4DQIA

Ternary complex of bacillus dna polymerase i large fragment, dna duplex, and dctp (paired with dg of template)
Total Genus 207
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
207
sequence length
579
structure length
579
Chain Sequence
KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords DNA polymerase I
publication title Structural factors that determine selectivity of a high fidelity DNA polymerase for deoxy-, dideoxy-, and ribonucleotides.
pubmed doi rcsb
source organism Geobacillus kaustophilus
total genus 207
structure length 579
sequence length 579
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4dqiA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4dqiA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4dqiA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4dqiA01
3AVJA 4E1MA 2QXFA 4DTRA 1LW0A 3LZJA 4CEZA 1ZBFA 1D8YA 2VG7A 1XHZA 3RAXA 4OJRA 3CG7A 4NLZA 4YVZA 1RDDA 2ETJA 2G8KA 5DQIA 4FVMA 3V6HA 5I42A 4Z4GA 4I27A 1HUOA 3MAQA 4FCYA 4E3SA 1U9LA 3RR7A 3G6VA 9ICFA 4EYIB 3KKSA 3G0ZA 4PPXA 1F21A 4RPXA 3C1YA 4K4GA 3CM5A 3HP9A 3AO4A 3SUNA 4M0AA 1Z26A 9ICIA 4IQWA 3KK1A 2I9GA 1B9FA 3L2UA 1L3SA 3SQ0A 3EPIA 5HP1A 5KG1A 3V9XA 4XQ8A 4LSNA 4GMJB 3HX0A 3PW7A 3MBYA 4PY5A 3QO9A 4KLIA 4TUPA 3MR5A 4KHSA 2UVUA 1RDAA 1C0UA 3AVBA 3VQ8A 4EBEA 4DTUA 4TQSA 2C2DA 2J6SA 5TZVA 1TVRA 1UA1A 1TV6A 4F4XA 3AUOA 2BKEA 1TKXA 1KCFA 2JGUA 4IBNA 4RQ4A 1L3TA 3K57A 2BANA 4ELTA 4GC7A 4JV1A 5JS2A 3AVGA 4HYKA 4AHTA 1X9MA 5HHHA 4YFKA 4YQWA 4FS1A 3UXNA 2W8KA 5EWEA 1QSYA 4ID1A 4I28A 2PYJA 1KVBA 4MEYA 4JLHA 3LP2A 3ZD8A 5L1KA 3HT3A 2HHVA 2ZQBA 5DBCA 4B9LA 4KTWA 2GV9A 4HHTA 2Y1IA 4NM1A 5KTQA 2RF2A 2XCPA 1X2IA 3OYJA 4UBBA 4BWJA 2IAJA 1BHLA 3C23A 5HRNA 2BCRA 4QW8A 3MABA 4CF8A 4NCGA 2BCSA 2RPIA 4KLFA 5D3GA 5DGAA 1C0TA 2ZD1A 4I7FA 8ICNA 2W9CB 4CHPA 4RT2A 7ICEA 9ICVA 4DFJA 4M6WA 1A5WA 9ICEA 1NK0A 1VSJA 3PMNA 4GVMA 2M9NA 5HRPA 4YD1A 2XGQA 2NRTA 4RG8A 5KT3A 4E7HA 4YR2A 3L3UA 2JZBA 3PX0A 2C22A 5DKWA 5D49A 4PGXA 4CCHA 3RMAA 2ATLA 4M2YA 4FJMA 1CUKA 3EYZA 1NK6A 5DG8A 5KFMA 3U3YA 4E0DA 2PXIA 3ZSVA 2E6MA 4H4OA 4W5QA 1S1XA 3QNNA 5HMMA 1U48A 4FJHA 2DFLA 4CESA 3I0SA 4AHRA 2F1HA 1TK5A 3GFKB 2DPJA 1REVA 3C94A 4J2DA 4RQ0A 3AVHA 3HVTA 4ICLA 4O4GA 1TL1A 3HL8A 4FYDA 1L5UA 3S3NA 5J2JA 2ZJ8A 1NKCA 4RU9A 1AROP 1V9PA 2FMSA 3SYZA 3AU2A 5KT7A 9ICPA 2ZTDA 7ICOA 3AO2A 3OYIA 4B9MA 3D45A 2EHGA 7ICUA 1ZQDA 2ZE2A 1KVAA 3O4NA 7ICFA 3ISCA 3ISDA 3QEWA 1IO2A 1C1BA 4YMNA 2D0CA 3RH6A 3PO4A 3GQCA 4RQ7A 4M6WB 1JLFA 1RT1A 4QWDA 4I2CA 8ICMA 3L2VA 1UAXA 3MGHA 2LSNA 4DOCA 5JS1A 1IKYA 3TWHA 4RW8A 2DFEA 4O0IA 3RWUA 3TQ1A 3JPOA 1WSFA 8ICYA 3NF8A 5IIKA 1JL2A 2JLEA 3V81A 8ICFA 4UB1A 1S1WA 7ICRA 4NCBA 5DBAA 7ICHA 3B0XA 2BCVA 1MSWD 3LAKA 4G3IA 5J2CA 1WSHA 2JEJA 1RBSA 5KG2A 1PZNA 1N48A 1VK0A 4DOBA 1TL3A 1J5OA 3PW5A 4BE2A 1Z00A 1T4GA 5EWGA 4DQRA 4LZGA 4DSIA 5KFZA 2X6NA 4B9UA 1TV9A 3JPTA 2OA8A 4IRCA 4DQSA 3G6XA 3K2PA 2A1SA 4CGGA 4ED8A 4DSKA 3IM1A 4CFBA 4DTNA 3KLGA 3ITHA 4KLSA 1S1UA 2O4GA 4M45A 2AQ0A 1ZQAA 3RJJA 4BDPA 3M9OB 1FKPA 2PI4A 2NUBA 1RTDA 5FRNA 3G10A 4B9VA 4AHCA 4I2JA 4M3ZA 3VQ7A 8ICHA 1CLQA 3DOKA 3EY1A 3NF7A 2A1RA 3PW4A 1BI4A 2QK9A 4JV0A 4Z4EA 3SJJA 3WNHA 1NJXA 4PA1A 4R63A 1L3UA 4PHEA 1TK8A 2VANA 5L1LA 4UBCA 4F5QA 3PUFA 3NH1A 1QE1A 1ZQNA 5F9NA 5DG9A 8ICPA 4B9NA 2ZUCA 4CEDA 2PI5A 3ZSYA 1NK8A 3OS2A 3BJYA 3NF6A 3UQ2A 4JUZA 2IGIA 1N56A 4ELUA 2RDIA 3AVIA 3ORYA 3H8SA 3VQAA 3HXMA 1NK7A 2VG5A 3E2EA 4E7LA 8ICLA 1K1QA 4KLOA 1Y97A 2BQRA 4FK2A 3RJEA 1T05A 4BXOA 4RQ3A 1U45A 4M3TA 1GOAA 3LP0A 1Z00B 2GWSA 3PR5B 4I9LA 4LSLA 5KFRA 2NRWA 2I5JA 1ZETA 1BPEA 4ECSA 4DSLA 9ICXA 1HUZA 4M9JA 3FFIA 3V9UA 3TI0A 4ED0A 5KT2A 4ECUA 3QEBZ 4FLXA 4FJXA 5KFLA 1J53A 3TARA 3P83D 4ED7A 4I29A 3NDKA 3C6UA 3KLEA 2D0BA 4PHDA 3VA3A 1C1AA 3QZ7A 3SNNA 1S76D 4TUSA 4CJFA 4YXMA 4DWIA 4NCAA 5D4BA 3RJKA 2V9WA 1I39A 3MR2A 5KFFA 2Z1IA 1QTMA 4K8XA 1BI4B 1R0AA 4M04A 3UIQA 3ZSXA 4CHZA 5J0YA 4HUGA 4DSJA 4FW2A 4DSFA 2OPSA 4UQGA 3K59A 1VSIA 1ASUA 4HUFA 4CEBA 3S3MA 1S0MA 2F8SA 1GOCA 4YR3A 4K4HA 4AH9A 3ZDEA 9ICKA 3LP3A 8ICGA 3L3VA 4M9LA 4CJKA 4DQIA 3T1AA 3HPOA 4KAZA 1C0MA 4BXOB 1YVUA 2XRIA 3SV3A 3LPUA 5DMRA 3NGIA 1H38A 5KG5A 4QWEA 3S3OA 3QIOA 4KITB 4AHSA 4H4MA 4FLYA 2OWOA 3MXIA 4R66A 2R8GA 4CFDA 1CZBA 2QKKA 4BE1A 1YTAA 3O3GA 5I3UA 5J0XA 2ALZA 4B08A 3OS1A 4WE1A 4YNQA 3KKRA 1HJRA 2QKBA 1BPDA 3EZ5A 4Z6FA 1NKBA 1SUQA 3OY9A 5DLFA 1SL2A 2E4LA 3AVCA 2YHBA 1ZQUA 1ITGA 4NLKA 3TFSA 3OYGA 4O3SA 4YG2A 4FLZA 1A76A 4CHYA 5DDMA 1RCHA 1ZQEA 4XRHA 9ICTA 2HNYA 4JS4A 5IIIA 4UAYA 3SUQA 3NGYA 3T5JA 1WLJA 4J9PA 1TKDA 5EWFA 1HNVA 4QZFA 4DU3A 5J2EA 4XUSA 1ZYQA 4DL4A 4RNOA 4KHYA 8ICAA 3PNCA 3A2FA 3DLRA 4ZTFA 1TKTA 4FJ9A 4ECTA 3T5KA 2R8KA 4F2RA 4ECWA 3HPGA 5J0OA 4Z4CA 2AU0A 5CZ1A 1RBVA 2YV0X 4DTXA 1WSEA 3JPPA 5KG7A 1BCOA 5C24A 2YNHA 5J0UA 1TFRA 4FLWA 3RB0A 5KFXA 3N97B 5HROA 3UPQA 1IKXA 4DTSA 3V1RA 5CZ2A 4N56A 1VSEA 5HRSA 4DFKA 2JEGA 5KFDA 4F5NA 2XY7A 1Y88A 1FXXA 1EXNA 2BE2A 2KW4A 5HHIA 3ETLA 4CJ5A 2UVWA 5BOMA 3KLFA 4ZTJA 1BCMA 5KG0A 4RW7A 3V4IA 1EX4A 3ISNC 3VQPA 2G8WA 1RYSA 9ICNA 4DOAA 3OYNA 