4DQIA

Ternary complex of bacillus dna polymerase i large fragment, dna duplex, and dctp (paired with dg of template)
Total Genus 207
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
207
sequence length
579
structure length
579
Chain Sequence
b'KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase I
publication title Structural factors that determine selectivity of a high fidelity DNA polymerase for deoxy-, dideoxy-, and ribonucleotides.
pubmed doi rcsb
source organism Geobacillus kaustophilus
molecule tags Transferase/dna
total genus 207
structure length 579
sequence length 579
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4dqiA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4dqiA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4dqiA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4dqiA01
3GV7B 1N5YA 3M9OB 4JLHA 4K4HA 4CJQA 3QZ8A 2QKKA 2KFZA 4CFCA 1WSEA 4O55A 4DSEA 3KIOA 1J5OA 1ZBHA 8ICPA 1XI1A 4Z4CA 4DTRA 3ORYA 4CFBA 3MR3A 5IILA 4O44A 3C2LA 3RH6A 4FS2A 2QK9A 4DSLA 3MR5A 4XQ8A 1ASUA 4Y1CA 1WSHA 8ICLA 5I42A 5J2BA 1ZQWA 3H8SA 3HT3A 5HLFA 8ICOA 1RT3A 1S9EA 3QEXA 3C95A 3ZSOA 4N47A 4DFMA 3ZDAA 1S1VA 5FRMA 3AU6A 3V7JA 4M9JA 5KG0A 4E7HA 1TKTA 4F4YA 4CHOA 2HNZA 3SJJA 4FJMA 4TSXA 3OYLA 5HMMA 2YHBA 1XSLA 2HHWA 2IBKA 2QXFA 3HPGA 5KFKA 8ICQA 4F5QA 2FMQA 3U6FA 3QEAZ 2OYQA 4CJRA 2GV9A 3WNHA 1W9HA 4C8OA 3LALA 3JPTA 2BGGA 2G8HA 2C2RA 1SV5A 3G10A 4B9SA 2R7YA 3KK1A 1VRUA 3HW8A 4F93B 4CJ5A 1SZPA 4MFFA 3OY9A 2GBZA 3L2RA 3OJUA 5KGXA 3L8BA 2YKMA 1S10A 1VSJA 1K6YA 2W9MA 4FJ7A 4YFUA 3GIMA 1DTQA 1S0VA 1BL3A 4CEFA 4YD1A 4DSIA 5KT3A 1HQUA 1BQNA 4DL7A 2ISPA 4TUPA 4CCHA 1QSSA 2VG6A 3PVXA 9ICMA 3QIOA 3DMJA 4Z4IA 2A1RA 3F9KA 4CF2A 4JWMA 3JPRA 2WONA 3LP1A 1ZQSA 3DLBA 2JEFA 3C2MA 4F92B 3E01A 3GDXA 3WNGA 4IRCA 3TANA 4DOCA 2Z1IA 1KEJA 3QNNA 2AQ4A 5IIOA 1BPEA 4DU1A 4P4OA 4TURA 4NCAA 3B0XA 4M2YA 4OGCA 3DLHA 3OSNA 1C0UA 1BPYA 4P2HA 4OKEA 2F8SA 4IFYA 5J0TA 4GLXA 2IGIA 4PY5A 3RJKA 1TV6A 4RG8A 1NK9A 4M3XA 1CZ9A 3V6DA 3HXMA 4QZHA 2PYLA 1JKHA 3TI0A 5HRSA 5KFNA 4HTUA 1R0AA 2P6RA 4AHTA 4B3OA 2YV0X 3ZDEA 3OYDA 7ICPA 1BPDA 4RNMA 3SI6A 1VRTA 4FW1A 3C6TA 2PFOA 5EWGA 1WSGA 1TK0A 4FJIA 1GOAA 1JXEA 1XSNA 2DY4A 3P1GA 4CGHA 5DGAA 4IR9A 4YR2A 4E7KA 3SQ2A 1LV5A 4BACA 4KLDA 4YR0A 4KV8A 1VSMA 4O5BA 4JV0A 8ICWA 4AHSA 1KFSA 3CM6A 3O3HA 1S76D 3HP9A 1S0NA 3O4QA 2IHMA 2XRIA 2Z1JA 1K1QA 2HHQA 3JSMA 4QWBA 2RDJA 2C28A 4FK0A 1WAJA 4E1MA 1X2IA 3QE9Y 3LDSA 9ICPA 3TAPA 5IIJA 1EXNA 2B5JA 2PFPA 4RW4A 4NCBA 1JIHA 4B8CA 4CEOA 2V4RA 4I2JA 1J53A 4PH5A 3BJYA 2W9CA 4OKJA 3K59A 3LANA 3K58A 3NGYA 4M9NA 4NYFA 3AVMA 3RAQA 2NRZA 3PR4A 1C7YA 1F21A 5K14A 1NK7A 5KFIA 2YNIA 4X5VA 4M3RA 1D8YA 2BCSA 3RJFA 1VSFA 3LZIA 2LSNA 5J2EA 7ICUA 5KFEA 1MC8A 1HRHA 4I29A 3CM5A 1XHZA 4CK1A 3KHLA 3TAFA 4BE0A 1COOA 4DQRA 4H4OA 1ITGA 3QEBZ 4ED0A 1CXQA 1BCMA 3EPIA 3KD5E 2JEGA 4PHAA 4FVMA 5FRNA 1BCOA 1T8EA 4QZFA 3Q8KA 1EX4A 4KLGA 2XY5A 3RJHA 4ECSA 1S9GA 3VQDA 4J9QA 4FLVA 5CJ7A 3QERA 4I28A 3K57A 4AHRA 5KT2A 4KN7A 3GQCA 1Q9XA 2ZTCA 4B9NA 3RH5A 4YP3A 3D45A 4I2BA 1GOCA 1HMVA 1S6QA 4NXZA 4RZRA 3T5LA 4I2CA 1Y97A 3PMLA 4YQWA 5CYMA 4IKFA 3L2UA 3K5OA 3OYFA 3EW9A 3VQ5A 1ZQLA 4I2FA 4B8AB 3MDAA 2XGPA 2BQRA 1U04A 3AA2A 3OYMA 1I39A 2FPKA 3SCXA 4CERA 3AO1A 4PHDA 3B6OA 3OHBA 2AJQA 7ICSA 3MR2A 9ICRA 7ICFA 1NJXA 2JGUA 4XUSA 1RPLA 1D9FA 1B22A 2R8GA 3ITHA 4YR3A 4F4ZA 3MXMA 3ISCA 4G3IA 3L2QA 5KFWA 7ICNA 4ECUA 5KFPA 5TZVA 4RQ8A 4UBCA 2XGQA 3HX0A 5J2PA 1ZQTA 3UIQA 3LPUA 3TFSA 4QWEA 2P5OA 2AQ0A 1WN7A 3WNFA 4DWIA 1FKOA 5BOMA 2IDOA 4BE2A 1JXLA 4UAYA 3C5GA 4HUEA 8ICYA 4F5OA 2MAXA 3Q8QB 5DMRA 3ISDA 1BPXA 5J2AA 1UWBA 1ZQAA 4M9HA 3M9NB 8ICEA 3CFRA 4R63A 4M47A 4DL6A 1CUKA 1YVUA 4YCXA 3QZ7A 3V9ZA 3T5JA 3V81A 8ICFA 5SWMA 5HP4A 3C2KA 9ICTA 3KLIA 2XHBA 3C1ZA 3UQ0A 1FKPA 5KT4A 4DMNA 4KLSA 4HHTA 4LSLA 2E4LA 4FJKA 4IG3A 1U9LA 1ZQGA 3UXPA 4LH5A 9ICAA 2MUTA 3AA4A 1KDHA 1S5JA 4FBTA 3PR5B 4EBEA 5JS2A 4FLZA 5C24A 3AVAA 2VANA 2KQ2A 3C1YA 1KFDA 2HVIA 9ICUA 2PI5A 1DOQA 4PHEA 1WSJA 1ASVA 4KB1A 2BDPA 4E7LA 4M45A 4M3UA 5F9LA 4N5SA 4W5TA 1T7PA 3BQ1A 2G8IA 2AU0A 1A5WA 4QZBA 5J0OA 5DQHA 4TQSA 4BDZA 1XSPA 1TAQA 4FJJA 2I1QA 3DRSA 3AVLA 5J2KA 2XY6A 3IS9A 3ULDA 2DFEA 4K8XA 4Z4GA 2E6MA 1RT2A 3SQ1A 4KLEA 4PGYA 2ZD1A 3PNCA 5HHIA 3OYCA 4ED8A 3H40A 4DTPA 3RJJA 4CGIA 3NH0A 4JWNA 2ALZA 4QZ9A 9ICQA 3SZ2A 2EHGA 4YFKA 2HHUA 4KI6A 1JL2A 2XO7A 1HJRA 4RNNA 3OYBA 4F5RA 3RB6A 5HMLA 5EOZA 1FXXA 3S3NA 3AU2A 3CFOA 4RW8A 1GOBA 4ED2A 4KTQA 1UT5A 2DFFA 3NE6A 1HYZA 1VSKA 4FM2A 4FM1A 4IFVA 1RZTA 1LAWA 4I27A 1I3AA 3NFAA 3K5LA 4KREA 4FYDA 2EX3A 3NH1A 3KHRA 4FJGA 4RQ5A 4FK4A 2DPJA 2HB5A 1QTMA 4GXIA 4KHSA 1ZQKA 3MXIA 4Q8FA 3D0PA 4ID5A 3H8WA 2JEJA 4EP4A 3Q8SB 4ECVA 9ICEA 5DDMA 3KLFA 2P6UA 1LWEA 3RMDA 3HVRA 1ZQUA 4F50A 3JPOA 4Q8EA 4FZZA 7ICQA 3QEPA 4M3TA 3V1QA 2P1JA 4DTXA 2F96A 3NDKA 3JPNA 3L2VA 5KRSA 4EYIB 5KI6A 3GFKB 4OGEA 4O5KA 3FFIA 3UQ2A 4ECWA 3DOLA 8ICMA 1UA0A 5KT5A 4O0JA 3VQEA 4NLGA 4RQ7A 2RKIA 1S97A 9ICFA 1EP4A 4FLTA 4TUQA 4CF0A 4F2RA 3TARA 3RRHA 2BCRA 2BCQA 2R8JA 3SUOA 1KFTA 3TAMA 2ZQBA 4J9NA 5J2MA 4KLFA 