4DQIA

Ternary complex of bacillus dna polymerase i large fragment, dna duplex, and dctp (paired with dg of template)
Total Genus 207
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
207
sequence length
579
structure length
579
Chain Sequence
KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural factors that determine selectivity of a high fidelity DNA polymerase for deoxy-, dideoxy-, and ribonucleotides.
pubmed doi rcsb
source organism Geobacillus kaustophilus
molecule tags Transferase/dna
molecule keywords DNA polymerase I
total genus 207
structure length 579
sequence length 579
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4dqiA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4dqiA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4dqiA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4dqiA01
4R8UA 1UOCA 3EPGA 3RB0A 3OYGA 2KFZA 2Z1HA 1S0VA 1S0NA 3UXNA 3VQCA 4ECXA 1Q8IA 1ZQHA 4ELUA 4YR0A 4JV2A 2XY5A 5L1IA 5KFDA 1RDAA 2HNZA 4CIFA 4OJRA 4EEYA 5HBMA 4Z6FA 1R0AA 4F8RA 3OYJA 4CFCA 4DSFA 1J53A 4M45A 5DQHA 1S76D 3UQ0A 4M04A 1TAQA 1UT8A 3LK9A 7ICTA 4AHVA 4DF4A 2KZ3A 7ICIA 2BCSA 3S9HA 4CCHA 1SV5A 4GXJA 1TK0A 5J2IA 2FBYA 1RILA 3FDSA 2W9BB 1IKXA 1VSHA 3JPOA 4QWAA 2W9MA 3E2EA 3UQ2A 4QWDA 5KI6A 3JYTA 4CHZA 1ZQUA 3QIOA 4PPXA 3M8PA 4CF2A 2FMQA 1S1VA 3H4BA 3JPQA 4GC7A 4M3TA 7ICJA 5J2AA 4KN7A 2W8KA 1KFTA 4DTMA 3AV9A 1WSHA 4M3YA 5I3UA 3SYZA 1LW0A 4CFAA 3PX6A 1JKHA 3LAMA 3KLFA 4CJ4A 1JXLA 1KEJA 4PWDA 5J2BA 2P66A 5KFUA 5J1EA 1WSIA 1UWBA 2Z1JA 3DLBA 2RN2A 4N41A 1VSJA 4YMOA 2FPKA 1HUZA 3ZDBA 4FJJA 3ZSYA 4UAZA 8ICKA 3T5KA 4DQPA 4MF8A 3G10A 1BPYA 3V7LA 2GUIA 3AO1A 2OWOA 3RH6A 3Q8RB 3M8SA 2MUTB 3NF9A 4M9HA 1BPBA 3NF7A 3CM5A 3L2VA 2QK9A 3DRPA 2ASJA 2KZZA 4R64A 3PW5A 3NH0A 1ZQRA 1NJWA 4FLVA 4FM2A 5KFHA 4ECWA 3TFRA 1HNIA 3LP2A 3AO2A 4CEAA 3B6OA 1WCNA 4PH5A 4RNOA 3A2FA 1GOCA 4CECA 5KFTA 3PR4A 9ICSA 2IBKA 9ICXA 4Q45A 3ISBA 1GOAA 4F5RA 5CZ1A 4J2EA 1B9DA 4GC6A 3HPOA 4CHPA 4O0IA 5CA7A 2IHMA 4CFBA 1JXBA 3SI8A 4KMUA 3MR2A 3LANA 3ZCMA 3I0RA 2KFNA 1K6YA 1WNSA 4CESA 4O9MA 4QAGA 9ICFA 3QERA 5J2HA 9ICLA 1AROP 1XSPA 2VWKA 5KFGA 3BGRA 2D0CA 2E6LA 1ZQPA 5DDYA 8ICLA 1BHLA 4IBNA 4E7LA 1C1BA 3WNEA 9ICCA 4P4OA 2ISOA 3AVKA 3HWTA 2HVIA 3BQ1A 2E4LA 3LP1A 1ZQLA 4Q44A 2Y1JA 2A1JA 3VQAA 5KFAA 4CEOA 4DTPA 2BPCA 1VSMA 3OYLA 2P5GA 1V9PA 3DLHA 4DOAA 3KK3A 3L3VA 1DLOA 9ICNA 3KKRA 3QE9Y 1ASWA 1IXRA 3IHQB 4YR2A 5EOZA 3K5LA 5DGAA 5HNKA 2A1RA 4ECTA 4PGQA 3RBDA 4MF2A 1T7PA 2WONA 4KB1A 3GV5B 3KTQA 4KO0A 4I2AA 4PY5A 4KHNA 1I39A 2ASLA 8ICOA 4B9LA 5KFOA 1TKTA 5IIMA 2D0BA 1ZBHA 3TFSA 3BQ0A 4AHUA 1U04A 3QINA 3L3UA 3VQBA 2RKIA 4O3OA 4MFFA 2NRVA 9ICMA 4HCBA 5FRMA 2ZE2A 1Z3EB 4Z4FA 4M9NA 4JS5A 4H4MA 4ELVA 3D0PA 1Q9XA 1DOQA 4B9SA 2ZUDA 1RT4A 2B6AA 3HYFA 4LSNA 1HUOA 4M42A 4DFKA 3VQ8A 2BQRA 2BGGA 4CJQA 4DO9A 3NDKA 4CHYA 4DU3A 4CF9A 3K4GA 3K58A 4KLEA 3HP9A 3LDSA 3V9XA 2QKKA 4ZH4A 3OVNA 3DM2A 1CEZA 3VA3A 2DTUA 1RZTA 1ZQDA 2F96A 2BKEA 4KLFA 3O3FA 5DBBA 3N97B 1W9HA 4IDKA 4NCAA 3C2MA 4OPKA 4BWJA 3L2UA 2ZJAA 3MGIA 4BWMA 7ICUA 4KTQA 1VSKA 4RQ5A 2V4RA 4ECRA 4YG2A 2IS3A 4O4GA 3M9MB 2P51A 3KK2A 4RW7A 1LWCA 4F3TA 2X78A 4O3SA 4ID5A 5DB7A 1BIZA 4XA5A 3GIJA 4K4IA 4TQRA 3AVFA 4KHQA 4QZIA 4YD2A 2VA3A 4CIEA 5J2DA 3O4QA 2YV0X 1A77A 4QZAA 9ICIA 2XY6A 3ZDAA 1TAUA 4J9MA 4YFKA 8ICBA 4JV1A 1JLQA 4RUCA 4KLDA 1EXNA 1SUQA 4CJEA 1XO1A 2G8FA 1C0UA 7ICPA 4I2QA 9ICUA 3KJVA 1D8YA 5KFEA 1JLFA 3KD5E 5KFJA 4O3RA 3K2PA 5IIKA 1RBRA 3BQ2A 4CJWA 4FJGA 1BPEA 2P1JA 4PGYA 1U48A 3H4DA 3EYZA 3OYFA 2IMWP 4ECQA 4E0DA 1VSFA 3HM9A 3NGIA 2OZMA 4I29A 1H38A 3TWHA 4PA1A 3ALYA 2FMSA 2BCRA 8ICSA 4UQGA 4O44A 3ZT1A 1JLGA 9ICVA 2LSNA 4CFDA 3BJYA 1VSIA 3LZJA 5D3GA 4I2FA 3ZSOA 2DY4A 4Q0BA 4TUQA 4CK2A 2JEIA 5L1LA 1TL3A 5C5JA 4ECZA 1T03A 1C1CA 1KCFA 3SPYA 1BVSA 4J9RA 3OYKA 1BISA 3HT3A 3TAEA 3EY1A 1KLNA 2ZUCA 3TAPA 3TI0A 3IS9A 3VQDA 1COOA 8ICXA 1IKYA 4DMNA 1RDCA 2VG6A 4NYNA 4CIGA 4M41A 4ZTFA 1PZNA 2IHNA 1RT3A 3T5HA 1F21A 3C5GA 2X6NA 5J2GA 1SKWA 2RPIA 1LW2A 1LWFA 4TUSA 3V7KA 4UAYA 1ZQKA 4PHPA 1D5AA 4CGIA 4ID1A 3MFHA 4CGJA 4J9LA 5IIIA 3IM1A 1S1WA 4G1QA 1G15A 3FYHA 2KW4A 4BDPA 4IG0A 3D45A 1ZQOA 4EP5A 2NRXA 4F50A 2GBZA 3SJJA 1RXWA 3DRRA 1LAVA 3ISDA 2NRZA 1S77D 5HP1A 4OVLA 2B5JA 8ICTA 1X1PA 4PHDA 2I1QA 7ICSA 3P83D 4GXKA 1KRPA 2OA8A 4NCBA 1HJRA 4DTXA 3WNHA 8ICRA 4DOBA 4NLNA 2ZTDA 3LPUA 3EW9A 5DG7A 1C1AA 5J0RA 5KFPA 2BCQA 1NOMA 4NXZA 4FO6A 3RMCA 4IFYA 3GIIA 4KHUA 5J2FA 4C8KA 4B9VA 1RT6A 4UB2A 2ATQA 5HP4A 2C22A 4K8XA 2BPFA 1CUKA 4CJTA 5EWEA 4CJVA 2ASDA 5KG3A 4YXJA 2MAXA 4RT2A 4FLYA 4QWEA 4N56A 1CZBA 1WSFA 3C95A 1A5VA 1C0MA 1QQCA 1ZBUA 1SKRA 8ICUA 4QZ8A 4MEYA 1IKWA 4J2DA 1WAJA 4N5SA 2BPGA 2IAJA 3U3GA 4CK1A 4KI4A 5IILA 1DTQA 2OYQA 2DFHA 4YFUA 3C1ZA 2AU0A 1ZQSA 2Q3SA 2YKNA 4QZFA 2C2DA 4UB3A 4DTRA 1RPLA 4LY7A 1W0HA 3O3GA 3OS0A 4RW8A 4YXMA 1N5YA 4K8ZA 1NOZA 1ZQGA 4B3OA 3RJJA 4PUOA 2YNGA 3H7IA 3UPQA 1L3UA 4I2BA 2PXIA 1RTIA 3HXMA 3VQ7A 1EXQA 3QO9A 3GDXA 1JLBA 1YTAA 7ICHA 4L8RB 3GIMA 3ETLA 2MUTA 4CGHA 4RQ3A 4KKOA 1N6QA 2G8WA 5J2EA 7ICMA 3G6XA 4DLEA 2F1IA 3BQTA 3GQCA 1HYSA 