2MA1A

Solution structure of hrdc1 domain of recq helicase from deinococcus radiodurans
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
75
structure length
75
Chain Sequence
HDAPLFEALRAWRLQKAKELSLPPYTIFHDATLKTIAELRPGSHATLGTVSGVGGRKLAAYGDEVLQVVRDSSGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA helicase RecQ
publication title NMR structure of the N-terminal-most HRDC1 domain of RecQ helicase from Deinococcus radiodurans
rcsb
source organism Deinococcus radiodurans
molecule tags Dna binding protein
total genus 20
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2013-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00570 HRDC HRDC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.80 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2ma1A00
2DGZA 2HBJA 2E1FA 2E1EA 3SAHA 2RHFA 4O3MA 4CGZA 3SAGA 1D8BA 2CPRA 4QIWF 3CYMA 2HBKA 4OO1J 2RRDA 4QJFB 2HBLA 1WUDA 3SAFA 5C0YA 2HBMA 4CDGA 4NLCA 1GO3F 4NLBA 2KV2A 1YT3A 2MA1A
chains in the Genus database with same CATH superfamily
2LYAA 3A0BU 2V4RA 1SKRA 3F2DA 2NRXA 3RJFA 2M9NA 3N97B 3VCBA 3PX0A 1DRGA 3WK4A 3PO5A 2ZIWA 1PZNA 5TISU 5L1IA 2FMQA 5KG3A 9ICQA 4CE6A 2I6XA 4QZEA 4Q8FA 2DGZA 3E0FA 4P0PB 2KVCA 1IV8A 4CGZA 4BXOB 4RQ6A 2PMZF 4JMUA 5AKIA 4DWIA 4KLQA 2RRDA 1Z00A 4F2SA 3FAHA 5HMLA 3JPNA 4XRHA 2G06A 4UB3A 5KG7A 5KT7A 3V7KA 1ZQAA 3K4GA 3UQ2A 4PZNA 2XY5A 2KD1A 2LHTA 4DFPA 4BWJA 1ZQVA 5KFBA 9ICLA 1ZOLA 5KT5A 2HHVA 2E1FA 3NVZA 4Y2JA 3WKCA 2KIVA 3KHHA 7ICKA 3OTQA 7ICRA 2F2AB 5KG6A 1SL0A 2ZIVA 5HNKA 4ECYA 1NK6A 5KL8B 3OHBA 4C7YA 2LM1A 9ICPA 2A19A 5AKJA 3LK9A 4J9QA 4DL2A 3WK9A 1NK8A 3I1YA 3E58A 4DF4A 4O3NA 2GOLA 2F77X 5E79U 3HILA 3ICXA 4UB6U 4OJ6A 2XO7A 3M9NB 8ICQA 3KHRA 2C22A 4DL7A 2Y9TA 1LVHA 5KFGA 4RQNA 2G5HB 2R8IA 2HHXA 3RJJA 3KZIU 2BKEA 5GTIU 2R8KA 4NXZA 1L3TA 3SV4A 1ZD2P 4TQRA 3ISCA 4BJQA 2MRLA 3PR4A 3ISDA 3MDAA 3BQ7A 2WFAA 2UVVA 4PHAA 1MN8A 3NVVA 1TV9A 2AH5A 1ZQTA 4CCHA 2KZ3A 1N56A 5IILA 4M04A 1V85A 4YMOA 4XA5A 4US8A 3Q8MA 5KFLA 4R63A 1ZQSA 2FDRA 2H5XA 2BCVA 2HW3A 2XY7A 4M0AA 4WJ3B 4QIWF 5DQHA 2ZIVB 3D2SA 4Z6EA 2KNJA 3QU5A 3M9MB 2KP7A 2JR5A 3OHAA 2K4PA 5H2FU 4PGXA 4DL4A 2EAPA 2BHNA 1IM4A 2NRTA 5ALZA 3MR6A 4DLGA 3TI0A 3H8MA 2K8CB 4F91B 3OJUA 2XI9A 2W8KA 3C29A 2XY6A 4J9LA 3PW0A 4FZNA 3T5LA 2HDOA 1JIHA 2Y0SC 1NJXA 2R18A 2WAQC 2KHVA 3KHGA 2G08A 3PO4A 1MQ2A 2KKPA 3L4PA 5F9LA 2F1HA 3MBYA 1L7OA 1L7NA 8ICVA 8ICUA 3RFAA 1ZQXA 8ICIA 2GH1A 2VANA 1JX4A 8ICSA 4O3MA 5KFPA 2FPMA 2M0NA 1NJYA 4YCXA 2MAXA 1HJPA 2ZTEA 5AICA 8ICGA 5KAFU 4UB5A 5A0LA 2Y9UA 5DB8A 4RQ8A 2F1JA 4G9BA 1ED1A 5KFIA 7ICMA 4QNLA 3BQTA 2BCQA 1NKBA 2D8CA 1UQVA 4TQSA 3GILA 2MSNA 2DFLA 3RAXA 2E8PA 4DOBA 3UM9A 4DS5A 5KFVA 5ALVA 5CEHA 3UQ0A 4DOAA 2EZYA 2ZUBA 5F3XB 1V38A 8ICYA 4MEYA 4Z6FA 4ACOA 4MFFA 1ZD5A 1N2XA 4NY8A 2G5IB 4PHEA 4IQVA 3G6VA 5GTHU 4F4YA 1BPXA 5D4BA 2K60A 2JZBA 9ICHA 4B6JA 1FIQA 2YY6A 5KFFA 3V72A 3H8JA 1ZJNA 1T7PA 3HKZC 1ZRMA 3NVYA 2OWOA 8ICOA 2BCSA 2KSOB 4ECXA 1KSPA 2HHTA 4YR3A 4IL6U 4RT2A 2BR0A 4JUZA 1NJZA 5J2JA 1D8YA 5J0QA 1KFDA 1KN5A 2PFOA 4RQ4A 2ALZA 3BS7A 4C8LA 3AMZA 4IQWA 2YMQA 2HOFA 3ZD9A 3OSPA 2G0AA 1ECWA 2R8JA 4DSLA 1ZQZA 2P35A 3SEIA 2W11A 3RJHA 3FDSA 3THVA 8ICRA 1BNOA 1XSPA 3KD3A 5J0XA 3IN5A 2ZIUA 5KFKA 4O5CA 3MGVA 4UATA 5J0RA 3TQ1A 3RH6A 4OJLA 4DFJA 3CRXA 3RH5A 9ICRA 4BUGA 2AQ0A 4QWBA 4MHVA 5EOZA 3BQ0A 2JEFA 8ICTA 4FBTA 5ALEA 2HHUA 4B9TA 9ICEA 2QLTA 5KFJA 4C8OA 2KKVA 3LWLA 1SXDA 5KG5A 3I76A 5KG0A 4GFJA 4ECRA 2AGQA 4QZIA 9ICIA 2WB1C 5DB9A 3NVWA 5J0WA 4NL9A 4KTQA 4M9GA 1CI4A 3B0XA 4F8RA 4EZ6A 8ICFA 1S76D 4IR1A 2BQRA 4Y2YA 4Y2QA 3K1RB 3BQ1A 4BDPA 1S8OA 4ZH4A 2KFZA 1RQNA 4R65A 2GLEA 1L5UA 2ZTCA 2DKXA 5DBAA 1A0PA 1D8LA 3IM1A 4YMNA 4K4HA 1GO3F 3TANA 1U47A 3GZFA 5D49A 2F8KA 3L5KA 1QCKA 1NI3A 1JN3A 5TZVA 4F2RA 2ZIUB 2A1JA 2H3IA 4C4SA 4QZDA 4F71A 5KFMA 3CNHA 4EYIB 4AYBF 2G07A 4QZ8A 4ZOHC 1K1SA 8ICPA 4C8MA 3M6KA 4DEZA 1HUZA 3Q8RB 3H0MB 4KLSA 3QEAZ 5ALMA 4R64A 2OHFA 3UMBA 4P4PA 2BPFA 2FJ6A 2XCPA 2IMWP 2XICA 3T5JA 1SXEA 4RUAA 1NK4A 2JV3A 3BQ2A 5EE1A 4I2IA 4RNOA 2JRZA 4DFMA 1QSSA 5ALFA 5ALUA 3CW2C 1ZETA 2HVIA 2E8OA 5ALJA 4QZHA 1S0NA 1ZQDA 1U45A 5KFYA 4U6PA 2WF8A 2E1EA 8ICXA 3UPQA 1XC9A 2HBKA 5J0SA 2P66A 5HR6A 3N28A 3T3FA 2H3ZA 2DUYA 2FMSA 4CF3A 3B0YA 2EANA 3AU2A 4BWMA 2DPIA 