4DQIA

Ternary complex of bacillus dna polymerase i large fragment, dna duplex, and dctp (paired with dg of template)
Total Genus 207
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
207
sequence length
579
structure length
579
Chain Sequence
KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural factors that determine selectivity of a high fidelity DNA polymerase for deoxy-, dideoxy-, and ribonucleotides.
pubmed doi rcsb
source organism Geobacillus kaustophilus
molecule tags Transferase/dna
molecule keywords DNA polymerase I
total genus 207
structure length 579
sequence length 579
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4dqiA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4dqiA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4dqiA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4dqiA01
5BOLA 9ICGA 2Z1HA 4B8AB 3G10A 4YXMA 5J0PA 2FBYA 4I2IA 1N56A 1HQEA 2HVIA 2G8VA 3HWTA 1GOAA 4EZ6A 5J2QA 9ICBA 3KKSA 3O4QA 5CYMA 3AVFA 2ZJAA 3UXNA 3IHQB 3GV5B 1ZQZA 4PH5A 2AQ0A 1RDAA 3K58A 4CEOA 5TZVA 1JL1A 4CEZA 3OGUA 1V9PA 4CJKA 1TKZA 1TVAA 5SWMA 3VQ7A 4F3OA 3K5MA 1RT5A 4C8OA 3LWLA 3RJHA 2X6NA 1Z00A 8ICQA 3GDXA 3QO9A 2XC9A 2F8TA 5KFFA 4RQ2A 3RBEA 2BR0A 4DTSA 4RNMA 1XO1A 3WNGA 4CJLA 4NCAA 2OYQA 2KFNA 5KFGA 4DU3A 4I2FA 2B5JA 1BHLA 3HL8A 5CR0A 2D0AA 1JXLA 2KFZA 4FM2A 4M0AA 4KLJA 4IQWA 2RKIA 4FJNA 1HYZA 4CGDA 4FLWA 2RDIA 1EP4A 4DFKA 3D45A 4RQ8A 5DGAA 7ICMA 1LW2A 2PYLA 4M3UA 3TANA 1RXVA 1HPZA 3HM9A 4PGQA 2MUTB 4BGDA 4NLKA 5CWRA 2R8IA 1IKVA 4RW6A 2ETJA 4MQ3A 4KAZA 5EWEA 5KG5A 4IR9A 3KK2A 2XCPA 3JPTA 1BPYA 2X74A 4E7IA 1NOMA 1CEZA 9ICQA 2HNDA 5DBCA 4P4MA 1ASVA 1CZBA 4ECZA 3ZSYA 4M3XA 4YR3A 1ZQDA 3EY1A 5KRSA 1C1AA 4KI4A 4Q44A 2XO7A 2J6TA 3VA0A 4CK1A 3RAXA 1CXQA 4DL6A 1BCMA 3OY9A 2NRWA 2NRTA 4B08A 5HMLA 2JEJA 4Q8FA 4F5OA 4DU1A 4YMNA 9ICTA 4CJEA 8ICBA 4I28A 4PHPA 3E01A 1RT2A 1SZPA 1ZQTA 2ITGA 1H38A 2WOMA 2KN7A 4CJ4A 2YKMA 4QW8A 1RTIA 4UAWA 2IS3A 2VANA 1SL2A 4ECSA 1WSEA 4E3SA 1DTQA 4RPXA 4YR2A 3MBYA 2BCUA 2AGPA 3MGHA 3N97B 4NLGA 2H5XA 3TAMA 3EWAA 1RT7A 3LK9A 3QESA 4OVLA 9ICVA 4FLYA 4XA5A 2RF2A 4DTOA 4R63A 2B4JA 4GC6A 1JLFA 1RTHA 3RH4A 4IG0A 5CZ1A 2NUBA 4B9LA 8ICUA 4Q8EA 3T19A 2BCRA 3OYHA 1UAXA 2ISPA 4E19A 1C6VA 3KHRA 1JLAA 3UXPA 1JL2A 4UBCA 4PHEA 4K8XA 2FLNA 2IAJA 5DG8A 5DBAA 3ISBA 1T8EA 1A5VA 5J2EA 3RRGA 1WSJA 1NK9A 3NF9A 3QEIA 4Q43A 2VA8A 4F4ZA 3EPGA 5KG1A 3PR5B 1XC9A 4YFKA 4I2EA 4MFCA 1I3AA 4CHPA 3BJYA 4DTNA 1VSFA 4Z6CA 3TARA 4ELTA 4CJTA 2YNIA 4OGEA 4M3WA 1BPBA 4F5PA 4RQ1A 1NOYA 5KFXA 4GXJA 1U49A 9ICMA 1CLQA 3CG7A 3L3VA 4GVMA 1RZTA 1L5UA 3TABA 4FW2A 3L3UA 2KQ2A 4FJXA 5KFHA 3MEEA 3NHGA 5DB7A 4YD1A 5DDMA 4DF4A 3OYCA 2G8IA 9ICLA 4PHDA 5KFKA 3V6JA 3Q8SB 8ICVA 5HROA 4RQ4A 2W9CB 2W9CA 3GIIA 1HNVA 9ICFA 4ED7A 3AO3A 1NKBA 8ICKA 4NLZA 2MAXA 3ISCA 3C95A 1S1TA 4YD2A 1Z25A 2HNYA 1X1PA 4CJQA 7ICHA 5IIOA 2EX3A 4KHUA 4J9LA 3ORYA 1N48A 1HNIA 4O9MA 3ZSOA 3M8PA 1HMVA 2NRVA 4MFBA 4M42A 4CF2A 5BPCA 3K2PA 3BQ2A 1JXBA 4E7JA 1NJYA 4CEBA 3OHAA 4FBUA 3AVNA 4CHQA 4DL2A 4M3TA 3SV4A 1ZQAA 1RILA 4G3IA 3SQ4A 1MC8A 4M6WA 4BACA 4LZDA 3QINA 5KT7A 3VQ5A 4FM0A 4ECRA 2V4RA 2ZTEA 4F4KA 5CP2A 4I2DA 4CHZA 5SZTA 4QOZB 3RMCA 1NOZA 1R0AA 3LANA 5J29A 4ECWA 4HUEA 4RUAA 5D46A 1ZQRA 4N56A 3Q8QB 2P66A 1ZBUA 1JX4A 3AVKA 1XS9D 1WSFA 5IILA 3M9OB 3MFHA 3HT3A 4QWBA 8ICYA 2B6AA 3QETA 2LYHA 3HX0A 4XUSA 5KFQA 1GOBA 2R8JA 3PW7A 4Z0UA 2F1IA 4FJ8A 3AA4A 4DG1A 3SPYA 4KHQA 4Z6FA 3KLGA 4CERA 2ATLA 4IDKA 2XY7A 4B9NA 4QZEA 4CFDA 5KFRA 3O3HA 3AVBA 4QWDA 5KFDA 2XY5A 4KHSA 1ZQJA 5KFUA 3M8RA 3KKRA 4ED3A 5KT4A 3S3OA 1SV5A 4OKJA 1S0VA 5J2PA 1S9FA 3HPOA 1LWEA 3O4NA 3O3GA 3PO4A 4UB3A 4G1QA 1TV9A 5KG2A 1ZQHA 4ECTA 3AA2A 1S9GA 3WNEA 2IOCA 4R66A 1FKOA 4EBDA 4DMNA 3ZDEA 1EETA 8ICPA 2ZUBA 3LP3A 4FZZA 5DQHA 7ICFA 3SQ2A 4DSLA 3NAEA 2W9BB 3K4GA 3VQ9A 4QZCA 3PO5A 4X5VA 4DQQA 4NXZA 2XGPA 4P2HA 4FJKA 3TAFA 4Y1CA 1ZQQA 2HHWA 4B9MA 3T5LA 5KT2A 3L2VA 4CGGA 2BDPA 4LH4A 2Q0ZX 3TAQA 1U48A 1WCNA 1RBSA 4CJWA 1VSHA 1TK0A 5IIIA 3DMJA 3RH5A 1JXEA 2DTUA 3RRHA 5IIKA 2UVRA 1YVUA 3F9KA 2JLEA 4EYIB 5D49A 1WNSA 1TAUA 4AHUA 3PW0A 3RR8A 3DLHA 2FMQA 4Z4IA 4CCHA 3SI6A 1RPLA 3MEGA 4FVMA 8ICSA 3ZT4A 2OPPA 4YQWA 1X9WA 1ZBLA 1QS4A 5F9LA 1NK4A 1XSNA 4IQUA 1QSYA 4DLGA 1RBUA 4DSFA 2W9MA 4J9NA 3V4IA 1KFSA 4TQSA 5KFNA 4KO0A 2R7YA 3RJEA 3DI6A 1IM4A 4IQTA 1JMSA 8ICWA 3QEAZ 4B8CA 1T05A 4BE2A 9ICOA 1ZQOA 2BGGA 5KFIA 5FRMA 5KGWA 4QWAA 1Z26A 1HUZA 5EU7A 2BCVA 2KW4A 4KLFA 3MR5A 4CJSA 4DTRA 4FK2A 4CJRA 3U3GA 4UQGA 2Y1JA 1L3VA 3K59A 3OSNA 1HUOA 4Z4EA 2KZ3A 1IG9A 3H08A 2PZSA 4HYKA 3QZ8A 3S3MA 4FS1A 3LZIA 4DSKA 4RU9A 3K57A 3NH0A 9ICPA 4IRKA 1UA1A 3NF7A 4O3NA 3AU6A 4CK2A 4Z4GA 4CF1A 4QZHA 4UB1A 3V9SA 3GIJA 4TUSA 4DS4A 4E1NA 4PGYA 1HYVA 2O4GA 5IIJA 4QZ9A 1VSJA 3RB6A 1ITGA 5DB6A 1NKEA 3LDAA 4CESA 3KD1E 3MDCA 9ICIA 3V7JA 3RJFA 4R8UB 3OJSA 4K4HA 4EP5A 2VA3A 3H8WA 4ECYA 4DSEA 1IKWA 2Z1IA 5J2GA 4R65A 7ICPA 1KEJA 3V72A 2C2EA 2HHUA 4M3ZA 3GIKA 5KT6A 1RYSA 7ICSA 2ISOA 4UAYA 4IBNA 2J6UA 4KRFA 1LW0A 3C1ZA 3H40A 5KTQA 1B92A 3T3FA 4DL5A 4PHAA 2P5OA 4I27A 4OLAA 8ICZA 3IS9A 4CF0A 