3QNMA

Haloalkane dehalogenase family member from bacteroides thetaiotaomicron of unknown function
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
231
structure length
231
Chain Sequence
LKYKNLFFDLDDTIWAFSRNARDTFEEVYQKYSFDRYFDSFDHYYTLYQRRNTELWLEYGEGKVTKEELNRQRFFYPLQAVGVEDEALAERFSEDFFAIIPTKSGLMPHAKEVLEYLAPQYNLYILSNGFRELQSRKMRSAGVDRYFKKIILSEDLGVLKPRPEIFHFALSATQSELRESLMIGDSWEADITGAHGVGMHQAFYNVTERTVFPFQPTYHIHSLKELMNLLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Haloalkane Dehalogenase Family Member from Bacteroides thetaiotaomicron of Unknown Function
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Structural genomics, unknown function
molecule keywords Haloacid dehalogenase-like hydrolase
total genus 90
structure length 231
sequence length 231
ec nomenclature
pdb deposition date 2011-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3qnmA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3qnmA01
4BX2A 4HGQA 1RMTA 3ZX4A 4EELA 2C88A 4UMEA 2B1QA 5ALNA 3N28A 3WK7A 2IOFA 2WF7A 5AI9A 2P27A 4MUMA 3B9BA 3EWIA 4DW8A 4Y2UA 4UATA 3U19A 5IT0A 4Y2QA 3E81A 3B8EA 5AW5A 3DAOA 3KBBA 5AIAA 1EK1A 2FUCA 1Z5GA 3SF0A 2YMQA 5ALJA 4HGNA 4RETA 1ZD2P 1ZD5A 3QGMA 4KNVA 3W5AA 3L0CA 1QH9A 4UMVA 2JARA 1AQ6A 3FVVA 4UM5A 2ZBDA 4XE5A 3SHQA 3J7TA 2X4DA 5ALMA 1LTQA 1SU4A 4E88A 3E8MA 3OCXA 4KN8A 4CF3A 3EPRA 5AI0A 5AESA 5ALGA 2FEAA 3L8GA 1VJ5A 3PGLA 4EENA 3OCWA 4BYGA 2G80A 3F9RA 3A1DA 2OA0A 2I54A 3I6BA 2R8XA 3WKBA 3QX7A 4YH1A 4UMFA 3MN1A 1Z5UA 5ALIA 2HSZA 1RLMA 3PGVA 5ALUA 5E0OA 2DQSA 5AVSA 3MC1A 3WKCA 4ZEWA 4Y2RA 3N07A 2ODAA 4UW9A 3QUBA 2CFTA 1L7OA 4ZEXA 3QLEA 5IT4A 3ZW7A 3PCTA 2FPXA 1WPGA 3DDHA 2ZXEA 3BWVA 4H1WA 3UMCA 5A3RA 5AKLA 4QQFA 2HCFA 4EZEA 5AM0A 3NUQA 3WK9A 2B82A 3ZWKA 3M9LA 1RDFA 2BDUA 3EF0A 4MWOA 4UU1A 3AR9A 5AVXA 4FFDA 4I9GA 1QYIA 2W4MA 4F72A 1TA0A 2HX1A 3HYCA 2MSNA 3I76A 1RMQA 1X42A 4Y2YA 4KYTA 3ZTWA 5AVZA 3MMZA 5ALRA 2YFYA 1RPZA 4BNDB 4XQ0A 3AR3A 2IOFK 1U7PA 2G08A 5ALOA 2YBDA 2JAUA 3AR7A 1CR6A 1N9KA 3L0BA 3VAYA 4Y2SA 5JJBA 1MH9A 2C8LA 5AM2A 2EAUA 1Y8AA 2WM8A 3M1YA 1WVIA 4NAVA 2CFRA 1J8DA 3ZTYA 4RESA 3OTQA 2MU2A 2FPUA 2R8ZA 5ALYA 4CF5A 1PW5A 1RQLA 2HO4A 4C4RA 3W5DA 2YJ5A 1ZOLA 1S8OA 3ZU6A 3NRJA 3B9RA 3MPOA 1SWWA 2GO7A 1TJ3A 3L0YA 3S6JA 1L7PA 1ZJJA 4IG4A 3WGUA 4YCNA 3IJ5A 5AKZA 2HF2A 4UMDA 3QXGA 3OCVA 2YY6A 3W5BA 3WKDA 2Q4TA 4BNDA 3PDWA 5ALHA 4OFZA 3GYGA 2C8KA 3R4CA 3NALA 2JAWA 3ZX5A 3AR2A 2BY4A 4AS2A 5ALTA 3DNPA 3A3YA 3RFUA 2YMMA 2ZBFA 1NF2A 3OCUA 3QNMA 4OCZA 1NNLA 4AS3A 1T5SA 2NO5A 4ZEVA 1L7NA 1L8LA 2GHQA 5AI6A 3L1VA 2I55A 3A1EA 4G9BA 5ALKA 3KZXA 5AI4A 4C4SA 1KYTA 5AVVA 4YCLA 1WR8A 2I34A 2WF8A 4KX5A 1YS9A 2ZBGA 1F5SA 4UASA 4DFDA 1SWVA 3E58A 5ALSA 3ZI4A 1JUDA 3SMVA 1Q91A 3QYPA 2GMWA 2Q4RA 2OBBA 1YNSA 3U7GA 4AP9A 4C4TA 2P69A 4L57A 3QU7A 3BA6A 5AW0A 4NWIA 4JDPA 3AR8A 3UM9A 5IS2A 1ZRMA 4CF4A 1QQ5A 2YN4A 4I9FA 3ZUPA 4OD0A 2O9JA 3WK6A 1Z4LA 2AMYA 1RMYA 3NAMA 4NFLA 2MU1A 3AR4A 2HDOA 3NANA 5AVUA 1S2OA 4UM7A 3E84A 1YDFA 4Y2PA 2B1RA 2CN1A 4EX6A 1Z4OA 2C4NA 2P9JA 3L7YA 1VFPA 4QJBA 5AM4A 5ALQA 1LVHA 2IYEA 3RF6A 4J03A 1Z4KA 2GFHA 2G07A 5ALVA 5AKJA 1QQ7A 3UMBA 1EK2A 3N1UA 5AI8A 2NO4A 3WKEA 2WF6A 4CE6A 5AVTA 3FPBA 2D2VA 2P11A 4BEWA 4B6JA 1TJ5A 1TJ4A 3K1ZA 5ALPA 4XOUA 5A3SA 5AM5A 2PQ0A 2R8YA 3U7HB 4BX3A 3P96A 4FE3A 4DCCA 4Y2TA 1Q92A 2IOHA 1U2SA 3OCYA 4EX7A 2G06A 1XPJA 5ALLA 3OPXA 3QU9A 3KD3A 5ALDA 3ZVNA 3ZWDA 3WK4A 1YV9A 1TE2A 4YCMA 2QYHA 3NASA 1RQNA 5AKHA 5ALFA 2YMPA 3N5KA 1Z4QA 1RLOA 5AKXA 4IFTA 2AH5A 1N8NA 1RKQA 3R09A 4CNQA 3U7EB 2WF5A 1T5TA 3ONNA 5AKGA 5AW2A 1YMQA 2EATA 3WGVA 5AVYA 1XP5A 2WFAA 3OCZA 2ZOSA 4JB3A 3L8EA 5AM3A 1WZCA 4XPZA 2B30A 3AR6A 2Q5EA 3WKAA 3U26A 4FYPA 4UARA 3FGOA 3QU2A 2HF7A 2FDRA 4BX0A 3NIWA 4DWOA 2G1AA 2FUEA 5AKYA 1O08A 5AK6A 2ZG6A 3ESRA 2RB5A 3TLMA 4Y2XA 1T9ZA 3U13A 3L8HA 4GIBA 3AR5A 5AW1A 3ZVMA 4HGPA 3FM9A 1Z4PX 5AICA 2EARA 5AM1A 4G63A 2I6XA 3IB6A 1RC8A 1Z4IA 3HLTA 2ZBEA 1U2TA 3L1UA 2B8EA 4Y2VA 2W43A 3QUCA 4YIKA 5T41A 1ZD4A 3ESQA 5A3QA 2G09A 2CFSA 3U7FB 1O03A 5AW4A 2OM6A 3EF1A 3KC2A 5AIBA 1L8OA 3CNHA 2O2XA 2RAVA 4EEKA 2JAOA 4L6AA 5AW9A 2AUTA 1RKUA 3ET4A 5AW8A 1XVIA 4PNHA 3SLRA 1K1EA 3I28A 2R8EA 1RKVA 4UAUA 5FP0A 4Y2JA 3I1YA 4KNWA 2WF9A 2RARA 4HAIA 1U7OA 2YJ6A 2HOQA 1L7MA 4NABA 4UAVA 2HEGA 3UMGA 2HI0A 1YJ5A 3KDPA 4BBJA 5ALXA 4L6CA 5AW6A 4NV0A 3QU5A 3FZQA 1ZD3A 3SKXA 4HGOA 1Z4JA 3ED5A 2RBKA 2YMLA 5ALZA 1RRCA 2I33A 5AK4A 5AK5A 5AW7A 5AW3A 1Z4NA 2IA5A 4J2TA 3W5CA 2W11A 2OYCA 5AI5A 3L8FA 1J97A 3QU4A 2NYVA 4UU0A 3R9KA 3N8GA 2QLTA 2YJ4A 2FI1A 1IWOA 3SD7A 3WK8A 1ZS9A 5ALWA 2I7DA 3QUTA 2JGAA 4KX3A 2AGVA 4Y3UA 4OHFA 4BEVA 2WHEA 3DV9A 2PKEA 1RLTA 4HGRA 4YIHA 4O8CA 2VKQA 4YGYA 4GXTA 1QQ6A 1Z88A 1FEZA 1CQZA 3A1CA 4BKMA 1ZRNA 2PR7A 5AK3A 4F71A 5AKKA 3IRUA 1NRWA 1Z4MA 3WK5A 2HHLA 2B0CA 2FPWA 3ZVLA 2GHTA 3QUQA 5AVRA 3CZ4A 1U02A 1L6RA 5ALEA 2YJ3A 5AVWA 1VJRA 3D6JA 3ET5A 4HYTA 3L5KA 5AKIA 2C9MA 2B8JA 2G0AA 2BDEA 5AHXA 2FPRA 5AVQA 5AKEA 3KOOA 2FPSA 3FPSA 3SKYA
chains in the Genus database with same CATH superfamily
