3A0HU

Crystal structure of i-substituted photosystem ii complex
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
98
structure length
98
Chain Sequence
EELVNVVDEKLGTAYGEKIDLNNTNIAAFIQYRGLYPTLAKLIVKNAPYESVEDVLNIPGLTERQKQILRENLEHFTVTEVETALVEGGDRYNNGLYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem Q(B) protein
publication title Location of chloride and its possible functions in oxygen-evolving photosystem II revealed by X-ray crystallography
pubmed doi rcsb
molecule tags Electron transport
total genus 22
structure length 98
sequence length 98
chains with identical sequence u
ec nomenclature
pdb deposition date 2009-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF06514 PsbU Photosystem II 12 kDa extrinsic protein (PsbU)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.320 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Photosystem II 12 kDa extrinsic protein 3a0hU01
5TISU 4UB6U 5GTHU 4PJ0U 4IL6U 2DUYA 3A0HU 2AXTU 5H2FU 3WU2U 1S5LU 5B66U 5KAFU 5KAIU 5B5EU 3KZIU 3A0BU 5GTIU 4UB8U 5E79U
chains in the Genus database with same CATH superfamily
1NK7A 1ZXIA 4KLUA 3SZ2A 2FMPA 3TANA 5HMMA 3SAHA 3HWTA 2ZTCA 3FC4A 4P2HA 3TQ1A 2WF7A 3H8SA 7ICIA 2OHFA 5ALQA 1NK0A 4J9MA 4EZ6A 1ZETA 1ZQXA 4J9QA 1URJA 9ICIA 1JUDA 2DFLA 3T5KA 1NK8A 2BCUA 4P0QA 4B9SA 1DOQA 2HDOA 7ICRA 1JMSA 4DFPA 2KNJA 2K60A 3TARA 1S77D 2ODGA 3GILA 3PW7A 2JXJA 2ASJA 4US9A 4ECZA 2QLTA 4BWMA 2XVTA 4QJFB 1LV5A 3NTUA 4JWMA 3A0BU 1MSWD 3BS5A 1ZQCA 3N7PD 4ELUA 4FE3A 4DQIA 4O3OA 3ISBA 4I2DA 1DXSA 1YT3A 4CF5A 2QARA 2C2EA 3RJJA 1L8LA 4K4GA 4EZ9A 3RFAA 1NK6A 4B9MA 5AKYA 5ALUA 2NV3A 4NL9A 4F72A 4IRDA 5D49A 1ECWA 4DFDA 3Q8PB 2K8AA 1NJXA 2W7OA 4DWIA 1IIPA 4EYIB 1JXLA 2CN1A 1A6SA 4ED0A 4Z6FA 4IQWA 3K1ZA 1NJZA 3OSNA 5AKLA 3RF9A 3IM1A 4C8KA 4RU9A 2WAQC 3U26A 5KL8B 1BPYA 5ALIA 2DWQA 4F5PA 4J03A 5DKWA 4O0IA 2E1EA 1XSPA 4YG2A 4UAWA 2ESEA 3EPGA 3HP6A 1T7PA 1RQLA 2BCVA 4UAYA 3PW2A 4YXJA 2ZUCA 1ZQPA 1KTQA 2BPFA 3EUB2 3TFRA 2BR0A 1SGGA 3EW9A 4DQRA 2ISOA 2KEYA 1ZRNA 3PX0A 1X66A 4F5OA 4RPYA 2HOIA 2G0AA 4YXMA 3SV3A 9ICPA 5T14A 2JRZA 1RYRA 4QZEA 4QWAA 4PL2A 4FS1A 8ICLA 1RXVA 4G9BA 2G5HB 7ICHA 4R63A 1ZOLA 4I2EA 4BWJA 3KD3A 1UHUA 5IIMA 4RT2A 3MR2A 1MQ2A 1JROA 3AL0B 2ZIXA 2G06A 4KLIA 4M6WB 5AK5A 1SWVA 2DL0A 4PGQA 3WK8A 4F4ZA 1NJWA 4KLFA 1A77A 4A8EA 2KTQA 1MC8A 1D8LA 1S0NA 1NZBA 3NASA 1V85A 2PFNA 1ZQSA 2G07A 4FBUA 4M04A 4NLKA 1DRGA 2KJ9A 3MGVA 4RQ2A 5AM0A 5KTQA 2OYYA 2C2RA 4KITB 2JZBB 5J2FA 2XO7A 2IOFK 3T79A 5ALYA 1JXEA 2KVCA 2ZIWA 3CP8A 4Y2PA 5KFGA 1S9FA 3J81j 2Q4TA 1S10A 3KKAC 4US8A 3AU2A 5FP0A 2N1RA 3M9MB 5G5GA 3UMBA 9ICLA 1CUKA 5J2EA 2V4RA 4IRCA 2E8MA 2OH2A 2XY5A 2BCQA 1RYSA 1PUZA 2LI6A 4QZHA 4JV2A 5AIBA 3SV4A 1F0MA 2RDIA 4OJLA 3HW8A 5J8YC 1KFDA 7ICPA 3TKAA 2MU2A 2IHNA 4J9OA 1NNLA 3NVVA 1CI4A 4DLGA 3I76A 2DQNB 2EAOA 3E0FA 1Z1BA 4IQVA 5DDMA 4DFKA 8ICCA 1N56A 2HI0A 3H0LB 4M9JA 4IQUA 2WHEA 2H5XA 2WF9A 3BJYA 1SWWA 3L4PA 1TAMA 2KFNA 3DV9A 4C8LA 1PK1A 3AMZA 1NZPA 2PMZF 1UT5A 1KSPA 5BOMA 2E1FA 2G5IB 3F5EA 1AQ6A 3UM9A 2KV2A 3H0RB 2AXTU 1NKEA 9ICRA 4ECYA 4BJQA 3V7JA 2AJQA 4M2YA 3NRWA 3M6KA 7ICQA 5HHHA 1LB2B 3RB0A 5C5JA 5KT7A 4QZGA 4DLEA 5KT3A 3OHBA 1Z4NA 1DGJA 5AK3A 2OXOA 4KN7A 4DS5A 2P6RA 2Y1IA 2ZTEA 2K4PA 1RPLA 4FZMA 2A1JB 2Y0SC 2JEJA 4KTQA 3H8JA 1Q46A 4CCHA 5KFFA 3KKAA 1LKYB 3NS1A 5CRXA 2AQ0A 5DB6A 2BPCA 4DS4A 1J97A 2ZXIA 1FO4A 4NM1A 5KFCA 2J6UA 1LVHA 3ZD8A 5CJ7A 4I2HA 4O3RA 4O3SA 4GXJA 8ICYA 3AQFA 2YMPA 3GFKB 2VA2A 2M9NA 4MEYA 5J8YA 4C7YA 3FYHA 4F4WA 5BOLA 2LKYA 2V9WA 3RJGA 4ECUA 1X6IA 2EDUA 5AKJA 2NYVA 5AK6A 4ED2A 5KFJA 1SKSA 2YTUA 3K75D 2W9CB 1J2NA 2W3SA 5EWFA 5DB8A 3GV8B 3T5HA 3JPNA 3PR4A 2JH7A 4M9GA 4ELTA 4TUPA 5ALVA 5KG5A 3BQ1A 3SQIA 2CRXA 4KX3A 4R8UB 1L5UA 7ICUA 5KFBA 5DBCA 4YFKA 