2MA1A

Solution structure of hrdc1 domain of recq helicase from deinococcus radiodurans
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
75
structure length
75
Chain Sequence
HDAPLFEALRAWRLQKAKELSLPPYTIFHDATLKTIAELRPGSHATLGTVSGVGGRKLAAYGDEVLQVVRDSSGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title NMR structure of the N-terminal-most HRDC1 domain of RecQ helicase from Deinococcus radiodurans
rcsb
source organism Deinococcus radiodurans
molecule tags Dna binding protein
molecule keywords DNA helicase RecQ
total genus 20
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2013-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00570 HRDC HRDC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.80 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2ma1A00
2HBMA 4NLCA 2DGZA 4O3MA 2HBKA 2HBLA 2HBJA 2E1EA 2CPRA 3SAGA 1D8BA 4NLBA 3CYMA 1YT3A 4CDGA 4QJFB 3SAHA 4CGZA 2KV2A 1GO3F 4QIWF 2E1FA 5C0YA 3SAFA 2RHFA 1WUDA 4OO1J 2MA1A 2RRDA
chains in the Genus database with same CATH superfamily
4Y2YA 3I1YA 2HVIA 2DUYA 3N28A 3QUBA 3QUQA 4QZHA 3GIKA 4O5CA 5ALDA 3NVYA 2LPEA 4RQ8A 3UMBA 2PFQA 1JIHA 9ICFA 3JPQA 2KK0A 4DLGA 3C1ZA 2MA1A 1WWVA 4EZ6A 2HBJA 4ECSA 2ZUCA 2KVSA 3PV8A 2KJ9A 1DGJA 5KFZA 3WK8A 1CUKA 1FFUA 1ZQSA 5ALJA 2XY7A 4WJ3B 3M9MB 5J0XA 5KT7A 2EH9A 3WU2U 4F93B 3TAQA 5IIJA 4DFKA 1X2IA 5KTQA 3V6KA 3J81j 3PX0A 1U4BA 3GQCA 4C0ZA 4LVSA 1ZQZA 4PHEA 1B0XA 9ICKA 1D8YA 1IIPA 3AN1A 1GO3F 3M8SA 2BCQA 2XIDA 2LM4A 4UB4A 5ALXA 7ICIA 3KD3A 5K4LA 4I2DA 7ICGA 5DDMA 9ICXA 2JZBA 3RH5A 2P66A 2KIWA 3GIJA 3N4MB 5JUMA 5TISU 2AHOB 8ICAA 5IIKA 3PW4A 1Z1VA 4RQ4A 3N97B 2H3QA 1BGXT 4DFPA 3EZ5A 3KTQA 4Z6FA 4J9OA 4O9MA 3NS1A 3V7JA 5J2EA 3UXPA 5AI8A 2DGZA 4F5NA 4G9BA 4UARA 4C4TA 2BKEA 3IRUA 4KX3A 8ICPA 5EWEA 9ICMA 2MRLA 2ES6A 5J0PA 2YTUA 3ICXA 5KFTA 2QB0B 4BWMA 5IIIA 3MGVA 1HEKA 2FLLA 2Y1JA 1KSPA 1ED1A 4M9JA 4DLEA 2F1IA 1Q3UA 2VIXA 2OM6A 1RM6C 2XY6A 4F5OA 1ZQTA 1ZYQA 3I28A 3KKAC 1U45A 1J2NA 1BPZA 5KFSA 4ECTA 1L7MA 4DQIA 7ICQA 1NJZA 1SKRA 3RTVA 5KG2A 4F91B 3QU9A 5HHIA 4ED6A 5ALQA 3C28A 4X5VA 5ALNA 2A3VA 2KZMA 4P4OA 4F4WA 3QE9Y 2FMQA 2BQ3A 4C8KA 3OTQA 5DB8A 5J2IA 4RQ7A 4M6WA 1N2XA 1A0PA 5AI6A 3K1ZA 2G5HB 7ICKA 3KZIU 5HHHA 3PW7A 5KFVA 2IOHA 2DPIA 2FPKA 4BGDA 1X6IA 4IQTA 4UB5A 1NK8A 2FLNA 3BDPA 7ICVA 3HWTA 3SAGA 4PZNA 1MC8A 2JXJA 2ZIWA 4JV2A 1L8LA 4E0DA 5KG5A 2C2DA 4RQ2A 4KLFA 1S0VA 8ICKA 1U47A 2ZUDA 1SV0A 4IRKA 4ED2A 3C2LA 5ALEA 2KVCA 1ZD4A 2V9WA 2DBYA 2I1QA 5AK5A 3PY8A 4J9PA 5DGAA 2KICA 3LYSA 1NKCA 1X9SA 1XU4A 5EOZA 1KLNA 5EE1A 1Z4NA 5AM4A 4ECXA 4YVZA 3HW8A 1UHUA 7ICMA 4DCCA 3H8WA 1XO1A 2HMXA 2RDJA 2HVHA 2JHDA 4CF4A 2ZJ8A 3BZCA 5J0SA 3QU4A 1QTMA 5AIBA 4YP3A 3RH6A 3SQIA 4KMUA 3FM9A 2ZTCA 4DL6A 4U6PA 1WWUA 4R8UA 3G6XA 4RPYA 1ZQHA 2M9NA 1FFVA 2K4PA 2F1JA 5AIAA 3RFAA 2B6GA 4ELVA 1SXEA 2JEGA 4FZLA 1NKEA 4C4RA 4J9QA 1ZQKA 7ICRA 4ICAA 5KFNA 3C29A 3LWLA 4B6JA 1ZQXA 4DOBA 4M9HA 2EZZA 2XVTA 4JV0A 5KG4A 4TUQA 8ICUA 1SB3C 2ZG6A 5ALIA 4HAIA 9ICNA 4LZGA 4CNQA 2Y0SC 4CRXA 4FE3A 2IMWP 3C23A 2WAQF 1JRPA 4QJFB 5KFLA 4IC9A 2W43A 1L7OA 3EW9A 3RJIA 8ICHA 2F3NA 1T4GA 1XO0A 1XSLA 1ZD3A 3RRGA 9ICEA 5ALHA 4UAUA 4Y2PA 4YMOA 3WK9A 2ZIUA 5IIMA 1UA1A 4LZDA 2Y1IA 4US8A 1NKBA 4Q8FA 2LHTA 4F92B 4O3RA 1RXVA 2IOFA 1ZOLA 2O6KA 5AK6A 2EAMA 1D9FA 1KQQA 1L3SA 2DF4B 3PMNA 3RJKA 2PI4A 3RB4A 4QIWC 4DSLA 2KKPA 1RYUA 5DGBA 1SV0C 4PZOA 3PNCA 1N5WA 5J2GA 3HT3A 3ISCA 1SL0A 1WCNA 2FPMA 4KN4A 2ZIVA 2PFNA 3WKDA 2VA2A 3H0RB 4YXJA 5J0QA 2PMZF 4I2BA 2XI9A 4MFFA 8ICEA 4K4IA 3AU6A 3RJHA 1L3VA 5B66U 3K4GA 1SIJA 2E8OA 3ZDCA 2FMSA 7ICNA 4J9KA 4ECVA 2KSOB 4FBTA 4QWDA 5L9XA 4F3OA 3KZXA 1ZD5A 1Q46A 2UVVA 1D8BA 4UB8U 2Y0SF 3EUB2 3NVZA 2OHFA 5ALWA 3G6YA 5KL1B 3RJGA 4OJLA 1IG6A 4J9LA 1T3QA 5ALUA 1A77A 2BHNA 5KG7A 5AM0A 4PGXA 4DFJA 5AKGA 4F2RA 3KOOA 4R65A 2LYBA 4YFKA 5CEHA 4XRHA 1SWVA 3A0HU 4EX7A 2UVRA 1T8EA 5BOLA 2JR5A 1XC9A 3CP8A 5TZVA 3MBYA 3E2EA 2NRXA 5DLFA 1ZQIA 9ICRA 1PVPA 2LMRA 4YR0A 2D3DA 3IV6A 4JWNA 2ISPA 3BQ7A 4O5EA 2OWOA 5HR7A 8ICZA 1OXJA 4I2EA 9ICAA 4UQGA 2BPGA 1XWLA 3WK6A 3MR6A 4K4GA 1T3NA 2BCRA 2G0AA 4YMMA 5DQGA 5CHGA 5J29A 2FPLA 2FJ6A 1RPLA 1ZQCA 3IM1A 4EX6A 2NYVA 5AI9A 5KT5A 1B22A 4QZAA 5CA7A 5CB1A 5KFJA 1X40A 1V97A 2BCUA 4CGZA 1Q8KA 3IN5A 2BQRA 3RR8A 1KW4A 8ICJA 2ZIVB 