2YMPA

Chloroacetic acid complex bound l-haloacid dehalogenase from a rhodobacteraceae family bacterium
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
225
structure length
224
Chain Sequence
b'SGILVFVNETLLDLTSLSPLFERVFGDAKVLREWFPELILYSQTLTLTGLYRPFGEIAAAVFEMVAANHQAKVTPDDIAELKTRLTSMPAYPDVAPALTRLQDAGFRLVTLTNSAPSPAPSPLEKAGIASFFEAHLTVHSSQRFKPHPSVYDSTAETLGAKPEELCMIACHIWDTIGAQARGWRGGFVARPHNTPLTLAEVPQPDFIGRDMGELADQLIASLTA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-HALOACID DEHALOGENASE
publication title Marine Rhodobacteraceae L-Haloacid Dehalogenase Contains a Novel His/Glu Dyad that Could Activate the Catalytic Water.
pubmed doi rcsb
source organism Rhodobacteraceae
molecule tags Hydrolase
total genus 86
structure length 224
sequence length 225
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2ympA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2ympA01
5AHXA 3PDWA 1Z4NA 1TE2A 4XE5A 3UMCA 2ZG6A 3HLTA 5AW4A 2QYHA 4MUMA 4YIHA 4AP9A 4FE3A 1XPJA 2C8KA 5ALUA 1T9ZA 2HX1A 4HGOA 2ZBGA 4NABA 3B9BA 1QQ6A 2IOHA 4CNQA 1ZOLA 5FP0A 3RF6A 3MPOA 3U13A 3ZVMA 2JAUA 1U02A 5AKEA 4KN8A 3QUQA 3QYPA 2Q5EA 4DW8A 2YJ6A 1Q92A 3WGUA 3EF1A 1Z4OA 4BNDA 2G09A 1X42A 2ZXEA 3E84A 4C4RA 1J8DA 2FPRA 1VJ5A 1TJ3A 2OM6A 3AR5A 1YV9A 1L6RA 3U7FB 1Y8AA 3L7YA 4PNHA 2HDOA 3U7EB 4EENA 2PQ0A 4BX0A 4BEVA 5AW7A 4HGRA 5AKYA 2ZOSA 2ODAA 1NNLA 2B0CA 4KYTA 2HI0A 4HAIA 4YCMA 5ALIA 5AKXA 2P9JA 3L1VA 5ALVA 3EPRA 4UATA 1L8OA 1JUDA 4O8CA 5A3SA 4XPZA 3ZUPA 3OTQA 5AICA 3WK7A 2W11A 5ALMA 4G9BA 3AR9A 4UMDA 2JARA 4NAVA 5AKGA 5E0OA 5T41A 3DDHA 3E58A 3L8FA 3GYGA 5ALPA 5ALLA 4I9GA 1YNSA 2G80A 2JGAA 1S2OA 5IT0A 5AM2A 2NYVA 5AM3A 5ALSA 2MU2A 1Z4LA 3I6BA 5ALXA 3L0YA 3SKXA 2C4NA 2HEGA 3L8EA 1Z88A 3R09A 4Y2JA 3WKAA 1FEZA 3ZX4A 3AR3A 5ALOA 1S8OA 4UASA 1L7OA 3NANA 5ALTA 3W5BA 4KX3A 5AVXA 3QU5A 2IOFK 5AIBA 5ALNA 4KX5A 3A1EA 1TJ5A 3PCTA 2HO4A 5AI8A 3RFUA 4E88A 1RRCA 4Y2XA 2FDRA 2C8LA 5AI0A 2FPUA 4UAUA 5AVSA 1YMQA 5IS2A 3KC2A 2YN4A 3L5KA 3SHQA 1O03A 3UMBA 1NRWA 1WZCA 3DAOA 2B8EA 2QLTA 1Z4JA 3KBBA 5AI5A 3WK4A 3W5AA 2WF9A 5AVYA 3A1CA 3QX7A 4EX6A 2I33A 3U19A 4UU1A 2B1RA 3QUTA 4Y2YA 4AS2A 4OD0A 1L7NA 2NO4A 3WK5A 4HGNA 4HGQA 3NAMA 1YDFA 2IYEA 1AQ6A 4L6CA 4Y3UA 3EF0A 2BDUA 3WK9A 2HCFA 2P69A 5AM0A 5AKKA 1RPZA 1RC8A 1RQNA 2WHEA 5ALQA 1Z4IA 2CFRA 2WFAA 3PGLA 2OYCA 2WF7A 5ALFA 3FVVA 3NALA 3R4CA 1ZS9A 1RLMA 4Y2VA 1VFPA 2GMWA 4J03A 2YJ5A 3QU4A 3FM9A 4KNWA 1RQLA 3NRJA 1RKVA 3N8GA 3ONNA 1EK1A 1ZD3A 2G06A 5AW5A 4NWIA 1Z4QA 3ET4A 4FYPA 3SF0A 3K1ZA 3OCZA 5AW2A 4JDPA 4EZEA 4J2TA 4BEWA 4Y2QA 3AR6A 3M9LA 4AS3A 4IFTA 3QLEA 5ALYA 1U2TA 3ZX5A 3U7HB 2EATA 2FUCA 5AW1A 1ZD4A 1RKQA 1T5SA 3L1UA 2YMLA 1VJRA 4L57A 5AVTA 5AW8A 1L7PA 2I7DA 2FPSA 3IJ5A 2R8YA 2P27A 4UM5A 1N9KA 4Y2TA 2AUTA 5AK6A 4QQFA 3WKCA 3VAYA 3I28A 3SKYA 3WK6A 4L6AA 3WKDA 4YIKA 3SD7A 2B8JA 3L0BA 5ALDA 1L7MA 4C4SA 3KOOA 3FGOA 3E81A 5AVVA 5ALKA 2Q4TA 3KDPA 3ZW7A 4BX3A 2R8XA 2RBKA 3ZVLA 1Z4PX 2ZBEA 3N5KA 1Q91A 5ALGA 3L8HA 4UMVA 4Y2UA 1Z4KA 4EX7A 2GO7A 1SWVA 3NUQA 3D6JA 5AI6A 4OHFA 1L8LA 2HF2A 5ALRA 5AM4A 2ZBDA 4NV0A 3R9KA 4GIBA 4DWOA 4Y2PA 2HOQA 4OCZA 2Q4RA 2B1QA 1T5TA 4CE6A 3UMGA 1Z4MA 2O2XA 4YH1A 5AVWA 2YMQA 3NASA 2HSZA 3QU9A 5AVQA 4BYGA 1NF2A 1TA0A 4YGYA 4DFDA 3WKBA 2FPXA 3UM9A 4UMEA 1F5SA 3ZTYA 2EARA 4XOUA 5AW0A 4QJBA 2PKEA 3A1DA 3M1YA 3AR8A 2G08A 2NO5A 2C9MA 2DQSA 1LTQA 2EAUA 2YMMA 3PGVA 3IRUA 2AMYA 4HGPA 3QU2A 4UU0A 1K1EA 5AK4A 1QQ7A 4UMFA 5IT4A 1RKUA 2YFYA 4Y2RA 3FPSA 3BA6A 4GXTA 1ZRMA 5AI4A 5AKJA 3P96A 3ZVNA 1YS9A 4ZEVA 3J7TA 5AKHA 2G07A 4CF5A 2AH5A 3KD3A 1U7PA 2HHLA 2JAWA 2IA5A 3EWIA 1RMQA 2BDEA 5AVUA 2D2VA 3MC1A 1CQZA 1ZJJA 2P11A 5AKZA 4C4TA 1ZD5A 5AIAA 4B6JA 4F71A 1TJ4A 1WR8A 2CN1A 2B30A 3BWVA 3F9RA 1RDFA 4BNDB 2W4MA 3B8EA 3OCYA 2B82A 3A3YA 2RARA 4XQ0A 4CF4A 3ZWKA 2PR7A 2FEAA 1RLTA 2YMPA 2FPWA 3DV9A 3QU7A 2I54A 2O9JA 4BKMA 1ZRNA 5A3RA 4ZEXA 1SU4A 3I76A 2YY6A 4UARA 2GFHA 5AKLA 1WVIA 4H1WA 3QNMA 3ZWDA 5ALHA 5AKIA 5AW6A 3SLRA 3U26A 5AVRA 4NFLA 2JAOA 1N8NA 1ZD2P 1MH9A 3ESQA 1QQ5A 3S6JA 2FI1A 4UM7A 2AGVA 4KNVA 3L8GA 1RMTA 4IG4A 5AVZA 5AM5A 1PW5A 3E8MA 3FZQA 2W43A 2IOFA 3KZXA 4RESA 3FPBA 3OCWA 4OFZA 4YCLA 3U7GA 4ZEWA 2YJ3A 5AESA 1U2SA 1QYIA 5AW9A 2X4DA 3ZTWA 2WM8A 1QH9A 2WF6A 3N1UA 4F72A 3AR7A 3TLMA 1EK2A 1SWWA 3ZU6A 5AK5A 4CF3A 1WPGA 2MU1A 2I6XA 3MN1A 3SMVA 2WF8A 4YCNA 1XP5A 3N28A 3WKEA 1J97A 4RETA 3IB6A 1Z5GA 2R8EA 2RB5A 3ET5A 4BBJA 3MMZA 2C88A 5ALJA 2CFSA 2R8ZA 2OA0A 5AW3A 4EEKA 2HF7A 2FUEA 1Z5UA 5AM1A 3QXGA 2G0AA 3N07A 2GHTA 4MWOA 2YJ4A 3CNHA 5AI9A 4G63A 1YJ5A 2G1AA 2RAVA 3QUBA 2CFTA 3AR4A 3OCUA 1U7OA 3DNPA 1KYTA 4UAVA 3WK8A 1CR6A 1IWOA 3OCVA 3L0CA 5ALEA 3QUCA 3CZ4A 5A3QA 3W5CA 3I1YA 3B9RA 4FFDA 4Y2SA 5AK3A 3ZI4A 5ALWA 4DCCA 5ALZA 4BX2A 4EELA 1O08A 4JB3A 2OBBA 3QGMA 3OPXA 1RLOA 2VKQA 3NIWA 2I34A 3ED5A 3WGVA 1RMYA 4I9FA 1LVHA 3ESRA 4UW9A 2MSNA 1XVIA 2GHQA 2WF5A 2YBDA 3HYCA 2ZBFA 4HYTA 3W5DA 3AR2A 5JJBA 2I55A 3OCXA 2BY4A
chains in the Genus database with same CATH superfamily
