4DQIA

Ternary complex of bacillus dna polymerase i large fragment, dna duplex, and dctp (paired with dg of template)
Total Genus 207
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
207
sequence length
579
structure length
579
Chain Sequence
KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase I
publication title Structural factors that determine selectivity of a high fidelity DNA polymerase for deoxy-, dideoxy-, and ribonucleotides.
pubmed doi rcsb
source organism Geobacillus kaustophilus
molecule tags Transferase/dna
total genus 207
structure length 579
sequence length 579
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4dqiA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4dqiA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4dqiA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4dqiA01
7ICPA 5HP4A 5KFRA 4CF9A 3RJFA 4KLOA 1NK0A 4CFBA 4FO6A 4H4OA 4H4MA 2PZSA 2B4JA 1ZQJA 4J9LA 4DLGA 4DFKA 1UOCA 9ICVA 4DL5A 4ICLA 1B92A 5C5JA 1L5UA 4RT2A 3TAMA 4CECA 3HVRA 3QEVA 1WLJA 1Z00A 3OJSA 3B0YA 2IAJA 1DTTA 5D4BA 3P1GA 3WNGA 2P6UA 1NOMA 4N41A 2PFPA 4M9HA 2VWJA 1QS4A 1XC9A 4ID5A 4ID1A 3RH4A 4UBCA 4Z0UA 5CZ2A 2V4RA 5IIOA 2BCRA 3KLGA 3KTQA 7ICTA 2G8WA 5J2GA 4KLQA 3Q8PB 1L3VA 4CHNA 3IS9A 9ICIA 1RT7A 3L3UA 5KRTA 3QE9Y 4FS1A 4I9LA 3K4GA 2ALZA 3V7LA 4F4KA 8ICGA 2DTUA 7ICEA 4IRDA 2BDPA 1RT5A 1VSEA 3PMLA 4M45A 2BPFA 1HNVA 1J54A 2ATQA 8ICMA 3SUOA 2DFHA 4C8OA 5CYMA 3NH0A 1KTQA 4QWBA 4KI6A 4RQ6A 3AVBA 4O5CA 1S9GA 3RWUA 5KT3A 2HHUA 3D0PA 1AROP 1VSIA 3OYLA 5BOMA 2VG7A 4YG2A 4O3OA 1U48A 3V6HA 4UAYA 3B6PA 2FPLA 2LYHA 1RTIA 1RBUA 2YHBA 3ORYA 3MDAA 3FYHA 4QZFA 3I8DA 4KV8A 4RQ3A 5KFDA 1JLQA 2WONA 1I3AA 1S0NA 8ICHA 4PH5A 4UB3A 2HNDA 4TUSA 1GOBA 1JXEA 4FM2A 4FYDA 2Q3SA 1NK5A 4AILC 1BPDA 4Z6FA 1ASUA 1UWBA 4OPKA 5KRSA 4QWAA 2W8LA 3PO5A 2HHXA 7ICKA 2I1QA 1NK4A 3VQAA 4KI4A 3PR5B 5J2EA 3MABA 2DFEA 3T1AA 3V1QA 2OPRA 2PYJA 3V6DA 4RPXA 2FC0A 4FW1A 2HMIA 3MDCA 1REVA 4MEYA 3RBDA 4CIEA 2PFOA 3G10A 5CZ1A 4RU9A 1ZQXA 1NJXA 7ICMA 1KLMA 2ASLA 1SL0A 3HPHA 5J2KA 4MFCA 1T8EA 4IR9A 3LDSA 3VQBA 1RT3A 7ICLA 3RH6A 3V9XA 1ZBUA 4DTOA 5HP1A 4C8NA 2OZMA 5J2MA 2W9CB 8ICZA 1TKXA 4DWIA 4YR0A 5KG2A 3PW5A 4KLTA 4G3IA 1Y97A 2HW3A 4O44A 1U47A 4FJ8A 4KHYA 4I2QA 3AO3A 9ICJA 4CGIA 3OYIA 1JLGA 2WOMA 5J1EA 4KB0A 4FBUA 1NKCA 1SV5A 5KFSA 3MR3A 3QZ8A 1RBVA 3IM1A 4M9LA 3RJJA 3ZDDA 3S3OA 2FLPA 3CM5A 4F4XA 3AO1A 3QEIA 4YNQA 5SWMA 4PY5A 3RB4A 3CG7A 4MEXA 3LP3A 5C25A 3SUQA 3OYEA 4ED1A 3A2FA 2XRIA 4YFUA 1ZBFA 4KN4A 3SUNA 3AVGA 3T5LA 4CJTA 3S3MA 3RR8A 4RQ7A 1S97A 4F92B 4HUEA 4KO0A 8ICOA 2BQ3A 1TKDA 4XRHA 2BCVA 3AVKA 3P83D 2BCUA 2AGPA 3V6JA 2A1RA 3SI8A 1JXLA 3FFIA 5J2FA 5HRRA 1VK0A 3PX6A 5EWEA 4M9JA 3I0SA 1IKYA 4J9MA 3OYCA 3C23A 1B9FA 9ICTA 1XO1A 8ICJA 3M9MB 4PWDA 5J0SA 1KRPA 1BPXA 1BQMA 1QTMA 3AVHA 1LAVA 5DQHA 3OS2A 3KHHA 4UQGA 2RPIA 4J9OA 3BJYA 4XA5A 1JMSA 4ZHRA 3QERA 5KFYA 1HPZA 4CHOA 4O9MA 4KRFA 5J0RA 1ZQVA 3Q8RB 2PY5A 3I0RA 1RDAA 3EPIA 1A5XA 4RW8A 3T5HA 4FZXC 4B9UA 1VSFA 5HNKA 1F21A 1VRUA 2J6SA 2LSNA 3HL8A 5KGXA 1IKXA 2HVHA 3LALA 1COOA 1NJYA 8ICCA 3QIOA 3OYKA 3H8JA 4JLHA 3TFSA 4RQ2A 1HYZA 1WN7A 4DU1A 1H38A 1MC8A 7ICRA 2P5OA 1LWFA 5HMMA 4E89A 9ICOA 3UXOA 4JV1A 5DLFA 3MGIA 4YFKA 4CHQA 5DQIA 2RN2A 4QWEA 7ICQA 4AHUA 4FJ7A 4KTZA 1BPEA 3DOLA 2R8KA 4DSKA 4ECXA 3WNEA 3ZDEA 1EX4A 2A1JB 4Z4FA 3G6XA 1ZQZA 5DBAA 3KKSA 3H4DA 1LB2B 1KDHA 9ICHA 4HCCA 2C22A 1FK9A 4DQPA 1B43A 1S1TA 5IIKA 3M9NB 4E7IA 1TKZA 4IDKA 3AVCA 1GOAA 4ED8A 8ICYA 2JEIA 9ICFA 3PUFA 1A5WA 4KLHA 9ICCA 2OPPA 5J0WA 2KTQA 1MSWD 3KD1E 2HHTA 2XY8A 7ICUA 1N56A 3QZ7A 3Q8KA 3C1ZA 3HVTA 4K8ZA 4QZIA 2XCPA 3NHGA 4GXKA 1TK0A 3ZCMA 4CFDA 3TFRA 4CJUA 3LWMA 4ELTA 4AHRA 4X5VA 2PFNA 1N5YA 4K8XA 3QETA 4CF0A 4LSNA 5JS1A 3T3FA 2KN7A 3OYJA 3AVFA 4OKEA 4CK1A 1RZTA 4OLBA 2YNFA 3AUOA 5J0PA 4FBTA 1ZQUA 4M47A 1S6QA 4B9NA 3L8BA 1S1VA 2RDIA 4O3SA 1UT5A 2KQ2A 4JWNA 4RUCA 4LZGA 4PHDA 4ECYA 3ISBA 4CGJA 9ICQA 4DTNA 4CF8A 3JYTA 1C0MA 4E7KA 4FVMA 2IBKA 3SCXA 2I9GA 2BR0A 1QLNA 3ZT4A 3DI6A 1BPZA 4BDYA 1JLAA 3NF8A 2WTFA 4HYKA 5KG1A 2C28A 4IKFA 5DG9A 5KGWA 1WSGA 4CF1A 4DTUA 3ZD9A 3RAXA 5CHGA 5T7BA 2ZUBA 4FJIA 2RF2A 3PR4A 2B5JA 2GBZA 4AHSA 4ED0A 5KFJA 4LD0A 5HBMA 3C6UA 8ICUA 4O0JA 3SNNA 1NOYA 4KHSA 1VSHA 1VSLA 3ISNC 4DMNA 4NYFA 4OLAA 1T05A 1WSEA 4B08A 7ICGA 3ZSVA 4M0AA 1XSLA 3CFRA 3MBYA 3DM2A 4YMMA 1YTUA 1SZPA 4F2RA 1XWLA 5KFTA 3TAPA 5CR0A 2W9CA 4I2HA 1ZQQA 3QINA 2ZTEA 4NLKA 2HHQA 3MEDA 4CGHA 4I9QA 1BVSA 3DOKA 4RZRA 4J9QA 2P66A 1HJRA 4BGDA 4Z4GA 2XY5A 4G1QA 3G0ZA 3ZDAA 4YP3A 3ZSYA 2DFFA 4F93B 3LPTA 7ICHA 1RT6A 5CY4A 4DSIA 3ZT3A 2R7YA 4F5QA 4YMNA 2ZTDA 1Z26A 4N56A 2D0BA 5BOLA 1VRTA 2HHSA 1ZQSA 1GOCA 4DL7A 4F91B 4O0IA 4EBDA 2BE2A 3PVXA 4YQWA 1YTAA 3IHQB 1ZQMA 1TAUA 4GLXA 3TAQA 2ISPA 4KREA 1YVUA 3HWTA 3CFPA 4E19A 4GC7A 1QSLA 4JS4A 3NGYA 3P5JA 2B21A 4HHTA 3BQTA 5TZVA 4I2DA 2MUTB 1S1XA 3NF7A 4OVLA 1U4BA 4ECUA 1D5AA 4ED7A 2W9BB 4F4WA 4IFYA 4KFBA 4FLXA 5KFNA 8ICBA 4JUZA 5J2QA 2FLNA 1CXQA 2YKMA 5D49A 5CB1A 4P4MA 4QZAA 4B8CA 5DLGA 2BGWA 5DBBA 5FROA 1R0AA 4M3RA 5F9NA 4RUAA 4DOCA 3QESA 1S5JA 3RTVA 