3DV9A

Putative beta-phosphoglucomutase from bacteroides vulgatus.
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
246
structure length
243
Chain Sequence
SNAMFKEAINNYLHTHGYESIDLKAVLFDMDGVLFDSMPNHAESWHKIMKRFGFGLSREEAYMHEGRTGASTINIVSRRERGHDATEEEIKAIYQAKTEEFNKCPKAERMPGALEVLTKIKSEGLTPMVVTGSGLLDRLNHNFPGIFQANLMVTAFDVKYGKPNPEPYLMALKKGGFKPNEALVIENAPLGVQAGVAAGIFTIAVNTGPLHDNVLLNEGANLLFHSMPDFNKNWETLQSALKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystal structure of putative beta-phosphoglucomutase from Bacteroides vulgatus.
rcsb
source organism Bacteroides vulgatus
molecule tags Isomerase
molecule keywords beta-phosphoglucomutase
total genus 76
structure length 243
sequence length 246
ec nomenclature
pdb deposition date 2008-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3dv9A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3dv9A01
2Q4TA 4C4SA 2DQSA 4L6CA 1YV9A 4Y2RA 2JAUA 1O08A 3ZVLA 2HSZA 2HOQA 5AKIA 1LVHA 2G07A 2IYEA 2RB5A 4J03A 3KD3A 1U02A 3ZX4A 5ALLA 2CN1A 1ZRMA 4UAVA 5A3QA 2WF7A 3OPXA 2I54A 5ALZA 4UU1A 4I9GA 3GYGA 3DAOA 2RBKA 2ZBGA 1SWWA 1RRCA 3QU4A 3WKBA 1EK1A 1QQ5A 1TJ3A 4UMFA 4XPZA 5IT4A 5ALPA 3I28A 1Q91A 5AW3A 3D6JA 4Y2VA 2HCFA 3ET5A 1L8OA 1Q92A 2FUEA 2ZBEA 4MUMA 5AVQA 3N07A 2NO5A 1N8NA 3NANA 3W5CA 1FEZA 5AKXA 3MPOA 1L7MA 2FEAA 3L0BA 3N5KA 3AR3A 3OCXA 5ALYA 4Y2JA 1F5SA 1MH9A 4AS2A 5AW4A 3L8HA 4HAIA 5AW7A 2B8EA 3WK6A 3AR8A 3DNPA 3FPSA 2YFYA 5AM1A 2GHTA 2R8EA 4ZEXA 3ZWKA 3U26A 4HGQA 2EATA 2FPUA 2ODAA 2HI0A 3R09A 3RFUA 4C4RA 1Z5UA 3RF6A 3L8EA 3UMBA 5ALXA 3QUQA 3A3YA 4Y2SA 4KX5A 3WK7A 3ESRA 5AKHA 1Z4NA 3VAYA 4BKMA 5ALMA 2YMLA 2YMPA 1RMYA 2MU1A 2R8XA 1RC8A 4CF4A 2ZBDA 2P27A 3FVVA 1RMTA 3EF0A 5AVRA 2Q4RA 3B9RA 4O8CA 4NV0A 4G9BA 5JJBA 1QH9A 2OM6A 4JDPA 3WK9A 3OTQA 1TJ4A 2PR7A 1RLMA 4UMVA 3I1YA 2YJ4A 5IT0A 3M1YA 4RETA 4NAVA 4YCNA 2C9MA 2IOFK 5AVZA 1LTQA 3CZ4A 1T9ZA 3WKCA 3U7EB 2B8JA 3QUBA 4GXTA 4E88A 3HLTA 4FYPA 3QU9A 4C4TA 1IWOA 4CE6A 2YBDA 5AW1A 2GHQA 3E81A 2WFAA 2WF8A 3R4CA 4DCCA 5AVXA 3KBBA 1Z4IA 5ALDA 3A1DA 5AI4A 4HYTA 1RPZA 3U19A 3ZTYA 5AVYA 2G08A 3E8MA 3AR7A 3IJ5A 4OHFA 1QQ7A 4F71A 2HX1A 3IRUA 2D2VA 1YNSA 4AP9A 4Y2QA 4PNHA 1L7PA 5AW9A 3ZW7A 4UMEA 2C4NA 3AR9A 5ALSA 2G1AA 3SMVA 2I7DA 2B30A 1Z4OA 4EEKA 4BEWA 4F72A 2AUTA 2HO4A 2R8YA 2W43A 4IG4A 2C88A 4KNVA 1ZJJA 1T5SA 3L1VA 5AESA 3QU5A 1Z4PX 3ZUPA 2ZBFA 4Y2TA 5ALOA 2HHLA 3OCVA 5AW6A 2B0CA 2WF9A 2YMQA 3FGOA 3R9KA 4HGOA 3UMCA 3NIWA 3QUCA 4Y2YA 1CR6A 3A1CA 3NAMA 2WHEA 4UARA 4XQ0A 4Y2XA 2VKQA 1WZCA 3A1EA 3EPRA 4I9FA 2IOFA 3EF1A 2RAVA 3W5BA 4G63A 3ZI4A 3QU7A 3SLRA 3EWIA 2RARA 4BNDA 1YMQA 2NO4A 2B1RA 3NRJA 4UM7A 1SU4A 1Z5GA 1X42A 4GIBA 4CF5A 3U13A 3B9BA 4Y2PA 3WKAA 5FP0A 2BDUA 4QJBA 4IFTA 3QUTA 3L1UA 5AK3A 4EZEA 1RKQA 5AKJA 3ONNA 1YJ5A 5ALRA 3WK5A 2JARA 3PGLA 3QX7A 2FPSA 4YCMA 1RKUA 5ALNA 3L8GA 5A3RA 1L8LA 4EX7A 2CFTA 5ALFA 3WK8A 1RLTA 1CQZA 1L7NA 2B82A 3F9RA 3AR5A 1TJ5A 5ALKA 2AH5A 3B8EA 3J7TA 3KDPA 3W5AA 2YY6A 1VJ5A 1S8OA 4Y2UA 2Q5EA 5T41A 3E84A 5ALWA 1N9KA 4FE3A 3W5DA 5ALEA 3ZWDA 2PQ0A 4XE5A 2W4MA 1XP5A 5AW0A 3MMZA 3ZVMA 1TE2A 1Y8AA 4BX0A 2B1QA 4KX3A 2HF2A 3FPBA 4YH1A 4RESA 2I34A 3HYCA 1ZRNA 3WK4A 2CFRA 1T5TA 3KZXA 4BX2A 3U7HB 3NASA 3WKEA 1ZOLA 5AM5A 5AW5A 5AM0A 2FPXA 2MSNA 2QLTA 5ALIA 2I55A 5E0OA 4H1WA 2ZG6A 3ZX5A 1WR8A 4KYTA 2P9JA 4EENA 1K1EA 4L57A 3U7GA 4DWOA 4YIHA 1L6RA 4J2TA 3AR6A 4YCLA 4BBJA 5AHXA 1YS9A 1WPGA 3SD7A 5ALQA 1RMQA 2FI1A 1ZD4A 1Z4KA 3K1ZA 2PKEA 4CF3A 4BNDB 4FFDA 2AGVA 3P96A 2G0AA 1RQLA 3KOOA 3KC2A 4YIKA 4ZEVA 3IB6A 1ZD2P 3I76A 3SF0A 1RKVA 3OCZA 1ZD5A 1NF2A 3BWVA 1EK2A 5AKEA 2P11A 3OCWA 5AKGA 3L8FA 5AKZA 5ALGA 5AI0A 1XPJA 1YDFA 1JUDA 2FPRA 1Z88A 4EELA 1ZS9A 2GFHA 2JAOA 3N28A 2I6XA 5ALUA 4ZEWA 3TLMA 5AIBA 4UU0A 3E58A 4B6JA 3ED5A 1U2TA 2R8ZA 5ALTA 4HGNA 3OCUA 3MC1A 5AICA 5AVWA 3L0YA 4KN8A 1J8DA 1O03A 2OBBA 2O9JA 3BA6A 2YJ6A 4UW9A 3N8GA 3SKYA 1NRWA 5AIAA 1S2OA 5AI8A 1U7PA 3UMGA 4OCZA 2AMYA 4KNWA 2G80A 2YJ5A 5ALVA 4NABA 5AVUA 1ZD3A 2HEGA 3QGMA 3L7YA 4UMDA 1RQNA 3ZU6A 1KYTA 4BX3A 5AKKA 2WF5A 4DFDA 5AKLA 5AI9A 2EARA 1PW5A 3L0CA 3PGVA 3WGUA 3QNMA 2ZOSA 3AR4A 3PDWA 3CNHA 1VFPA 3L5KA 2WF6A 3QYPA 2QYHA 2HF7A 1U2SA 3UM9A 1RDFA 3ESQA 1SWVA 1TA0A 4Y3UA 1QQ6A 3I6BA 5IS2A 4NFLA 2YMMA 3PCTA 2IA5A 2OA0A 3N1UA 2G09A 2GO7A 2NYVA 3NUQA 2I33A 2C8LA 3ZTWA 3OCYA 3S6JA 2P69A 3WKDA 2G06A 5AM2A 3SKXA 4BYGA 2YJ3A 4UASA 4L6AA 2OYCA 5ALJA 3ZVNA 3DDHA 4EX6A 3QXGA 5AK6A 2YN4A 1WVIA 1Z4MA 3U7FB 4UAUA 3ET4A 2IOHA 5ALHA 1J97A 2EAUA 4NWIA 1Z4QA 4YGYA 3QU2A 5AVVA 2FPWA 3AR2A 2FUCA 1L7OA 5AVSA 2FDRA 2BY4A 5AI6A 1NNLA 2JGAA 5AVTA 4UATA 2BDEA 1RLOA 2W11A 1VJRA 5AKYA 3SHQA 5AW8A 5AM4A 1QYIA 2CFSA 2X4DA 4XOUA 2WM8A 2ZXEA 2JAWA 4DW8A 4OD0A 5A3SA 2MU2A 2GMWA 1Z4JA 3M9LA 5AW2A 3NALA 2HDOA 3WGVA 4QQFA 3MN1A 1XVIA 3FM9A 4JB3A 1Z4LA 1AQ6A 5AK5A 4HGRA 3DV9A 4HGPA 5AM3A 4BEVA 1U7OA 3FZQA 2C8KA 5AI5A 4OFZA 5AK4A 2O2XA 4UM5A 3QLEA 4AS3A 4MWOA 4CNQA
chains in the Genus database with same CATH superfamily
