3DV9A

Putative beta-phosphoglucomutase from bacteroides vulgatus.
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
246
structure length
243
Chain Sequence
b'SNAMFKEAINNYLHTHGYESIDLKAVLFDMDGVLFDSMPNHAESWHKIMKRFGFGLSREEAYMHEGRTGASTINIVSRRERGHDATEEEIKAIYQAKTEEFNKCPKAERMPGALEVLTKIKSEGLTPMVVTGSGLLDRLNHNFPGIFQANLMVTAFDVKYGKPNPEPYLMALKKGGFKPNEALVIENAPLGVQAGVAAGIFTIAVNTGPLHDNVLLNEGANLLFHSMPDFNKNWETLQSALKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords beta-phosphoglucomutase
molecule tags Isomerase
source organism Bacteroides vulgatus
publication title X-ray crystal structure of putative beta-phosphoglucomutase from Bacteroides vulgatus.
rcsb
total genus 76
structure length 243
sequence length 246
ec nomenclature
pdb deposition date 2008-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3dv9A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3dv9A01
2G80A 2JGAA 1O03A 1ZJJA 2P11A 3CZ4A 3KOOA 1RMQA 3OCZA 1EK1A 2YJ3A 4EELA 3AR5A 4XE5A 3TLMA 2RB5A 1T5SA 2B8EA 4DCCA 3MMZA 5AI4A 2G06A 3QU9A 4DW8A 4Y2PA 4F72A 1RKVA 2HF7A 4CF3A 4UU1A 4UMEA 5AKYA 2JAUA 4UU0A 3N8GA 2NYVA 4EX6A 3N5KA 3WGUA 5AVUA 2G07A 2QLTA 2WHEA 4NV0A 1XPJA 5AI0A 1LTQA 2B1QA 4OHFA 3PGLA 4YCNA 1NNLA 3QU7A 5AW8A 2YMMA 1YMQA 5ALKA 2IOFA 3WK9A 2FEAA 4KX3A 4L6AA 4UAVA 2FI1A 4ZEVA 2Q4TA 2DQSA 1PW5A 2ZBFA 5AVSA 2WF8A 3MN1A 3N1UA 3OCYA 2AMYA 1RDFA 5AICA 2W11A 2I7DA 3U7FB 4NWIA 5AW3A 4FFDA 2OM6A 4Y2SA 1L6RA 3KD3A 2O9JA 3I1YA 3AR8A 2MU1A 4O8CA 1S2OA 1U7PA 3E84A 3UMGA 4HGRA 2YMLA 3L8GA 3QUCA 2JAWA 1WVIA 2I6XA 3QGMA 4HGPA 1RKQA 2CFSA 1QQ6A 5E0OA 2NO4A 3QU2A 5ALLA 2QYHA 3UMCA 4HGNA 3ZU6A 1TJ4A 2I33A 3ZVLA 3D6JA 4RESA 5ALTA 4UM5A 3N28A 3W5BA 4OD0A 2CN1A 3QUTA 3B9BA 4IG4A 1TA0A 1NF2A 2PR7A 3L8FA 5IS2A 3ED5A 2FPSA 4Y2XA 3AR2A 5AW9A 1VJRA 3FPBA 5AKIA 3U19A 5ALEA 2I54A 2B0CA 4EEKA 2YBDA 4BKMA 5ALNA 2MU2A 2GO7A 5ALUA 5AW7A 3NUQA 1TJ5A 1SU4A 4UASA 4Y2YA 2I55A 5AKXA 5JJBA 1ZD5A 5AKHA 1LVHA 2FUCA 1SWVA 1RMYA 5ALGA 2JARA 2OYCA 2C88A 2WF9A 1T5TA 3ZVNA 3AR9A 2WF6A 3BWVA 3WK6A 4QJBA 1N9KA 2FPUA 5ALWA 3ZWDA 3WK4A 4UMVA 4UMDA 1AQ6A 5ALVA 2CFRA 1U2SA 4XQ0A 4BYGA 1S8OA 3WKDA 3N07A 3NANA 4FYPA 2G08A 2HO4A 3NASA 4OCZA 3ESQA 4KN8A 3OCVA 2WM8A 5T41A 4YH1A 3SMVA 5ALZA 5AVXA 3K1ZA 1T9ZA 2EARA 4NFLA 3OCXA 4B6JA 2ZBGA 4BX0A 4HGOA 3FGOA 1RQNA 2HI0A 5AW1A 5ALRA 5ALJA 3AR6A 3ZTWA 3KC2A 4AS2A 3L1VA 4KYTA 5AIBA 2W4MA 4Y2TA 1X42A 1N8NA 4BNDB 5IT0A 4AS3A 1L7NA 2MSNA 1K1EA 3PGVA 3F9RA 4YIHA 3L8EA 3L0YA 3B9RA 5ALXA 4F71A 1Z88A 3QUQA 3EF1A 4J2TA 5AVRA 4YGYA 4JDPA 2HSZA 2D2VA 1L7OA 3I6BA 3OCUA 3QYPA 4KNWA 2GHTA 1JUDA 3WKCA 3L0BA 2B8JA 5AI6A 5ALPA 1RQLA 3A1EA 2W43A 5AK3A 1CQZA 4I9FA 5ALYA 1Z4JA 2G0AA 4MWOA 5AVQA 4OFZA 2ZG6A 3UMBA 3OCWA 4L6CA 2P69A 3KBBA 3AR7A 5IT4A 1L8LA 1RRCA 1RLOA 5AM1A 3WK8A 2R8ZA 2PQ0A 4CNQA 4IFTA 2OBBA 1NRWA 3QU4A 5AW6A 3ZW7A 4BEVA 3KDPA 2CFTA 2Q4RA 1ZD2P 1SWWA 3U13A 2EATA 3A1CA 3HLTA 1WPGA 2NO5A 1ZOLA 1Z4KA 5AKZA 3B8EA 4KNVA 4XPZA 1ZD3A 2FPWA 3QUBA 5AVTA 4XOUA 2BY4A 2R8EA 3NRJA 3FPSA 2IYEA 2FPXA 1YDFA 3GYGA 1KYTA 4UATA 5AM3A 3QU5A 5ALFA 4CE6A 4Y2RA 3U7EB 5ALMA 2OA0A 3SKYA 5A3RA 5AM2A 1Z4LA 5AI9A 1QQ7A 3U7GA 1Y8AA 2WF5A 5FP0A 2C8LA 4UMFA 2YJ4A 2HX1A 5AW5A 1XP5A 2YN4A 5ALIA 4Y2VA 4EZEA 4CF4A 4BBJA 2RAVA 4QQFA 1MH9A 1Z5GA 3R9KA 3P96A 5AKKA 3IB6A 3MC1A 3ESRA 2G1AA 4J03A 3SHQA 3MPOA 2WFAA 4UM7A 5ALOA 1IWOA 4GIBA 2FUEA 3DNPA 4KX5A 3CNHA 1Z4QA 2BDEA 3U7HB 4AP9A 3PDWA 3SLRA 2IOFK 3WKAA 2C9MA 1Z4PX 1L8OA 5A3QA 2AH5A 2YMQA 4Y2QA 5AKGA 2GHQA 5ALQA 3SD7A 3L0CA 2RBKA 3ZVMA 3QXGA 1Z4OA 1YNSA 3A1DA 3A3YA 1Z4MA 2B30A 1L7PA 3ZTYA 5AKEA 3R09A 5AVZA 3SF0A 3WKBA 2HCFA 3IJ5A 4C4TA 3R4CA 3DDHA 2HOQA 3L1UA 1RLTA 3SKXA 2YY6A 1ZD4A 3EPRA 1ZRMA 2AGVA 5AW4A 5AW0A 1RMTA 4PNHA 4BX2A 5AW2A 1RPZA 3EF0A 1U2TA 2ZBEA 5AVWA 1U7OA 2HHLA 4YIKA 2GFHA 3NALA 1YJ5A 4DWOA 3FZQA 4BEWA 1Q92A 5AI8A 2C4NA 4Y2UA 2ZOSA 1QH9A 1Q91A 4G9BA 4L57A 3J7TA 4MUMA 2FDRA 1CR6A 3E8MA 3ZI4A 4EENA 3IRUA 3VAYA 2HF2A 5ALSA 3ZX4A 3FM9A 1Z4NA 3WK7A 2JAOA 2YFYA 3M9LA 1WR8A 4Y3UA 2P27A 2C8KA 4BX3A 4BNDA 3U26A 1RLMA 4NABA 5AI5A 1Z5UA 5A3SA 3E58A 5AKLA 3DV9A 5AVYA 4UAUA 5AM5A 2ZXEA 5AK4A 5AIAA 2O2XA 1YS9A 3ZX5A 4YCMA 3EWIA 2PKEA 3W5DA 1EK2A 1Z4IA 3S6JA 3QLEA 5AM4A 5AK6A 1J8DA 3WK5A 4HYTA 2ODAA 3QNMA 1F5SA 1ZS9A 2X4DA 2FPRA 3ET5A 3QX7A 2BDUA 5AK5A 4UARA 2IOHA 4H1WA 4HAIA 5AVVA 3ZWKA 4YCLA 1VFPA 4UW9A 3OTQA 3ZUPA 5AKJA 1U02A 3UM9A 3I76A 2R8XA 2B1RA 2VKQA 3W5CA 4E88A 2ZBDA 4I9GA 3OPXA 4CF5A 2GMWA 2IA5A 2G09A 4RETA 2HDOA 2B82A 1TE2A 1L7MA 5ALHA 4EX7A 2YJ5A 2HEGA 5AESA 1FEZA 2RARA 1TJ3A 4HGQA 4ZEXA 4NAVA 3AR4A 3ONNA 3RFUA 3W5AA 1RC8A 5AM0A 3WKEA 3HYCA 4ZEWA 3RF6A 2EAUA 1XVIA 3FVVA 1YV9A 3KZXA 3L5KA 4G63A 2Q5EA 1QQ5A 1VJ5A 1RKUA 2R8YA 2P9JA 4JB3A 2YJ6A 3NAMA 3DAOA 1O08A 2I34A 3NIWA 3E81A 3ET4A 1QYIA 3L7YA 4FE3A 3BA6A 3AR3A 4C4SA 4GXTA 4Y2JA 3M1YA 4DFDA 3WGVA 2AUTA 5AHXA 5ALDA 1WZCA 3L8HA 3PCTA 2WF7A 3I28A 4C4RA 1J97A 2YMPA 1ZRNA
chains in the Genus database with same CATH superfamily