5DDMA 2YB4A 1JMSA 5D46A 1WWVA 4X5VA 4JWNA 1HUOA 4RQ7A 1ZQOA 4GLXA 1YZ7A 4F3OA 4O3RA 1AROP 4OO1J 5DQGA 3KZXA 5EE9A 2CN1A 7ICFA 3PX6A 4RQ3A 7ICEA 1YZ6A 2W3SA 4M6WA 1ZYQA 7ICUA 4PHPA 1MSWD 4ECUA 3N4MB 1SIJA 3PY8A 1DOQA 1J97A 1JI7A 4F5PA 1T4GA 1K1QA 2NYVA 4UBCA 5AI8A 5KL1B 4KLLA 1DK2A 1QH9A 4P4OA 1SL1A 1PK3A 1UT8A 2MU2A 3MR5A 1KEJA 3LYSA 1ZQ1C 4M2YA 2ATLA 2HI0A 2LKYA 4ELVA 3AUOA 1ZQCA 2HOIA 4F92B 5AI6A 3H7IA 4O5KA 3ZDBA 4P0PA 1SV0C 3C28A 3PVXA 4BXOA 3TADC 3ZDAA 3A0HU 4CRXA 3Q8LA 4IR9A 2ZXHA 5AKEA 1X66A 4F4XA 2KZZA 3PV8A 2A3VA 2JMGA 5KFDA 4A8EA 5HP4A 4KN4A 4RU9A 1X9SA 2ZUCA 1KFTA 5AI5A 2W9MA 1NZBA 2IOFA 4DSJA 2YX8A 2K4HA 5ALKA 4DS4A 2WTFA 1L3SA 5AHXA 4J9KA 3PX4A 1L3VA 2KJ5A 2K8BB 4NLGA 4M6WB 3QZ7A 2MA1A 2FPKA 1PK1B 2YB1A 4ED8A 4KLGA 4P0QB 3C21A 4HYKA 5ALSA 2FI1A 2HMXA 4UAYA 2RHFA 2DPJA 4JV2A 3VC8A 5J0YA 2DBYA 1MA7A 3EPGA 3AN1A 3UXNA 4F5RA 2ZJAA 3Q8SB 2EH9A 3TACB 4XQ8A 4MF2A 5L1LA 3HRDD 2ZIXB 3HWTA 4IS7A 1COOA 2ASJA 5AKXA 2Q4TA 3RRHA 1ZD4A 3ZDCA 4F72A 3KTQA 5CHGA 5DG9A 5KG2A 2NO5A 5HR7A 5J8YC 3EZ5A 4DO9A 2ESEA 8ICJA 1A6SA 2EAOA 1X42A 5BOMA 3RJGA 5AM5A 3C2MA 1L8OA 4NWIA 3GIMA 5AM2A 5KFRA 1RZTA 9ICTA 2F3NA 5ALIA 7ICTA 2XIDA 3QNMA 1KKXA 2B6GA 4C80A 4IQTA 3SV3A 4DQIA 4DSKA 7ICQA 2F44A 3BJYA 2PFQA 1S10A 1S0OA 4OJ5A 3FM9A 2OYYA 3M8RA 4M9LA 2ZTDA 4M9HA 3S6JA 3AM9A 5ALTA 4EEYA 9ICFA 3JPSA 2LMRA 1ZXIA 4DSIA 1VLBA 4FZMA 4Y2RA 2WF9A 5JU5A 2FMPA 4Y2XA 2IA6A 5ALXA 5DBBA 4J9SA 4MFAA 5IIMA 1T3NA 4TUQA 2UVRA 4PHDA 4QW8A 1KTQA 2D3DA 4RNNA 4OD0A 4C0ZA 3RAQA 1PVPA 1J2NA 3F5AA 3SD7A 1D8BA 2LM4A 2EAMA 4J9PA 1ZD3A 9ICOA 4NV0A 1NKCA 4PL1A 5J2CA 3EYZA 1H38A 2PI4A 2BQ3A 4QZAA 1CRXA 2Y1JA 3ED5A 4J9RA 3UXPA 2MUTB 1Z1VA 2H3QA 3GU3A 4FBUA 2OCEA 1Z4NA 3R9KA 2WAQF 3LWMA 4EX6A 5L9XA 3RJEA 2B0CA 2W9CB 2KOBA 4K4IA 1S77D 3K1ZA 5KFNA 5AK4A 2E8NA 5DLGA 8ICMA 3KKAC 1RDFA 3CYMA 4YXMA 4ECVA 2IBKA 4XUSA 4YFKA 5KAIU 1UCVA 2ISOA 8ICHA 4DF8A 5JUMA 1ZQWA 2W03A 5ALGA 1SL2A 4R66A 2KN7A 2KTQA 2VIXA 4YMMA 2F8LA 1ZQQA 2W9BB 1TAQA 5ALHA 2CXYA 4EZ9A 5IIKA 3JPRA 1ZQLA 7ICOA 2KSOA 4DOCA 5KTQA 4I2HA 2LPEA 4I2CA 2KFNA 3B9JA 8ICZA 2JEJA 3PSIA 4Q8EA 2BPCA 3H0LB 4EBCA 2QB0B 4EBEA 4F4KA 2Q0ZX 3IV6A 4ECSA 3O0FA 5AKYA 3TFSA 1XU4A 1SB3C 1S9FA 5J2FA 2AXTU 3IHQB 2W54A 5L1JA 4J9MA 3H8WA 2F1IA 3HKZF 1NJWA 1DXSA 3WK7A 4ECQA 2DF4B 5BPCA 9ICSA 5KG4A 1COKA 3KBBA 1FO4A 2OXOA 2YMPA 2ASLA 4JWMA 1L8LA 3BS5B 3J81j 1ZQIA 4OJPA 3ZI4A 5J2IA 2OH2A 3RB3A 3WK6A 4DSFA 1NKEA 4KLJA 1A77A 2YMMA 4KX5A 3EW9A 3JPTA 4USAA 3RB6A 5AIBA 3WK5A 1ZQGA 1QQ5A 3ZDEA 5ALYA 2BCRA 3SYZA 2F76X 4ELTA 3F5EA 1U9LA 3PSFA 4UBBA 5J0TA 4M47A 1B0XA 4ECZA 2YN4A 1TVAA 4YR0A 1ZQPA 1UA0A 4UAZA 1SWWA 1Z19A 1URJA 1X9MA 5AKHA 4QWAA 2OM6A 2I5HA 3ETLA 5JTIA 3TARA 1VDVA 8ICWA 5J0PA 1MC8A 2KICA 3D2QA 3V6HA 3U26A 5F9NA 5KFAA 2WB1F 5KT3A 2E5SA 2VJ4A 1A76A 1XO0A 2BCUA 1X2IA 3QYPA 4PL2A 1Z1BA 3F2BA 4KLOA 2KV2A 3BZCA 2ODGA 4JV0A 1ZQKA 1NK5A 1N61A 3PMLA 3RRGA 5T14A 2NRVA 2UVWA 3RBDA 2WF5A 3PW4A 4F50A 4YD2A 5C0YA 1Z3EB 2YMLA 1NK9A 1RM6C 8ICNA 1T8EA 1N60A 4YD1A 4C4TA 3NGDA 1XSNA 3QXGA 3ORYA 1S97A 3HW8A 3M7DA 2HHSA 3SQIA 2W43A 1D9FA 4YN4A 2ZUDA 3M8SA 5KFZA 5ALOA 1QQ6A 8ICLA 4O5EA 3WKBA 2RP5A 3C1ZA 4M9NA 4AP9A 3HX0A 4R8UA 4EENA 3FC4A 1OW5A 5AM1A 2HSZA 3MC1A 4YQWA 5IIIA 3DDHA 9ICBA 4I2DA 2I1QA 3QUTA 3QUQA 4KMOB 2W3RA 4Q43A 3NS1A 7ICSA 4TURA 4F4WA 4I2GA 5DG8A 4B9NA 4QZFA 3C23A 2RLTA 1XNSA 4EBDA 4NLBA 3QZ8A 5ALDA 5ALQA 2LI6A 1ZQFA 4RPXA 4RPYA 4PJ0U 3NRZA 2PKEA 1S0VA 7ICNA 3T5HA 1Q8KA 3N7RC 3EUB2 5K4LA 5CA7A 4YG2A 2HBMA 4CDGA 1WCNA 1SV0A 3IDWA 4CF4A 1B43A 4MEXA 1X9WA 1N63A 2NV3A 4UAVA 4B9LA 2HHWA 3M6ZA 2DKZA 3WK8A 5AKZA 5KNIA 3C5FA 4R8UB 1RXWA 1BPEA 4B9SA 5KFEA 4MFCA 4QZCA 1KDHA 4Y2UA 5AM0A 3TAQA 1Y88A 4LZGA 5AKGA 2KG5A 4F4ZA 5DDYA 4RUCA 2K8AA 4KMUA 3GIKA 4J9OA 3DEEA 1BVSA 2HBLA 5KFXA 4EYHB 2HVHA 4EX7A 1S0MA 3QEBZ 5DBCA 4UAWA 2IOHA 5J0UA 5CJ7A 2PXIA 2KZMA 1PK1A 3TAPA 2EQYA 1X40A 3MABA 4P0QA 2QARB 1WCLA 3C2LA 2LYBA 4F5OA 4UAUA 4NLKA 3NASA 9ICKA 4JK1A 3RB4A 2YTUA 4RZRA 2JEIA 3GV5B 1JROA 8ICAA 1IXRA 2DQNB 1ZJMA 2ZIXA 5J8YA 9ICUA 3EPIA 1ZQNA 5CB1A 4RQ2A 1B22A 4KLEA 3HP6A 4KX3A 1WYGA 1JXEA 4QW9A 1Q3VA 2EZXA 4P4MA 2VKQA 1NK0A 4QWDA 5J29A 3LVVA 3IG5A 1RG6A 2NRWA 4PH5A 1PVRA 4RNMA 2P6RA 3OPXA 2D6FC 5ALNA 2A1AA 5AK6A 3KHLA 4C8KA 5ALLA 4ECWA 