2A1JB

Crystal structure of the complex between the c-terminal domains of human xpf and ercc1
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
79
structure length
79
Chain Sequence
b'DPADLLMEKLEQDFVSRVTECLTTVKSVNKTDSQTLLTTFGSLEQLIAASREDLALCPGLGPQKARRLFDVLHEPFLKV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA repair endonuclease XPF
publication title Crystal structure and DNA binding functions of ERCC1, a subunit of the DNA structure-specific endonuclease XPF-ERCC1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 23
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2005-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00633 HHH Helix-hairpin-helix motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2a1jB01
9ICCA 1ZQUA 5JUMA 3C1ZA 1ZQYA 4YCXA 1MQ3A 3HP6A 1KRPA 2XO7A 3V6JA 4F4KA 3PW0A 3H7IA 1XSPA 1TK8A 1S0MA 2W9BB 2R8IA 1NKBA 2HHSA 4J9QA 4DWIA 1S0VA 5KFKA 1NK8A 3T5HA 2KFNA 5KFBA 2MAXA 4NM1A 4ED6A 4Z6DA 9ICHA 4ELVA 3PX4A 7ICUA 4I2CA 4GXJA 9ICMA 3B0XA 2KZ3A 2XC9A 4GC6A 3AU6A 2AQ4A 4KLSA 9ICWA 4KN4A 1BGXT 3BQ0A 4F50A 2FLLA 1RYSA 3SI8A 1JIHA 3PW2A 1T7PA 9ICTA 1X9WA 4QZIA 4UB1A 3RR7A 4LZGA 1QLNA 8ICSA 1A77A 4QWEA 3T5KA 9ICBA 4BWMA 5KFGA 7ICMA 4IQWA 2VA2A 4RNOA 3SV4A 8ICPA 1IM4A 3JPQA 5DBAA 9ICRA 5DDYA 4RT3A 3KHGA 2JEFA 8ICLA 3MR3A 5KFNA 5J2GA 2FLPA 4R66A 5KT7A 1HUZA 4I2HA 8ICAA 1L5UA 4F2SA 2MUTB 4NXZA 1T3NA 5HP4A 4QZDA 4PGQA 3Q8MA 1A76A 3T5JA 4F4WA 5D49A 2A1JB 3ZD9A 4ECZA 4RQ3A 5IIJA 3RB0A 4YG2A 4RUAA 4C8LA 4I29A 4LVSA 4P4PA 2W9CA 5DB6A 3OJUA 3OJSA 4Z6CA 4ED0A 3MBYA 4JWNA 2J6SA 4RT2A 4B9NA 4JV2A 1TFRA 4ED1A 4RZRA 1ZQPA 2XY7A 4O3SA 5EWFA 1SZPA 4YR3A 4F3OA 4F4XA 4I2AA 1UT5A 5DB9A 4I2BA 2C28A 4F4ZA 1RZTA 1HUOA 1B22A 5KFTA 4YFKA 3QEBZ 1TKDA 2WTFA 5KG0A 4DL5A 3IM1A 3PVXA 4B9MA 9ICAA 3RJJA 1BPXA 2Y1JA 2BPCA 3MGIA 5J0WA 4I27A 4F91B 5J29A 1U48A 3V7LA 1ZQEA 4O3OA 1ZQVA 1KLNA 4QW9A 2XY5A 5J0OA 3PW4A 2V4RA 1NJWA 4IRDA 5J2FA 4YN4A 5CA7A 3UQ2A 4DSEA 3PW7A 1KSPA 4KLHA 9ICUA 2PFQA 4M9HA 4IRCA 1U4BA 4EBCA 3GV7B 4DSKA 5KT2A 4YXJA 4O3QA 2Y1IA 4I2EA 2UVUA 1NJZA 5L1KA 1NK5A 8ICIA 5KFYA 2ZJ8A 3EPIA 4DO9A 9ICKA 3EW9A 5J0YA 3FDSA 1QTMA 4DSFA 5J2AA 5D4BA 2AJQA 5KFQA 5CP2A 3GV5B 4DOAA 4M47A 4YD1A 2ASDA 2P6RA 4B9SA 2H5XA 2AU0A 3Q8KA 3H4BA 3QZ8A 7ICLA 1ZQIA 4QW8A 1COOA 4KLJA 1ZQXA 4ZH4A 5HMMA 1ZQSA 1TK0A 4TUQA 3G6VA 4C8KA 3UXPA 7ICQA 3K4GA 4P4OA 5F9NA 4ECXA 5DQHA 4UBCA 4EYHB 4DOCA 3Q8LA 3MDCA 3GQCA 5KFJA 2NRZA 7ICGA 1DOQA 1SL1A 5L1IA 3THVA 1SL0A 3JPSA 5J0PA 2BHNA 2FPKA 5DBCA 2AGOA 2W8LA 4DL6A 5F9LA 1ZJMA 9ICXA 2B21A 4MFCA 2XY6A 4NLGA 5KG1A 1C7YA 1PZNA 4I2DA 5J0RA 1TAQA 3GDXA 1XO1A 5KFEA 2LYHA 4ED3A 4DQQA 4F5OA 2BQ3A 1NK6A 3OHBA 3V7KA 4DFPA 1DGSA 5DKWA 1L3VA 8ICQA 7ICKA 8ICFA 4F8RA 3TQ1A 5DQIA 4RQ5A 4QWAA 1ZQRA 5L1JA 2BGWA 2FMSA 5J2IA 3PR5B 4R65A 4ECVA 5IIOA 4PHEA 4DL7A 9ICQA 1NKEA 1KFDA 4HYKA 3RH4A 3M8RA 2DPIA 4F92B 2P66A 3UXOA 3C21A 3HX0A 2BQRA 3RJEA 5KFLA 4O0IA 5KFRA 5KTQA 1KDHA 2KZZA 1CEZA 4DFJA 4MEYA 3NGDA 5DLFA 9ICIA 4RNNA 3TANA 2ZUBA 2ZTEA 2ZUCA 4YMNA 5CHGA 4F4YA 8ICOA 3M9NB 4R63A 4Q44A 3LK9A 4M9LA 1NK9A 4DQIA 1UA0A 4RQ8A 5J0QA 4C8OA 4EZ6A 4NLKA 4KLLA 4KLQA 4RPYA 4O9MA 4ECUA 1ZQTA 3HPOA 2PFPA 4M6WA 5IIKA 1ZQCA 1ZQQA 8ICMA 4J9OA 3T3FA 4ELTA 3GILA 4O5KA 9ICJA 2I1QA 4UQGA 3C2MA 3RR8A 5L9XA 4F93B 1X9SA 1LV5A 3ORYA 4DEZA 4RQ6A 5J2HA 1UA1A 2HHQA 2XCAA 4KLOA 2ZUDA 3ZDCA 5KFDA 4J9SA 4F2RA 3Q8SB 4KN7A 4MF8A 4BGDA 1TAUA 3V6HA 8ICGA 5KFVA 4IQUA 2VA3A 4GXKA 3TAPA 1U47A 5IILA 3ZDDA 5DB7A 2W9CB 1KTQA 1Z00B 3PMNA 1BPZA 4I2FA 4ED2A 4DFKA 3PO4A 1S77D 4QZCA 4UAWA 1ZQDA 1T8EA 3OHAA 2BCQA 5KT3A 3MR5A 1JN3A 3UPQA 2AGQA 1K1SA 3BJYA 1L3TA 2I9GA 4KLMA 4QZ9A 1Z00A 4DQSA 3TAQA 5KFAA 3M9OB 1ZETA 2NRXA 1L3UA 4KLUA 5KT4A 4Z6EA 1WCLA 2JEJA 1X2IA 3MFIA 4X5VA 1JXEA 3C5FA 5J0SA 1ZQZA 3PV8A 4DSIA 2IBKA 2HHTA 2UVWA 7ICNA 2AGPA 2HVIA 4YMMA 1CUKA 1D9FA 4KLGA 4K4GA 3RB6A 2XGQA 1ZQGA 4YR0A 3MDAA 2ZJAA 4DL3A 4TURA 4JV0A 3PX0A 3RJFA 4M0AA 1ZQNA 3RJHA 2F1IA 4ECRA 3TARA 2FMPA 3BQTA 2ALZA 4JWMA 4UB3A 4DQRA 9ICOA 1SKWA 4TQSA 2W9AA 2ZTCA 5J0UA 1NK0A 4ED7A 3H4DA 3LWMA 4BDPA 4PH5A 4YQWA 2FLNA 5KG5A 4RQ0A 7ICEA 8ICXA 4XUSA 9ICVA 1SL2A 4MEXA 3RJKA 4F5NA 4JK1A 1S76D 4ECQA 4O5CA 1U49A 4RQ2A 1XU4A 1S0NA 2KTQA 5J2CA 1U45A 2BCUA 1SKSA 3ISBA 4UB5A 2UVRA 1BVSA 3QEAZ 4YMOA 1XSNA 1JMSA 3OGUA 3KTQA 3PR4A 4UB4A 1NKCA 4YP3A 4KLTA 2ISPA 5BOMA 4XA5A 5DLGA 4J9MA 4JV1A 4NM2A 1S97A 1IXRA 1XWLA 3RH6A 3AUOA 1QSLA 4FBUA 4I2JA 5J2JA 3KHHA 4B9LA 5HNKA 3V6KA 4QWBA 4ECWA 4QZEA 3RRGA 4XQ8A 5EWGA 1ZQLA 3V72A 2R8GA 4C8NA 4R64A 9ICGA 4EZ9A 4F5QA 3LWLA 1XC9A 4QZGA 1D8YA 4UB2A 3PO5A 2NRWA 8ICJA 2PXIA 3JPPA 2BPGA 1NOMA 1ZQMA 4Z6FA 3FYHA 4UAZA 8ICKA 8ICBA 1ZQFA 4FBTA 4DF8A 1ZYQA 2BDPA 4O3PA 5KG4A 4M9JA 4BWJA 5C5JA 8ICWA 3PNCA 5IINA 4DL2A 5KFCA 9ICPA 3HWTA 4P2HA 4RPXA 7ICVA 3EYZA 1NK4A 5EOZA 4E0DA 3TFSA 1RXWA 4DFMA 3PMLA 7ICJA 5J2EA 2C2EA 4I28A 3V7JA 3ZDBA 8ICHA 8ICCA 4FS2A 2IA6A 2C2DA 4DLEA 4GXIA 8ICTA 4O5EA 1KEJA 4M6WB 3OSNA 4M04A 1MSWD 4GC7A 5DDMA 4BXOA 4M9NA 1BPEA 4F5PA 3SZ2A 3C23A 2BR0A 5DGAA 2NRVA 4J9KA 2F1JA 3JPOA 4DL4A 3RAQA 1WCNA 2HHVA 5KFSA 3KHRA 4C8MA 2PFOA 4EBDA 3ZDAA 4P4MA 4IR9A 5IIIA 4EBEA 5BOLA 3QZ7A 3MR6A 4DF4A 4DSJA 4DLGA 3LDAA 5CJ7A 5KFPA 4UAYA 3MABA 5CR0A 3H40A 1TK5A 4CCHA 4QWDA 8ICYA 8ICUA 3RRHA 2KFZA 2R8KA 3NTUA 8ICEA 4YVZA 3JPNA 3UQ0A 2W8KA 3C5GA 3RJGA 1D8LA 3TFRA 1ZQKA 1BPBA 3BQ2A 3C2KA 4DS5A 2W9BA 4GLXA 3T5LA 5KFUA 4J9LA 4XRHA 2DPJA 4DSLA 2UVVA 3SV3A 2HHUA 1ZQHA 2OWOA 4IR1A 2HW3A 5DBBA 4EEYA 5TZVA 2M9NA 2Q0ZX 4TQRA 8ICZA 1N56A 4PGYA 2BKEA 3MGHA 4PHAA 4TUSA 9ICNA 7ICSA 2R8HA 1ZQJA 4JUZA 1RYRA 9ICFA 3RJIA 1RPLA 2PFNA 1XSLA 5KFHA 7ICIA 4QZAA 1X9MA 9ICEA 5KFMA 3GV8B 3PY8A 1JXLA 4I2GA 1D9DA 4NLZA 2C2RA 1S0OA 5KT6A 5J2KA 3Q8PB 2NRTA 3C1YA 7ICPA 2ZTDA 2VA8A 1Y88A 4EYIB 5KFWA 7ICTA 7ICFA 4RQ4A 3PX6A 1BPDA 4QZ8A 1EXNA 1K1QA 5EWEA 5DG7A 1HJPA 5J2DA 1BPYA 4O3RA 2MUTA 4FS1A 2ATLA 5KFIA 3AU2A 4RQ7A 4PGXA 2GWSA 2BPFA 5DB8A 1ZQOA 4KLDA 2A1JA 5J0XA 1NJYA 1ZJNA 5L1LA 1T4GA 3JPRA 3MFHA 2JZBB 1L3SA 2PI5A 3ZDEA 4IRKA 1ZQWA 4B9VA 4QZBA 3G6YA 1XS9D 2IMWP 3BDPA 4K4HA 3JPTA 4IQTA 5DG8A 3BQ1A 4KLFA 1S10A 3GFKB 5DG9A 2J6TA 3H8WA 2JZBA 4J9RA 4KLEA 2JEGA 5CB1A 3B0YA 2RDJA 2KZMA 5KFOA 2BQUA 1NJXA 5KG7A 4M9GA 4MFAA 4O3NA 3GIKA 2ZJ5A 4QWCA 2KN7A 3IHQB 5KFZA 2BCVA 2FPMA 1B43A 3RBDA 3ISCA 1LB2B 1MQ2A 3EZ5A 4YXMA 5J0TA 3G6XA 4Q8EA 4F5RA 4UBBA 1V9PA 5HHIA 5BPCA 4ELUA 3K75D 4I2IA 2V4QA 4YR2A 5KFXA 4KITB 3M9MB 5IIMA 1TVAA 1RXVA 1MC8A 2BCRA 3SYZA 1UT8A 4LZDA 3EWAA 4MF2A 4ED8A 3ISDA 1KFTA 8ICRA 5D46A 5KG3A 4DOBA 4KTQA 3RAXA 7ICRA 2W9MA 3Q8QB 2BCSA 3GIIA 1S9FA 1SKRA 4TUPA 3RBEA 4RNMA 4DQPA 7ICHA 2J6UA 5KFFA 3KHLA 4RU9A 4J9PA 4IQVA 2XCPA 4QZFA 2FPLA 4NLNA 5CWRA 1AROP 2DFLA 7ICOA 2RDIA 3C2LA 2HHWA 5KG2A 3QE9Y 4RPZA 1KFSA 4Q43A 2VANA 4B9TA 8ICNA 5HMLA 3TI0A 2V9WA 2PI4A 5DGBA 3Q8RB 4R8UB 1ZQBA 3N4MB 4M2YA 2R8JA 4PHPA 4RUCA 3RB3A 2ASLA 1ZQAA 8ICVA 2HHXA 4K4IA 3RH5A 3RB4A 4BXOB 5KG6A 5DQGA 4YD2A 3MR2A 2IHNA 4B9UA 4PPXA 4G3IA 1U9LA 1TV9A 3ETLA 4DS4A 4R8UA 2F1HA 5HHHA 2ASJA 4ECSA 2FMQA 3OSPA 3GIMA 4KLIA 3HW8A 2HVHA 5KT5A 2IHMA 3UXNA 3ZD8A 4KMUA 3EPGA 4J9NA 4FO6A 2XGPA 3HT3A 3N97B 1NK7A 1N48A 2P6UA 2C22A 1JX4A 4MFFA 9ICLA 3H8JA 2JEIA 4ECTA 3H8SA 4Q8FA 3E2EA 2ISOA 1H38A 4PHDA 4ECYA 5J2BA 4QZHA 4RQ1A 2AQ0A 4NY8A 1Z3EB 4Q45A 9ICSA 3GIJA 1QSSA 3PW5A 1QSYA 3M8SA 3RTVA
chains in the Genus database with same CATH superfamily