3PSIA 2KICA 5AKEA 4ED1A 2BZFA 5KFKA 4NWIA 4JWNA 1ED1A 1QQ7A 1Z3EB 5DGBA 3QZ7A 3UMGA 2HHUA 4F2SA 1COKA 4QNLA 3S6JA 4DCCA 4BUGA 4I29A 2W03A 4F2RA 2ZIUB 1M6YA 2KOBA 3GDXA 3BZKA 4UW9A 5KG3A 2BGWA 2W43A 1BPEA 2EAPA 4DL2A 4FBTA 4PZOA 3HKZF 1S0OA 2VA3A 3N7SC 4FFDA 4Q8EA 3L5KA 2FPKA 3QEAZ 3MFHA 7ICSA 4IC9A 1X40A 2B0CA 4FZLA 2ZJ8A 3JPSA 5G5HA 2XGPA 3LYSA 3KBBA 5DG8A 4Q44A 4I2BA 2XC9A 2JMGA 2H3VA 2F8KA 1XWLA 1RQNA 1FIQA 1ZQRA 1XC9A 9ICEA 2NRWA 5ALTA 2P66A 4YVZA 1UPHA 3GZFA 1H38A 3V72A 4PJ0U 3ED5A 1C20A 9ICKA 1TV9A 3MFIA 2K89A 4PL1A 2GO7A 3F53A 2ISPA 2W9BB 2XI9A 4PZNA 3PY8A 4ZOHC 5IIKA 5KFMA 4ED3A 4R8UA 2F1IA 2WTFA 2KD1A 1NOMA 5KG0A 2R8IA 2JEFA 3BS7A 3RRHA 1L3UA 2KIWA 5AM1A 4UBBA 3UPQA 3ISCA 1QTMA 9ICTA 4Y2RA 2F77X 3PSFA 5KFAA 4QZ8A 5KFIA 5J0XA 4JV1A 4M0AA 1OXJA 5KFUA 2RLTA 1XU4A 1FFVA 4CF3A 4UB2A 1OW5A 3RJFA 7ICEA 2LM4A 4Z6CA 4CF4A 2HBJA 5J0SA 2YMMA 4QZDA 5KFZA 4UB4A 4F8RA 4GIBA 1KDHA 4OO1J 3C1YA 2AU0A 2HHTA 3G6YA 4LVSA 4LJXA 2WF6A 4I2GA 3KOOA 1YZ7A 3RJIA 3LWLA 2R8GA 4DSFA 5ALEA 3GU3A 5CP2A 1JI7A 1SV0A 3TACB 3G6XA 4ZH4A 2E8PA 4Q43A 1BGXT 3D6JA 5EOZA 3WU2U 1BPDA 3V7LA 3RR8A 9ICJA 5KAFU 4ECTA 1K5OA 2JR5A 1U48A 4F3OA 2F2AB 1QLNA 4JUZA 2IOFA 2H3ZA 2W9BA 4J9LA 3QEBZ 1ZQMA 3TI0A 5K4LA 4C80A 4P4MA 1OUQA 4DL7A 2MUTB 1TK0A 7ICGA 9ICWA 2G09A 2YMLA 1ZQTA 3C23A 5AM3A 3WK5A 3H4DA 3ONNA 3VCBA 3OJUA 5AM5A 5EE1A 5J0PA 4KLTA 2WF5A 1DK3A 4RQNA 4G3IA 1HUOA 2J6SA 3WKAA 1D8BA 1NK4A 5DQHA 5ALGA 1QQ6A 4NLNA 2ASLA 4NXZA 1HUZA 5L1KA 1F5SA 1NKCA 2HVIA 2P35A 1S8OA 3QU4A 1JRPA 5HHIA 3BZCA 3RRGA 3CRXA 2KSOB 3OHAA 2OCEA 5J0UA 1L3TA 4K4HA 2V4QA 1FEZA 5AKZA 4QWCA 1JN3A 2XY6A 4RUCA 3BQ2A 3C5GA 2O6KA 1VDVA 2FDRA 3WK6A 3QE9Y 2KKPA 4MHVA 1RDFA 2VANA 3QNMA 4NLBA 1XO0A 3ZDCA 2KHQA 4GC6A 1B0XA 1JALA 8ICSA 4K4IA 4O5EA 4DSKA 1ZYQA 3C2LA 2LPEA 3FAHA 4C8MA 2XCAA 2RQ5A 5HR7A 1TFRA 3RJEA 4AYBF 3HT3A 1K1SA 2LHTA 2LM1A 3SMVA 2PMZC 4HYKA 4BXOB 1BPZA 4DFMA 2UVUA 5ALNA 4IR1A 4DSEA 4EBDA 1Q8KA 3VC8A 5J2AA 2HOQA 5AK4A 1Z19A 3RH4A 3H7IA 4IL6U 2BPGA 2EZXA 5KG7A 4ED7A 3PX4A 2DKXA 3DDHA 2FMQA 4PPXA 1X2IA 2WB1F 1ZQHA 1KRPA 1T3QA 8ICEA 2W11A 5AI0A 2B21A 2EANA 3UXNA 4OJ5A 2AGPA 5ALMA 1T4GA 4DO9A 1TVAA 2IOHA 4JMUA 3UQ0A 2HOFA 3HX0A 3N4MB 5DB7A 3B0YA 7ICVA 5KG6A 2KN7A 9ICHA 8ICNA 4DL6A 9ICCA 3RJKA 3MGIA 1SIJA 1U9LA 4DOBA 5KFRA 3QUBA 1XNSA 2PFPA 3AM9A 1Z00B 1IV8A 3IN5A 5C0YA 4USAA 1XSLA 1WG8A 4J9NA 9ICMA 4TQRA 5ALOA 3GIKA 4RUAA 2HMXA 4CE6A 2BCSA 4B6JA 2DBYA 5KFHA 2KZ3A 1UT8A 3V6KA 8ICBA 4QZIA 3E2EA 3OGUA 2XGQA 4Y2SA 3KZXA 3QZ8A 2C28A 3THVA 2XCPA 2JEIA 3JPQA 1D8YA 5L1IA 3LVVA 1IXRA 4ECWA 1X42A 2W3RA 4DQPA 3C28A 2K8CB 3Q8SB 3IV6A 9ICVA 3PR5B 2UVVA 2ASDA 2NRXA 1Q3UA 4P4OA 7ICJA 3NVYA 4JK1A 4R66A 2EH9A 3QUQA 5AM4A 4Y2JA 4FO6A 4F4KA 8ICZA 4KLDA 4QW8A 4UASA 2XICA 4MFFA 2DKZA 4M6WA 3HKZC 3K1RB 5CA7A 2HHSA 3FM9A 3PX6A 5ALPA 2BHNA 2KJ5A 4MFAA 2Z7JA 4KLSA 3MDCA 1B4FA 3QU2A 5CR0A 1ZQYA 3AQEA 2DPIA 2W9MA 3CNHA 1DK2A 2PFQA 1WWUA 4R64A 3RR7A 5ALZA 1B22A 1TKDA 1NI3A 2FI1A 4LZGA 1SXDA 3QUCA 5KT4A 2NRVA 3Q8MA 2JZBA 3UQ2A 3MR3A 1XSNA 7ICTA 5TISU 1X9MA 2ZXHA 1WWVA 3HJEA 4DF8A 1ZQZA 2C22A 3L3FX 2ZIVB 4NY8A 2HW3A 2QB1A 3BQTA 5KG1A 2IHMA 2W9AA 1N60A 1ZD5A 4B9VA 4DF4A 1J2MA 5AKHA 2DGZA 3ETLA 1SL1A 2YY6A 5B66U 5ALWA 5B5EU 3RTVA 1UCVA 4Q8FA 4O3PA 3QYPA 5JTIA 4YR0A 3AN1A 1K1QA 2LBOA 1ZQDA 3QX7A 5KFVA 7ICLA 5ALJA 4DQQA 4ICAA 4ELVA 4YD2A 3ZDBA 2HHXA 1AROP 1Z1VA 4DL3A 1B43A 4FZNA 2FPLA 4RQ5A 4RQ6A 2VJ5A 8ICRA 2E5SA 4B9UA 2KG5A 3EWAA 3EYZA 4UARA 4OCZA 1MA7A 1QSYA 1L6NA 1FFUA 3PO4A 4I28A 2YX8A 4M9LA 2GH1A 3NGDA 2RP5A 4F71A 3PVXA 1L3SA 5J0WA 2BCRA 2CXYA 3QU9A 5IINA 4CGZA 3MABA 5IIIA 4B9NA 7ICNA 2HHVA 4UBCA 2I6XA 4GC7A 3UXPA 4DOAA 2KFZA 3Q8LA 5A0LA 3MR6A 2KIVA 4KLMA 2FMSA 5J0OA 5KT6A 1T3NA 1TAUA 1N2XA 2LMRA 2H3IA 3PSTA 1BPBA 3H4BA 