3QNMA

Haloalkane dehalogenase family member from bacteroides thetaiotaomicron of unknown function
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
231
structure length
231
Chain Sequence
LKYKNLFFDLDDTIWAFSRNARDTFEEVYQKYSFDRYFDSFDHYYTLYQRRNTELWLEYGEGKVTKEELNRQRFFYPLQAVGVEDEALAERFSEDFFAIIPTKSGLMPHAKEVLEYLAPQYNLYILSNGFRELQSRKMRSAGVDRYFKKIILSEDLGVLKPRPEIFHFALSATQSELRESLMIGDSWEADITGAHGVGMHQAFYNVTERTVFPFQPTYHIHSLKELMNLLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Haloalkane Dehalogenase Family Member from Bacteroides thetaiotaomicron of Unknown Function
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Structural genomics, unknown function
molecule keywords Haloacid dehalogenase-like hydrolase
total genus 90
structure length 231
sequence length 231
ec nomenclature
pdb deposition date 2011-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3qnmA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3qnmA01
2FPSA 4HGOA 4XQ0A 2G0AA 1YDFA 3NRJA 5AKLA 3L1VA 5AVZA 5AVUA 5AVYA 2JARA 2GO7A 3EF1A 2R8EA 3WK7A 2IOHA 3D6JA 5ALTA 1RC8A 2W11A 3OCVA 3AR2A 2C8KA 1CR6A 5AESA 1RMTA 1RRCA 2HDOA 2MU1A 3KC2A 3UM9A 3DAOA 5AVTA 2HF2A 5AVRA 1X42A 2W43A 3WK8A 2Q4RA 3W5DA 5ALSA 5AI5A 5ALFA 4Y2PA 2HCFA 1J8DA 3WKBA 5ALVA 1EK2A 2EARA 4NFLA 1XP5A 1ZD5A 3DNPA 1XVIA 2YMMA 4QJBA 2RBKA 4HAIA 3WKAA 3M9LA 3NASA 2ZOSA 1QH9A 5AM5A 1U2TA 2G80A 4JDPA 4Y3UA 1Q91A 3AR6A 5AW5A 1KYTA 4UAVA 2O2XA 3R9KA 2O9JA 3BA6A 1JUDA 5AKJA 1NRWA 5ALMA 2FPUA 4C4RA 2ZBEA 1S2OA 3PGLA 1LVHA 3J7TA 3B9BA 4ZEXA 4Y2RA 2C9MA 1TJ5A 1WPGA 5AW2A 4NWIA 3QUCA 3ZI4A 5AVXA 3QGMA 3OCWA 2P9JA 5ALRA 5ALJA 4AS3A 2G1AA 2QLTA 2RARA 3FPSA 2VKQA 3A3YA 3ZW7A 1Z4IA 3EWIA 4Y2QA 2I34A 2C88A 3W5CA 2WF5A 5ALUA 1YS9A 5T41A 4J03A 4BYGA 2EATA 5AICA 3L0BA 4BX3A 2PKEA 3U26A 3NUQA 1IWOA 4UAUA 2WF6A 3SF0A 4OD0A 2I55A 3QU7A 1NF2A 3QU5A 5ALGA 3I28A 3AR3A 2P11A 4F71A 2NYVA 4E88A 3A1DA 3ESQA 3NANA 4BX0A 1TJ4A 2HX1A 3B9RA 5AVVA 3QUBA 3FM9A 2PR7A 3QLEA 3SMVA 3NALA 3E84A 4CF3A 4OHFA 4EX7A 3WKDA 5ALXA 4XPZA 1RMQA 3A1CA 5AM1A 2QYHA 3SD7A 2HOQA 3MC1A 5AI0A 5ALWA 1NNLA 4KN8A 1ZRMA 2I33A 4AP9A 1RQLA 1AQ6A 4EENA 1QQ7A 1K1EA 3E81A 2OYCA 2FUCA 3L1UA 2I6XA 2AMYA 2B82A 4AS2A 4G9BA 1RKVA 4HGPA 4Y2XA 1WVIA 3K1ZA 3M1YA 2HO4A 4YIKA 5AI4A 2HF7A 2YN4A 4UU1A 3U7EB 3QUQA 3ZWDA 4UW9A 3OPXA 2ZG6A 2B8EA 5AI8A 2WF7A 3DDHA 4C4TA 3HLTA 2FDRA 4HGNA 1N9KA 1WR8A 3AR5A 3IRUA 3VAYA 3ZUPA 1U2SA 1T5TA 4EX6A 1RLMA 4YGYA 2YY6A 1YJ5A 2I7DA 2CFTA 3WGUA 1L7PA 4BEWA 1L8LA 4CF5A 1YNSA 2ODAA 4KX3A 1F5SA 1Z4LA 3EF0A 3KOOA 2CFSA 1U02A 2FI1A 4UMEA 3WK6A 4GXTA 2YJ4A 1Z4PX 4UU0A 4HGRA 4BEVA 4BX2A 2G07A 3ET5A 3AR7A 4KX5A 1T5SA 3ET4A 4BNDA 1ZOLA 2WM8A 1ZD3A 2R8ZA 2YJ6A 3SKYA 2FPRA 1SU4A 5ALPA 2MU2A 2HI0A 4CE6A 3ZWKA 4OCZA 5ALZA 1FEZA 3N8GA 2MSNA 2RAVA 1TJ3A 1L7MA 3ZU6A 4IFTA 3QXGA 5JJBA 4L6AA 2IYEA 3PCTA 1Z4QA 3U13A 4NABA 3B8EA 3N1UA 1LTQA 3ZX5A 2B30A 1MH9A 4UMFA 4DCCA 3DV9A 3A1EA 4BNDB 2AH5A 5AHXA 5AKXA 3EPRA 3R4CA 4UMDA 4DFDA 2HEGA 4YCMA 1WZCA 3I1YA 2P69A 4HYTA 4UMVA 5A3SA 4L57A 3SHQA 2YFYA 5AM0A 3U19A 3QYPA 3ZVNA 2YJ5A 4I9FA 1VJRA 5AIBA 2R8YA 2G08A 3L5KA 5IS2A 1ZD2P 3L8EA 1ZD4A 2IOFA 2WHEA 3CZ4A 1J97A 2ZXEA 4ZEWA 4C4SA 3RF6A 3I76A 3L8GA 1RQNA 3SLRA 2OBBA 1O03A 2WF9A 2B8JA 2RB5A 1O08A 3OCYA 2HSZA 3L7YA 3MN1A 2FUEA 3RFUA 1ZS9A 5ALQA 3FGOA 4UATA 5ALYA 2BY4A 2NO4A 5A3QA 4IG4A 3OCZA 2HHLA 1QYIA 2AGVA 4FYPA 3S6JA 1Z5GA 4NAVA 1N8NA 2G09A 1RLTA 5ALKA 2OA0A 4MWOA 3ZTWA 5ALDA 4EELA 4JB3A 2OM6A 4Y2UA 2EAUA 2D2VA 3AR4A 3NAMA 1Z88A 3QX7A 5ALHA 2WFAA 1PW5A 3UMCA 2AUTA 5AW8A 4BBJA 3PGVA 1RPZA 4J2TA 3ZTYA 4YIHA 5FP0A 1U7PA 1Z4NA 2YMPA 1RKUA 1EK1A 4EZEA 4H1WA 3MPOA 4Y2YA 3E58A 5AKZA 5ALEA 5ALLA 5AM2A 2GHTA 3AR8A 3IB6A 2JAOA 2YMLA 3W5BA 1Z4JA 5ALOA 1QQ5A 2JAUA 2BDEA 3U7FB 2FPXA 2X4DA 5ALIA 2B1RA 4Y2JA 2YJ3A 3GYGA 1SWWA 4Y2SA 4OFZA 2YBDA 3L0YA 1RDFA 4B6JA 4HGQA 5E0OA 3WK4A 2C4NA 1XPJA 1Y8AA 5AW9A 3ZVLA 2P27A 3KBBA 1RKQA 2C8LA 2GHQA 5AI9A 2G06A 5IT0A 4RETA 3I6BA 2BDUA 2I54A 4XOUA 3P96A 3QU9A 5AKYA 3U7HB 5AKHA 1L7NA 4FFDA 3TLMA 3ZVMA 3L8HA 3UMBA 5AVSA 5AW0A 3L0CA 3N07A 5AVWA 2Q5EA 3NIWA 3WGVA 4Y2TA 3MMZA 3QUTA 3WKCA 4G63A 2ZBGA 4UM5A 4RESA 5AW7A 4YCNA 5AK5A 5AM3A 3AR9A 3ESRA 5AKGA 3L8FA 3W5AA 3R09A 4BKMA 4DWOA 1TE2A 1L8OA 3ONNA 3OCUA 1RLOA 4MUMA 4O8CA 1S8OA 4UM7A 3FVVA 4YCLA 4L6CA 2IOFK 3KZXA 5AK6A 5AI6A 1CQZA 2PQ0A 1RMYA 5AVQA 1L7OA 1Z4KA 4NV0A 2IA5A 1QQ6A 4KNVA 5A3RA 2B1QA 1SWVA 5AKEA 5ALNA 3ED5A 2NO5A 3ZX4A 3FZQA 2YMQA 4YH1A 1YV9A 4Y2VA 3OTQA 4KNWA 1Z4OA 1T9ZA 5AIAA 5AKIA 2B0CA 3QU4A 5AM4A 2JGAA 2GMWA 2Q4TA 3N28A 3UMGA 3E8MA 5AW6A 2CN1A 4FE3A 3BWVA 2JAWA 4ZEVA 4I9GA 2R8XA 4CF4A 5IT4A 3WK9A 4XE5A 3QNMA 5AKKA 5AW1A 4GIBA 1VJ5A 2ZBDA 4PNHA 2ZBFA 3FPBA 4KYTA 2FPWA 5AW4A 3IJ5A 2GFHA 1ZRNA 1VFPA 2DQSA 4UARA 1Q92A 3N5KA 2FEAA 4QQFA 5AK4A 1YMQA 1Z4MA 3KDPA 3QU2A 1Z5UA 4EEKA 3CNHA 1ZJJA 5AW3A 5AK3A 3OCXA 4UASA 3KD3A 3PDWA 4F72A 3WKEA 3HYCA 4CNQA 3SKXA 2CFRA 3F9RA 1L6RA 1TA0A 1U7OA 3U7GA 3WK5A 2W4MA 4DW8A 2WF8A
chains in the Genus database with same CATH superfamily
