2A1JB

Crystal structure of the complex between the c-terminal domains of human xpf and ercc1
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
79
structure length
79
Chain Sequence
DPADLLMEKLEQDFVSRVTECLTTVKSVNKTDSQTLLTTFGSLEQLIAASREDLALCPGLGPQKARRLFDVLHEPFLKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure and DNA binding functions of ERCC1, a subunit of the DNA structure-specific endonuclease XPF-ERCC1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords DNA repair endonuclease XPF
total genus 23
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2005-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00633 HHH Helix-hairpin-helix motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2a1jB01
4UB5A 7ICKA 4EZ6A 4KN7A 4O5EA 5KFMA 3THVA 4M6WA 5IIIA 4DF4A 4M2YA 4F2SA 4ED7A 2J6TA 1KFDA 4PGQA 4RUCA 5J2GA 1U49A 1TFRA 5DB6A 2KTQA 8ICAA 3M9NB 3H4BA 3ORYA 4DL3A 4X5VA 4Q8EA 5DGAA 4B9NA 8ICOA 4JK1A 3LDAA 4QZEA 4B9LA 3H7IA 5KFLA 5KG1A 5C5JA 7ICJA 9ICHA 4F92B 3EW9A 1UT8A 2KZ3A 5DQIA 1Z00A 4FBUA 5KG6A 4ECSA 2I9GA 2HHUA 1ZQZA 2ATLA 1NK4A 4PH5A 4I2FA 3MGIA 4M9JA 1ZJNA 1IXRA 8ICJA 4M04A 1RPLA 3TFRA 3Q8KA 4I2CA 3GV5B 5HNKA 3OSNA 3SV3A 1TVAA 8ICVA 5HHHA 4B9SA 1LB2B 5EWGA 3MBYA 3RTVA 1ZQWA 4GXIA 1KDHA 4J9QA 5KFVA 3HWTA 3HX0A 1N56A 4O3RA 2JZBA 3G6XA 4C8NA 4DL5A 1KRPA 1XC9A 3SV4A 3PNCA 4Q8FA 1ZETA 1U48A 2R8IA 1HUZA 3H8SA 4KLIA 3T3FA 9ICEA 2W8KA 5KT4A 4RQ0A 2WTFA 2NRZA 4Q44A 2Y1JA 4O3PA 4F5PA 5DB9A 3PW5A 4MF8A 1S0MA 2DPJA 4O5KA 2JEFA 2UVRA 4EBCA 4TUPA 4GC7A 2KFNA 4P4OA 9ICMA 1ZQVA 5J2KA 5CA7A 3GV7B 2ASJA 4UBBA 4QZFA 2JEJA 4I2HA 4KLFA 4ED6A 4KLOA 4UQGA 4IQTA 4F4XA 7ICMA 1HJPA 3RH6A 4DS4A 9ICXA 3AU2A 5HMMA 4F93B 3C2KA 1XU4A 2XCPA 1DGSA 2AGPA 4I2BA 5IINA 2JEGA 9ICRA 2PFNA 1T7PA 4KLHA 4ED1A 4YCXA 4BGDA 4B9TA 3C2MA 3JPQA 3OSPA 4K4IA 4KLQA 3MDAA 4I27A 5DLFA 1MQ2A 9ICVA 2NRVA 3MDCA 3EPGA 5CB1A 2C2EA 3RRGA 3NGDA 2W9BA 7ICHA 3M8RA 4YN4A 1MQ3A 3PVXA 5KFWA 3QEAZ 4M6WB 2ISPA 3TAQA 1BPZA 4QW9A 4NM1A 2C28A 3ZDBA 4ECRA 5F9NA 1RXWA 5IIJA 3V72A 4R64A 5IIMA 3H8WA 4XUSA 3AUOA 4GXJA 2BR0A 1T3NA 5KFDA 1XO1A 4UAWA 3HP6A 4M47A 4DSFA 2ZTEA 2R8GA 4NLZA 2W9CB 3LK9A 3K4GA 3EYZA 4B9VA 8ICNA 1TV9A 2V4QA 4I2EA 4RPXA 1XWLA 5KFFA 4JV1A 2XGQA 9ICBA 8ICFA 7ICOA 4ECTA 2RDJA 1D9DA 1U4BA 2R8KA 4XRHA 3EPIA 1XSLA 1ZQQA 4B9MA 4IRDA 4O3NA 4KITB 2MAXA 4PGXA 4I2JA 1ZQUA 3KTQA 4QZGA 4I2AA 2DFLA 1SL1A 5CHGA 3BQ0A 3T5HA 4J9MA 4NLGA 1ZQAA 2PI5A 7ICGA 9ICIA 1ZQFA 3ISCA 4F8RA 1ZQYA 4UAYA 1U45A 3RB4A 1JXLA 4RQ5A 5KFHA 3QEBZ 5DQGA 1NK8A 2BCUA 4YMOA 4PGYA 4O9MA 4ECXA 7ICNA 4ECZA 3ISBA 2UVVA 5KFRA 1NKEA 5DGBA 4PPXA 5KFQA 1XSPA 4MFFA 5EWEA 1CEZA 4F50A 5J0UA 4ED0A 1RYSA 1L3VA 5KFOA 3UQ2A 5DG7A 2W8LA 1ZQPA 3OGUA 3TFSA 2ZUDA 1NJZA 2BHNA 1ZQRA 3PW4A 3JPSA 4JWMA 4YFKA 5EWFA 3TARA 4QWAA 2FMQA 3EWAA 5J2CA 2GWSA 1QSLA 4DSJA 5J2BA 2PFQA 2DPIA 5J29A 4F4WA 3SYZA 4BXOB 4DL2A 4P4MA 2ASLA 4F4KA 5D46A 1U47A 4F4ZA 5IIKA 8ICLA 4MEYA 2MUTB 3AU6A 1KEJA 1L3UA 2BCQA 3PR4A 3JPOA 7ICPA 4YR3A 3QZ8A 1QSYA 1SKSA 4YQWA 3K75D 3RJHA 5DB7A 4DL7A 5DBCA 3GV8B 2ZTCA 9ICSA 3RH5A 1SZPA 5BOMA 4DQRA 3MR5A 3ZDEA 2KZMA 1ZQHA 1A76A 4QWDA 4DEZA 4DLGA 4RU9A 3RAQA 3RR8A 4JV0A 5J0OA 5L1LA 1C7YA 5KG3A 4M9GA 4UB2A 4KLTA 2HHSA 3KHHA 1ZJMA 3C1ZA 1KFTA 1D8YA 4Q43A 5HHIA 4RT2A 4RQ2A 3C5GA 4C8LA 3RH4A 3ETLA 1S97A 3PW7A 5L9XA 1RXVA 4QWBA 4NLKA 3GILA 1TAUA 4DQIA 3BQ2A 5KFXA 4YD1A 3TI0A 4RNOA 4KLLA 4FO6A 5KFKA 3M9OB 4QZCA 4UB4A 3Q8LA 1X9SA 5J0RA 4DWIA 3ZDDA 4M9NA 2AU0A 2RDIA 1KFSA 4UB3A 5J0XA 5KFZA 4IQUA 2W9CA 1ZQKA 3C2LA 4RNNA 5HP4A 2BCRA 3GIJA 4UB1A 4DFPA 4I2GA 2VANA 3GIMA 4ELTA 3EZ5A 2A1JA 3RB3A 7ICSA 1ZQSA 2HVHA 1MC8A 5KFPA 9ICKA 5TZVA 2XO7A 3HPOA 1NOMA 1NK9A 1TAQA 2BPFA 3PR5B 3Q8RB 4UAZA 2IBKA 3ISDA 1COOA 4LVSA 8ICPA 1ZQLA 5BPCA 2F1IA 8ICBA 3GFKB 8ICEA 3MR2A 2NRTA 4FS2A 5KTQA 9ICPA 1K1QA 3H8JA 2C22A 5KFGA 4IRKA 4O3QA 3PX0A 5J0QA 3T5JA 3N4MB 4MFCA 3MR3A 1LV5A 2IHMA 4MEXA 3OHAA 3HW8A 4F91B 5EOZA 4DQPA 3ZDAA 3Q8QB 4Q45A 1Y88A 3MFIA 1BPBA 3V7KA 7ICVA 1T8EA 5DLGA 1UA0A 2ALZA 4LZDA 3QE9Y 4YXMA 3Q8PB 4HYKA 1RZTA 2KFZA 4F2RA 2BGWA 2BCVA 4KLMA 2C2RA 2PFOA 8ICQA 4JWNA 2FMSA 1BPYA 4DFKA 2AGQA 1ZQBA 2VA2A 1BVSA 4XA5A 5J0WA 3N97B 1DOQA 1XSNA 2ISOA 8ICRA 3PW0A 7ICQA 3LWMA 5DG9A 3RJEA 2MUTA 4QZBA 4EYIB 4F5NA 1HUOA 2BPGA 5DQHA 5DBBA 5KFNA 1AROP 2XGPA 4F5OA 1Z3EB 4UBCA 2W9MA 4Z6EA 2FMPA 3B0XA 4IR1A 2F1JA 2C2DA 4KN4A 5IILA 2HHWA 5J2HA 1ZQTA 2P66A 2XY7A 4ED3A 2IMWP 4ELUA 3PMLA 2VA3A 3ZD9A 4TURA 3OJSA 1WCLA 5KFBA 4M9LA 1NKCA 3M9MB 3PX6A 8ICMA 7ICTA 2BPCA 4YD2A 4J9RA 4I28A 3RAXA 2W9AA 4GXKA 4Z6CA 2HW3A 3T5LA 4J9PA 1BPDA 3C5FA 4B9UA 4PHDA 4J9NA 1S0NA 9ICWA 1BPEA 2VA8A 3MABA 5J2DA 3UPQA 1KLNA 5KT3A 4EBEA 1ZQMA 5DBAA 4K4HA 1X2IA 4ECWA 2HHVA 2I1QA 2XY5A 1ZQIA 9ICAA 1JX4A 4TUSA 4KLDA 4IRCA 2A1JB 5KT7A 3E2EA 2JEIA 4NY8A 1Z00B 4YG2A 4PHAA 4JUZA 3KHLA 4G3IA 3KHRA 4BDPA 1B22A 1S77D 2Q0ZX 4KTQA 4F3OA 3SI8A 3UXOA 9ICFA 8ICXA 5KFAA 4O3SA 5KG2A 2W9BB 4C8KA 4BWMA 5KFSA 1N48A 1PZNA 3G6VA 4QZAA 1NK7A 4IQWA 9ICNA 2AGOA 4F4YA 4QZDA 1ZQJA 4ECVA 4YMNA 3PY8A 9ICJA 9ICGA 5KG0A 3FDSA 1SKWA 5JUMA 7ICFA 5KFIA 3TANA 9ICLA 1NJYA 1SL0A 3C1YA 5F9LA 3V7JA 1S10A 4RQ6A 3RJIA 2BCSA 3MR6A 2JZBB 1ZQNA 4XQ8A 4RQ4A 3Q8SB 3M8SA 4RQ1A 4FBTA 8ICIA 3JPRA 3RJJA 1ZQXA 5J2JA 8ICTA 9ICQA 1S0OA 1T4GA 2ZJAA 4Z6DA 3OHBA 4GC6A 3RB6A 3RR7A 4YMMA 7ICIA 1B43A 2F1HA 3RBDA 9ICCA 3GQCA 1BGXT 1BPXA 3T5KA 4YR2A 2FLNA 5KG7A 2NRWA 4I29A 1JXEA 5L1JA 4RZRA 4MF2A 1QLNA 1ZQEA 3SZ2A 2FPMA 4RQ8A 1QTMA 4YR0A 3KHGA 3LWLA 5L1IA 3H40A 4RQ3A 1IM4A 8ICZA 4QZ9A 5L1KA 2ZUCA 4NM2A 4DLEA 1EXNA 4R8UA 3QZ7A 5BOLA 5J2IA 3UQ0A 3NTUA 1S0VA 4MFAA 1JIHA 2ZTDA 3GIIA 1NJWA 4J9SA 5D49A 4BWJA 4RPZA 1TKDA 4GLXA 4KMUA 3MFHA 4NLNA 4DSIA 4ECYA 3RB0A 3G6YA 4ELVA 1V9PA 1TK8A 1MSWD 3FYHA 5IIOA 5J2AA 4BXOA 3ZDCA 4DSEA 2H5XA 4YXJA 3V6HA 1CUKA 5KFUA 2V4RA 4ECUA 2V9WA 5DKWA 4DO9A 4ED8A 1NKBA 5D4BA 4R66A 2BDPA 4RUAA 2KZZA 1S76D 5HMLA 4QZHA 4KLSA 1D8LA 2AQ0A 5J0SA 1ZQOA 3UXNA 1UA1A 8ICKA 5J2EA 1JMSA 2B21A 2BKEA 3V6JA 2NRXA 1TK5A 4NXZA 3PO4A 2PXIA 4PHPA 1JN3A 4QWEA 4R65A 8ICUA 3RBEA 4RQ7A 4QWCA 1UT5A 1U9LA 4EZ9A 4JV2A 2PI4A 5J0PA 3PV8A 3GIKA 5KG5A 4I2DA 5KT2A 3RJGA 4J9LA 2PFPA 2AQ4A 5KT5A 2HHTA 8ICCA 2XC9A 9ICOA 5KG4A 5KFEA 4DS5A 3JPTA 2UVUA 3B0YA 5J0TA 4ZH4A 8ICSA 2FPKA 1A77A 1XS9D 8ICWA 1WCNA 4YVZA 4E0DA 4DFMA 2R8JA 4EEYA 3RJFA 4DOAA 3ZD8A 4M9HA 3BQTA 3BJYA 2ASDA 2ZJ8A 5DDYA 2ZUBA 5KFTA 4TQSA 5DB8A 3PX4A 5KFYA 4DOCA 2IA6A 1NK6A 4I2IA 3JPPA 4O3OA 9ICTA 3TQ1A 5J0YA 2IHNA 2FPLA 4KLJA 2BQRA 4QW8A 4CCHA 5KFCA 1S9FA 1L3SA 4O0IA 4DSKA 4TUQA 4EBDA 1NK0A 4PHEA 4C8OA 4J9OA 3Q8MA 2XCAA 4ED2A 4RT3A 2AJQA 1RYRA 5KT6A 4DL4A 4Z6FA 4DFJA 3OJUA 2Y1IA 2BQ3A 4K4GA 9ICUA 4P4PA 2BQUA 4DQQA 5CR0A 1D9FA 3PO5A 3HT3A 4YP3A 3TAPA 5J2FA 4DF8A 1X9WA 4R8UB 3MGHA 3PW2A 4QZ8A 3PMNA 2LYHA 2P6UA 5CP2A 4QZIA 4R63A 7ICRA 1NK5A 1SL2A 4RPYA 1KSPA 7ICEA 2HHXA 3RJKA 3C21A 4IR9A 4M0AA 4TQRA 8ICYA 4DL6A 7ICLA 3V6KA 2OWOA 1NJXA 3H4DA 1X9MA 5DG8A 1H38A 4KLUA 4KLEA 1KTQA 2FLLA 3C23A 2HHQA 4P2HA 1L5UA 4RNMA 7ICUA 3GDXA 3RRHA 4KLGA 3IHQB 8ICGA 1L3TA 1ZQGA 3IM1A 5CJ7A 2XY6A 2FLPA 2HVIA 2KN7A 4ECQA 2P6RA 1ZYQA 2R8HA 1ZQDA 3V7LA 4FS1A 4DSLA 8ICHA 1K1SA 4C8MA 2M9NA 1QSSA 4LZGA 3BDPA 4J9KA 3JPNA 5KFJA 2J6SA 1SKRA 4IQVA 5CWRA 4F5QA 4EYHB 4DQSA 4F5RA 3BQ1A 2J6UA 4O5CA 4DOBA 2ZJ5A 5DDMA 3UXPA 1TK0A 2UVWA 1ZQCA
chains in the Genus database with same CATH superfamily