1JHVA 1OILA 2P79A 3FSRA 4DB4A 3TKAA 1NW6A 3OIYA 2VNIA 3I6QA 3PICA 4WLNA 3FDZB 4EELA 2R97A 4PHTA 3RRNA 5CD1A 1OGJA 3F6RA 4I8DA 2V03A 1MOSA 3M5WA 4ZYTA 1I33A 3LWBA 3ITKA 4LVCA 4NDNE 4TT3A 1FP6A 5BMOA 4C05A 4PGGA 3G79A 3H2JA 1P2TA 5HZGA 3G0IA 1A5TA 1OZAA 4Q3OA 1JU3A 3QBVA 4A8JB 2RAPA 2V96A 3TG8A 2N42A 5DZSA 4KMSA 1MRNA 3LW7A 1YTUA 4O08A 5DHTA 3HW8A 4Q6WA 5KFMA 4TYNA 1BFDA 5EC8A 3LGAA 4M1SA 2FHPA 3DZCA 4BV8A 4NOLA 1CEQA 5DBEX 1IN5A 1IPFA 4R54A 4B83A 3B2NA 2W9CB 4BQFA 2I3ZA 2EDUA 1W25A 1D8AA 3W5AA 3STUA 3OJCA 4KO1S 3L7KA 4Z2YA 3EZLA 2FMPA 1AGXA 3LHDA 2PUWA 3EA0A 3NM5A 2ZAGA 1INLA 4CLRA 1USWA 1B22A 1UR5A 1BEUB 1NBMA 3CZRA 3PXAA 4ER0A 4ICAA 1EJ6A 2C2KA 1NKTA 1D0SA 2Y1WA 4PYIA 2BFWA 2X4DA 1XSLA 2RHGB 5KNDD 4F3OA 5LZ9A 2EGHA 4RTRA 1RQ2A 1WCXA 1Z56C 3Q6NA 4PZLA 2FPPB 2FEAA 2PSJA 2QHXA 2W58A 3L8GA 2PGDA 4WGGA 5HE8A 2ZYAA 2XB2A 3I04A 1I5RA 3FKSD 4UAGA 5HS4A 1Z45A 1SCDA 2DMRA 1Z0UA 3LCMA 2OA0A 2V0CA 3L7CA 4WFIA 3V1KA 5CCEA 3AUFA 3TOSA 5A62A 5GZ1A 2C83A 2O5CA 4MJXA 5IJAA 3FHOA 4RDHA 1RYNA 1XMSA 4F5NA 3MK31 5EIEA 3KXLA 4R66A 3JX9A 2DWQA 5CFQA 3R40A 3O3CA 4YVZA 1ZVKA 4NPCA 4IZOA 1ZG3A 1DWQA 2NU9A 5GVSA 1QAOA 4HZUB 5IARA 4KBYA 3Q88A 4GX1A 4B9VA 1DAOA 3PWKA 1TTQB 2D2XA 2X3FA 1E6WA 3GLTA 4A03A 4ZMSA 2C7PA 1JHZA 2GEDA 3ZIAA 3OMLA 4F5YA 4CHGA 1ABEA 1CZOA 4ALLA 4DFPA 1WKVA 4FBLA 1AC5A 2CJWB 4IRKA 4G0ZA 5ESDA 4QWBA 1KVUA 3I12A 4HB3A 5SY6A 4GPTA 2FZVA 4QLBA 5CA7A 3VYVA 1SVIA 3F7TA 4NVRA 5BSFA 3T3PB 1R4ZA 4L2IA 2X4GA 2IEYA 2FP3A 3CX4A 3PUVA 2ZB4A 4KXMA 4F6RA 1QLJA 4J9VA 5LD2B 3L7LA 4E5SA 2XNKA 3ROMA 1KPIA 1EM6A 2JS7A 5EJGA 2NSJA 3OJEA 4XSHA 1F38A 2XRYA 3JZFA 1M6NA 5BOSA 2F6RA 2AOUB 3H5NA 4JGGA 4DL7A 1F14A 1YR9A 2J9RA 1ATIA 4P3XA 2UUBB 3AEZA 3O8OA 1SCUB 4ID9A 1LBEA 2JIBA 2AC2A 1Y48E 2NP6A 2FWRA 5A2QA 2OUIA 2XNHA 3NHBA 2JAUA 4M36A 2AC4A 4OOEA 5KTRA 4IUDS 3U3JA 2HZ7A 4PYJA 2C5LA 4YBRA 1SVLA 1USKA 4DOMA 3OA0A 4RTMA 2QTNA 3UUEA 1EEXB 1XCMA 1C0LA 1CRWG 2HCRA 4S1NA 2WM8A 4YB8A 2P6PA 1WVIA 4ZRNA 3WJAA 5HMMA 1V6SA 4XM2A 5BNFA 3VR6H 4EQ6A 4HQ6A 4LBWA 3RSSA 4YAUA 1E3LA 3BHJA 1Z47A 2FPUA 1PNOA 1SCBA 4JJ6A 5K3AA 1LPSA 3B1YA 2JFVA 4EG3A 2C2BA 1WKCA 2W6PA 4HAVA 4W9RA 2R9VA 2EBHX 4DL6A 2J0SA 2I1WA 4QODA 4WKOA 5CNMA 3V4VB 2NV2B 2BKEA 1N5IA 4FX5A 1T2UA 2FU5C 3G49A 5JZSA 5FYDA 4HEJA 3ANLA 2HA0A 5B6IA 1HLFA 4RQ4A 6PFKA 3DE2X 1R18A 3HJRA 3Q8XB 1RAIA 3IELA 2K8CB 1XEXA 5EUQB 5ECDA 2VRCA 3TUJC 2BQUA 3HCDA 3CZ5A 4KWCA 4G3XA 4EUEA 3DJYA 3MOGA 3WP0A 5FH9A 5AKZA 3ETRA 4ZZ2A 4NQRA 1LH0A 1OXKB 4UMDA 5F1OA 4GXQA 4AROA 3WKDA 2FOLA 2IPXA 2YWJA 1NULA 4JYMA 1ILEA 1HDGO 2QRZA 4UBOA 2BRUA 5U9CA 2O8FA 3K1RB 2NZUG 2CJWA 2H8KA 4R2JA 2RLTA 4KFUA 4E3WA 3LVQE 5DEIA 2ZT7A 3KKMA 4L0DA 1QNLA 4LJ8A 4N18A 4RV9A 2E4XA 4L75A 5E6UB 5H4HA 3ZWWA 3O03A 2NSHA 1ZK4A 5J2JA 1NPDA 2Y1JA 2GEJA 4GZMA 1S02A 1XRJA 1JN3A 2V9CA 1FW6A 1D5CA 5LIPA 3GV8B 2ZBFA 5I5EA 1KW4A 1WDKA 1YR2A 1NNLA 1P0MA 1AD2A 2BPFA 1NUUA 3HBFA 4Y9RA 4ZYXA 4DR1B 4TYQA 4MS4B 2R5FA 2WPDA 2XGGA 3H9QA 2Y77A 1NXVA 3FCCA 1TMGE 3HWSA 3ILYA 4GS5A 4L9SA 4MVYA 1XJQA 4M55A 3NCTA 5CVCA 4D98A 2PUFA 3OZRA 1VMKA 2DERA 3SS9X 3R4VA 4LDNA 5B1DA 1UADA 1ZQ1C 3HDJA 1N0IA 4YMGA 4KP7A 1WR8A 2A67A 2OP0A 3D6MA 4P5PA 1F5SA 4KPFC 2D7JA 4ZMBA 2HQRA 2YNMC 4FT4A 4MRMA 4DCPA 1E2KA 4YRTA 1OJLA 1FQKA 4HFNA 4CUJA 2QVZX 4QZAA 4DL2A 3T5GA 4LVOA 1GL3A 1K92A 3F8WA 3EOBI 5FL7D 3VNBA 1FUEA 2V45A 1EB9A 3G9QA 4TV9F 1KAMA 1Z06A 4YUYA 3RS2A 1T8PA 4W9NC 2PXCA 1Z38A 4NNPA 3TOVA 1YVUA 2ZE6A 1O0BA 3UAWA 3PX6A 4HEA6 4Q4CA 4E07A 4ED8A 4JASB 1D1TA 3VDRA 2ET6A 3BA6A 2GAFA 5AW0A 1V4NA 3KTQA 4D7AA 1S3IA 3UM9A 2RG7A 5G5HA 5BOLA 5KFIA 4CCYA 3N7TA 3L0ZA 1FTSA 1ZINA 3MFIA 1NE2A 4KFTA 2A7QA 1UMCA 4S1PA 5HZHA 4EZ6A 1RMYA 1BDJA 2G71A 2G8LA 2MR6A 2R5NA 3PA8A 3C3EA 4YJFA 5B36A 3M4JA 5JJLA 4U7PB 5EJFA 2QE6A 2GILA 3JSAA 4IR9A 1OROA 3OZIA 4N40A 2FWBA 3PSAA 4WK4B 5BR8B 1YDFA 4N76A 3PXUA 3WGGA 4D5EA 3TADC 4RZSA 3TM4A 4G1MB 4K9KA 5CDSA 2QA5A 3HUDA 3P27A 4AZ0A 2BGLA 1TK8A 2C1EA 2HREA 2R7NA 1UFKA 3L7YA 3UMJA 4CYMA 1R9MA 3PFFA 5EZYA 2BI8A 2Y93A 1L4YA 3AO0B 5HFAA 2VP2A 1BDIA 3FUXA 2QE7A 1WCIB 5ENDA 4LFAB 2AFIA 2O23A 3BG5A 4KMMA 5LP6A 1U3CA 2C00A 1OREA 4QUHA 2A9KA 5ILOA 1T4CA 5DYWA 2JLUA 4XZ3A 2G5PA 1LTKA 1N5RA 4A8EA 1P62B 1U8ZA 2DRIA 2F4NA 2ZTLA 4MCJA 3EWAA 4M7WA 1DC6A 3QX9A 4EPWA 2Z08A 2GARA 2OSBA 3QZUA 4YGXB 4ENVA 5ADVA 2Q5FA 1N2XA 2Q0ZX 1FQWA 1U1FA 2W7PA 1CBUA 2AOTA 4B6JA 2WSSD 2X2EA 3DXXA 5BOVA 5HQ3A 3ESCA 5ALPA 4N3NA 1JHPA 2NZ2A 3QYJA 2JGKA 2QAIA 4H6VA 4PTLA 4I3HA 1LB1B 4NYMR 4F21A 3LWLA 1E0KA 3AEKA 2DG2A 1O77A 2CK3D 3OLZA 3W2TA 2ECOA 5JBNA 4AMUA 2WSLA 4C0QC 1CRXA 4CCHA 1BHQ1 1JDUA 2QN1A 1Q0LA 9ICXA 1U7ZA 3BD6A 3RHFA 4AF7A 2PL3A 4FQ5A 4GI7A 3PNSA 1Y6FA 4UCWA 4MLZA 4IICA 5KL1B 2E4WA 2PT5A 4H6PA 3OPXA 4ENRA 1OH5A 3FOCA 3KD3A 1XDGA 2WT9A 2I1VB 1FDVA 4RFSA 3LLCA 2AEMA 4AWXA 3E22A 2EFEB 1TJNA 1TCCA 1N1GA 3RYCB 3FSEA 2FVYA 3T5LA 1ETHA 1UP4A 3EEIA 2DT8A 3DMPA 3ILSA 4GGMX 4JIGA 5ECWA 4EWLA 2HFKA 1F8XA 1ZIPA 2BP7A 1NN3A 1QGED 2E4VA 5FLYA 1QIKA 4D8YA 5MFPA 5LVAA 2YVKA 3LA6A 1G8MA 2JNWA 4XJXA 1MEEA 2E4ZA 1E20A 1WXIA 3KUDA 2BPOA 1L4HA 2FZKA 4C4OA 1BRMA 2H7VA 4IH9A 1VLZA 1TF5A 4WJLA 2ANBA 2PZAA 4ZHQB 3H4IA 4L8WB 3FFXA 4QUDA 3HABA 3L92A 1D2CA 