4QIWF 2DKZA 5J2CA 4FO6A 2H3VA 5ALMA 5AKJA 3AMZA 3T5LA 3N7RC 2XO7A 4DL7A 1ZQNA 5J0WA 5KFCA 3QYPA 2KSOA 4MF2A 4QNLA 2NRTA 1N5XA 5KG0A 4Y2TA 5EWFA 4ZOHC 1TAQA 3WKCA 4I27A 1K1QA 2XY5A 1D9DA 4P0PB 4UAVA 3NVWA 1RYSA 2HHSA 1DGSA 3OSPA 3AUOA 2HCFA 9ICLA 4KTQA 9ICWA 4RT3A 4J03A 2VKQA 3ETLA 2YMQA 5J2DA 4ED3A 3M7DA 1PZNA 5CWRA 5DDYA 4FS1A 5CR0A 1K1SA 1WG8A 1M6YA 3KHHA 3FYHA 4JB3A 4UB6U 9ICVA 3H8JA 1ZJMA 2G07A 1LVHA 2NRWA 2W9BA 3RBDA 4KLSA 1RQLA 1QQ7A 1L8OA 2ZJ5A 4ED0A 3F2BA 5C0YA 3ED5A 2MUTB 3GDXA 3TADA 4EZ9A 5IIOA 2AGOA 3CNHA 3Q8LA 2VJ5A 4QWBA 1QQ6A 2F8LA 4UBCA 4KLQA 1SGGA 2NRVA 2WTFA 4EYHB 3PZPA 4I29A 2GOLA 5KAIU 4US9A 2W3RA 4UAZA 4CE6A 2F8KA 4DFMA 3M9OB 3PW5A 1P7DA 2EZYA 8ICYA 1ZD2P 1FO4A 3MR3A 3N7PD 3UXNA 4ECQA 4DL2A 4KLEA 4DQRA 2DWQA 5HNKA 2EQYA 5DQHA 4RUAA 5DKWA 2YMMA 5EE0A 1X9XA 3B0YA 4TUPA 2KJ8A 5ALFA 1ZQBA 3MFHA 2E3TA 9ICBA 2WF5A 5KFDA 1SKWA 5J2HA 1N60A 5AKEA 3MGHA 3H8MA 1FIQA 2AQ0A 3EWAA 1LV5A 3MR5A 4C8OA 3V72A 4EYIB 3OJSA 1K5OA 4A8EA 4P0QA 8ICCA 3THVA 2ZIWB 5BOMA 3BQ1A 1IV8A 3PR5B 1NJWA 8ICVA 3SZ2A 1MA7A 9ICIA 5DG9A 2ZTDA 3L3FX 2C2RA 3PSIA 9ICJA 4OD0A 3ONNA 2H5XA 3FC4A 2FE9A 4MEYA 2ZJAA 4BUGA 2AH5A 1MQ3A 1ZQQA 4F50A 4GC6A 2R8JA 2KFZA 2HOQA 2XC9A 2HHQA 4IQUA 2R8KA 1F0MA 4QWCA 8ICMA 4RQNA 9ICTA 2E8NA 4KLDA 4C8MA 4BX9C 4F71A 2F76X 5AI5A 1LB2B 4F8RA 4NLKA 3N7SC 4DSFA 3CYMA 4GLXA 1RYRA 4QW8A 4PL1A 3RF9A 3ETRA 3MR2A 2QKQA 3EYZA 3M6ZA 2JEIA 2Z7JA 5D46A 1BPXA 5ALYA 3EPIA 1Z1BA 4NXZA 1ZETA 4TURA 5AKKA 4RQ5A 1V85A 3UMGA 4C7ZA 3TACB 2E1EA 2YX8A 4M2YA 4RPXA 2M0NA 2JH1A 3GZFA 4NV0A 4ECRA 4BJQA 4QZ8A 3LVVA 2C2EA 2KHVA 2OCEA 1XSPA 4HYKA 3L5KA 3LK9A 5AI0A 2K89A 2RDIA 4F5RA 2PFPA 2KEYA 1X42A 5DBCA 4JUZA 3RBEA 3M6KA 3C5FA 1Z00A 1S5LU 2YY6A 4DOCA 4UATA 5AKIA 3JPOA 4UAYA 3EPGA 4RQ1A 4YR3A 2WF9A 2KJ5A 3WKBA 4Y2XA 4QZEA 1A6SA 1ZQYA 3IDWA 1NZBA 5H2FU 5J0YA 2XICA 1N61A 2IHMA 3UM9A 4DS4A 1O03A 3QUCA 3B0XA 4NLZA 3C2KA 4PPXA 4IRCA 4NY8A 3QXGA 4O5KA 2AU0A 3VC8A 1QSYA 5ALOA 4RQ6A 3PX6A 2K8CB 3AEVA 8ICIA 3SV4A 3PSTA 4I2CA 3BJYA 3PW2A 4F4XA 3O0FA 2YB1A 2BDUA 3SAHA 2DPJA 2ZIUB 2Y9UA 4GXJA 2AQ4A 2F2AB 3HILA 8ICQA 2KHQA 3NTUA 4PJ0U 3FAHA 2JMGA 4RNOA 4IR9A 3K1RB 1UA0A 3HKZF 4UASA 2WB1C 1ZRMA 5J2FA 4B9NA 5KG6A 3DDHA 3PO4A 1BPBA 4IQVA 1YZ6A 4KITB 4KLTA 4QWAA 1NK7A 4GXIA 5KFFA 3CRXA 5DBAA 3NUQA 4UW9A 4QW9A 5GTHU 2A19A 5KT2A 2KE7A 4AYBC 2BPFA 4NLCA 1BPDA 2WF6A 2NV3A 3ISBA 3AQFA 3GV5B 2MAXA 2J6SA 5HR6A 4EBEA 4Y2RA 3WKAA 3FDSA 1JMSA 2LKYA 4NM2A 4DL5A 1L3TA 3RJFA 2LBOA 3SAFA 4KLMA 1TK8A 2W8LA 3SV3A 3GIIA 4Y2JA 4CF5A 1B43A 1NJXA 3V6JA 2RRDA 2FDRA 1F5SA 1V9PA 4UB2A 4B9VA 2E5SA 4RQ3A 5J2AA 2IA6A 5KFKA 1RZTA 5EE3A 2EAOA 4O0IA 5KFPA 5IINA 1ZQ1C 1JALA 3UQ2A 4YXMA 4NLNA 2BPCA 3BS7A 3L4PA 2QB0A 2HBLA 4Q43A 3H7IA 7ICHA 2KP7A 3JPNA 2BCSA 5A0LA 4FZMA 4F4YA 4EBDA 1QQ5A 2HHXA 4Y2VA 2JEFA 1SL2A 3KHGA 1L5UA 2FI1A 2GO7A 4O3MA 5FP0A 5HMLA 3TFSA 4QWEA 4ECYA 2BR0A 4JK1A 1B4FA 4YG2A 1CI4A 5EWGA 1XS9D 1XSNA 4KLLA 3QNMA 2PKEA 3T5KA 4DL4A 1EXNA 1URJA 1KRPA 1COKA 2ZTEA 2UVWA 2MU2A 3V7LA 4UB1A 7ICLA 2EANA 4BDPA 2P35A 4KLHA 3Q8MA 3RAXA 1C7YA 4DFDA 4KLGA 1Z00B 5DBBA 1WYGA 1ZQWA 3KBBA 1V38A 4P0PA 5JRTA 2P6RA 8ICNA 3GV8B 1ZJNA 3NRWA 2PXIA 2BQUA 4I28A 3K75D 2AGPA 3DEEA 2AJQA 4P4MA 2D8CA 9ICQA 4DL3A 2FLPA 3RJJA 3AM9A 2K60A 1HUZA 1RG6A 1KDHA 1ZRNA 2HHTA 4PH5A 2XGQA 8ICBA 5B5EU 2K4HA 2YB4A 8ICTA 5DB9A 2L5YA 3T3FA 1JX4A 1BNOA 4NWIA 1DXSA 1TV9A 4AYBF 2QARB 2XCPA 3LWMA 1UQVA 1KKXA 2VJ4A 4M9LA 3JPSA 4JMUA 5AKYA 4I2FA 5AI4A 5AK4A 1NK6A 2ZXHA 4CCHA 1S8OA 7ICPA 5BPCA 4PL2A 5ALLA 4O3PA 5KG1A 1Y88A 2F44A 4F72A 2W7OA 4MFCA 2D6FC 3HX0A 4MHVA 1KFSA 1F44A 3PX4A 4RNNA 1CEZA 4EBCA 2RLTA 1UPHA 4KMOB 3T79A 2W03A 1L7PA 5J0UA 1J97A 4PHAA 4MFAA 3OJUA 2HW3A 1TFRA 5KFIA 4UBBA 3PSPA 3QUTA 1KBUA 3BZKA 4GXKA 1T7PA 2FMPA 4RUCA 3C5GA 5DQIA 1MN8A 4Q44A 4YN4A 4BXOB 3WK7A 2C22A 1CRXA 3H4DA 2XGPA 4UB3A 3HPOA 1TVAA 5CRXA 3E58A 8ICXA 2C28A 1QLNA 3UPQA 3PW0A 2DFLA 2K8AA 3JPRA 3PSFA 3RB6A 1KEJA 1IXRA 3BS5B 1PUZA 5D4BA 3ORYA 4NLBA 3D2SA 4ED7A 5DG8A 1DK3A 2LM1A 4ED8A 1NK4A 2OYYA 4JV1A 2W54A 2ISOA 4FS2A 4C80A 3TANA 1KTQA 2F77X 5L1LA 1FEZA 2QARA 1TK5A 3RRHA 2V4RA 3RJEA 5AK3A 1TAUA 1BVSA 2AGQA 2H3IA 3BQTA 2R8GA 4QZCA 4QZFA 2GLEA 3OPXA 1YZ7A 2KV2A 4DO9A 2HDOA 4NM1A 4ECZA 2DKXA 1NZPA 4C8NA 3S6JA 5KT3A 5AM3A 