2Q3HA 1V71A 3PZPA 1QB7A 3SEZA 5LJIA 1ADGA 2ZYHA 5AJWA 3ZY2A 4DLNA 5BQXA 1VCIA 3FCEA 2C5HA 2EF1A 2W22A 3P9ZA 3CTPA 4GWLA 3WFZA 1BHJA 1SXJC 4TS4A 4UUNA 4BKRA 4BVFA 5CUQA 3TLXA 1G3MA 2W9BB 5DTJA 3L4EA 5A0VA 4Q1BA 4ROSA 4KIJA 5I6DA 1NW5A 3OTOB 1GZSA 1PR2A 3C3WA 4PN3A 1U0JA 1T0JB 1WQ3A 4GRDA 4U7PB 5FWAA 1EP3B 4GDFA 2AWNA 5AUPB 4MV9A 3X1WA 1IOVA 2IMWP 4HTFA 1HE4A 2FLPA 1UDWA 2XSZD 3AQEA 1TJNA 4Q66C 2WHEA 2Z3WA 3M1AA 2JZBA 1FJGB 8ICEA 4HEHA 1W8IA 2ZKLA 5KYUA 3KQNA 4CIBA 1JU3A 2G8LA 3CNNA 3PUKA 5C8XA 2HYIC 4EMSA 3KUDA 4PQEA 5J4VA 2AV6A 1ZVMA 3JASA 3SBXA 4CMJA 3ZE6A 4LJ5A 1VHJA 2QNBA 1XCOA 1WS6A 3EIXA 4L27A 4UBLA 5FOWA 1WYGA 2D5AA 2YUIA 5FOXA 3QKUA 5BPCA 4B7CA 5CB4F 1NI4A 6CHYA 2P2DA 5LBUA 2VJPA 4RIFA 5FBHA 1ZQIA 4UAVA 4CQMB 1Q6YA 2OM2A 3HKBB 4ER3A 2DLDA 2YWJA 3P0JA 4OP2A 4P84A 2J0EA 1N48A 3H5IA 3G0DA 3M6XA 3Q85A 3VNBA 3MN1A 1QPGA 3I52A 3JATA 4LKOA 2VQEB 1NLMA 2XIDA 3I3SR 2G8NA 1RXVA 4M88A 3H05A 3TLJA 4MJXA 4OBEA 4ZARA 2ODTX 3D6MA 1ZQMA 1HYQA 1K6MA 4WN9A 4JELA 3S2UA 1WUHS 1J21A 3ZIUA 1CJBA 1KOGA 4X94A 3Q7QA 1EVIA 4OQLA 5HCNA 2CXSA 3FVTA 2VYND 4FGWA 4BLPA 5I47A 1YS4A 1KVSA 3HJAA 2GAJA 1XO1A 1V5IA 1A9YA 2G28A 1FDRA 3F5QA 3VOAA 4ZOLA 3IESA 4HYKA 3VTFA 4DXAA 1H2XA 4PC1A 4PZAA 2NO4A 3E22A 4J91A 2ZR0A 4WQMA 1F4LA 5KFCA 5IJWA 2EFGA 1AS0A 1L5UA 3MS2A 1UH5A 2EFDB 4B47A 2I29A 3U4IA 1G5FA 4EY8A 3AM1A 1JHMA 3TIGA 2BFFA 1JXLA 1M0TA 3QELB 5ESXA 1GCUA 5AQEA 4JMUA 1O97C 1TA0A 2Y2UA 1IHXA 4KVGA 3RAPR 2PKCA 4C4OA 1VLQA 1PS8A 3BG5A 3L8FA 3ED5A 1FNBA 1I6LA 4QIHA 4WFQA 1ONBA 1WCXA 4ZVNA 5CK5A 3T5MA 3VV3A 2CCJA 3W7VA 1ZZEA 2X76A 4PYNA 4TMXA 1D2CA 4J4BA 2NSHA 3EBLA 3Q5GA 2W2MA 4HRXA 3R7FA 1JSXA 4EK9A 4TN5A 5PGMA 3RIGA 2BYTA 8GPBA 4BQSA 5JI2E 1GGFA 3FVWA 4JUDX 3OHAA 2QDXA 1FDVA 2OL4A 1KIAA 5IVPA 2P4QA 4MMXB 4R9VA 5I3CA 2O20A 2WD7A 3EGEA 2PRKA 3I6IA 1NL3A 1AUOA 1F51E 3PJGA 5GV8A 1FTNA 2OQVA 4AMGA 4QWBA 1KQ3A 3TXXA 5KNCD 4M1WA 3RAXA 1CE8B 1SUAA 2AC7A 2BFBA 2VK2A 4WN3A 3ZVKA 9ICCA 3PFNA 1GN8A 1QYRA 1U3GA 1SU4A 1UHUA 2Y9TA 1PV4A 1KY4A 3JR7A 1ZWLA 1JI7A 1CZUA 2J5RA 3NBMA 3ZWOA 1NHGA 1UBOS 1A96A 1G8FA 3G9ZA 4NPCA 4C20A 5DM1A 3RABA 1XD2B 2HWKA 4CODB 1K97A 4DBLC 4HTFB 5KZMB 1TVKA 4GL4A 4HH3C 4GVPA 4U3JA 2FW1A 3QF4A 3TJZA 2ADFA 3ADKA 2QVCA 3LHDA 3NETA 4DABA 4ER6A 4C7XA 1CY4A 3BMQA 2O57A 2W6JD 4QATA 5DB7A 1NXTA 1J8YF 1T4CB 3W2GA 1JDNA 3UGQA 4QOSA 3NTUA 4XQ0A 1FIQA 4GQBA 2EG9A 3WKDA 3AUAA 4J0DA 3IV6A 5G40A 1HDCA 1M1YE 4Q4HB 3KSBC 2Z6VA 1JS1X 3V1UA 1K27A 3UXEA 2W2KB 1N2OA 4FHDA 1TM7E 5AJUA 3KUUA 2ZTCA 2CB0A 2QJWA 3L0IB 4XYMA 2HMWA 4OQZA 4YH1A 3SMVA 2IEIA 2XTNA 5KG0A 1HLPA 1QTNA 1WHTA 1Y37A 2FCAA 3B3AA 3KEQA 3MCWA 5HHHA 4NVRA 3RU3A 7ICHA 1AM4D 1A9RA 2OC4A 3AI2A 3AFNA 4MQUA 1JB9A 1FX0B 4OB8A 1ZJYA 4LJAA 5LKAA 3DLHA 2AS0A 5KJFA 1RQNA 2HPAA 2Z2KA 2JH8A 5D1HA 2IDJA 2QROA 3IHLA 2VT7A 2WYVA 2OCGA 2X77A 2FPPA 3B6EA 3WNVA 2AF4C 4B71A 2ASDA 4Q9IA 1W96A 2A19A 3UXMA 2ZW9A 1E32A 2EFYA 3ANXA 4HH1A 2G1UA 5DGDA 1T43A 4N3AA 7ICIA 2ADMA 4G65A 1ZUWA 2AZMA 4DCGA 3LA6A 5IT0A 1KSJA 3FUWA 2QPLA 1W2GA 4RHCA 2O3UA 3C85A 1Y6FA 2COEA 2QV0A 1PRYA 2X9GA 4HNRA 4QUHA 2J6SA 2E5LB 5CDYA 2PJUA 3BGIA 3NIBA 2WUDA 1MFZA 2ACVA 3OPYA 3VI4B 1R0KA 4P5EA 4C7MA 2MYPA 3UOAB 1L7OA 5FO1A 2SNIE 3N97B 5BPHA 5B7PA 4G8DA 4TOIA 2VHQA 3DOUA 1ZXBA 1A9PA 2O2DA 5F9FA 1I7NA 3WKCA 4JR0A 4HDMA 4MF8A 2J0SA 3T3OA 4IVNA 2C04A 2Q5FA 4Q37A 5AK3A 4IRCA 1G4UR 1KFKB 2LNDA 3VO1A 1QFMA 5COQA 1U8AA 2TYSB 3H84A 2OV8A 2XMSA 1MV5A 4IZHA 1AKVA 4LK2A 4QLAA 4KFUA 4QPZA 1DK3A 4ZQFA 4PNPA 4ZU3A 3ETEA 1KEPA 3HBMA 1NC1A 5DV9A 1ZC4A 3C3BA 3KYDA 4A0QA 4TUYF 1X3SA 4R1NA 4YR7A 2PUFA 2V5AA 5G0UA 3AR7A 5KTKA 4B6EA 3PQEA 3WK8A 4K4IA 3KPWA 4UHFA 4X45A 1J0CA 1O87A 3HEMA 1E20A 3O4RA 4QEDA 4IFTA 4EP1A 4QZDA 2OAGA 2Q41A 5EWEA 2QMYA 3A31A 3D0QA 3IKJA 5KVQA 4AX4A 1VYTA 3J81A 3EISA 5F23A 4Q4JB 4EB0A 3QHAA 2EQYA 2VYQA 3OZWA 4UOZA 1WPGA 3FGNA 3PPXA 1KO5A 3C7DB 1DAIA 4IWYA 1TU0A 2BSAA 3VR4D 2FU5C 4E5SA 5DG7A 1FLVA 4ZMSA 2DTDA 3B2NA 3M6AA 4IDGA 1HNZB 2ZSDA 5C34B 2BR4A 3CVJA 4KMUA 4XUCA 2J9ZB 1U1GA 5CCDA 4XW2A 2XA1A 1VL2A 3AJRA 3V7KA 1VYUA 2G3YA 1ZQ9A 1ISRA 4Q1VA 3GGDA 4RD4A 1ZQFA 5ECGC 3UB3A 5FV4A 3QW4B 2DERA 2MTBA 2IFTA 1OZAA 2Q21A 4LYEA 4YXJA 1ISPA 3IBTA 4JEMA 4TWBA 3FSEA 3BB3A 2B7LA 2AN5A 2ZS9A 3GILA 2XGMA 1IY0A 4HDCA 3L6BA 1S2DA 1J56A 3RBEA 1RYEA 2FF5A 1GU0A 1ZKDA 4GGMX 4I5FA 3DF7A 1SVWA 2OOSA 3BICA 4CI0B 3E9DA 3RRYA 4F1JA 4Y2RA 1E5LA 1E4EB 3N58A 2I62A 1IJBA 1M33A 2FOIA 1RCTE 4HP8A 2RDJA 4JSRA 4L5YA 2QY9A 4RHEA 4ZVRA 3MJCA 5EWMB 5B1SA 4KU4A 3KFVA 3M6WA 4B3TB 1E6MA 3CVXA 1N8KA 2PSEA 5KFMA 4M8KA 4Q4AB 1FS4A 1KXJA 2DECA 1EDEA 3DEJA 2AR9A 2JJMA 1M8GA 2PKRA 1N9GB 1TCAA 4H2DA 3LBIA 4LWOA 4RHTA 1XP5A 3QOFA 5C0OE 1G5IA 4DIDA 3GD5A 2F7SA 1RHQA 3NS1A 4QQKA 1UMCA 1LVGA 2CHQA 3E82A 3RSGA 4EMBA 1T2AA 1E2MA 1R8SA 1XTZA 1JG4A 4LZDA 2XCPA 4N65A 1ILWA 3F2DA 3R9KA 2VQDA 4EYSA 5L7TA 4DJ5X 2BSXA 2DWPA 2NPOA 4E7OA 9MHTA 4TRMA 5J2HA 3AGQA 4DL6A 1G5TA 3H4IA 3A3OA 1NULA 4ZXFA 2H16A 3S7TA 4JS0A 1DMSA 4REQB 5JVDF 4DRXA 1E3TA 1V25A 4C2UA 4PHPA 1W1UA 2WFAA 4AP6A 4XIGS 4XJXA 5JCOC 3ZKWB 3NVWA 5EGNA 1I01A 1DC4A 1T3TA 3FW1A 1EK6A 4IEIA 4FR2A 2G72A 1FY2A 1RTKA 3V1NA 4N0QA 1DDGA 1OV6A 2ZYSA 3MPUA 5CNJA 4JZYA 3FCSB 1C1DB 2BPOA 1FZQA 4F0JA 4U9HS 2WYWA 1ZUNA 