2MA1A

Solution structure of hrdc1 domain of recq helicase from deinococcus radiodurans
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
75
structure length
75
Chain Sequence
b'HDAPLFEALRAWRLQKAKELSLPPYTIFHDATLKTIAELRPGSHATLGTVSGVGGRKLAAYGDEVLQVVRDSSGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA helicase RecQ
publication title NMR structure of the N-terminal-most HRDC1 domain of RecQ helicase from Deinococcus radiodurans
rcsb
source organism Deinococcus radiodurans
molecule tags Dna binding protein
total genus 20
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2013-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00570 HRDC HRDC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.80 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2ma1A00
2CPRA 2HBMA 4QIWF 1WUDA 1GO3F 3SAHA 2RHFA 2HBJA 4QJFB 1YT3A 2MA1A 4NLBA 2E1FA 4NLCA 2HBKA 1D8BA 4OO1J 2E1EA 4CDGA 2RRDA 2DGZA 2KV2A 3CYMA 5C0YA 3SAGA 4CGZA 2HBLA 3SAFA 4O3MA
chains in the Genus database with same CATH superfamily
2VKQA 5KFPA 2HBMA 1ZD5A 1FEZA 4IL6U 5ALVA 1CRXA 4BXOA 5EWEA 4TUSA 2E8MA 4FS2A 5AK3A 1UQVA 3LYSA 4EEKA 4GXKA 2ZIWA 3KZXA 2W54A 2D8CA 2WF6A 1D8LA 4JWNA 5KT7A 4F2SA 1ZQYA 4ED7A 1NK0A 5BOLA 1C20A 5AM2A 1ZD2P 4ELUA 1KL9A 1HEKA 1L7PA 4Q45A 4DF4A 1JIHA 5AM3A 2JH7A 3PSPA 1ZETA 2BCSA 1XSNA 4P0QA 4RPYA 1MQ3A 1ZQIA 3Q8MA 2YTUA 3D2NA 5J2CA 3TANA 3SR6A 3IN5A 5L1JA 1JRPA 1SL0A 4LJXA 2NRZA 3MC1A 4CE6A 4K4IA 5KT2A 3ZDCA 4MEXA 3Q8KA 2QB1A 3D2SA 4KX3A 3M1YA 5EE9A 1Q8KA 1WG8A 5AKIA 5J0SA 1DOQA 5AKGA 1TKDA 5KFJA 4JMUA 5KFBA 2ASDA 5CA7A 2J6UA 1RYRA 1KBUA 4EYHB 2KMDA 5BPCA 4F50A 1U9LA 2Z7JA 2RQ5A 4O3SA 2PFOA 3HPOA 3KD3A 4RPXA 7ICMA 2JEGA 5KFFA 4FE3A 4Q8EA 4RQ4A 2PI5A 3SV3A 1OW5A 4Q43A 4WJ3B 1Z4OA 4C8OA 2KICA 4Z6CA 1ZQKA 4JV2A 4RQ3A 4J9RA 3B0XA 3JPOA 1JROA 1AQ6A 1S0NA 1ZD4A 3M9MB 2FLLA 1FFVA 1BVSA 2ZIXB 5KT5A 1XSLA 3GV7B 3TI0A 5AHXA 5ALSA 1SV4A 5EE1A 8ICXA 1M6YA 4KLJA 4ICAA 3T5HA 1TK0A 2AXTU 1UT5A 1L3VA 4TQSA 1HUZA 4F4XA 3UQ2A 5HMMA 5AKHA 2KKPA 3M7DA 5KT6A 3NUQA 1T3QA 4BDPA 2XI9A 2JZBB 3RR7A 1WWUA 3C29A 4O3MA 1V38A 1PK1B 2DQNB 4F91B 4P4PA 3O0FA 4GXJA 4XRHA 2NRVA 2BCRA 2AQ4A 4KLLA 4XQ8A 4DLEA 3OJUA 4Z6DA 2G07A 5AICA 2IA6A 4PGQA 2A19A 1DRGA 4K4HA 5T14A 3WK4A 4PL1A 1U4BA 2WTFA 4ELVA 9ICCA 5AM4A 4I28A 2C2EA 5ALNA 4M47A 4M9LA 4QWAA 1ZQ1C 3CRXA 4P0PB 5AKKA 2ZUBA 4EBEA 4M0AA 4I2JA 1BPEA 1T3NA 3DEEA 2IMWP 3HWTA 2JR5A 2M0NA 9ICVA 2YB1A 2WF5A 3BQTA 4I2GA 4F4KA 5J2KA 4J9KA 2W43A 3CP8A 3TADA 3C5FA 2LYHA 1BNOA 3AM9A 2KOBA 4J9PA 3BJYA 3WKCA 1NK4A 4AYBF 3HJEA 2HDOA 4JWMA 3TQ1A 1QQ5A 5HR6A 2Y0SF 5DG7A 1FO4A 2HHQA 2FPKA 2KSOA 5DQGA 4PGXA 2F76X 2ASLA 3ED5A 5ALTA 4EELA 3GILA 2HHWA 4FZMA 1J2NA 2W9CA 1BPXA 1ZJMA 5AM0A 3K4GA 2BR0A 4DFMA 4UB8U 4YP3A 2GWSA 2FDRA 4QWDA 4CF4A 3E0FA 2QLTA 2WAQC 4R66A 1URJA 3QNMA 2G06A 3A0HU 5KL8B 3ZDDA 4RQ5A 3C5GA 3GV8B 5KG3A 1SKSA 3V6KA 4BX9C 4F4ZA 4CRXA 2ZXIA 3K75D 2VA3A 3PZPA 1PVPA 5AI9A 3WK7A 2JEIA 2MA1A 7ICKA 3OHBA 1HIWA 5KAIU 9ICOA 1ZQMA 3MDCA 4OD0A 1RXWA 3RJEA 1ZQFA 3IM1A 2HOFA 1DK2A 4EZ6A 2W3SA 3QZ8A 1ZOLA 2K8CB 1SL1A 4Y2UA 3TARA 2DWQA 7ICHA 4MHVA 2QARB 5H2FU 4IS7A 2F1HA 3TFRA 4Y2SA 3FAHA 2ASJA 4DSKA 1O03A 3QU2A 2KP7A 2AJQA 4DOAA 4BWMA 1DGSA 1X6JA 4G9BA 3HT3A 2K4IA 1IV8A 2XVTA 4I2FA 4BJQA 3G6VA 2YMQA 4FBTA 1SWVA 4O9MA 3UXNA 3TADC 2WB1F 1ZQBA 5HNKA 3PMNA 4RQ6A 3SV4A 4NLCA 4OO1J 1KFSA 5DB8A 1IM4A 3LK9A 3KZIU 4NL9A 9ICWA 2R8JA 1EXNA 4K4GA 5IIKA 4YMOA 3L4PA 4RQ7A 8ICTA 5HR7A 4NLZA 2G08A 4FFDA 4YR2A 4NV0A 1RYSA 3M8RA 3VCBA 1U47A 2EZZA 1QSSA 5EE3A 3BQ2A 3PSIA 3MR5A 2FLPA 7ICUA 3H8JA 4UATA 2R8KA 4ED0A 2BPGA 1TAUA 2EQYA 9ICAA 3FDSA 5ALJA 5KFSA 5KFUA 3CNHA 5AKJA 2Y9UA 2JMGA 2E1EA 4Z6EA 4NLGA 3UMCA 2HSZA 5E79U 4TURA 4PHDA 2F77X 2JV3A 4IQVA 4UAZA 4DL7A 1JXLA 5KG7A 2ALZA 4PGYA 5AIAA 4UAUA 1ZRNA 5DQHA 3H0RB 1N5XA 2B0CA 2BCUA 4MFAA 2ZUDA 1NJXA 3BS5B 4KN4A 2AGQA 5JUMA 1ZQXA 4OJPA 4QZEA 4YD2A 7ICVA 3PR4A 1XC9A 3JPNA 4DQSA 1JI7A 5KFWA 5IIMA 2EZYA 3HILA 4NL9C 2KE7A 5L1KA 3N7PD 2ZUCA 2Y1IA 4C7ZA 4ED1A 2KEYA 4DQPA 5DGAA 2W9BB 2OCEA 7ICNA 3C28A 4Y2RA 5KFTA 3UQ0A 3AU2A 2G5HB 2BHNA 5ALLA 1RG6A 7ICJA 3RJHA 2OHFA 1L3SA 8ICWA 4F3OA 1L3UA 8ICUA 1SXDA 5GTHU 2F44A 1BNPA 3B0YA 3AN1A 4C4TA 3L3FX 5KFKA 5KFLA 4X5VA 4C8NA 4YR3A 2AH5A 1PVRA 1LKYB 1ZQVA 