2YMPA

Chloroacetic acid complex bound l-haloacid dehalogenase from a rhodobacteraceae family bacterium
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
225
structure length
224
Chain Sequence
SGILVFVNETLLDLTSLSPLFERVFGDAKVLREWFPELILYSQTLTLTGLYRPFGEIAAAVFEMVAANHQAKVTPDDIAELKTRLTSMPAYPDVAPALTRLQDAGFRLVTLTNSAPSPAPSPLEKAGIASFFEAHLTVHSSQRFKPHPSVYDSTAETLGAKPEELCMIACHIWDTIGAQARGWRGGFVARPHNTPLTLAEVPQPDFIGRDMGELADQLIASLTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Marine Rhodobacteraceae L-Haloacid Dehalogenase Contains a Novel His/Glu Dyad that Could Activate the Catalytic Water.
pubmed doi rcsb
source organism Rhodobacteraceae
molecule tags Hydrolase
molecule keywords L-HALOACID DEHALOGENASE
total genus 86
structure length 224
sequence length 225
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2ympA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2ympA01
4DWOA 5AKXA 3NALA 4DCCA 4UATA 5AVUA 2MU2A 4CF4A 5ALNA 4HGRA 3OPXA 3ZUPA 2C88A 4UU0A 2G80A 2ZBGA 4KNVA 4YCLA 3RF6A 5AKLA 2ZBFA 2HEGA 4BEWA 3AR8A 4YCMA 4FFDA 5AW9A 3OCWA 5AI5A 3ONNA 2MSNA 4G9BA 3ZX5A 3AR9A 4OD0A 1LTQA 3E8MA 3RFUA 5AW4A 1J8DA 2RB5A 2PR7A 1O08A 2WHEA 3U26A 1J97A 2I55A 3WGUA 4FE3A 1RLOA 3WKEA 3E58A 3ESRA 1RKQA 1T5SA 5ALUA 3PGLA 5ALPA 4HGPA 5ALFA 5AW0A 5AI0A 3WK5A 1VFPA 1QYIA 4YIHA 2C9MA 4BX3A 4MWOA 4F72A 2Q5EA 2RBKA 3FVVA 5AKZA 4EX7A 1S8OA 4EX6A 3NIWA 2IYEA 4Y2YA 4Y2SA 2W4MA 1T5TA 1ZD4A 4ZEVA 2WF7A 5AI6A 5A3SA 1TJ3A 5AKIA 2FI1A 1ZS9A 2B0CA 3U7FB 2CFRA 5AW6A 3QU9A 3ZW7A 3I76A 1TE2A 2WF8A 1Z4NA 2ZBEA 4L57A 3W5AA 2HCFA 5ALHA 4HGOA 5ALWA 4EENA 2GO7A 5AESA 1L7PA 3AR6A 3BA6A 2FPWA 5AW8A 5A3RA 4OCZA 4Y2JA 2FPRA 3R9KA 3ZTYA 3FZQA 3AR3A 1ZOLA 5AKEA 4F71A 1TJ4A 3WK8A 1YMQA 3L0CA 2O2XA 4UMDA 4YGYA 3OCVA 3GYGA 1RMTA 5AVRA 3UMGA 2WM8A 2WFAA 1WZCA 3QX7A 5ALTA 3W5CA 4NFLA 1RQNA 4BNDA 2NO5A 1Z4OA 5AICA 2YMLA 2C8LA 4JDPA 1EK2A 1Z88A 3UM9A 3KC2A 2QLTA 1Z4IA 3FM9A 4XOUA 3ZU6A 5ALOA 2CFTA 2ZG6A 4H1WA 1Z5UA 3CZ4A 5ALXA 3NAMA 1U02A 5ALZA 2HF2A 4UMVA 4C4RA 4BKMA 3AR2A 2C4NA 2I6XA 5AI4A 3E81A 4IFTA 1Z4MA 3QUBA 2IOFA 2W11A 3FGOA 3U7GA 3AR4A 4CE6A 4RETA 2DQSA 1CR6A 2BDEA 3MPOA 2YMQA 3DDHA 1U7PA 3HLTA 4AS2A 2OBBA 1RC8A 2HO4A 4Y2XA 1Q91A 1YS9A 3L7YA 3OTQA 3MMZA 1QQ7A 3R09A 1RKUA 2W43A 3NANA 2EARA 5AKHA 3PDWA 4HYTA 3SLRA 3QU2A 1K1EA 2OA0A 3A3YA 2B8JA 3EPRA 4NAVA 3SKXA 3WGVA 4UAVA 2G09A 5ALLA 1NNLA 2GMWA 4UMEA 3SF0A 1LVHA 2R8EA 2EATA 2YN4A 4UMFA 2GHTA 3DAOA 4OFZA 3U13A 2JAOA 3SMVA 3QNMA 4BBJA 1QQ5A 1RDFA 3L8EA 1T9ZA 4UM5A 4L6CA 2YMMA 4Y3UA 4BEVA 4XQ0A 4NWIA 5AIAA 4J2TA 4Y2VA 3ZTWA 2RARA 3U19A 3OCXA 2G1AA 3WK4A 5AHXA 5ALQA 5ALVA 3A1EA 2FPUA 4CF5A 5AK6A 5AVSA 1U7OA 3DNPA 5AW5A 1Z4KA 2JARA 5AW3A 2CN1A 2JAWA 2IOHA 3ZWKA 2PQ0A 5AW1A 2IOFK 4BX0A 3HYCA 5AKJA 2O9JA 3KDPA 4NABA 5AW7A 1U2SA 1YV9A 4KN8A 1SWWA 2HX1A 3B9BA 1KYTA 5AM0A 1SWVA 1NRWA 2JAUA 4UASA 2WF5A 3QU4A 4GIBA 4DFDA 1L6RA 2R8XA 1CQZA 2AGVA 3QLEA 1XP5A 4UM7A 3N28A 4YCNA 3L1VA 2NO4A 5IT4A 3KBBA 2B1QA 4Y2UA 5AM5A 2P11A 3L0YA 1YDFA 5AM2A 3QYPA 4I9GA 4YH1A 2Q4RA 3AR5A 4MUMA 5AK4A 3WK9A 4Y2RA 2FEAA 2EAUA 2QYHA 3ZVNA 2PKEA 3PGVA 3AR7A 1ZRMA 4HAIA 4QJBA 3WKCA 4QQFA 4JB3A 3QUQA 3KZXA 4GXTA 1PW5A 3E84A 3D6JA 3L5KA 2GHQA 4NV0A 2VKQA 5AM3A 1F5SA 2B30A 4YIKA 5AI9A 2YFYA 4CNQA 5AKGA 2G08A 5IT0A 3KOOA 3W5DA 3NUQA 2YY6A 2YJ5A 3MN1A 5AVYA 2HI0A 2JGAA 4KYTA 2FDRA 3OCUA 5FP0A 3EF1A 5AK5A 2HOQA 2Q4TA 3VAYA 3B9RA 1EK1A 5AIBA 3ESQA 3MC1A 4CF3A 5ALJA 3N1UA 1X42A 2YJ4A 3L8FA 2WF6A 2G07A 4Y2TA 5AKYA 1L8OA 4Y2PA 2HF7A 2AUTA 2OM6A 2YBDA 4B6JA 2C8KA 4XE5A 3SHQA 1O03A 5ALMA 1XPJA 3KD3A 1WR8A 1JUDA 3WKDA 5AVZA 1Q92A 1RMYA 3L8GA 5AVVA 1ZD3A 2P9JA 3N8GA 3QXGA 4KNWA 3ZI4A 1L7NA 1RKVA 4BNDB 3I28A 3NRJA 3FPSA 3I6BA 3QUCA 4UARA 3ET4A 5AW2A 2FUEA 3ZWDA 4EZEA 3SD7A 1L7MA 1U2TA 3M9LA 3PCTA 3CNHA 2B82A 3U7HB 3A1CA 1RPZA 3QUTA 5E0OA 5A3QA 2AMYA 5T41A 4AP9A 2YMPA 4KX3A 3WKBA 1FEZA 2ZXEA 1Y8AA 5IS2A 5AVWA 4FYPA 2R8ZA 1WVIA 2GFHA 2WF9A 2P27A 2HSZA 2B8EA 2FUCA 2BY4A 4Y2QA 1N9KA 4RESA 5ALDA 2G0AA 2YJ6A 5JJBA 2I33A 2I7DA 3SKYA 1QQ6A 5ALKA 3ET5A 5ALGA 3IJ5A 1S2OA 1MH9A 1SU4A 3F9RA 3QU7A 3IRUA 3W5BA 4PNHA 3WK7A 2MU1A 3R4CA 5ALYA 1XVIA 3L1UA 3M1YA 3QGMA 2AH5A 2ODAA 5AVXA 1WPGA 3A1DA 3ZX4A 2YJ3A 3OCZA 1YNSA 4ZEWA 4AS3A 5AM4A 4UW9A 5ALEA 2OYCA 3J7TA 2I34A 1AQ6A 4XPZA 3OCYA 1VJ5A 1Z4LA 4BYGA 3WK6A 4I9FA 1Z4JA 1RRCA 4IG4A 1NF2A 1ZJJA 2G06A 1Z4PX 4UU1A 4E88A 4L6AA 2B1RA 4OHFA 3EF0A 4ZEXA 2HDOA 4DW8A 1TA0A 4O8CA 3K1ZA 2IA5A 4BX2A 5ALSA 1L7OA 2FPSA 5AVQA 2CFSA 3UMBA 5AM1A 4G63A 3IB6A 4J03A 1RMQA 4C4SA 3TLMA 3L0BA 1Z4QA 2I54A 1RLTA 4EELA 3L8HA 5ALIA 5AK3A 2HHLA 2ZBDA 3ZVLA 3N07A 4KX5A 1N8NA 1L8LA 3ZVMA 3EWIA 1QH9A 1RLMA 3NASA 3P96A 2FPXA 1RQLA 3I1YA 3QU5A 3WKAA 3BWVA 3DV9A 1ZRNA 3UMCA 5AVTA 2D2VA 2X4DA 5AKKA 3B8EA 2NYVA 2BDUA 1IWOA 1YJ5A 1TJ5A 4HGNA 4HGQA 3U7EB 3N5KA 5ALRA 3S6JA 2P69A 2ZOSA 4UAUA 5AI8A 2RAVA 1ZD5A 1VJRA 1ZD2P 2R8YA 4EEKA 1Z5GA 3FPBA 4C4TA 3ED5A
chains in the Genus database with same CATH superfamily