4UB5A 4M2YA 4F2SA 4ED7A 1U49A 1TFRA 5DB6A 2CPRA 3H4BA 3ORYA 1Z1BA 4QZEA 3H7IA 5KFLA 5KG1A 2JRZA 4F92B 2ZIVA 1UT8A 4FBUA 1ZD4A 2DQNB 2QB0A 4I2FA 4M9JA 1ZJNA 1VJ5A 2W43A 5E79U 2ZXHA 5HNKA 2AXTU 3OSNA 3L3FX 8ICVA 4IS7A 2KMDA 1LB2B 3RTVA 1FEZA 4J9QA 5KFVA 1N56A 4O3RA 2W7OA 4Q8FA 2WFAA 2QKQA 4RQMA 2JR5A 1HUZA 2ODGA 4CF5A 2WTFA 2KG5A 2Y1JA 5DB9A 4MF8A 4AYBC 4C80A 2KFNA 2G5IB 2ZIUB 5J2KA 4KLOA 4KLFA 4IQTA 1L8LA 4DS4A 5HMMA 5L1MA 1DGSA 5IINA 2JEGA 2PFNA 4ED1A 4BGDA 1RG6A 2EZYA 4KLQA 1UQVA 3MDAA 4I27A 5DLFA 9ICVA 2NRVA 3MDCA 3KBBA 5KFWA 4M6WB 2ISPA 2HCFA 2C28A 3ZDBA 1RXWA 5IIJA 4R64A 3H8WA 1COKA 1AQ6A 3PSIA 3HP6A 4DSFA 2R8GA 4UATA 4B9VA 3S6JA 4RPXA 4Y2VA 7ICOA 2XIDA 4HAIA 3F2BA 4XRHA 2R8KA 2HDOA 3EPIA 2M0NA 1XSLA 4IRDA 2MAXA 4PGXA 3HJEA 1HEKA 4J9MA 4NLGA 2PI5A 2OH2A 3WK5A 3HRDD 3KFUF 4LJXA 3RB4A 2YMLA 5KFHA 1SXDA 3F2CA 4PGYA 4ECXA 4C4TA 3ISBA 2UVVA 4PPXA 5DGBA 3MGVA 4MFFA 5EWEA 4J03A 1RYSA 1L3VA 3UQ2A 2KK0A 5DG7A 2W8LA 1ZQPA 1KL9A 4ICAA 3OGUA 2ZUDA 4JWMA 3PW4A 3DDHA 2KSOA 2G07A 4BXOB 5HR6A 3RFAA 4F4KA 4QIWC 3UM9A 5IIKA 1J2NA 3AU6A 5G5HA 3PR4A 3JPOA 3QZ8A 1QSYA 1SKSA 2W11A 5DB7A 3GV8B 2ZTCA 5AKJA 1D8BA 4RU9A 2GOLA 1DRGA 3RR8A 3F5AA 5AM2A 2YQEA 3C1ZA 4Q43A 4RQ2A 3RH4A 1J97A 3ETLA 4QWBA 4C7YA 3TI0A 2VJ4A 4RNOA 1DXSA 4FO6A 4IL6U 4QZCA 4F71A 1PUZA 5H2FU 2W9CA 4RNNA 1TAMA 1JALA 3KZXA 5KFPA 4FE3A 3IG5A 1VDVA 3Q8RB 8ICPA 4BJQA 2IBKA 1ZQLA 3GFKB 8ICEA 2NRTA 1K1QA 3VC8A 4MFCA 2IHMA 3QUQA 3HW8A 4F91B 5EOZA 3R9KA 2DKXA 1T8EA 1QH9A 1ZXIA 2WHEA 3QE9Y 2KFZA 2BCVA 3MC1A 8ICQA 1RYUA 4DFKA 5AK6A 1BVSA 5J0WA 4FZMA 8ICRA 3AEVA 2KKVA 3L4PA 4CDGA 3AL0B 2G0AA 3B9JA 5DBBA 4UBCA 2LHTA 2OYYA 1YT3A 2W9MA 3B0XA 2C2DA 4KN4A 3M6KA 3NRWA 2P66A 4KX3A 3PMLA 2VA3A 3OJSA 1NKCA 7ICTA 3PX6A 8ICMA 2BPCA 4Z6CA 3K1RB 2F8LA 4PHDA 5KT3A 4K4HA 1SB3C 3OPXA 2HHVA 2XY5A 1N5XA 4IRCA 2A1JB 3E2EA 5A0LA 4PHAA 1SGGA 5ALWA 4G3IA 5AK5A 3AQFA 2HOQA 4BDPA 4KTQA 5AI0A 3SI8A 2FJ6A 3QX7A 9ICFA 8ICXA 5KG2A 3PSTA 1ZQJA 4F4YA 1VLBA 2YY6A 5KFIA 1NJYA 5AKKA 1S10A 2BCSA 3MR6A 2KV2A 3PZPA 1ZQXA 8ICTA 3RR7A 4Z6DA 4GC6A 4Y2SA 4YR2A 3N7PD 4MF2A 1QLNA 4JB3A 1QTMA 5JTIA 4YR0A 3QUTA 3H40A 1IM4A 5L1KA 2ZUCA 5AKYA 2VJ5A 4R8UA 1NJWA 4KX5A 2G08A 4J9SA 4BWJA 3CNHA 4GLXA 4A8EA 2MSNA 1Q3UA 3RB0A 3G6YA 1TK8A 5J2AA 3A0BU 4ED8A 3NVVA 1S76D 5AKIA 5HMLA 4QZHA 4KLSA 2AQ0A 8ICKA 1FFUA 1JRPA 5J2EA 2CN1A 4NXZA 3PO4A 3RBEA 4RQ7A 2CRXA 2MA1A 1KBUA 4I2DA 5KT2A 2KVCA 2PFPA 5AM5A 2XC9A 5KG4A 5KFEA 1Z4OA 2UVUA 5J0TA 8ICSA 1A77A 8ICWA 4YVZA 4E0DA 3WKCA 4AYBF 5KFTA 5DB8A 1P7DA 2EAMA 4I2IA 3DEEA 4O3OA 2HBMA 5GTIU 2FPLA 4CCHA 1IV8A 5ALJA 1S9FA 4DSKA 1NK0A 4J9OA 4ED2A 2B6GA 5KT6A 4DL4A 3CW2C 2BQ3A 2KKPA 2BQUA 4YP3A 3TAPA 5J2FA 4Y2RA 4DCCA 4C7ZA 5CP2A 4R63A 7ICEA 5AM0A 2HHXA 3C21A 2O6KA 2W55A 4DL6A 5DG8A 4KLUA 3E0FA 3C23A 1N2XA 5ALGA 8ICGA 1ZQGA 3F2DA 2HVIA 4ACOA 2KN7A 1ZYQA 2R8HA 1ZQDA 2KOBA 4C8MA 5KFJA 2Z7JA 4Y2XA 3BQ1A 2J6UA 3UMCA 5DDMA 3BZKA 3UXPA 7ICKA 4EZ6A 5KFMA 2OEHA 5IIIA 1WG8A 1KFDA 4CE6A 2KTQA 1WWUA 3M9NB 4B9NA 4JK1A 4B9LA 7ICJA 5AI9A 5C5JA 9ICHA 1L7MA 3IG8A 2KZ3A 1N62A 3NS1A 4PH5A 3MGIA 1IXRA 8ICJA 2H3VA 3TFRA 3GV5B 2WF8A 2OHFA 2JGAA 4B9SA 2PKEA 2VIXA 3HWTA 4NLCA 2JZBA 3C29A 3T79A 3G6XA 4DL5A 5CRXA 1M6YA 3PNCA 4OJLA 1ZETA 3AN1A 2ZG6A 4PZNA 3T3FA 9ICEA 2FDRA 2E8NA 3QU9A 4O3PA 2DPJA 4GC7A 5CA7A 4I2HA 4QZFA 3NVZA 9ICXA 3AU2A 4BX9C 2YTUA 2MU2A 4YCXA 5ALTA 3JPQA 3OSPA 4K4IA 1MQ2A 3KZIU 2PMZC 2QARB 1FIQA 2W9BA 3IRUA 1MQ3A 3PVXA 2KJ5A 3QEAZ 4OJ6A 4ECRA 5F9NA 5IIMA 4CF3A 2A3VA 4UAWA 4M47A 2ZTEA 3LK9A 3EYZA 5KFFA 8ICFA 4US9A 1D9DA 1OXJA 4OO1J 1RQLA 4KITB 4I2JA 1ZQUA 2E1FA 2DFLA 3ALRA 1ZQAA 2YB4A 2ESEA 9ICIA 1U45A 3QEBZ 5DQGA 5ALHA 5AM4A 4NJ8A 5KFRA 2JMGA 3O0FA 5KFOA 2NO5A 3KD3A 1FFVA 3TFSA 1NJZA 8ICUA 2FMQA 4QWAA 1L7PA 2GWSA 2YMQA 1SXEA 4F4WA 1U47A 4F4ZA 8ICLA 4MEYA 2MUTB 1JROA 2RP5A 3C28A 4YR3A 2N1RA 4DL7A 9ICSA 2H3QA 5DBCA 3RH5A 1SZPA 1DK2A 4JV0A 5ALLA 4M9GA 2D6FC 2HHSA 3KHHA 1D8YA 2W54A 3C5GA 4C8LA 2XVTA 4NLKA 5KFXA 5KFKA 3M9OB 4UB4A 3Q8LA 1X9SA 3ZDDA 1OUQA 5J0XA 1X6JA 3C2LA 5HP4A 2VANA 2G09A 3GIMA 1ZQSA 5J8YC 5ALOA 4IC9A 2BPFA 4LVSA 2IOFA 3ISDA 5BPCA 8ICBA 4FS2A 2KICA 4IRKA 4O3QA 3N4MB 1LV5A 2R18A 5ALDA 5AM1A 3ZDAA 1BNPA 4Q45A 1Y88A 3V7KA 4C4SA 2ZIVB 4Y2JA 1X40A 3QXGA 3Q8PB 4F2RA 1ECWA 2QB0B 1KW4A 4JWNA 2FMSA 1BPYA 1ZQBA 2VA2A 2ISOA 1DOQA 1XSNA 3RJEA 2F77X 1SV0C 3CP8A 1T94A 1NI3A 4USAA 5J2HA 2XY7A 2E1EA 2LYBA 3BS5A 4QIWF 4M9LA 4EEKA 5ALIA 2IOFK 3FC4A 4I28A 3RAXA 4GXKA 2HOFA 2HW3A 3ZI4A 4J9PA 4B9UA 4J9NA 1BPEA 5J2DA 1KLNA 4EBEA 4NV0A 5DBAA 1X2IA 2I6XA 9ICAA 1X66A 2JXJA 4TUSA 5KT7A 3NRZA 1NNLA 2JEIA 1Z00B 2H3ZA 2WAQF 3KHRA 1ZOLA 1B22A 1DK3A 5AI4A 1F0MA 2BDUA 4O3SA 5GTHU 2A19A 4C8KA 4IQWA 1N48A 1NK7A 2OCEA 9ICNA 9ICLA 2G06A 4RQ6A 4ZOHC 4UAVA 2WB1C 4XQ8A 4RQ4A 9ICQA 1S0OA 1T4GA 2ZJAA 7ICIA 3F53A 3NASA 9ICCA 3KOOA 1BGXT 2FLNA 4I29A 1ZQEA 2FPMA 2JV3A 5ALNA 3K1ZA 5C0YA 3EUB2 2KP7A 4PJ0U 2DWQA 2K8BB 4QZ9A 4NM2A 1EXNA 5BOLA 3NTUA 3GIIA 3D2NA 5D49A 5KL1B 1TKDA 3QYPA 5AM3A 4NLNA 2NYVA 2DBYA 1MSWD 3FYHA 4BXOA 4KMOB 1V85A 1XO0A 2KE7A 4DSEA 2H5XA 3V6HA 1CUKA 2WF6A 1NKBA 4P0PB 5J0SA 1UA1A 2BKEA 3TACB 4AP9A 4UB6U 4Y2YA 4PHPA 3IN5A 1UCVA 4R65A 4QWCA 4EZ9A 4JV2A 5KG5A 3U26A 2AQ4A 2HHTA 8ICCA 3N7RC 3WU2U 4ZH4A 3TADC 5AKHA 2WAQC 4DOAA 2ASDA 5ALXA 2MRLA 5KFYA 4DOCA 2ZIWA 1O08A 3ONNA 3JPPA 9ICTA 3E58A 2IOHA 3TKAA 5KFCA 4Y2QA 1L3SA 4G9BA 5AK3A 3WKDA 4C8OA 4CNQA 2K60A 4DFJA 2LPEA 2Y1IA 2K8CB 5CR0A 3PO5A 4DF8A 1X9WA 4QZ8A 7ICRA 1NK5A 1SL2A 4RPYA 1A6SA 1K5OA 3RJKA 4M0AA 8ICYA 3KKAA 5ALKA 1X9MA 4KLEA 1WWVA 2PMZF 1L5UA 4RNMA 3GDXA 3IHQB 2XY6A 2LM1A 3V7LA 1K1SA 4LZGA 1DGJA 1ZQ1C 3QUCA 5CWRA 1FO4A 4PL2A 3H8MA 5K4LA 3FAHA 4O5CA 4DOBA 1TK0A 2UVWA 2E8PA 4KN7A 4O5EA 3THVA 4M6WA 4DF4A 3WK4A 4RUCA 1F44A 5J2GA 3H0LB 1LKYA 3D6JA 4X5VA 4DL3A 2W7PA 4Q8EA 5DGAA 8ICOA 5DQIA 3M1YA 4GFJA 5KG6A 2I9GA 1ZQZA 4P0QA 2ATLA 1SV0A 1X9XA 3H0MB 5HHHA 5AICA 3BZCA 5EWGA 4U6PA 1KDHA 1KRPA 2YMPA 1U48A 2AHOB 3H8SA 5KL8B 2W8KA 5KT4A 4RQ0A 2NRZA 2WF9A 3UMGA 2UVRA 4EBCA 5ALQA 4P4OA 2JEJA 3GV7B 4ED6A 1X42A 1HJPA 3RH6A 3C2KA 1QCKA 1XU4A 4KLHA 5ALFA 4UARA 3KKAC 2HMXA 2C2EA 3RRGA 7ICHA 3NGDA 2OXOA 4QW9A 5ALMA 3V72A 4XUSA 4GXJA 2BR0A 4C0ZA 1XO1A 1KKXA 1SZHA 2W9CB 3K4GA 1TV9A 4I2EA 4EX7A 2XGQA 1Z1VA 9ICBA 4ECTA 5KAIU 2AH5A 3ETRA 1Q46A 2FI1A 1U4BA 1PK1B 3AQEA 4O3NA 1CRXA 1SL1A 5CHGA 3T5HA 1B0XA 1ZQFA 4UAYA 3N28A 1JXLA 3D2SA 4RQ5A 1NK8A 5ALSA 4CF4A 2EAPA 4ECZA 4F50A 5J0UA 4ED0A 2KJ8A 4NL9C 5G5GA 1V38A 2BHNA 1ZQRA 2KHVA 3TARA 5J2CA 2EZZA 4RQNA 1QSLA 5J2BA 4JMUA 3SYZA 3H0RB 5D46A 2EAOA 2BCQA 4Y2UA 3RJHA 1CI4A 3DV9A 2ZIXA 3ZDEA 5B5EU 1A76A 4DEZA 5AK4A 1L6NA 5J0OA 5KG3A 4UB2A 5HHIA 3PW7A 5L9XA 4DQIA 4YD1A 1F5SA 5J0RA 4DWIA 2AU0A 1KFSA 5KFZA 1ZQKA 2LKYA 2BCRA 4I2GA 3GIJA 4DFPA 4CGZA 4F72A 4ELTA 2K4PA 2A1JA 3RB3A 7ICSA 4UB8U 1MC8A 9ICKA 3HPOA 1NOMA 1TAQA 2EANA 4UAZA 1COOA 2F1IA 5EE3A 2RLTA 2K89A 9ICPA 1S5LU 2C22A 5KAFU 3PX0A 4PZOA 3MR3A 4MEXA 3OHAA 5AKZA 4DQPA 1RDFA 3Q8QB 1UA0A 2ALZA 4LZDA 4HYKA 1QQ6A 2BGWA 2C2RA 2PFOA 2KSOB 2AGQA 1KQQA 4XA5A 1N5WA 1PK3A 2YN4A 3SR6A 3LWMA 4EYIB 4QZBA 4F5NA 3QU7A 5DQHA 5KFNA 1AROP 2XGPA 2F2AB 1Z3EB 3QU5A 2F1JA 4NL9A 5IILA 4DFDA 4ED3A 3ZD9A 2QLTA 3M9MB 4YD2A 4J9RA 2JHDA 1URJA 1S0NA 3UPQA 4OJPA 1ZQMA 1YZ7A 3I28A 1IIPA 1JX4A 1S8OA 4NY8A 4YG2A 4F3OA 3UXOA 2QARA 1RM6C 2W9BB 3G6VA 4QZAA 9ICJA 4QZDA 4ECVA 3PY8A 3ICXA 3FM9A 3LVWA 9ICGA 3FDSA 1SKWA 7ICFA 3HKZF 3TANA 2HOIA 3C1YA 5F9LA 1ZQNA 2RQ5A 3Q8SB 3M8SA 4FBTA 8ICIA 3AM9A 4YMMA 1B43A 2F1HA 3CRXA 2ZXIA 2NRWA 1JXEA 4NLBA 3SZ2A 2L5YA 2ZIUA 3KHGA 3NVYA 5L1IA 4GIBA 2RRDA 4RQ3A 8ICZA 3RF9A 4DLEA 4C4RA 5J2IA 4MFAA 1UHUA 1JIHA 2ZTDA 3GZFA 3SAFA 5ALPA 4DSIA 5ALZA 4ELVA 1V9PA 4Y2TA 2A1AA 4YXJA 3SEIA 2V4RA 4ECUA 3QU2A 4DO9A 1YZ6A 3IV6A 4R66A 2BDPA 4RUAA 2KZZA 1D8LA 1SIJA 3HILA 1NZPA 2I5HA 3V6JA 2NRXA 3L5KA 1TK5A 5AI6A 2WF7A 1O03A 2PXIA 1ZD5A 2EZXA 4QWEA 1U9LA 2PI4A 5J0PA 3PV8A 1SWVA 2KIVA 3RJGA 4J9LA 2Y0SF 3WK8A 1Q8KA 5KT5A 4OJOA 1RQNA 4QNLA 4DS5A 5ALEA 2FPKA 1WCNA 2JH7A 2R8JA 4EEYA 4M9HA 1J2MA 3LYSA 3BJYA 4TQSA 5AKXA 1SV4A 1NK6A 2NO4A 2W3SA 4FZNA 5J0YA 2IHNA 4KLJA 2BQRA 2KD1A 1QQ5A 3N7SC 1WUDA 2F3NA 4EBDA 4PHEA 3A0HU 1RYRA 3WKAA 