3QX7A 2I9GA 1TK8A 2V9WA 3GFKB 5C5JA 2JH7A 4Y2TA 4O3OA 3SAFA 5DLFA 1KQQA 1PVQA 4UW9A 4Q44A 2RDIA 2W9AA 4K4GA 3AU6A 1RYRA 1F0MA 1YT3A 3WU2U 9ICMA 1IG6A 5KT2A 2HCFA 1ZQHA 2K4EA 1JXLA 3OGUA 3SENA 3SAGA 3F53A 9ICGA 2VJ5A 1XWLA 4LZDA 2AJQA 4YXJA 4NLCA 2KMDA 3H8SA 3GV7B 1SGGA 4J03A 4OJOA 1KLNA 5L1MA 3ZDDA 3C1YA 3PW2A 4FS1A 7ICLA 9ICXA 1NZPA 1WWUA 2BQUA 2NO4A 1UT5A 3OSNA 3RH4A 3N7PD 4O3QA 2Z7JA 4I29A 3AQFA 1QSYA 4RQ5A 2W04A 2VA2A 2JH1A 5DB7A 9ICWA 4DL6A 1WG8A 4O3PA 3SMVA 1LKYB 3LDAA 4PGYA 3WKDA 4C7ZA 4P2HA 1RYUA 4Y2VA 2XGPA 4Y2SA 2KJ9A 3M9OB 4GXKA 2NRZA 4RQ1A 2MUTA 3V7JA 1B4FA 1JUDA 4FO6A 4ECTA 2RDJA 3RTVA 1RQLA 3IRUA 4DFDA 2ES6A 3KKAA 7ICGA 2G09A 1ZQRA 5AI9A 2C2DA 5AIAA 2ISPA 1OXJA 2W9CA 3SAHA 1ZQUA 1QTMA 7ICJA 2W8LA 3Q8QB 1L3UA 2QKQA 5J2BA 2E8MA 2PMZC 3MR2A 1OUQA 3JPOA 3DV9A 1QQ7A 1ZQJA 4DFKA 2B21A 1U49A 5CRXA 4B9VA 2C2EA 9ICVA 1T94A 4Z6DA 3H0RB 2ZIWB 3RR7A 4I2BA 5IIOA 3Q8PB 2W9BA 4C8NA 2DL0A 8ICEA 4FFDA 4MF8A 1N48A 1ZRNA 4CF5A 3M1YA 1BPDA 4QZ9A 2GWSA 4QZGA 3PW7A 5J2GA 1PUZA 5DGBA 4ELUA 3E2EA 1F5SA 4DQPA 4KITB 5HHIA 5AK5A 5CWRA 1XO1A 1BPBA 2CRXA 4I2JA 2PFNA 2BDUA 3QU4A 1XS9D 1Z00B 5HHHA 2QB0A 4UQGA 3RR8A 2Y0SF 1XSLA 5J0OA 3H4DA 1O08A 1T3QA 2BPGA 3BDPA 2DWQA 1TE2A 1S5LU 3D2NA 5KG1A 3MFHA 5IINA 4DL5A 1N5WA 1IIPA 4TUSA 5G5HA 3HJEA 5AI0A 5DB6A 2K4IA 2UVUA 3UMCA 1UA1A 5J2DA 4O9MA 5IIJA 1SKSA 5KFWA 5ALPA 5EE0A 1CUKA 2AGPA 3BS5A 2AHOB 2P6UA 2XVTA 5JRTA 2R8HA 4YVZA 4QZBA 1UHUA 1U48A 9ICNA 5DGAA 3QE9Y 1HEKA 2WF7A 4ED1A 2JGAA 3FYHA 1N62A 4KLFA 1EXNA 4QIWC 1TAMA 4F5NA 3L3FX 4FS2A 5DKWA 4UB4A 1VJ5A 4JV1A 1BNPA 4DCCA 3IG8A 4DSEA 2KE7A 4UB2A 1JALA 5AKLA 3D6JA 4RPZA 1O03A 2BDPA 3TKAA 2ZG6A 7ICIA 2W55A 3HPOA 4LJXA 3I28A 4M9JA 2QB1A 4B9UA 1C20A 1J2MA 2R8GA 4I2EA 4NM1A 5CR0A 4OCZA 2ZJ5A 2N1RA 2RQ5A 5J2KA 3AQEA 3PMNA 2J6UA 3T79A 2PI5A 3ISBA 3KOOA 2KVSA 4UARA 2BGWA 1TAUA 1X6JA 1KL9A 1FFUA 5KFSA 4F5QA 2Y1IA 3RB0A 2H3VA 3SZ2A 1P7DA 2KEYA 2PFPA 3EWAA 5G5GA 3MFIA 4GC7A 4ED2A 3QU2A 4FZLA 2AU0A 4DQRA 4IQUA 1MQ3A 8ICCA 1FFVA 2ZJ8A 4F93B 2YQEA 3JPPA 4E0DA 4RQMA 4DL3A 4GIBA 3GIIA 4EEKA 1RYSA 3NTUA 2CPRA 4EELA 3RBEA 4KLUA 5BOLA 5B66U 1U4BA 4HAIA 4PZOA 3JPQA 4Y2PA 4I2AA 4I2FA 3ZD8A 3C2KA 4J9NA 3RF9A 3V7LA 4KLDA 1KW4A 4RQ0A 2KJ8A 1WUDA 4NLZA 4Z6CA 5ALWA 4ED3A 4IRCA 1FEZA 1TFRA 1DK3A 1Z4OA 8ICKA 4ED0A 4NM2A 2JZBB 2V4QA 5KFOA 4KLHA 1D9DA 1ZQEA 1X6IA 2XC9A 1DGJA 3T5KA 4TUPA 4GXJA 4YR2A 2ZXIA 1C7YA 2OEHA 2JHDA 3QU7A 5EWEA 2VA3A 3AL0B 5KFTA 4UB1A 4IRKA 1AQ6A 3IP4B 3MR3A 3F2CA 1M6YA 2ASDA 1SZPA 2AQ4A 3K75D 5ALRA 1SKWA 4DLEA 4BX9C 1HIWA 3MGIA 1L6NA 1L7MA 4O0IA 2W7PA 4KLTA 4NLNA 2E3TA 3CP8A 4ED7A 1BPYA 1V97A 2IHNA 4LVSA 5EE3A 2J6TA 4B9MA 1F44A 2JEGA 5KFUA 4ED6A 5AK3A 3G6YA 1RXVA 2KK0A 5J2AA 4I27A 3PZPA 5DG7A 3PSPA 2FE9A 2W7OA 3WKAA 2LBOA 4QJFB 2QARA 4Q45A 2L5YA 4KLMA 3TFRA 5KFQA 2HHQA 4FE3A 2HOQA 5EWFA 5J2EA 1CEZA 2WHEA 1V9PA 2O6KA 1TK5A 3TADA 4GC6A 9ICAA 3NUQA 1NOMA 2FPLA 5B5EU 2LYHA 3GDXA 3OJSA 5AKKA 1QSLA 1UPHA 4BGDA 4AYBC 4IRDA 1TKDA 4YP3A 2FLNA 3PSTA 7ICPA 4G3IA 4DQQA 4UASA 1SV4A 3MDCA 2VA8A 2C2RA 4KN7A 3PW5A 4NL9C 3V6KA 1Q46A 4NJ8A 8ICBA 5KT6A 4ICAA 1JRPA 1L7PA 1BPZA 3RJKA 3WKEA 4UB8U 2IHMA 4KLIA 3H4BA 2K89A 2J6SA 4QWCA 4QWEA 5AM4A 2A1JB 3GIJA 4GXIA 5KFHA 2FLLA 3BZKA 1QLNA 2H3FA 4US9A 3PNCA 3QUBA 3ONNA 3H40A 2KIWA 4RT3A 1NK7A 1KBUA 1Q3UA 2KHQA 3GQCA 4O3SA 9ICCA 3ALRA 3NRWA 4DQSA 1LV5A 5FP0A 3G6XA 1ZQBA 3Q8KA 1X9XA 4I28A 1LB2B 5HMMA 3GV8B 4JB3A 3V6JA 7ICVA 1RPLA 2GO7A 2EZZA 3QU9A 3PR5B 2WF6A 1NNLA 2AGOA 4IC9A 3SR6A 4C4RA 5KFCA 1BGXT 3C5GA 7ICHA 1LKYA 1TK0A 1SZHA 3ETRA 1KRPA 9ICJA 2HBJA 2XCAA 3LVWA 1ZQYA 1K5OA 2BZFA 5J2HA 5AM3A 2IOFK 4PPXA 3AEVA 5DQIA 3N7SC 4U7CA 3QUCA 2EDUA 2XGQA 5CP2A 4PGQA 2JXJA 1N5XA 3RJIA 5AI4A 5EWGA 5KT4A 2FLPA 1SWVA 3UXOA 1KFSA 3UMGA 3MGHA 2C28A 5L1KA 3HT3A 1ZQMA 1DGSA 3KFUF 4CNQA 3SI8A
chains in the Genus database with same CATH topology
