2YMPA

Chloroacetic acid complex bound l-haloacid dehalogenase from a rhodobacteraceae family bacterium
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
225
structure length
224
Chain Sequence
SGILVFVNETLLDLTSLSPLFERVFGDAKVLREWFPELILYSQTLTLTGLYRPFGEIAAAVFEMVAANHQAKVTPDDIAELKTRLTSMPAYPDVAPALTRLQDAGFRLVTLTNSAPSPAPSPLEKAGIASFFEAHLTVHSSQRFKPHPSVYDSTAETLGAKPEELCMIACHIWDTIGAQARGWRGGFVARPHNTPLTLAEVPQPDFIGRDMGELADQLIASLTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Marine Rhodobacteraceae L-Haloacid Dehalogenase Contains a Novel His/Glu Dyad that Could Activate the Catalytic Water.
pubmed doi rcsb
source organism Rhodobacteraceae
molecule tags Hydrolase
molecule keywords L-HALOACID DEHALOGENASE
total genus 86
structure length 224
sequence length 225
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2ympA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2ympA01
3L8FA 3N1UA 4NFLA 5ALZA 3KBBA 2R8XA 5A3QA 2MU2A 5ALRA 3WKBA 2JAUA 2BY4A 2WM8A 3OCWA 1RKVA 3QX7A 3ZVMA 4UARA 2CFRA 1XVIA 4OFZA 1ZJJA 1ZRMA 2W43A 2WF7A 4EX7A 5AIAA 4RETA 5ALTA 3WK6A 3WK8A 1YMQA 1YJ5A 5AVYA 2FPWA 2HO4A 3SKXA 3ZVLA 5AKGA 2C88A 1Z4JA 3MC1A 4NWIA 3SLRA 5ALSA 3VAYA 3U13A 4KX3A 4BNDA 1VJRA 1WPGA 4NABA 3AR7A 4XOUA 2RB5A 2O9JA 4J2TA 3DDHA 4HGNA 4BBJA 3ZUPA 2Q4RA 2MSNA 3U19A 4DW8A 2Q4TA 4FE3A 5AK5A 3QYPA 3N8GA 1TA0A 1RC8A 3UMCA 5AW8A 5AM2A 2BDUA 3ET5A 2YMMA 4XE5A 3ED5A 1U2TA 1Y8AA 3ZVNA 1L7PA 3UM9A 1T5TA 3EWIA 4RESA 2PKEA 3SKYA 3QUBA 1NNLA 2GHQA 1YS9A 2FEAA 3FZQA 4BEWA 2NYVA 3WK4A 2DQSA 1N9KA 3QU4A 5AI5A 5ALYA 5AVQA 5AW2A 3J7TA 3A1EA 2FUCA 3P96A 2IOFK 3NAMA 1S8OA 4XQ0A 2AMYA 1X42A 5AKEA 3I76A 2G80A 3HLTA 1U7PA 1ZS9A 4Y2VA 4HGRA 4OCZA 5AK4A 3WGUA 3R09A 3L7YA 2G09A 4UAUA 2GHTA 1TE2A 1L6RA 4IFTA 2OM6A 2NO5A 2VKQA 3KC2A 3QU7A 2FDRA 2YBDA 3IB6A 4CE6A 3U7GA 3U26A 2ZBFA 2YMQA 3NIWA 4Y2SA 1Z5GA 2G07A 5AVUA 1O03A 3AR2A 2EATA 5AI9A 1Z4OA 1YNSA 3PCTA 4KNVA 3WGVA 3QUCA 1YDFA 4C4RA 5AW3A 1Z4KA 5ALFA 2ZBEA 2HI0A 3L0CA 5AIBA 1WVIA 2QLTA 2GFHA 5AK3A 3N28A 4HGOA 4C4TA 3AR4A 4HGPA 4QQFA 5IT0A 3QUQA 4Y2RA 4YIKA 1CQZA 2HCFA 3WKEA 3BWVA 5AK6A 3D6JA 1WR8A 1Z88A 4YIHA 3FGOA 4EZEA 4Y2QA 1YV9A 4Y2PA 2CN1A 2JAOA 5A3SA 3U7FB 2C9MA 3U7EB 3A1CA 5AVVA 1L8OA 1NF2A 5ALIA 4UU0A 2I55A 1SU4A 4ZEXA 2RBKA 3MPOA 5AKIA 2PQ0A 3ESQA 5AM4A 1O08A 2ZOSA 5AW7A 4Y3UA 3L5KA 3PGVA 4HAIA 2B82A 1Z4IA 4KNWA 3FPSA 2JGAA 5ALOA 5AM3A 3CNHA 2C8KA 3SD7A 2WF5A 1L8LA 3I1YA 3QU5A 4E88A 3OPXA 4UMDA 1U02A 2CFSA 1QQ5A 3WKAA 5ALXA 4YCLA 5ALQA 2R8EA 3CZ4A 3IRUA 2MU1A 5AKZA 3PDWA 4UM7A 3FPBA 1RQNA 4DFDA 4Y2XA 4I9FA 4MUMA 5IS2A 4FYPA 3GYGA 1TJ5A 2P9JA 2HEGA 2QYHA 3SMVA 4KN8A 3E8MA 1Z4QA 1KYTA 5AESA 3AR5A 2O2XA 4BX0A 2I54A 2ZXEA 3L0YA 2HF7A 4NAVA 1RPZA 2GO7A 1ZRNA 1L7MA 1Z4MA 1PW5A 1Z5UA 1RQLA 2W11A 3WK7A 2FPRA 3E58A 3OTQA 3KOOA 2B1RA 3NANA 4UMVA 1IWOA 1RDFA 2JARA 2IOHA 2FUEA 4OD0A 3WK5A 1NRWA 3EF0A 3ZI4A 3QNMA 2R8YA 3QU9A 4NV0A 4PNHA 4Y2UA 5ALGA 3W5AA 3ZTWA 1Q92A 3F9RA 4AS3A 4EELA 2YY6A 4L57A 1CR6A 2I6XA 2W4MA 4UMEA 5A3RA 1U2SA 4QJBA 2HSZA 4GXTA 1Z4LA 1SWVA 1Z4NA 2IOFA 2HF2A 3AR9A 3E84A 1TJ3A 1Q91A 2ODAA 3EPRA 5ALHA 4UW9A 1QYIA 3AR6A 4BX3A 3NUQA 2PR7A 2AUTA 2CFTA 3NALA 4ZEWA 4C4SA 2HDOA 1RKQA 3N07A 3SHQA 3M9LA 3HYCA 3KD3A 2YJ5A 4AS2A 3DV9A 3I28A 4G63A 4DCCA 4GIBA 3B9RA 2JAWA 4EENA 1VFPA 5AICA 2YMLA 4Y2JA 1J97A 4G9BA 5FP0A 2RAVA 4BEVA 2IYEA 5AW4A 1QQ6A 3TLMA 1F5SA 5ALKA 2HHLA 3QXGA 4L6AA 1EK1A 4EX6A 4UASA 2R8ZA 3W5CA 1RMQA 3L8EA 3DNPA 4O8CA 4AP9A 2B0CA 3U7HB 5AI8A 3ZWDA 4IG4A 3L0BA 3IJ5A 3L8HA 4MWOA 5ALMA 3SF0A 4CNQA 5AVRA 2B1QA 3ZX5A 2HX1A 1ZD4A 4CF3A 3OCYA 1QH9A 4KX5A 5JJBA 2G08A 3PGLA 1Z4PX 2FPSA 2NO4A 3BA6A 3ONNA 3R4CA 1ZD2P 1K1EA 1SWWA 5ALVA 2GMWA 5ALDA 5AW0A 1L7OA 5ALEA 4UMFA 4CF4A 1VJ5A 3QUTA 1RMYA 1LVHA 2WHEA 4EEKA 1ZOLA 2G0AA 2OYCA 4BNDB 5IT4A 3ZX4A 4YCMA 1EK2A 2Q5EA 3AR3A 5AI6A 3R9KA 2AH5A 3OCVA 2FI1A 3DAOA 3E81A 4BX2A 1RRCA 1MH9A 2B30A 1LTQA 1XP5A 2YJ4A 4UATA 2WF8A 2X4DA 1ZD5A 3ZTYA 3RFUA 1N8NA 1RLOA 3QLEA 3UMBA 5T41A 2D2VA 3WKDA 4YCNA 3ESRA 2OA0A 2B8JA 3W5BA 1ZD3A 5AW6A 2EAUA 3FVVA 5AI0A 3KDPA 4YGYA 3B9BA 4UU1A 2YJ3A 5E0OA 4CF5A 5AVSA 3N5KA 5ALUA 1J8DA 5AM0A 4B6JA 1T5SA 5ALLA 5ALPA 2I7DA 3QU2A 1WZCA 3A1DA 4XPZA 2ZG6A 4I9GA 3UMGA 5AW9A 2P69A 4FFDA 4UAVA 3L1UA 2IA5A 2I33A 4F71A 5AHXA 3ET4A 2C4NA 5ALNA 2OBBA 2EARA 4L6CA 3EF1A 1RLMA 1RKUA 3MMZA 4JB3A 3M1YA 4Y2TA 3MN1A 2AGVA 3OCUA 3FM9A 3ZW7A 2YFYA 2FPXA 3RF6A 2I34A 2YMPA 1XPJA 3B8EA 4HGQA 5AVXA 5AM1A 4Y2YA 5AM5A 4BYGA 2WF6A 3I6BA 2WF9A 2WFAA 1T9ZA 3W5DA 5AKYA 2C8LA 2B8EA 3WKCA 5AKXA 4F72A 4H1WA 5AVTA 4ZEVA 5AW1A 4HYTA 1L7NA 3L1VA 3KZXA 4KYTA 2ZBDA 1S2OA 2RARA 1RLTA 4UM5A 5ALJA 4J03A 5AI4A 4JDPA 5AVZA 3AR8A 2HOQA 2FPUA 3A3YA 3NRJA 3K1ZA 2G06A 2P11A 5AKKA 5AKHA 5AKJA 1AQ6A 2YJ6A 2G1AA 3ZU6A 2P27A 3ZWKA 3OCZA 1QQ7A 5ALWA 4BKMA 1TJ4A 2ZBGA 1RMTA 5AVWA 2BDEA 3NASA 1U7OA 3OCXA 5AKLA 3S6JA 4OHFA 5AW5A 3WK9A 4DWOA 3QGMA 1FEZA 2YN4A 1JUDA 4YH1A 3L8GA
chains in the Genus database with same CATH superfamily
