3QNMA

Haloalkane dehalogenase family member from bacteroides thetaiotaomicron of unknown function
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
231
structure length
231
Chain Sequence
LKYKNLFFDLDDTIWAFSRNARDTFEEVYQKYSFDRYFDSFDHYYTLYQRRNTELWLEYGEGKVTKEELNRQRFFYPLQAVGVEDEALAERFSEDFFAIIPTKSGLMPHAKEVLEYLAPQYNLYILSNGFRELQSRKMRSAGVDRYFKKIILSEDLGVLKPRPEIFHFALSATQSELRESLMIGDSWEADITGAHGVGMHQAFYNVTERTVFPFQPTYHIHSLKELMNLLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Haloacid dehalogenase-like hydrolase
publication title Haloalkane Dehalogenase Family Member from Bacteroides thetaiotaomicron of Unknown Function
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Structural genomics, unknown function
total genus 90
structure length 231
sequence length 231
ec nomenclature
pdb deposition date 2011-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3qnmA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3qnmA01
3SKXA 2I54A 5AI5A 4OHFA 3SMVA 1Z4KA 1LTQA 4AP9A 5ALXA 4E88A 4KNVA 4HGNA 3ZU6A 4J03A 3SF0A 5AM0A 1O08A 3E8MA 4EEKA 1TJ5A 3E84A 3KDPA 1S8OA 5AKIA 2ZXEA 5ALQA 4L6CA 3ET4A 3FPBA 3WGVA 2MSNA 1ZJJA 3MMZA 2HCFA 3I28A 3L8HA 4H1WA 1X42A 3QYPA 3L0CA 1SWVA 1O03A 2YJ4A 2BDUA 2HO4A 2YJ5A 3A1DA 3W5BA 5AK6A 4C4TA 4XPZA 3SKYA 1Z4OA 4HYTA 4EX7A 3ZTWA 4B6JA 2YMMA 2JAWA 1WPGA 2B1QA 1ZD4A 3SHQA 4KN8A 1L8OA 5AKYA 3D6JA 3DDHA 4Y2YA 4HAIA 1RKQA 2OA0A 1RLTA 4EZEA 3ZVMA 2PKEA 4CF4A 1J97A 1YV9A 3L0YA 2OBBA 4UAVA 5AVRA 2YY6A 3WKEA 1ZRNA 4XE5A 1RPZA 1U02A 3W5AA 5AM2A 3WK9A 3AR7A 5AW9A 4I9GA 4J2TA 5AVUA 4UM7A 2G80A 2WFAA 3HYCA 1T9ZA 3ZUPA 5AKJA 2G09A 2O9JA 1WVIA 3U7HB 3PGLA 1RQLA 1S2OA 1LVHA 5AVSA 3UM9A 2Q4TA 3ESRA 2YJ6A 5ALVA 1N9KA 2NO4A 5AKLA 2W11A 4Y2SA 3MC1A 3QU9A 5AKEA 5ALKA 3FPSA 5AM1A 1RKUA 2EARA 2Q4RA 2ZBGA 2EATA 3WKDA 4XQ0A 3L5KA 2I34A 4UW9A 5IT4A 2ZBEA 4PNHA 2G06A 2GMWA 1WR8A 1J8DA 1L7OA 1AQ6A 4HGPA 4GIBA 5AK3A 5ALPA 2AMYA 3K1ZA 2G1AA 2PQ0A 4Y2VA 2RAVA 3R4CA 3OCZA 2JGAA 3OCVA 4YCLA 2I6XA 1F5SA 3ZW7A 1TE2A 5ALGA 4BKMA 1VJ5A 3B9RA 4FE3A 2FPXA 3J7TA 3L8GA 3IB6A 3W5CA 5ALHA 3BWVA 3EF1A 4OD0A 4C4RA 5ALYA 1QH9A 1U2TA 3P96A 1RKVA 2FPWA 2X4DA 5AVVA 2ZG6A 1RQNA 3AR6A 3RFUA 2C8LA 3L0BA 4I9FA 1Z5GA 3OPXA 4G63A 4BYGA 1RDFA 2WM8A 3QXGA 5ALTA 4UMFA 2I33A 5ALIA 1SU4A 2FDRA 5AI9A 2W43A 3E81A 4MUMA 2CN1A 5A3QA 1Z4PX 2D2VA 2FI1A 1NRWA 3WGUA 4BX0A 1QYIA 2P27A 2HX1A 5AI0A 2RARA 1ZD3A 4G9BA 3AR5A 4FFDA 3U7EB 2B0CA 1ZD5A 3QGMA 3MPOA 4YH1A 4RESA 1K1EA 1Q92A 5ALWA 3A3YA 1Q91A 3E58A 3R09A 3R9KA 3A1CA 3AR3A 3SD7A 2AGVA 3QUTA 3QNMA 3ZX5A 3KBBA 5AI4A 2WF5A 2I55A 3S6JA 2IYEA 2WF9A 2RBKA 3FM9A 3VAYA 2NYVA 2JARA 1YDFA 1FEZA 3UMBA 3U13A 5AKXA 2HI0A 4CF3A 3UMCA 2QLTA 2G0AA 2YN4A 4CE6A 5ALJA 4FYPA 1Z4NA 5FP0A 3QUQA 3TLMA 3EPRA 1YJ5A 3I6BA 4HGOA 1RLMA 5A3RA 4O8CA 5AVXA 4F71A 4YCMA 4RETA 2WF8A 5IT0A 1L6RA 1RMTA 2IOHA 5AI8A 3OCWA 2YJ3A 1RLOA 3DV9A 1CQZA 4Y2RA 3QU5A 3MN1A 4UU1A 4CNQA 3BA6A 2FUCA 2ZBDA 2YMPA 3OCYA 3WKCA 2CFRA 2MU1A 4XOUA 3U7GA 5AKHA 1MH9A 5AKKA 3F9RA 3KC2A 1Z4QA 1YNSA 5ALZA 2HF7A 2VKQA 4KX5A 2DQSA 4KX3A 3NASA 1TA0A 3AR4A 2B82A 3WKAA 4UMEA 2C8KA 2EAUA 3UMGA 5AESA 2ZBFA 2GHTA 2CFSA 2BY4A 2IA5A 3WK4A 4BNDA 3QUCA 5ALDA 3B8EA 5E0OA 2HDOA 3KD3A 5A3SA 4UASA 5ALRA 3U19A 3ONNA 5AHXA 3KOOA 2P69A 2YMQA 2P9JA 3DAOA 4L6AA 2FEAA 5AVQA 5AVZA 2YMLA 4OFZA 4UARA 2HEGA 2ZOSA 3L8FA 3CZ4A 5AW2A 4BNDB 3QU4A 3NRJA 2OM6A 1T5TA 1ZS9A 3L1VA 3ZVNA 1Z4LA 2P11A 4HGRA 2WF7A 4ZEWA 3AR9A 2YBDA 3EWIA 2CFTA 1T5SA 2B8EA 4JDPA 4MWOA 1CR6A 4ZEVA 2JAUA 3L7YA 4UM5A 4NABA 4F72A 4C4SA 4NAVA 3SLRA 5AI6A 3WK5A 3PCTA 1RC8A 5AK4A 1WZCA 1YMQA 5ALMA 1L7NA 1IWOA 3OTQA 4Y2JA 4CF5A 4Y2QA 4HGQA 1EK1A 4JB3A 2IOFA 3NAMA 3ZI4A 2QYHA 4UMDA 2GHQA 2C88A 1L8LA 3WK7A 3DNPA 1EK2A 1VFPA 2FUEA 5JJBA 4IFTA 1ZD2P 1VJRA 1U2SA 2R8YA 5AM4A 3NIWA 3A1EA 1Z4JA 5AICA 2FPUA 3AR8A 1JUDA 3N28A 5AKGA 1Z4IA 3OCUA 3L1UA 3AR2A 4L57A 4KYTA 2FPSA 4Y3UA 5AW6A 3QLEA 1NF2A 2NO5A 4EELA 4Y2TA 4BEWA 2HHLA 5ALUA 3B9BA 2HF2A 1QQ6A 4DCCA 4BX3A 2R8ZA 5ALEA 4OCZA 3N1UA 5IS2A 2O2XA 5AKZA 4DWOA 5AW4A 5AW3A 4GXTA 3GYGA 4EX6A 5ALOA 1U7PA 3ZX4A 3WK6A 2MU2A 3WKBA 2C4NA 3M1YA 4Y2PA 2WF6A 1QQ7A 3FGOA 3ZTYA 2HOQA 3QX7A 4YIHA 2Q5EA 3EF0A 2AUTA 3ESQA 5AW1A 5AW5A 5AM5A 5AIBA 2AH5A 1RMQA 1YS9A 5AVWA 2YFYA 2IOFK 4QJBA 5ALNA 4NFLA 4DFDA 1Z4MA 3N5KA 4UATA 2GO7A 3QU2A 4DW8A 5ALSA 5ALFA 1XVIA 3PGVA 1QQ5A 3WK8A 2B8JA 3ZWDA 5AIAA 5AVTA 3QUBA 1L7MA 1Y8AA 4UU0A 1TJ4A 4YGYA 3M9LA 3ZWKA 5AW8A 5AK5A 3FVVA 2BDEA 4NV0A 4YCNA 4KNWA 3NANA 4NWIA 2C9MA 1Z88A 5AVYA 1U7OA 2WHEA 4IG4A 4AS2A 3U26A 3CNHA 1RRCA 1KYTA 1PW5A 2G08A 2R8EA 3OCXA 3N07A 4QQFA 4BX2A 2B1RA 3U7FB 5T41A 1Z5UA 5ALLA 1RMYA 2G07A 5AW7A 1XPJA 4Y2UA 2OYCA 2W4MA 4ZEXA 2I7DA 3ZVLA 3NUQA 4AS3A 4BBJA 3RF6A 1NNLA 2R8XA 3NALA 4EENA 3HLTA 4BEVA 3ED5A 2FPRA 2B30A 2HSZA 3W5DA 2PR7A 2JAOA 4Y2XA 3KZXA 1N8NA 1ZOLA 4UAUA 3PDWA 5AM3A 2GFHA 3FZQA 3IJ5A 2ODAA 4UMVA 3IRUA 1TJ3A 4YIKA 2RB5A 5AW0A 1ZRMA 3I76A 3I1YA 1XP5A 1L7PA 3N8GA 3QU7A 3ET5A 3L8EA 1SWWA
chains in the Genus database with same CATH superfamily
