2YMPA

Chloroacetic acid complex bound l-haloacid dehalogenase from a rhodobacteraceae family bacterium
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
225
structure length
224
Chain Sequence
SGILVFVNETLLDLTSLSPLFERVFGDAKVLREWFPELILYSQTLTLTGLYRPFGEIAAAVFEMVAANHQAKVTPDDIAELKTRLTSMPAYPDVAPALTRLQDAGFRLVTLTNSAPSPAPSPLEKAGIASFFEAHLTVHSSQRFKPHPSVYDSTAETLGAKPEELCMIACHIWDTIGAQARGWRGGFVARPHNTPLTLAEVPQPDFIGRDMGELADQLIASLTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-HALOACID DEHALOGENASE
publication title Marine Rhodobacteraceae L-Haloacid Dehalogenase Contains a Novel His/Glu Dyad that Could Activate the Catalytic Water.
pubmed doi rcsb
source organism Rhodobacteraceae
molecule tags Hydrolase
total genus 86
structure length 224
sequence length 225
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2ympA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2ympA01
4BKMA 2W43A 3FVVA 4XE5A 3F9RA 5AM0A 3U13A 4BEVA 2ZBGA 5AK3A 4UU0A 1J97A 1T5SA 3NIWA 2P9JA 2JAWA 3DNPA 4UM5A 1U02A 4O8CA 2YJ4A 5AVZA 3M1YA 4UAVA 3AR6A 1RKVA 4XQ0A 2YJ6A 3W5AA 3KC2A 3TLMA 1QQ7A 3AR4A 5ALQA 3FM9A 3B8EA 2IYEA 4HGQA 3R4CA 3NUQA 3ZWDA 4NABA 5AW3A 5AW8A 4NFLA 3OCZA 1ZD4A 3A1EA 1ZD2P 5FP0A 2WF6A 5ALPA 2HHLA 4QQFA 3QNMA 3L0YA 1RQNA 5AVRA 2IOFK 2WF9A 5AVXA 5AW4A 4Y2SA 1WZCA 2P27A 3NRJA 3WKAA 5AIBA 1YDFA 3HYCA 3SD7A 4CF3A 4KNWA 5AM2A 2NO5A 2HX1A 4UARA 2VKQA 2O2XA 1ZD5A 2C4NA 3PGVA 2CFSA 2HCFA 2YMLA 3ZVLA 3WK5A 3QU2A 1N9KA 2AUTA 3ESQA 4YH1A 4Y2XA 2JARA 1Z4KA 4OCZA 2OM6A 3MN1A 5AM1A 1QH9A 1Z4PX 3EPRA 4J2TA 3W5DA 5ALDA 4EENA 1QYIA 1YNSA 1PW5A 1ZRMA 4KNVA 4L6AA 2MU2A 2HF7A 3ED5A 3I1YA 4FE3A 1S8OA 4JB3A 5ALJA 3I28A 3MC1A 4Y2JA 4CF5A 1K1EA 3B9BA 2AH5A 5AI5A 3OPXA 1RLTA 2G08A 4HYTA 4YIKA 1ZD3A 3E81A 4GIBA 3I6BA 2G09A 2O9JA 3ET4A 4UW9A 2PR7A 3IJ5A 3NASA 3KDPA 4HGNA 1S2OA 5IS2A 1ZOLA 5AVYA 3MMZA 4UMVA 4DW8A 1U7OA 2YMPA 4Y2TA 2AGVA 3N5KA 5AVVA 1Z4JA 5ALHA 2G80A 2Q4TA 4EX7A 3VAYA 2GFHA 2QLTA 4BX2A 2HDOA 1RQLA 2R8ZA 4YCMA 2NYVA 2YMMA 2FPUA 2ZBFA 3ZTYA 5AIAA 2YBDA 2BDEA 3ZUPA 5AM3A 2FPRA 2RAVA 5AK5A 5ALTA 1RC8A 2EATA 1F5SA 2I54A 3D6JA 2DQSA 1CR6A 3ZW7A 1QQ6A 4UM7A 4I9GA 3WK8A 2G0AA 2CFTA 4EZEA 2GMWA 3RFUA 1LVHA 3I76A 3QU7A 4DFDA 3J7TA 3L5KA 2YY6A 3OCUA 2PKEA 2FUEA 5ALVA 2RARA 3N1UA 1U2SA 1Z5UA 1MH9A 2WFAA 3AR8A 1TJ5A 3QUCA 3L1UA 4XOUA 2G1AA 4C4SA 5AI9A 4OFZA 2WF8A 5AM5A 4Y3UA 3U7FB 4Y2UA 3E8MA 3WKEA 2IA5A 2HSZA 4E88A 4AP9A 4DWOA 2FPSA 3ZU6A 3SKXA 1Z88A 4MWOA 4G9BA 3U7HB 1SWWA 5ALUA 3SHQA 3PCTA 2B1QA 3L8EA 2BDUA 1ZS9A 5AI6A 3L7YA 1VJ5A 4G63A 3A3YA 4CNQA 2B8JA 3QU5A 5AKJA 5AKKA 2ODAA 5AVSA 1N8NA 5AVQA 5ALGA 3ZI4A 5ALYA 5ALIA 2C8LA 4L57A 3QGMA 5E0OA 1T5TA 4KX5A 2G06A 2HOQA 3OCYA 5A3QA 1L8LA 5AKIA 2I33A 3EF0A 3ET5A 1T9ZA 3UM9A 2YN4A 3QUQA 4RESA 1ZJJA 2WHEA 2B1RA 5AK6A 2BY4A 3RF6A 3UMGA 4EX6A 4IFTA 3QUBA 4ZEVA 5AHXA 2I7DA 3S6JA 4YCLA 4Y2PA 2EAUA 2I34A 3R9KA 4YCNA 3ESRA 2AMYA 2CFRA 5AESA 2OBBA 4UU1A 1WPGA 4NAVA 4YIHA 5AW9A 2R8XA 5JJBA 5ALMA 4RETA 3A1DA 3CZ4A 5ALZA 3KOOA 4BX3A 3FPSA 3NANA 4CF4A 4BBJA 3KBBA 5ALWA 1RDFA 1TE2A 5AI0A 2ZOSA 3AR9A 3L8GA 3WGUA 3U26A 4UASA 1O08A 4Y2QA 2ZXEA 2B8EA 1KYTA 4HAIA 3OCWA 2W11A 1L7OA 1L6RA 3OCXA 2MSNA 5AK4A 4OHFA 2X4DA 1EK2A 1YJ5A 3SF0A 2B82A 1QQ5A 1WR8A 3NALA 4IG4A 2FPWA 4HGRA 2HEGA 5AW7A 3U7GA 1FEZA 5ALLA 3N07A 1TJ3A 4UATA 2YMQA 4EELA 5AKHA 4YGYA 5ALNA 5AVUA 2GO7A 2GHQA 3OTQA 3FGOA 3ZWKA 4FFDA 2YFYA 1L7NA 3ZX5A 3ZVMA 2D2VA 3ZTWA 5IT4A 3B9RA 1L8OA 4HGOA 1RMQA 3DDHA 2GHTA 5A3SA 2C88A 3L0CA 3L8FA 1XVIA 3UMBA 1Q91A 1WVIA 1Z4QA 1TJ4A 3AR2A 3EWIA 2R8YA 2I6XA 3L1VA 1Z4OA 2RB5A 1RRCA 4ZEXA 1YV9A 1RMTA 3U7EB 5AW0A 5IT0A 2ZBEA 2P69A 4Y2YA 4I9FA 3DAOA 1IWOA 3QXGA 1TA0A 3IB6A 3QX7A 1L7PA 2YJ5A 2MU1A 2PQ0A 3AR5A 3QLEA 1XP5A 2JAOA 5ALSA 2FDRA 5ALRA 5ALKA 1CQZA 4CE6A 1Z4IA 2ZBDA 4F71A 1NF2A 5AKGA 2Q4RA 4NWIA 3E84A 1RLMA 4GXTA 1NNLA 4C4TA 2OYCA 2B0CA 3WK9A 4KYTA 3QU4A 4UMFA 2HF2A 2W4MA 5AM4A 1RKQA 1VFPA 5AW1A 4OD0A 5A3RA 3ONNA 5AKYA 3PGLA 2QYHA 2B30A 5AI8A 1Y8AA 5AW5A 4Y2VA 4H1WA 3A1CA 2ZG6A 3FPBA 3AR7A 2WF7A 3WKCA 3KZXA 3GYGA 3E58A 2G07A 5AVWA 1RKUA 2JAUA 2FI1A 3K1ZA 1SWVA 3MPOA 5AW6A 2YJ3A 3OCVA 5ALEA 5AICA 1EK1A 4ZEWA 1YS9A 1XPJA 4BYGA 2Q5EA 4KN8A 2HI0A 5AKZA 3M9LA 4J03A 1VJRA 3WK6A 3SMVA 2C9MA 1RPZA 3WGVA 1NRWA 5AKEA 3WKBA 2NO4A 3L8HA 1AQ6A 4Y2RA 1Z5GA 4BX0A 4UMDA 4XPZA 3ZX4A 3WK4A 3WK7A 1U7PA 3U19A 2FPXA 2RBKA 3EF1A 3ZVNA 3BWVA 4F72A 2FEAA 3FZQA 3KD3A 3QU9A 5AI4A 2WM8A 4JDPA 1X42A 2OA0A 4BEWA 4HGPA 4EEKA 5T41A 1Q92A 3CNHA 4NV0A 4UMEA 5ALFA 2P11A 1Z4NA 1JUDA 3SLRA 3R09A 4B6JA 4AS3A 3SKYA 2FUCA 4L6CA 4BNDA 4KX3A 3PDWA 4MUMA 1Z4MA 4DCCA 1ZRNA 2JGAA 5AKLA 3AR3A 3HLTA 1YMQA 2CN1A 2WF5A 1O03A 1Z4LA 2HO4A 5ALXA 4C4RA 3W5BA 4QJBA 4UAUA 3L0BA 4AS2A 3P96A 5AKXA 5AVTA 3DV9A 2EARA 5ALOA 5AW2A 1RMYA 2I55A 4FYPA 2R8EA 3BA6A 4PNHA 3N28A 1L7MA 4BNDB 1J8DA 1LTQA 2IOFA 3WKDA 1SU4A 2IOHA 2C8KA 3NAMA 3N8GA 3QUTA 3QYPA 1RLOA 3UMCA 3IRUA 1U2TA 3W5CA
chains in the Genus database with same CATH superfamily