2CF6A 1QTIA 3TDMA 5CX1A 4DRZA 4US9A 4W9RA 3DHVA 2ZP1A 3BULA 4XDHA 5B57C 2XYHA 4LMRA 5LYJA 2C7QA 3R0JA 3G89A 1J2JA 3IP9A 1MO3A 4MEJA 4QULA 3QP9A 3LKVA 5ERGB 2EF1A 3DMTA 4HZGA 1IPFA 3BX1A 3E15A 3W3AH 1AKYA 4FCWA 2IH2A 1C0PA 4M99A 4AQDA 3RFTA 3CH6A 1NBHA 3FUTA 4Q9DA 5FWXB 2NV3A 5HKAA 1A04A 1UM9B 1QLWA 1ZJJA 5KFMA 4RPLA 2DHQA 4UDNA 2ZQZA 5SV2A 1UEJA 2BJVA 4B87A 3PLNA 3HSSA 1ES9A 1XTZA 3V1YA 1W88B 3OQBA 3HXQA 4KIWA 1DI0A 3TEJA 2ZRAA 3AFGA 5AVYA 1W5EA 3PL5A 1HT3A 4J07A 1NR7A 2IYLD 4UU8A 3DMTC 3I6IA 2HPHA 2WG0A 1UAYA 5B3AA 3ZEIA 4M0EA 1C2TA 3E3AA 4F60A 1JEYB 3RWOA 3C5WP 3C3CA 2YWHA 3DTTA 1XU4A 3HB1A 4IJ5A 4PYNA 3F7NA 4WN9A 4CLRB 1S96A 1V16B 2ICAA 2NZYA 1B0XA 5AD1A 4NY1A 1MPTA 1QJCA 2PJDA 1L3CA 2RB5A 3EXFB 3NONA 4EG3A 4F91B 3DDHA 1OZ0A 2J6UA 1ZH6A 4FHCA 1XTKA 3U40A 3RUPA 3EZFA 1P1IA 1XL1A 2QNBA 3OJLA 2PM8A 5FOXA 4Z2AA 4ZYZA 4DLEA 5J58A 2HA4A 3SAFA 5KYWA 1IXYA 4BWFB 4ARIA 4I46A 4B8ZA 3F71A 4AJIA 4G5YA 3S2GA 4XKJA 2IF2A 4UNIA 5CDGA 1L4LA 2BDUA 3JTEA 2AFHE 1KP3A 3ET5A 4S12A 2RDIA 3ZE6A 1E9FA 1XCLA 1NYLA 1MJHA 1ZU5A 3D8HA 4JS0A 1SB8A 1ZJ4A 2ECOA 3I37X 3Q7SA 3FZYA 3DOCA 1Z37A 1QPGA 1I7SB 1E3MA 3BQMB 2CYAA 3SAGA 4MEBA 4U7FA 3SKYA 4O63O 1MOPA 2VYCA 3I9V6 1UP7A 4UBIA 1OKKD 2ZSEA 3OCCA 3DDOA 2CL6X 2A59A 1GPAA 3I9NA 3R6LA 2AI3A 2RH4A 3U1TA 4BVKA 2B3DA 2CLKB 4ZEOA 2BM1A 2LKDA 1DRUA 1M75A 3L6UA 3R0ZA 2HCRA 1CHDA 4IKOA 1J09A 4DWJA 3F5FA 3PO5A 4D8YA 1GTRA 5EMJA 3ODPA 2O20A 3DL7A 3FHOA 1HX7A 2YR0A 4YRNA 5EA2A 1VZ2A 2BMVA 2G80A 2WP8J 5DEOA 3TGPA 1WUDA 3NOXA 1P1BA 2G9ZA 4PL1A 1YU9A 1V5WA 2BFDA 4DLYA 4E46A 4EG6A 2Y1LA 3FFBA 1TJYA 4KMOB 3G2IA 4TQGA 1C7YA 1DDIA 2DJ5A 3E5RA 4FS3A 4YONB 1EX9A 1CT9A 2LCQA 1YR9A 1TE2A 1NK6A 1P4SA 2EWMA 1JEOA 1N62A 2ZTEA 1T2CA 4GKVA 4UXIA 5CLQA 4BO1A 1V11B 4DMGA 1Q14A 2J9ZB 5C8DA 3A6EA 1PNRA 1OTYA 2ZIEA 5DSTA 3E48A 2AG6A 3S2YA 3PGA1 3OZTA 2D1YA 4ZI7B 4I8IA 4NESA 3CLVA 4IG9A 4D4MA 3IMGA 5JS1A 1EFVB 3CX4A 2TMYA 1WDMA 1SK9A 2IHZA 2BBTA 4Y0NA 1O03A 1CZNA 4KOEC 5IM4F 1V0JA 3NUZA 4IPTA 1HT2E 1P0CA 3KWMA 4LNAA 4AKSA 1QTRA 5LOVB 4D6YA 3EW9A 3Q8PB 2AWNA 1L5HA 1PKXA 1N3IA 1QH8A 1RIFA 1UPFA 4B74A 2Y9TA 4UXHA 4BCBA 2VNIA 1KAGA 1SGWA 4JGIA 1B4FA 5CLIA 2QVBA 3RNOA 1LUAA 3VSEA 3ZJTA 2ZSUA 3OPVA 4TUQA 1MZVA 1PU2A 3HUUA 2QLTA 3DXFA 1VC2A 3CHYA 3QZUA 4H59A 2BTQB 2GCOA 3VU8A 3ZHXA 2QNIA 1CRZA 4GM4A 3UH0A 2IGTA 4BKQA 4EYSA 2AFIB 5KDOA 4NENB 4DMLA 5DI9A 1FL9A 2ZAIA 3WKEA 3QLUA 4EBDA 5IEBA 1WR8A 5ADVA 2ID4A 1ODFA 1T8RA 3JATB 4KXQA 5DKWA 1K88A 1D1QA 3OZCA 2LYBA 2ZFUA 3TZHA 4F4DA 1IJFA 5AVVA 3C7KA 3OE5A 3ABSB 1QQBA 3NU1A 3DB1A 3I64A 5HE8A 1ZQFA 1U80A 3LSTA 3RRZA 5IXJA 3MPOA 2CD7A 4M9QA 1G5FA 1V1MB 4F3KA 1IHOA 1GT91 1Z07A 2VP6A 4QYIA 4Q8EA 1OE0A 1FTSA 3OJCA 5FUWA 4OU5A 3B6JA 1E1QD 4B7UA 3DXXA 1KRXA 2C2BA 4LRWA 2WICA 3G7SA 1R0YA 3L46A 2VQFB 3OQNA 2H8GA 2A9FA 2XB6A 5DM1A 2BWJA 4OO3A 2R48A 2C03A 2X8AA 4RS4A 4WLUA 1ZITA 2J9YB 3TFSA 3OAAD 2OH2A 1XD2A 2RI0A 1LLCA 3PFBA 4QA9A 1A6SA 2M1XA 4MITA 3OQOA 3R8FA 3SC2A 4R0NA 4C7ZA 5DWDA 2WF5A 3LL4A 4KXMA 2XDAA 1B16A 4XVUA 4G23A 2IK8A 4Q3CA 4Z6KA 3MWEB 1XVLA 1BRMA 3TAXA 2JLAA 4PC3A 3RU3A 1GTG1 4R7ZA 3BXEA 2FG6C 2YVAA 3BS5B 1ADCA 2Q29A 1QO0A 1NN0A 2Y9MB 4FCVA 2H4WA 4N3AA 4O4JF 4PLYA 1K3FA 2X8LA 1QP7A 3SC2B 1SCAA 4JK1A 1SK8A 3A2KA 2C5EA 3WYNA 2QTAA 3QBVA 1XC9A 3BIJA 4ZDIA 8ICLA 5FULA 2PE5A 4RA6B 4Q48A 4WXHA 2H92A 2AGOA 3NX4A 1A8UA 1O5TA 1WD5A 2OFXA 2QPOA 4NBVA 2I71A 2OXFA 3UG7A 1BMQA 1KK3A 2AI1A 5EL0A 1WQ4A 2AOUA 3CUWA 1WZEA 2EQBA 4WXRA 3TB6A 3H4BA 4J3JA 5ICGA 2VAXA 2Z6QA 2VBIA 5LM3A 1OT3A 3AHIA 3RB4A 4RTLA 1UPAA 4P5DA 5H70A 1K68A 1ZQ9A 2PZBA 3C98A 4GLXA 4IIJB 5FT9A 4F4FA 1TW3A 4GGOA 1IN5A 3UBTA 5C9ZA 1Q0HA 2ZRGA 3H5IA 2B7LA 3V34A 1CWUA 4HVTA 3Q5EA 2GO7A 3E9CA 4NAVA 2XY5A 3JQ8B 4G07A 4TMFA 3DLIA 3O7WA 4G9GA 1BWQA 1NVKA 5B1EA 1T2NA 3RAFC 2PJZA 3BE4A 4I08A 1QBGA 3D81A 3K8ZA 2GCGA 2JHCA 4WK4B 2B1RA 4XFDA 5BW5A 2CXUA 2HMWA 1M7BA 1SUBA 1ZSNA 1F0PA 4LBWA 5FRDA 4AJ2A 5HOEA 3J81A 2XVZA 5CTJA 5JQGB 4YVFA 5IM4A 4PZZA 1ZMTA 5DK6A 5EHGA 1Y4DE 1M73E 2LPMA 1JSZA 4K40A 1UFVA 4QQKA 1C1DB 3HRIA 1NZBA 3QKRA 1E66A 2B4KA 4HJRA 4MKXA 4G0VA 4AUKA 2QR2A 1NJ5A 5HJ2A 1CUYA 2GAOA 5CUQA 4U7GA 1CTQA 2PVPA 1SKRA 2JGDA 3SR4A 4A8JB 1VE7A 4B7AA 5JARA 2YY6A 1I1NA 3I45A 4ALJA 4ZGGA 3EX7C 1CUUA 3TNDA 1W8IA 2IIVA 3C4VA 3H42B 3IMKA 4IRUB 3DXYA 3IAHA 3GDXA 2MR6A 3D3WA 1GO3F 3AR9A 4JJEA 4R2WA 4EG4A 1FMFA 1ECGA 1H5NA 3G0GA 4F11A 1UQUA 1ZOSA 4B9MA 1JX6A 2RGYA 4U2BA 2QD1A 1JU4A 1GXSA 4BNUA 4DLPA 1NXQA 5T6MA 4ZJZA 3ECCA 1V8OA 2E82A 4LZZA 5FHRA 3H5NA 3T5KA 4I0WB 2HDOA 1P2SA 2DKNA 5F2KA 4ZT6A 1OU0A 3RPEA 1UC4B 5CEHA 3KAKA 1E0JA 1F48A 2ILTA 3B2NA 3ENZA 4ME6A 3WYEA 3K0AA 4KCGA 4DCCA 2WB4A 3RTDA 4I19A 2XYVA 4BP9A 3NIFB 1F0MA 2Y2UA 5HMLA 1OTHA 3IQDB 4AMUA 4C3ZA 2J6HA 2W6MA 5BWNA 3V46A 3SC4A 3GWZA 4MW6A 1YUMA 1B6SA 1VSTA 1GUYA 4CTMA 2ZB2A 5CEEA 1HG0A 3P5SA 4EWLA 2VDQB 3NTRA 4GOLD 3EQ7A 1JHQA 3KJHA 1WABA 3VV2A 1X92A 2QPAA 3E5MA 5EJ5A 1P73A 1Y7PA 1EK5A 3WGJA 3MBYA 3RR7A 4IQ8A 2BHTA 2ERYA 1KRHA 4EX6A 3LA8A 4C3OB 1RZUA 3DO5A 3AI2A 3MWGA 4YB8A 2VN8A 1E9BA 3KYCB 1TIKA 1PK1B 1P5JA 2QZSA 1K9SA 3ICWA 1J49A 2BBWA 1A8SA 3AMVA 3BTSA 4B9SA 4CNQA 2VDWA 3EVAA 3IJ5A 1JF8A 2WV9A 3NC1C 3Q4GA 4JC0A 2OCXA 4N3GA 2OFFA 1G38A 2MSDB 4LISA 