2YMPA

Chloroacetic acid complex bound l-haloacid dehalogenase from a rhodobacteraceae family bacterium
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
225
structure length
224
Chain Sequence
SGILVFVNETLLDLTSLSPLFERVFGDAKVLREWFPELILYSQTLTLTGLYRPFGEIAAAVFEMVAANHQAKVTPDDIAELKTRLTSMPAYPDVAPALTRLQDAGFRLVTLTNSAPSPAPSPLEKAGIASFFEAHLTVHSSQRFKPHPSVYDSTAETLGAKPEELCMIACHIWDTIGAQARGWRGGFVARPHNTPLTLAEVPQPDFIGRDMGELADQLIASLTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-HALOACID DEHALOGENASE
publication title Marine Rhodobacteraceae L-Haloacid Dehalogenase Contains a Novel His/Glu Dyad that Could Activate the Catalytic Water.
pubmed doi rcsb
source organism Rhodobacteraceae
molecule tags Hydrolase
total genus 86
structure length 224
sequence length 225
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2ympA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2ympA01
1YJ5A 5AM1A 1LTQA 5AKHA 1U2SA 4F72A 2ZBGA 2FPWA 1O08A 2Q4RA 5AI6A 5AI9A 4BYGA 1IWOA 5IS2A 3R9KA 1T5TA 1K1EA 1Z4IA 2AGVA 2P11A 3DV9A 3UMBA 3ZWKA 3EWIA 4HGNA 3ET4A 4NWIA 1SWWA 4Y2QA 3J7TA 3N1UA 3QLEA 4KN8A 3SKXA 4G63A 3QUTA 3N07A 1L7NA 3A1DA 4XQ0A 3U7GA 2B0CA 2GMWA 1WPGA 4I9FA 2HSZA 4B6JA 3A1EA 3QU2A 4UAVA 3MN1A 1XPJA 3NALA 4UAUA 5AI5A 3U7EB 3W5BA 1Z4LA 4DCCA 4AP9A 3OPXA 3WKBA 1Z5UA 5ALMA 2ZBEA 2OM6A 1QQ7A 3BWVA 1S2OA 4OFZA 2RBKA 3QU9A 3ZVMA 4EELA 3FPBA 2BDEA 4UU1A 1RC8A 5AW0A 5AW9A 3BA6A 4YGYA 2BDUA 3A3YA 3QUBA 3DAOA 3RF6A 2FUCA 2G08A 3I6BA 4CF4A 3S6JA 2G06A 3SF0A 4DWOA 3K1ZA 3IRUA 4EX6A 1Z4MA 4PNHA 5AIBA 5AW8A 4GXTA 1L7PA 2YJ6A 5ALPA 2BY4A 2FPRA 1FEZA 3AR6A 4BX3A 4UMVA 3EF0A 4YIHA 3KOOA 3WK4A 2O9JA 3OCUA 2NYVA 3ZX4A 2FPXA 4Y2UA 3B8EA 1L8LA 3OCYA 3ZVLA 5AVWA 1Z4JA 5AK4A 2WF8A 4BNDA 1QQ6A 1Q91A 2PR7A 3L8HA 1TJ4A 3FGOA 1WR8A 1N8NA 3QUQA 1CQZA 1SWVA 5AVQA 2X4DA 3L8FA 3E81A 4IFTA 1L6RA 4FE3A 2IA5A 3ET5A 2FEAA 1CR6A 4RETA 5AKKA 2GHQA 1RPZA 1YV9A 1RKUA 2PQ0A 3W5AA 2B1QA 3FZQA 1SU4A 1ZD5A 2G80A 1RQNA 1VFPA 5JJBA 4DW8A 1S8OA 3L0YA 4IG4A 5ALXA 4RESA 3U7HB 3ZTWA 4UATA 3WKCA 3W5CA 1RLMA 4EX7A 3OCXA 4Y2JA 5AHXA 5ALUA 2CFSA 2C8KA 5A3RA 4QQFA 1U7PA 5AKXA 2B30A 4BNDB 4ZEXA 3FM9A 1ZRNA 3QU7A 3WGUA 5AM3A 4C4TA 1XP5A 3SHQA 1U7OA 5T41A 1N9KA 3AR7A 2DQSA 3OCVA 3I1YA 1XVIA 3AR5A 2NO4A 5AI8A 4CNQA 4Y3UA 5AM4A 2YJ4A 2R8XA 3QX7A 3ZI4A 4KNWA 5AVYA 1KYTA 2QYHA 1TJ3A 3QU5A 2JAUA 5AW7A 1O03A 4ZEVA 3MPOA 2O2XA 4J03A 1RDFA 5AIAA 5AM2A 4EENA 5AI0A 2IOFA 3PGLA 3WK8A 2HO4A 3B9BA 2IOHA 3L1VA 3PCTA 1Z4NA 5AKZA 5ALYA 3E84A 3UM9A 2OYCA 4DFDA 3FPSA 1L7MA 1YDFA 4G9BA 4E88A 4OHFA 3ZW7A 2JARA 3AR3A 3WK5A 4FYPA 3EF1A 1ZRMA 4EZEA 1Z4OA 1ZD2P 2VKQA 4KNVA 3ONNA 3PDWA 1EK1A 4ZEWA 3IJ5A 2JAWA 3NIWA 1ZOLA 5AKEA 3KD3A 4UMFA 3L1UA 4NV0A 4YCNA 2GFHA 2HX1A 2OBBA 1U02A 4CF3A 5FP0A 5AW2A 4HAIA 3AR4A 3AR2A 1QYIA 3ZVNA 2PKEA 2G1AA 1Z4PX 3KZXA 1J97A 4J2TA 5AVZA 2YN4A 2HEGA 4FFDA 4JDPA 1QH9A 4I9GA 3WKAA 3E8MA 5AVTA 5AKJA 2C9MA 1RKQA 3MMZA 1L8OA 2CFTA 2HDOA 3U13A 5ALWA 2W43A 5AKYA 1T5SA 3L5KA 4YIKA 2HCFA 1WZCA 3ESQA 4Y2TA 3ED5A 5AVXA 1Z4QA 5ALOA 5ALIA 3HLTA 5AVRA 1NRWA 2D2VA 1RRCA 3FVVA 3OCWA 2YMMA 2CFRA 2YFYA 3QYPA 1YMQA 3WKDA 4EEKA 4XOUA 2B82A 3U19A 2QLTA 2FI1A 2B8JA 2FPSA 3TLMA 2IYEA 1YS9A 3N28A 3F9RA 4UU0A 3KC2A 2I54A 3PGVA 2YMPA 3VAYA 5AM5A 1ZS9A 2P69A 2AMYA 4AS2A 2C4NA 3NANA 2ZXEA 2RARA 3U26A 2Q5EA 2RB5A 1TE2A 4O8CA 1EK2A 4OD0A 3QGMA 1RMYA 3UMGA 3QU4A 1QQ5A 2ZOSA 3ZX5A 3NRJA 3NASA 4BEWA 1RQLA 2IOFK 3ESRA 1YNSA 3M9LA 5AM0A 2R8YA 3N5KA 5IT0A 5ALHA 4XPZA 5AICA 4QJBA 1RLTA 4UMDA 2JAOA 2YJ3A 2MU1A 5AKGA 3KDPA 3U7FB 4Y2VA 3EPRA 4Y2RA 2WM8A 3L8GA 2NO5A 4UW9A 2G0AA 2G07A 1VJ5A 1MH9A 1X42A 4UARA 1ZJJA 3DNPA 4BKMA 1PW5A 2ODAA 4HGPA 5ALSA 2HHLA 2I34A 3L7YA 2Q4TA 5AI4A 2HI0A 3QUCA 4YH1A 2P9JA 4CF5A 5AK3A 5AKIA 3N8GA 5AK5A 3HYCA 1RKVA 4YCLA 2WF5A 1U2TA 1J8DA 3SLRA 3R09A 5ALVA 4CE6A 2I55A 4XE5A 3B9RA 3GYGA 2WHEA 1T9ZA 2HF7A 3OTQA 3CNHA 1LVHA 1TA0A 3ZWDA 4UMEA 5A3QA 5ALTA 2FPUA 2EARA 4NABA 2B1RA 4JB3A 4BX0A 5AW5A 5ALLA 1NNLA 3W5DA 1ZD3A 4H1WA 5AW6A 2YJ5A 2P27A 3WKEA 4C4RA 3QNMA 4L6AA 2WFAA 3AR9A 4HGRA 4KYTA 1Q92A 1Z4KA 2G09A 3RFUA 3DDHA 1RMTA 2I7DA 2OA0A 3ZU6A 3NAMA 2EAUA 2W11A 2CN1A 2HOQA 1F5SA 5AESA 3OCZA 5AVVA 5AVUA 3IB6A 4AS3A 3WGVA 3KBBA 1JUDA 3A1CA 1VJRA 4HGQA 2WF6A 4MWOA 4BX2A 2EATA 4UASA 4NFLA 2R8EA 2R8ZA 4BBJA 2WF9A 2YBDA 1Z5GA 2MSNA 2YMQA 5ALGA 2B8EA 4C4SA 4UM7A 5AKLA 2ZBDA 3E58A 3I76A 4KX5A 4MUMA 3P96A 3I28A 5AW1A 3MC1A 2I6XA 2ZBFA 1L7OA 1NF2A 3WK6A 5IT4A 1RLOA 5ALRA 4GIBA 5ALZA 2YY6A 3L0BA 2GO7A 5AW4A 3WK9A 2ZG6A 4L6CA 1WVIA 4UM5A 4OCZA 5ALKA 2W4MA 3CZ4A 5AVSA 4HGOA 5AK6A 4KX3A 5ALDA 4Y2YA 1AQ6A 2FUEA 3M1YA 4Y2PA 3SD7A 4F71A 2FDRA 2I33A 3AR8A 3L8EA 4YCMA 4L57A 1Z88A 3R4CA 2MU2A 2WF7A 4NAVA 2YMLA 2JGAA 4HYTA 5AW3A 2AH5A 3SKYA 1TJ5A 3NUQA 4Y2SA 3ZTYA 5ALEA 5ALJA 5ALFA 2C88A 3UMCA 1RMQA 5E0OA 5ALNA 1ZD4A 3D6JA 2HF2A 3WK7A 2RAVA 1Y8AA 4BEVA 3SMVA 2C8LA 5ALQA 2AUTA 5A3SA 3QXGA 2GHTA 3ZUPA 3L0CA 4Y2XA
chains in the Genus database with same CATH superfamily
