2YMPA

Chloroacetic acid complex bound l-haloacid dehalogenase from a rhodobacteraceae family bacterium
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
225
structure length
224
Chain Sequence
SGILVFVNETLLDLTSLSPLFERVFGDAKVLREWFPELILYSQTLTLTGLYRPFGEIAAAVFEMVAANHQAKVTPDDIAELKTRLTSMPAYPDVAPALTRLQDAGFRLVTLTNSAPSPAPSPLEKAGIASFFEAHLTVHSSQRFKPHPSVYDSTAETLGAKPEELCMIACHIWDTIGAQARGWRGGFVARPHNTPLTLAEVPQPDFIGRDMGELADQLIASLTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords L-HALOACID DEHALOGENASE
publication title Marine Rhodobacteraceae L-Haloacid Dehalogenase Contains a Novel His/Glu Dyad that Could Activate the Catalytic Water.
pubmed doi rcsb
source organism Rhodobacteraceae
total genus 86
structure length 224
sequence length 225
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2ympA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2ympA01
3MMZA 2JAWA 4FFDA 3L8FA 3R09A 3U19A 3QGMA 1RC8A 2P69A 5AKEA 4CE6A 3EF0A 1VJ5A 3ZX5A 1YMQA 4RESA 4UM7A 3DDHA 3OCVA 3ZI4A 2JAUA 3L8GA 2WFAA 4PNHA 1SU4A 1ZD5A 4J03A 4L6AA 2VKQA 4BYGA 3I6BA 2GHQA 2G1AA 2EATA 3ZVMA 4YIHA 2IOFK 4C4RA 5AW7A 5AVZA 5AW2A 3MPOA 3AR5A 4HGOA 2OYCA 5ALNA 4BKMA 1ZRNA 2JGAA 4I9FA 5ALOA 2YJ6A 4IFTA 2YJ3A 3OCZA 4NWIA 1RQNA 2CFSA 1Z88A 1ZS9A 3ET4A 2MSNA 1RKQA 3ZWDA 4KN8A 5AESA 3QUQA 1L8OA 3SD7A 4AS2A 4BNDB 1FEZA 3QU5A 2GFHA 3U7FB 3KD3A 3N8GA 4YIKA 3EPRA 2R8ZA 3MN1A 1F5SA 2OM6A 3OCUA 3FZQA 5AKIA 5AVTA 4BX2A 3S6JA 3L8EA 5AW6A 3EWIA 2B1QA 5AW1A 2FPWA 5ALKA 2I34A 2YJ5A 3DAOA 1L7MA 2ZBGA 3QUCA 4NFLA 3NANA 2YFYA 5AKHA 5AI5A 3NIWA 5A3QA 2FPXA 1RKVA 1TJ3A 4QJBA 4GXTA 3ESQA 1RQLA 5AI0A 1J97A 2WM8A 4UATA 1Q91A 3WK7A 3U26A 5AVXA 5ALEA 4NV0A 3WGVA 1Q92A 3WK4A 3ED5A 5AW4A 5AKGA 1JUDA 2NYVA 1L7NA 1Z4NA 3I28A 1ZJJA 5AVUA 1LVHA 3ZVLA 2O2XA 3A1CA 1L8LA 1TE2A 4ZEVA 3QX7A 2PKEA 2YJ4A 4BX3A 3IJ5A 4XQ0A 3I1YA 2IOHA 2Q4RA 3OPXA 3VAYA 4ZEXA 3KOOA 3DV9A 5AM3A 4Y2QA 4F71A 1U2TA 5ALGA 1RLMA 3WGUA 4EX7A 2DQSA 2HEGA 2FPSA 2Q4TA 3NAMA 2CFRA 5A3SA 4Y2YA 3F9RA 2G08A 2HHLA 2B0CA 2WF9A 3UMCA 1Z5UA 4HGNA 3A1DA 1QQ7A 5AM2A 5AKXA 1RLTA 4ZEWA 3ZU6A 2MU2A 2W4MA 4KYTA 3WKDA 3EF1A 3AR9A 3CNHA 4UU0A 5AKJA 5AKLA 3QNMA 1O08A 4CF3A 1PW5A 1RMYA 3KC2A 3OCYA 4HYTA 2HF2A 3ONNA 3W5BA 2HI0A 1SWWA 3UMBA 2WF7A 2ZBEA 4G63A 3PGLA 2HX1A 3QU2A 5AW0A 4YCNA 4OCZA 2R8XA 3ZX4A 3L0CA 5AW5A 5ALZA 4JB3A 4YCMA 1U7PA 5JJBA 4BNDA 4XOUA 3M1YA 3R4CA 5IS2A 3L0YA 1Y8AA 3N1UA 2WF5A 3PDWA 4G9BA 2RB5A 3ZVNA 2NO5A 3B8EA 4UM5A 4L57A 3SF0A 1ZD3A 3WKEA 2JAOA 5ALVA 4IG4A 2EAUA 4KNVA 4H1WA 3FPSA 1N8NA 2ZG6A 4J2TA 1ZD2P 1YDFA 3AR7A 4DCCA 1Z4PX 1S2OA 3GYGA 3L0BA 2FPUA 3KDPA 2R8EA 3QXGA 5AI9A 3WK5A 4BEVA 3QU4A 2C8KA 3A3YA 3DNPA 5AW3A 1L6RA 5AVYA 3AR4A 4YGYA 3BA6A 2OA0A 2FPRA 3W5AA 2YBDA 3HLTA 4EZEA 2FI1A 4NABA 2CFTA 5AM5A 5E0OA 1EK1A 1Z5GA 5AVSA 5ALPA 1Z4MA 3E8MA 3WKCA 4UASA 4UW9A 4KX5A 4FE3A 1WPGA 2Q5EA 1YJ5A 2G0AA 3U13A 4I9GA 3L5KA 3E84A 4KX3A 1O03A 4DFDA 3A1EA 2I6XA 3W5CA 2I55A 1CQZA 4CF4A 4HAIA 3R9KA 2HF7A 2G06A 2C4NA 2AUTA 3PGVA 5A3RA 2YMLA 3K1ZA 2ZOSA 2QYHA 5FP0A 2YMMA 2YMPA 2ODAA 5AK6A 1WVIA 5ALXA 2BDUA 4C4TA 2ZBFA 1U02A 1Z4QA 2GMWA 1YNSA 2P11A 4MUMA 1RKUA 1AQ6A 4C4SA 4EX6A 3WK9A 3SMVA 1TJ5A 4DW8A 2CN1A 1RPZA 3N07A 1NF2A 3BWVA 3N5KA 3SLRA 4HGQA 2R8YA 5ALQA 5ALIA 2WHEA 3AR2A 4YH1A 5AI4A 5AKKA 2RAVA 4Y2VA 5AKZA 3ZUPA 4UAUA 2RBKA 4Y2PA 5AM4A 3M9LA 5ALYA 1VFPA 2EARA 5AK5A 2HDOA 5AVRA 2RARA 5ALRA 2B8JA 3B9RA 1XVIA 4EELA 4UAVA 5AI6A 5AKYA 2B30A 3N28A 3IB6A 1NRWA 3E58A 4XE5A 5ALUA 2IYEA 5AW8A 4AS3A 3OTQA 5IT4A 2MU1A 1L7PA 3FM9A 1Z4LA 5ALWA 4B6JA 5ALTA 2JARA 2FUCA 4Y2RA 3TLMA 4BX0A 1WR8A 1QQ6A 5ALFA 4F72A 2I54A 4O8CA 1K1EA 2G80A 1Z4OA 2C88A 3OCXA 4QQFA 3WK6A 1NNLA 3L1VA 4UMFA 3QLEA 4YCLA 1U2SA 3QU7A 2FDRA 4EEKA 4OFZA 1ZRMA 1N9KA 1ZD4A 2AH5A 1IWOA 4BBJA 5ALHA 4HGPA 4UMDA 5AIBA 4Y2SA 1EK2A 3FGOA 2IOFA 3SKYA 3PCTA 1L7OA 3D6JA 1U7OA 3OCWA 3UMGA 4Y2TA 4L6CA 1WZCA 2W43A 4BEWA 3AR3A 5AK4A 3MC1A 2YN4A 1Z4IA 4JDPA 3U7HB 2B8EA 2C9MA 2O9JA 2P9JA 2YMQA 3ZTWA 1VJRA 5AVVA 1XPJA 5IT0A 3HYCA 1Z4JA 3AR8A 3L1UA 2HCFA 3QYPA 2WF6A 3NUQA 5AVWA 1S8OA 3ZTYA 3I76A 2I33A 3NASA 2GO7A 2HO4A 2QLTA 5ALLA 2B82A 2D2VA 1MH9A 2OBBA 5ALMA 2PQ0A 3WKAA 4Y2JA 4OD0A 3NRJA 4UARA 3FPBA 4MWOA 4NAVA 4CF5A 2X4DA 2FEAA 4AP9A 3ESRA 4UMEA 3U7GA 4GIBA 5AIAA 2FUEA 3B9BA 1YS9A 2BDEA 3QU9A 2AGVA 2I7DA 3L8HA 3NALA 4EENA 5AK3A 4FYPA 1ZOLA 3AR6A 2GHTA 1RRCA 2YY6A 5AW9A 5ALJA 1T5TA 3L7YA 4DWOA 1RLOA 3WK8A 5AM1A 2NO4A 2IA5A 1CR6A 1LTQA 2HOQA 2C8LA 3U7EB 1QH9A 4XPZA 5T41A 3RFUA 1XP5A 1J8DA 5ALDA 5ALSA 2WF8A 2HSZA 3FVVA 3UM9A 1SWVA 3WKBA 3W5DA 5AHXA 1RMTA 4KNWA 1T5SA 1RMQA 2AMYA 4RETA 3E81A 3QUTA 3IRUA 5AICA 1QYIA 1TA0A 2P27A 1KYTA 4Y3UA 3SKXA 4E88A 3P96A 2G09A 2PR7A 4UMVA 1X42A 4Y2XA 2G07A 2ZBDA 2ZXEA 1Z4KA 3CZ4A 4HGRA 3ZW7A 4CNQA 1RDFA 3ZWKA 1T9ZA 1QQ5A 3QUBA 1TJ4A 4UU1A 5AI8A 3J7TA 3KZXA 5AVQA 4OHFA 3SHQA 4Y2UA 2W11A 1YV9A 3RF6A 5AM0A 3KBBA 3ET5A 2B1RA 2BY4A
chains in the Genus database with same CATH superfamily
