4DQIA

Ternary complex of bacillus dna polymerase i large fragment, dna duplex, and dctp (paired with dg of template)
Total Genus 207
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
207
sequence length
579
structure length
579
Chain Sequence
KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural factors that determine selectivity of a high fidelity DNA polymerase for deoxy-, dideoxy-, and ribonucleotides.
pubmed doi rcsb
source organism Geobacillus kaustophilus
molecule tags Transferase/dna
molecule keywords DNA polymerase I
total genus 207
structure length 579
sequence length 579
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4dqiA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4dqiA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4dqiA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4dqiA01
2E6LA 1B9DA 4YR0A 4C8KA 3DLHA 3MFHA 7ICNA 1HYSA 4PWDA 1NK5A 5CYMA 4KREA 5J2QA 4NYFA 2E6MA 4JUZA 3MFIA 2PI4A 4Z4CA 1KCFA 1JLAA 1HYVA 5DG9A 4QCLA 4DF4A 2F1HA 2KFZA 1B22A 4IQTA 1UAXA 3OS1A 2W42A 1CLQA 3TARA 1ZQHA 2XY6A 4OJRA 3QEBZ 3M8SA 4JS5A 3OHAA 5KFZA 4RQ5A 1RILA 4CGHA 4CK3A 1YTAA 2E4LA 1BQNA 1RT1A 3DLGA 3V6HA 4DFJA 2KZZA 1WNSA 4CIFA 3FFIA 4YR3A 5FROA 1EKEA 2FLNA 2ZUDA 3PMNA 3ULDA 2JEGA 4MFAA 4DTSA 1FKPA 4CECA 2I1QA 1T03A 4NCBA 5KGWA 4AHRA 1C0MA 4B08A 3AO3A 4FBUA 4OGEA 5C25A 1BIUA 2XGPA 3RH4A 4O44A 2HHTA 1PZNA 4FZXC 4Z6EA 2AGOA 4O3PA 2ASLA 7ICRA 8ICPA 4FBTA 3VA0A 4YR2A 4PH5A 1JLEA 4OGCA 5DG7A 1S1TA 4OVLA 1U49A 2ISOA 5HRRA 5IILA 3BDPA 2W9BB 1U9LA 3OSPA 1ZQJA 3V1QA 4EEYA 1JKHA 4C8LA 4CGGA 3NF8A 3D0PA 4FS1A 1SKRA 5KFTA 1L3VA 3RMCA 3NCIA 4K8XA 1BPYA 5KFIA 3H7IA 4FW2A 1YT3A 3Q8LA 3PMLA 4XQ8A 4IR9A 2HVHA 4QZEA 3AVLA 3AA2A 3OYFA 4AHUA 5E41A 4N56A 3BQ2A 1B92A 3HVRA 3V9WA 5CA7A 1ZYQA 3RJGA 1ZQVA 4Z6DA 1BQMA 2ETJA 3DI6A 4F8RA 4F4YA 3QZ7A 1REVA 1DTQA 4CHOA 3QEAZ 4Y1DA 9ICFA 4ZH4A 3ISCA 4RQ3A 2BE2A 4M9GA 1ZQKA 2WTFA 3Q8KA 1ZQIA 4Z6CA 3SPYA 1KLMA 4CHYA 4FJJA 4FJ5A 1TGOA 2A1JB 4QWBA 5KT4A 3HW8A 1IKXA 4TUSA 1RYRA 2AGQA 3AVCA 4IQWA 4CHNA 3M9OB 1LAVA 1B9FA 9ICLA 4DTUA 5DQGA 4C8OA 1MSWD 5J2NA 4OPJA 2M9NA 9ICBA 5J2AA 3V9XA 4J9KA 3VQ8A 4EYIB 3G0ZA 3TANA 1KRPA 4CF1A 5TZVA 1JLBA 3DOLA 1NOMA 4LZDA 3TAEA 1WSIA 4CIGA 4F3TA 2BDPA 5L1KA 3HP6A 2G8UA 4KMUA 2ISPA 1S1VA 4PHAA 4EP4A 2W9MA 4F5NA 3MEEA 1C1AA 3EY1A 2YNFA 3OS0A 7ICHA 4TUPA 3Q8PB 3IG1A 4RZRA 8ICUA 3Q8RB 2I9GA 8ICVA 8ICNA 1VSJA 3C23A 2JZBA 3VQCA 4UAYA 1IXRA 1ASUA 1RYSA 3NTUA 1U4BA 1RT2A 3T1AA 2X78A 4LH5A 1K1SA 1GOBA 9ICRA 1JMSA 4AILC 2FMQA 4BWJA 2B21A 1J9AA 1JXLA 4QZ8A 4IR1A 1I3AA 3OGUA 4J9OA 3VQPA 3GV5B 3V9UA 4KHQA 5BPCA 4J9QA 2BKEA 3KHRA 4ECYA 4ED7A 2V9WA 2XY7A 3V81A 3NHGA 4GC6A 4KLDA 3KHGA 3ZSRA 2OPSA 3B0XA 3DLRA 4R63A 3LWLA 3V7LA 4UQGA 4HCBA 4J9LA 3DOKA 4F93B 7ICLA 2B5JA 2Z1GA 3EWAA 4QZCA 1RXVA 2W8KA 5KFXA 4Q43A 4GMJB 4BGDA 4KLOA 1NK0A 3RMBA 2AQ0A 4DQPA 1YVUA 3HVTA 1BVSA 3KTQA 4KLGA 4IFVA 4IG0A 4EZ9A 3JSMA 1WSHA 3MDCA 1FXXA 3SQ0A 5CP2A 3MXIA 2ALZA 5L1IA 4NM1A 1BPBA 4E19A 4YD1A 5C5JA 3TWHA 4TURA 4F91B 3QE9Y 5J2CA 4I29A 4KLHA 4LSLA 1D8LA 5KFPA 4M41A 5J2MA 1RBUA 4TUQA 2BGWA 1BPXA 4FLYA 2DFHA 1XU4A 5DBBA 3GFKB 8ICGA 1S0VA 3SYZA 4KLSA 1RTIA 8ICFA 2P6RA 3O4NA 2BCVA 3F73A 4M3YA 5KT7A 3SZ2A 4DQQA 8ICZA 1JLCA 3V6DA 2VWKA 1X1PA 5KFSA 1N6QA 2ASJA 3Q8QB 3SI8A 2C2DA 4DSJA 2D0AA 5DB7A 1FKOA 3SQ1A 3SQ4A 2AJQA 1TV6A 4KHYA 4QW8A 5J2EA 4YD2A 1N56A 1XHZA 4IQVA 3PO5A 5J29A 3GIJA 5J0RA 3I0RA 3KLHA 4QWEA 4Y1CA 1C7YA 7ICUA 9ICXA 3HL8A 4ICLA 4HCCA 2BANA 3C6UA 2OZSA 2MUTA 1LWFA 4FM1A 3HPGA 4RQ1A 4BXOA 4KLJA 3K5LA 1TKZA 2HNZA 1UWBA 2RPIA 2VWJA 3BQ0A 3D45A 4CJUA 2ZTCA 4ECTA 2P5GA 5DB8A 3ZD8A 3K5MA 1RT3A 1JN3A 4ECQA 5CZ1A 4NM2A 4JWNA 1MQ3A 1JL1A 3NDKA 4QZ9A 2X74A 2OWOA 3PO4A 1Q9YA 4MFBA 4CJQA 3B0YA 1BCMA 4O3SA 3PUFA 2UVRA 1F21A 3M8RA 4O4GA 2R8JA 8ICBA 2ZUBA 2W9BA 4FJXA 4KFBA 4I9LA 1BHLA 1QLNA 4KPYA 5HRSA 1ZQZA 4M6WA 2F1JA 3HSTB 2WONA 3H40A 1BL3A 2FPKA 2LYHA 5DLFA 2PI5A 3LP3A 1KFSA 2A1RA 1KLNA 4KO0A 3AVBA 2Y1IA 4ZTJA 2Z1JA 4B9NA 4CGDA 3TAMA 4IBNA 3NH1A 1VRUA 5D46A 4CEDA 3NGZA 1EXNA 1RT5A 4Z6FA 2FPMA 1SZPA 5CR0A 3TFSA 3RRHA 1SUQA 5DB9A 3RBEA 1RBTA 4J2BA 4IDKA 2BCRA 1XSLA 2O4IA 2R8KA 4KTZA 5DGAA 5KG7A 1IKWA 4PQUA 2Y1JA 5CWRA 3AVFA 4M3UA 3SNNA 3PW4A 4CCHA 4Z4HA 2NRZA 3ALYA 4RPXA 3VQDA 4Q5VA 9ICTA 9ICHA 3MR3A 4P4PA 3PR5B 3JYTA 4E3SA 4PY5A 4E7KA 4KAZA 4DQIA 5KFFA 3E2EA 4Q0BA 5FDLA 2IHNA 4OLBA 3MDAA 4R66A 4ELTA 5KFLA 2P6UA 4BDYA 4KLLA 2OA8A 3ZSYA 3N97B 4DF8A 4WE1A 2PYLA 2KTQA 1A5WA 4FJ9A 3SUPA 2ASDA 3AVGA 3L3UA 1JX4A 3OJSA 4JRQA 8ICEA 4KLEA 5KFGA 4KHNA 1RTJA 4ECWA 2JEJA 2J6SA 4KV8A 1RNHA 3ZDAA 3K58A 2BR0A 5KG4A 1D9FA 4ED2A 4DTPA 4RQ0A 3RJKA 2BCUA 4QOZB 4DU4A 3ISNC 3A2FA 4JV2A 1KVCA 3MEDA 5KT2A 5IIKA 5DB6A 1ZJNA 1XI1A 4F4XA 4F5QA 2YNHA 1KTQA 3QO9A 1RCHA 5DDYA 1C0TA 4M42A 4RU9A 4MQ3A 3PVXA 3NBPA 3C2MA 4M9HA 3ZT2A 2BPCA 3UXNA 1S10A 1NK7A 1A76A 1RBRA 1TL3A 2PYJA 3HK2A 4IRKA 3RMDA 8ICTA 3EPGA 4B9MA 1ZQCA 1BIZA 3NAEA 2HHUA 4RQ7A 4M3ZA 4JV1A 1WN7A 4XRHA 4F3OA 4M2YA 4DSLA 7ICVA 4RPZA 3GILA 4DTMA 4GVMA 1ASVA 1QTMA 4P4MA 4ED0A 1KVBA 5J2JA 4IRCA 