2A1JB

Crystal structure of the complex between the c-terminal domains of human xpf and ercc1
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
79
structure length
79
Chain Sequence
DPADLLMEKLEQDFVSRVTECLTTVKSVNKTDSQTLLTTFGSLEQLIAASREDLALCPGLGPQKARRLFDVLHEPFLKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein
molecule keywords DNA repair endonuclease XPF
publication title Crystal structure and DNA binding functions of ERCC1, a subunit of the DNA structure-specific endonuclease XPF-ERCC1.
pubmed doi rcsb
source organism Homo sapiens
total genus 23
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2005-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00633 HHH Helix-hairpin-helix motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2a1jB01
2C2EA 1D9FA 4C8MA 5KFQA 4NM1A 5DBAA 1UA0A 5J0RA 1K1QA 4M04A 5BOLA 4IQVA 5KFXA 3QZ7A 3GIKA 3V7JA 3PMLA 4ECTA 2BQ3A 1SL2A 9ICLA 3T5LA 1MQ2A 4QZCA 3B0YA 3ISBA 5J2GA 1PZNA 3TAQA 2C22A 5HP4A 1X9MA 4GC7A 3LK9A 1KDHA 1TAUA 4UB5A 4IQTA 4I29A 1T3NA 4KLSA 3MGHA 4ECWA 2HHXA 4F5RA 3RB6A 4JV2A 5KFPA 4I2JA 3QEAZ 1T8EA 4TUQA 3RR8A 2MAXA 4YD1A 3HPOA 4DL2A 4O3SA 1B22A 4YD2A 2W9BB 1WCLA 8ICUA 4KLUA 3AUOA 4RUAA 4NLZA 2JEIA 4LZDA 4B9NA 5KFCA 1Y88A 8ICEA 1KFDA 4KITB 4QZHA 5J2IA 7ICLA 2W8LA 2IHMA 8ICRA 3ZDDA 3RJGA 4UQGA 1RPLA 5DB7A 2OWOA 1SZPA 3C1ZA 1ZQBA 7ICHA 3T5JA 5DDYA 4G3IA 1ZQUA 5L1KA 4DWIA 4DQQA 5J2JA 2KN7A 1TVAA 2NRTA 4ECRA 1S0MA 5L9XA 5KG6A 3MBYA 5KFRA 2HHSA 5KG0A 5HHHA 1NK0A 4I28A 4I2FA 5DLGA 5DDMA 5D4BA 4Z6FA 4DOCA 3M9MB 4ED3A 4QWDA 3ZDBA 4C8KA 4FBTA 2AJQA 2FLPA 1NKBA 2VA8A 9ICHA 2ZUBA 4I2DA 2PFPA 7ICFA 5KFTA 4YXMA 3LWMA 3RB4A 5J0TA 1QSYA 5J2BA 4O5EA 2BPGA 5DQGA 1X9WA 4NLKA 4DFMA 5KFEA 3PY8A 1U45A 2FMPA 7ICEA 1BPEA 1ZQFA 4P2HA 4HYKA 3KTQA 2ZUCA 3EZ5A 2RDJA 3QEBZ 4KLQA 3RAXA 2R8IA 4EZ9A 1MC8A 2F1JA 5J0YA 3ISCA 5C5JA 1X9SA 2JEGA 1JMSA 5DBCA 5KG5A 4FBUA 9ICXA 1UA1A 9ICGA 8ICKA 2BCUA 4M47A 