1SBNE 4GC9A 1NF3A 4BNMA 2MYNA 2Z2XA 1G20A 5I3CA 3SE7A 4WZAE 4DMRA 5AVOA 3F2CA 5F98A 4DQSA 4BQOA 1OXTA 4YQEA 5LQSA 3MBOA 4ABTA 5CR9A 5G5GA 3KHLA 3NVKI 1RYSA 4M6WA 1ZBQA 4FHGA 4I5GA 2GILA 5FD8A 4HGYA 4AXBA 4RVOA 4ZI3A 3AM1A 2W6JA 3ONVA 1XRMA 2Q3JA 4Q01A 1RRVA 4MP8A 2WY2D 6YASA 1ODFA 3WGIA 2V54A 4XW2A 1ZQXA 3TIIA 5JARA 3AEUA 1OH8A 1BVSA 1LI7A 1WXXA 2II6A 3ZGZA 3RJMA 1HQYE 3CE6A 1T8PA 4G5RA 4Q19A 3TADC 9ICTA 2NSDA 2YHBA 2HUNA 3O92A 4F06A 4S1TA 2KYRA 1E3SA 1JDBC 2WU4A 4BVJA 3GLGA 4Q8FA 2YJTD 3I58A 4Z2YA 5B12A 4KLTA 1NW8A 4EGSA 2AHOB 3FX2A 3ENZA 2EKBA 4IR1A 3QA3E 4FKBA 4FE3A 2RG1A 1S2GA 1UMBB 2XE4A 3PFIA 3PNOA 2C5EA 1ZQVA 1KQPA 2IKQA 2WU3A 5CVEA 3IJRA 4L0DA 3PCXA 3RAQA 1N2CB 5CNKA 1QAQA 1U7XA 1Y1PA 2WINI 4NMLA 4Q1FA 4ZD6A 1Z0AA 3AF0A 4RTLA 3PGLA 4OYLA 3H5LA 5ALPA 2IE0A 3EZLA 4DMCA 1E0DA 1KIAA 4CETA 2YBEA 1JAYA 1YASA 2Y1WA 4AG6A 4XYLA 5DNEA 4US0R 3M8SA 4ME6A 5E6SB 1PR5A 3BQTA 1UMCB 2FZGA 1KEVA 4UHKA 3N75A 4BX3A 4GM4A 1SVNA 1W34A 4RPHA 4A3SA 3E03A 4NZZA 5KNDD 2EKZA 4LOJA 2W7OA 4LYJA 5BN4B 5EIEA 1L5NA 2FWNA 3KZMA 1E1KA 1NVTA 2ZSUA 4OG2A 1DQRA 4UDXX 1T8EA 4ECUA 2ZSIA 4LXUA 1PHRA 3F6SA 3H3FA 4UEQA 3U4AA 3WO1A 1T8YA 4KJXA 2GTPA 3FJOA 2R48A 4BNGA 1N3IA 3UB3A 1ZH6A 2E4WA 1XUOA 2BM1A 3BTUA 2Y0BA 3DDWA 3JZFA 1MEJA 2DLNA 4JVOA 4UPEA 1F8XA 2ALZA 1SUBA 2ZTDA 3AOEC 3OJFA 3ADPA 1T9GS 1J0EA 1IG0A 2HMSA 4YJGA 4FDUA 1S0NA 1Z33A 1E3EA 1V6CA 3NH6A 5EQFA 4JUCA 3CF4G 4LZZA 4A5SA 3U48A 3UKJA 2HMXA 2QAIA 2XXJA 5KFOA 1GZVA 4MINA 3IEXA 4WZAB 3RSFA 4B3TB 1POXA 5JBIA 3FWZA 3W5AA 1H1DA 2PMEA 2AUNA 1E9DA 3IVRA 3OZAA 4ITRC 4ECYA 3NGDA 3V2GA 4F2GA 4HRYA 1HKHA 4C0KA 2GUGA 4KCGA 4MWEA 3V9AA 3D8SA 4BP9A 4HB3A 4O5EA 1ISPA 2JRLA 1CWUA 1YK0A 3D0KA 1N6OA 3MGIA 1U47A 1JHRA 3PHCA 5I8ZA 1K7SN 4XJTA 3UH0A 2FPRA 2GBPA 5KNBD 5BUSA 2WK1A 3KUDA 4HDKB 4C4ZA 1Y9AA 3BJMA 3JQAD 1BDMA 3EXG2 4GXNA 4RVUA 3RVSA 3S2ZA 3IMGA 5EHQA 1XOIA 1ZUNA 2QR5A 4RK6A 4D3XA 3OIVA 3R9WA 5C5JA 1GUYA 4NBLA 4MV4A 3RIYA 1XD2A 5GOZA 2F9FA 1UZAA 2GZRA 2JJYA 4GGOA 4Q3AA 4CKEB 3KJGA 1V6SA 3DF7A 3TLAA 4DLEA 3QEKA 2BI8A 3DOFA 4J0JA 2AZTA 3STVA 5T8KA 1AZSC 1U2RA 5AUQA 5JSYA 1DKLA 3OZUA 2Z56A 4J91A 2R7KA 1QPGA 1UUFA 4TL9A 3RVQA 1DWPA 1IXRA 2H4JA 1CZNA 4G9EA 2P9ZA 4IW3B 3COPA 4RV4A 3TM5A 3IDZA 1RQNA 1I2BA 2HQOA 2ZJOA 4OLJA 5EIWA 3VNRA 2H63A 4FB5A 3U5TA 1Z4OA 1KJNA 2O8EA 3AI1A 1JAHA 5JYEA 1FVHA 3QKWA 4HWRA 4PU0A 4ZAFA 1CK4A 4I29A 1L5RA 4OQYA 4PZYA 3PFBA 3ML1A 4YAUA 2JLAA 2FWJA 1D0SA 2W22A 5EJFA 2P4HX 3FFXA 1LS1A 4X7RA 3DE7X 2KSQA 2ATCA 4LDQA 2R2AA 4Z9YA 3LKZA 3VUEA 5C9ZA 5JSFA 5GONB 5JECA 2FW8A 1BXKA 4FE7A 1KJZA 1JX4A 1XWLA 1WXHA 1ZONA 3ESAA 1K68A 3R3ZA 4NYJQ 1ND6A 4EKNB 3FOEC 2GARA 4H31A 3IALA 4ZODA 4D9CA 2Q3HA 4LRXA 3EIEA 1MRSA 2Y68A 3IILA 1SEVA 3LK9A 3AUJB 1M67A 1Z4MA 2PKWA 3FKSD 5HEKA 1ZZEA 4TTIA 2DQKA 2OWOA 3AEKB 4PFJA 3AL3A 1K2VN 5SY4A 4BVFA 1C3LA 3URKA 1ULAA 3K9HA 2PO7A 3SEFA 3U4QA 5BURA 2I67A 4RH1A 2PSEA 1NJ5A 4M76B 4MO9A 4OQXA 4TMYA 1LDMA 2PANA 4TT3D 5DLQC 2WWVD 2BE7A 3D8NA 4WLFA 7REQB 3M6WA 5KUTA 1KP9A 1TLTA 1SVIA 4F97A 4KQ6A 3QM1A 5J1TB 1QQ7A 5JY6A 2R1VA 1C2TA 4X95A 5ADWA 3ZI0A 3ZWCA 5KFKA 3R7WA 4A1FA 4WTOA 4JI5B 5B4VA 4GYKA 5LZ2A 1UCFA 5L7YA 3CKKA 1QUFA 2OEPA 2PRKA 4FOTA 1IQRA 3B9QA 3L82B 1OX6A 4FBTA 3PA8A 4HYTA 3SLRA 4H0FA 2P9HA 2JLQA 3HU2A 3HWSA 4ECZA 3DOOA 4NK5A 3ZV4A 4OMUA 2DKZA 1XDDA 1L5UA 2B8JA 3B5JA 3HP7A 4IQ4A 4N12A 4Q6BA 4Z3KA 2M6KA 2QM8A 2SNIE 2QE6A 2W8BA 4M55A 4F3NA 4PHFA 1DRGA 2K4HA 1FMLA 1HV8A 4I2EA 5EAIA 2BCSA 3VH3A 3TS1A 1Z9BA 3B1KA 3KR2A 1KFJB 2G36A 1HF3A 1HYQA 1ZQNA 1NN5A 3QLTA 3SF0A 3THRA 3V33A 1PIWA 4DMGA 4H7FA 2REXB 4UMFA 5H4HA 4BFLA 2ZXHA 1ZHOA 3B5EA 3OF3A 1H66A 2MAXA 4W1SA 5JCXA 2IPLA 4URZR 1ZSYA 4I4NA 4O2BA 4Q05A 1VI6A 3DTYA 5EHIA 5EMLA 1V1RA 3UAZA 5EJ2A 5GIOE 4XQ0A 2PLAA 4JV2A 2FSFA 2HXSA 1N9ZA 5J2UB 2V98A 2XMGA 4Y2VA 2VA2A 1N36B 3U37A 8ICHA 5K2MA 2VBIA 2GD0A 1VSBA 3A2NA 3HLKA 3SNHA 3GA0A 4I2CA 4BWVA 2AJQA 1JQEA 1Y6ZA 3CLTC 3X44A 4R81A 1CB7A 4RNCA 3NWEA 1NLFA 5CPBA 3WFIA 5A2GA 1V2HE 1JG6A 3KZVA 2O8BA 5LYJA 1PU2A 4P3PA 2H5JA 5DCWA 1L9XA 3WL6A 2D1QA 4ER3A 1RWQA 4GOXA 1G291 1ULSA 2PT9A 3V7YA 4DB4A 1V4VA 2JJQA 3KDPA 4NABA 8ADHA 3OF5A 3HCWA 2PY6A 1NP3A 4K87A 3MFHA 1ZQSA 2I6QA 3LV8A 3P9CA 1VDMA 2V5VA 4L50A 4N5HX 1SVSA 4XWGA 3U17A 1RLJA 3KKKA 1VKHA 2DR2A 1KYTA 4QZEA 1XG5A 2X42A 4Q3LA 5KNCH 4Q37A 2CLOB 3UBTA 1EWQA 1MHPA 4AF7A 1P0MA 1RCTE 3PRJA 7ICHA 2VUIB 5JAIA 1T3SA 4C7JA 5JI3E 3CTPA 1KEEA 4C8OA 2UVWA 3UNXA 3DDSA 3DDZX 1T94A 3B8HA 3TYXA 4YCNA 1N2GA 3I5UA 3NTVA 2EDUA 2FZ4A 4D4JA 1GU0A 1AHIA 5CT6A 1DKNA 5KFMA 1M2JA 3PTAA 1FLDA 4ISBA 2GK7A 3LL7A 3CONA 2RHTA 2YWGA 4G8CA 4XARA 3DFFA 2CNKA 2NPOA 4LRUA 1LBSA 3KT6A 4MW4A 2GGSA 3NVMB 2R1TB 2Z08A 1XL1A 2A0YA 2XNCA 4OHMA 2C5FA 3DWIA 5DTMA 4BU1A 2XE7A 1X1QA 9ICWA 2EAUA 3BX1A 4XUCA 3LZDA 2PKEA 2ZUFA 1EJ2A 1P73A 1RVV1 3AR7A 4TXHA 1O96B 5JD5A 4EGCB 4UVDA 2H1OA 1JYFA 2XCTB 1ZM4A 3EWNA 3NHLA 3G7NA 3R3SA 3H65A 4IXDA 1AGRA 1DJQA 5BNIA 1DIAA 3L4JA 4YY3B 3WHKA 2B30A 3L4PA 1Z39A 3L3BA 4PRZA 4HS4A 2WU1A 4QGFA 4PSCA 1C81A 5J2KA 3OUTA 5ERGB 4EGAA 5FWNA 3B6IA 1E2DA 2E5SA 1CUUA 3SEAA 3ZQKA 5IKPA 2VL7A 1FLAA 4OJOA 3LOQA 4IJWA 5BSUA 1IBSA 5D3QA 1IXYA 1XZDA 3FOAA 3PHJA 3GGOA 4Q02A 4YB8A 2ZS7A 1TUEA 1CJBA 1BA2A 3SZMA 