3QNMA

Haloalkane dehalogenase family member from bacteroides thetaiotaomicron of unknown function
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
231
structure length
231
Chain Sequence
LKYKNLFFDLDDTIWAFSRNARDTFEEVYQKYSFDRYFDSFDHYYTLYQRRNTELWLEYGEGKVTKEELNRQRFFYPLQAVGVEDEALAERFSEDFFAIIPTKSGLMPHAKEVLEYLAPQYNLYILSNGFRELQSRKMRSAGVDRYFKKIILSEDLGVLKPRPEIFHFALSATQSELRESLMIGDSWEADITGAHGVGMHQAFYNVTERTVFPFQPTYHIHSLKELMNLLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Haloacid dehalogenase-like hydrolase
publication title Haloalkane Dehalogenase Family Member from Bacteroides thetaiotaomicron of Unknown Function
rcsb
source organism Bacteroides thetaiotaomicron
total genus 90
structure length 231
sequence length 231
ec nomenclature
pdb deposition date 2011-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3qnmA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3qnmA01
3FGOA 3WKAA 3NANA 5AKEA 5AKLA 4UARA 1T5TA 2GHQA 2HOQA 1N8NA 3KC2A 3QUCA 3HYCA 4RETA 3W5BA 1YV9A 2AUTA 2YFYA 3EWIA 3N07A 1L7NA 1J97A 5AK5A 4E88A 2PKEA 1T9ZA 4F72A 2JGAA 3N8GA 2CFRA 5AI5A 1XP5A 2HX1A 3A1CA 4YIHA 3UMBA 2NO5A 5AKYA 2Q4RA 2IOFA 5ALFA 1RKVA 4MUMA 2R8YA 3SD7A 2HSZA 4C4TA 4UMEA 3W5AA 2JAOA 4NV0A 5ALJA 2I55A 3OCUA 1RC8A 5AW8A 4YCMA 2YMQA 3FZQA 5AK3A 4BBJA 3QUTA 2CFTA 4BYGA 2R8XA 4ZEWA 5AKZA 4BEVA 2HEGA 5ALMA 1Q92A 4FFDA 3TLMA 3NALA 4CE6A 2PQ0A 2HO4A 4I9FA 3L8EA 3NIWA 4H1WA 1RLMA 4Y3UA 2AGVA 1Z4QA 2OBBA 3R4CA 2I34A 4MWOA 2C8KA 4DCCA 3IB6A 3A3YA 1SU4A 5AKKA 3OCXA 3I28A 1L8LA 2OM6A 2HDOA 4BX2A 4B6JA 1AQ6A 3AR5A 3MC1A 3ET4A 1Z4KA 5AW3A 1Z4LA 4Y2RA 5ALHA 5ALOA 4NAVA 4HGNA 4Y2YA 2FDRA 4NFLA 3QU4A 5AK4A 5ALKA 2WM8A 5AKHA 2G09A 3L0BA 2NYVA 2MSNA 1RMYA 4ZEXA 2G0AA 1U02A 4IFTA 3L0CA 3WKEA 2BDUA 2YJ5A 3I6BA 5T41A 2WF7A 5AKIA 3QU7A 4O8CA 4J2TA 2W4MA 4Y2JA 4OD0A 4EENA 1ZS9A 3ZWDA 2HHLA 2WF8A 1Z88A 3B9RA 4XPZA 4UM7A 2YMLA 2P9JA 2ZXEA 5AESA 3OPXA 3I76A 5AI0A 2QLTA 5ALLA 2HCFA 3J7TA 3OCYA 2WHEA 3ZX4A 3EF0A 2ZBDA 4BX3A 4YCLA 5AVRA 3SF0A 3OTQA 3ZTYA 4XE5A 5AM1A 4Y2QA 1YNSA 1Z4OA 3QXGA 2OA0A 4DFDA 4XQ0A 3SLRA 5AVZA 2P27A 1L7MA 4UU1A 5AI4A 3QGMA 3WK8A 3KZXA 3SMVA 3FPSA 2ZBFA 3RF6A 3QUBA 5ALWA 5AIAA 4KX5A 3QNMA 5ALVA 3MPOA 1ZJJA 1TA0A 1Z5UA 3BWVA 2D2VA 4HYTA 2WFAA 3EF1A 1PW5A 2YY6A 5AKJA 2HF2A 3OCVA 4Y2SA 2Q5EA 3UMCA 1RQLA 5AHXA 4L6AA 2RB5A 5AVWA 4NABA 3M9LA 1RQNA 4IG4A 5AW0A 4UASA 1QQ5A 4OHFA 5AI9A 2C4NA 4UATA 1FEZA 2IOFK 5AW5A 3I1YA 1KYTA 3KOOA 3U19A 3ESQA 1O08A 2BDEA 2IYEA 3IRUA 1EK2A 4UAVA 3R09A 4UW9A 1TJ5A 2FPUA 2WF6A 1MH9A 3HLTA 4F71A 1K1EA 5A3RA 3KDPA 5AM3A 1NRWA 3ZVLA 1QH9A 5ALDA 1L7OA 4UU0A 5AVXA 5ALZA 1RPZA 5AI8A 4YCNA 2W43A 2FPSA 3WK6A 4CF4A 4QQFA 3D6JA 2O9JA 3BA6A 3KD3A 5ALNA 3U7FB 3GYGA 1WPGA 4DWOA 2EARA 2AH5A 3L8HA 4EX6A 2NO4A 5IS2A 5ALTA 3L8GA 1L8OA 1SWWA 1CQZA 2EAUA 4RESA 4Y2XA 1JUDA 4L6CA 1EK1A 1Z4MA 3WKDA 3IJ5A 5AW4A 2MU2A 5ALQA 5ALIA 3FM9A 3QLEA 3MN1A 2O2XA 3RFUA 1T5SA 4OCZA 1WVIA 4UMDA 2BY4A 3U7EB 3E58A 3NASA 2ZOSA 5AICA 2R8ZA 3OCWA 1VFPA 2ZBEA 3U26A 1Z4JA 1TE2A 1U7OA 4I9GA 3WKBA 1U2SA 3P96A 3L1VA 1TJ4A 3L7YA 3E84A 3QU9A 2C9MA 3PGLA 4BNDA 1Q91A 2WF5A 2CFSA 4Y2VA 2ODAA 5AVYA 4DW8A 1J8DA 2YMMA 2FPWA 2CN1A 4J03A 1L7PA 2HF7A 4ZEVA 2EATA 4KNVA 1ZD2P 1L6RA 5AK6A 1U2TA 4AP9A 1RDFA 3WK4A 4KNWA 5AW6A 4Y2TA 4YGYA 3R9KA 1YJ5A 2YJ4A 3DNPA 3L1UA 5A3QA 1YMQA 5JJBA 3QUQA 1YDFA 3NRJA 5ALPA 2B1QA 2WF9A 4UAUA 1Z4NA 1RLOA 3DV9A 1QQ6A 2B30A 2GFHA 3OCZA 2RBKA 3AR3A 3KBBA 3B9BA 3DDHA 1ZD3A 2I7DA 3A1EA 5AM0A 4BKMA 3PCTA 1ZD5A 3L0YA 3UMGA 2GHTA 3K1ZA 3S6JA 2QYHA 4NWIA 1X42A 3PGVA 1IWOA 3ONNA 2R8EA 3AR6A 3QYPA 4UMVA 3ZI4A 2OYCA 1S8OA 3EPRA 4CF5A 4HGOA 1WZCA 2B82A 3ZVMA 2JARA 1XPJA 1ZD4A 5AKGA 3ZW7A 4BX0A 3SKXA 3ED5A 3FVVA 5AVVA 5IT0A 5E0OA 3ZWKA 3NAMA 3ET5A 3QU5A 2IA5A 3NUQA 4FE3A 2YJ6A 1QYIA 3ZU6A 1WR8A 3ZVNA 2B1RA 4KX3A 4HGPA 4BEWA 2GMWA 2PR7A 3M1YA 2W11A 2AMYA 5AI6A 4EELA 4Y2UA 3ZX5A 4Y2PA 2I54A 1TJ3A 1S2OA 1Z5GA 5AM4A 1RKQA 1YS9A 2MU1A 4HAIA 3E81A 2YMPA 3L5KA 2G08A 2FEAA 4L57A 4AS3A 1NF2A 3AR4A 4CF3A 1ZRMA 3N5KA 4QJBA 2I6XA 3ESRA 4EEKA 3N1UA 2GO7A 3CZ4A 4G9BA 4XOUA 5AW2A 3AR2A 1Z4IA 3SHQA 1LVHA 4JB3A 2YJ3A 3QX7A 4G63A 3ZTWA 1N9KA 3N28A 2P69A 2JAWA 1QQ7A 5AW7A 5FP0A 2X4DA 5AVUA 3CNHA 2VKQA 2FUEA 5AW9A 1F5SA 3WK5A 2FPXA 2DQSA 2RARA 3UM9A 4KN8A 3W5DA 3L8FA 1ZRNA 1VJRA 1RRCA 2FI1A 5AKXA 3MMZA 4KYTA 5ALEA 3U7GA 5AM2A 2HI0A 5ALGA 4CNQA 2B0CA 2JAUA 3E8MA 2G1AA 5ALUA 2B8EA 4PNHA 4FYPA 5IT4A 1VJ5A 4YH1A 1LTQA 4JDPA 2YBDA 3U7HB 5ALRA 5AVSA 4C4RA 3B8EA 5ALXA 3A1DA 4YIKA 3WKCA 3PDWA 2B8JA 4EX7A 3DAOA 3WGVA 2Q4TA 3AR7A 5A3SA 1Z4PX 1XVIA 4C4SA 5AIBA 1CR6A 4GXTA 3F9RA 4GIBA 4OFZA 1O03A 4UM5A 3U13A 3QU2A 2RAVA 4HGQA 2I33A 2C88A 1U7PA 2ZBGA 5ALSA 1RMQA 2G06A 1RKUA 1ZOLA 2G80A 2FPRA 1NNLA 3W5CA 3WK9A 5AM5A 1SWVA 2IOHA 2YN4A 1RMTA 3ZUPA 5AW1A 2ZG6A 5ALYA 4UMFA 4BNDB 3AR9A 3WGUA 4HGRA 1RLTA 3AR8A 5AVQA 2C8LA 5AVTA 1Y8AA 4AS2A 4EZEA 3FPBA 3SKYA 2G07A 3WK7A 2P11A 3VAYA 2FUCA
chains in the Genus database with same CATH superfamily