4B9TA 3K75D 4Z4IA 1NJYA 4E0DA 3NF9A 4I9QA 3WNGA 8ICXA 1S6PA 1RTHA 4FK4A 5HP1A 2R8HA 1N48A 5J2HA 1Q8IA 4ECZA 2BCQA 3IS9A 4ED1A 3C1YA 3V6KA 5DBCA 3MGHA 4DQRA 3LWMA 3K57A 4CJTA 4DOBA 4DWIA 3JPTA 3AU6A 4YN4A 8ICCA 5D49A 5KT6A 2FLLA 3TABA 1H38A 1VSLA 4B8AB 1ZQRA 2AQ4A 3T5HA 4R65A 9ICIA 1S6QA 4YXJA 3I0SA 3LAMA 2JLEA 1ZQYA 3MR5A 4ZHRA 1S97A 5KFJA 4KLQA 2XCAA 2ZJAA 1T3NA 5KFOA 4IFYA 4HTUA 7ICGA 4FK2A 5L1LA 1GOAA 3EYZA 4QZHA 2IAJA 3AO4A 2Q3SA 5EWEA 2W8LA 5DQIA 1NKEA 4LH4A 4CJVA 4RQ8A 5D4BA 3OYJA 3V7KA 4FM0A 2IMWP 2IBKA 3C6TA 4K4HA 1BI4A 2NRTA 3S9HA 1DTTA 1TKDA 4RQ4A 5KG2A 4C8NA 2Z1IA 3P83D 3KJVA 3ZCMA 2P5OA 7ICIA 3KIOA 4KLIA 1IO2A 1ZQGA 1HJPA 3SV3A 4BE0A 3KLFA 1XC9A 4CFDA 1UT5A 1A5XA 1Z26A 3VQBA 4UB3A 2RF2A 3M9NB 5J0WA 3LAKA 3KKSA 4B9UA 4M9JA 4E1MA 3H8WA 4UB5A 2I5JA 1NJXA 2V4RA 1S9FA 5KFNA 4DL6A 2ATQA 1S1XA 5HRNA 1SL0A 9ICJA 4NCGA 4CHPA 3RB6A 3TR8A 2YV0X 3H8SA 3ZDDA 9ICPA 5KG6A 1C6VA 3L2UA 3RMAA 3KK2A 4QZIA 2YKNA 3M8QA 2HHVA 4FJ7A 4KB0A 4QWDA 2BCSA 2FBVA 2VA3A 3JPOA 1X9SA 4E7LA 3MR2A 4PUOA 4J2AA 3NGYA 1ZQNA 3NF7A 1DOQA 4ECRA 4CEZA 2F8TA 5L9XA 1RXWA 4DL7A 2P51A 1B43A 4F4KA 4NLZA 3IRXA 4F50A 9ICNA 4PGQA 9ICWA 1MU2A 2C28A 4BDZA 3OYLA 4KN7A 5DBAA 3MXJA 5KFYA 4FM2A 1LAWA 3I8DA 3MBYA 2R8IA 1ZQPA 1IKYA 4CJPA 2GWSA 1Z3EB 1ZQSA 4GXIA 4RG8A 1O1WA 1NJWA 2D0CA 5KFKA 4DSKA 1RTDA 1QE1A 4RT3A 3ZT1A 3QNNA 4CEQA 3KK1A 2KQ2A 1Q9XA 3LP2A 1Z00A 4DSFA 3RB3A 4LVSA 4YXMA 5FRNA 3OS2A 2F8SA 1IH7A 4YQWA 4ED6A 4CFAA 3RJJA 3ZT3A 3JPNA 4CESA 4YP3A 1J54A 4CJWA 8ICIA 4LSNA 4FLUA 1VSKA 5KG0A 3KLEA 4YFUA 4DL4A 2C2RA 3K5OA 3QERA 5HLFA 2BHNA 3PNCA 1ZQLA 2H5XA 1T8EA 2MUTB 1ZBUA 3MXMA 2OYQA 3QEIA 3MAQA 4DU3A 3QINA 1XHXA 2YNGA 5J1EA 4CJSA 5DG8A 5KFRA 1ZBHA 3HM9A 2AU0A 1S9EA 9ICOA 3PV8A 5HBMA 1ZBFA 1XWLA 1VSIA 4M04A 4FJLA 5BOMA 1LWCA 4F92B 4I2JA 4CJFA 4FW1A 4KTQA 5DLGA 3FDSA 1XO1A 1ZQUA 4F5OA 4O5CA 3RJIA 4UB2A 1KVAA 4MF8A 4QZAA 3LPUA 1EXQA 3AUOA 3G10A 4KITB 4M3WA 1COOA 3G6VA 3RR7A 2C22A 1U45A 4DOAA 4TQSA 2X6SA 1TK5A 4DO9A 7ICQA 9ICQA 1S5JA 1ZQEA 5HHHA 4DS4A 3T19A 5I3UA 1K6YA 4ECVA 5KG5A 4KLTA 3N4MB 4HUGA 3AVMA 4M45A 4Q8FA 3IAYA 4XIUA 4NYNA 2G8FA 4DOCA 3DM2A 1X9WA 1KDHA 3LZIA 2QXFA 2G8HA 3ETLA 9ICEA 4NLGA 4O5BA 4W5NA 2VA8A 4UBCA 4AH9A 3AO5A 2BGGA 4IG3A 1HPZA 4BDPA 3QIPA 4KLMA 3WNEA 4M3RA 4W5OA 4FVMA 4DL3A 1J5OA 1U48A 5EOZA 1HQEA 4CEOA 3PW5A 1BI4B 3CFRA 3PY8A 4CHZA 4DU1A 2DFEA 4PGYA 4CGFA 3FYHA 3OYCA 2ZJ8A 1D5AA 5KGXA 8ICLA 2DFLA 2VA2A 4O5KA 4Z4FA 2QKKA 4ED3A 4GXKA 4DTXA 4HYKA 4CJKA 1MC8A 3C1ZA 4ID1A 1NOYA 2BQRA 4KHUA 4YMMA 1TV9A 4AHVA 3SUOA 2PXIA 4UBBA 5J0YA 5SWMA 4ED8A 5DKWA 3PW2A 4EZ6A 3KD5E 3O3FA 1TKTA 4QZFA 1FK9A 1IG9A 4M3TA 4J9PA 4DFMA 5J0OA 3QEXA 3ZDEA 4RNOA 5CJ7A 1S1UA 5KFVA 5CY4A 3IHQB 3V1RA 2P66A 4O3OA 4R8UB 3H08A 1S76D 3QIOA 4JLHA 5BOLA 4LY7A 2PY5A 9ICUA 1TKXA 3KK3A 4FS2A 3THVA 1D8YA 1CZBA 5HP4A 3Q8SB 4ECXA 4M3XA 4N5SA 4O0JA 1SL2A 3TAQA 7ICTA 4PHEA 3AVHA 2A1JA 3V1OA 1NK9A 3V4IA 4FZYA 4PHDA 4QAGA 4KLUA 1ZQXA 1VSMA 7ICMA 1BPZA 5EU7A 3AA3A 4DMNA 3ZT0A 3T5LA 3PX4A 1IM4A 4YNQA 4FJHA 5T7BA 4F5PA 4ZTFA 2XO7A 4F5RA 1RBVA 4OKJA 4CERA 3V72A 4JWMA 4JS4A 3BQTA 3OYGA 4FCYA 3LANA 1ZBIA 3WNFA 2IC3A 8ICOA 4PA1A 4FLVA 2V4QA 4IKFA 3OYNA 3NGDA 3PW7A 5EWFA 1ZJMA 3E01A 3IM1A 5SZTA 2HHXA 4B8CA 5CB1A 4J2EA 1TK0A 1RDBA 4EYHB 7ICFA 1CUKA 4RUAA 1VSEA 3G6YA 3OSNA 1CXUA 4CFBA 1L3UA 1AROP 2UVWA 4O5EA 1G15A 3Q8MA 3LP0A 2DY4A 5C42A 2UVUA 3HT3A 3F9KA 4YVZA 1L5UA 5HMLA 4GW6A 4CIEA 5J0UA 3SJJA 3SPZA 2F1IA 1X9MA 4GC7A 4I2AA 3B6OA 4RW6A 1Y97A 4F4WA 3VQ7A 3WNHA 4CK2A 3AA4A 2UVVA 2VG6A 3O3GA 3OVNA 2G8IA 4J9NA 4CF9A 3ZSZA 3CM5A 4CJ4A 4I2GA 4IRDA 4E7HA 3LDAA 1TVAA 4O9MA 2B4JA 4M9LA 4FLTA 5JUMA 3OHBA 4OKEA 4UAZA 1WAFA 2KN7A 2FPLA 1RDAA 4J9MA 3UIQA 3RAQA 4DQSA 4H4OA 1ZQAA 2HNYA 1VSDA 3AO1A 4BE1A 3RJEA 4GLXA 4YMNA 4G3IA 4RNMA 3JPSA 4NLNA 4CJEA 2YNIA 5KFCA 3GV7B 3SI6A 4RNNA 2C2EA 4DEZA 4X5VA 2ZUCA 3RB0A 1CXQA 2X6NA 3CFPA 3O3HA 1R0AA 1RT6A 3ZSVA 2RDJA 3H4BA 3VQ4A 1RPLA 3C5FA 3ZT4A 3UQ2A 3RJFA 9ICCA 5C24A 8ICRA 3VQ5A 4I7FA 4W5RA 1NK4A 1LW2A 3SCXA 3AU2A 5IINA 3DRRA 3OYHA 3RTVA 4HVJA 4FJNA 4QZBA 1HNVA 3C94A 5KFUA 5J0SA 1TAQA 4RT2A 1QQCA 8ICKA 3ZSXA 5J2KA 1QS4A 7ICEA 5CYQA 4B9VA 3QESA 4HUEA 4MFFA 3C2LA 3HJFA 3RH5A 1UT8A 1EX4A 4CK1A 5HROA 5KG1A 2BQUA 2J6TA 2KZMA 4DS5A 5JS1A 1ZQOA 4FJMA 1WSEA 3NH0A 4DTNA 1WSGA 4AHTA 1K1QA 4M6WB 5HNKA 1C1CA 1BGXT 8ICMA 4N47A 4RUCA 3GQCA 4OKKA 1ZQFA 3DRPA 2XRIA 1TK8A 7ICOA 3U3GA 4CGJA 3MECA 3GV8B 2KFNA 3ZSOA 2GV9A 3MGIA 3HPOA 3P5JA 2FLPA 1XSPA 1KFTA 5L1JA 3U6FA 3UPQA 5D3GA 4F2SA 2IDOA 1RBSA 3HXMA 2VG7A 4FJ8A 4TSXA 3LK9A 2YHAA 3QETA 5KFBA 4FLXA 4KN4A 4UB1A 3VQ9A 3UXPA 3TQ1A 4FLWA 1UA1A 4H8KA 1JL2A 4CEBA 3S3MA 4B9SA 8ICHA 4FXDA 2HHSA 3ZSQA 2B6AA 1JIHA 1X2IA 4P4OA 1QHTA 3HO1A 3P1GA 3AVAA 4FYDA 2JEIA 1L3SA 4CJ5A 4XA5A 9ICKA 1ITGA 4UB4A 3AO2A 4MEYA 1CZ9A 1HRHA 3GIIA 4CF0A 3QLHA 4N41A 4KHSA 5DK5A 4AHCA 3H4DA 3NGIA 3KHHA 5J2DA 5J0QA 4PGXA 5KFEA 3V9ZA 1RT4A 4EBDA 3SUQA 2KZ3A 1NKBA 5KFMA 4JRPA 2G8WA 4L8RB 4Z4EA 1HQUA 2IS3A 2J6UA 2PZSA 3AA5X 2WOMA 3VQAA 4KI6A 1U47A 3K4GA 3MR6A 1LW0A 4DL5A 4FJGA 2FBYA 2XCPA 1SL1A 4DFPA 4Q45A 