5DGBA 2I1QA 3RH5A 4TQSA 3N97B 2PFQA 1KSPA 3M8SA 3V72A 5KFDA 5J2FA 4UBCA 3TFRA 1HUZA 4UB2A 2XCPA 3ZDAA 4F2SA 4QZBA 4J9PA 1XWLA 4DL3A 5DGAA 3SZ2A 5DG8A 3UPQA 3Q8KA 2P6RA 4K4GA 4O5CA 4MEYA 2KTQA 2HHVA 2R8KA 3KHHA 3UXOA 3GIMA 5HMMA 1ZYQA 4O9MA 3M9OB 3ISDA 5KFUA 4EBEA 4QWBA 7ICPA 4F4WA 4XA5A 2HHWA 4RQ7A 5KFWA 2XY7A 4QZDA 4DQPA 3JPTA 5DB8A 2Q0ZX 4F3OA 1NK6A 1LV5A 1XU4A 2AU0A 4RUCA 4RNOA 4UAZA 4ECYA 5DQIA 2ATLA 4EBCA 2FLLA 2FLNA 4YG2A 2UVUA 1Z00A 9ICRA 2ZTEA 1ZQWA 1L3SA 3RR7A 3KHRA 5KT2A 4F50A 4MF2A 4LZGA 2ZJ8A 4RNNA 1S0OA 1AROP 4DSIA 9ICPA 3E2EA 3C5GA 4O3PA 3RJIA 1NK7A 4JUZA 5KFBA 3MFHA 1NK4A 2W8KA 5KFAA 1SKWA 3IM1A 5J2CA 1KLNA 4NXZA 4IQWA 4YMOA 2V9WA 4KLJA 4QWCA 2XY6A 2UVRA 5J2EA 4O3RA 3HWTA 4F5QA 3PR5B 1T4GA 4TQRA 1JXEA 4DFKA 4YMNA 5DG7A 3BQ0A 4BGDA 4F5OA 3FDSA 1NJXA 2ISPA 3QE9Y 3T3FA 3OHBA 3TARA 4DEZA 3H8JA 1TK5A 5KFOA 1NK8A 4F4YA 2ZTCA 4BDPA 4RQ8A 3G6YA 3PW7A 3RAQA 3RRGA 3OJUA 4M0AA 4DSFA 4ED6A 3GIIA 4QZAA 1HJPA 4Z6EA 1CUKA 5CJ7A 2BKEA 4UB4A 7ICVA 5IIIA 2VA2A 3SYZA 4KMUA 2ASLA 2HVHA 2ZJ5A 1NKEA 9ICEA 4J9KA 1NOMA 4MF8A 3BJYA 1KFTA 3N4MB 1EXNA 5BOMA 1JXLA 4KLDA 5IIMA 2BQUA 4KLHA 4IQUA 4Q45A 5EWEA 4RPYA 1ZQLA 4MFCA 5IIOA 4UAWA 3MDAA 3EYZA 4XRHA 3TAPA 1XC9A 2AQ4A 3C23A 4M9LA 9ICSA 2BPCA 3UQ2A 5IIKA 1NK9A 1NJWA 4DL4A 4ELVA 3RBDA 1QSSA 5KFJA 9ICCA 4ECUA 1RXWA 2KZMA 1ZQRA 2R8GA 2UVWA 3JPRA 1JIHA 2IHNA 1C7YA 2PXIA 2BR0A 1CEZA 1NK5A 3PX0A 1X2IA 9ICMA 3JPSA 5J2AA 5L1JA 4QZIA 4YR2A 4ED2A 4DLEA 2J6SA 2FPLA 4C8OA 4PGYA 3M9NB 1S0VA 1ZQNA 3QZ8A 3RB3A 2BCSA 1LB2B 2UVVA 3V6KA 4M6WA 1D9DA 4LVSA 4KN4A 5KG4A 4KLMA 4GXJA 1H38A 3AU6A 3KHLA 1BPZA 1RYRA 4YCXA 4R65A 4MEXA 1D8YA 1V9PA 3G6XA 4RPXA 2JEJA 4NLNA 1KFSA 4RNMA 4TURA 2JZBA 3RJEA 4DL6A 3OSNA 2AGQA 1ZQSA 4UAYA 2FMQA 4GC6A 2HVIA 2XGPA 1XSLA 4NLGA 1N56A 2JEFA 5KFFA 4QWAA 4TUSA 3MR5A 5KFNA 4RPZA 4ECXA 5EWFA 4ECQA 1L5UA 2ISOA 5F9LA 2KFZA 4ELUA 3BQ2A 4JWNA 8ICSA 8ICZA 4F5NA 5KFKA 3MR2A 4R63A 4O0IA 5HMLA 5KT7A 