5HBMA 2R8IA 4OPJA 4FLYA 4IR1A 5DQIA 4FJ5A 4PGQA 5EWEA 2J6SA 4RNOA 5DBBA 2OZMA 1WSIA 4OKKA 2IAJA 5J2GA 5HHHA 4UB3A 4GXJA 1UAXA 1RXWA 4FK2A 1RTIA 2B6AA 4FJXA 4C8MA 3AO4A 2LYHA 3RBEA 2ISOA 4KHQA 3K5NA 1ZBUA 3LP3A 4CJKA 3GIKA 3PW0A 3NBPA 2P5GA 3ZSVA 1FK9A 5KFDA 5KG1A 3VQAA 4W5OA 1ZETA 1BHLA 3PMNA 4RUCA 4NM1A 2BPCA 2Q3SA 3T5HA 3GIIA 4BWMA 4CECA 3OYNA 4CK3A 1S1XA 4CHYA 1AROP 3Q8MA 4J2AA 5CZ2A 3ISNC 1MQ2A 1Z25A 3HL8A 4I2EA 1A5XA 4O3PA 3SUQA 2W8KA 4FW2A 5DBCA 4RQ6A 4YN4A 4KFBA 2D5RA 3NHGA 2GWSA 1N6QA 4GVMA 3V6HA 4UB2A 5KGWA 3IG1A 2IMWP 3SV3A 3QLHA 1HQEA 3LWMA 2C2EA 4ED1A 4QOZB 5IIKA 4JRPA 3RMCA 2Y1JA 4O3SA 1NKCA 2NRVA 1ZBFA 4ED7A 5DBAA 4DL4A 3K75D 5BOLA 3OHAA 3IM1A 4FXDA 4QZCA 3V9UA 3RB3A 4J9SA 4CF8A 1RT5A 4CJPA 5KFTA 3RMAA 2ZJ5A 2FMPA 9ICXA 1BGXT 4NLKA 4RQ1A 4JS4A 2G8UA 4UB1A 3PW4A 3LAMA 1D5AA 3QESA 1Y88A 3OGUA 3WNEA 4F4WA 4OJRA 4ELUA 3K4GA 2J6TA 4IBNA 3P83D 3NH2A 1MSWD 2BGWA 3TFRA 2ETJA 2RF2A 4JUZA 2B4JA 2XCAA 1T4GA 3L3UA 4DTSA 4O3QA 8ICNA 3V9WA 4OVLA 3OYAA 1Z26A 1C0MA 3THVA 4UB4A 1BPZA 1SKWA 4JK1A 5KFSA 4KMUA 3PUFA 3S9HA 3RBDA 9ICOA 1WCNA 1ZQXA 3G6XA 5J0UA 4IRKA 2KZMA 9ICWA 4CEZA 1TVAA 4YD2A 2XY7A 1S0OA 3U3YA 1KVBA 1KTQA 7ICMA 2PI4A 3RJIA 4IQUA 4E0DA 1ZQPA 3S3MA 3MFHA 3MDCA 1IKVA 5KFGA 1T03A 1TV9A 4HUGA 1Z3EB 1T05A 5J2QA 3QIPA 5KFBA 4P4PA 3KKRA 1IXRA 2OPRA 1XC9A 4AHCA 1HYVA 4QCLA 2GUIA 4MFCA 4QZAA 3VQ4A 2FBVA 1CEZA 3AVHA 1CZBA 1C6VA 4HCCA 4KPYA 4OPKA 4BXOB 3SUPA 4YNQA 1U4BA 1LWFA 3G6VA 2D0AA 2JLEA 5DQGA 4Z4EA 2AGQA 9ICJA 3AO5A 4GMJB 2ZTDA 3GIJA 3EY1A 4M9GA 1S6PA 3K2PA 1B92A 4BWJA 4R65A 3C6UA 4UBBA 4KLJA 3BQ2A 5J0YA 2BPFA 2KFNA 4Z4HA 2YKNA 4CJEA 4R8UB 1BIUA 1ZJNA 2JEIA 1ZQOA 3V1OA 3ZT4A 3HM9A 4L8RB 3KTQA 5DG8A 2FLLA 4PUOA 2RPIA 4QWCA 3ZSQA 2W42A 3DRPA 4BXOA 4YXMA 1IKXA 4ZTJA 4N41A 2ZJ8A 2KW4A 1VSIA 3ZSXA 3NF6A 1YTAA 5EU7A 2X6NA 2G8WA 4M3ZA 1ZBLA 2ZTEA 4K8ZA 1C1AA 1RDAA 4CGDA 1Q9YA 4MF2A 4F5NA 4DOAA 3RAXA 4B9MA 5KRTA 3NGDA 4K4GA 1KLMA 2VA2A 3AA5X 1BIZA 2PXIA 1RBSA 2Z1HA 4CIFA 3UXOA 8ICGA 5D49A 3LK9A 3OS0A 3OS2A 4QWAA 4E89A 1KLNA 3Q8RB 2ATLA 4R8UA 4RU9A 1X9MA 4PPXA 3OYHA 3VA0A 1RBRA 4DEZA 4J9OA 2IOCA 3VQCA 1D8LA 1SKRA 1XU4A 3GILA 4DTMA 2F1JA 1TK8A 5KFJA 4PHPA 4DL2A 1BI4B 2G8VA 4R5PA 2M9NA 1SKSA 1MU2A 4Z0UA 1RT4A 1WSFA 2A1SA 4DOBA 5I3UA 4J9RA 4ECXA 4PQUA 2XCPA 3AV9A 2FPMA 1NJZA 4IQWA 2BKEA 3KHHA 8ICZA 4DSFA 3NTUA 3HYFA 1D9DA 4ZHRA 2HHSA 1JLBA 3VN5A 4ECYA 1DTTA 5KFZA 8ICVA 4CJLA 4DLEA 1RXVA 3NGIA 3HPOA 1B43A 5L9XA 3UXNA 3V7KA 3RR7A 2J6UA 4CJSA 4PWDA 4CGGA 3MR6A 3QNOA 5J29A 4R64A 4Z4FA 1VSDA 3ZCMA 5DB8A 4JV2A 3ZSZA 4NLZA 3VQBA 3UPQA 2BHNA 1BI4A 4YMNA 1TAUA 2F1HA 3RR8A 1LWCA 3AO3A 2FBXA 1ZQMA 4YVZA 4J9KA 1WAFA 2O4GA 5J2FA 1H38A 1NK6A 4KTWA 4M41A 3HJFA 3OYGA 3HPHA 3OYJA 2O4IA 2RDIA 4FCYA 5J0QA 1BISA 4KLTA 3AVNA 4CJFA 4RQ2A 4BGDA 2ATQA 4EP5A 1V9PA 1B9DA 4N56A 1DGSA 2PFNA 1JLGA 3MGHA 1IKWA 1ZQHA 4CESA 4YXJA 2XY8A 3ASMA 4KLOA 4FJNA 3MXJA 2D0BA 5CWRA 1TL3A 4HUFA 3H4DA 2AGOA 1S1WA 4CF9A 5KG6A 4LY7A 4CJTA 3KLEA 4BDPA 5CY4A 5L1JA 3MEDA 5E41A 4J9PA 3NF8A 5HP1A 5CB1A 3VQPA 3N4MB 4QZGA 4DS4A 4KI4A 1RT7A 4XA5A 4LZDA 3CFPA 4M6WB 1L5UA 2VG5A 4KLLA 2BPGA 5J0SA 4ZTFA 4DL5A 2ZUCA 1L3UA 1ZQNA 1RT1A 4F3OA 2ZJAA 4ECZA 5HROA 1HNVA 1NK0A 4DSJA 4RW9A 4I9LA 3OS1A 2OZSA 1RBVA 4DL3A 9ICSA 1SL2A 3EPGA 3MAQA 3GV5B 2UVRA 5J0PA 5FROA 3PW2A 2X78A 2G8KA 8ICXA 4C8LA 1J9AA 3HK2A 2ZUBA 4LD0A 3HP6A 1JMSA 5D3GA 3VA3A 2OPPA 4JRQA 4AHUA 2OWOA 4O3NA 1NOYA 3V1RA 7ICOA 4E3SA 4UAZA 2BCVA 4CHZA 3ISBA 3GV8B 5KFYA 3OSPA 3HVTA 4ICLA 2OA8A 4XIUA 4CHNA 2I9GA 3KD1E 7ICRA 2HVHA 3ZSYA 2BR0A 4GW6A 1G15A 4NM2A 1RYSA 9ICBA 1VSLA 2HNYA 4CJWA 2PFQA 3DLEA 4RPYA 1A77A 5DLFA 4I2DA 4ELTA 4LH4A 1IH7A 4KLHA 1MQ3A 5L1LA 1S1UA 3PO4A 2V9WA 1HNIA 4I2AA 3G0ZA 3KLHA 5KG5A 4KRFA 3C23A 5DGBA 2IHNA 5T7BA 2NRXA 5D46A 4O9MA 3RH4A 2PZSA 4UQGA 1EKEA 4FS1A 5KG3A 1JLAA 5J2IA 3H8JA 4H8KA 4I7FA 4DTJA 4E1NA 5DKWA 4CGJA 3PO5A 4KLQA 3QEIA 3RJGA 3VQ7A 1B9FA 4W5RA 4I2GA 4I2HA 3JPQA 5KG4A 5JS1A 4RT3A 1X9WA 2IS3A 4F4XA 3SUNA 3OJSA 3RWUA 2DPIA 4ECQA 9ICNA 3ETLA 3V9XA 4EZ6A 3EZ5A 3DRRA 1ZQDA 4FZYA 5J2DA 4Y1DA 4DFJA 8ICIA 2FPLA 5KFOA 4I2QA 3SPZA 4W5NA 3KJVA 4OLBA 5J0WA 3EWAA 5KFRA 4AH9A 4KHWA 3L3VA 1UT8A 1HUZA 1IKYA 3AVIA 3PX4A 4ELVA 3T1AA 3LZJA 3M8SA 2F1IA 1S1TA 4Q44A 4B9VA 3TQ1A 4J9MA 3MABA 2D0CA 3NAEA 3RRGA 3I0RA 3QINA 1TFRA 1HYSA 3CQ8A 1RDDA 3PW5A 3S3OA 4DU4A 4B9UA 4CEEA 3QEVA 4N76A 4FM0A 2IC3A 1X1PA 3BDPA 4IG0A 3SI8A 4KTZA 3ZDDA 4Z6CA 5KT6A 2IA6A 4DF8A 2KZZA 4EYHB 1TVRA 4FJLA 3RJEA 4DFPA 2ZE2A 3ZT3A 4HCBA 4LZGA 3PV8A 4KLIA 4YG2A 3OYIA 4RQ3A 4KITB 2FBTA 2VG7A 3A2FA 1XWLA 3VQ8A 1C1BA 5D4BA 2C2DA 2BE2A 4GC7A 7ICTA 3MFIA 3PX0A 3KK2A 4F8RA 9ICKA 2HW3A 4KAZA 1YTUA 9ICCA 5BPCA 3U3GA 3MGIA 3TR8A 1RYRA 5HNKA 4QZDA 1WCLA 7ICIA 1KCFA 3O3GA 5C5JA 2YNFA 4CHPA 3TAQA 1JN3A 3ZSWA 2WOMA 1QSLA 4KLMA 7ICEA 1ZQQA 2W9AA 4QW8A 2BANA 1RNHA 2W8LA 5KTQA 1ZQZA 2FBYA 1KVCA 3I8DA 3AVGA 4KKOA 4W5QA 3O3FA 5KFLA 3AA3A 4C8KA 1O1WA 4FLXA 1KVAA 5J2HA 4O4GA 4DS5A 4DQPA 3VQ6A 3DYAA 4QW9A 2ZUDA 4KHNA 1QSYA 1J54A 3KLGA 5DDYA 4I2PA 2HNDA 1ZYQA 1UA1A 5CA7A 4JV1A 5CZ1A 1RCHA 4FJ9A 4YMMA 