4U0JA 5KYUA 4HDSB 2XVMA 5DTEA 1N2IA 4PPQA 1X7YA 4B45A 1PEYA 2ATEA 1U99A 2ZIWB 4F5EA 4FYYA 1GUZA 2H51A 3C1TA 2NRZA 2J48A 4DG5A 2EX0A 1ULHA 4XJTA 3F47A 3U3XA 1KY4A 3WLQA 4GNRA 3F5SA 4G41A 4HF7A 1X87A 5JZBA 1RLTA 3W4KA 1T2FA 3TZLA 3BD6A 1U2RA 3OUZA 2JHPA 1I7LA 4RVFA 4MA0A 1NFRA 2G4VA 5B1YA 2J0UB 1AUXA 4ND6A 3U7HB 3LXXA 3B3QA 3UK1A 4PSDA 1KSFX 2EFGA 4OEHA 3MD9A 3HJUA 4BC1A 1UOOA 4DXAA 4A92A 5C8YB 1U8XX 5F1YA 1MAWA 3NATA 1E3TA 3UQYS 1YQDA 2JIDA 3MXOA 2BBWA 1GNRA 2W2LD 2NSHA 3UMJA 1N2GA 1ST3A 4KXWA 3E9ZA 1B7GO 1OU0A 4QQNA 3PWTA 4ID3A 3NVMB 1URPA 5EPEA 4WD3A 4I2EA 4ZDIA 1LEHA 1SCUA 1NY6A 1UBCA 4DPLA 2XE8A 3MK31 3GJ3A 2X4DA 5AVVA 3OFKA 4BNTA 3AETB 3NVWA 4FB4A 1VRCA 4H1HA 2FU5C 2DPHA 1YKFA 3MGIA 2P8SA 4WFJA 3IEPA 4CT5A 4I81A 2P3QA 1XJWA 1VKNA 4FC7A 3K7EA 3SD7A 2CGEA 3OPYI 1SPXA 1S0VA 4DEVA 3DE5X 2QRMA 2VZEA 1FEZA 3TZQA 1OWPA 2YN4A 3U09A 1VL5A 3TQTA 5IKOA 4J9OA 1ISFA 3C7DB 4MHSA 2IIQA 1C81A 4Y2RA 1YRQA 3RV4A 2NZYA 2B0JA 3Q8SB 4DDMA 2A88A 3FYUA 3WIOA 2QX9A 2CE7A 5BPHA 5K20A 3Q1LA 2RBEA 3V2UA 4Z0TA 3S2UA 4IH9A 4FHCA 4JJFA 1E58A 3FRJA 4YV0A 5BSUA 2ZAYA 3RAQA 2J30A 3TFWA 1O4WA 4J9SA 2HU2A 3FVRA 4MIKA 2RGRA 3FSJX 2XGQA 4OF4A 4B4OA 3PHJA 4S12A 4GGMX 3NAQA 1G8KA 1MO3A 4HD8A 1Z6AA 5CX1A 3NDPA 3RSGA 2XMPA 1VPWA 2AFIB 1RD4A 3HKDB 4BO3A 1DWOA 3HHPA 4DFKA 5T4FA 3ER8A 2LNDA 3HEMA 4H7FA 4ZOQI 3GLHA 4BV9A 4H1VA 4NZZA 3AKCA 1H8EA 5AICA 1CX9B 1OFGA 4ECUA 1U5AA 3PX6A 3C3EA 2GWRA 3D6HA 4CM1A 1BPBA 3BQ2A 4MMYB 4KSCA 5ITZA 4BFXA 1R9MA 3H9CA 2ETVA 2PD6A 1UA1A 1H4SA 2V4UA 3DPSA 1ENPA 5DO9A 3TI7A 5TE9A 3LFUA 3DBOB 1QMGA 2P77A 5A1JA 3V80A 3VNQA 3A9CA 4LVNA 4DG9A 3T5DA 1JDTA 5ALFA 4NSNA 5EZYA 5J1SB 4C08A 4K9SA 5GTDA 1ZM7A 3ZNQA 1YAJA 3OFSA 3O8OA 4IV8A 4EFKA 1TM7E 1UADA 4K9KA 2AA3A 3BMXA 3VTAA 2AYYA 3V8BA 1MQ8B 3LPAA 4G9GA 5A6VA 4M83A 1ZO8A 4UEKA 4KOAA 2WYHA 3K16A 1KO8A 3RBZA 4IL5A 1BX3A 1Q1AA 2D8AA 3VU3A 3MIZA 3AF6A 2W7PA 4C8KA 3TKAA 1RWXA 2CNWA 4KGVA 4AM8A 1TC1A 1A71A 1MB4A 4C07A 1YZ7A 2HHXA 4UPVA 3TX6A 3RYHB 4GGOA 5J4LA 3KPUA 1OI3A 2XIQA 2Z04A 4P54A 4B6OA 4CN9A 5GADl 2EH9A 3ERCA 1BE8A 2XTAA 4RZXA 2O14A 1AK1A 3S2IA 3GLFA 1X1SA 4XVCA 1VCNA 2O3JA 3JYLA 3UYLA 1IVYA 2HO4A 3U81A 3JQFA 1JA1A 3AW9A 5KFLA 1AK9A 4A10A 2B1QA 4E0BA 3L8MA 5TEWA 3D9QX 2WU0A 2G1JA 1XCGB 2BFFB 5F23A 2NVOA 2OMKA 5AW9A 2QD2A 3JQDA 4ENSA 1M1YB 2ZE7A 4J07A 2XW6A 4IJ5A 3VGPA 3PT5A 4OBWA 1U4SA 5HMLA 4D46A 3R3UA 1E2KA 5GZ3A 4RFSA 3PW2A 2W2TA 3TOVA 5KQGA 4FMCF 4L3VA 4HPXB 1JKIA 2RIRA 2HCTA 3BXOA 3LAWA 4OL9A 1WG8A 4ASUA 2Z83A 4HAVA 1OZGA 4LTMA 5IIMA 3EQ8A 4OIMA 2ASVA 1T9AA 3RH5A 3LHKA 2PUDA 4KWEA 4P93A 4K81B 2K5UA 2KQUA 4IDCA 3DCJA 4C7JA 4IMJB 3H13A 1M6WA 1M2NA 2NO0A 2OR3A 5CJ7A 1JXAA 4JT4A 2DR3A 3E05A 1VCIA 1QCCA 3TQRA 2R4TA 1NJ6A 2P65A 1EP9A 5FI3A 1QYIA 4P4SB 1EZ1A 4A6PA 1WTCA 1T3GA 1Q3KA 5FTJA 3TR0A 1GCOA 4LX8A 4ROSA 5B6IA 1MABA 3D7LA 5JXHA 3DKIA 3ZU2A 3CMCO 3KVVA 3K70C 4B3RB 2B7LA 4QRIA 2PXHA 3UMCA 4XW2A 3KQTA 1P61B 2QZJA 2AZ4A 3OQ6A 3HI4A 2Q21A 4M22A 2FLLA 2JZNA 4HB4A 4IX1A 4OJPA 4RSGA 3LGAA 3L7CA 2OCLA 1X9XA 3W4JA 1LQUA 3BD8A 1IBMB 4V2IA 2VNIA 3QHQA 3AF4A 5IH7A 1NR5A 3EWSA 2I7TA 1QZXA 3F4LA 6NULA 1X2EA 1T2VA 4S0ZA 3CSDA 1ZA2A 3KEQA 2DPLA 4GE0A 3B8EA 3TMYA 4OU5A 3SBEA 4MP8A 1R0YA 2HT1A 3GAMA 2Z95A 2VPWA 5D49A 3RYTC 2B92A 2RHGB 1Q3TA 4B2YA 3JD2A 4AJJA 4C1NA 4Q3NA 1QAOA 2OVFA 1DC3A 4KN7A 5KKNB 1KGDA 1Z8DA 2GCEA 2C0QA 2GQ0A 1W19A 3RJTA 2C3YA 1XELA 4KLHA 3D3WB 3DNPA 1SKYE 4I6GA 1KERA 4WZBB 1NBOA 2HGSA 2GLXA 2DBVO 3JR3A 3COSA 5CRXA 4ZKEA 1Z4IA 4GOOD 2W98A 1A69A 4QOFA 2NLOA 3P0EA 4U2FA 5IZCA 4HNSA 1GRCA 5JZ9A 5I4KA 5BWNA 2C9CA 1LK7A 2RAPA 1O8CA 3RFFA 3W9SA 5LA6B 2GX6A 3UXYA 3WGIA 1L4UA 2ZIXB 2WSIA 4Q16A 3M34A 1D3AA 3DFKA 3IILA 3V1MA 3K05A 1KQOA 1NVXQ 2XZTA 4UFNA 5AUPB 3LY9A 5DM70 3NV7A 3VUEA 3PVXA 2ZTUA 3K94A 4GC7A 2NU9A 3I3OA 2C7PA 3ETHA 1I4OA 2OD9A 1GKYA 2QT0A 5H4HA 2YTUA 5AUQA 2CL7X 4E5NA 3ROFA 2QN9A 1K2WA 4DJ5X 5JI3E 2DHDA 1QIFA 2ZP1A 2BKLA 2VP5A 3PU6A 3WY9A 4AKEA 2J32A 5LDDC 2FY8A 1ZOLA 1IBLB 3HXPA 9LDBA 2P2YA 1I2ZA 4PPGA 3HG7A 3ABOB 5KNBD 1UJMA 2W6PA 2VJ5A 2RH9B 3MT8A 5KNBH 3SE0A 4NJOA 1UZLA 4GMFA 4X62B 1Z4KA 5KG0A 2C1XA 3MCWA 5AM0A 1FNSA 2H1SA 2EL9A 2CNLA 1HQDA 2DBYA 4EJ6A 4U9HS 4NYJQ 3H04A 4BASA 3Q40A 1SXQA 1ZESA 4KLIA 3CUVA 4XQGA 1C8BA 4F7DA 2VSXA 2WG0A 1GZ6A 1OXSC 4PANA 4PU0A 2IYOA 2VZ0A 2WNSA 1J56A 4WGFA 4BOYA 3KJXA 4FMDB 5FHRA 2X9LA 4G89A 5KYNA 5CFNA 3D3KA 1MVLA 4C2TA 4US8A 1RXUA 1WSDA 3QKSB 4XRRA 1XALA 3BVPA 3IHLA 3HSYA 1OLOA 4CEHB 3F74A 2F64A 1XL1A 3N0TA 3IB3A 4CGYA 1PN3A 4G4SP 2JJ8A 2Y2VA 3QVGA 4JB2A 4E2ZA 4FS8A 1ZI8A 1G59A 2JGDA 3R7NA 2HWWA 3WLIA 4Q3EA 1WETA 4ZDJA 1PUXA 3RANA 2O8EB 5BV2P 3N7SC 1DDGA 1XZFA 1VE3A 2QJOA 2XSZA 3JU3A 4CN8A 4G63A 1MR3F 4J1TA 4HMQA 2QTWB 3S0JA 3IQGX 1XZBA 4CYMA 4I5EA 3BMOB 1E3IA 3M4YA 2Z5LA 2XDAA 1TU0A 2QUHA 5DSZA 1NF8A 4PLCA 4KACA 4NOJA 3JPOA 4C7OB 1MFZA 2XGGA 4HFRA 2AGVA 3C87A 5SZJA 1IZ0A 3H75A 4QG7A 1KFTA 1MJFA 4KBGA 4JK1A 3Q6MA 1J0DA 1PUZA 1OFHA 3OLXA 5DWVA 3N7TA 2PI4A 3CTPA 1IEXA 3HKBA 1X7WB 1M10A 2IS2A 4HNQA 3PNPA 2GPSA 4WECA 4ENRA 5JNRA 1O1YA 2VR1A 2O7VA 1QU3A 2I4NA 4YCJA 2GXUA 4YMNA 3AR4A 1UM9B 4PAWA 1WV1A 2JDIA 1MDBA 3WK4A 2FJ6A 4YUAA 1UQVA 4CWAA 5BPFA 2BZ0A 1XD2A 5IU6A 