2MA1A

Solution structure of hrdc1 domain of recq helicase from deinococcus radiodurans
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
75
structure length
75
Chain Sequence
HDAPLFEALRAWRLQKAKELSLPPYTIFHDATLKTIAELRPGSHATLGTVSGVGGRKLAAYGDEVLQVVRDSSGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA helicase RecQ
publication title NMR structure of the N-terminal-most HRDC1 domain of RecQ helicase from Deinococcus radiodurans
rcsb
source organism Deinococcus radiodurans
molecule tags Dna binding protein
total genus 20
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2013-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00570 HRDC HRDC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.80 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2ma1A00
4QJFB 2HBKA 2KV2A 2CPRA 4O3MA 4QIWF 2RRDA 2RHFA 2HBLA 1YT3A 3SAFA 4NLCA 5C0YA 2E1FA 2MA1A 4CDGA 3SAGA 1WUDA 3SAHA 2HBJA 4NLBA 2HBMA 4CGZA 3CYMA 2DGZA 2E1EA 1GO3F 4OO1J 1D8BA
chains in the Genus database with same CATH superfamily
4M04A 4B9LA 1WG8A 1X9XA 5KFEA 4US9A 1QSLA 4YMMA 8ICMA 1MC8A 4OJLA 5KG4A 2PFOA 2YN4A 3SAGA 5EWFA 1QSYA 8ICLA 2KG5A 4E0DA 4ECYA 4LVSA 2YMLA 4K4HA 5KFOA 4DL3A 4B9TA 2HHXA 4AYBF 3HKZF 2F77X 5DB8A 3V7JA 2W3SA 3ALRA 5CJ7A 3RAXA 2YB1A 4KLFA 5KFLA 1T7PA 3E2EA 9ICWA 1LB2B 3OJSA 1B0XA 2C2DA 4Y2PA 1JMSA 5J2JA 2DGZA 5B5EU 1TV9A 3MFHA 2P35A 3L3FX 2QB0B 4J9QA 3TFRA 1S0NA 2EAOA 1PK1B 4ECXA 5AI0A 1N63A 2A19A 1XC9A 4QWEA 1MN8A 1C7YA 3V7LA 1Q3VA 3RAQA 4I28A 3AM9A 5ALYA 1QLNA 2KZ3A 2E8OA 3J81j 4EELA 1B4FA 1RG6A 4GC7A 2IOFK 1ZQXA 2R8IA 4DF4A 3WKBA 5J0SA 4DOBA 1ZYQA 3SV4A 1BNPA 1SV0A 3SD7A 1RYRA 3HPOA 1KKXA 1X2IA 2JEJA 4DQPA 2E3TA 2W55A 3D2QA 2BGWA 3TFSA 5ALPA 4QZ9A 3BJYA 4C8KA 1N48A 4OJ5A 5J0YA 4TQSA 2M0NA 4DCCA 3QEBZ 4KN4A 2BPGA 8ICIA 2L5YA 3PW7A 4MHVA 1N60A 3ETLA 1PVRA 4KLQA 4O3QA 4BWJA 4YFKA 4UB5A 5KFIA 3TKAA 5JRTA 2HHTA 5ALQA 3PZPA 4DL4A 4Y2SA 1X42A 3N28A 5AKXA 1MQ2A 4IR1A 2OCEA 4RPZA 4TUPA 4B9VA 4DL6A 5GTIU 2HBJA 1U49A 4QWBA 8ICXA 1ECWA 7ICUA 3JPPA 3T79A 3NVZA 5KFFA 4DSKA 2GH1A 4O3SA 4J9RA 2ZIXA 5AKJA 2AH5A 2KICA 2KHQA 2XI9A 1S8OA 2LBOA 3QNMA 2YX8A 1T8EA 4R63A 5HMLA 3KFUF 5DLGA 4IQVA 2RQ5A 3C29A 3QUTA 2OEHA 5ALJA 5ALXA 9ICHA 1ZQEA 3C21A 1J2NA 2WAQF 8ICAA 3N7PD 4JWMA 1UT5A 1KQQA 1J2MA 3M8RA 4P0PB 2Y1JA 4DLGA 2R8JA 5DG8A 1CI4A 2HW3A 2LMRA 2ZJ5A 1JALA 4Q8FA 7ICTA 4IRCA 2UVWA 3UXPA 1JI7A 2H3FA 4O5CA 5ALVA 2B21A 1ZRNA 2XVTA 4EZ9A 3VCBA 4GXKA 4HAIA 3KBBA 2CN1A 4C80A 1JX4A 4O0IA 1V9PA 4I29A 4CNQA 4KTQA 1ZQ1C 1D8LA 1DOQA 1M6YA 5ALZA 2QKQA 5DKWA 9ICRA 4JV2A 4Z6CA 3RR7A 2DKZA 5KFVA 3KKAA 1ZQWA 1N56A 4ECTA 5ALUA 5EWEA 3DDHA 4EEKA 3TADC 2MSNA 2A1JB 2XY6A 3QZ7A 2WB1C 1JIHA 4NL9C 1V38A 5IIMA 8ICPA 5H2FU 1B22A 3HT3A 2PMZF 1H38A 3TANA 3PO4A 3GIMA 4GLXA 5AKZA 4F2SA 4CF4A 3HX0A 4O5EA 2ZG6A 4UAZA 4EYHB 4FFDA 5KAIU 1COKA 4F3OA 4NLZA 2KMDA 1O03A 3M1YA 1SZHA 4YR2A 4I2FA 1K1SA 2LM4A 2KZZA 1RQNA 8ICCA 4KX3A 4UQGA 3EPGA 7ICEA 1N62A 4IR9A 1TK0A 5L1LA 2H5XA 4JWNA 4ELUA 4OO1J 4ECWA 2N1RA 1TK5A 4KLDA 4Y2YA 2XC9A 3RJIA 1S0VA 2ISPA 3SZ2A 4OD0A 4O3RA 4QZDA 1LVHA 1MA7A 1D8YA 1DXSA 1KL9A 2KD1A 5IILA 4KLGA 2OH2A 2FLPA 8ICQA 4DS5A 4DFKA 5ALWA 4F93B 2HOQA 4HYKA 1YZ7A 3IM1A 2KTQA 3GV5B 2C28A 1FO4A 3H0RB 4O3NA 2F44A 2K4IA 2DWQA 4DQRA 4PGYA 2VANA 1X66A 2W04A 4F5NA 3ISBA 1P7DA 3KHLA 3CRXA 2OHFA 3JPRA 2LYBA 2DQNB 3Q8SB 3ZDCA 3D2NA 4EBDA 3QUBA 3V6JA 4GXIA 2OWOA 3MFIA 5EE3A 2F1HA 2JV3A 2R8KA 3H0MB 1ZQFA 2ZIVB 4C4TA 1ZQOA 3B9JA 2EH9A 3PSTA 1NK0A 4M9GA 3F5EA 1ZQVA 4NWIA 1UPHA 4QIWC 3RB6A 3A0BU 3RF9A 5J2GA 1SKRA 4ECUA 5KT6A 3RB4A 2XGPA 1L7NA 5J2DA 2F8LA 2MU2A 1BPBA 4KN7A 1BPEA 4GIBA 4BX9C 4M9NA 2LPEA 1RPLA 1DGSA 3RR8A 3UM9A 3Q8RB 5KT4A 1NK7A 5B66U 1ZQLA 2F1JA 4KLHA 4KLTA 2QARB 4B9NA 9ICCA 3PY8A 4K4GA 2YY6A 2H3IA 1ZQJA 5ALTA 5L9XA 4DSLA 4R64A 3C5GA 2JH7A 3ZDDA 4C7YA 1NJYA 3ONNA 3V7KA 4FE3A 2JR5A 4RPXA 4EZ6A 4M0AA 8ICNA 4J9OA 4QZ8A 3K1RB 3EW9A 3AN1A 9ICVA 1QSSA 1BGXT 3AU2A 2G07A 1TFRA 3Q8MA 4RT2A 4IRDA 3SEIA 3KZXA 4DFMA 2W9CA 1HJPA 4UAYA 4UATA 2W54A 4GC6A 3LVVA 3RJEA 4KLEA 3IRUA 3RJGA 3IP4B 5KFWA 3H40A 2IOHA 3WK9A 2W8KA 2GOLA 3PX0A 1ZJMA 3LVWA 1HEKA 3UMBA 5AIAA 5L1IA 1L3UA 1TAUA 2FMSA 5ALDA 2RLTA 4XA5A 4RQMA 1S0OA 1ZD5A 1KFDA 2WTFA 2ZUCA 9ICMA 2HBKA 1FIQA 1WCNA 3F5AA 2LHTA 