3A0HU

Crystal structure of i-substituted photosystem ii complex
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
98
structure length
98
Chain Sequence
EELVNVVDEKLGTAYGEKIDLNNTNIAAFIQYRGLYPTLAKLIVKNAPYESVEDVLNIPGLTERQKQILRENLEHFTVTEVETALVEGGDRYNNGLYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Photosystem Q(B) protein
publication title Location of chloride and its possible functions in oxygen-evolving photosystem II revealed by X-ray crystallography
pubmed doi rcsb
total genus 22
structure length 98
sequence length 98
chains with identical sequence u
ec nomenclature
pdb deposition date 2009-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF06514 PsbU Photosystem II 12 kDa extrinsic protein (PsbU)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.320 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Photosystem II 12 kDa extrinsic protein 3a0hU01
2DUYA 4UB8U 3WU2U 4PJ0U 5KAIU 4IL6U 2AXTU 5B66U 3A0BU 5GTIU 3A0HU 3KZIU 5E79U 5GTHU 5KAFU 1S5LU 5B5EU 5H2FU 5TISU 4UB6U
chains in the Genus database with same CATH superfamily
4RU9A 1ZJMA 2W3SA 1L8LA 2LBOA 5E79U 2E1FA 2XCAA 2ISOA 4JV1A 2NRTA 8ICQA 5B5EU 5AI8A 4RNMA 3L3FX 5J2IA 2KHQA 5CR0A 5DDMA 3MR5A 4Y2JA 4JK1A 2W04A 5J0XA 3RJJA 1UT8A 3GIKA 1ZQIA 2F44A 2KVSA 4J03A 5J0QA 4PGYA 3SYZA 4QNLA 3RBEA 2PMZC 2FJ6A 2FLPA 4PH5A 4OJOA 4Q8FA 2KHVA 4DL5A 4IRCA 5AKLA 4DF4A 4NWIA 4I2IA 8ICWA 4UBCA 5KG6A 3EYZA 2K89A 4KLUA 2NRXA 1TVAA 2IHNA 3IG5A 2KMDA 5TISU 4ED6A 4ED1A 2ZIWA 3AU6A 4QIWF 3GDXA 3C23A 1SKRA 4RQMA 3A0BU 3KHHA 3RTVA 2DPJA 3RF9A 2YQEA 3SAFA 4MEXA 1Z1VA 1T4GA 3QU9A 3C2KA 2AHOB 3B0YA 2FLNA 1RM6C 3MABA 1MSWD 2ASLA 4I2AA 3BS5A 4LZGA 3ZDBA 3RH4A 2LM4A 4Z6EA 4QWBA 4NL9A 5EE9A 1IM4A 3BS5B 4KMOB 5B66U 4DOAA 1TFRA 5EE1A 8ICHA 3JPNA 5DDYA 2KN7A 4XQ8A 1FEZA 3WKEA 3JPQA 1UQVA 3KKAC 3V6JA 4QZAA 4O3RA 5C0YA 3GV7B 3T5JA 1PZNA 3F2CA 1NI3A 4KLIA 1L7OA 1SXDA 4I2FA 4KLGA 4B6JA 7ICEA 1XSPA 2K4HA 3E2EA 2WF5A 2VJ4A 4K4GA 3QYPA 1ZOLA 1MQ2A 2BPCA 3M6KA 1N60A 1WCNA 2LPEA 1YZ7A 4C4RA 4EX7A 4G3IA 4DF8A 2LI6A 5KFNA 4TQSA 5DB7A 4BX9C 9ICIA 5KT5A 1X6JA 4M2YA 3C2MA 4QZIA 1COOA 1SV4A 1XC9A 1ZQWA 5A0LA 1JMSA 5DQHA 1JN3A 5J0TA 4FS1A 2XGPA 2BR0A 2KD1A 5HHIA 4DQPA 2BCVA 3H0MB 1FFUA 3H8SA 1ZQAA 2P6RA 2LKYA 3PMNA 2KZMA 3PX0A 3RR7A 4ECRA 4Y2YA 4CE6A 2B6GA 1S97A 4M0AA 1Q3VA 2WF7A 4NLNA 4OD0A 2KOBA 4NV0A 1UHUA 2ZUCA 4NM1A 2G07A 2HVHA 2V4RA 2EZYA 2OH2A 1TK0A 2WTFA 2UVUA 1NZBA 1DK3A 1RG6A 4K4IA 3F5EA 5AI6A 2W43A 1J97A 4FFDA 1Z19A 1MC8A 1V97A 3KKAA 4GXJA 5L1IA 3MGVA 3V7KA 5J2EA 4F3OA 1RQNA 3AQFA 1ECWA 3R9KA 2AGQA 3EZ5A 3G6YA 1KL9A 4FZMA 4EX6A 2DPIA 3AL0B 4YMOA 3ZDCA 3EPIA 4DLEA 1TE2A 1ZQTA 1XO0A 3E58A 7ICQA 3OJSA 1XO1A 2DQNB 9ICTA 3H7IA 1KLNA 1V85A 2G5HB 3FYHA 2RRDA 4QZ9A 1Z3EB 2MA1A 3OHAA 5KG7A 1AQ6A 4X5VA 3WK9A 4DFKA 3QNMA 1S0VA 4NJ8A 1BPXA 4IQUA 1KW4A 2WF6A 5ALPA 3KOOA 2M0NA 3NVYA 1NK4A 7ICPA 4JWMA 4EELA 1S8OA 3KZXA 4QZFA 2KIWA 3LYSA 1VDVA 2OWOA 4UATA 5AI4A 3KTQA 3F5AA 1QQ7A 5KFOA 3OTQA 4XRHA 9ICEA 4KN4A 2Z7JA 4MFFA 3IDWA 4K4HA 3LDAA 1O03A 4G9BA 4ICAA 4EYHB 3B9JA 2ZUDA 5KT3A 2BQ3A 5J0UA 1D9FA 4PGQA 3UQ2A 5AKIA 1ZQLA 5AKEA 1MQ3A 1UT5A 2FE9A 2IHMA 4UAZA 1N56A 2UVVA 5KFSA 4C8LA 3C2LA 3GQCA 2P6UA 5T14A 3GIJA 4P0PA 1N2XA 2KJ9A 3PY8A 4O9MA 1NJZA 3KBBA 3O0FA 5CB1A 4P0PB 4DSLA 1JI7A 3QZ7A 2PI5A 2JR5A 3QUQA 3RB6A 2WAQC 1C7YA 2JZBA 7ICGA 2PMZF 1ZQKA 5AM3A 1ZYQA 2HHVA 2W8KA 1A76A 5DB9A 4EZ9A 4M9NA 2QKQA 3QUBA 9ICQA 2F8KA 4C7ZA 4UAYA 1KFSA 1L7MA 4CRXA 3CP8A 1L7PA 1KRPA 4B9NA 8ICRA 5J2JA 5CRXA 5KL8B 3ORYA 1ZQQA 1HIWA 3C5FA 1CI4A 2Y9TA 2DUYA 4C7YA 5HR7A 1ZJNA 2K8AA 4UAVA 5AKXA 4CCHA 4BGDA 4CGZA 1T3QA 4YCXA 4U7CA 1TAQA 1UCVA 1BPZA 2KNJA 7ICFA 1FO4A 4UB6U 3Q8KA 3OHBA 3WKBA 4F4YA 2G08A 4IQVA 3OPXA 4YG2A 3IN5A 4HYKA 1A0PA 4DEZA 