3R5HA 4B7AA 2OXTA 2ZVDA 1JG6A 4O4HB 5EKDA 4R40A 4DR1B 1QKKA 1FRFS 3C4QA 2BZGA 5T8KC 3W79A 2NTJA 3PR2B 4XKJA 1BKYA 1F8XA 3BL8A 3PWSA 4YRJA 3JD1A 4MVJA 3UJ6A 1KRXA 2I4TA 1JRLA 5L3QB 2JLZA 1X42A 3ESDA 2IVFA 2Z83A 1QTNA 4M2YA 5JEEA 1U9JA 5BN3B 5JO9A 3VH4A 1SH7A 5EQFA 1TAQA 1FFWA 5BN4A 2BIFA 3KZOA 3VU9A 3KXIA 1NNEA 3OHMA 3W5IA 5IIKA 2FLVA 2ORED 4J0CA 1RM4A 2XVYA 2VRBA 1R0RE 2IELA 1CR4A 4YT4A 3TOZA 1YL6A 4DN6A 2Z2YA 2ZRFA 1X2BA 1U3DA 1VHWA 1DOZA 1REQA 2NU9B 1JDSA 4FMPA 4AY5A 5AI8A 4DQSA 4PNZA 1O87A 4QFMA 2RDIA 2QYOA 3EQ6A 3JQFA 4HZGA 2HOFA 5HIAA 4RL4A 3BTVA 2N1BA 2EZXA 4DQIA 3CRZA 1NVFA 1RHQA 2BFAA 4IDDA 5MFZA 4J9UE 4L3VA 1L5GB 1CY6A 2JL1A 1NM5A 3R7WB 2VYND 3U5ZB 1I2BA 4O0IA 1M6VB 4ZU6X 3P9SA 2DBZA 3U56A 4K9SA 2ZTCA 3NOVA 3EXIA 1EE9A 3FM9A 2PD3A 1BS1A 3VR2A 1SKRA 2OXEA 4MV4A 3HHPA 2A5LA 4X97A 1PNRA 2ON6A 1ZU5A 3NBQA 2G1KA 3IXQA 3PNQA 1SXGA 4WKCA 4MW4A 1Z8DA 1RYZA 5COAA 3MR5A 2JVKA 2FAXA 2O0JA 4P4PA 1SD2A 2OBMA 5CRXA 2PWYA 3KKQA 4RU9A 1HMYA 2QV7A 5TLSA 4YALA 1THZA 3S1LA 1IUPA 2XGQA 1OI3A 3IOCA 3T5MA 3HP4A 1XTPA 3H9BA 1M5UA 4IOMA 3OTIA 2PE5A 1E0JA 4Q3CA 4TX1A 1HM5A 3I53A 4U7CA 2V58A 4DCSA 4O4JA 5EMLA 2YWBA 4YREA 4HH3C 3UM9A 1YVUA 3AFNA 4TYQA 3NNNA 5AW0A 3UWDA 3WFIA 3CH7A 1U5CA 1OIWA 1X77A 2LD4A 2NU8B 4D4LA 2CGEA 4J43A 5JRZA 5KYYB 4RY2A 3QU2A 1FP6A 4BRWA 2HU2A 5E79U 1TK0A 1GQYA 3RH4A 2IH5A 3SAHA 3ZHCA 4C7YA 3GBSA 1PYOA 5B37A 2VTBA 3UANA 1GGJA 3O8QB 2P66A 2E1FA 5AKZA 3R0QA 1G21B 3SJZA 4XIFA 1AU9A 1KZ6A 3BGSA 4UD2A 4GQBA 1S0VA 2FEAA 4EFNA 2EH9A 1L9KA 4DBVO 1UP6A 3RR8A 1WVIA 3ZNPA 4MYHA 5IRCD 3QX3A 1KIAA 4H2DA 1H6CA 4P3YA 1W88B 1QH1B 1O58A 4RAQA 4DKJA 1E0AA 4YI3A 5AM5A 4ND5A 1BDIA 5JAZA 1O4VA 3GJ3A 1SKWA 2NUPA 4FGLA 1JWAB 1A5ZA 4RZRA 1F17A 3FDJA 5TPZD 4UHKA 5IDVA 4RETA 4E6PA 2RB5A 2X5XA 4MHSA 4XGKA 3O3MB 3PQ4A 2VSXA 2OECA 4H7IA 3OM9A 4NCIA 4WFJA 2OFOA 2VJDA 4BN5A 3AETB 5FUWA 2NNLD 1GYRA 3JRWA 3CKKA 3OX1A 2XIQA 4DWJA 2JA2A 3AP1A 3R7NA 3EG9A 2XICA 4YCBA 3DR3A 1KEPA 2QP3A 4YJGA 2GPJA 2IFTA 1JIKA 1Q1BA 8ICZA 1CQJA 4G89A 3JXEA 4P4SB 1MIHA 4IIJF 1UBEA 5JJBA 1Y1LA 4B79A 3FY4A 1NVKA 3VNAA 4R01A 5J2DA 2I6QA 3TW4A 4ZICA 3ANYB 5JANA 5FPQA 2VTEA 4H6PA 4DRXB 3HWX1 5KYWB 4IR9A 4I2NA 4G36A 1QO0D 3FBGA 4NR0A 2R8PA 4YG2A 2HHUA 4RWEA 1YGPA 3SYZA 3JZIA 3TOVA 4R9UC 3DTYA 3HA2A 4YCAA 1SVUA 5CDGA 5JZSA 1YJAA 2VI5A 3S7TA 2HU8A 2GD6A 5JECA 1M6HA 2WWYA 1TUBB 4E4RA 3M4NA 2NYVA 3P4YA 1CPYA 2R5NA 2Z04A 3LO5A 2BMFA 1HJPA 1WBDA 4ITRC 4V2IA 3ZQJA 3MCVA 1K89A 1RE0A 3DHWC 3FKSD 4X7RA 3DZBA 4P4MA 4JQYA 1N6RA 5C46F 4IIDA 1TYBE 1O5TA 3ZIDA 1RTKA 1U3UA 1TYCA 4Z6DA 3WLNA 1GUAA 3FLEA 2YY7A 4INOA 2DKOA 4LJ6A 2P9GA 2B8EA 3AU6A 2JW5A 3TH5A 2B94A 4XWYA 4JLKA 4WZAA 1Q0UA 2V7GA 4K6KA 3PFKA 3WSVA 5A04A 3BB3A 1LRJA 1J0XO 1RZRA 1FFCA 4BZWA 1E1CB 2W6QA 1GR1A 5DN6A 5C1IA 2G4CA 3R8FA 1U45A 3CUEF 4K81B 1G2PA 3BRWD 3BE8A 2YN2A 4G24A 3S2YA 5DBOA 3RQIA 1U80A 4JDPA 4EY3A 5U4XA 3CLSC 1G291 3NTQA 4DSTA 2NT3A 5JPIA 2FUCA 1ZQZA 3L1UA 5DYGA 1K7SN 1UFVA 5A9SA 1YFKA 3IN5A 2AOTB 4M0CA 1ZQUA 7ICRA 3VPSA 1VC2A 4DQQA 2ZBEA 1Y7PA 2QKYA 3MT9A 2JEOA 3ADPA 3NVYA 2CNDA 2Q5JA 1UKBA 4E1BA 2HCBA 3PTAA 1GLGA 4JI3B 4YGYA 4M86A 2QRVB 4DSKA 5BRJA 1LX6A 5KHLB 3A70A 1TQ2A 3FNRA 4CGZA 1KAHA 2B1GA 3W4JA 2XGJA 1N2IA 3QLTA 2FFJA 2ZIEA 1GY8A 1IQ0A 4LBZA 4QPJC 1BVHA 3NGDA 1CSEE 1E9RA 1NVDA 1TVCA 1KF0A 4L75A 4BNXA 4INZA 4PICA 3R44A 4M98A 3R4VA 1A95A 4NATA 3VHXA 3OJCA 3N2EA 4YLYA 5HIIA 1GIAA 4J75A 2YY6A 1SQFA 3QF4B 3G0CA 1Y4DE 1XTQA 3OFSA 1HTTA 5KFHA 4FLMA 1FX0A 5JQGF 3BIJA 3FPBA 1XSLA 3U7GA 1XYGA 3I01A 3LWZA 3P0JA 3WDSA 3WRXC 1JEEA 3PRHA 5K03A 2FUG1 3AOEA 5LP6B 4RF3A 3NFYA 1FNSA 2PXIA 1TCAA 4PRLA 2KSOA 4EFDA 3S99A 4YJ2B 3IT0A 4UNRA 4TQGA 2H00A 4UU8A 2XE7A 4LZOA 3LWNA 4L8VA 1QHYA 4QZGA 1W9HA 3IUMA 1Z8HA 4WZBA 5BNZA 2FP3A 5EP1A 2P68A 2FUNB 1AZWA 4II2A 1E8MA 5KPDA 3IQEA 1CVIA 3UTCA 2IUYA 1HL7A 2GHQA 3A06A 4NF2A 2AMVA 2YBDA 4DIOA 3MTDA 5IAOA 3EGEA 3P5BA 1ZQLA 3PGJA 5LM3A 1VYUA 4XE5A 3LUGA 4I1IA 3X3HA 1FL9A 4M9RA 4ZK6A 5K1ZA 2IUSA 2IQ5A 3C3DA 4D5EA 2VVTA 4U9UA 1LW6E 1QG2A 2RGDA 2QNIA 1PUIA 5DOVA 1XTUA 4FI3C 3WGUA 4BNJA 3L04A 2XWBF 3S2FA 2H4ZA 1G20E 3C7KA 2WZQA 1XVAA 3KXKA 1BVUA 2IGBA 3ZCTA 1KSJA 5J9FA 3N05A 4BKQA 2H0AA 4V0RA 3BWBA 4X1YA 1CRQA 4MW9A 3DQZA 2W5UA 3FWPA 4O5KA 4Y2HA 5HM8A 3ZDEA 2PV0A 10MHA 4QIWC 1P2TA 2WD7B 4PWYA 2HSGA 3AZOA 3R6DA 4EW3A 4HQ0A 5BOSA 1FP1D 7ICIA 5TARA 2BQ3A 5EWFA 3ODPA 3HBLA 4RCZA 3U4DA 5AIBA 4L28A 2ZRMA 4RM3A 2C4TA 2ZIUB 1PUZA 4EK9A 1O97D 4AN4A 5AJWA 1WBJB 4E32A 3OAAD 1IN5A 1NKEA 2ES4A 4TV8B 4QU8A 2AGQA 4MGKR 4S2UA 1E64A 2X0DA 3FMIA 1G5IA 2C2ZA 4DFMA 1A7AA 4E2ZA 5DISB 1BDMA 1MJ5A 3W1VA 2VDKB 4O1MA 2JAPA 1FTSA 2G6BA 3ABIA 2WKWA 3A1TA 4S24A 3WYEA 4Q7MB 3M5WA 4FKMA 4DL5A 2HVHA 5KTMA 4BVKA 1D07A 3PGLA 2RHWA 4BIMA 4M55A 3UB4A 5ER6A 2FMQA 4WASA 1FSPA 4RQ8A 3RRMA 1UBNA 1SXJE 1I2MA 5I9MA 4AJNA 2Q8NA 2BCEA 5CT5A 3I1IA 4Q6WA 4RZXA 2I6SA 2CPRA 4KDRA 3K9HA 2QG4A 1D2GA 4Z1MA 1FVHA 2I7VA 2A1IA 3EQ8A 5JVDF 2VA9A 3T0GA 4L8YA 1LWOA 5FWYA 5D5HA 2OE2A 2GWSA 4ZPXA 5J2EA 5JHGB 8ICYA 2OSBA 1W0JA 3QELA 5KX5F 3QFCA 3ISVA 1PT5A 4DFDA 8ICGA 1CUGA 1FFYA 1RXYA 2HPHA 2BEVB 1KK3A 2A7QA 1Z33A 1J56A 4TUQA 1BG6A 4R1LA 2DCMA 1HFEL 5DX1A 1IXRC 1JZTA 5F78A 1KO5A 4B34A 3LKZA 2I2AA 