3DV9A

Putative beta-phosphoglucomutase from bacteroides vulgatus.
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
246
structure length
243
Chain Sequence
SNAMFKEAINNYLHTHGYESIDLKAVLFDMDGVLFDSMPNHAESWHKIMKRFGFGLSREEAYMHEGRTGASTINIVSRRERGHDATEEEIKAIYQAKTEEFNKCPKAERMPGALEVLTKIKSEGLTPMVVTGSGLLDRLNHNFPGIFQANLMVTAFDVKYGKPNPEPYLMALKKGGFKPNEALVIENAPLGVQAGVAAGIFTIAVNTGPLHDNVLLNEGANLLFHSMPDFNKNWETLQSALKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords beta-phosphoglucomutase
publication title X-ray crystal structure of putative beta-phosphoglucomutase from Bacteroides vulgatus.
rcsb
source organism Bacteroides vulgatus
total genus 76
structure length 243
sequence length 246
ec nomenclature
pdb deposition date 2008-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3dv9A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3dv9A01
4GIBA 3OPXA 4NV0A 4ZEWA 2ZOSA 2IOHA 1L7MA 2FPWA 4E88A 1AQ6A 3QX7A 5AKKA 5ALSA 1CQZA 2EAUA 2EARA 2ZBEA 4UATA 3D6JA 1RMYA 1WVIA 1Z4OA 4IFTA 3WKBA 3OCVA 4UMDA 3EF0A 2BDEA 3ZI4A 1ZD4A 4Y2RA 3J7TA 5AI0A 1Z4KA 5JJBA 3QUBA 4UMVA 5AI9A 4UAVA 5AVYA 1RQLA 1U02A 4AS2A 3OCWA 3I1YA 3W5AA 1Z88A 1PW5A 2HCFA 3E84A 2AH5A 5ALEA 3WK9A 3OCYA 1Y8AA 4O8CA 3NAMA 3ZVLA 3E8MA 3QGMA 3VAYA 2HF2A 4DW8A 3ONNA 5A3RA 1ZD3A 2OA0A 4RETA 2OYCA 1U2TA 4UM5A 2YJ6A 4H1WA 1NRWA 2PQ0A 1T5TA 2YN4A 3AR2A 3ZUPA 1RC8A 5AW7A 1LTQA 3ZTWA 4EENA 2RARA 4C4SA 3KOOA 4FFDA 3WK4A 1RPZA 2FI1A 4CF4A 2DQSA 2QLTA 5AK3A 5AK5A 5ALVA 5AKYA 5FP0A 1MH9A 1O03A 4YIHA 1U7OA 3L5KA 4B6JA 2NO5A 3B9BA 4OD0A 1RKVA 2PR7A 3WK8A 3ZVMA 3FGOA 2I33A 1WPGA 3WGVA 5AKLA 1TJ4A 2G06A 4BNDA 4Y2QA 2MSNA 4ZEXA 4EELA 2AMYA 2RBKA 3AR3A 1VJ5A 2G1AA 1FEZA 1RLOA 1EK1A 4KNWA 5AW3A 2BDUA 5IT0A 4AP9A 3L0YA 1NNLA 3R4CA 2ZBGA 3ED5A 4BYGA 4MWOA 1RLMA 3PGLA 3QU5A 1F5SA 3L1VA 4L57A 3B8EA 2VKQA 3ET5A 3ESRA 1ZJJA 2JAUA 4YH1A 4CF3A 3NASA 5ALHA 3L8EA 3L8GA 2HEGA 4BKMA 3L8FA 2QYHA 2OBBA 3QU4A 1L7PA 3I76A 2CN1A 3N5KA 4HGPA 2YMQA 4DFDA 4DWOA 2C9MA 4YCLA 2HO4A 2GHQA 5AVRA 4CE6A 2JAOA 3N28A 3SF0A 2AUTA 2ZXEA 3ZVNA 1XVIA 1L7NA 2GMWA 5ALMA 1XPJA 4FE3A 2R8YA 3FPSA 5AW8A 3NIWA 1QQ6A 2WHEA 3AR5A 3WKDA 2NO4A 5AKEA 2W11A 4YIKA 3L1UA 1TE2A 2FUEA 1Z4IA 2NYVA 2FPRA 2HOQA 3FVVA 1SU4A 1X42A 2JAWA 4L6CA 1KYTA 1Z4MA 5AKGA 2IYEA 2O9JA 2C8KA 2YJ3A 2P9JA 4G9BA 2G07A 4CNQA 3EWIA 3N07A 1O08A 3IRUA 1IWOA 3HYCA 3PDWA 3SMVA 5A3SA 1YMQA 2CFTA 5AVSA 1ZD5A 1J8DA 3U7GA 5ALUA 2FDRA 1SWVA 4UW9A 2GHTA 3DNPA 4Y3UA 4I9FA 3BA6A 4HYTA 5E0OA 2HHLA 3ET4A 3CNHA 5ALFA 3U26A 4J2TA 3R9KA 1ZOLA 3AR9A 5A3QA 5AW2A 5AW6A 3I28A 5ALYA 3I6BA 2B1QA 3PGVA 2C4NA 3ZWDA 1QQ5A 3QNMA 2MU1A 4EX7A 4Y2YA 4OHFA 5ALXA 4NWIA 5ALLA 3S6JA 3U7FB 2WF8A 2X4DA 5AICA 2Q4RA 3QYPA 5AM0A 4UMFA 1RRCA 1RMTA 4KNVA 1S8OA 3TLMA 3UMCA 3UMGA 3WKEA 3WK5A 2C8LA 2MU2A 4KX5A 5AVXA 1YJ5A 2G80A 4G63A 3F9RA 3U13A 1JUDA 4PNHA 5IT4A 2WF6A 3L8HA 3ZX5A 2WF9A 4F72A 5IS2A 4Y2PA 1L8LA 4MUMA 4AS3A 4BEWA 3IJ5A 1L7OA 3P96A 1U2SA 3AR8A 4Y2VA 2B8EA 1RLTA 4F71A 1Z4JA 2WF7A 1TA0A 4I9GA 3U7EB 1T9ZA 1N8NA 4IG4A 2R8ZA 3OCUA 5ALNA 4EEKA 1K1EA 3MMZA 4Y2UA 5AW4A 4Y2JA 5T41A 3SD7A 1Q92A 4NABA 2P69A 3RF6A 2Q4TA 3E81A 1Z5UA 2HDOA 2O2XA 1Z4NA 2HX1A 4NAVA 2I7DA 3SLRA 1RKQA 4KN8A 1VJRA 5AVUA 1S2OA 3DV9A 3QLEA 4UMEA 2BY4A 4OCZA 3E58A 4Y2SA 3PCTA 5AW1A 2ODAA 2HF7A 2IOFA 3WK7A 5AM1A 5AM4A 2IOFK 2YJ5A 3CZ4A 5AVZA 3ZTYA 5AKZA 3AR4A 1U7PA 3M1YA 2B30A 4UASA 5AVQA 5ALZA 3L0BA 5AVTA 4BNDB 3QUTA 3W5CA 4UARA 3EF1A 5ALKA 3A1EA 1Z4PX 2ZBDA 3U7HB 2ZG6A 3OCZA 2G08A 3KBBA 1ZRMA 2EATA 3QU7A 5ALOA 3N8GA 2B8JA 3IB6A 1RDFA 3QU2A 4QQFA 5ALDA 1QH9A 3AR7A 2YY6A 1ZD2P 2FPXA 3SKXA 3M9LA 1Z4LA 3QU9A 3HLTA 5AKJA 2R8EA 5ALRA 5AM5A 2ZBFA 3OTQA 4C4RA 4RESA 5AW5A 2FEAA 4YGYA 5ALTA 3A1CA 3MC1A 2OM6A 3DAOA 3SHQA 3ZX4A 3UM9A 3NANA 2HSZA 3BWVA 1L6RA 3KDPA 2RB5A 1YNSA 3K1ZA 2GFHA 3OCXA 4YCNA 3W5DA 2AGVA 1L8OA 2YJ4A 4JB3A 5AM3A 4UM7A 3QXGA 2P11A 2YFYA 3B9RA 3MN1A 4HGNA 5AIAA 4Y2XA 3WGUA 3ZW7A 2WF5A 4CF5A 2JGAA 4L6AA 4NFLA 5AI5A 4KX3A 4EX6A 1RKUA 4JDPA 2JARA 3NALA 3ZU6A 5AM2A 1N9KA 5AVVA 2G09A 4UU0A 4XOUA 4GXTA 1QYIA 3R09A 4HGOA 3RFUA 4BX2A 1QQ7A 3SKYA 4J03A 2B1RA 2FPUA 5ALGA 4QJBA 3U19A 2CFSA 2I34A 1Q91A 5AKIA 5AI6A 3NUQA 1T5SA 2YMLA 5AI4A 1ZS9A 2G0AA 5ALJA 2HI0A 2IA5A 1ZRNA 5AW9A 5AKHA 2Q5EA 4UU1A 3WKAA 4BEVA 5AK6A 1TJ5A 4FYPA 1WR8A 3ZWKA 1YDFA 5ALWA 2W4MA 4KYTA 3QUCA 2PKEA 4BBJA 2W43A 1J97A 3KC2A 5AW0A 4Y2TA 3FM9A 1YS9A 2I54A 3A3YA 2FPSA 3N1UA 2P27A 3EPRA 1YV9A 5AIBA 4HGRA 2WFAA 3WKCA 5AHXA 2I6XA 1Z4QA 3W5BA 3DDHA 5AVWA 1SWWA 3FZQA 2YBDA 3L7YA 1CR6A 4C4TA 3GYGA 1VFPA 3ESQA 2YMMA 2GO7A 4HAIA 2RAVA 3MPOA 1EK2A 2I55A 2R8XA 4DCCA 4XPZA 4ZEVA 5ALIA 5AI8A 5ALQA 5AK4A 3L0CA 2YMPA 2D2VA 4XE5A 3QUQA 2CFRA 4UAUA 3WK6A 2C88A 3NRJA 1LVHA 1XP5A 4XQ0A 1RQNA 3A1DA 3FPBA 2FUCA 4HGQA 4BX0A 1WZCA 1TJ3A 5AKXA 4YCMA 1Z5GA 1NF2A 2B0CA 4EZEA 3KD3A 2WM8A 5AESA 1RMQA 2B82A 3KZXA 3AR6A 3UMBA 5ALPA 4OFZA 4BX3A
chains in the Genus database with same CATH superfamily