9ICBA 2NUBA 3AO5A 4FS2A 5KFCA 1TVRA 2VANA 3PX4A 1C7YA 4DF8A 2BKEA 3IRXA 5D46A 2Q0ZX 3M8RA 4FLVA 2YNGA 1ZJNA 1QSSA 3BDPA 1RPLA 3ZT2A 4JV0A 1RDBA 1RT2A 2E6MA 3SYZA 3F73A 3MFHA 3V81A 3SJJA 2JEGA 3RJHA 1ZQTA 3IAYA 2AQ4A 4NY8A 1TKTA 4TQRA 1S0VA 3KK1A 4UB5A 5HRNA 3V72A 1RYRA 4FLWA 8ICIA 2XCAA 4CJPA 3K5NA 4QZEA 4M9GA 1IKWA 3LP1A 1RYSA 3B6OA 2IHMA 1BHLA 2EX3A 2A1JA 1C0UA 1UA0A 2QKKA 3QLHA 8ICTA 4CJQA 1HYSA 4NM2A 4PGYA 4R66A 2R8HA 2IA6A 1U9LA 1S76D 4CJLA 3FDSA 4YD2A 5C42A 4F5NA 1HQUA 5KFBA 2GUIA 3M8SA 2OPQA 3ZSXA 4KPYA 4Y1DA 2P51A 2BCQA 1C1AA 3PW0A 4FJ9A 1TAQA 2P6RA 4RW4A 2KFZA 3K59A 3DLHA 4LY7A 3LP2A 3PMNA 3AU2A 2FBYA 3AO4A 2FMQA 4DTMA 3QEXA 5J0YA 1BI4B 3MXMA 3HP9A 4GXIA 3U3YA 4Z4CA 4RNMA 5J2BA 3NF6A 4PA1A 1DTQA 3TARA 3TABA 4B9VA 1XI1A 2BANA 5CP2A 4RQ1A 4GVMA 4J9RA 3KIOA 1BPYA 4HCBA 1X1PA 3ZT0A 1LV5A 4EP4A 7ICSA 3F9KA 2R8JA 1C1BA 4DSFA 4BE0A 4I2JA 2AGOA 4CEZA 1IM4A 1VSDA 5FRMA 3LAMA 2G8IA 5DKWA 4IRCA 2X6SA 1PZNA 5HHHA 2M9NA 3SZ2A 3T5KA 1ZETA 2FBTA 4TUPA 3QO9A 3AA3A 3E2EA 5JS2A 5KFQA 1JXBA 1QSYA 3VQQA 3QEWA 3V9UA 3MR5A 3OVNA 4LH4A 2NRVA 5KG3A 4CERA 1DGSA 4ECWA 1TVAA 3QEPA 3TANA 2P1JA 4M3YA 4KHNA 3H40A 2DFLA 2IMWP 5HHIA 4B9SA 4FK0A 1NJZA 9ICUA 5KFOA 4RPZA 4P2HA 5IIMA 3OS1A 1TK8A 3S9HA 3DRRA 1W0HA 1N6QA 3ZT1A 4DG1A 4M04A 2X78A 8ICKA 3ALYA 2F1IA 1L3TA 4FJKA 3BQ2A 4CEDA 1ZQFA 1Q8IA 1K1SA 3DYAA 3AVIA 3DLKA 4QZDA 5J2IA 2YV0X 1S9FA 3GILA 1WAJA 1WNSA 3C2MA 5DG8A 4I2GA 3EPGA 1RXWA 3RJEA 1Z3EB 4PHPA 1KVBA 3VQDA 1A76A 3QNOA 3GFKB 5J2CA 3GDXA 3LZIA 4FK2A 3EY1A 1SKWA 4GW6A 4QCLA 1NK9A 5DG7A 4M3WA 4CJRA 3KLHA 3AV9A 1KFSA 5K14A 3AA2A 3THVA 1NK7A 8ICAA 4BE2A 4KN7A 4IQUA 2KZMA 4I2CA 4EEYA 5J2AA 2F1JA 1J53A 4BWMA 3HK2A 2GV9A 4MQ3A 3RMCA 4KLFA 4TUQA 1WSHA 4NYNA 3PW7A 8ICPA 5E41A 1G15A 1A5VA 1X2IA 9ICMA 1TL3A 8ICVA 3AA4A 5J2NA 4ZTFA 3C5GA 4CCHA 5KG0A 4HUFA 2G8FA 4DF4A 3RMAA 3OS0A 2YHAA 3GIKA 4DL4A 3OYMA 2XO7A 2W9AA 1RDCA 2MUTA 2NRXA 1XS9D 5D3GA 4DSLA 1ZYQA 3NGZA 1RTJA 1UT8A 2V9WA 3PW2A 1LW0A 1O1WA 3GV7B 3MEEA 2JZBB 2W9BA 4H8KA 4FJGA 4J2EA 2VA2A 5HLFA 2R8GA 3H4BA 1RILA 2OPSA 1C6VA 3HPOA 4E3SA 4KB1A 3NE6A 4ELUA 1ZBIA 2J6UA 4O3PA 4B9MA 2ITGA 1ZQPA 4QW8A 3OYNA 4FCYA 5IIIA 3LANA 2QXFA 2Z1GA 4Z4EA 3HP6A 3RR7A 4YN4A 1S77D 3OHAA 2Z1IA 4CIGA 3GIMA 1D8YA 3PV8A 2C2RA 2UVUA 1Q9YA 4OPJA 4I2EA 2VG6A 3VA3A 1BCMA 3GIJA 5EWFA 1BIUA 4TURA 3UXNA 2IGIA 8ICFA 1L3UA 2J6TA 3OHBA 4O5KA 4RW9A 4QZHA 3AO2A 4E1MA 1ZQGA 5CYQA 3V9WA 1QE1A 1QHTA 5I3UA 1ASWA 4F4ZA 2UVWA 1WAFA 3C5FA 3K57A 5KFLA 2AU0A 4HVJA 3RRHA 2P5GA 3SQ4A 3JPOA 3SV4A 5J0QA 2XGPA 4KLDA 3K2PA 2QK9A 2ZUDA 4RT3A 2PI5A 4DSJA 3JPNA 2YNIA 3M9OB 4OKKA 3DRPA 4BACA 4NLZA 3VQ6A 5J2PA 3RRGA 1VSJA 4O55A 4DS5A 4E7HA 1TV9A 4O5BA 2F8SA 4QWCA 4M6WB 4YVZA 3OYHA 2PFQA 4DU3A 3G6YA 4C8LA 3DRSA 3KK2A 1HUOA 2PI4A 5IIJA 1RBTA 4RW6A 2OZSA 1ZBHA 3AVAA 4IBNA 4CESA 1NJWA 3S3NA 2AGQA 1BISA 2DY4A 5KG5A 3DLEA 3V1RA 2ETJA 2B6AA 3MXIA 3L3VA 1HUZA 1XHXA 2XGQA 4EZ6A 5I42A 3OGUA 3TAGA 5HMLA 1JL1A 3ZSOA 4F4YA 3U6FA 1FXXA 1ZQAA 1BI4A 2ZJAA 1Z25A 3HXMA 1ZBLA 1S1UA 2NRZA 2W9MA 1WCLA 3IG1A 1N48A 1HYVA 2ZQBA 4JS5A 4F50A 3DLGA 1TL1A 3MECA 3VQEA 2ISOA 5IINA 1CLQA 4M2YA 1L3SA 7ICJA 2BQUA 2D0CA 1ZQCA 4GXJA 1IG9A 9ICRA 1KEJA 4F2SA 4RNNA 2H5XA 1YT3A 1X9MA 3NGDA 3OYAA 5J0XA 4M3TA 3MR6A 4CEEA 3RJGA 4O4GA 3JPRA 2UVVA 3K58A 4FLYA 1EXNA 1CXUA 3VQCA 1XHZA 2BCSA 4ECZA 1J5OA 3ZSZA 8ICEA 1ZQYA 4MFBA 3H8WA 3EZ5A 1C0TA 3HJFA 2KFNA 1RCHA 1BIZA 2AQ0A 9ICAA 2IC3A 4QAGA 9ICXA 4DL2A 4PUOA 3KHLA 3L2VA 5C24A 3KD5E 1FKPA 5DDMA 1RT1A 1KLNA 4DOBA 9ICWA 3AVLA 2V4QA 3TQ1A 4JV2A 5KFUA 2I5JA 4DO9A 2XC9A 4MF2A 2PXIA 1IKVA 1BCOA 3MR2A 3K5LA 2HHVA 4FJLA 8ICNA 4W5TA 5DGAA 1CUKA 1ZQDA 3ZDCA 9ICGA 4KTQA 3L2RA 3VQPA 3ZD8A 4EZ9A 3BGRA 3SPYA 4DEZA 9ICLA 4P4PA 4IQWA 4K4IA 4IFVA 1C1CA 3HW8A 3OJUA 2Y1IA 3SQ1A 3JPPA 5DBCA 3MAQA 5CA7A 4KLLA 4LZDA 1UAXA 2ASDA 1VSKA 3OY9A 4E0DA 4NLGA 4LSLA 4FJMA 4QWDA 4UAZA 1NKBA 4UB4A 4B9LA 3O3HA 5KFVA 2PYLA 4FJ5A 4CFCA 2Z1JA 5DGBA 3N97B 1I39A 2EHGA 1X9SA 1ZQOA 3UIQA 3HYFA 4CJWA 2ZD1A 3RMBA 1D8LA 4ECTA 4RW7A 1CZBA 4MFAA 1TV6A 3PO4A 4FK4A 3CYMA 5KG6A 3LWLA 2D0AA 1ITGA 4PPXA 4BE1A 2BQRA 2ATLA 1ZJMA 4XUSA 4RQ5A 4IQTA 4PGXA 3O4QA 2JZBA 3AVMA 3UPQA 4I28A 5L1LA 3JPQA 2GWSA 2ZJ5A 4PHEA 4FZZA 4KHQA 4ZH4A 1K6YA 3GQCA 3ZSQA 4CEBA 3V9ZA 4IG3A 4QOZB 3HPGA 2FPMA 1WCNA 4IQVA 1MQ2A 2E4LA 4TQSA 2X6NA 3SI6A 3NF9A 4BDZA 2D5RA 2HHWA 4KLJA 1DLOA 4JRPA 4Z6EA 5KG4A 4J9SA 3NFAA 4CJEA 4QZ9A 1U04A 3VQ4A 4R63A 3Q8LA 5J0TA 1Y88A 4UB1A 3MGHA 3LK9A 1S1WA 3LPUA 3MFIA 4O3QA 4N47A 3LZJA 4DFMA 3QNNA 4AHVA 3GV5B 4OGCA 4P4OA 5DB8A 2HB5A 3BQ0A 3O4NA 1ZQBA 4FLUA 2ZE2A 3ULDA 3EWAA 3VN5A 3B0XA 2FMPA 1LAWA 5KFIA 3SV3A 3HSTB 4J2BA 8ICQA 2YNHA 2BGGA 4ELVA 5IILA 5J2HA 4DFJA 1JLBA 4KKOA 4CJ5A 2G8KA 5FDLA 3D45A 4KHUA 1NK8A 1ZQNA 3LAKA 4Q8FA 4J2AA 1XSNA 1MU2A 3UQ2A 1WSIA 4RQ8A 4RQ0A 3MXJA 1JX4A 1VSMA 4F5PA 4K4HA 1K1QA 3NH1A 4RQ4A 4M6WA 3QIPA 2C2EA 4CEOA 2RDJA 4DQQA 4ED6A 4Q43A 1BPBA 3NAEA 4QZBA 3DLBA 4B3OA 1EETA 4Q8EA 8ICLA 2MAXA 3SPZA 1S0OA 3L2UA 1U49A 3VA0A 2JEFA 3M8QA 1S10A 3N4MB 1CZ9A 3OYDA 5EWGA 1JN3A 1IXRA 4NXZA 2IDOA 4Q5VA 1XSPA 1JL2A 