3RB6A 4FJ9A 4F92B 3NCIA 2PYLA 5KG1A 3AA2A 3LALA 1TVAA 3RR7A 1RBSA 2ETJA 1TL1A 4FM0A 3OS1A 3ZD9A 3E01A 3RRHA 4MFAA 3TAQA 3S3NA 2J6UA 1EX4A 5KG6A 1WSGA 1S1XA 4E3SA 4CK3A 1BGXT 3NF8A 4F4XA 3PV8A 2YNIA 4B9MA 2PI5A 3L2QA 3SQ2A 4M0AA 3Q8PB 5KT5A 3M9OB 1S97A 1MQ3A 1RTHA 3AVAA 1QSYA 1XSNA 2D0AA 3U6FA 3C5FA 1JX4A 1KTQA 2FPMA 1K1QA 4BE1A 3OSNA 1EKEA 3OYAA 1EETA 5KT3A 3V4IA 3AU2A 1FXXA 1TGOA 3H8JA 4ED8A 4ECSA 4ED2A 4LH5A 3QESA 4Y1DA 4M3ZA 3LPTA 4KHSA 3WNGA 2BHNA 9ICQA 5DLFA 4PHAA 4RQ6A 2BQ3A 3OSPA 1ZQJA 4DL3A 1BCMA 3NBPA 4CJSA 4DSKA 4F5PA 4QZ9A 4DS5A 1NOYA 3UXPA 3RMAA 3TANA 2X74A 4F3OA 2XHBA 4QZEA 4FZYA 4K4HA 5EWGA 9ICKA 4OLBA 1U47A 3DLGA 1XHZA 3LP0A 5KFZA 3PW4A 3OYEA 9ICTA 1B92A 3OYCA 3RH4A 4UBCA 4O55A 3AVHA 3PW0A 5J2MA 3KLGA 4FZXC 5L9XA 1ASUA 4XQ8A 1NKBA 3RAQA 4IR9A 1YT3A 1Y97A 3OYMA 5J0TA 3THVA 5KRTA 4M6WB 2H5XA 9ICRA 1CXQA 4UB4A 4LVSA 4CJKA 2ATLA 2RDIA 4CGFA 4M9GA 2HVHA 4EBDA 1X9MA 3HJFA 4R8UB 4KLIA 4O3PA 3MBYA 3KHHA 3SI6A 4FK2A 5DBCA 1NK8A 1TKXA 3V81A 4J9NA 4RQ1A 4W5RA 4UBBA 3SZ2A 4FJXA 5KFVA 2HHUA 8ICWA 3MFIA 4I2DA 4CEDA 4RW6A 4N47A 5KFKA 4DLGA 4KLSA 3T5JA 4Z6CA 1WAFA 5HRSA 3QEIA 4KB0A 3OHBA 4FK0A 1U49A 1L5UA 3AVCA 1ZBFA 3TAMA 8ICVA 4CEBA 3OYHA 5CJ7A 4GLXA 2ZJ5A 2EX3A 4Z4IA 1RDDA 1ZBIA 5KFQA 5KFWA 3H40A 3T3FA 4FJHA 2HHVA 4KV8A 2G8UA 4RPYA 3QZ8A 7ICOA 2AGOA 9ICAA 2YNFA 3ZT3A 5KRSA 4JV0A 1XI1A 2DFFA 3RJEA 3VA0A 4LD0A 1A76A 3ZSQA 2YNHA 5KFFA 2W9CB 1HQEA 3HSTB 4E7JA 4F2RA 1QTMA 3G6YA 4RNMA 3B0XA 3K5NA 3M8RA 1S0OA 4RPXA 5J2PA 4RNNA 4RQ2A 4C8OA 5J0YA 2AGQA 4DL2A 1S9FA 3IAYA 3QEAZ 4FJLA 4BE0A 2F1HA 2V4QA 2UVVA 5KT7A 3HVRA 3V6DA 1XHXA 3ZDCA 1T3NA 3TAFA 3PO4A 3S3MA 4QZHA 2ZD1A 4OKKA 4I9LA 4P4PA 3CFPA 3TQ1A 1ZQCA 2AQ0A 2IGIA 5KT6A 1BCOA 2XCPA 2ZTCA 3RH5A 9ICGA 4I2CA 5KFMA 4CF1A 1HMVA 2VA8A 1SL1A 4FS2A 4FYDA 5KFNA 3RB4A 4CJ5A 1BI4A 5HLFA 1TV6A 4EP4A 9ICEA 4KLGA 3LWLA 4CEZA 1VK0A 3GILA 1QSSA 3AVGA 4J2BA 4M9LA 4HVJA 1NKEA 4RQ7A 3DLEA 5KFBA 2FC0A 4YNQA 2FLLA 4Z4EA 3PUFA 5SWMA 4AILC 4UAWA 3DLRA 1L3TA 3JPRA 3KD1E 4FLUA 3ZDDA 3H8WA 1T05A 3H8SA 5HRPA 3QEWA 1QE1A 5F9NA 3MR6A 1NKCA 4OLAA 1Z00A 3HK2A 4KLUA 1S6QA 3KHLA 3VN5A 5KFLA 3GV7B 3RR8A 3I0SA 5J0PA 2ALZA 1YVUA 1S9EA 1Z25A 4F4ZA 2WTFA 3MEDA 4IKFA 5KT4A 5DDMA 5IINA 3P1GA 4RQ0A 2NUBA 1D8LA 4I2EA 4KAZA 4IQVA 3OJUA 4JRQA 4TURA 4DF8A 3MECA 3AVLA 3C2LA 4B9UA 1QS4A 4OPJA 2F1JA 3V9ZA 1ZQYA 4KRFA 3OHAA 4CEFA 1BQMA 1HNVA 4RQ8A 4QZDA 3HP6A 8ICFA 2M9NA 4FW1A 3I8DA 2C2EA 1S10A 1FK9A 2HMIA 3PMLA 1RT5A 5KFRA 2PFOA 4RUAA 2VA2A 3NTUA 5CYMA 4ED3A 4KN4A 1RT1A 4CGDA 1ZQVA 3OYBA 4JWNA 1S0MA 1JXEA 1ZQXA 7ICFA 4J9OA 2R8JA 1N48A 1S6PA 5DGBA 4PGXA 3TARA 4YD1A 3C23A 1BPZA 3KIOA 3VQQA 3CFRA 2BQUA 4CF8A 1X9WA 2E6MA 4AHTA 3NGYA 7ICGA 4ZTJA 4EZ9A 1IM4A 4GVMA 3LWMA 2XO7A 4IR1A 4I2IA 4UB1A 3KHGA 4DOCA 3Q8LA 1JL1A 3OYIA 5BOMA 4ED6A 8ICEA 1JL2A 1ZQIA 4M3UA 4Q43A 1U9LA 3RMBA 4BXOA 4IG3A 9ICPA 4DL4A 3AUOA 5J29A 4KHYA 3SNNA 5KFIA 3DRSA 3AO5A 7ICEA 4KTWA 2VG5A 4FW2A 4DL5A 5CP2A 4F5QA 2PZSA 9ICWA 2F8TA 2AJQA 3AO3A 1ZJMA 2HHXA 3NGZA 2JEJA 4AHRA 9ICOA 3SUPA 2ZJ8A 3MEGA 4FCYA 4QWCA 2RF2A 4JLHA 4O5BA 1KDHA 2C28A 1UA1A 1TV9A 2ZQBA 3O3HA 4KITB 1B22A 3QEXA 3DOLA 5I42A 4HHTA 4OGEA 4NY8A 3DYAA 3K5OA 1B43A 4H4OA 4HUGA 4DU4A 3AVNA 4E89A 4CHNA 5KFYA 3V72A 4NLZA 1ZQFA 1U4BA 3JPPA 4I27A 4E1MA 4EBCA 5KFSA 1ZETA 4QZCA 4DWIA 3AU6A 4RT3A 3KLIA 4BGDA 1KLMA 3Q8QB 1XS9D 3GV8B 2XGQA 5J2QA 4JWMA 4M9JA 2D5RA 3SQ4A 3SPZA 4J9PA 3QLHA 4NM1A 2FBXA 2QXFA 4PQUA 2VWJA 3PX0A 4CEEA 8ICAA 3DMJA 4RQ4A 2YKMA 3NF6A 4KLJA 2FLNA 3OJSA 3AVJA 5BOLA 4O5KA 3LDAA 4F2SA 4I2PA 4O5CA 4CHQA 2XGPA 4NLGA 4QZGA 4MQ3A 4XRHA 2PFPA 3NE6A 2R7YA 4F93B 3MXMA 5HMLA 4HTUA 3T1AA 4FJMA 3OYNA 4CERA 2IOCA 1BPDA 2C2RA 1LAWA 4TUPA 4RU9A 4W5QA 8ICPA 1ZJNA 1VSLA 2BANA 3HX0A 3CM6A 2J6TA 4F4KA 4YP3A 1UT5A 3CQ8A 3HW8A 3ZSWA 4W5OA 4FLXA 3V9UA 1MU2A 3OS2A 1IG9A 2IC3A 3V6JA 4QW8A 4YCXA 1MSWD 4KLOA 2BGWA 1D9DA 1FKOA 2WOMA 4R66A 3V7JA 2XY8A 4DQRA 4RPZA 2F8SA 5J2KA 7ICVA 4P2HA 3ZSRA 4I28A 2HB5A 1NJXA 3WNFA 5J0QA 4KPYA 4QCLA 1ZYQA 5IIJA 4ECVA 3SUOA 4QOZB 7ICKA 1A5WA 4LZGA 2BDPA 3LAKA 3MDAA 4HUFA 4KREA 4TSXA 2W42A 2JZBB 1BL3A 3V1RA 4CE9A 3DLKA 1KVBA 2KTQA 3V9WA 3DI6A 5DG9A 2O4GA 5IIOA 2XC9A 1RTJA 3RBEA 5D4BA 3GFKB 4E7IA 4DL6A 3RAXA 1UA0A 4ELTA 8ICIA 3RJHA 1X9SA 3JPNA 2HHTA 5C24A 3VQ6A 3VQEA 2R8IA 2I9GA 3AVMA 1MC8A 1JIHA 3HVTA 4DTNA 1CLQA 4C8MA 4DSIA 4AH9A 1NK0A 1O1WA 3PW2A 5F9LA 3NH2A 1QLNA 2UVWA 2R8HA 3HPHA 4BXOB 4R63A 1Z26A 5J0UA 5DLGA 3PW7A 2V9WA 4LZDA 1DGSA 4DFMA 3M9NB 5J0SA 3SCXA 4GXIA 1T8EA 3AVIA 4DQQA 3PO5A 1RYRA 2ISPA 1BQNA 1VRTA 5CY4A 4Z0UA 4K4GA 1ZBLA 5TZVA 1Y88A 4M6WA 5KGXA 3KLEA 1CXUA 3KK1A 4J9SA 3ZDEA 4FJNA 4KLTA 3MXIA 3TR8A 3AO4A 3ULDA 1KSPA 2BR0A 1VSEA 3MEEA 4OKEA 1VRUA 2OPQA 4IQUA 4CGGA 4RW9A 3K59A 2G8VA 4QW9A 1BI4B 5KT2A 4O0JA 4Q8FA 1RT7A 8ICYA 4ECUA 1XSLA 1JLCA 5CWRA 3IG1A 2HHQA 5CZ2A 3LP3A 3C6UA 3Q8MA 4ZHRA 2PFQA 8ICZA 1UAXA 4I9QA 1K1SA 4MEXA 1NK5A 5J2NA 3PMNA 3HPGA 1ZQNA 4DG1A 2P6RA 3RJKA 1LWEA 2LYHA 2W9CA 4FK4A 4FS1A 3CG7A 4BDZA 4CF0A 3MXJA 2OZSA 3ZD8A 3V6HA 2W8LA 4YQWA 5HRNA 1HYZA 1ZQQA 1N56A 5HMMA 4EYIB 4LH4A 1X2IA 4FVMA 