4JXKA 2BFEA 4PPFA 1E92A 4RHFA 2QGFA 1P9WA 7ICHA 1ZISA 1N78A 1LH0A 1RLUA 1WQ4A 1YKSA 2O1EA 2PXXA 4GC9A 4YJ3F 4D3ZA 3I42A 1Y48E 2VZEA 5A0FA 5C8XA 5U9CA 2N0SA 4ZPJA 1NJ5A 3X1XA 4KBGA 1LQTA 2VCHA 1P2GA 3OBBA 4JL8A 2C7VA 1WL8A 3BJRA 1RC8A 2EGUA 2DULA 3MINB 1CF9A 3MTDA 4OJTA 2RGGA 2VDUE 4HNTA 3THWA 4EO4A 2ZXIA 3NGDA 3DDUA 4FGUA 3IDZA 4ARUA 2IHZA 5LXTB 4W7IA 3UOWA 2QN8A 1WF6A 5KQLA 4X71A 5TJ9A 4FFLA 5I3ZA 1JJIA 1I3LA 3DQPA 1N77A 3G7NA 3P97A 4CDGA 1Z18A 4FZNA 3I52A 3CR8A 1B6RA 3LA6A 4EWLA 1YRBA 1GL9B 3DMHA 3VZDA 5DNCA 1HDRA 3S7TA 2C2YA 3K6JA 4NZOA 2YYZA 4YBRA 4R01A 4QZAA 3UBTA 3UPQA 1V48A 2QPAA 3FPLA 5TPZD 4CTNA 3TG2A 4G0WA 1TVCA 3CBQA 2Q3EA 5J4VA 4BWYA 4EH1A 2W55A 4J7UA 2E4WA 2IEAA 1KAOA 1FS6A 3EUAA 4PHCA 1N2GA 4M9JA 5FI3A 1Q46A 3C3DA 2QG4A 4G07A 2VCYA 4CIAA 3SKVA 1PJCA 1WXIA 2C03A 5JSZB 1MX5A 4Z7QB 4XUDA 4G2NA 1KL9A 4C0AC 4FCVA 1MJ5A 2HJ9A 2CUKA 3ROQA 5KJEA 5JYEA 1V5GA 4O2AB 1F3OA 1X7HA 1Z6AA 2BFCA 4D97A 3SF8A 1U0GA 3HDGA 1XR3A 7ICOA 1NP6A 5I6DA 1PR1A 2WRZA 4DLNA 1GPAA 1OBCA 3F2CA 3NOQA 4MV7A 3TM5A 2LP4Y 1KEWA 2OGWA 1RPNA 1QQBA 5KFBA 1P8JA 3MELA 5C3UA 3DS8A 4DY6A 5H68A 1WXGA 3N8HA 1E8DA 1JHOA 2GR9A 2JCXA 3DHYA 2K7ZA 1R0RE 1R8SA 3BULA 3MB8A 3O4JA 3K09A 2DKFA 4C04A 7ICPA 4GHWA 2I5HA 2VR1A 5JBQA 2OHGA 4DCSA 3NBYC 3BFVA 5H9WA 3RRJA 3WYBA 5ALRA 1WCNA 3CSUA 1MABA 4LRWA 5EIBD 1XCMA 5D2CA 4BLTA 3KTAB 4NEHB 1LA2A 4F2HA 5KFAA 5HIIA 2F3SA 1CRLA 1J1UA 2FP4A 3ZJUA 2N9UA 3UWMA 4EKEA 3PJRA 5DGXA 2VDKB 3WRYA 3LW8A 1R0KA 3PE4A 4FMDB 3B48A 2M6SA 2LVBA 5F5LA 1RABA 2MYUA 3PTAA 4F5YA 4RV9A 1PTJC 3NC4A 3SE7A 3RU7A 2GOLA 2BP7B 2PL1A 2I7TA 3CH4B 4FYWA 1QSSA 1BFUA 1OWPA 1DKRA 4IDCA 4RFLA 1M72A 4C7BA 3GFOA 1BW9B 4Z99A 4PS1A 3TBFA 1RZRA 4KREA 3GB9A 1UP6A 3CLTD 3QU7A 2CJFA 5TXGA 4YMIA 3AR3A 1E9FA 4O4JF 5E1OA 1OAOC 4L8LA 1T9AA 2GRAA 1GGVA 1JQKA 3H4VA 3WJ7A 3UOAB 3Q98A 1XD2B 5LQKA 4CR6A 4Q21A 2OD2A 1I33A 3G8CA 3IXMA 3I9JA 4KE9A 4K86A 1MB2A 5IP5A 5AVVA 1EFTA 4LZWA 1XK7A 2VH1A 2ZIEA 3IBSA 4KPGA 2I1QA 1PK9A 2O8NA 3HKDA 4PCAA 2GBIA 3BRWD 3MD0A 4WLOA 5K3CA 4DVGA 4MVJP 1CZKA 3R74A 1EYZA 1GT6A 2FX2A 2EKLA 1RMQA 4WASA 4JBXA 4B87A 3N6RA 1Z62A 5C80A 1PFUA 4LJ6A 5EEHA 2YH2A 3AKEA 3L05A 4ND3A 1P3JA 4XQEA 5FFFA 3ICQB 3N2IA 1P7YA 4DLRA 3TD6A 4CDRA 2A4MA 2H1HA 4HCJA 4FM9A 1B73A 1K1EA 3R5JA 4ETWA 1RG6A 4ILEA 3MJEA 2FZKA 2H0AA 5LQCA 3UHPA 4BV9A 3OSPA 1ZH2A 1Q7TA 1SGGA 2PE5A 4BJ3A 3EC1A 1G6HA 2I8LA 1PJ3A 2OPHA 1RYEA 2V7UA 3IQZA 1LLQA 1W4ZA 3GV0A 2PSFA 3HVHA 2YN4A 4N0PA 3RRYA 4MYCA 4Y6LA 2BCUA 2XXAB 4LYDA 5C5IA 2XMPA 2LM4A 1DQNA 1ODCA 2C3YA 2Y8EA 4LRUA 4FP9A 1YJCA 4ND5A 2GBCA 2ECKA 4R1LA 4UHJA 5DJ5A 5LZ9A 4YRZA 2F4VB 1JX6A 2WT8A 4LNHA 5TVGA 1QO9A 3KKMA 3FLMA 4EL5A 2O2EA 2HBZA 1RFLA 2N75A 1HDIA 4D0GA 2NNLD 1TW2A 2XYPA 3QPAA 2VHWA 2JLCA 3H11B 3AM4A 3LLMA 2F67A 4YALA 4HKTA 3ETEA 4C14A 3D59A 3GMDA 3U4HA 3EAFA 1SIWA 2W4QA 1XTKA 2P75A 1TM2A 4JV0A 4K81B 1DDOA 1BG6A 4WOCA 2B34A 2CDAA 1APBA 1EWVA 4IDFA 4MVJD 1DZIA 1XZEA 1EUDB 1AHHA 4ARCA 4X3OA 2BHTA 3SIPA 1KXJA 3L41A 4TTJA 4BEWA 1AT1A 2IHUA 1NVBA 1T13A 4JHLA 1FTYA 2AI3A 1FLDA 2V7PA 2ODAA 3U5ZB 2C2WA 1J0EA 1D6SA 3TLCA 4XVHA 2NO9A 2C22A 1SFRA 1VIDA 3MLAA 3OFNA 3KWMA 3KYDB 3SEFA 1L5QA 2O3TA 3HJAA 4QWEA 3ROXA 5HUJA 5B57C 1M1YE 5JAMA 1JWBB 2VH5R 4HGRA 1WETA 4I2FA 1JVSA 4GPTA 5JJLA 1W34A 4P54A 1ZQUA 2YNMD 3FDIA 1P5JA 1T0JB 3H4TA 3K0FB 3KNZA 3JQ7B 1PSWA 1M6WA 2QZPA 1A69A 4QASA 5E6UA 1VI2A 4W8OA 4BGEA 1A88A 3QA9A 2KP7A 4KGXA 2OBNA 2W2LA 2HWXA 2RC6A 1X87A 4ZOHC 1U0EA 4R66A 4ZRDA 1EVEA 2WU0A 2R8RA 3H9CA 4CKWA 1G8KA 2E4ZA 5ALPA 1CUBA 3UG6A 3H1BA 1N57A 2PT7A 4H3HB 3ZLUA 1HT0A 4Z8XA 4PSCA 1S02A 2AZMA 4BPRA 2AV6A 5J0TA 3RTBA 1EXMA 1VE3A 4WE3A 1XDSA 1EUCA 3RRBA 1IXRA 2VQDA 3C8HA 2FSFA 4TKUB 4AWXA 1VRVA 1GYQA 2RK3A 1A50B 2B9VA 4H31A 2GDZA 1M34E 1IJEA 3O5AA 2G82A 2IYYA 4R8UA 1PK1A 1JFLA 2H4HA 1YIOA 1G291 4LYHA 5DEOA 1Q6ZA 3INGA 3GN1A 4I1UA 4AG3A 2IJGX 3U13A 3RC3A 3SC4A 1ZNQO 4RZIA 8ICXA 3E9DA 3DPIA 5C81A 1M2HA 2QRZA 1GQ2A 4DCCA 2GBPA 1OZFA 3JD0A 2VZ8A 4LK3A 2XODA 1K5DA 5K01A 5KOIA 3Q3EA 1NOJA 3K96A 6REQB 1B0ZA 1NI4B 2CK3D 3HJGA 2P69A 3KUXA 3OPQA 2A7XA 4JL5A 5IJ0A 1J00A 5LQRA 3TR0A 4AQDA 4H4DA 1HO3A 3PSAA 4NMHA 4UNNA 1GL7A 1NLFA 3OOHA 1EQUA 4BNIA 3HUEA 2YBEA 1TX4B 3QYPA 2PU5A 3U3JA 4LZGA 3FF4A 2J46A 3O9MA 2D6FA 3UMVA 1H2HA 3DBHA 1ML3A 3MT0A 4DSUA 2QI9F 2Q1UA 3DLHA 4GZ3A 1UFOA 5LWQA 4PSAA 3UGJA 1E94E 4JYPA 4OQPA 4MPTA 4JB2A 5EIWA 2JGDB 3GL9A 1QHNA 3HPQA 3U31A 4A3SA 1Z2EA 5K0ZA 4HVAA 2VPXA 3VDMA 4GI1A 1ODLA 2RB5A 4YT2A 5DGBA 2ZYWX 1HQKA 3EDQA 1VJ1A 4J2HA 2ZSIA 2AG6A 2Q5IA 3GJRA 3RFUA 3FCAA 2ZUWA 4KLNA 4AIRA 4F4DA 4B6QA 4JLAA 4EYEA 2PXAA 5ALQA 2KBFA 3KUDA 4KK4A 5DYYA 1F38A 2J3DA 2UZ4A 2D6FC 4RY8A 5JVDF 1C4WA 5EE1A 1YO6A 1DKNA 1KY2A 1YCFA 2JFPA 4KLRA 2ILTA 2V5VA 4R05A 1CWUA 2F3TA 3QFFA 3ZH2A 3VSAA 2F55A 4PZNA 2I2FA 4MQFA 2EQ5A 2WMOB 5BWCA 3P32A 3QEJA 1DAGA 5AJVB 3WGMA 1NTOA 5DBGA 1N2ZA 1B6GA 2RJNA 3F8SA 1K3FA 1PKXA 4Z4EA 3MWFA 2BJVA 4B47A 1U2GA 4XIIA 4DF8A 4QSMA 2CFOA 5JLAA 2C0PA 4F5PA 1T6NA 3FWPA 4MV9A 1OF1A 1C9YA 1VJDA 2OE2A 2OM6A 2VT2A 2PUCA 1TF5A 4HUJA 1ELOA 1LNQA 4EDFA 2HHCA 3KO8A 5I7EA 3HCBA 1SMKA 1Z88A 2VDNB 3LLVA 3D1JA 3FROA 3OLVA 3BC1A 2EZ9A 3FVRA 3RTDA 1OW3B 2EFDB 3G9ZA 