3UA4A 4TVBA 3FAKA 4HVLA 3IAUA 1FCJA 2OYSA 3ZI7A 5I7OA 2Z6QA 2QG4A 4TROA 1HOTA 4PVDA 4P7JA 2X0EA 5JD6A 1BCRB 1K8RA 3GH1A 3BQMB 3UFXA 4BFUA 2SICE 1YA8A 4EMUA 4NE7A 4Z4QA 4P86A 2RDMA 3PWTA 1REQA 4MYHA 4UQPA 1GLNA 4OLBA 1M75A 2BFEB 2R4TA 1W0KA 3CCBA 2B36A 1STOA 4DN6A 1FDUA 4R0MA 2W48A 3TGPA 3F8WA 1ZQCA 2OGUA 5FF9A 3L0OA 3BTUA 1B0AA 1KJ8A 3CX8A 3KVNA 5CDTA 7MDHA 1HNNA 1PFUA 2C2MA 3K7EA 3MWEB 1J99A 4IJMA 5JCJD 4X66B 4M89A 2HPHA 3HYNA 1TD1A 3VU9B 5IJAA 1O94A 4BMZA 4MPRA 4DQSA 4DQQA 2X6TA 3QLTA 4MTLA 4OBXA 5JJKA 3D6TB 1UCFA 1WUIS 4QNNA 3KXPA 2PZMA 3CY6A 3V4SA 2ZITA 1UOEA 5BSTA 3C5EA 3DBVO 3OVMA 4YCBA 4B09A 4BL5A 2H31A 2A88A 4G97A 3OQJA 4O0MA 3RUAA 3TGWA 4RZIA 5CEJA 3UMYA 4DOAA 1FFDA 2R9VA 4FWIB 1B6RA 1X9SA 4GR5A 1V0JA 1L5NA 2GKSA 4EUEA 1A5ZA 4L4RA 3QUSA 4L5JA 4RIHA 5C35A 3S8EA 5ADVA 1X13A 1Q0LA 1U9ZA 3H3XA 3B3FA 2O8EB 2LCQA 3B36A 4C0WA 4CQJA 4PLWA 3IBCA 3KELA 3ZE1B 1LW6E 3CKMA 4P4SB 1ADJA 2A5JA 3HYTA 3P9CA 3I9FA 4GLFA 1T3NA 4GBMA 1Z3IX 1J1ZA 2H92A 1WNFA 3T1HB 2JFNA 1NMEA 3M6FA 4PQYA 4Y0VA 4KFTA 1TAGA 3CUSA 3HRKA 4LTMA 5DH9A 2OECA 1TUGA 3OWXA 4I14A 2PXXA 5A9SA 1LS1A 4C4YA 3HO6A 3CUVA 2WICA 1SJ9A 1GWNA 1GTG1 1YS2X 3AKDA 3KJZA 1P2TA 3TJRA 4UAUA 3AWDA 3VAAA 4MS3A 4CHGA 2AG8A 1U0RA 4IXTA 1HUZA 2PZAA 4FILA 1ZDMA 3F46A 2XDYA 3F0TA 4F1KA 1SZPA 1V3TA 3DD1A 3EGDA 1MTZA 7ICTA 1H2YA 3EPPA 2ONYA 3MT0A 1G38A 1CEQA 2WRZA 5CEEA 1G41A 1WXIA 3OFJA 3SXJA 2NNWB 2BGNA 7ICVA 1O4WA 4HDMB 4OFWA 2ZT5A 2V45A 3QLEA 4NMMA 5TGTA 3GJTA 2AVDA 1OWLA 3EA5A 1AQLA 1ZS9A 1ONPA 3VH1A 4GVLA 1CZKA 2ID4A 4WXMA 1OXXK 5BXQC 2J3DA 4G26A 4HJXA 4WXPA 5KT2A 1D4OA 3CXRA 1BFDA 2PEZA 3Q7PA 3SIPA 4GZ6A 4MO2A 2YCLA 5CCXA 1Y3HA 1L5ZA 4L4YA 4NG4A 1XD2A 5IKMA 4K28A 5HBGA 1ZM9A 1Z62A 1IDN1 3IUEA 4QTUB 4N3NA 2LDBA 3Q3CA 4P32A 1T8PA 1ADYA 2O2JA 1TVEA 1G1MA 2ZSEA 4C6HA 4O3PA 1GO2A 1QO9A 1NM5A 3IEVA 7ICGA 2HJGA 2ZR9A 4O59O 4RKWA 1WX1A 3SJ7A 2VZ8A 3WHPA 4MRPA 4QDOA 2C2BA 4K7JA 1L3UA 3DLAA 2R8JA 3UFXB 1FU8A 5EINA 2X0IA 4WIAA 3S2GA 5IYZB 2D62A 2ANBA 3MJDA 4XUEA 2BFAA 1TAUA 5K4LA 2XQFA 4ENVA 2VEDA 5TQ2B 5IHPA 1R0SA 4J07A 1GZ6A 1K98A 2CUNA 2PXCA 2QVZX 4KVFA 4FE4A 1EVZA 4TTIA 1U5BA 4XGIA 3AK4A 4JJZA 3VR5H 4BX9A 1JAHA 3VZRA 5ISMA 3ZWNA 5KNLA 3HGQA 1C29B 1T36A 3B3QA 1TJ3A 2XBLA 1KRHA 2BFDA 2XPCA 2VHTA 1OX4B 4QVIA 2PGJA 1GAJA 3FETA 3P9SA 4MQEB 1N6LA 4RTJA 3G85A 3NDPA 3AUXA 1QQBA 3SG0A 1ZH0A 1KPHA 2R68A 1XLTC 2KK0A 3EAFA 4KOEC 1IULA 3FRHA 2W7PA 3LPAA 4EZIA 1ACMA 2R8YA 3LTEA 4QM7A 4CXMA 4C3OB 1KOFA 2BR5A 4FFLA 1CY8A 4UCFA 2HU2A 2G0TA 4IWXA 3RUEA 3EPKA 1QAQA 4AJ2A 3B8HA 3H16A 4M0EA 1DQSA 3IR5A 4FQ5A 3QF7A 1ZOOA 5BW5A 1XEAA 3ET4A 4BZZA 3L7YA 4U4AA 1B26A 2ATVA 4IV0A 5K8CA 3TINA 2KJ5A 4BX8A 2OGWA 3AR3A 3SYRA 1PJAA 1DI0A 1A9XB 2WSIA 1HEKA 1KYVA 3N6XA 4F46A 1TK2A 1TK0A 1J9ZA 1N6KA 3L8HA 3OGUA 2G5IB 4P93A 2EZ8A 1L3TA 2YMPA 4NPAA 2V7GA 2ZSFA 1WCWA 1AN0A 1W46A 1DKOA 4G0OA 1KDZA 1P0QA 721PA 2DKZA 3CKKA 5BWCA 2JRZA 4RUKA 2EJCA 5B4VA 1A7UA 2NUTA 4Y8VA 3IUNA 3KSUA 3TR6A 3RUHA 4PZPA 5EE0A 2FA9A 4DF3A 4XE5A 1NFFA 1AA9A 1J1IA 1VPLA 3KQVA 3PHIA 2ZJ1A 4OYRA 1OQAA 3U4DA 5CRXA 1N75A 1T15A 3F53A 1MO3A 2IY8A 2R00C 4UUMA 5KYGA 1AQJA 3O94A 2VP2A 2AJCA 3DUFA 3PFGA 4JT8A 3AKZA 2VZEA 3DOJA 4AJ4A 1J25A 4IHJA 4MA4A 3N5KA 4NOJA 3ZQ6A 1WXDA 2VBCA 5AT1A 1SD5A 1CQIA 1U0EA 1XPJA 2JL1A 3VVBA 2NU8B 4DV3B 3DLIA 4YR3A 4TQGA 5FBRB 3RCBA 4GFDA 1H4QA 1B8UA 3N7RC 3PGLA 2AFRA 2ZVQX 4Q01A 4A16A 1REQB 2C0CA 2ZSUA 2VRCD 4MRNA 3ZWMA 2YN2A 3C48A 3WMWA 4BJ3A 4BFVA 4HQLA 4IH9A 1YMQA 5DHTA 3FTPA 4O0LA 1NVDA 2K4EA 1LGYA 5FNZA 4MFFA 1UKZA 2IWRA 3KEGA 4YT2A 1ABBA 1E99A 1RI5A 1THTA 4FGKA 4DVJA 3HFSA 1F3LA 2E5SA 4JROA 4KQCA 2JFGA 4KWEA 3VV2A 4S0ZA 5KOHA 3JAKB 1QSYA 4Z4GA 5KNBD 1GPWB 2EKDA 1KLNA 2RCNA 2CNLA 3RS5A 2XZDA 2P1DA 3RHZA 2QB0B 4P9NA 3OO0A 1W88A 4A0HA 3SZUA 1U2RA 4HQ0A 2BM1A 1ZN9A 1WDKA 4NZMA 3E27A 2MU1A 1QANA 3ZWXA 4UHDA 4ZJUA 1SCAA 3AINA 3K71B 1RU3A 3KKMA 1UPUA 2BGIA 1E4EA 3G0IA 2I2XB 5EJ6A 4R7TA 4B6OA 3BJZA 2CJXA 5MDHA 2JAWA 2GFQA 3G7SA 3GEMA 3O8QB 3K5IA 4DM3A 1KSPA 4BJ5A 2R5FA 1ZJMA 3SV3A 3C8DA 4F2SA 3LQYA 2VNJA 4V0KA 5CU7A 1Z56C 2C2YA 4E70A 2ZRLA 3B7GA 4ZDKA 6PFKA 3FR8A 3LZCA 1OGYA 5JXIA 4GE0A 4PQFA 4LG1A 3IMCA 4MEJA 5CT4A 3IDQA 5J0YA 1V5WA 3WVNA 4YAKA 1UA1A 2RIRA 4Y9DA 1E7RA 3V2UA 3UT5B 3BJYA 2YWXA 4AIRA 2PSDA 5TEVA 2FAXA 1R88A 3QPBA 4KMOA 1OFIA 3WRWA 2V5UA 5KVSA 2DR2A 3NHSA 2YKGA 1LSOA 2YB4A 1FQKA 2RAFA 3BAFA 1NBMA 3CBQA 3ZBQA 2QE7A 1E6CA 1HC7A 3QMMA 4D42A 4D9EA 4CUZA 1T8YA 2EOAA 2Z2ZA 2PBZA 3NKFA 3QWBA 5JTUA 2W9XA 4DNOA 3E53A 3LWDA 1ELOA 2KSQA 3RLIA 2I1QA 4POOA 4LBZA 1PYGA 2EFJA 2WHPA 4IDDA 2H7YA 2QRUA 2VDJA 5CB0A 5FA6A 3O8NA 2XNCA 1BDBA 3FGZA 5EIAA 5BWMA 4Q21A 4J43A 1W19A 2PFSA 5DGCA 3EXG2 1KI3A 3CSUA 4I4IA 1NNUA 3UJ9A 4P38A 3G6XA 3LY9A 1BW9B 1EUDB 1Q6ZA 2P8JA 4KZPA 4N5NA 1SUPA 5TPWB 5JFOA 2H7XA 4FZRA 1D2EA 2B4RO 1CZHA 4HCJA 4S0XA 4A82A 1WD5A 4QYXA 1EX7A 1KOJA 1VHQA 3K31A 5B6PA 5U1PA 5DP2A 2GF2A 3DEZA 4JZKA 1HEYA 3EDCA 2FLNA 2PUJA 1U28A 1AV7A 4OHKA 2BUCA 3O2QB 1QPZA 4B43A 1VG1A 2Z5FA 4TKLA 4DSUA 4DQVA 1PZNA 5C0YA 1J06A 1D5CA 5K8IA 3LXUX 1TFRA 4NOMA 3PX4A 3IALA 3H1PA 2GJ9A 1QM5A 1LV8A 