1BE0A 1IG0A 4NJMB 1I6MA 4I5IA 4MW6A 1TZJA 2CCJA 3M1AA 3THYA 2ZJZA 3EXG1 3OX3A 3GZNA 4JI2B 4EI2A 4RQ2A 4YUVA 3ANXA 2OV3A 1GLGA 3RO7A 2JIDA 1DQSA 2WHXA 4X90A 2C4TA 2HV9A 1FDRA 4OQPA 4K86A 3NDPA 3GP8A 1WCLA 4QFDA 2ODPA 2VP6A 1JDBB 4BLTA 1JFFB 2VDVE 3K9BA 4XQCA 4A6PA 4A8HA 3HO6A 2BMFA 5BV7A 4DV0B 4Q4JA 3D3JA 3QIVA 3IBSA 4YMSA 4HDMA 3TR5A 4CM9A 4DMUB 5AUOB 4IYJA 2OVBA 1ORHA 1R88A 3H1PA 3S2EA 3M8KA 1WHTA 3OEWA 4UNRA 2I91A 1DHRA 4BE7B 1BGXT 4PZDA 1PVVA 5KHAA 3NT2A 5HEKA 3WYNA 4D9EA 1CUYA 4LSZA 2NUTB 4NFSA 4FEGA 4LQLA 4QRDA 1OB2A 1GA1A 4RDIA 3REQA 3TRHA 2DCUA 1PT7A 3V1NA 4B34A 4DKXA 1KI6A 5K6TA 1G0NA 3GG2A 2YWCA 1S2MA 1KIFA 4ZEMA 5KG1A 3ER6A 1RCUA 2B5OA 4IQUA 3H18A 2FUKA 1PLKA 1BCRB 1VPLA 3O1HB 5HDBB 1S4MA 3H65A 4P86A 3UMMA 1A77A 2WSBA 2YWXA 2AFIB 1S0OA 4KXLA 1VL2A 4CF6A 5FIUA 3RH6A 3CNHA 1MC4A 2O2XA 5SYMA 2Y9MB 1E58A 4FSHA 3BRSA 2L82A 4IGAA 5F1YA 3PC3A 1T1EA 421PA 1AZSC 5ULLA 4DN6A 4AECA 5GOZA 4MWTA 2VDKB 2AR9A 4IKOA 4RORA 4AIIA 1K1EA 4KE6A 4YXWD 1RRCA 1DS6A 2DPJA 4QYIB 2WUVA 2H1FA 3DE7X 1A9RA 1BVHA 4HLDA 4H9GA 5GTIU 4NZMA 1NOIA 2GKSA 2XMPA 3EF3A 2RHLA 1MJFA 5BNIA 4BFXA 4QOIA 3ZHRA 4CU2A 2F1JA 2RK6A 4HMQA 5MDHA 5IAEA 4NE9A 2VVTA 2ZIVA 4UB1A 1A5SB 4NJMA 1KJ9A 1QX3A 2DEUA 3KDPA 4AKEA 4WOJA 4OX9B 4X8HA 1XYVA 3MGCA 2YB4A 5TV2A 3QU5A 1RZUA 2VK4A 3MD0A 4R2WA 4ZYLA 1QF6A 1OH6A 3AHGA 1SL2A 3VYWA 3FB4A 5FFMA 1RRVA 2FMUA 1ZJZA 3EWSA 2XB9A 2O19A 4KPUB 5BV0A 3P97A 3LUDA 4DT1A 1XYGA 1IN8A 2X0RA 3U09A 1QAQA 2WTEA 1O94D 2DWUA 1KYZA 4O59O 2D3WA 2PG3A 1T8TA 4L5CA 4OHKA 4EABA 2I4NA 3WISA 1GUFA 1Y89A 2H18A 1N6LA 4RV5A 5FWXA 5L7YA 1BXKA 3G8DA 4Q01A 2FI1A 3A2NA 3JTEA 4FJ2A 4LY0A 1ZS9A 3HJHA 4MVJH 4M47A 2YYZA 2IZ1A 3FI9A 3V8BA 4DRXB 2OBLA 3L7OA 5FUXA 1ZGAA 4G0WA 3EGOA 1EFVA 1K8YB 2AJDA 2IDZA 3TK1A 5JFTA 2AHOA 2O6KA 4C0JA 1JYFA 4YXJA 4QUEA 2V4QA 5CK4A 2QQ5A 5AHOA 5ITZB 1J06A 3UAOA 2G5CA 1JG4A 1MB9A 1XZKA 2CFCA 3G5MA 4YP7A 1I1OA 3EY4A 3NATA 4MRNA 4OYYA 5JVDB 2VKQA 3ADOA 1GGNA 4J0KA 4L50A 1VHTA 5KTOA 2CL5A 3LUHA 4LXIA 5D7NA 5CBPB 1IY0A 3UJ6A 3N74A 3K70B 2R6JA 5F9HA 1Z6XA 2WQZA 3OZCA 2H4JA 4G37A 1UJ6A 1NYLA 2I4MA 2XNDD 1ND5A 1OOEA 1BVSA 1UXIA 3O4VA 3T5PA 1U1GA 4EVQA 4EY8A 2FPMA 1U2DA 3DTNA 1VIVA 3B13B 1NUTA 3V3KA 1J24A 4AXBA 2O5RA 3PX7A 1SULA 4M37A 1E1CA 2OHIA 1XMXA 5CLQA 4QOGA 2RONA 1JQ5A 2ASJA 1S1CA 3K71B 5FOXA 4LWQA 4HRAA 2YH2A 4FVTA 3DOHA 3SNKA 5JISA 5HR7A 4HQKA 2OO5A 1ID1A 4G8BA 4LRWA 4MULA 4U2FA 3VNQA 5L51A 2PUGA 3D6JA 2X77A 2WJIA 2HRRA 4HAWA 5IPFA 3ZWXA 5FBVB 5LM3A 3AHDA 4M1MA 5DBBA 1TF2A 4YAJA 5TPWA 4X5OA 4E1VA 1PJ8A 4E21A 4ISBA 4A82A 5T5QA 4EBEA 2B5VA 3S1LA 3U2QA 4O0MA 4PGYA 4H31A 1ZM9A 5ELLA 5JZOA 3C23A 2XTZA 4RX1A 3JQFC 2QRJA 1TCUA 3LY8A 5F1PA 4BKUA 1DQYA 2NPFA 4YRSA 2JGDB 2ZE8A 2XT6A 4OLAA 2XIDA 5DPMA 3V72A 2ZWVA 4F3YA 3BZKA 2H5JA 4AIRA 5GINE 2VZEA 3GJYA 3H2HA 1GNRA 3HP1A 5BNTA 4W9NA 3GCWA 4QUBA 5CW1A 3DNMA 3DOEA 3BWBA 3KXPA 4EB6A 5DDYA 1UOQA 2JRLA 1X1RA 2LDXA 3CQ9A 5G2OA 2GFIA 1EK1A 4WN3A 2VPIA 1A2QA 2D8AA 5LBTA 3QMMA 1Z62A 3S1SA 4RETA 1TO6A 1V4VA 2QRUA 1JQAA 4L4YA 3QGMA 1FIQA 1X9WA 5LZ4A 3C5WP 3AJRA 4H15A 2HHHB 2JARA 4RCZA 1OVGA 1W0CA 3MTBA 4R2IA 3ZWAA 4KBFA 4LYDA 4A26A 3CRMA 2WV7A 4MGKR 4M54A 2FE4A 3IDZA 2OZKA 4JP1A 3W9SA 4PRLA 2YRXA 2ECKA 5TT0A 2FGJA 4KN8A 3UXMA 1JQ3A 3H5TA 4JH0A 2QDKA 1KZHA 4JSYA 3EWNA 3N3BC 1V8BA 1JDSA 4NZNA 1CRQA 4TTAA 1M1UA 1NXXA 1XTJA 2DTXA 2V3VA 2VWGA 1ICIA 5JR3A 5LLDA 2Q9UA 1J6UA 1D6MA 5ECGC 4XCQA 1GN8A 1O95A 3BE5A 3KXIA 1PR6A 5B7GA 3OZGA 1HE8B 3BVPA 2AN1A 1N7JA 1LDBA 4O2BB 2ACKA 2F4VB 4DSIA 4KDCA 3FMGA 3GYBA 3HC7A 4UVDA 2V65A 1RLMA 4LVSA 2FJUA 5EINA 1Z28A 1ZI9A 4ND4A 1Y7LA 3L77A 1EXDA 2DQSA 1QYXA 3L05A 4J7XA 1UM9A 3FGZA 5DNUA 2QG6A 2KM1A 4PGHA 1KLNA 3BTVA 1WCIA 2I4IA 1FY2A 1XLTA 2VYVA 4KLLA 4GVXA 4ZEWA 2E5WA 3SHOA 4C6HA 3HO1A 5DYGA 2EZUA 1L7OA 1QC5A 3F7NA 1L2TA 3TN7A 5DCLA 3QLEA 5IT4A 2GA8A 1NVMB 4XPIB 1K89A 1T3GA 2ZXEA 3PV0A 2KNJA 4W5WA 4UUMA 4JBYA 5A3RA 1CS0A 5F3DA 2A92A 2JFBA 4EKIA 3KVYA 1H0RA 1SGWA 1YZFA 2G40A 2VDUE 3KEOA 3TE6A 2AQ4A 4C7OB 4C9BA 2DR2A 2IFTA 5JZBA 4A0GA 3PQ2A 3HYLA 5TGTA 3U6BA 1OKKA 2IVZA 1XD9A 2QRKA 3B78A 8ICQA 2A6PA 3FTNA 4HPJB 3PR5B 1QRAA 1RVV1 2JIQA 4OSEA 4RQAA 1N8TA 3H8VA 3ZYZA 4TTVA 3EPJA 4QZ8A 3KKOA 2HJHA 5EERA 1YQWA 4ECSA 1NZBA 4ENWA 1ZGBA 2EL7A 7ICIA 4L8GA 4YJKA 5KNBA 1FP2A 2WK1A 1FW8A 9ICTA 3ZQUA 3JXEA 3ENZA 1KJ8A 4H4EA 5J4KA 1ENYA 5HRAA 2IF2A 4V03A 3PLNA 1DUIA 1C3EA 2H4XA 2XTAA 3ZQ6A 4MXDA 1ZIOA 2Z9BA 5H02A 4GMFA 1CDOA 1WLYA 3GY0A 4MUFA 4RIIA 2VP0A 3PDCA 3CSSA 2QTHA 4BBAA 3ETGA 1DARA 2YS6A 1UXKA 1FUIA 3D4NA 1B16A 2OHXA 4LC0A 1DL5A 1TI7A 2OYSA 2QXTA 1M1YA 4MLPA 4DJJA 5HIKA 3NTOA 2XB4A 4IINA 3HJGA 3M6IA 3OE1A 1MSWD 2W9BB 3STXA 5HKKD 2SKDA 3KV3O 3M1YA 3NM6B 3TD9A 2J85A 1OAOC 5F7JA 3WNQA 2Y1EA 4D4HA 4F9TA 5JXGA 3IG8A 4BXOA 1KZ4A 2P78A 3I9KA 1DBWA 4ED3A 1TUBA 1Y3FE 1JAHA 4KLJA 4GNRA 1YZYA 4ON9A 4TS9A 1R8JA 1CS0B 3KKZA 3V9AA 4DWOA 2PRSA 1PS0A 1RWQA 2HT6A 4C0KA 2XYGA 3DYVA 3G02A 2VK2A 2BBOA 3DMYA 3ZQKA 4BP9A 4JODA 1QH8A 3R7FA 3G2LA 4QDUA 2RP5A 1FB5A 1NQUA 2GR9A 2ZTVA 4Q66C 3VV2A 3S8YA 2QQEA 1XAHA 5C9ZA 1ZL2A 2OLKA 4Q4LA 1XEFA 1SOMA 3DDUA 2FSVC 