2KZ3A 2HHUA 2P6UA 3DLEA 2FLNA 4AHVA 4NY8A 2Z1HA 1BQMA 4QAGA 1NJZA 5KFKA 4P2HA 1SZPA 5J2KA 4MQ3A 4ECQA 4Z4IA 2ZUDA 4KLQA 1EP4A 3CFRA 4DFMA 1YTUA 1HMVA 4RZRA 3RB4A 1LW2A 3RBEA 4HVJA 3I8DA 1D8LA 1HYSA 3MFIA 3KHHA 1D9DA 1UT5A 4DL5A 4QZBA 2FMQA 1JL1A 4CIGA 9ICBA 3F73A 1TAQA 5KFQA 2VWKA 5KFHA 3PMLA 1JN3A 1K1SA 2ATQA 2YNGA 5HBMA 3K5NA 4NLNA 5IILA 2W8LA 3TAQA 5J2FA 1A5XA 1KLMA 2OPPA 4DL7A 3KHLA 2IHMA 7ICKA 2R8JA 3VQEA 4QWAA 4B8CA 3K5MA 4K4IA 4IDKA 4UAWA 4J9MA 4N76A 3V6DA 4PWDA 5KFOA 4FZXC 1WAFA 4O0JA 4F50A 3RTVA 2IS3A 2B21A 4I2GA 4CGIA 8ICCA 1ZQLA 4I2AA 2E6LA 4RW4A 1XWLA 3V1QA 1ZQOA 1GOBA 4DFPA 4IRDA 3QESA 4W5OA 4KLGA 3PVXA 5J2AA 4IQUA 3IS9A 4M3WA 4DG1A 4YCXA 2AJQA 3GV5B 3RJIA 1RBRA 3IG1A 1VSMA 3T3FA 3NFAA 1EXQA 2IDOA 3OYLA 4MF8A 1RT4A 8ICIA 2ZJ5A 1HNIA 1CZ9A 4IFVA 3U3GA 1UWBA 3RMDA 4I2IA 4FLVA 2F8TA 3H8WA 4O5KA 3QEAZ 2G8FA 9ICJA 4J9QA 4KLLA 4DO9A 4JS5A 2OPQA 4OKJA 4UB2A 1BISA 3V7LA 4MEXA 4IRKA 5D46A 1HPZA 1LAVA 3VQ6A 4OPJA 2AQ4A 4FJNA 2R8HA 3GV7B 3K58A 5KG6A 1HJPA 4HUEA 3HK2A 4UB4A 2FBTA 2IOCA 2ZTEA 2HB5A 4DMNA 1S0VA 5DB7A 4FLTA 2EX3A 1EKEA 4KHQA 3DLBA 1QSLA 4KHUA 1KSPA 2ASDA 3NF9A 1RZTA 3SUOA 2X6SA 3CFOA 4IR9A 4L8RB 1ZQKA 1Q9YA 3F9KA 2GBZA 4FLUA 2P66A 1KLNA 4C8MA 1KFTA 2FC0A 3QEIA 1KTQA 3JPSA 4Y1CA 4FJ8A 4X5VA 4IG3A 4KRFA 4ECRA 2FPMA 7ICVA 5KI6A 4FBUA 4ZH4A 3WNEA 3MXMA 3E01A 4M42A 4RPZA 3RMBA 3LPTA 3C6TA 5J0PA 3RB3A 4Z4HA 4M47A 4QZ8A 5DBBA 4Q8FA 4FM1A 1I3AA 1ZQYA 1SL0A 4GW6A 4J9LA 5CB1A 5BOLA 4DL2A 1BPYA 4IG0A 4CJQA 4CJSA 3KK2A 4Q0BA 4EEYA 5KFSA 1KFSA 4OGCA 3AVAA 2F96A 4TQRA 4MFFA 5KGWA 2BQ3A 2PY5A 3RB6A 3H40A 4M3RA 3RJGA 4PH5A 3DI6A 1X1PA 3PW0A 5EOZA 3LAMA 5KG4A 4AILC 1JLQA 4DU1A 4OLBA 4CEAA 4CHQA 4CIFA 4F2SA 2JZBB 3L2RA 2UVRA 3HVRA 1U04A 5KGXA 3RAQA 3ZDCA 4W5RA 1RDCA 1B22A 4ED2A 4PHPA 4G1QA 4ELVA 2HHXA 3CYMA 3GV8B 2BCQA 4NLGA 3T5HA 1IM4A 1ZBLA 5DB6A 4CJVA 4F91B 3LZIA 1RILA 1S6PA 4IQVA 4NXZA 1RT2A 5DB8A 4EP4A 1D5AA 3DLKA 2X74A 3M8RA 2V4QA 4EZ6A 3DRPA 4E7IA 1VSLA 2C28A 4EP5A 5J2GA 3OYDA 4HCBA 4BDYA 2HMIA 1D9FA 3KIOA 4FJLA 5SWMA 3RBDA 3QLHA 4KTQA 3KK3A 3LANA 4DF8A 4PUOA 1VSFA 2KFZA 4AHUA 3T19A 4O5BA 5J1EA 5DG7A 1RNHA 1VRTA 4NM2A 2B6AA 2MAXA 1JKHA 4Q44A 4MFCA 4UB3A 3JYTA 2GUIA 4I2FA 4DLGA 8ICTA 1WSIA 1XSNA 2NRVA 2IC3A 2FBVA 1VSDA 8ICWA 3U6FA 4F8RA 4E1NA 1ZQSA 4CJUA 1ZQCA 1G15A 3VQBA 1NKEA 4CJTA 2BPFA 3Q8QB 8ICUA 4K8ZA 3V9ZA 2PYLA 3Q8SB 2HHTA 4QZDA 5IIOA 2XY6A 2ASJA 2MUTA 1ZQXA 2FBYA 5J2PA 8ICOA 4DL3A 1W0HA 5C42A 3N4MB 1RTIA 1XU4A 1RTJA 3QINA 2VA3A 3K4GA 4FM2A 5KT6A 4XIUA 5CYMA 3DYAA 2FPKA 9ICWA 4F3TA 3DMJA 3HYFA 3HJFA 4RT3A 2J6UA 4DS5A 2Q3SA 5FROA 5FDLA 5J2HA 4ECYA 3VQ9A 4UB5A 4DTOA 4BWMA 3B6OA 1XO1A 1ZQGA 1RTHA 4DTJA 4IQTA 4P4PA 3DOLA 2YKMA 1RXVA 1QHTA 8ICJA 3MEGA 4R64A 4CGHA 2AGPA 3LWLA 4B3OA 4GXIA 1LWFA 2I1QA 1C1CA 3JPRA 3RRGA 1JLEA 4Z4FA 4CFCA 9ICAA 5KFWA 3HO1A 2YNIA 3AA3A 2F1JA 4Y1DA 3OYBA 3NTUA 5KFVA 1XSPA 4F5PA 3MECA 3AO5A 4YMOA 5IINA 5BPCA 1S10A 3IHQB 3O3FA 3M9NB 4CFAA 3MGIA 4E7JA 4FJGA 4KLHA 3ZSQA 2G8HA 5KFPA 3H4BA 3H4DA 1JXEA 3OYCA 1DTTA 3KHGA 2G8VA 3LDSA 1NJYA 1X9SA 1HYZA 5DDYA 2MUTB 1DLOA 4J9OA 5KFGA 3K75D 4M3UA 1WSJA 4F5RA 1ZQVA 4ED3A 4YN4A 2O4IA 2C2EA 4RW9A 5L1IA 3G6YA 3KD5E 4NYFA 3P1GA 4YD2A 1X9WA 1XC9A 4QWCA 2W9AA 3O3HA 4F4KA 5J2NA 5HRRA 2OZSA 4CHOA 4FJ7A 4O9MA 4KI6A 1S0NA 2KTQA 2BGWA 4CHNA 5J0WA 3VQ4A 4RPYA 5FRMA 7ICPA 3OYEA 4F92B 2B4JA 2Z1JA 1C7YA 2Z1GA 4FM0A 1TKZA 1SKRA 5KFUA 1XI1A 5J0SA 1A5VA 4HCCA 4CEEA 8ICEA 1JXLA 4KLUA 3UQ0A 4OLAA 3RRHA 3SPYA 5HLFA 5KFJA 2BR0A 9ICQA 2HVHA 3OS0A 2BCUA 5DQHA 1U49A 3QIPA 3FYHA 4O5CA 1ZQRA 2BPGA 3D0PA 5IIMA 4EZ9A 1ZQTA 3TAFA 3GIMA 2NRZA 4M3XA 3ULDA 4RQ6A 3MXJA 4N47A 5J2QA 2F1IA 1RXWA 4Q5VA 5KFIA 4QCLA 4O3NA 1KRPA 4DTMA 2PFOA 2IHNA 1BL3A 2DFHA 4KB1A 3BQTA 1ZQHA 4J9NA 4CK1A 4Z6EA 2R7YA 2OPRA 4W5TA 9ICRA 3B0YA 4BE0A 2DFFA 4CEQA 2OZMA 5KFTA 1ZQJA 2AGQA 4KHWA 3RH5A 3V6KA 2JEFA 3SCXA 4CJEA 4J9RA 2HHSA 4RUAA 4GC6A 8ICRA 2IA6A 3AVKA 4KLJA 3NGDA 3QE9Y 4QZAA 5HP4A 5KRSA 2ISPA 3CFPA 2PFNA 4M9GA 3ZCMA 1MU2A 2C2RA 5DQGA 3RH4A 3NAEA 3C1ZA 3KLIA 4F5OA 5CYQA 8ICZA 2ITGA 3FDSA 3BQ0A 3QEPA 4KB0A 1S77D 3TANA 3ZD9A 3CQ8A 4MFAA 2ZUBA 9ICOA 2W42A 2VA2A 3TFRA 2VWJA 1ASWA 3DRRA 3AVLA 4B9TA 4ED6A 4M3YA 4FJJA 1TGOA 2RKIA 3PR4A 2WOMA 2FPLA 3NCIA 4RUCA 3PO5A 2HNZA 1CEZA 3GILA 3TAMA 3PX6A 3Q8MA 3V7KA 1ZQIA 9ICGA 1S9GA 4E19A 1UT8A 4OPKA 2W9CA 3L2QA 1ZQBA 4QZGA 8ICBA 5KG3A 1SKWA 3V1OA 1CXUA 3IAYA 3ZDBA 8ICQA 4CGJA 4FO6A 3C2LA 3KLHA 4C8OA 3ZSOA 4F93B 4GXKA 1ZQFA 4E89A 3OSNA 3VN5A 3ZSZA 1T8EA 3MR3A 5CJ7A 4YXJA 3BDPA 1NOYA 3AO3A 1NOMA 4KN4A 3ZSWA 5KRTA 4CK2A 1SL1A 3O4QA 5L9XA 4QWBA 2X78A 1JMSA 4J9SA 3ASMA 1BVSA 4ZHRA 4I2BA 2V4RA 9ICMA 5C25A 2A1JA 2BDPA 3AA4A 3I0RA 1S1VA 3ZT4A 4CJ3A 3BQ1A 3AU6A 4O5EA 4BGDA 3C5GA 4IFYA 3OHBA 1KFDA 1S6QA 1RPLA 4F4ZA 3L8BA 1VRUA 5CY4A 3H08A 2LYHA 1WNSA 5HMLA 1KDHA 5KFEA 3C2KA 1N5YA 1SKSA 3ZDDA 3AV9A 4DS4A 1QQCA 3S9HA 1RT7A 4F4WA 5F9LA 7ICNA 3IRXA 1RT5A 2FLPA 3M8SA 3QZ8A 1U47A 4DU4A 4LVSA 2Y1JA 3GDXA 4KLMA 2BGGA 4GLXA 2P6RA 4KN7A 2HHQA 2ZJAA 4DLEA 4BDZA 3DLHA 3NE6A 2BHNA 7ICIA 1S9EA 4JWNA 3SI6A 5JUMA 1VSHA 3K5OA 