2PT5A 1XJ0A 3IGFA 2RMKA 2MINB 2BGRA 1R10A 1IAQA 1W5FA 2Z8ZA 4WZBA 3SC4A 4V0NA 3AXSA 4K9SA 3OPVA 2VJMB 1L5GB 1J6UA 9ICXA 3NW9A 4KV7A 1NJ5A 1TZKA 1FRNA 1G16A 4OCZA 1L7QA 1OCEA 1P7ZA 3OEEA 4KO1S 3RBZA 3UKOA 1KI1A 1FRVA 5E7JA 1R9JA 3I53A 3BRWA 3G0CA 5KOHB 3SENA 2OHJA 1LBSA 5ALZA 1ZW6A 3ZHSA 1N2JA 4FC7A 4Z9XA 1DLIA 3DBLB 1JYSA 4CV3A 5KVVA 1QKJA 3KCQA 4GO1A 4IF4A 1Y82A 2D1RA 5KNDD 3EH2A 1WU8A 3ECAA 3A3PA 3ENVA 4X6UA 4UEWA 2QLNA 5E3JA 5EXPA 4CTKA 2I66A 3TUZC 3CNBA 2LCFA 5LWQA 4R40A 4GHWA 2VNHA 3BVPA 1JIJA 4TSFA 4ZQGA 3I09A 4NMLA 2Z6AA 1NK8A 4AS2A 4IS3A 3SX0A 2PM8A 3FY4A 4J1NA 3LHSA 4GR9A 1IN4A 3M6UA 4ECYA 3WYBA 2PWPA 2PGOA 3K1AB 2EIXA 4R0VA 1NJWA 2QTZA 2Y1CA 4ZCLA 1G8KA 1JTVA 4DQRA 2GI4A 3D64A 4JBLA 4W6QA 4MUNA 3URKA 4D9GA 5B1YA 3UQ0A 1OU0A 3PDIA 1J07A 5DQHA 4JLVA 4NCKA 3M7DA 3OU7A 4GL2A 1G20E 2W8BA 3HL4A 4XZ3A 1N9ZA 5C5EA 3I4LA 3B1XA 4KFCA 3L9WA 4B87A 4EUFA 2PYZA 3SHFA 2O8CB 1CR1A 4Q18A 4QEZA 4CM5A 6ABPA 5KYXA 1ACJA 3TANA 3ETDA 1IVYA 2VSOA 1LTKA 4ETMA 1O4VA 3TDMA 4E13A 2GYUA 3A1EA 4XIYA 3WIDA 1J20A 3HMQA 3PQ7A 3DNMA 2C2OA 1DKRA 4ZQEA 4Z9AA 2R6DA 2O2ZA 3GDOA 4EEXA 4GKVA 4ZEOA 4TSKA 3FNGA 2E1EA 3F3SA 3FWNA 3QQ5A 4JLAA 3Q10A 3VX4A 1MRZA 2YFHA 4OXKA 2AJQA 1CYDA 5D87A 5DSTA 2OFWA 3ETJA 3Q8KA 2YR0A 3IOEA 2JHDA 1C3EA 2W58A 3CX4A 3VYRB 3ZDQA 5IT9A 3DUFB 1WW3A 5IJZA 3KRTA 2OWEA 2CBZA 3ODGA 5FNVB 1QXSA 1UANA 4MR9B 3QOWA 1J0EA 3CLRC 4TUYB 2JIBA 4UBJA 2JF0A 1ORVA 1AY0A 3QU4A 1B3BA 5AW6A 3NBQA 5EHGA 3PNMA 4ECWA 3D2SA 5C4IA 2C20A 3M83A 1WA5A 3DKPA 4BMXA 3E1SA 3U56A 1C0LA 1Z4KA 5EJFA 1SEPA 4D8XA 4ESEA 5C37A 3IERA 5HTOA 4ACOA 3FNRA 3V5NA 3T0GA 1Y89A 3PICA 2QT1A 3C1AA 4F2RA 4QO7A 2ZRMA 5KJCA 4EFDA 4EVIA 4X3PA 4RS4A 4TTTS 4YP7A 2DR3A 4JJ6A 1V8ZA 1F0KA 3MK31 4KQGA 4XLTA 2QI9C 5SYAA 3GUYA 3DCYA 4UEOA 4WOKA 3RREA 3RWMB 4I1RA 1AGRA 1RHJA 3DCJA 2A0FA 2WUFA 2QM0A 3GYGA 4MAMA 4O4HB 3S1AB 2IHMA 4AP5A 3WGIA 2BBSA 1L5HB 2IU4A 3PQ6A 4CKCA 2DMRA 1DAEA 1O6ZA 1Q77A 2AA3A 1D9DA 4P5PA 3F8TA 2IF2A 3BE4A 3L84A 3NPMA 4G1CA 4MROA 5HJ7A 1ZQQA 1Z17A 4MV7A 2O14A 1T2DA 4AJOA 4QIWF 2M6RA 3M2PA 4F06A 4X62B 1KQPA 3BMOB 2PX6A 1QQ7A 4URHA 2AB0A 1JVBA 4IRMA 1PK8A 4EYIB 4E31A 3D0RA 2YJ4A 1WTCA 2DLNA 2QT0A 3HBJA 4ENUA 521PA 3M2TA 4TS3A 3D3WB 2Q3FA 5IWAB 2IZ6A 2WTXA 2ZR7A 1GDTA 1DSSG 4QC2A 1BNOA 2PVCA 2OO5C 2HK8A 3F4BA 4KN5A 1HFKA 4Q7LA 3FG9A 3ORFA 5T3UA 3WIBA 1D0IA 4US1R 3DMTA 2P41A 4ZAFA 2C4HA 2ZIAA 3B0XA 4QWAA 4JP1A 2D2XA 1NMZA 3AU9A 4OH7A 2NVUB 3RUPA 5AKKA 1MDBA 3E4DA 3ESRA 3OSPA 5CPBA 5CW1A 2FWAA 1SZDA 4O33A 1GP2A 4TLBA 2FFQA 3ENKA 4JYAB 1CUGA 2GNPA 2GF0A 2O48X 3L7JA 2PFPA 4FUQA 1UMDA 1PZXA 4LYHA 1H1DA 4KBFA 1NF3A 4W82A 2YY5A 4WLVA 4NEQA 1C3LA 4WBNB 2VXOA 1WUKS 2N46A 4ECTA 1U65A 4MVWA 4OHVA 4Q02A 5DYNA 5AR1A 3W8RA 4WEQA 4IQWA 4XEUA 3U7HB 5C81A 1MPTA 2DEUA 3O8OA 3R0IA 1Y3FE 3Q3VA 5KO2A 1ZK1A 1YU9A 3MEQA 1JIVA 4OBBA 3UV7A 2G5GX 4W4TA 5JALA 1LLQA 1X2IA 2C9MA 2IITA 5T4BA 1ZQLA 3ER6A 3VHQA 4GP6A 4HSGA 1S97A 4H9GA 1PSDA 3ND6A 4F8YA 4P83A 4F4FA 5K7SA 3SYMA 2VUIB 3Q7SA 1GG5A 2JB9A 2YV3A 4QELA 3BJMA 3A1DA 3T9EA 3ZK7A 3CE6A 1X77A 1E9VA 3REGA 4GGPA 1RZRA 1ULUA 2C9ZA 3VC7A 3UJNA 2GS9A 4E09A 4F3TA 1FNMA 2WDZA 2AN3A 1QE3A 4FX2A 5J2UA 3UTCA 5I5GA 1WSBA 1SCKA 2AOUB 2R65A 4H0NA 1Y6GA 4OQDA 4ME6A 1F7UA 4GKJB 1V37A 2NLOA 1RJFA 2JRCA 2KPOA 2P3SA 3DDCA 4PX9A 3RYFB 5IJ0B 5KX5B 1RMTA 4L7QA 2FQYA 1Z5NA 1T4GA 4GDMA 2YW2A 1D8YA 5HZGA 3SJZA 1SQ0A 2MSWA 3Q41A 1ZM3A 4G9GA 1U2TA 5BSEA 1U7OA 5IRCD 1EIZA 2BEUA 9ICEA 2OFFA 3VPHA 3VX3A 3LVRE 2FEOA 2ODPA 5KFAA 4QTZA 3SAJA 3WLEA 5C5CA 3ZEIA 2R6GA 4HVCA 5A02A 5CVEA 2ZYIA 3K8YA 2NMVA 1CDEA 3GJSA 4G24A 5EJIA 1QH9A 4KR9A 4G9BA 4NMWA 3J7TA 1P0IA 2UZ0A 4E03A 1DKPA 2RFLA 2YTZA 4RX1A 2ZUTA 2XUQA 3MWJA 4RPJA 2E4ZA 1RD4A 3M9LA 1IEVA 3ZV7A 1BS9A 3AO0B 4RL4A 1KI6B 2HWWA 1F44A 5E1DA 5B1IA 1NDQA 3OFVA 1P7DA 1ZQRA 3M4ZA 3ZYCA 4YV7A 5A4DA 1N7GA 3PDIB 4MW7A 1L7VC 2ZRJA 3GD7A 5D3MB 3CWQA 5FDFA 1N63A 3U5TA 5BN4B 4OXRA 5CVVA 1X1QA 4IY1A 1S8AA 4N18A 3S2ZA 1RAEA 1IXKA 7ICPA 3N87A 4HDKA 4TYPA 5A4KA 4IO1A 2WFMA 3WR5A 2V7XA 1G0OA 3PLNA 4OX9Y 4TXHA 4P3XA 5CLJA 4ZVSA 2G0NA 3JWJA 1FQJA 2H4FA 2ECOA 1PG5A 1OFUA 3IVRA 3MAAC 4XAQA 4BJ1A 8ADHA 4ZIRA 3AY6A 4UTNA 3ZD7A 1A27A 1NXXA 3NVYA 1EMDA 1II8A 1PQUA 3T35A 4CKEA 2I4IA 1EWRA 1TD9A 4LI3X 3Q2IA 4CYMA 1VIMA 2AW5A 1O54A 3CONA 5CXXA 3D8RA 2VDPB 3ROKA 1LNQA 1M2NA 2JANA 1AE1A 2B2NA 3HJHA 1QHYA 1Z5PA 1KI2A 3PXCX 1EVYA 1RLUA 1UMKA 5JBQA 1V3VA 3CJTA 3NV7A 2FR0A 2CK3A 4MR9A 2FXIA 3RJJA 3BRSA 4TZ0A 1DO2A 3N7PD 1SB8A 1DZIA 2QMEA 4UHJA 5T4EA 1FP1D 2CL0X 3KEFA 4AG5A 4DEXA 3QKWA 3UCXA 3BIXA 4MR8A 1ULSA 3A9VA 5CYFA 3WWPA 3L3BA 4B84A 5DBBA 2GMWA 3I83A 2W2LD 1RCUA 1S9FA 2A5LA 2Z0MA 5K0TA 1ZVKA 4UHEA 2H08A 4LOKA 4ZI7A 1QGED 4IJVA 4LOJA 1FLAA 1JEQB 5D85A 2HLDA 3QZ8A 3T9DA 2ILTA 2WBLC 1R6DA 3D7RA 3GMIA 1TYBE 2HSEA 2VJMA 1SUFA 2D0DA 2PKYX 1EUYA 5JHGB 3JV7A 3SZRA 1KZGB 5E1MA 4YQEA 1WXXA 2CYBA 2ZIXA 4PJ0U 1F0MA 4L02A 2QGFA 2XYHA 1XXLA 3LF1A 3QVLA 1EAYA 4GP7A 2BM0A 4JLOA 4MRRA 5K6AC 1RC8A 1L9XA 3HA2A 4UCXA 3SDBA 4JI0B 4RTOA 3RF6A 2B1IA 1E7QA 3FVVA 1DK2A 1TIBA 2LWIA 2PNFA 4C80A 1RWKA 4H77A 3TLAA 4Q9DA 5DX8A 4OFBA 