4DJEC 1GKKA 1OAKA 1ACLA 1VJTA 4G4GA 2OBMA 2QENA 1X8XA 2W58A 3NVZA 5ALHA 1JL3A 1MORA 2C2OA 5D6OA 3H17A 2ACKA 2E6KA 5DNEA 2NU9B 1ULTA 4D8WA 4QFBA 5HBGA 3MGVA 4DR3B 1E1QD 1XC9A 4CEIB 4QOFA 2Z6UA 2JFXA 1K8QA 4RTMA 1S10A 4C0JA 1QLJA 4H6PA 5HZGA 1YB6A 4GXIA 2C4WA 2WAOA 1DWQA 3FW1A 8ICUA 4NYMQ 1D04A 1Z12A 4IVNA 1JI3A 4HDRB 1ZQPA 2X19A 4QIHA 3TZBA 2PX8A 3FFBA 2GNOA 1QGUB 2YMPA 4BNHA 2ZIWB 3MFQA 4YRSA 3BT7A 4Z5XA 3EXEB 1SA0A 4TMYA 2W6OA 3HYRA 3AL0B 3HGTA 3E58A 1K4KA 2M1XA 4MOWA 2E5LB 3PD0A 1EJ2A 1K66A 1LZKA 3AR8A 1J39A 1XUOA 3A70A 2XI4A 4FX5A 3EXG1 4NU6A 2C8JA 4BTLA 1JQLB 3FE2A 3HB7A 4QPCA 1IMOA 4QXOA 4UBJA 3BIWA 1FRQA 1FX0B 4YDHB 5CR9A 1AGXA 3STWA 4TQGA 1V39A 5GONB 4BV2A 4KMOA 2NO0A 3P45A 2OENG 1Z0IA 3WZ2A 4COOA 2QTVA 4AX8A 5I3CA 1L5KA 3FLAA 1CSEE 2M2IA 1Q95A 3DCJA 4QZHA 3TS1A 4YTEA 1SUBA 3ZWYA 4L0DA 4C0ZA 1DC7A 5EPEA 4A1FA 3CUUA 3DTNA 4M9ZA 4Z4CA 4YR2A 1E1CB 1FSZA 1ZNWA 3G82C 2Y1KA 1C3EA 4AC9A 3BZUA 3SNKA 3UJAA 1YDHA 3RS7A 1FVFA 4KLTA 4M9GA 4J3FA 3QU9A 1NJFA 4X60A 5EHIA 3RVQA 3UFBA 4GLLA 1MJGM 1TK2A 4GMXA 2ZUBA 1W1IA 2IEBA 2BOVA 2XUPA 3I64A 3NHZA 4HNRA 4B84A 2ORWA 4MW2A 5EXSA 1KOLA 3VNAA 4BFVA 4A2QA 5KYKA 4Y2TA 3O0DA 2P2GA 3QUTA 5IXSA 3A3OA 3E9EA 3MQFA 4MRNA 3R0QA 2QT0A 3TMYA 5AM3A 3EQ8A 1TD1A 4RMHA 5ETJA 2JLRA 1KZ9A 4IQ4A 4QJFB 3LYHA 3IURA 2FPLA 3A9TA 4WSOA 1QLNA 2DHEA 3E2MA 3IBGA 1Z0FA 3OLCX 4FLEA 4HAOA 3UNXA 4AJIA 3TD2A 3F2VA 4V02A 3Q9LA 3HFSA 1UK7A 2BONA 5BOVA 2XQGA 3GJSA 3TIVA 1Q0TA 1J2MA 1S8OA 4HX2A 2D1RA 3MQ4A 4P7BA 3Q7RA 1RJFA 1SCDA 1UBFA 3NGMA 4IX9A 1CJUC 1UM9B 4NYMR 3GRZA 3OJFA 3FHJA 1BX0A 1UM8A 4XEUA 2V6MA 3U1VA 5D01A 2ZDQA 1KH1A 4KLQA 2PKCA 4S1OA 2J0UA 1S5PA 4QBFA 2OKGA 2UUAB 2FWIA 1AROP 1DRJA 3IOYA 3OG9A 2ARKA 3TSCA 3WISA 3ZEAA 3ZX4A 4DCPA 1R66A 2IU0A 4DCNA 4BPBA 1USUA 9ICUA 1WE2A 1JAIA 1UMBA 4R1TA 1FDUA 1A7JA 1V0JA 3C4QA 3TLAA 1ZQ9A 4HXFB 1WCIB 3V1LA 4ZVUA 3ZK8A 1P4JA 5H9VA 5AIAA 1P2TA 2UZ3A 5AKIA 4XYGA 1EVZA 2ZAMA 1G4HA 2I2CA 5M5BA 4EBDA 3KPVA 1NLMA 3U61B 3C6BA 2AHOB 3GILA 4Q44A 3VR6A 1QPGA 4I1YA 1OGYA 4JZYA 1BN6A 4JH0A 2REQA 2B2NA 1L4HA 1W5SA 1DJNA 3JQGB 4ZEVA 3LNCA 2Q5HA 2A4KA 3ZDEA 1Q1GA 1HIWA 2YFKA 1UDBA 4M9QA 1Q7GA 3O6VA 1CUAA 1LQUA 4X1KB 1VJ5A 2IZ7A 4C1BA 3AFMA 2I6FA 2IH5A 1SKAA 3RYTC 3P71T 4LZJA 4B80A 3OFJA 4JB0A 3K1AA 1BVUA 2EP5A 3VZRA 1JHDA 3FI9A 1FC0A 3ZJ5A 3D54D 4G5XA 4BJ6A 5LLDA 3KWLA 4YAJA 5F2EA 2QEQA 1DIHA 1UT8A 2JFVA 4NYJQ 3WL7A 5L45A 4FFWA 8ICMA 4G81A 2H29A 1IUNA 4NARA 4OYLA 2AG5A 3CRNA 4DQ0A 3AF0A 5M34A 1SKYE 3BGOS 4NKRA 4V0OA 2AGQA 5A6VA 2DHQA 4IGEA 3CCCA 3R0XA 2J4CA 2X14A 2VUIB 4WXMA 1LVGA 4DDWA 3CEJA 1MEOA 2X8JB 3QPUA 5LWHA 5J3JA 3PNQA 4PAQA 2E1EA 3CBGA 1VIYA 3HO6A 2QT1A 4PLWA 1JALA 3H0EA 3ABRB 4RZ3A 4ZI3A 4O4IA 4FT4A 2F59A 4LHWA 2W4MA 3BWDD 2BR5A 4GR4A 4XB1A 1IB6A 3LBAA 1QFSA 1VGQA 1OZGA 1GA1A 1T0BA 4NOLA 3QX3A 3ERCA 1HY3A 2QMYA 5ITWA 4I46A 2YHIB 3DCNA 3UXEA 4DS5A 1JLMA 2CLDX 3HN6A 4RJKA 2NVUB 3RUCA 4A6EA 1E2MA 1VBFA 4BQQA 1JT2A 1T43A 2R8EA 4RADA 2F8SA 1IM8A 2AW3A 5F3WB 3KSAC 3BIOA 2HHUA 1ZGAA 1MTZA 4LHZA 4MX8A 5KMGA 1NK0A 2RSLA 4E7PA 1AXGA 2JHDA 3RRMA 1PU2A 4FYXA 3C5GA 2GN8A 4B6EA 3RBVA 5TQJA 3WICA 4NOKA 4DMKA 3V6MA 3EHDA 1XEWY 1FRVA 2VUSA 2HWYA 3SR3A 1N0UA 3T8YA 4G37A 1OSNA 2NG1A 3U4GA 1BS9A 4V1CB 5FL7A 2R4UA 2HMSA 4DIMA 3PPXA 3SZLA 3RJZA 1U0LA 2GCIA 2VJKA 3QTTA 3SE0A 5KKAA 5KB3A 1JLLB 3TAPA 1AU9A 1JE0A 1KY4A 3DNPA 3M1IA 1FS4A 4L02A 3EOAI 4GI3A 4LC1A 1Z0UA 2GLXA 1XVIA 4V1CI 5CPBA 3CRZA 3JY6A 4I55F 4MNTA 1SV0C 4B9LA 3IV7A 2JHGA 4TTIA 5BSKA 1PRYA 5ELMA 1F7VA 1GNQA 3FN4A 3PV0A 3RRHA 4KQMA 1HJPA 4C1NA 1EE2A 3RIXA 4D2IA 3DE5X 5MN4A 4M8SA 1XTIA 1EDEA 2C82A 1ZQOA 2NO1A 5KFIA 2DQZA 4L5AA 2PBZA 2N1BA 3BF7A 3I3SR 3R7DA 3SMQA 4X92A 2XI9A 1QJ4A 2I6QA 5I7AA 3UW1A 2PZBA 3T7AA 1UPBA 1W44A 4V1CA 4GLBA 3JQ7A 3HVKA 3NJ8A 3GBVA 2PPLA 3PNPA 3LUHA 5KJ1A 4DB4A 1E0AA 2QYOA 1O6BA 1YACA 1WOYA 3A37A 4HMQA 4EHAA 1AGYA 2RCNA 3GRVA 3TIFA 3WY9A 1GD1O 2FY8A 1VYTA 4PYLA 2JFHA 2XADA 4ED1A 4L8GA 4Q6WA 1YE3A 4LJKA 4P3KA 3QG1A 1IY9A 1GARA 3PUXA 2DUWA 3H2SA 2GUGA 2NZVG 2DZDA 3AUYA 2EJCA 4H1VA 1ZJZA 1J21A 4ISBA 2RKWA 3PFCA 1H2WA 1XZDA 3G17A 2XT9A 3T1QA 1NG9A 4X93A 5CDFA 2QLTA 2FVXA 3R7LA 4RZSA 3U48A 3FPSA 4NCIA 3MDCA 1J23A 2H6EA 2R751 2VDOB 1PIWA 2VUUA 3AEYA 4HGZA 2PMZC 4E5DA 3PW7A 2JFOA 4Y2QA 1H38A 4F3KA 3RTGA 2ZUSA 4K03A 4MWZA 3SPXA 1YC5A 2G76A 5CFLA 4J2OA 3RUDA 3ZV6A 3M8KA 3B1XA 4G65A 1QB7A 2WUFA 2DBYA 2HMAA 3MCTA 3T54A 3D3WB 1G8SA 3AM3A 3D3KA 3VAZA 1GUBA 3SC2B 2QE7A 1FSPA 4TVSA 5AJHA 4E2ZA 2BP7A 4MUJA 1AQIA 1CC1S 2BEKA 2BTQA 1EJBA 4D3DA 5IG2A 3JARA 1N8SA 1VMAA 4PANA 2Q2NA 1ORDA 3IEVA 2ENUA 1QTIA 2XO7A 2Q5FA 4XQ9A 4OXRA 1EGQA 4PXAA 3H84A 4EW2A 2E5FA 2ZJBA 3FCXA 1PJ4A 2XXAA 5BNZA 1YRHA 1A98A 2Y92A 1JPNA 2WIBA 4CGZA 3I9FA 3TMKA 1WXWA 3FNGA 2DXIA 1OXSC 2HRBA 4CF3A 1KA9H 1BPEA 2W6NA 3FRJA 3SEQA 4CM6A 1V47A 1HQDA 5BN4A 2JIZD 5L53A 5HKKD 1D03A 2QYHA 3MJSA 2OP0A 4MRSA 3ZKAA 1SHKA 1QG6A 2ZM5A 3MVEA 1NZPA 2HTEA 5TMDA 3PX0A 2G77B 2KWIA 2VAXA 2CHVA 3HV2A 3MBIA 1QIDA 3OM1A 4K8RB 5BV1A 5FA6A 1JYEA 3EG5A 5E4FA 2FPKA 3LVRE 5EHNA 4B73A 1S01A 1SCIA 4P86A 4PINA 2Q2OA 1YONA 4XJXA 3WYFA 1QWSA 3M6XA 