3V9SA 4CHQA 4CEDA 1SL1A 8ICTA 5SZTA 3SQ4A 2DTUA 3F73A 3PX6A 4FO6A 3H4BA 2E6LA 5EWFA 5FDLA 5IINA 4FJ8A 2HHXA 1ZQIA 2BQ3A 1SUQA 5CP2A 8ICUA 2W9CB 1QQCA 4QZIA 1JLQA 4HVJA 3KK3A 1ZQCA 5KFQA 4FBUA 2UVVA 4Q0BA 5J0RA 1HJPA 5CHGA 1IG9A 4C8NA 4EBCA 8ICKA 2G8FA 4CEQA 4CFDA 3LDAA 1WLJA 3QO9A 1U49A 1VK0A 7ICHA 4ID1A 4J2EA 3JPSA 3V72A 2VA8A 4M3YA 2YNHA 2F8TA 4CE9A 1Z00B 4K4IA 5DB9A 4GXKA 3AUOA 5DK5A 1A76A 4DO9A 4B08A 1RBUA 2UVUA 1RDCA 1W0HA 4QZ8A 1SL0A 4CIEA 1HUOA 2W9BB 4NYNA 4LVSA 5KFXA 2NUBA 2Y1IA 4KN4A 5HRPA 3SQ0A 8ICBA 3SNNA 2H5XA 1YT3A 1RDBA 3VQ9A 3ZSRA 4PGXA 3E2EA 3P5JA 1JL1A 3OVNA 3RMBA 1EETA 4HYKA 4UAWA 4MFAA 4DTUA 1NK5A 4O0IA 5KT7A 2I5JA 2NRWA 3AVFA 3AVCA 3LP2A 1REVA 2KTQA 1RT6A 1TL1A 4DG1A 5L1KA 3C21A 3QETA 3ZT1A 1Z00A 4CJVA 3V4IA 8ICRA 1XS9D 3B0YA 1QLNA 3AVJA 3M8RA 4FLWA 5DG7A 3KHGA 3Q8LA 4BDYA 1TKXA 2W9BA 4YMOA 4J2DA 3LAKA 5DLGA 4AILC 2YHAA 4F5PA 4FJHA 4RW7A 1T3NA 4M0AA 7ICKA 4ED6A 4Z6EA 4DSKA 4Q5VA 4KB0A 4G1QA 5DB6A 4P4MA 1KSPA 4ED3A 4MQ3A 1ZQVA 3V6JA 9ICGA 2DFHA 4FZXC 1TKDA 3BGRA 2WTFA 3ZDCA 9ICLA 4R66A 1A5VA 4E7IA 4O5EA 1IO2A 2OPQA 1ZQEA 4F3TA 3EYZA 1NOMA 5J2JA 2KN7A 3IHQB 2PY5A 4F91B 5J2NA 1LAVA 5IIMA 3ZT2A 4NY8A 3AVKA 3DLGA 4DTOA 4E7JA 4CJUA 4EBDA 2OPSA 2RN2A 4DFKA 2FMSA 4RPZA 1JLEA 2BQUA 1QE1A 1K1SA 3AO2A 1ZJMA 3LPTA 1L3VA 3G6YA 4Q43A 4GC6A 5J1EA 4Z6FA 4RQ0A 4TUSA 2HHTA 2BCUA 4QWDA 2X74A 3SPYA 4RQ4A 8ICAA 4B9TA 3I0SA 1NK8A 3LWLA 3T5KA 3BQ0A 5IIIA 4IDKA 1RILA 7ICVA 1U45A 3T19A 1BVSA 4CGFA 4KO0A 3QEWA 3RTVA 5C42A 2ITGA 4F4KA 8ICJA 1JX4A 1CXUA 4MF8A 2ASDA 1DLOA 1LW0A 4FLUA 4DQIA 4M04A 4RUAA 7ICLA 1S9FA 1N48A 3N97B 4AHVA 2Q0ZX 2P51A 2MUTB 1NJWA 1ASWA 3ZDBA 1Q8IA 5KFCA 4RT2A 2AGPA 3ZD9A 3Q8PB 4OLAA 3MEGA 7ICGA 5CYQA 4RW6A 4CJ3A 1NJYA 2ASJA 5KFMA 1JLFA 3PW7A 3NF7A 1ZQJA 4O5CA 3PY8A 2FLNA 3TAGA 4KHYA 5F9NA 3JPPA 4QAGA 1UOCA 4MEYA 1JLCA 1ZQFA 3B6PA 3H7IA 3MBYA 1QS4A 4LSNA 4CK2A 1NK4A 4ECTA 4MEXA 3L2WA 3HSTB 3DI6A 4PA1A 4DF4A 1VSEA 5DB7A 4DQSA 4KHUA 2V4QA 3FDSA 4QZEA 3JYTA 3CG7A 1BQMA 1TKZA 4H4MA 4I9QA 4NLNA 2P66A 2NRTA 2C22A 9ICHA 2VWKA 3SYZA 5KFAA 3RB0A 3FYHA 1XO1A 1X9SA 4CIGA 5HRNA 3T3FA 4CF1A 4BE1A 3ALYA 4M9LA 3DM2A 3C94A 4O3OA 4ECRA 1LB2B 1L3TA 5HRRA 2QKBA 3NF9A 3M8PA 4F2SA 5J0XA 4CFAA 5KFVA 1RTHA 3DLRA 1RBTA 4JS5A 1QHTA 3KKSA 3MECA 9ICIA 1LW2A 4IQVA 1RTJA 1KRPA 1S0MA 2HHVA 4NCGA 3DLKA 2HMIA 3H08A 3BQTA 4MFBA 5KG2A 1ZQBA 1TK5A 5KFHA 2X6SA 3ZT0A 2JZBB 3NCIA 4XRHA 2R8HA 2FLPA 2VWJA 4M3WA 4DLGA 4M6WA 2FC0A 2DFLA 4B9LA 3TAEA 1NKBA 5CR0A 1ZBIA 5DG9A 1C0TA 1EXQA 4J2BA 3ZD8A 2XC9A 4EZ9A 2A1JB 3CYMA 1BPBA 3VQQA 1CLQA 2ASLA 3LP0A 3C5FA 5L1IA 3V6KA 4EEYA 5C25A 1C1CA 1XHXA 4TQRA 1L3SA 5KG7A 4CJ4A 8ICCA 4WE1A 1ZQRA 3IRXA 1N56A 1TGOA 3MEEA 2R8KA 4Q45A 1S77D 1ZQYA 4M42A 4DTNA 3K5MA 8ICHA 4DU3A 7ICJA 4DQQA 1WNSA 2PYJA 4KLUA 3NGZA 2JZBA 1U47A 5KFUA 1U48A 1JXBA 4ZH4A 4RPXA 2VA3A 4UB5A 5KFFA 2B21A 4I2IA 4IRDA 3V7LA 3OYKA 4O3RA 3TABA 1HPZA 3HO1A 2KZ3A 1NOZA 8ICSA 1VSHA 4Z6DA 2A1JA 2Z1GA 4E19A 3HWTA 1NKEA 3M8QA 9ICVA 1RTDA 3OYEA 3IAYA 4IQTA 4J9LA 3SV4A 2YNGA 3O4NA 1PZNA 3DOKA 5JUMA 3RB4A 3AVBA 4CEBA 2UVWA 5J2CA 4CEAA 1IM4A 3TWHA 3M9MB
chains in the Genus database with same CATH superfamily
2UUBJ 3DOMA 3GFXA 3GV7B 5HVGA 5F8JA 3BBBA 3JTNA 4JLHA 3I56N 4KBIA 1M1KO 3AT1B 5ETTA 4A8SA 2KFZA 1XN9A 2WCXA 4CFCA 2YWHA 1WSEA 2RQMA 4H4KC 1ZBHA 1EHWA 2JWKA 2G5HB 4Z4CA 4JI6J 3CJCA 3FSIA 1VRUB 3MR5A 5AZJB 1MWZA 1I1GA 3UN5A 2G09A 3D0IE 4WQ5C 2GHPA 3H8SA 2BYCA 3HT3A 2KD1A 5HLFA 2YY6A 3GE9A 2DY9A 1HQUB 2E66A 3DCAA 4A62A 2HBLA 1BQNB 1GTEA 1T0TV 3B9JA 5JVGL 3UWTA 4CHOA 2KKZA 1RACB 4DXLA 1WEXA 4JHDA 2WSCC 5L46A 4DV7J 1QVFR 2HHWA 4PKIA 3HPGA 4A8MP 4H5VA 1LOTB 2FMQA 3U6FA 3C8YA 2ZBCA 4PZNA 2ZJRL 4B9SA 2P9EA 2UXBJ 4YDDB 3KK1A 4GO7X 1SC6A 4ZCKA 5EOYA 5KNIA 4NLWA 4EGLA 1SZPA 1VQ9S 3QICA 3OY9A 1WI6A 4TKTA 3O3LA 1YXQA 3L8BA 3CJ5A 1UJ5A 2IJRA 2W24A 4YFUA 3G86A 3BH7B 3V6DB 1H7XA 4ZPWR 3M3ZA 4M5IA 4ZVTB 4DSIA 2H54B 3WXLA 1NDLA 3JSBA 4B3OB 1RGIA 2GLEA 2MDAA 3QGHA 2P5VA 2VG6A 3PVXA 2XZWA 3BPSP 1KBUA 4WFYA 3F9KA 3AQPA 4CF2A 3JPRA 1DJ0A 2WONA 2W6LA 3DLBA 2JEFA 2PIIA 2N7YA 2V8HA 2PFFB 2QLXA 4KV8B 3F2BA 3VAMA 2G2ZA 4NLXA 1TZ0A 2FC9A 3QNNA 4JK9A 4P4OA 4A8YA 4CLZA 3B0XA 1XNRK 4OGCA 2YKPA 2UXCF 3OTDA 1I3OB 2IHR1 4RG8A 1NK9A 1CZ9A 2NO4A 1Q3VA 2ZJQL 3LM2A 4BRFA 5KFNA 3J7Z5 5I3QA 2H51B 2QL7B 3ZDEA 3EICA 4IOBA 7ICPA 1Z4OA 4C11B 3G8SA 2OM6A 1U2RA 2BW2A 1Q46A 5K14B 4OHWA 1TK0A 2DVIA 3GWCA 4Z37A 3I8BA 5DGAA 1S4EA 4E7KA 2QLWA 1LV5A 3F56A 5AXKA 2OELA 2G06A 4YR0A 5U47A 2RE1A 3CM6A 3BR9A 3HP9A 3O4QA 1ZQ1C 4B3MK 2PGCA 2HVZA 5AM1A 3VGMA 2O5DA 5A8RA 2ZIUA 2FE9A 1QCKA 2BRLA 2IYGA 3A3PB 2VFVA 1KVIA 1KVJA 2A41A 2J8AA 3UKRA 2VJ5A 4NCBA 4NE9C 1OUQA 3LYSA 4B8CA 1RWNB 2UUWA 2V4RA 1J53A 2DO4A 2W9CA 4OKJA 3K59A 3H0MB 2ZGZA 3MMBA 2DNNA 3AVMA 4P2MA 3W7BA 1C7YA 5KL1B 3AOBA 4DFDA 4DR3F 2KG5A 1FI4A 1WF0A 2J7WA 2D8CA 5J2EA 3M1FA 5HL7L 1UPPA 5KFEA 2E1MC 2ZH6A 2HSEB 1FNMA 4OJ1A 1H0HB 5JMNA 3CM5A 3MM6A 3EUB2 3TAFA 1COOA 1YJUA 1GLLO 3IG5A 3DU6A 3GYGA 1HBOA 1ITGA 2W7AA 5AM5A 3D67A 1W7AA 1IJFB 3E0FA 1CXQA 2QI2A 4PHAA 2DXEA 3O5TB 3CC2S 1RFQA 3Q8KA 