4YUWA 1BKYA 3PNYA 5H9WA 4R1PA 1T9KA 1MAWA 1MF7A 3CVWA 2AKEA 1ZQZA 2FSVC 2XVMA 2B37A 3NOVA 2DPHA 5JWHA 1P7WA 1J2EA 2HGSA 4E0DA 3F2CA 4QQRA 1R66A 9ICAA 1D8BA 4N3GA 3EUAA 2CCJA 3ND8A 2PL5A 4DQXA 1JAIA 3OBBA 1ORIA 2ZIXB 4TWIA 4F1WA 2YICA 2AH5A 1W5SA 4WLVA 3RAQA 2WB2A 3TRDA 1RC8A 2J7KA 1SCKA 3KUDA 3GLVA 3DZIA 2O8FA 2QJOA 1FO4A 5AK3A 1Z8HA 1GOTA 4OXRA 1XZBA 3HP7A 4DIKA 2J87A 3TARA 3QKSB 2AKYA 2C04A 3H99A 3CVYA 5EUCA 1O95A 1H1LA 4COOA 1QS0B 3R6TA 4Y9UA 4GMKA 2Y1CA 1H66A 1HUQA 3RJJA 2OD9A 3BH7A 2QT0A 2O8FB 4ZCLA 5FNVA 3RDPA 5JNLA 5C3UA 5C52B 1OXKB 3HCCA 4OBEA 4K4GA 4FZ3A 5EJ5A 2RH5A 1Q0QA 1LWOA 2ESEA 5KFHA 2OR3A 4K6GA 2QV0A 4PRLA 4G86A 5JCJA 3WAJA 2Q50A 4OQNA 1NUPA 4BCBA 1A9OA 2X1VA 4XWYA 2R8BA 1V6AA 4LVOA 2CNDA 1ZC3A 5J2TF 3OECA 3ZH9B 4ESOA 4L4RA 2WJHA 4UW9A 3HR8A 2XWPA 4Y3UA 7MDHA 1FU7A 2AC4A 3HSKA 4UCXA 3NHYA 4G0VA 3FFWA 1T0BA 4GDFA 3OZSA 1Y3AA 5TMPA 1QP7A 3EEFA 3L07A 1Q7GA 2QZ9A 1OQAA 1P0MA 2I9PA 3LOPA 2GQ0A 3EVFA 1HXHA 2C2EA 1KZ9A 1NQTA 1E2UA 5EXEA 2EQ5A 4N47A 1FFUA 2QUKA 3W5HA 2RK6A 2CDAA 4JKIA 3FUVA 1Z4JA 3HJBA 3UB3A 1CUXA 1XYVA 1XNSA 1I4EB 1NU6A 2XNKA 1ISRA 2O5EA 4TLDA 1S2OA 2W2KA 5JHGB 5C8DA 1H94A 1N25A 5FLYA 5ADWA 4L7QA 3OX4A 2A57A 3C7TA 1IOZA 3KHRA 1E5XA 4BO3A 1UFRA 4KDCA 2YWXA 3C5GA 2DLNA 4RJTA 1NQAO 3MTGA 4JR0A 4ZRDA 1SQSA 1NBAA 1QK5A 3CSSA 1VSVA 1IOLA 2ZDQA 2RDMA 1T6NA 2WD8A 4EPVA 3U7RA 1GL6A 4XCXA 1ZJNA 3UKJA 4JZYA 3RHZA 2I03A 3H8MA 3VJMA 4Z9XA 1VLZA 4DTIA 1JPVA 2UZ3A 5J2CA 5J9FA 5DASA 4ZC8A 1DRGA 1SUAA 5EIBD 3S2FA 4GUAA 2O0JA 3PCRB 4BLSA 2N3ZA 4CG3A 2QZZA 4PPXA 5SYAA 4NFLA 4OP2A 3ZDAA 4KX3A 5EJ8A 4LCJA 1OBFO 4KPUA 3FETA 2J5RA 4YPVA 1F2UA 1JLMA 4GI5A 4UNSA 1W1UA 3KX2A 3NUQA 4C4OA 2HCRA 4JUFA 2VK1A 4BZQA 4Q1EA 1FU8A 4EHDA 4GZMA 3COVA 1B8NA 4HZUA 4XDZA 1ZQUA 3IDFA 1ZQWA 3DOHA 2EGHA 5FJIA 2FN9A 4X97A 1OH5A 4KPUB 1UP7A 1N6OA 4AZVA 4AZ0A 4FOLA 2XCIA 1ONOA 5THXA 1S4MA 2H1SA 3VR5H 1IM4A 2RHFA 4BV8A 3Q8LA 1D9ZA 4X6UA 1CUSA 3T9EA 5HHHA 1KFKB 4C8MA 4C43A 3F90A 4FPXA 5KU1A 3JWGA 4R2MA 5BW5A 4GOXA 3KUUA 3OPMA 4Y2HA 2G8LA 4FJ1A 5LFAA 3ZGXA 1BQEA 2P1DA 4Z3DA 2R96A 1KI7A 2JJ1A 1V4NA 3CUTA 3WGQA 4WRRA 1YKFA 3KLPX 3I61A 1E2NA 1BYIA 3OSUA 2YB1A 1Q1AA 1YQTA 2YQ4A 1ZD4A 4R3NA 1LVGA 1W7AA 3BILA 2UV8A 3GMIA 3UIEA 1NRIA 3PKIA 4W8GA 3MUNA 3ZXYA 4B5LA 2GKGA 5JBNA 5DB4A 1QFJA 4NBVA 1RPZA 2ZWMA 5K3DA 3LPCA 1OX4A 3O4VA 2IV3A 5I9BA 5DT9A 4X9XA 4Y6GB 1DQRA 5BVGA 3JX9A 4DYDA 5LL6P 2CZGA 4YV1A 4KVZA 2B61A 2IDKA 3BGIA 3H2BA 3UFXA 1YE5A 2Y27A 3RB4A 1XZFA 2VOEA 3QVUA 5CYFA 1OX4B 4CHTA 3OT1A 7ICEA 4C2AA 4INAA 1KQ3A 1L7PA 3BKWA 2HMXA 2CJXA 3NBQA 2OILA 3OM1A 5ABPA 1JDTA 3TFQA 3V1KA 4A10A 3N2GA 3JQ7B 1SC6A 2PXHA 3ED1A 4EVSA 5HHIA 4JLVA 2Q0SA 2XOKD 1B73A 2C8KA 3OT1B 4K8OA 1YF3A 4ETNA 5L3ZA 2J6UA 4CNQA 2J45A 4IW3B 2PZJA 3IXLA 3K8QA 1RBQA 4L8GA 2ILVA 1A4RA 3O83A 1T5DX 2A9KA 3RPEA 2GEFA 5A2GA 5G02A 3JU3A 4YJFB 3VPSA 1GN8A 3GRAA 4HK4A 4C21A 3V4LA 2R1TA 1ZWLA 4S35A 4KEAA 3CRQA 3RT1A 4RPJA 4JI4B 4MV0A 1JVSA 4GVLA 3K5PA 5DW0A 3DVAB 3L7BA 2P30A 4FI3F 4UHDA 4CCYB 3ZWXA 2E5WA 1GNTA 1WEHA 4IGFA 2PXIA 1T6XA 4JBIA 3Q7RA 3OE5A 4OSOA 4XIGS 1PFVA 2I91A 4DL5A 1FDSA 3HB7A 4B3GA 4I8XA 1FW8A 2PH1A 4AZ3A 2Y1EA 4MYSA 1VKOA 1H6AA 2P78A 1UP6A 4G1VA 2IVZA 3KKPA 2YXNA 3VH1A 5ICMA 1DKMA 1J4AA 5CK4A 1F9EA 4KQ1A 9ICJA 4JP5A 5FFMA 4R3WA 3QMPA 3O73A 1ZOSA 2H4WA 2QUHA 3QITA 4L4SA 4M37A 3RUEA 1E1QA 1NBEA 2Y0BA 3N6XA 3BMQA 2P9FA 4U0JA 1N6PA 2X3YA 2LYBA 1UMDA 2WJ4A 3G79A 3TSCA 1M0EA 3PFBA 5B12A 2W42A 4OQPA 3NVKI 1FLDA 3TDNA 4DO9A 4J2OA 1IXYA 1TC2A 3HZOA 3RC3A 4EGCB 2V45A 5IXJA 3T9BA 1M54A 3SV4A 3GCWA 1FMJA 3LUPA 2HQ1A 4B80A 1OX6A 2OV6A 4LJRA 2AMFA 4KCGA 4X90A 4ARBA 2JGAA 4TUYA 2X9NA 1YIOA 4MYHA 1BMFA 3S81A 1D8LA 4IGEA 3LC2O 4LE1A 4TV9B 2QSYA 3IAM1 2B7LA 4MH0R 3CP8A 2OPBA 4I5FA 2YRWA 5FAKA 2JDIA 1U3VA 2M6LA 5DB8A 2CBXA 4MHTA 3PR5B 3PQCA 1Y4AE 4QUGA 4UB1A 4R0MA 4PPQA 3VSDA 4B0OA 4OHYA 1TF7A 3JATB 1LFAA 1SVUA 1KI1A 1NIPA 1ZJYA 5HUHA 5IDXA 2NRVA 1J8FA 4IQFA 3G82C 1C8BA 1VLJA 2C0PA 4C88A 5JZ9A 3COSA 3AI1A 2RAVA 2JLYA 4YRMA 3QYAA 1H6DA 2BCSA 1Z82A 1YZLA 1EUZA 4OM7A 4G85A 3TLGB 2PUTA 1I3LA 2WM8A 5AESA 5M5BA 4A36A 5EWJA 5DHRA 2F3TA 4POAA 2H1WA 3HL4A 1UDWA 1VE5A 3IAFA 1T8YA 3MEQA 3NORA 1S2GA 5E7QA 3I1YA 2Q0QA 3LHDA 4R5MA 5CITA 1JHMA 3DF9A 1S3SA 1LQTA 1LW6E 3JPSA 4BFSA 2Z4SA 3JAWA 4MARA 1Z26A 3BAZA 1NT2A 5EZYB 4WAUA 4B7ZA 3EVZA 3DOUA 4B85A 4HDOB 4OJLA 2HHQA 1V2GA 2VRNA 4OD0A 4GICA 5BR1A 1YFLA 3NYRA 4ZCRA 1CUFA 3RS8A 1YL7A 1X8KA 1WXQA 1WHTB 4EELA 2DWPA 3PI7A 5HRAA 3VO1A 5JAZA 1E0AA 1U2GA 4RHFA 5A7HA 5LP6A 5ALHA 2B4QA 3FDFA 1JTVA 3HUDA 4E5PA 4DL2A 4QU5A 1BXGB 3UXMA 4MVCA 3RH0A 2JAOA 1DARA 4NQZA 4DQLA 5KFFA 5H02A 4M47A 1VHWA 4Q6BA 3NIWA 3WKDA 3R3JA 1YMUA 5JD3A 3BK2A 5TQ2A 2PN1A 2VXBA 3OC0A 5ITSA 3WYBA 4GC9A 3N0WA 2HW8A 2O2DA 1VCOA 3IJPA 2PX2A 4Z0NA 3QW2A 3DTNA 4GZLA 5E9JA 5FOQA 3VU9B 3Q0IA 1Z7EA 3NT2A 4X7MA 4XX0B 1JG4A 5B66U 1OC4A 1GO2A 1N1EA 4KSCA 1KYYA 2XD9A 3H2GA 1VIMA 5U1PA 1IQPA 4GNKA 3IG5A 3ZBQA 4BFTA 3I28A 1Q74A 1GZHB 3HH8A 3SOZA 3H9BA 1DXYA 4Q1VA 1P19A 4Q01A 4D0RA 3NDPA 3JPPA 3O4HA 2O5CA 4U6SA 5LDDC 1BPXA 1PQPA 2C84A 3L77A 1EVJA 3QMMA 2Q3JA 2XXJA 1AY0A 3V5NA 2FU5C 1H2YA 1CUEA 4NLNA 4R81A 5BORA 4XAQA 1ISHA 5CT6A 5CA0A 3C3MA 5GJWC 4RMJA 1RAIA 1LTHR 5I7UA 2Y0PA 5J0YA 3UAYA 3PC8C 