6ADHA 1RQRA 3AU8A 1AH2A 3KT0A 2YFHA 1PWXA 4IH4A 2YY7A 4Y2XA 4IXMA 3K1ZA 3DL4A 3RUFA 1O5OA 3DOUA 4GFJA 1T2EA 4CIBA 3AF2A 5JSZA 3HWX1 1O96B 4WTOA 2HF7A 4TMFA 3KXIA 1PTKA 1G8HA 4X7RA 1E0SA 4OHYA 3CWCA 3KHHA 1JQEA 4UEOA 3KQYA 1Y5MA 2XLCA 3HDYA 4MVJI 3NDJA 4Q45A 4R2XA 1PWZA 2ZG6A 5AI8A 3HDVA 5HDBB 5BRNA 2QN1A 1PWYE 1DC5A 3RGWS 4AN0A 2GDJA 5ADVA 4JVLA 5HQ3B 3KSBC 3JPSA 2A5JA 4JROA 3FC4A 3C2LA 4O3MA 4MB2A 3UUWA 5BVHA 2H3HA 4C78A 4MQ5A 4AQYB 4O4HB 4KV7A 3WO1A 1NVMB 1ZCZA 1GL3A 3A1SA 3A31A 1CUCA 1JIIA 2AMVA 1X9HA 2R6CA 4PO1A 4K3VA 3SSAA 1L3SA 1AA6A 4X62B 4MI9A 4KHZA 4ZO7A 2D7JA 1XZGA 2PJZA 4CZ2A 1Z1VA 5EVJA 4EYOA 4MMYB 3KTAA 5CVEA 1ZUNB 3L8CA 4C8OA 2ZBQA 3UHAA 2I7DA 2V6BA 5KSOA 3JYLA 3MOSA 1PD0A 2JPDA 1X8LA 1ZQKA 3OOYA 1KJ8A 621PA 5IMSA 1F5SA 1WUTA 2RFLA 4R84A 2HR1A 4ED0A 2QMZA 1U2DA 5AT1A 1UC5B 4PQGA 2WV9A 3F74A 1U8TA 1SB3C 4Q16A 3DLCA 3GLGB 2X3YA 2E87A 2ZWMA 3FKJA 4XM0A 1EWQA 4KGDA 3OZSA 3KPUA 2VNIA 3DMTC 4O3PA 2O8BB 5IIJA 1WWKA 2PI5A 2HV9A 3EOZA 3JXEA 4NP6A 1YMUA 1NNI1 5CDYA 3WGTA 2BH2A 3SNHA 3V8QA 3AT1A 2C2XA 4E13A 1RI4A 1Y4DE 3EDCA 5AXAA 1KY3A 4QG3A 1E66A 1YQUA 2VRBA 4OF4A 2V96A 1CW2B 3LPLA 5C7LO 1JKJB 1D9DA 2IP1A 3PR2B 3AJDA 1FUIA 2QYSA 5H0IA 4M0FA 2B2XA 3GIKA 1VLQA 4G36A 5JQGA 1YS2X 3KM0A 3N8GA 4G5HA 4C2AA 1TEHA 4ECEA 5J2BA 1I5RA 2AOUB 4HWGA 1RQGA 1HDEA 5I01A 4LJ8A 5FLXA 2JKVA 1DJOA 1JYFA 1CUKA 1KVQA 3MJDA 3AO0B 4KI7A 5CA0F 7MHTA 4DOMA 1NK6A 1IRXA 1G5PA 4J9KA 1T5OA 2IYEA 5DN6A 1AHIA 3I58A 3O47A 5LP6B 3I1IA 2XE6A 4JVOA 2QV0A 8ICHA 4IRKA 1YWGO 2IELA 4I5GA 2XF8A 4FO6A 1EFDN 4YASA 5FPYA 3H97A 1US8A 3RJEA 3FB4A 2NUAA 4FMPA 1IIRA 1FE8A 3UPTA 1Z33A 2XTJA 3A1EA 1P2FA 4KXMA 5IVKA 4FNOA 1C30A 4ENVA 2EEPA 1GGEA 4DQRA 1GTL1 1DDGA 2AOWA 3B1FA 4FGZA 4HG2A 5J2UA 1ZQYA 3T5TA 3BXXA 3LUPA 1D6NA 1Z0AA 4W5QA 1Q8KA 4MKRA 5CFPA 2DTEA 4DEXA 5LFAA 1E60A 4GMFA 3MFIA 1RM4A 3EQ9A 3NBMA 3TB4A 2GD0A 2WA1A 2OECA 1NJZA 4BVFA 4ZYWA 3R0JA 3ZVRA 4WBSA 2BW0A 1XYVA 2Q1TA 4MW5A 1VSUA 1OBHA 3EA4A 2C20A 2R8YA 1N6KA 3MG9A 5CDFE 2QMOA 2QB1A 3LQ4A 3TCNA 2GXQA 4QPPA 3L7JA 2G83A 1XAJA 3MMXA 1KR5A 2VSFA 3W4JA 1H65A 4JOSA 3MXOA 2FMIA 3E61A 3K16A 2G1JA 2J45A 1OY1A 1UBRS 2QJOA 2ZK7A 3H1EA 1JB9A 3S27A 2VHEA 1KDHA 1G20A 2LXNA 1G17A 5LYJF 5BWMA 2XZLA 3HHPA 4PRZA 3OESA 5JZ9A 1SKWA 2HSJA 3I61A 4DKJA 3JATB 3FGOA 1ECLA 1BHSA 2X8JA 1X7ZA 2VPZA 2AFIE 5A3QA 3WQBA 5I7OA 3PWSA 1ZR2A 1GFSA 3PPIA 4JUCA 2IPMA 4Q19A 4UU1A 3MQ2A 4RKRA 2GXSA 3GCGA 2OA0A 1EHCA 4G4SO 4QYSA 5FLEX 3AV0B 2ODWA 4GLOA 1VL6A 2JFQA 4IIJB 1X9WA 1KYXA 2ZT6A 4G8JA 2Q2WA 4BECA 1E8MA 3LNTA 3ZV7A 1L1EA 3PNYA 3SYLA 3NR2A 1DHRA 2ZR7A 3F96A 4POAA 3WZLA 1MC5A 2EYQA 4URXR 3F5AA 2OAGA 3FCCA 3PEEA 1DINA 4HMPA 5FPQA 2P2LA 4PZPA 4WVFA 1JLLA 4C2BA 3JR7A 2IYWA 1VE9A 4IYJA 4ARAA 4Y2GA 4LJRA 4DL6A 5KJ6A 4TGLA 4OHVA 5DIFA 1M33A 4AO8A 3BPSA 2FOLA 1DARA 1GUDA 2X9LA 3HL0A 4L0QA 4N3NA 4OQEA 5A71A 3UH1A 3KYIB 1QMPA 4TKZA 4BVAA 4ESHA 5JCZA 5JAUA 4CLOA 1CRWG 2ZUCA 4AYXA 3TAUA 3MSXA 4C21A 5A7FA 3NS1A 4G0OA 4UBMA 1B3RA 2LCQA 3C8ZA 4DJ5X 3O4RA 3F7MA 3RJFA 4L73A 3ZIUA 4ZKEA 1NVUQ 4Q8FA 5EIBC 2I71A 3FOBA 3D6NB 3BKXA 4V0NA 4ZDWA 1DG1G 4RPZA 1U1IA 4DTCA 3U56A 4W1SA 1C2TA 3UC9A 4YR7A 4FI3F 4RAQA 5BMVB 5KX5B 2I4IA 4M0UA 1UBTS 3ZBPA 3FFTA 2FJ6A 1VCIA 4V3BA 3FGZA 2BEWB 3ZNOA 4YV1A 1O3YA 3RAEC 4BAUA 4Y2JA 3DF9A 5DFAA 2NIPA 3SDZA 1F14A 1QLWA 1YZHA 2JIRA 2LNDA 3EISA 4FUQA 3OTOB 1AMUA 2P2ZA 3M6MD 4HGQA 1TM5E 1L3IA 2I03A 1JQBA 3EFBA 4JR1A 3VC7A 3KJZA 4NE2A 1KZ1A 2C8LA 3WWPA 1S7CA 1NZJA 3ZVLA 4CKCA 2MUTA 1CD5A 3N0XA 1BE1A 3MS7A 1WBBA 1BD3A 1WXDA 1CERA 2CFCA 2GO1A 3WOHA 1H2ZA 3RBZA 1E6WA 4IJVA 4EI8A 1ZK0A 1YCDA 5J4LA 5TC4A 4F2DA 2W5UA 3WP0A 4R2HA 5LQJA 3UENA 1NX9A 3BQ7A 2IRWA 4HF7A 1KEPA 3O8OA 4YAFA 2JNWA 2OZLA 2YS7A 2HHSA 3BMOB 3EW7A 1FTQA 2YZ7A 1Y6FA 1UKEA 1N32B 4RQ7A 4CCHA 1D0IA 2A1IA 1JQDA 3BMQB 1QHHA 1W6UA 4MR9B 1ED1A 2AR9A 3K94A 4GZMA 2C28A 1F48A 1J0BA 1P2DA 2BN4A 2ZSEA 3NIWA 4MRRA 3PEWA 2WWHA 1EUDA 4CUZA 2OH2A 3BDIA 5IC4A 2NQTA 5EJ6A 4GKJB 2QU7A 5MN5A 5A5GA 5G4LA 1ZGZA 3W3AH 3QIAA 3H1TA 3EN0A 3E2IA 3X1MA 5JJKA 3L7OA 4PZDA 4CCWA 2YXEA 2QTRA 3G0BA 5E7MA 3DYIA 4XM2A 3VR6D 4QBIA 2QRKA 1G2QA 3T94A 4TM8A 3OQNA 1CPYA 5HQ3A 3BGVA 2MYTA 4UAJA 5CX1B 1JMVA 5B7QA 5BNWA 2EWVA 2J3KA 2R1ZA 3OQ1A 4TT3D 1SD1A 4PC3A 4L5YA 4P84A 5ECDA 1P4RA 3V6HA 2PX3A 3C74A 5DHSA 3VU0A 1JH8A 2B6NA 1Z6TA 1YCGA 4LHXA 2QJRA 3W5IA 2PGDA 4PV7A 4QVGA 4CXMA 4UDOA 1JEQB 2NT3A 4BNLA 4QZIA 1DLJA 2JHCA 5EWMB 2XGSA 3IPAA 1DWOA 3UGQA 3KZNA 5SYAA 3V7FA 2QM7A 4R1QA 3G02A 5AJXA 3V8EA 3LY5A 1OFTA 3FSEA 4YHBA 1PYDA 3S2GA 3WFZA 1T1RA 3N4MB 3OHSX 4JI2B 2LI6A 1UP4A 1XOIA 3OHMA 4Z0TA 1NBME 2C77A 2ONZA 4L85A 4RY2A 1JVBA 4B2LA 5ELLA 4DEVA 4FFMA 3B36A 3BEDA 4GDFA 4IPTA 2Q4TA 1UDRA 5AW6A 4B5LA 4CEHA 2R5WA 1HE4A 2VNKA 1OYOA 3KJFA 5CWRA 4IR1A 1Q44A 1Y6QA 2QP9X 4I6EA 2H4FA 4LEIA 5FAXA 4D56A 1R0YA 5KHLB 2NZ8A 1U0SY 4G1MB 1JNXX 2E49A 1B74A 2X1MA 4QUGA 3ZU4A 1KSJA 3HGQA 3WLEA 1FDIA 3G5TA 1YBAA 1MTOA 2OXFA 2EF0A 3GA7A 4WJZA 1M0TA 1RRMA 4K26A 4QULA 2QRNA 4JR2A 5LIPA 1KGSA 3PVSA 3VNVA 1QOZA 4JSYA 3FPBA 2QKYA 2QVXX 5INTA 5JXWA 5AW4A 1EBBA 1ZOPA 2XUOA 4MYDA 2OV6A 3ZCXA 4N41A 3ITKA 