3WKCA 1PK3A 1ZQYA 5J8YC 4F4KA 1S0MA 1XSPA 5TISU 2NO4A 2MAXA 2F44A 1F0MA 4Y2XA 4ELVA 3ETRA 2HBJA 3NVWA 2XC9A 4F50A 4UAVA 1JIHA 3PW2A 1T7PA 1RQNA 1SXEA 9ICBA 4EELA 3SV4A 1XNSA 1IM4A 3LVVA 8ICLA 3BZKA 5J2GA 4R66A 5KT7A 5AM4A 3SEIA 1L5UA 1BNPA 3GZFA 2MUTB 1T3NA 5HP4A 4PGQA 2KSOB 3ZD9A 3RB0A 3IN5A 3OJUA 2K8CB 2H3FA 4JWNA 4RT2A 4JV2A 1TFRA 4NLCA 4RZRA 5EWFA 1SZPA 1YZ6A 1X42A 2ZIVB 4JB3A 5DB9A 2C28A 1WWUA 1TKDA 4DL5A 3PVXA 1RDFA 4B9MA 2WB1F 2Y1JA 3SD7A 4F91B 5J29A 1ZQEA 4O3OA 4IRDA 5J0OA 2G5IB 5J2FA 4YN4A 5CA7A 2VKQA 4C7YA 9ICUA 1KSPA 1JROA 4DSKA 2UVUA 1L7PA 4PL2A 4DO9A 3EW9A 5J2AA 2LM1A 2ASDA 2JRZA 5EE1A 2P6RA 2HBMA 3U26A 3H4BA 3PSIA 7ICLA 5HMMA 3IP4B 1ZQSA 4TUQA 3UXPA 5F9NA 4ECXA 5DQHA 4UAUA 2HBKA 4CF4A 3GQCA 2HOIA 2K4HA 2NRZA 1SL1A 3D2SA 5DBCA 9ICXA 1TAQA 5KFEA 2LYHA 4ED3A 1NZBA 3OHBA 3V7KA 4DFPA 4F8RA 3TQ1A 5DQIA 4RQ5A 2W3RA 2FMSA 5J2IA 3PR5B 5IIOA 3M8RA 2DPIA 2CN1A 3UXOA 2KZZA 4DFJA 3FAHA 4MEYA 5GTHU 4CF3A 4RNNA 4RQMA 3TANA 4F4YA 2QB0B 5L1MA 3LK9A 2DKXA 1WG8A 5K4LA 1UA0A 4EZ6A 5J0QA 4NLKA 3TADA 1UHUA 4RPYA 3HPOA 1ZQCA 3NVZA 5ALMA 3GILA 2LYBA 3TADC 1C20A 3C2MA 5AI9A 5L9XA 5B5EU 1UA1A 2XCAA 2LI6A 2ZUDA 4J9SA 1SWVA 4KN7A 8ICGA 3IG8A 3TAPA 4Y2SA 1PVPA 4I2FA 3F5EA 1PVRA 4UW9A 2QB1A 1T8EA 2BCQA 1Q3UA 1L3TA 1Z00A 5KFAA 1ZETA 1L3UA 1X2IA 1ZQZA 3K1RB 2RQ5A 2HHTA 2UVWA 2KE7A 7ICNA 3KKAA 2EZYA 2G07A 1A6SA 3RB6A 1ZQ1C 1FEZA 3KKAC 2LYAA 4DL3A 3CP8A 2ZG6A 2W04A 4M0AA 3C29A 1Z4OA 2F1IA 4AYBC 2FMPA 4DCCA 9ICOA 2HCFA 4TQSA 2W9AA 5J0UA 1NK0A 2DWQA 3H4DA 3WK7A 3LWMA 2FLNA 3D6JA 2E8PA 1X9XA 1SL2A 4MEXA 3RJKA 2Q4TA 4ACOA 2KTQA 4RQ2A 1XU4A 2IOFK 1NNLA 2EZXA 2UVRA 3PR4A 4UB4A 4PZNA 2ISPA 5JU5A 5BOMA 3RH6A 5EE9A 4FBUA 2E1EA 3AQEA 4I2JA 1KBUA 1T3QA 5HNKA 4B9LA 1X66A 2K4IA 2YQEA 4R64A 4P0QA 4UB2A 3PO5A 2PXIA 1PK1B 1ZQFA 4DF8A 2JH1A 2BDPA 4BWJA 5AKKA 8ICWA 2OYYA 4DL2A 1UPHA 3F5AA 4RPXA 7ICVA 3EYZA 5AKZA 2WAQF 3PMLA 4I28A 3V7JA 2ZIUB 1KEJA 3MGVA 4GC7A 2NO5A 3HKZF 2JH7A 1BPEA 4F5PA 2QARA 3BZCA 4J9KA 3J81j 3RAQA 1ZD2P 2KJ9A 2PFOA 5IIIA 3QZ7A 5KL1B 5CJ7A 4UAYA 3H40A 1TK5A 8ICYA 5ALVA 3NTUA 8ICEA 3JPNA 3I1YA 3C5GA 3RJGA 3BQ2A 4AYBF 2W9BA 2ZIWB 2DPJA 4EEYA 5AM2A 2CXYA 8ICZA 4PGYA 3MGHA 5HR6A 2R8HA 2GOLA 2ZXHA 2PFNA 4GIBA 2EANA 3LYSA 7ICIA 1JXLA 4HAIA 1D9DA 2C2RA 3Q8PB 4CNQA 3C1YA 1J2MA 1T94A 2EAPA 5KFWA 4RQ4A 7ICFA 1BPDA 2DUYA 5J2DA 2ATLA 5ALWA 2DBYA 5J0XA 1D8BA 1T4GA 3JPRA 3CYMA 2JZBB 1IV8A 4QZBA 3G6YA 4KLFA 5DG9A 3H8WA 4KLEA 3B0YA 2KZMA 2GLEA 2BQUA 1NJXA 2I6XA 4MFAA 4O3NA 4QWCA 3WKDA 3QYPA 3EZ5A 4CE6A 4I2IA 1TVAA 4FE3A 3SENA 5G5HA 3EWAA 4MF2A 4ED8A 1KFTA 4Y2RA 4KTQA 2W9MA 2BCSA 3GIIA 4TUPA 3WK6A 1ZOLA 5C0YA 2YMLA 3F2DA 7ICHA 5KFFA 4RU9A 4NLNA 5CWRA 1AROP 1SWWA 5KG2A 8ICNA 4OO1J 3IRUA 2PI4A 2ES6A 4PHPA 2ASLA 1ZQAA 2K8BB 4B9UA 3ETLA 3OSPA 2EH9A 2VJ4A 5KT5A 3UXNA 1NK7A 4MFFA 1JX4A 4ECTA 4UATA 4QZHA 9ICSA 3GIJA 3UMGA 9ICCA 3C1ZA 5AI0A 4YCXA 3HP6A 2XO7A 3V6JA 3M6KA 4J9QA 4DWIA 1S0VA 1NK8A 2KFNA 5KFBA 4ED6A 2EDUA 4GC6A 9ICWA 2OXOA 4KN4A 3BQ0A 2FLLA 3ZI4A 1X9WA 2HOQA 3M7DA 1Z1BA 2E5SA 4LZGA 1QLNA 8ICSA 3T5KA 3MC1A 5AKGA 4QJFB 3JPQA 1F5SA 9ICRA 5DDYA 4RT3A 2JEFA 5KFNA 2FLPA 4QIWC 5KNIA 1HUZA 4I2HA 5B66U 1NZPA 1SGGA 5AI4A 4NXZA 2LPEA 3Q8MA 4QZDA 1A76A 3H0LB 4PL1A 4C8LA 4I29A 5ALDA 4YG2A 4RUAA 3QX7A 4Z6CA 2QLTA 2J6SA 4B9NA 4ED1A 2KIWA 4F3OA 4F4XA 2B0CA 3B9JA 1B22A 1RZTA 3QEBZ 2EQYA 2WTFA 3IM1A 1BPXA 2F8KA 3MGIA 5J0WA 1U48A 4QW9A 2Y0SF 3UQ2A 3KZIU 2PFQA 5F3XB 4IRCA 4M9HA 1U4BA 3K1ZA 4O3QA 4I2EA 3QXGA 2EAMA 5L1KA 2PMZC 3EPIA 9ICKA 3FDSA 2W3SA 4DFDA 4M47A 5ALPA 4J03A 2AU0A 2FDRA 1PVQA 4AP9A 5KAIU 1P7DA 2G08A 4C8KA 7ICQA 3K4GA 4P4OA 1DRGA 4EYHB 1N5WA 4DOCA 3KFUF 2KHQA 5KFJA 7ICGA 2KJ8A 1SL0A 3JPSA 2AHOB 5ALOA 4DL6A 5AK6A 5F9LA 2H3ZA 2B21A 3ICXA 1IIPA 4MFCA 5KG1A 1XO1A 4DQQA 1OUQA 4F5OA 3QU9A 3HJEA 1DGSA 2K60A 1ZQRA 5L1JA 4R65A 4Y2VA 4DL7A 1NKEA 4OJ6A 5AIBA 2O6KA 3BS5A 5CEHA 2A3VA 2P66A 2F3NA 2HBLA 1KQQA 5EE0A 3A0HU 2L5YA 4YMNA 5CHGA 2HSZA 4Q44A 1NK9A 4DQIA 4RQNA 4RQ8A 4C8OA 2G06A 4KLLA 2K4EA 2DGZA 1ZQTA 4M6WA 5IIKA 4J9OA 4UQGA 4F93B 1X9SA 3ORYA 1LKYA 2HHQA 3E58A 4KLOA 3ZDCA 3Q8SB 3PSPA 4MF8A 4GXKA 2H3QA 1SIJA 3ZDDA 2W9CB 1Z00B 4DFKA 4QZCA 1ZQDA 3OHAA 3BJYA 4KLMA 2HOFA 2D8CA 3M9OB 2LM4A 2MU2A 5ALZA 2JEJA 2K89A 3PV8A 5J0SA 2IBKA 1N2XA 2D6FC 1D9FA 4K4GA 4P0PB 1SZHA 3QU4A 1ZQGA 2H3IA 4YR0A 3PX0A 3RJFA 1ZQNA 3AEVA 3TKAA 2JR5A 2ALZA 2W11A 4UB3A 4DQRA 2JXJA 1SKWA 2ZTCA 4ED7A 1SV0A 4PH5A 4B6JA 8ICXA 1AQ6A 1SV0C 4ECQA 3NRZA 4O5CA 3UMBA 5J2CA 3ISBA 3OPXA 4YMOA 1XSNA 3AN1A 1L7MA 2E3TA 2WF9A 2AXTU 4UB6U 1NKCA 4KLTA 3WK8A 4XA5A 4NM2A 1IXRA 2YB1A 5J2JA 4P0QB 3V6KA 3F2CA 4QZEA 3V72A 2OHFA 5CRXA 4PZOA 4QZGA 2KD1A 2YY6A 2NRWA 5AKXA 1NOMA 3AM9A 4Z6FA 4KX3A 1JUDA 4O3PA 1FO4A 5KFCA 9ICPA 1MA7A 4P2HA 2WF6A 5EOZA 4E0DA 7ICJA 1S8OA 2F8LA 2YB4A 3ZDBA 2XICA 2QARB 1Z4NA 2XVTA 1RG6A 1MSWD 1SB3C 5DDMA 4FZMA 5AKIA 3SZ2A 1J97A 4DL4A 1WCNA 5KFSA 1BNOA 2W03A 5BOLA 4DLGA 5KFPA 3MABA 3WKEA 2K4PA 8ICUA 3RRHA 2R8KA 4YVZA 2B6GA 2W8KA 5ALKA 2UVVA 2HI0A 1VJ5A 4IR1A 2QKQA 4TQRA 7ICSA 4IC9A 3I28A 9ICNA 5ALGA 5AI6A 1K5OA 9ICEA 5KFMA 3GV8B 4I2GA 4NLZA 3QU7A 5AHXA 4C4RA 5KT6A 2NRTA 7ICPA 2W7PA 2VA8A 3PX6A 1K1QA 5EWEA 5ALIA 1BPYA 4O3RA 4FZNA 2MUTA 4FS1A 5KFIA 3AU2A 4RQ7A 4NL9A 5FP0A 2KSOA 1S5LU 1ZJNA 1L7OA 4BJQA 4NL9C 1L3SA 2HMXA 3ZDEA 4IRKA 2ZIXB 5ALEA 1XS9D 1S10A 3SR6A 3GFKB 2ZIVA 4J9RA 2N1RA 5CB1A 4M9GA 3C28A 5AI8A 2KN7A 3IG5A 1RQLA 3RBDA 1LB2B 5ALNA 4YXMA 5J0TA 1OXJA 3CRXA 5HHIA 4ELUA 3K75D 2V4QA 4KITB 5AM5A 4CF5A 3KD3A 4C7ZA 4Y2QA 5D46A 5KG3A 4DOBA 7ICRA 2KVSA 3KHLA 4IQVA 2XCPA 2DFLA 2G0AA 3C2LA 4Q43A 1WUDA 2OEHA 3TI0A 2V9WA 5DGBA 4M2YA 4RUCA 3RB3A 1L8LA 5KAFU 2JV3A 3RH5A 2HHXA 3RB4A 4BXOB 5DQGA 3HRDD 1U9LA 4R8UA 2ASJA 2FMQA 2RRDA 2HVHA 4KMUA 1SV4A 4Q8FA 2JHDA 5J2BA 1N63A 5ALXA 5JUMA 1KRPA 3PW0A 2WF7A 3H7IA 1TK8A 2LBOA 2R8IA 4CGZA 5KFKA 2M0NA 9ICHA 2G09A 4I2CA 1A0PA 9ICMA 3M1YA 2IOFA 3B0XA 2KZ3A 2QB0A 1BGXT 1RYSA 1A77A 4QWEA 5KFGA 2KKPA 1ZRNA 4RNOA 5AKHA 1UCVA 5DBAA 2BDUA 3KHGA 1VDVA 3MR3A 5ALHA 2BZFA 2FJ6A 2W55A 1OW5A 3N7PD 3M6ZA 2A1JB 5ALYA 4ECZA 4LVSA 5IIJA 2E8MA 3WKAA 4P4PA 5DB6A 3OJSA 5AKYA 1ZD4A 2OM6A 2GO7A 4A8EA 4U6PA 1FFVA 5H2FU 2XY7A 4YR3A 2KOBA 4I2AA 1UT5A 4I2BA 4F4ZA 4WJ3B 1KW4A 5KG0A 3KOOA 2KIVA 2LMRA 1UQVA 3RJJA 2BPCA 1O08A 3KBBA 1KLNA 2XY5A 3PW4A 1NJWA 2NV3A 2V4RA 5ALLA 4DSEA 3PW7A 4KLHA 3QU5A 4EBCA 1JI7A 3GV7B 2I5HA 1NJZA 5KFYA 2ZJ8A 4BUGA 5J0YA 4NLBA 1QTMA 4DSFA 4UB8U 4DOAA 4OJLA 3DEEA 2H5XA 3S6JA 3Q8KA 1ZQIA 4QW8A 4KLJA 2Z7JA 1TK0A 4QNLA 2YN4A 2MRLA 3MDCA 1DOQA 5AM3A 2AGOA 4U7CA 4NLGA 1C7YA 4I2DA 3GDXA 2YMMA 2BQ3A 1JALA 3BS5B 5DKWA 2LHTA 8ICQA 4QWAA 3VCBA 1YZ7A 2BGWA 1PK1A 2KJ5A 4ECVA 1FIQA 1V38A 4F92B 3C21A 5ALTA 3RJEA 2BQRA 5KFRA 1KDHA 1CEZA 1N61A 2F77X 2RLTA 2ZUBA 2ZUCA 3M9NB 4R63A 4M9LA 3WU2U 4KLQA 1F44A 4O9MA 2ZIUA 3PSFA 5E79U 3ONNA 2I1QA 2KEYA 2P35A 3O0FA 2OH2A 5GTIU 4IQUA 1URJA 3WK4A 4UAWA 5KT3A 2KKVA 3MR5A 1JN3A 3UPQA 2AGQA 2I9GA 3NASA 4QZ9A 2NRXA 5KT4A 2WFAA 3MFIA 1YT3A 1JXEA 3H0RB 4IL6U 4CRXA 2AGPA 2HVIA 1CUKA 3IV6A 2FI1A 1GO3F 4TURA 4JV0A 4ECRA 3TARA 3BQTA 4JWMA 1B0XA 3A0BU 1QQ6A 2KVCA 3F2BA 3QUCA 4BDPA 4YQWA 7ICEA 4XUSA 4FFDA 4F5NA 4JK1A 1S76D 4OCZA 1U49A 1S0NA 2MA1A 3D2QA 1WWVA 2E8OA 2BCUA 1SKSA 1JMSA 2E8NA 4J9MA 5DLGA 2R18A 1QSLA 1S97A 1XWLA 5A0LA 3AUOA 4OJOA 2EZZA 4PJ0U 4QWBA 4ECWA 1B4FA 5EWGA 5AK3A 4C8NA 9ICGA 5ALFA 5HR7A 2WB1C 3JPPA 1ZQMA 3FYHA 1VLBA 5ALJA 8ICKA 1ZYQA 5KG4A 1KKXA 3OTQA 5AK4A 3HWTA 3ALRA 2ODGA 2OCEA 1RXWA 4DFMA 5J2EA 2C2EA 8ICHA 8ICCA 4FS2A 4QIWF 8ICTA 3OSNA 3L3FX 3I76A 3SAFA 4M9NA 3C23A 2BR0A 2NRVA 3CW2C 2F1JA 3JPOA 5J8YA 3KHRA 4EBDA 4IR9A 1Q46A 4DSJA 5CR0A 1WYGA 2KFZA 3UQ0A 1D8LA 1BPBA 4GLXA 3T5LA 3GU3A 4XRHA 1J2NA 2HHUA 3SV3A 4NWIA 2OWOA 2HW3A 5DBBA 2LKYA 5TZVA 2M9NA 3HILA 1N56A 2BKEA 5AKLA 4TUSA 9ICFA 5T14A 1RYRA 3RJIA 3NVYA 1N62A 1QCKA 1XSLA 2PMZF 5KFHA 1X9MA 3PY8A 4NJ8A 1S0OA 5J2KA 2ZTDA 2CRXA 1Y88A 4QZ8A 2CPRA 1DK3A 1EXNA 2PKEA 3QUQA 2KK0A 4PGXA 4KLDA 2Y9UA 5L1LA 3MFHA 5JTIA 3TACB 2PI5A 4C4TA 1Q3VA 1ZQWA 4B9VA 2IMWP 3BDPA 3JPTA 5DG8A 2Y9TA 2ESEA 2ZJ5A 2E1FA 5KFZA 2BCVA 4C0ZA 3ISCA 3G6XA 4Q8EA 5BPCA 4YR2A 5IIMA 1RXVA 2JMGA 2H3VA 4LZDA 3VC8A 