2MA1A

Solution structure of hrdc1 domain of recq helicase from deinococcus radiodurans
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
75
structure length
75
Chain Sequence
HDAPLFEALRAWRLQKAKELSLPPYTIFHDATLKTIAELRPGSHATLGTVSGVGGRKLAAYGDEVLQVVRDSSGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title NMR structure of the N-terminal-most HRDC1 domain of RecQ helicase from Deinococcus radiodurans
rcsb
source organism Deinococcus radiodurans
molecule tags Dna binding protein
molecule keywords DNA helicase RecQ
total genus 20
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2013-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00570 HRDC HRDC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.80 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2ma1A00
1D8BA 2HBLA 4QJFB 4CGZA 2RHFA 3CYMA 4CDGA 2DGZA 3SAFA 2HBKA 2E1FA 5C0YA 2HBMA 2HBJA 4NLBA 2CPRA 4OO1J 1YT3A 2RRDA 3SAHA 2MA1A 1WUDA 2KV2A 1GO3F 4QIWF 4O3MA 4NLCA 2E1EA 3SAGA
chains in the Genus database with same CATH superfamily
4RQ1A 4J9OA 2WB1F 4IQWA 8ICWA 4DLGA 5KAIU 3RJGA 4J9SA 3C1ZA 5KFYA 5DBAA 5KT3A 1UT8A 2YB1A 1U48A 3BS5A 4M9GA 1FIQA 4DOCA 4NLGA 3SAHA 1IIPA 5D46A 3ISCA 3CW2C 3PMNA 3BQ1A 3NS1A 1H38A 3SAGA 2XGPA 2ZIXB 3SYZA 3KHRA 4KN4A 2HBLA 1L6NA 3EW9A 4Z6CA 8ICKA 3DDHA 2Y0SF 4B9LA 2ZJ5A 2IA6A 1RYUA 3IM1A 4QWAA 2W7PA 4RU9A 4P4PA 3Q8MA 4OCZA 8ICAA 3VCBA 2Q0ZX 3HP6A 2KFNA 3RH5A 5KFHA 4DOAA 1UT5A 3GV7B 3MR6A 1A6SA 3HKZC 3KHGA 3CYMA 5EWGA 1V85A 3ZDDA 2AU0A 2ISOA 7ICQA 3IHQB 3S6JA 2Y1JA 1JX4A 4NL9A 3N28A 2QB0B 4IQVA 4IRKA 4KMUA 2BPCA 4ECYA 2RP5A 9ICRA 2KK0A 2NRWA 2DKXA 2HHSA 5BPCA 4O3PA 4RNNA 3ZD9A 3D2SA 2R8HA 1BNOA 1HUOA 3JPOA 3WK7A 4GC7A 4F4YA 4RQ8A 1L7PA 4DFJA 3TAQA 4Y2TA 5KFVA 4AP9A 3WK5A 1BPEA 4KX5A 4F92B 4UBBA 5KFWA 3PO4A 4LZDA 4HAIA 5CHGA 2F76X 9ICSA 4DF4A 4DQPA 5ALFA 4QWBA 2L5YA 1N48A 2F2AB 2W9MA 1KRPA 3LWMA 5D4BA 4FFDA 8ICTA 3H4DA 1ZQWA 4Z6EA 3Q8RB 4B9MA 1Y88A 5IIMA 2JH7A 2DPJA 4KLFA 9ICTA 1X42A 4KMOB 4O3OA 3EWAA 4NM2A 2ZIVB 5KT5A 2LM4A 2H5XA 4FO6A 4YFKA 3F53A 5J0UA 5J8YA 3ETLA 2ZTCA 2W54A 5K4LA 2FMQA 1N2XA 5AICA 4MFCA 5EE1A 5AKXA 4ECQA 3CRXA 3KOOA 4Y2UA 3RTVA 4ZH4A 3ZI4A 2D3DA 2B21A 1RQNA 4O3SA 3NGDA 5J0SA 1ZQOA 3H7IA 8ICYA 2XGQA 3AUOA 5AI4A 3UQ2A 2PKEA 4J9MA 2EANA 5DBCA 5H2FU 3KZXA 4K4HA 1FEZA 2KHQA 2H3QA 9ICXA 5ALKA 1NKBA 2E8MA 2DUYA 4EYIB 4GIBA 5EWFA 2KP7A 5KG3A 4ECVA 2FLPA 4EBEA 3RJEA 5EE0A 2K8CB 1MC8A 4OJ6A 2ZIUA 2ZTDA 4ED2A 1D8LA 2BR0A 3QU4A 2AQ4A 2KD1A 2PFQA 8ICEA 4QIWF 4IL6U 5KNIA 3QUCA 5ALXA 2Z7JA 3DV9A 1FO4A 3NTUA 8ICHA 5AK4A 4XA5A 4BGDA 2I6XA 4YR0A 3RR7A 1IG6A 2XI9A 2WTFA 4ELTA 1RG6A 4R66A 2AGQA 4Y2RA 2M0NA 3C1YA 3NRZA 3SI8A 3KHHA 1CUKA 4PZOA 2GLEA 5AHXA 4F4XA 2JXJA 3PMLA 9ICEA 2BCVA 2E1EA 3AL0B 4DFMA 8ICQA 4M9HA 4USAA 4JWMA 3M9OB 9ICMA 5KG0A 4F4WA 2V4QA 4FBTA 4PL2A 4PHPA 2LM1A 1SV0A 4U6PA 2IOHA 1YZ7A 4YMMA 5AM4A 5KFEA 4IRCA 4ED0A 2KHVA 4DO9A 4JV1A 3RJFA 2H3VA 2R18A 4DFDA 2E8NA 4NLKA 3C23A 3LYSA 4F5PA 4YG2A 3JPNA 3AU6A 1KW4A 4FZNA 4FZMA 1IM4A 2R8GA 3T5KA 1MQ2A 2JEJA 9ICUA 3T5HA 1TE2A 5CJ7A 3RH6A 4M47A 2ZIVA 5AKEA 1SL0A 1OXJA 1ZD5A 1N56A 4QJFB 2NV3A 1T8EA 1XO1A 1KTQA 2NRTA 1KLNA 1QCKA 3MFIA 4DQSA 4LVSA 4DS4A 1N62A 1TK5A 2PFNA 1SKSA 2BGWA 3MBYA 4O5KA 2KE7A 3LK9A 2DPIA 1HIWA 4KLLA 3CP8A 2XY5A 1NJYA 4FZLA 4DL3A 3QU2A 4F3OA 2G5HB 4F72A 2ATLA 3TADC 5ALSA 2MSNA 3RAQA 4P2HA 1XNSA 4K4IA 4DQQA 2LI6A 1D9DA 3I76A 3HJEA 3M1YA 5AKYA 5KFPA 2PFOA 4F2SA 2R8IA 1A0PA 2H3ZA 3J81j 9ICHA 3QNMA 5AM5A 3TACB 3N7SC 4BWMA 4MEXA 5AI0A 1JROA 3RRHA 3LVWA 4YCXA 3N7PD 1SV4A 2CRXA 4DL7A 3SV3A 5DQGA 2DWQA 3NASA 4BDPA 1KQQA 4BX9C 2A3VA 4ELUA 3PW0A 5BOLA 5L1LA 1BPBA 1J97A 2EAMA 4E0DA 1YT3A 1DXSA 2K89A 4PZNA 4XQ8A 4KLHA 4KITB 2I1QA 5EE9A 4OJ5A 3PO5A 4DL5A 2V4RA 1LKYB 2LMRA 4J9RA 1ECWA 2HSZA 2UVWA 4GFJA 1B43A 4C7ZA 1U45A 4C7YA 2HCFA 2AGPA 1NK6A 5DG7A 1JALA 5ALZA 3TFSA 3ZDCA 2PMZF 4CE6A 5KG7A 1ZQNA 1PVQA 4IQUA 4F5NA 5J2EA 5KFXA 4TQRA 3UXNA 3KTQA 2BCSA 4C80A 1UCVA 4TQSA 3E0FA 2ALZA 4KLUA 3QXGA 4US9A 1JI7A 5AIBA 1KFSA 1Z3EB 2KV2A 4DLEA 1LVHA 1ZQSA 1ZRMA 3QE9Y 2RLTA 2FMPA 2E8OA 1ED1A 7ICRA 1S0VA 4JMUA 2H3IA 3FYHA 4QW8A 4ED7A 5KFOA 2G07A 4Y2VA 2KEYA 4OJPA 4I27A 3QYPA 3RFAA 4YMOA 4UB3A 1JIHA 8ICFA 2A19A 2W9CB 4NL9C 1N61A 2ZUBA 1X66A 1T3NA 4YMNA 5CWRA 