1KE1A 2WTBA 3JD4A 3UK0A 3KZIU 4B6FA 4DF8A 3H5NA 3GPIA 4HYQA 5CBPB 2CXUA 3C5GA 1VGVA 2NPIA 4TXLA 1SCUB 1W36C 1S2GA 1P33A 3PMNA 2WJWA 4J49A 5AVJA 4AW9A 1LNZA 1XTKA 4RD6A 4BO3A 4Z5XA 1E3EA 1NOKA 2DPJA 2GAOA 2M98A 4B0OA 1ZYUA 2ZPUA 4EHAA 4ECAA 1A9TA 4JB3A 2O8DB 3C45A 3Q0TA 3WXBA 2YWRA 5AP9A 3IEXA 4JGBA 3CNLA 4KGZA 4OBWA 5JJ5A 3KZ1E 3KSAC 3D2BA 3BPSA 4IF6A 1MENA 3JQ8A 4V1CI 4KLEA 3D3WA 2JMGA 2QN6A 3O95A 5KFSA 4DLLA 2JK0A 4I55B 3G2QA 1ZUD1 3GL9A 1JR2A 2XXAB 5H1YA 3DW1X 5FFNA 3NIDB 3HHPA 2D2IA 3ISTA 3V34A 5JYCA 1P4SA 1BG6A 3M9WA 4N3CA 4CCYB 4QJ3A 1SVOA 2FMUA 2G80A 3RAEC 2EJWA 3TADA 3T52A 3CZ4A 3DLCA 3CYFA 4QXOA 1MVNA 4NS1A 5EWJB 4AT1A 5CB8A 3E2EA 4R0NA 3OUZA 4EELA 2HSGA 2OILA 4KO8A 3M8KA 3TQTA 5A4FS 4LXYA 4DCCA 2BMVA 5B53A 3W9BA 3K2IA 3MMZA 3H9CA 3EZGA 1IEWA 4CJXA 4UD2A 3SQNA 4Z4FA 3EULA 3AF3A 2C9DA 2Z04A 1VE6A 3NU1A 5LBTA 5J2AA 2QXUA 2ZAYA 3O8OB 2EBHX 2IBMA 3ZIAA 3FDIA 3HE3A 3ME5A 2C61A 4RVDA 4C6TA 3C7AA 4N8SA 1SBTA 4RAOA 3KXLA 3HN6A 1FYDA 4BNHA 1Z8DA 5IC6A 5L4LA 1IQRA 2CL6X 2R8BA 2E2WA 5DP1A 4KQIA 2I7VA 1A5AB 3KHGA 2F3SA 3C41J 1C7FA 4Q4LA 4RIIA 1MKYA 2FEWB 2UZ1A 4YCNA 4RPYA 1LJLA 2CYAA 2P75A 4NYIR 2QGNA 1R6XA 2FOLA 3FPHA 3K8QA 3X2FA 3W2TA 3ZE7A 4ZGGA 5LZ5A 4CI9A 5M3BA 4TSRA 4D5GA 4PLFA 2BHLA 4GC5A 5FYDA 4B32A 4EHHA 2BBTA 3GJRA 4EPXA 3ZD9A 4ZREA 3SR6A 5FPPA 1C2TA 5IMBA 4MFCA 1E64A 4FYKA 3VH4A 1TO2E 3QBJA 1G0NA 1G8PA 4TGLA 4OK3A 5FYQA 2WF8A 1QH8B 1GUYA 2AMYA 2E1RA 3DA8A 3N53A 4B4DA 4E30A 5J2GA 3TL6A 1YZLA 3PSIA 2ON6A 2QM7A 3G7UA 5A5FA 2G82A 4YFVA 2UAGA 2W4QA 2ZVPX 4M60A 3T3IA 3U3KA 4JBHA 4YBZA 3AP3A 3H2SA 3HDGA 1DC5A 3LCVB 4HYEA 4BFTA 5IU6A 3R0JA 3C15C 2IODA 2P2CA 1BWQA 4LXXA 4ZAWA 2PT6A 4G9EA 2KEYA 4HUQB 3PNOA 2XXBA 4YMNA 1O97D 1NUQA 1Z8HA 3QMWA 4OPMA 4YXMA 1ZK3A 4MUKA 1WDWB 2G9RA 3ND8A 1U8YA 3T3HA 2YMLA 3X1YA 3W8FA 2P6MA 3M8SA 4KLGA 5DM0A 3A4MA 2P91A 1N2SA 3DJFA 3K0CA 4I08A 1N60A 5J0RA 3C2MA 4HN4B 4YDHB 3QU2A 2A3NA 3B20A 1BS2A 3RDPA 2P77A 3KAQA 3AFOA 3QVSA 1N56A 3SICE 3IKMB 1NFRA 4IYRA 4LHWA 2JLAA 4M9CA 2FFRA 4OQMA 2VCYA 2DQKA 4PXSA 1T0BA 3R5SA 1SOWA 1XX6A 3RS4A 1G21E 3D5EA 2DPXA 4WCVA 4CUKA 4XARA 3NYIA 4R3UC 4HXEB 5IIMA 1YONA 1ZIOA 4WJKB 1ODCA 3EEIA 9ICJA 2IK8A 3OE5A 3RKRA 5JJLA 1EFKA 1HH4A 2ZJOA 3AQ4A 1L5YA 4BGVA 4J9KA 5HUJA 1JECA 2Q1TA 2Q3JA 2LKYA 4GLLA 3VJKA 4NLBA 4K40A 1V8BA 1RADA 1JQKA 2A94A 3HJEA 1M9NA 2A14A 1T4DA 5B3KA 1WIWA 5IDVA 3L92A 1ISFA 4ER5A 4CKBA 2XDQB 5CTAA 2XCIA 1JKMA 2YJZA 4G81A 3L7LA 4W5JA 1Q0SA 2OHIA 2XITA 1US8B 3ZU4A 1OW3B 3CH6A 1R1DA 1N5RA 4UTVA 3C8UA 1HSOA 5KG5A 4K05A 1QGOA 4RLQA 4UASA 4MZXA 1SELA 2FXVA 3KWMA 2HJHA 4MDYA 5JCJA 5JPIA 4KGVA 4TZTA 4RHUA 5E6SB 4RUAA 4HAUA 2PGAA 4L4UA 4ZPJA 4EPTA 5LMNB 3G9XA 3RVRA 3MD9A 1Z00A 1LBEA 3OLVA 4TKMA 3I73A 1XKTA 1CZOA 2W6OA 2R48A 4IX9A 2EZXA 2ZI6A 3SR3A 3OZDA 1CUEA 1SA0A 3U17A 3FUTA 1E0AA 4AYXA 1M0SA 1PBNA 1F4VA 2HQOA 2J9GA 2FWNA 4NYJQ 1M3SA 3FMVA 4KHZA 1OZ0A 2YN0A 3F98A 4LIPD 1ATIA 1U3CA 9ICSA 5FAXA 4Z7JA 2FFBA 3KQLA 1BJKA 1QU3A 2DBQA 4O4LA 3MWDA 3EA0A 3GLFE 1OJ7A 1OA1A 1PU2A 4M7PA 5J9FA 4A9AA 3MTBA 3F5EA 4FEGA 3UUWA 3R0XA 4QWCA 2E55A 3P0HA 2XUOA 4J7CA 4KN8A 1VIYA 3MWLA 2CNOA 4MW9A 3PNLA 3ROZA 2CHVA 3GUVA 4M9JA 3HR7A 3UXNA 3MQ2A 1ZN8A 4D3ZA 5BYKA 3OF5A 2ZWVA 3VGJA 1A2KC 2KP7A 3IM1A 3MTAA 2IHJA 3EVCA 4KK3A 3LBFA 1IG3A 3LLSA 3GFQA 3MXTA 5KFTA 2ODNA 3WRXA 2HU5A 1Z0ZA 5JHHB 3H0LB 1ZM7A 2JATA 1KZ1A 4RQ7A 3D8SA 2QIOA 3A9CA 3NDRA 4B4KA 3IJEB 1KFCB 1T1EA 4OEHA 3GEPA 4ZYYA 1KC3A 2FUNB 4OK5A 4M9ZA 1ZX1A 3PQFA 5HR6A 3EZLA 3ZDEA 1A88A 1Y88A 4JI2B 1KY5A 4BNDB 1X2BA 4Q45A 4IINA 8ICUA 2LW7A 4RL6A 1IWPB 1BFUA 4LZPA 1RWOA 1E3QA 1MA0A 3L8EA 3URMA 4F5EA 3U44A 2Y9PB 2QTVA 4RACA 1QIHA 4WFJA 2MT9A 3Q9UA 4JDPA 1XA4A 4KIUA 4MR7A 1UAYA 3AJEA 1YSCA 4QDJA 3CVWA 2GBFA 3FOBA 1VMAA 4W9NC 1S01A 3H5AA 5LD2B 2WD8A 5HZKA 4V0ME 4TSFD 3IDOA 2B8JA 1MX1A 2BRUA 4TZ6A 1UBNA 3LYHA 4W5QA 3ELUA 3R3HA 5I8PA 3NQ41 4ECVA 4H17A 4WX2B 3ENZA 2EF0A 2VCHA 5FWXB 4ENQA 4E5DA 4MWOA 4A92A 4TYMA 4YECA 1PIWA 3C0KA 4Z9BA 3RTCA 1Y4UA 3PRKE 3EY9A 3TQOA 4OGFA 2G7MC 2B69A 2BI8A 4RNMA 2EBWA 4QULA 2CNKA 4IOLA 4NQZA 3L41A 2FPIB 4R81A 4QUJA 3RU9A 4XWGA 1UBMS 4F4XA 3F78A 3WYAA 3BYZA 3EVGA 1WXGA 3FYCA 3KAKA 3LYSA 3WLOA 4DLUA 1JHYA 1JQ3A 2HAEA 4UBNA 1BDHA 3PF8A 4GSYA 4L9SA 4HLCA 2GK6A 1EP1B 1PE0A 3GGSA 1XEXA 1M1NB 3P2IA 4EY7A 5IVDA 1A95A 1T8WA 1WCIB 3U2QA 1BE1A 4MQFA 3DV2A 4WKPA 5TMBA 4E21A 4DR7B 1TOAA 4A6DA 4YJFA 1CQPA 4Z7QB 3X44A 4L51A 5AJVB 1ZOLA 1MEJA 5CM9C 1RVV1 3W05A 4B34A 1ZQBA 1SA0B 3H2KA 5K4GA 4Z53A 4KO2S 5CH8A 2FMTA 3VHXB 5J2DA 4PM4A 2X8BA 1SL0A 3CW2A 1Z2EA 3AVQA 1QYVA 1FZTA 3NBFA 3SY8A 1KFTA 1V5EA 4NFYA 1OW5A 1R6BX 4BOYA 4ALKA 4FBGA 5BUZA 1BE6A 2W6ID 4G3IA 3DVSX 4GRAA 4ZD6A 3O8CA 2X4IA 1FU4A 4CFSA 3T5LA 4A36A 1SQFA 2VDWA 4KLMA 1AF4A 4YO7A 1VSQA 1XDDA 4IDFA 5L95A 2J31A 4YUZA 4I2HA 4PX3A 3B9QA 2AQ8A 4R2WA 5JD4A 4DMCA 3FPLA 3GNQA 1EYZA 1TC2A 4X61A 4ZJZA 2DM6A 4EDFA 5LLTA 2H4HA 1Q8KA 4WZBE 2NYRA 3LFHA 1X38A 1W4CA 5AM3A 1A8SA 4G8JA 5EMJA 1VL6A 1NW9B 4G5SA 5F7ZA 3FRIA 5EQDA 5A3RA 1R4NB 3AIIA 5AM2A 1FYVA 1RM3A 3H7IA 3N3BC 3OHMA 4FNOA 5EUBA 4DCNA 2BF7A 3ONFA 4D8UA 4S1VA 1RYDA 1TZMA 