2QYOA 4W4TA 1EWVA 3FKSD 1IAVA 1A50B 4QQ8A 4HVAA 1ISPA 2ZKLA 3PDHA 1GV0A 1NMEA 2C04A 3GG9A 5H2FU 3I8OA 1GTMA 2ZSKA 2VA3A 1UBKS 1H9AA 2WY2D 1P62B 1W48A 3JARB 3EFHA 4WZAA 3L7JA 5JSZB 3D0OA 4XGIA 4UHDA 5J2BA 6YASA 1GP2A 5CA1F 2HVIA 5E9AA 1DJMA 3I9KA 1SBNE 3LOQA 1SBHA 3TARA 1VDVA 2ZAIA 3CM0A 1Z28A 4P4LA 4R68A 3NIFB 4A8EA 1HRDA 4DC1A 1WX1A 1WR8A 4LAFA 5IVHA 2A35A 3FOZA 5B57C 1M33A 4NBTA 4TURA 1ISJA 2A4KA 3FZQA 4YBRA 5GZ3A 4L4ZA 1Z3CA 3V00A 3EGIA 2EEPA 4IG4A 1L5HA 1D6SA 3K5PA 1BWPA 1YR6A 5DBEX 3PX3A 2GWRA 5EGSA 2ZYGA 1XXLA 1AKRA 3F5SA 3WWYA 1XF1A 1KKXA 4L0QA 4OGGA 3AG5A 3KKQA 3W0LB 2GYWA 1R4NB 3G8AA 4O4HB 3AVUA 3NXSA 5EHIA 1KBUA 1YCHA 3Q0EA 3Q3IA 3M3DA 4RD6A 5DW0A 4LJLA 3H65A 1DXQA 1R64A 2IU3A 4XGQA 4R6WA 1UBTS 4PLYA 5IVIA 5JSQA 1JHPA 4BC1A 2RHBA 2MYTA 2HMVA 4H4EA 4I9GA 1RHKA 3HP1A 4X63A 4N3GA 3E15A 2X86A 5CFLA 2H7YA 1Q3VA 5KAPA 3HXTA 1NAHA 2HDOA 3DMTA 2CXXA 2DEUA 4JS0A 3RBAA 1WDWB 2LE0A 4FEGA 4KO3S 4ZCQA 4AJJA 1ZN2A 2COEA 5C8VA 1ZCJA 1ZQCA 3HKCA 3V8BA 1UPAA 4HQRA 2O52A 5B53A 4DA9A 4XDYA 5AQEA 4DNXA 2X2PA 4WL0A 1BVHA 3AVOA 5KG3A 4Q44A 4HD8A 1M6HA 3VAYA 1XQWA 2H1RA 3MJHA 3NDIA 4PXAA 3AO0B 2ZJAA 3UATA 3A58B 4MDYA 2HLPA 5AFSA 3H5AA 4U9IS 2C3OA 1P2TA 2YFKA 3TCXB 4BB9A 1ODFA 1Y1SA 2MU1A 3GYBA 5TMPA 4GZ3A 5CK4A 4H6PA 1HOXA 5DBBA 3UT5A 1CUVA 1YIDA 4DCTA 2C7RA 3P71T 5HUQA 2JJQA 3CNBA 2GOLA 1KOLA 2MJLA 2XAAA 3PHHA 3G68A 3BHIA 1HWYA 3BHNA 2ERXA 3R5TA 4E5PA 4YJ2A 1FSSA 3NIBA 4ZVKA 4DBVO 3QVUA 2YWCA 3AIMA 3TR5A 2FRVA 2QAGC 5DMXA 3UCXA 1THGA 4KLEA 4WK4B 3HI6A 2WFAA 1UPUA 2QRPA 4BNVA 2BKLA 2WYWA 1AK9A 3VVCA 4EA9A 1PWXA 3QKRA 3DDCA 2CB9A 3EA4A 5DWQA 1FUEA 5FEMA 3X44A 1BVUA 1GGMA 3WBBA 4Q3DA 1CFJA 2E4UA 5CBKA 1DQRA 2XX3A 4M49A 3VNBA 3UWOA 2V6FA 1QRAA 3FD8A 1COWA 1IIBA 1Z29A 1LW6E 4J9UE 4X1IA 4FKBA 2O6HA 1I1OA 3QE0A 3ZQUA 2YW9A 3OZWA 1X7XB 3T5GA 4CEIB 1HEIA 1ISFA 2FR8A 2A0UA 3NRWA 4TL6A 4J9PA 2QF7A 1H1LA 3E9YA 5IKXA 3GDHA 2BV3A 4Q48A 3GLFB 4L8WB 4UEKA 3VTKA 2OHVA 2FQWA 1GZHB 2IXBA 3IE2A 1UH5A 2EJBA 2PO5A 5BPFA 4WXMA 2X4IA 4B6OA 4NWIA 4R8KA 3O8BA 2R60A 2C2XA 1WVGA 3AINA 4KFRA 3KXPA 1AIPA 1F8YA 2HQRA 3R7NA 1BH6A 1LZKA 3CPJB 4DGSA 3IHQB 3H0EA 2CV0A 1OA1A 2PXHA 2ONJA 2P5UA 3DAOA 4L74A 1FPMA 2IHTA 1TZMA 3SF0A 4DRXA 4LY3A 4XWYA 4EPWA 3WIOA 3UWPA 5LJIA 3KQTA 4B9MA 3HYRA 4PGXA 4J4BA 2X1HA 4O33A 1AKVA 4DDUA 4F4XA 3LT2A 3RTBA 3EWNA 4TSKA 1X70A 4F04A 4J9SA 3KB1A 2CJWA 3TPZA 1IQPA 1UC5B 3ESYA 3WLHA 4KL8S 2FYTA 4TXLA 2YHSA 2C8JA 3IULA 2H0AA 2JJ1A 4PHPA 3HKBA 5T57A 2V0GA 3SK0A 1OC4A 5JYDA 2AD5A 4AJ4A 4LGYA 3RFTA 2O2HA 4H7HA 4OATA 4R8UB 5TR9A 4L7QA 4BV9A 2YJ4A 1U8TA 3EQ2A 3LO8A 3A32A 2I4LA 1OBCA 2WAOA 4QTTB 1NQ5A 1OV6A 1MGOA 1N5DA 4QW9A 2K5UA 5M2QA 2B69A 4A73A 4QUDA 3U44A 2DGDA 2B99A 2XECA 1L7MA 2GCGA 1ADFA 4TVOA 4QHYA 3KT8A 3FZGA 5TXGA 2ZS8A 1VJCA 4A0GA 4EH1A 3OZAA 4QD3A 1V16A 2ZRQA 1EWQA 3GNTA 3HKDB 2VHEA 4QRHA 5K3BA 3LQRA 4IZIA 2XMRA 1A9ZA 4ZHSA 3Q6IA 4HLQB 3G5UA 5DGTA 2G6TA 3L8MA 4QZVA 2VDVE 3DMRA 5C8YF 4GOKA 2PUWA 3SC3A 2QJFA 1NY6A 4DMCA 3VR3A 1NRWA 5LYYA 1HDEA 5ITWA 3GU3A 2B82A 3ZW8A 3RU2A 1JF8A 3NLLA 3A7EA 4P0TA 4RH3A 4R71A 2AMYA 4OEHA 1EDDA 3KEOA 1YRQA 1N2SA 3VR5A 1C5KA 1X87A 3TH5A 1R3UA 4ZANA 2B35A 5F1YA 4BEWA 3N7SC 3ESRA 1OZFA 3WNBA 2G7MC 1E1QA 1O4VA 3PUXA 2PL5A 5T5QA 1GG2A 1LDMA 1MG0A 2DWCA 4JR1A 3H8WA 3WGNA 2RHGB 5F5NA 4ND2A 3ZU2A 1RYZA 2EAMA 3NDRA 3VRHA 2FRXA 4EUFA 4RPKA 2QMOA 2XI4A 3ID6C 3GYGA 1GPDG 4JI6B 3B9PA 2VJBA 4DS3A 2GERA 5D3ZA 4HKTA 1D8LA 2FPUA 2D00A 4AF6A 2JR5A 5AW6A 4CGZA 4HUTA 1KMHA 3LWDA 1MVNA 4JXZA 5HKAA 4Y6GB 3A9TA 4KN6A 4BN5A 2ISOA 2A0KA 2QE6A 1YL5A 2QRNA 2Q28A 1KFJB 3FYDA 4IRDA 3D0RA 1R0WA 1K1SA 2J48A 1GL3A 2KE7A 4XVRA 1NRXA 2QZJA 4KLMA 4CVNA 1ML3A 3PF9A 1EVYA 3M89A 2IFTA 1OTXA 2PBLA 1LJ8A 2WA2A 4KMMA 5DNAA 2CNNA 3DLBA 5FTWA 3D6MA 3IJEB 4H7DA 4PLPA 5DVZA 3W06A 3W1WA 4ZT7A 4O2AF 1WU7A 3WWDA 4B3GA 3W79A 5BR7A 2RAUA 4JC4A 5B66U 1T6ZA 3CWZA 4L57A 2OSBA 4P7GA 1MO6A 3TBHA 1ZQEA 5HP4A 4YRRA 5JATA 4PYJA 2NSJA 1JFTA 4Q21A 1E79A 4ED8A 3EYZA 5BR8B 1L4YA 3IIIA 2NZ8A 3TQSA 2VF4X 2H8GA 4DL5A 2JGIA 3HJEA 4PPNA 4LBZA 1OIWA 4X6YA 1LKYB 4O4HF 2FX3A 3N8IA 1J56A 4B45A 2Q4RA 3U7RA 1B00A 1G63A 3BMQB 1U6JA 3A1UA 3EWIA 3GLVA 4W5HA 1MP0A 3U37A 1Z6QA 3R3VA 1TF5A 3OI7A 1IQ0A 3LUJA 1N6PA 2RHLA 2XV1A 3D5TA 3F6PA 3P2MA 3RIXA 1JFVA 2YUIA 3DR5A 3JQGA 1URPA 1K89A 4XWOA 4JB8A 2XUGA 3SDBA 3A3OA 4BUCA 5LYJA 4PS0A 3C8DA 3GRRA 4LZAA 4HLUC 2ZUBA 3Q5DA 2GEVA 2UZ4A 3ZZ0A 2AOTA 3QQ5A 2C2BA 3QHPA 2VG8A 3NBUA 4C43A 1OI3A 4WLFA 3ZY5A 5KFCA 3AGPA 4PLGA 4FT2A 4P84A 3TKAA 3G2JA 3IYLW 1XA0A 3PIDA 3MJRA 1EE9A 2CCGA 2JHFA 1V8PA 4GQAA 4KLSA 1PNTA 5AOAA 1RQNA 1EFLA 1RXWA 5J2AA 2HBYA 5ALXA 1RHQA 3ZTWA 1NJ8A 2QN1A 4IDPA 3ECCA 4RLHA 4P58A 4DOAA 3CVYA 3FF1A 1EJ0A 4RPIA 2Y1XA 5H5JA 4E12A 1KORA 3ZBTA 4EMBA 1F0PA 4HXEB 3EGEA 3SCZA 4A6EA 1NVMB 1S89A 4RZ3A 1U2EA 3E1SA 2BFNA 2J9XB 3CF2A 2NSYA 4JQSA 3IQIX 3WB2A 2FW0A 4E88A 2XB6A 2FDCA 4PQGA 5KYTA 1DUVG 4L5AA 4RY8A 3RU9A 4I6EA 3C0KA 1ONSA 2NU6B 2P4QA 4UUMA 1H5NA 2O8DB 5FQOA 3TI9A 1U2ZA 2YWGA 5JJIA 4HAIA 2GD1O 3ORFA 1DFGA 4II3A 4IFIA 5H83A 5BY2A 3WLMA 4HQ0A 4BLQA 5KWIA 4ZVUA 5LR6A 1U0SY 2NO1A 4EF6A 4LY0A 1UAAA 2DPHA 2OV4A 3MTBA 4JXXA 4W99A 3KWJA 4BVKA 1Z07A 3PQ2A 1FNCA 4DT1A 3IQGX 2FFHA 1G5TA 3DEAA 