2EZYA 1NK7A 4LZGA 4GXIA 2JEIA 2AJQA 3RB4A 8ICGA 4CRXA 5TISU 5AKJA 4O3MA 5AM1A 3TAPA 3K75D 4B6JA 7ICLA 4QWCA 1X40A 3ZD8A 2JEFA 5CEHA 1VDVA 3BJYA 2IOFA 3OJUA 5HMMA 3FM9A 2HOIA 1ZQ1C 4J9KA 4KLEA 2ZJAA 4IRDA 1L3UA 5KT7A 3ISDA 2YMQA 3H0RB 1ZQCA 1ZQIA 4ZOHC 4DL4A 1KDHA 2OXOA 5KFFA 2BPFA 8ICCA 3OPXA 5DLFA 1NK9A 2YN4A 3WK4A 5JRTA 4NY8A 2IHNA 1S8OA 3QU9A 1QQ5A 3MDAA 2XY6A 3MGIA 5F9NA 2ASJA 3K1ZA 2EH9A 3SR6A 3HW8A 5T14A 2W9CA 5AKKA 4YXMA 4KLIA 3PX0A 5JU5A 5AKZA 3UMGA 1DOQA 5CA7A 1ZQMA 2W43A 3LWLA 4C4TA 2F1IA 3BQTA 5J0WA 2JH1A 3M9NB 1BPYA 4ACOA 2ZUDA 5KT4A 1K5OA 2CXYA 4PL1A 5ALOA 7ICJA 1NOMA 1HEKA 1WCNA 1ZD4A 4B9UA 3RAXA 3SZ2A 1QLNA 5AKHA 1L7NA 3AEVA 2ZIWB 5AK6A 2WF7A 4EEYA 4RPZA 2OWOA 3OTQA 3IN5A 4DQRA 2C22A 4RQMA 3WKBA 4CF4A 5DQIA 3SEIA 2W9BB 1ZQRA 3C2MA 2JGAA 4FE3A 1BPXA 4DF8A 5IIIA 1SL2A 2VJ5A 5IILA 4KLQA 3V7LA 1L7MA 2YY6A 5HHIA 2UVUA 4J9PA 5JTIA 1DRGA 1T94A 9ICKA 1RM6C 4M6WA 4CDGA 2FMSA 4Y2QA 1TAUA 9ICIA 3JPRA 2W9AA 3V6JA 3WK8A 2F3NA 2G08A 4F50A 7ICKA 2KKPA 2YB4A 2KJ9A 4JV2A 1NNLA 4RQ5A 4CGZA 1KKXA 1TK0A 4C4RA 2QKQA 3T5LA 4ECUA 2F8LA 5ALRA 5HNKA 5B5EU 2P66A 1ZETA 5DG9A 1XSPA 4DL2A 1PK1B 3V7KA 3TADA 1X6JA 3WU2U 1L3TA 3HPOA 2OH2A 4GLXA 4C8LA 4CNQA 1XSNA 3IRUA 4C8KA 3EYZA 1NZBA 4UB8U 4NLCA 3RJJA 2WF6A 5KFGA 1D8BA 2F1HA 4PPXA 3QUTA 5KFNA 1Z00B 2HOFA 4MFAA 2KSOA 3HX0A 3KZIU 2YMMA 2WHEA 4F4ZA 2EZZA 2BQ3A 3EPGA 3WK9A 1URJA 2KFZA 4FS2A 2ZXHA 5AM3A 4DL6A 1ZQFA 5KFSA 3GILA 3GIIA 1QTMA 1JUDA 1F44A 1B4FA 5ALQA 3C5FA 2HDOA 3DEEA 1JN3A 2NRXA 1BPZA 1UPHA 1N63A 5TZVA 2ZXIA 4IS7A 1A77A 5L9XA 2NRVA 2KZMA 2HBJA 5GTIU 4DEZA 4P0PA 2WF5A 4QZ9A 3A0BU 1AQ6A 2B0CA 3MDCA 1L5UA 8ICPA 2P35A 2W03A 3ETRA 4Y2PA 2KTQA 5AKLA 2BHNA 2HHXA 1N60A 2IBKA 5ALDA 2ZJ8A 5KG2A 2BCQA 2JMGA 3G6XA 2EQYA 3RRGA 5C0YA 2H3FA 5J2GA 3ISBA 1ZQLA 3Q8SB 5A0LA 1PK1A 4KLGA 4DSEA 5DQHA 5ALGA 4IC9A 1ZYQA 7ICPA 4YXJA 4Q8EA 8ICRA 4UBCA 5J0YA 1Q3UA 4F93B 1PK3A 5KG4A 4RNOA 4DS5A 4YR2A 5EWEA 3EZ5A 5ALNA 5KT2A 1Q3VA 3IV6A 5DDYA 1XO0A 1D8YA 4ECRA 4PGYA 5DDMA 3TKAA 2FE9A 4PHAA 2Q4TA 7ICHA 2HHUA 4DCCA 2FJ6A 3BS7A 1L3VA 1LB2B 1SGGA 3Q8LA 8ICZA 3PSTA 5CRXA 1NK4A 4BXOA 5C5JA 3PW2A 2XC9A 1J2MA 4M9JA 4NLZA 1O03A 9ICCA 3PX6A 1MA7A 1S0NA 5KFBA 3OHAA 4B9NA 3ICXA 1Z4NA 3PW5A 2F1JA 8ICUA 2W04A 1QSLA 1KFDA 2WFAA 1WWUA 2OCEA 3H0MB 4ECSA 5J0OA 1UA1A 2HW3A 2JHDA 5KFDA 1UA0A 4F8RA 4KN7A 4QZBA 9ICAA 2RQ5A 2M9NA 3MR5A 1ZQUA 4J9LA 2K4PA 4JB3A 4DSFA 4QWEA 1NZPA 2XIDA 4Y2JA 3PY8A 2W3SA 3AMZA 3RB3A 3L5KA 5ALHA 5AM0A 1KL9A 4EELA 9ICLA 7ICOA 5J2DA 3H8WA 3BQ7A 2W11A 3KBBA 1UQVA 4A8EA 2UVRA 5ALYA 2W9BA 2KJ8A 3B9JA 4R8UA 4M9NA 2KVCA 2NO4A 3MC1A 5DB7A 2KIVA 4NLBA 2XY7A 2HHTA 1XC9A 4DSIA 2RRDA 2MUTA 3JPQA 4F5OA 1FFVA 4QZCA 4P0QA 2P6UA 2KMDA 3PSIA 5ALIA 4QZ8A 1RXWA 4US8A 1P7DA 1ZQTA 2XICA 2IHMA 1SIJA 4R64A 1TVAA 3L3FX 3M6ZA 2YMLA 4EENA 4KLDA 2HVIA 1NKEA 3O0FA 2G09A 5J0XA 1NK5A 2J6UA 3RR8A 3OGUA 2V9WA 1SXDA 3JPTA 5DB6A 4UQGA 3RH4A 3RBDA 2BZFA 1IV8A 3GIJA 2HI0A 4F91B 4UAYA 5KT6A 2JRZA 4JK1A 3Q8QB 2YMPA 3RB6A 2LYAA 1C7YA 1ZJNA 3PR5B 3QU5A 4KLOA 2YQEA 3PV8A 1SXEA 1SKWA 4K4GA 3F2CA 1RPLA 1T7PA 1SWVA 3WKDA 5AI6A 1V9PA 1DGSA 5L1KA 4F4KA 2KVSA 3KHLA 1OW5A 2RDJA 1SZPA 1KEJA 2QLTA 1SKRA 2JZBA 4MEYA 3QZ8A 2C28A 2N1RA 1MSWD 4F5RA 1TAMA 2BQUA 7ICIA 7ICSA 4YQWA 4QZGA 2KSOB 8ICVA 4ICAA 1MN8A 4I2CA 5J29A 3JPSA 3ZDAA 2BCUA 2KNJA 5KFIA 5HP4A 4NWIA 2KIWA 2ZIXA 5J2CA 2KN7A 3B0XA 1FFUA 2KICA 3H4BA 3V6KA 4NLNA 2VANA 3MGHA 2FPMA 2A1AA 4I2GA 2LYHA 8ICSA 4P0QB 2DKZA 2LHTA 4QWDA 4NXZA 4C8NA 4RT2A 3BZKA 1RYSA 2W3RA 1TFRA 4AYBF 9ICQA 1COKA 1KN5A 2BPGA 4RQNA 2HMXA 1U49A 2FI1A 3Q8PB 3PVXA 1A76A 1ZOLA 1TV9A 1EXNA 2UVVA 3GIKA 1BGXT 4C0ZA 5ALWA 2W7OA 2OM6A 3K1RB 4I2BA 2G06A 2J6TA 4P0PB 3C5GA 5KFCA 3M8RA 8ICJA 4QZEA 5HR6A 3VC8A 4KLTA 4EYHB 1QH9A 1RXVA 5KFTA 4DSLA 2OHFA 4EBCA 4CF5A 4R8UB 2KJ5A 3JPPA 1PZNA 5CB1A 2KZ3A 2WF9A 4AYBC 3V7JA 5F3XB 2C2EA 1KSPA 3AN1A 4XRHA 2E1FA 4IQTA 4U7CA 4UAUA 4I2HA 3IDWA 4PGXA 4FBUA 2DF4B 3RBEA 4M9LA 3M7DA 3I28A 3WKEA 5FP0A 1QQ6A 2RHFA 4UAVA 2ZTEA 4RPYA 3TARA 4QZFA 5J2IA 2EAOA 3UPQA 1NJXA 3OSNA 5KL1B 4QW9A 4ED6A 1DK3A 1T4GA 1B22A 7ICUA 1K1QA 4JUZA 1Q46A 2XVTA 4BWJA 4B9TA 4TURA 2W8KA 4KLJA 3RF9A 2P6RA 4O3NA 3EPIA 1J2NA 8ICXA 5KFRA 2HBKA 2VA3A 1N5WA 5CP2A 2F8KA 2K4HA 5J8YC 5EOZA 4DFPA 1V97A 4NV0A 2ISPA 