1WG1A 5B7WA 2XY5A 3CCMS 1VJ5A 2Q36A 2IDEA 4LF5F 4EFHA 4PPDA 1BUXA 4F4AA 1HNXF 1FW6A 4JKHA 4FLVA 1HPMA 2QKQA 4DV7F 3QERA 2CZ4A 1XMOJ 4I28A 2P35A 2GV1A 1HKCA 5KT2A 3ZZYA 4KN7A 5ALHA 1T9TA 4IO9Q 4C1NI 2YKOA 4DV5F 3QUTA 4MK8A 2FZCB 1GX6A 2E1RA 3BO2A 1HMVA 4NXZA 3O1BA 1WUAA 1Y97A 3PMLA 1VGYA 1YDLA 1FKOB 4NRUA 4I2FA 2ZF5O 1T02A 3GG0A 3CO0P 1IR1A 2IVFB 3AA2A 1VIXA 4M7YA 3K7RA 4CERA 4I68A 4PHDA 2ZZNA 2AJQA 3E58A 1R8AA 1NJXA 1G3OA 1ELOA 1MN7A 4M1KA 2W7PA 1B22A 5AZIA 3ITHA 4YR3A 3KLIB 3ISCA 1S79A 1FKPB 4G3IA 3N6NA 1HBNB 2I5HA 7ICNA 2J7UA 4ECUA 1VQ6N 3AXKA 5E33A 2HQGA 1M6YA 5TZVA 2M9KA 2O8DB 4YEAA 2UZAA 1WKJA 1TL3B 3LPUA 3TFSA 1WN7A 3N7PD 4IJAA 2BOAA 2HQFA 1QQ7A 5IQ6A 1JXLA 4UAYA 2HK2A 3DEEA 3VEXA 2WVFA 1V38A 2R3VA 3CJTA 1UVMA 1HNXK 3AOCA 3M32B 1EIYB 5J2AA 1UWBA 2FJ6A 4UOFA 1ZQAA 2DXFA 3HT0A 4M9HA 2F8MA 4DV7K 8ICEA 3CFRA 3EGNA 1ZD4A 1XK8A 4BVPA 4FO0A 4BRAA 4M47A 1Q7YO 1UHUA 5FJ4A 3THXB 3AJ1A 4YCXA 3QZ7A 4LF4J 2HMXA 3V81A 4N77A 3LUYA 9ICTA 2NXCA 1YUWA 1JCEA 3UQ0A 1NJIT 2UXBK 5H9EJ 5LMUF 2JHDA 4DR5J 2UXDF 3H1VX 3GBTA 3CJ2A 4IG3A 1C2PA 3C0BA 2GIFA 5BRFA 3AD7C 5C24A 2J0QD 1WBBA 1QQOA 2KQ2A 4W4MA 5F8HA 4J7CA 4ZA1A 9RUBA 1ASVA 4KB1A 1TMMA 1L3KA 2I1RA 2D7SA 2FHJA 4V1Ak 1RHUB 3IWLA 4ILHA 4N5SA 3HJVA 2HRYA 2ZWPA 3V4MA 3BQ1A 2FVSA 3R8EA 2WF8A 2CH6A 2G8IA 4NL9C 1A5WA 3D1OA 5J0OA 4BGBA 1SC3B 1D09B 4YORA 4UAUA 1WOSA 4DV6F 2DFEA 2QLTA 3BF1A 1RT2A 5DM6Q 3J7YU 3ALRA 2ZD1A 1FRMA 1LWEB 5MAOA 2CNOB 1SBRA 4GKJJ 5F1XA 3RJJA 1WC0A 2HVEA 3NH0A 2VBWA 4JWNA 2DCUB 2I0XA 3ULHA 1OIAA 1Q78A 3C16A 4ZCIA 4RPFA 1U1NA 2NPFA 3RB6A 3AU2A 1X42A 2QB0B 5GAGU 5LOQA 1OSCA 3FGVA 1GOBA 4KTQA 3NE6A 3FR0A 3FFIB 1JALA 3E9OA 4K4UA 4B1ZA 3CJKA 3PEJA 5FPMA 4GMKA 1I3AA 4PXEA 4N8NA 3VENA 5LMUK 4B1WB 2O6KA 4I6WA 3JTOA 2F8KA 3TAMB 1X3MA 3K5PA 4BC4A 4DV2J 4GXIA 3L6QA 4KHSA 5J2MB 4CD3A 1MW7A 1YJVA 2CJXB 1A0PA 2JEJA 1RBLA 4EP4A 3GYXB 3VVUA 1EQ0A 1RHMB 3KLFA 2JHEA 3RMDA 1Z1VA 1CQNA 3HVRA 1ZQUA 1VOMA 3C2PA 4WK1A 4KMOB 2QL5B 3JPOA 1BE4A 4X64F 3QRQA 3VCBA 3HLUA 4CF5A 2QRRA 2P1JA 4DTXA 5M1QA 3L2VA 3Q86A 1F9EB 4GRSA 3GFKB 4OGEA 4O5KA 1VQPN 1BWFO 3NBPB 1QH9A 2RB7A 4Q2MA 8ICMA 3VMFB 1UA0A 3LM9A 4DV6K 3BN7A 1WOPA 3CRXA 1APSA 9ICFA 4BR9A 4FLTA 2K3KA 3SEIA 1V4TA 3RRHA 2VBZA 3A3NB 1KFTA 3BR8A 2LYVA 2ZQBA 1CQMA 4J9NA 4J8FA 2KEYA 2HQ3A 2NO5A 3ENAA 4KLFA 4OPJA 2D69A 3O80A 3M4XA 4PGQA 4FJ5A 1FFSB 3NRWA 4LREA 1O0PA 2P9CA 5DBBA 2L9WA 1UAWA 4USKA 3GP9A 2IAJA 1SJ1A 5HHHA 2HQIA 3ZI4A 1T3OA 1Q7LB 4UB3A 4GXJA 3EN9A 4KR0B 4C8MA 3UMGA 3IG1B 3C19A 2LYHA 3RBEA 2ISOA 3ZETA 3QLHB 1P90A 1ZBTA 1FE4A 2JXJA 1XEZA 1TUGB 2B0CA 1FK9A 1O6XA 5KFDA 5KG1A 3R1LA 1Z2LA 4FYYB 1ZETA 4PG4A 3QUBA 2BPCA 3C46A 2OFGX 1ZRMA 3CIZA 2LEBA 1S1XA 1RWXB 1AROP 3ISNC 1Z25A 3TU5A 3QFPA 4FW2A 3SUQA 4I6MB 4RQ6A 2W25A 2AMCB 2JVOA 3LDNA 2GWSA 4ZDNA 3DXMB 5HQLA 4MAKA 2QWQA 2KIWA 3SV3A 2IMWP 4C0BA 2MKIA 1HQEA 4GY2B 4HDGA 3LWMA 2A5XA 4CLTA 2LEAA 2W1BA 4USAA 1Y00A 4UB6U 4NLOA 3WXJA 1QUPA 1OWXA 1YHQS 1EQMA 3IBWA 1NJIO 5DDQC 5G5HA 4M5MA 3RB3A 1IG6A 1OH7A 3FRZA 3J7ZT 2V7YA 2FMPA 4XTTA 1U2VA 4NLKA 2E2NA 2YHYA 1VQKS 3BN4A 1D5AA 3QESA 2R7WA 2W7OA 3WNEA 1IBCB 4JD2A 4ELUA 2MLXA 2BGWA 2DIVA 2ETJA 3N7SC 2B4JA 2EFOA 2VUGA 5ALNA 1UFKA 1T4GA 2FPHX 5AQXA 4A47A 3L3UA 3TPQA 3NOCA 2IJNA 1N32J 3OYAA 2WVBA 5BN9A 1PVQA 4OCZA 1C0MA 5AQHA 2FIUA 3RW6A 4Q7AA 1LWFB 2JVRA 1SKWA 5BYRA 9ICOA 3BO4A 1EQYA 4IRKA 1H72C 4LR9A 9ICWA 1TVAA 1S0OA 4IO1A 1IBKJ 2WUSA 3QXGA 1KVBA 1KOOA 1S6PB 4OZLA 1YIJN 4ZKAA 1ZQPA 2FHOB 3L3FX 4PRFA 4OYZA 3MFHA 3MDCA 1IKVA 3CO9A 3MPUB 2DGUA 1TV9A 4M5JA 2VJUA 1T05A 2FY8A 1UP1A 2VIHA 1N8RO 2FY1A 4QCLA 2WSFC 4QPTA 2J0SD 1OJ4A 2DIUA 4QZAA 5AE1A 3VQ4A 2FBVA 1CEZA 1PBUA 2AV5A 4UOHA 1CZBA 3IUCA 2FQQB 2IM1A 4F04B 4KYZA 3SUPA 1S22A 3O9SA 4YNQA 3WXIA 5IV4A 4JI3J 5F3XB 2D0AA 5DQGA 4QYZJ 4Z4EA 1NNDA 4QQBA 4IQMA 4KSEB 3VESA 1X4HA 2DHGA 3EY1A 2WFAA 3WC0A 1NGDA 4M9GA 3K2PA 4GKJK 1B92A 3FVYA 2IM2A 3C6UA 4M94A 4IEEA 1GFWB 4QR0A 5ALYA 3K8WA 2HGMA 3BQ2A 1UVIA 3FE1A 1WC5A 5J0YA 4IO9L 2FI1A 3OW2M 3MCAB 1BIUA 1ZQOA 3V1OA 4WFNQ 3ZT4A 4TYAA 4NLQA 2K2PA 1WORA 5IT9Y 1GTHA 3ZSQA 2W42A 3DRPA 2VFRA 3CF5Q 4N41A 3CCUN 2NYVA 1VQ7S 3ZSXA 4QS7A 3NF6A 2B4UA 2XNRA 5AIAA 4QIGA 1VQ5N 2RU3A 4K8ZA 3G8QA 2I7PA 1Q9YA 4MF2A 3NWGA 4F5NA 3W2VA 4ERDA 4CO4A 3CC7N 3DKDA 4F36A 4K4GA 1KLMA 3AA5X 1BIZA 2PXIA 3O1LA 5AXLA 3QT7A 5F0XA 2RQ4A 3UXOA 4PWDB 2F3NA 5D49A 1V4SA 3FJ2A 3OS0A 1KLNA 4RNFA 3CCZA 1U1KA 5HANA 3N0VA 2LDYA 2GAHC 3CNHA 1D8LA 1ZPWX 2CG4A 1SKRA 1CS4B 4I6AA 2FVRA 1TK8A 4OLPA 2HVDA 1FRKA 4PHPA 4DL2A 2EWSA 1BXNA 2EAMA 3N4PA 1ZPVA 4CNZA 2N82B 1RT4A 4CZGA 2A1SA 4DOBA 1AT1B 3IDWA 4ECXA 4Y2YA 4CNQA 2VD3A 2AX0A 5KAFU 4IQWA 3SIPB 2H3ZA 1AW0A 1PJ7A 4NLTA 2JH1A 3NTUA 3HYFA 3KBBA 4ZHRA 1JLBA 1DTTA 5KFZA 2VKQA 4A57A 4K4ZA 1FXLA 1F9HA 3MR6A 2K1RA 2LMRA 2FXUA 3MGJA 4Z4FA 1VSDA 4KRWA 5BYQA 2KVQE 3VEZA 1R0CB 4DZDA 3ZSZA 1ZM2A 2ZBQA 2XG8A 5A6WA 3UPQA 3L4BC 1T9UA 3J7ZO 3Q0AA 4U8YA 1TAUA 5AKXA 1LWCA 2FBXA 3KZXA 4NLDA 1WAFA 3IM9A 5J2FA 1H38A 3SAFA 2VONA 1IUJA 3TTDA 2ZIVB 3HJFA 3O1WA 2KN4A 3MAAB 2LCWA 3PYDA 3HPHA 1QVGM 1DXSA 4FCYA 1BISA 1NGAA 3IFRA 