1UCVA 2VG8A 3FVVA 4FJ0A 2AKYA 4BCCA 1XVVA 4I5GA 4JUIA 4Z7NB 1QU3A 2Y2UA 2H8KA 2IYOA 3EVGA 5C5EA 5JR3A 3GX1A 4XVUA 1BWRA 3JWPA 2P4HX 3PC7A 1C0PA 3AEUB 4KDCA 2XKBA 2NX2A 4Y2SA 1QIIA 1FRNA 3KYJB 4JU8A 3C3XA 2ZIXA 5KT5A 1VPTA 3AF3A 4P86A 3ND7A 3FA2A 2EFYA 3WWDA 5DBOA 3E22A 3A27A 4FGWA 2BJWA 3LVFO 1HMPA 2A0WA 3LCVB 1KBUA 1SEVA 2R25B 3TJRA 2VAPA 1G9TA 3UA4A 3PWKA 4UU8A 2R6FA 3K1YA 4D4GA 2PFOA 1XK6A 2JLSA 4MVWA 5KL8B 3K70B 3I6BA 2WKPA 4PS0A 2EJBA 2WG0A 2ZYTX 1GYRA 1MGOA 3SVLA 3IKLA 2JFWA 2F43B 4W1RA 3ZLJA 2Z04A 4QTTB 5LSAA 3RSOA 5JMOA 7ICSA 3JZMA 3ASZA 1F0PA 2VT6A 5C31A 2RGAA 2AI3A 1T29A 3OESA 4Y6RA 3SV4A 1J07A 4XEUA 4CGZA 3OA2A 3QIAA 3FZYA 1S0NA 3TH5A 1T4MA 2ZR7A 2O07A 4KVAA 5CG1A 3R6GA 3WYNA 5B2ZA 2PZ8A 7GPBA 5JATA 1G2IA 2R7NA 3K8QA 4KXVA 5TE9A 1P3JA 4D9BA 1Z88A 1T9AA 4HXEB 4DGQA 3KSAC 4D2IA 1CEQA 3QBJA 4C4YA 5BO5A 4A5OA 5FBLB 1GUAA 2BPOA 1Y98A 5D87A 4A0GA 4QGFA 4X1YA 4DF8A 3BXOA 3AKEA 2V7GA 1DVRA 3HR7A 2BV3A 4LNHA 4NG4A 3FCAA 5E4YA 3GGGA 2AK3A 4IQ8A 4YCLA 2I34A 2CLCX 5J8YC 5JYEA 4X62B 1AXGA 3R9IA 3CF6R 4XB1A 6PFKA 1JA9A 1X8XA 2HNBA 2PFQA 4GC9A 5JWOA 1APBA 3COYA 1TV9A 2Z6AA 2VJYA 3GVIA 2GPJA 1Z0SA 2B37A 1RQRA 2ZVJA 4QTXA 1FO4A 2Q9UA 1Z6QA 2YY5A 1YK0A 5FO1A 3B9RA 1AK2A 3KQNA 1WP9A 2AG8A 2FJPA 2IIVA 3LO5A 5KTKA 1CUGA 3IQZA 3VYVA 1BOOA 4ZREA 2C1ZA 3QLUC 4LWOA 2XBMA 4HS9A 1QDEA 2GTPA 1JDBB 1YRYE 2O14A 2VEDA 3RVPA 3G68A 2ZJFA 2YHUA 4O2BF 4YAEA 4DLYA 5FB3A 2QUIA 3K73O 1YJXA 3SYTA 1JEYA 1V6AA 3VR3D 1CJSA 4J07A 1VFPA 3T15A 1B8VA 4LOLA 5B36A 1J9EA 2XCSB 1VCMA 4CKXA 1SKWA 1QOPB 3R3VA 4ID3A 3KCNA 4J16A 4QHSA 5ALEA 1EZ4A 2I71A 3DL0A 3MT9A 4EGJA 1DC3A 2J4CA 4R6WA 1RPZA 3SEAA 3NC4A 1NRWA 2ORVA 5FEMA 5JI3E 5E8JA 1XNJA 5HFJA 2X7HA 2QSJA 1MW8X 4BMZA 4CEHA 4PONA 3SFZA 4MV6A 4LYAA 1R8SA 2QE7A 1R15A 3TECE 2GH1A 2XUGA 4GMHA 3LXUX 5LMZA 4QUAA 2OAGA 4ED7A 2QSUA 3AILA 2RJOA 3PLNA 4IIBA 4Z9YA 5CDSA 4WK4B 2I9KA 5ALXA 5BPFA 1D4ZA 1H2FA 2A5GA 2CB9A 4XVCA 1YQTA 2X0KA 3GT3A 2XYPA 3QUTA 3HLYA 3OPNA 1DKQA 3C6ZA 4B7ZA 5DGCA 2XMQA 3EDMA 4G24A 2WMDA 2R00C 3LDGA 2XGQA 4Q34A 3MWJA 4AO7A 4WZZA 1JW9B 1X1SA 2YH2A 4U00A 1UL1X 3FZNA 2DH5A 3D1VA 2ZITA 3IAEA 1M6VB 4I2BA 5IFKA 4C7JA 3EFBA 4HPXB 1O6CA 4RIEA 3ESQA 1D2HA 3KQYA 5M2QA 4MHSA 5B58C 4CCAA 1E1QD 2WTXA 1M74A 2KJQA 2YV2A 5J2GA 1GLNA 3GFTA 3EZ9A 3ZXYA 1C20A 5JZ9A 4X8HA 2HPZA 2X86A 2YYZA 1U2GA 5D4BA 4FE3A 2SHKA 2QPTA 2FEWB 3PXUA 2H3IA 1V48A 2K4HA 1EFRA 1C3XA 3V1YA 1CI4A 4O5KA 3GARA 3MS2A 3LD9A 2PQ2A 3QVVA 3VMFA 1TNDA 3LWBA 4INAA 1OT3A 4BQRA 4US0R 2E1FA 3TQOA 2RKOA 1IXYA 2DSNA 1Z3IX 4EX7A 4I4NA 4L50A 3A1NA 3AB3A 2QLTA 5DWVA 4DR7B 1WXXA 1W2WB 3EDCA 2Y05A 4FC6A 3LWMA 1PDVA 2IGTA 1R18A 4LA4A 4BFWA 4M9NA 5HE8A 4OHKA 5NULA 5JU5A 3FOCA 1YL7A 5EI5A 1JE1A 4AP6A 3A6EA 3OLZA 2AXQA 1KOLA 2CHQA 4N5IX 2WFAA 5JZVA 3RCBA 3VJKA 3IALA 4PX5A 1RM5A 3A3KA 3W1EA 4FX5A 1EFAA 5IIMA 1BMFD 3L7YA 4B6OA 4J9SA 2Q0XA 2B8JA 3C1ZA 1B8UA 3AEZA 4MS3A 1W36B 4ZWNA 4RK4A 1I7NA 4V2UA 3A25A 1IM4A 1A5BB 5JADA 2PG3A 4GOLD 1EIWA 3QMPA 1MA7A 4O5EA 4P7GA 4O1HA 1EVEA 5FJIA 1PDOA 5DBBA 3IN5A 2QWXA 1S3IA 1U0BB 4F5NA 3OZCA 4TT3A 5A9RA 3V1KA 1SUBA 5AXCA 5C80A 2O05A 2NG1A 1KNQA 4JX9A 2BHNA 1YHNA 1I3MA 3LX6A 3I8XA 1U1GA 4BZWA 1P0IA 1U0RA 4M6WA 2JBAB 1P0PA 4ONEA 3PW7A 2CLFB 2X9NA 2PL3A 1YRBA 4JXKA 4Z1OA 3GVPA 1W6RA 3BK1A 1C1YA 4G2NA 3U7QA 1MRNA 5KFMA 1NKTA 1SVLA 4X60A 2JIMA 1MCZA 3MJ4A 3S7TA 3TRKA 2EIHA 5K3FB 5M5BA 3K05A 4KLJA 3OEED 1RJGA 2XYHA 4X71A 1DB3A 3D8UA 1A9QA 4IEFB 4YWHA 1HNWB 3CUYA 521PA 3CF0A 5EP1A 4FMCB 4YCJA 3IE2A 2OYCA 3QXSA 2WMOB 4I27A 1TZMA 1XVLA 3AI7A 2PH3A 3KS9A 3SE0A 1QWOA 2Q5HA 4R84A 1L4YA 1LJ8A 4JA0A 4YD1A 3G6WA 3CF2A 1CFZA 3H04A 5LZ8A 3IS3A 1XI2A 4GO1A 1DBIA 2YN2A 4HQLA 2Q9AA 4RFSA 4GMDA 1KWGA 5DTEA 4Q4CA 4INJA 4CHGA 3K1JA 3NT5A 1NI4A 4Y2RA 4EA6A 2XMPA 1WF3A 2IYVA 1OLSA 1JSRA 5BQ3A 2QTLA 2KHZA 3SX0A 5FUYA 1ZNWA 2J0EA 7ICMA 5DYYA 5DKWA 3R0XA 1E0SA 1PR4A 1ZW1A 4U9HS 2M6LA 1WWVA 5AKLA 1SJ9A 1EXNA 2I78A 4XSVA 3L0BA 2BR0A 3TL2A 4OI2A 3U9SA 4B4VA 3AG5A 3DP7A 5F9NA 4K9SA 5KMGA 2IV3A 3O90A 2YWJA 1ZM9A 2IYLD 3I5XA 1T2FA 1Z18A 4R0VA 4O8CA 3AMVA 4G1FA 5J2UA 4V1CI 4J29A 1RKBA 5EFZA 3UN1A 4DBLE 1T26A 2YINC 1J21A 1GG8A 1CR1A 3OOWA 4F4CA 3PNMA 1MX1A 4ZCMA 1QM5A 2L0XA 4HDMA 2P2GA 2RK4A 3BX1A 1ZQUA 1AX9A 3JQFA 3FAZA 1A9XB 2RJNA 3O47A 1P80A 4Q3EA 2JGEA 4H7PA 2WFZA 2DLCX 3UXEA 4F4WA 1DJLA 5BW6B 5DTMA 5BV0A 1DDIA 3VYUB 3QA3E 2XZLA 4XARA 4QTYA 2ZI3A 2GLUA 2LWIA 4DNFA 2IBSA 4YR2A 4KIUA 4CFYA 5BVHA 3EEQA 2VZ0A 1QGUB 1ZU4A 4E5VA 2W6PA 3D2BA 3FDIA 2PMKA 5TPZD 3W6PA 2GS9A 3QBEA 1F1JA 2NYVA 1UDRA 4YT8A 3SZUA 4MW2A 3D6JA 4I9GA 4RJKA 1HQKA 2GDZA 1NXQA 4WDQA 2P2NA 2WD7B 4HOYA 3L1HA 3TQRA 4KRGA 2VH2A 2JJ1D 5EZQA 3RVDA 1JH8A 4GLXA 1AH2A 4EGSA 2JCBA 5T6BA 3AUXA 4YMNA 1KI6B 2DWOA 2VNSA 1ULTA 1JVSA 4Q21A 2DAPA 5H2FU 5FHRA 4FDTA 4B7UA 2XH8A 4OHXA 3P9YA 1N1DA 1RXWA 2OFWA 3HDGA 1G41A 3R40A 5AKIA 2XB2A 2EERA 4C3VA 3AYXB 1CUVA 4YCXA 1GKKA 2WWTA 3HV0A 3CNEA 1ZSNA 1M0TA 5FIUA 4S1NA 3OE5A 3TBHA 3PO5A 1NATA 1VMEA 4TYQA 2C7PA 3FPSA 1TC1A 3OX3A 5JVDF 1A7KA 1YTUA 2X15A 5LJLA 4M83A 2BQUA 3DCNA 3G0OA 1THTA 3EPJA 1FRFS 4I2GA 3E3AA 3G0IA 4CLEA 3K0AA 1DOZA 1E6UA 3MWEA 3RFCA 3U09A 1G59A 3LUCA 4M1TA 1E2KA 3JQ9A 5L9AA 3AR2A 2Q7XA 2PJDA 2C9OA 4Q4AA 3WISA 