1L3CA 4DDVA 3FTNA 2C3PA 3LW7A 3OZBA 1U0FA 4L8FA 4PCVA 3TLJA 1AO3A 1IZ7A 4G4GA 4PNEA 4JH0A 4AB1A 4ND7A 3HJBA 2C2RA 2ZRAA 4AZ3A 4D26A 1PQPA 3L7YA 2E5WA 2WYIA 3K9BA 1XSLA 4QG3A 3K9QO 5TDHA 1KETA 4QYTA 3PSPA 1MQAA 1AF7A 1L8LA 2FUEA 1Z7EA 1Y8RA 2RGYA 1VDMA 4EFDA 4AP5A 4O3RA 1LPBB 3AR2A 4DJAA 4DMMA 4PLVA 5LN1A 3IIJA 1TJPB 2QTAA 4C4ZA 3PSAA 4FNGA 2VEDA 3FTPA 5G0TA 4G3XA 4CT4B 1H0KA 4LDNA 4QNMA 5BQ3A 5I01A 3MYYA 4ZQIA 3OZIA 1Z13A 4X3PA 3C16C 4RS4A 1WE2A 4X7PA 5KOJB 3HWWA 3DUWA 5EHZA 5JH7A 1XDWA 2AZMA 2V8BA 1QQ5A 7ICQA 4K3VA 1LF5A 4AJOA 3FVVA 1SC6A 4K87A 4ZCQA 5JQWA 3OC6A 1V1MB 2PGAA 5KU7A 2IS1A 1D2CA 3N7RC 4H15A 2GM5A 1W88B 2VYNA 1NLZA 5JS1A 3IP8A 4BBJA 1GZVA 1QCYA 2VUSA 2VWHA 2IYUA 2QYSA 1GEEA 2O7SA 2XCPA 1X1QA 3N2EA 4UVIA 1I2CA 4X5OA 1VIAA 1KTIA 4MUYA 1BCRA 4FTWA 2QUIA 3IVRA 1H5QA 3GIWA 4IMIB 4F6RB 2SHKA 3KR2A 4WHMA 3I92A 2WMNB 1J7KA 3IBFA 4TL6A 4BLPA 3NKLA 1YF3A 3IAAA 1CUKA 2FW0A 1XAHA 1KMHB 1AJEA 1X7DA 1TEHA 4LYGA 5F4BA 3VR6A 4PHDA 5HXAA 2QROA 2PWZA 4YRAA 2K4HA 4MW2A 3TACB 4XX0A 4W9NA 2I2XB 2DPXA 2I2CA 1Q21A 4ZZ3A 3MRXA 1P8JA 5DIFA 2XYRA 4QQKA 2Q07A 5I7SA 3PO5A 1G41A 4OQMA 4L0CA 2GLUA 1F6BA 4UW9A 2VDLB 3DL2A 1I32A 2XAUA 2BGIA 1Z5WA 1C50A 2JCVA 1KKUA 5DYWA 4M9SA 4FYHA 5KNCD 1BROA 3BQ9A 5KNCH 4EO4A 3PGKA 2DCMA 3RQIA 4FCCA 1G3RA 1RE0A 2CW5A 2XO7A 4CQLB 3IPAA 3B2EA 4DFMA 5DBFA 2IK8A 4B3BA 2GAIA 1JKJA 1NT4A 2VJKA 4MCAA 5DFAA 5EHNA 1U7ZA 2W04A 4JHXA 4MB6A 4N8SA 1D2HA 2O3SA 2Z9BA 1MG5A 2A9FA 2GZ3A 3MTIA 1T0HB 3RK0A 1UKCA 1NLMA 2EW2A 2JK0A 3F67A 1ES9A 4UDOA 2E4ZA 1DADA 3SI7A 2OBNA 1T6BY 4JLPA 2JKYA 1YDFA 5K03A 1C3LA 4YPFA 1D9XA 1HNNA 4ZYTA 3C43A 1YE5A 4UAGA 3VYUB 1GG9A 4LG1A 4YJGA 1HE2A 3O9MA 5JJ5A 4FFRA 3NHAA 3DV9A 3C5WP 3MBYA 3GPDG 1IUOA 2PSHA 4BGUA 3R0QA 3V7KA 2HF7A 2NM0A 5HZHA 4NDNE 5B4UA 1TA0A 3Q88A 5C0OE 3WV4A 4PONA 3SGLA 4C80A 4AYTA 1PL0A 1XRQA 1EVJA 1JHZA 4RLFA 2BPFA 2IZ1A 3C2LA 4QARA 5AXCA 4BP3A 5LMUB 2VNJA 4K88A 3JR7A 1AF4A 3KQOA 2RGEA 2P9JA 1GRNA 4XA5A 1TD1A 2FX5A 2FP3A 3SYKA 5AFSA 3SSNA 4M0DA 1PR4A 3G1WA 1CJBA 1LTHR 3RB6A 1JJFA 1Z1VA 2Z2ZA 3L9XA 1A9ZA 3MT9A 2X1MA 3HYSA 3GJRA 1CLEA 1C1HA 2O5EA 4IEIA 5J1TB 3RADC 1VJGA 1Z6GA 1PJZA 3VH4A 1NLYA 1RACA 3AZQA 4DSFA 1NPTO 3B6ZA 1AS0A 2JIRA 2XADA 3LHIA 4N5NA 2C88A 1T9DA 4UCQA 5HKAA 2HMTA 1NL3A 3AUUA 1DIHA 2RONA 4RENA 1PLLA 2ZZNA 3OX2A 1G5PA 3ZN2A 1UAGA 1LDBA 3VSDA 5JANA 1ZXBA 4GZMA 2YW2A 4PAOA 3O83A 4LC1A 4NMXB 1U47A 2J5XA 3EK2A 3DHYA 2E8PA 5ARBA 5CA0B 2VEOA 2CFOA 1J1ZA 4FDMA 1VE5A 5AW1A 5AW5A 2YRFA 3W9BA 4OXKA 1JR2A 3SX4A 1W0JD 4NEQA 2DY1A 1Z4MA 2ZJOA 4PC6A 4E46A 2GAJA 3G9XA 2JGJA 1XRNA 1ZH4A 1VCHA 4B3MB 2X8WA 2ZCVA 4CQNA 2XVTA 5C18A 2ZBVA 4RX1A 3PUWA 5HKOA 4PFQA 1COZA 1MENA 3KKQA 3FDJA 1R66A 3U26A 2G76A 3KZMA 5H59A 4YCBA 2XUDA 3CIOA 4GOXA 3JQBC 5BR1A 1PT7A 4GLBA 1JFSA 5IJ9A 5IJWA 3BDAA 3RG8A 2XUOA 1ABBA 2BPCA 5LQRA 4MI9A 1XDDA 1S89A 2ODAA 1RE1A 1EZ4A 5TPZD 5L95A 3H4BA 4L5BA 4ZZIA 1Z63A 4PRKA 2COUA 1XXHA 4ZYYA 4HVAA 4K3UA 4DCUA 2Q5IA 4ZAGA 5CB4F 2XKJE 4EGJA 2WE7A 4I0WB 4P34A 1S8AA 3Q7IA 4N7RA 5L3RA 2R62A 4YA6A 1GD1O 2JFOA 4JLUA 4U8HA 5F98A 2L19A 4POOA 3LGXA 3M1AA 5L1MA 3WKEA 3I2JA 1XKXA 4FP9A 2NAPA 1S2LA 3P9QA 4S1NA 3CVXA 1RWQA 5KOHA 1TM4E 5D6NA 5EXXA 1U2EA 3Q98A 4QXOA 4HCJA 5DHAA 3RARA 2VYQA 2H2IA 2CV1A 1NI3A 2UXBB 2CVZA 1DX4A 3FPSA 1RKUA 3CM0A 4RD0A 3G6VA 3OESA 3IP1A 1JJVA 2VQFB 3UT0A 1KEEB 3IBCA 4CR8A 1MC8A 1MB3A 2MCFA 1HYHA 1L5OA 4B3CA 4YCLA 2VF5X 4GNKA 1F5SA 4OFXA 3B9RA 4CU2A 3L8GA 1XQXA 1JSXA 1FPQA 1NU6A 4Q00A 4H31A 3C28A 3RS8A 1MPTA 1ZLYA 4BVHA 2O3UA 3OKPA 2ZDHA 1R0LA 3L7BA 1DK2A 2YRXA 4DC9A 2Z2KA 2KJQA 3GAAA 3DEIA 1KFJB 2PNJA 3IEIA 4P98A 3MTDA 4IMRA 5TIIA 5CLHA 4OYHA 4QJ5A 3DTTA 3ISBA 2RP5A 3K92A 2CZCA 3WGLA 3WXMA 4UULA 1FTQA 4MXDA 3E9QA 2H2DA 1PL8A 1PJAA 3SHFA 4OM8A 3SHOA 1O9GA 4B32A 4R8VA 3OO1A 3MFIA 1E5LA 4NY8A 4O8CA 2Y1LA 3ZWOA 3N2GB 4HH4A 2WF8A 4BGDA 5U4XA 2JK1A 4G9EA 4IZ6A 3F3KA 1NYRA 1PVOA 4KR9A 4QVKA 2J08A 2OCBA 4LY6A 2BHNA 1CSEE 4YAOA 3CEAA 2F4NA 1N32B 4EHHA 1KDHA 3DGFC 4NENA 2FUNB 4LMAA 1W36C 3LSYA 1CJMA 4PVCA 4C05A 4BNDA 1YJAA 2Z2IA 2OORA 3MJVA 2HTFA 4OM7A 3EARA 1KOGA 1FBNA 2ZSAA 2AQ8A 2DGZA 3KWFA 4LXGA 3NETA 3OA2A 3PO4A 4R31A 1Z4LA 2YC4C 1VL2A 4WNAB 3GBPA 4E09A 1GOTA 2JAUA 2F55A 3VYSB 3ZLVA 4LGVA 2EFJA 2X0EA 2VL7A 3V8VA 1Z7WA 1GPAA 2JCBA 4GBGA 4L4ZA 3GRCA 3KEMA 2XMQA 4XVHA 1US8A 3G2OA 3WJ2A 2QB0A 1X6JA 2FR8A 2JGLA 1XEFA 3SJCA 1SOAA 4QE3A 3ETJA 4TMXA 4LVUA 4UTXA 8MHTA 3AHFA 1V45E 2V59A 3A3OA 1Q7BA 1YA4A 2QV7A 4JC5A 2EDUA 5AW3A 4CG1A 4Q6WA 3GBSA 4IHJB 4RU1A 4IXMA 5LQCA 2WYOA 1XRRA 1KZ4A 4KQMA 1RQRA 5IBPA 4EGSA 5G5HA 4B48A 1LBTA 2XITA 1VMKA 2HYDA 1P7DA 5FWNA 5AVTA 1UMKA 1PYDA 3EAGA 4Z4HA 2XEDA 3G2IA 2A0UA 4LJYA 2CXNA 2ZE6A 1GU0A 4FDLA 1L1RA 1HR0B 4WJLA 4B17A 2K87A 2QRVA 1SOMA 5GQSA 2D0DA 5E9AA 2WAXA 1YS4A 2H00A 2P1ZA 2YVKA 1GPDG 4RZ3A 1GCUA 3LDAA 1AKWA 1LPSA 3THYA 1I3KA 1GGEA 2KX7A 5CK4A 4RDIA 4EB6B 2CBXA 3I2FA 2JANA 2X9VA 1TRHA 4H16A 1C0IA 3H40A 4O3PA 4K46A 3IUNA 4OXRA 5A05A 3SQNA 3NOOA 1YVDA 4OHFA 3HCCA 4JWTA 5LJIA 2NXNA 1IVSA 1NQTA 5GIPE 1IVNA 3EVNA 3QLVA 1XVVA 2VA9A 3A1WA 3A7EA 4RPXA 2D00A 1C9YA 1TOAA 4R2HA 1VDZA 