9ICUA 4DQQA 3HT3A 2F44A 4R8UB 3MGHA 2YMMA 4QZIA 1BNOA 2GLEA 5AI5A 1L8OA 5ALRA 2Y0SC 7ICLA 3V6KA 3H4DA 5HR7A 3SAGA 3HKZC 4FZLA 2FLLA 2HHQA 4UASA 3SMVA 4EELA 7ICUA 3RRHA 4KLGA 1L3TA 5CJ7A 4ECQA 2P6RA 5AI8A 4FS1A 2YB1A 1QSSA 4BUGA 2OM6A 5ALYA 3JPNA 1SKRA 4IQVA 2CXYA 2ZJ5A 1ZQCA 4FFDA 2LI6A 3SD7A 2J6TA 4PGQA 2EDUA 8ICAA 2DKZA 1GO3F 1B4FA 2HBJA 4UAUA 3LDAA 2E8MA 3EW9A 1Z00A 1ZD2P 4B6JA 4UW9A 4ECSA 2HHUA 5ALVA 1LVHA 1NK4A 4M04A 1RPLA 1N63A 4WJ3B 3Q8KA 4I2CA 1PVQA 3SV3A 3ED5A 3PSFA 1JUDA 1TVAA 3MBYA 1ZQWA 3NVWA 4GXIA 1Z19A 3QNMA 3HX0A 1Q3VA 4C8NA 1XC9A 2LM4A 3SV4A 2R8IA 5T14A 4KLIA 1QQ7A 4EENA 2FE9A 2Q4TA 4Q44A 4F5PA 3PW5A 1S0MA 3SQIA 4O5KA 2JEFA 4TUPA 9ICMA 1ZQVA 2ASJA 4UBBA 3BQ7A 2BZFA 1C20A 4UQGA 4F4XA 7ICMA 4OJ5A 4F93B 2K4HA 1ED1A 2DUYA 2XCPA 2AGPA 4I2BA 9ICRA 1T7PA 4B9TA 3C2MA 2XICA 1JI7A 1L7NA 5J8YA 1L7OA 3EPGA 5CB1A 3M8RA 4YN4A 5JRTA 4NM1A 3TAQA 1BPZA 3AUOA 1PVPA 1T3NA 5KFDA 4NLZA 3IDWA 8ICNA 2V4QA 1XWLA 4JV1A 3IP4B 2RDJA 2HI0A 1OW5A 1HIWA 1ZQQA 4B9MA 4I2AA 3KTQA 4QZGA 2LYAA 3BQ0A 2K4IA 2NV3A 1X6IA 7ICGA 3ISCA 4F8RA 1ZQYA 2E3TA 4O9MA 2BCUA 4YMOA 7ICNA 1NKEA 1CEZA 5KFQA 1XSPA 2H3IA 2ZIWB 2D3DA 3JPSA 4YFKA 3TADA 5EWFA 4QJFB 3EWAA 4DSJA 2HSZA 2PFQA 2DPIA 5J29A 4DL2A 4P4MA 4US8A 2ASLA 1L3UA 1KEJA 7ICPA 5JU5A 4YQWA 3K75D 3I76A 5KNIA 2KNJA 5BOMA 4DQRA 3MR5A 2KZMA 1ZQHA 4QWDA 4DLGA 3RAQA 5L1LA 1C7YA 1KN5A 4KLTA 1ZJMA 1KFTA 4RT2A 1S97A 1RXVA 1TAUA 3GILA 3BQ2A 5CEHA 4KLLA 4M9NA 2RDIA 4UB3A 2ES6A 1TE2A 4IQUA 2F8KA 4UB1A 2K4EA 3EZ5A 2GH1A 2HVHA 5AKLA 2JH1A 5TZVA 2XO7A 5ALUA 1NK9A 5B66U 2DL0A 3PR5B 3WK7A 4O3MA 3PSPA 3MR2A 3GU3A 5KTQA 2B0CA 3H8JA 5AIAA 3J81j 5KFGA 5EE9A 1ZRNA 2E5SA 5J0QA 3T5JA 2D8CA 3MFIA 1BPBA 7ICVA 1IG6A 5DLGA 5EE0A 5FP0A 4YXMA 1RZTA 4P0QB 4KLMA 2H3FA 5TISU 3BS7A 2VKQA 3N97B 3D2QA 2RHFA 3WKEA 3PW0A 7ICQA 5DG9A 2MUTA 1HUOA 2BPGA 2KHQA 2LBOA 4F5OA 4Z6EA 2FMPA 2KIWA 4IR1A 1UPHA 2HHWA 1ZQTA 2IMWP 4ELUA 4TURA 1WCLA 5KFBA 2W9AA 3NUQA 3T5LA 1SWWA 1BPDA 2F76X 3C5FA 2YX8A 1WYGA 9ICWA 2VA8A 3MABA 1N60A 1XNSA 4ECWA 2I1QA 1ZQIA 3LVVA 2XI9A 1PVRA 4KLDA 4JUZA 3KHLA 1ZD3A 1S77D 2Q0ZX 2W3RA 3VCBA 2KVSA 3AMZA 2EH9A 5KFAA 4BWMA 5KFSA 1PZNA 4Y2PA 2AGOA 2G5HB 4YMNA 4PL1A 5KG0A 5JUMA 3CYMA 1SL0A 3V7JA 3RJIA 2JZBB 4RQ1A 2E8OA 3JPRA 3RJJA 5J2JA 3RB6A 2LMRA 2WF5A 3OHBA 3RBDA 2HBKA 3GQCA 1BPXA 3T5KA 2KEYA 4CRXA 1PK1A 5KG7A 5L1JA 4RZRA 4NWIA 4RQ8A 5AKGA 4OD0A 1V97A 2K8AA 3LWLA 2P35A 3QZ7A 3UQ0A 1S0VA 4EX6A 2DGZA 4RPZA 3BS5B 4KMUA 3MFHA 4ECYA 1NZBA 1N61A 3WK9A 1Z4NA 5IIOA 1ZRMA 3ZDCA 5KFUA 2W04A 2V9WA 5DKWA 5D4BA 3SENA 3SAHA 1ZQOA 3UXNA 1JMSA 2B21A 2ZIXB 1MA7A 2Y9UA 1JN3A 2WB1F 2Y9TA 1UT5A 3QUBA 3GIKA 3F5EA 4U7CA 2EQYA 9ICOA 3OTQA 3WKBA 3JPTA 1LKYB 3B0YA 1XS9D 3I1YA 4DFMA 3RJFA 3ZD8A 3BQTA 2ZJ8A 5DDYA 2ZUBA 3M6ZA 3PX4A 2IA6A 3M7DA 2HBLA 3TQ1A 4QW8A 4O0IA 2GO7A 4TUQA 3Q8MA 4OCZA 2XCAA 4RT3A 2AJQA 5AHXA 5AIBA 4Z6FA 3OJUA 4K4GA 4P4PA 1D9FA 3PW2A 3QU4A 1T3QA 3PMNA 2LYHA 2P6UA 1A0PA 1KSPA 3WK6A 3UMBA 4IR9A 2QB1A 5F3XB 4TQRA 2OWOA 1NJXA 1H38A 5EE1A 1KTQA 2DF4B 4P2HA 1MN8A 4P0PA 3IM1A 2FLPA 2W03A 4DSLA 8ICHA 2M9NA 2KJ9A 3BDPA 4J9KA 4MHVA 5AKEA 2J6SA 4F5QA 4EYHB 4DQSA 4F5RA
chains in the Genus database with same CATH topology
4UB5A 7ICKA 4EZ6A 4KN7A 4O5EA 5KFMA 3THVA 4M6WA 5IIIA 4DF4A 4M2YA 4F2SA 4ED7A 2J6TA 1KFDA 4PGQA 4RUCA 5J2GA 1U49A 1TFRA 5DB6A 2KTQA 8ICAA 3M9NB 3H4BA 3ORYA 4DL3A 4X5VA 4Q8EA 5DGAA 4B9NA 8ICOA 4JK1A 3LDAA 4QZEA 4B9LA 3H7IA 5KFLA 5KG1A 5C5JA 7ICJA 9ICHA 4F92B 3EW9A 1UT8A 2KZ3A 5DQIA 1Z00A 4FBUA 5KG6A 4ECSA 2I9GA 2HHUA 1ZQZA 2ATLA 1NK4A 4PH5A 4I2FA 3MGIA 4M9JA 1ZJNA 1IXRA 8ICJA 4M04A 1RPLA 3TFRA 3Q8KA 4I2CA 3GV5B 5HNKA 3OSNA 3SV3A 1TVAA 8ICVA 5HHHA 4B9SA 1LB2B 5EWGA 3MBYA 3RTVA 1ZQWA 4GXIA 1KDHA 4J9QA 5KFVA 3HWTA 3HX0A 1N56A 4O3RA 2JZBA 3G6XA 4C8NA 4DL5A 1KRPA 1XC9A 3SV4A 3PNCA 4Q8FA 1ZETA 1U48A 2R8IA 1HUZA 3H8SA 4KLIA 3T3FA 9ICEA 2W8KA 5KT4A 4RQ0A 2WTFA 2NRZA 4Q44A 2Y1JA 4O3PA 4F5PA 5DB9A 3PW5A 4MF8A 1S0MA 2DPJA 4O5KA 2JEFA 2UVRA 4EBCA 4TUPA 4GC7A 2KFNA 4P4OA 9ICMA 1ZQVA 5J2KA 5CA7A 3GV7B 2ASJA 4UBBA 4QZFA 2JEJA 4I2HA 4KLFA 4ED6A 4KLOA 4UQGA 4IQTA 4F4XA 7ICMA 1HJPA 3RH6A 4DS4A 9ICXA 3AU2A 5HMMA 4F93B 3C2KA 1XU4A 2XCPA 1DGSA 2AGPA 4I2BA 5IINA 2JEGA 9ICRA 2PFNA 1T7PA 4KLHA 4ED1A 4YCXA 4BGDA 4B9TA 3C2MA 3JPQA 3OSPA 4K4IA 4KLQA 3MDAA 4I27A 5DLFA 1MQ2A 9ICVA 2NRVA 3MDCA 3EPGA 5CB1A 2C2EA 3RRGA 3NGDA 2W9BA 7ICHA 3M8RA 4YN4A 1MQ3A 3PVXA 5KFWA 3QEAZ 4M6WB 2ISPA 3TAQA 1BPZA 4QW9A 4NM1A 2C28A 3ZDBA 4ECRA 5F9NA 1RXWA 5IIJA 3V72A 4R64A 5IIMA 3H8WA 4XUSA 3AUOA 4GXJA 2BR0A 1T3NA 5KFDA 1XO1A 4UAWA 3HP6A 4M47A 4DSFA 2ZTEA 2R8GA 4NLZA 2W9CB 3LK9A 3K4GA 3EYZA 4B9VA 8ICNA 1TV9A 2V4QA 4I2EA 4RPXA 1XWLA 5KFFA 4JV1A 2XGQA 9ICBA 8ICFA 7ICOA 4ECTA 2RDJA 1D9DA 1U4BA 2R8KA 4XRHA 3EPIA 1XSLA 1ZQQA 4B9MA 4IRDA 4O3NA 4KITB 2MAXA 4PGXA 4I2JA 1ZQUA 3KTQA 4QZGA 4I2AA 2DFLA 1SL1A 5CHGA 3BQ0A 3T5HA 4J9MA 4NLGA 1ZQAA 2PI5A 7ICGA 9ICIA 1ZQFA 3ISCA 4F8RA 1ZQYA 4UAYA 1U45A 3RB4A 1JXLA 4RQ5A 5KFHA 3QEBZ 5DQGA 1NK8A 2BCUA 4YMOA 4PGYA 4O9MA 4ECXA 7ICNA 4ECZA 3ISBA 2UVVA 5KFRA 1NKEA 5DGBA 4PPXA 5KFQA 1XSPA 4MFFA 5EWEA 1CEZA 4F50A 5J0UA 4ED0A 1RYSA 1L3VA 5KFOA 3UQ2A 5DG7A 2W8LA 1ZQPA 3OGUA 3TFSA 2ZUDA 1NJZA 2BHNA 1ZQRA 3PW4A 3JPSA 4JWMA 4YFKA 5EWFA 3TARA 4QWAA 2FMQA 3EWAA 5J2CA 2GWSA 1QSLA 4DSJA 5J2BA 2PFQA 2DPIA 5J29A 4F4WA 3SYZA 4BXOB 4DL2A 4P4MA 2ASLA 4F4KA 5D46A 1U47A 4F4ZA 5IIKA 8ICLA 4MEYA 2MUTB 3AU6A 1KEJA 1L3UA 2BCQA 3PR4A 3JPOA 7ICPA 4YR3A 3QZ8A 1QSYA 1SKSA 4YQWA 3K75D 3RJHA 5DB7A 4DL7A 5DBCA 3GV8B 2ZTCA 9ICSA 3RH5A 1SZPA 5BOMA 4DQRA 3MR5A 3ZDEA 2KZMA 1ZQHA 1A76A 4QWDA 4DEZA 4DLGA 4RU9A 3RAQA 3RR8A 4JV0A 5J0OA 5L1LA 1C7YA 5KG3A 4M9GA 4UB2A 4KLTA 2HHSA 3KHHA 1ZJMA 3C1ZA 1KFTA 1D8YA 4Q43A 5HHIA 4RT2A 4RQ2A 3C5GA 4C8LA 3RH4A 3ETLA 1S97A 3PW7A 5L9XA 1RXVA 4QWBA 4NLKA 3GILA 1TAUA 4DQIA 3BQ2A 5KFXA 4YD1A 3TI0A 4RNOA 4KLLA 4FO6A 5KFKA 3M9OB 4QZCA 4UB4A 3Q8LA 1X9SA 5J0RA 4DWIA 3ZDDA 4M9NA 2AU0A 2RDIA 1KFSA 4UB3A 5J0XA 5KFZA 4IQUA 2W9CA 1ZQKA 3C2LA 4RNNA 5HP4A 2BCRA 3GIJA 4UB1A 4DFPA 4I2GA 2VANA 3GIMA 4ELTA 3EZ5A 2A1JA 3RB3A 7ICSA 1ZQSA 2HVHA 1MC8A 5KFPA 9ICKA 5TZVA 2XO7A 3HPOA 1NOMA 1NK9A 1TAQA 2BPFA 3PR5B 3Q8RB 4UAZA 2IBKA 3ISDA 1COOA 4LVSA 8ICPA 1ZQLA 5BPCA 2F1IA 8ICBA 3GFKB 8ICEA 3MR2A 2NRTA 4FS2A 5KTQA 9ICPA 1K1QA 3H8JA 2C22A 5KFGA 4IRKA 4O3QA 3PX0A 5J0QA 3T5JA 3N4MB 4MFCA 3MR3A 1LV5A 2IHMA 4MEXA 3OHAA 3HW8A 4F91B 5EOZA 4DQPA 3ZDAA 3Q8QB 4Q45A 1Y88A 3MFIA 1BPBA 3V7KA 7ICVA 1T8EA 5DLGA 1UA0A 2ALZA 4LZDA 3QE9Y 4YXMA 3Q8PB 4HYKA 1RZTA 2KFZA 4F2RA 2BGWA 2BCVA 4KLMA 2C2RA 2PFOA 8ICQA 4JWNA 2FMSA 1BPYA 4DFKA 2AGQA 1ZQBA 2VA2A 1BVSA 4XA5A 5J0WA 3N97B 1DOQA 1XSNA 2ISOA 8ICRA 3PW0A 7ICQA 3LWMA 5DG9A 3RJEA 2MUTA 4QZBA 4EYIB 4F5NA 1HUOA 2BPGA 5DQHA 5DBBA 5KFNA 1AROP 2XGPA 4F5OA 1Z3EB 4UBCA 2W9MA 4Z6EA 2FMPA 3B0XA 4IR1A 2F1JA 2C2DA 4KN4A 5IILA 2HHWA 5J2HA 1ZQTA 2P66A 2XY7A 4ED3A 2IMWP 4ELUA 3PMLA 2VA3A 3ZD9A 4TURA 3OJSA 1WCLA 5KFBA 4M9LA 1NKCA 3M9MB 3PX6A 8ICMA 7ICTA 2BPCA 4YD2A 4J9RA 4I28A 3RAXA 2W9AA 4GXKA 4Z6CA 2HW3A 3T5LA 4J9PA 1BPDA 3C5FA 4B9UA 4PHDA 4J9NA 1S0NA 9ICWA 1BPEA 2VA8A 3MABA 5J2DA 3UPQA 1KLNA 5KT3A 4EBEA 1ZQMA 5DBAA 4K4HA 1X2IA 4ECWA 2HHVA 2I1QA 2XY5A 1ZQIA 9ICAA 1JX4A 4TUSA 4KLDA 4IRCA 2A1JB 5KT7A 3E2EA 2JEIA 4NY8A 1Z00B 4YG2A 4PHAA 4JUZA 3KHLA 4G3IA 3KHRA 4BDPA 1B22A 1S77D 2Q0ZX 4KTQA 4F3OA 3SI8A 3UXOA 9ICFA 8ICXA 5KFAA 4O3SA 5KG2A 2W9BB 4C8KA 4BWMA 5KFSA 1N48A 1PZNA 3G6VA 4QZAA 1NK7A 4IQWA 9ICNA 2AGOA 4F4YA 4QZDA 1ZQJA 4ECVA 4YMNA 3PY8A 9ICJA 9ICGA 5KG0A 3FDSA 1SKWA 5JUMA 7ICFA 5KFIA 3TANA 9ICLA 1NJYA 1SL0A 3C1YA 5F9LA 3V7JA 1S10A 4RQ6A 3RJIA 2BCSA 3MR6A 2JZBB 1ZQNA 4XQ8A 4RQ4A 3Q8SB 3M8SA 4RQ1A 4FBTA 8ICIA 3JPRA 3RJJA 1ZQXA 5J2JA 8ICTA 9ICQA 1S0OA 1T4GA 2ZJAA 4Z6DA 3OHBA 4GC6A 3RB6A 3RR7A 4YMMA 7ICIA 