4FJGA 3HPGA 2HB5A 4MF2A 3PVXA 2BKEA 2FLPA 3VQCA 5L9XA 2BCQA 4KLEA 3A2FA 1YTAA 5KFPA 1U4BA 1IKXA 4FO6A 7ICVA 2OWOA 5KRTA 4KN7A 1WN7A 4JLHA 4MF8A 3TAGA 1RCHA 3LAKA 4F2RA 7ICRA 3AVGA 4J9SA 1ASWA 3HPHA 4OPJA 5DK5A 4IQVA 4MFFA 2ZJ5A 2B21A 3KTQA 1Z00B 2R8GA 4YNQA 3CFRA 3JPSA 4F8RA 4IG3A 3JPRA 8ICJA 1U9LA 4Q45A 3M8QA 1ZQNA 4FZYA 4O0IA 4I2CA 3OVNA 1XSLA 2M9NA 4IFVA 2P6UA 8ICCA 3VQ6A 2LSNA 1PZNA 4BWMA 4BDPA 3NH2A 1TV6A 3KLHA 1VSEA 3DLKA 1JLGA 4CGJA 3V7LA 3KJVA 3MR2A 3OYFA 4PQUA 4TUQA 2JGUA 4FZXC 5HHHA 1LV5A 3QIOA 3HVRA 4F4YA 2ZD1A 4DL3A 1L3SA 2QXFA 3BQ0A 1BL3A 3IM1A 4J9KA 2ASLA 9ICKA 1HQUA 1SL0A 4CJFA 4FJMA 1TKXA 4CIFA 3L2WA 5J0WA 2I9GA 1X9MA 4YVZA 1CZ9A 5HHIA 4GLXA 5J2BA 2OZSA 1HYSA 4AHSA 3ZT1A 5DB9A 1RDCA 9ICAA 5L1JA 1WSGA 3MECA 4ED6A 2YHBA 2OZMA 3JSMA 4CECA 1HJPA 2BHNA 3M9NB 4CIEA 3KIOA 3KLFA 1S6PA 4O3OA 1K1QA 4FLZA 4ZH4A 2P6RA 2FBVA 4EP4A 2FMPA 2A1RA 3AA5X 2OA8A 5KFJA 3RWUA 4M6WB 4TUPA 3OS2A 1U04A 5JS1A 3BQTA 3O3FA 4P4OA 4UBBA 4O44A 4F2SA 5J0YA 2FBXA 7ICUA 1TVRA 3AV9A 3CFOA 2IGIA 5KFOA 3ASMA 1TAQA 4CE9A 4ED8A 4FBTA 2DPJA 3ZSRA 4YN4A 4F93B 1W9HA 3K5OA 1UA0A 4I2QA 5F9NA 4IKFA 3C2LA 4M2YA 2AQ4A 1S9EA 5J2HA 3HYFA 4JS5A 4DLEA 3AO4A 4JS4A 4CJUA 1RT1A 4YP3A 1S1XA 4W5TA 4YG2A 4O3PA 2HHQA 4NCBA 5KFBA 1KLMA 3BGRA 2OPQA 3QZ7A 2XGQA 4CGFA 3KK1A 4F5NA 1LWCA 3SQ1A 2AGOA 3C21A 1C0MA 1IO2A 3LAMA 5J0UA 8ICTA 4RNNA 4CEQA 3AUOA 1T3NA 4MEYA 3ZT0A 4KLOA 4CHYA 4F5QA 4GXKA 4CF9A 4W5OA 4ID5A 2ASDA 5J2JA 4ELVA 4BE0A 7ICEA 1ZQBA 1ZYQA 4KI6A 4KB0A 4OKEA 3UIQA 4RNOA 1TKTA 3NDKA 4RG8A 4NCGA 3ZSXA 4NM1A 2X6SA 4FK4A 4ECQA 4ZTJA 4GXIA 4FJ5A 4JV2A 2FC0A 4KLUA 4FLUA 4F91B 3VQBA 2PFQA 8ICXA 3JPNA 1LB2B 2BPGA 4CGIA 2FPKA 1ZETA 4ECUA 4DTJA 7ICQA 1RTJA 3KHLA 1KCFA 4E0DA 3DRSA 4ZHRA 2D0CA 4KLQA 4FK0A 3NE6A 1BISA 4QZ8A 3CM5A 3JPPA 2UVUA 5DGBA 4I2HA 5J0RA 1KSPA 4TSXA 4QW9A 3C2MA 4H4OA 3GV7B 2HHXA 4CHOA 3JPOA 3K75D 1QSSA 4M9LA 3VA3A 3H4BA 3Q8KA 1T7PA 5KGXA 1XHXA 3V9ZA 3ZCMA 4FJ7A 3FDSA 4FJLA 3TI0A 4ED0A 1O1WA 1CUKA 3KHHA 1MSWD 3VQEA 1VSMA 4DFPA 2A1SA 3SI8A 2W42A 5KG6A 2W8KA 1ZQEA 7ICOA 4HUFA 1RT6A 2AJQA 4QZDA 1JLEA 8ICRA 3PX4A 3CM6A 4LY7A 2HMIA 1ZQKA 4E7KA 4KTWA 5HMMA 2FBTA 4F50A 1ZJMA 4M3YA 1AROP 7ICNA 2GWSA 4K4IA 4DTUA 3UQ0A 1SKSA 3TAPA 2R8HA 1WSHA 2XCAA 4J2BA 2DPIA 4J9QA 2VA2A 5CYQA 3AVIA 2D0BA 3DOKA 3C6UA 3OS1A 5KI6A 1RBTA 4NY8A 4J9OA 1TL3A 2YNHA 3GILA 3LALA 5EOZA 4RW7A 4CEDA 3NBPA 1VSIA 4DS5A 2XY8A 4CF8A 1LWFA 2RDJA 3EW9A 3AVLA 3RJIA 1S5JA 3HP6A 3K5LA 4ED1A 2AGQA 3MXIA 4JK1A 1G15A 2GUIA 1ZQGA 2ZUDA 4F92B 3V6HA 4FW1A 3AO1A 2FPLA 3UQ2A 2YKNA 4FS2A 4NYNA 4CEFA 3HSTB 3G6XA 1BIUA 2A1JB 5L1LA 1Q9XA 3NGIA 5FRNA 2XHBA 1F21A 3MEDA 1A5WA 1U45A 1ZBIA 5J2MA 5I42A 1ZQYA 1TK8A 2JEFA 5CA7A 4RQ7A 4LSLA 2IHNA 5C42A 4UB5A 4LVSA 3HK2A 5CJ7A 1MQ2A 5L1IA 1EX4A 4DFMA 9ICNA 1TGOA 3HJFA 4PUOA 4NM2A 7ICJA 3LPTA 5HRNA 5HRPA 3AU2A 3T5JA 3PUFA 3ZDBA 3PNCA 4J9RA 5FDLA 1HJRA 4PWDA 4UB4A 4LD0A 1YTUA 2C2DA 1XWLA 1QQCA 4XQ8A 1BPDA 3WNFA 2JZBA 2PYJA 2VWJA 1ZQLA 3OSPA 3SV3A 3PW4A 4GMJB 3LP0A 2PFOA 1RBVA 4F4XA 4ECXA 4I2JA 2MUTA 1NK0A 4PY5A 1ZBFA 3CFPA 1RXWA 4DEZA 5J2KA 3NGDA 2PI4A 1B22A 3VQ8A 8ICEA 4B3OA 1TKDA 1S76D 4GW6A 2C2RA 4KITB 3RB3A 1TFRA 2ZJ8A 4FCYA 4W5RA 4EEYA 4CEEA 2HHSA 3PX6A 4FYDA 4P4PA 9ICSA 4M9GA 4B9UA 4KLGA 3C94A 5CZ2A 4YR0A 1ZQIA 3QEVA 3NFAA 4C8KA 4CFBA 2QKKA 5KT3A 3AVHA 2F96A 1BQMA 2VG5A 2Y1IA 4O5BA 4B9VA 4OKKA 5DG9A 2QKBA 2C22A 4RQ6A 3C6TA 5HRSA 1IKYA 4AILC 4M9NA 5FROA 1B43A 4KTZA 4M3RA 4YFUA 1C0UA 4W5NA 2ASJA 2RPIA 4M45A 8ICFA 4OPKA 4F3TA 3G0ZA 1BPEA 2BE2A 4OLBA 8ICOA 4FXDA 1XI1A 3H8JA 2E4LA 3MXJA 3VQAA 5KG3A 4R64A 4Z4HA 3ITHA 2VG7A 3JYTA 4QZAA 1C7YA 4MFAA 5DB8A 1BPXA 2BPFA 4WE1A 3M8SA 4I2GA 4KPYA 3V7KA 3ISNC 1VRTA 3L8BA 2ZUCA 3ZSWA 1FKPA 3RH6A 2P1JA 4J9MA 1ZQMA 2E6MA 5KFEA 3AVJA 1RNHA 4E89A 3L2QA 4CK3A 4QCLA 1A5XA 1S97A 1VRUA 1ZBHA 3OYJA 2PXIA 1NJZA 8ICLA 1XU4A 1NJXA 5J2DA 4TQRA 3AO2A 3DLBA 3C5GA 3V1OA 4CFAA 4FJ9A 3E2EA 2BQRA 4DO9A 4FLVA 3M9MB 4C8NA 4JRQA 3DLGA 1L3UA 4DOCA 1K1SA 4RT3A 5J0SA 4F5RA 2JEGA 4DL7A 4W5QA 3HVTA 4I2AA 2DFFA 2YHAA 1JN3A 4KREA 1IXRA 1KVCA 3MABA 1JIHA 1QE1A 3RJGA 3PX0A 1VK0A 3BQ1A 3SNNA 8ICNA 2BQ3A 3DOLA 2P51A 3V9XA 3H4DA 4CGHA 3HW8A 3V6KA 2KZZA 5KFWA 4J2DA 2IDOA 2NRXA 1Z3EB 3SUNA 2G8WA 4AHTA 4NLNA 1RBRA 3U6FA 2NRZA 8ICAA 5C24A 1JKHA 1FXXA 1LAVA 3OJUA 3PMLA 7ICGA 1QSLA 9ICXA 4ID1A 4JV1A 3LDSA 3QNNA 5DKWA 4R8UA 3EZ5A 2DFLA 2IMWP 1Y97A 5KT5A 1DOQA 4I9LA 5J2FA 3GV8B 3CQ8A 4LH5A 4E7HA 4RT2A 5DQIA 3C2KA 3WNHA 3VQDA 1REVA 2EHGA 1A77A 9ICUA 2D5RA 5CY4A 3AVAA 3GFKB 4RZRA 1KVBA 2GV9A 4I7FA 4Z4CA 3SQ0A 4FJIA 3TFRA 2R8KA 4IRCA 5DDYA 5CB1A 4QZGA 3NGZA 3AO5A 4CJPA 1ZQPA 1S6QA 4RUCA 3LP1A 3VQPA 5DG7A 7ICTA 1QHTA 5HLFA 2BCSA 4J9PA 4CIGA 4JV0A 3TR8A 4JUZA 2ZTCA 4EYHB 3P83D 3SUQA 3NF6A 3C23A 3V9UA 3B0YA 2Z1JA 4KLTA 1SKRA 5C25A 5HP4A 1UOCA 2PFPA 4BXOA 2F1JA 4E7LA 1S10A 2PI5A 3T5KA 3UPQA 1YT3A 4KLMA 4M9JA 2J6SA 1A76A 1MQ3A 1RT4A 7ICIA 3RAQA 1ZQXA 2F1HA 4H4MA 2ALZA 5J0OA 2IC3A 4O3RA 1JLCA 3OS0A 7ICLA 1LAWA 1WLJA 3DLRA 4N47A 3QEBZ 3RR7A 4KHWA 1W0HA 1B9FA 2OPRA 3V81A 4DU4A 3NF8A 3MR6A 4Z4FA 5BOMA 2X78A 1EXNA 4IR1A 