3D2NA 3RC9A 2FMXA 4C8MA 4IPTA 4E5VA 4KLOA 4J4TA 1VP9A 4Q9JA 4GMXA 3GP8A 3TJMA 3AR5A 4BDSA 1F17A 2W48A 1KVQA 4B4UA 2FMHA 5CT6A 1LX6A 3D7LA 3ZHZA 4P3KA 4CTJA 4KCGA 3PFIA 5KZMB 4BQNA 4OXXA 2MUTA 1VE3A 4C4YA 4FEEA 3FFXA 3FZEA 3HV2A 2QMEA 4EIWA 3OEWA 5FO1A 3W78A 4CV1A 5CURA 3PSHA 4ED7A 1RXSA 5DM0A 4YJ3B 4JYAB 1PR1A 5IAEA 1T4CB 3ZJUA 5C7YA 4ZYXA 3GNLA 3G59A 4NECA 2NTJA 1D9FA 2V4ZA 2GK6A 2HWUA 4G1BA 1NW7A 3I42A 3DOCA 3O4FA 1SQ5A 2YQZA 3OOHA 1QCCA 4PYKA 2VTKA 3AFNA 4JJGA 4UVEA 3G3EA 4CLHA 4C2BA 4BO0A 1JLKA 2W6ZA 2J3EA 2XWBF 3TTXA 1JNYA 1AO0A 3FYTA 2VPWA 5J2BA 5SY6A 2YN2A 4GX5A 2ZUTA 3SFVA 2ZTMA 4V0SA 2PWZA 2Z9BA 3M9NB 3H4DA 1D1TA 5DN6A 1RPJA 2MYTA 2R8HA 1M1YB 2YXBA 3B36A 4PX2A 3L93A 4CI0B 3UF0A 4DR6B 4N01A 1KJWA 1I2MA 1R6BX 1ZVKA 5B1EA 4JJ8A 1KYZA 2I22A 4KUHA 3LVWA 1NVAA 1FU8A 1R6VA 2HRDA 3LQ2A 2VQDA 1V3VA 4EHIA 2J08A 3G68A 2YWCA 3RU7A 3UV3A 5BSEA 2AA3A 4L7QA 1SXJB 3KTFA 4YJGA 3PJRA 1XS9D 3DAYA 2FW1A 4D0RA 3FPSA 4HNQA 2LNDA 5BSGA 1FSGA 4UUAA 1ZKDA 3QXGA 4BEVA 5KEIA 5DP1A 3Q3JB 1ORHA 1U5AA 3QWIA 2R8RA 3NS1A 4EY8A 1QV9A 4DB4A 2UYYA 4QYWA 4Z9YA 4CCWA 3GLGE 2PKXA 3J80A 4QZHA 1OC4A 4FE3A 2CVOA 1YFZA 1EFHA 3SR6A 4B7XA 1YZ3A 4Y2GA 3CP8A 5BYAA 4CF4A 4HH4A 2Y1GA 2ZR8A 1X66A 2ZBQA 4NV3A 3KR0A 1ZUWA 2B4KA 3CH6A 1NONA 3BSYA 1WVIA 3IL2A 4G4IA 4XYGA 1U02A 4OHOA 1S96A 1JDTA 3MJDA 2BI4A 2Z3VA 4BN4A 3SMVA 1S0OA 2O0LA 3BIFA 4DW8A 1OXTA 5FXMA 1KK0A 2FFAA 3NONA 3SP1A 2VF5X 1U9IA 2ASDA 2ARKA 1ZQTA 9ICLA 4PHTA 4JYPA 1NRXA 2HMWA 4JJZA 2H5IA 1VYHA 3W1WA 3KJGA 2Z1DA 3GZJA 3MYRA 3E1KA 3H3FA 5CYFA 1WR8A 4PG4A 4AMYA 4I9NA 4PYNA 3IDZA 1B0PA 2IZ7A 1SXJD 1GKUB 1N9ZA 2BISA 3DUFA 5BMVB 2PGLA 2P1DA 1EUDA 3MJ4A 3UUGA 1TVCA 3ETGA 2PGOA 1E3LA 4JU8A 4L9SA 4YMMA 3ROEA 2B7CA 5GQSA 4CNBA 4DCMA 1E2NA 5DQHA 5CVCA 1P1CA 3GCDA 2Z7JA 3JSXA 3F6YA 4I5EA 4I4LA 4IEIA 4QU0A 1KN5A 3SK0A 1R5JA 4Q4JA 4D79A 1EZ4A 5L1KA 4NMLA 1W1UA 1SOUA 4QXRA 5JYEA 2IZ5A 4UJ5A 4BNTA 4BO9A 5DSZA 3CPJB 4LRQA 2FN9A 1E61A 1G20A 2PQMA 5BR7A 3E81A 2WDZA 1MFPA 4Y3UA 4P3NA 2HA2A 5FAXA 3R75A 3ZDYB 3A6DA 5AT1A 1QQ5A 5EP1A 2D3DA 2FZGA 1TEXA 3S2YA 4ZOLA 5DULA 1NOMA 2HEIA 4KFTA 1YHZA 1FTNA 4AURA 4C6TA 3NKFA 3O4IA 4FWIB 3TECE 2CBGA 3FYUB 5B2EA 3J81k 1RYHA 4FONA 5JZSA 5KMGB 4HWKA 4TXNA 4LHXA 3F8SA 3HWRA 3EBOA 2TMDA 4D4IA 1ZOOA 1DWPA 4V3BA 1JX4A 1E3TA 1XZHA 2RHCA 2JZBA 1PSWA 4I3FA 3TXYA 3R5SA 3PZRA 1A50B 3RG8A 3LVVA 4R7ZA 4QW8A 1ZH4A 4NIMA 3EVAA 3EGDA 5KYXB 5KFKA 5DH9A 1K5DA 2N47A 1W1WA 2VH5R 1P4AA 2O8VA 1ZMXA 3B13B 3GRZA 1JPUA 3LG2A 3Q7EA 4NOMA 5AJZA 2OVBA 1RKVA 3HYSA 2CK3A 1BW9B 4ZGWA 1SCKA 3U4GA 3TAHA 1IMJA 1FF9A 3T1VA 1VBFA 4A0HA 3H9JA 4QSHA 3AU8A 2ZPTX 4YAJA 4S1WA 6REQB 3LIIA 3KQNA 4IC9A 3IHTA 1EUCA 4DF8A 1M2OB 2BR3A 2PZGA 3RC1A 2FOLA 1DFGA 2AX4A 1YVPA 3QEJA 3ND5A 1UBLS 1C9MA 4HPXB 4RENA 3E9YA 8OHMA 1JB9A 4A8JA 1YT5A 4B48A 5DVZA 1KY3A 3EF1A 2WPNA 9ICHA 1UH5A 2H7YA 4X95A 3UJNA 3CEMA 4KN9S 4O0IA 1TM4E 1IIBA 1E1DA 3L7DA 2QWXA 8ICQA 1Q1EA 4B4WA 1RCFA 3ZZMA 3CVUA 3FTQA 3INTA 4FINA 4UCXA 1ZD3A 3UV6A 1I4DD 5KVAA 2CYAA 2ZDQA 2CUKA 3QWFA 3GYGA 2DFDA 3S2ZA 1W94A 4F4UA 2IYFA 1T9GS 2HHAA 4PVDA 1PNOA 1XQ6A 3VMFA 1DIBA 1EFDN 5F5LA 4Q15A 4UAJA 1J8VA 1FMTA 1XQ1A 3PQ7A 2BFWA 5DLPA 5CGQB 2AN9A 2NRVA 2DQ4A 2DUJA 4KX3A 2G9QA 1YH3A 3GRFA 5K2MA 1TYAE 1OI2A 1DCMA 2W9CA 5GM1A 5FBHA 3QEBZ 3FHTA 4F4IA 2Q50A 3KSAC 2QMHA 2KKVA 5SYNA 4DOCA 1D4AA 2E4AA 1PL0A 2X1HA 3BN3A 1RRFA 5H5JA 5J0OA 3GUHA 1M6HA 1DFIA 1QYDA 3AM5A 1RLUA 4M88A 5ARBA 2JJ8A 3JQAB 3RUPA 1EZZA 2HU5A 1G3RA 3AG6A 5FORA 4ED0A 3ZU2A 5ALUA 4C0KA 1MG0A 4I14A 3RJMA 4CV3A 3ADBA 1XAJA 1G0NA 1QIEA 2NQ8A 2XSZD 1VDZA 3S40A 1CUFA 4DY6A 1TKAA 1HQYE 2Q5HA 1B6RA 1QH8B 4EUSA 2ZJ8A 3GUVA 4EG3A 1OJLA 2PXHA 4CU2A 3IMKA 4CMEA 2QLLA 1JHUA 4EZIA 4YUVA 5DBGA 1HYEA 1WVGA 3NRZA 4NG5A 1MW8X 1MQSA 1MX3A 1Q83A 1XXHB 4DADA 3MFQA 4HQOA 2IEDA 1VLJA 1Y33E 3BHJA 1VCMA 1Z6PA 5SYAA 1P1JA 2I7DA 2BFFB 2NRZA 5L1LA 2VNJA 2C9BA 5K5EA 4CKCB 1GG5A 1ZCAA 1BN7A 1HL7A 2F90A 1ZNYA 4RXMA 3W5SA 5AICA 3VOAA 3IH5A 4Q47A 3JQAD 1X6VA 1K7FB 5CJPA 3DD5A 4JUCA 3X43A 1NQAO 4GOJA 1BA3A 5AQEA 3FLMA 3J7TA 1LBEA 3H9BA 3HILA 2JFNA 1PV4A 4PSDA 2I87A 3GEDA 3OUTA 1JFSA 2GZHA 4BEJA 2H08A 4NDZA 3O03A 4NU0A 1EVQA 4OA5A 4D9JA 3HM2A 1N1GA 1PO7A 1P39A 4UBOA 1SU4A 1DBRA 2D59A 1E5QA 3A3PA 6AT1A 2AWOA 3KKQA 2VCHA 4KLLA 1QE5A 1A8HA 2ZJ3A 1SL0A 2UUPA 3U7RA 4B3RB 1XC7A 3TNFA 4KQXA 4HQ0A 3UN1A 4KN8A 1ZSVA 2VDJA 1Z83A 3R5FA 4WFKA 4OI0A 2DG2A 2XECA 3S6JA 2J3DA 4LHYA 1OPRA 1PJ4A 3W0LB 4BMCA 1B6TA 5DGAA 3K96A 2PIAA 5F4BA 1TKCA 8ICUA 1WQ3A 1GYPA 1SOWA 1KJIA 3RYTC 2H54A 3K0BA 1PGPA 2O8CB 3OQ1A 2VNSA 4ENSA 1W9MA 7GPBA 1WQ4A 2AQKA 5IAJA 4HAOA 2V3CC 1L8LA 5E3IA 2R62A 4ZV7A 4LW8A 4MAFA 3KB6A 2ZAOA 2UUBB 4Z53A 1X9XA 3SVTA 1U2TA 4I9UA 2EKLA 5F9FA 1N3IA 4K03A 4HEJA 1OWMA 2H1IA 4KLZA 2EW8A 2YJZA 4F2RA 2MYPA 3O0FA 5K8CA 2GA9A 1XD2B 4W82A 2WHQA 1S3IA 1TYZA 4Z6FA 2CNNA 5H80A 3EW7A 4TV9A 1ANKA 3COSA 3MLAA 4UXHA 1XTBA 4KWTA 3UMJA 3SZMA 2YB4A 3IX7A 1WKCA 4ZHQA 1TTQB 1RBQA 1W36C 3C6ZA 4B75A 3CH4B 1W96A 3DCJA 5D1NA 2AXNA 2E1RA 2AIRA 2LRHA 1ABEA 2WIGA 2B6GA 1X9IA 3IKVA 4YROA 3DNPA 4XUDA 2NU7A 3JQFC 4M7WA 1GPBA 3R7LA 4IZ6A 3O4RA 2L69A 1MOSA 4DG8A 1F0MA 1QMPA 4G0QA 4HFNA 4G0ZA 4UC0A 3MB8A 1AXRA 3FB1A 4G4SP 2ACEA 2GYUA 5DOVA 3HY6A 1OAKA 3BPSA 