2KICA 3RAXA 1CI4A 1S9FA 1SKRA 1KL9A 3UMCA 3RBEA 2J6UA 4QZFA 2FPLA 7ICOA 2RDIA 3QE9Y 4RPZA 1KFSA 4B9TA 4F71A 3Q8RB 4R8UB 8ICVA 1KN5A 4K4IA 5KG6A 1DGJA 4YD2A 4G3IA 4PPXA 1TV9A 4DS4A 1L8OA 4BX9C 4EEKA 3GIMA 3HW8A 2IHMA 5AICA 4J9NA 3EPGA 1N48A 2XGPA 2F2AB 2P6UA 3H8SA 1H38A 4PHDA 4ECYA 2A1AA 3NS1A 4Q45A 2YTUA 3T5JA 1ZQUA 3N28A 1TAMA 3H0MB 1MQ3A 2HHSA 1NKBA 2W9BB 1V85A 3T5HA 3R9KA 4NM1A 1LVHA 5EE3A 4Z6DA 3PX4A 7ICUA 4GXJA 2ZXIA 4Y2UA 3ED5A 4KLSA 2AQ4A 3AU6A 3FC4A 3SI8A 2D3DA 9ICTA 4QZIA 4UB1A 3RR7A 2KNJA 4BWMA 7ICMA 4IQWA 1ZD5A 2VA2A 2WAQC 8ICPA 4Y2TA 4US8A 3EUB2 8ICAA 4F2SA 3HKZC 1QH9A 3N7SC 4F4WA 5D49A 1QQ7A 1SXDA 4RQ3A 2W9CA 4ED0A 3D2NA 3MBYA 2GH1A 2F76X 3CNHA 1ZQPA 4O3SA 4NV0A 1HUOA 1M6YA 5KFTA 4YFKA 3NVVA 3WK9A 9ICAA 4I27A 2DF4B 3V7LA 1ZQVA 4FZLA 4P0PA 2KHVA 5G5GA 4OJ5A 5KT2A 4YXJA 2Y1IA 1NK5A 8ICIA 3F53A 3SQIA 3UM9A 3WKBA 3E0FA 5D4BA 2AJQA 5KFQA 5CP2A 3GV5B 3QUBA 4YD1A 4B9SA 4OJPA 3QZ8A 4US9A 1COOA 1ZQXA 1PUZA 4ZH4A 3DV9A 4EX7A 3G6VA 4UBCA 5AIAA 3AMZA 3Q8LA 2XIDA 2RHFA 5L1IA 3THVA 3DDHA 5J0PA 2BHNA 3PSTA 2FPKA 2W8LA 1MN8A 1ZJMA 2XY6A 1PZNA 5J0RA 1DK2A 2RP5A 1NK6A 2KG5A 1L3VA 1DXSA 7ICKA 8ICFA 4OD0A 1X6JA 3LVWA 4USAA 4PHEA 5AI5A 9ICQA 1KFDA 4HYKA 3RH4A 2W7OA 4JMUA 3RF9A 3HX0A 5KFLA 3L4PA 4O0IA 5KTQA 9ICIA 1Z1VA 3NGDA 5DLFA 5AM0A 2ZTEA 8ICOA 5KL8B 2DKZA 4ECUA 3QU2A 2PFPA 1ZQQA 3T79A 2YX8A 8ICMA 3T3FA 1N5XA 1L7NA 4ELTA 4O5KA 9ICJA 2WF8A 3RR8A 1LV5A 4DEZA 4RQ6A 5J2HA 4MHVA 2YMQA 2NYVA 4Y2PA 1RYUA 5KFDA 4F2RA 2EAOA 1Q8KA 1TAUA 4LJXA 4BGDA 3V6HA 5KFVA 2VA3A 1U47A 5IILA 5DB7A 1KTQA 1BPZA 3PMNA 4ED2A 3PO4A 1S77D 5AK5A 1ZD3A 1COKA 2VIXA 1K1SA 4DQSA 3FM9A 3TAQA 4KLUA 4Z6EA 1CRXA 1WCLA 4ICAA 4X5VA 3C5FA 4DSIA 3BQ7A 4YMMA 3AQFA 4KLGA 2XGQA 3QNMA 3MDAA 2ZJAA 2AH5A 5ALSA 3BS7A 3RJHA 3IDWA 3WK5A 4C4SA 4Y2YA 1X6IA 2XI9A 4EX6A 5KG5A 4RQ0A 2YMPA 9ICVA 1U45A 2W43A 2ZIXA 2JGAA 2KMDA 1V97A 4UB5A 4O3MA 1BVSA 3QEAZ 3OGUA 3KTQA 4YP3A 4JV1A 1HEKA 1TE2A 2IOHA 3KHHA 3RRGA 4XQ8A 2FE9A 1ZQLA 3AL0B 2R8GA 5ALUA 4EZ9A 4F5QA 3LWLA 2A19A 1XC9A 1D8YA 8ICJA 5ALRA 2BPGA 5AM1A 4UAZA 2Y0SC 8ICBA 3SMVA 4FBTA 3SAGA 1ZXIA 4M9JA 2VJ5A 5C5JA 3PNCA 5IINA 2K8AA 3PZPA 1O03A 1NK4A 2KV2A 3RFAA 3TFSA 2IA6A 3L5KA 2C2DA 4DLEA 4GXIA 4O5EA 4M6WB 4M04A 5AKEA 4BXOA 3N7RC 1IG6A 1LKYB 5DGAA 2DQNB 5ALQA 1NI3A 2HHVA 4C8MA 3ZDAA 4P4MA 4EBEA 4F72A 3MR6A 4DF4A 3LDAA 2WHEA 1XO0A 4CCHA 4QWDA 1L6NA 4IS7A 2DL0A 3TFRA 1ZQKA 1RM6C 3C2KA 4DS5A 2MSNA 5KFUA 4J9LA 4DSLA 1ZQHA 2Q0ZX 3NRWA 4PHAA 5AKJA 1ZQJA 4JUZA 2ZIWA 1RPLA 4QZAA 1HIWA 4UARA 2W54A 3KZXA 1ECWA 4KX5A 4EYIB 7ICTA 5DG7A 1HJPA 2GWSA 2BPFA 5DB8A 1ZQOA 2A1JA 1NJYA 1FFUA 4K4HA 4IQTA 2WF5A 3BQ1A 2HDOA 2J6TA 1ED1A 2JZBA 2JEGA 3H8MA 4CDGA 2RDJA 4C80A 5KFOA 1N60A 5KG7A 3GIKA 5JRTA 3IHQB 4GFJA 2FPMA 1B43A 1MQ2A 1Z19A 4F5RA 4UBBA 1V9PA 5KFXA 3M9MB 1MC8A 4G9BA 2BCRA 3SYZA 1UT8A 4KMOB 4Y2JA 3ISDA 8ICRA 3SAHA 3NUQA 3Q8QB 1JRPA 4RNMA 4DQPA 4UASA 4J9PA 2HHWA 1ZRMA 2VANA 5HMLA 1QQ5A 2KP7A 1ZQBA 3N4MB 2R8JA 4ZOHC 3MR2A 2IHNA 1X40A 2F1HA 5HHHA 4ECSA 3QUTA 4KLIA 3ZD8A 4FO6A 3HT3A 3N97B 9ICLA 2C22A 2G5HB 3H8JA 2JEIA 3E2EA 2ISOA 4EENA 4RQ1A 2AQ0A 4NY8A 1Z3EB 1QSSA 3PW5A 1QSYA 3M8SA 3RTVA
chains in the Genus database with same CATH topology
9ICCA 1ZQUA 5JUMA 3C1ZA 1ZQYA 4YCXA 1MQ3A 3HP6A 1KRPA 2XO7A 3V6JA 4F4KA 3PW0A 3H7IA 1XSPA 1TK8A 1S0MA 2W9BB 2R8IA 1NKBA 2HHSA 4J9QA 4DWIA 1S0VA 5KFKA 1NK8A 3T5HA 2KFNA 5KFBA 2MAXA 4NM1A 4ED6A 4Z6DA 9ICHA 4ELVA 3PX4A 7ICUA 4I2CA 4GXJA 9ICMA 3B0XA 2KZ3A 2XC9A 4GC6A 3AU6A 2AQ4A 4KLSA 9ICWA 4KN4A 1BGXT 3BQ0A 4F50A 2FLLA 1RYSA 3SI8A 1JIHA 3PW2A 1T7PA 9ICTA 1X9WA 4QZIA 4UB1A 3RR7A 4LZGA 1QLNA 8ICSA 1A77A 4QWEA 3T5KA 9ICBA 4BWMA 5KFGA 7ICMA 4IQWA 2VA2A 4RNOA 3SV4A 8ICPA 1IM4A 3JPQA 5DBAA 9ICRA 5DDYA 4RT3A 3KHGA 2JEFA 8ICLA 3MR3A 5KFNA 5J2GA 2FLPA 4R66A 5KT7A 1HUZA 4I2HA 8ICAA 1L5UA 4F2SA 2MUTB 4NXZA 1T3NA 5HP4A 4QZDA 4PGQA 3Q8MA 1A76A 3T5JA 4F4WA 5D49A 2A1JB 3ZD9A 4ECZA 4RQ3A 5IIJA 3RB0A 4YG2A 4RUAA 4C8LA 4I29A 4LVSA 4P4PA 2W9CA 5DB6A 3OJUA 3OJSA 4Z6CA 4ED0A 3MBYA 4JWNA 2J6SA 4RT2A 4B9NA 4JV2A 1TFRA 4ED1A 4RZRA 1ZQPA 2XY7A 4O3SA 5EWFA 1SZPA 4YR3A 4F3OA 4F4XA 4I2AA 1UT5A 5DB9A 4I2BA 2C28A 4F4ZA 1RZTA 1HUOA 1B22A 5KFTA 4YFKA 3QEBZ 1TKDA 2WTFA 5KG0A 4DL5A 3IM1A 3PVXA 4B9MA 9ICAA 3RJJA 1BPXA 2Y1JA 2BPCA 3MGIA 5J0WA 4I27A 4F91B 5J29A 1U48A 3V7LA 1ZQEA 4O3OA 1ZQVA 1KLNA 4QW9A 2XY5A 5J0OA 3PW4A 2V4RA 1NJWA 4IRDA 5J2FA 4YN4A 5CA7A 3UQ2A 4DSEA 3PW7A 1KSPA 4KLHA 9ICUA 2PFQA 4M9HA 4IRCA 1U4BA 4EBCA 3GV7B 4DSKA 5KT2A 4YXJA 4O3QA 2Y1IA 4I2EA 2UVUA 1NJZA 5L1KA 1NK5A 8ICIA 5KFYA 2ZJ8A 3EPIA 4DO9A 9ICKA 3EW9A 5J0YA 3FDSA 1QTMA 4DSFA 5J2AA 5D4BA 2AJQA 5KFQA 5CP2A 3GV5B 4DOAA 4M47A 4YD1A 2ASDA 2P6RA 4B9SA 2H5XA 2AU0A 3Q8KA 3H4BA 3QZ8A 7ICLA 1ZQIA 4QW8A 1COOA 4KLJA 1ZQXA 4ZH4A 5HMMA 1ZQSA 1TK0A 4TUQA 3G6VA 4C8KA 3UXPA 7ICQA 3K4GA 4P4OA 5F9NA 4ECXA 5DQHA 4UBCA 4EYHB 4DOCA 3Q8LA 3MDCA 3GQCA 5KFJA 2NRZA 7ICGA 1DOQA 1SL1A 5L1IA 3THVA 1SL0A 3JPSA 5J0PA 2BHNA 2FPKA 5DBCA 2AGOA 2W8LA 4DL6A 5F9LA 1ZJMA 9ICXA 2B21A 4MFCA 2XY6A 4NLGA 5KG1A 1C7YA 1PZNA 4I2DA 5J0RA 1TAQA 3GDXA 1XO1A 5KFEA 2LYHA 4ED3A 4DQQA 4F5OA 2BQ3A 1NK6A 3OHBA 3V7KA 4DFPA 1DGSA 5DKWA 1L3VA 8ICQA 7ICKA 8ICFA 4F8RA 3TQ1A 5DQIA 4RQ5A 4QWAA 1ZQRA 5L1JA 2BGWA 2FMSA 5J2IA 3PR5B 4R65A 4ECVA 5IIOA 4PHEA 4DL7A 9ICQA 1NKEA 1KFDA 4HYKA 3RH4A 3M8RA 2DPIA 4F92B 2P66A 3UXOA 3C21A 3HX0A 2BQRA 3RJEA 5KFLA 4O0IA 5KFRA 5KTQA 1KDHA 2KZZA 1CEZA 4DFJA 4MEYA 3NGDA 5DLFA 9ICIA 4RNNA 3TANA 2ZUBA 2ZTEA 2ZUCA 4YMNA 5CHGA 4F4YA 8ICOA 3M9NB 4R63A 4Q44A 3LK9A 4M9LA 1NK9A 4DQIA 1UA0A 4RQ8A 5J0QA 4C8OA 4EZ6A 4NLKA 4KLLA 4KLQA 4RPYA 4O9MA 4ECUA 1ZQTA 3HPOA 2PFPA 4M6WA 5IIKA 1ZQCA 1ZQQA 8ICMA 4J9OA 3T3FA 4ELTA 3GILA 4O5KA 9ICJA 2I1QA 4UQGA 3C2MA 3RR8A 5L9XA 4F93B 1X9SA 1LV5A 3ORYA 4DEZA 4RQ6A 5J2HA 1UA1A 2HHQA 2XCAA 4KLOA 2ZUDA 3ZDCA 5KFDA 4J9SA 4F2RA 3Q8SB 4KN7A 4MF8A 4BGDA 1TAUA 3V6HA 8ICGA 5KFVA 4IQUA 2VA3A 4GXKA 3TAPA 1U47A 5IILA 3ZDDA 5DB7A 2W9CB 1KTQA 1Z00B 3PMNA 1BPZA 4I2FA 4ED2A 4DFKA 3PO4A 1S77D 4QZCA 4UAWA 1ZQDA 1T8EA 3OHAA 2BCQA 5KT3A 3MR5A 1JN3A 3UPQA 2AGQA 1K1SA 3BJYA 1L3TA 2I9GA 4KLMA 4QZ9A 1Z00A 4DQSA 3TAQA 5KFAA 3M9OB 1ZETA 2NRXA 1L3UA 4KLUA 5KT4A 4Z6EA 1WCLA 2JEJA 1X2IA 3MFIA 4X5VA 1JXEA 3C5FA 5J0SA 1ZQZA 3PV8A 4DSIA 2IBKA 2HHTA 2UVWA 7ICNA 2AGPA 2HVIA 4YMMA 1CUKA 1D9FA 4KLGA 4K4GA 3RB6A 2XGQA 1ZQGA 4YR0A 3MDAA 2ZJAA 4DL3A 4TURA 4JV0A 3PX0A 3RJFA 4M0AA 1ZQNA 3RJHA 2F1IA 4ECRA 3TARA 2FMPA 3BQTA 2ALZA 4JWMA 4UB3A 4DQRA 9ICOA 1SKWA 4TQSA 2W9AA 2ZTCA 5J0UA 1NK0A 4ED7A 3H4DA 3LWMA 4BDPA 4PH5A 4YQWA 2FLNA 5KG5A 4RQ0A 7ICEA 8ICXA 4XUSA 9ICVA 1SL2A 4MEXA 3RJKA 4F5NA 4JK1A 1S76D 4ECQA 4O5CA 1U49A 4RQ2A 1XU4A 1S0NA 2KTQA 5J2CA 1U45A 2BCUA 1SKSA 3ISBA 4UB5A 2UVRA 1BVSA 3QEAZ 4YMOA 1XSNA 1JMSA 3OGUA 3KTQA 3PR4A 4UB4A 1NKCA 4YP3A 4KLTA 2ISPA 5BOMA 4XA5A 5DLGA 4J9MA 4JV1A 4NM2A 1S97A 1IXRA 1XWLA 3RH6A 3AUOA 1QSLA 4FBUA 4I2JA 5J2JA 3KHHA 4B9LA 5HNKA 3V6KA 4QWBA 4ECWA 4QZEA 3RRGA 4XQ8A 5EWGA 1ZQLA 3V72A 2R8GA 4C8NA 4R64A 9ICGA 4EZ9A 4F5QA 3LWLA 1XC9A 4QZGA 1D8YA 4UB2A 3PO5A 2NRWA 8ICJA 2PXIA 3JPPA 2BPGA 1NOMA 1ZQMA 4Z6FA 3FYHA 4UAZA 8ICKA 8ICBA 1ZQFA 4FBTA 4DF8A 1ZYQA 2BDPA 4O3PA 5KG4A 4M9JA 4BWJA 5C5JA 8ICWA 3PNCA 5IINA 4DL2A 5KFCA 9ICPA 3HWTA 4P2HA 4RPXA 7ICVA 3EYZA 1NK4A 5EOZA 4E0DA 3TFSA 1RXWA 4DFMA 3PMLA 7ICJA 5J2EA 2C2EA 4I28A 3V7JA 3ZDBA 8ICHA 8ICCA 4FS2A 2IA6A 2C2DA 4DLEA 4GXIA 8ICTA 4O5EA 1KEJA 4M6WB 3OSNA 4M04A 1MSWD 4GC7A 5DDMA 4BXOA 4M9NA 1BPEA 4F5PA 3SZ2A 3C23A 2BR0A 5DGAA 2NRVA 4J9KA 2F1JA 3JPOA 4DL4A 3RAQA 1WCNA 2HHVA 5KFSA 3KHRA 4C8MA 2PFOA 4EBDA 3ZDAA 4P4MA 4IR9A 5IIIA 4EBEA 5BOLA 3QZ7A 3MR6A 4DF4A 4DSJA 4DLGA 3LDAA 5CJ7A 5KFPA 4UAYA 3MABA 5CR0A 3H40A 1TK5A 4CCHA 4QWDA 8ICYA 8ICUA 3RRHA 2KFZA 2R8KA 3NTUA 8ICEA 4YVZA 3JPNA 3UQ0A 2W8KA 3C5GA 