5DBBA 4KMOB 2RDIA 1SL1A 4Z6FA 2XCAA 1NK6A 2IOFA 4ZOHC 5KL8B 1XWLA 4OJOA 5CEHA 9ICBA 1TAMA 4PL2A 3IDWA 4PZOA 3RFAA 3WKDA 5DB9A 4FS1A 3GDXA 3ETRA 2BCSA 4F91B 1RZTA 5KFTA 4ED1A 3QU7A 4RQ1A 1YT3A 2BCQA 1BPDA 2NRXA 4MF2A 3ISDA 2JEIA 4US8A 4Z6DA 1S97A 1WUDA 5IIOA 2YB4A 9ICJA 2F76X 5AI9A 4QNLA 5AM2A 2BCUA 4NY8A 2ZIWA 5CHGA 3BZKA 4ED7A 4BDPA 2J6UA 5AM1A 2KKVA 4ICAA 2K4HA 5HMMA 2KSOA 4U7CA 5J29A 4X5VA 5AKLA 2EQYA 9ICSA 9ICUA 2XIDA 2W3RA 3HW8A 1PVQA 4CGZA 4Y2TA 2D6FC 2VIXA 1T94A 1X9WA 2EZYA 3HJEA 5KG2A 7ICRA 3AQEA 7ICVA 3N4MB 5DDMA 4DL2A 2BQ3A 3WU2U 3TAPA 4Y2UA 5KT3A 2LM1A 2M9NA 3CNHA 1RM6C 3D6JA 4UW9A 3BDPA 4MEXA 1K1QA 4IC9A 2P6RA 1J97A 1ZQRA 2NRVA 5DQHA 5EWGA 8ICKA 4EYIB 5AKGA 1BPYA 5F9LA 2KJ8A 2MUTA 4JK1A 3PW0A 3EPIA 1JN3A 3V6KA 5KFRA 5CB1A 4C4SA 2Y0SC 3F53A 1YZ6A 5AIBA 5J8YC 4R8UB 4AYBC 5HNKA 3HKZC 4Y2QA 2DL0A 3NVWA 3UMCA 1ZD2P 4DFDA 4RQ7A 4IQUA 1NK5A 4GXJA 1Z19A 1XS9D 5L1KA 2BDPA 1Z00A 4KLSA 5J0XA 2KFNA 1X6JA 3PMLA 3PSIA 3NTUA 2LI6A 4OCZA 4PHDA 5ALKA 3QEAZ 5IIIA 2GWSA 3SAFA 3C2LA 4FZLA 5E79U 1ZQTA 3MR3A 4TUQA 4F2RA 2A1JA 3NS1A 1T3NA 2BR0A 3KZIU 1IXRA 1RXVA 1COOA 1PVPA 3H7IA 3H0LB 4F8RA 2G5IB 5KFSA 3SQIA 2HOFA 3PR5B 3HWTA 4ELVA 2IA6A 5HHHA 3G6XA 3I28A 2KVCA 5KT5A 7ICNA 7ICJA 5KNIA 2HHQA 3M9OB 2B0CA 2Y1IA 1A0PA 5BOMA 1A77A 3B0YA 1L8LA 4IRKA 5HR7A 4FZMA 1VLBA 3BQTA 1LKYA 1Y88A 4F4WA 2PI4A 4CDGA 2CRXA 5ALIA 3OHBA 1KFTA 2A1AA 2K4EA 4DQIA 3KOOA 4IQWA 2AJQA 2W9BB 4TURA 3RH5A 2HOIA 3ZD9A 4QZBA 1BPXA 2ISOA 1HUOA 1ZRMA 1JUDA 1NZPA 9ICKA 4C8NA 1Z4OA 3T5HA 1BPZA 1ZOLA 5IINA 4B9MA 4YQWA 5KFYA 2KOBA 2KEYA 2K4PA 2ASLA 8ICOA 3JPOA 3QU5A 2F3NA 3F2CA 3RH4A 4LJXA 1L3SA 9ICAA 2JZBB 3KTQA 3SV3A 3WKCA 5KTQA 5KFZA 2PXIA 2H3VA 1JROA 2WF8A 3O0FA 5EOZA 1D9DA 3ZD8A 2G06A 1U47A 2DBYA 5ALOA 9ICTA 3H8SA 3G6YA 3MR5A 2QB1A 4QZIA 2HHWA 1F44A 3IHQB 4NM2A 8ICFA 3PX4A 4EX7A 2Y9TA 1ZD3A 3MC1A 2OXOA 9ICGA 2WAQC 4IS7A 5DGBA 2IMWP 3BZCA 5AKHA 4ELTA 2FI1A 5BOLA 4M9LA 4NLBA 3ZDBA 1L7MA 4C7ZA 1SB3C 1T3QA 5BPCA 7ICFA 1XNSA 2ZUBA 3MGIA 4F4XA 3FAHA 2CPRA 3GU3A 3TACB 3I1YA 4I2JA 1L7PA 3OJUA 4I27A 5ALRA 2E8PA 5F3XB 1KEJA 3SENA 2D3DA 4DOCA 2W7PA 2KZMA 5KFUA 5ALGA 3WK4A 2YMPA 2HBMA 5KFDA 4C8LA 2WF9A 3PV8A 5DG9A 1SXEA 2XGQA 1SKSA 1N61A 5ALHA 3PNCA 5DLFA 1F0MA 2UVUA 3MR6A 4K4IA 3RB0A 5C5JA 1ZQIA 1O08A 2ASJA 4F5PA 1S5LU 1KW4A 1BNOA 4CE6A 1QQ7A 4JV1A 3EUB2 1CRXA 4PJ0U 5KFGA 2FJ6A 2FMQA 4ZH4A 1KRPA 2XO7A 4RQ2A 2WF7A 1PZNA 1UA0A 3LWLA 3CW2C 3ISCA 3UXNA 3IG5A 3L5KA 1XO1A 4DFJA 1XU4A 4BXOA 4KX5A 4KMUA 3ZDEA 4M6WB 5J2AA 1QCKA 2CXYA 1NJXA 1XSPA 4QZCA 4PPXA 2EAPA 5ALNA 8ICJA 4BWMA 2DF4B 3M8SA 4JB3A 4CF5A 1DK3A 7ICMA 1SL2A 3KD3A 4FS2A 1NI3A 3FM9A 1X9SA 4ECVA 4B6JA 3Q8KA 3QYPA 1NK4A 4M9HA 9ICNA 4BJQA 5CA7A 3U26A 2I9GA 3FYHA 4YXJA 1XO0A 4YD2A 2EAMA 3QU4A 2C2RA 4XQ8A 1IIPA 4P0QB 3RB3A 5KFJA 4RQ4A 2E1FA 2BPFA 2VKQA 5CR0A 1UT8A 2ASDA 2V4QA 2V4RA 1L5UA 3E58A 5ALFA 4EEYA 4P4OA 2AXTU 5DQIA 5CWRA 4PGXA 1L7OA 4UASA 4PH5A 1RYSA 3K75D 3FC4A 4B9SA 1KTQA 5J0RA 2XICA 2NRZA 1CUKA 4QZGA 4O5KA 1NZBA 3IV6A 4DEZA 2KNJA 3PSFA 5FP0A 5KG7A 2KFZA 3EWAA 4IL6U 1SZPA 4I2GA 3M9NB 5AK4A 1T4GA 2G09A 4J9KA 1IV8A 5DQGA 9ICOA 7ICHA 1TVAA 8ICZA 1ZD4A 3V72A 3WK8A 3NASA 1SKWA 3RJJA 9ICQA 4DWIA 5KFXA 3G6VA 1D8BA 3M9MB 4ED2A 9ICLA 1NJZA 5KG3A 1WWUA 2W9MA 4CRXA 8ICUA 4QIWF 7ICSA 4ECRA 1XSNA 3RJFA 3WKEA 2ODGA 5KFBA 9ICXA 9ICEA 3CP8A 1KBUA 4USAA 5KFHA 5JTIA 2KVSA 1BVSA 4C0ZA 5DB7A 5AKKA 3QUCA 2F8KA 2QB0A 4KLOA 3F2BA 5ALSA 2EZZA 2OYYA 2AGOA 1PK1A 3NUQA 3UXOA 1ZQSA 1D9FA 3RRHA 4ED0A 9ICFA 3N7RC 3OTQA 3NVVA 5G5GA 4PL1A 5ALEA 2JXJA 4RNMA 3KHGA 4DFPA 4MFCA 3AL0B 4DSIA 1ZQKA 3RJHA 2WF5A 5KG5A 8ICEA 4UB3A 4A8EA 4NL9A 5AI5A 3SI8A 4DQQA 4UB1A 1KSPA 3TAQA 3M6KA 1EXNA 2XY7A 2YMMA 3QUQA 4O3PA 2AQ4A 4BUGA 1SGGA 3THVA 2DUYA 5JUMA 4Q43A 1Z3EB 2W11A 3TARA 1U4BA 2KV2A 5AK3A 4RT3A 1SV0C 3K4GA 2NRTA 3QU9A 2I1QA 4AP9A 5J2FA 5HHIA 8ICGA 3NVYA 5AKEA 3JPQA 2HVIA 3QZ8A 3E0FA 4JV0A 4C8OA 1C20A 4ACOA 8ICHA 4Y2JA 4NV0A 5IIJA 3WKAA 2I5HA 4RNNA 5AK6A 2A3VA 5HP4A 5EE1A 7ICLA 3F2DA 5J0TA 5J2KA 4J9PA 1FEZA 4RQ8A 3SAHA 2FPKA 1RQLA 3GZFA 5G5HA 2W9AA 2ZXHA 1IG6A 5J2IA 4UB8U 3I76A 2Q4TA 4M47A 1MQ3A 1SL0A 3DEEA 2P6UA 2J6SA 5ALLA 2G0AA 8ICTA 4UB4A 2W43A 4QWAA 1CEZA 2HMXA 4UB6U 4NLNA 4DSEA 3V6HA 2AGPA 2E1EA 1NOMA 3PR4A 5D46A 2JMGA 5J0UA 