5KFZA 4FM1A 1KDHA 1KVAA 5J0XA 1ZQCA 4BWJA 4DF8A 3ZSVA 3MDAA 1KFTA 2F8SA 1KTQA 2HNZA 3RMDA 1Y88A 1S1VA 4YMMA 3B6PA 1NK8A 1L3TA 4DQPA 1VSKA 2IA6A 4HVJA 4DTXA 4UB2A 4Q5VA 2KZMA 4DOAA 3TQ1A 3VN5A 4M41A 2G8KA 3H8SA 5J0QA 2WTFA 9ICHA 2BANA 5L1KA 3AVCA 3SCXA 2C28A 1S0OA 4I2PA 4KKOA 4CFCA 2I5JA 3S3NA 3LWMA 3QEPA 2RN2A 1S1UA 1S77D 4F4WA 2G8HA 4QZIA 1BQNA 4YMOA 3V6DA 2E6LA 4Z6DA 2YNFA 5HBMA 4KFBA 5EWFA 3V1RA 2GBZA 4DQSA 2OPSA 4KTQA 1MU2A 2I1QA 1C1BA 3OYAA 3L2RA 1XSPA 2ATQA 3OYKA 3QEWA 4AHRA 3RJJA 2Q3SA 3RMBA 5JUMA 5CHGA 4AHVA 4FLXA 4Q0BA 5IIMA 4PPXA 1GOCA 3PY8A 4KHYA 1BCOA 2QK9A 4O55A 2KTQA 3ALYA 2P5GA 5EWGA 4DWIA 4O0JA 4DQRA 5KFCA 4CJVA 4FJJA 3QEXA 4N5SA 3ZD9A 4AHCA 3N4MB 4I9QA 3KHGA 2ZTDA 1J5OA 4O5EA 1RYRA 5I3UA 5HNKA 3RB0A 4O5CA 3KLIA 3MGIA 4DQIA 4YXJA 1BVSA 3DLEA 5J2IA 1WCLA 4HCCA 8ICGA 1QTMA 3ZD8A 4DOBA 4RW4A 3P1GA 1N6QA 4KB1A 1TK5A 5KFAA 2FPMA 5DMRA 2YV0X 1SUQA 4PGXA 1BPZA 3ZT2A 2HW3A 1DLOA 5J0TA 1UT8A 3KD5E 4K4GA 4DTPA 4FLTA 4M47A 9ICEA 1KLNA 2HVHA 4DFJA 5KFMA 8ICMA 9ICCA 1J53A 4O3QA 1ZQWA 2UVWA 4RW8A 4O4GA 2UVVA 1NK6A 1CXUA 1DTTA 9ICJA 3Q8MA 1Q8IA 4CJ3A 4KLIA 4JRPA 4ECVA 2ZE2A 1D9DA 1ZJNA 1D5AA 4HUGA 1DGSA 2Z1GA 3C1YA 3QNOA 4YCXA 5KFSA 2ZQBA 5E41A 3HO1A 5C5JA 5KG7A 4JWMA 3CYMA 3UXOA 3RBDA 4BDYA 3QIPA 3TFSA 3DRPA 3QLHA 4CHNA 3Q8LA 4C8LA 4KLSA 1WAFA 4EZ9A 3IG1A 5KFLA 3FFIA 4FJHA 1S0NA 2FLLA 1RT3A 2DFEA 1JLBA 4BXOB 4Z6EA 1B9DA 4OJRA 3OYEA 1WSIA 3TWHA 4KLHA 1K6YA 2DY4A 2XY6A 3ZSZA 3G6VA 4MEXA 4J2EA 4ICLA 3EYZA 3VQ4A 4XRHA 4J2AA 4TURA 2XRIA 4IFYA 1ZQFA 4Y1DA 1RDDA 4DL4A 1BIZA 3NTUA 3T1AA 1XHZA 5KFVA 3RTVA 4L8RB 3OHBA 4B9TA 3VQQA 3IRXA 1BI4B 3PW2A 1N5YA 3KLEA 5T7BA 1RDBA 4QZFA 4M04A 2W9AA 3LZJA 1D8YA 2V4QA 7ICKA 3P5JA 5KG4A 3RB4A 3HXMA 4ZTFA 1T4GA 4XIUA 1WAJA 1EKEA 3B0XA 2JEIA 1EXQA 3OYMA 1D9FA 1VSDA 3I0SA 3ZDDA 4LSNA 3AA3A 4R5PA 3I8DA 4QWEA 3NGYA 4KHNA 4N76A 2VG6A 4DSJA 4CEAA 3NCIA 4OGCA 4N41A 2JZBB 3SPZA 4LZGA 1IH7A 1SL1A 3PW5A 3DYAA 4RPZA 1ZQVA 4O5KA 4I2BA 2IBKA 8ICHA 1Q9YA 3C5FA 1KRPA 3SUPA 3ISDA 3SYZA 4PA1A 4NYFA 4O3SA 2G8FA 3MFIA 4CJ5A 4K8ZA 3QERA 4EBCA 2HHTA 4AH9A 4BDZA 4DTMA 3PMNA 3OYDA 4HTUA 3FYHA 4QWCA 2V9WA 5KG0A 1FK9A 1X9SA 2G8UA 3F73A 4JWNA 1I39A 4I29A 3LP2A 2A1JA 3H7IA 2IHMA 1COOA 3HP9A 2FMSA 3THVA 5D3GA 3ZT3A 1NKCA 5JS2A 5J2CA 1C0TA 3B6OA 1QLNA 1ASUA 8ICIA 3PR4A 3OYIA 4KLDA 3Q8RB 4HHTA 5DQGA 3EPIA 2VWKA 3GIMA 4DSIA 5HRRA 3ULDA 2AU0A 3T5HA 4M9HA 4IRDA 4RQ5A 3NH1A 1D8LA 4RPYA 2YNGA 9ICRA 5K14A 1NK7A 3V9WA 3TAEA 3RMAA 3ETLA 3DRRA 5J2AA 3IAYA 4KN4A 1RTDA 4RW9A 1S0MA 4QZBA 3G6YA 4KLLA 1BI4A 2WONA 3L2UA 3DM2A 1UWBA 2HHVA 3OYGA 2PY5A 3OYBA 1KFDA 3KK3A 2DFHA 3QE9Y 3SJJA 3BDPA 3U3YA 4GC7A 5DLFA 4ED2A 1HRHA 1BGXT 3LPUA 4H8KA 1JLQA 3I0RA 5IINA 2BQUA 2O4IA 1X2IA 3RJKA 4BE1A 3D0PA 1UT5A 3SZ2A 1U47A 3V1QA 5DBBA 2BPCA 1TL1A 3MAQA 1NJWA 3ZSQA 5HP1A 3PV8A 1T03A 3OYLA 1ZQSA 1VSLA 4HCBA 3JPQA 4RQ3A 4KMUA 9ICWA 2W9BA 3GQCA 5DLGA 5KFTA 4QAGA 1SKWA 1J54A 4KV8A 3OYNA 3MXMA 3MR3A 2BGWA 2PFNA 3Q8PB 5J2NA 1C1CA 2W8LA 3S9HA 3ZDAA 4UAZA 1S1WA 5KFYA 3ZDCA 4C8MA 1ZQUA 1J9AA 1NK5A 3K5NA 5D4BA 3AVMA 4RQ0A 4EBEA 4B9SA 4E1MA 3SUOA 4ELUA 5J1EA
chains in the Genus database with same CATH superfamily
5BOLA 2B9YA 3GJRB 1P6TA 5J2PB 4B8AB 3E66A 2B6GA 4YXMA 1JJCB 3VTIA 2EZYA 3QU7A 3Q8VA 2E2QA 2DY9A 4QJFB 3LW5C 2LM1A 1GOAA 1ZBSA 5J2QA 2CG4A 3AVFA 4FF3A 3UXNA 4PH5A 2MPUA 2AQ0A 3DXBA 1N36F 3K58A 2OTJN 4F3MA 2KI2A 3KK3B 3OGUA 4CLUA 4CJKA 1HKCA 4DR5F 3PSPA 4BG8A 1K73T 4M5DB 2IMOA 3PHEA 4OX8A 3RJHA 5DM7L 2X6NA 4NXNF 3MWBA 3CD5A 2XC9A 4K2JA 3AAWB 4RNMA 4FWNA 3OPKA 4CJLA 2RP5A 1MMLA 2OSRA 2KVCA 3BGRB 4I2FA 1NM1A 5CA5A 4YY3J 5H1SQ 3CDUA 4K42A 2UUBK 2OTLS 4KLJA 2W25A 4WIIA 2W7AA 2OEKA 3VEXA 5AJ3K 2RDIA 1EP4A 4H5VA 4RQ8A 5DGAA 7ICMA 1LW2A 2KXFA 4AQYF 3TANA 3QSIA 1NZPA 4Z7YA 3JAMO 1KHWA 3TJAA 3WBZA 3JXUA 4MQ3A 5EWEA 4LR8A 5HQ8A 4HAIA 3JPTA 1BPYA 2ZHOA 3J7YU 5DBCA 1SS6A 3THYA 3M30B 4JK7A 3DXMA 2PMZC 3UMCA 3EY1A 1B0VA 2XO7A 4M1KA 5ETVA 4WFNL 2J6TA 2XB2D 1CJTA 1GTEA 4C3LA 2VQFK 1Z6RA 3VGLA 2P9NA 3VA0A 1J2NA 1B4FA 5ETSA 5HJYA 3TZXA 1GLDG 5JMVA 3OHRA 2DHAA 1BCMA 1WWHA 5CYQB 1MN8A 4NLPA 3QFWA 2PEHA 4CJEA 2QFJA 2DNMA 4NI2B 1WI6A 4BREA 1ZQTA 4ZPWR 3R27A 1Y3KA 2K89A 4BRMA 1RTIA 4UAWA 4XAKA 1DXSA 4FWKA 2CIMA 3ATVA 2KRRA 4A8MP 4YR2A 2BCUA 1S79A 2MQNA 5ALWA 3MGHA 5CE3A 4EAHD 3TAMA 3EWAA 1KNZA 2KT5A 2BX6A 4OVLA 4FLYA 2F9DA 2ZFHA 4DTOA 2L3MA 4V1Ak 1JROA 4GC6A 2QA2A 2QYCA 1ZA2B 3HJEA 8ICUA 3NXZA 5DZ6A 1MN7A 1NGDA 3KHRA 4CP5A 3H8YA 1APSA 2Q3PA 3UXPA 5AK6A 4UBCA 4PHEA 1HNXF 2OYYA 2IAJA 3FLCO 3I33A 5HVHA 5F8GA 2R4FA 3TR5A 2VHGA 1WSJA 1NK9A 4H0TB 3QUBA 2F1FA 1J5OB 4ZP7A 3E9OA 1HX1A 4AL5A 2R7RA 2I7NA 3EPGA 5KG1A 3MM9B 1H6KX 1I3AA 5EE0A 3QLHB 2HSEB 2Y8YA 4Z6CA 1NSAA 2GCFA 1NOYA 2ZIVB 5KFXA 4L6V3 1U49A 3TQEA 2HQIA 4AT1B 1CLQA 4F04B 1WC4A 2PMWA 4GVMA 3N6LA 3PYDA 2VBYA 4MKYA 5KAIU 2GVZB 3ENVA 5H9EJ 3CJ2A 4R0JA 1WUUA 3MC1A 5ALLA 2MQQA 5LSOA 4OYAA 4FJXA 3SDEA 4KHPJ 1TUWA 1M1KT 4X4QA 5JMNA 3KK7A 9ICLA 1N63A 1HA1A 5K14B 3F53A 3ZI4A 2CDRB 3GIIA 1HNVA 1N5WA 1RTJB 3DNCA 4MO4A 4BRLA 1BY9A 3MM8A 3FRYA 3AO3A 1DT9A 4BRIA 1VQ4N 2QARB 