3RJGA 1D8LA 3TFRA 1ZQKA 1BPBA 3BQ2A 3C2KA 4DS5A 2W9BA 4GLXA 3T5LA 5KFUA 4J9LA 4XRHA 2DPJA 4DSLA 2UVVA 3SV3A 2HHUA 1ZQHA 2OWOA 4IR1A 2HW3A 5DBBA 4EEYA 5TZVA 2M9NA 2Q0ZX 4TQRA 8ICZA 1N56A 4PGYA 2BKEA 3MGHA 4PHAA 4TUSA 9ICNA 7ICSA 2R8HA 1ZQJA 4JUZA 1RYRA 9ICFA 3RJIA 1RPLA 2PFNA 1XSLA 5KFHA 7ICIA 4QZAA 1X9MA 9ICEA 5KFMA 3GV8B 3PY8A 1JXLA 4I2GA 1D9DA 4NLZA 2C2RA 1S0OA 5KT6A 5J2KA 3Q8PB 2NRTA 3C1YA 7ICPA 2ZTDA 2VA8A 1Y88A 4EYIB 5KFWA 7ICTA 7ICFA 4RQ4A 3PX6A 1BPDA 4QZ8A 1EXNA 1K1QA 5EWEA 5DG7A 1HJPA 5J2DA 1BPYA 4O3RA 2MUTA 4FS1A 2ATLA 5KFIA 3AU2A 4RQ7A 4PGXA 2GWSA 2BPFA 5DB8A 1ZQOA 4KLDA 2A1JA 5J0XA 1NJYA 1ZJNA 5L1LA 1T4GA 3JPRA 3MFHA 2JZBB 1L3SA 2PI5A 3ZDEA 4IRKA 1ZQWA 4B9VA 4QZBA 3G6YA 1XS9D 2IMWP 3BDPA 4K4HA 3JPTA 4IQTA 5DG8A 3BQ1A 4KLFA 1S10A 3GFKB 5DG9A 2J6TA 3H8WA 2JZBA 4J9RA 4KLEA 2JEGA 5CB1A 3B0YA 2RDJA 2KZMA 5KFOA 2BQUA 1NJXA 5KG7A 4M9GA 4MFAA 4O3NA 3GIKA 2ZJ5A 4QWCA 2KN7A 3IHQB 5KFZA 2BCVA 2FPMA 1B43A 3RBDA 3ISCA 1LB2B 1MQ2A 3EZ5A 4YXMA 5J0TA 3G6XA 4Q8EA 4F5RA 4UBBA 1V9PA 5HHIA 5BPCA 4ELUA 3K75D 4I2IA 2V4QA 4YR2A 5KFXA 4KITB 3M9MB 5IIMA 1TVAA 1RXVA 1MC8A 2BCRA 3SYZA 1UT8A 4LZDA 3EWAA 4MF2A 4ED8A 3ISDA 1KFTA 8ICRA 5D46A 5KG3A 4DOBA 4KTQA 3RAXA 7ICRA 2W9MA 3Q8QB 2BCSA 3GIIA 1S9FA 1SKRA 4TUPA 3RBEA 4RNMA 4DQPA 7ICHA 2J6UA 5KFFA 3KHLA 4RU9A 4J9PA 4IQVA 2XCPA 4QZFA 2FPLA 4NLNA 5CWRA 1AROP 2DFLA 7ICOA 2RDIA 3C2LA 2HHWA 5KG2A 3QE9Y 4RPZA 1KFSA 4Q43A 2VANA 4B9TA 8ICNA 5HMLA 3TI0A 2V9WA 2PI4A 5DGBA 3Q8RB 4R8UB 1ZQBA 3N4MB 4M2YA 2R8JA 4PHPA 4RUCA 3RB3A 2ASLA 1ZQAA 8ICVA 2HHXA 4K4IA 3RH5A 3RB4A 4BXOB 5KG6A 5DQGA 4YD2A 3MR2A 2IHNA 4B9UA 4PPXA 4G3IA 1U9LA 1TV9A 3ETLA 4DS4A 4R8UA 2F1HA 5HHHA 2ASJA 4ECSA 2FMQA 3OSPA 3GIMA 4KLIA 3HW8A 2HVHA 5KT5A 2IHMA 3UXNA 3ZD8A 4KMUA 3EPGA 4J9NA 4FO6A 2XGPA 3HT3A 3N97B 1NK7A 1N48A 2P6UA 2C22A 1JX4A 4MFFA 9ICLA 3H8JA 2JEIA 4ECTA 3H8SA 4Q8FA 3E2EA 2ISOA 1H38A 4PHDA 4ECYA 5J2BA 4QZHA 4RQ1A 2AQ0A 4NY8A 1Z3EB 4Q45A 9ICSA 3GIJA 1QSSA 3PW5A 1QSYA 3M8SA 3RTVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 9ICC A;  1ZQU A;  5JUM A;  3C1Z A;  1ZQY A;  4YCX A;  1MQ3 A;  3HP6 A;  1KRP A;  2XO7 A;  3V6J A;  4F4K A;  3PW0 A;  3H7I A;  1XSP A;  1TK8 A;  1S0M A;  2W9B B;  2R8I A;  1NKB A;  2HHS A;  4J9Q A;  4DWI A;  1S0V A;  5KFK A;  1NK8 A;  3T5H A;  2KFN A;  5KFB A;  2MAX A;  4NM1 A;  4ED6 A;  4Z6D A;  9ICH A;  4ELV A;  3PX4 A;  7ICU A;  4I2C A;  4GXJ A;  9ICM A;  3B0X A;  2KZ3 A;  2XC9 A;  4GC6 A;  3AU6 A;  2AQ4 A;  4KLS A;  9ICW A;  4KN4 A;  1BGX T;  3BQ0 A;  4F50 A;  2FLL A;  1RYS A;  3SI8 A;  1JIH A;  3PW2 A;  1T7P A;  9ICT A;  1X9W A;  4QZI A;  4UB1 A;  3RR7 A;  4LZG A;  1QLN A;  8ICS A;  1A77 A;  4QWE A;  3T5K A;  9ICB A;  4BWM A;  5KFG A;  7ICM A;  4IQW A;  2VA2 A;  4RNO A;  3SV4 A;  8ICP A;  1IM4 A;  3JPQ A;  5DBA A;  9ICR A;  5DDY A;  4RT3 A;  3KHG A;  2JEF A;  8ICL A;  3MR3 A;  5KFN A;  5J2G A;  2FLP A;  4R66 A;  5KT7 A;  1HUZ A;  4I2H A;  8ICA A;  1L5U A;  4F2S A;  2MUT B;  4NXZ A;  1T3N A;  5HP4 A;  4QZD A;  4PGQ A;  3Q8M A;  1A76 A;  3T5J A;  4F4W A;  5D49 A;  2A1J B;  3ZD9 A;  4ECZ A;  4RQ3 A;  5IIJ A;  3RB0 A;  4YG2 A;  4RUA A;  4C8L A;  4I29 A;  4LVS A;  4P4P A;  2W9C A;  5DB6 A;  3OJU A;  3OJS A;  4Z6C A;  4ED0 A;  3MBY A;  4JWN A;  2J6S A;  4RT2 A;  4B9N A;  4JV2 A;  1TFR A;  4ED1 A;  4RZR A;  1ZQP A;  2XY7 A;  4O3S A;  5EWF A;  1SZP A;  4YR3 A;  4F3O A;  4F4X A;  4I2A A;  1UT5 A;  5DB9 A;  4I2B A;  2C28 A;  4F4Z A;  1RZT A;  1HUO A;  1B22 A;  5KFT A;  4YFK A;  3QEB Z;  1TKD A;  2WTF A;  5KG0 A;  4DL5 A;  3IM1 A;  3PVX A;  4B9M A;  9ICA A;  3RJJ A;  1BPX A;  2Y1J A;  2BPC A;  3MGI A;  5J0W A;  4I27 A;  4F91 B;  5J29 A;  1U48 A;  3V7L A;  1ZQE A;  4O3O A;  1ZQV A;  1KLN A;  4QW9 A;  2XY5 A;  5J0O A;  3PW4 A;  2V4R A;  1NJW A;  4IRD A;  5J2F A;  4YN4 A;  5CA7 A;  3UQ2 A;  4DSE A;  3PW7 A;  1KSP A;  4KLH A;  9ICU A;  2PFQ A;  4M9H A;  4IRC A;  1U4B A;  4EBC A;  3GV7 B;  4DSK A;  5KT2 A;  4YXJ A;  4O3Q A;  2Y1I A;  4I2E A;  2UVU A;  1NJZ A;  5L1K A;  1NK5 A;  8ICI A;  5KFY A;  2ZJ8 A;  3EPI A;  4DO9 A;  9ICK A;  3EW9 A;  5J0Y A;  3FDS A;  1QTM A;  4DSF A;  5J2A A;  5D4B A;  2AJQ A;  5KFQ A;  5CP2 A;  3GV5 B;  4DOA A;  4M47 A;  4YD1 A;  2ASD A;  2P6R A;  4B9S A;  2H5X A;  2AU0 A;  3Q8K A;  3H4B A;  3QZ8 A;  7ICL A;  1ZQI A;  4QW8 A;  1COO A;  4KLJ A;  1ZQX A;  4ZH4 A;  5HMM A;  1ZQS A;  1TK0 A;  4TUQ A;  3G6V A;  4C8K A;  3UXP A;  7ICQ A;  3K4G A;  4P4O A;  5F9N A;  4ECX A;  5DQH A;  4UBC A;  4EYH B;  4DOC A;  3Q8L A;  3MDC A;  3GQC A;  5KFJ A;  2NRZ A;  7ICG A;  1DOQ A;  1SL1 A;  5L1I A;  3THV A;  1SL0 A;  3JPS A;  5J0P A;  2BHN A;  2FPK A;  5DBC A;  2AGO A;  2W8L A;  4DL6 A;  5F9L A;  1ZJM A;  9ICX A;  2B21 A;  4MFC A;  2XY6 A;  4NLG A;  5KG1 A;  1C7Y A;  1PZN A;  4I2D A;  5J0R A;  1TAQ A;  3GDX A;  1XO1 A;  5KFE A;  2LYH A;  4ED3 A;  4DQQ A;  4F5O A;  2BQ3 A;  1NK6 A;  3OHB A;  3V7K A;  4DFP A;  1DGS A;  5DKW A;  1L3V A;  8ICQ A;  7ICK A;  8ICF A;  4F8R A;  3TQ1 A;  5DQI A;  4RQ5 A;  4QWA A;  1ZQR A;  5L1J A;  2BGW A;  2FMS A;  5J2I A;  3PR5 B;  4R65 A;  4ECV A;  5IIO A;  4PHE A;  4DL7 A;  9ICQ A;  1NKE A;  1KFD A;  4HYK A;  3RH4 A;  3M8R A;  2DPI A;  4F92 B;  2P66 A;  3UXO A;  3C21 A;  3HX0 A;  2BQR A;  3RJE A;  5KFL A;  4O0I A;  5KFR A;  5KTQ A;  1KDH A;  2KZZ A;  1CEZ A;  4DFJ A;  4MEY A;  3NGD A;  5DLF A;  9ICI A;  4RNN A;  3TAN A;  2ZUB A;  2ZTE A;  2ZUC A;  4YMN A;  5CHG A;  4F4Y A;  8ICO A;  3M9N B;  4R63 A;  4Q44 A;  3LK9 A;  4M9L A;  1NK9 A;  4DQI A;  1UA0 A;  4RQ8 A;  5J0Q A;  4C8O A;  4EZ6 A;  4NLK A;  4KLL A;  4KLQ A;  4RPY A;  4O9M A;  4ECU A;  1ZQT A;  3HPO A;  2PFP A;  4M6W A;  5IIK A;  1ZQC A;  1ZQQ A;  8ICM A;  4J9O A;  3T3F A;  4ELT A;  3GIL A;  4O5K A;  9ICJ A;  2I1Q A;  4UQG A;  3C2M A;  3RR8 A;  5L9X A;  4F93 B;  1X9S A;  1LV5 A;  3ORY A;  4DEZ A;  4RQ6 A;  5J2H A;  1UA1 A;  2HHQ A;  2XCA A;  4KLO A;  2ZUD A;  3ZDC A;  5KFD A;  4J9S A;  4F2R A;  3Q8S B;  4KN7 A;  4MF8 A;  4BGD A;  1TAU A;  3V6H A;  8ICG A;  5KFV A;  4IQU A;  2VA3 A;  4GXK A;  3TAP A;  1U47 A;  5IIL A;  3ZDD A;  5DB7 A;  2W9C B;  1KTQ A;  1Z00 B;  3PMN A;  1BPZ A;  4I2F A;  4ED2 A;  4DFK A;  3PO4 A;  1S77 D;  4QZC A;  4UAW A;  1ZQD A;  1T8E A;  3OHA A;  2BCQ A;  5KT3 A;  3MR5 A;  1JN3 A;  3UPQ A;  2AGQ A;  1K1S A;  3BJY A;  1L3T A;  2I9G A;  4KLM A;  4QZ9 A;  1Z00 A;  4DQS A;  3TAQ A;  5KFA A;  3M9O B;  1ZET A;  2NRX A;  1L3U A;  4KLU A;  5KT4 A;  4Z6E A;  1WCL A;  2JEJ A;  1X2I A;  3MFI A;  4X5V A;  1JXE A;  3C5F A;  5J0S A;  1ZQZ A;  3PV8 A;  4DSI A;  2IBK A;  2HHT A;  2UVW A;  7ICN A;  2AGP A;  2HVI A;  4YMM A;  1CUK A;  1D9F A;  4KLG A;  4K4G A;  3RB6 A;  2XGQ A;  1ZQG A;  4YR0 A;  3MDA A;  2ZJA A;  4DL3 A;  4TUR A;  4JV0 A;  3PX0 A;  3RJF A;  4M0A A;  1ZQN A;  3RJH A;  2F1I A;  4ECR A;  3TAR A;  2FMP A;  3BQT A;  2ALZ A;  4JWM A;  4UB3 A;  4DQR A;  9ICO A;  1SKW A;  4TQS A;  2W9A A;  2ZTC A;  5J0U A;  1NK0 A;  4ED7 A;  3H4D A;  3LWM A;  4BDP A;  4PH5 A;  4YQW A;  2FLN A;  5KG5 A;  4RQ0 A;  7ICE A;  8ICX A;  4XUS A;  9ICV A;  1SL2 A;  4MEX A;  3RJK A;  4F5N A;  4JK1 A;  1S76 D;  4ECQ A;  4O5C A;  1U49 A;  4RQ2 A;  1XU4 A;  1S0N A;  2KTQ A;  5J2C A;  1U45 A;  2BCU A;  1SKS A;  3ISB A;  4UB5 A;  2UVR A;  1BVS A;  3QEA Z;  4YMO A;  1XSN A;  1JMS A;  3OGU A;  3KTQ A;  3PR4 A;  4UB4 A;  1NKC A;  4YP3 A;  4KLT A;  2ISP A;  5BOM A;  4XA5 A;  5DLG A;  4J9M A;  4JV1 A;  4NM2 A;  1S97 A;  1IXR A;  1XWL A;  3RH6 A;  3AUO A;  1QSL A;  4FBU A;  4I2J A;  5J2J A;  3KHH A;  4B9L A;  5HNK A;  3V6K A;  4QWB A;  4ECW A;  4QZE A;  3RRG A;  4XQ8 A;  5EWG A;  1ZQL A;  3V72 A;  2R8G A;  4C8N A;  4R64 A;  9ICG A;  4EZ9 A;  4F5Q A;  3LWL A;  1XC9 A;  4QZG A;  1D8Y A;  