1FIQA 3RR8A 2B21A 1OXJA 1BPBA 2LM1A 1RQLA 4RPZA 3M7DA 4J9KA 1RYUA 5AIAA 1LVHA 1MN8A 3RJEA 1WG8A 2AU0A 2YY6A 9ICSA 1U4BA 4ECYA 3H4BA 4UB2A 5KT7A 4KLQA 4PGXA 4GC7A 5J2DA 5J0YA 2AGOA 3SAHA 2QB1A 4Y2TA 4I2HA 3TACB 4DWIA 2F8LA 2JEGA 2C2DA 4DLGA 1KSPA 2V9WA 2E8MA 9ICKA 4EEYA 8ICAA 3V7LA 2D8CA 3BQ2A 3OGUA 1S10A 3ONNA 5L9XA 3TAQA 4YQWA 2XO7A 3BQ7A 1SL1A 1QQ5A 4J9LA 3JPRA 3UXOA 1UPHA 2BGWA 1ZQXA 4PZNA 2RHFA 8ICJA 2H3QA 5JRTA 4PPXA 4QZDA 9ICOA 3D6JA 1SIJA 2JH7A 4Z6FA 2R8JA 4FZLA 4RQ0A 3NVWA 2HOQA 3PW0A 4OCZA 4Y2RA 1HEKA 5EWGA 8ICGA 2BQRA 4USAA 3PW7A 2KICA 2K8CB 9ICPA 3LWMA 2QARA 2C2RA 5IIIA 1ZQFA 5EWFA 3MR2A 1ZQHA 4NM2A 4ED3A 4LJXA 2QARB 5L1KA 2KSOA 3K1RB 7ICHA 1GO3F 4P4OA 1P7DA 2A19A 1F0MA 2ZXHA 3RB4A 1L3VA 2KSOB 3HT3A 1RYRA 2F76X 2CRXA 9ICRA 1H38A 4C0ZA 3C5GA 4GFJA 5DGBA 3VC8A 7ICOA 2WF8A 4F50A 3KFUF 2XVTA 4JUZA 1S0NA 4PHPA 3QEBZ 2K4PA 1PK3A 4CF3A 4NLCA 4RQ3A 2P35A 2F1JA 1RXWA 1S76D 3RH6A 1Y88A 8ICBA 1Z1BA 4NLZA 4DL6A 2F1IA 3NASA 4Y2UA 2JH1A 1U48A 5AKGA 4ELTA 3WK8A 4F2RA 1SZHA 4FE3A 4R64A 4NLBA 2ESEA 5ALKA 3GILA 2W3RA 3QU4A 5J0RA 1MA7A 2JRZA 2VA2A 3AU2A 4TURA 3LWLA 3HP6A 5AK4A 2E8OA 7ICLA 3KHLA 1DXSA 2K4IA 4C8MA 1RXVA 3K1ZA 2AH5A 3CRXA 5HMLA 1N5WA 1QSLA 4CDGA 2XCPA 1B43A 7ICUA 5AI5A 5DGAA 4C8NA 1BPYA 3LVWA 3H8WA 3WK6A 4O3QA 1NK0A 3QUTA 2EQYA 3HKZF 2K8BB 1D8YA 4C80A 3PNCA 8ICIA 2WAQF 5KFVA 5CEHA 4P0QA 4FZNA 2OM6A 4RZRA 3RAXA 3J81j 3N7RC 1C20A 3H4DA 3A0HU 1X2IA 3L5KA 1ZD3A 2EZZA 1WYGA 4M9LA 4E0DA 3V72A 3BZCA 3H0LB 1DRGA 5AM5A 4PHDA 2OEHA 3NVZA 2RDJA 2HSZA 2LYAA 4GXIA 1EXNA 4RPYA 9ICVA 2ODGA 2NO5A 4MFAA 2YMLA 1JXEA 1IIPA 2KP7A 1N61A 5KFWA 2ZIWB 3SV4A 4Q45A 1K1SA 1U47A 1ZQMA 3NRZA 1NJWA 2QLTA 4IC9A 3ISDA 1IG6A 4KLLA 5HP4A 5HHHA 4ECQA 5KFMA 4J9NA 2XI9A 4GLXA 2BCSA 2BDPA 4R8UA 3Q8PB 3ED5A 1NKEA 2LMRA 2HI0A 5AI9A 2N1RA 1WUDA 5DG8A 4UBBA 3UXPA 5DBAA 8ICEA 3EPGA 1X9MA 4R8UB 5AIBA 4DFPA 3RH5A 3MGHA 4GXKA 2JXJA 1BGXT 3SEIA 4RNNA 3Q8QB 3K75D 1N63A 5J2CA 4FBTA 3AMZA 2EAPA 2H3IA 1KQQA 3ISBA 5ALZA 1VLBA 2UVWA 4J9MA 4EYIB 2BPGA 1S0OA 3NRWA 3TFSA 1ZRNA 2KJ5A 1KTQA 3EW9A 5L1MA 5BOLA 3I1YA 1J2NA 4QWCA 3HW8A 4QZHA 4M04A 2G0AA 4YFKA 1X66A 3TAPA 4KLMA 5J2GA 2Y1IA 1SB3C 2Y0SF 4ACOA 1U49A 2PFPA 3FM9A 4EBCA 3TARA 4F5PA 2FPLA 3M6ZA 4YMMA 5ALFA 2JEJA 4IQTA 3SI8A 4UB3A 1ZQEA 5ALVA 5BPCA 4JMUA 5J0WA 4OJ6A 2UVRA 1L7NA 2MRLA 2I9GA 5KFRA 7ICKA 3F53A 4YR3A 3GFKB 1N48A 3I28A 2A1JA 1KKXA 5DG7A 1CRXA 1BPDA 3SZ2A 2A1JB 1T94A 1ZQGA 4DSEA 2GO7A 2KV2A 2FMSA 4F2SA 1B22A 5ALNA 4ELVA 2VKQA 1X9WA 5KFXA 4F71A 2NV3A 3BZKA 5CJ7A 4DQQA 1V9PA 1SWVA 4MEYA 1WCLA 3MR3A 5DLFA 1SZPA 1TV9A 4DQIA 5AI0A 3CW2C 4I2EA 2G06A 2ZG6A 1K5OA 3OSNA 4F8RA 5AK6A 8ICZA 1SKWA 3ZD8A 2W9AA 4NY8A 3MFIA 4KLEA 3PVXA 2FPKA 3B0XA 2Q0ZX 2JEFA 3IHQB 4P4PA 3LK9A 5KTQA 3DEEA 2PI4A 1LB2B 1XU4A 2ALZA 1L3TA 2YMQA 7ICIA 1U9LA 4WJ3B 3PW5A 2R8IA 8ICYA 4LVSA 2GLEA 4MHVA 4DS4A 5J29A 2HHXA 3SD7A 2HHUA 5DB6A 4RUAA 3SR6A 1Z00A 2W7PA 4F93B 5KFAA 2VIXA 2HHQA 1A77A 4ZOHC 4KLSA 4ECXA 1Z00B 5KFHA 4O3NA 1CEZA 4GC6A 5C5JA 3HWTA 3C1YA 2W54A 2R8HA 5J8YC 4ED8A 2W8LA 1PVPA 4YXJA 1QLNA 5J2BA 3PSIA 3ETLA 1SV0C 2NYVA 3K4GA 5KG4A 2I1QA 2IOHA 9ICLA 1OUQA 2EH9A 3RJKA 4RQ7A 5KFDA 4XA5A 2YMMA 5L1LA 4ECSA 1ZQSA 4KLHA 2DWQA 3MC1A 4J9QA 5G5HA 4UB8U 7ICJA 3KHGA 3PO4A 2MAXA 4RT3A 4UB4A 5GTIU 5L1JA 1QTMA 3TQ1A 3N97B 4US8A 3SAGA 2HBKA 5K4LA 5DB8A 4M6WA 2F3NA 4Z6CA 4M6WB 1L8OA 2JZBB 3TKAA 3C1ZA 1ZQBA 5AK3A 2FMQA 3RJHA 5J2AA 4RQ8A 4I2DA 5IINA 8ICNA 9ICWA 1XSNA 4I2CA 4KX3A 2WFAA 4AYBC 3IRUA 2BCUA 3PW4A 4DFDA 1KFDA 9ICGA 2E5SA 4QW8A 1X42A 5KFZA 5HMMA 5ALUA 3Q8RB 1B4FA 4YXMA 2BPFA 4I2BA 5J8YA 3PW2A 4QIWC 5KFLA 2XY7A 2ZIXA 2ZXIA 2C28A 2ISPA 4DSJA 2BDUA 4KTQA 1NK9A 1SV0A 4YVZA 4F5OA 2ZIXB 1JUDA 2JMGA 5ALWA 5IIKA 8ICVA 1SKSA 4FO6A 4TUQA 3M8RA 2AJQA 5ALYA 