3DV9A

Putative beta-phosphoglucomutase from bacteroides vulgatus.
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
246
structure length
243
Chain Sequence
SNAMFKEAINNYLHTHGYESIDLKAVLFDMDGVLFDSMPNHAESWHKIMKRFGFGLSREEAYMHEGRTGASTINIVSRRERGHDATEEEIKAIYQAKTEEFNKCPKAERMPGALEVLTKIKSEGLTPMVVTGSGLLDRLNHNFPGIFQANLMVTAFDVKYGKPNPEPYLMALKKGGFKPNEALVIENAPLGVQAGVAAGIFTIAVNTGPLHDNVLLNEGANLLFHSMPDFNKNWETLQSALKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords beta-phosphoglucomutase
publication title X-ray crystal structure of putative beta-phosphoglucomutase from Bacteroides vulgatus.
rcsb
source organism Bacteroides vulgatus
molecule tags Isomerase
total genus 76
structure length 243
sequence length 246
ec nomenclature
pdb deposition date 2008-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3dv9A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3dv9A01
4XPZA 4UW9A 3W5BA 2NO4A 5IT0A 3HLTA 1AQ6A 1XVIA 3ED5A 1CR6A 4BYGA 4MWOA 2JAWA 2WHEA 1NNLA 5ALNA 5AKKA 5ALRA 1YNSA 3EPRA 3L1VA 1L7PA 2HI0A 3ESRA 5A3RA 1Z4PX 2I7DA 2RARA 3ZU6A 4FFDA 4BNDB 4KNWA 1Z4NA 2P11A 3HYCA 5E0OA 3UMBA 5ALUA 5AHXA 2RAVA 4UATA 4AS2A 2MU2A 1X42A 4UARA 3ZUPA 3QYPA 5AKEA 3R09A 1ZRMA 1SWWA 1EK1A 3B9RA 4GXTA 5FP0A 2HO4A 1O08A 1S2OA 3ONNA 4KN8A 3W5AA 3ZX4A 4YGYA 4Y2SA 3N07A 2C88A 2YJ6A 4UM5A 3UMGA 3SKXA 3AR2A 3ZX5A 3AR6A 3WK7A 2CFRA 2OM6A 3KBBA 3ZVLA 3ZVMA 3EF0A 3QU4A 1QQ7A 3MN1A 4NAVA 1S8OA 5AIAA 3WK9A 3ZI4A 4UAUA 2WF9A 2B82A 3U19A 3ET5A 2HHLA 2HX1A 2ZBDA 2YY6A 5AM4A 2HEGA 4BNDA 4HGNA 2R8ZA 4CF3A 3AR9A 4C4TA 5ALWA 4EX6A 3QU9A 3L0YA 5AVXA 2YN4A 3ZTYA 2ZG6A 3B8EA 4NV0A 4QJBA 3DAOA 2YMMA 1Z4LA 4PNHA 2GHQA 5AVWA 3W5DA 1T5SA 3MC1A 5AVQA 2GO7A 4DCCA 3QUTA 1T9ZA 1YS9A 2BY4A 3W5CA 4YCMA 1K1EA 4O8CA 5T41A 1ZD4A 5AKGA 1ZJJA 3FM9A 4Y2JA 3NRJA 4HYTA 3NUQA 5ALQA 3ZW7A 3I6BA 3M9LA 5ALFA 2I6XA 5AKJA 3N8GA 1JUDA 1MH9A 3EWIA 3A3YA 5AVSA 3L0CA 2ZBFA 4ZEXA 2Q5EA 4BKMA 1L7NA 3ESQA 1RLMA 2I55A 2FI1A 4BBJA 5AKYA 4HAIA 1ZOLA 1Z88A 1Z4QA 1Y8AA 3P96A 1RKUA 4C4SA 5AI8A 4Y2XA 1EK2A 4ZEWA 3L8GA 2AUTA 5AW2A 5ALOA 1U7OA 3AR8A 3B9BA 3IB6A 3SF0A 3VAYA 5IT4A 1L8OA 1QQ5A 5ALJA 3E84A 2W4MA 5A3SA 1ZS9A 4UM7A 2B0CA 2I54A 3DV9A 4Y2UA 3WKCA 4XQ0A 1WZCA 1L7MA 1WPGA 4KX3A 5AW3A 2WM8A 2WFAA 2G09A 4AP9A 5ALKA 2PKEA 2R8YA 4HGQA 3WGVA 4J2TA 5ALDA 5AKXA 4YIHA 1Z4JA 4I9GA 5AW1A 5AI0A 2HF7A 2FUEA 4UAVA 4YIKA 2OYCA 3QU5A 3FPBA 3QU2A 3AR3A 2IA5A 3WKAA 2YFYA 5AI5A 3NIWA 2G06A 1PW5A 2HF2A 1L6RA 4BX2A 3OCUA 3OCXA 5AW6A 5AM5A 4B6JA 1ZD5A 1U2TA 3M1YA 5AM3A 5AW4A 3KZXA 5AK5A 5IS2A 1ZD2P 5AW5A 2R8XA 3L0BA 5AKZA 3FVVA 4AS3A 1YMQA 4GIBA 5AW8A 2WF6A 2X4DA 4DWOA 3WKBA 2YJ3A 3U7HB 5AVYA 3E58A 3WK6A 4J03A 2PQ0A 3QGMA 4G9BA 3EF1A 3KD3A 1TE2A 2HSZA 3NAMA 3D6JA 3OCZA 1T5TA 1RLTA 3IJ5A 3J7TA 4E88A 2HDOA 2W43A 3CNHA 3L8EA 5ALTA 5AVZA 5ALXA 4EELA 3WK5A 4KX5A 4HGPA 1FEZA 4DW8A 3UM9A 3ZVNA 3U13A 4YCLA 2O9JA 5AVVA 3OPXA 3RF6A 3I76A 3L8HA 4YCNA 4DFDA 3QLEA 3GYGA 3PCTA 3SHQA 2B8JA 3SD7A 5ALZA 2EATA 4OFZA 1Z4OA 5AIBA 4KNVA 2AH5A 5ALLA 3S6JA 3MMZA 2OA0A 2CFSA 1RC8A 2QYHA 4UMDA 1NRWA 2B1RA 3L8FA 3AR5A 3ZWKA 1RDFA 1WR8A 4CE6A 4CNQA 3L1UA 1KYTA 3A1CA 2PR7A 3MPOA 3QUBA 2ZBEA 4IFTA 3NANA 2BDUA 2FPSA 4UASA 3QU7A 3BWVA 3N28A 4I9FA 3L5KA 3I28A 5ALGA 4BEVA 4CF4A 5AVTA 1IWOA 5AI6A 3SLRA 4OCZA 3KC2A 4FYPA 2Q4TA 2DQSA 4L57A 1YDFA 3AR7A 4F72A 3QNMA 1Z4IA 5AK6A 1J8DA 1O03A 3KOOA 2P9JA 4L6AA 1VJ5A 3A1DA 3U26A 3QUQA 5AVUA 4NFLA 5AK4A 4HGRA 4Y2PA 5ALYA 3NALA 4UMFA 2WF8A 2IOFA 4MUMA 3DDHA 5ALMA 2JGAA 4EX7A 1TJ4A 1XP5A 4EENA 2ZOSA 1N9KA 3IRUA 2JAUA 4CF5A 3OCYA 1TA0A 2CFTA 3F9RA 2B1QA 3E81A 2YMLA 2HCFA 4XOUA 2B8EA 4EEKA 1U7PA 4ZEVA 4C4RA 2AGVA 4UU1A 2MSNA 3PDWA 1U2SA 3PGLA 5AESA 4RESA 1N8NA 3U7GA 4UU0A 4BX0A 4Y2TA 2ODAA 3N5KA 5ALHA 3KDPA 2BDEA 2C9MA 4UMVA 1QH9A 3DNPA 2Q4RA 3WKEA 3WKDA 2G07A 3FPSA 4RETA 1YJ5A 1F5SA 3WK4A 5AM2A 2R8EA 2RB5A 2MU1A 5JJBA 2FDRA 2G08A 2GMWA 2C8LA 2P69A 3WK8A 1LVHA 4FE3A 3U7FB 1RMTA 2ZXEA 5AK3A 3OTQA 2CN1A 5AM0A 2D2VA 4NABA 1L7OA 3FZQA 2OBBA 4JDPA 2YBDA 2EAUA 2VKQA 2C8KA 1VJRA 2GFHA 3K1ZA 3OCVA 4YH1A 4BX3A 2G1AA 3RFUA 1TJ3A 1Z4MA 3CZ4A 3TLMA 1J97A 1NF2A 1U02A 3WGUA 4KYTA 3N1UA 4H1WA 1SU4A 5AICA 5AI4A 3U7EB 1YV9A 3ZWDA 1RPZA 2FPWA 1Z5GA 2G80A 2EARA 1LTQA 2W11A 2WF7A 5AKLA 5ALIA 1RQLA 1CQZA 1VFPA 5A3QA 1QQ6A 2WF5A 3QUCA 4F71A 4UMEA 5AKHA 3SMVA 3QX7A 1RKQA 3FGOA 1QYIA 1SWVA 3SKYA 1TJ5A 2NYVA 3PGVA 4HGOA 3L7YA 3I1YA 5AW7A 4EZEA 2NO5A 2QLTA 1ZD3A 5ALSA 2AMYA 2YJ4A 1RMYA 2JARA 3NASA 4QQFA 1Z5UA 2YMPA 5AKIA 5AM1A 1XPJA 2YMQA 4XE5A 5ALPA 4IG4A 1RLOA 2FPRA 2P27A 2YJ5A 4G63A 2GHTA 3R4CA 2HOQA 2B30A 3R9KA 3AR4A 4Y2QA 5ALEA 1Z4KA 1RQNA 2FEAA 2FPUA 4OHFA 1RKVA 2IYEA 1Q91A 5ALVA 5AW0A 2I33A 2RBKA 3ZTWA 4Y2VA 2ZBGA 2FUCA 3OCWA 1ZRNA 3QXGA 4OD0A 2JAOA 2IOHA 4BEWA 1WVIA 2G0AA 4Y3UA 4Y2YA 1Q92A 3BA6A 3A1EA 3UMCA 4L6CA 4JB3A 5AW9A 4Y2RA 4NWIA 2I34A 2IOFK 5AI9A 1RMQA 2O2XA 3ET4A 5AVRA 1RRCA 1L8LA 2C4NA 3E8MA 2FPXA
chains in the Genus database with same CATH superfamily