2BQUA 4DL4A 2K60A 4ED2A 1FFUA 3IP4B 5J0XA 5KFAA 1LV5A 3B9JA 2HHUA 1K5OA 2DKZA 2DFLA 7ICIA 1TE2A 3MABA 4JV1A 4NM2A 2YMPA 3SI8A 2CRXA 5CEHA 2ZIVB 3K1ZA 5HP4A 4ECZA 2JHDA 3EPGA 4HAIA 5KFMA 4IR1A 4KMOB 2LM1A 4RT2A 4M9NA 4J9QA 1A0PA 1ZQAA 3NGDA 4KLDA 4PJ0U 2JXJA 2ZJ5A 2RHFA 4R8UB 2JH1A 5DDYA 5ALUA 5IILA 2BQ3A 2FLNA 2QB0B 4I2CA 2DPIA 2BGWA 2AGPA 3CYMA 3RB4A 3ISBA 3ZD9A 1RYUA 1Z3EB 5D46A 4B9MA 2W8LA 3LVWA 2LI6A 3PW2A 5KFEA 3TAPA 2YX8A 3EZ5A 2VA2A 4YMNA 3FM9A 3QXGA 1ZQJA 2R8GA 4PHEA 2G5IB 3UPQA 3IDWA 3PMLA 4KLHA 5F9NA 3QU5A 4EX6A 4JK1A 4O3PA 2OH2A 5FP0A 1SKWA 5ALMA 5ALYA 1YT3A 5DB9A 5KFDA 5ALIA 4PH5A 3MGHA 4J9OA 4YVZA 1Z1BA 1U45A 7ICFA 4QIWC 2FMSA 8ICYA 2MUTB 3SAFA 4MEYA 3F2DA 1RDFA 2W04A 4MFCA 2E8PA 2KJ8A 1K1SA 3JPRA 4EBDA 1C7YA 3N4MB 1B0XA 2RLTA 4I2IA 7ICGA 2ZTDA 1N48A 1F0MA 4UB1A 9ICGA 4KLSA 5CRXA 1RXVA 1ZJNA 5ALRA 1TVAA 8ICBA 2HVIA 1Q3VA 1N56A 4M2YA 2MAXA 4E0DA 4C4SA 5BOMA 4F5PA 3RBEA 1RQLA 4QW9A 3N97B 1L3TA 2PMZC 1X9WA 3LWMA 1U49A 4J9LA 3SMVA 4RQ8A 1MQ2A 1JN3A 4Y2PA 1L8LA 2PKEA 2FJ6A 4KX5A 5AI6A 4M6WA 2P6RA 3T79A 4F5OA 7ICEA 3M6ZA 1LVHA 4DSJA 1N62A 1CI4A 3I76A 2HOIA 1PK3A 1XO1A 2WF9A 3RBDA 3UMGA 4KLTA 3I28A 3RB3A 4F2RA 4PHAA 5KG2A 3GIKA 2MRLA 3ONNA 1JALA 3NASA 3THVA 1SL2A 2KZ3A 2ZIUA 3MBYA 4DO9A 2C28A 2KVSA 4KN7A 1S76D 3GFKB 3MFHA 3NRZA 2KKVA 4Y2VA 9ICSA 2KD1A 3MR2A 2NRTA 1Z00A 2OWOA 3BDPA 4OJ5A 4DSLA 2L5YA 1VLBA 2K8BB 4P4OA 5B5EU 1UA0A 4CDGA 4I2AA 4F5QA 4ZH4A 1Z1VA 4F71A 4FBUA 3JPSA 5J0RA 2ES6A 3SENA 4RQMA 4MF2A 4Y2YA 4RQ1A 3PX4A 4IRDA 2BCVA 9ICFA 7ICOA 4UB4A 4RQ2A 3BQ7A 2FMQA 2AU0A 3K1RB 1SZHA 8ICLA 1QSLA 2W9AA 3C23A 2RRDA 1BPBA 2JEFA 5KFNA 5KFGA 4YXMA 4UB2A 4NWIA 3AQFA 3G6YA 3MDAA 5J0UA 4RQ0A 3ISDA 1ED1A 2I5HA 7ICPA 4GC7A 2IHNA 3NVVA 4DQQA 2IHMA 2WF7A 2E5SA 2XO7A 3ISCA 2LM4A 4O3RA 8ICEA 1ZQNA 2LMRA 2YMMA 3AQEA 2ESEA 2BDUA 3F5AA 1X9MA 4ECUA 1VDVA 3F2BA 1ZQDA 4XA5A 4F72A 5D4BA 3KHHA 5ALXA 4C7YA 3DV9A 1J2MA 1J97A 4DS4A 3FC4A 5ALQA 4DFDA 3QUCA 2GLEA 5AI0A 5AM1A 5TZVA 4B6JA 2A1JA 3RJGA 2LPEA 4J9MA 2E8OA 2LYBA 3RJIA 4EYIB 1Q46A 3UXPA 3T5KA 9ICXA 4QNLA 2R8HA 3WK9A 4M9GA 5CJ7A 5D49A 3RRHA 5AKEA 1P7DA 2HBKA 3WK8A 1D8BA 4BXOB 4UBCA 1NJYA 2KG5A 4B9UA 2KFZA 1QH9A 3EWAA 1NJWA 2F1IA 4RZRA 4B9VA 3AU6A 1ZYQA 4KLEA 3E2EA 2ZIWB 4FO6A 3CW2C 1KLNA 2UVUA 4DL3A 2NV3A 3BQ0A 2I9GA 5J0TA 5J0YA 1ZQWA 2R18A 4B9LA 8ICVA 2I1QA 2KVCA 4EEYA 2BPFA 2PFPA 2XC9A 1S0MA 3WKEA 2BQRA 2G09A 2F8LA 5J2FA 4P0QB 5KFIA 4KITB 4UAVA 2H3IA 2YB4A 3QE9Y 3NTUA 5IIJA 3AMZA 4GFJA 4MFFA 4Y2XA 5EWFA 1D9DA 3MFIA 3GIIA 1NOMA 2RDIA 1WYGA 3QU9A 2R8IA 2EZXA 5KG4A 1B22A 1NNLA 2GH1A 3QUQA 2H5XA 2ISPA 5F3XB 1KN5A 2V4RA 3PW0A 2F3NA 4R65A 1S0VA 3AUOA 2UVVA 4KLGA 1L8OA 1KDHA 5KFVA 1VJ5A 4RNOA 3IG8A 5AI8A 2E1FA 1S5LU 4DOCA 2QKQA 5J0QA 3H4BA 3V6HA 1RPLA 2HHXA 2P35A 5IINA 2EAOA 1Z4NA 1OUQA 1X2IA 1Z19A 1S77D 1COOA 5KTQA 8ICHA 2G0AA 2ODGA 3RB0A 5ALDA 3IHQB 7ICRA 4Q8FA 1KKXA 3LDAA 1UHUA 1NKBA 4M04A 5CHGA 2K89A 4UBBA 2I6XA 4AP9A 1SB3C 3JPPA 3HW8A 3H8WA 5KT4A 3RH6A 1SWWA 3L5KA 3HKZC 2E8NA 3KTQA 2ZIUB 5DQIA 3NVZA 1L7OA 2EANA 5AKYA 5KAFU 1DK3A 2KTQA 4NM1A 2C2DA 4B9TA 5DBBA 2ZJ8A 3QEAZ 5KT3A 2KZZA 1QLNA 2DKXA 1NKCA 1KRPA 1SKRA 3PSFA 2WAQF 2ZJAA 1QTMA 5CP2A 5HHHA 3QU7A 4Y2QA 5J0PA 9ICIA 4QWCA 5AK5A 2K4PA 3DDHA 4US8A 3V7LA 4I2DA 1L7MA 4IRKA 4CGZA 5ALHA 1V85A 4P2HA 1ZQUA 2VA8A 1SXEA 5KG6A 2O6KA 2DBYA 2GOLA 1A76A 3TAQA 9ICMA 3NRWA 4I2EA 2KNJA 4JV0A 4C8MA 2ISOA 1WWVA 4BGDA 3TKAA 1B4FA 5ALPA 2KIVA 9ICLA 2LBOA 1XWLA 5J8YA 3SD7A 4UAYA 1N2XA 2AQ0A 2ZIXA 4U7CA 3AEVA 4GXIA 5J2DA 4GIBA 3HP6A 1UA1A 3WKBA 4EBCA 1X66A 4B9SA 2V9WA 4NY8A 5AKLA 5ALEA 8ICFA 4PL2A 1SIJA 2EH9A 5J2BA 8ICOA 5G5GA 4BUGA 2W7PA 1ZQLA 5J2JA 4R63A 2BDPA 8ICPA 2P6UA 5KNIA 4RU9A 4DL5A 3F5EA 2NYVA 3MGIA 5AM5A 8ICZA 2JZBA 2Y1JA 4PPXA 3OHAA 2EAPA 2W55A 1TAQA 1PK1A 2KSOB 3TACB 4J9NA 3EYZA 5J0OA 3M8SA 2W9CB 1N61A 3QX7A 5DB7A 1MA7A 4M9HA 3RJKA 1ECWA 2K4HA 4QWBA 4DCCA 1OXJA 4C80A 1GO3F 1S0OA 4YCXA 4DSEA 2CXYA 2D3DA 4QZIA 4CNQA 9ICUA 3BS7A 4YN4A 1QCKA 1X40A 1K1QA 3BQ1A 4DS5A 1MSWD 9ICKA 3N7SC 7ICTA 4US9A 4RNNA 3KHGA 2AGOA 4P0PA 5F9LA 4UB5A 2RDJA 4IR9A 1ZQSA 8ICMA 2DF4B 8ICIA 2KHVA 2MU2A 2N1RA 4RQNA 2FE9A 2B6GA 5J8YC 3QZ7A 4HYKA 2OYYA 2KN7A 1ZQEA 2LKYA 3QUBA 2W03A 1JUDA 2BCQA 1IG6A 8ICCA 4UASA 2M9NA 4ED6A 3SEIA 2W7OA 1ZQHA 