1NURA 4IMRA 5E4FA 5E3HA 1ETHA 4HMQA 4R69A 4IR1A 3ZY4A 3L01A 2W48A 3EB9A 2VTDA 3TVDA 1U5BB 7ICOA 2CF5A 4O0MA 5CA0B 1T1IA 1K8ZB 5EIHA 4HB0A 4HP8A 2R97A 4FR0A 2UZIR 1MMFB 2G6TA 4M46A 1XN4A 1NAHA 3ONVA 4IXMA 3TOXA 2WIKA 3BWDD 3QVXA 4D9GA 1Z1BA 1J49A 1E1MA 4L2IB 3HA2A 3O8CA 4WTOA 3K8OE 1FRVA 3E48A 1Q3UA 3HCBA 3RLFA 1HSOA 2B4RO 3RRZA 4WE3A 3FPHA 3ZDEA 5TPWB 4YFKA 1F6DA 3H2ZA 3URKA 1ZL0A 4MMXB 1Q17A 2CDBA 2AR9A 1W0KA 2WNIA 4H7EA 3VHRA 1QYDA 2QWXA 1DC3A 1GU7A 1MZPA 4JJ6A 1Q91A 4NMLA 3Q3GE 1CZUA 2ES6A 4TVSA 2PM8A 5C18A 4MKGA 1QZZA 5CVUA 5AK6A 4TTJA 5TQJA 4B3JA 1WKVA 5L7YA 1ZRSA 4RTPA 1JU4A 4USAA 1KAMA 3NEAA 4HGZA 2DEUA 3WMEA 4QPNA 5F73A 2AOUB 3K0BA 5DKFA 3QXSA 1E9RA 3OEWA 3RROA 3QFTA 1T91A 3PEUA 2ZT7A 1LDEA 2HHAA 4Q12A 2CK3A 5JEEA 2CFIA 1GPH1 3O8OB 3BGVA 5LYJA 1UDRA 2H1FA 2VQDA 3KWMA 4JBNA 4OFZA 4RZIA 4W1PA 3T7TA 3VH2A 3IVAA 2G9UA 2DTXA 3FMPB 4N39A 4DR4B 4UATA 4POOA 4CV2A 5LWHA 3DE3X 1C81A 4P4MA 1XELA 2QRLA 1VLQA 1DWUA 2AOTA 5IK2A 1FIUA 2Q5QA 5I3ZA 4B82A 4RNOA 3I2KA 3KDSE 3WK9A 4R51A 4HFMA 4NE2A 5EEHA 2XT0A 5H82A 4KLLA 1WMFA 3F8WA 4TMFA 3G2QA 2O7RA 4WNAA 2R66A 3LW8A 4ENQA 3P19A 3WGVA 3ICCA 1TF2A 1R3UA 1TM7E 4ZU1X 3SJAA 4Z7JA 5L3SA 1AKEA 3HB0A 3K6RA 4C78A 2O8NA 4L8WB 2FK7A 4GMXA 5AR1A 2IOYA 5KYYA 3GLTA 2G0TA 3EAGA 4YCLA 4CCWA 3SIPA 5C4IA 2PZBA 2A5LA 2O1SA 3GBSA 1CUVA 4JH0A 5L3SB 3VAAA 3QE2A 3KD2A 4NHEA 4DG9A 1O6ZA 5L1LA 4DJ5X 4NH0A 2D5BA 1CQIB 5LXTF 1HE1C 2C7OA 1G3UA 5IT5A 1A50B 2FFAA 4D26A 4P0QA 2YRFA 2DKNA 3UPQA 1M2VB 1DS6A 3AGQA 1DT5A 1YMQA 1SY7A 4M53A 1Y37A 3OHAA 1N60A 4F84A 3MCZA 1MAHA 1XU9A 2BEUB 1EP2B 1OXTA 3C70A 2PNJA 1TKCA 2JAXA 1SUEA 3NBYC 3RFFA 1ECCA 5E6RB 1XK6A 3D81A 3ADBA 2Z2XA 3MMSA 3TQQA 4XD7A 3KYIB 2EG5A 1DAEA 2KV2A 5L1KA 4JI1B 4QOFA 3ZBTA 3K6KA 5HFNA 4NV1A 5DNDA 2QRQA 3SFTA 3D3JA 3V7UA 3EVAA 3G23A 3TKLA 3TN7A 1XVVA 2Q8QA 3V00A 1AUOA 1U4SA 3K9GA 2QR5A 3H18A 1X9IA 3FDZA 2AZDA 4LDJA 1TK9A 2F1JA 1SEPA 1YJBA 3RJ5A 3JWHA 2EZ8A 2I2XB 2HWXA 4TYMA 3G7SA 3K9NA 1T1EA 1MABA 4M9LA 2H65A 3R5SA 5EE0A 4LWPA 4KKVA 4C6SA 3FDZB 1ISFA 2FHPA 4AF6A 4CRWB 1F48A 1NC1A 4LJXA 3HFRA 3C8DA 1MN8A 4QWAA 5C1PA 3AOEC 4MW0A 3R77A 3GZNB 2C1XA 2FQXA 4LHZA 4BE7B 3HZZA 3S99A 1BE8A 2XQVA 3BMCB 5ALRA 5A9SA 1QDLB 2ZSFA 5JCOA 2PZKA 5DWVA 4CN9A 3WNDA 3H5RA 4EG0A 3G6KA 4KLRA 4KE7A 4IR9A 1IXRC 4ZT2A 4A0QA 2PGNA 1W34A 2BC9A 3VM6A 3CFYA 3OETA 3MTBA 3T9FA 3C2MA 2O0MA 4KBYA 3PYMA 5SY9A 1SXGA 1WG8A 4JJGA 4UHJA 1H5UA 3T7IA 1TECE 1YFKA 3COZA 2IZ5A 2I76A 4KV7A 4KXWA 4DWIA 3MCWA 5CFLA 2VNIA 3RRHA 1W49A 5REQA 1M0SA 1NZPA 2Q2VA 2KQUA 4I99A 5L6LB 3LIIA 2CNKA 5CNMA 4GX2A 2QIOA 2F7SA 3FVRA 3HVIA 2GLTA 4I5EA 2IU3A 3U7JA 4I1OA 3M9OB 3OP4A 3L7YA 2WFLA 1MOQA 2D7JA 3E8SA 3FPJA 5B58T 3KJZA 1XP5A 3H0RB 1C0PA 1XMSA 1SUIA 4TQSA 4B9UA 2Q3CA 1R6XA 3C7KA 4OA5A 2AC7A 2PS0A 1BEUB 1D8YA 1VYUA 4BFWA 1QH8A 2WFLB 4ZJYA 1XYGA 4B35A 2P4UA 3DZJA 1YB2A 1CQXA 4BQOA 5FFNA 1U9IC 3GFQA 3K1AA 4LMPA 5KYVA 1WVGA 4ZANA 3KV3O 5B3LA 4C7MA 4Q00A 1AH2A 3WRXA 3ZVLA 4FDTA 1AK9A 1ODLA 1II8A 4B8ZA 2BFOA 4NU0A 3RTVA 4KFSA 1XA3A 4H15A 2VQ6A 4GBED 1LPAB 4Q4HA 1ZICA 5KYWA 2H5IA 4CG0A 2XWBF 3M89A 4EL0A 1Z2PX 1JMKC 5AD1A 2JGIA 4YA6A 4QTYA 2XVZA 4S1VA 3NV7A 3CZCA 1TYEB 3T35A 1NV9A 4X7BA 4BNDA 2C5BA 5EI5A 1Q14A 2H51A 3LPAA 4PCUA 3ETNA 3L0ZA 1II8B 5EJ2A 3VNRA 3S1AA 3MGIA 3SZ2A 4BPBA 1GL3A 1VJ0A 2H16A 4EEYA 5KYWB 4DNFA 1UKYA 4IIDA 1TRHA 5IEJA 2D5LA 1I6LA 3H4BA 1IM5A 1PU2A 2W98A 4PFKA 1IJFA 1ZK3A 5JTUA 3WLHA 4LHSA 1YRAA 5T57A 5TEWA 2VQEB 1YVPA 4R01A 4JV5B 2Q3MA 5JY6A 4OHXA 4ED7A 5DM1A 1RI3A 3LTEA 5K8TA 4LI3X 3PUIA 3SC3A 4O33A 1OUMA 1BSVA 3K4HA 4N0PA 4DLGA 2CNWA 3ZE2B 3BBLA 1ZQPA 5TRTA 3RYFB 4KE8A 5KFOA 2VSYA 3N59A 1LS1A 4D5GA 4DL9A 5B5SA 1UC5B 4MO2A 4EX7A 3PFIA 4RFSB 1Z8DA 3KJIA 1NUSA 2F2TA 1F3OA 3MYYA 2PS9A 1XDZA 4F38A 5FUWA 5L3RA 4WV3A 2L5YA 4WMLA 3HSYA 1ZK4A 4Y2VA 2R8KA 1TA0A 1G7SA 3G5AA 1GLNA 2CXXA 3LP6A 3RVBA 2YC2C 3TPCA 1Z34A 3HJRA 3WA6A 4AO6A 2CB0A 5KC9A 2BMDA 3GJ3A 3MF4A 4ITUA 2C1EA 3Q3VA 5FPQA 3W6NA 3TZ6A 5FPYA 3VYTB 1DX6A 2RGDA 4DV5B 2CHEA 3UAGA 3KQUA 3VGPA 4EZ9A 1ZRMA 3GLHE 4XQGA 5A4IS 5JMOA 4UHFA 3ISTA 4C80A 3ETGA 4D4HA 3HKEB 2KX7A 1ABEA 5D00A 3NWBA 4P58A 4DS4A 3KJNA 4XQEA 3ZVKA 4M9CA 4ZYYA 1A9YA 5HEKA 3PUJA 4GU5A 2JZBA 5HRUA 1X77A 4IOLA 2ZBFA 4IUBS 2V7WA 1Z0IA 4JC8A 3OAAD 1ZCJA 1SXHA 5C5IA 1ZL2A 4E12A 1X94A 4KDRA 3QG5A 1I2MA 2JD2A 1ZUNA 1U80A 4BZWA 1EB8A 1BNCA 3UK6A 1BJKA 2VIIA 2A0FA 1WMAA 1RKUA 2BGMA 5C8YB 2G09A 1JU3A 1T0UA 4EGAA 4TSKA 3RSLA 2CMHA 1QKJA 1GFIA 3GJ0A 4RAOA 2EZZA 3EA5A 4ZO4A 5KSOA 1PKXA 3K6JA 3S2IA 1ZUNB 1YCGA 5HKLA 4EA6A 1YGYA 1Z5VA 1Q95A 4CT0A 4PG5A 3H4VA 2GR9A 5A5VA 1GKUB 4DDMA 4XLZA 9ICOA 4PYIA 2G72A 5LMNB 3X1WA 4ZYUA 3D6NB 4W82A 1PK1A 3HKBB 4BEJA 5KVQA 5A6SA 3GG9A 2ZBRA 3FZQA 2YBDA 2V6BA 3C1YA 4GKAA 5ARCA 3T06B 2QRKA 2BI7A 4LECA 2TMKA 1Z19A 2I4OA 3WGNA 4G4SO 1E8MA 1N2HA 3WZ2A 2B82A 2P7HA 2VSFA 5FBVB 4OHKA 1WSBA 1NHGA 2PIAA 3MLBA 1TNDA 2I78A 4K6MA 3L1IA 3GLHA 5IULC 4OHBA 4P32A 2EW1A 3PC4A 5AHRA 4NFHA 3G1TA 4F2DA 8ABPA 4RS3A 4CLDA 2DQNB 1AKUA 4MAFA 4QA9A 1K4KA 1VI2A 3Q87B 2HHUA 2UXDB 1ZVMA 1K6MA 4O0IA 5KTQA 5KT4A 5DIFA 3JVVA 1F7VA 1VBMA 