4DSEA 4FBTA 2G8UA 4FK4A 4B9SA 4F4YA 1J9AA 2IBKA 2BPCA 4FJKA 4I2DA 4CJWA 3B6PA 3Q8RB 4QW9A 1S5JA 1RBUA 4RNMA 3NH2A 1QS4A 1UOCA 5T7BA 3QEVA 3AA2A 2XGPA 3ISBA 3JSMA 4R8UA 4I9QA 1IH7A 2ASLA 1DOQA 3THVA 3OJUA 3T5LA 1ZQMA 5J0TA 3WNGA 5KFYA 4EBCA 4OVLA 4KREA 3SI8A 2DPIA 3V6JA 3NH0A 2P5OA 4M9HA 4CK3A 1JLBA 2W9BA 1ZQQA 5IIJA 1RBTA 4J2AA 3DRSA 1BPZA 1HQEA 4ED1A 2IMWP 3SUPA 4O3OA 2P51A 2A1JB 4H8KA 5KFNA 4DQPA 1ZQZA 2BQUA 3MFHA 4FZYA 5J2DA 3AO1A 4EYHB 1S97A 1IXRA 5KFAA 4N5SA 5L1JA 2XC9A 4CJLA 3MR6A 1NOZA 5DB9A 4LH5A 2XHBA 3HW8A 2PFPA 1UA0A 3HWTA 3NGZA 4MF2A 4LD0A 5DK5A 1WSGA 4RNNA 3JPNA 3OJSA 3AVFA 1XHXA 3OGUA 4F3OA 3CM6A 3LDAA 4J9KA 2PFQA 1JLCA 3KD1E 3V9WA 4J2EA 3GIKA 9ICCA 4YR0A 4Z6CA 1DGSA 5DLGA 3M8QA 1MC8A 3MDCA 2XO7A 1Z25A 4KLDA 2ISOA 4C8LA 3TABA 4FJ5A 3GIIA 3NHGA 5J2MA 4KHNA 2YHAA 4DQQA 3H8JA 4ECZA 4CF0A 4I2QA 3ZT1A 4PHAA 5J0RA 1LWEA 3Q8PB 3OVNA 7ICMA 2G8IA 5KFBA 4RQ2A 3C95A 5CA7A 3P5JA 1T03A 2KQ2A 4R8UB 4ID5A 4KFBA 4YP3A 4O3QA 3ALYA 3SV4A 3OYAA 3C21A 4EBDA 3BGRA 4TUQA 2XCAA 5K14A 4B8AB 3KJVA 1NK5A 1JIHA 4CGFA 3AVNA 5CWRA 4UAZA 3EW9A 2B5JA 2W9BB 3UXOA 5C5JA 4QZHA 4C8NA 1WN7A 3V7JA 1ZBUA 4Q8EA 3HM9A 3M9MB 3MEDA 5EU7A 4YMMA 3SQ1A 7ICTA 4CECA 4P4MA 4KLEA 2HHWA 4RQ8A 4C8KA 8ICVA 3PW2A 2H5XA 3ZSRA 1ZQWA 4KV8A 9ICSA 2Q0ZX 3C2MA 4M9NA 4DTPA 4OKKA 4O3RA 2ZTCA 3UXPA 3VQCA 2P1JA 4DEZA 1B9DA 3ZT0A 4FXDA 4CEFA 4FS2A 3WNFA 3NBPA 3VQDA 9ICHA 8ICXA 4R65A 4PQUA 1LWCA 5J2IA 2HW3A 4TSXA 2OYQA 1Q9XA 1WCLA 5J0QA 1S9FA 4KLTA 1JLAA 4QZIA 5SZTA 4O3PA 2KFNA 4Q43A 1RYRA 4CJPA 1COOA 4CF1A 2YNFA 4OGEA 1XSLA 3QEXA 3QETA 1HYVA 3DLGA 3SPZA 4Q45A 3OSPA 1TK0A 3Q8KA 4CF2A 2DY4A 1Z3EB 3ZDAA 3SQ4A 3LWMA 4KTZA 4RW6A 3EWAA 1BGXT 3H7IA 1ASVA 3SQ2A 4CJRA 4Z6DA 4FW1A 2FMPA 1WCNA 8ICSA 1IG9A 2UVVA 3HP6A 4P4OA 3TR8A 4HTUA 3VQQA 4JRPA 3EPGA 1ZJNA 3RJFA 5DGBA 1NJWA 4CE9A 4JV2A 2WONA 3GIJA 1YT3A 1T7PA 1TVAA 4MFBA 4N41A 4FK0A 4CGDA 1U4BA 4TURA 7ICQA 1IKVA 4PGQA 3TAEA 4FZZA 5J29A 1NK4A 4PGYA 3RJHA 5HNKA 1SV5A 2HNDA 4R5PA 3AVMA 3OYFA 3OYMA 1CXQA 3ZT2A 1ZJMA 3V72A 9ICUA 1FKOA 2KN7A 2VA8A 8ICKA 2PZSA 4BACA 3V9SA 1ZBHA 4O55A 2P5GA 2RDJA 5CP2A 1BQNA 1MQ3A 5KFCA 1Q8IA 3MEEA 4CERA 3MDAA 2FLLA 2XY8A 3BQ2A 4E7KA 3LK9A 3KHRA 5CR0A 2D5RA 4DL6A 3LP1A 3SZ2A 4KO0A 1ZQPA 4YFUA 4LH4A 4FJIA 1BIUA 4Z0UA 4OKEA 2D0AA 4LZDA 4IR1A 4I2HA 4W5NA 1B92A 5CHGA 3RMCA 4QZ9A 4CJ4A 4IKFA 1S1TA 1T3NA 1J54A 4CEOA 4I2EA 1ZBIA 3RR8A 2AGOA 1A77A 2FBXA 2HVIA 1KVCA 4QZEA 1B43A 2VG6A 4QZCA 1TAUA 4RQ1A 7ICSA 1BPBA 2KZMA 3TAGA 1LAWA 3PV8A 3QNOA 3HPHA 1WAJA 4KPYA 3OYKA 1JXBA 1BIZA 3HSTB 3KTQA 4KMUA 3L2WA 1HQUA 4NYNA 3QERA 3JPQA 1W9HA 3DM2A 4DF4A 1RT6A 3VQ5A 4JRQA 2J6TA 1K6YA 1N6QA 2JEIA 1FK9A 3PY8A 1C6VA 3LALA 3OYHA 1XS9D 4XA5A 4RQ5A 4J2BA 3ZT3A 4CF9A 1HRHA 9ICLA 2R8IA 3VA0A 4O44A 3Q8LA 2RN2A 1L3VA 4ECXA 2W9MA 5KT5A 3OHAA 1DTQA 1RT3A 3TAPA 2WTFA 1LV5A 1QSSA 2DTUA 1JLGA 1QLNA 4JWMA 1LB2B 7ICLA 1MQ2A 4KKOA 2XY5A 3M8PA 1KEJA 1EETA 1RDBA 3PX4A 1VSKA 2YKNA 4GXJA 1O1WA 4M41A 4I2PA 1NK9A 4JK1A 1IKWA 5E41A 1S0OA 4ECVA 3C5FA 5KT4A 3K5LA 1BPXA 5J2BA 7ICGA 4KI4A 7ICJA 3AA5X 4LY7A 4QOZB 1JX4A 2KZZA 2NRXA 4CIEA
chains in the Genus database with same CATH superfamily
4ILLA 5K8MA 4BGAA 4E1MA 3MDQA 1K0VA 4MJKA 4CEZA 1FFUA 4FP9A 1UVLA 1ZBFA 2VG7A 3E3XA 1CS4A 3RAXA 4Y2AA 3FC9A 3QT7A 3QU9A 4ES1A 2ETJA 2FB0A 1HQUB 2MMYA 2CNKB 4JBCA 4I27A 1MN9A 1BXNA 3MAQA 4FCYA 3DM2B 1NI3A 1GLDG 9ICFA 2ZIUB 4GVBB 4PPXA 3WXIA 1NZPA 4RPXA 1FDNA 3CM5A 3E58A 1VDVA 2W7PA 4OYMA 2O8CA 3M2RB 1B9FA 1L3SA 3QBCA 2LBOA 4O44B 2D6FC 4TYAA 1HNZJ 4LSNA 5K8OA 3WQPA 1TELA 3NS6A 3QO9A 2ZOGA 4TUPA 3MR5A 1ZM4A 1JLGB 3HI0A 4YOYA 3JQKA 3O44A 1N54B 1FRLA 4KGVB 2PD1A 1FDDA 4X4SA 4MKBA 1S5ZA 4KKOB 3AVBA 2EAMA 4EBEA 2J6SA 5TZVA 1TVRA 1TV6A 3PIPQ 3AUOA 3TADC 1EETB 3TEHB 4JV5F 4PZOA 3OPKA 2JGUA 4RQ4A 1QM9A 4JK8A 3R27A 4I2PB 5HR6A 2A0FB 2BANA 4L6V3 3K57A 2JNJA 3I33A 4DCJB 4DUZJ 4IOAQ 5HQ8A 5JS2A 4J8FA 4QJFB 2PMZD 3EDQB 2KM8C 2IYGA 1FKAF 4YFKA 3CJKB 4YQWA 5EWEA 4AF1A 5K8NA 1N5WA 4MEYA 4JLHA 4N8NA 4RO0A 3LP2A 5L1KA 2PT0A 3DXKA 3WX8A 4HT7A 4NI2B 4A8MP 4KTWA 2KKHA 4L75A 2P9IA 4WK1A 3ENQA 1RAEB 3TA0A 2ZVSA 2L9DA 3OYJA 5HJXA 3C23A 4CT9A 2EEYA 3ONNA 2CGKA 3H42A 3VEVA 1F60B 1S99A 4CHPA 4JKGA 2YCHA 4M6WA 4NLRA 1VSJA 2ADBA 3C19A 3PMNA 3IBFB 1KQQA 4ZP7A 5CCMA 5TKWA 4RG8A 1BA0A 1X4DA 4PGXA 5LY3A 3Q24A 2DEJA 3M8ZA 3O9RA 5CD4H 2NR0A 4FJMA 1CUKA 3EYZA 1NK6A 5DG8A 1WF1A 4M5JA 1TKXB 3D54A 2VUGA 4GKJJ 1WWVA 2AJ2A 4W5QA 1R27B 2RHSB 2A18A 4FJHA 4YY3K 3FAHA 1VQ9S 4Z37A 1JJ4A 1MLAA 3EICA 1VQ8N 3GFKB 1MN8A 4RQ0A 3CCLN 4ICLA 4O4GA 4NXNJ 4KBOA 3HL8A 1L5UA 2CQ0A 2Y1RI 1NKCA 1V9PA 1HBUA 1SKUB 5KT7A 2ZTDA 3U1LA 2DY1A 2DD8S 2E5SA 3M1VB 7ICUA 1M5HA 3ZTPA 3VF6A 3ISCA 1SJRA 3H8MA 2AJ4A 5BR8F 3PO4A 2J9DE 2LQ5A 3GQCA 4EHUA 5IOLA 2OTJN 4M5IA 3FVYA 1F3VA 1ZZFA 4HI2A 4NLPA 3IFRA 8ICMA 1UAXA 2PEHA 2GO8A 3AXMA 3GJSB 5JS1A 2HOEA 4RW8A 2DFEA 2KO1A 3M6XA 8ICYA 5IIKA 1Z2LA 2E1AA 8ICFA 2NLXA 1R3NA 7ICRA 3B0XA 4C1NI 4HTIA 2KJVA 1TYQA 3TZYA 2SXLA 2MZ1A 1GNKA 5K4LA 1Y0HA 5KG2A 4AE5A 1VK0A 1ULRA 1TL3A 5AQHA 1Z00A 3WXKA 4DQRA 2FTRA 5KFZA 4B9UA 3CMAS 3JS6A 2FXUA 