2MA1A

Solution structure of hrdc1 domain of recq helicase from deinococcus radiodurans
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
75
structure length
75
Chain Sequence
HDAPLFEALRAWRLQKAKELSLPPYTIFHDATLKTIAELRPGSHATLGTVSGVGGRKLAAYGDEVLQVVRDSSGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein
molecule keywords DNA helicase RecQ
publication title NMR structure of the N-terminal-most HRDC1 domain of RecQ helicase from Deinococcus radiodurans
rcsb
source organism Deinococcus radiodurans
total genus 20
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2013-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00570 HRDC HRDC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.80 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2ma1A00
4CGZA 2HBMA 4QIWF 4CDGA 1D8BA 2HBKA 2DGZA 2HBLA 4NLBA 3CYMA 2KV2A 2RRDA 2E1FA 4QJFB 3SAHA 3SAFA 2CPRA 2E1EA 1GO3F 4NLCA 3SAGA 4OO1J 4O3MA 2RHFA 1WUDA 2HBJA 5C0YA 1YT3A 2MA1A
chains in the Genus database with same CATH superfamily
2W9CB 3UMCA 3RH6A 3KFUF 1JXEA 2KTQA 2YB1A 5DBCA 1ZQRA 1QLNA 3M9NB 1BPDA 2PI5A 8ICBA 2V4RA 2E1EA 3ZDBA 4KLOA 2AH5A 1X66A 1NK4A 1L7OA 1V9PA 3CNHA 5E79U 2RP5A 2ZIXB 5DG8A 3C2MA 2BPCA 2QB0A 5KFGA 1L7PA 3PNCA 7ICTA 4GC6A 3PO5A 5J0WA 1JMSA 4NY8A 5EE3A 5KAFU 1FIQA 2B6GA 3G6XA 3QUBA 2WF5A 2PMZF 7ICOA 2DKXA 2FMPA 4DF4A 2JH7A 4ED1A 4M9HA 4F5NA 4U6PA 1SB3C 2F2AB 4DFDA 5DGBA 4RZRA 9ICSA 1ZQOA 5DLFA 1KFSA 4I2HA 3IP4B 4R8UB 4J9KA 4JWMA 2J6TA 1ZQEA 4BJQA 1Z00B 3V7LA 5J0QA 4ED7A 5ALKA 2YTUA 2BCRA 8ICWA 2G07A 4RQ7A 3BS7A 4US8A 5ALHA 5AI0A 1JN3A 1RQLA 4ED3A 4Q8EA 1X9XA 2ASJA 5IIKA 2KK0A 4NLBA 1ZJMA 1NK5A 1PVRA 2A3VA 1S9FA 7ICGA 4US9A 1JXLA 2RDJA 4DFKA 3O0FA 5KAIU 4YR2A 2R18A 3H8SA 1SGGA 2E3TA 1UCVA 1JROA 1N5XA 2DGZA 5GTHU 8ICQA 3HWTA 3RB4A 2BR0A 1SL0A 2IBKA 4NLKA 7ICNA 3EWAA 3UXNA 4KX3A 5AM2A 4RUCA 3SAFA 2FPKA 2CRXA 5ALWA 3QZ8A 1SV4A 2YY6A 1SV0C 5AKLA 3N97B 9ICFA 4F91B 5DKWA 5AM5A 1D9FA 1F44A 4ECSA 4PZNA 4DQSA 5KL8B 4QZAA 3C29A 2DFLA 5KFPA 1XSLA 2BCVA 2KJ5A 1XC9A 1XO1A 3ZD8A 1TVAA 2J6SA 2JZBA 5J2FA 1HEKA 4B9TA 2EAMA 5ALVA 5DGAA 1IV8A 1ZQJA 3UPQA 1U48A 9ICRA 4PHEA 1SIJA 2WAQF 9ICLA 3M8RA 4EBCA 1IIPA 3AM9A 4YMMA 4RQ3A 2BGWA 2ZXIA 3J81j 4Y2VA 2NV3A 5EE9A 1ZD4A 2KZZA 5DB6A 3VC8A 1D8LA 2HOFA 2BHNA 2NRZA 4C8LA 3BS5B 3RB3A 4DQQA 5J0TA 1WCLA 5ALXA 2Q0ZX 4RPZA 3WK4A 5L1JA 1QCKA 1FO4A 1SKSA 3MR3A 3H8MA 1ZQKA 4B6JA 2Q4TA 4RNOA 1XU4A 9ICEA 1X2IA 1B4FA 2GWSA 4I2FA 5TZVA 4QWBA 5AKKA 4C8KA 1CI4A 3V6HA 4M2YA 5DB8A 3SEIA 4IQWA 1T94A 1F5SA 3KHLA 2ESEA 1Q3UA 4CCHA 3PX6A 2XY5A 8ICSA 2JEFA 3RR7A 1S10A 3TANA 3RJHA 3RBEA 2FMQA 4KLLA 1S0OA 2RDIA 2GLEA 3H40A 3BQ0A 1IG6A 2XIDA 5KFTA 3KKAC 5AKHA 3TADC 5AIBA 4I2DA 2AGPA 2ZG6A 4KLTA 5B5EU 1Z19A 4DOBA 3AEVA 2XO7A 8ICEA 3GIJA 1RXWA 3BZCA 1NK7A 4NM2A 1RYUA 1ZJNA 3QX7A 2JXJA 2WHEA 5AKGA 5H2FU 4IRKA 4BUGA 1NI3A 4CNQA 3K75D 1TAQA 2KFZA 3QU5A 5AHXA 5BOMA 2YMQA 3AQEA 2G5IB 4I29A 4U7CA 5J2KA 5AK3A 5HHHA 2P6RA 2KZMA 4RQ2A 4KLDA 4RU9A 3IG8A 2QLTA 5L1LA 2HHXA 3JPPA 4KTQA 2B0CA 2H3ZA 4QZCA 3JPTA 2W8KA 4C7YA 1VDVA 1L3SA 2D3DA 2NYVA 4I2GA 2GOLA 9ICHA 1ZETA 5HR7A 4Z6FA 5G5HA 2E8NA 8ICTA 3BQ7A 5EWFA 1QSLA 4C4RA 3H0LB 2ODGA 2ZJ5A 3FDSA 4XA5A 2WF7A 5KT7A 1PK3A 4OJOA 5J29A 4I2CA 4EYHB 1MN8A 3QE9Y 1UA1A 1ZQAA 2OH2A 1UT5A 5DQIA 3LDAA 4P0QA 2W9BB 4HYKA 2W11A 4JV2A 5KFOA 4LJXA 4ELTA 4F5RA 2ZIWB 3I1YA 1WCNA 3WK6A 3SMVA 3KTQA 4R63A 9ICQA 1RYSA 1A0PA 4DF8A 2F1HA 2ZXHA 1WWUA 2KKPA 4UARA 2HHQA 4I2IA 4YD2A 2G5HB 2A1JA 2WF8A 3WK7A 3ZD9A 4I2BA 2BPGA 1TKDA 2EDUA 1CRXA 2NRXA 2MRLA 1FEZA 2ZIUA 2YB4A 5KFMA 1L3UA 3WK9A 4YP3A 5DBBA 2BPFA 4EBDA 1QH9A 2DL0A 1SXDA 4B9MA 5HP4A 5KG2A 2HHUA 3WKBA 4Y2UA 5F9NA 4DFJA 3SYZA 5KFLA 5L9XA 2HVIA 3G6VA 1PK1B 5J2JA 1N48A 4F5QA 2XCPA 1XSPA 4DL3A 3MFIA 4O3MA 2CXYA 1KRPA 4YVZA 3A0BU 1XS9D 2ZIVA 5AM1A 1U47A 2MSNA 1JUDA 4NXZA 7ICMA 3TAQA 4RNMA 7ICIA 2H3FA 5KTQA 2OWOA 4DSJA 2FLLA 4M47A 5ALZA 2KJ8A 2VANA 4UB3A 3UXPA 4Q8FA 3PW2A 5KFYA 4M0AA 1SKRA 3RFAA 2O6KA 4ED8A 4NV0A 4FO6A 4DSKA 4TUPA 4BXOB 7ICJA 2XC9A 2DPIA 1UPHA 1RQNA 4CDGA 1U45A 3RAXA 5ALTA 4Y2PA 2EZXA 2I9GA 4ELVA 3CRXA 3ZDCA 1MQ3A 1SKWA 4P0PB 3E58A 1ZD2P 1L8LA 2WFAA 1N56A 1NK0A 4EZ6A 2E8OA 1BNOA 4C4TA 4EZ9A 4NJ8A 1SWWA 1KEJA 3QYPA 4PHPA 3NVZA 4MFCA 3AQFA 2A1AA 4O3PA 