2DGZA 2LHTA 5J2IA 5J2GA 9ICTA 9ICHA 2KZMA 3F53A 1XU4A 3AL0B 2IOFK 8ICAA 3GU3A 3A0BU 2JGAA 1XSPA 2VANA 5KFZA 1RZTA 4USAA 2XCAA 2ZXHA 2GO7A 5L1LA 1PZNA 3C1YA 3C2MA 3H40A 5AKXA 5AI5A 2Y9TA 2ZG6A 2OXOA 2XICA 3SAGA 3GV5B 4ECVA 1HUOA 4C8KA 2HBLA 1UCVA 5DKWA 3T5LA 2NRXA 4OJ6A 2UVWA 3GZFA 4F4WA 4IQUA 4RUAA 4QZCA 3EW9A 2EAMA 4I2HA 9ICPA 9ICBA 2J6SA 4JUZA 4EX7A 4I29A 3M9OB 4O5KA 4QJFB 4OJLA 3RAXA 1KFTA 5ALFA 4DQRA 4QZ8A 3Q8SB 1HJPA 3WK6A 3PX0A 4KLIA 4UQGA 3IV6A 4DFJA 4RNMA 4RPZA 1ZQPA 2ZTEA 5ALZA 2KJ5A 4KLQA 5B66U 2KJ9A 3LVVA 9ICEA 1RQNA 5AK6A 4DSFA 3PV8A 3PO5A 5AI4A 1LB2B 3M6KA 2QARA 2HHTA 1S9FA 3RH5A 1S97A 4NXZA 1WUDA 1KTQA 4DF8A 3ETLA 3H4DA 3N7RC 2NRWA 3RF9A 3ICXA 5EWGA 3SQIA 1KQQA 1BPZA 3WKDA 4NLNA 5KFXA 4O3OA 1NZPA 5G5HA 4YD1A 3HX0A 4ECQA 3ZDAA 3F2CA 4IRCA 3KBBA 2WHEA 3Q8LA 2HMXA 4AYBC 1NK6A 1ZQCA 1IXRA 1NI3A 2Y0SC 4QZDA 2WF8A 1L5UA 2HHVA 7ICLA 4RT3A 3GDXA 3HRDD 1T94A 1UT8A 4Y2JA 1N63A 4ECYA 2CN1A 2K4EA 1L7NA 3LWLA 3OPXA 1SGGA 1V9PA 5J2AA 3N28A 3KHLA 3H8MA 1YZ6A 1UPHA 1BPYA 3EUB2 1ZD3A 4TQRA 4DL6A 3SZ2A 2XGPA 3NVYA 1TFRA 3C2LA 5L9XA 4KTQA 4ED3A 5DB6A 3C1ZA 1S8OA 3D2QA 2HVHA 1ZQTA 1T8EA 4QZHA 5C0YA 3RR8A 2J6TA 3IRUA 4QIWF 3KKAA 2XY7A 4KLMA 3QYPA 1MN8A 1X6IA 4UW9A 4PZOA 4ELTA 4MF8A 2OEHA 1A77A 7ICQA 4A8EA 1JXEA 2RP5A 8ICJA 3BS5A 1RM6C 1O08A 3V7JA 3H7IA 2WB1C 5AIBA 8ICSA 4O5CA 1AROP 2YQEA 3Q8PB 4ED8A 1D9FA 5HMLA 8ICNA 1L6NA 2B21A 4Z6FA 5DLFA 4QZFA 2PFNA 1XS9D 3PR5B 1NKEA 4DOBA 1NJZA 1ZXIA 3ETRA 4R64A 2E3TA 3JPTA 2KIWA 2W9BA 4YXJA 2OM6A 1SV0A 4FZLA 3H0MB 1X9XA 2PMZF 2XCPA 1CUKA 3VC8A 4ECXA 3RJJA 3QEBZ 1S10A 3OSNA 5ALWA 5KG5A 3MGVA 5KFOA 4F93B 5DG8A 2ZTCA 1F44A 3RRGA 3H8SA 4NJ8A 4NLKA 4FZNA 2W8KA 1TK8A 2UVRA 5HHIA 3Q8QB 3C2KA 3WU2U 1V97A 3ORYA 4CF5A 3RTVA 2JEJA 5L1MA 4KLOA 4QWEA 3OTQA 1ZQOA 4TUQA 1LKYA 3GQCA 2HOQA 4I2BA 5J2EA 2BZFA 2HBJA 4NLBA 4IQTA 9ICRA 2F8KA 5ALGA 4IC9A 4PHPA 5CWRA 3OJSA 5KFHA 1JMSA 3KKAC 2NO4A 3QUTA 4YMMA 5DLGA 2ZIVA 3S6JA 3MR3A 5KFCA 1ZQRA 2BPCA 4O3QA 1NK8A 3NS1A 8ICKA 4DFPA 3RAQA 4UB3A 3ZI4A 1FIQA 4YR0A 2XY5A 2NO5A 4O0IA 3I1YA 4R8UA 3RB6A 2HHSA 2PXIA 4YG2A 5ALOA 4KMUA 2DUYA 1U48A 9ICQA 1TAMA 2QB0A 5EE0A 5IIOA 3PO4A 4ECTA 3R9KA 5AK4A 3E58A 4C0ZA 1NK5A 3PNCA 5TISU 4C8LA 2F1JA 2W11A 4PZNA 4TUPA 1XO0A 3KHRA 1SV0C 4OCZA 1QSYA 4GC6A 1T7PA 3ALRA 5KL1B 2Q0ZX 4DQIA 4ACOA 4M9JA 1TV9A 5KG0A 4F4YA 2HW3A 1PUZA 3PVXA 2LYAA 4EZ9A 1BPDA 5JTIA 5CR0A 2KHQA 4M6WB 3UXOA 4KLFA 1WCNA 1Q3UA 5DBAA 9ICJA 3PW7A 2H3ZA 2IOFA 3BZCA 3IG5A 4ECWA 4P4MA 4B9NA 3UM9A 8ICRA 1Y88A 3T3FA 3PW4A 4DLGA 3J81j 1N60A 2XIDA 5JU5A 1KFDA 2A3VA 1ZRMA 2H3QA 5C5JA 4G3IA 4F5RA 3RH4A 2MUTA 1T4GA 2H3VA 2WFAA 1SZPA 3OSPA 5DBCA 1Z00B 3BZKA 1DXSA 4FS1A 4C4RA 5KFQA 3V6JA 2HCFA 5ALKA 1COKA 4QZBA 5DG9A 1F5SA 4LZGA 2AHOB 1DGJA 5J2HA 2K8AA 4J9SA 4LVSA 1H38A 4IQWA 2F2AB 1YZ7A 3GIJA 1IIPA 3PY8A 1QQ7A 2HI0A 8ICQA 1TK5A 4LZDA 4XUSA 2PI4A 2CPRA 4CCHA 4I27A 4CF3A 2P66A 4DL2A 3PX6A 1D8YA 3ZDBA 3RFAA 2VJ4A 5KFYA 5CB1A 3ZD8A 2Q4TA 4KLUA 4YFKA 2IOHA 2DL0A 3Q8RB 2EDUA 4F92B 2MSNA 4UARA 4F5NA 4YQWA 3RJFA 1CEZA 3MR6A 3SAHA 7ICSA 2YMLA 3NVWA 2JRZA 1X42A 3T5JA 2YN4A 1JX4A 1KSPA 3TFSA 2A1AA 2C22A 1NZBA 4ECSA 1A6SA 4Y2TA 5EOZA 4J03A 2A1JB 2BKEA 5J0WA 1XNSA 3V7KA 3C21A 2KFNA 3UMBA 2W3RA 3JPQA 5DDMA 3V72A 1MC8A 4UAWA 4QW8A 2VJ5A 3KOOA 4DWIA 4BWJA 5IIIA 5L1IA 1ZQGA 5AKZA 1NK7A 4OJOA 4ZOHC 5J29A 1KEJA 2XY6A 2IBKA 3OGUA 1ZQZA 2KK0A 3U26A 5K4LA 4UB6U 2VIXA 1ZQQA 4QZAA 3HKZF 1KW4A 3GIMA 1B43A 5GTIU 4O5EA 1PVQA 4DEZA 3FYHA 2XGQA 1WCLA 3G6XA 5KG1A 3KFUF 3QU4A 2FPMA 2H3FA 3SYZA 2V4QA 2ATLA 3H0LB 5KFRA 1QQ6A 3PW5A 2FPLA 8ICGA 5JRTA 4Q44A 4ECRA 4EENA 4DFKA 4DSIA 2C2RA 4JB3A 1NK9A 5A0LA 2KV2A 3M9NB 2PFQA 3EPIA 4RUCA 2W9MA 2FMPA 2DPJA 2FI1A 3D6JA 4GLXA 5DGBA 3PSTA 3ZDEA 3WK5A 3WKAA 1X9SA 1BGXT 1N5WA 4QZ9A 4F8RA 4QZGA 2D6FC 4U6PA 2YY6A 4O3NA 9ICNA
chains in the Genus database with same CATH topology