4DJBA 2OA8A 4DQSA 2DF4B 4AUKA 3IMQJ 4FVUA 3KLGA 3I0SB 1U6BA 5ETTA 4ZS6A 1ZQAA 3RJJA 4BDPA 3M9OB 2ZNYA 4U7BA 3HVTB 5FRNA 2GWKA 4B9VA 2M8DB 1TL1B 1RAJA 2XMJA 1CLQA 3DOKA 1M1HA 3IR7B 4RQMA 1ZD2P 5ETRA 2GOLA 1XMOF 5GIPA 2QW9A 5AHXA 1O13A 2ZE2B 2KG0A 4DV6F 4F71A 5L1LA 2YHWA 1WKJA 4F5QA 3PUFA 1QE1A 5AQXA 4B17A 4FF2A 1WKKA 2ZUCA 1NBEB 2PI5A 1KL9A 4TKTA 3NF6A 4JUZA 3R5DA 2IGIA 3QX7A 5KQDA 1CJVB 3WEEB 2NYVA 1GLBG 1IJEB 4C0BA 3HXMA 1XNSA 5LOQA 3K0JA 3CXCM 3V81B 2IOFA 4E7LA 4ED5A 4CZGA 1PIEA 1O6XA 4FK2A 5AQIA 1VFJA 3P5BP 4BXOA 4HLBA 4M3TA 1RSCA 3A3NB 4LVOP 4JI3F 3PJ9A 2QWPA 1J5OB 5ALSA 4QPTA 5AKIA 4ES3A 1QQNA 4PXBA 4DSLA 4ECSA 4NLOA 3L4QA 4M9JA 1M1KO 3V9UA 3TI0A 5KT2A 4FLXA 5KFLA 4LF9J 3GDQA 2MRLA 3EZUA 3TARA 3CNQP 4ED7A 3EDRB 3F53A 4I29A 3C6UA 3BR8A 5F0UA 1FKPB 2P9NA 2OLWA 1RTDB 3VA3A 3TSUA 1C1AA 3H7HB 3H2UB 4DV5F 4LF4J 4MYTA 1QZ6A 1HUXA 4NCAA 5D4BA 2V9WA 2Z1IA 1QTMA 4K8XA 1BI4B 1C4CA 4QIWD 4KPCA 4M04A 3GCXP 3ZSXA 2ZBCA 2I2YA 4HUGA 4OJ5A 3DRYA 4DSJA 1ZM3A 3O8WA 3AAQA 1K47A 4C48A 1NGJA 2LEAA 1JROA 1TQLA 4AQYK 5GAGP 1PGZA 2YQ1A 3ONQA 1SC6A 4FYXB 1BE4A 1SV0A 1ATNA 4G9ZA 2W43A 1FF2A 3LA0A 1SS6A 3S3MA 4K4HA 4AH9A 1JJ2R 1SZHA 4OHVA 1J6ZA 4F4AA 2ZM6F 3JTPA 2VG5B 4HDGA 1N8RO 3LGHA 2GVDA 3HPOA 3BGFA 2VFTA 4WZQA 2YQ3A 1C0MA 3NLCA 4FL9A 4WP3A 1YJ9S 1SZ2A 2E9RX 1E6VB 2ZC3A 5EHHA 5KG5A 3S3OA 1ZAWA 3ZNJ1 2GVZA 3BUZB 1Q7YO 4H4MA 3TJ8A 1DRZA 4FLYA 2OWOA 3CJSA 3NNAA 3ADAC 4K41A 3PG9A 3FFIB 3MXIA 3M6GA 2R8GA 1P7DA 4CFDA 5I3UA 2C1EB 5J0XA 2YKAA 4B08A 3OS1A 2HWTA 2AA4A 4YNQA 2DR9A 1BPDA 2P9CA 3KLEB 4Z6FA 5JMNA 3OY9A 3BH7B 2RE1A 1HI0P 5DLFA 1SL2A 3K9JA 4MLEA 1C0FA 4MN4C 4CHYA 2HLTA 1H2TZ 1VJ5A 3BSCA 2FJEB 3SUQA 3BGLA 1R0AB 3AQPA 2QWNA 2BKPA 2K4EA 1I94F 2N3OA 4RNOA 2B0GA 2OPSB 2ZH5A 3PNCA 1MROA 5K5MA 3QRQA 4DR6K 3IAS9 2DJWA 3BV8A 4K50A 4FJ9A 4QJVA 4K2XA 1ITPA 4Y00A 5G5GA 1Y3KA 3HPGA 1UFKA 4LQ9A 2AU0A 3D6FB 2G5HB 5CZ1A 1QTNB 1WSEA 5KG7A 3THWA 1BCOA 2HSEB 5J0UA 1TFRA 4FLWA 3C16A 5KFXA 1CJUB 3UPQA 4DTSA 4BRNA 4N56A 3PJXA 1VSEA 2ZWHA 2JEGA 4GY2B 2V8DA 5KFDA 3HHLC 4CRXA 1UVKA 5HHIA 1BY9A 3KG0A 2YKOA 2IIHA 1UQVA 3ULHA 2HAIA 5E79U 1BDGA 4JKFA 5KG0A 5D4NA 4B3RF 3HHLB 3WKDA 3D6MB 2C3OA 3WT0A 4ZJQA 3VCBA 4NMXA 3NWGA 1LWXA 4KGXB 3J80Y 3ISNC 2CQ3A 4PZVA 3CWJA 9ICNA 5HK4A 5LL6Z 4DV7K 2DNLA 3OTEA 2JH7A 2F5GA 4ZITA 5AFUH 4AHVA 2MJUA 2KP7A 3OBIA 2HNYB 4P2HA 4DHVA 2JC0A 4YB1P 5EE3A 2BM1A 2XMKA 1R31A 5U47A 3RZAA 4GVLA 5ALOA 2NRRA 1YTUA 2AJ0A 4RZRA 3CCUS 3RB4A 4ZIWA 3I8DA 1D8LA 2ZZMA 1HYSA 3MFIA 1UT5A 2P9LB 2D3OR 1D09B 3H2VE 2HWIA 1B3TA 2BX6A 4NEZA 1E6YB 1JN3A 2YNGA 4C97A 3PRDA 3IP0A 2AIRB 3T1HJ 3WXMB 2LYVA 2APOA 3TAQA 1KLMA 3M30B 3O9TA 3PYGA 1JQGA 3N5FA 2YNHB 1N33F 4BRGA 4ZJOA 2ZIVB 5HROB 7ICKA 3MDFA 2A5XA 1IKXB 3VQEA 2K60A 2WF7A 4QWAA 3MWBA 4OI1A 4N76A 4PWDA 5L39A 3RJMB 4O0JA 2BEFA 1KAXA 2BE2B 3GJTB 4DBQA 2BH1A 2IS3A 4I2GA 3R9KA 3KLFB 4NASA 2E6LA 1XNRJ 3V1QA 2V8PA 3CPWM 2W3SA 3TUZC 2JRSA 2BKOA 3O5BA 2AJQA 3GV5B 2E5JA 4NXMF 1VSMA 3T3FA 4XDCA 1EXQA 4Y34A 3F41A 1RT4A 2ZJ5A 3DLEB 3KKAA 3U3GA 1UWBA 2LQ8A 4Y2IA 4FLVA 3QEAZ 3DKDA 1BQMB 1OKJA 2G8FA 3CCQS 1EIYB 1TL7B 1RCXB 3MPUB 3D0HE 5AZJB 2E9TA 4NLBA 4G1PA 2X1FA 3V7LA 4MEXA 1HMVB 1LAVA 2YXLA 1DXSA 4LF5K 2MZTA 5KG6A 2YB1A 3QGIA 4DR1J 5AQQA 1IBMF 2C2ZB 2E29A 4WFZA 3HDSA 4FLTA 5IWAJ 2ZFHA 1KSPA 2XMMA 3SUOA 2YTCA 4H0YB 4LMZA 1TVRB 2UXCF 1ZQKA 4H54A 2GBZA 3CI5A 4IOAL 2V34A 1FEHA 5FPEA 4C8MA 4GRSA 5A8RA 4BC2A 1KONA 1KTQA 2MQMA 1W25A 1D9AA 2IJRA 3QUTA 5T14A 1RUSA 1NZAA 1HD1A 2QWRA 4JN4A 3WZ0A 2VH7A 3SSSA 4ECRA 2FPMA 1L7NA 3A0BU 3ZTRA 4FBUA 2O6KA 5THWA 3E01A 4P9SA 2EWHA 3A5MC 3RMBA 5AM5A 3DNCA 4CYUA 1XQSC 3CJTA 4Q8FA 3NCPA 5ETVA 4FM1A 1L7PA 2HMXA 3F2KA 2HZVA 4H4KC 3ZETA 4A5BA 3IS9B 5IXUA 3TW0A 4GW6A 4PL8A 1PYOB 4ZCLA 3IG1B 2QTDA 4IG0A 3GMGA 2Z30B 2KVSA 3KK2A 4OL8A 3S6JA 1F5SA 1Y10A 4K4XA 1NMDA 5AQLA 2FGCA 4MK8A 2K4IA 1RQ0A 4JI0J 3GP9A 2DCLA 4MFFA 5KGWA 2AV5A 2K8AA 5E84A 2OPQB 2CADA 3H45C 2UXBJ 1N32J 2ROGA 3D28A 5GINA 2I0XA 3LAMA 4NMLA 4CHQA 4CIFA 2POKA 5HL7Q 3L2RA 1NLKL 3VAMA 3MPDA 5KGXA 1R8BA 3U1MA 4PHPA 4G1QA 4JI8J 1PVRA 4CLWA 5A0LA 3NASA 2X3DA 2GO9A 2Q4TA 3MTKA 2QM1A 4Y2KA 1ZBLA 2B9EA 3TUJC 4L72B 4F91B 1NNLA 4J90A 4Y2YA 1SJ3P 2VZ9A 3CO9A 2HRUA 4IQVA 1HWIA 4NXZA 1NM2A 4NJ8A 4WTYA 3DLKA 2X74A 1DK2A 3CJ3A 3QGGA 1HWUA 1FJ7A 1XNQJ 3M8RA 4I69A 3D2WA 3MAAA 5HMZA 4C0OC 4GO7X 1IV0A 2C28A 2VPYB 2DNOA 5J2GA 2H3QA 2QARA 4FWPA 2NQPA 4KHPK 3OYDA 4BDYA 3DOMB 3BO4A 2DGOA 3B9JA 5SWMA 5LXYA 2XMWA 3QLHA 3PACA 4KTQA 1SQEA 5BXIA 2A2CA 1FEZA 1SC1B 3QT6A 4PG6A 2IM2A 4YN3B 4LVNP 3OA9A 1RNHA 4B1XB 1RHRB 3RFAA 2B4UA 4C7QA 3FCWA 4WQ4A 4DR7K 5ALKA 4IOCQ 1X5OA 1HWLA 4ACOA 4UB3A 4MIBA 3X3UA 5D0RA 2RRBA 1VBYA 1XSNA 1TU0B 3U6FA 5ALWA 2XG8A 4EMDA 4CJUA 1ZQCA 3GONA 4BUGA 4RW8B 1VQON 1MMLA 2F9DA 2BPFA 4ZA1A 2PKEA 2RSQA 3V9ZA 3NWRA 1YVNA 2CPXA 2GC8A 1PSDA 5IIOA 1RHJB 4FSVA 1S5LU 2XY6A 1BC6A 3NP5A 1ACMB 2CUYA 4DV0J 2F7VA 2DGZA 1SC4B 5JMVA 4BRMA 1U2FA 4W98A 1FDBA 4LBHA 1VQ8S 1K73T 4BR0A 2OD4A 5HJYA 4C1NK 2VA3A 3K17A 2QZ8A 1RLDA 1S6PB 2AXTU 5BPNA 1RT2B 3UMCA 3MR7A 3H3NO 4YOXA 4F3TA 3DMJA 3HJFA 