1RXVA 4NLGA 5DLGA 2N1RA 5J8YC 5HMMA 2EZYA 4M9JA 3GIKA 2HBLA 4J9QA 4F3OA 4ECRA 3M9OB 8ICGA 3ED5A 5AI8A 1ECWA 3ETLA 3THVA 2HHTA 4ELUA 4XQ8A 1PUZA 2KVSA 3PX4A 1ZQSA 4FZNA 4I28A 2UVVA 2D8CA 5L1IA 5KFCA 3PW7A 3RTVA 2EANA 4IRDA 4FBTA 1KL9A 4NLNA 3M8SA 5AM4A 2EAOA 1AQ6A 3EYZA 5T14A 7ICSA 1L5UA 3SQIA 2AGQA 8ICPA 5DB7A 4DSEA 2ZUBA 4O9MA 3K1RB 4MHVA 1GO3F 2Y1IA 4NL9A 3RH4A 2BQRA 3MR6A 2FPMA 1JRPA 2HBKA 4OJ5A 5ALLA 4F71A 1DOQA 2KOBA 9ICJA 4O5EA 3HKZC 4BDPA 4UAVA 2P6UA 5JTIA 4C4SA 2K4PA 2HCFA 5AKJA 4J9SA 5L1KA 4DL2A 1DK3A 3TFSA 1J2NA 3I28A 2WTFA 1IM4A 3H8JA 2DF4B 4YD1A 1KTQA 5KT6A 4YCXA 5AKZA 3AU6A 5IIOA 1U4BA 4Q44A 3SD7A 3N7PD 3RB6A 1M6YA 2Y9TA 1JI7A 2W55A 3HRDD 3GIMA 3GZFA 3C2KA 2IHMA 4O3NA 2LM1A 5KG3A 1N2XA 1N62A 3AU2A 5A0LA 4DL6A 1UHUA 9ICBA 1V38A 1ZYQA 4RUAA 3OSPA 4IC9A 1X9WA 5EE0A 3SI8A 1KQQA 3PVXA 4DCCA 3QEBZ 4O3QA 4F93B 4AYBF 4KLMA 2NO5A 3F5EA 1LB2B 2IOHA 2K4EA 5F3XB 4EBEA 3D2SA 2KIVA 1T3NA 2M9NA 4DFPA 1ZD5A 1D8BA 3PSFA 2XGPA 2ZTCA 5HR6A 3C1ZA 3OTQA 2HSZA 4GXIA 2KSOA 1CUKA 1C20A 2HDOA 3F2DA 4UB2A 2ALZA 2Y9UA 4M9GA 2BKEA 2W9MA 1D9DA 4B9SA 2WB1C 2W7PA 3MFHA 4DOCA 3EPGA 4F5PA 3ORYA 1X9MA 1DXSA 4AP9A 3V7KA 2UVRA 5KG7A 5D49A 1H38A 1B43A 3T79A 4KLJA 2OHFA 2IOFA 3DEEA 2H3QA 2F44A 4UW9A 4XRHA 2G08A 4ED6A 4EX6A 5KFXA 4DL5A 1BGXT 5F9LA 3V6JA 4ECUA 4Y2QA 4TURA 1ZQFA 2AGOA 5KG5A 5ALDA 7ICUA 1KFTA 4DL4A 2BDPA 4QJFB 4DS4A 4DQIA 3N4MB 3N7RC 1ZQXA 2KE7A 3AMZA 2AXTU 4J9RA 2YN4A 5J2GA 2H3IA 4PL2A 1D8YA 4CGZA 2IOFK 3C21A 3C5GA 7ICKA 4IRCA 4O5KA 1SZHA 1S76D 2ASLA 2XY7A 4Y2YA 3T3FA 5AKEA 3RAQA 4F2RA 8ICZA 2CPRA 3HW8A 3TACB 1NJZA 1FFVA 2I1QA 3TARA 9ICXA 1Q3VA 3ICXA 3VCBA 4DWIA 4ACOA 4YR0A 5EOZA 1Z3EB 2JH1A 2HHSA 3L4PA 3MDCA 4F2SA 3NVWA 3V7JA 2Y1JA 1JALA 5G5GA 1YZ7A 1CEZA 2ISPA 4I2JA 4DFMA 4F4KA 3WKCA 2JR5A 1YT3A 2KZ3A 5CHGA 2LHTA 2KEYA 2W9CA 4ICAA 4PPXA 2WF6A 3KHGA 2I5HA 5ALOA 5AI6A 3R9KA 3KZIU 1NKCA 5KFJA 4I2AA 1X9SA 1QQ6A 4TQRA 2KP7A 2D6FC 7ICHA 5BOLA 2KVCA 2AU0A 2LYHA 1LKYA 2PXIA 3D2NA 2UVUA 3N7SC 2ZIUB 3FC4A 5DDMA 2BZFA 1S0MA 3BZKA 3UQ0A 2ASDA 8ICCA 4OJPA 5KFEA 4O3RA 3OJUA 1T3QA 1SWVA 3NVVA 2VJ4A 2YX8A 4TQSA 3GDXA 1XNSA 5DB9A 2KNJA 3V72A 5DQGA 1RZTA 2V9WA 3AL0B 9ICUA 2RHFA 2ATLA 3PSPA 1OW5A 2YMLA 1A77A 5KFNA 4J9OA 3T5KA 3Q8PB 4KX5A 2KHQA 2K8AA 3QU2A 3BQTA 3PO4A 5ALJA 2MUTB 2QARA 3UMBA 2C2DA 1KLNA 2K4HA 3IHQB 3MGVA 5HNKA 1PVQA 2IA6A 4G9BA 1X42A 2VA8A 1SXEA 5AM3A 4ECXA 4OO1J 1ZD3A 4O3OA 1NNLA 4Y2JA 9ICWA 2PFNA 3HKZF 2EH9A 2ZJAA 2XI9A 5KT2A 1UA0A 3LK9A 4O0IA 1BPEA 4NL9C 4KLUA 3C23A 4IR1A 2BQUA 4ZH4A 2HOQA 3E0FA 3M6KA 1N5WA 5CWRA 2FE9A 4K4IA 2W43A 5AICA 1ZQNA 3RB0A 1S97A 1L8OA 1MA7A 2Y0SC 5KG4A 2DUYA 7ICLA 1QSYA 2W03A 3H7IA 3RJEA 4TUSA 2EQYA 4PZOA 3RJKA 5CJ7A 4MEYA 2VJ5A 2F1IA 4E0DA 1X40A 4KLHA 1L7MA 2LYBA 2C28A 3RH5A 2P66A 2PI4A 1BNPA 4FFDA 4UAYA 3IG5A 4YN4A 4DOAA 5ALPA 3PZPA 8ICFA 2BDUA 4IQTA 3L3FX 2DQNB 4UB1A 1L3VA 5ALUA 3GV5B 2FDRA 3F2CA 4B9LA 3L5KA 4KLSA 2E5SA 4QZHA 5D46A 1NK6A 1KBUA 4R65A 2W04A 2M0NA 1T4GA 2DPJA 1YZ6A 4DLEA 2LPEA 2LMRA 4B9VA 5AI9A 5AK4A 1NK9A 4M9NA 4P4MA 3D2QA 2IMWP 3C2LA 1DGJA 4R64A 2W7OA 2WB1F 5ALFA 3MR2A 4NM1A 3BS5A 8ICYA 3JPSA 4DS5A 3WK8A 4QNLA 1N60A 5KFWA 3BQ1A 2BCQA 4BWJA 4A8EA 3S6JA 1NOMA 9ICCA 3PX0A 4ECVA 1K1SA 4RQ4A 1NKBA 1KFDA 1MSWD 4Y2TA 3SAHA 8ICXA 4RT2A 4C8NA 3MGHA 1DK2A 1T7PA 4UQGA 2LI6A 5KT5A 2QB0B 9ICVA 2NO4A 4KLFA 1L6NA 1WG8A 1C7YA 4YMOA 4YQWA 4K4HA 2R8HA 3H4DA 4DSLA 3H0MB 8ICMA 4CE6A 3WK5A 5EE1A 3HX0A 5KFKA 2G0AA 5DDYA 4LZDA 2F1JA 5DBAA 5KL1B 2WAQC 4Z6EA 4DLGA 3QZ7A 5J0UA 5IIIA 1QTMA 4RQ0A 3NTUA 5J2CA 2JHDA 5J2DA 2VA3A 1WUDA 4IQVA 1ZQDA 3LWMA 1COOA 1ZQCA 4PL1A 3OGUA 2HHVA 2HVHA 3C5FA 1Z4OA 4QW9A 1X6IA 2DKZA 3AN1A 3WKEA 1ZQLA 1ZQTA 5IIJA 1TAUA 2KICA 5BPCA 4M6WA 4FZLA 5HHIA 4JV1A 4FE3A 3UQ2A 3QUQA 3B9JA 2W3SA 2F8LA 3ZDEA 4DSIA 4Q45A 2W54A 2HMXA 2V4QA 4RQ8A 8ICJA 2KMDA 3MBYA 4ECYA 3KBBA 1IXRA 4F50A 5J0XA 3JPNA 5FP0A 3ZDAA 1COKA 1QQ5A 2VIXA 1MQ2A 5CRXA 5CA7A 3KKAA 3QUTA 2PFOA 3NUQA 1S8OA 2HBMA 4QW8A 1ZQUA 2R8GA 1UT8A 4F8RA 9ICKA 5IILA 2BQ3A 4YG2A 3PR4A 4K4GA 3C28A 2HOIA 4QWDA 3ZI4A 2JEJA 3QNMA 4J03A 2DWQA 3ISBA 1KSPA 4R66A 3U26A 3PW4A 3PSTA 3M9MB 4FS2A 3M1YA 1N63A 3Q8MA 5J2BA 1KN5A 4QZ8A 4QZFA 4J9LA 4JUZA 4NLZA 2KV2A 2RRDA 3BDPA 4RQ6A 2JZBB 1BPBA 1ED1A 5ALNA 2W9BA 1ZRNA 4EYIB 1SZPA 2HW3A 