2G09A 1ECWA 2F8LA 2K4HA 2KICA 2M0NA 4KMOB 4NWIA 4BJQA 3AQFA 2VKQA 2YB1A 3PSFA 1NZBA 1Q3VA 2HBMA 1A0PA 1A6SA 2WAQF 4OJPA 1GO3F 2WB1F 1CRXA 2XIDA 2KJ5A 2A3VA 1XNSA 2H3IA 2YB4A 3CP8A 2H3QA 2RHFA 1ED1A 3VCBA 2HOQA 2ZIXB 4GFJA 2JH1A 3LYSA 2HBJA 2KJ9A 3LVVA 4NLBA 2PMZC 2KOBA 2H3VA 2E5SA 4NLCA 3D2QA 2ZIWA 3KZXA 4OO1J 2VJ5A 4IC9A 3SMVA 3M6KA 3CYMA 4ICAA 4AYBF 3N7PD 4CGZA 3N7SC 5C0YA 4KX5A 5HR6A 2GH1A 2KEYA 2Y0SF 3T79A 4P0PA 3AQEA 2GOLA 3LVWA 4OJOA 2BDUA 3F5AA 3M6ZA 4QIWF 1WUDA 3F2BA 2DF4B 2F76X 2ZIVA 3NRWA 1HEKA 2KHVA 2HOIA 5HR7A 2KNJA 2N1RA 4FZMA 2G08A 3C28A 2JH7A 2K8AA 3PSPA 3N7RC 4NV0A 3RF9A 2KKPA 2VIXA 3M7DA 2OYYA 4A8EA 3IG8A 2LBOA 2G5HB 2LKYA 2YX8A 2F2AB 2E1FA 2RP5A 3HKZF 1IIPA 2W03A 3ICXA 3NUQA 4P0QA 3SQIA 3E0FA 2G5IB 1PVQA 2WAQC 2MRLA 3D2NA 2W7OA 2DGZA 1URJA 3ONNA 2LHTA 2WB1C 2XI9A 3IN5A 2G06A 2ZIUA 3PSIA 3C29A 4O3MA 2LYBA 2ZIXA 3F53A 5KL8B 4U7CA 2CPRA 3AL0B 2DQNB 3KFUF 1OUQA 2H3FA 3F2CA 3GU3A 2JGAA 1Z19A 1TAMA 3O0FA 2KKVA 4QNLA 1L6NA 3RFAA 2VJ4A 2OH2A 3H0LB 4BX9C 4CRXA 2HMXA 2KD1A 3L3FX 2G0AA 4C0ZA 3D2SA 2ZXIA 2ZXHA 4KX3A 4AYBC 3PZPA 1PVPA 4OJ5A 1YT3A 2MA1A 2Q4TA 1HIWA 2Y0SC 2HBKA 2K8BB 1P7DA 2JMGA 2ZG6A 1Z1BA 1D8BA 1XO0A 2G07A 1PVRA 2K89A 2E1EA 4JMUA 4PL2A 2OXOA 4CDGA 2XICA 4QIWC 3ALRA 5KL1B 2KIWA 2KV2A 5A0LA 3SAGA 1KBUA 1DRGA 2HBLA 1T94A 2OM6A 3SAFA 4BUGA 3IP4B 2W7PA 4FZLA 2HOFA 3F2DA 3H0MB 5T14A 2PMZF 2W04A 2Z7JA 4ACOA 2F77X 4OJ6A 4PL1A 2ZIWB 2K8CB 3VC8A 3GZFA 2CN1A 3HKZC 2K4EA 3SAHA 2ZIUB 4P0QB 2LYAA 2NV3A 3OPXA 3F5EA 2KJ8A 3MGVA 2KHQA 2R18A 3PSTA 1ZQ1C 3CRXA 4P0PB 4QJFB 4OJLA 1Q3UA 2CRXA 1F44A 4FE3A 1SZHA 1UPHA 2ZIVB 3K1ZA 2H3ZA 2KVCA 4FZNA 3H0RB 2D6FC 2RRDA 3IG5A 4WJ3B 3DEEA 2JHDA 4U6PA 1MA7A 5CRXA 2K4IA 2XVTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CPR A;  2HBM A;  4QIW F;  1WUD A;  1GO3 F;  3SAH A;  2RHF A;  2HBJ A;  4QJF B;  1YT3 A;  2MA1 A;  4NLB A;  2E1F A;  4NLC A;  2HBK A;  1D8B A;  4OO1 J;  2E1E A;  4CDG A;  2RRD A;  2DGZ A;  2KV2 A;  3CYM A;  5C0Y A;  3SAG A;  4CGZ A;  2HBL A;  3SAF A;  4O3M A; 
#chains in the Genus database with same CATH topology
 2VKQ A;  5KFP A;  2HBM A;  1ZD5 A;  1FEZ A;  4IL6 U;  5ALV A;  1CRX A;  4BXO A;  5EWE A;  4TUS A;  2E8M A;  4FS2 A;  5AK3 A;  1UQV A;  3LYS A;  4EEK A;  4GXK A;  2ZIW A;  3KZX A;  2W54 A;  2D8C A;  2WF6 A;  1D8L A;  4JWN A;  5KT7 A;  4F2S A;  1ZQY A;  4ED7 A;  1NK0 A;  5BOL A;  1C20 A;  5AM2 A;  1ZD2 P;  4ELU A;  1KL9 A;  1HEK A;  1L7P A;  4Q45 A;  4DF4 A;  1JIH A;  5AM3 A;  2JH7 A;  3PSP A;  1ZET A;  2BCS A;  1XSN A;  4P0Q A;  4RPY A;  1MQ3 A;  1ZQI A;  3Q8M A;  2YTU A;  3D2N A;  5J2C A;  3TAN A;  3SR6 A;  3IN5 A;  5L1J A;  1JRP A;  1SL0 A;  4LJX A;  2NRZ A;  3MC1 A;  4CE6 A;  4K4I A;  5KT2 A;  3ZDC A;  4MEX A;  3Q8K A;  2QB1 A;  3D2S A;  4KX3 A;  3M1Y A;  5EE9 A;  1Q8K A;  1WG8 A;  5AKI A;  5J0S A;  1DOQ A;  5AKG A;  1TKD A;  5KFJ A;  4JMU A;  5KFB A;  2ASD A;  5CA7 A;  2J6U A;  1RYR A;  1KBU A;  4EYH B;  2KMD A;  5BPC A;  4F50 A;  1U9L A;  2Z7J A;  2RQ5 A;  4O3S A;  2PFO A;  3HPO A;  3KD3 A;  4RPX A;  7ICM A;  2JEG A;  5KFF A;  4FE3 A;  4Q8E A;  4RQ4 A;  2PI5 A;  3SV3 A;  1OW5 A;  4Q43 A;  4WJ3 B;  1Z4O A;  4C8O A;  2KIC A;  4Z6C A;  1ZQK A;  4JV2 A;  4RQ3 A;  4J9R A;  3B0X A;  3JPO A;  1JRO A;  1AQ6 A;  1S0N A;  1ZD4 A;  3M9M B;  2FLL A;  1FFV A;  1BVS A;  2ZIX B;  5KT5 A;  1XSL A;  3GV7 B;  3TI0 A;  5AHX A;  5ALS A;  1SV4 A;  5EE1 A;  8ICX A;  1M6Y A;  4KLJ A;  4ICA A;  3T5H A;  1TK0 A;  2AXT U;  1UT5 A;  1L3V A;  4TQS A;  1HUZ A;  4F4X A;  3UQ2 A;  5HMM A;  5AKH A;  2KKP A;  3M7D A;  5KT6 A;  3NUQ A;  1T3Q A;  4BDP A;  2XI9 A;  2JZB B;  3RR7 A;  1WWU A;  3C29 A;  4O3M A;  1V38 A;  1PK1 B;  2DQN B;  4F91 B;  4P4P A;  3O0F A;  4GXJ A;  4XRH A;  2NRV A;  2BCR A;  2AQ4 A;  4KLL A;  4XQ8 A;  4DLE A;  3OJU A;  4Z6D A;  2G07 A;  5AIC A;  2IA6 A;  4PGQ A;  2A19 A;  1DRG A;  4K4H A;  5T14 A;  3WK4 A;  4PL1 A;  1U4B A;  2WTF A;  4ELV A;  9ICC A;  5AM4 A;  4I28 A;  2C2E A;  5ALN A;  4M47 A;  4M9L A;  4QWA A;  1ZQ1 C;  3CRX A;  4P0P B;  5AKK A;  2ZUB A;  4EBE A;  4M0A A;  4I2J A;  1BPE A;  1T3N A;  3DEE A;  2IMW P;  3HWT A;  2JR5 A;  2M0N A;  9ICV A;  2YB1 A;  2WF5 A;  3BQT A;  4I2G A;  4F4K A;  5J2K A;  4J9K A;  2W43 A;  3CP8 A;  3TAD A;  3C5F A;  2LYH A;  1BNO A;  3AM9 A;  2KOB A;  4J9P A;  3BJY A;  3WKC A;  1NK4 A;  4AYB F;  3HJE A;  2HDO A;  4JWM A;  3TQ1 A;  1QQ5 A;  5HR6 A;  2Y0S F;  5DG7 A;  1FO4 A;  2HHQ A;  2FPK A;  2KSO A;  5DQG A;  4PGX A;  2F76 X;  2ASL A;  3ED5 A;  5ALT A;  4EEL A;  3GIL A;  2HHW A;  4FZM A;  1J2N A;  2W9C A;  1BPX A;  1ZJM A;  5AM0 A;  3K4G A;  2BR0 A;  4DFM A;  4UB8 U;  4YP3 