4K4YA 1J5EF 3UI3A 2Q3SA 4EX6A 4A8YA 4ZVUB 5HOOA 4RJVA 2KEYA 2ESEA 2NUUG 5A6WA 3QRRA 2DL0A 5LSLA 1N2XA 4TY9A 4OPHA 3QU7A 4U96A 2YWFA 2HHHK 4NYOA 3NGTA 4IQTA 1YJWS 2OTJS 1VQ6N 3IBCB 4CGHA 2JV3A 3LWLA 2WVFA 2CXEA 1TUWA 2XZWA 1WI8A 1LWFA 4B3OA 1JKHB 1UW9A 3P96A 2NREA 4EUVA 4X4TA 4K0KF 4Z4FA 3PDNA 4A4JA 3M5RA 4AXIA 1FW6A 3OYBA 5IV3A 3WIUA 3NUQA 4Y2CA 2DNKA 2V8GA 4YMOA 2QYCA 5IINA 5M1QA 3G2XA 1SWWA 3FCHA 3ZTSA 2BZ2A 1OY6A 4HT5A 3MGIA 5IT9Y 3D2FB 4KLHA 3ZSQA 2CQIA 3H4BA 1JXEA 1WG8A 4DX5A 2EBGA 1H2UX 4Y6IA 3HZEA 1DKGD 5AKGA 1PJ7A 4KAIA 1FCAA 4M3UA 2MKJA 5BRHA 1ZQVA 5J2PB 3NVVA 3EVWA 2XQCA 5C42B 3X1LB 3G6YA 1RTIB 2KI2A 1HNZK 4USJC 1RTJB 4QIEA 2GMJA 5GAHI 1X9WA 2W9AA 1FEEA 2QWOA 2NUHA 3MGVA 4CHOA 4FJ7A 4CO2A 3DYAB 2KTQA 4RPYA 7ICPA 2Q66A 1C7YA 1UZDA 2Z1GA 3UE2A 3CXCR 4B3MJ 4CF3A 1TKZA 5ALTA 4C80A 2GAHC 1SKRA 3DXSX 2MKKA 1A5VA 4WFBQ 2ZDOA 4USMA 4DUZK 4OYBA 5A2QY 5HLFA 1RTHB 2ASPA 1B7YB 2BR0A 2FY8A 5DQHA 4MIAA 2DNQA 1CULA 1ZQRA 3TEGA 5J8YC 4QZVB 3VAJA 1ZQTA 3W62A 3FRYA 3H1QA 3TAFA 2NRHA 1SV0C 2KICA 3W3DA 4EIAA 2I9SA 1A0PA 5J2QA 2F1IA 4CGZA 3MECB 4X4NA 5KFIA 3EEQA 2B3TB 2NCKL 4QCLA 4FFDA 1UPPA 3DWLA 2JXJA 4LF8F 3TKAA 3SSQA 1W26A 3ED5A 1M90O 4R0JA 4XTTA 2EKYA 4CK1A 1Q82O 4Z6EA 3G25A 5FPDA 2E1EA 2W55A 1JRPA 2MKHA 1KQFB 1RAFB 3LDNA 4GKKF 1MWMA 3K1RB 3MCNA 3UKRA 5CRXA 1ZQJA 2G1DA 1CVJA 4KHWA 3QFWA 1FRMA 2COLA 3BDEA 3UR3C 3DLLQ 1SJFA 4B3TJ 1EQYA 5ALRA 3UMGA 5J2NB 3R1XA 3FLCO 4RUAA 4Z7CA 2FI1A 3POTB 2ZH3A 5H1SQ 2CPHA 4WXWA 2OYYA 3QE9Y 5HP4A 5SUHA 3ET6B 2H9ZA 2PFNA 4ZVSB 2PGCA 2OI2A 2YY3A 4GKJK 1MU2A 3HCXA 2PMWA 2Q2RA 3C1ZA 3BBCA 3KLIA 4E98A 2ITGA 3BQ0A 1B99A 1S77D 5KPRA 1KHVA 3GE9A 3BPDA 1IR1A 9ICOA 2VA2A 3FSYA 2P6TA 3UVJA 3I5BA 1ASWA 5ETNA 1FESA 4HACA 5AI5A 5AI9A 1WHWA 5A8KA 2XWYA 2WOMA 2GQQA 4NXNK 1LNQA 1MROB 5C2DA 3TAMA 2UUTA 3Q8MA 1ZQIA 3MM9B 3NMRA 2DCUB 4E19A 1UT8A 4OPKA 1HQ2A 3L2QA 4R25A 3PXGa 4B6JA 3W3SA 3MUTP 4RU2A 3IAYA 3T9NA 5KPZA 5EGYA 4CGJA 2KIVA 2VC1A 3H5YA 3W9JA 4ZLPA 2OPRB 1V6HA 4GXKA 2NSBA 3VN5A 3ZSZA 1T8EA 5CJ7A 4BLGA 2ASMA 2QEXN 1IVZA 3AM9A 1IBLJ 1AA1B 1EO1A 3HHDA 1NOMA 3UMBA 5KRTA 1LK5A 2HKEA 1SL1A 1MW7A 4J9SA 4JI1K 4I2BA 1VAZA 2Q6BA 2BDPA 1HA1A 2F77X 2VFSA 3I0RA 4YDXA 1HJOA 4F26A 1RI7A 1GTEA 3Q7CA 3C5GA 1WTBA 4B1WB 3OHBA 3UWTA 3CC7S 5CEHA 3OT9A 5KAKA 2Z57B 2CYYA 5KFEA 5JTIA 4C6AA 2IRXA 3UO0A 1HNXJ 2XO6A 3H8YA 4DS4A 2NLWA 3H5SA 1SI9A 3W8PA 4X4RA 4OCZA 2E5LK 1X42A 4DU4A 2N82B 3GDXA 4PKGA 2KJ9A 2HNZB 3KUEA 1YX2A 2B4OA 2HHQA 1S9EA 4UB8U 5F8LA 5AR0A 4KRWA 4A62A 2V8VA 3BEGB 4FBTA 4I6YA 2VQEJ 1Q4RA 2IBKA 4LF6J 4FJKA 2QMUB 4L76A 3BO2A 3ZX0A 4JB8B 4LF7J 3KWMA 5T7BA 2CWKA 2DHXA 3ISBA 3JSMA 4R8UA 4KSEB 4DR5J 3T5LA 3F5EA 4DV4F 4KREA 2YPYA 4Y2QA 2P5OA 5IIJA 5GMEA 3WQTA 5C25B 4H8KA 5KFNA 2M4MA 2WSEC 5IC4B 5B0GA 2YMLA 2DIUA 4HHJA 1YLXA 3CC4S 5D4PA 1S57A 2CJBA 2GUPA 4N5SA 4WU2A 3CDAA 2OCEA 1RT4B 3MMBA 5DB9A 1VRUB 4EU0A 4ZP6A 5BN9A 2XHBA 3THTA 1VC5A 1UA0A 4A47A 2GLEA 2MLXA 2FZKB 4RNNA 3JPNA 5LMNJ 3OJSA 3BN7A 3HX9A 2FE9A 4F72A 1NGAA 4IO8A 1NDKA 3PIOQ 2BW7A 2GZOA 5F2RA 2XZTB 4LF4K 3KD1E 2X3GA 4FKYA 5AQPA 3V9WA 3GIKA 3UW1A 4Z6CA 5DLGA 4FXWA 1MC8A 3MDCA 2XO7A 1Z25A 2ISOA 2ZH6A 4AL6A 5EUHA 1T6CA 3GIIA 3NCQA 2F1FA 1QH9A 1HNWF 2F63A 2WBRA 1HBOA 4QIFA 2HS3A 4DQQA 3H8JA 1XN9A 4CF0A 4WJBA 4OHZA 5J0RA 1QQ6A 2FZGB 2DNNA 4B3SF 4F25A 5KFBA 3W2VA 3P5JA 5J1NA 3A3OB 4YP3A 4I0WA 5ALJA 3ALYA 3BGRA 2CG8A 4JYAF 4B8AB 4NLTA 2CGJA 1NK5A 4YOVA 3A5NC 4UAZA 3AVNA 1F6TA 4CQ1A 2AKWB 2DR8A 1HQEB 4QZHA 4NRUA 3QAUA 4TYBA 4X66F 4OV6A 4RBTA 4Q8EA 3HM9A 1EHWA 3M9MB 5EU7A 2JFDA 3WXLA 3CCEN 3N9UC 1VQ4N 1RQLA 2OSQA 2BA9A 2DTJA 5AQJA 2DXDA 2ACYA 1NMNA 2J7UA 1HFEL 2IIRA 4PAAA 4H0TB 3NRZA 3ZSRA 2V94A 3L3CA 1TMJA 4X62J 1JMTA 2ROPA 4DCOB 2RNEA 2FY1A 1AFIA 4LFBJ 4FF4A 2Z56B 1GTHA 1RK8A 5E7OB 4DEZA 4NLDA 1YQHA 1B9DA 2EFPA 1H98A 4FXDA 2MHNA 2P9KB 3WNFA 3NBPA 2W01A 3OR2B 3VQDA 4BC5A 4PQUA 1FDAA 2BRLA 2R3VA 4TSXA 2K8GA 3CQXA 1WCLA 5J0QA 3D2QA 2H3FA 3R7BB 1RDUA 3KVGA 4O3PA 1COOA 2VOOA 2WF9A 1T0TV 1M6YA 5ALLA 2YBVA 1T03B 1ECWA 2ZJPQ 1P90A 2DR5A 3W61A 1RZMA 3QETA 4JI2J 3KJVB 3DLKB 2AZ1A 4DPOA 3CJ8A 2JZ5A 1N61A 4CF2A 1QY7A 2A6AA 4JB3A 5C2FA 3FZBA 3SQ4A 1QAJA 4KGZB 2H5JB 3H7IA 1ASVA 1DQ9A 3SQ2A 1WCNA 3WK8A 1U8SA 1ESVA 3HP6A 2QA1A 3G8QA 4JRPA 3EPGA 2E3TA 1ZJNA 3UPFA 3P8BB 1N8RT 3VF2A 1TVAA 2PEBA 4UUXA 2YJFA 2DYAA 1GXLA 4OHWA 1TL5A 2G5IB 2IA0A 1U4BA 1IKVA 3UD5A 3OTOJ 2CWXA 2BRKA 3TAEA 5AQMA 2QLFB 4NLUA 3RJHA 5HNKA 2FDNA 3HD1A 2HNDA 3HILA 3ZT2A 4C23A 4OD0A 5ETOA 4RNFA 2Q1NA 3WK5A 5IQ6A 2RILA 2GIRA 3DDKA 1ZBHA 4G1IA 3FBEA 3GYNA 2WVBA 2RDJA 2HBKA 2VJUA 2V4JB 3FZFA 2JMGA 1RBAA 1Q8IA 4OI4A 5JU5A 2XY8A 3J7ZO 3KHRA 1LXNA 3CMES 3FZMA 2D5RA 1AFJA 3SZ2A 4KO0A 3W64A 1QQ7A 2DPNA 1R89A 5A0YA 4IR1A 1RJJA 1B7FA 4CZIA 2AJFE 2UZAA 3DLGB 2O8DB 2GH1A 3ZEUA 4CJ4A 4IKFA 4I2EA 1ZBIA 2F4VJ 4PRFA 5LMUF 2HVIA 4K4SA 4CJ7A 4DR6F 4QZEA 2DNGA 3V4MA 4CO0A 2KJ5A 3PZPA 3KUHA 5HVGA 1QAYA 4RQ1A 2KZMA 2FJVA 2HBQB 1RAGB 3SAFA 3PV8A 4MH8A 4S0MA 4N8OA 1JXBA 3VPZA 1VQOS 1XNRK 2WONB 4A8EA 3PFEA 3CEDA 3QERA 1U2RA 4BC3A 1A0OB 2A2DA 2VIHA 2DT9A 4BRAA 5F3ZA 1JCGA 