4DSIA 4F5QA 4JV0A 2R8HA 4O5KA 2YN4A 4UATA 2A1JA 1ZQ1C 2NRZA 2RRDA 3TAQA 1CRXA 3G6VA 4DQSA 1MN8A 1LKYA 4XQ8A 8ICOA 2QB0B 4NV0A 2EZZA 5IIOA 3T5LA 3ETRA 4KX5A 4AP9A 2K4HA 2LYAA 3GIJA 4HAIA 5AKIA 4GFJA 2IMWP 4GLXA 3PW4A 9ICGA 1U49A 1RM6C 1XS9D 4M9HA 3RAXA 3H8MA 1V97A 4ECXA 5KAIU 3RB4A 5AKKA 3HRDD 1RZTA 5EE9A 2UVRA 4BX9C 3M1YA 2YB4A 5HP4A 4KLQA 1SV4A 2D3DA 2BQ3A 3IRUA 1KEJA 5AI8A 1SB3C 2W9CA 3EZ5A 3NUQA 3PV8A 2KP7A 2ES6A 1ZD3A 4RPXA 2FLPA 3IP4B 5ALHA 3BDPA 4YD1A 1COOA 1WCNA 1N5XA 2H3QA 4YMNA 2A3VA 3Q8QB 4ED6A 3ICXA 1BNOA 1UQVA 3WKBA 2AGOA 4B9LA 3OJSA 2GOLA 1KFSA 4NJ8A 5ALRA 4O3NA 3WK7A 4QZCA 2W7PA 3CW2C 3AEVA 3GIMA 5KFEA 3M8SA 1IG6A 4IQTA 2L5YA 3C1ZA 5KFXA 4F4YA 5JU5A 2JH1A 2IBKA 2QKQA 2ZIUA 5GTIU 3K4GA 5J29A 4RNNA 2QB0A 4F93B 1U47A 1ZQAA 4DSLA 4AYBC 5DG7A 4IS7A 2AH5A 2R18A 3ZI4A 3PMNA 3D2QA 4UAUA 4Y2XA 4GXKA 4JB3A 5J0QA 5AKXA 3C2MA 1N62A 4KLEA 4LZDA 3ORYA 5CB1A 2ZG6A 5DBBA 3OPXA 3RBDA 1ZQGA 3PW5A 8ICJA 3O0FA 5DB9A 2JEGA 5J2GA 3PW0A 5KFQA 5AM2A 9ICNA 3V6HA 3IG8A 1SKWA 1TAQA 3BS5B 1TK8A 2Y9UA 1NK9A 4KLJA 5IIJA 3NRZA 1BNPA 2WB1C 4DEZA 3I28A 5EE0A 4NL9C 8ICIA 4CRXA 2OEHA 8ICQA 2KK0A 4GXIA 8ICWA 1ZQWA 4RQ1A 1YZ6A 4YR2A 2KE7A 4I27A 5HR6A 2K8BB 3RB6A 9ICFA 2Q0ZX 4UB5A 4IR9A 4EENA 3PSPA 4QIWF 2E8OA 2QARB 4TUQA 1O03A 3LVWA 1IM4A 2WF8A 3IDWA 2HVHA 1KL9A 2JGAA 5L1MA 5J2IA 1O08A 1ZJMA 3TADC 3FDSA 2I5HA 3NVWA 4EX6A 2C2DA 5KFWA 1SL0A 1JIHA 2KVSA 4PHPA 3T5JA 2D8CA 3H0MB 4ED8A 2BQUA 3AUOA 4PH5A 3SR6A 1Q3VA 4RT3A 2DPJA 2MRLA 1VJ5A 3C29A 4RQ4A 1RYUA 2M0NA 4F5RA 2YB1A 4I2IA 1TK5A 2HHQA 2ZJ5A 5H2FU 9ICUA 1A0PA 5J2KA 3Q8RB 1ZD4A 1S0MA 7ICFA 3RH5A 5DG9A 1U4BA 1PVPA 2EAMA 3KFUF 4YP3A 4YMMA 1S97A 5GTHU 5JRTA 3PO5A 2A19A 4KMUA 5KG4A 2F1HA 4QWDA 4WJ3B 8ICAA 5F3XB 2W8KA 3JPTA 1ZQFA 4F5NA 5KFYA 3RB3A 4QZ9A 4P0PB 2ATLA 1F44A 3Q8KA 4UB3A 2ZIXB 4C0ZA 3ALRA 4C7ZA 5J0TA 1ZQKA 2MUTA 5HMLA 1ZQNA 5ALDA 4DFJA 9ICOA 2AGQA 5J0RA 5TZVA 5AI9A 3KHRA 1ZRMA 2G08A 4OD0A 1X9XA 3SD7A 5AI4A 1VLBA 3QXGA 3HILA 4OJPA 8ICTA 4RQ7A 3MDAA 4RZRA 2RHFA 5DLFA 7ICMA 3TADA 5F9NA 2ZIWB 8ICHA 4TUSA 4I2CA 2P6UA 2DUYA 2A1AA 5D46A 3RJHA 4I2JA 5AICA 3SAFA 2FJ6A 1HIWA 2HCFA 3MR5A 3WKDA 1L7OA 2KSOA 3IG5A 4RNMA 5DQGA 5AKGA 5J2CA 4PGXA 1PVQA 4YN4A 3M8RA 3F5AA 3GV5B 5KFOA 2MSNA 3ZDEA 5EWEA 1ZJNA 2FE9A 5EE3A 5KG2A 2LYBA 1MQ3A 4EEYA 4OJ6A 2VA8A 5D4BA 1ZQJA 5L9XA 2HSZA 2B6GA 3F2DA 3SYZA 3B9JA 4Y2QA 8ICGA 3MC1A 3JPRA 2UVWA 2KJ8A 1X6JA 2W54A 4P0PA 2HBLA 4QWEA 3LWMA 4QW9A 5J2HA 2PI4A 5KFLA 4C8NA 5KT5A 4XRHA 2BKEA 4Y2YA 5AI5A 2R8KA 3PNCA 5CWRA 1PK1B 1KLNA 2EQYA 4BXOA 4O3QA 4EBCA 1KW4A 8ICUA 3ZDDA 2D6FC 3H40A 4IRKA 2I1QA 9ICQA 2J6TA 5DBAA 5BPCA 1X9SA 1T8EA 1UA1A 2IA6A 1T94A 5KL1B 3M9OB 4QZFA 3JPOA 3WKEA 5KFNA 8ICVA 2PKEA 3KHLA 3C21A 1EXNA 4DL4A 1ZD2P 3LK9A 3SI8A 4C8OA 2R8JA 4EELA 2YMQA 1C7YA 1ZQOA 2OWOA 4KLHA 1SXEA 5ALFA 1S5LU 4X5VA 2W55A 2F76X 3KZIU 8ICFA 4QWBA 1QSLA 1RXWA 5DLGA 4O3MA 1ZQUA 3V6JA 4CNQA 4YCXA 3R9KA 3MGHA 5ALSA 3V7KA 5DGAA 3RAQA 1Z00A 2F3NA 3RBEA 1PZNA 3RH6A 2WAQF 4EEKA 5CEHA 4UB8U 3GQCA 2Y1JA 4UB6U 4NLCA 4M9NA 4ACOA 3KHHA 4J9RA 5ALKA 1ZQEA 2VJ4A 4MFCA 2OM6A 3OSPA 1ZQLA 5ALLA 5J0YA 4UQGA 5AI6A 2MAXA 1D9DA 2KHVA 5AIAA 1V9PA 4BDPA 2LYHA 2KMDA 4DL5A 1TE2A 4UAVA 2W8LA 2MA1A 4PGYA 3E58A 1SZHA 1NK5A 3TFSA 4O5CA 4QZBA 3DEEA 2KZZA 1N5WA 3D2NA 1PK3A 2JHDA 2ZJAA 1L7NA 1A76A 5AHXA 2NO5A 2AQ4A 3B0XA 3OTQA 9ICXA 2ALZA 1BPXA 2GWSA 2FLLA 3UMCA 2H3FA 4BGDA 2XIDA 2BDPA 1U45A 2FPMA 1CEZA 2KZMA 2GLEA 2FLNA 5JUMA 4KLGA 4ECVA 2I9GA 5E79U 3SENA 2ZUBA 4RPZA 2NO4A 4TURA 4I2AA 4EYHB 3N28A 4U6PA 4O9MA 1S76D 5DQIA 1WCLA 4Y2TA 1XO1A 1D9FA 3IHQB 2ZIVA 1PVRA 4RQ8A 4DOCA 4Z6EA 5J2BA 4C4SA 2K4IA 1WYGA 2W04A 1L7PA 4XUSA 1KKXA 4MF8A 1WUDA 3SAGA 8ICPA 4E0DA 3QU5A 3MBYA 3LDAA 4M47A 2JV3A 3QUTA 1RG6A 1QSSA 4QIWC 2CPRA 3WK9A 4Y2UA 