2A1JB

Crystal structure of the complex between the c-terminal domains of human xpf and ercc1
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
79
structure length
79
Chain Sequence
DPADLLMEKLEQDFVSRVTECLTTVKSVNKTDSQTLLTTFGSLEQLIAASREDLALCPGLGPQKARRLFDVLHEPFLKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA repair endonuclease XPF
publication title Crystal structure and DNA binding functions of ERCC1, a subunit of the DNA structure-specific endonuclease XPF-ERCC1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 23
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2005-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00633 HHH Helix-hairpin-helix motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2a1jB01
3C21A 4QZDA 5KG7A 1U49A 5D46A 4KLHA 9ICSA 4M47A 1UT8A 1NK4A 4Q45A 4PHEA 4UB5A 1T4GA 1UA0A 3MABA 2JZBA 3EWAA 4F92B 2PXIA 3TI0A 3RJIA 4CCHA 4DSIA 4C8OA 5KFKA 4PPXA 4KLGA 4RUAA 4EEYA 4TUSA 2C2RA 2PI4A 5KFOA 4RPYA 4QWCA 4I2DA 2XY5A 2AU0A 2HHVA 1ZQEA 1ZQIA 4DL5A 3PX4A 8ICWA 3H8SA 4MFFA 3RBEA 3M9NB 1ZQHA 1U4BA 3RR8A 1HUZA 3EZ5A 3RB4A 1KFSA 7ICIA 2PFNA 1Y88A 5L1KA 8ICLA 4XRHA 1XWLA 4QZEA 4R63A 4XQ8A 3MR5A 3RRHA 2A1JA 5CA7A 2ASJA 1NJZA 2F1HA 4I28A 5DGBA 5CR0A 4BGDA 8ICZA 4KLTA 1A76A 4K4IA 3GIIA 4IQVA 1NKEA 1ZQJA 4DSJA 4YXMA 4EBDA 4ECWA 1S0NA 5DKWA 3BQ1A 3H8WA 4QZIA 3RAQA 5BPCA 4M2YA 4NLGA 3JPSA 4ECTA 2XCAA 3H40A 7ICRA 1C7YA 9ICLA 4HYKA 1EXNA 4YR0A 3TFSA 5DBAA 4G3IA 3TFRA 4I27A 2XGPA 3PX0A 4R8UA 3RB6A 4O3PA 4UAZA 3RB0A 2NRTA 5J2IA 4KN4A 4M6WA 2UVVA 5HMLA 4PH5A 4BXOA 3BQTA 3MDCA 1ZQQA 1S77D 9ICXA 3NGDA 4JK1A 8ICVA 4J9OA 2A1JB 2GWSA 1PZNA 5KFZA 5KFWA 2P66A 2KFNA 5KG2A 2ZUDA 9ICMA 5J0UA 1TVAA 2J6TA 4F4ZA 5J2GA 4B9NA 4K4GA 2ALZA 3EPGA 4Z6CA 7ICVA 5J2KA 2KZZA 3JPOA 3RJGA 4QZCA 5DG8A 1MQ2A 2JEGA 4RT3A 4F8RA 3ISCA 3JPTA 4MEYA 5KFEA 4M9LA 4NLZA 4DS5A 9ICIA 9ICNA 4DOBA 2R8GA 1LB2B 5DLFA 3MFIA 1NK0A 4KLFA 5KG3A 4DLEA 4GLXA 2BCSA 3MGHA 4R8UB 1QLNA 3BJYA 9ICHA 4YN4A 5DQGA 4M6WB 1JXLA 4DQIA 5BOMA 4F50A 3SV3A 3BDPA 1DOQA 3LDAA 4LZDA 3KHGA 1K1QA 9ICTA 1ZQXA 3GDXA 4KLDA 1N48A 7ICEA 3GIMA 4RQ4A 2I1QA 4IQTA 5C5JA 3H4BA 3PW7A 3THVA 1ZJNA 4R65A 2BCUA 4MFCA 5DB6A 3GV5B 4ED8A 3GQCA 3V6HA 2IHNA 5J29A 5HHIA 4ECSA 3JPNA 2V9WA 1B43A 3GFKB 3OHAA 4UBBA 8ICGA 4J9QA 3C5GA 1TK5A 2R8JA 1BPEA 5EWEA 1TAUA 4JV2A 2BPCA 5DDYA 4ELTA 8ICAA 4O3NA 1RXVA 1L3VA 4PHAA 4O3OA 1UA1A 3RJEA 4BDPA 7ICUA 8ICYA 5DG9A 4J9PA 4DFMA 9ICRA 2FPKA 1XSPA 4GXJA 5J0YA 4DL6A 1ZQCA 2DPIA 1ZQRA 4GC6A 3BQ0A 3RRGA 4UBCA 3V6JA 5KFYA 3AU6A 5F9LA 4YMOA 4NLNA 4O5CA 7ICSA 2FMQA 3H8JA 4B9VA 3B0XA 2FPMA 4YFKA 4O3RA 1NK9A 2KZMA 4RUCA 4KN7A 5KFRA 2Q0ZX 2XCPA 2FLLA 3RJFA 4F93B 5JUMA 3RJJA 4Z6DA 2ZUCA 2W9BA 4F5OA 4NM2A 2UVUA 9ICVA 4TUPA 7ICLA 4RNMA 4F5QA 3V6KA 1IXRA 1X9WA 4DQSA 5DBBA 3SI8A 2AQ0A 7ICHA 1U45A 1NJWA 1N56A 1L3TA 1JMSA 5L1IA 4EBEA 5KT4A 1SKRA 4XUSA 2ZJAA 5J2FA 4J9SA 5KFDA 3M9OB 1ZYQA 5J0RA 1CUKA 5KG5A 4DOCA 1NOMA 2KN7A 2HHUA 1ZQYA 5IIOA 4RU9A 2BQRA 5DDMA 1L3UA 3RJHA 3M8RA 1Z00A 5CB1A 2NRZA 3ZDEA 1D8LA 1S10A 1NJXA 2ISOA 1T8EA 4J9MA 1T3NA 1X9SA 2ZTEA 2W9CA 1NKBA 1ZQUA 4MF8A 7ICNA 2H5XA 4IRCA 4Q43A 4DF4A 3EW9A 2W9BB 4I2FA 3T5LA 4GXIA 4KMUA 3Q8RB 5J0TA 1SL1A 3MR2A 1QTMA 2RDJA 4J9RA 3ZDBA 5KT3A 1SKSA 4ELUA 9ICAA 2XY7A 2W8KA 3PW2A 1TK8A 4P4OA 4P4PA 5EOZA 5F9NA 5DG7A 1H38A 4QZHA 5KT2A 4KLLA 5J0XA 1Z00B 1XSNA 9ICCA 5J2AA 4EYIB 4KLIA 2W9CB 3UXPA 4TURA 3Q8MA 3GIJA 4UB3A 3LK9A 4J9NA 4NXZA 1HUOA 4I2GA 4F5PA 8ICJA 3UPQA 4P4MA 4C8LA 3TANA 3C2LA 3PO4A 4RQ5A 4ECXA 7ICPA 4C8MA 2UVWA 3ZD8A 4B9TA 1NK7A 4RNOA 1L3SA 3K4GA 3AUOA 4O3QA 1NK6A 4F4XA 3RTVA 4DL2A 1QSSA 1MSWD 3PV8A 3GIKA 3PR4A 1TV9A 4P2HA 3PW5A 3T5HA 2AGOA 1U47A 3B0YA 1HJPA 4RQ1A 5KFBA 4M04A 7ICJA 1TFRA 5J0WA 4MEXA 4DFJA 3RBDA 9ICGA 4JWMA 4KLMA 3OSNA 4JV0A 4RQ7A 3OJUA 3OJSA 4O0IA 4QWDA 4JUZA 3UXNA 5KFQA 4ECQA 3V7LA 2MAXA 5HHHA 4KLEA 1JX4A 1D9DA 4UB4A 3Q8SB 5KFSA 3LWMA 2W9MA 3HP6A 3OSPA 7ICKA 1RZTA 3JPRA 2W9AA 4JWNA 5IIJA 1A77A 4PGQA 3MDAA 1KFTA 1WCNA 3PR5B 4IRDA 5KFFA 4UQGA 2XC9A 4ED3A 4KLOA 3RH6A 4EZ6A 1S9FA 4O3SA 2PFQA 2AGPA 5J2EA 1JXEA 3ZDCA 2KZ3A 4C8KA 4Z6FA 5IIKA 2R8HA 3Q8PB 3T5KA 2RDIA 2IMWP 3KTQA 2HW3A 1XU4A 4ED0A 4DL3A 1TK0A 3LWLA 4M0AA 4RT2A 3MGIA 5KFVA 4YMMA 4F4YA 2XO7A 3ISDA 4KTQA 4RZRA 3Q8KA 5DB8A 1ZQZA 4I2IA 3TARA 1D9FA 4R66A 4F5RA 3PMLA 1TAQA 2KTQA 3RB3A 4EZ9A 2C28A 4I2AA 7ICQA 2IHMA 4QZBA 2HVHA 5KFLA 5KG4A 5J0SA 4M9HA 5DB7A 5KT6A 1ZQVA 3RH5A 5IILA 3OGUA 4YMNA 1MC8A 2ZJ8A 4BWMA 2JEJA 2J6UA 1KEJA 3MR3A 1JN3A 2VA3A 1BVSA 4F4KA 1KTQA 4YD1A 2P6RA 5CJ7A 2ATLA 3V7JA 9ICEA 4YQWA 4FS1A 5TZVA 3EPIA 1S76D 5KTQA 2BKEA 5KG0A 2AQ4A 4QWAA 3GILA 3ORYA 4K4HA 5DB9A 3PY8A 2J6SA 2BR0A 2PFOA 4UAWA 3RJKA 5D4BA 9ICUA 3M8SA 2ASDA 1QSLA 2ISPA 5KFXA 1ZQMA 4R64A 4FBTA 1ZQDA 4KITB 5KFPA 5IIMA 2BPFA 3FYHA 2Y1JA 2HHQA 3IHQB 3RH4A 2HHXA 5DQIA 4DL4A 1WCLA 5HMMA 2XY6A 5L1LA 2DPJA 1XC9A 1ZQLA 2ZTDA 4X5VA 1ZQNA 4YCXA 4DSKA 1NJYA 4PGXA 5KFCA 5DGAA 1XO1A 3PMNA 1SKWA 2XGQA 4JV1A 4I2JA 3SZ2A 3Q8LA 4B9LA 2BCQA 1S97A 4M9JA 4ECYA 2V4RA 1SL0A 2AGQA 4QZ9A 4QZAA 5L9XA 5J2DA 3HT3A 3JPPA 3JPQA 4EBCA 2C22A 2BHNA 4TUQA 4RQ8A 5KFTA 3ETLA 4YP3A 3H4DA 2W8LA 4DFKA 1RYRA 8ICQA 8ICPA 4DSLA 3G6VA 3C23A 5KFGA 5KFMA 5J2BA 3QEBZ 9ICWA 4PHDA 4MF2A 4J9KA 4QZ8A 3H7IA 1ZQOA 1ZQPA 2ZTCA 5KG1A 3V7KA 2BQUA 1BGXT 3AU2A 4GXKA 4ED2A 3PW4A 1KDHA 1ZQAA 4B9MA 2HHTA 3PVXA 4B9SA 1COOA 2BCVA 2FMSA 8ICNA 1JIHA 8ICEA 9ICQA 3SV4A 9ICBA 1TKDA 4I2HA 4KLJA 5CP2A 4BWJA 9ICFA 2ASLA 4PHPA 4ECZA 3QZ8A 2LYHA 8ICCA 2HHWA 7ICOA 2BGWA 4QZFA 3PO5A 9ICOA 4RQ2A 2P6UA 5BOLA 1L5UA 2ZUBA 1NKCA 4RPXA 4ECUA 3MFHA 2BQ3A 2PI5A 4IR9A 4ED6A 1NK8A 4I2CA 2HVIA 1S0OA 1V9PA 3TAQA 4DS4A 3G6YA 5KFJA 4RQ6A 1B22A 4M9NA 1AROP 1KFDA 2R8IA 8ICFA 2JEFA 1ZQWA 4TQRA 4QW9A 4QWBA 4YD2A 2JZBB 5KFUA 1LV5A 2FMPA 1KSPA 3UXOA 2MUTA 4I2BA 3C1YA 4EYHB 2OWOA 5CHGA 2JEIA 2FLNA 4RPZA 1X9MA 3PW0A 4O5EA 4F91B 4F3OA 4DQQA 3MBYA 3TQ1A 5IIIA 3C2MA 2HHSA 4DQPA 9ICKA 3T5JA 4F2RA 3HPOA 5CWRA 1BPXA 4NLKA 9ICJA 1BPBA 4XA5A 1NK5A 4DEZA 8ICUA 2B21A 4ECRA 1S0VA 4M9GA 4NY8A 1S0MA 2DFLA 2ZJ5A 7ICMA 1Z3EB 3OHBA 2C2DA 4ED7A 2I9GA 4E0DA 1RXWA 2KFZA 3QE9Y 5J0PA 4DSEA 1KLNA 1T7PA 1UT5A 2BCRA 4KLQA 4UAYA 8ICXA 1U9LA 3C5FA 1ZQGA 5KFNA 1XS9D 8ICMA 8ICIA 4DL7A 2MUTB 4DF8A 3UQ2A 3FDSA 4YXJA 4F5NA 7ICGA 5J2HA 4C8NA 2Y1IA 2NRXA 2VANA 2FPLA 2VA2A 4I29A 8ICHA 4MFAA 4DLGA 1ZQBA 4Z6EA 4RNNA 4QW8A 3KHHA 3EYZA 3PNCA 3C2KA 4O5KA 4KLSA 4RQ3A 4IR1A 4QZGA 2VA8A 4ED1A 2C2EA 3K75D 5DLGA 4UB1A 1ZJMA 3N97B 4NM1A 3C1ZA 5KT7A 1BPZA 8ICOA 3T3FA 2BDPA 1BPDA 2F1IA 4ZH4A 3QEAZ 3G6XA 4BXOB 4FS2A 3GV8B 1MQ3A 3MR6A 4UB2A 5D49A 5KFHA 2F1JA 4Q8FA 5KFIA 1ZETA 4F4WA 4TQSA 4IRKA 3TAPA 3N4MB 3M9MB 5KT5A 4O9MA 5J0OA 3Q8QB 3RAXA 2UVRA 3V72A 1XSLA 4ECVA 3ISBA 5HNKA 1SZPA 5L1JA 4GC7A 2BPGA 2NRWA 5EWFA 4LVSA 5KFAA 5HP4A 1ZQFA 2AJQA 7ICFA 1ZQTA 8ICSA 4PGYA 4YG2A 7ICTA 1IM4A 4DOAA 1X2IA 4J9LA 1RYSA 1BPYA 3SYZA 5J2CA 3GV7B 2M9NA 5DQHA 1K1SA 4QWEA 4YR2A 3UQ0A 3ZDDA 1KRPA 4DSFA 3ZDAA 3HWTA 3HX0A 8ICBA 3E2EA 4F2SA 4KLUA 4LZGA 3QZ7A 3BQ2A 2FLPA 3RR7A 4IQWA 5KG6A 5EWGA 3PX6A 2PFPA 1RPLA 4B9UA 4DFPA 4FBUA 4ELVA 4YR3A 4DQRA 3ZD9A 4YVZA 3KHLA 4Q44A 2IA6A 8ICTA 1ZQKA 5J0QA 8ICRA 2V4QA 4FO6A 8ICKA 1ZQSA 1QSYA 1D8YA 1CEZA 4Q8EA 4RQ0A 5J2JA 4IQUA 4DWIA 1SL2A 2NRVA 3NTUA 9ICPA 5DBCA 4I2EA 5IINA 3HW8A 1U48A 2R8KA 3IM1A 2WTFA 1DGSA 4DO9A 3KHRA 2IBKA
chains in the Genus database with same CATH superfamily