5J0PA 4U6PA 5KFIA 3DDHA 5D46A 1L6NA 4YN4A 8ICFA 3KZIU 2Y9UA 1TK8A 4QZBA 5ALJA 3M8SA 2XC9A 4IQWA 2XY5A 1L3UA 5JTIA 4A8EA 3ZDEA 1S77D 4I2GA 3GV5B 2BCQA 4JV0A 4PHEA 1X40A 2C22A 1J2MA 4Y2VA 3F2DA 5D4BA 3M9NB 9ICMA 4KMUA 2M9NA 3VCBA 4UASA 1JROA 1ZRMA 5AM2A 3ICXA 4PZOA 4ED2A 4RT2A 1XSLA 1WWUA 4IL6U 2F1HA 5AKYA 8ICUA 3BQ1A 2BCRA 2YB1A 2DL0A 2AGPA 3H0RB 5EE3A 4I28A 2VJ5A 1ZQRA 3WK5A 5KT2A 4UB1A 4ED7A 3C28A 2D6FC 2JEIA 1ZQDA 2O6KA 3QZ8A 4F5NA 4PL2A 1V38A 4BUGA 5KFUA 5AKKA 3TFRA 3N4MB 2A1AA 5DQGA 1HUZA 2KK0A 1D8BA 3HILA 5KG5A 1N62A 1Z4NA 2ZIUA 2V4QA 5FP0A 3OSPA 3ALRA 1TAUA 3N7SC 3N28A 3C21A 2ZIUB 2KTQA 9ICXA 1U45A 4J9SA 1NJYA 3QX7A 2H3FA 1ZXIA 4RQ1A 2ASJA 1ZQUA 2R18A 4YP3A 3L4PA 7ICMA 5ALSA 4O5EA 2KFZA 2ZIVA 1JIHA 5ALDA 3PX4A 3QUCA 4ECVA 1DOQA 2ZUBA 2E1EA 4UW9A 2D3DA 4JWNA 5D49A 9ICUA 2ZIVB 1O08A 1QQ6A 4C4TA 1SL2A 3MGIA 2A3VA 2C2EA 4CF4A 1PVQA 5KFYA 3T5LA 4RQ4A 1BNPA 1AROP 2FI1A 1S9FA 3UMGA 2XY6A 3ZD9A 1WWVA 3RJGA 4Y2SA 4BWMA 5DG9A 1FFVA 5AM0A 4F4ZA 2MSNA 3QU2A 2MU2A 1BNOA 3F2BA 2W11A 4ZH4A 4O3MA 1SXEA 3FC4A 7ICVA 2RP5A 1BVSA 2EAOA 3RJIA 7ICTA 5KFJA 9ICJA 4Y2XA 1T7PA 3AN1A 4ECZA 4O0IA 1F44A 3BJYA 9ICHA 5KFEA 2DGZA 2KVCA 1S0MA 2KIVA 3Q8MA 4P4MA 9ICFA 5F9NA 5ALMA 1JALA 4IRKA 4DO9A 3V6HA 2EDUA 2XGQA 3T79A 3RB3A 4NLKA 4RNOA 5J0OA 3HJEA 3SV3A 5ALOA 4QWAA 5ALQA 2GWSA 2AQ0A 2BZFA 3DV9A 3M1YA 3TI0A 3IP4B 4F72A 4KITB 2J6UA 4P0QB 2L5YA 4ECUA 2GH1A 3EUB2 1HJPA 7ICSA 2FDRA 2HBMA 4JB3A 1JRPA 5KFPA 1KFTA 2IMWP 3UXNA 3CNHA 9ICBA 1NJXA 1XS9D 2F77X 2PFOA 2IOFK 3NS1A 4F4KA 1PK1A 4LZDA 5CA7A 4AYBF 3OJUA 3T5KA 1NOMA 4DCCA 4RQ6A 2E8PA 1PK1B 3U26A 4ECTA 5KFBA 2OXOA 3QEAZ 4KLFA 2LYBA 4C8KA 4Z6DA 4BXOA 2W03A 1RYSA 1SGGA 2CXYA 3PR5B 4BXOB 2NRVA 5BOMA 1Q46A 4I29A 1ZQOA 1JXLA 3UMBA 1NZPA 2JHDA 3HPOA 1RZTA 4KLDA 2CN1A 3EWAA 4FS2A 2NRZA 3D2SA 1RDFA 5J2KA 1COKA 4KLJA 1ZD4A 4RQ5A 1NK7A 3JPOA 4DFMA 2YX8A 2GOLA 1D8LA 2PXIA 2KEYA 2NRWA 4Y2QA 2EANA 4DOCA 2ASDA 1KEJA 4KX5A 1F5SA 5KG0A 1DGJA 4Q8EA 1NKCA 3PX6A 2HMXA 4Y2PA 2KKVA 5KFQA 2ZJ8A 1Q8KA 3LVVA 2ATLA 4OO1J 4KLOA 4RQ2A 2HVIA 2OHFA 8ICOA 4F91B 4F4XA 3RRGA 3G6XA 1IV8A 4B9LA 4M9HA 3RB0A 2W7OA 5AKJA 5HNKA 2K60A 1X9SA 1UA1A 2R8KA 1Z4OA 5DLGA 3PMLA 3QXGA 2IOFA 4IR9A 1ZQPA 2KZ3A 2B0CA 2KFNA 4NXZA 5IIMA 3PSTA 3M9OB 1T8EA 2DF4B 3PV8A 2K4EA 2HDOA 3MFHA 4IRDA 4RPXA 5KG1A 3BQTA 5ALTA 3G6VA 4KLTA 1N5XA 4UB5A 1SL0A 2I5HA 2FPMA 2FLLA 2J6TA 5JU5A 3TANA 2XICA 2H5XA 5KG2A 2HBLA 5AK5A 5DBCA 5J2HA 2CPRA 2RDIA 3GU3A 3AEVA 4UAUA 2JV3A 4UAWA 4DSFA 1ZD5A 4EZ6A 3KHRA 3UQ0A 4EBDA 5DBBA 1ZD2P 2HHSA 1KBUA 5KFFA 4B9TA 1QH9A 3S6JA 1HUOA 4DL3A 2BHNA 5KFKA 4JV2A 4YR2A 4TQRA 2ZJAA 1NK5A 4M47A 4OJLA 4B9SA 3HX0A 3IM1A 3H8MA 4YMNA 4YD2A 1ZETA 4KN7A 3WKCA 1TKDA 4ED0A 4UARA 3N7PD 2DBYA 5DQIA 8ICPA 1LV5A 5ALGA 3AUOA 3THVA 5AM1A 3JPSA 2XIDA 4UQGA 4DFJA 3D2NA 1ZQVA 3NUQA 2W9CA 3PO5A 5TZVA 4BJQA 1X9XA 5KT6A 3I76A 1NKBA 3QU5A 2PFNA 2E3TA 3ZDDA 2W9CB 3M9MB 3UPQA 3C29A 4O3PA 3SQIA 5KL1B 3D2QA 3RAQA 5ALLA 2WB1C 4DSIA 1OW5A 3MDCA 1KDHA 4IR1A 5EOZA 5F9LA 5GTHU 5CWRA 5KFCA 3RBDA 2BKEA 2LHTA 1CUKA 5AKHA 1LKYA 4NLGA 2NO4A 4GIBA 4R66A 1IXRA 3NVVA 4XUSA 2HOFA 3BS7A 4J9RA 1LKYB 3KD3A 4F92B 4QWDA 4RUCA 4Q43A 5JUMA 4PL1A 3WK4A 8ICKA 1NK8A 4P2HA 3GV8B 1L5UA 3PZPA 3ETRA 4QZEA 4OJPA 4BDPA 3FDSA 1D9DA 2ES6A 3HKZC 1ED1A 1KN5A 4DS5A 4BWJA 5KT4A 7ICNA 2EAMA 2G09A 3H8JA 1URJA 1UA0A 2I6XA 4MF2A 4OJ5A 2HHTA 5KFTA 2YTUA 5CHGA 2W9BA 3QE9Y 4MFCA 4US9A 1A6SA 4DL2A 3PSFA 4J9OA 2W9BB 2YMPA 2ZTDA 4IS7A 1ZQ1C 3NGDA 2HOIA 5IILA 3WKDA 2FMPA 2HCFA 7ICRA 3V6KA 2KZZA 3BQ0A 3E0FA 5KNIA 4F4WA 3SENA 1TK5A 5DKWA 1NK6A 3MR6A 3RJFA 4DL7A 2Q4TA 3JPTA 3GIMA 5KFGA 1ZQZA 5J2FA 3H40A 2AQ4A 2KG5A 2WHEA 3ZDAA 5EWEA 5H2FU 4B9MA 2H3VA 4YD1A 4I27A 1X6IA 2YN4A 1K1QA 4PJ0U 8ICXA 3MBYA 2OCEA 8ICCA 1NNLA 1ZQYA 1TAMA 