4ECYA 1XU4A 5KG2A 1MQ2A 4NLKA 1DTTA 3MAQA 1I3AA 4KLLA 4O3NA 4UB5A 4Z6DA 4F5NA 2VG7A 4IQWA 4YVZA 4NM2A 1A5XA 1ZQTA 4IFVA 1NK9A 9ICBA 1WN7A 5C42A 3HO1A 4FM1A 3C6TA 3G0ZA 1WCLA 1NK4A 1QHTA 4F4YA 2AGPA 4G3IA 4MFBA 4KLHA 8ICCA 1KFDA 4DTOA 2YHAA 4BE2A 2G8KA 1TK8A 5JS1A 1JLAA 4KI6A 1NK7A 1L3SA 1RDBA 3M8QA 5T7BA 2PI4A 4C8LA 4ED0A 2UVUA 5DMRA 4XIUA 2KQ2A 1JN3A 5SZTA 2NRWA 4AHCA 5HROA 2OPPA 2A1JB 3RWUA 5KG0A 1TFRA 2A1SA 1JMSA 5EWFA 3B0YA 4DQSA 4FBTA 1NJYA 2JGUA 3VQ4A 4I2HA 1XWLA 1WSEA 1Q9YA 1J54A 1KVAA 1KFSA 3TAGA 2RDJA 3ZSXA 4TQSA 3TABA 4NYFA 3QEBZ 1LB2B 3PVXA 4Z4GA 2ZTEA 9ICHA 4CEQA 3PX4A 4FJ5A 4YMNA 3RJGA 3CFOA 5KGWA 2DFLA 5EU7A 2Z1IA 1S5JA 4IRDA 1RYSA 2I5JA 4CJ3A 4F91B 1XC9A 3ZSVA 1C6VA 2JEGA 4J2AA 2IDOA 4CHOA 1RBUA 1BIUA 3GIKA 3MGHA 3EWAA 2PFNA 4FBUA 5JS2A 3L2RA 4Q8EA 1BPXA 4KTZA 3KKSA 3P5JA 2FBVA 4B9TA 4B9NA 4ICLA 3F9KA 3RMDA 3V1QA 4RW4A 3EPIA 5KG7A 4Z4CA 4JK1A 3QEPA 4IRCA 3V1OA 1IH7A 4E7HA 3K57A 2FPLA 4FLWA 4J9QA 3MR5A 3H08A 4BACA 2FBTA 1L3VA 2ITGA 3SQ0A 4C8NA 4DEZA 3T19A 3MDCA 1ITGA 1TKZA 4JUZA 2AQ4A 4JRPA 1C0TA 1RXVA 1ZQEA 3OGUA 1ZQMA 3ISCA 3OY9A 3SUNA 4YMMA 3O4NA 7ICLA 3PR5B 3JPSA 3ORYA 1VSDA 2XY7A 4EZ6A 4DQIA 3QIPA 4W5TA 3JSMA 2B21A 4CJRA 5DK5A 1U45A 2B4JA 4I2GA 3ITHA 3ISNC 5CR0A 4DTSA 4E19A 3C21A 3N4MB 4M3XA 2G8HA 3RJIA 1T4GA 3QNOA 2FMPA 1RBVA 3HL8A 5KG5A 2XCAA 4FLZA 4QZBA 2W9BA 4I7FA 4FJIA 5D49A 2KZMA 2OPSA 3G6VA 3T5LA 4DFJA 4HUEA 1S1TA 3UIQA 4FJ7A 2BCVA 1TVRA 5FDLA 1JLEA 1ZQAA 5KFXA 2X6SA 4B8AB 1EP4A 1TKDA 5J0WA 4CJPA 1IKVA 4GMJB 2Z1GA 5L1KA 5D46A 2W9AA 1J5OA 1NK6A 2HNDA 3AA4A 5FROA 3V9SA 3MR3A 3UXOA 4H8KA 4RZRA 1RTDA 3PNCA 3JPTA 2JEFA 5HRRA 4R5PA 5CB1A 4Z4HA 2BCUA 5E41A 3LZIA 1S9GA 4IQTA 3C2KA 4F5OA 2HHWA 3VQPA 3ZT2A 5DKWA 3OYDA 4FJKA 4KLMA 4GW6A 1IO2A 1C7YA 4M3RA 4Z6EA 4FLTA 4DTJA 2VANA 4MFCA 4FZZA 1RBTA 4OKJA 1NJZA 3IRXA 4EBEA 2NRTA 2XRIA 2BE2A 2ZUBA 5KFCA 2R8GA 4Y1CA 3RRGA 4M2YA 3RTVA 1HPZA 2DPJA 4I2JA 1SZPA 3L8BA 1HYVA 9ICJA 4YR3A 3EZ5A 4HYKA 1LV5A 8ICGA 3RJFA 3PY8A 3QEVA 8ICNA 4NCGA 4RG8A 1B9FA 2HHSA 4KFBA 4LSLA 4HCCA 4O5EA 2JLEA 4CJFA 3K5MA 8ICJA 5DG8A 3KLHA 2GWSA 1RCHA 5DB8A 4YN4A 3VQ9A 4P4MA 5FRNA 5DBAA 3ZT4A 3Q8KA 3F73A 2PY5A 4O3QA 5BPCA 3Q8SB 2P6UA 5DQGA 4DSLA 3SUQA 4ED1A 4DFPA 4Q5VA 4B08A 4ED7A 2O4IA 5CHGA 3K75D 4DL7A 2Q0ZX 3V6KA 3AVBA 1TK5A 3ASMA 4DU1A 2YHBA 1SKSA 4AHSA 1SL0A 4F4WA 2HNYA 4CJUA 1REVA 1QSLA 4BDYA 5CYQA 4XUSA 3FFIA 1D9FA 5KG4A 1FKPA 1ZQWA 1S1UA 2GV9A 4E7KA 3MABA 4N76A 5J0OA 3C94A 1RNHA 2P5OA 4DSJA 2QKBA 3NFAA 5J0XA 1CZ9A 1SL2A 3NHGA 1HJPA 4E1NA 7ICRA 1HQUA 5L1JA 2EHGA 4JS4A 4FXDA 1ASVA 1WLJA 3SQ1A 3QNNA 3C1YA 5DB9A 4X5VA 3CYMA 4DTUA 8ICQA 2PYJA 1GOBA 3SV3A 5DQIA 4OGCA 4R65A 4IRKA 1ZQZA 2Y1IA 5JUMA 2R8KA 8ICMA 2UVRA 1HRHA 3NGDA 5C25A 5HHIA 4WE1A 4PHEA 3AA3A 7ICQA 4DSEA 5J2JA 1Z00B 2HW3A 3BDPA 8ICHA 1RT2A 3RB3A 7ICNA 3S3OA 4M3WA 2J6SA 3QETA 2OPRA 2FLPA 4W5NA 5HHHA 5K14A 3VQ5A 5KTQA 5DB6A 4M47A 3L2WA 2KN7A 3NH1A 4KLQA 4KHWA 1KVCA 2DPIA 3KHRA 4B8CA 2JZBA 4QWBA 3QZ7A 3B6PA 4DS4A 2G8IA 4FJ8A 3ZT0A 4J9KA 3U3YA 4CJLA 1WSJA 1J9AA 3NAEA 2IA6A 2DFEA 4EYHB 1ZQBA 5J2CA 3DOKA 1YTUA 3SV4A 3ZSZA 3AA5X
chains in the Genus database with same CATH superfamily
1PKUA 2VGNA 2V6AA 3RB0A 4I2QB 2AEMA 2KFZA 3VZIA 4CO4A 1OY8A 3CWJA 1TR0A 4PQUB 2H1YA 4JK7A 4JV2A 2WB1D 1N0VC 5KFDA 1RDAA 2HNZA 3NS5A 3QXGA 4OJRA 3MWPA 5DM7L 3OYJA 2RB7A 2RIJA 5ETKA 4KH4A 4AXJA 4M04A 3UO0A 1TAQA 1BDGA 4B1XB 3KK1B 2KZ3A 1FWLA 4PWUA 3L4IA 5T14A 5LMUJ 1TK0A 2R7VA 4OPHA 4YMEA 5J2IA 1HNZF 1KLMB 4M8LA 1VSHA 5H1SQ 3JPOA 3E2EA 3UQ2A 4W98A 4ZVTB 4LF4F 3QRPA 1CVJA 3M8PA 2RKIB 3R9LA 3JPQA 4M3TA 5J2AA 4KN7A 2W8KA 4CH7A 3M2UB 5I3UA 3EZWA 3QPIA 1LW0A 1WHXA 4CFAA 5BPLA 1JKHA 3KLFA 2KRRA 2YHXA 1JXLA 1EETB 4PWDA 5KFUA 1QVFM 5J1EA 2M0NA 2PAVA 1F6TA 3I96A 4JI5J 2Z1JA 3W5ZA 2RN2A 4YY3J 4BC5A 1NGEA 2JGAA 4YMOA 1HUZA 2ACMA 5ALKA 8ICKA 3ISZA 3G10A 3GP9A 1X3NA 4X64K 3M2RB 2OWOA 4B3SJ 2LHTA 3FKBA 2ASJA 2CN1A 1SWWA 4JMUA 3C16B 3ONNA 4R64A 3D2EA 2IVMA 1FKPB 3QMQA 1XR7A 3JS6A 5GADI 4FM2A 2ZIVB 4ECWA 3G82A 1N5XA 4GVEA 2H3ZA 2G0JA 3DOMB 4CEAA 1WCNA 2YMPA 1SJFA 3OL7A 2H65B 3MI7X 4CECA 3ZC4A 5KFTA 9ICXA 1PK1A 4Q45A 2R7WA 3ISBA 1HWJA 2M52A 2UXBJ 4GC6A 4CFBA 3HOSA 1JXBA 1SV4A 2EEYA 3CJKB 3AA9A 1X6JA 2V63A 4OYZA 4CESA 5K4LA 2ZWOA 1IV8A 3MR7A 4QAGA 9ICFA 5J2HA 3T1YF 1YUWA 2NRHA 4ZVHA 2FZKB 5B08A 2GIRA 1Q16B 3WNEA 3P39A 9ICCA 2OPQB 3OV7A 3DLGB 4LBIA 2XIDA 5HAOA 1XNRJ 2FHJD 3BQ1A 1ACMB 3LP1A 1ZQLA 4Q44A 4PKIA 3J80U 2Y1JA 2QYCA 4JYAK 2A1JA 4MAKA 4QIVA 3OYLA 2KM8B 2LDIA 4BRQA 5AICA 3X1LB 3L3VA 1SV0A 9ICNA 4OYBA 5K8OA 1IXRA 3IHQB 2ZC4A 3K5LA 3W9JA 3KDOA 5HNKA 1U1KA 2A1RA 3SD7A 2ZKTA 1X4HA 4PGQA 4A8EA 4PJ0U 5ADXA 3RBDA 4EGLA 4DR3J 1T7PA 3GV5B 3N4QA 3RYLA 3PM9A 2KL8A 2PA3A 4PY5A 2F65A 4QYZJ 3ID6A 1TL3B 2ASLA 4KO0B 4B9LA 2CH5A 3FZFA 2P9IA 3BQ0A 3QFWA 4ATNA 3HSCA 4FP9A 3NNCA 2D6FC 3C14B 5BR8F 4FF2A 1EAYC 4O3OA 1DQ8A 4HTJA 1FFGB 2NRVA 1HBOB 2CJ9A 3TTFA 3OTOJ 4FFDA 1Z3EB 2DB1A 4M9NA 1QZ6A 1NDPA 3K89A 1BWVA 3D0PA 1Q9XA 2W2MP 3O9RA 2E7WA 3EE3A 1NGIA 1YVFA 4Y0WA 3UI3A 2CQ1A 2DGTA 1TL4A 3FEXB 5AE2A 3SEIA 2BGGA 5CZXA 4CJQA 