3ISCA 2HS0A 3ET6A 4I0WA 3C14B 1S1TA 4CO1A 3K1ZA 1HBUA 4DV4K 2HNYA 3PSFA 1NWKA 4BGAA 3ORYA 1HNIA 2GQ2A 2E3TA 1OIAA 3M6VA 2N1RA 1F0XA 5AQPA 2AMCB 3T9NA 2P9KB 3ICLA 4MFBA 4M42A 5B5EU 3M6GA 3P4UB 7FDRA 4BLGA 3GP9A 3A0IX 1N0VC 2IDLA 3CMAS 5BR8K 3V2UC 3OL8A 2ADCA 4M6WA 5AM4A 2DJWA 2IC3B 2MDAA 3DXSX 2KT3A 2VCPA 4A48A 2ASPA 2ZNYA 1NMEB 2ZTEA 2J7UA 4P2FA 7AT1B 3UR3C 2J9CA 3V6DB 4FF4A 2BA9A 2BOAA 4ZKAA 2O8BA 2CGKA 3A5LC 2KD1A 5J29A 4Y2JA 2FVRA 4RUAA 2ZWPA 5D46A 2XZWA 3AARA 2IOFK 1HNVB 2DGXA 1DZ5A 3AVKA 5IILA 3M9OB 1VCTA 2MLYA 4QWBA 8ICYA 5CD4A 4QS9A 2QL9B 4P72A 4JI3K 1GOBA 5ALHA 4OLOA 2W7PA 3VOVA 5IZHA 3DOKB 1H2UX 4OJ3A 4A8XA 4CERA 2ATLA 4QPXA 3NMRA 3CCES 4HT7A 2QWQA 2Y0SF 1O8BA 3ZTPA 3IWLA 3QQCD 3O3HA 1OH7A 4QWDA 5AQLA 4KHSA 2OEJA 1N0UA 4JN4A 5HQMA 4LQ3A 1H0HB 3CHWA 1WEZA 3KZIU 3CJ5A 3CP8A 2CG8A 2V9KA 3O3GA 1I3OB 3PO4A 2RU3A 2LKYA 5KG2A 2EFVA 1U26A 4EX6A 1U2VB 3D2EB 3HM8A 2ZZNA 4QR0A 2COLA 4XH5A 5LL6d 1WDDA 3ZDEA 2DTJA 2NXEA 4QQBA 3LP3A 2DNQA 2ZJQQ 2NXUA 4DSLA 2XMKA 4YOUA 3RUBL 2RRAA 3KFUF 2OO4A 1SC4B 1M5KC 3VQ9A 3PO5A 4DQQA 1OJ4A 2BE7D 3H8MA 3HKWA 3NGTA 3TUIC 4Y1CA 1NGIA 4Z2XA 1ZQQA 2HHWA 4B9MA 2ZIXA 4PZVA 5KT2A 3L2VA 1WOOA 6FD1A 2I7PA 2BDPA 4O8KA 1RHUB 3L7UA 4CZJA 3D6RA 1U48A 4B1ZA 4K2XA 1IJFB 1WCNA 1P90A 1DTTB 2DNPA 4UW9A 2JOQA 5IIIA 4H4KA 1JXEA 3RRHA 2GV1A 1WWUA 3F9KA 4G9ZA 3UKRA 2JLEA 4USMA 4EYIB 1K44A 1IIPA 3T9ZA 2ILZA 1UPHA 5M1FA 2FMQA 4DU7A 4Z4IA 3BREA 1ROFA 4CCHA 4DUZF 5HR6A 5J2NB 1C1BB 8ICSA 3ZT4A 4XPCA 3LH2S 4F67A 3I4HX 3VGUA 5GMDA 4YQWA 1X9WA 1FO1A 1IKXB 1ZBLA 5U47A 3PLAA 1PYTA 1QS4A 2D4WA 1NK4A 3RW6A 1TUUA 3C19A 3DDIA 4OYOA 5IQ6A 1QJHA 2W9MA 3QU9A 4TQSA 5LSLA 2R7YA 1X42A 4IQTA 1F9FA 3UN2A 1F9EB 3FBBA 4BS2A 4QZVB 4WQ5C 1YI2N 5F0XA 2NUUG 1Z26A 1MROB 3CD6N 4KQZA 3MR5A 1Y64A 2BM1A 4FK2A 3W3SA 4G65A 3J7ZO 4UQGA 1DAXA 1VLYA 4NZ6A 1YJRA 2F63A 2W6KA 1IG9A 3UD4P 4HYKA 3QZ8A 4ZPDA 2LLZA 4C48A 1BOTO 3S3MA 4TU8A 4FS1A 4DSKA 2XNQA 4M5LA 3HSCA 2CXYA 3MWPA 4CQ1A 1UA1A 3AT1B 4O3NA 4ISEA 5IT9O 1RYUA 2HLUA 5BPMA 2WFAA 2K7KA 3KG1A 4PGYA 1HYVA 1VSJA 2AJFE 2KIWA 3ZETB 5M2RA 1RB0A 2DBYA 4X64F 3KYLA 4NYZA 2VKZG 1GLBG 2GHWA 4FWLA 3A5OC 3CJRA 4LC9B 3BSNA 3FMBA 1X4BA 2CZ4A 1VQ6S 5E7OB 2E1FA 2VA3A 1Y9OA 3B6BA 4WK3A 3C8YA 2AV5A 4QU7A 2DGUA 1KEJA 1R43A 2WONB 4CLYA 1RZMA 1SI9A 2C2EA 2BE2B 4YS2A 4M3ZA 2VQFF 3OL9A 2ISOA 4DMZA 1LW0A 2J0XA 5M2PA 5AQKA 4PWDB 3PG9A 1B92A 1HHTP 4I27A 4CF0A 1H7WA 1N33F 3HPGA 4MDAA 4NRUA 2NZ4A 1PCAA 1YTAA 2K1RB 2UXDJ 5GAHI 1IKXA 4C2MA 1S5LU 1XMOK 2AX1A 1Z2LA 5I4MA 4KN7A 5ETMA 1R27B 2IM3A 5CHCB 1AXQA 3TAGA 2K1RA 1Q81O 2HBMA 3LAKA 2N7YA 2L41A 4F2RA 3AEVA 2UUCJ 4BC9A 1VQKN 1PBAA 4MKVA 2GS8A 1TYQA 2VJ5A 2ZJ5A 2B21A 5A8WA 4OI1A 3CC2N 1SQEA 2R9LA 1ZM9A 3JPRA 2KKZA 1U9LA 2MQLA 1RQ0A 4FZYA 1E6VB 2DGWA 1XSLA 3GLJA 2P6UA 2GH1A 3VQ6A 2E5SA 1GFWB 1PZNA 1TV6A 1EHWA 3KLHA 3DLKA 4IDHA 1JLGA 4CGJA 5A2QO 4IKAA 3OYFA 3EL2A 2KHOA 2FIUA 1L3SA 5EY4A 4XEIA 3BQ0A 1BL3A 3D6FB 2ASLA 9ICKA 4ILRA 2XLJA 1SL0A 3TVZA 1TKXA 3C16A 2W40A 2PC6A 4K4TA 4JMUA 4DR5J 4CTAB 1ZPWX 1X4HA 2DH8A 2GWJA 3CCRN 2U1AA 5J2BA 5DM6Q 2IPOB 1FDBA 5B0CA 2QEXN 3TOQA 5ALKA 2BW2A 2KH9A 4P2SA 3KLVA 4ED6A 2OZMA 2QXLA 1HJPA 2BHNA 1K0TA 4CIEA 3KIOA 2E1EA 4JI5K 4LSLB 1K1QA 4ZH4A 3ZZ0A 4IYQA 3EXCX 2FMPA 2ZGYA 5KFJA 1BLUA 3RWUA 4M6WB 2NR0A 2RDDA 3MUTP 4DV0F 4UBBA 2HPUA 5J0YA 3WXJA 3UWTA 3PFEA 1MROA 5BJRA 4J90A 1FDAA 2ZGZA 2IGIA 4OYBA 2XMMA 4ILHA 1DQAA 3H0RB 3NNHA 3ASMA 2CRXA 1FNOA 4OZ1A 4OD0A 4YN4A 4F93B 2MY8A 2ZBRA 3K5OA 2V7YA 1UA0A 5A0YB 2G06A 2VQFJ 3ZEUB 4M2YA 4P0PA 2ERRA 2D1KA 2CPDA 2HI0A 2HBQB 4CJUA 3PKYA 1HL6A 1S1XA 5AQGA 4YG2A 4NCBA 5C2DA 3KOAA 4B3TF 3BGRA 4CGFA 2UXDF 1RHQB 1S59A 2EW9A 5AM2A 1LWCA 3SQ1A 1V3RA 1NBEB 1KQKA 1VQ4S 3C21A 2VICA 3LAMA 4EWTA 2E5HA 4JI3F 1SBRA 3T6JA 3NVYA 4F5QA 2PFFB 2HQDA 4W5OA 4ID5A 2HFVA 3G8SA 3ZC4A 4F25A 5CZXA 1TKZB 4ELVA 4L74A 2DT9A 4KB0A 1XR6A 1TKTA 2P9EA 1KVIA 5HJXA 1BG3A 4Y2AA 2F65A 4RG8A 5HN0A 4C4TA 5M1NA 4FJ5A 2FC0A 2JJ4D 5C7PA 3VQBA 2X1AA 8ICXA 2NCKL 3CJQA 1LB2B 2BPGA 1WSVA 2FPKA 5D0EA 5AK3A 1ZETA 4DV6F 4DTJA 7ICQA 3G86A 3GL1A 5A0YA 2YWEA 2QC3A 1JLBB 1WHWA 2RD5C 4I6AA 3TJ8A 4DU8A 4GVEA 2BZ2A 1U8SA 4UUWA 1KSPA 4NASA 1V97A 5AKKA 1RHKB 1QSSA 3VESA 4JI5F 4M9LA 4HH1A 3HHLA 4I69A 3J80Y 4DCHA 4WJBA 5AKJA 4MDBA 2E1PA 1XHXA 1U6ZA 4FJLA 3TI0A 4ZVRB 3AY0A 1RABB 4CYUA 2A1SA 3SI8A 2CH5A 2W42A 4USTA 3NMUA 4ILJA 3H2UB 2W43A 4HUFA 4NLBA 2CZVC 3AB2B 4HHHA 3IDHA 3GU3A 2OPSB 3WKCA 4YHHJ 1X6JA 3CM6A 3N7SC 1XMQK 1OVYA 5DJBA 4GV3A 7ICNA 1N5YB 2GWSA 4NPOA 2MJNA 3SAHA 3I9V9 4J5OA 2FJEB 2F7TA 3ENOA 2GEMA 4FZVA 1Q8BA 3C16B 2YKQA 2LHTA 5DDOC 1TL3A 5BRFA 5A2QY 2RE1A 2YNHA 3GILA 2HKEA 3LALA 3VEVA 1N6QB 2CPEA 3B9JA 4ZPCA 3RJIA 1VQMN 1S5JA 3N79A 1EQMA 3MXIA 2C42A 2ZXIA 4JK1A 4NA1A 2R7SA 2D0PA 3NGRA 2ZUDA 2F4FA 1UEVA 2YWGA 1T11A 2ZNZA 3HBTA 2CPJA 2MKYA 4NYNA 4CEFA 2CNOB 2MLZA 3FZLA 3G6XA 1CJKA 1M0SA 1BIUA 3LPYA 4XTTA 4X66F 1VQON 3C65A 1A5WA 4YOVA 5J2MA 3AXMA 2WVEA 4DV7F 3M3ZA 3FZMA 4M7YA 1TK8A 4LSLA 2IHNA 3QGIA 5KAKA 5AQSA 4DV3J 2HK3A 4HI2A 3HK2A 2RSQA 1HWKA 5B09A 5CQGA 4PUOA 3HJFA 3E1YA 4KBOA 3WC0A 4DV2J 