2WMNB 3DHEA 4JXJA 1BPEA 4C8OA 2WIFA 4FS3A 4N5MA 9ABPA 2YXPX 1FFXA 1K0UA 4P5DA 4BB9A 1WCWA 3D6VA 1G16A 1P75A 3FUCA 1ZJMA 3IJ5A 2ZSHA 2P9EA 3BFJA 3EIHA 2FQ1A 1Q0PA 3EK2A 7ICSA 5K09A 3TDMA 3X1WA 5BWBA 1TM1E 3W5BA 2VJDA 2Q1WA 4ZV9A 3A05A 4W1SA 1EVJA 5KU1A 1VPDA 3G0CA 5KNBD 3I45A 3DP7A 2JGRA 4Q4AB 5K0GA 3JWGA 1SXEA 2F1KA 3IAHA 1ECGA 5KVSA 1QHGA 2ZE5A 2C8KA 4BQSA 5J0YA 3OEED 3AR2A 2QJTA 2F3UA 4UAZA 4ZDIA 5ALTA 1KFTA 3BIXA 3OM9A 1W4BA 4BNWA 3DNPA 3LYAA 5CFOA 1T5DX 4TUYA 3IBFA 1AQJA 4JLVA 4YX9A 5J2BA 4I14A 2A86A 4PYMA 1NAIA 2QR3A 2ZIGA 4XWTA 1GSOA 3L8CA 3NCHA 3LVRE 1ORWA 2NT4A 3IP5A 4ZICA 5BN3B 2FZCA 1ZQ9A 4ZIRB 5CTAA 2D3DA 3PHIA 2WTAA 4PICA 4IRDA 1PZFA 2ZRJA 2IP2A 4PAMA 4QOHA 4BQPA 2FMTA 2VQEB 3EZ5A 3DGEC 4JHXA 1DPFA 2JFUA 3VKHA 2UZ0A 5JNTA 4O8ZA 5JS8A 3I1FA 3ZDZB 5B4TA 4DFDA 2PSSA 4QAQA 4BJQA 3VDNB 4RJJA 1KMHA 3JPNA 2C5EA 5U4XA 1DC5A 1RQXA 3C6KA 3U4DA 4TXJA 4W5OA 3QNUA 3NVYA 5CDGA 5KYXA 4D9MA 5IKPA 1L7XA 1YB1A 2WWIA 3I4FA 5FTMA 3BRWA 4G41A 3Q0TA 2CGEA 3DE4X 4DQSA 5KJFA 2GXQA 4JXXA 4KIJA 4R8RA 1H2AS 2IF0A 2VHTA 1KP3A 3HN7A 3VVBA 3WWYA 3AM1A 2YTUA 2OZEA 2XWQA 2D62A 3V4SA 4Y9SA 2P69A 1FVFA 4DNPA 5EMJA 1OBHA 1V95A 4F2PA 1GPBA 2ZUTA 3DBLB 3PVSA 1T4DA 5J4YA 2ZUWA 2QMZA 2A4KA 2K87A 3NWBA 5KDLA 4QVIA 1NJFA 3DTYA 1FYXA 3P2JA 5ILQA 3DAYA 1UF9A 2VDWB 4OD0A 2ZRFA 3ZUPA 1X1AA 3R6WA 3F90A 5COQA 1EQAA 4CMIB 3RUIA 3A0BU 2FN3A 4DSZA 4EJ6A 3OLWA 1EQ2A 3N2GB 1QG2A 1NRJB 2AI2A 4CG1A 2HDOA 4EA6A 1LBTA 3RHSA 4OJPA 1Q14A 4TVKA 3P2EA 5J4VA 3LX8A 3AB3A 4ENQA 1HE5A 2X23A 1Q1NA 2ZBRA 5GY7A 3B7PA 3CRNA 2CEKA 1U4OA 2JFFA 1EESA 2DKNA 4MITA 3KFVA 3H1TA 3CZMA 1T43A 1U4SA 3B1JA 3ZU5A 1ZQUA 3ZDDA 2B8TA 3P0RA 4B79A 1EM8B 2IHNA 2FRXA 5I4KA 2CHUA 5C31A 1JLSA 3RF6A 5I7WA 2G5IB 3C3AA 3G9TA 4JMPA 4UD2A 3MS7A 2ZR0A 3NHKA 3PUIA 5IX8A 2HXSA 2D59A 1MTZA 1XU9A 2GN9A 3VR2D 2E1EA 3N59A 2H2GA 3AB8A 1PK9A 4H3KB 3CGWA 3AOEC 5J0OA 2WD7A 3AIIA 3SBOA 3EXHC 3W3AD 3PB3A 3B1KA 2F3TA 2O3UA 1HYBA 1YR1A 2GLUA 1WQ4A 2WYVA 1MX9A 4XOUA 1I0LA 1VSBA 2WUWE 5YASA 3OM8A 2ZJYA 2VCEA 3LHKA 1VSVA 1YZ7A 3F3MA 4RTQA 2HHJA 2NYAA 4D3FA 1Y0BA 3BCRA 1G5RA 4EKYA 5K8CA 2HR1A 3S27A 2JI7A 3NBFA 3VAZA 1WRBA 2C3YA 4QUGA 4W7SA 1FXUA 1O54A 4RPKA 4FP9A 3RWBA 2D4HA 1QBGA 3LV8A 4ACOA 5B3KA 4IHJB 4I27A 2AGQA 3TDNA 3QXJA 3RBZA 5CLHA 2DWPA 1W7AA 3LRXA 2DFPA 1J07A 1L4UA 1HQYE 2YJNA 4RMNA 2REQA 3UXPA 4DABA 1RSZA 3QWBA 3VPDA 1C4OA 1FFYA 3EAGA 3N5KA 4DCTA 4UPEA 3DEHA 5JY1A 1QHFA 3GVXA 3VPHA 2C4KA 4MWGA 1JHQA 3QNWA 1X9IA 1M0WA 4G56A 3E9YA 2E48A 4HDAA 5AVJA 4JI7B 1ZD1A 2BLLA 5TARA 2J9FA 4BAGA 4B71A 2DL0A 1LLDA 4YAFA 3EGEA 4DR3B 4XWYA 1T0BA 1LXCA 1UC9A 1JG3A 3K16A 1ZQTA 1NXQA 2C9DA 2XICA 1L1RA 1QQBA 3LFUA 3TAPA 2JAXA 3AR6A 4QASA 3LSTA 1B15A 1J0CA 3LPCA 1YS4A 4FYPA 1XMPA 2IHMA 3HKCA 3UAZA 3W7VA 1OX4B 1UOPA 4R7GA 3KHUA 4NY8A 2D1RA 2GNPA 1LJUA 4O1IA 1CR2A 5E6RA 4Z54A 4DSAA 3MFHA 1TCAA 3IPXA 4B45A 2E5FA 4WERA 1Y33E 4AK9A 4KO2S 3ZZUA 1CCWA 3AEQB 5LQRA 1VI5A 1PSWA 1QTNA 5F12A 2CBXA 1L5VA 3PPIA 2J0EA 1P6UA 1W93A 1AS3A 3BGWA 4XIGS 3UZUA 1WEKA 1AGRA 4N5DA 4YYZA 1ONBA 1SPBS 2RHBA 1XRQA 4BVGA 5A7FA 3RADC 1TVAA 1S2LA 2J7PD 3KOXA 3OTOB 2F9FA 2HDHA 4J6FA 1SU7A 3KOUA 3F3KA 2IEIA 2I03A 4FNAA 1JMYA 1DLIA 2B6NA 3FPEA 3U39A 2DR3A 5MHTA 2VAWA 4L4SA 2RAUA 4NESA 5KDOA 3TLCA 4OQQA 5L3ZA 3GFKB 1GP2A 2C94A 2WM9B 4H59A 2R2GA 3CLTD 4S1VA 3BT7A 1A0PA 2B25A 2AJCA 1Z74A 3QELA 1KRPA 5ELMA 2PFQA 1E2LA 2PUJA 4ROSA 3R9XB 1E3TA 1Z18A 3RAEC 2EFCB 3IMEA 3QOYA 1QMGA 4MAMA 5DI3A 3BAZA 1KO7A 4J4TA 5KNCD 5ICFA 4MI1A 3OAAD 2Y1CA 3IHTA 3NJ4A 1NLUA 4MARA 2XEXA 4QXMA 3A6LA 5JCOC 4K88A 4PPNA 3VC2A 1A8UA 2H1VA 3PNLA 2ATIA 4XDHA 3DT9A 2ORYA 3E82A 5LCXA 1OKKD 4PHDA 7ICEA 1ISMA 3S1AB 2YV2A 4JY7A 3CEMA 5EYPA 4AJKA 5AW9A 2NTEA 1YS1X 3RTAA 3E3AA 4UFOA 5ENVA 3A9RA 3ASYA 3AHFA 2FK8A 4K4GA 5BR4A 3V2GA 3KHHA 3CPEA 4GWGA 1TW3A 3CKYA 3I01A 4BO3A 2Q6VA 2BM8A 3FHTA 4B3RB 2YZGA 1MX3A 2VR1A 3F7MA 3MHTA 4M76B 1NC3A 2R85A 5JS7A 5SZIA 1G5HA 2VDQB 3U3MA 4RC9A 1BKSB 4R9NA 4JQCA 5KOHA 3GV5B 2QTFA 3I3OA 5EJAA 2Q45A 4BFUA 3BGDA 4JJEA 4BO8A 1M6YA 3NEPX 2AR0A 1C3XA 2GZ3A 2XE4A 4JC4A 1YJ5A 4AY2A 2ZTEA 4M60A 2AUMA 3GW8A 5I7RA 3ELYA 1MB2A 4NSNA 4KPUA 1XWLA 3SF8A 5KCZA 1LNSA 1Z36A 2ATCA 2R751 1YR6A 1PLJA 3DEYX 4C43A 1Q74A 5HZMA 3G2JA 3SQWA 4YT8A 1I2MA 2HHVA 4Y0AA 1UDBA 1Q7BA 2IUYA 3NP7A 2HCTA 1P3DA 5KG6A 2H4YA 2VBFA 4UPDA 4G86A 4Q02A 1NUSA 4K26A 4MV0A 3RAJA 4R9SA 3QU4A 1ZRHA 4MKHA 4YJHB 3UGKA 5ABPA 4TYYA 2Q9CA 3N2KA 4J16A 3WLMA 3JU3A 3V1MA 3W5IA 1KDPA 3QLUC 4JLAA 3O94A 1EKXA 3D5EA 1CUSA 2HVIA 1QV9A 2WB1C 4JNKA 4N6OA 4DMFA 1Q0TA 1RLTA 2X76A 1K98A 3T7TA 3E9RA 4EO7A 2UYQA 1H9BA 3R23A 5I47A 1XP8A 3K6SB 2J5BA 4IW3B 1AQLA 4OLFA 3IT1A 4BFLA 4JYZA 1AVTA 1DT5A 1R00A 3ZYCA 2QAGA 4D96A 5ENZA 2HBYA 5CFRA 2HSEA 1QQ6A 1N5OX 2H1WA 2UUPA 3KEMA 3HNOA 2E2WA 4O2BF 1HNXB 1FL9A 1NSTA 2Y1KA 2WNSA 3RTVA 2QX7A 3FYSA 4EMSA 1ISPA 1MP0A 3P9XA 1WNFA 4BLQA 1HLPA 4JLWA 4R1MA 4AQ7A 4NPAA 5IH3A 2HHLA 3T1TA 3THWA 2BHRA 4KLAA 4CR7A 1GRQA 2I4RA 3A4TA 3FKQA 3IHQB 3KOWA 2QL5A 5J29A 4GBMA 3RGWS 3WLOA 5BQ5A 4TSRA 5T4FA 2GZHA 3ANYB 3VHXA 4U6SA 5AVWA 2YJ3A 1OI2A 2N1RA 1I3KA 4WBSA 4MVJF 1L3VA 1N9ZA 