2X1FA 2DISA 1OYEA 4C2MA 3L4PA 1N63A 3J7YI 1RTHB 2B9WA 3IR5B 1JLGA 4FWKA 1ZQHA 4CESA 4YXJA 3IC1A 2YBVA 2XY8A 3OFEA 3MXHP 4BHQA 4Y2TA 4K7QA 4K4TA 2D0BA 4ZJLA 2AGOA 1S1WA 4CF9A 5KG6A 4CJTA 3KLEA 1NZAA 4L3NA 3H2LA 3OVBA 5HP1A 5CB1A 5GAGI 5CCLA 4LZDA 3AARA 3CFPA 4KLLA 3OVAA 2KDOA 3HVTB 4ICLB 1N36J 1LK5A 1ZQNA 4M5GA 1RP5A 4JI3F 4F3OA 2ZJAA 5IWAJ 2FB0A 4OJOA 4K42A 1NK0A 3HHKA 4RW9A 4I9LA 2OZSA 3DRYA 3J7AP 3ZZRA 1TUWA 3FUYA 9ICSA 3DLEB 3GV5B 2UVRA 5FROA 2CADA 2G8KA 3MF5A 3DXBA 3LO3A 4OYOA 1J9AA 3R9PA 4WPAA 3N01A 2ZUBA 4LD0A 5HMXA 2IMOA 1S1UB 3IR7B 4H54A 3VA3A 1YZ6A 2RUGA 8AT1B 3D3BJ 4RUBA 1AZSB 2V8GA 4ED5A 3X1LB 3AJ2A 4LBHA 4HDHA 2XMKA 3V1RA 2VBXA 4ZVUB 3W65A 7ICOA 4M8LA 5GAEI 1NHUA 3BSCA 2EG1A 3FCWA 3H7HB 1HUXA 1SJ3P 1I94F 3O9QA 2OA8A 3GLJA 2J9DE 2E1PA 1JLAB 5HOOA 3D9BA 1DGKN 3QATA 2BR0A 3CSKA 2MSSA 3LDQA 1ATRA 1G15A 1IBKK 1HNWJ 3BPDA 1RYSA 4NWIA 2PFQA 3DLLQ 2L08A 2ACYA 3N4WA 3UVJB 3K17A 1A77A 2EAPA 1VLBA 3GIRA 4I2DA 1NDKA 4ELTA 1BNOA 4CM0A 4IKAA 4NXMF 1MQ3A 5L1LA 1KXPA 3UO0A 2W4CA 2CJAA 1PK1B 4I2QB 2VQFF 5LT5A 1LK7A 2UP1A 1HNIA 1RAFB 2Q6BA 4ZN3A 4FNHA 5AQTA 3F2KA 2ZOFA 3RH4A 4JI3K 3AFGA 4QYZK 2YCHA 2CQ1A 4O4RA 1RDWX 5KG3A 2Z30B 3VALA 2YQ3A 4H8KA 1F2HA 4I7FA 4DTJA 2GGPB 4CZFA 3PO5A 4LF2A 1AYEA 1WF1A 2E5LJ 3VQ7A 2ZIXB 4XK8C 1B9FA 4LF7F 3QFWA 1N54B 3JPQA 2GMJA 3BS5B 5KG4A 1VHIA 3N9UC 2IS3A 3SUNA 4A2BA 3AXMA 2C2NA 3ETLA 4EZ6A 3DRRA 4DV4J 3RFAA 1R8BA 1FT8A 4JKAA 4FZYA 4QIVA 1G6BA 3CCWA 3W8GA 3OXGA 3O08A 2E5IA 3VEWA 2G1HA 1TVRB 2BW7A 4W5NA 4KGKA 2KMDA 1NGJA 4X2BA 5AQYA 1X8DA 2GQ2A 2ZE2B 3KJVA 2D3O1 4O23A 3J81Y 3EGZA 1DKGD 1I94K 1RZMA 5GVQA 3U1NA 5KFRA 3HJEA 3P4IA 3QRPA 1U1RA 3I28A 2XULA 2DKZA 3M8SA 2FJEB 4OYWA 1IXKA 1EZZB 4J9MA 5I3PA 3W66A 2YN4A 3TADA 4NXMK 4WCEQ 2QXLA 1TFRA 2X1GA 1RDDA 5EDWA 3AHPA 3MWBA 4X66F 3ILIA 4DHVA 1Q95G 2IM0A 3HSGA 5HN0A 1F0XA 1NBWA 1TUYA 1OQ3A 3QEVA 2AA4A 1GLBG 3UKUA 1N88A 4FM0A 5DM7Q 3BDPA 1GLCG 3ZDDA 3WKBA 3LA0A 3ZZZA 4KKOB 3ZT3A 2VB6A 3R6GB 3LP1B 1TAMA 4WKYA 4O4GB 4U67Q 3E01B 5THWA 2BACA 2FBTA 1HKBA 4MDAA 3A2FA 3GFYA 1FD8A 4LF7K 4FWSA 1C1BA 1CLFA 2HNDB 5E3AA 4GC7A 4NXNJ 3CDUA 1HNZF 7ICTA 1R8CA 5ETVA 3KK2A 5AFUA 2V50A 4KAZA 2HW3A 2HK3A 3VV2B 4ZVRB 1YTUA 2M8HA 2WF6A 2YQ1A 2UU9F 3U3GA 1H2VZ 3L7OA 2QWPA 2EFVA 1WCLA 7ICIA 1HWLA 1RHJB 4NI2A 3ZTOA 2GW8A 3C3LA 1QSLA 2BRKA 7ICEA 4KBOA 5C12A 4QW8A 2QMUB 4C4WA 1N5VA 2W8LA 3SBMA 5AQQA 4BR7A 3M5RA 3AVGA 2C1EB 1UMJA 2AJ1A 4JI4J 3DDHA 4YB7A 5F3ZA 2I6WA 4A8QA 3KKAC 3RUBL 2JV3A 2BKNA 4FSVA 1KVAA 1KDNA 1VQ9N 2JRZA 3CPWM 1CC8A 2P9NA 2CJBA 2ZUDA 4KHNA 5JU5A 3KLGA 1YWXA 2MPUA 2PMZC 3QNMA 1ZYQA 4F72A 1I51B 3OXFA 4X66K 4FJ9A 3CJ9A 4CO1A 1RDRA 5BXIA 4FYXB 3V9SA 4O8UA 2KT2A 1SL1A 2VPYB 2BX6A 2MQQA 3F73A 1NGIA 3OXLA 1VK8A 1HNWF 2J9CA 2QEXS 4M5HA 4G1PA 1VQNN 4KGXB 2B0GA 1UCVA 5IINA 1SXLA 2D9PA 1VQOS 1Y3KA 3DFEA 1SUQA 3R2CJ 3ENQA 5CP2A 8ICUA 3T69A 3AQOA 1SVDA 3EUNA 2CQHA 2UVVA 3KG1A 4Q0BA 3OV7A 5J0RA 1IG9A 4C8NA 2LECA 4EBCA 8ICKA 2WF7A 4ILMA 4R0JA 1SV0A 5AKHA 4PXBA 4C6AA 4WFNL 2UU9K 2B6GA 1N60A 3QO9A 1WLJA 5BN8A 1RT6B 4ID1A 4DG1B 3VGTA 1RWVB 5ETKA 4M3YA 5IWAK 2YNHA 3R3TA 4ILRA 5DB9A 2N3OA 3EX7B 4TVAB 3CF5L 4GXKA 1WC1A 2P6TA 3Q7BA 3AUOA 5DK5A 4B08A 1QD1A 4BQZA 4WFBQ 4YB1P 2UVUA 1SH0A 3KOOA 1W0HA 3HHNB 4CIEA 3KJQB 2W9BB 4ZP7A 5D15A 4OHZA 4MTPA 2NUBA 3UN2A 1NM1A 5FPEA 2E8NA 3SNNA 2H5XA 2VHGA 2F4VJ 3VQ9A 1RISA 3E2EA 5B0FA 4CLPA 1QUVA 1J2VA 3OVNA 4ILJA 1EETA 4URSA 1FO1A 2XWXA 2QW9A 3AY9A 5KAIU 2P9LB 3VC8A 4K2XA 3CNQP 3J8AA 4C3KA 4OX7A 2CPYA 4RLEA 1TL1A 3MM9A 1HNWK 2E8AA 3ILJA 4HACB 4H0VB 4CF4A 3HKWA 4OYMA 2CJYB 4MO4A 4JN4A 5E0OA 3SSRA 3ZLJA 3THWB 2X1BA 1FNXH 1JLEB 2ZKTA 1QE1B 5ALOA 4YMOA 4C98A 2VF3A 3Q7CA 2GO8A 5DLGA 2X7IA 2VKZG 2A3VA 1NGCA 5J1EB 3MURP 2GMLA 5K8MA 4M0AA 1EKSA 3W5YA 4G1QA 1BDGA 4OO1J 1NZBA 3U1MA 3CMAS 2B8QA 1AFIA 2P9SB 1MROB 1TKDA 3ETOA 2QSFA 3BGRA 2Y0SD 4E7IA 1IO2A 1YSJA 2OPQA 4CQ1A 1DT9A 2E5LK 2JH7A 5J2NA 1HR0F 3TJ8A 5J2PB 3CC2N 5IIMA 3CI5A 4NXNF 2Q31A 5E3CA 3DLGA 4GFJA 3CCMN 3MEGB 3RBXA 4Y2XA 4RW6B 2E9RX 2H3VA 4DV4K 1YITS 2AYEA 1ESVA 2RJZA 4RKUC 4RPZA 5JXSA 3SDEA 2YQEA 1L3VA 3E9PA 4Y0WA 1H73A 1VQLN 4GC6A 1ZAVA 4CZCA 2RD5C 4TUSA 4LF9J 5AQKA 2GVZA 2BCUA 4QWDA 3I5BA 2BJ8A 1TE2A 2B8PA 4B9TA 1O13A 2KI2A 4LSNB 4OI3A 3BQ0A 1RILA 4FPBA 4BR0A 1X5TA 4KB7A 3JQJA 2X3GA 5H9FJ 2DJWA 3EXYA 3RTVA 5C42A 4LF6J 1G4CA 2QYGA 1SCJB 5ALWA 4AE5A 1JX4A 1T6DA 4USJC 4H4MB 2E5HA 3MX5A 3IN5A 2EH9A 7ICLA 1S9FA 1N48A 2Q0ZX 1FJGF 1NJWA 1ASWA 4H5TA 2KVIA 3D7EO 4V19S 3ZDBA 3N5FA 1P9YA 3Q8PB 2KT3A 5CYQA 1Q81T 2ASJA 2F7VA 4UARA 1N34J 3PY8A 5F9NA 1XJWB 4BRHA 2DY1A 4DDFA 1F5BA 2RDDA 3OBIA 1ZQFA 1QS4A 1LW2B 4CK2A 4BQLA 4LC9B 4O8KA 1TL7A 3DI6A 4H0OA 4PA1A 1VSEA 5ELZA 1FX2A 4NCGB 2XWYA 4MYUA 4NXNK 3H8YA 3FDSA 2XYPB 3TVZA 2XS5A 3W8PA 1R6VA 4BGAA 3CG7A 1BQMA 4C0ZA 4BS2A 5BR8J 2HZVA 4I9QA 1P8ZA 2OIHA 4WZMA 4UW2A 2NRTA 3NVMA 5KFAA 3RB0A 2I8EA 1XO1A 5HRNA 3T3FA 4M9LA 2E7VA 2WB1D 3DM2A 2L3MA 4O3OA 1C1CB 1L3TA 4JI4K 5FPDA 4D3HA 5D0GA 4JV5J 3NF9A 3M8PA 3DLLL 5GAGP 4F2SA 2VOOA 4NZ7A 3DLRA 1QHTA 3AEVA 2Z2YB 3MECA 3CIPA 1YK9A 4IFVB 3JS6A 1NLVA 4IQVA 