1KD1T 5ALDA 3W5XA 3T1YJ 4X2BA 4JRQA 2J6TA 1N6QA 3OXFA 1VI7A 1T9WA 3UDLA 2XSFA 1NGDA 3HKWA 2DVIA 2O8BB 2QB0A 3OYHA 4XA5A 1IJJA 2Q0UA 1HRHA 2R8IA 3Q8LA 1X9XA 2MZRA 2MGZB 5KT5A 4K2JA 5BN8A 1Z05A 1LEOA 1XEZA 3UB5A 1BQNB 1KP6A 2HG4A 3E9LA 2WK4A 5CAAA 5I4MA 4DR1K 1IWAA 1H72C 3AD8C 4BGBA 3LO3A 2LXIA 1GQEA 1F5AA 4GXJA 1ELOA 3AJ1A 4LR9A 1N36F 3IG5A 1FFSB 5IWAK 1VQ6S 4I64A 4YB5A 3C8YA 5B5EU 1BWFO 2Z2YB 2NO5A 4QS7A 1TKZB 1Q86O 4MT1A 1FJGF 4WFBL 4KI4A 2YX4A 4BG9A 4RUBA 1SQKA 2KZZA 1Q0NA 3HVWA 2HBJA 1WSVA 5ETQA 2VG6B 4CIEA 4YOUA 2V2ZA 5HLFB 2V0NA 3AVJA 3AQEA 2AEFA 3P4IA 2QXFA 4J7CA 1LW0A 1HIYA 1ATRA 3GR0A 2XYGB 1XHZA 3CG7A 1RDDA 4F3MA 2E8OA 3D6RA 2BM0A 3T9ZA 4FVMA 3BBFA 4ZVHA 3CCJS 5I42A 3MCPA 1HUOA 4C9DA 1U9LA 4NOHA 2B43A 3G6VA 2JWLA 4EYIB 1F21A 2CPYA 2E66A 2ASOA 4DPXA 4OX9F 5AICA 2O01C 3Q83A 3SUNA 4DU7A 3LW5C 3SCJE 1D3WA 3KK1A 1DRGA 4JI0K 1UHUA 2B9YA 1RB0A 3EPIA 4ZPVR 2PBDA 1MG7A 5F3XB 2RE2A 4XQ8A 1RT3B 5KAFU 3MBYA 4A8WA 1X5PA 1N32K 4H5WA 2HPUA 1MWKA 3CRXA 1BMQB 1C0UA 1QUVA 3S41A 4PL7A 4TQSA 2C2DA 4C2MA 3CDUA 3MAHA 2YKNB 2E2QA 4IBNA 2AYBA 2J8SA 4PYDA 1S3XA 4JV1A 4JI8K 4HYKA 2IY5B 2E1CA 1BWVA 2QL9B 5CHIA 2J0WA 5HHHA 3WK9A 4FS1A 3UXNA 4LF5F 1PCAA 3QWUA 3P31A 1QSYA 1Q53A 3J81O 3ZD8A 4KH6A 3HT3A 3JSYA 5DBCA 2YX8A 3MPYA 2P9PA 1XNQK 3R5AA 2GV9A 2Y8WA 4NM1A 1H1VA 2Z0GA 4ZCMA 4Y2JA 2IJNA 5HRNA 2BCRA 4QW8A 2BCSA 3SCIE 3EMTA 1GMVA 3CW2C 2ZD1A 3WKBA 2CNNB 1RQNA 2PFUA 2HFNA 3AOCA 4USVA 4Y0WA 3J8AA 3TZXA 4NA2A 5HP1B 5KL1B 3EJMA 2VYPA 5HRPA 5T7LA 4YD1A 2XGQA 1PC4A 2HRYA 3PCOB 3PM9A 4F3QA 3BS5A 5DKWA 5D49A 3O08A 4CCHA 4KH4A 4ANEA 2KKPA 4RNHA 1MWZA 3OR1A 1L3KA 2O1PA 2ZH8A 2FC9A 3A8EA 2W24A 3QSIA 2PXIA 3QUCA 2XSJB 2DRAA 4DV1J 4DV0K 3ZXWA 2DKXA 1S1XA 2XM3A 4CLLA 1RKIA 2GCFA 5GAEI 4CESA 3KG1A 1U1PA 1CPZA 1R0BG 2DPJA 1REVA 3C94A 3MN5A 2WB1C 4LR8A 3OTQA 5F8GA 4DUYK 2E5IA 3IG8A 2RF2B 4RU9A 2YQ0A 4DPYA 2YB4A 1JB0C 2GX9A 3OUYA 2IAJB 1F44A 3K8WA 4UAUA 4FYYB 1VQLN 4QS8A 3QDKA 2G06A 3N7PD 2KIWA 5D3GB 1C0TB 4A8QA 4I7FB 2QEXS 4YMNA 2O66A 2D0CA 4DKWA 2YWGA 3RH6A 2PFFB 1KN6A 3CC2N 1YRXA 3J7A1 4CZJA 4QWDA 3QYPA 1SBRA 5GVQA 3ZTOA 4KHPF 3MGHA 3NAIA 2WRMA 2MKCA 3C2PA 3RWUA 2F40A 1RHMB 1WSFA 4E1JA 3SD7A 3WU2U 1JL2A 2JLEA 1Z4NA 6FD1A 3SEIA 1LK7A 1L7OA 2H3IA 3ENVA 1S1WA 1AZSB 5DBAA 7ICHA 3ZZZA 1RXOB 2JLGA 1WSHA 2JEJA 3NGKA 4OZ3A 1N48A 2Y0BB 3KK7A 2LQBA 2KLAA 2VBZA 2JJ4D 4PEOA 5EWGA 1PKUA 4DV2F 2DRBA 4HAIA 2X6NA 4H4OB 2HS0A 3TJAA 3JPTA 3DU5A 3SMVA 4YMEA 3G6XA 1U09A 4ED8A 4RX6A 4JV5J 4CGGA 4DTNA 2CAJA 2AQ0A 4ZJLA 3BF3A 3K0SA 2VQFJ 2NUBA 4DPWA 3CD0A 4M3ZA 3VQ7A 4DR4F 5CQGA 4FPBA 3U1NA 1VYAA 3PIOL 4B3MK 1NGCA 3AJ2A 2ZNZA 2QK9A 2RHFA 4QR2A 2YWWA 1NJXA 3D7EO 4R63A 1T02A 2RHQB 4O8KA 2QG9B 3QJJA 5AM3A 4P7TA 1LFPA 1TK8A 2IBOA 2CN1A 4WKRA 1C1BB 3O9SA 1ZQNA 1JLFB 2QB1A 1RT1B 4B9NA 1NK8A 1HBOB 3BJYA 5AXMA 3LDQA 1N56A 1IKYB 2V2KA 1AW0A 2RDIA 3AVIA 4TU9A 1ZQ1C 3ORYA 1VR6A 3SFGA 3VQAA 2HHHF 3E2EA 3CJ1A 1VLBA 3F2BA 2XYHB 3PHEA 8ICLA 3NMAA 1K1QA 4LJMA 3LDOA 5LXRA 5EX0A 1T05A 4NWBA 1H74A 3PSTA 3D66A 1GOAA 2WF5A 3C14B 2RQ5A 1WTFA 3LPYA 4I9LA 4CLSA 1U2VA 2I5JA 5L1MA 1VC6A 1HUZA 1URNA 1ZA2B 2DISA 2N7YA 4ISEA 5EX5A 4ISFA 4TN2A 4FJXA 1Y11A 3ITHB 1S1UB 1J53A 4B3TK 1BD6A 5HVFA 2QWMA 2I38A 5E0OA 3QZ7A 3SNNA 1BNPA 4CJFA 4DWIA 3EWGA 3MR2A 2E8MA 5KFFA 3AY9A 3GWCA 4LFAF 3FBCA 1L8LA 2FJXA 3DHWC 1F2GA 1OYEA 3BN4A 2MKYA 3UIQA 2OXOA 1FE4A 3VOVA 3S6EA 4IKAA 4DSFA 1Z2ZA 2BE9B 2AMCB 1NGEA 1FWPA 3DGVA 3BP8A 1OW5A 3K59A 1VSIA 2P6SA 2ZWPA 3HTVA 2EVZA 3IGVA 2WBMA 4USAA 1U8WA 2OEKA 2NXCA 1WOPA 1GOCA 5BR8J 5FPMA 3EVOA 2M70A 3AARA 2WB1D 3L3VA 3WK4A 4M9LA 2UUWA 4DQIA 3T1AA 2QLTA 1DGKN 1VQ4S 2E8NA 4KAZA 2E5GA 3SV3A 1Z4OA 5EVZA 3NGIA 1FO1A 4DZ6A 5EN1A 4A2BA 2BV3A 3LP0B 1MMNA 3BKFA 1NGHA 4PKIA 5AI0A 4LSLB 2CH6A 3IWLA 4TVAB 1CZBA 4ILMA 4BE1A 1KVKA 2ALZA 4WFNQ 1U24A 4OQJA 4E8UA 2QA4G 1AQ6A 2QKBA 2MDAA 3ZFVA 1M90T 5K9FA 1SUQA 3D0IE 3AFGA 4R0EA 1Q82T 1O0PA 2E4LA 3AVCA 4K7QA 1ZQUA 2YHBA 5M2RA 4FLZA 3LVWA 2I7NA 4Q7AA 3IDHA 5DDMA 1G4CA 2YKPA 1FX4A 1OJ4A 5D15A 1MA9B 4JS4A 1ROFA 3K89A 3N7SC 2RAQA 1WLJA 4J9PA 1TKDA 3PYFA 4NA3A 1KQKA 1HNVA 1G1XA 4QZFA 1WHXA 5J2EA 1CJTA 4XUSA 1X4BA 4DL4A 1ATSA 3J7Z5 1DHMA 5H9EJ 4ZN3A 1HNXK 5T41A 1WUAA 4BHQA 1WI6A 1TKTA 1RU2A 2QX0A 4JAXA 2FSJA 4DV6J 1VBKA 4X4PA 4ZN1A 2FLOA 2CDRB 1Y64A 1RWKB 4J37A 2JSXA 3CVKA 4YHHF 1M0SA 2MZQA 1RBVA 4P0QA 4DTXA 5MLCV 3JPPA 2OIHA 4I1TA 3I28A 5C24A 5J1PA 2GGPB 5AK3A 2IHR1 3RB0A 2XEXA 2VQEK 1HX1A 4LF6K 4U9RA 9RUBA 3V1RA 5CZ2A 2QC3A 4F5NA 4MDAA 1Y88A 2KW4A 1EXNA 2LP4A 4USHA 4LF7K 1F5BA 5RUBA 3ETLA 1P1LA 3ZO7A 3G6EN 1BCMA 2VBYA 1SPBP 4JI3J 2B9WA 4ZVQB 4DR5K 3HF5A 4AM7A 1W97L 3V4IA 4PL2A 3CD5A 4WE1B 3C65A 3OFGA 1EX4A 1RWXB 2PAVA 3QBWA 4WQ5A 1RYSA 2KVQE 4D3HA 3L7PA 3OYNA 3CNHA 2KZ3A 1YF5L 2FLNA 3VAKA 4N77A 4M94A 5DZ7A 2Z1HA 9ATCB 4QAGA 4PG7A 3A0IX 5KFKA 2ZH1A 2CKWA 5J2KA 3KDOA 1K8AO 1EKRA 4DV5J 4CLPA 4Z4IA 4DQ8A 4FPIA 4P2XA 4JI5K 4DFMA 3GJQB 4C4RA 1X4CA 3U27A 4JI1F 4C0HA 1LW2A 1S12A 4HVJA 4QPXA 3PEJA 3KHHA 1UPMB 1YJRA 3MMAB 4ZIVA 5LMNK 4QZBA 2FMQA 1JL1A 4CIGA 9ICBA 4BRPA 2GS8A 2HQIA 4PYAA 1YIJN 5KFHA 