A;  2GWS A;  2FDR A;  4QWD A;  4CF4 A;  3E0F A;  2QLT A;  2WAQ C;  4R66 A;  1URJ A;  3QNM A;  2G06 A;  3A0H U;  5KL8 B;  3ZDD A;  4RQ5 A;  3C5G A;  3GV8 B;  5KG3 A;  1SKS A;  3V6K A;  4BX9 C;  4F4Z A;  4CRX A;  2ZXI A;  3K75 D;  2VA3 A;  3PZP A;  1PVP A;  5AI9 A;  3WK7 A;  2JEI A;  2MA1 A;  7ICK A;  3OHB A;  1HIW A;  5KAI U;  9ICO A;  1ZQM A;  3MDC A;  4OD0 A;  1RXW A;  3RJE A;  1ZQF A;  3IM1 A;  2HOF A;  1DK2 A;  4EZ6 A;  2W3S A;  3QZ8 A;  1ZOL A;  2K8C B;  1SL1 A;  4Y2U A;  3TAR A;  2DWQ A;  7ICH A;  4MHV A;  2QAR B;  5H2F U;  4IS7 A;  2F1H A;  3TFR A;  4Y2S A;  3FAH A;  2ASJ A;  4DSK A;  1O03 A;  3QU2 A;  2KP7 A;  2AJQ A;  4DOA A;  4BWM A;  1DGS A;  1X6J A;  4G9B A;  3HT3 A;  2K4I A;  1IV8 A;  2XVT A;  4I2F A;  4BJQ A;  3G6V A;  2YMQ A;  4FBT A;  1SWV A;  4O9M A;  3UXN A;  3TAD C;  2WB1 F;  1ZQB A;  5HNK A;  3PMN A;  4RQ6 A;  3SV4 A;  4NLC A;  4OO1 J;  1KFS A;  5DB8 A;  1IM4 A;  3LK9 A;  3KZI U;  4NL9 A;  9ICW A;  2R8J A;  1EXN A;  4K4G A;  5IIK A;  4YMO A;  3L4P A;  4RQ7 A;  8ICT A;  5HR7 A;  4NLZ A;  2G08 A;  4FFD A;  4YR2 A;  4NV0 A;  1RYS A;  3M8R A;  3VCB A;  1U47 A;  2EZZ A;  1QSS A;  5EE3 A;  3BQ2 A;  3PSI A;  3MR5 A;  2FLP A;  7ICU A;  3H8J A;  4UAT A;  2R8K A;  4ED0 A;  2BPG A;  1TAU A;  2EQY A;  9ICA A;  3FDS A;  5ALJ A;  5KFS A;  5KFU A;  3CNH A;  5AKJ A;  2Y9U A;  2JMG A;  2E1E A;  4Z6E A;  4NLG A;  3UMC A;  2HSZ A;  5E79 U;  4TUR A;  4PHD A;  2F77 X;  2JV3 A;  4IQV A;  4UAZ A;  4DL7 A;  1JXL A;  5KG7 A;  2ALZ A;  4PGY A;  5AIA A;  4UAU A;  1ZRN A;  5DQH A;  3H0R B;  1N5X A;  2B0C A;  2BCU A;  4MFA A;  2ZUD A;  1NJX A;  3BS5 B;  4KN4 A;  2AGQ A;  5JUM A;  1ZQX A;  4OJP A;  4QZE A;  4YD2 A;  7ICV A;  3PR4 A;  1XC9 A;  3JPN A;  4DQS A;  1JI7 A;  5KFW A;  5IIM A;  2EZY A;  3HIL A;  4NL9 C;  2KE7 A;  5L1K A;  3N7P D;  2ZUC A;  2Y1I A;  4C7Z A;  4ED1 A;  2KEY A;  4DQP A;  5DGA A;  2W9B B;  2OCE A;  7ICN A;  3C28 A;  4Y2R A;  5KFT A;  3UQ0 A;  3AU2 A;  2G5H B;  2BHN A;  5ALL A;  1RG6 A;  7ICJ A;  3RJH A;  2OHF A;  1L3S A;  8ICW A;  4F3O A;  1L3U A;  8ICU A;  1SXD A;  5GTH U;  2F44 A;  1BNP A;  3B0Y A;  3AN1 A;  4C4T A;  3L3F X;  5KFK A;  5KFL A;  4X5V A;  4C8N A;  4YR3 A;  2AH5 A;  1PVR A;  1LKY B;  1ZQV A;  2BQU A;  4DL4 A;  2K60 A;  4ED2 A;  1FFU A;  3IP4 B;  5J0X A;  5KFA A;  1LV5 A;  3B9J A;  2HHU A;  1K5O A;  2DKZ A;  2DFL A;  7ICI A;  1TE2 A;  3MAB A;  4JV1 A;  4NM2 A;  2YMP A;  3SI8 A;  2CRX A;  5CEH A;  2ZIV B;  3K1Z A;  5HP4 A;  4ECZ A;  2JHD A;  3EPG A;  4HAI A;  5KFM A;  4IR1 A;  4KMO B;  2LM1 A;  4RT2 A;  4M9N A;  4J9Q A;  1A0P A;  1ZQA A;  3NGD A;  4KLD A;  4PJ0 U;  2JXJ A;  2ZJ5 A;  2RHF A;  4R8U B;  2JH1 A;  5DDY A;  5ALU A;  5IIL A;  2BQ3 A;  2FLN A;  2QB0 B;  4I2C A;  2DPI A;  2BGW A;  2AGP A;  3CYM A;  3RB4 A;  3ISB A;  3ZD9 A;  1RYU A;  1Z3E B;  5D46 A;  4B9M A;  2W8L A;  3LVW A;  2LI6 A;  3PW2 A;  5KFE A;  3TAP A;  2YX8 A;  3EZ5 A;  2VA2 A;  4YMN A;  3FM9 A;  3QXG A;  1ZQJ A;  2R8G A;  4PHE A;  2G5I B;  3UPQ A;  3IDW A;  3PML A;  4KLH A;  5F9N A;  3QU5 A;  4EX6 A;  4JK1 A;  4O3P A;  2OH2 A;  5FP0 A;  1SKW A;  5ALM A;  5ALY A;  1YT3 A;  5DB9 A;  5KFD A;  5ALI A;  4PH5 A;  3MGH A;  4J9O A;  4YVZ A;  1Z1B A;  1U45 A;  7ICF A;  4QIW C;  2FMS A;  8ICY A;  2MUT B;  3SAF A;  4MEY A;  3F2D A;  1RDF A;  2W04 A;  4MFC A;  2E8P A;  2KJ8 A;  1K1S A;  3JPR A;  4EBD A;  1C7Y A;  3N4M B;  1B0X A;  2RLT A;  4I2I A;  7ICG A;  2ZTD A;  1N48 A;  1F0M A;  4UB1 A;  9ICG A;  4KLS A;  5CRX A;  1RXV A;  1ZJN A;  5ALR A;  1TVA A;  8ICB A;  2HVI A;  1Q3V A;  1N56 A;  4M2Y A;  2MAX A;  4E0D A;  4C4S A;  5BOM A;  4F5P A;  3RBE A;  1RQL A;  4QW9 A;  3N97 B;  1L3T A;  2PMZ C;  1X9W A;  3LWM A;  1U49 A;  4J9L A;  3SMV A;  4RQ8 A;  1MQ2 A;  1JN3 A;  4Y2P A;  1L8L A;  2PKE A;  2FJ6 A;  4KX5 A;  5AI6 A;  4M6W A;  2P6R A;  3T79 A;  4F5O A;  7ICE A;  3M6Z A;  1LVH A;  4DSJ A;  1N62 A;  1CI4 A;  3I76 A;  2HOI A;  1PK3 A;  1XO1 A;  2WF9 A;  3RBD A;  3UMG A;  4KLT A;  3I28 A;  3RB3 A;  4F2R A;  4PHA A;  5KG2 A;  3GIK A;  2MRL A;  3ONN A;  1JAL A;  3NAS A;  3THV A;  1SL2 A;  2KZ3 A;  2ZIU A;  3MBY A;  4DO9 A;  2C28 A;  2KVS A;  4KN7 A;  1S76 D;  3GFK B;  3MFH A;  3NRZ A;  2KKV A;  4Y2V A;  9ICS A;  2KD1 A;  