1P7WA 2WV7A 3JPPA 3HLTA 1G2IA 2C5AA 3QA3E 2CHEA 3NT2A 3GUUA 1MVNA 2R68A 3EG9B 1FP1D 2RARA 4B82A 4FFDA 4EAQA 4KLDA 1X1QA 5A62A 4BB9A 5K0LA 5ALUA 3P2KA 3ZUPA 1L4FA 4NE2A 1TGVA 4Z8XA 3K05A 5GVSA 2BCQA 2OHVA 1TVMA 4JXJA 4IQVA 4I2VA 3EWNA 3V4RA 2HR1A 2QARB 4P32A 1WNFA 4LOHA 4DFPA 4LISA 1IM5A 5B3JC 4AT1A 3IO3A 3M6MD 4AYWA 1RG6A 5JNLA 3SAFA 5TT0A 4WQMA 3QHAA 3GARA 5AJVB 3LPLA 1A04A 1XGKA 2I65A 5IUNC 5JNWA 3CVOA 3TQIA 1G21A 2V9CA 3UGJA 3NP9A 4YRPA 3Q2KA 3D0OA 1V43A 4KVFA 3HV0A 2R60A 4EYKA 2YNMC 3L0CA 2OBYA 2Q2NA 3X1ZA 3G23A 1A8QA 5FTMA 3N0WA 1Z4QA 4OO1J 1SD2A 2FPGA 4KIGA 2P9HA 4O4IA 2QF7A 3JXEA 1N6LA 2XXAB 5GONA 1OXSC 3WLLA 2PBLA 4U2KA 4C03A 4E03A 4KMSA 5B3LA 2PKWA 4GKJB 5TC4A 3T7IA 4ACOA 1MC5A 4AW9A 4YCBA 4D5GA 1R2QA 1TOAA 2VQFB 4OMCA 1YVEI 4IIDA 5FNVA 2E21A 3FW1A 4TMKA 3THRA 2FHSA 2LYBA 5DG9A 3QK7A 1VG9B 1JHZA 4QJIA 3V34A 1KIMA 4XWKA 1GUFA 4PQRA 3KCNA 2OZEA 1U5CA 1MRNA 3AEKB 5TARA 4OQZA 2C22A 2J4DA 2BKVA 4KE8A 5JIBA 1UPFA 1JQAA 4JUZA 3BDVA 1C30B 5EJ8A 2OQIA 4RK7A 3UMVA 3ZDYB 1HM5A 4J3FA 4ZQFA 4MW4A 4Y9TA 3AEQA 1FX0A 2EATA 2MHCA 3RWBA 5AIBA 1LU9A 1SA0A 5ULLA 3O3MB 3CISA 4MLZA 2O19A 1KKMA 1EGVB 2YZ7A 1OIVA 3HJBA 1HTWA 4WBNB 1V7CA 5CA1B 1L7RA 4EHHA 3NHJA 5I47A 2HQ1A 3KUCA 4G4GA 2EFGA 4EYGA 3QOWA 1FFWA 3S1AA 1WKBA 3IEXA 2HCBA 3DLPX 1OFIA 3GPBA 2PL9A 1WVGA 2D1RA 2X0DA 1Y37A 3HCDA 3HXLA 4H16A 5BN3B 1FCJA 4PG6A 2R8IA 5HTOA 3DCNA 4HEHA 5AESA 1DCMA 4G07A 7ICPA 4LF9B 5J2GA 5DM1A 4P4GA 1KDOA 1A9PA 4ZI3A 1XNSA 4L9WA 2M98A 2OGWA 5TV2A 1GKKA 3WK8A 9ICNA 1PF7E 3I01M 4YT8A 4JLSA 5FPYA 4HFNA 3FRJA 2QPTA 5EMNA 2EFDB 2GN6A 2GA8A 4U00A 2XF2A 3UWKA 2P5TB 3BJIC 1I4DD 3ST7A 4TTPA 1HEUA 1F60A 4B7XA 5HILA 5AI4A 3HVIA 1RAFA 4TTTS 3EY9A 1WMSA 3BRSA 1N63A 4P3PA 3LXUX 4RT2A 2KMLA 3KWLA 1QLNA 5I48A 3D2BA 3TINA 3D02A 4X92A 5ER6A 5K4AA 1ENYA 2KG5A 4PG7A 1ZM4A 1IYZA 1PZHA 3JQAB 5BY2A 2ZTHA 3QQ5A 4LJ8A 4F12A 4LDPA 3O26A 2GHTA 3G8CA 1L5VA 3ZCXA 4C5BA 2IU6A 5H70A 1QRDA 4IUYA 2V59A 3IEPA 3VU9B 5KTYA 4CN9A 1QHHB 1P0QA 2WD9A 2QYSA 3CR7A 2ONZA 2IOFK 1N33B 4MO9A 5IXYA 1MPXA 3BJRA 5HYVA 1QYCA 4G1BA 4L2IA 3KPJA 1T1GA 3KAJA 4XGIA 1NVVR 4NL9A 4NBSA 2JW5A 2MTBA 3B48A 5C4IA 1ORIA 4GLXA 1RYYA 3NAGA 1NLUA 3G85A 4U5QA 2JBAB 4OTZA 2G9VA 4LJAA 5TGZA 2K8AA 3M2TA 2QX6A 2XKBA 1QQ7A 2BEUB 1S8OA 2Q28A 1JN0A 2BGRA 3R0QA 5DTRA 1IUKA 1VPVA 2WUVA 4KC0A 4ZO7A 3TQHA 2G5CA 1DADA 4OO3A 3I58A 4MV8A 4O29A 1T2UA 1HE1C 4RD0A 2P9EA 3B38A 1FB5A 4DCCA 3IBYA 2ISOA 3VUEA 4H2DA 2HN9A 3CSUA 2IYRA 4PAWA 1UADA 1O9HA 4CU5A 4QU9A 1I3LA 4R2JA 3ZKAA 3VKFA 5CB4F 2G8NA 3ICXA 3EFEA 4LGVA 5FR1A 3EFBA 1GZHB 3P2YA 5D87A 1G16A 1D4FA 1NUPA 1PKXA 1R0RE 5C53B 2QRKA 3WYDA 3L4BA 3E22B 2H2FA 2UYOA 2QUJA 2R5FA 2X9LA 1M72A 3DGFC 2CHVA 4WX2B 1JH9A 4IRCA 3N75A 2XCUA 3I2YX 4GVPA 3IAEA 4KYIB 2JLSA 4M7WA 4WE3A 1PVVA 3ZWCA 3MELA 1CUVA 4LWOA 4BE9A 2ZTSA 4EUHA 4B4OA 4HG2A 1DNPA 1QIKA 2GB4A 3DXYA 4N0MA 4J2TA 5ALDA 4Q02A 2VJOA 2VDWA 1M1XB 1H2AS 4YIKA 3F5EA 1C7EA 4XUSA 3ZHBA 4P35A 2DH6A 1UOOA 1T5LA 5D6NA 3RRHA 1G2OA 5KYKA 3SC2B 5EZQA 1LLCA 2B37A 4N6OA 5AW8A 3HDTA 5T14A 2NU7A 3ADBA 1NYLA 3GAMA 4OHYA 4D8UA 1ILEA 1L8XA 3LVVA 5KPJA 3L8EA 1GDDA 1H66A 3P97A 4C21A 2FUG6 4BAZA 1D03A 1PRYA 4U9IS 4ZT3A 2WP8J 3EJWA 3ZZTA 1TUIA 5ALZA 1Z4OA 1WF6A 2AH5A 1Q1GA 4FD2A 1E89A 3H3JA 1P1BA 2DECA 4UMDA 4ED0A 2Q3JA 3EOZA 3MQFA 3DQZA 1E32A 2KVCA 1CUZA 3RBVA 1K8RA 3IJRA 4AKHA 4OHMA 1EUZA 4B76A 3BB3A 4MDHA 4NMWA 4EIWA 2KHZA 3OLYA 2GBGA 1R8XA 3FHOA 3QUQA 1PZMA 3ICQB 5CX1B 1KC3A 2IU3A 3VVBA 2Y9PB 4XW2A 1KRHA 4YRTA 3LOPA 1TAMA 4RBNA 4XYMA 1ZM3A 3C2LA 2I6GA 4ZFNA 2X7XA 3S3TA 1G5TA 3KVYA 2ALZA 3DNPA 4FLMA 2W9MA 3WKDA 2WB4A 1O57A 2GK3A 3WV5A 1BHQ1 3S2UA 1R10A 1PK1B 5LR6A 3KSBC 3LA8A 1JQEA 4QAQA 1KU6A 2H48A 3MFHA 2VSYA 4UNRA 1QTQA 5L53A 2WHRA 1SU8A 4MIKA 4LF8B 1NUQA 1A88A 1VA4A 3ZV3A 3DCYA 4OJNA 3GIIA 2ZREA 2OQ2A 4RXTA 5E6RA 4HN2A 1JLLA 3BTOA 1OFTA 2Z57A 3LX8A 5GV8A 4RUCA 4LGCA 1KS2A 3QLUC 2H3HA 1TJPB 1J0XO 1BGVA 1X7ZB 3GIKA 3NTRA 1Y6RA 1FDIA 3JY6A 1C3EA 2XI9A 1G8KA 1G1AA 3AH8A 3KJHA 1V8PA 1RLOA 1VHTA 2RI1A 1E8MA 1E66A 2YCBA 2IK8A 3UKOA 3U49A 4FMCB 3T7TA 4UTOA 4QLAA 3A0UA 3MSCA 4ZGGA 2PMCA 4EWLA 1II9A 4KMOA 3ORHA 5HMLA 2QN6A 3WB2A 1TZCA 2DFPA 4JOBA 3C5VA 1SD5A 2M1ZA 1JGTA 3WJ2A 1UXOA 1MPTA 1IJEA 3A4VA 4NR0A 4G4SO 3L4BC 1KSJA 1E5QA 3E5HA 2NQ2C 5DG7A 3N07A 2WTNA 1E3SA 2WWGA 5SYNA 5CG2A 2P5YA 5A2QA 2Q6TA 2QLLA 5JI3E 1A5TA 5M7EA 3UQZA 1QHSA 2VA9A 3J81k 3PPIA 1HE8B 2PIDA 1Y5LA 1EX1A 4DSKA 1Z07A 5KYWA 3GPCA 1D2GA 2P65A 4KWHA 2ZM5A 3H2IA 3LT0A 2GCIA 3K0FA 4TUYA 5KPDA 4HATA 1TD9A 1N2CA 1JDTA 3L77A 1QRAA 1Z6TA 5EZSA 1P31A 1A4XA 3WAKA 3RYIB 4X1KB 4HNRA 3O31A 4G0MA 4BC0A 4HAIA 4HAWA 3ZXXA 3AM1A 2JJ8A 3QZ7A 1VI6A 2B4KA 1SUDA 5A4FS 1V3VA 1TK9A 1HZZC 2CL7X 3Q4GA 4EEXA 1YFJA 8ICHA 4DIOA 4WLNA 2I6FA 4NBNA 3RBZA 4QVKA 3SR3A 4OOFA 1TPYA 3M6UA 3TXYA 4MV7A 1N6KA 2ZE5A 1FNMA 1QHXA 3G9XA 2IYXA 5HHTA 4J4BA 2PGXA 2V9WA 3W6PA 2NUAA 4RPIA 3FPHA 3FA2A 4L8LA 2ZFUA 2HF8A 4DA7A 3TSWA 3PFNA 1RAIA 2AOXA 1G4HA 1FFBA 1VG8A 2D8AA 2Z5GA 1D6JA 5BN5A 2P66A 2MWMA 1NXPA 3P5BA 3PQ6A 2XWQA 2DZDA 4W1QA 3LCVB 1YMQA 2VN8A 4A6EA 4JLKA 4ZVRA 1OWPA 4NM2A 4NMXB 1O87A 1XA0A 1MW8X 1K9SA 3Q8WA 1GVNB 1RCUA 4US1R 2BCRA 2P3LA 4ZK2A 1NPTO 5CA1F 2NZYA 1THTA 4ZOBA 3R2JA 4BFUA 4ZVOA 2QR5A 