4ZOHC 4NXNJ 2DR8A 5J2MB 3V9XA 2QKKA 3RBXA 2WC9A 5LL6Z 3OVNA 3J7AN 1IQZA 3VA3A 3EWGA 1JB0C 1ZQDA 3WKAA 5F8IA 4KLFA 3O3FA 3CD6S 3EXYA 2BKNA 1C20A 3NVMA 3ZZOA 3C2MA 4OPKA 4BWJA 2RE1A 4BWMA 1VSKA 5C10A 1KVKA 4NASA 1QH9A 4ECRA 3TADA 4IG3B 2C1EB 2P51A 1RDWX 4M5IA 4NLYA 4RW7A 2QXLA 3HLUA 2OEMA 4E8UA 1B0VA 1CBKA 4ID5A 5DB7A 4CLTA 5AQJA 4QOTA 3FMWA 4TQRA 4YD2A 2VA3A 5ALEA 2MSNA 3JAMY 2UUTA 2YV0X 4P2MA 1GX6A 3VETA 4FXVA 2Q0RA 3C46A 1HNIB 4YFKA 4JI4F 4LIWA 1JLQA 4RUCA 3WKEA 3AB2B 3N5FA 1HBOA 1T3VA 2R7OA 2YNIB 7ICPA 4A62A 1S3XA 9ICUA 2GUPA 1VQOS 3BEXA 3HTVA 1D8YA 2BJ8A 2QE5A 3PIOL 2WVEA 1GX5A 3JTOA 1Y3KA 5IIKA 1CQNA 3MD1A 1XNRK 3VAGA 3EYZA 3BGFA 2KU7A 2CDRB 2IMWP 1WOOA 3HM9A 1QAJA 3GYGA 4OZ5A 1JI7A 4ANCA 4CF3A 4I29A 5EHHA 3ALYA 4AQYJ 2DL0A 4UQGA 2G06A 1CI4A 4FKXA 1TV6B 1YRXA 3FZBA 1GH8A 3M1VB 4FWNA 1ZRMA 3VAKA 2Z8QA 1FKOB 5KAIU 1UPPA 4CK2A 4BREA 4PG8A 1TL3A 3SR6A 5C5JA 4M5JA 3ZO7A 1KCFA 1DZ5A 2GHPA 4J9RA 2QSFA 2EAPA 1BMQB 1KLNA 1Y9OA 3TAPA 3EMTA 5E79U 5J8YC 2VKQA 2YKQA 4M5MA 3R6LB 3A5OC 4QU7A 4GV6A 4HH1A 3TUJC 1VC0A 2C2OB 2W2NP 4B3TF 2X6NA 5HLFB 1NHVA 1SKWA 4RUBA 2RPIA 3V7KA 2B8PA 3H3OB 4ZJLA 1RWWB 2XMTA 3QAEA 4ID1A 1TE2A 2GO9A 3NUQA 3IM1A 1CJVB 1S1WA 4G1QA 1B0PA 2OIHA 1UEKA 3W62A 5CD4H 2UXDK 2KW4A 3VPZA 3D45A 1BE4A 1ZQOA 4JKAA 2F9WA 5GADP 2CPEA 1EQYA 4C1NI 3JS9A 3VOVA 4F9OA 2B5JA 2W41A 2I1RA 2GGPA 2YX4A 7ICSA 4GXKA 3IBPA 4JI0K 1KRPA 4AYBD 3DLLQ 1HJRA 1ZM3A 5ITHA 2ZTDA 3LPUA 4GKJJ 2YCHA 2FTRA 4RBUA 2HGMA 1R6VA 4G9BA 5ETVA 2NYVA 3GE9A 4X4PA 4KC5A 4FO6A 4IFYA 4FWSA 3GIIA 2R9LA 1M5PC 2VPZB 3CMAN 5J2FA 4B9VA 5HP4A 3W7BA 4CJVA 1R8HA 5AXMA 3AAPA 4YXJA 2MAXA 2Q3PA 4G1IA 3G8TA 3C95A 3THWB 1NHUA 1A5VA 4ZP6A 1XMOK 4CF5A 4QZ8A 1NB2A 4PAAA 1KQSR 2RS2A 3H25A 4CK1A 3NAIA 4RO0A 4X66J 5B0CA 2MRLA 2OYQA 5L46A 3DLEB 4D3HA 3C1ZA 2QTDA 2BKOA 3IM9A 3VV2B 4ZLLA 2B4VA 2GLEA 4DX8H 1VHIA 3MEEB 3OS0A 4US8A 1N5YA 1WEZA 2CQHA 1FWPA 2O8DB 2YNGA 2YWKA 4GIBA 1RTIA 3BGUA 3VQ7A 3H42A 4FVCA 3QO9A 5A8RA 1WI8A 2GQ2A 5GMKa 4CGHA 2F8KA 2CDQA 4LSZB 2CGLA 5J2EA 1FDDA 2B7BB 3EGVA 5HO4A 3G6XA 2F1IA 1Y5IB 3BQTA 2X1GA 3F41A 5KL8B 5HR6A 2ZBIA 2MZQA 4CW7B 4NLSA 4FJ9A 1MLAA 2RT3A 4X62K 3EUNA 4F92B 4YOYA 2ADBA 2WHEA 4I6MB 2B7CB 2E7VA 2DPNA 2V7YA 4X64J 3PIPL 3AAWB 4GVBB 2EPIA 2CVIA 2HURA 2EI5A 1HUXA 3RRHA 4UOFA 4BGAA 3TAQA 2V8VA 4AUKA 1S1XA 2GO7A 4E3SA 5ETSA 4Z7YA 2A42A 2M7SA 2ZGYA 3FC4A 1W7AA 1P9QC 2DNRA 2VL1A 3L2QA 2WRMA 4LF5K 5KT5A 1N0UA 2GMHA 2VZ9A 4NO7A 3KVGA 2DGOA 2H3FA 2FJWA 2R3VA 1ZZNA 4AL5A 4HTLA 1K1QA 3G4SN 3OSNA 2ASOA 5DM6Q 3FZLA 5L9NA 5E3AA 1SXLA 1NU0A 4YB5A 3QIDA 1KQQA 3K8WA 1FXXA 1TGOA 2FUG9 4ED8A 2GAGC 4GKJK 1JJHA 3D1OA 1HBNB 4Y1DA 1YJUA 4DOZA 3JQKA 2ZH1A 2HK2A 5DLFA 4RQ6A 1ZQJA 5A8WB 4DL3A 2NCKL 1BCMA 4CJSA 5F3ZA 4DS5A 1KKXA 3ETOA 1K8AO 2EKYA 2XM3A 3D6TB 3R1XA 2HAIA 1RQ0A 1RAFB 1VQMS 2X74A 2QRRA 2XHBA 3G4SS 5EWGA 2A3JA 2V9KA 4KE5A 2NXNA 5ALPA 1U1LA 3TADC 1B92A 2VJ4A 3G25A 4CDIA 4KH5A 4O55A 3PW0A 4FZXC 5L9XA 4WQ5C 1ASUA 1FJGK 4I56A 1JLEB 1VK8A 3D3BJ 3FEYB 3QX7A 3PJXA 1YT3A 1NH8A 2V69A 4PXBA 5E3CA 2R2UA 2K3IA 3LP2B 1Q5VA 3J7A1 1BC6A 5M2RA 2C2ZB 3R7SB 2ATLA 4NRUA 2ZH4A 3H5UA 1ILYA 2X3DA 1OY6A 3MDFA 3HJFA 4OPAA 4ILLA 4V19X 1RHUB 1G7CB 2OTJS 3QYPA 3KHHA 3VGVA 4MKBA 5A0YA 4UARA 2W2OP 1UVKA 1VYAA 4UBBA 4FOEA 2BW7A 2YNGB 1UWBB 4JD2B 4MYTA 4NLUA 4O4RA 1Q3VA 2F9JA 4ED4A 4N8NA 4CF4A 4Y3CA 2H51B 4CEDA 1WOQA 5AM2A 2HF4A 2V52B 3T5JA 1WAFA 1N2XA 1ZXOA 2ZITA 3OHBA 2VU5A 2R7SA 2KHVA 3UE5A 1IJJA 2HS4A 3VC8A 4QJFB 1F44A 1PC5A 1WKKA 3PSTA 4C11B 2HFZA 1VDHA 2ZJ5A 3H5SA 1UWAA 5IWAK 4QS9A 2HHVA 3TSUA 1XJWB 2BM0A 2AGOA 1FFSB 2YNFA 3VA0A 3MCMA 5KAKA 3RGIA 5AK6A 2YNHA 5KQ8A 4QPTA 3HSTB 2E7XA 4GV3A 4MMOA 3BSAA 3F56A 4YHHF 3B0XA 4KHPF 2E8NA 1F5SA 3NVVA 4BVOA 3M8RA 1S0OA 4RPXA 3LM9A 4FWPA 4V19J 4GKJF 2RQMA 1S9FA 1FEZA 3QEAZ 3IG1B 4WXOA 4FJLA 2X51A 1S99A 4ZPVR 3WUHA 3HVRA 4AL6A 5HVHA 1SJ4P 4QZHA 2ZD1A 2IYIA 4ZPAA 3OR1A 3CFPA 1S1WB 1ZQCA 1SXEA 3SQGA 2AQ0A 1ULRA 1BWFO 3PLAA 5KT6A 2A2CA 2D0PA 3HI0A 2N82B 2XCPA 2LU2A 2MJNA 4HT7A 3UKUB 4A2AA 2Q31A 4EX6A 4E98A 2CPXA 1HMVA 2HBJA 1XTZA 1DHMA 1NJIO 1R3NA 4FXWA 2IBOA 2QKQA 4EP4A 3VGUA 1EB0A 4UW2A 3D6JA 2IM1A 2D1KA 3GILA 1FFVA 2V68A 1ATRA 2VKZG 2XLJA 3U26A 3I1YA 1X4BA 1WKLA 1NPKA 1J2NA 2FLLA 4DR4K 4Z4EA 3PUFA 3TZZA 4FLUA 3OLBA 3H8WA 3SEOA 4JI0J 4PRFA 1RQLA 3WKCA 1KC8T 5HRPA 3HK2A 2F8HA 2KHQA 3OR2A 3KHLA 2YY3A 1RWMB 3VN5A 2W4PA 3CC4N 3NMUA 1N34F 1C0UB 4BJQA 3TACB 3BF4A 5J0PA 2R7QA 2ALZA 2KMDA 3MEDB 4ZPTR 3SFUA 2W40A 3ZETB 4IKFA 1RU2A 4RQ0A 4I2EA 4C48A 1LKYB 4DKWA 5AT1B 1HHTP 2QA4G 4DV5K 3FRYA 4WKRA 4CO0A 3C2LA 1U1QA 4OPJA 1QS4A 3V9ZA 4DV2K 2XTJP 1VJ5A 3K2YA 4DUYK 1H1VA 2EAMA 3A8IA 5LM7E 1M6YA 4FW1A 6FD1A 1N36K 2G2OA 1S10A 3Q0AA 3PMLA 2ZXHA 1RT5A 2QG9B 5KFRA 2VA2A 5CYMA 3D6MB 4RBTA 3OVAA 3BO3A 1S0MA 1RHQB 5FLXU 1ZQXA 2YBVA 2B9YA 2R8JA 4ZCMA 2ZHAA 4PGXA 5BYSA 1OYEA 5ETLA 2QV6A 2G5IB 5ETMA 1IG6A 1V6HA 2A1AA 3C23A 4CYUB 2ZIXB 2UP1A 2WF8A 3HI9A 4M95A 1X9WA 2QA1A 2VG6B 7ICGA 2FZGB 4I2IA 2K3KA 2NLXA 4UB1A 2CQGA 3KWGA 3A4TA 3OYIA 1K9MO 3L5KA 3ZTQA 1IBMJ 2V8PA 2MQQA 3DGPB 2V4JB 2HOQA 3CI5A 3I32A 