1B43A 2F1HA 3RBDA 9ICCA 3GQCA 1BGXT 1BPXA 3T5KA 4YR2A 2FLNA 5KG7A 2NRWA 4I29A 1JXEA 5L1JA 4RZRA 4MF2A 1QLNA 1ZQEA 3SZ2A 2FPMA 4RQ8A 1QTMA 4YR0A 3KHGA 3LWLA 5L1IA 3H40A 4RQ3A 1IM4A 8ICZA 4QZ9A 5L1KA 2ZUCA 4NM2A 4DLEA 1EXNA 4R8UA 3QZ7A 5BOLA 5J2IA 3UQ0A 3NTUA 1S0VA 4MFAA 1JIHA 2ZTDA 3GIIA 1NJWA 4J9SA 5D49A 4BWJA 4RPZA 1TKDA 4GLXA 4KMUA 3MFHA 4NLNA 4DSIA 4ECYA 3RB0A 3G6YA 4ELVA 1V9PA 1TK8A 1MSWD 3FYHA 5IIOA 5J2AA 4BXOA 3ZDCA 4DSEA 2H5XA 4YXJA 3V6HA 1CUKA 5KFUA 2V4RA 4ECUA 2V9WA 5DKWA 4DO9A 4ED8A 1NKBA 5D4BA 4R66A 2BDPA 4RUAA 2KZZA 1S76D 5HMLA 4QZHA 4KLSA 1D8LA 2AQ0A 5J0SA 1ZQOA 3UXNA 1UA1A 8ICKA 5J2EA 1JMSA 2B21A 2BKEA 3V6JA 2NRXA 1TK5A 4NXZA 3PO4A 2PXIA 4PHPA 1JN3A 4QWEA 4R65A 8ICUA 3RBEA 4RQ7A 4QWCA 1UT5A 1U9LA 4EZ9A 4JV2A 2PI4A 5J0PA 3PV8A 3GIKA 5KG5A 4I2DA 5KT2A 3RJGA 4J9LA 2PFPA 2AQ4A 5KT5A 2HHTA 8ICCA 2XC9A 9ICOA 5KG4A 5KFEA 4DS5A 3JPTA 2UVUA 3B0YA 5J0TA 4ZH4A 8ICSA 2FPKA 1A77A 1XS9D 8ICWA 1WCNA 4YVZA 4E0DA 4DFMA 2R8JA 4EEYA 3RJFA 4DOAA 3ZD8A 4M9HA 3BQTA 3BJYA 2ASDA 2ZJ8A 5DDYA 2ZUBA 5KFTA 4TQSA 5DB8A 3PX4A 5KFYA 4DOCA 2IA6A 1NK6A 4I2IA 3JPPA 4O3OA 9ICTA 3TQ1A 5J0YA 2IHNA 2FPLA 4KLJA 2BQRA 4QW8A 4CCHA 5KFCA 1S9FA 1L3SA 4O0IA 4DSKA 4TUQA 4EBDA 1NK0A 4PHEA 4C8OA 4J9OA 3Q8MA 2XCAA 4ED2A 4RT3A 2AJQA 1RYRA 5KT6A 4DL4A 4Z6FA 4DFJA 3OJUA 2Y1IA 2BQ3A 4K4GA 9ICUA 4P4PA 2BQUA 4DQQA 5CR0A 1D9FA 3PO5A 3HT3A 4YP3A 3TAPA 5J2FA 4DF8A 1X9WA 4R8UB 3MGHA 3PW2A 4QZ8A 3PMNA 2LYHA 2P6UA 5CP2A 4QZIA 4R63A 7ICRA 1NK5A 1SL2A 4RPYA 1KSPA 7ICEA 2HHXA 3RJKA 3C21A 4IR9A 4M0AA 4TQRA 8ICYA 4DL6A 7ICLA 3V6KA 2OWOA 1NJXA 3H4DA 1X9MA 5DG8A 1H38A 4KLUA 4KLEA 1KTQA 2FLLA 3C23A 2HHQA 4P2HA 1L5UA 4RNMA 7ICUA 3GDXA 3RRHA 4KLGA 3IHQB 8ICGA 1L3TA 1ZQGA 3IM1A 5CJ7A 2XY6A 2FLPA 2HVIA 2KN7A 4ECQA 2P6RA 1ZYQA 2R8HA 1ZQDA 3V7LA 4FS1A 4DSLA 8ICHA 1K1SA 4C8MA 2M9NA 1QSSA 4LZGA 3BDPA 4J9KA 3JPNA 5KFJA 2J6SA 1SKRA 4IQVA 5CWRA 4F5QA 4EYHB 4DQSA 4F5RA 3BQ1A 2J6UA 4O5CA 4DOBA 2ZJ5A 5DDMA 3UXPA 1TK0A 2UVWA 1ZQCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UB5 A;  7ICK A;  4EZ6 A;  4KN7 A;  4O5E A;  5KFM A;  3THV A;  4M6W A;  5III A;  4DF4 A;  4M2Y A;  4F2S A;  4ED7 A;  2J6T A;  1KFD A;  4PGQ A;  4RUC A;  5J2G A;  1U49 A;  1TFR A;  5DB6 A;  2KTQ A;  8ICA A;  3M9N B;  3H4B A;  3ORY A;  4DL3 A;  4X5V A;  4Q8E A;  5DGA A;  4B9N A;  8ICO A;  4JK1 A;  3LDA A;  4QZE A;  4B9L A;  3H7I A;  5KFL A;  5KG1 A;  5C5J A;  7ICJ A;  9ICH A;  4F92 B;  3EW9 A;  1UT8 A;  2KZ3 A;  5DQI A;  1Z00 A;  4FBU A;  5KG6 A;  4ECS A;  2I9G A;  2HHU A;  1ZQZ A;  2ATL A;  1NK4 A;  4PH5 A;  4I2F A;  3MGI A;  4M9J A;  1ZJN A;  1IXR A;  8ICJ A;  4M04 A;  1RPL A;  3TFR A;  3Q8K A;  4I2C A;  3GV5 B;  5HNK A;  3OSN A;  3SV3 A;  1TVA A;  8ICV A;  5HHH A;  4B9S A;  1LB2 B;  5EWG A;  3MBY A;  3RTV A;  1ZQW A;  4GXI A;  1KDH A;  4J9Q A;  5KFV A;  3HWT A;  3HX0 A;  1N56 A;  4O3R A;  2JZB A;  3G6X A;  4C8N A;  4DL5 A;  1KRP A;  1XC9 A;  3SV4 A;  3PNC A;  4Q8F A;  1ZET A;  1U48 A;  2R8I A;  1HUZ A;  3H8S A;  4KLI A;  3T3F A;  9ICE A;  2W8K A;  5KT4 A;  4RQ0 A;  2WTF A;  2NRZ A;  4Q44 A;  2Y1J A;  4O3P A;  4F5P A;  5DB9 A;  3PW5 A;  4MF8 A;  1S0M A;  2DPJ A;  4O5K A;  2JEF A;  2UVR A;  4EBC A;  4TUP A;  4GC7 A;  2KFN A;  4P4O A;  9ICM A;  1ZQV A;  5J2K A;  5CA7 A;  3GV7 B;  2ASJ A;  4UBB A;  4QZF A;  2JEJ A;  4I2H A;  4KLF A;  4ED6 A;  4KLO A;  4UQG A;  4IQT A;  4F4X A;  7ICM A;  1HJP A;  3RH6 A;  4DS4 A;  9ICX A;  3AU2 A;  5HMM A;  4F93 B;  3C2K A;  1XU4 A;  2XCP A;  1DGS A;  2AGP A;  4I2B A;  5IIN A;  2JEG A;  9ICR A;  2PFN A;  1T7P A;  4KLH A;  4ED1 A;  4YCX A;  4BGD A;  4B9T A;  3C2M A;  3JPQ A;  3OSP A;  4K4I A;  4KLQ A;  3MDA A;  4I27 A;  5DLF A;  1MQ2 A;  9ICV A;  2NRV A;  3MDC A;  3EPG A;  5CB1 A;  2C2E A;  3RRG A;  3NGD A;  2W9B A;  7ICH A;  3M8R A;  4YN4 A;  1MQ3 A;  3PVX A;  5KFW A;  3QEA Z;  4M6W B;  2ISP A;  3TAQ A;  1BPZ A;  4QW9 A;  4NM1 A;  2C28 A;  3ZDB A;  4ECR A;  5F9N A;  1RXW A;  5IIJ A;  3V72 A;  4R64 A;  5IIM A;  3H8W A;  4XUS A;  3AUO A;  4GXJ A;  2BR0 A;  1T3N A;  5KFD A;  1XO1 A;  4UAW A;  3HP6 A;  4M47 A;  4DSF A;  2ZTE A;  2R8G A;  4NLZ A;  2W9C B;  3LK9 A;  3K4G A;  3EYZ A;  4B9V A;  8ICN A;  1TV9 A;  2V4Q A;  4I2E A;  4RPX A;  1XWL A;  5KFF A;  4JV1 A;  2XGQ A;  9ICB A;  8ICF A;  7ICO A;  4ECT A;  2RDJ A;  1D9D A;  1U4B A;  2R8K A;  4XRH A;  3EPI A;  1XSL A;  1ZQQ A;  4B9M A;  4IRD A;  4O3N A;  4KIT B;  2MAX A;  4PGX A;  4I2J A;  1ZQU A;  3KTQ A;  4QZG A;  4I2A A;  2DFL A;  1SL1 A;  5CHG A;  3BQ0 A;  3T5H A;  4J9M A;  4NLG A;  1ZQA A;  2PI5 A;  7ICG A;  9ICI A;  1ZQF A;  3ISC A;  4F8R A;  1ZQY A;  4UAY A;  1U45 A;  3RB4 A;  1JXL A;  4RQ5 A;  5KFH A;  3QEB Z;  5DQG A;  1NK8 A;  2BCU A;  4YMO A;  4PGY A;  4O9M A;  4ECX A;  7ICN A;  4ECZ A;  3ISB A;  2UVV A;  5KFR A;  1NKE A;  5DGB A;  4PPX A;  5KFQ A;  1XSP A;  4MFF A;  5EWE A;  1CEZ A;  4F50 A;  5J0U A;  4ED0 A;  1RYS A;  1L3V A;  5KFO A;  3UQ2 A;  5DG7 A;  2W8L A;  1ZQP A;  3OGU A;  3TFS A;  2ZUD A;  1NJZ A;  2BHN A;  1ZQR A;  3PW4 A;  3JPS A;  4JWM A;  4YFK A;  5EWF A;  3TAR A;  4QWA A;  2FMQ A;  3EWA A;  5J2C A;  2GWS A;  1QSL A;  4DSJ A;  5J2B A;  2PFQ A;  2DPI A;  5J29 A;  4F4W A;  3SYZ A;  4BXO B;  4DL2 A;  4P4M A;  2ASL A;  4F4K A;  5D46 A;  1U47 A;  4F4Z A;  5IIK A;  8ICL A;  4MEY A;  2MUT B;  3AU6 A;  1KEJ A;  1L3U A;  2BCQ A;  3PR4 A;  3JPO A;  7ICP A;  4YR3 A;  3QZ8 A;  1QSY A;  1SKS A;  4YQW A;  3K75 D;  3RJH A;  5DB7 A;  4DL7 A;  5DBC A;  3GV8 B;  2ZTC A;  9ICS A;  3RH5 A;  1SZP A;  5BOM A;  4DQR A;  3MR5 A;  3ZDE A;  2KZM A;  1ZQH A;  1A76 A;  4QWD A;  4DEZ A;  4DLG A;  4RU9 A;  3RAQ A;  3RR8 A;  4JV0 A;  5J0O A;  5L1L A;  1C7Y A;  5KG3 A;  4M9G A;  4UB2 A;  4KLT A;  2HHS A;  3KHH A;  1ZJM A;  3C1Z A;  1KFT A;  1D8Y A;  4Q43 A;  5HHI A;  4RT2 A;  4RQ2 A;  3C5G A;  4C8L A;  3RH4 A;  3ETL A;  1S97 A;  3PW7 A;  5L9X A;  1RXV A;  4QWB A;  4NLK A;  3GIL A;  1TAU A;  4DQI A;  3BQ2 A;  5KFX A;  4YD1 A;  3TI0 A;  4RNO A;  4KLL A;  4FO6 A;  5KFK A;  3M9O B;  4QZC A;  4UB4 A;  3Q8L A;  1X9S A;  5J0R A;  4DWI A;  3ZDD A;  4M9N A;  2AU0 A;  2RDI A;  1KFS A;  4UB3 A;  5J0X A;  5KFZ A;  4IQU A;  2W9C A;  1ZQK A;  3C2L A;  4RNN A;  5HP4 A;  2BCR A;  3GIJ A;  4UB1 A;  4DFP A;  4I2G A;  2VAN A;  3GIM A;  4ELT A;  3EZ5 A;  2A1J A;  3RB3 A;  7ICS A;  1ZQS A;  2HVH A;  1MC8 A;  5KFP A;  9ICK A;  5TZV A;  2XO7 A;  3HPO A;  1NOM A;  1NK9 A;  1TAQ A;  2BPF A;  3PR5 B;  3Q8R B;  4UAZ A;  2IBK A;  3ISD A;  1COO A;  4LVS A;  8ICP A;  1ZQL A;  5BPC A;  2F1I A;  8ICB A;  3GFK B;  8ICE A;  3MR2 A;  2NRT A;  4FS2 A;  5KTQ A;  9ICP A;  1K1Q A;  3H8J A;  2C22 A;  5KFG A;  4IRK A;  4O3Q A;  3PX0 A;  5J0Q A;  3T5J A;  3N4M B;  4MFC A;  3MR3 A;  1LV5 A;  2IHM A;  4MEX A;  3OHA A;  3HW8 A;  4F91 B;  5EOZ A;  4DQP A;  3ZDA A;  3Q8Q B;  4Q45 A;  1Y88 A;  3MFI A;  1BPB A;  3V7K A;  7ICV A;  1T8E A;  5DLG A;  1UA0 A;  2ALZ A;  4LZD A;  3QE9 Y;  4YXM A;  3Q8P B;  4HYK A;  1RZT A;  2KFZ A;  4F2R A;  2BGW A;  2BCV A;  4KLM A;  2C2R A;  2PFO A;  8ICQ A;  4JWN A;  2FMS A;  1BPY A;  4DFK A;  2AGQ A;  1ZQB A;  2VA2 A;  1BVS A;  4XA5 A;  5J0W A;  3N97 B;  1DOQ A;  1XSN A;  2ISO A;  8ICR A;  3PW0 A;  7ICQ A;  3LWM A;  5DG9 A;  3RJE A;  2MUT A;  4QZB A;  4EYI B;  4F5N A;  1HUO A;  2BPG A;  5DQH A;  5DBB A;  5KFN A;  1ARO P;  2XGP A;  4F5O A;  1Z3E B;  4UBC A;  2W9M A;  4Z6E A;  2FMP A;  3B0X A;  4IR1 A;  2F1J A;  2C2D A;  4KN4 A;  5IIL A;  2HHW A;  5J2H A;  1ZQT A;  2P66 A;  2XY7 A;  4ED3 A;  2IMW P;  4ELU A;  3PML A;  2VA3 A;  3ZD9 A;  4TUR A;  3OJS A;  1WCL A;  5KFB A;  4M9L A;  1NKC A;  3M9M B;  3PX6 A;  8ICM A;  7ICT A;  2BPC A;  4YD2 A;  4J9R A;  4I28 A;  3RAX A;  2W9A A;  4GXK A;  4Z6C A;  2HW3 A;  