1Z4OA 1HJPA 2YN4A 1VLBA 4ZH4A 8ICFA 2ODGA 1DRGA 1TKDA 4NJ8A 1C20A 3SEIA 4KLUA 1L7NA 2G08A 5ALSA 2KN7A 2KZZA 1WCLA 5ALKA 1SZHA 3RB0A 4Y2SA 4YD2A 1UT5A 5J8YC 4RZRA 5DB7A 1ZQEA 8ICLA 2NRZA 1JXLA 5KFBA 3PVXA 4DSJA 5J0OA 5J2KA 8ICRA 2IHNA 1ZQOA 2HBMA 2HSZA 5KT4A 4RQMA 4M47A 5GTIU 4KN7A 2JRZA 2LYHA 2KZ3A 2BCVA 1J2MA 4KLJA 4DEZA 2A1JA 2G5IB 4O3NA 5T14A 1OW5A 5F9LA 4J9NA 3VCBA 2DL0A 2KG5A 4IR1A 4RQ0A 2BZFA 2W9BB 3ISDA 3RH4A 1S0OA 1X9WA 2NO4A 3Q8QB 3H0LB 1KN5A 2LI6A 5JTIA 8ICOA 3TKAA 2I6XA 3GIMA 1D8LA 3QU7A 5C5JA 4DSKA 1SWWA 5J2JA 3NVVA 2W8KA 4RNMA 5E79U 5IILA 4PHDA 2WF7A 4Z6CA 5AHXA 5L1MA 3NRZA 1AROP 1N62A 4ECWA 3ZD9A 2VA3A 1LKYA 4I2IA 3Q8SB 9ICPA 2HHWA 4FBUA 2ZUBA 5KFGA 1AQ6A 3MC1A 2ATLA 4KLIA 2JEJA 3H8SA 2ZIXB 1JUDA 3HRDD 4Y2UA 3MDAA 2E1FA 4ELTA 4DQPA 2ALZA 4PGQA 1HIWA 4QZ9A 1SKSA 4DSEA 3HJEA 4F4ZA 2B21A 1QSSA 4B9TA 5CP2A 4M9GA 3WK4A 2P6UA 3H40A 4EEYA 4R8UB 4DWIA 3V7KA 1S9FA 3MGIA 3QU5A 4Z6DA 1MSWD 1T94A 3IP4B 2K4EA 4AP9A 5KFMA 1NK0A 2A1JB 4F5PA 2BGWA 8ICWA 1KFDA 4OCZA 3SMVA 2I5HA 3UMCA 5KFYA 3AU2A 3C2MA 5HP4A 5KFHA 3KKAA 3LVWA 2KTQA 3Q8RB 4M04A 4R64A 2WFAA 5J0TA 1XNSA 4YQWA 4KLOA 1BNPA 2KIVA 4J9SA 2PI5A 3GV7B 4BWJA 2K4IA 3SD7A 3D2NA 1NI3A 3T5JA 1ZQMA 3D2QA 4IRDA 3MDCA 4TQSA 4ECUA 3WKEA 2H3ZA 2RHFA 5KFUA 3NGDA 3ZDBA 3C21A 3KFUF 4F5QA 4Q45A 4U7CA 4G3IA 3RAQA 2CXYA 5ALZA 7ICUA 1Z3EB 3B9JA 2ESEA 2Q4TA 2KOBA 1SV4A 7ICSA 2E8PA 4P2HA 4KX5A 3CW2C 5D49A 2PFOA 1IM4A 2NO5A 2G06A 3F53A 1BPEA 2N1RA 4R66A 2Y9TA 4FFDA 2WHEA 4F2SA 4B9UA 2HOIA 2UVUA 3ALRA 1Z19A 1O08A 4I2AA 3HP6A 4C8LA 1QSLA 3HKZC 3QEAZ 4R63A 3IHQB 3OHAA 7ICTA 1SXDA 3TQ1A 2K8BB 4NL9C 1DOQA 2F1HA 5F3XB 5KFEA 3IG8A 2W9MA 2VANA 2JZBB 4OO1J 3BS5A 4XA5A 5DG7A 5L1IA 1L3UA 5AKXA 4XUSA 3QZ7A 4LJXA 1X9MA 2Q0ZX 4M9NA 3F5AA 4USAA 1X6JA 4DS5A 3LDAA 3QU2A 1Q3VA 4IQWA 4PGYA 2V4QA 4CF3A 1VJ5A 5J0RA 2AXTU 5KT6A 4J9RA 5KL8B 4OJPA 1QCKA 2MSNA 3DV9A 5HMMA 2W9CA 5ALTA 4I2HA 2MUTA 1UCVA 1COOA 5KFRA 1U49A 4QZIA 3PMLA 2EAPA 4OJ5A 2J6TA 2OXOA 2HOFA 1BPYA 3QX7A 2VA8A 2PMZC 3R9KA 3KHRA 1N63A 3BQ0A 3OSNA 1NOMA 4ED1A 3H4BA 1DK2A 2BDPA 1RQNA 4B9SA 2ZIXA 1ZQAA 2KKVA 4O3SA 2KNJA 3TADC 4QZGA 1S77D 5ALGA 3RB3A 8ICSA 1TE2A 4RU9A 3F5EA 4DF4A 3I76A 1TAMA 4DQSA 3F2DA 4JWMA 2YMPA 3U26A 4EELA 2RQ5A 4B9MA 1L6NA 1H38A 4IS7A 5J2BA 1NK9A 4GFJA 4UAWA 1N56A 1JN3A 3ZDAA 4QZDA 4TUSA 5AKZA 5AM2A 4XQ8A 2JV3A 4MEXA 4K4HA 1U48A 5L1JA 4ELUA 1ZQDA 4YMNA 4RT2A 5ALRA 5ALVA 4NL9A 4YD1A 2R8HA 2KFNA 4OJ6A 4FZNA 1QH9A 1NJYA 1ZQUA 2RP5A 1HUOA 4GIBA 5KG3A 4B9LA 4O3OA 1NNLA 3C1YA 9ICHA 4NLGA 1S97A 1ZQLA 5KFOA 2ASJA 7ICEA 5EE9A 3AL0B 3H0MB 4OJOA 9ICCA 3OGUA 1NK5A 3AQEA 3ZD8A 2CN1A 5J8YA 3NASA 1ZQPA 4TQRA 9ICUA 2W9CB 1VDVA 4J9MA 5G5GA 4Z6EA 4Q8EA 3E0FA 4DF8A 5CJ7A 3OHBA 3QZ8A 3A0BU 1LKYB 1UT8A 4Y2QA 3TARA 1SL1A 2W9AA 2OEHA 2JGAA 3SYZA 2J6UA 9ICGA 1PK1B 3F2CA 2HBKA 2R18A 3JPTA 8ICGA 5KFXA 4QZBA 2IOFK 1RXWA 1SZPA 5KFQA 3M1YA 1S76D 3D6JA 4GC7A 2G09A 4IL6U 3SENA 3PR4A 2EZXA 5DB6A 3PO5A 7ICJA 2H3FA 2XCAA 3G6VA 4EEKA 5KFAA 4ACOA 3MFIA 3M9NB 7ICOA 2WF8A 2WB1F 2IBKA 1ZQVA 5KAFU 7ICFA 2W7PA 1PK3A 5AKLA 4M6WB 5AICA 3RR7A 3KHLA 4BXOA 3Q8PB 9ICSA 5JU5A 5AM5A 1ZQFA 1JXEA 4I2JA 1A76A 1TK0A 3UQ0A 3SR6A 4RPZA 3QEBZ 1YT3A 4PHPA 2CRXA 3TI0A 2QLTA 2KMDA 1N48A 2B0CA 1JROA 4F4KA 1U9LA 1JI7A 2ASLA 2HHVA 2GH1A 1ZXIA 5F9NA 2W3SA 5AM1A 3GFKB 1S10A 2HHUA 1RDFA 3GU3A 2WAQC 1ECWA 5ALPA 3T5HA 1ZQGA 2W11A 4P4PA 2DQNB 4I2GA 4YCXA 3V6HA 5KFWA 3MABA 2QB1A 5AKHA 5DLGA 1WUDA 4O3QA 9ICOA 2KD1A 3UXOA 2YMLA 1PK1A 1PVRA 3JPPA 1ZQJA 2OH2A 4CDGA 3TFRA 1S0NA 2GWSA 4DSIA 4YR2A 3Q8KA 3SI8A 5L1KA 4DQQA 2JH7A 3ZDEA 3M8RA 1PVQA 2W55A 2R8IA 4DOAA 3BQ2A 2A1AA 1MQ2A 2CPRA 2YQEA 3IG5A 2ZXIA 3WK5A 5KNIA 2E8MA 2I9GA 4M0AA 2ASDA 3TAPA 2EDUA 1KFTA 1OUQA 1ZQRA 3GILA 5G5HA 4MF8A 1KL9A 2HI0A 2W04A 1X66A 3ZI4A 4EENA 4C7YA 1S0MA 4P0QB 2LYAA 4C4SA 3ZDDA
chains in the Genus database with same CATH topology