5EY5B 1PJ2A 3A32A 3ZE6A 1OD6A 2G0AA 4M9NA 4FR0A 3JPOA 1GADO 2ZB3A 3LGSA 5AHXA 3QQPA 4QTZA 2IHKA 5KNLA 1MZPA 3M9XA 1GILA 4JLNA 1JSZA 4EBBA 1M0EA 4NBWA 3KT6A 3FJOA 3SKYA 2NSLA 3E1SA 4KLGA 3IIIA 1VMEA 4I4TF 3S40A 4PBSA 3TBKA 4X91A 4PGXA 3NWEA 4PU0A 1PNQA 2IXAA 1GQFA 4PM4A 3T4EA 4BKPA 4C78A 3BULA 4ZVSA 4A0HA 1U0BB 1WU8A 1O58A 3H99A 1N0WA 1AXEA 2VPYA 4FOTA 4QYWA 3TIXB 1TQHA 2XW6A 4RPXA 4YCSA 1M1NA 1TM7E 3BAFA 3RSLA 3TBFA 2QLJA 4TM8A 3IQZA 3KPUA 2QSUA 3LL7A 3B8EA 4H6WA 3V7WA 1Z73A 2A88A 4TWRA 3ZI7A 5BN4A 1XTQA 4MDHA 4Q21A 3D5TA 2PRJA 3PX0A 4U6NA 3ZDBA 2WJ6A 4O3QA 1VKHA 1NXTA 1UEJA 1Y81A 3E3MA 3F5DA 4JCOA 2LZ0A 3NBZC 1PGOA 4PTYA 3T5DA 3IAXA 2RGUA 2VP5A 4ZI7F 5LXTB 4E11A 1RADA 4L8VA 3DEAA 3M1IA 2Z8XA 5BN5B 4MKGA 1XEXB 2PLFA 2MRLA 1SBQA 2QX4A 5DT2A 2XKBA 6AT1A 1YA6A 3SAGA 5C46F 4EKDA 2ZB7A 3CB2A 4CFSA 3F2VA 1NXPA 3NWJA 3O3OB 1GUDA 4J7UA 2FR0A 2ORWA 1L8AA 1V8DA 1SQGA 4XM1A 5AESA 2IS1A 4G0MA 3FLAA 4EMBA 1S97A 1CS4C 2QQFA 4TLBA 3TX6A 1F0YA 2G80A 3IXQA 2K4MA 1JG1A 3BHNA 5KNDA 3S99A 2IVFA 1K3TA 2C2GA 1TM4E 3QX7A 2VO1A 2ZE7A 3B3GA 1H6CA 3GJZA 3LY5A 3MT9A 4GU5A 4M98A 1X38A 4YH1A 1Z8DA 3SYMA 2QL7A 2BGMA 3TZQA 4L8YA 2VJAA 4V0MA 1W5EA 3AMVA 2JB9A 4AJ2A 1I3OA 4EB3A 2VCYA 3HNRA 1G17A 1MO5A 1DXQA 3PWSA 2XDAA 5AVSA 5CVJA 4MP6A 1B4DA 1T0JB 4RW0A 4WZZA 4MVJI 5CIQA 1SKBA 1D2HA 4N5NA 3KR9A 2HMWA 4QO7A 1NQWA 3KQPA 4I2FA 4ELUA 1N7IA 1AU9A 1ZLYA 4ZCMA 4TWBA 2V9ZA 4DJ5X 3ROQA 1ZQIA 2WT4A 3DE0X 1JIXA 3W6PA 4MYRA 4QQFA 5AM0A 3EZYA 3QUSA 3QFFA 3PTZA 3EIFA 4C01A 4X65B 3FSGD 2RRDA 3KZOA 1R0BA 2O2EA 3MEQA 1JXEA 2PX3A 3ECCA 1X77A 3EFOA 4MKZA 3DKVA 4R2HA 5H83A 4F9FA 3HCBA 1UBEA 5E4TA 1GLNA 1E8DA 4HDOB 4BHTA 5HVNA 3FMOB 1KOFA 2QD2A 4QYIA 3NT5A 4GM4A 4Z6KA 1Q46A 2BCVA 5A4FS 3EIOA 3A6JA 2YWHA 4B85A 3RB6A 1ZNQO 3VVMA 3ZNOA 4E09A 2MSNA 3PHCA 3RAFC 3L8YA 2WWYA 3K05A 1X1QA 2H17A 1FRVA 2PLNA 4K9QA 4DRXA 1TTPB 4RD3A 1JDBC 1RWXA 1OJ7A 2VAMA 4IJVA 3CURA 3C5HA 1CEXA 1T1JA 1LDYA 4XQ0A 2XQVA 1J0AA 2HCBA 3K72B 3E9NA 1YJQA 2PFOA 2E21A 4KOEC 4IS2A 4RZ2A 3H3XA 1CR6A 1NC1A 2P66A 1ZGZA 3HILA 2GHRA 3O8QA 3L0BA 3PXDA 2PZEA 4LF7B 3G2IA 1ZEMA 1TB4A 3FTQA 3ZR4B 1MZVA 4NCAA 1WMDA 4BQQA 4CWAA 2XIQA 1E3JA 4X71A 2SHKA 3X1YA 4G1CA 3EIWA 5LIRA 2CFRA 5H81A 2OAGA 1T8SA 3HU5A 1G3RA 5J2TF 1X7ZA 1VBMA 3KPYA 3SZ3A 2RFLA 4OXRA 2Q28A 2ZRKA 1MR3F 4DC9A 1CP2A 2R8ZA 4CF5A 1FTNA 1REQB 3D4IA 4NI5A 1RQLA 2HO4A 3OZWA 4QTUB 1Z3IX 2EYQA 4K0RA 1P19A 1ZOLA 2KFNA 3R5HA 4C2TA 2ZRDA 1E1LA 1XDZA 4BVKA 1V47A 4L07A 5EUBA 5K6AC 2BKUA 3C39A 4V2UA 3QXCA 2C2EA 4OREX 3RE1A 3MPOA 1Y1RA 2GO7A 3H8WA 1V8ZA 3B85A 4FMPA 1OIWA 3DO5A 2ZIXA 3QBDA 4I3FA 5FO1A 3PA6A 4RWEA 5CB1A 3S6JA 1DU4A 4ZDWA 3WLQA 3Q8PB 1GGEA 1E2HA 1A97A 3CG0A 3Q3EA 3UAXA 4DUYB 5T4HA 2BBTA 2H1OA 2R47A 4WKBA 4GQBA 4H7PA 3MWDA 1FVXA 4KW7A 4QPCA 3U0BA 2KE7A 5F1KA 4FFVA 3O9ZA 4XJSA 2PZLA 3RVSA 4CMHA 2XRZA 1NU8A 3JQGA 3OCVA 3EEBA 1KFEB 4LZGA 3K31A 2VJ5A 1U1IA 2A33A 2Z2JA 3D0KA 3D43A 4D4LA 1IVNA 4KACA 4TYMA 4AG6A 1OA0A 3HWTA 1ZM7A 5ALHA 1OXXK 1RYZA 3JAWA 1SHZA 3DZGA 5JAZA 3UJ9A 3PMNA 1J8MF 3QF4A 2AN9A 3T7DA 2POCA 4KN9S 5JAQA 1F44A 5GJCA 4KLIA 1I13A 1NVVQ 2W2TA 1Y4UA 3K5IA 2ONCA 4C8LA 2FRDC 1P2FA 4X9XA 4O3NA 5E9QA 5LP6F 1J5XA 4OVKA 3OH8A 5DI3B 1C8BA 3Q2IA 2YMMA 2JEOA 2WUEA 5JALA 1VI2A 2VSQA 1AKRA 5FJIA 4JGIA 3OQHA 2J33A 3PYMA 4MGEA 1SB8A 2LR0A 3I61A 3PQ3A 2WZCA 1E6EA 2CXSA 1CUKA 1N6KA 3R9IA 3HPOA 3GJ8A 3QPBA 4X0EA 4BQIA 3FY4A 1XD2A 4KQ2A 1H6DA 2WJ4A 1SHKA 5CB8A 4TKUB 3LDUA 3ZCTA 3IE1A 3JPSA 1R0LA 2F62A 4AQDA 1P4JA 5TB5A 2GGSA 5TE9A 1VCNA 3N75A 5JS6A 1Z2CA 1NK9A 2NYUA 2RAFA 4IJQA 1PX2A 2WPDD 3NOXA 3UKJA 4EGCB 4HNTA 5L95A 2XY6A 4NXZA 1RHUA 1CERA 3G2PA 3CNOA 3VKUA 3H1FA 1KC3A 5KOHB 4DZZA 3QVLA 1PJAA 3MIIA 3OM0A 4DMCA 1XL0A 2RGNC 3H42B 3VBCA 3THYB 2JFOA 4PHFA 4CEJB 2VXBA 4KHZA 1WXDA 1E9DA 4AO7A 1V9CA 2YINC 2BR4A 5E3JA 1QIDA 1HDZA 1BH2A 2CB0A 4J94A 3U7GA 1CI4A 3GEGA 2G76A 2JL1A 4TLDA 1FU7A 4ZPXA 5HBRA 1I7QB 5L3SB 4FMCB 4NV3A 2VRBA 2WSYB 1TUIA 1LLUA 4QJ5A 2E4AA 4P0PA 1JXQA 3CVOA 5L53A 3FWKA 4NFHA 4NWIA 2GXSA 2JH1A 5J43A 1JEQA 3AR8A 4QNLA 1U0RA 1GG8A 2W22A 4IQFA 2QMOA 4JBIA 3EPPA 5FTLA 5IS2A 2YN4A 5KFXA 4FD2A 5ICGA 1E2EA 4D25A 1RM5A 1M83A 4WZBB 1M2JA 4LJ9A 4HH1A 1GU0A 4HQ0A 2C77A 5IULC 4MS4A 3SXJA 4CM3A 5LZ2A 3WBKA 3LY7A 5D5PA 1SXJD 3MJFA 4ZODA 4KYVA 1KQNA 1N2BA 5FA6A 3USES 1UPUA 2P7HA 4G8CA 4M7RA 4X6LA 3F5AA 3TCNA 4BP3A 1H6AA 1IHDA 1O9BA 1WY5A 2XUQA 4GX5A 5DTMA 4Z7QB 1N36B 1DI0A 1YB6A 4CI0B 2I1QA 4FOLA 4NK5A 4RCVA 3PQ6A 1Z1BA 1ML3A 1VBNA 1US8A 2X7JA 2I67A 3LQQA 4O4LF 1D9ZA 1ODLA 4D6XA 5C1BA 1OYWA 3FAKA 4GXKA 1UEIA 4MUBA 4F2GA 2BLNA 4WLFA 4MHOA 1JDZA 4GFJA 2GFHA 2L2QA 4P4MA 3E9QA 1JHUA 3VXKA 4DBLC 2QVXX 2C22A 3PC7A 4TL9A 3EPKA 3UUWA 1I94B 4Q4JB 3KPWA 2O2JA 4JVSB 3ISBA 5IBQA 2I5PO 5BUQA 4X7MA 3URMA 2XBUA 2PGNA 4HH0A 5KT4A 4P98A 1RJGA 4BLSA 2O3QA 1K5HA 3DGFC 4CN9A 1MOZA 2PCJA 3OFND 3K4HA 4IQTA 1THTA 1TJ4A 1CE8A 5HFNA 5T4BA 3WNZA 3SPXA 4B75A 1NBEA 2C7GA 3NGXA 2TRSB 1K4YA 3BC1A 1JQDA 3QKTA 4OQZA 4TRMA 4ZVLA 5K3CA 1PR1A 2HAEA 2WAOA 1NX6A 4TMFA 5DHFA 3UQZA 3I9OA 1KHHA 1PL7A 5GADl 4Z51A 3FCOA 3BD8A 4KWTA 4RPJA 1JKMA 4DDWA 3DV2A 4JLPA 