4MHVA 2GWSA 2FLNA 2I9GA 4Q43A 3A0HU 4MFFA 4O3QA 2JV3A 4PH5A 1ZD2P 4DSKA 3C2KA 4NM1A 3PZPA 3E58A 2QARB 1M6YA 4RQ6A 1ZQVA 3G6YA 1NI3A 1X9WA 2MUTB 1V38A 1WYGA 1CEZA 1F5SA 5BOMA 2AGOA 1JMSA 4YD2A 2YX8A 1XU4A 3NVVA 5J0PA 1RZTA 3FDSA 4JV0A 1SL1A 4O5CA 2R8KA 4R65A 3D2NA 5J2AA 2ZIUB 2QB0A 1KFTA 4RPXA 5ALUA 1X2IA 1ZJMA 2KZZA 2GOLA 3Q8KA 4QIWC 2PXIA 5ALMA 2EDUA 3OJSA 1S0OA 2PI5A 3LVVA 4UARA 2A1JA 4R63A 4KLSA 1RQLA 5KFAA 3BS5B 4RQ0A 1VJ5A 5J2FA 3QUQA 1B0XA 1QSYA 7ICEA 1Z4OA 2MA1A 2BCRA 2FLLA 1COOA 5KTQA 1S5LU 2XCPA 3H8SA 2K4IA 4QZHA 1ZRNA 5AI5A 1PVRA 1L7OA 5DGAA 3SMVA 4YD1A 3SENA 1ZQQA 3C21A 7ICTA 1X9SA 4QZAA 1QSSA 4UB2A 5IIKA 2Y0SC 2NRZA 2BDPA 3LDAA 3MABA 1CRXA 4B9SA 3IG8A 1S0MA 5KG1A 5AK3A 3NVZA 1PVPA 1UHUA 5ALPA 1IXRA 4RUAA 1ZQBA 2WAQF 2AH5A 2CPRA 1ZQAA 2E5SA 1XSLA 5KG5A 3BZCA 4M6WB 1CI4A 3RJIA 1ZXIA 5ALEA 3SD7A 4ED1A 9ICFA 2QARA 1DK2A 1ZQEA 3PSFA 9ICGA 1TKDA 5DG8A 5DB9A 8ICBA 4UB4A 1X9XA 2JR5A 2QB1A 2DFLA 3NRWA 4CF3A 9ICJA 4I2DA 3QUBA 5HHHA 4ECTA 1NK0A 3E2EA 1ZQJA 3AM9A 4I2JA 3N4MB 3ORYA 4ECXA 4J9NA 3B0YA 2ESEA 2KOBA 5KFMA 3MFHA 1T3QA 4PGQA 2WF8A 9ICNA 5HMLA 3AU2A 3KKAC 5F9LA 1WCLA 4XUSA 1Z00A 4UATA 2Y1IA 1HJPA 2A1JB 3H40A 2DBYA 4YVZA 4RQ4A 5HR7A 2AHOB 3GFKB 5G5GA 3KFUF 2G0AA 3D6JA 3V72A 2D6FC 3QZ7A 3TANA 4I2EA 3GDXA 1L8LA 5AIAA 3TI0A 2JEGA 4DFKA 7ICGA 3T5JA 3PW7A 3D2QA 2VIXA 2ASLA 4RUCA 3FAHA 2PFPA 2MU2A 2WB1C 3L4PA 1LKYA 2MAXA 1TK8A 2W55A 2NYVA 3ALRA 3F5AA 3IP4B 5L1IA 4I2FA 1S97A 2XCAA 4IR1A 5IIJA 1O08A 2PMZC 1U47A 2JZBB 3UXOA 5L1MA 4NJ8A 7ICVA 2K8AA 5ALLA 3GQCA 2OEHA 5AM2A 3WKCA 4F2RA 1JXLA 3HKZF 1KBUA 2BDUA 1ZQDA 3I1YA 2W8LA 8ICMA 2LYBA 2C2RA 1XS9D 2HHVA 4UAWA 2IOFK 1ZD3A 3QEBZ 1RYRA 2Y9TA 2F77X 7ICNA 4EZ6A 4YN4A 1SWWA 2Y9UA 2ZIWA 2R8JA 3QEAZ 5AI8A 4IR9A 2EZXA 5J2JA 3EUB2 4OO1J 1X9MA 3PW4A 8ICIA 3GV5B 1JRPA 3IG5A 4UB1A 2LPEA 2O6KA 3R9KA 4BJQA 4G3IA 1F0MA 2LBOA 1S77D 3N97B 5KFKA 3ED5A 3BQ2A 9ICVA 4RNMA 4OD0A 3WKAA 4QNLA 3THVA 4B9VA 4J9QA 2HBMA 4O5EA 4I28A 4OJOA 1JXEA 3NVWA 4ECWA 4EX6A 3CNHA 5D49A 4YP3A 3HT3A 4UASA 3PR4A 5AKGA 4OJLA 4M0AA 4P4OA 4RQ7A 1AROP 4C4SA 3SAFA 3HRDD 5AI9A 1RDFA 4YR3A 4CCHA 4GXJA 7ICFA 3T3FA 4BUGA 4GXKA 2F44A 1PUZA 3F2BA 3PX4A 8ICNA 1QQ7A 5DGBA 3GU3A 4DWIA 3WK6A 2J6SA 5ALVA 3F2DA 4Y2XA 4UB6U 4RQ3A 2VJ4A 4RQ2A 3NVYA 1WWVA 2VA2A 4I2IA 5IINA 5DBBA 2I5HA 3M8SA 1OUQA 2ES6A 5ALJA 3PNCA 1GO3F 5J2HA 1ZQGA 4UW9A 2K8BB 3RJHA 2G5IB 1SV0C 5DKWA 5J2KA 2E8PA 1YZ6A 3AQEA 3TQ1A 1ZQPA 4EZ9A 5DB8A 5DLGA 1D9FA 5KL8B 2HVHA 4ED3A 3MR3A 4PJ0U 4QZDA 1WUDA 5J2BA 2ZG6A 3OSPA 3SQIA 4P4MA 5E79U 1SZHA 5G5HA 3UM9A 1BVSA 3K4GA 4GC6A 8ICOA 4KTQA 9ICWA 3M6KA 1Z1BA 3PSPA 3UMCA 5KAFU 3KD3A 4Y2SA 3AQFA 2AXTU 1HUZA 1ZQYA 4Q8FA 5B66U 4RZRA 9ICBA 2WAQC 2RDIA 1U4BA 4F71A 4DOBA 4LJXA 2FPLA 4Y2YA 3C29A 3U26A 4JWNA 7ICMA 4UB5A 1Q8KA 5KFLA 5GTHU 4QZIA 1NKCA 1L3SA 1NJWA 4DQIA 5EE3A 4MF2A 4EEKA 1DGJA 4O0IA 3OHBA 9ICOA 1XWLA 4TUPA 2EAPA 2HHWA 2IMWP 2YTUA 4ED8A 3T79A 3HWTA 1U9LA 4Z6DA 1X6IA 2K4EA 4EX7A 4M04A 3H0LB 3MGVA 3QX7A 3UXPA 4FS1A 3H8MA 4O3RA 1K1SA 3H8JA 9ICPA 3QU7A 3G6VA 4Q45A 2DL0A 2KKVA 3GIMA 4PHDA 4WJ3B 3GZFA 2B6GA 1ZQXA 2DGZA 4C8OA 2ASDA 5KFZA 1WG8A 5IIOA 4BXOB 4HYKA 2E3TA 2VA8A 3ZDBA 4RT3A 4G9BA 4EBDA 2CN1A 5J0QA 4O9MA 1Z1VA 3BDPA 4Q44A 4I29A 1BNPA 1BPDA 2MRLA 4ELVA 2VKQA 2LKYA 3SV4A 8ICLA 1NK8A 2DQNB 1C20A 1S9FA 4M2YA 3ONNA 2XO7A 1ZQKA 2K60A 3HILA 3FC4A 3N7RC 4ECZA 1TAQA 4C8MA 2KG5A 5ALTA 5AKIA 3BQ0A 3F5EA 2GO7A 3KKAA 5CR0A 1LV5A 1NJZA 3C2LA 2BKEA 3RB0A 1ZQZA 5JUMA 2GH1A 2C2DA 4TUQA 4F5QA 2HOQA 3M9MB 4TUSA 3MR2A 2OYYA 4KX3A 4J03A 1N5XA 5L1JA 2BQRA 2FDRA 1S76D 1MQ3A 4Z6FA 5J0RA 2FPKA 2AQ0A 3TFRA 4I2AA 3UMBA 1Z19A 5KFQA 3RJKA 2HHQA 2D8CA 1L8OA 4MF8A 4X5VA 5KG6A 3UQ0A 1SB3C 4UAZA 3NUQA 2NO5A 2ZUCA 5KFUA 1S10A 2ODGA 5KFJA 5J0TA 1VLBA 3C28A 3V6HA 4KLMA 4PHEA 1ZQHA 5AK5A 3GV8B 4DSJA 3ZDEA 2PI4A
chains in the Genus database with same CATH topology