2H3ZA 2QUBA 1Y7HA 1GL3A 1FDSA 4JGIA 1OYYA 5KZMB 2PGOA 4D46A 2HMUA 3EDCA 3ICPA 1CCWA 4EF4A 4KPFC 1JR6A 3FTPA 1EKXA 4WXYB 2Y0SF 1IHUA 3VNQA 4QOHA 2YHBA 1POXA 3COZA 2Q5LA 4AKIA 1MN6A 3OESA 3A1VA 5AI6A 5JXIA 2ID7A 1B7GO 4DKJA 3AUUA 4WK6A 1E9RA 1Z83A 4ZYVA 3TX6A 3FMGA 1PU2A 4LTDA 3SVZA 1WF3A 2IGBA 4YRJA 2C5HA 1Y3DE 5HKOA 4M87A 1ZVKA 1YCDA 2MSNA 3SI8A 5L4SA 2XZTA 1N62A 2QBYA 3TSAA 4PRYA 1E3DA 3P2EA 3FHJA 5KDLA 2L42A 2EEZA 2SICE 2XO7A 4RPJA 1SC3A 3PQ4A 4RTPA 2X23A 4TM8A 4MW6A 3WBKA 4M0DA 4ZWNA 4A2WA 2F64A 5CK5A 3EISA 2A7XA 3GCDA 4L8YA 4I5GA 2EZYA 2KMDA 5K0ZA 2ZUEA 4Y1EA 1UJ2A 4M04A 1OYWA 4HDKA 4BO3A 5JH7B 2ZUBA 5KT4A 4JK1A 2EANA 1AQJA 4NZYA 2JFYA 4GXRA 1N0UA 5DB7A 1AGXA 1Q84A 3TUJC 3ZWQA 5DK4A 2I7XA 3FPKA 3R5XA 4PAQA 4G0NA 3HB1A 1LPAB 3PKZA 5JYEA 1UBRS 1RQNA 1NJSA 4QGSA 4YLEA 3OCWA 4F97A 2IOHA 5JZOA 4X6UA 3NTOA 1M1YA 1RYFA 1I1NA 2IUYA 3DDWA 3ET4A 3WFZA 4AY6A 1L8LA 4CDNA 3L7OA 4FFBB 4CEHA 2R11A 1XK6A 5HR7A 3VPFA 4Z0PA 3ACBA 3K4PA 4PPXA 1BX0A 5TQ2B 2QR3A 2P11A 3MJDA 3UMBA 4YAFA 4NFYA 1Y1RA 4YXFA 1BO6A 4UB6U 3QYPA 1DJMA 4QXAA 4XIYA 5HK8A 2ZUWA 5E2IA 1GLGA 3SYZA 5I7UA 3LPCA 4CI0B 2O2ZA 2G9QA 1AE1A 2PR2A 5IP5A 3OMXA 2HBKA 4EBBA 1GTMA 3G49A 1SUEA 4MUAA 4NH4A 3CYMA 4KLIA 3EXEA 2FDXA 1COWD 3CX8A 3W1VA 4NZZA 2FPPB 3AVQA 2OK7A 4KKXB 4TN5A 3ASVA 4YCJA 3ESBA 4DPLA 1RFLA 3TB4A 5A3VA 4L4XA 4IWNA 3AL0C 3JQ7A 3AT1A 1RJGA 3D1LA 1NZDA 2A5JA 5K0GA 5B57C 1A1SA 1L3CA 4V39A 1Z82A 2C59A 4CKBA 1ZMBA 1VPWA 3L8GA 1WCV1 3M83A 3WYGA 1GNSA 4HZIA 1UZAA 5H83A 5DYWA 5KFAA 3D2QA 3GLIE 3HVUA 3NRCA 4ENPA 3DNFA 2XUAA 3ZEIA 2WIGA 2PS9A 4JV2A 2JCVA 1DHTA 1K1SA 4MV4A 2WM8A 1PLJA 3VH1A 5FF9A 1DOQA 2VA3A 2ZU0C 3A05A 3GMIA 1M0WA 4NYJQ 1EWKA 3ITDA 3RYCA 2FN4A 4PC3A 3AK4A 4D8XA 3HKBB 4PZZA 3I1FA 1U2GC 2FPIA 3U44A 3WLRA 1SCDA 1L5GB 2J5QA 2BOVA 4DQQA 5IDYA 2OGZA 5I7VA 1MIHA 2SKDA 3HN7A 1P5FA 1YL6A 2H07A 4QDZA 2HHUA 1XDDA 3BCHA 4PO1A 1S4MA 3E03A 2FG5A 5FFMA 3UXYA 1W4AA 4DZZA 3SIPA 4F93B 3LDUA 3LC2O 3NAMA 2QE6A 3BIFA 4I2JA 4OYRA 1D2RA 1ODTC 4O4HA 1L5FA 5LVAA 3GQVA 4EQ6B 5COQA 2F1OA 4RNOA 3VHXA 4CFSA 2EGHA 3VTZA 3H2SA 4UBNA 1TYZA 4G5QA 5L1JA 3T5CA 4ZIRB 3ZZ1A 1CFJA 3GCWA 1R4MA 2B21A 1KP9A 4DLZA 1IG6A 1UR5A 4UASA 1TB4A 5BYJA 3TXXA 1KYYA 2V4RA 3U7QB 1YKGA 1UMDA 3IMGA 2H11A 4RZ2A 1I3KA 3FVTA 3T7KA 4BMCA 2YCLA 3BPSA 2F8KA 3F2CA 3D1JA 2LI6A 3HS3A 2HJ9A 3SM9A 4UTPA 3AETB 3AHJA 4NFLA 2HBYA 2WE8A 5LDGA 3TEMA 1XEWY 1XE3A 5A7GA 4NCNA 3F9RA 3V1LA 4QZDA 2V0NA 3CHYA 3KZCA 1EWQA 1ZGJA 3AHGA 3R7NA 3N2ZB 3RBAA 4AC9A 4F3TA 1JPJA 2O2GA 1VMDA 4YY3B 2VTVA 9ICEA 4EPXA 5J0RA 2VP6A 1Z63A 2V3VA 2R65A 2RGNC 3WWPA 4B2LA 2XCAA 3UV7A 1M6VB 4JVSB 3M6ZA 4Q05A 4J6EA 3NWEA 1NJ8A 3ZC3A 4UQLA 4Q9IA 4CR6A 3EASA 3ZOZA 4MTLA 1EJ6A 4V0NA 3T5BA 1MGPA 1WUHS 4FFNA 1C1YA 1SXJE 1KYZA 4AJIA 4MRMA 4RFLA 1L7DA 4FMCF 1VPLA 3PENA 3ILYA 3SP1A 2V7UA 1LBQA 1QG6A 5AKIA 1FUEA 1YQXA 1E1RD 3GFRA 4DABA 4LE1A 3IDWA 1I24A 2P27A 4P1ZA 3FBTA 2CCGA 2QX8A 3FRHA 2KNJA 5J2UA 1KVSA 5B7QA 5U4XA 3TAXA 1RYZA 3BD6A 4EHLA 4V0KA 4JB3A 3P0EA 4Z1OA 4EGQA 1C1DA 4LCBA 4BMXA 5AT1A 3DKRA 4K8RB 2VK2A 5KG4A 2W70A 5CB6A 4QZHA 4M6WA 3QTBA 4LYHA 4MFAA 2VF2A 3KU4A 4MWSA 5CUQA 1SOWA 3VMMA 5ER9A 1N1MA 3MD9A 3WMGA 2CWDA 3BZCA 1SKRA 4B5LA 1HH4A 3DA8A 2ZU6A 3K0KA 2JLYA 2GOYA 1U3WA 2PU7A 4TS1A 3FY4A 1OLUA 1EJBA 4MHOA 3T8YA 1U3VA 2B9EA 5FB3A 3M6VA 4LZOA 2ZIEA 3IAXA 1FMLA 3BJMA 4BCDA 1XLVA 3BDPA 1UFRA 2UZ3A 4FJ0A 1QP8A 4YV1A 1URPA 2DHDA 3GLKA 2Q4DA 4ZCRA 4EDFA 2Q5HA 3MGAA 1QIDA 4PQGA 1YJAA 2BBOA 2UXCB 1NZBA 2FEWB 2KK0A 4MWZA 4AN0A 3H5RA 3T1OA 4NK5A 2F2AB 5F4BA 1EH5A 1BS1A 4NATA 4IDAA 5GM1A 4JJFA 1IN5A 1NV9A 5J4LA 4C4OA 5IBQA 1EK2A 1CJMA 2DBQA 4JJ8A 2ALJA 1JR3D 1U47A 2XEXA 2GM3A 2FWNA 2DEUA 1AQIA 1SVKA 1G5FA 3WZLA 3T7DA 4II3A 1ZSYA 1O6FA 1OI2A 1YMUA 2NV2B 3M4XA 3Q8RB 3C3BA 3I3OA 4O2BA 2NN3C 4D3DA 2J07A 3O73A 1ZNZA 4U7PB 2QTVB 2FV8A 4Q1VA 2BEVA 3M9WA 5JDCC 5AJYA 2H5EA 5CK4A 1OIXA 2OYCA 3RBXA 1CRPA 2A35A 5KFTA 1ZN2A 4DYDA 1AGYA 1DQNA 1K4MA 3M1YA 1RZTA 5FPQA 1X2IA 3EVGA 3DMGA 2OV1A 1QZZA 4UNPA 1MQ2A 4KE7A 1Q0QA 3CUVA 3H1PA 8ICWA 2ZIUA 4YMIA 2I4MA 4G9BA 2R8JA 3RS3A 1B00A 1QK5A 1DWOA 3LS2A 4ED9A 3CXRA 4KLHA 1RWQA 3QEJA 4WNCA 3QLEA 4BASA 1CP3A 3ISJA 4FDTA 3QLVC 2YC4C 1EA5A 3N8IA 4KK3A 9ICJA 4JC4A 3X2SA 3WGJA 3EF3A 1WUYA 4FNAA 5D3MB 4FILA 1WZEA 3BWBA 3SGLA 4ECYA 3T6KA 4LDZA 3OE4A 2V6MA 2PG3A 5HE9A 1TCBA 3TQTA 3LHSA 2FE4A 4QZCA 4IOJA 4ND3A 2BM8A 3MTEA 2XGSA 4CF6A 3TW6A 1UXIA 3IG8A 5BORA 2KBEA 1RYBA 2XKJE 4ZO8A 1P6UA 1CYDA 4YRDA 1ZG3A 3LUHA 2V7GA 3GRKA 3G79A 2E5WA 3C2MA 4JHLA 3CJQA 7REQB 4OMUA 4BQSA 5AWFC 5BW8A 2CHUA 4OA5A 1VJRA 5CIWA 2PCJA 3FSJX 1RHRA 2Y2UA 5JAOA 4M1MA 4RA6A 4DV2B 3DF7A 4XRRA 2E9SA 5CJ2A 3LUFA 4XEUA 3FWNA 3K32A 4KXXA 2ZRCA 3GP3A 2OAGA 4WUVA 5KYYB 2CV1A 2INGX 2MOKA 3SMVA 1ISSA 2PT7A 2KJ9A 1M2WA 1YZLA 4F50A 1HRKA 3RUIA 2WT8A 2YV4A 4LSZA 4WD3A 3VC8A 5DOVA 2JEGA 3AYXB 1HMYA 5EWJA 2Z08A 3C3JA 3BZBA 3C8MA 3BH6A 1BHO1 4GWLA 1BVSA 4B9NA 3WIOA 4LMPA 3KP1A 4BAUA 3V1MA 4F2RA 4YLGA 2FEMA 4LHVA 3W5BA 2IBMA 1Z13A 4G9GA 1WW2A 5UKDA 5JS8A 2AOWA 3H5IA 1EBBA 4F8EA 5HUQA 5KFFA 3HNRA 3KB1A 1HT1E 3P9XA 3S70A 1N0HA 2VTEA 2EU8A 1JKFA 