3DV9A

Putative beta-phosphoglucomutase from bacteroides vulgatus.
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
246
structure length
243
Chain Sequence
SNAMFKEAINNYLHTHGYESIDLKAVLFDMDGVLFDSMPNHAESWHKIMKRFGFGLSREEAYMHEGRTGASTINIVSRRERGHDATEEEIKAIYQAKTEEFNKCPKAERMPGALEVLTKIKSEGLTPMVVTGSGLLDRLNHNFPGIFQANLMVTAFDVKYGKPNPEPYLMALKKGGFKPNEALVIENAPLGVQAGVAAGIFTIAVNTGPLHDNVLLNEGANLLFHSMPDFNKNWETLQSALKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystal structure of putative beta-phosphoglucomutase from Bacteroides vulgatus.
rcsb
source organism Bacteroides vulgatus
molecule tags Isomerase
molecule keywords beta-phosphoglucomutase
total genus 76
structure length 243
sequence length 246
ec nomenclature
pdb deposition date 2008-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3dv9A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3dv9A01
3RF6A 3ZVLA 4Y2XA 2YJ4A 2RB5A 4UAUA 1FEZA 3OTQA 1TJ5A 1YS9A 3L8HA 3QYPA 3SLRA 2YBDA 3KZXA 3L0CA 3NRJA 3L0BA 5T41A 5ALJA 3ZVMA 5AW5A 2G0AA 4J2TA 1RRCA 4FFDA 4OD0A 3R9KA 4BNDA 2HSZA 2WF9A 3I28A 4L6CA 3SKXA 3WKDA 5ALLA 4UMEA 5AVTA 5AI4A 3SHQA 1Q91A 2G09A 4RETA 3U26A 4F71A 2VKQA 2I34A 3TLMA 5AVXA 2CFSA 2QLTA 3QU2A 1CR6A 4G9BA 5AM4A 2AUTA 3W5CA 2BY4A 1O08A 3QXGA 4XQ0A 2P11A 3AR3A 2I7DA 5AKHA 3A1EA 5AI0A 1U7OA 3R4CA 3ZTWA 5AIAA 2B8JA 2Q4TA 3N8GA 4BEWA 2AH5A 4YIKA 3ZX4A 2FI1A 5AKIA 4DWOA 3NASA 3ONNA 2P27A 3B9RA 2R8ZA 1ZRMA 4G63A 4F72A 4Y2RA 4DFDA 3U19A 4CF5A 1Z5UA 2HOQA 4QJBA 4UAVA 4MWOA 3WGVA 3WKBA 2RBKA 3WGUA 3D6JA 1F5SA 4CF4A 3NIWA 2JGAA 2WM8A 1TJ3A 3N07A 4UU0A 1X42A 1RMYA 2HI0A 5ALWA 3OCZA 4UMDA 3AR2A 2HDOA 1XP5A 2EARA 2I33A 5AVQA 3A1CA 5IT4A 3WK6A 4Y2JA 2WFAA 1RLOA 3W5AA 1SWWA 1ZD2P 2I54A 2O2XA 1EK1A 2FPWA 3CNHA 1Z4JA 2QYHA 3QNMA 5AVZA 2JARA 5FP0A 4AS3A 2HHLA 4Y2PA 1TE2A 2PKEA 4BX2A 3SMVA 2OM6A 4NFLA 2W11A 4BX0A 2C4NA 4ZEVA 1Z88A 4Y2VA 5AW8A 2YN4A 4EELA 3NANA 4Y2TA 1J8DA 3U7GA 1L7OA 2NYVA 4IG4A 5AVRA 5AW9A 1U7PA 1NRWA 2RARA 3FPSA 1U2SA 2NO4A 3M9LA 1L7MA 4UATA 2ZOSA 3L8FA 4EENA 1L7PA 2CN1A 3IJ5A 4HAIA 2G1AA 4UU1A 1Z4PX 4YCMA 3U13A 2B30A 2DQSA 3FVVA 4YIHA 3IRUA 5AM1A 4KYTA 3W5DA 5AW2A 4UMVA 4QQFA 3QUQA 4UASA 3N1UA 2IOFK 5AK6A 4C4TA 3PDWA 5IT0A 2C9MA 3EF1A 4EEKA 1XPJA 2ZG6A 2JAUA 4HGPA 2YJ3A 3P96A 2GFHA 3OCWA 2FPSA 3RFUA 5AKLA 5ALGA 3KOOA 1RKVA 1RDFA 2EAUA 1YDFA 5AICA 1WR8A 4KNWA 3MPOA 3QU5A 5A3QA 5ALSA 5AI8A 1S8OA 3J7TA 5AK3A 4NAVA 4Y2QA 5AW0A 5AW7A 4J03A 4JDPA 1LVHA 2WF6A 4BKMA 4RESA 3WKAA 3AR5A 4UM7A 1NNLA 4NV0A 2FDRA 3WK8A 3I6BA 5AM2A 1Z4OA 4CNQA 3ZUPA 5AK4A 3UMBA 4KNVA 2OA0A 4FE3A 4L6AA 2NO5A 1U2TA 3QX7A 3EF0A 3E8MA 2WHEA 3UMGA 2B1QA 1RQLA 5A3RA 4OCZA 3AR7A 3ESRA 5ALPA 2ZBFA 3M1YA 1NF2A 3QU4A 1PW5A 4YH1A 5ALYA 2YJ6A 3KD3A 1Z4MA 2MSNA 3MN1A 2ZXEA 3I1YA 4MUMA 1RPZA 4UW9A 2HX1A 3AR8A 5AW1A 3EPRA 3QUTA 2RAVA 2FEAA 5AW4A 1T5SA 5ALMA 1QYIA 5AM3A 3F9RA 4E88A 5ALRA 3K1ZA 4HGOA 2PR7A 3HLTA 3WK7A 2AGVA 1RKUA 3MMZA 2C8LA 5ALEA 3UM9A 3OCYA 2YMPA 2WF5A 3QU9A 2GHTA 4GXTA 5AI5A 3NUQA 2GMWA 5AKZA 4DCCA 2X4DA 3L7YA 4XOUA 2FPUA 2YY6A 1ZRNA 1EK2A 1T9ZA 1ZS9A 2B1RA 2YMLA 3A3YA 2D2VA 4KX5A 4YCNA 4BX3A 2R8EA 4I9FA 3ED5A 5AVUA 2B8EA 3L5KA 2ZBGA 5ALQA 1Z4IA 1QQ5A 2I6XA 2JAOA 3SKYA 3OCXA 3QGMA 1Y8AA 4YGYA 4OFZA 1K1EA 5ALOA 2HF7A 5AKYA 1T5TA 1L8LA 4H1WA 4NABA 3KDPA 1QQ6A 1ZD5A 4YCLA 1YV9A 3ZTYA 3E58A 4ZEWA 4IFTA 3L1UA 3QU7A 3WKCA 1RC8A 2ZBDA 2FUEA 1WPGA 2MU1A 5AKJA 2HCFA 2FPXA 3MC1A 1RMTA 4HGQA 1L7NA 1QQ7A 3OCVA 4FYPA 5AESA 5ALDA 2MU2A 5AK5A 1RMQA 1WZCA 5AI6A 3QLEA 4Y3UA 1YJ5A 3U7FB 2I55A 4KX3A 3N28A 5AKGA 3DNPA 1N8NA 3B9BA 1YMQA 1KYTA 2P69A 5ALVA 2Q5EA 4NWIA 3OCUA 4AS2A 3PCTA 3ESQA 2YFYA 3BWVA 4Y2YA 2FUCA 1LTQA 1RKQA 2GHQA 3DV9A 1WVIA 2B0CA 2ZBEA 4EZEA 5E0OA 1SWVA 3N5KA 1TJ4A 4EX6A 5ALXA 4EX7A 2GO7A 2BDUA 3I76A 3UMCA 4PNHA 3FPBA 3U7EB 2W43A 5AVWA 2JAWA 5AI9A 1JUDA 3NALA 2R8XA 3WK9A 3NAMA 3L8EA 2IA5A 1CQZA 2CFRA 4UMFA 5AW3A 3E81A 5A3SA 1VJ5A 2YMMA 3IB6A 5AM0A 3PGVA 4GIBA 1TA0A 5ALUA 3L1VA 5AIBA 4UM5A 2C8KA 3VAYA 3EWIA 3E84A 5AKEA 1MH9A 4BEVA 1Z4QA 3AR9A 5AKKA 3WKEA 2G80A 2O9JA 3L0YA 3ZU6A 3ZW7A 4KN8A 1Z4NA 3HYCA 4O8CA 4I9GA 1O03A 3FGOA 3FM9A 2OBBA 3A1DA 4ZEXA 4BBJA 2WF8A 5ALFA 5ALTA 2HO4A 3OPXA 5IS2A 4BYGA 1ZJJA 3GYGA 3L8GA 4HGNA 2ODAA 5JJBA 1J97A 3WK5A 3BA6A 3DAOA 3U7HB 5AVYA 5AKXA 1SU4A 2G06A 1Q92A 3AR6A 4OHFA 3KC2A 2EATA 2OYCA 3ZX5A 1XVIA 4BNDB 3PGLA 4CE6A 1RLTA 4UARA 3SD7A 5ALKA 5ALNA 4XE5A 4XPZA 1ZD4A 3QUCA 3ZWKA 3W5BA 5ALHA 2FPRA 2HEGA 3FZQA 2P9JA 4HYTA 3ZVNA 5AVVA 1L6RA 3S6JA 2AMYA 1VJRA 1RQNA 4JB3A 2G07A 1Z5GA 4HGRA 4DW8A 5ALIA 4Y2SA 2Q4RA 5AHXA 4CF3A 2B82A 2R8YA 3AR4A 5AW6A 1QH9A 1U02A 1ZD3A 4C4SA 1RLMA 1IWOA 1S2OA 2IOFA 2W4MA 2IOHA 4L57A 1Z4KA 3ZI4A 3ZWDA 4B6JA 1Z4LA 1VFPA 2CFTA 3KBBA 3R09A 3SF0A 4Y2UA 3DDHA 1YNSA 2YMQA 2BDEA 2PQ0A 3WK4A 1N9KA 5AVSA 3ET4A 4C4RA 2G08A 1L8OA 2YJ5A 5AM5A 3B8EA 3QUBA 1AQ6A 2IYEA 2HF2A 2WF7A 3ET5A 2C88A 1ZOLA 5ALZA 3CZ4A 4AP9A
chains in the Genus database with same CATH superfamily