1HIWA 2KJ9A 3CP8A 4IC9A 1SZHA 4KX5A 2LBOA 1ED1A 3RF9A 1PVRA 3KFUF 2G0AA 4FZLA 2WB1F 4A8EA 2XI9A 4CGZA 2CN1A 2F76X 2G5HB 4P0QB 4JMUA 3SMVA 2D6FC 1Q3UA 2H3IA 2F8LA 3M6KA 4QNLA 1Z1BA 2KJ8A 2LHTA 1XNSA 2M0NA 3PSPA 2KVCA 2YB1A 2MRLA 2HBKA 2VKQA 3AQFA 2F2AB 2G07A 2LKYA 2HBMA 1Q3VA 4NLBA 2KEYA 4OJPA 2K4HA 3D2QA 2OH2A 2DQNB 2JH1A 1IIPA 2RRDA 3SAHA 1A0PA 4ACOA 2VIXA 2H3ZA 2WAQC 3RFAA 3ONNA 1XO0A 4OJOA 4AYBF 4NV0A 4P0QA 3PSIA 1NZBA 2Y0SC 4PL1A 4NLCA 2E1EA 3AL0B 2WB1C 3SAGA 3N7SC 2ZIXB 2Q4TA 2HMXA 3N7RC 1P7DA 2JH7A 1HEKA 2XICA 3LVWA 3L3FX 3N7PD 1D8BA 4KMOB 2HBLA 3M6ZA 4OJLA 1CRXA 2HOFA 1L6NA 3C29A 3ALRA 3F5AA 3IG8A 2CRXA 2ZIVB 2Y0SF 3IP4B 3PZPA 3F5EA 1PVPA 3O0FA 4C0ZA 2G09A 4BX9C 2A3VA 3SAFA 2W7OA 3F53A 2OM6A 1URJA 2G06A 2WAQF 2ZIWB 4PL2A 2CPRA 2W7PA 1YT3A 2ZXHA 4CRXA 3PSTA 4P0PB 4BUGA 2E5SA 2PMZC 2K89A 3VCBA 3F2BA 5CRXA 1F44A 2GH1A 3IN5A 4O3MA 4U6PA 3CRXA 5HR6A 3GU3A 3VC8A 4OJ5A 2HOQA 2YX8A 3DEEA 3PSFA 1A6SA 3F2DA 3HKZC 1ECWA 2KHVA 1UPHA 2KJ5A 2LYAA 2VJ4A 3CYMA 1MA7A 2H3VA 2R18A 2K8AA 4GFJA 3T79A 2OYYA 2ZXIA 3ICXA 4KX3A 4AYBC 2JGAA 2K4EA 4FE3A 3D2NA 2W04A 1ZQ1C 2ZIUB 3LYSA 3F2CA 2HOIA 3H0LB 2E1FA 2HBJA 3MGVA 3HKZF 1KBUA 1OUQA 4U7CA 2BDUA 3NRWA 4FZNA 4FZMA 2VJ5A 3H0MB 1GO3F 4P0PA 3H0RB 3KZXA 2GOLA 1Z19A 2K8BB 2LYBA 2DF4B 2G5IB 2PMZF 2RP5A 2JHDA 2KHQA 1PVQA 2OXOA 2H3QA 4QIWC 2ZIVA 2KKVA 3M7DA 2N1RA 2W03A 3OPXA 1DRGA 2F77X 4QJFB 3AQEA 1T94A 2KOBA 2NV3A 2RHFA 3GZFA 3LVVA 1TAMA 4WJ3B 4CDGA 3E0FA 2ZIWA 2DGZA 2JMGA 2K8CB 3NUQA 4ICAA 3D2SA 5KL1B 2XIDA 5KL8B 5C0YA 2H3FA 4OJ6A 2ZIUA 4OO1J 2MA1A 3C28A 1WUDA 2KV2A 2G08A 3K1ZA 3IG5A 2XVTA 2KD1A 2KNJA 5T14A 2ZG6A 4QIWF 4NWIA 2KIWA 2ZIXA 5A0LA 2K4IA 2Z7JA 4BJQA 2KICA 2KKPA 3SQIA 5HR7A 2YB4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D8B A;  2HBL A;  4QJF B;  4CGZ A;  2RHF A;  3CYM A;  4CDG A;  2DGZ A;  3SAF A;  2HBK A;  2E1F A;  5C0Y A;  2HBM A;  2HBJ A;  4NLB A;  2CPR A;  4OO1 J;  1YT3 A;  2RRD A;  3SAH A;  2MA1 A;  1WUD A;  2KV2 A;  1GO3 F;  4QIW F;  4O3M A;  4NLC A;  2E1E A;  3SAG A; 
#chains in the Genus database with same CATH topology
 4RQ1 A;  4J9O A;  2WB1 F;  4IQW A;  8ICW A;  4DLG A;  5KAI U;  3RJG A;  4J9S A;  3C1Z A;  5KFY A;  5DBA A;  5KT3 A;  1UT8 A;  2YB1 A;  1U48 A;  3BS5 A;  4M9G A;  1FIQ A;  4DOC A;  4NLG A;  3SAH A;  1IIP A;  5D46 A;  3ISC A;  3CW2 C;  3PMN A;  3BQ1 A;  3NS1 A;  1H38 A;  3SAG A;  2XGP A;  2ZIX B;  3SYZ A;  3KHR A;  4KN4 A;  2HBL A;  1L6N A;  3EW9 A;  4Z6C A;  8ICK A;  3DDH A;  2Y0S F;  4B9L A;  2ZJ5 A;  2IA6 A;  1RYU A;  3IM1 A;  4QWA A;  2W7P A;  4RU9 A;  4P4P A;  3Q8M A;  4OCZ A;  8ICA A;  3VCB A;  2Q0Z X;  3HP6 A;  2KFN A;  3RH5 A;  5KFH A;  4DOA A;  1UT5 A;  3GV7 B;  3MR6 A;  1A6S A;  3HKZ C;  3KHG A;  3CYM A;  5EWG A;  1V85 A;  3ZDD A;  2AU0 A;  2ISO A;  7ICQ A;  3IHQ B;  3S6J A;  2Y1J A;  1JX4 A;  4NL9 A;  3N28 A;  2QB0 B;  4IQV A;  4IRK A;  4KMU A;  2BPC A;  4ECY A;  2RP5 A;  9ICR A;  2KK0 A;  2NRW A;  2DKX A;  2HHS A;  5BPC A;  4O3P A;  4RNN A;  3ZD9 A;  3D2S A;  2R8H A;  1BNO A;  1HUO A;  3JPO A;  3WK7 A;  4GC7 A;  4F4Y A;  4RQ8 A;  1L7P A;  4DFJ A;  3TAQ A;  4Y2T A;  5KFV A;  4AP9 A;  3WK5 A;  1BPE A;  4KX5 A;  4F92 B;  4UBB A;  5KFW A;  3PO4 A;  4LZD A;  4HAI A;  5CHG A;  2F76 X;  9ICS A;  4DF4 A;  4DQP A;  5ALF A;  4QWB A;  2L5Y A;  1N48 A;  2F2A B;  2W9M A;  1KRP A;  3LWM A;  5D4B A;  4FFD A;  8ICT A;  3H4D A;  1ZQW A;  4Z6E A;  3Q8R B;  4B9M A;  1Y88 A;  5IIM A;  2JH7 A;  2DPJ A;  4KLF A;  9ICT A;  1X42 A;  4KMO B;  4O3O A;  3EWA A;  4NM2 A;  2ZIV B;  5KT5 A;  2LM4 A;  2H5X A;  4FO6 A;  4YFK A;  3F53 A;  5J0U A;  5J8Y A;  3ETL A;  2ZTC A;  2W54 A;  5K4L A;  2FMQ A;  1N2X A;  5AIC A;  4MFC A;  5EE1 A;  5AKX A;  4ECQ A;  3CRX A;  3KOO A;  4Y2U A;  3RTV A;  4ZH4 A;  3ZI4 A;  2D3D A;  2B21 A;  1RQN A;  4O3S A;  3NGD A;  5J0S A;  1ZQO A;  3H7I A;  8ICY A;  2XGQ A;  3AUO A;  5AI4 A;  3UQ2 A;  2PKE A;  4J9M A;  2EAN A;  5DBC A;  5H2F U;  3KZX A;  4K4H A;  1FEZ A;  2KHQ A;  2H3Q A;  9ICX A;  5ALK A;  1NKB A;  2E8M A;  2DUY A;  4EYI B;  4GIB A;  5EWF A;  2KP7 A;  5KG3 A;  4ECV A;  2FLP A;  4EBE A;  3RJE A;  5EE0 A;  2K8C B;  1MC8 A;  4OJ6 A;  2ZIU A;  2ZTD A;  4ED2 A;  1D8L A;  2BR0 A;  3QU4 A;  2AQ4 A;  2KD1 A;  2PFQ A;  8ICE A;  4QIW F;  4IL6 U;  5KNI A;  3QUC A;  5ALX A;  2Z7J A;  3DV9 A;  1FO4 A;  3NTU A;  8ICH A;  5AK4 A;  4XA5 A;  4BGD A;  2I6X A;  4YR0 A;  3RR7 A;  1IG6 A;  2XI9 A;  2WTF A;  4ELT A;  1RG6 A;  4R66 A;  2AGQ A;  4Y2R A;  2M0N A;  3C1Y A;  3NRZ A;  3SI8 A;  3KHH A;  1CUK A;  4PZO A;  2GLE A;  5AHX A;  4F4X A;  2JXJ A;  3PML A;  9ICE A;  2BCV A;  2E1E A;  3AL0 B;  4DFM A;  