4A2QA 1KDZA 1RYYA 2XMSA 1G8JA 2DKOA 3MBIA 2GSWA 5E6RA 4A0QA 3ZOKA 2QP4A 2XEXA 3OQ6A 3V46A 4E4RA 2JBHA 1IEWA 2PGXA 4DLYA 4F2GA 3M4YA 1ZH0A 1LVHA 2QVGA 1N6PA 2G07A 4CQLB 4Q47A 1U7XA 5TMDA 3UG7A 2IXTA 4PONA 3B53X 2Q6KA 3O21A 5BNFA 2OO7A 3PYLA 3KFXA 2VK1A 3NPMA 5FTKA 1EH5A 5CK5A 2JVKA 4V1CB 1FW6A 3ITEA 1HK7A 4ZT3A 4UU1A 1MENA 4ZOAA 4CU2A 1LTHR 4MWCA 2QVXX 3D7NA 5KFDA 2VDKB 2O5RA 3TRDA 3E9RA 4IDNA 3SHVA 4IJ6A 5CJ2A 1C3OB 4U7PB 4CQMB 5TQ0B 4EKGA 1VRCA 2WVGA 4C7MA 4IZOA 2XYVA 3LO8A 1KXJA 1TMKA 4NM2A 2Q6VA 2HHAA 2FE9A 1UT5A 1N1EA 2PMWB 2QLBA 3GDGA 4NU5A 3PXGA 2LPMA 4ZZ1A 3NHBA 3C6MA 1CY4A 5IVDA 5GM1A 3SEZA 3OP1A 2OH2A 4HNGA 5LB2A 1XCOA 3DTVB 1A8SA 1GV1A 2AEMA 4N3GA 4F60A 1BMDA 2JFNA 2QRVA 4XQ8A 1P77A 2BMAA 1MF7A 3C5CA 4DFJA 5AVQA 2H5IA 1MPXA 1WULS 2J4CA 3UC9A 1TMYA 3LO5A 4OBXA 4TL7A 4Y67A 1L4LA 3L0BA 4I1VA 2DQZA 4JS0A 3BJMA 3V1TC 3W1WA 4JUDX 2Q4DA 2VP0A 5AHRA 1F8FA 2POCA 1XAGA 2H11A 1CJUC 4LOKA 3PW5A 1BQ4A 1SXHA 2P9CA 4P3YA 1KFKB 2FEMA 5TS2A 2HWXA 5SYAA 4LIPD 3SZ2A 1KDTA 2EZ4A 3R3UA 4UU7A 2AFIA 4QYXA 3ZD7A 2PZ8A 4DBLC 3AP3A 4X6UA 2ZTSA 3CHYA 2P4SA 5BPCA 3HYLA 4P4MA 5A9RA 1Q3UA 2A5LA 3ZEIA 3LUHA 1N9GA 3HGMA 1I7SB 2H16A 4FS3A 4YT8A 4PINA 4P3NA 4P4SB 4TRRA 3AJEA 3P2YA 5KYWA 3GCWA 1BE1A 4XM1A 2NM0A 4LZOA 4OATA 1ADFA 4V3CA 3EFEA 3IBTA 3L49A 3MWLA 3MABA 1GCUA 1OW5A 4I5EA 3D1VA 4XSHA 4DIEA 4BWGA 3DCNA 4YR0A 3QNUA 4JNKA 5KL8B 1ENYA 3KUUA 3MYYA 3N0XA 3UOAB 2FMPA 4MRSA 8ICUA 3WLHA 4B9VA 4DLVA 1EMDA 1V11A 3GMDA 1EP2B 3FN4A 5ES4B 4MWTA 3PXUA 4G89A 4GZ6A 3WY9A 1GPAA 3WLRA 2Q6OA 3O8DA 4UNQA 3WNBA 3OX2A 2WSSA 5HR5A 1UJBA 3GFFA 4OJ6A 3ZE2B 3X2SA 2PTHA 5H9WA 1CJBA 2YN0A 4Z4HA 3HN7A 4H6VA 2AHOB 4RAQA 1P2DA 2GEKA 1IJEA 2ZR9A 3BTOA 3G8AA 3IPAA 2MT9A 2NQ8A 2WIAA 4H60A 9ICEA 3A3NA 2GRUA 3ESZA 4OH7A 5HIAA 4TZ0A 2WJZB 3QE2A 1TFRA 2WD9A 3KWMA 6ABPA 3MTEA 1SHKA 3OX3A 3DL4A 5JC1A 2BKAA 1GXSA 3FZEA 4O4HF 5C1BA 4FQ8A 1HTBA 2LUOA 1LPBB 2YHIB 3TNYA 4CQLA 1TEVA 2R47A 2ZPAA 5EE3A 1AZWA 4RHUA 3T12A 1J1ZA 1L4FA 4RQ5A 3LXUX 4K3UA 3CB2A 2E8NA 1TD9A 4X45A 1NK7A 4QJFB 3ENWA 1JQDA 2WFLB 3N6XA 1E32A 4DGSA 3U40A 5HKBA 2C7BA 1B0UA 4EQ6A 1CF9A 3MRSA 1OJLA 4BLRA 3PLRA 2FHPA 3D1LA 5KHLB 1HEUA 1DCTA 3R5SA 2O8BA 2W58A 4JIGA 2IV2X 1YE3A 1E3EA 3ZK7A 2GETA 3DG9A 3ZHBA 3P8ZA 3EGEA 3HM2A 9ICJA 1E6EA 1VLHA 1PFWA 5JADA 4DNPA 5G4LA 1SOAA 3C8HA 3NEYA 5G2OA 5ALDA 4MA5A 2WU1A 1VL0A 1IPEA 1KF0A 1QMPA 1L3UA 1C7EA 2WYUA 2YWXA 1JYEA 1ZM2A 4OHFA 1OX5A 4LMPA 4WGGA 2UUCB 3MR3A 1CF2O 4RE5A 5EQJB 521PA 4A82A 2H4JA 1T0IA 1O95D 2I0FA 1QH1A 3PC7A 4MJ7A 4XQEA 3VSAA 2OEPA 2OE2A 2PGOA 5IINA 3DO6A 4EUSA 2NRXA 4IVRA 5H1YA 4ENPA 1HI9A 2J3QA 3MQ2A 1FYVA 2DUYA 1OIXA 3TXXA 7REQB 1D8LA 1PZEA 3DONA 5GJWC 3TTUA 3HB1A 4UB5A 3KV1A 2C9DA 3OLXA 1OI4A 3ZQKA 3O8RA 3IXQA 4RADA 1XMIA 2I7TA 2Y8EA 2JZNA 3CEMA 1L5KA 4LPKA 4B46A 3AEXA 4AKSA 3V33A 1DWUA 4YAEA 5CBPB 3X0DA 2BBSA 3SQIA 2G0TA 3I6ZA 3I9V6 4JLPA 5E1MA 1SBHA 4ZAWA 5LFAA 2JIMA 1AUQA 4Q8EA 4DQLA 1UMDB 5FBKA 1SD1A 2CJWA 1L4MA 2DFKB 2V55B 4QZBA 2Q1TA 3IGFA 4MR8A 5HG0A 3SEQA 1L7BA 3NOQA 3RV3A 5IDYA 2YFQA 3E3AA 4G1CA 3T35A 2GAJA 3RRYA 1QMGA 5A1TA 4QDKA 4UDYX 4E30A 2QSUA 2LRHA 1RYBA 1VSUA 1ADCA 4I4TF 2XTNA 4UAGA 1ZFNA 3O4RA 1RR6A 2WWTA 4DNQA 4EL5A 3QUCA 2OCXA 3K9GA 3UCEA 4ALJA 1OH8A 4EGAA 3B78A 3B5EA 3A1CA 5BW5A 4FEGA 3WFZA 2DWOA 4O4JB 4X94A 1BHO1 4Y2XA 3DKKA 4FSXA 5A0VA 2RHMA 3MD0A 5A9TA 3LDFA 1YIDA 3JQQA 5CT8A 3FB1A 1PR3A 2EBUA 3LQKA 5FD8A 5KFCA 1W0JD 4C0BA 3IILA 2CNWA 4CNBA 3W5BA 2HJRA 3OQPA 1P60A 4A27A 4F96A 2AJQA 1KJNA 1U6KA 2N75A 2A9FA 2OORC 4B6SA 5LLTA 3BQ9A 1OW3B 3WC4A 1ZK2A 2R2AA 1G7RA 3FPGA 4N3NA 2VI5A 1VE1A 2HMAA 2YRXA 3CEPB 1JJVA 4CQJA 4M9CA 3K70D 4HNQA 2WA1A 1UR5A 1E61A 1K6EA 1XYYA 2VPIA 3L7DA 5EKXA 3GLGB 5HUJA 3LIPA 4HQNA 1UXIA 4WESB 1DQNA 4NMLA 5AUOB 1IXRC 1GEGA 3TQTA 1RRMA 2C5FA 2H51A 1MX3A 4M7RA 4ETMA 4EA8A 5TT1A 2FMSA 4P2GA 4BO9A 4EECA 5HRUA 1DIGA 2GK7A 4FFVA 3ZNNA 2A9VA 2ZYDA 3DB1A 1SVLA 1Z0KA 3IP5A 4G84A 4GMGA 2XJ9A 4RS4A 1E98A 1SRQA 4D99A 3U9TA 4FOSA 1QVVA 2XBUA 5AMXA 3ZWYA 2FFHA 5CLIA 5G4KB 1RKUA 4N54A 5AJYA 3VDNB 1YK1A 5LZ4A 4Z8XA 3PQFA 1GILA 2DYKA 5F2EA 1Z82A 4BQOA 2PI4A 1NFFA 2AG6A 5TIIA 1BIFA 4Q44A 1MG0A 1P39A 2EW2A 2XVMA 4HDKB 2WP0A 1DAHA 4UVDA 2WFMA 3B8EA 4JB0A 1RVDA 4ZT2A 4ECTA 2HYDA 1P7PA 4QO7A 3JASB 3KDPA 2RGWA 1L3IA 1GUBA 4WFJA 1WSDA 2BMJA 2C4HA 2P35A 4Y2UA 4ZMBA 4LOHA 1JDNA 2MYTA 1M3SA 2QXTA 1ZVKA 2Q5EA 3SHWA 4B6EA 4OJQA 5SYNA 1XPUA 4L73A 2G40A 4RK5A 4EHAA 1ORVA 2C9CA 1T1GA 4YXFA 2I6QA 3I04A 3ZWDA 4EP1A 2P6PA 2QTTA 3DC7A 4YMUA 5L4SA 1EK5A 3ODGA 5K3CA 1QKKA 1KJJA 2QE6A 3I64A 3I6YA 1W7AA 4UNIA 1EX1A 4F8RA 4LUCA 4GXKA 4CWAA 2YKGA 5EXSA 1SXJA 2JFPA 4OQLA 4QDTA 1BX0A 4I2IA 1QH8A 3D5TA 3E2PA 3A6FA 3NASA 3FOBA 2PBRA 3B6JA 3HJRA 1QLWA 1ZOLA 2ZGVA 4PC1A 5IJ0A 1FYFA 2HREA 3ZNQA 1JEQA 5KFMA 3KPUA 2QLTA 3OGUA 1AF4A 2DVMA 1WKCA 2WJIA 1MFPA 4ZODA 4WNAB 4MROA 4WKNA 5DTRA 5IEBA 3GLRA 3THXA 1BDJA 4HYEA 5F4ZA 5FOWA 4Y9TA 1WXHA 1EEXB 2DFNA 4EENA 5J2DA 3ROXA 3ZHZA 4CT0A 2OECA 1FRQA 2I8AA 8ICIA 2J5KA 3FFBA 1CQXA 2BQUA 3NBKA 5EWMB 9ICMA 3FG9A 5AHXA 2GN1A 4ZFNA 3B1WA 3PVXA 3R6LA 4DG8A 3KQNA 4QM6A 4MS4B 3TEJA 2WWFA 2JHFA 3T5PA 3C39A 3O95A 4IDHA 1RKXA 3HBMA 3RHSA 1EFPA 5E79U 2B3DA 4LAFA 2JIQA 1USGA 4ESEA 4WXMA 4XR9A 1B8VA 4O29A 3I76A 3WADA 