4FZMA 1NVBA 4LECA 1I7NA 2VF2A 1NVWQ 3NANA 4OQPA 4C6RA 2WUWE 1K4KA 3U1BA 2WICA 3H13A 2ZJ4A 3NRJA 5F3XB 3PSAA 5H8WA 4D4IA 2NUTB 2OLKA 1BU5A 5CLLA 2C9ZA 3OX1A 3QYAA 3OJUA 3QPWA 1NJGA 3URMA 4BASA 4QLBA 3RH5A 1SHTX 3QPDA 1P5JA 1V37A 5HRUA 3CX7A 4KO2S 3QWFA 3X1KA 1NVAA 3V8EA 1QTNA 1THMA 5CYOA 4GDFA 4DR7B 1JA9A 4DQSA 3V4SA 3WOVA 2YYZA 3MMNA 3GGGA 1RYBA 3OC0A 5H0IA 3W2FA 3WLJA 1U8EA 2XCLA 2XMBA 2Y9TA 2FSSA 1XDBA 3CNOA 2GBPA 5FPPA 2ZTSA 8ICMA 3PRKE 5FFFA 1PS9A 4LHEA 3U09A 3RADC 2FEWB 1E96A 5JSKA 4BFXA 3UQ0A 4TTIA 2QGNA 3K30A 5BN3B 2ZIXB 1MO5A 4R5MA 4PLFA 4C89A 1RBYA 5FPQA 2WHXA 1ZD1A 4QG3A 2G4LA 1JHXA 2PT6A 4B2PA 3IA2A 4AFNA 3K53A 3WNCA 2QJRA 4TWRA 1DHRA 2PS1A 5DHSA 4URUR 4K8RB 1AJEA 1YTLA 1N0IA 3BRCA 4FXPA 4Z4EA 3MC1A 5CB4A 1DELA 3F2DA 3TR6A 1DDGA 3LTEA 2ZJ0A 5L45A 3NC0C 3HJCA 2DFLA 1GCIA 1ZMBA 2X9LA 3VGJA 4PW0A 4YACA 5I47A 2BR3A 2IE8A 2QGZA 1NVUQ 3AUAA 2F00A 1ZXIA 9ICTA 3RRHA 3A37A 2FOLA 4TTTS 4F96A 1PFYA 4LV6A 4K87A 4YD2A 1UBMS 5E3IA 3HBMA 5IVDA 3L1KA 3H9GA 2H3EA 3TG8A 2H0RA 4G0XA 1AS3A 3D3KA 4QBHA 1YZ3A 3VV2A 1N6KA 4HDQB 4JWNA 4IHAA 4UNPA 1PBNA 4OX9Y 1SKYB 4TTRA 2OQVA 2PFKA 1PV4A 2P11A 2G25A 3AV0B 4PLWA 1HC7A 4H0FA 4X45A 4OH1A 1EXNA 2G0NA 1HFEL 4UB1A 3UQZA 1GSHA 4P86A 1VB5A 4FFBA 1H3EA 2C59A 4QTYA 3FVWA 5F78A 4DCCA 4BZPA 3WLFA 4UB8U 4KNYA 1E89A 1FFVA 2GA8A 1WSAA 4MIYA 1KZ1A 2OWEA 3GOHA 1GPJA 1YI8A 5IC4A 2VTBA 3HVKA 1H9CA 4LQLA 4KYVA 2HKIA 1FDUA 5CG2A 2DQ4A 3CKKA 4UHBA 2HNBA 5BUQA 4AMYA 3PWSA 3G3EA 1I3NA 3PXAA 5BYBA 3WAKA 4P4GA 4CG3A 3L8FA 8ATCA 4RFLA 5JHHB 2FEAA 3I4LA 1G291 2VQFB 3FZEA 4LF7B 1IUPA 3DR3A 3QKSB 1Q6ZA 3OCXA 4QZHA 3QU7A 4ASUD 2HK7A 3HB0A 1YRAA 3DOJA 2QMUA 1HT3A 2H3VA 1H5QA 4QFBA 1XVIA 3ZIDA 4MVCA 3AMVA 2Q9UA 1OOEA 2X77A 3FKJA 1AHHA 3IUPA 4HWKA 4W7HA 4U6NA 3RRJA 3OH8A 4DJ5X 2R7NA 3A4TA 2O19A 3FMVA 4DMHA 3L4BC 3A7DA 4K0RA 4HUQB 4IF6A 2IXFA 3RR2A 2C4TA 4DZTA 1GRQA 1IVNA 2Q5CA 4LA4A 5PNTA 5DB9A 1NMZA 2OL4A 2PGOA 1K8QA 2Z8ZA 2R25B 1KHHA 2IS2A 4P4NA 3LG2A 4JLSA 3RDPA 2WW8A 3WQBA 3TF5A 3AI3A 2X5OA 1LTKA 4WOKA 5FUMA 3T5TA 2PVCA 1Z19A 1HE5A 1BS9A 4PZOA 3VNSA 3ZDFA 1TF2A 2A0YA 2Q0HA 3P5BA 4V0OA 4K8OA 4H4CA 4AURA 3L04A 3T38A 4OHYA 1JQLB 2GTPA 2FPGB 2BGWA 1PK1B 1PT8A 4PN3A 2HRQA 2VXYA 4FZNA 3ZN2A 2HCRA 4EHIA 4A36A 2CNLA 3NM6B 3A1VA 1JXLA 2GWSA 4Z1MA 3H5TA 5CRIA 4P5DA 4LFCB 4J0GA 3D7LA 2FKAA 2FKNA 2Z4SA 1M2OA 5CVEA 4ZHQB 1PR0A 3JQAD 5I9BA 5B37A 3DAYA 4R0VA 2QENA 1ZA1A 1SUCA 3P2KA 1C7IA 3TO5A 5DEIA 4J94A 2I7CA 1TKCA 4MB2A 3T9BA 3Q3JB 5J8YC 2C9BA 3DP7A 1YZNA 5D84A 1E69A 3SZ2A 1P1BA 2DT8A 3MXOA 5B7QA 4J3JA 1PLJA 1IN8A 4UD2A 3T3MB 3CY6A 3DD5A 1IN5A 3ZJYA 1EA7A 1D7AA 4OJKA 2H4XA 2H08A 4FR2A 5DNEA 3A1SA 5F98A 1BMDA 3LVRE 2REQB 1DUSA 1Z26A 3IT3A 2DY1A 1XHFA 3K96A 3R0VA 4UNSA 2FFJA 5EQDA 1D5CA 3WYNA 1JXAA 1U45A 1JSRA 4F97A 3HFRA 1U7XA 3KZVA 1L4GA 3OZFA 2X22A 5U4XA 3WLEA 3BZBA 1VBFA 3WI7A 1E1NA 3K6RA 1XDWA 2XQGA 4JITA 4DL6A 4WX2B 1WHSA 1XRJA 4FZVA 1DQSA 5DN6D 4MGZR 2FP4B 4JXKA 3N2NA 1KE1A 2I4TA 5LBUA 3Q0IA 1JMYA 5KQGA 4MGKR 1LPSA 4PAWA 1M34B 4Y6LA 4ARSA 5BN4A 4CV3A 4NAVA 1OLOA 3UT0A 4LXHA 9ICUA 1BWRA 5EVCA 3L79A 3AF2A 4WA7A 2WKRA 1QIGA 3ZE1B 2O0LA 1I1QB 3C87A 2P2LA 4LKRA 5C32A 3F4KA 5JW6A 2IX3A 1T2FA 4I6JA 4EB6A 3HHPA 1A7AA 3KFVA 1U9JA 2YOFA 4LXYA 3EQ8A 1X7YA 4NU0A 1U0FA 4DREA 2QLNA 4DABA 1T9GR 2ZBEA 2X8JA 1IDOA 4RTQA 3MB8A 4RQ0A 5BORA 4EEZA 5DG7A 1QU2A 1JB9A 3OJ0A 4D9EA 3SC6A 4RVHA 3OE1A 4P4MA 3UJBA 1JSCA 4BFCA 4PPQA 2QQ5A 2IYQA 3UJ7A 1WDLA 5L7YA 3OCYA 4DLAA 3DNMA 4M0EA 3D5QA 4FFVA 4RXUA 2PWPA 4DCSA 4ME6A 3H4VA 1EI9A 4HXFB 4KH1A 5BVGA 4TL9A 3EHEA 2BKXA 3OZIA 4IQ4A 1YB4A 1U0HC 3N0WA 5HZKA 1R88A 1TUEA 4RZIA 2NO4A 3NH6A 2VRCD 1EKXA 2VP2A 2OCIA 3I04A 3EF3A 3WMRA 1DX6A 5JCZA 3SX0A 3S0JA 3WBKA 5DGBA 4S2EA 4KN7A 1Q0ZA 3DPSA 1NKVA 1Q1AA 3PR1A 3LRTA 3T3FA 4MUBA 2RHFA 3TSZA 5DP1A 4DEYA 1IOVA 2C0PA 1NE7A 2PL3A 3SAJA 1OIVA 3ZWOA 3EMDA 4HVLA 1IIRA 3WGGA 4OJTA 3L6RA 2ZIWA 3LVWA 2QL5A 3LRXA 1R0LA 5TQ0A 5GTHU 1AKWA 1O6FA 5GONA 4MYSA 3CUTA 3UGTA 4G0ZA 4RD4A 2EGHA 4LK2A 4AJIA 4R81A 1Y9JA 2YQ5A 5CMLA 4EG7A 3FNRA 4PG5A 4EG5A 4C3VA 4MQMA 1QV9A 2QYSA 1V1RA 2XUJA 1MDBA 1KEKA 4F2SA 4J1SA 3HTXA 4GE0A 5CYGA 1JEQB 4J3FA 4P4TA 1Z82A 4DV1B 4UTOA 1V5GA 4C01A 4RK0A 5IG2A 4L2IB 3BQ9A 4NMXB 3TIIA 4CTNA 1RRFA 2QMEA 3EVGA 4ANFA 1UAGA 2FN7A 3JQFC 1R4MA 4ENQA 1ONOA 4BNWA 1OLXA 5DULA 1C1XB 1R0KA 1U8UA 4DLPA 3UICA 3L49A 5DHTA 3OUZA 4Q47A 1YQ9A 3QKIA 4KIWA 3LQ4A 4K4GA 2JANA 4EEYA 3ZW9A 1XRRA 5H80A 5KFUA 3OFSA 2XNSA 4RA6B 4I66A 4XCVA 2R6ZA 2QTMA 1C0IA 3PLAE 3SYMA 4EJMA 3NS1A 4DBLC 1RAIA 1DZ3A 2UUBB 1UDAA 1NNI1 4QG7A 4TUSA 3HYNA 1TU0A 1W0CA 2UDPA 5J2GA 1B6RA 3CUYA 3OJOA 4QJ4A 2NVOA 1H6BA 3EJ6A 3FROA 1KU6A 4NLZA 5LWHA 2BP7B 3AM9A 1TLLA 4PZZA 1FBNA 3AHFA 4OJ5A 4JMLA 1NZBA 2E49A 4D0SA 3NONA 1LRLA 4ZI2A 2WTEA 1X9GA 3LFTA 3DOEA 2XY4A 3R41A 4UFPA 4XCQA 2VA9A 2VH1A 4LF9B 4TLAA 1D0VA 1OBHA 3G9ZA 5JVDB 3HP7A 5IXSA 3Q7QA 2NX2A 5IAGA 5CVTA 1GTJ1 2IYZA 2H65A 2PFPA 3V1TC 1DC8A 1P18A 3F6BX 4GR5A 4DXAA 3A70A 1YZ6A 2OV2A 2VLBA 1AQ6A 3SXUA 3E7WA 5IH3A 4JJ6A 3VM6A 4XB6B 1EVZA 1XR3A 2YC4C 1IAQA 4A4DA 2Y0PA 1Q15A 4YD1A 1RMQA 3D6JA 3ESBA 