3T5L A;  4J9P A;  1BPD A;  3C5F A;  4B9U A;  4PHD A;  4J9N A;  1S0N A;  9ICW A;  1BPE A;  2VA8 A;  3MAB A;  5J2D A;  3UPQ A;  1KLN A;  5KT3 A;  4EBE A;  1ZQM A;  5DBA A;  4K4H A;  1X2I A;  4ECW A;  2HHV A;  2I1Q A;  2XY5 A;  1ZQI A;  9ICA A;  1JX4 A;  4TUS A;  4KLD A;  4IRC A;  2A1J B;  5KT7 A;  3E2E A;  2JEI A;  4NY8 A;  1Z00 B;  4YG2 A;  4PHA A;  4JUZ A;  3KHL A;  4G3I A;  3KHR A;  4BDP A;  1B22 A;  1S77 D;  2Q0Z X;  4KTQ A;  4F3O A;  3SI8 A;  3UXO A;  9ICF A;  8ICX A;  5KFA A;  4O3S A;  5KG2 A;  2W9B B;  4C8K A;  4BWM A;  5KFS A;  1N48 A;  1PZN A;  3G6V A;  4QZA A;  1NK7 A;  4IQW A;  9ICN A;  2AGO A;  4F4Y A;  4QZD A;  1ZQJ A;  4ECV A;  4YMN A;  3PY8 A;  9ICJ A;  9ICG A;  5KG0 A;  3FDS A;  1SKW A;  5JUM A;  7ICF A;  5KFI A;  3TAN A;  9ICL A;  1NJY A;  1SL0 A;  3C1Y A;  5F9L A;  3V7J A;  1S10 A;  4RQ6 A;  3RJI A;  2BCS A;  3MR6 A;  2JZB B;  1ZQN A;  4XQ8 A;  4RQ4 A;  3Q8S B;  3M8S A;  4RQ1 A;  4FBT A;  8ICI A;  3JPR A;  3RJJ A;  1ZQX A;  5J2J A;  8ICT A;  9ICQ A;  1S0O A;  1T4G A;  2ZJA A;  4Z6D A;  3OHB A;  4GC6 A;  3RB6 A;  3RR7 A;  4YMM A;  7ICI A;  1B43 A;  2F1H A;  3RBD A;  9ICC A;  3GQC A;  1BGX T;  1BPX A;  3T5K A;  4YR2 A;  2FLN A;  5KG7 A;  2NRW A;  4I29 A;  1JXE A;  5L1J A;  4RZR A;  4MF2 A;  1QLN A;  1ZQE A;  3SZ2 A;  2FPM A;  4RQ8 A;  1QTM A;  4YR0 A;  3KHG A;  3LWL A;  5L1I A;  3H40 A;  4RQ3 A;  1IM4 A;  8ICZ A;  4QZ9 A;  5L1K A;  2ZUC A;  4NM2 A;  4DLE A;  1EXN A;  4R8U A;  3QZ7 A;  5BOL A;  5J2I A;  3UQ0 A;  3NTU A;  1S0V A;  4MFA A;  1JIH A;  2ZTD A;  3GII A;  1NJW A;  4J9S A;  5D49 A;  4BWJ A;  4RPZ A;  1TKD A;  4GLX A;  4KMU A;  3MFH A;  4NLN A;  4DSI A;  4ECY A;  3RB0 A;  3G6Y A;  4ELV A;  1V9P A;  1TK8 A;  1MSW D;  3FYH A;  5IIO A;  5J2A A;  4BXO A;  3ZDC A;  4DSE A;  2H5X A;  4YXJ A;  3V6H A;  1CUK A;  5KFU A;  2V4R A;  4ECU A;  2V9W A;  5DKW A;  4DO9 A;  4ED8 A;  1NKB A;  5D4B A;  4R66 A;  2BDP A;  4RUA A;  2KZZ A;  1S76 D;  5HML A;  4QZH A;  4KLS A;  1D8L A;  2AQ0 A;  5J0S A;  1ZQO A;  3UXN A;  1UA1 A;  8ICK A;  5J2E A;  1JMS A;  2B21 A;  2BKE A;  3V6J A;  2NRX A;  1TK5 A;  4NXZ A;  3PO4 A;  2PXI A;  4PHP A;  1JN3 A;  4QWE A;  4R65 A;  8ICU A;  3RBE A;  4RQ7 A;  4QWC A;  1UT5 A;  1U9L A;  4EZ9 A;  4JV2 A;  2PI4 A;  5J0P A;  3PV8 A;  3GIK A;  5KG5 A;  4I2D A;  5KT2 A;  3RJG A;  4J9L A;  2PFP A;  2AQ4 A;  5KT5 A;  2HHT A;  8ICC A;  2XC9 A;  9ICO A;  5KG4 A;  5KFE A;  4DS5 A;  3JPT A;  2UVU A;  3B0Y A;  5J0T A;  4ZH4 A;  8ICS A;  2FPK A;  1A77 A;  1XS9 D;  8ICW A;  1WCN A;  4YVZ A;  4E0D A;  4DFM A;  2R8J A;  4EEY A;  3RJF A;  4DOA A;  3ZD8 A;  4M9H A;  3BQT A;  3BJY A;  2ASD A;  2ZJ8 A;  5DDY A;  2ZUB A;  5KFT A;  4TQS A;  5DB8 A;  3PX4 A;  5KFY A;  4DOC A;  2IA6 A;  1NK6 A;  4I2I A;  3JPP A;  4O3O A;  9ICT A;  3TQ1 A;  5J0Y A;  2IHN A;  2FPL A;  4KLJ A;  2BQR A;  4QW8 A;  4CCH A;  5KFC A;  1S9F A;  1L3S A;  4O0I A;  4DSK A;  4TUQ A;  4EBD A;  1NK0 A;  4PHE A;  4C8O A;  4J9O A;  3Q8M A;  2XCA A;  4ED2 A;  4RT3 A;  2AJQ A;  1RYR A;  5KT6 A;  4DL4 A;  4Z6F A;  4DFJ A;  3OJU A;  2Y1I A;  2BQ3 A;  4K4G A;  9ICU A;  4P4P A;  2BQU A;  4DQQ A;  5CR0 A;  1D9F A;  3PO5 A;  3HT3 A;  4YP3 A;  3TAP A;  5J2F A;  4DF8 A;  1X9W A;  4R8U B;  3MGH A;  3PW2 A;  4QZ8 A;  3PMN A;  2LYH A;  2P6U A;  5CP2 A;  4QZI A;  4R63 A;  7ICR A;  1NK5 A;  1SL2 A;  4RPY A;  1KSP A;  7ICE A;  2HHX A;  3RJK A;  3C21 A;  4IR9 A;  4M0A A;  4TQR A;  8ICY A;  4DL6 A;  7ICL A;  3V6K A;  2OWO A;  1NJX A;  3H4D A;  1X9M A;  5DG8 A;  1H38 A;  4KLU A;  4KLE A;  1KTQ A;  2FLL A;  3C23 A;  2HHQ A;  4P2H A;  1L5U A;  4RNM A;  7ICU A;  3GDX A;  3RRH A;  4KLG A;  3IHQ B;  8ICG A;  1L3T A;  1ZQG A;  3IM1 A;  5CJ7 A;  2XY6 A;  2FLP A;  2HVI A;  2KN7 A;  4ECQ A;  2P6R A;  1ZYQ A;  2R8H A;  1ZQD A;  3V7L A;  4FS1 A;  4DSL A;  8ICH A;  1K1S A;  4C8M A;  2M9N A;  1QSS A;  4LZG A;  3BDP A;  4J9K A;  3JPN A;  5KFJ A;  2J6S A;  1SKR A;  4IQV A;  5CWR A;  4F5Q A;  4EYH B;  4DQS A;  4F5R A;  3BQ1 A;  2J6U A;  4O5C A;  4DOB A;  2ZJ5 A;  5DDM A;  3UXP A;  1TK0 A;  2UVW A;  1ZQC A; 
#chains in the Genus database with same CATH topology
 4UB5 A;  4M2Y A;  4F2S A;  4ED7 A;  1U49 A;  1TFR A;  5DB6 A;  2CPR A;  3H4B A;  3ORY A;  1Z1B A;  4QZE A;  3H7I A;  5KFL A;  5KG1 A;  2JRZ A;  4F92 B;  2ZIV A;  1UT8 A;  4FBU A;  1ZD4 A;  2DQN B;  2QB0 A;  4I2F A;  4M9J A;  1ZJN A;  1VJ5 A;  2W43 A;  5E79 U;  2ZXH A;  5HNK A;  2AXT U;  3OSN A;  3L3F X;  8ICV A;  4IS7 A;  2KMD A;  1LB2 B;  3RTV A;  1FEZ A;  4J9Q A;  5KFV A;  1N56 A;  4O3R A;  2W7O A;  4Q8F A;  2WFA A;  2QKQ A;  4RQM A;  2JR5 A;  1HUZ A;  2ODG A;  4CF5 A;  2WTF A;  2KG5 A;  2Y1J A;  5DB9 A;  4MF8 A;  4AYB C;  4C80 A;  2KFN A;  2G5I B;  2ZIU B;  5J2K A;  4KLO A;  4KLF A;  4IQT A;  1L8L A;  4DS4 A;  5HMM A;  5L1M A;  1DGS A;  5IIN A;  2JEG A;  2PFN A;  4ED1 A;  4BGD A;  1RG6 A;  2EZY A;  4KLQ A;  1UQV A;  3MDA A;  4I27 A;  5DLF A;  9ICV A;  2NRV A;  3MDC A;  3KBB A;  5KFW A;  4M6W B;  2ISP A;  2HCF A;  2C28 A;  3ZDB A;  1RXW A;  5IIJ A;  4R64 A;  3H8W A;  1COK A;  1AQ6 A;  3PSI A;  3HP6 A;  4DSF A;  2R8G A;  4UAT A;  4B9V A;  3S6J A;  4RPX A;  4Y2V A;  7ICO A;  2XID A;  4HAI A;  3F2B A;  4XRH A;  2R8K A;  2HDO A;  3EPI A;  2M0N A;  1XSL A;  4IRD A;  2MAX A;  4PGX A;  3HJE A;  1HEK A;  4J9M A;  4NLG A;  2PI5 A;  2OH2 A;  3WK5 A;  3HRD D;  3KFU F;  4LJX A;  3RB4 A;  2YML A;  5KFH A;  1SXD A;  3F2C A;  4PGY A;  4ECX A;  4C4T A;  3ISB A;  2UVV A;  4PPX A;  5DGB A;  3MGV A;  4MFF A;  5EWE A;  4J03 A;  1RYS A;  1L3V A;  3UQ2 A;  2KK0 A;  5DG7 A;  2W8L A;  1ZQP A;  1KL9 A;  4ICA A;  3OGU A;  2ZUD A;  4JWM A;  3PW4 A;  3DDH A;  2KSO A;  2G07 A;  4BXO B;  5HR6 A;  3RFA A;  4F4K A;  4QIW C;  3UM9 A;  5IIK A;  1J2N A;  3AU6 A;  5G5H A;  3PR4 A;  3JPO A;  3QZ8 A;  1QSY A;  1SKS A;  2W11 A;  5DB7 A;  3GV8 B;  2ZTC A;  5AKJ A;  1D8B A;  4RU9 A;  2GOL A;  1DRG A;  3RR8 A;  3F5A A;  5AM2 A;  2YQE A;  3C1Z A;  4Q43 A;  4RQ2 A;  3RH4 A;  1J97 A;  3ETL A;  4QWB A;  4C7Y A;  3TI0 A;  2VJ4 A;  4RNO A;  1DXS A;  4FO6 A;  4IL6 U;  4QZC A;  4F71 A;  1PUZ A;  5H2F U;  2W9C A;  4RNN A;  1TAM A;  1JAL A;  3KZX A;  5KFP A;  4FE3 A;  3IG5 A;  1VDV A;  3Q8R B;  8ICP A;  4BJQ A;  2IBK A;  1ZQL A;  3GFK B;  8ICE A;  2NRT A;  1K1Q A;  3VC8 A;  4MFC A;  2IHM A;  3QUQ A;  3HW8 A;  4F91 B;  5EOZ A;  3R9K A;  2DKX A;  1T8E A;  1QH9 A;  1ZXI A;  2WHE A;  3QE9 Y;  2KFZ A;  2BCV A;  3MC1 A;  8ICQ A;  1RYU A;  4DFK A;  5AK6 A;  1BVS A;  5J0W A;  4FZM A;  8ICR A;  3AEV A;  2KKV A;  3L4P A;  4CDG A;  3AL0 B;  2G0A A;  3B9J A;  5DBB A;  4UBC A;  2LHT A;  2OYY A;  1YT3 A;  2W9M A;  3B0X A;  2C2D A;  4KN4 A;  3M6K A;  3NRW A;  2P66 A;  4KX3 A;  3PML A;  2VA3 A;  3OJS A;  1NKC A;  7ICT A;  3PX6 A;  8ICM A;  2BPC A;  4Z6C A;  3K1R B;  2F8L A;  4PHD A;  5KT3 A;  4K4H A;  1SB3 C;  3OPX A;  2HHV A;  2XY5 A;  1N5X A;  4IRC A;  2A1J B;  3E2E A;  5A0L A;  4PHA A;  1SGG A;  5ALW A;  4G3I A;  5AK5 A;  3AQF A;  2HOQ A;  4BDP A;  4KTQ A;  5AI0 A;  3SI8 A;  2FJ6 A;  3QX7 A;  9ICF A;  8ICX A;  5KG2 A;  3PST A;  1ZQJ A;  4F4Y A;  1VLB A;  2YY6 A;  5KFI A;  1NJY A;  5AKK A;  1S10 A;  2BCS A;  3MR6 A;  2KV2 A;  3PZP A;  1ZQX A;  8ICT A;  3RR7 A;  4Z6D A;  4GC6 A;  4Y2S A;  4YR2 A;  3N7P D;  4MF2 A;  1QLN A;  4JB3 A;  1QTM A;  5JTI A;  4YR0 A;  3QUT A;  3H40 A;  1IM4 A;  5L1K A;  2ZUC A;  5AKY A;  2VJ5 A;  4R8U A;  1NJW A;  4KX5 A;  2G08 A;  4J9S A;  4BWJ A;  3CNH A;  4GLX A;  4A8E A;  2MSN A;  1Q3U A;  3RB0 A;  3G6Y A;  1TK8 A;  5J2A A;  3A0B U;  4ED8 A;  3NVV A;  1S76 D;  5AKI A;  5HML A;  4QZH A;  4KLS A;  2AQ0 A;  8ICK A;  1FFU A;  1JRP A;  5J2E A;  2CN1 A;  4NXZ A;  3PO4 A;  3RBE A;  4RQ7 A;  2CRX A;  2MA1 A;  