4QWDA 2VA3A 3M7DA 2ZIUB 1HUZA 1KLNA 1UCVA 2PFNA 4QW9A 3QX7A 2PFPA 1Z4NA 4I2BA 1S76D 3RBEA 1TE2A 3C2KA 2IBKA 4NXZA 4F5OA 4P0PA 2K8BB 2D8CA 3QU2A 3KHRA 2KE7A 3PW2A 4J9NA 2MAXA 1GO3F 4YR0A 3C2MA 4RZRA 3PW5A 2P66A 3LWMA 4NJ8A 5EE0A 3SR6A 3FDSA 3ICXA 5KL1B 1ZETA 4YVZA 3HRDD 4EENA 2ATLA 2XY5A 2ES6A 3RRGA 2NO5A 2KIWA 5AK5A 5A0LA 2KK0A 5F9NA 4YXMA 2Y0SF 4MF8A 2BQUA 1B43A 1AROP 7ICIA 3T5JA 2W03A 4KLLA 1X6IA 3WK5A 4KITB 4Q44A 3WK7A 4FBUA 3R9KA 1ZQHA 2DPJA 3S6JA 3AQFA 4PHAA 3JPSA 3Q8QB 3QE9Y 5KFMA 2KP7A 3PMNA 2PI5A 3KKAC 4O3MA 1TKDA 2F2AB 2RDJA 1Q8KA 3MR2A 7ICPA 3C5FA 2GLEA 4M6WA 1JXLA 4F72A 5C0YA 4ED6A 5KG6A 2R8GA 1NK9A 1A6SA 1PUZA 4EX6A 5D49A 2HSZA 4Y2XA 4KLMA 4RQ0A 3OGUA 2VA2A 1QTMA 4XRHA 1NNLA 4KLIA 1U45A 2W9CB 4QJFB 1ZQAA 3GFKB 3GILA 1Q46A 2AHOB 2BZFA 4F5QA 2EDUA 1IM4A 1A76A 3UPQA 4RQNA 4F71A 2PKEA 5J2HA 4QZAA 3TQ1A 8ICRA 3NRZA 1ZXIA 2I6XA 1QQ6A 4I2EA 2KKPA 1JRPA 5AM5A 1S0MA 2YQEA 2RRDA 2HBLA 4P0QA 5AHXA 4UB2A 3MBYA 3SYZA 4NLGA 5AKYA 3L4PA 3RH6A 1L3VA 4QWCA 2NRWA 7ICGA 4YCXA 1ZQBA 2ZTDA 4Q8EA 2OM6A 4OJPA 4RUCA 2Z7JA 3C1YA 2YMQA 4F4KA 3ORYA 4DLEA 5L1MA 2K8AA 2DFLA 3A0HU 4G9BA 4DO9A 4JUZA 2BQRA 3EYZA 3OSNA 5J2EA 1SWWA 4RQ5A 3KHHA 3T5LA 5AI8A 2ZJAA 4CCHA 1L6NA 3LDAA 2ZIWB 5T14A 1Q3UA 5AI6A 2KJ9A 3RJKA 2EANA 3LK9A 3K1ZA 2UVVA 2ZIVA 4FO6A 4Q45A 4PZNA 4YD1A 4UBBA 3AEVA 3BS5B 5K4LA 2KSOB 2NO4A 2JGAA 2ZTEA 2K89A 3DV9A 5GTHU 3OPXA 2EZXA 2WF6A 3PO5A 1SWVA 2PFQA 2QARA 4RQ3A 5AM4A 1WCLA 2AGQA 1WYGA 2VJ5A 1U9LA 1ED1A 3HP6A 7ICKA 4BGDA 3AU6A 5J8YA 2NV3A 3OSPA 3VC8A 3ED5A 2MUTB 4QZEA 5KFKA 5KG1A 3AUOA 3MDCA 1ZQDA 4RUAA 3AMZA 3B0XA 5AM0A 2VJ4A 5DBAA 4O9MA 5J2CA 2KIVA 8ICWA 4XUSA 4C4RA 2W8LA 2BPCA 5KFAA 5KFCA 3Q8LA 4CF3A 3GV8B 3HILA 2MRLA 4P2HA 1Z1BA 4ECZA 5IIKA 4P4MA 2AU0A 3ZDAA 1X40A 2HI0A 4Z6EA 4LZGA 1Z00B 7ICOA 1VJ5A 2BDUA 2VA8A 1ZQCA 5DB6A 3JPNA 2FPMA 2RHFA 1MSWD 4R65A 2ZXIA 3GIIA 2WB1F 4EBEA 3RTVA 2PMZC 1S77D 3CYMA 8ICBA 2Y9UA 4U6PA 2XCPA 1URJA 2E8MA 4QZFA 3BQ1A 2JEFA 3GQCA 2DPIA 4ED3A 1XSLA 3NRWA 1S10A 2NYVA 2QLTA 3TI0A 4ECSA 3UQ2A 8ICYA 4MEYA 1F5SA 3PX6A 1QH9A 4YG2A 4MFFA 2HHUA 1KFSA 3RBDA 1ZQGA 2ZUDA 4ECQA 1LKYB 1SV4A 5J0WA 4FBTA 4DOAA 2AQ0A 2HVHA 5J2BA 2Q0ZX 1DRGA 4F92B 5J0QA 1SXDA 2W7OA 1ZQMA 5J0PA 4IQTA 2E8NA 4F50A 2LYHA 2B6GA 5KT7A 3GV7B 9ICIA 1PK3A 2YTUA 7ICQA 3OHAA 1ZQNA 2E5SA 1LV5A 4I2CA 5KFNA 4OJ6A 1ZQPA 3WK6A 2F1IA 3UMGA 2BCRA 1DK2A 1NJWA 1N5XA 1Z1VA 2FDRA 4I2AA 2ZIUA 3BQ0A 4DL5A 2ALZA 4RNOA 4M9JA 4O3OA 2ZIXB 3SMVA 3GIJA 4YN4A 1QQ5A 1VDVA 3H8WA 3PVXA 3ZI4A 3MGHA 3C28A 3NGDA 4TUSA 4DS4A 5EE9A 1AQ6A 2R18A 3MDAA 1UA1A 5KG0A 2FMPA 1NKEA 5DG7A 4JMUA 4MFAA 4GFJA 2ZTCA 2LYAA 3UQ0A 1NK8A 4R8UA 1X9MA 3BQ7A 2GO7A 3H4DA 1S9FA 1RXWA 4PHEA 5L1JA 2G5HB 4NLKA 4DL7A 4QW8A 2C22A 2BKEA 5JU5A 1L3TA 1V97A 2KJ5A 1JXEA 4F4ZA 5TISU 4FZNA 4UAWA 4YMNA 2K60A 2FLLA 2O6KA 1FFUA 1ZQUA 2HHVA 2LKYA 3T3FA 4Y2VA 1OUQA 3N7SC 5KFQA 2G08A 5DGAA 4PGQA 4J9LA 3TADA 4ED8A 1DGJA 2BCVA 3C1ZA 1KN5A 2RP5A 3PSPA 4P4PA 2MA1A 8ICSA 2J6TA 1FFVA 4G3IA 3C23A 5AKIA 5AI4A 4DSFA 1SIJA 1TAQA 3PW4A 5CRXA 2UVRA 4YMOA 3BS7A 1UQVA 4YP3A 4J9MA 4NM1A 4LZDA 2HHSA 1ZJNA 2FLNA 4J03A 4WJ3B 2HCFA 2K8CB 2IHMA 2KHVA 2FPLA 4BXOB 4DQSA 4RQ6A 4F5RA 3D2SA 5TZVA 3T5KA 2ZJ8A 1NKCA 1V85A 5DBCA 1HIWA 3GIKA 1RDFA 4I2HA 2WHEA 3MABA 4UAVA 1KDHA 1OXJA 2JEGA 1N2XA 3H8JA 2W9BA 4RU9A 4J9SA 5D4BA 3JPTA 3N97B 1ZQQA 1WWVA 5CP2A 1NKBA 5J0OA 4Y2RA 4KLJA 2DKXA 4DF8A 2V9WA 2H3ZA 3IG8A 2H3QA 4I2DA 4KLUA 4UBCA 1OW5A 3H8MA 3QXGA 3H4BA 2IHNA 4DSJA 1K5OA 1N5WA 2JZBA 5KT2A 4I2IA 4UAUA 4C8MA 3Q8PB 2ESEA 5DDYA 4PHPA 1TK8A 2BHNA 3M6ZA 4EBCA 4R66A 2HDOA 1RYUA 1UHUA 4QZHA 2JRZA 4UARA 4B9UA 1ZQZA 1L8OA 5HR6A 5ALMA 3MGVA 5AICA 2JHDA 5AM3A 2C2EA 4M2YA 4TQRA 3BS5A 1U48A 8ICVA 2R8HA 4F4YA 4RPYA 2KN7A 3LYSA 4NLCA 2FE9A 3EZ5A 5KFPA 3BQ2A 4YR3A 3IN5A 1ZQYA 2WFAA 5KAFU 2JH1A 9ICPA
chains in the Genus database with same CATH topology
