A;  3KKA C;  3TAD C;  2E8P A;  4PZO A;  1RG6 A;  2K60 A;  3K1R B;  1KW4 A;  1OXJ A;  5J8Y A;  2KSO B;  3BQ7 A;  2LPE A;  1PK1 A;  2F3N A;  4RQN A;  5F3X B;  1UCV A;  2QB0 A;  2QKQ A;  5KNI A;  4NL9 A;  1SV0 A;  5JU5 A;  1X40 A;  1V38 A;  1F0M A;  2QB1 A;  2DKZ A;  1COK A;  2EAM A;  2Y9U A;  4PZN A;  4IS7 A;  3BS7 A;  5L1M A;  1PK3 A;  2KSO A;  1LKY B;  2LMR A;  2KG5 A;  2DL0 A;  1WWV A;  1SXD A;  2KIV A;  4NJ8 A;  5JRT A;  3BS5 B;  2D8C A;  1SGG A;  2F8K A;  4MHV A;  1OW5 A;  1LKY A;  2B6G A;  2FE9 A;  5J8Y C;  1Z1V A;  2D3D A;  3KKA A;  1DXS A;  1B4F A;  1B0X A;  3TAD A;  2L5Y A;  2F44 A;  2ESE A;  2KMD A;  1V85 A;  4NL9 C;  1SV0 C;  3BS5 A;  2GLE A;  2E8N A;  3TAC B;  1UQV A;  1X66 A;  3IDW A;  3HIL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...