3MGIA 4F5OA 2ZTDA 5AKXA 8ICHA 4UB4A 2ZIWA 4CF3A 3KHHA 2Z7JA 3C1YA 5IIMA 4MEXA 2ES6A 1N61A 2KN7A 4KMUA 5CR0A 5DQHA 3F53A 4UAZA 3PW0A 1K1QA 4C80A 4YXJA 2A19A 2JRZA 3N28A 4DL7A 5KFUA 3RJFA 4TUQA 8ICUA 7ICRA 2W8LA 4QZDA 4PJ0U 2JGAA 7ICEA 2BCUA 1ZQBA 4FBUA 3ALRA 2L5YA 2XGQA 4ED0A 3SR6A 4LZGA 2K60A 3ONNA 3CP8A 1KKXA 3FAHA 5KG0A 4KN7A 2DBYA 3HT3A 1PK1A 2VKQA 5JRTA 4RQNA 1LKYB 3NRZA 3T5LA 3NGDA 4J9NA 1XWLA 4IQUA 4QWAA 4JV0A 3QUCA 3QU7A 3ISCA 2QKQA 2JV3A 4EELA 4RT3A 1TFRA 4FS1A 1A6SA 3T5HA 4KITB 1U49A 1BVSA 1KW4A 4EEYA 3PV8A 5J0SA 3F2BA 2FPLA 3WKDA 4YFKA 5KNIA 2CN1A 3EW9A 2Y0SF 2GH1A 3MR5A 2EAPA 4RPXA 1SL1A 3DV9A 4BXOA 2YQEA 3E2EA 4GC7A 4HAIA 3GQCA 3HJEA 4OD0A 4F4XA 1BPZA 3PMNA 1VLBA 3CYMA 5JUMA 1Y88A 4F4WA 3EUB2 2KIWA 3PSIA 3NRWA 4P0PA 3IV6A 5KT3A 4JK1A 3OSNA 3GV8B 3BQ2A 1S0NA 1J97A 4PGXA 1ZRMA 2QARB 5TISU 2LYAA 3ISDA 3QEAZ 4QIWC 2XCAA 4O3SA 4KLQA 3B0YA 2F77X 2OYYA 2FI1A 2R8JA 5J2HA 2P35A 3LYSA 5KG6A 2I6XA 4G3IA 1TE2A 4JMUA 4Q43A 1PZNA 1XO0A 8ICLA 3NASA 3RJJA 3QU9A 4QWEA 2KJ9A 2AQ0A 3OHAA 5ALRA 1TK8A 3TI0A 1JX4A 4DO9A 1T8EA 1ZQWA 1ZXIA 5ALQA 1TK5A 5J8YA 1ZQQA 4BGDA 3Q8QB 3GILA 5KFHA 1B22A 3RBDA 4GXJA 4JB3A 2LKYA 4FZMA 4ECQA 2G06A 4M04A 5KT4A 2E8PA 4MFAA 1OUQA 1A76A 3FYHA 2ZUCA 3RJIA 1B0XA 2JEGA 3OJSA 3CW2C 4P0QB 2PFPA 2KKVA 3NS1A 1AROP 4ECZA 3SZ2A 4GIBA 4OJLA 1MC8A 4WJ3B 2ZUDA 2R8KA 1ZQPA 3PR5B 1HIWA 4MF8A 3ZDDA 8ICKA 3JPRA 1RM6C 3T5JA 4RQMA 4JWNA 2A1JB 1X6JA 4PGQA 1ZQIA 4F4YA 3QU4A 2KFNA 3SENA 4X5VA 2ZIXA 3RRGA 3FM9A 5J2AA 1F0MA 3EPIA 9ICAA 3F5AA 4Z6DA 2OEHA 1HJPA 4PGYA 1O08A 1BPXA 5KFFA 3KZXA 4P4PA 1LV5A 4QWCA 5KFZA 1HUZA 1L3TA 1RPLA 2OXOA 1KDHA 5ALMA 3WU2U 9ICOA 2K89A 4RNNA 2NRWA 1ZQYA 5ALIA 4CRXA 2C2RA 4MFFA 8ICOA 3PMLA 5ALSA 3UXOA 2JEIA 5EWEA 3DDHA 4R8UA 1NZPA 2ZIVB 2NRTA 3IDWA 4IS7A 5AM0A 5J2IA 1NJWA 7ICVA 3HP6A 2F76X 2H3VA 1Z00A 4BWMA 2KHVA 3JPQA 1QSSA 3NVYA 3WKAA 4QZEA 1V85A 3V6KA 5J0RA 1VJ5A 5AK6A 2H5XA 2WF9A 8ICIA 1OXJA 2W3RA 3Q8KA 3LWLA 2FLPA 2F3NA 3PW5A 2IHNA 8ICVA 3UM9A 8ICRA 3Q8LA 8ICNA 4LVSA 1RYRA 2OM6A 2AJQA 1ZQ1C 4Z6CA 4QZIA 4CF5A 4M6WB 2OCEA 2F8KA 1Z4NA 3SV4A 1DRGA 4F92B 3GIIA 3H8WA 2YMMA 5J0YA 4MF2A 1Z1BA 2B21A 4P4OA 9ICMA 2PMZC 4AYBC 4F4ZA 2XY6A 5KFVA 1NJYA 9ICPA 2FMSA 4EEKA 8ICAA 3MABA 3KHRA 5KFIA 1ZQVA 3LVWA 1O03A 2C22A 1Z1VA 2HHWA 5DG9A 3RJGA 4BX9C 3D6JA 1P7DA 4UAWA 2R8IA 4I2EA 4YXMA 9ICIA 1BPYA 1S77D 4ECTA 3Q8RB 2XICA 2LBOA 4KN4A 3MC1A 5EWGA 4OCZA 4YMNA 5KFAA 3G6YA 2KD1A 2MAXA 4KLGA 1ZQMA 4PHAA 4J9PA 3OHBA 2PFQA 3MDAA 2E1FA 1SL2A 4QZ9A 3A0HU 5AKIA 3IM1A 5K4LA 4DQRA 1QQ7A 7ICQA 3RF9A 4J9MA 1TV9A 1Q46A 2MA1A 1SV0A 4QZBA 1L7NA 4IR9A 1NK8A 2KG5A 4DEZA 1ZQZA 4Y2XA 2JMGA 5J2EA 4Y2RA 1TAMA 1Q8KA 4OJ6A 3EZ5A 4C8OA 1S0VA 5C5JA 1EXNA 3PY8A 1DGSA 4EENA 3HILA 3BJYA 3UMGA 4CF4A 4I27A 5AIAA 3B0XA 3TFRA 4C7ZA 3RRHA 3TKAA 4GFJA 2K8CB 2G09A 1TK0A 2FJ6A 1ZOLA 1ZQHA 4UAUA 3KOOA 1FFUA 4P2HA 4KMOB 3KD3A 5CEHA 2ZJ8A 1J2MA 4UBBA 4UB6U 4NWIA 4PH5A 4QIWF 3H0RB 9ICNA 3LVVA 4QZGA 4RPYA 7ICFA 5AK5A 1UQVA 3I76A 2J6UA 4GLXA 2HBJA 3QXGA 5C0YA 1K5OA 3GFKB 5AI4A 3IN5A 1NZBA 2ZTEA 2RLTA 2KSOB 2BCSA 4PHDA 5KFRA 1URJA 7ICPA 1WWVA 3GU3A 2GO7A 4F72A 2EZZA 5AKYA 3OPXA 4IL6U 2UVWA 2MUTA 2W9AA 3GV7B 1PVPA 5KG1A 3AUOA 5J0OA 3SAGA 4M9LA 9ICTA 4USAA 3TQ1A 2C2EA 5D4BA 5DG7A 3SV3A 5JU5A 4C8MA 1JIHA 4NLCA 3TADA 2XVTA 9ICGA 3K4GA 2K4IA 1RDFA 5CB1A 4GXKA 4DSFA 2VA2A 4KLIA 2YMPA 3K1ZA 5ALGA 4ZOHC 2AQ4A 1WYGA 4O5CA 4XUSA 3HPOA 4ED2A 5B66U 3M6ZA 4C0ZA 4EX7A 4DQPA 4UASA 5ALEA 2AHOB 4YR3A 5AI5A 2K8BB 5IINA 5KFQA 5KFBA 1V97A 3RR8A 1HUOA 2NRVA 1S5LU 4UB5A 4B9UA 2ISOA 3IRUA 4B9NA 1U9LA 2MU2A 1ZQGA 5GTIU 1RG6A 5HMLA 2E8MA 2QB1A 3M7DA 4UATA 5KFSA 4UBCA 2HI0A 2LM4A 5J0PA 2RQ5A 3JPOA 4ECWA 1NJXA 5L1MA 4RQ1A 4UB8U 5ALYA 3H4BA 1XSNA 3ETRA 1NKEA 4Y2SA 2FLNA 2PKEA 3TAPA 5KFDA 3Q8SB 5CP2A 1LVHA 4RQ5A 4KLEA
chains in the Genus database with same CATH topology