3JPYA 1UA0A 1PNVA 4WLEA 4DLZA 1ADCA 1NATA 3ADPA 4OHRA 3DE2X 3TLJA 2FFBA 3KDPA 1O97D 1Z0SA 4ICIA 3RJKA 3BUSA 1ZJJA 3GA5A 4R7ZA 4AG6A 4KLAA 2C5GA 4HDMA 1SJ9A 4LQ4A 2AMLA 3LHFA 4X8HA 4ZOBA 3V8BA 3RB0A 3LBHA 2C3UA 2DWPA 1VG9B 1TC1A 2EW1A 2HFKA 1U7OA 4FBMA 1NMQA 5L3VA 4GLXA 3NU1A 1XZBA 1V3QE 4OL9A 3O8QA 4C9BA 1E32A 1N0VC 4M46A 2EBHX 1T8EA 1B0PA 1NZDA 2JIQA 1XO0A 2XDWA 3CPHA 2PWBA 3LMKA 1YKGA 3ORQA 2ZIVB 4JA0A 5B66U 4V3CA 2BQ3A 1DMSA 2PX4A 2A9VA 4I6JA 3I9V1 3LSTA 4LJ5A 3KUKA 4HHEA 4MB0A 4V24A 2Z30A 4US1R 1KI1A 2BUBA 4WA7A 5A5EA 1B26A 2E8NA 3EF1A 1ISJA 3KTQA 4BRUA 3ZGLA 1O9BA 4LYJA 4U9HS 1NZFA 4B3HA 3ICCA 4Z0NA 2XXJA 4YQEA 2RHFA 1RM0A 3KKLA 3Q1LA 4XPIA 5AHKA 2C8KA 1X0VA 3UUFA 3W4IA 1SXHA 4C4PA 4EHDA 2XCSB 1NXXA 1RRCA 3KC2A 3JWEA 3D4OA 3O38A 3K53A 2A5YB 1M1NB 3OEHA 2PZAA 2V7VA 3HKCA 1KYVA 4MPJA 4OHKA 4V0LA 3NKFA 4DAEA 3RSSA 4QUBA 3DXZA 3SFVA 4LKRA 4K05A 1JHAA 3D4IA 4II3A 2Q45A 3E05A 3UTDA 1EIZA 1EP2B 2JA1A 3H0KA 3AHDA 1VSTA 3DA8A 3RYIA 3BH0A 4HLNA 4P0QB 4UHDA 3HZRA 1E6KA 2DFVA 2H1IA 2RI0A 3B6MA 3THRA 3WBFA 3VC8A 4K9NA 3WV5A 3C1OA 2AQ8A 3PNVA 2Q9CA 4RHUA 2IYOA 1GL6A 4RD1A 1GTMA 4DA4A 4QO7A 2ZYDA 2QL6A 1UQVA 1KPIA 4RKYA 4WNCA 3K9NA 1TXGA 1CQJA 2MT9A 1BU8A 4F4JA 5KFYA 1Y81A 4XGNA 2I6GA 4XWTA 5KYGA 2W54A 2ISPA 4PQEA 4RTLA 2WD8A 1XIVA 3ABIA 3RH0A 2CVFA 3D6VA 2O2XA 3EDRA 3OZFA 4D81A 1B23P 4RPJA 1PSZA 1KTIA 4TMTA 3ETJA 1PTJA 4AS1A 9ICHA 1Y89A 2C95A 2QVGA 4QNRA 5A7HA 4BKPA 4KVFA 4MQ6A 4RD2A 4C4ZA 4ZJYA 2NX2A 3H8VA 1BKDR 5TMBA 2WAQC 5CCEA 3J7TA 4YVZA 3EBLA 3LKVA 3VO9A 1NY5A 5JAHA 1X8JA 3K5HA 3B3GA 1H6BA 4LG1A 3QUCA 1O5IA 1UMDB 2ORIA 3IR5A 4LWPA 1KSGA 2A88A 2VSNA 2FXIA 1RM6C 2XYVA 3BTUA 3Q8RB 3CONA 3D2LA 4TMXA 5TE9A 1HRDA 5DX0A 4IMPA 4JA2A 4FHCA 4JQYA 3TL2A 1AO3A 3DGFC 2OFPA 4KPUB 3V80A 1VLLA 2HHTA 1FVHA 1DO0A 4NL9A 1RYUA 3TW0A 2G1AA 3GWGA 1F0KA 4Z9FA 2FLWA 4XD2A 2BGNA 1DELA 3C3BA 3LVFO 1YZUA 3ZW7A 2VHJA 4PTYA 4TSFD 1RWMA 5EZSA 8AT1A 4FFNA 1HNWB 1IWBB 2HGZA 4LF8B 2BZ1A 5T4BA 1IN5A 4R65A 2B61A 3AL2A 2COKA 3BJEA 1KN5A 3COWA 3PFGA 4WVLA 3S1AA 3UEOA 4ABTA 4TYYA 1YT5A 4CKBB 5GAJA 2D5BA 1IWOA 1LDGA 3K31A 2K8AA 3RKSA 4EPYA 4OD0A 1MV5A 2FB9A 4ZP1A 5K8TA 5KYYB 1AURA 1O89A 3QJGA 5K03A 4P93A 5JI2E 3AZOA 2H8KA 5LJLA 4WACA 2Y1OA 1WX1A 1IEWA 2FZGA 3CUYA 3B6KA 2B1GA 1Y3FE 3C85A 4KSYA 4NYIQ 5DM4A 3TJZA 1XP8A 3R8FA 2CPRA 1M1XB 1FDTA 1TJ4A 5DB4A 1H8ED 4PYNA 1HTTA 3FG9A 2OV3A 2IXGA 3GAFA 1ZAYA 5JRJA 2YOHA 2BISA 4ARZB 3NDRA 1JIKA 3ZQJA 2JLYA 5CB1A 1M67A 3CC8A 3HFJA 5KTOA 1I7DA 2EZ4A 5LZ2A 3ACCA 5TLSA 2DFKB 2N46A 2XHEA 2C7PA 4LNUB 1WHSA 1USVA 2VP9A 3NTLA 3M6KA 2J30A 4DOCA 1SKBA 4DY4A 1QZUA 3DLAA 4HS4A 2R0QC 4JQZA 1MO2A 2JK0A 1A9TA 4KL8S 4Q3CA 5T6BA 2QD2A 2BR0A 1PP4A 2W2MA 1B6SA 4CQJA 3KJNA 5ED4A 1H0RA 3EXHA 2XNJA 1TKAA 2GZAA 2VWQA 2ZI7A 3GQBB 1TQDA 3LXMA 4OVKA 4PGHA 2OYCA 3ZGXA 5BSGA 3SAFA 2QX4A 3AJRA 4E5YA 5FADA 3VAAA 5FUMA 3QQ5A 5EIOA 4NU8X 1A8IA 2BCRA 3PGJA 1QQAA 3QQPA 4G0XA 3RODA 4MICA 4DWIA 4RLFA 3WB1A 1XKXA 4MR8B 9ICKA 2ZDGA 3OU6A 3RFXA 4DJJA 3WWCA 3VPXA 4O0IA 5C3MA 3ONVA 2JD0A 2VHVA 3QV2A 3GVHA 1V8OA 4QT0A 2HIMA 2YRWA 3KDSE 4FYJA 4PO3X 3IJPA 1INLA 2DBQA 3ID6C 1VOTA 5EVCA 1JZQA 5B2ZA 3UV6A 5C5DA 4ETMA 1LDBA 3UW3A 4OKIA 1DJQA 1WCXA 2GERA 3I2HA 1E4VA 4Z49A 2H2GA 3A10A 3KQPA 2QY6A 3CUEF 1NW9B 4KMMA 2F9FA 3WLSA 1GRNA 4JT2A 4MVJA 4OHWA 1BCRA 3SK0A 1EEHA 4YT8A 3MNFA 3TRHA 2GBGA 3LZDA 2MINB 3F6SA 3G2QA 1IUPA 3ONFA 4G8BA 3MGBA 3E70C 4I7EA 4M3NA 5LU8A 3LWNA 2YNMC 2LCFA 5KPJA 2IEZA 2I3GA 1GZ4A 1U2SA 2AI2A 4JJKA 3CH6A 2E4UA 4RVCA 1Q84A 1HEYA 2PIAA 2JD2A 4EF5A 1IG3A 1K8YB 1SOWA 3TECE 1RLMA 2ATXA 3RBXA 3VZPA 4S35A 3TOXA 1UPXA 3L7KA 1I94B 1BROA 4Q8EA 4UAZA 4IJ6A 3AQFA 4D74A 4C7JA 1N25A 3R44A 1MOPA 4UOZA 4NVRA 1E3LA 1PJRA 3MPUA 1K7YA 3S99A 5J2HA 2VYVA 2PGJA 1QCKA 3HS3A 3KKPA 2X8BA 4O0LA 1XN4A 1XF1A 2O7SA 2ZYGA 4DSZA 1JDSA 4GL2A 1SZDA 4FDTA 4H0NA 4OQ4A 4LY6A 4N39A 3DWGA 4ZD6A 2EP7A 1KZGB 4A5OA 3FGNA 5HJ7A 3VKUA 1ZOLA 3OF2A 4PZEA 5TQ2B 5D5HA 1UOQA 2R8ZA 3W06A 2O8BA 5CD1A 4IMIB 2V65A 3F5FA 2UZAA 5BPHA 4U3JA 3JQ9A 4DB2A 5L40A 2N1RA 4NXZA 3Q7PA 3H5AA 2VRCD 3W5UA 4NBUA 4BZWA 4OCZA 4P92A 1KFSA 3WZMA 4MAAA 4Q1CA 1EB9A 3VJKA 2F2TA 2WZDA 1ZLYA 2H3EA 1XWFA 2I1LA 1JEEA 3L84A 1L7MA 2EL7A 3F49S 3VX3A 3Q2OA 3QXGA 3IULA 1I7SB 3O2QB 4I50F 5H7XA 5AJZA 5GP1A 2BGWA 4LBWA 1IQPA 1ZUNA 2FDXA 4MJ7A 4XRRA 5GADl 5BNTA 5REQB 4WESA 2FR0A 2R1UA 3WLLA 2A5LA 1DRWA 4A8HA 5HJEA 5L1KA 2ZRJA 3EX7C 5JXHA 2C5EA 4OP2A 5H82A 2H7XA 5GTDA 4GYYA 1YQGA 4X95A 1C0KA 1HUQA 9ICNA 1C8VB 2OEPA 5DG8A 2HEGA 4MV8A 4XM1A 4BO3A 3TLGA 4I4TB 1SXJB 4BFCA 4HUQA 1HDOA 4F7DA 2V7XA 8ICZA 1BA3A 4AW9A 1FLAA 2A84A 2BJWA 2O7RA 3TTWA 1KEKA 3KZCA 1ZQVA 2HC9A 3IEMA 1AV7A 2QW0X 1OJLA 1WMAA 5AM0A 3UXPA 1W4AA 1PG5A 1LJLA 4KACA 4K3UA 3D8UA 1KJZA 2YJ5A 3A9SA 3T15A 3T9CA 3IELA 3AQ4A 4II2A 2Y1XA 1CJCA 3TLXA 4C06A 4LSMA 3MUOA 2P3LA 4AYBC 1NMEA 4MUYA 2PG3A 4ZCQA 4YRRA 1JGTA 4YP5A 3I4FA 1ILEA 4GXKA 1BHO1 1G20E 3BSYA 2DX7A 1L5GB 3A25A 2JG3A 4Q00A 1KAQA 1NJGA 1XJWA 1ZA1A 1JEAA 4IIJF 1MAAA 2JAHA 4KAAA 2FKAA 4HDRA 1Z73A 3M3HA 4MA5A 2AGOA 1X1RA 4AYBF 1DEHA 2B1IA 4G1FA 1Y9ZA 1EFVB 1XLVA 4C7OA 2AUNA 2CE7A 