4QZDA 1L8LA 4M47A 1UT8A 4Q45A 2JZBA 1SB3C 4C0ZA 4DSIA 1C20A 3WKDA 5ALJA 4C8OA 4ACOA 2G07A 4EEYA 4P0QB 2IOFK 2PI4A 5KFOA 3S6JA 2EDUA 2W3SA 2B0CA 3RR8A 3F53A 5L1KA 4LJXA 3RRHA 2A1JA 2F1HA 5CR0A 5DGBA 4KLTA 4IQVA 1NKEA 4DSJA 2IA6A 1O08A 2XCAA 3CYMA 4HYKA 4YR0A 3TFSA 4R8UA 2YB1A 4KN4A 5J2IA 4PH5A 3MDCA 2WB1C 1X9XA 2P66A 2KFNA 1PZNA 4B9NA 4K4GA 4F4ZA 2EQYA 3LVVA 2ALZA 2CRXA 3IG5A 5HR7A 4QZCA 4F8RA 4MEYA 5KFEA 4DOBA 5G5HA 3CNHA 5KG3A 2KJ5A 4DLEA 2BCSA 9ICHA 4M6WB 1PK3A 5BOMA 3BDPA 1DOQA 1V85A 1K1QA 1PUZA 7ICEA 5ALMA 2OM6A 1ZJNA 5GTIU 3GQCA 3SR6A 5KNIA 1B43A 2HSZA 4UBBA 4FE3A 3C5GA 1TK5A 1BPEA 1TAUA 2BPCA 5DDYA 2E1EA 4RQMA 1L3VA 4BDPA 4GXJA 1ZQRA 3RRGA 1JROA 4UBCA 3V6JA 2DWQA 3B0XA 2XCPA 4F93B 5JUMA 3C28A 4CGZA 3NRZA 2EH9A 1IXRA 3SI8A 2AQ0A 3O0FA 1U45A 5L1IA 4XUSA 5AKKA 3SD7A 5KFDA 1WUDA 4DOCA 4C4TA 2HHUA 3D2SA 1Z00A 5CB1A 1D8LA 1J2NA 1T8EA 4MF8A 4IRCA 2K8BB 2QLTA 4UB6U 4DCCA 2KG5A 3EW9A 2W9BB 2KJ8A 2E3TA 4GIBA 3IP4B 1SKSA 1T3QA 2HBLA 2M0NA 5AI5A 4P4PA 2ZIVA 3H0RB 3SMVA 2ZIXB 2K4IA 2W9CB 4QJFB 2KSOB 3LK9A 4J9NA 3IRUA 1HUOA 4F5PA 5ALHA 8ICJA 1SWWA 7ICPA 4C8MA 3ZD8A 4B9TA 4RNOA 4O3QA 2F8KA 5H2FU 4F72A 1QSSA 3IN5A 2KK0A 3GIKA 2G09A 4NL9C 1JUDA 1Q3UA 4Y2QA 2DKZA 2DF4B 2AGOA 4RQ1A 5J0WA 2EANA 3BS7A 4QWDA 4ECQA 4KLEA 4CF4A 1D9DA 4UB4A 3CP8A 3Q8SB 7ICKA 2W9MA 3JPRA 2W9AA 1SV0C 3MDAA 2EZYA 1KFTA 5KFFA 2XC9A 5ALLA 5L1MA 3J81j 1JXEA 2HI0A 1UCVA 2R8HA 3Q8PB 3MGIA 4YMMA 4F4YA 3TARA 1D9FA 4F5RA 1GO3F 1M6YA 3WK6A 3PMLA 3RB3A 4EZ9A 2OCEA 2OHFA 2ZIWB 1ZQVA 2K60A 5AIAA 1RM6C 3WK5A 2J6UA 1SZHA 1KEJA 1JN3A 1BVSA 4YQWA 5TZVA 3D2QA 3VCBA 2AQ4A 5DB9A 3PY8A 2PFOA 3RJKA 4UAWA 9ICUA 1F5SA 3M8SA 2ASDA 2ISPA 5KFXA 4KITB 5KFPA 3FYHA 5E79U 2HHQA 2MRLA 1NZBA 3N28A 2W11A 3AN1A 2DPJA 1XC9A 1WYGA 3LVWA 3N7SC 5DGAA 2XGQA 4I2JA 4ECYA 2EZXA 1SL0A 4QZ9A 5L9XA 5AI4A 5KFTA 4EENA 2ZTCA 5ALIA 1ZQAA 4GXKA 1X6JA 4B9MA 3AL0B 3PVXA 2FI1A 4B9SA 1JIHA 1N2XA 4I2HA 4PHPA 7ICOA 2LYHA 5AM3A 4QZFA 2HDOA 3PSTA 4U7CA 4I27A 4CF3A 1NK8A 2HVIA 2LM4A 3TAQA 2HOQA 5KFJA 2AXTU 4TQRA 1ZQWA 4OD0A 4QW9A 3F5EA 3UXOA 2MUTA 5K4LA 2OWOA 4O5EA 3C2MA 1X66A 2KVSA 5AKEA 5CWRA 1RYUA 1BPXA 1N62A 4OJPA 4UATA 1NNLA 8ICUA 2B21A 1ZRMA 4M9GA 1S0MA 2DFLA 1FEZA 4Y2TA 4AYBC 2BCRA 4KLQA 4UAYA 3C5FA 4YXJA 1P7DA 3M6ZA 8ICHA 2FPLA 4I29A 4KLSA 3EYZA 4QZGA 4ED1A 1HEKA 3C1ZA 3FC4A 1BPZA 2BDPA 2YMQA 3QEAZ 1MQ3A 5D49A 1IV8A 2PMZF 1L7OA 4UAVA 2UVRA 3Q8QB 4ECVA 1ED1A 4LVSA 2AJQA 7ICFA 1X42A 4ICAA 4PGYA 8ICSA 4Y2JA 1X2IA 3UM9A 2Y9UA 5DQHA 4YR2A 3ZDDA 8ICBA 2WF9A 1Z4OA 2HMXA 2FLPA 5T14A 1DRGA 2PFPA 1RPLA 4FBUA 4DFPA 3KHLA 4P0QA 1ZQKA 5J0QA 2V4QA 4FO6A 8ICKA 1QSYA 1CEZA 4Q8EA 3FM9A 4IQUA 2RQ5A 3SEIA 3F5AA 1KQQA 4I2EA 5IINA 1U48A 3OTQA 3IM1A 5KG7A 1U49A 3TACB 1N61A 2HBKA 2PXIA 1UA0A 4RUAA 3KKAA 4TUSA 1LVHA 4RPYA 4I2DA 1ZQIA 8ICWA 3RBEA 3M9NB 2BDUA 1ZQHA 1HUZA 3EZ5A 5AK4A 1KFSA 7ICIA 3FAHA 1XWLA 1BNOA 4XQ8A 1YZ6A 1NJZA 4I28A 2XI9A 8ICZA 1A76A 4K4IA 3GIIA 3QX7A 1ZQJA 4ECWA 1S0NA 5DKWA 3BQ1A 4QZIA 5ALTA 4ECTA 3QUTA 2E8MA 1K5OA 1C7YA 4G3IA 3TFRA 5ALWA 2XGPA 3PX0A 3RB6A 4O3PA 4UAZA 3RB0A 4M6WA 1URJA 3KZXA 2YMMA 1S77D 1J97A 3NGDA 2GWSA 1T94A 5KG2A 2NV3A 2J6TA 1Z1BA 4Z6CA 5DG8A 3DEEA 2JEGA 2JH7A 4NLZA 1KBUA 1LB2B 3B9JA 1QLNA 4YN4A 2VKQA 5DQGA 3SV3A 3LDAA 1Z4NA 2Y0SC 2MU2A 1ZQXA 3I76A 1N48A 2KEYA 3THVA 2BCUA 4R65A 2E8PA 2N1RA 3GV5B 1N5WA 4ED8A 3V6HA 2IHNA 5HHIA 4ECSA 2K8CB 1OW5A 8ICGA 4J9QA 4O3OA 1UA1A 8ICYA 5DG9A 3KD3A 1XSPA 4DL6A 1ZQCA 3BQ0A 5ALKA 5F9LA 4YMOA 4O5CA 7ICSA 3H8JA 3SAHA 1V97A 2FPMA 1Q46A 1L7MA 5TISU 3C29A 1QCKA 3I1YA 1X6IA 5KFRA 2Q0ZX 2FLLA 3RJFA 5G5GA 2ZUCA 2W9BA 5FP0A 4NM2A 3ETRA 1X9WA 4DQSA 5DBBA 7ICHA 1JMSA 1SKRA 3BS5B 5J2FA 5KG5A 1NOMA 2JMGA 2BQRA 5DDMA 1L3UA 2ZIXA 1S10A 1Q8KA 1T3NA 2WB1F 1X9SA 2W9CA 1NKBA 1ZQUA 2KSOA 7ICNA 4P0PB 2H3QA 4Q43A 4DF4A 1S8OA 4GXIA 3PSPA 4KMUA 2IBKA 5J0TA 3MR2A 1QTMA 4J9RA 4OJLA 1V38A 9ICAA 4CNQA 5ALFA 4P4OA 5DG7A 3WKCA 4KLLA 1PK1A 3AQFA 1FO4A 1L8OA 3A0BU 2VJ4A 3TANA 2QARA 2ODGA 4RQ5A 4ECXA 2UVWA 2WAQC 3AUOA 1NK6A 4F4XA 1MSWD 4IC9A 5AM0A 3PV8A 1XNSA 3F2BA 3PW5A 2KV2A 2CN1A 3B0YA 1HJPA 4MEXA 2AHOB 3OSNA 4RQ7A 3OJUA 4GFJA 3OJSA 3UXNA 4NL9A 1MA7A 2A3VA 2WF5A 3LWMA 3OSPA 2LKYA 1RZTA 4JWNA 4Y2VA 5ALEA 3ED5A 5A0LA 1WCNA 3E0FA 4OJ5A 4O3SA 1HIWA 5J2EA 1YZ7A 2G5HB 1SV0A 1QQ7A 3T5KA 2HW3A 4DL3A 1TK0A 5ALQA 5KFVA 2B6GA 2LBOA 4QNLA 3ISDA 2FE9A 4KTQA 4FZNA 3PSFA 2KTQA 4I2AA 7ICQA 5KFLA 3QU4A 5KT6A 3RH5A 5ALDA 2ZJ8A 3MR3A 4G9BA 1KTQA 9ICEA 1S76D 5KTQA 1JRPA 2BKEA 5KG0A 4QWAA 3GILA 4K4HA 3IDWA 1QSLA 1ZQMA 3WKEA 1ZQDA 2BPFA 3IHQB 3RH4A 4J03A 4DL4A 1WCLA 5HMMA 2XY6A 2ZTDA 4X5VA 1ZQNA 4DSKA 1NJYA 2RLTA 1XO1A 3PMNA 4B9LA 2AGQA 3LYSA 4JMUA 5J2DA 1J2MA 4QZAA 3JPPA 4EBCA 1FIQA 1ZQQA 3H4DA 2W8LA 2KOBA 1RYRA 3G6VA 1DGJA 5J2BA 9ICWA 2K89A 4J9KA 4QZ8A 2OXOA 2ZXHA 5KG1A 3AU2A 2HHTA 2K4HA 1DXSA 1COOA 2F8LA 4CRXA 2GH1A 4FZLA 8ICNA 1Z1VA 2KVCA 5GTHU 3QUBA 3SV4A 4MHVA 1TKDA 4KLJA 5CP2A 1B4FA 1F0MA 3QZ8A 2E8OA 3HKZC 2HHWA 3PO5A 1UQVA 9ICOA 5BOLA 1L5UA 1NKCA 4RPXA 2PI5A 3MFHA 4I2CA 2D3DA 3G6YA 2R8IA 1AROP 4Y2XA 2JR5A 4QWBA 4YD2A 1ZRNA 2JZBB 2ZG6A 4I2BA 4F71A 2JEIA 2F44A 3PW0A 4F91B 5IIIA 9ICKA 3T5JA 4F2RA 4NLKA 4XA5A 2NYVA 1FFVA 2CXYA 4NY8A 2ZJ5A 1Z3EB 3OHBA 4Y2SA 4DFDA 5CEHA 4ED7A 2I9GA 3SQIA 4E0DA 3QE9Y 5J0PA 4DSEA 1T7PA 1UT5A 3BQ7A 2ZIUB 1ZQGA 1XS9D 8ICIA 3F2CA 3GU3A 3NS1A 2Y1IA 4C8NA 2W7PA 2VANA 3BZCA 1ZQBA 4Z6EA 4RNNA 3C2KA 4O5KA 4NM1A 5DLGA 8ICOA 3T3FA 4BUGA 2F1IA 3G6XA 4UASA 2ZXIA 5KFHA 2F1JA 3K1ZA 3QU2A 1SGGA 3PSIA 5J0OA 1SZPA 4GC7A 1ZQFA 5HP4A 1ZQTA 4YG2A 3SYZA 4OO1J 3NVWA 4QWEA 5ALVA 3ZDAA 2YB4A 3HWTA 3HX0A 4LZGA 5EE3A 4IQWA 4YR3A 4DQRA 3ZD9A 2JGAA 8ICTA 2DBYA 2QKQA 3L4PA 1D8YA 4US9A 3RFAA 3WK7A 5J2JA 2YQEA 5ALSA 3NTUA 2WF8A 5DBCA 3KHRA 2QB1A 2WFAA 5D46A 4PHEA 3EWAA 3TI0A 4UARA 2KKPA 4PPXA 3ALRA 5HR6A 2C2RA 2BZFA 4QWCA 3DV9A 2AU0A 4DL5A 3PX4A 1ZQ1C 1U4BA 2DL0A 3RB4A 1F44A 4R63A 5AM4A 3MR5A 3H8MA 4RQNA 3RF9A 4EBDA 4M2YA 3RAQA 4NLGA 3JPSA 2F2AB 5ALNA 2LYAA 2JHDA 3KBBA 5KAFU 2HOFA 4UAUA 2LPEA 2NRTA 2VJ5A 3TKAA 4BXOA 5HMLA 3BQTA 1KN5A 5J8YC 5KFWA 2ZIVB 2ZUDA 9ICMA 1TVAA 5J2GA 4PZOA 3EPGA 7ICVA 5J2KA 2KZZA 3RJGA 1X40A 4UB8U 3ISCA 4HAIA 4M9LA 9ICIA 9ICNA 3MGHA 3NUQA 5AK3A 1B0XA 5B66U 2GO7A 2QB0A 4LZDA 3KHGA 9ICTA 3GDXA 4KLDA 1TE2A 3H4BA 4MFCA 5AKJA 2V9WA 5J29A 3H0MB 2D8CA 4O3MA 2LI6A 5EWEA 5KL1B 4JV2A 1CI4A 8ICAA 1RXVA 4J9PA 4DFMA 9ICRA 1A6SA 4QIWC 1RQNA 3AMZA 5KFYA 4NLNA 2RP5A 3WK4A 2KZMA 4RUCA 4KN7A 4P0PA 3RJJA 1LKYB 4Z6DA 1PVQA 1OXJA 9ICVA 7ICLA 4RNMA 4F5QA 2KIVA 2H3FA 1N56A 5ALUA 1L3TA 1N63A 3ONNA 4J9SA 4WJ3B 1ZYQA 2JXJA 5J0RA 1CUKA 2KICA 4RU9A 5IIOA 3QYPA 3MGVA 3M8RA 2NRZA 3ZDEA 1NJXA 1ZD4A 3L5KA 2ISOA 3WKAA 1KW4A 2F77X 1RG6A 2LM1A 2G08A 2H5XA 2P35A 3ZI4A 5ALOA 4NJ8A 1IIPA 2GOLA 3Q8RB 1SL1A 3M6KA 2PMZC 4OJOA 2KE7A 2RDJA 1CRXA 3PW2A 3D6JA 1TK8A 5EOZA 5F9NA 4QZHA 3QNMA 1XSNA 2KMDA 1Z19A 2Y0SF 2F76X 3WK8A 4TURA 4NXZA 4P4MA 3C2LA 1S5LU 1NK7A 3K4GA 5AKIA 4DL2A 3PR4A 4AP9A 4M04A 1WG8A 4DFJA 3RBDA 9ICGA 4C7ZA 4JV0A 3NRWA 5KFQA 3V7LA 2MAXA 1JX4A 3ICXA 5KFSA 3HP6A 1A77A 5IIJA 4PGQA 2HBJA 1BNPA 4UQGA 2EAPA 4ED3A 4IL6U 3N7RC 1S9FA 2CPRA 3ZDCA 5CRXA 2KZ3A 1PVRA 4Z6FA 5IIKA 2RDIA 2IMWP 4EX7A 4ED0A 3LWLA 4M0AA 3MC1A 1SIJA 2W04A 3Q8KA 1ZQZA 4I2IA 2KD1A 1TAQA 2E5SA 1JI7A 2C28A 3PZPA 4QZBA 2HVHA 2AH5A 5DB7A 5IILA 3OGUA 1RDFA 4YMNA 2DQNB 2JEJA 4BJQA 4YD1A 2ATLA 3EPIA 5AI6A 2LYBA 2YY6A 3OPXA 1QH9A 2G06A 4Y2UA 4C7YA 2J6SA 2BR0A 1ECWA 3QU7A 4R64A 5IIMA 2Y1JA 2XVTA 5DQIA 4ZOHC 3TADC 5ALYA 2EAOA 2YX8A 5L1LA 2WAQF 4EEKA 4YCXA 4PGXA 1SKWA 4M9JA 3Q8LA 5AICA 2V4RA 3N7PD 2C22A 4TUQA 3NVYA 8ICPA 4DSLA 5KFMA 3QEBZ 4OJ6A 4PHDA 3BZKA 1ZQOA 1ZQPA 3PW4A 1KDHA 4C4RA 2JV3A 8ICEA 9ICQA 2K8AA 3R9KA 4BWJA 2W55A 5AHXA 4Y2RA 2ASLA 4ECZA 8ICCA 5AI0A 1L7PA 4RQ2A 2BQ3A 4ECUA 4IR9A 1FFUA 1V9PA 4DS4A 4M9NA 2GLEA 2NO4A 1LV5A 2ZIUA 5AKHA 2KP7A 3C1YA 5CHGA 1X9MA 3AQEA 4F3OA 4DQQA 3TQ1A 4DQPA 3HPOA 4DEZA 2H3VA 1ZD3A 1S0VA 2YTUA 7ICMA 4CDGA 2C2DA 3I28A 2KFZA 2W7OA 1KLNA 1U9LA 2ZIWA 5KFNA 3T79A 4FZMA 3UMGA 3UQ2A 3FDSA 7ICGA 5J2HA 4MFAA 4DLGA 2EAMA 2KKVA 2C2EA 8ICVA 1ZJMA 1SXEA 5KT7A 4US8A 3MR6A 2VIXA 4UB2A 4PJ0U 3DDHA 4IRKA 3TAPA 3N4MB 2KHQA 2XICA 2OYYA 