4C0LA 4NCXA 3FDFA 3MWYW 2O19A 4C76A 3LGXA 3OCWA 2PUAA 4NZ9A 2OP1A 3HN6A 5DT9A 2OPHA 2LYBA 1XRRA 2QP9X 3CW9A 3L8FA 2PXCA 4UAJA 5DQIA 1Q7EA 2F76X 5C1IA 4C87A 3HJTA 5HE9A 3FOEC 2P3OA 2GN6A 3JQBA 3A4NA 4RJ2A 2F48A 1HA3A 5HE8A 3RC9A 4KH0A 1GYQA 1VRWA 1NXQA 4RPIA 1SBIA 3QHQA 3O2NA 3DHYA 1YH3A 4A8EA 4LKOA 4AW9A 3ZCPA 2K89A 2HO5A 2JJ8A 3AEVA 3C7AA 3N2LA 4EZ6A 1RWWA 3EE6A 3H40A 1BROA 2W55A 5EWJA 1FFBA 4DLXA 2QTGA 3HVHA 3U4QB 4ED2A 3LA8A 4C78A 2QT1A 2YJ6A 1C0PA 3EH1A 3KYCB 3WIOA 4PZ0A 3UATA 4AZVA 4F7DA 2CVQA 2PS0A 3FI9A 4V0QA 2D8AA 4I4LA 3COSA 5GV7A 1DAMA 1WU8A 1YOVA 3K30A 2GDJA 2AEFA 2BZ1A 2ZP1A 4KNWA 4M22A 3D8NA 2E9SA 2VLIA 3BM5A 5TISU 1Z75A 2AOXA 1SA0A 2GPJA 4OJMX 2CCJA 4L7VA 4LXQA 3T5BA 3VHXA 1QV6A 1Y5IA 1VMAA 2ASJA 3L18A 5K8TA 2GJ9A 3OCCA 5AKKA 3A4TA 1SB8A 1OXUA 1AQNA 1BJTA 2A9QA 3QFSA 3VO1A 2FZWA 3E3MA 2AT1A 1IM4A 2JGRA 4R3NA 3UMJA 3V2IA 3IDQA 3JY6A 3KZMA 3ONFA 3I6IA 5BQ5A 2VF4X 3II6X 1M0WA 4YRZA 3OZVA 4JC5A 4MW9A 3AIMA 3K0CC 3O8QB 2P6MA 2JG3A 1CNEA 4AN4A 2FGJA 4PO8A 3RUDA 4BDTA 1H4TA 2XNDA 5I7SA 4CMCA 5ELLA 2J32A 1F14A 1ULZA 1X7ZA 2D4HA 4YRQA 1SKUA 5KVCA 3OHBA 1SCQA 3T5HA 1TVMA 4UPEA 3PUWA 3RBVA 5JFOA 4GPD1 4EYEA 1FO4A 1XT6A 5E7QA 3BD8A 3SM3A 4MUYA 1POWA 4HZUB 4V1CI 2AXTU 3OJSA 5FBWB 2X9NA 2BFBB 2IL1A 2W9CB 1RBZA 1V8FA 3FYUB 4LY0A 4W6ZA 2AFHE 1X0VA 2WV7A 4DQ0A 1ZOIA 3K96A 2PMEA 3VXKA 3FI0A 2WDZA 3GWGA 2I91A 2ISOA 3O94A 4IAOA 3H9UA 4L6AA 4IEEA 5KREA 3FY4A 1KZ7B 5EL0A 1FLVA 4G0UA 5TR9A 3D64A 5ALJA 2J09A 1ECCA 2CD7A 1PL7A 1DARA 2NACA 3H6GA 3RJTA 3S3TA 4A0RA 2Y93A 4MUKA 1MPTA 4KXWA 2KSOA 1ZM9A 4OJNA 4XWOA 1YF3A 1ND5A 1B15A 1Y8CA 4BX9A 4M7WA 4FX5A 4TS1A 2ZI5A 4BNUA 2C2MA 2JCBA 5ALHA 1R5OA 4Z9AA 1F12A 1EWRA 2UUPA 2NU8A 3V4RA 5ULLA 2DEUA 3AB7A 4M1TA 4F5DA 5JAUA 1WDWB 1LH0A 3BIOA 3DOCA 1CUKA 3I2YX 5DHFA 3DUFA 2C2EA 4PSCA 5JV5A 5P21A 1K9SA 2I99A 2CLSA 1OFUX 2NYUA 2BY4A 2WSMA 5CXUA 3JVEA 1E2MA 2XUHA 3QQ5A 4DIBA 5SZIA 4CLDA 3TSWA 3OZAA 2P2CA 3UWPA 1EFVA 3FDSA 1HJPA 1F2VA 2JEYA 1AXEA 4ECZA 2HLPA 5FOTA 4B4UA 2HJVA 3ILSA 3TSYA 5DGAA 4IDFA 2G0NA 2OHGA 3PSPA 1Z4JA 1W35A 2FH5B 1WXGA 2B20A 2CNOA 1IZYA 2YIDA 4TT3D 1LSJA 2QN6A 2FWNA 3H11B 1AMUA 4YXJA 4WK6A 1SPBS 3OUZA 1A9ZA 2QV0A 3F6YA 5HMLA 1ETHA 4PL2A 1XAJA 2WYWA 4XRGA 1XVIA 4Q12A 2Z2ZA 1JA9A 1H2WA 1LC0A 4ER5A 3RYHB 3R75A 4BL5A 1GR0A 2F9FA 5FI1B 2O2ZA 1UM9A 2XRYA 4P0TA 3D2AA 1Z6XA 2FMXA 3LUGA 2BCEA 2KICA 4L2IA 4JI0B 1KZGB 5DQHA 3FOWA 3JAKB 1SFRA 4FZVA 4HDRB 3MWEA 4WV3A 5DU2A 2P90A 5FUQA 4GKJB 1DFIA 1JIUA 5AI5A 3G6XA 1UJ6A 3KJEA 3IKVA 5DWQA 1NN3A 1G21B 2V7VA 4TVSA 4UHKA 2HV8A 1N0UA 1JHUA 4US0R 4KPFC 5JRJA 2WTFA 4DJFC 2B7LA 1F5NA 1PLJA 1PR4A 3D3EA 4DCPA 4F38A 2KVCA 1G6KA 5E8RA 4CM4A 3AUOA 4Y2RA 1AK9A 3COJA 3HKCA 1WABA 1PNRA 4IIDA 1JR3E 3GRVA 4ISCA 1P4JA 2IYEA 2P68A 1C3EA 1U31A 4NBUA 1DBIA 1C3LA 1U02A 1MT0A 5KOYA 1AKRA 1SVKA 2OBMA 2ZRPA 2HHWA 1D0IA 4J1TA 4JAVC 3AONB 2GEDA 3CISA 5CVJA 5LQKA 4HLCA 3VOBA 1PUXA 1DAOA 3OPXA 3JX9A 2WJWA 5A4JA 2I65A 2YICA 3C21A 4W7IA 2G76A 2Z08A 3JQGB 1FSPA 1AS0A 3Q2IA 4OFXA 5NULA 3SEAA 3LOPA 3NR2A 3FMFA 1TJ3A 3F6EX 1R8JA 1E1RD 4WCDA 5GTDA 2IW3A 5DGBA 1E4VA 2FVXA 3C7CB 2RGCA 3TW6A 5DOVA 4JITA 3FHJA 3SY8A 2XB9A 3WGTA 4CTNA 3WQBA 2UDPA 3GNQA 5F2OA 1YZTA 4CGYA 3PLNA 3IUEA 2FG6C 3BL5A 1KEPA 4JQOA 2WTBA 4PZYA 1IIPA 3IEKA 4Q4HB 4GQBA 3HYTA 8MHTA 1Z0JA 3BTVA 3CU5A 1Q1QA 2NU7B 1E6WA 5E2AA 4W82A 3T0IA 2Y1LA 2EFGA 1BXZA 3GAZA 4JK1A 5AP9A 3WMWA 1FMFA 4F7WA 5BRJA 3IVGA 4XQGA 1PWHA 3P1JA 2EFCB 1FDWA 4M49A 4F84A 3OZFA 4OKNA 3WK6A 3KKOA 4LWPA 4NENA 1E2FA 2Q3DA 3BAZA 4QGHA 5AM1A 3GT3A 5C8YF 2Y1GA 3GUZA 1YJ8A 4PM4A 5IP5A 2Q27A 1WBDA 4AIRA 5KCZA 3ENKA 1PVDA 5ARBA 2Y99A 2CXSA 3B8HA 4F3RA 1BXKA 1FFXB 2RHHA 3HGTA 4IXTA 1G9SA 4WRRA 1UPUA 3UK1A 5LB4A 3MGIA 2DQYA 1OREA 2R6AA 4P31A 1J8FA 1OPRA 3EIUA 4XWGA 2VANA 3P5BA 2VH2A 3QUQA 2Q9CA 4IM7A 4X8MA 5FUVA 2VSOA 4G26A 3ZIAD 1IHPA 1YD7A 1AKUA 4FFBA 3K2EA 2GVDC 3RC3A 4WBNB 4BVKA 4RIFA 1LRLA 1N77A 3K8ZA 3EVCA 3JQ7A 4EBFA 4MMXB 3KT3A 4MVCA 3TTXA 4O5EA 3WO1A 4YMGA 4K05A 3MS2A 3TE6A 4EY8A 3PC4A 4HMPA 3RIGA 1JFFB 3IAUA 3CRQA 3VPBA 4FFOA 1AHHA 2HHXA 2QRNA 3BRWD 3NI2A 4TSKA 4BVFA 4DWJA 1EU1A 1Q0SA 3DV0A 5A3JA 2IUFA 1ODJA 3B9RA 4MUXA 1ZQGA 5IDWA 4QPPA 2KIWA 1KDHA 1H94A 2C9YA 1KHTA 3AESB 1VB5A 3CRW1 1MC8A 3FMOB 1FSGA 4JEMA 3VZDA 3NGXA 4B3CA 4Z3OA 2B35A 3TTVA 3UJNA 7ICLA 1IYZA 5A5VA 1UXKA 2IYSA 3TSCA 1OKKA 2WPNA 2YV5A 3RBAA 1JBKA 1A8QA 4MO2A 1HKHA 3K1TA 5EZQA 5BRNA 3O9MA 4PPXA 1V9PA 2IITA 2B2NA 4QATA 3R7FA 3WHKA 4B8WA 1G2QA 1MQSA 4OQNA 5KNDH 1I0IA 3CEHA 5JYEA 1RYSA 1IHUA 3T9AA 2VP6A 1HETA 5AVZA 3NOOA 1ZXLA 3X1JA 3TSAA 1GGJA 3NTVA 2PUDA 1B2LA 5HBGA 1NNI1 3AM9A 2Q3CA 1BEEA 2B8JA 1DNPA 4WD3A 5KHOC 4E88A 4F46A 5JRZA 3BK7A 4LV6A 4M1ZA 1TEHA 4DV5B 1CEYA 1J20A 1BNOA 1DXSA 3ISJA 3Q1LA 1DG3A 1DUVG 2C7VA 3CX7A 2IBKA 4GBJA 2VHCA 4K6HA 4P6VF 1I5EA 5EIHA 4AAYA 4QGSA 5EJ8A 2MINA 4WCFC 3F3SA 3OE4A 4QWWA 1K06A 4LJ5A 3OG9A 4OG2A 5FWYB 5AVXA 5IYZA 4DB2A 4R1OA 1U5CA 4C8NA 4X91A 2NRWA 3TIXB 1HLFA 3U3ZA 2BBWA 3NVYA 1MT3A 1Q0TA 3A7EA 1H1LB 1B1AA 4Y6RA 4DXAA 1R4NB 1IY0A 1LDMA 4ETWA 4CKCB 2WIJA 5EJAA 4RUKA 1NN5A 2CXUA 2P4EA 1K4KA 