1K08A 3ZY4A 2C4NA 1WV0A 4FS2A 2Y1OA 5FP0A 4GG1A 2XVYA 2CNDA 1QK5A 2OOSA 2E5SA 3DOEA 4ZYYA 3K4QA 2ZAMA 3OPYI 5EPUA 3EAGA 4D99A 3BWBA 1N6RA 1LNSA 2Q0HA 3ZDBA 3RHFA 5EQJB 1A5AB 3UKJA 4A91A 4DLPA 5JPIA 5ES4B 2RH4A 1X7YA 1I9CA 4KTQA 4F6RA 1X2BA 2BR0A 1BWQA 4DUPA 1Y1PA 1QS0B 2ZB8A 4F2SA 1NV8A 1K06A 4JLPA 3C8HA 1AQIA 2PWAA 3VC8A 2FEOA 1Z4LA 1A98A 3ZIAA 2ECOA 1ZQAA 1YB2A 4DIUA 1E8MA 3ZOKA 1JR3D 2G80A 3AEKA 2C88A 4YCLA 2OSBA 4FOLA 3PZPA 4NJOA 4QTXA 5CEHA 2JGIA 4G09A 5LJLA 2WMYA 2LKYA 4TLAA 3C0KA 5K0JA 2XY7A 2PUDA 5CNMA 3PX0A 3PWSA 4C21A 3N3AC 5JPDA 2IBTA 2RKWA 2FSIA 1NMSA 2FSGA 5IFLA 4GUDA 5EKSA 2P7IA 1D0VA 1F6BA 4QZFA 1KORA 4NS1A 1YQ9A 5J8YC 3LLSA 1CEQA 1JVSA 3ZHUA 4FZ3A 4YRSA 3ONDA 5LYJB 4H1VA 4C03A 3ZOZA 4WBNA 4ECUA 1QOZA 2ODGA 3NHBA 3A0UA 1RM5A 1Y6FA 4DJTA 5AHXA 2NPOA 4IW3B 4IQUA 2BMFA 1TA0A 3FCUB 3PX2A 5A4DA 3DBVO 3IDFA 1SUSA 2JCYA 1BXRB 4OXYA 4I81A 4M0CA 5DT9A 3QTBA 1XMPA 2R6GA 1NPYA 3FX2A 4KHPB 4A7PA 1RE0A 4AG6A 4X7BA 5AKEA 5AVOA 1XROA 4E1BA 1Y8QA 3AB8A 4C05A 3SDZA 1ZXXA 2QDKA 4PZUA 4ASUD 2GHQA 1S76D 3N6XA 2QHXA 3GGPA 1EDDA 1DQRA 2IGBA 3L04A 2FG6C 1OXJA 4J29A 1GXSB 3ZE8A 2HC9A 2QP9X 2E5FA 1SR8A 3RKRA 2VSNA 2A67A 4KKVA 3U7FB 4FNMA 3V7UA 3BMNA 3N8KA 4GXQA 2NVUB 2HK9A 4IBOA 1WQ1R 1RWXA 4IDFA 4RPKA 4LJAA 4YUXA 1YF3A 4EGCB 2WWVD 3RK1A 3HG7A 1Q0UA 4UQOA 1OYOA 2BHRA 3RF9A 2HIGA 3KVNA 2JBHA 2XXAB 1L1QA 1D4ZA 1DWQA 1POWA 2GAJA 3NOVA 1P4HA 2W2NA 4GX2A 3K32A 2DE0X 5J5CA 1TM5E 3VR1A 4HZUA 4AY5A 4HDAA 1NAIA 3G8DA 5CB0A 3MJCA 2RQ5A 4FDTA 4E31A 1LLDA 1Y9EA 4EHNA 5C53B 1Z36A 5ICGA 1TLLA 1VRVA 1G8PA 5FOSA 1KYYA 3JVUA 3U7QB 2CSXA 3I1JA 5JQGB 4C4XA 1U2DC 1X86B 4NU8X 5DYWA 3TEFA 1A1SA 3LC0A 4Y2YA 4YACA 4A6DA 5KOHB 4IVRA 3WKDA 4UHBA 5FHQA 2HVHA 2XBMA 4CF3A 1X1SA 4LPKA 1I33A 4NU6A 3UG7A 2OAQ1 5JRTA 4ED8A 3QY9A 5KNBD 1L3TA 5KFRA 1F0NA 5BOMA 1FSZA 2AMJA 3HZZA 2Q1UA 4O4IA 3CMMA 4O2BF 2IIVA 1J21A 4IG4A 2EAUA 1ZA1A 2Z4RA 2FQQA 4MUGA 1P77A 3UXPA 4IJKA 4L4UA 3ROPA 4F3CA 2QQ0A 3MILA 2IBMA 4FGUA 4RZHA 3IG5A 1S89A 1UMCA 3H65A 1V1MA 4LXYA 3RROA 3D2SA 2PSEA 2PNFA 4WXPA 2AVDA 3QLVC 1ATIA 1ZM4A 2XWQA 2AN4A 1T8EA 2QVYX 4LFAB 4GQAA 2ATVA 1QRTA 3DKIA 4US8A 3ZH2A 1RYZA 1DPFA 3R3YA 5T3UA 5U1PA 4BLQA 3PYXA 4DUZB 2MA1A 1M54A 4QWEA 3S8EA 3AIIA 2ZJBA 3NVMB 1Z75A 2GN0A 3UT0A 1J42A 3WSWA 3M6ZA 1G4HA 5KFXA 5A7HA 1Q0SA 5AK5A 1XKTA 4B2LA 4FD2A 2G4CA 4RKWA 8ICIA 3E58A 3TNJA 4P86A 1G64A 4CCAA 1CFZA 1U2ZA 4HXFB 2IDZA 2MSDB 2QZ9A 3C7DB 4BJ1A 3FB4A 5GJVC 2O20A 5KSYA 2YJTD 5EJ5A 3UMFA 5HHTA 3UXYA 3B3JA 5KT2A 3SV4A 3B51X 5T57A 3G89A 3RU9A 3Q8LA 3EOZA 5C8YF 2EKPA 3HA3A 4BDPA 3AR8A 1FLVA 1XTUA 4N82A 1XSPA 3PSFA 3AKEA 1J7JA 3RIYA 1H23A 4Y6PA 3CS3A 5P8WA 3TZBA 2VCEA 3QBJA 4ZQCB 1GPYA 3MM4A 3DOJA 4PPGA 2VFAA 3CVOA 2JCBA 4DNFA 3OI7A 1GZ6A 2B8WA 3V97A 1T1SA 2A1UA 2I8CA 2FZLA 3A1VA 1Z5OA 4U7DA 4ENUA 4WL0A 5JANA 4G9EA 1C0EA 1GVNB 4WNAB 4HQ6A 1BS2A 1L5WA 4DL7A 4Q4LA 4MS3B 1KZ6A 2HWXA 3CHYA 1UBSB 3OIGA 1P72A 2QD4A 3ZX5A 2I4LA 4JMLA 4MF8A 2Y4OA 3OCVA 2C31A 4CV0A 3MWYW 8ADHA 4DQPA 3RVDA 1PFUA 1WJGA 3GT0A 1G7RA 4QUGA 3OAAD 3PMNA 5GV7A 2FVYA 3IP3A 2JEIA 2PTGA 2CFOA 3VBEA 3BIOA 3OD5A 3KQOA 2JD0A 1R0RE 4AY4A 1VKZA 5JASA 1I80A 3L5OA 3MN1A 3ZQ6A 4JLNA 5CFMA 5K4HA 1JQJC 3PYLA 2WD8A 4Z9XA 2BFAA 1R5BA 4ENPA 1C0KA 3DWEX 3CBQA 2F8LA 3RB8A 2FPXA 4K9RA 3E5HA 3MA0A 3JARB 1UAYA 2Y99A 4RQNA 2HV8A 5AVXA 2WE7A 4F5PA 3KUCA 1GCUA 2R85A 1NKBA 1LVHA 4AO6A 1ECBA 2RDIA 4J9VA 4BX3A 3L1IA 4QDZA 3VRHA 4RO0A 3TNDA 5CCBA 4KE8A 4QZ8A 2Z2JA 5KTQA 3OGUA 1DP4A 4C08A 1ZYQA 3W4KA 2B83A 5KWSA 4CU5A 3H5VA 1HRKA 2AG0A 5DNEA 2P2LA 1EX7A 1I5OA 2FK8A 3EG9B 3KQWA 2GWRA 3OM8A 1P5RA 3TLGB 3OOWA 4D4HA 1AKEA 4RTLA 5I5GA 5IEJA 1BRTA 2AE1A 3NORA 4QUAA 3EZ5A 1ZH6A 2PRIA 4L5JA 4TMWA 2HT1A 1UJNA 4NCXA 1F1JA 5CHGA 3ZXXA 2DBZA 1Z16A 3L7AA 3IUYA 1ZHOA 4X3OA 1I1NA 4YT2A 1ZSNA 4XKJA 5LPNA 4DQRA 2XDAA 3DYIA 2DFPA 4J2TA 5H3LA 5K8VA 1GUFA 2P3OA 3R4VA 3GPLA 1TADA 5KYUB 3AR4A 2FPRA 1UKEA 4JI1B 5LCXA 5DASA 4MKGA 2ZJ7A 4F86A 2CFTA 5AM5A 2XY4A 3EXIB 3UPQA 5HZGA 3R6DA 5A9TA 2FQ1A 2JEYA 2QK4A 3OIFA 1J9EA 2Q3EA 4RD6A 1YZVA 1ZUHA 4CLDA 2W2KB 3A0RB 2X4GA 3UTCA 4F60A 1QTQA 4YXWA 1H0RA 4M9LA 4NZYA 1J24A 1RYBA 3VVLA 4BNGA 5BW8A 1RKUA 5EIAA 3I62A 2QRZA 1GZHB 3BH0A 2BGKA 4LE1A 2C5AA 3VTFA 3NCHA 3ZE2B 3BWVA 4MMYB 4X7MA 3PV8A 2KM1A 3DUWA 1SCJA 2IYTA 1OAOC 3O9ZA 1EQ2A 1NOIA 2ILVA 1BX1A 2IFTA 3T3IA 3WHKA 2QDXA 4KC0A 4Z7NB 1S2IA 2F3TA 2F3UA 4R41A 3HU5A 3A1FA 1USWA 1SV0A 3V1UA 1MJGM 4ABTA 4J9QA 4QG7A 1JFFA 3UHOA 4XSGA 3HMKA 3BH7A 3OFVA 8ABPA 4FSHA 1HO3A 4XIYA 1XT6A 4YP7A 1JXEA 3V7LA 2DSNA 3ZBTA 2A5LA 1PAUA 1OLOA 1BMFA 3ZH9B 1M1NB 3A06A 1LEHA 4II7A 4HGPA 1N0WA 3KOUA 1W8DA 3C45A 4MNTA 3MCTA 4UEOA 4MZXA 2HTFA 1EGMB 3DNMA 3GFQA 2I33A 4K1LA 5AJWA 4YJHB 2B6NA 1NLMA 1U0LA 3UFBA 3VC1A 3NRJA 1IC6A 5IZCA 3OEEA 2QUAA 3HY3A 2QG6A 5GONF 1QDLB 1TTTA 1ECJA 1YASA 4H1UA 4FBUA 4ND1A 3P2KA 5EZSA 4I3HA 1OV4A 1O4VA 2R5FA 3LXRA 4ZT5A 1S0UA 4BC1A 3TACB 1TYEB 1Z4KA 4B79A 4AO7A 2KHVA 4E2XA 1UDCA 3SHQA 2W6QA 3GB9A 3OHAA 1H2HA 2Z95A 2VHWA 2YIDA 3BMOB 2PFQA 3PR3A 3WGTA 1RJGA 3RTGA 2XD9A 1YGYA 1E77A 3UC9A 4M76B 2AN5A 1GZ5A 4NDAA 3VZCA 1U3TA 