3WGZA 2CLSA 1HTBA 5CEJA 4INZA 3RHFA 1ZEMA 2WWHA 2XTZA 3D4BA 3REQA 3OQNA 1S1CA 4KGVA 3ZR4B 2ODPA 7ICPA 4C4AA 4B6FA 1H2AS 3C3CA 2IUTA 4YFVA 3UAOA 2B9VA 3AM3A 3PUKA 3PD0A 2G0NA 3TFRA 6LDHA 4O5KA 3QOYA 4L5YA 4HAOA 1PJRA 4P3XA 3ZGOA 4NU8X 2AJLI 3R0IA 4CLOA 5I4IA 1VCHA 3RF9A 3IT1A 4LPSA 1KE2A 2VLBA 3E9ZA 3OHMA 4YCAA 1ODKA 2OXIA 3D2NA 4M7RA 5E2AA 1GZ4A 2IYPA 1U9CA 2GBCA 2AXQA 3TACB 1V1JA 4CLOB 5E95A 3QFHA 4KGZA 4G07A 4RANA 5G1NA 4WJLA 4EYHB 4UDXX 3AM9A 1C1YA 3DMTA 1D5WA 4F2SA 2WQ6A 1LPOA 1GZ5A 3PXUA 3WLJA 1QQ5A 4M1KA 3AY0A 1V41E 4K6CA 5TGDA 4F4HA 4PZUA 4Y9TA 4JU8A 4PYLA 5DXAA 1APBA 3FYUC 2OQRA 4Q3AA 3B1JA 3CY6A 3NUGA 1KYQA 3FTQA 4QU8A 3E1GA 3WAKA 4XB6B 1D07A 3IKLA 1D5CA 4K9SA 5HSGA 2D06A 4RGYA 3WGLA 4QGBA 2D6FC 5HGJA 1JXEA 4G0WA 4Z54A 4XM1A 5G53C 4MF2A 2B5VA 3RJMA 1Y1QA 2Z98A 2QAIA 1IN4A 3THXB 4XSVA 2JH9A 3IO3A 5AW1A 4OV6B 3H2IA 4AKTA 2FQQA 1XCPA 1OLOA 4KACA 3GDGA 1V2HE 2BV3A 2ZJ7A 2EDUA 1GWNA 3ZKWA 3QVTA 4QUDA 3NNSA 2HJRA 5DNVA 1R0BA 2B4KA 3KQSA 2QF7A 4PX2A 3IUQA 1QAMA 5F9MA 2PPVA 1HRDA 5KJ1A 5JSFA 2Q4DA 3NC0C 4OH1A 5L6MB 1PNVA 1XHLA 5DHUA 4G3XA 2R8IA 3MUOA 1RVDA 2QM3A 2HC9A 3PO5A 1GKKA 3NH6A 4UPDA 4ED6A 1QE0A 1S8FA 4QOHA 3HNRA 5G1PA 2Z2JA 3MQFA 1BS2A 4JGIA 4NVRA 4L5JA 1TYBE 5KFRA 5JE8A 4D8YA 5JI2E 4C89A 3ZHQA 1ULSA 4KQFA 1RXCA 3BIWA 4I1UA 2C5GA 4CM3A 2X8WA 4L5IA 4PYNA 2H5XA 1QC5A 1RAAA 3M33A 1JVNA 5IIMA 2JVJA 1NKCA 4ZOLB 1ZHOA 2HBMA 2PLRA 2QN8A 4KQ2A 1ECGA 1UKVY 3ZLUA 1H9CA 2NYAA 4ZI7F 2EAPA 3K16A 3FB4A 4UU1A 1BE1A 4RUCA 1WE2A 4TL9A 5EZ5A 3NZEA 1OLXA 2A2ZA 1QC5B 3HRDD 1DO8A 1U65A 4D8WA 1D6MA 4JKYA 2YZKA 2HLDA 1GPJA 3L7MA 1LDNA 4B5KA 5D8DA 2QM8A 5F4BA 7ICLA 2GVZC 1CVIA 2K7ZA 1D2NA 1XD9A 4UBJA 3VZCA 4JSRA 3D64A 3K2IA 3A2LA 5BVHA 5KWEA 2WLTA 4QT4A 5EXPA 5D5QA 2A9FA 3RNLA 4QKQA 1OLXB 1KBQA 3RU9A 4MHVA 4R1SA 1N78A 3M1AA 3CC8A 3DHVA 5K6RA 4HT3B 4ZZ3A 4DCPA 2FN7A 4I46A 3LKDA 4DFPA 3HS3A 3B3GA 4EUKA 2CXRA 3UAWA 3OH8A 3UB4A 1L7DA 4RACA 5D84A 1JKMA 4PLHA 1B14A 1VC2A 2Y3IA 3TR6A 4JX8A 4MV3A 4EJ0A 1NJ1A 1IIPA 1B6SA 3LUHA 3TBHA 4UHKA 1LTQA 4IS7A 4C4SA 4RCVA 4P4PA 4LCBA 4YIHA 4A73A 5IIIA 4DWWA 4DQVA 4X64B 3ZQJA 5FUQA 2V3CC 4JUIA 4YALA 2XTJA 2HY7A 1BN6A 4IOJA 2IEGA 4YXJA 4AIIA 1BCRA 3OJEA 3NBAA 2JD0A 2J3MA 1T1RA 2VWGA 4DC1A 4L57A 3ET5A 3QZ7A 1DI0A 4S2EA 1JJVA 3RO7A 4BKMA 4C5CA 4I1YA 2ZS8A 4EZBA 2WIBA 2G5HB 4KVAA 4DTCA 2VTVA 1JEQB 1SOAA 4XWTA 3RC1A 3NHJA 5CU7A 2I7TA 2IYAA 2I7CA 2WG0A 4OFWA 3O4RA 1PWEA 3HXTA 1Z4MA 5BT9A 2KSOA 3G9UA 3TQHA 2FDXA 4E2WA 5HUJA 2I5PO 4D4GA 2C78A 3G5LA 3V8QA 1FUUA 5AUOB 4QHTA 1WF3A 3Q1LA 4JP3A 4GEGA 4I2EA 3UNXA 4XXHA 3U26A 1XTJA 1MXFA 3F3SA 3MR2A 3MT8A 2QTRA 5IARA 2GSDA 4FXPA 3TOZA 4LBZA 1Q15A 1NXVA 2Y2UA 1X9XA 1S4QA 4J1NA 4NONA 5INTA 4E94A 1S7CA 3I9JA 4DSEA 2XC9A 2QE7D 1RQXA 4L8VA 3ITDA 1SXJC 3ASZA 2ANCA 4DSOA 4I9GA 4OHZA 5JNRA 3OCUA 4DV2B 3HILA 3RJHA 2VPQA 3KAKA 4B43A 7AT1A 4EG8A 1ZJZA 1SCIA 4F8JA 3U16A 3EPIA 2I3DA 2G63A 1K66A 5CEHA 1EBBA 3RUHA 2ZU0C 2PXAA 5FJJA 3HKCA 1W5EA 1I7NA 3IXQA 1R9JA 4IDGA 5T14A 4RF2A 1W6UA 2ZPUA 3IB6A 2AUNA 2PSHA 3I58A 2V9PA 4YCBA 2FMPA 2AJCA 1FE8A 2XPCA 4KH1A 3HL0A 1PL7A 4OHVA 4NMHA 4JYZA 2YY5A 5B1EA 3T4PA 3M6AA 2BQ3A 3G8CA 2ZSEA 3A3NA 3UJ7A 4WA7A 4J9QA 3EEBA 1U0SY 3HKCB 2JLCA 3NANA 1L6RA 1R9GA 5B7NA 3T0GA 1PNTA 1KDYA 1FYEA 1RLJA 3G0BA 4II2A 1FP4A 3OUTA 3SQLA 3N7SC 4GYYA 2CFCA 3TW8A 2IYOA 4BVHA 3QKSA 5AI5A 2ZDGA 2QV7A 3EUWA 1QS0A 2H4YA 3T7SA 1RLUA 4PYJA 3O8NA 2BEVB 4ARZA 3V8EA 4IRDA 2ECQA 3FDXA 2OGSA 1IY1A 1WPRA 3D2CA 4X1KB 2G0AA 1KMNA 1FP4B 4F3TA 1JSRA 4MB6A 4KWCA 3TW8B 4M9JA 1BKSB 1E3IA 2HBLA 5DTQA 5GZ1A 3ZHBA 2JLWA 4P84A 1O96B 3OQPA 2ZXUA 4X85A 4ARZB 3K0EA 3K0HA 1VZ2A 1NOMA 4TKLA 1SKSA 4W99A 3IALA 3B3FA 4WSOA 5HF9A 2DE0X 2YMPA 3TLJA 4V0LA 1T3GA 4LZPA 4NBLA 2QMYA 4OIFA 3IQWA 3C85A 3U56A 3P0HA 3B1FA 1RP1A 2FY8A 1OW3B 4HLNA 5AKKA 1GITA 4IDCA 1E7WA 1U8EA 2PX3A 4RQBA 4YMSA 1ZISA 3OA0A 1QFSA 1QYXA 1BEZA 5AVYA 3ID6C 4D7AA 5IZCA 1I0IA 4PHFA 4L16A 1MC8A 4JQCA 3G2HA 3KETA 2UYYA 4CF4A 1GNQA 1F3LA 3TXXA 3ICOA 1H0KA 4LRUA 1L5MA 1N8SA 4UUQA 2HDNB 5CDFE 4BZPA 4JSTA 2HKIA 2AMYA 3IEPA 4G2TA 1GPWB 4AKEA 3EMVA 3AM4A 4TZKA 2IH4A 4BFVA 1XZAA 3JQFC 5A62A 1ADJA 4RT3A 2PH3A 3WSTA 1ZAYA 2R7AA 2IU6A 3TQIA 3G0DA 5IDYA 2QRHA 2ZI4A 5C7LO 3C1OA 4A82A 1FVXA 4OXNA 1YBMA 3TAQA 3WL7A 5KG7A 1E9VA 1R5BA 4Q7LA 3VKUA 4ZO9A 4YJ3B 4ZOCA 4MP8A 4DA4A 1LK7A 4PLPA 3D3KA 1U3TA 4N12A 2WPDD 3KB8A 3Q7TA 1VJCA 4DSKA 3V55A 2X5OA 5KCZA 3OA2A 6Q21A 3FOZA 5CA1F 1R18A 5LJLA 1T10A 2X0EA 1EFRD 3CWZA 1P1JA 4RE5A 1GDHA 2GF9A 1G60A 1YB7A 4MQ4A 3W90A 3NWJA 1ZK1A 4XB1A 4LHVA 2XCLA 3PF8A 1CQPA 3RRBA 3BRQA 4EJ6A 2Y9MB 5ALYA 5A4FS 4FHEA 3PNKA 5CP2A 4K5QA 2EEZA 3I2GA 4GYKA 5DI9A 3RVKA 4ESVA 4GI3A 2GN9A 4PSCA 3KZ1E 4LI0A 2MU2A 2G28A 1JIKA 3VPFA 3PMNA 4DA6A 2VDWB 4REQB 3VC7A 1W5FA 4BO9A 4EG6A 10MHA 3EVEA 1WY5A 3H5AA 1G19A 5KG1A 4EF4A 2C8VA 1U2SA 2VYNA 4EWLA 3MINA 1G4AE 5J0OA 2WNHA 2UVRA 3PEFA 1XTKA 3MMZA 1UMCB 4KR0A 1A97A 2O5VA 4BTEA 4I27A 4KLTA 1LK0A 5K09A 1XRPA 1ZM2A 2OBLA 1SG0A 5C80A 2HLNA 3TQTA 5J63A 1H3EA 2OZVA 3FWZA 4UASA 5CDFA 2RG1A 3MINB 1ULZA 4BLOA 1WABA 5KYXB 4EVRA 5KQLA 1QTQA 1EDBA 3CCFA 