2N1RA 1PVPA 3ONNA 2BDUA 1F44A 4CRXA 4FE3A 4WJ3B 2K8CB 4QIWF 4OJ5A 2K8AA 2H3FA 2RHFA 2KHVA 2M0NA 2A3VA 2ZIXB 2KKVA 3SMVA 2OXOA 2W03A 3H0LB 4ICAA 2G5IB 3F2DA 2K4HA 3D2SA 2WAQC 4U7CA 4OJLA 2XVTA 3SQIA 2ZXIA 2XIDA 3CP8A 3VCBA 3SAGA 1MA7A 1KBUA 2HOFA 2WB1F 3C28A 3SAHA 2CN1A 2PMZC 2KD1A 1HIWA 1PVQA 2G07A 4BJQA 1PVRA 2OH2A 4NLBA 4O3MA 4CGZA 3AQFA 3CYMA 2KVCA 3GZFA 1ZQ1C 2D6FC 2HOQA 2ZXHA 1L6NA 2R18A 3KZXA 4C0ZA 2VIXA 1T94A 1XNSA 2ZIWB 5T14A 1XO0A 1Q3UA 2Q4TA 3H0RB 2KJ9A 1A0PA 3AQEA 4U6PA 2CPRA 3PZPA 2K4IA 3GU3A 3LVVA 4JMUA 1URJA 3K1ZA 3DEEA 2ZIVA 4FZMA 4AYBF 3F2BA 4GFJA 2F2AB 1IIPA 3HKZF 2F77X 2OYYA 2LYAA 3IP4B 2G0AA 4P0QB 3NUQA 5C0YA 3ALRA 2W04A 2W7PA 3NRWA 2YB1A 1P7DA 3CRXA 2LYBA 2DQNB 2E1FA 4CDGA 2CRXA 2VKQA 4IC9A 1A6SA 2HMXA 2GOLA 2JGAA 2K89A 1HEKA 2HBJA 2HBMA 3LVWA 3N7RC 3OPXA 2G5HB 2DGZA 2H3ZA 3IG8A 1ECWA 2E1EA 2H3QA 2WB1C 2K4EA 3D2NA 4PL1A 3T79A 2KJ8A 2JMGA 3AL0B 3M7DA 2KJ5A 2HBKA 2ZIUB 3L3FX 4QJFB 2GH1A 3H0MB 2HOIA 2ZIXA 4A8EA 2ZIVB 3F5AA 2LHTA 2Y0SC 3F53A 4FZNA 4KMOB 3PSTA 2PMZF 2KICA 3F5EA 2KHQA 2VJ5A 2XI9A 4NWIA 2LBOA 4AYBC 2YX8A 1UPHA 4QIWC 3HKZC 5HR7A 3M6KA 3M6ZA 3RF9A 2XICA 1ED1A 5KL8B 1CRXA 3KFUF 4OJOA 4P0PA 1Q3VA 2K8BB 1DRGA 4BUGA 2F8LA 2ZG6A 1NZBA 2LKYA 2NV3A 2KNJA 2KOBA 3C29A 3VC8A 1TAMA 4PL2A 1GO3F 2KEYA 3PSFA 4BX9C 2W7OA 1Z19A 3N7SC 1OUQA 5HR6A 2G08A 3RFAA 3MGVA 2KKPA 2JHDA 1SZHA 2KV2A 3IG5A 2WAQF 3F2CA 3PSIA 2VJ4A 2RRDA 2HBLA 3ICXA 4P0QA 3N7PD 1YT3A 5KL1B 3SAFA 4KX3A 2G09A 4KX5A 3LYSA 4FZLA 4NLCA 2H3VA 2RP5A 2E5SA 3PSPA 2MA1A 3O0FA 4OJ6A 1WUDA 3IN5A 2G06A 2H3IA 2MRLA 4P0PB 2YB4A 3E0FA 2F76X 1Z1BA 3D2QA 4QNLA 4ACOA 2KIWA 5A0LA 5CRXA 2OM6A 2JH1A 4OO1J 4OJPA 1D8BA 2ZIWA 2DF4B 4NV0A 2Z7JA 2ZIUA 2JH7A 2Y0SF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QJF B;  2HBK A;  2KV2 A;  2CPR A;  4O3M A;  4QIW F;  2RRD A;  2RHF A;  2HBL A;  1YT3 A;  3SAF A;  4NLC A;  5C0Y A;  2E1F A;  2MA1 A;  4CDG A;  3SAG A;  1WUD A;  3SAH A;  2HBJ A;  4NLB A;  2HBM A;  4CGZ A;  3CYM A;  2DGZ A;  2E1E A;  1GO3 F;  4OO1 J;  1D8B A; 
#chains in the Genus database with same CATH topology
 4M04 A;  4B9L A;  1WG8 A;  1X9X A;  5KFE A;  4US9 A;  1QSL A;  4YMM A;  8ICM A;  1MC8 A;  4OJL A;  5KG4 A;  2PFO A;  2YN4 A;  3SAG A;  5EWF A;  1QSY A;  8ICL A;  2KG5 A;  4E0D A;  4ECY A;  4LVS A;  2YML A;  4K4H A;  5KFO A;  4DL3 A;  4B9T A;  2HHX A;  4AYB F;  3HKZ F;  2F77 X;  5DB8 A;  3V7J A;  2W3S A;  3ALR A;  5CJ7 A;  3RAX A;  2YB1 A;  4KLF A;  5KFL A;  1T7P A;  3E2E A;  9ICW A;  1LB2 B;  3OJS A;  1B0X A;  2C2D A;  4Y2P A;  1JMS A;  5J2J A;  2DGZ A;  5B5E U;  1TV9 A;  3MFH A;  2P35 A;  3L3F X;  2QB0 B;  4J9Q A;  3TFR A;  1S0N A;  2EAO A;  1PK1 B;  4ECX A;  5AI0 A;  1N63 A;  2A19 A;  1XC9 A;  4QWE A;  1MN8 A;  1C7Y A;  3V7L A;  1Q3V A;  3RAQ A;  4I28 A;  3AM9 A;  5ALY A;  1QLN A;  2KZ3 A;  2E8O A;  3J81 j;  4EEL A;  1B4F A;  1RG6 A;  4GC7 A;  2IOF K;  1ZQX A;  2R8I A;  4DF4 A;  3WKB A;  5J0S A;  4DOB A;  1ZYQ A;  3SV4 A;  1BNP A;  1SV0 A;  3SD7 A;  1RYR A;  3HPO A;  1KKX A;  1X2I A;  2JEJ A;  4DQP A;  2E3T A;  2W55 A;  3D2Q A;  2BGW A;  3TFS A;  5ALP A;  4QZ9 A;  3BJY A;  4C8K A;  1N48 A;  4OJ5 A;  5J0Y A;  4TQS A;  2M0N A;  4DCC A;  3QEB Z;  4KN4 A;  2BPG A;  8ICI A;  2L5Y A;  3PW7 A;  4MHV A;  1N60 A;  3ETL A;  1PVR A;  4KLQ A;  4O3Q A;  4BWJ A;  4YFK A;  4UB5 A;  5KFI A;  3TKA A;  5JRT A;  2HHT A;  5ALQ A;  3PZP A;  4DL4 A;  4Y2S A;  1X42 A;  3N28 A;  5AKX A;  1MQ2 A;  4IR1 A;  2OCE A;  4RPZ A;  4TUP A;  4B9V A;  4DL6 A;  5GTI U;  2HBJ A;  1U49 A;  4QWB A;  8ICX A;  1ECW A;  7ICU A;  3JPP A;  3T79 A;  3NVZ A;  5KFF A;  4DSK A;  2GH1 A;  4O3S A;  4J9R A;  2ZIX A;  5AKJ A;  2AH5 A;  2KIC A;  2KHQ A;  2XI9 A;  1S8O A;  2LBO A;  3QNM A;  2YX8 A;  1T8E A;  4R63 A;  5HML A;  3KFU F;  5DLG A;  4IQV A;  2RQ5 A;  3C29 A;  3QUT A;  2OEH A;  5ALJ A;  5ALX A;  9ICH A;  1ZQE A;  3C21 A;  1J2N A;  2WAQ F;  8ICA A;  3N7P D;  4JWM A;  1UT5 A;  1KQQ A;  1J2M A;  3M8R A;  4P0P B;  2Y1J A;  4DLG A;  2R8J A;  5DG8 A;  1CI4 A;  2HW3 A;  2LMR A;  2ZJ5 A;  1JAL A;  4Q8F A;  7ICT A;  4IRC A;  2UVW A;  3UXP A;  1JI7 A;  2H3F A;  4O5C A;  5ALV A;  2B21 A;  1ZRN A;  2XVT A;  4EZ9 A;  3VCB A;  4GXK A;  4HAI A;  3KBB A;  2CN1 A;  4C80 A;  1JX4 A;  4O0I A;  1V9P A;  4I29 A;  4CNQ A;  4KTQ A;  1ZQ1 C;  1D8L A;  1DOQ A;  1M6Y A;  5ALZ A;  2QKQ A;  5DKW A;  9ICR A;  4JV2 A;  4Z6C A;  3RR7 A;  2DKZ A;  5KFV A;  3KKA A;  1ZQW A;  1N56 A;  4ECT A;  5ALU A;  5EWE A;  3DDH A;  4EEK A;  3TAD C;  2MSN A;  2A1J B;  2XY6 A;  3QZ7 A;  2WB1 C;  1JIH A;  4NL9 C;  1V38 A;  5IIM A;  8ICP A;  5H2F U;  1B22 A;  3HT3 A;  2PMZ F;  1H38 A;  3TAN