4BJQA 3JQEA 4Y6OA 1RM3A 3O3OB 4R2HA 4JXXA 2MSDB 1OT5A 5D85A 5DJ5A 5DGDA 2GGSA 2CSUA 2JHAA 3AB7A 3VISA 4GP7A 1M5RA 4NP6A 1DQZA 5AJWA 4UM9D 4TXLA 3F1LA 2GR9A 3ABOB 5KT3A 2V7XA 1N32B 4YRSA 3PIRA 2WJPA 1QYXA 4XIFA 5LQKA 1J23A 3R5SA 1J99A 2I9PA 1H42A 4DSUA 4XA5A 1PGPA 4G84A 4DG8A 2R4TA 1QCYA 2Z4SA 1Y3FE 2QSJA 3CNNA 1RRFA 4EKYA 3ZY3A 3DOHA 4QRIA 3OJUA 2WHXA 3AFOA 1QLWA 1KI9A 3DWFA 1ORHA 4I5IA 3OECA 3FTFA 5G0UA 2LKDA 5H9WA 1GGEA 3TSOA 2O52A 3GVPA 1KPIA 1ZNYA 2VHXA 3ROKA 1FQWA 4JP2A 1J06A 1Y7LA 4S1PA 3HJCA 1WZIA 4Y1GA 3NFYA 5CA0F 4JFAA 2XNKA 1W2WB 4PX5A 2ATCA 5IT5A 3CRW1 4BY9E 3HCCA 5BSRA 2BFWA 2C95A 1HWYA 5ICCA 4J0QA 1JDSA 2UUAB 1COZA 2IYZA 2OKGA 2J9FA 1KMNA 2Q99A 5I7FA 4Z4GA 3K92A 4DQDA 1P0PA 4CV0A 2WVHA 1P19A 1KOLA 4HT3B 2ZIWA 2RH9B 1E7SA 4FFMA 4W9NC 5HFJA 3NWPA 3K30A 3DEHA 2OCKA 3FLEA 4FFPA 3N53A 3SWWA 3VGPA 2B94A 3A70A 5GMOA 1H6DA 2KZZA 3N3BC 1L7QA 5TDHA 3E27A 1FSZA 2Z98A 1XUOA 3WMWA 2D0IA 3P9QA 1T8WA 2ESEA 4PX9A 3WDSA 1FUUA 2AFVA 3GEBA 4OJPA 1VYTA 5K03A 4NLNA 2QVYX 1OPXA 5CNJA 3UGKA 3UUGA 4EENA 4EJMA 4JN6B 5B1HA 9ICMA 5SYMA 1TM7E 4UFNA 1N1EA 4DGQA 5KKCA 3D8RA 2IPOA 1J7JA 3PX2A 5K0EA 2DB3A 2VHUA 3S2GA 1WKCA 1DKQA 3WK4A 2G08A 4RANA 3U7FB 5KFSA 4HTAA 3RF9A 5AM0A 2D2VA 4GMDA 3EPKA 4JDPA 4EKEA 1JB1A 5FPSA 1JMSA 4O5OA 4Q18A 1JAXA 4R8LA 3QMVA 3RRXA 4PPFA 3EC2A 2UZ1A 1EWTA 1XRSB 3F4KA 4IXMA 4L07A 2IQIA 1TUBB 4UHHA 3L49A 2R6R1 4UBOA 1W48A 4WRRA 1TCCA 5JBNA 1B93A 3RC1A 2B30A 2PZ8A 4ZCPA 4AS1A 2K7ZA 1EFPB 1X7WB 1E58A 4NENA 5K4GA 4RDIA 1ZKDA 5KNBH 4AYBC 4FVTA 1VSBA 4Y3UA 3ZH2A 4MW2A 1O94D 1YZGA 4KK4A 2Y9UA 2YTUA 5CMLA 1THMA 3BSWA 3L82B 2AD5A 2VYNA 5B3JA 4R9RA 1VG0B 3SJ7A 5G3YA 3Q6MA 4QFCA 2C1ZA 2DP4E 4Z6KA 3JAKA 3OE1A 1ILWA 1Z8HA 3NX4A 3HVRA 1U2PA 5KNBD 3L6CA 5D2CA 3LX6A 3WNQA 4YEDA 2AXEA 1Q0ZA 4AURA 2RH5A 3IP6A 2O6LA 1FK8A 2VHTA 3OIYA 2UDPA 2FN3A 3ZVMA 2QU8A 1PFGA 2WJIA 1TZMA 2YNMA 2BUCA 4JYMA 1DCTA 1HEYA 2A9FA 2YY6A 5EL0A 1XCJA 3BSYA 1QXSA 1O4VA 1RW4A 3VR2D 3JPQA 1IZYA 4LHWA 1VBKA 4N7MA 3TLGA 2ZROA 3DMYA 4TZTA 4CTKA 4PTZA 1N7HA 4Y2HA 3LOQA 3G5TA 4DWWA 2PVCA 2WJ3A 1PD1A 3DZHA 4FQ8A 3MS7A 3CTMA 4PU0A 2E49A 1U31A 1HDCA 1UCVA 5IKEA 3GLSA 3MAAC 4ZCLA 1G38A 3G8AA 3H0RB 4EECA 3T3DA 1E2UA 1PDOA 2X9VA 4NMLA 4AMUA 4MVJA 2IGTA 2W2OA 3OEHD 1T8YA 1CUJA 2YR0A 1X0VA 4S0XA 3L8CA 1JFFA 1UPXA 2PAFA 4TQ9A 1OYOA 3KUXA 1YIAA 3MQ4A 1QCZA 4N0QA 1F2TA 2NP6A 2QKYA 4UVIA 5CNIA 2NO6A 4FR0A 1XD9A 5AVYA 1MOZA 1Q7RA 4LDJA 3E1GA 1TJNA 3SJUA 1WDWB 4RD2A 3VJKA 2BJHA 1IEXA 5TQJA 4DLSA 4GECA 1E77A 4GVXA 5ALXA 3RTBA 3UBTA 3T1QA 4LGYA 2R6AA 4CT4B 1TT5A 1UWCA 2JKZA 4I4IA 2YVKA 3S6JA 2R8OA 3KKMA 3M5WA 3T52A 3G2KA 2ID8A 3O2JA 1PNOA 2FOIA 4Z3OA 2ZPUA 4C7ZA 1U3FA 3KG2A 5D3ZA 4MUBA 1K8ZB 4GC6A 3OJEA 1ES9A 3CEMA 4TSKA 1AZWA 1LLQA 3UQ0A 5EKXA 3WBFA 4WKGA 4NL4H 2OORC 4HBZA 2W6NA 3PUVA 5FLYA 4IOKA 2JS7A 2VJNA 2WU0A 3DC2A 4CMKA 1RPNA 1TQ2A 1C81A 2HRQA 3IXQA 4RY9A 3WLNA 3PXBA 4DBVO 1W8DA 3C45A 1QVWA 2HWYA 2K7FA 4KUEA 3OLXA 2AGVA 1GA6A 2NPIA 5TMDA 4EA9A 5ECYA 4MCJA 2EAMA 1ZQDA 2H0QA 3H0LB 4DSFA 4LF4B 5J2BA 2DQYA 3D59A 3BK7A 4EG7A 2G40A 2BHSA 3HYLA 2KQUA 3ZLUA 2OK8A 5C81A 5L7WA 4EFDA 2BFFB 3JZDA 3RFXA 3R8FA 1ZX1A 4JUIA 3CN7A 1JALA 5E4YA 3OT1B 1H93A 5AHKA 1SY7A 4QATA 3T5AA 3SFVA 5JMTA 1UKAA 2AFIA 1RHQA 3AFMA 4GPIB 1WCLA 3P71T 1RE0A 3UXHA 1DT5A 4IVPA 3ZK9A 2WJ4A 5LIRA 1UMBA 5CXUA 4QULA 2PH3A 1HIWA 2IYYA 1XZFA 3CVXA 1YKFA 5MGNA 1K9VF 3BGIA 3M4JA 4DIDA 1PO7A 2B34A 5A5GA 3FR8A 3QEMA 1H9CA 2NU6B 5JYBA 1AMUA 4RQ3A 4M1QA 3EYAA 1KNQA 1P80A 1DDGA 1DELA 4QRDA 2F1KA 4DMLA 3CWCA 4ZQCB 1PG2A 1ZGHA 4DN6A 1XXLA 4FGZA 3WQSB 4MULA 4JA0A 2P2GA 2QRPA 3GT4A 3T3GA 3G6YA 2YVLA 1T9GR 4GI3A 2AN1A 1Y34E 3W79A 1YOVB 2P1ZA 2F3PA 5HKAA 2DKXA 2O05A 1ZQ9A 4UCXA 1VL1A 4CMIA 1L5YA 1V8DA 1J0CA 2GN0A 1OUQA 4PHPA 3ZZNA 4BTLA 3K72B 4OLFA 5LMCA 3LQYA 3UJNA 1CR1A 3V80A 3WWOA 2C2GA 1NSTA 3UFBA 1K27A 1Z0KA 3UZUA 3PFCA 1VDZA 2WMYA 1NVWQ 1A7AA 1EIWA 4BNDA 2CLIB 1BU8A 1C9EA 1YBVA 2OOSA 1X1SA 2QV7A 2HTFA 4ZXFA 3F2VA 1A95A 4PF1A 4FMDB 3CLUD 1MA0A 4ZZ0A 1FQJA 3OO1A 4GM4A 3OP1A 4CRWB 4CRXA 2BCEA 3TD9A 1M8KA 1U9LA 3EXG1 2EKPA 4I4TA 5IIOA 4QWMA 4AB1A 2G5GX 5CNMA 4L75A 5KFGA 4ZJPA 5JAIA 2FFJA 1GZ7A 1UMKA 4OFBA 2CXYA 1JIXA 5EOVA 1W0JD 5E4TA 4B2PA 2YZGA 4B2IA 3ZWVA 4AUEA 1U0LA 1NVUQ 4P5PA 1ZOIA 3L0SA 5C8YA 4QOFA 2YICA 1P7YA 1SKQA 1V8FA 4M8IA 3KQNA 1W46A 3N87A 2VPIA 3R77A 3PUKA 3KUKA 1Q1NA 2KWIA 2AUMA 2P4UA 2G09A 1V1RA 2E85A 8ICRA 4RFVA 4LZLA 4M7OA 3KKAC 4A82A 3SLGA 5E9JA 2P6UA 4QNRA 1GAWA 2FUEA 1E6CA 1INLA 1Y8CA 5CAEB 2IA5A 4KUHA 1HNZB 2QTWB 1P7ZA 2C7QA 1L6RA 4S2EA 4KO4S 5EI5A 2CXNA 3PSTA 2VPPA 4DSZA 1VSVA 4KAJA 1LBIA 4LV8B 4RPKA 5H7XA 1X1CA 1J2NA 2WZBA 1NK5A 4XA8A 4PCAA 1Y5RA 1GZDA 1SIJA 2P9QA 1JHUA 1DJOA 4NNOA 2REBA 1LQTA 4H1TA 2ODTX 1GR1A 3I4CA 3ZJUA 2OMKA 5J0XA 4OQNA 1KJ8A 1ZQXA 3FX2A 2HREA 3UO8B 3C5CA 1E61A 4GPBA 4KX5A 2PJRA 3WV4A 1QGOA 5JTIA 3T61A 1XEAA 1U8TA 2PX2A 1D0VA 3JD4A 3AJRA 1OVMA 3P9PA 1OY1A 4WVLA 5LWQA 4O8ZA 4FZJA 1R0LA 2W2LA 5LP6F 4D9CA 2BDUA 2YWCA 4I36A 1NVFA 3HUEA 3SZUA 3JWJA 5KC9A 3KSAC 4OJOA 1W19A 1IN8A 3GROA 1RCFA 1I7NA 1HC7A 3JWGA 4ASUA 2PXCA 4MDFA 4AM8A 1GYQA 