1UXIA 1MOQA 3B6JA 1ILWA 3EF1A 3H2JA 3JV7A 4QATA 4QIHA 4AKSA 4BE7B 1WUKS 3NVZA 1T15A 5JU6A 1HZJA 3H19A 4TMXA 4U2BA 4HPJB 3TSZA 1RXEA 4I55A 1BQ3A 2P68A 2BUAA 5F1PA 3LQFA 5J0WA 3NXKA 1WQ3A 4RL6A 3VJMA 1R9NA 4DAEA 1U5CA 1T3TA 3VCBA 1M6NA 5CHGA 1MQ3A 2FKAA 3B1YA 5GJVC 2J0EA 1BRMA 4LF4B 3NHPA 1MB9A 2FZKA 2ZVDA 1ZCZA 2LE0A 2XWQA 4RORA 3VYVA 5ULLA 2X58A 2OM6A 2YBDA 1F60A 1VJTA 2NPFA 3UW3A 1P2UA 4PG4A 4ZK2A 4IIEA 1THZA 3JAKA 2AR0A 2C28A 1LTKA 1XPJA 2PGAA 3OJLA 4MR8B 1QP0A 3QHQA 5LNK6 1RZ3A 1QHGA 1UZNA 2O4CA 3L07A 3N8KA 4QECA 5IVDA 3TINA 1BHJA 3FLBA 3C1ZA 3ICEA 4RPKA 3NHFA 2Y4OA 3UANA 1WD5A 2R6AA 5SZKB 1JE1A 2IS4A 2IP4A 4ZGGA 2VQFB 5EC8A 1K4MA 4KO4S 2QENA 3VTAA 2D00A 1QNFA 3KQSA 2ODBA 1X19A 2W2VA 1ZXBA 5T4FA 3UUGA 4C04A 2DWCA 5CJPA 5JI2E 2MR6A 3NBZC 2F44A 2FLWA 1O97C 2I3GA 1L4HA 4QQKA 5EE9A 4WNYA 3TNFA 3C87A 3CNHA 1Z73A 4DNXA 2OYSA 5LQJA 5JJLA 5EMNA 2CNNA 3CY6A 3W78A 3GD5A 2XECA 4P7FA 2CC2A 4P58A 2ZGVA 3CR3C 5BYAA 1KZ6A 2I5PO 1NN1A 2JIZD 2FPLA 3RSQA 5F4ZA 3ZY5A 4EIWA 5IDWA 2ZIVB 4DREA 5EYPB 1LX6A 3VR4A 3HACA 4XIIA 4E5UA 4Z0NA 1FNMA 5KAMA 1BKDR 3B3GA 5HYVA 3E9ZA 2ZUWA 1AHNA 2P27A 3WSTA 1R0ZA 2HAEA 2KMLA 4IJ6A 2VUTA 4NY8A 2ZTUA 4ZVOA 3L6BA 2YFHA 2AG1A 3BHIA 4B7UA 4BLOA 2W2LD 1FBNA 1T2VA 4ML3A 2DQ4A 1FDSA 3WVNA 4KODA 4LGMA 5TR9A 3MGBA 5EY5B 2PZLA 2VDJA 3QLJA 5EOVA 4QUIA 3V3KA 1CFZA 5ALGA 3EXEA 4FP9A 4K1XA 4KPUA 4EHLA 1I1OA 3C14C 3JPRA 1FSZA 4M8NE 1JAZA 3HCDA 3A4TA 3UQ2A 5EEHA 3NTUA 1XZKA 3DMTC 4GI5A 3AUAA 3W5BA 1RI5A 3CC8A 1ETHA 2R11A 2AH5A 2BMFA 4QPNA 3WB0A 3GRPA 1JALA 3RR8A 4DLSA 1IOZA 1RHQA 1TVEA 1S2MA 2P2ZA 2QRPA 3IR6A 3S99A 4HNUA 1MDBA 1R0LA 1JEJA 1C9DB 2WFZA 3RRZA 3BWEA 2ZJ4A 3O9MA 1LF5A 2AFIE 2XVMA 4BP8A 2P79A 4L8LA 4ZT7A 4H4DA 1I9GA 1E32A 1X9SA 2YFQA 1GTJ1 2BVNA 1BHQ1 5J2AA 2CNWD 1N8KA 2ZPUA 3NEAA 3DW1X 4L5YA 1T34A 4FONA 3WYFA 4ZOHC 2LCQA 3U09A 1GDTA 2JG3A 1XU9A 2CJWB 2G25A 4RV9A 1E3IA 2ZYRA 2BFEB 2Q9CA 1TK5A 4E88A 9ICEA 1Z13A 3JX9A 1IK4A 5HG0A 3PQ2A 3R5SA 4C78A 1E92A 4CDRA 4EJMA 2X5OA 5JH7F 3TH5A 2H51A 3ADOA 4X71A 4DA9A 4JL8A 1XVLA 1IZ0A 4GKJB 1RXVA 3Q3VA 1DKRA 3RU7A 5LMZA 4JJEA 5AVQA 1G41A 2OQIA 4FXPA 3UMBA 2WTFA 2LRHA 2K8BB 2H08A 2VWHA 3ROKA 5LU9A 4XM1A 4E7PA 2FRDC 4J1TC 1E1CA 3K7EA 4OIMA 4ZOAA 1A04A 3PQ8A 4WBNA 1NE2A 1HFKA 2R5NA 3EWSA 2OBFA 5T6BA 1WBDA 1X8LA 5DP1A 1ESDA 3O0TA 3U44B 2H1LA 1HT2E 5AK3A 4A8HA 1YOBA 3VQTA 4HWKA 2NRXA 2BFEA 5I7HA 3PLRA 4ZKEA 1WKCA 4CLXA 2I65A 1SBHA 2H48A 7ICKA 5KNDH 1VLZA 8ICTA 4UOZA 2KI5A 3RUEA 4DJ5X 1X92A 4RQNA 2P5YA 1H23A 1K7YA 2GN8A 2YOFA 4F93B 1J2RA 4Z8XA 5CM2Z 1II8A 4X94A 5BOLA 5FFNA 5IXSA 4G4JA 5E2AA 1OBHA 3IQIX 3M9XA 4N7BA 3DAPA 4EBCA 3CLHA 4N5LA 4U7FA 3VGPA 3WHPA 1QIFA 2IVFA 1LPOA 3DFMA 1RRPA 4FD3A 4R9RA 5A4KA 3ZW8A 1CD5A 5EWJB 3HM9A 1YJBA 1SU8A 5BN5A 3E9MA 4YRLA 4EZIA 2OCGA 4G5YA 4WI1A 2ISPA 1KAOA 2DERA 4J0CA 3K2EA 3CRW1 1H42A 2Z6VA 3WL8A 4AJNA 2VPTA 1KYQA 1Q1ZA 3A4VA 4Y7CA 1EX9A 2DQZA 3U3KA 1IH8A 5IH7A 2EZXA 3FPLA 1LD3A 2V0GA 4K7JA 4UD6A 1Y1KE 4L85A 1S1CA 2PEYA 4OY3A 3NT5A 4ZYXA 1J4AA 3A7EA 4RSMA 1Z0JA 4DG5A 3QOFA 5I7SA 3JQAA 4ZWNA 2ONKA 4GI7A 2IFTA 4XDZA 4U2KA 3J81j 1H1LB 2R6GA 3IMKA 1T0IA 4OHKA 4ETNA 1FP4A 1UPFA 1N77A 1H5UA 2X9QA 2J31A 3LOUA 4ES6A 4KR0A 4DE5A 4YAFA 3GGPA 4YRTA 1EVKA 4OH7A 3ZXYA 5EUCA 1I1NA 1HGXA 3DE0X 3HR8A 4EB6A 5CG2A 4RFLA 5LYJF 5TY0A 5L1MA 3TE6A 3FOZA 3CINA 5E7JA 2K89A 3AHFA 1L4FA 1L5HA 3QPWA 3AJ9A 3UICA 4NCBA 1K4YA 1GZ7A 2ANBA 2GVDC 3HUUA 3NNSA 4HSGA 1IK6A 3SS8A 2KHVA 4OD0A 2QB0B 1LKYA 3RTVA 4OHCA 1BPXA 4YJHB 3S55A 1XNRB 1W30A 1G20B 3EQ8A 3MTQA 2Q7OE 1GLVA 1R50A 3T0GA 4BJQA 2PJDA 1UJ5A 1J97A 3U26A 1FLNA 1KKMA 1U0OC 2A9PA 2H52A 2EGUA 3A1WA 3FRHA 1QANA 1ZWKA 5EIOA 2FN4A 5B5EU 3UV3A 4AO7A 1ZJWA 2RGXA 5JFGA 2QW8A 2FPIA 1F1JA 5I48A 3LUDA 4XI9A 2GKGA 5IC6A 4OO1J 1SZJG 3AINA 3DVRX 3MSCA 4HGPA 4LNAA 1ZD8A 3JASB 3WK5A 2QGFA 4KB5A 4XAQA 1UBMS 2R8IA 1VFPA 2CLDX 4CM1A 1TKRA 4F7DA 1ZGBA 2ATEA 2SKDA 1RLUA 2H4HA 5JMOA 5KVCA 1NSTA 3RTDA 4JY7A 5AFSA 5DQHA 4JLKA 5AJHA 3RJGA 1YZUA 3QKUA 3N3BC 1Z74A 4EHDA 2E55A 1E4EA 3KEMA 1ZN8A 3KR1A 4PPGA 1M73E 1RBQA 2ZBVA 4JWMA 4KO1S 4D80A 5ICGA 2O0HA 1DBQA 3OIYA 4R3NA 1SFRA 4CEJB 2XDYA 3KT0A 1C80A 2NIPA 2WYOA 1FFWA 2QARA 1YDHA 4HAYA 4OO3A 5DYNA 1ORTA 3FMOB 4MARA 4QUEA 3OX1A 4DJFC 1BNOA 1CNFA 2IHYA 1TX4B 2IPNA 3PJDA 1W5AA 1VPVA 1XCLA 5J0XA 2A6PA 2R5FA 1CQXA 3A2MA 3Q5EA 4JUAA 3KKQA 4KXXA 2NT4A 5EIBC 4DQ0A 1X1CA 3M8RA 1H6DA 4DDUA 2C99A 1FUYB 2CF6A 3BGVA 1VKNA 1N3BA 4MRAA 2XMPA 1GR0A 1FYWA 1OD6A 1LPBB 1V11A 1XTBA 2BM0A 4GAEA 4HLCA 2XZPA 4PCUA 4X00A 4F2RA 3HJTA 5CT9A 3RBZA 3C45A 5BSEA 4INPA 1AROP 2LHTA 1CQWA 2QMUA 2AMVA 2J4DA 1TO2E 5DGXA 1F2TA 3GLHE 4BO1A 1AKEA 1NK9A 1ENYA 1EGHA 4OHOA 2FXVA 3VI4B 1EQUA 1OT5A 2I3BA 2H1SA 1O58A 3SAGA 2GCOB 2JIMA 1R5OA 2EH9A 1BCSB 2P1DA 3DV2A 3GUCA 1HZZA 2Q3MA 1XNSA 2YIDA 4MVJD 3TCKA 2PGOA 2C2ZA 3UN1A 2ID9A 2KM1A 2XJ4A 1WBBA 4LWPA 3S1AB 1JHOA 8ICNA 2NU7A 2W2OA 4EOGA 5HKAA 2WVGA 4J0GA 4ZU3A 5SYMA 1L4UA 8ICIA 3DCJA 5DNVA 2OHFA 2DFTA 4LKRA 4Q1DA 1YQEA 4DA4A 1U8UA 2JHCA 4AX8A 2P6OA 2IPOA 5LB2A 4FSDA 1GILA 5A4MS 1IZYA 1NJFA 2NW6A 3DL2A 3L6OO 2A3VA 1WZCA 2KIWA 1E6KA 