5DASA 5I8PA 2AH5A 1KKUA 3CT6A 2COEA 1A0PA 1KYVA 5AFSA 2G8LA 4F84A 4XQ9A 3DXYA 4ZYYA 3D59A 5E6UB 3EIFA 4GPD1 3THWA 3T5GA 4BNDB 1T4GA 3M4YA 3T9CA 2OHJA 4YMUA 2QGZA 3LQQA 4NK5A 3F90A 1CVRA 5FI0B 3Q9LA 4UE2A 2BBTA 4MW5A 5IANA 1C3EA 4Z0PA 3NAGA 2P4SA 4ADSG 2W2KA 3NTRA 4XGIA 2PJZA 5BO5A 3C4JA 2AC7A 1JDUA 2C20A 2P2CA 1XFAA 3ZQ4A 3PSPA 3AEQB 4M9ZA 1GGHA 1X1AA 4M9QA 4ZQCB 3OZAA 3MABA 3HY4A 5JZVA 3M1LA 4NCBA 5KAPA 2WTBA 1SWWA 3Q3CA 2MU1A 1ISHA 4I55F 5ISMA 1T5LA 2CB9A 1Q0HA 1BFUA 5DI9A 3TAUA 4L7QA 4PO1A 4M9XA 1A9ZA 1M1XB 1DC7A 1U94A 5I4BA 1FBTA 1II8A 3ZWWA 2Q6VA 2HGZA 2R6ZA 3FYUA 3N7UA 4UTZA 2DR2A 5JAIA 4X6XA 2NSDA 1IBCA 3W5DA 1N9GA 1FLDA 5MGBA 3MMNA 3CEPB 4MQFB 2R7LA 3PNVA 3EVZA 3UJCA 4GC7A 5CDFA 1EP9A 2QDKA 4O4HF 3S0JA 3KKZA 4MFAA 1KO4A 4NC9A 1L3CA 3TLEA 5HMLA 2HX1A 4Z3DA 4NABA 2FK7A 3ZK9A 4IF4A 4HLUA 2C96A 3M9NB 4IGKA 2GN8A 1NULA 1P0PA 3RS3A 1ZOIA 1F48A 5E1BA 1QVRA 3STWA 1CY4A 3ESAA 3C2KA 2H1IA 3G6YA 1OPXA 3R3WA 2YVLA 3CR7A 1IDN1 2WU0A 5HOQA 2WP0A 4AZ0B 4JWTA 4MO9A 5EXTA 1DUSA 4ER3A 1L3BA 4HH1A 3WMEA 2P1ZA 4HQNA 5TJ9A 5SYAA 1J0AA 4BFLA 1T1RA 1XKQA 3MR3A 3A36A 2E4ZA 4W82A 1MC8A 3MCUA 1J5XA 5LZ2A 3ZX4A 1X7YB 3JARA 4YRSA 2DECA 4DYHA 1QHSA 4FCCA 1Y4UA 1W5TA 4JWNA 5FL7D 1LB1B 4QW9A 2C8LA 2K89A 1JR3A 2A35A 5TB5A 3T8YA 3DEJA 1YZKA 2NWQA 5DTJA 5J2TB 1UXKA 3LI2A 2XJ9A 2JLRA 1YMUA 2DLCX 8ICQA 3C3YA 3AVTA 2PMBA 5KNBH 1EWKA 1PF7E 1I4LD 1NQOA 3GNLA 4XUCA 4HX5A 2BI7A 5BSUA 3PYLA 3IYLW 3IULA 1Q22A 3OSNA 2BQRA 4YT8A 1XZJA 3GLFA 1FZQA 1G8GA 4ECVA 4GM0A 2IC5A 4JLSA 1U99A 3MBIA 1OVMA 1E0KA 2H4JA 3JVVA 3SF0A 2QLFA 4OH7A 2P9HA 4LZNA 4QELA 2ZB4A 3T4PA 521PA 1P1RA 3QZ7A 1QC5B 1V26A 1DCTA 1GZHB 1NW3A 1T8WA 3BF8A 3EGXA 4BLWA 3I28A 2IPAB 2ODTX 3NHYA 3G0IA 5ALKA 2PX6A 2BEJA 1R8JA 1EIZA 1ZISA 1UPCA 2W9BB 1VG9B 2HPAA 3WJ2A 4MHVA 2XVMA 4X0EA 4AZVA 3N74A 4BV2A 2H4FA 4FGJA 3OJEA 4BAZA 1GUDA 1NJ2A 3BDPA 1W6UA 5HBGA 3RRXA 4YMLA 3P9CA 2OXIA 3IRUA 1G3UA 1EXMA 1JTVA 2OHVA 1K1EA 3OHAA 2YHUA 3D7LA 5KO2A 2Q0SA 4B6SA 2IA5A 1N7IA 2CXTA 2ZRIA 4UBKA 2VYQA 1EVQA 4IC9A 4TKVA 3OZWA 1U5BB 3ZV5A 4P0PA 3SY8A 1XTZA 1MP0A 1S0UA 3T95A 4MR7A 2IEGA 1SR8A 2XMZA 1M75A 3GP3A 2MINB 1SU4A 4Q66C 4QGFA 3ONFA 5IMSA 5IASA 5KC9A 2ZSKA 3LCJA 4ZQHA 1SXDA 1JA1A 3VGPA 2TMDA 1KAGA 1N48A 4FPXA 1X2EA 4H4EA 2H65A 4CQMA 3HZZA 4AY4A 4UHFA 5A5DA 1Y8CA 5HKKA 1VLLA 4DV4B 3AJAA 1R0CA 2GPNA 5I9LA 4IS7A 4NM1A 3TIFA 1U8YA 3CONA 4QBTA 1MXHA 2ZSIA 3M6UA 3IKTA 1OBVA 2C5GA 3L7LA 3DMTC 1UODA 3EF3A 4WJ3B 4JHXA 2BMEA 3G1WA 1OH6A 3EXAA 1E60A 2ONKA 3FD8A 2GA8A 3PR5B 4ZP1A 5JPDA 2A67A 4ZCSA 4ENRA 3IAEA 5E7IA 4XA8A 2DGZA 2V6FA 4RHYA 1AH2A 2OHXA 4D57A 3UW3A 4C6RA 2I87A 4AQDA 4DOAA 2AKEA 3F5FA 3T3FA 1WZNA 3B6JA 1N34B 3RJZA 4J76A 5B6JA 4BX8A 4QU0A 4OGWA 2HWWA 1R50A 1FXUA 3FSEA 4NH0A 2WE8A 4RK7A 4UOQA 3IQXA 4J94A 1EA7A 3K1TA 3ES9A 1FJHA 1UBMS 2OG2A 3P20A 1DBPA 1SOMA 4ND4A 3GDWA 1FP7A 3N39C 3K94A 2PGNA 1TO6A 4RTRA 4IQ0A 3LSYA 3DTVD 3QPUA 1Z2AA 2EW8A 2ZSEA 4LBWA 2W54A 5KDDA 4PIVA 4WLOA 3O2NA 3ISTA 1HNZB 4NP6A 2CVZA 2EJVA 4HGRA 3O38A 2WP8J 2WU8A 1RHUA 4P53A 3ZGNA 4YCMA 4QZEA 2QIPA 2VAMA 4Q3NA 2C7BA 4O4IA 3KOXA 5KDOA 2RCNA 2NVOA 4C4OA 4I6JA 4ZAVA 1JJIA 5HKBA 1A4IA 1VCMA 4MA5A 4G1MB 4JJ6A 1HETA 3A04A 1Z88A 4Q3KA 1PI3A 2ODBA 2GN4A 4AN0A 2ZRJA 4UTXA 4CF6A 1JSCA 1V97A 2ZS7A 3KAJA 4U2FA 1Y8QB 3WQBA 4GH5A 1UANA 2PDAA 3MJTA 3K1RB 3WX0A 4RANA 3WNCA 5F7ZA 3OHPA 5A7HA 1WUYA 1NASA 4F6RB 1O89A 1PQUA 3LVBA 3VC1A 1IG3A 1M74A 3PUWA 1U7TA 2PX3A 4JSTA 3MT8A 4RTMA 4KLIA 2HPZA 1YVPA 4RM2A 3TMKA 2I1QA 1YUNA 3CP8A 1B1AA 1C4XA 1G8AA 3WRYC 2Y6VA 5JG7A 4IGIA 3HFSA 3JZFA 1ZN2A 4BTLA 1ULUA 4PXYA 3A11A 3ZD7A 3V2HA 1F2VA 4OJNA 4YWJA 2EOAA 2A33A 1UIRA 2XSZD 1PW7A 1SKBA 3CJRA 1QTIA 4RNMA 3PY8A 2HA2A 4EEXA 1G8YA 4MCAA 5JS2A 1BMFD 1WDTA 1DRWA 4QOGA 1ZGCA 3COWA 5CH3A 3CVXA 1Q12A 3RVOA 2QPLA 4ZQEA 5KYNA 3K0FA 1RAIA 5ESWA 1H4QA 2FSUA 1AOXA 5E7MA 4FYYA 1CUEA 4OH1A 3SEAA 2BF4A 1BS9A 1V6CA 3QU9A 4JU9A 2Y1DA 4C0XA 5K09A 2IPLA 1O6GA 2EWMA 1I14A 1G1AA 1SCQA 2CHGA 1Z26A 4BO0A 4RKQA 1XF1A 4YP3A 5JV5A 1LQUA 2F3UA 2GN0A 3W8FA 4WNCA 4U7PB 3KTQA 2DPYA 4L5JA 4IIJB 1QFJA 2VH1A 3T3DA 3S2GA 3ZTTA 4IIBA 4DUGA 1KWKA 4GMXA 1UPFA 3E6AA 3ILHA 1PR1A 2ASJA 2SCUB 2Y2UA 3UUWA 4G8DA 1J2NA 5A0LA 3EXHB 3AIMA 2YOHA 3L0PA 3A9TA 4N8EA 4Q00A 3WYGA 3QSGA 3UKJA 3K4GA 1N6LA 5LDDC 1SC6A 2P91A 3ROFA 2QRNA 3VO8A 2LCQA 1S2IA 2I7TA 2PX5A 1TYDE 3KXPA 4BL5A 3PPVA 1KP3A 4KREA 1XP5A 2Q7OE 4AG5A 2QTZA 4EO9A 3ABRB 4PZDA 4KWCA 1HYHA 3NKVA 4R2XA 3ND8A 3H3JA 5IP5A 3H3FA 1ZJWA 2NZXA 1T0HB 3BWDD 1X9SA 3T4EA 2CNLA 4ICIA 1U7OA 1Y9EA 5CB1A 3U4HA 1DBRA 3CF4A 4CMIA 1F0MA 1VIMA 5FTWA 1QDUA 1XNQB 3BZBA 5J4HA 4DDKA 2F55A 2W6ZA 3ZEIA 3G2IA 3A2KA 4XFKA 1E2BA 1Y82A 4PVDA 5FTLA 3IDAA 4HEQA 3KB2A 4ZHQA 1ZCZA 3W90A 1S5LU 3KX2A 3GEDA 4DS5A 5AH0A 4PGHA 2YJ6A 4HDSA 3LC1O 4O0LA 3SQMA 3U7FB 3K9QO 1UDRA 1P1JA 1KR2A 1U1CA 4G5HA 5GP1A 4NJMA 3LYLA 1C4WA 1C2TA 2OV8A 1P1HA 3PQ5A 4MQBA 5K3OA 4NAVA 5E0OA 1N0HA 5EKUA 2HHCA 4CETA 3MJRA 4GZ3A 5BN5B 1U0OC 3N8HA 3ND7A 3SVTA 2IHUA 1NXSA 3L0ZA 3VISA 4OMDA 2YIMA 4UASA 1W9MA 4BVAA 3QU5A 1NNSA 3PCTA 5J2FA 1Z2DA 2QLBA 3OUTA 1ONSA 4PLZA 4IJVA 1QO7A 