3L7OA 4DL4A 3R5GA 2W2PP 3MCOA 3R5DA 4RLEA 2DNYA 4A8KA 4KTWA 2VG5A 1RAGB 3UR3C 4DL5A 5CP2A 2XHCA 4FW2A 3CO0P 3AO3A 2HHXA 4BRKA 3NGZA 3THXB 3P45B 3UMGA 2JEJA 1VQMN 3SUPA 4B3TJ 2FI1A 3MAHA 2DNLA 1QVGR 3MEGA 3M2VB 3I5AA 3GE1A 1NMDA 2PMZF 2IVPA 4O5BA 4TLQA 3N7RC 3OL8A 3O1LA 2ZQBA 2E1RA 4KITB 4WCEQ 5J1PA 1ED1A 2VUGA 1FE0A 3B78A 4IOCQ 3IMQJ 2H3GX 4K4UA 4OGEA 1HBUB 5LXRA 3FZHA 4HUGA 3AVNA 4E89A 5ALNA 2A10A 2Q0UA 1GXLA 4ZIVA 1FRLA 5CZVA 3P3DA 4O0NA 4E1MA 3IWNC 3O9TA 2CRXA 4DWIA 3J80O 4RT3A 3KLIA 1PG5B 2I6XA 3MN7A 3MCAB 4M9JA 2D5RA 4Y00A 2QXFA 1MG7A 2F9DA 1VBZA 2UUWA 1FJ7A 3UM9A 2W6KA 2HIQA 3NF6A 3U27A 2VFVA 4ZVGA 2FLNA 3OJSA 4Y2VA 1AYEA 3LDAA 2IJRA 1UP1A 2XGPA 4BR2A 2YKAA 2FVCA 3MTJA 3THYA 5AI0A 3MXMA 4HTUA 3E8OA 2NR0A 3CJ8A 1F3FA 1PAEX 1UW4A 4ICAA 4B3OB 3SDEA 2J8SA 5D78A 4RU9A 2XSJA 3HMJG 3TUIC 8ICPA 3S6EA 2BANA 3CM6A 2A5XA 1O03A 4P74A 1RHKB 1UT5A 3NAHA 3CQ8A 3ZSWA 3Q23A 3MN6A 2LCWA 2VQEK 3OS2A 2HMIB 4A8QA 3HCXA 4QW8A 4LRBA 2FVSA 1MSWD 2WFAA 1D9DA 2ZF5O 3KLHB 2O8CA 5IT9Y 4MIAA 1NSKL 2M4MA 1RLDA 1LKZA 5FD1A 4JI6J 3TX0A 4PL1A 2XMUA 7ICKA 2HQGA 3CMAS 3LAKA 2BDPA 2N3OA 2GFFA 1RA6A 2V0NA 3LPYA 3MXHP 2FGOA 2XNRA 1D3WA 2E1FA 1UVIA 1BL3A 4CLZA 4CIOA 2EZYA 2LKYA 3V9WA 2FE9A 3TAMB 4X4UA 1VISA 2O4GA 2XC9A 1Z05A 1RTJA 4BRIA 3RBEA 1S57A 4E7IA 3QSIA 2P35A 1NZ8A 3TW0A 1S1VB 3JPNA 2D74B 2WHOA 2Y0BB 3VQEA 4A46A 4U96A 3IP0A 3MM9B 1PAUB 3AVMA 5ADXH 1SPBP 1JIHA 4DTNA 1N5WA 3HKWA 4MTPA 1CLQA 2JV3A 3WK7A 1SC3B 1QQNA 3CD7A 3J7Z5 4YOEA 1U8SA 4DSIA 2DO4A 3MUVP 4TNOA 2V8DA 3HKZC 4Y2SA 1R43A 3D9BA 4RJVA 1YZ7A 2BBEA 1DY3A 2MKCA 3NH2A 5GMDA 2YQEA 2K60A 2YWEA 1ZTWA 4R63A 3PW7A 4LREA 2BACA 1HW8A 2RRBA 1SXDA 1F9HA 2VH7A 1GNKA 3SCXA 3PIOQ 1T8EA 4H0XB 4MKYA 1I3OB 2E1MC 3AVIA 4DQQA 3W2WA 2JWLA 5LMNJ 4CLSA 2BH1A 1VRTA 4QU6A 4Z0UA 3O0FA 1FD8A 2UYTA 2J8AA 2H3VA 2XEXA 1NGFA 4M6WA 5KGXA 3R97A 4LVNP 3T9ZA 4YDUC 3J81j 3TR8A 4IDKB 2EG2A 1KSPA 3ULDA 3QJPA 1VSEA 1O13A 4IQUA 2E8PA 2G8VA 3OFGA 4QW9A 1NCLA 4KBIA 1RT5B 3ITHB 2WFBA 8ICYA 3CULA 5CWRA 3IKMA 2PO4A 4KIAA 1FK9B 1S5LU 3CJ0A 3QLHB 4ZHRA 4KGZB 1DRGA 4I9QA 2KG1A 1WHYA 4DV6F 1MWKA 1NLKL 2LXFA 2X3GA 1CSJA 2BZFA 1NK5A 4BUGA 5G0RA 5J2NA 2KE7A 3KLGB 5BYRA 4BC3A 1M90T 2P6RA 2LYHA 4FK4A 4RW6B 1NGAA 4CF0A 2OZSA 1FVSA 2W8LA 3AY9A 5GADU 4XEIA 5HMXA 1SUQB 4WFAQ 5HRNA 3OHRA 4DR2K 3CT9A 3DXSX 4O5FA 5KPZA 4LF7F 4LH4A 4FVMA 3NGSA 4QYRA 4M5NA 3K8VA 4G1QB 1DTTA 4A8YA 4KLLA 3G6ES 4Z6DA 4F5NA 2FJDB 3W8PA 4YVZA 2F77X 1A5XA 1NGDA 3PHTA 4IFVA 1U6ZA 5HBMB 1DQAA 4ZOSA 1C1BB 4B3MK 4IOAL 5HMWA 1WCLA 4F7VA 3LVVA 4DUZJ 5U47A 1HI0P 2D9PA 3AHPA 3Q8VA 1PJ6A 4XK8C 5AZJA 4DTOA 1RT7B 4BE2A 3OW2M 3I4PA 1JLAA 2CJYB 1L3SA 4JKBA 2E66A 1U0HA 1KEKA 1U24A 4H0YB 4XIUA 4UY8O 2DITA 2EC0A 1OMSA 4URSA 4ZCIA 2I9SA 2ZFHA 3KNAA 2OPPA 5AKGA 2J9DA 1VOMA 1R8AA 1HNXF 1BOTO 4JHDA 3GZFA 2HBKA 5K5MA 2I5HA 4NLDA 2FSNA 4FBTA 4EHTA 1F0XA 2H3IA 3VQ4A 5AKKA 1PGZA 2J7UA 4M7YA 2K06A 2MJUA 1C4AA 3S8SA 4NYFA 1UETA 1URRA 9ICHA 2G0IA 2XYPB 4WZQA 4FJ5A 5F1XA 5KGWA 5EU7A 2OJ3A 2VIXA 3CMEN 2LYBA 5M1PA 3BGOP 1RYSA 2D9OA 4F04B 3BBFA 2O66A 5A8WA 2I5JA 4CJ3A 5K20B 1Q18A 1ZM4A 1XC9A 2V67A 5FLXY 4DR2F 3ZSVA 2JEGA 5JTIA 4YB7A 3A8YA 1ITPA 4WP3A 2AEJA 2PFNA 1BPXA 4KTZA 2LEAA 4L73A 3KKSA 3TJAA 4BBYA 3P5JA 4UB8U 2W3RA 1TKTB 2ZJPL 1VQ4N 5EX5A 3PZPA 4CZIA 4X66K 3ZX0A 1D8BA 4CLFA 3ZZUA 2LDYA 4IRCA 3CCEN 3VAFA 4FLWA 3WK4A 1SJ3P 1S79A 1L3VA 2Q1LA 4Y0FA 4URGA 4C8NA 3T19A 4BC9A 3CCES 1VMBA 4Y2JA 1Q4RA 1ZQEA 2BM1A 5BJRA 4WP9A 5EGYA 3OGUA 2DH8A 4P7VA 2CVEA 1FKAF 3O4NA 4QIGA 1Z19A 2HOFA 1VSDA 2XHWA 1U02A 4UQTA 1AXQA 3QIPA 3CJQA 5IC6B 1IBMK 2B21A 4CJRA 1U45A 3D1HA 2B4JA 2OELA 3ISNC 1FX2A 4FPIA 4DTSA 1VCTA 1I94J 1H7XA 5IT9O 1IQTA 2FMPA 2XCAA 2UV8A 1RWNB 5RUBA 1S49A 2W9BA 4CZJA 3O9SA 2OPSA 1Q46A 4F67A 3SAHA 4BRLA 3JTNA 3CNHA 1BNOA 4NLXA 1GTEA 3UIQA 4FJ7A 3MM9A 2RRAA 2CGKA 3HFZB 1S6OA 4B1ZA 4B8AB 4MJKA 4CJPA 5J0WA 1IKVA 4GMJB 3P49B 2Z1GA 4FF4A 2DRBA 5D46A 4CLPA 5FROA 1SKUB 3V9SA 4MN4C 2QLJB 4IOXA 2QARA 3LM2A 4TU7A 4OYPA 1YBAA 4R5PA 5CB1A 5E41A 4FZVA 1S9GA 1WHVA 1FW6A 2HHWA 5DKWA 3C3LA 4FJKA 4OZ1A 1WG8A 4WTOB 2HSEB 4Z6EA 4IFEA 1JLGB 1B99A 4DTJA 2VANA 4MFCA 4FZZA 3QWPA 1RBTA 3N4PA 4ZJQA 3OA9A 3DDKA 3NOGA 2NRTA 3GYNA 2XRIA 3V4IB 2P9PB 1S6UA 2ZUBA 5KFCA 5AFUA 3MHYA 5FP0A 4AM7A 4WXWA 3R27A 1L8OA 3L8BA 9ICJA 1PVRA 3R8YA 3SCIE 4FWQA 3QEVA 4EO8A 2IMOA 4JKCA 4KFBA 2HHSA 1B9FA 1TL7A 2W25A 4O5EA 2DH7A 3BY5A 2QWQA 2LPEA 1M5HA 2VG5B 1UVJA 4IUFA 3VGKA 2C3PA 2GWSA 4EI2A 4CDGA 4DR4J 2J76E 5BPCA 4ZPWR 1H98A 4NZ7A 1WC0A 4DSLA 2DYAA 4C4SA 4XPEA 4ED5A 4ED1A 2F44A 2Q97A 4DFPA 3CCVS 1M0SA 3O3LA 2MB0B 3AVBA 4DUZF 5ALGA 2XS5A 2WAQF 2YHBA 2IVOA 4JI2K 2ZG6A 3E9LA 3LTOA 4CJUA 1REVA 2HBMA 2YPZA 1RFQA 1QSLA 4IO9Q 4BDYA 1NEEA 1RQNA 3DWLA 2JVOA 1S4FA 1VQON 1NDCA 3FBBA 5JMNA 2IM3A 5AQIA 2KSOB 5CE3A 1KWMA 4O8UA 4NJ8A 3M4XA 4X64F 5J0OA 3C94A 1X0PA 1T9WA 4PG4A 2QKBA 3MPVA 5J0XA 1SL2A 3V5RA 5CHIA 1VI7A 7ICRA 1HQUA 5L1JA 1UCVA 3DFEA 1ASVA 3SQ1A 1DXSA 2AZ3A 2BRLA 2EFGA 4FE3A 4JV5F 1GOBA 4LR9A 5H1SV 3W1YC 1PVQA 3AJ2A 4OLOA 4R65A 3SCLE 2MTLA 1ZQZA 5JUMA 1CPZA 2R8KA 4MIBA 4XO0A 1EQ0A 