4LC0A 4NX2A 4UFOA 5TX7A 4FXOA 1CC1S 3SE7A 5JNUA 4F06A 3C1ZA 1QYCA 2HWXA 1JDZA 2LNDA 3RIXA 1D2GA 1Y4UA 3BGIA 1E3IA 5I3ZA 2AQKA 4LYGA 4M2YA 3DBVO 2RHMA 1ZOIA 1Z4PX 2BCVA 3K9QO 1QHSA 3KD2A 8ICKA 3BA6A 4BVEA 4CBVA 8ICXA 2JJQA 2YB4A 3GVCA 4K88A 4QEDA 4RE6A 4EG8A 1OWLA 2QN3A 5FXMA 4F2PA 3GFKB 4DL6A 3IOBA 2UUPA 5KNCA 3E9QA 5ALEA 3VPCA 2KG5A 5JZOA 4N7RA 2QQ5A 1MAVA 1S6YA 1D2AA 4J9SA 3A4LA 3UWPA 1SQ6A 4IJKA 2GYUA 1HDCA 1H4SA 2BKXA 3L7DA 2PX8A 1M2GA 4LC1A 1MQ8B 3RKSA 3WLIA 5FWYA 7ICUA 2Q5EA 3A6KA 1R3UA 2AH5A 3MGIA 2M9MA 5JAZA 4XJVA 1QK5A 3G2PA 5KFTA 5CITA 5H8WA 2W2QA 1PUJA 5FFFA 4BX2A 1JLRA 1J8YF 2HY7A 3MWKA 3N75A 5T57A 1LTQA 4HUTA 4YK7A 3F74A 4L02A 4JYMA 5IBCA 1YGYA 2ILVA 5DLDA 4PX5A 4AY2A 4B7ZA 4RPXA 2G9NA 4BMNA 2HU5A 4H77A 2P79A 2GZSA 1X7ZB 3E0FA 1N8NA 2BP7A 3DHWC 3GLIA 3QUSA 2FEPA 1KERA 2VCHA 4L28A 3LQ1A 3UEOA 1UOQA 1WJGA 5F73A 2QOEA 3ESRA 1E64A 4FZLA 1GTMA 1MX9A 2IU6A 4NBUA 4NQZA 2TS1A 4K2HA 5H3LA 4Y1GA 1KOGA 2GZAA 1N5OX 5FLKA 3RLFA 3CUEF 4F3NA 3I4CA 4XZ3A 1DO0A 3DE6X 3ADBA 1DEXA 1XSEA 2DQ4A 3KDPA 4RH3A 4W7HA 4JI1B 3U0VA 3HA3A 3FYUB 3I34X 1F8UA 5EEGA 2WTUA 2WOJA 5KG2A 1UZAA 4CF5A 2GBGA 3DW3X 1W44A 3A2LA 3LWLA 5AXDA 4Y6SA 2PLFA 3V9PA 4DC0A 1A9ZA 1WZUA 2PFKA 5K8IA 2PGLA 4HP8A 1CEEA 4PHDA 2HREA 1A72A 3L6RA 4MQBA 2JEIA 4DIUA 3MRTA 1TA9A 4K8RB 4QE3A 1UBJS 1UK6A 5C8VA 4BY9E 2F9LA 2MDTA 2XJ9A 4I9GA 4LFCB 3VPAA 4FFDA 4WW0A 4OGGA 4Z7JA 1D4ZA 3P9QA 1V85A 2HBLA 4LBYA 3QLVC 4XIYA 5FFNA 2PZMA 4ZCLA 1GU7A 4MW2A 4BU1A 4LC9A 1X1DA 4Z3KA 3Q7RA 3Q7TA 3C6BA 4KWTA 5J2TA 1QHHA 4OHBA 1YB7A 3VBCA 1W93A 1BDJA 3E4CA 3D1JA 1H6CA 1JLLA 4TKZA 2KN7A 4O4JB 1M10A 2N1RA 2QZ9A 2G72A 4HUQA 5ILOA 4OLBA 3FOCA 1PEKE 3UJ8A 5CVDA 1RHRA 5DP1A 4RLHA 1V47A 5EGSA 1NJFA 1SHUX 3MR3A 4I2JA 3A9CA 1BCRA 3TLGB 4P54A 4IQWA 3B8EA 5A3JA 2IIPA 2VJBA 1D4OA 4LI3X 2GNPA 3KB6A 3PJGA 5GADl 2O2DA 2QMQA 3ZOZA 3A9TA 1Z6GA 2QLMA 2OVFA 3MIZA 3F97A 3O4RA 4JVMA 4RGQA 1HDGO 5EJGA 5IJ0A 1WTAA 4GRAA 4ZVKA 1Y3IA 4BVHA 4UD6A 3G0OA 4DIBA 5KG4A 2P9TA 3A28A 4NKRA 3QITA 1IZ7A 4LHZA 4PWYA 5AKXA 1U2GA 3ZDFA 3UJ9A 4C01A 1NFFA 2XE4A 5J2GA 1KORA 1R4MA 1Y5RA 2WJWA 3OKPA 1E1YA 2HDHA 1Q83A 2IYAA 1YBHA 1Q0LA 4OVKA 2FZ4A 4P58A 1U5CA 5DNDA 4C43A 1PUXA 3AYXB 1T2AA 4E5KA 1VLMA 3IDFA 4IHJB 5JE8A 2J33A 4B2PA 4DANA 2R47A 4OOEA 2IV2X 5GPBA 1NWHA 1EDDA 1R0SA 1VHTA 1OWMA 4HRXA 3B85A 1MX1A 2WFLB 3EVZA 3ZZNA 4OF4A 1B26A 3QFFA 1FFHA 1I7LA 2NO1A 4K6GA 5DTEA 3VNRA 4PNEA 5JYDA 4A15A 1IM5A 1E0SA 2HV9A 6REQB 1YS1X 3WK9A 3S29A 3TUJC 2POQX 3LX8A 4PRYA 4CIBA 3QGMA 1S9FA 2H1VA 1PYGA 1I2CA 2Q7DA 1I3NA 2Z7JA 2PA3A 4UB6U 2WLSA 4LWQA 4PAOA 4F6RA 4WE3A 2OCBA 1RWMA 5CWRA 2PN1A 2NTNA 2YWJA 3CG4A 4KZKA 5KYVA 3A3OA 3UXNA 2VRCD 4QJFB 3JS5A 4OMFG 4L2IA 4KQIA 3NWOA 3CIOA 2QRQA 4LXHA 3I12A 3I1IA 3QUAA 4RX1A 1UWLA 2WM8A 3IQXA 4RE5A 4C6TA 5JBIA 1TTTA 4D3XA 2CFRA 4IM7A 2G5TA 1T36B 3C8MA 5E6SA 4KG7A 2QT9A 2Q8NA 3B53X 3I73A 3AIIA 2QAGB 4FCCA 1GNVA 4M1QA 4BAGA 1J00A 3Q3CA 2HOFA 2E2WA 2X0EA 5BR4A 3S8YA 1V4VA 3HWTA 2G9UA 3VJMA 3RYIA 2WF7A 1IVSA 3DDZX 1THGA 3NRZA 2QG4A 2PMDA 2VJPA 3NORA 3DAPA 3ND5A 3OLZA 5G5HA 4MGIR 3QE9Y 3WK8A 3LRTA 1X6IA 4J9NA 2DCUA 4XLLA 4JI5B 1Z8NA 3VQTA 4ZI3A 4QVGA 1U81A 1N25A 1KSPA 4RKYA 1M7GA 1N6HA 1DWOA 3OUZA 4FN5A 5IC5A 4EGAA 3KKAA 3FSJX 4ZAWA 1PJQA 3LWDA 3MWDB 1P74A 5EE5B 4P7GA 4EUSA 5CCEA 2X0DA 5A5EA 5BPCA 3W9SA 1UJ2A 4DA6A 3N5CA 3OU2A 5CLFA 2WSYB 3HI4A 1WPGA 4NLKA 1A8PA 1TUEA 2EJWA 2MT9A 4FDMA 4GKBA 4DBLC 3LUHA 2AZMA 1AZLA 1FFBA 1I01A 4QUEA 5KU1A 3K1AA 2IH4A 3QHQA 1T2FA 2G83A 4M22A 3P4UA 5BWMA 3AU8A 3SZRA 3OKFA 4CKWB 4F4CA 3U19A 2C2DA 5CNJA 1Y34E 2VJKA 2V3CC 1HTTA 2QVXX 2YINC 1YHYA 4O2BF 4MJXA 2AU0A 2EYQA 1C5KA 1TM2A 1J0DA 2PMWB 4LZLA 2AOWA 4N0MA 3KXDA 5DM70 4RBNA 3RSLA 1LNQA 1BDMA 4GI2A 4NFSA 4YMHA 3PC3A 4N0PA 5H3CA 5J5VA 1BXKA 3QELB 3ZZ1A 4QWAA 1SKQA 1FSZA 1HSZA 1Z2CA 2CCJA 3CZAA 3JVEA 3QUBA 4QGBA 4UHFA 4UVHA 3RTGA 2PRYA 4F56A 4ZVSA 2TRSB 3WU2U 3OHBA 4ZO7A 4JC4A 1IV8A 4F4WA 2DQSA 1YZGA 2KB0A 3CUSA 3ETNA 4RPGA 1EG7A 1N9KA 4RJTA 4NYIR 4U7WA 3T3EA 3VX3A 3FNRA 1HEUA 1EVIA 2V5VA 2WIKA 5K3EA 4PZUA 2OCDA 4TKMA 5I9LA 2L69A 1U7UA 1XNQB 3P96A 4L8YA 4XW2A 3TSAA 5D51S 4OI0A 1E6LA 3PHGA 5T4BA 4EH1A 2X5NA 1UT5A 3QA9A 3RYCB 2FP4B 2HK8A 1M1NB 4LV8B 3T7AA 2P5SA 4YRMA 4F5PA 2FZ5A 2Y1CA 1SB9A 5E7QA 1NOKA 4OCZA 1DRGA 3R75A 3RJJA 4H18A 1OLXB 5ER9A 1I3KA 4CF6A 1NV9A 3HKBB 1AQLA 3JD4A 1ZQJA 3QG5A 3SF8B 5FOQA 1AMNA 1DG1G 1KMIY 1CIVA 1KFEB 3C16C 4ND1A 1VA4A 1DL5A 1WCV1 3NGDA 1DQYA 2BKVA 3HJEA 3ELWA 16PKA 3VHQA 2HJSA 4AZ3B 1U8CB 3OPMA 4Q6WA 4G36A 1G8YA 3FMOB 5FV4A 2QD4A 5KAMA 1CRPA 4ZXPA 3ZD8A 1EBUA 1V26A 4ALKA 4I1PA 1A5SB 4GM0A 1T91A 1XMJA 1YUNA 4W5JA 4NNJA 4WERA 5K2MA 4M6WA 4B3CA 1M83A 3IEVA 3ZCVA 4HF7A 3P0RA 3PTAA 2ONJA 2BFWA 3GUHA 4R8VA 3VZRA 3BPSA 3N53A 5TSDA 4H6PA 1GL9B 1OHHA 3V5NA 4NK4A 3KHUA 5EIBC 2VAVA 5AVUA 2XZPA 4WX2B 1N8SA 2C54A 1Z1BA 3DDUA 1B6GA 3NHMA 1W2HA 4I3HA 1WZ2A 2Q1TA 3ZNQA 2O8FA 3V7JA 2W9BB 2WZCA 5HGJA 2LYAA 1DSSG 3IBYA 3PRYA 1Y0BA 2QTFA 2MUTB 4NY8A 3IPCA 4PC7A 4CM6A 3EGDB 1CR2A 1WMAA 1RM6C 1VI2A 5AXBA 4AM8A 4JD5A 3LFUA 3BDVA 2R1TB 2E4YA 4J49A 4JB8A 2QRZA 4MP8A 3AR4A 