1XD2B 1T9GR 1USKA 4GR5A 5A9RA 2YWEA 4IPTA 3H2SA 1E79A 3FPEA 2CYCA 1ECJA 4JT4A 2I2CA 3L82B 3AMZA 3LW7A 3CR7A 1Y9ZA 2Z4TA 3AF1A 3GQBA 3A37A 4XVRA 5DP2A 5ALTA 4OQMA 2QDXA 1YKGA 1KYZA 5BPCA 4KLHA 2KVSA 2VEDA 5D51S 2C57A 2K5UA 4DV7B 3D6UA 3FHTA 2XZOA 5EUBA 3VTZA 4V0ME 4I55F 4R0NA 3RYCB 3PHBE 3GQBB 1A76A 5COAA 4ZT7A 4D8TA 3JQEA 2K4EA 4G4GA 4MKRA 1HQDA 1PSWA 3BFKA 2OD2A 4GXTA 4S24A 4JASB 2B1RA 2RBGA 1EQUA 3QNWA 3D4OA 3RAGA 5HJEA 4RTOA 3DPUA 1L2TA 2AZ4A 1SHTX 5L45A 3AY3A 3O93A 2DFNA 3D8RA 4CCSA 3BFXA 3ZHRA 2R8RA 4N3BA 3WTBA 2NZJA 3GDFA 1WZ2A 3A3YA 4KLOA 1XZQA 3JQ7A 2MAXA 3VR6H 4CCAA 2JCYA 5EVJA 3FVTA 2C20A 1E60A 2EJUA 4O2RA 5ITVA 5MF6A 4OK3A 2JR5A 5KNCH 2FW0A 3RR7A 5HJ2A 3WFZA 1HOXA 5LJIA 1QGOA 5H9VA 4YJFA 4FILA 4DL6A 1Z5GA 1YACA 5T4BA 1KO4A 3NJRA 1XZDA 4NZPA 2I3GA 3P5BA 4FKMA 1CQZA 3CVVA 2ID7A 3AU8A 1XAIA 3OTGA 4C1NA 4NBTA 3G5TA 4YRNA 2EJBA 3DVAA 1YZUA 5E6SB 2NV2B 2G40A 1DAIA 4CCYA 5AO9A 2IOQA 1JJIA 4ZODA 2V4RA 2QVXX 4DV0B 5EXXA 1RPLA 4IIHA 2DBZA 2BEKA 1UPAA 2K8AA 2X5KO 2UUAB 2XODA 2F3QA 4BECA 3T5PA 1YQXA 3DWIA 4GKKB 1RWKA 2VNKA 4R9VA 4BVLA 3GMTA 3ZNNA 2AU0A 3KT3A 1LA2A 4B6JA 2ABWA 2AJ8A 2CDRA 1WQ3A 4V0MA 1ADFA 4BAGA 1ZPDA 4CLHA 4DBZA 4RZ2A 2ONZA 1GT6A 1P81A 2X3FA 3PX6A 2EG9A 2HU2A 1LKZA 2A86A 2Z7JA 3H19A 4IAOA 4BYGA 3O1JC 3ZY6A 5AJUA 3CNNA 1WWVA 4KZKA 1GU1A 3HVKA 2W7OA 3L8FA 2I8LA 1XZMA 5IIOA 4DJAA 5I4KA 4CQJA 3G2JA 2Z2ZA 2DY0A 2JA1A 1VMAA 3K73O 3H11B 3W3AH 1E7QA 1G5FA 4QXMA 9ICVA 5KQRA 1U1CA 2RKWA 4ZAVA 4F4FA 1BPDA 3M8RA 5KNLA 1XNQB 3DZBA 2B4AA 2POQX 4M9UA 4LMRA 4OQZA 3HYCA 3CO0S 1SBNE 3GUCA 3MOGA 1SWVA 4I66A 5BN1A 2J6SA 3FOWA 2VDNB 5IYZB 3KAJA 2V58A 2FZVA 1R4MB 1YJCA 2IYWA 5AW2A 5A4KA 4Q16A 2QNBA 1UL1X 4OHFA 5LD2C 4DFJA 4TV9A 3R3VA 2VHYA 4KC0A 1TKBA 1DL5A 5ULLA 4C3VA 4CG1A 4GXJA 2XEDA 5JTTA 2E18A 1X6VA 3A4LA 1OBCA 1PJBA 2BJVA 9ICQA 1NJ8A 2LM1A 1COZA 3JATA 3AIOA 4BEWA 4PZDA 1R9NA 4WLOA 3II6X 4K8RB 4XFKA 1UEJA 1B8VA 4HXYA 4XQ8A 1Q92A 2BR0A 4Z9YA 1WDKA 4Z5XA 1VJRA 3CUSA 4GOMD 3LX5A 3TLGA 3OD1A 1WO8A 3H4MA 2CL0X 3ADDA 2FW8A 2BKUA 3OQ6A 5DXFA 2XE4A 2PV7A 2XUOA 3NW9A 3P9QA 1RHRA 2FZEA 9ICMA 1OGJA 1S2NA 3DOFA 4RKQA 2OUIA 4JUBA 3C6BA 2PVSA 2KJ9A 3CLSC 4KLSA 2O2SA 5IF3A 4ZT3A 4BMOB 3ZV6A 2VHVA 4JLKA 3X44A 1A95A 3MHTA 1KS2A 3AL2A 1N4DA 4K1XA 2E2WA 9ICPA 4JNKA 2V7QD 2WTAA 2ISPA 3D4LA 2VJ4A 2PRJA 3UYKA 2Z56A 2CJYA 2HHJA 2CHGA 5HPYB 5EZYA 2H1LA 3RBZA 4LGMA 8ICUA 4DDKA 1P80A 2BZFA 3OJLA 3PA6A 5MGNA 4LC9A 1PJ3A 4HAZA 2G9ZA 1NNUA 1EJ2A 4OFBA 4QQ8A 1VOTA 2HPHA 5A02A 1WHTA 3QXXA 3HWTA 1RPTA 1M6HA 2HV8A 2JIDA 1IXSB 4B09A 2UVVA 1N8TA 2X9VA 4JJIA 1BXGA 1AV7A 1ZOIA 3WGYA 3UXOA 4HEHA 1OREA 4C1BA 5KNBA 2BDPA 3RAFC 1HTWA 3W6PA 4B9SA 2PMZC 3I4FA 3O3MB 4JB0A 5FLKA 1HIWA 3ZQKA 2XWJI 5JNWA 3K1TA 3VU9A 4Z9AA 1DC6A 4XX0A 4HX5A 4KMUA 3OSZA 1HEKA 1E2QA 2DHQA 3UG6A 3C6QA 1P1CA 1E1RD 3UJHA 3W2IA 5BSMA 4F4DA 3TK1A 4XWOA 2MINB 2X0NA 4KE9A 3T7AA 3GDXA 2IY8A 4GKVA 2PUAA 5FWAA 4HQ0A 2C9ZA 4CF6A 1XE3A 2FZLA 3NYWA 1O89A 5K4HA 3PE6A 4IWXA 3K8ZA 1YKSA 1NQ5A 4L07A 1GGKA 4O08A 2C5AA 2PSEA 3ZI4A 2W04A 4JJ4A 2BFNA 4JQYA 4ZVVA 5GJCA 4X94A 1LLUA 3ND6A 2VDRB 3PNMA 3JPRA 2GXUA 5BYKA 3MAGA 1NRWA 2HOFA 4D4LA 1JHAA 2X6QA 4DE5A 1LBEA 2DT8A 3MXTA 1TM2A 3P2IA 2ID9A 1HRKA 1U2DC 2HA6A 2ZTHA 3BZCA 8ADHA 4LX0A 3FPLA 2CCGA 3DE7X 2BGRA 4M0MA 4DBLC 4B4OA 1A5TA 2ZRGA 3JWJA 1S5PA 5JYDA 1KDVA 1U5BA 121PA 5HOEA 2VKQA 2KICA 3LSTA 1F8GA 1T9GS 1NL3A 3OLVA 3MIIA 2VF2A 2P2SA 4F2WA 5D3MB 4F3RA 4K6KA 2Q5HA 1F8FA 3ZVNA 1ID8A 5ALMA 3G5MA 4L2IA 5JW6A 3EXIA 4H7DA 3EGOA 3X0DA 1HC7A 3BK1A 1CT9A 1PWXA 1PTKA 2ECOA 1SU4A 1KH3A 1N0IA 5TPWA 1RW4A 2R18A 2AG8A 2YXPX 3DULA 1NK7A 1ZQJA 2DWCA 4XPIB 1YCFA 3V34A 3PDWA 2A9RA 4QTXA 3OQMA 3IIEA 4JOSA 3DEEA 2H9YA 1V85A 2VL7A 3EXIB 2JLUA 2IUUA 2DHCA 1XVAA 4DV1B 1FFGA 4PGMA 2YYAA 2C96A 4QFMA 3EA4A 1NP3A 3C21A 2LW7A 3AF4A 4PE5B 4NWIA 3QJ5A 2BZ0A 2OGWA 1ULBA 4FHCA 1L4NA 2SNIE 1XEWX 2BH2A 1MKYA 2C8LA 4HX2A 4ZRNA 5H4GA 5CNKA 3F9RA 2XUFA 3DLHA 1W47A 4Y6PA 1VE1A 3TADC 1IG3A 3WDKA 4PEVA 8AT1A 1SL2A 2HXSA 1QYWA 3SHTA 2J46A 3OEHD 2AOUA 1HYBA 2FR8C 3LKBA 2BTEA 1V47A 3ZWPA 4OQQA 1KAHA 1ETUA 1ATZA 3C6KA 4XR4A 1N48A 1UWCA 1RNLA 5B7PA 3M5DA 2PZMA 3O8OA 5AKZA 4H35A 3THOA 2B30A 4QVIA 1E6CA 3W5CA 1NWCA 1FBTA 3EF1A 5JVDF 3V97A 5KC8A 3MFYA 3OCZA 4ZEMA 2GESA 3GV7B 3BB1A 4Q4JB 2B8JA 3S7TA 4DMRA 1T4CB 3KE8A 3BIOA 5EP3A 1XC9A 1NVXQ 4QM7A 1F0PA 4EG5A 1ZQ1A 2ATXA 3KS9A 3GP8A 5BNZA 4PVDA 4BQRA 1ESCA 2FSSA 5K5EA 1P31A 2BONA 4RTQA 3RU2A 5IBCA 2ZYRA 4OQDA 2GN0A 3BCUA 1KJ8A 3TQFA 3S40A 4DMKA 1NW3A 4R1MA 2EL9A 3BXPA 4RTKA 1WCV1 3RU7A 2PMWB 2F1KA 2SBTA 2KSQA 2PUWA 3DNFA 1PAUA 4W5OA 1UBCA 3ZHZA 5ALJA 4HOYA 5FULA 1Z07A 1GRVA 3VSBA 2ASEA 3OE7D 1WEKA 4WJZA 4E09A 2OAP1 3C3JA 2DPMA 5IC6A 3GMSA 1PFKA 4MCAA 3ROQA 1M2KA 3DBLA 3CRXA 2O2YA 1DIRA 1CQIA 3H2JA 5F7ZA 4TLAA 3HKZF 2BBTA 4MP3A 1M2VA 3MUEA 4QGSA 2O3QA 2EZXA 4YT2A 3CYFA 4QPDA 5K3SA 4IO0A 4HGQA 2BEUA 5DGTA 4LXXA 3NR2A 3FFAA 3EIWA 3QEKA 5E6RA 4JXZA 5BY2A 3DBLB 2AQ4A 1D09A 1ZIPA 4WKOA 1X74A 2FWBA 1TMYA 4DWVA 5I8ZA 3HLYA 3WX0A 4HN2A 3BPSA 3SC4A 3VHQA 3JR3A 3ZYZA 3EEYA 1YR6A 2I3AA 1KEPA 4YDQA 3GBVA 1SV0C 