3Q8SB 4FLTA 2VG5A 3V7JA 4YXJA 4CK2A 5DDYA 1KVAA 3V9SA 1SUQA 2X74A 3RJKA 4L8RB 3OSPA 4NCAA 2FLLA 3V7KA 4RG8A 5KI6A 7ICFA 2BHNA 1S0MA 4F5RA 1EXQA 1ZQEA 3PX0A 4NCBA 1KVCA 4ECRA 1FKOA 2G8HA 4I2BA 2VA3A 4ECSA 1B9DA 2A1SA 4BXOB 5FRNA 3ISDA 4CGFA 4F8RA 2Z1HA 4IR1A 2OWOA 1ZQKA 5DB6A 1EP4A 3H08A 4B8AB 4N76A 3U3GA 4J2DA 2XY7A 4DQRA 1D9DA 3ZDBA 1DOQA 2NRTA 8ICWA 3WNHA 4IRKA 3V6KA 1S6PA 4EYIB 5J29A 5KFHA 4YD1A 4E1NA 1Q9XA 1TK5A 3C2KA 2AJQA 5HRSA 4PQUA 4FXDA 1HRHA 3JPSA 1RBSA 4DQIA 7ICNA 2FBVA 1BQNA 4RNOA 5HRPA 5J2JA 3O3GA 2RKIA 3PNCA 4FW2A 4FJHA 1RDDA 2F1HA 5KFAA 1MQ3A 3QEAZ 4F3TA 4JWMA 1LW2A 1ZQIA 3C2LA 3C6TA 3NTUA 3PW4A 3DMJA 4DTRA 3RJIA 3CM6A 4FM0A 4DS4A 2R8IA 3Q8MA 2ZUCA 3K75D 4M3UA 7ICVA 4UBBA 4CEQA 5DB9A 4M9NA 2O4GA 1ZQRA 2G8VA 1HJPA 3TAEA 4FJJA 4KHWA 4W5RA 4R8UB 1T7PA 5KFZA 3CQ8A 4CJKA 4DFPA 4JK1A 1HNIA 4CHPA 3ITHA 3OYFA 1A77A 5J0UA 3SUPA 4YR3A 5KFKA 2KZZA 3KHRA 2Y1JA 3Q8QB 2ASJA 2FPKA 5L9XA 3T5JA 4MF8A 3KJVA 2VA8A 5KFMA 4TSXA 4J9NA 5KT4A 3T19A 4C8MA 1ZQLA 1EKEA 9ICEA 5HROA 5KT6A 4DTXA 4DTJA 5SZTA 4DLEA 4BDPA 4J9KA 4KLEA 4KITB 2DPIA 3C94A 4DTPA 4O5EA 3OSNA 4LVSA 2JEJA 4CHYA 1IO2A 2FBXA 1CEZA 5CJ7A 3RMDA 2HNYA 2OA8A 1T4GA 5BPCA 4CJVA 1V9PA 2ZTCA 8ICXA 5KT5A 3G6VA 4ED3A 4KLSA 1Z00B 3C1YA 1JLFA 2KZ3A 4MFFA 2HNZA 3HM9A 1KCFA 5J0OA 4KLMA 4F3OA 4Q45A 1KFDA 4EP5A 4YCXA 1JLEA 4N5SA 2KW4A 5DK5A 4CF2A 3OYGA 4CJSA 3ZSRA 2OYQA 4DQSA 4QW9A 4I2AA 3BQ1A 4I2FA 1RXVA 3AVNA 4YMOA 4JRQA 3RB3A 4CHZA 3K5OA 3EYZA 5DB7A 1U45A 1BL3A 4FM1A 4UAWA 4DL6A 4M41A 4CEAA 3NGIA 3QEBZ 4EYHB 2JGUA 3C21A 2VWKA 1UA1A 4AH9A 4CIFA 9ICNA 2E6LA 4EBCA 4ECQA 5EOZA 4FZYA 5J2DA 5L1JA 2FMSA 4W5NA 4R5PA 3RBEA 4Z4IA 4NCGA 3WNFA 5KFEA 3KK3A 3LP0A 3NDKA 1LWEA 3KLEA 4KLUA 1SKRA 1IH7A 4KLGA 4I2PA 3AVJA 4R64A 3NBPA 3UQ0A 5L1KA 4PHAA 4RPYA 1KFTA 1S9EA 3TI0A 4DTSA 1SL2A 2IOCA 5KT2A 2F8TA 4Z6DA 1B22A 1LWCA 4CJ3A 1NKEA 1W9HA 3L2QA 2W42A 5KTQA 2XY6A 4I2IA 3NH2A 3KLIA 4Z4HA 4FLZA 4I27A 5JUMA 7ICIA 5KFPA 2DPJA 3TWHA 2NRWA 3KHGA 3O3FA 2G8UA 4KMUA 4FJNA 3CFOA 4CFAA 4HTUA 4K4GA 3KLFA 8ICRA 2XHBA 3RAQA 4CK3A 4DSEA 4NM1A 3SQ2A 3ZSWA 1TGOA 2IS3A 4LH5A 3ASMA 4XIUA 4IG0A 2JLEA 3VQ8A 3H8SA 3GIIA 4FJXA 3SQ0A 2ZJ8A 1RTDA 1NK6A 4KLIA 1HQEA 4W5OA 4YXMA 3HT3A 4AHCA 1BGXT 4BWJA 1X9WA 1ASVA 4M3ZA 1JLCA 4DL3A 4J9PA 3OYBA 4QZ8A 3RH5A 4NLNA 5F9LA 1RT4A 4WE1A 4ZTJA 1JIHA 4R65A 4W5QA 4M3XA 3V4IA 3E01A 4BXOA 1NOZA 5CWRA 3TR8A 4CE9A 4F5OA 3AU6A 4C8KA 3MEGA 4DU4A 4XQ8A 4E7JA 3HO1A 2BPCA 5KG7A 3VQ5A 1J9AA 4CJFA 4AHTA 4HUGA 3KKRA 3UXPA 1HMVA 1ZQHA 3JSMA 3M8PA 2BPGA 5KFXA 1SL1A 2IHNA 2F96A 4Z6CA 1XU4A 4QZGA 4CGDA 1D9FA 4EBEA 9ICKA 3C95A 5KFGA 4M42A 4DOAA 2YKNA 4B9TA 3RB6A 5KFFA 1SKSA 4KAZA 4OKJA 3TAFA 1T03A 4GC6A 1ZQWA 1QQCA 4QZCA 4PGQA 4I29A 5EU7A 1JKHA 2UVRA 1TFRA 3GV8B 4UB2A 3ISCA 5KT7A 4CJ4A 1WSFA 3ETLA 8ICSA 4CGGA 4YR2A 4OGEA 3NCIA 5L1IA 3PY8A 3RB0A 4ECVA 4R8UA 1RTHA 3JPTA 3V1OA 1WSJA 3L2WA 4Q44A 3H7IA 3EW9A 5KFWA 2QKBA 9ICPA 4OJRA 2O4IA 4Q0BA 2HVIA 4O3RA 4O3NA 4GMJB 4Y1CA 2W8KA 2C2DA 3DLRA 3VQ9A 3VQ7A 3HX0A 5DMRA 7ICOA 3LDAA 1T3NA 4E7LA 1KSPA 4ED2A 4CEFA 3K5MA 1RNHA 4KTWA 9ICSA 5DQGA 3AA5X 4I7FA 1RBRA
chains in the Genus database with same CATH superfamily
2XSFA 1EKRA 1WSVA 1R0CB 2FVPA 2QMUB 2CNOB 2PZSA 4DFKA 2K4PA 2K3KA 3TAMA 2RRAA 3QEVA 1X3NA 1WLJA 2GHWA 3H3NO 4C7ZA 2IAJA 2V0NA 4QS7A 5LMNJ 1LKZA 3WNGA 1WKKA 2DNPA 3K8VA 1QS4A 5ALHA 2RIJA 5HMXA 4GVLA 4ILMA 1RFQA 5F41A 2F9DA 1N52B 4P2SA 3KLGA 4LF4J 5AQPA 2F8EX 5AQFA 2G8WA 3H5YA 4CHNA 1HNWJ 1P8GA 4XH1A 4CNQA 1LOUA 3M4XA 3EDRB 5HATA 1VC5A 5EVZA 1B4SA 3MAAB 2ZJPQ 3PMLA 4K59A 4ZVHA 2C2ZB 3BZKA 2DO0A 2DFHA 3K9KA 4LC9B 4YB1P 2VIHA 5CYMA 3OPXA 5AI0A 4DCJB 5HN0A 2E1RA 2YNFB 2HHUA 5AJ3J 1F3FA 3EXYA 1PJ7A 2VG7A 4LRBA 5ALTA 1FRHA 1PYSB 4O3OA 3B6PA 2LYHA 3BM7A 4F04B 2WHEA 4M5IA 3FYHA 1YJVA 3BB5A 4QZFA 5K5MA 5G0RB 3GE1A 1FEZA 4KV8A 3J7YU 1R8PA 4BC2A 1ULRA 5KFDA 3JYTB 2D0OA 4NLCA 3D1HA 3OXGA 1EQYA 3MK6A 1GOBA 1JXEA 2ADCA 4FYDA 3DI6B 2RLTA 2XICA 2Q3SA 1NK5A 4AILC 1TP7A 1ASUA 4Z6FA 5LXRA 4BC3A 2W8LA 3PO5A 7ICKA 1KC8T 3PR5B 1SJFA 4BC5A 1S8OA 3T1AA 1N32K 3V6DA 4MHVA 3OVBA 2OFGX 5HVHA 3PSIA 3MDCA 3C6UB 5CZ1A 4RR5A 3BR9A 2GWKA 4UARA 3O9SA 1M5KC 5J2KA 5L9NA 4IR9A 3B8AX 3OUYA 4E2FB 1V85A 1ZBUA 2ZH1A 3QSYB 5J2MA 2W9CB 4RBVA 2O8DB 3OQ2A 4DWIA 1FJGK 3CJTA 4A61A 3AB2B 4KLTA 4CLPA 5I3PA 1N0UA 2RQCA 5CA5A 9ICJA 4CGIA 2CKWA 2EW9A 2WOMA 2W6LA 4JYAF 2W2MP 1NKCA 4JI2K 5KFSA 1RBVA 2EZXA 3LVWA 4C4RA 3IM1A 2DT9A 3VCDA 4M9LA 2BOAA 2XS7A 4WJBA 5SWMA 3C29A 4B3MF 4CM2A 5AQSA 3W5XA 3UN5A 3WXKA 3A2FA 3FGVA 4X4TA 2H3VA 1WKLA 1CJTB 4Z2XA 3AVGA 1MMNA 2G5IB 2R4FA 3H1QA 3RUBL 3RGIA 3MM9A 4UOGA 1WDTA 4KH6A 4W4MA 2GIRA 1WDDA 3AJ2A 1TKDA 2EWSA 2BCUA 3L5KA 4X4PA 1JJCB 3EKSA 1C2PA 1JXLA 3THYB 3DAWA 5J2FA 5HRRA 1VK0A 2AMCB 2HQIA 3OYCA 1X7VA 5AQVA 5D4NA 2ZIVB 1OS5A 1FNMA 1BPXA 1VIXA 2ZBRA 1T3VA 3KHHA 3NKYA 4R0EA 4ZVGA 1WF1A 4WFAL 2PMZC 1X66A 1UPHA 4Q2LA 2OCEA 3CCTA 1SXLA 4I7FB 3Q8RB 4QR0A 2DPNA 3EPIA 3VAIA 3IRXB 5D6GA 2PN6A 4USJC 4Z94A 4B9UA 1T02A 2YNGB 2J6SA 3D6FB 2DBYA 4CLLA 2HVHA 3TTFA 1EKSA 2ZZMA 3LALA 3VESA 4C3LA 4KGZB 4CO2A 1NJYA 1BHNA 