4PRKA 1WDTA 5L7YA 1OYYA 3TD6A 2CYBA 2VSXA 3BMOA 4F0JA 2IL1A 3DVQX 1Q0UA 1W5SA 1QFJA 3DAHA 3OA0A 3TTVA 5DGBA 2UVRA 1NMZA 2Z6AA 2HL6A 3CINA 3UZUA 1Z88A 3HJBA 3JRNA 1MOZA 1JR3A 2WAQF 3G6KA 5DJ5A 3MT8A 4ZN6A 3Q5GA 3VNAA 1MJGA 3EG5A 3ICVA 1S77D 1L8OA 2HDNB 4F1KA 2F1OA 5TQ0B 3JQRA 3F53A 2JLRA 5LUAA 1CPYA 2RHWA 2CVHA 2Q1XA 1WHSB 2NU8B 1C80A 1VJDA 3RKRA 3SHOA 1H9CA 1BD4A 3WLAA 4PHEA 1QORA 1XDSA 4WXYB 1A95A 4KLUA 1OREA 4GFDA 1SL2A 3BWMA 3M6ZA 9ICJA 5KYYB 2EAMA 1N0IA 3X44A 2J5KA 2VDVE 1NA5A 1I0IA 2GN2A 2WKPA 3CX3A 3CV3A 4M0FA 4RQAA 4WSOA 4CEIA 2I87A 4U7CA 4HBGA 4R98A 4GL4A 3R0IA 4D4IA 3R5FA 2CPRA 2FH5B 1HRKA 4MGZR 1W30A 2P6UA 4Q1EA 1T0JB 1SVOA 1VB5A 1G8MA 4JLVA 4YLYA 1JLHA 1MH1A 5CM2Z 3DL0A 2UYHA 3NHFA 4URFA 3IRUA 1RZVA 5CT8A 2GD1O 2PYIA 4IJWA 5L51A 1T3QA 1E62A 2PYZA 4I81A 4PHCA 2HIAA 5D85A 4FOSA 3L0SA 4TLAA 4YJ2B 3SC6A 1M5RA 3RRBA 3H65A 5K6AA 3OECA 4M1WA 3LKBA 4X71A 1V6SA 2IXBA 4FIZA 4EJMA 2BONA 4Q0MA 3DE2X 4IY1A 3SBXA 3OQJA 2PS9A 5IXSA 4BEJA 4ZHQA 2GCIA 2RHRA 4RIHA 5B7PA 2HWUA 4EKEA 3IV7A 3L1IA 3QMMA 1R6BX 2GPNA 3B82A 3AR5A 2XHEA 4PAWA 5T67A 1RHUA 2DHRA 4XWYA 2C5SA 2X0JA 3R7BA 2PUBA 1SNYA 4O25A 2WP0A 2WHRA 2X1LA 3D7NA 3PJEA 2JHDA 5ERYA 3KHLA 2H63A 3FYCA 2PDAA 3HKEA 1QONA 2B1JA 3HKZF 1BGVA 3EJ6A 4FNOA 3EARA 2I78A 2I7CA 3N2YA 4N03A 2UUCB 3RF7A 3NP7A 3T0FA 4DQ0A 2X9QA 4YJ3F 2FMIA 3LUPA 4H31A 4LJ4A 3PUHA 5CB1A 3JV7A 1IM8A 3C45A 5KFNA 3PVSA 4CQMA 5L4NA 1G60A 3GQCA 3K9FC 1BNPA 1OB5A 3I9V1 3ZDCA 2D3DA 1XS9D 1RYYA 2P9QA 3RFXA 4ASUA 4CL2A 2HCTA 4RKFA 1K0FA 1V43A 1VGQA 1E3DA 2R97A 3BMCB 3AL0C 4YAKA 4DJTA 2H9IA 5C81A 3DC7A 3H3JA 4P0PA 2G77B 3JQ7A 3T12A 2WWYA 5BQ3A 4GSLA 3HBAA 4OQ4A 3UGTA 3KCNA 5JS7A 5HMMA 2HLDA 4LIPD 1KI8A 1NLZA 3P32A 5KFUA 1WQ1R 4G67A 4R8UB 1O94D 2BI7A 4GOOD 3QRWA 4I1OA 4WJLA 1GPUA 5IM5A 2KJ9A 4KLSA 4EM6A 1MQ3A 1QKIA 2QNRA 3ACCA 1J25A 1FYFA 3ZLTA 1YTUA 2OGSA 4DSAA 4AJJA 2QARB 2GZDA 4BQSA 4C7OB 1K1SA 1DDGA 1EYZA 5B4TA 3IVCA 3CUTA 4LJ7A 4P34A 3BFXA 1XELA 1RR6A 2A88A 2PLRA 4TUYF 2OYYA 4B32A 4W7IA 4GGPA 3ZCRA 4BX3A 2QJFA 3LPDA 3B0YA 1E6CA 1QGED 3TKYA 3OAAA 4AZVA 1CE8B 4C4SA 5HHHA 1JIQA 1NXOA 1ETHA 1KJ9A 1DTWA 4D99A 1L4NA 1R8YA 3PC8A 3CH4B 4IJQA 5G1NA 1GLGA 3D43A 4INJA 3RQIA 2YS6A 9LDBA 1WD7A 3G2HA 4RPKA 3AK4A 2W04A 1I3LA 4G5HA 4GKKB 3ZKWA 3S5JA 1NX6A 5AICA 2O7VA 3QXSA 4TS4A 3FYUC 4YASA 4NXNB 2BPCA 4Q45A 1E77A 2WJZB 2RKBA 1QB7A 4JVSB 3U4QB 1EU1A 4TTTS 1YS7A 4TMVA 2FJ0A 1DV2A 4MRPA 1QQ6A 5I4CA 2GPAA 3V72A 2HJVA 1EK1A 1HORA 2JIRA 2O0JA 1PYDA 2XWJI 3NAZA 4R31A 3AEQA 1AQYA 1IVNA 1T2DA 4Q7JB 3PDUA 1LV7A 1SIWA 2QQFA 4QIWF 1G21A 2K8AA 4NLZA 4KO3S 4OH7A 4BO7A 5IAAA 5LVAA 3BMXA 4F97A 4G0WA 2XD9A 5I01A 4B83A 3EVDA 1T13A 1RXVA 1ZQZA 1A7UA 3F6PA 3PFHA 2I4RA 3EFBA 1FTNA 1P6XA 1RW4A 2E4ZA 2Z08A 2IDKA 1XSNA 3F5SA 4Q47A 3OCYA 4MYHA 1QH9A 1U45A 1J56A 4XWGA 3VVBA 3UPQA 5CFQA 5KJ1A 3EZLA 4W9NC 1D6MA 4LXQA 3EVTA 1DUIA 1WXHA 3VISA 4AMGA 1OI7A 2DT5A 4MWEA 4PLFA 5LWQA 1H2BA 3U4HA 5I6DA 5ALVA 2ZSKA 2Q49A 2VEDA 3L05A 4RF4A 2O8CA 5KT7A 1HA3A 2A9QA 2LKYA 2ZYAA 4EP1A 1O94C 2WTMA 2VANA 1DIGA 1SXJE 2P2YA 4R7TA 2X19A 3GA7A 2G0AA 3JZDA 3SEQA 3RTEA 4IH9A 4UBNA 5LLDA 1ELOA 3F3KA 3MELA 3PQFA 4BNDB 2BGUA 4DUGD 5LZ4A 4TTIA 5F9NA 3K8QA 4DV4B 2H65A 1KQ3A 2PLWA 4PZAA 2FWNA 3VBEA 1JAXA 3PHJA 1TEZA 1E2LA 5TT0A 1AKQA 2BN4A 4LK2A 4OFBA 4NH0A 4L3WA 5TMBA 1U7TA 2O5RA 2YY7A 3NJRA 1SA0B 2WB1C 1OPXA 3HKDB 3M7IA 2MSWA 4HQKA 3SYMA 1JPVA 5K3FA 3GEPA 3M0EA 4K9SA 4RTJA 4CYMA 4D46A 5A5DA 1GCOA 1A7KA 3QYFA 4H7DA 4M9RA 2VDPB 4CGZA 2ZSHA 5K0TA 3FTFA 3A6ZA 1ZMXA 5DBFA 3CKMA 3AP3A 5GJBA 2JFWA 2ZJ2A 2FZEA 1KSGA 4B9AA 4PN3A 3KR2A 3HA7A 3FOBA 2F4NA 4FW8A 3DTVB 2XCPA 3W8DA 4MWDA 2ORIA 4HO1X 4XJSA 4YBZA 1UHUA 4DFJA 2EKZA 3DM9B 3UNXA 1OFTA 2J5QA 4POOA 1F20A 3QKSA 2OENG 3PC8C 4P4OA 3T7TA 1QVRA 4NMWA 4RKQA 5AYVA 1MQAA 4N0QA 4LEIA 4EITA 1ZQ1C 2HNAA 3OSZA 4CEJA 4NIMA 2C83A 4K81B 1MX3A 2PI5A 1SOAA 2KVSA 1VB3A 2AS0A 2EFCB 2ATXA 2KI5A 2NPIA 2PSEA 2Q3CA 1PR0A 4MP6A 2Y0CA 1JZSA 3BAZA 3RS2A 2OLJA 4XWTA 4DSKA 3UTCA 1RRFA 4D45A 3PRJA 1B74A 3S4YA 4LXTA 3JAMA 5EINA 2ZKIA 2HMAA 3GUCA 4AIRA 5AHKA 1P9NA 1SCUA 4MJLA 3LT5A 1XCJA 2I7DA 1Y4ZA 4X63A 3NJ4A 2QR5A 3U1VA 4XPZA 4HLDA 2IKSA 2OTCA 2JA2A 3H6GA 3UMGA 3PT9A 4GZ5A 3TQTA 1VTKA 2VPYA 4REQA 4URHA 3GELA 3TDKA 1C4OA 3WIOA 4BJ3A 1UCVA 2Z58A 2XADA 4RJLA 2FCRA 2I33A 1A27A 5FBKA 3G8AA 5ALNA 4FDVA 4ZALA 1Z2PX 4WZAE 4QUJA 1ZCBA 3H2YA 2WV7A 2B4AA 4PWZA 1SXEA 1E2JA 4ZCIA 3NHSA 1BWRA 2FJ6A 4ITRC 4CWAA 1DIBA 3JQCA 1XF9A 2AXQA 4AKIA 2V3WA 1KQGA 1AUQA 5IAEA 1XQVA 3NHWA 4QUIA 4UEOA 3KTOA 3UJ6A 1E0AA 1SVWA 2AWOA 3T5GA 1U2PA 1Q1EA 5HJEA 1KZGB 3BORA 3NHBA 2BFFB 3DOOA 4E2ZA 8ICJA 1M1UA 2ST1A 3U5TA 4UCQA 1X6VA 4HZUB 1WCLA 2WTEA 1IBLB 3VJKA 3ZLUA 3DWGA 3K92A 4XM0A 1TQ6A 1B14A 2ENWA 1CQXA 1NKTA 5I9TA 1U31A 3GLFE 2EV9A 2OHXA 3ZNOA 4AP6A 4N76A 4OBWA 1QGDA 3HBLA 3ND7A 1Q0PA 2JCGA 2RHHA 5C7YA 3T1OA 4WFKA 2WZBA 1TK2A 1J7JA 2WD8A 4KR2A 2FAXA 2XVAA 3N2IA 4M0MA 3ZHTA 4BUCA 1T9HA 1QHNA 1E0DA 3NKVA 4HNUA 1S2OA 1ZQYA 1ZESA 2KVCA 2XYPA 2ASVA 1JXMA 1LJLA 2E1PA 1JALA 1GL6A 2FPKA 1PRYA 3I58A 3JARB 2R6JA 3NRJA 2GPSA 3FFWA 5CYOA 3TSWA 4F5NA 1JEYA 