3O2SB 4RUKA 4EY7A 2HRZA 2MYUA 2A8YA 3WMEA 4DSEA 1RRGA 1PG2A 4GI1A 1TAQA 3H16A 4BYGA 1T5TA 1GTG1 1LY1A 1WB5A 2J5QA 2QRLA 3KEFA 1Q0RA 2O3QA 4G63A 2BFEA 1WYGA 2BGKA 1WPGA 3KLOA 3WNDA 1J9EA 1Z15A 2M6RA 1EX1A 1T26A 4CMGA 5E6SB 3RUFA 4HS4A 3E5HA 2DE0X 4DTCA 3LT1A 1KDVA 1S8AA 5EQTA 3K0HA 4NHEA 2PFOA 5CX1A 1Z3IX 4HLDA 1F8XA 5KYYA 2IIQA 3KXIA 4GBGA 1ZOSA 4YB8A 4RL4A 4KLUA 1H4VB 1T8RA 3OURA 1RM0A 2CXTA 3L3FX 4OP1A 1GLGA 3AP2A 5BOMA 1KQGA 2H2IA 4BMZA 4I2GA 1L8LA 4KAAA 1S3IA 5KYVA 3X2EA 5CA1B 2NO0A 8ABPA 1QE5A 5PGMA 4ZICA 3PYXA 3JR3A 1KL9A 3PSHA 4QXAA 3AEUA 5ENDA 4LBVA 4S1OA 2OCYC 4M9GA 1W36D 2IS1A 2QTGA 2VF7A 3IAEA 2RJOA 3SR4A 4M7WA 1C0PA 5J40A 1XSPA 1T9BA 1RRMA 3GBPA 4NZYA 2RGDA 4MDEA 4MS4A 2DQSA 4ED9A 4X8LA 3T95A 4MA5A 4ML3A 2BMAA 4KE7A 4HPWA 1Z2DA 1R8JA 2KPOA 1Y7LA 3EFEA 3OE5A 3VYRB 4MZDA 2CDBA 1HNWB 3R0XA 1J39A 1FTQA 3HNOA 4PX3A 3KT6A 4G3IA 4YRDA 3RSHA 3I53A 1UCFA 1J2TA 1O95C 3H2YA 4V39A 3RANA 1SOUA 3HYTA 1W4CA 2KMLA 3TCKA 2CYCA 1UJNA 3MD0A 1PU2A 2DU8A 4U9UA 3V8PA 2VUSA 2Z5GA 2YNMD 3I1FA 2DY0A 2BQRA 3GVXA 3ZV3A 2YFQA 4JJ8A 3MGVA 1P4HA 3R6LA 1Y6JA 4NCNA 1P0PA 2C31A 3PQ5A 3O31A 3K70D 4RGVA 4XR4A 1OZHA 2VEDA 3WMXA 2ZS9A 1VPEA 4IYRA 3WLSA 4NY8A 4D8TA 3VHLB 2V0CA 1N7GA 2QTHA 4J16C 3UMMA 4D9JA 2IELA 1O5IA 3N28A 4P2BA 5KTYA 5DEOA 3RBVA 1NXVA 1VDMA 2HLDA 4E13A 3CXRA 2HEIA 3LECA 3E9QA 4UB3A 1WOYA 4GGMX 4P2GA 5JS7A 1JB1A 2OPHA 3VAZA 3WGZA 2Q49A 4FFOA 4RMGA 4B4UA 1KQNA 1ZYUA 2VS1A 3SM3A 1WCV1 1WW3A 2OGUA 1QHYA 1MW9X 2GTHA 2PCJA 4NBRA 4FP9A 1W5EA 1IJKA 5E9JA 3TIGA 2WRZA 4LDAA 3KELA 4KVZA 2FFAA 2WJJA 3UWDA 3I2HA 3SZMA 3RNLA 3RYCB 2ZPAA 3F78A 1YQDA 4GKVA 2GZ3A 2WUVA 2D8CA 2PU7A 2XD9A 3UKJA 4D4LA 2KMDA 1YFJA 1GL7A 1NUHA 4LYJA 2PLFA 3D5EA 1L9KA 3RSFA 2EYUA 4RUAA 2ES6A 3TEJA 3BFKA 4MIKA 3KJXA 3VXKA 3IEKA 3GEPA 3NFRA 5DHRA 3V3TA 5BOLA 4GSKA 2HQBA 2C20A 3D3QA 4OLAA 2UYOA 3R24A 2BEUB 3O3NB 3BQTA 1QX3A 5CPBA 1XNHA 5ITVA 4Y2PA 2AHOA 4Z6EA 1RYFA 2H3HA 2RBEA 3V4RA 2AFHE 1SCKA 3B13B 3O3CA 4BDTA 5EIEA 4DRZA 1V2HE 3ON5A 2VP4A 1U65A 1KRXA 4PZNA 3MGHA 2QAGB 4HQNA 3BQ1A 1JG1A 3C21A 3QBVA 5H4GA 5GJBA 1KO8A 4ND5A 4I9UA 1QH1A 4Z4HA 5KFRA 3MMSA 1JVSA 4HY3A 4RSRA 2GZRA 3IPCA 4WXEA 1GEGA 3WLNA 2BFBB 4FHGA 4PYOA 3H1TA 1W0KD 1W46A 1E1DA 1S5PA 4ED3A 1XDZA 3UQYS 4LWOA 1NI3A 1Y6QA 3ACBA 2AQ0A 1S2OA 1EZ1A 1P2GA 1HR0B 1TJPB 2WT4A 2JCYA 1R0XA 3TMAA 3NBXX 1WNTA 5JRJA 1W4ZA 3K16A 4PNHA 3AMZA 4NJMA 2WV7A 4CMBA 1SNYA 2YJ6A 3VGPA 1UBSB 1D1TA 5C51B 4Z54A 3GJ8A 1S3FA 2ZUWA 2ZR0A 1F3LA 3LCUA 1QZUA 3ILYA 3AVQA 3JZFA 3PRJA 1X6JA 2I5PO 1GNLA 3PNYA 4G65A 1E2QA 1T2AA 4OJYA 2JJ8A 2W00A 5B1YA 4N0MA 3BQNB 2VDLB 5GJWC 1ZD5A 3F3SA 4OJQA 3RYHA 3AX6A 4GPTA 5ALUA 1CJKC 4OP3A 4BO5A 5CWRA 3BBPA 3RROA 4KGXA 621PA 2QROA 2XNHA 4FONA 3AI2A 5IXJA 2ZTLA 4YS6A 5CCXA 1V7CA 5EPOA 2G28A 4M55A 4URHA 3K1AB 4YVZA 2FW7A 2F62A 5HWSA 3B6ZA 3AHIA 3OHBA 3QFCA 1YVDA 1HX7A 1NUTA 2RHTA 4D0LB 1IBCA 3GROA 4QX6A 4AYTA 1VGVA 5J59A 3VU9B 4ZYVA 5EP1A 3GG2A 2CEAA 1ZUNA 2IEAA 4AF7A 2A9FA 3ZK8A 3K8OE 3HA3A 2YWJA 5I4KA 4DARA 3LU1A 4IJKA 5JVDF 2UUAB 3ILHA 4Q1VA 2ZE8A 4Z7JA 3I8SA 2EP8A 3HR4A 2ZYTX 3UFBA 4TWBA 2I1QA 1ZLYA 4BO6A 4QASA 4GEKA 2R18A 2I54A 2JGMA 2AYXA 4ER3A 3LZ6A 1NP6A 1WU8A 5C8YB 5D4BA 2AI3A 5JCXA 3GMIA 3ZVKA 2VPTA 4BMSA 4C4AA 1KSPA 1X6IA 3AHDA 5K3EA 4M37A 4DV4B 1D1SA 4C4YA 1PR3A 4M1WA 4YAOA 4DGQA 1ADCA 1MO3A 4U4AA 3LP5A 2JFQA 2WIKA 4F5YA 1WLSA 3ZQ6A 1XMVA 1KSGA 1PSDA 1K0FA 2ZIZA 1IBLB 1UFKA 2WMYA 4K9SA 3GJ3A 3SZLA 5I4BA 2C4UA 3I0ZA 3W3ZB 3ZD9A 1P2SA 4C9BA 4C08A 2JEJA 5ERYA 2PS3A 4RGQA 1D07A 3P9XA 3CUSA 4B6PA 4XM2A 2H31A 5DLPA 1MQAA 1ENOA 2R8EA 3GHHA 3T5PA 4BIIA 3UK7A 1IVYA 1ZI6A 4I2BA 5A4JA 5T7BA 2YMQA 4JBIA 4W9NC 4BNUA 1ONPA 4P8RA 3V1UA 2WE8A 4TLLB 121PA 2NACA 1QZXA 3SENA 4FBMA 2WAXA 3IUNA 4NPHA 3ENZA 4G8JA 4KGDA 2HBJA 1PG0A 5K0JA 3UPTA 2JFPA 4CR6A 1F8FA 3UHOA 3QVLA 5EMNA 3CONA 1Y88A 5AVSA 2WK1A 3OIFA 3ZGVA 2QN6A 4YPOA 3NIDB 1ZIXA 4XPIB 1E98A 3EISA 4KAFA 1VLLA 5KT2A 1XLVA 1U4BA 2DERA 3CRW1 4ID9A 4BP8A 2X1VA 3NTUA 1M2VB 3USES 4W9MC 3SG0A 3Q2KA 4YO7A 2Q7DA 2Z0MA 4O2AB 1CRXA 5DWDA 3GRUA 4K9MA 1OD6A 3UK0A 2QBYA 4MGHA 2CB0A 4GKKB 2EV9A 4AB1A 2FPWA 2B98A 3EGCA 1NA5A 4A82A 1AQNA 3CFYA 4NESA 4N8EA 2B7BA 3CCFA 2E48A 2B0CA 4IIJF 2O0HA 5CURA 3DBHA 3I0NA 4YALA 3ZKWA 2WG2A 3LYHA 3S5UA 4CKWA 3ZCVA 2BOVA 3S70A 4EB3A 2KSQA 4PSKA 3N2IA 2J6SA 1TCCA 4GPZA 1V7ZA 1XI2A 1RU3A 3IQXA 3MS2A 1LRJA 5JH7F 4GYKA 2ASEA 4QARA 3VHQA 2IK8A 1A8QA 1V39A 4B6QA 2AEEA 1HH4A 4FE7A 4BB6A 3STXA 5G1PA 3FBGA 3X43A 1I2CA 2ASDA 1WHTB 3DFIA 3QA9A 1JFSA 4YYZA 1U7WA 1NNUA 2AWNA 1BPBA 3HCWA 5TF4A 1QKJA 4K3UA 3G7UA 4DW8A 4K86A 3HB7A 3SHVA 5EWLB 3I9V1 4X54A 5C1PA 1RLIA 1RYSA 1V96A 3BCSA 2V6MA 4IX9A 3W2EA 4RDXA 1UWVA 1VG8A 2CEKA 2PUTA 2PGNA 3R0ZA 3U60B 1UM9B 1C7YA 4XJSA 3MPOA 4NCHA 5AM2A 2ZWVA 3GA5A 3H2IA 3H11A 4Q19A 1GZDA 1X2IA 4N8DA 4USAA 4KGVA 5TEWA 3RV3A 3D59A 4QDUA 5JCOC 2KZMA 2V7BA 3ABIA 2OPBA 1TU4A 2VKQA 3DDNA 4C7BA 1TPYA 3T7EA 2O4CA 1P60A 1WV0A 4MV9A 4JI5B 3VAAA 3MCUA 3TEMA 4DLZA 2QZZA 2PPLA 3TTSA 1XN4A 2CLIB 1F14A 2QGFA 4R2MA 1B2LA 4YJHB 2AC2A 4P22A 1BVYF 4OH7A 5CCDA 1GFIA 1TVKA 1N5MA 5K8IA 4LV5B 1TD1A 