4M9RA 5AXDA 3IP5A 5IBRA 3ZJ5A 3B9JA 1I01A 3H84A 4LUCA 4YUXA 1QP8A 1W8DA 3SEIA 1ESMA 3SV4A 1Z6YA 2BKXA 1ZHFA 1MT0A 3AQIA 4NCNA 2NLOA 3F1KA 2ZBRA 2CL7X 2NUAB 3DHWC 3PI6A 3T1VA 3WYCA 1A27A 3T5CA 1WLYA 2VTBA 2VEDA 4UEOA 2VI5A 3L1KA 2YVQA 3G1TA 4LCJA 3RR2A 1CI4A 1UMKA 1Z4IA 3EY9A 3G1WA 3UMJA 7REQA 2PH7A 2P2GA 2ZG6A 4I8DA 4Y7DA 2FOIA 5D5HA 2VNSA 2J41A 1MU0A 3Q3JB 2CMHA 2KJ9A 1KO5A 3QVTA 2F8SA 2GD1O 1FRFS 3M3PA 4R1MA 4G01B 3NBUA 1ZUHA 2ZRGA 4KLOA 1Y4DE 4QFBA 3TRIA 3WNZA 1BG6A 1GV0A 3HFSA 1IU9A 4JS0A 2VXYA 1YDMA 1A9XA 3THXB 1DBIA 1UQTA 4DQUA 1JXLA 1RQXA 4EJSA 3CZ9A 2CSUA 3MR5A 2YCLA 4N76A 1NQWA 2QRZA 3I2JA 3ZPXA 2AJCA 2PGLA 4ASUD 2C2OA 3IO3A 4GPZA 4ZJYA 1GGHA 4I6EA 4YDSA 2OZEA 1NVAA 1Z1BA 3BD9A 2DT8A 2X0NA 3G2NA 5DGTA 5LOVF 1I7SB 5JT1A 1CUEA 4KRXA 1P1RA 3PEWA 1VYTA 2HWUA 1KJJA 1ZN9A 3CCBA 3LYHA 3Q41A 1I1QB 1ZOIA 5K01A 1BDBA 2RK6A 1QLNA 5BT8A 1KP3A 4TVKA 1U9CA 4DSIA 2H3ZA 4D6XA 3NM6B 3CNNA 4LE0A 4I2IA 4XASA 3ORQA 4GX0A 1PNOA 4XSHA 4EJ0A 1ORHA 3QELB 2A59A 3IH5A 3PUJA 4XVCA 1QZZA 2NO1A 1M7HA 3C5WP 3JQQA 3LIIA 4ON9A 3H0RB 2ISOA 3LRXA 3R9IA 1KFEB 4HDSA 3WMXA 1FFAA 4NJEB 5ELMA 4PONA 4GMGA 1G5TA 2KNJA 1T24A 3P9XA 4UB1A 1PT6A 1JE0A 3W6OA 1SQ6A 1OFUX 5FUMA 4QOFA 5HKKD 4BNTA 5K99A 3D1VA 1P7YA 1BE6A 3WGVA 2CVHA 5FI1B 3NORA 3VSEA 4YCBA 1AY0A 3EUEA 1QHHA 3DZIA 4CTMA 1B14A 1JIJA 2BUBA 3BL5A 4NC9A 2CZQA 2I2AA 5IAGA 4CL8A 2C3MA 4YQFA 4ZT6A 1GRVA 3JPTA 2O8BB 4YAWA 1JDZA 1N0IA 2WE7A 2YW2A 2BR0A 1QYCA 3NIGB 3BTVA 1FC0A 3WI7A 5IMSA 1B8UA 4RQ2A 3MGVA 2I2FA 5EJIA 2ZXUA 2Z1MA 1D2RA 4C2AA 5KI6A 4BKUA 5K20A 4QGGA 5I5EA 3R20A 3COJA 4MEBA 3P94A 1HT0A 4EB3A 3SQDA 2HJSA 3ZD7A 2Q7DA 3H0CA 2OILA 4PWZA 2XGSA 2WUWE 4P93A 2HDHA 4WH0A 5T5QA 4E4YA 5JLJA 2I4NA 4NLGA 4DSEA 3LQRA 5HBRA 3D4NA 1IV8A 3KHSA 3R0QA 4IDAA 2JK0A 2XWSA 4J90A 1T3HA 1Q21A 1YUMA 3HHEA 1V5IA 3HLYA 4LXTA 4XYEA 2CN1A 3N87A 3Q5GA 4R8LA 2KK0A 3BKWA 5E3JA 1QH8A 1NWHA 3HYCA 1NOKA 1WPRA 2A3NA 3MT8A 3GCXA 2Y92A 3H5IA 3RB8A 1UAYA 2EZ9A 2W7TA 4ZQGA 2FMKA 4P2GA 1XTTA 4WDRA 4AULA 1THGA 5J4VA 5KCZA 2GEJA 1JR3A 2IYYA 4UHEA 1GPLA 4TXNA 3JAWB 1K66A 2FVXA 4V0OA 2B5OA 1GPMA 1QHNA 1NQTA 1TUBA 1UMBA 4JP8A 4PLHA 1KSJA 2LKYA 1CV2A 2FA9A 3OMLA 3QU4A 3OETA 5KG4A 3PVCA 4D97A 4BB0A 1JXAA 2H17A 1A9YA 2AVNA 1VKOA 2ZYSA 3OSNA 3GNLA 4R8KA 3BWYA 5DTQA 3HKCB 4RBNA 3RG2A 3S40A 3T9EA 6Q21A 3V8RA 3GLFE 3AVXA 1Z62A 5CDHA 4WJ3B 5IT4A 1RM6C 2HVIA 1S8NA 1JNXX 1WUDA 4MDYA 1PHPA 4MAFA 3AH8A 4PXSA 2JLUA 1XF1A 3I2IA 5ITSA 1LRLA 1YDFA 3O8RA 1H5QA 1NRXA 3E5NA 4GL2A 3CUSA 3R6DA 5E2BA 4MR7A 1A8QA 4HMPA 4R9NA 4V3CA 2W2TA 4MUMA 3RAPR 3GFPA 3GL9A 1UOPA 3KVVA 1M0WA 4MWTA 4HEA1 2IH5A 5DH9A 5BOVA 8ICOA 2GRAA 4I55B 5TPWA 1ZRMA 3BL8A 5DGAA 1H1LA 1X14A 5GV8A 1KL9A 2C4KA 3O2NA 3SR4A 4UCFA 4RVSA 2DHRA 2J9FB 4C80A 2QKQA 2OHHA 7ICTA 2UUPA 3E3OA 2IYRA 3NHUA 3TR6A 3WSWA 4BVBA 3KO8A 2X7HA 3OD1A 4G0WA 3K0KA 1Q3KA 4DFKA 2ZU6A 4UNRA 2BPCA 3ANSA 3B48A 1CETA 1Z0KA 4GZMA 1XI2A 3L6CA 1GPAA 3HEAA 3P32A 3VYUB 3V7KA 3WHLA 2JATA 1DO0A 1Z68A 3X1YA 5IVHA 1Z0UA 1EFKA 3V8QA 1NMQA 3DKRA 4IDEA 1C20A 1Y1TA 2MMGA 2WZQA 3D43A 4ND7A 1E7QA 1C3OB 4RLHA 5C2JB 3OC6A 4IWXA 3DPUA 4DILA 5C5DA 4QZ9A 4L5BA 4AJIA 1T2EA 4F4WA 4F5OA 5JRTA 1LLCA 1NVUQ 3ZU5A 5AIBA 1ZQZA 1S2DA 2P30A 3T0IA 3N0RA 5BW8A 2NU9B 4KQ9A 3NCHA 3ADCA 4MQFB 1PVOA 3JQCA 3N1UA 1W2WB 3OY2A 5I7OA 3IS3A 2I6SA 4B73A 1YCFA 1QIJA 3ISTA 4KUGA 4XR9A 3A1NA 4HTFB 2DFKB 1K2WA 3AF2A 1GN8A 1RLIA 2FP4B 2NTVA 1IUPA 3RHZA 3HB5X 5F76A 4BMXA 2FFAA 2VDQB 4OHBA 1SIUA 2Q46A 3EDCA 3V8PA 4W8HA 4PPXA 1P0FA 1FQOA 4H60A 3VO9A 5GGYA 1VIAA 4DOCA 3QZUA 4Y0NA 1HNNA 1T1SA 2OBMA 1M83A 2PUTA 3CH4B 4QHTA 3KK0A 4P32A 2PM8A 2QB5A 4F5DA 3MTJA 1HDZA 4X3CA 4FINA 3ACBA 4GX2A 3N8HA 3LBFA 3RJZA 4DLPA 4YLGA 2EF0A 2QL5A 4X41A 3O3OB 4NEHB 4RPJA 4CMIB 1RKXA 3A6HA 1RWWA 1QGDA 1P3JA 2QD3A 3UY4A 2B6GA 4Z6EA 6REQB 2OG2A 4O3QA 1BD4A 4ZDIA 4S04A 1R9MA 3EG5A 4G89A 2P9FA 2R84A 2VJMB 4RZHA 4WEQA 4P80A 3WG9A 3ZZ0A 3IKLA 5AW2A 2ZITA 4LI3X 3D2SA 4MDHA 3PUYA 3OEEA 4FYMA 4QVKA 1A2BA 3RSZA 4PQEA 4UEJA 4J0EA 2GA8A 3K6KA 1WZEA 3CWZA 1F51E 4RU9A 1M5TA 1Z18A 3D7MA 1Z3IX 1YSCA 2XMSA 2ZJ0A 3G9XA 3QPBA 4QLAA 5A62A 5KTPA 5EQJB 1DT3A 4MGZR 4JJ6A 4DR5B 1QIGA 4TMWA 1RIFA 1NDQA 9ICMA 2CLCX 3R7AA 4KX3A 1QIMA 4IIGA 3AUXA 3ABIA 3TIGA 4NENA 2B69A 4RF3A 1AGPA 1IN4A 3ESYA 4D9BA 2DRIA 3OM1A 1Q2UA 2EJCA 4MUIA 2X2PA 2GYUA 4TKMA 1ISHA 1UWLA 1DBPA 3GZNB 1NLZA 4M0DA 4Q15A 4E1AA 3R5KA 2BLLA 2AMLA 3EEBA 4W9MC 1N9KA 5CYOA 1JBEA 1OZ0A 1H2XA 3IKVA 4F3KA 3DHVA 4P22A 2I33A 2PZMA 1F2DA 1U1FA 1PN3A 2WD7B 1ZQYA 2JV3A 1T5BA 3EPHA 3V32A 1H9BA 4BIIA 4U2GA 3K2IA 1WCNA 5TX7A 4GG1A 3BDIA 9ICFA 4M54A 4PFQA 2XB4A 4I1UA 3MLEA 3GK3A 1G66A 1ZA1A 2EU8A 4EP1A 3GGSA 3MLBA 4C7BA 1A0OA 3OCZA 5CIQA 3RBVA 3TLBA 5THXA 1ZNWA 2Z58A 4PYRA 5BVGA 4EEZA 2BGLA 4OQPA 2K60A 3KAJA 1WD7A 2XGGA 4R2LA 1KH2A 3GUZA 2E4XA 1QYXA 3H4VA 3KZ1E 4TN1A 5T4HA 4AZSA 5K8IA 1V45E 2EHDA 4EDFA 3TQCA 4Q44A 1Z4LA 2WZDA 4ENSA 3N2NA 3MUOA 4HNTA 1NI4A 1OC4A 1UBNA 5KWEA 1B3BA 1Z4PX 1JIHA 1FU8A 1IZ8A 2X6TA 5GONA 4MKIA 3AJDA 3OKPA 2OYYA 4B9SA 3F6EX 3QKRA 3DVAA 1GGVA 2CUKA 2FZ5A 4O0LA 3EUFA 2D13A 4RSGA 3OE7D 4BX2A 3FMFA 