1ED1A 3F2CA 2LYAA 4QNLA 2DQNB 2F8LA 2JMGA 2A3VA 4A8EA 1IIPA 2ZIXA 2H3VA 3F2DA 1P7DA 2KEYA 2KICA 3D2QA 2KKVA 2MRLA 4BJQA 4U6PA 2E1EA 2K4IA 2KJ9A 3VCBA 2H3FA 1NZBA 4FZMA 3N7RC 1DRGA 4BX9C 2HBKA 4KX3A 1HIWA 2WB1F 2YX8A 1L6NA 4GFJA 4FZLA 2E5SA 2K4HA 2VJ4A 2ZIWA 1XO0A 2W7PA 1Q3VA 2WB1C 3ONNA 4PL2A 2KIWA 2VKQA 3CP8A 1Z1BA 5HR6A 3F2BA 2HBMA 4CDGA 4ACOA 1KBUA 3LVVA 2KV2A 2H3ZA 2KHQA 3IG5A 1Q3UA 3PSIA 2KJ5A 2K8BB 2G09A 1PVRA 2MA1A 2XVTA 1F44A 3H0LB 3OPXA 2YB1A 2DGZA 2YB4A 3ALRA 2G5IB 4P0QB 2D6FC 2NV3A 3E0FA 3NRWA 4P0PB 1HEKA 2KVCA 4C0ZA 1PVPA 2HMXA 3SAHA 3O0FA 2RHFA 4CGZA 2JGAA 3F5AA 3M6ZA 3PZPA 4WJ3B 1D8BA 2CPRA 2PMZF 4QIWF 3VC8A 4JMUA 3PSPA 1MA7A 2ZIVB 2W7OA 3D2SA 5T14A 2PMZC 4QIWC 4OO1J 2RRDA 2JH7A 1A0PA 2LBOA 2KNJA 4QJFB 3SAFA 1TAMA 3KFUF 3KZXA 1PVQA 3L3FX 1OUQA 5C0YA 3HKZF 4FE3A 2G06A 2HOQA 1GO3F 2CN1A 4IC9A 4NV0A 2ZIXB 3HKZC 5CRXA 3GZFA 1YT3A 4PL1A 2KD1A 2DF4B 1SZHA 2LHTA 2Q4TA 2HBJA 1CRXA 3IG8A 2K4EA 3LVWA 2E1FA 3NUQA 2ZIUB 2K8CB 3M7DA 1T94A 3RF9A 2OXOA 2XI9A 2ZIWB 3H0RB 2K8AA 2H3QA 2H3IA 3SAGA 3F53A 2OYYA 3C29A 3SQIA 3GU3A 4FZNA 2VJ5A 2Y0SC 3DEEA 2G07A 2WAQF 2F2AB 2HBLA 1WUDA 2KJ8A 4AYBF 5HR7A 4OJPA 1UPHA 2OM6A 2RP5A 2R18A 2ZIVA 2WAQC 4AYBC 2KHVA 5KL8B 2ZG6A 2G08A 5KL1B 4NLCA 1A6SA 2KKPA 3N7SC 3M6KA 2OH2A 3H0MB 4U7CA 3PSTA 4OJOA 2HOFA 3LYSA 2G0AA 1ECWA 1ZQ1C 2KOBA 4KX5A 4NWIA 3RFAA 2CRXA 2LKYA 2GH1A 3K1ZA 2HOIA 2GOLA 2F77X 2BDUA 3ICXA 4OJ6A 4KMOB 4O3MA 2XICA 4P0QA 2F76X 2N1RA 4P0PA 3F5EA 3CYMA 2XIDA 3N7PD 3IN5A 2M0NA 2ZIUA 2Z7JA 2Y0SF 3PSFA 3AQFA 2LYBA 4ICAA 3MGVA 3AQEA 2W04A 3C28A 3T79A 2JH1A 2ZXIA 4CRXA 2G5HB 2JHDA 2ZXHA 4OJLA 3SMVA 1Z19A 3CRXA 1URJA 1XNSA 3AL0B 2W03A 4NLBA 4OJ5A 3D2NA 4BUGA 5A0LA 2K89A 2VIXA 3IP4B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DGZ A;  2HBJ A;  2E1F A;  2E1E A;  3SAH A;  2RHF A;  4O3M A;  4CGZ A;  3SAG A;  1D8B A;  2CPR A;  4QIW F;  3CYM A;  2HBK A;  4OO1 J;  2RRD A;  4QJF B;  2HBL A;  1WUD A;  3SAF A;  5C0Y A;  2HBM A;  4CDG A;  4NLC A;  1GO3 F;  4NLB A;  2KV2 A;  1YT3 A;  2MA1 A; 
#chains in the Genus database with same CATH topology
 2LYA A;  3A0B U;  2V4R A;  1SKR A;  3F2D A;  2NRX A;  3RJF A;  2M9N A;  3N97 B;  3VCB A;  3PX0 A;  1DRG A;  3WK4 A;  3PO5 A;  2ZIW A;  1PZN A;  5TIS U;  5L1I A;  2FMQ A;  5KG3 A;  9ICQ A;  4CE6 A;  2I6X A;  4QZE A;  4Q8F A;  2DGZ A;  3E0F A;  4P0P B;  2KVC A;  1IV8 A;  4CGZ A;  4BXO B;  4RQ6 A;  2PMZ F;  4JMU A;  5AKI A;  4DWI A;  4KLQ A;  2RRD A;  1Z00 A;  4F2S A;  3FAH A;  5HML A;  3JPN A;  4XRH A;  2G06 A;  4UB3 A;  5KG7 A;  5KT7 A;  3V7K A;  1ZQA A;  3K4G A;  3UQ2 A;  4PZN A;  2XY5 A;  2KD1 A;  2LHT A;  4DFP A;  4BWJ A;  1ZQV A;  5KFB A;  9ICL A;  1ZOL A;  5KT5 A;  2HHV A;  2E1F A;  3NVZ A;  4Y2J A;  3WKC A;  2KIV A;  3KHH A;  7ICK A;  3OTQ A;  7ICR A;  2F2A B;  5KG6 A;  1SL0 A;  2ZIV A;  5HNK A;  4ECY A;  1NK6 A;  5KL8 B;  3OHB A;  4C7Y A;  2LM1 A;  9ICP A;  2A19 A;  5AKJ A;  3LK9 A;  4J9Q A;  4DL2 A;  3WK9 A;  1NK8 A;  3I1Y A;  3E58 A;  4DF4 A;  4O3N A;  2GOL A;  2F77 X;  5E79 U;  3HIL A;  3ICX A;  4UB6 U;  4OJ6 A;  2XO7 A;  3M9N B;  8ICQ A;  3KHR A;  2C22 A;  4DL7 A;  2Y9T A;  1LVH A;  5KFG A;  4RQN A;  2G5H B;  2R8I A;  2HHX A;  3RJJ A;  3KZI U;  2BKE A;  5GTI U;  2R8K A;  4NXZ A;  1L3T A;  3SV4 A;  1ZD2 P;  4TQR A;  3ISC A;  4BJQ A;  2MRL A;  3PR4 A;  3ISD A;  3MDA A;  3BQ7 A;  2WFA A;  2UVV A;  4PHA A;  1MN8 A;  3NVV A;  1TV9 A;  2AH5 A;  1ZQT A;  4CCH A;  2KZ3 A;  1N56 A;  5IIL A;  4M04 A;  1V85 A;  4YMO A;  4XA5 A;  4US8 A;  3Q8M A;  5KFL A;  4R63 A;  1ZQS A;  2FDR A;  2H5X A;  2BCV A;  2HW3 A;  2XY7 A;  4M0A A;  4WJ3 B;  4QIW F;  5DQH A;  2ZIV B;  3D2S A;  4Z6E A;  2KNJ A;  3QU5 A;  3M9M B;  2KP7 A;  2JR5 A;  3OHA A;  2K4P A;  5H2F U;  4PGX A;  4DL4 A;  2EAP A;  2BHN A;  1IM4 A;  2NRT A;  5ALZ A;  3MR6 A;  4DLG A;  3TI0 A;  3H8M A;  2K8C B;  4F91 B;  3OJU A;  2XI9 A;  2W8K A;  3C29 A;  2XY6 A;  4J9L A;  3PW0 A;  4FZN A;  3T5L A;  2HDO A;  1JIH A;  2Y0S C;  1NJX A;  2R18 A;  2WAQ C;  2KHV A;  3KHG A;  2G08 A;  3PO4 A;  1MQ2 A;  2KKP A;  3L4P A;  5F9L A;  2F1H A;  3MBY A;  1L7O A;  1L7N A;  8ICV A;  8ICU A;  3RFA A;  1ZQX A;  8ICI A;  2GH1 A;  2VAN A;  1JX4 A;  8ICS A;  4O3M A;  5KFP A;  2FPM A;  2M0N A;  1NJY A;  4YCX A;  2MAX A;  1HJP A;  2ZTE A;  5AIC A;  8ICG A;  5KAF U;  4UB5 A;  5A0L A;  2Y9U A;  5DB8 A;  4RQ8 A;  2F1J A;  4G9B A;  1ED1 A;  5KFI A;  7ICM A;  4QNL A;  3BQT A;  2BCQ A;  1NKB A;  2D8C A;  1UQV A;  4TQS A;  3GIL A;  2MSN A;  2DFL A;  3RAX A;  2E8P A;  4DOB A;  3UM9 A;  4DS5 A;  5KFV A;  5ALV A;  5CEH A;  3UQ0 A;  4DOA A;  2EZY A;  2ZUB A;  5F3X B;  1V38 A;  8ICY A;  4MEY