3P2OA 3DKPA 1I2AA 1EESA 4NENB 2DUJA 3G49A 5CFOA 1I4LD 3OM1A 3BQ7A 3DBLA 1IG6A 5JZSA 3ZDAA 1O3YA 3KWMA 2R8RA 4O8CA 5GQSA 4YMLA 3EBLA 4I3HA 3KR2A 1KPIA 3M1IA 3IUEA 2R4QA 1JVNA 3ND5A 3HVRA 2YXLA 3ETNA 1UMDA 1KEUA 2ATIA 3G2MA 4BKMA 1L4BA 3IDAA 4FC7A 4CF5A 2B1GA 4B3TB 3SI7A 1XU9A 4BB5A 3L8YA 1J8MF 2O8EA 5JOQA 3PHCA 2QP4A 1WKVA 4ES6A 1TYCA 2K4PA 1DKOA 1NF9A 1M7BA 1L6IA 1NW5A 1PTJC 2EOAA 1KSFX 3WL4A 4GVXA 5GOZA 5BMVB 3IVXA 2VT7A 3O75A 5HRAA 1K4MA 5HZMA 4CMAA 3PL1A 3Q85A 3REQA 5BOSA 4IZ6A 5F7OA 3NOQA 4IILA 2WTUA 3ABQB 2UXCB 3M49A 3O9ZA 2EFYA 3VU0A 3P0JA 4D46A 3GCDA 1ZQBA 3WSVA 4JV5B 4P3OA 3T1HB 3WZ2A 3EAQA 1LBTA 2MRLA 4REQB 3OZEA 4C5BA 3O92A 4MS3A 4ECRA 1JRLA 4HRXA 4XQGA 1OKKD 5FORA 7ICEA 1FP6A 5DSZA 2I4NA 4P7FA 5HTOA 4HZUB 4CM8B 4FGUA 1HLPA 2DQKA 5HQJA 3PZPA 1ESCA 3BQMB 3MILA 1GUFA 1ZINA 4K81B 3RD5A 2YJNA 2RQ5A 5FWYA 1SQFA 4NMMA 4MUIA 2WMNB 3GRZA 1EXVA 1MB0A 3NNSA 3DCNA 5LDDC 1H3NA 2JLXA 2OEHA 4LSZA 1H9BA 4RVDA 4KREA 4ZREA 3GJXC 1RACA 2BH9A 1F0MA 4DL4A 4ACOA 4M60A 4GW3A 3BZKA 1OI7A 4B4OA 3L77A 2GPBA 1AGNA 4MARA 1IHXA 4RFVA 3SQOA 4RTOA 3DTVD 3GLQA 2OQ2A 3U1VA 4P08A 2VJOA 3W9SA 5HIAA 2LBOA 1NQXA 3F3MA 1KW4A 3WIEA 1VKJA 2GEBA 1YMUA 3ZS9A 2BJVA 3G8BA 1QCCA 1VIYA 2A92A 2WPDA 3BT7A 3M4ZA 1X92A 3O4HA 1G60A 4OJOA 2P6RA 3NS7A 1ZM7A 2ZIFA 2O14A 5KQPA 3UAOA 1JZQA 4PYMA 4H3VA 4BE7B 4DIKA 5KYXA 1CPYA 1NK5A 3HJBA 4YMWA 3C8MA 3MCAA 4RIGA 1M6VB 1XKLA 5AKXA 2B30A 2G9NA 1LBSA 5KMGB 1TIKA 3RWMB 2KS6A 1JR6A 1MC5A 1NMSA 3NO4A 3OCVA 4RS3A 3KDSE 2QW1A 2OK8A 1WWVA 1KPGA 1TMKA 3CW2C 4DA8A 1MAUA 4PBTA 2R7KA 4WESB 1Q0PA 3VMFA 4Q3LA 2A94A 3COYA 5L7WA 3AZPA 5EKDA 5KTTA 2G9VA 2QIOA 2J7PA 1PJTA 3LCJA 4CIDA 2JAPA 3T1TA 3BREA 2WD7A 1VCIA 3IKVA 5CW2A 3WNVA 3VPXA 4MQEB 1R4ZA 5IIOA 3GGCA 1DFHA 3DE6X 4MV0A 3BMCA 4FDUA 1DS6A 5C7YA 3A27A 1LC3A 2O2YA 3STTA 3TADA 3WYBA 3R9XB 3OZDA 4JUCA 3KAJA 4C2AA 4J0CA 3U13A 3ME5A 4CWAA 2PUGA 4EMSA 1E3LA 5KFMA 3H8SA 5KX5B 4KN5A 2B8JA 2XB9A 1O8BA 3HL4A 4WE3A 3CLKA 2FLNA 3CKMA 2ZYIA 5J2TF 1AKQA 2ZAOA 2Y1JA 1F2TB 2AJBA 2QARB 5L1LA 3LXUX 3GPLA 1Y9EA 3CA8A 4FO6A 4NF2A 2CNBA 3VO2A 3UCEA 4LQCA 5JASA 2I87A 3M4JA 2GRJA 4RLQA 4H35A 2TMKA 2OFWA 4AMVA 1WSBA 4U8GA 3NYWA 3PLRA 4AYXA 4MQ6A 1I94B 5AKIA 4YJ3A 1Z7YA 1OH6A 4PQFA 3UMSA 4J7CA 4Y1EA 3RUDA 3IT1A 2AFHA 2O8VA 1FYEA 4IXNA 4PNPA 3D7SA 2UZ0A 4JKYA 3SZUA 1HORA 3LGSA 3OJCA 3O47A 1C7EA 3I9OA 1KJ9A 3H2BA 4U7TB 3PZBA 2E37A 2XGOA 3W9YA 2QP9X 3KJEA 4G37A 1RM3A 4MEAA 4FW9A 1FX0A 1NPYA 3X0DA 3ZU6A 3ADBA 5BYKA 5CVVA 4C4PA 1NG9A 4UTPA 3W1EA 3GJTA 3KBOA 1M1NB 4IGKA 2ERYA 5JYBA 4G09A 2AI2A 4UVEA 3N2ZB 2CL6X 2NOAA 1VLHA 2E4ZA 1XEAA 4YCJA 4BO3A 4IMJB 3SPXA 3BS5B 1KKMA 4OHXA 5K5EA 3QXHA 3SLKA 3EZ6A 2O5CA 1HKUA 2JD1A 3ZEAA 3RHSA 2PX2A 4LOIA 3K6SB 2DFDA 1G0OA 3G59A 5B58C 1VHDA 3A14A 3R4CA 1MC4A 4Q1BA 2FLLA 3K9CA 4J4TA 5G41A 4D81A 5ALEA 4Q9JA 2XT0A 3H9CA 5A1TA 4BQIA 1RZVA 3NGDA 3FCOA 4EUHA 3LA6A 4ACBA 2CF6A 4IEEA 4C20A 4BLPA 3DCJA 2R85A 4MR8A 2BCSA 3Q72A 4PZPA 5TB5A 1E2JA 1DAOA 2H17A 3A9UA 3NVKI 4WK2B 1PTKA 3ET4A 3SIRA 3NI2A 1B8UA 1MJ5A 2BIFA 3WRYC 3U7GA 1K6JA 4LC1A 1P33A 1XU4A 1SZDA 2ZUCA 1NOJA 1WKBA 1S3SA 1U1EA 3OWHA 4Z1OA 5CJPA 1R15A 1VTKA 3OEEA 3LK6A 3G17A 2F43A 3KYDB 1DT3A 2HPAA 3RJZA 4GOND 2KHZA 1CC1S 3FPAA 3L1HA 2ZE6A 2JEOA 4GH5A 5P21A 2ROQA 4ECVA 1QORA 5A3VA 2C1EA 3OA0A 3E0QA 1KYXA 1A0PA 1Z2OX 2ZIGA 3GF4A 3GJRA 4U6PA 1NK7A 4WZBB 2JKZA 3KQQA 3UT6A 2M32A 2CLHB 3UAYA 4I2DA 4L75A 2Z98A 4KCGA 2IP1A 3HADA 1DQNA 1E2KA 3H0RB 4YMOA 4QWCA 1TYZA 2VHCA 3WYFA 3ISVA 3FZNA 5K8UA 1P1FA 1RR6A 2CV2A 1C3VA 4ECXA 1E18A 2ZRKA 3N7RC 1HTTA 3SU8A 1I6KA 5LU8A 2Q1TA 3AR5A 1XWWA 4PRYA 5BMVF 3ESAA 4V0SA 2WTFA 1SR8A 2OV3A 2XLCA 3Q3EA 2GEUA 1UBLS 3HZOA 2AZMA 3R6TA 2O7SA 3ZBPA 4OJ6A 1PZNA 2YQEA 2RAFA 2WFLB 4JHLA 1N2XA 2N46A 1YDHA 4X1KB 4OJNA 5ANRB 2ZTHA 3KD3A 3RT7A 4GC9A 3EXG2 4YI5A 1XFDA 1OMOA 1L4NA 3VR0A 3IP6A 3R3YA 5C5DA 3BMNB 1E2NA 5AJTA 1Q0TA 4EA6A 4P33A 3KU4A 2D74A 2I4IA 2J9YB 3C3BA 3CZMA 3ZLTA 1N3IA 3U4MA 3ICWA 1OGJA 2RG1A 4UOQA 5JNUA 5J0WA 1E2DA 3R5FA 1T6YA 5CEEA 1WCYA 5HJ5A 2R4UA 2O1XA 1XVVA 2ZSUA 2KSOA 5KNIA 2BDPA 1CRZA 2A5LA 1TQ8A 3Q3VA 3C6MA 2XOEA 1ZXLA 3B70A 2WWTA 5F76A 4PCLA 4DUZB 3QUCA 1DAPA 3RIGA 5B3AA 4KLRA 3VDRA 3O1HB 3EZ2A 5EUMA 2VDPB 2LHTA 5BSGA 3HA7A 2AN4A 2I55A 4GX1A 1SG9A 2HF7A 3K2QA 4AJEA 4S1NA 3H2KA 1K6MA 4I2EA 2Z5LA 3CG4A 4C0HA 3H04A 3H4MA 2AZXA 3SNKA 2C9CA 1YR3A 4X7RA 2XY7A 1P74A 4E5YA 4KXVA 3NV9A 2CDCA 2XYHA 2R4TA 4N49A 3KPJA 2PD4A 1IG3A 1T5BA 2J8ZA 4RJKA 2VDRB 3KBBA 5KWEA 1ODKA 1RI5A 4MYRA 1Q0LA 5CJ7A 4OA5A 4UASA 1U1DA 4IQ8A 4IO1A 4E6EA 1GG5A 4MTLA 1UK6A 4KHZA 3EGDB 3UMVA 2OD2A 1UKBA 5DTJA 3H8VA 5ADWA 1ACJA 1QLJA 2DKFA 3FGNA 4ZN6A 2QM0A 2P30A 5IINA 2VWPA 1N9GB 2FSGA 4YAFA 3S40A 3GZNB 5SZHB 1JPVA 4XUEA 2XW6A 4R31A 3AEQB 3N9IA 5HDQA 4R01A 1A7UA 5JXJA 3A6PC 4UNQA 3MRXA 3B52X 4B8WA 4KWEA 3EAFA 4FYWA 6Q21A 3NBKA 1ZR4A 2E8PA 5F7JA 5A2GA 1JQJC 2ZXHA 3BWCA 1ZH6A 2DPLA 4B6RA 1YJ5A 1EM8A 2IXDA 3BSFA 1ZIPA 2ZANA 5KQMA 4G1MB 9ICBA 4IV5A 4ZOBA 1KI6A 4IR7A 1VGRA 4OXNA 1DXHA 4K03A 2IWRA 2WIAA 4DLGA 3E3AA 3ZWNA 4I9FA 2H2AA 3ZS8A 3ER8A 4KG7A 2C82A 2O57A 1RE0A 3IMFA 