1DINA 4C6TA 5EKSA 1Q7CA 3ZWDA 2LPMA 2M2IA 2RGYA 3TL6A 3RARA 2KZMA 4M38A 4PN3A 1X94A 3D6UA 3PP8A 1MHPA 2Z8ZA 4W63A 3BL6A 2HPZA 4B6RA 2J08A 3KV1A 4TPKA 1RLOA 2XH8A 3UJAA 2BKLA 2AMJA 3AN1A 5DB9A 2JGJA 3AYXB 3I58A 1G60A 5JCXA 1DUVG 1KO4A 1E7QA 1A7KA 3MJRA 1HE4A 4AZ3A 2W4QA 4EFLA 3DV0A 3NLLA 4IGKA 5BUZA 3LRPA 3T3FA 1HYGA 3C4QA 3ESXA 4YQWA 3P0EA 4I5EA 5D87A 3LECA 4LWOA 3OCZA 3WGHA 1VLBA 4AY6A 1U7WA 4PYQA 3FUTA 1YHYA 4MVCA 3AQEA 3H2ZA 3O3MB 2BYTA 4NXMB 4O3PA 3K4GA 5A0VA 1ULHA 2R8JA 1V6CA 1PG0A 2XCLA 4L6IA 3ZNNA 4DA4A 1SC1A 1K27A 4IIHA 3FGOA 5EP1A 3OTIA 2EBWA 2FDRA 3RJHA 3L18A 3ZV5A 1JRPA 2KB0A 1TLTA 4I2NA 3U9TA 4N0EA 1EK0A 2JH8A 4LS3A 1GPUA 1R4MA 4M0CA 4YUZA 1KI4A 5AKYA 2WHQA 3LWDA 4X6YA 5KYXB 3HDYA 3BA1A 3QFTA 4GVLA 1ZGJA 2PVCA 3QH4A 2RB5A 4KXVA 4O4LA 4TTQA 1R10A 4LDJA 4L73A 2GPWA 3U13A 3E70C 1FFXB 1HLDA 1CYDA 3GFVA 4YP9A 3HO8A 4CBVA 1O8BA 2WU4A 1NT2A 3B6JA 2KHQA 4DPMA 4LMPA 3BE4A 4D6YA 3VU9B 2PBRA 4WNAB 2JGNA 2VXYA 2IXTA 3PQ4A 4F45A 2ADOA 3WB1A 4W4TA 3T34A 1NURA 5A5GA 3AVTA 3B12A 3IP1A 1C20A 1OF1A 2QTLA 2XDQA 1Q1ZA 1HUZA 3QVSA 3WNVA 4PRYA 3NC1C 1B74A 2ZS7A 5FV7A 4OKNA 3PGJA 1IXZA 5CA1B 5JTIA 3GIJA 4TXNA 4P6VF 2HWYA 3MGAA 4PIMA 1GQRA 4WVLA 4DJDC 5A3SA 1G9TA 1OFVA 3BE8A 2JI4A 2B1JA 1MBZA 2YY7A 4WUVA 4NYIR 3ZN2A 4BWMA 3EF1A 2GBLA 3ZIDA 3ZHTA 1D2AA 5F23A 4S0ZA 2RGGA 3EC1A 3ND6A 3HJBA 1PGPA 4GF5A 1Z29A 2RAVA 2EW8A 2GD2A 3AUXA 4Q7JB 5J63A 4ERNA 2WTFA 2XCIA 3EVFA 2VHQA 3E7DA 2PMZC 5JRZA 3I5MA 3MS2A 1YJCA 3N7PD 2PWZA 1ZH4A 1W48A 2H2FA 3SLKA 1WUHS 4L3OA 1IUOA 1TM2A 2V7QD 2WW8A 3MAJA 2MT9A 3UJPA 2QRQA 1RRKA 1PZHA 3O90A 4LYJA 2R7AA 5L7TA 1XZEA 1VE1A 2IXGA 2VYCA 3OPQA 4UXHA 2UZ1B 3DT8A 3F4KA 4FCWA 2JF0A 2HN9A 5KKAA 1M33A 1L5KA 4OIFA 1CY1A 4LOLA 3E15A 3WWEA 1E2QA 3WQQA 3IVAA 4YV7A 5BQXA 3NHFA 1WTAA 1Q7GA 4ZJUA 4KV9A 3UMGA 1P73A 5DMHA 1ZCFA 3T12A 4MYTA 1XRPA 4JT9A 1U4BA 3Q8SB 3TI0A 5IABA 5EZYF 2PJZA 3SICE 3DAHA 3AEVA 3RR8A 1J7JA 1V1RB 3H4MA 4TTTS 5IKEA 5LD2C 3HYSA 2I7TA 1EPUA 3NVAA 4OSPA 1Z15A 4GC5A 3LYUA 1OXSC 3TZKA 4O4LB 1RWNA 1UXGA 5HJ7A 1C7YA 4RQ1A 2WMDA 3B70A 4B8WA 2YZ7A 2NYVA 1CUVA 2VYFA 2WP0A 3N8HA 4G0QA 1K8ZB 1XAIA 1D6NA 2ZSFA 2EZZA 4MPRA 3OZXA 4HDNA 4M1QA 3OMWA 4DXAA 1EXVA 3HZHA 3TFRA 4K81B 3ZS8A 1KR5A 1MIOA 1N7GA 5ICSA 4FDVA 3VSDA 4ZOLF 1TKDA 1YHNA 1DJQA 4OBBA 3BGIA 4P36A 2CNDA 1C50A 4QWEA 1I24A 1M2FA 3KXDA 3MYYA 4GW3A 5CX1A 3REGA 3I83A 4R0MA 3T7KA 1ODCA 3LO5A 1QLWA 3IBGA 4YIHA 4K9OA 2EP7A 3LZ6A 3E7WA 3GLFE 2ACEA 1F9AA 3PE3A 3O26A 1PK3A 1LUAA 1M6EX 1OV4A 1Q6ZA 3CX7A 4GP9A 1IEQA 4GXTA 5FOTA 4B4WA 4EI8A 4QUAA 2AG8A 3H11A 3RHTA 1DGQA 1SBZA 1PT8A 5IK2D 4PVCA 3WB9A 2PZJA 3GDGA 3BZBA 4J9PA 3JWHA 3ZV7A 3LY9A 3B1VA 2PE5A 4I2JA 4YPFA 2REQB 4MA4A 5CIYA 3CRVA 5FI5A 2ZR9A 1UDAA 3B1WA 4OLJA 1NVUQ 1RT9A 2WNIA 1CLUA 2VHJA 1PVQA 4YAWA 3I04M 3W7BA 4FILA 3M6UA 4MZDA 4Z4CA 4MI6A 5C8VA 2DE0X 4YD2A 1BWQA 1KZ9A 2X41A 4FFSA 4MROA 4NAHA 4U00A 1EHIA 1KVQA 3D6TB 4URHA 5KYKA 2X9LA 5KNDH 4OF4A 5KT6A 1UMBA 3G82C 3QF7A 3R3SA 1A3CA 3ENNA 3TQRA 3FDZA 2XXBA 4DWJA 2VTBB 3VKWA 4JUBA 1QYWA 1I1HA 4G36A 2WSMA 4JSRA 2QN6A 2EKZA 1I0IA 1X9GA 3FYDA 3NBXX 2IYRA 3C1YA 1MDFA 3KTFA 2P8JA 4LYAA 2V7QA 1DKNA 5ESRA 3UENA 1JR2A 1D9FA 2GEUA 1YIDA 2R8GA 1TVKA 4QZHA 2Y27A 2EJTA 3FPJA 3IQGX 3ZVKA 5K51A 2W3SA 1X9SA 2XNCA 5JH7A 3ZIUA 2CC2A 1E1YA 3IBYA 5AW5A 4YVFA 3QLJA 4O3MA 2H1SA 4FJ0A 5TX7A 2F1RA 4QOJA 5DGHA 2O54A 2DHRA 1QH1A 1OVMA 4GI5A 5J2TA 1QK4A 1MOPA 4Q7EA 3T7CA 2VHUA 2KE5A 5ALJA 4Z3OA 3ZGNA 1GCGA 4RGQA 4E2FA 1M1XB 2ZYRA 3E9CA 3USZA 3A26A 2ODWA 3MGVA 3LCUA 1NQ5A 1QH9A 3S2GA 3R0QA 2NNWB 5K2OA 5FCDA 4BE4A 4P3KA 3S2FA 4WFQA 1M6HA 2F17A 4ARAA 1G5IA 1ZX1A 1OX4A 2SNIE 1TUEA 2JGEA 3GJXC 3VO2A 2PX0A 4EYOA 3J7TA 4I50A 4I2IA 3OTGA 4CQMD 3QELB 5THQA 4M88A 4Y1FA 3U4QB 1ESDA 1E1RD 3AUJB 1EJ0A 5LQDA 1BU8A 5EE0A 4DLGA 3ONFA 4QIWC 4N0DA 1U3DA 1IK4A 3I5AA 5DOVA 2DR0A 3AI7A 2GVZC 4B3JA 1Z82A 5EHGA 4B3TB 3A2MA 2ZYIA 2E4YA 2CYAA 1RJ9B 3LX6A 4R3UC 4EGSA 1DVRA 1SXHA 1ZSVA 2PSHA 2V4ZA 1PTKA 1YH3A 2Y1GA 7ICRA 3CNQS 3QEOA 1NZDA 4FO6A 1TL7C 3SJZA 2WQ7A 4RIEA 2NT3A 4MMXB 4FWTA 3V7YA 1KAHA 3PC2A 3OWXA 5DU2A 4CEHB 5D5HA 5D49A 2A8YA 1RBMA 1MAUA 1Z8FA 4B2IA 2ETVA 5T6BA 3UJ8A 4WIAA 2BEUA 4PAGA 2ODAA 4UBNA 3MLAA 4D9IA 1K6MA 2CFTA 2QAGC 3KLBA 2RJNA 2OQRA 4I19A 5DTEA 1R8QA 4AI6A 4U2DA 4WFJA 1MC8A 5IMBA 3T15A 5JJKA 1F7VA 1Y98A 1F6WA 3I2FA 4N9QA 4QJ3A 1GTRA 5EWLB 3V1YA 4PJ0U 5J2IA 1ZHOA 4M1KA 2FWNA 3ILXA 3H7IA 1D4AA 4E3ZA 3Q3IA 1J9ZA 1NW7A 1QG4A 1Z1VA 3RFCA 3OECA 4Y9TA 5J2UB 4I6JA 3WRVA 4X00A 1Q5PA 4PO8A 1A04A 5AJTA 2F2AB 2WOOA 4D9HA 5KQSA 5KO2A 3UA3A 1ZM4A 3PFBA 4BO1A 4X1KB 4RZRA 1G5QA 7ICHA 2NPOA 2X3UA 4JI4B 3KJFA 2ZULA 4NHOA 1KS2A 4Q45A 1NZFA 1NNUA 1W36B 5TLSA 3OP4A 1N5JA 4JI1B 5LYYA 2F76X 1PQWA 4L9RA 3ER9A 3RLFA 2F3SA 3H9EO 1OB5A 4HQFA 2E55A 3AR7A 1XJCA 1ZQAA 3LH5A 4JLKA 4PLVA 2C59A 2W83A 3CUUA 5CP8A 3KFXA 4DLLA 2Q3FA 4DQLA 1Y8CA 2V7UA 1MD9A 2HIAA 2I2WA 1YU9A 3GL9A 2GJKA 3PZRA 3DULA 4ZVKA 5FQNA 3TW0A 5IM4A 3AF1A 4X66B 2BKVA 3HB5X 5B4UA 1T2CA 3RS9A 4IZIA 1P1IA 1KMHB 1W96A 4DIOA 3E7PA 1KU6A 4RESA 2PFGA 3OTQA 4OL9A 5HIJA 1GCIA 1HDCA 5BUSA 2ZETA 1II0A 3C1TA 5IZCC 2M98A 