2HBMA 2H3ZA 4A8EA 2F76X 2ZIVA 2HBKA 2H3VA 4OJ5A 2Q4TA 2LHTA 3KFUF 2DGZA 3HKZF 2KEYA 3T79A 2KHVA 2KOBA 2YB1A 3DEEA 1A6SA 2H3QA 4ICAA 2JMGA 3C28A 2GOLA 3HKZC 2HOIA 2G08A 2H3FA 2XI9A 1TAMA 4KX3A 3SAHA 4OJ6A 2LKYA 5HR7A 4FZMA 3SAFA 2KJ8A 2CRXA 2G06A 2E1EA 1OUQA 3F2BA 4NLCA 3RFAA 1T94A 2XVTA 4NV0A 2CN1A 2HOQA 2K4IA 3E0FA 3H0LB 3M6KA 2DF4B 1L6NA 3PSTA 2Y0SF 1UPHA 2GH1A 1Q3UA 2RP5A 2ZIXB 3K1ZA 4CDGA 2OM6A 4OJOA 3H0MB 4P0QB 2D6FC 1MA7A 1ZQ1C 2KKVA 2KVCA 2Y0SC 3N7PD 3D2NA 2W03A 2OH2A 3N7SC 4GFJA 2K8CB 2ZIUB 4OJLA 1F44A 3CRXA 4P0QA 2G0AA 2G09A 3M6ZA 4WJ3B 4P0PB 4C0ZA 3CYMA 1DRGA 5KL8B 2KV2A 2RRDA 4QJFB 3N7RC 3C29A 2XIDA 2PMZF 5KL1B 2WAQC 2VJ5A 4KMOB 1ED1A 3GZFA 2KIWA 3PSIA 3NRWA 1Z1BA 1HIWA 4P0PA 2KJ5A 2JH7A 2LYBA 2PMZC 4AYBC 2K8BB 2ZG6A 2ZIWB 4OJPA 4U6PA 2JHDA 3AQFA 1WUDA 2H3IA 2F2AB 3SMVA 1Z19A 4NWIA 3LVWA 4PL2A 5A0LA 1HEKA 4PL1A 4QIWF 3IG5A 4CGZA 2ZIWA 3H0RB 1A0PA 2ZXHA 3LVVA 2LYAA 2N1RA 2Z7JA 4BX9C 3PZPA 4QIWC 2VJ4A 2KKPA 4IC9A 1SZHA 2BDUA 3IP4B 1P7DA 2YX8A 2HBLA 3L3FX 2ZIXA 2F77X 2DQNB 2G5HB 2OYYA 1XNSA 2KNJA 3F53A 2WAQF 2KICA 4FZLA 1IIPA 1CRXA 2CPRA 2MRLA 4BUGA 1ECWA 3F5AA 2ZIUA 2ZXIA 4AYBF 3AL0B 2YB4A 3M7DA 3F5EA 4FE3A 4BJQA 3F2CA 2K4EA 2XICA 3LYSA 2F8LA 2E5SA 3KZXA 4FZNA 2RHFA 2LBOA 2NV3A 2HBJA 3D2SA 5C0YA 1KBUA 3PSPA 4JMUA 1Q3VA 2HMXA 2W04A 2M0NA 3ICXA 3VCBA 3AQEA 3IN5A 2G07A 2G5IB 3PSFA 3VC8A 4ACOA 1D8BA 1NZBA 2HOFA 2OXOA 4KX5A 4U7CA 1XO0A 5T14A 2KHQA 2JH1A 2K8AA 2KD1A 5HR6A 2JGAA 1URJA 2K89A 3D2QA 3SQIA 2KJ9A 4NLBA 3GU3A 4CRXA 2E1FA 3ALRA 1PVRA 2A3VA 2K4HA 3MGVA 3OPXA 2VIXA 2W7OA 2WB1F 3IG8A 3ONNA 3F2DA 1PVQA 5CRXA 3CP8A 1GO3F 1PVPA 3O0FA 2VKQA 4QNLA 2ZIVB 3SAGA 2WB1C 2W7PA 3NUQA 4OO1J 4O3MA 2R18A 3RF9A 1YT3A 2MA1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CGZ A;  2HBM A;  4QIW F;  4CDG A;  1D8B A;  2HBK A;  2DGZ A;  2HBL A;  4NLB A;  3CYM A;  2KV2 A;  2RRD A;  2E1F A;  4QJF B;  3SAH A;  3SAF A;  2CPR A;  2E1E A;  1GO3 F;  4NLC A;  3SAG A;  4OO1 J;  4O3M A;  2RHF A;  1WUD A;  2HBJ A;  5C0Y A;  1YT3 A;  2MA1 A; 
#chains in the Genus database with same CATH topology
 2W9C B;  3UMC A;  3RH6 A;  3KFU F;  1JXE A;  2KTQ A;  2YB1 A;  5DBC A;  1ZQR A;  1QLN A;  3M9N B;  1BPD A;  2PI5 A;  8ICB A;  2V4R A;  2E1E A;  3ZDB A;  4KLO A;  2AH5 A;  1X66 A;  1NK4 A;  1L7O A;  1V9P A;  3CNH A;  5E79 U;  2RP5 A;  2ZIX B;  5DG8 A;  3C2M A;  2BPC A;  2QB0 A;  5KFG A;  1L7P A;  3PNC A;  7ICT A;  4GC6 A;  3PO5 A;  5J0W A;  1JMS A;  4NY8 A;  5EE3 A;  5KAF U;  1FIQ A;  2B6G A;  3G6X A;  3QUB A;  2WF5 A;  2PMZ F;  7ICO A;  2DKX A;  2FMP A;  4DF4 A;  2JH7 A;  4ED1 A;  4M9H A;  4F5N A;  4U6P A;  1SB3 C;  2F2A B;  4DFD A;  5DGB A;  4RZR A;  9ICS A;  1ZQO A;  5DLF A;  1KFS A;  4I2H A;  3IP4 B;  4R8U B;  4J9K A;  4JWM A;  2J6T A;  1ZQE A;  4BJQ A;  1Z00 B;  3V7L A;  5J0Q A;  4ED7 A;  5ALK A;  2YTU A;  2BCR A;  8ICW A;  2G07 A;  4RQ7 A;  3BS7 A;  4US8 A;  5ALH A;  5AI0 A;  1JN3 A;  1RQL A;  4ED3 A;  4Q8E A;  1X9X A;  2ASJ A;  5IIK A;  2KK0 A;  4NLB A;  1ZJM A;  1NK5 A;  1PVR A;  2A3V A;  1S9F A;  7ICG A;  4US9 A;  1JXL A;  2RDJ A;  4DFK A;  3O0F A;  5KAI U;  4YR2 A;  2R18 A;  3H8S A;  1SGG A;  2E3T A;  1UCV A;  1JRO A;  1N5X A;  2DGZ A;  5GTH U;  8ICQ A;  3HWT A;  3RB4 A;  2BR0 A;  1SL0 A;  2IBK A;  4NLK A;  7ICN A;  3EWA A;  3UXN A;  4KX3 A;  5AM2 A;  4RUC A;  3SAF A;  2FPK A;  2CRX A;  5ALW A;  3QZ8 A;  1SV4 A;  2YY6 A;  1SV0 C;  5AKL A;  3N97 B;  9ICF A;  4F91 B;  5DKW A;  5AM5 A;  1D9F A;  1F44 A;  4ECS A;  4PZN A;  4DQS A;  5KL8 B;  4QZA A;  3C29 A;  2DFL A;  5KFP A;  1XSL A;  2BCV A;  2KJ5 A;  1XC9 A;  1XO1 A;  3ZD8 A;  1TVA A;  2J6S A;  2JZB A;  5J2F A;  1HEK A;  4B9T A;  2EAM A;  5ALV A;  5DGA A;  1IV8 A;  1ZQJ A;  3UPQ A;  1U48 A;  9ICR A;  4PHE A;  1SIJ A;  2WAQ F;  9ICL A;  3M8R A;  4EBC A;  1IIP A;  3AM9 A;  4YMM A;  4RQ3 A;  2BGW A;  2ZXI A;  3J81 j;  4Y2V A;  2NV3 A;  5EE9 A;  1ZD4 A;  2KZZ A;  5DB6 A;  3VC8 A;  1D8L A;  2HOF A;  2BHN A;  2NRZ A;  4C8L A;  3BS5 B;  3RB3 A;  4DQQ A;  5J0T A;  1WCL A;  5ALX A;  2Q0Z X;  4RPZ A;  3WK4 A;  5L1J A;  1QCK A;  1FO4 A;  1SKS A;  3MR3 A;  3H8M A;  1ZQK A;  4B6J A;  2Q4T A;  4RNO A;  1XU4 A;  9ICE A;  1X2I A;  1B4F A;  2GWS A;  4I2F A;  5TZV A;  4QWB A;  5AKK A;  4C8K A;  1CI4 A;  3V6H A;  4M2Y A;  5DB8 A;  3SEI A;  4IQW A;  1T94 A;  1F5S A;  3KHL A;  2ESE A;  1Q3U A;  4CCH A;  3PX6 A;  2XY5 A;  8ICS A;  2JEF A;  3RR7 A;  1S10 A;  3TAN A;  3RJH A;  3RBE A;  2FMQ A;  4KLL A;  1S0O A;  2RDI A;  2GLE A;  3H40 A;  3BQ0 A;  1IG6 A;  2XID A;  5KFT A;  3KKA C;  5AKH A;  3TAD C;  5AIB A;  4I2D A;  2AGP A;  2ZG6 A;  4KLT A;  5B5E U;  1Z19 A;  4DOB A;  