A;  3PO4 A;  3GIM A;  4GLX A;  5AKZ A;  4F2S A;  4CF4 A;  3HX0 A;  4O5E A;  2ZG6 A;  4UAZ A;  4EYH B;  4FFD A;  5KAI U;  1COK A;  4F3O A;  4NLZ A;  2KMD A;  1O03 A;  3M1Y A;  1SZH A;  4YR2 A;  4I2F A;  1K1S A;  2LM4 A;  2KZZ A;  1RQN A;  8ICC A;  4KX3 A;  4UQG A;  3EPG A;  7ICE A;  1N62 A;  4IR9 A;  1TK0 A;  5L1L A;  2H5X A;  4JWN A;  4ELU A;  4OO1 J;  4ECW A;  2N1R A;  1TK5 A;  4KLD A;  4Y2Y A;  2XC9 A;  3RJI A;  1S0V A;  2ISP A;  3SZ2 A;  4OD0 A;  4O3R A;  4QZD A;  1LVH A;  1MA7 A;  1D8Y A;  1DXS A;  1KL9 A;  2KD1 A;  5IIL A;  4KLG A;  2OH2 A;  2FLP A;  8ICQ A;  4DS5 A;  4DFK A;  5ALW A;  4F93 B;  2HOQ A;  4HYK A;  1YZ7 A;  3IM1 A;  2KTQ A;  3GV5 B;  2C28 A;  1FO4 A;  3H0R B;  4O3N A;  2F44 A;  2K4I A;  2DWQ A;  4DQR A;  4PGY A;  2VAN A;  1X66 A;  2W04 A;  4F5N A;  3ISB A;  1P7D A;  3KHL A;  3CRX A;  2OHF A;  3JPR A;  2LYB A;  2DQN B;  3Q8S B;  3ZDC A;  3D2N A;  4EBD A;  3QUB A;  3V6J A;  4GXI A;  2OWO A;  3MFI A;  5EE3 A;  2F1H A;  2JV3 A;  2R8K A;  3H0M B;  1ZQF A;  2ZIV B;  4C4T A;  1ZQO A;  3B9J A;  2EH9 A;  3PST A;  1NK0 A;  4M9G A;  3F5E A;  1ZQV A;  4NWI A;  1UPH A;  4QIW C;  3RB6 A;  3A0B U;  3RF9 A;  5J2G A;  1SKR A;  4ECU A;  5KT6 A;  3RB4 A;  2XGP A;  1L7N A;  5J2D A;  2F8L A;  2MU2 A;  1BPB A;  4KN7 A;  1BPE A;  4GIB A;  4BX9 C;  4M9N A;  2LPE A;  1RPL A;  1DGS A;  3RR8 A;  3UM9 A;  3Q8R B;  5KT4 A;  1NK7 A;  5B66 U;  1ZQL A;  2F1J A;  4KLH A;  4KLT A;  2QAR B;  4B9N A;  9ICC A;  3PY8 A;  4K4G A;  2YY6 A;  2H3I A;  1ZQJ A;  5ALT A;  5L9X A;  4DSL A;  4R64 A;  3C5G A;  2JH7 A;  3ZDD A;  4C7Y A;  1NJY A;  3ONN A;  3V7K A;  4FE3 A;  2JR5 A;  4RPX A;  4EZ6 A;  4M0A A;  8ICN A;  4J9O A;  4QZ8 A;  3K1R B;  3EW9 A;  3AN1 A;  9ICV A;  1QSS A;  1BGX T;  3AU2 A;  2G07 A;  1TFR A;  3Q8M A;  4RT2 A;  4IRD A;  3SEI A;  3KZX A;  4DFM A;  2W9C A;  1HJP A;  4UAY A;  4UAT A;  2W54 A;  4GC6 A;  3LVV A;  3RJE A;  4KLE A;  3IRU A;  3RJG A;  3IP4 B;  5KFW A;  3H40 A;  2IOH A;  3WK9 A;  2W8K A;  2GOL A;  3PX0 A;  1ZJM A;  3LVW A;  1HEK A;  3UMB A;  5AIA A;  5L1I A;  1L3U A;  1TAU A;  2FMS A;  5ALD A;  2RLT A;  4XA5 A;  4RQM A;  1S0O A;  1ZD5 A;  1KFD A;  2WTF A;  2ZUC A;  9ICM A;  2HBK A;  1FIQ A;  1WCN A;  3F5A A;  2LHT A;  5DBB A;  4KMO B;  2RDI A;  1SL1 A;  4Z6F A;  2XCA A;  1NK6 A;  2IOF A;  4ZOH C;  5KL8 B;  1XWL A;  4OJO A;  5CEH A;  9ICB A;  1TAM A;  4PL2 A;  3IDW A;  4PZO A;  3RFA A;  3WKD A;  5DB9 A;  4FS1 A;  3GDX A;  3ETR A;  2BCS A;  4F91 B;  1RZT A;  5KFT A;  4ED1 A;  3QU7 A;  4RQ1 A;  1YT3 A;  2BCQ A;  1BPD A;  2NRX A;  4MF2 A;  3ISD A;  2JEI A;  4US8 A;  4Z6D A;  1S97 A;  1WUD A;  5IIO A;  2YB4 A;  9ICJ A;  2F76 X;  5AI9 A;  4QNL A;  5AM2 A;  2BCU A;  4NY8 A;  2ZIW A;  5CHG A;  3BZK A;  4ED7 A;  4BDP A;  2J6U A;  5AM1 A;  2KKV A;  4ICA A;  2K4H A;  5HMM A;  2KSO A;  4U7C A;  5J29 A;  4X5V A;  5AKL A;  2EQY A;  9ICS A;  9ICU A;  2XID A;  2W3R A;  3HW8 A;  1PVQ A;  4CGZ A;  4Y2T A;  2D6F C;  2VIX A;  1T94 A;  1X9W A;  2EZY A;  3HJE A;  5KG2 A;  7ICR A;  3AQE A;  7ICV A;  3N4M B;  5DDM A;  4DL2 A;  2BQ3 A;  3WU2 U;  3TAP A;  4Y2U A;  5KT3 A;  2LM1 A;  2M9N A;  3CNH A;  1RM6 C;  3D6J A;  4UW9 A;  3BDP A;  4MEX A;  1K1Q A;  4IC9 A;  2P6R A;  1J97 A;  1ZQR A;  2NRV A;  5DQH A;  5EWG A;  8ICK A;  4EYI B;  5AKG A;  1BPY A;  5F9L A;  2KJ8 A;  2MUT A;  4JK1 A;  3PW0 A;  3EPI A;  1JN3 A;  3V6K A;  5KFR A;  5CB1 A;  4C4S A;  2Y0S C;  3F53 A;  1YZ6 A;  5AIB A;  5J8Y C;  4R8U B;  4AYB C;  5HNK A;  3HKZ C;  4Y2Q A;  2DL0 A;  3NVW A;  3UMC A;  1ZD2 P;  4DFD A;  4RQ7 A;  4IQU A;  1NK5 A;  4GXJ A;  1Z19 A;  1XS9 D;  5L1K A;  2BDP A;  1Z00 A;  4KLS A;  5J0X A;  2KFN A;  1X6J A;  3PML A;  3PSI A;  3NTU A;  2LI6 A;  4OCZ A;  4PHD A;  5ALK A;  3QEA Z;  5III A;  2GWS A;  3SAF A;  3C2L A;  4FZL A;  5E79 U;  1ZQT A;  3MR3 A;  4TUQ A;  4F2R A;  2A1J A;  3NS1 A;  1T3N A;  2BR0 A;  3KZI U;  1IXR A;  1RXV A;  1COO A;  1PVP A;  3H7I A;  3H0L B;  4F8R A;  2G5I B;  5KFS A;  3SQI A;  2HOF A;  3PR5 B;  3HWT A;  4ELV A;  2IA6 A;  5HHH A;  3G6X A;  3I28 A;  2KVC A;  5KT5 A;  7ICN A;  7ICJ A;  5KNI A;  2HHQ A;  3M9O B;  2B0C A;  2Y1I A;  1A0P A;  5BOM A;  1A77 A;  3B0Y A;  1L8L A;  4IRK A;  5HR7 A;  4FZM A;  1VLB A;  3BQT A;  