2ZBUA 5FBWB 1X7WB 3V8MA 4AF8A 4O3SA 4OF4A 2IXTA 4PGFA 2ZRDA 1J07A 2YN2A 3X43A 3IGFA 4A1FA 4UUBA 3OQBA 3W5SA 4JUCA 4C6TA 3HY4A 3GZNA 4ZO7A 3TEFA 3JWIA 5JH7F 1RI1A 3F98A 4AQYB 2QYHA 2QPTA 1LJ8A 5JWRA 4J0GA 4LYYA 4Q3CA 1ZINA 4QU9A 3BMCA 3X2SA 5C4MA 4Z6FA 2FDCA 2E5SA 2CV0A 5KUTA 1K4YA 3DDWA 4LGYA 5CFPA 1TE2A 3DMHA 3WLFA 4DJJA 4BLVA 4C6TB 2GERA 1Q3VA 1Y3DE 1PVRA 2QORA 3VR4H 2IY9A 1L9XA 5B6PA 4HFNA 3CH7A 1AUQA 3ZXXA 3MGAA 5CIQA 3DKRA 4I19A 3OLQA 3NRCA 4NI5A 5FF9A 3IIKA 4CDNA 4WK0B 5FR2A 3FN4A 5E0OA 1IVYA 3SVZA 1HDOA 1JLSA 1MEEA 1JJ7A 1QO0A 1FY2A 1SEVA 2IP2A 2IUFA 3ZGNA 2ZIGA 4NBSA 3GA5A 1G5IA 4ZVKA 1LFDB 3VU8A 2L69A 3R5FA 1N2EA 3X2EA 3K32A 2YZNA 1M72A 2QVGA 1RM5A 2ZRCA 4ER0A 1U7DA 1NK9A 4G63A 1FTWA 8ICCA 5CT5A 4TTTS 4GI1A 4KVFA 3DS8A 2EYUA 3NTVA 4FZMA 3BRSA 4CM5A 2R8OA 1AS3A 1YZGA 2IWRA 1IRXA 2V98A 4QYIA 3M9XA 3LYHA 5BUSA 1JWLA 1L4GA 2WUFA 1R6DA 4IEFB 4BZZA 2OHOA 1YQGA 4FT4A 2G82A 2II6A 3GO4A 2IXFA 2AV6A 2XYHA 4JBXA 2YOFA 3A1EA 3AY7A 4PTZA 4QYIB 4I4TF 3VDRA 1HDYA 3UA3A 2AJBA 2H08A 4G0XA 2VWQA 1SXDA 4AKIA 3U0BA 4HLDA 4I1VA 1RC1A 4L74A 2CVQA 1EINA 4QFBA 4BNVA 5JFOA 1Y6GA 2P9TA 3GT4A 1P75A 3E7WA 1Y6RA 5DNAA 1C1XB 3PLAE 1UDAA 3GNLA 3DFZA 4ELVA 2CLLB 4G0MA 1X7GA 3TIIA 3M8SA 3V4VB 3IAXA 1COWA 4KIUA 5IKEA 4L28A 2JMGA 1KBZA 4XUDA 4PHAA 2IHNA 3JRNA 2DPGA 3MJEA 5KFDA 1K9VF 2QUZA 4DHWA 1WMSA 3A4IA 3AUJB 1GGNA 4ETWA 3BJRA 2Z83A 4I2DA 1CR4A 1CJBA 1F2TA 4PM4A 2B3TA 4UM8B 4A7PA 1T7PA 2O05A 3D54D 4EB6B 2FK8A 5H8WA 3J81A 2EBWA 2FSGA 3Q8RB 2GDJA 3CZMA 5KFJA 3EFEA 5KNDD 3KC2A 2I9KA 3FXAA 3K94A 3NAQA 3O2JA 2QSUA 2GCGA 4V39A 5M7EA 4P5DA 7ICHA 4NJOA 5AIBA 3A9WA 1XU7A 1F2TB 4DKXA 3AUUA 1AN9A 4C4YA 1OU0A 2QW1A 3REFA 3A9RA 1M2EA 2VBCA 4PF1A 2R8XA 3B78A 4P2GA 2ZRLA 2ONCA 2W0MA 2VXYA 3CPHA 3RYFA 2A58A 1LVHA 5A06A 4BVJA 3JQBA 4FGWA 4HQNA 4URHA 5KAPA 3F2VA 3M3HA 1ZJ4A 2RONA 5KFCA 4RFSA 1SIOA 2PS3A 2YWRA 1G2OA 2HQBA 2ADMA 1P7CA 4E03A 1NVWQ 5K8LA 1YIAA 2RI1A 4Y6OA 1S3FA 3L04A 2Q2NA 2JFGA 3CUWA 4ZVSA 4OQYA 2B1JA 4DIBA 1V45E 2I2AA 4EATA 4Y9RA 2W2NA 4J4BA 4IQ8A 1DHRA 3HO6A 2XOKA 2VK2A 3HU1A 3TG2A 3IV9A 3A1SA 1Q0PA 3L84A 2KBEA 1NTRA 1OB2A 4AUKA 1UBKS 2LIVA 5CVEA 3LBAA 1JI3A 1C7JA 1PRYA 3A6HA 1IYZA 2C7QA 5SZJA 1NVVQ 1ICIA 4MX8A 3MRXA 4MULA 1XU4A 4QIWF 1L3CA 3GZJA 4WFQA 2IYYA 1LS6A 1FL9A 1MAVA 5IT0A 3T38A 3U49A 1CD5A 4U3JB 1O7JA 1EHCA 1HT2E 3GDWA 2WTMA 3HKEA 3VUEA 3C2KA 2QUAA 5HF6A 4PLYA 4BP1A 3T3FA 4ZCSA 5DYNA 3GJQA 3S2UA 3N28A 1JB1A 1UAAA 1AKYA 5KYTA 2FRDA 2H3ZA 2V6JA 4KQGA 1ADBA 3UGTA 4OAQA 5I48A 3QEBZ 4I50F 1J70A 4MKZA 1Y4DE 3F5FA 4E2FA 4ZJZA 1SXJD 4RQ3A 1ZGCA 1VLMA 3QI7A 3D2LA 3GAFA 1J8DA 2YYYA 4II7A 5EHGA 4O4HB 5KTSA 5TJ9A 5EJ9A 5C8YA 4RYLA 4LVSA 1K08A 2VP6A 4NDNE 2AFVA 4UXIA 1Q1ZA 3IPRA 5KSZA 2W6NA 3WV5A 2KJ5A 1DFGA 1VPDA 3DYVA 3LT4A 1WY7A 3DEZA 1WUDA 3O5AA 4IC9A 1ZW1A 4LJLA 1V8OA 4DDVA 3DP7A 1GIAA 3CVJA 1SZJG 2QL7A 4PANA 1QOPB 2AQHA 3ILHA 3FHJA 4Q05A 3LBHA 2W8KA 1NBHA 1M33A 3HKBA 4YR2A 3MVEA 2GTHA 4U7JA 2HB6A 2DG2A 1YDHA 5A3JA 3WWPA 3THYB 5B58C 4RQMA 1R6AA 5AVUA 2B3DA 1E1DA 2DPLA 4ZIRB 5L3VA 1ICEA 5JROA 1Z6ZA 4GXQA 4P3PA 2N1BA 3QLVA 2A92A 2XNDD 3UOWA 2ZCJA 4Q1DA 4DSJA 3BGSA 1L5ZA 2HRZA 3DKPA 2C5HA 1SELA 3UWSA 2OSVA 1DGJA 1ZHFA 5KYNA 3FAZA 4AN1A 5ALDA 3A2NA 2P75A 4KQJA 3I83A 4BJ3A 3BXOA 4F4KA 3OO0A 1HDRA 1I5OA 5HQJA 1T2CA 4F1KA 3V7KA 1RFLA 2G7ZA 2XAUA 1KDOA 1QUFA 3HDHA 3TJMA 2PYDA 4RNDB 3H40A 4ZVNA 2PUGA 4QXOA 4B73A 1JDZA 2GM9A 1YT3A 1N7IA 4DZZA 1Q2UA 3C3KA 1EP1B 2VJBA 3HA3A 4H4EA 5LP1A 3UJAA 4C5AA 3GFGA 5EKTA 4Q7MB 4DDUA 3I2HA 4NOJA 4C4XA 3OOEA 2VS1A 2E4YA 4BX2A 3SHVA 4BNYA 4JBHA 4IIVA 1DAGA 4C7JA 2DQZA 1ZQDA 3QTTA 3L43A 3SE0A 1I4OA 2PFQA 3E3AA 1NKTA 5CJJA 3RKRA 2ZB8A 4FZLA 5CDYA 2FE4A 1K2VN 1C4KA 1T43A 2FFJA 1P72A 4QBIA 5DULA 4Z4FA 2JIZD 5HJ5A 4CZ2A 1D0VA 1UJCA 2F8TA 3FJYA 2GI4A 2XUJA 1TLLA 4GOND 2FMXA 4ZVRA 2W9MA 4J9NA 4CMEA 3PICA 2PT7A 4ZOQI 1UFOA 3MR5A 3EXHB 2DFTA 2VP5A 3I1FA 4EG3A 1ID1A 2PXXA 3ESAA 3KTQA 5T4HA 3S28A 3NT4A 4IWNA 1G291 1UMKA 5F9NA 3DE1X 1EG2A 4D45A 5FOXA 2A19A 2FFBA 3GJSA 4JB8A 1SXQA 2HBKA 1I01A 1JF8A 1OKKD 4J90A 1N6RA 1E63A 2WMDA 4QJ4A 1KIMA 4PQFA 3NDRA 2ATVA 1XXLA 5THQA 4Q34A 4FCVA 4F8RA 3H2YA 1LI7A 4N65A 2IYXA 3O8LA 2PYIA 2QRGA 1XZ8A 3QVKA 3B1XA 1TZKA 4MUNA 4BNUA 2PBZA 1EQ2A 5CXSA 1UPHA 2PZGA 3THXA 5A03A 3OF2A 4BUCA 1N1DA 2AMJA 1JTFA 2F3SA 5L4LA 1G0NA 1MB2A 1A7AA 5F1KA 2PJDA 4P86A 4Z99A 2NIPA 2YOHA 4A3SA 4OLHA 2RGUA 1ISPA 2FX3A 3PQ2A 1NZJA 5ELLA 3WLRA 1M1YB 5DW3A 1XI2A 3I8XA 2HIHA 5FQOA 3BX1A 1CR0A 4L73A 3OFVA 2YCBA 4K9KA 1GL9B 3EIOA 2BCRA 3F49S 5HZMA 4U39A 5LLDA 1TI7A 4EG4A 1V95A 2D13A 1P1KA 4IWYA 4AW9A 5AHWA 1GPMA 3EIUA 1KOGA 5BR7A 4GGMX 2J9FA 1D1TA 4G5OA 4GUDA 2ALZA 2L17A 4FB4A 3FLBA 2X19A 1XQVA 5FBHA 3UJ3X 4ZGWA 3F4LA 4QDTA 3BSWA 3IUJA 3PV0A 1ESNA 3RHTA 4QJ5A 1HFWA 4UB2A 4UUPA 4DIDA 2PBLA 4IINA 4ZOLA 4IHQA 4J9UE 2MU1A 2ZXIA 1PFGA 2FNAA 2J9FB 1R5JA 2O1WA 4DARA 3J81k 5HMMA 1WXIA 4KXLA 3DE4X 4OO3A 2PRYA 4MIYA 2GRAA 2AYZA 4CIXA 3U5ZB 4KDEA 4DLVA 2Q6LA 1TAGA 1K5PA 2H17A 4U7TB 1TTHA 3WGMA 2E5FA 2BY4A 4YJKA 1DTSA 4H7IA 2WILA 4V1CI 1AXRA 1J8MF 4CMHA 4ZT6A 2OCIA 2IK8A 3H42B 4D0GA 2ZYIA 