2FR8C 3HKZC 3STHA 3GJTA 3CRNA 1M2FA 1QTQA 1FZTA 3C15C 1TMKA 3LQ1A 1MG0A 2JH9A 1ZQ1C 3IMCA 3HCRA 1FDSA 1YCGA 3RTVA 3JQ8A 3P1JA 1Z0UA 3TNYA 2CHEA 4JT8A 4YXFA 4NL9A 4HGQA 4B9TA 1NJSA 3ACCA 4HDKB 2GBIA 1QYRA 3G0HA 3OT1A 4RTSA 4J3NA 1OW5A 2OCAA 4I5DA 2OORA 4FS3A 5F3RA 1W76A 4LGCA 2WWHA 1C29B 2WBLC 3O8RA 5JCJA 4Q43A 1XDWA 2AG8A 1OZHA 3RR7A 1SKYB 2J0EA 4WN9A 4PN7A 3UJNA 2LDBA 3AINA 3TF5A 3IAHA 2P67A 1ODCA 4IFTA 3H4IA 1G4UR 1L1QA 3DVLA 4TV9A 4HXGA 5FR2A 1ABFA 5JQGB 1T9DA 3TFWA 1E63A 1BRTA 4KMMA 3K72B 3SIXA 5FOXA 2W7PA 3V33A 3RT7A 3L40A 4F92B 2BJHA 2XUJA 3T3OA 2XBLA 2QUIA 5I4IA 3RSCA 2NZWA 2PKXA 3W6PA 2HT6A 1MC1A 1XS9D 1NIPA 3EUB2 4ECSA 4I7EA 5FYQA 4BE9A 1NJYA 5L45A 2EEPA 3E9RA 4R6WA 5IVDA 1TFUA 2AN1A 4LRWA 5HFAA 1AUQA 2C9MA 3GUHA 2HBJA 2OMKA 2OAGA 3TNFA 4HAYA 4MITA 3EUAA 4D9IA 3PDIA 2V0NA 1TW3A 1GITA 1UPTA 5B2ZA 4OJLA 1TRKA 4NI5A 4QPNA 2MMCA 3HK2A 1DKLA 3FTQA 3GLRA 4DHEA 2QB0A 4L27A 4CIYA 4XFDA 3PT9A 1PAUA 3P0FA 3A1NA 1ZRHA 4NS4A 2WB4A 3PHHA 1SQ6A 5DCUA 1CF4A 4DTCA 3CUWA 2GFHA 2PGDA 2F62A 5I9IA 9ICTA 3AVOA 3N2NA 3JQDA 4G2NA 3B48A 5ESDA 3NWEA 4Q9AA 1A7UA 3UPTA 3UJ9A 2IOFA 2GPTA 1JA0A 1OXKB 4OX9Y 3ITNA 4BQOA 3AWDA 4NOMA 4NYMQ 4FBUA 4BVHA 4OSPA 5GJVC 3VV2A 4LWQA 5IHXA 1BTOA 4J2HA 1BXRA 5DQIA 5KUTA 3QF7A 5DGHA 1SD1A 1IHUA 3P2EA 5CHYA 3DHYA 2HQSA 1JL3A 4B76A 4XDHA 1K4MA 1CQIA 1M2NA 2JIQA 4D4MA 5BORA 3CNHA 2MYPA 4GD3Q 2O5EA 2HJGA 4A0FA 1C41A 3PDCA 1E2EA 3WGOA 4XQ8A 4OHRA 3TPZA 1BHJA 1HK7A 3PJFA 4ENUA 1E61A 2GEDA 1EJ0A 4D4JA 1RMYA 3I2IA 5L3SA 1Y7IA 2FQYA 4IFIA 1PNVA 2KTQA 4LWPA 2DFDA 2XNCA 2DWUA 3PDWA 5FBLB 4YFVA 1JGTA 1XPUA 3NHSA 2AYXA 5CLQA 1IUOA 2FMXA 4NJEA 1VLVA 4A8TA 2AOUB 3IEUA 3KQKA 2NRZA 4RQ2A 3ENWA 2GB4A 4MKIA 3T5HA 3DZKA 3CJTA 1E62A 3EPGA 1EGHA 3H42B 2GLUA 4S05A 3QPVA 4J4BA 4TSKA 4PLWA 2B0CA 2NRXA 4NBLA 2P9JA 2CNKA 2VHYA 2RHGB 2ZGVA 4DCVA 4NMXB 3UW1A 8ICWA 2JASA 4HHEA 1KI4A 4Q4LA 1M2VB 3R7AA 3U1TA 3DEFA 3VDNB 3SM3A 5JVDB 3Q9NA 3WP1B 5BR1A 1C7YA 2R8OA 4LV8B 1H22A 5CB6A 4QDTA 3AEYA 1UP7A 3PXUA 2BM1A 3MD9A 4V0SA 3C1YA 4V0OA 5C31A 3DE5X 3M6LA 4BNKA 1KKMA 5CWRA 1GUBA 1Z3IX 1F06A 2XGMA 5J0QA 1EPUA 4ZZ1A 1U0BB 1L5ZA 1DAPA 1DKMA 2J7KA 1KC3A 1XV5A 5JAUA 3TNDA 4UTRA 4EL0A 1NN5A 1J6UA 4B0OA 1LDMA 2B1RA 4AZ3A 5K0GA 1H8EA 2Y1XA 1KE2A 2AEEA 2TRSB 3TM5A 5J47A 1JHVA 3AF1A 3HDTA 4S3MA 2FWIA 3LY9A 2XA9A 1M6NA 5HUJA 2WIJA 1RAGA 1PG2A 2AC2A 1NOJA 1Z0FA 5DCWA 2E5SA 4J03A 1DIRA 5TEWA 2CMDA 4IDNA 3D0QA 4E1AA 4LE2A 2FW7A 3NGLA 4YPOA 3MWEB 5A4AA 5KOYA 5GV8A 4I2AA 4B6QA 3S8YA 4NPAA 4XLLA 1P4GA 3OA2A 1IZ7A 3LT2A 1MVNA 1MABB 2I1VB 2RBEA 1UM9A 5T5QA 4DDUA 3CVYA 3FCAA 4FIZA 2VWGA 3Q7RA 3FI9A 2R7NA 3TDKA 3KEFA 3HGTA 1STOA 3M89A 3MRVA 5K0JA 1BE6A 4YONB 1X6JA 3T7DA 5TQ0A 4DIFA 4LDZA 1JV2B 2DTXA 1DRKA 1NXVA 3WV5A 3G13A 2P79A 3VR3A 3R6WA 4PYJA 3A4TA 1GN9A 4DPKA 1V1MB 2ASEA 1T4DA 2P4HX 1P44A 2PT9A 3RBXA 4AMBA 1GXSA 4M1SA 4QWWA 1ODKA 3NXSA 3PTLA 3IQZA 4DIDA 3B5EA 1IWPB 1GVHA 4KHZA 2ZYUX 1AKEA 5CVDA 4E5UA 3OA0A 4DL6A 1MOPA 4B6JA 3EZLA 3CZAA 3GN2A 2ZTHA 1O94D 2IZ0A 5JH7A 4TTIA 3AO0B 2PVPA 4QATA 8ICJA 4A8PA 2DJIA 1YA4A 5E3IA 3B20A 3TBKA 3ULKA 3O47A 5C1PA 1P62B 3VH1A 1E77A 3MD0A 1EVLA 1GNPA 2XCLA 5FA5A 4NLZA 2D7JA 2I1WA 1MRSA 1WUIS 2E49A 2P0EA 3K6SA 3S1SA 3UMSA 4DLZA 1BZYA 4CDGA 2ZB8A 1BEEA 3CNNA 3OLYA 3QOYA 1V7PC 5CG2A 3ROXA 4BVJA 2WF8A 1N60A 1WY5A 2IHNA 4EG1A 4P5DA 2OBXA 5JRDS 2XCSB 1G7SA 4KO4S 2IU0A 1W0CA 2D3TA 4BCBA 5BSMA 5FQNA 4K1LA 4UAVA 2AGPA 4WLUA 2WSMA 3A6KA 1TC1A 1J49A 3NT2A 2BMJA 4LW8A 3LLMA 4R3NA 2PLNA 2R6GA 4WDRA 5KNCD 1O08A 3UBTA 4IOJA 1EG2A 4MJ3A 1J22A 5THXA 3EVAA 1F2DA 1Y6ZA 5SY9A 1F4VA 2OGTA 5HF8A 1SCUA 3KBOA 3ECCA 1KDVA 1MOSA 3H9CA 2IODA 4XB2A 2CLHB 2IKQA 2R6FA 1PDVA 1SVOA 2PU7A 2JIDA 1QHNA 4EG6A 3N7AA 1VHLA 4S1PA 4DG5A 2G36A 2VQSA 2XUZA 3L46A 2A4MA 3BOSA 2D59A 1TT5B 1X74A 1RPJA 3K0SA 4FU0A 3S70A 1MQSA 1Y8AA 3LBNA 2OKCA 3RSGA 1N6IA 4DLNA 7ICNA 2JPDA 1AGXA 5EL0A 5IX8A 1UBTS 4CLOB 1R6AA 1FJXA 1S9DA 3SSMA 4EH1A 2VSQA 3B85A 2MSDB 4B8WA 4WZAE 4RAOA 3QPCA 2D5LA 2EQ5A 2BAGA 4ZVSA 4R71A 1VB3A 2JCBA 3U3OA 4G4SP 4Q21A 1YXMA 2KJ5A 5AVXA 5DF1A 1XVUA 4N4AA 5AYVA 4EMTA 1ZNZA 3ZG6A 3L49A 5CTJA 2O57A 1FTYA 2Z9CA 3B6ZA 3QBDA 3NCTA 3K4HA 2WIAA 4CN9A 2XQFA 3GBPA 4M89A 4RA9A 1FBNA 1NBMD 2N0SA 3DP7A 3BMQB 5EHNA 2PN1A 3N2KA 4AG6A 4EF6A 3PSAA 4NYJQ 1VI6A 2BQUA 4IL5A 1DEOA 4ON9A 3R75A 4Q3LA 5C32A 4FLFA 5H7XA 4NWIA 4ID3A 3K2BA 2AFIB 5B58T 3HU5A 1S3FA 3K1ZA 2Q2OA 3R20A 3BXPA 4EYHB 5BSVA 1ZNWA 9ICXA 4QUJA 2H48A 1W49A 3WS7A 4QICA 3PEUA 4U8GA 2X7JA 4ZCTA 2XNDD 3W9UA 3GHHA 1QG4A 2X13A 4PLFA 4EATA 4PC3A 2QB1A 3SD7A 5KTOA 5DM1A 9ICQA 1YOVB 4QPDA 1C9DB 2D1SA 1UBHS 3E22B 1S7GA 4M0EA 3H40A 4K5QA 1O9GA 2G5CA 1UJMA 3URKA 2HCJB 2I71A 3A9UA 5FOWA 2GM5A 3SC2A 2XD9A 1A6SA 1Y80A 4OSOA 2G08A 3SNHA 1PJ2A 5D51S 5LB4A 1SUFA 4F5QA 4LVNA 1OT5A 5K3DA 1E6KA 4ED7A 1RJWA 2XB8A 2MYNA 3RBEA 5AI4A 3KCNA 4C87A 1D8TA 5FEMA 2PCLA 3NGMA 3T3NA 4OAPA 4RDXA 4X7BA 1ZD5A 2C2WA 3ZWBA 3C6YA 1N1EA 2ZAGA 1EB8A 3HRHA 1AE1A 2I54A 3MB5A 1QV9A 4AY2A 1E2UA 4YB8A 1ULTA 2PI4A 4L9AA 5AOVA 1HNWB 3GQVA 4Q12A 5AW6A 1AS2A 3OPYB 5A5EA 1E1NA 4FGZA 1VG1A 1QV7A 3FDXA 1SXJC 