8ICQ A;  4M9H A;  4USA A;  4JWM A;  3M9O B;  9ICM A;  5KG0 A;  4F4W A;  2V4Q A;  4FBT A;  4PL2 A;  4PHP A;  2LM1 A;  1SV0 A;  4U6P A;  2IOH A;  1YZ7 A;  4YMM A;  5AM4 A;  5KFE A;  4IRC A;  4ED0 A;  2KHV A;  4DO9 A;  4JV1 A;  3RJF A;  2H3V A;  2R18 A;  4DFD A;  2E8N A;  4NLK A;  3C23 A;  3LYS A;  4F5P A;  4YG2 A;  3JPN A;  3AU6 A;  1KW4 A;  4FZN A;  4FZM A;  1IM4 A;  2R8G A;  3T5K A;  1MQ2 A;  2JEJ A;  9ICU A;  3T5H A;  1TE2 A;  5CJ7 A;  3RH6 A;  4M47 A;  2ZIV A;  5AKE A;  1SL0 A;  1OXJ A;  1ZD5 A;  1N56 A;  4QJF B;  2NV3 A;  1T8E A;  1XO1 A;  1KTQ A;  2NRT A;  1KLN A;  1QCK A;  3MFI A;  4DQS A;  4LVS A;  4DS4 A;  1N62 A;  1TK5 A;  2PFN A;  1SKS A;  2BGW A;  3MBY A;  4O5K A;  2KE7 A;  3LK9 A;  2DPI A;  1HIW A;  4KLL A;  3CP8 A;  2XY5 A;  1NJY A;  4FZL A;  4DL3 A;  3QU2 A;  4F3O A;  2G5H B;  4F72 A;  2ATL A;  3TAD C;  5ALS A;  2MSN A;  3RAQ A;  4P2H A;  1XNS A;  4K4I A;  4DQQ A;  2LI6 A;  1D9D A;  3I76 A;  3HJE A;  3M1Y A;  5AKY A;  5KFP A;  2PFO A;  4F2S A;  2R8I A;  1A0P A;  2H3Z A;  3J81 j;  9ICH A;  3QNM A;  5AM5 A;  3TAC B;  3N7S C;  4BWM A;  4MEX A;  5AI0 A;  1JRO A;  3RRH A;  3LVW A;  4YCX A;  3N7P D;  1SV4 A;  2CRX A;  4DL7 A;  3SV3 A;  5DQG A;  2DWQ A;  3NAS A;  4BDP A;  1KQQ A;  4BX9 C;  2A3V A;  4ELU A;  3PW0 A;  5BOL A;  5L1L A;  1BPB A;  1J97 A;  2EAM A;  4E0D A;  1YT3 A;  1DXS A;  2K89 A;  4PZN A;  4XQ8 A;  4KLH A;  4KIT B;  2I1Q A;  5EE9 A;  4OJ5 A;  3PO5 A;  4DL5 A;  2V4R A;  1LKY B;  2LMR A;  4J9R A;  1ECW A;  2HSZ A;  2UVW A;  4GFJ A;  1B43 A;  4C7Z A;  1U45 A;  4C7Y A;  2HCF A;  2AGP A;  1NK6 A;  5DG7 A;  1JAL A;  5ALZ A;  3TFS A;  3ZDC A;  2PMZ F;  4CE6 A;  5KG7 A;  1ZQN A;  1PVQ A;  4IQU A;  4F5N A;  5J2E A;  5KFX A;  4TQR A;  3UXN A;  3KTQ A;  2BCS A;  4C80 A;  1UCV A;  4TQS A;  3E0F A;  2ALZ A;  4KLU A;  3QXG A;  4US9 A;  1JI7 A;  5AIB A;  1KFS A;  1Z3E B;  2KV2 A;  4DLE A;  1LVH A;  1ZQS A;  1ZRM A;  3QE9 Y;  2RLT A;  2FMP A;  2E8O A;  1ED1 A;  7ICR A;  1S0V A;  4JMU A;  2H3I A;  3FYH A;  4QW8 A;  4ED7 A;  5KFO A;  2G07 A;  4Y2V A;  2KEY A;  4OJP A;  4I27 A;  3QYP A;  3RFA A;  4YMO A;  4UB3 A;  1JIH A;  8ICF A;  2A19 A;  2W9C B;  4NL9 C;  1N61 A;  2ZUB A;  1X66 A;  1T3N A;  4YMN A;  5CWR A;  2EZY A;  1NK7 A;  4LZG A;  4GXI A;  2JEI A;  2AJQ A;  3RB4 A;  8ICG A;  4CRX A;  5TIS U;  5AKJ A;  4O3M A;  5AM1 A;  3TAP A;  3K75 D;  4B6J A;  7ICL A;  4QWC A;  1X40 A;  3ZD8 A;  2JEF A;  5CEH A;  1VDV A;  3BJY A;  2IOF A;  3OJU A;  5HMM A;  3FM9 A;  2HOI A;  1ZQ1 C;  4J9K A;  4KLE A;  2ZJA A;  4IRD A;  1L3U A;  5KT7 A;  3ISD A;  2YMQ A;  3H0R B;  1ZQC A;  1ZQI A;  4ZOH C;  4DL4 A;  1KDH A;  2OXO A;  5KFF A;  2BPF A;  8ICC A;  3OPX A;  5DLF A;  1NK9 A;  2YN4 A;  3WK4 A;  5JRT A;  4NY8 A;  2IHN A;  1S8O A;  3QU9 A;  1QQ5 A;  3MDA A;  2XY6 A;  3MGI A;  5F9N A;  2ASJ A;  3K1Z A;  2EH9 A;  3SR6 A;  3HW8 A;  5T14 A;  2W9C A;  5AKK A;  4YXM A;  4KLI A;  3PX0 A;  5JU5 A;  5AKZ A;  3UMG A;  1DOQ A;  5CA7 A;  1ZQM A;  2W43 A;  3LWL A;  4C4T A;  2F1I A;  3BQT A;  5J0W A;  2JH1 A;  3M9N B;  1BPY A;  4ACO A;  2ZUD A;  5KT4 A;  1K5O A;  2CXY A;  4PL1 A;  5ALO A;  7ICJ A;  1NOM A;  1HEK A;  1WCN A;  1ZD4 A;  4B9U A;  3RAX A;  3SZ2 A;  1QLN A;  5AKH A;  1L7N A;  3AEV A;  2ZIW B;  5AK6 A;  2WF7 A;  4EEY A;  4RPZ A;  2OWO A;  3OTQ A;  3IN5 A;  4DQR A;  2C22 A;  4RQM A;  3WKB A;  4CF4 A;  5DQI A;  3SEI A;  2W9B B;  1ZQR A;  3C2M A;  2JGA A;  4FE3 A;  1BPX A;  4DF8 A;  5III A;  1SL2 A;  2VJ5 A;  5IIL A;  4KLQ A;  3V7L A;  1L7M A;  2YY6 A;  5HHI A;  2UVU A;  4J9P A;  5JTI A;  1DRG A;  1T94 A;  9ICK A;  1RM6 C;  4M6W A;  4CDG A;  2FMS A;  4Y2Q A;  1TAU A;  9ICI A;  3JPR A;  2W9A A;  3V6J A;  3WK8 A;  2F3N A;  2G08 A;  4F50 A;  7ICK A;  2KKP A;  2YB4 A;  2KJ9 A;  4JV2 A;  1NNL A;  4RQ5 A;  4CGZ A;  1KKX A;  1TK0 A;  4C4R A;  2QKQ A;  3T5L A;  4ECU A;  2F8L A;  5ALR A;  5HNK A;  5B5E U;  2P66 A;  1ZET A;  5DG9 A;  1XSP A;  4DL2 A;  1PK1 B;  3V7K A;  3TAD A;  1X6J A;  3WU2 U;  1L3T A;  3HPO A;  2OH2 A;  4GLX A;  4C8L A;  4CNQ A;  1XSN A;  3IRU A;  4C8K A;  3EYZ A;  1NZB A;  4UB8 U;  4NLC A;  3RJJ A;  2WF6 A;  5KFG A;  1D8B A;  2F1H A;  4PPX A;  3QUT A;  5KFN A;  1Z00 B;  2HOF A;  4MFA A;  2KSO A;  3HX0 A;  3KZI