3HX0A 1KSPA 1J53A 2NRXA 3PR4A 1ZQBA 2DPIA 4Z4GA 3QEPA 2HMIA 4DTJA 3G6XA 5KTQA 2FBTA 2VG5A 2LSNA 2FC0A 2ITGA 2FMSA 4J9RA 1KFDA 1HUZA 4YG2A 4B9LA 8ICAA 4ECUA 5KFWA 1C0UA 5DDMA 2Q0ZX 1WSFA 2QKBA 4YMOA 2R7YA 3L2RA 1HMVA 2OPRA 4MF2A 3VQ6A 3OYIA 4O3NA 3LZJA 5KG3A 3U3YA 4RW9A 2HB5A 4HHTA 1EETA 3NH2A 3BQ1A 4E89A 3OY9A 3AVJA 4K4IA 1N5YA 3K59A 3DLEA 9ICMA 2ZE2A 3EW9A 5IIIA 2XY8A 4TQRA 1WAJA 1T7PA 4K4GA 4CJ3A 4UAWA 3ZD9A 4JV0A 4KI4A 3GDXA 3V7JA 3OJUA 9ICGA 3HP9A 5KRSA 3QZ8A 4DLEA 1BPEA 2W9CA 1S9GA 4CEFA 4FK0A 5DMRA 3V9SA 2ZD1A 4J9SA 4RW4A 4QW9A 4I27A 4NLKA 3L2QA 4Q44A 1S0OA 3HYFA 1D9DA 2PFOA 5JS2A 4FJIA 4BWMA 4I2EA 4K8ZA 4Q8EA 1VSFA 1NJZA 4PHPA 1RT7A 4N76A 2ATLA 4NXZA 2GBZA 4QWAA 2P1JA 3H8JA 1W9HA 4AHSA 1LB2B 2BPGA 2O4GA 4DL2A 3M8PA 5J0TA 4OPKA 5DQHA 2OPPA 3DLKA 7ICPA 3PW0A 3UQ0A 1UA0A 5KFAA 4E1NA 4RQ6A 5J0XA 2FBXA 4M9NA 1JXBA 3RR8A 4GXJA 4DFKA 4ID5A 4KLFA 3BJYA 1RZTA 3B6PA 2IA6A 4RQ2A 1LV5A 2ZTEA 1SKSA 1VRTA 3S3NA 4PPXA 3TAPA 2XY5A 4I2QA 1DGSA 4O0IA 3C2KA 1VK0A 4O3QA 1SKWA 3CG7A 4I2HA 4NCAA 2QK9A 3QEWA 4P2HA 4CEAA 3VQEA 4XUSA 3V6JA 2W9AA 3C5GA 4DTOA 3CM6A 1JLGA 4YFKA 4I2IA 2JEFA 2D0BA 4LZGA 4MEXA 3AVKA 2OZMA 1TVRA 2BPFA 2NRWA 2XC9A 4R5PA 3EZ5A 4KHWA 4FO6A 1JXEA 5J2PA 2RKIA 1DLOA 4H4MA 2ZJ5A 8ICSA 1QSYA 4OLAA 3LDSA 3ITHA 4CFCA 4KKOA 4DG1A 3KLGA 3RBDA 1TL1A 1QSSA 3ORYA 1KEJA 5DGBA 1JLFA 1ASWA 4CEEA 2EHGA 2ZQBA 1ZQTA 4B3OA 3OYMA 4W5QA 2HHQA 5HRPA 3OYDA 4J2DA 3GIMA 3RB4A 3TAFA 3ZDBA 2EX3A 3ISBA 5IIJA 7ICJA 3OYBA 3TAGA 3LPTA 3T5KA 4Z0UA 4EBEA 1L3TA 4I2BA 2HNDA 2HVIA 4JK1A 4M47A 4I2CA 4F2RA 4ELUA 3EPIA 5F9NA 8ICJA 1TFRA 2VANA 2IOCA 5KRTA 5I42A 5HMMA 3CFOA 3M9MB 5EWGA 1S77D 1LWEA 4BACA 1QSLA 1RDCA 4I2PA 3K5NA 4ELVA 1WSJA 3OYAA 2W9CB 1Y88A 4EBCA 1ZQQA 2PFNA 3KKRA 3L3VA 4LD0A 5KFQA 1U04A 2G8KA 1SV5A 3DMJA 8ICYA 3ZSWA 3KD1E 4DLGA 2HW3A 5J2IA 3VN5A 2OPQA 4YCXA 3L2VA 1JLQA 3MABA 4CF8A 4RW7A 5J0PA 3PX6A 5F9LA 3DRSA 3JPQA 4G1QA 1T05A 1BISA 3ISDA 1WLJA 1ZQDA 4QZGA 4KTWA 4FLZA 1CEZA 3C95A 3QNOA 2DFFA 4R64A 3JPRA 3QEVA 4CJRA 1A77A 2FMPA 3L2WA 9ICSA 1HNIA 3NF6A 3RAXA 2PFQA 1UOCA 4C8MA 1S1WA 3AV9A 5K14A 4IQUA 1GOCA 3ZDCA 3NE6A 2DTUA 5KT3A 1ZQWA 2Z1HA 3RH6A 4MFCA 4KB1A 3TI0A 2A1SA 3HWTA 2AGPA 4I2DA 1XSNA 3OYKA 5J2FA 3L8BA 3LP1A 1WCNA 4DSEA 4E7IA 1S0NA 2IGIA 3BGRA 2PFPA 2R8GA 5FRMA 3DLBA 1T4GA 3UXOA 1ZETA 3CYMA 3RWUA 1BPDA 2XHBA 1VSHA 1MQ2A 3C21A 4HUFA 3HPHA 4RW8A 5CZ2A 4QZDA 2JZBB 3SV4A 4CE9A 4QWCA 2RDIA 2HHWA 2YKMA 3VA3A 4CGIA 4O55A 1HUOA 7ICKA 1ZBLA 4DSIA 2BQ3A 4CHQA 4DTRA 2ZTDA 5IIMA 4BXOB 4CJLA 9ICAA 2IHMA 2NRVA 2G8VA 5J2GA 4I2FA 4RPYA 2RN2A 1ZQMA 8ICQA 4ECSA 4NY8A 1XS9D 1A5VA 3VQQA 2MAXA 3PX0A 1Z25A 2D5RA 4FZZA 9ICVA 4KRFA 3JPPA 4EP5A 2GUIA 3T3FA 1RDDA 1NOZA 3CQ8A 2F96A 1WCLA 3KLIA 3RRGA 1EP4A 2DPJA 3MEGA 1S0MA 5KFHA 3K2PA 4M0AA 1V9PA 7ICSA 2JGUA 3OYEA 1YTUA 1HJRA 1HYZA 5IIOA 4CF2A 4W5TA 1TAUA 5HHIA 1C1BA 2XGQA 1BCOA 1W0HA 3ASMA 3S3OA 1NK6A 2KW4A 3LALA 1Z00B 4FJKA 3AVIA 3GIKA 8ICWA 4O3RA 1NK8A 3T5JA 5KT5A 3RJHA 2YHBA 3AVNA 5J2BA 3O4QA 4R8UA 5KFDA 3DYAA 4BE2A 5CHGA 1NKCA 5KI6A 3TFRA 3SQ2A 2NUBA 3SUNA 3KHLA 1I39A 3NFAA 4F4ZA 4I28A 1IKVA 4E7JA
chains in the Genus database with same CATH superfamily
5C42B 1B9DA 3GFZA 3MFHA 4X62K 4KREA 3MMVA 2LPEA 2FDRA 2CQ3A 1KCFA 2W41A 4PAAA 3HZGA 3FRYA 2QYCA 1VQKS 1TKTB 3DGVA 1Q82O 3TW0A 1B22A 4YOWA 4OLPA 4UUWA 1AA1B 4LUBA 3OS1A 4YHHF 4QQBA 1ZQHA 4OJRA 2D8CA 4JS5A 4RQ5A 4CK3A 1CS4A 1ATNA 1PC4A 3LH2S 3O5BA 2UXDF 1BQNA 1WNSA 1VMBA 3FFIA 2JEGA 1X0FA 4Z7YA 4DR3F 4DTSA 5BYRA 2I1QA 1WOOA 1C0MA 1FO4A 4B08A 1NSQA 4DX7A 5C25A 2WF7A 3MMBA 2HIYA 2W2PP 5EE1A 2MLXA 2QFIA 4DL0C 1FXDA 1PZNA 1RB0A 2YBVA 4Z6EA 2AGOA 4O3PA 2V2ZA 8ICPA 1T6DA 3KZIU 2KOBA 4HEA9 1B4SA 4FBTA 4NPOA 4YR2A 4CZMA 5DG7A 1E6YB 2R7UA 3BS5B 2WHEA 4EUVA 4LF8J 4Y2TA 1CJKA 2RUGA 1TFWA 4LRAA 4IOCQ 4C8LA 4B1ZA 4CGGA 1GLEG 1ATSA 4FS1A 1SKRA 5ALYA 4KH6A 2EPIA 1RCXB 4K8XA 2MGZA 2EW9A 2XS2A 3MEEB 2WMMA 2QT7A 2V51B 5AJ3F 3P31A 1Q46A 1UPPA 4IR9A 1RYUA 3NLCA 4U7UD 2R7OA 4I68A 3FZHA 4JI2K 3I0SB 2IVMA 2VL1A 5F3TA 2DNYA 1B92A 2V2QA 1OSDA 5AKIA 1BQMA 3ILIA 3DI6A 4F8RA 2ZGYA 4LBHA 1HWLA 1SIJA 1UVNA 1R8CA 3LP0B 4TNOA 1KKXA 1Q86O 1ZQKA 3MD1A 3KUGA 4JKGB 3SPYA 2WW8A 1KLMA 4FJ5A 1SJQA 3E9LA 2E2OA 4TUSA 4YB1P 2AGQA 1NSKL 3Q24A 4IQWA 2DK2A 4QIWC 1X4EA 2R2SA 2ZG6A 3S8SA 1B9FA 1HI8A 2HFOA 4HACB 4ZP9A 1S1WB 2W1BA 2DNLA 4LFBJ 4MIBA 1ZTWA 4BUGA 3CQYA 3G0ZA 3TANA 3CRXA 5TZVA 1HR0F 3VESA 3Q2SC 4LZDA 3H5YA 1XMQF 1HR0K 4JI6K 5I4MA 4C80A 2QMXA 4F3TA 2BDPA 2OUGA 3HP6A 4KMUA 2ISPA 2JVRA 5JRTA 2PFDA 4LF1A 2Q0RA 4F5NA 4E2FB 3EY1A 1OH8A 4BG9A 1XMOF 4J03A 4RZRA 2EZXA 3Q8RB 2I9GA 8ICVA 1VSJA 3DU6A 2ZDPA 4DV1K 4UAYA 2QWOA 1WKLA 5LT5A 2VONA 2QE5A 4LQ3A 2KHVA 2DR9A 5D4OA 3CPWM 1RT2A 5F0WA 3MN5A 3CHWA 3VWSA 1K1SA 4J37A 4UOFA 1VISA 1JMSA 3JSBA 4A59A 4IR1A 3GV5B 3ILJA 3KHRA 2VFUA 2V9WA 4OJOA 3ZTSA 1WEZA 1QZ5A 2OPSA 1FE0A 3NRWA 3LWLA 3KKAA 1SJ1A 4UQGA 5DDRC 4F93B 1UZHA 5AKHA 2PDAA 5ETQA 4LF4J 2O01C 2B4PA 2FHJD 2EVZA 3RMBA 3SJHA 4ID8A 1ECWA 1K0TA 2ROGA 2JWLA 4B3OB 4XPEA 4K4WA 4WTYA 3MEKA 1EWRA 1OPZA 3MDCA 2IRYA 3N6NA 2ALZA 2Y3YA 4OJ6A 4MKYA 