3MR2 A;  2NRT A;  1Z00 A;  2OWO A;  3BDP A;  4OJ5 A;  4DSL A;  2L5Y A;  1VLB A;  2K8B B;  4P4O A;  5B5E U;  1UA0 A;  4CDG A;  4I2A A;  4F5Q A;  4ZH4 A;  1Z1V A;  4F71 A;  4FBU A;  3JPS A;  5J0R A;  2ES6 A;  3SEN A;  4RQM A;  4MF2 A;  4Y2Y A;  4RQ1 A;  3PX4 A;  4IRD A;  2BCV A;  9ICF A;  7ICO A;  4UB4 A;  4RQ2 A;  3BQ7 A;  2FMQ A;  2AU0 A;  3K1R B;  1SZH A;  8ICL A;  1QSL A;  2W9A A;  3C23 A;  2RRD A;  1BPB A;  2JEF A;  5KFN A;  5KFG A;  4YXM A;  4UB2 A;  4NWI A;  3AQF A;  3G6Y A;  3MDA A;  5J0U A;  4RQ0 A;  3ISD A;  1ED1 A;  2I5H A;  7ICP A;  4GC7 A;  2IHN A;  3NVV A;  4DQQ A;  2IHM A;  2WF7 A;  2E5S A;  2XO7 A;  3ISC A;  2LM4 A;  4O3R A;  8ICE A;  1ZQN A;  2LMR A;  2YMM A;  3AQE A;  2ESE A;  2BDU A;  3F5A A;  1X9M A;  4ECU A;  1VDV A;  3F2B A;  1ZQD A;  4XA5 A;  4F72 A;  5D4B A;  3KHH A;  5ALX A;  4C7Y A;  3DV9 A;  1J2M A;  1J97 A;  4DS4 A;  3FC4 A;  5ALQ A;  4DFD A;  3QUC A;  2GLE A;  5AI0 A;  5AM1 A;  5TZV A;  4B6J A;  2A1J A;  3RJG A;  2LPE A;  4J9M A;  2E8O A;  2LYB A;  3RJI A;  4EYI B;  1Q46 A;  3UXP A;  3T5K A;  9ICX A;  4QNL A;  2R8H A;  3WK9 A;  4M9G A;  5CJ7 A;  5D49 A;  3RRH A;  5AKE A;  1P7D A;  2HBK A;  3WK8 A;  1D8B A;  4BXO B;  4UBC A;  1NJY A;  2KG5 A;  4B9U A;  2KFZ A;  1QH9 A;  3EWA A;  1NJW A;  2F1I A;  4RZR A;  4B9V A;  3AU6 A;  1ZYQ A;  4KLE A;  3E2E A;  2ZIW B;  4FO6 A;  3CW2 C;  1KLN A;  2UVU A;  4DL3 A;  2NV3 A;  3BQ0 A;  2I9G A;  5J0T A;  5J0Y A;  1ZQW A;  2R18 A;  4B9L A;  8ICV A;  2I1Q A;  2KVC A;  4EEY A;  2BPF A;  2PFP A;  2XC9 A;  1S0M A;  3WKE A;  2BQR A;  2G09 A;  2F8L A;  5J2F A;  4P0Q B;  5KFI A;  4KIT B;  4UAV A;  2H3I A;  2YB4 A;  3QE9 Y;  3NTU A;  5IIJ A;  3AMZ A;  4GFJ A;  4MFF A;  4Y2X A;  5EWF A;  1D9D A;  3MFI A;  3GII A;  1NOM A;  2RDI A;  1WYG A;  3QU9 A;  2R8I A;  2EZX A;  5KG4 A;  1B22 A;  1NNL A;  2GH1 A;  3QUQ A;  2H5X A;  2ISP A;  5F3X B;  1KN5 A;  2V4R A;  3PW0 A;  2F3N A;  4R65 A;  1S0V A;  3AUO A;  2UVV A;  4KLG A;  1L8O A;  1KDH A;  5KFV A;  1VJ5 A;  4RNO A;  3IG8 A;  5AI8 A;  2E1F A;  1S5L U;  4DOC A;  2QKQ A;  5J0Q A;  3H4B A;  3V6H A;  1RPL A;  2HHX A;  2P35 A;  5IIN A;  2EAO A;  1Z4N A;  1OUQ A;  1X2I A;  1Z19 A;  1S77 D;  1COO A;  5KTQ A;  8ICH A;  2G0A A;  2ODG A;  3RB0 A;  5ALD A;  3IHQ B;  7ICR A;  4Q8F A;  1KKX A;  3LDA A;  1UHU A;  1NKB A;  4M04 A;  5CHG A;  2K89 A;  4UBB A;  2I6X A;  4AP9 A;  1SB3 C;  3JPP A;  3HW8 A;  3H8W A;  5KT4 A;  3RH6 A;  1SWW A;  3L5K A;  3HKZ C;  2E8N A;  3KTQ A;  2ZIU B;  5DQI A;  3NVZ A;  1L7O A;  2EAN A;  5AKY A;  5KAF U;  1DK3 A;  2KTQ A;  4NM1 A;  2C2D A;  4B9T A;  5DBB A;  2ZJ8 A;  3QEA Z;  5KT3 A;  2KZZ A;  1QLN A;  2DKX A;  1NKC A;  1KRP A;  1SKR A;  3PSF A;  2WAQ F;  2ZJA A;  1QTM A;  5CP2 A;  5HHH A;  3QU7 A;  4Y2Q A;  5J0P A;  9ICI A;  4QWC A;  5AK5 A;  2K4P A;  3DDH A;  4US8 A;  3V7L A;  4I2D A;  1L7M A;  4IRK A;  4CGZ A;  5ALH A;  1V85 A;  4P2H A;  1ZQU A;  2VA8 A;  1SXE A;  5KG6 A;  2O6K A;  2DBY A;  2GOL A;  1A76 A;  3TAQ A;  9ICM A;  3NRW A;  4I2E A;  2KNJ A;  4JV0 A;  4C8M A;  2ISO A;  1WWV A;  4BGD A;  3TKA A;  1B4F A;  5ALP A;  2KIV A;  9ICL A;  2LBO A;  1XWL A;  5J8Y A;  3SD7 A;  4UAY A;  1N2X A;  2AQ0 A;  2ZIX A;  4U7C A;  3AEV A;  4GXI A;  5J2D A;  4GIB A;  3HP6 A;  1UA1 A;  3WKB A;  4EBC A;  1X66 A;  4B9S A;  2V9W A;  4NY8 A;  5AKL A;  5ALE A;  8ICF A;  4PL2 A;  1SIJ A;  2EH9 A;  5J2B A;  8ICO A;  5G5G A;  4BUG A;  2W7P A;  1ZQL A;  5J2J A;  4R63 A;  2BDP A;  8ICP A;  2P6U A;  5KNI A;  4RU9 A;  4DL5 A;  3F5E A;  2NYV A;  3MGI A;  5AM5 A;  8ICZ A;  2JZB A;  2Y1J A;  4PPX A;  3OHA A;  2EAP A;  2W55 A;  1TAQ A;  1PK1 A;  2KSO B;  3TAC B;  4J9N A;  3EYZ A;  5J0O A;  3M8S A;  2W9C B;  1N61 A;  3QX7 A;  5DB7 A;  1MA7 A;  4M9H A;  3RJK A;  1ECW A;  2K4H A;  4QWB A;  4DCC A;  1OXJ A;  4C80 A;  1GO3 F;  1S0O A;  4YCX A;  4DSE A;  2CXY A;  2D3D A;  4QZI A;  4CNQ A;  9ICU A;  3BS7 A;  4YN4 A;  1QCK A;  1X40 A;  1K1Q A;  3BQ1 A;  4DS5 A;  1MSW D;  9ICK A;  3N7S C;  7ICT A;  4US9 A;  4RNN A;  3KHG A;  2AGO A;  4P0P A;  5F9L A;  4UB5 A;  2RDJ A;  4IR9 A;  1ZQS A;  8ICM A;  2DF4 B;  8ICI A;  2KHV A;  2MU2 A;  2N1R A;  4RQN A;  2FE9 A;  2B6G A;  5J8Y C;  3QZ7 A;  4HYK A;  2OYY A;  2KN7 A;  1ZQE A;  