4R65A 1SL2A 5L1LA 1KQQA 5KFSA 2F8LA 2HBKA 4ECQA 5L1JA 3HPOA 3GIIA 4YQWA 4C4RA 3EPIA 4YR3A 1JX4A 4DSJA 2VIXA 3KTQA 4YMOA 1KN5A 5KT2A 3ZDAA 9ICAA 4KLOA 4ECRA 1ZQIA 1GO3F 2PXIA 9ICSA 1SV0C 1UA0A 3KHGA 3TAPA 3BQ7A 5F9LA 3JPPA 1L7MA 1NJYA 2HBMA 3QU7A 4Z6DA 3N7RC 5DDYA 1HEKA 4NLZA 2WFAA 4PHEA 3M6ZA 2AHOB 1BVSA 4UAZA 2F1JA 4UB1A 4KN4A 2HHWA 1X9WA 7ICOA 1NKBA 4I2FA 5KFPA 3I1YA 3N97B 5KFTA 1DGSA 3UXOA 5J2JA 4J9PA 5KFDA 5J2DA 3H8WA 4ECSA 4EX7A 1KBUA 1QCKA 2RDJA 4U7CA 8ICKA 4FS2A 2BDUA 3M7DA 3D2SA 4OJOA 1QQ5A 7ICKA 4C4TA 2Y9TA 4QZAA 1L3VA 1QH9A 2Y0SF 1N61A 2F44A 2PFOA 4MEXA 4MF2A 2ZUDA 4CDGA 9ICBA 5IILA 1P7DA 2VKQA 3BQ0A 3PMLA 5CHGA 2DF4B 3A0HU 3ZD9A 4RQ0A 2XY7A 2YQEA 4NLGA 4P4PA 4F92B 3NVZA 4F91B 3C2KA 3AU6A 1SZPA 1KFTA 4P0QB 3GV7B 3F2BA 3PZPA 4RNOA 4NM2A 3CYMA 5HNKA 3SEIA 2NRTA 5EWGA 4J9KA 5KNIA 4KMOB 4EBEA 1V38A 2ZTDA 3WK4A 1ZQBA 4Q45A 4J9SA 4Y2VA 3WKCA 2E3TA 1N63A 2PI5A 2BQRA 1ZQQA 1Y88A 3F2CA 2KKVA 1S0VA 4PHAA 1Z4OA 3M9NB 5ALXA 4RQ3A 4PHDA 4F50A 3T3FA 2E8NA 1HJPA 4XA5A 8ICXA 1ZQVA 3C5FA 4TQSA 3ISDA 4F4XA 2K4EA 1L8OA 4KLLA 4B9TA 1N48A 1SKRA 2EZYA 4RQMA 8ICMA
chains in the Genus database with same CATH topology
5TISU 4UB6U 5GTHU 4PJ0U 4IL6U 2DUYA 3A0HU 2AXTU 5H2FU 3WU2U 1S5LU 5B66U 5KAFU 5KAIU 5B5EU 3KZIU 3A0BU 5GTIU 4UB8U 5E79U
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TIS U;  4UB6 U;  5GTH U;  4PJ0 U;  4IL6 U;  2DUY A;  3A0H U;  2AXT U;  5H2F U;  3WU2 U;  1S5L U;  5B66 U;  5KAF U;  5KAI U;  5B5E U;  3KZI U;  3A0B U;  5GTI U;  4UB8 U;  5E79 U; 
#chains in the Genus database with same CATH topology
 1NK7 A;  1ZXI A;  4KLU A;  3SZ2 A;  2FMP A;  3TAN A;  5HMM A;  3SAH A;  3HWT A;  2ZTC A;  3FC4 A;  4P2H A;  3TQ1 A;  2WF7 A;  3H8S A;  7ICI A;  2OHF A;  5ALQ A;  1NK0 A;  4J9M A;  4EZ6 A;  1ZET A;  1ZQX A;  4J9Q A;  1URJ A;  9ICI A;  1JUD A;  2DFL A;  3T5K A;  1NK8 A;  2BCU A;  4P0Q A;  4B9S A;  1DOQ A;  2HDO A;  7ICR A;  1JMS A;  4DFP A;  2KNJ A;  2K60 A;  3TAR A;  1S77 D;  2ODG A;  3GIL A;  3PW7 A;  2JXJ A;  2ASJ A;  4US9 A;  4ECZ A;  2QLT A;  4BWM A;  2XVT A;  4QJF B;  1LV5 A;  3NTU A;  4JWM A;  3A0B U;  1MSW D;  3BS5 A;  1ZQC A;  3N7P D;  4ELU A;  4FE3 A;  4DQI A;  4O3O A;  3ISB A;  4I2D A;  1DXS A;  1YT3 A;  4CF5 A;  2QAR A;  2C2E A;  3RJJ A;  1L8L A;  4K4G A;  4EZ9 A;  3RFA A;  1NK6 A;  4B9M A;  5AKY A;  5ALU A;  2NV3 A;  4NL9 A;  4F72 A;  4IRD A;  5D49 A;  1ECW A;  4DFD A;  3Q8P B;  2K8A A;  1NJX A;  2W7O A;  4DWI A;  1IIP A;  4EYI B;  1JXL A;  2CN1 A;  1A6S A;  4ED0 A;  4Z6F A;  4IQW A;  3K1Z A;  1NJZ A;  3OSN A;  5AKL A;  3RF9 A;  3IM1 A;  4C8K A;  4RU9 A;  2WAQ C;  3U26 A;  5KL8 B;  1BPY A;  5ALI A;  2DWQ A;  4F5P A;  4J03 A;  5DKW A;  4O0I A;  2E1E A;  1XSP A;  4YG2 A;  4UAW A;  2ESE A;  3EPG A;  3HP6 A;  1T7P A;  1RQL A;  2BCV A;  4UAY A;  3PW2 A;  4YXJ A;  2ZUC A;  1ZQP A;  1KTQ A;  2BPF A;  3EUB 2;  3TFR A;  2BR0 A;  1SGG A;  3EW9 A;  4DQR A;  2ISO A;  2KEY A;  1ZRN A;  3PX0 A;  1X66 A;  4F5O A;  4RPY A;  2HOI A;  2G0A A;  4YXM A;  3SV3 A;  9ICP A;  5T14 A;  2JRZ A;  1RYR A;  4QZE A;  4QWA A;  4PL2 A;  4FS1 A;  8ICL A;  1RXV A;  4G9B A;  2G5H B;  7ICH A;  4R63 A;  1ZOL A;  4I2E A;  4BWJ A;  3KD3 A;  1UHU A;  5IIM A;  4RT2 A;  3MR2 A;  1MQ2 A;  1JRO A;  3AL0 B;  2ZIX A;  2G06 A;  4KLI A;  4M6W B;  5AK5 A;  1SWV A;  2DL0 A;  4PGQ A;  3WK8 A;  4F4Z A;  1NJW A;  4KLF A;  1A77 A;  4A8E A;  2KTQ A;  1MC8 A;  1D8L A;  1S0N A;  1NZB A;  3NAS A;  1V85 A;  2PFN A;  1ZQS A;  2G07 A;  4FBU A;  4M04 A;  4NLK A;  1DRG A;  2KJ9 A;  3MGV A;  4RQ2 A;  5AM0 A;  5KTQ A;  2OYY A;  2C2R A;  4KIT B;  2JZB B;  5J2F A;  2XO7 A;  2IOF K;  3T79 A;  5ALY A;  1JXE A;  2KVC A;  2ZIW A;  3CP8 A;  4Y2P A;  5KFG A;  1S9F A;  3J81 j;  2Q4T A;  1S10 