1RTJA 1KRPA 3HMJG 1Y7PA 1YGYA 1TQLA 3ILLA 3BQTA 4MFBA 5KG2A 3KXDA 2DK2A 2LP4A 5HK4A 5ALVA 3DXKB 2FLPA 4M3WA 4M5DA 4KHPJ 4M6WA 3AQEA 1S49A 4WXOA 4DR7J 3EMTA 5DG9A 3QYPA 1EXQA 5LM7E 4J2BA 3D28A 3KMSA 3LP0A 5EHHA 1TUUA 2VC1A 3PFOA 4PL7A 2DGTA 3HILA 3P6YC 2EXUA 1FKAF 5KG7A 5GAEP 3U27A 3ET6B 4WE1A 1X60A 1UKUA 4DPTA 3SD7A 1TGOA 3N7RC 2QFIA 2D1CA 2MY8A 1TTHB 2UUAJ 1FEEA 5LXRA 5GAHU 2EAOA 1YVNA 3K5MA 1IV0A 4MJKA 3NVVA 1WNSA 4BRIA 1KQKA 3SQGA 4UUWA 2LBOA 3M6ZA 4UB5A 2B21A 4IRDA 3L95X 3OYKA 4MH8A 3OBYA 3HO1A 4NO7A 2F5GA 3H3NO 5E84A 3SLCA 3DDIA 1FFGB 2Z1GA 3KJFB 1T11A 3K9KA 1RTIB 4WCEL 9ICVA 2F4VK 2NXUA 1RTDA 1NMEB 4K4XA 5HLFB 1PC5A 4QOTA 4W98A 4DKWA 1BMQB 4UTGA 4OI4A 3CJ8A 1VQ4N 2D4WA 1T44A 2UVWA 1YJNN 5DM7L 4B3SF 1QAJA 1IM4A 2MQPA 4OJ6A 2NUUG 1KC8T 5CEHA 3NRBA 1U02A 1EARA 4JHDB 3L7PA 3BZKA 4OYBA 4BG9A 3QZ8A 4MMOA 2QKKA 1RUSA 2OI2A 2DNPA 4U67L 4OI0A 4DSEA 4LF6F 1J5OA 1UTAA 3KJNB 3P5BP 4DTRA 1XR5A 3OW2R 4O44A 2EANA 4FS2A 2QK9A 4DSLA 4OLOA 3KK1B 2XMVA 4XQ8A 1NGEA 2KLAA 1HHSA 4OZ5A 2A18A 2MKYA 3RZAA 5IXUA 1WG4A 3H6EA 2IOFA 2CPEA 5AI6A 5RUBA 3PIPQ 1ZQWA 3QIDA 1RKJA 1A6LA 5KQ8A 1MA7A 3PYEA 3M6UA 1EO1A 3P4UB 1J2MA 1TL4A 3UDCA 3VOVA 3ZSOA 3F5EA 4N47A 1ZRNA 2Z2ZA 1S1VA 1ACMB 2VG6B 5FRMA 3AU6A 3V7JA 4M9JA 2AEJA 5JVHQ 3PRDA 2OSRA 2HNZA 1T94A 4FJMA 2WONB 4KX5A 2YHBA 1A6SA 4ZITA 1WC6A 2IBKA 4EO8A 2QXFA 5KFKA 8ICQA 1RXOB 3JAMY 4M5LA 1FX4A 1Q81O 1SH2A 2BGGA 1S72N 1EB0A 4B17A 1FVQA 2DR8A 5LJWA 3Q24A 1HI0P 4F93B 2IYIA 5AQRA 2HEKA 4MFFA 3FMBA 4RCHA 2FJBB 1S5LU 2GBZA 4AM7A 1K0TA 5KGXA 2YKMA 4OYPA 1S10A 1K6YA 2A3ZA 2LFVA 4BRMA 4LF9K 1FDNA 3US5A 1N2XA 1PSDA 3AGKA 4YD1A 5KT3A 5EXWA 4OPAA 4AQYF 5H9FK 2GWJA 1QSSA 3DMJA 2G08A 3PZPA 4LF6K 4MYTA 4EO6A 3EVOA 4JWMA 1ZQSA 3C2MA 4F92B 4FWRA 3O9TA 4LRCA 3TANA 5ADXH 2K7KA 2AQ4A 5IIOA 1NU0A 4DU1A 4TURA 3THPA 3CVKA 4NCAA 1RM6C 1UL3A 3MCPA 3DLHA 5A8RB 2CQ0A 1KVKA 2J9EA 2QA2A 3OSNA 1C0UA 1BPYA 2H3FA 4LR8A 1JK9B 1Q82O 1N34K 3IRUA 1SJQA 2LEPA 2RS2A 3SAGA 4Y00A 3MMCA 4IFYA 4GLXA 2I38A 3IO1A 4PY5A 4MK7A 4M3XA 4WJ3B 3GPAA 3UKRB 4WFBL 3HXMA 4QZHA 3TI0A 5HRSA 2YV0X 2D1KA 3NMUA 3MMBB 1BPDA 4RNMA 3SI6A 1VRTA 3OT9A 4FW1A 3C6TA 3VCDA 5EWGA 4GVBA 5B08A 4FOIA 3P1GA 4IR9A 2ZBIA 3SQ2A 3A3OB 2V2KA 5BR8K 4BACA 1NCLA 4AHSA 1AA1B 2MQNA 2KICA 3CCRS 1YLXA 2ZH3A 2IHMA 4A8OA 2PC6A 3MM6B 3P5TL 2UUTA 5ALPA 5ADXA 2HHQA 3JSMA 2QM1A 4JP8A 4JV5K 1RBOB 3DXSX 4E1MA 1HBOB 3LDSA 2NLXA 2P6SA 9ICPA 3T9NA 5IIJA 1HX1A 4OV6A 1CSJA 4RW4A 1MWYA 3WKCA 3GR1A 1K73T 1JIHA 4WF9Q 1RQLA 3CDWA 4CEOA 3NGKA 4I2JA 1MN9A 1YJTA 3BJYA 4UT4A 3W62A 5FPNA 4M9NA 3RAQA 2NRZA 4ER8A 1SV4A 5JRTA 2DWQA 4C80A 1F21A 1NK7A 1Z1BA 5KFIA 1LCUA 3CCJS 4Y2VA 3RJFA 4NYZA 2LSNA 2JLGA 7ICUA 1UZHA 1H74A 1C4CA 1KQSR 5D0RA 4G6VB 1WSRA 2RRBA 1Q5VA 4H4OA 1HMVB 4ZCMA 3QUQA 4GVLA 4OYXA 3CC4S 3EPIA 2E3TA 2UUAK 1OYDA 4A8EA 4JI1J 2VJ4A 1T8EA 4QZFA 4DMZA 2ZIWA 1RA6A 4CP5A 3AD9C 5HAOA 5E26A 4WP9A 4NLUA 3VQDA 3NAHA 4HLBA 4NLPA 5IQQA 5AZIB 3I9ZA 1RG6A 1VK3A 5IZHA 4WFZA 3ITHB 1PAEX 4PPZA 3QBXA 1QZ6A 3MZIA 1E6YA 3FKBA 3QWUA 1SJRA 5AM2A 2FF3B 1IBLJ 2LYAA 3RH5A 4ZPVR 3RSEA 1NPRA 1VQ7N 5AQLA 5D0EA 4R79A 1TUVA 3HVAA 2Z4PA 1M5PC 4YDUA 1U24A 4RZRA 3G9CA 4ZLJA 3VGSA 3CERA 1SV0C 3BM7A 4X84A 1Q5YA 3K5OA 4MLHA 3EW9A 4FZLA 3J80Y 3NVZA 2P9GA 1WELA 4C7QA 1U04A 3OYMA 2WF9A 2N1RA 3NASA 4PR6A 1UWBB 3OHBA 2BM0A 2FUG9 7ICSA 3MR2A 3ICLA 1O03A 1QJHA 4QR2A 3VEVA 2RP5A 1D9FA 4HL9A 2IFXA 4BBYA 2HS4A 3V81B 1S12A 4WTYA 1HKGA 5KFWA 2YI1A 1REGX 4CM2A 2AKWB 4RQ8A 2XGQA 2GS8A 3SFUA 4IG3B 1ZQTA 1V3ZA 2P5OA 4DV1F 4F0MA 4USWA 2J7KA 4DR6J 3SMSA 3R2DJ 3PIOQ 3FC9A 5C24B 4IH7A 2RRDA 2KV2A 4FZVA 8RUCA 1T6CA 4PABA 1HIYA 4HUEA 1FJ7A 3M7DA 2MAXA 3Q8QB 5DMRA 4CZMA 3ISDA 4CVNE 4DR2J 3IBPA 1KP6A 2LA4A 2LQJA 4R63A 2C2MB 5HROB 4Y34A 1HNVB 2G0JA 2KU7A 4JAXA 1YVUA 2AXTU 2KO1A 3UI3A 8ICFA 3C1ZA 4FPRA 2CJKA 5KT4A 4DMNA 4KLSA 1KQFB 1RT2B 1U25A 3M6GA 2ZD1B 4FJKA 3M6WA 3CB4A 3EVWA 1U9LA 3UXPA 2V34A 4LH5A 3AA4A 3CUNA 2RMLA 1S5JA 3PR5B 1Q3UA 5JS2A 4FLZA 4B1VA 3C16B 1UVNA 1XO0A 4OX9F 1VLOA 2PI5A 1DOQA 2E29A 1OH6A 1WSJA 2GQCA 2QSWA 5HQMA 2ZC3A 2BDUA 4M45A 2FGCA 3BQ7A 4DV3J 3I55S 1T7PA 5BYSA 2YMPA 5GAHI 3UD4P 1ZTWA 3ZZTA 3CJKB 2AU0A 2HFVA 4QZBA 4LMZA 5DQHA 3KFUF 1LFPA 4BDZA 4KPCA 3HX9A 1XSPA 1TAQA 3VERA 1DQAA 2I1QA 3DRSA 3AVLA 5B8HA 2ES6A 5J2KA 3CEDA 3CJBA 1Z4NA 3OUYA 5E7OB 2R2RA 4DV1K 4CRJA 4H0TB 2YWGA 4NWBA 3SQ1A 3I1YA 4HHJA 3IR6B 4ZPDA 4O0NA 3ETMA 3L9ZA 5HHIA 4F9OA 2YY3A 2FSKA 3CGIA 3H40A 3WK9A 4P7VA 4DTPA 1K73O 5HMYA 2O8BA 4CGIA 4BR2A 3CPWR 2BTFA 2ALZA 2CDQA 4KI6A 4YFKA 2HHUA 2V2ZA 4XO0A 4RNNA 3A13A 3OYBA 4F5RA 4CGZA 2M0NA 4WQ5A 2I9SA 5HMLA 5EOZA 3BKUA 4RW8A 2BM1A 1AQ6A 3BYRA 1COKA 4HI2A 1OPIA 4FM1A 1LAWA 3GFZA 3DWLA 4KREA 3K5LA 4FYDA 1ZM9A 4QIWC 2PD1A 5IT0A 1L8OA 5HR6A 5DRKA 1JCFA 2EX3A 5CZVA 2WVDA 3ENBA 2DPJA 4GV6A 2HB5A 5ALUA 2V0NA 4BRDA 1WHXA 1ZAWA 1PIEA 1D0EA 4ECVA 9ICEA 1OVQA 3P8BB 3DNCA 4ES3A 2YMMA 2IAJB 1PC4A 4QS8A 1RA7A 2IRYA 1EAYC 4LFCJ 3SMVA 4FZZA 2JZ5A 3KWIA 4IZ9A 7ICQA 3A5NC 2O8FA 3ZETB 3G71N 3M7VA 4OZ2A 4EYIB 5KI6A 2CNNB 3GJSB 3PIPL 2DITA 2H1YA 4MIWA 3IAS9 3UQ2A 4ECWA 1SZHA 