4XD7D 2PUFA 4OLFA 2H54A 2M98A 2GZSA 3E0FA 5BPCA 3WB1A 1L5HB 2IS1A 4C22A 4QEDA 3FYTA 5LA6A 2ZZMA 4JUFA 3O75A 2GZDA 4PAQA 4BBPA 4E13A 1IZYA 3ECSA 3HKDA 1RYBA 4B6GA 2NV0A 4AC9A 2PTGA 1K7XB 1TU4A 3OIWA 3QKRA 3DEYX 4FFSA 5H3HA 3O95A 1JQBA 2QYHA 1EZZA 4IYJA 5EWFA 1Y8AA 1UJ6A 4IR7A 1ISMA 3LC0A 5HRCA 4ASUA 1P0QA 2V59A 1T3GA 4LZWA 1QGAA 2OMKA 4F6CA 1T1IA 2Y1JA 1ZQCA 3MAAC 1F06A 1OTXA 5FBHA 3G9ZA 5CXXA 4ER7A 1EK1A 4JXZA 4WSOA 1VDMA 2PZMA 1GDTA 1WXFA 3KCQA 3W05A 4IGAA 3RC2A 4B6PA 1T4GA 2CXOA 721PA 2PU5A 5J2HA 4LDPA 4J1NA 4K81B 3IAUA 4QUKA 2OA0A 1KTIA 5KYYB 4WKOA 1KJIA 4N8EA 1U5BB 4TKVA 5DM2A 5G5HA 4HH0A 4XB2A 4ZANA 4IR9A 3RJKA 1SKMA 4OU4A 1GQOA 5MHTA 1MOSA 2P3LA 2C8KA 3KQSA 2XGMA 5FOSA 1PRYA 2WHPB 2QR3A 1O9GA 2PXIA 3P26A 2PYDA 1GSIA 3O4FA 4TQAA 1U7DA 5JD5A 1U28C 2J48A 2W7TA 4YT2A 3GDXA 3S1SA 4Z51A 4ZQIA 3KETA 4DYDA 3MIZA 5A6VA 3MT8A 1MJFA 3B8EA 1AMOA 4EAQA 2I4MA 4KYVA 2HWUA 5HA5A 1CUCA 4LYEA 1ZD2P 4FGZA 1VCHA 1E6EA 4FS8A 4OQNA 4QQFA 3REFA 2YYSA 1DOHA 3ORQA 4ZCSA 2HB6A 1A4IA 1TB4A 1FU4A 3B1KA 4PE5B 5G1NA 3FCCA 4G37A 3QITA 1FNCA 1NC1A 2LPMA 5AM1A 2FR8C 5CXQA 1YFLA 4J0JA 3KTQA 4DR6B 4ZVUA 3CWQA 3UPQA 4DA9A 4WCDA 3D7LA 1D9XA 3DZGA 4MGKR 3GUZA 3ZYZA 5IABA 1Q2UA 3IEUA 4Q16A 4E2WA 4LXQA 4PXYA 4KUGA 2YL2A 3ONWA 1USKA 1DQSA 3DYIA 2WTUA 2IPOA 1X3LA 1SBQA 3IHQB 3TG8A 1YZHA 3ZWAA 2Q4EA 3SOPA 2XB4A 2ZRBA 4J9QA 4AZ0B 2FV8A 4S04A 1U81A 2XUOA 3DPIA 2EJWA 3RS9A 4D57A 1NW3A 1UEIA 3M5CA 3PPXA 3FVQA 3GCDA 1FFCA 2AXNA 1J20A 4JWTA 5J9FA 1A69A 3D6UA 4EPVA 4X93A 3BJIC 5BUZA 1WXDA 4MLPA 3MUFA 3IDWA 1VL6A 1VYTA 2GM9A 1TJPB 8ICTA 1A8SA 3NDPA 1DE0A 5HSGA 1JEAA 1IHDA 3D1JA 3EXHC 2EYQA 4HZIA 1IOWA 2ZWVA 1C0LA 3UAVA 4I4TB 1ARZA 4ON9A 2VP3A 2GVDC 2E1PA 3LECA 2F1HA 2VJ4A 4NS4A 2JLAA 5JAHA 4I2FA 2AMYA 1CW2B 3N7TA 2VAMA 2VH5R 1J90A 1Y33E 4ZPJA 2AA3A 2QQEA 2BEUA 1HYEA 3B6ZA 3TEJA 3NIBA 2OK7A 1SXDA 1B42A 3HRHA 1KARA 3K5WA 2LYHA 1UPUA 1Z74A 1N7HA 3B38A 4H0NA 3HL0A 3V5NA 4EELA 2Z2YA 1LLUA 5JCZA 3KKLA 1ZESA 3EFOA 4KXFB 3HM9A 5JTIA 4L9SA 2ZUDA 4BZQA 2YS7A 3KQKA 2YV5A 3U44B 2R44A 4U7FA 1RRCA 2C5GA 3KKEA 4HHEA 3L82B 1UA0A 4XXHA 4CT4B 2WTNA 3QJGA 4QJFB 1TADA 1TQ6A 3H9JA 2IHMA 2WIBA 3G59A 1KW4A 4D02A 2C2WA 2YX1A 3KQLA 1QAOA 3QVWA 1EWQA 1ZQZA 1JDNA 3PVXA 4BWMA 4C43A 1H1LB 1FFXA 1UXGA 1NW8A 3SJZA 4Z7JA 1ZNXA 3BSSA 1OD6A 1KQGA 1SIJA 4N0EA 4KL8S 1VSTA 1FOEB 1T8UA 2V98A 4I6GA 2CSUA 5B7QA 4ZVQA 5I8PA 5KQLA 1XU4A 4YMHA 1Y1SA 5G3YA 3P19A 4YRPA 2J32A 4B9LA 2O2YA 3T4EA 3KOYA 1ZQ1A 1O94C 2MIIA 2M6RA 1NW7A 3PUZA 4IR1A 1IY1A 5CRIA 3WLOA 1DT5A 3H9CA 3KK0A 3KOZA 2HBYA 1YZYA 3ST7A 3BYZA 1RJWA 4DCVA 3GJ7A 3SBDA 2WR8A 2ZIEA 3DZFA 4HBGA 1CDEA 1R0BA 4BC0A 1DMRA 4K9LA 3WRWA 4QQNA 2IW3A 4DCCA 1M8PA 4F8JA 3MCTA 3THXA 4RT2A 1RLIA 5IUNC 1ZQXA 5BSKA 2NQ8A 4XI9A 4TV9F 3KV3O 4NAHA 1ZI6A 3QVGA 3ZZ1A 3N8GA 3BE8A 4KN9S 3MB8A 2PGJA 1X9HA 3CMCO 3KE9A 5JTUA 1KOFA 3RLIA 4YT5A 1HDIA 3AW8A 2V3WA 4KLMA 1ZN2A 4P54A 1PGNA 1CRQA 4PHFA 4MHVA 1STOA 4KMOA 5E9WA 5GPBA 1CQPA 7YASA 2G6BA 1L5MA 3PUWA 4QZHA 1WZCA 1R8JA 3P9KA 3PSPA 4P4GA 1KYWA 4ZEOA 4H16A 4FDVA 1W2GA 1JHRA 4DBZA 2BBOA 4PVDA 1U11A 2RLTA 4I5DA 3JQ8B 1G8YA 2GZAA 1P1BA 5HQTA 4FIZA 3ED5A 3KB1A 1QFSA 1URPA 4M0UA 3J81k 3K4GA 4IQTA 2SKCA 5LQMA 3E9NA 1POXA 3SIWA 4FNAA 4H3SA 2GK6A 2G5PA 1UPTA 3O5AA 1YOBA 2A5JA 2Z2XA 1UQUA 5EIBD 3G2HA 2IXAA 1VSUA 4IINA 1J2EA 3N4MB 2CJPA 3F73A 3Q7QA 3V00A 2XKJE 3VR5H 2WTBA 2YZNA 5A06A 3I76A 3AEQA 4GOOD 2EWWA 5KO2A 5DTIA 4RNOA 4ILEA 3N2KB 2IZZA 4ENTA 2AEJA 3ZDQA 1GRRA 1DC5A 4G6ZA 2VSYA 1BXZA 1QH8A 2D5CA 3TSWA 1SXPA 4MVJM 5D85A 5AM5A 4L7VA 4UB4A 3GGJA 1SBHA 4KYUA 2ODTX 2JFGA 3RT1A 4A8JB 2FWRA 4UNQA 4CTNA 5BRAA 4RVUA 4UE6A 3L8EA 1LW7A 4P3YA 2HBZA 2C8LA 1ZG3A 4JX8A 3OZ7A 4HWGA 1NWCA 2IC5A 3OH8A 3VPAA 2QB0A 1UZLA 3L93A 1OXMA 4MDHA 2H18A 4DT1A 1PJTA 2VYCA 4CCYB 1MJNA 2J9FA 3AI2A 3S7ZA 2IY7A 1QHSA 3I2YX 3D2CA 1I7LA 3KVVA 2I4LA 3F47A 2J3QA 4JITA 2I3BA 4JI5B 3BRWA 1QSSA 2ZOSA 2AMJA 3D3JA 2Q5CA 3EBOA 1J5EB 4OHBA 3U4QB 4KAFA 1AC5A 3P32A 4KLCA 4AW9A 1G8GA 3I0ZA 4Q4JA 1V3QE 4QO7A 3RB6A 1VE7A 3ISTA 3U4CA 3I64A 2ZRMA 1DHTA 4EI2A 1I36A 3LRPA 5DF1A 2A8YA 3H2JA 2QUAA 4GZLA 3UFXB 1YZTA 1XXLA 4LAFA 4LMRA 1K6XA 4RACA 3ENNA 4MR9A 3B2NA 4EQZA 4F3KA 2E55A 3DH0A 1FDWA 3IQIX 2C57A 4DMMA 1PK3A 4ATNA 3MVEA 4ZOLB 2BFFA 1XD9A 4RENA 2C31A 3ZGXA 1W93A 3C74A 4RZ3A 1L5KA 2WIAA 4JJ8A 2E87A 3JAWB 2XCPA 3Q3GE 5E4FA 3H2BA 4OXNA 5EMKA 2FPMA 3V1NA 1Y80A 2AOVA 2WWWA 1V9LA 3CRVA 1PFGA 1QSGA 2QRGA 3DE6X 1RPJA 4R1LA 5D3MA 1XZJA 4DQVA 1WM1A 1P5JA 1PJLA 4DA8A 3CUKA 3GV7B 1OLUB 1BFKA 4WA7A 3SQLA 4M7WA 4C4ZA 4Q3AA 1BVHA 2Q9BA 4OHZA 4XPZA 5EJIA 2DGZA 3H8SA 3RYCB 2K5UA 4QOIA 5A5FA 4DCOA 1GPNA 3KD3A 3S2ZA 1V5GA 4EEKA 1PJSA 1QQTA 3D5EA 3PHHA 4OI0A 2A1IA 2UZ3A 1E0DA 3Q7TA 2R8RA 1GPMA 2L82A 1C7RA 5J0PA 1O03A 5AFSA 4WOJA 5TQ2B 3AUAA 4G25A 3C5CA 4TLMB 4A8PA 3OWHA 4X45A 4AJ4A 5HR6A 1SU4A 2XCIA 3F97A 2IOHA 4D82A 1YOVA 5E2AA 3U7JA 1IPFA 3JD4A 1JI7A 3G3EA 2H1CA 3OETA 4OM7A 5ETJA 3R7NA 2HHUA 2YQ5A 4PAMA 1HBJA 4UZFA 3AR6A 3GIIA 2NW6A 1KSJA 4AKGA 5JT1A 4F04A 2C0QA 1R12A 1GTZA 4GLOA 1P4JA 4H1VA 2XITA 2HJ9A 3JYNA 1YDFA 3K2BA 1SBZA 4G5QA 3LK6A 