5KT5A 5AKLA 3K1RB 1XSLA 3ISBA 5HNKA 4NWIA 3M1YA 5KFAA 3CRXA 7ICTA 4DOAA 4J9LA 5J2CA 3GV7B 2M9NA 3QUQA 3UQ0A 4OCZA 4DSFA 5ALZA 3NASA 3E2EA 5ALGA 1VDVA 3HKZF 3QZ7A 1A0PA 3BQ2A 5KG6A 5EWGA 4ELVA 4YVZA 3WKBA 4Q44A 8ICRA 1ZQSA 1ZD2P 1SL2A 1KL9A 2NRVA 4KX5A 1OUQA 3HW8A 2W3RA 1DGSA 3C21A 1QQ6A 9ICSA 4KLHA 1NK4A 4UB5A 1T4GA 3MABA 4F92B 3RJIA 4CCHA 1UHUA 5KFKA 4KLGA 1WWVA 3QUCA 2XY5A 2HHVA 1ZQEA 1ZOLA 2W03A 1N5XA 3H8SA 4MFFA 3HRDD 2DKXA 2PFNA 1Y88A 8ICLA 4XRHA 4QZEA 3WU2U 4NLBA 5CA7A 2ASJA 2E1FA 4IS7A 4BGDA 2K4PA 4B6JA 4YXMA 2FJ6A 3H8WA 5BPCA 2Q4TA 3H40A 7ICRA 4KX3A 9ICLA 1EXNA 5DBAA 1COKA 4Y2PA 5JU5A 2KHVA 8ICMA 3UMCA 2UVVA 5JTIA 9ICXA 1Q3VA 4JK1A 4J9OA 2A1JB 5KFZA 1PK1B 5J0UA 4NV0A 3JPOA 1MQ2A 3NVZA 4RT3A 3JPTA 5J8YA 4DS5A 2QARB 5AK5A 2R8GA 4NLCA 4CF5A 5DLFA 3MFIA 1NK0A 4KLFA 5AIBA 4GLXA 4R8UB 3BJYA 2WHEA 1JXLA 4DQIA 4F50A 2W43A 2FDRA 3GIMA 2Y9TA 4RQ4A 2I1QA 4IQTA 2W54A 5AKZA 5C5JA 3PW7A 5DB6A 1LKYA 2DUYA 3JPNA 3GFKB 3OHAA 2R8JA 2F3NA 5F3XB 4ELTA 4O3NA 3RJEA 4PHAA 1IG6A 7ICUA 2FPKA 5J0YA 2DPIA 1D8BA 4GC6A 3AU6A 2FMQA 4B9VA 4YFKA 2LMRA 4O3RA 1NK9A 5AM2A 4PL1A 4F5OA 2UVUA 4TUPA 1PVPA 3V6KA 1O03A 1NI3A 1NJWA 4EBEA 5KT4A 2WF7A 3KZIU 2ZJAA 3M9OB 3A0HU 4A8EA 2KN7A 1ZQYA 3RJHA 5AK6A 4J9MA 2ZTEA 4AYBF 3AEVA 3L3FX 4I2FA 3T5LA 2NO5A 3ZDBA 5KT3A 4ELUA 2XY7A 2IOHA 2W8KA 1VLBA 2OH2A 1H38A 3KOOA 5KT2A 5J0XA 1Z00B 1NZPA 9ICCA 5J2AA 4EYIB 4KLIA 2G0AA 3UXPA 3F2DA 3Q8MA 3GIJA 4UB3A 4I2GA 3UPQA 1N60A 4C8LA 3PO4A 2MSNA 2E8NA 3WK9A 1L3SA 3RTVA 2HCFA 2KNJA 1TV9A 2R18A 2YMPA 4P2HA 3EUB2 4EX6A 1YT3A 3T5HA 1U47A 4USAA 3UMBA 3SAFA 5KFBA 4QIWF 7ICJA 1TFRA 1SXDA 4JWMA 4KLMA 5AM5A 4O0IA 4JUZA 2O6KA 4UW9A 4CE6A 5HHHA 5C0YA 4U6PA 1SV4A 1VJ5A 1MN8A 3SAGA 4BX9C 3PR5B 4IRDA 4KLOA 3RH6A 4EZ6A 2YMLA 2PFQA 2AGPA 5KAIU 4C8KA 3E58A 2I6XA 3KTQA 1XU4A 4RT2A 2XO7A 4RZRA 5DB8A 5ALRA 4R66A 1SWVA 3BS5A 2IHMA 1QQ5A 5KG4A 2KIWA 5J0SA 4M9HA 1KKXA 1MC8A 4BWMA 2VA3A 4F4KA 2XIDA 2P6RA 5AKXA 5CJ7A 3V7JA 4FS1A 1JALA 3NVVA 3ORYA 2LHTA 5EE1A 5D4BA 4FBTA 4FFDA 5EE9A 2HHXA 4JB3A 5AI8A 1ZQLA 2D6FC 5KFCA 4JV1A 2KJ9A 3SZ2A 2BCQA 1S97A 4PZNA 1AQ6A 3JPQA 3TADA 3HT3A 2BHNA 4RQ8A 3ETLA 4YP3A 4DFKA 2JRZA 8ICQA 3C23A 2PKEA 5KFGA 3VC8A 4MF2A 3GZFA 3H7IA 2DGZA 2ES6A 3V7KA 2BQUA 1BGXT 2RRDA 4ED2A 1ZXIA 5ALXA 2BCVA 3M7DA 2FMSA 1TAMA 1L7NA 9ICBA 3QU5A 3QU9A 9ICFA 1UPHA 4Y2YA 4PL2A 2BGWA 2Z7JA 2P6UA 2ZUBA 4ED6A 1S0OA 2G5IB 1B22A 4RQ6A 3HILA 1KFDA 2ESEA 2H3IA 2JEFA 8ICFA 5ALPA 5KFUA 2FMPA 1KSPA 4EYHB 2FLNA 4RPZA 5AI9A 3MBYA 2HHSA 2H3ZA 5AKGA 4EELA 9ICJA 1BPBA 1XO0A 1NK5A 5EE0A 4ECRA 4KMOB 3IG8A 1RXWA 8ICXA 4C4SA 1DK3A 5AM1A 5JRTA 2MUTB 4DL7A 4DF8A 2OEHA 4F5NA 3H0LB 2NRXA 2VA2A 4QW8A 3KHHA 3PNCA 2YN4A 4RQ3A 4IR1A 1WWUA 2VA8A 3K75D 4UB1A 3N97B 2A1AA 2HBMA 1BPDA 4ZH4A 2IOFA 4BXOB 4FS2A 3GV8B 5KL8B 3SENA 4Q8FA 5KFIA 1ZETA 4F4WA 4TQSA 3AM9A 2HOIA 3M9MB 2I5HA 2L5YA 4O9MA 3RAXA 3V72A 1DK2A 5L1JA 4C80A 2BPGA 1ZD5A 2NRWA 5EWFA 3KFUF 2JH1A 3HJEA 1IM4A 1RYSA 1BPYA 1K1SA 1RQLA 1KRPA 5B5EU 2RHFA 4F2SA 4KLUA 2A19A 3RR7A 2QB0B 2EZZA 3PX6A 1L6NA 4B9UA 2MA1A 3CW2C 4RQ0A 4DWIA 3U26A 5AKYA 2K4EA 9ICPA 2WF6A 3QXGA 3D2NA 2R8KA 2WTFA 4DO9A 3IV6A 3KKAC
chains in the Genus database with same CATH topology
3C21A 4QZDA 5KG7A 1U49A 5D46A 4KLHA 9ICSA 4M47A 1UT8A 1NK4A 4Q45A 4PHEA 4UB5A 1T4GA 1UA0A 3MABA 2JZBA 3EWAA 4F92B 2PXIA 3TI0A 3RJIA 4CCHA 4DSIA 4C8OA 5KFKA 4PPXA 4KLGA 4RUAA 4EEYA 4TUSA 2C2RA 2PI4A 5KFOA 4RPYA 4QWCA 4I2DA 2XY5A 2AU0A 2HHVA 1ZQEA 1ZQIA 4DL5A 3PX4A 8ICWA 3H8SA 4MFFA 3RBEA 3M9NB 1ZQHA 1U4BA 3RR8A 1HUZA 3EZ5A 3RB4A 1KFSA 7ICIA 2PFNA 1Y88A 5L1KA 8ICLA 4XRHA 1XWLA 4QZEA 4R63A 4XQ8A 3MR5A 3RRHA 2A1JA 5CA7A 2ASJA 1NJZA 2F1HA 4I28A 5DGBA 5CR0A 4BGDA 8ICZA 4KLTA 1A76A 4K4IA 3GIIA 4IQVA 1NKEA 1ZQJA 4DSJA 4YXMA 4EBDA 4ECWA 1S0NA 5DKWA 3BQ1A 3H8WA 4QZIA 3RAQA 5BPCA 4M2YA 4NLGA 3JPSA 4ECTA 2XCAA 3H40A 7ICRA 1C7YA 9ICLA 4HYKA 1EXNA 4YR0A 3TFSA 5DBAA 4G3IA 3TFRA 4I27A 2XGPA 3PX0A 4R8UA 3RB6A 4O3PA 4UAZA 3RB0A 2NRTA 5J2IA 4KN4A 4M6WA 2UVVA 5HMLA 4PH5A 4BXOA 3BQTA 3MDCA 1ZQQA 1S77D 9ICXA 3NGDA 4JK1A 8ICVA 4J9OA 2A1JB 2GWSA 1PZNA 5KFZA 5KFWA 2P66A 2KFNA 5KG2A 2ZUDA 9ICMA 5J0UA 1TVAA 2J6TA 4F4ZA 5J2GA 4B9NA 4K4GA 2ALZA 3EPGA 4Z6CA 7ICVA 5J2KA 2KZZA 3JPOA 3RJGA 4QZCA 5DG8A 1MQ2A 2JEGA 4RT3A 4F8RA 3ISCA 3JPTA 4MEYA 5KFEA 4M9LA 4NLZA 4DS5A 9ICIA 9ICNA 4DOBA 2R8GA 1LB2B 5DLFA 3MFIA 1NK0A 4KLFA 5KG3A 4DLEA 4GLXA 2BCSA 3MGHA 4R8UB 1QLNA 3BJYA 9ICHA 4YN4A 5DQGA 4M6WB 1JXLA 4DQIA 5BOMA 4F50A 3SV3A 3BDPA 1DOQA 3LDAA 4LZDA 3KHGA 1K1QA 9ICTA 1ZQXA 3GDXA 4KLDA 1N48A 7ICEA 3GIMA 4RQ4A 2I1QA 4IQTA 5C5JA 3H4BA 3PW7A 3THVA 1ZJNA 4R65A 2BCUA 4MFCA 5DB6A 3GV5B 4ED8A 3GQCA 3V6HA 2IHNA 5J29A 5HHIA 4ECSA 3JPNA 2V9WA 1B43A 3GFKB 3OHAA 4UBBA 8ICGA 4J9QA 3C5GA 1TK5A 2R8JA 1BPEA 5EWEA 1TAUA 4JV2A 2BPCA 5DDYA 4ELTA 8ICAA 4O3NA 1RXVA 1L3VA 4PHAA 4O3OA 1UA1A 3RJEA 4BDPA 7ICUA 8ICYA 5DG9A 4J9PA 4DFMA 9ICRA 2FPKA 1XSPA 4GXJA 5J0YA 4DL6A 1ZQCA 2DPIA 1ZQRA 4GC6A 3BQ0A 3RRGA 4UBCA 3V6JA 5KFYA 3AU6A 5F9LA 4YMOA 4NLNA 4O5CA 7ICSA 2FMQA 3H8JA 4B9VA 3B0XA 2FPMA 4YFKA 4O3RA 1NK9A 2KZMA 4RUCA 4KN7A 5KFRA 2Q0ZX 2XCPA 2FLLA 3RJFA 4F93B 5JUMA 3RJJA 4Z6DA 2ZUCA 2W9BA 4F5OA 4NM2A 2UVUA 9ICVA 4TUPA 7ICLA 4RNMA 4F5QA 3V6KA 1IXRA 1X9WA 4DQSA 5DBBA 3SI8A 2AQ0A 7ICHA 1U45A 1NJWA 1N56A 1L3TA 1JMSA 5L1IA 4EBEA 5KT4A 1SKRA 4XUSA 2ZJAA 5J2FA 4J9SA 5KFDA 3M9OB 1ZYQA 5J0RA 1CUKA 5KG5A 4DOCA 1NOMA 2KN7A 2HHUA 1ZQYA 5IIOA 4RU9A 2BQRA 5DDMA 1L3UA 3RJHA 3M8RA 1Z00A 5CB1A 2NRZA 3ZDEA 1D8LA 1S10A 1NJXA 2ISOA 1T8EA 4J9MA 1T3NA 1X9SA 2ZTEA 2W9CA 1NKBA 1ZQUA 4MF8A 7ICNA 2H5XA 4IRCA 4Q43A 4DF4A 3EW9A 2W9BB 4I2FA 3T5LA 4GXIA 4KMUA 3Q8RB 5J0TA 1SL1A 3MR2A 1QTMA 2RDJA 4J9RA 3ZDBA 5KT3A 1SKSA 4ELUA 9ICAA 2XY7A 2W8KA 3PW2A 1TK8A 4P4OA 4P4PA 5EOZA 5F9NA 5DG7A 1H38A 4QZHA 5KT2A 4KLLA 5J0XA 1Z00B 1XSNA 9ICCA 5J2AA 4EYIB 4KLIA 2W9CB 3UXPA 4TURA 3Q8MA 3GIJA 4UB3A 3LK9A 4J9NA 4NXZA 1HUOA 4I2GA 4F5PA 8ICJA 3UPQA 4P4MA 4C8LA 3TANA 3C2LA 3PO4A 4RQ5A 4ECXA 7ICPA 4C8MA 2UVWA 3ZD8A 4B9TA 1NK7A 4RNOA 1L3SA 3K4GA 3AUOA 4O3QA 1NK6A 4F4XA 3RTVA 4DL2A 1QSSA 1MSWD 3PV8A 3GIKA 3PR4A 1TV9A 4P2HA 3PW5A 3T5HA 2AGOA 1U47A 3B0YA 1HJPA 4RQ1A 5KFBA 4M04A 7ICJA 1TFRA 5J0WA 4MEXA 4DFJA 3RBDA 9ICGA 4JWMA 4KLMA 3OSNA 4JV0A 4RQ7A 3OJUA 3OJSA 4O0IA 4QWDA 4JUZA 3UXNA 5KFQA 4ECQA 3V7LA 2MAXA 5HHHA 4KLEA 1JX4A 1D9DA 4UB4A 3Q8SB 5KFSA 3LWMA 2W9MA 3HP6A 3OSPA 7ICKA 1RZTA 3JPRA 2W9AA 4JWNA 5IIJA 1A77A 4PGQA 3MDAA 1KFTA 1WCNA 3PR5B 4IRDA 5KFFA 4UQGA 2XC9A 4ED3A 4KLOA 3RH6A 4EZ6A 1S9FA 4O3SA 2PFQA 2AGPA 5J2EA 1JXEA 3ZDCA 2KZ3A 4C8KA 4Z6FA 5IIKA 2R8HA 3Q8PB 3T5KA 2RDIA 2IMWP 3KTQA 2HW3A 1XU4A 4ED0A 4DL3A 1TK0A 3LWLA 4M0AA 4RT2A 3MGIA 5KFVA 4YMMA 4F4YA 2XO7A 3ISDA 4KTQA 4RZRA 3Q8KA 5DB8A 1ZQZA 4I2IA 3TARA 1D9FA 4R66A 4F5RA 3PMLA 1TAQA 2KTQA 3RB3A 4EZ9A 2C28A 4I2AA 7ICQA 2IHMA 4QZBA 2HVHA 5KFLA 5KG4A 5J0SA 4M9HA 5DB7A 5KT6A 1ZQVA 3RH5A 5IILA 3OGUA 4YMNA 1MC8A 2ZJ8A 4BWMA 2JEJA 2J6UA 1KEJA 3MR3A 1JN3A 2VA3A 1BVSA 4F4KA 1KTQA 4YD1A 2P6RA 5CJ7A 2ATLA 3V7JA 9ICEA 4YQWA 4FS1A 5TZVA 3EPIA 1S76D 5KTQA 2BKEA 5KG0A 2AQ4A 4QWAA 3GILA 3ORYA 4K4HA 5DB9A 3PY8A 2J6SA 2BR0A 2PFOA 4UAWA 3RJKA 5D4BA 9ICUA 3M8SA 2ASDA 1QSLA 2ISPA 5KFXA 1ZQMA 4R64A 4FBTA 1ZQDA 4KITB 5KFPA 5IIMA 2BPFA 3FYHA 2Y1JA 2HHQA 3IHQB 3RH4A 2HHXA 5DQIA 4DL4A 1WCLA 5HMMA 2XY6A 5L1LA 2DPJA 1XC9A 1ZQLA 2ZTDA 4X5VA 1ZQNA 4YCXA 4DSKA 1NJYA 4PGXA 5KFCA 5DGAA 1XO1A 3PMNA 1SKWA 2XGQA 4JV1A 4I2JA 3SZ2A 3Q8LA 4B9LA 2BCQA 1S97A 4M9JA 4ECYA 2V4RA 1SL0A 2AGQA 4QZ9A 4QZAA 5L9XA 5J2DA 3HT3A 3JPPA 3JPQA 4EBCA 2C22A 2BHNA 4TUQA 4RQ8A 5KFTA 3ETLA 4YP3A 3H4DA 2W8LA 4DFKA 1RYRA 8ICQA 8ICPA 4DSLA 3G6VA 3C23A 5KFGA 5KFMA 5J2BA 3QEBZ 9ICWA 4PHDA 4MF2A 4J9KA 4QZ8A 3H7IA 1ZQOA 1ZQPA 2ZTCA 5KG1A 3V7KA 2BQUA 1BGXT 3AU2A 4GXKA 4ED2A 3PW4A 1KDHA 1ZQAA 