3SLCA 3CJ8A 1C4CA 4JKBA 3EKUA 5D0RA 2DQNB 2MQMA 4KLHA 1D8LA 2HFNA 5J2MA 4TUQA 2BGWA 4FLYA 2DFHA 3PG9A 5DBBA 1REVB 3H6EA 3C6UB 4JN4A 2FJWA 2AZ3A 3HF5A 4NLYA 3T1HJ 2O8EB 3LDQA 3VERA 3BZKA 4DQQA 2QL5B 5F8LA 1QE1B 2VWKA 3GYNA 1N6QA 2ASJA 3Q8QB 3SI8A 1TFYA 2C2DA 4DSJA 2D0AA 2KM8B 3I56N 2HVEA 5DB7A 1FKOA 3SQ4A 5FPNA 5ALUA 2W6LA 3K5PA 2VOOA 3PO5A 3LDLA 1HNZF 3UKRA 4JI3K 2K8GA 1BUXA 5AI6A 3GIJA 3I0RA 4TU9A 3KLHA 4QWEA 3FZMA 4Y1CA 5D0GA 1C7YA 9ICXA 3NRZA 1HNIB 4URQU 1NB7A 3AQEA 3VEYA 2BANA 4IYQA 2VKQA 2LA4A 4NLBA 4FZMA 2WCXA 4RQ1A 3LM2A 4KQZA 3N7SC 3K5LA 1WF0A 2HKEA 2V63A 2KT3A 2VWJA 4DR5K 4DV6J 2ZTCA 1VQ5S 3PEHA 1KTVA 1WHVA 4D3HA 3ZD8A 1NCLA 5CZ1A 3NDKA 2Q66A 4AXJA 2VUGA 1Q9YA 4UZBA 4MFBA 4A47A 4ZCMA 1IG6A 5AM2A 4O3SA 4PG8A 2UVRA 1ZS6A 2R8JA 4O4GA 3MMAB 2Z2LA 3UDVA 1HNXJ 2MLYA 1TL7A 2W9BA 1N5SA 1C2PA 1KL9A 2FPHX 3BPDA 4FJXA 1RHQB 1QLNA 1BHLA 4KPYA 1NZPA 4M6WA 3JTPA 2WONA 1E6YA 3H40A 3MMCB 3VEVA 1PBUA 2JNJA 4Y2QA 3I82A 1NM1A 3ZTQA 3BDEA 3G82B 3VOVA 5DO2A 4ZPTR 2HFZA 3W2WB 3UMCA 4LRDA 4RKUC 4ZCLA 4U67Q 3THWA 1F5BA 3D6MB 4GKKF 2K8CB 4AE5A 5D46A 1FRLA 2YPYA 2KYXA 4UB6U 2VU5A 2AP1A 1FJGJ 5CR0A 3A8EA 1SUQA 5DB9A 3VAFA 2DRBA 4DV2F 1JNZB 2BCRA 2VIXA 2R8KA 5DGAA 1MDUB 2Y1JA 3LO3A 1RISA 3AVFA 1R8HA 2VFTA 3NS7B 4CYUB 4CCHA 5H1SQ 1XR7A 3VPZA 4Z4HA 4JI0J 4Q5VA 9ICHA 3M7DA 1TTHB 3O44A 1YI2S 4DR1J 3M2VB 5LJ5Y 1L7PA 3JYTA 5AK6A 2M88A 2NPFA 1U8SA 4U67L 2IHNA 3CC7S 2YVSA 1SB3C 4ELTA 4CRJA 2DCUB 4BDYA 2DY9A 4KLLA 3ZSYA 3N97B 2BMBA 2HSTA 2F76X 2XI9A 5DM7L 5A2QU 1EP4B 3GSDA 3R6GB 2FVRA 3L3UA 3PEJA 8ICEA 3HI0A 2VG5B 4ECWA 1HD1A 1X31C 2M7SA 2V9KA 4AQYF 3K58A 2LYAA 4IEEA 4I6WA 3GPAA 3D3BJ 1D9FA 2BKOA 4UY8O 3CO9A 4DTPA 4RQ0A 3RJKA 2DEJA 2R2UA 3G8SA 3AQOA 1KVCA 4LF6K 2JFKA 1ZPWX 5IIKA 1N60A 4O23A 3G9CA 1J97A 4HKQA 2ZHAA 4F4XA 4F5QA 1YITN 2K8AA 1RCHA 4ACOA 3C19A 2QLXA 3PVXA 2HPUA 2QLTA 3MEGB 1RTHB 4KV8B 3ZT2A 2BPCA 2MB0B 3UXNA 4CNZA 5LJWA 4HTLA 3G2XA 1RWWB 3Q83A 1TL3A 4DHVA 2O8BB 2PYJA 2F40A 1Z19A 2ZJQL 4F7VA 2GCFA 2OMOA 3CJKB 3NAEA 5K4LA 3BSAA 2ZIUA 2HHUA 2UXDK 2VIHA 3H5UA 1WN7A 1NPPA 2Z8QA 2CJXB 3AY0A 4RPZA 4CO4A 4NEZA 1ASVA 3AD9C 3W2VA 2GEMA 1F5SA 4ED0A 3AD8C 3ICXA 5ITHA 2YTUA 3K75D 1NJYA 3UR3C 4P2SA 3M4XA 4I9QA 3MOJB 2CXEA 1HBUA 3FZLA 1JRPA 2XZDB 1N48A 2UUBK 4ECZA 3V6KA 4JEPA 4KB7A 2YQ1A 3LWMA 3I76A 2CQIA 2X51A 4YY3F 4BRPA 4YN4A 2KVCA 1S1XB 5KT6A 4LF7F 3TABA 1X9XA 1F5CA 2DISA 2P9KB 4B8AB 3VAJA 4U6PA 3D1HA 4H4KA 2YMLA 2KU7A 3D7SB 4R65A 2M5YA 5AE2A 1O13A 3H0PA 5LJ3Y 4M5MA 2OHDA 4PPZA 4LFAF 5KFJA 3CC7N 2ZJAA 4IFYA 1U09A 2NV3A 3GU3A 1N6QB 7ICGA 5D4LA 5L1LA 5C25B 4TU7A 1GOAA 3FGUA 1J5EK 3AO4A 3BN7A 3VF6A 2Q3SA 1YHQS 1SH0A 1NKEA 3QGIA 1KAZA 1WC0A 3VF2A 3V7KA 5H9EJ 2JZ5A 2CJYB 3DLEB 3RSEB 1P7DA 1WC3A 5LY3A 3C6TA 3LGNA 4K4HA 3MPUB 4ZLJA 1TKDA 2OJ3A 3EICA 3CJ4A 4M94A 3WX4A 4E1JA 1AZSA 2X3DA 3ZCMA 1DXSA 2P5OA 1RADB 1NDLA 1IBKF 4KLIA 4BE0A 4LIWA 1XC9A 4H0PA 1UT5A 4F3MA 1N8RO 3SD7A 1WSVA 3NNCA 3BSOA 4UB3A 2LYBA 4USAA 5J0WA 3NEKA 4FVUA 3LAKA 5IWAF 2EZZA 1S9GB 2V4RA 3CJBA 2ATQA 1S59A 3UW1A 3A1YG 2MJUA 5HRNA 5AQOA 4ILLA 2ZIWB 5FLXU 4V19J 3TR8A 5C2DA 2CQ0A 1LW2B 2X1BA 3Q2TC 1C6VA 1GK8A 3KK2A 5LSRA 5ETMA 3VGKA 1IUJA 2HHVA 4AL6A 4QWDA 1U02A 1VHFA 2M9KA 1X9JA 1R8PA 4RWXA 3LW5C 3NF7A 3CCTA 2A3VA 1RWVB 1L8OA 3VAGA 2F8TA 1Y64A 5L9XA 3M1YA 5LM7E 2W2MP 1DQAA 1UEUA 4PQUB 1P9QC 4BDZA 4B9QA 4X65J 1WEXA 5DBAA 4B3MJ 1NGHA 4LMZA 1UETA 1LAWA 3ATVA 2R3VA 3FNNA 2NRHA 1XNQJ 4CJPA 1Z3EB 3Q8UA 2D3O1 1ZQSA 2E8OA 1O1WA 2O8EA 3IUCA 1NJWA 2J9EA 1QE1A 4UARA 1NJIO 2H5IB 2XNQA 3FCWA 1SKUB 5ETNA 2KQ2A 1R31A 3D2NA 4W98A 4YXMA 3EE3A 3OS2A 4YQWA 2CWXA 4CFAA 3QT5A 1NUEA 3NVKA 1UWAA 4OX8A 2ZZNA 2KHCA 5H1SV 2DR6A 5DDQC 1OW5A 1J54A 5J1PA 4LSNA 4FLUA 5KG0A 4YFUA 1FX4A 3KDNA 4GKJJ 4BRGA 2C2RA 5HLFA 4CNYA 4JI4J 2AYEA 3SQGA 3PNCA 2H5XA 3FBCA 3AJDA 3QEIA 1YJ7A 1LWXA 2DRAA 2JWNA 4OX9K 4I0WA 5LXYA 3TJ8A 4QIEA 5IXUA 5HQMA 3PV8A 4CD3A 3DKDA 4WKYA 1S79A 4C8YA 3CCMS 4YUDA 1YWXA 3HVWA 3O9SA 4E98A 4FJLA 1GMWA 3C28A 3AXKA 4FW1A 3TR5A 1ZM4A 2V8HA 1KHVA 3FDSA 4F5OA 4N77A 1HUXA 1X4FA 2GOLA 4O5CA 3RJIA 4UB2A 3DGPA 4ES2A 5AFUA 4URGA 3MDFA 4ICLB 3R8YA 2V8VA 3AUOA 1ZM2A 4KITB 4LBIA 4CLTA 2EFVA 3RR7A 2VQFK 2MZ1A 4TQSA 3PACA 2XSFA 2X6SA 1F3VA 2D9PA 4RCHA 2AWZA 4JV5F 5HHHA 2AJ0A 3CCRN 3T19A 5I3UA 4Y2MA 1GH8A 4IL6U 4ECVA 5KG5A 2QC3A 4M45A 3QRPA 4Q8FA 1WEYA 1MG7A 3IAYA 4Y3CA 1WC1A 3LL3A 4XIUA 2L08A 2G8FA 4HACA 4BRIA 5J2MB 1LWFB 1X9WA 3LZIA 1KOHA 2OP5A 4JHDB 4NLGA 4O5BA 4W5NA 3ULEA 3I8BA 3AO5A 3H0MB 3GE9A 2YB4A 2BGGA 2YKNB 2AV5A 5ALJA 2EFQA 4DV4J 2H3IA 4KLMA 3WNEA 3KJVB 4M3RA 4FVMA 4BRCA 1J5OA 4RW4B 5EOZA 3MPDA 1OPIA 4PR6A 4CEOA 3CFRA 2DFEA 4PGYA 3FYHA 2FE9A 4OJ3A 4MK7A 2VA2A 2QKKA 1UZDA 1NDKA 2BJ8A 3HILA 3C1ZA 4MKVA 3VGVA 2E8NA 3KUEA 2EDUA 4BRFA 2V69A 2MZSA 4CNQA 3SUOA 4OL8A 2B9WA 4UBBA 1M0SA 2R2TA 2CRLA 2M4MA 4ED8A 1X4HA 1U2VB 2HSEB 1IBMF 2WB1F 4IFYB 2W04A 4YB6A 2AA4A 1FK9A 4M5NA 3U9ZA 1IG9A 3VEWA 4J9PA 1RACB 2A3ZA 4DFMA 5J0OA 1YHQN 3QEXA 4F0KA 2E66A 4QIGA 3LDNA 3ZDEA 5EHHA 5CJ7A 5KFVA 1K8AO 3WZ0A 1WG5A 2KICA 4FN5A 2ZH2A 2P66A 1MN8A 3B9JA 1S4EA 4L73A 1NGFA 