A;  3KKA C;  4US8 A;  3AU2 A;  5FP0 A;  2N1R A;  3M9M B;  5G5G A;  3UMB A;  9ICL A;  1CUK A;  5J2E A;  2V4R A;  4IRC A;  2E8M A;  2OH2 A;  2XY5 A;  2BCQ A;  1RYS A;  1PUZ A;  2LI6 A;  4QZH A;  4JV2 A;  5AIB A;  3SV4 A;  1F0M A;  2RDI A;  4OJL A;  3HW8 A;  5J8Y C;  1KFD A;  7ICP A;  3TKA A;  2MU2 A;  2IHN A;  4J9O A;  1NNL A;  3NVV A;  1CI4 A;  4DLG A;  3I76 A;  2DQN B;  2EAO A;  3E0F A;  1Z1B A;  4IQV A;  5DDM A;  4DFK A;  8ICC A;  1N56 A;  2HI0 A;  3H0L B;  4M9J A;  4IQU A;  2WHE A;  2H5X A;  2WF9 A;  3BJY A;  1SWW A;  3L4P A;  1TAM A;  2KFN A;  3DV9 A;  4C8L A;  1PK1 A;  3AMZ A;  1NZP A;  2PMZ F;  1UT5 A;  1KSP A;  5BOM A;  2E1F A;  2G5I B;  3F5E A;  1AQ6 A;  3UM9 A;  2KV2 A;  3H0R B;  2AXT U;  1NKE A;  9ICR A;  4ECY A;  4BJQ A;  3V7J A;  2AJQ A;  4M2Y A;  3NRW A;  3M6K A;  7ICQ A;  5HHH A;  1LB2 B;  3RB0 A;  5C5J A;  5KT7 A;  4QZG A;  4DLE A;  5KT3 A;  3OHB A;  1Z4N A;  1DGJ A;  5AK3 A;  2OXO A;  4KN7 A;  4DS5 A;  2P6R A;  2Y1I A;  2ZTE A;  2K4P A;  1RPL A;  4FZM A;  2A1J B;  2Y0S C;  2JEJ A;  4KTQ A;  3H8J A;  1Q46 A;  4CCH A;  5KFF A;  3KKA A;  1LKY B;  3NS1 A;  5CRX A;  2AQ0 A;  5DB6 A;  2BPC A;  4DS4 A;  1J97 A;  2ZXI A;  1FO4 A;  4NM1 A;  5KFC A;  2J6U A;  1LVH A;  3ZD8 A;  5CJ7 A;  4I2H A;  4O3R A;  4O3S A;  4GXJ A;  8ICY A;  3AQF A;  2YMP A;  3GFK B;  2VA2 A;  2M9N A;  4MEY A;  5J8Y A;  4C7Y A;  3FYH A;  4F4W A;  5BOL A;  2LKY A;  2V9W A;  3RJG A;  4ECU A;  1X6I A;  2EDU A;  5AKJ A;  2NYV A;  5AK6 A;  4ED2 A;  5KFJ A;  1SKS A;  2YTU A;  3K75 D;  2W9C B;  1J2N A;  2W3S A;  5EWF A;  5DB8 A;  3GV8 B;  3T5H A;  3JPN A;  3PR4 A;  2JH7 A;  4M9G A;  4ELT A;  4TUP A;  5ALV A;  5KG5 A;  3BQ1 A;  3SQI A;  2CRX A;  4KX3 A;  4R8U B;  1L5U A;  7ICU A;  5KFB A;  5DBC A;  4YFK A;  3PSI A;  2KIC A;  5AKE A;  4ED1 A;  2BZF A;  5KFK A;  4NWI A;  4JWN A;  1ED1 A;  1QQ7 A;  1Z3E B;  5DGB A;  3QZ7 A;  3UMG A;  2HHU A;  4F2S A;  1COK A;  4QNL A;  3S6J A;  4DCC A;  4BUG A;  4I29 A;  2W03 A;  4F2R A;  2ZIU B;  1M6Y A;  2KOB A;  3GDX A;  3BZK A;  4UW9 A;  5KG3 A;  2BGW A;  2W43 A;  1BPE A;  2EAP A;  4DL2 A;  4FBT A;  4PZO A;  3HKZ F;  1S0O A;  2VA3 A;  3N7S C;  4FFD A;  4Q8E A;  3L5K A;  2FPK A;  3QEA Z;  3MFH A;  7ICS A;  4IC9 A;  1X40 A;  2B0C A;  4FZL A;  2ZJ8 A;  3JPS A;  5G5H A;  2XGP A;  3LYS A;  3KBB A;  5DG8 A;  4Q44 A;  4I2B A;  2XC9 A;  2JMG A;  2H3V A;  2F8K A;  1XWL A;  1RQN A;  1FIQ A;  1ZQR A;  1XC9 A;  9ICE A;  2NRW A;  5ALT A;  2P66 A;  4YVZ A;  1UPH A;  3GZF A;  1H38 A;  3V72 A;  4PJ0 U;  3ED5 A;  1C20 A;  9ICK A;  1TV9 A;  3MFI A;  2K89 A;  4PL1 A;  2GO7 A;  3F53 A;  2ISP A;  2W9B B;  2XI9 A;  4PZN A;  3PY8 A;  4ZOH C;  5IIK A;  5KFM A;  4ED3 A;  4R8U A;  2F1I A;  2WTF A;  2KD1 A;  1NOM A;  5KG0 A;  2R8I A;  2JEF A;  3BS7 A;  3RRH A;  1L3U A;  2KIW A;  5AM1 A;  4UBB A;  3UPQ A;  3ISC A;  1QTM A;  9ICT A;  4Y2R A;  2F77 X;  3PSF A;  5KFA A;  4QZ8 A;  5KFI A;  5J0X A;  4JV1 A;  4M0A A;  1OXJ A;  5KFU A;  2RLT A;  1XU4 A;  1FFV A;  4CF3 A;  4UB2 A;  1OW5 A;  3RJF A;  7ICE A;  2LM4 A;  4Z6C A;  4CF4 A;  2HBJ A;  5J0S A;  2YMM A;  4QZD A;  5KFZ A;  4UB4 A;  4F8R A;  4GIB A;  1KDH A;  4OO1 J;  3C1Y A;  2AU0 A;  2HHT A;  3G6Y A;  4LVS A;  4LJX A;  2WF6 A;  4I2G A;  3KOO A;  1YZ7 A;  3RJI A;  3LWL A;  2R8G A;  4DSF A;  5ALE A;  3GU3 A;  5CP2 A;  1JI7 A;  1SV0 A;  3TAC B;  3G6X A;  4ZH4 A;  2E8P A;  4Q43 A;  1BGX T;  3D6J A;  5EOZ A;  3WU2 U;  1BPD A;  3V7L A;  3RR8 A;  9ICJ A;  5KAF U;  4ECT A;  1K5O A;  2JR5 A;  1U48 A;  4F3O A;  2F2A B;  1QLN A;  4JUZ A;  2IOF A;  2H3Z A;  2W9B A;  4J9L A;  3QEB Z;  1ZQM A;  3TI0 A;  5K4L A;  4C80 A;  4P4M A;  1OUQ A;  4DL7 A;  2MUT B;  1TK0 A;  7ICG A;  9ICW A;  2G09 A;  2YML A;  1ZQT A;  3C23 A;  