3N9IA 2NSLA 4H7DA 4JK3A 4ED8A 2NRWA 1KRPA 3ZIUA 2WF6A 3A2MA 5H83A 3Q87B 3QY9A 5JCOC 3G8CA 4DSUA 3BB1A 4ZTUB 3HS3A 1U4BA 3F5MA 3NWOA 2R96A 3F2BA 4AJHA 2Q07A 3TZCA 5HQJA 4QDJA 4DDHA 4KBYA 2WJJA 1ORRA 3JR3A 2EAMA 3SG0A 1OY1A 3NHWA 2AFHB 4M0UA 1AK9A 3RRYA 4LRUA 2RHHA 2NQ8A 2PSJA 3LQKA 4EB6B 3R7DA 4PQGA 1IU9A 3B3AA 2IDMA 5SY4A 4YT2A 1QDLB 1Q7BA 5BNWA 1X13A 3N7SC 4BTVA 3K92A 4KW7A 4GI7A 5JZOA 3FUCA 3SDBA 2P6UA 4LOIA 4RIFA 3T7TA 1XPJA 3ANNA 2BKUA 5ITVA 1VHDA 3K1AA 4RCYA 4TLEA 4PC6A 3UJBA 4LF5B 1XWLA 3F1KA 4N3AA 1ECJA 1LUAA 3HZRA 1QZ3A 3E84A 1BIFA 1U65A 3NC1C 4HNVA 1S77D 3TFQA 2YHIA 2WT9A 3FWYA 1BXZA 3MWLA 3BKWA 4ZO6A 3U4QA 2PZEA 1ECGA 2CLLB 4DCMA 3M6ZA 3KOUA 4BZZA 3LF1A 3PNKA 3V2GA 4D9HA 2JIZD 2OLEA 1RZ3A 1JKXA 2OC4A 1AB5A 3CNBA 3PC3A 4FDTA 4IQWA 2VH2A 4F5RA 1LH0A 2XXAB 4D0LB 1DWQA 4Q5IA 1EJBA 4B83A 1L7OA 2ZXUA 1T9AA 2GZRA 3D6VA 1TIPA 4X3PA 4TQAA 4UFPA 5C51B 5HUHA 4URHA 2H1HA 1HFJA 5K8TA 4Q7LA 4X62B 3SJCA 2LYAA 4CRXA 3BWYA 1Q3UA 1CUBA 1U3GA 4W9NA 3DKPA 1KVTA 3TQHA 4O0MA 1OB5A 1L7QA 4WNYA 1YDFA 1IY9A 4ZYXA 4TXHA 5AJVB 4OUDA 1KEZA 4CRWB 4G5OA 1HDOA 1PS0A 4ZRDA 4ZU1X 2ISCA 3U3RA 2AR0A 1ZS9A 1MOQA 1H3NA 4BMYA 2ISQA 1Y6GA 3BCHA 4YJ3A 3AUXA 1XG5A 1JFFA 3VBEA 2IEDA 4D25A 1HUOA 4M9GA 1HE1C 2ATXA 1U4OA 3CF6R 1K7XB 3B6MA 4A15A 1N75A 5DLEA 5A7GA 4RO0A 2I4NA 4XEHA 1IVNA 1RWBA 3H6KA 5F4BA 1UMDB 1B73A 3HCDA 3LUDA 5KU7A 1HPLA 5CA0F 3K8ZA 1MU0A 1ID8A 4OOFA 3KDPA 7ADHA 1OSNA 1NN1A 2AJCA 2JCGA 3PYXA 3UH0A 4QM6A 5BOLA 4QLAA 2HOQA 1Q3TA 3KQUA 4F1KA 3QX9A 2WPDD 1E7WA 4BYGA 3KLOA 4OIFA 3LUHA 1L7EA 3VYWA 2QY9A 3KZVA 2R00A 1Z56C 3Q4GA 2EHJA 1NPDA 1QSGA 1MX9A 4YAJA 3JRXA 2V7TA 2ZCVA 5T3YA 5AKHA 4YVZA 5KL8B 1O95D 3IS3A 3SQIA 1ILEA 1JKMA 1VJDA 1AK1A 3FTFA 5AIAA 2WIDA 3CLTD 3AY7A 1E2LA 4CQLA 2KK0A 1QV6A 4HXEB 5FR1A 3EXFA 4HJRA 4ZARA 3J81A 1WSDA 3LC2O 3HKBA 3JZDA 5J2CA 3DDWA 1DOQA 2X40A 2J3KA 1QZUA 4HS9A 4RCVA 1GPBA 2V97A 4RMIA 4LHSA 2P3OA 5L1MA 2HHXA 2AGVA 1JH8A 1C9YA 4JLOA 4LK2A 3UPUA 2HA3A 1J2RA 1KFDA 5J0UA 2XHZA 1G4AE 3HNRA 3QVGA 1ZL2A 2Z4RA 5J0WA 3VNVA 2O3TA 3W2IA 4I29A 2GJ4A 1N2BA 1T8YA 4N5HX 4G5GA 2IV3A 4LZGA 5E4FA 3FOEC 4ZHSA 3QWBA 2C9YA 3IXLA 3TQOA 1O0CA 2VDNB 2LDXA 3JQGB 1QIJA 3CZMA 3T99A 3RK0A 2PEZA 9ICHA 1ENPA 4EHBA 1J07A 5F3DA 3UTDA 1KI3A 4FWTA 1DEHA 3B70A 8ICTA 1LLQA 5E3HA 2ZRBA 1LBTA 2A9VA 2FZ5A 3RFTA 1FDUA 4XUGB 1B6SA 3TQIA 3TMAA 5D49A 4JA2A 2Q4DA 3M7DA 1EE2A 1GEGA 1QSLA 3O8OB 4MUMA 1FU4A 2OHGA 2IF2A 3T1VA 3ZHUA 1WQ3A 2ZDHA 1OMOA 4J1TC 1UZUA 3PDJA 3TI7A 4L3WA 1NI3A 2VZ0A 1XVVA 1E66A 1Z4OA 3D7MA 4RTNA 4XTRA 1P73A 2E8NA 1ADGA 2HDOA 5ED0A 1GQQA 1JQDA 4BMOB 5F1OA 1JR3E 4LUCA 3C97A 2GS9A 4NCAA 3WV4A 2JI4A 4GYKA 1NATA 5BPCA 1KAMA 2OUKA 5MN6A 4ZI2A 3IMEA 3FWKA 1XZDA 5ALPA 1QGUB 1PG0A 3R0IA 4YTEA 2R1VA 3V6KA 2G76A 2XA1A 3R3UA 4QJ4A 4UVHA 4REOA 1QP7A 4PZZA 3PHJA 1RWPA 5DG8A 3BHNA 1ORVA 3V8QA 3T52A 4G5XA 3H13A 1E3EA 4G0MA 3AYZB 3IT2A 1XC7A 2YWCA 3T7KA 4LF6B 4LTNA 4JL5A 1F3LA 4K0KB 2R2AA 3GLFE 2G83A 3ZXSA 3HDHA 2YC4C 3HFGA 3LAWA 4X00A 1OBHA 2PH1A 1QCYA 3LHDA 2RGXA 2ZS9A 8ICEA 2GAAA 1G19A 3EAQA 2QQFA 2MUTB 5AI5A 1QGAA 4L8WB 4LHEA 1Q1EA 5F35A 2UKDA 4KZKA 1L3SA 4LRQA 1R88A 4L6CA 1D7AA 2QJTA 3WK9A 5IVKA 3OZIA 1KGSA 3F5EA 3PITA 1YZYA 5JDCC 4R63A 2GM3A 4R1UA 1WG8A 2VA8A 3SSNA 2WKSA 5CDSA 4QTZA 1UMKA 2R6DA 2VT3A 1L4HA 1ZI6A 4FX2A 3AVYA 5HBRA 3G5TA 1KBUA 3GRZA 1WCWA 3BSYA 1TOAA 3MINA 5B66U 1QYWA 1RFGE 1R5BA 5EFOA 1OB2A 1NJ8A 1UUFA 1G6Q1 5DMXA 1DAKA 4B09A 4UMVA 3ADCA 2ZSJA 4K6GA 3TSZA 1Z7YA 2RCYA 3R9IA 4BYMA 5HZHA 4WNIA 1C9MA 1R27A 4KTVE 3ZXUB 1LI4A 3KDSE 3MNFA 4B3XA 1E5LA 3T5PA 2DETA 4Z3OA 5TQVA 3ZE8A 3NEJA 7ICMA 2FK8A 3SXUA 2HXGA 3VHLB 9ICOA 3SYMA 5L1IA 3H2YA 4LVCA 1DKOA 4HRVA 4D44A 4N48A 3CKYA 3KYBA 3X1MA 3ID6C 4F3NA 1K6MA 2FRXA 3W2EA 2Z1MA 2I4OA 3AOGA 1P3DA 1SXHA 4BASA 3BYZA 4QO7A 4H1WA 3LSTA 1Z73A 5AKIA 1RWKA 4L7VA 5E9WA 4LDJA 3QKSB 2NYRA 4AZWA 2ZXHA 3G2PA 4CUKA 3TZQA 4ZO7A 2C5SA 4JUCA 1XDGA 4KN5A 3D6UA 4IGFA 4JT4A 3L7MA 4G4JA 2ZWMA 1N78A 4P35A 1WPGA 5ECWA 3MN1A 2BFCA 4YK7A 2JG3A 1X14A 1LPNA 1GGFA 4F1JA 4Y2GA 2KOBA 4RADA 2I5HA 1JG7A 2WK1A 4PQYA 3OUUA 4OYHA 2OOKA 5JY1A 2JFQA 4EO4A 1OZGA 3FNBA 1SBQA 3KJHA 5SYNA 1ZUWA 2LMRA 4OGGA 2XMSA 1DHRA 3D7SA 4DCCA 3PKZA 2EU8A 3ICXA 3WIUA 3OQOA 4DARA 4Y6PA 5DQHA 1P0CA 3ESBA 1V1RA 4CLXA 9ICCA 2JLXA 1BX3A 1XKLA 2SICE 5GGYA 2H54A 5FJIA 4Q44A 3DOHA 4ECRA 4TTVA 1TVKA 5J59A 1MVOA 3VR6H 1GTRA 1Y42X 3T1NA 3ISJA 4FXPA 1EG7A 2D1YA 2WFLB 1XTBA 4E2FA 3LTEA 4B82A 3SJ7A 4IV8A 2AZ4A 5FD8A 3AEKA 1JWLA 1PWXA 3R8CA 1OW3B 2ERCA 1U7WA 3H17A 5JZ9A 3ITDA 1EFDN 4F5ZA 5KJ6A 4LYFA 1UC5B 4EENA 4FDMA 1YIOA 2X3FA 2GLTA 2EQAA 2QL6A 2PWBA 1HDCA 3KIPA 5JASA 3PX6A 2DPLA 3H84A 2IIPA 4BVGA 1G9XA 1IQRA 2QRZA 1QFZA 3H9EO 2PS1A 3UG7A 4KBGA 5LUBA 2ZP1A 1Z34A 5U4QA 1HEIA 1M76A 4RBNA 5LWQA 1M0WA 2Q6OA 2QTVA 4P98A 5FOQA 2HXYA 3Q8KA 1RI5A 1UAGA 5JD3A 1RQRA 4OYRA 4WJKB 4JYBA 4Y2XA 4JVOA 4QOIA 5IS2A 1DXHA 3KC2A 5DRYA 4QARA 1GTZA 4I4TF 5DULA 2WHPA 1AIPA 4LWZA 3VYRB 3TARA 2W4QA 2CEKA 3NM4A 2C2KA 1PJSA 1KRHA 4B6OA 1VA4A 3A9RA 4GICA 4EEZA 4HL6A 3T1TA 4UUBA 2VXOA 2J87A 4UEWA 1PSZA 1NA5A 4J0IA 1NUAA 3NH9A 1X94A 3GFQA 