5EE1A 2FUNB 4KOEC 1B6TA 4LYFA 1QH9A 3HK2A 3B6JA 2IIVA 1VBNA 1TCVA 2PT5A 4JHXA 3TPFA 1R0SA 3I9OA 4Q4DA 4IHJF 3R41A 4BKUA 2O8BA 4DRXB 4B2LA 4D96A 2GD6A 1K8YB 3SZUA 3OBIA 2ZUBA 3EFOB 3P9YA 4KWIA 3L4SO 3S27A 4UBCA 4YRQA 4JR2A 4ZYWA 1S02A 4OKNA 2F59A 4IRMA 3WY9A 4KQHA 1B8PA 2K8CB 3GUHA 3MN1A 2V9ZA 1DXQA 4D9MA 2O8BB 4XI9A 5LZ2A 3PB3A 1KDRA 1CY2A 3AL0C 4QASA 1QHFA 3TTSA 3ZDZB 1JQAA 3TVYA 4DL7A 2BM1A 4OOFA 4FZRA 3L05A 5BOSB 3GT0A 2WUGA 4P3YA 1PWHA 3DC2A 1YK0A 2CUZA 4HEA1 1KTIA 1IG0A 2VR1A 3GAAA 1AK1A 4BV9A 4UBOA 4WOJA 1JEQA 3FI9A 4GPIB 1J97A 3W8RA 4NYJR 3F8TA 1QVVA 3FM9A 2I87A 1YS9A 2D3DA 5L1JA 1FBNA 1E1KA 1HDXA 3GIWA 5BQFA 3GJZA 3WGTA 1XCOA 3BIJA 2GCPA 3ORYA 7MHTA 4FI3C 1RFGE 4ISBA 4CV3A 4WJKB 4UEOA 3KVRA 1UJ5A 1QLJA 2G4VA 2F4VB 1ZNZA 2QX9A 2FX5A 4C7YA 4XRRA 2QTBA 4MKFA 1J33A 3DO6A 1GCUA 3HP1A 3WOVA 3EVTA 1LNZA 3GFKB 4X95A 4ONEA 5F76A 3B9JA 2VT2A 4E4RA 5B64A 4RCYA 2C2GA 2PCLA 5AHKA 4BFZA 5ICFA 1EZZA 1HKUA 2Y67A 1SC1A 1X8XA 5A0TA 3B52X 1F4LA 4R8RA 2ZYSA 1KRXA 4TWAA 4CODB 4QXPA 2VUTA 4LHYA 3IESA 1NN5A 2QP9X 3C7DB 4ECVA 2BQRA 1RYBA 4KODA 1T5TA 4MRSA 2Q2OA 2KE7A 3HVJA 5IJ0A 2WDZA 2BZGA 3WB1A 3PPIA 2EHJA 3AFMA 2MRLA 4ZRMA 1Q57A 3CR8A 621PA 4X8OA 3GAZA 2HLHA 1N5JA 5KS2A 3BXZA 3FHCB 4W1QA 3KXIA 2UZ1B 3R0VA 3EQ2A 4TWJA 1U6IA 5IJ0B 1BHQ1 1I7PA 3DE5X 4J0JA 1EXDA 4TTRA 3WQBA 3KSAC 3GFTA 4FLEA 5FWNA 2AUTA 4ZVOA 3HDGA 1QNLA 2C2WA 2FEWB 1JAYA 2XCQA 4ALLA 5IWAB 3O8DA 1WP4A 1R0KA 2FMQA 2FWAA 2HRBA 1QU3A 4AX4A 4PQEA 2Q5LA 3CF4A 4X7RA 1FSPA 1SKWA 4XM0A 4Y0VA 2C92A 3UC5A 3KRTA 4FQ7A 1OGYA 2JA2A 4OKSA 3BA6A 5GINE 4BEBA 1UT8A 2Y0SF 4MDHA 1H6BA 1KKXA 3G85A 3OMLA 4LK3A 1TMOA 2Y0DA 2LPEA 2BEVA 4TMWA 3IKVA 3SHWA 2F8KA 1KXZA 3SJ7A 1NW8A 4X1KA 3HV2A 5SZIA 1S7GA 2VPWA 1O5IA 5JQGF 3COJA 4Z6EA 3PD7A 3RD5A 1O96A 1PBTA 3CLSD 4DG5A 2DQKA 2X9GA 8ICBA 2Y77A 1VIYA 2ENWA 1B7GO 2R62A 2YVLA 2WVAA 5DG9A 3J80A 1CR1A 1NPTO 3B20A 3V4PB 3FF1A 4DSUA 2NYRA 4BNNA 2GK6A 4DNXA 2GJKA 1K5OA 5BN3A 4YMOA 4JHLA 3EASA 3CZ4A 4HD8A 3LPNA 1YMVA 4R8MA 1QVAA 3I45A 3SYTA 1T8SA 2ZRNA 3AESB 4CEHA 2X9QA 3PSTA 4Y30A 1YQ9A 4XYGA 1Z3CA 4FGLA 1CVLA 3C5WP 3IOMA 1XVUA 5BN3B 4MNTA 4GYWA 2Q21A 1OZGA 4WEOA 2GPAA 4LEIA 1IXKA 1PVVA 1MC1A 3PNLA 2P8SA 4GZ6A 4X45A 4H7HA 3NIDB 2HVHA 4O5OA 1QX3A 4AO8A 3HM9A 3VJLA 4QGAA 2OCBA 1ZXIA 1TK3A 4CEHB 2RB5A 3SZOA 1RJGA 1Z00B 1J8VA 3HB4X 5DBFA 4YAKA 1C3XA 1FYVA 3DSRA 2A8YA 3ZLBA 2GPSA 3D1LA 3TRJA 1IONA 5CD9A 2XKKA 4BE9A 2YQZA 4L5BA 2FVYA 3BM5A 4FMCB 3I9V1 3TQCA 1RPNA 2N75A 3FCUB 4QJBA 4IMIB 1KQOA 5G0SA 4WZ6A 1FYFA 1QB7A 1I3MA 2XBUA 3AQIA 4IJ5A 4U7GA 5AKHA 2MUTB 3G9ZA 2XYGA 4YJDA 2PCJA 5BSKA 1ADYA 3NU1A 5FYDA 4YJ3A 2IZ6A 2N47A 2A9OA 3HXOA 1TW2A 1WSWA 3JD0A 4XRGA 5JRZA 1BD4A 3FDIA 3L7CA 3LQRA 1VG0B 3E9NA 4G9GA 3GYGA 5A5GA 4MMYB 1ZC4A 1NVGA 1PD1A 3ZV7A 5KTRA 3RAJA 3RG8A 4MVJM 4UB8U 2Q27A 4HQOA 1PEDA 2RRDA 221PA 1GGEA 4HMOA 3AR6A 1TZJA 1FVHA 3IR5A 2ZTCA 2ADOA 5CTJA 5JC1A 4U02A 2H2DA 2YR0A 3KR0A 3AP3A 1M2OA 4EY6A 2BTOA 2VDWA 4L15A 4REQA 3DV2A 4RLFA 3ADCA 5GONB 3V8VA 4LTDA 5JNUA 4P38A 3M6FA 2FW1A 3GQCA 4C0JA 4WCFA 2W22A 1R2QA 3E8MA 1TM3E 1DINA 4TUPA 1SKUA 2AUMA 3PPVA 1YUMA 4UM5A 4C0KA 1UMCA 3QENA 4DHEA 2WWTA 1GQYA 1M2OB 2PX0A 4JX9A 2XT9A 1P1FA 1K75A 1CRWG 1FXWF 3SNHA 4CI0B 4PO9A 3ZPXA 4E2XA 3O2NA 1TJ4A 2PY6A 4R1LA 4RQ6A 2I6QA 1OA0A 4WCFB 3N2ZB 5KYXA 3TNYA 5EIFA 4B34A 3MWGA 1FNNA 5EKDA 4QO8A 1XD2A 5CVVA 4ZFNA 1X2EA 3T7JA 2CJWB 4YMWA 3JXEA 3B8EA 3ETRA 3MWFA 4DR6B 4RPGA 1Y7PA 1AF7A 3JYOA 3P8ZA 4HGPA 1NVUQ 2FPLA 5T8KA 4MIEA 2XTNA 2WJJA 1V9CA 4B7AA 3SAGA 3ZHVA 9MHTA 1ISSA 4X41A 3UY4A 1K86A 3B1WA 4JLJA 2UVDA 3FVQA 3O3OB 3LHSA 3WNBA 1FUEA 4A2QA 4LZLA 5ALUA 3RYCA 5CFZA 5CM2Z 2OEPA 1RE1A 1IG6A 1OLUB 4F4WA 1L7XA 1C9EA 2QLMA 2EBUA 3GMDA 2RB4A 2BUAA 1GUDA 5H16A 4KLAA 2I9GA 2PUJA 2D1YA 2J0UA 4P92A 2V9WA 2PMFA 5CR9A 1CW2B 3QIAA 2A5JA 1TW3A 2YBEA 4PG8A 4WKGA 3BRCA 1SVMA 4I8DA 4LV8B 2Z1MA 3U3MA 5LQCA 2VA8A 4FOPA 4PIVA 3OAAA 4IS3A 1PTJA 1TU3A 2RJNA 3PX3A 4P7GA 1A27A 3RSOA 4YVFA 3OM9A 2E1PA 1U45A 2D8CA 2OFPA 4NC9A 4Q7EA 4QEZA 2H3IA 2J0UB 4DNQA 3P9XA 2A5DA 5B30A 4PO8A 2DUJA 4FHGA 1CEZA 2W2MA 5JDCC 5J0UA 3HUFA 3H04A 3L7OA 3ZGZA 5KKCA 1ITZA 3DMFA 1HM5A 1TQHA 1OWMA 1JX4A 3OT4A 5E7IA 4JGBA 5J58A 3I42A 3ZV4A 1A5SB 5E6SA 4GMGA 3C8MA 4E33A 2FSVA 1MDFA 3SG0A 1QE3A 4G81A 4L4ZA 4NMMA 1B93A 2YXDA 4QUAA 3MC1A 3LF1A 2BFCB 3I9NA 3VZQA 4EQZA 4O3OA 2GFHA 3E7PA 3F3YA 4I1PA 4NS4A 3F74A 3TWOA 3BULA 5JS6A 3FWPA 2VIXA 1G5QA 4Q9LA 1K92A 3M3PA 4GH5A 4KW7A 1PSZA 3IUBA 1C9JA 4F06A 1HYGA 3UQZA 5DTEA 3A32A 3VO8A 2BGKA 4JMUA 4MVJH 4TZTA 2YHUA 1O9HA 4FD3A 3P2KA 4KFRA 1C4XA 2DKXA 3DZCA 2IITA 1UBOS 1WCLA 1ULTA 3H11A 5A71A 1AV6A 1K8RA 3KT8A 4U2GA 1EWKA 3JRXA 3EISA 1N4AA 1D6JA 1NRJB 2V97A 4XQCA 2J07A 1N2XA 3UT5B 1U4NA 5BWNA 5HM6A 2PZAA 2AGOA 2HU8A 2IIBA 3C6MA 3KQTA 3BMXA 5IYZA 3I8OA 5C81A 5FUVA 4Y6RA 1R4MA 1VMIA 4B6SA 4D8XA 5TARA 3NS7A 3GF4A 1JKIA 3L4PA 3OPXA 4PSVA 3HR4A 4RD3A 1Z6QA 1XUOA 1T2UA 3F6BX 4W9MC 2GPBA 3OJCA 3G8DA 3WWDA 3WYAA 3SY8A 2JJ2D 2MDTA 3O4JA 3OLZA 1PL0A 5BURA 2VHJA 2E8OA 1SVWA 3OCYA 3ODPA 4MW7A 1BMTA 4HVLA 2I7XA 2Y1GA 4MVYA 4YPFA 4AMVA 5IKMA 1L3UA 