4B9MA 2HHTA 3PVXA 4B9SA 1COOA 2BCVA 2FMSA 8ICNA 1JIHA 8ICEA 9ICQA 3SV4A 9ICBA 1TKDA 4I2HA 4KLJA 5CP2A 4BWJA 9ICFA 2ASLA 4PHPA 4ECZA 3QZ8A 2LYHA 8ICCA 2HHWA 7ICOA 2BGWA 4QZFA 3PO5A 9ICOA 4RQ2A 2P6UA 5BOLA 1L5UA 2ZUBA 1NKCA 4RPXA 4ECUA 3MFHA 2BQ3A 2PI5A 4IR9A 4ED6A 1NK8A 4I2CA 2HVIA 1S0OA 1V9PA 3TAQA 4DS4A 3G6YA 5KFJA 4RQ6A 1B22A 4M9NA 1AROP 1KFDA 2R8IA 8ICFA 2JEFA 1ZQWA 4TQRA 4QW9A 4QWBA 4YD2A 2JZBB 5KFUA 1LV5A 2FMPA 1KSPA 3UXOA 2MUTA 4I2BA 3C1YA 4EYHB 2OWOA 5CHGA 2JEIA 2FLNA 4RPZA 1X9MA 3PW0A 4O5EA 4F91B 4F3OA 4DQQA 3MBYA 3TQ1A 5IIIA 3C2MA 2HHSA 4DQPA 9ICKA 3T5JA 4F2RA 3HPOA 5CWRA 1BPXA 4NLKA 9ICJA 1BPBA 4XA5A 1NK5A 4DEZA 8ICUA 2B21A 4ECRA 1S0VA 4M9GA 4NY8A 1S0MA 2DFLA 2ZJ5A 7ICMA 1Z3EB 3OHBA 2C2DA 4ED7A 2I9GA 4E0DA 1RXWA 2KFZA 3QE9Y 5J0PA 4DSEA 1KLNA 1T7PA 1UT5A 2BCRA 4KLQA 4UAYA 8ICXA 1U9LA 3C5FA 1ZQGA 5KFNA 1XS9D 8ICMA 8ICIA 4DL7A 2MUTB 4DF8A 3UQ2A 3FDSA 4YXJA 4F5NA 7ICGA 5J2HA 4C8NA 2Y1IA 2NRXA 2VANA 2FPLA 2VA2A 4I29A 8ICHA 4MFAA 4DLGA 1ZQBA 4Z6EA 4RNNA 4QW8A 3KHHA 3EYZA 3PNCA 3C2KA 4O5KA 4KLSA 4RQ3A 4IR1A 4QZGA 2VA8A 4ED1A 2C2EA 3K75D 5DLGA 4UB1A 1ZJMA 3N97B 4NM1A 3C1ZA 5KT7A 1BPZA 8ICOA 3T3FA 2BDPA 1BPDA 2F1IA 4ZH4A 3QEAZ 3G6XA 4BXOB 4FS2A 3GV8B 1MQ3A 3MR6A 4UB2A 5D49A 5KFHA 2F1JA 4Q8FA 5KFIA 1ZETA 4F4WA 4TQSA 4IRKA 3TAPA 3N4MB 3M9MB 5KT5A 4O9MA 5J0OA 3Q8QB 3RAXA 2UVRA 3V72A 1XSLA 4ECVA 3ISBA 5HNKA 1SZPA 5L1JA 4GC7A 2BPGA 2NRWA 5EWFA 4LVSA 5KFAA 5HP4A 1ZQFA 2AJQA 7ICFA 1ZQTA 8ICSA 4PGYA 4YG2A 7ICTA 1IM4A 4DOAA 1X2IA 4J9LA 1RYSA 1BPYA 3SYZA 5J2CA 3GV7B 2M9NA 5DQHA 1K1SA 4QWEA 4YR2A 3UQ0A 3ZDDA 1KRPA 4DSFA 3ZDAA 3HWTA 3HX0A 8ICBA 3E2EA 4F2SA 4KLUA 4LZGA 3QZ7A 3BQ2A 2FLPA 3RR7A 4IQWA 5KG6A 5EWGA 3PX6A 2PFPA 1RPLA 4B9UA 4DFPA 4FBUA 4ELVA 4YR3A 4DQRA 3ZD9A 4YVZA 3KHLA 4Q44A 2IA6A 8ICTA 1ZQKA 5J0QA 8ICRA 2V4QA 4FO6A 8ICKA 1ZQSA 1QSYA 1D8YA 1CEZA 4Q8EA 4RQ0A 5J2JA 4IQUA 4DWIA 1SL2A 2NRVA 3NTUA 9ICPA 5DBCA 4I2EA 5IINA 3HW8A 1U48A 2R8KA 3IM1A 2WTFA 1DGSA 4DO9A 3KHRA 2IBKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C21 A;  4QZD A;  5KG7 A;  1U49 A;  5D46 A;  4KLH A;  9ICS A;  4M47 A;  1UT8 A;  1NK4 A;  4Q45 A;  4PHE A;  4UB5 A;  1T4G A;  1UA0 A;  3MAB A;  2JZB A;  3EWA A;  4F92 B;  2PXI A;  3TI0 A;  3RJI A;  4CCH A;  4DSI A;  4C8O A;  5KFK A;  4PPX A;  4KLG A;  4RUA A;  4EEY A;  4TUS A;  2C2R A;  2PI4 A;  5KFO A;  4RPY A;  4QWC A;  4I2D A;  2XY5 A;  2AU0 A;  2HHV A;  1ZQE A;  1ZQI A;  4DL5 A;  3PX4 A;  8ICW A;  3H8S A;  4MFF A;  3RBE A;  3M9N B;  1ZQH A;  1U4B A;  3RR8 A;  1HUZ A;  3EZ5 A;  3RB4 A;  1KFS A;  7ICI A;  2PFN A;  1Y88 A;  5L1K A;  8ICL A;  4XRH A;  1XWL A;  4QZE A;  4R63 A;  4XQ8 A;  3MR5 A;  3RRH A;  2A1J A;  5CA7 A;  2ASJ A;  1NJZ A;  2F1H A;  4I28 A;  5DGB A;  5CR0 A;  4BGD A;  8ICZ A;  4KLT A;  1A76 A;  4K4I A;  3GII A;  4IQV A;  1NKE A;  1ZQJ A;  4DSJ A;  4YXM A;  4EBD A;  4ECW A;  1S0N A;  5DKW A;  3BQ1 A;  3H8W A;  4QZI A;  3RAQ A;  5BPC A;  4M2Y A;  4NLG A;  3JPS A;  4ECT A;  2XCA A;  3H40 A;  7ICR A;  1C7Y A;  9ICL A;  4HYK A;  1EXN A;  4YR0 A;  3TFS A;  5DBA A;  4G3I A;  3TFR A;  4I27 A;  2XGP A;  3PX0 A;  4R8U A;  3RB6 A;  4O3P A;  4UAZ A;  3RB0 A;  2NRT A;  5J2I A;  4KN4 A;  4M6W A;  2UVV A;  5HML A;  4PH5 A;  4BXO A;  3BQT A;  3MDC A;  1ZQQ A;  1S77 D;  9ICX A;  3NGD A;  4JK1 A;  8ICV A;  4J9O A;  2A1J B;  2GWS A;  1PZN A;  5KFZ A;  5KFW A;  2P66 A;  2KFN A;  5KG2 A;  2ZUD A;  9ICM A;  5J0U A;  1TVA A;  2J6T A;  4F4Z A;  5J2G A;  4B9N A;  4K4G A;  2ALZ A;  3EPG A;  4Z6C A;  7ICV A;  5J2K A;  2KZZ A;  3JPO A;  3RJG A;  4QZC A;  5DG8 A;  1MQ2 A;  2JEG A;  4RT3 A;  4F8R A;  3ISC A;  3JPT A;  4MEY A;  5KFE A;  4M9L A;  4NLZ A;  4DS5 A;  9ICI A;  9ICN A;  4DOB A;  2R8G A;  1LB2 B;  5DLF A;  3MFI A;  1NK0 A;  4KLF A;  5KG3 A;  4DLE A;  4GLX A;  2BCS A;  3MGH A;  4R8U B;  1QLN A;  3BJY A;  9ICH A;  4YN4 A;  5DQG A;  4M6W B;  1JXL A;  4DQI A;  5BOM A;  4F50 A;  3SV3 A;  3BDP A;  1DOQ A;  3LDA A;  4LZD A;  3KHG A;  1K1Q A;  9ICT A;  1ZQX A;  3GDX A;  4KLD A;  1N48 A;  7ICE A;  3GIM A;  4RQ4 A;  2I1Q A;  4IQT A;  5C5J A;  3H4B A;  3PW7 A;  3THV A;  1ZJN A;  4R65 A;  2BCU A;  4MFC A;  5DB6 A;  3GV5 B;  4ED8 A;  3GQC A;  3V6H A;  2IHN A;  5J29 A;  5HHI A;  4ECS A;  3JPN A;  2V9W A;  1B43 A;  3GFK B;  3OHA A;  4UBB A;  8ICG A;  4J9Q A;  3C5G A;  1TK5 A;  2R8J A;  1BPE A;  5EWE A;  1TAU A;  4JV2 A;  2BPC A;  5DDY A;  4ELT A;  8ICA A;  4O3N A;  1RXV A;  1L3V A;  4PHA A;  4O3O A;  1UA1 A;  3RJE A;  4BDP A;  7ICU A;  8ICY A;  5DG9 A;  4J9P A;  4DFM A;  9ICR A;  2FPK A;  1XSP A;  4GXJ A;  5J0Y A;  4DL6 A;  1ZQC A;  2DPI A;  1ZQR A;  4GC6 A;  3BQ0 A;  3RRG A;  4UBC A;  3V6J A;  5KFY A;  3AU6 A;  5F9L A;  4YMO A;  4NLN A;  4O5C A;  7ICS A;  2FMQ A;  3H8J A;  4B9V A;  3B0X A;  2FPM A;  4YFK A;  4O3R A;  1NK9 A;  2KZM A;  4RUC A;  4KN7 A;  5KFR A;  2Q0Z X;  2XCP A;  2FLL A;  3RJF A;  4F93 B;  5JUM A;  3RJJ A;  4Z6D A;  2ZUC A;  2W9B A;  4F5O A;  4NM2 A;  2UVU A;  9ICV A;  4TUP A;  7ICL A;  4RNM A;  4F5Q A;  3V6K A;  1IXR A;  1X9W A;  4DQS A;  5DBB A;  3SI8 A;  2AQ0 A;  7ICH A;  1U45 A;  1NJW A;  1N56 A;  1L3T A;  1JMS A;  5L1I A;  4EBE A;  5KT4 A;  1SKR A;  4XUS A;  2ZJA A;  5J2F A;  4J9S A;  5KFD A;  3M9O B;  1ZYQ A;  5J0R A;  1CUK A;  5KG5 A;  4DOC A;  1NOM A;  2KN7 A;  2HHU A;  1ZQY A;  5IIO A;  4RU9 A;  2BQR A;  5DDM A;  1L3U A;  3RJH A;  3M8R A;  1Z00 A;  5CB1 A;  2NRZ A;  3ZDE A;  1D8L A;  1S10 A;  1NJX A;  2ISO A;  1T8E A;  4J9M A;  1T3N A;  1X9S A;  2ZTE A;  2W9C A;  1NKB A;  1ZQU A;  4MF8 A;  7ICN A;  2H5X A;  4IRC A;  4Q43 A;  4DF4 A;  3EW9 A;  2W9B B;  4I2F A;  3T5L A;  4GXI A;  4KMU A;  3Q8R B;  5J0T A;  1SL1 A;  3MR2 A;  1QTM A;  2RDJ A;  4J9R A;  3ZDB A;  5KT3 A;  1SKS A;  4ELU A;  9ICA A;  2XY7 A;  2W8K A;  3PW2 A;  1TK8 A;  4P4O A;  4P4P A;  5EOZ A;  5F9N A;  5DG7 A;  1H38 A;  4QZH A;  5KT2 A;  4KLL A;  5J0X A;  1Z00 B;  1XSN A;  9ICC A;  5J2A A;  4EYI B;  4KLI A;  2W9C B;  3UXP A;  4TUR A;  3Q8M A;  3GIJ A;  4UB3 A;  3LK9 A;  4J9N A;  4NXZ A;  1HUO A;  4I2G A;  4F5P A;  8ICJ A;  3UPQ A;  4P4M A;  4C8L A;  3TAN A;  3C2L A;  3PO4 A;  4RQ5 A;  4ECX A;  7ICP A;  4C8M A;  2UVW A;  3ZD8 A;  4B9T A;  1NK7 A;  4RNO A;  1L3S A;  3K4G A;  3AUO A;  4O3Q A;  1NK6 A;  4F4X A;  3RTV A;  4DL2 A;  1QSS A;  1MSW D;  3PV8 A;  3GIK A;  3PR4 A;  1TV9 A;  4P2H A;  3PW5 A;  3T5H A;  2AGO A;  1U47 A;  3B0Y A;  1HJP A;  4RQ1 A;  5KFB A;  4M04 A;  7ICJ A;  1TFR A;  5J0W A;  4MEX A;  4DFJ A;  3RBD A;  9ICG A;  4JWM A;  4KLM A;  3OSN A;  4JV0 A;  4RQ7 A;  3OJU A;  3OJS A;  4O0I A;  4QWD A;  4JUZ A;  3UXN A;  5KFQ A;  4ECQ A;  3V7L A;  2MAX A;  5HHH A;  4KLE A;  1JX4 A;  1D9D A;  4UB4 A;  3Q8S B;  5KFS A;  3LWM A;  2W9M A;  3HP6 A;  3OSP A;  7ICK A;  1RZT A;  3JPR A;  2W9A A;  4JWN A;  5IIJ A;  1A77 A;  4PGQ A;  3MDA A;  1KFT A;  1WCN A;  3PR5 B;  4IRD A;  5KFF A;  4UQG A;  2XC9 A;  4ED3 A;  4KLO A;  3RH6 A;  4EZ6 A;  1S9F A;  4O3S A;  2PFQ A;  2AGP A;  5J2E A;  1JXE A;  3ZDC A;  2KZ3 A;  4C8K A;  4Z6F A;  5IIK A;  2R8H A;  3Q8P B;  3T5K A;  2RDI A;  2IMW P;  3KTQ A;  2HW3 A;  1XU4 A;  4ED0 A;  4DL3 A;  1TK0 A;  3LWL A;  4M0A A;  4RT2 A;  3MGI A;  5KFV A;  4YMM A;  4F4Y A;  2XO7 A;  3ISD A;  4KTQ A;  4RZR A;  3Q8K A;  5DB8 A;  1ZQZ A;  4I2I A;  3TAR A;  1D9F A;  4R66 A;  4F5R A;  3PML A;  1TAQ A;  2KTQ A;  3RB3 A;  4EZ9 A;  2C28 A;  4I2A A;  7ICQ A;  2IHM A;  4QZB A;  2HVH A;  5KFL A;  5KG4 A;  5J0S A;  4M9H A;  5DB7 A;  5KT6 A;  1ZQV A;  3RH5 A;  5IIL A;  3OGU A;  4YMN A;  1MC8 A;  2ZJ8 A;  4BWM A;  2JEJ A;  2J6U A;  1KEJ A;  3MR3 A;  1JN3 A;  2VA3 A;  1BVS A;  4F4K A;  1KTQ A;  4YD1 A;  2P6R A;  5CJ7 A;  2ATL A;  3V7J A;  9ICE A;  4YQW A;  4FS1 A;  5TZV A;  