3WK7A 4EBEA 1ZQNA 4Q44A 2R8GA 3WKAA 1Q3UA 2DFLA 1QCKA 4FBUA 3GIIA 2VANA 3WU2U 2IBKA 3TADC 2YB4A 5AICA 3QU7A 5AM4A 3IV6A 2Y0SC 2ZJ5A 9ICAA 4DQRA 3UMCA 3CYMA 4QZCA 1DGSA 1SWWA 4B9UA 1PUZA 4CF5A 3BDPA 3RFAA 2F2AB 4C8OA 5AHXA 2LYHA 4PHAA 2KE7A 3Q8SB 4ECWA 5J0SA 3T5HA 4O5CA 3IG8A 4O3SA 2EZXA 3UM9A 4I2JA 5HR6A 1M6YA 5ALIA 2KKPA 3JPPA 2W9MA 2WF9A 1L3SA 3ZI4A 1QSSA 2AXTU 4J9PA 8ICLA 9ICCA 2OYYA 3PSPA 1RPLA 4TUSA 4O3OA 2DKZA 1XNSA 4YR0A 5IIJA 2E8NA 3T3FA 5CP2A 4TUPA 5F3XB 1YZ6A 2DKXA 4DL4A 5KAIU 2H3ZA 3GZFA 1B0XA 2W55A 3V7JA 5KG3A 2VA8A 4O5KA 5AKZA 2HBJA 8ICMA 3NTUA 2MUTA 2G5IB 5G5GA 5ALXA 1S5LU 4M9GA 4AP9A 3AQEA 4CNQA 2PKEA 4HAIA 8ICSA 2MUTB 5ALEA 4F5QA 9ICNA 5ALHA 3TADA 4QJFB 1QSYA 3FAHA 3MDAA 4M9JA 1ZQJA 4DSKA 3Q8LA 1BPEA 3AM9A 4EENA 2P66A 4B9VA 4RQNA 1DK2A 2Y1JA 5IIOA 3ISCA 4R65A 2HW3A 2IA6A 4F5RA 5KAFU 4EEKA 8ICTA 1YT3A 2ZTCA 2WB1F 4DOBA 1JX4A 5EE0A 4QZGA 5ALRA 3PR4A 4ELUA 4QWEA 4C4SA 2JGAA 1VJ5A 1T3NA 2RQ5A 2ZTEA 2RLTA 2KJ8A 3SMVA 1XWLA 4MF8A 4DQSA 2J6SA 1ZQCA 4R63A 3HRDD 4NL9C 3RRHA 2QB0A 2HHWA 4QZ8A 2BQUA 2PFQA 2QB0B 2VA3A 1PVRA 4QW9A
chains in the Genus database with same CATH topology
2DUYA 4UB8U 3WU2U 4PJ0U 5KAIU 4IL6U 2AXTU 5B66U 3A0BU 5GTIU 3A0HU 3KZIU 5E79U 5GTHU 5KAFU 1S5LU 5B5EU 5H2FU 5TISU 4UB6U
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DUY A;  4UB8 U;  3WU2 U;  4PJ0 U;  5KAI U;  4IL6 U;  2AXT U;  5B66 U;  3A0B U;  5GTI U;  3A0H U;  3KZI U;  5E79 U;  5GTH U;  5KAF U;  1S5L U;  5B5E U;  5H2F U;  5TIS U;  4UB6 U; 
#chains in the Genus database with same CATH topology
 4RU9 A;  1ZJM A;  2W3S A;  1L8L A;  2LBO A;  5E79 U;  2E1F A;  2XCA A;  2ISO A;  4JV1 A;  2NRT A;  8ICQ A;  5B5E U;  5AI8 A;  4RNM A;  3L3F X;  5J2I A;  2KHQ A;  5CR0 A;  5DDM A;  3MR5 A;  4Y2J A;  4JK1 A;  2W04 A;  5J0X A;  3RJJ A;  1UT8 A;  3GIK A;  1ZQI A;  2F44 A;  2KVS A;  4J03 A;  5J0Q A;  4PGY A;  3SYZ A;  4QNL A;  3RBE A;  2PMZ C;  2FJ6 A;  2FLP A;  4PH5 A;  4OJO A;  4Q8F A;  2KHV A;  4DL5 A;  4IRC A;  5AKL A;  4DF4 A;  4NWI A;  4I2I A;  8ICW A;  4UBC A;  5KG6 A;  3EYZ A;  2K89 A;  4KLU A;  2NRX A;  1TVA A;  2IHN A;  3IG5 A;  2KMD A;  5TIS U;  4ED6 A;  4ED1 A;  2ZIW A;  3AU6 A;  4QIW F;  3GDX A;  3C23 A;  1SKR A;  4RQM A;  3A0B U;  3KHH A;  3RTV A;  2DPJ A;  3RF9 A;  2YQE A;  3SAF A;  4MEX A;  1Z1V A;  1T4G A;  3QU9 A;  3C2K A;  2AHO B;  3B0Y A;  2FLN A;  1RM6 C;  3MAB A;  1MSW D;  2ASL A;  4I2A A;  3BS5 A;  4LZG A;  3ZDB A;  3RH4 A;  2LM4 A;  4Z6E A;  4QWB A;  4NL9 A;  5EE9 A;  1IM4 A;  3BS5 B;  4KMO B;  5B66 U;  4DOA A;  1TFR A;  5EE1 A;  8ICH A;  3JPN A;  5DDY A;  2KN7 A;  4XQ8 A;  1FEZ A;  3WKE A;  3JPQ A;  1UQV A;  3KKA C;  3V6J A;  4QZA A;  4O3R A;  5C0Y A;  3GV7 B;  3T5J A;  1PZN A;  3F2C A;  1NI3 A;  4KLI A;  1L7O A;  1SXD A;  4I2F A;  4KLG A;  4B6J A;  7ICE A;  1XSP A;  2K4H A;  3E2E A;  2WF5 A;  2VJ4 A;  4K4G A;  3QYP A;  1ZOL A;  1MQ2 A;  2BPC A;  3M6K A;  1N60 A;  1WCN A;  2LPE A;  1YZ7 A;  4C4R A;  4EX7 A;  4G3I A;  4DF8 A;  2LI6 A;  5KFN A;  4TQS A;  5DB7 A;  4BX9 C;  9ICI A;  5KT5 A;  1X6J A;  4M2Y A;  3C2M A;  4QZI A;  1COO A;  1SV4 A;  1XC9 A;  1ZQW A;  5A0L A;  1JMS A;  5DQH A;  1JN3 A;  5J0T A;  4FS1 A;  2XGP A;  2BR0 A;  2KD1 A;  5HHI A;  4DQP A;  2BCV A;  3H0M B;  1FFU A;  3H8S A;  1ZQA A;  2P6R A;  2LKY A;  3PMN A;  2KZM A;  3PX0 A;  3RR7 A;  4ECR A;  4Y2Y A;  4CE6 A;  2B6G A;  1S97 A;  4M0A A;  1Q3V A;  2WF7 A;  4NLN A;  4OD0 A;  2KOB A;  4NV0 A;  1UHU A;  2ZUC A;  4NM1 A;  2G07 A;  2HVH A;  2V4R A;  2EZY A;  2OH2 A;  1TK0 A;  2WTF A;  2UVU A;  1NZB A;  1DK3 A;  1RG6 A;  4K4I A;  3F5E A;  5AI6 A;  2W43 A;  1J97 A;  4FFD A;  1Z19 A;  1MC8 A;  1V97 A;  3KKA A;  4GXJ A;  5L1I A;  3MGV A;  3V7K A;  5J2E A;  4F3O A;  