2EZ4A 4LTDA 2XW6A 4AB1A 2FEWB 3THVA 3OEHA 1EIWA 3EZFA 4GOXA 2AHOA 1JEOA 3F90A 2XIDA 5TZVA 1JQ3A 4BFCA 1B0UA 3KHHA 4C2TA 1OU4A 1T2EA 3V8MA 4NP6A 3I5YA 5JFGA 1XELA 3ANSA 3R76A 1V1JA 1G6Q1 4BVGA 3CJQA 4HAYA 1A9XB 1RCTE 2H7XA 1I2BA 2WHPA 3QVGB 3Q8PB 2WM8A 2X5NA 3AYXB 4RA6B 4R5HA 1GUDA 4WZBA 2HFKA 3OESA 3LJKA 2ZYSA 1NP3A 3O47A 3KT3A 4FZNA 3GRUA 5CW2A 2OBMA 3FWNA 5D86A 2HHSA 5KREA 4ZMBA 8ICZA 3T1TA 4N5DA 2PMCA 3QG1A 1ZXBA 3D8HA 4LXUA 5A3SA 5JY1A 4RY2A 1GUYA 2VXYA 1L4GA 2VK2A 2HIMA 3LW8A 1N77A 2FUG1 1JL3A 4V2UA 4W5TA 1XDZA 5CXUA 2I7CA 4QZIA 4KYVA 3VR2D 3MSXA 5C32A 2PSHA 3A7EA 4F5QA 4IIEA 3PEEA 4FBLA 2GUWA 1BQ4A 2ZBRA 1FK8A 4EZ6A 2J9ZB 2W9BA 4DUGA 4I2JA 5IS2A 3HKBA 3ZU4A 5FOUA 2OQ2A 2G6TA 2Q45A 3GPDG 1QFZA 2R3SA 5HXAA 3SQIA 3F47A 4B43A 3KDPA 1XAHA 1EWQA 1KEEA 4KLMA 3RFAA 2HHHB 1GJRA 4ZQIA 4ED9A 1WB6A 2PH5A 5IAGA 4FZRA 1NI3A 4KRFA 2CE2X 1ZW1A 2CE7A 2HADA 4HLUA 4ZARA 4DFDA 4ZVOA 4HDNB 4MKFA 1ZKMA 2PGJA 4P93A 4OQZA 3B1ZA 3IVMA 3HB7A 4YO8A 1GPAA 4NH0A 4IIJB 3NJ8A 2OXTA 1AQYA 2R8JA 1XN1A 2FPIA 3NIGB 4B4DA 3MS2A 1NBMD 4IHJB 4R71A 4X8HA 3C3WA 4NR0A 3KUKA 1T5LA 3QYFA 4JP1A 3JPSA 1OT5A 4HTFA 3M9LA 1L4EA 4A2WA 3BTSA 2YINC 3RUEA 1X15A 1JYFA 5FTNA 1CXZA 3D1VA 1A9RA 1P33A 4FFSA 3M6MD 4CEIB 4ARCA 3WL4A 3KU1A 3DC7A 4I27A 1T3NA 1QBKC 5I9BA 2JH9A 1YR2A 4PNPA 1PGNA 1Z0SA 3CA8A 5DBCA 4ZDKA 4DV6B 5A02A 3OT5A 2AOVA 4MWEA 8ICGA 1Q7GA 3GD5A 1VHJA 3T7CA 2GJ4A 3LC1O 1ZM7A 2G5GX 2J3JA 2PXAA 4YXMA 4CM1A 4FGJA 1T8UA 1YQWA 4Z51A 5DWQA 2WF6A 1ODFA 4C78A 3EH2A 4BO7A 2GM3A 4E30A 5KYYB 5L7YA 5DM4A 1LZKA 2FZ5A 3T9BA 5CJ7A 3D81A 1F8UA 4XLTA 1HEUA 4ZMSA 2Q4DA 1GQFA 1T9GR 4UU8A 3Q8XB 4GRIA 4N47A 1E59A 4NLKA 2JIOA 4X91A 3I37X 4Q39A 1FJHA 2JVJA 4NBSA 4L74A 2ORED 5DBEX 1M8GA 4JIMA 1UF9A 4NBWA 2C00A 4BLVA 4NMWA 4QWCA 1K5GA 5HA5A 4NYIQ 4TTJA 3ADKA 3VC3A 1SGGA 3RCBA 4Z6CA 2QOEA 4K46A 3B8HA 5DDIP 4KTTE 5J29A 1KDPA 3VDRA 4YP5A 1PJQA 1FTSA 2V7UA 4MS1A 1G5RA 1AX9A 1W36B 4DV4B 4LRSB 1E1CA 2QIOA 2QJOA 5JJ5A 4HY3A 3HU2A 4UM7A 4YMGA 4MIEA 1QXSA 4EO4A 3C3EA 3UXOA 1MKYA 1I3KA 2EATA 3SAFA 2IDKA 4U6SA 4JJEA 1XFAA 1KMHA 4BKMA 3P0FA 3HLKA 2QLNA 4K88A 4OQNA 3H97A 3V48A 4ZYTA 1A9PA 3OQVA 1XPRA 1RKQA 5AMXA 3VR3D 4YQWA 1MQAA 1DAPA 3TGLA 4CL8A 3JATA 5K0LA 4QZAA 1XA3A 1FSSA 1FX0A 3FSJX 1R0SA 3JWPA 3CC8A 1HFEL 5M29A 3GN2A 2FSUA 3LOPA 5AHOA 3UZUA 1P4GA 2BGGA 1VIAA 1VE5A 1KBQA 4ZVRA 1ES9A 2UXCB 4JAVC 5ILGA 3G82C 2ZAGA 1ZQBA 3WK4A 4NBNA 1DEAA 4GM1A 4RCVA 4KLDA 3QPCA 1U28A 2XUPA 5I7SA 1KVSA 3O8OA 1ZH2A 3IJ5A 3DKPA 3QEOA 2H7VA 4WLNA 3B6IA 1NLZA 3CJRA 2PZ8A 1I2AA 1GRQA 1RZ3A 3K2QA 2EFHB 1QP4A 1Q5PA 2Q28A 3GMDA 1CW2B 1P29A 3UMYA 5I4CA 3LF1A 2R00A 2B0CA 1W36D 1W5TA 3UA4A 1U6IA 5AO9A 3TKYA 4M04A 4V3CA 5REQA 2XITA 2W4QA 5E8JA 4ZKDA 1V11A 4EY3A 1TM2A 1BNPA 3WNZA 1E2BA 3INYA 5IABA 1KR5A 4WOCA 2RB5A 2NZVG 2BN4A 5CCXA 1NYRA 5EWEA 3HBFA 1GA6A 3H9QA 3UQZA 4ELUA 1XTRA 3VSDA 2IH4A 3M89A 1X7ZA 5H81A 4IV8A 1QG6A 2UYCA 4PY2A 1S77D 4G0PA 1IBKB 5HR7A 3RWOA 5CVDA 3CF0A 4MWCA 3NAQA 1FDIA 1IUKA 4OU4A 4YRAA 1OILA 2EGGA 5I48A 3R6WA 4LV5B 5KSOA 5LQJA 1NBIA 2JGDB 4HDSB 3ZTTA 2JJ2A 4OK5A 8ICFA 3G49A 5DGDA 3LPAA 3O91A 2E2WA 5BQ5A 3K0EA 1ESCA 3V8QA 5IXSA 4FO6A 1GQ2A 4KIUA 2ZE8A 4YR9A 2D4HA 4TMTA 4EL5A 4HEA6 3AEYA 4GYJA 3P5BA 4KLRA 4ZAGA 3QITA 4QM6A 2JBAB 3SQOA 1J20A 5KYNA 1NVXQ 4I1YA 5D46A 1IG3A 3HEMA 5K6AC 3PV0A 3SI7A 3K3PA 4HBGA 2A30A 4F8JA 8GPBA 4P35A 5IAKA 3CPEA 3C74A 3EQZA 4JBNA 2C78A 4LOJA 4RKFA 3FZNA 4CG3A 1HE5A 4Q16A 4I6JA 3ZCUA 3I01M 4Z3DA 1JWBB 2K4EA 2QL7A 3PHLA 3CKYA 3IKLA 1J2JA 1NY5A 2WSSD 4O0MA 4JGIA 2QJWA 2X7XA 5HS4A 2WVHA 4R8VA 1N5KA 2QROA 2PQ0A 1GSAA 2FWAA 4UARA 4WOBA 2BCUA 5LXTA 3KDAA 1HC7A 3ME5A 1X87A 4JOSA 1XR3A 2XYPA 3JX9A 2JASA 2J9XB 4A0GA 1JJFA 2EFDB 2NUAA 3TTYA 4P7KA 2GZMA 1KI6A 2XMPA 5SZHB 4EJMA 3A6EA 2JF0A 2E1PA 4H7PA 4OA8A 3PKJA 4DMFA 4PLFA 3BGWA 3P9IA 4BFVA 1ADBA 1NUTA 1WUDA 2AMYA 4AF6A 4MHOA 2V58A 4IY1A 1O8BA 3LVRE 3UWMA 2LMRA 4YFKA 3D0KA 2J9FA 5EFZA 2R87A 3IXLA 2X86A 3NRWA 4KQ6A 5CXQA 3FGNA 2BM0A 4PTLA 1XRMA 4EYKA 3S44A 3EZLA 2YRFA 2EZZA 2Z58A 3SFZA 1IHYA 2WJ6A 4RPYA 2C22A 1TAGA 4JWNA 2Q6OA 4MVJH 5DBHX 2HV9A 1H85A 3GDGA 1D8AA 2WTXA 1P9OA 4HYKA 4BNMA 3OJ0A 4ICAA 4B9LA 1Q16A 4UB1A 4GL2A 4C0QC 4RKEA 1FEZA 2O07A 4YIKA 3AHDA 3I2GA 3EZGA 4MGEA 3JWEA 1W5AA 1HX7A 2C1EA 3IESA 1A4IA 3I64A 2BCRA 3M3PA 5DQIA 5LDGA 3KOXA 4X1YA 1ZIYA 1JHOA 4OQXA 3WP1B 1ZVVA 2X0KA 3I2KA 4YFVA 1DELA 2CZGA 1TQ2A 2YFQA 1OJ7A 4HBZA 2GQ0A 4E5PA 2JZCA 1U7HA 5CT4A 1H5UA 2GCPA 2EZ8A 1BVSA 2N1RA 3T3PB 8ICRA 3BS5A 2ZANA 1YI1A 3T52A 2ASJA 1VIYA 3GT7A 1N5RA 5K0SA 1RQXA 2BJHA 3F9RA 1U8EA 2JI4A 3UKDA 3Q7SA 4N4AA 1WS6A 3PX6A 3N2KB 2JLUA 3OCYA 3OZVA 1L7EA 3H1BA 3OJSA 4UREA 4BFWA 4M6WA 1ZHHA 2WDPA 2HJSA 5IJWA 1P2SA 1JEYA 3V3KA 3V1KA 1LLFA 1W6RA 3L0YA 4C6HA 4UCFA 3PX4A 3TRIA 4L57A 2AFRA 5CA0F 5FRDA 3FCXA 1Q15A 1UBCA 1QIHA 3A6GA 2KS6A 2VAXA 1V9PA 3DXYA 1CJKC 4BWFB 5DGXA 5H4GA 3QXSA 5SV2A 3VZQA 1IQRA 1DEHA 1JFRA 3G9TA 1BHJA 2AR0A 1TK9A 1QIDA 4Y18A 2WICA 3QM1A 2EBHX 2FWPA 5C1OA 5ERXA 4RT3A 5E95A 3IC5A 3C23A 3RYFA 2GCOA 1TDJA 2BUCA 2VDQB 2Z8XA 1ONBA 3DT8A 4IYRA 3MGVA 4JP8A 5ILOA 4F5OA 2PGNA 