1KRHA 1GPH1 2WP0A 1U45A 4CZ2A 1Y3FE 1A04A 1PJ3A 1UDCA 3JASB 4FSDA 4MQMA 4UDNA 4JJ7A 1G7RA 4GBJA 3TQCA 4F2HA 3AESA 3GLIE 5TLSA 3VPBA 3W9BA 1WBDA 2QRPA 4DR4B 3L8HA 4ISBA 5EWMB 2JIQA 4F9EA 1C1HA 1SURA 1Y9JA 1UM9A 1W93A 4K1LA 2ORWA 2XUDA 4JQYA 3FOEC 3R4VA 4RZRA 2PA0A 4Q37A 3NVKI 1BMFD 4ND5A 3H40A 4DQRA 1U4BA 1EHCA 1RYFA 2CZCA 2Y92A 4RF5A 3H5NA 5AWFC 4B4WA 1N3IA 1CDEA 1J23A 3HBLA 4ABYA 3T99A 3DWIA 3V6KA 3C7KA 2ZAIA 3I01A 3CWCA 1C8LA 3AY0A 3EXEA 3LK6A 5AVTA 5HRCA 2IWHA 5L9AA 5EMNA 4U7DA 3AVXA 5IKEA 3KTDA 1GZ3A 2V7WA 4KXXA 1WS6A 4E1AA 2VHVA 4RETA 2OXEA 4YDHB 5JDCC 3LE8A 3DLTA 2XGGA 1CD5A 2AR7A 2JIMA 3K92A 4G5YA 1N2SA 2VKQA 4PLPA 4UB4A 4XIYA 2I34A 4OB7A 4A03A 5AVXA 1K86A 3OOJA 3GFQA 3V42A 3E05A 1F5NA 2BJWA 2C2WA 5B1DA 1O8BA 2RC6A 3M34A 5LWQA 2XICA 4GZMA 5BNFA 1O9GA 1DBPA 3ORYA 2P0AA 1KP9A 3KZMA 3FVTA 5DBBA 3O9MA 4IVQA 1L4EA 2Q27A 4LFCB 3T1QA 1MTZA 4Q15A 1O9BA 4D9IA 4IO0A 3BZCA 2VYFA 1ST3A 3HGMA 1OZAA 2MT9A 3P9YA 3ALRA 4HH0A 3ZV3A 3C5EA 3M6IA 3UMYA 3LLVA 3LIPA 5KTTA 1RAEA 2G28A 2J9RA 3TCNA 2XCSB 3DT9A 4B3GA 1E18A 1BXZA 3VYWA 2A9FA 4ASUA 2XOXA 4F1JA 4ANFA 1K63A 3WGJA 5KYXA 2GYUA 2VJ5A 5KG3A 4F72A 3M6XA 1NURA 1FU4A 4GW3A 5IC6A 4QQKA 4CF5A 4KRGA 4IDHA 1KBZA 4QECA 5KUTA 3W3AA 1XXHB 2KJ9A 1GEGA 1I6KA 2PI4A 4GSLA 4H59A 4OXRA 4TMWA 3KYBA 3H11B 4LJXA 2W00A 4UEJA 5DT2A 4X84A 5J58A 3TNFA 4INAA 4QZAA 5FFNA 1Y3HA 4EGSA 2P2LA 1HY3A 1M9NA 4DLVA 3MJFA 1UBMS 1X77A 3P5BA 4LOAA 1N9GA 1O87A 4A26A 3VYTB 4EY7A 4NESA 3VU9B 4X8HA 1XCLA 5SV2A 3CR3C 4LY3A 5JY1A 4ND8B 2FZLA 1RLOA 1E0JA 3V1NA 3VXKA 4DCMA 1L4HA 5K0LA 1QP4A 4L3OA 5EINA 4D0NA 1W9MA 2C59A 3MEQA 4I55F 5HDBB 2QT0A 3U1BA 2ODQA 2AFVA 4GXQA 5BNWA 3GG2A 2LPMA 4J9LA 1M5UA 3SV4A 4N65A 4Y2PA 2I4TA 1WYGA 1F51E 2RI0A 4ZQEA 1DT5A 2B34A 1ML3A 1P8JA 1MV5A 2PO7A 3KAQA 3T3PB 3UJCA 3T0GA 2I4LA 4H7FA 1XRMA 3E35A 1M34B 3QELB 2R5WA 2UVDA 5JFOA 2P78A 3MR2A 5A4FS 4C7XA 2C00A 4BVBA 4EW6A 4BX0A 3V2UA 3G2KA 4HNTA 2A0FA 1TT7A 4RZXA 4GZ3A 1A9RA 2GYYA 4FNMA 2JLCA 5AJVB 3MS4A 3D9QX 4LJ9A 3IFSA 1E64A 1VHLA 5FTLA 1FQJA 4KPEC 5I7FA 1J0DA 1RI1A 2QG9A 1B7GO 2V7GA 2WM9B 3D54D 4JI0B 4BECA 2IU4A 3BMXA 3DWFA 3JWHA 2WJ4A 2VNIA 2IH4A 2LKDA 1NHGA 8ICMA 1XTVA 2BFAA 2L69A 3HVKA 3KPYA 3B6JA 3FG9A 3VVCA 4EOGA 3CXUA 4R6XA 3SENA 1WHTB 3BD6A 1OA0A 3OF3A 1KZ1A 2RHBA 2X0KA 1L7VC 2I7TA 3DS8A 3FUUA 3HA2A 3HHPA 4PSUA 2OV2A 4DR5B 1O6ZA 1Q1ZA 2Z3ZA 3LUGA 1T7PA 1D9XA 4K88A 3V34A 4CI0B 5FIUA 1PL7A 2LE0A 1W2HA 6ABPA 3MGIA 5K8TA 2VJYA 3LOUA 5KG2A 3BXXA 3HCOA 4H4DA 4BZZA 5F3DA 1H6BA 2FEMA 3OM8A 3VPDA 3WQHA 3JVDA 2NSYA 1V2GA 1XCOA 2XDYA 1Q84A 2JAUA 2YWHA 3R41A 5B36A 2JZOA 4MINA 2R6R1 2O07A 3DYVA 1U8XX 2P79A 5DLFA 5CA7A 4G1CA 1KNXA 1BE0A 3F5MA 3JSXA 2AF4C 4GBED 4J0QA 4R2LA 3ZU5A 3IEMA 3AU6A 3BK7A 2GFHA 2H7YA 3A6KA 2HZ7A 4I2BA 1SUDA 2F00A 1K7SN 1J2EA 1X92A 3EAFA 4UQOA 5B30A 3L0OA 2KSOA 4DG5A 4KDRA 1XMIA 2AI2A 4PHTA 4QDKA 3R7LA 3QX3A 3FBGA 5DPMA 1Z08A 1BNOA 2X9NA 4TYPA 5KB3A 1SK9A 3NP9A 2PZJA 5F2OA 2XYHA 4AW9A 5K4LA 4J9SA 2LKYA 1IVNA 1K68A 1QHEA 4QEKA 3TZQA 2VYND 3E03A 4EW2A 4MWSA 4EDHA 5HZMA 3RIMA 4YRKA 1ECGA 4F6LA 1DEXA 5SYMA 2C5BA 3TRFA 1ZA1A 4C8NA 1LRLA 1OI7A 1SG0A 1YR8A 4P34A 3PTLA 1LNSA 1QC5B 2AWNA 2BQRA 1H85A 8ICAA 1Q50A 4Z54A 4U0KA 2FGKA 4FHFA 2H17A 1A88A 4B81A 4P4SB 5FPYA 1HNXB 3CG0A 3IAUA 2IEAA 2CVOA 2CLEB 3BGWA 2FVYA 4O3FA 4XZ3A 1T3LA 4DB2A 4D96A 2G82A 1CFJA 3AP1A 4K05A 1FFCA 4X54A 2VUTA 1BH6A 4W9NC 4I2CA 1X86B 2EEPA 4TQGA 5C8DA 1TXGA 2JI9A 3H1GA 4ECQA 4QT0A 4CQNA 3RB4A 5KFQA 1YZVA 3FHTA 2JHFA 1B8VA 2P5UA 1EM8B 4QSHA 5HMLA 1Q1AA 5BN3A 5FT9A 2Z2JA 2VWQA 4FQ5A 4LBYA 2EKLA 2YXPX 3HJTA 1OZHA 1UKBA 1WSAA 4QYIA 1U81A 2O23A 1IQRA 4XFJA 4IDDA 5DV9A 2LCFA 3UWMA 2A0UA 1JDUA 5HQTA 3ABZA 2HWKA 1XZLA 2IX9A 3E2MA 4GOJA 5K09A 3ESRA 1FS4A 4K40A 2R4QA 1HUOA 1PR5A 2QJTA 2WWRA 2YQ5A 1PCXA 5JNRA 1JA1A 1MW9X 2Y1EA 1PBTA 2BFEA 4OJPA 1G5RA 4YA6A 2F8TA 3R74A 3RAQA 1OW3B 2J0UA 3NVDA 4H1TA 1O77A 4RL6A 5LA6F 2FV8A 1CUDA 2C4MA 1LLFA 3AHEA 2E3JA 2PU5A 3CZ9A 3RROA 3WIUA 2CLMB 3GAMA 2AZXA 1PWHA 3KLOA 3KZOA 2PT9A 4O4IA 3E5RA 3FDZB 4R1NA 3IEIA 3W5SA 2J4FA 2IUUA 2O48X 1K8RA 4HEA1 3PRHA 4F3KA 3PWTA 4DSJA 2CXHA 1YGYA 3HC7A 1GNPA 2C29D 2JLXA 3PX6A 3E7DA 2C2YA 2E4WA 3SS7X 3HUFA 2RP5A 5AJHA 1G7SA 3TO5A 1T24A 5CDSA 4WZAE 3GGCA 4DLRA 4HG2A 2Z5FA 5I8ZA 4UB2A 3SQLA 2YMPA 1N3BA 4JA0A 4R40A 4AZVA 2WWTA 4HEHA 1K66A 5K0NA 2PAFA 4PZ9A 2FW0A 4DCCA 2P6OA 5JFTA 1RYBA 1BAPA 1ZVKA 2IZZA 4HDNB 4LK2A 2DYKA 4I36A 3D2CA 4BVLA 1W1WA 1ZS9A 4R9SA 4YRQA 2NZYA 5GTIU 1LNQA 1NJ8A 4P35A 4UJ3A 4DLSA 2J0VA 1XVUA 4CKXA 1NMZA 2BYTA 4V03A 2R6GA 3RS3A 1YH3A 3IOMA 4PQEA 2FR1A 2B78A 2IPMA 2OY0A 3T61A 3DM5A 1PEKE 2WAXA 2XY4A 3BPSA 5CW1A 3C14C 1D1QA 1EWQA 5MHTA 1MC5A 1CIVA 1MIOB 4D74A 3GG9A 4WPGA 5CBPB 2VN8A 1JG2A 3C1OA 4NU6A 2HUPA 2PX4A 4C7YA 2QTNA 1XZNA 1HFEL 1Z4IA 2H85A 3H9EO 4GPEA 1U3WA 5CLGA 1L3UA 4C8LA 3JQ7B 4QXRA 3TADC 3GRAA 1SA0B 4OFZA 4ZU1X 3UY4A 4CCYA 4MF2A 4OXXA 4UTNA 1U1FA 3IPYA 5KNDD 2RDJA 1CDZA 1PYGA 3V8EA 5AUNB 3HSYA 4IJUA 2IPAB 4IOKA 2XCTB 3QBJA 2P75A 1XZ8A 3LLCA 1VGRA 1NK7A 4IFTA 2BTQB 3OZVA 3EAQA 1J1IA 3LYHA 4FSHA 4HBGA 5BOLA 4YQYA 1YZGA 2BR4A 4C29A 3VNUA 1UT5A 3FYUB 2ROQA 4LX8A 2PUEA 2XIDA 3Q7IA 4RPIA 3TVTA 2H5EA 1A5SB 1E8DA 3RC3A 1EJBA 1GV0A 4Z9YA 4D57A 1MABA 4M6WB 1OXUA 2LUOA 