A;  4Z6F A;  4ACO A;  4MFF A;  1ZD5 A;  1N2X A;  4NY8 A;  2G5I B;  4PHE A;  4IQV A;  3G6V A;  5GTH U;  4F4Y A;  1BPX A;  5D4B A;  2K60 A;  2JZB A;  9ICH A;  4B6J A;  1FIQ A;  2YY6 A;  5KFF A;  3V72 A;  3H8J A;  1ZJN A;  1T7P A;  3HKZ C;  1ZRM A;  3NVY A;  2OWO A;  8ICO A;  2BCS A;  2KSO B;  4ECX A;  1KSP A;  2HHT A;  4YR3 A;  4IL6 U;  4RT2 A;  2BR0 A;  4JUZ A;  1NJZ A;  5J2J A;  1D8Y A;  5J0Q A;  1KFD A;  1KN5 A;  2PFO A;  4RQ4 A;  2ALZ A;  3BS7 A;  4C8L A;  3AMZ A;  4IQW A;  2YMQ A;  2HOF A;  3ZD9 A;  3OSP A;  2G0A A;  1ECW A;  2R8J A;  4DSL A;  1ZQZ A;  2P35 A;  3SEI A;  2W11 A;  3RJH A;  3FDS A;  3THV A;  8ICR A;  1BNO A;  1XSP A;  3KD3 A;  5J0X A;  3IN5 A;  2ZIU A;  5KFK A;  4O5C A;  3MGV A;  4UAT A;  5J0R A;  3TQ1 A;  3RH6 A;  4OJL A;  4DFJ A;  3CRX A;  3RH5 A;  9ICR A;  4BUG A;  2AQ0 A;  4QWB A;  4MHV A;  5EOZ A;  3BQ0 A;  2JEF A;  8ICT A;  4FBT A;  5ALE A;  2HHU A;  4B9T A;  9ICE A;  2QLT A;  5KFJ A;  4C8O A;  2KKV A;  3LWL A;  1SXD A;  5KG5 A;  3I76 A;  5KG0 A;  4GFJ A;  4ECR A;  2AGQ A;  4QZI A;  9ICI A;  2WB1 C;  5DB9 A;  3NVW A;  5J0W A;  4NL9 A;  4KTQ A;  4M9G A;  1CI4 A;  3B0X A;  4F8R A;  4EZ6 A;  8ICF A;  1S76 D;  4IR1 A;  2BQR A;  4Y2Y A;  4Y2Q A;  3K1R B;  3BQ1 A;  4BDP A;  1S8O A;  4ZH4 A;  2KFZ A;  1RQN A;  4R65 A;  2GLE A;  1L5U A;  2ZTC A;  2DKX A;  5DBA A;  1A0P A;  1D8L A;  3IM1 A;  4YMN A;  4K4H A;  1GO3 F;  3TAN A;  1U47 A;  3GZF A;  5D49 A;  2F8K A;  3L5K A;  1QCK A;  1NI3 A;  1JN3 A;  5TZV A;  4F2R A;  2ZIU B;  2A1J A;  2H3I A;  4C4S A;  4QZD A;  4F71 A;  5KFM A;  3CNH A;  4EYI B;  4AYB F;  2G07 A;  4QZ8 A;  4ZOH C;  1K1S A;  8ICP A;  4C8M A;  3M6K A;  4DEZ A;  1HUZ A;  3Q8R B;  3H0M B;  4KLS A;  3QEA Z;  5ALM A;  4R64 A;  2OHF A;  3UMB A;  4P4P A;  2BPF A;  2FJ6 A;  2XCP A;  2IMW P;  2XIC A;  3T5J A;  1SXE A;  4RUA A;  1NK4 A;  2JV3 A;  3BQ2 A;  5EE1 A;  4I2I A;  4RNO A;  2JRZ A;  4DFM A;  1QSS A;  5ALF A;  5ALU A;  3CW2 C;  1ZET A;  2HVI A;  2E8O A;  5ALJ A;  4QZH A;  1S0N A;  1ZQD A;  1U45 A;  5KFY A;  4U6P A;  2WF8 A;  2E1E A;  8ICX A;  3UPQ A;  1XC9 A;  2HBK A;  5J0S A;  2P66 A;  5HR6 A;  3N28 A;  3T3F A;  2H3Z A;  2DUY A;  2FMS A;  4CF3 A;  3B0Y A;  2EAN A;  3AU2 A;  4BWM A;  2DPI A;  5DDM A;  2YB4 A;  1JMS A;  5D46 A;  1WWV A;  4X5V A;  4JWN A;  1HUO A;  4RQ7 A;  1ZQO A;  4GLX A;  1YZ7 A;  4F3O A;  4O3R A;  1ARO P;  4OO1 J;  5DQG A;  3KZX A;  5EE9 A;  2CN1 A;  7ICF A;  3PX6 A;  4RQ3 A;  7ICE A;  1YZ6 A;  2W3S A;  4M6W A;  1ZYQ A;  7ICU A;  4PHP A;  1MSW D;  4ECU A;  3N4M B;  1SIJ A;  3PY8 A;  1DOQ A;  1J97 A;  1JI7 A;  4F5P A;  1T4G A;  1K1Q A;  2NYV A;  4UBC A;  5AI8 A;  5KL1 B;  4KLL A;  1DK2 A;  1QH9 A;  4P4O A;  1SL1 A;  1PK3 A;  1UT8 A;  2MU2 A;  3MR5 A;  1KEJ A;  3LYS A;  1ZQ1 C;  4M2Y A;  2ATL A;  2HI0 A;  2LKY A;  4ELV A;  3AUO A;  1ZQC A;  2HOI A;  4F92 B;  5AI6 A;  3H7I A;  4O5K A;  3ZDB A;  4P0P A;  1SV0 C;  3C28 A;  3PVX A;  4BXO A;  3TAD C;  3ZDA A;  3A0H U;  4CRX A;  3Q8L A;  4IR9 A;  2ZXH A;  5AKE A;  1X66 A;  4F4X A;  2KZZ A;  3PV8 A;  2A3V A;  2JMG A;  5KFD A;  4A8E A;  5HP4 A;  4KN4 A;  4RU9 A;  1X9S A;  2ZUC A;  1KFT A;  5AI5 A;  2W9M A;  1NZB A;  2IOF A;  4DSJ A;  2YX8 A;  2K4H A;  5ALK A;  4DS4 A;  2WTF A;  1L3S A;  5AHX A;  4J9K A;  3PX4 A;  1L3V A;  2KJ5 A;  2K8B B;  4NLG A;  4M6W B;  3QZ7 A;  2MA1 A;  2FPK A;  1PK1 B;  2YB1 A;  4ED8 A;  4KLG A;  4P0Q B;  3C21 A;  4HYK A;  5ALS A;  2FI1 A;  2HMX A;  4UAY A;  2RHF A;  2DPJ A;  4JV2 A;  3VC8 A;  5J0Y A;  2DBY A;  1MA7 A;  3EPG A;  3AN1 A;  3UXN A;  4F5R A;  2ZJA A;  3Q8S B;  2EH9 A;  3TAC B;  4XQ8 A;  4MF2 A;  5L1L A;  3HRD D;  2ZIX B;  3HWT A;  4IS7 A;  1COO A;  2ASJ A;  5AKX A;  2Q4T A;  3RRH A;  1ZD4 A;  3ZDC A;  4F72 A;  3KTQ A;  5CHG A;  5DG9 A;  5KG2 A;  2NO5 A;  5HR7 A;  5J8Y C;  3EZ5 A;  4DO9 A;  2ESE A;  8ICJ A;  1A6S A;  2EAO A;  1X42 A;  5BOM A;  3RJG A;  5AM5 A;  3C2M A;  1L8O A;  4NWI A;  3GIM A;  5AM2 A;  5KFR A;  1RZT A;  9ICT A;  2F3N A;  5ALI A;  7ICT A;  2XID A;  3QNM A;  1KKX A;  2B6G A;  4C80 A;  4IQT A;  3SV3 A;  4DQI A;  4DSK A;  7ICQ A;  2F44 A;  3BJY A;  2PFQ A;  1S10 A;  1S0O A;  4OJ5 A;  3FM9 A;  2OYY A;  3M8R A;  4M9L A;  2ZTD A;  4M9H A;  3S6J A;  3AM9 A;  5ALT A;  