1TQ6A 3KK0A 5IAJA 3ZCQA 2BY4A 4EJ0A 2ZWIA 2E18A 2PFNA 3UK0A 4XJVA 5FPPA 4AL4A 4AX4A 2ZTUA 3D2QA 5C5EA 4XGKA 1N8NA 5CHYA 3IE1A 3AQIA 4EUKA 3AP1A 4OBXA 1YMVA 2DU8A 4MWOA 1E6CA 5B5SA 1DEOA 4HN2A 2QP3A 5D1NA 5BT8A 1NLUA 4Y7DA 3GEHA 4NCKA 2BQUA 1NFQA 4JLOA 3RJJA 4OKNA 1DIAA 1XD2A 3EB9A 3SYNA 2F2AB 4N0DA 3L5OA 3O82A 1UHUA 4OHBA 3LJKA 2GN6A 2OD7A 3ZWBA 4XIYA 3DDZX 1CJBA 2PQ2A 1T2CA 2P3OA 2YV3A 3Q4GA 1YRLA 3SBOA 1YK1A 5IVPA 2JLAA 3QX7A 4PFQA 1L7BA 1OUMA 4CLDA 2C4VA 1BYIA 1J2UA 3OWOA 3K8QA 2HLHA 3OC6A 3KVNA 3EVDA 3F8TA 4I08A 4TLLB 3DOIA 2IZ5A 3LM8A 2VXBA 4YY3B 1RCUA 3UMCA 4J1TA 4RIIA 3L04A 5C4IA 3W7AA 4FHFA 4BBJA 3EH2A 2WSSA 1NBOA 1GAJA 1QPBA 4M0AA 2LKYA 3SZ2A 2VNJA 5DGTA 4ZQHA 1U04A 4CIYA 4CM4A 2X8WA 3H4MA 1C1DB 3T7IA 3IKMB 4FYMA 4IHQA 3RC2A 4P3NA 5FCDA 2HK6A 3HJRA 5FR1A 1YOVB 3UAGA 4TMZA 5JUMA 2BUAA 2OR3A 2EJBA 4B9EA 2FH5B 1Z7GA 3B2EA 1H2YA 3U4QB 3LFHA 2ZBVA 1HEIA 1N8TA 1ZC3A 3F5DA 4FHGA 4N6NA 4H1WA 1DS6A 4Y2YA 1O9HA 1Z9BA 2JJMA 3TI7A 1UDCA 4BQFA 3UJNA 1UBEA 3IB6A 5KFMA 1ZD1A 3FXAA 4NIMA 5G40A 2PWPA 2BCSA 2C3OA 4YP6A 1KVTA 4LHYA 4ZU1X 1D1SA 1J20A 1JPUA 1L7AA 1SBIA 4HFNA 1SWWA 2NU8B 2YWFA 3PR4A 5EE0A 5I7WA 4B6JA 3L0YA 4O5AA 4EYHB 1S3GA 2PA3A 3LQYA 4YV0A 2VZLA 1Y8AA 1U47A 1P0FA 2WPDD 3KWJA 1E3DA 1KI8A 2AVNA 1SKMA 2KX7A 4JB8A 1WG8A 1L5UA 3UJDA 4RQNA 2XGMA 3FWHA 4CM3A 4G0VA 1DQYA 2P62A 3AJ9A 3VH4A 1MAUA 1YI0A 3V33A 1XN1A 2FMUA 3D3NA 3QXXA 1PFKA 5I9SA 1LI4A 1H42A 1DKMA 4PHHA 3W79A 4XGQA 1XMVA 2VYFA 4DKXA 3WYNA 3GX1A 3IQDB 4NAHA 3VR6H 4DDVA 3DMYA 3CF0A 4XSGA 5E9JA 3E5MA 3QBVA 4BVLA 1CUDA 3IL2A 4IHAA 5BR1A 3JD3A 4QAQA 1XDWA 5A5FA 2JIDA 3FA2A 2GX6A 4A5SA 1K9VF 3OTWA 1SXQA 7ICIA 1F4VA 3ABSB 1Z1BA 3PS9A 4HNGA 4TS9A 2VBGA 3RBAA 4YCNA 2RIRA 3AB7A 1XV5A 4UHCA 4TTQA 1DKUA 4HNHA 4DNQA 1YZKA 1RYBA 2X2PA 3CXUA 2X1LA 5A6SB 1YS7A 4H7HA 1EE9A 5KCMA 3C97A 5E6UB 4YPFA 3OQHA 3TZLA 3OE7A 2C7GA 5E2BA 4FONA 2I6TA 1JI0A 4O8CA 4LGVA 1R10A 4KWTA 2FSUA 1NKCA 9ICLA 2W48A 3FVVA 1PZFA 3PUIA 4GAEA 4QYTA 3KEMA 3EULA 1ZCFA 1ETHA 2ASDA 4Q7MB 3HXLA 5LSAA 1GNLA 2DUUA 2R2AA 1G55A 4NZZA 5JC1A 4ZCSA 5FX2A 3DVAA 4YFKA 2WWRA 2IA5A 4BB5A 3FBWA 2SKDA 2GAFA 1SWVA 4NEQA 3K75D 1M2OB 1JWAB 3PB3A 3AY6A 2VP2A 2C2GA 2RGNA 3L4BA 1RM3A 3PL1A 4H17A 2RB4A 2X0KA 2NSLA 4ZI7F 5KFSA 3ILVA 1DQPA 1YV9A 1P4SA 3PLRA 1I36A 3GLKA 4MW9A 5DNVA 3RS8A 3VVMA 1I13A 1VGVA 3KE8A 4HSGA 1T9ZA 5F51A 4Q93A 4AN1A 1K8RA 2CVOA 4DQUA 4J90A 4RNDB 2IQIA 1QGUA 1Q19A 1QCZA 2PSDA 2XE8A 5FUWA 2GMWA 3ECAA 3R7WA 4G1UC 4IOMA 4BDPA 1UXIA 4NNPA 1F4LA 1T9HA 2GCEA 4U00A 3C2KA 1U8AA 3CMMA 2QVCA 3H65A 2P4HX 5CCDA 3OCCA 1IIBA 2CCGA 3F7OA 4D5EA 2P6RA 1L7QA 1KI2A 2UVQA 3RSZA 4IS7A 3WK9A 3EYZA 1FPQA 5KYVA 1OE0A 2WKPA 5J2TA 1DXHA 1HSOA 2GEJA 2BWJA 1HI9A 4J9NA 3X1YA 4E3ZA 5JAZA 3CKKA 2ZBFA 1ZEMA 4CL3A 2IEIA 1WV0A 4ZKDA 4ZCLA 4LHVA 4BJQA 1IEQA 1YR2A 4FDVA 3BOSA 3LY8A 4D92A 1XEXA 2AYXA 3F1LA 2VOJA 4PBTA 3RJ9A 1TF2A 5FOVA 2XYGA 2Q3MA 3AERA 4JLBA 4QQFA 3V5NA 3RAFC 1M2EA 3HDJA 5K3FB 1T3TA 2V7EA 3PFNA 1ZCBA 5JU6A 4OI1A 2C9OA 4F8EA 2HEIA 2XQKA 2VJNA 4S1WA 1ATZA 1HTWA 3EAQA 4F72A 5AHWA 4I66A 1UL1X 2WQZA 5B4UA 3DLBA 2WPDA 4ARSA 4JVSB 1XMOB 1GR1A 1V2GA 2XDQA 1OUQA 4YPOA 1YB4A 4GOKA 3KZKA 3Q7IA 1WY7A 2FFRA 4PAWA 2E3JA 5EZYF 4BX9A 1E3JA 3IHQB 1V7QA 2CJXA 5DM2A 3HVIA 5FUVA 4NECA 3T3PB 3UYKA 4RJTA 4X65B 1SD5A 1HA3A 1LKZA 1VJCA 4F1WA 3B7PA 4CMBA 1X66A 2KW5A 1OH6A 4F5RA 3IPCA 3GCDA 1UAYA 3F3YA 3TKYA 4TVKA 4BO4A 2W11A 3IOCA 1M6EX 1YUBA 3QKSB 3IVXA 3R2JA 3U1BA 1IBMB 1L4KA 2JFNA 1IUKA 3KJEA 3AB8A 1LD3A 1VMEA 2R6AA 3C24A 5CX1A 1RPJA 1JLHA 3WYAA 1QUEA 2IZ6A 1T34A 1L4LA 1GNTA 1H93A 1IHUA 2P9BA 2XCQA 4U9UA 5FLYA 4UUOA 1IBSA 4P80A 1VKHA 4MZXA 3SQDA 3WXBA 1S4MA 3DAYA 5HE9A 3EZ6A 3ESXA 4BNNA 5DG9A 1JAXA 3G9TA 4ADSG 4HMOA 4JS0A 3ZHYA 3VZBA 4MO9A 4L8VA 1NKTA 3VYRB 1OC4A 2GN4A 1PNOA 3SENA 1SUAA 3JRWA 4RF5A 1DTWB 3E3OA 3T3HA 4B4DA 1YZTA 3A26A 4TV8B 1YZQA 3CCFA 2P2DA 2I4NA 1A0PA 1A04A 1NDUA 1X7YB 2MHCA 4MEBA 5ECGC 4EY6A 4JKOA 3L0DA 1QH9A 3IRVA 5AM5A 3KOWA 1N4DA 5KFQA 4B3TB 2HD4A 5AW5A 4DL9A 3OO1A 4PO8A 5IJZA 1PR4A 5BURA 3UUGA 2FNAA 3K35A 3L0ZA 3RVDA 5HIJA 4MP6A 3S55A 4LPSA 1B4DA 1NRWA 3W6NA 3EDMA 3ZDRA 1L5VA 2ISCA 1SC6A 5EESA 5A2QA 4RCVA 4X61A 3EEYA 1FTSA 3G6XA 5DHUA 1R64A 3REOA 1XHEA 1ZVMA 3IV9A 2WUWE 3O2NA 4R4JA 4JC4A 4KMOB 1PFVA 5FULA 3DOEA 3GXBA 4PO9A 2XWQA 3E9NA 1K5HA 2XSZD 4FPXA 1PEAA 4GICA 4CM8B 5JWOA 2B4RO 1JKIA 1XNJA 4CI0B 3DZHA 5AD1A 4DC0A 4NH0A 2IU4A 2W03A 1XSPA 4B3CA 2P9JA 4QQ8A 2VHYA 2Q3LA 3WYDA 4KLIA 1E6LA 5DU2A 2VH2A 3GLHB 4JT8A 5CJ7A 3CSSA 1ZDMA 1SA0B 4JSTA 1FNDA 3SYMA 5JSFA 3A3YA 4XDZA 5BRJA 3ZI7A 4PZAA 2Q6OA 1EUQA 1W8DA 1PUIA 4M49A 5I45A 3MILA 3PGMA 2X0EA 2B94A 1T4MA 4QGFA 3GJ8A 3L0BA 2FW8A 3HCOA 3VR2D 4BX3A 4F9FA 5F4ZA 2I4OA 3Q5EA 1HEKA 2EDCA 3KEQA 3BB1A 3F78A 2IMWP 3AILA 1X9GA 2XKBA 3A4VA 3KALA 1PK3A 3H83A 1TO6A 4L4UA 4K4IA 2A35A 1NF2A 5M3BA 1YASA 4MROA 4BE7B 4RY0A 5BW8A 1FY2A 2YFQA 3QVGA 4TV9A 4J9LA 2FG5A 4LC9A 1NQXA 3KOYA 3A1DA 2QRHA 5EERA 1N2HA 4KNYA 2NAFA 3B9RA 3KSUA 3EEQA 3NW9A 3GUCA 3NKLA 1MVLA 1ZN2A 3R0IA 4MW6A 4DMHA 4HB2A 2Q46A 4BQEA 1H4TA 3HRDD 5EQJB 5IVHA 1VL5A 2DFLA 3IIMA 3ND6A 4ZO6A 