2E1RA 2M0GB 4IL6U 1ZOLA 5HBMA 2Z2LA 3W9HA 2IVNA 4NLNA 2D3ZA 5IILA 1PBAA 3G9CA 2EDUA 2W8LA 2UUAF 2OPPA 2VBWA 4DL7A 3EXCX 3ILOA 5A76A 3KHLA 2GA7A 2R8JA 6FDRA 2Y0SF 1VQNN 3W7BA 3KOOA 1BUXA 2E5LF 4B8CA 2MY8A 4IDKA 2ZM6J 4UAWA 3V6DA 5KFOA 2X7IA 2OTLN 5AZIA 2G9OA 1ZAXA 2B21A 5C7PA 1UL3A 4LFCF 1ZQOA 1GOBA 3FEZA 3D7SB 1APSA 4BG8A 3RYLA 3LDPA 2KU7A 5AQUA 5J2AA 2OD6A 1S7IA 3RJIA 3NFAA 4P0PB 3ETRA 3DC2A 4IFVA 4O5KA 3TRGA 2H3VA 4OZ0A 4XAKA 3MM8B 3DCAA 3W2WA 2HGNA 4IUFA 1BISA 2W54A 2CQPA 5DO2A 3H5UA 3BYPA 2V2VA 4OHYA 1QHAA 2ZJQQ 4LJXA 3VQ6A 1V9OA 4X62K 4OPJA 2AQ4A 4FJNA 2YX6A 2R8HA 2EZZA 2LEBA 3QUBA 4LFBK 1HJPA 1HHTP 1XERA 2V51B 4Z7YA 2FBTA 1I94J 4OYOA 3PHTA 5EX3A 5DB7A 2EX3A 3DLBA 3NF9A 1RZTA 1HIWA 4YDDB 1N5XA 1X31C 3C28A 4L8RB 3VAHA 2OH2A 5CR4A 3HRGA 2PFDA 1TE2A 2H48B 4FLUA 1KLNA 4D3GA 2DGTA 3JPSA 4Y1CA 4EEKA 5KNIA 3MURP 1WBDA 1X60A 1BO5O 4IG3A 3HULA 3HRDD 4LF4F 3SFUA 2NZ4A 4M42A 2DR7A 3HI9A 5DJBA 1T3OA 4FXVA 2P2CB 1WUDA 2FIUA 3DN9A 5IT9U 2IM3A 5DBBA 2CVEA 4M5DA 4JI2K 2H1YA 1I3AA 5CB1A 1LKZA 4CJQA 2CJXB 4B3RJ 3NNHA 1HNIB 4Q0BA 3NOGA 3WQUA 3VALA 2H65B 3PYDA 1VQMS 2LFVA 2ZD1B 4J9VA 2MSTA 5M1NA 3HKZC 1VMBA 1AYEA 1UVMA 3CCVN 4A8KA 3E9OA 3FR0A 3RJGA 2A6MA 4Y0FA 5GAHP 3SAGA 1HPZB 3DI6A 3RSEB 2O67A 1E3MA 1HWJA 3A1YG 5KG4A 2JH3A 3CD6N 1YSJA 4GO5X 3GFXA 3OTOK 5ETPA 3W5ZA 1UCNA 2UVRA 2IOHA 2YWKA 1RDCA 2QLJB 3GV8B 2BCQA 2BTFA 4NLGA 3EVMA 3T5HA 4K4VA 1SH0A 1UJ4A 5DB6A 3LZIA 2LU1A 1RILA 2G0CA 5DB8A 4EP4A 4M5MA 3TUPA 3MZIA 3AD7C 1D5AA 2MKSA 5KOWA 1N33J 3AGKA 1VSLA 1Q78A 3C6TB 4HCBA 2WAQC 2K3KA 2QFIA 1UVJA 3O0FA 3WIVA 1UETA 1RLCL 1RAIB 3MMCA 1DT9A 2RRNA 3KK3A 1FI4A 4DN0A 3TU5A 4UQTA 4PUOA 1NB2A 4ZP9A 3OUYB 1VRTA 3W66A 2B9XA 2B6AA 4Q44A 2LYBA 2VASA 4Y2VA 1YJNN 4NXMJ 4G65A 3JYTA 4DLGA 8ICTA 2Z2MA 1WSIA 1H0HB 5B0CA 2NRVA 2IC3A 2FBVA 8ICWA 2I1RA 3CCMN 2Q36A 3UFCX 2CIMA 1G15A 2P9SB 1JLQB 2DNZA 3RG6A 1HW9A 2WVDA 4CJTA 4FWRA 4GMKA 3Q8QB 1CJKB 1FFWB 5AKXA 3FQKA 4NE9C 4ENOA 3OTCA 3Q8SB 2HHTA 1IM6A 1LXJA 2HQGA 2JOQA 1Z6RA 3A13A 2ASJA 3NS7B 2MUTA 3THYB 2FBYA 2WF8A 4UZCA 4OV1A 1FTRA 8ICOA 4PXCA 2YHXA 3CCTA 3F5AA 1IBMJ 3M05A 4OYWA 3JTOA 3GE1A 4U8YA 2K8BB 5KT6A 3AQFA 2JGAA 2FVSA 3AN1A 2UXCJ 4PABA 4LSZB 3CJ0A 2J6UA 2ZITA 3DRPB 4DS5A 1F0XA 1VQLS 4ZPTR 2HMIB 4TY8A 2F4FA 4EENA 1HARA 2JX2A 1WACA 3M32A 4XDDA 3ILJA 4R64A 3MEGA 4KJIA 2AGPA 2CJQA 2WW8A 3HMJG 2NXNA 4GXIA 3J7ZT 3SQGA 2YWHA 1RHQB 4X4QA 1C1CA 3JPRA 4EFHA 2DGXA 3MPVA 1EKSA 2YNIA 3MM5B 5B0DA 3AA3A 3AB2B 5KFVA 2PMZC 2Q43A 1RTZA 3KHYA 2WSFC 1S10A 4DOZA 1HLUA 4A46A 3M9NB 4CLUA 3TOQA 4CFAA 4ZLJA 5KFPA 1COKA 3ZZ0A 1DTTA 3AA8A 2EZXA 2CPZA 3RVCA 2G8VA 2VPXB 2VGNA 1X9SA 1DLOA 1HYZA 1EZZB 1T05B 5LJVA 1RAAB 2QA2A 4F5RA 4ED3A 3A12A 4YN4A 4RWXA 5C2CA 3D2EB 3M8YA 3O4WA 4OI0A 1URRA 2B4VA 3BY5A 2AYEA 2MQNA 3O3HA 5HRRA 2OZSA 4CW7B 5CYMB 4YOTA 4O9MA 4FZMA 3FEXB 2BGWA 3D6TB 2XZDB 4CHNA 2Q79A 1P1TA 3HKZD 5FRMA 3OYEA 2KMDA 2Z1JA 4FM0A 2J9EA 3QIDA 1RHUB 2HCFA 5KFUA 1NPPA 3KBBA 4KLUA 3UQ0A 4LBPA 2MQLA 5AQFA 4BBYA 5B7WA 3RRHA 1HBMA 5KFJA 3DOLB 4LRAA 9ICQA 2RQKA 3OS0A 4L3NA 1U49A 2KJ8A 3QIPA 1WELA 5GAHU 2D3UA 3HSZA 5AK5A 3U8XA 1JLEB 3A8JA 1QJHA 3UNYA 1C0GA 3ULDA 2CQHA 4RQ6A 2MHEA 3KFWX 1X9JA 3HOSA 3AAPA 2ERRA 2ZWOA 1RXWA 1OY8A 2V7YA 2DHAA 4O3NA 1Q86T 1NBWA 3RW6A 2ZH4A 2PFOA 1JI7A 4KB1A 4ZOSA 1OPIA 1X0PA 4DR2K 1GXUA 2I6WA 4DV3F 3M6VA 4AT1B 3BS7A 2K1RB 2MB0B 2BJ8A 1TP7A 4MMOA 2LXUA 2E2PA 2ZIWA 4CEQA 5ETSA 1LCUA 2OZMA 1TUYA 4RW9B 2AGQA 3DHXA 3RH5A 3V6KA 4CJEA 4J9RA 5AQNA 2J5AA 2VFUA 1OUQA 5D4LA 2IA6A 4P71A 4BROA 2I6XA 5C15A 4QZAA 3I55S 2F9JA 2XLIA 2ZHBA 3CUNA 5FJ4A 2ISPA 2VPWB 3MM7A 1A6SA 3CFPA 4US9A 4C0ZA 2FDRA 1WHVA 4F9OA 3JB9k 4DV1K 1J5EJ 8ICZA 4FF3A 5LJ5Y 1FD2A 3AAWB 2KFYA 4KB0A 3TANA 3ZD9A 3CQ8A 1T11A 2ZUBA 3BKUA 3DLJA 5HR7A 4CZLA 1QUPA 3TFRA 5F0WA 4J9UE 4U7CA 3DRRA 3AVLA 4M3YA 1FD8A 1TGOA 3UD4P 3H5XA 3SMSA 1NEEA 2V9KA 4RUCA 1DY3A 3I9V9 1CEZA 2LMIA 2C2OB 1ZS6A 3VCDA 2R7TA 3ICXA 2ZGZA 3PX6A 3V7KA 9ICGA 1TKTB 1S9GA 4KH5A 4CLFA 1ZQBA 1S72N 4K0KJ 2DNRA 1K5OA 1SKWA 1RG6A 4C11B 3V1OA 1K8KB 1BU6O 8ICQA 2CGLA 4TNOA 3C2LA 5IM0B 1B0VA 3KLHA 4C8OA 3ZSOA 3UKUA 1RP5A 2QI2A 4URSA 4E89A 3CIMA 3OSNA 3OW2M 3JAMO 2JVRA 3I4HX 1SH2A 3BDPA 3MMJA 4KN4A 3ZSWA 5GAGI 3UDEA 4HWIA 3WKCA 1U25A 2KXNB 2J4RA 4JI4F 2X78A 1YXQA 3ASMA 3BQ7A 2Z58B 4WQ5C 4HI1A 1JCFA 4CIOA 5AQKA 3BF4A 4QNLA 2RS2A 3A5OC 2E1ZA 2E1MC 2CQBA 2MQ8A 2CRLA 4LUBA 4IFYA 3Q7BA 1SIJA 1Q5YA 1S6QA 1RPLA 4F4ZA 3L8BA 5CYQB 2FJ6A 2LYHA 2XHCA 3BPSP 2L48A 3VAFA 1WG4A 2KM8B 2P8IA 1WNSA 3K9KA 1N5YA 1IBCB 3CIZA 1IG8A 3CD7A 3S9HA 1RT7A 8RUCA 2RKIB 3IRXA 3VERA 2HSTA 5AM2A 2AT1B 1T6DA 5JLHA 2VQFK 4LVSA 4KLMA 3M2UA 4M95A 5KPTA 2K7KA 4BDZA 4DLEA 4HR2A 7ICIA 2ZIXB 5BRDA 3AL0B 3LGMA 1JNZB 4KR0B 2OEJA 4U6PA 1YHQS 2IVYA 4F4YA 2W4DA 1HHQA 1N4LA 5E26A 1Z19A 3B6PA 2XULA 1QVFM 3R3TA 2O8FA 4QW9A 3G6ES 3IM8A 5L9NA 4LF8J 4DUYF 3ZX2A 3QEVA 2VB6A 3OQ2A 2XGPA 3AA2A 2ZZTA 1RWOB 1IH7A 4QIWC 3KG4A 1DOQA 3OJUA 2OMLA 2KHQA 3ZC4A 2EFGA 2HFSA 5TISU 1RA6A 4PG8A 3SI8A 3F0NA 4NLQA 1WNEA 3NH0A 2Y0SC 3MM6A 4WXOA 4GKKJ 1BQXA 1Z1VA 2W9BA 1ZQQA 5ALIA 4ED4A 4ZHRB 1RBTA 