4IQ4A 3OQMA 4IHQA 3CZRA 4K9KA 3LCUA 2ZVQX 4UCXA 2BI4A 1U98A 1UAGA 1LBSA 1L5GB 3H2IA 3RRMA 2Y0BA 3T7SA 2C7RA 3Q98A 4JX8A 2D2VA 2JANA 5B3KA 1P1KA 2DE0X 3LQ1A 5HNKA 4XJXA 3GJ3A 4QBIA 2CT8A 3H8WA 3SAGA 1O5OA 3EMKA 4P3XA 1LVGA 3I32A 5AW9A 3O90A 1R0YA 4F5QA 1XVVA 2Z8XA 2C4NA 3GT4A 3LX5A 2L0XA 2GYWA 4BP1A 2G36A 4LHVA 2QARA 2BFEA 3D4OA 3A26A 2XWQA 2XUKA 4G85A 4WZBB 5K1ZA 2QGZA 4Y7CA 5T5QA 1BVSA 2BHNA 4I4TA 4MVJP 3EXEA 3RM3A 1N75A 2DX7A 4OHYA 4BMDA 1IOWA 1D9XA 2IEBA 2NZUG 3GGPA 5F7XA 4GC5A 2QUHA 1T91A 1RZRA 3GJXC 3E9ZA 3MHTA 2FW8A 2PL3A 5KJ6A 1E7SA 2HHLA 4WQMA 4KQCA 4I8DA 5F12A 3EIXA 2KEYA 2QSZA 4N9QA 1U63A 5K2OA 4DR6B 3G3EA 2VF5X 2J4FA 3SS7X 4MS1B 1JF8A 4X20B 1OHHD 4HH0A 4B3RB 5F9NA 1C9EA 3PXCX 3VSBA 4OOEA 2Z8YM 1OLSB 1G21A 2EBWA 1GZ3A 2EL7A 3I0NA 4HNAB 1PQ4A 1EFRD 2VWQA 2QJWA 3PHJA 1DV2A 4HO1X 4CG2A 1RYEA 1M54A 2FZCA 1J9ZA 4S1WA 3G68A 4J2HA 1YIOA 3IMCA 4LJKA 2KNJA 1QS0B 4L27A 5I9TA 4ENRA 2IKSA 4HSEA 4X00A 1YKGA 4BO4A 4QNMA 1KKUA 2OYRA 3LECA 4EHBA 1E2IA 4NK4A 4PTYA 4LXYA 1U9ZA 3TARA 4KLDA 3N7UA 3EEYA 3UJ3X 4WASA 2ZM6B 3HADA 5F2KA 1PVQA 2VIIA 3QU7A 1VPTA 1GPKA 2GGSA 4FTWA 3TBHA 1NVFA 3ORRA 3VFDA 2ACVA 3NHPA 4IDEA 5COQA 2FWIA 2B1RA 3LE8A 5J2TB 3EWAA 4RQMA 1ZICA 3Q87B 1N1DA 3GFOA 1X42A 4D44A 3ICPA 1CHDA 4M0LA 8OHMA 1BTOA 5IJWA 2F6RA 1LDNA 4UUAA 1JHDA 2YWRA 3E5NA 2V7EA 5TE9A 3F5AA 3IELA 4PQYA 3DLHA 5LQRA 1MORA 2VA9A 2CNWD 2WABA 4ZXFA 2NUTA 1YFLA 3VJMA 1ZVVA 3BHMA 1MNAA 1RYHA 2IE0A 2VXYA 2CD9A 3LYHA 4KSBA 2GK3A 5GJCA 5IBPA 4OO1J 4F12A 5BSKA 4HQ6A 1GAJA 3WIBA 3P71T 4E5VA 4O2AA 4ZANA 3NTXA 3FTFA 3LC2O 3WB2A 5T4HA 2JARA 3L6OO 1E2PA 4IRDA 1RAAA 3TAPA 2M6RA 1JSRA 2X58A 4CTMA 3F4KA 5CA1A 3BL8A 4RDCA 4RY9A 1GYPA 2ICAA 4L5YA 2H06A 4U6QA 3AEZA 1K66A 4I36A 5B2ZA 5I7AA 5HQ3A 3OAAD 3EC1A 3FF4A 3ER9A 4RMIA 5CIWA 3F9RA 1TMOA 3PFKA 1P33A 3FVTA 1I30A 3PRHA 1C1XB 4NR0A 4PGHA 3UV3A 4FILA 3KKAC 3KKQA 2JAXA 2QQEA 3AERB 3AGQA 1JJFA 2HHHB 4QTTB 2FMIA 2PZLA 5CIYA 4MDFA 3FZGA 3E53A 4H3SA 4L8FA 1U28A 3FCYA 5AHKA 2C5GA 1WUIS 2YWJA 2JASA 5H70A 3BX1A 3RVOA 2BPCA 5ALWA 2WT4A 1ZSNA 2FU5C 1NWCA 3RRJA 2B6HA 1YZNA 1PGQA 2HBRA 4MRAA 5F9HA 1KFTA 1RM4A 1XN1A 2WU3A 1JSCA 1ORHA 1PK8A 5DGIA 2QXYA 1U2QA 2WVAA 2D1SA 2X2OA 1R6AA 1TFUA 1KYYA 2NV0A 3DTNA 1N1MA 5MFZA 1U3FA 1PJSA 2HCRA 4DCOA 4QZIA 1UKAA 4MSUA 3HLYA 3GGGA 4UB2A 4C6HA 3QLUA 2DY1A 1ZIOA 4X1YA 4ACAA 3F2BA 3IQFA 3U44A 1FJHA 1ZD1A 3TI9A 1G59A 4US9A 1NK0A 5ALIA 1L5HB 2I55A 2DPLA 1BRTA 2OZPA 3BMNA 4ZU3A 2F3TA 4P2HA 2CF6A 2HQSA 2Q1XA 4DEVA 1YQUA 4J9KA 3KLBA 4M55A 3HGQA 5KZMB 2D3TA 4O5KA 2FFAA 4RSMA 1DTWA 3T52A 4L8YA 4L57A 4XDGA 2C29D 1AD2A 3L9WA 2O2EA 5LZ7A 2R8OA 1J39A 3VVCA 3WRYC 5A5GA 5BV1A 3BXZA 5LQMA 3NVVA 1GCGA 1U0OC 4GOJA 7ICEA 1JPVA 1GY8A 3PR3A 1WPGA 2QUZA 3GLKA 2G77B 1A95A 5HFJA 1DJPA 3U17A 3CVJA 1ECPA 3LYLA 1NMYA 2BM0A 5DNAA 3W34A 1R64A 4C1BA 1PCXA 5IKOA 1TM1E 3EA0A 1IE3A 3KOUA 1FB5A 1HOXA 1XZIA 2PEZA 2X1VA 4ZYVA 3DR5A 2XMPA 4OF4A 1AXRA 2NUAA 3CF6R 2AQ4A 3KUCA 4MV3A 3SF0A 8ICRA 1PUZA 2K2WA 2WWXA 1ZOSA 1SIBE 4Q19A 4RNMA 4J91A 4K8RB 4UTXA 5TY0A 3TQRA 4EVSA 3IT0A 4IOKA 3N28A 4XCVA 4W1PA 2PYDA 2BDPA 1NDQA 2PZJA 3PFGA 3PNOA 4URUR 2BIFA 1A50B 3H18A 1FDSA 1HZZA 2PS3A 2VN8A 1H3NA 3KS9A 3TLMA 2VG8A 3TX2A 1FU7A 1HDZA 1W73A 4BWJA 1ECGA 1WBJB 1T9AA 2HGZA 5ENDA 3RVDA 5A1JA 5CHGA 1M9NA 5IHPA 1GFIA 3P9CA 4JL6A 1U49A 5ADWA 3BORA 5JSUA 1OASA 3LBNA 3VZRA 1W88B 2HZBA 1F17A 1UDXA 1O87A 4HQKA 4TLMB 4M0KA 3NAGA 5JNSA 2X77A 3PGMA 1I3OA 2OV6A 1VZ2A 3G5LA 3EG9B 4KUHA 2XCLA 3PR1A 3URMA 5L6MB 1E79D 1U7PA 2YVKA 4AB1A 5FOUA 5CEEA 1O0BA 3WRVA 2HHSA 4U1RA 1GZ7A 2WOJA 5BSUA 3QK7A 3OQBA 1XLTC 2PPVA 5K03A 1DC3A 2J4DA 1XZMA 3KEFA 5KFQA 3O82A 3QKUA 3RE1A 4MWGA 1LPOA 3L7YA 1HH4A 1U7TA 4IMPA 2QMOA 4O2AF 1T29A 4PS0A 2RBGA 5K0LA 5HOQA 3ZU6A 1O54A 3PIDA 4NHEA 2LKYA 3ICVA 3H99A 3JPYA 4CIXA 4DFDA 1EG7A 3E0QA 3OZTA 4RA6B 3UQ0A 3PX4A 1IJFA 4G97A 2BAGA 1TM4E 1N5KA 4WNAA 1WG8A 1ZCBA 2WMYA 3FUVA 3OEYA 2R11A 4I2EA 1ZIYA 2QX6A 2GVZC 1QR6A 4F5PA 1JSZA 4N5NA 1GG9A 3RSOA 3WQSB 1DWQA 4JOCA 1ZK1A 5FQNA 2TMGA 2CBXA 3RUEA 3UGTA 2Y1JA 2IYRA 5HVNA 4G0WA 2XA9A 5IXSA 4AY6A 1P4SA 1W48A 1ZMTA 2B4KA 3HB4X 3KJNA 1TYZA 2EV9A 3ZD8A 1X3LA 5FR2A 4BTEA 5D46A 5CB8A 5IS2A 2ZUTA 3MRXA 5JZ9A 3BS7A 1SUAA 4H18A 3ZIDA 2XRFA 3B70A 3I6QA 5JD4A 1XCPA 1WPXA 2EX4A 2R85A 3CCBA 3CS3A 1U1EA 1Y3DE 1P2TA 2Z2IA 2VF8A 3DLCA 3BQNB 3WGYA 3ZV7A 4FO6A 2NYVA 7ICNA 1A7AA 2FP3A 4IX1A 4RD3A 4W5HA 2WFLA 1Q11A 1JU3A 4KRGA 4OHRA 1ZQOA 5J0RA 1XO0A 3HRDD 3K1AA 1ADGA 3HI4A 3HWWA 3WGHA 3UBTA 2XNDD 4ARAA 3HM9A 1Z3CA 3S2GA 1KORA 1SG6A 4MVJH 2Z3WA 2A78A 4OJ5A 1V25A 2C5HA 3GJ7A 5FOVA 5CEJA 1JFFA 3LSYA 4BB6A 3LK9A 1HZZC 1L4HA 3ED1A 2JHDA 2LD4A 9LDBA 3AYXB 1U94A 2QAIA 4UAUA 2IYFA 4X93A 2XY6A 4YP1A 4W1QA 3T5KA 4DT1A 4ZH4A 1N2HA 4DQUA 3OZWA 3D0QA 4QW8A 2GWSA 1C0KA 1MIOB 1A1VA 1MGOA 1WKBA 4ECSA 2ES4A 2ZULA 3NYRA 2C5EA 3G8BA 1QBKC 4PGMA 4E2YA 4HUTA 3PFFA 5JD6A 3OQOA 3CIOA 1ZJ5A 4J7CA 2EDAA 1E5LA 1GUYA 2TYSB 3NWOA 4KQMA 1PT5A 4YPOA 1OXTA 3UTCA 2QI9C 4Q6WA 3KOZA 1ONNA 3V80A 1PNOA 3K8QA 4GLBA 1NNLA 4GOKA 3DL7A 2C78A 1T4CA 3P9YA 4G25A 2I7CA 5JMWA 2NPOA 5C31A 2FSIA 3EFOB 5CLQA 