3Q8XB 4HGQA 4GRAA 4LDRA 5ARDA 4EFMA 3J81k 3MWDA 3D4IA 4WK2B 5J0OA 1D2GA 5LPNA 1GO2A 4KLTA 1Y3DE 1YHNA 2WAQF 2FQQA 1V39A 2QV0A 1RMQA 3FMFA 3GUUA 3D8TA 4Y3UA 1EHYA 3RT7A 5JJ5A 1YVDA 2R8PA 2I80A 4EIWA 2HIAA 3GY0A 4HQ0A 4LY9A 4B5KA 5KQPA 1HDCA 5KNBH 3ZGZA 1E98A 1XL0A 3CVWA 4ZT7A 4DTCA 2RHLA 1N6HA 2HOFA 1AE1A 4MP8A 4NWIA 2OCBA 2EU8A 4H6VA 3EPGA 1E5VA 1GCIA 2ZUUA 2DKNA 4GM1A 4PSDA 4QA9A 1B4FA 4FZVA 4R2WA 3NFRA 2JGJA 3MUNA 2BMEA 1HKUA 4HLCA 3TUZC 2RAPA 5BO5A 5FNVA 1YRLA 1SB3C 5TF0A 1ODJA 4RA9B 3ZDYB 5L4SA 2IIVA 1VIVA 2QARB 5TT0A 3QEAZ 4IQ8A 3AM9A 1J99A 4F6RB 4FYYA 2B0CA 1C3OB 2ZJBA 2GILA 3OX2A 4EA6A 2J08A 3D7SA 5C8VA 3SXJA 1PW7A 1Z73A 4Z6DA 3DE2X 4WZBA 5TS3A 3WY9A 3R3YA 2Q5QA 4DLWA 3L18A 2XUOA 4PNHA 1PVOA 1A9TA 1E7QA 3DO6A 4YROA 3SE7A 2QMEA 4G5OA 1S5PA 3ZQKA 4JCOA 1O5IA 4ZOBA 3W8RA 1Z06A 2ZU0C 4XGNA 2FE9A 1T9AA 5HHHA 1F2DA 1SUSA 2I6GA 1YCFA 1UXGA 2PMKA 4GFJA 3WL3A 2GPBA 1KEJA 1A8UA 1BDMA 1NR1A 4M0FA 4JROA 4KLUA 1DEKA 3RH4A 5FBKA 2JIZD 2WKRA 1ULAA 5IW8A 3WXMA 4B40A 2ZBVA 3PYLA 4ZVTA 4BMDA 4EP1A 1WCWA 1BKYA 4FEGA 3G2HA 4R16A 4B87A 2IK8A 2FN8A 3UB2A 1N5IA 1L5WA 4I3FA 1YXMA 3IT3A 4WASA 1MXHA 1KZ6A 5DBAA 1XSLA 2VBGA 5GONB 3T34A 1G1AA 2ORVA 3PTZA 4IS7A 1TO6A 3Q5EA 1O03A 4Z3OA 3JQPA 1YJQA 3OIDA 2JAPA 3NYRA 4I4IA 4JXKA 1R6XA 5C0YA 2D7JA 4C6TB 4ZO6A 3WFJA 4BE7B 5FFMA 3QYAA 4KQKA 1Y6RA 2WJGA 4E51A 1FUEA 1LLDA 4WUVA 1VL8A 1W59A 2ZVDA 1NV9A 3D2AA 3PIDA 2AOXA 4A10A 4WBNF 2ZQYA 3EA4A 1WXEA 1C0IA 4Z4FA 3FAKA 2CBXA 5FOUA 3ZWWA 5JQWA 3K5IA 5K0ZA 2CL0X 3HY4A 4QZEA 1KA9H 1A6SA 3G13A 2DSTA 4C3ZA 5CK5A 3P8ZA 3O38A 2DHEA 1YI1A 3T3IA 1K8XB 1PAUA 4OJMX 2GEJA 2OCIA 2TS1A 3VPGA 2VIIA 4AX4A 2QBYA 3ZJVA 3F2VA 3SC6A 1ZGHA 1P60A 4X66B 3N4MB 1SHZA 1U04A 1CVLA 1TK2A 3LD9A 4P4UA 2GX6A 2EF1A 4PM4A 2R6ZA 3D1JA 1BD3A 1TYDE 1SHUX 3VDMA 2VXBA 1RC1A 4JL8A 3H05A 2O6KA 2IS2A 1I24A 1YASA 3DZKA 3L4BA 3QJ5A 5THQA 2WWFA 4WSOA 3RM3A 5IFLA 1XTBA 4ES6A 1G20A 4B4VA 1FQOA 4JB3A 5DBHX 5J2FA 2AEFA 2BM0A 1H05A 4PFQA 1GXSB 2PX0A 3EDMA 4FFVA 4JK3A 5HJ2A 4ALKA 4FWIB 4O4IF 1JHRA 4W4TA 1R8QA 3V1KA 2I4NA 3MGGA 3ZPXA 1QH9A 5AW6A 4XUSA 2OUKA 1Z19A 3N2KA 1S2OA 4LRTB 1MX1A 5CVCA 2R8KA 2C7VA 2VO1A 1SH7A 1HLGA 3FZYA 1GAEO 3GMSA 3R09A 2GPAA 4IM7A 4OQ4A 4E2YA 3OCJA 4HN4B 1C50A 4ZC8A 3BQ7A 3DDHA 4GPBA 3T8YA 3ZY3A 1QTQA 4XGRA 2BDEA 1ZGCA 4UOQA 3CX3A 3R9IA 4HNUA 1DWUA 4DMMA 5CHYA 3TAXA 4C6HA 2RE8A 1MEJA 4M9RA 2VWHA 2Y2VA 1UIMA 1N7IA 1PJBA 5T3YA 5HIAA 2WQ7A 5KQMA 3BC1A 3H2KA 2AMFA 1R0BA 2ZK7A 5HR6A 1P2TA 4HH4A 1N2CA 2I2FA 3FJOA 2FJ0A 1Q3HA 3BYZA 1D0IA 2R86A 3L9XA 1VJ1A 3M4NA 2XNDD 5DHSA 1QG2A 4UNNA 4OSEA 2RDIA 4GRIA 5FOXA 5ALMA 3K2BA 2C9OA 4QQ8A 3RF6A 1JPJA 1PL8A 2JAXA 1RRMA 3RSOA 4GHWA 4F5DA 4OMDA 1GFSA 4BQOA 4ZVMA 2GCEA 1KDRA 2HQBA 3IALA 1E2JA 4X63A 2MSEB 1DWQA 3GJXC 2HCTA 4RMJA 4ZEOA 4BMOB 4OYLA 5LD2C 2PS9A 4YG2A 1D9DA 4DA9A 1XJQA 1XAHA 2HCBA 4L8VA 3H4VA 2FFBA 4F4IA 3EUWA 2E18A 1LB1B 3NBAA 2Z95A 3ZCSA 4RGQA 2OWDA 3KEMA 2M1XA 3MMXA 4NLZA 1U9CA 4W99A 3QKRA 2MR5A 2ZR0A 1I2MA 3TAUA 1KFJB 1F20A 1KYIA 1RYMA 3LUDA 1GDTA 2ISQA 2C07A 1U3UA 1QJCA 1Q91A 4D02A 2BFDB 2IODA 4MZDA 3LI2A 5KFOA 2D6FA 3U26A 1NJGA 2C03A 4QJ4A 4EDFA 2FEOA 2QP4A 2ZRGA 3GRRA 3KPUA 3WMGA 5ICGA 3PUVA 3DT6A 4DA6A 4WIAA 1XWWA 4NOLA 4QNMA 3DD1A 4TKVB 3UCXA 1ZQMA 2PD3A 5DLGA 1H2EA 3SI8A 1T4BA 1RACA 1YNOA 4K9QA 3N05A 4HWRA 5CR0A 4YS6A 3WXBA 5KJCA 4LGYA 2GAFA 1UK7A 1U7OA 1NJWA 2EJVA 5G0VA 2PGJA 4EUEA 3DDZX 1QNFA 5T5QA 3Q7SA 4HCJA 4MH0R 5AVOA 3B5EA 2Q4TA 1ISMA 4BEWA 4OXIA 5I8PA 3G0HA 1A76A 4LCEA 3KKAC 1SBCA 1PS9A 2IYYA 2Q9AA 2W6JA 3A9RA 3OEYA 1CTQA 2IEIA 4DWOA 1L4FA 4EYQA 2RHJA 4US2R 1MA0A 3RPEA 2EERA 1BJKA 3THXA 2ANBA 1FZTA 4XB6B 3EQ7A 2CJFA 1CWUA 3W7VA 4IJQA 1RC8A 4QWMA 4XVRA 3DKIA 3R8FA 1GSIA 3OU6A 5LMUB 1Y4UA 1SZHA 2HRQA 2WD9A 2XCAA 8OHMA 1UUFA 1H4TA 1EM6A 1Y80A 2PZMA 5FAXA 4ZC1A 5IP5A 3NIWA 3RWOA 4WERA 2WM8A 4TXNA 3SJCA 3JYLA 4DOCA 3DTVB 4RQ5A 5E6UB 3FBWA 5ALWA 5TR9A 1AGRA 1K6MA 4AZWA 4L74A 2PJRA 2OQ2A 1EDOA 2JIBA 4DGQA 4Y30A 3MWYW 3D2BA 2YYYA 2AQKA 3ZQUA 4XM0A 2NU6B 4MUHA 1ODIA 1Y8ZA 3I9V1 4ZI7A 1P1CA 2OD2A 4ZOLF 1Z7EA 2IYZA 2ZI6A 1IN7A 3PKJA 3I83A 3TPCA 3MGBA 2QYHA 2ZQZA 2I1WA 3DLBA 1A5AB 1FRVA 1IPEA 1NJFA 3OOSA 2J5KA 3FWPA 3IMCA 5DM1A 1TTTA 3H1TA 2AOWA 2Q8PA 3QA3E 4UHFA 4PHGA 2K7ZA 5HHTA 3LPNA 4KH0A 5ES3A 4LRWA 5DNDA 3RS7A 2FK7A 2QR5A 1C14A 3IAM6 4H2DA 3CMCO 5CEHA 2PFQA 5FI3A 5I9SA 4P6VF 3RUAA 3EC7A 4BX2A 4DLNA 5IZCA 1ACJA 3A3KA 3KKNA 3RUEA 2IYOA 1J21A 2A88A 4N8EA 4ENUA 3ONVA 5JS7A 3R3WA 4AIIA 2Q4OA 1MO6A 1G6Q1 1T3TA 3K9WA 3WTBA 3KPJA 5B58C 1E7WA 1S77D 2RKOA 1YO6A 4CFZA 1KMCA 1LBSA 3MR3A 3OLYA 1A9OA 1OGIA 3TOVA 3BFVA 4Q00A 2HSGA 4QGFA 1HTWA 2FXIA 4AICA 2CXTA 1VGQA 5JNUA 4ZMBA 5K3FB 3VZRA 3K0SA 3DBHB 1EWKA 5JZBA 3PZPA 2GCOB 1UT8A 2NO4A 3LCUA 1T1GA 1ZK4A 3M9LA 1IUKA 4D3DA 4QIWF 1MORA 3UPUA 4EENA 1PQ4A 3ADPA 3JPYA 1HH4A 1Q11A 4KMRA 2XWPA 4WXYB 1AQNA 4P4GA 4XWGA 3HEAA 4BO9A 2Q2WA 2G5TA 1XO0A 2O0HA 4HZGA 2OCGA 5A3JA 5A7GA 2QVLA 4YMVA 4KMSA 5CITA 3D4LA 4O63O 4FSXA 5DSTA 4KGVA 1JQDA 1ZXBA 2B1JA 1KQPA 2N9UA 1Q1QA 4TKZA 4TSKA 4UBLA 1QHNA 2FSGA 4UMVA 1RP7A 1GU0A 3VR5A 4B6SA 1DC5A 1OXJA 1C0KA 