2ACEA 2X0JA 2NZWA 4FD3A 7ADHA 1Q7TA 3MS2A 4Q9JA 3G7NA 3F5MA 3STHA 1QM5A 2O20A 2XWPA 3ELBA 4P92A 4MGIR 4HLUC 3SBOA 4FOOA 3EEIA 1C20A 4H4CA 4JEIA 4DAEA 1Y7PA 1Z7GA 2FK8A 4ZO8A 3AUSA 2OKGA 2X7HA 1J0BA 3EIXA 1ZAYA 4MWEA 3TZKA 3FYHA 4PICA 1O3YA 3KSRA 2QIPA 1EJ6A 1J8MF 2R96A 1JEAA 3QIAA 4LISA 4XX1A 4NY1A 4ZPXA 1TYDE 5HCNA 1TIPA 1V43A 1HUZA 1PLJA 5HS6A 2ZYTX 3V3TA 2FWNA 5CLGA 5G0UA 2ECOA 4RCVA 1OT3A 1TX4B 2HHTA 2IS6A 1MBZA 1RDFA 4YK7A 3F2IA 1X7XA 3TZ6A 1ZICA 2ZULA 3G5AA 4JP2A 1GU1A 4HS4A 1JLSA 4ZMRA 3JQCA 1Z7BA 4WPGA 4E5SA 1CFZA 1YK1A 3OFNA 3ZX5A 2EU8A 4V0NA 1KFEB 1R16A 3VI3B 3L7AA 2IYEA 1YS2X 3DEYX 3K09A 5AHWA 2O2JA 1UIMA 1YKGA 2FWMX 5KC8A 3OJ0A 3I6BA 2FSFA 2MR5A 4RFLA 1GARA 4FJ0A 3RVBA 1RLOA 4BECA 2Q49A 2XYVA 3TIGA 1PT6A 3UNXA 1A0OA 2PXIA 3R1IA 4F2PA 4R01A 1SQ0A 3QEOA 4JJAA 1M3SA 2A9JA 4BBAA 2XCQA 3H97A 3SIXA 2V6BA 5AOCA 3TNLA 4J3NA 1SK8A 1UQTA 5BSHA 2ZAOA 2BE7A 4IO1A 1X8JA 4HDKA 5JCJA 3C1ZA 5F2KA 1DGSA 5JSKA 5KFXA 4RELA 1QHHB 3K31A 4MZXA 4BV2A 4OUDA 1Z3CA 1N3LA 5BOMA 4REMA 5C31A 1TM1E 1YASA 4BNHA 3ZWXA 4GLLA 3D6VA 4OQXA 3E0XA 1CR6A 3TINA 5FEUA 4F5OA 3CCBA 2QYTA 2KN7A 1FP6A 2G36A 1SU7A 4OB7A 4U5XA 2BRUC 2IYLD 3D2QA 5BRNA 2HYIC 2YWHA 1SV0C 4XI9A 4AECA 4X71A 2IYQA 2K4MA 1NJYA 3D8UA 4B9LA 3BRWA 4YMLA 1QVZA 4CI0B 2D7CA 4JV2A 4MQFA 1ZDMA 3RG2A 3ZPXA 4PIPA 3KD2A 1CUGA 4NNPA 3VSEA 3JAWB 2VTBB 2E7ZA 3ZQKA 1KBOA 4ED8A 1ACMA 1UPCA 3GF4A 4HNTA 1MX5A 2JEJA 4DKXA 3BK2A 3P9YA 4FD2A 3K53A 4U1RA 1N0WA 2RHDA 4HXGA 3QUBA 2XNDD 1NUQA 2CMKA 3C8HA 2XJ9A 5JNLA 2NQTA 5LIRA 1K7XB 4H7DA 2JI8A 1RYFA 1Z88A 4PAMA 1BN7A 3MW8A 3K6SB 1UMDB 4HZUA 5K0GA 4ITVA 4AI6A 4A03A 1ZAKA 4MEAA 1ZW1A 3KIPA 8GPBA 1E7SA 4GO1A 3NALA 3P9XA 5LZ8A 1NKCA 2PMCA 4RZQA 1T8WA 1W94A 2K8BB 1SG9A 5ESXA 2Z2JA 5CDTA 1TRKA 4YXMA 2AN5A 4WLNA 3AZOA 2PS9A 4PJ0U 3UFXA 1ZIDA 1XEXB 2DL0A 2ORIA 3FKJA 3QSYA 3DTVB 3JSAA 4I2VA 1N6IA 4UTNA 3V1YA 2PIAA 2DLCX 4TKZA 1BIFA 1CT9A 2PZJA 4O3SA 2R8JA 4OGLA 2BM0A 4X8HA 3SDZA 3V6MA 1EGHA 3G8CA 5KFDA 4QPJC 4EJ2A 3MJHA 4PG7A 3ASZA 3N05A 3RU3A 4ZEOA 3W7VA 5EZSA 5CFPA 4D8TA 3LVVA 1UEXC 3JQAB 4DT1B 5AKJA 3Q0TA 5K99A 2HGZA 1DKNA 1VG0B 3L0OA 2KVCA 4CLEA 1K3TA 3SJAA 4D4KA 1XMOB 2IHUA 3E5NA 1AIPA 4AYBC 1UK6A 3IPCA 1X9WA 1QDLB 3OCVA 4IRMA 4OREX 3PEEA 4N1AA 1EFCA 4P36A 2W0MA 4QPNA 4C4RA 5DKFA 3QOYA 4CTNA 3S8EA 1Y5NA 2IHZA 4WUVA 1G6KA 4UHFA 1OB5A 4H6WA 3C14C 4GG1A 1A04A 3COWA 3QXGA 4RHUA 3CUKA 4BQPA 3UPUA 5C8DA 4RCYA 1XMJA 2ODQA 2ONKA 2XI4A 5BO5A 3CX6A 3DOEA 3FGPA 3IP6A 4G67A 3GJ7A 2EAMA 1TNDA 3CX8A 1Q91A 4FINA 1Q0TA 3RIXA 4EARA 3GCZA 2JI4A 4BO6A 3IALA 1AA6A 4I2FA 4RPHA 4EJMA 2E1EA 3JTMA 1W4LA 2QR2A 1AE1A 1V6CA 2BUCA 3WLOA 5HPYB 1DVRA 1P80A 3NHRA 5F9HA 2DYKA 4P8RA 1LDEA 1ZHOA 2ZIFA 1JIKA 3I6MA 3S4YA 4D42A 3MOIA 2AYXA 1W29A 3FMIA 4TTJA 4V0QA 1W59A 4N0QA 2KI5A 1RBZA 5K8LA 2A30A 2BQRA 1VJDA 1EI9A 3DZCA 1WPXA 1U48A 4DLWA 1HFWA 3OP1A 4GYWA 1B8UA 5C35A 3GMDA 5COBA 3OLWA 4O6VA 2V6JA 4XWTA 1J2EA 3MB8A 2PVCA 2R5FA 3ZWMA 3F97A 1P33A 3PXXA 5DHSA 1K27A 3OZSA 4AF6A 1XD8A 1L3BA 3OAAA 1P1CA 1SY7A 1LS6A 3B1YA 2HV9A 5D51S 1LW7A 3A4LA 3UH0A 1FXUA 2O8BA 4N49A 3M7IA 2YNMA 4OK5A 1NJ5A 5LP1A 1ZD2P 4JZYA 3KQPA 1OTYA 4MHVA 1HL7A 1ZSVA 2GEFA 3CZAA 4LHZA 2MUTA 1AN0A 4KODA 3WR5A 2B4AA 4YHBA 2XZOA 3R24A 5DX8A 3TRHA 1MJGA 2Z6UA 2Q5JA 4B73A 4X41A 1CJKC 1EFPA 4V1CI 2WFLA 2NRXA 1XCOA 5F1KA 4ZTUB 1W5FA 4P2BA 1II8B 2Q27A 3RC7A 1NBME 3AEUB 3KUDA 3P26A 1Y6JA 3LW8A 2GCOA 4L27A 4ESOA 2CL6X 1X80A 4EP1A 1SOUA 2BYTA 5KI6A 4D9EA 6AT1A 2VLBA 4OXYA 2PRYA 3TQIA 3QVUA 4GMDA 3EXHA 3W5IA 1FNDA 4MUEA 1NJGA 1E2MA 2JAHA 1DFHA 4OLHA 1H1LA 1IB6A 2CLIB 3NWEA 3HUDA 3GZNA 1PNRA 2FZVA 5EFZA 2HCRA 3TIFA 8ICGA 1N6KA 5DNUA 3VO9A 3DNMA 2A5LA 4BJHB 3SXPA 1Z19A 4HTFB 1NVVQ 2Q8PA 4KWTA 4EJSB 2X9GA 3B1FA 4ZRDA 4OJYA 2XGJA 1RAHA 4TS4A 4EEXA 4ZU1X 1CDEA 3LWMA 4Y9TA 3EX7C 1T9KA 4DEXA 3G68A 5FWAA 3TGLA 7ICLA 4TZ6A 1WV0A 5BV0A 1ADFA 3UHJA 1ZQ1C 4LBWA 3RC3A 2OQVA 2PFSA 2X40A 4H3KB 3TLAA 3CPEA 4HDNB 2OCPA 1V3VA 3PNYA 3PHHA 1X66A 3R6DA 1UXOA 3A9VA 4E12A 3CISA 2CLDX 5TQ2A 1D1SA 5AVRA 1GL7A 1PR6A 4KFUA 2ERYA 2G72A 2IWRA 4Q39A 3RVJA 3PB3A 1XR3A 3FUVA 1GLVA 1PKEA 1XTZA 2C77A 4JQYA 1YDGA 3MG9A 3JQEA 4ZANA 3OHAA 3RE1A 4Q4JA 2GMWA 2X1VA 4EABA 2R18A 1JSLA 4LGYA 3WRXC 4HPWA 5EIBD 3CF4G 4S35A 1V9CA 4INPA 4AZWA 3PC7A 4DMGA 2QR5A 5IFKA 1SIBE 1L4HA 4EQZA 1BC5A 1RCFA 2PQ2A 4PPFA 1UOPA 3KEGA 4RZRA 4DJEC 4Q4LA 1JZQA 4QGBA 4V3CA 4F5YA 1WCIB 5CJJA 2YYYA 4BEJA 4D9HA 3RSCA 2H54A 3D8BA 4CIDA 2HBJA 4JVNA 3QGMA 3HDYA 4M98A 5L3ZA 4Z7OB 3VR5D 5J2UF 1SKRA 3OLCX 1PUJA 3ZNPA 3OEED 4PW0A 1ATIA 1KEWA 4XIJA 2PXCA 3KSDO 1PQYA 1KVTA 1YVUA 1JYFA 2E48A 1KE1A 2CHVA 2LKYA 2BKEA 1CULC 2W2LA 3K6KA 1M8FA 1ID8A 5EWMB 1SU6A 2WKPA 4A0SA 2A1TR 3JWHA 4M0AA 3CVJA 3ZXYA 1JS1X 4HSEA 2VA8A 2WIKA 4LY9A 1BJRE 2Q5QA 5EVJA 2OVBA 2QM8A 4X45A 1VRVA 4C5AA 2BEUA 4DCTA 3TOSA 1NP3A 2OL4A 4IRUB 1M5UA 1ILEA 1AS2A 4A5SA 1JV2B 1V37A 4RABA 3ZD6A 5T3YA 4I5DA 2RFLA 4PRLA 2J9GA 4LOLA 1KJQA 4YCCA 2P2GA 4N6GA 1YFJA 4JUDX 3IULA 2BMWA 3U4MA 3AUXA 1QO0D 4C5BA 5GONB 3PFWO 4CM9D 1QFMA 1R1DA 4I5IA 1ULZA 2C3MA 5AK4A 3CLTC 4RCZA 2XOXA 3GGPA 2I78A 1UL1X 1YZHA 1ZIPA 3ZE7A 3VZCA 