3EPI A;  1S76 D;  5KTQ A;  2BKE A;  5KG0 A;  2AQ4 A;  4QWA A;  3GIL A;  3ORY A;  4K4H A;  5DB9 A;  3PY8 A;  2J6S A;  2BR0 A;  2PFO A;  4UAW A;  3RJK A;  5D4B A;  9ICU A;  3M8S A;  2ASD A;  1QSL A;  2ISP A;  5KFX A;  1ZQM A;  4R64 A;  4FBT A;  1ZQD A;  4KIT B;  5KFP A;  5IIM A;  2BPF A;  3FYH A;  2Y1J A;  2HHQ A;  3IHQ B;  3RH4 A;  2HHX A;  5DQI A;  4DL4 A;  1WCL A;  5HMM A;  2XY6 A;  5L1L A;  2DPJ A;  1XC9 A;  1ZQL A;  2ZTD A;  4X5V A;  1ZQN A;  4YCX A;  4DSK A;  1NJY A;  4PGX A;  5KFC A;  5DGA A;  1XO1 A;  3PMN A;  1SKW A;  2XGQ A;  4JV1 A;  4I2J A;  3SZ2 A;  3Q8L A;  4B9L A;  2BCQ A;  1S97 A;  4M9J A;  4ECY A;  2V4R A;  1SL0 A;  2AGQ A;  4QZ9 A;  4QZA A;  5L9X A;  5J2D A;  3HT3 A;  3JPP A;  3JPQ A;  4EBC A;  2C22 A;  2BHN A;  4TUQ A;  4RQ8 A;  5KFT A;  3ETL A;  4YP3 A;  3H4D A;  2W8L A;  4DFK A;  1RYR A;  8ICQ A;  8ICP A;  4DSL A;  3G6V A;  3C23 A;  5KFG A;  5KFM A;  5J2B A;  3QEB Z;  9ICW A;  4PHD A;  4MF2 A;  4J9K A;  4QZ8 A;  3H7I A;  1ZQO A;  1ZQP A;  2ZTC A;  5KG1 A;  3V7K A;  2BQU A;  1BGX T;  3AU2 A;  4GXK A;  4ED2 A;  3PW4 A;  1KDH A;  1ZQA A;  4B9M A;  2HHT A;  3PVX A;  4B9S A;  1COO A;  2BCV A;  2FMS A;  8ICN A;  1JIH A;  8ICE A;  9ICQ A;  3SV4 A;  9ICB A;  1TKD A;  4I2H A;  4KLJ A;  5CP2 A;  4BWJ A;  9ICF A;  2ASL A;  4PHP A;  4ECZ A;  3QZ8 A;  2LYH A;  8ICC A;  2HHW A;  7ICO A;  2BGW A;  4QZF A;  3PO5 A;  9ICO A;  4RQ2 A;  2P6U A;  5BOL A;  1L5U A;  2ZUB A;  1NKC A;  4RPX A;  4ECU A;  3MFH A;  2BQ3 A;  2PI5 A;  4IR9 A;  4ED6 A;  1NK8 A;  4I2C A;  2HVI A;  1S0O A;  1V9P A;  3TAQ A;  4DS4 A;  3G6Y A;  5KFJ A;  4RQ6 A;  1B22 A;  4M9N A;  1ARO P;  1KFD A;  2R8I A;  8ICF A;  2JEF A;  1ZQW A;  4TQR A;  4QW9 A;  4QWB A;  4YD2 A;  2JZB B;  5KFU A;  1LV5 A;  2FMP A;  1KSP A;  3UXO A;  2MUT A;  4I2B A;  3C1Y A;  4EYH B;  2OWO A;  5CHG A;  2JEI A;  2FLN A;  4RPZ A;  1X9M A;  3PW0 A;  4O5E A;  4F91 B;  4F3O A;  4DQQ A;  3MBY A;  3TQ1 A;  5III A;  3C2M A;  2HHS A;  4DQP A;  9ICK A;  3T5J A;  4F2R A;  3HPO A;  5CWR A;  1BPX A;  4NLK A;  9ICJ A;  1BPB A;  4XA5 A;  1NK5 A;  4DEZ A;  8ICU A;  2B21 A;  4ECR A;  1S0V A;  4M9G A;  4NY8 A;  1S0M A;  2DFL A;  2ZJ5 A;  7ICM A;  1Z3E B;  3OHB A;  2C2D A;  4ED7 A;  2I9G A;  4E0D A;  1RXW A;  2KFZ A;  3QE9 Y;  5J0P A;  4DSE A;  1KLN A;  1T7P A;  1UT5 A;  2BCR A;  4KLQ A;  4UAY A;  8ICX A;  1U9L A;  3C5F A;  1ZQG A;  5KFN A;  1XS9 D;  8ICM A;  8ICI A;  4DL7 A;  2MUT B;  4DF8 A;  3UQ2 A;  3FDS A;  4YXJ A;  4F5N A;  7ICG A;  5J2H A;  4C8N A;  2Y1I A;  2NRX A;  2VAN A;  2FPL A;  2VA2 A;  4I29 A;  8ICH A;  4MFA A;  4DLG A;  1ZQB A;  4Z6E A;  4RNN A;  4QW8 A;  3KHH A;  3EYZ A;  3PNC A;  3C2K A;  4O5K A;  4KLS A;  4RQ3 A;  4IR1 A;  4QZG A;  2VA8 A;  4ED1 A;  2C2E A;  3K75 D;  5DLG A;  4UB1 A;  1ZJM A;  3N97 B;  4NM1 A;  3C1Z A;  5KT7 A;  1BPZ A;  8ICO A;  3T3F A;  2BDP A;  1BPD A;  2F1I A;  4ZH4 A;  3QEA Z;  3G6X A;  4BXO B;  4FS2 A;  3GV8 B;  1MQ3 A;  3MR6 A;  4UB2 A;  5D49 A;  5KFH A;  2F1J A;  4Q8F A;  5KFI A;  1ZET A;  4F4W A;  4TQS A;  4IRK A;  3TAP A;  3N4M B;  3M9M B;  5KT5 A;  4O9M A;  5J0O A;  3Q8Q B;  3RAX A;  2UVR A;  3V72 A;  1XSL A;  4ECV A;  3ISB A;  5HNK A;  1SZP A;  5L1J A;  4GC7 A;  2BPG A;  2NRW A;  5EWF A;  4LVS A;  5KFA A;  5HP4 A;  1ZQF A;  2AJQ A;  7ICF A;  1ZQT A;  8ICS A;  4PGY A;  4YG2 A;  7ICT A;  1IM4 A;  4DOA A;  1X2I A;  4J9L A;  1RYS A;  1BPY A;  3SYZ A;  5J2C A;  3GV7 B;  2M9N A;  5DQH A;  1K1S A;  4QWE A;  4YR2 A;  3UQ0 A;  3ZDD A;  1KRP A;  4DSF A;  3ZDA A;  3HWT A;  3HX0 A;  8ICB A;  3E2E A;  4F2S A;  4KLU A;  4LZG A;  3QZ7 A;  3BQ2 A;  2FLP A;  3RR7 A;  4IQW A;  5KG6 A;  5EWG A;  3PX6 A;  2PFP A;  1RPL A;  4B9U A;  4DFP A;  4FBU A;  4ELV A;  4YR3 A;  4DQR A;  3ZD9 A;  4YVZ A;  3KHL A;  4Q44 A;  2IA6 A;  8ICT A;  1ZQK A;  5J0Q A;  8ICR A;  2V4Q A;  4FO6 A;  8ICK A;  1ZQS A;  1QSY A;  1D8Y A;  1CEZ A;  4Q8E A;  4RQ0 A;  5J2J A;  4IQU A;  4DWI A;  1SL2 A;  2NRV A;  3NTU A;  9ICP A;  5DBC A;  4I2E A;  5IIN A;  3HW8 A;  1U48 A;  2R8K A;  3IM1 A;  2WTF A;  1DGS A;  4DO9 A;  3KHR A;  2IBK A; 
#chains in the Genus database with same CATH topology
 4QZD A;  1L8L A;  4M47 A;  1UT8 A;  4Q45 A;  2JZB A;  1SB3 C;  4C0Z A;  4DSI A;  1C20 A;  3WKD A;  5ALJ A;  4C8O A;  4ACO A;  2G07 A;  4EEY A;  4P0Q B;  2IOF K;  2PI4 A;  5KFO A;  3S6J A;  2EDU A;  2W3S A;  2B0C A;  3RR8 A;  3F53 A;  5L1K A;  4LJX A;  3RRH A;  2A1J A;  2F1H A;  5CR0 A;  5DGB A;  4KLT A;  4IQV A;  1NKE A;  4DSJ A;  2IA6 A;  1O08 A;  2XCA A;  3CYM A;  4HYK A;  4YR0 A;  3TFS A;  4R8U A;  2YB1 A;  4KN4 A;  5J2I A;  4PH5 A;  3MDC A;  2WB1 C;  1X9X A;  2P66 A;  2KFN A;  1PZN A;  4B9N A;  4K4G A;  4F4Z A;  2EQY A;  3LVV A;  2ALZ A;  2CRX A;  3IG5 A;  5HR7 A;  4QZC A;  4F8R A;  4MEY A;  5KFE A;  4DOB A;  5G5H A;  3CNH A;  5KG3 A;  2KJ5 A;  4DLE A;  2BCS A;  9ICH A;  4M6W B;  1PK3 A;  5BOM A;  3BDP A;  1DOQ A;  1V85 A;  1K1Q A;  1PUZ A;  7ICE A;  5ALM A;  2OM6 A;  1ZJN A;  5GTI U;  3GQC A;  3SR6 A;  5KNI A;  1B43 A;  2HSZ A;  4UBB A;  4FE3 A;  3C5G A;  1TK5 A;  1BPE A;  1TAU A;  2BPC A;  5DDY A;  2E1E A;  4RQM A;  1L3V A;  4BDP A;  4GXJ A;  1ZQR A;  3RRG A;  1JRO A;  4UBC A;  3V6J A;  2DWQ A;  3B0X A;  2XCP A;  4F93 B;  5JUM A;  3C28 A;  4CGZ A;  3NRZ A;  2EH9 A;  1IXR A;  3SI8 A;  2AQ0 A;  3O0F A;  1U45 A;  5L1I A;  4XUS A;  5AKK A;  3SD7 A;  5KFD A;  1WUD A;  4DOC A;  4C4T A;  2HHU A;  3D2S A;  1Z00 A;  5CB1 A;  1D8L A;  1J2N A;  1T8E A;  4MF8 A;  4IRC A;  2K8B B;  2QLT A;  4UB6 U;  4DCC A;  2KG5 A;  3EW9 A;  2W9B B;  2KJ8 A;  2E3T A;  4GIB A;  3IP4 B;  1SKS A;  1T3Q A;  2HBL A;  2M0N A;  5AI5 A;  4P4P A;  2ZIV A;  3H0R B;  3SMV A;  2ZIX B;  2K4I A;  2W9C B;  4QJF B;  2KSO B;  3LK9 A;  4J9N A;  3IRU A;  1HUO A;  4F5P A;  5ALH A;  8ICJ A;  1SWW A;  7ICP A;  4C8M A;  3ZD8 A;  4B9T A;  4RNO A;  4O3Q A;  2F8K A;  5H2F U;  4F72 A;  1QSS A;  3IN5 A;  2KK0 A;  3GIK A;  2G09 A;  4NL9 C;  1JUD A;  1Q3U A;  4Y2Q A;  2DKZ A;  2DF4 B;  2AGO A;  4RQ1 A;  5J0W A;  2EAN A;  3BS7 A;  4QWD A;  4ECQ A;  4KLE A;  4CF4 A;  1D9D A;  4UB4 A;  3CP8 A;  3Q8S B;  7ICK A;  2W9M A;  3JPR A;  2W9A A;  1SV0 C;  3MDA A;  2EZY A;  1KFT A;  5KFF A;  2XC9 A;  5ALL A;  5L1M A;  3J81 j;  1JXE A;  2HI0 A;  1UCV A;  2R8H A;  3Q8P B;  3MGI A;  4YMM A;  4F4Y A;  3TAR A;  1D9F A;  4F5R A;  1GO3 F;  1M6Y A;  3WK6 A;  3PML A;  3RB3 A;  4EZ9 A;  2OCE A;  2OHF A;  2ZIW B;  1ZQV A;  2K60 A;  5AIA A;  1RM6 C;  3WK5 A;  2J6U A;  1SZH A;  1KEJ A;  1JN3 A;  1BVS A;  4YQW A;  5TZV A;  3D2Q A;  3VCB A;  2AQ4 A;  5DB9 A;  3PY8 A;  2PFO A;  3RJK A;  4UAW A;  9ICU A;  1F5S A;  3M8S A;  2ASD A;  2ISP A;  5KFX A;  4KIT B;  5KFP A;  3FYH A;  5E79 U;  2HHQ A;  2MRL A;  1NZB A;  3N28 A;  2W11 A;  3AN1 A;  2DPJ A;  1XC9 A;  1WYG A;  3LVW A;  3N7S C;  5DGA A;  2XGQ A;  4I2J A;  4ECY A;  2EZX A;  1SL0 A;  4QZ9 A;  5L9X A;  5AI4 A;  5KFT A;  4EEN A;  2ZTC A;  5ALI A;  1ZQA A;  4GXK A;  1X6J A;  4B9M A;  3AL0 B;  3PVX A;  2FI1 A;  4B9S A;  1JIH A;  1N2X A;  4I2H A;  4PHP A;  7ICO A;  2LYH A;  5AM3 A;  4QZF A;  2HDO A;  3PST A;  4U7C A;  4I27 A;  4CF3 A;  1NK8 A;  2HVI A;  2LM4 A;  3TAQ A;  2HOQ A;  5KFJ A;  2AXT U;  4TQR A;  1ZQW A;  4OD0 A;  4QW9 A;  3F5E A;  3UXO A;  2MUT A;  5K4L A;  2OWO A;  4O5E A;  3C2M A;  1X66 A;  2KVS A;  5AKE A;  5CWR A;  1RYU A;  1BPX A;  1N62 A;  4OJP A;  4UAT A;  1NNL A;  8ICU A;  2B21 A;  1ZRM A;  4M9G A;  1S0M A;  2DFL A;  1FEZ A;  4Y2T A;  4AYB C;  2BCR A;  4KLQ A;  4UAY A;  3C5F A;  4YXJ A;  1P7D A;  3M6Z A;  8ICH A;  2FPL A;  4I29 A;  4KLS A;  3EYZ A;  4QZG A;  4ED1 A;  1HEK A;  3C1Z A;  3FC4 A;  1BPZ A;  2BDP A;  2YMQ A;  3QEA Z;  1MQ3 A;  5D49 A;  1IV8 A;  2PMZ F;  1L7O A;  4UAV