3NG8A 3HOTA 1Y3JA 2A1JB 4MKVA 4I6MA 4Y2TA 2RH3A 4DQPA 3OXGA 1ZQZA 2BQUA 2BJ1A 5M1KA 3MFHA 4FZYA 1S1VB 1HPMA 4JEPA 3MOJB 3AO1A 2PDAA 2HZCA 1S97A 4OJ1A 1NM1A 1IXRA 4V19J 2A19A 1WEYA 5L1JA 3DFEA 4CJLA 1VJWA 4HTJA 4BR7A 1Q79A 4LH5A 2H3GX 3HFKA 1N60A 2FHJA 3CT9A 2HBLA 3HW8A 2XMTA 4CLYA 3BBBA 3NGZA 1NNEA 4LD0A 5DK5A 3HZGA 4OMFG 2HFZA 1YIJS 3ULEA 2X1AA 4ICAA 3P45B 2ZJQL 1RT5B 4F3OA 3MUMP 1BHNA 4AFFA 3I4PA 2UYTA 2MSNA 1DZ5A 3R7SB 4Y2RA 3UN2A 3FZKA 2PFQA 3TPQA 4ANCA 2KN4A 3CIPA 2RVJA 4J2EA 9ICCA 2IDLA 4X65F 4KLDA 4U7UD 4FJ5A 3WXJA 5ALQA 5J2MA 1S6UA 3JXOA 1ZPVA 4ECZA 4NZ6A 4PKHA 3ZT1A 4PHAA 1R8PA 3J81U 1FT8A 1NSQA 1X3NA 2OKQA 4RQ2A 1T9XA 3S01A 4ID5A 1RWVB 1VLYA 3SV4A 3C21A 5ALVA 2XCAA 1P8GA 5K14A 4ZVGA 3G8TA 5BR8K 4JKCA 3EW9A 2RRDA 1EAYC 2B5JA 3UXOA 1BA1A 1CC8A 2CXYA 4Y2UA 1Q81T 2Q97A 2HBYB 2LXFA 1ZBUA 1UAWA 3MEDA 1B70B 4LRFA 1PJ6A 3SQ1A 1HBNB 4EK2A 2YQEA 1P9QC 2W1BA 4RQ8A 1W7WA 3PW2A 2ZUAA 1N63A 1ZQWA 4KV8A 5DDRC 4CNQA 3NL0A 2FHOB 2Q0ZX 2ZZNA 2MLZA 4DB3A 4FF1A 2MJNA 1RGVA 1Q5VA 4DTPA 4OKKA 4O3RA 3ZZYA 3O8MA 2BUNA 4RQNA 2RD5C 3UXPA 1JLCB 4M5HA 2P1JA 2RMLA 1X3MA 3GSDA 8ATCB 4IXCA 1FRHA 4CEFA 4FS2A 3I76A 2GHPA 4A8OA 3I9ZA 4ZVPB 8ICXA 2DGVA 3W60A 4K5SA 5BPMA 1ZOTA 4OJPA 1Q9XA 3KMSA 1S9FA 1JLAA 4QZIA 1RWPB 1YRTA 4I2QB 5H9EK 3DAWA 1NWKA 2QWLA 1LWEB 1RYRA 1RKJA 4CF1A 3RBZA 5D4OA 2YNFA 1EWRA 3ZX3A 2NXUA 3QNMA 4KFBB 1XSLA 4DV6K 2EAOA 3OHRA 2IOFK 4JKAA 5CA5A 1TK0A 3Q8KA 3SDEB 1FFVA 1Z3EB 2KRBA 3OFHA 1QAIA 1PG5B 1ZD3A 3HD2A 3K5PA 3C15B 3J7AP 1BGXT 1J2MA 4K4WA 2RQCA 4CJRA 4Z6DA 2L41A 3PKYA 3A8IA 2V8HA 3F44A 4P10A 4DV4J 3P49B 1IG9A 4FN5A 4EI2A 3CCVS 4DL0C 2J0XA 5KQ8A 2QSFA 4JP8A 4K42A 3VQSA 4HTUA 5IZHA 4JK7A 3RJFA 4JD2B 2KSOA 3CGIA 1ZAVA 4JV2A 4JI3K 3GIJA 1YT3A 3I32A 2H4YB 4MFBA 4TLRA 4GV9A 4P2SA 3R8YA 3IAM9 4NLCA 4DCHA 2RU3A 3SMPA 2E7WA 1LOTB 2CNLB 1CBKA 5GTHU 3I82A 1NK4A 3O6WA 4GV3A 3AOAA 4OLOA 1X4GA 3PYEA 3R2CJ 1SV5A 3AVMA 4NZ0A 1KS2A 4Y65A 2NS1B 2Y0SD 3DXMB 2EK1A 5F3TA 3V72A 3QICA 1OH8A 2PZSA 1IJFB 5CD4A 4DV5K 3CJRA 3M2VA 3V9SA 1LWCB 2AHOB 2PSZA 3EGZA 4OI6A 4NL9C 5KFCA 2M5YA 2MYFA 3GCWP 2V63A 3QNWB 5AE2A 3MEEA 2YMPA 1LFWA 2IYIA 2DGQA 3H0MB 3TSPA 1GK8A 2KL8A 5JVHQ 1VQ7S 1HNWJ 3MX5A 4LH4A 4Y2MA 2OGUA 2RS8A 3HSDA 4W5NA 5AIAA 2VKRA 3RMCA 1FRXA 2O8EB 4B3SJ 4QZ9A 4BC7A 3G96A 1S1TA 3R5CA 3THXB 1J54A 1WKLA 2CZ9A 2FHMA 4RW6B 3RR8A 1OYDA 2QKQA 2AGOA 3CCZA 2PE8A 4JYAJ 2PO4A 1KVCA 1YJNS 4OZNA 1TAUA 5AJ3F 2ZM6K 1WUUA 4KQZA 3IR6B 2YMQA 3HPHA 2DH8A 4JKEA 4CLZA 1WAJA 1BLUA 5AKYA 4X66J 4KPYA 2OANA 3OYKA 3FUYA 3HSTB 2KYZA 1SJQA 3ID8A 1RAHB 3JQMA 1C1CB 4I6WA 1HQUA 4NYNA 1XC3A 1Z1BA 3PNIA 4I67A 2VQEF 2IVFB 3DM2A 4XPCA 3VQ5A 2ZIUA 4GVBA 4OYXA 4WTOB 2H4WB 2ADCA 3PY8A 2KOBA 1C6VA 2P9UB 1XS9D 3ZT3A 3DGPB 5H9FK 3GBTA 3M2RA 3CJ5A 2R7VA 2BZFA 4JI7F 3FZHA 2MEWA 4O44A 2BJ7A 3VA0A 2BXJA 1FKOB 2WSCC 1L3VA 1DTTB 1N88A 3B8HA 3I6PA 4DR3K 1NMEB 2YPZA 5GAEP 1UVIA 2KRRA 1QSSA 3IGNA 1JLGA 1QLNA 2BACA 3TP2A 2KJWA 2ZKTA 4KKOA 3AODA 4FYWB 3LP1B 3NCRA 1P8ZA 3M8PA 4DCPB 5ADXA 5AK6A 1KEJA 1EETA 5A8WB 1VSKA 1P6TA 5M1FA 1O1WA 4M41A 1KD1O 4I2PA 1K8AT 2L5YA 4CM0A 4KH0B 1NK9A 4E2FB 2WFBA 4JI5F 2WTUA 4KMOB 1S0OA 3TADA 3C5FA 1GXTA 3GZFA 1BPXA 4ZPWR 2I5HA 7ICGA 3CJKA 1U0HB 7ICJA 4OX8A 3MC1A 3AA5X 2VHGA 4LY7A 1SQFA 1JX4A 4CI6A 3CJ7A 1I6JA 5JRTA 2K8CB 2PMHA 4EO6A 3QWPA 3SJHA 3LZJA 2YMMA 1V3SA 2QTWA 4UOFA 3N28A 4YVZA 3QB0A 2CPIA 1M5VC 4DUTA 3V6HA 4Z4GA 1KXPA 4E3SA 4KHMA 1PK1B 1RT6B 3KKSA 3M6UA 1FK9B 2D9PA 4B3RK 3O9QA 1NPKA 1VJQA 1J2NA 2UUBF 3UQSA 1Z26A 9ICIA 1U1NA 4A8FA 2GW8A 3L2UA 5KG1A 3V9XA 1KW4A 5AKLA 1DTQB 1HL6A 4PY5A 3TTCA 3JQJA 1X6IA 4KHSA 2A1AA 3IR5B 2OFGX 1TUUA 1R8AA 3MHYA 1RDAA 4KY3A 4FWKA 4OYIA 2DIVA 3QSYB 4M5GA 1UA1A 2R18A 2IVMA 4F4XA 2BKEA 1TKXA 1FWKA 3EGWB 1OH7A 1ZPWX 2CH5A 3S8SA 5E5NA 1NSPA 2LECA 4ELTA 5B0FA 1PK3A 4XH4A 1S8OA 3AVGA 2M52A 4FZLA 1IKWB 4ITSA 4XH1A 3MK6A 3VHQA 4X62F 5ALGA 3D3BJ 2W8KA 2JHEA 4ID1A 3UE5A 4I28A 4FPRA 4LFBF 3TTDA 3B6BA 3OTDA 4KX3A 3G71N 4DDFA 5K20B 3NXZA 2GNKA 5LMUJ 1N33K 2Y1IA 2BBEA 5KTQA 4DR6J 3KD3A 2VG7B 1CS4B 1U1MA 2JR5A 4UBBA 1RACB 1R43A 1BHLA 3TX0A 4ZDNA 2FZCB 3M1VA 3MABA 2UV8G 4CF8A 4NCGA 2RPIA 5B0EA 2CPRA 4PPDA 4KLFA 1GMUA 1OS5A 1RU1A 4W92B 4HKQA 9ICVA 4HHHA 1A5WA 2KK0A 2O8CB 3EUB2 3I87A 2M9NA 4NXMK 2G13A 4AXJA 3PLAA 4LSNB 3CJBA 2NRTA 4E7HA 3L3UA 2JZBA 3KLVA 4EHTA 2GWJA 3QO9B 3RMAA 3B4MA 4M2YA 4RBVA 3EZWA 3ZLJA 4YDUA 5JXSA 3H2LA 4E0DA 3U3YA 1TV6B 5AM0A 5F8MA 2HK2A 1HR0F 3ZSVA 1QD1A 3K8VA 2BANB 2ZOMA 4CO1A 3BZCA 2H51B 1KN5A 2CRXA 5HMMA 1Y5IB 2DFLA 4KX5A 1IR2A 3EM1A 1IBMK 3FC4A 3I0SA 1N36J 5AI4A 1F2HA 1P27B 1TK5A 2JLFA 3LP2B 3AVHA 3U26A 3HVTA 3DXKB 1D0EA 2UXCK 2EFNA 1N5YB 1TL1A 1WDDA 1FJGJ 1S72S 2P9IB 4MHVA 5HSPA 2ZJ8A 1R7IA 2GFFA 1RT7B 4UAVA 3SYZA 2ZHAA 7ICOA 1KKHA 4CZFA 3OYIA 4USWA 1EB0A 1ZQDA 2ZE2A 2OUGA 1IBKF 1OVQA 1KVAA 3W0LA 7ICFA 2DNPA 1NGBA 1X4EA 2HF4A 1FWLA 1IO2A 2EK6A 3VEYA 4JKGB 5GAEU 2G1HA 1V4SA 5FD1A 4MTPA 4RQ7A 4M6WB 2EBEA 1KBUA 4OJGA 3I1YA 3L2VA 5L38A 2LSNA 4P6QA 3MPWA 2O8FB 4EWTA 3TWHA 4F67A 1CJVA 5HQMA 3WEEA 4O0IA 4OX9J 3TQ1A 3JPOA 3MGJA 5KOXA 1SXLA 3V81A 4UB1A