1KBU A;  4I2D A;  5KT2 A;  2KVC A;  2PFP A;  5AM5 A;  2XC9 A;  5KG4 A;  5KFE A;  1Z4O A;  2UVU A;  5J0T A;  8ICS A;  1A77 A;  8ICW A;  4YVZ A;  4E0D A;  3WKC A;  4AYB F;  5KFT A;  5DB8 A;  1P7D A;  2EAM A;  4I2I A;  3DEE A;  4O3O A;  2HBM A;  5GTI U;  2FPL A;  4CCH A;  1IV8 A;  5ALJ A;  1S9F A;  4DSK A;  1NK0 A;  4J9O A;  4ED2 A;  2B6G A;  5KT6 A;  4DL4 A;  3CW2 C;  2BQ3 A;  2KKP A;  2BQU A;  4YP3 A;  3TAP A;  5J2F A;  4Y2R A;  4DCC A;  4C7Z A;  5CP2 A;  4R63 A;  7ICE A;  5AM0 A;  2HHX A;  3C21 A;  2O6K A;  2W55 A;  4DL6 A;  5DG8 A;  4KLU A;  3E0F A;  3C23 A;  1N2X A;  5ALG A;  8ICG A;  1ZQG A;  3F2D A;  2HVI A;  4ACO A;  2KN7 A;  1ZYQ A;  2R8H A;  1ZQD A;  2KOB A;  4C8M A;  5KFJ A;  2Z7J A;  4Y2X A;  3BQ1 A;  2J6U A;  3UMC A;  5DDM A;  3BZK A;  3UXP A;  7ICK A;  4EZ6 A;  5KFM A;  2OEH A;  5III A;  1WG8 A;  1KFD A;  4CE6 A;  2KTQ A;  1WWU A;  3M9N B;  4B9N A;  4JK1 A;  4B9L A;  7ICJ A;  5AI9 A;  5C5J A;  9ICH A;  1L7M A;  3IG8 A;  2KZ3 A;  1N62 A;  3NS1 A;  4PH5 A;  3MGI A;  1IXR A;  8ICJ A;  2H3V A;  3TFR A;  3GV5 B;  2WF8 A;  2OHF A;  2JGA A;  4B9S A;  2PKE A;  2VIX A;  3HWT A;  4NLC A;  2JZB A;  3C29 A;  3T79 A;  3G6X A;  4DL5 A;  5CRX A;  1M6Y A;  3PNC A;  4OJL A;  1ZET A;  3AN1 A;  2ZG6 A;  4PZN A;  3T3F A;  9ICE A;  2FDR A;  2E8N A;  3QU9 A;  4O3P A;  2DPJ A;  4GC7 A;  5CA7 A;  4I2H A;  4QZF A;  3NVZ A;  9ICX A;  3AU2 A;  4BX9 C;  2YTU A;  2MU2 A;  4YCX A;  5ALT A;  3JPQ A;  3OSP A;  4K4I A;  1MQ2 A;  3KZI U;  2PMZ C;  2QAR B;  1FIQ A;  2W9B A;  3IRU A;  1MQ3 A;  3PVX A;  2KJ5 A;  3QEA Z;  4OJ6 A;  4ECR A;  5F9N A;  5IIM A;  4CF3 A;  2A3V A;  4UAW A;  4M47 A;  2ZTE A;  3LK9 A;  3EYZ A;  5KFF A;  8ICF A;  4US9 A;  1D9D A;  1OXJ A;  4OO1 J;  1RQL A;  4KIT B;  4I2J A;  1ZQU A;  2E1F A;  2DFL A;  3ALR A;  1ZQA A;  2YB4 A;  2ESE A;  9ICI A;  1U45 A;  3QEB Z;  5DQG A;  5ALH A;  5AM4 A;  4NJ8 A;  5KFR A;  2JMG A;  3O0F A;  5KFO A;  2NO5 A;  3KD3 A;  1FFV A;  3TFS A;  1NJZ A;  8ICU A;  2FMQ A;  4QWA A;  1L7P A;  2GWS A;  2YMQ A;  1SXE A;  4F4W A;  1U47 A;  4F4Z A;  8ICL A;  4MEY A;  2MUT B;  1JRO A;  2RP5 A;  3C28 A;  4YR3 A;  2N1R A;  4DL7 A;  9ICS A;  2H3Q A;  5DBC A;  3RH5 A;  1SZP A;  1DK2 A;  4JV0 A;  5ALL A;  4M9G A;  2D6F C;  2HHS A;  3KHH A;  1D8Y A;  2W54 A;  3C5G A;  4C8L A;  2XVT A;  4NLK A;  5KFX A;  5KFK A;  3M9O B;  4UB4 A;  3Q8L A;  1X9S A;  3ZDD A;  1OUQ A;  5J0X A;  1X6J A;  3C2L A;  5HP4 A;  2VAN A;  2G09 A;  3GIM A;  1ZQS A;  5J8Y C;  5ALO A;  4IC9 A;  2BPF A;  4LVS A;  2IOF A;  3ISD A;  5BPC A;  8ICB A;  4FS2 A;  2KIC A;  4IRK A;  4O3Q A;  3N4M B;  1LV5 A;  2R18 A;  5ALD A;  5AM1 A;  3ZDA A;  1BNP A;  4Q45 A;  1Y88 A;  3V7K A;  4C4S A;  2ZIV B;  4Y2J A;  1X40 A;  3QXG A;  3Q8P B;  4F2R A;  1ECW A;  2QB0 B;  1KW4 A;  4JWN A;  2FMS A;  1BPY A;  1ZQB A;  2VA2 A;  2ISO A;  1DOQ A;  1XSN A;  3RJE A;  2F77 X;  1SV0 C;  3CP8 A;  1T94 A;  1NI3 A;  4USA A;  5J2H A;  2XY7 A;  2E1E A;  2LYB A;  3BS5 A;  4QIW F;  4M9L A;  4EEK A;  5ALI A;  2IOF K;  3FC4 A;  4I28 A;  3RAX A;  4GXK A;  2HOF A;  2HW3 A;  3ZI4 A;  4J9P A;  4B9U A;  4J9N A;  1BPE A;  5J2D A;  1KLN A;  4EBE A;  4NV0 A;  5DBA A;  1X2I A;  2I6X A;  9ICA A;  1X66 A;  2JXJ A;  4TUS A;  5KT7 A;  3NRZ A;  1NNL A;  2JEI A;  1Z00 B;  2H3Z A;  2WAQ F;  3KHR A;  1ZOL A;  1B22 A;  1DK3 A;  5AI4 A;  1F0M A;  2BDU A;  4O3S A;  5GTH U;  2A19 A;  4C8K A;  4IQW A;  1N48 A;  1NK7 A;  2OCE A;  9ICN A;  9ICL A;  2G06 A;  4RQ6 A;  4ZOH C;  4UAV A;  2WB1 C;  4XQ8 A;  4RQ4 A;  9ICQ A;  1S0O A;  1T4G A;  2ZJA A;  7ICI A;  3F53 A;  3NAS A;  9ICC A;  3KOO A;  1BGX T;  2FLN A;  4I29 A;  1ZQE A;  2FPM A;  2JV3 A;  5ALN A;  3K1Z A;  5C0Y A;  3EUB 2;  2KP7 A;  4PJ0 U;  2DWQ A;  2K8B B;  4QZ9 A;  4NM2 A;  1EXN A;  5BOL A;  3NTU A;  3GII A;  3D2N A;  5D49 A;  5KL1 B;  1TKD A;  3QYP A;  5AM3 A;  4NLN A;  2NYV A;  2DBY A;  1MSW D;  3FYH A;  4BXO A;  4KMO B;  1V85 A;  1XO0 A;  2KE7 A;  4DSE A;  2H5X A;  3V6H A;  1CUK A;  2WF6 A;  1NKB A;  4P0P B;  5J0S A;  1UA1 A;  2BKE A;  3TAC B;  4AP9 A;  4UB6 U;  4Y2Y A;  4PHP A;  3IN5 A;  1UCV A;  4R65 A;  4QWC A;  4EZ9 A;  4JV2 A;  5KG5 A;  3U26 A;  2AQ4 A;  2HHT A;  8ICC A;  3N7R C;  3WU2 U;  4ZH4 A;  3TAD C;  5AKH A;  2WAQ C;  4DOA A;  2ASD A;  5ALX A;  2MRL A;  5KFY A;  4DOC A;  2ZIW A;  1O08 A;  3ONN A;  3JPP A;  9ICT A;  3E58 A;  2IOH A;  3TKA A;  5KFC A;  4Y2Q A;  1L3S A;  4G9B A;  5AK3 A;  3WKD A;  4C8O A;  4CNQ A;  2K60 A;  4DFJ A;  2LPE A;  2Y1I A;  2K8C B;  5CR0 A;  3PO5 A;  4DF8 A;  1X9W A;  4QZ8 A;  7ICR A;  1NK5 A;  1SL2 A;  4RPY A;  1A6S A;  1K5O A;  3RJK A;  4M0A A;  8ICY A;  3KKA A;  5ALK A;  1X9M A;  4KLE A;  1WWV A;  2PMZ F;  1L5U A;  4RNM A;  3GDX A;  3IHQ B;  2XY6 A;  2LM1 A;  3V7L A;  1K1S A;  4LZG A;  1DGJ A;  1ZQ1 C;  3QUC A;  5CWR A;  1FO4 A;  4PL2 A;  3H8M A;  5K4L A;  3FAH A;  4O5C A;  4DOB A;  1TK0 A;  2UVW A;  2E8P A;  4KN7 A;  4O5E A;  3THV A;  4M6W A;  4DF4 A;  3WK4 A;  4RUC A;  1F44 A;  5J2G A;  3H0L B;  1LKY A;  3D6J A;  4X5V A;  4DL3 A;  2W7P A;  4Q8E A;  5DGA A;  8ICO A;  5DQI A;  3M1Y A;  4GFJ A;  5KG6 A;  2I9G A;  1ZQZ A;  4P0Q A;  2ATL A;  1SV0 A;  1X9X A;  3H0M B;  5HHH A;  5AIC A;  3BZC A;  5EWG A;  4U6P A;  1KDH A;  1KRP A;  2YMP A;  1U48 A;  2AHO B;  3H8S A;  5KL8 B;  2W8K A;  5KT4 A;  4RQ0 A;  2NRZ A;  2WF9 A;  3UMG A;  2UVR A;  4EBC A;  5ALQ A;  4P4O A;  2JEJ A;  3GV7 B;  4ED6 A;  1X42 A;  1HJP A;  3RH6 A;  3C2K A;  1QCK A;  1XU4 A;  4KLH A;  5ALF A;  4UAR A;  3KKA C;  2HMX A;  2C2E A;  3RRG A;  7ICH A;  3NGD A;  2OXO A;  4QW9 A;  5ALM A;  3V72 A;  4XUS A;  4GXJ A;  2BR0 A;  4C0Z A;  1XO1 A;  1KKX A;  1SZH A;  2W9C B;  3K4G A;  1TV9 A;  4I2E A;  4EX7 A;  2XGQ A;  1Z1V A;  9ICB A;  4ECT A;  5KAI U;  2AH5 A;  3ETR A;  1Q46 A;  2FI1 A;  1U4B A;  1PK1 B;  3AQE A;  4O3N A;  1CRX A;  1SL1 A;  5CHG A;  3T5H A;  1B0X A;  1ZQF A;  4UAY A;  3N28 A;  1JXL A;  3D2S A;  4RQ5 A;  1NK8 A;  5ALS A;  4CF4 A;  2EAP A;  4ECZ A;  4F50 A;  5J0U A;  4ED0 A;  2KJ8 A;  4NL9 C;  5G5G A;  1V38 A;  2BHN A;  1ZQR A;  2KHV A;  3TAR A;  5J2C A;  2EZZ A;  4RQN A;  1QSL A;  5J2B A;  4JMU A;  3SYZ A;  3H0R B;  5D46 A;  2EAO A;  2BCQ A;  4Y2U A;  3RJH A;  1CI4 A;  3DV9 A;  2ZIX A;  3ZDE A;  5B5E U;  1A76 A;  4DEZ A;  5AK4 A;  1L6N A;  5J0O A;  5KG3 A;  4UB2 A;  5HHI A;  3PW7 A;  5L9X A;  4DQI A;  4YD1 A;  1F5S A;  5J0R A;  4DWI A;  2AU0 A;  1KFS A;  5KFZ A;  1ZQK A;  2LKY A;  2BCR A;  4I2G A;  3GIJ A;  4DFP A;  4CGZ A;  4F72 A;  4ELT A;  2K4P A;  2A1J A;  3RB3 A;  7ICS A;  4UB8 U;  1MC8 A;  9ICK A;  3HPO A;  1NOM A;  1TAQ A;  2EAN A;  4UAZ A;  1COO A;  2F1I A;  5EE3 A;  2RLT A;  2K89 A;  9ICP A;  1S5L U;  2C22 A;  5KAF U;  3PX0 A;  4PZO A;  3MR3 A;  4MEX A;  3OHA A;  5AKZ A;  4DQP A;  1RDF A;  3Q8Q B;  1UA0 A;  2ALZ A;  4LZD A;  4HYK A;  1QQ6 A;  2BGW A;  2C2R A;  2PFO A;  2KSO B;  2AGQ A;  1KQQ A;  4XA5 A;  1N5W A;  1PK3 A;  2YN4 A;  3SR6 A;  3LWM A;  4EYI B;  4QZB A;  4F5N A;  3QU7 A;  5DQH A;  5KFN A;  1ARO P;  2XGP A;  2F2A B;  1Z3E B;  3QU5 A;  2F1J A;  4NL9 A;  5IIL A;  4DFD A;  4ED3 A;  3ZD9 A;  2QLT A;  3M9M B;  4YD2 A;  4J9R A;  2JHD A;  1URJ A;  1S0N A;  3UPQ A;  4OJP A;  1ZQM A;  1YZ7 A;  3I28 A;  1IIP A;  1JX4 A;  1S8O A;  4NY8 A;  4YG2 A;  4F3O A;  3UXO A;  2QAR A;  1RM6 C;  2W9B B;  3G6V A;  4QZA A;  9ICJ A;  4QZD A;  4ECV A;  3PY8 A;  3ICX A;  3FM9 A;  3LVW A;  9ICG A;  3FDS A;  1SKW A;  7ICF A;  3HKZ F;  3TAN A;  2HOI A;  3C1Y A;  5F9L A;  1ZQN A;  2RQ5 A;  3Q8S B;  3M8S A;  4FBT A;  8ICI A;  3AM9 A;  4YMM A;  1B43 A;  2F1H A;  3CRX A;  2ZXI A;  2NRW A;  1JXE A;  4NLB A;  3SZ2 A;  2L5Y A;  2ZIU A;  3KHG A;  3NVY A;  5L1I A;  4GIB A;  2RRD A;  4RQ3 A;  8ICZ A;  3RF9 