1M3SA 2CXUA 1G5RA 4RZ3A 1CVLA 3DKIA 1SUIA 3FKJA 2PT5A 5E1MA 3MBOA 3FMGA 3KYDA 3PE4A 1OAAA 3BRCA 5HCIA 1EXVA 5KFZA 3ICEA 4KLFA 2M6RA 3UPQA 3KAKA 4AJEA 4E94A 4DR4B 1IBKB 5BOVA 4XXHA 2NUTA 2ZRGA 2PU5A 5EJ8A 5A6VA 1JHQA 1JS1X 3ANLA 4M0DA 1UPBA 2GTPA 3LHKA 3N2GB 3NATA 3FTDA 1PEKE 3DVQX 4NPCA 3QEMB 4KK4A 3DL0A 1T9HA 5LXTF 1RRVA 2XC9A 2EBWA 3K0CC 1NF3A 4BMSA 1IIBA 4F2RA 1U2EA 1JSXA 1K75A 4MYCA 3EK2A 2CVQA 3O31A 1NMYA 4P7KA 2KJ9A 1WV0A 4W63A 4EFMA 1EK6A 4MRVA 3UHFA 4AKHA 3KVNA 3TW8B 2H3HA 1EDOA 3SF8A 4LYHA 1N4AA 4FCWA 4LJLA 3HUFA 5ELMA 1ZJYA 3G2QA 1X8JA 3UXNA 2FTKE 1Z62A 2LWIA 4WRRA 4RNNA 1AY0A 3NONA 3CVWA 1GM5A 1IBSA 3H87A 2YJNA 4JSRA 3RV3A 3D31A 3ZDZB 4LDPA 1FXWF 2X0FA 2PGIA 1V3UA 1V11B 2YFYA 1BDJA 3VMFA 1SGGA 1QP0A 1D7OA 5FBVB 3W1EA 1NF8A 2BL4A 2WWTA 1US8A 5B1DA 3KB1A 5KREA 2YHAA 2PL5A 1EBFA 3P2YA 1KNQA 1PV2A 4FIDA 1UBJS 4GSLA 5EAIA 4WFKA 2W4MA 3E7PA 4Q6BA 1G7RA 3TOCA 3DVAA 1DAMA 4OJKA 1Z45A 3LA6A 5M04A 1W7AA 4OK3A 4UNIA 4R2IA 4ND7A 3FVWA 1YL7A 2WWGA 4J0KA 1FDWA 4PBTA 1O6BA 3R5KA 1T3NA 4C6TA 1QYCA 4RA6B 2HW3A 1ZK3A 4D81A 4TTQA 5JE8A 2VXCA 1YOBA 5IIOA 5LQJA 4YXJA 4PG6A 3LECA 1UPAA 4DV2B 2E9SA 1TW2A 4RY0A 1K0UA 5D7NA 2W04A 2C2HA 1YBHA 4ROSA 2GAFA 4O5OA 4R8MA 4Y18A 4URUR 1YDMA 3H3XA 2Y1IA 1G2IA 3L0CA 3TSYA 2I9GA 1Q1AA 4LGMA 2IX3A 1WAMA 1CUSA 5MDHA 2EIHA 5ICGA 2F8SA 1SK8A 1DPFA 3A32A 2GZ2A 5TF0A 4E3WA 4DCUA 1N2SA 3UKDA 3DOFA 5EPEA 2XD4A 2K4IA 2UZ0A 3RVBA 2BM0A 3IURA 4IEIA 1OU0A 4L4ZA 5EYPB 1X19A 2WWIA 2XKJE 4PG5A 4EYIB 1I33A 2A7XA 1CXZA 5B6IA 2QMEA 4QULA 1NZFA 5KTNA 3I01M 2BOVA 1XZIA 2WJIA 2HF9A 4KO8A 4CNQA 1UJCA 2I4RA 1C7IA 4I2FA 4PR3A 4US2R 2QE6A 4IQUA 8ICIA 2R68A 1GGMA 1KW4A 3ICQB 3PEYA 1R4NA 2YCBA 1L6RA 3N59A 2I4MA 2IZ5A 1I4EB 1IVYA 3I4LA 3L8MA 3L1VA 4EJSC 2W9CA 4AKGA 1SUPA 5A3SA 1YAHA 1MIOB 1FS5A 1X38A 4ELVA 1KI6B 3E9NA 1GL3A 2HWUA 3QUSA 2OGZA 3JPTA 4JV2A 3DM5A 5EPOA 4U7TB 1IRXA 4PCAA 3V4RA 2KIWA 3MGGA 5KFQA 5E9AA 1UEXC 1K98A 3W5BA 5BYKA 2ONZA 4GX2A 2CE7A 3REQB 3RGGA 2GOLA 3WBKA 3FGNA 1IL0A 2EIXA 2WAQC 4MEAA 6YASA 2ZWIA 2JFGA 1G55A 1IJFA 1P1IA 1JDZA 3KQWA 3IIMA 4LJKA 3CGGA 3GRRA 2H1LA 2AXPA 2GTIA 2DZDA 1II0A 3NO4A 3DMPA 3DV0A 2F8MA 4WJZA 1E5QA 4FYKA 1N2GA 4XB1A 4RJ2A 1Y89A 3AESA 1F0KA 4RZIA 1X1BA 4HXFB 4F9EA 4A36A 5BW5A 7ICJA 2H2DA 5KAFU 4CWAA 3CT4A 4CEHB 2LNDA 1ATZA 5U1PA 3LJKA 4AN1A 5AW5A 1VJ0A 4QYXA 3LH5A 5FLKA 2QTGA 1OX4B 4X71A 1YB1A 3B1FA 3R3YA 5HK9A 2DY0A 4XARA 5EHXA 2EGHA 4JHLA 2CSUA 4HRYA 4EJ0A 1VIVA 1P91A 5IWAB 5KT3A 6REQA 1W75A 4CMJA 2H4XA 1LV8A 3GLTA 2Q49A 2Z1DA 2I6FA 2AW3A 3T79A 4MUAA 4O2BB 4JZYA 3LWLA 3K75D 4EKDA 4FYMA 1J1ZA 5G0WA 3D6JA 4DXDA 3R9KA 2UDPA 4OQYA 1L5UA 5AOAA 2G9NA 9LDTA 1DSSG 4LF9B 2ZIXA 4OKNA 2X0RA 3PJRA 3DTVA 4C3VA 1CU1A 5J40A 1DC5A 3EUWA 1SXQA 3PKIA 2WWFA 3V7NA 3RTBA 4R7TA 1A8HA 1LZKA 3HYSA 3IQWA 4ME6A 1CJKC 1Q0QA 4D41A 3KYCA 1RYFA 1TRHA 3QFRA 1RYMA 4REQA 1E1MA 1KMHB 3FWZA 4P34A 4D6YA 4YRNA 1A76A 2VWQA 1OLXA 2Q3DA 1HNXB 2HJ9A 2XY7A 4JQZA 1XAJA 4KLNA 4CNBA 1N5KA 1T5OA 1JMVA 1TTPB 3TZEA 1HYGA 5DIZA 4P5EA 2YASA 2BFFA 4EUEA 3A6PC 2HSDA 6ABPA 1ZNQO 4Q9NA 5AVZA 3JWEA 2W6ID 3E8MA 3H7IA 2C98A 2W71A 4C76A 2O48X 4HNQA 2F9MA 3ETDA 4JDUA 1GZSA 1A1VA 5EWGA 5KNDD 4DLUA 4DC0A 3TQTA 3IAM1 1PNTA 1JDTA 2CDAA 4HF7A 2V7WA 1RRFA 4OA5A 3JPRA 4FFMA 4Q9IA 4X1OA 4XPIB 2Q99A 5TT0A 2Q5OA 2F48A 9ICAA 2CMGA 2HU5A 4BJ5A 4TT8A 3IIKA 1MPTA 3HUEA 3CW2A 1SUDA 1GZVA 5DYNA 2JJMA 2QENA 3MXOA 1V2HE 4GO1A 5TDHA 1I4DD 2WSIA 3SI8A 1W94A 4G4IA 3RTAA 3A6FA 4Z99A 3ZYCA 4QWCA 3HYTA 2ZQYA 3VR5H 3ON5A 2WKPA 4LQDA 5BQFA 1NDHA 3EIHA 1VE7A 4HLNA 4AG3A 2XB6A 3RLFA 1BJRE 3EZFA 3LBFA 3Q8SB 4FZJA 1KZ4A 3R6LA 4G67A 3EF1A 2Q4OA 4MPTA 4V0MA 4RLHA 4J0DA 5LBTA 4RVDA 2WJPA 4YFYA 4BLSA 4DLLA 1JUDA 1UXIA 2NACA 3CEAA 1DARA 1NP6A 3AI7A 5CNJA 4WDQA 5DM60 5CA0B 2G80A 3D5EA 4CM6A 4P3XA 2G71A 2O3JA 3KTOA 4RJJA 5IT9A 4K40A 2KQUA 2OPBA 2X9QA 4N8DA 1QHEA 4UXHA 2F1IA 3A05A 4EF5A 3OZBA 3UMFA 5L9AA 1K7EB 2KS6A 3F4LA 3ZVRA 3C8MA 2Y92A 4F4UA 1XR3A 4DNFA 1U49A 2CC2A 3WLPA 2KG5A 2Y1OA 1TUEA 2DQYA 4N8SA 2CNNA 2GI4A 5DGTA 3MTIA 3A3OA 2K2QB 4HB0A 2C5AA 3IR6A 2XT9A 3EPHA 2IYEA 2RKBA 2C4KA 3K32A 2BDUA 4Q39A 1NE7A 2WFAA 2FSVA 3H18A 3S2ZA 4ECEA 4KLQA 5KOJB 2VJ4A 2EVWX 1PFKA 4DLSA 4ASUD 4GSKA 3L4SO 1IATA 1SU7A 4KNWA 5IM5A 2Z8YA 3OQ1A 4JUDX 4KPGA 3LVVA 3T7SA 4O3MA 2O2CA 5BV2P 2IUEA 5LQNA 5FBKA 3D4BA 1CJVC 1UL1X 2EWWA 4WACA 4GT1A 3AF3A 3DXZA 4AKTA 2WMOB 2DG2A 1GNSA 1DJLA 3GX1A 2ZUUA 1T2AA 2FW9A 2QLJA 3RJ9A 2ZSAA 3C2LA 1NBOA 4XUEA 2C22A 3HL4A 3LW7A 3P2IA 2Y27A 2FFRA 3TXYA 4IHAA 3DLTA 3IPYA 3I5XA 4WOBA 1Z9BA 3HCOA 3HKEB 1LSUA 3L7NA 3RVKA 2V6JA 4D4KA 4N3BA 5SYMA 4YASA 1SUSA 4HAZA 1NN3A 3FB4A 5LJLA 4RS3A 1SG0A 5ALRA 2R65A 1Z83A 2RJNA 3UMGA 3VYSB 2IL1A 4RTQA 1A3CA 4OKSA 5TISU 4W5TA 3ER9A 1NF2A 1ELOA 2PFQA 1OKKD 2FSGA 2QX9A 1ZUNA 4RHTA 3UUGA 3PP8A 2X2EA 3MQ2A 4UB2A 4MVJE 5DT9A 2UVUA 1Y6QA 1GFZA 3D5QA 4JJ8A 3SYNA 3IAAA 4YUYA 1KI1A 1G18A 4PAWA 3VKFA 3IV7A 2ID9A 2A1JA 2QTNA 1GAQA 1KMQA 2W3RA 3IVRA 1YI8A 4E03A 2DUWA 2XRYA 5DXFA 4DZZA 3UAWA 4EG0A 4RPGA 3F9RA 1NRJB 4ISBA 1YRYE 4DAOA 5E0KB 3NS7A 1NKTA 2AQ4A 4YJHB 2YINC 2W2QA 4YD2A 4EBCA 4G0YA 