1RQN A;  3AQF A;  1ECW A;  3R9K A;  2AGQ A;  3EZ5 A;  3G6Y A;  1KL9 A;  4FZM A;  4EX6 A;  2DPI A;  3AL0 B;  4YMO A;  3ZDC A;  3EPI A;  4DLE A;  1TE2 A;  1ZQT A;  1XO0 A;  3E58 A;  7ICQ A;  3OJS A;  1XO1 A;  2DQN B;  9ICT A;  3H7I A;  1KLN A;  1V85 A;  2G5H B;  3FYH A;  2RRD A;  4QZ9 A;  1Z3E B;  2MA1 A;  3OHA A;  5KG7 A;  1AQ6 A;  4X5V A;  3WK9 A;  4DFK A;  3QNM A;  1S0V A;  4NJ8 A;  1BPX A;  4IQU A;  1KW4 A;  2WF6 A;  5ALP A;  3KOO A;  2M0N A;  3NVY A;  1NK4 A;  7ICP A;  4JWM A;  4EEL A;  1S8O A;  3KZX A;  4QZF A;  2KIW A;  3LYS A;  1VDV A;  2OWO A;  4UAT A;  5AI4 A;  3KTQ A;  3F5A A;  1QQ7 A;  5KFO A;  3OTQ A;  4XRH A;  9ICE A;  4KN4 A;  2Z7J A;  4MFF A;  3IDW A;  4K4H A;  3LDA A;  1O03 A;  4G9B A;  4ICA A;  4EYH B;  3B9J A;  2ZUD A;  5KT3 A;  2BQ3 A;  5J0U A;  1D9F A;  4PGQ A;  3UQ2 A;  5AKI A;  1ZQL A;  5AKE A;  1MQ3 A;  1UT5 A;  2FE9 A;  2IHM A;  4UAZ A;  1N56 A;  2UVV A;  5KFS A;  4C8L A;  3C2L A;  3GQC A;  2P6U A;  5T14 A;  3GIJ A;  4P0P A;  1N2X A;  2KJ9 A;  3PY8 A;  4O9M A;  1NJZ A;  3KBB A;  3O0F A;  5CB1 A;  4P0P B;  4DSL A;  1JI7 A;  3QZ7 A;  2PI5 A;  2JR5 A;  3QUQ A;  3RB6 A;  2WAQ C;  1C7Y A;  2JZB A;  7ICG A;  2PMZ F;  1ZQK A;  5AM3 A;  1ZYQ A;  2HHV A;  2W8K A;  1A76 A;  5DB9 A;  4EZ9 A;  4M9N A;  2QKQ A;  3QUB A;  9ICQ A;  2F8K A;  4C7Z A;  4UAY A;  1KFS A;  1L7M A;  4CRX A;  3CP8 A;  1L7P A;  1KRP A;  4B9N A;  8ICR A;  5J2J A;  5CRX A;  5KL8 B;  3ORY A;  1ZQQ A;  1HIW A;  3C5F A;  1CI4 A;  2Y9T A;  2DUY A;  4C7Y A;  5HR7 A;  1ZJN A;  2K8A A;  4UAV A;  5AKX A;  4CCH A;  4BGD A;  4CGZ A;  1T3Q A;  4YCX A;  4U7C A;  1TAQ A;  1UCV A;  1BPZ A;  2KNJ A;  7ICF A;  1FO4 A;  4UB6 U;  3Q8K A;  3OHB A;  3WKB A;  4F4Y A;  2G08 A;  4IQV A;  3OPX A;  4YG2 A;  3IN5 A;  4HYK A;  1A0P A;  4DEZ A;  1FIQ A;  3RR8 A;  2B21 A;  1OXJ A;  1BPB A;  2LM1 A;  1RQL A;  4RPZ A;  3M7D A;  4J9K A;  1RYU A;  5AIA A;  1LVH A;  1MN8 A;  3RJE A;  1WG8 A;  2AU0 A;  2YY6 A;  9ICS A;  1U4B A;  4ECY A;  3H4B A;  4UB2 A;  5KT7 A;  4KLQ A;  4PGX A;  4GC7 A;  5J2D A;  5J0Y A;  2AGO A;  3SAH A;  2QB1 A;  4Y2T A;  4I2H A;  3TAC B;  4DWI A;  2F8L A;  2JEG A;  2C2D A;  4DLG A;  1KSP A;  2V9W A;  2E8M A;  9ICK A;  4EEY A;  8ICA A;  3V7L A;  2D8C A;  3BQ2 A;  3OGU A;  1S10 A;  3ONN A;  5L9X A;  3TAQ A;  4YQW A;  2XO7 A;  3BQ7 A;  1SL1 A;  1QQ5 A;  4J9L A;  3JPR A;  3UXO A;  1UPH A;  2BGW A;  1ZQX A;  4PZN A;  2RHF A;  8ICJ A;  2H3Q A;  5JRT A;  4PPX A;  4QZD A;  9ICO A;  3D6J A;  1SIJ A;  2JH7 A;  4Z6F A;  2R8J A;  4FZL A;  4RQ0 A;  3NVW A;  2HOQ A;  3PW0 A;  4OCZ A;  4Y2R A;  1HEK A;  5EWG A;  8ICG A;  2BQR A;  4USA A;  3PW7 A;  2KIC A;  2K8C B;  9ICP A;  3LWM A;  2QAR A;  2C2R A;  5III A;  1ZQF A;  5EWF A;  3MR2 A;  1ZQH A;  4NM2 A;  4ED3 A;  4LJX A;  2QAR B;  5L1K A;  2KSO A;  3K1R B;  7ICH A;  1GO3 F;  4P4O A;  1P7D A;  2A19 A;  1F0M A;  2ZXH A;  3RB4 A;  1L3V A;  2KSO B;  3HT3 A;  1RYR A;  2F76 X;  2CRX A;  9ICR A;  1H38 A;  4C0Z A;  3C5G A;  4GFJ A;  5DGB A;  3VC8 A;  7ICO A;  2WF8 A;  4F50 A;  3KFU F;  2XVT A;  4JUZ A;  1S0N A;  4PHP A;  3QEB Z;  2K4P A;  1PK3 A;  4CF3 A;  4NLC A;  4RQ3 A;  2P35 A;  2F1J A;  1RXW A;  1S76 D;  3RH6 A;  1Y88 A;  8ICB A;  1Z1B A;  4NLZ A;  4DL6 A;  2F1I A;  3NAS A;  4Y2U A;  2JH1 A;  1U48 A;  5AKG A;  4ELT A;  3WK8 A;  4F2R A;  1SZH A;  4FE3 A;  4R64 A;  4NLB A;  2ESE A;  5ALK A;  3GIL A;  2W3R A;  3QU4 A;  5J0R A;  1MA7 A;  2JRZ A;  2VA2 A;  3AU2 A;  4TUR A;  3LWL A;  3HP6 A;  5AK4 A;  2E8O A;  7ICL A;  3KHL A;  1DXS A;  2K4I A;  4C8M A;  1RXV A;  3K1Z A;  2AH5 A;  3CRX A;  5HML A;  1N5W A;  1QSL A;  4CDG A;  2XCP A;  1B43 A;  7ICU A;  5AI5 A;  5DGA A;  4C8N A;  1BPY A;  3LVW A;  3H8W A;  3WK6 A;  4O3Q A;  1NK0 A;  