2DHCA 4K26A 1HDOA 3BWEA 2XB9A 3EIOA 1P73A 2VF7A 3GA0A 4X1YB 3AVYA 1AK1A 1Y6QA 4PGMA 2JJ1D 2KHVA 4K1XA 3DZDA 3H5WA 4WLUA 1GU7A 4H7JA 4GMXA 2DFTA 4UDYX 2RI0A 5ICEA 4JJIA 4EGCB 3RS0A 1ZSNA 1N2ZA 1B6SA 2D13A 1QKIA 1KWGA 1M2JA 1O5IA 3QLUA 3P5SA 1MNAA 5EERA 4RL4A 2KFZA 5FO1A 1PWXA 4ENUA 4AJNA 1ZQRA 1H2RS 1HMPA 2VF5X 4HDRA 1C3OA 5JXHA 3OG9A 1GGMA 1CP2A 3A2MA 5EG5A 2RHLA 4X85A 2FF7A 1E8NA 1HX7A 2HDNB 4C9BA 3RF7A 1GN8A 4KJZA 1J9EA 4PTYA 3WL3A 4IZHA 2EAOA 2QJOA 2O3TA 3FNQA 3KQQA 2R9VA 4BNGA 5BW4A 1E2DA 3BIOA 3FNRA 1L5MA 5F5XA 4RY8A 4BP9A 1UANA 4JR0A 5EXPA 3KKEA 4OHFA 4QBFA 4WKBA 5M5BA 1AZSC 4BO5A 4OD0A 1EGMB 2WT4A 5IXJA 4NCXA 3A1EA 1VIAA 5AI9A 2FP4A 2JDID 2HRDA 2GZDA 4UW9A 1C0IA 4YJKA 2CE2X 4FOLA 3LHDA 3WLJA 3U5ZB 1EXWA 3GC6A 2CVFA 5FDFA 4KLNA 4QJ4A 3K9LA 2ZDQA 1CS0B 3MWYW 4A03A 1TPZA 8GPBA 2QL9A 3F7TA 4BBZA 1U7DA 2YJ6A 1W1IA 1VCHA 1WB4A 4MLCA 4H3SA 5A05A 2VNAA 4K2HA 4BUGA 4V02A 3VR3D 2ZZNA 3U9LA 1MMFB 4PIVA 5THQA 5E1BA 1M1NB 5JBQA 3BD7A 1RQ2A 2JFNA 5K9ZA 3C3CA 5ALWA 2GEVA 3IH5A 4MVYA 1G8AA 1HZZA 1JR4A 5CXXA 5IM5A 4RZSA 3SYTA 2I9GA 3QBEA 1RI5A 3RJFA 5CNKA 4O8CA 4G67A 1A7UA 3ROPA 3HKEA 4DWVA 3BORA 1QO0D 3GLIB 3R7SA 3KHUA 1ORVA 4HDAA 2VDVE 3LYHA 2ZE7A 3OPVA 4IZ6A 3M3PA 2BELA 2XYQA 1C7ZA 3ONWA 2CNNA 4FHFA 1FA9A 3ZIUA 2OCLA 3TARA 3F5MA 3VVCA 3QX3A 4NJ8A 4I50B 2II6A 2QP4A 2PI4A 3IKJA 4YP6A 3K1AB 4F46A 2H3VA 1EESA 3GY0A 4RD1A 3BXHA 3G9UA 4BGDA 5JRJA 2VSOA 5I7HA 5KVQA 2X5NA 3UN1A 1KETA 7ICMA 3RVMA 4MYSA 3DFZA 1XN1A 5H9VA 4F8YA 1LC0A 1MHTA 3QELA 4KSBA 3EZNA 2HHXA 3V48A 2W8BB 3KBOA 2ON6A 2VL7A 3SBDA 3AHIA 5HQTA 3WK5A 2WFLB 4NCIA 1LPMA 1NRIA 2QAGB 1B8NA 2B4TO 4RGYA 2UAGA 3PJDA 4MICA 3H40A 1D2AA 4LI0A 4CIVA 2ZETA 4J4HA 4XRHA 5CFOA 5H4GA 2QZSA 2YWJA 1J2YA 4M8NE 5JUMA 2QU7A 3DD1A 1VXOA 3ZD9A 3GIMA 3ZLTA 2R18A 3K5PA 3U09A 4CF4A 4ZICA 1VJDA 3AR7A 4R6WA 1NR1A 3ZHYA 1MAVA 3AY7A 4K88A 4E08A 1W36D 2IHTA 2FLNA 2WQZA 1VLZA 2CBZA 3DWEX 2UVVA 2VYVA 3I23A 5GIOE 1CRLA 4C89A 4GPAA 3MT7A 1O54A 1JHPA 3OTOB 4S1VA 4MP6A 1U2SA 1Y1KE 2BE7A 1NJ1A 2QY6A 5DHRA 1HT2E 4KR9A 1WPXA 1XQ9A 2J6HA 1XMJA 3H04A 2CDRA 4FHDA 1FFCA 3AUTA 1PVOA 1AHHA 2XNHA 1G9SA 3WRWA 2HNKA 4HPJB 2NTYC 4KR2A 2G76A 1W25A 1A71A 2QUIA 4POAA 3QOXA 4C5CA 3TRFA 5DPMA 1Q77A 2EZUA 4DSJA 3AWIA 4ND8A 3MCWA 2MAXA 5IJXA 2NXJA 4M0MA 5DHQA 1BHJA 2H1OA 2AR0A 1UC9A 4MGYR 1U6KA 1DFIA 4GYJA 5ADHA 2VZ9A 5BMVA 3FOFC 1P4SA 1KFBB 3FPJA 5BQ5A 4XJXA 3C85A 5IM4F 3MBYA 3SHFA 3BFJA 1UPBA 2NXNA 4CIYA 5LOVA 3UTDA 3NNDA 2P9BA 1S96A 4C2TA 4GOMD 5ALEA 1PJAA 2BMFA 1GFSA 5HKBA 1HYBA 3H2KA 4WCDA 2WU3A 3QOFA 1WDLA 3ER6A 4YALA 3GJQA 5JSHA 1G5QA 1BCRA 4DDWA 3HLKA 3SFZA 2GILA 2FCAA 4RGVA 4XDZA 4EP1A 4KIUA 3OZBA 1AD2A 3RB0A 4AP5A 2GAFA 4X45A 5E0OA 1QV7A 5A9SB 2GHRA 4YI5A 1Z62A 5AKEA 4BFLA 4FDAA 4FMDF 4A26A 3QPDA 5JSFA 3QX9A 1XZKA 1YXMA 4LHEA 4QW8A 2ZS7A 1PZXA 4B6QA 3U19A 1L7XA 1RM5A 5J8YC 2ZIAA 3DEKA 1DRUA 4FS1A 1B0ZA 2R8ZA 4G01B 5D1HA 1TO6A 2PYZA 2ZI4A 4YJ3A 4K9SA 1TMGE 2BGIA 3MCTA 3IAFA 1GITA 4PHDA 3PR5B 3TPFA 1CSEE 5HRCA 4J0GA 7ICSA 1T34A 3NTXA 1VIDA 2ZRNA 1EP2B 3R76A 3LQRA 3T9CA 2O2EA 1MA3A 1UDWA 4F21A 3QVUA 1ISPA 2GAIA 4KTVE 4XCXA 3WL4A 3DEAA 1U2GA 2BBTA 1H5UA 4AY4A 1GLNA 3TTXA 3DB2A 2FR1A 4X8MA 1QQ5A 2HHSA 1TF7A 1YB6A 3CY6A 1YS7A 2PFGA 2Q21A 3D3NA 2ZVPX 5LLSA 5B2ZA 1PJZA 2WAMA 3TO5A 4DR1B 4DIKA 3NHPA 5I4IA 1SXHA 1E5DA 1UK6A 1BWPA 3SE0A 4YCCA 4KFCA 4LJXA 3OD1A 1BWSA 1QTMA 2W2KB 3RUEA 3E82A 4KQCA 2CRXA 4OQXA 4Y0VA 4HDMA 4GRAA 4CQJA 4PWYA 3A3PA 3VKVA 5G3ZA 4IGFA 4YI3A 4EYOA 2NNWB 1JDBB 1S3IA 5JLJA 2NO9A 4AYXA 2AK2A 2FCRA 1E8DA 1JVNA 1XQXA 2PT9A 2RP5A 3K2EA 4V0SA 2OTCA 4NCKA 4H59A 3WGTA 3TLBA 3HCEA 4MS3A 4OYYA 1VMAA 3E23A 1BNPA 1BH2A 2PBZA 3SY8A 4I1SA 3F4BA 3HTXA 1E69A 1ICEA 3PGKA 3CX6A 2VBFA 3AFIA 2CFSA 3PNQA 3H99A 4P7GA 1I36A 1XXHA 4FBTA 3RE1A 4W5RA 2KEYA 3HP1A 3LUCA 5A0FA 4BEVA 4CM5A 1CEZA 3VPGA 2CMGA 1CTQA 3I39X 3ZG6A 4DPKA 5BSVA 3T95A 3KXLA 3SVTA 4JVLA 1SMKA 2H8KA 3KOMA 4FNGA 5GZ1A 2RGNA 4ISCA 4B7CA 1XLTC 5C9ZA 1CNFA 2VPWA 4M8LA 3JU3A 3GL9A 4XM2A 2J1LA 2IYPA 4G97A 4W5WA 2W90A 2A6PA 2XB4A 3DGEC 2BWJA 5KT5A 1GG9A 4MR7B 3EPIA 1NFRA 3D6NB 4K03A 3L4JA 1WD7A 5GIPE 5IYZF 2X77A 4ALMA 4EYQA 3GXOA 2IWHA 2V54A 2A78A 3DL4A 1ZJ5A 4LZJA 2OUKA 5IUKC 4NCHA 4X41A 2GFHA 5P8WA 2CL6X 1WDKA 2HHJA 1VC2A 3GFGA 5AK0A 2REXB 3EOBI 3DUFA 3ZQUA 4KB5A 3CH6A 1BFDA 3CX3A 2W11A 3F97A 4CM6A 4AJJA 5E2BA 3E3OA 4X9XA 5T6BA 4RTNA 3HI6A 4U02A 4NEGA 2NIPA 2ARKA 2YMPA 2GVZC 2GRUA 1G9XA 2RCNA 3KZIU 4PBRA 2W37A 3SI7A 1SQSA 4UBCA 4V0ME 5BWCA 1OC2A 4TUSA 1GR0A 4G23A 3TUZC 5GGYA 3JASA 2I33A 2ZBGA 1I4TD 1G20B 3V1UA 1BMFD 4RKWA 1D5CA 3RH4A 4CLEA 2I34A 1Z34A 1ID1A 2A0FA 1XV5A 4G4SP 3F53A 1Y5IA 1HFJA 1RQXA 1KAQA 4RULA 4UUMA 4BYGA 1U2EA 4IF4A 1L7PA 2I03A 5PNTA 4ZHQB 4MWTA 4FNOA 3E3MA 1FFHA 3HYCA 4Q9NA 3ZK7A 3GUYA 4RTRA 1U3CA 1MJGM 4HWPA 1FDRA 4MVWA 2L82A 1M6EX 2QDKA 1GRCA 1LKYB 3I6IA 3H13A 1NW9B 3OZRA 4HJXA 2YH2A 1RZRA 4ZU3A 1E1MA 1FRQA 3EF0A 3UJ9A 1BX3A 1WRBA 2BM1A 2GX6A 4DMMA 2Y67A 5DM0A 3AOEC 4PAMA 3UHJA 5CA0B 3AY6A 4QOSA 5F12A 3MTJA 4ZMRA 3EYZA 2YMMA 2IDJA 3O03A 4YVZA 4K6HA 5I5GA 2KKVA 3AERA 3EARA 2ZJAA 3LK6A 3OPYI 4HPXB 