3E9RA 2V59A 2YMPA 3GVXA 1K5OA 1P7ZA 3STYA 3T3NA 3WK9A 1NTRA 2JFZA 3TLXA 3WRXA 1S2DA 1R6XA 4G86A 5KFEA 4HGQA 3WGZA 4YAEA 5KG6A 3KELA 3H1TA 3PHGA 2JBWA 5AKYA 3PJDA 5GIPE 9ICOA 1B74A 4N3BA 4PGHA 2ATCA 4I1UA 4Q9IA 2OQRA 3WDMA 5CFRA 1M0EA 1VCHA 3BVPA 4RPXA 2ZRLA 1JDJA 3KIPA 3AKCA 5J58A 3LDHA 5LP6F 3PCTA 1ZZGA 3FF4A 1IN8A 2I3AA 3MMSA 3PNVA 3KVOA 2YN4A 1J1ZA 2FW8A 1RU3A 5ITZB 3G1TA 2IYYA 4W5RA 4GBJA 1AK9A 3K2IA 1REQB 4ER7A 1KJNA 3IJRA 1E1RD 4KJZA 3HSKA 3UOAB 3CPSA 1MO2A 3W5UA 4DRYA 4Z6KA 5LMNB 2CLCX 4TT8A 2XNDA 2ZYVX 4LJSA 4YUYA 4BTLA 5DTIA 1EFLA 5LQCA 3LX4A 1XZDA 3E8XA 3E22B 2CLIB 1T8PA 4TKZA 1C7EA 4P4MA 5B12A 1P4SA 5FPTA 5B3AA 4PGYA 5EWMB 3CMCO 1I6KA 3WDLA 2C7RA 2P27A 3PSTA 3FNQA 4OGGA 4D97A 3DZKA 3ICVA 2GJSA 4KAXA 3RUAA 1OCEA 2R65A 1L5KA 3QOXA 4RPJA 1ODLA 3TRKA 3EUB2 1JG2A 1MVNA 5TT0A 1OZFA 2P6NA 3IBFA 2EC5A 4MLCA 1QKIA 2OBNA 5FYQA 3RADC 4LYGA 3MJVA 2GZRA 3C3DA 4J03A 3TSCA 7ABPA 4B84A 1J5XA 4G0WA 1ZN9A 4UXJA 5JZBA 4CBVA 3EAQA 2VF7A 3NWOA 2YJ6A 2PE5A 1X3LA 2ZB2A 1G60A 1PT5A 3A3KA 3OCUA 2QUBA 1D2NA 3WDSA 5AVJA 4NNJA 1GCAA 3Q1LA 2WUEA 2IHBA 4KQWA 4FNAA 1UK6A 1XMIA 1L5YA 3HO1A 3QX8A 3LNCA 2SICE 4EI2A 4TWBA 1AUXA 3HWX1 1LUAA 1F6WA 1ZMRA 2FNAA 3B85A 3I2IA 1J9GA 2AQ8A 2ZITA 4O3QA 4Q1FA 1IHDA 1EBBA 3T34A 1O6ZA 1C8VB 1QO7A 1VSUA 3IP8A 4CEJA 1WMSA 1CETA 4MARA 3LKBA 3ZNQA 3LWNA 1KDOA 2ZYDA 4EY7A 3GJ4A 3NVWA 3K8ZA 4J7XA 1LF5A 2W6MA 2WU0A 1GPWB 3D4LA 4BS9A 5LSAA 4I1PA 3ZDEA 3UMBA 4OV6B 1SCIA 4IQGA 3ETDA 2VATA 4WK2B 3DKVA 4UVIA 4CMIA 1H2BA 4X45A 3EN0A 5B1HA 4L0DA 3QX3A 1GQYA 1CD5A 3DKKA 1G5HA 2VPIA 3NV9A 2XQVA 4ZIRA 3HJTA 4H1WA 2W2TA 3S1SA 2I1LA 1JEDA 1MZPA 1G4UR 3CLSC 2P75A 4OQ4A 4K6MA 2O3SA 3M6KA 1O94A 5L51A 4XWTA 2HQBA 1RAFA 1A8SA 1U9JA 2YZNA 4HAWA 2OLJA 1WPGA 4RD0A 4ZXFA 2XY5A 4RTRA 2I6XA 4WJLA 5I9NA 1CZLA 3ABIA 2PGDA 1S3SA 2QE7D 3I3SR 3TEMA 1G8GA 2C4KA 4RS4A 1U9ZA 4M87A 1KY4A 4DO9A 3VR0A 3NHZA 4WKBA 5K09A 5HQ3A 1O58A 2XVAA 4DRZA 1AC5A 4TYQA 2M9NA 2NXJA 3QVXA 4JJ4A 2OCXA 2F3NA 1SAYA 3IBGA 1IQUA 4UB4A 1Z2DA 1PVQA 5DJ5A 1DDIA 1SB8A 4ZICA 3F3KA 4UTNA 1Y1RA 2X1VA 2DKOA 3N6RA 1W0JD 1H5QA 1KH2A 1CRPA 4B6JA 4LDRA 2ZJ0A 3ESCA 2N75A 1BXZA 2RHTA 4FFVA 4XPIB 4XVUA 1DC7A 4UFOA 4M9RA 3DMGA 1N9GA 4LC9A 1J0CA 2WEKA 2AFHE 4INJA 2DWQA 1P74A 1MDFA 4YHBA 1MQ2A 4LFCB 4HGZA 2P68A 2JVIA 2JLRA 2QX6A 1QTRA 1HDYA 5K0GA 3R0JA 2UVPB 1QR2A 4CKBB 1CDEA 3WKAA 4BECA 2B8NA 1PJTA 2ZJZA 1O6BA 4JT9A 4EFKA 4FFPA 1MLDA 1EJ6A 2A78A 3A1WA 2JHAA 2R44A 4DFMA 1Q44A 2CNLA 2ZIWB 1CDDA 3PEFA 4FYPA 3AR6A 1S7GA 2ZI9A 2ECPA 4DT1A 3NIBA 1RLOA 3CIOA 3EIXA 1UKBA 4R2HA 1P18A 2IUYA 3F1LA 1AXGA 4EB0A 3WKBA 4WY8A 3NBXX 3IB3A 3MFHA 2G07A 3UCFA 2ATEA 1TZCA 1L5UA 4ARSA 2ID8A 3LRPA 4C1NA 3N0TA 2GOYA 2ZRKA 3NG1A 2B1RA 2I2AA 2IA6A 2ZK7A 1ZEJA 3O8QB 2FLPA 3HI4A 3TLZA 2IT1A 1AF4A 4QUKA 5HIAA 4PPNA 4M54A 4NPAA 3ODGA 2IELA 3IQIX 5I7VA 3ENQA 3TARA 1ZI9A 5AW2A 1LD3A 4TZKA 1DKQA 1G3IA 3MMPA 1GILA 1K6XA 3BQMB 4X7RA 2VTBB 5TEVA 3UBTA 5BWNA 4WADA 1EWRA 3ZWDA 3I30X 3TOCA 5FLYA 3OFNA 5C8DA 4GLOA 4JB8A 1DX9A 3CRNA 1MV8A 4IDPA 4EEXA 4REQB 5TV2A 4BLRA 3HWWA 3H5NA 3REFA 1O0BA 1Q3KA 2ZBGA 5AR1A 2Z09A 1SD2A 4RPHA 3W5JA 1IN6A 2VUTA 1L4YA 4BO2A 1UA1A 2R6FA 1ICIA 5KNDD 2GF2A 3EC2A 4UVGA 4G0NA 4R1TA 4NC9A 3BDIA 1FTYA 2R6DA 4ND6A 2FFQA 5BR4A 2DF8A 4TPKA 2JD1A 3WGUA 4DYDA 3SYKA 4KBYA 4RIFA 2VXOA 4GGPA 5GY7A 1Z0IA 3I9LA 2KKPA 5LP6C 2LE0A 2NNLD 4DL2A 1MGOA 2GSWA 4PG6A 3DV0B 2H31A 3H8SA 1F2UA 4DDKA 1DAIA 1UPBA 2CLOB 1MF7A 421PA 3CN7A 2FFBA 3VPSA 3FAHA 1TECE 1CYEA 2IYAA 2HXGA 1CYDA 5J5VA 1NI4B 4OHCA 3P94A 3A2LA 5DXFA 2XTAA 2JH7A 2CL7X 1QOPB 2VG8A 4D4JA 2JA2A 4WXHA 1RM0A 2EX4A 3AB7A 3X1JA 4MR7A 3SXUA 5DISB 3CSSA 2QGFA 1Y1TA 2BE9A 1UFKA 1XF9A 3CNBA 1EEHA 5DTQA 1LGYA 3UHJA 1EH5A 3R77A 1RAIA 2PANA 1ZOSA 1DL5A 1TQ8A 3ROZA 4RNCA 3EPJA 1NUAA 1QAMA 2GSDA 1XKLA 2Z3ZA 1DRVA 3X0DA 2YXNA 2YIMA 3G5UA 3FLBA 4MS4A 4J0FA 2XCAA 4F45A 1NK4A 1JJIA 1HJPA 4RPZA 1YI0A 1FYFA 3E1GA 1BYIA 3G2JA 3DFKA 3LKVA 3GQBA 5JZVA 4DKXA 1CY0A 4M7PA 2W6JD 1UXIA 4EG6A 5JC8A 1N6NA 3J7AC 4W8HA 3G7NA 5CDFE 3ZHBA 5C2JB 4Q02A 2ZTEA 2AUMA 5J2JA 1UFRA 4B6OA 3EAFA 2JEZA 5LNK1 2GFQA 4HSGA 3TGPA 4ZZIA 1PBNA 3BDAA 4WCVA 2CXRA 3VR4D 1OROA 1NNLA 3L1VA 2QMUA 1U0HC 5EXPA 1P2BA 1XDWA 1MRNA 1KJYA 5J2DA 2NG1A 3U62A 2IOFA 3SKYA 2GN1A 3OEYA 4LDNA 3IAFA 1P7PA 3D6VA 2JK0A 3DE6X 1SZDA 5G5HA 3LBYA 5JD4A 3IGFA 3DO8A 1FDOA 3TRHA 4Z2YA 4C8LA 1VQ1A 4F8YA 3JQ7B 2EQ5A 1Q19A 4C7OB 3T3HA 5L9XA 1HT3A 1W5FA 3RSHA 5K8UA 2DERA 3NTOA 3HKCB 1M10A 1XJ5A 3OQMA 2QQ5A 5EKXA 4GR4A 4ZT7A 3ROQA 3LP8A 1SB9A 1XWIA 2JGJA 3GA5A 4KQCA 3KQLA 4CM6A 5DB4A 4DPMA 1V3UA 4TWIA 1ZJWA 1JIXA 3B0YA 4AKGA 2Y1IA 4KHZA 3QG5A 2GCNA 1P31A 5KJEA 1KKUA 2QUHA 4DR4B 1NW3A 3UK2A 1IBLB 3T1QA 4KR0A 2GOLA 4Q9DA 3KKAC 2Z3WA 4QEDA 2NUTA 4IUCS 4C5BA 4BZQA 4IINA 5BN5A 4QZBA 2WTFA 4EW2A 5KTNA 3BXXA 1ZM9A 5B1SA 2X9NA 3W6NA 4BNIA 2GAIA 2IUEA 3VZDA 5KFBA 1MA0A 3PI7A 4NBUA 4PPQA 5HOEA 4DA0A 1VI2A 5B5EU 2HK6A 3DEHA 3IT3A 5I7RA 4LV6A 2AZMA 4XFDA 4FWBA 3B1WA 3VPFA 3K9NA 4N5LA 3WTCA 3W5HA 4I4TF 3BE4A 2GAAA 1B00A 3HDGA 3CYFA 1M0TA 4M89A 3G0CA 1J97A 2HFJA 2J5XA 4GWKA 3SEQA 2ZIGA 1USIA 1EX6A 