3QUT A;  2EQY A;  3HKZ F;  2K8B B;  1D8Y A;  4C80 A;  3PNC A;  8ICI A;  2WAQ F;  5KFV A;  5CEH A;  4P0Q A;  4FZN A;  2OM6 A;  4RZR A;  3RAX A;  3J81 j;  3N7R C;  1C20 A;  3H4D A;  3A0H U;  1X2I A;  3L5K A;  1ZD3 A;  2EZZ A;  1WYG A;  4M9L A;  4E0D A;  3V72 A;  3BZC A;  3H0L B;  1DRG A;  5AM5 A;  4PHD A;  2OEH A;  3NVZ A;  2RDJ A;  2HSZ A;  2LYA A;  4GXI A;  1EXN A;  4RPY A;  9ICV A;  2ODG A;  2NO5 A;  4MFA A;  2YML A;  1JXE A;  1IIP A;  2KP7 A;  1N61 A;  5KFW A;  2ZIW B;  3SV4 A;  4Q45 A;  1K1S A;  1U47 A;  1ZQM A;  3NRZ A;  1NJW A;  2QLT A;  4IC9 A;  3ISD A;  1IG6 A;  4KLL A;  5HP4 A;  5HHH A;  4ECQ A;  5KFM A;  4J9N A;  2XI9 A;  4GLX A;  2BCS A;  2BDP A;  4R8U A;  3Q8P B;  3ED5 A;  1NKE A;  2LMR A;  2HI0 A;  5AI9 A;  2N1R A;  1WUD A;  5DG8 A;  4UBB A;  3UXP A;  5DBA A;  8ICE A;  3EPG A;  1X9M A;  4R8U B;  5AIB A;  4DFP A;  3RH5 A;  3MGH A;  4GXK A;  2JXJ A;  1BGX T;  3SEI A;  4RNN A;  3Q8Q B;  3K75 D;  1N63 A;  5J2C A;  4FBT A;  3AMZ A;  2EAP A;  2H3I A;  1KQQ A;  3ISB A;  5ALZ A;  1VLB A;  2UVW A;  4J9M A;  4EYI B;  2BPG A;  1S0O A;  3NRW A;  3TFS A;  1ZRN A;  2KJ5 A;  1KTQ A;  3EW9 A;  5L1M A;  5BOL A;  3I1Y A;  1J2N A;  4QWC A;  3HW8 A;  4QZH A;  4M04 A;  2G0A A;  4YFK A;  1X66 A;  3TAP A;  4KLM A;  5J2G A;  2Y1I A;  1SB3 C;  2Y0S F;  4ACO A;  1U49 A;  2PFP A;  3FM9 A;  4EBC A;  3TAR A;  4F5P A;  2FPL A;  3M6Z A;  4YMM A;  5ALF A;  2JEJ A;  4IQT A;  3SI8 A;  4UB3 A;  1ZQE A;  5ALV A;  5BPC A;  4JMU A;  5J0W A;  4OJ6 A;  2UVR A;  1L7N A;  2MRL A;  2I9G A;  5KFR A;  7ICK A;  3F53 A;  4YR3 A;  3GFK B;  1N48 A;  3I28 A;  2A1J A;  1KKX A;  5DG7 A;  1CRX A;  1BPD A;  3SZ2 A;  2A1J B;  1T94 A;  1ZQG A;  4DSE A;  2GO7 A;  2KV2 A;  2FMS A;  4F2S A;  1B22 A;  5ALN A;  4ELV A;  2VKQ A;  1X9W A;  5KFX A;  4F71 A;  2NV3 A;  3BZK A;  5CJ7 A;  4DQQ A;  1V9P A;  1SWV A;  4MEY A;  1WCL A;  3MR3 A;  5DLF A;  1SZP A;  1TV9 A;  4DQI A;  5AI0 A;  3CW2 C;  4I2E A;  2G06 A;  2ZG6 A;  1K5O A;  3OSN A;  4F8R A;  5AK6 A;  8ICZ A;  1SKW A;  3ZD8 A;  2W9A A;  4NY8 A;  3MFI A;  4KLE A;  3PVX A;  2FPK A;  3B0X A;  2Q0Z X;  2JEF A;  3IHQ B;  4P4P A;  3LK9 A;  5KTQ A;  3DEE A;  2PI4 A;  1LB2 B;  1XU4 A;  2ALZ A;  1L3T A;  2YMQ A;  7ICI A;  1U9L A;  4WJ3 B;  3PW5 A;  2R8I A;  8ICY A;  4LVS A;  2GLE A;  4MHV A;  4DS4 A;  5J29 A;  2HHX A;  3SD7 A;  2HHU A;  5DB6 A;  4RUA A;  3SR6 A;  1Z00 A;  2W7P A;  4F93 B;  5KFA A;  2VIX A;  2HHQ A;  1A77 A;  4ZOH C;  4KLS A;  4ECX A;  1Z00 B;  5KFH A;  4O3N A;  1CEZ A;  4GC6 A;  5C5J A;  3HWT A;  3C1Y A;  2W54 A;  2R8H A;  5J8Y C;  4ED8 A;  2W8L A;  1PVP A;  4YXJ A;  1QLN A;  5J2B A;  3PSI A;  3ETL A;  1SV0 C;  2NYV A;  3K4G A;  5KG4 A;  2I1Q A;  2IOH A;  9ICL A;  1OUQ A;  2EH9 A;  3RJK A;  4RQ7 A;  5KFD A;  4XA5 A;  2YMM A;  5L1L A;  4ECS A;  1ZQS A;  4KLH A;  2DWQ A;  3MC1 A;  4J9Q A;  5G5H A;  4UB8 U;  7ICJ A;  3KHG A;  3PO4 A;  2MAX A;  4RT3 A;  4UB4 A;  5GTI U;  5L1J A;  1QTM A;  3TQ1 A;  3N97 B;  4US8 A;  3SAG A;  2HBK A;  5K4L A;  5DB8 A;  4M6W A;  2F3N A;  4Z6C A;  4M6W B;  1L8O A;  2JZB B;  3TKA A;  3C1Z A;  1ZQB A;  5AK3 A;  2FMQ A;  3RJH A;  5J2A A;  4RQ8 A;  4I2D A;  5IIN A;  8ICN A;  9ICW A;  1XSN A;  4I2C A;  4KX3 A;  2WFA A;  4AYB C;  3IRU A;  2BCU A;  3PW4 A;  4DFD A;  1KFD A;  9ICG A;  2E5S A;  4QW8 A;  1X42 A;  5KFZ A;  5HMM A;  5ALU A;  3Q8R B;  1B4F A;  4YXM A;  2BPF A;  4I2B A;  5J8Y A;  3PW2 A;  4QIW C;  5KFL A;  2XY7 A;  2ZIX A;  2ZXI A;  2C28 A;  2ISP A;  4DSJ A;  2BDU A;  4KTQ A;  1NK9 A;  1SV0 A;  4YVZ A;  4F5O A;  2ZIX B;  1JUD A;  2JMG A;  5ALW A;  5IIK A;  8ICV A;  1SKS A;  4FO6 A;  4TUQ A;  3M8R A;  2AJQ A;  5ALY A;  5J0P A;  4U6P A;  5KFI A;  3DDH A;  5D46 A;  1L6N A;  4YN4 A;  8ICF A;  