3K1JA 4P08A 1A0OA 5EESA 1HR0B 1Y8QA 2CFSA 2XJ4A 4IJVA 4BVJA 2PY6A 4LJ7A 4C7OB 2YFHA 4M9LA 1I10A 4NZZA 4KN6A 3CWCA 4PYMA 2IH5A 3T79A 1FDOA 2NSHA 2ZIWA 4CKWB 4EPYA 3A2KA 3EWSA 5SICE 1PQYA 3PRYA 1ZI6A 4OIMA 2M32A 2QJTA 4DSOA 1JR6A 3QW2A 2DCMA 2ONZA 4OSOA 1DV1A 4UHJA 2XITA 3SNKA 4JYZA 3O1IC 1PR1A 1DCMA 5J8YC 2K8CB 4DSAA 3DV9A 1IUPA 4QXPA 3ZDDA 1NBEA 1S9HA 2GCPA 2Q28A 3TNJA 2NWQA 4FFNA 3DUWA 4RYDA 4Q05A 1VBFA 3SE0A 5HIKA 2ZCJA 2MR5A 1FYWA 3VKUA 3T54A 3ZWPA 3KPVA 2GFIA 4K88A 3B5JA 1XS9D 2CBGA 1CP3A 1OX4B 4LTDA 3UBMA 3P32A 5A0LA 4OXQA 3U7IA 4P7KA 4YJKA 1PQWA 1XXLA 1N5OX 1ZUIA 2EQAA 4RIEA 1NU6A 5JANA 5I4IA 1QK4A 4E7OA 4LF9B 4MHOA 2KSOB 2HMYB 3A3OA 4GYYA 1TKDA 3W3AA 2AC7A 3TKAA 2F8KA 1A27A 4Y8VA 5B1DA 3QQPA 1XWFA 3X1KA 4IC9A 1PJLA 4JT2A 4MVJI 3ZX4A 5C5CA 4X1IA 3L8YA 4GC6A 1DQZA 2IHBA 3PKZA 3SSAA 4TTVA 3JPOA 1GSOA 1M2OA 4L9WA 1QCYA 2P2ZA 3H5LA 4MUNA 4N5IX 4ZYLA 2UYCA 4R5HA 5EJ4A 4JIMA 1WSAA 1TZCA 4LVCA 3LWMA 2VT2A 3EC7A 2ZSFA 1C81A 3PFNA 2W2KA 3O8LA 1N2CA 4AJEA 3ZWWA 1A9OA 4PZOA 4Z3KA 4EHKA 1UT6A 2VYFA 4LV5B 4YUWA 1ENPA 9ICQA 2W6IA 4RD1A 3TD6A 3I28A 5AW3A 1OFGA 4INOA 4L5CA 4DYHA 2YW9A 3LHIA 3MINA 4LBZA 4GG1A 3C7DB 3SV4A 4ELUA 3BDAA 1PYDA 2XGGA 1OLSA 3E61A 5IJXA 3CVUA 4Q00A 4WUVA 1SUIA 5DWVA 1WXXA 5A7HA 4DEYA 5DNEA 1U3GA 3AV0B 2X19A 2P9YA 5HHIA 1CUFA 1RYZA 1NUUA 2AZTA 3QPVA 3RTVA 2BE9A 3VPHA 4JQZA 5TPWB 3UPTA 4LJYA 5EAIA 4NBSA 1VYUA 3NGMA 1U7ZA 2ZRQA 4YDRA 3F5FA 1M1UA 4MV6A 2JCYA 3DZBA 5CX4A 4ZYWA 4J0QA 1KFDA 5DKWA 3ORYA 3L77A 1T13A 3FX2A 3GFRA 2YXLA 3FFXA 4RAOA 3QEBZ 2P9FA 2ZYTX 1P1RA 3I09A 2ZE6A 3MCAA 3DMNA 4KODA 1AQIA 1D1PA 2R7AA 2DFTA 2RI6A 2DG2A 3M1IA 3W5VA 4DTCA 1WZ2A 4GKKB 2ANCA 2Q21A 4M36A 4OX9Y 4L0MA 1EVJA 3C1AA 4KW7A 1SL0A 1PK9A 1DELA 2M98A 1KSFX 4QZEA 1G16A 1X6IA 2EFHB 3CIFA 3FF1A 3P9ZA 3V00A 2P6UA 1GN8A 1L7QA 4J1SA 3FAZA 4QPNA 5L9XA 2OLKA 1FNNA 1FUEA 1QWSA 2ODPA 3O4VA 2IDMA 3TLYA 4UBIA 4H7DA 2XMGA 1C14A 2PVPA 4H1UA 1Z0DA 2F9MA 1K0UA 2CYBA 1ZBDA 2D0PB 5TXGA 3JCZA 2JGKA 1SXJB 2QZSA 5AJXA 1Z4NA 1T1EA 1T25A 3FB4A 5EVCA 5KINB 1EX7A 4P7JA 3B1JA 3BD6A 4J4TA 2EEZA 4NL4H 3G9TA 4FMCB 5CYPA 1X1CA 3IJRA 3JXEA 4N40A 3ECAA 2VSXA 2KKPA 3NDJA 4ZI7A 4YFKA 3T7TA 1QPGA 1L5NA 3THYB 4ND3A 1K5HA 1JXOA 1E6LA 1R8XA 2ZRBA 3AWIA 3M8KA 2IS1A 2HM7A 4W5JA 4A6DA 1OGIA 4TUQA 5DBGA 5ARCA 1IAVA 3NWPA 1KMHA 3I62A 4FR0A 4MNTA 4TKVA 6REQA 1JJAA 1Z6PA 1UOEA 2ACWA 3RFAA 1SG0A 2BR3A 3C48A 3Q7RA 4PX9A 2PUEA 1UEXC 4LC9A 5JXWA 2EKDA 2CZGA 2ASEA 2O2YA 2BFFB 2Q5QA 4AZSA 4DMUB 2BFBA 4E31A 4YK7A 3CN9A 4ZA2A 2K6GA 3GVIA 2GEFA 3B3QA 4Y0VA 2GB4A 1C3VA 1ZWLA 4MUEA 2PMDA 3W1EA 4BIMA 1OI3A 2XYPA 1Y5LA 4XYEA 5FO0A 3VGPA 4RETA 2QW1A 5GTHU 3NEAA 4MDYA 3ZN2A 1DCKA 4HF7A 3SX4A 4I29A 4B2YA 2ESRA 3Q0TA 5TSDA 1DFGA 1GN9A 4WNCA 4ZYZA 1A5SB 3KTQA 3DZHA 3SKVA 1AMNA 3QUBA 4G5RA 2NRZA 3KHRA 2IZ6A 3DQQA 3G6WA 4XTRA 1HYQA 5TQVA 9ICHA 5AUNB 2BGGA 4U39A 5JTUA 2BZSA 1L6NA 2IOYA 1M1YB 2K5UA 2WTMA 5IUJC 1J33A 2FWJA 3TLGB 1FRFS 4ZOEA 4INZA 4O1IA 1P74A 2FZEA 3OIWA 3QKRA 2ZJAA 4MVJG 2ZSEA 4YC7A 3VR3A 4B6QA 1XROA 5B6PA 1LTKA 4CIYA 1PVPA 1VTKA 1XSEA 5B55A 1JI3A 3C2KA 5KFWA 4C03A 1HBJA 2H57A 5AJUA 3E15A 3DMPA 4OPMA 3CR7A 3LTEA 1MTZA 4CM3A 3X43A 4BP3A 1XAIA 5HF6A 3M9OB 2M6LA 2XODA 4DLBA 3L06A 1HSOA 5I45A 4B2PA 2PZGA 4I1OA 3IJ5A 3PI7A 1KBZA 3UFXB 2M9NA 4Q3BA 4NMXB 3L6EA 3TTTA 4E5YA 4DF3A 1NX6A 3AUJB 2ISCA 4YMMA 2XT9A 3ZKAA 5GPBA 3UUEA 3CM0A 2VQ6A 2PX4A 1ZQXA 5TJHA 2PGLA 4CLXA 1BKDR 1PHPA 3RYFB 1QRAA 4DM3A 3WDMA 3ZI0A 3VHRA 2A33A 4X41A 2RIPA 1NLMA 1W44A 2F3QA 2YXEA 4EB3A 5HX7A 4Q5IA 1Z4OA 1G98A 1OI7A 1WAMA 5E6UA 3E9MA 3IBGA 4XVUA 4BBAA 3OZUA 2TRSB 1UPAA 2R00C 3E18A 4MPRA 2ZYGA 4NVRA 2C5AA 1RWVA 2GUWA 3DEYX 3IOEA 4M83A 4U63A 1LK5A 4GL2A 4ARBA 3NCTA 3AVVA 3OUTA 2VJKA 1JHQA 2XD4A 3A70A 4Y2TA 4O4IF 4I2BA 3MOIA 1K7FB 1KK0A 3VKWA 3ZY2A 2OENG 3QJYA 1V4NA 1YZFA 1S0VA 2B0CA 2WF9A 3HKZF 1YQ9A 3W5SA 4ZICA 2QP3A 1BMQA 2JRLA 3PXXA 4QASA 1KDOA 1JEQB 1VGRA 1IK4A 2VEDA 1FPQA 3I0MA 1LV7A 3KALA 5DLYA 3DAPA 3SN6A 2O3TA 5KBYA 4Y2YA 1T94A 2G63A 1P4AA 2PDAA 2FA9A 5ITZA 3JW8A 5CT6A 4YRGA 2YZ7A 3PUJA 3HJCA 4MIEA 4XIFA 1KYXA 2FLKA 1N63A 3PSIA 5B64A 4NEHB 2G83A 2NZ8A 4TTJA 2FP4A 3EPRA 4CCYB 2IOFA 4J76A 2AU0A 1SG9A 1KO4A 1UKBA 1Q8KA 1II8B 2IF0A 2AI3A 4TVBA 1T2FA 1VIVA 2ONCA 3AJAA 1YO6A 4REQA 5JCXA 5CA0B 1LXCA 1UXGA 3JQAA 2ECKA 2BGLA 2GD0A 5EEHA 1EUZA 1E3JA 1E2UA 2IF2A 2PRZA 2Q1UA 3AU8A 4LHEA 4OQEA 5HQJA 1CZRA 5JJLA 3RS3A 1SCBA 2CEAA 4CEIA 1E2LA 1J5EB 2H92A 4DJ5X 1YS6A 4CI0B 2RDJA 3B9BA 1PTKA 1QOPB 3VBCA 4ESHA 4CEIB 2R9VA 2CLIB 2JGDB 1AXGA 2OOKA 1OYOA 2VHYA 3CMMA 5BOSB 1FE8A 2NLOA 3IP6A 4EZIA 1EBBA 4FHFA 3L7LA 2G1UA 3QUTA 4Y6PA 2ID4A 1O94D 3UCFA 4DLKA 2QIPA 2CV1A 3MUNA 2PUGA 2YVAA 3WLNA 2VYQA 1Z25A 2GDZA 4P84A 3SBEA 4KR3A 2XIJA 3IP8A 3F7MA 1WDKA 4E3WA 3WK5A 1KQFA 2L42A 2IZ0A 4CJXA 3L6UA 1TK9A 1RRVA 3IQWA 1JZQA 2XGPA 1R9GA 1H5QA 1QTNA 5E9JA 3MJHA 4CHTA 2BHSA 1K8YB 2YV1A 2VWPA 1VJ1A 2I4LA 3L0DA 4J9UE 4HGZA 4XX0B 4BO5A 5JD5A 4Y1RA 4PZAA 4UHCA 3S40A 3VPGA 5ALFA 1V4VA 2WVHA 2NSJA 4IXNA 2XECA 1VCOA 3BXFA 4MR7B 1TK3A 1OYYA 4JLBA 1KQGA 2F90A 2I6GA 1QVWA 1DRJA 4F97A 5B4UA 4OGGA 