3FPCA 4Q4AA 2OWDA 4QEZA 8ICWA 1VRCA 3EPHA 5TGTA 3HU3A 4CM9D 3GH3A 4WV3A 5F23A 5KX5F 4N54A 4KITB 5CHEA 3HSYA 3CV3A 3KR9A 1QH8B 2BY4A 2V1UA 2Q8PA 3UFXA 1ZKDA 3BSSA 1BDIA 5HMLA 4YRCA 2A9PA 1L5WA 1TJ4A 4REMA 3UV6A 3BJIC 4IFTA 1KYVA 3CT4A 5F1PA 1TF7A 1HEUA 1OF1A 1FZQA 2QB0A 2D5LA 1S1CA 3H17A 2BUAA 5E7IA 1GLVA 3ETLA 1P7ZA 2IHNA 2UZIR 2AL7A 1KGSA 5A04A 4RPCA 4EMTA 4NYIR 3HDYA 3QTLA 5KG4A 3V6HA 2EDAA 2IZ7A 1BU8A 3IC5A 3VR5H 3SP1A 4R1SA 3OEWA 2Z57A 4IXTA 3B6KA 4LHYA 2B21A 3GLSA 3KO8A 3K4HA 2ZWPA 3TVYA 2O2XA 1WZUA 4QA9A 4ECQA 3FPSA 4N12A 2I6GA 3OZBA 2B7LA 1EE1A 1ZQUA 4JUIA 1A0OA 2VTVA 3MT7A 1QQTA 2C94A 5EAIA 1G16A 1QO9A 4Y6OA 1H3FA 3AF3A 3NVVA 1H2ZA 1LPNA 5AW2A 3KTQA 5ESXA 2EQYA 4C3UA 3OF3A 1F0NA 1KYIA 2JBHA 1CJBA 2Z58A 3GQVA 5JNWA 2IYOA 3MXTA 2XUFA 2X5JO 1JU9A 2YIJA 3U4QA 4WOJA 3PHLA 2HFJA 1RZUA 2O20A 3SY8A 4X20B 2PUDA 4ENSA 2DBVO 3VC8A 4BKQA 1K4YA 3KTOA 3AM1A 1XMPA 2BE7A 2H29A 3ZXUB 2CVOA 1B0UA 3DWIA 4EWLA 2VUTA 1SXQA 4M9QA 3GA7A 3SOPA 2D5BA 3ANLA 2VPXA 1LXCA 4OUKX 4HMOA 5J2UA 1MH9A 2O6KA 4RADA 4B3HA 2J0UB 4TMFA 1IJEA 2I2CA 4CKCA 4CLRB 2R87A 2W2VA 2VNSA 5CAEB 3LDFA 2EQ5A 1Z7BA 1Y1LA 4O1HA 4RNDB 1H1DA 4ZZ2A 3SDSA 2KX7A 3F2VA 3KQSA 3JAKA 3CBGA 3BE6A 1X94A 4YMTA 4OREX 2OLJA 3JYOA 1AHIA 1DO0A 1WVMA 4J2OA 4Q43A 2LW7A 3L7OA 3HWSA 5KG2A 4C6TA 1RXCA 5ER9A 1TMGE 9ATCA 2O6LA 3OCCA 3ZJ4A 3TQHA 1OYOA 2ZWOA 2D6FC 2BJHA 2K60A 3Q6MA 2A5GA 1U1GA 3GDGA 3IDWA 3I05A 3BJEA 3DZ8A 1H8EA 5KTQA 3S2UA 3REFA 4PL1A 2IYUA 1UM8A 3QHQA 4I1PA 3L7BA 1PIWA 2PWBA 3ETHA 2C4HA 3P9IA 4F4IA 2J3HA 1CUXA 2XDWA 4UULA 1PWZA 3DC2A 4X8MA 4QOSA 2K8BB 4NCAA 4JVSB 2VHTA 2AMLA 2CNOA 3RRGA 2Q1WA 4RJ2A 1M8JA 2BUBA 5JIBA 1OVGA 1SA0B 3DT6A 5IM4F 2OBYA 2XF2A 3U7QB 5G4LA 1EFUA 3G2IA 2CHQA 3TL6A 2PT5A 1XD8A 1MAHA 3KDAA 4UCFA 1OTYA 3OT5A 4H16A 1COWD 3TJMA 1QB7A 3D64A 4Q9DA 1E9AA 4DLXA 3A11A 4RTJA 3U7EB 1L7EA 5LMNB 7AT1A 1RE1A 4KQHA 4KIFA 4KQXA 5JV5A 3MINB 1MCZA 5C9ZA 3MG9A 2QTWB 3AYXB 4TXJA 3LUAA 1WBDA 4Z9BA 5C1DA 2Z8XA 3NP9A 4OGWA 2HIAA 3D2SA 1RFLA 2WV9A 1VL8A 5JNSA 1Z4MA 3IVRA 1CR2A 5J3JA 1K5GA 3ISBA 2IIBA 4NBLA 3AUSA 3CZ5A 4UB5A 2NU7A 3B8EA 3UHAA 1UXOA 4H1VA 2W37A 4G5GA 4F92B 1IBMB 4KXLA 1EBBA 1L6RA 5HVNA 4WOPA 1O2DA 1C81A 4QRDA 2GVNA 4CG1A 2QD5A 4LIPD 1N2CB 1Q6YA 1VSTA 5LU9A 1XHLA 2QRGA 1USKA 2MOKA 3JSAA 1JJAA 2D3DA 5FA8A 5J0SA 3P19A 4O5CA 4BV3A 5EL0A 3ADCA 4YQEA 2G83A 5MFZA 1XF9A 1ESNA 2FOXA 1U90A 2E4YA 3NHYA 4O3OA 1DPGA 2C4VA 4Q9AA 1DL5A 2QN9A 3MOGA 1P5FA 3PFGA 1LC0A 1NX9A 1CTQA 5KTOA 4QZGA 1Z25A 4CKZA 5EJAA 1BA2A 3LK7A 1A71A 2XUQA 3RUPA 1NK9A 2GPYA 4HFJA 1E3IA 1GT6A 3KQNA 7REQB 2JJ1D 1E59A 1U9IA 2RK3A 5BWLA 4ICAA 4I2IA 3LPLA 1ZMRA 2G5IB 2ZTCA 5TLSA 1VYTA 1P2BA 3U9TA 2HH9A 2BI4A 1RNLA 2GTIA 3B12A 4YCBA 3G5AA 2LV8A 3LKBA 3P0FA 1P7PA 5FOWA 4IUDS 4IXDA 4OBBA 4KMRA 2FI1A 2GJ4A 2FSHA 1V48A 2R2AA 4FDTA 3U26A 2Q1UA 2NAPA 2KD1A 1ZM3A 4JJIA 1PT6A 1B3RA 3K71B 1Q19A 1TQ6A 3FDIA 5HJ2A 1GGJA 5LB4A 1CIPA 4IDQA 4JVNA 3OMWA 2Y66A 3KDPA 3JQQA 1N1MA 1X8LA 3D3WA 2PD6A 1IV8A 3EGXB 1NG1A 2V03A 4MPTA 1V7PC 2FG6C 3PPXA 2OEPA 3VR3D 2WZQA 3EPJA 2HJGA 2FSUA 1QHSA 2UVDA 4FR0A 4LJ8A 2EKQA 4UM9D 1UIMA 2OTCA 5LQUA 1HE1C 3DTTA 1W6RA 4NDNE 4D79A 3VR5D 2J6TA 1JHOA 1IXRC 2FSVA 4HNGA 1L3UA 2I7DA 3RYIB 1GZSA 3WLRA 2ZUEA 1MUUA 3IT2A 4PXSA 1E1QD 5KTRA 3WL7A 3M9WA 2PI4A 2CYBA 4RQ1A 3P9QA 1O6BA 1DCTA 3VH4A 1G5QA 1WRBA 2F3SA 2I6FA 2B8NA 4KUHA 1DBSA 4GUDA 1MX1A 1E7SA 1SKQA 4I0WB 3F67A 1QGED 3DMFA 1Y5LA 3LCCA 4AG3A 2QVCA 4MF8A 4Z6KA 2BFDB 3PA8A 4BEJA 5G0SA 3SC2A 2G1UA 4YCMA 2F9FA 3HVHA 2EZTA 1COOA 4FGLA 2ZUTA 1IEQA 5BURA 2RAVA 4WJ3B 3AF5A 2WYUA 1V35A 3FE2A 2HU7A 4EFLA 4XUGB 4MHTA 5DB7A 4G2TA 1VHQA 2HXYA 5KJCA 3X1MA 4AMBA 4FPXA 1QNFA 4GDMA 4Y0AA 3IVAA 4IV0A 4Y1FA 2HWKA 4N65A 3IMKA 1U49A 1L4FA 1B6TA 1TT5A 1N7HA 3N8DA 1SVWA 4NRDA 2C5EA 4PHTA 3I62A 2ZWAA 4BFWA 5LLTA 2GRAA 1QQ7A 1XTSA 3BWVA 4KH0A 3EIXA 3A6LA 3UMFA 1E79D 3QEJA 3I2IA 5A4FS 4ZT4A 2DUMA 4IIJB 4C78A 4XDHA 8ICPA 4EDFA 1ORVA 2QG9A 1CZKA 1P3JA 3G1UA 3PNQA 4F6RB 1VCMA 5A5VA 4DNFA 4F5QA 4OQDA 3NDPA 3R8XA 2RHMA 3IIEA 5HKLA 1YHNA 8ADHA 2X4DA 3E6AA 3G5MA 3FB4A 1PK9A 5JH7B 4AS1A 2GFQA 4ZP1A 2B5OA 4YFKA 2QTVB 4XVHA 2WP0A 1CJMA 4L22A 1C3LA 1YIAA 4GMDA 3BERA 1LCIA 1N2ZA 1U7PA 4MCHA 4WY2A 4FDMA 1H0HA 2CDNA 1Y1TA 1MQ2A 3ENKA 5F1OA 1JS1X 1E3SA 1R0YA 5I8ZA 1ID1A 3RC7A 1XEWX 2W6PA 2C2GA 4HK4A 3SHOA 5A7FA 3B0XA 4H7IA 3K0EA 2I1WA 5J0XA 2I1LA 3BE5A 3Q1LA 4G1FA 1LK7A 1RBMA 4PH5A 1LUAA 4X91A 2GM9A 1EFVA 4ZOHC 1MJGA 1MO2A 2QJWA 2NZVG 1JJIA 3U40A 1REQB 1XZCA 2PZJA 5G1OA 1VJDA 3KLPX 1MRSA 4NNOA 4LZPA 3BGOS 1NU8A 2W42A 5FTKA 1C0KA 5DDIP 1MW8X 2AE1A 2JI6A 2XSZA 1S1MA 5JO9A 3WRWA 1P2VA 4PGFA 1ZQTA 3E03A 3BWEA 4M6WA 3CGGA 1O94A 1I3OA 3KLBA 4EO9A 4DQDA 4Q01A 4K9DA 2JAQA 2YXEA 2D7DA 4YP0A 5FCDA 2XNKA 4I4LA 8ICLA 2OENG 4MVYA 3T54A 4R40A 2ZCJA 1NR1A 2JLVA 4TYQA 2XMPA 3A28A 3P20A 4BO0A 3H9JA 3ZZ1A 1T15A 5TQ2A 3SZGA 3IDOA 3ZYCA 3HACA 3LBYA 4TRMA 2O7QA 1TEZA 3C3CA 4P35A 1SXEA 1EGMB 2AFVA 1PJSA 1QGUB 2P6UA 3CJRA 4XW2A 4DLYA 3T35A 3R40A 4TQGA 4I5FA 3UK2A 3O3OB 3N59A 4DNOA 3F0TA 1AZWA 5LQJA 4MWSA 3UAZA 4RQ5A 1FXSA 4UMEA 2GPAA 5EJMA 2WJAA 5ICCA 3FDJA 