1A98A 4NMMA 5I4IA 3EXG1 2OD7A 3A6HA 4QOEA 1WF3A 5ENVA 5ILOA 1MZPA 1FTQA 1J2UA 2RJNA 3T7SA 1I7PA 1DOAA 4N5NA 5CYOA 5DNYB 4QXQA 1KR2A 1Z68A 4BLPA 2ZYVX 1VE9A 2FUNB 1E3DA 5J0XA 4JH0A 4R2MA 3X1WA 1CS4C 4BO0A 4F9FA 3HVRA 3C6BA 3AJ8A 4J0JA 1L3VA 2HBZA 2JIDA 2PMFA 5HCIA 2VH2A 1E2LA 1JNXX 3O4FA 2OL4A 1SXHA 1Q14A 1VLVA 4BJQA 4LYHA 2R48A 2J4CA 2ZTHA 5CYPA 1Y4AE 5A6SA 4NIMA 3X2EA 3WLIA 2WSMA 4IHAA 3QE3A 3T3FA 4IR7A 4PTZA 1YD7A 3F49S 3PR3A 1FYWA 5NLLA 3CW9A 3SS9X 4F6RA 1W7AA 4LWQA 5DISB 4FEEA 3B48A 1ENPA 1J4AA 4CDNA 4IH1A 4XXHA 1GGNA 5M29A 1ZN2A 4XVUA 2XT9A 3SVLA 4XQ9A 4PANA 3RC1A 3FE2A 1DIGA 1I4TD 4K6KA 1L3TA 1NDQA 1QIFA 3A11A 2QIOA 4ZVOA 4X44A 4OXNA 1P3JA 3IAEA 2NRZA 3IDWA 1XEXB 1P5ZB 1Y7HA 4RPXA 5IF3A 2CKMA 3G17A 3JXEA 4Q5IA 3U0VA 1NNLA 2E6UX 1AK2A 3O4JA 2ETXA 4ZOHC 1CUUA 1I7LA 1XTPA 1QH8B 2HBKA 5MN4A 2JFPA 2I3GA 2XGQA 2BBTA 4Y1RB 1FLNA 4HWPA 5F2EA 3BTVA 1RJFA 2QN1A 1XNSA 2EFYA 1UHUA 4RTJA 1QNLA 4L5AA 1QF7A 7REQA 1QRTA 2NO5A 3OZXA 4L4YA 4DCVA 4KN4A 2CXUA 1L7EA 2WWXA 3TDMA 3VO1A 1EFRA 1G20E 3M83A 2WIFA 3EEOA 1EUQA 2LCIA 2I1QA 1RQLA 1IAQA 3HH8A 2NUTB 2HPVA 3OX3A 4LE0A 4XLLA 3PHHA 2XBUA 4G9GA 4L5BA 1E20A 2H9YA 1YE8A 4BMSA 4EW3A 5CG2A 3ICXA 4WESA 3M1YA 2IYSA 4FBGA 2Y1GA 4WCVA 1SKRA 3PY8A 1C2TA 4URHA 2XV1A 5EP4A 2XUHA 3I9MA 2NTVA 5ALYA 3N86A 5COBA 1YUMA 1EJ6A 2R79A 5F33A 1SCDA 2ADMA 3HPRA 2DUWA 3OQ6A 1EH5A 4KMOA 2IOYA 1I4LD 4WZAB 4B9TA 4Q7KA 4L5YA 4W82A 3FDZA 4I1RA 1DTEA 5IBRA 3CP8A 1LRJA 3A3PA 3C5CA 2ES4A 3RTDA 1X7XB 3ND7A 4AJNA 2WVAA 5IANA 1UFKA 3GFGA 5ICSA 7ICFA 3OQHA 2PR7A 3FOCA 3WMEA 1ZQYA 2PUWA 3BTSA 4ESOA 1AH2A 3HM2A 1B2LA 5E3IA 3UUEA 2AZTA 4DCNA 2CZGA 1Y6FA 3WMRA 1YB7A 2Q8NA 2WZBA 5K51A 1HZZA 3WNDA 5IG2A 4EGQA 3BJEA 1TAGA 3WHIA 1JQ5A 1Z35A 2P67A 4UXIA 1TPYA 3Q2IA 1SCIA 5AI5A 1FX0A 4QREA 2A67A 5LZ5A 4BCDA 3DGFC 1C7ZA 2AOTB 4DJAA 3USCS 3L7YA 4FQ8A 2QD3A 3TKYA 3BWCA 4J1TA 1KRWA 3PV0A 2P5YA 1D0SA 2C5GA 1PVVA 4E5KA 3DAGA 2YS7A 1JBKA 1FLVA 3ZGLA 4DSKA 1Y8RA 2Q0QA 3HP4A 2WUWE 4RY8A 4LHZA 3RT9A 3HJNA 3KLMX 5KHOC 2XY7A 1KEZA 3Q9UA 2DJ5A 4LYJA 2R47A 3WHPA 1H38A 2C4TA 4Q3EA 4WGGA 4EHLA 3RGGA 2PUVA 4FD2A 1TC1A 1C80A 3L5KA 1FP4B 1KFEB 1SXJB 4H3SA 3U1TA 5DGDA 1E3MA 3JATA 1WCIB 4J0KA 5LQUA 2F3RA 4DL4A 4EGAA 1Y8AA 3ZLJA 3HX0A 3TB6A 2I4OA 2OCAA 2X9VA 3HB0A 5TQ0B 3DAPA 4DYDA 3M6ZA 1T8WA 3VZSA 1WMEA 3QTBA 1ULZA 4LOJA 4YJGA 4WQMA 4AZSA 1FP1D 1VE5A 4FFLA 2XA1A 4RCVA 5EAIA 3RC7A 4BUZA 4YCLA 1QIEA 2HY7A 2QL9A 1MO5A 4RF3A 1LDBA 3O3MB 2IBKA 4CMJA 3QU7A 2AW3A 4FGUA 3LTEA 4MPRA 2ZBDA 1RI2A 2ZB3A 3MWDB 3NZEA 4RFLA 4DC9A 1FY2A 5I7WA 1WPGA 1LKYA 2VT2A 3CTPA 3EC2A 2PKCA 1H1LB 2FSVC 1UBKS 1AS0A 4GQIA 5KFHA 2HHCA 4M9CA 4NR0A 1JQAA 2BV3A 5HJ5A 4IILA 5E9AA 1VLHA 3PDHA 2JB9A 4UE3S 2Y93A 1NW3A 3VPSA 2CD9A 2RG1A 1FTSA 2RGXA 1BVSA 3Q15C 4J7CA 4X93A 3TZLA 4AMZA 3THWA 2OQIA 2YDXA 3N0WA 3BWYA 3DLAA 3MF4A 1Q0ZA 4YJHB 4H1HA 1KYZA 2B5VA 2JS7A 3P2OA 4KW7A 4B6OA 1FBNA 3CGGA 2OCEA 2XGJA 3BT7A 2PFNA 4U2GA 3VR2A 3NC1C 2O8FA 2R751 3MMSA 3NBMA 4QDTA 3DLPX 4X5OA 4CKEA 2J0QA 2CHEA 3WS7A 2JD0A 1G0NA 1KK2A 1PK3A 2WT4A 3WMWA 2GKOA 3L6UA 3ZV6A 4R0NA 5CGZA 1E58A 3VJLA 3WSTA 4EM6A 1Z2AA 5BSVA 5KIAA 4DB4A 1GRQA 3IHWA 4E11A 5J0QA 1IATA 1MD9A 3DFUA 2WVJA 3AU8A 2GM5A 4WT7A 4X8LA 7ICPA 5EYPB 4ARZB 3M8KA 4YECA 1TU3A 1I13A 2DG2A 4KRYA 4A7PA 2PWZA 3VR1A 1LTQA 1NY5A 5HZKA 2GHQA 4XASA 1Z6XA 5GV7A 1W85A 1XLVA 1WVIA 2HPAA 3GZJA 1T2VA 2R97A 2UYQA 3HP7A 3TEJA 1JR4A 3ROFA 2PN1A 5BYAA 1GQRA 5J2TB 7ICIA 1RQRA 1FDSA 3JQ8B 5G4KB 1M8GA 1E5DA 2ADFA 1BGWA 3RK0A 5C34B 2O5VA 3RG8A 5AVWA 5LD2B 1MJGM 1VSUA 4NU5A 3RANA 1JUDA 2DECA 2NYRA 3GJYA 4GDMA 1ZGJA 1TK5A 3PHJA 4JP3A 4DLTA 2F67A 4CR6A 4HB3A 5KSZA 1D8BA 2KG5A 3N9IA 1UBGA 1YUNA 2ANCA 3A32A 1M1ZA 4U7FA 3EPLA 1JI7A 2DFLA 3ITKA 4IQFA 5G0UA 1Y0BA 3FXAA 5JASA 5LZ2A 4KR6A 3G0OA 2BP7B 1CJUC 2XOEA 3D3KA 1UBLS 3KKEA 3NV7A 4U6NA 4KHZA 4OB6A 1MOSA 4D0GA 2V54A 3SFZA 1UBTS 1ZZGA 2HMYB 3P0FA 5KFJA 4ZU3A 5IARA 1OD6A 2D3DA 2IDJA 3C7DB 3Q0IA 4DF4A 4O3SA 4F7DA 1FFEA 2IF2A 4DV6B 3C8ZA 2LD4A 3DEFA 1TK9A 2E1FA 2XQKA 3DMHA 4B80A 1QGED 3SVZA 3ZE1B 2Q3EA 3L0YA 5REQA 4C0ZA 2NYUA 4QUAA 4OJLA 2XD4A 4MMYB 1L5KA 3UHFA 1Q15A 4C7KA 1IY9A 3HDYA 2OBBA 3IESA 2JD1A 2M6KA 4OHXA 1XKTA 3V97A 5J2TF 3AUTA 1T3SA 5FBWB 3D59A 4GYJA 3BXHA 121PA 3ELYA 4W5NA 1QO7A 3BD7A 1QG0A 4R5HA 1ZK1A 5LU8A 4ECSA 4IAOA 4F60A 4UE2A 1CR2A 3L77A 4PLZA 3BILA 3S40A 2UUBB 3BS7A 2JLAA 1SKAA 2W2MA 3D8BA 3HCCA 3I30X 2YUTA 5ULLA 4RVNA 1QGZA 1SBHA 3OOWA 3OEHA 3QFFA 1RXCA 3IUSA 4R8LA 4LMPA 4CN8A 3DONA 5B1IA 1PWZA 1EXWA 4TKUA 5IJXA 2QY6A 4HB4A 1J2NA 1FA9A 2PTGA 5DSZA 2Q4EA 5E7JA 1EBFA 2AJTA 2ZP1A 2Y1WA 1GR0A 3IELA 1JWBB 3MJHA 4Z7JA 4RNDB 4EI9A 2D1RA 5FTWA 3R24A 2AI3A 4DWIA 1QK5A 1NX6A 3M5PA 1CIPA 4FCVA 3B9JA 1SKUA 2L0XA 4J3JA 5EJ6A 4R3NA 3I6MA 3I73A 3ID6C 3BQTA 1M2GA 4PAMA 1JRPA 1RD4A 5CVVA 1OROA 3OIYA 3TGPA 2PX3A 4PPYA 1L6RA 3VHXA 5FR2A 2VVTA 4NYMQ 2P9HA 1OBVA 3W6ZA 1S01A 3T7DA 4CMGA 3P9QA 4DW8A 3W5IA 3C41J 4XUCA 2FHPA 4D9JA 1B8OA 1F8UA 3FNGA 2A4MA 2W2OA 3CZQA 3IHTA 2Y9TA 2OMKA 4PX9A 1RLMA 2QSJA 3WRYA 3MBYA 2IOFA 2X9LA 3I4FA 1A7KA 2COKA 4BE9A 2IYPA 2F4NA 2WB4A 3FAHA 3NHLA 3TZBA 