2TMGA 3GRCA 3ITKA 2V7PA 3N8KA 1NP7A 4I50F 5AKGA 3DL0A 3QJYA 5L9XA 3UJPA 3S8YA 1A9SA 2VNIA 2XUFA 5EUBA 1S10A 4PSCA 3A04A 4UBIA 5JDCA 5AVOA 4UM9B 3PB3A 1RLMA 1HSZA 5C80A 3LSYA 5JC1A 4EPRA 1H2YA 4KDFA 3Q7RA 4BUZA 1V16A 3F9CA 4R8KA 4F96A 1AMNA 4P0PA 3AVVA 1R00A 4PPNA 4JL8A 1VKHA 3UJBA 2QMOA 4NCJA 2AYZA 2O7SA 4ZCIA 3CZMA 1ZHFA 4CM4B 3HRDD 1SXJD 3IBCA 4INOA 3F2BA 1GPYA 4DARA 5T7BA 1SXGA 1LPPA 2ZB3A 1TADA 4EMBA 3PU6A 1U2TA 4Y9SA 4PAGA 2D1SA 5I4CA 3EGOA 1QFZA 2GZSA 3QLVA 3JVUA 3DTTA 5KTQA 1PQPA 3ZDZB 4X5OA 3LF1A 3WGIA 1PR1A 4MPTA 1JEQB 3QW4B 2CKMA 4OHZA 2R7MA 5EJ5A 3P52A 5IK2D 1QIEA 3SS9X 1TE2A 2XQGA 1XMVA 4KPEC 3FIJA 5KJCA 1KZ1A 3N2KA 3DVSX 1A2OA 1TKBA 5JHHB 1RRKA 3CLTD 4DSLA 1T4CA 2R6JA 3QBVA 4PINA 4FX2A 4N76A 3SYLA 1XLUA 3SBXA 3V6KA 2I76A 5DWVA 1GPNA 3KHSA 1ZJZA 2RSLA 1VP3A 1UDBA 4BFVA 1GYPA 3BWVA 3UW3A 5KCZA 1KO8A 1E6UA 1JHDA 3HE3A 3WLOA 7MHTA 5DCWA 4PYMA 1MB2A 3ZV4A 5IDXA 5AK4A 5CH3A 2A1TR 4Z6CA 3MGKA 3OTHA 4TKZA 3GLFE 4JUCA 3R3VA 3LVBA 4YPOA 2ZBUA 2CFTA 3B5IA 4E12A 5TXGA 1OLOA 2UVPA 1E9CA 4X0EA 2E1RA 2XQFA 3EGDA 2NZ8A 5L4LA 1UP4A 8ICOA 2GPBA 1QH9A 5K3EA 2OCDA 1FTWA 2BTEA 3ZCQA 1JILA 2XA9A 5F76A 3SDSA 3FYHA 1IK6A 3CPJB 3HZZA 2IOYA 1Z5NA 5T57A 3C5HA 1JSXA 1ULZA 5EJAA 4KOAA 3OCVA 5LUAA 2EIXA 1JXEA 5DX1A 2YY5A 3D6FA 1LK7A 1MQ9A 4MAAA 1XZDA 2BQUA 1JIJA 2NQ8A 4FCTA 5LJLA 1RQPA 4GUAA 3JVVA 3T5LA 1Z0ZA 2DF4B 3KR9A 1PX2A 4C5AA 1ZD3A 2YJ4A 3ZDXB 4ABYA 3B1WA 1UT5A 3UAOA 1T43A 3DZKA 3QEOA 3NHUA 3OF2A 4LQDA 4H3HB 4I2EA 3WGQA 4LOJA 1XZLA 5B6JA 4BNLA 5JECA 4U0KA 4L3OA 2H1CA 1L7VC 2FUNB 2LBOA 1YA8A 3W1WA 1ZEMA 2P35A 5IT9A 1HQKA 4N5LA 1L1EA 2JEYA 1I2AA 5CTAA 3B7WA 5DN6D 4ZOHC 3CEAA 2COKA 1GN9A 3K70C 1SUWA 4B1FA 3AHEA 2VZ0A 1FUIA 4HN4B 1IXSB 3H9GA 1B3BA 1YC5A 1DAGA 3JAWB 3THOA 5JAHA 1N5JA 1J8MF 4Y2SA 2NU9B 4EARA 2D8CA 4IJQA 3AQFA 1NP3A 5FL7A 3IVMA 2DUMA 3DEEA 3BILA 2FQYA 2CLSA 2GLEA 4QZVA 1P7DA 4CF3A 2VBIA 5EHXA 2DCUA 4D4IA 4A2QA 1YOBA 2G63A 1EVLA 2SKCA 3S8EA 4DRYA 1SB3C 1YS9A 2X0IA 2GBCA 3USCS 2DHQA 5LZ8A 3OX2A 1A8UA 3PHIA 3EWSA 3NUQA 5CVDA 3WDKA 4EMUA 1VBMA 4R71A 3PT5A 5L1LA 4TQGA 2M6LA 3CLVA 4ARZB 4MKGA 2QQ0A 1F9EA 1CY2A 4XB6B 4OQMA 1HDRA 1P9OA 3DZJA 1L4UA 5KG1A 1P5HA 4NARA 4QFDA 1YCFA 3GF4A 2OZLA 4OXXA 3OMWA 1BNOA 3TQRA 1SH7A 4UFPA 4M9ZA 2O6KA 4DQLA 1IQPA 2RAUA 1GT6A 2BAGA 3A6GA 1NW5A 4Q4JB 4B9AA 4RUKA 3H2BA 4HXYA 4R01A 4FEEA 1XNGA 4IUBS 5CB4A 2BLNA 3EW9A 4W9NA 2Q9AA 2HQSA 3K31A 7AT1A 4ANFA 2CL0X 1YL5A 4DWOA 1ZETA 4QDTA 1KBUA 4J03A 4WNIA 2M9NA 3KSMA 2H29A 5DP2A 4O25A 4CODB 2JFFA 2HJRA 3EEIA 2DFLA 1PWYE 4B3GA 4WN3A 1E9EA 4YS6A 2J7KA 4O59O 5HGXA 3D7KA 4AQ7A 3H0MB 4F2WA 1NR7A 4IUCS 1ZW1A 1ZISA 4WEQA 1L5RA 4D57A 3R3YA 2VUTA 3NANA 2C04A 5F5LA 3D7NA 3A26A 4YUXA 3WJ1A 3N28A 2O8EA 1ZUNB 3L79A 5KFXA 3TCNA 2DBZA 4QHTA 1UBJS 4OJMX 4B80A 3B13B 4D02A 1OTHA 2GYVA 1CVRA 3GV7B 3A9RA 2O5RA 1QQBA 2DJ5A 4DL6A 4YP9A 2C2RA 4QQKA 1Z1BA 3KALA 3KOWA 1LDYA 2PT5A 2H2IA 3VSBA 4DRXB 4GI1A 5KFPA 5TS3A 5J0PA 3OGUA 5K8VA 4XAQA 3STHA 2HQRA 4O02B 3WLHA 5T4FA 1U4NA 5D3QA 5C35A 3EQ2A 1Q1QA 4M8SA 3UB2A 4Y0AA 3G6WA 2AVDA 3DE7X 5EIWA 3LWMA 4MJXA 1CB0A 3RSCA 5I8PA 4NC9A 4J9OA 4P3XA 3NHZA 5K0BA 1WPQA 3DAGA 2QJWA 4NY1A 5FORA 3DV0A 1QANA 1PGQA 1X39A 3PGVA 1KP2A 1PK7A 4DEXA 1NVTA 3WWDA 1QPGA 3JVIA 3KLOA 3DOOA 5LZ5A 1IHOA 1OGYA 1N2BA 1H1DA 1FDUA 3WL6A 4LI3X 4ER3A 3RB8A 2Z6UA 1T24A 2B9VA 3R9KA 4X8HA 4IFIA 2YHIA 1RKVA 4GOND 4ZHQF 3U6BA 1QZ3A 5DXAA 1H2ZA 2TMDA 4D0RA 3ZIAD 2XNDD 4OK5A 3BAFA 2QTHA 1AUPA 3LT5A 3C97A 4UEOA 3B6ZA 2Y0PA 4C8OA 5HOQA 2GS9A 3WL5A 1OSNA 1PEDA 3EA5A 4RZUA 4PFJA 2C9CA 1KRWA 3PQFA 5BNIA 2NV6A 1DIHA 2W6JA 3C29A 3V8EA 4BGUA 5F51A 4C0ZA 2PA3A 3Q3EA 2BP7A 3E4DA 4TMZA 3CCCA 1Q0SA 1ODKA 1O89A 2Q0HA 2A3VA 3GLHA 4J9RA 1M6WA 2CUNA 5C1OA 2GZAA 3GCXA 4JUBA 1G6KA 1GXSB 4YMVA 4Z6FA 2LM1A 3SSMA 1IWBB 3L7IA 1JIHA 2RDIA 4QO8A 2PS3A 4QC2A 1MJFA 5F21A 3M8RA 2H7XA 2VDUE 2CV0A 1DKUA 4R9UC 4DR4B 4MRRA 5CDGA 3A9UA 4TMFA 2I8CA 4GOKA 1NMZA 3T94A 4ZC1A 2RCYA 2Q46A 2OWDA 1HDIA 4KDCA 1R6AA 5DHUA 2JGJA 2G6TA 3LDGA 5KG2A 4YRQA 5AW2A 1U7OA 4XQ9A 4H60A 5IT4A 4QASA 1MT0A 2VSXA 3WSWA 4QLBA 2ZUDA 1JYSA 4A5SA 4WFQA 2IA6A 1S3GA 2I54A 3GUVA 3SIRA 1TAHA 4XM1A 2IBTA 1ESDA 4HYQA 3OEEA 5LP6B 1Z4JA 4EZBA 1UKCA 5AI0A 3T5KA 4PSKA 4GI7A 2Q7DA 4NZOA 4RWZA 2C82A 1A9QA 2PLAA 2ZSJA 3ICWA 2VXOA 1KARA 1ZOPA 5AK5A 2J3IA 4L4SA 3BXEA 4R40A 2PX0A 4A7PA 2PH7A 3FKJA 3I12A 3UCFA 3OAAD 1IN6A 3ROEA 1NI4B 3E58A 4DIUA 3A28A 4J3JA 3KD3A 5DGXA 2E8NA 1O96B 3CNHA 3CGWA 2ONCA 3H4VA 1ORDA 2ECOA 1JPNA 3HPRA 2OORA 5JARA 1N6OA 3IP7A 3RF6A 2F1RA 1VSTA 2HCTA 3CO5A 3WHLA 1ZZEA 3AEKA 1EQ2A 1GCGA 4MRAA 3ZCPA 2XQKA 4YQFA 3MHTA 2JIDA 4OB7A 4JY7A 1C30A 1ISJA 1ST2A 2AQKA 3SHWA 5J43A 3AUYA 2PI5A 5M04A 4RLHA 3VO8A 1GZ5A 1V38A 2VH5R 3OQMA 1PW7A 1J5PA 2JC3A 2Q6OA 4A6DA 2P2SA 4IDOA 2GJ4A 2BH9A 5HDQA 3NWOA 1WSAA 2RGWA 4H4CA 1NW7A 4JWNA 3DDHA 3RANA 3E9EA 3JD1A 3NHSA 3RK0A 4KFRA 2LUOA 5KFKA 4WBNA 4MA4A 4DM4A 5CA1A 2PS0A 4WESB 1OZAA 2DX7A 1V37A 5AOAA 3WKEA 3AW9A 3PNCA 1U0OC 2HA0A 5JASA 4R1TA 4B9LA 4AJEA 1R4ZA 4R2XA 1D3AA 5IAGA 1ZUHA 3PXDA 1S76D 2WAYA 2R48A 1W0KD 1JI0A 4CXMA 4DCUA 3EZ5A 2C78A 2GPSA 