U;  2YMM A;  2WHE A;  4F4Z A;  2EZZ A;  2BQ3 A;  3EPG A;  3WK9 A;  1URJ A;  2KFZ A;  4FS2 A;  2ZXH A;  5AM3 A;  4DL6 A;  1ZQF A;  5KFS A;  3GIL A;  3GII A;  1QTM A;  1JUD A;  1F44 A;  1B4F A;  5ALQ A;  3C5F A;  2HDO A;  3DEE A;  1JN3 A;  2NRX A;  1BPZ A;  1UPH A;  1N63 A;  5TZV A;  2ZXI A;  4IS7 A;  1A77 A;  5L9X A;  2NRV A;  2KZM A;  2HBJ A;  5GTI U;  4DEZ A;  4P0P A;  2WF5 A;  4QZ9 A;  3A0B U;  1AQ6 A;  2B0C A;  3MDC A;  1L5U A;  8ICP A;  2P35 A;  2W03 A;  3ETR A;  4Y2P A;  2KTQ A;  5AKL A;  2BHN A;  2HHX A;  1N60 A;  2IBK A;  5ALD A;  2ZJ8 A;  5KG2 A;  2BCQ A;  2JMG A;  3G6X A;  2EQY A;  3RRG A;  5C0Y A;  2H3F A;  5J2G A;  3ISB A;  1ZQL A;  3Q8S B;  5A0L A;  1PK1 A;  4KLG A;  4DSE A;  5DQH A;  5ALG A;  4IC9 A;  1ZYQ A;  7ICP A;  4YXJ A;  4Q8E A;  8ICR A;  4UBC A;  5J0Y A;  1Q3U A;  4F93 B;  1PK3 A;  5KG4 A;  4RNO A;  4DS5 A;  4YR2 A;  5EWE A;  3EZ5 A;  5ALN A;  5KT2 A;  1Q3V A;  3IV6 A;  5DDY A;  1XO0 A;  1D8Y A;  4ECR A;  4PGY A;  5DDM A;  3TKA A;  2FE9 A;  4PHA A;  2Q4T A;  7ICH A;  2HHU A;  4DCC A;  2FJ6 A;  3BS7 A;  1L3V A;  1LB2 B;  1SGG A;  3Q8L A;  8ICZ A;  3PST A;  5CRX A;  1NK4 A;  4BXO A;  5C5J A;  3PW2 A;  2XC9 A;  1J2M A;  4M9J A;  4NLZ A;  1O03 A;  9ICC A;  3PX6 A;  1MA7 A;  1S0N A;  5KFB A;  3OHA A;  4B9N A;  3ICX A;  1Z4N A;  3PW5 A;  2F1J A;  8ICU A;  2W04 A;  1QSL A;  1KFD A;  2WFA A;  1WWU A;  2OCE A;  3H0M B;  4ECS A;  5J0O A;  1UA1 A;  2HW3 A;  2JHD A;  5KFD A;  1UA0 A;  4F8R A;  4KN7 A;  4QZB A;  9ICA A;  2RQ5 A;  2M9N A;  3MR5 A;  1ZQU A;  4J9L A;  2K4P A;  4JB3 A;  4DSF A;  4QWE A;  1NZP A;  2XID A;  4Y2J A;  3PY8 A;  2W3S A;  3AMZ A;  3RB3 A;  3L5K A;  5ALH A;  5AM0 A;  1KL9 A;  4EEL A;  9ICL A;  7ICO A;  5J2D A;  3H8W A;  3BQ7 A;  2W11 A;  3KBB A;  1UQV A;  4A8E A;  2UVR A;  5ALY A;  2W9B A;  2KJ8 A;  3B9J A;  4R8U A;  4M9N A;  2KVC A;  2NO4 A;  3MC1 A;  5DB7 A;  2KIV A;  4NLB A;  2XY7 A;  2HHT A;  1XC9 A;  4DSI A;  2RRD A;  2MUT A;  3JPQ A;  4F5O A;  1FFV A;  4QZC A;  4P0Q A;  2P6U A;  2KMD A;  3PSI A;  5ALI A;  4QZ8 A;  1RXW A;  4US8 A;  1P7D A;  1ZQT A;  2XIC A;  2IHM A;  1SIJ A;  4R64 A;  1TVA A;  3L3F X;  3M6Z A;  2YML A;  4EEN A;  4KLD A;  2HVI A;  1NKE A;  3O0F A;  2G09 A;  5J0X A;  1NK5 A;  2J6U A;  3RR8 A;  3OGU A;  2V9W A;  1SXD A;  3JPT A;  5DB6 A;  4UQG A;  3RH4 A;  3RBD A;  2BZF A;  1IV8 A;  3GIJ A;  2HI0 A;  4F91 B;  4UAY A;  5KT6 A;  2JRZ A;  4JK1 A;  3Q8Q B;  2YMP A;  3RB6 A;  2LYA A;  1C7Y A;  1ZJN A;  3PR5 B;  3QU5 A;  4KLO A;  2YQE A;  3PV8 A;  1SXE A;  1SKW A;  4K4G A;  3F2C A;  1RPL A;  1T7P A;  1SWV A;  3WKD A;  5AI6 A;  1V9P A;  1DGS A;  5L1K A;  4F4K A;  2KVS A;  3KHL A;  1OW5 A;  2RDJ A;  1SZP A;  1KEJ A;  2QLT A;  1SKR A;  2JZB A;  4MEY A;  3QZ8 A;  2C28 A;  2N1R A;  1MSW D;  4F5R A;  1TAM A;  2BQU A;  7ICI A;  7ICS A;  4YQW A;  4QZG A;  2KSO B;  8ICV A;  4ICA A;  1MN8 A;  4I2C A;  5J29 A;  3JPS A;  3ZDA A;  2BCU A;  2KNJ A;  5KFI A;  5HP4 A;  4NWI A;  2KIW A;  2ZIX A;  5J2C A;  2KN7 A;  3B0X A;  1FFU A;  2KIC A;  3H4B A;  3V6K A;  4NLN A;  2VAN A;  3MGH A;  2FPM A;  2A1A A;  4I2G A;  2LYH A;  8ICS A;  4P0Q B;  2DKZ A;  2LHT A;  4QWD A;  4NXZ A;  4C8N A;  4RT2 A;  3BZK A;  1RYS A;  2W3R A;  1TFR A;  4AYB F;  9ICQ A;  1COK A;  1KN5 A;  2BPG A;  4RQN A;  2HMX A;  1U49 A;  2FI1 A;  3Q8P B;  3PVX A;  1A76 A;  1ZOL A;  1TV9 A;  1EXN A;  2UVV A;  3GIK A;  1BGX T;  4C0Z A;  5ALW A;  2W7O A;  2OM6 A;  3K1R B;  4I2B A;  2G06 A;  2J6T A;  4P0P B;  3C5G A;  5KFC A;  3M8R A;  8ICJ A;  4QZE A;  5HR6 A;  3VC8 A;  4KLT A;  4EYH B;  1QH9 A;  1RXV A;  5KFT A;  4DSL A;  2OHF A;  4EBC A;  4CF5 A;  4R8U B;  2KJ5 A;  3JPP A;  1PZN A;  5CB1 A;  2KZ3 A;  2WF9 A;  4AYB C;  3V7J A;  5F3X B;  2C2E A;  1KSP A;  3AN1 A;  4XRH A;  2E1F A;  4IQT A;  4U7C A;  4UAU A;  4I2H A;  3IDW A;  4PGX A;  4FBU A;  2DF4 B;  3RBE A;  4M9L A;  3M7D A;  3I28 A;  3WKE A;  5FP0 A;  1QQ6 A;  2RHF A;  4UAV A;  2ZTE A;  4RPY A;  3TAR A;  4QZF A;  5J2I A;  2EAO A;  3UPQ A;  1NJX A;  3OSN A;  5KL1 B;  4QW9 A;  4ED6 A;  1DK3 A;  1T4G A;  1B22 A;  7ICU A;  1K1Q A;  4JUZ A;  1Q46 A;  2XVT A;  4BWJ A;  4B9T A;  4TUR A;  2W8K A;  4KLJ A;  3RF9 A;  2P6R A;  4O3N A;  3EPI A;  1J2N A;  8ICX A;  5KFR A;  