A;  2UVR A;  3Q8Q B;  4ECV A;  1ED1 A;  4LVS A;  2AJQ A;  7ICF A;  1X42 A;  4ICA A;  4PGY A;  8ICS A;  4Y2J A;  1X2I A;  3UM9 A;  2Y9U A;  5DQH A;  4YR2 A;  3ZDD A;  8ICB A;  2WF9 A;  1Z4O A;  2HMX A;  2FLP A;  5T14 A;  1DRG A;  2PFP A;  1RPL A;  4FBU A;  4DFP A;  3KHL A;  4P0Q A;  1ZQK A;  5J0Q A;  2V4Q A;  4FO6 A;  8ICK A;  1QSY A;  1CEZ A;  4Q8E A;  3FM9 A;  4IQU A;  2RQ5 A;  3SEI A;  3F5A A;  1KQQ A;  4I2E A;  5IIN A;  1U48 A;  3OTQ A;  3IM1 A;  5KG7 A;  1U49 A;  3TAC B;  1N61 A;  2HBK A;  2PXI A;  1UA0 A;  4RUA A;  3KKA A;  4TUS A;  1LVH A;  4RPY A;  4I2D A;  1ZQI A;  8ICW A;  3RBE A;  3M9N B;  2BDU A;  1ZQH A;  1HUZ A;  3EZ5 A;  5AK4 A;  1KFS A;  7ICI A;  3FAH A;  1XWL A;  1BNO A;  4XQ8 A;  1YZ6 A;  1NJZ A;  4I28 A;  2XI9 A;  8ICZ A;  1A76 A;  4K4I A;  3GII A;  3QX7 A;  1ZQJ A;  4ECW A;  1S0N A;  5DKW A;  3BQ1 A;  4QZI A;  5ALT A;  4ECT A;  3QUT A;  2E8M A;  1K5O A;  1C7Y A;  4G3I A;  3TFR A;  5ALW A;  2XGP A;  3PX0 A;  3RB6 A;  4O3P A;  4UAZ A;  3RB0 A;  4M6W A;  1URJ A;  3KZX A;  2YMM A;  1S77 D;  1J97 A;  3NGD A;  2GWS A;  1T94 A;  5KG2 A;  2NV3 A;  2J6T A;  1Z1B A;  4Z6C A;  5DG8 A;  3DEE A;  2JEG A;  2JH7 A;  4NLZ A;  1KBU A;  1LB2 B;  3B9J A;  1QLN A;  4YN4 A;  2VKQ A;  5DQG A;  3SV3 A;  3LDA A;  1Z4N A;  2Y0S C;  2MU2 A;  1ZQX A;  3I76 A;  1N48 A;  2KEY A;  3THV A;  2BCU A;  4R65 A;  2E8P A;  2N1R A;  3GV5 B;  1N5W A;  4ED8 A;  3V6H A;  2IHN A;  5HHI A;  4ECS A;  2K8C B;  1OW5 A;  8ICG A;  4J9Q A;  4O3O A;  1UA1 A;  8ICY A;  5DG9 A;  3KD3 A;  1XSP A;  4DL6 A;  1ZQC A;  3BQ0 A;  5ALK A;  5F9L A;  4YMO A;  4O5C A;  7ICS A;  3H8J A;  3SAH A;  1V97 A;  2FPM A;  1Q46 A;  1L7M A;  5TIS U;  3C29 A;  1QCK A;  3I1Y A;  1X6I A;  5KFR A;  2Q0Z X;  2FLL A;  3RJF A;  5G5G A;  2ZUC A;  2W9B A;  5FP0 A;  4NM2 A;  3ETR A;  1X9W A;  4DQS A;  5DBB A;  7ICH A;  1JMS A;  1SKR A;  3BS5 B;  5J2F A;  5KG5 A;  1NOM A;  2JMG A;  2BQR A;  5DDM A;  1L3U A;  2ZIX A;  1S10 A;  1Q8K A;  1T3N A;  2WB1 F;  1X9S A;  2W9C A;  1NKB A;  1ZQU A;  2KSO A;  7ICN A;  4P0P B;  2H3Q A;  4Q43 A;  4DF4 A;  1S8O A;  4GXI A;  3PSP A;  4KMU A;  2IBK A;  5J0T A;  3MR2 A;  1QTM A;  4J9R A;  4OJL A;  1V38 A;  9ICA A;  4CNQ A;  5ALF A;  4P4O A;  5DG7 A;  3WKC A;  4KLL A;  1PK1 A;  3AQF A;  1FO4 A;  1L8O A;  3A0B U;  2VJ4 A;  3TAN A;  2QAR A;  2ODG A;  4RQ5 A;  4ECX A;  2UVW A;  2WAQ C;  3AUO A;  1NK6 A;  4F4X A;  1MSW D;  4IC9 A;  5AM0 A;  3PV8 A;  1XNS A;  3F2B A;  3PW5 A;  2KV2 A;  2CN1 A;  3B0Y A;  1HJP A;  4MEX A;  2AHO B;  3OSN A;  4RQ7 A;  3OJU A;  4GFJ A;  3OJS A;  3UXN A;  4NL9 A;  1MA7 A;  2A3V A;  2WF5 A;  3LWM A;  3OSP A;  2LKY A;  1RZT A;  4JWN A;  4Y2V A;  5ALE A;  3ED5 A;  5A0L A;  1WCN A;  3E0F A;  4OJ5 A;  4O3S A;  1HIW A;  5J2E A;  1YZ7 A;  2G5H B;  1SV0 A;  1QQ7 A;  3T5K A;  2HW3 A;  4DL3 A;  1TK0 A;  5ALQ A;  5KFV A;  2B6G A;  2LBO A;  4QNL A;  3ISD A;  2FE9 A;  4KTQ A;  4FZN A;  3PSF A;  2KTQ A;  4I2A A;  7ICQ A;  5KFL A;  3QU4 A;  5KT6 A;  3RH5 A;  5ALD A;  2ZJ8 A;  3MR3 A;  4G9B A;  1KTQ A;  9ICE A;  1S76 D;  5KTQ A;  1JRP A;  2BKE A;  5KG0 A;  4QWA A;  3GIL A;  4K4H A;  3IDW A;  1QSL A;  1ZQM A;  3WKE A;  1ZQD A;  2BPF A;  3IHQ B;  3RH4 A;  4J03 A;  4DL4 A;  1WCL A;  5HMM A;  2XY6 A;  2ZTD A;  4X5V A;  1ZQN A;  4DSK A;  1NJY A;  2RLT A;  1XO1 A;  3PMN A;  4B9L A;  2AGQ A;  3LYS A;  4JMU A;  5J2D A;  1J2M A;  4QZA A;  3JPP A;  4EBC A;  1FIQ A;  1ZQQ A;  3H4D A;  2W8L A;  2KOB A;  1RYR A;  3G6V A;  1DGJ A;  5J2B A;  9ICW A;  2K89 A;  4J9K A;  4QZ8 A;  2OXO A;  2ZXH A;  5KG1 A;  3AU2 A;  2HHT A;  2K4H A;  1DXS A;  1COO A;  2F8L A;  4CRX A;  2GH1 A;  4FZL A;  8ICN A;  1Z1V A;  2KVC A;  5GTH U;  3QUB A;  3SV4 A;  4MHV A;  1TKD A;  4KLJ A;  5CP2 A;  1B4F A;  1F0M A;  3QZ8 A;  2E8O A;  3HKZ C;  2HHW A;  3PO5 A;  1UQV A;  9ICO A;  5BOL A;  1L5U A;  1NKC A;  4RPX A;  2PI5 A;  3MFH A;  4I2C A;  2D3D A;  3G6Y A;  2R8I A;  1ARO P;  4Y2X A;  2JR5 A;  4QWB A;  4YD2 A;  1ZRN A;  2JZB B;  2ZG6 A;  4I2B A;  4F71 A;  2JEI A;  2F44 A;  3PW0 A;  4F91 B;  5III A;  9ICK A;  3T5J A;  4F2R A;  4NLK A;  4XA5 A;  2NYV A;  1FFV A;  2CXY A;  4NY8 A;  2ZJ5 A;  1Z3E B;  3OHB A;  4Y2S A;  4DFD A;  5CEH A;  4ED7 A;  2I9G A;  3SQI A;  4E0D A;  3QE9 Y;  5J0P A;  4DSE A;  1T7P A;  1UT5 A;  3BQ7 A;  2ZIU B;  1ZQG A;  1XS9 D;  8ICI A;  3F2C A;  3GU3 A;  3NS1 A;  2Y1I A;  4C8N A;  2W7P A;  2VAN A;  3BZC A;  1ZQB A;  4Z6E A;  4RNN A;  3C2K A;  4O5K A;  4NM1 A;  5DLG A;  8ICO A;  3T3F A;  4BUG A;  2F1I A;  3G6X A;  4UAS A;  2ZXI A;  5KFH A;  2F1J A;  3K1Z A;  3QU2 A;  1SGG A;  3PSI A;  5J0O A;  1SZP A;  4GC7 A;  1ZQF A;  5HP4 A;  1ZQT A;  4YG2 A;  3SYZ A;  4OO1 J;  3NVW A;  4QWE A;  5ALV A;  3ZDA A;  2YB4 A;  3HWT A;  3HX0 A;  4LZG A;  5EE3 A;  4IQW A;  4YR3 A;  4DQR A;  3ZD9 A;  2JGA A;  8ICT A;  2DBY A;  2QKQ A;  3L4P A;  1D8Y A;  4US9 A;  3RFA A;  3WK7 A;  5J2J A;  2YQE A;  5ALS A;  3NTU A;  2WF8 A;  5DBC A;  3KHR A;  2QB1 A;  2WFA A;  5D46 A;  4PHE A;  3EWA A;  3TI0 A;  4UAR A;  2KKP A;  4PPX A;  3ALR A;  5HR6 A;  2C2R A;  2BZF A;  4QWC A;  3DV9 A;  2AU0 A;  4DL5 A;  3PX4 A;  1ZQ1 C;  1U4B A;  2DL0 A;  3RB4 A;  1F44 A;  4R63 A;  5AM4 A;  3MR5 A;  3H8M A;  4RQN A;  3RF9 A;  4EBD A;  4M2Y A;  3RAQ A;  4NLG A;  3JPS A;  2F2A B;  5ALN A;  2LYA A;  2JHD A;  3KBB A;  5KAF U;  2HOF A;  4UAU A;  2LPE A;  2NRT A;  2VJ5 A;  3TKA A;  4BXO A;  5HML A;  3BQT A;  1KN5 A;  5J8Y C;  5KFW A;  2ZIV B;  2ZUD A;  9ICM A;  1TVA A;  5J2G A;  4PZO A;  3EPG A;  7ICV A;  5J2K A;  2KZZ A;  3RJG A;  1X40 A;  4UB8 U;  3ISC A;  4HAI A;  4M9L A;  9ICI A;  9ICN A;  3MGH A;  3NUQ A;  5AK3 A;  1B0X A;  5B66 U;  2GO7 A;  2QB0 A;  4LZD A;  3KHG A;  9ICT A;  3GDX A;  4KLD A;  1TE2 A;  3H4B A;  4MFC A;  5AKJ A;  2V9W A;  5J29 A;  3H0M B;  2D8C A;  4O3M A;  2LI6 A;  5EWE A;  5KL1 B;  4JV2 A;  1CI4 A;  8ICA A;  1RXV A;  4J9P A;  4DFM A;  9ICR A;  1A6S A;  4QIW C;  1RQN A;  3AMZ A;  5KFY A;  4NLN A;  2RP5 A;  3WK4 A;  2KZM A;  4RUC A;  4KN7 A;  4P0P A;  3RJJ A;  1LKY B;  4Z6D A;  1PVQ A;  1OXJ A;  9ICV A;  7ICL A;  4RNM A;  4F5Q A;  2KIV A;  2H3F A;  1N56 A;  5ALU A;  1L3T A;  1N63 A;  3ONN A;  4J9S A;  4WJ3 B;  1ZYQ A;  2JXJ A;  5J0R A;  1CUK A;  2KIC A;  4RU9 A;  5IIO A;  3QYP A;  3MGV A;  3M8R A;  2NRZ A;  3ZDE A;  1NJX A;  1ZD4 A;  3L5K A;  2ISO A;  3WKA A;  1KW4 A;  2F77 X;  1RG6 A;  2LM1 A;  2G08 A;  2H5X A;  2P35 A;  3ZI4 A;  5ALO A;  4NJ8 A;  1IIP A;  2GOL A;  3Q8R B;  1SL1 A;  3M6K A;  2PMZ C;  4OJO A;  2KE7 A;  2RDJ A;  1CRX A;  3PW2 A;  3D6J A;  1TK8 A;  5EOZ A;  5F9N A;  4QZH A;  3QNM A;  1XSN A;  2KMD A;  1Z19 A;  2Y0S F;  2F76 X;  3WK8 A;  4TUR A;  4NXZ A;  4P4M A;  3C2L A;  1S5L U;  1NK7 A;  3K4G A;  5AKI A;  4DL2 A;  3PR4 A;  4AP9 A;  4M04 A;  1WG8 A;  4DFJ A;  3RBD A;  9ICG A;  4C7Z A;  4JV0 A;  3NRW A;  5KFQ A;  3V7L A;  2MAX A;  1JX4 A;  3ICX A;  5KFS A;  3HP6 A;  1A77 A;  5IIJ A;  4PGQ A;  2HBJ A;  1BNP A;  4UQG A;  2EAP A;  4ED3 A;  4IL6 U;  3N7R C;  1S9F A;  2CPR A;  3ZDC A;  5CRX A;  2KZ3 A;  1PVR A;  4Z6F A;  5IIK A;  2RDI A;  2IMW P;  4EX7 A;  4ED0 A;  3LWL A;  4M0A A;  3MC1 A;  1SIJ A;  2W04 A;  3Q8K A;  1ZQZ A;  4I2I A;  2KD1 A;  1TAQ A;  2E5S A;  1JI7 A;  2C28 A;  3PZP A;  4QZB A;  2HVH A;  2AH5 A;  5DB7 A;  5IIL A;  3OGU A;  1RDF A;  4YMN A;  2DQN B;  2JEJ A;  4BJQ A;  4YD1 A;  2ATL A;  3EPI A;  5AI6 A;  2LYB A;  2YY6 A;  3OPX A;  1QH9 A;  2G06 A;  4Y2U A;  4C7Y A;  2J6S A;  2BR0 A;  1ECW A;  3QU7 A;  4R64 A;  5IIM A;  2Y1J A;  2XVT A;  5DQI A;  4ZOH C;  3TAD C;  5ALY A;  2EAO A;  2YX8 A;  5L1L A;  2WAQ F;  4EEK A;  4YCX A;  4PGX A;  1SKW A;  4M9J A;  3Q8L A;  5AIC A;  2V4R A;  3N7P D;  2C22 A;  4TUQ A;  3NVY A;  8ICP A;  