5T7BA 2A3NA 2XCTB 4PE5B 1M6WA 3T54A 4GC7A 4FN5A 4GOXA 1R9NA 1PNTA 4XASA 3Q7IA 5I01A 1NXOA 3L0IB 3WWDA 1U3WA 1SMKA 2HA3A 2R6DA 2PI5A 4RTKA 1S8OA 4JT8A 4JU9A 2EAMA 1DMSA 4B4VA 5DCUA 3OA2A 4UEKA 1Y42X 4RIHA 2XMDA 1WMEA 5BWMA 1JEYA 4AC9A 1DTEA 2W2KA 3DDOA 2DY1A 2F59A 5DEOA 4FYWA 1FZQA 8ICGA 2WAYA 1MN8A 1YJAA 2M6RA 3ETCA 3K0HA 4JN6B 5FI3A 3TQQA 4H3HB 5DBAA 3M8SA 1L7PA 3O4JA 5EVCA 3ONEA 2M9MA 4IG4A 3CWQA 1QONA 2WAXA 4LBVA 4PSDA 4A73A 3T7IA 5GQSA 5LMUB 2O8EB 4UB5A 3N2EA 3BQTA 4IWXA 2ZRMA 4OHYA 2HRDA 1NTOA 4REQB 1SL0A 1HE3A 2Q4TA 3RAQA 2EFYA 2Y0PA 3QE3A 4GZ6A 2AT1A 1DXYA 4KRGA 4RZIA 3RT7A 1GA6A 3I5XA 2Y0SF 2Z56A 3C74A 3S28A 1XKQA 5FOUA 1D1PA 2O0KA 2A1IA 4QXOA 4XM0A 3EFHA 3EZGA 5K4HA 3WAJA 2K7FA 1P5RA 1IZ0A 1O89A 1IRIA 3ZWOA 2MOKA 4JUFA 1JE0A 4WASA 5EAIA 1MKYA 2I4TA 4BFYA 4KRYA 4JL5A 2JK1A 2PA0A 4TV8F 4OCZA 3BZUA 2GM5A 2R7MA 2Z04A 2QOEA 3DPIA 2NGRA 5EIBD 4V1CB 4TWJA 2GCNA 2OHJA 1L7NA 5DXJA 4BZQA 2CV2A 5ANRB 1SO8A 1F2UA 1EBFA 2WAMA 4YCJA 5L1KA 1V26A 4II3A 3M8RA 4PINA 5FPHA 1U7XA 2JJ1D 3HBAA 4G5OA 4PC7A 3T9EA 4CLDA 1OHHD 4U5XA 5EUMA 2G0NA 3SFZA 1A7AA 1EDOA 4Y30A 1Z6TA 2LD4A 3I3SR 1R6VA 1UBMS 3NTLA 3ROXA 4PGFA 5I7OA 4ZXPA 3N87A 5AQEA 2O20A 4DLUA 3N0VA 2G28A 4M1YA 4QQKA 4Z53A 2IODA 4JL6A 3SC4A 3X43A 1NBOA 4C6RA 1E7YA 4RV4A 3TJMA 1WUJS 3QKSA 1FSFA 3RAGA 4BTVA 4R8MA 1OZ0A 3MJTA 3SMVA 1Q91A 3OLXA 5AHRA 1BH6A 1EFRD 3PTLA 1ZJ5A 3WQSB 4CR8A 2Q4RA 3HADA 5JNRA 1I7NA 3BIWA 4IUYA 3V9PA 3K75D 2Q1YA 2VK8A 4HGZA 3ETLA 2EEZA 1LZKA 1OCEA 3WMRA 3OLCX 1BS2A 4L57A 4O2AF 2HK6A 5JSZA 4JD5A 3R5TA 3CLRC 1K8XB 4MYUA 4BQNA 3ZJVA 3M9NB 4QGBA 3NXSA 5KDDA 4G4GA 2QLBA 1SUWA 1YBAA 4TUYB 3QTLA 2I71A 3R7BA 4IEIA 1XA4A 2H65A 3DVLA 1K0FA 1QTQA 1SKAA 3GIIA 2NADA 2UDPA 4QDTA 4D9JA 2WD9A 4K9PA 4BEBA 3NAMA 5IBRA 3DVAB 1TT7A 3ZV4A 5JIBA 1RLIA 1ZCZA 1GPMA 3B1ZA 1NDHA 2KSQA 2WSIA 5MN6A 3GLGE 3GT4A 4JS0A 1IY1A 5H5JA 1PD0A 3CUVA 3CUKA 2ZPUA 1PDWA 1V85A 2J9GA 4FQ7A 3HI6A 2DBRA 1ISSA 3TIIA 3IUYA 2P9JA 2XLBA 3QOWA 5F4BA 1UKYA 3IO3A 1RWPA 4KVFA 1O5OA 3NHRA 1LVHA 3CLVA 2O8CB 2IYEA 1BEEA 1QZTA 4F4FA 3AJ8A 1DSSG 4G1FA 2ZJ3A 4WNIA 1TGVA 1QFYA 2PMBA 1SB9A 2ZJ6A 3T5JA 4O2RA 1UT6A 3WSVA 1L5FA 1M9NA 2WF6A 1V9LA 5IVHA 1JA1A 1R4NA 2BEJA 1YCHA 1NBME 4CMAA 4AMGA 2XD4A 4PLFA 5DM1A 1UBRS 4Q1EA 1KDOA 4YRDA 3FOWA 2JBAA 5CEJA 4N5LA 1NJXA 2EFGA 3LYLA 2XQJA 1CF2O 2BD0A 4UJ3A 1ZA1A 3PVCA 1N3BA 3PFGA 4JMUA 2B37A 1T0PA 2IS4A 4NC9A 1CV2A 1MAHA 3JQ7B 3SSOA 1FP4B 2OCYC 2IOHA 1TEXA 1XTIA 2K2QB 1QSYA 3HCPA 3MRSA 1Y9EA 2WR8A 5EKXA 3HL4A 2ZTDA 4JHLA 5DYYA 4RSRA 2AF3C 2IIVA 4WK6A 3UJ3X 1WHSA 1YI0A 2QI9C 3SF8B 2UVRA 1ZFNA 4P34A 1V7PC 2JVJA 3JPRA 2YCBA 3IA2A 4G2TA 4GQIA 5EWJA 5DG9A 1RD4A 3CUTA 2OXOA 3MHPA 4MVJM 4HK4A 4O4IA 3PXGA 2WB2A 1DB3A 2WYOA 3I53A 1RYBA 5ALFA 4WXHA 2YV4A 5KFJA 2DHCA 2ZRQA 5G0SA 3ZLTA 3JYHA 4AJPA 5KFZA 4DDMA 5JD5A 3D4BA 5HA5A 2JEJA 1RKQA 3OQ1A 2PGXA 1Z0FA 2X13A 1XCBA 1H0KA 2PIAA 3DC7A 3KRTA 5FAKA 5H16A 3GPBA 4J07A 4AKTA 5C0OE 1SQSA 4PYNA 1DIGA 4YRRA 1H2XA 4E22A 1SBYA 4H1UA 1T1IA 2P2NA 3NJRA 1NVFA 4GLLA 4JB3A 5AM3A 4KO4S 4W8OA 1NYQA 4U39A 4BX8A 4KLEA 1NASA 4FSDA 16PKA 1IIRA 5FJJA 4ALMA 4HGYA 5D3KA 2W55A 3L49A 4RQBA 1W4CA 2YHIA 3SQDA 3NTVA 1CIJA 3ZGZA 4HDKB 4EG8A 1RZRD 1FZTA 2VWHA 2J4CA 4Z6CA 2GO1A 1PHPA 1EVKA 1VSQA 2CLSA 3U4CA 3ZHUA 4ZWNA 3PFWO 1O08A 2MJLA 2OWDA 1BOOA 2QRVA 4GX0A 4UXJA 5EEHA 5DLPA 2QD3A 3CRQA 3F6PA 1K6IA 4D3SA 4RVUA 1NI4A 1FJXA 4M2YA 2XE7A 2HIMA 3Q87B 4RGVA 4D41A 4BPBA 3K96A 3ABQB 1QPGA 5ICMA 1Z2AA 3MINB 3RH5A 4MQ5A 3VNSA 1IAQA 1QFSA 3P20A 4TVBA 3NP9A 1PI3A 7ICQA 1A2OA 1QCZA 2C03A 3RVKA 3TO5A 4UHJA 2DZDA 3FFAA 4HDSB 1LWNA 4RE6A 4UTXA 1J20A 1X9HA 4R0NA 1VPTA 2C96A 8ICAA 2R1TB 2PX4A 4KG7A 3QJGA 1K06A 2RGEA 4U02A 3ZCUA 3P45A 3A9CA 4A7PA 4B32A 2C7QA 4CEHA 3PNOA 4BEJA 3BF7A 1E5QA 3GDHA 5EGSA 2WU8A 2KSOB 4HLUA 2OV6A 1V71A 1GQSA 5EHXA 4KQJA 4BZPA 2O2SA 3SU8A 5J0UA 1FYEA 1ML4A 1WL8A 2W03A 4ECVA 3FMPB 2I7XA 4ENSA 4XARA 2NW6A 5DVZA 5G3ZA 3DMDA 4RQMA 3OKCA 5DWDA 2EQAA 3MG9A 1UPAA 1U5AA 3JWIA 1BJRE 2CK3A 4ZOCA 3PW7A 1L3UA 4PO1A 1PQ4A 4BGDA 1OSNA 2C95A 2ZREA 5HNKA 4D42A 1QRUA 4I0WB 1ZVQA 3W1VA 3TQHA 3U40A 1S76D 5IJZA 2D8MA 2OLJA 5CG2A 1SUDA 4PXAA 4MWEA 2XT9A 2CT8A 3AVYA 1ORRA 1U2GA 3H86A 1GSAA 2HHAA 2A1UA 4W5JA 1P5FA 1MNQA 2GPAA 2PYZA 4M46A 3CBGA 4XQEA 4XX0A 1XQYA 2J3LA 5E38A 5AQ1A 3CIOA 3TTTA 3R5JA 4ES6A 2HC9A 1LX7A 3I28A 3GGPA 4NH0A 3F9CA 1C7FA 1QWSA 2B4QA 1S4QA 1EEHA 1S3FA 3IKMB 3JVIA 4UM8B 4BY9E 4HAIA 2WJVA 3E9EA 1T3TA 3HZRA 3AKCA 3I5UA 4FQ8A 5E6SA 1TMYA 2H5XA 2PKXA 3KB6A 4M1ZA 4HAZA 3CUYA 5HQ3B 3I2YX 1R5OA 3K8QA 3F5FA 1TW2A 3GPIA 1XVVA 3HR4A 1C14A 4P2GA 4RBNA 1LPBB 2KJ9A 1NM5A 4LNAA 2XMGA 3E1KA 5B2EA 5JD4A 2IJGX 1OASA 1EUCA 4PBTA 2DJ5A 5JXJA 5DK6A 4DLPA 2ZYDA 3FPLA 3W5HA 2BFNA 3DOCA 3BB1A 2J87A 5L6LB 3IH5A 4KL8S 1AB5A 3DKIA 3ZDYB 3PVXA 4QYSA 5AK4A 1IQPA 1BFKA 4KDEA 1PEDA 1L5NA 4GPAA 2QN9A 3P2YA 3R20A 1N2HA 2F1OA 2HTFA 3DO6A 4LEIA 3IP3A 2RI6A 2CJPA 2QRLA 1NOMA 1HR0B 1W581 2BJVA 4HDNB 4XTCS 4DCGA 2C04A 4LOHA 2HBKA 1CVIA 4XIFA 4B73A 2IBKA 1YVPA 3PCXA 3S2IA 4KBGA 1ODFA 2HSWA 1G20E 2N1BA 4FHEA 1PR4A 2BDTA 4GH5A 1NATA 3N97B 1N6RA 3BMOA 2IV2X 1AK2A 