3H0KA 2C77A 5AKJA 3EN0A 1NMEA 3GV7B 3BJZA 3GF4A 4GSKA 3VA7A 1U2DA 1QQ7A 2K89A 1TJ4A 4DL9A 2RDJA 2VOJA 3PVXA 3CXUA 4JFRA 1RM4A 4PU0A 2NSHA 3NLLA 4ZTZB 4P4UA 5EJ2A 4C22A 2CV0A 2I65A 2PXXA 1XMXA 1U8ZA 5DXJA 5BNWA 1EVEA 4XSVA 3CURA 3HKBA 1OU4A 3QW4B 1P7VA 1RSZA 4WLEA 2NV6A 1LTHR 4UTOA 3QPBA 1XT6A 1OBFO 4BPBA 2J08A 5C34B 4YHHB 4NP6A 3A1UA 2W58A 4IUYA 1EJBA 2AK2A 4EAQA 4R40A 4YREA 2H29A 3HJNA 2O5EA 5E1BA 1GQRA 3F2BA 2R8XA 3GFBA 2OKGA 1Y3HA 3L07A 4PG4A 1H0KA 1RYZA 2A33A 2JAUA 3LV8A 1A8HA 2XOKA 5HDQA 8ICBA 5BMVA 3VR6H 1Y8CA 2FB9A 5F21A 2FMUA 4EJSB 2G7ZA 5CFOA 1Q22A 5GY7A 5B30A 3SM3A 3W2GA 4BZXA 3TRHA 4HNTA 1J7KA 3GEBA 1QBKC 3IHQB 4Z9XA 2ZRJA 3R7FA 2IYVA 5EQTA 3T4XA 2GPYA 2EQYA 3HFRA 3JWPA 1XEAA 4KUEA 4GYKA 3PX2A 2VYVD 1RWBA 1ID1A 4Z86A 3T79A 4LDJA 2CXTA 4O0LA 5G0TA 1UP6A 3AHFA 3BCSA 1Z35A 3N2LA 4JX9A 4J9LA 4NDAA 5EEHA 3ZVLA 4DGQA 4GWGA 1B8PA 1V8BA 3KQPA 5GGYA 1ZEMA 3C14C 3CH5A 1J8MF 1WP9A 3DGEC 4GPAA 4YPFA 4YQZA 1KO7A 1XNGA 3I23A 4R5HA 1VRWA 1ZY2A 4DC9A 5EKXA 3LWNA 4XOUA 3ROKA 5JJCA 1Z25A 4KKXB 3ZW9A 1QCDA 2Y77A 4Q8FA 5DBHX 3RSQA 4ED7A 1COWD 1D09A 2FW0A 2HF8A 4Q37A 1UKCA 4UHJA 4YALA 5IMSA 3NRWA 2JGIA 1DO2A 3G88A 3RSCA 3SU8A 2DPYA 1QO9A 4Z53A 1II8B 3TTWA 3S44A 4AO6A 2O07A 4L15A 3P9RA 4UVDA 4AG5A 1ZMRA 3A2NA 4KLEA 2Q3HA 3G2MA 4RM3A 3W6NA 4K46A 1L4BA 2OAQ1 4XE5A 4G86A 1XMSA 3VR4D 1X2IA 8ICQA 2F77X 1BX0A 2GASA 4ZVUA 2W2TA 4ALLA 3AL3A 1U7WA 4G5RA 3HSKA 3K0CC 5THXA 1R2QA 2NU7A 4IF4A 3NTOA 4E5VA 1KC3A 1EM8B 2DH6A 3ND9A 2EW2A 2YIMA 1T5DX 3L8YA 4XUDA 4MFAA 1C30B 3WO0A 2OHFA 2R8GA 1PG2A 3GEMA 4AMVA 5ICSA 5BWOA 2JG3A 1IU9A 1P3JA 2AT1A 4QFBA 3VKHA 1XDDA 2R4TA 4G01B 1H22A 2NYUA 3E9NA 4MW0A 4XR9A 2OKCA 2VPTA 3PSPA 1BA2A 1AKRA 1G63A 2NTJA 4CFZA 5JXHA 3RBDA 5MN4A 4KUHA 3WL7A 1KEZA 3KOYA 3DPSA 3LLUA 4MR7A 4XQ0A 4IO0A 4O1IA 2C9DA 4F86A 1W49A 1L0BA 4QW8A 1IQRA 2O3RA 3LPAA 3TNFA 2EVWX 4O2AB 1UBOS 3R9IA 2AFVA 3ZHBA 1J2TA 1V3QE 2G40A 2XYQA 4BJ1A 1YO6A 3DTNA 3EDMA 5F7OA 3OE7A 1MNQA 4EUNA 2XTAA 1Q0TA 2E1RA 5B58C 4RTSA 3UWOA 3TR6A 1UT8A 3WLEA 1HE4A 1ZJMA 4O2AA 1JEDA 4U2EA 1WMFA 2A8YA 1APBA 2OM6A 1GPLA 3LUCA 3HA5A 5FOWA 2BPGA 3UANA 4Q4JB 1H8EA 3WMWA 5AXCA 3BA1A 2CDRA 3D6NB 4R1NA 3QU7A 3AGPA 1TAQA 1CFZA 1EFDN 1FSFA 4QNMA 2PXAA 4UFNA 4XSGA 5IK2A 4EA7A 1SBYA 3AKZA 4B3RB 4JYCA 3CP8A 2GDZA 4DABA 3T38A 1ZXIA 2EZTA 2R7KA 3L4EA 4S1TA 1G6OA 4C87A 5IP5A 1QLJA 2G07A 1TI7A 4E5YA 1CULC 2HGZA 2P91A 3JYQA 1XD2B 3QMWA 1VXOA 3QWAA 3R7WB 4KSYA 4XWOA 2ALJA 1N5XA 1WCIB 1KJYA 3KQUA 2PY6A 4FJ2A 4E32A 3HZRA 1NVAA 4S04A 5D86A 5LDHA 1NQWA 4ZV9A 4AQ7A 1YDFA 2OQIA 3R3JA 4TTVA 4I4TA 4MI6A 4GMFA 1JS1X 4NOJA 1MABA 3F5AA 1NVVQ 2F8LA 1IOZA 2P3OA 1XZGA 2Y1XA 3FCAA 4HB4A 1NW6A 3N59A 2X0NA 3FBGA 1EP9A 4FZ3A 4O4HF 2F3TA 3QMPA 4US2R 3KUCA 4ISBA 3H1FA 2J5BA 2P2LA 3FAZA 2M6LA 1NI4A 4MCIA 4U63A 5EJ8A 3DT6A 5I3CA 1KFJB 4PXAA 1EFUA 2COEA 4GXIA 1X94A 2JJMA 3MINA 4I6GA 1MD9A 5ERXA 1F3OA 4ZZ2A 2O8EB 2CN1A 2QW8A 2ES4A 3GZNA 2GK7A 2JGFA 4C8MA 4M87A 4MINA 4MKIA 5A3SA 1M1ZA 3A25A 3AXTA 3I32A 4JLDA 3U7EB 2ZZNA 5IT9A 1YDGA 4EK9A 4YUVA 3F6SA 1LPAB 3C28A 3KTAB 4NM1A 4NMXB 3ZPXA 2OK8A 5ADHA 1R50A 1I2AA 2KD1A 5AKIA 5DBBA 2WAXA 3IHTA 4YRCA 3K9WA 3NHYA 4HWPA 5KPDA 3UQZA 1O08A 5AUQA 3GA0A 4Y3UA 1HEKA 1YSCA 1D8AA 2PS3A 4OM8A 3ZHQA 2E9SA 2WJVA 3ZWCA 3ZVRA 2HVIA 4X6YA 4MRMB 1TRKA 4YMNA 4OSPA 2HZ7A 2BGMA 4DS5A 4TXJA 3RU9A 3TLYA 4JLKA 4XSHA 1XWFA 5B3JA 1JQLB 1PFKA 1WU7A 4IXTA 1CLEA 3ZDXB 2HXYA 1JHXA 1YOVB 3B6EA 3ZGYA 4C0JA 3QVOA 2C3UA 3DGFC 3VPXA 1Y4AE 1BS2A 4QKQA 3KOUA 2EP5A 4FO6A 4ECWA 4AKHA 1W25A 2WPDD 1KKMA 5L1JA 3JYLA 2OCIA 3EXAA 1X38A 2KZMA 3G7UA 2NU6A 2OLKA 3NIBA 3OPXA 4GGMX 4ICIA 4UMDA 4CTJA 4HQ6A 1EE2A 2OILA 1GYPA 4ES6A 4YCBA 4MVXA 1S0NA 3GV5B 2R8EA 3AF4A 3CO5A 3IESA 2H51A 4ZT5A 4AZ0A 2DPJA 1ZUHA 4QDJA 4MQ6A 3LG2A 1H94A 5D3MB 4C6RA 2OD9A 5FI1B 1CP3A 1NDUA 1JGTA 1U0GA 2BFCA 3BL8A 1G5TA 2J3JA 2NSYA 5L8VA 4N65A 1XVAA 1PWHA 2VT7A 2D06A 2YQ4A 4RL4A 4MHTA 3N7SC 2RONA 2CB0A 2W2LA 2GN4A 3DVSX 2WJIA 5KT5A 3ETLA 2F1HA 1CUFA 2ZSIA 2QMUA 4OGWA 2RHLA 4GYWA 3CNOA 1E7QA 4LRQA 5IUJC 2YXLA 3EJWA 4ISCA 2WJPA 1KTQA 1PWZA 4LE0A 4QYMA 4Q9JA 5KKAA 1E7RA 4RZSA 1FJGB 2XIDA 1CKEA 1GWNA 2I54A 4U6NA 4LBVA 2C7BA 1TPYA 2O1EA 3GH1A 3UQ0A 1DCKA 1YHNA 4XIIA 4A7PA 1KI1A 1FDWA 1KETA 4R5MA 4A4DA 2V4QA 1QVWA 1NC3A 1L7MA 5JCZA 4XB6B 4I27A 2GAFA 1VJGA 3LHKA 5DM4A 3TXXA 3UIEA 1CDEA 2CHGA 3I2IA 1L6IA 4WT7A 1OAOA 4JLMA 2FPRA 3R24A 4UPDA 2OXIA 3P71T 2FPPA 1BNOA 1GGKA 3DZHA 3JQGB 2A1JA 3T3FA 4XIJA 1G18A 5MGBA 5EKDA 3IERA 1GNQA 5KFCA 4CG0A 3T1YB 1ONBA 4FKMA 2GZMA 3HDGA 3I8SA 1V7PC 1C81A 1YVRA 1GUBA 1XROA 3H11A 5GJCA 4W5NA 1JXLA 4KXUA 5FWNA 4HAWA 5E3JA 2GT1A 2HRCA 3Q10A 3R0QA 5A5GA 5ALGA 2AQ4A 2B6HA 2R44A 1Y3AA 2HSJA 2JH9A 2QUKA 3A05A 3F3MA 4JBHA 4RTKA 4QG7A 3ADKA 2C0CA 3QEJA 5DNUA 2YW9A 5BPHA 3OURA 4EELA 1AUPA 1Q7RA 1UKAA 5M3BA 2QD2A 1YDWA 4OX9B 8ICYA 2H48A 2VPQA 1DQRA 2B69A 4Q4CA 4GXTA 2VATA 1Q44A 3VKGA 3AVVA 7ICGA 1H66A 2IVZA 2WVJA 2D8AA 3BF8A 3AILA 1GGHA 1NBAA 2EKDA 3EPRA 3AHGA 3I6YA 2X6RA 3W9BA 1KDRA 3QYJA 4BL5A 4OLAA 3I4LA 3BYZA 1XU9A 3KKQA 2H2DA 3Q7PA 2H3QA 1WXEA 2J6TA 2W6JD 2ET6A 2W8ZA 3TIVA 3ZHRA 3H5TA 5DGCA 4DNQA 3EBPA 2P40A 3IAFA 4A10A 1KDPA 3I28A 1UODA 3KQVA 4G63A 2JLUA 5IT5A 5J63A 3KZCA 4JC5A 1L9KA 1XR3A 5HRUA 3HJFA 3A0HU 1P39A 1FFSA 2H9YA 1IYZA 1RWVA 2QTGA 2RGCA 4N5MA 2E3JA 1Z6AA 2E89A 4C8OA 3ONDA 4G0YA 4WJKB 4YMIA 5JATA 5HCUA 3PIIA 1W0CA 2DJIA 3TNJA 1M74A 4RVHA 4DLAA 4OJMX 4QJ3A 1HNNA 4UTNA 5FEUA 1M2FA 2YYYA 2ZAGA 3M6WA 4LHYA 4NBWA 4UQOA 3ETGA 4JB0A 1Z7YA 5F51A 3RVLA 3TL6A 4XUSA 1LBSA 1D2CA 2C9OA 6LDHA 4DQQA 5JH7A 5JS8A 1JDTA 2FPGB 2Q8PA 2RHDA 2C4UA 4PO3X 4XI9A 3CTPA 3IBTA 4AP9A 1NI5A 1SPXA 5FNZA 2WMNB 1EA7A 2V7UA 3BGWA 1ATZA 2W3RA 3QXXA 4WUVA 3ZWDA 1DG3A 3L01A 4QSHA 3TD9A 1WEHA 3WO1A 1H65A 1L7EA 2HSDA 3EGEA 1NTOA 3PMNA 4KGDA 3T3GA 1PWYE 1T5OA 2PT9A 3RI3A 4DE5A 2ZCJA 4PAQA 4RZ3A 1JQKA 4XCVA 3I5XA 2F1KA 5KOIA 2Q9UA 2R8IA 1A96A 4KX5A 4MVJF 4NNPA 3JX9A 3E0QA 3LT2A 2DSNA 3PJDA 2FPSA 1KU0A 2G67A 2Q41A 3JWGA 2QIOA 5E6RA 3VTFA 3ONNA 1Z00A 1U1GA 1M2HA 4GMGA 2PGJA 1YZUA 4QUDA 2H11A 3BEDA 5CMLA 1N4AA 2Q2VA 2K4PA 1PFQA 2GMWA 2JLWA 1VM6A 4JT4A 1A69A 1N3YA 1UPBA 2CVZA 3DQQA 4IJMA 5CJ2A 1X9GA 1TT5A 1CUJA 1PNQA 1G19A 1QNFA 2P4EA 3ER6A 1O9HA 3FDZB 1GZ6A 2M2IA 3IP3A 3FDFA 3K9HA 3KCQA 2IW1A 2JI8A 3KU1A 3PITA 2HPVA 1UPHA 2ZIAA 1LPPA 3EK2A 2V1XA 1UBHS 1XCBA 3O75A 4FSDA 5IT4A 1IB0A 3I4FA 3QVMA 3NHRA 3HW8A 2HDWA 4INOA 4S35A 4QEZA 2YW2A 4BO3A 1E1QA 3ZW8A 4C30A 3CE6A 1AV7A 2YNMA 1TUIA 4I3FA 2P75A 4JLOA 5CLHA 2X1MA 1MH9A 4MWGA 3KDSE 4B71A 3WWYA 4V2IA 1F44A 1OXTA 2AR7A 2QD3A 3SF8A 3IILA 2KE7A 3SV4A 4LQLA 4A0QA 1P5ZB 3DZ8A 3ITEA 3L7IA 1JNXX 3GG2A 1AS2A 4B2IA 4DIFA 3C23A 2O6HA 1B1AA 2V59A 2HU8A 5L6LB 2DQZA 2OO3A 1JG7A 2VIXA 4JJ6A 1CD5A 4Y2HA 5JZVA 5K0JA 3D2AA 3MCZA 4Z8YA 3VU9A 1X15A 5HPYB 5I7OA 5JBQA 1PJSA 3O4JA 1ISJA 4YTEA 1CRLA 1J20A 1CUDA 1ZXLA 4MJ3A 4AO7A 3KS9A 3W5BA 3PX7A 3L6DA 3U4CA 3OETA 4U3JA 2F3UA 3ZDRA 3ICOA 2BEUA 1JI0A 3F7TA 4HDMB 4RHCA 4UOQA 2HT6A 3F2VA 3UOAB 4TWZA 3PX3A 4JUZA 2V0GA 3G2KA 1RYHA 3L6CA 3PR1A 3WZ2A 1KEJA 3BQ0A 1SXDA 5L9AA 5IKXA 2GN8A 4JHLA 9ICTA 2OO5C 3HJUA 1EIZA 4LNUA 4M8NE 4ZOBA 4MW9A 2XGJA 2Q0HA 2PUHA 5FTNA 1FYWA 2UKDA 1NBOA 1FDIA 3X1KA 3GPIA 3UW3A 1TYAE 3AERA 4KPEC 4JLNA 3DBRA 5BW8A 3DCNA 1H9BA 1OX6A 3FYSA 4LOJA 2Q3JA 2PUDA 3B2EA 3E2PA 2FRDC 1G41A 1T8UA 3L02A 4ARUA 2XCAA 5I7UA 3LT0A 3CZ9A 1SD1A 2OT3B 3M1YA 1FFCA 1KAOA 3QPCA 1P6QA 4BRWA 2X0RA 3FM9A 3P19A 3Q9LA 4TTPA 1IBRA 5AJXA 2E18A 2I29A 1U7ZA 2PH3A 2W8KA 1SKYB 2QE6A 2YMPA 1I3OA 2IY9A 4TN1A 5FLEX 2IQ5A 4AYXA 5SYMA 1PT8A 2Y71A 6YASA 4OJ6A 2ZJYA 3NHPA 4B3IA 1FMJA 2JJ1A 4Q6BA 5LQRA 1N57A 2QLJA 1GPDG 4PYJA 3SR0A 4KMOA 1T29A 4YR7A 1MA3A 4Y2YA 1XYVA 1ZOPA 5E1MA 5FF9A 3VO9A 1EGVB 1YS4A 1MJ5A 2XAAA 3KJXA 3NOQA 5A0TA 4URUR 1JJFA 1XVTA 1ZM3A 2HMTA 4JT9A 1JFLA 1V7CA 2HA6A 4I6EA 4NE7A 4NBSA 3BD7A 1EMDA 2O59A 4W1SA 5AVTA 4LQCA 2EFHB 3D8RA 4UCWA 2ACWA 1R0WA 4B0OA 3HA2A 2O3SA 1ZQWA 1ZH0A 4F3YA 2DTXA 1HIWA 1FQJA 1KSHA 1N5KA 5IHPA 1E79D 1J99A 4OY3A 3UWKA 1Z5WA 4B3MB 4EZ6A 4P32A 2FMPA 3MUFA 2OC4A 2Y6UA 1OBHA 3B3FA 3B9JA 1BN7A 3NHKA 1I3MA 1P5HA 4X94A 2P11A 3UXOA 4BWVA 1D9DA 1H2RS 2DERA 1PW7A 3L7MA 2C1XA 5MHTA 5I4IA 4CMHA 1K7CA 4JBIA 4X1IA 4H1HA 3OCXA 5F3XB 5LSAA 2JVKA 1H2HA 2HJWA 1PO7A 3GJ8A 3RC7A 2IWHA 3LC1O 5E2BA 721PA 9ATCA 10MHA 3GRPA 3SFZA 1SVLA 3AESB 2RFLA 4J4BA 4M0LA 3IVGA 4YRLA 3S2EA 1XEWX 3EXIA 2LV8A 5GONF 1KGSA 1CJBA 4MA0A 2V98A 1KDHA 4FYXA 4WKPA 3VZDA 3M4ZA 4R2KA 1Z0SA 3W06A 4ACAA 1THZA 2CT8A 4HYQA 4M1KA 5A1JA 1DZIA 4OI1A 3LGAA 4TMTA 4YHBA 3RTCA 3OZSA 4PHHA 3OMLA 4TMYA 2O2SA 3OBIA 2ZVJA 4JROA 1R0RE 1D7AA 3E05A 3OCWA 3LNTA 1DFIA 1DEAA 1K75A 1NR1A 4M1TA 4LUCA 1CQJA 3FGPA 4EL0A 4RH0A 1RABA 2PR2A 1ZNXA 3UV6A 4CT4B 3ZD7A 1VE1A 1ZRMA 1M0WA 4IIJF 1OR8A 4P0PB 2SCUA 3FZEA 4TN5A 5G0VA 3GA5A 4MYUA 3FJOA 3O1HB 8ICZA 4ER7A 5E95A 3KOZA 6CHYA 3UCEA 2OWDA 3R2JA 4G37A 4CUKA 2SICE 5B66U 2Z4RA 5FO1A 1JEQB 2ZUUA 4D9NA 4PYQA 4OHOA 3U7QB 2OBFA 3WNDA 1T6YA 1ZH4A 1UAGA 2VHXA 3INTA 1RE1A 4XGIA 4COKA 4NZPA 5AKGA 4TTQA 5ITZB 1GCGA 4NJEA 4TXNA 3WL3A 3ZHSA 3MC1A 2G6TA 2F3SA 1JSCA 3EEIA 2PMZC 3CUYA 3EZ2A 4XWKA 1ZFNA 2GKSA 3IDQA 1RT9A 3PU6A 2OWOA 5LWHA 5CA7A 2HFKA 2C5GA 2GHRA 4NEGA 2K8CB 3NYWA 4DL7A 2AR0A 2DP4E 4WCFA 3W8EA 3HCAA 3ZUPA 4BB9A 2X2PA 3QVSA 4GR5A 3SSMA 1NSTA 5BORA 1GIAA 3V8VA 1YVPA 1NVXQ 2DFLA 4GP7A 1QO7A 1CFJA 2UYQA 3MFYA 1WUJS 2XT9A 1HEIA 3UT5B 4BLQA 1A7AA 1GRQA 2X58A 2IY8A 4L95C 4A9AA 4DARA 7ICIA 1L5VA 3PHLA 1O8BA 2R5FA 1UBRS 5BV8A 4J0CA 1YAJA 4IRMA 2GFIA 1Z2DA 2I4NA 2GEDA 2IVFA 3JPNA 5KSPA 5A4FS 1EJ6A 2IU3A 3BD6A 1XXHB 2IYYA 1HL7A 3DKRA 3HI6A 4UTXA 1CZKA 1EHYA 4G5SA 2AC4A 2R8HA 4YJHA 5CVUA 2R18A 3FMIA 4NZZA 4ALNA 2GVNA 2FEAA 4CN8A 1C2YA 2JJ2D 1HLDA 4FFWA 4RD1A 3BRWA 3W8FA 5AMXA 1R8QA 2R11A 1AIPA 3NTVA 3OT1B 4X54A 4C05A 4B7CA 2XAUA 2W7TA 3R3WA 4FWBA 3O8DA 4NOKA 2V55B 3WHLA 2CL0X 3T15A 3LPCA 4LDZA 4F8JA 1CEYA 4HDMA 4M9GA 1KTVA 1NQAO 3Q8LA 2FLNA 1MGOA 1OX5A 2QVLA 3FGZA 1S8OA 4KIJA 1WCXA 3T1QA 1Q0ZA 1ECBA 3GL9A 5DV9A 4FS2A 1XMIA 3BGVA 3EGWA 1O6GA 4OBBA 1Y5LA 1W7AA 2JANA 3HLTA 5TF0A 3O94A 5F3WB 3FPHA 4FDTA 2PU7A 4HGRA 4P83A 4AT1A 2KSOB 4B09A 3HKDA 4YQYA 4RQUA 4FEGA 4BMDA 4ZIRA 8ICGA 1H6BA 3IPAA 5BUCA 1ODSA 3GB9A 4KVFA 