5EOYA 5HRNA 1XMQJ 1RQNA 3EDQB 5JVHL 3PNCA 3SCJE 3E9PA 1FHTA 4LD0A 1YJ9N 4FVUA 2UZAA 3EX7B 1CS4B 1QQCA 3KMQA 3GR0A 1VQ5N 2ZBPA 3WHIA 2DR5A 2PFOA 1VISA 3OR1B 2CWKA 5B0EA 1A0OB 2D1CA 5IT0A 4RCHA 3E8OA 2OH2A 3C0BA 4RUBA 3HHNB 4IJAA 2PI4A 2XYGB 3AJ1A 2JNJA 4ZJQA 4GW6A 3ONNA 4LF7K 2MHNA 4B3RF 7FD1A 1P1TA 4B1YB 2ZJ8A 3CMAN 5AQVA 3G87A 4FWMA 3ZTSA 1R8BA 1WOPA 2DH9A 4ZJOA 1XTZA 4ILLA 3KKAC 2W3RA 4H5WA 3ETMA 2G5IB 3KJFB 1O0PA 5KT3A 2CQBA 1A9NB 2F96A 3R3LA 2VG5A 2ZVIA 2YQ0A 5DG9A 2WVDA 4WTYA 1HYSB 3QATA 5ELZA 5HRSA 1IKYA 1P8ZA 3GCWP 5FROA 2YKAA 5AICA 1N32J 2VQEK 1IKVB 1Y4ZB 3G0ZA 3P49B 2AIRB 4EU0A 1XI1A 3QSYB 3P5TL 4KX5A 4R64A 4QIWF 4Z4HA 3JYTA 3DGPA 1X5SA 3E9LA 4BRAA 1W2IA 2JZ5A 1BPXA 2DNYA 3V7KA 3ISNC 2ZUCA 1FKPA 3RH6A 4DR1J 1I94J 1VQOS 3AVJA 2X1FA 4DR7J 1BUXA 1R0AB 4CK3A 1GMVA 4JI7K 3ZZPA 1ZBHA 1PC4A 2Z2LA 3ENQA 1NJXA 4JK8A 1UVNA 3C5GA 4C3KA 4UB8U 3PEJA 2BQRA 4ZLLA 2A40A 4DO9A 3EE3A 3ATUA 3CJ7A 4JNEA 3Q0AA 1YJVA 5JTIA 4DOCA 1OYEA 5H9EK 3QU4A 4RT3A 4F5RA 2ZJRL 2GIFA 1AQ6A 4YOXA 5L46A 1EO1A 3A8JA 1S48A 2ZC4A 1QE1A 4ZOSA 2VFUA 4X4VA 1HIWA 4Y2IA 2F8LA 8ICNA 3K5PA 2HSZA 4JI2K 4X62F 4NLSA 1KAZA 1X4FA 4DV1K 4C8YA 4QIWC 2O8DB 1OW5A 3DI6B 3TAMB 2GMLA 1RBRA 5BR9A 2J0QD 3HHKA 1B0XA 1WNEA 4KHPF 2EPIA 1NEEA 3PMLA 1U1KA 3QNNA 4JV1A 5DKWA 3V4IB 2OLWA 1JNZB 4FPAA 3L3CA 1Y97A 5KT5A 2VKRA 3VENA 5ETRA 3NS7B 3PACA 1DOQA 4LF5F 4CLSA 4JI2J 2FDRA 3W0LA 5ALMA 2HQGA 3VAHA 1CBKA 2HVDA 1ECWA 3VQDA 1A77A 3VAJA 3HJVA 5LMUF 2D5RA 3GFKB 3CNQP 4RZRA 3H59A 2GV9A 4K4UA 1U8WA 1J6ZA 4JHDB 4LR9A 1ZQPA 4RUCA 2BUNA 2G2YA 3DGPB 1H98A 3MM9A 4BRFA 1VQ7S 4UOGA 4CIGA 3TR8A 2M52A 2ZTCA 1YQHA 3SUQA 3C23A 2PA8D 3W62A 4K4SA 2MHEA 2B3TB 2B4VA 4NLUA 2Z1JA 1Q7YT 1PVQA 2CPZA 2WAQD 1GNKA 1SKRA 2F1JA 4DX8H 4NJ8A 5CXTA 3HZ6A 1QUVA 1U0SA 2ZDPA 4PUOB 3CJKB 3W9JA 3IR5B 3N28A 5AHXA 3J7ZT 4MMOA 7ICIA 1KHVA 1ZQXA 3J81U 4H4MA 4URSA 2ALZA 1NI3A 3CI5A 4X4RA 4LR7A 3I8BA 2QTDA 2IC3A 4FWSA 5IC6B 3LYSA 4EUVA 2RRBA 4KH0B 3G25A 1QQ5A 3DRYA 2RJZA 2EVZA 3V81A 3AGRA 4Z4FA 3BH7B 2M0GB 3UO0A 2N7CA 2I9SA 2FJVA 4IR1A 2E5GA 4FM1A 2Q1LA 3IRXB 3ZSVA 4LRBA 3R1HA 3FCHA 2QG9B 3M6UA 3EXYA 2XYPB 2HNZA 3KWIA 4ZLNA 2VFSA 4YMMA 4DPOA 3B4DA 3C7NB 1NK8A 5IWAK 4WXOA 4DQPA 2EKNA 2Q79A 3TQ1A 3AQEA 3VN5A 1FCAA 3WEEA 3R1XA 3H8SA 2DF4B 2IHR1 4DN9A 1CS4A 4LFBJ 2NO4A 3MN9A 2XLKA 1S0OA 4I2PA 2XEXA 4OX9J 1NSKL 2I5JA 3GJTB 3S3NA 3DRXA 1ULRA 4C3MA 5C0YA 1HD0A 4V19S 5ETLA 3CC7N 3JB9k 1S77D 3O9UA 4F4WA 2KN4A 2A3VA 2E6LA 2KM8B 2CGLA 4YB7A 2YNFA 3H3NO 1WBDA 2OPSA 2I1QA 1C1BA 2LU1A 1SC3B 2GIQA 2HF3A 5G5HA 3RJMB 1PK1B 4AHRA 3SEOA 3EUB2 2XS7A 1WEYA 3RMBA 2R2UA 3AY9A 1UMJA 3DDKA 1J5EJ 4PPXA 1RWNB 3TJ9A 1RDRA 1GOCA 2MLXA 4A8SA 1BCOA 4O55A 1PK1A 4DWIA 1D3WA 2UU9K 1M90T 2VIXA 2JL9A 2ZIUB 5KFCA 1KQSM 4N5SA 3THWB 2G1HA 2OELA 1NH7A 3AA8A 3KHGA 1J5OA 3D2WA 4Y2XA 3BY5A 5I3UA 5GAEU 1JI7A 1P9QC 5IQQA 4B3TJ 1IV8A 4WJ3B 2RMLA 3Q86A 3QWPA 4P2MA 4HCCA 2OANA 8ICGA 3VGKA 4KB1A 2DL0A 1TK5A 2LQ5A 1VQ5S 1SXDA 1WORA 2F9WA 2R7OA 3CJ0A 4X2BA 4OQJA 1DLOA 2P9CA 2I0XA 4DDFA 4X62K 4L72B 3RAMA 4BGBA 4M47A 9ICEA 4FPRA 1IQZA 1JK9B 1J53A 4ZVUB 2M2BA 4BRHA 1ZQWA 1WUDA 2UVWA 4RW8A 2UVVA 1F3FA 3MOJB 5HLFB 5CRXA 1KOHA 1FFSB 2VPYB 2M8DB 4JI0K 1FRJA 4ECVA 3SD7A 2G4BA 2NZTA 3U4LA 1KAXA 3CCMN 2P8IA 2NYHA 2VONA 4B3SK 4IL6U 1FXRA 1DGSA 3FCVA 4OZ0A 4ES1A 3FZ2A 3MMAA 2O6KA 2ZIVA 3GR1A 5KFSA 2P9UA 4F7VA 5C5JA 4JWMA 3RBDA 2RIJA 5A6WA 1XNSA 2FHJA 4CHNA 3R5CA 2HG4A 4OYXA 2QX0A 3KLEB 1BQNB 4H4OB 4B3TK 3MCMA 3IG1A 4DX5A 1UKUA 5EXWA 4FJHA 5D0RA 3ZEUA 2H3GX 1PBUA 2CQIA 4FYVB 4JAXA 2EI5A 3D0IE 2BABA 2XZDB 3OYEA 2YMLA 2QMWA 4FSVA 2DY4A 3P39A 4ZVGA 4MEXA 4WFAQ 5A8KB 2ZWHA 5M2UA 2V51B 1YBAA 2C3PA 4TURA 4IWVA 3UN3A 4F9OA 1BIZA 2PBDA 5KFVA 4W92B 4IOBA 3O1WA 3GE1A 2JR5A 3VQQA 2KRBA 2D74B 3KLEA 4QZFA 2JHDA 2ZZMA 2C3OA 1HD1A 2W9AA 3N7RC 1D8YA 2V4QA 1MNEA 2UUTA 4URGA 7ICKA 1FESA 4UAUA 3VAFA 3ISND 5KG4A 1TKTB 1Z1VA 3QIPB 2OPRB 3SFGA 1WAJA 2GMJA 3O0FA 3OYMA 1D9FA 2V8PA 4OHZA 3ZDDA 2IYGA 1VSDA 3AA3A 3O44A 3AJDA 1XBWA 1S4FA 3E01B 2K4PA 3WQUA 4IOAQ 2EG2A 1HMVB 3NVKA 5AQYA 2RHQB 3O5TB 4DSJA 4OGCA 4WP3A 2CVEA 4ZVPB 4LZGA 2E1CA 3N7PD 3O9TA 1UZHA 2JC1A 3UKUA 2ADBA 4NA2A 4U8YA 1FJGK 4LQ9A 2GHPA 5A76A 3TTDA 3HKZF 4I2BA 2R7TA 2IBKA 8ICHA 3I87A 4DR6J 1KRPA 4ZMMA 1KR4A 2L9NA 4JI5J 3ED5A 1VR6A 4Y3CA 1P1LA 4K8ZA 3K1RB 3MZIA 1V3SA 4JI0F 1VHXA 4DTMA 2QB1A 2GVZA 3K7RA 4K0KJ 4TY9A 3FYHA 4QWCA 2V9WA 4RO0A 1X9SA 4MYUA 4QR1A 2ZJQL 1IR2A 2B9XA 4QIEA 1ZTWA 4KGZB 1AZSA 1HWUA 3MUMP 3BO2A 3HP9A 1B3TA 5D3GA 3ZT3A 2YTCA 4DL0C 1H2VZ 2DY1A 1VLOA 1BA0A 2WVFA 1C0TA 4JD2B 2QIFA 2WVCA 1NB2A 4PG5A 1QLNA 3W60A 1XNQJ 8ICIA 9ATCB 2CDQA 1V85A 1FDDA 4KLDA 1RBLA 1GLJO 2VWKA 2YTUA 5HRRA 2ZHAA 1CZAN 3WKBA 1PJ5A 1VLBA 1D8LA 5D4NA 1JRPA 1B0PA 1KN5A 3OXFA 4CTAA 2YNGA 1LWFB 1NK7A 3TAEA 2UXCJ 3RMAA 3ETLA 4YDUC 4DR4F 2N4DA 5J2AA 1RTDA 1L8OA 1S0MA 4X4TA 4OCZA 3QT7A 4USKA 1VAZA 3G6YA 3BKFA 2WRMA 3FFKB 2HHVA 1EX8A 1IWGA 3KK3A 2F5GA 3EE8A 2ZH1A 1ZD3A 3GG1A 3I5BA 1HRHA 4CLLA 3LPUA 2KT2A 2LEBA 4H8KA 1JLQA 4DR5K 1W2BR 3NRZA 2YWWA 1X2IA 1X4EA 5CEHA 1RT6B 2ZH5A 4B9QA 1HPZB 4U67Q 1TL1A 