1GAOA 2LP4A 1ELOA 2R2UA 2GX9A 3FZFA 2XHCA 5H9EK 3B4DA 3ZX2A 4JI7K 1J5EK 4DU1A 3MWPA 2UXDJ 2ZNZA 7ICRA 1LWFA 1HWIA 4K4ZA 3UXOA 4JV1A 2VV5A 1WEYA 3MGIA 3LP1B 2IVNA 1FE0A 3S6EA 1X4CA 2RN2A 4OI1A 2OTLN 4NL9C 4KTZA 5LY3A 2J5AA 4BR9A 2NCKL 4WYLA 1TAMA 2DIVA 2R8KA 4DSKA 3WNEA 3H0MB 2A1JB 4Z4FA 3G6XA 3I9V9 1Z1BA 3B6BA 3KKSA 3FE1A 2P9LA 4DR1F 2X1GA 5KAKA 1RCXB 2OPQB 1FK9A 1S1TA 4IDKA 3KKAA 3EUNA 3WQTA 3O08A 1SQFA 1VDHA 9ICFA 3PUFA 1F6TA 4CH0S 1A5WA 4IOAL 2E1ZA 1TYQB 4FOIA 3KKFA 4N8OA 4JI8F 2XY8A 7ICUA 2A0FB 1N56A 3QZ7A 1J97A 3Q8KA 1EARA 4KGXB 3F5AA 2JR5A 2B6GA 2M5YA 3NHGA 4CBXA 4GV6A 1LKYA 1YJ9N 4X4QA 3W3DA 3TFRA 2IMOA 2VD3A 4CJUA 3LWMA 3WX8A 4AHRA 4YY3J 2PFNA 4K8XA 3IG5A 2HWHA 1SPBP 4LSNA 5AQWA 3OYJA 2DR9A 3AVFA 4ZP6A 4OLBA 3H42A 5GIOA 3QICA 2ZH6A 4H0VB 1NGJA 5J0PA 1PVRA 2CPZA 5GINA 5CD4A 4FBTA 4M47A 1S6QA 3L8BA 4JKHA 2VBZA 2KQ2A 1LWXA 2KHQA 2A3ZA 2FSNA 5ALRA 4CGJA 4UTGA 2I9SA 3U1NA 3ENOA 1RA7A 3MCSA 4MH8A 1C0MA 3HLUA 3CMES 1SJQA 2I9GA 4KHMA 4NA2A 3W9IA 4DV7F 1QLNA 2P9PB 3F2BA 5JTIA 1KVIA 2XHWA 1VRQC 3DGPB 2CJ9A 5KG1A 2LDYA 3MCMA 1KQSM 2ZZNA 1NEEA 5DDOC 1V38A 3WXIA 3BYRA 5CHGA 2HBRB 2F7VA 3B9JA 4ZCKA 2E5HA 1IG8A 3PR4A 4LR8A 2ATCB 2GBZA 3ADAC 4KHSA 1A9NB 4WJ3B 5C25B 1T05A 4QIEA 7ICGA 2HZCA 5KOWA 3ZSVA 3GJTB 1WUUA 3CFRA 4YMMA 2GH1A 1KHVA 4YDDB 1CBKA 2FY8A 1R8HA 4I2HA 1ZQQA 1P27B 3DLKB 5LT5A 2EZYA 2HHQA 4J8FA 3DOKA 3C15A 2KYZA 3HHLC 2P66A 2QWOA 4Z4GA 4PJ0U 3BPSP 1KQKA 4G1QA 4YUDA 4DV0K 2VFTA 3IP0A 3LPTA 3UN2A 7ICHA 1RT6A 5K14B 4DSIA 3ZT3A 2BDUA 4DV2J 1Z26A 3KDOA 1ZQSA 3GZFA 2W55A 2WMMA 4O0IA 4DUYJ 4EBDA 1WEZA 2CGKA 3POTA 1YTAA 1TAUA 1YJUA 4AL5A 3HT0A 3FBEA 2MGZB 1NU0A 4BC4A 1V5IB 4DR5F 4NLQA 3EX7B 2ZOGA 3P5JA 3BQTA 3WC2A 4I2DA 1KNZA 2DGUA 4C3KA 5D3GB 1U4BA 4ECUA 1D5AA 4ED7A 2AEJA 3JQJA 3UDVA 1Z2ZA 2W9BB 4KFBA 5K8NA 1UP1A 2G1HA 4X62K 3RJMB 8ICBA 1VQ4S 4DR2J 1YZ6A 3CNHA 2FLNA 3H2VE 5CZVA 2YKMA 5GAGU 2FSKA 2L08A 2K06A 1FXDA 1NHVA 2KG1A 1JI7A 3ZTSA 4M3RA 3ZEUA 2AT1B 3W5ZA 4WQ5C 4GKJF 3G25A 4BR0A 3L3CA 1PIEA 2F2AB 3EWGA 3DRYA 3DNCA 2W4CA 3HKZD 3WXMB 1X4AA 4MK9A 3G6ES 5D46A 5E0OA 2E5LK 2F4FA 3RAMA 1RPLA 2HMXA 3EEQA 1F60B 1RDBA 3G4SN 3RVCA 1P9QC 2P9SA 3SFGA 3F73A 3MFHA 3TA0A 1PBUA 3G86A 3NRZA 1RBAA 2BABA 1RADB 4OZ2A 1CS4A 2CGJA 5IT4A 2BJ7A 3A5NC 3IAYA 2AQ4A 4Y2SA 4NY8A 4FVCA 3QRRA 5FLXO 1UVLA 2DVIA 1O0PA 2F4VF 3AT1B 2VCPA 2G07A 3V72A 3T1HF 8ICIA 4ERDA 3K5NA 3VPZA 1IKWA 1U1MA 3FMWA 1RYSA 5BR9A 2IHMA 2ZXHA 2FTRA 3EVWA 2F8MA 3UVJB 1VJQA 3O5BA 4CJQA 8ICTA 5ALJA 3DDKA 4LRCA 1HYSA 4NM2A 1X8DA 3O3LA 5MLCV 1Q8KA 2E1FA 5E5NA 4RW6B 5C42A 4WQ4A 2W54A 3UNGC 1JROA 1WACA 4XH4A 4KPYA 4K4VA 2MLZA 3M1FA 3H8YA 4OI4A 2B6AB 5D0RA 2PD1A 2HQCA 1PK1A 2XTJP 2VF3A 3AEVA 4RW4A 2F1FA 2CJQA 3DLHA 3QGPA 3LP2A 2UXCJ 4LY7A 3PMNA 3AU2A 2FBYA 3AO4A 2KRBA 2CPFA 2ZZTA 4AXJA 4FWNA 3P5BP 4X64K 4F36A 3MXMA 4U96A 1HR0F 4RNMA 1DTQA 3C16B 4NE9C 2OKQA 3DEEA 2J0SD 3TABA 4B9VA 2HRTA 3TPQA 3CCJN 4GVMA 3BKTA 4H0XB 4RU2A 4NLRA 4RBUA 3MECB 4J9RA 2DNOA 2H5EA 1DRGA 1X1PA 3ZT0A 1PILA 3OTEA 7ICSA 3M30B 3AN1A 4I2JA 1W25A 4NYZA 2AGOA 4ES1A 1R3NA 4U95A 4CJ7A 4KH1B 1VCTA 5DKWA 2E9RX 4DR3J 2X6SA 1F44A 3IR7B 2Q31A 3ZZZA 1XK8A 3I4HX 3QO9A 3AA3A 3VEYA 5C2GA 3GSIA 1S7HA 3CP8A 1P6TA 3VQQA 4HT7A 4NMXA 2QI2A 3QEWA 3MR5A 5BYSA 3OVNA 3R9KA 1VC0A 3T1YK 5TISU 1K47A 4OZNA 4ZDNA 3CJBA 1UHUA 3PTWA 3BBFA 4K0KK 3TANA 3FCHA 1MWQA 3TA1A 1NMDA 4M3YA 3H40A 3I6PA 1NJZA 4LF8J 1Y7PA 2H65B 3A0IX 3TTCA 2KKVA 1ZS6A 3D1OA 1PJ6A 1W0HA 4ISGA 4DG1A 1KN6A 2X78A 3QX7A 2UUAK 3ALYA 3H2UB 4CEDA 1A6LA 1Q8IA 3IGVA 3DYAA 4QZDA 4C97A 1S9FA 2H3ZA 5ALPA 2DHAA 4C0OC 2HOIA 3PIPQ 3BGRB 4LF1A 2LCWA 4PHPA 3WK5A 3G82B 3LOUA 5DO2A 1C1CB 4TXSA 1I51B 3UWTA 4ZJLA 3LZIA 2C3PA 1VI7A 4DPTA 3EY1A 4QCLA 4M3WA 3KLHA 3AV9A 1S48A 3AA2A 2NYHA 3OT9A 5J2AA 1L3KA 5J2QB 1MLAA 1VQON 3TEGA 3PRBA 2P9UB 4NL9A 5CE3A 2HEKA 3RMCA 2LFVA 3M2UA 5AKKA 3NMRA 4TUQA 3KYLA 3WC0A 2A6OA 3H5SA 4NYNA 2RHFA 2GIFA 1YVFA 3MC1A 1CC8A 3D2WA 1GLFO 1TL3A 8ICVA 5RUBA 5J2NA 2RQMA 5B0BA 2VH7A 1V9OA 4DF4A 3MMJA 4RW7B 5L8RC 1ATRA 1N36F 4LIWA 3THXA 2OEMA 2NUHA 4FWPA 4CO4A 2XO7A 5AKXA 3CJ4A 4K4UA 2H3EB 3AY0A 2MKHA 4CLWA 3NGZA 3MEEA 4KGVB 1YBAA 2JZBB 3PJ9A 4FJGA 2HLUA 3VZHA 1QZ6A 4WXWA 4IQMA 1HWUA 5HLFA 1HJOA 3NS7B 2VQFF 1C6VA 4LFBK 3KJFB 2CQBA 1GH8A 4O3PA 4B9MA 4L75A 4IG3B 4QW8A 4OYAA 4BVOA 2KYXA 1Q3VA 5IIIA 1VHIA 4LF5J 3QBXA 3HP6A 3OHAA 1DLOB 2Z1IA 1RDWX 1D8YA 2NNWA 1ZZFA 3AXMA 1WC3A 4OPJA 4I2EA 4KB7A 4WF9Q 3UD3P 3GIJA 2XM3A 4HH0A 2D7SA 1S1WB 1N61A 1ZPWX 2J6TA 1YRTA 4HDGA 1FDNA 1NPKA 1YF5L 1TUYA 4CZGA 4JI1K 1OQ3A 1QE1A 4I4BA 1K44A 4OYOA 4CTAB 1QHTA 1ASWA 2GGPA 3Q24A 2ZE2B 2UVWA 4QIWC 3SQ4A 3BS9A 3JPOA 3TADA 3WQPA 4IO9L 2QK9A 3M05A 4DSJA 2ZH4A 4AYBD 4OKKA 1N33J 1XNRF 4OYPA 4BACA 5AR0A 3VQ6A 5A2QO 1RBOB 5J2PA 4BRPA 2MSTA 2CDQA 4B17A 2ZJPL 2Q0UA 2H3GX 5EOYA 2YX6A 4M6WB 4YVZA 1IR1A 1ZTTA 4UOFA 1UEKA 3LGMA 5IIJA 1RBTA 1N8RT 4FPAA 1ECWA 4P10A 1ZBHA 3NCPA 4CESA 3VGKA 1BISA 3I96A 5KG5A 3DXMA 3EN9A 5AM1A 3DLEA 5BR8J 2ETJA 3EGNA 2DEIA 1VYAA 1IBKJ 3L3VA 3N4WA 3N0VA 2VG5B 1QQ7A 3TTDA 1JL1A 4F4YA 2R7XA 1FXXA 3T9ZA 4IWVA 1NGFA 1ZQAA 