4UB2 A;  3PO5 A;  2NRW A;  8ICJ A;  2PXI A;  3JPP A;  2BPG A;  1NOM A;  1ZQM A;  4Z6F A;  3FYH A;  4UAZ A;  8ICK A;  8ICB A;  1ZQF A;  4FBT A;  4DF8 A;  1ZYQ A;  2BDP A;  4O3P A;  5KG4 A;  4M9J A;  4BWJ A;  5C5J A;  8ICW A;  3PNC A;  5IIN A;  4DL2 A;  5KFC A;  9ICP A;  3HWT A;  4P2H A;  4RPX A;  7ICV A;  3EYZ A;  1NK4 A;  5EOZ A;  4E0D A;  3TFS A;  1RXW A;  4DFM A;  3PML A;  7ICJ A;  5J2E A;  2C2E A;  4I28 A;  3V7J A;  3ZDB A;  8ICH A;  8ICC A;  4FS2 A;  2IA6 A;  2C2D A;  4DLE A;  4GXI A;  8ICT A;  4O5E A;  1KEJ A;  4M6W B;  3OSN A;  4M04 A;  1MSW D;  4GC7 A;  5DDM A;  4BXO A;  4M9N A;  1BPE A;  4F5P A;  3SZ2 A;  3C23 A;  2BR0 A;  5DGA A;  2NRV A;  4J9K A;  2F1J A;  3JPO A;  4DL4 A;  3RAQ A;  1WCN A;  2HHV A;  5KFS A;  3KHR A;  4C8M A;  2PFO A;  4EBD A;  3ZDA A;  4P4M A;  4IR9 A;  5III A;  4EBE A;  5BOL A;  3QZ7 A;  3MR6 A;  4DF4 A;  4DSJ A;  4DLG A;  3LDA A;  5CJ7 A;  5KFP A;  4UAY A;  3MAB A;  5CR0 A;  3H40 A;  1TK5 A;  4CCH A;  4QWD A;  8ICY A;  8ICU A;  3RRH A;  2KFZ A;  2R8K A;  3NTU A;  8ICE A;  4YVZ A;  3JPN A;  3UQ0 A;  2W8K A;  3C5G A;  3RJG A;  1D8L A;  3TFR A;  1ZQK A;  1BPB A;  3BQ2 A;  3C2K A;  4DS5 A;  2W9B A;  4GLX A;  3T5L A;  5KFU A;  4J9L A;  4XRH A;  2DPJ A;  4DSL A;  2UVV A;  3SV3 A;  2HHU A;  1ZQH A;  2OWO A;  4IR1 A;  2HW3 A;  5DBB A;  4EEY A;  5TZV A;  2M9N A;  2Q0Z X;  4TQR A;  8ICZ A;  1N56 A;  4PGY A;  2BKE A;  3MGH A;  4PHA A;  4TUS A;  9ICN A;  7ICS A;  2R8H A;  1ZQJ A;  4JUZ A;  1RYR A;  9ICF A;  3RJI A;  1RPL A;  2PFN A;  1XSL A;  5KFH A;  7ICI A;  4QZA A;  1X9M A;  9ICE A;  5KFM A;  3GV8 B;  3PY8 A;  1JXL A;  4I2G A;  1D9D A;  4NLZ A;  2C2R A;  1S0O A;  5KT6 A;  5J2K A;  3Q8P B;  2NRT A;  3C1Y A;  7ICP A;  2ZTD A;  2VA8 A;  1Y88 A;  4EYI B;  5KFW A;  7ICT A;  7ICF A;  4RQ4 A;  3PX6 A;  1BPD A;  4QZ8 A;  1EXN A;  1K1Q A;  5EWE A;  5DG7 A;  1HJP A;  5J2D A;  1BPY A;  4O3R A;  2MUT A;  4FS1 A;  2ATL A;  5KFI A;  3AU2 A;  4RQ7 A;  4PGX A;  2GWS A;  2BPF A;  5DB8 A;  1ZQO A;  4KLD A;  2A1J A;  5J0X A;  1NJY A;  1ZJN A;  5L1L A;  1T4G A;  3JPR A;  3MFH A;  2JZB B;  1L3S A;  2PI5 A;  3ZDE A;  4IRK A;  1ZQW A;  4B9V A;  4QZB A;  3G6Y A;  1XS9 D;  2IMW P;  3BDP A;  4K4H A;  3JPT A;  4IQT A;  5DG8 A;  3BQ1 A;  4KLF A;  1S10 A;  3GFK B;  5DG9 A;  2J6T A;  3H8W A;  2JZB A;  4J9R A;  4KLE A;  2JEG A;  5CB1 A;  3B0Y A;  2RDJ A;  2KZM A;  5KFO A;  2BQU A;  1NJX A;  5KG7 A;  4M9G A;  4MFA A;  4O3N A;  3GIK A;  2ZJ5 A;  4QWC A;  2KN7 A;  3IHQ B;  5KFZ A;  2BCV A;  2FPM A;  1B43 A;  3RBD A;  3ISC A;  1LB2 B;  1MQ2 A;  3EZ5 A;  4YXM A;  5J0T A;  3G6X A;  4Q8E A;  4F5R A;  4UBB A;  1V9P A;  5HHI A;  5BPC A;  4ELU A;  3K75 D;  4I2I A;  2V4Q A;  4YR2 A;  5KFX A;  4KIT B;  3M9M B;  5IIM A;  1TVA A;  1RXV A;  1MC8 A;  2BCR A;  3SYZ A;  1UT8 A;  4LZD A;  3EWA A;  4MF2 A;  4ED8 A;  3ISD A;  1KFT A;  8ICR A;  5D46 A;  5KG3 A;  4DOB A;  4KTQ A;  3RAX A;  7ICR A;  2W9M A;  3Q8Q B;  2BCS A;  3GII A;  1S9F A;  1SKR A;  4TUP A;  3RBE A;  4RNM A;  4DQP A;  7ICH A;  2J6U A;  5KFF A;  3KHL A;  4RU9 A;  4J9P A;  4IQV A;  2XCP A;  4QZF A;  2FPL A;  4NLN A;  5CWR A;  1ARO P;  2DFL A;  7ICO A;  2RDI A;  3C2L A;  2HHW A;  5KG2 A;  3QE9 Y;  4RPZ A;  1KFS A;  4Q43 A;  2VAN A;  4B9T A;  8ICN A;  5HML A;  3TI0 A;  2V9W A;  2PI4 A;  5DGB A;  3Q8R B;  4R8U B;  1ZQB A;  3N4M B;  4M2Y A;  2R8J A;  4PHP A;  4RUC A;  3RB3 A;  2ASL A;  1ZQA A;  8ICV A;  2HHX A;  4K4I A;  3RH5 A;  3RB4 A;  4BXO B;  5KG6 A;  5DQG A;  4YD2 A;  3MR2 A;  2IHN A;  4B9U A;  4PPX A;  4G3I A;  1U9L A;  1TV9 A;  3ETL A;  4DS4 A;  4R8U A;  2F1H A;  5HHH A;  2ASJ A;  4ECS A;  2FMQ A;  3OSP A;  3GIM A;  4KLI A;  3HW8 A;  2HVH A;  5KT5 A;  2IHM A;  3UXN A;  3ZD8 A;  4KMU A;  3EPG A;  4J9N A;  4FO6 A;  2XGP A;  3HT3 A;  3N97 B;  1NK7 A;  1N48 A;  2P6U A;  2C22 A;  1JX4 A;  4MFF A;  9ICL A;  3H8J A;  2JEI A;  4ECT A;  3H8S A;  4Q8F A;  3E2E A;  2ISO A;  1H38 A;  4PHD A;  4ECY A;  5J2B A;  4QZH A;  4RQ1 A;  2AQ0 A;  4NY8 A;  1Z3E B;  4Q45 A;  9ICS A;  3GIJ A;  1QSS A;  3PW5 A;  1QSY A;  3M8S A;  3RTV A; 
#chains in the Genus database with same CATH topology
 3WKC A;  1PK3 A;  1ZQY A;  5J8Y C;  4F4K A;  1S0M A;  1XSP A;  5TIS U;  2NO4 A;  2MAX A;  2F44 A;  1F0M A;  4Y2X A;  4ELV A;  3ETR A;  2HBJ A;  3NVW A;  2XC9 A;  4F50 A;  4UAV A;  1JIH A;  3PW2 A;  1T7P A;  1RQN A;  1SXE A;  9ICB A;  4EEL A;  3SV4 A;  1XNS A;  1IM4 A;  3LVV A;  8ICL A;  3BZK A;  5J2G A;  4R66 A;  5KT7 A;  5AM4 A;  3SEI A;  1L5U A;  1BNP A;  3GZF A;  2MUT B;  1T3N A;  5HP4 A;  4PGQ A;  2KSO B;  3ZD9 A;  3RB0 A;  3IN5 A;  3OJU A;  2K8C B;  2H3F A;  4JWN A;  4RT2 A;  4JV2 A;  1TFR A;  4NLC A;  4RZR A;  5EWF A;  1SZP A;  1YZ6 A;  1X42 A;  2ZIV B;  4JB3 A;  5DB9 A;  2C28 A;  1WWU A;  1TKD A;  4DL5 A;  3PVX A;  1RDF A;  4B9M A;  2WB1 F;  2Y1J A;  3SD7 A;  4F91 B;  5J29 A;  1ZQE A;  4O3O A;  4IRD A;  5J0O A;  2G5I B;  5J2F A;  4YN4 A;  5CA7 A;  2VKQ A;  4C7Y A;  9ICU A;  1KSP A;  1JRO A;  4DSK A;  2UVU A;  1L7P A;  4PL2 A;  4DO9 A;  3EW9 A;  5J2A A;  2LM1 A;  2ASD A;  2JRZ A;  5EE1 A;  2P6R A;  2HBM A;  3U26 A;  3H4B A;  3PSI A;  7ICL A;  5HMM A;  3IP4 B;  1ZQS A;  4TUQ A;  3UXP A;  5F9N A;  4ECX A;  5DQH A;  4UAU A;  2HBK A;  4CF4 A;  3GQC A;  2HOI A;  2K4H A;  2NRZ A;  1SL1 A;  3D2S A;  5DBC A;  9ICX A;  1TAQ A;  5KFE A;  2LYH A;  4ED3 A;  1NZB A;  3OHB A;  3V7K A;  4DFP A;  4F8R A;  3TQ1 A;  5DQI A;  4RQ5 A;  2W3R A;  2FMS A;  5J2I A;  3PR5 B;  5IIO A;  3M8R A;  2DPI A;  2CN1 A;  3UXO A;  2KZZ A;  4DFJ A;  3FAH A;  4MEY A;  5GTH U;  4CF3 A;  4RNN A;  4RQM A;  3TAN A;  4F4Y A;  2QB0 B;  5L1M A;  3LK9 A;  2DKX A;  1WG8 A;  5K4L A;  1UA0 A;  4EZ6 A;  5J0Q A;  4NLK A;  3TAD A;  1UHU A;  4RPY A;  3HPO A;  1ZQC A;  3NVZ A;  5ALM A;  3GIL A;  2LYB A;  3TAD C;  1C20 A;  3C2M A;  5AI9 A;  5L9X A;  5B5E U;  1UA1 A;  2XCA A;  2LI6 A;  2ZUD A;  4J9S A;  1SWV A;  4KN7 A;  8ICG A;  3IG8 A;  3TAP A;  4Y2S A;  1PVP A;  4I2F A;  3F5E A;  1PVR A;  4UW9 A;  2QB1 A;  1T8E A;  2BCQ A;  1Q3U A;  1L3T A;  1Z00 A;  5KFA A;  1ZET A;  1L3U A;  1X2I A;  1ZQZ A;  3K1R B;  2RQ5 A;  2HHT A;  2UVW A;  2KE7 A;  7ICN A;  3KKA A;  2EZY A;  2G07 A;  1A6S A;  3RB6 A;  1ZQ1 C;  1FEZ A;  3KKA C;  2LYA A;  4DL3 A;  3CP8 A;  2ZG6 A;  2W04 A;  4M0A A;  3C29 A;  1Z4O A;  2F1I A;  4AYB C;  2FMP A;  4DCC A;  9ICO A;  2HCF A;  4TQS A;  2W9A A;  5J0U A;  1NK0 A;  2DWQ A;  3H4D A;  3WK7 A;  3LWM A;  2FLN A;  3D6J A;  2E8P A;  1X9X A;  1SL2 A;  4MEX A;  3RJK A;  2Q4T A;  4ACO A;  2KTQ A;  4RQ2 A;  1XU4 A;  2IOF K;  1NNL A;  2EZX A;  2UVR A;  3PR4 A;  4UB4 A;  4PZN A;  2ISP A;  5JU5 A;  5BOM A;  3RH6 A;  5EE9 A;  4FBU A;  2E1E A;  3AQE A;  4I2J A;  1KBU A;  1T3Q A;  5HNK A;  4B9L A;  1X66 A;  2K4I A;  2YQE A;  4R64 A;  4P0Q A;  4UB2 A;  3PO5 A;  2PXI A;  1PK1 B;  1ZQF A;  4DF8 A;  2JH1 A;  2BDP A;  4BWJ A;  5AKK A;  8ICW A;  2OYY A;  4DL2 A;  1UPH A;  3F5A A;  4RPX A;  7ICV A;  3EYZ A;  5AKZ A;  2WAQ F;  3PML A;  4I28 A;  3V7J A;  2ZIU B;  1KEJ A;  3MGV A;  4GC7 A;  2NO5 A;  3HKZ F;  2JH7 A;  1BPE A;  4F5P A;  2QAR A;  3BZC A;  4J9K A;  3J81 j;  3RAQ A;  1ZD2 P;  2KJ9 A;  2PFO A;  5III A;  3QZ7 A;  5KL1 B;  5CJ7 A;  4UAY A;  3H40 A;  1TK5 A;  8ICY A;  5ALV A;  3NTU A;  8ICE A;  3JPN A;  3I1Y A;  3C5G A;  3RJG A;  3BQ2 A;  4AYB F;  2W9B A;  2ZIW B;  2DPJ A;  4EEY A;  5AM2 A;  2CXY A;  8ICZ A;  4PGY A;  3MGH A;  5HR6 A;  2R8H A;  2GOL A;  2ZXH A;  2PFN A;  4GIB A;  2EAN A;  3LYS A;  7ICI A;  1JXL A;  4HAI A;  1D9D A;  2C2R A;  3Q8P B;  4CNQ A;  3C1Y A;  1J2M A;  1T94 A;  2EAP A;  5KFW A;  4RQ4 A;  7ICF A;  1BPD A;  2DUY A;  5J2D A;  2ATL A;  5ALW A;  2DBY A;  5J0X A;  1D8B A;  1T4G A;  3JPR A;  3CYM