4JI7K 3HZGA 4DSEA 2JJ4D 1U0SA 2MZTA 1JXVA 2CZVC 4JKHA 3BDPA 4PXCA 1F0MA 2F63A 4ANDA 1RT2A 1IVZA 4LF4K 4JI8F 1YKWA 3ADAC 4M3WA 3T1YK 3QETA 3AD9C 5ALHA 1TELA 1XMQK 1OPZA 5D3GB 5K14A 1FESA 5GTHU 3M1VA 4LF9F 3SBGA 5KTQA 4NA2A 3MM5B 4I67A 3AJ1A 3EGZA 2W7OA 4NZ0A 3ZZRA 5DETA 3UCUP 4DUZK 4ENOA 1GMWD 2MQLA 4KYZA 3KHRA 3R1HA 2HQIA 4B8CA 2W1BA 4NLTA 1D9AA 1W26A 4DV3F 4DS4A 2G8IA 3PYFA 3PYGA 4K5RA 3MM8B 2XBPA 2KT2A 3NAEA 2PKEA 5IWAF 2ZBCA 1GLLO 2HI0A 4EYHB 1JJ2M 2CQPA 1GTHA 1VQ8N 3AEVA 3AA5X 1WC3A 3RG6A 1M5VC 4R8UA 1UOCA 1JJ2R 3D2FA 3EPGA 2FHOB 1F5BA 3T7ZA 3OYGA 1DFDA 2FJAB 4IYQA 2NPIA 1S0VA 3VQCA 1ZQHA 2HFOA 4ELUA 4OYIA 3NBPB 3NS1A 3QU9A 1R89A 4Y2PA 3TSPA 3NCQA 4P6QA 4CIFA 3A0IX 2BUPA 4EEYA 3G6EN 2QMUB 4J37A 4F8RA 4CFCA 3VQSA 4DSFA 3HSZA 1J53A 4M45A 5DQHA 4NRTA 1U2RA 7ICTA 1UT8A 3LK9A 4DF4A 5ALLA 2QZ8A 7ICIA 3U1NA 1XN9A 2CQIA 2DGQA 4GXJA 1APSA 3FDSA 4I7FB 2KG0A 1D09B 2V5HG 3QIPB 2XO6A 5AXNA 3DXKB 4MIWA 3JYTA 2G07A 2HLUA 3EKUA 4PPXA 1TUVA 3FK4A 1N5QA 2FMQA 1RXOB 2MDAA 1S1VA 3GU0A 3BSOA 1YI2S 2G2YA 4I4BA 4GC7A 2K4HA 1HD1A 2PEBA 4GVLA 4ZP8A 4CJ4A 4WKYA 2MA1A 5J2BA 2HVZA 3WKDA 2PMHA 4QIFA 5HSPA 3BO4A 5AE1A 3THWA 3DLBA 1XERA 4N41A 3KFWX 4Z94A 4A8XA 3I0SB 3ZSYA 4UAZA 2EBGA 3QFPA 3C6AA 4IOCL 4Q2LA 2GVZA 3OT9A 1BPYA 1SAZA 1QTNB 3DJCA 4LR8A 1KAYA 1SV0C 3NF9A 1BPBA 4XDCA 4JKDA 1FO1A 3L2VA 2YHWA 2CPDA 1J6ZA 1DURA 2KZZA 4CO3A 3NH0A 1JROA 2B4OA 4JI4K 2EBEA 5KFHA 3FBCA 3LP2A 1VC5A 3BKTA 3B6OA 1U1OA 1JNZB 4PH5A 1TAMA 3N5BA 3AQFA 1GOCA 2R2SA 2B9XA 3EJMA 5CZ1A 2MLYA 4J2EA 2W55A 4O0IA 5CA7A 2IHMA 3TX8A 4CLKA 4DHYA 3DXKA 1VR6A 3EVMA 1S7HA 3I0RA 5B0BA 5DZ7A 1YJNS 9ICLA 5ETRA 5KFGA 3BGRA 2CZ9A 1ZQPA 4L75A 4P0PB 4IBNA 4E7LA 5AXKA 5D8HB 4PHTX 4H4KA 2ISOA 5KNIA 3T1HJ 3MOJB 2E4LA 2N7CA 4R0EA 4C7YA 3VQAA 4DR7F 1W25A 2M88A 1V9PA 4CP5A 2KHDA 3KK3A 1RWXB 1MWZA 4BY9C 1DLOA 1X3MA 1FF2A 3KKRA 3L9ZA 4IZ9A 1ASWA 2QB0A 4TYBA 5DGAA 1CJTB 2ROGA 3G96A 5K14B 4ECTA 2ZH8A 2VONA 2W04A 2KM8C 3C15B 2QFJA 4O3MA 2WONA 3LGMA 3VAIA 4LF9K 4CI0B 3KTQA 4NXMJ 3H2VE 2ZWHA 1G99A 3WHIA 3FZKA 1QAIA 5D77A 5IIMA 4QJVA 2P9PA 5BRHA 1WWHA 3TFSA 2AP6A 2EAOA 1RT2B 2OAUA 1XIQA 4NXMF 4WJ3B 1U04A 2FSKA 1Q81T 3L3UA 3VQBA 2RKIA 1BA1A 2B9EA 2IOHA 1OQ3A 1MMDA 4HCBA 2FSJA 5FRMA 2ZE2A 4H4MA 5IC4B 1FNXH 2F7VA 4OZ2A 4UY8T 3CB4A 4B9SA 5EDWA 2XULA 3AN1A 3U9DA 2NLWA 1HUOA 5A8RB 4M42A 3ET6B 3VQ8A 4DO9A 2ZC3A 4CHYA 3K4GA 1F5CA 1EIYB 3HP9A 1COKA 4ICLB 2WBNA 1U1NA 3E01B 1CEZA 2KSOA 2DTUA 1RZTA 1NU4A 3OBWA 5DBBA 1Q86T 1HBMB 2P9KB 3U4LA 2BE9B 1J2MA 5HMYA 3L2UA 4RKUC 1KVJA 3BS5A 4KTQA 2W43A 1U8WA 3H6EA 3CJSA 4IH6A 2KV2A 4YG2A 4OZLA 3TP2A 3TVKA 4A57A 3MMBB 2GA7A 5HK4A 3D1QA 2CQDA 2VOPA 2K8GA 1T9TA 3BPSP 4CBUA 1Z4NA 1K47A 3MM5A 4F3TA 4AXIA 3N01A 2QMWA 2X78A 4O3SA 3DCAA 1YRTA 3I8BA 3GIJA 1WKJA 4EX7A 4YB1P 4CIEA 3H0PA 5LJ3Y 4MH8A 3RBZA 1WEYA 5J2DA 1WC5A 4DMZA 5T7LB 3D2EB 1A77A 2MSTA 3VCDA 4YN3B 3ZDAA 3QSYB 4J9MA 2IM0A 3KWIA 1XMOF 2QX0A 1DK2A 4KLDA 4CJEA 2HZVA 1XO1A 3W65A 2G8FA 2GIFA 1ATSA 3HKZF 4I2QA 5A6PA 3IV6A 4DV4F 3KJVA 2EFNA 1N36F 3GG0A 1P9YA 3FEZA 4IQXA 4CJWA 2EZZA 4FJGA 2VJ5A 3KJQB 2LYVA 1BPEA 2WOMB 3BB5A 5ALFA 4HDGA 4X4QA 2ZVIA 2J0SD 4ECQA 4E0DA 1VSFA 1R7IA 2CXEA 3TWHA 5IS2A 3M05A 4MK8A 2FMSA 3MMAA 5DJBA 1SH2A 2O6KA 2A0FB 2RUGA 3IDHA 3G8QA 2V2VA 5D3GA 1VGYA 2WSFC 4I2FA 3ZSOA 4R5PB 5BR8K 3N6LA 4LRAA 1KS2A 2HHHK 2WCXA 2JEIA 5L1LA 2Z57B 5HROB 1T03A 2HS0A 1C1CA 3SPYA 2GZOA 1BVSA 4C7ZA 1BISA 2DXDA 4WFNQ 2W7AA 3IS9A 2MHEA 3BBBA 3CCVN 1COOA 2GOLA 1IKYA 4CIGA 4JB8B 3CJ3A 2IHNA 2E5LJ 4IOAQ 3O4WA 3KUHA 1XR6A 5J2GA 1OPIA 2P9SB 1LW2A 1S72N 2GHWA 4LVOP 4Y2KA 5JVHQ 5DRKA 1WD6A 4OJ1A 5IZHA 2E1YA 2OTLN 4HHUA 4JI7J 3AQOA 3MTKA 2HFUA 3B8HA 1AZSA 2N1RA 1RKIA 1GAOA 3AARA 2HQFA 3CCLN 1CJVA 1T44A 3MF5A 1Z1ZA 3QBWA 2UXDJ 4EP5A 1C0FA 3EICA 1SS6A 1RXWA 3DRRA 2CG8A 2LQ5A 2HFNA 1S77D 2BKPA 1HR0F 4OVLA 3IG8A 1GMVA 1X1PA 4B9QA 4PHDA 4WJBA 2EFQA 5J2PB 3PFOA 2FC9A 2E2NA 4LMZA 4WYWA 4NCBA 4DTXA 8ICRA 2Q6CA 1BY9A 2QO3A 3C14A 4HVZA 1C1AA 1NGGA 1WUAA 2MXYA 3O8WA 4CZKA 3AQEA 4NXZA 3RMCA 2NUHA 3BH7B 1KOOA 1RHJB 2ATQA 2JH1A 1XNRF 1N61A 3CQXA 2IC3B 1UVMA 4K8XA 4RQNA 3MCPA 1VFJA 2KYZA 5KG3A 4QWEA 1WSFA 2JVRA 1C0MA 3M2VA 4G1PA 2GO8A 2DNZA 4MEYA 3EGNA 4N5SA 3BDEA 3BH6B 3U3GA 4KI4A 2HMXA 3BP8A 5IILA 1V5IB 1TQLA 3I31A 4TY8B 4DV1J 3KK3B 2R42A 3GR0A 4BC4A 2O3DA 3NGUA 1TFWA 4A59A 2I5JB 4M5LA 3CD6N 2YKNA 1Y64A 3GBTA 4QZFA 2C2DA 1AUSL 1MWQA 1W0HA 3VMFB 1UCNA 2VIHA 1T02A 1PSDA 2WVDA 3NCRA 4JI2F 1SCJB 2Y9TA 3H7IA 2R18A 1L3UA 4I2BA 2M0GB 3HXMA 2AA4A 2CNKB 2NXJA 3I6PA 3MCNA 3GDXA 4LSNB 3NWRA 1JLBA 1YTAA 3KG4A 4L8RB 2K4IA 1RTDB 1KKHA 2MUTA 3GFZA 1N6QA 4EFHA 3KK7A 1CULA 4MDBA 4YY3F 7ICMA 2KXHA 5JVGQ 4B17A 2QWRA 1RCXB 2I2YA 3GQCA 3HVWA 3WC2A 1SQGA 3RB6A 3OBIA 2AF6A 2RH3A 2EQYA 4CZLA 2G08A 1NUEA 3NCIA 3BF1A 4A8FA 3AA2A 3M6GA 4W92B 3KJFB 4FDFA 3FFKB 2Y3YA 1RBSA 2KVCA 2ETJA 4FM0A 1WG5A 4RPFA 4ZVOB 3E01A 1OUQA 3MC1A 4MFAA 2J6UA 1EX4A 3H2LA 5KG6A 3IBWA 1WSGA 4ZVRB 3VWSA 2KJ8A 5D4LA 3WXMB 2OMLA 4JB3A 2YNIA 5EX3A 4B9MA 4E2FB 2Y0SF 2N4DA 3CXCM 3CDBA 1MQ3A 5CQGA 2CQ2A 3DLKB 3H98A 1SB3C 2D0AA 4LF8J 3U6FA 