4DSL A;  5KFM A;  3QEB Z;  4OJ6 A;  4PHD A;  3BZK A;  1ZQO A;  1ZQP A;  3PW4 A;  1KDH A;  4C4R A;  2JV3 A;  8ICE A;  9ICQ A;  2K8A A;  3R9K A;  4BWJ A;  2W55 A;  5AHX A;  4Y2R A;  2ASL A;  4ECZ A;  8ICC A;  5AI0 A;  1L7P A;  4RQ2 A;  2BQ3 A;  4ECU A;  4IR9 A;  1FFU A;  1V9P A;  4DS4 A;  4M9N A;  2GLE A;  2NO4 A;  1LV5 A;  2ZIU A;  5AKH A;  2KP7 A;  3C1Y A;  5CHG A;  1X9M A;  3AQE A;  4F3O A;  4DQQ A;  3TQ1 A;  4DQP A;  3HPO A;  4DEZ A;  2H3V A;  1ZD3 A;  1S0V A;  2YTU A;  7ICM A;  4CDG A;  2C2D A;  3I28 A;  2KFZ A;  2W7O A;  1KLN A;  1U9L A;  2ZIW A;  5KFN A;  3T79 A;  4FZM A;  3UMG A;  3UQ2 A;  3FDS A;  7ICG A;  5J2H A;  4MFA A;  4DLG A;  2EAM A;  2KKV A;  2C2E A;  8ICV A;  1ZJM A;  1SXE A;  5KT7 A;  4US8 A;  3MR6 A;  2VIX A;  4UB2 A;  4PJ0 U;  3DDH A;  4IRK A;  3TAP A;  3N4M B;  2KHQ A;  2XIC A;  2OYY A;  5KT5 A;  5AKL A;  3K1R B;  1XSL A;  3ISB A;  5HNK A;  4NWI A;  3M1Y A;  5KFA A;  3CRX A;  7ICT A;  4DOA A;  4J9L A;  5J2C A;  3GV7 B;  2M9N A;  3QUQ A;  3UQ0 A;  4OCZ A;  4DSF A;  5ALZ A;  3NAS A;  3E2E A;  5ALG A;  1VDV A;  3HKZ F;  3QZ7 A;  1A0P A;  3BQ2 A;  5KG6 A;  5EWG A;  4ELV A;  4YVZ A;  3WKB A;  4Q44 A;  8ICR A;  1ZQS A;  1ZD2 P;  1SL2 A;  1KL9 A;  2NRV A;  4KX5 A;  1OUQ A;  3HW8 A;  2W3R A;  1DGS A;  3C21 A;  1QQ6 A;  9ICS A;  4KLH A;  1NK4 A;  4UB5 A;  1T4G A;  3MAB A;  4F92 B;  3RJI A;  4CCH A;  1UHU A;  5KFK A;  4KLG A;  1WWV A;  3QUC A;  2XY5 A;  2HHV A;  1ZQE A;  1ZOL A;  2W03 A;  1N5X A;  3H8S A;  4MFF A;  3HRD D;  2DKX A;  2PFN A;  1Y88 A;  8ICL A;  4XRH A;  4QZE A;  3WU2 U;  4NLB A;  5CA7 A;  2ASJ A;  2E1F A;  4IS7 A;  4BGD A;  2K4P A;  4B6J A;  4YXM A;  2FJ6 A;  3H8W A;  5BPC A;  2Q4T A;  3H40 A;  7ICR A;  4KX3 A;  9ICL A;  1EXN A;  5DBA A;  1COK A;  4Y2P A;  5JU5 A;  2KHV A;  8ICM A;  3UMC A;  2UVV A;  5JTI A;  9ICX A;  1Q3V A;  4JK1 A;  4J9O A;  2A1J B;  5KFZ A;  1PK1 B;  5J0U A;  4NV0 A;  3JPO A;  1MQ2 A;  3NVZ A;  4RT3 A;  3JPT A;  5J8Y A;  4DS5 A;  2QAR B;  5AK5 A;  2R8G A;  4NLC A;  4CF5 A;  5DLF A;  3MFI A;  1NK0 A;  4KLF A;  5AIB A;  4GLX A;  4R8U B;  3BJY A;  2WHE A;  1JXL A;  4DQI A;  4F50 A;  2W43 A;  2FDR A;  3GIM A;  2Y9T A;  4RQ4 A;  2I1Q A;  4IQT A;  2W54 A;  5AKZ A;  5C5J A;  3PW7 A;  5DB6 A;  1LKY A;  2DUY A;  3JPN A;  3GFK B;  3OHA A;  2R8J A;  2F3N A;  5F3X B;  4ELT A;  4O3N A;  3RJE A;  4PHA A;  1IG6 A;  7ICU A;  2FPK A;  5J0Y A;  2DPI A;  1D8B A;  4GC6 A;  3AU6 A;  2FMQ A;  4B9V A;  4YFK A;  2LMR A;  4O3R A;  1NK9 A;  5AM2 A;  4PL1 A;  4F5O A;  2UVU A;  4TUP A;  1PVP A;  3V6K A;  1O03 A;  1NI3 A;  1NJW A;  4EBE A;  5KT4 A;  2WF7 A;  3KZI U;  2ZJA A;  3M9O B;  3A0H U;  4A8E A;  2KN7 A;  1ZQY A;  3RJH A;  5AK6 A;  4J9M A;  2ZTE A;  4AYB F;  3AEV A;  3L3F X;  4I2F A;  3T5L A;  2NO5 A;  3ZDB A;  5KT3 A;  4ELU A;  2XY7 A;  2IOH A;  2W8K A;  1VLB A;  2OH2 A;  1H38 A;  3KOO A;  5KT2 A;  5J0X A;  1Z00 B;  1NZP A;  9ICC A;  5J2A A;  4EYI B;  4KLI A;  2G0A A;  3UXP A;  3F2D A;  3Q8M A;  3GIJ A;  4UB3 A;  4I2G A;  3UPQ A;  1N60 A;  4C8L A;  3PO4 A;  2MSN A;  2E8N A;  3WK9 A;  1L3S A;  3RTV A;  2HCF A;  2KNJ A;  1TV9 A;  2R18 A;  2YMP A;  4P2H A;  3EUB 2;  4EX6 A;  1YT3 A;  3T5H A;  1U47 A;  4USA A;  3UMB A;  3SAF A;  5KFB A;  4QIW F;  7ICJ A;  1TFR A;  1SXD A;  4JWM A;  4KLM A;  5AM5 A;  4O0I A;  4JUZ A;  2O6K A;  4UW9 A;  4CE6 A;  5HHH A;  5C0Y A;  4U6P A;  1SV4 A;  1VJ5 A;  1MN8 A;  3SAG A;  4BX9 C;  3PR5 B;  4IRD A;  4KLO A;  3RH6 A;  4EZ6 A;  2YML A;  2PFQ A;  2AGP A;  5KAI U;  4C8K A;  3E58 A;  2I6X A;  3KTQ A;  1XU4 A;  4RT2 A;  2XO7 A;  4RZR A;  5DB8 A;  5ALR A;  4R66 A;  1SWV A;  3BS5 A;  2IHM A;  1QQ5 A;  5KG4 A;  2KIW A;  5J0S A;  4M9H A;  1KKX A;  1MC8 A;  4BWM A;  2VA3 A;  4F4K A;  2XID A;  2P6R A;  5AKX A;  5CJ7 A;  3V7J A;  4FS1 A;  1JAL A;  3NVV A;  3ORY A;  2LHT A;  5EE1 A;  5D4B A;  4FBT A;  4FFD A;  5EE9 A;  2HHX A;  4JB3 A;  5AI8 A;  1ZQL A;  2D6F C;  5KFC A;  4JV1 A;  2KJ9 A;  3SZ2 A;  2BCQ A;  1S97 A;  4PZN A;  1AQ6 A;  3JPQ A;  3TAD A;  3HT3 A;  2BHN A;  4RQ8 A;  3ETL A;  4YP3 A;  4DFK A;  2JRZ A;  8ICQ A;  3C23 A;  2PKE A;  5KFG A;  3VC8 A;  4MF2 A;  3GZF A;  3H7I A;  2DGZ A;  2ES6 A;  3V7K A;  2BQU A;  1BGX T;  2RRD A;  4ED2 A;  1ZXI A;  5ALX A;  2BCV A;  3M7D A;  2FMS A;  1TAM A;  1L7N A;  9ICB A;  3QU5 A;  3QU9 A;  9ICF A;  1UPH A;  4Y2Y A;  4PL2 A;  2BGW A;  2Z7J A;  2P6U A;  2ZUB A;  4ED6 A;  1S0O A;  2G5I B;  1B22 A;  4RQ6 A;  3HIL A;  1KFD A;  2ESE A;  2H3I A;  2JEF A;  8ICF A;  5ALP A;  5KFU A;  2FMP A;  1KSP A;  4EYH B;  2FLN A;  4RPZ A;  5AI9 A;  3MBY A;  2HHS A;  2H3Z A;  5AKG A;  4EEL A;  9ICJ A;  1BPB A;  1XO0 A;  1NK5 A;  5EE0 A;  4ECR A;  4KMO B;  3IG8 A;  1RXW A;  8ICX A;  4C4S A;  1DK3 A;  5AM1 A;  5JRT A;  2MUT B;  4DL7 A;  4DF8 A;  2OEH A;  4F5N A;  3H0L B;  2NRX A;  2VA2 A;  4QW8 A;  3KHH A;  3PNC A;  2YN4 A;  4RQ3 A;  4IR1 A;  1WWU A;  2VA8 A;  3K75 D;  4UB1 A;  3N97 B;  2A1A A;  2HBM A;  1BPD A;  4ZH4 A;  2IOF A;  4BXO B;  4FS2 A;  3GV8 B;  5KL8 B;  3SEN A;  4Q8F A;  5KFI A;  1ZET A;  4F4W A;  4TQS A;  3AM9 A;  2HOI A;  3M9M B;  2I5H A;  2L5Y A;  4O9M A;  3RAX A;  3V72 A;  1DK2 A;  5L1J A;  4C80 A;  2BPG A;  1ZD5 A;  2NRW A;  5EWF A;  3KFU F;  2JH1 A;  3HJE A;  1IM4 A;  1RYS A;  1BPY A;  1K1S A;  1RQL A;  1KRP A;  5B5E U;  2RHF A;  4F2S A;  4KLU A;  2A19 A;  3RR7 A;  2QB0 B;  2EZZ A;  3PX6 A;  1L6N A;  4B9U A;  2MA1 A;  3CW2 C;  4RQ0 A;  4DWI A;  3U26 A;  5AKY A;  2K4E A;  9ICP A;  2WF6 A;  3QXG A;  3D2N A;  2R8K A;  2WTF A;  4DO9 A;  3IV6 A;  3KKA C; 
#chains in the Genus database with same CATH homology
 3C21 A;  4QZD A;  5KG7 A;  1U49 A;  5D46 A;  4KLH A;  9ICS A;  4M47 A;  1UT8 A;  1NK4 A;  4Q45 A;  4PHE A;  4UB5 A;  1T4G A;  1UA0 A;  3MAB A;  2JZB A;  3EWA A;  4F92 B;  2PXI A;  3TI0 A;  3RJI A;  4CCH A;  4DSI A;  4C8O A;  5KFK A;  4PPX A;  4KLG A;  4RUA A;  4EEY A;  4TUS A;  2C2R A;  2PI4 A;  5KFO A;  4RPY A;  4QWC A;  4I2D A;  2XY5 A;  2AU0 A;  2HHV A;  1ZQE A;  1ZQI A;  4DL5 A;  3PX4 A;  8ICW A;  3H8S A;  4MFF A;  3RBE A;  3M9N B;  1ZQH A;  1U4B A;  3RR8 A;  1HUZ A;  3EZ5 A;  3RB4 A;  1KFS A;  7ICI A;  2PFN A;  1Y88 A;  5L1K A;  8ICL A;  4XRH A;  1XWL A;  4QZE A;  4R63 A;  4XQ8 A;  3MR5 A;  3RRH A;  2A1J A;  5CA7 A;  2ASJ A;  1NJZ A;  2F1H A;  4I28 A;  5DGB A;  5CR0 A;  4BGD A;  8ICZ A;  4KLT A;  1A76 A;  4K4I A;  3GII A;  4IQV A;  1NKE A;  1ZQJ A;  4DSJ A;  4YXM A;  4EBD A;  4ECW A;  1S0N A;  5DKW A;  3BQ1 A;  3H8W A;  4QZI A;  3RAQ A;  5BPC A;  4M2Y A;  4NLG A;  3JPS A;  4ECT A;  2XCA A;  3H40 A;  7ICR A;  1C7Y A;  9ICL A;  4HYK A;  1EXN A;  4YR0 A;  3TFS A;  5DBA A;  4G3I A;  3TFR A;  4I27 A;  2XGP A;  3PX0 A;  4R8U A;  3RB6 A;  4O3P A;  4UAZ A;  3RB0 A;  2NRT A;  5J2I A;  4KN4 A;  4M6W A;  2UVV A;  5HML A;  4PH5 A;  4BXO A;  3BQT A;  3MDC A;  1ZQQ A;  1S77 D;  9ICX A;  3NGD A;  4JK1 A;  8ICV A;  4J9O A;  2A1J B;  2GWS A;  1PZN A;  5KFZ A;  5KFW A;  2P66 A;  2KFN A;  5KG2 A;  2ZUD A;  9ICM A;  5J0U A;  1TVA A;  2J6T A;  4F4Z A;  5J2G A;  4B9N A;  4K4G A;  2ALZ A;  3EPG A;  4Z6C A;  7ICV A;  5J2K A;  2KZZ A;  3JPO A;  3RJG A;  4QZC A;  5DG8 A;  1MQ2 A;  2JEG A;  4RT3 A;  4F8R A;  3ISC A;  3JPT A;  4MEY A;  5KFE A;  4M9L A;  4NLZ A;  4DS5 A;  9ICI A;  9ICN A;  4DOB A;  2R8G A;  1LB2 B;  5DLF A;  3MFI A;  1NK0 A;  4KLF A;  5KG3 A;  4DLE A;  4GLX A;  2BCS A;  3MGH A;  4R8U B;  1QLN A;  3BJY A;  9ICH A;  4YN4 A;  5DQG A;  4M6W B;  1JXL A;  4DQI A;  5BOM A;  4F50 A;  3SV3 A;  3BDP A;  1DOQ A;  3LDA A;  4LZD A;  3KHG A;  1K1Q A;  9ICT A;  1ZQX A;  3GDX A;  4KLD A;  1N48 A;  7ICE A;  3GIM A;  4RQ4 A;  2I1Q A;  4IQT A;  5C5J A;  3H4B A;  3PW7 A;  3THV A;  1ZJN A;  4R65 A;  2BCU A;  