1FKPB 3VGLA 2PY5A 4U95A 3L09A 8RUCA 5F8IA 3KK3A 3TADC 2QB0A 1N34K 2QMUB 1CZBA 4B3MF 1HQ2A 1Q0NA 2OTLN 3H45C 3GCWP 2ATCB 5DM6Q 5AK4A 3V1OA 1G6BA 4QAGA 2V50A 3OLBA 4JKFA 4DMNA 1SUQB 2JSXA 1I1GA 2LU1A 3OTCA 3T5LA 1IM4A 2ALYB 4JI2J 4LF6F 4F5PA 2UUCF 4F5RA 4HLBA 4OKJA 1K0VA 4JWMA 2UUCK 5GTIU 4DR3J 5JVGL 4DCHA 4FCYA 2YKMB 2X7IA 2ZH3A 5BR8F 1VJWA 3CMAS 2V4QA 3VR1A 5M1KA 1X8DA 4OZJA 3PW7A 3BBFA 2E29A 3E01A 3SBMA 3D2SA 1UPMB 4KPCA 4B8CA 2YX1A 1FVSA 2VH7A 2OFGX 4C48A 2K8BB 3MWPA 2HHHF 1CUKA 4RUAA 3G6YA 3OSNA 5IS2A 4CFBA 2VICA 4KAIA 2JX2A 3LVWA 4YVZA 3SR6A 5HMLA 4LFBK 1VI7A 4IO9Q 4A46A 3SPZA 1HLWA 4I2AA 4ED5A 3DHXA 3B6OA 2HRTA 1VHIA 2M0GB 2H65B 4Y2JA 4F4WA 4Y2PA 1G2EA 4AUKA 5AZIB 2Q1NA 2VG6A 3O3GA 3I55N 4J9NA 3P49B 1Z4UA 3CM5A 3TX0A 4E7HA 2P9NB 3LDAA 2IJNA 2F9JA 4EO6A 5JUMA 1KKHA 5E84A 1U1QA 1TL7B 3R2CJ 1HMVB 3UIQA 1RJJA 1ZQAA 1U1OA 3HX9A 4C3MA 5GTHU 2J5AA 4QIVA 2XHWA 3MTKA 3DYAB 3RJEA 2MLZA 4GLXA 4YMNA 2O8BA 4G3IA 1KQQA 3LDOA 1BWVA 3THWB 3U1MA 3GDQA 2YH1A 1JNRB 1H1VA 4ZMMA 1Q81O 3RB0A 1EQ0A 3GWCA 1CXQA 4OLOA 2EI5A 1LW0B 2YY6A 1RT6A 3ZX0A 3ZSVA 5FJ4A 3ZT4A 5AQGA 1HBMB 1WNEA 3K7RA 2HEKA 2PBDA 4B3TJ 2HGMA 4P7TA 3VQ5A 3DLLL 5BR8J 1RXOB 4A2BA 1PC5A 4K8RA 1WJ9A 5KAFU 1LW2A 2G1HA 4DR7K 5IINA 2QIFA 1ILYA 2JC1A 1ZOTA 1HNVA 1WSRA 1YJ9N 1ZXOA 3C94A 4OZ0A 1YX2A 2POKA 3O2IA 3BP8A 5J0SA 2P35A 2LQ9A 8ICKA 1TQLA 1Z4OA 3H20A 3IWLA 3RVCA 2MQOA 4Y6IA 4HUEA 2KJ5A 2JR5A 1EX4A 2UXCJ 4F72A 1LKYA 4DPXA 5KG1A 2CPYA 1ZQOA 3GJSB 2WUSA 2COLA 4DTNA 2QRRA 4LR9A 2RKIB 4CRXA 4I6AA 4LFCK 1P9YA 3ZETA 4I7FB 1OYEA 1C1CA 2F8KA 2CNLB 8ICMA 5AQTA 2W03A 2EAMA 4RUCA 4OKKA 5CD4A 3HHLD 2WBMA 1IG8A 2CAJA 1R8BA 2E3TA 3AXMA 4WZMA 2GV9A 5LJVA 3BH6B 1FRIA 4ZJLA 4AXIA 4ZLPA 1RWXB 1KFTA 1J5OB 1B0PA 1M90T 3UPQA 5D3GA 4F2SA 2E2NA 2VDIA 4FJ8A 1GLCG 2MQPA 4A5AA 5KFBA 2ERRA 5KPRA 3VQ9A 3TQ1A 2GVZA 4H8KA 1CJVA 4Q2LA 5B5EU 4B9SA 8ICHA 3H2LA 1VLYA 3ZSQA 1X2IA 3ETMA 4ILRA 2QLFB 5GAHU 2UU9F 3JB9k 4DU7A 5CEHA 3T79A 1L3SA 4C0OC 2FJDB 4UB4A 1DURA 1S1VB 1CZ9A 1NAQA 2HBLA 1HRHA 1X5TA 4DV5F 3GL1A 3GIIA 4KHSA 1JLAB 1FDBA 3WXKA 3H4DA 3KHHA 1JUDA 4BRNA 2D9OA 1H2VZ 1XNRK 1RT4A 4ZPAA 2DVIA 3SUQA 1SH3A 5KFMA 1TUWA 1NLKL 4X4SA 3EM1A 1CPZA 5G5HA 2J6UA 2J8AA 2XB2D 3AA5X 3I4HX 1UWBB 3C0BA 2MKKA 2VB6A 4KI6A 3CD6N 4IZ9A 2BEFA 4QS7A 5BPMA 3U7JA 2IHR1 1WF2A 2P9KA 4NYZA 2FBYA 5AQPA 4MKAA 4ZN3A 2XCPA 4FWSA 4Q45A 3G4SN 2OEKA 1HARA 3B4DA 4JK7A 5ALHA 4Z4GA 2RP5A 2HMIA 4DTJA 3G6XA 3UN3A 3ZZOA 5KTQA 5JMNA 2FB0A 1S57A 4CO2A 1QJHA 2FMSA 4BREA 3N4PA 2K89A 4B9LA 4JI0K 4JP8A 4CZJA 1AUSL 4PZOA 4ZP6A 4QYZK 1WB9A 4ATNA 3WKBA 1HMVA 3AOCA 4NEYA 3OYIA 2W2QP 3RSEA 3N9UC 4Y2XA 3D6RA 3U3YA 3KJFB 4RW9A 2OH2A 1UJ5A 1FXRA 1PKUA 1RUSA 5DETA 3BQ1A 2VQFF 5B0BA 2W4CA 4K4IA 1B64A 2A42A 3MI7X 1RI7A 3K59A 9ICMA 4ZLNA 2ZE2A 3EGVA 3EW9A 3Q23A 5IIIA 3DRPB 4K4UA 2O66A 1WAJA 4CJ3A 1U6ZA 1IBCB 5CCLA 1YUWA 4A8XA 5AKGA 1X42A 4CO0A 4DZDA 1B0XA 4DUZK 3R3LA 4P0QA 1H6KX 1S9GA 2Y0SC 4CEFA 4FK0A 4UOCA 1T6CA 4J9SA 2RMLA 3LPEA 2NXCA 3CP8A 3NNHA 3PRDA 3L2QA 4Q44A 3O3LA 4K8ZA 3HT0A 3I28A 4JI8J 2D0OA 3FBBA 4O4RA 4Y2CA 4PHPA 4NB4A 3NVZA 4QWAA 3CDUA 5FLXY 4KBIA 1ZD5A 4LRCA 2P1JA 4AHSA 4X65F 1V6HA 4WYLA 2KL8A 4K59A 5DDOC 2NUUG 3RUBL 2AX1A 1AQ6A 1MWYA 4LF5F 4RQ6A 4E1NA 1NLVA 3QFPA 3EX7B 2DH8A 2DGXA 4GXJA 3SK3A 2E9RX 4X4QA 5E5NA 2IA0A 1PBAA 2C2ZB 4BHQA 3TTFA 1DGKN 2ZTEA 4UB8U 4KHRA 2HBMA 2FQQB 3R1XA 4KKOB 3WK6A 1VRQC 2G5IB 3QUTA 4O3QA 4IFVB 4IO8A 1DT9A 1FF2A 2CXYA 4DQ8A 4NXMF 1DKGD 3JAMY 2GHWA 4B1YB 5HVGA 1O6XA 1JLGA 2LQ5A 2KV2A 3WBZA 1V97A 1FNMA 2JEFA 2AMCB 1JLQB 5DZ6A 2HWIA 1E4FT 1NPRA 4F71A 1WDTA 2ODGA 2BPFA 2XC9A 3EZ5A 3IBFB 2RKIA 1DLOA 2ZJ5A 2B43A 4M63A 1QSYA 1T3OA 1NGIA 1QAXA 1V4TA 4PABA 1SJRA 2ZZTA 5ETVA 3ITHA 5A6PA 3RBDA 4MK8A 2DF4B 1KEJA 1ASWA 2OPSB 2A40A 4JMUA 5AQUA 4DV6K 1YBUA 2D3OR 2IY5B 1IV8A 1SXEA 3TKAA 2L9WA 4XO0A 1NNDA 5HMWA 2HHQA 3IR6B 2XLIA 4J2DA 4Y0FA 1DRZA 4PZVA 3ZDBA 3IG5A 3PNIA 2PFFB 3ISBA 4IEIA 3OTOJ 2LQJA 4FP9A 3CCJS 1KP6A 2OLWA 3DNCA 2HNDA 3RW6A 4JK1A 3HHLB 5TISU 8ICJA 1TFRA 1U1LA 5HMMA 3H59A 1HW9A 2KYZA 2ZBCA 4DPOA 4ZVEA 4BACA 3D66A 1QSLA 4I2PA 3NGUA 4F0MA 2RQKA 5A8RB 3OYAA 3VF4A 3L3VA 4LD0A 4URSA 5KFQA 1SV5A 4TKTA 3QBXA 1KVKA 4UOGA 4BG8A 3DMJA 2ZH9A 5M2UA 5J2IA 5C12A 2VJ4A 4WK1A 2OPQA 2LMIA 3BO2A 5CE3A 1VS3A 1EETB 4CF8A 1VQ9S 4N7TA 4IXCA 3D28A 1T05A 1PYSB 2GA7A 2NZCA 4OYOA 2Y0BB 3JAMU 1JJ2M 3H46O 2R7TA 2AHOB 1HNVB 1EJ7L 5TKWA 3MDQA 1RAOA 3M1VB 5AKEA 2EG1A 2RD5C 4FOEA 3CT9A 2LM4A 2A2DA 4CE6A 1X60A 5KL1B 4ED4A 2EXUA 3BZCA 1HNIA 2ZKUA 4X62F 3OW2R 3AH6A 2P9PB 3AV9A 5K14A 1NGDA 4OYBA 2AXTU 4NWBA 4M95A 5KT3A 3WUHA 3RH6A 4MFCA 5A0LA 3CCRS 3HWTA 1ZPVA 5DDPC 2AT1B 4OYAA 3OYKA 2EFGA 3J80Y 4A8OA 1VQ6S 3FE1A 4E7IA 2DNRA 2R8GA 1GAOA 2E5SA 4WQ5A 3IR5B 2CFXA 3CYMA 5ALSA 3A8JA 3N79A 2XO6A 4ANCA 1DFDA 3C21A 2FZCB 1N5VA 3HPHA 4RW8A 1AT1B 2JJ4D 2JZBB 4L76A 1MWQA 4HAIA 2ZVSA 2DHXA 2UUBF 3KFUF 4ZA1A 4JD2B 5BR9A 3QUQA 2OSQA 3V2UC 4L72B 2BV3A 3R7SB 3VA3A 4CGIA 5B0FA 1HUOA 1ZBLA 4C11A 2BQ3A 3MM9B 4CJLA 2G8VA 1Q78A 1XR6A 3C6AA 2ZC3A 1TL1B 5HMYA 3H2UB 3I9V9 1RDRA 2C2MB 4RWWA 2DNOA 4AL7A 3W1YC 