3HO8A 4YXMA 1L5SA 3O1LA 9LDBA 3EZ6A 4V1CB 1WYGA 4UZEA 4NNOA 5BP7A 4JC4A 4PLTA 1KYIA 13PKA 1DJPA 4K9MA 4LF9B 1C2TA 3OZGA 2LRHA 2JIPA 3G59A 3WLIA 2GJ8A 1TO1E 3NH9A 1K68A 1RWPA 1BC5A 4EY5A 1TQ8A 1U4OA 5LSAA 1HYEA 3RB0A 1MOSA 1V5FA 4HX9A 1E1YA 2PBFA 2X0JA 3K9BA 5K6AC 1ZQFA 2G9NA 4DM7A 1RACA 2BKVA 2M1XA 1RBZA 3IR6A 5FI3A 4JAVC 4QUKA 5FBRB 3TMYA 2P9BA 3AVTA 4F5RA 3JASA 5D49A 1M6YA 2Y9TA 2DCMA 3DW1X 2OAGA 2FWRA 2OCGA 3NRBA 5HCUA 4BWVA 2NRXA 4G0NA 4TX1A 4YO8A 4WLEA 3VR2A 3NB0A 3DHEA 1AC5A 1H0RA 1XMIA 2XKBA 2Z0MA 1T29A 5E8RA 1Y48E 4RDCA 3JASB 3BJMA 1T8WA 4YAWA 3KEOA 4GS5A 3ZZUA 3TF5A 1VTKA 5DN6A 5I3CA 3RUFA 1P1HA 3GGDA 3NBMA 1DC5A 4DN6A 1OAOC 4PLFA 3ELBA 1NN0A 2PRKA 4GM1A 1AKWA 5CLJA 5KG0A 3IQIX 5JZSA 5L1IA 1SB9A 2PMBA 5GQSA 3QV2A 4BY9E 3EZ5A 3CEHA 2IXDA 1QOQB 4U2DA 4WLUA 1FVFA 2HWKA 1W96A 1RRVA 4GG1A 2ERCA 2E89A 2VPPA 2X14A 2UYQA 3CNBA 1YNOA 5AVQA 1M8KA 5TR9A 2I6FA 2MINA 1CUGA 3U48A 3SEQA 2A1AA 1GP2A 4WZAE 3QU2A 3LUCA 3OQOA 4QHYA 4RKRA 3AM1A 5BQOA 1QX4A 4XCVA 4F04A 1DJMA 5BWLA 4H17A 3IRVA 3MLAA 1RS0A 3UCXA 3M4NA 1P3Y1 2ZU6A 1GR1A 3AKYA 3TBFA 5FPTA 2GS9A 4RJIA 4M9GA 3IILA 2DB3A 1OVGA 4GBMA 3ZWVA 4L6AA 2ZE5A 3TLEA 2A9QA 4NARA 3AU6A 2CEAA 3UQ2A 5U4XA 1A4IA 3ZTTA 2R1UA 3AHHA 2AI3A 2VJCA 3T4UA 5DSZA 1KVQA 1QZXA 5EMKA 5DIZA 5ED0A 3OJWA 5D3MA 1D8AA 1P2TA 1W19A 4YRKA 3FTEA 1SBTA 6AT1A 4K88A 5JISA 2CPRA 4K9DA 3IV6A 2O7NA 4GC6A 4BNLA 2BEJA 4ECEA 3MTIA 4O2BF 3EGDA 1A8PA 3DE2X 4PSKA 1I51A 2ZROA 4PGHA 4XPIA 4KVGA 4LXQA 1S0UA 1L6NA 2ZIEA 3AJDA 2O14A 3OPQA 1QFMA 3L18A 2QGZA 4ZDJA 1CUDA 3R76A 1FCJA 5CXXA 3L5OA 5LU9A 4QRIA 3HYLA 4NS1A 3EGDB 3TW0A 2NM0A 1K88A 4BMZA 3UENA 4E88A 1PK8A 4EHLA 4K6OA 4LXUA 1KO8A 2XVYA 2PFSA 1PLLA 4WZAA 1DV2A 2P9CA 2IW1A 4PYRA 1YZHA 3R5JA 5SY6A 1G5RA 3UPTA 3AHFA 2R7NA 4MW1A 1Z88A 2D1TA 2F2AB 1WHSB 4A8JC 5I51A 3CJRA 1WU7A 1NXTA 5H83A 4RKWA 4I3GA 4BWFB 3ETLA 4ZTZB 2FQ1A 2YIDA 3AN1A 4IJWA 5H0IA 3BQ1A 3A0UA 4WZAB 4BTVA 2RGXA 1XMQB 4YDHB 1TUGA 4WBNF 4A03A 3ZCPA 1MRNA 3AIKA 1W30A 3FYTA 3ANMA 1M10A 5CT8A 3MLEA 1E9DA 1UJMA 4UNNA 4I4CA 4KKXB 1TEZA 3CX6A 4LRXA 3GJ8A 4ALJA 4H6PA 2Y05A 4JXXA 4Q4JA 2PPLA 3D8HA 1T4CA 2AK3A 3LUKA 1TAUA 2JK0A 3ZJUA 3URMA 1USUA 1NSYA 2J5BA 1H2EA 2HSEA 1CS0B 2WJ3A 4BVAA 3BE4A 5JMWA 3JVDA 1A4UA 4V0NA 3C4VA 3A6KA 4Q0MA 3FAHA 2I2WA 4EKDA 4Y1RB 1D9DA 1TK2A 3G1UA 1DWQA 5TXGA 4ZYXA 1WUTA 5JMPA 5IM4F 1O9GA 3E9YA 2V4MA 4G9BA 3OJSA 3L6BA 4OK6A 2UYHA 4ZJPA 3R5HA 4FBTA 3VC8A 1G1MA 1DDIA 1JAHA 1TJPB 1J0EA 4YDRA 3RIMA 1NV8A 4IF6A 1V1MB 1YJQA 1EVIA 4NDAA 4F3NA 4LF4B 5IVKA 3S8YA 6CHYA 1N75A 3KJEA 4Y8VA 3ZGVA 1RIIA 1ZQQA 4FVTA 2HIGA 5CFMA 3NHRA 3SZ3A 3R4VA 2N42A 2V0NA 1I2AA 4BJHB 2X5XA 3GA0A 1GPYA 4JV2A 2WWWA 4DL3A 1I5EA 4MIKA 4IJ6A 5TDHA 1PUJA 2YW9A 2IYTA 4OJPA 3N2NA 1PX2A 5HKKD 3B1KA 3FKSD 4ITRC 5FHRA 2YV1A 3PVZA 4LDPA 1ZMTA 4ZN6A 2PWAA 2NZWA 4RQ2A 1EGMB 2JGFA 1UXJA 3VU1A 1UMBB 1UF9A 1OJ7A 2BKEA 2EX4A 1ZK0A 3NT5A 3EEIA 4Z1OA 4H60A 2PS1A 4B6QA 1T4DA 2H9AA 2PX4A 4ELUA 2YV2A 1CFZA 3K1ZA 5M34A 2E4WA 2Q3DA 3T52A 4YAJA 1X7WA 2A0XA 2C98A 3NDJA 1E59A 3BCSA 2VZLA 3D8BA 4EJ2A 3OE4A 1FTYA 5CGQB 1ODFA 2BHTA 3HZHA 4MPRA 1J0AA 2JPDA 3GP5A 4FIZA 4UQGA 2I4TA 1E2FA 3OKFA 5JSQA 4HATA 1Q20A 1KVTA 2BMFA 1CHNA 4GOOD 1NVDA 1TRKA 1O87A 4R41A 3AZOA 4ND5A 2J7PD 3EPPA 3AXSA 4JNCA 5CB4F 3K09C 1NVTA 4G5YA 1R6VA 2NTYC 2O8DA 4DQIA 1FDRA 1HYQA 4DANA 4NCXA 5JAOA 1QYRA 3OZUA 1CV2A 2WHYA 4RK5A 3ESDA 5I7AA 1T3ZA 1TQ6A 4PGGA 4DYHA 1P9RA 1ZNWA 4BQEA 2OLKA 1PG2A 4H4DA 3W34A 4KR2A 5KBYA 1G9XA 4A6XA 4HUJA 4N3AA 3N3BC 4G1BA 2R9VA 1GAXA 2BL4A 2O8DB 3PEYA 3NHFA 1PJLA 3WVNA 3IKTA 1K5DA 1H9BA 4R9NA 1Z6XA 5CUQA 3KKMA 3A31A 3BWBA 5D86A 1YGPA 4WBXC 2WVHA 4MK4A 3AVYA 1C0LA 5EIOA 1W8DA 4UQPA 3RGWS 1SQ5A 3U0VA 3ZCRA 2WPDA 1XYYA 2NOAA 3FOBA 4ANFA 1UIMA 3I04M 3UEOA 3GI1A 3VAYA 4EUSA 3FLMA 1EFRA 5AJZA 3QWIA 4ARSA 1UJ4A 2WAAA 1ZH8A 3MILA 4ZDWA 3WK4A 2EAOA 1HZZA 1H0SA 3VTKA 1RG6A 3BJZA 3JARB 3ND5A 1MX1A 2WT4A 1GZ7A 4S1WA 1A98A 3C8HA 2BGGA 3GDOA 3ON5A 4CL2A 5J2FA 4G0ZA 5DRYA 3TO5A 3PC8A 1V5IA 5C0YA 5E7JA 1FIQA 1OXSC 1D6SA 1U98A 3ONDA 2NRZA 2FWIA 4RFVA 2R79A 4HB3A 1IOWA 821PA 1CF2O 3A6PC 3HLKA 4C9BA 1KH2A 5U9CA 1E3MA 1E3JA 4KMSA 3UO8B 1KNQA 3ND9A 4MRRA 1C1XA 2YIMA 3CVUA 4EITA 2Z2YA 5IJZA 4UOQA 1MNAA 2NO4A 4RYDA 5IKOA 2ZJ5A 1ZVJA 1Q7BA 1DGQA 4B3TB 4C2UA 5BQXA 1T5LA 5ITZB 2ASJA 2CMFA 4QUEA 2RBEA 3RIXA 2VUUA 1D0SA 2IV2X 1RM3A 1UXGA 2C4UA 3ZGYA 3LVWA 2HHLA 2FRVA 3BMNB 3BEDA 1LWNA 4R40A 3HP6A 4JMPA 3SS9X 4R7ZA 2AGPA 3DMDA 2WUEA 2O48X 4RWZA 5IIJA 3BQTA 1T5OA 3CH5A 1YRQA 2B8NA 5THKA 1JHDA 2GNPA 4EB6A 2KD1A 1K7SN 4Q3OA 4PNPA 2CZCA 5TMBA 3PDCA 4L95C 4RM2A 2G80A 5D4BA 3T3PB 3QHQA 4RZQA 2R00C 2ODWA 2GUGA 3F7MA 4H6WA 3P96A 5EKUA 2L42A 3RW9A 3T3HA 3OZCA 4BO8A 1CBUA 3A4TA 3FTNA 3HQ4O 1DJOA 5LIRA 2P5YA 1PKEA 8ICAA 1GSAA 4MI1A 1SCJA 1OXVA 3ANXA 3FWHA 2B8WA 1Y1SA 3LUFA 3L0BA 4QLOA 5LN1A 1V0JA 2OCLA 2XF8A 2KFZA 3V6JA 4BC1A 3FJ1A 1NXOA 2Z1NA 3NC1C 3WFJA 2WQZA 2B4YA 3PYLA 3GXOA 3NNNA 1P39A 1QSGA 5JV5A 2KKPA 2MR6A 2A0YA 2VDLB 4GX5A 3UGKA 3C0KA 2ZGVA 2QYSA 5AW5A 2K87A 2IEDA 3DOOA 3NP9A 2BCJQ 4HVAA 1ZM9A 5IX8A 1O94C 2ZAGA 4LPKA 4B1FA 4WIAA 1QHHB