5AM3 A;  3WK5 A;  3H4D A;  3ONN A;  3VCB A;  3OJU A;  5AM5 A;  5EE1 A;  5J0P A;  4KLT A;  2WF5 A;  1DK3 A;  4RQN A;  4G3I A;  1HUO A;  2J6S A;  3WKA A;  1D8B A;  1NK4 A;  5DQH A;  5ALG A;  1QQ6 A;  4NLN A;  2ASL A;  4NXZ A;  1HUZ A;  5L1K A;  1F5S A;  1NKC A;  2HVI A;  2P35 A;  1S8O A;  3QU4 A;  1JRP A;  5HHI A;  3BZC A;  3RRG A;  3CRX A;  2KSO B;  3OHA A;  2OCE A;  5J0U A;  1L3T A;  4K4H A;  2V4Q A;  1FEZ A;  5AKZ A;  4QWC A;  1JN3 A;  2XY6 A;  4RUC A;  3BQ2 A;  3C5G A;  2O6K A;  1VDV A;  2FDR A;  3WK6 A;  3QE9 Y;  2KKP A;  4MHV A;  1RDF A;  2VAN A;  3QNM A;  4NLB A;  1XO0 A;  3ZDC A;  2KHQ A;  4GC6 A;  1B0X A;  1JAL A;  8ICS A;  4K4I A;  4O5E A;  4DSK A;  1ZYQ A;  3C2L A;  2LPE A;  3FAH A;  4C8M A;  2XCA A;  2RQ5 A;  5HR7 A;  1TFR A;  3RJE A;  4AYB F;  3HT3 A;  1K1S A;  2LHT A;  2LM1 A;  3SMV A;  2PMZ C;  4HYK A;  4BXO B;  1BPZ A;  4DFM A;  2UVU A;  5ALN A;  4IR1 A;  4DSE A;  4EBD A;  1Q8K A;  3VC8 A;  5J2A A;  2HOQ A;  5AK4 A;  1Z19 A;  3RH4 A;  3H7I A;  4IL6 U;  2BPG A;  2EZX A;  5KG7 A;  4ED7 A;  3PX4 A;  2DKX A;  3DDH A;  2FMQ A;  4PPX A;  1X2I A;  2WB1 F;  1ZQH A;  1KRP A;  1T3Q A;  8ICE A;  2W11 A;  5AI0 A;  2B21 A;  2EAN A;  3UXN A;  4OJ5 A;  2AGP A;  5ALM A;  1T4G A;  4DO9 A;  1TVA A;  2IOH A;  4JMU A;  3UQ0 A;  2HOF A;  3HX0 A;  3N4M B;  5DB7 A;  3B0Y A;  7ICV A;  5KG6 A;  2KN7 A;  9ICH A;  8ICN A;  4DL6 A;  9ICC A;  3RJK A;  3MGI A;  1SIJ A;  1U9L A;  4DOB A;  5KFR A;  3QUB A;  1XNS A;  2PFP A;  3AM9 A;  1Z00 B;  1IV8 A;  3IN5 A;  5C0Y A;  4USA A;  1XSL A;  1WG8 A;  4J9N A;  9ICM A;  4TQR A;  5ALO A;  3GIK A;  4RUA A;  2HMX A;  4CE6 A;  2BCS A;  4B6J A;  2DBY A;  5KFH A;  2KZ3 A;  1UT8 A;  3V6K A;  8ICB A;  4QZI A;  3E2E A;  3OGU A;  2XGQ A;  4Y2S A;  3KZX A;  3QZ8 A;  2C28 A;  3THV A;  2XCP A;  2JEI A;  3JPQ A;  1D8Y A;  5L1I A;  3LVV A;  1IXR A;  4ECW A;  1X42 A;  2W3R A;  4DQP A;  3C28 A;  2K8C B;  3Q8S B;  3IV6 A;  9ICV A;  3PR5 B;  2UVV A;  2ASD A;  2NRX A;  1Q3U A;  4P4O A;  7ICJ A;  3NVY A;  4JK1 A;  4R66 A;  2EH9 A;  3QUQ A;  5AM4 A;  4Y2J A;  4FO6 A;  4F4K A;  8ICZ A;  4KLD A;  4QW8 A;  4UAS A;  2XIC A;  4MFF A;  2DKZ A;  4M6W A;  3HKZ C;  3K1R B;  5CA7 A;  2HHS A;  3FM9 A;  3PX6 A;  5ALP A;  2BHN A;  2KJ5 A;  4MFA A;  2Z7J A;  4KLS A;  3MDC A;  1B4F A;  3QU2 A;  5CR0 A;  1ZQY A;  3AQE A;  2DPI A;  2W9M A;  3CNH A;  1DK2 A;  2PFQ A;  1WWU A;  4R64 A;  3RR7 A;  5ALZ A;  1B22 A;  1TKD A;  1NI3 A;  2FI1 A;  4LZG A;  1SXD A;  3QUC A;  5KT4 A;  2NRV A;  3Q8M A;  2JZB A;  3UQ2 A;  3MR3 A;  1XSN A;  7ICT A;  5TIS U;  1X9M A;  2ZXH A;  1WWV A;  3HJE A;  4DF8 A;  1ZQZ A;  2C22 A;  3L3F X;  2ZIV B;  4NY8 A;  2HW3 A;  2QB1 A;  3BQT A;  5KG1 A;  2IHM A;  2W9A A;  1N60 A;  1ZD5 A;  4B9V A;  4DF4 A;  1J2M A;  5AKH A;  2DGZ A;  3ETL A;  1SL1 A;  2YY6 A;  5B66 U;  5ALW A;  5B5E U;  3RTV A;  1UCV A;  4Q8F A;  4O3P A;  3QYP A;  5JTI A;  4YR0 A;  3AN1 A;  1K1Q A;  2LBO A;  1ZQD A;  3QX7 A;  5KFV A;  7ICL A;  5ALJ A;  4DQQ A;  4ICA A;  4ELV A;  4YD2 A;  3ZDB A;  2HHX A;  1ARO P;  1Z1V A;  4DL3 A;  1B43 A;  4FZN A;  2FPL A;  4RQ5 A;  4RQ6 A;  2VJ5 A;  8ICR A;  2E5S A;  4B9U A;  2KG5 A;  3EWA A;  3EYZ A;  4UAR A;  4OCZ A;  1MA7 A;  1QSY A;  1L6N A;  1FFU A;  3PO4 A;  4I28 A;  2YX8 A;  4M9L A;  2GH1 A;  3NGD A;  2RP5 A;  4F71 A;  3PVX A;  1L3S A;  5J0W A;  2BCR A;  2CXY A;  3QU9 A;  5IIN A;  4CGZ A;  3MAB A;  5III A;  4B9N A;  7ICN A;  2HHV A;  4UBC A;  2I6X A;  4GC7 A;  3UXP A;  4DOA A;  2KFZ A;  3Q8L A;  5A0L A;  3MR6 A;  2KIV A;  4KLM A;  2FMS A;  5J0O A;  5KT6 A;  1T3N A;  1TAU A;  1N2X A;  2LMR A;  2H3I A;  3PST A;  1BPB A;  3H4B A;  4DSI A;  4F5Q A;  4JV0 A;  2R8H A;  4O5K A;  2YN4 A;  4UAT A;  2A1J A;  1ZQ1 C;  2NRZ A;  2RRD