1MMLA 2E1CA 2CPXA 4B3TK 3NY0A 3OVAA 2ZJAA 4U7UD 2A6MA 3ID6A 1N48A 1HYVA 5F3ZA 3DLGA 3FZ2A 1TL1A 3IBCB 4LBPA 1FKOB 2JH7A 3TUJC 4IOCQ 4F3MA 4F0MA 5G5GA 3WDOA 2D0CA 5CABA 3QT6A 1IG9A 1KEJA 2ZXIA 2U1AA 2IVPA 3KG0A 1S6PB 3OYAA 2FJAB 4CWBA 2LXFA 3VEXA 3K58A 3EM1A 4FLYA 3HSCA 2A10A 3VQCA 4CO5A 2BCSA 4RTFD 2C42A 3ZSZA 8ICEA 1FF2A 4MFBA 1RG6A 4DV6J 1OIAA 1Q7YO 1WORA 2R2TA 1BIZA 2AQ0A 3V5RA 2YPZA 2QV6A 4P2MA 3GYNA 1VQNN 3C6TB 3IWNC 4USAA 1F9HA 4DL2A 1QUPA 2PDAA 1KXPA 3PNIA 2A5XA 4IXCA 3SBTA 2FZCB 4LF6J 1RDRA 1RT1A 5KAFU 2W7AA 3TQ1A 3CE8A 3MN5A 5KFUA 3I8BA 4DO9A 2IM0A 5I3QA 4I6MA 3ZXWA 4MF2A 1BCOA 3MR2A 4FJLA 4W5TA 5J1NA 3ZLJA 2QC3A 3KMQA 2LLZA 2IJFA 5C0YA 5AQNA 4MDAA 4DN9A 3TUZC 1GEHA 3VQPA 2QA1A 2RD5C 3SCKE 4I67A 4P4PA 9ICLA 3SPYA 3HMJG 3QBCA 2KE7A 2Y1IA 1U6FA 3SQ1A 5IC6B 4LQ9A 4HKQA 3BUZB 3KJVB 3BN4A 3VZIA 1WJ9A 1N5XA 4KLLA 3Q86A 1VQYA 2VFSA 1UAXA 5HROB 3HVAA 1LW0B 3OY9A 2YQ1A 2BJ8A 2HGNA 2PSZA 5IZHA 4AD6A 2ZIUB 1NKBA 1Z1ZA 4UB4A 2QLXA 3AQEA 2WVDA 4NX9A 5KFVA 2U2FA 4DV5F 3M2VB 4BR4A 3UE5A 2KG5A 3OXLA 4FJ5A 3N4QA 4CFCA 1SC3B 2EFPA 5ADXA 2EHGA 2ZH7A 1X9SA 3UIQA 4F4AA 2EFOA 3CO9A 3RMBA 2BJ9A 3K1RB 3QGIA 5BYQA 1QQMA 1NRKA 2COLA 3KG1A 4ZVOB 4MFAA 1TV6A 5DRKA 3PO4A 3OFFA 2VDIA 3DGVA 4ZCMA 3BSAA 1OO0B 5DDRC 1G99A 5F3XB 1ZJMA 3S7RA 4XUSA 4GO7X 2WZ1A 4BCAA 4PYAA 3AVMA 1MWMA 1VQPN 2HPUA 2GWSA 5HK4A 3EE9A 1FIQA 3A12A 4KHQA 4ZH4A 3ZSQA 4PG8A 4QOZB 4K5SA 2UUBJ 3IKMA 1MQ2A 3O4WA 2M9KA 4CLKA 3HKWA 2X6NA 4B1YB 4NLXA 2D5RA 1UJ5A 3CPEA 1FO1A 4KLJA 2YHXA 4JRPA 4KAIA 3H0LB 5CHIA 3D0HE 2VC0A 4NCGB 4R63A 2WRMA 2HBZB 1P8ZA 1U0HB 4DV3K 3Q8LA 1LWEB 4UB1A 5IOLA 5HQMA 3LZJA 3IUCA 1UPMB 4PXCA 2R9LA 4AHVA 3M5RA 2CJXB 3GV5B 5IWAJ 2QWNA 2VZ9A 2NV3A 3O4NA 5EX0A 4M5DA 1HBMA 2VWBA 2CNNB 4US9A 5M1NA 2YNHA 2BGGA 4DV4J 4IH5A 2VPYB 4KKOA 4CJ5A 3FZMA 2JWKA 4BRCA 1NK8A 4KRWA 3VENA 2HBLA 5L46A 4HHUA 1WSIA 3W61A 3PIOQ 4IJNA 1JX4A 1VSMA 4F5PA 4RQ4A 2C2EA 3L09A 1HNXF 3H59A 3WKBA 3PSTA 1R31A 1HHTP 4B3OA 1EETA 4YB6A 4Y2MA 2MAXA 3T69A 2DHGA 1BE4A 4CLZA 4WU3A 1S10A 3UMBA 2HF3A 1CZ9A 3OYDA 1SV0C 4IG0B 2CRXA 3WZ0A 4FLTA 3TSPA 1DQ9A 3V7JA 1NDKA 4L3QA 1GK8A 1RAEB 3W3SA 4CK2A 2OEKA 4LRDA 2C3OA 4G1PA 1F5SA 1IXKA 5AKEA 3NL0A 2FLLA 3V2UC 1RAHB 1SB6A 5KI6A 1JLCB 4YEAA 2UXDK 3QFUA 3ZNUA 1D3WA 3TVZA 1I94F 2RQKA 2A1AA 3HRGA 1WWHA 4FWMA 4WE1B 4I6AA 2KHDA 1NGIA 4ECSA 1B9DA 3GZ7A 2A1SA 3E01B 4BXOB 2XMVA 5I9EB 3E9PA 3DRXA 3T6BA 4OX9J 4EWTA 2G2ZA 5DB6A 4NZ0A 3CCVS 4B8AB 5IXUA 3U3GA 1IG6A 3WNHA 4IRKA 2OHDA 3V6KA 2CIMA 2GVZB 5KFHA 4LBHA 4YD1A 4ZJQA 3C2KA 2NUUG 2B56A 1A0PA 3TZZA 4M63C 3JPSA 3FGUA 5ALDA 4Y2VA 2AH5A 2IVFB 3I1YA 5KOXA 4AUKA 1BQNA 3D2FA 2O8CA 1OPIA 5GIPA 4JBCA 3T7ZA 1ZBSA 1NSQA 4F3TA 4BRMA 3SEIA 1ZQIA 3HOTA 1HWKA 3G9CA 3PW4A 3R3TA 3DMJA 3RJIA 3CM6A 4FM0A 2L3MA 2R18A 4DS4A 1K8AT 4JI6J 1RXOB 4YY3K 1JKHB 2ZM6J 2DGZA 7ICVA 5DS7A 5ETVA 4W5RA 1NXIA 1HKAA 4AL6A 2F9WA 5DZ6A 1T7PA 2M3DA 1RE1B 1FNOA 3CQ8A 4C98A 2WF8A 5ALNA 3Q8QB 4NA3A 3SIPB 5BN8A 1YQHA 4J9NA 5KT4A 3NGRA 3HTVA 5HJXA 3BF3A 1ZQLA 1EKEA 1KOHA 2HVDA 3US5A 1M90T 3ENWA 2HOFA 1B99A 3OW2R 4BR5A 1PKUA 1FERA 5ALMA 2NXCA 2FBXA 5FP0A 3PKMA 8ICXA 1BA1A 3NVWA 3TAMB 1TTHB 1JLFA 2QTWA 4CLTA 2IAJB 2HNZA 1YUWA 3CJSA 4I56A 1X42A 4BRDA 1SIZA 1KCFA 4JK9A 3SAGA 2FHMA 4Q45A 1KFDA 3VOVA 3DOMA 1WG1A 3EZWA 3ULHA 4JI5J 3KLGB 4IEEA 4I6WA 3ZTRA 3DLLQ 4V1Ak 1WWVA 4QW9A 2V2VA 4MKYA 1N63A 4I2FA 4X66F 3B8HA 5HANA 3LM2A 4H5VA 2MDAA 3JAMO 3P39A 2OTJS 2KHOA 1NAQA 4ZVQB 3EYZA 4QPTA 3KWIA 5DB7A 4NO7A 4FM1A 4DL6A 2VQEK 3LDPA 4M41A 3J7A1 4YMEA 2ZHBA 4DV2K 5CYMB 4J37A 4DFDA 2E6LA 2CYYA 3MCPA 3BSNA 4CIOA 1NGDA 2JGAA 3U26A 3GU0A 1IBCB 5J2DA 4FZYA 5L1JA 4V19X 4AE5A 3RU0A 1MU2B 3Q8YA 3CXCR 4DUYK 3KDNA 2ACYA 5ETKA 3NDKA 3KLEA 2B9XA 4KLUA 2YJFA 1IH7A 1SCJB 1T9XA 4KV8B 2ZJRL 2NLWA 1XMOK 3WKAA 4EMDA 4NASA 4R64A 1Y5NB 1ZZNA 3NBPA 3UQ0A 1RWNB 1QVGR 1S9EA 2HYIB 4UB8U 3FQKA 4WCEQ 1YHQS 4BS2A 4TLRA 5KT2A 2F8TA 4Z6DA 5BREA 4CJ3A 1W9HA 1X60A 4U67Q 5KTQA 2FJXA 3V6DB 5AKGA 4FZMA 4YOWA 1V3ZA 4Z4HA 4MN4C 1L7OA 4I27A 2BUNA 4DPXA 3UW1A 3CQXA 3IV6A 4KR0B 3TWHA 4Y2YA 3AA8A 4DUZF 5M1FA 2ZC3A 1IQTA 4CFAA 3OUYB 3GE9A 1OH5A 1SB3C 1JQGA 2OAUA 2MQ8A 3SR6A 3SQ2A 3ZSWA 1O8BA 1TGOA 5SUHA 3NMAA 3H8SA 3GIIA 2WOMB 4H5WA 5A8RA 2W41A 3IN5A 4FF3A 1SQEA 1YK9A 2EWHA 1RTDA 1NK6A 2LMRA 4JI4F 3PSFA 2QL5B 1BQXA 1X5OA 3CMEN 4BRHA 4NV0A 1X9WA 3CJ2A 5LL6Z 4M3ZA 4DL3A 3GSDA 1E3MA 3I9ZA 2ZH2A 3IFEA 4JEPA 2DCLA 3VGSA 5IS2A 4J03A 1FI4A 3RH5A 2KJVA 2MZRA 1YZ7A 2YMQA 3C65A 5F9LA 1RT4A 4ZTJA 3KVGA 4R65A 4W5QA 3HJEA 3OL7A 5DDPC 3CF5Q 5M2PA 3TR8A 2MY7A 3D6HB 4LFAJ 3W9HA 2QW9A 3MM9B 1S5ZA 2R7RA 1FFUA 4PABA 3K0SA 1H73A 1RI7A 3THWA 1IVZA 4C7QA 2DGXA 3MEGA 2OJ3A 4DU4A 1PAEX 5AQZA 3WHIA 4X4UA 3VQ5A 1HD0A 2VJ5A 4CJFA 4J7CA 4NLBA 3O44A 4DHVA 3UXPA 1HMVA 2Q2RA 1S4FA 3JSMA 3CCMS 1SL1A 3IP4B 4NYPA 4CH7A 1XNQJ 3KJQB 3L4PA 3VC8A 4QZGA 1HNIB 2RAQA 4QJVA 1WC6A 9ICKA 3C95A 1FRKA 5ALVA 2HMPA 4M42A 2LEBA 4ACOA 2YX4A 2UXCK 2EFGA 1T03A 3IM8A 5A8WB 3D4JA 2HS0A 4QZCA 3BO3A 4DX7A 2KI2A 2BYCA 1R8AA 4UY85 5KT7A 4CJ4A 4CZHA 2W4PA 1Q86T 1WSFA 4QIWF 8ICSA 2F8LA 4YR2A 3NCIA 5D15A 