3WNBA 4RENA 4Y6PA 1K6XA 2H65A 3T4XA 2FPSA 2FVYA 4PINA 1ZJYA 3A32A 4H15A 5LQMA 5IYZF 1QRAA 3FWPA 3O31A 4LRSB 4BWFB 5THQA 1RIIA 3ZDFA 3CKLA 2JL1A 4AD8A 3AONB 2HGZA 1P7DA 2E1RA 4LY3A 4CPDA 2PFNA 2PSDA 2CXUA 3IDAA 4HWGA 2DBZA 4IDFA 1JLRA 1SOWA 4LFBB 1I2ZA 5A7HA 3TQFA 2RG7A 4CV3A 5TEWA 1M34A 2IYOA 3V9PA 4FWIB 2BN4A 2NU8A 4JP3A 3W3AD 3WL5A 4AN1A 3QSYA 3RH4A 5CRIA 4DRXA 1QH9A 3P96A 3N7AA 4IX1A 4KVFA 4FS2A 1JDVA 4WEOA 1P7CA 2DTEA 1Y82A 3GGJA 1ZXLA 3BWVA 4E3WA 4L3WA 4V1CA 4CQNA 4MQ4A 1PBNA 3LTNC 4TWBA 1C0EA 3A4NA 3G82C 5D01A 3NTLA 1ADGA 2DQYA 4O3OA 2F1JA 1GN9A 2IPMA 4YT8A 5IVIA 4EUNA 3RW9A 4YCSA 2AZXA 5ALRA 1MABB 3JWGA 1Q3VA 4IS3A 5I7UA 4DCVA 3NP9A 3CW8X 3GMIA 3OFSA 4EBEA 2H06A 1ZQBA 3JVEA 4J4HA 1T36A 3EXHB 4OOFA 3WBFA 4QZ8A 3EE6A 3UT0A 4US2R 2QTLA 5DDMA 1H69A 2VXOA 4RA6B 2J5XA 2J67A 3KSMA 3SQMA 2NZWA 1TKDA 1W0KD 3OQHA 5T8KC 1WO8A 4YI3A 1P5HA 1KDTA 3KYIB 2AOVA 3LYAA 4KLGA 5HHHA 4M1OA 5DBFA 2NP7A 3VKUA 4F96A 5AQEA 2I1LA 4BFVA 2I2XB 2BF4A 5LOVB 2XY4A 2ZRAA 5D3MB 3AJ8A 2I1QA 2K4PA 1Y5IA 5KTTA 5E6RB 1QRTA 4J9QA 4HK4A 2OAEA 3OOJA 4HR7A 1ZQCA 1U04A 1FMFA 3H05A 3B6KA 1JR6A 5D1HA 2B4KA 3VNAA 4P7BA 4PLYA 1JH9A 2CD7A 3ZX5A 3AR9A 2C29D 5GZ6A 4DDHA 3U4HA 1CU1A 2HMTA 1XWWA 3TXXA 5CXQA 1EBFA 3CM0A 4LV5B 1Z0SA 3RFUA 8OHMA 1ADFA 1CRWG 1ETUA 1MB2A 1NK0A 1LPNA 5JNTA 5KPDA 1LLUA 3VJKA 3CQ9A 1NONA 3WKEA 1RVDA 3Q8PB 4RQ6A 2G6TA 3MD9A 4KFRA 4YACA 1OH7A 1P2GA 1UPAA 4I5IA 1JWBB 3C2QA 3EEYA 5CH5A 3BDPA 3DJYA 4NF2A 3RVOA 4KQEA 4CF7A 4YMOA 4LZOA 3KX2A 2XQVA 5LFAA 2FWRA 1QCYA 2ZETA 4BKOA 1JEQA 2IEZA 1OCEA 4U5XA 4CKWB 1PJQA 1IUKA 1E7RA 1XTKA 2L19A 1P2VA 2G88A 2O14A 4WVLA 4XM2A 5DI9A 1TU3A 1X7ZA 4URFA 4A6DA 1OA1A 4QWAA 5I51A 3U44A 2GLUA 2BI7A 1FBTA 3EIUA 3I4LA 3CCFA 5B7NA 2WOJA 4PCAA 1Z7EA 2D1SA 1S8OA 3ZE8A 4GICA 2OVBA 1T5TA 3H9JA 2HT6A 2J33A 3KJNA 1F2TB 2AEEA 4QASA 5CVTA 1GJRA 2KJ8A 2QZ4A 2NO7A 4JWTA 1H4SA 4PC2A 4B82A 1G9XA 4C87A 3K5HA 4UE2A 1M2VB 3CYMA 2OCLA 4L4RA 4Z1MD 3A4YA 3LUBA 3MWGA 1QCZA 3ISVA 3OOSA 4EUKA 3HWWA 1T3QA 2XYQA 3BHMA 2VCYA 4G97A 3VYSB 5IWAB 4ETIA 2LCIA 3AVQA 3BE5A 4X64B 2ZRJA 3GJQA 1AN0A 2NAPA 4GX1A 1UA1A 2EAOA 1T9DA 1JAIA 1REQB 3R4VA 1PL7A 1HKUA 4L57A 4X7MA 1UM8A 5ADUS 1EE2A 2M6RA 4MVJI 5JNSA 3PXUA 1ZL0A 2VJYA 3I37X 1V5WA 2XTMA 4N3NA 2PH1A 3AR6A 3L0DA 1OYWA 3D6TB 3ZC3A 4BFWA 5G4KB 1WCXA 2C95A 3BA6A 1DK2A 1BGWA 2WJ6A 5JAPA 4ZCIA 1KAMA 2ZJBA 4E5DA 2VDKB 1AA6A 5DM4A 5FKJA 3VPGA 3R9KA 4JUBA 1J9EA 3AR3A 1JROA 2WAAA 3H0EA 4IGEA 4KLUA 3RANA 3AVYA 1G3IA 1BW9B 1RI1A 1A8PA 2VPWA 4CV0A 3GEPA 3UH1A 3BJEA 4BX9A 5KL8B 2JLYA 3OHSX 4X0EA 1G7SA 4WA8A 3KIPA 1D8LA 3GILA 3UMGA 2EFDB 2FE9A 4ZKDA 1W35A 4DVGA 4DTIA 2O6LA 3DZGA 3VISA 3K53A 4BAGA 1Y6QA 5I4CA 5J43A 3PW0A 1RQ7A 4NMMA 1TVCA 1U3UA 4DLRA 2ECKA 3OLYA 4QFDA 1ZN7A 2D5IA 3I39X 2DPJA 4HFNA 3T7IA 1ZZGA 2JCVA 2GS9A 1V38A 3MF4A 4KLZA 3AEKA 1G17A 4PG6A 4H35A 1R2QA 3ZU4A 4UNSA 3KYCB 1G8KA 1FFXA 3OLQA 4A36A 3L4BC 1GZ3A 3I05A 1BCSA 2Q3BA 1QKJA 3EC7A 1TQ4A 2VPZA 1THTA 1ZGGA 2J3MA 3EXFA 1YRYE 3IEIA 4Q4AA 2NU7B 2LWIA 4RTQA 2O05A 3K8QA 1FFSA 2ZQ5A 2ABWA 5H8WA 4V0RA 4S3MA 1O94A 1KFKB 3TRFA 3GQBB 3C3AA 2VHUA 5ALZA 1YR1A 5G0SA 1IVNA 4UMVA 2PXIA 3O7WA 2H1IA 1FRNA 1PR2A 3OH8A 3PPVA 5EWMB 5AXAA 5IC4A 1V1MA 2HSGA 1QAMA 3RFTA 1Y98A 2FH5B 3DWFA 1MORA 3ZE9A 2EZYA 1N6PA 2MMCA 3KZCA 4RQ0A 1P4JA 4CMGA 3B52X 3AF3A 4CG2A 2VNHA 1LX7A 4GD3Q 4BUZA 2QSZA 4LV8B 4W5OA 3MMXA 4TKVA 1UL1X 1I4OA 1M2EA 3U7JA 1TUIA 3DFIA 2WUGA 3C5HA 4ED8A 1NSFA 4NFYA 3T3PB 3ZZUA 5BR4A 1RE0A 2XTAA 4IJUA 4KIGA 5J2EA 4PO8A 3PEFA 3T15A 2FRDA 2WYHA 4J1TA 3T8YA 4D8TA 5K8LA 4GYJA 1F2UB 1SRRA 3X1XA 1TYBE 2EARA 4J0HA 5BRNA 3NBMA 3U9TA 3I09A 3TDMA 4BKQA 4O4JF 4EA7A 5TRTA 3RBDA 4D98A 5K03A 1LV5A 3OHPA 2OG1A 5A4IS 1UZUA 1E5XA 4YMNA 4L27A 2OA0A 4Z2AA 3SF8B 5HSGA 4KPEC 5FUQA 4K9MA 4B85A 2PDAA 4BC1A 1PQYA 1J00A 1UDAA 4KLFA 4YRSA 2BE9A 4FFPA 3MB8A 5JS6A 3T1HB 4GI1A 1E3TA 1DXHA 2ZI7A 1XPRA 5KSYA 1ID8A 1J9ZA 1MABA 1V9LA 1J5XA 1XA4A 1A9RA 3ZOKA 3P8ZA 3KQLA 4FT2A 3KFUF 1N1DA 2BGIA 1TIKA 2YWHA 4Y6RA 2IOQA 4KLMA 4PG5A 5FB3A 3QE0A 1C1XB 4IUBS 3N76A 4CI0B 5DG9A 1O95A 4A4DA 4F5ZA 3CLKA 3SQNA 5KX5F 5HGXA 3B51X 1UFQA 3GJZA 1XVUA 3USES 5L4NA 4QM6A 5B7QA 4HDQB 5CNIA 1FX0A 3DBRB 3EEIA 3ZR4B 3WLNA 4C0HA 1YRQA 1G59A 5JW6A 3PT9A 3ZDEA 1WULS 4NZOA 2Z8YA 3WSVA 5LR6A 2C7RA 3RUDA 1GTMA 1OSNA 3EIOA 4R8RA 3VZSA 4KR3A 1XF9A 3VMFA 1SGWA 1LY1A 4YECA 2KBFA 3PXDA 3WK4A 3TZHA 4M9GA 3PR3A 3H4TA 4PXYA 4EY4A 2C94A 1ZIOA 4CF5A 1R8QA 1TM1E 4IJ5A 4JLDA 5ENZA 4BNVA 2VTDA 1KI7A 2XUGA 3DBOB 3G0BA 3I9FA 4PAQA 4YRZA 1C1XA 5F3DA 4ZGBA 3DFZA 5D2CA 3R7LA 3VPXA 4WZBE 4JMUA 1Y81A 3FCOA 2NXEA 5DHAA 2P4EA 2NNLD 1GO2A 2EFGA 3SM9A 3O0FA 1BWPA 1SELA 3EVZA 3S2IA 4DBLE 3CF2A 2HMAA 1VPEA 3T9BA 1EE9A 3VR4D 4AMUA 5AM0A 5FO0A 821PA 3ZWNA 3RJHA 1Z63A 2V7WA 3C6ZA 4U7HA 2AG5A 3WWOA 5KREA 1KI9A 1LNZA 1RFLA 3AMVA 3LK6A 1I36A 4UAWA 4R83A 3LCVB 1OFVA 3OIFA 2RBGA 1PL8A 1P91A 4OM8A 4WNIA 5K1ZA 3RC8A 3C2MA 4FZVA 4YRAA 1NC1A 2CLSA 2P91A 3DLAA 2BRUC 3UK6A 5I7RA 4TLMB 3JASA 1F0YA 1RYMA 4CKWA 3FMPB 2XSZA 3IVXA 1OXUA 1IWBB 1Z5NA 2B8TA 4KWHA 4MI1A 5DK6A 1EVEA 1O2DA 2Y0EA 2OXOA 3IQFA 3KKNA 