2HBK A;  2VA3 A;  1N5W A;  5CP2 A;  2F8K A;  2K4H A;  5J8Y C;  5EOZ A;  4DFP A;  1V97 A;  4NV0 A;  2ISP A;  4MHV A;  2GWS A;  2FLN A;  2I9G A;  4Q43 A;  3A0H U;  4MFF A;  4O3Q A;  2JV3 A;  4PH5 A;  1ZD2 P;  4DSK A;  3C2K A;  4NM1 A;  3PZP A;  3E58 A;  2QAR B;  1M6Y A;  4RQ6 A;  1ZQV A;  3G6Y A;  1NI3 A;  1X9W A;  2MUT B;  1V38 A;  1WYG A;  1CEZ A;  1F5S A;  5BOM A;  2AGO A;  1JMS A;  4YD2 A;  2YX8 A;  1XU4 A;  3NVV A;  5J0P A;  1RZT A;  3FDS A;  4JV0 A;  1SL1 A;  4O5C A;  2R8K A;  4R65 A;  3D2N A;  5J2A A;  2ZIU B;  2QB0 A;  1KFT A;  4RPX A;  5ALU A;  1X2I A;  1ZJM A;  2KZZ A;  2GOL A;  3Q8K A;  4QIW C;  2PXI A;  5ALM A;  2EDU A;  3OJS A;  1S0O A;  2PI5 A;  3LVV A;  4UAR A;  2A1J A;  4R63 A;  4KLS A;  1RQL A;  5KFA A;  3BS5 B;  4RQ0 A;  1VJ5 A;  5J2F A;  3QUQ A;  1B0X A;  1QSY A;  7ICE A;  1Z4O A;  2MA1 A;  2BCR A;  2FLL A;  1COO A;  5KTQ A;  1S5L U;  2XCP A;  3H8S A;  2K4I A;  4QZH A;  1ZRN A;  5AI5 A;  1PVR A;  1L7O A;  5DGA A;  3SMV A;  4YD1 A;  3SEN A;  1ZQQ A;  3C21 A;  7ICT A;  1X9S A;  4QZA A;  1QSS A;  4UB2 A;  5IIK A;  2Y0S C;  2NRZ A;  2BDP A;  3LDA A;  3MAB A;  1CRX A;  4B9S A;  3IG8 A;  1S0M A;  5KG1 A;  5AK3 A;  3NVZ A;  1PVP A;  1UHU A;  5ALP A;  1IXR A;  4RUA A;  1ZQB A;  2WAQ F;  2AH5 A;  2CPR A;  1ZQA A;  2E5S A;  1XSL A;  5KG5 A;  3BZC A;  4M6W B;  1CI4 A;  3RJI A;  1ZXI A;  5ALE A;  3SD7 A;  4ED1 A;  9ICF A;  2QAR A;  1DK2 A;  1ZQE A;  3PSF A;  9ICG A;  1TKD A;  5DG8 A;  5DB9 A;  8ICB A;  4UB4 A;  1X9X A;  2JR5 A;  2QB1 A;  2DFL A;  3NRW A;  4CF3 A;  9ICJ A;  4I2D A;  3QUB A;  5HHH A;  4ECT A;  1NK0 A;  3E2E A;  1ZQJ A;  3AM9 A;  4I2J A;  3N4M B;  3ORY A;  4ECX A;  4J9N A;  3B0Y A;  2ESE A;  2KOB A;  5KFM A;  3MFH A;  1T3Q A;  4PGQ A;  2WF8 A;  9ICN A;  5HML A;  3AU2 A;  3KKA C;  5F9L A;  1WCL A;  4XUS A;  1Z00 A;  4UAT A;  2Y1I A;  1HJP A;  2A1J B;  3H40 A;  2DBY A;  4YVZ A;  4RQ4 A;  5HR7 A;  2AHO B;  3GFK B;  5G5G A;  3KFU F;  2G0A A;  3D6J A;  3V72 A;  2D6F C;  3QZ7 A;  3TAN A;  4I2E A;  3GDX A;  1L8L A;  5AIA A;  3TI0 A;  2JEG A;  4DFK A;  7ICG A;  3T5J A;  3PW7 A;  3D2Q A;  2VIX A;  2ASL A;  4RUC A;  3FAH A;  2PFP A;  2MU2 A;  2WB1 C;  3L4P A;  1LKY A;  2MAX A;  1TK8 A;  2W55 A;  2NYV A;  3ALR A;  3F5A A;  3IP4 B;  5L1I A;  4I2F A;  1S97 A;  2XCA A;  4IR1 A;  5IIJ A;  1O08 A;  2PMZ C;  1U47 A;  2JZB B;  3UXO A;  5L1M A;  4NJ8 A;  7ICV A;  2K8A A;  5ALL A;  3GQC A;  2OEH A;  5AM2 A;  3WKC A;  4F2R A;  1JXL A;  3HKZ F;  1KBU A;  2BDU A;  1ZQD A;  3I1Y A;  2W8L A;  8ICM A;  2LYB A;  2C2R A;  1XS9 D;  2HHV A;  4UAW A;  2IOF K;  1ZD3 A;  3QEB Z;  1RYR A;  2Y9T A;  2F77 X;  7ICN A;  4EZ6 A;  4YN4 A;  1SWW A;  2Y9U A;  2ZIW A;  2R8J A;  3QEA Z;  5AI8 A;  4IR9 A;  2EZX A;  5J2J A;  3EUB 2;  4OO1 J;  1X9M A;  3PW4 A;  8ICI A;  3GV5 B;  1JRP A;  3IG5 A;  4UB1 A;  2LPE A;  2O6K A;  3R9K A;  4BJQ A;  4G3I A;  1F0M A;  2LBO A;  1S77 D;  3N97 B;  5KFK A;  3ED5 A;  3BQ2 A;  9ICV A;  4RNM A;  4OD0 A;  3WKA A;  4QNL A;  3THV A;  4B9V A;  4J9Q A;  2HBM A;  4O5E A;  4I28 A;  4OJO A;  1JXE A;  3NVW A;  4ECW A;  4EX6 A;  3CNH A;  5D49 A;  4YP3 A;  3HT3 A;  4UAS A;  3PR4 A;  5AKG A;  4OJL A;  4M0A A;  4P4O A;  4RQ7 A;  1ARO P;  4C4S A;  3SAF A;  3HRD D;  5AI9 A;  1RDF A;  4YR3 A;  4CCH A;  4GXJ A;  7ICF A;  3T3F A;  4BUG A;  4GXK A;  2F44 A;  1PUZ A;  3F2B A;  3PX4 A;  8ICN A;  1QQ7 A;  5DGB A;  3GU3 A;  4DWI A;  3WK6 A;  2J6S A;  5ALV A;  3F2D A;  4Y2X A;  4UB6 U;  4RQ3 A;  2VJ4 A;  4RQ2 A;  3NVY A;  1WWV A;  2VA2 A;  4I2I A;  5IIN A;  5DBB A;  2I5H A;  3M8S A;  1OUQ A;  2ES6 A;  5ALJ A;  3PNC A;  1GO3 F;  5J2H A;  1ZQG A;  4UW9 A;  2K8B B;  3RJH A;  2G5I B;  1SV0 C;  5DKW A;  5J2K A;  2E8P A;  1YZ6 A;  3AQE A;  3TQ1 A;  1ZQP A;  4EZ9 A;  5DB8 A;  5DLG A;  1D9F A;  5KL8 B;  2HVH A;  4ED3 A;  3MR3 A;  4PJ0 U;  4QZD A;  1WUD A;  5J2B A;  2ZG6 A;  3OSP A;  3SQI A;  4P4M A;  5E79 U;  1SZH A;  5G5H A;  3UM9 A;  1BVS A;  3K4G A;  4GC6 A;  8ICO A;  4KTQ A;  9ICW A;  3M6K A;  1Z1B A;  3PSP A;  3UMC A;  5KAF U;  3KD3 A;  4Y2S A;  3AQF A;  2AXT U;  1HUZ A;  1ZQY A;  4Q8F A;  5B66 U;  4RZR A;  9ICB A;  2WAQ C;  2RDI A;  1U4B A;  4F71 A;  4DOB A;  4LJX A;  2FPL A;  4Y2Y A;  3C29 A;  3U26 A;  4JWN A;  7ICM