1XVTA 2GUGA 4JLSA 1RXSA 1JWBB 3Q0TA 1UKEA 3VU1A 4YH1A 3KZKA 1HNXB 1T8TA 3BAZA 1SCAA 4FS1A 4WGFA 2ZIXB 3JPPA 2JLZA 4W7HA 3ORHA 4WX2B 1QHXA 1VJCA 1N9ZA 2A67A 1TW3A 2R4QA 3E22B 5J2JA 3VVBA 2PNJA 1I7DA 4P0QB 3QKSA 4DL5A 3IJ5A 1PGOA 9LDBA 1IVYA 1I2CA 3WJ2A 1NQ5A 1B00A 4ZICA 3KXLA 4DW8A 1QYVA 4Z4CA 5J0RA 3SJUA 3QLVC 5DU2A 5EUCA 4LXGA 1CUZA 4HWSA 5AK5A 3DLPX 3GFKB 5JRTA 2ZSDA 2IL1A 5P21A 3D5QA 2X0DA 3F5MA 2PVSA 2BUBA 4RQUA 1OCEA 5JYCA 3PF9A 4ZO4A 2AHRA 3VVLA 4RH3A 1GKUB 2VSFA 1MQ3A 3DTVA 2P0YA 3FIJA 2QN8A 3QUCA 1UK9A 4PX9A 1KDHA 1I7QB 1ZQMA 2FPSA 3U9TA 1J2JA 5KFVA 1P4GA 2I99A 1L5WA 4HLUC 4ZO9A 1Q44A 4HAOA 4MFAA 4KXUA 2Q07A 4WQMA 5C8XA 3KXIA 1ZHOA 4MR7A 1Z06A 4MVJI 1R8QA 2C2HA 2ZR8A 2BF4A 3AINA 4EARA 1LDYA 1PU2A 4AG6A 3KLBA 4CU2A 2R85A 3E6AA 3JQAD 3Q8MA 3KEQA 5MN6A 3GRRA 3A2NA 5B4VA 4X1YB 2B7CA 3ZE6A 1VZ3A 1G7SA 1EB8A 4HAVA 3CURA 4QYIA 2XA9A 2O2HA 3HFJA 1R0YA 1BPYA 1JLKA 2G77B 1BZYA 2YMQA 3P71T 2J6IA 4OP1A 2Q0ZX 3SAFA 3PNLA 5AXBA 1HH4A 3JWJA 3QYJA 3KL4A 1CG6A 1V8FA 4TQSA 1EBUA 1ZVQA 2Z9DA 2RK3A 4ZCTA 3K1TA 1TVAA 3RAEC 4K0RA 1R4ZA 3QXGA 1YR7A 4F06A 3DNFA 3AM9A 4U7TB 4GZ5A 5JBIA 2I8AA 4B83A 1ZJMA 4WINA 4LJ7A 4UD2A 4B9VA 3RH5A 2FA9A 2AG0A 5B6JA 2IIQA 1R9JA 2IYWA 4EY7A 3V4RA 1W88B 5FQOA 4H59A 4X7RA 2EL9A 4EDHA 2I5PO 2QU7A 4H6PA 1I2AA 3CE6A 1JEYB 4QUBA 3DW1X 4L16A 4GBMA 2JGFA 1E59A 1XYVA 4ELUA 1EUZA 3R20A 3NEYA 2PRZA 2YHIA 3F9IA 5EY5B 1ZM3A 1VMAA 2PJRA 1RPNA 1WDKA 1AQ6A 1PG5A 8ABPA 2D5IA 4Z8YA 5GY7A 1R6AA 4B9EA 3LF1A 2OO7A 3FH0A 3WJ1A 1RWNA 3D8NA 5EWMA 2Z43A 4WUTA 5KWSA 2B3DA 4YRSA 1BFUA 4QLOA 3WWZA 5IIKA 4RUKA 3CYMA 3IVCA 4KX3A 1W4LA 4TL8A 2OE2A 3KZNA 1XF9A 4OMDA 3BHIA 1Y6RA 2J07A 2XB9A 4FD2A 2EJTA 3PC2A 2PWYA 1K4KA 1FYDA 2Q1TA 4YFKA 2I7VA 2WOOA 3L2OB 2JK1A 1WV0A 4EPTA 1OU0A 1QV6A 3RS0A 4EJ6A 3EW7A 3ZQ4A 3TZEA 4N47A 1PGJA 4C78A 2FZWA 4BHTA 3LW8A 5CCXA 1JHDA 1ZGGA 3C5HA 4DRXA 1Z1VA 3GH3A 3CE9A 4P7FA 2QEQA 1WKBA 1N92A 2CXHA 3B5IA 3KZMA 4G56A 3S70A 1P6XA 3K6RA 1S02A 3H42B 5JNVA 4RHYA 1NN0A 1I3OA 1SGWA 3MDCA 1G42A 2B36A 1SMKA 1XN1A 4RL6A 4IFBA 2GJSA 1ULHA 1ZI9A 3AERA 1GV1A 4ZOHC 2PSFA 5CLJA 1DAMA 3W78A 3CYFA 5K3DA 4Z0PA 2QUKA 1WX1A 5ICSA 3VYWA 1NR5A 1ML3A 1R3DA 3OKCA 2Y68A 2EKDA 4IF6A 1KY5A 1TYZA 1X7GA 1YR2A 1BXRA 1BQEA 1DQZA 4RQ4A 5EWLA 2QN3A 4IJ6A 1VE5A 1WBDA 3GC6A 3KQPA 3LQKA 4RS3A 1D8AA 2QXYA 3SC6A 1MO5A 1WZIA 4UTOA 4RIFA 5MDHA 3TVTA 1GRNA 3TO5A 5A5VA 4H1TA 3W2IA 1Q3HA 3L05A 2LTAA 2I7CA 1CTQA 4CV2A 3PEFA 4RPKA 4RV9A 2BKLA 3PNKA 1MAWA 1MQSA 1EVZA 2IELA 2KTQA 3G9TA 2YN4A 3TZCA 5DTJA 4ZAXA 2Y1DA 4W4TA 1NVUQ 1KEPA 3CR3C 4F93B 4ZEVA 4ZO6A 4MS3B 4DLWA 4KWTA 2NV3A 1XA3A 4H4EA 1NLZA 1S0OA 1V8DA 1AUVA 4ZVVA 3Q0EA 2PRIA 1Q3KA 2PQMA 4D4LA 4NESA 3LXXA 4E09A 3OKPA 1JU9A 4OX9Y 2YOGA 2UXDB 4R98A 1QO7A 2H59A 3JYHA 2G40A 4UAYA 1IN4A 2VK2A 5CM2Z 4QATA 2P1RA 2IUYA 3UK6A 4Z4HA 2WHXA 3TQ1A 2FEKA 3S2GA 4HDSA 4XFJA 4Y67A 3F5AA 3U7QB 3AM4A 4HYYA 3AR5A 4ARIA 3U7RA 2WVAA 1YUBA 3IULA 4M9HA 5ALKA 2BH2A 5KG7A 4NONA 4QO8A 4MCAA 1UUFA 2Q3CA 4MHTA 3N8IA 1UHUA 1QK3A 4WBNB 1RKQA 2AFHA 5B1DA 5J23A 1AN9A 4US9A 3AY0A 4DSEA 3IGFA 4EBEA 5L6LB 3W2HA 3IAAA 3EJWA 3G89A 3W34A 2C84A 3UW3A 2JK0A 5K2MA 1RFLA 2GVNA 4XASA 2LCQA 4UBKA 2BCJQ 2K7FA 3BGVA 2ZR0A 4KEAA 2GBPA 4BRUA 2QPAA 2PLWA 3TINA 1OE0A 1THZA 2Q62A 1MJ5A 4XQEA 3AKDA 4KGDA 3A28A 4RFSB 3JWGA 1LF0A 3E8XA 4TSRA 2R7LA 3TKLA 8ICOA 5CJPA 1EX9A 1O95C 3IHKA 1NI4B 1U8FO 5DMXA 3HJCA 4EG4A 5KFHA 2H07A 4E4YA 3O8BA 3LVVA 1COWD 4IHJB 2PMZF 1OLSB 1NVVQ 2LHTA 1TKBA 1CY2A 2GT1A 3JPYA 2PBRA 1E9BA 1P77A 3CRQA 4MQEA 3TRIA 4C08A 4CBVA 3Q8XB 4ECYA 2CKDA 4BKMA 2JL1A 4D0LB 5FAXA 2RAFA 1X2BA 5CPBA 4ZDIA 3KYDA 5JAOA 1JX6A 3GDGA 2QRHA 4AJLA 1JXQA 1OBFO 1GTL1 2FP4B 4AJIA 5ALQA 5KMGB 2X3UA 2ILTA 3QWFA 1NXTA 3H7IA 2J59A 2WUVA 4CIWA 1EFPA 1H5QA 1DBPA 4U5QA 1HXHA 4U39A 1T5OA 2I22A 3PQ4A 2L69A 4JXJA 3NHKA 3GBSA 3WGKA 4YJFA 5A9TA 3V4FA 3R7WB 3WB2A 2E3JA 1Z4PX 4Q3OA 5D5PA 4LE1A 1VI2A 4P84A 2WQZA 3WRXA 5D3ZA 1IJKA 4E22A 4AJKA 3IEKA 3OFNA 5H4HA 3EPLA 2JFUA 4MKIA 4JLPA 1R3UA 1I30A 3VPSA 2CXQA 5G2OA 4AFNA 3NASA 1UKBA 4B35A 4ECQA 4F11A 4J1TA 1N2CE 1SD1A 3Q5DA 3K9FC 1G8KA 2BI4A 1LTHR 3P9IA 1UBKS 3VC2A 2CLHB 4EY3A 2XHEA 1CXZA 1KETA 3V48A 5BVHB 1CE8A 2YV4A 4UVDA 4WXMA 2O7NA 1IM5A 1OYYA 4M0KA 5FI5A 2BFMA 4TVBA 3SR0A 4BO7A 4N03A 4WOBA 4FYKA 1S77D 3FHJA 4XGNA 3LQQA 1ULBA 2C5LA 3AKCA 1G98A 4RQ7A 1PW7A 1Y3DE 2D0DA 1CSEE 3DFKA 1QVAA 1ZAYA 3HLKA 4NY1A 1TMKA 4H0FA 3TM4A 1EBFA 4ZQGA 5FPKA 3RB8A 2XZPA 1J0DA 1OBHA 4ACAA 1XMOB 5AKJA 2XA2A 4UTXA 1KKLA 2NUAA 4BBAA 4KPFC 1S97A 4D45A 2CZCA 1DBQA 5LYJB 3JRWA 2YWBA 2OB1A 1CCWA 1NKEA 4C9BA 2DTXA 4EX6A 4I2HA 2HMTA 2ZJOA 1WPXA 1N4DA 1YB6A 3TIGA 3R9KA 4YUZA 1GZHB 5HR5A 2FY8A 2C7RA 2PZLA 3RJJA 3MJVA 5H1YA 4I2JA 3G2QA 4HWRA 3BSYA 3V6MA 5A7HA 4LN1A 3NKFA 4F9GA 4RJIA 5BWNA 3DZIA 3WFJA 3ZR4B 5C7LO 5ALNA 5I8WA 2C2OA 3DLIA 1F9EA 3LYUA 1EFKA 1LUAA 4DIBA 1T3LA 3QV2A 4AL4A 5H9VA 2PX5A 3DHYA 4Q3BA 3ZQJA 1P2TA 1YJCA 2PZJA 3K0AB 3MWEB 3IELA 4ARAA 1IWOA 2VYVA 2VHWA 4JIGA 3A6FA 4PGHA 1AU9A 4Q4AB 1FF9A 4W5HA 2HF8A 1PR0A 4RPGA 1SK8A 4RV4A 4CM7A 2KJ8A 5DNEA 1KH2A 3PDHA 2AF4C 2VA2A 5LA6B 2DR0A 1C4XA 