A;  3TAQ A;  1CRX A;  3G6V A;  4DQS A;  1MN8 A;  1LKY A;  4XQ8 A;  8ICO A;  2QB0 B;  4NV0 A;  2EZZ A;  5IIO A;  3T5L A;  3ETR A;  4KX5 A;  4AP9 A;  2K4H A;  2LYA A;  3GIJ A;  4HAI A;  5AKI A;  4GFJ A;  2IMW P;  4GLX A;  3PW4 A;  9ICG A;  1U49 A;  1RM6 C;  1XS9 D;  4M9H A;  3RAX A;  3H8M A;  1V97 A;  4ECX A;  5KAI U;  3RB4 A;  5AKK A;  3HRD D;  1RZT A;  5EE9 A;  2UVR A;  4BX9 C;  3M1Y A;  2YB4 A;  5HP4 A;  4KLQ A;  1SV4 A;  2D3D A;  2BQ3 A;  3IRU A;  1KEJ A;  5AI8 A;  1SB3 C;  2W9C A;  3EZ5 A;  3NUQ A;  3PV8 A;  2KP7 A;  2ES6 A;  1ZD3 A;  4RPX A;  2FLP A;  3IP4 B;  5ALH A;  3BDP A;  4YD1 A;  1COO A;  1WCN A;  1N5X A;  2H3Q A;  4YMN A;  2A3V A;  3Q8Q B;  4ED6 A;  3ICX A;  1BNO A;  1UQV A;  3WKB A;  2AGO A;  4B9L A;  3OJS A;  2GOL A;  1KFS A;  4NJ8 A;  5ALR A;  4O3N A;  3WK7 A;  4QZC A;  2W7P A;  3CW2 C;  3AEV A;  3GIM A;  5KFE A;  3M8S A;  1IG6 A;  4IQT A;  2L5Y A;  3C1Z A;  5KFX A;  4F4Y A;  5JU5 A;  2JH1 A;  2IBK A;  2QKQ A;  2ZIU A;  5GTI U;  3K4G A;  5J29 A;  4RNN A;  2QB0 A;  4F93 B;  1U47 A;  1ZQA A;  4DSL A;  4AYB C;  5DG7 A;  4IS7 A;  2AH5 A;  2R18 A;  3ZI4 A;  3PMN A;  3D2Q A;  4UAU A;  4Y2X A;  4GXK A;  4JB3 A;  5J0Q A;  5AKX A;  3C2M A;  1N62 A;  4KLE A;  4LZD A;  3ORY A;  5CB1 A;  2ZG6 A;  5DBB A;  3OPX A;  3RBD A;  1ZQG A;  3PW5 A;  8ICJ A;  3O0F A;  5DB9 A;  2JEG A;  5J2G A;  3PW0 A;  5KFQ A;  5AM2 A;  9ICN A;  3V6H A;  3IG8 A;  1SKW A;  1TAQ A;  3BS5 B;  1TK8 A;  2Y9U A;  1NK9 A;  4KLJ A;  5IIJ A;  3NRZ A;  1BNP A;  2WB1 C;  4DEZ A;  3I28 A;  5EE0 A;  4NL9 C;  8ICI A;  4CRX A;  2OEH A;  8ICQ A;  2KK0 A;  4GXI A;  8ICW A;  1ZQW A;  4RQ1 A;  1YZ6 A;  4YR2 A;  2KE7 A;  4I27 A;  5HR6 A;  2K8B B;  3RB6 A;  9ICF A;  2Q0Z X;  4UB5 A;  4IR9 A;  4EEN A;  3PSP A;  4QIW F;  2E8O A;  2QAR B;  4TUQ A;  1O03 A;  3LVW A;  1IM4 A;  2WF8 A;  3IDW A;  2HVH A;  1KL9 A;  2JGA A;  5L1M A;  5J2I A;  1O08 A;  1ZJM A;  3TAD C;  3FDS A;  2I5H A;  3NVW A;  4EX6 A;  2C2D A;  5KFW A;  1SL0 A;  1JIH A;  2KVS A;  4PHP A;  3T5J A;  2D8C A;  3H0M B;  4ED8 A;  2BQU A;  3AUO A;  4PH5 A;  3SR6 A;  1Q3V A;  4RT3 A;  2DPJ A;  2MRL A;  1VJ5 A;  3C29 A;  4RQ4 A;  1RYU A;  2M0N A;  4F5R A;  2YB1 A;  4I2I A;  1TK5 A;  2HHQ A;  2ZJ5 A;  5H2F U;  9ICU A;  1A0P A;  5J2K A;  3Q8R B;  1ZD4 A;  1S0M A;  7ICF A;  3RH5 A;  5DG9 A;  1U4B A;  1PVP A;  2EAM A;  3KFU F;  4YP3 A;  4YMM A;  1S97 A;  5GTH U;  5JRT A;  3PO5 A;  2A19 A;  4KMU A;  5KG4 A;  2F1H A;  4QWD A;  4WJ3 B;  8ICA A;  5F3X B;  2W8K A;  3JPT A;  1ZQF A;  4F5N A;  5KFY A;  3RB3 A;  4QZ9 A;  4P0P B;  2ATL A;  1F44 A;  3Q8K A;  4UB3 A;  2ZIX B;  4C0Z A;  3ALR A;  4C7Z A;  5J0T A;  1ZQK A;  2MUT A;  5HML A;  1ZQN A;  5ALD A;  4DFJ A;  9ICO A;  2AGQ A;  5J0R A;  5TZV A;  5AI9 A;  3KHR A;  1ZRM A;  2G08 A;  4OD0 A;  1X9X A;  3SD7 A;  5AI4 A;  1VLB A;  3QXG A;  3HIL A;  4OJP A;  8ICT A;  4RQ7 A;  3MDA A;  4RZR A;  2RHF A;  5DLF A;  7ICM A;  3TAD A;  5F9N A;  2ZIW B;  8ICH A;  4TUS A;  4I2C A;  2P6U A;  2DUY A;  2A1A A;  5D46 A;  3RJH A;  4I2J A;  5AIC A;  3SAF A;  2FJ6 A;  1HIW A;  2HCF A;  3MR5 A;  3WKD A;  1L7O A;  2KSO A;  3IG5 A;  4RNM A;  5DQG A;  5AKG A;  5J2C A;  4PGX A;  1PVQ A;  4YN4 A;  3M8R A;  3F5A A;  3GV5 B;  5KFO A;  2MSN A;  3ZDE A;  5EWE A;  1ZJN A;  2FE9 A;  5EE3 A;  5KG2 A;  2LYB A;  1MQ3 A;  4EEY A;  4OJ6 A;  2VA8 A;  5D4B A;  1ZQJ A;  5L9X A;  2HSZ A;  2B6G A;  3F2D A;  3SYZ A;  3B9J A;  4Y2Q A;  8ICG A;  3MC1 A;  3JPR A;  2UVW A;  2KJ8 A;  1X6J A;  2W54 A;  4P0P A;  2HBL A;  4QWE A;  3LWM A;  4QW9 A;  5J2H A;  2PI4 A;  5KFL A;  4C8N A;  5KT5 A;  4XRH A;  2BKE A;  4Y2Y A;  5AI5 A;  2R8K A;  3PNC A;  5CWR A;  1PK1 B;  1KLN A;  2EQY A;  4BXO A;  4O3Q A;  4EBC A;  1KW4 A;  8ICU A;  3ZDD