2K8AA 2VKQA 3PSFA 2ZG6A 3VCBA 2K4HA 2DGZA 2K8CB 2YB4A 2LYBA 3L3FX 2HBLA 3SMVA 3M7DA 3PSIA 2Y0SC 3ONNA 3SAGA 4NLBA 4CRXA 3PSTA 4FE3A 3D2SA 4OJ6A 2ZIWA 2WAQF 3F5AA 1YT3A 2BDUA 2YB1A 3O0FA 4FZNA 4KX3A 4BUGA 2RP5A 4QJFB 3SAHA 2CRXA 2OYYA 2G07A 4IC9A 5A0LA 2MRLA 3CP8A 2ZIUB 3ICXA 3LVWA 4FZMA 1Q3VA 3H0LB 4NWIA 3F2BA 5C0YA 2F2AB 2HOQA 4AYBF 1PVPA 2KHQA 1XO0A 3MGVA 2JMGA 1HEKA 2F77X 2KVCA 2MA1A 2GH1A 2VJ5A 5KL8B 2VJ4A 3H0MB 3HKZF 2F8LA 2F76X 4OJOA 4OJPA 4BX9C 1ED1A 2WB1C 4O3MA 3AQEA 2H3IA 3PZPA 5HR7A 2ZIUA 2HBJA 4JMUA 2CN1A 1Q3UA 3N7SC 2GOLA 2KICA 2VIXA 3CYMA 2OM6A 2LHTA 2K4IA 3LYSA 2KJ9A 3OPXA 2ZXHA 3GU3A 3D2NA 2KV2A 2WAQC 1P7DA 4OJ5A 3D2QA 4PL1A 1ECWA 3RF9A 3CRXA 4WJ3B 2OXOA 2G0AA 3E0FA 2H3ZA 4PL2A 2HOFA 3M6ZA 2DF4B 2DQNB 2Z7JA 2RHFA 2W7OA 4QIWC 3NUQA 2D6FC 2PMZC 3KFUF 2KKPA 1DRGA 4U7CA 1Z1BA 3N7PD 1WUDA 2JGAA 1URJA 1F44A 2G08A 2KD1A 4AYBC 3F2CA 4NLCA 2HBKA 2R18A 4C0ZA 2E1EA 2HMXA 1SZHA 2NV3A 2YX8A 2JHDA 1UPHA 4KMOB 1PVRA 3T79A 2ZIXA 2M0NA 2ZIVA 3AQFA 2OH2A 2JH1A 2Q4TA 2W03A 3GZFA 4NV0A 4CDGA 2KOBA 4BJQA 1XNSA 4CGZA 5HR6A 3H0RB 3LVVA 3SQIA 3IN5A 2PMZF 2ZIXB 1IIPA 2G09A 2KKVA 2XI9A 1GO3F 2KHVA 2ZIVB 4QIWF 2KJ8A 4KX5A 2LKYA 2E1FA 4U6PA 3AL0B 2JH7A 2KNJA 2LBOA 2H3VA 3SAFA 2K89A 3F53A 3C28A 2G06A 1HIWA 2N1RA 2A3VA 2KEYA 2XIDA 2H3FA 3M6KA 3RFAA 1PVQA 2HOIA 2RRDA 4P0PA 3ALRA 3PSPA 3N7RC 2HBMA 3F5EA 1Z19A 1TAMA 1KBUA 3F2DA 2E5SA 4ACOA 3KZXA 1L6NA 3NRWA 4QNLA 2CPRA 2KJ5A 1D8BA 3IG5A 2ZXIA 4FZLA 2WB1F 3DEEA 3HKZC 2Y0SF 4GFJA 1CRXA 1A6SA 2KIWA 4ICAA 1NZBA 1A0PA 5KL1B 4P0PB 2K8BB 2W7PA 1ZQ1C 2XICA 4OJLA 1T94A 2G5IB 4A8EA 3K1ZA 2G5HB 3C29A 4P0QA 1OUQA 3IP4B 2K4EA 5CRXA 5T14A 2ZIWB 2H3QA 3IG8A 2W04A 4P0QB 2XVTA 1MA7A 4OO1J 2LYAA 3VC8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HBM A;  4NLC A;  2DGZ A;  4O3M A;  2HBK A;  2HBL A;  2HBJ A;  2E1E A;  2CPR A;  3SAG A;  1D8B A;  4NLB A;  3CYM A;  1YT3 A;  4CDG A;  4QJF B;  3SAH A;  4CGZ A;  2KV2 A;  1GO3 F;  4QIW F;  2E1F A;  5C0Y A;  3SAF A;  2RHF A;  1WUD A;  4OO1 J;  2MA1 A;  2RRD A; 
#chains in the Genus database with same CATH topology
 4Y2Y A;  3I1Y A;  2HVI A;  2DUY A;  3N28 A;  3QUB A;  3QUQ A;  4QZH A;  3GIK A;  4O5C A;  5ALD A;  3NVY A;  2LPE A;  4RQ8 A;  3UMB A;  2PFQ A;  1JIH A;  9ICF A;  3JPQ A;  2KK0 A;  4DLG A;  3C1Z A;  2MA1 A;  1WWV A;  4EZ6 A;  2HBJ A;  4ECS A;  2ZUC A;  2KVS A;  3PV8 A;  2KJ9 A;  1DGJ A;  5KFZ A;  3WK8 A;  1CUK A;  1FFU A;  1ZQS A;  5ALJ A;  2XY7 A;  4WJ3 B;  3M9M B;  5J0X A;  5KT7 A;  2EH9 A;  3WU2 U;  4F93 B;  3TAQ A;  5IIJ A;  4DFK A;  1X2I A;  5KTQ A;  3V6K A;  3J81 j;  3PX0 A;  1U4B A;  3GQC A;  4C0Z A;  4LVS A;  1ZQZ A;  4PHE A;  1B0X A;  9ICK A;  1D8Y A;  1IIP A;  3AN1 A;  1GO3 F;  3M8S A;  2BCQ A;  2XID A;  2LM4 A;  4UB4 A;  5ALX A;  7ICI A;  3KD3 A;  5K4L A;  4I2D A;  7ICG A;  5DDM A;  9ICX A;  2JZB A;  3RH5 A;  2P66 A;  2KIW A;  3GIJ A;  3N4M B;  5JUM A;  5TIS U;  2AHO B;  8ICA A;  5IIK A;  3PW4 A;  1Z1V A;  4RQ4 A;  3N97 B;  2H3Q A;  1BGX T;  4DFP A;  3EZ5 A;  3KTQ A;  4Z6F A;  4J9O A;  4O9M A;  3NS1 A;  3V7J A;  5J2E A;  3UXP A;  5AI8 A;  2DGZ A;  4F5N A;  4G9B A;  4UAR A;  4C4T A;  2BKE A;  3IRU A;  4KX3 A;  8ICP A;  5EWE A;  9ICM A;  2MRL A;  2ES6 A;  5J0P A;  2YTU A;  3ICX A;  5KFT A;  2QB0 B;  4BWM A;  5III A;  3MGV A;  1HEK A;  2FLL A;  2Y1J A;  1KSP A;  1ED1 A;  4M9J A;  4DLE A;  2F1I A;  1Q3U A;  2VIX A;  2OM6 A;  1RM6 C;  2XY6 A;  4F5O A;  1ZQT A;  1ZYQ A;  3I28 A;  3KKA C;  1U45 A;  1J2N A;  1BPZ A;  5KFS A;  4ECT A;  1L7M A;  4DQI A;  7ICQ A;  1NJZ A;  1SKR A;  3RTV A;  5KG2 A;  4F91 B;  3QU9 A;  5HHI A;  4ED6 A;  5ALQ A;  3C28 A;  4X5V A;  5ALN A;  2A3V A;  2KZM A;  4P4O A;  4F4W A;  3QE9 Y;  2FMQ A;  2BQ3 A;  4C8K A;  3OTQ A;  5DB8 A;  5J2I A;  4RQ7 A;  4M6W A;  1N2X A;  1A0P A;  5AI6 A;  3K1Z A;  2G5H B;  7ICK A;  3KZI U;  5HHH A;  3PW7 A;  5KFV A;  2IOH A;  2DPI A;  2FPK A;  4BGD A;  1X6I A;  4IQT A;  4UB5 A;  1NK8 A;  2FLN A;  3BDP A;  7ICV A;  3HWT A;  3SAG A;  4PZN A;  1MC8 A;  2JXJ A;  2ZIW A;  4JV2 A;  1L8L A;  4E0D A;  5KG5 A;  2C2D A;  4RQ2 A;  4KLF A;  1S0V A;  8ICK A;  1U47 A;  2ZUD A;  1SV0 A;  4IRK A;  4ED2 A;  3C2L A;  5ALE A;  2KVC A;  1ZD4 A;  2V9W A;  2DBY A;  2I1Q A;  5AK5 A;  3PY8 A;  4J9P A;  5DGA A;  2KIC A;  3LYS A;  1NKC A;  1X9S A;  1XU4 A;  5EOZ A;  1KLN A;  5EE1 A;  1Z4N A;  5AM4 A;  4ECX A;  4YVZ A;  3HW8 A;  1UHU A;  7ICM A;  4DCC A;  3H8W A;  1XO1 A;  2HMX A;  2RDJ A;  2HVH A;  2JHD A;  4CF4 A;  2ZJ8 A;  3BZC A;  5J0S A;  3QU4 A;  1QTM A;  5AIB A;  4YP3 A;  3RH6 A;  3SQI A;  4KMU A;  3FM9 A;  2ZTC A;  4DL6 A;  4U6P A;  1WWU A;  4R8U A;  3G6X A;  