3N5CA 3RKUA 5F3RA 2QDKA 3DBLB 1A9ZA 2IS2A 4IHKA 5ALXA 4BFTA 5K6TA 5AUNB 1B6TA 4D0RA 1KOFA 1E9CA 3SD7A 3CIOA 3P2OA 5EJAA 2FAXA 2BKAA 2HM7A 3PNCA 1CHDA 2O07A 4FC7A 5LQNA 3RYIB 4S1PA 5J58A 3CX3A 2BKEA 1E4OA 2LBPA 3WRWA 1OASA 2EKQA 3CUVA 4ALMA 1AQ6A 5KNCA 3QVWA 4GKKB 1JN3A 1S2IA 3KSDO 4OOEA 3K70B 2C5FA 2J3LA 2YVAA 1JHVA 3TGWA 5DB8A 2I6XA 2C83A 2MSLA 1XTJA 4G9BA 1E61A 1V1RB 2OM2A 3BRQA 3E22A 3HUTA 2H4WA 3ND7A 1IB0A 1TPYA 4M0MA 4RA9B 3NM5A 4X00A 1JFTA 1C0PA 3JYHA 3SHFA 2HO4A 3KEGA 2JASA 4RT3A 5BV2P 1ZVVA 3GLUA 1A5ZA 5AI4A 1E5LA 2DE0X 2VYVD 3H6HA 3L43A 4L5CA 2CL6X 1Q21A 4TN1A 4BCCA 2O3RA 4RA6A 5KG4A 4H3SA 4OJKA 3FOZA 2YINC 3A1VA 4IS3A 4TQSA 3O0TA 3GMIA 4UW9A 2LHTA 4FBLA 1ENYA 2VF5X 4K1XA 4IIHA 2YWBA 1NR5A 4J0QA 3WIVA 2GHIA 4YLEA 5KVSA 2WJVA 4UULA 2XCUA 4ND4A 4Q4AA 1N6OA 5I8ZA 3K2QA 4KR6A 2AR7A 1R7RA 2Z5LA 1U4OA 3VU3A 4U2FA 3GRCA 4YDSA 3RYFA 2Z1NA 1L5ZA 2F1RA 5EWLA 3Q8MA 1IVYA 3PSFA 3ZHXA 2EHJA 1QK5A 1L5WA 2CXYA 1B8OA 5IZCA 4UZFA 4WERA 4GPIB 4YGYA 2O23A 5ENVA 5DULA 1CYDA 1UXJA 4WESB 2QAGC 3NHPA 9ICGA 1ENOA 1HDYA 2WSBA 4N6OA 1MO6A 4YLGA 3CVOA 4S05A 3QBJA 4GQAA 2ZJYA 1A4RA 1VCMA 4YRPA 5H59A 1K0UA 4R41A 1CQPA 1RIFA 3LXRA 3RV4A 4F3RA 2B1JA 2EBFX 2I62A 2P1ZA 2LR0A 3NYIA 3PCXA 2CRXA 2YJNA 4QREA 5E2AA 4L2IB 4URFA 4IFIA 3U7JA 4B2YA 1TVKB 1FQWA 1SKSA 3ROMA 3QNWA 1UWKA 1C0LA 2IYAA 4FR0A 2RLTA 2VF7A 1P3DA 1XZ8A 2JEZA 2ZI3A 1KMCA 4DDTA 5AMXA 1MGPA 1DIOB 1KH2A 3GGOA 3PHHA 1ADFA 1J8VA 1YA4A 1W94A 1TCVA 2OG1A 4TRNA 5DTRA 2AKAB 4YJFA 3H2IA 3O7WA 4I4IA 5M2QA 4ZREA 5BRAA 2J9FA 3VNRA 3M4ZA 4QZCA 4MKFA 1H6CA 4MW1A 1K75A 1KDOA 2IP2A 2JF0A 3AJAA 3OZIA 1XAGA 3L79A 3QPBA 3E5RA 2H1VA 2E7ZA 1MN6A 3ROGA 3M6UA 4C6HA 2Y93A 3RYCB 1VSVA 5C0YA 1W59A 2V9ZA 2Y77A 3WRXA 1WY5A 1JBQA 2JRZA 1YOVA 1H8EA 4Z9BA 2YYYA 1N6RA 3HKBA 3DAGA 3EPLA 2IYUA 1ESDA 1AKVA 1BH2A 1DBRA 4O3QA 4KIWA 5F1KA 2O3QA 3HYTA 1ZOOA 2Y0DA 5AUQA 4BVJA 1EAMA 4TUSA 1L4YA 2P40A 4AJKA 4ESOA 3QEBZ 2VEOA 1KQ3A 2A67A 2VPWA 2AHOA 3Q12A 4S1NA 4DR2B 1U28A 4XLZA 1T3GA 3W1VA 4QGAA 4HVLA 3RHTA 4UHBA 4R2JA 3MFHA 3U81A 7ICGA 2HWUA 4Q5IA 4G09A 3T4PA 2K60A 3ORRA 3CINA 1IMJA 2ZRGA 5G1NA 3WDSA 1VGRA 2W8BA 1QK4A 2YFYA 3V4OA 4BQPA 3H3XA 2FETA 1ZCAA 2XMBA 1CVRA 1ZIXA 1JE1A 3FOEC 4CG3A 4ZAVA 3GUYA 3HCFA 1J2NA 4LXUA 1G5IA 3TH5A 5C46F 1H2AS 2RDIA 2HPZA 2DVMA 1HFJA 2J3QA 4CJXA 2GKOA 1E20A 4MHVA 1J07A 1O7JA 1VKJA 1PS8A 2GJAA 1ISFA 3BWBA 1T8RA 4ECUA 2YC4C 3JATA 5EPUA 1X9SA 2HSZA 1HK7A 1TJYA 2QQEA 1Z75A 2IWHA 4O2LA 2IDMA 4U2DA 1WQ1R 4EW6A 2ZQ5A 4UB3A 2WMYA 3GEPA 1WAMA 4IG4A 2WOOA 3IXQA 4C29A 3S6JA 5IIMA 3HLKA 2AJCA 4V2IA 4GBGA 1O4WA 4DTIA 4ZTBA 2LKDA 4KLSA 1NOIA 3LD9A 3QZUA 1UOOA 3JYPA 4Q18A 4AM8A 2WAQF 5KEIA 4X45A 1I30A 1TZMA 3Q2KA 2HBMA 5DP1A 1ZM3A 4Y6SA 3T5CA 3TJRA 2IUUA 1Q0ZA 5CRXA 3PC7A 1ZJWA 3BL5A 2ASEA 4KLUA 9LDBA 4TT8A 1ZN9A 1QAOA 4BFZA 2ZE5A 4NU0A 1N2OA 2ZVDA 1UK6A 3CX7A 1ZM4A 1R1DA 3ENVA 3SQMA 4JI6B 4EDHA 4US2R 4GP9A 4LS3A 1Y8ZA 3MRTA 4KXQA 4CHTA 1BU5A 4E5NA 2IBTA 3VC3A 1Z36A 1HE1C 3CZAA 3GIIA 3DV0A 4TYQA 5K20A 1V9LA 3WYGA 1EXDA 5HXAA 5DNDA 2ZUVA 4O02B 5JQWA 4KVGA 5CLGA 3RIYA 4B2IA 2OQRA 4GI2A 3HR4A 2NNWB 1PVRA 4G3IA 1DLIA 1XELA 3A9UA 5BWNA 1N5WA 3R7SA 2UZ0A 1RPZA 1TAUA 3NETA 4ENSA 1GFWA 1OTXA 2VJCA 2XDAA 3HZOA 4I1OA 3OEHD 1T5BA 1TA9A 1EVYA 3C5VA 3KAJA 4ZAWA 2AFIA 3U9LA 3HJEA 3FOFC 1EFPA 1TTTA 1WTCA 4CF6A 3I53A 4IDGA 2WIAA 4FE4A 3Q1KA 2BKUA 2I7CA 2JFFA 1VZ3A 3E7XA 3WLKX 4DR7B 3EXEA 2Z9BA 1T10A 1QQ5A 2L82A 4UDNA 3UMFA 4EFNA 5C8ZA 2O2YA 4WT7A 4DLBA 4B3IA 2OBYA 4EB6A 2J5XA 2NXCA 3KD2A 2PRJA 5LOVA 1ZK1A 4OFZA 1JRLA 2LE0A 1NY6A 4P33A 5G0UA 2FX5A 3PJGA 5FIUA 1WUHS 3VH3A 2YXLA 1V9PA 5BO5A 2CHFA 2ZB2A 1LNSA 4M0EA 3B1YA 5I7UA 1XPJA 4RDCA 2WTUA 5FTWA 3K6SB 2P27A 4EOGA 1E6UA 2ZUFA 1WZNA 4ER7A 4CKZA 4N0EA 3SR4A 3W3ZB 1Y3BE 2APJA 1N5IA 3H3FA 2HIGA 5A9TA 4RGYA 1ENZA 2HA6A 2NUTB 4O3FA 2JFZA 1EE1A 2JZBB 2W7TA 2XZTA 3M70A 3NTOA 4X6YA 4EB0A 4DV2B 2BEVB 4OJ5A 2ADMA 4YVFA 3SZMA 2HVIA 2WKSA 4I99A 4CT0A 1BDMA 1KZ6A 3BMQA 3NVDA 2WIJA 1KAHA 5AKHA 4CR8A 2H54A 1L7NA 2YIDA 2LM1A 1Q3KA 1TKRA 3BWXA 3PSPA 4L15A 4MQMA 4JC0A 1GILA 3L0CA 5K09A 9ICFA 1KQOA 3IVAA 3L8DA 4QYMA 2PH7A 1I4OA 2CJWB 3QLUC 4H7EA 3QYJA 3TI9A 4PE5B 1BXRB 2A3NA 4TQRA 2ZBGA 3BMCA 5AW7A 5A0LA 3THXA 8ICPA 2AWOA 4OI4A 1KPHA 5J2AA 2BFBA 2OO3A 4XWAA 4DMCA 4NBKA 1CEZA 3PO4A 4FQ5A 4B4KA 4BKMA 4DWOA 2Q7OE 3E48A 3EEFA 3IKJA 4G5OA 4FE7A 3U7RA 5C32A 5JD6A 2JHPA 3G6WA 4C2UA 1L3VA 1T9BA 2RHGB 4KQWA 5HIMA 1Z29A 3PP8A 1O0SA 2CHEA 4OU5A 3X1KA 1AQYA 4TWAA 5G3YA 4EG4A 4IUCS 2NLOA 3RVBA 2PQ0A 1J24A 5F9LA 7ABPA 3EXG2 4I6GA 4OAQA 1RCTE 4RZHA 4YJGB 5DNWA 4ZT5A 5FKJA 2HDHA 5DCLA 5H1YA 5HZMA 4AYTA 3AL0C 2P5TB 2CMDA 3K0SA 1AE1A 3BK2A 2VPYA 3C87A 1KDTA 4X3CA 2X15A 2YWCA 1ZK2A 2Y0CA 4YH1A 2IHNA 5L1MA 8ICOA 4DNPA 2FX3A 3BGSA 1X7XA 2R68A 1QIFA 3NUGA 3U3KA 4E7OA 2H2WA 3AVYA 3RAXA 4IIEA 1U2PA 5DRTA 3D81A 3OX4A 4KQ6A 4IDHA 1AKYA 1DGSA 1AVTA 1PT5A 3GFSA 1FQKA 2BM0A 1NVVR 2PZMA 2V6GA 1C1YA 2D3TA 2TSYB 4WMLA 4BGUA 2W42A 3PLAE 3BN3A 2VPIA 4FE3A 2VN8A 3DAPA 1T35A 2ODPA 3ENZA 4D43A 1RIIA 2NOAA 1THMA 4EUFA 3C4VA 5HP4A 1Y3AA 9MHTA 3T9DA 4HQLA 3H87A 4BTVA 3VR3D 2XOKD 9ATCA 3BK1A 