4GPIB 4N4AA 4LZPA 5HHIA 3LWMA 4N54A 4R6XA 1JR4A 3H75A 3RC3A 2A9RA 1G98A 4C20A 1ZM9A 5KG7A 5B7GA 5FEUA 2CXHA 2VHXA 2QM0A 2WZCA 4FR2A 4OGKA 3TCXB 2C9YA 3MWLA 3CZCA 3FF1A 2AI2A 3A6LA 4GWKA 3RJ5A 4C7VA 2OKGA 3JWPA 1RBYA 2PJRA 3PGVA 1ZRSA 3KZIU 1XZLA 3HR4A 3IQXA 4G1CA 4ZT2A 3EXAA 2E9SA 2YOGA 2ZS8A 4BGIA 1RP7A 5DCUA 4MQFA 5IBCA 1FP4B 1R3UA 1M6HA 2PFGA 1KI3A 2QT1A 5JE8A 4CKZA 2BGNA 2J5RA 3N7TA 4D3YA 1APBA 3G6XA 3K4HA 1WF6A 3QUAA 4AVYA 3VR6H 4LXIA 2AT1A 4YIKA 1LF0A 1IDN1 4FFBA 1U0TA 1TLFA 4WOBA 5AKGA 3C28A 1KFCB 1T0PA 3QNUA 3HB0A 3SZ3A 5AVYA 3I0NA 4NZPA 1U8TA 4ZVSA 3ND8A 5CURA 5BYBA 1DC5A 1WQ1R 4TXMA 5FBWB 1W5SA 3WYDA 3E22B 4KYTA 2FDRA 3QVGB 2QY9A 1CVRA 1KOFA 1MO4A 1WIWA 3CV3A 4JEIA 4M9LA 4RVCA 4DMFA 4HN2A 2KICA 2H1VA 1G21E 4O5OA 3EBLA 1PCXA 3SJUA 1HE1C 1QWOA 4OLHA 5HR7A 2O1EA 5EA2A 1SG0A 4KSYA 3VAYA 3H9QA 3ALRA 2WWIA 4KXWA 2WVHA 5E3IA 3DT9A 3I45A 3ZV3A 2O5RA 4R05A 1F20A 4PSVA 3DC7A 1Q2XA 3CUUA 2WF6A 4IGFA 3IV9A 1M5RA 1Y1LA 4KEAA 1PGQA 2OBNA 1EXNA 5DNUA 5KSOA 4CNBA 1WPQA 2AOTA 3ER9A 1M8KA 4Y2PA 1F7VA 2PTHA 3MWEA 3ND6A 1O4VA 3OPQA 1TAHA 2VF7A 3OU7A 5C4GB 3T6KA 4AJKA 1LFDB 3W3AH 1X6JA 3OQIA 4RMIA 3DV0B 1MJ5A 5DI3B 1U8YA 1UKAA 5ALMA 1TEHA 5EOZA 2P9GA 3ZGVA 3PWSA 1PK1B 3QIAA 1U65A 5CEJA 4ECXA 4IMIB 2X0FA 3C5VA 3AFGA 1OXJA 3M2PA 4PCVA 4I50A 3MMPA 1P4AA 1D2CA 4BLSA 4G81A 5BO5A 4DA8A 1LWOA 2H1CA 2XIJA 2NV0A 4R9VA 4TSFD 3S5JA 3WYEA 5B1YA 1KMQA 4AO6A 1DTSA 4EKGA 3SZLA 1VB3A 2FFBA 2O8DA 3NC1C 1NVBA 1X7WB 3USCS 4FX2A 5LJLA 2OO7A 3ZWDA 1GRRA 3BGIA 4X93A 3WRYA 1PJ8A 5DG7A 2FXIA 3LLUA 2QQGA 4WCFB 1BHO1 1DC4A 4ZXPA 3VTZA 3ZYZA 4GUAA 1PS0A 4OQEA 3D6UA 1AMUA 4GQAA 4R1UA 4QXMA 4H08A 3Q7RA 3KKLA 3AUYA 3F71A 3JZMA 3W4KA 1JJAA 1XTRA 4XD2A 4KH0A 4CZ2A 2YV1A 2BFDB 3TAXA 3RSOA 1U0FA 3PSFA 4F3CA 1EWRA 1VCIA 4F2HA 5JJ5A 4JWNA 2C4TA 4L0MA 3C6BA 3UW1A 3VDQA 5C46F 4CEHB 3KU4A 3QXSA 1G5PA 2OTCA 1W0JD 5KHAA 3O3CA 1R4MA 5IF3A 1D9XA 2VF8A 1LV7A 3GCZA 2CKMA 3COZA 3VC8A 4GYYA 1EM6A 4PZLA 3IVGA 4XCXA 4C4YA 4FZ3A 2JH7A 2QMQA 3K0AB 4YUWA 1LGYA 5JFTA 5K0FA 3EX7C 1O77A 3HWX1 3U7RA 4Y2QA 4DRZA 1KDYA 4YMHA 4C76A 4PGXA 1VP9A 2MSDB 4GMDA 2EIXA 4M53A 4X97A 4IDPA 4DHWA 4CLEA 3PRHA 3X0DA 4D4MA 3W05A 3M4JA 4RQMA 5CFQA 2ZTEA 3V72A 3LM8A 3O73A 5E4JA 4ZT3A 1VHTA 2AE1A 2QZPA 3F4BA 3HYLA 1YQUA 3UHAA 4WVFA 3R7WB 2W9CA 2AQHA 2BPOA 1AZWA 4OHVA 3UA4A 5IEJA 3L6UA 1NXSA 5IIOA 4DSUA 2Q5QA 4WASA 1KXZA 1LQUA 2C7BA 4WKCA 5KEIA 4KV9A 3JQBC 2FN9A 4IJKA 1Z3EB 1V9SA 4M88A 5IJ9B 2QQFA 2YJ3A 4LMAA 3ZX4A 5ILOA 4LYHA 1NX9A 4RLFA 2E4UA 3OFKA 2ZLBA 4RQ5A 2HHHB 5LZ8A 3I61A 1JTVA 5I9BA 3LX8A 4EYGA 2V6BA 3UMVA 4EPWA 3FTEA 4OK6A 2J46A 3AL2A 4LXQA 4YAJA 4WBXC 3F5AA 4QZIA 1ONNA 4UB3A 3HWRA 4YJFB 3CJQA 2OCPA 3L5OA 4RKFA 4BYGA 1U7WA 3ZD8A 1NJ2A 5EE5B 3OJ0A 1IYZA 1G8FA 5JNLA 1GFWA 2C00A 4C7ZA 2BR3A 3EJWA 2C2BA 4XX0B 1GV1A 5BW4A 1I4TD 2FF7A 2BR5A 2QU8A 1JI7A 3LRPA 4H3VA 1KZ9A 3I9KA 4L9WA 4YRIA 5C5IA 4U02A 4YREA 4JLJA 1FTQA 1VZ2A 4GXIA 3V4LA 2YFKA 4FB4A 1GAEO 1A9XB 2KHZA 1JDUA 1XKQA 1E77A 3ZHSA 1FDIA 3HSSA 5ARCA 1JJBA 1W47A 2CFSA 3T5LA 4JJAA 1PG5A 2WJHA 5KYWA 3H4BA 3PJRA 4F4UA 1VOTA 2D54A 5KFRA 1YTLA 1ZXIA 1SVUA 1DSSG 3TLMA 3SENA 1LSJA 3O8DA 3KOUA 2XOKA 3TW4A 3UHPA 3NDJA 8ICVA 4MUYA 3H8JA 2AD5A 2BBWA 2Z7JA 1Z7GA 4MYUA 4GH5A 3H1BA 3GY0A 1TT7A 2I1WA 2FEKA 1ZQ1A 3H2KA 4RQ7A 2O3QA 2FPOA 4PC3A 1HDIA 3ZDXB 3ZWOA 4K6KA 2ODWA 2JH1A 2PQMA 1HFWA 2QJRA 1D6JA 1T2CA 2GXQA 3QKRB 2M2IA 2AFHE 3HXLA 5BMVA 5I01A 3HCFA 3KHKA 1SQFA 1UJNA 4LV6A 3MEQA 2IUTA 3QF4A 5HR5A 5J1SB 2CDNA 3PNSA 2Y8EA 5EZYA 4MXDA 1BPEA 2C3UA 1EDBA 1SCJA 3B8EA 4YC7A 3RVRA 1TUBB 1YD7A 1LJ8A 1RWOA 1I6KA 1ZD1A 3G2HA 4FUTA 4J4TA 1YJ5A 4OGFA 3C0KA 4XYGA 5CX4A 1L4NA 2W37A 3ISDA 4DSKA 1EEHA 1WJGA 3ROPA 4FI3F 3U7EB 1W6UA 4PIMA 3UFXA 3AVVA 3F74A 4YD1A 4JU8A 2P69A 3EXIB 2HK7A 5EJAA 4W63A 4QLBA 2RAVA 3R75A 4H6XA 1HZZC 2ZQZA 3H11A 2R8YA 3DVSX 1RM3A 2HHVA 1RHKA 3O4RA 4UHJA 1IJFA 2WRZA 4YMVA 3EZGA 2VQEB 1HL3A 1O9BA 2J5KA 2XA2A 1KSGA 2XOEA 4R3WA 2VDRB 3SP1A 4A73A 3CP8A 4RNMA 3OE1A 3PP8A 4YAOA 1H9CA 4CF4A 3W77A 3V48A 1OBOA 4KO2S 1P9WA 1ZBDA 1EFVA 2DZDA 5BSFA 2GTHA 3O74A 2CXPA 3TE7A 4E32A 4YMUA 4FEAA 3QTBA 4DM7A 4O4LB 1VB5A 2B61A 2PVSA 4LTNA 3FUXA 3EPIA 3R7SA 4EW2A 2PTGA 2HWWA 3K5IA 1GADO 2KMDA 2CHEA 3OZFA 2I71A 5K9ZA 1PYDA 1UCVA 1G8SA 2PVCA 3FFTA 3RS4A 2X4IA 1SXQA 2C4VA 2LZ0A 5GOTA 3Q9UA 1UIMA 2HSEA 1R6TA 3FF4A 2ASJA 2CCGA 3QJGA 3QI2A 3BN3A 3RB6A 5B4UA 3INTA 3DBLA 5KYVA 3OJOA 3OGUA 4YEDA 4RA6A 1RHRA 1FK8A 2FPPA 5BPCA 3E7DA 2CEKA 1ITZA 4MGHA 4C08A 4CHGA 1JHXA 5K45A 3U49A 4LJ6A 1NMYA 2QD5A 3HSYA 4U63A 4QM7A 4QUDA 2I66A 1AKNA 1SXHA 1HPLA 1XZGA 3FJ1A 4DRYA 5HHTA 3E3MA 3HRKA 4DS4A 4HLDA 3ZE7A 3INRA 3FPFA 4DQXA 1W36D 1ZESA 1L1RA 4XSGA 1DG3A 3OVMA 4NNOA 5KCMA 4DNPA 1Y5MA 3QX8A 3GQVA 4G85A 3ROMA 5KTSA 5KZMB 3IAEA 3A9VA 3EFBA 3LOPA 4DV7B 1MFZA 2IODA 4L51A 2AC2A 1UJMA 2TECE 2XYPA 2BMWA 4OK3A 2GF0A 1VYVA 3D8UA 3PQEA 4LGCA 1WZUA 4R8MA 5HW0A 2V6IA 4GKAA 4AW9A 4RAQA 1D2MA 1X86B 3UJCA 2VJ4A 4UDYX 3WGJA 1Z0IA 2BCUA 1PBTA 5FUBA 5J5CA 2C2WA 4BBAA 3LGXA 2I9GA 3KLOA 3ODGA 1MPTA 5FBLB 4EMUA 5FH9A 4YJ2A 2HVHA 2CKDA 4LMPA 4BFTA 1L5LA 4ZVLA 5KNLA 