1R4MB 5LR6A 3PDIA 2B9VA 1OZFA 1OLXA 1YS1X 4PLZA 4EW1A 1E1LA 1NUHA 1VMDA 2B8TA 3DKRA 3GLRA 1M6HA 4F46A 3QW2A 4Y1RA 1ZQVA 3VZPA 1WO8A 3P32A 3KVRA 1GN9A 3BF7A 4TUQA 1DUVG 4UC0A 4WW0A 1FS6A 3BSWA 4LTDA 3PR2B 2RHWA 4YYZA 1B76A 3TD2A 2QDXA 1RSZA 1FRVA 2Y92A 3UA3A 4ZOHC 3R5KA 4F4IA 5L51A 3FJ1A 2Y6VA 4B3HA 4IYRA 2Z4TA 5KQSA 4URZR 4JX9A 2BQUA 2CXHA 1WWUA 3KFLA 5BNFA 2IPOA 5CB8A 1UBLS 2O8CB 2CVPA 2WPDD 2P5YA 2OCXA 3NHZA 4RJJA 3G2JA 1SXEA 5KDDA 3T7SA 1RW4A 3EGEA 4G1UC 4M9HA 5IARA 5AW7A 1HL3A 1NOIA 4M86A 1QS0A 2W4MA 3K1TA 4ODIA 4B74A 1YB5A 5LB2A 5EIWA 1OPRA 3IV7A 4NICA 3OGUA 2IXTA 1KAOA 4AYBF 1UPTA 2IYXA 4YVZA 3O75A 4EHFA 2NRWA 5JWHA 3SF8B 5EQJB 1L3TA 5EWJA 4BV8A 5KU1A 4RQBA 1R9JA 3WGYA 3FNEA 1PWYE 4MEXA 4P6VF 2VNSA 5CP2A 5JRDS 3ACDA 3L0ZA 4AUMA 1P3JA 2XWBF 3QENA 1JG2A 3EW9A 5JD4A 2VXYA 3QM1A 1ZJ6A 4KREA 2ZUEA 3AM3A 4AZTA 4YR0A 3DB2A 4B9TA 1S6YA 5HBGA 1E5XA 5KQRA 5D5QA 3VR4D 1OWMA 3NBAA 3ENVA 1SVWA 3M5WA 3OH8A 1COWD 3MJCA 3DLHA 4F4CA 3WXBA 4AX4A 1DG1G 1E64A 4ITRC 4JY7A 2HJVA 2P78A 1K9VF 4BYMA 5A3VA 3FROA 1VPDA 3H83A 2OYRA 1TIKA 2AX3A 1EBBA 4TV8F 3SYNA 3FMVA 4FXOA 4ZIRA 3TD9A 5EE0A 4MW9A 4FMPA 1Z33A 3IE0A 1JEYA 4RVCA 1UDBA 2V7XA 5ALTA 1HKHA 4HQFA 3UC9A 3HA3A 1BVUA 3BFPA 3ON5A 4Q18A 4F4FA 2X2PA 4B9UA 2OZLA 5A4FS 4ALKA 4BWGA 5BUQA 1I33A 3BGVA 3UVEA 3K0FB 3CRVA 4M1TA 4P86A 1U3VA 1QU2A 4LI3X 2GXAA 1E0AA 2PPLA 1OBVA 5FQNA 1UODA 1E89A 2BHLA 1SN7A 5E2BA 3X1XA 2E2WA 4CF3A 3ICXA 3KKAC 3K71B 1PD0A 2ZJ0A 3GK3A 3QUQA 2WIGA 1AMOA 3KALA 3U1TA 1YHYA 4XFJA 5BN4B 2VKTA 1RHKA 3R41A 5FL7A 1GT91 4EYKA 1E5TA 2R11A 3QEMA 3BWEA 1DSSG 4KX3A 1U3WA 2RLTA 4DGSA 4RQ6A 1KYVA 1L7DA 1M8PA 8ICWA 4QUDA 1KJNA 3I09A 4KAFA 3GV7B 2GHTA 4N3NA 4FGLA 1CHDA 1DP4A 1JMVA 1QRRA 5BT9A 1P4GA 3E1KA 1U4NA 1EXMA 3JQ8B 4EPYA 4ZAFA 2XUJA 3MFYA 2RCNA 4M9CA 3I52A 2D8MA 4OIFA 1T24A 3D8HA 3EIWA 3DP7A 1DL5A 2ANBA 4AX8A 3OZ7A 2INGX 2AFHA 4FJ2A 2IHYA 1JU9A 1SKAA 1WOYA 3UBTA 4EI7A 2BBOA 4UB5A 5J2TA 2E82A 1NE2A 3BEDA 2FJUA 3INTA 2ZROA 2ZR0A 3RPEA 3TOXA 2CB9A 4C0LA 3THRA 2JFFA 1Q2XA 2FSHA 5K6AA 2FETA 4ZVMA 2BZ1A 3R8XA 3H1FA 4PWZA 5EMKA 4M9JA 1BXRA 1DT3A 4TTPA 4RZIA 1EM8A 1RYDA 1MV5A 3QVTA 1EIWA 5EE1A 4ESHA 4GLFA 2EKLA 3ZWNA 4B6RA 3MUFA 5ESRA 1AXGA 1OJ7A 3JZMA 2G6BA 4PBTA 1VFNA 4QJBA 2V7GA 2X2OA 3OY7A 1NXTA 3FMPB 2WAOA 3OY2A 1IJEA 1HDOA 5CW2A 2PO7A 1I1OA 2VK2A 4L50A 3NBXX 3RU7A 2QB1A 3QELA 3C5EA 1OR8A 4LF5B 2VP2A 2ZTMA 1JI7A 4OAPA 3EFBA 3H0MB 4LZPA 2H2WA 4MRNA 4PG8A 4JK3A 3R5FA 3PNVA 2QVLA 3UBMA 1XVUA 2BI4A 1QF6A 4MQMA 4MW0A 5KFVA 5LQSA 2F59A 1EHIA 4MDFA 2BBSA 1WMSA 2PFGA 1Z6ZA 3NKFA 4FFNA 3I8OA 4JL6A 4P53A 1NVFA 2DBRA 1KVQA 3OQJA 1E8NA 3WYEA 3EG5A 1GVNB 3DTYA 5TXGA 2IV7A 1ZM9A 4OJ5A 4IJKA 4JR2A 4RQMA 3FFAA 4HY3A 4KI7A 3EVFA 3S2YA 1Z4OA 1U31A 3G3EA 2DWOA 3QKIA 1MT0A 1VPTA 2OCGA 1QVAA 3F7OA 1T2DA 4HQ6A 2C2HA 3IIIA 3PTLA 4LC9A 4ZYUA 9ICGA 1ZEJA 1HV8A 4MO2A 3LM8A 1T10A 4QYWA 4GSKA 1VIYA 3KVYA 1G64A 4PXSA 2QP9X 4DF4A 4KE9A 1XS9D 4NYMR 4XVQA 4A0QA 1BEUB 2L82A 2FFJA 1GQFA 4C6RA 3Q3GE 3SLGA 4NU0A 4WWHA 2NVUA 1H22A 1IHYA 1DCKA 1P60A 3VOSA 1PJ2A 5K8VA 1J23A 4RZSA 5LFAA 4EG7A 4II7A 3CF0A 5EJGA 1T9GS 3MAGA 2I3DA 1DX6A 5C1PA 1ADJA 4ZTBA 4NU6A 4GPZA 2V5VA 2W8BB 2C92A 2PRZA 1QH9A 2F3UA 2BCSA 1J6UA 1UR5A 4KLDA 4M8IA 4MR9B 1TADA 2GVDC 5JNTA 4BQRA 4TN5A 2GZ1A 3ZDRA 1B42A 4GL2A 2HPVA 4KQ2A 4U63A 2H2AA 2O48X 2I33A 3O4FA 2D6FC 3ZDCA 1QV7A 2CLLB 1UJ5A 2D2VA 3C1UA 3GRVA 4OXQA 1AUOA 3LA6A 4E70A 1QGED 3FHCB 1TEZA 4IL6U 1ZQZA 4IXNA 4MQEB 3I12A 4DC0A 3HUFA 2QDKA 2K8AA 5ETJA 1MXFA 3ZE2B 2DH6A 3KBBA 5TGTA 3G17A 1D2AA 5JS2A 1GNQA 2Z2YA 1GFIA 4R16A 1P2DA 2PX3A 4CEIA 2UU9B 4M9UA 1DTEA 4BHTA 5ICMA 3SVZA 3BXHA 4ARAA 4Y9SA 4TZ0A 4GWGA 2HU8A 5G41A 1NQXA 2GA9A 4JYMA 521PA 4KQCA 4MQUA 5GJWC 5FKJA 3CY6A 2IMWP 3VU8A 4KX5A 1ZXIA 3ZWPA 1K7YA 5KFUA 3UMGA 2ZBFA 4HEJA 3B6KA 4UCFA 2HK6A 2G82A 2XIDA 3GMTA 2BFDB 3ZJUA 2R60A 2C57A 4E31A 3ME5A 4PCLA 3PA6A 2MYTA 1P2TA 4UARA 4URWR 3OMWA 4QZGA 3R7LA 4JLOA 3K6RA 4ZRMA 5FV7A 3AUTA 5HCIA 4NL4H 4ZVQA 1DARA 4K26A 1K8ZB 3AR9A 4IIJA 1C9NA 3DM9B 1NY5A 3GG2A 5HKLA 3GFBA 4KUGA 3RBDA 2QRUA 2XOKD 4LY3A 2FVYA 1X7GA 1AV7A 3H9QA 1M2VA 3HCOA 1OREA 1D6SA 1JU4A 4QWDA 4TUYA 2H5JA 2II6A 1CE8B 2YW9A 3JXEA 2O07A 4U02A 4KVZA 2ZIUA 2QMHA 3KLBA 1L7VC 2HJWA 5COQA 1CUJA 2IIVA 1OW3B 3C41J 5EJMA 4AKHA 3RWOA 2F8TA 6GPBA 1GZUA 5A6SA 4JA0A 4RAQA 1D4AA 2CEKA 3TFSA 3BRSA 3IOCA 4I5FA 7ICGA 5IYZF 5J47A 4OGFA 4E94A 4DJTA 4ENPA 3GCWA 4I4CA 4E5PA 4X66B 2VSYA 2MAXA 1TKBA 2WJJA 1C1DA 4DLNA 2WSMA 1YZNA 1IN7A 2R6AA 3G49A 3JTEA 2O0MA 2RKOA 1KP3A 4BPBA 5T41A 1UFKA 1WUHS 4KRFA 1KZ9A 3EGWA 4HQ0A 4P0QB 3MUNA 3LS2A 3EWAA 1R9NA 2QE6A 3KZXA 3PDWA 2PX4A 4ENTA 4AF7A 3U0VA 4U7DA 3VHRA 4HYYA 3GLGE 3K2QA 2J3DA 4AP9A 1DEHA 3BB3A 4JUFA 2PR2A 4J03A 3AY7A 3P9ZA 3PCRB 3TZCA 4QBHA 5IIJA 3B13B 3K9FC 4AU1A 2JFXA 4OMUA 1P0PA 2JEYA 3HJFA 4YV7A 4XDGA 4W7SA 2P68A 2BCVA 4NBKA 4R98A 3SV4A 3KB6A 2XGSA 3LTNC 1IQRA 4XWKA 3JD3A 3LQQA 1JHUA 4R8UA 3VU1A 1WP9A 3VPDA 3LOQA 4QT0A 4JUBA 3RUCA 3S2GA 4B31A 2A3VA 5AM1A 2PN1A 1E1QD 3L79A 3V5NA 3SQXA 3WYBA 1QG0A 2ZUDA 3INNA 3K70D 3EG9B 1XPRA 3OURA 4NK5A 3JYNA 3MOGA 1NI5A 2IE0A 3MINB 