4LF7K 3PX0A 1ED1A 4CLPA 4QYRA 1BLUA 4EP5A 3F56A 3T3FA 1RDDA 5CRXA 1NOZA 1IJJA 2ESEA 2CQ1A 5B0DA 1PYTA 1M5PC 1CQNA 4JK8A 4A5BA 3KUHA 4KT0C 1VDVA 2DPJA 2ZJRQ 1S0MA 1FRHA 1CQMA 4MDAA 4M0AA 7ICSA 2JGUA 3OTDA 2BBEA 3OYEA 3HJEA 2FJXA 3ENVA 4WF9L 3C65A 3R1LA 3NMAA 2D4WA 1RHJB 4ZK7M 1TAUA 1F60B 1C1BA 1WC4A 5FPMA 1KD1O 2HBQB 2O1PA 3T41A 1O03A 3QQCD 4LR7A 2IOFK 1Z00B 1FIQA 3HZ6A 2MHNA 4NI2A 2ZBRA 4FJKA 2OTJN 2M52A 3OBIA 3GIKA 4O3RA 5AQMA 2CDRB 2A0FB 1SV4A 5KT5A 1JCEA 3AVNA 5J2BA 4PPDA 4NYPA 2IVFB 1TP7A 2YCHA 3IMXA 3ILOA 3TFRA 4LSZB 2V8DA 4F4ZA 3PZPA 4I28A 2OD4A 4US8A 1O5JA 2W6KA 3KNGA 4E7JA 4JOUA 1CBKA 1G7CB 4JI5K 3N6LA 4M63C 3CDEA 3S6EA 4JUZA 3MFIA 2E6MA 4F02A 3ET6B 2MKIA 1ROFA 4K4VA 2PI4A 3OR2B 3SENA 5DG9A 5AM0A 1FKOB 3VCDA 4QS9A 3KFWX 1CLQA 1HHTP 1RTZA 3TARA 1VBYA 1CVJA 3OHAA 1HA1A 3DOMB 2P9SB 3CE8A 2E4LA 4NJ8A 1MN7A 1HQUB 1RT1A 4NA1A 4I69A 3CJCA 3NCPA 1UFKA 1N4LA 2JH1A 3PMNA 2XICA 3ULDA 5LSOA 1IVZA 1IKVB 4CBWA 2P9IA 3ELHA 1U1PA 2KMDA 4CDGA 3VEXA 2WB1C 1DY3A 4AHRA 3N4QA 4C4WA 4FBUA 1J27A 4EFAC 2Z7JA 3RH4A 2N3LA 5CABA 4EEKA 1URNA 4FNIA 2W25A 3F2DA 3AJ1A 2RS8A 2ASLA 4C23A 2FGOA 3L4BC 7ICRA 2IVNA 3NBPB 4M7XA 2RQ5A 3BR8A 2NR0A 3Q86A 3GCXP 2W9BB 1U9LA 4P52A 2ZM6K 1H3DA 1RWKB 3WEEB 3MC1A 5KFTA 3RMCA 1RGVA 5KL8B 3NCIA 1NXIA 3RBXA 1BPYA 2YQ3A 2GZOA 3PMLA 4K43A 4CH0S 2F4VJ 3P5BP 1IR0A 1K8KA 2HVHA 1RAFB 4QZEA 4AHUA 3DCAA 4WU3A 3A5OC 1SV5B 2CPRA 2H48B 2FSNA 1F3FA 3HVRA 5CA7A 1ZYQA 3RJGA 1SZHA 1ZQVA 4IOBA 1Q4RA 1SVDA 3NL0A 2ABYA 3QZ7A 1HWUA 1REVA 4EHUA 1DTQA 4CHOA 2EFPA 5LOQA 3H8YA 3ISCA 2ZIXA 4ZJOA 3O0FA 2YQ0A 4QJFB 3Q8KA 5IT4A 2KI2A 3F2BA 2F63A 4CHYA 4FJJA 2HBZB 1B99A 4JKCA 4PKDB 3ZC4A 2HMXA 4CI6A 2EG2A 2EWHA 1P6TA 3IBWA 1X6JA 3UKRB 1AB8A 3L7UA 1RSCA 2DNZA 3M9OB 1NMDA 5DQGA 5LMUF 3C3LA 4C8OA 1MSWD 3EDQB 3GG0A 3HCXA 2D1CA 3QSYB 5J2NA 5KPZA 4IKAA 1CJVB 4B3RJ 3OXFA 2Q2RA 3V9XA 4J9KA 5A76A 3MR7A 1WSIA 2WVEA 4BRHA 2P9CA 3C6HA 3VGTA 3VC8A 3T7ZA 3CC2S 2V4JB 3AQFA 1S1VA 3K8WA 2EFNA 1X3MA 2ZJPL 2W9MA 3VAKA 1C1AA 4CO1A 3OS0A 7ICHA 5HVHA 3Q8PB 1BD6A 1NU0A 2FD2A 4G1PA 2JZBA 3EL2A 3KK2B 2NQPA 3ZO7A 1P1TA 3AY9A 5MLCQ 4FOIA 3FCHA 1Q3UA 3UDLA 3NTUA 1UEVA 3T1AA 2DHGA 4FF4A 1VQ6N 2XHCA 4B3RF 1QUVA 2FMQA 1JXLA 5A6WA 4A8WA 1I3AA 4P71A 3OGUA 2ZITA 5HO4A 4J9OA 4ZLLA 4MYTA 3V9UA 2N7CA 2D1KA 5BPCA 2E7XA 2BKEA 1CJUB 3WC2A 3O9QA 1XR5A 5EE3A 3NHGA 4GC6A 4L75A 4KLDA 2E2PA 3ZSRA 4PQAA 4MAKA 1ZXIA 3DLRA 1B0TA 4OZ5A 3V7LA 1BA0A 4J9LA 2D3DA 3QICA 2Z1GA 1WBBA 4DR4K 1HR0J 1TMJA 2W8KA 2G5HB 5AKYA 5KFXA 1GX6A 3NOCA 1U0SA 1NK0A 1OH6A 2ZHOA 1JLFB 2R42A 4ZVGA 4JYAJ 2GGPA 3IDWA 1BVSA 4KLGA 4IFVA 4IG0A 4EZ9A 5JLFA 3JSMA 5EE0A 1GT8A 3G4SS 4HH0A 4F26A 3AD7C 3CJ5A 5AQVA 1R0BG 3SQ0A 5CP2A 1RT1B 1KD1T 3OL8A 5L1IA 4YD1A 3MWBA 1SC4B 4KIAA 1HD0A 3PYDA 4NRUA 2EAOA 3I0RB 3KLHB 5J2CA 4LSLA 3L3FX 2P9IB 3FKBA 1RBUA 1BPXA 1XU4A 1JROA 2DH9A 5ETRA 3KZBA 4DUYF 2QWMA 1RTIA 4RQNA 5K20B 2GUPA 1FRJA 3O4NA 2DHHA 4DUYK 2QEXS 4GKJF 3C15B 2LQBA 5ADXH 3DLKB 3IGNA 1X1PA 1HBOA 5KFSA 2G06A 2JOQA 4OJPA 1RCOB 2WSEC 3SMSA 2KJ9A 4GNIA 2AJQA 1TV6A 4KHYA 4QW8A 5J2EA 5JVHQ 4FNHA 1XHZA 4CH7A 3D2EA 3CCUN 2HGNA 1PG5B 2DH7A 2E5LK 4WQ4C 2CKWA 3NRBA 5C7PA 3LM9A 2V2VA 2LFVA 4NL5A 4OZ2A 4KMOB 7ICUA 4ICLA 1ZZNA 1SJFA 1YXQA 7FD1A 1T9XA 5JU5A 1LKZA 1JQGA 2IYGA 2OZSA 3OPKA 3D7EO 2I5HA 2MUTA 1QDUB 4FM1A 3FRZA 1NSAA 2QA4S 1TKZA 1AZSB 2BJ9A 2RPIA 1GLDG 3BQ0A 5CD4H 3QT8A 4O44B 5DZ7A 2XQCA 5DB8A 2QWLA 3CJKA 1JL1A 2GMLA 1OMSA 1MWZA 1IBLF 2OWOA 3EZUA 4PXDA 3B0YA 4OHXA 1GXLA 3J7AP 1BCMA 4I64A 3TJAA 1B7FA 3PUFA 1F21A 3CI5A 1XC3A 2OPQB 3NS5A 4DV4F 2ZUBA 4KFBA 4I9LA 1HWKA 2V0NA 4FYXB 4DR3K 3BR9A 2F1JA 2V68A 2FY8A 3C66A 4B1WB 1BL3A 2KXHA 2CZVC 4RL1A 3HSZA 3ILLA 4DX5A 2HBJA 4H0YB 1KFSA 1DTTB 1KLNA 4KO0A 2Y1IA 4DB3A 4ZTJA 4CGDA 4B9NA 3OTOF 4WQ4A 3CXCR 2H3FA 1DHMA 4IBNA 2P6SA 4FFDA 4IDHA 5IM0B 1I94F 5GVQA 1KEKA 4YY3K 5J2NB 5HVFA 4YS2A 4Z6FA 1SZPA 2N82B 2CG8A 3MURP 1RBTA 1XSLA 2O4IA 1B7YB 3VAHA 2ZH6A 4PQUA 1WTFA 3OL9A 5A0YA 2J0SD 2NRZA 3TZZA 4YDUC 3DRRB 3WIUA 3KD3A 3ULHA 1N32J 3D1OA 3L95X 1Q16B 2IMOA 1IR1A 4K0KF 4E3SA 4NX9A 3DN9A 3IC1A 3MHYA 4E7KA 3E2EA 5FDLA 3BF1A 1CZAN 3NOGA 3ET6A 3M6ZA 2B0GA 2ASDA 2E5HA 3AVGA 2E2QA 2G09A 2YKQA 4JRQA 3AEVA 5D0HA 3MM8A 3C6TB 2ASPA 2B5JB 1RTJA 2JEJA 4KV8A 2OELA 4XEIA 2MQ8A 3ZDAA 3PYFA 5MLCV 2BR0A 5F1XA 3ED5A 3KYLA 4KYZA 5KG4A 3SQGB 1COKA 1TL3B 1HIWA 2DR7A 4HHJA 4NLCA 2BCUA 4U7UK 1UL3A 3AA9A 4DU4A 2K1RB 3CJAA 3MEDA 5KT2A 5DB6A 1XMBA 3IFEA 2V4JA 3JQMA 5J2QB 2QSWA 2R9LA 1RGIA 5AK5A 1MMLA 3GMGA 1MN9A 3M32B 3NBPA 1PO6A 3C2MA 3WK5A 4M9HA 4DR1K 5K8NA 2YKAA 3VALA 4DR7J 1NK7A 2ZUGA 1XMQK 4JI8K 1X5PA 3QNMA 4JI8F 1S5ZA 4BC9A 2W3SA 1RAHB 3HK2A 3CCJN 2LMRA 8ICTA 3GZFA 2YH0A 2H4WB 1T9TA 4W4MA 3CCZA 4LSLB 4RW6B 2MSSA 2WBRA 4M3ZA 1T03B 3IP0A 1Q7LB 3CEDA 1UVIA 4OZLA 3KNAA 4X66J 4XRHA 4F3OA 1IWAA 4WCEQ 1B70B 4DSLA 7ICVA 4OPAA 1RDUA 1HKBA 3PFEA 1NH7A 4GVMA 5B09A 2K2PA 1KVBA 1W26A 4IRCA 4B9TA 2DRDA 2UU9K 1CI4A 2YKPA 3MPVA 2R8HA 3SEOA 3QJLA 5J2HA 4WF9Q 3FCVA 4ED1A 5ALOA 2BUNA 2H54B 2Y0SF 3UDEA 5DBCA 3MGHA 2BW7A 3CCUS 2WOMB 4A8EA 2AIRB 3LP1B 2V67A 5LL6d 3KWMA 