1U7DA 1Y98A 2JGJA 3L7IA 2WTXA 3C8ZA 4AK9A 1OB5A 2VQ3A 3HH8A 3C5EA 4E03A 1ETUA 4GX1A 2PL5A 4UHDA 3C29A 5DEOA 3ZKWB 4AN1A 5JQGF 4X6XA 5KQPA 1NJFA 3QVTA 2BD0A 3CSSA 3MJDA 4WDRA 2VHVA 4NPHA 5T64A 5JPCA 1N8TA 4HLDA 3H4DA 4YCJA 4RTKA 2NP6A 13PKA 1SK8A 4MDHA 1TC2A 2ZKIA 2B1QA 3LQQA 2Q9UA 1LQ2A 4NOMA 2O52A 2WY2D 1XPOA 3Q7IA 4IWYA 3VYSB 4F6CA 3X1MA 2CNKA 2I34A 2XRZA 1FXUA 4DNXA 2Z56A 3HYCA 4LYDA 3KZXA 3FJOA 1NBME 2O20A 1ZSVA 2C5BA 4FSHA 3WKEA 2JGFA 1H6CA 4I2NA 1FXSA 1T0JB 4O02B 1CUCA 1OFUA 2XKAA 1NRJB 1JVNA 2LI6A 4KV7A 2MSNA 3NWJA 3OE1A 1XTKA 1Y5NA 5E0OA 1YL7A 3T5GA 1GGNA 3T5CA 4Q1DA 4C0SA 4C7YA 3S5UA 4CKWA 1NVGA 2GI4A 1GUFA 1ZK4A 2QVYX 2ZW9A 3FPJA 3RU7A 4B45A 4BKRA 2ZAMA 3TR0A 1ZQEA 4TL6A 2RHJA 4D2IA 4DWOA 1QIJA 1SUDA 2VLBA 2VUIB 1YOVB 1OXVA 2WSIA 2XOKD 4YN3A 4ZV9A 4KXNA 2QOEA 3LQFA 4TROA 1D4FA 4HDNB 1FRZA 1Z0ZA 1TYBE 1SXQA 3VNUA 1NVMB 2WG2A 3H2KA 3LX4A 2V7QA 1VSTA 4EW1A 2BSXA 2GTHA 2DKZA 3L3FX 1LNSA 1YAHA 3HA3A 4WY2A 4X54A 3QM1A 1N57A 4RU9A 2QD4A 4RH0A 4KTQA 5HPYB 4XRRA 3KFLA 1M2FA 4KB5A 5IF3A 1HEYA 1XB2A 2XMQA 2R66A 1JA1A 2JLAA 1NRIA 2G25A 3IR7A 4ATNA 4UTNA 3ZGYA 1CNMA 4YJHB 1TUEA 1DX4A 2C96A 3P0IA 1TTQB 2SCUB 4HWGA 5A3RA 1ZS9A 4EELA 2WIFA 1K8XB 3U4IA 2WT8A 3L40A 4HLUA 5E4YA 1T15A 3AM3A 3ZS9A 1N6KA 3RSZA 4F91B 1XXHB 3WDKA 3DBRB 4BVHA 5DBHX 3U7RA 4MRMB 1L4BA 5KS2A 4RPYA 1PYGA 2VT3A 4ZU6X 1R12A 4R7GA 1GRQA 3F7TA 3T9FA 4G37A 1D2MA 2D13A 2HV9A 5G1NA 4EBBA 2QGFA 4B31A 1Y1TA 4MS3B 3D2SA 2WWIA 3CVYA 5AICA 2RC6A 2H07A 5DE3A 4UD2A 5IVKA 1VI6A 3AEQA 5A3VA 1VQ1A 1XG5A 4ECRA 1E1CB 1VBKA 1L5FA 2GESA 3HKZC 2JIZA 3IVMA 4RWEA 5JISA 3HP4A 3HO1A 3C15C 2KBEA 3JPNA 3DR3A 2QW0X 4HN9A 3EXHC 1XCLA 5K0TA 1F06A 2QSJA 2FZLA 4PO3X 1WCV1 1K9VF 3GLTA 4RK7A 4IGEA 1EFVB 1SIWA 1ZK3A 2G71A 2HVIA 2G80A 2RH9B 2XYRA 1ZYUA 2YJ5A 3KXPA 3TW8B 3HFGA 3UFBA 1NKEA 4MUGA 4YONB 4K1XA 3T9EA 3HJFA 1UXJA 3OJUA 1KVQA 3LCMA 4QUAA 3WNQA 4URVR 3VAAA 1COOA 5H3CA 2GN2A 4PRKA 3UTDA 2I78A 4E2ZA 4C29A 5J58A 3FGNA 3EQZA 1UBHS 1KEEA 1WTAA 2WILA 1E9FA 1XZDA 1S0OA 2Y68A 2FEWB 2YWCA 5LMNB 4DMCA 4IQ8A 1N6LA 2EQBA 4JR1A 3ZE9A 3M82A 4OFWA 3MGHA 2GILA 1JJBA 3V1NA 1R4ZA 7ICGA 1SU6A 3L0CA 4JUAA 3QNMA 1QRDA 5B58C 4LWZA 3MCVA 4OA5A 3L5KA 2WF6A 1G3RA 5IMBA 3LHDA 2O8VA 3N74A 3G9ZA 3WAKA 3TFQA 3DOFA 2A4KA 2IP4A 4ZK6A 3FBWA 5IAGA 4P36A 4A2PA 1JEJA 1KA9H 3GLSA 3TJRA 1QB7A 2OO5A 2C84A 5AWFC 4CG3A 4E6PA 3W04A 3M6MD 1RVV1 4JELA 2Y4NA 3BZKA 3MT7A 5EYPB 3V97A 2HK9A 3QE9Y 2VSQA 3FHCB 1DQPA 3R6GA 4BB0A 3BWXA 5HILA 3U37A 2XB2A 1EX9A 4MUHA 1DQYA 4ODIA 4ZO6A 1OWMA 1V85A 2PCLA 2MSWA 4CL3A 3PY8A 3CGGA 1ZY2A 4P5EA 1RFGE 4V24A 3PA6A 1K97A 4ZYTA 5I9LA 1W9HA 1X1QA 1WUKS 4YS6A 3QXHA 1DKMA 4D0LB 4TX1A 1AV7A 3AIOA 4CLRB 2W22A 3IQHX 1Z2NX 1QHIA 4L08A 1MAAA 5B1SA 4ZIRA 4L2IB 5AUQA 1E2DA 2OBXA 3LYAA 1JROA 4U2DA 5D85A 1L7XA 4PCUA 4DDVA 2YQ5A 4NMHA 9ICTA 2H2IA 4UE2A 3HMQA 4XLTA 4RTRA 1RJDA 3EGXA 3N0WA 2D00A 3ET4A 4USAA 1BS1A 5AJZA 4BFWA 5IWCA 2X3UA 3BB4A 1P5FA 3JVIA 3KAPA 2P1RA 5U4XA 4BB9A 1IAQA 3D4NA 2QTHA 4RQUA 1MEEA 1HTTA 5CFNA 2VNJA 1RJWA 3Q5DA 2H5XA 2KTQA 4PHTA 2H85A 5JAPA 1GZSA 4OXNA 3UV6A 4YR3A 4XYMA 3C3KA 5AVSA 1J2UA 2QHXA 3GK3A 2X5NA 5KJCA 5AI6A 1V7ZA 3AB8A 1UANA 3ZJ5A 4CCSA 1MH1A 1N2JA 2R62A 3QZ7A 1UJNA 2O2HA 1RLOA 3BGWA 3PNQA 4JP5A 3STUA 2V6GA 4BKPA 1NUPA 3OA2A 1TGYA 5HQ3B 5I3CA 3WI7A 5DVZA 3PJRA 3FR8A 3MFHA 4MPTA 2BJVA 3A0UA 4LRQA 3LM8A 1VPWA 2V4RA 4HDOB 2JAWA 3WE7A 1NJYA 2MU2A 2PD4A 3B7PA 1DC7A 2PK3A 3FOCA 5K2MA 3DOHA 3EZLA 4JZKA 4P86A 5DF1A 4IGAA 4KQJA 3UMRA 1M1YA 2M6SA 1A76A 1D5CA 2WTAA 3GH1A 2BLNA 1KWKA 5B3LA 4O25A 2XZLA 3SDZA 4U9HS 1U5BB 1U9IA 1GQYA 3MG9A 2RIRA 1THZA 2G9VA 1S77D 3G5TA 2X0IA 2YC2C 1GKLA 4O1HA 3COYA 5THQA 3RW9A 2OXIA 2C98A 2HRCA 2V3VA 2DFPA 1U80A 2CHUA 3PP8A 3UT0A 3ZGOA 5HJEA 2BGJA 4JUFA 4JJZA 1FXWF 3ASZA 2Q3LA 3G17A 3LFHA 3MTDA 4LRTB 3VZSA 4LBWA 5DGXA 4DLSA 4JI2B 3NYQA 3LPAA 3FC4A 4Z1OA 2JCGA 1FNCA 3OT1A 1NIPA 3R0VA 3OEWA 4P4UA 4OL9A 2O2XA 1Q3VA 3R7WB 3GVCA 4YV0A 4DWWA 4MWOA 5KSYA 2AX3A 1H0KA 1WZUA 4DV0B 1DKQA 1DUSA 1NW7A 2RHTA 4L6CA 2JLZA 5FUWA 2D5CA 4J0IA 5KJEA 1W94A 4G41A 1BE8A 4PPFA 2CE2X 2Z8YA 1EUCA 3BB1A 4YR2A 1AROP 2R8IA 1NV9A 3QVUA 3KZKA 1SUWA 1QV9A 2ZWMA 5ALLA 2HF9A 1ODSA 2O8FA 2QUAA 2XCUA 1P4GA 4MEAA 4WCFB 5INTA 3I2KA 3SC2B 1MVOA 1XRSB 1XZHA 4PQGA 1B22A 5EQFA 5K8JB 2BP7A 2L19A 1XRQA 9GPBA 2RP5A 1K6JA 3JARB 1QGAA 4NQZA 5CDTA 2HLHA 1PU2A 1II9A 1H6BA 2ZBGA 2XZDA 5KNCH 1QQ5A 3S1LA 2YQEA 1IN6A 1BKYA 2OEHA 4U6NA 2HBKA 1NASA 2ECQA 1OROA 1VL6A 3EDMA 4K9OA 3JD4A 2VK8A 1QG6A 1TCVA 2EC5A 2H4WA 1YRHA 5C3UA 4I6EA 4C5CA 1I2BA 4G8BA 1NPTO 4U9UA 1FVFA 2QM3A 4BWFB 4TTSA 2KHVA 2H3HA 2ZBEA 1MZPA 1X2IA 1TAQA 4MUMA 1C5KA 1RU3A 2B94A 3CLRC 4N7BA 1FLDA 2IQIA 3EIWA 3KDAA 1WQ4A 4MKGA 4KIWA 4CMEA 2PSJA 4KQWA 5DHRA 4CLRA 4EB0A 2VTKA 3VNRA 1S2NA 1NW9B 4W7HA 3BCRA 1SQ0A 5FEMA 3DDOA 1LLQA 3TPCA 3W9BA 5J23A 1N0IA 4Z6EA 3PW7A 2F1KA 2PRJA 1G7TA 4Y2JA 4MIYA 4NY1A 3DXZA 1ZEMA 3JQEA 3QOFA 3X1YA 1W52X 1FX1A 2VRCA 3NFRA 5ES3A 2W6ID 4D9GA 4BGDA 1I3KA 5EG5A 2HSGA 1XEXA 4DCMA 5B36A 1CUEA 2R8EA 3R20A 3S1AA 1WBBA 1J8YF 3NTQA 4ILKA 4WAUA 1UMCB 4EPWA 3BDIA 2IELA 3QBDA 4CKCA 