3ZGXA 1SOVA 5CR0A 3UT5A 1AM4D 3UGTA 3OJOA 5E7JA 2YYYA 2XY4A 2O3QA 2OWOA 4RNCA 2G0TA 3DD5A 1H4TA 4BWGA 3TZLA 2BJVA 4Y6QA 3HXOA 1PVOA 4K9NA 2ZRHA 3EASA 3U61B 3D64A 3H4TA 5KTQA 1EX1A 1H9CA 3ZTWA 1QH9A 1R15A 3UY4A 1YDHA 1PUXA 1SBNE 3OPVA 2P3SA 3ZCQA 1USIA 3V1UA 2OESA 3F0TA 1H1LB 2JGFA 3SBXA 5EERA 4LDNA 1JMSA 3OM1A 2ZAIA 3KAPA 3F73A 4QUEA 3HNPA 3ALRA 3BRSA 3HXMA 1XRSB 821PA 4LJAA 1O6CA 2AW5A 1CR6A 3V34A 2J5RA 3BWMA 4KZPA 3UA3A 4RIHA 3ASZA 4UJ5A 5JISA 2RC5A 4HVTA 1UT5A 3I9NA 1NLZA 1YA6A 2YUIA 3WWZA 4D9NA 4TUPA 1F12A 4MMZB 2IWRA 5KQPA 2DLDA 2Y1GA 1TJNA 1YBVA 3QWFA 3GUCA 4LV5B 1RLIA 3RYHA 5U9CA 3GPBA 4RVNA 3H19A 4DSOA 1PUJA 1S7CA 2HMXA 3SEZA 4RD1A 5KU1A 2AN9A 4IAOA 4XYEA 4I50A 4V24A 3TD9A 3B6IA 3OEHD 4HDRB 1HYEA 2FW0A 4FTWA 4PANA 1BD3A 3GJSA 4D9BA 1DWUA 5FPHA 1QYXA 2NU6A 4ZD6A 6ADHA 1RVV1 4PFQA 2WW8A 3CXUA 3UHAA 4DBZA 3FF4A 3GRUA 4P4LA 3JZMA 3ROZA 4G25A 4OJTA 3RB6A 3ZQUA 1DTWB 2JGLA 2FZVA 3PR1A 3RKRA 1IN6A 3LCCA 1MB3A 3KT8A 2O4CA 1T3LA 3TNLA 5MN5A 4Y1RB 2R60A 2GEFA 1QRUA 4ENTA 1LC0A 4UQOA 2AZDA 4YRMA 2OP0A 1ZICA 1V5IA 4GMDA 3TSCA 4Q4JA 4JJFA 3O95A 1EM8A 2HO4A 2RGYA 3U3KA 4AIIA 1RPTA 3D0KA 4EFLA 4FB5A 4M8IA 4GWKA 2EYUA 5G40A 5F7OA 1TZJA 1VSVA 5D7BA 4NEHB 1WZCA 4EKIA 3AB7A 2ZJ2A 3RJEA 4WGGA 1Q21A 5DBBA 3MBKA 1F4LA 4L51A 4FUQA 4GDMA 4WXPA 4CKWA 2WJ6A 2FUKA 5FWXA 5HTOA 1ZP6A 1QMGA 2DBVO 1KJQA 1PNOA 4DLEA 2YYSA 3HHEA 1OC2A 4O3RA 2O8CA 2BPGA 1L5MA 2UZ4A 3BDVA 3TIIA 5B7PA 3L4BC 2M6SA 3TAHA 1B0ZA 4QL3A 3DA8A 2QF7A 4UOEA 3RG8A 4IDFA 5JW6A 1VCIA 3G2KA 2CXQA 5KKNB 1ZD1A 5KOHA 4ECZA 1KJJA 1H0HA 1RBQA 2EFHB 2NRTA 1GA4A 2D74A 1ZUD1 1RM6C 4QHSA 2GXUA 1CUJA 1M54A 5AUNB 1N6NA 2YC2C 2P27A 3EGWA 3NV9A 1RXUA 3MDAA 3SE0A 1SHJA 3BQMB 4A03A 2JR5A 3GJXC 4I1OA 1H6DA 3ZVLA 3ZE2B 2XDAA 3HR7A 1DUVG 3LKVA 5DEIA 1FYFA 2B37A 3PC8A 2PUGA 5JU5A 1RHJA 1RLUA 2WSLA 2R4TA 5P21A 3VTFA 1K3UB 2BFDB 4JQCA 3CA8A 4XQGA 5HJ2A 2XCAA 1GPYA 2HEIA 3ZUGA 3ZKWB 3ZS8A 2VDJA 3BH7A 1QAQA 1EUDA 4REMA 2A59A 6LDHA 4ARIA 5D1HA 3E48A 1TU4A 3RB0A 4MUHA 4JXKA 3IIIA 4HZUB 2OQRA 3NWJA 1XZLA 2O4UX 1ZLYA 3GR6A 2FEWB 2AEFA 1AHNA 3RSHA 1W6RA 2GNAA 2BSQA 3SX0A 1GQOA 2XODA 4KODA 2ILVA 3EDYA 5B1IA 1O3YA 4Q9LA 1ZGZA 3LQRA 3N8DA 4F4KA 2KZ3A 1ZSNA 4LHXA 2LKYA 4INJA 4QGAA 3KWMA 5DSXA 3LS2A 1PW5A 2QARA 4M1ZA 1PWZA 4I9UA 2P7HA 2VF8A 1IZZA 1D9XA 1MTZA 2XADA 3VR4H 5LFAA 2XRFA 4JBWA 1IM2A 2VQDA 5CT4A 1JHOA 1SN7A 1ZNXA 4RD0A 1VSUA 2GZ3A 3VKHA 4JX9A 2YWFA 5BXYA 3B1YA 1FTGA 1HQCA 1XL1A 1POXA 2W3SA 3CR3C 4CKBA 3WIBA 2NPIA 3TQRA 3KEOA 1XPOA 1JQJC 3W8RA 5TPWA 1X7XB 4JGGA 4CM9A 3G82C 3JD4A 2JS7A 5A3QA 4NQZA 4LZZA 5IK2A 5CLFA 1JKJA 1B8PA 2Q6IA 4I2IA 4I4TB 1EP2B 4FOTA 5DHPA 7ICHA 5L7TA 2JGIA 2P75A 1YZ7A 4N3NA 1T2NA 5KFFA 3DUWA 2VPQA 4XLTA 4FLEA 3WFZA 1J2YA 3E2EA 2ZYHA 3EZGA 4R5MA 4OXXA 1Z63A 4FE3A 1VBMA 1GGVA 4L0CA 2I99A 1R0YA 3TD2A 3QENA 4ER7A 2HFKA 4WBNF 2I2BA 2DBQA 3F8TA 3KHSA 1TZKA 2C3UA 4MZDA 3NVWA 3FCXA 5DTRA 3LG2A 3IPAA 1NWCA 2V6IA 4PFKA 5IJ0A 1XNGA 3CRVA 1OA0A 1U3CA 5CM2Z 3DFUA 4PLVA 4MW7A 1BHSA 1L3TA 3ANMA 3ML1A 2PVSA 3WGQA 4IYJA 1K8RA 3M7IA 5LXTB 1T9KA 3BQ1A 1V9SA 1ZJ6A 4JSYA 3LLCA 8ICLA 1ZEJA 1N0WA 4TVKA 4EUHA 4FZ3A 3B36A 1VGRA 3WHPA 3QBJA 3BVPA 2K4MA 1USGA 4KX5A 4ZKDA 5DO9A 1O94A 1T3ZA 5LZ8A 3WYCA 1M2KA 2F1HA 2AS0A 3JR7A 3IEXA 5BMVA 1ADFA 2OUIA 3P97A 3HZOA 4BDSA 2AMLA 2ETXA 2XE6A 5M5BA 4XI9A 2QM3A 4QUHA 2R66A 4USAA 1XXHB 4H7HA 3UK0A 4D82A 4HYYA 1E2KA 1EE1A 1DIAA 3HPQA 3MWJA 2RKWA 4KOAA 3U44A 5I8WA 8MHTA 2GEJA 4OATA 1GYPA 2NMVA 3EQ2A 4C3OB 5CFRA 1WKVA 4DBLE 1DXQA 3NRJA 3G1TA 2UV8A 3A31A 3TQFA 1ZVVA 3HCCA 4EO7A 4G0PA 4DEYA 4FS2A 4DCNA 4RABA 3FTCA 5TMEA 4MR9A 1OFIA 2YH2A 5KYXA 4WZBE 5B58C 5CVVA 4JODA 4E30A 3R5TA 4X20A 1EVKA 4W8HA 5DHTA 4Y8VA 3M6AA 4JI5B 1Y3FE 1KK2A 4O2BF 1G6KA 4RHCA 1HR0B 3PNOA 2BD0A 3EOZA 2PLWA 1NY6A 2XNSA 2DAPA 5DBHX 2VYNA 3GJ8A 1R6TA 2O8DB 2PZFA 4AMZA 3SAGA 4K26A 3AHJA 2O7NA 2O2ZA 1XBTA 3DHVA 1XO0A 2IV7A 4RQ6A 2Y66A 1RADA 1W85B 1Y63A 5K05A 4MP8A 2DQSA 2ECPA 2D2EA 5CP2A 4J0HA 4QYSA 3F6YA 2P9BA 4R4JA 1LC3A 1P0IA 2AMYA 2BFEA 3AQIA 3IQDB 3NAZA 3AJ8A 1RKUA 1H2YA 3PFNA 4IJQA 3GAFA 4AKSA 5DGXA 3L1KA 1MCZA 5EIBD 3IUNA 1M34A 5AHOA 3KG2A 4YV7A 5EQTA 4I2GA 1YR3A 3AU8A 5THKA 1E96A 2H06A 4LFCB 4IOKA 2YV2A 2PR7A 5ILGA 1IIRA 1YB5A 3V3TA 3KWFA 3OI7A 3QVTA 5JRTA 1QVWA 4M6WB 2G04A 1SBCA 3TLBA 2RDMA 1QCCA 2X5NA 4B4OA 1M6EX 4ZWNA 2D00A 2QUZA 4KFTA 4IIHA 3DLBA 4Z8YA 2D5BA 3RK1A 4F4ZA 4KVZA 3AHCA 3W8NA 4YDQA 4C05A 3H0EA 1VJ1A 1NUTA 5KT7A 1PKXA 3GAAA 3UAXA 5K4GA 3DE3X 3I8XA 4F12A 1NBMA 3GWZA 4XYMA 2VUUA 4E07A 3O91A 2FMPA 1XMSA 1L5OA 3OJUA 1NI4A 4X85A 5GIOE 1XLTC 4GG1A 5LD2C 3PXCX 4KDCA 3BFKA 4D2IA 2XVTA 3VH2A 1VL0A 2AVNA 3Q8RB 3FTNA 4DA8A 4A6DA 2UYGA 2I4IA 4DPLA 4ZKEA 1TK8A 4B33A 2NUAA 4AKEA 4YCSA 1JLLB 4IILA 3B52X 3QKRB 3NTXA 4B9LA 1U0FA 3TFSA 1JBEA 1PZXA 5KQMA 1K63A 4GI2A 4M88A 3DE1X 1RXWA 2AZXA 4KVFA 3EG5A 3AV3A 1DBWA 3IA7A 1EGMB 2ZW9A 3A9VA 4HI0E 4FE7A 2JLVA 2GZ1A 1T9ZA 3LY5A 3CNQS 1N2XA 5TPZA 5IIJA 3W2TA 1J5PA 2P4EA 2Q5EA 4P3PA 2ZJ1A 4WKNA 1LLUA 4UTVA 7ICKA 4BWFB 1WHTB 1FCJA 3ANSA 3WL3A 3BM5A 4R9NA 4Z4CA 2VZ8A 1CQXA 1Y81A 2A9FA 1JU3A 1DOAA 2ZBPA 