4B6JA 4KH1A 3PFCA 3U81A 3RUFA 3JQBC 3HXLA 1K5DA 1QMGA 4GH5A 3DDUA 3KHKA 1DHRA 3RU2A 5JAPA 1SB9A 1PDOA 2J6HA 4MQFA 4UUOA 1XXHA 4RKFA 5F1OA 2ODPA 1V4VA 4RJLA 2A59A 1ZQEA 3R6DA 4TTSA 3CH6A 4UAJA 5FBRB 5G41A 1M54A 1UBFA 2PV0A 3ZWYA 1U5AA 4RW0A 4HNAB 4ARSA 3GLFA 4YN4A 2XTAA 2LBPA 3WGKA 1UL1X 2IYEA 2DQ4A 3QTLA 4ZZ0A 1S2GA 4DIEA 5IN4A 3UXPA 8ICSA 1CHNA 2QAIA 3M9NB 5T4EA 2IV3A 1LLUA 3L02A 3AQIA 4Y0AA 1RCFA 1U49A 2FFRA 5BUSA 3K2IA 3VZDA 2E5LB 3V7LA 4JUIA 4AP9A 1SGGA 5C46F 2W90A 1GZDA 4LW8A 4X64B 5EIWA 4P0PA 2D3TA 2JI8A 5F2KA 2NU8B 4FC6A 4XIIA 3AFGA 1P3Y1 1TJ5A 4EVIA 4X3CA 1L4BA 4N40A 3A9VA 1G3QA 3N6XA 3VC3A 5TPWA 5HOQA 4HZIA 1Z8NA 3NETA 3V6JA 1C3VA 3TX6A 3BQ0A 2W2NA 1O95A 3IEKA 5CIQA 3HO8A 1JAZA 3Q8PB 2KFNA 1EK6A 1RRCA 4X71A 4DXAA 4LJRA 1JJVA 1WJGA 1VLBA 5GTHU 1TK0A 2EGUA 3CKMA 1R64A 3HEMA 2G5CA 3JQ9A 3JS5A 3O3NB 1SKQA 1WKBA 3D7NA 4PZUA 2JGRA 2YCBA 4KSYA 1IMJA 4B35A 1AN9A 3YASA 1D0VA 2QG6A 4BNXA 4ARCA 3RLIA 1QE5A 3R5SA 4I2EA 1O6GA 3ZHQA 1K9VF 1NWHA 4Z1MA 5JS2A 2J4DA 2REOA 3WA6A 3TACB 4L78A 4CKWA 1CNMA 3S5UA 3GJQA 2F90A 5HNKA 3KXLA 1RTTA 2VDKB 4WFJA 1SCUA 1PE0A 2CK3D 4FDAA 1E2PA 3PX0A 5TDHA 2WABA 1R88A 3NKFA 4O2LA 1QIMA 2DPXA 2ID7A 4BNJA 5B6PA 1Q0RA 3GLKA 2GAOA 4TRNA 1I0LA 1JU3A 3K9QO 1RI4A 3OLQA 3KQUA 4G85A 1QCDA 1S96A 1YVUA 5A7FA 1JPUA 3BREA 4NS4A 4XRRA 4EPTA 1XD2A 1W96A 1YULA 7ICTA 4IZHA 1FNDA 3U56A 3OECA 1NZJA 2E85A 1SKSA 1WB9A 2M32A 4R01A 5F78A 2AC7A 3LWDA 2D2IA 2ZRMA 1KDOA 4BV8A 5TMEA 4AUKA 3KALA 2QL7A 1QF6A 2P0EA 2CNBA 3KQWA 1P5FA 2AYZA 1NJZA 3KUUA 1DKPA 1KYVA 1AQYA 1NQXA 1JFFB 3LIIA 1P1IA 2Y0CA 5IAJA 2XTJA 3L6CA 5IX8A 3MOGA 1KSPA 4DL6A 3REQA 1XFDA 5CB6A 2IZ6A 2NUPB 8ICTA 5G02A 3WGUA 1UMDB 1XZMA 4IR9A 4FLMA 5BNZA 2IX3A 3IYLW 4C9BA 1J0EA 3GV5B 3O0TA 3PQ7A 2XCUA 4HNRA 4FPXA 4LS3A 1RHRA 3LWLA 2DWCA 4EG0A 3AIIA 3UOAB 3KV1A 4P5EA 3I8OA 3SK0A 4A3SA 4PC6A 3K3PA 4ZO9A 1K2VN 4BZWA 1TMGE 1R18A 3TIIA 4H7JA 2QYSA 3GPCA 2W2KB 3HXMA 4Y2JA 3II6X 5DLPA 4EI2A 5K0GA 2HT6A 4H77A 4F4JA 3N2GB 5DX1A 5EIBD 4YRFA 1T5BA 1VG1A 3F53A 4QZBA 2A7XA 2NSHA 2JH1A 1DAKA 3A4IA 5F5NA 2FMIA 3PGA1 1Z4JA 3N3BC 1OCEA 5BSGA 4XD7D 2ZETA 1EX1A 2BKEA 3E4DA 5CNKA 1COOA 1W4AA 2HB6A 4HAYA 1QRAA 5KINB 1DJMA 3JVUA 2KE7A 5E6SB 1BJRE 5KSYA 4NF2A 2CXPA 4O5EA 1P9NA 2HPZA 5BV2P 5I51A 5LQJA 1PHRA 3I2HA 5EZYF 2PFSA 4B75A 3MGVA 3H0CA 1VPEA 3M5DA 3TH5A 1Z1VA 2OM6A 2WJIA 3QKSB 1LWNA 2JFQA 1A69A 2PZ8A 3UT5B 1CQXA 4DBLC 3SZUA 4C88A 5LOVB 1COZA 2YB1A 1TO2E 3NH9A 4ZYVA 5KT6A 1PVQA 5DP2A 3PFHA 2OHIA 2CXYA 3NANA 4F56A 3EULA 1TQ6A 3BL8A 3HA7A 1XQWA 2WB1C 4G0XA 4MVJF 3TW4A 3NBFA 1C2YA 3WLOA 5G4KA 3M1LA 3NMUF 1DELA 4RM2A 1UADA 1B42A 2XWSA 3C43A 2IYQA 3QBDA 1XRPA 5C5EA 2QRGA 1L7MA 2PIAA 4WVLA 1CUWA 3C4VA 1DX9A 3CT6A 4CM5A 1THMA 5BWLA 4JODA 3VJMA 5EHNA 1E5QA 1NXPA 2GJ4A 3LMKA 4MVJA 4WLVA 4FW9A 5BRNA 2W54A 3PXCX 1GGMA 5IEBA 4ER0A 5F1KA 4FZ5A 1LI7A 4D3SA 5GWXA 1W36D 2FMQA 5C37A 2O19A 3HNOA 2QX8A 1CEZA 4A82A 4RXTA 2NV0A 5FUMA 3DLIA 3AEYA 1CR4A 3SEQA 1T6ZA 1OV4A 1X7XA 2ONCA 4JBLA 4Y2GA 1M33A 2CLCX 4XIJA 5KREA 1UCVA 4WBSA 4UASA 5D51S 1PYOA 3BS5B 1HYHA 1DU4A 2VT3A 3O94A 2WOOA 5CXQA 1GPNA 3EG5A 2FOIA 2RH8A 4M89A 1PLLA 3UH0A 1FRQA 1NLUA 1G21A 4NULA 3ADOA 3JPWA 1ZWLA 4NKRA 1QB7A 4OQXA 1ZVMA 4RQ3A 1WY7A 3HYTA 1YJAA 1CZUA 4TKMA 1L4KA 1PS8A 1TGVA 1UM8A 2BIFA 2ENWA 3G0BA 3JZDA 3PE4A 1DKMA 1L4MA 1ZG3A 2KK0A 1KI8A 3I6QA 3ITNA 4TPKA 1X3SA 2WMOB 5FHRA 5CFMA 1G6KA 2PE5A 3EGDA 2AZDA 4KQCA 4C87A 1YRYE 3OZRA 4D6XA 1YQ9A 4J0EA 3WYEA 1ICEA 3KTOA 4FHEA 5PGMA 1S2LA 4MW1A 3ZLUA 1TQHA 5CEEA 3RAXA 4PRZA 2GERA 1BHQ1 2YIVX 4JEIA 1GPUA 1UJNA 4NQZA 4BTLA 4CWAA 2HOIA 2D2EA 2V98A 3HJHA 2V5UA 4ZDKA 3SP1A 2YY5A 2KMLA 2UUAB 1NUHA 1G8GA 1XDZA 4TV8F 2ZRPA 3HSKA 3L7JA 5EMMA 2ID9A 2Y1DA 4HDOB 2H4FA 1CEYA 2AU0A 1UCFA 2VNAA 2ORIA 2ZTLA 2VDNB 4L2IB 4L4RA 1U65A 4OMCA 4N47A 2J3LA 3D3NA 3S1SA 4M55A 3CVUA 5DLEA 3RJJA 1IUNA 3DL2A 2EDAA 1U7HA 2F4VB 1LBEA 1NSTA 2FXVA 3BRQA 5E3JA 1QQAA 4TYYA 3AR5A 1GA1A 2P7IA 4PAOA 5DULA 3RJIA 1TUGA 1Y3CE 2WIGA 3LRPA 3DOFA 2GBIA 4NBNA 1UXKA 2YZNA 4F3TA 3D6HA 2PZBA 2FP4B 1ATZA 3I6BA 4KWHA 4QOFA 3ANTA 2YYSA 1FDOA 3EVAA 3K0CC 3OY2A 1AMUA 3TLEA 2YW2A 3FHJA 1SXJE 4KXLA 4TL7A 1Z3EB 3UMBA 3LT2A 3NKLA 3QUAA 3OO1A 5DM0A 3IDFA 3NRZA 4QT4A 1SVMA 3PUKA 3QVGB 1QRRA 4D9KA 5HXAA 2CBZA 1TRKA 1UDXA 2BFCA 3Q8MA 3FYUA 1H2WA 4G4JA 4IMIB 4JR0A 5AH0A 5ELXA 4BO8A 4C7VA 1BNCA 2DY0A 2ZULA 2XNKA 3OFKA 5EFOA 1CZLA 2FOXA 2O57A 1OYWA 1V3VA 3BFPA 1NW6A 4YUYA 4B17A 1KVRA 4CF6A 3FPGA 3I9FA 1EFDN 2UZ1A 3X44A 3F8TA 3P2YA 2CEKA 4NL4H 4WAUA 2WAOA 3LBYA 5DN9A 4UUPA 1QZZA 1Z0DA 4B9VA 4O3OA 3N0VA 3EGWA 4JLDA 1ZVJA 2XITA 3SIRA 2C3YA 3UGQA 3VAAA 1E99A 7ICOA 1E0DA 1CPYA 3CRXA 1DJQA 2PFPA 5E95A 5AP9A 5J59A 3VFDA 3VV3A 4ZFNA 1NAHA 1QX4A 1M83A 2Q1YA 3L6RA 1Z8FA 4RKEA 5LN1A 3MLBA 1XZPA 4A2QA 3EZ5A 3O9VA 2YJNA 1FNBA 1MZVA 4LK3A 4MFAA 3WLAA 4EYEA 3RHFA 3WK7A 3RUIA 1E2MA 3LDGA 2FFQA 1ZH2A 4OJYA 2AX4A 2RHMA 1L5NA 1YR6A 5F4ZA 2J0EA 1AKUA 2N0SA 4UEKA 2FCRA 5J40A 2BZSA 4FZRA 5E9WA 4PBRA 4LSZA 4YR9A 3U44B 4MVYA 1Z6YA 4IS2A 4M2LA 3SIXA 1WCV1 1JX4A 4G3IA 1NC1A 2RAFA 3SHVA 4CW7A 2QTTA 2D1QA 3CLTC 2MA1A 3BMQB 