3AIKA 2DRIA 3G1UA 5CBPA 1KXJA 1J49A 1Z1VA 1TIPA 3MVEA 3RW9A 4PCLA 4X66B 1VL8A 3I83A 1Z68A 3FPKA 3HY6A 4ZPJA 1XP5A 4PF1A 2LHTA 2Q4RA 4MUMA 5D1HA 2ZJAA 4BFXA 2BT4A 3C5EA 3STUA 3T5MA 2NUPA 4MRAA 5CB4B 4PLYA 3M4ZA 3BS4A 5T57A 5JFOA 1C9NA 4ZEWA 2ID8A 5FL3A 1H9CA 2KM1A 1S5LU 2FOXA 2FZCA 4H4EA 4EKNB 2G83A 3WP0A 1U04A 1YRQA 2IX3A 3CH4B 4GYYA 2QGNA 4PC1A 4UTRA 3RARA 3STTA 2WVHA 1AKQA 1ZQOA 1VLMA 4BJ5A 1WBDA 4HFJA 3F5EA 1L9XA 4ACBA 4R71A 1JILA 3EASA 3VNVA 1XQVA 2WT9A 1O8BA 5AOVA 1A8SA 4TUQA 4GDMA 4RHCA 4UM7A 3STYA 5BR1A 3UW3A 4X1KB 1A9TA 1U9JA 1YVRA 3VZCA 3TWOA 2D06A 1WB4A 2VUHB 4H4DA 4ALIA 1AUQA 1WDWB 2QDKA 4QWCA 3RKSA 3COSA 3KALA 4EKYA 2ZSJA 3OLYA 2BJWA 1VBMA 4EK9A 3O6VA 1T5OA 2X0DA 4NQRA 4I50A 4ZZ1A 1HL3A 1QPBA 3S1AA 3CURA 1FVFA 1RQNA 5KG0A 3UT5A 2KP7A 3VC2A 1CDZA 1K1QA 4AURA 3R5KA 1AJEA 1BPEA 2QSJA 1JL3A 5IBPA 1Y6RA 3AUKA 3GUUA 2FR1A 4CF7A 4UHFA 3OHBA 1I8TA 3BA6A 3KLNA 1QGUB 1IRXA 3I3SR 2SICE 2QYTA 3PTLA 3AEUA 3AU6A 4HNSA 1N3LA 3I4FA 4CR8A 4LEIA 1QYWA 3ZWWA 3CEPB 4NXZA 3OCWA 4HC4A 4HDNA 1ZYUA 1TE2A 3QIAA 2Q8QA 5KT4A 4D4JA 4FMDF 4QBGB 2VPYA 1S10A 3QZUA 3IAS6 2AQ4A 3PGLA 2F3SA 1EX6A 2BEUA 3FN4A 1UWLA 3DB2A 2NU6A 4TLAA 3TIXB 1OLSB 4UCQA 3N7PD 3LFTA 3Q6NA 3ADPA 1M0EA 3EVZA 5EP3A 1T15A 3B1FA 2RAFA 4DAOA 1W6UA 3GGSA 4BMCA 3L7DA 3KTDA 2VJMA 5LMZA 2D1RA 1ZN7A 5D5HA 3KFUF 3ZJYA 5DGXA 4DLTA 3IEIA 1G42A 3RSSA 4G6ZA 3TG2A 5CW2A 4QEZA 3AFNA 1ADGA 5HDBB 4LE2A 1YZNA 3OQIA 1NKBA 4XVCA 1XMQB 1O57A 4KQ9A 3IO3A 3W2FA 1ZEJA 3W9BA 2YXBA 1VG8A 7ADHA 5DB8A 1M1UA 2WIBA 1K6JA 3AIIA 1X7ZB 1JIQA 3MLBA 3WHIA 2FUEA 1F5SA 5A6SA 1EGHA 1UZNA 3DVLA 4B81A 4Q18A 3RO7A 2QW0X 1KAMA 4KYTA 1TF5A 4LI0A 2GI4A 1J23A 1P81A 5CCBA 1Y9JA 3UMVA 4S2EA 4D99A 5EQDA 7ICGA 3F6EX 4EB3A 1OLSA 3BICA 1PGNA 4FCWA 3U13A 3MXOA 2A94A 4BV9A 2GERA 4OQDA 4MVJP 4E70A 1KSFX 4I3FA 1II8B 2HBYA 3EC7A 4GNKA 3BS5B 2F3RA 3C2QA 3LNTA 3KQTA 3NANA 3SAGA 2PV7A 1PQWA 5D5QA 4D56A 4JL6A 2MSEB 3OTIA 3JALA 3PKZA 4TOIA 2Q1WA 3H4BA 3KM0A 1E7MA 3BTSA 1H0SA 3FOCA 1CQJA 1I4EB 2ATLA 3KYDB 4QEKA 4BV2A 3Q88A 4RZ2A 3JPQA 1P17A 3HDYA 4MEBA 3TXXA 3AERA 4TMFA 5LMNB 3KPYA 1EXWA 4EHIA 3DAHA 1PFVA 2UVRA 2C9CA 2QRVB 5D51S 1QTRA 5DNUA 1EP2B 4DA4A 3HY4A 1FP4B 4MQLA 2MUTB 2P3QA 2G5GX 5IILA 1RCUA 2NVUB 4NFLA 3V7KA 4MS3B 1I10A 3BA1A 2B5OA 4CHGA 1EXVA 2VBIA 2PX8A 2W70A 4XZ3A 4F5YA 1LDBA 4GPBA 3AL0C 1VCHA 1XLUA 3GEEA 2E7ZA 4O5AA 3T5KA 3Q2IA 2BN4A 3LQ4A 1F6DA 2RLTA 1I30A 1G16A 4QRDA 3EGOA 3H3XA 1MQAA 3RR2A 1DV2A 4EY4A 1BN7A 1FZQA 2Q4BA 1U4BA 5F1YA 2RDIA 2LYBA 3R5JA 3M5CA 1ZJ6A 3HC7A 4H6VA 3VVCA 4JY7A 4XGIA 1P4AA 1RRPA 3R3YA 3U56A 1AVTA 2O05A 5CRIA 2VBCA 2AS0A 1HDIA 5EIBC 2KLHA 3HSYA 3I2FA 4XM1A 4LRQA 4FMCB 4D74A 4F1WA 1KEPA 4ZU6X 2W4IA 3WLPA 1CX9B 1HEUA 4G86A 4BASA 4DCGA 1BKYA 3EGEA 4Z51A 1P2GA 4CMBA 3ACDA 3TDNA 2WFLB 4N76A 2J9YB 1KWKA 1PD1A 2UUBB 2J1LA 1U3WA 2VHWA 1AKWA 3UG6A 1ZH2A 3G5AA 4OQQA 3T9AA 1WULS 1Z36A 1VMEA 4ECAA 1IB6A 2YZMA 3PQCA 4TV9F 3UANA 2ZYDA 1VP9A 3C6BA 1IXYA 1QRSA 3AVQA 3QLEA 3RT7A 3TQHA 3DEKA 4KXNA 1X94A 1UDXA 5BUZA 2E8OA 1T10A 3ID6C 4R8SA 2VJ4A 2V4RA 2XY7A 3SR4A 4EATA 3GAZA 2FRVA 2Y1JA 3KVRA 2HHHB 4OX9B 1Y0BA 1D7OA 3EBOA 5KFNA 1Y4DE 3EEOA 1JR3A 1U31A 7ICNA 3AUOA 2ES4A 5ALPA 5KVSA 5E6RA 5WRFA 2GFHA 4J0FA 2BSXA 3CA8A 1P9WA 2AC7A 4YALA 1XZFA 5I8ZA 1ZQKA 4P33A 1OTHA 2R7KA 2GXQA 3EA4A 1P6XA 3CKLA 5LP6B 4L2IB 2DCUA 1M0SA 3GI1A 1A9QA 5E0OA 1LBHA 1O54A 2AI3A 3E70C 3ZPXA 3KNZA 5KREA 3AEYA 2EEPA 2NV3A 1ZD1A 2H1CA 1XRJA 4BN0A 3KZOA 5DQIA 4HAXA 1DC8A 1POXA 2YIJA 4Z3OA 2WU8A 4MVJI 3MJSA 2V7PA 1WF3A 2KJQA 5IJAA 2E3JA 4MRSA 1WOYA 2P2ZA 1SMKA 1Z3CA 4OHZA 4MV1A 3KT8A 2ZTMA 2NACA 2HDHA 3PEVA 1T5HX 1J00A 4RGQA 4MFFA 2OWEA 1HEYA 3UQZA 4GOMD 1ZW1A 2Y05A 3QKSA 2OPHA 2MYNA 4BZQA 4JJ4A 5KT5A 3OHMA 1QNFA 2W2OA 1LCIA 2EKPA 1UXOA 4ZT4A 1PUJA 5K51A 4BWJA 1JQ3A 1X2EA 2CHGA 3L02A 1IBKB 4HS4A 3V4RA 1AB6A 3FPBA 1KU6A 4DZTA 5I7WA 3GLSA 1XZGA 2AZDA 9ICNA 3K0KA 4HO1X 4EHHA 4EL0A 1AGXA 2BR5A 4DDKA 2ZP1A 3CTMA 3AT1A 2FPMA 4RNOA 5HQJA 1TQ8A 4X65B 3GLGA 3IMCA 1DAKA 2QJRA 3VC8A 5JPDA 1TJPB 1GN9A 3EXIB 3EXG2 2W2KA 2HEGA 8ICEA 4GECA 4IIUA 4CM6A 5COQA 4C80A 1KH3A 3RU2A 4O8ZA 1ISRA 4X6LA 4CTOA 3VTFA 5IT9A 5JSZA 5KQPA 5HP4A 4BIIA 4AJHA 1YVUA 1D2HA 5ETJA 5DN6D 3DDNA 4EPRA 5DRYA 2DKNA 2A1JA 2PKYX 1V5FA 3PITA 4D8WA 4O3PA 1OLUA 4Q7LA 4HYQA 1V3TA 2QY6A 1ZNQO 4PG5A 1C8VB 4QFDA 5J5VA 4YR3A 4LDAA 2YNMD 1TM2A 4Q4JB 2ZRNA 2HIGA 2VIXA 2UUAB 1OZHA 5F77A 3I6BA 3CUWA 3TTYA 4K9SA 2LKCA 1GSIA 3R3HA 1P91A 1MENA 1RJWA 2ZETA 3BB3A 2PGJA 3AM5A 4N12A 2TYSB 3H5AA 4G2NA 2DR2A 3OMWA 2ZI3A 2D7DA 5BQOA 2EW8A 2GDJA 2NZYA 3ICQB 3RRGA 4DQQA 3QGMA 3LWDA 5I45A 2AOUA 4KO8A 3BJEA 2IUFA 2J9FA 2ZB2A 4RMGA 2FG7C 1PW5A 1GCAA 4OO3A 4BQRA 5LIRA 4IQVA 1VG0B 1WD7A 1N6NA 5K8UA 4KG7A 3HB5X 4R2LA 2APJA 3WB9A 4E5MA 3IHKA 1SVWA 5TEVA 5BNTA 3LQ1A 2BGJA 4LY3A 3FDZA 4K87A 2YNMA 4DAEA 5FNVF 3A9UA 4DE5A 4CI9A 1Z2EA 4BNIA 4KMOB 3CX6A 3OWXA 4RSRA 3W34A 4NIMA 2DERA 2NRWA 3WQRA 4AFNA 4MMXB 3PXBA 3G8CA 1BCSB 1S9DA 3G6KA 2XCPA 4YR2A 5THXA 1MT0A 4YMIA 4CKWA 2IF2A 2R9VA 4AW9A 3N2GA 2ZYSA 3KWJA 1W5FA 4Q4AA 5LYJA 4LK3A 3D4IA 2OGSA 3VTZA 4D9EA 5BP7A 5JLJA 4GPIB 1IQ0A 1UODA 2R65A 4H7PA 5SZHB 1T3ZA 1FRNA 2V0GA 1XE3A 3RJMA 3P2IA 1MF7A 1IN6A 1VPTA 4F8YA 4CKZA 4HNGA 1LDYA 