4RPY A;  1ZQH A;  2M9N A;  1FFV A;  2K4P A;  2F1J A;  5AIA A;  3RFA A;  2B6G A;  4ELV A;  1SXE A;  2JEG A;  4FZL A;  1NKE A;  4C4R A;  4J9Q A;  1ZQK A;  7ICR A;  4ICA A;  5KFN A;  3C29 A;  3LWL A;  4B6J A;  1ZQX A;  4DOB A;  4M9H A;  2EZZ A;  2XVT A;  4JV0 A;  5KG4 A;  4TUQ A;  8ICU A;  1SB3 C;  2ZG6 A;  5ALI A;  4HAI A;  9ICN A;  4LZG A;  4CNQ A;  2Y0S C;  4CRX A;  4FE3 A;  2IMW P;  3C23 A;  2WAQ F;  1JRP A;  4QJF B;  5KFL A;  4IC9 A;  2W43 A;  1L7O A;  3EW9 A;  3RJI A;  8ICH A;  2F3N A;  1T4G A;  1XO0 A;  1XSL A;  1ZD3 A;  3RRG A;  9ICE A;  5ALH A;  4UAU A;  4Y2P A;  4YMO A;  3WK9 A;  2ZIU A;  5IIM A;  1UA1 A;  4LZD A;  2Y1I A;  4US8 A;  1NKB A;  4Q8F A;  2LHT A;  4F92 B;  4O3R A;  1RXV A;  2IOF A;  1ZOL A;  2O6K A;  5AK6 A;  2EAM A;  1D9F A;  1KQQ A;  1L3S A;  2DF4 B;  3PMN A;  3RJK A;  2PI4 A;  3RB4 A;  4QIW C;  4DSL A;  2KKP A;  1RYU A;  5DGB A;  1SV0 C;  4PZO A;  3PNC A;  1N5W A;  5J2G A;  3HT3 A;  3ISC A;  1SL0 A;  1WCN A;  2FPM A;  4KN4 A;  2ZIV A;  2PFN A;  3WKD A;  2VA2 A;  3H0R B;  4YXJ A;  5J0Q A;  2PMZ F;  4I2B A;  2XI9 A;  4MFF A;  8ICE A;  4K4I A;  3AU6 A;  3RJH A;  1L3V A;  5B66 U;  3K4G A;  1SIJ A;  2E8O A;  3ZDC A;  2FMS A;  7ICN A;  4J9K A;  4ECV A;  2KSO B;  4FBT A;  4QWD A;  5L9X A;  4F3O A;  3KZX A;  1ZD5 A;  1Q46 A;  2UVV A;  1D8B A;  4UB8 U;  2Y0S F;  3EUB 2;  3NVZ A;  2OHF A;  5ALW A;  3G6Y A;  5KL1 B;  3RJG A;  4OJL A;  1IG6 A;  4J9L A;  1T3Q A;  5ALU A;  1A77 A;  2BHN A;  5KG7 A;  5AM0 A;  4PGX A;  4DFJ A;  5AKG A;  4F2R A;  3KOO A;  4R65 A;  2LYB A;  4YFK A;  5CEH A;  4XRH A;  1SWV A;  3A0H U;  4EX7 A;  2UVR A;  1T8E A;  5BOL A;  2JR5 A;  1XC9 A;  3CP8 A;  5TZV A;  3MBY A;  3E2E A;  2NRX A;  5DLF A;  1ZQI A;  9ICR A;  1PVP A;  2LMR A;  4YR0 A;  2D3D A;  3IV6 A;  4JWN A;  2ISP A;  3BQ7 A;  4O5E A;  2OWO A;  5HR7 A;  8ICZ A;  1OXJ A;  4I2E A;  9ICA A;  4UQG A;  2BPG A;  1XWL A;  3WK6 A;  3MR6 A;  4K4G A;  1T3N A;  2BCR A;  2G0A A;  4YMM A;  5DQG A;  5CHG A;  5J29 A;  2FPL A;  2FJ6 A;  1RPL A;  1ZQC A;  3IM1 A;  4EX6 A;  2NYV A;  5AI9 A;  5KT5 A;  1B22 A;  4QZA A;  5CA7 A;  5CB1 A;  5KFJ A;  1X40 A;  1V97 A;  2BCU A;  4CGZ A;  1Q8K A;  3IN5 A;  2BQR A;  3RR8 A;  1KW4 A;  8ICJ A;  2ZIV B;  4QIW F;  2DKZ A;  5J2C A;  4FO6 A;  2H3V A;  5ALM A;  5AKJ A;  3AMZ A;  3T5L A;  3N7R C;  2XO7 A;  4DL7 A;  1ZQN A;  5J0W A;  5KFC A;  3QYP A;  2KSO A;  4MF2 A;  4QNL A;  2NRT A;  1N5X A;  5KG0 A;  4Y2T A;  5EWF A;  4ZOH C;  1TAQ A;  3WKC A;  4I27 A;  1K1Q A;  2XY5 A;  1D9D A;  4P0P B;  4UAV A;  3NVW A;  1RYS A;  2HHS A;  1DGS A;  3OSP A;  3AUO A;  2HCF A;  9ICL A;  4KTQ A;  9ICW A;  4RT3 A;  4J03 A;  2VKQ A;  3ETL A;  2YMQ A;  5J2D A;  4ED3 A;  3M7D A;  1PZN A;  5CWR A;  5DDY A;  4FS1 A;  5CR0 A;  1K1S A;  1WG8 A;  1M6Y A;  3KHH A;  3FYH A;  4JB3 A;  4UB6 U;  9ICV A;  3H8J A;  1ZJM A;  2G07 A;  1LVH A;  2NRW A;  2W9B A;  3RBD A;  4KLS A;  1RQL A;  1QQ7 A;  1L8O A;  2ZJ5 A;  4ED0 A;  3F2B A;  5C0Y A;  3ED5 A;  2MUT B;  3GDX A;  3TAD A;  4EZ9 A;  5IIO A;  2AGO A;  3CNH A;  3Q8L A;  2VJ5 A;  4QWB A;  1QQ6 A;  2F8L A;  4UBC A;  4KLQ A;  1SGG A;  2NRV A;  2WTF A;  4EYH B;  3PZP A;  4I29 A;  2GOL A;  5KAI U;  4US9 A;  2W3R A;  4UAZ A;  4CE6 A;  2F8K A;  4DFM A;  3M9O B;  3PW5 A;  1P7D A;  2EZY A;  8ICY A;  1ZD2 P;  1FO4 A;  3MR3 A;  3N7P D;  3UXN A;  4ECQ A;  4DL2 A;  4KLE A;  4DQR A;  2DWQ A;  5HNK A;  2EQY A;  5DQH A;  4RUA A;  5DKW A;  2YMM A;  5EE0 A;  1X9X A;  3B0Y A;  4TUP A;  2KJ8 A;  5ALF A;  1ZQB A;  3MFH A;  2E3T A;  9ICB A;  2WF5 A;  5KFD A;  1SKW A;  5J2H A;  1N60 A;  5AKE A;  3MGH A;  3H8M A;  1FIQ A;  2AQ0 A;  3EWA A;  1LV5 A;  3MR5 A;  4C8O A;  3V72 A;  4EYI B;  3OJS A;  1K5O A;  4A8E A;  4P0Q A;  8ICC A;  3THV A;  2ZIW B;  5BOM A;  3BQ1 A;  1IV8 A;  3PR5 B;  1NJW A;  8ICV A;  3SZ2 A;  1MA7 A;  9ICI A;  5DG9 A;  2ZTD A;  3L3F X;  2C2R A;  3PSI A;  9ICJ A;  4OD0 A;  3ONN A;  2H5X A;  3FC4 A;  2FE9 A;  4MEY A;  2ZJA A;  4BUG A;  2AH5 A;  1MQ3 A;  1ZQQ A;  4F50 A;  4GC6 A;  2R8J A;  2KFZ A;  2HOQ A;  2XC9 A;  2HHQ A;  4IQU A;  2R8K A;  1F0M A;  4QWC A;  8ICM A;  4RQN A;  9ICT A;  2E8N A;  4KLD A;  4C8M A;  4BX9 C;  4F71 A;  2F76 X;  5AI5 A;  1LB2 B;  4F8R A;  4NLK A;  3N7S C;  4DSF