1FK9B 2K8GA 3DOLA 4P74A 5KT5A 2CPHA 4O0JA 4XPEA 3VQEA 2RKIA 1S97A 2FGOA 5KL8B 1NU4A 2HCFA 5AM3A 2BCRA 2R8JA 1S1XB 2VC0A 3VAGA 5JVHL 4WZQA 2R8IA 1Y5LB 4FLYA 2CQGA 4IR1A 5DQIA 5AKJA 2XB2D 5EWEA 3OL9A 5AQSA 2LDIA 4JBCA 4Z7CA 3WIVA 2VZ9A 3QGIA 2ZGYA 3D6RA 3T1YF 1DURA 2B6AA 4LRFA 4H5NA 4WU2A 1X66A 1DEJA 4JI1K 3K5NA 1HQEB 2BVZA 2W2OP 2GTDA 3NCPA 2P5GA 1UVJA 4WP3A 5HI7A 5HMWA 2BKPA 1X3NA 1ZOTA 4NM1A 1IJEB 2F9WA 3GIIA 4BWMA 4CECA 1WWUA 4CK3A 5G0RB 2IIRA 5A8KB 4CHYA 2E44A 3D4JA 1IBLK 1U2VB 3U8XA 1A5XA 1FWLA 4DUYJ 2W8KA 4YN4A 4KFBA 3J7AN 2AX1A 4JKDA 1VQMS 5ALZA 1WTFA 1RDUA 4DR1J 1DBDA 3ELHA 4U7BA 2Q6CA 4FWOA 1KD1T 4U96A 4CLYA 2C2EA 2KB2A 4BC3A 1RJJA 2JFDA 2FVPA 1WEZA 4OV1A 2Y1JA 4O3SA 4I6YA 4DL4A 4CLSA 3E8OA 2YJFA 5LXYA 1U1LA 4DV3F 3O5BA 3IM1A 4FXDA 1VQSA 1NEEA 4HH0A 2LU1A 4H0YB 2HLUA 2WBNA 1XUPO 2VPWB 3Q23A 2IVYA 4JS4A 2DGSA 3A5OC 3KG0A 3T1YK 5LMNJ 2B7CB 2OEHA 1FXRA 3PHEA 1GXLA 5D6GA 4DX6A 1T05B 1MSWD 4US8A 5D4NA 3WK7A 2EFNA 3KWGA 1JJCB 5J8YC 1K8KA 1XTZA 1F5AA 2ZH9A 4DR2K 2XBPA 4HT7A 4S0MA 2HHHF 1FEHA 4QU7A 2RHFA 4WF9L 4EHUA 5KFSA 4KMUA 3M6XA 4ATNA 3PUFA 3S9HA 1UWAA 1ZQXA 3UW1A 2KZMA 4CEZA 2XY7A 3U3YA 2FYXA 3OR1A 2Q1LA 7ICMA 4AFFA 3S3MA 4J90A 3C6UB 3I4PA 1T03A 2DHAA 3B4MA 1J5EJ 2LXUA 2YXLA 2R7RA 4TY8A 4HUGA 4D3GA 5KFBA 4P4PA 2JLFA 3KKRA 4HWIA 1T9YA 1XC9A 2ALYB 5T41A 3TQEA 4QU6A 2HSTA 1RWUA 4YOEA 3Q2SC 1J2NA 4DV3K 4LF8J 2QEXN 4C0HA 1C6VA 3JS9A 4LVNP 4JI2J 3DRPB 2E1ZA 1VQON 1KKHA 3V4IB 1SB3C 2GIRA 5BPMA 2BJDA 3BBFA 4MO5A 3AO5A 3HZGA 4GMJB 2D0PA 2ZTDA 3RGIA 3FGUA 2VGNA 3FQLA 1TKXB 3EZWA 2AZ3A 1KLMB 3GZFA 3MPVA 2R18A 2PFUA 4KLJA 3GONA 2YKNA 1VI7A 4K4YA 2HHHK 1ZJNA 3W3DA 1N0VC 3HM9A 2Y0BB 1Y5NB 4PUOA 5CA5A 3MCMA 3I5AA 4W90B 3CJ3A 4BXOA 1IKXA 3E66A 4ZTJA 2KW4A 1PJ5A 1GLJO 2LMIA 4KH0B 1RT4B 4CI0B 2CQ2A 4N8OA 2D0OA 1RDAA 2ZVIA 3SSQA 1PVRA 4ZHRB 2VA2A 2CQPA 3IGNA 1JLBB 1DTTB 4JYAJ 3LGHA 1RI7A 2A1BA 2K06A 1C4AA 4DUYF 2RLTA 5FLXO 8ICGA 1ZA1B 2K1RB 3LK9A 2CNLB 3HD2A 3OS2A 4QWAA 4L3QA 1X9MA 4R8UA 3UE5A 1R6YA 2AJ2A 4X4NA 3VA0A 5D77A 1RBRA 3CMQA 4PG6A 4J9OA 4K2JA 2IOCA 3MN7A 2YX7A 4ZVGA 3GILA 4DTMA 2F1JA 1JI7A 3PIOL 4CLKA 3WZ0A 2V6AA 2ZITA 4WIQA 2H4WB 1NM2A 4DB3A 1LWCB 4R5PA 2FHMA 2M9NA 1SKSA 2R2SA 5M1NA 4Z0UA 4NLYA 1LWXA 1WSFA 1WC4A 4NL9A 3C7NA 2XCPA 2OKQA 3BGFA 3C15B 2PEHA 2BKEA 3W64A 4M63C 3K1ZA 4DSFA 3C28A 1T9XA 2Y9UA 5A2QO 2XQCA 8ICVA 2GWKA 4Y3CA 4DLEA 1KD1O 2BH1A 3NGIA 1FO4A 4OZ0A 1B43A 4DX8H 5LMNF 5L9XA 1JLGB 2ROPA 4MLEA 4I0WA 3RR7A 1PO6A 2Q2RA 4CJSA 4LQ3A 2QV6A 4XAKA 2ROGA 3UCZP 2HFNA 5BRHA 2BE7D 4PZVA 4H5WA 1S1WB 3BEGB 2OD4A 3AMZA 3KLEB 2P9IA 3ZCMA 1LKYB 4JV2A 3ONQA 5HP1B 3OFHA 2NLWA 1YITN 2CXYA 4F0KA 2WVCA 2ASOA 2NCKL 1BI4A 3RR8A 1B70B 1ZQMA 4YVZA 2AIRB 3PSFA 2LM1A 1YBUA 2O4GA 4M95A 3QU2A 4KTWA 4M41A 2DR6A 4EAHD 5ALRA 2ATCB 2KHDA 3GJQB 4DUYK 4NV0A 4RW9B 5J0QA 2BZ2A 4F0HA 1YJWS 2ATQA 3ENWA 2OTLS 1JMTA 3BSAA 4EP5A 2C2KB 1V9PA 1WUUA 4DR1K 4N56A 1DGSA 2PFNA 1QAXA 1HBNA 3MGHA 4KLOA 4P2XA 3PG9A 3MXJA 2KKPA 5CWRA 1TL3A 3THTA 3DLKB 1XNQF 1MWKA 1RWOB 1JQGA 5HJXA 1NUEA 2SXLA 4YS2A 2ZVSA 3WIUA 1KHWA 1RT7A 3HD1A 1L5UA 2VG5A 3DN9A 3QU4A 1TL5A 2Z58B 2PMWA 1VC0A 2E1EA 2W04A 3VZIA 4RR5A 1H2TZ 1W2BM 2YPZA 2W40A 2G0CA 2LQBA 3UDLA 5LMNK 4WFXA 5C25B 5K8NA 3AJDA 1RBVA 4DL3A 4DPWA 3TYTA 3H90A 3MAQA 2WB4A 2E1YA 1WHVA 5J0PA 4CZHA 4LF1A 8ICXA 1JJ4A 3BS7A 5D3GA 3R5AA 2HI0A 3QYYA 5F0UA 4OYIA 4DQ8A 3JAMO 1HNIB 4ZJOA 5EE1A 3WEEA 1RDFA 3GE1A 2DBYA 2AEMA 2LPEA 2M52A 4E3SA 2BCVA 3ISBA 2OEMA 3U4LA 2F40A 2WW8A 1L8LA 3W9HA 3BYPA 2UXCJ 3KD1E 4DV0F 7ICRA 4PKGA 1WHYA 3ZSYA 4I7FB 2WTUA 1W97L 4GW6A 4XH4A 2HBZB 3IWNC 1VSLA 3Q89A 1D8ZA 4NA2A 3O4WA 4CLFA 2GX9A 1IWAA 1UW9A 5FLXU 4RPYA 4K5RA 4PG5A 2QWMA 4HVZA 4ZJQA 1B7FA 4KLHA 3D6MB 3DRRB 3I6PA 3GOIA 1XNQK 1JB0C 2D3ZA 3HOSA 5K9FA 4C97A 2KHQA 4DN0A 4OZ3A 4LF8K 4I2AA 3G0ZA 3HHDA 3KJVB 5KG5A 4JI2K 1FDAA 1QTNB 4WK3A 3MMJA 2NRXA 1JRPA 1F44A 3BKTA 4G9ZA 4O9MA 2PZSA 4PL2A 2DNQA 1RAAB 3MM8B 5GINA 4LR7A 2IRXA 4H0PA 3PJXA 4FKYA 3H8JA 3RF9A 4E1NA 5DKWA 4CGJA 3M30A 4LFAF 5A2QU 2MRLA 4C4SA 4KLQA 3QEIA 1CULB 2WZ1A 4I2GA 2JRSA 2R7UA 2E2OA 4RT3A 1X9WA 4F4XA 1WDTA 2VYPA 1TP7A 3CIMA 4JI8F 3EZ5A 5AK5A 5AM0A 3G82A 3D66A 4DR3J 4DFJA 5KFOA 2ZUAA 3MUVP 1P6TA 2YKQA 1TKTB 2ABYA 3IRWP 3DU5A 4OLBA 5J0WA 2QLBB 4DV0K 3NG8A 3L3VA 1UT8A 2HFOA 4J5OA 3PYFA 3QPIA 1IKYA 3AVIA 2G9OA 4HEA9 4W92B 5AM4A 3OHRA 2E8OA 4EX6A 1ZXIA 1C1BB 5E5NA 4B9VA 3ZXWA 4PEOA 3NMAA 2BJ7A 3KK2B 2PKEA 4RBUA 3MABA 2WVEA 5BPLA 3QINA 1X4BA 1HYSA 2F76X 3PW5A 4JYAK 1RQNA 4DU4A 2EDUA 4B9UA 1RAEB 3QJLA 1EKRA 3T1HF 4CEEA 1NZPA 2H9ZA 3SI8A 4KTZA 4PHTX 1MN8A 3ISND 2ZHAA 4CBUA 4LF5J 2ZM6F 4EYHB 5KPZA 4XH1A 3RJEA 4X4PA 4HHHA 1HNXJ 3ZYYX 4LZGA 3C6AA 3OTEA 2NREA 2LQ5A 4RQ3A 2VG7A 3R7NB 5B66U 1WOQA 4RO0A 2P9NB 2O8CA 3SCKE 3KLGB 4DV5J 5D4BA 2YWWA 8ATCB 6FDRA 3I32A 3PX0A 3MPWA 3QB0A 9ICCA 1M1HA 4JI8K 5BPCA 2XO6A 3MGIA 3TR8A 1RYRA 5AQJA 5HNKA 1U2CA 5ALDA 3O3GA 2YNFA 2ZH8A 2JH3A 5EY4A 2WOMA 4IO8A 3AA9A 3JAMU 1SUQB 4OD0A 3I8DA 3GFHA 2AJ0A 5BPNA 2GAGC 4Q0BB 3HF5A 3GCWP 5J2HA 3TEGA 4DS5A 3VQ6A 2VCPA 3IBFB 4USTA 1X4GA 2DGQA 1W7WA 1URJA 3QO9B 1Q7YT 