4OYPA 2FHOB 5HP1A 3M2UA 3X3UA 2KM8C 4RQ3A 1U1LA 2QSWA 2YNIB 1X5TA 4CO3A 1SKWA 1Q79A 1PYSB 1V4SA 5AQNA 1KC8O 4DPUA 3Q8PB 2GO9A 1WKJA 1XMQF 3DRPB 2G9OA 3E51A 2XS5A 2Z2ZA 3W3DA 5KFYA 3NGKA 2OCEA 2VL1A 3K2YA 4I6WA 5GIPA 5D4BA 5IS2A 4RQ0A 3MEDB 4GMKA 3CMEN 4ELUA 2UXCK 4C4WA 3IS9B 5FLXU 4PWUA 5JJBA 3AGKA 3UD3P 3J7A1 3CJKA 1FFWB 3OTCA 4DHVA 1IG8A 3IBFB 3CC4N 1SZ2A 3ULEA 3MXHP 2ZJPQ 4B3OB 2BKPA 1IM6A 1RDAA 3MDQA 5AKZA 3U26A 1WOQA 2FF6A 3M05A 4JI6F 2G1DA 1SJRA 2QL7B 5EE1A 3VQ7A 5AI4A 2A42A 1I94K 2AJ1A 4CZGA 1HQ2A 1Z00A 1HNZF 8ICQA 2ZVSA 2CJXB 4RQ2A 3M8ZA 4OZ2A 1SV0A 2ZKTA 2BW7A 3EO3A 2RHFA 4W98A 3QFUA 4QYZJ 5KFGA 1YIJN 4DU3A 4NYPA 3HHEA 2A18A 2B5JA 2HSTA 4RBTA 3UDEA 3VGSA 3EGNA 4GKJJ 3J7YP 5CR0A 1AW0A 2D0AA 1JXLA 4M0AA 4TLRA 3RF9A 2RKIA 4LUBA 4JKGB 4NWBA 1Q81T 4DFKA 4KGKA 3TVYA 4DCPB 4X65K 1U1QA 1S7HA 4I1TA 2U2FA 4M3UA 4I2QB 3OUYB 1CULB 1HPZA 2V7ZA 3MCOA 4CLWA 2R8IA 3AXKA 1BO5O 4RW6A 2ETJA 4P71A 5I9EB 4IR9A 2AJ0A 2XCPA 2X74A 1NOMA 2XNRA 3T69A 2HNDA 1ASVA 4ECZA 3ZSYA 5LMUJ 2IBOA 1ZQDA 5D0HA 3VZHA 3WIVA 4KI4A 4IC9A 4Q44A 3PRVA 3S6EA 2PO4A 3LGHA 4JI6K 2QN6B 4I7FB 2CNLB 1SB3C 3HDSA 3ENBA 3OXGA 1V5IB 3IDWA 3OY9A 3SENA 2NRWA 2Y9UA 3AM9A 1KBUA 2JEJA 3D54A 3VQSA 4Q8FA 2JH3A 4URQU 1NGJA 4F5OA 4DUTA 1E3MA 1N32K 1LFPA 9ICTA 5ADXA 1DQ8A 1B64A 1KOOA 8ICBA 2BJ8A 1E4GT 1SZPA 2DKOB 4EO8A 2XSJB 2YKMA 2HGNA 4LSNB 1U6FA 2M3DA 1OQ3A 1V5VA 4WKYA 4E3SA 2DNHA 1DTQA 3KJNB 1HW9A 3MBYA 4OHWA 2AGPA 4OHXA 1QCKA 3N97B 1SV5B 2LQ9A 3TVKA 3PJWA 1VJWA 1SIWB 3M1VA 1WG4A 2MQPA 2GUPA 3FAHA 2K3IA 3ENAA 4R63A 4ZVSB 2FJDB 1XEZA 4ACOA 4ZJLA 4IG0A 5CZ1A 5ETOA 4Q8EA 4DJBA 2LCWA 1WF2A 1UAXA 2ISPA 1URJA 3RSEA 1KBRA 1J2VA 3ZTRA 2NSBA 3BZQA 3EZOA 2HRUA 3EDRB 2BUPA 1LXJA 4H0VB 1JL2A 4K8XA 1FNXH 1SPBP 5J8YA 2FVPA 5DBAA 1T8EA 1A5VA 5GAGU 3RRGA 4FPBA 3KXDA 3QEIA 2W03A 4Q43A 1C1CB 3WK8A 2VA8A 1XC9A 1QHAA 4MFCA 3IWNC 3BPDA 2AEMA 3VF0B 1RLCL 3BJYA 4DTNA 2DH7A 4RWXA 4CJTA 2YNIA 1BPBA 3VVTA 1RAAB 1YBTA 2CPXA 3M2UB 4LBHA 1M1GA 3OA9A 2Q6BA 1RZTA 4CZIA 5IV3A 3MCSA 1NU0A 4C8ZA 3TABA 4FW2A 2ASYA 2L08A 5DDQC 4CBUA 1UW9A 4C7YA 2KQ2A 5AQIA 5C10A 1RI7A 4UY8O 3F2BA 4YD1A 2XLIA 1FFVA 2F44A 4I68A 5DDMA 4DF4A 2I5HA 2G8IA 1ZQ1C 3NVZA 5KFKA 4F0KA 2QA1A 4CBXA 4RQ4A 1C0UB 1YRUA 2W9CA 1I5OB 1RLDA 1WC5A 2YXLA 1LCUA 1AFIA 2M8HA 1GO3F 3NVWA 9ICFA 4ED7A 2ACYA 4UY85 3EGVA 8ICKA 1RAHB 2V68A 4PL7A 4NLZA 5D15A 2GVDB 2VDHA 2UUAJ 3F2DA 1VJ5A 2EC0A 1IN0A 2YBVA 2JXJA 3J7Z5 3R7SB 4US8A 2FJXA 4J9LA 4O9MA 2AD9A 4NL9A 4RQNA 3R5GA 4U7UD 2WC9A 1RDFA 2F8EX 3NWGA 1T44A 2AYEA 3KLIB 1NPPA 1AA1B 3SQGA 1P7DA 4CF2A 3K2PA 1JXBA 4K5SA 4IOXA 2FYXA 1NJYA 3OHAA 2AZ1A 4FBUA 2HNZB 3AVNA 1MMDA 4KAIA 3BGFA 3JSMB 2VC1A 4TN2A 3CJ8A 1JXVA 1MC8A 3SQ4A 4LZDA 1ESVA 2NPIA 2XMWA 2HFZA 3NCPA 2MZSA 2DVIA 4ECRA 2KB2A 3C6HA 1FE0A 1PJ6A 3A3PB 5HL7L 2V4RA 3R2CJ 2KHQA 3T1YF 5M1PA 1UHUA 2R3VA 3MURP 3QXGA 3RMCA 2OHFA 1NOZA 3S41A 4EELA 3LANA 5F1XA 3TX8A 4ECWA 2ZEJA 4NMLA 1IBKK 3Q8QB 3VAMA 1VYAA 3FM9A 2M88A 1YX2A 4ZVTB 4ZHRB 1WSFA 3MFHA 2LYHA 2BRLA 2LQJA 3C2PA 2YB4A 4ZS6A 1NGBA 3H45C 3CF5L 1HQUB 1YHQN 4FJ8A 4DG1A 3MTKA 5AQJA 4GKJK 3SPYA 3ZYYX 4MJKA 4Z6FA 3L4BC 1RG6A 3THTA 2PGCA 5MAOA 1VS3A 2X7IA 3MGJA 4F26A 5J1EB 3MCAB 2OXOA 3BN7A 4LRCA 1UFLA 3M8RA 3KK1B 2NXJA 4LREA 1PIEA 3S3OA 2ZH6A 1GLEG 2HBJA 4OKJA 4ZVEA 3W5YA 3TP2A 2J76E 1LWEA 3RFAA 3O4NA 5T7LB 4UB3A 4DOZA 3SJHA 2AJ2A 3MM8B 3AA2A 1S9GA 1XNRF 2IOCA 1FKOA 2G0JA 2CPRA 4EBDA 1Z19A 5HBMB 2YJEA 5HOOA 2UUCF 2ZUBA 3TUPA 4IOCQ 4FZZA 5DQHA 3SSRA 5KAFU 4NLDA 7ICFA 3SQ2A 2W9BB 3K4GA 1KEKA 4X5VA 2MKJA 2IAJB 3D0HE 4PXCA 4LF8J 1ATSA 3MN7A 4L76A 3S1TA 5C15A 2NREA 3OQ2A 3W9IA 4OX6A 5ETNA 1HI0P 4U67L 2ZUGA 1RACB 1S72N 3ZTOA 4CIOA 1RWMB 3ZFVA 3PFOA 3BR9A 4B6JA 3CB4A 3PRBA 1TK0A 1SH3A 3DMJA 4QS8A 5IIKA 1HNWF 1YVUA 2VASA 3TZYA 4OJ5A 1TAUA 4AHUA 1NGGA 5DRKA 2HLTA 3ILJA 3SI6A 4FVMA 1T9TA 1OYDA 4F3QA 1Q82O 4NI2A 5AKGA 1BA1A 1NMDA 1NGCA 4IQUA 2W4DA 4CLPA 4DSFA 1JB0C 1QD1A 2LXFA 1Q86T 5KFNA 3RJEA 4H0PA 1N60A 8ICWA 4BRPA 1U25A 3QGPA 2M0NA 1WG1A 2AH5A 3R5JB 1T05A 5M1OA 2VV5A 2BGGA 1FE4A 2GGPB 3R8EA 4QWAA 2GO8A 4RNFA 2BCVA 4JI1K 4KLFA 2VZ9A 5AT1B 4CJSA 2RAQA 3U3GA 2O01C 2GQQA 1NDCA 2Y1JA 4H5TA 2B56A 4JKGA 3OSNA 4Z4EA 1PJ7A 3UB5A 1Q8LA 2VIHA 2PZSA 4FDFA 4RU9A 3K57A 1Q4RA 4ERDA 3HSDA 9ICPA 4IRKA 5AFUH 2OUGA 3AU6A 4CK2A 2UUWA 3V9SA 1Q5YA 3GIJA 4DS4A 1T9UA 2WW8A 2HHHF 3MN6A 1SV0C 2O4GA 5IIJA 1XMOF 4LF1A 1KQSR 3L3FX 3MDCA 3CCSS 1SGGA 3WK5A 5ETTA 3DV9A 4ZOHC 3V7JA 1O51A 3TACB 2VGMA 3D1OA 4Q2LA 4K4HA 2BBEA 4ECYA 4DSEA 3TTCA 3QBWA 1IBKF 2NNWA 5J2GA 1GXUA 1KQQA 7ICPA 2A3JA 3CCEN 2CQDA 2A2CA 1N34J 4OYMA 1JJ4A 4JI7J 3I0RB 2HHUA 4QR2A 2P5VA 3E0FA 4B02A 3C29A 3IR7B 5CCMA 1N5QA 3C1ZA 3H40A 2WHEA 3QWUA 4CF4A 4DL5A 1URRA 2P5OA 4OLAA 1U1OA 4FJGA 2MYFA 3M8WA 2HB5A 2QW9A 1XK8A 4C1NK 4LFAK 1ZZNA 5L9XA 2DRDA 4KLEA 3MK6A 3I31A 5KFPA 1U4BA 4WK1A 7ICVA 4LIWA 4ZK7M 2OWOA 4JLHA 1FIQA 3MECB 4DUZK 1DJ0A 2EQYA 4X65F 5EX0A 1SKUB 3FC9A 3OV7A 3O1BA 5AJ3J 4OPJA 3RW7A 4TNOA 3AOBA 1VQPN 2EZXA 2KL8A 2HFSA 4OJ1A 3KTQA 4YNQA 4Y2QA 1UCNA 4Q45A 2M7SA 3M8QA 2MY7A 1QM9A 1WKKA 5LJVA 3NH2A 3MOZA 4Y2KA 