4YVZA 1A9RA 2IYSA 3THOA 1L4LA 4LWZA 3Q6NA 1H8HD 2PANA 4BMCA 3ICVA 2JHPA 1G21B 4PZLA 2KNJA 1OF1A 3TSYA 3ZCVA 4FD3A 1ZKDA 4GHWA 4DIKA 1RC0A 4WZAA 4QWCA 4KI0A 4WL0A 1ZQIA 4G0NA 5HUHA 3U81A 2FG7C 1UPHA 1VB3A 1E32A 2DPYA 2IUSA 1Z7GA 3H6KA 4YY3B 3JATA 5DCWA 3OEWA 3B1VA 1V85A 1CZOA 2TRSB 1C4KA 3QX8A 4R1QA 2RGXA 4EHJA 2PL5A 2VPWA 4AWXA 3CLRD 4YTEA 3DL7A 4YRCA 3TX2A 4W9MC 4EW2A 2B8NA 4DPMA 2CVOA 4OQMA 3WVNA 3JYQA 3HCAA 2ETVA 4HUQA 4EFLA 3CVYA 2W03A 3H2SA 2DUYA 4TKVB 1OILA 3AHJA 4QGAA 3ZUGA 4DJ5X 2N47A 1ID8A 3ND9A 1JX4A 2KFNA 1IG3A 2NADA 1JHUA 1RE0A 3T5HA 1U2DA 1Y5MA 2YZ2A 1XWFA 4FN4A 3M89A 3FTEA 3PPWA 3UF0A 4CKEA 3ESXA 4LSZA 3Q7RA 3LQYA 1WB6A 2HM7A 2OWDA 3GAAA 4GICA 1TAGA 3MELA 1QYRA 5AQEA 1FIQA 1Z45A 4KBYA 3WK5A 4NDZA 2JARA 4MQFA 3X43A 1IN5A 3OTIA 1GPJA 4RE6A 1UJ2A 2FOLA 4DILA 2BGTA 1V39A 1S4MA 2AJDA 4F2RA 1AUOA 1EVLA 1YUNA 5G5GA 2VWGA 3BN3A 1S8OA 1QGDA 5CX1A 2J09A 1ZNQO 3GDOA 1EFVA 2G08A 3SZGA 1U0GA 1I33A 1EINA 3ITEA 1AIPA 1LNZA 2F59A 3PSIA 3H7AA 5LJIA 3N70A 1XDDA 2AYXA 2E82A 4KRYA 5I7VA 4H35A 2RHRA 4E1VA 2CFCA 3T54A 4ZRDA 2VJMB 2C5AA 1QBGA 2GJ9A 5K4GA 3AL3A 4R1PA 2K8CB 4MVJF 3PUJA 2QVYX 1Q7GA 4RTOA 2B7BA 2V4UA 4N82A 4O08A 1RVDA 3L43A 4BLWA 2QPOA 4W82A 5EPOA 2Y1FA 1KMHA 4B3SB 3VV2A 2PH7A 2C9DA 4BBZA 2V9ZA 3HVKA 1P73A 2F8KA 3QPDA 4G0WA 1Z8FA 2BJHA 4DMLA 4AULA 4BP1A 4BJ6A 4OJ6A 1I8TA 1FVOA 1YE5A 5EHQA 3WV4A 4AD8A 2F62A 4Y2UA 3K0HA 3ELWA 2O3TA 4P80A 5FCDA 2R62A 4KE6A 4R65A 1CUXA 4Z4GA 3OT4A 4OQLA 4C3ZA 5EFOA 4ZAWA 1PFVA 2EQ5A 2I1LA 3HB1A 3HEMA 3L8ZA 3RC9A 5E1BA 1UOQA 5EXPA 4YRTA 1OB2A 3QE4A 1Y5LA 3RABA 4KQKA 4UE3S 2PEYA 2DHCA 1A2KC 4K3UA 3GPBA 5KYKA 1EQUA 2ZRFA 3FKSA 3N2EA 2GZ1A 3WGUA 4QZAA 5B3KA 3N7PD 3PF8A 4GT1A 3TGPA 4DQDA 3EEOA 5FL7A 4FO6A 3AEKA 4J7AA 1Z0UA 4NXZA 3UHJA 3WMWA 3AFMA 3JQGB 4P3PA 1KIAA 1ZWKA 1Z1BA 1QH0A 1E1LA 2GPNA 2IZ7A 2YJTD 2BEUB 2CCJA 2R2AA 2R84A 3BS5A 4I4TF 1PSZA 4FZRA 1JTVA 4RQ8A 5J1TB 1DGQA 4XM1A 9ICHA 1SXEA 4BFZA 3U7EB 3HUTA 1X0XA 3QEKA 1A7JA 4YREA 3SI8A 3FWPA 3EFOB 3SR3A 3QFFA 1SVIA 2DMRA 3ABZA 3ZZ0A 2QPLA 1D4FA 2PKQO 3GWZA 5HF8A 4UVHA 2O59A 4M0CA 4KPYA 2VBGA 4HYEA 4IJVA 2FX3A 2YWRA 1GCOA 1UPFA 3G0BA 3NU1A 5COAA 4WOCA 4O3QA 4RYLA 2NNLD 5C1DA 1A9SA 3MRXA 4ENVA 1FFXB 2AK2A 1E0JA 4OY3A 4P92A 2OD9A 3UHPA 2XHZA 1CK4A 4PCUA 1I14A 2DPXA 4ED9A 2HOFA 4B45A 4G07A 3SMVA 5BNIA 2O4CA 1KPGA 2AWOA 3Q8WA 4IV0A 1N0HA 2MMGA 2OLJA 1ESEA 5C52B 3MDAA 3MWGA 2X8BA 3SP1A 3A05A 5KFYA 1G6KA 1R6BX 2M1XA 3VSBA 4OYYA 4NQZA 4PZOA 3N59A 5CT5A 1ZOSA 1RYFA 1YT5A 3ESBA 2V7VA 4LKOA 2B7LA 2WB4A 2WPNA 4X8LA 2QOEA 1XPRA 4MW6A 5A03A 4EF5A 2GAFA 2H8GA 1GT91 4NQRA 3OJUA 1OZFA 5HEKA 3LLUA 3UT5B 2W6ZA 3BOSA 4QOEA 4F38A 4WN3A 3F9RA 3THXB 3ZW8A 3ZJYA 2FMHA 3MYYA 4V0RA 1QF6A 2BSQA 4MIOA 1NYQA 4BWYA 4RANA 3QVGB 1V45E 1XQXA 1X1RA 2DWPA 1Z73A 1YF3A 9ICVA 3TRDA 1KJ9A 1XZFA 3RODA 4DMFA 3LFHA 3IEXA 5FI0B 1MOZA 2YFHA 1UAAA 2EFCB 3C1TA 4DCJA 3OHMA 2XMRA 9ICNA 4RD0A 3NHFA 5I7EA 4YJGA 2AR9A 4KGXA 3WIVA 2FSUA 2ORIA 1LWNA 4HYTA 5DNUA 1SKBA 2GASA 2XZOA 4N5NA 1HE1C 4X3CA 1FVHA 5AWFC 3HQ4O 3K70C 5IKEA 2C42A 2Q1UA 2WJ6A 4GXRA 5DHFA 5FR2A 2FN7A 1JLRA 3V2GA 1JLSA 4MX8A 4DJAA 4B74A 1THGA 5EE3A 4YRAA 2JC3A 4E15A 3PFBA 4DQXA 3H1PA 3C6KA 2P9GA 2JGMA 1ORTA 3HNRA 5I9SA 3KJEA 1I13A 4Z3KA 3ES9A 4EY6A 5KVAA 1TAHA 2HQRA 2Q50A 3SZLA 1NVBA 3AEQB 5CDTA 1MAAA 3A9RA 2D2FA 4DM3A 5IXYA 1QH8B 3SQOA 3RJEA 5BQOA 1Z8NA 3VFDA 4CPDA 4DFJA 2ICAA 3AUSA 4U6NA 2OEHA 5EINA 2VLBA 3S0JA 1CJVC 5K8CA 1QLWA 2A7QA 4CMAA 2E4AA 3MF4A 2WSLA 1EUQA 7ICPA 4TTAA 1GQFA 2JJMA 3ZNOA 3QUBA 3VAZA 5BWBA 3K32A 1X7WA 2YHAA 5JMWA 1PD0A 3L7NA 4NAVA 2X40A 3O1HB 3GFOA 3H9UA 2JR5A 4KLTA 3BZUA 2GWRA 4M3NA 1NLMA 4DT1B 1EP9A 4QHYA 2J9FB 4O2RA 2C4TA 3FXAA 3GUUA 7MDHA 3C6YA 2IJGX 2Q4DA 1JBEA 1IOVA 1KFBB 5EP2A 3NC1C 4ZGBA 2WB1C 2P30A 3SWWA 1Y9DA 3VNAA 1VL5A 4URVR 2WYIA 1HI9A 4E03A 4LEIA 2EBUA 3NWOA 4Q4JB 3UTDA 2H92A 3DAYA 5FBRB 8ICLA 2GPBA 3OM1A 1L1QA 1ZSVA 4OX9B 1PIWA 2ZYVX 2Q27A 3TZKA 2WA1A 3RYFA 4LC0A 1LVGA 4H18A 4O3NA 2C0PA 1XMQB 4DFPA 4UEQA 4X8OA 3W2GA 3M1AA 1E4OA 2GFQA 1L3TA 4ZYXA 2H85A 2BFFB 2OQIA 4JBYA 1O4VA 3JWEA 3CGGA 1XJCA 2PMBA 4BKQA 2HMYB 3UPUA 5IC5A 1MW9X 2IXDA 3MTGA 4M8KA 5DB8A 4U7DA 3RTDA 2CLLB 4F1WA 4JV5B 1ISRA 2AIRA 2C5BA 3GQBB 4XYMA 1EXDA 3CCCA 1FTGA 1ORWA 5D3MB 1VPEA 4IDPA 1E3MA 5DBIA 1XEFA 1W1IA 1FMLA 3CF4G 3PQFA 4HNQA 1KLNA 4HX2A 1TZKA 2IZ6A 2CPRA 2DHDA 2AZXA 3GQCA 4KI7A 1V1RA 3F2IA 1P1IA 1IN1A 3AUKA 3HCOA 4MGIR 2VWHA 2CZGA 3UOAB 1SZHA 2KV2A 1GARA 2W7OA 5J58A 5KAPA 1GTVA 3KEFA 4DNOA 1DTEA 1YBVA 1E7YA 2NXCA 3DB1A 2EARA 3V4PB 2JJ2D 3QFCA 4OBEA 1Y4UA 1RRFA 2H4ZA 2V7QD 2YY7A 2GAAA 3GLRA 3WNZA 2JFNA 4NLCA 2HSWA 1Q19A 2Y9MB 1A27A 3BQTA 5KTQA 4EB3A 3PGKA 3UK2A 1YOVB 2ISPA 3WP0A 2ZSEA 1O6BA 1X7XA 4BNYA 1W1UA 1VGRA 1W48A 5IAAA 5E4JA 2J5XA 4IVRA 3N0TA 3HWRA 2C59A 2H5IA 1DCKA 3PTZA 3HR8A 1JNXX 4PR0A 5CHGA 2QX4A 4JC8A 3ZVLA 2XI9A 4KO2S 2G88A 5KJFA 3V7WA 2P2ZA 3VHQA 4J2TA 4EENA 3DV0A 2FAXA 1RRKA 4JB3A 3SKVA 2EG5A 1RIIA 1II0A 1P3Y1 4PLTA 1LY1A 4OO3A 1O58A 2JLYA 4L2IA 4EPRA 3SYZA 4Z49A 3KZCA 4HH1A 4G9GA 3FTQA 3BZBA 3WIOA 5TC4A 5BV8A 5ALHA 3OQJA 1PN3A 5K3BA 2CW5A 