1UA1A 2QTWA 5CA7A 4JV1A 5CZ1A 1RCHA 2YNHB 4OX6A 4KAIA 3M2RA 1LOUA 1HW8A 2U2FA 5SZTA 1KWMA 4AL7A 2KXHA 2WMMA 3H4BA 2E6LA 5EWFA 2R7SA 1X9JA 5GADU 2KKVA 4A8FA 4F3QA 2HHXA 3UM9A 1RHQB 1ZQIA 2ZWHA 2E8PA 4F02A 1JLQA 1HA1A 4HVJA 3KK3A 3G8TA 5KFQA 4DI6A 1W25A 5AQFA 1HJPA 1EETB 1QQMA 4A5BA 3DHWC 4K4SA 4BY9C 5IFMA 5LMUJ 3CJSA 2UXDJ 2XM3A 1URNA 1U49A 2VDHA 3NGTA 3VAJA 7ICHA 1TL1B 3MM9B 4ZIWA 2F8TA 2ITMA 4RTFD 3F5AA 3UDVA 5C7PA 2VV5A 2PFDA 1OQ6A 1U0HA 3CCTA 4USIA 3DGPA 2HF4A 4C8ZA 2HRTA 5AKZA 4QZ8A 4B3RF 2ZKUA 3VR1A 4JKEA 4QIEA 4GV9A 2NS1B 4WWSA 2NPIA 1YT3A 2E7WA 3TO8A 4X4SA 1WG5A 1M0SA 5HR7A 4PGXA 3P5JA 1JL1A 2CA9A 3RMBA 3NL0A 4G1QB 2YH1A 4CO0A 1CZAN 4DV6J 4DTUA 2FF6A 2UXCK 3ENOA 2I5JA 3PXGa 2A0FB 3LP2A 3BGRB 2IOHA 1SJFA 3HSCA 2OPQB 3HHLA 3QETA 3UCUP 2E20A 5J2NB 3CCLN 4L76A 1XS9D 2B9YA 2F7TA 1QLNA 3M8RA 3R7SB 2CZVC 3SXLA 2WAQC 3Q8LA 3BKFA 1NDPA 3CCJN 1DK3A 1WYGA 3SDEB 2GC8A 3LAKA 3RG6A 3LVVA 1QY7A 3M2UB 1IWGA 5CRXA 4F5PA 2GVZB 5EX0A 4YOXA 2BMBA 3L4IA 4KB0A 2CXEA 4ED3A 4FZXC 2DFHA 5C42B 3CC4N 4Y2KA 5DETA 1KNZA 3A5MC 1QAYA 4Y2MA 5D0HA 2F1FA 1VQ6S 3EYZA 2FTRA 2B4PA 4X64J 3ZT2A 4DPUA 3AVKA 2MZQA 4PWWA 4U7UK 4DTOA 5CYQB 4EBDA 1UEUA 2OPSA 3NNAA 2RN2A 2FMSA 2CPXA 4DR3K 1QM9A 1QQNA 2BQUA 5IV3A 1QZ5A 3MOJB 1K1SA 4P75A 2DHXA 3F5TA 3TZZA 3G6YA 1VR6A 3WKDA 1RWWB 2ZH2A 3D2NA 3MN9A 1IM6A 4IYQA 4K50A 2HHTA 1M1GA 4RQ4A 4P2FA 3R6LB 5IIIA 1ZZNA 1TL7B 7ICVA 3PJWA 3DI6B 3T19A 4CGFA 1V3SA 4DCOB 2A1AA 4KO0A 4U6PA 2ITGA 1YRXA 2L5YA 1BQMB 1FE0A 1CXUA 4MF8A 2DH8A 5CH7B 4FLUA 4M04A 1VBKA 3HOTA 4AHVA 3M6KA 2MUTB 2ZWOA 4RT2A 1SWVA 1F9FA 3QFHA 3DM2B 5CQGA 1JLFA 2OGUA 3NF7A 4U8VA 3MX2A 4LF5K 4O5CA 1WKLA 2RQCA 3M8PB 1RAOA 3TAGA 1ZXOA 4H0XB 3KYLA 3TA2A 1JLCA 3MECB 3B4DA 3MBYA 2ZHBA 3MDFA 1RTJB 2UV8G 4DF4A 5DB7A 4G1IA 4DV5K 2BABA 4DQSA 4USVA 4MFBB 2V4QA 4UOCA 3UNGC 4Y0FA 5CCMA 4CIOA 2FVCA 4M5DB 4YHHF 1S8OA 1X5OA 2AT1B 3LDPA 2MZTA 2XTJP 4RNHA 1KTVA 4QS9A 5ETRA 3FEZA 1XIQA 3I82A 4CF1A 2IVMA 2HLTA 3LP0B 2CYYA 4FKXA 4JB3A 5HRRA 4AXIA 2RS8A 3A8JA 2QKBA 2VL1A 5J0XA 1RTHA 2MY7A 1VS3A 4WE1B 1BD6A 3KKSA 1FCAA 3R1HA 1NH7A 1YVFA 4E1JA 3OPXA 4JKCA 1S0MA 2XI9A 2DH9A 3SEOA 3H08A 2GH1A 2QWNA 1ZQBA 2ZDOA 3ZT0A 3QAEA 4XRHA 2VODA 1SI9A 3SQGB 1V97A 4ES1A 3OLBA 2K8BB 1SKUB 4B9LA 3TAEA 1NKBA 3ENVA 3PYGA 1XR6A 1BO5O 1C0TA 2CPDA 3CWJA 1W26A 4EK2A 5AQWA 2HURA 3F2CA 1SIWB 2QYCA 1X5PA 5L1IA 1FRIA 4NJ8A 6AT1B 2M2BA 1XHXA 4ANCA 2J4RA 1RTDB 1FTRA 4CJ4A 5CAAA 1VQPS 3FBFA 4RBVA 1N8RT 3IRXA 5BJRA 2HFUA 1N56A 3CULA 2R8KA 1S77D 3RU0A 1VC6A 1ZQYA 2DCLA 3I5CA 5AI5A 4DTNA 4DU3A 2UXDK 3OTOJ 4YOYA 4JMUA 5AE2A 3NGZA 2JZBA 1CPZA 2KP7A 3JSYA 4ICAA 4ZH4A 4RPXA 1J5OB 4WFAQ 4CBWA 4A2AA 3I76A 3O8WA 2KIVA 4O3RA 1HPZA 2QZ8A 3O9UA 2Q3PA 4Z6DA 3NP5A 1S57A 1NGBA 3W2WA 2QIFA 2DNKA 2BE9B 4FXVA 2MZRA 2Y0SF 1ZAXA 3UVJA 4ALZA 4DCPB 4FN5A 3IAYA 4IQTA 1WNEA 4ZPTR 4NOHA 2YNGA 1NO8A 1PZNA 4WQ4A 1Z4UA 2H3GX 3D2FA 2FHJD 1S1VB 2V94A 3CXCM 1F0MA 2B43A 1H98A 3TWHA 3KKAA 2HNZB 4YY3F 3AB4B 3OTBA 5AI4A 2GMHA 4JI0J 2ACMA 4HTIA 2O66A 4UY85 2KL8A 3ID6A 2Q43A 3N28A 1ZS6A 2YX8A 3C2LA 5DDRC 4RWTA 5AQNA 4Y1CA 1WSHA 3MC1A 3N79A 5I42A 2YKMB 3BS5A 1N61A 2OD6A 4ZPCA 4LUBA 3ID8A 8ICOA 3CMEN 3UDEA 3QEXA 3C95A 4X62F 5LJVA 3W61A 3FZ2A 2RQKA 1V5IB 3CCQS 3KNGA 2HMPA 5KG0A 2DKXA 3DMJB 3BO3A 3ATUA 5AKGA 3SJJA 4L73A 4TSXA 4A46A 5HMMA 4F5QA 4X64K 2M0GB 4BRLA 3QEAZ 2GV9A 3WNHA 4B1YB 1HBUA 2DEIA 3JPTA 4BG8A 2G8HA 7FD1A 3GL1A 4ZK7M 4HH1A 2CGJA 1U8SA 1SV5A 3G10A 4DUTA 1XNSA 2M3DA 2R7YA 3HW8A 1CJKA 1X6IA 5T7LA 1C0UB 4HI1A 3LVWA 2OCEA 2NYHA 4IFYB 5GADI 2KSOA 1VSJA 2W9MA 5M1PA 4AXJA 1DTQA 4LBPA 1BL3A 4CEFA 4YY3K 2OTJN 2A6MA 1ECWA 1FRHA 3PACA 3EL2A 2JOQA 2W4PA 1RWMB 2YMQA 4DL7A 4TUPA 4CCHA 9ICMA 1VRTB 3QIOA 1VQMN 3C6TB 2HF3A 4Z4IA 3EKUA 1DGJA 2WB1F 1CJUA 4JKGA 2A1RA 2A6OA 4GVBB 3FEXB 1LEOA 3LP1A 1CJVA 1BG3A 4E98A 4L72B 3E01A 3HKZC 5ADZA 5A6PA 2O8EA 1YQHA 2XS2A 4DOCA 5L39A 2HIQA 1B0PA 4KHRA 2JX2A 2KE7A 2A19A 4RL1A 4M2YA 1NMNA 3SCJE 2EWHA 5J2QB 3S41A 3JSMB 1WG8A 4P2HA 4OKEA 2PMZD 3HSDA 1VJQA 2GO9A 3B8HA 2Z7JA 2IGIA 2YMLA 1TV6A 2XMJA 3WKAA 1NHVA 4RW4B 2XMWA 1JKHA 1HI8A 1R0AA 2P6RA 4AHTA 4CLWA 3OYDA 1HWKA 4GKKJ 2MKHA 4IFEA 3GSDA 2PFOA 3QGGA 3KOAA 4FJIA 1GOAA 1JXEA 3C29A 1XSNA 2PAVA 4CGHA 2DY4A 2E2PA 3OFGA 3OTOF 4KLDA 1BNPA 4JV0A 8ICWA 1O8BA 5ALTA 4LBIA 2N7CA 1KFSA 3O3HA 1Q86O 1S76D 1U09A 1S0NA 3HRDD 2QA4N 1NRKA 3BBCA 3FZFA 3LDOA 3CPEA 2VPZB 4H4OB 2RDJA 1KN5A 2C28A 1ZZFA 1X2IA 2DHSA 2BJ1A 3TAPA 1EXNA 2B5JA 2PFPA 4FFDA 3CTRA 5LJ3Y 2AZ1A 4XDDA 3CCUS 2F9TA 1DZ5A 4NYPA 4PH5A 3LPYA 3LGMA 5D4OA 3K58A 3NGYA 4A5AA 2G13A 4E8UA 4FWPA 3PHTA 4NYFA 2ZIWB 2MQMA 4BJQA 4NLRA 2ZC4A 5LSRA 4DX7A 1ZM4A 2YNIA 2QFJA 4X5VA 3GG1A 1IG8A 4M3RA 1D8YA 2QA4G 4LIWA 3CC7S 3ZFVA 3H25A 4JI0F 4HR2A 1XMQF 1HRHA 5CZXA 4I29A 2QL9B 1XHZA 3RSEB 2LM4A 3KHLA 4CE6A 4BE0A 4CZLA 4DQRA 1R8HA 3R5GA 3JB9k 3ILOA 3QEBZ 1IR2A 4ED0A 2F65A 2DRBA 1K8AO 3WK4A 1BCMA 3TTCA 4XDCA 2HHPA 1I94J 2HG4A 3WK5A 1M90T 4FVMA 5C0YA 2NSCA 4QNLA 1BCOA 5DDOC 3MM5A 4CO3A 3OTOK 3RJHA 4EENA 4ECSA 1RABB 3MDQA 4UUXA 5T14A 2CNKB 3O6QA 2MKJA 1S9GA 2PMHA 3BREA 3PKMA 2VWBA