4EEY A;  9ICF A;  3JPS A;  2LMR A;  1ZXI A;  4DSI A;  1VLB A;  4FZM A;  4Y2R A;  2WF9 A;  5JU5 A;  2FMP A;  4Y2X A;  2IA6 A;  5ALX A;  5DBB A;  4J9S A;  4MFA A;  5IIM A;  1T3N A;  4TUQ A;  2UVR A;  4PHD A;  4QW8 A;  1KTQ A;  2D3D A;  4RNN A;  4OD0 A;  4C0Z A;  3RAQ A;  1PVP A;  1J2N A;  3F5A A;  3SD7 A;  1D8B A;  2LM4 A;  2EAM A;  4J9P A;  1ZD3 A;  9ICO A;  4NV0 A;  1NKC A;  4PL1 A;  5J2C A;  3EYZ A;  1H38 A;  2PI4 A;  2BQ3 A;  4QZA A;  1CRX A;  2Y1J A;  3ED5 A;  4J9R A;  3UXP A;  2MUT B;  1Z1V A;  2H3Q A;  3GU3 A;  4FBU A;  2OCE A;  1Z4N A;  3R9K A;  2WAQ F;  3LWM A;  4EX6 A;  5L9X A;  3RJE A;  2B0C A;  2W9C B;  2KOB A;  4K4I A;  1S77 D;  3K1Z A;  5KFN A;  5AK4 A;  2E8N A;  5DLG A;  8ICM A;  3KKA C;  1RDF A;  3CYM A;  4YXM A;  4ECV A;  2IBK A;  4XUS A;  4YFK A;  5KAI U;  1UCV A;  2ISO A;  8ICH A;  4DF8 A;  5JUM A;  1ZQW A;  2W03 A;  5ALG A;  1SL2 A;  4R66 A;  2KN7 A;  2KTQ A;  2VIX A;  4YMM A;  2F8L A;  1ZQQ A;  2W9B B;  1TAQ A;  5ALH A;  2CXY A;  4EZ9 A;  5IIK A;  3JPR A;  1ZQL A;  7ICO A;  2KSO A;  4DOC A;  5KTQ A;  4I2H A;  2LPE A;  4I2C A;  2KFN A;  3B9J A;  8ICZ A;  2JEJ A;  3PSI A;  4Q8E A;  2BPC A;  3H0L B;  4EBC A;  2QB0 B;  4EBE A;  4F4K A;  2Q0Z X;  3IV6 A;  4ECS A;  3O0F A;  5AKY A;  3TFS A;  1XU4 A;  1SB3 C;  1S9F A;  5J2F A;  2AXT U;  3IHQ B;  2W54 A;  5L1J A;  4J9M A;  3H8W A;  2F1I A;  3HKZ F;  1NJW A;  1DXS A;  3WK7 A;  4ECQ A;  2DF4 B;  5BPC A;  9ICS A;  5KG4 A;  1COK A;  3KBB A;  1FO4 A;  2OXO A;  2YMP A;  2ASL A;  4JWM A;  1L8L A;  3BS5 B;  3J81 j;  1ZQI A;  4OJP A;  3ZI4 A;  5J2I A;  2OH2 A;  3RB3 A;  3WK6 A;  4DSF A;  1NKE A;  4KLJ A;  1A77 A;  2YMM A;  4KX5 A;  3EW9 A;  3JPT A;  4USA A;  3RB6 A;  5AIB A;  3WK5 A;  1ZQG A;  1QQ5 A;  3ZDE A;  5ALY A;  2BCR A;  3SYZ A;  2F76 X;  4ELT A;  3F5E A;  1U9L A;  3PSF A;  4UBB A;  5J0T A;  4M47 A;  1B0X A;  4ECZ A;  2YN4 A;  1TVA A;  4YR0 A;  1ZQP A;  1UA0 A;  4UAZ A;  1SWW A;  1Z19 A;  1URJ A;  1X9M A;  5AKH A;  4QWA A;  2OM6 A;  2I5H A;  3ETL A;  5JTI A;  3TAR A;  1VDV A;  8ICW A;  5J0P A;  1MC8 A;  2KIC A;  3D2Q A;  3V6H A;  3U26 A;  5F9N A;  5KFA A;  2WB1 F;  5KT3 A;  2E5S A;  2VJ4 A;  1A76 A;  1XO0 A;  2BCU A;  1X2I A;  3QYP A;  4PL2 A;  1Z1B A;  3F2B A;  4KLO A;  2KV2 A;  3BZC A;  2ODG A;  4JV0 A;  1ZQK A;  1NK5 A;  1N61 A;  3PML A;  3RRG A;  5T14 A;  2NRV A;  2UVW A;  3RBD A;  2WF5 A;  3PW4 A;  4F50 A;  4YD2 A;  5C0Y A;  1Z3E B;  2YML A;  1NK9 A;  1RM6 C;  8ICN A;  1T8E A;  1N60 A;  4YD1 A;  4C4T A;  3NGD A;  1XSN A;  3QXG A;  3ORY A;  1S97 A;  3HW8 A;  3M7D A;  2HHS A;  3SQI A;  2W43 A;  1D9F A;  4YN4 A;  2ZUD A;  3M8S A;  5KFZ A;  5ALO A;  1QQ6 A;  8ICL A;  4O5E A;  3WKB A;  2RP5 A;  3C1Z A;  4M9N A;  4AP9 A;  3HX0 A;  4R8U A;  4EEN A;  3FC4 A;  1OW5 A;  5AM1 A;  2HSZ A;  3MC1 A;  4YQW A;  5III A;  3DDH A;  9ICB A;  4I2D A;  2I1Q A;  3QUT A;  3QUQ A;  4KMO B;  2W3R A;  4Q43 A;  3NS1 A;  7ICS A;  4TUR A;  4F4W A;  4I2G A;  5DG8 A;  4B9N A;  4QZF A;  3C23 A;  2RLT A;  1XNS A;  4EBD A;  4NLB A;  3QZ8 A;  5ALD A;  5ALQ A;  2LI6 A;  1ZQF A;  4RPX A;  4RPY A;  4PJ0 U;  3NRZ A;  2PKE A;  1S0V A;  7ICN A;  3T5H A;  1Q8K A;  3N7R C;  3EUB 2;  5K4L A;  5CA7 A;  4YG2 A;  2HBM A;  4CDG A;  1WCN A;  1SV0 A;  3IDW A;  4CF4 A;  1B43 A;  4MEX A;  1X9W A;  1N63 A;  2NV3 A;  4UAV A;  4B9L A;  2HHW A;  3M6Z A;  2DKZ A;  3WK8 A;  5AKZ A;  5KNI A;  3C5F A;  4R8U B;  1RXW A;  1BPE A;  4B9S A;  5KFE A;  4MFC A;  4QZC A;  1KDH A;  4Y2U A;  5AM0 A;  3TAQ A;  1Y88 A;  4LZG A;  5AKG A;  2KG5 A;  4F4Z A;  5DDY A;  4RUC A;  2K8A A;  4KMU A;  3GIK A;  4J9O A;  3DEE A;  1BVS A;  2HBL A;  5KFX A;  4EYH B;  2HVH A;  4EX7 A;  1S0M A;  3QEB Z;  5DBC A;  4UAW A;  2IOH A;  5J0U A;  5CJ7 A;  2PXI A;  2KZM A;  1PK1 A;  3TAP A;  2EQY A;  1X40 A;  3MAB A;  4P0Q A;  2QAR B;  1WCL A;  3C2L A;  2LYB A;  4F5O A;  4UAU A;  4NLK A;  3NAS A;  9ICK A;  4JK1 A;  3RB4 A;  2YTU A;  4RZR A;  2JEI A;  3GV5 B;  1JRO A;  8ICA A;  1IXR A;  2DQN B;  1ZJM A;  2ZIX A;  5J8Y A;  9ICU A;  3EPI A;  1ZQN A;  5CB1 A;  4RQ2 A;  1B22 A;  4KLE A;  3HP6 A;  4KX3 A;  1WYG A;  1JXE A;  4QW9 A;  1Q3V A;  2EZX A;  4P4M A;  2VKQ A;  1NK0 A;  4QWD A;  5J29 A;  3LVV A;  3IG5 A;  1RG6 A;  2NRW A;  