3AVQA 4XYGA 1KVTA 2FW1A 4D81A 2B36A 4FYHA 3P9ZA 2M98A 3INNA 1Y5IA 3I3OA 4G85A 3FWHA 4JAVC 4ZP1A 4BLTA 1ZK4A 1AVTA 2QV0A 1I80A 3EZ5A 2QM3A 4OQZA 4H7IA 4F5YA 5BOSA 5EJEA 4LDPA 4DIOA 3BS7A 5CCDA 3K5IA 4YAFA 3K96A 4FJ1A 1OUMA 1NOMA 2FDRA 1N0VC 3J81k 2REBA 3GPCA 3L2OB 1SQ5A 1NG1A 1OLSA 3OFNA 6ADHA 1DMRA 4RTQA 1AMOA 3NBQA 1KQNA 4F3OA 5ESRA 4AJ9A 3VR4A 3RHSA 3K73O 1N6OA 1P3Y1 3VC3A 3BJYA 3NHAA 5ELLA 3DULA 5AOAA 3BZWA 4DQSA 4RDHA 1VG0B 2UYYA 3AB7A 5TQVA 1TLFA 2BHLA 5DO9A 4Y18A 2XNCA 5TB5A 4BP8A 2IOYA 1QFSA 5FPHA 5IH7A 2AHOB 4NZMA 1FRVA 5FEMA 1OIWA 1BX1A 1SC6A 1FX0A 1U8EA 5CP2A 1VKHA 1YGPA 4BE4A 4ED0A 2BF4A 2VNAA 4Z2YA 3L6EA 4L9AA 5DW3A 3EE6A 2FEMA 4R3WA 4ON9A 4J0KA 5ECDA 4WXMA 3OP1A 5AK3A 2ZYGA 4GOJA 5KHAA 5IG2A 1CVLA 2J5RA 2LRHA 3ONEA 4FWIB 1LDNA 2YWFA 4GYJA 3FCEA 5EWMB 5LQAA 5D3ZA 1QG0A 5IWAB 4BNNA 1EFRD 3HEMA 1N60A 2EFDB 2R1ZA 4DR4B 4Y2QA 5DTJA 1ZGZA 4KYVA 3SLKA 2A5LA 3TK1A 3JU3A 4X44A 3LECA 1QNLA 3PXGA 4RQ2A 3NTUA 2QTZA 1FNMA 2WUFA 4ID3A 4RK1A 2G1UA 5DB4A 5E3IA 2MSLA 1HZZA 3ONWA 4C4AA 2G70A 4MAMA 5FA5A 2EQAA 2NVUA 4FD3A 4IX9A 1GTSA 4HDKA 4E31A 4DLGA 1D2RA 2LR0A 3PB3A 3SLGA 3W1WA 2PQ0A 4ALIA 3D8SA 5GAJA 5BN1A 1U9CA 4YRDA 1Y6JA 5IK2D 4EEXA 1U0SY 4PHPA 1AHNA 1QGZA 2E8MA 1YCHA 3K6JA 4J6EA 3B0XA 1CS4C 1L2TA 2WU1A 4JLAA 5E8RA 5JOQA 3NVKI 4MP3A 2ZS8A 1F5NA 4KN4A 2DKXA 2L5YA 4QGGA 3PW4A 3CKKA 4GQBA 2X4GA 4JVNA 1YIAA 4DS3A 1Y8RB 2O14A 4PPXA 5K51A 2M32A 2DFVA 5K0EA 3RC1A 4C5AA 1UMDB 4YXJA 1DVRA 1J9ZA 2BJHA 4PYIA 1QQ5A 1V6CA 3WKAA 2F43B 3SHVA 2A2ZA 1GJRA 1Q50A 2Q6OA 3WYFA 3CZ4A 3QVGA 3IMFA 4I7EA 1R37A 3FBTA 2OV4A 4LXGA 1EVYA 3UV3A 1Y9JA 4M7PA 3VYTB 3COYA 5JTTA 1PIWA 1T3HA 3FPBA 1RQNA 4L8GA 4MKGA 5D3KA 1KRWA 1GZ3A 1C7FA 4DQRA 5T6BA 4MGHA 3F98A 1ZCZA 1JAYA 1PT7A 1FU4A 2JS7A 1TJ5A 2XUIA 4LVSA 1H0SA 1J24A 2QYHA 2W70A 5JR3A 4TQAA 3UQYS 4JMLA 1W87A 4NCXA 4L78A 4E0BA 5H9WA 4E22A 4MQFB 4JU8A 1B4DA 1O89A 1ZZEA 1RM5A 4M8KA 3U3KA 2H5EA 4CCWA 3TF5A 4KBFA 4UJ3A 3BILA 3IBCA 1E4EA 4YUXA 3NBUA 1KWGA 3E7WA 3TW4A 4WL0A 2DBQA 4MEYA 5L3SA 1QIEA 3HN6A 3EXHC 3ZXYA 4EZIA 1DJNA 1KZ1A 4WBSA 1JIJA 1V4BA 1IUNA 4M1YA 2RHCA 4P9NA 1YA8A 4BNZA 3AI1A 2AZ4A 3T9CA 1MHTA 4TVKA 4JLWA 4K9RA 2OQ2A 3R44A 3GP8A 2GERA 1NU8A 1W0JA 3KLPX 3DPIA 1K92A 1SXJD 5KS2A 4CXMA 3LBNA 1TKCA 2JIDA 1ZD1A 2BMWA 1DOQA 2JFUA 2YV2A 3CRMA 3HB7A 3MJDA 3T7SA 4YPVA 1M0EA 2DVMA 3RSHA 1YRWA 3O2NA 3UYLA 4CLEA 4GBJA 3NV7A 3NNSA 3EXHA 4DUYB 4NJEB 1NY6A 1ODIA 5KT3A 3D54D 4PBSA 3EIOA 3C8ZA 5K99A 1EFRA 1CIPA 3R7DA 5TEWA 2V4ZA 2ZRDA 2Z8XA 4RQ5A 5KTOA 5E4FA 4K2AA 3H87A 3WFJA 4JITA 5K20A 1UC9A 4V0MA 5CK4A 3DO6A 3GWGA 1OGYA 4P22A 4ACBA 1OASA 3TI0A 1MB9A 2YNMD 3EVNA 2NGRA 2YASA 4PXSA 5FUVA 5C35A 4QZVA 1AO0A 1IFXA 1LKZA 3CCCA 4PO1A 2PFOA 1L4KA 2KFZA 1TJ3A 2F9MA 5EP1A 2ID7A 4EYIB 3MA0A 2QX7A 2L82A 2PUGA 4DNXA 1TD1A 3NUQA 1EEXB 2ZREA 2ZIUA 2AUTA 2V6FA 4MCJA 2QX6A 3BQ1A 2IZ1A 3KK0A 2WZQA 1RQXA 3SHQA 4EG1A 5LD2C 1R1DA 3TTTA 2EP7A 1Z8HA 1WZNA 2I67A 2XV1A 3BXPA 3CPEA 1Q19A 3KD3A 4ED6A 2VHZA 1JXQA 3EZ7A 3LK6A 3BGDA 3ZU5A 3G49A 3I42A 4JBGA 9ICPA 4N39A 3OWOA 2R7NA 1XSPA 4GW3A 3DQPA 1M1YB 4WY8A 1W2GA 4M98A 4EG5A 5TGDA 2IYUA 1JRPA 3KQSA 4IICA 3VU3A 4HLQB 2XGSA 2D6FA 2B25A 3RFCA 2JC3A 5K03A 221PA 3E5NA 1PV4A 2JK1A 1TO6A 1DUSA 2HF9A 5CH5A 1SZHA 2K4HA 1NVDA 1Y37A 1UBMS 1JHVA 4UASA 1YRQA 4MZXA 5P8WA 1AGYA 1UXIA 5J0RA 3FMGA 1SCBA 1N2GA 1RS0A 3HDQA 4LOIA 1XPRA 1KI4A 3OX4A 4BLPA 3ZLVA 5IYZF 3PPWA 4D8UA 1AKWA 5KQSA 2HBKA 1HQKA 2NYAA 5H7XA 5ALMA 2BI8A 3EFHA 2WR8A 4MI9A 1M33A 2QF7A 2Z1DA 4CM4A 1FK8A 1TKAA 1AS0A 4LXIA 4CVNA 1Q11A 4PIPA 3GIDA 3IODA 2LYHA 4C0AC 4JP2A 3A3KA 5IIMA 3AEKA 4UBKA 4UOZA 3J7AC 3AVOA 3EODA 3JZFA 3M6FA 4FGWA 1SUSA 1T1EA 3D3QA 1DQZA 4X8OA 5H02A 3GAMA 3TW8B 5FTLA 2FN4A 4FOOA 1WWVA 1V5FA 4HB0A 1PSDA 2BGGA 5A1TA 3MAAC 1U28A 4MQUA 1C9KA 3L0OA 3P0JA 4PHFA 4DCSA 1O77A 1EZ4A 3D4LA 3HVKA 3MOGA 4OXNA 2BZSA 4RVDA 3PFCA 3X1DA 4F2DA 2NXJA 4O3FA 2GTHA 1E2NA 2Z98A 5JSUA 4LYJA 2QKYA 2WUEA 4YDQA 2WHPA 4YQFA 1XJWA 5B64A 1CYDA 2ZUFA 1GCAA 2ZBUA 3G0BA 1KZYC 5E8JA 3MS7A 1GSAA 3OIDA 7MHTA 3D3NA 1CNMA 5FHQA 4X8LA 2GVZC 3C2LA 1N4DA 4HUJA 3H9EO 2A1UA 2VH2A 1CDZA 1P0PA 2FI1A 2B2XA 3IOYA 3E81A 3KB2A 3N6XA 1XZLA 2A0YA 4JI7B 1N8KA 1W5BA 5F7ZA 4J9OA 5KI6A 3DEJA 1G20A 3MS2A 5DF1A 3M3DA 3BD8A 4PLTA 5CEFA 1SIBE 4MMYB 4CG3A 1HE5A 4K1XA 4AICA 3PQ5A 5LQDA 5A0VA 1UK7A 1HYEA 4G1BA 1X9WA 3RJEA 1BEUB 2FSVC 2N0SA 3AUTA 4O0MA 5FUXA 4U0KA 1NAIA 3LKZA 1PI3A 4U7PB 4YACA 3I39X 3VSAA 1KY3A 2CLIB 3CLTC 4MS4A 1Z0JA 2GZ2A 3EPLA 1GV1A 1KZ7B 1YAHA 3HCEA 2WABA 2IMWP 1AA9A 4CI0B 3NM5A 4XWWA 1DKMA 1WDWB 3EVFA 4PZOA 1V4NA 2I6TA 4FMPA 1TVAA 1NK0A 1XKQA 4IDGA 4UNSA 3T3DA 4DV2B 2C7RA 2P7HA 3B2QA 4BJQA 2BQRA 2R6CA 3QKWA 3QVGB 2Y2VA 1Z06A 3FIUA 4AZ3A 4AJOA 4H27A 2EZXA 2GA8A 2C20A 3PXEA 2EL9A 5KFLA 5EWJA 4CR8A 2FOIA 1SY7A 4C14A 4A2CA 1RPJA 1AC5A 1H38A 1ZG3A 4ZQIA 4D79A 4RK4A 1PEAA 5CDHA 1WBBA 3WSTA 4PPYA 4AZWA 5ALLA 5LZ5A 2WDPA 1K5PA 2JH1A 1Y8RA 3RTVA 2FNAA 4DRXB 5KTPA 4M9UA 4RY8A 5AW9A 1MO5A 4JI3B 3MD0A 2HK7A 3GU3A 4LXUA 4RZIA 1Y7TA 2AOTB 4NDZA 4P31A 4FLFA 1GZSA 3G7NA 3I5MA 4QUHA 4CCYA 3C3JA 1OLXA 3BE6A 4GXQA 5CW1A 