1Y8CA 3C8HA 3CGGA 3FYUA 4JA0A 5JSFA 2WWRA 4OO1J 1P3JA 4M04A 3GPDG 3AVVA 3W3AD 4DCUA 1SU7A 4RCZA 5AUQA 1T1JA 2PRIA 1V6AA 2KHZA 1LDEA 5ALIA 1C30B 3RH0A 4C0BA 2V6IA 1JAYA 3IIJA 6REQB 1XZNA 1DTWB 3ADCA 4CIAA 5FEUA 3CYMA 4HLUC 4YJHA 3M3HA 3S2FA 3HEAA 5LZ8A 1XQ1A 3KB6A 4TUPA 3MM4A 1K4KA 1Z07A 1AGXA 1L1QA 3Q0EA 4GBED 1JEEA 2RHBA 4B73A 3AHEA 2W0MA 4FYWA 2CFOA 4I7EA 2WMDA 3K92A 3JVDA 3KTFA 2GVNA 4D2IA 4MLCA 5KL8B 1FXWF 3DPUA 1QV9A 2ATIA 4LCBA 4PO1A 2RGRA 5H16A 1YXMA 4R01A 3GRUA 4JNKA 3X1MA 3DXXA 2P9YA 3CV3A 3QBVA 4FGUA 2FUKA 4O3QA 3V7JA 4P7KA 2Q29A 3C5HA 2KVSA 5IXYA 4PPGA 4US0R 4PSUA 1ULZA 1QWSA 2BDEA 2IHKA 1RVDA 5DX0A 4ZMBA 3U1BA 1HKHA 4OSOA 3A6PC 2DF4B 1F2DA 2JLQA 5CWRA 1GZUA 1VKOA 2ODQA 2HVIA 4JLPA 4NBNA 4WBNF 4O2AF 3LU1A 4P98A 1SO8A 2Y0CA 4BXOA 4FFSA 5F4ZA 1T8UA 2WFLB 2WU8A 3U4CA 1MQAA 2I9PA 1NA5A 7GPBA 3MXOA 4KG7A 5DOVA 1G4HA 5AWFC 3RVLA 1UJ5A 4J9QA 2O1EA 1IXYA 1Z4MA 3HUUA 4PLVA 4RBNA 5F51A 3WHLA 1TB4A 1WU7A 2H1CA 3GRPA 2Q50A 3MAGA 5J1TB 4V0OA 3E03A 4YWJA 3REQA 4DSEA 2AL7A 2I03A 5LQKA 4C4TA 2XVMA 1B2LA 4H4DA 1WLSA 4NBLA 1K8ZB 1H2WA 4GG1A 1H38A 2NVOA 3TLYA 3K30A 4LXGA 3IB3A 3VR5A 3GVXA 3IELA 3AIKA 2K89A 4EG6A 4AROA 4GYKA 4TMFA 1G2QA 1U0HC 3EPRA 1ZRMA 4QUAA 5H2FU 3AONB 3DEYX 3UBTA 3HCNA 1HSZA 2C31A 1BX3A 1KAEA 2BN4A 1WRBA 2L18A 2P9QA 4PW0A 3RSQA 2V0GA 1QB8A 1JPUA 2TMKA 1OXVA 1M2HA 1ZQSA 3GEGA 5KG3A 3K5PA 2NO9A 4EJ0A 3RTAA 5BY2A 3C21A 4E46A 2I6GA 2GEDA 2X58A 1LBQA 3HWWA 5EUQB 1NMYA 2EYUA 3S5UA 1I4TD 5D5QA 4TYNA 3IOYA 3HVRA 1VXRA 4D3SA 4DM7A 3CXUA 3J80A 1FRQA 2H3VA 2F43B 3KL2A 2BCRA 1Q74A 4C5AA 3SOPA 4RTMA 2CFIA 1CY7A 5KYTA 3CUWA 4DJTA 3GMDA 2BRUC 3WQQA 2H2DA 4U6SA 5B55A 1QE5A 1X1SA 5C31A 5JNTA 2EW1A 2VATA 1S2LA 4NG5A 4DPKA 4DR4B 2W9AA 2HLPA 4LMPA 3VYUB 4YRGA 4X65B 4G37A 1RWQA 4JLJA 4NFHA 2Q1XA 4X3OA 3ZE2B 4BNDA 4RF5A 4DWJA 1NDUA 1TK9A 1WXWA 2RHRA 3H2BA 3NLLA 2HIHA 4NDNE 1M72A 1BXGA 2GA9A 1KAGA 1LPMA 1JNXX 1Q20A 3HU5A 2D8MA 2D4HA 1MB3A 2X9NA 1YB5A 2ZRDA 1ETUA 4JNCA 3P0RA 4WW0A 3TRFA 1WTAA 3PR3A 3ZGLA 4RZUA 3MVEA 5M2QA 3FOEC 1RABA 3A2NA 3RTGA 2XUAA 2ZRHA 3BWXA 1Y5LA 4CF7A 4N9WA 4GKKB 2Q5HA 1V9LA 4PPYA 3PC7A 3UO8B 3DDSA 4CFZA 2V6FA 1L5VA 1VDMA 2W00A 3KYCA 5D6NA 3T5GA 1RSZA 3ICWA 1VM6A 4XDGA 1SOUA 3R7DA 1U9JA 4YMHA 5KPDA 4A5SA 3VNSA 3Q8MA 1SKWA 3KEOA 5BW8A 2DFDA 3D1VA 2DL0A 4A7PA 3EZ5A 4ELVA 1FX1A 4HSEA 4N3BA 4X24A 4X3CA 5FBWB 4N3GA 3LUKA 1D7AA 4JEHA 3DW3X 3KE8A 4KO4S 4CGYA 5HCIA 1OIWA 3CO0S 4E14A 2VJ5A 2SKDA 3DTVA 2QX4A 2E0IA 1JI0A 4BNFA 3JSXA 4DB2A 1IM8A 4AZ0B 1CZRA 3RD5A 4IDOA 4RWEA 5I7HA 4F5OA 5K5EA 2ZBDA 1GDDA 3OPXA 3LI2A 1NQVA 1X94A 4RSMA 2JVIA 3CLUC 2B82A 2X2OA 4MP8A 3H4BA 1YQXA 2W6JA 3GELA 5ES3A 4DNFA 5IH7A 4FO6A 3OQVA 4K6MA 2A4KA 4DA9A 4DSZA 2I0FA 3E3LA 3MS7A 3DEKA 1D4ZA 4YUXA 1YVPA 3UB2A 1TM1E 1KMMA 4M0AA 3A6ZA 4R6WA 1EFRD 1K6EA 4R2KA 2XRYA 3DBRA 4XWOA 3I2JA 1V43A 4FFNA 3QXXA 4F84A 1SHKA 4D56A 2XTZA 4BFXA 2JJQA 5K0JA 1R3UA 4PPQA 4WD3A 3VO2A 4C8LA 1G8AA 2HIGA 2Q28A 2Y71A 3SEFA 4FSHA 4IHJF 2BGTA 2GNOA 4DE5A 4FHZA 1FJXA 2GTIA 3P9XA 4Q12A 4J9PA 3I1JA 1UBJS 2W2TA 3GFOA 4HH4A 1P5FA 3HK2A 2JPDA 3CZQA 5BN5A 1NJGA 4M0KA 1IMOA 5CD1A 2RHMA 4YCJA 4B74A 5K0FA 5J23A 1CUXA 3TS1A 3T95A 3L5OA 3HFRA 1K7EB 4HVAA 2XGGA 2MSLA 3GNTA 2ZS7A 4P0TA 1KDVA 4N1AA 4WRRA 2OYRA 1U48A 2G5CA 3GUCA 1JR3D 3DT6A 4FS3A 2BP7B 2BTOA 2IXGA 2JGMA 2XIQA 3MRSA 4N39A 2VBFA 3AM9A 2OG2A 4V1CB 2C7OA 3W6UA 3COJA 3WGNA 3M9MB 1I80A 4NM1A 8ICBA 1IEQA 2AG0A 3OAAD 3MYYA 2Z57A 5KX5F 3N86A 1AO0A 2R2GA 3ZHTA 3B5IA 4TL9A 5DHSA 2I1WA 4KQWA 3HCAA 4IQ0A 3V3TA 3W0LB 3EEFA 2VIIA 5DLDA 5FPTA 1SVKA 4XSHA 2A9JA 4OHZA 2JGAA 1EB9A 3OURA 3GPBA 3LQFA 2C5LA 3ENWA 3PF9A 3QPUA 3OCZA 4HV4A 1PEDA 1JIXA 4B2PA 3KM0A 1JPVA 1CI4A 2F3TA 4MLPA 5AHOA 3FDSA 4D8VA 4ARCA 1F9EA 2XMBA 1L8XA 4P2GA 4EW1A 4FEYA 3FVQA 1PZEA 1U0NA 1T8RA 1WXQA 3SQLA 4Q3NA 2G06A 4B4OA 3EWAA 1ZM4A 2PD3A 1YZGA 4KYIB 1H2AS 2QLBA 2HF7A 4K2HA 4R8RA 4OOFA 1Y8ZA 1E0DA 4CF3A 6ADHA 2ENWA 4BO4A 1DTEA 2SECE 5J58A 2IYYA 2GK4A 3PD7A 4PTZA 1UBGA 4YMIA 1HY3A 5EUCA 2ALZA 2H0QA 5AI0A 3HA7A 4WL0A 1HBJA 4FLEA 2NV0A 3ANNA 1SQSA 2P9EA 2PL1A 2NZYA 1JEAA 4P4NA 4V0LA 2X40A 1F8XA 1WSDA 3HN2A 4B5KA 1E2FA 2Q7XA 2OO5A 3FWPA 4QNLA 3E9YA 4JJGA 4C8OA 4AZ0A 3HXKA 1KK3A 1LQTA 3LOPA 2Q8PA 4NE9A 1DFIA 4B9EA 1E9SA 1YFLA 3WX0A 2SBTA 3BMCA 2FKNA 1B73A 3P2MA 1EP2B 2WE7A 1FC0A 4QPJC 2KE7A 4QZGA 4TWAA 1VOTA 4G0UA 1VJ0A 3NEJA 5AVSA 2LTAA 5JTIA 2XUPA 2W11A 3UQZA 1XZQA 4HPXB 4FFVA 4FLMA 2IS2A 3KAPA 5AW3A 2CT8A 2XSZA 5HKOA 1DAPA 1N0HA 2LR0A 4UUPA 4YAFA 3BGWA 3QP9A 4OHBA 1DX4A 1A2OA 1W6RA 1XHEA 3I1YA 3C4VA 3K9NA 2G77B 3ROXA 2HMTA 5D3ZA 2CE7A 3G8YA 4TYQA 2O50A 2ATLA 5EEGA 3BWEA 1QHHA 1UKEA 1E63A 2BELA 2JDIA 3G6KA 4JLUA 3WA6A 1VSVA 3UMGA 2LUOA 2ZB4A 3ZV6A 2CXOA 3DMRA 1OXMA 3H9QA 1N36B 2PMEA 2C2KA 1NSYA 2FN7A 2H2WA 2ZZNA 4F4WA 1FP7A 1T8EA 4Q4AA 1YQQA 3IUPA 4G84A 1WKVA 1Z6TA 3QTTA 4L0CA 1O2DA 3KOYA 3SLGA 3QKSA 4LHYA 4PG8A 3GCDA 3CVVA 1ZJ5A 4FK8A 3EB9A 3QPWA 3BSSA 1GPUA 3TSZA 2VHCA 5A04A 5D7BA 1DXQA 2DG2A 2EWWA 3ND7A 4KWTA 3A6KA 4OHCA 1P2BA 1FXSA 3IG5A 1C9DB 3IP4B 1GNQA 2BLLA 4L73A 1CFJA 1O1YA 1SOVA 2Y0SF 2GZAA 1KHTA 1XL0A 3FPBA 