2XUAA 5B1DA 1PSZA 2QRKA 3DONA 3SFVA 2DSTA 3VYTB 1YJ5A 4QRHA 3WY9A 2X8AA 3H0RB 2F8TA 4B3BA 2W54A 1N2XA 5JO0A 2ZIEA 3G6XA 3OPNA 4FMBB 3EVBA 3H2YA 2I7DA 2QNBA 3T7IA 4E07A 5A02A 2A9KA 1ORHA 1VCNA 1G8JA 3N7RC 3MK31 1OAOC 4BAUA 3ZQKA 1M10A 1M8PA 4TZTA 5DO9A 4Z4QA 4AKHA 3GFFA 2XD4A 2NU8A 4MO9A 5DF1A 4D25A 1EG7A 4BLSA 4BEWA 3QVGA 5BYJA 1V3QE 3ZX5A 5AXBA 3BWCA 4WK6A 1TT5B 1HKUA 1SH7A 4Z9YA 4ITUA 3SV3A 3K96A 2K4EA 2J0SA 3IPAA 3CH6A 1DX6A 1E5TA 4LOLA 3T3FA 1HURA 5KKCA 4DC9A 5AVUA 1H05A 2B35A 3M6WA 2OUKA 2GTIA 4RC9A 2VJDA 4W5OA 1OBOA 3FPEA 1ZIXA 3OP1A 3TJRA 3ZLJA 2DF4B 1JJAA 1D3AA 1ZI6A 2JFUA 2R47A 2NTEA 2J3HA 4NZYA 5KG4A 3KAPA 3H19A 4UM5A 1JLKA 1U7PA 4Y8VA 4K05A 4U2KA 1L5SA 2A35A 2C3YA 2OCDA 4IY1A 1FNSA 1RMTA 2FWPA 4QT4A 2ODGA 3FROA 3BVPA 3AIOA 1OVGA 4CM3A 2QL6A 4I6EA 1P8JA 2X6TA 3JVDA 4ZYYA 1RQGA 1CEYA 1HNZB 4AYTA 5I5EA 5IF3A 1E2BA 5AKLA 3KB8A 3SX0A 4Q3LA 5IJWA 3V80A 2Y4OA 4YN4A 2H3HA 2P77A 1HUOA 1KI6B 5C0YA 1X9WA 2ZJYA 1O96B 2B5VA 2I6QA 3SZLA 1O87A 3DBVO 4M0FA 2IYAA 3GLHE 5JAPA 3THXA 4MHOA 5KPDA 4LGMA 3P2YA 4K9KA 2QRNA 4A8JB 1QJCA 5KQSA 5IBCA 2WSBA 5FV7A 3R4CA 3NVYA 3HFSA 1U1DA 1YA6A 1T3NA 1Z4LA 2I6SA 5KFUA 2DUYA 1E6EA 5K2MA 1YFKA 4B35A 1XC7A 1Z2DA 3VNQA 2ZITA 4OOEA 4DQKA 2QOEA 3LXXA 2BUAA 3KRTA 3TFQA 3HVIA 3P20A 2GZ1A 1VHTA 2Y0BA 5TJHA 3LYAA 3K9NA 2P9JA 3CRW1 3GPCA 1WSBA 3EF0A 2ZVQX 3AI3A 1Z38A 3Q11A 1I5EA 1TGVA 1RP7A 3TX6A 1KE1A 3IG5A 3Q3IA 1WV0A 3LIPA 4QO7A 2O7SA 1HRKA 1MO5A 2OV3A 4N01A 1TC1A 4B4OA 1ZJJA 2JGDB 4JK1A 1VJ0A 2DFPA 4P4PA 1CZUA 4Y6RA 1BDIA 2AK3A 1SD5A 4TZKA 1RYRA 4OJNA 3LE8A 1A7JA 2QAGB 1PJTA 4YJDA 5J1SB 5IDXA 2P7HA 1XK6A 4QWMA 4H7HA 1HFJA 2OC9A 2BDEA 2XZLA 2BLNA 1QCKA 2E8MA 1O94C 4RSGA 2GUGA 4TYQA 1OXSC 4QZHA 2ZKLA 2EG9A 4TUYA 1DMSA 4IRKA 1EIZA 4ITRC 5BOMA 3DL2A 1SQGA 2Z30A 3W8DA 5I7RA 2Z4RA 4PVDA 3ILVA 1R27A 3K5IA 1ORTA 3UJCA 2Z7JA 4Y6QA 3FVRA 3JQ7B 5TMEA 4ZTUB 2REOA 3F6PA 3GV8B 3Q0EA 4M9QA 1Y4AE 3AI7A 4RJ2A 1NYRA 4QLBA 4CN8A 1DJOA 2QN9A 1M2FA 1XA3A 1B74A 1XZHA 1Y9EA 2HHJA 4IIEA 4WXMA 3HEMA 1T2UA 3RAQA 1KH1A 4D3DA 3B1VA 2YMMA 4WXEA 3HJNA 9ICSA 1ISHA 5FOUA 1NSTA 5DP1A 5UKDA 3NVVA 5K8IA 4RJLA 4QJFB 4RZIA 5B57C 1WE2A 3RUDA 3BEOA 3A6KA 3GLIE 5IJ9A 2BUCA 3E7DA 5EEHA 1Y3BE 1K8QA 1XDSA 2AMLA 1U5CA 2ZCVA 4N8DA 3L0DA 4C0QC 4UAYA 2EW2A 1SOUA 3D59A 5F23A 1EWYA 4B7ZA 4QBKA 2F1KA 3KHSA 2VYND 3GGOA 5A5FA 2P9QA 3VDRA 4IVRA 2BCRA 1ZNXA 3ZWKA 2EANA 5FWXA 3VU0A 2ECOA 4CIWA 3OZDA 2Z2IA 2GPAA 3CR3C 3HCDA 5A0LA 2Z8XA 121PA 1K5DA 4INPA 4X1OA 4BCBA 1OI4A 4K9DA 1AA9A 1FUKA 1GR0A 1VYTA 4J0GA 5B2EA 4RMHA 2P69A 4TVKA 4RD3A 3I9FA 5BO5A 5LFAA 1T4BA 4TRRA 2VRCD 3LGAA 1DRGA 3ZE2B 4EBFA 1QS0B 1BNPA 1TZKA 5KFXA 4LFBB 3COWA 1B0XA 5J1TB 1YIAA 3ZCSA 4EPYA 3UXMA 1VIMA 4Y1FA 2JFBA 5EHNA 5LN1A 2X41A 1SRRA 1CP3A 3GIDA 1D0VA 5CT8A 1XXLA 2CSXA 3SAHA 4WL0A 1EJ2A 2JH1A 3IHQB 4FEEA 4A6EA 1SHKA 4UVGA 2M9MA 4J7UA 2DUWA 4B74A 4OF4A 2ZSFA 1IUNA 2WYUA 5BR8B 1I94B 5HF6A 2P40A 2IPOA 1U7TA 1XELA 2D7JA 4QWBA 3UB2A 1Y5RA 3ISTA 2JI6A 2FFQA 1KOJA 4NH0A 3U9LA 4G1BA 2R8XA 5C37A 1XMPA 2W9CB 4O25A 4Q6BA 4J9KA 4GBJA 3K9BA 3K1JA 5DYYA 1XRSB 4X85A 3VVMA 4R3UC 3AR5A 3ABIA 3WZMA 5J2TF 4RM3A 1LW7A 4HWOA 2HCJB 4CLRA 4DBZA 1SUSA 1B2LA 4BO0A 2FVXA 1E1CB 1C7YA 1AM4D 4ENSA 1Q0TA 3FMGA 3QU7A 2VS1A 5DNAA 1SIWA 1FRFS 2XYQA 2QLMA 2YWFA 2QNIA 1JQJC 4K81B 4AJJA 1YQWA 3A28A 4D4LA 1YOVB 1TD1A 3AEQB 1EVIA 1E6LA 4CCSA 3FSEA 2V6JA 2WR8A 1NVDA 1NBMD 1EZ4A 3DCIA 3U0VA 4V24A 3KDSE 1XP8A 4ZU3A 3QWHA 1W8IA 1M73E 4FONA 2H3QA 1TCCA 2QI9C 3QE4A 2I3AA 1Z2CA 4IG4A 1C4OA 1W85B 4NDAA 4LJXA 4NLNA 2C4NA 3O73A 3PQEA 4OQEA 1FSPA 3PW7A 2QLJA 2AJCA 3UMRA 8ICPA 2CVFA 1NVXQ 1AGYA 3GHYA 4ZZ0A 3HI6A 3QSYA 3QIVA 4J76A 3IBTA 2XADA 1PFYA 1M5TA 3SHWA 5CLJA 4RQMA 4BMOB 3GIIA 4WJ3B 2KI5A 4LV8B 5DGDA 4LUCA 1CQZA 4PAQA 4AVYA 2AXNA 4ED7A 2BFDA 5C32A 1NBMA 4LKRA 4D8TA 3AI1A 4K2AA 4EFMA 2IPAB 3E82A 2YZ7A 1ZJ5A 4XB1A 2J3JA 1Z07A 2PUJA 1GU7A 2XKJE 1KYIA 5EKUA 2VWHA 4YRPA 4QZBA 1N32B 5CP2A 1K2WA 4F60A 1ZKDA 4DNQA 1DXQA 3C29A 2QTRA 4XYBA 1ZU4A 1YI0A 2WKSA 3MHPA 4FD2A 4U8GA 5GGXA 3OAAD 2K2QB 3GUZA 1X9SA 4CU5A 1Z6GA 1HL7A 3TLKA 4PGYA 3PUWA 1OZGA 4XI9A 1AV7A 2Y1WA 5IAJA 4NWIA 1ZLYA 5CAEA 3B3FA 2WLTA 3T7SA 4Y1GA 1J24A 3N53A 4YACA 1VLZA 2O0KA 4Q16A 4G0WA 3IUBA 4FOOA 4E5PA 1Z0KA 4BJ3A 4Q82A 1A4UA 5F9NA 2BEJA 2AJDA 4MINA 3T79A 4P6VF 4R9UC 2JGMA 4ZWNA 3KU1A 4NS4A 5CH3A 4EECA 1VIDA 2G36A 1L4GA 3O2JA 3W7AA 2UDPA 3PK0A 3MBYA 4QNMA 2XIJA 4M9NA 4XOUA 4MLDA 4RTSA 3OHAA 1QYXA 4RDIA 2ZZMA 1PV2A 1BNCA 5U9CA 3TQ1A 1V16B 1MC8A 3TTVA 3W5DA 3OAAA 2N1RA 1RZUA 3QV1A 1IHDA 4ME6A 4X0EA 3OHSX 4RY2A 1PF7E 1NVGA 2JFGA 1C80A 1WPXA 4LF4B 1S3FA 4OAPA 2JH9A 2RHOA 5K3DA 1Z4PX 2WMYA 5U4QA 1V7PC 1T5LA 2YV3A 4X8OA 4OJYA 1M6WA 3TFRA 3EWAA 4JUAA 2JZNA 5IKEA 1NV8A 1UJ6A 2O2DA 2G5PA 3W6UA 4FU0A 4LHWA 5T8KA 4FW9A 3COJA 4BKRA 3MHTA 4NL4H 2ZRQA 4FC7A 4LXYA 2D00A 1W30A 1MJFA 3PL5A 1NVMB 3WIBA 3KU4A 4PSAA 5FWYB 4RETA 4YJ3B 2CSUA 3Q8RB 3RSOA 2IYQA 1WCIA 1NKCA 1WZUA 4AUMA 1V45E 4MAFA 2W90A 1FYEA 4NFHA 3DOFA 4BWFB 4O4LA 3FMVA 4KLGA 1TK0A 2ZE8A 5D87A 1F06A 3MZ0A 3PJDA 1SZJG 4MVJH 2ESRA 2HQBA 2R8IA 2I34A 3V1UA 1B0ZA 3K71B 2GGSA 