2LKY A;  3QUB A;  2W03 A;  1JUD A;  2BCQ A;  1IG6 A;  8ICC A;  4UAS A;  2M9N A;  4ED6 A;  3SEI A;  2W7O A;  1ZQH A;  2DGZ A;  2LHT A;  5J2I A;  5J2G A;  9ICT A;  9ICH A;  2KZM A;  3F53 A;  1XU4 A;  3AL0 B;  2IOF K;  8ICA A;  3GU3 A;  3A0B U;  2JGA A;  1XSP A;  2VAN A;  5KFZ A;  1RZT A;  4USA A;  2XCA A;  2ZXH A;  2GO7 A;  5L1L A;  1PZN A;  3C1Y A;  3C2M A;  3H40 A;  5AKX A;  5AI5 A;  2Y9T A;  2ZG6 A;  2OXO A;  2XIC A;  3SAG A;  3GV5 B;  4ECV A;  1HUO A;  4C8K A;  2HBL A;  1UCV A;  5DKW A;  3T5L A;  2NRX A;  4OJ6 A;  2UVW A;  3GZF A;  4F4W A;  4IQU A;  4RUA A;  4QZC A;  3EW9 A;  2EAM A;  4I2H A;  9ICP A;  9ICB A;  2J6S A;  4JUZ A;  4EX7 A;  4I29 A;  3M9O B;  4O5K A;  4QJF B;  4OJL A;  3RAX A;  1KFT A;  5ALF A;  4DQR A;  4QZ8 A;  3Q8S B;  1HJP A;  3WK6 A;  3PX0 A;  4KLI A;  4UQG A;  3IV6 A;  4DFJ A;  4RNM A;  4RPZ A;  1ZQP A;  2ZTE A;  5ALZ A;  2KJ5 A;  4KLQ A;  5B66 U;  2KJ9 A;  3LVV A;  9ICE A;  1RQN A;  5AK6 A;  4DSF A;  3PV8 A;  3PO5 A;  5AI4 A;  1LB2 B;  3M6K A;  2QAR A;  2HHT A;  1S9F A;  3RH5 A;  1S97 A;  4NXZ A;  1WUD A;  1KTQ A;  4DF8 A;  3ETL A;  3H4D A;  3N7R C;  2NRW A;  3RF9 A;  3ICX A;  5EWG A;  3SQI A;  1KQQ A;  1BPZ A;  3WKD A;  4NLN A;  5KFX A;  4O3O A;  1NZP A;  5G5H A;  4YD1 A;  3HX0 A;  4ECQ A;  3ZDA A;  3F2C A;  4IRC A;  3KBB A;  2WHE A;  3Q8L A;  2HMX A;  4AYB C;  1NK6 A;  1ZQC A;  1IXR A;  1NI3 A;  2Y0S C;  4QZD A;  2WF8 A;  1L5U A;  2HHV A;  7ICL A;  4RT3 A;  3GDX A;  3HRD D;  1T94 A;  1UT8 A;  4Y2J A;  1N63 A;  4ECY A;  2CN1 A;  2K4E A;  1L7N A;  3LWL A;  3OPX A;  1SGG A;  1V9P A;  5J2A A;  3N28 A;  3KHL A;  3H8M A;  1YZ6 A;  1UPH A;  1BPY A;  3EUB 2;  1ZD3 A;  4TQR A;  4DL6 A;  3SZ2 A;  2XGP A;  3NVY A;  1TFR A;  3C2L A;  5L9X A;  4KTQ A;  4ED3 A;  5DB6 A;  3C1Z A;  1S8O A;  3D2Q A;  2HVH A;  1ZQT A;  1T8E A;  4QZH A;  5C0Y A;  3RR8 A;  2J6T A;  3IRU A;  4QIW F;  3KKA A;  2XY7 A;  4KLM A;  3QYP A;  1MN8 A;  1X6I A;  4UW9 A;  4PZO A;  4ELT A;  4MF8 A;  2OEH A;  1A77 A;  7ICQ A;  4A8E A;  1JXE A;  2RP5 A;  8ICJ A;  3BS5 A;  1RM6 C;  1O08 A;  3V7J A;  3H7I A;  2WB1 C;  5AIB A;  8ICS A;  4O5C A;  1ARO P;  2YQE A;  3Q8P B;  4ED8 A;  1D9F A;  5HML A;  8ICN A;  1L6N A;  2B21 A;  4Z6F A;  5DLF A;  4QZF A;  2PFN A;  1XS9 D;  3PR5 B;  1NKE A;  4DOB A;  1NJZ A;  1ZXI A;  3ETR A;  4R64 A;  2E3T A;  3JPT A;  2KIW A;  2W9B A;  4YXJ A;  2OM6 A;  1SV0 A;  4FZL A;  3H0M B;  1X9X A;  2PMZ F;  2XCP A;  1CUK A;  3VC8 A;  4ECX A;  3RJJ A;  3QEB Z;  1S10 A;  3OSN A;  5ALW A;  5KG5 A;  3MGV A;  5KFO A;  4F93 B;  5DG8 A;  2ZTC A;  1F44 A;  3RRG A;  3H8S A;  4NJ8 A;  4NLK A;  4FZN A;  2W8K A;  1TK8 A;  2UVR A;  5HHI A;  3Q8Q B;  3C2K A;  3WU2 U;  1V97 A;  3ORY A;  4CF5 A;  3RTV A;  2JEJ A;  5L1M A;  4KLO A;  4QWE A;  3OTQ A;  1ZQO A;  4TUQ A;  1LKY A;  3GQC A;  2HOQ A;  4I2B A;  5J2E A;  2BZF A;  2HBJ A;  4NLB A;  4IQT A;  9ICR A;  2F8K A;  5ALG A;  4IC9 A;  4PHP A;  5CWR A;  3OJS A;  5KFH A;  1JMS A;  3KKA C;  2NO4 A;  3QUT A;  4YMM A;  5DLG A;  2ZIV A;  3S6J A;  3MR3 A;  5KFC A;  1ZQR A;  2BPC A;  4O3Q A;  1NK8 A;  3NS1 A;  8ICK A;  4DFP A;  3RAQ A;  4UB3 A;  3ZI4 A;  1FIQ A;  4YR0 A;  2XY5 A;  2NO5 A;  4O0I A;  3I1Y A;  4R8U A;  3RB6 A;  2HHS A;  2PXI A;  4YG2 A;  5ALO A;  4KMU A;  2DUY A;  1U48 A;  9ICQ A;  1TAM A;  2QB0 A;  5EE0 A;  5IIO A;  3PO4 A;  4ECT A;  3R9K A;  5AK4 A;  3E58 A;  4C0Z A;  1NK5 A;  3PNC A;  5TIS U;  4C8L A;  2F1J A;  2W11 A;  4PZN A;  4TUP A;  1XO0 A;  3KHR A;  1SV0 C;  4OCZ A;  1QSY A;  4GC6 A;  1T7P A;  3ALR A;  5KL1 B;  2Q0Z X;  4DQI A;  4ACO A;  4M9J A;  1TV9 A;  5KG0 A;  4F4Y A;  2HW3 A;  1PUZ A;  3PVX A;  2LYA A;  4EZ9 A;  1BPD A;  5JTI A;  5CR0 A;  2KHQ A;  4M6W B;  3UXO A;  4KLF A;  1WCN A;  1Q3U A;  5DBA A;  9ICJ A;  3PW7 A;  2H3Z A;  2IOF A;  3BZC A;  3IG5 A;  4ECW A;  4P4M A;  4B9N A;  3UM9 A;  8ICR A;  1Y88 A;  3T3F A;  3PW4 A;  4DLG A;  3J81 j;  1N60 A;  2XID A;  5JU5 A;  1KFD A;  2A3V A;  1ZRM A;  2H3Q A;  5C5J A;  4G3I A;  4F5R A;  3RH4 A;  2MUT A;  1T4G A;  2H3V A;  2WFA A;  1SZP A;  3OSP A;  5DBC A;  1Z00 B;  3BZK A;  1DXS A;  4FS1 A;  4C4R A;  5KFQ A;  3V6J A;  2HCF A;  5ALK A;  1COK A;  4QZB A;  5DG9 A;  1F5S A;  4LZG A;  2AHO B;  1DGJ A;  5J2H A;  2K8A