1JAZA 4A4DA 3E5NA 3IG5A 4ALIA 4C8NA 4HVTA 4B8ZA 4IJMA 1J70A 3TSOA 4DV1B 2IHUA 1J21A 1DIRA 1V7QA 1Y9JA 3L0DA 1P5ZB 2QR5A 3GOQA 3P9QA 1TAHA 4IYRA 4J76A 5FL7A 5FWAA 3PGA1 3U7HB 2NWQA 2JBHA 1JHAA 2X22A 2EKLA 3L7IA 4YGYA 5LKRA 2BZFA 4R1TA 2VA2A 1CQZA 1E2GA 1LQTA 1HL3A 3QPCA 2BOVA 5IM5A 5E6SB 5KHOC 5DQGA 5K2MA 4ZN6A 2BFEB 2I2DA 5DLEA 3D8UA 1JB1A 3IMFA 5LYJF 4C30A 1Z39A 3RAXA 3D0OA 3UHOA 4E94A 2NXWA 1OAAA 2O52A 4ND3A 5FWYB 5TVKA 3V8RA 1PUXA 3F4BA 2FPWA 4KYIB 4QLOA 1CY2A 2HTEA 1U5CA 2QSZA 4XSGA 3VJRA 5CCBA 5FR2A 3WGOA 3D2QA 5EIBC 2IK8A 5DQHA 1E2PA 1P2SA 1PFGA 1WBJB 4OKIA 5EEGA 1KFBB 3BMNA 1VJRA 2OCKA 3NW9A 4U0KA 4UULA 3EXG2 3GJTA 1X7DA 3DLPX 2GT1A 3M6FA 3TWOA 3QYAA 2OZLA 4EJ0A 4B3GA 4DQRA 1RHRA 2Q2QA 2C9MA 2B8JA 1IMOA 1E0AA 3SJCA 3DVRX 3C2LA 4H27A 4O3SA 4N3BA 4B3SB 4F2DA 5AKEA 2C92A 3EFBA 5BWOA 3G7SA 4OHCA 1R3DA 3FETA 5JAUA 1P6QA 2Z8YM 2GZAA 4UMEA 5CR0A 5KZMB 1KDTA 2P1ZA 3JW8A 1Y1QA 4KXYA 5DMXA 5EFOA 2GBPA 3N76A 5AI9A 1C8KA 1I3LA 2RSLA 4EATA 2PGIA 3AUTA 5H59A 3UC9A 4H3VA 3O4HA 4RNNA 1K7EB 2D4AA 2H1IA 1XAJA 3EFEA 4R2LA 1JAYA 4IUCS 1ODKA 5AJUA 1UAGA 2XYHA 2NO1A 4YJ3F 3IAM1 5BYAA 2RQ5A 2XJ4A 4I1YA 1YF3A 1FNNA 5HS6A 4QD3A 4KLOA 2ZYHA 4PL2A 1Q2XA 4WAUA 4GD3Q 2OGWA 5JWOA 2UUOA 2A14A 2O2ZA 2YQZA 2IPNA 3LXXA 3MT0A 3WRYC 5CXUA 3GRVA 1MG0A 3WL8A 1YD7A 3W8FA 4DBZA 2XGPA 2IELA 3LLUA 2NRZA 4ND5A 4ED6A 2ZZNA 1GGHA 4UM5A 1CZKA 3HFSA 2HXGA 4N4AA 2FEXA 5KKCA 2ACVA 3VYTB 4LMAA 4HYQA 3DS8A 3TTYA 2JMGA 4R5MA 1CUUA 2QJOA 1V0JA 2NQTA 5EGNA 3JARA 2R00C 2QN3A 3FCAA 3QE2A 3AVQA 4HDRB 3SHVA 3U44B 1HTBA 2LIVA 1LA2A 2VQ6A 4G1UC 1GPDG 5EQFA 4L3WA 2WNHA 3PKJA 4RGBA 2XY4A 4QBTA 1IN4A 3AU9A 2ZSUA 1YHZA 3Q9UA 4JWMA 3A1DA 1E1MA 3NKLA 4K8OA 4MP8A 1M34B 1CG6A 5HGJA 2HLDA 2O7RA 1KETA 2OCBA 1P77A 1R6BX 1YRLA 2JHDA 1TXGA 2YZKA 2CDAA 1UOEA 4WLEA 2X7XA 3MB8A 3OBIA 1H8HD 3UFXA 3WOHA 4HNAA 5KT7A 2AKAB 3OHSX 3IVRA 3WV5A 3LAWA 3PIRA 1HLGA 2J0UA 2GN1A 4K9RA 3IAS6 2IEDA 4XEHA 4JELA 5FULA 5BN4B 1JJ7A 2Z4TA 1WV0A 3AHCA 4YRPA 4XI9A 3RVBA 3VR4A 3B89A 3PQ7A 3T3IA 4FFLA 4MVJP 3U61B 3CTMA 4ZEXA 1ZAKA 4KR2A 3ZW7A 2JGIA 2AX4A 2QT9A 2W5UA 2GFQA 2RHHA 3FDIA 3DOFA 3GLHE 4BP1A 1IPHA 2DF4B 4Y9DA 2F8LA 4CG3A 5SY4A 1ODTC 4ZHQA 4DEZA 1DX4A 3K6RA 1WXEA 2ZRHA 4G67A 1VDMA 5DN9A 2BFOA 5JAMA 1ZPDA 4MWOA 4LY3A 1VE9A 5EZ6B 3NAZA 4Q16A 3AR9A 1NFRA 1WB4A 2A0FA 1KU0A 3CVJA 4LXQA 4QPDA 9ICRA 1H9CA 3I4LA 1EMDA 1GRRA 3FPKA 5IDXA 3TBHA 1HFEL 3HP6A 1E0JA 3ZJUA 3SAFA 2FW8A 3AH8A 2X19A 4IS3A 4YEDA 4F8JA 1B26A 2W2LA 5CYOA 3BMCA 2GUGA 3B9JA 3RNLA 2FW7A 2RHJA 4PIVA 1X8JA 4ECZA 3KSMA 2ZUVA 3IP7A 3HFJA 2O4UX 4OO1J 1RPTA 4AT1A 2HJSA 1ACLA 4GYKA 3PRHA 4D4KA 2H1LA 3B2QA 4XUCA 4HH4A 3QBTA 5HCNA 2ZJ4A 3MCAA 2QT0A 3PX3A 4F12A 1FDWA 4QICA 3WGLA 2WZDA 4Y2SA 1L4EA 2AG6A 3B9QA 4EF5A 1XVTA 4PHAA 4J0CA 5KX5A 4RTOA 1Z19A 1F20A 4IS7A 5I9TA 2B2CA 3TQTA 5LMNB 3E0FA 2O50A 3FCUB 1H8EA 4BO9A 3ZTYA 4BMPB 1UH5A 1LTHR 1RYUA 1IV8A 1WNTA 3D3WB 3RSZA 2WKQA 2F1IA 5HGXA 1C80A 3HYTA 3HXLA 5C7LO 3CHYA 2E89A 3HP4A 1JLKA 1YQGA 4P4NA 5FI1B 2ZYSA 1MGPA 5FWNA 3ZZ0A 2G1UA 3VTKA 5JH7B 1GVHA 3C43A 4YDRA 3ITNA 3G0GA 1WW3A 1C7QA 3CSDA 1I1QB 1ICEA 1SWWA 5CITA 2TYSB 4L51A 1L4GA 5BQPA 2WY2D 3GCZA 3QVGA 1XZ8A 1RW4A 4PCVA 3HMKA 2B7LA 2UZAA 3CCBA 4IVRA 2A0YA 4OK3A 4ZT5A 1KERA 2EL9A 4ZCIA 1QBKC 1HQKA 4RLQA 2BUCA 1GL7A 2OHGA 2BGNA 3MABA 1W19A 1W9HA 9ICJA 4CIYA 3GLGB 2H2DA 2HF2A 4Z3DA 4DR5B 4H4CA 2BFFA 4UEJA 5CH5A 4QWCA 1U7HA 4B2LA 1EDEA 1NW8A 4EG0A 1JEEA 1W30A 1FTWA 3PO4A 4X54A 1GHTA 2VDJA 4CKZA 2EIXA 1KDRA 1XO1A 3QQ5A 5H4GA 1VPWA 2PS9A 1ZBQA 3D64A 2HV8A 4FDUA 1ZN7A 1K66A 1AF7A 2JIZA 1T3HA 4KIFA 2QPOA 1P18A 4LDQA 3E5HA 2XCQA 4NDAA 3B3AA 4FFPA 3UQYS 1G18A 2ZDGA 5T8KA 5FAXA 4EPTA 4J9OA 2ONZA 2R6R1 4ZK6A 5DG7A 1YOBA 1EH5A 1P1RA 1TECE 2VCHA 2GN2A 4MF2A 1AK9A 3BORA 3BRWD 3VR5A 1XE3A 1XUOA 3P9YA 4TVSA 2RC5A 4XYBA 2FSIA 2B7CA 1NK7A 2IZ7A 4RWZA 3IDWA 5ALKA 1ORTA 4LK2A 4NZOA 4ZVTA 3B5IA 1EFVB 3OT5A 5IJ9B 4CL2A 4BC0A 2Q5HA 1E1QD 4XWGA 1QC5B 2Z83A 3FKSA 2GERA 4NMLA 2H3VA 2WF8A 2EJWA 2V7WA 5FBLB 4CCWA 1NK5A 2BE7A 1T9KA 2FZ5A 4OYRA 4BNJA 1JNYA 2QP4A 3C24A 3SEQA 3A1WA 1KMMA 4NYIQ 3EJWA 3GLGA 3ZGXA 2R60A 1UPFA 1XFAA 1LGYA 2VUIB 3MCZA 1SZHA 1J2YA 1XZCA 1YAJA 2IIPA 3OM1A 4Q9NA 4QQ8A 3VH2A 3ZHSA 5DBGA 3R24A 1DIBA 1XROA 3GFTA 2HHUA 1DC7A 1P5JA 2EP5A 3C29A 3OIWA 3FYHA 1C1DA 1JHRA 4YQEA 4C4TA 3DMRA 1PZXA 5H68A 1U0NA 3EMBA 3UMFA 1TYBE 4RCYA 3SQMA 4E0DA 4LISA 3K9GA 5J5AA 2G9UA 1TVCA 4LCEA 3BN3A 1J0EA 2VDNB 2VDMB 3FR8A 3IOEA 4KCGA 4MICA 3DL7A 2ERYA 4KV7A 2QZ9A 1KI9A 4MQ6A 3RK4A 1K68A 3KUUA 1T5HX 1KN5A 3SZGA 2HJVA 3ESYA 1J8YF 3TIGA 3KJXA 3G2NA 1XKTA 4GOLD 2XB8A 4WJ3B 3O3NB 4R1LA 3OEHA 1I3NA 4M53A 1A69A 3PKIA 1OYOA 4J16C 3UV6A 1IBMB 1RJ9A 2VRWA 4NEGA 1O5TA 5EKDA 2B34A 3WXBA 3GUVA 1FFHA 4Z4QA 3PSHA 3OQ6A 2XSZA 4G0YA 4WESB 1CJKC 4QZ9A 2MMGA 1L5OA 5IH7A 5KQPA 4BWFB 1X7WB 1Z6YA 2EQ5A 1Y3IA 5C80A 2CXNA 1U1DA 3IUSA 3VHLB 4IV0A 3GUHA 4LZAA 2UUAB 3OOEA 2C5GA 4L9AA 4KE8A 4DL4A 1RFGE 3W5UA 3KE9A 1YCGA 3IN5A 1BTOA 1N9GA 1QORA 4CE6A 4MUGA 1L5GB 1O5IA 4Y67A 5HKKA 4DXHA 2NP7A 2F77X 3PF9A 4KLSA 1UIMA 3SYRA 4Q44A 4HNQA 4KK3A 4ZVUA 3AP1A 1SC4A 3UMRA 4CV0A