3BZKA 2WWTA 3IBCA 3CZ5A 4D26A 2IE8A 4CCYA 2RGBA 3TMKA 3LQRA 3SIXA 2RG1A 3K32A 3M70A 1E1DA 5DB7A 5DBEX 4GMDA 3AKDA 4CMAA 1N92A 1ZA1A 3G2NA 4I8IA 4O8CA 2E1PA 1VP3A 2C83A 1ULTA 2QJOA 3WB1A 4Y6GB 1QLWA 4JASB 4BLTA 4LHVA 3IEKA 4RFVA 4DA8A 2PAAA 4LZZA 4TKLA 2XNDD 1ZIYA 1J1IA 4YCLA 3NUGA 1U48A 1KK3A 4LZLA 4JMLA 2EAMA 5M5BA 2F8MA 5MN5A 4YJ3A 1P2VA 3H16A 2DBVO 4ROSA 4J9OA 3VR3A 3SBDA 1GGKA 3SC2B 3UN1A 3FYSA 1T0PA 2VUSA 1VIVA 2R6R1 1R4AA 2Y1IA 4LGCA 4NJOA 4IHKA 3I1JA 5GVRA 2QVZX 2Q1TA 3A0RB 4FK8A 2VDLB 1F4PA 1NP6A 4RH1A 4JQZA 3C3AA 3MSXA 4UW9A 3X1YA 4RPYA 3AETB 4MS1A 2CD7A 3H8MA 3IAAA 3K31A 5DGAA 2DWOA 5BMVB 3TVDA 3CNLA 1JXQA 1WDMA 1TNDA 1NYLA 1A2QA 2QQGA 1DOAA 1SWWA 1YRBA 4JOBA 5BN1A 4M0MA 4OI2A 3CBGA 1PK7A 2CMHA 1R16A 1E6CA 4JGBA 3QXSA 4N7MA 3RFCA 2CLCX 1VYHA 3RNLA 4F7DA 4IIYA 1OVMA 1SGGA 3QFRA 4B9EA 2DPLA 1EVYA 1U3FA 2D2IA 2G4CA 2IJGX 5BOSA 1FXWA 2GEUA 1TYAE 4ZV4A 1NVKA 3FOZA 4MWSA 2QX8A 3IESA 4WQMA 4WEOA 2EATA 3EULA 4FZJA 4B9SA 1P18A 3T0GA 1EE2A 2I2BA 1TKBA 3UJAA 2DBZA 1JJBA 1DIOB 1QK5A 4UBJA 5TGDA 1SEVA 4DIOA 2V6BA 4AULA 4OQNA 2R44A 2QN8A 2OFPA 1J39A 1Y1QA 1S96A 2DFLA 3KXDA 4FS8A 4QZAA 4YD2A 4BHTA 2Q6VA 1V7CA 5IDVA 2W8BB 4L3WA 4XH9B 3EG5A 2ONCA 2F1RA 4B45A 5GAJA 2ZPUA 1H85A 1OZAA 1Y1SA 3C3WA 4PQGA 1GA6A 1YONA 3O93A 4FFBA 5C3MA 3I62A 2CJWB 4D97A 4II3A 4O4JB 4F2SA 4CKEB 3DBLB 1UT8A 4PTLA 2CLFB 1EJ6A 1N61A 4BZXA 4XYGA 1YH3A 1KEVA 1OPXA 3GNSA 3ICEA 2BPFA 5KFZA 1XNJA 1NX6A 5BVHA 4P3OA 4LF8B 1GQOA 3NAGA 3UCXA 4BVAA 4WRRA 1IHYA 4RQ3A 1DWUA 4AS1A 3GBVA 2AWOA 1I32A 4XWYA 4TMYA 4KOAA 2D62A 4KO1S 1NQ5A 1HDOA 3OJFA 2Q9UA 4Q9HA 1KFCB 5HMMA 4C1NA 1E3JA 4MVJD 1LF5A 4JBGA 4X7MA 3SKYA 1C5KA 3B6MA 3ZWVA 5CDHA 4CJXA 1BXRB 1WMAA 1HC7A 3ZDYB 5A4IS 3PF8A 4AZVA 1YIDA 3REOA 4YMMA 4MPDA 2XMCA 4OXKA 2FWNA 4PZYA 3MGBA 2KTQA 4YIHA 1SKWA 5FPKA 3FNGA 5FLYA 3FSJX 3CLHA 3SQNA 2PCJA 4RT2A 3AONB 1A9XA 3A4IA 2YZ2A 2DCMA 2EKQA 2PYIA 1NLMA 3DEYX 3JV7A 2QL5A 3HJEA 4G8BA 4CG1A 5CVEA 3OQ6A 4CKCB 3M9XA 1I4DD 4H6XA 4K3UA 3L6RA 4B5KA 3MD9A 5FUMA 5IYZB 2WVGA 4DT1B 2DUNA 3AEVA 1U8ZA 2A5JA 5H3HA 3B1WA 1RTTA 2EH9A 4WGFA 3R3ZA 2HO5A 3L84A 5DSXA 1PT7A 4QZFA 3GMTA 5B58C 1XO0A 4URYR 2COEA 2PM8A 3DOJA 2HCFA 5ITZB 2FMKA 1A1SA 1QM5A 3HU5A 5F51A 5JSHA 4RT3A 1NG9A 2PRZA 4W9MC 4GMXA 3V2UA 5TQ0B 1DRWA 1P60A 1PT8A 4PX3A 3Q7TA 1U0HC 3FPJA 2ZYTX 5JBNA 4XVQA 1RXIA 3P9KA 1B8OA 4G4JA 3X1KA 1Z3IX 4UNRA 5CBPB 3UUGA 4G1UC 4RHXA 2O7VA 3JYPA 5JMWA 1XU9A 1E0AA 2O1SA 3JAMA 1DUIA 1EDDA 1ESEA 5C1IA 1DLJA 4KBYA 3QF4A 4IOJA 3TSYA 1DWQA 1B00A 4JIGA 3HFRA 1YZ7A 1P1RA 5T64A 4Z9XA 2LI6A 1VHQA 5J4LA 3CO5A 5IYZA 1UUFA 2WUVA 1B8UA 2NUPB 2D1SA 5CPBA 1MLDA 1KOFA 4WLVA 4OLAA 3LQ2A 1JUDA 4J9NA 1QANA 4GZ5A 1PAUA 1IUOA 2NRZA 4IQFA 3WL3A 4BBZA 4DY6A 1FB5A 1WVGA 1F38A 1H2ZA 5M34A 2J5BA 3OEYA 4H31A 3PHIA 1I33A 4ROTA 4IVPA 4JVMA 2W6JA 1LK0A 3T1NA 4MYSA 4YVZA 2F8LA 1Q91A 3MMPA 1RI2A 3CRZA 1MOPA 2AEFA 3FFTA 3FHTA 3H1AA 4E51A 3IPXA 2HCRA 2Q1SA 3FKSD 4KNWA 4MP3A 2V3CC 2P8JA 4M9GA 2FLLA 1Z13A 5L8VA 3TNFA 1D9FA 1ODKA 2RBKA 1H1TA 3R8XA 4KXFB 3SHOA 3GPDG 4V2UA 2JI4A 1CUKA 2B4TO 2ICAA 3EIEA 2HSGA 2JGKA 2VFAA 3EQ2A 1DO0A 2H9YA 3ONEA 5K2OA 4YJFA 3FMFA 2OEHA 1N5LA 2ZPAA 4C01A 5H83A 2NQ8A 2ID4A 1UOOA 1T1EA 4KLJA 3OZCA 5HR6A 1D8YA 2O8FA 8ABPA 3LQYA 5EMHA 4I50B 1OLOA 4ECTA 1VGQA 3S1AB 3WXBA 1URPA 1ZOOA 5D5PA 3LC2O 4DY4A 2DOKA 5IN4A 3UT5B 3GA0A 4M0LA 4TKVA 1C7QA 1ZCJA 1VCMA 4I46A 4FI3C 3IOYA 1KEKA 5A9SA 5KQRA 3H7IA 4N0EA 2P2YA 4OIFA 5JAQA 1HDYA 2WQ6A 4BNTA 1PT5A 3FKSA 1L4NA 2YICA 4IYRA 4FGJA 3UAXA 5DM60 2PD4A 4HRAA 3BZWA 4HQKA 3VCBA 4F5RA 2PI5A 3BXOA 5K4AA 3V4FA 3WWZA 3AEUB 2C7BA 1F48A 4ELTA 4B9TA 5KHOC 1HOXA 1L7EA 3GH1A 4R8VA 2IEGA 1MFZA 2LD4A 3PNYA 2HHQA 1N3BA 2AT1A 2ZR7A 2XA9A 1T0UA 2P2NA 2OFWA 3O82A 4HDNB 1QTQA 2C88A 2H7YA 2ZBGA 4AKTA 3VPHA 4JV2A 2PFPA 3MWKA 1OBHA 1U49A 8ICZA 2BEUB 2QTWB 1M7HA 1ZGHA 3MCAA 2NU6B 3QWBA 1T0BA 4GNRA 4QHYA 1BJKA 4F04A 4QXPA 4XSVA 9ICUA 5IJXA 3ZZNA 3I5AA 3K2EA 2VJMB 1O5IA 1Q14A 2VUIB 1J1ZA 2Q45A 1AU9A 3DNFA 3TLAA 4M1MA 2EKZA 4E22A 5TPWA 2EHJA 4IXMA 5E6SA 4TM8A 2V03A 2PRKA 3TIVA 1ZQQA 3OQHA 3OQIB 3A32A 3IO5A 2JIMA 1VG1A 4KTQA 3O4JA 3QLVA 1H0RA 1NMYA 3OF2A 5KX5B 4YAEA 1W5SA 4QYMA 3AB3A 5GONA 3V4LA 5DG7A 2PI4A 1V7ZA 1OV6A 5T4EA 3C7CB 3IDQA 1ADFA 1WETA 4W7SA 3O0FA 5E1BA 2ZT5A 3PJEA 3SYLA 4XTCS 5A6SB 3K9HA 1FS6A 4F84A 1UPAA 5DNCA 3PDJA 1AQIA 2BCUA 3TR5A 3AXTA 2C3PA 3THSA 4UD2A 3K2QA 4N65A 2COKA 5LQCA 1P1BA 3QF7A 1MXFA 2XMBA 1XAIA 2VTEA 4K6KA 2D59A 3FSGD 5HDQA 4BTLA 4KGXA 1LK7A 2HSJA 4MQ5A 1IG6A 2LCIA 5DEIA 1IY8A 4GFDA 5K0TA 2EL9A 2O4UX 2FMQA 4GKVA 5FO1A 1IJKA 2QB1A 3WYBA 1D5CA 5TV2A 1XYGA 3ETGA 1WNTA 4E2YA 2XVXA 1SXQA 5E8JA 3WLOA 1T5DX 2ZTLA 1KETA 1DAFA 1T3TA 4QVGA 3KTAA 3LZ6A 2JPDA 3T5JA 3JALB 4TN5A 2BONA 5F5LA 3HP6A 1FP2A 3ND6A 5KX5A 4X6YA 1GPMA 1CQJB 1JHRA 2CCGA 4O3OA 2H3IA 1MQ3A 3AERB 5ER9A 2MR5A 4J4BA 1QSYA 1RAFA 5HM8A 5KAIU 3QPDA 2XGQA 4HWTA 5B3LA 1YHYA 3FH0A 4TLCA 2BKEA 5CR9A 3L7BA 1FBNA 1OXBB 3HZZA 1Z34A 3CINA 4HWKA 2B69A 1CPYA 1QCCA 2W2QA 1N48A 2YJ4A 3ELBA 1YB5A 1V8OA 4WWHA 3I37X 3EDCA 1YGYA 4BKMA 1J2YA 3CVWA 1BTOA 2DGDA 1KVTA 1VJGA 4JBYA 1D04A 1G1AA 