A;  2JZB B;  1IV8 A;  4QZB A;  3G6Y A;  4KLF A;  5DG9 A;  3H8W A;  4KLE A;  3B0Y A;  2KZM A;  2GLE A;  2BQU A;  1NJX A;  2I6X A;  4MFA A;  4O3N A;  4QWC A;  3WKD A;  3QYP A;  3EZ5 A;  4CE6 A;  4I2I A;  1TVA A;  4FE3 A;  3SEN A;  5G5H A;  3EWA A;  4MF2 A;  4ED8 A;  1KFT A;  4Y2R A;  4KTQ A;  2W9M A;  2BCS A;  3GII A;  4TUP A;  3WK6 A;  1ZOL A;  5C0Y A;  2YML A;  3F2D A;  7ICH A;  5KFF A;  4RU9 A;  4NLN A;  5CWR A;  1ARO P;  1SWW A;  5KG2 A;  8ICN A;  4OO1 J;  3IRU A;  2PI4 A;  2ES6 A;  4PHP A;  2ASL A;  1ZQA A;  2K8B B;  4B9U A;  3ETL A;  3OSP A;  2EH9 A;  2VJ4 A;  5KT5 A;  3UXN A;  1NK7 A;  4MFF A;  1JX4 A;  4ECT A;  4UAT A;  4QZH A;  9ICS A;  3GIJ A;  3UMG A;  9ICC A;  3C1Z A;  5AI0 A;  4YCX A;  3HP6 A;  2XO7 A;  3V6J A;  3M6K A;  4J9Q A;  4DWI A;  1S0V A;  1NK8 A;  2KFN A;  5KFB A;  4ED6 A;  2EDU A;  4GC6 A;  9ICW A;  2OXO A;  4KN4 A;  3BQ0 A;  2FLL A;  3ZI4 A;  1X9W A;  2HOQ A;  3M7D A;  1Z1B A;  2E5S A;  4LZG A;  1QLN A;  8ICS A;  3T5K A;  3MC1 A;  5AKG A;  4QJF B;  3JPQ A;  1F5S A;  9ICR A;  5DDY A;  4RT3 A;  2JEF A;  5KFN A;  2FLP A;  4QIW C;  5KNI A;  1HUZ A;  4I2H A;  5B66 U;  1NZP A;  1SGG A;  5AI4 A;  4NXZ A;  2LPE A;  3Q8M A;  4QZD A;  1A76 A;  3H0L B;  4PL1 A;  4C8L A;  4I29 A;  5ALD A;  4YG2 A;  4RUA A;  3QX7 A;  4Z6C A;  2QLT A;  2J6S A;  4B9N A;  4ED1 A;  2KIW A;  4F3O A;  4F4X A;  2B0C A;  3B9J A;  1B22 A;  1RZT A;  3QEB Z;  2EQY A;  2WTF A;  3IM1 A;  1BPX A;  2F8K A;  3MGI A;  5J0W A;  1U48 A;  4QW9 A;  2Y0S F;  3UQ2 A;  3KZI U;  2PFQ A;  5F3X B;  4IRC A;  4M9H A;  1U4B A;  3K1Z A;  4O3Q A;  4I2E A;  3QXG A;  2EAM A;  5L1K A;  2PMZ C;  3EPI A;  9ICK A;  3FDS A;  2W3S A;  4DFD A;  4M47 A;  5ALP A;  4J03 A;  2AU0 A;  2FDR A;  1PVQ A;  4AP9 A;  5KAI U;  1P7D A;  2G08 A;  4C8K A;  7ICQ A;  3K4G A;  4P4O A;  1DRG A;  4EYH B;  1N5W A;  4DOC A;  3KFU F;  2KHQ A;  5KFJ A;  7ICG A;  2KJ8 A;  1SL0 A;  3JPS A;  2AHO B;  5ALO A;  4DL6 A;  5AK6 A;  5F9L A;  2H3Z A;  2B21 A;  3ICX A;  1IIP A;  4MFC A;  5KG1 A;  1XO1 A;  4DQQ A;  1OUQ A;  4F5O A;  3QU9 A;  3HJE A;  1DGS A;  2K60 A;  1ZQR A;  5L1J A;  4R65 A;  4Y2V A;  4DL7 A;  1NKE A;  4OJ6 A;  5AIB A;  2O6K A;  3BS5 A;  5CEH A;  2A3V A;  2P66 A;  2F3N A;  2HBL A;  1KQQ A;  5EE0 A;  3A0H U;  2L5Y A;  4YMN A;  5CHG A;  2HSZ A;  4Q44 A;  1NK9 A;  4DQI A;  4RQN A;  4RQ8 A;  4C8O A;  2G06 A;  4KLL A;  2K4E A;  2DGZ A;  1ZQT A;  4M6W A;  5IIK A;  4J9O A;  4UQG A;  4F93 B;  1X9S A;  3ORY A;  1LKY A;  2HHQ A;  3E58 A;  4KLO A;  3ZDC A;  3Q8S B;  3PSP A;  4MF8 A;  4GXK A;  2H3Q A;  1SIJ A;  3ZDD A;  2W9C B;  1Z00 B;  4DFK A;  4QZC A;  1ZQD A;  3OHA A;  3BJY A;  4KLM A;  2HOF A;  2D8C A;  3M9O B;  2LM4 A;  2MU2 A;  5ALZ A;  2JEJ A;  2K89 A;  3PV8 A;  5J0S A;  2IBK A;  1N2X A;  2D6F C;  1D9F A;  4K4G A;  4P0P B;  1SZH A;  3QU4 A;  1ZQG A;  2H3I A;  4YR0 A;  3PX0 A;  3RJF A;  1ZQN A;  3AEV A;  3TKA A;  2JR5 A;  2ALZ A;  2W11 A;  4UB3 A;  4DQR A;  2JXJ A;  1SKW A;  2ZTC A;  4ED7 A;  1SV0 A;  4PH5 A;  4B6J A;  8ICX A;  1AQ6 A;  1SV0 C;  4ECQ A;  3NRZ A;  4O5C A;  3UMB A;  5J2C A;  3ISB A;  3OPX A;  4YMO A;  1XSN A;  3AN1 A;  1L7M A;  2E3T A;  2WF9 A;  2AXT U;  4UB6 U;  1NKC A;  4KLT A;  3WK8 A;  4XA5 A;  4NM2 A;  1IXR A;  2YB1 A;  5J2J A;  4P0Q B;  3V6K A;  3F2C A;  4QZE A;  3V72 A;  2OHF A;  5CRX A;  4PZO A;  4QZG A;  2KD1 A;  2YY6 A;  2NRW A;  5AKX A;  1NOM A;  3AM9 A;  4Z6F A;  4KX3 A;  1JUD A;  4O3P A;  1FO4 A;  5KFC A;  9ICP A;  1MA7 A;  4P2H A;  2WF6 A;  5EOZ A;  4E0D A;  7ICJ A;  1S8O A;  2F8L A;  2YB4 A;  3ZDB A;  2XIC A;  2QAR B;  1Z4N A;  2XVT A;  1RG6 A;  1MSW D;  1SB3 C;  5DDM A;  4FZM A;  5AKI A;  3SZ2 A;  1J97 A;  4DL4 A;  1WCN A;  5KFS A;  1BNO A;  2W03 A;  5BOL A;  4DLG A;  5KFP A;  3MAB A;  3WKE A;  2K4P A;  8ICU A;  3RRH A;  2R8K A;  4YVZ A;  2B6G A;  2W8K A;  5ALK A;  2UVV A;  2HI0 A;  1VJ5 A;  4IR1 A;  2QKQ A;  4TQR A;  7ICS A;  4IC9 A;  3I28 A;  9ICN A;  5ALG A;  5AI6 A;  1K5O A;  9ICE A;  5KFM A;  3GV8 B;  4I2G A;  4NLZ A;  3QU7 A;  5AHX A;  4C4R A;  5KT6 A;  2NRT A;  7ICP A;  2W7P A;  2VA8 A;  3PX6 A;  1K1Q A;  5EWE A;  5ALI A;  1BPY A;  4O3R A;  4FZN A;  2MUT A;  4FS1 A;  5KFI A;  3AU2 A;  4RQ7 A;  4NL9 A;  5FP0 A;  2KSO A;  1S5L U;  1ZJN A;  1L7O A;  4BJQ A;  4NL9 C;  1L3S A;  2HMX A;  3ZDE A;  4IRK A;  2ZIX B;  5ALE A;  1XS9 D;  1S10 A;  3SR6 A;  3GFK B;  2ZIV A;  4J9R A;  2N1R A;  5CB1 A;  4M9G A;  3C28 A;  5AI8 A;  2KN7 A;  3IG5 A;  1RQL A;  3RBD A;  1LB2 B;  5ALN A;  4YXM A;  5J0T A;  1OXJ A;  3CRX A;  5HHI A;  4ELU A;  3K75 D;  2V4Q A;  4KIT B;  5AM5 A;  4CF5 A;  3KD3 A;  4C7Z A;  4Y2Q A;  5D46 A;  5KG3 A;  4DOB A;  7ICR A;  2KVS A;  3KHL A;  4IQV A;  2XCP A;  2DFL A;  2G0A A;  3C2L A;  4Q43 A;  1WUD A;  2OEH A;  3TI0 A;  2V9W A;  5DGB A;  4M2Y A;  4RUC A;  3RB3 A;  1L8L A;  5KAF U;  2JV3 A;  3RH5 A;  2HHX A;  3RB4 A;  4BXO B;  5DQG A;  3HRD D;  1U9L A;  4R8U A;  2ASJ A;  2FMQ A;  2RRD A;  2HVH A;  4KMU A;  1SV4 A;  4Q8F A;  2JHD A;  5J2B A;  1N63 A;  5ALX A;  5JUM A;  1KRP A;  3PW0 A;  2WF7 A;  3H7I A;  1TK8 A;  2LBO A;  2R8I A;  4CGZ A;  5KFK A;  2M0N A;  9ICH A;  2G09 A;  4I2C A;  1A0P A;  9ICM A;  3M1Y A;  2IOF A;  3B0X A;  2KZ3 A;  2QB0 A;  1BGX T;  1RYS A;  1A77 A;  4QWE A;  5KFG A;  2KKP A;  1ZRN A;  4RNO A;  5AKH A;  1UCV A;  5DBA A;  2BDU A;  3KHG A;  1VDV A;  3MR3 A;  5ALH A;  2BZF A;  2FJ6 A;  2W55 A;  1OW5 A;  3N7P D;  3M6Z A;  2A1J B;  5ALY A;  4ECZ A;  4LVS A;  5IIJ A;  2E8M A;  3WKA A;  4P4P A;  5DB6 A;  3OJS A;  5AKY A;  1ZD4 A;  2OM6 A;  2GO7 A;  4A8E A;  4U6P A;  1FFV A;  5H2F U;  2XY7 A;  4YR3 A;  2KOB A;  4I2A A;  1UT5 A;  4I2B A;  4F4Z A;  4WJ3 B;  1KW4 A;  5KG0 A;  3KOO A;  2KIV A;  2LMR A;  1UQV A;  3RJJ A;  2BPC A;  1O08 A;  3KBB A;  1KLN A;  2XY5 A;  3PW4 A;  1NJW A;  2NV3 A;  2V4R A;  5ALL A;  4DSE A;  3PW7 A;  4KLH A;  3QU5 A;  4EBC A;  1JI7 A;  3GV7 B;  2I5H A;  1NJZ A;  5KFY A;  2ZJ8 A;  4BUG A;  5J0Y A;  4NLB A;  1QTM A;  4DSF A;  4UB8 U;  4DOA A;  4OJL A;  3DEE A;  2H5X A;  3S6J A;  3Q8K A;  1ZQI A;  4QW8 A;  4KLJ A;  2Z7J A;  1TK0 A;  4QNL A;  2YN4 A;  2MRL A;  3MDC A;  1DOQ A;  5AM3 A;  2AGO A;  4U7C A;  4NLG A;  1C7Y A;  4I2D A;  3GDX A;  2YMM A;  2BQ3 A;  1JAL A;  3BS5 B;  5DKW A;  2LHT A;  8ICQ A;  4QWA A;  3VCB A;  1YZ7 A;  2BGW A;  1PK1 A;  2KJ5 A;  4ECV A;  1FIQ A;  1V38 A;  4F92 B;  3C21 A;  5ALT A;  3RJE A;  2BQR A;  5KFR A;  1KDH A;  1CEZ A;  1N61 A;  2F77 X;  2RLT A;  2ZUB A;  2ZUC A;  3M9N B;  4R63 A;  4M9L A;  3WU2 U;  4KLQ A;  1F44 A;  4O9M A;  2ZIU A;  3PSF A;  5E79 U;  3ONN A;  2I1Q A;  2KEY A;  2P35 A;  3O0F A;  2OH2 A;  5GTI U;  4IQU A;  1URJ A;  3WK4 A;  4UAW A;  5KT3 A;  2KKV A;  3MR5 A;  1JN3 A;  3UPQ A;  2AGQ A;  2I9G A;  3NAS A;  4QZ9 A;  2NRX A;  5KT4 A;  2WFA A;  3MFI A;  1YT3 A;  1JXE A;  3H0R B;  4IL6 U;  4CRX A;  2AGP A;  2HVI A;  1CUK A;  3IV6 A;  2FI1 A;  1GO3 F;  4TUR A;  4JV0 A;  4ECR A;  3TAR A;  3BQT A;  4JWM A;  1B0X A;  3A0B U;  1QQ6 A;  2KVC A;  3F2B A;  3QUC A;  4BDP A;  4YQW A;  7ICE A;  4XUS A;  4FFD A;  4F5N A;  4JK1 A;  1S76 D;  4OCZ A;  1U49 A;  1S0N A;  2MA1 A;  3D2Q A;  1WWV A;  2E8O A;  2BCU A;  1SKS A;  1JMS A;  2E8N A;  4J9M A;  5DLG A;  2R18 A;  1QSL A;  1S97 A;  1XWL A;  5A0L A;  3AUO A;  4OJO A;  2EZZ A;  4PJ0 U;  4QWB A;  4ECW A;  1B4F A;  5EWG A;  5AK3 A;  4C8N A;  9ICG A;  5ALF A;  5HR7 A;  2WB1 C;  3JPP A;  1ZQM A;  3FYH A;  1VLB A;  5ALJ A;  8ICK A;  1ZYQ A;  5KG4 A;  1KKX A;  3OTQ A;  5AK4 A;  3HWT A;  3ALR A;  2ODG A;  2OCE A;  1RXW A;  4DFM A;  5J2E A;  2C2E A;  8ICH A;  8ICC A;  4FS2 A;  4QIW F;  8ICT A;  3OSN A;  3L3F X;  3I76 A;  3SAF A;  4M9N A;  3C23 A;  2BR0 A;  2NRV A;  3CW2 C;  2F1J A;  3JPO A;  