4UUXA 5L1IA 1PK3A 1J2VA 4ECVA 1WI8A 2KIVA 5DM7Q 3H5XA 4Q44A 3H7IA 4QNLA 3EW9A 4NLOA 4NXNK 9ICPA 5E3PA 2O4IA 2QB0A 1NH7A 3CCES 2HSZA 3HHDA 4DR3K 4ZPWR 1IBMJ 4BR2A 3VMFB 2V94A 3LDAA 1T3NA 1LWFB 3CD6S 3K5MA 1WYGA 1RNHA 4KTWA 4I7FA 5KL8B 3DXKA 1RBRA 1VQ4N 2XYGB 2Z7JA 2BRKA 3RJFA 1NK0A 2MY8A 4FO6A 4L6V3 4H4OA 2B4JA 2A2CA 2AWZA 4DLGA 4AQYK 9ICVA 2EK1A 1B92A 4DV7J 5C5JA 1L5UA 4HLBA 4CECA 2X3GA 2P9LB 3OJSA 4CRJA 2VKZG 1SGGA 1F5AA 1ZA1B 5THWA 3P1GA 3CDBA 1WG4A 1S1TB 1I5OB 3G6EN 1U6BA 4IDKB 2Q43A 4KT0C 3J7ZO 1GXTA 1V4SA 5K4LA 3BGLA 4ID5A 3CIPA 4UBCA 4M7XA 5CZ2A 2V4RA 5IIOA 1SV0A 4LF7K 7ICTA 1BMQB 4LRAA 4KLQA 3H3OB 3Q8PB 1L3VA 9ICIA 3HZ6A 1URNA 4P74A 4URQU 3L3UA 5LMUK 5KRTA 3QE9Y 1LKYB 3K4GA 1FA0A 8ICGA 3OL9A 1BUPA 1TFWA 5F2RA 1RT5A 2HOQA 4M45A 2BPFA 2AP6A 3R2CJ 8ICMA 3SUOA 4LSNB 3V4MA 4C8OA 2B4VA 1KTQA 3A3NB 4KI6A 3TU5A 2GJ2A 4O5CA 1S9GA 3RWUA 4LF9J 3PZPA 1TL4A 1SJ4P 1AROP 4MYTA 1VSIA 2Z57B 1S6QB 5BOMA 2FI1A 3V6HA 2CA9A 2MKJA 2VU5A 4WYBA 4X65F 3CCRS 5GAEP 1YRUA 2RU3A 3LQVA 1Q8BA 2FY1A 3ISZA 4PH5A 3AHPA 3H5UA 2HK2A 2JDJA 4OYXA 3CCUS 5DJBA 1XN9A 3MM8A 3PDNA 3OTQA 4W98A 2G0JA 2YH0A 1BPDA 5KRSA 4QWAA 4DV1J 2HHXA 3VQAA 1UQVA 2B7BB 1HQEB 5J2EA 3MABA 5HVFA 3SFUA 2PYJA 5L38A 2WF9A 4RPXA 2FC0A 2QTDA 4B6JA 2UP1A 2ZITA 1GLEG 2FGOA 1REVA 1U2RA 3ILIA 4OJ1A 4CIEA 2D3O1 3R7SB 2FJWA 1NJXA 1T05B 1QQNA 1NGGA 2DCUB 1RT3A 4W90B 2QO3A 5B09A 1J6ZA 4ZITA 4DTOA 3R6LB 4C8NA 2OZMA 1MDUB 8ICZA 3WT0A 2DWQA 1JCGA 4YR0A 2JV3A 2MRLA 1XNSA 2VPWB 3PW5A 1GX6A 4WTYA 1WB9A 4G3IA 4HAIA 3NGTA 4KHYA 3DOKB 4I2QA 2YX7A 3C15B 2IM3A 3JTPA 2B7CB 4KB0A 4FF4A 2RRNA 4G1QB 3QFWA 3F2KA 3RJJA 4RWWA 1D8ZA 2K4IA 3QEIA 1RT6B 3DHWC 4LJMA 4PY5A 2HAFA 3RB4A 3I28A 3LP3A 2EKYA 5C25A 5ETSA 3E8OA 3M2RA 3LTOA 1NHKL 2JC1A 2LDIA 2I5HA 2BTFA 1C4AA 1S6OA 1N33K 2KG0A 1ZBFA 2FC8A 3POTB 3SUNA 1KR4A 1YJTA 4K50A 1VLBA 2E7XA 4CDIA 3UKRA 3AD7C 3RR8A 2W40A 1YBTA 4F92B 3MOZA 4KC5A 4HUEA 2ZJQQ 3MX5A 8ICOA 4NZ7A 4G65A 1BXNA 3M6ZA 2BQ3A 4XRHA 4A5BA 2BCVA 3P83D 5B8HA 3WK4A 2AEFA 4AFFA 2PO4A 2G0AA 2VICA 2QYGA 3FFIA 3OA9A 2D9OA 4KFBB 5BR8K 4M9JA 3I0SA 2QFJA 4J9MA 2Y9TA 4NA1A 4OI2A 9ICTA 1IBKK 1RISA 3NS5A 4DR6J 4PWDA 5J0SA 2YKMB 2H3QA 2AYEA 3UCZP 2OSRA 1LAVA 3FBFA 2QFIA 3PG9A 2PFUA 3CJ1A 3C46A 4J9OA 4ZHRA 3QERA 1JMSA 2EC0A 3ZEUB 5KFYA 5AKYA 2KU7A 4O9MA 4KRFA 4TYBA 4CDGA 3LO3A 2MGZA 4ALZA 3QUQA 1A5XA 3T5HA 3W7BA 2H48B 3HZGA 1VSFA 1VRUA 1NSKL 3J80O 2G2OA 2LSNA 3HL8A 5LJ5Y 4IH7A 5ADXH 3CD5A 2CQ2A 1YITN 2UV8G 2P9SB 4AM6A 1GLJO 5D77A 3NVVA 4TVAB 4KHPJ 1CS4B 3CJCA 4LREA 1HD1A 3ZETA 4C7YA 2EG1A 3R3LA 1H38A 3DU6A 1VLOA 1U2CA 3TR5A 3J81j 3SAFA 2A6AA 2F9JA 1IKWB 3QAUA 4QWEA 3PFOA 3GFYA 4DU7A 1VMBA 3EE8A 4ECXA 3OPKA 3ZDEA 2LQ9A 3MCOA 1HYSB 2DXDA 3H4DA 1LB2B 4B1VA 4OYMA 4ZPAA 3ZTOA 2KHCA 5LSRA 2CPJA 1ILYA 4JI2J 2E8NA 2MKCA 5C42B 9ICHA 4LF6K 4JV5F 4E7IA 2BVZA 3GB0A 8ICYA 3QWPA 2JEIA 5JU5A 4KLHA 9ICCA 1PK1B 1MSWD 4RW4B 1LOTB 4KY3A 3LP2B 3C1ZA 2YHYA 2WVCA 1IQZA 4DCCA 2HBMA 3QU7A 3DFEA 3KOOA 1U1QA 3ZCMA 4CFDA 2QRRA 1DTQB 4RX6A 1N5YA 2NSBA 3B82A 4CF0A 1LEOA 3ZZTA 3CCWA 3ETOA 3H2LA 1U8WA 2OPRB 3OL8A 3KFWX 3AL0B 4MLHA 1ZQUA 1NLKL 4TU9A 3BP8A 4FN5A 1UT5A 4JWNA 2RMLA 4LZGA 4PHDA 3T79A 1MROA 2LQ5A 3MTKA 2BMBA 2J0XA 3QO9B 3CERA 3N6LA 3QNWB 4FVMA 1TKXB 4YOXA 1TL7A 2IBKA 3M8ZA 2BR0A 2GC8A 4ZLJA 3LA0A 4O44B 1SBRA 4ILHA 1JLAA 3AODA 3QGHA 2WTFA 5J1EB 4PWUA 5DG9A 2M8HA 5K8MA 4CF1A 2DH9A 4DTUA 3PJWA 2WSCC 2Y0SC 5JMNA 5T7BA 4NEZA 2YKAA 3SENA 3TJ8A 4FKXA 3J7YI 4RUHA 2B5JA 1L7NA 2XB2D 3ATUA 5IT9Y 5KFJA 5HBMA 4O0JA 8ICUA 3MN7A 1VSHA 3AQPA 1VSLA 2JH1A 3ISNC 4IL6U 4DG1B 1FWLA 3KUEA 4B08A 2ZH5A 2VQFJ 4M0AA 4NXMF 5GAEI 3MBYA 3DM2A 1YTUA 4JI7J 1J5EJ 5KFTA 5CR0A 3DYAB 3QINA 3DN9A 3W2VA 4I9QA 2MLXA 1N8RO 4RZRA 2O8BA 3TKAA 2HHHF 4BGDA 3VGVA 4FZVA 2XY5A 2ZOMA 4LFCJ 4YP3A 5IWAK 3NNCA 2B4PA 2FVRA 4H4KC 1BA0A 2DFFA 4F93B 1FFGB 3P49B 4HACA 3KLHB 3GL1A 2ZG6A 2HQ3A 3DV9A 1UFWA 1W2BM 4YMNA 2HBQB 1IWAA 3FSXA 2ZTDA 1LFPA 1ZOTA 4ZIVA 4ED5A 4N56A 1WF2A 5A6WA 1VQ5S 1WKJA 5HI7A 4LT6A 4DL7A 1IM6A 4DV4K 1M0SA 2C1EB 2YI1A 4F91B 3M2UB 3D28A 3THPA 3IHQB 2AJ0A 1WBBA 2EG2A 3TAQA 2ISPA 4KREA 1FFVA 4X62F 2V4JA 3VAHA 1TL3B 3PXGa 4ZPTR 3THXB 4GC7A 3DHXA 1XNRJ 3NGYA 2B21A 3QUBA 1H3DA 5TZVA 1EWQA 4YHHJ 4WFAQ 3ZX3A 4CZLA 1NM2A 3MEEB 4F4WA 4OIXA 2VBXA 4QJFB 4KQZA 4FLXA 2O5DA 4IEIA 4DN0A 5HLFB 4MKBA 5J2QA 5ETRA 1CXQA 2E88A 3K89A 1AYEA 4CI6A 2FDRA 4WKRA 4RPFA 3A8KA 2LM1A 2R7VA 3PYEA 2RUGA 2QT7A 3NRBA 3QQCD 4ETXA 4QIWD 3QESA 2HK3A 9ICBA 1Q81T 3U4LA 2RRDA 4FVUA 3Q7BA 1C7YA 1XO0A 3NOCA 4E98A 2H4YB 3ICXA 2Q0ZX 3M8RA 3GR1A 4FLVA 2E29A 4QIFA 4E8UA 4OX9K 2BH1A 3ZT2A 2P5VA 2VBYA 3WIVA 3PJXA 1UVMA 3AA9A 3LPEA 3JXUA 3V81A 1X9XA 1Y9OA 3SJJA 3RJHA 1QE1B 3I87A 2GGPB 3FVYA 2YN4A 2NZTA 1TKTA 1FW6A 2QMWA 2MKKA 4TQRA 1S0VA 3KK1A 3R7BB 2OSQA 2V5HG 2VBWA 3MEKA 5HRNA 2HGMA 1RYRA 4FLWA 4UW2A 4BUGA 1VBKA 4M9GA 1O51A 1R7IA 4CW7B 1UCNA 5J2PB 4JK8A 2V8VA 2WTUA 1C0UA 1UA0A 1FXRA 4X4OA 4IOAQ 3QLHA 2QKKA 4M5MA 1S4EA 2Y9UA 4PGYA 2R8HA 4JI6K 2CG8A 4PG6A 4CJLA 1WNEA 2ZM6K 4ID8A 4X64F 2GUIA 2E8PA 3AGKA 2P51A 2XWYA 3DXMB 3DLEB 1OMSA 4DR7F 4OL8A 1C1AA 