1LS6A 2CHVA 4BLOA 2BTQA 4JY7A 3RWBA 2Q4RA 4GC6A 4FMBB 4QOIA 3SS8A 2C2BA 3NFRA 1G3UA 4NMMA 5L53A 1WG8A 3EFEA 4EQ6B 4EJFA 3D9QX 3EEBA 1OWPA 1M2VA 4OFXA 4B3FX 1D07A 4HOYA 4CKEB 1P5JA 3DB1A 1H38A 3N7UA 1OYYA 5HMMA 3QYJA 3IN5A 4EITA 3FDJA 2FYTA 2FLWA 1XWLA 2M9MA 5K3SA 1JVBA 3KHTA 4CDRA 1LW6E 4AF7A 1U7PA 3U3RA 3TL3A 3OT4A 3ZCRA 1UJ5A 1BXKA 4LWQA 4LZWA 3IAXA 4KLFA 3RS8A 2BP7A 4EG1A 1ZNWA 5HYVA 3RRMA 3WWEA 3VUEA 1SU8A 2YZMA 3AF6A 1X7XA 1M1UA 3K5WA 3N9IA 4YGYA 9ICEA 5GAJA 3DJYA 2X6RA 4A2QA 4BX9A 1TEVA 4XGRA 5F2OA 4GFDA 2CJWB 4Z49A 4X6UA 5LOVF 4QM7A 3HL0A 4Q1DA 4LQDA 1HGXA 3SHWA 3QE4A 1KO4A 5TIIA 1BDIA 2V74B 4F3YA 3U5ZB 3KWMA 2W0MA 1V16B 2QYHA 3BSWA 4EP1A 1PLJA 5A1TA 2I4TA 2V3WA 1LPMA 2RIRA 1SUAA 4HQLA 3SSOA 2P2SA 4EY6A 3KU4A 1CRZA 3CLUC 1NNI1 1HYBA 2G25A 3S5UA 4B32A 5AKZA 2A4MA 4LE2A 3M1IA 1J06A 1TD9A 2VRCD 1T24A 4E5KA 1NW9B 5KYWA 2VJPA 2YW2A 1QIMA 4ZYZA 4PCLA 4US1R 5KT5A 3FJOA 1Z26A 1P1BA 4P08A 1K8RA 1AK1A 3AIKA 4UM9B 1JJ7A 4Y1GA 3RSLA 4KAJA 4DMRA 1KNXA 5CK5A 3GAZA 3PXDA 2BSQA 3RJEA 3RH5A 4NARA 1UDAA 4QU8A 1WPRA 4YVZA 2B20A 1ZWKA 2B82A 3RAFC 4Z4HA 1PLLA 2XHEA 4AP9A 5E38A 3EUFA 4DOAA 4JP5A 4U6PA 4ENQA 1ODIA 2GHTA 1IOWA 1MD9A 5CD1A 2NZUG 2V6IA 2VWHA 4E5SA 3P71T 4ZI2A 2X8JA 4CVNA 3BQ9A 4PYQA 4W9MC 4JC0A 1ZQIA 4R1MA 4PH5A 4UCQA 1N6PA 2PR7A 4A0QA 2PZJA 2PG3A 3BBLA 2FG7C 3A70A 3N2YA 2JFWA 1JRPA 3CX8A 4CG0A 5DHPA 3FG9A 3C5HA 4DZTA 3WRYA 2O50A 2CXSA 3E9CA 2WB1F 2IHNA 1X92A 1YIAA 1LK7A 1UT8A 4RESA 1DVRA 1Q12A 3N8NA 2XMQA 3UOGA 1QO0D 3E5RA 3GP5A 1KAHA 5DB7A 4UM9D 1CHDA 3C14C 1PQWA 1JG3A 1NVMB 1ZESA 5K05A 3WYAA 3EEQA 4F4JA 4PPFA 2EX0A 3PDUA 3VJRA 1RXUA 2NQTA 4G5XA 3KKKA 1U0JA 1TCAA 3OICA 2B21A 4IDEA 1H4SA 4XWWA 2WJPA 4EYHB 2D00A 3FKQA 2XGPA 2D5LA 1YZQA 3T7SA 2I6UA 4BMSA 1ZI8A 3GIWA 3CR7A 1DLJA 4IZOA 2Q6KA 2VYVA 4BOYA 3V7WA 4CL0A 1E7QA 4HYYA 3P1JA 3JZAA 4YJDA 2FPKA 1FUUA 1Z63A 3VAYA 3SZ3A 4OHXA 1A8PA 3B6MA 3T0GA 3I05A 1ZW6A 4NLZA 3UJ6A 1EGHA 4MKHA 3QE9Y 1LVGA 4YI5A 5AKJA 4M1TA 3OLQA 2O4CA 2ZPUA 3PSIA 2XQKA 1IU9A 1UDBA 2MIIA 3UFXB 4IDBA 1NK0A 2A3VA 1WETA 3QXCA 5HM8A 4G23A 2NPIA 3WX0A 4NK4A 2Q7XA 3OCJA 4JVSB 4ARBA 3JQ6A 2AVNA 2I91A 3BBPA 1C7JA 2ZVQX 2J4CA 4MYRA 2DAPA 1XA0A 3H8MA 1K7YA 1Y8CA 4BVLA 4HLCA 2XWSA 1D2MA 1FFVA 4D8VA 2GYYA 3ONEA 2WINI 4EJ0A 1XCJA 3T5BA 4KGVA 2EGHA 5AW3A 1HA3A 2GLTA 4AKIA 1D3AA 5ETJA 1DG9A 4TV8A 2PLRA 3FAZA 4IKOA 1HUQA 3SQWA 2JAPA 4J1TC 3STUA 3ROKA 2JIPA 3AYZB 1N4DA 4Z7QB 3AMVA 2JHCA 2WM3A 3L01A 1EX1A 1W30A 5DM1A 3K9WA 2H9AA 4EKYA 2J0UA 3R6LA 1HBJA 2TRSB 3PA8A 2QRGA 3AF3A 4DOBA 5D51S 2P90A 3UPDA 3GLUA 3P9KA 3K0KA 1TEHA 3MG9A 2Z0MA 2C8JA 2XIQA 1XRSB 4KXYA 3QJGA 4QFCA 3Q3EA 1ZM3A 3BFXA 4H60A 3N2ZB 1Y4SA 4UAUA 3CN9A 1GFZA 4TVBA 5KFOA 1E0AA 3QVTA 2BIFA 3HEBA 2ZUVA 3IIIA 3DZJA 4HMPA 4RPCA 5IRCD 2FMTA 1SUBA 3AU6A 3PO4A 4N18A 1QORA 5K0BA 5KG7A 4J07A 4KH1A 1EB9A 1UMKA 1W46A 3S55A 4CV2A 1FMFA 4P58A 3V9PA 3LRTA 4I5IA 4RK1A 2O52A 2A7XA 2PFSA 2GEUA 3C2QA 3UMGA 2AOUA 2VT2A 2JEGA 3QUAA 1Y8ZA 3NP9A 2GASA 4MQFB 2ONZA 1DV1A 5E6RA 1CJTC 2QTGA 3DL7A 2X3FA 1EP2B 4DKJA 3RB6A 4CEHA 1OTXA 2X5JO 4PRYA 3FPHA 1MB0A 3R8XA 4JK3A 2FMPA 5FLEX 4CFZA 5EQFA 5EZ6B 4F84A 4OGLA 1ZUNA 4ZOLF 5JDCA 3STXA 3ZYCA 2OGWA 5DLGA 2P6OA 3CSDA 4X6LA 5JALA 4X1KA 3KE8A 3VMMA 5HJ2A 1MH1A 2DOKA 3FNFA 4DPKA 3IBTA 3W5DA 4K26A 1K1QA 3D4OA 4H16A 4HUQA 5BW4A 1C3VA 1JQAA 2PXCA 3NNNA 3WWDA 1T5HX 3D0RA 4NJMB 1EGQA 1B15A 1R27A 3PFWO 4D45A 3MMNA 3QWHA 5KTYA 5J4HA 1EHIA 3EF0A 1H2YA 4EYGA 2VJNA 3RBZA 5J40A 4PW0A 2EHJA 1UBJS 2ZRQA 1EB8A 1RYRA 3KFXA 4GZ3A 4C06A 1ZXLA 5EUBA 3CZCA 4LHSA 4Q24A 2FR8C 4LKOA 3AW8A 4BLSA 2OEHA 1BGWA 5G4KB 4CIVA 3F5AA 3MCVA 1DBSA 3D4IA 5EUCA 2IPXA 1U63A 3AY6A 5EIFA 3OZDA 2I6SA 5EMLA 2JLWA 1RQLA 1TOAA 1JSXA 3PK0A 1XB2A 4H7JA 4BX8A 2AI1A 2D1SA 4RF5A 2B9VA 1XL1A 3EPHA 8ICSA 3F7NA 4R64A 4GBMA 4GPEA 1ID1A 4G0OA 4J0QA 4TKVB 2GDJA 1GG2A 2PA0A 4W5HA 2AK3A 2KE5A 3ZHRA 4JBHA 1BD4A 5AM3A 3NNSA 3VSAA 1AHNA 2CJFA 2W71A 4NY1A 3P97A 3E3AA 1CC1S 5CTJA 3HNPA 1C81A 2G4LA 1XSNA 1JIQA 2TECE 3VSEA 2P3SA 2RKBA 3UGQA 2G1KA 3CLSD 4OSOA 4DM4A 1YDHA 3M8KA 3R2JA 1P5HA 3EYZA 1H3EA 1JW9B 2MINB 4R05A 1HL3A 2FAXA 4Z4FA 2ZI7A 2ONYA 3IUEA 1KMIY 5EWJB 1S9DA 3KEMA 2I3BA 5D3MA 2BZSA 2EZYA 3L41A 4H7HA 1Z73A 3OLXA 2RHJA 2DCMA 3DTYA 2OV8A 4DL9A 3WK5A 3MFIA 2C8KA 3G0GA 3NVYA 4DIKA 4ZRDA 1CF2O 1LLUA 3ZK8A 3S28A 2PFNA 2YYZA 3U60B 4JQSA 2IXGA 3FAKA 4CTKA 3AEUA 2PH1A 3NWJA 3PGVA 1LQ2A 1EIZA 5AJVB 2WB1C 4L6IA 1KVUA 2HUNA 3HXTA 1K8YB 3SX0A 4UB6U 1TT5B 1JDZA 5CA0B 1AA9A 2BYTA 4DSFA 3W7AA 3BJMA 4W5NA 1TAMA 2QIPA 3CRQA 4C07A 1E60A 3PFCA 5TGDA 3LT2A 5ALQA 3GV8B 5CT5A 3IOCA 3RV4A 5JOQA 3IPXA 4DA4A 3ZR4B 5SY9A 3OVMA 4AYTA 3EULA 3VJMA 4F3RA 4JEUA 2NVBA 3O1LA 2BFOA 1B8PA 2WA1A 2Q1YA 3GF4A 4EVIA 5KJFA 5LZ5A 4A5OA 5TT1A 3JTEA 4UMFA 1IYZA 4TMZA 9ICQA 2RBGA 3HP4A 3S2EA 3ZVKA 1JXQA 3FE2A 4BBJA 4YT4A 1QHHB 2FZ4A 5HX7A 4U8HA 4IO0A 4LVCA 5LQAA 4LJ4A 4RJLA 1KR2A 5DLQC 3CWQA 5B4UA 4MV6A 2X0FA 1V4VA 5TQ2A 4S0ZA 4AFNA 2WFLB 3VKFA 4R01A 4IKPA 3GLKA 1NMXA 4QPCA 2VA9A 1YU6A 5KCMA 3VR6D 2TS1A 1Q2UA 5HTKA 1ZETA 4YDSA 2JJQA 2P9EA 3FPFA 2V7QD 2EAOA 4UBBA 1E7RA 2H4XA 4IVQA 2I78A 