1LKY A;  1Y88 A;  4F4W A;  2PI4 A;  4CDG A;  2CRX A;  5ALI A;  3OHB A;  1KFT A;  2A1A A;  2K4E A;  4DQI A;  3KOO A;  4IQW A;  2AJQ A;  2W9B B;  4TUR A;  3RH5 A;  2HOI A;  3ZD9 A;  4QZB A;  1BPX A;  2ISO A;  1HUO A;  1ZRM A;  1JUD A;  1NZP A;  9ICK A;  4C8N A;  1Z4O A;  3T5H A;  1BPZ A;  1ZOL A;  5IIN A;  4B9M A;  4YQW A;  5KFY A;  2KOB A;  2KEY A;  2K4P A;  2ASL A;  8ICO A;  3JPO A;  3QU5 A;  2F3N A;  3F2C A;  3RH4 A;  4LJX A;  1L3S A;  9ICA A;  2JZB B;  3KTQ A;  3SV3 A;  3WKC A;  5KTQ A;  5KFZ A;  2PXI A;  2H3V A;  1JRO A;  2WF8 A;  3O0F A;  5EOZ A;  1D9D A;  3ZD8 A;  2G06 A;  1U47 A;  2DBY A;  5ALO A;  9ICT A;  3H8S A;  3G6Y A;  3MR5 A;  2QB1 A;  4QZI A;  2HHW A;  1F44 A;  3IHQ B;  4NM2 A;  8ICF A;  3PX4 A;  4EX7 A;  2Y9T A;  1ZD3 A;  3MC1 A;  2OXO A;  9ICG A;  2WAQ C;  4IS7 A;  5DGB A;  2IMW P;  3BZC A;  5AKH A;  4ELT A;  2FI1 A;  5BOL A;  4M9L A;  4NLB A;  3ZDB A;  1L7M A;  4C7Z A;  1SB3 C;  1T3Q A;  5BPC A;  7ICF A;  1XNS A;  2ZUB A;  3MGI A;  4F4X A;  3FAH A;  2CPR A;  3GU3 A;  3TAC B;  3I1Y A;  4I2J A;  1L7P A;  3OJU A;  4I27 A;  5ALR A;  2E8P A;  5F3X B;  1KEJ A;  3SEN A;  2D3D A;  4DOC A;  2W7P A;  2KZM A;  5KFU A;  5ALG A;  3WK4 A;  2YMP A;  2HBM A;  5KFD A;  4C8L A;  2WF9 A;  3PV8 A;  5DG9 A;  1SXE A;  2XGQ A;  1SKS A;  1N61 A;  5ALH A;  3PNC A;  5DLF A;  1F0M A;  2UVU A;  3MR6 A;  4K4I A;  3RB0 A;  5C5J A;  1ZQI A;  1O08 A;  2ASJ A;  4F5P A;  1S5L U;  1KW4 A;  1BNO A;  4CE6 A;  1QQ7 A;  4JV1 A;  3EUB 2;  1CRX A;  4PJ0 U;  5KFG A;  2FJ6 A;  2FMQ A;  4ZH4 A;  1KRP A;  2XO7 A;  4RQ2 A;  2WF7 A;  1PZN A;  1UA0 A;  3LWL A;  3CW2 C;  3ISC A;  3UXN A;  3IG5 A;  3L5K A;  1XO1 A;  4DFJ A;  1XU4 A;  4BXO A;  4KX5 A;  4KMU A;  3ZDE A;  4M6W B;  5J2A A;  1QCK A;  2CXY A;  1NJX A;  1XSP A;  4QZC A;  4PPX A;  2EAP A;  5ALN A;  8ICJ A;  4BWM A;  2DF4 B;  3M8S A;  4JB3 A;  4CF5 A;  1DK3 A;  7ICM A;  1SL2 A;  3KD3 A;  4FS2 A;  1NI3 A;  3FM9 A;  1X9S A;  4ECV A;  4B6J A;  3Q8K A;  3QYP A;  1NK4 A;  4M9H A;  9ICN A;  4BJQ A;  5CA7 A;  3U26 A;  2I9G A;  3FYH A;  4YXJ A;  1XO0 A;  4YD2 A;  2EAM A;  3QU4 A;  2C2R A;  4XQ8 A;  1IIP A;  4P0Q B;  3RB3 A;  5KFJ A;  4RQ4 A;  2E1F A;  2BPF A;  2VKQ A;  5CR0 A;  1UT8 A;  2ASD A;  2V4Q A;  2V4R A;  1L5U A;  3E58 A;  5ALF A;  4EEY A;  4P4O A;  2AXT U;  5DQI A;  5CWR A;  4PGX A;  1L7O A;  4UAS A;  4PH5 A;  1RYS A;  3K75 D;  3FC4 A;  4B9S A;  1KTQ A;  5J0R A;  2XIC A;  2NRZ A;  1CUK A;  4QZG A;  4O5K A;  1NZB A;  3IV6 A;  4DEZ A;  2KNJ A;  3PSF A;  5FP0 A;  5KG7 A;  2KFZ A;  3EWA A;  4IL6 U;  1SZP A;  4I2G A;  3M9N B;  5AK4 A;  1T4G A;  2G09 A;  4J9K A;  1IV8 A;  5DQG A;  9ICO A;  7ICH A;  1TVA A;  8ICZ A;  1ZD4 A;  3V72 A;  3WK8 A;  3NAS A;  1SKW A;  3RJJ A;  9ICQ A;  4DWI A;  5KFX A;  3G6V A;  1D8B A;  3M9M B;  4ED2 A;  9ICL A;  1NJZ A;  5KG3 A;  1WWU A;  2W9M A;  4CRX A;  8ICU A;  4QIW F;  7ICS A;  4ECR A;  1XSN A;  3RJF A;  3WKE A;  2ODG A;  5KFB A;  9ICX A;  9ICE A;  3CP8 A;  1KBU A;  4USA A;  5KFH A;  5JTI A;  2KVS A;  1BVS A;  4C0Z A;  5DB7 A;  5AKK A;  3QUC A;  2F8K A;  2QB0 A;  4KLO A;  3F2B A;  5ALS A;  2EZZ A;  2OYY A;  2AGO A;  1PK1 A;  3NUQ A;  3UXO A;  1ZQS A;  1D9F A;  3RRH A;  4ED0 A;  9ICF A;  3N7R C;  3OTQ A;  3NVV A;  5G5G A;  4PL1 A;  5ALE A;  2JXJ A;  4RNM A;  3KHG A;  4DFP A;  4MFC A;  3AL0 B;  4DSI A;  1ZQK A;  3RJH A;  2WF5 A;  5KG5 A;  8ICE A;  4UB3 A;  4A8E A;  4NL9 A;  5AI5 A;  3SI8 A;  4DQQ A;  4UB1 A;  1KSP A;  3TAQ A;  3M6K A;  1EXN A;  2XY7 A;  2YMM A;  3QUQ A;  4O3P A;  2AQ4 A;  4BUG A;  1SGG A;  3THV A;  2DUY A;  5JUM A;  4Q43 A;  1Z3E B;  2W11 A;  3TAR A;  1U4B A;  2KV2 A;  5AK3 A;  4RT3 A;  1SV0 C;  3K4G A;  2NRT A;  3QU9 A;  2I1Q A;  4AP9 A;  5J2F A;  5HHI A;  8ICG A;  3NVY A;  5AKE A;  3JPQ A;  2HVI A;  3QZ8 A;  3E0F A;  4JV0 A;  4C8O A;  1C20 A;  4ACO A;  8ICH A;  4Y2J A;  4NV0 A;  5IIJ A;  3WKA A;  2I5H A;  4RNN A;  5AK6 A;  2A3V A;  5HP4 A;  5EE1 A;  7ICL A;  3F2D A;  5J0T A;  5J2K A;  4J9P A;  1FEZ A;  4RQ8 A;  3SAH A;  2FPK A;  1RQL A;  3GZF A;  5G5H A;  2W9A A;  2ZXH A;  1IG6 A;  5J2I A;  4UB8 U;  3I76 A;  2Q4T A;  4M47 A;  1MQ3 A;  1SL0 A;  3DEE A;  2P6U A;  2J6S A;  5ALL A;  2G0A A;  8ICT A;  4UB4 A;  2W43 A;  4QWA A;  1CEZ A;  2HMX A;  4UB6 U;  4NLN A;  4DSE A;  3V6H A;  2AGP A;  2E1E A;  1NOM A;  3PR4 A;  5D46 A;  2JMG A;  5J0U A;  4QWD A;  2VA3 A;  3M7D A;  2ZIU B;  1HUZ A;  1KLN A;  1UCV A;  2PFN A;  4QW9 A;  3QX7 A;  2PFP A;  1Z4N A;  4I2B A;  1S76 D;  3RBE A;  1TE2 A;  3C2K A;  2IBK A;  4NXZ A;  4F5O A;  4P0P A;  2K8B B;  2D8C A;  3QU2 A;  3KHR A;  2KE7 A;  3PW2 A;  4J9N A;  2MAX A;  1GO3 F;  4YR0 A;  3C2M A;  4RZR A;  3PW5 A;  2P66 A;  3LWM A;  4NJ8 A;  5EE0 A;  3SR6 A;  3FDS A;  3ICX A;  5KL1 B;  1ZET A;  4YVZ A;  3HRD D;  4EEN A;  2ATL A;  2XY5 A;  2ES6 A;  3RRG A;  2NO5 A;  2KIW A;  5AK5 A;  5A0L A;  2KK0 A;  5F9N A;  4YXM A;  2Y0S F;  4MF8 A;  2BQU A;  1B43 A;  1ARO P;  7ICI A;  3T5J A;  2W03 A;  4KLL A;  1X6I A;  3WK5 A;  4KIT B;  4Q44 A;  3WK7 A;  4FBU A;  3R9K A;  1ZQH A;  2DPJ A;  3S6J A;  3AQF A;  4PHA A;  3JPS A;  3Q8Q B;  3QE9 Y;  5KFM A;  2KP7 A;  3PMN A;  2PI5 A;  3KKA C;  4O3M A;  1TKD A;  2F2A B;  2RDJ A;  1Q8K A;  3MR2 A;  7ICP A;  3C5F A;  2GLE A;  4M6W A;  1JXL A;  4F72 A;  5C0Y A;  4ED6 A;  5KG6 A;  2R8G A;  1NK9 A;  1A6S A;  1PUZ A;  4EX6 A;  5D49 A;  2HSZ A;  4Y2X A;  4KLM A;  4RQ0 A;  3OGU A;  2VA2 A;  1QTM A;  4XRH A;  1NNL A;  4KLI A;  1U45 A;  2W9C B;  4QJF B;  1ZQA A;  3GFK B;  3GIL A;  1Q46 A;  2AHO B;  2BZF A;  4F5Q A;  2EDU A;  1IM4 A;  1A76 A;  3UPQ A;  4RQN A;  4F71 A;  2PKE A;  5J2H A;  4QZA A;  3TQ1 A;  8ICR A;  3NRZ A;  1ZXI A;  2I6X A;  1QQ6 A;  4I2E A;  2KKP A;  1JRP A;  5AM5 A;  1S0M A;  2YQE A;  2RRD A;  2HBL A;  4P0Q A;  5AHX A;  4UB2 A;  3MBY A;  3SYZ A;  4NLG A;  5AKY A;  3L4P A;  3RH6 A;  1L3V A;  4QWC A;  2NRW A;  7ICG A;  4YCX A;  1ZQB A;  2ZTD A;  4Q8E A;  2OM6 A;  4OJP A;  4RUC A;  2Z7J A;  3C1Y A;  2YMQ A;  4F4K A;  3ORY A;  4DLE A;  5L1M A;  2K8A A;  2DFL A;  3A0H U;  4G9B A;  4DO9 A;  4JUZ A;  2BQR A;  3EYZ A;  3OSN A;  5J2E A;  1SWW A;  4RQ5 A;  3KHH A;  3T5L A;  5AI8 A;  2ZJA A;  4CCH A;  1L6N A;  3LDA A;  2ZIW B;  5T14 A;  1Q3U A;  5AI6 A;  2KJ9 A;  3RJK A;  2EAN A;  3LK9 A;  3K1Z A;  2UVV A;  2ZIV A;  4FO6 A;  4Q45 A;  4PZN A;  4YD1 A;  4UBB A;  3AEV A;  3BS5 B;  5K4L A;  2KSO B;  2NO4 A;  2JGA A;  2ZTE A;  2K89 A;  3DV9 A;  5GTH U;  3OPX A;  2EZX A;  2WF6 A;  3PO5 A;  1SWV A;  2PFQ A;  2QAR A;  4RQ3 A;  5AM4 A;  1WCL A;  2AGQ A;  1WYG A;  2VJ5 A;  1U9L A;  1ED1 A;  3HP6 A;  7ICK A;  4BGD A;  3AU6 A;  5J8Y A;  2NV3 A;  3OSP A;  3VC8 A;  3ED5 A;  2MUT B;  4QZE A;  5KFK A;  5KG1 A;  3AUO A;  3MDC A;  1ZQD A;  4RUA A;  3AMZ A;  3B0X A;  5AM0 A;  2VJ4 A;  5DBA A;  4O9M A;  5J2C A;  2KIV A;  8ICW A;  4XUS A;  4C4R A;  2W8L A;  2BPC A;  5KFA A;  5KFC A;  3Q8L A;  4CF3 A;  3GV8 B;  3HIL A;  2MRL A;  4P2H A;  1Z1B A;  4ECZ A;  5IIK A;  4P4M A;  2AU0 A;  3ZDA A;  1X40 A;  2HI0 A;  4Z6E A;  4LZG A;  1Z00 B;  7ICO A;  1VJ5 A;  2BDU A;  2VA8 A;  1ZQC A;  5DB6 A;  3JPN A;  2FPM A;  2RHF A;  1MSW D;  4R65 A;  2ZXI A;  3GII A;  2WB1 F;  4EBE A;  3RTV A;  2PMZ C;  1S77 D;  3CYM A;  8ICB A;  2Y9U A;  4U6P A;  2XCP A;  1URJ A;  2E8M A;  4QZF A;  3BQ1 A;  2JEF A;  3GQC A;  2DPI A;  4ED3 A;  1XSL A;  3NRW A;  1S10 A;  2NYV A;  2QLT A;  3TI0 A;  4ECS A;  3UQ2 A;  8ICY A;  4MEY A;  1F5S A;  3PX6 A;  1QH9 A;  4YG2 A;  4MFF A;  2HHU A;  1KFS A;  3RBD A;  1ZQG A;  2ZUD A;  4ECQ A;  1LKY B;  1SV4 A;  5J0W A;  4FBT A;  4DOA A;  2AQ0 A;  2HVH A;  5J2B A;  2Q0Z X;  1DRG A;  4F92 B;  5J0Q A;  1SXD A;  2W7O A;  1ZQM A;  5J0P A;  4IQT A;  2E8N A;  4F50 A;  2LYH A;  2B6G A;  5KT7 A;  3GV7 B;  9ICI A;  1PK3 A;  2YTU A;  7ICQ A;  3OHA A;  1ZQN A;  2E5S A;  1LV5 A;  4I2C A;  5KFN A;  4OJ6 A;  1ZQP A;  3WK6 A;  2F1I A;  3UMG A;  2BCR A;  1DK2 A;  1NJW A;  1N5X A;  1Z1V A;  2FDR A;  4I2A A;  2ZIU A;  3BQ0 A;  4DL5 A;  2ALZ A;  4RNO A;  4M9J A;  4O3O A;  2ZIX B;  3SMV A;  3GIJ A;  4YN4 A;  1QQ5 A;  1VDV A;  3H8W A;  3PVX A;  3ZI4 A;  3MGH A;  3C28 A;  3NGD A;  4TUS A;  4DS4 A;  5EE9 A;  1AQ6 A;  2R18 A;  3MDA A;  1UA1 A;  5KG0 A;  2FMP A;  1NKE A;  5DG7 A;  4JMU A;  4MFA A;  4GFJ A;  2ZTC A;  2LYA A;  3UQ0 A;  1NK8 A;  4R8U A;  1X9M A;  3BQ7 A;  2GO7 A;  3H4D A;  1S9F A;  1RXW A;  4PHE A;  5L1J A;  2G5H B;  4NLK A;  4DL7 A;  4QW8 A;  2C22 A;  2BKE A;  5JU5 A;  1L3T A;  1V97 A;  2KJ5 A;  1JXE