3PE4A 2HJWA 4TLEA 1YRWA 1ZHOA 3GVCA 2P9CA 4C0ZA 3WQSB 1W88B 1RABA 4MGYR 1G8PA 1Q7CA 2H2HA 1WE2A 4ZJYA 3EA0A 1JEEA 5AVVA 4ZO6A 4IFBA 4G6ZA 1VB3A 3TJZA 1H2EA 1BSVA 3D54D 1HMPA 3GRVA 2ZSDA 1Y7TA 4TMXA 1FFAA 3ETJA 3LBAA 4EA7A 1ZJMA 4RA9A 4DCPA 3K20A 4G0QA 1JYFA 3CVJA 3SNHA 3RS8A 2VUIB 4LNAA 1G8GA 3E0FA 1INLA 3HCRA 2PRIA 4BX9A 4AUKA 2NTNA 3IP4B 1ETUA 5EESA 4Q16A 4X6XA 3VPSA 4IGAA 2ZRNA 1RBQA 2V7GA 2HK9A 5A62A 2QTAA 2OQIA 1U2QA 4ZVQA 1VP3A 4P98A 1KEEB 1E3MA 3B1VA 3M8KA 3ETEA 1ADGA 3WB9A 2W2LA 2RRDA 3QMMA 4MKFA 3LT4A 4N8SA 3A25A 4RJLA 1PQPA 1ZN9A 1PKEA 1X1EA 4PYQA 2PQ2A 2NXWA 3PO5A 4CQJA 3T5HA 4J0HA 4MWBA 3PKJA 3INNA 5JAHA 4UD6A 2DHDA 4IUBS 1FFYA 3A1DA 4LXGA 1YCFA 2FE4A 3A4MA 4TL8A 3MBYA 3LW8A 3KOXA 1TJNA 1EFPA 2ZTMA 5IUJC 3CG0A 4XA5A 2P40A 1QPBA 4BKUA 3EBOA 1KL7A 3CT6A 4FXOA 1LI5A 2AYZA 1ZICA 4LQDA 4UOZA 5E4JA 3OIGA 1XKXA 1CWUA 3R5XA 3BL6A 3L8DA 1OX4B 4QKQA 4DZZA 2WKSA 2FSIA 3E3LA 3WFZA 4UBJA 5E8RA 1FVOA 2G4VA 1N57A 3QUAA 5KKAA 3OSNA 2XD4A 2YCBA 4PO8A 4Q03A 1J0AA 5IAEA 5DK6A 3DQZA 2XTMA 1TC2A 2ESEA 1LF0A 2YXNA 3TBKA 1LX7A 1Y7PA 3VH1A 3TGWA 5EC8A 1ZRNA 4YHHB 4AX8A 3TTXA 2E4AA 5CEFA 3NWBA 4JJ4A 2FN4A 2V65A 2X6RA 5IT9A 3MGGA 4INAA 1FJGB 4EPRA 1KARA 4NPCA 3JALA 3LX5A 4HRAA 3C8ZA 2B5VA 3UGQA 5EFOA 4Q6WA 3PJRA 1Y48E 1O87A 1YCDA 2GPWA 4R63A 1PN3A 4PE5B 4B3RB 1QKIA 1XFAA 4A6PA 1O8CA 4E3WA 3EVTA 1UC8A 1UEXC 5EUBA 1Z37A 3PQEA 4NFSA 2D0OB 1J2UA 1TM2A 3KKZA 4C0XA 1ZGAA 1UT6A 3E7PA 4TS1A 1TAMA 1N6HA 3VZSA 2QUBA 1ECPA 4MS1B 3KHKA 1XQVA 3DO8A 2UVWA 5HS6A 3KD2A 3HYSA 2H92A 2PUVA 3J81j 2L69A 1U80A 4GP6A 3BORA 4I4TA 4G1EB 5CT4A 3JVEA 5CYPA 1ZMTA 2JI4A 3ER6A 1J6UA 1XDSA 1TO2E 3QI2A 3LY9A 1LTHR 3KTDA 1CT9A 4JC0A 4MCJA 3OBIA 4RCZA 4YRLA 3UUGA 4CT5A 4A2QA 3BZUA 4JY7A 4US1R 2G0AA 4I50A 4BQNA 1UANA 5J2TB 4I3GA 2ODAA 5KQRA 2A0WA 2Q4TA 3TR0A 1KXZA 2XUPA 3DHYA 3HG7A 3TB6A 3TM4A 2W7OA 1IHDA 4NYMR 2CCKA 2DRIA 2AQ8A 4C2BA 2FPIB 2FA9A 821PA 3UTCA 1CCWA 2IUEA 3UXPA 4C3ZA 2V97A 3EIFA 4PC2A 4ZPJA 1AE1A 4ZZ3A 2YRXA 2B1RA 5GADl 2ZSJA 2R8JA 2GASA 4FUTA 2CHFA 1WEHA 4ALKA 1VPDA 2DPYA 2W0MA 2RGYA 4KYTA 4PCUA 1QK4A 1FJ2A 1ONBA 5COBA 5EE0A 3MR6A 4ZDJA 3E2IA 3ZYZA 2C42A 3V7WA 1W59A 3DMYA 3S5JA 5FX2A 3FF4A 1MTZA 4COKA 4C21A 1NW8A 2HHJA 4GMKA 4XQ9A 4D45A 5CLJA 3LX4A 1Z75A 3ZCUA 2Q7OE 3H2SA 1Y3BE 4NZZA 4QBTA 4XYMA 3K6KA 1P5HA 2W90A 3DSRA 4JI1B 3V7YA 1C4WA 4B40A 2X2OA 5BSHA 4RKFA 1VE7A 2P0YA 1GWNA 1CY8A 1QIMA 4Y2YA 3MA0A 4EPXA 5AO9A 4ZC1A 4ECUA 1U1IA 1WXHA 2LYBA 4M0FA 2DJ5A 3TTYA 1YULA 4C0QC 3EXFB 1RXSA 2QDXA 4I5GA 3E5NA 2QE7A 4Y2SA 5CH5A 4H31A 4E33A 3E0XA 1SD1A 4MUKA 2ZJ2A 2QTRA 5HJ7A 2H63A 1NMQA 2FUG6 1DKNA 3G0DA 1R2QA 3K75D 3ELWA 4KTQA 1FS5A 1Z34A 1HY3A 2BCJQ 5FEUA 2Q2QA 3A31A 3L6EA 2XRYA 3T0IA 2H8KA 1XZGA 1XCOA 1K2WA 1EIWA 1UBEA 2BYTA 1CQWA 4FJ0A 3U7JA 1C1DA 2OESA 3LQ1A 5E79U 2UXBB 1NVGA 4R16A 3B3JA 3TOVA 4HGYA 3PEYA 1QC5B 2YNMC 1W1WA 4F8YA 1WCIA 2CKMA 4JWKA 3Q2OA 5ENVA 1KFEB 1PZFA 1X6VA 3PXCX 4D9IA 2PRJA 3N4MB 3M4YA 5L9XA 2OZLA 2VT6A 2ZSFA 3K70C 4M1OA 2ZXFA 4K1XA 1J07A 1J2MA 2GH1A 4RQ7A 4B5KA 2EZ9A 3RJHA 2A5YB 5CR9A 3PQDA 3CR8A 1CZNA 1QMPA 5EJIA 3DAGA 2B5WA 1X3SA 5IULC 1V26A 1NQUA 1JFRA 4C4TA 1O97D 1CERA 1L0BA 3HWWA 3KTAB 2IYFA 5KU7A 4IDEA 4BVAA 1GZ5A 5CNIA 2P9HA 3BDAA 4PNZA 2WNIA 4KR6A 2PFGA 2XWPA 1BMQA 4PG8A 2KYRA 4F4DA 2HGZA 5DF1A 1E4VA 7ICFA 1FDVA 4JL6A 1WWKA 4HEA6 3D1LA 4PHGA 1OIXA 1PJRA 4MGIR 5F51A 5F2NA 1CR1A 2O5EA 5B2FA 1COKA 1SUFA 1F8UA 1R00A 3EJWA 5DHQA 5EY5B 3WLAA 3H1BA 5IFKA 2C57A 4G4IA 1C3JA 3L0PA 2W2OA 4RXTA 4QW8A 1X38A 2R66A 3F5FA 2OOKA 4EI8A 1DJNA 3AR2A 2G1KA 9ICXA 1RWWA 1RWMA 2HEGA 2BSQA 2W9BB 2DLDA 3UGJA 3TE6A 4S0XA 3GRYA 5DB8A 1CS4C 1Z4QA 4RV5A 2I7TA 1DX4A 3F4BA 1V8BA 5FI3A 4P3XA 1ISMA 2XNCA 2VJDA 3GMSA 4DWIA 2G17A 3TTWA 1YRYE 4A8TA 4P82A 1N5IA 1TOAA 2P91A 3ZHCA 4HQKA 3R4VA 2H7CA 3JCZA 3H4BA 3WHLA 3U4HA 2RC6A 5EKTA 4RIFA 4YJFA 3B2QA 2JFYA 5AICA 4FGWA 2QW0X 5AKGA 1QDEA 2P66A 3DE0X 2LCIA 3OOWA 4AWXA 5KJ1A 5TS3A 4PBSA 4TWZA 3UC9A 1Z13A 1IN6A 3OQOA 1GRNA 2IDKA 4U0JA 3STWA 4RPJA 4EHHA 4EZ6A 3CYFA 1F7VA 4ZMRA 3COJA 4NLKA 5HUHA 5DG9A 4GLFA 1JLMA 2OGTA 3CNHA 3QFTA 4UTXA 2FFRA 1LU9A 4UB2A 1TW3A 1M54A 1H2XA 4HGRA 5B1IA 2C5GA 4S24A 1LBEA 4KI7A 1KEVA 2CN1A 1XO1A 1ACMA 1OFUX 4KQ9A 1GXSA 3MTDA 3RJJA 2WSBA 1IPHA 5B6JA 2OXFA 1JJBA 3WA7A 2E3JA 3HLYA 1NATA 2I6XA 3RB3A 3EUFA 3HILA 3G2NA 3O4JA 4LJ6A 3W05A 4HNAA 5DBCA 1KJZA 3E48A 4BWMA 4CETA 4Y9DA 1H85A 2KTQA 3KYBA 1JBQA 5K6TA 2OCAA 3RVOA 2NRVA 3M6AA 4RVFA 2HK6A 2AH5A 4DUYB 2ASVA 4MP6A 1R5BA 2KEYA 2K2QB 2B9EA 2C83A 3KLMX 3Q40A 3T7KA 4EVSA 2JAXA 1D9FA 5L40A 3IO5A 4I5EA 4ALJA 3PC8A 2OUKA 4Q9LA 1PRYA 3LXXA 5K0ZA 1MC8A 2XCPA 4XLZA 4ZYYA 1MQ9A 3LKVA 4JLAA 1KI7A 2OXTA 3F5AA 1Z35A 3ZGYA 2YWHA 1NLMA 1DOAA 3ZLJA 3JQBA 4FD2A 1I6MA 2FMUA 5TDHA 4AP9A 5C4GB 2W6QA 3PKZA 3FWHA 4UU7A 3HB4X 3EDYA 2BDUA 3H6HA 1AUQA 1Y4AE 3A3YA 3NU1A 3IOMA 4PWZA 2GHRA 4I55B 4AVYA 2C4MA 4UUNA 2IHVA 1XS9D 3T4UA 3I2KA 5IW8A 1HG0A 3E70C 3AM3A 2C5FA 4KDFA 2XBLA 1JWBB 1PR5A 3R0IA 3FNEA 3WK4A 4CMCA 4BS9A 1GNVA 1I4EB 3LQQA 3PWTA 5JJKA 4DCOA 3E2EA 4LN1A 2PUFA 2YYYA 2ZB8A 3RS2A 3CJTA 1IQUA 1ZQJA 3BGSA 4DM3A 