3TX0A 2YKPA 1LXNA 2DHSA 2WBRA 1TAQA 3GPAA 2EQYA 4NZ6A 2FB0A 1DGKN 3QEXA 2ZBIA 1MA9B 3HP9A 3R9PA 3U3YA 1TQLA 3PRVA 2IM2A 5F8GA 3CJQA 2X1FA 3TARA 2DD8S 2FSJA 3DLGB 4WCEL 2M70A 4HCBA 4PKDB 1QHAA 4PAAA 1LV5A 1SIJA 1CQNA 2R8JA 4USVA 1C1BA 4BE0A 4OLPA 2VODA 4CEZA 3WUHA 3UE2A 3T1YF 1VSDA 2G8IA 4ZVSB 2GOLA 2ZH9A 2WVBA 4H0YB 5HHHA 3PYFA 2M9NA 4DV5J 2FBTA 3L7UA 2E7VA 3QYPA 3KOAA 1X4BA 2V68A 5HL7L 3E2EA 1NG9A 2FD2A 2HCFA 1OXJA 3A13A 1SZHA 3V9UA 5GAHP 4JI5K 1HHSA 1JNZB 4IOBA 1RM6C 2NRVA 4BRGA 2XG8A 3R1HA 4MFBB 5KG3A 3UD5A 4F71A 1R0BG 1T9WA 3E58A 4L76A 4OX7A 4FWQA 4KHNA 2B4UA 4FDFA 3VF2A 2A2DA 3M6VA 9ICUA 2E44A 2F3JA 3WKEA 2PAVA 2Z58B 1RT1B 1VK8A 1N6QA 3SBGA 4X4SA 3RFAA 4OPAA 1GQEA 4JYAK 1FJEB 1TUWA 3EL2A 3OTDA 5HQLA 1L3TA 4FJKA 2GUPA 4I6MB 1ZQFA 4O8UA 1K1SA 1Y00A 3AVIA 3FZLA 1RWWB 3CCVN 2Z2LA 1WNSA 3C2MA 2W03A 1M1HA 2FDNA 4DR4F 4I2GA 1KD1T 1RXWA 1VQMS 3RJEA 2BJ1A 3UO0A 3VQDA 3QNOA 3GFKB 3GDXA 4A8OA 5G4DA 2Y8WA 1F5CA 3IBPA 2PFFB 4M5GA 4ANEA 1KFSA 2DB1A 1F9EB 2NXUA 4BE2A 1RAIB 5BYRA 5IQQA 3FJ2A 5IT9U 3KZIU 1EAYC 4MQ3A 4KLFA 3M1VB 4ZLPA 1UEVA 1QDUB 5ETTA 3MURP 4CNZA 2Q79A 5E41A 3TNVA 1A5VA 3RYLA 1X2IA 2A42A 4UATA 2JLFA 4CP5A 3AA4A 4ZTFA 3IXQA 5KG0A 2JWLA 3ELHA 3RMAA 2HBKA 4WK3A 4X4VA 4DL4A 5H9FJ 2WC9A 1TV6B 2ALYB 2W9AA 1H7XA 4S0MA 3UKUA 1CULA 2MUTA 2GAGC 1RTJA 1LW0A 4H8KA 1RWVB 3GV7B 2CPDA 5EXWA 2VA2A 4CH1A 2L9DA 3ZFVA 3FC4A 1XMQF 2R8GA 2OYYA 3MI7X 1SKUB 4JKDA 4HEA9 3BGOP 4EENA 1S57A 2DXFA 2K8BB 3THTA 3I31A 3MPDA 4RUBA 4OZJA 2DR8A 3LANA 2QXFA 3QYYA 3O9UA 2C2NA 3UFCX 4YN4A 3GIMA 1MN9A 5H2FU 2HGLA 3QFHA 4K4SA 3EKUA 1HNZF 1BCMA 5GAGI 1BIUA 3UXNA 3ED5A 2IGIA 4DMZA 2P9KA 2OH2A 1GT8A 1QVGM 1L3UA 4NMLA 2MHEA 4O5KA 4K0KJ 4QZHA 4OPHA 3AO2A 2UUTA 2MA1A 3V9WA 1SC1B 7AT1B 4W92B 3EDQB 5AICA 4M5DB 3U8XA 1HBMB 4USMA 3C5FA 5KFLA 4P2FA 2CWKA 1VQLS 2YH1A 1XNQK 2YNHB 4RT3A 4KKOB 2KFYA 2ROEA 2DGVA 3JPNA 2YNIA 3ETMA 3M9OB 3DRPA 4OI6A 4NLZA 2HSEB 3WK9A 5A6PA 2OTJN 1CC7A 3RRGA 1B0XA 4DS5A 4E7HA 2F8SA 4MKVA 5C15A 3QU4A 1S12A 2KVIA 3BKUA 2PFQA 1VQ7S 1KP6A 3DRSA 4MTPA 4B3OB 2ZH3A 1Q7LB 1EETB 4IBNA 1X9JA 1NJWA 4OI0A 2G0IA 2DY4A 3S8SA 1W7WA 3V1RA 1HUZA 2XGQA 3VWSA 1YJWS 4U7UK 3D6TB 3E3XA 4PYDA 5HVGA 1Y64A 5AQYA 2VDHA 1BI4A 2MSSA 1FRIA 3HXMA 4G1IA 1GFWB 1S1UA 1JWWA 5AQKA 2MZSA 2NRZA 2BJDA 4JS5A 4F50A 1YHQN 3NS1A 3R5BA 5LMNF 3MXHP 1TUVA 2ERRA 5IINA 1CLQA 3QU9A 1L3SA 5BRHA 3KKAC 2YCHA 1HW9A 1NLVA 4GXJA 5U47A 1HBNA 2LMIA 1B0PA 3VF4A 4RNNA 2OANA 4DV7K 4LF4F 1RK8A 5C2FA 2K7KA 4BG9A 1X9MA 1NBEB 1HNWF 1ZH5A 1X6IA 5J0XA 4ED4A 3UB5A 3HSGA 5M2UA 3VGUA 3CC4S 4P9SA 1FRJA 1DURA 4O8KA 4WFXA 2HS4A 2MLYA 1BQNB 2BW2A 3D2FB 5FPNA 2O8CB 4MIAA 2P9GA 1LFWA 3H8WA 2EFVA 5M1PA 3HJFA 1PUZA 2EEYA 3P6YC 5AJ3F 4HTIA 4USWA 5LSLA 3WK6A 4FYWB 4QAGA 2BM1A 3EGWB 3DMJB 3GYGA 3KHLA 3D2QA 3L2VA 5C24A 2CPIA 2B8QA 5FLXY 2WVFA 1S59A 2D3ZA 4JI1J 4DOBA 1JMTA 2N3OA 3W2WA 3M6XA 4BX9C 1URJA 1NPPA 2B8PA 3F41A 4Y3CA 2PXIA 3FRZA 1P1TA 5H1SQ 1FX4A 3I33A 3W5YA 4KGKA 4DPUA 9ICGA 4KTQA 1JCEA 3MDFA 2VJUA 4IQWA 2XMAA 1FTRA 3QT8A 2LPEA 4IFVA 1J2NA 1E4GT 3ATVA 3O8MA 3CUNA 1QAXA 2LXIA 1KKHA 3CC2N 4URSA 3CCMN 5CA7A 2VKRA 1Z6RA 2E8MA 2V8PA 2WB1D 4UAUA 1VSKA 3KBBA 4NLGA 1N4LA 1EZZB 4FJMA 4QWDA 5D8HB 4DI6A 2Y9HA 2CQ3A 3G87A 4NB4A 2PYLA 1JCFA 2HFUA 2NRRA 4MK8A 2CPYA 4WFNL 1EIYB 5CHCB 1KEKA 2I6XA 5ALXA 1F2GA 3Q7CA 1JLFB 1WSRA 3MTJA 2HFNA 1Q53A 1V5VA 4KE5A 2HNZB 1FVQA 2CQ1A 4OD0A 1L7MA 4B3TJ 1DK2A 4F02A 3FSYA 2YB1A 1QQ6A 2G9OA 1BWVA 1SWWA 2E8OA 1MNEA 3NRWA 3DOMB 4PPXA 2VL1A 4ZCLA 4BE1A 1QTNB 2MEWA 2UUCJ 4F0HA 3O4QA 3UPQA 3CCEN 1OUQA 5L1LA 3LW5C 2DGWA 3O6QA 2W01A 1BU6O 3GQCA 2IPOB 3UCUP 3CD6N 4ZVTB 2ASPA 2RS8A 2FPMA 2CJAA 4IQVA 3AXKA 4TQSA 3M8YA 2DGTA 5AM0A 4NLTA 3AAPA 5KG4A 3NWGA 2AP1A 4QZ9A 3WXJA 1U04A 1EB0A 3MM6A 4KYZA 2X7IA 3NS6A 3GG0A 4IO9Q 2AF6A 3KLEB 2Y0SF 2KM8B 3MFIA 4O3QA 5JVGL 1N60A 4N47A 3QNNA 3T1HK 3AJDA 1QZ5A 2ZWHA 3ICLA 3NBPB 1ZQBA 1SJ3P 1E6YA 4JN4A 5KQ8A 3BBCA 2QN6B 1S9EB 4XPEA 1LAWA 3CRXA 4TKTA 2DL0A 3SV3A 3HSTB 4J2BA 3BV8A 2BRLA 2BKOA 4ELVA 1D4XA 5IILA 2HWTA 4DFJA 1JLBA 5ALZA 3R27A 4DR6K 1TUUA 3IBWA 4KHUA 4NLUA 1ZQNA 2OD4A 1DY3A 4RCHA 4Q8FA 4J2AA 3FZBA 1UETA 1MU2A 4RQ8A 3MOJB 4DU8A 2GQCA 4P75A 4B1WB 4ZP8A 3VAJA 4CEOA 2UXBF 2W11A 4Q43A 3NAEA 2ILZA 2N1RA 3VEOA 1NSAA 8ICLA 5AQOA 4I68A 1HR0K 2UXDF 1XIQA 2FUG9 4U6PA 5EWGA 3GFZA 1JN3A 5GAEU 4Q5VA 2E8AA 2IDOA 1XSPA 1JL2A 4GRSA 4L73A 4YB7A 5A8RB 4PXEA 3NNHA 5CZXA 4JKAA 5HMYA 3FBCA 3V9SA 1RTDB 3CCRN 2X74A 1JJ2R 4KHPK 1RU1A 2IJRA 4CO1A 1WHVA 4NCAA 3GR0A 3CWJA 2MXYA 3CCUN 1X4FA 3IAM9 1T44A 1S0MA 4F25A 4GIBA 5DM6L 4CF5A 2O8FA 4ZLLA 4YDUA 1KVCA 2DKXA 1RT4B 4J91A 3K5PA 4IYQA 4WQ4C 2K8AA 4MK7A 3FK4A 4NWIA 4F8RA 1VS3A 3IWLA 3VEWA 3AH6A 4F3QA 5L39A 3THWB 4TLQA 4DQRA 1D9DA 3ZDBA 3MEGB 1VFJA 3UDLA 2NRTA 1RCOB 4EYIB 4CD1A 4ZVFA 1KVJA 5J29A 4EX6A 4PHTX 5JLHA 4IC9A 4FFDA 1TK5A 2NPIA 1HMVB 1R89A 2Q1LA 1ZPVA 3JSMB 3TYTA 1IKVB 5IC4B 3BYPA 2I7PA 4PL2A 5IQ6A 4ZP7A 1H74A 2UYTA 2F8HA 3CJKA 5F1XA 4RNOA 4PWWA 5AXMA 1GXLA 1OSDA 3PNCA 1N54B 3QEAZ 1T03B 4FF2A 3I4PA 1LW2A 4BRNA 1V3RA 4DV3J 2GHPA 3C2LA 1PVQA 4EK2A 3LYSA 3BREA 