4PH5 A;  1PVR A;  4RNM A;  2P6R A;  3OPX A;  2D6F C;  5ALN A;  2A1A A;  5AK6 A;  3KHL A;  4C8K A;  5ALL A;  4ECW A;  3QX7 A;  2I9G A;  1TK8 A;  2V9W A;  3GFK B;  5C5J A;  2JH7 A;  4Y2T A;  4O3O A;  3SAF A;  5DLF A;  1KQQ A;  1PVQ A;  4UW9 A;  4Q44 A;  2RDI A;  2W9A A;  4K4G A;  3AU6 A;  1RYR A;  1F0M A;  1YT3 A;  3WU2 U;  9ICM A;  1IG6 A;  5KT2 A;  2HCF A;  1ZQH A;  2K4E A;  1JXL A;  3OGU A;  3SEN A;  3SAG A;  3F53 A;  9ICG A;  2VJ5 A;  1XWL A;  4LZD A;  2AJQ A;  4YXJ A;  4NLC A;  2KMD A;  3H8S A;  3GV7 B;  1SGG A;  4J03 A;  4OJO A;  1KLN A;  5L1M A;  3ZDD A;  3C1Y A;  3PW2 A;  4FS1 A;  7ICL A;  9ICX A;  1NZP A;  1WWU A;  2BQU A;  2NO4 A;  1UT5 A;  3OSN A;  3RH4 A;  3N7P D;  4O3Q A;  2Z7J A;  4I29 A;  3AQF A;  1QSY A;  4RQ5 A;  2W04 A;  2VA2 A;  2JH1 A;  5DB7 A;  9ICW A;  4DL6 A;  1WG8 A;  4O3P A;  3SMV A;  1LKY B;  3LDA A;  4PGY A;  3WKD A;  4C7Z A;  4P2H A;  1RYU A;  4Y2V A;  2XGP A;  4Y2S A;  2KJ9 A;  3M9O B;  4GXK A;  2NRZ A;  4RQ1 A;  2MUT A;  3V7J A;  1B4F A;  1JUD A;  4FO6 A;  4ECT A;  2RDJ A;  3RTV A;  1RQL A;  3IRU A;  4DFD A;  2ES6 A;  3KKA A;  7ICG A;  2G09 A;  1ZQR A;  5AI9 A;  2C2D A;  5AIA A;  2ISP A;  1OXJ A;  2W9C A;  3SAH A;  1ZQU A;  1QTM A;  7ICJ A;  2W8L A;  3Q8Q B;  1L3U A;  2QKQ A;  5J2B A;  2E8M A;  2PMZ C;  3MR2 A;  1OUQ A;  3JPO A;  3DV9 A;  1QQ7 A;  1ZQJ A;  4DFK A;  2B21 A;  1U49 A;  5CRX A;  4B9V A;  2C2E A;  9ICV A;  1T94 A;  4Z6D A;  3H0R B;  2ZIW B;  3RR7 A;  4I2B A;  5IIO A;  3Q8P B;  2W9B A;  4C8N A;  2DL0 A;  8ICE A;  4FFD A;  4MF8 A;  1N48 A;  1ZRN A;  4CF5 A;  3M1Y A;  1BPD A;  4QZ9 A;  2GWS A;  4QZG A;  3PW7 A;  5J2G A;  1PUZ A;  5DGB A;  4ELU A;  3E2E A;  1F5S A;  4DQP A;  4KIT B;  5HHI A;  5AK5 A;  5CWR A;  1XO1 A;  1BPB A;  2CRX A;  4I2J A;  2PFN A;  2BDU A;  3QU4 A;  1XS9 D;  1Z00 B;  5HHH A;  2QB0 A;  4UQG A;  3RR8 A;  2Y0S F;  1XSL A;  5J0O A;  3H4D A;  1O08 A;  1T3Q A;  2BPG A;  3BDP A;  2DWQ A;  1TE2 A;  1S5L U;  3D2N A;  5KG1 A;  3MFH A;  5IIN A;  4DL5 A;  1N5W A;  1IIP A;  4TUS A;  5G5H A;  3HJE A;  5AI0 A;  5DB6 A;  2K4I A;  2UVU A;  3UMC A;  1UA1 A;  5J2D A;  4O9M A;  5IIJ A;  1SKS A;  5KFW A;  5ALP A;  5EE0 A;  1CUK A;  2AGP A;  3BS5 A;  2AHO B;  2P6U A;  2XVT A;  5JRT A;  2R8H A;  4YVZ A;  4QZB A;  1UHU A;  1U48 A;  9ICN A;  5DGA A;  3QE9 Y;  1HEK A;  2WF7 A;  4ED1 A;  2JGA A;  3FYH A;  1N62 A;  4KLF A;  1EXN A;  4QIW C;  1TAM A;  4F5N A;  3L3F X;  4FS2 A;  5DKW A;  4UB4 A;  1VJ5 A;  4JV1 A;  1BNP A;  4DCC A;  3IG8 A;  4DSE A;  2KE7 A;  4UB2 A;  1JAL A;  5AKL A;  3D6J A;  4RPZ A;  1O03 A;  2BDP A;  3TKA A;  2ZG6 A;  7ICI A;  2W55 A;  3HPO A;  4LJX A;  3I28 A;  4M9J A;  2QB1 A;  4B9U A;  1C20 A;  1J2M A;  2R8G A;  4I2E A;  4NM1 A;  5CR0 A;  4OCZ A;  2ZJ5 A;  2N1R A;  2RQ5 A;  5J2K A;  3AQE A;  3PMN A;  2J6U A;  3T79 A;  2PI5 A;  3ISB A;  3KOO A;  2KVS A;  4UAR A;  2BGW A;  1TAU A;  1X6J A;  1KL9 A;  1FFU A;  5KFS A;  4F5Q A;  2Y1I A;  3RB0 A;  2H3V A;  3SZ2 A;  1P7D A;  2KEY A;  2PFP A;  3EWA A;  5G5G A;  3MFI A;  4GC7 A;  4ED2 A;  3QU2 A;  4FZL A;  2AU0 A;  4DQR A;  4IQU A;  1MQ3 A;  8ICC A;  1FFV A;  2ZJ8 A;  4F93 B;  2YQE A;  3JPP A;  4E0D A;  4RQM A;  4DL3 A;  4GIB A;  3GII A;  4EEK A;  1RYS A;  3NTU A;  2CPR A;  4EEL A;  3RBE A;  4KLU A;  5BOL A;  5B66 U;  1U4B A;  4HAI A;  4PZO A;  3JPQ A;  4Y2P A;  4I2A A;  4I2F A;  3ZD8 A;  3C2K A;  4J9N A;  3RF9 A;  3V7L A;  4KLD A;  1KW4 A;  4RQ0 A;  2KJ8 A;  1WUD A;  4NLZ A;  4Z6C A;  5ALW A;  4ED3 A;  4IRC A;  1FEZ A;  1TFR A;  1DK3 A;  1Z4O A;  8ICK A;  4ED0 A;  4NM2 A;  2JZB B;  2V4Q A;  5KFO A;  4KLH A;  1D9D A;  1ZQE A;  1X6I A;  2XC9 A;  1DGJ A;  3T5K A;  4TUP A;  4GXJ A;  4YR2 A;  2ZXI A;  1C7Y A;  2OEH A;  2JHD A;  3QU7 A;  5EWE A;  2VA3 A;  3AL0 B;  5KFT A;  4UB1 A;  4IRK A;  1AQ6 A;  3IP4 B;  3MR3 A;  3F2C A;  1M6Y A;  2ASD A;  1SZP A;  2AQ4 A;  3K75 D;  5ALR A;  1SKW A;  4DLE A;  4BX9 C;  1HIW A;  3MGI A;  1L6N A;  1L7M A;  4O0I A;  2W7P A;  4KLT A;  4NLN A;  2E3T A;  3CP8 A;  4ED7 A;  1BPY A;  1V97 A;  2IHN A;  4LVS A;  5EE3 A;  2J6T A;  4B9M A;  1F44 A;  2JEG A;  5KFU A;  4ED6 A;  5AK3 A;  3G6Y A;  1RXV A;  2KK0 A;  5J2A A;  4I27 A;  3PZP A;  5DG7 A;  3PSP A;  2FE9 A;  2W7O A;  3WKA A;  2LBO