2PGOA 3BWVA 4HX2A 4Q19A 4GXKA 3ICEA 4HAWA 2M32A 3TSWA 4I9FA 4ZO9A 2JZCA 1LRKA 1RYEA 4PO3X 3IKVA 3ILXA 1LZKA 4MJXA 3OX3A 4IEFB 3LX5A 3EOAI 1BD4A 5A02A 5E1OA 5DJ5A 2WLTA 1B93A 1VYTA 1ZUNA 2FEKA 3CVOA 4JQSA 2D06A 4EYSA 1XTVA 1SVSA 1L9KA 4RESA 3I9JA 3H2KA 2RHFA 4RPYA 1P1HA 1Z5NA 2RKWA 1E6KA 1XPOA 4M6WB 5HMMA 2QG9A 3CZ9A 3PRHA 3GLUA 3THWB 4D8UA 4UBNA 5C8VA 4FYPA 4K2AA 1SCKA 1KK0A 1ZUHA 2Q4BA 4YMHA 1RMTA 5MN6A 3LCUA 3OKAA 4ZI2A 3THXA 1JHAA 3GUHA 4V39A 4CF6A 3OIGA 3C7TA 4WOPA 4QZAA 4C14A 4MA4A 5KNCA 1HNZB 3MWEB 2DJIA 1DBVO 2OFFA 4I1VA 4JUZA 2PT5A 1KSPA 1T15A 3IAXA 1BPEA 2JD2A 4X00A 3AVWA 4YD2A 3QXXA 2WP8J 5BXYA 3EXFA 3DS8A 3MM4A 4BUGA 1DAOA 3M1IA 1PE0A 1H23A 1GNPA 1AHHA 2FRVA 3LBAA 1ZK3A 3C5HA 1E1MA 1NJ8A 2ZBQA 4WCFB 3OZTA 3BICA 3CX3A 2WD7A 1O9HA 4I9UA 2EYUA 3ZCVA 4JBYA 4CMHA 1ISPA 1ZS9A 4KGDA 5K09A 4C4YA 1NZJA 4K6MA 4XYEA 5CVJA 1B14A 4F72A 1BYUA 3ZJTA 9ATCA 2EXXA 2VDMB 5CPFA 2WRZA 4ZXPA 1NYTA 2C9DA 4WZAA 4ARIA 2W2PA 4PAQA 4HFJA 4QTUB 4OHRA 1L1QA 2YUTA 3GGSA 2YFKA 2XY5A 3KJZA 4DLZA 4AYXA 2W83A 4NK4A 1CLUA 1Z4JA 2VDNB 1JR3A 4RPLA 3G2NA 3WZMA 1E1RD 4FBLA 1XHFA 5E79U 3A1TA 2XRMA 4Y2TA 2OK7A 1A9TA 3HILA 4AICA 4G5YA 3DBRB 5KYWA 1ZMXA 4E3ZA 4FS2A 4PSAA 1KH3A 2AUNA 1D07A 3G0OA 1GZ7A 2PT6A 2ZJ7A 3UQZA 4EECA 4DFDA 1WXGA 3V33A 2WVAA 4F91B 3Q7EA 1UDAA 2XBMA 4FE7A 1L0BA 5B1SA 3IDOA 3B1KA 3GDWA 2RB4A 1ZGCA 2I4IA 2CFCA 4J75A 3MNFA 2ZJFA 2J9FB 4CW7A 4ID9A 1MHPA 3P7MA 5EQDA 3LA8A 3DV0A 1PJLA 5CVTA 3EVGA 3VYTB 1A76A 2A3NA 2VQDA 1TUBA 1N8NA 1POXA 1NFQA 3FZQA 1BFUA 2ACVA 5ADHA 4P81A 3FWKA 3LX8A 3DMHA 1K4YA 4JNKA 4R2JA 4FDVA 3TWOA 3AU8A 1IY1A 2P2DA 2FEPA 2QZPA 5JXWA 1E9CA 2BDUA 3PLNA 3KHKA 5L40A 1W0JA 3VNVA 3OOYA 2PD3A 1RI5A 4BAUA 4QIWC 1Y3AA 2X15A 5IAGA 3DHNA 2H4XA 2QKYA 3CGGA 2GZ2A 4OP1A 3TD6A 4I9GA 1S2DA 4C0ZA 3FYSA 5DX0A 1IIBA 1WDTA 1D4OA 3KPWA 3IR7A 1FJHA 2ODNA 4E5DA 1JT9A 1DJLA 4L4RA 5DPMA 2FPIA 1Q0LA 4WXYB 5KPJA 4LZNA 4PV7A 3UJPA 5KFBA 1HDXA 3GZFA 3W1WA 3FYTA 4CKWA 3BOSA 3AILA 4RNOA 2Y3IA 5CGZA 4XGQA 2FB9A 3FNIA 5TPZA 2QD1A 1O95C 2V0NA 3REQA 4G8DA 3HACA 1RM3A 4EF5A 3P1JA 1SVIA 2PJDA 4IR1A 1J9EA 4OD0A 3QWFA 2IPLA 4JIGA 1V4BA 3LKBA 3CC8A 1QSGA 1JAHA 4Q34A 1WKVA 1T4DA 3SC2B 3AVUA 3HSSA 1Y4ZA 1KH1A 3V8RA 2E3JA 1JJ7A 1YGPA 2B0CA 2HJRA 4Y6GB 3E58A 3LOPA 3M8KA 1V0JA 1L5FA 3L43A 2P4UA 5FLEX 4COOA 4EDFA 2VYCA 3ZHSA 1K1SA 2O6LA 4F04A 1UP7A 2AQ0A 4PLYA 2CJFA 5D5PA 3MXTA 3E1GA 4DB4A 3EUEA 1U0EA 1EA7A 3D3NA 2XEXA 4L4YA 2C5SA 3L06A 2FUCA 1XT6A 1HT3A 1V1RB 3HJCA 2FEOA 3U4AA 3VPFA 4YLGA 1W85A 3JAMA 1K1QA 3KOUA 1Z39A 2Y1EA 2MHCA 2X0RA 2EAUA 4M9NA 3FW1A 3UHPA 2REQB 1TVKA 5AT1A 5DTJA 4UUBA 2C1ZA 5HZMA 4LF7B 1EBUA 2JFYA 1OE0A 3OX1A 2GFIA 3G0IA 8ICIA 1KP9A 5CWRA 7ICTA 3DOIA 2GNOA 1GJRA 2Q1XA 5DK4A 5JASA 4X6LA 3RT7A 3IKMB 1NP6A 2RJ3A 2ZYAA 1RRKA 3GNSA 1U98A 3THSA 5J8YC 2HIGA 2YBDA 2PO5A 1XSPA 1NBMD 4UM5A 4LQ4A 1K7CA 1N5DA 2HIMA 3MYRA 5C5CA 1R4NA 2GPAA 2QGNA 2QYHA 5HE9A 4H6PA 1WPQA 2Z30A 2GWSA 4BBZA 1ZVVA 1OD6A 2UYGA 4D3FA 3NIWA 3EXIB 2Z58A 3HU3A 2YC2C 1DOQA 1H2AS 1GGJA 4YR7A 2Q0QA 4Y3UA 1KJIA 1WAMA 2QSYA 4EAQA 3AOEC 2BKUA 1G8HA 5AW4A 3OT1A 5FWYA 4PSVA 3V1UA 3OQMA 1E7MA 4C20A 1XZKA 3G7UA 4Z0PA 3THVA 4TTRA 2PEYA 2CLOB 4Z2AA 1HEIA 1YS9A 1VLVA 4M36A 3PA8A 4JT9A 2R00C 1KMNA 4XYMA 2AFIE 5GJBA 1QRUA 3GGDA 1ZQQA 1RAIA 8ICJA 1XVIA 5EMMA 2HHSA 4NR0A 1T5LA 1DIAA 3MJDA 5DLFA 2F3NA 4PLFA 4O2BF 3G6KA 4TVKA 4D9KA 2G08A 1OH8A 4ZOLA 2GVNA 3A36A 8OHMA 3NLLA 2BGTA 1UWKA 4ZVKA 4YT8A 1F8FA 1Z7YA 3FDFA 2HFKA 1HNWB 3BQ1A 1GPUA 2PR7A 5THXA 4UAUA 1RPNA 1AHNA 4PZUA 3EA0A 1GDDA 3CONA 5EXSA 4U7FA 2HMXA 5BOVA 3SLKA 1FU8A 1W4ZA 5ALXA 1KSJA 2G83A 4FKMA 3KDPA 5DASA 2ISQA 2W2XA 4EYIB 2E4WA 3UAXA 2PCJA 1E96A 1M5TA 3MA0A 3PFIA 2QX4A 4O4LF 3PE3A 4PLPA 1X9MA 5I51A 2LM4A 4A6XA 1KO1A 1XSEA 3G0HA 3Q6NA 4DUGA 3SHQA 4BFZA 1JFTA 1GDTA 1E79D 4MGYR 3EUFA 4IVRA 4ZT5A 1YUMA 3M5CA 2BL4A 2QL7A 2WHPA 1ZOSA 4ESVA 5GTHU 2DWUA 2O8VA 2OQ2A 3VYWA 4EDHA 4W6ZA 3WGOA 1VPVA 4L22A 1IPHA 2UZAA 1R7RA 4DCNA 3HQ4O 2EARA 1EFAA 2WJPA 1S1MA 3PFCA 2BP7B 3AHDA 1X94A 1JQDA 1NX9A 1ECCA 4BP8A 1KQPA 1ZVJA 3HU1A 2B35A 2IF2A 4MUNA 2AOVA 4UB4A 1AQJA 1E0KA 4U2EA 3M0EA 2ZYSA 5A0TA 1C7YA 3CF4A 5LOVF 2UXCB 1U2TA 1Y9ZA 2MR6A 4OYLA 1JXLA 1A9SA 2CKDA 3NWJA 2EKQA 1DMSA 1M1YE 1MAHA 2CV2A 3ABIA 1DIOB 4X1YA 4MV1A 4IG9A 2BM8A 5L1JA 2EKBA 5ERGB 4RDHA 3E48A 4O2LA 3E81A 3EC2A 3P9CA 1F3OA 1HIWA 5FWDA 4G9BA 2QAJA 5KCMA 1KMQA 1UQUA 3NHWA 2IZOA 3BJRA 1GM5A 3BDVA 1SKSA 3JWPA 1PWZA 3A6ZA 2H9IA 3VAYA 3WLKX 3HABA 4GSLA 1VKHA 1QIIA 2KJ9A 1JHYA 2E3TA 3UUEA 3A4VA 1QX3A 5A0VA 1N6OA 4M4SA 2ZETA 3LVRE 1RWBA 5CFRA 2P6UA 5EJAA 3UJ7A 4YACA 4ZVTA 1FW8A 2LZ0A 1D6NA 2W9BA 2JJQA 4TTVA 5G4LA 3AJDA 3VTFA 3BSSA 2VAVA 4V3BA 3LNTA 4WK6A 1JHQA 3TRDA 2EZUA 3CZ5A 1BDBA 4X0EA 1NK8A 1J4AA 1DC4A 1CUYA 3PFFA 3ND6A 5BWBA 3IAS6 4XD7A 4J9PA 4L9AA 2ZR9A 2YV4A 4NDZA 5A3SA 4LOAA 3AWDA 1PFGA 4DA4A 1HLGA 1BGVA 2NYRA 2TMYA 3W8RA 4WJ3B 2NQ2C 4DUZB 3IM1A 2AQ4A 2HW3A 5BV7A 4CHTA 1CS0A 5K01A 5JSQA 1FNBA 4UHEA 2ZCJA 5CR0A 5HIAA 1ZI6A 2QV0A 3PEUA 2JZBB 3LT0A 2VRWA 4Q9NA 3DUFA 3AHGA 4WT7A 1C5KA 3V6LA 3C6KA 1U2PA 1RABA 5KSOA 1QQBA 1T8PA 3W4IA 2GYWA 2BC9A 