2HSJA 1YS6A 3PEFA 2C3MA 1Q14A 3ZLBA 1JG4A 5JD5A 3PRYA 2RGGA 4H9GA 4CCYA 1TECE 4HVAA 1EFKA 2EGUA 5KNDH 4JL6A 1AKWA 2OOKA 3AVXA 1YI8A 2H92A 1CHDA 3TYXA 4QQNA 1ZC3A 3BFKA 4TL7A 3BXOA 5AJZA 4E5NA 5H02A 2YMQA 2BFBB 3RSHA 5ELLA 1D07A 3KJZA 4IDPA 1OGIA 2V4ZA 4K0RA 1JPUA 5KFBA 4HB0A 3C4QA 1AG9A 3ANXA 1NC3A 2PANA 1SC9A 3H0CA 1XL1A 4TTQA 3MF4A 3LQQA 5KNDD 4UVHA 3RJTA 4EKGA 2D6FC 2W0MA 1H2FA 1GQQA 1JI3A 4MKIA 4ID9A 1ORTA 3JQAA 1OREA 1Z0IA 1H22A 2IXFA 3QNUA 4RD6A 2GAJA 3BIWA 3M6LA 2XOKD 5BSUA 4L1KA 3SQWA 4MA5A 4RCYA 1G8GA 1KH2A 1PL0A 2IVFA 4B6EA 1CRWG 5KFLA 2OECA 3UATA 1L4LA 4EK9A 1DC6A 4EHIA 1QHEA 4X60A 4YCAA 1ODFA 4ATNA 2WF9A 1PFQA 1N75A 3ZE7A 3LY7A 4KQWA 3DOCA 3GEIA 4YHBA 4YASA 2AC7A 2XCOA 3T38A 4OY3A 4PNHA 5K0FA 1N6HA 3Q9NA 2JBAA 4Y6LA 1I4EB 3H5TA 1FDWA 4R51A 3K16A 3INYA 4ZYZA 1Z0FA 4LC9A 1PV2A 3Q41A 2BEUA 2AFHE 5KINB 3AF3A 3E9MA 2GEDA 1MH9A 5FT9A 5IAEA 3EWAA 3KKAA 4UUNA 1GTG1 1P6QA 2J7PD 3EX7C 3LF2A 5JU5A 1SBQA 4RQ1A 3GDGA 4QZAA 1C9KA 2VJYA 3BA1A 4N6GA 3FYCA 5DYTA 1HLFA 4PC2A 4B9SA 2ZATA 3FDJA 3KTOA 4Q6BA 1WBBA 2UYCA 4EQZA 2A0KA 1PR5A 1YFZA 2YZNA 3CGGA 1W87A 3KCQA 5FPTA 1EQAA 5FKJA 2HHQA 3LIPA 5LN1A 3E3LA 1ADJA 1A77A 4U6SA 5LQSA 1T13A 4IX9A 3JPTA 3VTFA 4AYTA 2VA2A 3FVVA 3OQJA 1F2VA 5ILOA 1A69A 4KBYA 3GFFA 2PTHA 4C7VA 1DDOA 5KOIA 3W2HA 3FMOB 5DM60 1XD8A 3AU9A 2BKAA 4E5MA 3NNSA 4L3VA 4POOA 3HYRA 3AW8A 3IPRA 5FTJA 3ZGZA 4B9VA 3G5AA 4GPZA 4IDGA 4C7YA 4DNOA 2V7QA 4PANA 2HOIA 2Y0SC 3NWBA 1KY5A 1KYXA 4BWMA 1I5OA 4X61A 4YP3A 2YFHA 3Q5GA 4R8SA 2IZ5A 3TQ1A 2CMDA 2H85A 3TDNA 4KIWA 4RQ5A 1SRQA 1NW3A 4FWBA 4NU8X 4ZV4A 3B89A 1ZRSA 1Y6GA 1ZC4A 2I99A 2C9DA 3ENQA 3VOSA 2QX7A 3ZDEA 4AN4A 2DQ4A 5E6UB 1Z6ZA 3OZDA 2V9PA 4C4RA 1PT7A 1WCIB 5HKLA 4BX0A 3R23A 5DFAA 5TS2A 5TF4A 1KBOA 3F4LA 1CI4A 2W9XA 3M6FA 4GXKA 1NKTA 3ILXA 3TFOA 3RU3A 5CX1A 4WLEA 4ZQBA 3KOZA 1W36B 3JX9A 2ZXEA 4CDRA 3NBUA 1DP4A 2IZ7A 1GGHA 3M6AA 3K1ZA 2X0NA 4ARVA 3ELWA 2VDMB 3B5EA 1V5FA 1EVJA 3LCRA 1BJKA 4JX8A 3OZIA 3QI7A 1AZLA 2VP4A 1SXIA 4IIFA 2C7RA 2PXHA 4RQ0A 4QHSA 3S29A 2QNIA 3T54A 3NIGB 1PK1A 4E2XA 3KJFA 3OFSA 4XSHA 5DHTA 4IRKA 2AZDA 3OE7D 1MB4A 4CM9D 1W581 4JH0A 4BVLA 5DRYA 2DWOA 1IY2A 3I73A 2ZSKA 3OUZA 3MWJA 2L19A 4EM6A 3MB8A 4KO1S 4U3JB 1WXIA 2HL6A 3W9YA 1TYAE 5KSZA 2E0IA 4U2GA 1SBNE 2OKCA 1TQ8A 4WKCA 5FI5A 3N86A 2IX9A 3EVFA 3I9OA 1HBJA 2J6CA 5H0IA 1X7ZA 2ZPAA 1U3UA 2Q6VA 2ZJ1A 3MUEA 5KL1B 3WJ7A 3BAZA 4BMPB 3LK9A 1CR6A 4IR9A 2Q9BA 1VE9A 3VNVA 2WI8A 1T6NA 1JVBA 5HJ2A 5CCDA 1R8SA 2F1IA 4L3WA 1JLMA 4AQDA 4CL0A 4LJ7A 2RAVA 5JJ5A 1QH0A 1ZRMA 5EJ2A 4TZ0A 4ZJZA 4OQDA 3QBJA 4DM7A 4W7IA 2C00A 1JR2A 4LN1A 2O7RA 4DL3A 1CK4A 4D0GA 2BI4A 3V9AA 3E2MA 5BUZA 3C6ZA 1UOQA 2HEGA 1XMPA 4HGNA 1WO8A 1WYGA 5E1MA 1XAHA 2WLTA 3CZPA 2C57A 1C9DB 1I80A 4ZAFA 3TSYA 1L5OA 4L51A 3BTVA 1EGAA 3STYA 2NM0A 3BL6A 3S5UA 3OZEA 4Q15A 2D0DA 4DUPA 3FNBA 1FRZA 4LOKA 1PFVA 7GPBA 2B2NA 1HLDA 5ESDA 5J4VA 1KVUA 4L72A 1FUYB 1RTTA 3DE2X 4DWJA 5CH8A 3LZ6A 9ICAA 4U7FA 1VA5A 2R1TB 4F3OA 3RS2A 4LSMA 3NO4A 1AV6A 3PHBE 2OWEA 3RLIA 4XWWA 2H3QA 3PF8A 4X1KA 4J2HA 1DX4A 2CY0A 1LH0A 2ZJBA 1I4LD 1BMTA 1OI7A 4C0KA 2ZPTX 4ZOQI 1Z5OA 3OT5A 3BF8A 3MYRA 4UB8U 3LPDA 1DAEA 1T29A 5AI5A 3OJXA 3ZS9A 3QXHA 1QP7A 1U9IA 1PZGA 2V4MA 1WAMA 1RM4A 3V1TC 3TG2A 3AMVA 2EFYA 4WL0A 2DTDA 2OXTA 3REQB 3ANMA 1KI4A 2WJJA 2X8WA 1F7UA 3YASA 4OEHA 2VP2A 3HSSA 5IYZB 3EVZA 3QVTA 4NYMR 4YAWA 3CR3C 4UBBA 1UPUA 1P9WA 1QKJA 4DLLA 4B73A 1PT6A 2DUNA 3JZIA 1WR8A 4MKFA 3A2KA 4MPDA 1T5HX 2ZIVA 3SEIA 3RAXA 4Z53A 5IILA 1JG7A 3EIEA 4ES6A 3V8BA 3ABQB 3RHTA 2V5UA 4NPAA 4HGYA 4J9NA 1YDFA 2C28A 2IYUA 2CC2A 4BV9A 4DBLE 2YB1A 4PCUA 3PSPA 2Z2XA 1I1OA 1T36B 3TVYA 4IQ8A 4HGRA 3OO0A 5AOVA 3MJCA 2C7BA 3D4LA 4RELA 4J7UA 1QG4A 7ICQA 2FMXA 2QG9A 4QAJA 1YR7A 1K6MA 1VJTA 1A9OA 2HT6A 3LLUA 1QGUA 3UC5A 2G9RA 4PZDA 1B0AA 1D2NA 2OG2A 2Y3IA 4AWXA 4Y6RA 1SIUA 1FQKA 1NM5C 3O4RA 2QAGC 4JUFA 3KRTA 1F8YA 4HH4A 5JJBA 1E96A 4MRSA 4LEIA 3PW2A 1PJTA 1QTNA 4LBYA 1NKCA 3I9KA 1L7OA 4P9NA 3WRXC 2OBBA 3VKHA 4AUMA 2CEAA 2PSEA 5JQWA 1GNPA 1NNI1 3MMSA 1V48A 4KR0A 4ONEA 2WF5A 4YAEA 1XKXA 2WWIA 1QYIA 3F1KA 4B43A 1U1CA 1R9NA 4RK5A 2DPXA 3NPMA 3IEIA 4GPEA 2BHNA 4BRWA 4LKRA 1X3SA 2J9YB 4D4GA 1QOQB 2ZS8A 2WHPA 5BOMA 3OKCA 4R1OA 1K4KA 2A5GA 5EQDA 3V2UA 3KL4A 2C0QA 2RGCA 3JR7A 3W90A 3B2QA 2Z9CA 5JH7A 4PC7A 2PQ2A 4R05A 1TF2A 1FP7A 3KETA 4I2HA 4CIBA 5JVDA 4PLGA 4ZEMA 4IQ0A 1WABA 3EDMA 4AX4A 3GUCA 1AQ6A 1J39A 4IZOA 2JAWA 5J8YA 2OHXA 4BC1A 4EBEA 4JLDA 1U04A 4U4AA 1L7BA 1KFKB 2EV9A 3DZCA 3GLGE 3PDCA 2WTXA 2PNJA 4HNAB 5EHZA 1ZH8A 2VJQA 1T1SA 5FOUA 4D44A 4R2MA 5CYGA 3WMFA 4FFBA 2F9MA 2FZLA 3RVLA 2F3SA 5AM4A 5HR5A 1SGGA 2NUBA 1YQUA 4C0SA 3D5EA 2P6NA 4DJEC 4ME6A 4HH0A 2FXVA 4JCOA 3LMKA 1WE2A 3GDWA 4BLTA 2AGOA 1T0IA 2WYWA 1WXHA 2RHMA 1U9IC 5G4KB 2XRMA 1Z7YA 2WD7B 3IV9A 1LWNA 5KTSA 1QWSA 2FPPA 4BKMA 2CYCA 1NJFA 3UK6A 2SHKA 9ICLA 5IKMA 4B44A 1UFOA 4KE9A 4GI5A 4N41A 1CUBA 2QZ4A 1C8KA 5C5JA 3UMJA 1VPEA 2GO1A 4OSOA 2G9ZA 4UM8B 5A4JA 5GOTA 2Z9BA 1WHTB 4ZQIA 2PRIA 4MARA 2ERYA 1R6BX 4KPUB 1YACA 1Y8QB 3RSZA 1A50B 1VBNA 2AN3A 1VMIA 3MFYA 1X1AA 2E1FA 4QGGA 2BVNA 3Q3HA 4XLTA 3W9BA 2RGBA 4EY4A 