5HZGA 2B8TA 3NC4A 4YJ2F 3RU7A 4WZBB 4QQNA 5K3CA 3A3YA 2J3IA 2P2YA 5AOAA 2CWWA 1AA6A 4TTPA 4LF7B 2WILA 5ARBA 2PGLA 2QX4A 5D3QA 5L4NA 3H5VA 4CUZA 4N0PA 3ISDA 1G20B 3TECE 1U1DA 3AEKB 3K0KA 1W1UA 4WDQA 3PA6A 5DBIA 2HWYA 4G5QA 4BNTA 4G1BA 3UXMA 1XHFA 1INLA 2QN2A 3LVFO 5KFWA 2A1JA 2VPYA 3LSYA 4IJMA 4PHHA 2YHUA 3KAPA 4UVDA 4YCAA 3W34A 5IPFA 5WRFA 3KPWA 2I5HA 1WCIA 5IIJA 3CTMA 3TANA 4YX9A 1ECWA 3KEOA 3LDHA 3ZXUB 1JEYA 1JWAB 3MXOA 2WPNA 3D8HA 3Q4GA 4QPJC 1R0SA 2W6IA 4YFKA 2MTBA 3DTVD 1I3LA 4DWVA 4EA8A 4H1WA 3R5HA 1M0SA 2GD2A 4QOJA 1XEWX 3MD9A 2FZ5A 5CT8A 1M2OA 2A1TS 5L9XA 3VNQA 4AF6A 3QFRA 1Q7TA 4MJ7A 5CDUA 4AYXA 2IF0A 4DJEC 3L40A 4JX8A 5FI1B 4G8DA 3KJIA 4RMIA 4N5MA 3Q0EA 3TYXA 1K5GA 1M2JA 3RR7A 1NAIA 2DKOA 2JH8A 2VBIA 1YZUA 4OP1A 3ROXA 5F73A 3CF6R 2BGMA 3BSSA 3I2KA 1XSPA 1E7MA 4EMSA 4FBUA 1UWLA 3GGJA 1USIA 1WZNA 3K73O 3NBUA 1TEVA 2XUPA 4KQEA 4PPFA 4GYYA 1T6YA 2CDAA 1G18A 3HRHA 1IG3A 3IQWA 2EZTA 3B5IA 4JI4B 1NMEA 4N6GA 2AX3A 2C1EA 1Y5IA 2YX1A 4P86A 3VZPA 3HJRA 3FD8A 4D1YA 2BHNA 3NTUA 1TMKA 3F73A 2I55A 1I2AA 1ZMBA 3DMRA 1LV8A 4IIVA 3D1LA 4MP6A 1P45A 3TMAA 4AKSA 2Z43A 3D5QA 1NVVR 4KPGA 4EITA 9GPBA 3E9EA 2FWJA 4FT2A 2G6BA 2XRMA 5HQ3B 5KG1A 3FOZA 3WWPA 5JXWA 1X6VA 1EJ2A 2V03A 3D4NA 1ZKMA 4FOLA 1LX6A 4MYDA 3AM5A 4KK4A 4NRDA 4WLFA 1CUHA 4YMGA 1JB9A 1P7CA 1FUYB 5E1OA 3SF8A 4XRHA 4K8RB 1V6CA 1I30A 4QO8A 1M2VA 2ZRJA 4RZIA 1Q16A 3DOCA 3A3NA 4PSKA 1O96B 1YDMA 2X1VA 4LHWA 4WE3A 2ZBEA 4XWOA 1RHQA 2HTFA 4L7VA 5KU1A 4EAAA 3OBIA 3PS9A 3A4MA 1RZVA 3E1GA 3C6ZA 3SQIA 4ZI5A 1F2UB 2V3VA 4G0OA 4F4XA 1Q3VA 1NUPA 3MS7A 1H8HA 4GC9A 3O3CA 3FPBA 2QTWB 4JJIA 2Q46A 4FONA 4LCJA 2RIRA 1ISJA 1L4GA 2ZUSA 2IHYA 1UJ5A 2P4HX 2QRLA 2V7VA 2XVYA 5DB8A 3AL2A 3Q3IA 5FWAA 5LLSA 1OFGA 3TBFA 3B38A 1DK2A 2QM0A 3KSRA 1KSHA 2ZTVA 2QVYX 5K03A 3UWKA 1YA6A 3B3FA 3KFVA 1G16A 3M5WA 1PUZA 3SZ3A 4FFOA 4FHCA 2X19A 4MYRA 3BQMB 2VQFB 3GDOA 2BHTA 1CQIA 2Z83A 1RPAA 3NGMA 1A8IA 2P35A 1RFGE 1IPFA 4P98A 1AB5A 2CL5A 2ECQA 3KYDB 1HT0A 2H4ZA 4JLUA 4DNOA 2HYDA 5A5GA 5IF9A 5JD3A 2PWAA 1VDVA 1E63A 4R9RA 1BXGB 1Z4QA 3AR9A 1ID1A 2BDTA 4UNSA 3VZCA 4HTFA 4ARIA 4S2EA 3TL3A 4HL6A 1FNCA 3LV8A 4G4SP 4GVXA 2JKZA 4F8JA 4G0WA 3TW8A 3K70B 4RPJA 3B70A 4F4FA 3PEEA 2MIIA 3T1VA 1RYZA 1MQ2A 3C6XA 4C01A 1BIFA 1W47A 5FUWA 4E12A 4DA0A 3A6ZA 1SCNE 2CB9A 1XI2A 1VC2A 4HLQB 5B3LA 1YZ6A 1BEUB 5AJXA 3PXGA 1RJDA 4DCJA 1YR9A 2ASLA 3DAOA 1PFYA 3EGDB 4B43A 1WEHA 1TECE 3JYOA 1SU4A 4K0RA 1OGJA 2CK3A 2IZ7A 1JG4A 3C5WP 2GD1O 2ZAGA 3BXEA 2RHTA 1G60A 2WHQA 5D84A 5L1LA 2JHCA 4I2VA 2OYCA 3JALB 1O9HA 5C5JA 2FSPA 4NLKA 1I36A 3JQGA 4TM7A 4X8OA 3V8BA 5EY5B 1G8KA 3U39A 2AQIA 3ZUGA 3AF6A 2XUZA 4GXJA 4YBRA 6PFKA 4OLBA 2QM3A 3WTCA 1CNEA 1W36C 5E8JA 4F8YA 3FZQA 4W6QA 4C4ZA 2P9JA 3ZLBA 3VDXA 1TZKA 4RM3A 4I08A 4C0JA 1LC0A 1Q0TA 2B4RO 5DKWA 1A77A 5ESRA 2WVGA 4F4HA 4KUEA 4ROTA 2VUIB 1DV2A 2W37A 3WLFA 4BFWA 5LIRA 1VJRA 2QD5A 4QDXA 3W1EA 4NH0A 1P1HA 5LQDA 3ADKA 5J2DA 2Q5OA 3VYUB 4JIGA 1FSPA 5DOZA 3UJ8A 4JD5A 4BQIA 4Z0HO 3DMDA 1NKTA 3LRTA 3KM0A 4M3NA 1L5UA 4I2IA 4QU9A 2UU9B 2GCOA 5CX4A 2XHZA 4L57A 3ZI4A 1T4DA 3KP1A 5IBQA 7YASA 1JQEA 4GGPA 2HZBA 3N70A 4M8IA 3SC2B 4ALMA 3SF0A 1GQOA 2QD1A 4KBYA 3NVYA 2HLPA 1XTJA 4JP5A 4V0MA 3RJMA 2HWUA 3WK4A 1KXJA 2LGJA 2MSDB 1DKRA 3OJCA 2JIZA 1NVFA 2M6LA 3EHEA 1WP4A 3K8YA 4GWLA 5GJVC 5P8WA 1T8TA 1V1MA 1PJSA 1TC2A 4MB6A 3H3JA 3GCZA 4EMUA 1E2EA 1ESCA 4CI9A 2UAGA 1VQ1A 4HYYA 2VXOA 4HLNA 2IHTA 5A7HA 4UAYA 4MHOA 2P2GA 1PX2A 3OE7A 3MD0A 2O14A 4CV3A 5JD5A 4AJPA 1EGVB 4KK3A 2H1WA 2DC1A 2YJ4A 1DEAA 1XZCA 3C3JA 1G55A 2PMDA 3GMDA 4PGHA 4X45A 3KQPA 1DARA 3FWKA 3W2GA 2ZU6A 4IIXA 3DVSX 4FOPA 4ZXFA 2GN9A 3LDAA 3DZHA 3ZW8A 3DM9B 4BMCA 2C54A 5JALA 1E1DA 2D5IA 5LUAA 2C31A 2IBMA 1T15A 4MUYA 3IP1A 2PGDA 2G9NA 4DRXA 5JVDA 5JTUA 3AUAA 1BO6A 3NRJA 4GP7A 4CIXA 4D8WA 4DJTA 2KS6A 1NW7A 4I1PA 4JC5A 3NBXX 1KI6B 3AI2A 4YUZA 4HWSA 2XRFA 4FYIA 1E62A 3ZZ0A 2V0GA 3SAFA 4CMIA 4EFDA 4YRMA 1T36B 3BA1A 3HWTA 1JHDA 4N7MA 1GFZA 3ES9A 5I9NA 3DMGA 4A15A 3RHTA 4OSPA 2YINC 3O8NA 3Q3CA 3DMNA 3HKZC 4W8HA 2W0SA 1V45E 1ECPA 4EF4A 5HQJA 5BV8A 3KS9A 2Z5GA 4WLUA 2WJPA 2GTHA 2BAGA 2CKDA 3VNAA 1GG2A 4AL4A 1UC4B 1N5XA 4ZT3A 2B8NA 2R65A 1F60A 1W4CA 2ZRIA 4D8YA 1TM2A 1QTMA 2A9RA 2IYXA 2QLFA 4RE5A 2CFSA 3N2KB 4REOA 2V3CC 4YP9A 4PXSA 1SHKA 3ROQA 4E4YA 2MINB 5BRAA 5L6MB 2JMGA 2ATEA 3B1JA 4KMMA 4OH7A 4DKXA 2KE5A 5JOQA 4MAFA 5K01A 2ATLA 4DCSA 2DMRA 4LZGA 4IUDS 4GMXA 4UTOA 5AKHA 3G8AA 3SHTA 1I6LA 3K1TA 2ZB8A 3LL7A 4ZP1A 3D8RA 3RB0A 4TWBA 4LQ4A 3LY9A 5FTJA 4DSTA 5CA1F 1GU1A 4BX9C 4QASA 2APJA 2C95A 2FDXA 1VKOA 3LBHA 3QBEA 1HC7A 5J5VA 4U6SA 4POAA 4CEHA 4FMBB 2FI1A 1UBNA 1GGJA 2ZSIA 4H4CA 4M7RA 4PYRA 4R8MA 3JPPA 2P7HA 3N0RA 4YJFA 4UTPA 2XADA 3FSJX 4RMGA 1TKDA 4C78A 2BF4A 2FJ6A 1ZRMA 3TEMA 2RRDA 2B4YA 1SXPA 4GLLA 1QVZA 1C7YA 1WNFA 1NQAO 2DVMA 4DDWA 1OBCA 4OX9Y 1SIBE 3LBNA 4YJHA 4UAVA 4E0BA 3EMKA 5DBGA 4Z4HA 5I9MA 3QENA 3UJHA 3BTOA 2Z5LA 3ZCVA 4YVZA 1E6KA 3GQCA 2H9IA 3BH0A 3IDQA 2P77A 2P91A 4GMHA 4MS1B 9LDBA 1SCJA 2Z0MA 4LE1A 4MV6A 4QYXA 3K4GA 3WV5A 4CQMA 6LDHA 5J9FA 1PRYA 3A05A 4IXWA 1C8VB 4RZ2A 1OXTA 1EI9A 1EYZA 1PEDA 1Y37A 3B0YA 