1UK6A 3G5UA 1VRWA 3T41A 1FNBA 3JATA 3WWOA 4AY6A 2R5FA 4EITA 1AQUA 1T6YA 4C1NA 3GD7A 3ZHYA 2QJRA 5ARDA 5HDQA 1X86B 1E3DA 3STUA 3KEQA 3C5WP 4EMBA 3C8HA 3QVXA 4O6VA 1JNYA 1WKBA 4GBJA 3CSSA 4X1IB 4I5EA 3GG2A 1SCNE 3LX6A 4CTKA 4MWBA 3C6XA 3QEJA 1PFYA 3COJA 1IPEA 3GC6A 3ABOB 1PDWA 2VDWA 1G98A 3KEMA 4N1AA 4YR3A 2KSQA 3TJZA 1A9SA 4Z6EA 3T15A 3C5FA 1QO0A 4ZVNA 1ENOA 4MJLA 1DAFA 3JWIA 1QLHA 3H1GA 1ISRA 1VYVA 1M9NA 1NR5A 1HT2E 5JPCA 1C9NA 2ODNA 4PEVA 3SQDA 2ASLA 2X6TA 5DVZA 3WZLA 5HYVA 3N2ZB 4IIVA 3K2QA 1RLMA 2CLEB 4ARAA 5A4KA 5J2UF 4B85A 4DMFA 1CYEA 2WJ4A 2R8RA 4OIMA 3V8BA 3HRKA 5KTKA 5C2JB 1VQ1A 1GCOA 1IBMB 4NZMA 2NO6A 4GPTA 1ZEMA 3FKSA 5IJWA 1Z22A 3U1BA 2P0YA 2HJWA 3GLHB 2AFRA 1ZA1A 4K8RB 5HF9A 1I1HA 5FO0A 3S44A 1JT2A 3EZNA 3ACBA 3EAFA 4I0WB 2GKGA 2C8JA 3RLIA 4BUGA 4BLUA 1YDWA 1M0TA 4HMQA 4UTOA 8GPBA 3IAFA 5AVVA 3ZW7A 3F74A 1D2EA 4RFSB 1WU8A 5FTKA 3K8OE 1UZAA 3T5AA 5ECDA 5CDFE 4G41A 3W3AH 4UJ3A 2PGJA 4M38A 4ZV7A 3A0BU 3BRWA 3MTQA 2Y99A 1TAMA 2PVCA 3P2OA 2BFOA 4TMKA 4OXYA 2XF8A 3BA6A 3UAZA 1DMSA 1ARZA 2BEUB 1G5TA 1N77A 4PGQA 4X93A 2L82A 2OV6A 5HJ7A 2QSJA 4XB6B 3FSRA 5CM9C 4P0QB 1CUVA 1M2JA 1TK9A 4GMHA 4CF4A 3WGGA 4XIGS 5J4LA 1J70A 3N76A 2REXB 4BQNA 3KTAA 1EP3B 4OGKA 2ID8A 5HR6A 2HJSA 3QNMA 1UJ6A 1KZYC 4IS3A 4Q9HA 1IXZA 2PUVA 1KVSA 1MH9A 4DQXA 1W5EA 3RB3A 5KTTA 5EUBA 9ICRA 3I9OA 3GOQA 3R5FA 1RYDA 5TEVA 4HUJA 4A2QA 3KHLA 3PFWO 1UBOS 5PNTA 3JWHA 4C7JA 1VLZA 2Q3CA 1EK2A 2XY6A 4YP0A 4DLPA 4GAEA 4OLJA 5JHHB 4JXJA 5DV9A 5KYUB 4B8YA 4JOCA 2RGWA 4NIMA 3EFOA 4PO3X 2YRWA 2FY8A 5F9FA 3E9MA 1OLOA 2VTVA 3LUAA 4MQUA 4WNAA 4QGSA 1TEZA 2JFHA 1CY2A 4LSMA 2HR1A 3D4PA 4PTLA 3LU1A 3GEMA 3V9AA 5IBQA 3QE0A 1D04A 1VXRA 1L7BA 5K0NA 3UXHA 3G88A 2G3YA 4QDXA 3JPSA 1TM2A 3P9IA 2IEYA 3AN1A 2PKQP 1Z00B 2Z3WA 3DUFA 3NYRA 4RMJA 2M6LA 1QQBA 1I9GA 5FBQB 2Q3JA 3A26A 5LBUA 4M76B 4MVJM 5CFNA 2AD5A 3GI1A 3KQQA 5GPBA 4UUNA 3VKWA 1LBEA 3WG9A 5IJZA 1I5RA 1I6KA 4WE3A 2Z09A 1N0VC 4O2AA 1WCYA 3G8AA 3ZWXA 3UMMA 4YIHA 1WD5A 1OH5A 1Z08A 1JEYB 4INPA 4GVLA 4NJ8A 5FP0A 5LB2A 2BT4A 1MN6A 1NYQA 2OCEA 4G1UC 5DHSA 3U31A 3LDGA 2XT6A 2J09A 1V7CA 5TGDA 2NM0A 1DRGA 1NNLA 4MNTA 1Z06A 5JSZB 4NRDA 1XHEA 1XU9A 5LKAA 2I6TA 2CJXA 2A1UB 5EWEA 1DBSA 1BKSB 1R10A 2IUUA 5AICA 4MW0A 5EHQA 5CYFA 2YQ4A 4IEFB 3P71T 4AT1A 2UZIR 1PEDA 5G0SA 4DYDA 3RH6A 4M9HA 2ZS8A 2WAYA 4BNIA 3JY6A 2ZUTA 3I8SA 4KX3A 2YB4A 1VGQA 1NAIA 1SV0A 4GYYA 3K9CA 2OFPA 1EQAA 2QAGC 3RSQA 4N03A 2AN3A 4QXPA 2JDID 6PFKA 3IUBA 4ZMBA 2VJMA 2Y05A 2QZSA 1JXAA 4NHEA 1ULSA 2E55A 4G5RA 3QE9Y 1VG0B 1VP9A 1W34A 2JF0A 1NHWA 4QZCA 5A0VA 4A8JC 3PZRA 1WX1A 1M8JA 4B43A 3HU2A 1BE8A 2GILA 2BDPA 1Q15A 1TPZA 2KD1A 4RVFA 5GM2A 1JFRA 4TTRA 4OPMA 1PZGA 2JHPA 4YRDA 2RSLA 4DCJA 3B6KA 5BPFA 2FW8A 2IYZA 4ABTA 3I83A 3ZWMA 2X15A 2MOKA 3V8VA 4OL9A 1MRZA 4R68A 4JLVA 1R3UA 4DANA 4V0NA 3V00A 3C8DA 5IH3A 3AVWA 3HSKA 1T5SA 5K8JB 3DZFA 1P75A 2WPNA 4JLBA 4Q0MA 3KJEA 1ZQJA 2KJQA 3TWOA 2UVQA 3ETGA 8ICUA 2Y9MB 5BN3A 4MQ5A 2PFKA 3FPLA 3OAAA 5KG2A 3EDMA 5CHEA 3VPAA 1UEIA 1K6EA 2K2WA 2ZKLA 3NBYC 4R0NA 1JAIA 4IM7A 2XH8A 1HZZC 2BBWA 3L0OA 2Z9BA 3CCFA 3CS3A 2ZVJA 3L02A 4OXRA 3K71B 4CM8B 4I2EA 4HADA 1LDYA 1Z6XA 5BNTA 3AM5A 4DLBA 4L08A 1DLIA 3SHFA 3RAEC 2HSWA 4HMPA 4UMFA 2YIVX 1SKQA 1LPMA 1H0KA 3S2SA 3DAPA 4LV6A 4I9NA 4KUEA 2QTHA 4YJFA 1P61B 1JEAA 1B14A 4MKXA 2P9QA 4PXAA 2DSNA 1UZMA 3NYIA 4YGXB 4GVXA 1I4WA 1GQSA 4XQ0A 5KQLA 3V6HA 2I1LA 3ZHXA 3LXRA 5KFMA 3J7AC 4OHXA 3T7IA 4OYLA 1RLJA 3K5IA 3TX2A 1EWRA 2FNAA 3TADC 1N3YA 3PVSA 5FOTA 4Z2AA 3NU1A 3MJEA 1UJ2A 5D3MB 5CBPA 2PUJA 3CZRA 4MH0R 1SUWA 3D3JA 3KPVA 1W25A 3V8MA 1ADBA 3NVKI 3BTSA 2FP4B 4Q05A 1M2HA 1G3RA 2W2VA 2SECE 4YD1A 1RJDA 4CLRA 3OF3A 4J1QA 4ZDIA 4ZT3A 3WTBA 4KFCA 2J48A 1OCEA 5CB4F 3H5AA 4LMPA 3C70A 2VWHA 3P0HA 1DAIA 1KC1A 3TVTA 2PQMA 2PCJA 1KZGB 4EEYA 3Q1LA 4QU9A 1D2RA 1QB8A 1E69A 1MB9A 3SOZA 3A2LA 3ROQA 5KYYA 5EOZA 5CDYA 3CHYA 3QFTA 3DXFA 2M0NA 4FCTA 3DOUA 1QE5A 2QMHA 3WRWA 3PT5A 3V9PA 4I46A 4UFOA 1J39A 2BKVA 1QH8B 1R4ZA 4DJAA 4GVPA 1Y3HA 1B3RA 1RYHA 1EFPB 2C4HA 4OFWA 1KN5A 2WQ7A 3GLKA 2ZOSA 4WK0B 2B4RO 1WWVA 2C7QA 3AM1A 2V4UA 3ZPXA 1QH1A 1OGJA 2PXCA 1MB0A 3RIEA 2P9TA 3GHYA 2Z43A 1B74A 3LKDA 2WUVA 3WYDA 3L8EA 2WLSA 1T1JA 2FR0A 5ALTA 4DJEC 1DELA 3RFAA 2BP7B 1ZQVA 3L7KA 4A1FA 1LPBB 5G0UA 2AXTU 2DEUA 3AF2A 3ZHTA 5CW1A 1PEYA 4U6SA 2PLRA 1QB7A 2ZI4A 5KB3A 1AN0A 3GLSA 5J63A 1L9XA 3M4ZA 1XQ6A 5KT5A 1F8GA 2GJSA 4EX6A 4IH4A 4Z4QA 5D01A 3MTBA 2JI6A 1C7RA 1V16B 1KBQA 2ERXA 3A9CA 4TWIA 2PUFA 4D8YA 2ZTEA 3ZHZA 2V4QA 3V6LA 1K6XA 3PD7A 4WECA 4YP1A 3WNBA 2FQWA 4W4TA 1DX9A 2HUPA 4U6NA 3N97B 3RJGA 1UF9A 4FT4A 3G6WA 1PHRA 3ZHBA 1P3Y1 4PRZA 2FPIA 2Q45A 3ZWQA 2A94A 1ECWA 3KXDA 3SJAA 1NVUQ 4DRXA 2AE2A 1LPSA 4FN5A 2UVWA 2R4QA 3FB1A 5FL7A 1ABBA 4OL0A 3JD3A 5BT9A 2D7CA 4YNBA 5E3JA 3ILSA 5H4GA 3FAZA 4G1CA 1TKDA 2ZJBA 1RHMA 3NHBA 1I7PA 4JLMA 2IDKA 4GP9A 4B17A 1G5FA 3CN7A 4HQLA 3F9IA 4L5CA 5I45A 4V39A 1JSZA 2QUJA 2ZUVA 4HX9A 1MDBA 5AM4A 2C95A 5FPKA 1XJ5A 4IO0A 3EIOA 2JHFA 1XJCA 4WW0A 1POWA 4Q19A 1C8BA 4U00A 1K5DA 3OEYA 3QVOA 4XRRA 4CHTA 4Y6OA 1I3OA 3FPEA 2QJWA 1ZU4A 1WEKA 1YB2A 3UFXA 1B22A 1K68A 1E4YA