2BMWA 1DRUA 2JJYA 2UZ0A 3BOSA 2O1SA 1WMBA 4P7FA 4IQFA 4UOEA 1W19A 2GCEA 5IBCA 4A92A 1A2QA 2J5XA 2HI0A 2L2QA 3ABQB 3QFRA 2JHAA 3MR5A 3V1MA 5EPOA 1NFRA 2FSSA 2H2HA 3WNVA 5IULC 5E0KB 5LNK1 5KFZA 4B7CA 3QY9A 5PNTA 4FBUA 1SQ5A 1QYCA 2JDID 1G5HA 1RG6A 2JI6A 2KI5A 3F53A 3EGOA 3DDWA 1MA3A 3EW9A 3GMIA 1RZRD 3K0HA 4D57A 2LR0A 4LJXA 3O1HB 1E5VA 4RMHA 5IJ0B 1EXDA 2GS9A 3PHCA 3CTPA 4JT8A 1BA3A 1P18A 4J9MA 1GAEO 2BTQA 1F4PA 2A7XA 2QUKA 4MS4A 4QVKA 3EJWA 3FVRA 4LZLA 5B1IA 1EVKA 5IUKC 4ZCMA 2YB4A 3I01A 5DKFA 1Q7BA 1TVKA 2FKAA 8ICWA 1C3XA 2FN7A 1RZ3A 1DMRA 3LBHA 3TNLA 4AWAA 3NJ4A 1NJSA 3TAXA 2FZ4A 4FOPA 1NPYA 4U2KA 4PYRA 4YNBA 3F4BA 3JRNA 4UQGA 1MOQA 3KVYA 1Z2EA 1KWGA 4YI5A 2PUCA 3PE4A 3SHOA 4JJ8A 3EAFA 2LBOA 3TBKA 1M66A 3EA4A 3PKJA 3QPBA 4F9FA 5G0WA 4YPVA 2QRZA 3LK7A 3W9UA 1P1FA 3H5IA 2V6BA 5LNK6 1I4DD 4DQQA 2PR2A 2FF7A 3P9SA 3QHAA 4ZJYA 3HDVA 2FRVA 4UEOA 2BGMA 2RB4A 1FNBA 4PXYA 1OTHA 4GSKA 5I7WA 2ATIA 3SJBA 3ZPXA 3RS8A 3KQKA 4Z99A 3BS5B 5DBFA 5JJCA 4HUQA 1Z3EB 4MMYB 1QIGA 3FYHA 3KZIU 1FP7A 1YBAA 2JI7A 2ORIA 3E7XA 3GAAA 1Y9DA 1N3YA 4YWJA 3STXA 4BWYA 5JS1A 4NHOA 2LV8A 1FS4A 2A0UA 4N7MA 2DR3A 5BSTA 1CKEA 3MJEA 7ICQA 4J49A 2GHQA 3V7KA 5EZYB 3C5WP 1NXTA 2E4WA 2P4QA 5KG4A 2I3BA 5HRCA 4ZALA 5CAEB 1QFJA 4AMZA 4FWBA 1XZGA 4W1SA 5U1PA 3HBLA 3EPKA 5SZJA 2E4ZA 3IAS6 4C14A 1PNQA 4R1QA 2WUWE 4KC0A 3OIGA 3O91A 4LN1A 2PPLA 4UM9D 5CNKA 1C0EA 4CQMD 4LY3A 2QTNA 3L4PA 4UTZA 1RPZA 2VH5R 4P4GA 3FNIA 3ZWXA 4EFKA 5JSHA 1YFJA 3W77A 3B82A 1HYHA 3DWGA 3FLEA 2PX5A 3NQ41 3V1UA 2IYAA 4BGUA 4C6RA 3F90A 2VZ9A 3GNTA 3QW4B 1GRNA 4N0EA 4E5MA 4IGKA 2A9RA 3I04M 4IIBA 1HDEA 4BMCA 2E6UX 4UQLA 1ZP6A 4QJ3A 2N9UA 3FDJA 2G1AA 3BE6A 4RVGA 4OJPA 2I7DA 3K6KA 5KYWB 3FZYA 2FXIA 5DFAA 2UXDB 4IS2A 3RRNA 1L5UA 1OLXA 3MW8A 4EJSA 4EVQA 2UZ1B 4JCOA 4OYHA 2WYIA 4XXHA 4W8GA 2ZB2A 4R98A 4I5GA 3THSA 2ZYIA 5KU1A 1ILEA 2C20A 4R40A 2XUIA 1ZQIA 1H9BA 1X40A 3QU5A 2WHRA 4QPCA 4KLUA 1JDVA 4O3FA 2BFAA 2DFLA 2BF4A 2JJMA 2XE8A 4W9NC 4E5UA 5KTKA 1RABA 1UA0A 1JZTA 3GYBA 3Q5EA 4QBFA 1HC7A 1S8NA 1G8HA 2RQ5A 2IPNA 3VZQA 4K5QA 4MQ6A 2DBQA 5C5DA 2YW2A 2RKWA 3NIWA 5TPWA 2FV8A 4IDOA 3K1YA 5J0PA 2JZOA 5ESXA 3TXYA 5CR0A 3N9IA 3WICA 1W2GA 2KK0A 4ZN6A 2QMZA 4XQ0A 5DP1A 3V2UA 5B66U 2R68A 1U9YA 1XLVA 4Q8FA 3A9WA 3MUFA 2X9VA 3M3DA 3ZJVA 1ONPA 1TM2A 4COOA 1NBAA 2A3NA 2G5CA 4DY4A 1DOAA 4AI6A 3CCCA 1PV4A 3GJ6A 4KLSA 2IHJA 4LCJA 1RI3A 3EF1A 2HIAA 1DG9A 3RK1A 4CN9A 2HRBA 5LJIA 2QI9F 3E8SA 2C07A 5AFSA 3EB9A 3FRHA 5THXA 2CHVA 4FMPA 3K9FC 3PNMA 1VJDA 4LY9A 1CY0A 4BNDA 4DF4A 1V8DA 3HBAA 3PC2A 3VSEA 3N7AA 3GQVA 2WPDA 1Q1AA 1OV4A 3ND7A 4U0KA 1DIOB 3GOQA 2O6KA 3IT3A 4B3FX 2B8TA 4JJFA 3MWEB 4NSNA 1Q1BA 4R2WA 3UPUA 3SQLA 4Q4AB 1V26A 5F98A 2Z0MA 2ZB3A 1TUBB 3IAXA 4RFVA 2HZ7A 1GG8A 1R8YA 2J3LA 3K9CA 2F59A 1KC1A 5KDDA 1RQXA 4TWAA 4WFQA 2E4XA 1T8PA 4M1EA 4YMIA 3N2GB 4DOBA 2HYIC 1N7HA 2V7PA 5AKJA 3V4LA 4DLNA 1ST2A 1WL8A 2BKVA 2W8LA 1JS1X 1SXEA 1YQWA 2AJLI 2DULA 4M1QA 4ZVOA 5I5GA 1AE1A 1T4BA 3MWGA 4JBYA 1NMEA 3G7SA 3MPUA 5KL1B 5ECYA 4QUDA 2O4UX 3WLMA 3B1ZA 1AQLA 4KH1A 3JQCA 4TV8B 3M70A 1V7PC 4MAAA 1W4LA 5C1OA 3D43A 4IP0A 2YQZA 2AOWA 1A8HA 2F67A 1CEZA 1L5VA 3M81A 5BORA 4D74A 5JSKA 5JH7A 3ABRB 3WAGA 2BCQA 4AY4A 5K5EA 2AEEA 2BEKA 3AV3A 4PR3A 4CZ2A 4RZRA 4EHLA 1E9CA 5DLGA 1KS2A 2AB0A 3QFFA 4F9GA 3BMOB 2Q46A 1YC2A 2F2TA 2H2AA 4QU5A 4CL2A 3PGJA 4KJZA 2ZSAA 3KU1A 1G0OA 2WR8A 4TYYA 2Y0DA 1MW8X 5C0YA 3G9QA 2Q2NA 5HIJA 3KPWA 2OCEA 1V6AA 4PYLA 3QEMA 3GLGE 3TDMA 4ZHQA 3NXSA 1T2VA 3VX3A 1KQOA 1WX1A 4PC3A 4E6EA 2PQ0A 2W4MA 1ZOOA 1E2JA 3S8MA 2BUBA 3MMZA 1PWYE 4N76A 3AU6A 1PBTA 4RBNA 2GHIA 2VPZA 3BVPA 4GM4A 3AN1A 2AK3A 3NB0A 4MRNA 3SQDA 4KXVA 1NKVA 2R0QC 1XTQA 1GFWA 5HKOA 5JSZA 3JD1A 1DDOA 4GKBA 4H2DA 2ZTVA 3TFRA 1ECJA 2AOTA 2HA6A 4IH9A 5GJVC 3EEFA 1L1FA 2HA0A 4N6NA 3PZPA 3KWLA 4CKBB 4OB7A 2I9GA 2OILA 3ANYB 3IKJA 1REQA 4M0PA 3BDVA 4EABA 1JHMA 1NXPA 4KYTA 4BNGA 3IJEB 2P9JA 2WEKA 2AGPA 2XE7A 3WLOA 4D3DA 1FYDA 4RVCA 3AI7A 2EX0A 4JWTA 3NHSA 5EZ6B 3FUWA 2B25A 3NOVA 3QKWA 3QTBA 4YCLA 2F43B 1Y34E 3UKJA 2JRCA 1KI8A 2DCUA 1GP2A 3LV8A 4DCVA 4ZU1X 3JSAA 4ER3A 1G8AA 1HE4A 3K1ZA 5MHTA 3RJJA 2P1DA 5FV4A 3H0CA 4RQAA 3VYWA 5KO2A 1M7HA 4H0NA 2YINC 2EAOA 1QOZA 2I29A 1LFDB 1JH8A 2JAPA 1D4ZA 1YRWA 3F5QA 1JXMA 4DCJA 2JKVA 4DTIA 1JR3D 3KUXA 1KXZA 3BT7A 4FC6A 4Z4IA 1E18A 4G1MB 3M4ZA 2BP7B 5AKGA 2ZUFA 4Q66C 1MO2A 4NC9A 4RKRA 3MT9A 1IHXA 2FLVA 2CSUA 4FP9A 3EX7C 4G0MA 2RHDA 4FBMA 2WHQA 5DPMA 2G9ZA 1VI2A 3UH0A 4C1NA 3ZU5A 2H31A 4LJ4A 4YR9A 3ADDA 3N8NA 4GNRA 1GAXA 2ZBPA 4X66B 2BCVA 2GCIA 3C7KA 3F9IA 2XNKA 4TVKA 5K05A 2R48A 5G3ZA 2BR4A 2NQTA 3GP8A 1MJGA 4ID3A 3GFTA 3LOUA 2K87A 4IEFB 4D3FA 4H59A 4C7XA 2GPNA 3KO8A 4W5NA 2CXRA 3AUAA 3L7AA 2OHIA 3DDCA 3ND9A 2ZUEA 1PN3A 1CUBA 4K9QA 4QQRA 4KN8A 4LGYA 4GZ5A 4QXRA 4EUHA 3HDYA 2SECE 4DSZA 1AKEA 5JS6A 1QRSA 1T4CB 1VIYA 1S97A 5EIXA 3NC1C 3V8NA 1V48A 1QS0A 3VO8A 4WZAA 4GFDA 1HPLA 4RNNA 2XXBA 3LY5A 3QNWA 3DPUA 1UJ4A 4OYLA 1F60A 1PKEA 3BBPA 4KSYA 4CM7A 4EPTA 5EJ5A 4NJOA 4REOA 1J7JA 2AR9A 3OO1A 1IB6A 1D1TA 1MIOA 3KJZA 3VO2A 3D4PA 1KAMA 3GXBA 4JLKA 4PO1A 4YP6A 5LYJB 4PWYA 5SY9A 1LD3A 1T2UA 2YYYA 