2H7XA 2WIDA 4M8NE 4P3PA 4RY2A 2JEIA 1YMUA 1W5TA 3G3EA 4PF1A 4BEBA 4MEXA 4FBTA 4QTUB 3MBKA 2K2WA 1F0KA 3DL0A 5HE8A 3BGVA 1ULTA 1XS9D 3MFHA 4IRKA 2FSIA 4DOMA 2VA2A 1Y1TA 1H2YA 2PPVA 4F4YA 2GEDA 1BTOA 2X5JO 3NJRA 3FPEA 4CFSA 3MWKA 3OFJA 3O4IA 1NQTA 3PQ5A 1WUJS 4O5OA 3KR2A 1RT9A 1E60A 5CJ2A 3KQMA 4JT8A 3TEFA 1UK6A 3L43A 1U48A 5DFAA 4EY4A 5KWJA 2LKCA 3A1UA 3BCUA 3N8IA 4ZALA 2WQ6A 1N3LA 4NYMR 3PF8A 1VRWA 5IDVA 2YHIB 5JCJA 2IY8A 1IQUA 2GZDA 4KVZA 1WABA 4H08A 4OGWA 4QLBA 3PI6A 1HDYA 2Q62A 2C4NA 5EZ5A 2DQNB 2XWBF 3LA8A 4EELA 2XGMA 4BLUA 1TW2A 2ERCA 5DN6D 1J8DA 3JAKB 1A1SA 4YMOA 1DEOA 4RDCA 3PGJA 2W9CA 3TXYA 5AVRA 3QBVA 1PK7A 2BPGA 3GUYA 4Z86A 1KZHA 1HOTA 2P2ZA 2VF2A 5LYJB 4ZT4A 5CT6A 4CEHB 3CNNA 1UMBB 1SKBA 2BWJA 3UAGA 1Y1KE 5EJ9A 5AOBA 5REQB 2O3UA 2H1VA 4E3ZA 2G1AA 3M2TA 1X3LA 4PPGA 4DIKA 4QHYA 1MAVA 5H5JA 3VH1A 4Z1OA 4JI6B 2PGOA 1PR4A 1A72A 4ETNA 4FZNA 2DQSA 4ZVNA 5CX1A 2WMYA 2LTAA 1OI2A 4YT5A 5IT5A 3GJSA 2OO3A 1ZCBA 4A1OA 4LV6A 4IR1A 3BMOB 5DDIP 5J2IA 1JXAA 2X9QA 3T3MB 4RJJA 1T5DX 2VANA 3IX7A 1UPBA 5FO0A 1MSWD 2VI5A 1MVOA 3FMIA 4QUKA 4WMLA 4JDUA 5LFAA 2Q50A 3U3MA 4CCWA 3CZAA 2PBFA 3EZ6A 3PDIA 3IMEA 5CXXA 1L1EA 1RXYA 1C5KA 2FZEA 2GN4A 4DSLA 4PLYA 4R1MA 5B7QA 2ZITA 1MW8X 1A9SA 1VJ0A 4CM4B 3W4JA 3HKCB 3D0OA 3QFHA 1MC1A 4ZT5A 2IU0A 2YB4A 5CM8B 1O7JA 1MF7A 2WWHA 4HSEA 2XO7A 4CRXA 4N6OA 2DOKA 1JLHA 1Q57A 1SOAA 2QUAA 4K6MA 4CIDA 2EWMA 1PGPA 3PW2A 2NZUG 4HQLA 4IX1A 3ISVA 4RTSA 2JBAA 2F8KA 1C3OA 2I8CA 4ETIA 1O96A 5EKDA 1UH5A 3WGZA 2W4IA 4FGJA 1X1EA 2BQUA 2W71A 4LGVA 3THOA 3QE9Y 1KETA 3C7CB 2G8NA 4PCVA 4NM1A 1OREA 1YU6A 2C3PA 3FVWA 1P7PA 3KB2A 3ZHSA 3TX2A 3LGSA 4UCXA 2PEZA 1FFSA 3ND8A 4RQNA 1D3AA 1M66A 1VCMA 1LSUA 2QT9A 1VG8A 2X15A 1FMLA 4XPIB 4EYGA 3WAJA 4N0DA 4R8RA 2JGFA 1SZDA 4GWGA 3WYDA 1FP4A 2BGTA 4UM7A 5L7WA 4WBXC 4Q02A 2PMBA 3U7QA 1H2XA 4FFRA 1V8ZA 5KYVA 4IQVA 1M75A 1E3WB 1MRZA 2WZQA 3DOHA 1N2EA 1U2EA 2P1RA 1Z4OA 1J25A 3RAGA 1RWPA 3SQXA 2UVPA 3PXXA 1C9NA 1MB0A 1LBTA 4QFDA 2GBLC 3VR0A 2WG1A 5T6BA 2F3NA 5IVKA 4FYVA 5DP1A 3SIPA 4LBZA 4QL3A 5L95A 1R6UA 1ORRA 3UMGA 1K0UA 1KU0A 5IMBA 2AEEA 3KWJA 2HHAA 4KXFB 5A3RA 3G0GA 1VSQA 1DTSA 2N1BA 1GA4A 2NO6A 3AWDA 2VCYA 1JJAA 3LSTA 3MSXA 3BH6A 2XGSA 2PGAA 4Q3KA 3QVLA 1EUDB 5FI0B 4A5SA 1M0WA 1WQ4A 1Z6QA 1QYVA 2P4SA 4RNNA 4H4EA 5JAZA 4IINA 3HW8A 2VJPA 3JQBA 1E69A 2W2QA 3QU4A 1PW5A 4CGYA 3Q9NA 3PYXA 1RWNA 3GC6A 2IV2X 4P1ZA 5ARCA 2WE7A 3EXHA 1I7DA 1JF8A 1YZTA 2VHCA 3CNLA 1REQB 4UBKA 4FQ7A 3L7LA 4ROSA 4CQLB 3UAYA 5F1PA 3W7AA 3B9QA 3UT6A 5KMGA 3W5UA 4JAVC 2IZOA 4FNOA 5LP6C 3WLMA 3DQPA 2AWOA 1TU0A 6ADHA 5B2ZA 4BFLA 5DK4A 1WLSA 3ZEAA 3OQVA 4K2HA 3T5BA 2JLVA 4NY8A 4MCIA 2VKTA 4O33A 3DEAA 3PWSA 4PZDA 3IT0A 1KAMA 4XCVA 4MFCA 4J2HA 4U2CA 4D25A 4K3VA 5TMBA 4J7XA 2J6UA 1E8MA 2FZCA 2HIGA 3DFKA 4R7TA 3H1AA 4JGBA 1KY5A 3WA7A 1EFVB 1NZFA 3U7HB 3QU9A 2EBWA 2SECE 1F2TA 2V7UA 2VXCA 2XCIA 3AYZB 3GCGA 3H17A 4M4SA 3DE3X 4LISA 2J6BA 5LJIA 1L9KA 3GJ0A 4MDHA 2OEHA 1H23A 1RSZA 2GF2A 3ICCA 4RZHA 4DL9A 5FORA 4ECRA 1OFIA 3O21A 1LRKA 2R1UA 4ZVVA 4PIMA 2E1EA 5JY6A 2I29A 3GEEA 1UEXC 5EA2A 4RQ4A 1K4YA 5AVKA 2N75A 3KJZA 8LDHA 1ZKDA 1IM2A 2RBEA 2G77B 5GMOA 2R8EA 2QTAA 3GUZA 4QBKA 5SZJA 4KLLA 4ENPA 2VPTA 3C3DA 3PL5A 3J81A 2DPYA 1K3UB 2VDWA 3NBZC 1RRVA 4RHFA 1E8NA 5A9TA 2Z6QA 4Z8XA 3KD2A 4IZOA 4PZZA 3GXBA 3HFJA 4MKRA 1HEKA 3ZLVA 2CRXA 4Z4GA 2J7PD 3QVMA 3JV7A 1KH1A 1AKMA 4YMNA 3P45A 3NO4A 5A2QA 3NXKA 5HF5A 5L8VA 4IBOA 1UC8A 2PT7A 4IL5A 5TQ2A 3ULKA 4B4DA 1KPGA 1K4KA 2FETA 3GDFA 3ZCQA 2C7PA 1TM5E 3EDOA 4GLJA 4GMGA 1KK1A 3IVMA 4HWTA 4W5JA 5GJBA 3CGWA 5HKAA 1GN9A 3T5LA 1Z0FA 3SPXA 5LWHA 4GM0A 4GECA 2AYYA 3GLGE 3R5FA 1KE2A 4PG8A 2J6IA 1P2VA 3OMWA 1MJHA 2QUKA 4ATNA 1EUDA 2OFWA 1WDKA 1XCJA 1W0JD 2DQZA 1NR5A 2PU7A 4IQTA 3ODGA 2ZCUA 2EGHA 3ZK9A 1SQ0A 1Z2DA 4DMHA 3HBNA 4DWWA 1ZMTA 4V1CA 2MU1A 3TSOA 4IIHA 5AHKA 5AKJA 2HCFA 3PSIA 5ADWA 4LJSA 2VA3A 1DCKA 1H22A 1VKNA 3NT2A 1M1NB 3LPLA 4A9AA 1RWXA 2VZEA 3KHRA 5EHQA 1KHHA 3B2EA 3V8VA 1CRPA 4G5GA 1NR7A 4UZEA 4GPIB 3B3AA 2NRXA 1O94D 3W78A 1YOVA 4GE3A 4YV7A 2R8BA 3GJTA 3CO5A 5HOEA 2QN9A 3B9PA 5HRUA 2OOKA 1L7BA 2VNHA 3DZFA 1DVRA 5KAMA 5FUQA 2Q6IA 3VSAA 3N28A 3ZR4B 3PSAA 1OAKA 1DDGA 2QRKA 3HU1A 1G2IA 2YIJA 4PQYA 4UJ5A 3DZDA 3SSMA 3VJRA 3QZ8A 1BE6A 2OR3A 2CMFA 3DWGA 2CCKA 2FZKA 4BAUA 3AT1A 2QRMA 3O1JC 4HNGA 2HPHA 2J9FA 1X94A 1ILEA 3ZE8A 4BATA 2YFYA 3BBLA 2ZZNA 3WRXC 1L4LA 4EG6A 4KIUA 1GUYA 2NXEA 1PJ8A 4IHJF 2IELA 4CNBA 4O3PA 3CM0A 3HGQA 4BFYA 2C77A 5JSHA 1GM5A 3KUCA 1P17A 5L3ZA 3NX4A 5SYNA 1TJ4A 1YL5A 1N5MA 5E1BA 5EJMA 4C6RA 2YIMA 4CMKA 3DR5A 4A0FA 5T7BA 3FSGD 4EG1A 4FZLA 3H5IA 4WJKB 2PZKA 4YJ3F 1EKXA 5DYIA 3H97A 4O1MA 3I39X 4MWCA 521PA 1BDHA 4NYJR 2FWMX 1HT1E 1RAHA 3O82A 3RB8A 4Q48A 5ECGC 1EDZA 2OHGA 1T5LA 1U9IA 3WK9A 1T9KA 3P9IA 1E9VA 2D1FA 3D3QA 5A02A 2Q2NA 2XGPA 1UDAA 2PRZA 3GBVA 1M1UA 3THXB 2ZE7A 4GSKA 2OZLB 3NOXA 3B1FA 5E6RA 1ZRSA 4F8EA 3UFXA 5J47A 5ALUA 2JJ1A 5KU7A 1G3MA 5HF6A 2DPIA 2MJLA 4ZQFA 3PQ4A 1NIJA 2WY2D 4RH0A 3ZXIA 2XB4A 3CJRA 3GIIA 3DMTA 3E84A 4MI3A 4BWMA 1F44A 3FIJA 1GJRA 3MB5A 4OPMA 3TQSA 1B23P 3QXHA 3G82C 4YALA 3I8XA 4IQ0A 2PI5A 2B69A 