2FP4B 3RJZA 3IA2A 3M9XA 2ERCA 1N2ZA 1A71A 4FYKA 4G24A 4YR7A 5LP6B 3EPGA 1KFCB 5DHRA 1G41A 4CDMA 4HGRA 3CZ4A 4Y0VA 3U9LA 5BT8A 5BVHB 4RTPA 1CNMA 4R63A 4OLJA 2F76X 1ZOIA 3A4LA 4E7PA 3EXEA 3WWYA 1XALA 1A0OA 3IQWA 2I8LA 1ZN7A 2P77A 1YDWA 5FV7A 5F1YA 4OAPA 4M9JA 3PD1A 3TIXB 1KRWA 2QSZA 4ZDJA 4Q03A 2IF0A 3C3XA 1ZAKA 4R83A 3PUJA 1Z2PX 4MROA 1PS9A 1XLTA 3WLPA 4G5RA 4BRUA 1U9IC 1MHPA 2R6R1 3HACA 5JXHA 1MIOA 5BWBA 2JJMA 1SIBE 1GSIA 3HB0A 1U1DA 4KNYA 4IDQA 2EJUA 2GPWA 3EPKA 3EFOB 1JLLB 3N8GA 3NQ41 2QBYA 1US8A 4R3NA 5FR1A 1NYQA 1KGSA 2O1XA 4OUKX 3SJCA 2DL0A 2GEFA 4JOBA 2H59A 5EHGA 4RQ0A 5CVEA 2FTKE 2XNHA 4O2AA 3AZOA 1XIVA 1FXWF 2HU7A 2BEUB 1GTMA 1QRSA 5ALEA 5HKBA 5JZOA 2RLTA 5J2FA 1B1AA 1HYHA 1Z7WA 4XQ9A 5B3JA 1BSVA 4D9GA 4U5XA 4TV9F 3DTVB 4D0NA 4NI5A 3LPLA 1BRMA 4FGWA 2PLFA 4ARAA 1UJCA 3B89A 4NY8A 1DLIA 1WDMA 2OZVA 4ZHQF 4NZOA 1NHGA 3P45A 4Z0PA 4C4OA 4PL2A 1NY6A 5D3QA 1M5RA 4BZXA 3NJ4A 3A1DA 4LY0A 4EWLA 1SBQA 4ZXPA 1Z0JA 3O94A 4X8MA 4YMUA 3VISA 4MTLA 3H6GA 1W59A 1RPNA 2VZ9A 2CF6A 1C80A 4Z4IA 2ZYHA 3JV7A 1SEPA 4QG3A 5BSVA 4J7CA 1PWXA 1Y5NA 2FHSA 1RAHA 1IXKA 3RUFA 1RFGE 1KKXA 1GGKA 1R64A 1PJ8A 1Z6GA 1KF0A 1TFRA 3SDBA 5FCDA 2ZIAA 4FM9A 5IYZA 3CIFA 5E6SA 2VTDA 3TANA 2DY1A 2EAPA 5DBAA 4DM3A 5K4LA 4M1SA 2PH7A 4XW2A 3PUZA 2ZQYA 5D2CA 1Z00B 3AETB 4WW0A 3EXFB 2GD0A 3EZ9A 3H5RA 3KZOA 3SQDA 2YOGA 1NN3A 4V03A 4ECVA 5E1MA 2R18A 3DTVD 4AW9A 3JPQA 3SZUA 2CHEA 4MLPA 1X9MA 1CDOA 1W6UA 4RHFA 5K3OA 1Y63A 3ZHSA 2I67A 2X5OA 2DQNB 3IHKA 1BH2A 3DCIA 2Q3BA 3THYB 1OX5A 4LMAA 1SVSA 3B3QA 5AOAA 4YH1A 1X80B 4CDGA 3IHWA 4FE4A 5DK4A 4GX1A 3WBBA 1ODKA 3BAZA 1VZ2A 3GLHE 1RTKA 5BO5A 2W8BA 2A8YA 2H29A 1SKRA 3M33A 4U3JA 4PPYA 3BGOS 3PE3A 3ROXA 2AW5A 3KZNA 3SNHA 2NU6B 3HA2A 5IF9A 3MXTA 4OM7A 1VMDA 4LJ5A 1KH1A 2OK7A 1APBA 3K1JA 3A6LA 4E11A 2E4VA 1ULHA 4A6XA 3QLEA 3PC8C 1R8QA 2P66A 4A8JC 2E4YA 4C9BA 1E9CA 4I3GA 2O14A 3BS7A 4FR0A 1FU4A 4RVDA 3NC1C 4WBNF 1DUSA 2BMWA 1H69A 4WKNA 4IRCA 4RPIA 3ETCA 1Z4JA 5GVSA 3OU7A 2BHSA 1WBDA 4DCSA 2ZDGA 1O6GA 1ORRA 5T4BA 2XNJA 3NW9A 1R9MA 2QLTA 4J6EA 2L5YA 2PUJA 4EA6A 4OK6A 4PX3A 3WYFA 5F3RA 4B6GA 2ROQA 1RVDA 1VL5A 1DBQA 3AN1A 2VJYA 2IH2A 4YJ2A 3EY4A 2BKAA 2RHDA 2Q3DA 3WOVA 2YXPX 2FWNA 2O5VA 1TD1A 3GRVA 2PX2A 2Y1XA 5BNTA 2HSZA 4YA6A 3T4EA 2XT6A 4KLSA 3K5IA 3G2LA 5CLLA 3SKXA 4QATA 3LT5A 3QNWA 3QZ8A 4EDFA 1H9CA 4IJVA 4BMYA 2J31A 1IXRC 2JIRA 1NUQA 3QGMA 4MINA 5BPFA 4KPEC 5CDSA 3H2IA 3IT0A 1R4MA 1N5JA 1SA0A 2XGJA 1E3WA 2BZ0A 1IXSB 4E2WA 4JLBA 4C88A 5DV9A 1SURA 1QGYA 4GKKB 3WI7A 3BQ7A 3OPNA 2ATLA 4AQ7A 1CSEE 1OKKD 1XG5A 2VJQA 1L4BA 2E21A 4BNJA 2E8PA 1AKYA 2QVBA 2V1UA 4EMTA 2Q49A 5K99A 4OTZA 5K4AA 1P91A 3DOUA 4UVDA 4OJPA 2J4DA 4UATA 1PJCA 1DAEA 4RD4A 2FCAA 1E1QA 4URHA 4L8FA 1SD1A 2B2CA 3E2PA 3CW2A 4CMEC 4XIJA 5HF6A 1WSAA 2LPMA 4LRWA 3ANTA 3STWA 5DBBA 1P60A 3ZCTA 2WWRA 4G0UA 1WMBA 4Z4QA 3HN7A 4TN1A 3B0XA 5CFQA 3DFZA 2EH9A 1ULUA 1TAQA 3F2CA 4O4IF 5ALGA 4AN0A 1PU2A 2CB9A 1WABA 3RVPA 5K8JB 5JU5A 4B9EA 4A0RA 1DJNA 3CW8X 2LBOA 3CNHA 3ETNA 2UZ3A 2NRXA 1DWUA 5LZ9A 1LKZA 2OO7A 3ZD8A 2VJAA 2HF2A 4UDXX 3FWZA 3H04A 3DTTA 4KE9A 4RCYA 1UMBA 3QU2A 3AJ9A 3N2IA 2FZKA 4ZC8A 1I13A 5BSTA 1KVRA 1ORDA 2HWYA 3KQTA 4BNDA 3FTEA 1ODCA 2OWEA 4DOMA 4RTQA 2PSJA 2E82A 4TKLA 3ZU5A 2FPUA 3UOWA 2V0NA 3CRZA 1WUTA 4Q3DA 2K8BB 4CKWB 4IJWA 5G2OA 1M6EX 1CNEA 1JVNA 3TN7A 4S35A 4RZSA 4RF2A 1DMSA 2QTCA 2Q41A 3VKUA 5EC8A 2QP4A 2XZOA 3CLUD 3BX1A 5J2CA 3U7IA 1EMDA 5DT2A 1ZGAA 4KXUA 4D8XA 1HZZA 3E84A 3GJ8A 2PBLA 1BFKA 2JH8A 5B30A 1QRAA 1BE0A 1I3CA 1E2LA 1T8WA 1RADA 3ZQKA 2VHVA 2RC6A 1KRPA 2GEVA 1NK5A 4HNHA 4CM4A 3DMDA 4RZ2A 3OE7A 5EWLA 1G8SA 3JZMA 3V33A 4FGZA 1QLJA 3ZV4A 1H1DA 5EPEA 3WSTA 1K0FA 4IMIB 3OKPA 3A31A 2P67A 1YJBA 2G5PA 4IR7A 1MAVA 3G17A 1ZX1A 3LNTA 4L1KA 2NPFA 1QZTA 1E7WA 3STHA 4YMNA 1BXGA 4J3FA 4BO3A 1SHJA 1IMOA 2A9VA 8ICWA 1ZOPA 1F2VA 1CNFA 1O96A 2BKEA 3KXDA 3T38A 4Q3OA 3CRW1 2NOAA 4QVGA 5EHXA 1BROA 2EGUA 4J2OA 3N7SC 3QU7A 1C7YA 2WAAA 1HEYA 3NHKA 4C2UA 4D9KA 4AJ9A 4MEBA 1ZITA 3BMXA 2VYNA 3FHOA 1ZEMA 5CGZA 2IXEA 5I9LA 3GFGA 4M0EA 3EBLA 4LXIA 2QX4A 4GICA 3QHPA 1KKLA 1VE6A 3HVUA 4M9XA 4DV1B 5ALLA 5UKDA 4ZVPA 3VNBA 4WNIA 4C6SA 3PUIA 2Y67A 3D2BA 4M9GA 4MWOA 4NLCA 5KG4A 1P7VA 3BF7A 4G84A 1YZNA 2YB1A 1YK1A 4W9NA 4IWNA 2G7MC 2C5LA 3AUYA 5IBCA 1L9KA 3Q0TA 3QFSA 5DOZA 2ZIXA 1TQDA 2H16A 3P2OA 1M2GA 1FS5A 1T2CA 4IIHA 4YDQA 4OMFG 2P2DA 3BB3A 5DNWA 1P0CA 5BUQA 4UQGA 1XOIA 3SC2A 5EHQA 1J49A 3VU0A 2QRVB 1NP7A 3R44A 2KJ9A 2DPLA 2F43A 2Y27A 4LYAA 2R96A 4ZQBA 2AF4C 3TNLA 5IAOA 3UJCA 4B0OA 5LM3A 1KJZA 4WVFA 5DB8A 3W7BA 3DMPA 2C84A 4TROA 1FNSA 2O2IA 4ZCTA 1L4MA 5I9IA 2ZRDA 2KSOA 2X58A 1FS4A 2CLKB 4C0ZA 2RRDA 5KAPA 3N7TA 4QFMA 1LV7A 3UWKA 3ETLA 2HLDA 5BN4B 1NKVA 2AR9A 4ND3A 1GU0A 2K60A 3CLRC 2NSHA 4EAAA 2Y1KA 1P1RA 1UOQA 4ZDIA 1XXHE 5E6UA 4KE7A 1E5TA 2UUCB 2F3QA 2KNJA 1T3LA 4TM8A 4UEWA 2Q6TA 3NHJA 4W1RA 5F1PA 4K9QA 4M21A 4EUEA 5IJ0A 4ALNA 4G8JA 4ZT3A 3IPRA 2YWFA 1OXVA 3WL3A 2DQYA 3F6EX 1THZA 1YR8A 1Q6YA 2AMFA 3CKMA 1VB5A 1L5LA 1WB5A 4JX9A 4B0PA 1VJTA 3ND9A 5TGZA 1JPVA 3ZZ1A 1VE9A 3MTAA 1HV8A 1N2CA 5A4FS 7AT1A 4P3YA 4RQTA 1R18A 3QX7A 1GWNA 