3EYWA 4O1MA 2M9MA 1QNLA 1CSEE 4QDUA 5HFAA 2IIPA 3PPWA 3I5YA 5JDCC 4HVCA 1J06A 1SC1A 1W4BA 1JE0A 4WVFA 2FQQA 2JLSA 3WIDA 1B16A 3WRXA 4LE0A 4V0RA 3ZY4A 4BPBA 2XW6A 2RGEA 4N6OA 5KWVA 1IUKA 1TQ6A 4YGXB 2VYCA 1RDFA 4DRXA 2ZZKA 1XCBA 2UAGA 2V4UA 4MJXA 2F2AB 4YO7A 3EXAA 3WL4A 5CB6A 1CR1A 4N49A 4XUDA 2IA6A 1ZWKA 3IUQA 4QOFA 1IPHA 3ROZA 3H3FA 3BS4A 1R0XA 2VUTA 2G09A 2FG7C 4ARUA 5CB4F 1KVRA 2WAOA 3FRJA 2X7JA 2F9LA 4MWZA 2JRZA 2WIBA 4KK3A 2CXYA 7ICKA 2AC4A 4PRYA 4X7RA 4TTQA 1KDYA 2IUUA 1C1DB 4KE8A 4B33A 4B5LA 5JMTA 3SKXA 1M2WA 4M89A 1KC3A 1JQEA 4CLHA 3EXEB 1RP1A 2J3MA 4TVOA 2XIDA 1ZJYA 3L0ZA 5JZVA 2O05A 2HY7A 5DHSA 4ARZA 1UPFA 2O8CA 1ZU5A 2HEIA 4FT4A 5LUAA 5C53B 2YN4A 3MT0A 1WVIA 1QX3A 3LRXA 4B3JA 3H5OA 4M54A 4CTKA 3HKBA 5JO9A 4AZWA 2OVFA 3EXHA 3M34A 2PMZF 2FF5A 3SYLA 3U4GA 1QGUA 2JD1A 1T9KA 2HIMA 4MVJD 2E5FA 3D7SA 3UB4A 1KY2A 2ZJ3A 1I94B 1Q0ZA 1EE2A 4I2DA 3C6KA 2H9YA 4PG8A 4HB0A 4C0ZA 3HDHA 3NH6A 2DWUA 4F2HA 4UUOA 4M9SA 4R3UC 4G2NA 3BXGA 1JN3A 1UM9B 2XUQA 1EWTA 3DFMA 4PCVA 4Z5XA 3R3XA 3ONDA 4S04A 3IV6A 1QH0A 3C0KA 3NTOA 5AW8A 1ZJWA 2RI0A 3TOVA 1E1NA 5G40A 3BWYA 1W2HA 5CCEA 1L4GA 3C3AA 1OF1A 3BJZA 5MN4A 1J0EA 1M6YA 1DGSA 2H1RA 3DGFC 3EGDA 1KQ3A 3O0TA 1PDVA 1G5IA 2ORED 1N56A 2JEOA 4TTRA 2W7OA 1WUDA 4Y9DA 1E79A 2W2TA 5JS8A 2FK7A 4FXPA 4G4SP 2EOAA 2ENWA 4M9JA 3V4PB 3EMBA 4ZZIA 4D80A 2FB9A 1O4WA 5L4LA 5BV0A 3R41A 1BH6A 2IHKA 1VBMA 2V6FA 1LUAA 2FN4A 3EPIA 1PVRA 3NUZA 1Y4UA 3AVXA 1N62A 4JMPA 3PXAA 4QBKA 3RS7A 2C2RA 4EVIA 4YECA 3D3WB 4HDSB 3OQJA 4F8YA 2ECPA 1NONA 2OM2A 2XUGA 1TT5A 1SCDA 4H7EA 4PTLA 2HXGA 5KWEA 4ABTA 1ZLXA 3GMSA 2CZCA 1OBFO 4U8HA 4CFYA 4HDMB 1NXOA 2DTEA 2MRLA 4C6TA 1T5DX 4ZDIA 4OLBA 2MDTA 2HNAA 5EGSA 2XGOA 3AHEA 1M0TA 1NNSA 1S5PA 1JSXA 4LJ6A 1E6MA 2CMDA 4DYVA 5CB1A 1U3VA 2D62A 4C6TB 3O0DA 4YXWA 4BZXA 4F6LA 1W0KA 4RNOA 1E1RA 1YB4A 1ORTA 4Q9LA 2Q8QA 1NUHA 3KD3A 2ILTA 3NEJA 4HWRA 2C8VA 1CYDA 4QGGA 1TW3A 1VCIA 4U7CA 4JASB 2H3QA 2OAQ1 4LYJA 5I9MA 2BKEA 4RVDA 2Z2YA 3VSDA 2I54A 2UVPA 5ALZA 1T3ZA 3UUWA 2AE1A 3RSQA 1J56A 3YASA 3BULA 5DLQC 2NG1A 1RAIA 1PT6A 4RHYA 4B85A 4YAWA 4LGMA 2CUNA 2JIOA 1FQWA 4UHHA 1ODLA 1NHWA 1UFQA 4C08A 1KFCB 4B9MA 1F1BA 1L1EA 2LCIA 4FYHA 3SZMA 5DLDA 2UYHA 1DIBA 4UMFA 3LX8A 3N2KA 1P1CA 1COZA 4JROA 4QVIA 3NAQA 4O2BA 2G9RA 3M6KA 5DTEA 5B3JA 1KEKA 1UMDA 4KR6A 1Q46A 3EZYA 5FBVB 1SU8A 1DC6A 3HJBA 5LPNA 2IEYA 4Q21A 1AS3A 1DEXA 4KLGA 3Q8SB 4WZ6A 1UQUA 1C7QA 1SCNE 2VBGA 3FYUC 3LT1A 3OWHA 2X22A 1I32A 4I14A 4CLOB 5L9AA 4UUBA 1NR7A 1JFVA 3B6IA 1F48A 3OQHA 4WN9A 1HQKA 1KQPA 2R8BA 4ZV7A 2XQGA 1T5LA 3N5KA 2BJWA 3KHKA 4B3DA 3EULA 2B4YA 3O2SB 5B7PA 1HE3A 3CBGA 1RLJA 3H6KA 4NAHA 2X42A 1WW3A 2C3OA 2G4CA 3LPMA 5K3FA 3W2FA 4LZGA 4DLRA 1LW6E 3H8VA 4E2XA 5JBNA 2CLKB 6Q21A 1N2GA 1R00A 3MMPA 2I2CA 3VR5H 2GA9A 3A1SA 1S2LA 3K8YA 2O5VA 2OBYA 4BFXA 5DBIA 5FUYA 1Z1VA 3RK0A 4RQ6A 3N0TA 2GHTA 3PC6A 4BDSA 4CRWB 4TZ6A 1CY6A 5H3LA 2C9OA 3H16A 4FDMA 1A2OA 1JHAA 3QKTA 4U4AA 4HGQA 5T4FA 3SP1A 4JH0A 2QTVA 3W5JA 4C0WA 1GGVA 2WD7A 3A3PA 1N4DA 3AUFA 3K70C 1YAJA 4D9MA 1WV0A 3MTIA 1T0PA 3H9QA 1S89A 2YVQA 1Y4DE 4RLSA 4UNNA 2AYYA 1I6WA 4BBJA 4EIWA 2VRCD 3PQCA 3TX6A 2I2XB 1E6CA 1W96A 4BQEA 4LX8A 2ZJ5A 1A88A 4HPXB 4D4MA 2IUSA 3KK0A 2I1LA 5ALMA 4OMDA 3VBEA 5CITA 2VJ5A 1OKKD 3E6AA 5HFNA 1AH2A 5LQJA 2J48A 3D8BA 1DGJA 4CF4A 1D6NA 1XTSA 1YNOA 2BUAA 2KWIA 3WJ7A 1JDBB 2P27A 3CF4G 3FCXA 4IWNA 1M2KA 1BFDA 1V1JA 4YXMA 5AOVA 4A7PA 5B1YA 4M0AA 3GZNA 1FMLA 4B9SA 2UVRA 4OQFA 4Q9JA 4B2IA 1VSVA 3HCAA 1VE9A 1EUDA 3VPSA 1SK9A 4KGXA 1RBQA 1UM8A 4OI1A 4ARSA 3PF8A 4LEIA 2CVPA 2CDNA 3BE8A 1E1LA 3GZNB 1ZEJA 2I5HA 1EVEA 1P7VA 2DBRA 1XV5A 1FFGA 3IIMA 4LF6B 1RWNA 4ZVNA 1WUYA 3ZHYA 3HCCA 4M9UA 2D0OB 1ZONA 1R27A 3SX0A 1NVWQ 4EKYA 5J4HA 1KKXA 2VUUA 3L8ZA 3PNVA 2CK3A 1V95A 4P38A 3ZUGA 4D41A 4U7DA 4ZAFA 3ZDXB 1QWOA 1V2HE 4GL4A 4IY1A 1CDDA 4PX5A 4RQ2A 3DVQX 3U3JA 3WTBA 2H9IA 4FGJA 5BW8A 5L95A 3LWDA 2C9MA 4XD7A 3T1OA 3WB0A 1SUBA 3VA7A 2ZJFA 3N05A 2CV2A 2HW8A 1KEUA 3N2NA 1SEVA 2HOFA 1N61A 3ZCQA 2HU8A 3D7LA 4RFSB 1K63A 4JXJA 3TZLA 1CZNA 3JVDA 3CH4B 3GJTA 3NHJA 3R5JA 1UUFA 4B79A 4XWWA 3OIDA 3AF1A 4YLEA 1NNEA 2SKDA 5KOHB 3MMSA 1H2FA 1NXSA 1RXYA 2CPRA 3KR2A 5E6RB 3W8EA 3HS3A 5BN4B 3W06A 5KQRA 3U5ZB 3VYVA 1J0XO 1YASA 4TLBA 4CFSA 3NHFA 1GA6A 5CA0A 2YQ4A 3I8XA 3E22A 3L82B 3QV1A 2WF8A 1XA0A 2ZYAA 5J2EA 4OGLA 3WL7A 4UAWA 1E0AA 5HP4A 3F2VA 5AXBA 1BWQA 1LZLA 1XUOA 2VNIA 4XPIA 3MJTA 2VT6A 3SSOA 3THRA 5KYVA 1JXLA 1VIDA 2FNAA 1R16A 3F47A 1SVWA 1LI4A 4G0NA 4KBGA 4LVSA 1UWLA 5F9LA 4X95A 3SXUB 2RKOA 4BE4A 3RVPA 2HRQA 4YASA 1CY1A 3DV0B 1JJIA 3HYRA 2Q0QA 4OJTA 3IP9A 1E7QA 5ICSA 1J5XA 1Q3KA 2ZYSA 4LJSA 4JB2A 1T26A 4PY2A 3EVAA 3VKVA 1Z5OA 1XQ1A 2Y76A 5KHAA 3ZCSA 4PNHA 3BQ1A 2XTAA 1UEJA 3QVGB 4LDPA 4L0DA 4O33A 5FBRB 5K7SA 1E9SA 4E4YA 2EWWA 5ALSA 4OQQA 3NJ8A 1N48A 1X19A 2C59A 2KE7A 3GILA 7AT1A 1C9MA 2JCVA 3R0IA 1JAHA 4XB1A 3VR5A 1QHXA 3CPEA 4DSTA 3AC0A 1YVUA 4BEWA 2ZRIA 2W71A 2C2YA 4PGXA 2WJGA 4W1RA 4PLHA 1DKNA 3QIAA 1KVSA 3L8DA 3PTAA 2HA3A 2ZJBA 3PNPA 2HDHA 4FFBB 4DMKA 3GEBA 1N2CB 3QOWA 2FG5A 3MCTA 4LXIA 1J2RA 1DGQA 3HRKA 4LJ8A 5HRAA 1LFAA 3N5CA 1Y8QB 3QF4A