4MFC A;  5DB6 A;  3GV5 B;  4ED8 A;  3GQC A;  3V6H A;  2IHN A;  5J29 A;  5HHI A;  4ECS A;  3JPN A;  2V9W A;  1B43 A;  3GFK B;  3OHA A;  4UBB A;  8ICG A;  4J9Q A;  3C5G A;  1TK5 A;  2R8J A;  1BPE A;  5EWE A;  1TAU A;  4JV2 A;  2BPC A;  5DDY A;  4ELT A;  8ICA A;  4O3N A;  1RXV A;  1L3V A;  4PHA A;  4O3O A;  1UA1 A;  3RJE A;  4BDP A;  7ICU A;  8ICY A;  5DG9 A;  4J9P A;  4DFM A;  9ICR A;  2FPK A;  1XSP A;  4GXJ A;  5J0Y A;  4DL6 A;  1ZQC A;  2DPI A;  1ZQR A;  4GC6 A;  3BQ0 A;  3RRG A;  4UBC A;  3V6J A;  5KFY A;  3AU6 A;  5F9L A;  4YMO A;  4NLN A;  4O5C A;  7ICS A;  2FMQ A;  3H8J A;  4B9V A;  3B0X A;  2FPM A;  4YFK A;  4O3R A;  1NK9 A;  2KZM A;  4RUC A;  4KN7 A;  5KFR A;  2Q0Z X;  2XCP A;  2FLL A;  3RJF A;  4F93 B;  5JUM A;  3RJJ A;  4Z6D A;  2ZUC A;  2W9B A;  4F5O A;  4NM2 A;  2UVU A;  9ICV A;  4TUP A;  7ICL A;  4RNM A;  4F5Q A;  3V6K A;  1IXR A;  1X9W A;  4DQS A;  5DBB A;  3SI8 A;  2AQ0 A;  7ICH A;  1U45 A;  1NJW A;  1N56 A;  1L3T A;  1JMS A;  5L1I A;  4EBE A;  5KT4 A;  1SKR A;  4XUS A;  2ZJA A;  5J2F A;  4J9S A;  5KFD A;  3M9O B;  1ZYQ A;  5J0R A;  1CUK A;  5KG5 A;  4DOC A;  1NOM A;  2KN7 A;  2HHU A;  1ZQY A;  5IIO A;  4RU9 A;  2BQR A;  5DDM A;  1L3U A;  3RJH A;  3M8R A;  1Z00 A;  5CB1 A;  2NRZ A;  3ZDE A;  1D8L A;  1S10 A;  1NJX A;  2ISO A;  1T8E A;  4J9M A;  1T3N A;  1X9S A;  2ZTE A;  2W9C A;  1NKB A;  1ZQU A;  4MF8 A;  7ICN A;  2H5X A;  4IRC A;  4Q43 A;  4DF4 A;  3EW9 A;  2W9B B;  4I2F A;  3T5L A;  4GXI A;  4KMU A;  3Q8R B;  5J0T A;  1SL1 A;  3MR2 A;  1QTM A;  2RDJ A;  4J9R A;  3ZDB A;  5KT3 A;  1SKS A;  4ELU A;  9ICA A;  2XY7 A;  2W8K A;  3PW2 A;  1TK8 A;  4P4O A;  4P4P A;  5EOZ A;  5F9N A;  5DG7 A;  1H38 A;  4QZH A;  5KT2 A;  4KLL A;  5J0X A;  1Z00 B;  1XSN A;  9ICC A;  5J2A A;  4EYI B;  4KLI A;  2W9C B;  3UXP A;  4TUR A;  3Q8M A;  3GIJ A;  4UB3 A;  3LK9 A;  4J9N A;  4NXZ A;  1HUO A;  4I2G A;  4F5P A;  8ICJ A;  3UPQ A;  4P4M A;  4C8L A;  3TAN A;  3C2L A;  3PO4 A;  4RQ5 A;  4ECX A;  7ICP A;  4C8M A;  2UVW A;  3ZD8 A;  4B9T A;  1NK7 A;  4RNO A;  1L3S A;  3K4G A;  3AUO A;  4O3Q A;  1NK6 A;  4F4X A;  3RTV A;  4DL2 A;  1QSS A;  1MSW D;  3PV8 A;  3GIK A;  3PR4 A;  1TV9 A;  4P2H A;  3PW5 A;  3T5H A;  2AGO A;  1U47 A;  3B0Y A;  1HJP A;  4RQ1 A;  5KFB A;  4M04 A;  7ICJ A;  1TFR A;  5J0W A;  4MEX A;  4DFJ A;  3RBD A;  9ICG A;  4JWM A;  4KLM A;  3OSN A;  4JV0 A;  4RQ7 A;  3OJU A;  3OJS A;  4O0I A;  4QWD A;  4JUZ A;  3UXN A;  5KFQ A;  4ECQ A;  3V7L A;  2MAX A;  5HHH A;  4KLE A;  1JX4 A;  1D9D A;  4UB4 A;  3Q8S B;  5KFS A;  3LWM A;  2W9M A;  3HP6 A;  3OSP A;  7ICK A;  1RZT A;  3JPR A;  2W9A A;  4JWN A;  5IIJ A;  1A77 A;  4PGQ A;  3MDA A;  1KFT A;  1WCN A;  3PR5 B;  4IRD A;  5KFF A;  4UQG A;  2XC9 A;  4ED3 A;  4KLO A;  3RH6 A;  4EZ6 A;  1S9F A;  4O3S A;  2PFQ A;  2AGP A;  5J2E A;  1JXE A;  3ZDC A;  2KZ3 A;  4C8K A;  4Z6F A;  5IIK A;  2R8H A;  3Q8P B;  3T5K A;  2RDI A;  2IMW P;  3KTQ A;  2HW3 A;  1XU4 A;  4ED0 A;  4DL3 A;  1TK0 A;  3LWL A;  4M0A A;  4RT2 A;  3MGI A;  5KFV A;  4YMM A;  4F4Y A;  2XO7 A;  3ISD A;  4KTQ A;  4RZR A;  3Q8K A;  5DB8 A;  1ZQZ A;  4I2I A;  3TAR A;  1D9F A;  4R66 A;  4F5R A;  3PML A;  1TAQ A;  2KTQ A;  3RB3 A;  4EZ9 A;  2C28 A;  4I2A A;  7ICQ A;  2IHM A;  4QZB A;  2HVH A;  5KFL A;  5KG4 A;  5J0S A;  4M9H A;  5DB7 A;  5KT6 A;  1ZQV A;  3RH5 A;  5IIL A;  3OGU A;  4YMN A;  1MC8 A;  2ZJ8 A;  4BWM A;  2JEJ A;  2J6U A;  1KEJ A;  3MR3 A;  1JN3 A;  2VA3 A;  1BVS A;  4F4K A;  1KTQ A;  4YD1 A;  2P6R A;  5CJ7 A;  2ATL A;  3V7J A;  9ICE A;  4YQW A;  4FS1 A;  5TZV A;  3EPI A;  1S76 D;  5KTQ A;  2BKE A;  5KG0 A;  2AQ4 A;  4QWA A;  3GIL A;  3ORY A;  4K4H A;  5DB9 A;  3PY8 A;  2J6S A;  2BR0 A;  2PFO A;  4UAW A;  3RJK A;  5D4B A;  9ICU A;  3M8S A;  2ASD A;  1QSL A;  2ISP A;  5KFX A;  1ZQM A;  4R64 A;  4FBT A;  1ZQD A;  4KIT B;  5KFP A;  5IIM A;  2BPF A;  3FYH A;  2Y1J A;  2HHQ A;  3IHQ B;  3RH4 A;  2HHX A;  5DQI A;  4DL4 A;  1WCL A;  5HMM A;  2XY6 A;  5L1L A;  2DPJ A;  1XC9 A;  1ZQL A;  2ZTD A;  4X5V A;  1ZQN A;  4YCX A;  4DSK A;  1NJY A;  4PGX A;  5KFC A;  5DGA A;  1XO1 A;  3PMN A;  1SKW A;  2XGQ A;  4JV1 A;  4I2J A;  3SZ2 A;  3Q8L A;  4B9L A;  2BCQ A;  1S97 A;  4M9J A;  4ECY A;  2V4R A;  1SL0 A;  2AGQ A;  4QZ9 A;  4QZA A;  5L9X A;  5J2D A;  3HT3 A;  3JPP A;  3JPQ A;  4EBC A;  2C22 A;  2BHN A;  4TUQ A;  4RQ8 A;  5KFT A;  3ETL A;  4YP3 A;  3H4D A;  2W8L A;  4DFK A;  1RYR A;  8ICQ A;  8ICP A;  4DSL A;  3G6V A;  3C23 A;  5KFG A;  5KFM A;  5J2B A;  3QEB Z;  9ICW A;  4PHD A;  4MF2 A;  4J9K A;  4QZ8 A;  3H7I A;  1ZQO A;  1ZQP A;  2ZTC A;  5KG1 A;  3V7K A;  2BQU A;  1BGX T;  3AU2 A;  4GXK A;  4ED2 A;  3PW4 A;  1KDH A;  1ZQA A;  4B9M A;  2HHT A;  3PVX A;  4B9S A;  1COO A;  2BCV A;  2FMS A;  8ICN A;  1JIH A;  8ICE A;  9ICQ A;  3SV4 A;  9ICB A;  1TKD A;  4I2H A;  4KLJ A;  5CP2 A;  4BWJ A;  9ICF A;  2ASL A;  4PHP A;  4ECZ A;  3QZ8 A;  2LYH A;  8ICC A;  2HHW A;  7ICO A;  2BGW A;  4QZF A;  3PO5 A;  9ICO A;  4RQ2 A;  2P6U A;  5BOL A;  1L5U A;  2ZUB A;  1NKC A;  4RPX A;  4ECU A;  3MFH A;  2BQ3 A;  2PI5 A;  4IR9 A;  4ED6 A;  1NK8 A;  4I2C A;  2HVI A;  1S0O A;  1V9P A;  3TAQ A;  4DS4 A;  3G6Y A;  5KFJ A;  4RQ6 A;  1B22 A;  4M9N A;  1ARO P;  1KFD A;  2R8I A;  8ICF A;  2JEF A;  1ZQW A;  4TQR A;  4QW9 A;  4QWB A;  4YD2 A;  2JZB B;  5KFU A;  1LV5 A;  2FMP A;  1KSP A;  3UXO A;  2MUT A;  4I2B A;  3C1Y A;  4EYH B;  2OWO A;  5CHG A;  2JEI A;  2FLN A;  4RPZ A;  1X9M A;  3PW0 A;  4O5E A;  4F91 B;  4F3O A;  4DQQ A;  3MBY A;  3TQ1 A;  5III A;  3C2M A;  2HHS A;  4DQP A;  9ICK A;  3T5J A;  4F2R A;  3HPO A;  5CWR A;  1BPX A;  4NLK A;  9ICJ A;  1BPB A;  4XA5 A;  1NK5 A;  4DEZ A;  8ICU A;  2B21 A;  4ECR A;  1S0V A;  4M9G A;  4NY8 A;  1S0M A;  2DFL A;  2ZJ5 A;  7ICM A;  1Z3E B;  3OHB A;  2C2D A;  4ED7 A;  2I9G A;  4E0D A;  1RXW A;  2KFZ A;  3QE9 Y;  5J0P A;  4DSE A;  1KLN A;  1T7P A;  1UT5 A;  2BCR A;  4KLQ A;  4UAY A;  8ICX A;  1U9L A;  3C5F A;  1ZQG A;  5KFN A;  1XS9 D;  8ICM A;  8ICI A;  4DL7 A;  2MUT B;  4DF8 A;  3UQ2 A;  3FDS A;  4YXJ A;  4F5N A;  7ICG A;  5J2H A;  4C8N A;  2Y1I A;  2NRX A;  2VAN A;  2FPL A;  2VA2 A;  4I29 A;  8ICH A;  4MFA A;  4DLG A;  1ZQB A;  4Z6E A;  4RNN A;  4QW8 A;  3KHH A;  3EYZ A;  3PNC A;  3C2K A;  4O5K A;  4KLS A;  4RQ3 A;  4IR1 A;  4QZG A;  2VA8 A;  4ED1 A;  2C2E A;  3K75 D;  5DLG A;  4UB1 A;  1ZJM A;  3N97 B;  4NM1 A;  3C1Z A;  5KT7 A;  1BPZ A;  8ICO A;  3T3F A;  2BDP A;  1BPD A;  2F1I A;  4ZH4 A;  3QEA Z;  3G6X A;  4BXO B;  4FS2 A;  3GV8 B;  1MQ3 A;  3MR6 A;  4UB2 A;  5D49 A;  5KFH A;  2F1J A;  4Q8F A;  5KFI A;  1ZET A;  4F4W A;  4TQS A;  4IRK A;  3TAP A;  3N4M B;  3M9M B;  5KT5 A;  4O9M A;  5J0O A;  3Q8Q B;  3RAX A;  2UVR A;  3V72 A;  1XSL A;  4ECV A;  3ISB A;  5HNK A;  1SZP A;  5L1J A;  4GC7 A;  2BPG A;  2NRW A;  5EWF A;  4LVS A;  5KFA A;  5HP4 A;  1ZQF A;  2AJQ A;  7ICF A;  1ZQT A;  8ICS A;  4PGY A;  4YG2 A;  7ICT A;  1IM4 A;  4DOA A;  1X2I A;  4J9L A;  1RYS A;  1BPY A;  3SYZ A;  5J2C A;  3GV7 B;  2M9N A;  5DQH A;  1K1S A;  4QWE A;  4YR2 A;  3UQ0 A;  3ZDD A;  1KRP A;  4DSF A;  3ZDA A;  3HWT A;  3HX0 A;  8ICB A;  3E2E A;  4F2S A;  4KLU A;  4LZG A;  3QZ7 A;  3BQ2 A;  2FLP A;  3RR7 A;  4IQW A;  5KG6 A;  5EWG A;  3PX6 A;  2PFP A;  1RPL A;  4B9U A;  4DFP A;  4FBU A;  4ELV A;  4YR3 A;  4DQR A;  3ZD9 A;  4YVZ A;  3KHL A;  4Q44 A;  2IA6 A;  8ICT A;  1ZQK A;  5J0Q A;  8ICR A;  2V4Q A;  4FO6 A;  8ICK A;  1ZQS A;  1QSY A;  1D8Y A;  1CEZ A;  4Q8E A;  4RQ0 A;  5J2J A;  4IQU A;  4DWI A;  1SL2 A;  2NRV A;  3NTU A;  9ICP A;  5DBC A;  4I2E A;  5IIN A;  3HW8 A;  1U48 A;  2R8K A;  3IM1 A;  2WTF A;  1DGS A;  4DO9 A;  3KHR A;  2IBK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...