4DOBA 4JI7F 3AU6A 3JPTA 2BH1A 2DKXA 5D49A 2XG8A 3JSMB 1Z1VA 4UAVA 3EKSA 3KLIB 3R9LA 5FPDA 3IBCB 3W64A 3QYPA 1K9MT 3EUB2 4OYZA 4KBOA 1ZQRA 2G0CA 1IV0A 4DUTA 9ICIA 5GMKa 3HOTA 2UXBK 3KMSA 2DKOB 3VTIA 2B4VA 3LUYA 2FJ6A 4U7CA 3MF5A 4ZHRA 2UXDJ 2KSOA 4KLQA 2XCAA 5KFOA 3ZEUA 1I51B 1BWFO 2FSJA 3QMLA 4ISFA 5C2CA 5EWEA 4ZCKA 2W8LA 2Q6CA 4LT6A 2QTDA 5DQIA 4Y2UA 1UAWA 4TXSA 2BE9B 4K0KJ 1HHSA 1YJTA 2IMWP 1X4GA 3BQ7A 4ILHA 1DTTA 1DAXA 2F8EX 5HQLA 1PCAA 4A8SA 5U47A 4JKEA 5AQJA 5LMUK 5ALNA 2LEPA 1T02A 1ZQGA 2NSBA 1RBAA 2EAPA 3KLFA 1JLBB 4OV1A 4KHPK 3FQKA 1A5XA 1ZBTA 4DV3K 4V19X 3TA2A 3KKSA 3J7YI 3T9ZA 4M9JA 1S9FA 2H3VA 4DL6A 3W65A 4CF5A 4MTPA 1SL0A 1UEKA 4NCGA 4GFJA 4CHPA 1T94A 1R89A 3ZDDA 4CI0B 1NGEA 5ADXA 2ZXIA 2VPWB 9ICPA 4KFBB 2CQ4A 3HKZF 2ZC4A 2IM2A 2OSRA 2YKNA 3M8QA 5FD1A 1HNXF 2FBVA 3JPOA 5JXSA 2GGPB 3C2PA 4ES1A 2RF2B 2NYVA 4DL7A 1B43A 3IRXA 4F50A 9ICNA 3LVVA 3GYXB 2YNHB 1MU2A 2Y9HA 4KN7A 3MXJA 3UN2A 4HL9A 2YI1A 3I8DA 2JH3A 1N0VC 1Q3VA 1ZQPA 4USMA 5IV3A 2K1RA 3JS6A 2GWSA 1RBOB 2P9LA 4RG8A 1JMTA 3M30A 1RTDA 1U2CA 4WZQA 4P2FA 4WYBA 4CEQA 2MSNA 2FHMA 4WP8A 4OHYA 2EEYA 4DSFA 3RB3A 1KN5A 2K7KA 1UVLA 4RNFA 1FWPA 2KIWA 1JJHA 4DR5F 2FI1A 4J9VA 1FD8A 2DT9A 1NGCA 1WI6A 3I5BA 1VSKA 3KLEA 2E5GA 4MO5A 1W7WA 4DL4A 4JYAF 2HHPA 4L74A 2G13A 5HR6A 2BHNA 5M1FA 2MUTB 1ZBUA 3MXMA 4F4AA 2OYQA 4DU3A 2YX6A 5HN0A 3QINA 2QB0B 1WF1A 4NA3A 4X4TA 1XHXA 1T11A 1U1MA 4CJSA 4RWTA 1ZBHA 1E6VB 3HM9A 4P73A 3RYLA 3TNVA 2GIFA 1RKJA 5HBMA 2PGCA 1XWLA 1NJIT 4EGLA 1VIOA 4B3MK 4UW2A 1VSIA 2LEBA 1XNQK 1W2BM 2C3YA 2CJBA 1L7NA 3THYA 3M05A 3MAHA 2P2CB 5DLGA 2CJ9A 3GFHA 4AF1A 3NGRA 5KAKA 2ZIXB 2HQDA 1KVAA 4GV3A 1COOA 2YJEA 1FNOA 3K2YA 2C22A 2VC0A 4U8VA 4DOAA 2AJ1A 2PMZD 2XZTB 4B02A 3R5CA 1S5JA 1ZQEA 3QYYA 4CT8A 4DS4A 3TUPA 2VD3A 4JI1J 3W3SA 4O0NA 2FC8A 4YOEA 4KLTA 3N4MB 4HUGA 2HDOA 3AVMA 1RT3B 3TQEA 4X4VA 4B1UB 3DM2A 2YWKA 4MH8A 2Q36A 9ICEA 4OZNA 5M1OA 2HIQA 4UBCA 4AH9A 1DQ8A 3KG1A 2Y8WA 1NB2A 4OX9J 1KONA 4K4ZA 2FJBB 2GQQA 4NLSA 4W5OA 2VCPA 2DXFA 3TUZC 2BM0A 2VFVA 1X0PA 2DNGA 3N4WA 2BJ7A 4FKYA 1U1NA 4DU1A 3OYCA 2ZJ8A 1WBDA 3ENHA 3FAHA 8ICLA 3R6LB 2ZOMA 4O5KA 3OTOK 3H2VE 3CF5Q 4HTIA 3CCEN 4HYKA 1QD1A 1WC5A 4IJAA 4CJKA 3DAWA 1LEOA 4LJMA 5HAOA 3TZWA 5ETTA 1TV9A 2YB1A 3UE5A 3LGMA 4ZHRB 5DKWA 3BZQA 4Y34A 4OHZA 2YWHA 1VR6A 2H3ZA 4QZFA 2CDQA 2LXFA 2ZVIA 4M3TA 5HSPA 3VQTA 3TWZA 5F8JA 4RNOA 3SFUA 4EX7A 5CY4A 1HIYA 4R8UB 4X4OA 2FGCA 3H08A 4BC5A 1S76D 4JLHA 4DV4K 4BVOA 3NWRA 1JCFA 4LY7A 1TKXA 2FXUA 2GVDA 2VBXA 1FEHA 2M8HA 4NMLA 5HP4A 3I9ZA 3C14A 3UKUB 4BQLA 1SL2A 7ICTA 5THWA 3H42A 1KNZA 1HKCA 3AVHA 5H9FJ 3QU4A 1NK9A 4FZYA 4PHDA 4KLUA 3AOAA 5EU7A 2F4VK 4ZJQA 2LEAA 2LLZA 2C1EB 1MWKA 4FWPA 2B51A 3EUNA 3DDNA 3ISZA 3V72A 1QAYA 1L7MA 2NZ4A 3QRQA 1QUPA 4JS4A 3BQTA 4OQJA 2NS1B 3OYGA 3LANA 3J7A1 3MN6A 1ZAWA 4PA1A 1HLUA 2FVSA 1VQ5N 4IKFA 4OI4A 1OUQA 1VQ8S 3NAHA 1BUPA 2YY3A 3NGDA 2XYHB 4LVNP 2MZRA 1ZJMA 3FSXA 4EO8A 1I5OB 2HHXA 3BYRA 2V52B 1V5VA 5CB1A 1NDPA 4FWKA 4QPTA 1A6LA 1RDBA 5AKKA 4EYHB 5F8GA 5SUHA 2AJ4A 3W0LA 1NH8A 2UVWA 2GO7A 3Q8MA 2F77X 2VGMA 2FDNA 4ZDNA 2I0XA 5J0UA 3SJJA 5I9EB 3AFGA 2F1IA 1X9MA 3D2FA 4RLEA 2BOAA 1YLXA 3E3XA 3KK1B 4USHA 2W24A 3WNHA 2MGZB 3ZEUB 3SBGA 4CK2A 4LR8A 2CQDA 4ANEA 1FFWB 1R6VA 2J9DA 3UD3P 3THYB 1V38A 2I38A 4MIAA 1YVNA 3QJPA 1IQZA 4ER8A 4O9MA 3W5YA 3ZZRA 4FLTA 4M9LA 1GO3F 4OV6A 4DV5K 1Y11A 4UAZA 3ISND 2KN7A 4QIFA 4B17A 3VF0B 3EXYA 3KOAA 3NMUA 1RDAA 5E2QA 3IRUA 3RAQA 4DQSA 2XMKA 4H4OA 2J9DE 3I87A 3IP4B 1RAJA 3KLEB 2CIMA 5IT9Y 1YBAA 3AO1A 3UO0A 2YNGB 3Q8VA 1MW7A 2CGJA 1CRXA 4RNMA 3JPSA 3IV6A 3DU5A 4NLNA 4CJEA 1KW4A 3H8MA 3UD4P 4WK3A 2LHTA 1XMOJ 2R2RA 3ADAC 1KC8O 3CFPA 1SPBP 3MM5A 2RDJA 1SXLA 1VCTA 3SIPB 3AAWB 3ID8A 2ZXHA 2ES6A 9ICCA 5C24A 1NO8A 1FHTA 3DXSX 3CIMA 3H0LB 2HG4A 2MPUA 3VVTA 1D8BA 4I7FA 2HSZA 3C16B 2RU9A 2VV5A 3DRRA 1DJ0A 3HBTA 1NI3A 2WVFA 5ALQA 4JI5J 1H72C 2WSCC 5KFUA 4BS2A 2Z30B 7ICEA 2Z0GA 1RFQA 1WUDA 2YPZA 4JI7K 2ZD1B 1KAXA 4P7VA 2JL9A 3HJFA 3RH5A 2XBPA 1KBRA 1RG6A 2DNQA 2A2CA 5HROA 4X64K 1JLGB 1TVRB 4RPFA 1WSEA 4FJMA 3NH0A 3ZX3A 1IJFB 2FHOB 1WSGA 4AHTA 1K1QA 5B0EA 3L4IA 4GVBB 4NASA 5JVHL 3AJ2A 3SMPA 3F53A 1BGXT 2NREA 1QVFR 3GQCA 1O0PA 1RT2B 4DOZA 1U26A 3DRPA 2XRIA 1DLOB 3OT9A 3N5FA 2ZIUB 3BO3A 4DCOB 5GAEI 4CGJA 3MECA 2KFNA 3BBBA 3P5JA 2CPXA 3WU2U 1W7AA 5L1JA 5AI5A 4DN0A 4B3TK 1HHQA 1PILA 3P4UB 3CF5L 3HXMA 3MOZA 2LDYA 2VG7A 1R0AB 1M5HA 1SGGA 2YHAA 5B66U 4KN4A 2E5LJ 3HLUA 5HJXA 3NMRA 3I4PA 3GONA 1UA1A 3FGVA 3D4JA 4CEBA 4Z2XA 4FXDA 3A5MC 5AXNA 3WHIA 4P4OA 4PWUA 1QHTA 3SQOP 3WXMB 1UHUA 5AKJA 2F8LA 1TELA 3AVAA 2EWSA 3CCWA 2CZ4A 4NYOA 1OQ3A 4KH1B 3AO2A 1SZ2A 4DV3F 1X4DA 3DDIA 1QZ6A 2Q1LA 5DK5A 4AP9A 1SH2A 3NGIA 4WXOA 1VQ4S 4BRAA 3FSIA 5KFEA 4TLRA 3DRSB 4YB5A 1NKBA 2G8WA 4L8RB 3M6XA 2IS3A 1LFWA 2PZSA 2E5JA 4OZ1A 1HBUB 2WOMA 3O9TA 3VQAA 2DGSA 3W62A 3C8YA 4XK8C 1PJ7A 1U8WA 1U47A 2BOPA 1REGX 2FF6A 3UMGA 1HFEL 3TVZA 4DL5A 1V85A 3N0VA 4X4RA 2E1MC 1KSPA 3UVJA 1MROA 4HT7A 1K47A 1HW8A 1ZQBA 5D4PA 2DPIA 3OXLA 2FTRA 3L4PA 4KGMA 4B3RK 1PK1A 3K8VA 2BANB 2VG5A 3BF3A 2FC0A 3HOSA 3H5XA 1KFDA 1HUZA 4TLQA 2BTFA 