4OIFA 2X5KO 1MPXA 3B2EA 3I9JA 3LA8A 4WAUA 4Y9TA 3VTZA 1IIPA 1RRFA 2VC2B 2QW8A 4C87A 1JLRA 2X8AA 2C54A 2FPGB 3BH6A 4LEIA 5K3FA 4C07A 3O4HA 4YJKA 1L2TA 1ULHA 1HO3A 3N7UA 1NN5A 2QRMA 4UU7A 2IYUA 3NYRA 4GXKA 3FSJX 5BR8B 1DCFA 1YR2A 3AB8A 3FPFA 5EIHA 2ZB2A 4C5CA 3EWSA 5LZ2A 1M34E 1GR0A 1TJ5A 1W94A 2UXDB 4TQUS 5ILQA 1GFSA 5CEFA 2JG3A 1PF7E 2HRBA 1OLUA 5HBRA 1KE2A 3X1JA 1ZW1A 2QF7A 1L5FA 3JPWA 1D8BA 4QZCA 3VDRA 4PBRA 3NXSA 4DR1B 4BFSA 1WD7A 1UWVA 4JASB 3DAPA 5J2FA 4TKUB 4RKRA 3OD1A 1RHMA 1UC9A 2HSDA 3PPVA 5CVUA 4DQLA 4MV6A 8ICNA 4JXJA 4WNIA 1QLWA 3M1LA 3HI6A 1Z28A 4JJAA 1ENOA 4L4SA 2W6PA 4MGKR 3L3FX 3IAHA 1MSWD 2DJIA 2ZYUX 3I5UA 3L02A 1PCXA 2KW5A 4I6GA 4P81A 7ICUA 2QE7D 3OJWA 1X6JA 1FQWA 1GUAA 1U2SA 5IAKA 3P4YA 5CAEB 4PCLA 3C3JA 3F4KA 1T1IA 2J6IA 4HD8A 2I4OA 4AU1A 3EPJA 1R3DA 3F2IA 3L9XA 4UKDA 4X0EA 5KOJA 1EP9A 2DWCA 3FB1A 4YI5A 3EG9B 4CF6A 1PZFA 5LA6F 5IZCC 2WM8A 1PNTA 5KTYA 5LWHA 2QVBA 4HATA 4OLAA 1DP4A 2ZWOA 4R66A 2I9GA 3EFEA 3ZD8A 4U7GA 1U7ZA 5C8YB 4J7UA 3C39A 3VC3A 1WZIA 1VZ3A 2FK7A 2FKAA 2WA1A 3THOA 1BA2A 1GLVA 3D0KA 3K9CA 2R1UA 2ZKIA 4OSPA 2J3LA 2H5EA 4XXHA 4A6XA 4G0PA 3SE7A 4E6EA 5KNDA 4YMMA 3ABIA 2HW3A 1ZNQO 1Y8RB 4B3GA 1W35A 4PGYA 5I9BA 4MWTA 1OI3A 2IYXA 1XRLA 1PI3A 1PN3A 3IAM1 3AR6A 3OG9A 2GUWA 4GR4A 3Q11A 2OVFA 3VR6A 5BMOA 2HJWA 2P9CA 3PUYA 4PYQA 1GQQA 2OBMA 4FP9A 4TMYA 3FOFC 2XCAA 5T67A 5K05A 3H1TA 1M8FA 2AXPA 1PJ3A 2HA5A 1MG0A 1TMOA 2O0KA 2PEYA 5J0QA 4I2FA 4LOLA 3WNDA 4DDUA 3TRJA 1M34B 5MGNA 1KRPA 3LQ1A 5IAGA 5ALXA 1QGUB 5FO0A 1VSUA 3UW3A 5AVRA 3I62A 3DE2X 4TMZA 1PK1A 3RJKA 2NGRA 3OKCA 3V4OA 3ZJ5A 4DDVA 4ZU1X 4R8UB 1QFYA 4RGYA 3A1WA 4EDHA 3MUFA 4WK0B 4MWCA 2IGBA 3HLKA 1QZ3A 1S4QA 5I7WA 1G42A 4D92A 3WLKX 3MJVA 4UVIA 1JUDA 2PQ2A 3MQFA 1XPUA 3QX8A 3F5AA 4ZCSA 1B23P 3GGJA 3N2EA 4C29A 1LB1B 1FMCA 4AKGA 3WSWA 1NXWA 4I9FA 5T3YA 1NJYA 2K4HA 3IO5A 4TL6A 4DSFA 3VCBA 1IZZA 1KZ6A 2A4MA 2AG5A 4OQFA 3RJ9A 1XL1A 1GFZA 2AE1A 3QXSA 2JDID 3JAMA 1TPYA 9ICPA 3AIOA 4IJ5A 2UZ3A 4LAFA 4PSCA 3NGMA 1V38A 4O4IF 1OAKA 3NM4A 3PXXA 4I2NA 3N0RA 1J90A 2ZVDA 4IXWA 3V1MA 1GGMA 2XI4A 1W6UA 3DO5A 1ARZA 1J22A 1B74A 1ZR4A 3AVPA 2R3SA 4Y30A 4H1VA 2P7IA 4RQMA 4BEVA 2CFTA 1SPXA 4IV8A 1NX9A 1JHOA 2V8OA 3GV8B 3FMFA 1RYFA 3JASB 4NZZA 1FDOA 2OOKA 5ICEA 3SEQA 2XF2A 2Y1KA 1P5JA 2FMPA 1V7PC 2XRFA 5EFZA 1VPDA 2B9VA 4REMA 3U09A 4NNOA 3B8EA 5UKDA 3BMQB 4A2PA 1U6KA 2F1RA 3FNIA 4X00A 5IANA 5HQJA 5DM70 2XNDD 3QV1A 4GLJA 2YNMD 4DARA 4EVRA 2VT3A 4EG3A 4LHXA 1TUEA 1ZLXA 1MAWA 4I1UA 4XOUA 7ICQA 1HE2A 3M9NB 3DFMA 4RLSA 1L5KA 3F49S 3RT1A 4YX9A 4LTDA 5I8ZA 4MV4A 1UPBA 2FPXA 4KODA 1YDFA 1Z83A 2NADA 1X8KA 4TV8B 4DC1A 2HUNA 2WMOB 5ERGB 1KJIA 1LWOA 2XOKD 4DA6A 3LPNA 1IH8A 4QGHA 3S8MA 2W71A 2JHFA 4TXMA 5AVKA 2AHOB 3IULA 2HYDA 1MC5A 3LO8A 2BCQA 4MW5A 1GTZA 1DEHA 3LJKA 2XB4A 2XVXA 3K8OE 3SKYA 2O7SA 3DE0X 5T4FA 3UMRA 4N40A 4KQMA 3UMJA 1TKCA 2YIDA 4CR7A 5HQ3B 4G0ZA 3TOSA 2CBXA 2NVBA 4IQFA 3OCCA 4YJGB 1I1QB 2NZ2A 2YVAA 3CUYA 2JIQA 1GU1A 1HGXA 1U9IC 2WHQA 2C97A 3RR7A 2F17A 2NUAA 2WHXA 4N4AA 5IJXA 3K0SA 2J87A 4II7A 1WZ2A 3OLXA 2ICAA 3IDSA 4G5RA 4RVFA 3CZ9A 1CYEA 1ST2A 2BFFB 3RIHA 3FC4A 1SCBA 5LC1A 3AG5A 1J7KA 5DTQA 4EJFA 3EGDB 2XZOA 1BWSA 1MH9A 4QRHA 1P9OA 5F64A 2R00A 5JAQA 3Q6IA 3O1JC 4QQRA 3LO5A 3OP4A 4BFYA 3AETA 2QRVB 2P8SA 3FE2A 4NJMB 3IB6A 3IDWA 3DOOA 2R79A 4Q6WA 2J6BA 3OPYB 1ZOPA 2J4DA 3R3UA 4GM1A 5IAOA 1X7YB 2BAGA 2ZU0C 1EFDN 1DIHA 3B1JA 4MJLA 3L0PA 4KTTE 4NU0A 2QB1A 4Y2HA 4ZVOA 2C3PA 5JYDA 2HBZA 3HLYA 3RBXA 2EHJA 4ZT3A 5LQAA 1CW2B 2F3RA 1Q1AA 1MIOB 2OC9A 2QLLA 4PAWA 5G2OA 5H3CA 3I72A 2ZCUA 4AMBA 2YVQA 4F5RA 2GARA 5SYMA 4ZCMA 5AOCA 3GHHA 4KK4A 3B52X 3GZ4A 3RAQA 4J0EA 3F2VA 4Y18A 5CW2A 3WJ1A 3ZZ0A 4F6RB 1G66A 4AS1A 1UIRA 4C88A 3WKAA 1L7RA 3UGJA 3VU8A 5IX8A 5LNK1 3O7WA 5JVDA 5EKXA 3AV0B 4RH0A 4MKGA 4YLEA 2GH1A 3HADA 3RG2A 8ICLA 4JHXA 1F2TB 2CZQA 4YP6A 4LSMA 1AKMA 1IBLB 3A3YA 2VPZA 3GR6A 2C5BA 1ZK2A 2WK1A 1GO3F 3BA1A 2AW3A 4BIMA 1XZGA 5H8WA 1C14A 5DASA 2KHVA 3FCYA 3DZDA 5TEWA 2ADOA 2R6ZA 3RYIB 4B8WA 5AVZA 3IJ5A 3WMGA 2JLVA 4CEIA 5L4NA 1I0ZA 1HZZC 3GQBA 1G2IA 2EW8A 3GG9A 5DBAA 1T4CA 3RLFA 5JU5A 1MP0A 1X6IA 4RADA 3D8NA 3HJUA 3F1KA 4QNRA 2KTQA 2JJYA 5JSKA 5DB8A 1A8IA 4O4JB 1DX6A 2F6RA 1USGA 4P80A 5IP5A 4DNPA 2WWTA 2IPXA 1MAUA 1IY1A 3LX6A 3CRMA 2MA1A 1B7GO 1W88B 1NQOA 2JHAA 3MCVA 3ZI0A 4BVJA 1KEUA 1N2EA 1VJ1A 5LQJA 2CDNA 2HH9A 2IYQA 4Q7MB 5CURA 3FOZA 1LLUA 2EQBA 1FBNA 3D7LA 4DPLA 1V39A 4F21A 5BRAA 1J2RA 3WLJA 5GMOA 3SAHA 4OJ6A 1EGVB 1WQ4A 3L6CA 3IVAA 1XQXA 2C4NA 2Z8YM 3QEOA 4PRYA 4RMIA 3GRFA 1KZHA 1DB3A 3H6HA 3OA0A 4KEAA 4BLQA 4MIYA 4DG9A 4F4UA 3C2QA 1PHRA 1T5HX 2H4XA 2RGXA 4W1SA 1V97A 1JLSA 5ALSA 4M9XA 5DDYA 4NX2A 3PX6A 4TWZA 4C3VA 3LQRA 2XEDA 4XB1A 5IXJA 2IS6A 2GRAA 4Y1RB 3RAFC 5GONB 1R0CA 3B48A 3CLRD 2GZSA 4F97A 2YXDA 4BWFB 3SZGA 1Z75A 4R84A 3TLCA 4XD2A 3PT5A 1OI7A 3WLAA 3UC5A 2HR1A 1BPBA 3NJRA 3Q5EA 3R8CA 4KV9A 4UEQA 2I8CA 5AKLA 1N9GA 3S40A 2JJ2D 1PK1B 1PGOA 3KJFA 1P73A 4EHJA 3M5CA 3L0DA 2NXWA 2CEAA 2O3SA 1LPOA 1PQYA 2AR7A 2PTHA 3QOYA 1QRRA 3M5DA 1IUKA 1X7ZA 2W6IA 5FV7A 1Z0UA 3PTLA 1SXIA 2FPMA 1YH3A 2C95A 2QL9A 2LHTA 1X7XB 1EJBA 