4AKGA 1SUDA 2FF5A 1MX1A 2ODNA 3OLWA 3R6TA 3IR5A 4BPRA 1L5HB 3RK0A 1KRWA 5ADHA 4K9RA 2FUG6 2AQ0A 4QFMA 1SXPA 3HK2A 1OILA 4HQLA 1B6RA 3GJ5A 4G0XA 2AYZA 4H0CA 5BYKA 2ERYA 2XRMA 3KX2A 2VSFA 1MRZA 4KWIA 2C5LA 1T3SA 2ORIA 2Q3MA 3AF0A 3NRBA 3QWAA 2B4KA 2OCPA 3TE6A 2C9ZA 5IMSA 3ESRA 4S04A 2X5NA 1LVHA 2VHCA 5CVDA 3X44A 3VBCA 2BBTA 2J48A 1FRZA 8ATCA 1H9AA 4MI3A 4KN8A 3FGNA 1PR0A 4EARA 1G2OA 1W0CA 1RXCA 1MA0A 1PZHA 2ZRCA 2QRZA 1UPXA 1E2IA 2IEIA 1KP3A 3QBEA 2FP3A 3WICA 3GK3A 5HKOA 2C54A 3HO8A 2VL7A 1TW3A 3SS8A 4WVFA 1DIRA 4L8YA 3RC8A 1U8YA 2IHUA 3HWX1 5EJ2A 5JC8A 4KLTA 4OK5A 2I62A 4A15A 2YW2A 4X1IA 4BB6A 5I7OA 4JYBA 3E15A 1OBCA 1LLDA 4BUJA 1H2BA 5BRJA 2H11A 3DD5A 4RV5A 4GRDA 2HB6A 4JSTA 4OLFA 4I2NA 3NHWA 3NDJA 1L5HA 3S7TA 2DUJA 5JISA 5C7YA 2GHRA 5E6RB 1Q1GA 4DL7A 5CH5A 1N2HA 5CA0A 1ZQRA 4NL9C 2HX1A 4JJEA 3E0QA 1NTOA 3CX3A 3ESYA 3HB9A 4PO9A 3DTYA 5MGNA 4TLMB 4PANA 5B6JA 4IIHA 2E4YA 3C21A 2POQX 3LLSA 4UB4A 4LISA 4O2AF 4GEGA 1LDGA 1KI2A 4IIXA 2FDCA 3Q41A 3N7TA 4OQXA 1K27A 1DG1G 2RQ5A 3MFHA 2R6AA 3C24A 5KYTA 2DUMA 3LYHA 3MWDA 1RYNA 1ZAKA 3PX0A 1KEWA 3V97A 3WGOA 3X2FA 5BSEA 4EQZA 3BWXA 5HHIA 3HI4A 4C7KA 5FPSA 1KQ3A 4XSGA 2D2EA 4BO5A 4M8NE 1YTUA 2E4ZA 2ATCA 4BJ1A 1DOZA 1TUGA 5JCOA 2ANCA 4DCNA 1Z88A 1KZHA 2Q7DA 3T5HA 1Z7BA 4LFCB 1FSFA 2RHBA 1BHQ1 1LSOA 5I5GA 1L4BA 4OXNA 3GGJA 3Q85A 3WLIA 3QKSB 4II7A 3LUJA 1Z4OA 4HDSA 4C0XA 1DKLA 1E1LA 3FVQA 2JG3A 2LW7A 3UUEA 1Q17A 2QIOA 5JYEA 2IODA 3B1KA 4HQOA 1QRAA 5HOEA 3L8MA 3LWLA 3KSBC 3P2JA 2KVCA 2X0RA 1PP4A 5LKAA 2J33A 5F5NA 2ZIFA 1C7FA 3CLRD 1QTNA 2AV6A 5KSYA 1RJFA 1SBQA 4G41A 4C0ZA 3OIWA 1ABFA 4BX9A 4EMUA 2YJNA 2WJWA 1E2EA 1NVFA 2IH5A 3DZFA 1LDNA 2ZR8A 1XNSA 4BLVA 4DLLA 3TD6A 3VOAA 4JT4A 3GLGB 1A3CA 1YIOA 3GIJA 3AY0A 3D7RA 2B98A 1UPUA 1QFYA 3LP5A 2K4IA 4XXHA 2EAUA 4BV8A 2W2KB 4WX2B 2XE4A 2D3TA 3X0DA 4R3WA 5JSZB 1YDWA 3K5WA 2POCA 2I6UA 2Q8PA 2ZOSA 2VH5R 2OM2A 1DBSA 2M6RA 4FHZA 2D1TA 5HFNA 1KGDA 2D1QA 2A1JB 3J81A 3CCBA 4ZCLA 1L3SA 3V6JA 1T36A 1OLUB 3P26A 5DHFA 4PLCA 3GCZA 4MUFA 3G2OA 3ETHA 4RPLA 4QTUB 1HKHA 4JUCA 3C7KA 5DLEA 1UBJS 4NK5A 3OBIA 5EIHA 4YR7A 3L6EA 3UMGA 3PJGA 3VPAA 1YRHA 3EZNA 3IELA 1M2VA 1NN1A 2JXJA 2AOUB 1Y80A 3VKUA 1FQKA 2J9FB 4WKGA 4X24A 5IU6A 1NZPA 5BSGA 3TTWA 1MVNA 4Y2UA 2IY8A 5DLGA 2QD5A 1JHOA 4A0SA 3LYLA 5BOVA 1GR1A 4JBLA 1H2EA 4UREA 2V9PA 4RHYA 3FDZB 3W7VA 1SUFA 3TMAA 3GFQA 1GPYA 3DMYA 2DM6A 3USCS 4QAQA 3QRWA 3KYIB 3E03A 3WRVA 3O4IA 4IS7A 1K4MA 2YWCA 5AUQA 4EHBA 2GTHA 1BDBA 3GCDA 4P2GA 4CKWB 3KKZA 4MDYA 2EBFX 3BAFA 3N2GB 5F98A 3EIXA 4Q4AB 5LYJB 5C3UA 1PS9A 3LZDA 1DOHA 4QDOA 2FJ6A 2PMZF 1JQKA 1Y42X 3DAGA 2QJFA 4B80A 1VDMA 1BYUA 1KJ8A 1E7RA 1AB5A 3BK2A 4HLDA 3PIDA 1L7RA 3M4JA 3P2KA 3VV2A 3C8HA 3FZEA 1L5WA 1BS1A 2IPNA 3ZZTA 1X6IA 1VC2A 4AL4A 4OP2A 4BVEA 2HOQA 2ZRGA 5IFKA 3KT6A 3H18A 1MT3A 2XBMA 1SUAA 2BR4A 3V2HA 3IEPA 5KFSA 4F72A 4R7GA 4G81A 2BJVA 1GILA 1V39A 1E6KA 5DN6A 3OX4A 3K94A 2PX4A 5E1DA 4MVJM 4DIMA 2JAOA 2NZJA 4H08A 4MI9A 3AEZA 4DSAA 3I0MA 1WPQA 3KOYA 1GTG1 5CB1A 2C3MA 5ALMA 2NU8B 2YIDA 3G8AA 5KFHA 1YDGA 4HNHA 3RUFA 3QVGB 1OREA 3HUUA 2A7XA 1K3UB 1XTKA 5KT7A 4XCVA 4TSKA 3R3UA 2ZDQA 1DJQA 4C89A 1RWWA 3GG2A 3FBWA 1TCBA 5JECA 3HGTA 4KR9A 2HU5A 4PPNA 1UPFA 5T4BA 2PXHA 4RPJA 3Q0IA 1C0KA 1JI3A 3WKEA 1R9NA 4KQ2A 4Q21A 3OFND 6GPBA 2C1EA 1ZW6A 1J2TA 2GNOA 1QSGA 2BFOA 1PJCA 2XUQA 3IUNA 4J0CA 3L6CA 5BWLA 1XD9A 4R8RA 5FA5A 3LO5A 5DLPA 2GAJA 3L0SA 3PC6A 3A9RA 1XMXA 5IUKC 3F46A 1QGOA 4B87A 3ZW8A 2G9UA 3OKFA 4YJKA 1TTPB 3IURA 4CQJA 4KKVA 4RU9A 2G8NA 2OCGA 2A1IA 3DAFA 1NW8A 1G2QA 3QWIA 1YZVA 4GI2A 4D80A 4NAHA 3CUSA 2JAHA 2HT6A 4I0WB 2DWPA 1ZQIA 1UJCA 2WUWE 1OIVA 4L8LA 4E30A 3I34X 1E66A 3H4IA 4X9XA 4ZOHC 3CISA 2J59A 3AN1A 1DAPA 3AKEA 2YVLA 4ER0A 4YRRA 2RIPA 5TGZA 4DLXA 4HT3B 3OFNA 3I53A 3C1OA 1IXRC 1O0SA 3ZZ0A 1GN8A 3WGYA 3CWQA 3THXB 3KDAA 2Q07A 1IM8A 2QMHA 2H0AA 2P3SA 4NH4A 5J0TA 4AF7A 4BLUA 4BO1A 5AW4A 4UFOA 4ENPA 4DSOA 3OO1A 1H2WA 1KSHA 1ZHFA 1IB0A 1T9BA 3NZEA 4N18A 3VGPA 1EK5A 2PNJA 3DF7A 4UZSA 3GLKA 4QUIA 5JZ9A 1DADA 1ODSA 4FSXA 1L5MA 4JVNA 9ICIA 4J9QA 2YB1A 1HLGA 2P1DA 4TT3D 4OJLA 4D4IA 3V1NA 3ML1A 4DRXA 1Q2XA 2Z3VA 3CRQA 3VDMA 2QMYA 1Y3IA 3R7WA 1EUYA 4G89A 2NWQA 3ZV6A 4OHRA 3FJ1A 3S1SA 1IHUA 3KVVA 3NBXX 5HXAA 1RXEA 3I72A 4NENA 3QI2A 3BHIA 5JJ5A 3PX6A 2HDWA 1F7UA 4G1EB 4GMHA 2ABWA 3NEYA 3TB4A 2EU8A 1B6GA 2EJBA 2QPOA 1LXCA 4Q5IA 1ZVMA 4EELA 1PFGA 2KLBA 4O5CA 1JYEA 1J99A 3WA6A 3LBHA 3GJ4A 1KZGB 3GLUA 1VHLA 3LBAA 5LQJA 1DDOA 2MU1A 2PH3A 1YJBA 4LF5B 4ISCA 2H6EA 4TSRA 2B34A 1QG0A 3RS8A 4QOJA 4GX0A 1ZYQA 2GD1O 4G63A 3C1AA 5FA6A 1RPTA 5AW9A 1BIFA 2F76X 1G8FA 1A4XA 4TUYB 3F98A 4QYTA 3V4SA 1KI8A 1A7AA 5DE3A 4I55A 4DV6B 3L7JA 3ANMA 1YUNA 3UXOA 1CRWG 4ED9A 4CMJA 5GGYA 4R2WA 2XOXA 4GPD1 2IVFA 4ZQFA 1CEQA 5B66U 3O8RA 3RJ5A 5C52B 4ZICA 2HJRA 1EWQA 2R68A 4IO1A 3NH6A 2BE9A 2CW5A 1KQNA 2MDTA 3VPSA 1N6KA 4HP8A 3WGKA 3TI0A 3QX8A 1BRMA 3K7EA 5C4MA 1Y81A 4IVNA 4RMIA 2DPMA 1EP9A 5IJ9B 3CXUA 3MTAA 5F1OA 4HEQA 3QG5A 4E88A 1RFGE 5CYPA 3GFTA 2AN1A 1J9EA 2LXNA 3KZ1E 3ZZUA 4K40A 1Q6ZA 3RBZA 4FFDA 5FWXB 4CE6A 5ARCA 4R7ZA 4JI4B 3VH3A 2E4UA 4OEHA 1Q0LA 4PGGA 3ES9A 