1G4UR 3U40A 4CLOB 4BEWA 5ICEA 1XMQB 3LZ6A 1P31A 4E21A 4M0CA 2TRSB 4MV0A 5I8WA 1CY4A 1Q46A 4YDSA 4UEJA 4O29A 2CVHA 3DZDA 3ESQA 3NCHA 2MWMA 1JHPA 1RG6A 2ODTX 3RJEA 3I0ZA 4PHPA 4KEAA 3T5AA 1F3LA 2GN4A 3C1OA 1COOA 4QO7A 2Y05A 2KP7A 5AJUA 5H5JA 3TM4A 4X7MA 4HNAB 3QE0A 5J59A 4AZ0B 3VU9A 4NPCA 3LCJA 2ZYIA 3UWDA 1GSIA 2YXDA 5JS8A 4NZNA 1NSTA 1X70A 1Z0JA 3CLVA 2H8GA 3QLUC 3KR0A 2HLPA 1PTKA 3VHXB 4YRSA 2QTCA 2B1RA 4NE2A 3PGMA 4CI9A 3B2NA 3PK0A 2WABA 2HH9A 3BC1A 3CEPB 3ZYZA 4ZHQB 1GA1A 2FHPA 3ED5A 2FPRA 3SS8A 2FWAA 2OBYA 5A4MS 3WDSA 1GZ4A 2P1DA 4LBYA 3AJEA 1JX6A 2YVAA 3E3MA 3QPDA 4KLOA 4OJ6A 4JAVC 1MIHA 4EY7A 5I9NA 3HRKA 1XZMA 4BVKA 1AHIA 3PJDA 4EB8A 2JLUA 3QY9A 2WWRA 4DCOA 1WHTA 2WZDA 1JFFB 3OPYA 3ZY2A 3L4KA 1UP6A 1R8YA 2ZS7A 3E3OA 5EJ4A 2KIVA 1J97A 3E61A 2JLVA 2EGHA 1WS6A 1YZYA 3UAYA 4PHTA 4BKOA 2RGUA 2O59A 3O74A 2FQ1A 4NMWA 2AN4A 1R4ZA 4TKVB 3SX0A 3KV1A 3ND7A 5AVSA 4O4IB 2P6PA 3NIFB 4JXZA 5B7NA 3W78A 4KYVA 5KMGB 3WGTA 5DGXA 2IIPA 4AW9A 2TS1A 1WR8A 3BT7A 1IM4A 4LA4A 2DQYA 3H5TA 2V6MA 3WRYC 3OE7A 3S2SA 3L04A 3EFEA 3TLXA 4UM9B 4ZZ0A 2I7XA 1BO6A 1NDQA 5EZ5A 4X5VA 3VPAA 2BFEB 2IYPA 4OHXA 4XWGA 3FHJA 2CJXA 5LIPA 4PLGA 3X44A 2PWAA 1QG4A 3BIJA 3MLEA 3O8NA 1PK1A 4JVMA 3UHFA 2IHKA 4P0PA 2CN1A 1MB0A 4XQ9A 3DHVA 1W36D 1JN0A 3GLKA 4YJ3F 3PYLA 4YRMA 3NOVA 2JAQA 2JKZA 2Q3LA 5ALWA 2I6TA 4F3OA 1Q83A 3A1CA 3HB7A 4EB3A 4R0NA 1OYOA 5FPTA 4EFMA 3C4JA 1U80A 2Z2XA 3BH0A 4TZKA 9ICBA 3HJTA 1R74A 4CEJB 1Z4NA 3DXZA 3HPOA 1D7OA 1CY0A 1U90A 1YULA 3PWKA 4Z6DA 1EGQA 4I4TA 3QJ5A 4YO8A 3E0FA 1LPOA 3NT5A 4JASB 3OMLA 1Y3HA 1ZD8A 2QWXA 4XVUA 3QMPA 3U7GA 4KHPB 4XLLA 4QTZA 1C0EA 1FIQA 1DLIA 4TT3D 2OLJA 1C1XA 4ZV9A 5C80A 4ESEA 4E22A 3BXEA 4Q66C 3AHCA 2W9AA 2Q3HA 4RA6B 5G5GA 5CM8B 3VYRB 4W5QA 5K3DA 4AO8A 4C3VA 1BTOA 1ODSA 2IW1A 2CHGA 4NJ8A 4DJDC 5JSFA 3JQ7B 3ZDQA 3MBOA 4S05A 5E95A 5L3VA 1T5TA 2SKDA 3S7ZA 1GTVA 2HWKA 1JHXA 5HFJA 1MOPA 5BSGA 3KZVA 2XODA 3ORRA 4GQIA 2B3TA 3OJEA 4UE3S 3WWPA 4GX0A 4OSOA 3ZWQA 1V7PC 1HTTA 4L2IA 4YR9A 2NP7A 2KB0A 1PZFA 3UJ9A 4ZCSA 1P1RA 4NCJA 2WB4A 5HP4A 3O8QB 5ENZA 3U7IA 4XYBA 4HDMB 4DMKA 4ACAA 5H8WA 4FX2A 3UJ3X 1JJIA 2DETA 3RBAA 2XMCA 1NNI1 5HKBA 1DTWA 1P1BA 3S68A 4LJLA 2KLHA 4ZCMA 1NZPA 1TA9A 1IV8A 2C7QA 2FGKA 4DV5B 3H5WA 2OKCA 3NGDA 2O06A 1ODIA 2QTFA 4ZI7B 3AQEA 2NQ8A 3KTFA 5ALNA 3SIRA 1L5RA 1AMUA 2GN8A 3JQ6A 1IE3A 2I03A 1KZYC 4JFRA 2X8LA 3U3KA 3UK2A 2I67A 3EQ7A 1WD7A 1KQNA 4YRNA 4QEZA 1IY9A 3E22B 4AS2A 1TK3A 3RRFA 3NOXA 3NJ4A 4B9VA 2FFQA 3GDHA 1ESDA 3G6YA 3TLCA 2XZDA 3HLTA 1P7CA 2JAOA 3P9PA 4CLHA 3KLPX 1XZGA 3ET5A 4YR3A 3BE5A 5C3MA 2A5GA 2NUPA 3T4EA 1PWHA 1UKEA 4A36A 4I1OA 2DFLA 2HHHB 4U3JA 5CHGA 3ELYA 5LYJB 3OZGA 4BLWA 4MPPA 2E4XA 2ZRLA 4YMOA 4N41A 1XLUA 3VR5H 1RWWA 2R9VA 1OYWA 5A9SA 2CYBA 3NVKI 5KHOC 2Q3EA 4PQGA 1HMYA 5KFPA 4J2TA 4JITA 4TLEA 5J0PA 5CM9C 3KE9A 2O9JA 4YRIA 3VQTA 3PLAE 4WZZA 3MJ4A 3ONFA 4XTRA 2C5HA 3BGSA 3LKDA 4K2HA 5KAMA 4K40A 2XR1A 1PYOA 1D8TA 2KW5A 1JQAA 2C5LA 1YA6A 4B5LA 1MMFB 3K0BA 4F8EA 1U2GC 3BBLA 4W4TA 4FW8A 4IQUA 5E8RA 2JFWA 5D1HA 3D7KA 3KR1A 4RNMA 2PQ0A 1MHTA 1RYUA 3QFTA 4R0VA 5B66U 1DV2A 3DF7A 4GLOA 2VWQA 2FEWB 1LBSA 1DJOA 4PQFA 3ZVRA 2A9RA 4DTCA 3BS7A 3T94A 5G1NA 5REQB 3I2YX 3RFUA 4HADA 1YR1A 3LPLA 5B2ZA 2Y27A 1PT8A 2YS6A 5LDHA 3FOWA 3B78A 4RSRA 4PFKA 3EGXA 4RPZA 1E7QA 1SPBS 1PV4A 3WHPA 2UZ1B 2UXDB 5FH9A 4PZZA 4U6QA 3JPRA 5FUMA 1EFTA 1AGXA 3GVHA 5E6UA 3ZI7A 5IPFA 4OMDA 5T8KA 3EXG2 4OFWA 1BVYF 3U9TA 2CBGA 4J1NA 5HDBB 5ICFA 4BTEA 2WWYA 1Z83A 3OZUA 3E27A 4DMLA 2X86A 2Z6VA 2HBMA 1WXDA 1XQYA 2A6PA 5E1BA 2PL1A 1XRPA 3T3IA 2UUAB 2PMDA 2PZGA 3UH1A 1H69A 1EDOA 4FQ8A 1S7GA 5EP4A 4BAZA 4TMVA 1F2TB 1VE7A 1RXIA 2C2BA 2D4HA 5EIEA 4HGZA 4NLGA 2WP0A 4LYYA 1R5NA 3UHAA 4C6TB 4UAWA 3A2NA 3Q11A 1FNMA 3KUUA 3F1LA 3HDVA 5B3LA 2NVWA 2PBFA 1UA0A 5ALDA 3H6KA 2CJPA 1TLTA 4FDUA 4DCMA 5FRDA 4D41A 1XZCA 2DKFA 5AHOA 4W8OA 1C7QA 3OU6A 1VL6A 4DVJA 3FPGA 2BSAA 1ONNA 1XZHA 2EFEB 3P5SA 3NAZA 1NJFA 2GEDA 5LYYA 3OEEA 3LXMA 1USIA 5BMVB 2FOIA 1DUIA 9ICHA 5KFZA 2ZJBA 1ECGA 1PTJC 1XDSA 4TQSA 3M1LA 5A2QA 4B44A 3MRTA 3E2PA 4G6ZA 4RPCA 2GUWA 3HK2A 4MFCA 4JSTA 2XYQA 3WVNA 1DKQA 5D1NA 2FQYA 4ENQA 7ICIA 2NZVG 1ZXLA 3S1LA 4J0GA 1PJ8A 3FWNA 3AIOA 4ICAA 3ROPA 2V7VA 2E55A 3JPWA 3LQFA 4DLGA 1O0BA 4E6EA 3OWXA 4ED7A 2JLRA 2PZKA 4BO4A 4QWAA 1XZIA 2YFYA 3TQFA 2ZI6A 1TLLA 1VL8A 3IC5A 3VR4H 4J16C 4J9KA 2GT1A 2WWWA 4X54A 1TO6A 2Y1KA 2VI5A 4LMBA 3DE6X 5C4MA 3N75A 1N5IA 1EGMB 3G9UA 4PYIA 4QYIB 3R3SA 3AY0A 3D59A 5CD1A 4GKKB 2DF4B 3OJXA 1G4AE 4DL7A 2QN7A 2ZTVA 4L07A 3HA7A 3U4HA 3TW8B 3MAJA 3MFQA 4ETMA 3VZBA 1T2CA 1P0MA 2J6UA 2GETA 3SKXA 1RI2A 2FRXA 3PXAA 4G01B 1TMKA 4B4DA 2H31A 5JEEA 4LYFA 2GS9A 4IIGA 2DRIA 3RSZA 8AT1A 2HIHA 3LWNA 1SIWA 2O2EA 4CCYA 2YMMA 5AK0A 1JHMA 4AT1A 2ZB7A 3KETA 2FW9A 3H1EA 2OBBA 2R7KA 4KRYA 1X6IA 1J42A 4EGCB 3MWDA 1SC4A 2FMQA 4LNAA 3HJEA 4NBLA 1TKCA 2R6ZA 1V11B 4LZGA 3L4BC 1A2KC 2I4OA 2DQ4A 5ALKA 3FCEA 5LCXA 2V3WA 2EATA 1A97A 1F4LA 4RU9A 4ES6A 4NOMA 3C3BA 2NUAA 3KKLA 3ZEIA 3HB5X 5GM2A 1EE2A 3NBMA 3AUFA 3H0KA 4GVLA 2XDQB 3B6MA 2VOJA 1ZQ9A 3I42A 1FS4A 3N0RA 4MICA 4C04A 3HYNA 4REQA 5DBEX 4QA9A 4AMVA 3EIOA 1KEZA 