5J8Y A;  3KHR A;  4EBD A;  4IR9 A;  1Q46 A;  4DSJ A;  5CR0 A;  1WYG A;  2KFZ A;  3UQ0 A;  1D8L A;  1BPB A;  4GLX A;  3T5L A;  3GU3 A;  4XRH A;  1J2N A;  2HHU A;  3SV3 A;  4NWI A;  2OWO A;  2HW3 A;  5DBB A;  2LKY A;  5TZV A;  2M9N A;  3HIL A;  1N56 A;  2BKE A;  5AKL A;  4TUS A;  9ICF A;  5T14 A;  1RYR A;  3RJI A;  3NVY A;  1N62 A;  1QCK A;  1XSL A;  2PMZ F;  5KFH A;  1X9M A;  3PY8 A;  4NJ8 A;  1S0O A;  5J2K A;  2ZTD A;  2CRX A;  1Y88 A;  4QZ8 A;  2CPR A;  1DK3 A;  1EXN A;  2PKE A;  3QUQ A;  2KK0 A;  4PGX A;  4KLD A;  2Y9U A;  5L1L A;  3MFH A;  5JTI A;  3TAC B;  2PI5 A;  4C4T A;  1Q3V A;  1ZQW A;  4B9V A;  2IMW P;  3BDP A;  3JPT A;  5DG8 A;  2Y9T A;  2ESE A;  2ZJ5 A;  2E1F A;  5KFZ A;  2BCV A;  4C0Z A;  3ISC A;  3G6X A;  4Q8E A;  5BPC A;  4YR2 A;  5IIM A;  1RXV A;  2JMG A;  2H3V A;  4LZD A;  3VC8 A;  2KIC A;  3RAX A;  1CI4 A;  1S9F A;  1SKR A;  1KL9 A;  3UMC A;  3RBE A;  2J6U A;  4QZF A;  2FPL A;  7ICO A;  2RDI A;  3QE9 Y;  4RPZ A;  1KFS A;  4B9T A;  4F71 A;  3Q8R B;  4R8U B;  8ICV A;  1KN5 A;  4K4I A;  5KG6 A;  1DGJ A;  4YD2 A;  4G3I A;  4PPX A;  1TV9 A;  4DS4 A;  1L8O A;  4BX9 C;  4EEK A;  3GIM A;  3HW8 A;  2IHM A;  5AIC A;  4J9N A;  3EPG A;  1N48 A;  2XGP A;  2F2A B;  2P6U A;  3H8S A;  1H38 A;  4PHD A;  4ECY A;  2A1A A;  3NS1 A;  4Q45 A;  2YTU A;  3T5J A;  1ZQU A;  3N28 A;  1TAM A;  3H0M B;  1MQ3 A;  2HHS A;  1NKB A;  2W9B B;  1V85 A;  3T5H A;  3R9K A;  4NM1 A;  1LVH A;  5EE3 A;  4Z6D A;  3PX4 A;  7ICU A;  4GXJ A;  2ZXI A;  4Y2U A;  3ED5 A;  4KLS A;  2AQ4 A;  3AU6 A;  3FC4 A;  3SI8 A;  2D3D A;  9ICT A;  4QZI A;  4UB1 A;  3RR7 A;  2KNJ A;  4BWM A;  7ICM A;  4IQW A;  1ZD5 A;  2VA2 A;  2WAQ C;  8ICP A;  4Y2T A;  4US8 A;  3EUB 2;  8ICA A;  4F2S A;  3HKZ C;  1QH9 A;  3N7S C;  4F4W A;  5D49 A;  1QQ7 A;  1SXD A;  4RQ3 A;  2W9C A;  4ED0 A;  3D2N A;  3MBY A;  2GH1 A;  2F76 X;  3CNH A;  1ZQP A;  4O3S A;  4NV0 A;  1HUO A;  1M6Y A;  5KFT A;  4YFK A;  3NVV A;  3WK9 A;  9ICA A;  4I27 A;  2DF4 B;  3V7L A;  1ZQV A;  4FZL A;  4P0P A;  2KHV A;  5G5G A;  4OJ5 A;  5KT2 A;  4YXJ A;  2Y1I A;  1NK5 A;  8ICI A;  3F53 A;  3SQI A;  3UM9 A;  3WKB A;  3E0F A;  5D4B A;  2AJQ A;  5KFQ A;  5CP2 A;  3GV5 B;  3QUB A;  4YD1 A;  4B9S A;  4OJP A;  3QZ8 A;  4US9 A;  1COO A;  1ZQX A;  1PUZ A;  4ZH4 A;  3DV9 A;  4EX7 A;  3G6V A;  4UBC A;  5AIA A;  3AMZ A;  3Q8L A;  2XID A;  2RHF A;  5L1I A;  3THV A;  3DDH A;  5J0P A;  2BHN A;  3PST A;  2FPK A;  2W8L A;  1MN8 A;  1ZJM A;  2XY6 A;  1PZN A;  5J0R A;  1DK2 A;  2RP5 A;  1NK6 A;  2KG5 A;  1L3V A;  1DXS A;  7ICK A;  8ICF A;  4OD0 A;  1X6J A;  3LVW A;  4USA A;  4PHE A;  5AI5 A;  9ICQ A;  1KFD A;  4HYK A;  3RH4 A;  2W7O A;  4JMU A;  3RF9 A;  3HX0 A;  5KFL A;  3L4P A;  4O0I A;  5KTQ A;  9ICI A;  1Z1V A;  3NGD A;  5DLF A;  5AM0 A;  2ZTE A;  8ICO A;  5KL8 B;  2DKZ A;  4ECU A;  3QU2 A;  2PFP A;  1ZQQ A;  3T79 A;  2YX8 A;  8ICM A;  3T3F A;  1N5X A;  1L7N A;  4ELT A;  4O5K A;  9ICJ A;  2WF8 A;  3RR8 A;  1LV5 A;  4DEZ A;  4RQ6 A;  5J2H A;  4MHV A;  2YMQ A;  2NYV A;  4Y2P A;  1RYU A;  5KFD A;  4F2R A;  2EAO A;  1Q8K A;  1TAU A;  4LJX A;  4BGD A;  3V6H A;  5KFV A;  2VA3 A;  1U47 A;  5IIL A;  5DB7 A;  1KTQ A;  1BPZ A;  3PMN A;  4ED2 A;  3PO4 A;  1S77 D;  5AK5 A;  1ZD3 A;  1COK A;  2VIX A;  1K1S A;  4DQS A;  3FM9 A;  3TAQ A;  4KLU A;  4Z6E A;  1CRX A;  1WCL A;  4ICA A;  4X5V A;  3C5F A;  4DSI A;  3BQ7 A;  4YMM A;  3AQF A;  4KLG A;  2XGQ A;  3QNM A;  3MDA A;  2ZJA A;  2AH5 A;  5ALS A;  3BS7 A;  3RJH A;  3IDW A;  3WK5 A;  4C4S A;  4Y2Y A;  1X6I A;  2XI9 A;  4EX6 A;  5KG5 A;  4RQ0 A;  2YMP A;  9ICV A;  1U45 A;  2W43 A;  2ZIX A;  2JGA A;  2KMD A;  1V97 A;  4UB5 A;  4O3M A;  1BVS A;  3QEA Z;  3OGU A;  3KTQ A;  4YP3 A;  4JV1 A;  1HEK A;  1TE2 A;  2IOH A;  3KHH A;  3RRG A;  4XQ8 A;  2FE9 A;  1ZQL A;  3AL0 B;  2R8G A;  5ALU A;  4EZ9 A;  4F5Q A;  3LWL A;  2A19 A;  1XC9 A;  1D8Y A;  8ICJ A;  5ALR A;  2BPG A;  5AM1 A;  4UAZ A;  2Y0S C;  8ICB A;  3SMV A;  4FBT A;  3SAG A;  1ZXI A;  4M9J A;  2VJ5 A;  5C5J A;  3PNC A;  5IIN A;  2K8A A;  3PZP A;  1O03 A;  1NK4 A;  2KV2 A;  3RFA A;  3TFS A;  2IA6 A;  3L5K A;  2C2D A;  4DLE A;  4GXI A;  4O5E A;  4M6W B;  4M04 A;  5AKE A;  4BXO A;  3N7R C;  1IG6 A;  1LKY B;  5DGA A;  2DQN B;  5ALQ A;  1NI3 A;  2HHV A;  4C8M A;  3ZDA A;  4P4M A;  4EBE A;  4F72 A;  3MR6 A;  4DF4 A;  3LDA A;  2WHE A;  1XO0 A;  4CCH A;  4QWD A;  1L6N A;  4IS7 A;  2DL0 A;  3TFR A;  1ZQK A;  1RM6 C;  3C2K A;  4DS5 A;  2MSN A;  5KFU A;  4J9L A;  4DSL A;  1ZQH A;  2Q0Z X;  3NRW A;  4PHA A;  5AKJ A;  1ZQJ A;  4JUZ A;  2ZIW A;  1RPL A;  4QZA A;  1HIW A;  4UAR A;  2W54 A;  3KZX A;  1ECW A;  4KX5 A;  4EYI B;  7ICT A;  5DG7 A;  1HJP A;  2GWS A;  2BPF A;  5DB8 A;  1ZQO A;  2A1J A;  1NJY A;  1FFU A;  4K4H A;  4IQT A;  2WF5 A;  3BQ1 A;  2HDO A;  2J6T A;  1ED1 A;  2JZB A;  2JEG A;  3H8M A;  4CDG A;  2RDJ A;  4C80 A;  5KFO A;  1N60 A;  5KG7 A;  3GIK A;  5JRT A;  3IHQ B;  4GFJ A;  2FPM A;  1B43 A;  1MQ2 A;  1Z19 A;  4F5R A;  4UBB A;  1V9P A;  5KFX A;  3M9M B;  1MC8 A;  4G9B A;  2BCR A;  3SYZ A;  1UT8 A;  4KMO B;  4Y2J A;  3ISD A;  8ICR A;  3SAH A;  3NUQ A;  3Q8Q B;  1JRP A;  4RNM A;  4DQP A;  4UAS A;  4J9P A;  2HHW A;  1ZRM A;  2VAN A;  5HML A;  1QQ5 A;  2KP7 A;  1ZQB A;  3N4M B;  2R8J A;  4ZOH C;  3MR2 A;  2IHN A;  1X40 A;  2F1H A;  5HHH A;  4ECS A;  3QUT A;  4KLI A;  3ZD8 A;  4FO6 A;  3HT3 A;  3N97 B;  9ICL A;  2C22 A;  2G5H B;  3H8J A;  2JEI A;  3E2E A;  2ISO A;  4EEN A;  4RQ1 A;  2AQ0 A;  4NY8 A;  1Z3E B;  1QSS A;  3PW5 A;  1QSY A;  3M8S A;  3RTV A; 
#chains in the Genus database with same CATH homology
 9ICC A;  1ZQU A;  5JUM A;  3C1Z A;  1ZQY A;  4YCX A;  1MQ3 A;  3HP6 A;  1KRP A;  2XO7 A;  3V6J A;  4F4K A;  3PW0 A;  3H7I A;  1XSP A;  1TK8 A;  1S0M A;  2W9B B;  2R8I A;  1NKB A;  2HHS A;  4J9Q A;  4DWI A;  1S0V A;  5KFK A;  1NK8 A;  3T5H A;  2KFN A;  5KFB A;  2MAX A;  4NM1 A;  4ED6 A;  4Z6D A;  9ICH A;  4ELV A;  3PX4 A;  7ICU A;  4I2C A;  4GXJ A;  9ICM A;  3B0X A;  2KZ3 A;  2XC9 A;  4GC6 A;  3AU6 A;  2AQ4 A;  4KLS A;  9ICW A;  4KN4 A;  1BGX T;  3BQ0 A;  4F50 A;  2FLL A;  1RYS A;  3SI8 A;  1JIH A;  3PW2 A;  1T7P A;  9ICT A;  1X9W A;  4QZI A;  4UB1 A;  3RR7 A;  4LZG A;  1QLN A;  8ICS A;  1A77 A;  4QWE A;  3T5K A;  9ICB A;  4BWM A;  5KFG A;  7ICM A;  4IQW A;  2VA2 A;  4RNO A;  3SV4 A;  8ICP A;  1IM4 A;  3JPQ A;  5DBA A;  9ICR A;  5DDY A;  4RT3 A;  3KHG A;  2JEF A;  8ICL A;  3MR3 A;  5KFN A;  5J2G A;  2FLP A;  4R66 A;  5KT7 A;  1HUZ A;  4I2H A;  8ICA A;  1L5U A;  4F2S A;  2MUT B;  4NXZ A;  1T3N A;  5HP4 A;  4QZD A;  4PGQ A;  3Q8M A;  1A76 A;  3T5J A;  4F4W A;  5D49 A;  2A1J B;  3ZD9 A;  4ECZ A;  4RQ3 A;  5IIJ A;  3RB0 A;  4YG2 A;  4RUA A;  4C8L A;  4I29 A;  4LVS A;  4P4P A;  2W9C A;  5DB6 A;  3OJU A;  3OJS A;  4Z6C A;  4ED0 A;  3MBY A;  4JWN A;  2J6S A;  4RT2 A;  4B9N A;  4JV2 A;  1TFR A;  4ED1 A;  4RZR A;  1ZQP A;  2XY7 A;  4O3S A;  5EWF A;  1SZP A;  4YR3 A;  4F3O A;  4F4X A;  4I2A A;  1UT5 A;  5DB9 A;  4I2B A;  2C28 A;  4F4Z A;  1RZT A;  1HUO A;  1B22 A;  5KFT A;  4YFK A;  3QEB Z;  1TKD A;  2WTF A;  5KG0 A;  4DL5 A;  3IM1 A;  3PVX A;  4B9M A;  9ICA A;  3RJJ A;  1BPX A;  2Y1J A;  2BPC A;  3MGI A;  5J0W A;  4I27 A;  4F91 B;  5J29 A;  1U48 A;  3V7L A;  1ZQE A;  4O3O A;  1ZQV A;  1KLN A;  4QW9 A;  2XY5 A;  5J0O A;  3PW4 A;  2V4R A;  1NJW A;  4IRD A;  5J2F A;  4YN4 A;  5CA7 A;  3UQ2 A;  4DSE A;  3PW7 A;  1KSP A;  4KLH A;  9ICU A;  2PFQ A;  4M9H A;  4IRC A;  1U4B A;  4EBC A;  3GV7 B;  4DSK A;  5KT2 A;  4YXJ A;  4O3Q A;  2Y1I A;  4I2E A;  2UVU A;  1NJZ A;  5L1K A;  1NK5 A;  8ICI A;  5KFY A;  2ZJ8 A;  3EPI A;  4DO9 A;  9ICK A;  3EW9 A;  5J0Y A;  3FDS A;  1QTM A;  4DSF A;  5J2A A;  5D4B A;  