A;  4J9S A;  4LVS A;  1H38 A;  4IQW A;  2F2A B;  1YZ7 A;  3GIJ A;  1IIP A;  3PY8 A;  1QQ7 A;  2HI0 A;  8ICQ A;  1TK5 A;  4LZD A;  4XUS A;  2PI4 A;  2CPR A;  4CCH A;  4I27 A;  4CF3 A;  2P66 A;  4DL2 A;  3PX6 A;  1D8Y A;  3ZDB A;  3RFA A;  2VJ4 A;  5KFY A;  5CB1 A;  3ZD8 A;  2Q4T A;  4KLU A;  4YFK A;  2IOH A;  2DL0 A;  3Q8R B;  2EDU A;  4F92 B;  2MSN A;  4UAR A;  4F5N A;  4YQW A;  3RJF A;  1CEZ A;  3MR6 A;  3SAH A;  7ICS A;  2YML A;  3NVW A;  2JRZ A;  1X42 A;  3T5J A;  2YN4 A;  1JX4 A;  1KSP A;  3TFS A;  2A1A A;  2C22 A;  1NZB A;  4ECS A;  1A6S A;  4Y2T A;  5EOZ A;  4J03 A;  2A1J B;  2BKE A;  5J0W A;  1XNS A;  3V7K A;  3C21 A;  2KFN A;  3UMB A;  2W3R A;  3JPQ A;  5DDM A;  3V72 A;  1MC8 A;  4UAW A;  4QW8 A;  2VJ5 A;  3KOO A;  4DWI A;  4BWJ A;  5III A;  5L1I A;  1ZQG A;  5AKZ A;  1NK7 A;  4OJO A;  4ZOH C;  5J29 A;  1KEJ A;  2XY6 A;  2IBK A;  3OGU A;  1ZQZ A;  2KK0 A;  3U26 A;  5K4L A;  4UB6 U;  2VIX A;  1ZQQ A;  4QZA A;  3HKZ F;  1KW4 A;  3GIM A;  1B43 A;  5GTI U;  4O5E A;  1PVQ A;  4DEZ A;  3FYH A;  2XGQ A;  1WCL A;  3G6X A;  5KG1 A;  3KFU F;  3QU4 A;  2FPM A;  2H3F A;  3SYZ A;  2V4Q A;  2ATL A;  3H0L B;  5KFR A;  1QQ6 A;  3PW5 A;  2FPL A;  8ICG A;  5JRT A;  4Q44 A;  4ECR A;  4EEN A;  4DFK A;  4DSI A;  2C2R A;  4JB3 A;  1NK9 A;  5A0L A;  2KV2 A;  3M9N B;  2PFQ A;  3EPI A;  4RUC A;  2W9M A;  2FMP A;  2DPJ A;  2FI1 A;  3D6J A;  4GLX A;  5DGB A;  3PST A;  3ZDE A;  3WK5 A;  3WKA A;  1X9S A;  1BGX T;  1N5W A;  4QZ9 A;  4F8R A;  4QZG A;  2D6F C;  4U6P A;  2YY6 A;  4O3N A;  9ICN A; 
#chains in the Genus database with same CATH homology
 2G09 A;  1ECW A;  2F8L A;  2K4H A;  2KIC A;  2M0N A;  4KMO B;  4NWI A;  4BJQ A;  3AQF A;  2VKQ A;  2YB1 A;  3PSF A;  1NZB A;  1Q3V A;  2HBM A;  1A0P A;  1A6S A;  2WAQ F;  4OJP A;  1GO3 F;  2WB1 F;  1CRX A;  2XID A;  2KJ5 A;  2A3V A;  1XNS A;  2H3I A;  2YB4 A;  3CP8 A;  2H3Q A;  2RHF A;  1ED1 A;  3VCB A;  2HOQ A;  2ZIX B;  4GFJ A;  2JH1 A;  3LYS A;  2HBJ A;  2KJ9 A;  3LVV A;  4NLB A;  2PMZ C;  2KOB A;  2H3V A;  2E5S A;  4NLC A;  3D2Q A;  2ZIW A;  3KZX A;  4OO1 J;  2VJ5 A;  4IC9 A;  3SMV A;  3M6K A;  3CYM A;  4ICA A;  4AYB F;  3N7P D;  4CGZ A;  3N7S C;  5C0Y A;  4KX5 A;  5HR6 A;  2GH1 A;  2KEY A;  2Y0S F;  3T79 A;  4P0P A;  3AQE A;  2GOL A;  3LVW A;  4OJO A;  2BDU A;  3F5A A;  3M6Z A;  4QIW F;  1WUD A;  3F2B A;  2DF4 B;  2F76 X;  2ZIV A;  3NRW A;  1HEK A;  2KHV A;  2HOI A;  5HR7 A;  2KNJ A;  2N1R A;  4FZM A;  2G08 A;  3C28 A;  2JH7 A;  2K8A A;  3PSP A;  3N7R C;  4NV0 A;  3RF9 A;  2KKP A;  2VIX A;  3M7D A;  2OYY A;  4A8E A;  3IG8 A;  2LBO A;  2G5H B;  2LKY A;  2YX8 A;  2F2A B;  2E1F A;  2RP5 A;  3HKZ F;  1IIP A;  2W03 A;  3ICX A;  3NUQ A;  4P0Q A;  3SQI A;  3E0F A;  2G5I B;  1PVQ A;  2WAQ C;  2MRL A;  3D2N A;  2W7O A;  2DGZ A;  1URJ A;  3ONN A;  2LHT A;  2WB1 C;  2XI9 A;  3IN5 A;  2G06 A;  2ZIU A;  3PSI A;  3C29 A;  4O3M A;  2LYB A;  2ZIX A;  3F53 A;  5KL8 B;  4U7C A;  2CPR A;  3AL0 B;  2DQN B;  3KFU F;  1OUQ A;  2H3F A;  3F2C A;  3GU3 A;  2JGA A;  1Z19 A;  1TAM A;  3O0F A;  2KKV A;  4QNL A;  1L6N A;  3RFA A;  2VJ4 A;  2OH2 A;  3H0L B;  4BX9 C;  4CRX A;  2HMX A;  2KD1 A;  3L3F X;  2G0A A;  4C0Z A;  3D2S A;  2ZXI A;  2ZXH A;  4KX3 A;  4AYB C;  3PZP A;  1PVP A;  4OJ5 A;  1YT3 A;  2MA1 A;  2Q4T A;  1HIW A;  2Y0S C;  2HBK A;  2K8B B;  1P7D A;  2JMG A;  2ZG6 A;  1Z1B A;  1D8B A;  1XO0 A;  2G07 A;  1PVR A;  2K89 A;  2E1E A;  4JMU A;  4PL2 A;  2OXO A;  4CDG A;  2XIC A;  4QIW C;  3ALR A;  5KL1 B;  2KIW A;  2KV2 A;  5A0L A;  3SAG A;  1KBU A;  1DRG A;  2HBL A;  1T94 A;  2OM6 A;  3SAF A;  4BUG A;  3IP4 B;  2W7P A;  4FZL A;  2HOF A;  3F2D A;  3H0M B;  5T14 A;  2PMZ F;  2W04 A;  2Z7J A;  4ACO A;  2F77 X;  4OJ6 A;  4PL1 A;  2ZIW B;  2K8C B;  3VC8 A;  3GZF A;  2CN1 A;  3HKZ C;  2K4E A;  3SAH A;  2ZIU B;  4P0Q B;  2LYA A;  2NV3 A;  3OPX A;  3F5E A;  2KJ8 A;  3MGV A;  2KHQ A;  2R18 A;  3PST A;  1ZQ1 C;  3CRX A;  4P0P B;  4QJF B;  4OJL A;  1Q3U A;  2CRX A;  1F44 A;  4FE3 A;  1SZH A;  1UPH A;  2ZIV B;  3K1Z A;  2H3Z A;  2KVC A;  4FZN A;  3H0R B;  2D6F C;  2RRD A;  3IG5 A;  4WJ3 B;  3DEE A;  2JHD A;  4U6P A;  1MA7 A;  5CRX A;  2K4I A;  2XVT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...