A;  2D6F C;  3H40 A;  4IRK A;  2I1Q A;  9ICQ A;  2J6T A;  5DBA A;  5BPC A;  1X9S A;  1T8E A;  1UA1 A;  2IA6 A;  1T94 A;  5KL1 B;  3M9O B;  4QZF A;  3JPO A;  3WKE A;  5KFN A;  8ICV A;  2PKE A;  3KHL A;  3C21 A;  1EXN A;  4DL4 A;  1ZD2 P;  3LK9 A;  3SI8 A;  4C8O A;  2R8J A;  4EEL A;  2YMQ A;  1C7Y A;  1ZQO A;  2OWO A;  4KLH A;  1SXE A;  5ALF A;  1S5L U;  4X5V A;  2W55 A;  2F76 X;  3KZI U;  8ICF A;  4QWB A;  1QSL A;  1RXW A;  5DLG A;  4O3M A;  1ZQU A;  3V6J A;  4CNQ A;  4YCX A;  3R9K A;  3MGH A;  5ALS A;  3V7K A;  5DGA A;  3RAQ A;  1Z00 A;  2F3N A;  3RBE A;  1PZN A;  3RH6 A;  2WAQ F;  4EEK A;  5CEH A;  4UB8 U;  3GQC A;  2Y1J A;  4UB6 U;  4NLC A;  4M9N A;  4ACO A;  3KHH A;  4J9R A;  5ALK A;  1ZQE A;  2VJ4 A;  4MFC A;  2OM6 A;  3OSP A;  1ZQL A;  5ALL A;  5J0Y A;  4UQG A;  5AI6 A;  2MAX A;  1D9D A;  2KHV A;  5AIA A;  1V9P A;  4BDP A;  2LYH A;  2KMD A;  4DL5 A;  1TE2 A;  4UAV A;  2W8L A;  2MA1 A;  4PGY A;  3E58 A;  1SZH A;  1NK5 A;  3TFS A;  4O5C A;  4QZB A;  3DEE A;  2KZZ A;  1N5W A;  3D2N A;  1PK3 A;  2JHD A;  2ZJA A;  1L7N A;  1A76 A;  5AHX A;  2NO5 A;  2AQ4 A;  3B0X A;  3OTQ A;  9ICX A;  2ALZ A;  1BPX A;  2GWS A;  2FLL A;  3UMC A;  2H3F A;  4BGD A;  2XID A;  2BDP A;  1U45 A;  2FPM A;  1CEZ A;  2KZM A;  2GLE A;  2FLN A;  5JUM A;  4KLG A;  4ECV A;  2I9G A;  5E79 U;  3SEN A;  2ZUB A;  4RPZ A;  2NO4 A;  4TUR A;  4I2A A;  4EYH B;  3N28 A;  4U6P A;  4O9M A;  1S76 D;  5DQI A;  1WCL A;  4Y2T A;  1XO1 A;  1D9F A;  3IHQ B;  2ZIV A;  1PVR A;  4RQ8 A;  4DOC A;  4Z6E A;  5J2B A;  4C4S A;  2K4I A;  1WYG A;  2W04 A;  1L7P A;  4XUS A;  1KKX A;  4MF8 A;  1WUD A;  3SAG A;  8ICP A;  4E0D A;  3QU5 A;  3MBY A;  3LDA A;  4M47 A;  2JV3 A;  3QUT A;  1RG6 A;  1QSS A;  4QIW C;  2CPR A;  3WK9 A;  4Y2U A;  4R65 A;  1SL2 A;  5L1L A;  1KQQ A;  5KFS A;  2F8L A;  2HBK A;  4ECQ A;  5L1J A;  3HPO A;  3GII A;  4YQW A;  4C4R A;  3EPI A;  4YR3 A;  1JX4 A;  4DSJ A;  2VIX A;  3KTQ A;  4YMO A;  1KN5 A;  5KT2 A;  3ZDA A;  9ICA A;  4KLO A;  4ECR A;  1ZQI A;  1GO3 F;  2PXI A;  9ICS A;  1SV0 C;  1UA0 A;  3KHG A;  3TAP A;  3BQ7 A;  5F9L A;  3JPP A;  1L7M A;  1NJY A;  2HBM A;  3QU7 A;  4Z6D A;  3N7R C;  5DDY A;  1HEK A;  4NLZ A;  2WFA A;  4PHE A;  3M6Z A;  2AHO B;  1BVS A;  4UAZ A;  2F1J A;  4UB1 A;  4KN4 A;  2HHW A;  1X9W A;  7ICO A;  1NKB A;  4I2F A;  5KFP A;  3I1Y A;  3N97 B;  5KFT A;  1DGS A;  3UXO A;  5J2J A;  4J9P A;  5KFD A;  5J2D A;  3H8W A;  4ECS A;  4EX7 A;  1KBU A;  1QCK A;  2RDJ A;  4U7C A;  8ICK A;  4FS2 A;  2BDU A;  3M7D A;  3D2S A;  4OJO A;  1QQ5 A;  7ICK A;  4C4T A;  2Y9T A;  4QZA A;  1L3V A;  1QH9 A;  2Y0S F;  1N61 A;  2F44 A;  2PFO A;  4MEX A;  4MF2 A;  2ZUD A;  4CDG A;  9ICB A;  5IIL A;  1P7D A;  2VKQ A;  3BQ0 A;  3PML A;  5CHG A;  2DF4 B;  3A0H U;  3ZD9 A;  4RQ0 A;  2XY7 A;  2YQE A;  4NLG A;  4P4P A;  4F92 B;  3NVZ A;  4F91 B;  3C2K A;  3AU6 A;  1SZP A;  1KFT A;  4P0Q B;  3GV7 B;  3F2B A;  3PZP A;  4RNO A;  4NM2 A;  3CYM A;  5HNK A;  3SEI A;  2NRT A;  5EWG A;  4J9K A;  5KNI A;  4KMO B;  4EBE A;  1V38 A;  2ZTD A;  3WK4 A;  1ZQB A;  4Q45 A;  4J9S A;  4Y2V A;  3WKC A;  2E3T A;  1N63 A;  2PI5 A;  2BQR A;  1ZQQ A;  1Y88 A;  3F2C A;  2KKV A;  1S0V A;  4PHA A;  1Z4O A;  3M9N B;  5ALX A;  4RQ3 A;  4PHD A;  4F50 A;  3T3F A;  2E8N A;  1HJP A;  4XA5 A;  8ICX A;  1ZQV A;  3C5F A;  4TQS A;  3ISD A;  4F4X A;  2K4E A;  1L8O A;  4KLL A;  4B9T A;  1N48 A;  1SKR A;  2EZY A;  4RQM A;  8ICM A; 
#chains in the Genus database with same CATH homology
 5TIS U;  4UB6 U;  5GTH U;  4PJ0 U;  4IL6 U;  2DUY A;  3A0H U;  2AXT U;  5H2F U;  3WU2 U;  1S5L U;  5B66 U;  5KAF U;  5KAI U;  5B5E U;  3KZI U;  3A0B U;  5GTI U;  4UB8 U;  5E79 U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...