2AJQ A;  5KFQ A;  5CP2 A;  3GV5 B;  4DOA A;  4M47 A;  4YD1 A;  2ASD A;  2P6R A;  4B9S A;  2H5X A;  2AU0 A;  3Q8K A;  3H4B A;  3QZ8 A;  7ICL A;  1ZQI A;  4QW8 A;  1COO A;  4KLJ A;  1ZQX A;  4ZH4 A;  5HMM A;  1ZQS A;  1TK0 A;  4TUQ A;  3G6V A;  4C8K A;  3UXP A;  7ICQ A;  3K4G A;  4P4O A;  5F9N A;  4ECX A;  5DQH A;  4UBC A;  4EYH B;  4DOC A;  3Q8L A;  3MDC A;  3GQC A;  5KFJ A;  2NRZ A;  7ICG A;  1DOQ A;  1SL1 A;  5L1I A;  3THV A;  1SL0 A;  3JPS A;  5J0P A;  2BHN A;  2FPK A;  5DBC A;  2AGO A;  2W8L A;  4DL6 A;  5F9L A;  1ZJM A;  9ICX A;  2B21 A;  4MFC A;  2XY6 A;  4NLG A;  5KG1 A;  1C7Y A;  1PZN A;  4I2D A;  5J0R A;  1TAQ A;  3GDX A;  1XO1 A;  5KFE A;  2LYH A;  4ED3 A;  4DQQ A;  4F5O A;  2BQ3 A;  1NK6 A;  3OHB A;  3V7K A;  4DFP A;  1DGS A;  5DKW A;  1L3V A;  8ICQ A;  7ICK A;  8ICF A;  4F8R A;  3TQ1 A;  5DQI A;  4RQ5 A;  4QWA A;  1ZQR A;  5L1J A;  2BGW A;  2FMS A;  5J2I A;  3PR5 B;  4R65 A;  4ECV A;  5IIO A;  4PHE A;  4DL7 A;  9ICQ A;  1NKE A;  1KFD A;  4HYK A;  3RH4 A;  3M8R A;  2DPI A;  4F92 B;  2P66 A;  3UXO A;  3C21 A;  3HX0 A;  2BQR A;  3RJE A;  5KFL A;  4O0I A;  5KFR A;  5KTQ A;  1KDH A;  2KZZ A;  1CEZ A;  4DFJ A;  4MEY A;  3NGD A;  5DLF A;  9ICI A;  4RNN A;  3TAN A;  2ZUB A;  2ZTE A;  2ZUC A;  4YMN A;  5CHG A;  4F4Y A;  8ICO A;  3M9N B;  4R63 A;  4Q44 A;  3LK9 A;  4M9L A;  1NK9 A;  4DQI A;  1UA0 A;  4RQ8 A;  5J0Q A;  4C8O A;  4EZ6 A;  4NLK A;  4KLL A;  4KLQ A;  4RPY A;  4O9M A;  4ECU A;  1ZQT A;  3HPO A;  2PFP A;  4M6W A;  5IIK A;  1ZQC A;  1ZQQ A;  8ICM A;  4J9O A;  3T3F A;  4ELT A;  3GIL A;  4O5K A;  9ICJ A;  2I1Q A;  4UQG A;  3C2M A;  3RR8 A;  5L9X A;  4F93 B;  1X9S A;  1LV5 A;  3ORY A;  4DEZ A;  4RQ6 A;  5J2H A;  1UA1 A;  2HHQ A;  2XCA A;  4KLO A;  2ZUD A;  3ZDC A;  5KFD A;  4J9S A;  4F2R A;  3Q8S B;  4KN7 A;  4MF8 A;  4BGD A;  1TAU A;  3V6H A;  8ICG A;  5KFV A;  4IQU A;  2VA3 A;  4GXK A;  3TAP A;  1U47 A;  5IIL A;  3ZDD A;  5DB7 A;  2W9C B;  1KTQ A;  1Z00 B;  3PMN A;  1BPZ A;  4I2F A;  4ED2 A;  4DFK A;  3PO4 A;  1S77 D;  4QZC A;  4UAW A;  1ZQD A;  1T8E A;  3OHA A;  2BCQ A;  5KT3 A;  3MR5 A;  1JN3 A;  3UPQ A;  2AGQ A;  1K1S A;  3BJY A;  1L3T A;  2I9G A;  4KLM A;  4QZ9 A;  1Z00 A;  4DQS A;  3TAQ A;  5KFA A;  3M9O B;  1ZET A;  2NRX A;  1L3U A;  4KLU A;  5KT4 A;  4Z6E A;  1WCL A;  2JEJ A;  1X2I A;  3MFI A;  4X5V A;  1JXE A;  3C5F A;  5J0S A;  1ZQZ A;  3PV8 A;  4DSI A;  2IBK A;  2HHT A;  2UVW A;  7ICN A;  2AGP A;  2HVI A;  4YMM A;  1CUK A;  1D9F A;  4KLG A;  4K4G A;  3RB6 A;  2XGQ A;  1ZQG A;  4YR0 A;  3MDA A;  2ZJA A;  4DL3 A;  4TUR A;  4JV0 A;  3PX0 A;  3RJF A;  4M0A A;  1ZQN A;  3RJH A;  2F1I A;  4ECR A;  3TAR A;  2FMP A;  3BQT A;  2ALZ A;  4JWM A;  4UB3 A;  4DQR A;  9ICO A;  1SKW A;  4TQS A;  2W9A A;  2ZTC A;  5J0U A;  1NK0 A;  4ED7 A;  3H4D A;  3LWM A;  4BDP A;  4PH5 A;  4YQW A;  2FLN A;  5KG5 A;  4RQ0 A;  7ICE A;  8ICX A;  4XUS A;  9ICV A;  1SL2 A;  4MEX A;  3RJK A;  4F5N A;  4JK1 A;  1S76 D;  4ECQ A;  4O5C A;  1U49 A;  4RQ2 A;  1XU4 A;  1S0N A;  2KTQ A;  5J2C A;  1U45 A;  2BCU A;  1SKS A;  3ISB A;  4UB5 A;  2UVR A;  1BVS A;  3QEA Z;  4YMO A;  1XSN A;  1JMS A;  3OGU A;  3KTQ A;  3PR4 A;  4UB4 A;  1NKC A;  4YP3 A;  4KLT A;  2ISP A;  5BOM A;  4XA5 A;  5DLG A;  4J9M A;  4JV1 A;  4NM2 A;  1S97 A;  1IXR A;  1XWL A;  3RH6 A;  3AUO A;  1QSL A;  4FBU A;  4I2J A;  5J2J A;  3KHH A;  4B9L A;  5HNK A;  3V6K A;  4QWB A;  4ECW A;  4QZE A;  3RRG A;  4XQ8 A;  5EWG A;  1ZQL A;  3V72 A;  2R8G A;  4C8N A;  4R64 A;  9ICG A;  4EZ9 A;  4F5Q A;  3LWL A;  1XC9 A;  4QZG A;  1D8Y A;  4UB2 A;  3PO5 A;  2NRW A;  8ICJ A;  2PXI A;  3JPP A;  2BPG A;  1NOM A;  1ZQM A;  4Z6F A;  3FYH A;  4UAZ A;  8ICK A;  8ICB A;  1ZQF A;  4FBT A;  4DF8 A;  1ZYQ A;  2BDP A;  4O3P A;  5KG4 A;  4M9J A;  4BWJ A;  5C5J A;  8ICW A;  3PNC A;  5IIN A;  4DL2 A;  5KFC A;  9ICP A;  3HWT A;  4P2H A;  4RPX A;  7ICV A;  3EYZ A;  1NK4 A;  5EOZ A;  4E0D A;  3TFS A;  1RXW A;  4DFM A;  3PML A;  7ICJ A;  5J2E A;  2C2E A;  4I28 A;  3V7J A;  3ZDB A;  8ICH A;  8ICC A;  4FS2 A;  2IA6 A;  2C2D A;  4DLE A;  4GXI A;  8ICT A;  4O5E A;  1KEJ A;  4M6W B;  3OSN A;  4M04 A;  1MSW D;  4GC7 A;  5DDM A;  4BXO A;  4M9N A;  1BPE A;  4F5P A;  3SZ2 A;  3C23 A;  2BR0 A;  5DGA A;  2NRV A;  4J9K A;  2F1J A;  3JPO A;  4DL4 A;  3RAQ A;  1WCN A;  2HHV A;  5KFS A;  3KHR A;  4C8M A;  2PFO A;  4EBD A;  3ZDA A;  4P4M A;  4IR9 A;  5III A;  4EBE A;  5BOL A;  3QZ7 A;  3MR6 A;  4DF4 A;  4DSJ A;  4DLG A;  3LDA A;  5CJ7 A;  5KFP A;  4UAY A;  3MAB A;  5CR0 A;  3H40 A;  1TK5 A;  4CCH A;  4QWD A;  8ICY A;  8ICU A;  3RRH A;  2KFZ A;  2R8K A;  3NTU A;  8ICE A;  4YVZ A;  3JPN A;  3UQ0 A;  2W8K A;  3C5G A;  3RJG A;  1D8L A;  3TFR A;  1ZQK A;  1BPB A;  3BQ2 A;  3C2K A;  4DS5 A;  2W9B A;  4GLX A;  3T5L A;  5KFU A;  4J9L A;  4XRH A;  2DPJ A;  4DSL A;  2UVV A;  3SV3 A;  2HHU A;  1ZQH A;  2OWO A;  4IR1 A;  2HW3 A;  5DBB A;  4EEY A;  5TZV A;  2M9N A;  2Q0Z X;  4TQR A;  8ICZ A;  1N56 A;  4PGY A;  2BKE A;  3MGH A;  4PHA A;  4TUS A;  9ICN A;  7ICS A;  2R8H A;  1ZQJ A;  4JUZ A;  1RYR A;  9ICF A;  3RJI A;  1RPL A;  2PFN A;  1XSL A;  5KFH A;  7ICI A;  4QZA A;  1X9M A;  9ICE A;  5KFM A;  3GV8 B;  3PY8 A;  1JXL A;  4I2G A;  1D9D A;  4NLZ A;  2C2R A;  1S0O A;  5KT6 A;  5J2K A;  3Q8P B;  2NRT A;  3C1Y A;  7ICP A;  2ZTD A;  2VA8 A;  1Y88 A;  4EYI B;  5KFW A;  7ICT A;  7ICF A;  4RQ4 A;  3PX6 A;  1BPD A;  4QZ8 A;  1EXN A;  1K1Q A;  5EWE A;  5DG7 A;  1HJP A;  5J2D A;  1BPY A;  4O3R A;  2MUT A;  4FS1 A;  2ATL A;  5KFI A;  3AU2 A;  4RQ7 A;  4PGX A;  2GWS A;  2BPF A;  5DB8 A;  1ZQO A;  4KLD A;  2A1J A;  5J0X A;  1NJY A;  1ZJN A;  5L1L A;  1T4G A;  3JPR A;  3MFH A;  2JZB B;  1L3S A;  2PI5 A;  3ZDE A;  4IRK A;  1ZQW A;  4B9V A;  4QZB A;  3G6Y A;  1XS9 D;  2IMW P;  3BDP A;  4K4H A;  3JPT A;  4IQT A;  5DG8 A;  3BQ1 A;  4KLF A;  1S10 A;  3GFK B;  5DG9 A;  2J6T A;  3H8W A;  2JZB A;  4J9R A;  4KLE A;  2JEG A;  5CB1 A;  3B0Y A;  2RDJ A;  2KZM A;  5KFO A;  2BQU A;  1NJX A;  5KG7 A;  4M9G A;  4MFA A;  4O3N A;  3GIK A;  2ZJ5 A;  4QWC A;  2KN7 A;  3IHQ B;  5KFZ A;  2BCV A;  2FPM A;  1B43 A;  3RBD A;  3ISC A;  1LB2 B;  1MQ2 A;  3EZ5 A;  4YXM A;  5J0T A;  3G6X A;  4Q8E A;  4F5R A;  4UBB A;  1V9P A;  5HHI A;  5BPC A;  4ELU A;  3K75 D;  4I2I A;  2V4Q A;  4YR2 A;  5KFX A;  4KIT B;  3M9M B;  5IIM A;  1TVA A;  1RXV A;  1MC8 A;  2BCR A;  3SYZ A;  1UT8 A;  4LZD A;  3EWA A;  4MF2 A;  4ED8 A;  3ISD A;  1KFT A;  8ICR A;  5D46 A;  5KG3 A;  4DOB A;  4KTQ A;  3RAX A;  7ICR A;  2W9M A;  3Q8Q B;  2BCS A;  3GII A;  1S9F A;  1SKR A;  4TUP A;  3RBE A;  4RNM A;  4DQP A;  7ICH A;  2J6U A;  5KFF A;  3KHL A;  4RU9 A;  4J9P A;  4IQV A;  2XCP A;  4QZF A;  2FPL A;  4NLN A;  5CWR A;  1ARO P;  2DFL A;  7ICO A;  2RDI A;  3C2L A;  2HHW A;  5KG2 A;  3QE9 Y;  4RPZ A;  1KFS A;  4Q43 A;  2VAN A;  4B9T A;  8ICN A;  5HML A;  3TI0 A;  2V9W A;  2PI4 A;  5DGB A;  3Q8R B;  4R8U B;  1ZQB A;  3N4M B;  4M2Y A;  2R8J A;  4PHP A;  4RUC A;  3RB3 A;  2ASL A;  1ZQA A;  8ICV A;  2HHX A;  4K4I A;  3RH5 A;  3RB4 A;  4BXO B;  5KG6 A;  5DQG A;  4YD2 A;  3MR2 A;  2IHN A;  4B9U A;  4PPX A;  4G3I A;  1U9L A;  1TV9 A;  3ETL A;  4DS4 A;  4R8U A;  2F1H A;  5HHH A;  2ASJ A;  4ECS A;  2FMQ A;  3OSP A;  3GIM A;  4KLI A;  3HW8 A;  2HVH A;  5KT5 A;  2IHM A;  3UXN A;  3ZD8 A;  4KMU A;  3EPG A;  4J9N A;  4FO6 A;  2XGP A;  3HT3 A;  3N97 B;  1NK7 A;  1N48 A;  2P6U A;  2C22 A;  1JX4 A;  4MFF A;  9ICL A;  3H8J A;  2JEI A;  4ECT A;  3H8S A;  4Q8F A;  3E2E A;  2ISO A;  1H38 A;  4PHD A;  4ECY A;  5J2B A;  4QZH A;  4RQ1 A;  2AQ0 A;  4NY8 A;  1Z3E B;  4Q45 A;  9ICS A;  3GIJ A;  1QSS A;  3PW5 A;  1QSY A;  3M8S A;  3RTV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...