3AR6A 3R3ZA 2C9BA 1JIIA 1YRBA 3LQ4A 2XUFA 2WU1A 1VJ0A 3K0CC 3L8ZA 5LBIA 3R40A 2VJOA 3SVTA 5BWLA 5AUNB 5BN5A 5A3QA 1THGA 1R3DA 5DOZA 4KLAA 3KHSA 3IDFA 5HHTA 1QHNA 3LT4A 3ENNA 1J1IA 1H66A 2A0XA 5KFRA 3WRVA 1U0GA 1XPUA 3C85A 2FVXA 4RHYA 5GGYA 3VNSA 3KV3O 5D3MB 5EGNA 1COWA 1BWPA 1VKRA 2IPNA 4D0SA 5JVDF 1L2TA 1ZJZA 1DG9A 1EVEA 2FCRA 5AVXA 1XP8A 1Y1PA 3C2MA 1FVXA 2Y9MB 2P0YA 1XWWA 3SQMA 3CVYA 2B3DA 3B89A 3FWZA 4YDHB 3TB6A 1ZRSA 1L4EA 3CH6A 4KC0A 3URKA 3PDCA 1X2IA 1EP1B 3OICA 4Z4IA 2NV3A 3QVSA 3D7MA 5EE5B 1TCUA 4TQUS 3C3AA 2BCEA 1XK6A 1Y9DA 1C80A 1LPPA 4WBSA 5JFTA 3KD3A 4UUNA 1IYZA 5SZKB 5AVQA 5FNVB 2R3SA 4JJZA 2RBGA 3DOCA 4KIUA 2E4AA 5KG4A 1BFDA 4B6SA 5JO9A 3KHTA 1F48A 3R7WA 3JALB 3NHPA 3WC4A 3T1OA 4QOIA 1R12A 1UT6A 3UJCA 1ORIA 1V16B 4DPKA 2OV4A 1I3OA 4Y2QA 1OTHA 1WPRA 4EJ0A 1B0AA 3CZQA 1NSYA 4EBEA 1AQNA 4ETIA 2IYFA 5G4KB 2ERXA 2IPXA 3F2BA 3L1UA 4N54A 1QCDA 2XUHA 4YXJA 2HMWA 4U7PB 1WZIA 3MMXA 5EIOA 4K05A 4MMXB 4GXTA 4IRXA 1TO2E 2IEBA 3BILA 1P3DA 3BJMA 4TXNA 4N03A 4NQZA 1IZ9A 3ROTA 5C8YF 4US1R 4G5SA 2C20A 1BWSA 4CU5A 1HETA 4YCDA 5IABA 4YDQA 5CEEA 2VHZA 5CXUA 3IUBA 5TR9A 1ECPA 1F0YA 3MWLA 4WQMA 4W82A 1O54A 3OHBA 2ZSKA 3ABSB 2W9MA 1JBQA 1N2CB 3ESDA 3B1JA 2JHFA 1GYPA 3P45A 1ZUWA 5KNBA 1T13A 1Z07A 1HDGO 3OM0A 3HZRA 1FYWA 2POQX 1F4PA 2A59A 4LJ5A 1DXSA 3RSFA 3A26A 3GJ4A 4FB5A 1O96B 4RF4A 2H52A 4KE8A 4JBGA 2HRBA 1U11A 1XG5A 2G8NA 4AQYB 2C4KA 5ALQA 2QK4A 2E87A 4RKQA 4R0MA 1G9SA 4L5AA 3GWZA 2WD8A 4AJNA 1ZMTA 3PD7A 4EFLA 1E32A 2I99A 2BHRA 4EX7A 1LGYA 1YZKA 3H0LB 4LXYA 1PI3A 3H8MA 4JBNA 1DFGA 5KREA 4EBFA 4N39A 1BDHA 3ZKWA 4AJPA 4Z6EA 2QEQA 3RHTA 4H59A 1OOEA 2YFHA 3FCAA 3Q41A 3KCQA 4NZYA 1K63A 1GRRA 2BR0A 4LSMA 3HCBA 2VJMA 3GBVA 5E6RB 2EFCB 2H1VA 4WKCA 1PGJA 4I8IA 5KFKA 3UK0A 5A4DA 3RC8A 1TQ8A 1SZCA 3CT6A 1YHZA 4M0UA 3T38A 3AP2A 3WGMA 4P4PA 5EKDA 4BWFB 4TS3A 5BOSB 1VCOA 3HP7A 4B09A 1D09A 1RM5A 5K8TA 1EUCB 3IBGA 1ZH0A 5BN3B 3I34X 4JB0A 3UATA 3W5CA 3B70A 4UOEA 3I0MA 5BT8A 1BEEA 3P0IA 5A0FA 4XPIA 3LQ1A 4H7KA 4W5JA 4G5QA 2CMGA 4CCSA 2FFRA 4COKA 3SN6A 1VZ2A 4GX1A 2BKXA 4K9QA 1LSSA 5KYKA 3CJQA 2NTEA 3TAXA 1P5JA 1QIHA 1E0SA 4YD1A 1W1IA 5KX5A 4DA6A 1DU4A 3OU2A 4KZPA 3KNZA 4EVSA 1M1NA 2J0SA 4WKBA 4QRDA 3WIUA 4BJ1A 2JARA 4WA7A 3TJMA 3HADA 5FR1A 1SQ5A 4CE6A 1W96A 3FN4A 4J90A 3ZY6A 1S9FA 1E6WA 4PYJA 3TUZC 3TLZA 1RYHA 1F44A 4F71A 1KZ1A 4OLFA 4OUKX 2NUTB 2LIVA 1A8UA 4EF6A 2KOBA 2I65A 3CLTD 2QL5A 2H5LA 3FLEA 2QPAA 3GX1A 1DPFA 3WGHA 1F9AA 1V39A 4IXTA 3DZKA 1HYGA 2FFBA 4RIHA 2C8KA 1LA2A 5L3QA 2JBAB 3UTDA 2DY0A 1JJBA 1D4FA 3L05A 1FXWA 4L5CA 2QI9C 5EPOA 2G17A 3ZJ5A 1SXDA 3M6AA 1JDVA 2I8LA 4J6FA 4MR8A 3HXOA 3Q3EA 5HF6A 3DZJA 4FHEA 2QPTA 2DFKB 5JTTA 5CPBA 5KQPA 3W5HA 3JWGA 4IUDS 1TTTA 3AFHA 3LUDA 4F8JA 5KZMB 3BERA 3RUAA 3SLRA 2CRXA 5BNWA 3BFVA 2HXSA 1EE1A 3SR0A 3LQKA 4G0UA 4D56A 4OVKA 1XB2A 2ZT8A 3F5QA 2Y9UA 1W35A 2GHQA 2FLWA 3SXUA 3I1IA 1OZAA 3HUTA 2I9PA 3IDWA 4I2IA 4OV6B 1IG0A 2AOTB 4IZIA 1U9LA 4HEHA 4MJLA 3JV7A 2BF4A 3EUWA 1W8DA 5COAA 3UJHA 3AFMA 4C2AA 2PH1A 4FHGA 1FFWA 3AGPA 2IW3A 2VDRB 4PC3A 3I61A 2P3LA 1DZ3A 3H18A 2VPTA 3TSYA 2V97A 4ZVVA 3PGVA 3TF5A 1UOQA 3UT5B 3ZZNA 4IICA 1MA7A 2PX8A 5IDWA 3OG9A 4EY3A 4GXJA 1XLVA 3GPIA 3WNDA 3MMSA 2YJTD 4X24A 1BKYA 1JSCA 2AR7A 5EE3A 4NLLA 4XGRA 1H3NA 4YWJA 2QQ0A 3ZQ6A 2QY9A 1G8MA 4MUBA 4QWWA 3T41A 3CO5A 3TNYA 1OBFO 4KSYA 1P4HA 4D2IA 3GT7A 3SF0A 4D74A 1RR6A 5F3XB 5IZ4A 2J0EA 4AF8A 4G5OA 1MEOA 4DDKA 3I8XA 5A4IS 1VLJA 1FP7A 3REFA 8ICEA 1X77A 3NHSA 5A1TA 3WZ2A 4KLTA 4KBYA 4TLBA 2FN4A 4BKRA 1IAVA 4E4TA 5IBRA 3A3NA 3ZH9B 3VDQA 3VX4A 2YXEA 4P4LA 4PO1A 5EUMA 4WV3A 1JW9B 2OXRA 4BFSA 4XIFA 5CXXA 4G0QA 1N5LA 5I7RA 5JQGB 2WJHA 4CMEC 2R66A 5HUQA 4DV1B 3I5YA 2JB9A 4FFWA 1HO3A 1P8AA 1B4DA 1WUJS 5JBNA 3NQ41 2I6XA 1ZQAA 4ZQBA 1ZQXA 1R8SA 5GWXA 3J7TA 4DYVA 2BD0A 4HUQB 4OGKA 3RB3A 2CK3D 2H48A 1ZYQA 1RKVA 1FX1A 3T4UA 4K6KA 1BOOA 4N0DA 1XA0A 5JPDA 1F14A 7ICUA 2GJ8A 16PKA 1SH7A 4JOBA 1KWGA 4JEHA 2GB4A 4EITA 3LO8A 1E1NA 2FMHA 2JEOA 1GQQA 5A4KA 3QQ5A 3K8OE 4QECA 1ZGBA 1XZNA 4I46A 4ARZB 4D1YA 3PQCA 5JPIA 1XMIA 4R1QA 2PGLA 1UXJA 1QG6A 3BE6A 4DHEA 3WMXA 2HHWA 1IDN1 5LA6F 2VT3A 4IJMA 2CXQA 2NYVA 1K8RA 3NP7A 3ULKA 1XHLA 1E1QA 4BQSA 5B55A 3JW8A 1FRNA 5DOVA 4QWEA 4B3IA 4KPUA 2GBPA 5F7OA 1PKXA 1QONA 2V0CA 1GNTA 4ZP1A 2WOOA 2JCSA 5EKSA 3G8DA 3T99A 4DA0A 4U4AA 1ZITA 2P6OA 4UQPA 4BFUA 4NEHB 1GA4A 4KYUA 2N46A 2ISOA 2FNAA 1ESEA 3ANLA 4ED9A 1BE6A 4HWOA 3I2HA 2SBTA 2BH2A 1FB5A 1IOZA 4OK6A 5EJFA 3ZCUA 5IKXA 1TB4A 2DH5A 4XGIA 2BFBB 4OHUA 3WGJA 2ZRIA 5KDOA 4ZYVA 1GY8A 5JYEA 1PJRA 3EVTA 4BWMA 4Q3KA 1COKA 3WIDA 4OBXA 4D4IA 1PWXA 5ECGC 2B98A 4U7HA 4WLUA 4F93B 3S70A 2BPOA 3SDSA 4AN0A 4HMPA 1XTTA 2XNHA 4TV9B 1J24A 4WFIA 4FMDF 3HFGA 2FRDA 2HHUA 3CNEA 4YRRA 4AXXA 1CUBA 1RBQA 2UZ4A 2OV3A 1GKKA 1XUOA 3OUTA 2W6OA 4UNNA 4F2WA 3BJEA 2O8FB 4F12A 4ECAA 3CLUC 2DSTA 2VHUA 5AVWA 3BIXA 3QLJA 1KZ7B 5E7MA 2ZB3A 3VISA 2H11A 1DJNA 3PVCA 7ICVA 1MG0A 1ORTA 4OG2A 1ZCAA 4BX2A 3IQWA 5FHQA 2DTXA 1P4SA 5HQTA 1WY5A 4NESA 2FPMA 3RF6A 5SY4A 3EFOB 1B1CA 1TYEB 2JRLA 3T5LA 2CXSA 4HGYA 4AN1A 2ID7A 2X22A 3IJ5A 4B7CA 3H9GA 1NV9A 2QIOA 3RRYA 5I7EA 1ZM2A