2OTLN 5I3QA 3KJVA 4DV3K 1MW7A 4TUQA 2JGUA 4FZXC 5HHHA 1LV5A 4XO0A 3GCXP 2MSTA 2QXFA 1S9EB 2DGTA 5ALDA 1HQUA 1WBBA 5ETQA 1RWWB 4FJMA 3D0GE 4CIFA 3L2WA 1X9MA 4ANDA 1F2HA 2B4UA 3HRGA 2YKMB 5HHIA 2QEXS 1GQEA 5LXYA 2Z0GA 1HYSA 4AHSA 5B66U 4KMOB 2KJ5A 1RDCA 4FWRA 3MECA 4NZ0A 1L7NA 5C24B 3M9NB 5CCLA 5AQXA 2WW4A 1UPMB 3KLFA 1T0TV 1SWVA 3QGHA 2P6RA 5EE3A 5D77A 4ZPVR 2A1RA 1G99A 1XERA 2PIIA 4OYZA 5T41A 3KOOA 3I1YA 3CCJN 5JS1A 3O5BA 4P4OA 4O44A 4CT8A 2QLJB 1TVRA 1Q8KA 2H48B 3UCGA 2RH3A 3IWXA 2E1RA 5CABA 3CFOA 1HBMB 1KDNA 3ONQA 3ET6B 2HAIA 1SIZA 2X51A 3UI3A 4CE9A 5LMNJ 3I6PA 3IFEA 4M5MA 3WKDA 2CPFA 4K25A 5JLFA 2KNJA 1W9HA 2B7BB 4USWA 1T94A 4I2QA 4IKFA 4KFBB 1C2PA 3M32A 3DYAB 4Y0FA 1S9EA 2DGVA 4LSZB 5AQHA 3CGIA 3F5EA 4DLEA 3AO4A 4JS4A 5AKYA 1PKUA 2ZH7A 2UYTA 3VF4A 2B8QA 4J9VA 4YP3A 2FHKA 5K9FA 2MTLA 4P6QA 3HTVA 2B51A 4F5NA 3CCZA 4WQ4C 5T7LA 1M5HA 4RTFD 2DRBA 2AGOA 2HQ3A 5ETPA 1IO2A 2BJDA 3HSZA 3M2VA 5J0UA 8ICTA 4MN4C 2HMPA 4GIBA 1T3NA 1IBLK 4GXKA 4L3NA 4CYUB 3MM6A 1S49A 3UKRB 2YN4A 2J5AA 3N4WA 4PG6A 3D7SB 3VEWA 1ZQBA 1YTYA 5EGYA 5HANA 1N5TA 3SQOP 4P52A 3W8GA 2GHVC 4I6YA 4NM1A 2X6SA 5JICA 4JYAJ 3QX7A 4F91B 1UW4A 4OZJA 3F0NA 3JPNA 5ETKA 4NXNK 3TRGA 2E9RX 1FVQA 2PMZF 1N61A 2G0AA 2F8HA 3BB5A 1KWMA 1FRHA 3KHLA 4ZLPA 1NUEA 3G2XA 4J9UE 4LF7F 4PXDA 2D0CA 5IM0A 2YH1A 1PYOB 2MA1A 3EGWB 1RT1B 4LRDA 1BISA 4X64K 4NLXA 3NS1A 4QZ8A 3NL0A 3AB4B 2Y1RI 3SSQA 3EM1A 1FJ7A 2K8CB 2M5YA 3C2MA 1XNRK 2YX7A 2FJWA 3JPOA 3K75D 2H3IA 1VK3A 2V8HA 2XVTA 1KP6A 3V9ZA 3ZCMA 3BBBA 3ZZOA 3R5BA 2E44A 1O1WA 2WF7A 5LJ3Y 4DFPA 2E7XA 2PE8A 3VETA 2W8KA 2F2AB 1HKBA 3LP1B 1RT6A 1IJJA 4DR1F 3HI0A 1NZBA 2XIDA 4NYOA 3SQGB 5IWAJ 4IO1A 3VV2B 4M3YA 3AD7C 5BRHA 3PRDA 3AAQA 1SKSA 3MX5A 4P0PB 2W55A 3BF4A 3D28A 3DXMB 1U0HB 3AVIA 2D0BA 3C6UA 5KI6A 1RBTA 3VQTA 4LJMA 5M1KA 2ODGA 3UQSA 4FKYA 2KJVA 3DCAA 3GPAA 3NBPA 1H3DA 4DS5A 1MWYA 3MI7X 3TZWA 2XY8A 3BF3A 1LWFA 4CF8A 2RDJA 3EW9A 5JU5A 4ZCLA 3T1HK 3HX9A 1TQLA 2E8AA 4K59A 3MDFA 3DLJA 2XI2A 2CQCA 3A0HU 4O4RA 1L3KA 1Z05A 1Q86O 2O8DA 2GUIA 3TO8A 1NDPA 1LW2B 1SJFA 3GWCA 2FPLA 4OLPA 1Z4NA 1Y7PA 4USJC 1FRKA 3SMZA 2O8CB 3U02A 3K89A 1F1BB 4HDHA 4AE5A 3OD2A 2A1JB 4A46A 5FRNA 3W8PA 4YOEA 2JLFA 3MEDA 1RWVB 3WXMB 3WX8A 1ZQYA 1FERA 1FWLA 2BE9B 2OPQB 4FOIA 5CA7A 2QL5B 4RQ7A 4NLCA 5C42A 4UB5A 4CF5A 4LVSA 1M6YA 1MQ2A 1G2EA 5K4LA 4UF4A 4LJXA 4CI6A 9ICNA 1NGAA 1TGOA 5GADP 1WSRA 1V6HA 3NOGA 2Y9HA 4PXEA 7ICJA 1A0PA 2FSNA 2LVWA 3LPTA 5HRPA 3T5JA 2PEBA 1RDWX 3PEHA 5FDLA 5DM7Q 2CKWA 1HJRA 4Y2SA 3IFRA 3SCIE 1XWLA 1HR0F 3RSEB 2UUBJ 3MM7A 2QM1A 1ZQLA 1G6BA 3SV3A 4GMJB 4ECXA 1QUPA 2LEPA 4DB3A 4PY5A 2HHHK 1RXWA 2FSKA 3VQ8A 4B3OA 3O9RA 1S76D 5A8RA 1MWKA 4KITB 1TFRA 2VOOA 1AYEA 1TFWA 3VCDA 4OI0A 3J81O 4DR1K 2NLXA 4DV2F 2XMJA 5HVFA 3UD5A 4KGMA 4QYRA 3CD7A 3ETOA 3H1VX 4P4PA 3EKSA 9ICSA 4M9GA 3I96A 4KLGA 5K8OA 3C94A 2A10A 4D3HA 2QWMA 4IO8A 3T41A 1M90O 4YR0A 3LVWA 1ZQIA 3J7AN 4CFBA 3OTEA 3QYPA 3AVHA 2YQEA 3PKMA 4O5FA 3JQJA 3Q23A 4O5BA 4B9VA 3AD9C 4OMFG 2QKBA 4ZN3A 2C22A 5SUHA 5E3CA 4AILC 2R2RA 3DC2A 1ZPVA 5EHHA 1N54B 4KTZA 4M3RA 4YFUA 1C0UA 4Y2RA 3NCRA 4W5NA 1TKXB 2ASJA 2IJFA 8ICFA 4OPKA 4F3TA 5AM0A 1YDLA 8ICOA 3V5RA 3H8JA 2E4LA 1EIYB 4LFAF 3HFKA 4GV9A 2YJFA 1FFGB 3ITHA 2RQMA 2JHEA 2BJEA 3FKBA 4KYZA 2WBMA 2H5IB 5DB8A 1ZA1B 1NBWA 4KPYA 4MK9A 1VRTA 3CO9A 3GFYA 1CJUA 2P1JA 2LEAA 2X1GA 4ITSA 4PPZA 2HYIB 2A6OA 1KQGB 4WFXA 5ALRA 6AT1B 1VRUA 2HS4A 2PXIA 2FGCA 1VQYA 2QLTA 1HNWJ 5ALUA 3U7JA 4G1IA 4C8NA 4BR0A 3CXCR 3LA0A 3U1LA 1NHVA 2UU9F 3OBYA 1FK9B 1VBZA 4OPAA 4L3QA 3GFZA 4W5QA 3HVTA 2LI6A 1JN3A 1IXRA 1FKPB 3MABA 3EICA 4FP9A 4OZ5A 2A19A 4KSEB 3RJGA 1T9WA 2AHOB 4BC4A 3G4SN 1Q16B 1GK8A 1VK0A 5ALOA 3AD8C 3SNNA 1IUJA 3WKAA 1EQYA 2HCFA 3V9XA 3H4DA 4CGHA 4AFFA 4J2DA 3OTBA 5F41A 2IDOA 5AXNA 1VQKS 1H2TZ 4WYBA 3W61A 2RHKA 4AHTA 2HIYA 3U6FA 1ELOA 5HK4A 5C24A 1NZAA 1UWBB 3Q22A 4CLZA 1QSLA 4ID1A 1ITPA 4R8UA 1T3OA 1IKYB 4M5JA 2DO4A 4UOHA 5BYSA 2DFLA 2IMWP 3CDEA 5KPZA 4GVBB 5AM5A 4BROA 4FN5A 1ILYA 5J2FA 1JKHB 4LH5A 2DHXA 4BRNA 1TMMA 2J9EA 4OZNA 2MZTA 1LKYB 3D66A 2E2OA 2EHGA 9ICUA 2BJ9A 3AVAA 4P73A 2P9UB 2VBXA 2ZOMA 2Z4PA 4I7FA 3SQ0A 4FJIA 4IRCA 3UDVA 3TWZA 3CJTA 3C15A 5DDYA 2XS2A 2JFDA 5CB1A 5HP1B 5FLXO 1S22A 3NG8A 4BC7A 5AIBA 2HGMA 3OVAA 5DG7A 5HLFA 1QHTA 1VBKA 3LDQA 4MHVA 2FVSA 3N0VA 3PJXA 4J9PA 4FPIA 1XUPO 5THWA 3ULEB 2IYIA 3OR2B 3CCQS 2DPNA 3NF6A 2H54B 4OFZA 4YB6A 1FKAF 4CO0A 3V9UA 2RQKA 2C3MA 1FEHA 2DGZA 3HHLB 2QRRA 2PFPA 1F60B 4BXOA 4KE5A 3M8YA 4E7LA 1JCGA 2XM3A 3UPQA 4LBPA 1YT3A 5L39A 3CC7S 2J6SA 4EENA 2DR6A 2DBBA 3R3TA 3FCWA 4CNQA 2F1HA 3L5KA 1ATNA 3IP0A 4FE3A 1YIJS 2Z30B 2FZKB 8AT1B 1LAWA 1WLJA 3DLRA 4N47A 4K4VA 1ZAVA 3RR7A 1OO0B 2E29A 4DPYA 4KHWA 2OPRA 4Z37A 2Q31A 2O8CA 4OX9K 1VQPS 1FTRA 2X78A 4AUKA 2ZHBA 5KFZA 4UAVA 5K8MA 2OFHX 4DF8A 3F9MA 5EE9A 3DWLA 3BBFA 3WK6A 4KIAA 3JAMU 2EEYA 3P8BB 2IA0A 4GKKF 2IOFA 3LP0B 1SH0A 3C46A 4UB2A 4DTXA 2KZMA 2D8CA 3EVOA 2G8KA 2WTFA 2BANA 5L1KA 3SCXA 3CULA 3DRRB 1SV4A 2W4CA 1KLMB 3PYEA 3U9ZA 3MMBA 3LWMA 2CYYA 3WXLA 5IT9Y 3SAGA 2RN2A 2MXYA 3IUCA 1X40A 2W24A 2KSOB 5B0FA 1S1TB 3SMPA 1N36J 4EGLA 