A;  3CYM A;  4GLX A;  1RYR A;  4QW8 A;  4PL1 A;  3RF9 A;  3ETR A;  3MR2 A;  2QKQ A;  3EYZ A;  3M6Z A;  2JEI A;  2Z7J A;  5D46 A;  1BPX A;  5ALY A;  3EPI A;  1Z1B A;  4NXZ A;  1ZET A;  4TUR A;  5AKK A;  4RQ5 A;  1V85 A;  3UMG A;  4C7Z A;  3TAC B;  2E1E A;  2YX8 A;  4M2Y A;  4RPX A;  2M0N A;  2JH1 A;  3GZF A;  4NV0 A;  4ECR A;  4BJQ A;  4QZ8 A;  3LVV A;  2C2E A;  2KHV A;  2OCE A;  1XSP A;  4HYK A;  3L5K A;  3LK9 A;  5AI0 A;  2K89 A;  2RDI A;  4F5R A;  2PFP A;  2KEY A;  1X42 A;  5DBC A;  4JUZ A;  3RBE A;  3M6K A;  3C5F A;  1Z00 A;  1S5L U;  2YY6 A;  4DOC A;  4UAT A;  5AKI A;  3JPO A;  4UAY A;  3EPG A;  4RQ1 A;  4YR3 A;  2WF9 A;  2KJ5 A;  3WKB A;  4Y2X A;  4QZE A;  1A6S A;  1ZQY A;  3IDW A;  1NZB A;  5H2F U;  5J0Y A;  2XIC A;  1N61 A;  2IHM A;  3UM9 A;  4DS4 A;  1O03 A;  3QUC A;  3B0X A;  4NLZ A;  3C2K A;  4PPX A;  4IRC A;  4NY8 A;  3QXG A;  4O5K A;  2AU0 A;  3VC8 A;  1QSY A;  5ALO A;  4RQ6 A;  3PX6 A;  2K8C B;  3AEV A;  8ICI A;  3SV4 A;  3PST A;  4I2C A;  3BJY A;  3PW2 A;  4F4X A;  3O0F A;  2YB1 A;  2BDU A;  3SAH A;  2DPJ A;  2ZIU B;  2Y9U A;  4GXJ A;  2AQ4 A;  2F2A B;  3HIL A;  8ICQ A;  2KHQ A;  3NTU A;  4PJ0 U;  3FAH A;  2JMG A;  4RNO A;  4IR9 A;  3K1R B;  1UA0 A;  3HKZ F;  4UAS A;  2WB1 C;  1ZRM A;  5J2F A;  4B9N A;  5KG6 A;  3DDH A;  3PO4 A;  1BPB A;  4IQV A;  1YZ6 A;  4KIT B;  4KLT A;  4QWA A;  1NK7 A;  4GXI A;  5KFF A;  3CRX A;  5DBA A;  3NUQ A;  4UW9 A;  4QW9 A;  5GTH U;  2A19 A;  5KT2 A;  2KE7 A;  4AYB C;  2BPF A;  4NLC A;  1BPD A;  2WF6 A;  2NV3 A;  3ISB A;  3AQF A;  3GV5 B;  2MAX A;  2J6S A;  5HR6 A;  4EBE A;  4Y2R A;  3WKA A;  3FDS A;  1JMS A;  2LKY A;  4NM2 A;  4DL5 A;  1L3T A;  3RJF A;  2LBO A;  3SAF A;  4KLM A;  1TK8 A;  2W8L A;  3SV3 A;  3GII A;  4Y2J A;  4CF5 A;  1B43 A;  1NJX A;  3V6J A;  2RRD A;  2FDR A;  1F5S A;  1V9P A;  4UB2 A;  4B9V A;  2E5S A;  4RQ3 A;  5J2A A;  2IA6 A;  5KFK A;  1RZT A;  5EE3 A;  2EAO A;  4O0I A;  5KFP A;  5IIN A;  1ZQ1 C;  1JAL A;  3UQ2 A;  4YXM A;  4NLN A;  2BPC A;  3BS7 A;  3L4P A;  2QB0 A;  2HBL A;  4Q43 A;  3H7I A;  7ICH A;  2KP7 A;  3JPN A;  2BCS A;  5A0L A;  4FZM A;  4F4Y A;  4EBD A;  1QQ5 A;  2HHX A;  4Y2V A;  2JEF A;  1SL2 A;  3KHG A;  1L5U A;  2FI1 A;  2GO7 A;  4O3M A;  5FP0 A;  5HML A;  3TFS A;  4QWE A;  4ECY A;  2BR0 A;  4JK1 A;  1B4F A;  4YG2 A;  1CI4 A;  5EWG A;  1XS9 D;  1XSN A;  4KLL A;  3QNM A;  2PKE A;  3T5K A;  4DL4 A;  1EXN A;  1URJ A;  1KRP A;  1COK A;  2ZTE A;  2UVW A;  2MU2 A;  3V7L A;  4UB1 A;  7ICL A;  2EAN A;  4BDP A;  2P35 A;  4KLH A;  3Q8M A;  3RAX A;  1C7Y A;  4DFD A;  4KLG A;  1Z00 B;  5DBB A;  1WYG A;  1ZQW A;  3KBB A;  1V38 A;  4P0P A;  5JRT A;  2P6R A;  8ICN A;  3GV8 B;  1ZJN A;  3NRW A;  2PXI A;  2BQU A;  4I28 A;  3K75 D;  2AGP A;  3DEE A;  2AJQ A;  4P4M A;  2D8C A;  9ICQ A;  4DL3 A;  2FLP A;  3RJJ A;  3AM9 A;  2K60 A;  1HUZ A;  1RG6 A;  1KDH A;  1ZRN A;  2HHT A;  4PH5 A;  2XGQ A;  8ICB A;  5B5E U;  2K4H A;  2YB4 A;  8ICT A;  5DB9 A;  2L5Y A;  3T3F A;  1JX4 A;  1BNO A;  4NWI A;  1DXS A;  1TV9 A;  4AYB F;  2QAR B;  2XCP A;  3LWM A;  1UQV A;  1KKX A;  2VJ4 A;  4M9L A;  3JPS A;  4JMU A;  5AKY A;  4I2F A;  5AI4 A;  5AK4 A;  1NK6 A;  2ZXH A;  4CCH A;  1S8O A;  7ICP A;  5BPC A;  4PL2 A;  5ALL A;  4O3P A;  5KG1 A;  1Y88 A;  2F44 A;  4F72 A;  2W7O A;  4MFC A;  2D6F C;  3HX0 A;  4MHV A;  1KFS A;  1F44 A;  3PX4 A;  4RNN A;  1CEZ A;  4EBC A;  2RLT A;  1UPH A;  4KMO B;  3T79 A;  2W03 A;  1L7P A;  5J0U A;  1J97 A;  4PHA A;  4MFA A;  3OJU A;  2HW3 A;  1TFR A;  5KFI A;  4UBB A;  3PSP A;  3QUT A;  1KBU A;  3BZK A;  4GXK A;  1T7P A;  2FMP A;  4RUC A;  3C5G A;  5DQI A;  1MN8 A;  4Q44 A;  4YN4 A;  4BXO B;  3WK7 A;  2C22 A;  1CRX A;  3H4D A;  2XGP A;  4UB3 A;  3HPO A;  1TVA A;  5CRX A;  3E58 A;  8ICX A;  2C28 A;  1QLN A;  3UPQ A;  3PW0 A;  2DFL A;  2K8A A;  3JPR A;  3PSF A;  3RB6 A;  1KEJ A;  1IXR A;  3BS5 B;  1PUZ A;  5D4B A;  3ORY A;  4NLB A;  3D2S A;  4ED7 A;  5DG8 A;  1DK3 A;  2LM1 A;  4ED8 A;  1NK4 A;  2OYY A;  4JV1 A;  2W54 A;  2ISO A;  4FS2 A;  4C80 A;  3TAN A;  1KTQ A;  2F77 X;  5L1L A;  1FEZ A;  2QAR A;  1TK5 A;  3RRH A;  2V4R A;  3RJE A;  5AK3 A;  1TAU A;  1BVS A;  2AGQ A;  2H3I A;  3BQT A;  2R8G A;  4QZC A;  4QZF A;  2GLE A;  3OPX A;  