2VZ8A 1Y5NA 1N4DA 3DMHA 4ESVA 2QX9A 1JXMA 3K4HA 4Q0MA 4N3BA 2G4LA 1SXJB 2PFSA 1JLHA 1VYVA 4UTVA 1HOTA 3R24A 3JPWA 2ZQZA 2AE1A 2KJQA 1L3IA 4NBLA 2CB0A 2FZEA 3C8ZA 3AONB 3UB3A 5SZHB 5G41A 4M9XA 3A6KA 3CV3A 2YIJA 5HQJA 4QVIA 1XLTA 1R9MA 3B1JA 4MRNA 1RC8A 1EU1A 5IVKA 2O2CA 1XTIA 1U63A 3MUOA 3GO4A 3HP4A 3M89A 2ZJFA 4CNQA 4QARA 4L08A 4S1OA 4ETMA 1M75A 4QTYA 1JLKA 3I72A 3MGCA 1HYEA 2ZRPA 1NAIA 2BFDB 4UBJA 4EQ6A 5J0OA 3T3MB 3AIIA 3GT7A 3NGMA 3M6IA 1O6CA 5IVHA 3NALA 4K9KA 4Q6WA 4ZIRA 2EQAA 5I7SA 1CEYA 3TQQA 2XUZA 1FDVA 2LKYA 1LSSA 1EP3B 1AOXA 3U7QA 4GFJA 3NBQA 4EG8A 1E2MA 2ZYHA 4JEMA 3EULA 3W7VA 3TRDA 2C4UA 3QKSA 3V97A 3IHQB 3AETA 1JMVA 1W4ZA 5JJCA 2OP1A 1JZSA 4HWRA 3OICA 1OZ0A 2PD4A 3EMDA 1LBHA 5DG8A 1S01A 4YVFA 3OCJA 3GT0A 5HCUA 5EWFA 1UZUA 2V96A 1KSHA 4WOJA 2HAEA 3UF0A 4B35A 3MIZA 2CGEA 4KP7A 1VTKA 1BNCA 1TYBE 1U0NA 1SL2A 5D7NA 4IHJB 2LBPA 3KPWA 1XAGA 8ICEA 3AL3A 3DLTA 4P31A 1M6VA 3D3KA 3NIBA 1OBHA 5BMOA 4LXIA 4UXHA 2PO5A 5FBVB 3RI3A 1ULAA 4MO2A 4RIIA 5EQJB 4PIPA 2V4UA 4AZTA 3HEBA 3ADOA 2CJFA 3UMCA 4N9WA 3WYBA 4FZMA 4X7MA 3ROMA 2DQZA 5BSWA 2NXEA 2UYYA 4C3OB 1FYVA 4JI4B 3JD2A 1IHPA 3L8YA 7ICNA 4R1NA 2X7JA 2RHTA 3AOEA 4HXEB 4P4SB 4PW0A 1T9GS 4ALNA 1K89A 1PFUA 3RC2A 5BSFA 5FLKA 1D0IA 3SIXA 4JBIA 1C41A 1YQTA 3M82A 2FSUA 1IHDA 4JLJA 5C8ZA 5E38A 4PLTA 5JNTA 3UMGA 5ETJA 4OF4A 3RFFA 1K88A 4ALIA 1UQVA 2F67A 5F1YA 4Z1MA 1NJXA 1XVTA 1C80A 3S1LA 1W4BA 1TTTA 4HV4A 3OOSA 1R0WA 1G8FA 3EMVA 4HVCA 3QU9A 2V98A 4WZBE 2CXHA 3DHWC 3RIYA 3HW8A 2D8MA 1M3SA 1CUKA 3I0NA 3NFRA 3OZTA 2GO7A 1PV4A 1P5JA 3PGXA 1CR4A 3HL0A 4K9RA 1RXCA 4LHZA 3P9RA 1RADA 1YONA 4WK0B 4EPTA 1S7CA 3TG8A 2VHWA 3IALA 5GJCA 1ZUIA 4ABTA 3L2OB 5BYBA 2W7PA 4MITA 4IGAA 1I94B 5IDWA 1KE1A 3UYKA 1QP4A 4ZYTA 1DLIA 1AKTA 3AG5A 5A3SA 4GBED 2BKUA 3N7RC 3S2EA 3LHKA 3ZV6A 3P2IA 1KY2A 4E21A 1JQBA 4PICA 2D74A 3ANYB 4N40A 2FZ5A 3JQCA 5KC8A 1V0JA 2G4CA 5DDIP 2IYVA 1QFJA 3NHFA 2QVCA 5BXQC 3QU5A 4KREA 3UUFA 4DR5B 4FYKA 2NPOA 1H3NA 5EHQA 4YR2A 5KDOA 1EGHA 4UZEA 4O33A 4JBWA 3SM3A 3ZU4A 1T9CA 1GTJ1 1M2KA 3DBHB 4OHVA 2QTVA 4ND4A 3ZNOA 3E8XA 1XZJA 1FFUA 4KH1A 1KEEB 2QZJA 4D9JA 5GTDA 4URZR 5IIMA 9ICWA 3DLCA 4L9AA 3WMXA 2XY7A 1ABBA 4YCLA 4BOYA 2AJBA 4G0ZA 3TMYA 4HDCA 4TLMB 1AKQA 4RPZA 2OXOA 3HPQA 2X1LA 1UAYA 4M3NA 4KNYA 1JL3A 4ESHA 3L1UA 5DDMA 2ZIXB 1WWKA 2CDAA 2CXUA 1C29B 4XQEA 4WA8A 2XYGA 3LUKA 4KCGA 2RLTA 1WMAA 2ZRJA 4O5KA 1XQYA 2NZJA 3D8SA 3PTLA 5ABPA 2A2ZA 4NBUA 3R3ZA 1YFLA 1KDRA 3LZCA 4IQUA 1II0A 3GGJA 5GQSA 1G8HA 4X6LA 3CLHA 1OWOA 1BE1A 3RUHA 4ZYUA 2W2MA 3JV7A 4QWAA 3GGSA 3FPFA 1QG2A 3ETDA 1U1EA 3TR5A 3T5HA 3COWA 1UBEA 4LZWA 4UB1A 1TM4E 3DTVB 2ZP1A 4G5GA 1ZOOA 1FTSA 2DBYA 5GZ3A 3JQ8B 4PGQA 1ECBA 1XEXB 4L0QA 2R6DA 2YRWA 1SUBA 1JWBB 3RR8A 4YBZA 5KVAA 2X5JO 8ATCA 3UB4A 1ORRA 4FIZA 3C6YA 1EB8A 3LW7A 1ECCA 3DZBA 1S0MA 5ECDA 1UC8A 4PSUA 1XPUA 4RCVA 2W2TA 4ECUA 4M0FA 4PZCA 4CHTA 3ZGYA 1BVYF 4BTVA 2OFFA 5IKPA 2XRFA 4QZFA 7REQA 1MAUA 1OAOA 4QUAA 5CBPB 3OQVA 2E4AA 5DGCA 3AR4A 2X0FA 4NOJA 4Y2VA 3A1NA 1IXRC 3W8DA 5KYYA 1TMOA 8ABPA 3U56A 1U11A 4LJYA 5G5HA 4OAOA 4I3GA 1A7JA 1E1CB 4G25A 4YT4A 1PD0A 3QZ8A 2FX5A 4MQLA 3LNTA 2WNIA 3K4GA 4KO2S 2DPMA 4BWVA 4PZOA 4YQYA 1QE5A 3DPUA 1B26A 4NLZA 3KKKA 4JSYA 5KCMA 3S5JA 1F9AA 4F4FA 3IV6A 1BXKA 2ZYIA 4ETNA 2XGMA 3HZRA 4NAVA 3NVMB 1G3UA 1DE0A 4FKMA 4G0YA 4EY8A 3EUFA 4TLLB 2V5VA 4ZT2A 1IBRA 3A2LA 3FYTA 2Q4BA 4GW3A 1XYVA 3J81A 1O0SA 5J4HA 3TKAA 2LZ0A 5H3HA 2W3SA 1HLGA 3C87A 2ZIZA 1DBWA 2CLDX 3R7AA 2QLMA 4MQFB 3NVZA 4BQFA 4P0QB 2H1LA 1QS0B 3QWHA 4JC5A 2YXBA 2KTQA 1S2GA 4M38A 4HQRA 2H54A 4YJHB 4E70A 2C29D 3I92A 3KJGA 4U63A 2ZT8A 3PR4A 2WWXA 1ZR4A 5HMMA 5KFJA 2EW2A 5DHAA 3EVEA 2ADFA 4C4SA 1RYRA 2HBRA 3ABRB 4E14A 2GN1A 1L8OA 1PVRA 1O94C 2EX1A 1NQTA 3EJ6A 3R3WA 2C96A 1F4VA 3V8MA 3KKLA 3NXSA 2WNSA 4XUGB 5IVIA 4DDVA 3EMBA 1PVPA 2C7OA 1PK9A 4Q4CA 3ERCA 4F5DA 4ZJYA 2C9OA 2A19A 1W5FA 3C1UA 2EJCA 2D06A 3C5GA 4J76A 4YACA 2EJWA 2XPCA 2OSBA 4I8IA 4MYTA 2R66A 2IYQA 1YRQA 1QGAA 4BB0A 1KXZA 5DNVA 4B4KA 2O0LA 1NVBA 2QB5A 4X66B 4J90A 2Z2YA 3JWIA 3PC4A 4DXHA 1X7GA 2PM8A 3BD8A 2UZAA 1EHCA 4F3YA 3FHLA 1USIA 2DTXA 4LE2A 3GA7A 2I2WA 4QUGA 4REMA 3PP8A 3KSZO 2FMHA 4RHTA 3SF8B 3MS4A 3CNBA 1IM8A 1UEIA 4HB2A 1WSDA 3PC7A 2VDPB 4UNSA 1NVAA 4QPCA 4S1NA 2F43A 4F9TA 4EG5A 4C4XA 3NKLA 4MAFA 3LQFA 4PGAA 4MSUA 2WHYA 4J9MA 1IBKB 3TI7A 4LJSA 3A1SA 1MTOA 3K15A 2J4FA 3RG2A 5JZ9A 3PW0A 1BHSA 3GZTB 3P45A 1ZMTA 3PFGA 2DVMA 5JEEA 4K6FA 2ZB2A 2P9JA 3LLVA 4YR3A 4IIJF 1T5DX 2L17A 1E79D 2ODNA 5KHAA 2RHDA 2BMWA 4DUYB 5DP1A 1YAHA 4R2IA 3I61A 2PMZF 1ULSA 4TTVA 2GN8A 5KVSA 1OAOC 3CEHA 1DCFA 4PXYA 1DKPA 1W75A 3FMPB 5A5EA 1NI3A 5LA6B 3QIAA 2YFKA 2CLCX 4RAOA 2QIOA 3M6WA 4QG7A 3UPDA 1KJ9A 4Q03A 3K35A 1M5UA 1C2YA 3PW5A 4NZMA 5MN6A 4IHJF 2QQEA 4NXMB 3B5JA 4Z9YA 3V72A 2GESA 2Y93A 4K1LA 4WV3A 2VEDA 4JLMA 5LCXA 1IMOA 3LWLA 4Y7CA 5BRJA 1X77A 1D8BA 5J0QA 1MQAA 1NN0A 5CLHA 5A03A 2JFXA 3V5NA 1NY5A 3LM8A 3FVRA 3KB2A 3HJEA 3AVTA 3DV2A 3AILA 4PBSA 1MO4A 2VIXA 2OCAA 1E7YA 3RNOA 2PWYA 2DAPA 1VJGA 2VNHA 3ND6A 4EHJA 1B8VA 1D6SA 3H9BA 1Z17A 1ZH4A 2PBRA 4KLAA 4RAQA 2P6MA 1TUBA 1KO4A 1E1LA 3EGWA 5AHRA