3QOYA 2D8MA 1XDBA 4QFCA 2V4ZA 5K8UA 3H5OA 3MRSA 2QB0B 3IT1A 3HXKA 3QEKA 2EKZA 1N3IA 3HJNA 1GPDG 3PG5A 3MYYA 5JZSA 1QX4A 5CDUA 4XTRA 4PC6A 2OGTA 3EIFA 1HUOA 4QM7A 2J8ZA 3O4HA 2IGBA 2GAOA 3M5WA 1YE5A 2B4KA 3WXMA 1VFPA 2O2SA 2ZE6A 4D0LB 3DB1A 4O2AF 1CDZA 2NN3C 2NWQA 1KK1A 2BZ0A 3G2KA 3M2PA 4W99A 5EUQB 4KR7A 4GL4A 1X74A 3QU2A 5IAOA 2WINI 1B43A 4YCDA 4ZAYA 3VBCA 3NPAA 4MA0A 2LKCA 2I4MA 1F5NA 3EZ2A 3OE5A 4HH1A 5LZ8A 5A06A 4RTSA 1Z2CA 1K4YA 3GJXC 2UYGA 1IAQA 4HLUA 3LXXA 1AKTA 3HJHA 3OTHA 5KVVA 1TF7A 4BKOA 3CZQA 1JB1A 4YMGA 3TOSA 5IULC 2GLEA 1CEXA 1KIMA 2ZIZA 1I4TD 1A96A 4RVSA 1FFAA 1SHZA 5CB8A 13PKA 4R8KA 5CK4A 3II6X 4OJQA 1OFUA 1UQTA 4I4TF 4A26A 4LECA 4E22A 5JPDA 5EJ4A 2FQXA 3TLEA 4PHAA 4EJMA 2X0DA 5KAMA 1XI2A 4KYVA 4Z7NB 5EE9A 8ICLA 1CUZA 2LYAA 3PXBA 5K1ZA 3RB6A 2IOHA 5DLPA 3D6JA 2ZS7A 3FPKA 3N6VA 5CBKA 2JD1A 3L8MA 4YAUA 4O5CA 3SXUB 5E2IA 2ADFA 4F7WA 1JXLA 2CY0A 1DOAA 3VJLA 3KQSA 2FSSA 5J2GA 4BFUA 5BW6B 4CEJA 5C7OO 5JPIA 3HKEA 5AVTA 3UHFA 4MXDA 1JEYB 1UANA 2EF1A 1TOAA 4AZSA 4IFEA 4P34A 1XCBA 1KF0A 5ECYA 3TQTA 3RJTA 1KP2A 1TNDA 5KVAA 2V7TA 5CT6A 3GLIB 5B2FA 1WWUA 4REQB 3ZZTA 5CYPA 1VXOA 5B58T 5AOBA 1E2NA 3IAFA 2I29A 2W22A 2HJWA 2JRLA 1EZZA 2Y3IA 3LCCA 4OK5A 1QU3A 1XQ6A 2GARA 4ZQIA 1XPOA 2L18A 2M9MA 4OXYA 1PJLA 2BMEA 1W5BA 3NHWA 3R7FA 4E07A 1C4KA 3IX7A 2G88A 3C6XA 4IVRA 1COOA 4I4LA 2P6MA 2VBCA 3AUFA 4RDHA 3I5XA 1EJ6A 2Z1DA 4G89A 1KYTA 3KQWA 2MCFA 2DHRA 3LDHA 1P0CA 2FK8A 3M4YA 3RB3A 2D59A 4GMDA 4P5DA 5GVRA 3DFFA 2PH5A 3A58B 1WU7A 2MSEB 2ON6A 3FLBA 1X1BA 3HKCB 3K0FA 4FDLA 1CVLA 1LF5A 2KHZA 2X0IA 4O8ZA 4D3XA 821PA 2CT8A 1M0EA 1DSSG 3ILHA 1K9SA 1NI5A 3OGUA 1VIMA 4OQMA 2IEYA 1RAGA 4TROA 4X7PA 5DCYA 1CULC 3SC2A 4OQZA 5LXTF 1MB9A 4M9HA 3QKSA 3PSHA 1F8UA 3CM0A 1WUYA 1CZLA 1TJ5A 3ABZA 4FIZA 1Z63A 1HFKA 3F90A 4AUKA 3AEUB 4J7XA 2VWHA 5JRZA 1OLSA 4DPLA 1C5KA 3LUKA 1IVSA 2H1SA 2Y68A 1X92A 2C29D 1WD5A 4WOBA 3W1WA 1G21E 3O9VA 4ELUA 4P08A 3VYVA 1MRNA 2J33A 4IV8A 1W8IA 1YZGA 4I1IA 4Z2YA 2AMJA 2WJPA 3DMDA 2XUFA 3HB9A 4K6CA 4AS3A 4CG2A 2AFHE 4W63A 5KT3A 1VM6A 3V34A 1LW7A 2Z8YA 4JWMA 3LHSA 5K2MA 2NW6A 3FGPA 5JEEA 2NSHA 4QECA 1ESNA 3EVCA 4FINA 4PX3A 4EAQA 5EIXA 1QS0A 5ALUA 1PZNA 4LJAA 3E82A 4I28A 3G2HA 3HBMA 1VL0A 2EATA 5AICA 2XTZA 1Y1QA 3DC2A 1STOA 4EQ6A 1W4BA 5LKAA 3PSTA 4NHEA 5TX7A 5CXSA 3TQIA 3P7MA 3SF0A 1HT1E 3EZ9A 4H6VA 1KEZA 1WRBA 3EQ6A 5KUTA 3QOFA 3V7JA 4FD2A 1P0MA 4YO8A 2VANA 1TIBA 4TRJA 5I9MA 3X1JA 3W04A 3ZHUA 3M3DA 4HX9A 1YFKA 4E88A 3UIEA 4GYKA 1PL0A 3F6EX 2HCJB 1QYWA 1Z00A 4QW9A 4ZAGA 5C4GB 5P21A 1BWPA 1LPMA 4N5HX 4Q3BA 2JXJA 2ECPA 2R8BA 4Y9TA 3GLIE 1Q5PA 3ORHA 4TV9B 2QN9A 3QUBA 3EF3A 4F6LA 2PR7A 2J5RA 4C4OA 3QX9A 5HUQA 3PHCA 2XNSA 4W1QA 3A27A 4BUJA 4Z7OB 3GBPA 4C3VA 4TWBA 3RUHA 4G4SP 3TOCA 1JBKA 3NT4A 1GKUB 2PXHA 2Q28A 5L3QB 1A0OA 4DV5B 1IK6A 2CV0A 1IQRA 1GZ3A 2ID8A 3IESA 1EVLA 1JHZA 3EFOB 5EJ2A 1U31A 1QO7A 4QL3A 2ZT8A 4JENA 5DK6A 3R1IA 3NHFA 1VPDA 3BORA 4IRCA 1JSZA 3ZWVA 4J7CA 5G0WA 3P9YA 4YD2A 4KR2A 4MIKA 1DRKA 3N0WA 2EWWA 3JRXA 1K7FB 4KV9A 4N1AA 4LF4B 1RJEA 4O5KA 3OQ6A 3PW4A 5EMKA 2COUA 4H27A 2ZSDA 2QIPA 3AUJB 4RLHA 4XAQA 3RQSA 4CVNA 3T9FA 3ORSA 5K0JA 3LRTA 3PQ5A 4UB5A 1OMOA 3RR2A 4QBKA 4D9CA 5BN1A 2NQ2C 1GGHA 1XSEA 2P3QA 3I73A 4CL0A 1JTEA 3ZUGA 4ZTZB 3HJCA 2W8BB 3IFSA 3OX2A 3FKSD 3OOJA 1ZIOA 3PRHA 3PE3A 4Q3AA 3DO6A 4KH1A 5CIQA 3LP6A 1G3MA 4ZT7A 1L5OA 3A2NA 1H3EA 1PVOA 1K5PA 3F2DA 2NT4A 2MOKA 3EXFB 1R4MB 1XRNA 4NV1A 2DPGA 4TSKA 4FW9A 1OFUX 4AJ9A 2Z5GA 3A11A 2QW8A 3OJCA 3CUWA 3WWOA 3U9SA 3LWBA 1C7QA 1JA9A 1HKHA 4M87A 2J7KA 1QTRA 1U0RA 1CJVC 3VAYA 2FLNA 3ZUPA 4D0SA 4CM5A 1VHWA 4RX1A 1SKRA 1YTLA 3DTYA 3EIWA 1GU7A 1SNYA 2IH2A 1RADA 1ZI6A 4I55B 5F1PA 3UAXA 1H4VB 5B3LA 4DV1B 4JUBA 1N2XA 4LTDA 2BFBB 2FW9A 4GPZA 2O57A 3GJQA 4ALNA 4LBZA 4UFOA 1Z83A 5EXXA 2J41A 3STHA 3AEVA 1CQJB 4B75A 3AXSA 5F3DA 3EIQA 1N6HA 1YHNA 3KHSA 1NK4A 4UHEA 5HF5A 5K7SA 3C3KA 4MQFB 3B2QA 4UMEA 2IHYA 2QTNA 2BL4A 2ECQA 2IS6A 2F00A 2QB0A 3CGWA 4ZO9A 1VZ2A 3ONWA 5IZCC 3VOBA 3D8NA 3BJZA 3V7LA 3QP9A 5TQ2A 2QF7A 4Y9DA 5D3MB 4ZT2A 2XB4A 5AWFC 4H1TA 3L92A 5A9RA 1U11A 4PBSA 2R86A 5IH7A 4W1RA 2F43A 1SY7A 4X6UA 5JANA 3U44A 1CB7A 4AF7A 4J94A 4RKWA 4XVUA 4PZCA 4TOIA 4M1MA 1CIPA 5ADHA 4DBZA 3VZQA 4G4IA 3SI7A 3GZJA 4MO2A 1VP9A 4B33A 4KGZA 1FEZA 4N48A 2GK3A 2XGGA 4H35A 3MIIA 1GPUA 1HFEL 4GDMA 4LY0A 1QIIA 3ELDA 3QJYA 5LVAA 4U5XA 3IMKA 4FCCA 4G5GA 2FWBA 1NW3A 2XQVA 3MWJA 3PQ4A 3Q9UA 3ZYZA 2HH9A 2JH7A 5JBNA 1LDYA 4WAUA 1SB8A 2MSKA 1QVAA 4OHZA 1WMSA 3LSYA 2HQOA 1XZFA 3DLIA 4OMUA 1GPJA 2GK4A 2DM6A 1WP4A 1W88B 2E1RA 2H1WA 1IVNA 2R44A 2FZLA 2W98A 3GGCA 6YASA 4CHGA 3R3JA 4JFRA 5CM8B 5J5VA 6REQA 1GUFA 3E22B 1NQ5A 1RTKA 4NH4A 4RAOA 4EHKA 3DM5A 3AM5A 3W5SA 5AHXA 1JECA 2JJ1D 1KBQA 5JH7A 3O8CA 2F1HA 4GSYA 4M37A 1Q22A 3AUSA 1G16A 2JLVA 2H5XA 1PK8A 1OWOA 3N58A 3OZ7A 4KLEA 3HU5A 4HWKA 1C30B 3AV3A 4JJZA 3CCBA 3L77A 3OH8A 5TNXA 5KWEA 4MUEA 5EG5A 4HUQB 1T4DA 1D09A 2WTXA 1J2JA 1VHDA 4EYSA 1XRLA 2Q3BA 2OCPA 3R7AA 4PWZA 5JDCA 2CGEA 4ZAZA 1FF9A 4MI6A 2EW2A 4LJ4A 5IABA 1WM1A 4OB6A 4ZVRA 5THKA 5JIBA 2FE9A 1TUBA 4RORA 4N49A 3BILA 4B8ZA 4C4SA 3S40A 4JLUA 3FDXA 4DHWA