5TISU 2CPYA 2RE2A 2HBZB 4A5BA 2EFPA 1DEJA 1J5EJ 3V4IA 1IBCB 3HRGA 3JSBA 4ECSA 4ED2A 5CCMA 3WNGA 1RAOA 3NBPA 3DYAB 1SIZA 2QWMA 4QZ9A 1FHTA 1KONA 3KOAA 5IT0A 4DUYJ 3RMAA 4H5TA 4K4HA 4NLQA 3P6YC 1RB0A 2CFXA 3THYB 4ES1A 3QMLA 3PW4A 3MMJA 3OYCA 4IO1A 2HBLA 3RH4A 4HI2A 3AVHA 3QNMA 4OZ0A 1WYGA 4USVA 4XQ8A 1NKBA 3RAQA 4P75A 2BOAA 3UKRA 2A3VA 1Y97A 2HFVA 1OXJA 4N8OA 4RBVA 3OYMA 5J0TA 5KRTA 3SCJE 2LMIA 4U8VA 9ICRA 4BRDA 1SC4B 4UB4A 4Y2CA 4LVSA 1T0TV 1W2IA 4Y34A 4CGFA 5F8HA 3K9JA 4A2BA 5LJ5Y 2KJ5A 5AK3A 2UUCJ 2DCLA 4KLIA 3MBYA 4FK2A 1VQNN 1TKXA 2GJIA 2YX7A 4JI2J 2VGMA 4W5RA 4HH0A 1VK3A 2HRYA 3VF6A 5KFVA 1T9XA 1A6LA 3KZBA 8ICWA 3QGHA 3W5YA 3MFIA 2WVFA 4P2XA 4N47A 4DLGA 4KLSA 3H0RB 2W54A 3QEIA 2LU1A 4FK0A 2ZUAA 3U7JA 4RR5A 3EVOA 2ZKUA 4P0QA 2F8EX 1ZM9A 3E51A 8ICVA 5CJ7A 2IRXA 2V50A 2EX3A 1Y7PA 1RDDA 1ZBIA 5AQGA 4LQ9A 5A0YB 3H8YA 1GMUA 4OYMA 2PN6A 7ICOA 1HWIA 9ICAA 3ZT3A 4FN5A 4DI6A 2YNFB 3ZSQA 4K4XA 3J8AA 3CDWA 2K4EA 3NVYA 4ZP7A 1NWKA 4ZMMA 3D6FB 2PMWA 5J2PA 2YKPA 4EWTA 4C8OA 3SMSA 3LYSA 5ALTA 1EHWA 2QT7A 2V4QA 4X65F 3AMZA 2BDUA 3ZTRA 1XHXA 1T3NA 3TAFA 2BUNA 1HNWK 1BWEA 1RT1B 1GK8A 2HFSA 4JI3F 5GAGI 4P4PA 2EW9A 2VC1A 2CH6A 2Q1NA 2H5IB 2E1CA 3O5TB 1OH8A 3CNQP 4IWVA 1Q8KA 5KFMA 4CF1A 2ZIVA 5BXIA 4CD1A 1XR5A 1SL1A 5HN0A 4C0BA 1QVGM 2BYCA 1UJ4A 1HMVB 2IDEA 3OUYB 3LW5C 1RABB 3D54A 1K44A 3FMBA 2CQ4A 4TU9A 2HOIA 5B8HA 4FZNA 4CH1A 1DGJA 5DZ6A 1OH5A 4D3GA 2B0CA 3G9CA 3D3CJ 1VK0A 4WP8A 4X66F 2HKEA 3QU2A 4NLRA 3AVGA 1B3TA 4OHWA 4HVJA 3DLEA 5KFBA 1DQ9A 2ZJQQ 3BUZB 4C98A 5L38A 3DLRA 1L3TA 3JPRA 4B6JA 3ZDDA 3J7AP 5J2QB 3C19A 4K42A 2A6OA 4U7UD 3L7UA 3OL6A 3H8SA 4FZMA 5F9NA 1KDNA 1NKCA 2RMLA 1NLVA 4OLAA 4LF1A 3CIPA 1TYQB 1S6QA 2FDRA 5E26A 2BXJA 3LGHA 2K8BB 2VFSA 3RR8A 3CO9A 3D2NA 3I0SA 1IJFB 5ETOA 1IBMF 1YVUA 1DBDA 4JEPA 2ZBPA 5F8NA 4WYLA 2AJ4A 4F4ZA 2WTFA 2CJQA 1ROFA 5KT4A 5DDMA 2FJEB 1RE1B 1D8LA 3OJUA 3W2VA 2CNLB 3MECA 3GYXB 4P71A 2ZOGA 1ZQYA 1FA0A 3BYPA 5KQDA 3VF4A 3N6MA 3K0SA 1QVFR 1O8BA 1K8AT 1HNVA 1FVQA 3PYEA 4QZDA 3BGLA 4IH5A 1H6KX 2OKQA 1JLQB 4DV4K 2Q36A 4GFJA 3I8DA 4O23A 4DQ8A 3VEVA 1WBBA 1FK9A 3E0FA 2ZM6F 2QLFB 1YJVA 5CYQB 4JBCA 2PFOA 4RUAA 3NTUA 1QQ5A 1WG4A 4ED3A 4WFBQ 1RT1A 2P9LA 4BR7A 4CGDA 4P9SA 1WC1A 1EX8A 2DIVA 4J9OA 2KVQE 1KD1O 1YF5L 1BQNB 5HQMA 4C8YA 3F2KA 4LF8K 2K8CB 1BPZA 2NQPA 1TVRB 3VQQA 3CFRA 3ZZZA 5F2RA 4AHTA 4X4VA 4BQLA 4ZTJA 4EZ9A 2O1PA 3ZZPA 4M7XA 4K25A 3LA0A 2XO7A 5D0RA 4YOWA 4CBWA 1QAYA 3KHGA 4DOCA 3Q8LA 1H2UX 4KHRA 1HFEL 1H2VZ 4DV3J 1BUPA 4ED6A 1R8PA 1JL2A 1ZQIA 3CCSN 1U9LA 4BXOA 2XSFA 4PZVA 3M6VA 3J7ZO 1SZHA 1FJCA 4CZMA 4OYOA 2ZVSA 1BQXA 2YKOA 3N4WA 3AO5A 5AQRA 2OXOA 1HLWA 4F5QA 2PZSA 4AQYF 4AHRA 2QSWA 2P5VA 2BJ3A 4QWCA 4JLHA 2RF2B 3D66A 4OX8A 1CRXA 2FPHX 1ZH5A 1Q1KA 1OH6A 2DNMA 1MNEA 1B22A 3DMJB 1GQEA 3QEXA 3PFEA 4HHTA 4I1TA 3IUCA 4CNQA 4NY8A 3DYAA 3K5OA 2DVIA 2K2PA 2DBYA 3KOOA 1MU2B 3OQ2A 3SBMA 1HHSA 4H4OA 3NLCA 4IFYB 4DU4A 4CHNA 4OJ6A 2YPYA 5KFYA 3V72A 1ZQFA 5ALUA 5IT4A 1U4BA 2DNOA 3JPPA 2D3O1 4TN2A 2PT0A 4EBCA 3W3SA 4B3SF 4ID5B 2UUBF 4K7QA 1LVHA 1Q95G 1TL1B 4OX7A 4BGDA 3CTRA 5AJ3J 4NLVA 2GGPB 3GV8B 2XGQA 1V5VA 4JWMA 2GTDA 3KLVA 5ALMA 4J9PA 3C6UB 2VJUA 3G2XA 4CEEA 8ICAA 5IWAJ 4I6YA 4RQ4A 2YKMA 2QL5B 2ALYB 2C3YA 3CPWM 5ALRA 5BOLA 3I33A 1N54B 3CERA 4DZDA 4MQ3A 4XRHA 5GAGP 4YOXA 4F93B 1KBRA 1DK3A 4DV4J 1F60B 1HJOA 2IHR1 4FJMA 1YJWS 4DR6J 1G1XA 3OYNA 1RGVA 4EEKA 2IOCA 4IG0B 2ROPA 3UKRB 2E1ZA 2O8DA 2P9KA 4W5QA 5DDRC 1ZJNA 1VSLA 2VCPA 5AM3A 4BRPA 2J6TA 3C29A 2E5IA 1R0BG 2FHKA 5HR7A 3M30A 4YP3A 5A76A 1TKZB 3CXCR 3CJ1A 2YX1A 3OXGA 4C0HA 3V9UA 1MU2A 2E88A 4EHUA 2IC3A 3TA2A 5BR8J 3P5BP 2BGWA 1FKOA 3TUPA 1ZRNA 5FPNA 1X6IA 4DQRA 2AKWB 5J2KA 3CCQS 3VGLA 5GIPA 4P2HA 2L5YA 3HULA 3ZSRA 4C4TA 4I28A 2NO4A 2DHXA 2HB5A 3ZXWA 3TEHB 4PL2A 4K5SA 5J0QA 5BN8A 1ZYQA 5IIJA 1KR4A 4ECVA 1A5WA 4X4NA 1OIAA 1SI9A 3MDAA 4IEEA 2BE7D 2VASA 4R79A 1RKJA 2CNNB 3TUZC 2G2ZA 4M5KA 4CE9A 2OHFA 4DR7K 2HF3A 4HT5A 3NG8A 5DG9A 1DRZA 2P9NA 5D4BA 2HG4A 1UA0A 2M5YA 1KN5A 1UVNA 2VF3A 1PYSB 2EWHA 3JAMO 2MQMA 5C24A 3FBEA 4RL1A 3VQ6A 5AQQA 4K4SA 4QBUA 3HVTA 5C2DA 3PIPQ 2JRZA 2MZJA 4P2FA 2UXBF 4C8MA 2CA9A 2W4CA 4ILJA 4AH9A 1FEHA 2YMMA 3TJ8A 2KOBA 3SCKE 1D1UA 1O1WA 3GFYA 5F9LA 2RAQA 3T69A 5B66U 2UVWA 2BEFA 2R8HA 4PPZA 3HPHA 1ZC6A 4IOBA 3KFUF 4BXOB 3ZNUA 3ZI4A 1Z26A 4MYUA 3HM8A 5DLGA 3F44A 1SBRA 2V9WA 2HGNA 1E4FT 1DGSA 1X4AA 4GXIA 4YS2A 4IXCA 1ZAXA 3PO5A 2ISPA 1BQNA 2VBZA 5CY4A 5TZVA 5D6GA 1Y88A 1CXUA 4CYUA 3J81O 4J9SA 4FJNA 2C2KB 3MM7B 3MXIA 3AO4A 3AJDA 2BR0A 3MEEA 4OKEA 2ADCA 3K59A 4BG9A 3Q2TC 4N77A 3EX7B 2CXYA 4O4GB 5E33A 1XSLA 3M1YA 1X5OA 2GNKA 3EEQA 5AQHA 1VQNS 1RDUA 3U1MA 5CZ2A 4FVUA 3ONQA 3LP3A 3Q8MA 2PFQA 1HI1A 5E3QA 1UAXA 4WFNL 3LDNA 5BRFA 2XMAA 3SAFA 1GLEG 4TKTA 5AQUA 3S1TA 5C24B 4XPCA 2W03A 3F5TA 3IN5A 5LMNF 3RJKA 2ZH2A 1KXPA 2W9CA 4WFZA 2E9RX 3GDQA 3CG7A 4YEAA 4BDZA 4C0ZA 4QPXA 3NVKA 3ZD8A 2OFHX 3MMCB 2FF6A 4YQWA 2NXUA 3DGVA 1V97A 4OMFG 1HYZA 2QB0B 4CD3A 1FNOA 4B3SK 3F9MA 1PJ7A 2HGLA 2CPRA 1N56A 3VENA 2VPXB 3R5AA 4NYPA 3O5BA 4OX9J 4ECYA 1H73A 5D0HA 2UXCJ 2K8AA 4DCHA 1I3AA 4NYZA 4H03B 4NM2A 4JKEA 