3VZIA 3KK2B 3V6DA 2KVSA 3I0SB 5E3QA 3H2LA 3HCXA 2G2OA 4ZCMA 3BSAA 3V1RA 3DLEB 5HSPA 4KTQA 1MU2A 5AQRA 1R31A 1BQXA 3O6QA 1RHRB 3OYKA 2Q3SA 2UXCF 3CJ9A 4FLXA 3S7RA 3BF1A 3PY8A 1HWLA 4KHYA 4JKFA 5EWGA 1HPMA 2GJIA 3VCBA 3FBEA 3ZD9A 5TKYA 4H4KC 2ZTDA 1L7OA 5HNKA 3KLIA 1U6BA 1L8LA 4CZLA 2EG1A 1SVDA 3GJQB 5F8IA 4CO4A 3A3NB 5H9FJ 1QTMA 4DOBA 2DYAA 1RHMB 2BANB 3QT6A 5DMRA 2DGOA 4A2BA 1BPZA 4JOUA 2E20A 2HW3A 1A6LA 3H98A 5J0TA 3D4JA 1UT8A 5JXSA 3KD5E 2A1AA 4K4GA 3Q24A 1RCOB 3UCUP 3IG5A 1KLNA 5FPDA 1RTZA 3AQFA 5KFMA 9ICCA 4LF4J 4O4GA 4HR2A 3FEYB 4C0BA 1VFJA 1PILA 1CXUA 9ICJA 1WWVA 2IOHA 2ZE2A 1D5AA 4HUGA 2HHHJ 3L6QA 3PIOL 2Z1GA 2VFVA 2LA4A 4YCXA 1YVFA 5E41A 3UXOA 3N6NA 4JI1J 4ETXA 4BDYA 1N8RO 4KHPK 3W5XA 1UFKA 1REGX 3SFUA 3DRPA 2C2MB 1R8HA 4C8LA 3EWGA 2NO5A 3H42A 2PA3A 3LDNA 3ZNUA 4K4ZA 4KLSA 1WAFA 2J7KA 5ALFA 4EZ9A 3NAIA 5KFLA 3FFIA 2W04A 1S0NA 2FLLA 4XK8C 1JLBA 2JFKA 1WSIA 3TWHA 3R9LA 1IBCB 3ZSZA 3G6VA 4WU2A 4J2EA 3W9HA 4ICLA 3CDAA 2C3UA 2QARA 2AEFA 3VAIA 4DX6A 4IFYA 4Y1DA 1R3NA 1RDDA 4DL4A 1FA0A 1Z2ZA 1RTHB 3RTVA 3ZLJA 2E7WA 1S6UA 3Q7BA 4YDUA 4L8RB 1OVQA 3OHBA 3CJ1A 2OAUA 2XMUA 1BI4B 3PW2A 5I3UB 4M04A 3IRUA 2J7WA 4BBYA 3LZJA 3D2QA 5T14A 3K0JA 4G1PA 3C28A 2KIVA 2IDEA 4TXSA 3P5JA 3CJBA 3I4PA 1LEOA 5E33A 3B0XA 4JHDA 1EXQA 4LSNA 2JX2A 4PL2A 3O8WA 1HNZJ 3NNCA 3I8DA 2KYXA 2KVQE 2QB0B 4KHNA 1TFYA 4JV5J 3PZPA 2HIQA 2I6XA 1L6NA 3IV6A 2WF9A 4PXBA 3M2VB 5IWAF 4OJ6A 3R8YA 3SPZA 2GMHA 4K7QA 3IC1A 2P9SB 2CN1A 1WG8A 4CZEA 2XWXA 2KLAA 1SL1A 3VEZA 3PW5A 3DYAA 4RW4B 4RPZA 4OYIA 1JJHA 4O5KA 1OUQA 4AQYK 3LPEA 4MIAA 1Q9YA 3V4MA 1CC8A 2JLGA 4KKOB 1WTBA 2W6LA 3ISDA 3SYZA 3JYTB 2D3UA 4PA1A 3ZZUA 4NLRA 4RBUA 4NLQA 3L4IA 4CJ5A 3WK9A 2HHTA 2GWKA 1LOUA 3VR1A 4F4AA 2BRKA 1EQ0A 5B0DA 4N7TA 3PMNA 3OYDA 1FK9A 4CRJA 3W66A 3BO3A 4HWIA 1I39A 4AYBC 1B99A 4I29A 2HZAA 4FL9A 2OM6A 3H7IA 2D3O1 3T1HJ 3MCNA 1WYGA 3HRDD 3UNGC 1ASUA 3PR4A 3Q8RB 2GVDA 2PSZA 2RHSB 2D3OR 4F71A 3EPIA 2KFYA 3ULDA 3PYGA 3I55N 2EFNA 5K8NA 3T5HA 4RQ5A 2IJNA 4B1XB 3NH1A 4WE1B 3KHYA 3LDPA 1S1XB 3R5AA 2EAOA 1L7MA 2DEIA 2L5YA 4MYTA 3ENHA 4JI4K 4KN4A 4RW9A 2DRAA 4QZBA 2E2PA 3DJCA 2HBKA 1CJTB 2ZH2A 4KLLA 4DXLA 3A8IA 3DM2A 1UWBA 3VGVA 2PY5A 3PHTA 3OYBA 2ALYB 3FUYA 5AQUA 3HF5A 3BDPA 1YGYA 5B08A 1BGXT 4ZLJA 3H0PA 3J80O 2VWBA 2J8SA 2ZJPL 1M1HA 1EWQA 2ZIXB 5C12A 3BV8A 3KLFB 3D0PA 1VHFA 1U47A 4KO0B 3V1QA 2H4WB 3GZFA 2L48A 1T03A 4WPAA 3JPQA 2OD6A 1VGYA 5J1NA 3GQCA 4CDIA 5KFTA 2LU2A 4KV8A 1J54A 4FO0A 1T03B 1DRZA 5J2NA 4ZPAA 1NDKA 3BM7A 4UAZA 1KTVA 1S1WA 1OSDA 4JV5F 1BE4A 1B0TA 1J9AA 3R6GB 1NK5A 1BC6A 3AHPA 3AVMA 4EBEA 1EKSA 3SUOA 4USHA 1N5VA 9ICGA 4ILMA 5DM6L 1MDUB 1X4GA 2I5JB 2BV3A 3G10A 1KD1O 3W2WB 1HW8A 5J0PA 2XHCA 3QAUA 4IFEA 1K5OA 1HQEA 3FSXA 3HWTA 2R7QA 1SC6A 1XQIA 2GJFA 9ICBA 5CYMA 3EE9A 2ZJAA 3IHQB 3GV5B 2IIHA 1ZQZA 3VC8A 1JLGB 3O08A 5HQLA 3QJJA 3O4WA 3LGMA 1YZ6A 1R59O 4CEZA 4M8LA 2Y9TA 1V9PA 1YJUA 4IS7A 4MT1A 3AAPA 1GTHA 1TKZA 1HNXJ 2BOPA 3TSQA 1NG9A 5SWMA 2K8BB 2HK2A 4U7UK 2B7CB 3K5MA 1G1XA 2HQFA 1RT5A 1Q95G 1U1RA 3P45B 3GDXA 2DNGA 5B8HA 3QO9A 2A5XA 2F8TA 3RBEA 1HWIA 2BR0A 1XO1A 2ILYA 3WNGA 4LF4F 4NCAA 4P7VA 3MF5A 5A2QU 1TL7A 2AJ4A 4IUFA 2P9SA 2KFNA 3H1QA 2OYQA 3F2KA 1BHLA 3VGMA 3LQVA 1MN9A 3HL8A 2V50A 4LFCJ 2KFZA 1MA9B 2KXHA 4PKGA 3HD2A 4FJNA 1HYZA 2CRLA 3BZKA 2J9DE 4FLWA 1JLQB 4DR6F 5HR7A 2BYCA 2LKZA 4LF9K 1RXVA 3OT9A 4PGQA 2MUTB 4BGDA 2YMMA 1PG5B 3QICA 5CWRA 1VQ6N 4KAZA 5KG5A 2IVPA 3ID8A 4FZMA 2E9ZA 3DEEA 2YHYA 4P4MA 4HVZA 1V38A 5KRSA 3J80U 1XMBA 3AFGA 5KNIA 2ZXHA 3MAAA 4C0HA 4HLBA 1RWOB 1DGJA 4OHVA 3J8AA 3RAXA 5GIOA 2WK4A 1IV0A 4PKHA 5F8NA 1GT8A 2NRTA 4JD2A 3N4PA 5HMLA 1LQ9A 1YXQA 2FPHX 5FPMA 4BY9C 1P8GA 1VIOA 4YMNA 4JI3J 4I28A 4WQ4A 1C4CA 3PTWA 3K8WA 2K3KA 1JUDA 1H38A 4DR4J 4QW8A 2KKPA 2IS3A 3RGIA 2W2NP 5GMEA 1SL2A 5F8JA 4ECSA 1WSEA 2FUG9 4RPXA 3ZO7A 2RVJA 2A6MA 2WAQF 2IVYA 4NLGA 2FGOA 3OFEA 4US9A 1G7CB 1RT7A 2MSSA 3QESA 5GVQA 9ICVA 4YHHK 5GAGP 1KN6A 4XA5A 2RF2A 2BACA 3WXIA 4R79A 3LL3A 2B4JA 5E3AA 1HI1A 2HQCA 2HEKA 5D6GA 1RTHA 3RH4A 2NUBA 3KZBA 1X9JA 4B9LA 1N52B 1DLOB 3OYHA 3CIMA 4DHYA 1C6VA 3UKUB 4K4YA 1JLAA 1OXJA 3N4QA 2KG0A 1NGEA 2GIRA 4KGXB 2VPZB 3P4IA 4PG8A 1MWZA 4DV7K 3DLLL 5A0LA 1EETB 3HMJG 4BR4A 2DEJA 3JS9A 2FLNA 4Y0WA 5DG8A 4DUYK 3DLLQ 3WUHA 3VTHA 1KQFB 5DO2A 1U0HA 3SR6A 1OQ6A 2JC0A 1TL1B 2O8FB 4YFKA 4I2EA 3MR7A 4IO9L 5IV4A 4OHYA 2IM2A 2UUAF 5AKIA 3TARA 3MCPA 1F5SA 4OGEA 5LMNK 4F5PA 5EVZA 4YY3F 3DGVA 1CQNA 9ICMA 3FGUA 3JS6A 4M5IA 3GDQA 4N8OA 3L3VA 1U2FA 3CCVN 1ZAXA 1FT8A 3HHDA 1L5UA 1BU6O 1V3ZA 2GA7A 3QT5A 1BDGA 3NHGA 5DB7A 4A47A 1UAWA 2ES6A 4IOAL 1S1UB 2GX8A 4PHDA 1AB8A 1KC8T 5HROA 2YNGB 2W9CB 2NRRA 1RADB 4WFBQ 3T79A 1NGFA 4ZCKA 3CETA 1NKBA 3OXLA 2YVSA 1BWEA 4RW9B 1P27B 3OFGA 2N3LA 1COKA 4OJPA 3UMGA 1X1PA 2EX3A 2Y0BB 3LO3A 4Q2MA 1N48A 3PJ9A 2DNKA 3ZSOA 4CI0B 4IFVB 2E5LK 3M8PA 2RF2B 1HMVA 1M5OC 2YB1A 1LK7A 2NRVA 1B7YB 2HMIB 3GFHA 2AA4A 5BPCA 1CJKB 4NV0A 3DHXA 2X3DA 3PNIA 4E7JA 4USIA 4CEBA 4WFAL 2RKIB 3U9DA 2ROGA 4PRFA 1WDTA 5M1QA 4M3TA 1KAYA 3SV4A 3NKYA 1ZQAA 4G3IA 2B5JB 1FWPA 2OGUA 2LQ8A 2NSCA 3VQ5A 3CJ3A 4FM0A 3LF0A