3RFAA 1RPNA 3T41A 3C21A 2H31A 4CTJA 3O91A 5KYXA 3Q7QA 4I7EA 2XKKA 4EBFA 3HJCA 4NH0A 1ZQLA 1FYEA 4U2EA 2CLMB 5CBPB 2J0UB 3OIWA 3MR2A 1E1QA 1P33A 2IW1A 4JB2A 3HO6A 3MGGA 4LYGA 1IZ9A 2OXCA 5A5VA 2WSSA 3W34A 3GIMA 3TRKA 1P1CA 1X9HA 2P3LA 2H2HA 4Q7EA 4F9EA 1OHHA 1TM5E 3CZAA 3O4IA 4NXNB 4XUSA 1ZVMA 1JBQA 3R5TA 4ALIA 3GAMA 3U4IA 4U6NA 3WV5A 3ICVA 1E1RD 4BFSA 4RHFA 2Q5JA 7ICPA 2O3TA 2PXHA 1WMEA 1ZJZA 3I1JA 2PX3A 4UU7A 5FA6A 3UYKA 3VNBA 3WWPA 4ALMA 3KTFA 1LLDA 4HAWA 1ZXXA 1YFZA 4C3VA 1U5AA 3BBLA 4F8JA 1Z0FA 2FPWA 2PKXA 2ZVQX 3T12A 2BQ3A 4YMSA 2RRDA 2OCXA 4YFYA 4Q43A 3OJCA 3U0VA 4DT1A 4M37A 4RIFA 4X6YA 2EYQA 2JFHA 4ENTA 3TAHA 3GLVA 1HDRA 5AKEA 4ZQBA 1FYVA 2ZSHA 1E9FA 2O2XA 4UMDA 1PJSA 3UT5A 2W9BA 3CRXA 1MC4A 4AZTA 1IQPA 1P7WA 4NEGA 2KZ3A 1CQJB 3B6ZA 3H3JA 4IUCS 4PVCA 1XZPA 3O1JC 4F92B 4HEJA 4FMPA 2YXNA 4K3VA 1E3LA 2QTRA 3IEKA 3DOHA 4DL6A 3F90A 3U7QA 3ZWPA 4UBMA 5IYZA 5JVDA 2QUHA 3CZ5A 3R3VA 5ALTA 3EGEA 4GP9A 1PWXA 2GLXA 3E5RA 4LRWA 3W5CA 1P1JA 4INOA 1XEFA 2B2NA 2FCAA 3HDQA 1T26A 3QE9Y 1N3LA 1EHCA 2K6GA 1UC9A 4WHMA 3NDIA 4UOEA 2QLJA 3X1KA 2VYCA 2YZGA 3T5PA 2WNHA 3AVPA 4J6EA 1PWHA 3MRSA 4ZO8A 3AJEA 2X23A 1QC5B 4TTQA 4U00A 4BGVA 1WEHA 1ZKMA 4J2OA 4LMRA 1DELA 2PLFA 1Q3TA 5FTJA 1SKUA 2X0KA 5J5AA 5L45A 2NQTA 1FP6A 4BKMA 5A0VA 1FUKA 1XWIA 4OKIA 1KRHA 5FYDA 1W2GA 2ZJ5A 1EZ4A 4ZP1A 3KFLA 4N82A 1QZXA 4L7VA 3RYFA 1PLLA 1KAEA 2QP4A 3T3GA 4HAXA 4YG2A 3LDGA 4U1RA 2WWGA 5J2CA 3PL5A 4EBBA 1Z5WA 3TIVA 3W5HA 1ZL2A 5FF9A 1KBZA 4ZOLF 4RUAA 4EB0A 4RETA 1AKVA 4GI3A 5AOVA 1XRPA 5JZ9A 1VLJA 4IRMA 5IPFA 1L5ZA 2PYDA 1DIRA 5JRZA 4JCCA 3BHJA 2FAXA 1LDBA 4YT4A 3OTQA 3ENKA 4Q4HA 3U1BA 2I7XA 2JMGA 3FBTA 1LKZA 4QJFB 4JVNA 1UP7A 3DKVA 3K0CC 5B55A 4KLNA 2WM2A 3TEMA 4ENQA 2GBCA 4IXWA 1JIVA 2FHPA 5G5HA 1C2YA 3GROA 3GDXA 4V39A 4RHYA 1T29A 3OQJA 2BD0A 4O2RA 4QLOA 1QE3A 2I7TA 2WDZA 5B4TA 3ER6A 1N5DA 3AF4A 1JHZA 1EUDB 3TQQA 1NW3A 4TSKA 4Q9JA 1T1RA 4Z49A 4A8JB 3EOAI 1B41A 4XQ8A 1IVYA 2Y0PA 3BC1A 3K4GA 1CUJA 1OFUA 4ZI2A 1FSSA 2HHCA 4L5JA 2BH2A 1CZRA 4BTEA 3AU9A 2VCHA 4JQZA 4ICIA 4N03A 2YN4A 3IOYA 3NEYA 4C6RA 1NZFA 5J0OA 4V03A 2EWMA 5C8XA 4QBIA 3K4QA 4PC7A 3TZEA 5BNTA 4NH4A 5TQ0A 5LP6C 1U8XX 3QELA 1EFCA 5I7FA 2E8PA 2GKOA 2VYND 1QYVA 3KQPA 2AL7A 2ZXIA 3M4YA 5DGHA 3N2EA 4GR4A 4BTVA 4F1KA 4FEYA 2AJBA 2QS9A 1BDJA 4Y9SA 2JDID 3RPEA 3LA6A 1UK8A 1SD5A 5GV7A 3SJBA 1HA3A 3BJYA 4BNNA 4LDPA 2RARA 3ESXA 4LHWA 1BWQA 4IH1A 5U9CA 5JS2A 5L4SA 1Z00B 2CXTA 3BB4A 1ZEJA 3B60A 1YS7A 3IHKA 2WYWA 3DT8A 5DDYA 1R8JA 4Q3NA 5E0KB 3NEJA 1NKEA 5FUWA 1C41A 3WLPA 2LNDA 5M2QA 2H8GA 2J3QA 2H00A 2IXBA 3O94A 1VYHA 4F84A 2O9JA 2PUHA 1DV1A 1JQBA 1OTYA 2BSXA 2FOLA 1UP6A 2HA2A 1JLKA 1ODLA 4NYIQ 2ID7A 2RGBA 2VT3A 2ZIZA 4EMBA 2HIHA 1I8TA 3ILXA 2WB4A 1JMSA 3B9BA 1Q0ZA 4LECA 3HXKA 1K92A 5E7QA 1A4UA 1WMSA 2PHZA 3AETB 1HG0A 2DBVO 3I1IA 4LDRA 3D9QX 3KJHA 3EF3A 3KXPA 3MJHA 3OOHA 4BTLA 2B4YA 3C3BA 2XZTA 5JRJA 2R8XA 2VHQA 3FROA 3V6LA 3H2ZA 1E2QA 1WB4A 3C4QA 5EIXA 1RYBA 1FE8A 5CM9C 4U8GA 4JL6A 1XP5A 2G9UA 3Q6IA 3N28A 4NE2A 5BN5B 1Q84A 4FYXA 4UM9D 3CLTD 2EJUA 1VL1A 4LJ8A 5FL7D 2CE2X 4DIKA 1QFZA 5K2OA 5KFZA 2P11A 2IIQA 5IVKA 3PE6A 1KSHA 3ISBA 5SY6A 3MAJA 4UJ5A 4XLTA 3KQMA 3QYPA 4EEYA 4DCOA 1FFHA 1BCRA 3QUSA 3MR3A 2WTUA 4AO8A 2AN5A 5I6DA 5LLTA 5F1YA 2WG2A 1KGDA 2VCEA 3ZK9A 5AK4A 5ENVA 3THOA 1TC1A 1PNRA 4UUPA 1E6CA 4V2UA 2IHTA 1KZ7B 2E21A 2ETVA 3OEHA 5F3RA 3SBDA 1B2RA 4CT0A 4QJBA 2C84A 2H6EA 2LTAA 1KOGA 1JW9B 2F90A 4PL1A 5FFFA 4A23A 2WKWA 5H4GA 4NV0A 2OLEA 4K9KA 4KXLA 2DB3A 5EMJA 1K4KA 1GCIA 1R0BA 3OWOA 1CBUA 1U31A 5HIIA 3NPMA 5H1YA 4CNQA 5IT0A 3NYWA 2I0FA 1YUBA 4DC0A 4BNJA 4CQLB 2XMDA 3OZ7A 4B9AA 2EJTA 4C0WA 1KMCA 4EAAA 3PC4A 4WN9A 3Q2KA 1IZZA 1EKXA 1TCUA 3MCWA 1EFRD 3ANNA 3OCUA 5FX2A 4IVPA 3K6SB 1QHEA 1ZIPA 2Q4TA 1MENA 2WHXA 4EKDA 2P0EA 5C7OO 4HL6A 2EJVA 3E5HA 3MJCA 4D0RA 3O4HA 4KPYA 1QK5A 1AV6A 3NM5A 1K6JA 5KVAA 2NMVA 5FWYA 8ICAA 4MF2A 4J3NA 2PGXA 5ALJA 2B1IA 2QX4A 4WJZA 4ID3A 1B43A 2J9FA 3NBXX 4DADA 3SYMA 3L8FA 5GQSA 3P71T 1TF7A 4QG3A 5ITWA 1K89A 5EZ5A 2PX4A 1P6XA 3G0GA 2OHOA 3T94A 3L8CA 2KE7A 1JEQB 1QO0A 1W87A 3CA8A 3LYLA 4CIDA 4PNEA 5GZ3A 4MYSA 1E3QA 2GZAA 2FW7A 2FZLA 4OATA 3WLFA 4NYMQ 4JBXA 4EW3A 1XLTC 1TCVA 2VJCA 3H5AA 4NATA 2B9EA 3L79A 4HDNB 2MJLA 1O95C 2IT1A 3KFVA 5JASA 1CF2O 1UP4A 5C1DA 4I2AA 1IN5A 2YN0A 1ZUIA 1O9HA 3AIOA 2R60A 1E6UA 2HA0A 2QLNA 2P75A 3QKSA 3VBEA 4B5LA 3QXGA 3QWAA 1V0JA 1UBSB 5FBHA 2FSVA 1ORVA 3FAZA 1VCMA 4O4LF 2PQ2A 5IAJA 4EF4A 2XY5A 1YE5A 2O8FB 3DEJA 1FSGA 1PO7A 1SCBA 3RFVA 3VDXA 1DOHA 2QN8A 5CB6A 9ICGA 3GAZA 2CL0X 4P2HA 4G4IA 4LGVA 5EP1A 4UM9B 1NVWQ 1UF9A 1IOWA 1J21A 1A7UA 1SA0A 2YNMA 3TR5A 3ZKAA 2ZBQA 2JEGA 5JS7A 2I91A 2ETXA 3JQEA 2B82A 1ZINA 5C0YA 2KPOA 4OJ6A 2QIPA 3CH7A 4JUDX 1EFLA 5JDCC 1X9WA 2REQB 3KJIA 2UU9B 1B4FA 2ZROA 1N5WA 5ITZB 5FNVA 3C8HA 2HW8A 4CFYA 4DEVA 1T8RA 4DMUB 3RYFB 4CI9A 7GPBA 1FEZA 3KKEA 3KLNA 3FIJA 4DL5A 3RSHA 4QD3A 4QVGA 5AVWA 7ICFA 5A04A 3IQHX 5KB3A 3ENNA 4L7QA 3WAGA 3THWA 3QX3A 1PR3A 1QMGA 3D2BA 1G4AE 5EUBA 5IKOA 4YRBA 1PDVA 1SOUA 5FOQA 3E4DA 4PQYA 4P0QA 4OLFA 4B45A 3LE8A 3TTSA 1MRNA 3F3KA 3QTTA 1XK7A 2F17A 1GUZA 