3SZRA 4NBTA 4O2BB 2CCJA 4GLJA 4ZEXA 3GHHA 3CNNA 2VJOA 4BAZA 5JXGA 1EUYA 4N0MA 2Z2KA 1BX0A 5ESWA 3RK0A 3O93A 3NAGA 3HJFA 3WBJA 1PFVA 6CHYA 2Z1NA 1KS2A 1X8LA 5AKLA 1QQAA 2DSTA 4KXFB 1YR6A 2Y1EA 4C89A 1YL5A 2D1YA 4C5AA 4QIHA 2PUBA 4B3DA 3ZNPA 1FMLA 1TF7A 1RIFA 1Z45A 3TLEA 4LZAA 2VDWB 4ZHSA 3P0HA 1YRAA 2PZLA 3ORHA 3TFRA 2QY6A 4XYBA 4MUBA 2WILA 5I7OA 3KJFA 4YMWA 2I99A 2FV8A 5FUYA 3CEJA 4XX0B 2QU8A 2BGMA 3QE3A 1JN0A 2EIXA 3MS4A 1UKVY 5IPFA 3V7YA 1LSSA 3REQB 5HJ5A 2VHZA 4UUQA 4KN4A 2P6PA 4RQ5A 2HMAA 1DEXA 1JBQA 5EMHA 2FVXA 3WY9A 4Q3CA 4D6YA 2REXB 4CN8A 2ONJA 3L49A 2JKVA 4F9GA 3W5CA 5KNIA 4XXHA 1R10A 4OATA 1CU1A 1WHSB 1QVZA 2FSSA 4X20A 2WZCA 2WK1A 3LUDA 1PK7A 3BHIA 3TI0A 3K1AA 3LCMA 5KFJA 4BY9E 3C7TA 1RACA 4I1VA 2KMDA 1DUVG 1W2WB 4MW2A 4B4VA 1F8GA 3QK7A 5C8YB 2H3FA 1W19A 1XLWA 2P0YA 3FDXA 3H1PA 3RIEA 4IL5A 3HBLA 3U1BA 1O5TA 5FEMA 3DPUA 4X1IA 4V2IA 2BI7A 2PI5A 3UTDA 3I9MA 3DT6A 1L7PA 2BHLA 4RTKA 4ALLA 1SHKA 5B5SA 1OZGA 1T8TA 2Q29A 1N60A 4JV5B 3DO5A 4HJRA 5HIJA 3K0AA 2WM9B 2YXDA 4DIFA 3JY6A 5DNVA 3KJIA 4F4FA 2BQ3A 1ILWA 3SVLA 1ZBQA 2FXVA 2VUUA 4EECA 3BFPA 3GEPA 3RDPA 3MC1A 3N58A 5T67A 2WHRA 5DCWA 4UDYX 1VJRA 4RIIA 2LIVA 2BT4A 3T4PA 4GPD1 1CZOA 2HO4A 4NFSA 4FU0A 1L5QA 4DG5A 1A9OA 5TMBA 4BP3A 4AY3A 4ZN6A 7ICGA 1DNPA 1S6YA 3BKWA 2BDEA 2VF8A 3P9NA 5DDYA 2ORVA 1P73A 3HVHA 1VA4A 1ZOLA 2JAHA 2PFPA 1M1XB 4IQ8A 4EZBA 3CE6A 4D9EA 1YFJA 1Y9AA 2WTEA 2QGZA 2R86A 1YS2X 1B3RA 2LGJA 2OBYA 1NXWA 2SKDA 3LPDA 1BPEA 5KFLA 3A3OA 3DPSA 2RGUA 5FHRA 4C7ZA 2FY8A 1T2NA 1AB6A 4WTOA 4D02A 4Y9DA 3RREA 4NNOA 2QMYA 4EYQA 1TJYA 3PD7A 4NK5A 2NYRA 3V4LA 1BPXA 2PVCA 4KL8S 4G5QA 5E1BA 4GU5A 2WD7A 2HREA 5LL6P 3LT1A 3INNA 2XE8A 1NMZA 3EMVA 4DSLA 3PUYA 1FP6A 2ZWMA 1M1ZA 4LXTA 1E32A 3N0VA 1VKHA 2ZXHA 5J4KA 2P6UA 3KXKA 4F7WA 3FJYA 4P6VF 4H3VA 3DV2A 3E3OA 2MSNA 4U63A 2MSCB 4M53A 5BRJA 3EIOA 2PMFA 3MTJA 4TXJA 2RH5A 3F1KA 4FZLA 1U99A 3WL8A 3IMFA 5JD6A 1D1PA 4JI0B 2BFEB 3MD9A 5T3YA 3FHJA 4ZP1A 3NIWA 3DBRA 5A3QA 1U5CA 1RBZA 5IIJA 1L5HA 3ASVA 3W2TA 4WLEA 1I7SB 1YZLA 3RJFA 1XMVA 3EIFA 4RJ2A 2R48A 1FVHA 2HO5A 4XWAA 3WG9A 1WOMA 2UYOA 3UY4A 3BREA 4D26A 4ND5A 4N9WA 1W75A 3NBQA 1N56A 4KZPA 2X6TA 3PJEA 2BPGA 4OP3A 3UAOA 2OZLB 5J23A 3UMCA 3KJEA 2Q9CA 1VOTA 4AK9A 3FUUA 4U4AA 4HAXA 3QNMA 3ZDZB 3HDTA 1Q7TA 3H9GA 5DGCA 4FLFA 4KB5A 3ONNA 3IFSA 4A3SA 2WF7A 1QNLA 2JCVA 3GW8A 4UVHA 3TRJA 5EIEA 3I5UA 4ZJYA 1Z47A 3PNSA 1E0SA 2DTEA 3ZS8A 2OKGA 1FRFS 3FGZA 4D9MA 4X00A 1CEEA 4XVHA 3AVYA 3V3TA 4F06A 3QHAA 4C7MA 1NYTA 2LD4A 2XE7A 3OZTA 4YJGB 1XTKA 2XBLA 1L5VA 1FFHA 1L4NA 2OA0A 1ZCBA 5J2AA 1V7PC 4GM4A 3OQBA 5LD2C 2H0AA 1C9YA 4D56A 3KJZA 4H7EA 3QFFA 3L77A 2YTZA 4UASA 3QEAZ 1XMXA 2IPAB 4PQEA 1LZLA 1FNDA 4ZGBA 4NJEA 2UYQA 3PPWA 5DRTA 1NXOA 1CQZA 1K3UB 3B20A 3W8FA 3R3ZA 2A5JA 3INGA 1CKEA 3T0FA 3DLIA 4JJ6A 5D7NA 2ZBFA 3TQIA 5CB4A 5DBIA 2R6AA 2BBOA 1QPGA 5KG3A 3PNOA 5EAIA 1N7JA 4D43A 5E1OA 1PFWA 3ZUPA 2X5KO 3AG5A 3IIJA 4K6OA 1MB2A 3I8SA 1CQPA 4PLHA 3IR7A 2FSVC 5DN6D 4AN4A 4NYIR 2FK7A 1F0YA 3UXNA 2EOAA 3H2KA 1WX1A 1XWFA 2W6PA 1ZCFA 1YB4A 4KRGA 3QZUA 4TSKA 3KKLA 4MVJA 2V0GA 5GONB 2NZXA 3H0LB 1MNQA 2BGNA 4RY9A 4MB2A 3PO5A 3AY7A 4ZVVA 5F3DA 1GFWA 1TKRA 3P4UA 4O3NA 5AIBA 1TW2A 3MRTA 1F3LA 3U6BA 1GFIA 4RIHA 2HCRA 2F1JA 4EEYA 1R0CA 3KKOA 4YR2A 1QUEA 2GN4A 3A9TA 2ODTX 3FHCB 2ESEA 3P9SA 1JH8A 2R7NA 2CYCA 4GXJA 4ITVA 4RFSA 1Z9BA 2FUKA 3CUKA 1U8XX 1VECA 4IAOA 2HPZA 4DBLC 2CB0A 5IP5A 3HSSA 1FFEA 4FFNA 5LMCA 3W90A 4DL3A 1E0KA 4EVQA 5CFLA 4U2DA 2XBUA 1ST2A 4XGNA 3JPRA 2Q5CA 5KFMA 4OOEA 5FTLA 3FFWA 4Q9NA 1YZGA 3JPOA 2MYUA 2NTEA 3PTZA 2OE2A 5FBQB 3P27A 1G20B 3ETEA 5CTAA 1OXSC 2EFYA 1NG9A 2PN1A 4WK6A 3K9BA 4QXAA 2QB5A 2VJMA 4F4ZA 1Z8NA 3HEAA 4UQPA 3CKKA 1K4YA 5D7BA 1Q3HA 4ZOLB 3WIDA 1WPXA 2CUNA 1OLXA 1YR9A 1JA1A 2ZCVA 2H2WA 5JYBA 4GZ6A 4WWHA 2GVDC 2Z98A 4DJFC 4DTIA 4HB4A 3KKMA 2BQRA 1AN9A 4DQIA 1X2EA 3ZXIA 3PXBA 1WXXA 3BXPA 4BBPA 2K89A 3HGQA 2QKQA 1JAHA 3RJKA 4FEYA 4HDMB 4IFTA 3DLHA 1GUZA 1SCUA 5FD8A 5I7AA 3GLIE 1B6GA 1SV0C 3HZHA 1NBHA 4MW4A 4BKUA 3EPRA 1XPUA 1NSTA 1OIWA 1QGDA 3FZQA 2J46A 3EGDB 4ND7A 1IOVA 1GM5A 2FJPA 1XZMA 5AKHA 1EJ0A 3GPCA 4KQIA 2BFBA 5IASA 2BRUC 1JDSA 2OYRA 2FEXA 3M5CA 4QU9A 3UMRA 4NMHA 3L0OA 4J9OA 2HHQA 4XCXA 3LH5A 2DFTA 5FWDA 2GZ1A 2JIQA 1L7VC 1P17A 4H0FA 2REOA 1GKYA 2NWQA 2JLSA 4B34A 5JNVA 4KYIB 5LA6F 5KWVA 4DAOA 1XA4A 4FJ0A 4ZCLA 3OHPA 3EGOA 3HM9A 1DAMA 2DHCA 5ER9A 3TM5A 3U17A 1CX9B 2Q1TA 1BOFA 821PA 1E0JA 4XGQA 1NQ5A 4M60A 4C0LA 4A8JB 2FJ6A 1ZWLA 1PW5A 1RMYA 2R8OA 4UHCA 2JIDA 1KDZA 4UDOA 1G8AA 5D01A 4PYOA 1MTZA 1Z2OX 2GZ2A 4MW9A 3VV2A 1V8FA 5JI2E 5CX4A 4KE6A 3TSYA 1E1LA 3QMWA 5HZKA 1POXA 4P38A 2RGDA 2OD2A 1NL3A 2I4RA 3DBLA 3FOAA 4KMMA 3IELA 4PINA 5A7FA 1OBFO 2X2FA 4RFVA 4FI3F 1FRNA 1TLTA 3WNCA 1P7WA 1ZQKA 3RRGA 1TQ6A 4F2WA 4JK1A 1LPPA 2CCKA 3B7PA 1NQTA 2O54A 2HW8A 1A5SB 5F76A 3AHEA 3ESXA 2A94A 2W2PA 1V1RA 1F51E 1TU0A 1QB8A 2W9CB 5ICSA 1YO6A 3T95A 1ZGHA 3EEOA 3M2PA 3TGWA 1BMDA 2BFCA 4MWBA 1LWNA 4DVJA 2EV9A 3PHJA 2V7PA 4RZIA 3F97A 3PQCA 3RFFA 3IMEA 4S24A 2H8GA 4KO3S 5CX1A 5IILA 2XPCA 4DQDA 1OXXK 2ATXA 2IP4A 1C7FA 4Q44A 1G21E 1Y3AA 3N28A 7ICKA