4OZ3A 2R3VA 1H6KX 2H1YA 2IYIA 2R8IA 2P9EA 4RO0A 1H72C 4M3UA 2OELA 4UBBA 5AK3A 4M9NA 3H98A 2O4GA 2G8VA 4WTOB 2X3DA 2PA8D 4J9VA 3N01A 4ILJA 2KL8A 4M5HA 1RA6A 3ZZPA 5A2QY 4DFPA 4JK1A 3S6JA 1F1BB 1HNIA 3C66A 1XUPO 2W43A 4CHPA 4FWRA 3ITHA 2QB0B 3O2IA 4L72B 3ET6A 1H1VA 3UDCA 2KZZA 3KHRA 2Y1JA 2BX6A 2ASJA 2FPKA 3W63A 3T5JA 1L8OA 1DKGD 4NRUA 5KFMA 5A8WA 1T3OA 4UB6U 4HTJA 1UVKA 3TVYA 4EIAA 2FPHX 1DBDA 2J0QD 5KT6A 3A8EA 4DTJA 4DLEA 4J9KA 4B9QA 3DXKB 1WC5A 4KITB 3K17A 1IN0A 4O5EA 2G0CA 1M1KO 1OY8A 1S99A 4CHYA 2VB6A 1IO2A 5A76A 1R6YA 1WUAA 1N36K 3OTOF 1IR0A 4YDXA 4H4OB 5FLXU 1T4GA 5ALEA 4WKYA 2ZTCA 1EJ7L 4MIBA 1NNLA 2ZFHA 4WFZA 3GG4A 1NWKA 2ABYA 4QYZK 3HM9A 3L7OA 2VQFK 3MDQA 5J0OA 1JJHA 1NGEA 4F3OA 1U7LA 4C2MA 4ID5B 2P9NA 2NO5A 1JLEA 4N5SA 4CF2A 3OYGA 2DR7A 4CJSA 2OYQA 4GFJA 2AJ4A 3VGTA 2M0NA 2XULA 2Z56B 5T7LA 4YS2A 1FESA 4JRQA 2GFFA 3H0RB 3OR2A 4LFCK 1VGYA 1PYTA 3D54A 2CG4A 1U45A 4XPCA 1RT5B 3RZAA 3NGIA 4CEAA 2JGUA 2G09A 3HKZC 4AH9A 4UUWA 3VAGA 3CNQP 1S9GB 4W5NA 3HM8A 1N5VA 4Z4IA 4ZOHC 1UVNA 2KMDA 4QQBA 3M32B 3MMCA 2DNGA 1ZAVA 2ITMA 2J7KA 4RWTA 1FFSB 2HQFA 4DR2F 5HMWA 1XNRK 2XVTA 3KG4A 4FYYB 3OTCA 1PO6A 2VGNA 5LSOA 4PHAA 4RPYA 1MN7A 3MM8B 4Q7AA 4BG8A 1YJ7A 4YHHK 1KFTA 1EO1A 5KPRA 1JRPA 1SL2A 4ZOSA 4DKWA 4PG5A 1MWYA 4RNHA 4JD2A 1RQ0A 2FF6A 2AJ1A 4A8WA 4I2IA 2DNRA 3RF9A 3NH2A 1REVB 4ETZA 3MM7A 4DCPB 2NQPA 2CPEA 1Z19A 3NLCA 2DPJA 4TY8B 4XAKA 2WUSA 2NRWA 2PEBA 3HJVA 2AYGA 3CFOA 1M5VC 1RT3B 3KLFA 4OYWA 2CPRA 2HZVA 1B7FA 2XHBA 2ESEA 4X2BA 3K2YA 4LMZA 2J9DA 1FCAA 2XMKA 4Y2UA 1Q16B 1QM9A 1KN5A 3TADC 4I2QB 2IS3A 3VERA 3W8PA 1G1XA 1ESVA 4J5OA 2LQJA 2OEHA 4ZA1A 1NHUA 5AM4A 3SQ0A 3JS6A 1HQEA 2JNJA 4OZLA 4CF3A 1ASVA 3TWZA 4O5FA 4FNIA 1N5TA 4PZVA 5D4PA 3FSIA 1RGIA 1NNEA 3M2RB 5JMVA 1FJ7A 3N9UC 2E7WA 1UVIA 4KSEB 4JI0F 1NOZA 5CWRA 2QE5A 5AKIA 3UKRB 4CE9A 4BBYA 3A8IA 3AU6A 2J9CA 3MPYA 3CO0P 3E66A 4XQ8A 2UXCF 4E7JA 4A48A 4CRXA 5KG7A 4DPOA 4Y65A 2OXOA 2HFOA 4AHTA 1PC4A 1C0GA 4HUGA 3KKRA 3W64A 1N5SA 1H98A 2GHVC 3M8PA 5KFXA 2VQEJ 3FFIB 3VTIA 3I56S 2ODGA 4JKBA 3CT9A 3I0SB 4M5LA 2K4HA 1D9FA 4PWDB 2XI3A 4D3GA 3HI0A 4DOAA 1FE4A 2GVDA 1L6NA 3ULEA 4EHTA 4ZHRB 3GOIA 1HBOA 4PGQA 4JB3A 1VQ5N 1PJ5A 2E5IA 4DR3F 1XMOJ 3AY9A 3ETLA 1WOQA 5FIIA 1BWEA 1RWMB 3FAHA 2JFKA 4Y2TA 1VRUB 1U2VA 4NI2A 3PY8A 3DLJA 4F9OA 3FM9A 1EWRA 2R7TA 4R8UA 1Z4UA 2RVJA 5ALKA 4OJ6A 2DNMA 1Z2LA 3V1OA 3L2WA 4NOHA 1B0VA 1WEXA 4ZPBA 1UL3A 1G4CA 4Q0BA 1BNPA 2HVIA 4O3NA 3D6RA 5JLFA 2C2DA 4DV5K 2GMLA 3UQSA 3ZETB 4O4RA 4A8QA 3VQ7A 5DMRA 2AIRB 3D9BA 4E7LA 1KSPA 4CEFA 4LF8F 4OFZA 2WHOA 3RW7A 1NZPA 2HG4A 5DQGA 2XIDA 2HF4A 2N4CA 2EI5A 4KPCA 2LEAA 7ICPA 4CF9A 4KLOA 3ZI4A 3T41A 4H4MA 5AZJA 1ZQJA 4J9LA 4DL5A 4ER8A 3HVRA 1U25A 2ILYA 2WSFC 5GADP 1Z00A 2IA0A 3B0YA 1GX5A 2KH9A 1A7GE 4OJ5A 5D4BA 1TU0B 2P6UA 1NOMA 2MQOA 1ZD5A 4N41A 2PFPA 3J8AA 4BY9C 5A2QU 3R8YA 3SQGA 8ATCB 2WAQF 2MJUA 1PYOB 1XC9A 4RLEA 5GVQA 3RH4A 4LJXA 1KQQA 2HOEA 4CF4A 3HFKA 2BCRA 4QBUA 3GBTA 2HHPA 5J2GA 3NOGA 4ZN3A 1RT7A 2P6SA 4NXMJ 1WC0A 2D1CA 3RBXA 5AI5A 2OO4A 2ALZA 2APOA 2G2YA 2DTUA 7ICEA 4IRDA 4C0HA 3PLAA 1VSEA 3TSUA 1N5YB 1K0TA 5F8LA 3D7SB 4FL9A 1HNVA 2ATQA 1URRA 1IBLJ 4K4XA 4C8YA 3NH0A 2ZJRQ 3AVBA 4Y00A 3O9RA 5KT3A 3D0PA 5E3RA 3KFUF 3WXLA 2H3IA 1VHFA 3MGJA 3OYLA 5ALSA 1PGZA 5D78A 4UY8O 3HFZB 1U48A 1V3SA 4K8RA 4ZIWA 4Q2MA 5AQMA 1MROB 3IR5B 2JOQA 3I8DA 1G3OA 3ZTPA 2ZWOA 1W97L 4LF2A 3QPIA 4EEKA 1JLQA 1I3AA 1S0NA 2DKOB 5H9FK 1TL7B 2W1BA 4PXBA 2HNDA 3QWUA 4TUSA 1FDAA 4WXOA 4FM2A 3ONQA 3U9DA 2CZ4A 1JLAB 1NH8A 4AYBC 4LF5F 2KT5A 1UWBA 4Y0WA 4OPKA 1FRMA 1IJJA 5HAOA 2I1QA 4KI4A 3TACB 2DFEA 5AQUA 2OPRA 2M7SA 1YIJS 5FPMA 2LVWA 2B5JB 3LPYA 4BR7A 4NXNJ 5AXLA 3RBDA 5HBMB 5EY4A 3G10A 2WW8A 1U02A 2E2QA 4RU9A 2WCXA 2PT0A 7ICMA 2ASLA 4YOTA 1T8EA 3DC2A 3LDSA 3DM2B 2JJ4D 3O0FA 3CD7A 2ZVSA 5I4MA 2BOPA 3KHYA 1Z05A 3V9XA 1TKXA 2J9EA 2YY6A 3W2VB 4O44A 1U47A 2JC0A 1SQKA 2NLXA 4FJ8A 4GKKJ 1TR0A 4WBFA 2O8BB 3NVKA 5J1EA 3Q83A 1GXUA 4FBUA 1SV5A 4EELA 2KVQE 5GAHU 4AQYJ 3S3OA 3EVMA 4HACB 3CM5A 1W7AA 1ZM9A 5CR4A 4FF1A 4YNQA 1H7WA 3FZKA 3CG7A 4MEXA 2K7JA 1ICEB 2FHJD 3SSQA 3SUQA 4DHYA 2B43A 1HEKA 2KJ8A 5C12A 3OYEA 4ED1A 2XRIA 3M6WA 1RB0A 1SH3A 4YFUA 5FJ4A 2Y0BB 4C48A 3T5LA 4CJTA 4LF7J 4EFAC 5BR8F 1G7CB 3JAMY 5E3CA 2V4JB 1IBKF 1S97A 5LMUJ 2D3OR 5L1MA 2WF7A 2A1RA 2DNZA 3FUYA 3VTHA 4YN3B 3H25A 3UMCA 1RBLA 5EWEA 2IDLA 2P35A 3C23A 2Z2ZA 4P71A 4IZ9A 2RILA 8ICJA 1VQMN 3M9MB 2AV5A 1VBYA 2KSOA 4I1TA 3D2EA 5KNIA 2H4WB 1BQMA 1QTMA 5DQHA 2XI2A 1RHKB 4UQGA 2BW7A 2QWPA 3H90A 4DR7J 2E2NA 3OTBA 3FFKB 1TFYA 2E9TA 4P7TA 1DXSA 2UU9J 5F0XA 5J0RA 1ZQVA 2PY5A 2LEPA 4RQNA 2ZOFA 4KBIA 1RDAA 4DBQA 3TQEA 4RW8A 3H0PA 4MKAA 1X40A 1SVDA 2JH3A 3GFXA 1JUDA 1JK9B 1IKXA 1OW5A 3QSIA 3MWTA 4PEOA 4PCQA 1AUSL 3HVWA 1COOA 2B51A 4RL1A 1ATSA 4H5RA 3ZYYX 4L3NA 3CJRA 3V81B 2KJWA 2RHSB 3QIOA 3OYKA 4DV6F 4C4TA 4HVZA 3TFSA 1VJWA 3ENQA 2KK0A 4RQ2A 1ZXOA 3BEGB 1HYZA 1WN7A 1TKTB 2EDUA 2XSJA 4NLPA 2P5OA 4YOUA 3KK1B 3CMAS 9ICOA 1VQ9N 2KXFA 4LF6F 3CTRA 1M5OC 4YFKA 4CHQA 7ICQA 1X4EA 2A18A 5DDQC 1BPEA 3DOLA 4OYIA 2CJKA 3GWCA 1EX4A 1C0UB 4RWXA 3QLHB 3PFEA