3KZI U;  2Y9U A;  1TK8 A;  4QZB A;  5ALJ A;  3M8S A;  2XC9 A;  4IQW A;  2XY5 A;  1L3U A;  5JTI A;  4A8E A;  3ZDE A;  1S77 D;  4I2G A;  3GV5 B;  2BCQ A;  4JV0 A;  4PHE A;  1X40 A;  2C22 A;  1J2M A;  4Y2V A;  3F2D A;  5D4B A;  3M9N B;  9ICM A;  4KMU A;  2M9N A;  3VCB A;  4UAS A;  1JRO A;  1ZRM A;  5AM2 A;  3ICX A;  4PZO A;  4ED2 A;  4RT2 A;  1XSL A;  1WWU A;  4IL6 U;  2F1H A;  5AKY A;  8ICU A;  3BQ1 A;  2BCR A;  2YB1 A;  2DL0 A;  2AGP A;  3H0R B;  5EE3 A;  4I28 A;  2VJ5 A;  1ZQR A;  3WK5 A;  5KT2 A;  4UB1 A;  4ED7 A;  3C28 A;  2D6F C;  2JEI A;  1ZQD A;  2O6K A;  3QZ8 A;  4F5N A;  4PL2 A;  1V38 A;  4BUG A;  5KFU A;  5AKK A;  3TFR A;  3N4M B;  2A1A A;  5DQG A;  1HUZ A;  2KK0 A;  1D8B A;  3HIL A;  5KG5 A;  1N62 A;  1Z4N A;  2ZIU A;  2V4Q A;  5FP0 A;  3OSP A;  3ALR A;  1TAU A;  3N7S C;  3N28 A;  3C21 A;  2ZIU B;  2KTQ A;  9ICX A;  1U45 A;  4J9S A;  1NJY A;  3QX7 A;  2H3F A;  1ZXI A;  4RQ1 A;  2ASJ A;  1ZQU A;  2R18 A;  4YP3 A;  3L4P A;  7ICM A;  5ALS A;  4O5E A;  2KFZ A;  2ZIV A;  1JIH A;  5ALD A;  3PX4 A;  3QUC A;  4ECV A;  1DOQ A;  2ZUB A;  2E1E A;  4UW9 A;  2D3D A;  4JWN A;  5D49 A;  9ICU A;  2ZIV B;  1O08 A;  1QQ6 A;  4C4T A;  1SL2 A;  3MGI A;  2A3V A;  2C2E A;  4CF4 A;  1PVQ A;  5KFY A;  3T5L A;  4RQ4 A;  1BNP A;  1ARO P;  2FI1 A;  1S9F A;  3UMG A;  2XY6 A;  3ZD9 A;  1WWV A;  3RJG A;  4Y2S A;  4BWM A;  5DG9 A;  1FFV A;  5AM0 A;  4F4Z A;  2MSN A;  3QU2 A;  2MU2 A;  1BNO A;  3F2B A;  2W11 A;  4ZH4 A;  4O3M A;  1SXE A;  3FC4 A;  7ICV A;  2RP5 A;  1BVS A;  2EAO A;  3RJI A;  7ICT A;  5KFJ A;  9ICJ A;  4Y2X A;  1T7P A;  3AN1 A;  4ECZ A;  4O0I A;  1F44 A;  3BJY A;  9ICH A;  5KFE A;  2DGZ A;  2KVC A;  1S0M A;  2KIV A;  3Q8M A;  4P4M A;  9ICF A;  5F9N A;  5ALM A;  1JAL A;  4IRK A;  4DO9 A;  3V6H A;  2EDU A;  2XGQ A;  3T79 A;  3RB3 A;  4NLK A;  4RNO A;  5J0O A;  3HJE A;  3SV3 A;  5ALO A;  4QWA A;  5ALQ A;  2GWS A;  2AQ0 A;  2BZF A;  3DV9 A;  3M1Y A;  3TI0 A;  3IP4 B;  4F72 A;  4KIT B;  2J6U A;  4P0Q B;  2L5Y A;  4ECU A;  2GH1 A;  3EUB 2;  1HJP A;  7ICS A;  2FDR A;  2HBM A;  4JB3 A;  1JRP A;  5KFP A;  1KFT A;  2IMW P;  3UXN A;  3CNH A;  9ICB A;  1NJX A;  1XS9 D;  2F77 X;  2PFO A;  2IOF K;  3NS1 A;  4F4K A;  1PK1 A;  4LZD A;  5CA7 A;  4AYB F;  3OJU A;  3T5K A;  1NOM A;  4DCC A;  4RQ6 A;  2E8P A;  1PK1 B;  3U26 A;  4ECT A;  5KFB A;  2OXO A;  3QEA Z;  4KLF A;  2LYB A;  4C8K A;  4Z6D A;  4BXO A;  2W03 A;  1RYS A;  1SGG A;  2CXY A;  3PR5 B;  4BXO B;  2NRV A;  5BOM A;  1Q46 A;  4I29 A;  1ZQO A;  1JXL A;  3UMB A;  1NZP A;  2JHD A;  3HPO A;  1RZT A;  4KLD A;  2CN1 A;  3EWA A;  4FS2 A;  2NRZ A;  3D2S A;  1RDF A;  5J2K A;  1COK A;  4KLJ A;  1ZD4 A;  4RQ5 A;  1NK7 A;  3JPO A;  4DFM A;  2YX8 A;  2GOL A;  1D8L A;  2PXI A;  2KEY A;  2NRW A;  4Y2Q A;  2EAN A;  4DOC A;  2ASD A;  1KEJ A;  4KX5 A;  1F5S A;  5KG0 A;  1DGJ A;  4Q8E A;  1NKC A;  3PX6 A;  2HMX A;  4Y2P A;  2KKV A;  5KFQ A;  2ZJ8 A;  1Q8K A;  3LVV A;  2ATL A;  4OO1 J;  4KLO A;  4RQ2 A;  2HVI A;  2OHF A;  8ICO A;  4F91 B;  4F4X A;  3RRG A;  3G6X A;  1IV8 A;  4B9L A;  4M9H A;  3RB0 A;  2W7O A;  5AKJ A;  5HNK A;  2K60 A;  1X9S A;  1UA1 A;  2R8K A;  1Z4O A;  5DLG A;  3PML A;  3QXG A;  2IOF A;  4IR9 A;  1ZQP A;  2KZ3 A;  2B0C A;  2KFN A;  4NXZ A;  5IIM A;  3PST A;  3M9O B;  1T8E A;  2DF4 B;  3PV8 A;  2K4E A;  2HDO A;  3MFH A;  4IRD A;  4RPX A;  5KG1 A;  3BQT A;  5ALT A;  3G6V A;  4KLT A;  1N5X A;  4UB5 A;  1SL0 A;  2I5H A;  2FPM A;  2FLL A;  2J6T A;  5JU5 A;  3TAN A;  2XIC A;  2H5X A;  5KG2 A;  2HBL A;  5AK5 A;  5DBC A;  5J2H A;  2CPR A;  2RDI A;  3GU3 A;  3AEV A;  4UAU A;  2JV3 A;  4UAW A;  4DSF A;  1ZD5 A;  4EZ6 A;  3KHR A;  3UQ0 A;  4EBD A;  5DBB A;  1ZD2 P;  2HHS A;  1KBU A;  5KFF A;  4B9T A;  