2Z2XA 3D4PA 3P7MA 3AY7A 1EFRA 1YJXA 5ESRA 3EASA 1HTWA 1UKCA 3EE6A 2WD8A 2A1TR 4M76B 1G5IA 1UF9A 2YWEA 4BIMA 1K0UA 8ICOA 5C5EA 3DDSA 3PGLA 2HO4A 3C85A 1E9FA 3NHWA 4DFDA 2ADMA 3LDAA 3IXQA 4LYDA 5TS2A 4MVJF 1S10A 3U4AA 3D8BA 4YCXA 3CF4G 3OTOB 3DBIA 4WNYA 1B42A 1QONA 3SR6A 2OZVA 3C5HA 3QVWA 1SIUA 3NH9A 4DUGA 1H93A 1FQOA 3AUTA 1AY0A 4M83A 3QY0A 2FW1A 5KFXA 1AKUA 4RK4A 2A0FA 1SIJA 1Z2AA 4OAPA 1KEPA 2ZAYA 4KACA 4QDKA 2PPVA 5LA6A 1H4QA 3I39X 5ALOA 5THKA 4ZPXA 1PHPA 1FDRA 4JI8B 3GEGA 2XKKA 4N3CA 4RVSA 1OH5A 4XZ3A 1E8DA 3H1PA 4W5QA 1J42A 4M8SA 3EG9B 1X80A 4OD0A 2JRZA 2EW2A 3QVVA 4WLUA 1U5CA 1EMDA 1DBRA 4ZDIA 4JQZA 5E3JA 2OYSA 2NUAA 4DLUA 2ZIVA 2RCYA 2WM8A 3D4BA 4ECTA 4UARA 2Y0EA 2HMXA 1B41A 2WJ4A 3S28A 5SZKB 2BM8A 4KU4A 3O1IC 4CV0A 5T3UA 4I1OA 3NEPX 2AV6A 4C07A 1PK3A 2LRHA 3MJSA 1CE8B 2YS7A 2XBUA 2HLDD 4XTCS 3G13A 2JZBB 3G0BA 4IUCS 2P27A 4WTOA 4B7CA 1L7VC 5CR0A 2WKQA 3A05A 2E0IA 2KOBA 4IJMA 2C4WA 3S44A 4O25A 2JIMA 2GM3A 3OWOA 2PLAA 5ES4B 4GPD1 4W1QA 2VA2A 4NL9A 1I24A 3DHWC 1DGQA 4E22A 2EDUA 3ZG6A 3AWIA 1W44A 2D1FA 4NBWA 1DV1A 4NIMA 5AMXA 2OKCA 2ICAA 3RYFA 2J09A 3SZ3A 4QGHA 1ZSNA 5EKSA 3CLVA 3ZV7A 2CFIA 2VVTA 2MTBA 4KQCA 2DL0A 2JFZA 1Z88A 4K28A 4RABA 1JEJA 2C2OA 3EGVA 5EE1A 2OFOA 3QOYA 1ZFNA 3SQIA 4KRYA 4EBBA 3MJCA 1ZNZA 1DT5A 1G8KA 5K6AA 3EN0A 4IIVA 3QE3A 4S0ZA 5TF0A 2XA9A 1Q3UA 2OY0A 4PV7A 3BJRA 4KQEA 3BE4A 2X5NA 1QOZA 3E22B 4MMYB 3PQ8A 2BKUA 3LBFA 1RHMA 3OLCX 4DLNA 1Z0ZA 1T0JB 3EDMA 4X1OA 2L2QA 2HPZA 1JKJB 1YIOA 2X6TA 3Q0TA 1L5KA 2DLNA 1AU9A 4A92A 2XADA 3WMWA 5JCJA 4D3YA 4DM7A 4FYVA 1SJ9A 3JD0A 5AUQA 2GZHA 3QITA 5ENZA 4WY5A 2BELA 2IYPA 4K46A 3K1ZA 4NQRA 2E55A 1Q84A 3FRHA 4GM4A 1ZMOA 1TYAE 2ZM6B 1YZQA 3PHGA 2HHUA 1XEWY 4B8YA 3WWEA 2HMYB 2FPXA 3VNUA 4UCXA 4CLOB 3H4IA 3UAWA 2KJ5A 4J75A 1GDHA 4I36A 1SXPA 2M1XA 4WKNA 1DJLA 3ZE9A 3KSDO 4FT4A 4JOCA 3BD9A 3TRFA 1BE1A 3NHZA 4DSNA 3TSCA 2DHQA 3MMPA 3JPNA 3GLIB 3RBZA 4X93A 1CF4A 4WXYB 5KL1B 4OYYA 3IUYA 4FBTA 1KOFA 4F4CA 1K66A 3LTNC 5AM3A 2V6GA 3SHQA 1KMCA 4C14A 4IR1A 3U62A 1YS2X 3I1YA 1MABB 2YW2A 2ORED 3BRSA 1KJ8A 3KT3A 5AVYA 2IL1A 2INGX 4CDRA 1NN0A 3ANNA 4Y8VA 5B55A 3ITDA 1T1IA 1PSZA 5ICSA 1IZ9A 1BQ3A 3DA8A 3HUDA 1E1KA 2FWIA 3G0IA 2P2SA 4EKDA 4QWDA 1FYFA 4AMUA 3T3EA 1FJXA 2NV3A 1WD7A 3RRNA 4BRSA 1DAIA 1GAJA 1HZZC 1HYHA 3P4YA 1LSSA 2J5BA 1AA6A 2CJFA 4JC8A 1GCUA 3MSCA 1V6CA 4CF3A 2PA0A 4PX9A 2ZBQA 3M2PA 3WLLA 1Y42X 3AFHA 2ZB4A 4POOA 2YV1A 3CEAA 2QXUA 1A9XA 2K87A 2YTZA 4R3NA 2H4FA 1EUYA 5IK2A 1BTOA 4P7KA 1BKDR 1FC0A 1KZ6A 1QFMA 4OQ4A 2QTNA 4UNIA 4YXWA 1S2MA 4V1CA 4UREA 2QLTA 3VMMA 2ZBRA 3KQYA 5AM5A 3H0LB 2OCXA 1KYQA 4LNUA 4KBFA 5IKPA 2XNJA 4EYHB 3HABA 3QELA 3RS9A 1RIFA 1ZU4A 2FEOA 5EHQA 1FW6A 3N70A 3AVPA 3T5JA 1B14A 4KHPB 3M9LA 3N5KA 5IT0A 1U04A 3EXIA 4JI3B 3STVA 2XTZA 5T64A 1RXIA 4CL0A 2WM3A 2MA1A 1L8QA 1Z0DA 1KNXA 4IHJA 3NKFA 1RPLA 2JASA 3DBOB 1CJTC 4I08A 4FMCB 4R1UA 3QYFA 3WDMA 2ZTEA 4NARA 1G6OA 2IE0A 3VNQA 3RVKA 1C1HA 2ZM5A 2WSLA 2YRFA 4EABA 1RVV1 3CF0A 3DBVO 5KC9A 3K2EA 4K4HA 4I55F 1X1QA 1A2QA 2WTMA 2WYHA 3CRZA 4GGPA 3BS4A 3MW8A 3PGA1 3VZPA 1Q92A 2NU9A 4B3IA 2C3UA 2OA0A 2KK0A 5HJEA 3MWEB 4ZCTA 4R83A 3FR7A 4BTEA 3TKYA 1RPTA 1RW4A 1C2YA 3MHTA 1NIJA 3K0SA 2AJLI 3V48A 4DHWA 2JIBA 1NBOA 1MEOA 1W8DA 4MPPA 1I9CA 1PZHA 3V7JA 2EQBA 1VYHA 3F5EA 3HWTA 2AOUA 5D51S 2CXPA 4J9NA 2VTEA 1AKEA 4BRUA 1JECA 4BJQA 1IWPB 1SQ5A 3NTVA 2X2FA 9ICAA 4DB2A 1Y5RA 4BUGA 4FZLA 4JJFA 1XDGA 3CIFA 3W34A 4OHPA 1V71A 1BFUA 2FF5A 5C8ZA 2PGLA 3H4TA 4WLEA 5IILA 3PSTA 2XITA 1OUMA 3JRWA 4C4XA 4BO8A 3BMOB 2Z3WA 4YUAA 4UBBA 4ZT6A 4TUYF 5JQGA 3H6GA 5F64A 1DJPA 1PW7A 3K0FA 4EYKA 3CVOA 1EPUA 3ONDA 9ICLA 3HXOA 1JQAA 4IPTA 3RBEA 1Z00B 5DISB 3S7TA 4F2PA 3NKLA 1I7DA 2QXTA 3SE7A 2EVWX 5HR6A 1DDOA 4TYMA 5DX1A 1Y8QA 1O7JA 1ZW6A 4A0FA 4MI6A 2OORA 3HK2A 4MV3A 2VDJA 1BPEA 3EPPA 3C6ZA 3TZQA 2ZAGA 1L3SA 2WTXA 1S0UA 3PE6A 2FK7A 5CFNA 4CLHA 4XOIA 1YKSA 4EPYA 5DZSA 2Z30A 4TXNA 4PS1A 1USVA 3UTDA 1EFKA 1P73A 2IDMA 4TTQA 3T52A 4CEHA 3NYQA 1Q1NA 4UXJA 2XE4A 1WD5A 4B3DA 4HWSA 1VCOA 1N2JA 5GV7A 1KYYA 3CX3A 5EUCA 3GIKA 2FSFA 3IBYA 4MUJA 1EAYA 3RJIA 2DWQA 1FYDA 5DBIA 4PGAA 1T5DX 4A9AA 5EP2A 4CMEC 5HIKA 1BVSA 2RKBA 2Y1LA 5I7VA 3WIUA 4G0WA 4BNKA 1FLVA 5AWFC 1VCHA 3PX4A 2QAJA 3IP7A 2B4QA 3EEIA 3WKCA 5MDHA 1NFRA 3FHJA 4DR3B 5MGBA 2VCHA 2SECE 1FXWA 3IDQA 1J0XO 1BO6A 3FDZB 3C6YA 5J0PA 3HRKA 5K2MA 3ZQKA 1RQ7A 2J5KA 5D85A 2ZDQA 4M9XA 2R68A 2PUJA 4O0MA 2RP5A 2WT9A 4C7OA 1P61B 2XRMA 4JU8A 1ZZGA 5JUMA 1AURA 5JR3A 4UB4A 4FX5A 2XZOA 1UEIA 2XZTA 4W7SA 1Y80A 4FS3A 3V34A 2W48A 3S1LA 1E2LA 2F64A 4B9EA 3SBOA 2RI1A 4DCGA 1KDPA 1U28C 2BDTA 4CU2A 5FO0A 2QKQA 4ECZA 3T8YA 1QG2A 2Q50A 1I2DA 2C22A 4GX2A 5KOJB 5IDVA 2BEKA 1EK5A 2HU5A 4PYRA 3BEOA 5A6SB 3LQ2A 4BFLA 2ZVDA 4M1KA 3CR3C 1HYEA 3ZHRA 2FEPA 1ND5A 2XICA 3JQAB 2ZYAA 3Q9LA 2VATA 5KREA 1TMYA 1XVTA 1MQ8B 4IIGA 5D3MB 4TKVB 4CIYA 1WJGA 2J3QA 4ND8B 1O9GA 1K8ZB 3HO6A 1BGVA 3I61A 1RS0A 3H2ZA 1F12A 2WM2A 4QWMA 4FQ8A 2XZPA 1VCNA 4JUZA 3MTGA 3GFPA 1ZVJA 3DE3X 1YQXA 4KSYA 3CGWA 2XGQA 2L0XA 4U1RA 4FDAA 3FVRA 3SR0A 4J4HA 3KB6A 2O8BA 4MR7B 4RFSB 2P3QA 3GLGE 2Z2KA 4DVGA 3L0DA 1D03A 4L6AA