4ES2A 1WF1A 1NK9A 2W01A 4QIEA 4P10A 1UHUA 3U1LA 3TKAA 3C6TA 2XB2D 3CJTA 2LYAA 3CDEA 4G3IA 5B5EU 4ANEA 2AX0A 2UUAJ 3AAQA 4CZGA 3F53A 2O8FA 2G8KA 1RDBA 3M8QA 5T7BA 4C8LA 5DMRA 5JICA 3M8PB 3VGMA 2NRWA 2YMLA 1ZAVA 3CUNA 4WYBA 2A1JB 3RWUA 4BGBA 2BMBA 2E29A 3UWTA 2A1SA 2UUAK 3WC0A 2MYFA 3LO3A 2B6GA 5M1QA 3UKUA 3L4BC 2GV1A 2F4VJ 2IYGA 2J0QD 1VQPS 2A41A 5DDOC 1XMQF 2MSSA 1KFSA 2OEKA 4TQSA 3JTPA 3W60A 5H9EJ 1IR2A 2XSJB 1PK1B 4Z4GA 2NZTA 2BW2A 3RJGA 2DHAA 2DRDA 4TY8A 5CCLA 3TEGA 2UXCK 3TZWA 1SH0A 2E9TA 4J2AA 3UNYA 3WIVA 4CHOA 1RBUA 4CI6A 3ENHA 2ZIWA 3GIKA 3L2RA 1X4GA 4JKFA 3BZQA 4I6WA 4DPOA 1PO6A 4Y28C 3HFKA 2FBVA 1PK3A 4DR5K 2AXTU 3Q24A 1NMEB 2DH9A 3V1QA 2WF5A 3D4JA 1QHAA 3EPIA 2GIQA 5ALIA 3S6JA 4P0QB 1RWUA 4UAVA 3H8MA 3B6BA 3Q2SC 4I69A 3QEPA 1KHVA 4X65J 1PBAA 2N7YA 4J9QA 4M5DB 1F2HA 5IM0A 1R0AB 1TKZA 4JI0F 2YX6A 2BA9A 4DJBA 3KZXA 2DCUB 4F0HA 4P0PA 3PYDA 1QQ7A 5B7WA 2A2DA 2JDJA 3ISCA 3OY9A 3D68A 2YVSA 3ENOA 2DEJA 2DK2A 5MAOA 4LIRA 2C2NA 4EZ6A 4KH0B 3JSMA 2HQCA 5DK5A 2PA8D 4I2GA 5CR0A 3OTOK 3RF9A 4E19A 2HYIB 1HNXJ 2G8HA 4JI7F 4NWBA 1T4GA 2ZD1B 3DDHA 2F8LA 5CYMB 2ZBQA 3RW7A 2PFUA 4QZBA 1RADB 1PVPA 1RYUA 5D49A 3PDNA 5HL7L 4P73A 5AIAA 3UN2A 4LF6J 4HUEA 2K7KA 4NLOA 1S1TA 4DV1K 1JLEA 3BQ7A 2QTWA 1XNQJ 3QT6A 4KRWA 2OH2A 1QM9A 3QICA 3UB5A 1UAWA 5L1KA 1AFIA 3RAMA 2ZM6J 4TVAB 3L09A 1NK6A 4HTIA 4A48A 2GQQA 4DR5F 4X65K 4N7TA 4DPYA 3JPTA 2F40A 3BS5B 3B9JA 2MQPA 5HRRA 4PXEA 2BCUA 4UF4A 2KKHA 2FLOA 4UAUA 3C2KA 4RU2A 2QLXA 3GPAA 2G5HB 4KLMA 4GW6A 3GJRB 1C7YA 2YB4A 4M3RA 3GB0A 3M2RA 2E5SA 1HNWJ 3CC2N 2LKZA 2VV5A 3G8SA 4DV6K 3PACA 4K0KF 1OKJA 2HSZA 4Y1CA 3B4DA 3RTVA 1KTVA 3OTBA 3Q83A 4C23A 2V51B 4ILHA 3VHQA 3IAS9 3CJ5A 2Z0GA 4DR4F 2QGFB 1JJCB 3HD1A 4P2SA 4DU8A 4LSLA 2M2BA 1NJIT 2JC1A 2JLEA 3DI6B 4DDFA 1X0FA 1YK9A 5F8MA 3FZMA 1ZAWA 2VPYB 2VKRA 3DOLB 4B3RK 5DG8A 3BPDA 5DB8A 5A0LA 4YN4A 4KGKA 4TYAA 4P4MA 3ZT4A 3QBCA 3F73A 1L3KA 3ZLJA 5K8MA 5DQGA 1EZZB 3SUQA 2A1BA 2H5EA 2FVRA 4KGVB 1SQFA 5CHGA 3K75D 5HANA 3ZZTA 3OR2B 2VBWA 3V6KA 2MGZB 3PSFA 3MN9A 4OV1A 1SKSA 4NI2A 4F4WA 3B8AX 2DO0A 4Y6IA 1OH7A 2BZ2A 2ZZTA 1O6XA 3WQTA 1CJUA 2R2RA 2OCEA 1U1MA 2O5DA 1NZBA 2NNWA 1D9FA 5KG4A 1ZQWA 1S1UA 2GV9A 4MKVA 2W3SA 4N76A 3SMVA 5HOOA 3A8EA 1VQ6N 4DSJA 3SLCA 2YQ0A 2JXJA 5M1OA 3NFAA 1CZ9A 2QW9A 1XQIA 3ATVA 4DCJB 3KWMA 3MM6B 2E3TA 2KJWA 2JHEA 4X4OA 2EHGA 3EL2A 2C3MA 1NHKL 3CYMA 2PYJA 1N63A 1T3QA 1UFLA 3SV3A 2RQ5A 4CJ7A 3J7YP 1T94A 2AT1B 3HFVA 1Q53A 3CIZA 1VRQC 8ICMA 4L6V3 2F2AB 3H45C 2KB2A 2ABYA 2X1BA 3NGDA 4WE1A 3IXQA 3W3DA 3AA3A 2KT3A 3JSMB 4OI6A 3H7HB 1VQ9S 4BX9C 8ICHA 4F02A 7ICNA 2QWPA 1X4FA 4JN4A 4HEA9 5EXWA 2W4DA 4DN9A 3IO1A 2FLPA 3T1YJ 3HX9A 2FVPA 8AT1B 3DLJA 4LSLB 2ZJQL 3H1QA 4OYXA 1OJ4A 2G1HA 3T6BA 4DUTA 2FJBB 2D3OR 2Y0SD 2XICA 2B51A 3NMAA 3CETA 5L39A 2MKYA 3NH1A 5EE0A 3NCPA 4KHWA 5ALSA 2HCFA 5ELZA 1YHQN 2JZBA 4QWBA 3QZ7A 3B6PA 5K9FA 2RU3A 2B9WA 1WSJA 2IA6A 2IRUA 1IKYB 1M5SA 2DFEA 1YIJN 3DOKA 1N88A 4YOVA 2IOFA 3SV4A 1N5YB 4BR5A 5KPRA 3PTWA 2UUCK 1HL6A 4PG7A 3KKFA 1ZD4A 1FRXA 3Q8UA 3UXNA 4ECXA 2J0XA 1S7IA 3OD2A 3MUMP 2OD6A 4YR0A 3MPYA 4DR6K 3O8MA 5L1IA 1N33K 3K7RA 2MQNA 1VBXA 1M5KC 2G1DA 2V2QA 1LK5A 4YOUA 4HHJA 1R0AA 2VODA 3KKAC 3H20A 1OVYA 1UPHA 1S1TB 1UEVA 2JMGA 2BCSA 2HZAA 3CSKA 2QL9B 3S9HA 4CCHA 1MA9B 4MKAA 2QEXN 1RILA 1IKXA 3WU2U 1SJQA 4QWAA 3QT7A 4G9ZA 3D2FB 1RP5A 1CJKB 4DV7J 2R7TA 5KI6A 2DEIA 2C3UA 4US9A 4CLYA 3QIOA 4CF2A 3WQUA 1VHXA 3C16A 3V2UC 3H4BA 2HVDA 1F5AA 1NDKA 7ICJA 4M94A 4C4WA 3QAUA 3I9V9 4M3YA 2QL7B 3SYZA 3DOMA 3NGTA 1T05B 5GMEA 3Q22A 2P66A 3KLFB 1AQ6A 3F5EA 4EK2A 1V3ZA 4RW4B 2X7IA 2A19A 2WF6A 3FRZA 1FJEB 1VSJA 1HKGA 2FPKA 2IM2A 3ZDBA 1LWEB 1OO0B 1PYOB 3CVKA 4FJJA 3T5KA 3D2SA 4DQPA 5CRXA 2NO5A 2YH1A 1YJ9S 2MQOA 3V7LA 2GUIA 3AO1A 2O8EB 3RH6A 3M8SA 1T6CA 3GG1A 3H1VX 2DKXA 2DTJA 1P27B 4F72A 1T9UA 1CS4A 1ZQRA 3IRUA 4FLVA 3IR7B 5HMZA 2DNPA 3TFRA 1HNIA 4JI4J 3SJHA 3EGWB 3V81B 5MLCQ 2KN4A 1WB9A 2FQQB 3O08A 1JKHB 1CJUB 4CLUA 3WX8A 1BD6A 4RNOA 3MMCA 4MT1A 2YWWA 3A2FA 1RT3B 1JNRB 9ICSA 4XDDA 4K0KK 4F5RA 2KHOA 1VQ9N 4OQJA 1K8KA 1HNWF 3W9HA 3HPOA 3HVAA 1P1TA 4KMUA 2CPJA 3MR2A 1T11A 3LANA 2GELA 4OJLA 5F0UA 2AH5A 5IQ6A 3QERA 4OCZA 1R27B 1AROP 1XSPA 2VWKA 2D0CA 2KKZA 2ZM6K 3SQGB 2KD1A 8ICLA 1NDLA 1C1BA 1QQMA 3GOIA 3A5MC 4LF7J 1S59A 2FDNA 4P4OA 2AHOB 3AVKA 3HWTA 4OJHA 2X1AA 1T3OA 4DU7A 4FNIA 1T6DA 3FM9A 1T9VA 5GAHU 4CEOA 3CEDA 1U26A 1UFKA 2O01C 1VSMA 4YOTA 3R6MA 4LQ3A 3DLHA 4DOAA 1IBLK 3TRGA 1B7FA 3QE9Y 4LBHA 3N28A 1SIWB 3M6ZA 3IAM9 4P72A 3CMES 4X84A 4IS7A 3N79A 4OD0A 4Y2RA 4PWWA 3L0QA 1VQLN 3NL0A 4E1JA 4KB1A 2C42A 4KO0A 2F3JA 2HEKA 4KHNA 3AL0B 1I39A 8ICOA 1ZZFA 5C12A 1TKTA 4OHVA 3HJEA 1ZBHA 4A5AA 1Y10A 1W97L 4NX9A 1R8CA 3KG1A 2MKKA 3QINA 4O44B 4BHQA 4AYBC 4B3RJ 2FY8A 1Y00A 9ICMA 5AM0A 4MLEA 2XMWA 5GAEI 2IOFK 1Q81O 4Z4FA 2AW0A 4DR1F 4YDXA 3VALA 2B6AA 3PNIA 1OSDA 2KVIA 4MDAA 3HYFA 4LSNA 1N33F 4A4JA 1QUPA 1HWLA 1HYSB 2BQRA 3E1YA 4H0VB 4DU3A 4CBXA 1IG8A 3A0HU 2XNQA 4X4SA 3LDSA 1X8DA 4ZH4A 4G6VB 1R6YA 3PRDA 4FWMA 1CZAN 2JNJA 3W9IA 3N97B 4IO9L 5JVGL 3HHEA 4IDKA 3NRWA 3A8JA 3OLAA 2ZH6A 4DV5F 3QRRA