1QH9 A;  3S6J A;  1HUO A;  4DL3 A;  2BHN A;  5KFK A;  4JV2 A;  4YR2 A;  4TQR A;  2ZJA A;  1NK5 A;  4M47 A;  4OJL A;  4B9S A;  3HX0 A;  3IM1 A;  3H8M A;  4YMN A;  4YD2 A;  1ZET A;  4KN7 A;  3WKC A;  1TKD A;  4ED0 A;  4UAR A;  3N7P D;  2DBY A;  5DQI A;  8ICP A;  1LV5 A;  5ALG A;  3AUO A;  3THV A;  5AM1 A;  3JPS A;  2XID A;  4UQG A;  4DFJ A;  3D2N A;  1ZQV A;  3NUQ A;  2W9C A;  3PO5 A;  5TZV A;  4BJQ A;  1X9X A;  5KT6 A;  3I76 A;  1NKB A;  3QU5 A;  2PFN A;  2E3T A;  3ZDD A;  2W9C B;  3M9M B;  3UPQ A;  3C29 A;  4O3P A;  3SQI A;  5KL1 B;  3D2Q A;  3RAQ A;  5ALL A;  2WB1 C;  4DSI A;  1OW5 A;  3MDC A;  1KDH A;  4IR1 A;  5EOZ A;  5F9L A;  5GTH U;  5CWR A;  5KFC A;  3RBD A;  2BKE A;  2LHT A;  1CUK A;  5AKH A;  1LKY A;  4NLG A;  2NO4 A;  4GIB A;  4R66 A;  1IXR A;  3NVV A;  4XUS A;  2HOF A;  3BS7 A;  4J9R A;  1LKY B;  3KD3 A;  4F92 B;  4QWD A;  4RUC A;  4Q43 A;  5JUM A;  4PL1 A;  3WK4 A;  8ICK A;  1NK8 A;  4P2H A;  3GV8 B;  1L5U A;  3PZP A;  3ETR A;  4QZE A;  4OJP A;  4BDP A;  3FDS A;  1D9D A;  2ES6 A;  3HKZ C;  1ED1 A;  1KN5 A;  4DS5 A;  4BWJ A;  5KT4 A;  7ICN A;  2EAM A;  2G09 A;  3H8J A;  1URJ A;  1UA0 A;  2I6X A;  4MF2 A;  4OJ5 A;  2HHT A;  5KFT A;  2YTU A;  5CHG A;  2W9B A;  3QE9 Y;  4MFC A;  4US9 A;  1A6S A;  4DL2 A;  3PSF A;  4J9O A;  2W9B B;  2YMP A;  2ZTD A;  4IS7 A;  1ZQ1 C;  3NGD A;  2HOI A;  5IIL A;  3WKD A;  2FMP A;  2HCF A;  7ICR A;  3V6K A;  2KZZ A;  3BQ0 A;  3E0F A;  5KNI A;  4F4W A;  3SEN A;  1TK5 A;  5DKW A;  1NK6 A;  3MR6 A;  3RJF A;  4DL7 A;  2Q4T A;  3JPT A;  3GIM A;  5KFG A;  1ZQZ A;  5J2F A;  3H40 A;  2AQ4 A;  2KG5 A;  2WHE A;  3ZDA A;  5EWE A;  5H2F U;  4B9M A;  2H3V A;  4YD1 A;  4I27 A;  1X6I A;  2YN4 A;  1K1Q A;  4PJ0 U;  8ICX A;  3MBY A;  2OCE A;  8ICC A;  1NNL A;  1ZQY A;  1TAM A;  3WK7 A;  4EBE A;  1ZQN A;  4Q44 A;  2R8G A;  3WKA A;  1Q3U A;  2DFL A;  1QCK A;  4FBU A;  3GII A;  2VAN A;  3WU2 U;  2IBK A;  3TAD C;  2YB4 A;  5AIC A;  3QU7 A;  5AM4 A;  3IV6 A;  2Y0S C;  2ZJ5 A;  9ICA A;  4DQR A;  3UMC A;  3CYM A;  4QZC A;  1DGS A;  1SWW A;  4B9U A;  1PUZ A;  4CF5 A;  3BDP A;  3RFA A;  2F2A B;  4C8O A;  5AHX A;  2LYH A;  4PHA A;  2KE7 A;  3Q8S B;  4ECW A;  5J0S A;  3T5H A;  4O5C A;  3IG8 A;  4O3S A;  2EZX A;  3UM9 A;  4I2J A;  5HR6 A;  1M6Y A;  5ALI A;  2KKP A;  3JPP A;  2W9M A;  2WF9 A;  1L3S A;  3ZI4 A;  1QSS A;  2AXT U;  4J9P A;  8ICL A;  9ICC A;  2OYY A;  3PSP A;  1RPL A;  4TUS A;  4O3O A;  2DKZ A;  1XNS A;  4YR0 A;  5IIJ A;  2E8N A;  3T3F A;  5CP2 A;  4TUP A;  5F3X B;  1YZ6 A;  2DKX A;  4DL4 A;  5KAI U;  2H3Z A;  3GZF A;  1B0X A;  2W55 A;  3V7J A;  5KG3 A;  2VA8 A;  4O5K A;  5AKZ A;  2HBJ A;  8ICM A;  3NTU A;  2MUT A;  2G5I B;  5G5G A;  5ALX A;  1S5L U;  4M9G A;  4AP9 A;  3AQE A;  4CNQ A;  2PKE A;  4HAI A;  8ICS A;  2MUT B;  5ALE A;  4F5Q A;  9ICN A;  5ALH A;  3TAD A;  4QJF B;  1QSY A;  3FAH A;  3MDA A;  4M9J A;  1ZQJ A;  4DSK A;  3Q8L A;  1BPE A;  3AM9 A;  4EEN A;  2P66 A;  4B9V A;  4RQN A;  1DK2 A;  2Y1J A;  5IIO A;  3ISC A;  4R65 A;  2HW3 A;  2IA6 A;  4F5R A;  5KAF U;  4EEK A;  8ICT A;  1YT3 A;  2ZTC A;  2WB1 F;  4DOB A;  1JX4 A;  5EE0 A;  4QZG A;  5ALR A;  3PR4 A;  4ELU A;  4QWE A;  4C4S A;  2JGA A;  1VJ5 A;  1T3N A;  2RQ5 A;  2ZTE A;  2RLT A;  2KJ8 A;  3SMV A;  1XWL A;  4MF8 A;  4DQS A;  2J6S A;  1ZQC A;  4R63 A;  3HRD D;  4NL9 C;  3RRH A;  2QB0 A;  2HHW A;  4QZ8 A;  2BQU A;  2PFQ A;  2QB0 B;  2VA3 A;  1PVR A;  4QW9 A; 
#chains in the Genus database with same CATH homology
 2DUY A;  4UB8 U;  3WU2 U;  4PJ0 U;  5KAI U;  4IL6 U;  2AXT U;  5B66 U;  3A0B U;  5GTI U;  3A0H U;  3KZI U;  5E79 U;  5GTH U;  5KAF U;  1S5L U;  5B5E U;  5H2F U;  5TIS U;  4UB6 U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...