3AEV A;  2XO7 A;  8ICE A;  3GIJ A;  1RXW A;  3BZC A;  1NK7 A;  4NM2 A;  1RYU A;  1ZJN A;  3QX7 A;  2JXJ A;  2WHE A;  5AKG A;  5H2F U;  4IRK A;  4BUG A;  1NI3 A;  4CNQ A;  3K75 D;  1TAQ A;  2KFZ A;  3QU5 A;  5AHX A;  5BOM A;  2YMQ A;  3AQE A;  2G5I B;  4I29 A;  4U7C A;  5J2K A;  5AK3 A;  5HHH A;  2P6R A;  2KZM A;  4RQ2 A;  4KLD A;  4RU9 A;  3IG8 A;  2QLT A;  5L1L A;  2HHX A;  3JPP A;  4KTQ A;  2B0C A;  2H3Z A;  4QZC A;  3JPT A;  2W8K A;  4C7Y A;  1VDV A;  1L3S A;  2D3D A;  2NYV A;  4I2G A;  2GOL A;  9ICH A;  1ZET A;  5HR7 A;  4Z6F A;  5G5H A;  2E8N A;  8ICT A;  3BQ7 A;  5EWF A;  1QSL A;  4C4R A;  3H0L B;  2ODG A;  2ZJ5 A;  3FDS A;  4XA5 A;  2WF7 A;  5KT7 A;  1PK3 A;  4OJO A;  5J29 A;  4I2C A;  4EYH B;  1MN8 A;  3QE9 Y;  1UA1 A;  1ZQA A;  2OH2 A;  1UT5 A;  5DQI A;  3LDA A;  4P0Q A;  2W9B B;  4HYK A;  2W11 A;  4JV2 A;  5KFO A;  4LJX A;  4ELT A;  4F5R A;  2ZIW B;  3I1Y A;  1WCN A;  3WK6 A;  3SMV A;  3KTQ A;  4R63 A;  9ICQ A;  1RYS A;  1A0P A;  4DF8 A;  2F1H A;  2ZXH A;  1WWU A;  2KKP A;  4UAR A;  2HHQ A;  4I2I A;  4YD2 A;  2G5H B;  2A1J A;  2WF8 A;  3WK7 A;  3ZD9 A;  4I2B A;  2BPG A;  1TKD A;  2EDU A;  1CRX A;  2NRX A;  2MRL A;  1FEZ A;  2ZIU A;  2YB4 A;  5KFM A;  1L3U A;  3WK9 A;  4YP3 A;  5DBB A;  2BPF A;  4EBD A;  1QH9 A;  2DL0 A;  1SXD A;  4B9M A;  5HP4 A;  5KG2 A;  2HHU A;  3WKB A;  4Y2U A;  5F9N A;  4DFJ A;  3SYZ A;  5KFL A;  5L9X A;  2HVI A;  3G6V A;  1PK1 B;  5J2J A;  1N48 A;  4F5Q A;  2XCP A;  1XSP A;  4DL3 A;  3MFI A;  4O3M A;  2CXY A;  1KRP A;  4YVZ A;  3A0B U;  1XS9 D;  2ZIV A;  5AM1 A;  1U47 A;  2MSN A;  1JUD A;  4NXZ A;  7ICM A;  3TAQ A;  4RNM A;  7ICI A;  2H3F A;  5KTQ A;  2OWO A;  4DSJ A;  2FLL A;  4M47 A;  5ALZ A;  2KJ8 A;  2VAN A;  4UB3 A;  3UXP A;  4Q8F A;  3PW2 A;  5KFY A;  4M0A A;  1SKR A;  3RFA A;  2O6K A;  4ED8 A;  4NV0 A;  4FO6 A;  4DSK A;  4TUP A;  4BXO B;  7ICJ A;  2XC9 A;  2DPI A;  1UPH A;  1RQN A;  4CDG A;  1U45 A;  3RAX A;  5ALT A;  4Y2P A;  2EZX A;  2I9G A;  4ELV A;  3CRX A;  3ZDC A;  1MQ3 A;  1SKW A;  4P0P B;  3E58 A;  1ZD2 P;  1L8L A;  2WFA A;  1N56 A;  1NK0 A;  4EZ6 A;  2E8O A;  1BNO A;  4C4T A;  4EZ9 A;  4NJ8 A;  1SWW A;  1KEJ A;  3QYP A;  4PHP A;  3NVZ A;  4MFC A;  3AQF A;  2A1A A;  4O3P A;  1RXV A;  4NLG A;  5DLG A;  2N1R A;  5J8Y C;  5HMM A;  2EZY A;  4M9J A;  3GIK A;  2HBL A;  4J9Q A;  4F3O A;  4ECR A;  3M9O B;  8ICG A;  3ED5 A;  5AI8 A;  1ECW A;  3ETL A;  3THV A;  2HHT A;  4ELU A;  4XQ8 A;  1PUZ A;  2KVS A;  3PX4 A;  1ZQS A;  4FZN A;  4I28 A;  2UVV A;  2D8C A;  5L1I A;  5KFC A;  3PW7 A;  3RTV A;  2EAN A;  4IRD A;  4FBT A;  1KL9 A;  4NLN A;  3M8S A;  5AM4 A;  2EAO A;  1AQ6 A;  3EYZ A;  5T14 A;  7ICS A;  1L5U A;  3SQI A;  2AGQ A;  8ICP A;  5DB7 A;  4DSE A;  2ZUB A;  4O9M A;  3K1R B;  4MHV A;  1GO3 F;  2Y1I A;  4NL9 A;  3RH4 A;  2BQR A;  3MR6 A;  2FPM A;  1JRP A;  2HBK A;  4OJ5 A;  5ALL A;  4F71 A;  1DOQ A;  2KOB A;  9ICJ A;  4O5E A;  3HKZ C;  4BDP A;  4UAV A;  2P6U A;  5JTI A;  4C4S A;  2K4P A;  2HCF A;  5AKJ A;  4J9S A;  5L1K A;  4DL2 A;  1DK3 A;  3TFS A;  1J2N A;  3I28 A;  2WTF A;  1IM4 A;  3H8J A;  2DF4 B;  4YD1 A;  1KTQ A;  5KT6 A;  4YCX A;  5AKZ A;  3AU6 A;  5IIO A;  1U4B A;  4Q44 A;  3SD7 A;  3N7P D;  3RB6 A;  1M6Y A;  2Y9T A;  1JI7 A;  2W55 A;  3HRD D;  3GIM A;  3GZF A;  3C2K A;  2IHM A;  4O3N A;  2LM1 A;  5KG3 A;  1N2X A;  1N62 A;  3AU2 A;  5A0L A;  4DL6 A;  1UHU A;  9ICB A;  1V38 A;  1ZYQ A;  4RUA A;  3OSP A;  4IC9 A;  1X9W A;  5EE0 A;  3SI8 A;  1KQQ A;  3PVX A;  4DCC A;  3QEB Z;  4O3Q A;  4F93 B;  4AYB F;  4KLM A;  2NO5 A;  3F5E A;  1LB2 B;  2IOH A;  2K4E A;  5F3X B;  4EBE A;  3D2S A;  2KIV A;  1T3N A;  2M9N A;  4DFP A;  1ZD5 A;  1D8B A;  3PSF A;  2XGP A;  2ZTC A;  5HR6 A;  3C1Z A;  3OTQ A;  2HSZ A;  4GXI A;  2KSO A;  1CUK A;  1C20 A;  2HDO A;  3F2D A;  4UB2 A;  2ALZ A;  2Y9U A;  4M9G A;  2BKE A;  2W9M A;  1D9D A;  4B9S A;  2WB1 C;  2W7P A;  3MFH A;  4DOC A;  3EPG A;  4F5P A;  3ORY A;  1X9M A;  1DXS A;  4AP9 A;  3V7K A;  2UVR A;  5KG7 A;  5D49 A;  1H38 A;  1B43 A;  3T79 A;  4KLJ A;  2OHF A;  2IOF A;  3DEE A;  2H3Q A;  2F44 A;  4UW9 A;  4XRH A;  2G08 A;  4ED6 A;  4EX6 A;  5KFX A;  4DL5 A;  1BGX T;  5F9L A;  3V6J A;  4ECU A;  4Y2Q A;  4TUR A;  1ZQF A;  2AGO