4RE5A 3W1EA 4YCAA 4Y2RA 1CIVA 4DS3A 1JFVA 1HSZA 4BC1A 2K2WA 4RK5A 3GL9A 3PNOA 1UP7A 3VOBA 1AK9A 3R20A 4WBXC 1JJFA 3CT6A 1BMFD 1RWQA 1P2SA 1QHSA 5CYGA 2CY0A 1AQLA 4CW7A 3ESAA 3FFAA 3GVIA 2IBSA 4QXMA 2YMLA 3G6YA 3JVUA 1QNLA 5IRCD 3RK1A 4ID9A 3OZEA 5I9IA 1E20A 4R0VA 5IM5A 2ZTHA 3WK8A 2B6HA 4Q1DA 4AF8A 1CT9A 2QM0A 4D6YA 4XPIA 4HKTA 1E7WA 2DH6A 3NTVA 5SZIA 2RGRA 1NK9A 3UXNA 4TS4A 4DUZB 2BRUA 3OPYI 4RIHA 4IM7A 4Q34A 5F73A 1RQ7A 1IJFA 1E3MA 4X6UA 4MOWA 2B7CA 3UJ3X 3ETDA 5IVDA 4MUAA 9ICLA 2W2VA 1HNWB 4IDCA 3NHMA 4MUGA 1EK2A 3R09A 1CNMA 2J07A 4EJSC 1BMFA 4IJWA 1XF1A 2VHYA 3LCRA 2FW7A 3TW4A 4MF2A 3B51X 4W5NA 1TQ4A 3LPAA 2GCNA 1QVAA 4K9MA 2HQRA 2H4HA 5D1NA 3R8FA 5GPBA 5B1IA 4MKZA 1TKAA 1O97C 3OURA 4J94A 2E8PA 4QULA 1TIKA 2RGNA 1HZJA 4FNOA 3HLYA 2F43A 3PMLA 3BQ9A 4OG2A 4AJOA 3S70A 3P96A 4CLRB 3BS7A 4OM7A 2QSYA 5HFJA 2AZXA 4BNDA 4DM3A 5LLTA 4TZ6A 2VYNA 3PYLA 3KOMA 3PXDA 1B73A 4WADA 4Y6OA 3WNQA 4AP9A 1IUKA 1JRPA 2LRHA 4CVNA 5KTOA 1SR8A 2DF8A 2G7ZA 2WTEA 2HRZA 4D0NA 1BWRA 3C1YA 5T14A 1GAEO 2AI2A 4B4DA 3AU9A 2ZS7A 3G79A 3LI2A 3M6VA 2I7VA 4R1MA 1HDRA 2VXBA 5DI9A 1T94A 4OO1J 2JHFA 3ABZA 3D7MA 2XIDA 2VRCA 5MGBA 1XU4A 3OIVA 3QMWA 4AJKA 1H2FA 1J8VA 2ON6A 2HF9A 2QTMA 4BJ6A 1Y7HA 4B85A 3RFAA 1XEAA 3CLTC 5FFMA 2ZAGA 2X1VA 1U0SY 3QOWA 1Y4UA 3BGDA 3F4LA 4POAA 4TYPA 4TLLB 4PONA 4PGXA 4HTAA 4IGKA 2XYVA 3GRRA 4ZCMA 4JP1A 3HJAA 5DX0A 3Q9LA 5I47A 4FYPA 3DMGA 1G5TA 2QARA 3RJTA 1I7DA 2UAGA 4PR3A 2BFDB 2JI9A 2PMCA 3IKVA 1G4AE 4JVOA 3IAHA 1NK8A 4QW9A 3PNVA 2IGTA 3TL3A 4CRWB 3SVTA 4K9PA 1OH5A 3DKRA 2JLUA 2X3UA 2QGZA 4KLDA 2YIVX 5DXJA 2O5RA 3ECAA 3OX2A 2DULA 2ODEA 4RQ8A 4L0DA 1ETUA 3CUUA 4QU0A 3SQIA 1WYGA 4I2CA 2J5QA 3T3HA 5IM4F 3HP7A 1QE3A 2OCKA 1UQRA 3H7AA 4DDWA 4UE6A 1SC9A 3Q8MA 1NXQA 5CAEB 3P9IA 1PFWA 1P7CA 2FSVC 4ETIA 2IHJA 2C4MA 5DZSA 3RUEA 3ZBQA 2WIJA 1SHTX 1GL6A 3S40A 1X66A 2E0IA 9ICCA 3O8LA 2QDXA 5MFZA 4P5DA 4FGWA 3OCXA 2CZQA 1DJLA 1M1XB 2WM2A 5FFNA 4L9AA 4GX2A 3A1NA 3G9TA 4ID3A 3O4HA 2X40A 4UVEA 2D0IA 2AXPA 2WM8A 1SVUA 4KWCA 3VJRA 3OT5A 2ZW9A 5BN5A 2MCFA 3C48A 4FS3A 1GTSA 2WOJA 2P8SA 4UBMA 4Y2JA 1PGQA 3QLUA 4A10A 1VKOA 3GGPA 1IAQA 1LU9A 1NVBA 2LR0A 5JC1A 2XUOA 4JLDA 4BNWA 4D45A 3PR1A 1H3FA 1G8YA 2BE7A 4EAQA 3ZTYA 4X8LA 1YR7A 2F59A 1R0WA 5KKNB 2C1ZA 4KXQA 1UK9A 1YK0A 1XTBA 2DPJA 4RTJA 3UJ6A 3A1FA 2V54A 4MRPA 5CLIA 1UK6A 4HYTA 3WBBA 1IK6A 5DV9A 3HDGA 2Y0SC 2BR3A 3ROQA 5CG1A 1MB9A 1UINA 3DWEX 4BFLA 3UUFA 1W6RA 3WS7A 5K8CA 4CV0A 3AUXA 1WMDA 3GDOA 2PUGA 1IIRA 1WCIB 3R5XA 3UXYA 5EIAA 3M9OB 3SR6A 5I9LA 1DRKA 4GSLA 1VI2A 4Q03A 4QPPA 5JVDF 4DBLC 5ALTA 4TV8F 5NLLA 3DFUA 5H80A 4O4LB 1SL0A 2H57A 1CF9A 2HWWA 1SBCA 2GPJA 2RAUA 4IQWA 1NLZA 2NXEA 3VJLA 4H4CA 3M6XA 3B38A 2H3ZA 1EE1A 3IVCA 4X00A 3SX4A 1LEHA 3BK1A 3T3MB 4CCYB 4U8HA 3M5PA 3ZJ5A 4I5FA 3ZXSA 1XQXA 1FFWA 2IPLA 2JFPA 3A9WA 5AUNB 1LD3A 2GN0A 4NBLA 5BW6B 2EP8A 5A2GA 1RYEA 2AVDA 5DB6A 2HMSA 5DCUA 3PFFA 3DDHA 1O6FA 4BGUA 2G9ZA 3H0LB 2R48A 1SO8A 1CEZA 4J9MA 3F67A 1P0QA 4JKYA 1YRWA 4BNLA 1QCYA 1WPRA 1ZUIA 3II6X 1NT2A 2ZRFA 1XG5A 4C3OB 3ORFA 4L0QA 3UXEA 1EBBA 4IICA 1RYFA 2H0QA 2HWXA 1JDSA 4H7JA 4JB3A 3EEYA 1XL0A 1JR3E 1Z2PX 4MS1B 2GXSA 3AHCA 4A8PA 4XWWA 4BQSA 4P3YA 2MMCA 2Q6TA 1MX5A 1FO4A 1UKEA 1CJCA 1FLAA 3SNHA 4QSMA 4DUGD 3CSSA 1N5KA 3V8BA 4X62B 1XZIA 4BMNA 1Z2AA 4Y1EA 4MXDA 1O2DA 2QUIA 4G24A 5J9FA 1SK8A 4A8TA 1BNOA 4TURA 5A5VA 4GIBA 4BC0A 3U81A 1X1EA 3BMCA 3MYRA 3MEQA 1QG4A 5BOSB 2FU5C 4V2IA 3MBOA 1K6XA 3KQMA 4W8OA 2JBHA 3V3TA 1CVRA 1AS0A 4PINA 1JH9A 1TAMA 1PR3A 4PEVA 3OM9A 3C8MA 3ONDA 2OAP1 2FNAA 1YV9A 2FWMX 3K4PA 4KLUA 4ZYVA 5MN4A 3EPGA 4JJ6A 2GDZA 1BGVA 3LUKA 1G2PA 5E7MA 2IEAA 4G09A 1LKYA 1J2MA 4NCBA 1T6BY 4DUGA 2QUBA 4RL6A 2ZIVA 4Q3EA 1JHAA 3HMQA 3SN6A 3GY0A 1JTVA 2GA8A 2IPMA 4QPCA 1OPRA 2AG1A 3K0FA 4E5NA 3U3ZA 1N2OA 4MA4A 1NBEA 3OQPA 4MW9A 3TO5A 2J3LA 1RADA 4MHSA 2ZIUA 4Q9NA 4FNMA 2I8LA 5LZ2A 3BE6A 2XNDA 2C84A 2C7OA 3Q5EA 7ICKA 4X3OA 1ZFNA 2VNJA 1SKRA 4RSMA 2NYVA 1JSXA 2C2KA 1NT4A 5BWNA 2V97A 1VMKA 1M7BA 1MRNA 4FFBB 2WDZA 2OFXA 1ULAA 2ZI9A 5HJ5A 1VB5A 2H1VA 1GPAA 3QLTA 2OQVA 2DSNA 4L5YA 3AI2A 2NRTA 1JFLA 4ND1A 4NZMA 2D0DA 2N42A 3GLGE 1RWMA 2A1TR 3L0ZA 1Z5OA 3DE3X 3HVUA 1RS0A 1RQPA 3PW0A 1U80A 2DQYA 3HNOA 4K6OA 5BVHB 3UAGA 1QIKA 2H17A 2VHJA 1CUBA 4E4YA 1LPNA 2LP4Y 3CV3A 3KSDO 2H06A 3OEHD 3VH1A 4BJHB 4TRJA 1GZ4A 1R00A 1IATA 4HQRA 1KF0A 2O8CB 1W5AA 1U7UA 2JJ2D 1TLTA 1WXEA 4I36A 1TJ5A 1GG9A 1HA3A 1NK7A 3WOHA 3S7ZA 3A0UA 1IZYA 1QLJA 2ATVA 1EE9A 4KXWA 3U7FB 3K70C 1A9XB 4AN1A 4Q15A 3HCBA 2QMEA 4PM4A 5FDFA 1PWEA 1TKDA 2PHZA 4QAJA 4L3OA 4Z6KA 1N6OA 2O1XA 821PA 4KR3A 4JU9A 4OK6A 1UZLA 4YDHB 1W0KD 1XNGA 1ZI9A 5F4ZA 3KQWA 1WXQA 4FIZA 1ODIA 2O19A 4GVPA 4OLBA 2WJJA 2PMFA 2J7KA 2P9CA 3DZIA 4QLAA 2WSIA 2PFQA 5F7OA 1J0AA 3SS9X 3A3KA 1P29A 2G28A 2XGJA 2EKLA 3QVJA 3S8MA 1QQ6A 4RVSA 1BHJA 4ARVA 4XWKA 1W52X 2XT0A 1EHIA 3NS7A 4I28A 2O8CA 3QYPA 3DYBA 4Q1EA 2C57A 1CB7A 1ZN2A 4IGEA 2JARA 1KIFA 4OJPA 5CGQB 1L5QA 5BYAA 4ZRNA 2R0QC 3AJ8A 4JP8A 3RASA 1WR8A 5MF6A 4MNTA 2XMDA 1U9IC 2YZNA 4A92A 4C05A 2GEVA 3UK0A 1W0KA 2GBFA 4S1VA 2O20A 2OBMA 1G3IA 2V4UA 4CZ2A 3QF4B 3G23A 4W5HA 2G4LA 1YI8A 1LB1B 4F93B 4OSEA 1KK1A 5E79U 2P2SA 3FY4A 2QT9A 3OUZA 3RS5A 4UQOA 2PS1A 1O9GA 3ND5A 5B7GA 4MYHA 1LFAA 4MVJA 5ERGB 2Q5IA 4HB4A 1X8KA 4J6EA 5EUQB 3EVGA 3GB9A 4QUKA 2WAOA 4ECXA 4MAAA 3F9RA 3RF7A 3R75A 4X93A 3STHA 2WHQA 4EYKA 4ER7A 4RE6A 3TKYA 3WA7A 3CY6A 8ICOA 1QX4A 3D9QX 5FLKA 3DFKA 1XALA 1ONOA 4ZC1A 4KHPB 3M33A 2SECE 3D3EA 4EJ0A 2HT1A 5CEHA 1L4EA 2H4ZA 2FZ5A 3W0LB 5ULLA 1L3CA 4A6XA 1A96A 3LRPA 2FR0A 4RYDA 1S3SA 1M0WA 4YJFB 4NDNE 1TLLA 2OV2A 5EHIA 2ZYWX 1YCHA 4A2QA 3MRXA 4JZYA 3H6KA 4R9RA 3TRJA 1SCNE 1R8QA 1YGPA 3VV3A 2O8FB 3NIWA 4CUJA 3U4IA 3DZ8A 3NJ4A 2PSFA 2N1MA 5H4HA 4QNRA 3W4JA 1KYVA 2JFVA 4TKVB 2VJCA 5A9SB 4R9SA 4OFXA 1IXZA 3EZ9A 3EQZA 3QQPA 2MSNA 1XBTA 3K3PA 3L46A 3CLUC 3R0ZA 2VYVD 4NCXA 3I09A 1YB6A 4NCHA 3UH0A 1F0YA 4KAXA 1OV4A 4P32A 5THQA 2WJZB 3WLQA 4K9NA 2VNIA 3GIWA 3FPCA 3VR1A 3HTXA 2BPOA 1GLVA 1SV0C 4PO8A 4DFDA 2XWBF 4W99A 5AVZA 1TVMA 2XE7A 3AHEA 2GN4A 2FWJA 3QNMA 4N5MA 2I29A 1SJ9A 4EA6A 1IEWA 3EF1A 1YFLA 2PL3A 3O5AA 3VZSA 1HV8A 2G67A 5F35A 5C8DA 2IBMA 2Z6VA 3ZZMA 3HG7A 3CC8A 1YC2A 3WL8A 3LUFA 4L5BA 5GZ3A 4DNPA 1TV9A 2VKTA 1CUZA 1QF9A 1R12A 4ICIA 3WNBA 4RIGA 3R3XA 2VYVA 1K6MA 3UUWA 2A88A 3OE4A 4F2GA 4C0HA 4YXWD 4P0PA 2QA5A 3SZRA 1P4JA 4C0JA 2C7GA 2AXEA 4QOSA 3PI6A 4MFCA 5TPWB 2J9ZB 3GRKA 5E6SB 5K03A 4LSZA 3WLKX 4CKYA 4OHUA 3ABRB 3PXCX 1HETA 1RPLA 3R24A 1R2QA 1Y5MA 1Q84A 3BL5A 1T34A 2XD9A 3BGWA 1FDWA 4UTPA 3IXQA 4KHZA 3RTDA 5GONB 5K3SA 2NVOA 1ZQJA 2HHXA 2XVAA 3ZVRA 4J1TA 3PEYA 1A9PA 5A2QA 1IYZA 2ZI5A 4PR0A 3D0OA 1H42A 3IG8A 2X0KA 2GJAA 4I29A 5GVSA 1QH0A 4WECA 5J0YA 2PXIA 4QJ3A 3FUVA 1U4OA 3KQLA 3HRKA 2IU6A 1CERA 2AA3A 2DQNB 2Q8NA 2ZANA 1ZWKA 4O3NA 1R5JA 4JX9A 4CR7A 5T3UA 1Z16A 1QRUA 3TR6A 7ICFA 2JATA 3LPMA 3EG9A 5IAOA 1V6CA 2C20A 2ZT6A 5FPPA 5TT1A 3NFRA 2VK1A 3CMMA 4HGPA 2IYYA 3D4OA 2C2HA 3RSHA 1CUWA 3KV3O 3D43A 4X91A 3SQDA 3T3NA 1NF2A 4RACA 2CXOA 4KKXB 2VAMA 1E79D 1YKFA 3DL0A 3GW8A 3RB6A 4O5KA 1H6AA 3KTAB 1Q0HA 1LJ8A 1N1EA 1IWBB 1T3QA 3KOXA 4FGSA 1RC1A 3DV2A 1CY4A 5KOJA 2VP9A 1V4NA 2XSZD 4DQVA 4NYMR 4IW3B 5DULA 2H2HA 5TARA 2DH5A 2IEDA 3ETNA 3VM6A 5AOBA 1QFZA 4S3MA 4YIKA 4JI7B 3FI9A 2H52A 3VOSA 3E3MA 3BH6A 1SG6A 4BNVA 4ZZ3A 2RE8A 4YQEA 1JR6A 5EWEA 1JIHA 2JLRA 4O63O 2VAPA 2CJXA 3OC6A 1KVQA 2XLBA 3ZE7A 1XZMA 4JAVC 4K1LA 1NNLA 3BF7A 3JPYA 1B3BA 2W9BA 4O4HA 4I9HA 3M1LA 3H4DA 4AY5A 3MUOA 2C2GA 5K4HA 2PY6A 2O2ZA 3SJ7A 3IJRA 3RSFA 4FYIA 3ZDZB 1E79A 2DKXA 3HP1A 3HYCA 5KU7A 5F2KA 3AVPA 1N0UA 1MB2A 1DUVG 4R8UA 2LM1A 4RQ2A 3X1ZA 2XKKA 2XSZA 1OYYA 4RD2A 3WVNA 1RZVA 5F2NA 3RR8A 1ZH4A 3D31A 4DIFA 1EEHA 1ZJ4A 4C7XA 2XVTA 1AXEA 4F21A 1UBLS 4DYHA 3NYQA 2P1ZA 1JWBB 5KU1A 5LNK1 5TC4A 3DP9A 3BF8A 1DX4A 1KAGA 4F4XA 3QTTA 1NQXA 4UOZA 2BMDA 2VZLA 3FSGA 2FZWA 2OYYA 3UBMA 2HR1A 4N0PA 4MI6A 2C4VA 3QKIA 5KNCH 5BUCA 3IP5A 4BNFA 4Z6FA 1DQSA 3EOZA 1D1TA 2J09A 4LA4A 4HAYA 1YJQA 2A5FA 4F4DA 5KVVA 3H0KA 5EE3A 5AESA 2WZBA 5AXDA 2XH8A 3U09A 1NMXA 4XJXA 3CMCO 5KT3A 4URHA 4YBZA 5IVHA 1L2TA 4C2TA 2H1OA 5IKMA 3E9YA 1XQ9A 4LE1A 4OHOA 2QRUA 3TTSA 3CKMA 4X1IB 5L45A 2E5FA 2P9TA 2H08A 2R6ZA 5GJBA 1SHJA 2Y4NA 1JT9A 3A0BU 1WB5A 4MQFA 3KQHA 3QXCA 4MRRA 4YAIA 4N39A 5E9WA 4GXRA 1FMJA 3UFBA 2QTBA 3LCCA 3UF0A 3IRUA 4RQUA 2X0FA 1FDVA 4LDPA 3M49A 5CA0B 2EJCA 4NZZA 4JJ8A 1R0ZA 1DKRA 1KA9H 4QARA 1U2EA 1Z29A 2HRBA 5AH0A 3OIUA 5C7OO 4IDOA 1JN0A 2YWHA 1O6BA 4QGFA 4R3NA 1H6CA 4BNZA 3RT9A 1TYBE 2BMAA 4ZQBA 2C4HA 1PJ2A 1WVIA 1JBEA 3WRXA 3PX3A 3VSEA 5JE8A 3MWDB 5JI3E 4YJGA 4L5JA 4N8SA 3G2JA 2CDBA 2A8YA 1S1CA 2EERA 4D02A 3CWZA 3TR0A 4PYMA 3E84A 4OXQA 1T3HA 2JIOA 4B3IA 4XX1A 4KZPA 1WXHA 1X1QA 3GYBA 3KQVA 1JIJA 5DNVA 1U11A 5C35A 5GTIU 3TGWA 4KIWA 1E63A 2CXUA 1U1IA 1DB3A 4V0KA 2ZRBA 3E8XA 2A4KA 3LBNA 3P7MA 1PJRA 3B9QA 2KJ8A 4KOEC 2PT7A 1WM1A 4HDSB 5CIYA 4W8HA 1KMQA 4CF5A 1COOA 4M9SA 2AZTA 3KPJA 1NBME 3F5FA 4LHEA 3TOVA 5CHGA 3FE2A 3WYFA 5HS6A 2R8PA 4EFNA 1C29B 3MWGA 3RRZA 4ZT5A 3U0BA 4YY3B 4RAQA 1IV8A 1U3TA 4PQYA 5GADl 1ISFA 2M98A 3HGMA 1J2RA 1N2GA 1N9KA 3A6EA 3JPWA 2X4DA 2OWOA 4K28A 4UB3A 4A03A 2CKMA 2CK3D 2QQEA 5DWDA 4PN3A 4GXIA 4V0OA 5D6OA 3IHTA 2WRZA 2F7SA 1TM3E 1ULZA 2X7JA 1VE5A 4YP3A 3BGIA 3A1DA 3T1OA 1RBYA 2ZI4A 3H5WA 3WGVA 3DE6X 4AX8A 4FJ1A 1HTTA 2XUDA 1RQXA 1E2FA 3I30X 2D5LA 1A76A 4DQXA 5FX2A 1T36B 2ZB3A 1ZUD1 2ZG6A 4MZDA 2OSBA 2EJTA 2BKAA 3G3EA 2IF0A 5EJ8A 1PUIA 3CZCA 4NZOA 1ZQFA 1LSUA 2AE2A 2Z09A 1Z25A 5JJCA 1JEOA 1OXMA 3PC8C 2HMVA 4MJ3A 3KXPA 8ICCA 4ZVOA 1CR4A 5B3KA 1N5MA 5ALFA 4WK0B 3NHRA 1MTOA 1ESNA 5KNCD 1M2VB 4TWIA 3CGGA 3DLAA 1XJQA 2PWZA 4LGYA 2QQ0A 4YEDA 2J31A 1JECA 3RS4A 1U4NA 4EYSA 1WNFA 5J4HA 4BTEA 2IOYA 5KIAA 1HZZC 3MGVA 4LRWA 2PZ8A 1NUSA 4DL2A 2P9ZA 2WA1A 1XLTC 4YRBA 4PZPA 2UYCA 1WUTA 4M76B 1AE1A 4MUHA 1IHPA 4IDQA 3H05A 3I4LA 1JPNA 4XIFA 5DG8A 1W8DA 3L0CA 4B4WA 2VDWA 5KO2A 3H1TA 3ANXA 3RAGA 2I9GA 3TB6A 3PPWA 4L76A 5HM6A 5JSKA 5EHZA 3H3JA 4OLJA 3I8SA 3RVOA 4KDFA 1WY5A 1YBVA 4LQDA 2L2QA 1KHHA 1X38A 3N3AC 4HEJA 3KR0A 3MTEA 3ZXIA 1IZ9A 3EMVA 1CY1A 4IJ6A 1IG0A 3ACBA 1UDCA 5BQ5A 1AROP 4Z4CA 2Q5LA 3VUFA 2P62A 4UB1A 4KU4A 4AMVA 5F9LA 4B3RB 1P7PA 5FFFA 1MMFB 1QVRA 2ROQA 2Q6IA 4IJVA 4B3MB 1K1EA 1USIA 3KZNA 4FFWA 