1YZ7 A;  2KV2 A;  4DO9 A;  2HDO A;  4NM1 A;  4ECZ A;  2DKX A;  1NZP A;  4C8N A;  3S6J A;  5KT3 A;  5AM3 A;  1Z4O A;  1HJP A;  2YN4 A;  1VLB A;  4ZH4 A;  8ICF A;  2ODG A;  1DRG A;  1TKD A;  4NJ8 A;  1C20 A;  3SEI A;  4KLU A;  1L7N A;  2G08 A;  5ALS A;  2KN7 A;  2KZZ A;  1WCL A;  5ALK A;  1SZH A;  3RB0 A;  4Y2S A;  4YD2 A;  1UT5 A;  5J8Y C;  4RZR A;  5DB7 A;  1ZQE A;  8ICL A;  2NRZ A;  1JXL A;  5KFB A;  3PVX A;  4DSJ A;  5J0O A;  5J2K A;  8ICR A;  2IHN A;  1ZQO A;  2HBM A;  2HSZ A;  5KT4 A;  4RQM A;  4M47 A;  5GTI U;  4KN7 A;  2JRZ A;  2LYH A;  2KZ3 A;  2BCV A;  1J2M A;  4KLJ A;  4DEZ A;  2A1J A;  2G5I B;  4O3N A;  5T14 A;  1OW5 A;  5F9L A;  4J9N A;  3VCB A;  2DL0 A;  2KG5 A;  4IR1 A;  4RQ0 A;  2BZF A;  2W9B B;  3ISD A;  3RH4 A;  1S0O A;  1X9W A;  2NO4 A;  3Q8Q B;  3H0L B;  1KN5 A;  2LI6 A;  5JTI A;  8ICO A;  3TKA A;  2I6X A;  3GIM A;  1D8L A;  3QU7 A;  5C5J A;  4DSK A;  1SWW A;  5J2J A;  3NVV A;  2W8K A;  4RNM A;  5E79 U;  5IIL A;  4PHD A;  2WF7 A;  4Z6C A;  5AHX A;  5L1M A;  3NRZ A;  1ARO P;  1N62 A;  4ECW A;  3ZD9 A;  2VA3 A;  1LKY A;  4I2I A;  3Q8S B;  9ICP A;  2HHW A;  4FBU A;  2ZUB A;  5KFG A;  1AQ6 A;  3MC1 A;  2ATL A;  4KLI A;  2JEJ A;  3H8S A;  2ZIX B;  1JUD A;  3HRD D;  4Y2U A;  3MDA A;  2E1F A;  4ELT A;  4DQP A;  2ALZ A;  4PGQ A;  1HIW A;  4QZ9 A;  1SKS A;  4DSE A;  3HJE A;  4F4Z A;  2B21 A;  1QSS A;  4B9T A;  5CP2 A;  4M9G A;  3WK4 A;  2P6U A;  3H40 A;  4EEY A;  4R8U B;  4DWI A;  3V7K A;  1S9F A;  3MGI A;  3QU5 A;  4Z6D A;  1MSW D;  1T94 A;  3IP4 B;  2K4E A;  4AP9 A;  5KFM A;  1NK0 A;  2A1J B;  4F5P A;  2BGW A;  8ICW A;  1KFD A;  4OCZ A;  3SMV A;  2I5H A;  3UMC A;  5KFY A;  3AU2 A;  3C2M A;  5HP4 A;  5KFH A;  3KKA A;  3LVW A;  2KTQ A;  3Q8R B;  4M04 A;  4R64 A;  2WFA A;  5J0T A;  1XNS A;  4YQW A;  4KLO A;  1BNP A;  2KIV A;  4J9S A;  2PI5 A;  3GV7 B;  4BWJ A;  2K4I A;  3SD7 A;  3D2N A;  1NI3 A;  3T5J A;  1ZQM A;  3D2Q A;  4IRD A;  3MDC A;  4TQS A;  4ECU A;  3WKE A;  2H3Z A;  2RHF A;  5KFU A;  3NGD A;  3ZDB A;  3C21 A;  3KFU F;  4F5Q A;  4Q45 A;  4U7C A;  4G3I A;  3RAQ A;  2CXY A;  5ALZ A;  7ICU A;  1Z3E B;  3B9J A;  2ESE A;  2Q4T A;  2KOB A;  1SV4 A;  7ICS A;  2E8P A;  4P2H A;  4KX5 A;  3CW2 C;  5D49 A;  2PFO A;  1IM4 A;  2NO5 A;  2G06 A;  3F53 A;  1BPE A;  2N1R A;  4R66 A;  2Y9T A;  4FFD A;  2WHE A;  4F2S A;  4B9U A;  2HOI A;  2UVU A;  3ALR A;  1Z19 A;  1O08 A;  4I2A A;  3HP6 A;  4C8L A;  1QSL A;  3HKZ C;  3QEA Z;  4R63 A;  3IHQ B;  3OHA A;  7ICT A;  1SXD A;  3TQ1 A;  2K8B B;  4NL9 C;  1DOQ A;  2F1H A;  5F3X B;  5KFE A;  3IG8 A;  2W9M A;  2VAN A;  2JZB B;  4OO1 J;  3BS5 A;  4XA5 A;  5DG7 A;  5L1I A;  1L3U A;  5AKX A;  4XUS A;  3QZ7 A;  4LJX A;  1X9M A;  2Q0Z X;  4M9N A;  3F5A A;  4USA A;  1X6J A;  4DS5 A;  3LDA A;  3QU2 A;  1Q3V A;  4IQW A;  4PGY A;  2V4Q A;  4CF3 A;  1VJ5 A;  5J0R A;  2AXT U;  5KT6 A;  4J9R A;  5KL8 B;  4OJP A;  1QCK A;  2MSN A;  3DV9 A;  5HMM A;  2W9C A;  5ALT A;  4I2H A;  2MUT A;  1UCV A;  1COO A;  5KFR A;  1U49 A;  4QZI A;  3PML A;  2EAP A;  4OJ5 A;  2J6T A;  2OXO A;  2HOF A;  1BPY A;  3QX7 A;  2VA8 A;  2PMZ C;  3R9K A;  3KHR A;  1N63 A;  3BQ0 A;  3OSN A;  1NOM A;  4ED1 A;  3H4B A;  1DK2 A;  2BDP A;  1RQN A;  4B9S A;  2ZIX A;  1ZQA A;  2KKV A;  4O3S A;  2KNJ A;  3TAD C;  4QZG A;  1S77 D;  5ALG A;  3RB3 A;  8ICS A;  1TE2 A;  4RU9 A;  3F5E A;  4DF4 A;  3I76 A;  1TAM A;  4DQS A;  3F2D A;  4JWM A;  2YMP A;  3U26 A;  4EEL A;  2RQ5 A;  4B9M A;  1L6N A;  1H38 A;  4IS7 A;  5J2B A;  1NK9 A;  4GFJ A;  4UAW A;  1N56 A;  1JN3 A;  3ZDA A;  4QZD A;  4TUS A;  5AKZ A;  5AM2 A;  4XQ8 A;  2JV3 A;  4MEX A;  4K4H A;  1U48 A;  5L1J A;  4ELU A;  1ZQD A;  4YMN A;  4RT2 A;  5ALR A;  5ALV A;  4NL9 A;  4YD1 A;  2R8H A;  2KFN A;  4OJ6 A;  4FZN A;  1QH9 A;  1NJY A;  1ZQU A;  2RP5 A;  1HUO A;  4GIB A;  5KG3 A;  4B9L A;  4O3O A;  1NNL A;  3C1Y A;  9ICH A;  4NLG A;  1S97 A;  1ZQL A;  5KFO A;  2ASJ A;  7ICE A;  5EE9 A;  3AL0 B;  3H0M B;  4OJO A;  9ICC A;  3OGU A;  1NK5 A;  3AQE A;  3ZD8 A;  2CN1 A;  5J8Y A;  3NAS A;  1ZQP A;  4TQR A;  9ICU A;  2W9C B;  1VDV A;  4J9M A;  5G5G A;  4Z6E A;  4Q8E A;  3E0F A;  4DF8 A;  5CJ7 A;  3OHB A;  3QZ8 A;  3A0B U;  1LKY B;  1UT8 A;  4Y2Q A;  3TAR A;  1SL1 A;  2W9A