A;  5KG5 A;  5ALD A;  7ICU A;  1KFT A;  4DL4 A;  2BDP A;  4QJF B;  4DS4 A;  4DQI A;  3N4M B;  3N7R C;  1ZQX A;  2KE7 A;  3AMZ A;  2AXT U;  4J9R A;  2YN4 A;  5J2G A;  2H3I A;  4PL2 A;  1D8Y A;  4CGZ A;  2IOF K;  3C21 A;  3C5G A;  7ICK A;  4IRC A;  4O5K A;  1SZH A;  1S76 D;  2ASL A;  2XY7 A;  4Y2Y A;  3T3F A;  5AKE A;  3RAQ A;  4F2R A;  8ICZ A;  2CPR A;  3HW8 A;  3TAC B;  1NJZ A;  1FFV A;  2I1Q A;  3TAR A;  9ICX A;  1Q3V A;  3ICX A;  3VCB A;  4DWI A;  4ACO A;  4YR0 A;  5EOZ A;  1Z3E B;  2JH1 A;  2HHS A;  3L4P A;  3MDC A;  4F2S A;  3NVW A;  3V7J A;  2Y1J A;  1JAL A;  5G5G A;  1YZ7 A;  1CEZ A;  2ISP A;  4I2J A;  4DFM A;  4F4K A;  3WKC A;  2JR5 A;  1YT3 A;  2KZ3 A;  5CHG A;  2LHT A;  2KEY A;  2W9C A;  4ICA A;  4PPX A;  2WF6 A;  3KHG A;  2I5H A;  5ALO A;  5AI6 A;  3R9K A;  3KZI U;  1NKC A;  5KFJ A;  4I2A A;  1X9S A;  1QQ6 A;  4TQR A;  2KP7 A;  2D6F C;  7ICH A;  5BOL A;  2KVC A;  2AU0 A;  2LYH A;  1LKY A;  2PXI A;  3D2N A;  2UVU A;  3N7S C;  2ZIU B;  3FC4 A;  5DDM A;  2BZF A;  1S0M A;  3BZK A;  3UQ0 A;  2ASD A;  8ICC A;  4OJP A;  5KFE A;  4O3R A;  3OJU A;  1T3Q A;  1SWV A;  3NVV A;  2VJ4 A;  2YX8 A;  4TQS A;  3GDX A;  1XNS A;  5DB9 A;  2KNJ A;  3V72 A;  5DQG A;  1RZT A;  2V9W A;  3AL0 B;  9ICU A;  2RHF A;  2ATL A;  3PSP A;  1OW5 A;  2YML A;  1A77 A;  5KFN A;  4J9O A;  3T5K A;  3Q8P B;  4KX5 A;  2KHQ A;  2K8A A;  3QU2 A;  3BQT A;  3PO4 A;  5ALJ A;  2MUT B;  2QAR A;  3UMB A;  2C2D A;  1KLN A;  2K4H A;  3IHQ B;  3MGV A;  5HNK A;  1PVQ A;  2IA6 A;  4G9B A;  1X42 A;  2VA8 A;  1SXE A;  5AM3 A;  4ECX A;  4OO1 J;  1ZD3 A;  4O3O A;  1NNL A;  4Y2J A;  9ICW A;  2PFN A;  3HKZ F;  2EH9 A;  2ZJA A;  2XI9 A;  5KT2 A;  1UA0 A;  3LK9 A;  4O0I A;  1BPE A;  4NL9 C;  4KLU A;  3C23 A;  4IR1 A;  2BQU A;  4ZH4 A;  2HOQ A;  3E0F A;  3M6K A;  1N5W A;  5CWR A;  2FE9 A;  4K4I A;  2W43 A;  5AIC A;  1ZQN A;  3RB0 A;  1S97 A;  1L8O A;  1MA7 A;  2Y0S C;  5KG4 A;  2DUY A;  7ICL A;  1QSY A;  2W03 A;  3H7I A;  3RJE A;  4TUS A;  2EQY A;  4PZO A;  3RJK A;  5CJ7 A;  4MEY A;  2VJ5 A;  2F1I A;  4E0D A;  1X40 A;  4KLH A;  1L7M A;  2LYB A;  2C28 A;  3RH5 A;  2P66 A;  2PI4 A;  1BNP A;  4FFD A;  4UAY A;  3IG5 A;  4YN4 A;  4DOA A;  5ALP A;  3PZP A;  8ICF A;  2BDU A;  4IQT A;  3L3F X;  2DQN B;  4UB1 A;  1L3V A;  5ALU A;  3GV5 B;  2FDR A;  3F2C A;  4B9L A;  3L5K A;  4KLS A;  2E5S A;  4QZH A;  5D46 A;  1NK6 A;  1KBU A;  4R65 A;  2W04 A;  2M0N A;  1T4G A;  2DPJ A;  1YZ6 A;  4DLE A;  2LPE A;  2LMR A;  4B9V A;  5AI9 A;  5AK4 A;  1NK9 A;  4M9N A;  4P4M A;  3D2Q A;  2IMW P;  3C2L A;  1DGJ A;  4R64 A;  2W7O A;  2WB1 F;  5ALF A;  3MR2 A;  4NM1 A;  3BS5 A;  8ICY A;  3JPS A;  4DS5 A;  3WK8 A;  4QNL A;  1N60 A;  5KFW A;  3BQ1 A;  2BCQ A;  4BWJ A;  4A8E A;  3S6J A;  1NOM A;  9ICC A;  3PX0 A;  4ECV A;  1K1S A;  4RQ4 A;  1NKB A;  1KFD A;  1MSW D;  4Y2T A;  3SAH A;  8ICX A;  4RT2 A;  4C8N A;  3MGH A;  1DK2 A;  1T7P A;  4UQG A;  2LI6 A;  5KT5 A;  2QB0 B;  9ICV A;  2NO4 A;  4KLF A;  1L6N A;  1WG8 A;  1C7Y A;  4YMO A;  4YQW A;  4K4H A;  2R8H A;  3H4D A;  4DSL A;  3H0M B;  8ICM A;  4CE6 A;  3WK5 A;  5EE1 A;  3HX0 A;  5KFK A;  2G0A A;  5DDY A;  4LZD A;  2F1J A;  5DBA A;  5KL1 B;  2WAQ C;  4Z6E A;  4DLG A;  3QZ7 A;  5J0U A;  5III A;  1QTM A;  4RQ0 A;  3NTU A;  5J2C A;  2JHD A;  5J2D A;  2VA3 A;  1WUD A;  4IQV A;  1ZQD A;  3LWM A;  1COO A;  1ZQC A;  4PL1 A;  3OGU A;  2HHV A;  2HVH A;  3C5F A;  1Z4O A;  4QW9 A;  1X6I A;  2DKZ A;  3AN1 A;  3WKE A;  1ZQL A;  1ZQT A;  5IIJ A;  1TAU A;  2KIC A;  5BPC A;  4M6W A;  4FZL A;  5HHI A;  4JV1 A;  4FE3 A;  3UQ2 A;  3QUQ A;  3B9J A;  2W3S A;  2F8L A;  3ZDE A;  4DSI A;  4Q45 A;  2W54 A;  2HMX A;  2V4Q A;  4RQ8 A;  8ICJ A;  2KMD A;  3MBY A;  4ECY A;  3KBB A;  1IXR A;  4F50 A;  5J0X A;  3JPN A;  5FP0 A;  3ZDA A;  1COK A;  1QQ5 A;  2VIX A;  1MQ2 A;  5CRX A;  5CA7 A;  3KKA A;  3QUT A;  2PFO A;  3NUQ A;  1S8O A;  2HBM A;  4QW8 A;  1ZQU A;  2R8G A;  1UT8 A;  4F8R A;  9ICK A;  5IIL A;  2BQ3 A;  4YG2 A;  3PR4 A;  4K4G A;  3C28 A;  2HOI A;  4QWD A;  3ZI4 A;  2JEJ A;  3QNM A;  4J03 A;  2DWQ A;  3ISB A;  1KSP A;  4R66 A;  3U26 A;  3PW4 A;  3PST A;  3M9M B;  4FS2 A;  3M1Y A;  1N63 A;  3Q8M A;  5J2B A;  1KN5 A;  4QZ8 A;  4QZF A;  4J9L A;  4JUZ A;  4NLZ A;  2KV2 A;  2RRD A;  3BDP A;  4RQ6 A;  2JZB B;  1BPB A;  1ED1 A;  5ALN A;  2W9B A;  1ZRN A;  4EYI B;  1SZP A;  2HW3 A;  3MGI A;  4F5O A;  2ZTD A;  5AKX A;  8ICH A;  4UB4 A;  2ZIW A;  4CF3 A;  3KHH A;  2Z7J A;  3C1Y A;  5IIM A;  4MEX A;  2ES6 A;  1N61 A;  2KN7 A;  4KMU A;  5CR0 A;  5DQH A;  3F53 A;  4UAZ A;  3PW0 A;  1K1Q A;  4C80 A;  4YXJ A;  2A19 A;  2JRZ A;  3N28 A;  4DL7 A;  5KFU A;  3RJF A;  4TUQ A;  8ICU A;  7ICR A;  2W8L A;  4QZD A;  4PJ0 U;  2JGA A;  7ICE A;  2BCU A;  1ZQB A;  4FBU A;  3ALR A;  2L5Y A;  2XGQ A;  4ED0 A;  3SR6 A;  4LZG A;  2K60 A;  3ONN A;  3CP8 A;  1KKX A;  3FAH A;  5KG0 A;  4KN7 A;  2DBY A;  3HT3 A;  1PK1 A;  2VKQ A;  5JRT A;  4RQN A;  1LKY B;  3NRZ A;  3T5L A;  3NGD A;  4J9N A;  1XWL A;  4IQU A;  4QWA A;  4JV0 A;  3QUC A;  3QU7 A;  3ISC A;  2QKQ A;  2JV3 A;  4EEL A;  4RT3 A;  1TFR A;  4FS1 A;  1A6S A;  3T5H A;  4KIT B;  1U49 A;  1BVS A;  1KW4 A;  4EEY A;  3PV8 A;  5J0S A;  3F2B A;  2FPL A;  3WKD A;  4YFK A;  5KNI A;  2CN1 A;  3EW9 A;  2Y0S F;  2GH1 A;  3MR5 A;  2EAP A;  4RPX A;  1SL1 A;  3DV9 A;  4BXO A;  2YQE A;  3E2E A;  4GC7 A;  4HAI A;  3GQC A;  3HJE A;  4OD0 A;  4F4X A;  1BPZ A;  3PMN A;  1VLB A;  3CYM A;  5JUM A;  1Y88 A;  4F4W A;  3EUB 2;  2KIW A;  3PSI A;  3NRW A;  4P0P A;  3IV6 A;  5KT3 A;  4JK1 A;  3OSN A;  3GV8 B;  3BQ2 A;  1S0N A;  1J97 A;  4PGX A;  1ZRM A;  2QAR B;  5TIS U;  2LYA A;  3ISD A;  3QEA Z;  4QIW C;  2XCA A;  4O3S A;  4KLQ A;  3B0Y A;  2F77 X;  2OYY A;  2FI1 A;  2R8J A;  5J2H A;  2P35 A;  3LYS A;  5KG6 A;  2I6X A;  4G3I A;  1TE2 A;  4JMU A;  4Q43 A;  1PZN A;  1XO0 A;  8ICL A;  3NAS A;  3RJJ A;  3QU9 A;  4QWE A;  2KJ9 A;  2AQ0 A;  3OHA A;  5ALR A;  1TK8 A;  3TI0 A;  1JX4 A;  4DO9 A;  1T8E A;  1ZQW A;  1ZXI A;  5ALQ A;  1TK5 A;  5J8Y A;  1ZQQ A;  4BGD A;  3Q8Q B;  3GIL A;  5KFH A;  1B22 A;  3RBD A;  4GXJ A;  4JB3 A;  2LKY A;  4FZM A;  4ECQ A;  2G06 A;  4M04 A;  5KT4 A;  2E8P A;  4MFA A;  1OUQ A;  1A76 A;  3FYH A;  2ZUC A;  3RJI A;  1B0X A;  2JEG A;  3OJS A;  3CW2 C;  4P0Q B;  2PFP A;  2KKV A;  3NS1 A;  1ARO P;  4ECZ A;  3SZ2 A;  4GIB A;  4OJL A;  1MC8 A;  4WJ3 B;  2ZUD A;  2R8K A;  1ZQP A;  3PR5 B;  1HIW A;  4MF8 A;  3ZDD A;  8ICK A;  3JPR A;  1RM6 C;  3T5J A;  4RQM A;  4JWN A;  2A1J B;  1X6J A;  4PGQ A;  1ZQI A;  4F4Y A;  3QU4 A;  2KFN A;  3SEN A;  4X5V A;  2ZIX A;  3RRG A;  3FM9 A;  5J2A A;  1F0M A;  3EPI A;  9ICA A;  3F5A A;  4Z6D A;  2OEH A;  1HJP A;  4PGY A;  1O08 A;  1BPX A;  5KFF A;  3KZX A;  4P4P A;  1LV5 A;  4QWC A;  5KFZ A;  1HUZ A;  1L3T A;  1RPL A;  2OXO A;  1KDH A;  5ALM A;  3WU2 U;  9ICO A;  2K89 A;  4RNN A;  2NRW A;  1ZQY A;  5ALI A;  4CRX A;  2C2R A;  4MFF A;  8ICO A;  3PML A;  5ALS A;  3UXO A;  2JEI A;  5EWE A;  3DDH A;  4R8U A;  1NZP A;  2ZIV B;  2NRT A;  3IDW A;  4IS7 A;  5AM0 A;  5J2I A;  1NJW A;  7ICV A;  3HP6 A;  2F76 X;  2H3V A;  1Z00 A;  4BWM A;  2KHV A;  3JPQ A;  1QSS A;  3NVY A;  3WKA A;  4QZE A;  1V85 A;  3V6K A;  5J0R A;  1VJ5 A;  5AK6 A;  2H5X A;  2WF9 A;  8ICI A;  1OXJ A;  2W3R A;  3Q8K A;  3LWL A;  2FLP A;  2F3N A;  3PW5 A;  2IHN A;  8ICV A;  3UM9 A;  8ICR A;  3Q8L A;  8ICN A;  4LVS A;  1RYR A;  2OM6 A;  2AJQ A;  1ZQ1 C;  4Z6C A;  4QZI A;  4CF5 A;  4M6W B;  2OCE A;  2F8K A;  1Z4N A;  3SV4 A;  1DRG A;  4F92 B;  3GII A;  3H8W A;  2YMM A;  5J0Y A;  4MF2 A;  1Z1B A;  2B21 A;  4P4O A;  9ICM A;  2PMZ C;  4AYB C;  4F4Z A;  2XY6 A;  5KFV A;  1NJY A;  9ICP A;  2FMS A;  4EEK A;  8ICA A;  3MAB A;  3KHR A;  5KFI A;  1ZQV A;  3LVW A;  1O03 A;  2C22 A;  1Z1V A;  2HHW A;  5DG9 A;  3RJG A;  4BX9 C;  3D6J A;  1P7D A;  4UAW A;  2R8I A;  4I2E A;  4YXM A;  9ICI A;  1BPY A;  1S77 D;  4ECT A;  3Q8R B;  2XIC A;  2LBO A;  4KN4 A;  3MC1 A;  5EWG A;  4OCZ A;  4YMN A;  5KFA A;  3G6Y A;  2KD1 A;  2MAX A;  4KLG A;  1ZQM A;  4PHA A;  4J9P A;  3OHB A;  2PFQ A;  3MDA A;  2E1F A;  1SL2 A;  4QZ9 A;  3A0H U;  5AKI A;  3IM1 A;  5K4L A;  4DQR A;  1QQ7 A;  7ICQ A;  3RF9 A;  4J9M A;  1TV9 A;  1Q46 A;  2MA1 A;  1SV0 A;  4QZB A;  1L7N A;  4IR9 A;  1NK8 A;  2KG5 A;  4DEZ A;  1ZQZ A;  4Y2X A;  2JMG A;  5J2E A;  4Y2R A;  1TAM A;  1Q8K A;  4OJ6 A;  3EZ5 A;  4C8O A;  1S0V A;  5C5J A;  1EXN A;  3PY8 A;  1DGS A;  4EEN A;  3HIL A;  3BJY A;  3UMG A;  4CF4 