2IXTA 3EOZA 1KC1A 1NBEA 1PV1A 3ELYA 3OU2A 3ZKWB 1NDHA 2XQKA 4US8A 3DQQA 3HCCA 1D1PA 3LT4A 5KC8A 2BH9A 4QDKA 3EYAA 4DLGA 2WPDA 3IJ5A 2UUCB 1S2OA 1SCQA 3IRUA 4NARA 4G8BA 4QWEA 4P4TA 3IOMA 4RXMA 1TM2A 1FNNA 3D5TA 3IXLA 3R4CA 3TLKA 2CFCA 1BWSA 2ZPAA 2XKJE 4WXYB 1X2IA 3PPIA 1E62A 4O0MA 5EPOA 2NSHA 1X1SA 4ZC8A 2W2QA 2PLWA 3DL0A 4DIBA 4B17A 5CA0A 2JDIA 3O93A 4HNGA 5G41A 1N4DA 2WLTA 5KQRA 4R1TA 4FN5A 1AGNA 2HJRA 3EAGA 1PTJC 1VLBA 3GRVA 4XIJA 3GEHA 2KVCA 3ZD9A 2BCVA 3HQ4O 4KAXA 2R44A 4XPZA 2Z3VA 2K4EA 4QOSA 5DFAA 4FYWA 2VPIA 2DUUA 5HFNA 3RIMA 3ZZMA 4FS1A 1NUHA 3MB5A 3PHHA 3ZKWA 4O3PA 1Y9JA 3C5GA 1NJGA 4AY5A 4JBGA 1TL7C 1ZJJA 3EXEB 4GX5A 4GC5A 4HZUA 5TGDA 4GKBA 4Q4JB 3A1SA 3VZQA 3VHRA 4ESOA 3QW2A 4C14A 5SY9A 1YGPA 2J9YB 3OZVA 3E7FA 1P4GA 2X6RA 3HL0A 4MVJH 4GMXA 1QRSA 1C4OA 1G20E 1DZIA 3K1ZA 1MX3A 3EIHA 4IX9A 1CUDA 3FTPA 1EB9A 4PHTA 3RS3A 1NXTA 5EHZA 3COWA 1B16A 4F2WA 1F6WA 3A1VA 3NI2A 2ZSDA 5WRFA 5J4KA 3TLCA 1W36B 2M1ZA 4Y6SA 3CZRA 2MSWA 2P4QA 4Q3BA 2CLEB 4UOQA 9ICKA 2BQRA 2CD9A 2YHSA 3S0JA 2OGWA 3TLXA 1DG9A 2R00C 3C1TA 4BMZA 3O8NA 2GD2A 2CWDA 3SMQA 2CPRA 3DGEC 4ZVQA 3UO8B 3K2QA 3JAMA 4OL9A 5KAFU 3FCEA 3CS3A 3IP4B 2X7JA 2XZDA 2JPDA 2RFLA 4MV3A 1G1AA 4RK1A 3TFWA 2FW9A 2RGGA 1M1UA 1ZI8A 4EW1A 2H0RA 3LUAA 2QQ0A 4KN7A 3RBAA 2PYZA 5M04A 3VZDA 4OHRA 2Z4SA 3QPDA 1TVKA 9ICSA 5CIWA 4DV1B 2GAFA 2DWPA 4DSLA 4K6GA 4MSUA 4O02B 3IMCA 3SAFA 2WSSD 4C01A 1KGSA 3IQDB 2BEVA 3MOIA 3MTAA 4JXZA 2JASA 1Q7CA 4UUAA 1FDRA 1ORWA 2D8CA 4UAUA 3IVCA 1OAKA 3BQ1A 5EP2A 4B87A 3E53A 3HKEA 1M74A 5BQPA 4YUVA 3T54A 2W9MA 3O2JA 3CX8A 4MYCA 2H9IA 2D8AA 1XWFA 4FD2A 4PM4A 4O3RA 4ZXFA 1LKYB 1I30A 2XRZA 5AKXA 3M5WA 2CZGA 5AVUA 2W54A 2IU6A 2MU2A 1R15A 1IXKA 4NM1A 2HZBA 2ZR9A 4R68A 4BO9A 2QRUA 4QZGA 1V8FA 2BM9A 3GPIA 3Q0EA 4J7UA 5J47A 5K0JA 3AL0C 3CURA 2ES6A 2YCBA 5J2UA 1L4GA 5A5FA 3KHRA 4KHPB 1E9VA 1A2KC 2HWXA 3IE0A 3VVCA 2F9MA 3ZCQA 1XDSA 2NRWA 1V25A 2EZUA 1Z15A 1JA9A 3EA0A 5DWDA 1G60A 5KYKA 3RUIA 1G8AA 3ADBA 3FDIA 2PO5A 4TZKA 5EJ5A 3ELWA 4AZWA 1VMAA 1SVMA 5GGXA 1HURA 2ZB7A 4OA8A 3HNPA 1V9CA 5F1KA 1G21B 4G9BA 5F7JA 1KDZA 4NJMB 3RRFA 4ARUA 4BMOB 3PKIA 4DUPA 1R4ZA 4YDQA 1DGSA 2RI6A 3AB7A 5KHOC 4R7TA 1YTUA 4ZDJA 3FCYA 2ACKA 2E4YA 3AUOA 3MCTA 5SZJA 5KU1A 3LYSA 1FX1A 1KR5A 1M2NA 2J09A 2JEZA 3PTLA 2PL3A 2JGEA 4RHXA 3LG2A 4YHBA 3WP0A 1X40A 3KQVA 2J3KA 3T3OA 1DAGA 3HJGA 3BCHA 1QK3A 3KPYA 3W5IA 1J0CA 5L1LA 3E8SA 4O4LA 1Y6JA 2EBHX 3ZHXA 2ZRLA 1GKLA 4UBJA 4KQWA 2JFYA 4QEZA 4NFSA 5TQ0B 1DBVO 1PWZA 4MGKR 3FWKA 3X43A 4Z4IA 4MUAA 3GLIB 3PHLA 2DH5A 3KCNA 4RTRA 3ROGA 1TIPA 3G9ZA 4O2LA 2JFNA 3MWEB 4B6FA 3K94A 1CDOA 2VHYA 2WYIA 3D2LA 3Q0TA 4HN9A 4P0TA 4W5WA 5CVUA 2WVAA 4CCHA 4DM3A 3LY5A 1VECA 3LVBA 3PD0A 4PHDA 1R9JA 5DSZA 5JISA 1MGPA 1OZAA 3PDIB 4GC6A 1D2NA 1PE0A 1R88A 3EDQA 4C03A 5CDSA 2KKPA 2IYSA 3UMYA 4OKNA 2B99A 3WS7A 2FYTA 3ECAA 4UPVA 4Y2YA 3RQIA 3LCUA 2X1LA 2BCQA 2XUOA 3W4JA 5CLFA 2FPIB 8ICMA 4P38A 1WOYA 1DUVG 5U1PA 5FWXB 2JGFA 2C5AA 1N2BA 1GFSA 4IDHA 1UH5A 3TBHA 1ZS9A 2B0CA 2V7GA 2CVZA 2W0MA 1SXJD 2O8CA 1DC8A 1OI3A 2JH9A 2JIOA 3ZDDA 3RABA 3NR2A 1GQFA 1O7JA 3MWJA 4NV3A 1S97A 3SZUA 1SVOA 4TXLA 3VFDA 3K5PA 3HXMA 2WF8A 4GVXA 1WXGA 2G7MC 3QV2A 1TTQB 3V7FA 2ZKIA 1SN7A 2O1SA 2XY7A 1DJOA 4AQYB 5BN4A 5ALWA 1QGYA 2OO5C 1CJCA 2OAGA 1JTFA 4QJ5A 5JAMA 3NAQA 3SXUA 1CUBA 2XQFA 3R5JA 1QXSA 2ID4A 4YALA 1RZTA 1ULUA 4OH1A 3H8MA 4HEHA 4U7WA 3GEDA 4FSHA 1QPZA 4KIUA 1QVRA 5G1OA 5LLSA 4ECAA 5JSZB 5FWXA 1N8TA 2R1UA 2JZBA 3FZQA 2J87A 5D8DA 3RAGA 4ND6A 4DDTA 1ZOLA 4FHFA 1QO0D 2GI4A 4GECA 1E9BA 1KFSA 3ORHA 4JX9A 1L4LA 3O95A 4RZIA 3SS7X 3UTCA 5IJ0B 1KHTA 4C0JA 3GQBA 4Z4HA 1Q1GA 1N6HA 1ZIDA 1M8JA 3HS3A 4TYPA 5KTNA 4RNOA 2HTFA 1KPHA 2JIBA 3M70A 4OKSA 5KYUA 3PGMA 4IDDA 4QXRA 4P83A 1EZZA 1TO6A 2PH3A 3JRWA 2XUZA 5BSGA 2G1UA 1GARA 2Z6QA 4LHEA 2BPFA 1DRWA 3EZ6A 3ZVKA 2XODA 4OJNA 3WZLA 2M6LA 4KLJA 4BVKA 4K0RA 3WXBA 4A9AA 3G6YA 1MTZA 5BSTA 4H3KB 1FQKA 3AZOA 3DP9A 4TKVB 1GL7A 3T7EA 1Q8KA 3TQRA 5F9NA 5F64A 2C4WA 1BROA 3LBAA 2Q5FA 1A8SA 2VPPA 2AOUB 2GYYA 3EZYA 3TAUA 3LKVA 1SKMA 3NTQA 1JDTA 1KQOA 2HF2A 4LBVA 4S05A 3D7RA 4RZSA 1T2NA 1RWNA 3S2UA 1N60A 1Y37A 1Z45A 2Z3ZA 3ROEA 1GKKA 2CNDA 2C4NA 2NYRA 3MTGA 2DSNA 3Q3CA 3WGQA 1COZA 4HPWA 1M6YA 2BFMA 2C2XA 3KXIA 1QO7A 2Z6AA 4INAA 4U9UA 5LD2C 5KFNA 4GPBA 3FA2A 2DOKA 2W11A 4V0SA 4JI8B 4IEFB 1WA5A 4F8EA 3ZIAA 3K15A 1QFXA 2XNJA 4D42A 4S2EA 4B4KA 1HE3A 1R64A 3GGGA 5DM2A 1XZNA 2QMZA 1MQ9A 4I5FA 1GGKA 3HZRA 4KXUA 4P3NA 1YZKA 3A8TA 4MTLA 1I7NA 1QC5A 3T1OA 1M7GA 2AA3A 4HFRA 5GAJA 4K9SA 4RZ3A 1E18A 3TZLA 3UXNA 2XV1A 3EW7A 3HEBA 3IAUA 3R3UA 4ZYLA 1QZUA 2QP9X 3B78A 3CSSA 3R09A 4BOYA 1FFEA 2UZ1B 2C31A 1VIDA 1Z6TA 2G72A 4J1SA 1AOXA 3E7PA 4TTTS 4BDPA 2W71A 4Q3DA 3RAJA 1CF9A 3GDFA 1K5OA 3KU1A 4QYSA 2BMAA 4MVXA 4ZCTA 3E9NA 3AL0B 3MFYA 1PX0A 2R6R1 1U7ZA 1DBRA 4F6RB 1K1EA 1T6ZA 1UPXA 3IUJA 1TD1A 4XQEA 4C89A 5FL3A 1SCNE 4B3HA 4MRPA 3SKXA 3LTEA 2W83A 4FR5A 3SC4A 1NLMA 4H27A 4EHBA 1NKSA 5KNBA 2Y67A 3AF6A 2G09A 1L7EA 2CLHB 1W4LA 4Z51A 3ABZA 4DQIA 3D6HA 5J23A 1U4SA 2FMHA 3JATB 5C35A 4IQUA 2KW5A 4BO3A 2WOOA 3ZY2A 1E5QA 4M7RA 4MS1A 3MAGA 5KKNB 1LUAA 1NL3A