3AETB 4WXHA 5IULC 3S6JA 3VJLA 3X3HA 1JN3A 4ZOHC 1N5KA 4ANFA 2WWGA 1HK7A 3GU3A 1ZMTA 4NE2A 1ZGCA 1CE8A 1JHZA 3I05A 3WQSB 3T94A 1SZJG 3LBNA 1J33A 4HS9A 2VJYA 1RAAA 4MS4A 3RWOA 2JHCA 2GKGA 4KIGA 1BVRA 3OFKA 3VR3A 3G6VA 3KKZA 1SK9A 4KTQA 2I4NA 1NQXA 2QPTA 3WJAA 4YR0A 2REQA 3M6ZA 1ZGJA 3CH5A 1LA2A 1FLNA 4R1SA 4C7OB 1VFPA 1T94A 2J3HA 3ENNA 2AOTA 2HA2A 5EQJB 5TB5A 3OKAA 2JEIA 3D31A 3OLZA 3QKIA 1EB8A 1QV6A 2V7BA 5HGJA 4YRZA 4LGVA 1RE0A 3ZU3A 3AL0C 4Q15A 3D02A 1N5MA 4DV1B 1KNQA 1L5LA 5LOVF 2D2EA 3L49A 2NZXA 1JEYA 1TE2A 1NMSA 2QN8A 2C9YA 3IP7A 4WK6A 1YO6A 2JEYA 4NJOA 1W47A 4EQ6B 4TQRA 1SKMA 3P27A 3T79A 4QXPA 3WDKA 5KYWB 3EOAI 4FOLA 4N0DA 4HX5A 1KARA 2DJ5A 1SC6A 2F00A 3IC5A 1KP9A 3ZDDA 1JLMA 1JG1A 3EG9A 3BL8A 3MJFA 4K46A 4WSOA 1ZQZA 1GCAA 1QVZA 3NOXA 4UE6A 3ZHVA 4B7UA 1DAKA 4E4YA 1MHTA 4EO9A 1SCNE 8ICRA 1QO0D 1RXWA 2PWBA 1RI4A 2PA3A 1QGZA 3BZKA 1JLLB 1GADO 1MORA 5KYWA 3H5VA 1VPVA 3I45A 4Y6LA 4DLBA 3KYIB 1JQ5A 1EKXA 2REBA 4OHUA 4JBWA 2JAQA 3CW2C 2I7CA 1G5QA 2RHJA 2ZWAA 4KMRA 1EVLA 5H7XA 2X9QA 1GGKA 3C3EA 3HJCA 3JCZA 4OUDB 2A1UA 1CETA 2AHOA 2JGLA 3NORA 1ZN2A 2UUOA 5FWXA 5K3SA 1DV2A 3EGVA 2WJVA 1AU9A 3F4LA 3TD6A 5HQ3A 3BFXA 4DR5B 2WSLA 4GOLD 3U49A 3ABQB 1IUNA 5C5DA 3I42A 1T0HB 2I34A 3Q8PB 5CD9A 5J47A 3E81A 3AF4A 1YK0A 2O8EA 4BB6A 1QYIA 4BQNA 3GZTB 3LHIA 5HW0A 1DE0A 1UXKA 4U2DA 4C4SA 4J4TA 5KT3A 2XTJA 3NTLA 5GIPE 2DTEA 2VP6A 1GSHA 5ALDA 1DKUA 2Q0SA 3FHCB 4MA5A 3DPIA 4QE3A 4Y1EA 2ONZA 4BLUA 3JWPA 4FINA 1JXMA 5B5EU 4B7XA 4H1TA 4MA0A 1ZRHA 5BQ5A 4E94A 5ITSA 4YR2A 4EVQA 3IPCA 3D2LA 2O1XA 4US2R 1OE0A 3HKCA 5C9ZA 2Q3BA 3H1EA 3THXA 1E5DA 4MRMA 5DHRA 1T1SA 3HV0A 5GTHU 3H0EA 4YO8A 5KFFA 4C1NA 4BFLA 4PHTA 1XPOA 2GEFA 4R2HA 5A7FA 3HVUA 4F3CA 1XAIA 2WZCA 1ZQOA 2Y92A 4WLEA 3PSFA 1EUDA 2VDLB 3ELBA 3AQIA 4BJHB 5IDQA 1H2ZA 3B6IA 3P2YA 5HKLA 3QU9A 1N2GA 3MJ4A 1UM9B 1X86B 1E9AA 3IKVA 3LT2A 1NZBA 5TF4A 4GI7A 2FMFA 1RRMA 4IBOA 1W30A 1GAWA 4NP6A 4U0JA 1IN5A 2Z58A 4FXPA 1NV8A 3ZDXB 1IPEA 3W5HA 5AVUA 2VNKA 5ILOA 3U4MA 5JS1A 1T10A 1J70A 2WE8A 3AKEA 4OATA 4XB2A 3ZWCA 1E6UA 4L4XA 2ZYVX 4OI1A 3GCWA 4HPJB 4G6ZA 1SG0A 2XUGA 3NGXA 5H82A 4AZTA 4YAGA 3ENQA 3F3KA 2XY4A 1JALA 1JBKA 2E18A 2GF9A 3WB0A 1IOLA 2DHDA 4Z86A 1YOBA 2XF8A 4RF3A 1L0BA 4AJ9A 1ZI8A 3WK9A 4TTPA 4LFBB 1S0UA 3K0AB 3PVSA 1A5TA 2Z9CA 1TC1A 1O96B 1IOWA 2HK7A 4Q4CA 3OSNA 3RO7A 3TI0A 2A5GA 3UMSA 1YFKA 3THYB 2GWSA 4Q9KA 2FSIA 2BMWA 2C2ZA 1BU5A 1CZNA 4OI2A 2OKGA 2R1ZA 1YIAA 2VEOA 2GOLA 5K8JB 1KETA 2KZMA 2AUNA 1FFGA 2HM7A 3BX1A 1LKYB 1Z39A 1IDOA 3N8KA 1OH7A 1YD7A 2C3UA 3IIKA 4U8HA 2ZI9A 1W0JA 2O19A 1T36B 3KPVA 4FKMA 2CVZA 2XWPA 4TURA 1E2UA 4HVTA 1XA0A 4C22A 2ES4A 3DVLA 2BE9A 3KEMA 3PI6A 2FLLA 3OZGA 2H17A 2WZBA 1DBIA 3E84A 3PYLA 5I7AA 3R7WB 4Z6CA 4KLDA 1ESZA 2P1ZA 2XD4A 3K9BA 3T0IA 4BDSA 4HAWA 4IRXA 1MQSA 2O3QA 1KJYA 2KS6A 2PCJA 1EGMB 3O8RA 3UNXA 2O8FA 2CNWA 3ANSA 2UDPA 1IJFA 3NBYC 2TECE 1EFAA 3D4PA 4OUDA 3MAJA 4B9LA 1E8MA 3DEEA 1FSGA 1V7ZA 1XMIA 3BK1A 3OM0A 3Q3HA 4YRDA 4YXWD 4L08A 3NAGA 1TLLA 4UM5A 1T9AA 2M2IA 4X85A 8LDHA 1YMUA 1G9SA 3QI7A 4Q1EA 5HYVA 3BULA 3A1SA 4WBXC 3QUTA 4DKXA 2KQUA 2BUBA 4G0VA 4BE4A 4C43A 1I8TA 2PR7A 5B6IA 1W1WA 5ITZA 5HF6A 1DLJA 4BU0A 2C78A 3PPIA 1YDWA 3LZDA 3ZXYA 1FRFS 3KQWA 1TT5B 1ABEA 3RR2A 3ADBA 5JNSA 3V33A 3F2BA 1TKBA 4BMCA 8AT1A 3C6KA 5F1YA 3RU7A 5DYTA 2JIZA 3UHAA 1X7HA 3ZH9B 4W5NA 3RJZA 3QLVA 4WBNA 1WUDA 1JLKA 5T64A 5C1IA 5AK0A 1X7XA 2V65A 3WGQA 4MUAA 4TLAA 4F2DA 3MILA 3ITNA 1XKLA 3UXYA 1JRPA 1XD8A 3EC2A 3AM3A 1YQDA 3C6YA 3D3EA 5GM2A 5K3AA 4CLRB 1A50B 2BKUA 4HQFA 5JCZA 4J1TA 5JH7A 3A3NA 3ABZA 5B64A 4XRGA 1SC4A 3CMMA 3BL5A 5KSZA 3G8BA 2JLYA 4FYMA 3MTIA 1BCRA 3THWB 2CXXA 1U3DA 4OYLA 1E94E 2REQB 2WKWA 3FUVA 1SWVA 1TU3A 1RHKA 1O95D 1U99A 1U45A 4G4JA 3PEEA 1RMYA 4QUDA 1ZYQA 2PGXA 5CB4B 1M2OB 4FWTA 1T5TA 2WAAA 4LNHA 1J23A 1U6IA 2AFVA 2DC1A 1KQGA 3L7NA 3WGZA 1N9KA 3W2EA 1BEUB 3H11A 2NTEA 2P3LA 2IBKA 4DDKA 4DM4A 1U2DC 3GIIA 1VC2A 3RYCB 2LRHA 3BOSA 3A9RA 3Q4GA 4HMPA 4JBXA 4P4MA 2YOFA 4LX0A 2LM4A 1TV9A 1UBEA 2CMDA 3N07A 2ZS8A 3SVTA 3W5IA 4FYPA 9ICIA 4KLSA 1B14A 3RC2A 4FGJA 3QI2A 3K3PA 4MV0A 2PGNA 1Q50A 4TRJA 1M67A 2GB4A 4I66A 3FI9A 4O1HA 1J0BA 1KEWA 3EC7A 5LIRA 2PUHA 2BBOA 4QGFA 2JFPA 3K05A 1VYVA 1AHIA 1TCVA 2QMUA 2VJDA 4YP0A 5K0LA 1Y7LA 4QFDA 5EZSA 1IL0A 1JLLA 4M1MA 4G0NA 3SSAA 1HL3A 2XCQA 3GH3A 2YL2A 5KTRA 5EQFA 4MCIA 4G5HA 5J2KA 3PE6A 1RP1A 4H60A 4KIWA 3KHLA 5CIYA 1FFYA 2EAMA 4BO7A 1QG2A 3ZTWA 3CLTD 1TCUA 1QCYA 3AM5A 3VKVA 1R66A 3SZOA 1QWOA 1RE1A 1XWLA 1L3SA 4IUCS 4KH0A 1HUOA 1BIFA 4WKOA 4CDMA 4YRIA 1GRRA 1XD9A 2D7CA 3W78A 3ACDA 5EIBC 4XVQA 1D6MA 5DCWA 5I45A 2C8JA 3OEHD 4WY2A 1GD1O 4KN6A 3RUFA 3OZAA 3CN9A 3R8XA 4QYMA 4IQ8A 3AFHA 3IXLA 1VMEA 5IDWA 2HJVA 5E4FA 1LDYA 4U39A 2AEMA 3I01A 3TMKA 3HUTA 1NDHA 1DCMA 1E9FA 4ZI2A 5L8VA 1A04A 2HBQA 1NVGA 4I9HA 2X9VA 1Y4AE 2IVZA 4RNCA 4C7YA 4IPTA 3DMDA 5TS3A 3MT7A 4UE2A 3T7EA 2C9OA 3ISCA 1OLSB 3A4VA 4H08A 3BXGA 4ZQHA 1E6WA 1RRGA 3T5KA 3EXHC 4FFRA 4MW4A 4O4LF 2MCFA 3W6ZA 3GUZA 3MGGA 3WGTA 4EA7A 3DYIA 4QDKA 2PRZA 5EWFA 3M82A 4E5UA 1PZHA 3WNQA 3ZZTA 5D84A 2F3NA 1QYXA 1T6NA 4P4GA 1H8HD 4OQNA 3ZY4A 2GM4A