3ZE8A 2G71A 3BXPA 1L7OA 2FWIA 3IV9A 3DV0A 3MPUA 4K46A 1UMKA 2Z5VA 3CEMA 2ADMA 3G9XA 1Z6YA 4DM4A 3DWIA 1E32A 2LCFA 5AFSA 4F2RA 1NQVA 1DRVA 4UBNA 1NJ1A 4BNXA 1D0IA 1IH8A 4YI3A 3GFVA 1NE7A 1WKVA 3H9CA 1UEXC 3QTBA 1G5FA 1VMDA 3B3JA 5JV5A 5ERYA 4JUBA 5SY4A 1Z5VA 3QFHA 4KFCA 1SZCA 4RXMA 5I9BA 4RQ7A 1J8DA 4P4GA 1UMBA 3MJVA 4WZBA 1MB3A 4OP3A 1IFXA 3GF4A 3ONWA 4L75A 4KNVA 1VI6A 1IM4A 4DSZA 4RD1A 3AUSA 2LPMA 1H2RS 4MR7A 1JB9A 2VJAA 3OZUA 1Z0DA 4E2XA 4J0IA 1X86B 1E6WA 8MHTA 5HG0A 3F73A 3PQ7A 2WJVA 1V37A 1G5IA 2IZZA 2JCXA 1JA1A 4F9TA 2CMDA 1JG2A 2VT2A 4MHVA 3O90A 1GAWA 5C5CA 1W7AA 3UXHA 1WP4A 2Q1XA 3TADA 1G6OA 3WLTA 5AM4A 3ELWA 1OQAA 2QTVB 4R83A 5CJPA 4BKPA 4QJBA 2I8CA 3AQEA 3FNBA 3PW5A 4UE3S 1LZKA 3UA4A 1M2WA 3CJQA 4XGKA 3PNBA 3SXJA 3T06B 4RK7A 3TH5A 4F4IA 2QZPA 4DXDA 2WIAA 2KFNA 3WL5A 4G9EA 2Q9BA 2GB4A 2R00C 3RYTC 4PLVA 5CDYA 1FIQA 1PJ3A 2WG0A 3P52A 3DE2X 2O0JA 3P9NA 3GLTA 4YHBA 5D3QA 4KQEA 1GL3A 1NIJA 1B43A 1LA2A 3BE4A 3GPLA 1VSTA 5F2OA 4OBBA 1RKUA 3D8HA 3HCOA 1GUZA 3K6SA 2FPRA 3LVWA 5E6UA 3E53A 1I2BA 1V2HE 1HX7A 3ICXA 2FZLA 3HA2A 4B3SB 4FHGA 3LX8A 2GCGA 3A6FA 1D07A 5TMDA 3PICA 4IKEA 3GEHA 3IBGA 3RSCA 5HX7A 2QNRA 4JODA 2FEOA 1VB3A 3S8EA 3DCYA 3Q1KA 1VGVA 3TTUA 1WSWA 3BORA 4ZODA 4QXAA 4QZEA 2EJVA 4C78A 3P9XA 4DRXB 1PL8A 3EAGA 2KW5A 3GU3A 3D0QA 3R7WB 3TDKA 2NAPA 3KLOA 4LZAA 3PCRB 3GEMA 2HBKA 5DPMA 4NENB 2QTVA 4IR7A 1F60A 1VKRA 4BYGA 4QU9A 2Q9CA 3G68A 3EDYA 2HXGA 2DBYA 1K86A 1MSWD 1RZ3A 4EBDA 2Y1DA 1E61A 3PGMA 3C6MA 4KLEA 3KETA 1J22A 2HUNA 5CBKA 3FYCA 1NKSA 4DLAA 2HJWA 4CIXA 5IC4A 4Y7DA 5E95A 3UWMA 5ALHA 1GNQA 4IXWA 4I2BA 3QMPA 4OPMA 4EZIA 3BDIA 2JIRA 4NNJA 1C8KA 1ISSA 3RBDA 2HYDA 4QKQA 1KN5A 2O54A 2I3ZA 2YWJA 1OIXA 3RJHA 4EG7A 3T3PB 4HB2A 1ZQVA 4C07A 4I55B 5KVCA 2ZDHA 3NDRA 4KRGA 4PS1A 2Q3JA 1QWOA 4HGZA 1YMVA 4AB1A 5DGIA 4RHFA 4JYMA 2M2IA 3O8CA 4IVQA 3HZHA 3JYLA 3T15A 1C7ZA 3DS8A 2H5IA 1KGSA 5B30A 3FI0A 2HJ9A 4ECVA 5ALWA 1NQOA 2I3GA 2ALJA 3OKAA 4I5DA 1LQ2A 2CB9A 1A0OA 4KSCA 3SWWA 1JEQA 4ALJA 3GDFA 4BKOA 5K3AA 3WDLA 5K20A 3FMOB 3TZLA 3HN2A 3VU8A 1RHMA 4LJ7A 3RG2A 1GNTA 1YKGA 3RTVA 3U19A 2OORA 1BDMA 5JDIA 4Q9LA 3H5RA 1GXSA 2IHZA 1LVGA 1OFVA 4D4KA 2FEXA 4NCJA 3PEFA 1DX9A 4B4UA 5K0ZA 5HKAA 1GRCA 3WHKA 2NO4A 5C8VA 3PSIA 2QI9F 4Q1FA 2Q5FA 1YU9A 3PA6A 4ELVA 2GNAA 2WKRA 1ZMBA 1HF3A 3DHYA 5CPFA 2G63A 4TT3A 2C0PA 2F3PA 1INLA 2IDJA 3JD1A 2PX5A 4KQMA 1DQYA 2QS9A 2BHRA 5KSZA 4OSOA 4NCAA 3H5IA 2Y0EA 3W9UA 3T9BA 1CF4A 1KRPA 2ZUEA 4RVOA 5E3JA 2Q5HA 1EWTA 4QJ4A 1DKPA 3CF4G 2XB6A 1VE6A 2IA6A 1SY7A 1R9GA 1Z37A 2XT6A 2MAXA 2VJLA 4KACA 2DWQA 2HV8A 1Z18A 221PA 1DEKA 1C20A 2I03A 4ZOLF 4L78A 3ZI4A 3V4OA 1TTTA 1CHNA 3LFHA 3MCTA 1TJYA 4XPIB 3ICOA 4PYNA 3KZVA 1YQ9A 1E0KA 2O6KA 2NAFA 4GSYA 1TQ6A 1XCBA 4IDAA 5IDYA 1ZESA 4EY8A 1YB1A 1E1KA 3HPRA 3VH4A 1SVNA 4CV3A 2VSOA 2YOGA 1X2BA 2OY0A 3E81A 2I87A 1K75A 3UY4A 3FAKA 4HRVA 2CL5A 3T9EA 2YHBA 2PFNA 3V6HA 3CNHA 4QBIA 2E4WA 3OFJA 5DK4A 5HIIA 1NVVR 3FFXA 1X0VA 1BFDA 3NHBA 3B8EA 5BPCA 3CCFA 3E7PA 1X7GA 3NHZA 5DB4A 3AR7A 3TFOA 3W04A 3ZOZA 2F43B 1MDFA 1IZ0A 1U94A 4M1TA 4GFJA 4IF6A 2G3YA 1K5GA 1Q7CA 4I2AA 2Q2WA 1UXGA 1T6YA 2XO7A 1RJDA 4G0ZA 3TQFA 4BNDB 3D2BA 2PEZA 5EOZA 2AOTA 5AQ1A 4FM9A 1KDPA 5J47A 3KQPA 4ZYXA 5BV7A 4WJKB 3UBTA 1UC5B 2G8LA 5K0NA 5BSKA 4F5OA 3Q3CA 1WABA 1XAHA 2OHFA 4AN0A 3PSFA 4NM2A 4OMCA 1CETA 1JG3A 4ZYTA 4LXIA 2KWIA 2OL4A 2CNKA 2ZXFA 4CG3A 3O31A 1QU3A 2YYYA 4G01B 3CFYA 1IE3A 4ZCQA 4B34A 3NWBA 4H1WA 4LYFA 1IC6A 2OBBA 3TZBA 4M0PA 4P7BA 4W1SA 1R0SA 1K7FB 4Q24A 4UEJA 2BKLA 1VXRA 1K06A 5B4TA 3I2YX 1PHRA 2NSDA 3LMKA 1YC5A 3E35A 3X1DA 2G0AA 2BGMA 3NBZC 2HJHA 4TTAA 3OQNA 4YRNA 4XD2A 2V74B 3UPUA 3LDGA 5JCPA 4Z49A 2BDUA 3D0RA 3ZK9A 3FYHA 2QRHA 1LBSA 1R15A 3SBEA 4PNZA 4EI9A 3I64A 4RU1A 1P2FA 3M89A 4L08A 4WOBA 3V1LA 2IP4A 3KVOA 2A1TS 4EGQA 4D9FA 4HY3A 4JEIA 2QARB 8OHMA 1R64A 2C82A 2O2SA 1SEPA 5IH3A 5FBQB 4XE5A 1P9RA 4UU8A 3DVSX 3L7NA 5DHRA 2NTNA 4OMUA 1G8GA 1WG8A 1EFVA 1YK1A 2PZGA 3FPSA 5AKJA 2C1XA 2IBTA 2ENWA 1JBQA 3JARA 1P39A 2V59A 1NJ5A 3M3HA 4HB3A 4HN4B 4URVR 1SKUA 3HO6A 3QPCA 1GRVA 2JASA 1XTSA 4QDXA 3A26A 2CJPA 1OA0A 4RLQA 4KQCA 4I27A 1JKFA 2I67A 1MH9A 1V35A 4CUZA 3IT1A 4C21A 2C2MA 4GOLD 4RHEA 4XWOA 4DL6A 1NR7A 3C5VA 2GF9A 3BJRA 3ZQJA 3L8HA 4WUTA 1UFKA 2BKVA 4PG4A 2EVWX 1UCFA 3W8NA 1RM3A 2A6PA 2YR0A 3UQYS 3DE1X 2JLXA 2Z04A 3HT3A 2Y76A 4KFRA 1FFVA 4N0QA 3B20A 3ECCA 1VJDA 3BJMA 2GD0A 1PDOA 1MUUA 2X42A 4BFTA 2PXXA 1FYXA 1YRLA 5CG2A 2CYBA 5BN5B 3HZRA 1XRQA 4CETA 4KQIA 3KHRA 2OGWA 1DTSA 2IHTA 2HUPA 2IYUA 5JWHA 3OZVA 4RW0A 1MR3F 4TV9A 2HW8A 3NRJA 3M0EA 1G6KA 5FH9A 3C3PA 4CLDA 3RS0A 1LPMA 4JJFA 4CMHA 3OEED 3JY6A 1Z62A 3ISBA 2QZ9A 4G4GA 3OLZA 1EDZA 1OROA 4FCVA 4FGLA 3PD0A 3KAKA 2A9JA 3SJZA 2PLRA 1N78A 1ZK0A 5KINB 4M87A 1P0MA 3NTUA 2VJPA 1SCQA 2GK7A 3ORSA 3SE0A 5AVJA 1CS0B 1YU6A 4C0KA 2R97A 2G1PA 4CF3A 3KPWA 4FEGA 1MHPA 5LBIA 3Q8QB 1EA7A 5BV1A 2AJBA 5E1MA 4P34A 2ZXHA 3ZS9A 4Y2GA 1NXWA 4HAWA 5EHQA 2JCGA 2FZEA 5EN4A 3JWJA 4BRUA 1XA4A 4DC1A 1GCOA 3G0GA 2WOOA 1XCLA 2HLPA 4RVUA 4RPXA 1YR6A 5KB3A 2EF1A 1T29A 4I9UA 3IDSA 4EH1A 3EF3A 1ZOIA 4XQGA 1QZZA 3E3NA 1CRXA 3TPFA 1UXJA