3MTBA 5GWXA 4DKXA 4EB0A 4RPZA 4FBTA 3EQ9A 2GBCA 2JFVA 3FPFA 4YR2A 2OBBA 3T4PA 3UHFA 5FUYA 2VK8A 3ZWVA 5ABPA 1GNRA 2ABWA 1RLMA 1WSAA 3GFPA 1SCIA 3H6HA 1GZ7A 1E9VA 1KA9H 2GX6A 1TMKA 3JQFC 3Q12A 3RVMA 1MEEA 4UE2A 4ZOCA 4Y2TA 1KAQA 4YN3A 1DKUA 4RAQA 3I30X 4HFRA 2MWMA 3DHEA 3TLZA 5KFGA 3I1JA 1XPJA 2JZBB 1DELA 3OTIA 5LP6B 2WAMA 2FTKE 3F49S 4CDMA 5K5EA 2O50A 1ZZGA 3EXHB 4TM7A 1A4RA 2WU4A 1FSPA 1C41A 4LJRA 3NBYC 1QIFA 1MUUA 3NS7A 1UJNA 3GG9A 4OQYA 1MLDA 3VPBA 3NAQA 1IOVA 3VDMA 4BYGA 1V5EA 3FXAA 2YCBA 4U5QA 3I6BA 2WFAA 1S5LU 2Q3LA 3H2BA 1UDBA 2ATLA 3ZUGA 4EUFA 1WE2A 2CLLB 3WMEA 4S24A 4F84A 1VLZA 4ZZ1A 3RT7A 1WQ3A 2ZRFA 2I03A 3QKTA 1DAMA 4CKYA 1LLFA 1ZIYA 4P0QA 2DUUA 3BXXA 4OB6A 1W6UA 1MV8A 4KI7A 3IUQA 3L7CA 5A4AA 2CL7X 5FR2A 2CK3D 1NBIA 1ORWA 2OGUA 1M2OB 4KR0A 7ICNA 1OLUA 3QWBA 3TPFA 1FC0A 4MWSA 2K4IA 2ZR8A 4RCZA 3DKKA 1U04A 3MMXA 3OQPA 3ORSA 5K0ZA 3L0ZA 4B3DA 1LY1A 3OPYA 4ZVOA 3TYXA 2QTVA 4IAOA 1DBQA 1XE3A 3AUKA 4V0QA 2BOVA 1QPZA 1NR5A 4EW3A 3HBNA 4GZ3A 5BW6B 2OPBA 2ZUEA 1J2RA 3FVWA 1Y7LA 2NZXA 2P4HX 1OA1A 4C6SA 4NLCA 1Z34A 3MRSA 1A2OA 3W3AD 4NLLA 4C88A 4HFMA 1XPUA 4YRGA 1AHPA 3MTJA 3AVPA 2ONKA 2C5LA 4ESOA 5B37A 2CY0A 4B48A 3BDAA 1CQIB 1KHTA 1WNFA 4FHEA 4NU8X 1HDRA 4S1WA 1REQA 4BC0A 3L43A 5B58T 1L5ZA 3ZEAA 5I9SA 3ZZTA 2YN4A 1TGVA 4F93B 1TEVA 4FC7A 3I09A 3LFTA 5C1IA 3FROA 2BL4A 1T36A 4CIWA 1SRRA 2QHXA 2PFSA 2WKQA 3IDSA 4A0HA 4ZYYA 2VHUA 3FPJA 3OQIB 4P5EA 2LPEA 3GDFA 2R8JA 1MXFA 3BFPA 1TC1A 3INYA 4RVNA 3TIGA 3G1UA 1OWOA 4IGFA 1ZNZA 3KUDA 1BIFA 2H2WA 2HMXA 1P4HA 2Z5VA 4WFJA 4HN2A 5FUMA 1MORA 2XYGA 1R16A 1RPNA 1DPFA 1USWA 3U61B 4HXEB 1G3UA 4TUPA 4Q9KA 1OH6A 2R00C 4OFZA 2V65A 1RAHA 3UMFA 4B75A 5ICMA 5ES4B 3EAFA 3NPMA 4WZAA 1NT2A 2XMBA 5JSZB 5AIAA 1NK9A 2VJMB 4RHFA 4I2VA 3IC5A 2HPAA 3PJFA 5KQMA 1D2HA 1MP0A 3H19A 2QV7A 1QHXA 4OK5A 4OYLA 3C43A 4Y7DA 2HHHB 5DGIA 4N7MA 1JE0A 5K0NA 3O26A 5YASA 1U99A 2G25A 2JD2A 2G36A 2P5UA 1VE5A 3EHEA 3F5QA 4AZ0B 4AN1A 2WB2A 4K4HA 8ICCA 2GOLA 1KOFA 3AUSA 5KVAA 3LOPA 1I1OA 1DXQA 1VJRA 2V45A 5FWYB 2KK0A 2QUHA 1ZP6A 3EZYA 4FFOA 3RVJA 3DE1X 1Z2EA 3DUFB 5FNVA 4EPVA 2DUNA 1ISGA 2E48A 2QRVA 1R4ZA 2CJFA 1QIJA 1B0PA 3JATA 4FDLA 4G97A 1KW4A 1SG9A 5AVJA 2QORA 3V7WA 4H7EA 1QIMA 4XQ8A 2VTDA 2XH8A 3H5LA 3HFJA 4QBFA 1VG1A 4W5HA 5DGTA 1NWCA 3PDJA 3KQLA 1NFRA 3W9UA 1Z75A 3T3NA 2ECKA 5TLSA 1IZ9A 2DRIA 3TUZC 3U7JA 1KH3A 3OZDA 1GD1O 1XMOB 3WP0A 4QUGA 4EW2A 2Q28A 4JV5B 2GAIA 3EEFA 4YV0A 2BGLA 3DAGA 3KFVA 2ZT8A 1NM5A 2W2PA 4FP9A 2P35A 4JQSA 2X9LA 4S3MA 4AY3A 3Q2OA 4HEHA 2A1JB 2WQ6A 1YFLA 4JP3A 3K5PA 4BO2A 4K05A 2GOYA 4ZQCB 1YB1A 1CUBA 3EVEA 4JC8A 1RADA 4HX9A 3IB3A 4PICA 2FPIB 3KEQA 2I76A 3M9MB 1VPTA 4YRAA 5LBUA 1USVA 1AB6A 3FNEA 3Q3EA 4TLEA 4C07A 4JXJA 4F4IA 4MWTA 3DFIA 1JFVA 4W1QA 3NVAA 3ROFA 4MFCA 3CBGA 4R63A 3K15A 3QTBA 2E5FA 2PUEA 3DEYX 3JQFA 3D7KA 3RJZA 5J2CA 4KLGA 1RJFA 1FFXA 1DBRA 3T1NA 1S7CA 1ZN9A 1U7PA 4IVNA 2I22A 1X7HA 1R12A 3MYRA 2VP2A 4MR8B 4MF2A 2V9WA 1OWPA 1Y82A 2YV5A 3BSWA 5IC6A 2WUDA 3L7YA 4OQDA 3GLVA 3EIWA 4HNAA 3DD5A 5GIPE 2E6KA 1EDEA 1V37A 3VPDA 3FLAA 5INTA 4J7AA 1WM1A 1XALA 2I6UA 4IQ0A 3M4XA 1XJ5A 4RVUA 4IGEA 5JZBA 3LH5A 5KFOA 5JTUA 3IDZA 3F4KA 1FYXA 1G1AA 1XNRB 1ZQAA 1GRRA 1LDBA 3HCRA 3ZWAA 1NQ5A 2FUKA 5GTDA 3FF4A 5KB3A 3DE7X 4Y0AA 4IDNA 4JFAA 4O4IB 5HA5A 2FX5A 1C0EA 3RRMA 3MCAA 2F2AB 4CE6A 1OFVA 3GJQA 4Z4HA 5KEIA 1U0TA 3KKAC 5KNCD 1IG6A 1MKYA 2LBPA 2ADFA 3U7QA 3TJMA 1S2IA 1ZXXA 1TX4B 3S2ZA 4ZQGA 3ZDZB 1D6SA 4RADA 3PLAE 3D5EA 1SM4A 2I4MA 3PGMA 3TZEA 4RVOA 1PJTA 1LQUA 1RRKA 2YIJA 4R0MA 1ZAYA 4KNVA 5SY9A 1JR3D 2W6NA 2X8BA 3JVUA 4FTWA 3KZNA 3M6KA 1UZLA 4NK5A 1N2ZA 2FYTA 3OO1A 5I45A 3ZLJA 2GXQA 5BT9A 1L5WA 1IN8A 3OT4A 4XEHA 2XA1A 1W5FA 1DK3A 4CU5A 1SXQA 4C4TA 4IUDS 4RJKA 1IUPA 5BUQA 3HPOA 4RSRA 3GGPA 1H3NA 3V7KA 5J2JA 2D4AA 3USCS 4Q18A 3I9KA 1NVVR 5LP6A 2DHEA 1FQOA 2GYYA 2ZRPA 3BWVA 2ZYSA 1M8PA 4M9XA 4A6EA 4LHXA 5SY4A 2XCTB 2GEJA 3IE0A 1JIKA 1ZK3A 2EGHA 3K16A 1ZQHA 4H3SA 3W2EA 4E08A 3M2PA 5EUBA 9ABPA 4U2DA 5KWEA 5C4GB 2QI9F 2KFNA 4UU0A 2I55A 5KOJB 2JZCA 1HKUA 2E5LB 2J30A 1ZAKA 1AKEA 1AM4D 1VL5A 1T4GA 4M9HA 3MRXA 4KXYA 1DAHA 4V0KA 4BFZA 4CIVA 2QY9A 5AM4A 1C3VA 1CHNA 4E2WA 3QFCA 5AW7A 2E8NA 3MGAA 8GPBA 3QE2A 1NPTO 1MX5A 3AERB 1W8DA 4QBIA 1W47A 2XNJA 4BVJA 5A6SA 1BQ3A 3DKIA 5JHGB 1R00A 2FFJA 2QENA 4Q5IA 4XDYA 3OSUA 3SY8A 1VCHA 5J2TF 1DARA 1W75A 1TMGE 2IEBA 5FBVB 2DB3A 4P4SB 4JNCA 3SD7A 3IVRA 3RRJA 3L8CA 3FYTA 2NQTA 3EC2A 3G6VA 4ED1A 4G4GA 3P20A 4X3PA 1GKUB 3QZ8A 3AM3A 4V3BA 2V8OA 4L2IB 4BP1A 3GGJA 5KWIA 2W9CA 4LJAA 3AWDA 5M5BA 1Y9ZA 3L7JA 3GQBA 1YVUA 3Q8SB 1G6KA 4FFBA 1TAHA 4J0QA 3WGLA 4M60A 1PWEA 4KVGA 2Q6KA 4AQYB 1RZRA 5KWJA 3Q8QB 4XDGA 4RWZA 1NZFA 1E2FA 1JFFB 1FNSA 3PDWA 4KFUA 4B4DA 2HVHA 2HUNA 5FL3A 3K9CA 1U98A 1WV0A 2ONZA 3NT5A 4G41A 2VXBA 4KYIB 2P6NA 5BR1A 1MEJA 4N01A 1NU6A 1N9GB 3GQVA 1RPTA 3QVTA 3SMVA 3GXBA 1P19A 2XNKA 4I4TF 4RD4A 4U0JA 4QBTA 5C3MA 4FDUA 1HZZC 3QWHA 1BS9A 1U90A 2J4CA 4R2XA 4A8JC 4BMOB 4MV3A 4FEEA 4DQLA 3R20A 3PX6A 4ZYVA 7ICFA 2H2GA 1BDBA 2I7XA 2XGGA 3D2CA 1ZVQA 2ZXEA 5TE9A 4A3SA 4EYKA 5D5PA 5JD3A 2BKEA 3T9FA 3VU1A 1E2EA 2V7QA 5DCUA 8ICMA