A;  2OEH A;  2JGA A;  3SYZ A;  2J6U A;  9ICG A;  1PK1 B;  3F2C A;  2HBK A;  2R18 A;  3JPT A;  8ICG A;  5KFX A;  4QZB A;  2IOF K;  1RXW A;  1SZP A;  5KFQ A;  3M1Y A;  1S76 D;  3D6J A;  4GC7 A;  2G09 A;  4IL6 U;  3SEN A;  3PR4 A;  2EZX A;  5DB6 A;  3PO5 A;  7ICJ A;  2H3F A;  2XCA A;  3G6V A;  4EEK A;  5KFA A;  4ACO A;  3MFI A;  3M9N B;  7ICO A;  2WF8 A;  2WB1 F;  2IBK A;  1ZQV A;  5KAF U;  7ICF A;  2W7P A;  1PK3 A;  5AKL A;  4M6W B;  5AIC A;  3RR7 A;  3KHL A;  4BXO A;  3Q8P B;  9ICS A;  5JU5 A;  5AM5 A;  1ZQF A;  1JXE A;  4I2J A;  1A76 A;  1TK0 A;  3UQ0 A;  3SR6 A;  4RPZ A;  3QEB Z;  1YT3 A;  4PHP A;  2CRX A;  3TI0 A;  2QLT A;  2KMD A;  1N48 A;  2B0C A;  1JRO A;  4F4K A;  1U9L A;  1JI7 A;  2ASL A;  2HHV A;  2GH1 A;  1ZXI A;  5F9N A;  2W3S A;  5AM1 A;  3GFK B;  1S10 A;  2HHU A;  1RDF A;  3GU3 A;  2WAQ C;  1ECW A;  5ALP A;  3T5H A;  1ZQG A;  2W11 A;  4P4P A;  2DQN B;  4I2G A;  4YCX A;  3V6H A;  5KFW A;  3MAB A;  2QB1 A;  5AKH A;  5DLG A;  1WUD A;  4O3Q A;  9ICO A;  2KD1 A;  3UXO A;  2YML A;  1PK1 A;  1PVR A;  3JPP A;  1ZQJ A;  2OH2 A;  4CDG A;  3TFR A;  1S0N A;  2GWS A;  4DSI A;  4YR2 A;  3Q8K A;  3SI8 A;  5L1K A;  4DQQ A;  2JH7 A;  3ZDE A;  3M8R A;  1PVQ A;  2W55 A;  2R8I A;  4DOA A;  3BQ2 A;  2A1A A;  1MQ2 A;  2CPR A;  2YQE A;  3IG5 A;  2ZXI A;  3WK5 A;  5KNI A;  2E8M A;  2I9G A;  4M0A A;  2ASD A;  3TAP A;  2EDU A;  1KFT A;  1OUQ A;  1ZQR A;  3GIL A;  5G5H A;  4MF8 A;  1KL9 A;  2HI0 A;  2W04 A;  1X66 A;  3ZI4 A;  4EEN A;  4C7Y A;  1S0M A;  4P0Q B;  2LYA A;  4C4S A;  3ZDD A; 
#chains in the Genus database with same CATH homology
 2K8A A;  2VKQ A;  3PSF A;  2ZG6 A;  3VCB A;  2K4H A;  2DGZ A;  2K8C B;  2YB4 A;  2LYB A;  3L3F X;  2HBL A;  3SMV A;  3M7D A;  3PSI A;  2Y0S C;  3ONN A;  3SAG A;  4NLB A;  4CRX A;  3PST A;  4FE3 A;  3D2S A;  4OJ6 A;  2ZIW A;  2WAQ F;  3F5A A;  1YT3 A;  2BDU A;  2YB1 A;  3O0F A;  4FZN A;  4KX3 A;  4BUG A;  2RP5 A;  4QJF B;  3SAH A;  2CRX A;  2OYY A;  2G07 A;  4IC9 A;  5A0L A;  2MRL A;  3CP8 A;  2ZIU B;  3ICX A;  3LVW A;  4FZM A;  1Q3V A;  3H0L B;  4NWI A;  3F2B A;  5C0Y A;  2F2A B;  2HOQ A;  4AYB F;  1PVP A;  2KHQ A;  1XO0 A;  3MGV A;  2JMG A;  1HEK A;  2F77 X;  2KVC A;  2MA1 A;  2GH1 A;  2VJ5 A;  5KL8 B;  2VJ4 A;  3H0M B;  3HKZ F;  2F8L A;  2F76 X;  4OJO A;  4OJP A;  4BX9 C;  1ED1 A;  2WB1 C;  4O3M A;  3AQE A;  2H3I A;  3PZP A;  5HR7 A;  2ZIU A;  2HBJ A;  4JMU A;  2CN1 A;  1Q3U A;  3N7S C;  2GOL A;  2KIC A;  2VIX A;  3CYM A;  2OM6 A;  2LHT A;  2K4I A;  3LYS A;  2KJ9 A;  3OPX A;  2ZXH A;  3GU3 A;  3D2N A;  2KV2 A;  2WAQ C;  1P7D A;  4OJ5 A;  3D2Q A;  4PL1 A;  1ECW A;  3RF9 A;  3CRX A;  4WJ3 B;  2OXO A;  2G0A A;  3E0F A;  2H3Z A;  4PL2 A;  2HOF A;  3M6Z A;  2DF4 B;  2DQN B;  2Z7J A;  2RHF A;  2W7O A;  4QIW C;  3NUQ A;  2D6F C;  2PMZ C;  3KFU F;  2KKP A;  1DRG A;  4U7C A;  1Z1B A;  3N7P D;  1WUD A;  2JGA A;  1URJ A;  1F44 A;  2G08 A;  2KD1 A;  4AYB C;  3F2C A;  4NLC A;  2HBK A;  2R18 A;  4C0Z A;  2E1E A;  2HMX A;  1SZH A;  2NV3 A;  2YX8 A;  2JHD A;  1UPH A;  4KMO B;  1PVR A;  3T79 A;  2ZIX A;  2M0N A;  2ZIV A;  3AQF A;  2OH2 A;  2JH1 A;  2Q4T A;  2W03 A;  3GZF A;  4NV0 A;  4CDG A;  2KOB A;  4BJQ A;  1XNS A;  4CGZ A;  5HR6 A;  3H0R B;  3LVV A;  3SQI A;  3IN5 A;  2PMZ F;  2ZIX B;  1IIP A;  2G09 A;  2KKV A;  2XI9 A;  1GO3 F;  2KHV A;  2ZIV B;  4QIW F;  2KJ8 A;  4KX5 A;  2LKY A;  2E1F A;  4U6P A;  3AL0 B;  2JH7 A;  2KNJ A;  2LBO A;  2H3V A;  3SAF A;  2K89 A;  3F53 A;  3C28 A;  2G06 A;  1HIW A;  2N1R A;  2A3V A;  2KEY A;  2XID A;  2H3F A;  3M6K A;  3RFA A;  1PVQ A;  2HOI A;  2RRD A;  4P0P A;  3ALR A;  3PSP A;  3N7R C;  2HBM A;  3F5E A;  1Z19 A;  1TAM A;  1KBU A;  3F2D A;  2E5S A;  4ACO A;  3KZX A;  1L6N A;  3NRW A;  4QNL A;  2CPR A;  2KJ5 A;  1D8B A;  3IG5 A;  2ZXI A;  4FZL A;  2WB1 F;  3DEE A;  3HKZ C;  2Y0S F;  4GFJ A;  1CRX A;  1A6S A;  2KIW A;  4ICA A;  1NZB A;  1A0P A;  5KL1 B;  4P0P B;  2K8B B;  2W7P A;  1ZQ1 C;  2XIC A;  4OJL A;  1T94 A;  2G5I B;  4A8E A;  3K1Z A;  2G5H B;  3C29 A;  4P0Q A;  1OUQ A;  3IP4 B;  2K4E A;  5CRX A;  5T14 A;  2ZIW B;  2H3Q A;  3IG8 A;  2W04 A;  4P0Q B;  2XVT A;  1MA7 A;  4OO1 J;  2LYA A;  3VC8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...