A;  4QJF B;  2QAR A;  4Q45 A;  2L5Y A;  4KLM A;  3TFR A;  5KFQ A;  2HHQ A;  4FE3 A;  2HOQ A;  5EWF A;  5J2E A;  1CEZ A;  2WHE A;  1V9P A;  2O6K A;  1TK5 A;  3TAD A;  4GC6 A;  9ICA A;  3NUQ A;  1NOM A;  2FPL A;  5B5E U;  2LYH A;  3GDX A;  3OJS A;  5AKK A;  1QSL A;  1UPH A;  4BGD A;  4AYB C;  4IRD A;  1TKD A;  4YP3 A;  2FLN A;  3PST A;  7ICP A;  4G3I A;  4DQQ A;  4UAS A;  1SV4 A;  3MDC A;  2VA8 A;  2C2R A;  4KN7 A;  3PW5 A;  4NL9 C;  3V6K A;  1Q46 A;  4NJ8 A;  8ICB A;  5KT6 A;  4ICA A;  1JRP A;  1L7P A;  1BPZ A;  3RJK A;  3WKE A;  4UB8 U;  2IHM A;  4KLI A;  3H4B A;  2K89 A;  2J6S A;  4QWC A;  4QWE A;  5AM4 A;  2A1J B;  3GIJ A;  4GXI A;  5KFH A;  2FLL A;  3BZK A;  1QLN A;  2H3F A;  4US9 A;  3PNC A;  3QUB A;  3ONN A;  3H40 A;  2KIW A;  4RT3 A;  1NK7 A;  1KBU A;  1Q3U A;  2KHQ A;  3GQC A;  4O3S A;  9ICC A;  3ALR A;  3NRW A;  4DQS A;  1LV5 A;  5FP0 A;  3G6X A;  1ZQB A;  3Q8K A;  1X9X A;  4I28 A;  1LB2 B;  5HMM A;  3GV8 B;  4JB3 A;  3V6J A;  7ICV A;  1RPL A;  2GO7 A;  2EZZ A;  3QU9 A;  3PR5 B;  2WF6 A;  1NNL A;  2AGO A;  4IC9 A;  3SR6 A;  4C4R A;  5KFC A;  1BGX T;  3C5G A;  7ICH A;  1LKY A;  1TK0 A;  1SZH A;  3ETR A;  1KRP A;  9ICJ A;  2HBJ A;  2XCA A;  3LVW A;  1ZQY A;  1K5O A;  2BZF A;  5J2H A;  5AM3 A;  2IOF K;  4PPX A;  3AEV A;  5DQI A;  3N7S C;  4U7C A;  3QUC A;  2EDU A;  2XGQ A;  5CP2 A;  4PGQ A;  2JXJ A;  1N5X A;  3RJI A;  5AI4 A;  5EWG A;  5KT4 A;  2FLP A;  1SWV A;  3UXO A;  1KFS A;  3UMG A;  3MGH A;  2C28 A;  5L1K A;  3HT3 A;  1ZQM A;  1DGS A;  3KFU F;  4CNQ A;  3SI8 A; 
#chains in the Genus database with same CATH homology
 1ED1 A;  3F2C A;  2LYA A;  4QNL A;  2DQN B;  2F8L A;  2JMG A;  2A3V A;  4A8E A;  1IIP A;  2ZIX A;  2H3V A;  3F2D A;  1P7D A;  2KEY A;  2KIC A;  3D2Q A;  2KKV A;  2MRL A;  4BJQ A;  4U6P A;  2E1E A;  2K4I A;  2KJ9 A;  3VCB A;  2H3F A;  1NZB A;  4FZM A;  3N7R C;  1DRG A;  4BX9 C;  2HBK A;  4KX3 A;  1HIW A;  2WB1 F;  2YX8 A;  1L6N A;  4GFJ A;  4FZL A;  2E5S A;  2K4H A;  2VJ4 A;  2ZIW A;  1XO0 A;  2W7P A;  1Q3V A;  2WB1 C;  3ONN A;  4PL2 A;  2KIW A;  2VKQ A;  3CP8 A;  1Z1B A;  5HR6 A;  3F2B A;  2HBM A;  4CDG A;  4ACO A;  1KBU A;  3LVV A;  2KV2 A;  2H3Z A;  2KHQ A;  3IG5 A;  1Q3U A;  3PSI A;  2KJ5 A;  2K8B B;  2G09 A;  1PVR A;  2MA1 A;  2XVT A;  1F44 A;  3H0L B;  3OPX A;  2YB1 A;  2DGZ A;  2YB4 A;  3ALR A;  2G5I B;  4P0Q B;  2D6F C;  2NV3 A;  3E0F A;  3NRW A;  4P0P B;  1HEK A;  2KVC A;  4C0Z A;  1PVP A;  2HMX A;  3SAH A;  3O0F A;  2RHF A;  4CGZ A;  2JGA A;  3F5A A;  3M6Z A;  3PZP A;  4WJ3 B;  1D8B A;  2CPR A;  2PMZ F;  4QIW F;  3VC8 A;  4JMU A;  3PSP A;  1MA7 A;  2ZIV B;  2W7O A;  3D2S A;  5T14 A;  2PMZ C;  4QIW C;  4OO1 J;  2RRD A;  2JH7 A;  1A0P A;  2LBO A;  2KNJ A;  4QJF B;  3SAF A;  1TAM A;  3KFU F;  3KZX A;  1PVQ A;  3L3F X;  1OUQ A;  5C0Y A;  3HKZ F;  4FE3 A;  2G06 A;  2HOQ A;  1GO3 F;  2CN1 A;  4IC9 A;  4NV0 A;  2ZIX B;  3HKZ C;  5CRX A;  3GZF A;  1YT3 A;  4PL1 A;  2KD1 A;  2DF4 B;  1SZH A;  2LHT A;  2Q4T A;  2HBJ A;  1CRX A;  3IG8 A;  2K4E A;  3LVW A;  2E1F A;  3NUQ A;  2ZIU B;  2K8C B;  3M7D A;  1T94 A;  3RF9 A;  2OXO A;  2XI9 A;  2ZIW B;  3H0R B;  2K8A A;  2H3Q A;  2H3I A;  3SAG A;  3F53 A;  2OYY A;  3C29 A;  3SQI A;  3GU3 A;  4FZN A;  2VJ5 A;  2Y0S C;  3DEE A;  2G07 A;  2WAQ F;  2F2A B;  2HBL A;  1WUD A;  2KJ8 A;  4AYB F;  5HR7 A;  4OJP A;  1UPH A;  2OM6 A;  2RP5 A;  2R18 A;  2ZIV A;  2WAQ C;  4AYB C;  2KHV A;  5KL8 B;  2ZG6 A;  2G08 A;  5KL1 B;  4NLC A;  1A6S A;  2KKP A;  3N7S C;  3M6K A;  2OH2 A;  3H0M B;  4U7C A;  3PST A;  4OJO A;  2HOF A;  3LYS A;  2G0A A;  1ECW A;  1ZQ1 C;  2KOB A;  4KX5 A;  4NWI A;  3RFA A;  2CRX A;  2LKY A;  2GH1 A;  3K1Z A;  2HOI A;  2GOL A;  2F77 X;  2BDU A;  3ICX A;  4OJ6 A;  4KMO B;  4O3M A;  2XIC A;  4P0Q A;  2F76 X;  2N1R A;  4P0P A;  3F5E A;  3CYM A;  2XID A;  3N7P D;  3IN5 A;  2M0N A;  2ZIU A;  2Z7J A;  2Y0S F;  3PSF A;  3AQF A;  2LYB A;  4ICA A;  3MGV A;  3AQE A;  2W04 A;  3C28 A;  3T79 A;  2JH1 A;  2ZXI A;  4CRX A;  2G5H B;  2JHD A;  2ZXH A;  4OJL A;  3SMV A;  1Z19 A;  3CRX A;  1URJ A;  1XNS A;  3AL0 B;  2W03 A;  4NLB A;  4OJ5 A;  3D2N A;  4BUG A;  5A0L A;  2K89 A;  2VIX A;  3IP4 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...