A;  4I27 A;  5AIA A;  3B0X A;  3TFR A;  4C7Z A;  3RRH A;  3TKA A;  4GFJ A;  2K8C B;  2G09 A;  1TK0 A;  2FJ6 A;  1ZOL A;  1ZQH A;  4UAU A;  3KOO A;  1FFU A;  4P2H A;  4KMO B;  3KD3 A;  5CEH A;  2ZJ8 A;  1J2M A;  4UBB A;  4UB6 U;  4NWI A;  4PH5 A;  4QIW F;  3H0R B;  9ICN A;  3LVV A;  4QZG A;  4RPY A;  7ICF A;  5AK5 A;  1UQV A;  3I76 A;  2J6U A;  4GLX A;  2HBJ A;  3QXG A;  5C0Y A;  1K5O A;  3GFK B;  5AI4 A;  3IN5 A;  1NZB A;  2ZTE A;  2RLT A;  2KSO B;  2BCS A;  4PHD A;  5KFR A;  1URJ A;  7ICP A;  1WWV A;  3GU3 A;  2GO7 A;  4F72 A;  2EZZ A;  5AKY A;  3OPX A;  4IL6 U;  2UVW A;  2MUT A;  2W9A A;  3GV7 B;  1PVP A;  5KG1 A;  3AUO A;  5J0O A;  3SAG A;  4M9L A;  9ICT A;  4USA A;  3TQ1 A;  2C2E A;  5D4B A;  5DG7 A;  3SV3 A;  5JU5 A;  4C8M A;  1JIH A;  4NLC A;  3TAD A;  2XVT A;  9ICG A;  3K4G A;  2K4I A;  1RDF A;  5CB1 A;  4GXK A;  4DSF A;  2VA2 A;  4KLI A;  2YMP A;  3K1Z A;  5ALG A;  4ZOH C;  2AQ4 A;  1WYG A;  4O5C A;  4XUS A;  3HPO A;  4ED2 A;  5B66 U;  3M6Z A;  4C0Z A;  4EX7 A;  4DQP A;  4UAS A;  5ALE A;  2AHO B;  4YR3 A;  5AI5 A;  2K8B B;  5IIN A;  5KFQ A;  5KFB A;  1V97 A;  3RR8 A;  1HUO A;  2NRV A;  1S5L U;  4UB5 A;  4B9U A;  2ISO A;  3IRU A;  4B9N A;  1U9L A;  2MU2 A;  1ZQG A;  5GTI U;  1RG6 A;  5HML A;  2E8M A;  2QB1 A;  3M7D A;  4UAT A;  5KFS A;  4UBC A;  2HI0 A;  2LM4 A;  5J0P A;  2RQ5 A;  3JPO A;  4ECW A;  1NJX A;  5L1M A;  4RQ1 A;  4UB8 U;  5ALY A;  3H4B A;  1XSN A;  3ETR A;  1NKE A;  4Y2S A;  2FLN A;  2PKE A;  3TAP A;  5KFD A;  3Q8S B;  5CP2 A;  1LVH A;  4RQ5 A;  4KLE A; 
#chains in the Genus database with same CATH homology
 2HBM A;  2H3Z A;  4A8E A;  2F76 X;  2ZIV A;  2HBK A;  2H3V A;  4OJ5 A;  2Q4T A;  2LHT A;  3KFU F;  2DGZ A;  3HKZ F;  2KEY A;  3T79 A;  2KHV A;  2KOB A;  2YB1 A;  3DEE A;  1A6S A;  2H3Q A;  4ICA A;  2JMG A;  3C28 A;  2GOL A;  3HKZ C;  2HOI A;  2G08 A;  2H3F A;  2XI9 A;  1TAM A;  4KX3 A;  3SAH A;  4OJ6 A;  2LKY A;  5HR7 A;  4FZM A;  3SAF A;  2KJ8 A;  2CRX A;  2G06 A;  2E1E A;  1OUQ A;  3F2B A;  4NLC A;  3RFA A;  1T94 A;  2XVT A;  4NV0 A;  2CN1 A;  2HOQ A;  2K4I A;  3E0F A;  3H0L B;  3M6K A;  2DF4 B;  1L6N A;  3PST A;  2Y0S F;  1UPH A;  2GH1 A;  1Q3U A;  2RP5 A;  2ZIX B;  3K1Z A;  4CDG A;  2OM6 A;  4OJO A;  3H0M B;  4P0Q B;  2D6F C;  1MA7 A;  1ZQ1 C;  2KKV A;  2KVC A;  2Y0S C;  3N7P D;  3D2N A;  2W03 A;  2OH2 A;  3N7S C;  4GFJ A;  2K8C B;  2ZIU B;  4OJL A;  1F44 A;  3CRX A;  4P0Q A;  2G0A A;  2G09 A;  3M6Z A;  4WJ3 B;  4P0P B;  4C0Z A;  3CYM A;  1DRG A;  5KL8 B;  2KV2 A;  2RRD A;  4QJF B;  3N7R C;  3C29 A;  2XID A;  2PMZ F;  5KL1 B;  2WAQ C;  2VJ5 A;  4KMO B;  1ED1 A;  3GZF A;  2KIW A;  3PSI A;  3NRW A;  1Z1B A;  1HIW A;  4P0P A;  2KJ5 A;  2JH7 A;  2LYB A;  2PMZ C;  4AYB C;  2K8B B;  2ZG6 A;  2ZIW B;  4OJP A;  4U6P A;  2JHD A;  3AQF A;  1WUD A;  2H3I A;  2F2A B;  3SMV A;  1Z19 A;  4NWI A;  3LVW A;  4PL2 A;  5A0L A;  1HEK A;  4PL1 A;  4QIW F;  3IG5 A;  4CGZ A;  2ZIW A;  3H0R B;  1A0P A;  2ZXH A;  3LVV A;  2LYA A;  2N1R A;  2Z7J A;  4BX9 C;  3PZP A;  4QIW C;  2VJ4 A;  2KKP A;  4IC9 A;  1SZH A;  2BDU A;  3IP4 B;  1P7D A;  2YX8 A;  2HBL A;  3L3F X;  2ZIX A;  2F77 X;  2DQN B;  2G5H B;  2OYY A;  1XNS A;  2KNJ A;  3F53 A;  2WAQ F;  2KIC A;  4FZL A;  1IIP A;  1CRX A;  2CPR A;  2MRL A;  4BUG A;  1ECW A;  3F5A A;  2ZIU A;  2ZXI A;  4AYB F;  3AL0 B;  2YB4 A;  3M7D A;  3F5E A;  4FE3 A;  4BJQ A;  3F2C A;  2K4E A;  2XIC A;  3LYS A;  2F8L A;  2E5S A;  3KZX A;  4FZN A;  2RHF A;  2LBO A;  2NV3 A;  2HBJ A;  3D2S A;  5C0Y A;  1KBU A;  3PSP A;  4JMU A;  1Q3V A;  2HMX A;  2W04 A;  2M0N A;  3ICX A;  3VCB A;  3AQE A;  3IN5 A;  2G07 A;  2G5I B;  3PSF A;  3VC8 A;  4ACO A;  1D8B A;  1NZB A;  2HOF A;  2OXO A;  4KX5 A;  4U7C A;  1XO0 A;  5T14 A;  2KHQ A;  2JH1 A;  2K8A A;  2KD1 A;  5HR6 A;  2JGA A;  1URJ A;  2K89 A;  3D2Q A;  3SQI A;  2KJ9 A;  4NLB A;  3GU3 A;  4CRX A;  2E1F A;  3ALR A;  1PVR A;  2A3V A;  2K4H A;  3MGV A;  3OPX A;  2VIX A;  2W7O A;  2WB1 F;  3IG8 A;  3ONN A;  3F2D A;  1PVQ A;  5CRX A;  3CP8 A;  1GO3 F;  1PVP A;  3O0F A;  2VKQ A;  4QNL A;  2ZIV B;  3SAG A;  2WB1 C;  2W7P A;  3NUQ A;  4OO1 J;  4O3M A;  2R18 A;  3RF9 A;  1YT3 A;  2MA1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...