4W9NC 2HDOA 3QKSB 4PO8A 5GJWC 2GJAA 1T0PA 4J9KA 1YVEI 2V4MA 4HQFA 1SAYA 1XRSB 5CYGA 4CMGA 1Z2PX 3M6ZA 2ZIUA 4XB6B 1YAHA 2G1AA 4TTIA 2R9VA 1G0NA 5J2CA 4RPHA 4D9FA 1N2HA 1FXUA 2JI9A 1R0WA 3A1VA 1L8XA 3DTVB 4KTTE 2FWJA 3DMHA 3QZ7A 3WL4A 3L7KA 3LPAA 3U40A 4C8KA 1U7HA 1H2BA 3EVBA 1INLA 1U3WA 4RESA 2IHBA 3RSZA 3ZEAA 1BPZA 2B1RA 3ED1A 1BWQA 5KDLA 2OD2A 5HWSA 2C3PA 3MGIA 3C5EA 4MR7B 4UBOA 4HRYA 5DG9A 1GA4A 4PW0A 1EAYA 3FNHA 4IWYA 3TKYA 4MF8A 4CF4A 1CQJA 3OCXA 1NJ2A 3FOEC 1KTVA 3LWZA 3A4VA 2WKWA 2M0NA 2V65A 4WLUA 5FWNA 2PUJA 4OL0A 1D4AA 4PLGA 4JLWA 1VJ0A 4QYIB 1Z00A 3GUCA 2Y8EA 4K46A 5F33A 3WTBA 4KTQA 3C7KA 4F8YA 4DSAA 1ZIPA 1KYYA 4P08A 5TS2A 5CK4A 1IXKA 2KSOB 3JQEA 1S0UA 1V2HE 1Z83A 3VYRB 4B9SA 4UULA 1TK9A 4AJHA 4IQWA 4R1SA 5JD3A 3WWEA 3CW2C 3C3JA 3KOWA 5IULC 2FOIA 5I7HA 2OGZA 1P72A 4YAJA 2GCNA 2FHSA 2PVPA 1ZQYA 3DLTA 5AW5A 2HW8A 3UKDA 2W54A 2XVZA 2XCRB 4IIJA 5IXJA 1SHLA 4UCFA 2GETA 4G1CA 4UQGA 4CM5A 1XAGA 1E2MA 3EDRA 4FLFA 3RAPR 7ICLA 1RYMA 3Q6MA 5DDMA 2PMZC 1W4BA 1ZLYA 5ADHA 3RT9A 2X1MA 4AURA 1SA0A 5IUKC 2JCVA 1W4ZA 2AJLI 3L3BA 2JEJA 1HWYA 1WL8A 4LHSA 5KQPA 1DC7A 4KQ2A 1V8ZA 2YHIB 3QWHA 5LZ9A 1NFFA 1QUFA 3VVMA 5M7EA 4J9LA 5F78A 1W44A 1E63A 3CLSC 1OFIA 3MBYA 3NRZA 3KJXA 3LWNA 5JXGA 4TYYA 2WJ4A 3RM3A 4CQNA 1Z82A 4I8DA 2QMZA 5JZBA 1UFQA 4NICA 1TEXA 1ZY2A 2P4SA 5EWMB 1J0CA 1BEZA 3WX0A 5A0VA 1GA6A 3Q41A 4MROA 2KG5A 1NOMA 3UXNA 7ICUA 3PNBA 1WUYA 4EVSA 1KFCB 3DE4X 5A2GA 1U2TA 5HOQA 1LLQA 1GGKA 2QY6A 3C7DB 5K6TA 3AUOA 3SHTA 4E3ZA 4PFQA 5DDIP 5CNMA 1VLQA 3QKIA 1N9GA 1KAOA 4JBLA 1U4BA 4UD6A 4EHHA 3NTQA 1EXMA 3SOZA 3ICOA 1PWYE 3RUEA 1MPXA 4IX9A 1PK1A 4QJIA 1N32B 4WFQA 4NECA 2PVCA 4BNJA 1HF3A 1B6TA 2RGDA 1M7BA 3TNDA 4ZO7A 3FC4A 4M8SA 3CCBA 2AEMA 5KNBH 4Q9IA 2Q3HA 2O2XA 4R41A 3C2KA 2QN2A 4Q4LA 5T67A 3U56A 3TLYA 3NVVA 5JSFA 5IBQA 1B3BA 1JU3A 1VFNA 5T8KA 1T34A 5DYIA 3AJ9A 3MN1A 1QH9A 4URYR 1B0XA 5JD6A 4UM9D 4D26A 1ZI8A 3QEBZ 1ZNZA 4MLDA 1KVSA 3H2ZA 3QI7A 2FTKE 3T38A 3G8BA 3C5VA 1HQYE 1P1JA 3LYLA 1NBME 2EKZA 3E2PA 3FFXA 5HIIA 2G5TA 3ABRB 1JDZA 3CJQA 3NOXA 3VR3A 1P1KA 5DBFA 3QF7A 3AERB 2Q4TA 3D4OA 3KWJA 4KYIB 1GQ2A 1EFDN 2YR0A 4Z6KA 4HTAA 2NZ8A 1NSYA 4LOIA 2EATA 4GPTA 4XWYA 2Q1WA 1B0UA 5CUQA 2PUHA 2ODWA 2QTMA 1N78A 2RE8A 1V16A 4I5EA 1BXRB 2A0KA 1TJ5A 2W58A 3NYRA 5EWLB 1AVTA 1VRWA 4LJKA 2WWXA 1MN6A 1RBYA 2J0VA 5KYNA 3Q3CA 5J3JA 2VPZA 3P52A 1UF9A 3MTIA 4Q39A 2ZZKA 1RC1A 3LDFA 2IDJA 5BVGB 5FRDA 2DKXA 1AHHA 3OCYA 1JB1A 3DMTC 2ZROA 5SY6A 3GN1A 4BMDA 1DKLA 2VAVA 1CIPA 1TM7E 1C2YA 2VXBA 1FFGA 2O0HA 1JLMA 3IO3A 3ZK7A 2EP7A 1PQYA 2OHGA 3U4IA 1T9GS 5BMVA 4OAQA 2JHGA 3PI6A 3TLJA 5ESRA 4DBVO 3QFRA 3EMBA 4RZ2A 2BQ3A 4ME6A 2N75A 2WJ3A 2WQ6A 5A0FA 1MGPA 4QPDA 4MAAA 2ZB2A 2K8BB 3THVA 1N2ZA 3AX6A 5AK0A 4BE9A 1EWRA 4ZPXA 4B7XA 2AJQA 3A14A 3UJ3X 2KZMA 3JV7A 3BWDD 2VJDA 1ESDA 4O4JA 4MKRA 3OPYA 3JWIA 1U31A 1NT2A 2F1KA 5LD2C 5TXGA 3QW2A 3O4JA 4GP7A 2Q8NA 1Z5NA 1XF1A 2BOVA 5KNCD 4JJAA 4YNBA 4PIVA 1E1QA 4MW1A 2O2JA 2G1KA 4DFKA 2QX7A 1GFWA 2RH9B 1UJNA 2XC9A 3FCSB 1AUXA 4NWIA 3I12A 4EHKA 3INYA 3UGJA 2CV0A 1J99A 4HDSB 1D1TA 2ID8A 3S2SA 2NVOA 2OCLA 1EZ1A 1KAHA 2DPMA 4GQAA 1RQ2A 1UOPA 3LUPA 4RVGA 3WQHA 1KDTA 1NBOA 2RHCA 3L46A 3IE1A 4Y2GA 4PGAA 5DNYB 4OJPA 2AFHB 4U9UA 3QX9A 5DB9A 3RAJA 2J4FA 4R6XA 5FTWA 3LZDA 2HBJA 1VRVA 2XZDA 5EJFA 1SVNA 4BNHA 1I3CA 4WBNF 4UHBA 2LGJA 4LBYA 1SL1A 1T8WA 3RT7A 3QQPA 2XTNA 5U4QA 2Q5LA 3BWMA 4G26A 2GBLA 1P2SA 4EAAA 3TN7A 2W2KA 2GLXA 4I2DA 3DEZA 3FCYA 4I1OA 4EVIA 4MQMA 2IQ5A 1V3VA 3HU1A 2PX6A 3UPTA 4J0FA 3DV9A 2Q3LA 4QIWF 3W9SA 1XWLA 5DJ5A 1H6CA 2J31A 1XT6A 4I99A 1TW2A 3DMRA 2GM4A 2YASA 4M9XA 4OHRA 1T5SA 5DRTA 3QEOA 2H08A 2PRKA 4MQEB 2A1AA 2V1UA 5M29A 4DQLA 3LLVA 3OPQA 3I6ZA 4LJ8A 4IHJF 4WJLA 1GQQA 1IM2A 3KYDB 4N6NA 1T9DA 2OV1A 3ZE7A 5AVRA 4FFLA 2PNFA 3QENA 2BMAA 2C82A 2Z4RA 3LUHA 3ESDA 3M5PA 5EVCA 2LE0A 5H0IA 1OXSC 4ZYUA 1EFPB 2GR9A 3JQQA 4MCIA 2CEKA 4R2KA 1HRDA 2XUZA 1QPZA 1NLFA 4X90A 4AZTA 5CR0A 1AMNA 3ETEA 1BHJA 1CB7A 4NI5A 4KR3A 4YJFB 3OEEA 4HD8A 2ES6A 2HLDD 2PSSA 2I8LA 5KG2A 2R6ZA 3OPMA 3A6DA 3R0JA 3F71A 1XZLA 4QZ8A 4B6QA 1XR3A 1LV5A 2QAGA 2IBMA 5I4BA 1PT9A 2BSAA 1JLHA 1RI4A 3JQRA 4XFDA 4F5PA 3H5TA 1L7RA 1R5OA 2FXIA 4H7IA 2IUUA 1G17A 2C2BA 4I14A 3U6BA 3BD7A 3PE4A 4JYCA 1KJ8A 4ND8A 1CE8B 3HY6A 4L28A 4TMTA 4UNRA 3GT0A 2RC6A 1O5IA 1YKFA 3RFAA 3GLFA 3C7TA 3OJWA 1NF8A 4MWOA 2ATCA 2J87A 2ZSFA 1FPMA 1P1CA 3TI9A 2V1XA 1MC4A 3TW0A 2H3VA 3ACCA 4B47A 4R63A 4TLDA 3D3WA 2ESEA 3CNQS 1K68A 4KFSA 5EHIA 2R97A 3UMGA 4N7JA 3BIWA 1G1AA 3ZV4A 2FDXA 3IBSA 2Y1XA 1S4QA 1A3CA 2O5RA 4YIHA 1TK3A 4GZ6A 1DLIA 4HV4A 8ICMA 2FWMX 4YMSA 3L8GA 1DQPA 2ZXEA 5CVCA 4ESHA 2WABA 3ROKA 4QDZA 2RC5A 2MSCB 1WLSA 4YMWA 5LP1A 3DW3X 1GZ6A 4A1OA 5LYJF 4CEHB 4QFBA 3SEIA 2HT1A 2W83A 1DEXA 5FTLA 1FSSA 3OX2A 3UMBA 4XEHA 2XVMA 4FW8A 5HMMA 2P6PA 1AO0A 2C20A 4BNTA 1N5LA 2TMDA 1V5IA 2AXEA 4IS2A 3IQHX 3LCUA 3WNDA 2F2AB 3DKKA 1QC5A 4BRWA 1L7PA 3BS4A 4RO0A 3TAXA 1AS2A 4LVUA 1JXEA 4BVBA 5AHRA 4JC5A 3GNSA 4A2CA 5KVSA 2XDWA 2BCGY 3FTCA 4NOJA 3RUDA 2GN9A 4YCCA 1N5RA 4KW7A 5KAIU 3GAFA 1IULA 4NHEA 2VHVA 1QLNA 3SEQA 3DE1X 4MK4A 3FPBA 3WJ7A 2HUPA 3RSHA 