A;  4DLE A;  4C4R A;  5J2I A;  4MFA A;  1UHU A;  1JIH A;  2ZTD A;  3GZF A;  3SAF A;  5ALP A;  4DSI A;  5ALZ A;  4ELV A;  1V9P A;  4Y2T A;  2A1A A;  4YXJ A;  3SEI A;  2V4R A;  4ECU A;  3QU2 A;  4DO9 A;  1YZ6 A;  3IV6 A;  4R66 A;  2BDP A;  4RUA A;  2KZZ A;  1D8L A;  1SIJ A;  3HIL A;  1NZP A;  2I5H A;  3V6J A;  2NRX A;  3L5K A;  1TK5 A;  5AI6 A;  2WF7 A;  1O03 A;  2PXI A;  1ZD5 A;  2EZX A;  4QWE A;  1U9L A;  2PI4 A;  5J0P A;  3PV8 A;  1SWV A;  2KIV A;  3RJG A;  4J9L A;  2Y0S F;  3WK8 A;  1Q8K A;  5KT5 A;  4OJO A;  1RQN A;  4QNL A;  4DS5 A;  5ALE A;  2FPK A;  1WCN A;  2JH7 A;  2R8J A;  4EEY A;  4M9H A;  1J2M A;  3LYS A;  3BJY A;  4TQS A;  5AKX A;  1SV4 A;  1NK6 A;  2NO4 A;  2W3S A;  4FZN A;  5J0Y A;  2IHN A;  4KLJ A;  2BQR A;  2KD1 A;  1QQ5 A;  3N7S C;  1WUD A;  2F3N A;  4EBD A;  4PHE A;  3A0H U;  1RYR A;  3WKA A;  9ICU A;  4DQQ A;  3HT3 A;  2F44 A;  4R8U B;  3MGH A;  2YMM A;  4QZI A;  1BNO A;  2GLE A;  5AI5 A;  1L8O A;  5ALR A;  2Y0S C;  7ICL A;  3V6K A;  3H4D A;  5HR7 A;  3SAG A;  3HKZ C;  4FZL A;  2FLL A;  2HHQ A;  4UAS A;  3SMV A;  4EEL A;  7ICU A;  3RRH A;  4KLG A;  1L3T A;  5CJ7 A;  4ECQ A;  2P6R A;  5AI8 A;  4FS1 A;  2YB1 A;  1QSS A;  4BUG A;  2OM6 A;  5ALY A;  3JPN A;  1SKR A;  4IQV A;  2CXY A;  2ZJ5 A;  1ZQC A;  4FFD A;  2LI6 A;  3SD7 A;  2J6T A;  4PGQ A;  2EDU A;  8ICA A;  2DKZ A;  1GO3 F;  1B4F A;  2HBJ A;  4UAU A;  3LDA A;  2E8M A;  3EW9 A;  1Z00 A;  1ZD2 P;  4B6J A;  4UW9 A;  4ECS A;  2HHU A;  5ALV A;  1LVH A;  1NK4 A;  4M04 A;  1RPL A;  1N63 A;  4WJ3 B;  3Q8K A;  4I2C A;  1PVQ A;  3SV3 A;  3ED5 A;  3PSF A;  1JUD A;  1TVA A;  3MBY A;  1ZQW A;  3NVW A;  4GXI A;  1Z19 A;  3QNM A;  3HX0 A;  1Q3V A;  4C8N A;  1XC9 A;  2LM4 A;  3SV4 A;  2R8I A;  5T14 A;  4KLI A;  1QQ7 A;  4EEN A;  2FE9 A;  2Q4T A;  4Q44 A;  4F5P A;  3PW5 A;  1S0M A;  3SQI A;  4O5K A;  2JEF A;  4TUP A;  9ICM A;  1ZQV A;  2ASJ A;  4UBB A;  3BQ7 A;  2BZF A;  1C20 A;  4UQG A;  4F4X A;  7ICM A;  4OJ5 A;  4F93 B;  2K4H A;  1ED1 A;  2DUY A;  2XCP A;  2AGP A;  4I2B A;  9ICR A;  1T7P A;  4B9T A;  3C2M A;  2XIC A;  1JI7 A;  1L7N A;  5J8Y A;  1L7O A;  3EPG A;  5CB1 A;  3M8R A;  4YN4 A;  5JRT A;  4NM1 A;  3TAQ A;  1BPZ A;  3AUO A;  1PVP A;  1T3N A;  5KFD A;  4NLZ A;  3IDW A;  8ICN A;  2V4Q A;  1XWL A;  4JV1 A;  3IP4 B;  2RDJ A;  2HI0 A;  1OW5 A;  1HIW A;  1ZQQ A;  4B9M A;  4I2A A;  3KTQ A;  4QZG A;  2LYA A;  3BQ0 A;  2K4I A;  2NV3 A;  1X6I A;  7ICG A;  3ISC A;  4F8R A;  1ZQY A;  2E3T A;  4O9M A;  2BCU A;  4YMO A;  7ICN A;  1NKE A;  1CEZ A;  5KFQ A;  1XSP A;  2H3I A;  2ZIW B;  2D3D A;  3JPS A;  4YFK A;  3TAD A;  5EWF A;  4QJF B;  3EWA A;  4DSJ A;  2HSZ A;  2PFQ A;  2DPI A;  5J29 A;  4DL2 A;  4P4M A;  4US8 A;  2ASL A;  1L3U A;  1KEJ A;  7ICP A;  5JU5 A;  4YQW A;  3K75 D;  3I76 A;  5KNI A;  2KNJ A;  5BOM A;  4DQR A;  3MR5 A;  2KZM A;  1ZQH A;  4QWD A;  4DLG A;  3RAQ A;  5L1L A;  1C7Y A;  1KN5 A;  4KLT A;  1ZJM A;  1KFT A;  4RT2 A;  1S97 A;  1RXV A;  1TAU A;  3GIL A;  3BQ2 A;  5CEH A;  4KLL A;  4M9N A;  2RDI A;  4UB3 A;  2ES6 A;  1TE2 A;  4IQU A;  2F8K A;  4UB1 A;  2K4E A;  3EZ5 A;  2GH1 A;  2HVH A;  5AKL A;  2JH1 A;  5TZV A;  2XO7 A;  5ALU A;  1NK9 A;  5B66 U;  2DL0 A;  3PR5 B;  3WK7 A;  4O3M A;  3PSP A;  3MR2 A;  3GU3 A;  5KTQ A;  2B0C A;  3H8J A;  5AIA A;  3J81 j;  5KFG A;  5EE9 A;  1ZRN A;  2E5S A;  5J0Q A;  3T5J A;  2D8C A;  3MFI A;  1BPB A;  7ICV A;  1IG6 A;  5DLG A;  5EE0 A;  5FP0 A;  4YXM A;  1RZT A;  4P0Q B;  4KLM A;  2H3F A;  5TIS U;  3BS7 A;  2VKQ A;  3N97 B;  3D2Q A;  2RHF A;  3WKE A;  3PW0 A;  7ICQ A;  5DG9 A;  2MUT A;  1HUO A;  2BPG A;  2KHQ A;  2LBO A;  4F5O A;  4Z6E A;  2FMP A;  2KIW A;  4IR1 A;  1UPH A;  2HHW A;  1ZQT A;  2IMW P;  4ELU A;  4TUR A;  1WCL A;  5KFB A;  2W9A A;  3NUQ A;  3T5L A;  1SWW A;  1BPD A;  2F76 X;  3C5F A;  2YX8 A;  1WYG A;  9ICW A;  2VA8 A;  3MAB A;  1N60 A;  1XNS A;  4ECW A;  2I1Q A;  1ZQI A;  3LVV A;  2XI9 A;  1PVR A;  4KLD A;  4JUZ A;  3KHL A;  1ZD3 A;  1S77 D;  2Q0Z X;  2W3R A;  3VCB A;  2KVS A;  3AMZ A;  2EH9 A;  5KFA A;  4BWM A;  5KFS A;  1PZN A;  4Y2P A;  2AGO A;  2G5H B;  4YMN A;  4PL1 A;  5KG0 A;  5JUM A;  3CYM A;  1SL0 A;  3V7J A;  3RJI A;  2JZB B;  4RQ1 A;  2E8O A;  3JPR A;  3RJJ A;  5J2J A;  3RB6 A;  2LMR A;  2WF5 A;  3OHB A;  3RBD A;  2HBK A;  3GQC A;  1BPX A;  3T5K A;  2KEY A;  4CRX A;  1PK1 A;  5KG7 A;  5L1J A;  4RZR A;  4NWI A;  4RQ8 A;  5AKG A;  4OD0 A;  1V97 A;  2K8A A;  3LWL A;  2P35 A;  3QZ7 A;  3UQ0 A;  1S0V A;  4EX6 A;  2DGZ A;  4RPZ A;  3BS5 B;  4KMU A;  3MFH A;  4ECY A;  1NZB A;  1N61 A;  3WK9 A;  1Z4N A;  5IIO A;  1ZRM A;  3ZDC A;  5KFU A;  2W04 A;  2V9W A;  5DKW A;  5D4B A;  3SEN A;  3SAH A;  1ZQO A;  3UXN A;  1JMS A;  2B21 A;  2ZIX B;  1MA7 A;  2Y9U A;  1JN3 A;  2WB1 F;  2Y9T A;  1UT5 A;  3QUB A;  3GIK A;  3F5E A;  4U7C A;  2EQY A;  9ICO A;  3OTQ A;  3WKB A;  3JPT A;  1LKY B;  3B0Y A;  1XS9 D;  3I1Y A;  4DFM A;  3RJF A;  3ZD8 A;  3BQT A;  2ZJ8 A;  5DDY A;  2ZUB A;  3M6Z A;  3PX4 A;  2IA6 A;  3M7D A;  2HBL A;  3TQ1 A;  4QW8 A;  4O0I A;  2GO7 A;  4TUQ A;  3Q8M A;  4OCZ A;  2XCA A;  4RT3 A;  2AJQ A;  5AHX A;  5AIB A;  4Z6F A;  3OJU A;  4K4G A;  4P4P A;  1D9F A;  3PW2 A;  3QU4 A;  1T3Q A;  3PMN A;  2LYH A;  2P6U A;  1A0P A;  1KSP A;  3WK6 A;  3UMB A;  4IR9 A;  2QB1 A;  5F3X B;  4TQR A;  2OWO A;  1NJX A;  1H38 A;  5EE1 A;  1KTQ A;  2DF4 B;  4P2H A;  1MN8 A;  4P0P A;  3IM1 A;  2FLP A;  2W03 A;  4DSL A;  8ICH A;  2M9N A;  2KJ9 A;  3BDP A;  4J9K A;  4MHV A;  5AKE A;  2J6S A;  4F5Q A;  4EYH B;  4DQS A;  4F5R A; 
#chains in the Genus database with same CATH homology
 4UB5 A;  7ICK A;  4EZ6 A;  4KN7 A;  4O5E A;  5KFM A;  3THV A;  4M6W A;  5III A;  4DF4 A;  4M2Y A;  4F2S A;  4ED7 A;  2J6T A;  1KFD A;  4PGQ A;  4RUC A;  5J2G A;  1U49 A;  1TFR A;  5DB6 A;  2KTQ A;  8ICA A;  3M9N B;  3H4B A;  3ORY A;  4DL3 A;  4X5V A;  4Q8E A;  5DGA A;  4B9N A;  8ICO A;  4JK1 A;  3LDA A;  4QZE A;  4B9L A;  3H7I A;  5KFL A;  5KG1 A;  5C5J A;  7ICJ A;  9ICH A;  4F92 B;  3EW9 A;  1UT8 A;  2KZ3 A;  5DQI A;  1Z00 A;  4FBU A;  5KG6 A;  4ECS A;  2I9G A;  2HHU A;  1ZQZ A;  2ATL A;  1NK4 A;  4PH5 A;  4I2F A;  3MGI A;  4M9J A;  1ZJN A;  1IXR A;  8ICJ A;  4M04 A;  1RPL A;  3TFR A;  3Q8K A;  4I2C A;  3GV5 B;  5HNK A;  3OSN A;  3SV3 A;  1TVA A;  8ICV A;  5HHH A;  4B9S A;  1LB2 B;  5EWG A;  3MBY A;  3RTV A;  1ZQW A;  4GXI A;  1KDH A;  4J9Q A;  5KFV A;  3HWT A;  3HX0 A;  1N56 A;  4O3R A;  2JZB A;  3G6X A;  4C8N A;  4DL5 A;  1KRP A;  1XC9 A;  3SV4 A;  3PNC A;  4Q8F A;  1ZET A;  1U48 A;  2R8I A;  1HUZ A;  3H8S A;  4KLI A;  3T3F A;  9ICE A;  2W8K A;  5KT4 A;  4RQ0 A;  2WTF A;  2NRZ A;  4Q44 A;  2Y1J A;  4O3P A;  4F5P A;  5DB9 A;  3PW5 A;  4MF8 A;  1S0M A;  2DPJ A;  4O5K A;  2JEF A;  2UVR A;  4EBC A;  4TUP A;  4GC7 A;  2KFN A;  4P4O A;  9ICM A;  1ZQV A;  5J2K A;  5CA7 A;  3GV7 B;  2ASJ A;  4UBB A;  4QZF A;  2JEJ A;  4I2H A;  4KLF A;  4ED6 A;  4KLO A;  4UQG A;  4IQT A;  4F4X A;  7ICM A;  1HJP A;  3RH6 A;  4DS4 A;  9ICX A;  3AU2 A;  5HMM A;  4F93 B;  3C2K A;  1XU4 A;  2XCP A;  1DGS A;  2AGP A;  4I2B A;  5IIN A;  2JEG A;  9ICR A;  2PFN A;  1T7P A;  4KLH A;  4ED1 A;  4YCX A;  4BGD A;  4B9T A;  3C2M A;  3JPQ A;  3OSP A;  4K4I A;  4KLQ A;  3MDA A;  4I27 A;  5DLF A;  1MQ2 A;  9ICV A;  2NRV A;  3MDC A;  3EPG A;  5CB1 A;  2C2E A;  3RRG A;  3NGD A;  2W9B A;  7ICH A;  3M8R A;  4YN4 A;  1MQ3 A;  3PVX A;  5KFW A;  3QEA Z;  4M6W B;  2ISP A;  3TAQ A;  1BPZ A;  4QW9 A;  4NM1 A;  2C28 A;  3ZDB A;  4ECR A;  5F9N A;  1RXW A;  5IIJ A;  3V72 A;  4R64 A;  5IIM A;  3H8W A;  4XUS A;  3AUO A;  4GXJ A;  2BR0 A;  1T3N A;  5KFD A;  1XO1 A;  4UAW A;  3HP6 A;  4M47 A;  4DSF A;  2ZTE A;  2R8G A;  4NLZ A;  2W9C B;  3LK9 