A;  4UB5 A;  1Q8K A;  5KFL A;  5GTH U;  4QZI A;  1NKC A;  1L3S A;  1NJW A;  4DQI A;  5EE3 A;  4MF2 A;  4EEK A;  1DGJ A;  4O0I A;  3OHB A;  9ICO A;  1XWL A;  4TUP A;  2EAP A;  2HHW A;  2IMW P;  2YTU A;  4ED8 A;  3T79 A;  3HWT A;  1U9L A;  4Z6D A;  1X6I A;  2K4E A;  4EX7 A;  4M04 A;  3H0L B;  3MGV A;  3QX7 A;  3UXP A;  4FS1 A;  3H8M A;  4O3R A;  1K1S A;  3H8J A;  9ICP A;  3QU7 A;  3G6V A;  4Q45 A;  2DL0 A;  2KKV A;  3GIM A;  4PHD A;  4WJ3 B;  3GZF A;  2B6G A;  1ZQX A;  2DGZ A;  4C8O A;  2ASD A;  5KFZ A;  1WG8 A;  5IIO A;  4BXO B;  4HYK A;  2E3T A;  2VA8 A;  3ZDB A;  4RT3 A;  4G9B A;  4EBD A;  2CN1 A;  5J0Q A;  4O9M A;  1Z1V A;  3BDP A;  4Q44 A;  4I29 A;  1BNP A;  1BPD A;  2MRL A;  4ELV A;  2VKQ A;  2LKY A;  3SV4 A;  8ICL A;  1NK8 A;  2DQN B;  1C20 A;  1S9F A;  4M2Y A;  3ONN A;  2XO7 A;  1ZQK A;  2K60 A;  3HIL A;  3FC4 A;  3N7R C;  4ECZ A;  1TAQ A;  4C8M A;  2KG5 A;  5ALT A;  5AKI A;  3BQ0 A;  3F5E A;  2GO7 A;  3KKA A;  5CR0 A;  1LV5 A;  1NJZ A;  3C2L A;  2BKE A;  3RB0 A;  1ZQZ A;  5JUM A;  2GH1 A;  2C2D A;  4TUQ A;  4F5Q A;  2HOQ A;  3M9M B;  4TUS A;  3MR2 A;  2OYY A;  4KX3 A;  4J03 A;  1N5X A;  5L1J A;  2BQR A;  2FDR A;  1S76 D;  1MQ3 A;  4Z6F A;  5J0R A;  2FPK A;  2AQ0 A;  3TFR A;  4I2A A;  3UMB A;  1Z19 A;  5KFQ A;  3RJK A;  2HHQ A;  2D8C A;  1L8O A;  4MF8 A;  4X5V A;  5KG6 A;  3UQ0 A;  1SB3 C;  4UAZ A;  3NUQ A;  2NO5 A;  2ZUC A;  5KFU A;  1S10 A;  2ODG A;  5KFJ A;  5J0T A;  1VLB A;  3C28 A;  3V6H A;  4KLM A;  4PHE A;  1ZQH A;  5AK5 A;  3GV8 B;  4DSJ A;  3ZDE A;  2PI4 A; 
#chains in the Genus database with same CATH homology
 1HIW A;  2KJ9 A;  3CP8 A;  4IC9 A;  1SZH A;  4KX5 A;  2LBO A;  1ED1 A;  3RF9 A;  1PVR A;  3KFU F;  2G0A A;  4FZL A;  2WB1 F;  4A8E A;  2XI9 A;  4CGZ A;  2CN1 A;  2F76 X;  2G5H B;  4P0Q B;  4JMU A;  3SMV A;  2D6F C;  1Q3U A;  2H3I A;  2F8L A;  3M6K A;  4QNL A;  1Z1B A;  2KJ8 A;  2LHT A;  1XNS A;  2M0N A;  3PSP A;  2KVC A;  2YB1 A;  2MRL A;  2HBK A;  2VKQ A;  3AQF A;  2F2A B;  2G07 A;  2LKY A;  2HBM A;  1Q3V A;  4NLB A;  2KEY A;  4OJP A;  2K4H A;  3D2Q A;  2OH2 A;  2DQN B;  2JH1 A;  1IIP A;  2RRD A;  3SAH A;  1A0P A;  4ACO A;  2VIX A;  2H3Z A;  2WAQ C;  3RFA A;  3ONN A;  1XO0 A;  4OJO A;  4AYB F;  4NV0 A;  4P0Q A;  3PSI A;  1NZB A;  2Y0S C;  4PL1 A;  4NLC A;  2E1E A;  3AL0 B;  2WB1 C;  3SAG A;  3N7S C;  2ZIX B;  2Q4T A;  2HMX A;  3N7R C;  1P7D A;  2JH7 A;  1HEK A;  2XIC A;  3LVW A;  3L3F X;  3N7P D;  1D8B A;  4KMO B;  2HBL A;  3M6Z A;  4OJL A;  1CRX A;  2HOF A;  1L6N A;  3C29 A;  3ALR A;  3F5A A;  3IG8 A;  2CRX A;  2ZIV B;  2Y0S F;  3IP4 B;  3PZP A;  3F5E A;  1PVP A;  3O0F A;  4C0Z A;  2G09 A;  4BX9 C;  2A3V A;  3SAF A;  2W7O A;  3F53 A;  2OM6 A;  1URJ A;  2G06 A;  2WAQ F;  2ZIW B;  4PL2 A;  2CPR A;  2W7P A;  1YT3 A;  2ZXH A;  4CRX A;  3PST A;  4P0P B;  4BUG A;  2E5S A;  2PMZ C;  2K89 A;  3VCB A;  3F2B A;  5CRX A;  1F44 A;  2GH1 A;  3IN5 A;  4O3M A;  4U6P A;  3CRX A;  5HR6 A;  3GU3 A;  3VC8 A;  4OJ5 A;  2HOQ A;  2YX8 A;  3DEE A;  3PSF A;  1A6S A;  3F2D A;  3HKZ C;  1ECW A;  2KHV A;  1UPH A;  2KJ5 A;  2LYA A;  2VJ4 A;  3CYM A;  1MA7 A;  2H3V A;  2R18 A;  2K8A A;  4GFJ A;  3T79 A;  2OYY A;  2ZXI A;  3ICX A;  4KX3 A;  4AYB C;  2JGA A;  2K4E A;  4FE3 A;  3D2N A;  2W04 A;  1ZQ1 C;  2ZIU B;  3LYS A;  3F2C A;  2HOI A;  3H0L B;  2E1F A;  2HBJ A;  3MGV A;  3HKZ F;  1KBU A;  1OUQ A;  4U7C A;  2BDU A;  3NRW A;  4FZN A;  4FZM A;  2VJ5 A;  3H0M B;  1GO3 F;  4P0P A;  3H0R B;  3KZX A;  2GOL A;  1Z19 A;  2K8B B;  2LYB A;  2DF4 B;  2G5I B;  2PMZ F;  2RP5 A;  2JHD A;  2KHQ A;  1PVQ A;  2OXO A;  2H3Q A;  4QIW C;  2ZIV A;  2KKV A;  3M7D A;  2N1R A;  2W03 A;  3OPX A;  1DRG A;  2F77 X;  4QJF B;  3AQE A;  1T94 A;  2KOB A;  2NV3 A;  2RHF A;  3GZF A;  3LVV A;  1TAM A;  4WJ3 B;  4CDG A;  3E0F A;  2ZIW A;  2DGZ A;  2JMG A;  2K8C B;  3NUQ A;  4ICA A;  3D2S A;  5KL1 B;  2XID A;  5KL8 B;  5C0Y A;  2H3F A;  4OJ6 A;  2ZIU A;  4OO1 J;  2MA1 A;  3C28 A;  1WUD A;  2KV2 A;  2G08 A;  3K1Z A;  3IG5 A;  2XVT A;  2KD1 A;  2KNJ A;  5T14 A;  2ZG6 A;  4QIW F;  4NWI A;  2KIW A;  2ZIX A;  5A0L A;  2K4I A;  2Z7J A;  4BJQ A;  2KIC A;  2KKP A;  3SQI A;  5HR7 A;  2YB4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...