1ZH0A 1D1PA 2WE8A 5TPZA 5C8ZA 4WH0A 1J00A 4UDNA 3LRXA 2ZSAA 1HRKA 1SOMA 3PUHA 3OC6A 3F90A 1FNBA 2HHAA 4LGCA 4YRQA 3EWAA 2C9MA 4WW0A 3THRA 2FSVC 2V6BA 1BKSB 3VJRA 3RF9A 2KB0A 3B6IA 1QRDA 2JJ1A 2QLNA 4WZAB 4P3XA 1HDXA 1S01A 1YQWA 3E7XA 4RA6A 2W48A 3AQEA 5KINB 3FUCA 1NQXA 3AOEA 3BL8A 4FN5A 3A2KA 1EGHA 2EF1A 1SL0A 1DG3A 4YQYA 5F7OA 4I2VA 3I34X 2KEYA 1P18A 2R1TA 3ZN2A 1KDOA 4CT5A 3H3FA 2QX9A 3KAKA 3CLUC 1KJWA 2C2ZA 3ZV6A 1Z0DA 3S29A 1Z8HA 1YQDA 3PVSA 4PLWA 4MP6A 1NNUA 4R2JA 5EWEA 4F3YA 4NV3A 5FV7A 4X6YA 3QWBA 3B60A 5BWLA 1BYIA 2XNJA 2PXXA 3QK7A 1XALA 1ZMRA 1ED1A 1RZRD 5DI3A 2W3RA 3KHSA 3P9XA 2CYCA 2H7XA 1KORA 5JDIA 5IIOA 3EOAI 4CKEB 1LV8A 4DS3A 4XD7A 1FFDA 3TOVA 3ZCTA 1N6LA 2RBEA 2WTAA 4Y9UA 4DARA 5LZ5A 2A3NA 1TO2E 4FHEA 1DO8A 4Y7DA 2K4PA 4L3OA 3T0FA 1MOQA 1FZTA 1HT0A 3K94A 2OWOA 5IT9A 1JQEA 5BUSA 2FW7A 5CX1B 2CUNA 4Z9BA 1WUIS 1IONA 1HETA 1EFVB 4AKHA 2W2TA 3DMNA 4PR3A 1JF8A 5HIJA 1U65A 2R4TA 4WCFA 2YMMA 3RC8A 2F1RA 1QHIA 9ICCA 3STHA 2QGZA 4N5DA 1HG1A 3FRHA 3N2NA 2UVPA 3FY4A 2R68A 1R6TA 1DAPA 4QQRA 3RYTC 4M6WB 1D7OA 2VRCD 1GKIA 1EDOA 4JN6B 2IEDA 4FLEA 5IANA 2E7ZA 3CLTD 2K4IA 3MINA 1KMHB 3H8VA 4FYJA 4YD2A 4YRFA 2GM5A 4NL9A 1T4CA 3RVLA 5ECDA 4IMIB 2Y4NA 4UHDA 2DWUA 5FTNA 4R8KA 1KK2A 4B0OA 2ACWA 2JMGA 2ZGVA 3EB9A 4X64B 2DSTA 5C1PA 3BHJA 1UWVA 4JL5A 2I33A 3ZI7A 2QMOA 2ZSUA 3QUQA 4NCJA 4FQ8A 4R1UA 4QOGA 3VC3A 3UNXA 2O3JA 4XPIA 1Y9ZA 1EK6A 2ASLA 1TKAA 1P31A 4ZQBA 4Y1EA 3KJGA 1IEWA 4J1QA 2EKBA 3U7IA 4KPEC 1ZJWA 2PTHA 2BE7A 1U9YA 3EPGA 1TE2A 1GA1A 4OUDA 1M2JA 2I6FA 4FMCF 3NTRA 4RK5A 4K4HA 3B1WA 3T9CA 1QQ5A 2I6GA 2HEGA 1KE1A 1KZ4A 2VLIA 5C8DA 5B1EA 1E3IA 2FSHA 4D0SA 3Q8LA 1YI1A 1O4WA 2FGJA 2GO7A 2FVXA 2Q2NA 4BQSA 5KFKA 4ARBA 2FUKA 3AEKB 4P4OA 3ZPXA 1V6SA 2FETA 4OBWA 4ZK6A 3I1IA 3ILYA 2XY4A 3AU6A 2X3FA 5IINA 3LQRA 1QQAA 1DDGA 2W6QA 1D03A 1O1YA 3BS5B 1NM5A 3R0QA 3DWEX 4BTEA 4M8NE 3DFMA 1VTKA 4EPWA 4PBRA 2OK8A 4ZQHA 2B98A 3GXBA 1DFGA 4QA9A 1XAHA 1OH8A 3BRCA 2VDQB 3BWEA 5MGBA 4FS2A 1AKEA 4CMBA 1M2VA 4DZTA 4U8HA 5KKNB 4ELTA 4B3RB 3RSQA 1ISSA 2L18A 4C03A 4P7JA 2LXNA 4H27A 4Y6PA 2V7WA 2HHXA 5J2UB 1PWEA 1TKCA 3JZFA 1TGYA 1NLYA 4FOSA 5LCXA 3GVHA 3HXLA 4JJEA 3OT5A 2ZIGA 3ZYCA 4L3VA 3LT5A 4I6EA 3WK6A 1F48A 3PA8A 2FN8A 1JMSA 2HY7A 3ABOB 4HDMB 2IMWP 4RQMA 2WBLC 1E2QA 4UVGA 1OAOC 2ZE7A 2W8ZA 4NTZA 3ID6C 5ICGA 2QTZA 3MT7A 3E4DA 2ZT5A 1A1VA 2QSZA 3AF1A 2FQQA 5CX4A 3P0FA 4AS3A 1GGVA 3EGEA 9ICEA 4Q24A 2BBSA 1T8RA 1YDHA 3HLTA 1ZMTA 3W5BA 4C4RA 3BXZA 4BWJA 2H1SA 3CW9A 1WUTA 4UVEA 1KI2A 3HDQA 4I5FA 1DGSA 4MQ5A 3LS2A 4TTVA 1J8YF 4LGVA 1KJYA 3MG9A 2VTBA 3TDNA 3RFFA 4HJXA 2NSYA 1KNXA 2OSVA 4XR4A 3F4LA 3SR4A 2HK6A 2ILVA 5K0GA 1L1RA 4N18A 5DG7A 1NVVR 2WNIA 3DFFA 1UBEA 4WEQA 2ZB3A 4Q48A 1FVXA 2W6CX 2HPAA 1PL0A 3STVA 4AYXA 3K0FA 4I2AA 1AF4A 3O1LA 1ETHA 5AM2A 3FOAA 3BULA 3PJEA 3GGDA 4XIGS 3BAFA 1MEEA 1JKJA 2QMUA 1E4EA 4KXYA 1Y8QA 1VPVA 3NBZC 3DVRX 1EFUA 4Q82A 2W0MA 1L9KA 3RC3A 5GZ1A 1E9FA 2JBWA 4K1XA 1BIFA 1DMSA 1RLTA 3WP1B 5HF6A 3HYNA 4NRDA 1LWOA 2HVIA 4YJGB 2VATA 3GH1A 4OH1A 1ISHA 3GG9A 4EJ0A 2YMPA 3L7JA 4JOCA 4KR9A 4R9NA 5JJCA 2NQTA 3WLSA 4M9GA 5TF4A 3R5KA 3AK4A 2BKAA 1IB0A 3V6JA 2WEKA 1REQA 3O1JC 4FYYA 5IFLA 2BMJA 1QE3A 2WIJA 3N7UA 3Q9LA 4PC3A 3DKVA 1IJEA 3RJGA 1UFRA 2OBMA 4F2WA 3N2IA 1MP0A 5IHPA 4QOFA 4C7KA 2YN0A 4N1AA 4D8TA 5KTYA 1QS0A 2GXQA 1ZS9A 1RIFA 2FW1A 4AKIA 2J6SA 4QNRA 2F9MA 1DFHA 2W4IA 4MEXA 2OYSA 3A6HA 1NJXA 1IYZA 2DY1A 3HKDB 4RDIA 4UE2A 3HGMA 1Z0FA 5IBPA 2ZUTA 1L1EA 2RG7A 2DPHA 3W7AA 5FF9A 1LNSA 1F9AA 2YDYA 3HZHA 3RV4A 3QKRB 1E2DA 5FAKA 1UPXA 4F5ZA 1EWTA 5F3DA 3ESRA 4IY1A 1EPUA 1H93A 2WJZB 2ZBVA 3PEUA 3NVMB 2BLLA 2ZYRA 2CY0A 3IOCA 2OP1A 2AL7A 4QNLA 1U3DA 1SQ5A 4Q9AA 3QQ5A 4JP2A 1L7OA 4ARZA 5F1PA 1UBCA 1YDMA 1X7WB 4B3IA 3QMMA 2ZCJA 4KIFA 1LLDA 4ZVKA 4QQ8A 1KK0A 1IRXA 4HGYA 3HG7A 3HKCA 2BONA 3WBFA 1T8PA 2NU8A 3EWNA 3KKOA 2BTOA 5B4UA 1WULS 5JPCA 1IVSA 3L0CA 4MFCA 4PC7A 1SV0C 5L1MA 3LC2O 1I5RA 1JR3D 5K1ZA 1T3NA 9ICRA 3M6UA 4MAFA 4P3OA 5BSVA 1EJBA 4JGBA 1L0BA 4A0SA 1NNI1 1Z5VA 4RABA 3IEIA 4HR7A 4QU5A 2HU7A 2QTGA 4QFDA 2WSIA 2XYVA 1AQYA 5CHEA 4EKDA 3DR5A 1Q46A 4BO8A 5A1JA 3C48A 2ZTHA 3RYFB 4LV6A 3CLHA 2CXPA 2ZDGA 4PO3X 1JFLA 2QX8A 4TURA 2P7IA 5LQAA 3UEOA 2NZJA 2BIFA 4URHA 4IXMA 4IJMA 1SC6A 1K06A 2CL7X 5EN4A 2PUBA 1NVGA 3T1TA 3F4BA 1FJHA 2FLWA 4OI4A 3GJ8A 2JV3A 3LGXA 1H94A 1IN8A 1J2YA 1DT3A 4QNNA 1CRLA 2DKNA 4KFRA 2AN4A 2R8OA 1U9IA 1EBBA 1HYHA 4I2EA 2HD4A 1DAKA 3H11A 4G4SP 3CNHA 1JROA 4TXNA 1X8LA 4WK6A 1YZ6A 3NJ4A 4ETNA 1DWOA 4U2DA 1Z4LA 1ZPDA 1Z7BA 1IEVA 4PCAA 4WKGA 5KFCA 2IT1A 3VGJA 3X0DA 1UZNA 2IOFA 5CVDA 1ZMBA 1YQEA 2EJUA 1TK8A 4D8UA 4D4MA 1PEYA 1LDEA 4RMGA 2HK8A 1J5PA 3QE0A 2R86A 3RVMA 1QRAA 3TIVA 3G02A 3MCVA 4JBHA 1LA2A 4WN9A 2JHCA 1G6OA 2F77X 4B9TA 3GI1A 4JJ4A 3BHMA 4NK5A 1IXSB 1F7VA 2ODPA 1XTZA 3PW5A 5HTKA 1X7XB 3PR2B 4BZPA 5JZOA 1IVNA 1IZ8A 3C3CA 1B8NA 5B12A 5DM0A 1PS8A 1I4OA 3CZRA 3PCRB 4X5VA 3EPRA 4WLOA 3HWX1 1E1CA 2VNKA 5ICMA 5KFWA 4F9EA 3C21A 3TMKA 3MQFA 2G72A 1GFZA 3NCTA 4UXJA 4ERXA 1XUOA 2C77A 3DC7A 3AONB 1XIVA 1C7IA 1RKXA 4R64A 2Y1CA 4J9RA 1WXQA 3DV0B 3KB2A 4I1VA 3LWDA 4X44A 5K7SA 