A;  3K4G A;  3EYZ A;  4B9V A;  8ICN A;  1TV9 A;  2V4Q A;  4I2E A;  4RPX A;  1XWL A;  5KFF A;  4JV1 A;  2XGQ A;  9ICB A;  8ICF A;  7ICO A;  4ECT A;  2RDJ A;  1D9D A;  1U4B A;  2R8K A;  4XRH A;  3EPI A;  1XSL A;  1ZQQ A;  4B9M A;  4IRD A;  4O3N A;  4KIT B;  2MAX A;  4PGX A;  4I2J A;  1ZQU A;  3KTQ A;  4QZG A;  4I2A A;  2DFL A;  1SL1 A;  5CHG A;  3BQ0 A;  3T5H A;  4J9M A;  4NLG A;  1ZQA A;  2PI5 A;  7ICG A;  9ICI A;  1ZQF A;  3ISC A;  4F8R A;  1ZQY A;  4UAY A;  1U45 A;  3RB4 A;  1JXL A;  4RQ5 A;  5KFH A;  3QEB Z;  5DQG A;  1NK8 A;  2BCU A;  4YMO A;  4PGY A;  4O9M A;  4ECX A;  7ICN A;  4ECZ A;  3ISB A;  2UVV A;  5KFR A;  1NKE A;  5DGB A;  4PPX A;  5KFQ A;  1XSP A;  4MFF A;  5EWE A;  1CEZ A;  4F50 A;  5J0U A;  4ED0 A;  1RYS A;  1L3V A;  5KFO A;  3UQ2 A;  5DG7 A;  2W8L A;  1ZQP A;  3OGU A;  3TFS A;  2ZUD A;  1NJZ A;  2BHN A;  1ZQR A;  3PW4 A;  3JPS A;  4JWM A;  4YFK A;  5EWF A;  3TAR A;  4QWA A;  2FMQ A;  3EWA A;  5J2C A;  2GWS A;  1QSL A;  4DSJ A;  5J2B A;  2PFQ A;  2DPI A;  5J29 A;  4F4W A;  3SYZ A;  4BXO B;  4DL2 A;  4P4M A;  2ASL A;  4F4K A;  5D46 A;  1U47 A;  4F4Z A;  5IIK A;  8ICL A;  4MEY A;  2MUT B;  3AU6 A;  1KEJ A;  1L3U A;  2BCQ A;  3PR4 A;  3JPO A;  7ICP A;  4YR3 A;  3QZ8 A;  1QSY A;  1SKS A;  4YQW A;  3K75 D;  3RJH A;  5DB7 A;  4DL7 A;  5DBC A;  3GV8 B;  2ZTC A;  9ICS A;  3RH5 A;  1SZP A;  5BOM A;  4DQR A;  3MR5 A;  3ZDE A;  2KZM A;  1ZQH A;  1A76 A;  4QWD A;  4DEZ A;  4DLG A;  4RU9 A;  3RAQ A;  3RR8 A;  4JV0 A;  5J0O A;  5L1L A;  1C7Y A;  5KG3 A;  4M9G A;  4UB2 A;  4KLT A;  2HHS A;  3KHH A;  1ZJM A;  3C1Z A;  1KFT A;  1D8Y A;  4Q43 A;  5HHI A;  4RT2 A;  4RQ2 A;  3C5G A;  4C8L A;  3RH4 A;  3ETL A;  1S97 A;  3PW7 A;  5L9X A;  1RXV A;  4QWB A;  4NLK A;  3GIL A;  1TAU A;  4DQI A;  3BQ2 A;  5KFX A;  4YD1 A;  3TI0 A;  4RNO A;  4KLL A;  4FO6 A;  5KFK A;  3M9O B;  4QZC A;  4UB4 A;  3Q8L A;  1X9S A;  5J0R A;  4DWI A;  3ZDD A;  4M9N A;  2AU0 A;  2RDI A;  1KFS A;  4UB3 A;  5J0X A;  5KFZ A;  4IQU A;  2W9C A;  1ZQK A;  3C2L A;  4RNN A;  5HP4 A;  2BCR A;  3GIJ A;  4UB1 A;  4DFP A;  4I2G A;  2VAN A;  3GIM A;  4ELT A;  3EZ5 A;  2A1J A;  3RB3 A;  7ICS A;  1ZQS A;  2HVH A;  1MC8 A;  5KFP A;  9ICK A;  5TZV A;  2XO7 A;  3HPO A;  1NOM A;  1NK9 A;  1TAQ A;  2BPF A;  3PR5 B;  3Q8R B;  4UAZ A;  2IBK A;  3ISD A;  1COO A;  4LVS A;  8ICP A;  1ZQL A;  5BPC A;  2F1I A;  8ICB A;  3GFK B;  8ICE A;  3MR2 A;  2NRT A;  4FS2 A;  5KTQ A;  9ICP A;  1K1Q A;  3H8J A;  2C22 A;  5KFG A;  4IRK A;  4O3Q A;  3PX0 A;  5J0Q A;  3T5J A;  3N4M B;  4MFC A;  3MR3 A;  1LV5 A;  2IHM A;  4MEX A;  3OHA A;  3HW8 A;  4F91 B;  5EOZ A;  4DQP A;  3ZDA A;  3Q8Q B;  4Q45 A;  1Y88 A;  3MFI A;  1BPB A;  3V7K A;  7ICV A;  1T8E A;  5DLG A;  1UA0 A;  2ALZ A;  4LZD A;  3QE9 Y;  4YXM A;  3Q8P B;  4HYK A;  1RZT A;  2KFZ A;  4F2R A;  2BGW A;  2BCV A;  4KLM A;  2C2R A;  2PFO A;  8ICQ A;  4JWN A;  2FMS A;  1BPY A;  4DFK A;  2AGQ A;  1ZQB A;  2VA2 A;  1BVS A;  4XA5 A;  5J0W A;  3N97 B;  1DOQ A;  1XSN A;  2ISO A;  8ICR A;  3PW0 A;  7ICQ A;  3LWM A;  5DG9 A;  3RJE A;  2MUT A;  4QZB A;  4EYI B;  4F5N A;  1HUO A;  2BPG A;  5DQH A;  5DBB A;  5KFN A;  1ARO P;  2XGP A;  4F5O A;  1Z3E B;  4UBC A;  2W9M A;  4Z6E A;  2FMP A;  3B0X A;  4IR1 A;  2F1J A;  2C2D A;  4KN4 A;  5IIL A;  2HHW A;  5J2H A;  1ZQT A;  2P66 A;  2XY7 A;  4ED3 A;  2IMW P;  4ELU A;  3PML A;  2VA3 A;  3ZD9 A;  4TUR A;  3OJS A;  1WCL A;  5KFB A;  4M9L A;  1NKC A;  3M9M B;  3PX6 A;  8ICM A;  7ICT A;  2BPC A;  4YD2 A;  4J9R A;  4I28 A;  3RAX A;  2W9A A;  4GXK A;  4Z6C A;  2HW3 A;  3T5L A;  4J9P A;  1BPD A;  3C5F A;  4B9U A;  4PHD A;  4J9N A;  1S0N A;  9ICW A;  1BPE A;  2VA8 A;  3MAB A;  5J2D A;  3UPQ A;  1KLN A;  5KT3 A;  4EBE A;  1ZQM A;  5DBA A;  4K4H A;  1X2I A;  4ECW A;  2HHV A;  2I1Q A;  2XY5 A;  1ZQI A;  9ICA A;  1JX4 A;  4TUS A;  4KLD A;  4IRC A;  2A1J B;  5KT7 A;  3E2E A;  2JEI A;  4NY8 A;  1Z00 B;  4YG2 A;  4PHA A;  4JUZ A;  3KHL A;  4G3I A;  3KHR A;  4BDP A;  1B22 A;  1S77 D;  2Q0Z X;  4KTQ A;  4F3O A;  3SI8 A;  3UXO A;  9ICF A;  8ICX A;  5KFA A;  4O3S A;  5KG2 A;  2W9B B;  4C8K A;  4BWM A;  5KFS A;  1N48 A;  1PZN A;  3G6V A;  4QZA A;  1NK7 A;  4IQW A;  9ICN A;  2AGO A;  4F4Y A;  4QZD A;  1ZQJ A;  4ECV A;  4YMN A;  3PY8 A;  9ICJ A;  9ICG A;  5KG0 A;  3FDS A;  1SKW A;  5JUM A;  7ICF A;  5KFI A;  3TAN A;  9ICL A;  1NJY A;  1SL0 A;  3C1Y A;  5F9L A;  3V7J A;  1S10 A;  4RQ6 A;  3RJI A;  2BCS A;  3MR6 A;  2JZB B;  1ZQN A;  4XQ8 A;  4RQ4 A;  3Q8S B;  3M8S A;  4RQ1 A;  4FBT A;  8ICI A;  3JPR A;  3RJJ A;  1ZQX A;  5J2J A;  8ICT A;  9ICQ A;  1S0O A;  1T4G A;  2ZJA A;  4Z6D A;  3OHB A;  4GC6 A;  3RB6 A;  3RR7 A;  4YMM A;  7ICI A;  1B43 A;  2F1H A;  3RBD A;  9ICC A;  3GQC A;  1BGX T;  1BPX A;  3T5K A;  4YR2 A;  2FLN A;  5KG7 A;  2NRW A;  4I29 A;  1JXE A;  5L1J A;  4RZR A;  4MF2 A;  1QLN A;  1ZQE A;  3SZ2 A;  2FPM A;  4RQ8 A;  1QTM A;  4YR0 A;  3KHG A;  3LWL A;  5L1I A;  3H40 A;  4RQ3 A;  1IM4 A;  8ICZ A;  4QZ9 A;  5L1K A;  2ZUC A;  4NM2 A;  4DLE A;  1EXN A;  4R8U A;  3QZ7 A;  5BOL A;  5J2I A;  3UQ0 A;  3NTU A;  1S0V A;  4MFA A;  1JIH A;  2ZTD A;  3GII A;  1NJW A;  4J9S A;  5D49 A;  4BWJ A;  4RPZ A;  1TKD A;  4GLX A;  4KMU A;  3MFH A;  4NLN A;  4DSI A;  4ECY A;  3RB0 A;  3G6Y A;  4ELV A;  1V9P A;  1TK8 A;  1MSW D;  3FYH A;  5IIO A;  5J2A A;  4BXO A;  3ZDC A;  4DSE A;  2H5X A;  4YXJ A;  3V6H A;  1CUK A;  5KFU A;  2V4R A;  4ECU A;  2V9W A;  5DKW A;  4DO9 A;  4ED8 A;  1NKB A;  5D4B A;  4R66 A;  2BDP A;  4RUA A;  2KZZ A;  1S76 D;  5HML A;  4QZH A;  4KLS A;  1D8L A;  2AQ0 A;  5J0S A;  1ZQO A;  3UXN A;  1UA1 A;  8ICK A;  5J2E A;  1JMS A;  2B21 A;  2BKE A;  3V6J A;  2NRX A;  1TK5 A;  4NXZ A;  3PO4 A;  2PXI A;  4PHP A;  1JN3 A;  4QWE A;  4R65 A;  8ICU A;  3RBE A;  4RQ7 A;  4QWC A;  1UT5 A;  1U9L A;  4EZ9 A;  4JV2 A;  2PI4 A;  5J0P A;  3PV8 A;  3GIK A;  5KG5 A;  4I2D A;  5KT2 A;  3RJG A;  4J9L A;  2PFP A;  2AQ4 A;  5KT5 A;  2HHT A;  8ICC A;  2XC9 A;  9ICO A;  5KG4 A;  5KFE A;  4DS5 A;  3JPT A;  2UVU A;  3B0Y A;  5J0T A;  4ZH4 A;  8ICS A;  2FPK A;  1A77 A;  1XS9 D;  8ICW A;  1WCN A;  4YVZ A;  4E0D A;  4DFM A;  2R8J A;  4EEY A;  3RJF A;  4DOA A;  3ZD8 A;  4M9H A;  3BQT A;  3BJY A;  2ASD A;  2ZJ8 A;  5DDY A;  2ZUB A;  5KFT A;  4TQS A;  5DB8 A;  3PX4 A;  5KFY A;  4DOC A;  2IA6 A;  1NK6 A;  4I2I A;  3JPP A;  4O3O A;  9ICT A;  3TQ1 A;  5J0Y A;  2IHN A;  2FPL A;  4KLJ A;  2BQR A;  4QW8 A;  4CCH A;  5KFC A;  1S9F A;  1L3S A;  4O0I A;  4DSK A;  4TUQ A;  4EBD A;  1NK0 A;  4PHE A;  4C8O A;  4J9O A;  3Q8M A;  2XCA A;  4ED2 A;  4RT3 A;  2AJQ A;  1RYR A;  5KT6 A;  4DL4 A;  4Z6F A;  4DFJ A;  3OJU A;  2Y1I A;  2BQ3 A;  4K4G A;  9ICU A;  4P4P A;  2BQU A;  4DQQ A;  5CR0 A;  1D9F A;  3PO5 A;  3HT3 A;  4YP3 A;  3TAP A;  5J2F A;  4DF8 A;  1X9W A;  4R8U B;  3MGH A;  3PW2 A;  4QZ8 A;  3PMN A;  2LYH A;  2P6U A;  5CP2 A;  4QZI A;  4R63 A;  7ICR A;  1NK5 A;  1SL2 A;  4RPY A;  1KSP A;  7ICE A;  2HHX A;  3RJK A;  3C21 A;  4IR9 A;  4M0A A;  4TQR A;  8ICY A;  4DL6 A;  7ICL A;  3V6K A;  2OWO A;  1NJX A;  3H4D A;  1X9M A;  5DG8 A;  1H38 A;  4KLU A;  4KLE A;  1KTQ A;  2FLL A;  3C23 A;  2HHQ A;  4P2H A;  1L5U A;  4RNM A;  7ICU A;  3GDX A;  3RRH A;  4KLG A;  3IHQ B;  8ICG A;  1L3T A;  1ZQG A;  3IM1 A;  5CJ7 A;  2XY6 A;  2FLP A;  2HVI A;  2KN7 A;  4ECQ A;  2P6R A;  1ZYQ A;  2R8H A;  1ZQD A;  3V7L A;  4FS1 A;  4DSL A;  8ICH A;  1K1S A;  4C8M A;  2M9N A;  1QSS A;  4LZG A;  3BDP A;  4J9K A;  3JPN A;  5KFJ A;  2J6S A;  1SKR A;  4IQV A;  5CWR A;  4F5Q A;  4EYH B;  4DQS A;  4F5R A;  3BQ1 A;  2J6U A;  4O5C A;  4DOB A;  2ZJ5 A;  5DDM A;  3UXP A;  1TK0 A;  2UVW A;  1ZQC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...