4ECUA 3M30B 4NLWA 1YRTA 3CNHA 4DV2J 1S8OA 1VQKN 3MPYA 3IWXA 3K1RB 1WSFA 4YMOA 4OYWA 5E79U 3OVAA 1FFVA 1IBLJ 2G07A 4O8KA 3UQSA 2H51B 2R7YA 3O6WA 4GIBA 2Q97A 1B4FA 4AM7A 1FNXH 4O3NA 4DV6F 3LZJA 5KG3A 5T7LB 3NH2A 2JHEA 4C4TA 5D0EA 3OY9A 1XQIA 1C0GA 3AVJA 2C3OA 4JD2A 3DLEA 3V6DB 2HS3A 5BRDA 3SMVA 2G9OA 2XY8A 2AP6A 4L3QA 3A12A 2Q3PA 3CCVN 4NL9A 2I8EA 4UAWA 3MM5B 1MLAA 3D1QA 3ZNJ1 2IM1A 4CP5A 3OJUA 3HP9A 2MRLA 4DLEA 2JVOA 2JXJA 5I3QA 5DMRA 3DMJB 1Z6RA 2HFVA 5KPTA 3HYFA 1S1TB 1D9DA 2D41A 2FHKA 2J7WA 3A8YA 2HRUA 4I2EA 1RA6A 3RGIA 4USUA 5GAGI 1NJZA 3SDEA 2K4HA 3QMQA 4M5GA 2B0CA 3FJ2A 3H8JA 3A3PB 1W9HA 3NNAA 2AX0A 3M7VA 3WT0A 2GQ2A 2O4GA 5B0AA 4PYDA 3M1VA 4UY85 3M3ZA 3RFAA 1M5OC 1O08A 4X62J 4YDDB 2O8FB 3PW0A 4CLUA 3IRXB 1UA0A 1KVJA 2MU2A 2KXNB 4KSEB 3CW2C 2I1RA 2FBXA 4X66K 4QU6A 1MU2B 1S4FA 5C2FA 3SAFA 3RR8A 3T1YK 1G4CA 3BJYA 4Y2KA 1HI1A 2IA6A 4RQ2A 3MN7A 2JDJA 4K41A 4ETXA 2BE2B 1VRTA 1FWLA 3SMZA 4DUYJ 2W54A 2X1GA 4USJC 2VHGA 2R18A 1RTDB 3F44A 4DUZJ 4CO5A 1H7WA 1SV0A 2ZJQQ 3PSFA 3M8PB 3BSCA 3HKZD 3CG7A 1SAZA 3CIPA 4F3QA 4WYWA 4NCAA 1VQNN 4P2HA 3DC2A 4RTFD 1NZBA 5ALXA 4XUSA 4DTOA 4RW8B 2OANA 1WWUA 2KHOA 4CZIA 2D0BA 3QLHB 3VV2B 4ZITA 3R1HA 3NXZA 3O6QA 3DOMA 1TVRA 4USIA 2HYIB 4R5PA 3RF9A 4FO6A 1VQSA 1YG0A 5AQKA 4CFCA 1TL1A 5BREA 3ORYA 4CEEA 2DB1A 2EHGA 4R25A 1W97L 3ETOA 4DPUA 5IWAJ 2AD9A 3FSYA 1VQ4N 2DR5A 3OYMA 3M1FA 4BC4A 1XEZA 4FE3A 3GIMA 3TAFA 3N7RC 1IBKK 1Q82T 4ILMA 4HVZA 3GP9A 3OLAA 3OYBA 2EC0A 3T5KA 4EBEA 4K0KK 2AW0A 1FWKA 3I56S 2HVIA 4M47A 3RW7A 2JGAA 2VJ5A 1KWMA 5F9NA 5I42A 2VANA 2IOCA 3OFFA 4MLHA 3ENOA 2FVQA 1P90A 4WFNL 1NNEA 3CFOA 4LBPA 3KLGB 4M5IA 4F25A 5LMUJ 1RDCA 1WSJA 2WRMA 4WJ3B 3KKRA 2U2FA 4KHPJ 4DV3J 1AW0A 1TUYA 3X1LB 3KD1E 3VN5A 3AAQA 3ZTRA 1HBNB 3L2VA 4CF4A 3QATA 5J0PA 2MZJA 2GC8A 3DRSA 2O8CA 4G1QA 3VQSA 1RQLA 1RHMB 3BV8A 3ISDA 1CLFA 1DTQB 3NAIA 1Q7YO 5DM7Q 1FT8A 2NYHA 1QM9A 4KTWA 4C1NK 3OHRA 1CEZA 5CAAA 2YHWA 1NG9A 1IR2A 1K73T 2BJDA 5T7LA 2HOEA 1NBEB 5M2PA 5M1PA 2FMPA 3L2WA 5HR7A 4JI6F 3NF6A 2OO4A 3JAMO 2PMZF 3RAXA 2HOFA 4YHHK 3CC2N 5B0CA 1Y10A 5E26A 3LA0A 4ZVSB 3ICLA 2BYCA 1RWMB 3CMES 3NVMA 2DTUA 2KKVA 1OY6A 4JKAA 2EC2A 4CH1A 2A1SA 5AM3A 3L8BA 2KIVA 3QDKA 1WCNA 3W9JA 3X3UA 4UW9A 2DEIA 4ZCIA 2H9ZA 3MECB 5FRMA 1U24A 1T4GA 3UXOA 1BPDA 2D7SA 2XHBA 3R9KA 1VSHA 2YNFB 4S0MA 2CPFA 2HZCA 4QZDA 2HQFA 3SDEB 1FO1A 1WKKA 4QWCA 3BGFA 2V7ZA 2HHWA 4NA2A 1KQFB 2YKMA 4O55A 4DSIA 2A1AA 5IIMA 4BXOB 3GJTB 2ZNYA 2NRVA 3DGPB 3QIPB 2LKZA 4IOXA 3CCVS 2KLAA 1ZQMA 2QB1A 4HHUA 2HI0A 3MM6A 2MAXA 3OA9A 3M6WA 4KRFA 1GTHA 5HMXA 1FEEA 1UFWA 2GAGC 3US5A 2F96A 1ZRMA 3RG6A 4K5RA 3Q0AA 1MMNA 3CD5A 1S48A 5AQRA 1JI7A 5BRHA 5FDLB 2VJVA 1YTUA 1HJRA 4H4MB 3T1HK 4PG5A 4B3TF 2VG6B 2IJRA 4W5TA 1OS5A 2XGQA 4J8FA 3SCJE 2DY1A 1TL4A 4NWIA 3OR2A 2B9XA 4N8OA 3HMJG 3O1LA 1WORA 4CZEA 3AVIA 2D69A 8ICWA 1NK8A 3RJHA 1ZH5A 2YHBA 4IDKB 3O4QA 4UTGA 3CD0A 4CD1A 2ACYA 3DYAA 1MROB 1NKCA 1SBRA 4P9SA 1M1GA 1DEJA 3SQ2A 2NUBA 3KHLA 2E8AA 3U27A 4C9DA 4C4RA 1IKVA 3CMAN 2L41A 4BRLA 4A8FA 4BLGA 3A3NB 2E6LA 4YR0A 4C8KA 4CIOA 7ICNA 4PWDA 5CYMA 3VMFB 2CPEA 5J2QA 1N36F 4NYFA 4USKA 3R2DJ 2ZWPA 1HBMA 1JLAA 2WAQC 4QCLA 4DF4A 2OXOA 2F1HA 5EE9A 2MYFA 3BGUA 3EVWA 4AM6A 3POTB 2QEXN 4KRWA 2BZFA 2VG7B 2CVEA 5KFZA 1RILA 4CGHA 2XI3A 4KGKA 3NCQA 4JB3A 2YTCA 3IKMA 1YTAA 2FSKA 2GW8A 3V6HA 2KZZA 3D67A 2KVIA 5FROA 4YR3A 2UUWA 1EKEA 1HNXK 2FLNA 2ZUDA 3JTOA 5HOOA 4MFAA 4JI4F 3BKUA 1KQSR 1FE4A 1FKPA 1OVYA 4JKDA 1T03A 3WXIA 3LP2B 3D6TB 4NCBA 2MQQA 5KGWA 5HATA 2GTDA 3AO3A 1O51A 1U2FA 5D77A 2MY7A 2XGPA 3FR0A 4O44A 2WSFC 5ADZA 5C24B 1RZMA 2LKYA 3QJJA 1FJGK 5E3RA 2E8MA 3VA0A 2APOA 4PH5A 3AQPA 2GELA 3WQTA 1S1TA 4C3KA 2ISOA 1G1XA 3WKDA 4USTA 4QS8A 3CCQN 5IILA 4JHDA 3NVYA 2RE2A 3V1QA 4MN4C 1JKHA 1KR4A 2CYYA 4EU0A 2KB2A 1L3VA 1ZQ1C 3CCSS 1FFGB 2B8QA 4A8KA 5KFIA 4RJVA 1H0HB 4FW2A 1YT3A 3Q8LA 4BC3A 4XQ8A 2XMWA 2IJFA 3OYFA 3AVLA 2OM6A 4IUFA 5E41A 2YKOA 1NBWA 3UM9A 4H0TB 4N56A 3D68A 1SIZA 2JC0A 4KGVB 3V9WA 2PC6A 4H0OA 4NLTA 1WUAA 4Z6DA 3OD2A 2ETJA 2HOIA 3ONQA 3UWTA 2K7JA 4Y1DA 4MLEA 2PKEA 4OJ1A 4ZH4A 4RQ3A 1A7GE 2BE2A 4DPYA 3DRXA 1R59O 4M9GA 5AQWA 3OBYA 4GMKA 4PEOA 1TGOA 4OZ3A 4BRMA 4MIWA 1U2VA 7AT1B 2A1JB 4QWBA 1IKXA 2YMMA 3VZHA 4MFBB 3CJ2A 2EFOA 3A0BU 2HBYB 5AKZA 4JI3F 1R3NA 1LAVA 4EK2A 9ICLA 3EE9A 4DDFA 3N5BA 4YORA 2ZM6J 2Q79A 3ID6A 3LPYA 2ZFHA 4NLOA 4YDUA 1WUUA 5J2AA 3WIVA 3VQ8A 1KRPA 3H3OB 4CF1A 4FZVA 1JLBA 4BRQA 4ZOSA 1NOMA 3TAEA 4USVA 5C15A 1HYSB 3THTA 3FFKB 3R5DA 3HSDA 2B9YA 3W63A 4PHAA 4CWBA 2HCFA 4EFHA 5F3ZA 2Z2YB 4KH0B 3MEEA 2XLJA 2YNFA 2RIJA 2L3MA 4TUPA 1I6JA 2HMIB 3IG1A 2V5HG 4A61A 8ICUA 2MKYA 8ICNA 3BKTA 3CVKA 2W7OA 4CLYA 4AD6A 1LK7A 4FF1A 5AQYA 1WG8A 3J81U 1FRXA 1ASUA 3MWTA 3B8AX 1RYSA 4RU2A 2IVYA 2RJZA 3BB5A 3AGKA 1Q18A 5IC4B 1UPHA 9ICRA 1W25A 2W43A 1GOBA 3KWIA 1BY9A 2NXUA 1J9AA 2B21A 4QZ8A 2KVQE 4ANDA 5A2QO 2V7YA 3PKYA 4J9QA 2DTJA 4ED7A 4KX5A 4JKGA 2XY7A 5HI7A 4JI1F 1WG4A 4JI1K 3KHGA 1WKJA 4R63A 2DNPA 4XTTA 3QX7A 3UFCX 5C10A 4HCBA 7ICLA 2Q4TA 2F7VA 5J1NA 1NU4A 5TKYA 2CG4A 1YGYA 1RXVA 1F5AA 2OI2A 2MHEA 3H0RB 4Q43A 3THXA 4GMJB 3RJMB