3DZDA 4OVKA 4CUJA 2QV7A 4RDCA 2I1QA 3D2LA 3G2LA 3VAAA 1ISGA 3IAS6 2UXCB 4L2IB 3HVJA 3LE8A 1T3HA 4AMYA 3NT4A 2H16A 3M9WA 2ZUEA 4TN5A 1AJEA 3DFIA 2BPFA 3QZUA 2FPPA 1PT8A 1MC8A 4Q5IA 4LZAA 1ULSA 3KPJA 4X41A 5FFFA 2GCPA 4Y3UA 2IV7A 1B4DA 1VIMA 1PJ2A 4NBSA 4KQWA 4RHTA 3B53X 4OJMX 4EIWA 3ZCSA 2HK7A 3UCEA 5FBKA 2ZIUB 3PRKE 1U1FA 1I3KA 4JP5A 2J9ZB 4FS3A 2TECE 4PBTA 1NU8A 1M6WA 5CP8A 3WG9A 2UZ1A 4DDTA 2F1JA 3CA8A 1ESZA 4YRBA 5KREA 1Y81A 3GFFA 4P83A 1OAKA 1GL9B 3B3JA 3KOOA 1UEJA 3FJYA 5EERA 2NXNA 3MGHA 1J8QA 3PX4A 3L0SA 1UCFA 1IUNA 1M2OA 2B94A 3LIPA 4P4UA 2R6HA 1GUDA 1K5PA 1COKA 1F7UA 3O2QB 1VSQA 1SQFA 2HA0A 1EP3B 5MN5A 3PIIA 3JPNA 3KKMA 4QZFA 4LF9B 3KT6A 3DLBA 4MTCA 5K45A 2BR3A 4CETA 1YL5A 1Z00B 1BX3A 3OJFA 1IXRC 4GKVA 2HZ7A 4JC4A 2HF9A 2PQ0A 2FU5C 2UYOA 3GO4A 3SYMA 1K92A 1XP5A 3CNLA 4ND1A 1MPTA 5EMNA 4C07A 1MT0A 1J6UA 2WP8J 4YJ2A 1L3IA 4NKRA 1LDMA 5HRUA 1IZ0A 4KLUA 4TRJA 1YACA 2H4XA 3DZCA 4RKEA 2ZRQA 2F7SA 3E58A 3UT0A 4UB1A 2YNMC 1X1AA 3GD5A 3ZZNA 3ZDXB 1EUDA 3PMLA 1XBTA 3L6UA 1PNRA 4KMOB 4Z5XA 1XPJA 4X6LA 2OGUA 2SKDA 3DHVA 3TOZA 4IIJB 2HQOA 4R1NA 5F64A 1GG9A 4JBWA 4PC1A 4QIWC 2C7VA 4HPWA 2AS0A 2RBKA 2ZYDA 4GXIA 3AJ8A 1K6IA 4X3OA 2WM8A 1SA0B 3EPKA 4GECA 1ODCA 1M8JA 4OJLA 3RRXA 4S3MA 4JLUA 8ICIA 5C4IA 3D8RA 2VJKA 5CBKA 3F7MA 4Z4QA 4KK4A 5CU7A 4IQVA 1A8PA 1G8PA 1WPRA 4EVRA 3AEXA 1NF3A 1G4AE 4OHVA 4C3UA 3EIHA 3JQAA 4KK3A 4PNHA 1UJ4A 3RTEA 1DGJA 4OHUA 4X94A 1PD1A 2FFAA 5CLLA 4WXRA 3CISA 3NS7A 3GJYA 1J2RA 3K4PA 2NVWA 3RUHA 5LNK6 3ZXUB 1AKTA 2RCNA 2WSSD 4X91A 4KQMA 3FM9A 5BQ5A 1BJKA 3D6FA 5KTRA 1P33A 3A1EA 3STYA 4YXWD 3PC3A 4NZMA 4LIPD 3IURA 1N9GB 2NT3A 3PQEA 3QVKA 5C4MA 1O97D 2NZUG 2Q3JA 4DIOA 1GL6A 1PK1B 1ULAA 3BTUA 1DKMA 1EUCA 4YMUA 2FCAA 2XMGA 4GOMD 4Y9TA 1RR6A 2PBLA 2O4UX 4D3DA 4HZUA 1FYXA 1WE2A 3QSGA 1G8AA 2QB0B 5JO9A 5ALJA 3U3OA 2JVKA 2G3YA 3MSCA 3F6PA 5T4HA 2B4KA 4HGNA 1EHCA 3E8SA 5KFTA 2OV2A 1OLOA 2CLDX 1WXHA 3QEJA 2ZTDA 1Y7LA 2EEZA 1WKVA 4NL4H 2H9IA 4OP2A 3WLFA 1ONPA 3AM1A 3J80A 3KLMX 3IMGA 1PJCA 5HK9A 5FA5A 1LRKA 2FPRA 1Q5PA 1Z6ZA 5I7UA 1CY1A 3P0IA 4ZK2A 4M47A 4LHWA 3HN7A 2XGSA 1QKKA 2DTDA 5A71A 4Y6LA 2Q45A 2ZJ1A 2R5NA 4JKYA 2K60A 2V7TA 4MO9A 1DELA 2V4QA 1ZGBA 4OTZA 2HSZA 3IT1A 4U4AA 1JDBC 1MHPA 1JTEA 1M0SA 2Z1DA 2R8BA 4D4IA 1QRTA 3E3OA 2BAGA 4MR9B 1V16B 1J1ZA 3KOXA 2PN1A 3NORA 1Y9AA 3WIUA 2CNDA 2HMAA 5FWYA 2GA9A 3U0BA 3ZZTA 1U0EA 3Q5EA 1UZMA 1E3WA 2WHEA 1GUYA 4HNUA 5F3WB 1P7DA 3Q40A 4L15A 4MVJE 1N5WA 2OQ2A 5B1SA 5CFNA 1T36A 3WL6A 1GO2A 1AKWA 2PGLA 4OGFA 3VPBA 4XA5A 4ZOLF 3T9FA 5ALZA 1V4NA 3BMNA 2I7XA 3U26A 4XRRA 1G8FA 3E9QA 2GOLA 2OB2A 1Q3VA 1K8XB 5BMVB 5DZSA 3BJEA 1NUPA 4GMGA 5KVCA 1UKYA 5ALLA 2A33A 3W9BA 3I2JA 4KOEC 4IF4A 3PNCA 1F12A 3L5OA 4NMXB 1L3CA 5EQJB 4IHKA 3VOAA 4JASB 2G8LA 1M1YE 1FE8A 4HN9A 2X6RA 3MMPA 3C24A 3W7VA 2WILA 2PO5A 1NASA 4OGWA 1AURA 2VNJA 4HDAA 1F2DA 2QAIA 2W42A 5HK8A 4IHQA 5YASA 4G65A 1U8AA 4TXJA 4RY2A 4O4JB 2UXBB 1YS1X 3OPYB 3M8RA 3O31A 4CWAA 2W90A 4TS1A 3DUFA 4JH0A 4YJ3A 2FMQA 3GIDA 2ZP1A 3DOUA 1P8JA 3ILVA 3BKWA 3OLYA 4V0QA 1WUKS 4YQEA 3Q4GA 3JS5A 1OGIA 3THYA 3K09A 3EDYA 5AI8A 3V32A 3AR7A 3T3EA 2WSBA 4RW0A 1MD9A 2XZTA 5EIHA 3BD6A 4AZSA 2OZEA 2DL0A 2G9VA 1Y63A 4DLGA 1QG4A 4M1QA 1VIVA 1M5TA 3ISVA 2XO7A 2FP3A 4JBNA 4D9GA 3NWEA 1SBNE 2W9BA 3EF1A 3RJ9A 2AFRA 4KKVA 2AE1A 3OECA 1KIMA 2PL1A 4HUJA 1V8OA 1N61A 2OHJA 2YHSA 5E1OA 2GYVA 4L5CA 1MDBA 1MORA 2Z3VA 4IX1A 4EDFA 1NG1A 3DDWA 1P2FA 2DFTA 3LSYA 1XMIA 1SXJD 4Q9JA 5C8VA 3HJHA 5TS3A 3C8DA 4HVLA 2YZGA 3IR5A 1PL6A 2C54A 1P6QA 3AN1A 2GJ8A 2PSJA 1NZFA 1M6HA 3K2IA 1Y5IA 3RJMA 1C7JA 4DG9A 4MRAA 5HJEA 4A92A 1RYDA 3R3ZA 4C14A 3MD9A 4TKMA 1EX7A 3DR3A 3FPEA 4BJ3A 7ICIA 3AVYA 4NJEA 3VNQA 1NJ1A 5IN4A 1F0YA 5J0TA 1IG6A 2C1XA 3PD0A 1BC5A 1RWVA 1TF7A 2NYUA 3L0YA 3N6RA 1G7TA 4DC0A 1OFHA 2QGNA 1U90A 3HYCA 3CZPA 2PR2A 5KHOC 4EYHB 1Z6XA 4Y6OA 4U8GA 3LVRE 5DBCA 4B4OA 4B73A 2EBWA 5FUWA 9ICPA 4R51A 1W36C 2OD7A 2ZZNA 5DPMA 5CB4A 3IP9A 2UYGA 1VKOA 2PU7A 2A14A 3EJ6A 3OZDA 1KEWA 1RLUA 2FRDA 2XF8A 2AU0A 1JAHA 3HU5A 4G2TA 4AJPA 2P67A 3ODGA 2CJXA 4FOPA 5DX1A 4ZGGA 1NZDA 3DNMA 3E4CA 2QZ9A 5FT9A 1ESCA 1JN0A 1Y9JA 1TMGE 2NRZA 4WJZA 5IEJA 4RPJA 5KU1A 5B3JC 1VECA 4FKZA 4MV4A 4XUGB 1KFJB 2QAGB 1JSLA 2QE6A 2A9OA 2V55B 3KVRA 1V41E 3L5KA 2R96A 5KYGA 3QVMA 4AM8A 3L1UA 5JU6A 1XQ1A 1D2MA 4GNRA 3OHBA 1N0IA 2JW5A 4JNKA 2ES4A 3SHQA 4ND8B 2QW8A 3OAAD 4TTJA 1KPHA 4IQ4A 5ADWA 9ICKA 4A1FA 4ED6A 4RIIA 2JEYA 3H17A 4YRZA 4OHCA 2X76A 3ADCA 3GLFB 1MZPA 1COWA 2NV6A 1T6YA 5HFAA 5DQIA 3KQVA 3RIEA 2JFBA 5KSWB 3L18A 1EGMB 1DDOA 1YR8A 4J8PA 1UJBA 4ZYVA 2X23A 4JOBA 2Z8XA 3ANNA 5IZCC 3D3WB 1BE6A 3ZI0A 1SQ0A 1QLHA 2PFGA 4FPXA 2XUDA 2C2XA 4EMSA 1C0IA 1ENOA 2X22A 3T1HB 1PVDA 2W55A 2ATVA 2I3ZA 2UUAB 2VDPB 4XIIA 5JMPA 3H19A 3KPWA 4JQZA 1YIAA 5JARA 1PZEA 1NPDA 1ZXBA 1HDZA 3AXSA 1G8HA 1WQ4A 1M6NA 4PL1A 3V97A 1PSDA 1VGVA 3T7SA 4MGYR 3RRJA 5CB0A 3V4SA 4FMBB 4YDHB 3A2MA 1FU7A 5AKGA 1ZK3A 4D8WA 1L5ZA 1JU4A 2JDID 4F56A 2HSGA 4IL5A 1H23A 4IS7A 1QC5B 8ICPA 2MUTA 3SF8A 2ONJA 3RIGA 4KN5A 3NWBA 5FTMA 3QPCA 4UDYX 3BQ2A 3C45A 1OA0A 2R8IA 3CCFA 3LFTA 3LPMA 2YXPX 4D8YA 2ZQZA 4UJ3A 1YFKA