3W79A 4YT8A 4EUSA 2ZZMA 2G4CA 2X7JA 1CDOA 3DEKA 3HYCA 3ZDFA 2ICAA 3H8VA 3A10A 4BO6A 2WU1A 5D6NA 1BGVA 2WNIA 3VHQA 4AC9A 3H4BA 2WJVA 2HHXA 4NK4A 9MHTA 1M1NA 4AMVA 3QLVA 1DAOA 4HRYA 5IJ0A 4V0KA 4MPPA 5LA6B 1ZNWA 2W6OA 1V5FA 5IVIA 1FX0B 2Q28A 5HM8A 3CYFA 4FYHA 4YAFA 3ADDA 3ZWQA 4MVCA 2OAP1 4O02B 2XEDA 3BA6A 5CHGA 1O6BA 3G9QA 5AKXA 1H0SA 4OA5A 5AVYA 3PUJA 4PAWA 1G7CA 1MO3A 3DE6X 3H99A 2CJXA 2AXPA 2FN7A 2WNHA 2Q7OE 3AEZA 4QDJA 1HR0B 2YHIA 2Z9DA 3GNTA 4WUTA 1ZBDA 2W9MA 2UVWA 2BEWA 3GNLA 4MGEA 1F14A 1BA3A 5KFRA 2ZBQA 1AV7A 1CJBA 1ODTC 4GGMX 1PFVA 4PZOA 2I6TA 1XWFA 4ZDJA 4G4SO 3T5AA 3T7CA 3STHA 5DXJA 1ZQIA 2JKYA 3E82A 3WYGA 2FN4A 4Q4JA 3ABIA 3IQXA 4KLCA 4QX6A 2DAPA 1E4EB 1NZDA 2IXEA 3PRYA 2XY5A 1GXSA 1QFXA 4IIFA 3ZNOA 4PGQA 3K09C 4Y8VA 4KO8A 5E4JA 4EY8A 5TIIA 1B6RA 4ELVA 1Z5GA 3TRHA 4DCPA 1PSZA 1TVMA 2YJTD 4UHEA 1GRCA 4EG5A 2FF7A 3UK6A 3S5JA 1AGXA 2QLJA 1BYUA 3MFYA 2TSYB 1Y89A 2CHGA 1NF8A 1XPUA 2GAAA 5IINA 1KPIA 2KZMA 2W6CX 2AOUB 3ENZA 3T5PA 4KRXA 2FWRA 5I7AA 1ZCAA 4RK7A 3HJFA 4GUDA 1U8ZA 2HNKA 1J2MA 3U4IA 3W77A 5H4GA 1GCAA 3FNHA 3RVLA 1NBWB 3HL0A 2VZ8A 5JZSA 1OVGA 2O4CA 4TRMA 3VR5H 3O8OA 1UBHS 2F9FA 3IPLA 3QFTA 4NOJA 3O2QB 5BN4B 5HJEA 3ER6A 1M2HA 3OQPA 1N6RA 3NVVA 1ZQAA 3IM1A 3L1JA 3PNLA 3FWZA 3GARA 4PLFA 2QPOA 2IP2A 2PUTA 4H7PA 4UB6U 5IZCC 3ZVLA 1KY2A 1LTKA 3Q5DA 4C2TA 1R5BA 3EZXA 1NMQA 2WLSA 2JEJA 2TYSB 3OEED 3MUFA 3QFCA 3HYSA 1S3FA 4GPZA 3L0IB 4UAUA 1Y3AA 2Q5CA 1L5QA 4MJ3A 5DZSA 5EEGA 3WGGA 4UFPA 4YAUA 3ZDEA 3PVCA 2GKSA 4CTKA 3S68A 3OKPA 4XSGA 3N2GA 4G5FA 4G0QA 3LUAA 4KTTE 2UXBB 3QPBA 3SLRA 3BHJA 4BNVA 3FTEA 1H9AA 5IK2A 4X7MA 3HKDA 1I32A 1KYWA 1KQNA 4E2WA 4RANA 3OZFA 4QTYA 2C7QA 4LZDA 3ON5A 5LXTF 5C1OA 1YI8A 4OD0A 3H4DA 3AEUA 1JTEA 1M76A 1C3EA 5EN4A 3OO0A 4JBHA 2O8DA 4N5IX 2IXGA 3OKAA 5FDFA 3O90A 4X6UA 3ZHUA 1EMDA 3VR6D 1ZCZA 3MGAA 1SXIA 3V1MA 4K6HA 1E3WA 3EZNA 4RKQA 3GLHB 4NCXA 5H2FU 4XM1A 4ZHQB 3CS3A 3A1VA 1P9OA 2ZYAA 1K8ZB 1WZUA 3MCAA 3WL5A 2QVGA 4Q6BA 3VISA 3G1UA 3TLMA 1XCPA 3DF9A 3VGJA 1TTQB 1T4CB 1MB4A 4MKIA 4Q9NA 4UBCA 2PJDA 3EA5A 3TSAA 4C4AA 4XQ0A 1ABBA 1E5TA 3UANA 3L6BA 4CG2A 1XKXA 3AR3A 2I7DA 4Y7DA 1YHYA 3GJZA 4EJ2A 4MPTA 4UHDA 4RORA 3MJCA 4DJJA 3JYHA 2YV1A 2DH5A 4AN4A 3E23A 4AZ0A 4KC0A 2MSKA 1Z16A 1UDBA 3TFOA 3DW1X 5A1TA 4DQPA 4KQFA 1M10A 3QIVA 5EXSA 4KCGA 4J3NA 3AVUA 2NRWA 2V6BA 3TNDA 4MRMB 3E53A 2A94A 5JSFA 4QGAA 2B37A 1C9MA 3RF7A 3LT5A 4LNUB 4WKCA 2VTDA 3B36A 5L1MA 4G1MB 3QG5A 4WFIA 2AXTU 2AD1A 4DJ5X 3WL7A 2R2GA 2HOQA 1S6YA 1NXXA 2Y1FA 3I52A 3P0HA 2EYUA 3AU9A 4Y6PA 4AJKA 3VC2A 1N2CE 4PC3A 2E6KA 2FLVA 2VDPB 3HHEA 3WL4A 1C7RA 1QOZA 3F6CA 3PTAA 4EHBA 3LU1A 3CKLA 4DT1A 1Z83A 2EJCA 4DYVA 2QL6A 2XZOA 4BS9A 5JW6A 2REXB 1U0FA 2WU3A 4H3VA 4B3HA 3VYVA 2NX2A 4OATA 4RFSA 4UMDA 1PZFA 3AR2A 2EGGA 4PSVA 5TQVA 1WU7A 2ZYWX 4PINA 1ZL2A 3F7OA 5DEOA 1XDDA 3UJ3X 4BKRA 2ODGA 3PUZA 3WK6A 7ICJA 5I5GA 1K0FA 1J06A 221PA 3KT8A 4FZ3A 4ED8A 4JJ4A 4BFCA 3W5AA 3E7PA 3QLUA 3WGTA 2AMVA 1TMOA 3O95A 2C04A 3WIBA 3JQAA 4DADA 4CKZA 2A9PA 2AS0A 1DOQA 1I3OA 2DKZA 1F6DA 2JW5A 4F4KA 1ZAKA 2LDBA 4MO9A 3EFBA 4RSHA 4TLDA 4WDRA 3R3VA 1OX6A 1MJ5A 1JYFA 3CPJB 5DTMA 2Y1OA 3SFVA 3LCVB 4AS3A 4F4CA 2OP1A 2GJAA 3PEUA 4KIGA 3ZH2A 1P0IA 3SSAA 3MNFA 3SYTA 4XCQA 4XWYA 4D6PA 4NPCA 1IM5A 1YU9A 3KKQA 4C20A 2H2FA 3MTIA 3TIXB 3GLHA 4W63A 4ECTA 1I1HA 4E6PA 2ZCVA 4BVAA 1QMPA 4O3RA 1JDSA 1DBIA 1NN3A 1MIHA 4UBNA 3MCWA 1QGDA 2WSYB 1Z0ZA 2KNJA 2NYVA 2CXQA 2J3KA 2VK1A 2W03A 1P81A 1F9EA 3BCRA 1XZHA 3X1JA 1FYEA 1PV2A 2C9CA 8ABPA 1MGOA 2WKSA 2FX3A 4OI4A 4RSMA 5J5CA 5U4QA 4FN5A 1KDZA 4B3JA 4KLSA 2BKAA 4AQ7A 2WUGA 3H1BA 3NJ4A 3GBPA 4WKBA 4XJSA 4XR9A 5DTRA 3ZD9A 2C2GA 2P3SA 4LE2A 3H9CA 4B4UA 2JV3A 2DLCX 1XXLA 2R62A 3IJ5A 4FLEA 1RWQA 3AY3A 1ZJMA 4JQCA 5H9WA 2A9OA 3FN4A 5FUYA 1PTKA 2D54A 3UNXA 4CTNA 5A9SA 2WI8A 2ID4A 3DE5X 3KFLA 4MIEA 1FO4A 2CLLB 3S70A 2KHZA 3F2BA 3BZBA 1GZ4A 3V46A 1DQSA 1LF0A 1U8EA 1NC3A 1ZBQA 3LNCA 1E2BA 2PCLA 1QHFA 3T3GA 1GDHA 2IFTA 3AEQA 4LXGA 1WBJB 1PQUA 4QSMA 1QH0A 5BVHB 1YF3A 2C9MA 1PWEA 1LK0A 4LDNA 4HC4A 4ZU6X 4O2AA 2C0CA 2GD0A 5SY4A 4HGPA 5KQLA 1RPLA 3G5AA 4C7JA 1PV4A 4BFTA 1RHKA 2VAWA 3H8MA 1UBEA 3KL2A 4URZR 3UV7A 1RS0A 4AURA 1R6DA 3S8EA 3GT7A 3M8RA 1VRCA 4N82A 4YMSA 4DUYB 4CEIB 3BZUA 1AXEA 3CRRA 4IYRA 1W19A 4HDNA 4MQLA 2VRWA 2ZVPX 2XXBA 3RFUA 5AKLA 4DVJA 4FK8A 1PG2A 5FWYB 4W9NA 3ZCUA 3R9XA 2IS1A 1YDFA 4TUSA 1BS1A 1J0CA 1EZZA 2C7BA 1R6TA 2FN3A 4RYLA 3HDVA 4FINA 2RJ3A 4PQGA 4R54A 4YI3A 1WD7A 2QZSA 2FE1A 3JQQA 4J4HA 3UOGA 5J2UA 1RWKA 3JWGA 4US1R 2KZZA 2HHJA 2WM2A 4Y2QA 4J9RA 1QZUA 3RE1A 1X0XA 4N12A 3TKAA 4EYHB 1FDVA 4IIJB 4PG6A 4QUGA 3C45A 2ESRA 4Q4JB 1T4CA 2P4EA 3JWEA 4ZAVA 4WJLA 3ZBUA 1N57A 1GYPA 4Z0TA 2I91A 1OILA 1KO7A 2NTJA 4L3WA 3FZGA 2Q3BA 4NY1A 5E6RB 3E48A 5FOWA 5FOVA 5IVDA 1A9XA 1R6VA 3FVRA 4D4MA 1XLWA 3I09A 4TMZA 1HNNA 3MB8A 3U4MA 3CH7A 4M1YA 2HW8A 4BNYA 2XCOA 1D2NA 1DCTA 3B6KA 1VHJA 4ED0A 3G8BA 4FS3A 4PZNA 3IEUA 1X6JA 4D99A 2A5YB 5TMPA 4ZARA 2WHEA 2MWMA 4G24A 1ZQDA 5DX0A 2B1QA 1JAIA 2IXBA 4OCZA 2W9AA 1MB3A 3BMCA 3DVRX 3CW2C 3OETA 5H3HA 1AVTA 4MITA 2ZRBA 1DXHA 4AJLA 2ZTDA 1OWOA 4V0RA 1OYOA 1H8HD 2VWPA