A;  4F4Z A;  5TIS U;  4FZN A;  4UAW A;  4YMN A;  2K60 A;  2FLL A;  2O6K A;  1FFU A;  1ZQU A;  2HHV A;  2LKY A;  3T3F A;  4Y2V A;  1OUQ A;  3N7S C;  5KFQ A;  2G08 A;  5DGA A;  4PGQ A;  4J9L A;  3TAD A;  4ED8 A;  1DGJ A;  2BCV A;  3C1Z A;  1KN5 A;  2RP5 A;  3PSP A;  4P4P A;  2MA1 A;  8ICS A;  2J6T A;  1FFV A;  4G3I A;  3C23 A;  5AKI A;  5AI4 A;  4DSF A;  1SIJ A;  1TAQ A;  3PW4 A;  5CRX A;  2UVR A;  4YMO A;  3BS7 A;  1UQV A;  4YP3 A;  4J9M A;  4NM1 A;  4LZD A;  2HHS A;  1ZJN A;  2FLN A;  4J03 A;  4WJ3 B;  2HCF A;  2K8C B;  2IHM A;  2KHV A;  2FPL A;  4BXO B;  4DQS A;  4RQ6 A;  4F5R A;  3D2S A;  5TZV A;  3T5K A;  2ZJ8 A;  1NKC A;  1V85 A;  5DBC A;  1HIW A;  3GIK A;  1RDF A;  4I2H A;  2WHE A;  3MAB A;  4UAV A;  1KDH A;  1OXJ A;  2JEG A;  1N2X A;  3H8J A;  2W9B A;  4RU9 A;  4J9S A;  5D4B A;  3JPT A;  3N97 B;  1ZQQ A;  1WWV A;  5CP2 A;  1NKB A;  5J0O A;  4Y2R A;  4KLJ A;  2DKX A;  4DF8 A;  2V9W A;  2H3Z A;  3IG8 A;  2H3Q A;  4I2D A;  4KLU A;  4UBC A;  1OW5 A;  3H8M A;  3QXG A;  3H4B A;  2IHN A;  4DSJ A;  1K5O A;  1N5W A;  2JZB A;  5KT2 A;  4I2I A;  4UAU A;  4C8M A;  3Q8P B;  2ESE A;  5DDY A;  4PHP A;  1TK8 A;  2BHN A;  3M6Z A;  4EBC A;  4R66 A;  2HDO A;  1RYU A;  1UHU A;  4QZH A;  2JRZ A;  4UAR A;  4B9U A;  1ZQZ A;  1L8O A;  5HR6 A;  5ALM A;  3MGV A;  5AIC A;  2JHD A;  5AM3 A;  2C2E A;  4M2Y A;  4TQR A;  3BS5 A;  1U48 A;  8ICV A;  2R8H A;  4F4Y A;  4RPY A;  2KN7 A;  3LYS A;  4NLC A;  2FE9 A;  3EZ5 A;  5KFP A;  3BQ2 A;  4YR3 A;  3IN5 A;  1ZQY A;  2WFA A;  5KAF U;  2JH1 A;  9ICP A; 
#chains in the Genus database with same CATH homology
 2N1R A;  1PVP A;  3ONN A;  2BDU A;  1F44 A;  4CRX A;  4FE3 A;  4WJ3 B;  2K8C B;  4QIW F;  4OJ5 A;  2K8A A;  2H3F A;  2RHF A;  2KHV A;  2M0N A;  2A3V A;  2ZIX B;  2KKV A;  3SMV A;  2OXO A;  2W03 A;  3H0L B;  4ICA A;  2G5I B;  3F2D A;  2K4H A;  3D2S A;  2WAQ C;  4U7C A;  4OJL A;  2XVT A;  3SQI A;  2ZXI A;  2XID A;  3CP8 A;  3VCB A;  3SAG A;  1MA7 A;  1KBU A;  2HOF A;  2WB1 F;  3C28 A;  3SAH A;  2CN1 A;  2PMZ C;  2KD1 A;  1HIW A;  1PVQ A;  2G07 A;  4BJQ A;  1PVR A;  2OH2 A;  4NLB A;  4O3M A;  4CGZ A;  3AQF A;  3CYM A;  2KVC A;  3GZF A;  1ZQ1 C;  2D6F C;  2HOQ A;  2ZXH A;  1L6N A;  2R18 A;  3KZX A;  4C0Z A;  2VIX A;  1T94 A;  1XNS A;  2ZIW B;  5T14 A;  1XO0 A;  1Q3U A;  2Q4T A;  3H0R B;  2KJ9 A;  1A0P A;  3AQE A;  4U6P A;  2CPR A;  3PZP A;  2K4I A;  3GU3 A;  3LVV A;  4JMU A;  1URJ A;  3K1Z A;  3DEE A;  2ZIV A;  4FZM A;  4AYB F;  3F2B A;  4GFJ A;  2F2A B;  1IIP A;  3HKZ F;  2F77 X;  2OYY A;  2LYA A;  3IP4 B;  2G0A A;  4P0Q B;  3NUQ A;  5C0Y A;  3ALR A;  2W04 A;  2W7P A;  3NRW A;  2YB1 A;  1P7D A;  3CRX A;  2LYB A;  2DQN B;  2E1F A;  4CDG A;  2CRX A;  2VKQ A;  4IC9 A;  1A6S A;  2HMX A;  2GOL A;  2JGA A;  2K89 A;  1HEK A;  2HBJ A;  2HBM A;  3LVW A;  3N7R C;  3OPX A;  2G5H B;  2DGZ A;  2H3Z A;  3IG8 A;  1ECW A;  2E1E A;  2H3Q A;  2WB1 C;  2K4E A;  3D2N A;  4PL1 A;  3T79 A;  2KJ8 A;  2JMG A;  3AL0 B;  3M7D A;  2KJ5 A;  2HBK A;  2ZIU B;  3L3F X;  4QJF B;  2GH1 A;  3H0M B;  2HOI A;  2ZIX A;  4A8E A;  2ZIV B;  3F5A A;  2LHT A;  2Y0S C;  3F53 A;  4FZN A;  4KMO B;  3PST A;  2PMZ F;  2KIC A;  3F5E A;  2KHQ A;  2VJ5 A;  2XI9 A;  4NWI A;  2LBO A;  4AYB C;  2YX8 A;  1UPH A;  4QIW C;  3HKZ C;  5HR7 A;  3M6K A;  3M6Z A;  3RF9 A;  2XIC A;  1ED1 A;  5KL8 B;  1CRX A;  3KFU F;  4OJO A;  4P0P A;  1Q3V A;  2K8B B;  1DRG A;  4BUG A;  2F8L A;  2ZG6 A;  1NZB A;  2LKY A;  2NV3 A;  2KNJ A;  2KOB A;  3C29 A;  3VC8 A;  1TAM A;  4PL2 A;  1GO3 F;  2KEY A;  3PSF A;  4BX9 C;  2W7O A;  1Z19 A;  3N7S C;  1OUQ A;  5HR6 A;  2G08 A;  3RFA A;  3MGV A;  2KKP A;  2JHD A;  1SZH A;  2KV2 A;  3IG5 A;  2WAQ F;  3F2C A;  3PSI A;  2VJ4 A;  2RRD A;  2HBL A;  3ICX A;  4P0Q A;  3N7P D;  1YT3 A;  5KL1 B;  3SAF A;  4KX3 A;  2G09 A;  4KX5 A;  3LYS A;  4FZL A;  4NLC A;  2H3V A;  2RP5 A;  2E5S A;  3PSP A;  2MA1 A;  3O0F A;  4OJ6 A;  1WUD A;  3IN5 A;  2G06 A;  2H3I A;  2MRL A;  4P0P B;  2YB4 A;  3E0F A;  2F76 X;  1Z1B A;  3D2Q A;  4QNL A;  4ACO A;  2KIW A;  5A0L A;  5CRX A;  2OM6 A;  2JH1 A;  4OO1 J;  4OJP A;  1D8B A;  2ZIW A;  2DF4 B;  4NV0 A;  2Z7J A;  2ZIU A;  2JH7 A;  2Y0S F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...