4ECVA 8ICLA 4KN7A 4DFJA 3C21A 8ICWA 1RYSA 5D46A 2DPJA 4O3OA 3JPOA 4B9SA 4KLTA 3HX0A 2HHTA 3PMNA 3SI8A 1U48A 4UBBA 4XQ8A 2HHQA 3RBEA 4YFKA 1UT5A 4F91B 4F93B 9ICUA 5J2KA 4P4OA 2NRWA 7ICTA 2AQ0A 2ASJA 4GXKA 1SL1A 5CR0A 2NRVA 3PW0A 1UT8A 1NJYA 4B9UA 3AU2A 4DQRA 4P4PA 1BGXT 7ICJA 5HHIA 1D8LA 1Z3EB 4YVZA 2XC9A 1ZQQA 7ICGA 3V6HA 7ICIA 2BDPA 4NY8A 3PV8A 7ICKA 3LWLA 4DLGA 3MDCA 3GILA 3H4DA 4ELTA 3Q8PB 2V4QA 1ZQVA 2KZ3A 1U4BA 4QZGA 5KT5A 4JWMA 2PI4A 4KLLA 4ED8A 5JUMA 4IRKA 9ICIA 5KFHA 1S9FA 2PFNA 4ED1A 1S10A 3RH4A 1ZQZA 1U9LA 2NRZA 2P6UA 3MFIA 1MSWD 9ICJA 5KG3A 4BWJA 4Q43A 5J0XA 4UB1A 1KTQA 5CWRA 3Q8QB 4QZFA 4RT3A 3GV7B 2XY5A 1MQ3A 3TFSA 4R8UA 3RJHA 5J2DA 8ICFA 3C2MA 4KLIA 4PHPA 4YXJA 3EWAA 4Z6DA 4YMMA 4R64A 3M8RA 2R8HA 1COOA 3FYHA 4J9MA 4PGQA 4QZ8A 5IINA 4JV1A 1ZQKA 3T5KA 3GQCA 5KG7A 2VA3A 5F9NA 4RQ0A 9ICOA 3H8WA 1ZQIA 4R8UB 2IBKA 1Z00B 4GLXA 1QLNA 1ZETA 4KLGA 1ZQCA 4RU9A 1XO1A 3PO5A 4QW9A 2VANA 4CCHA 4M9GA 3HT3A 5CB1A 4PH5A 3H40A 2MUTA 2B21A 4PGXA 3H4BA 5J2HA 4EYHB 2GWSA 2XCAA 2PFOA 5J0QA 4DL7A 7ICSA 2V4RA 1ZQDA 3NTUA 3V7KA 3C2LA 3THVA 2I9GA 4M9HA 4KLEA 1SL0A 1K1SA 4EBDA 2BPFA 2HHUA 4RQ4A 4I2GA 1ZQXA 5KG1A 2W9AA 1L3UA 4J9RA 4F4KA 2C28A 3EW9A 2BHNA 4FS2A 8ICBA 9ICKA 4DSEA 3JPQA 2W9MA 3G6VA 5EOZA 4RT2A 4F92B 4EEYA 3HP6A 1U47A 3RH6A 1NKCA 3UXNA 4Q44A 5J0OA 4ED7A 2RDIA 2BCRA 2H5XA 4RQ2A 3RRHA 4BXOA 3EPIA 4J9QA 4J9NA 5DLFA 1TFRA 4QW8A 1ZQOA 2DPIA 1S76D 4YR0A 4DOBA 1QSLA 3Q8SB 3C2KA 4PHAA 5DG9A 1ZQTA 2J6UA 3RJJA 4K4IA 4K4HA 1S77D 2ASDA 1WCNA 5KFVA 4B9MA 5KT3A 1U49A 1L3VA 3K4GA 4MFAA 4ECSA 2FMSA 2BGWA 2P66A 8ICGA 1ZQGA 1JN3A 4I27A 4BXOB 2W9BA 1XSPA 4O3NA 4PPXA 3C5FA 5KG2A 2FPKA 3LDAA 1A77A 4J9OA 2IMWP 3ZDEA 1TAQA 5DBBA 2W9CA 5KT6A 5KT4A 3TI0A 4M9NA 4Q8EA 3IHQB 4IRDA 3HW8A 3OSPA 2DFLA 2BCQA 4F8RA 2A1JA 4I2HA 3EPGA 5CHGA 2LYHA 1ZQAA 4M6WB 2R8JA 4Z6CA 3MR3A 5D49A 9ICVA 2XGQA 1ZJNA 3SV4A 1XS9D 1S0NA 3H7IA 7ICQA 2W9CB 3GV8B 3V7LA 3PX6A 3RB0A 1RZTA 4DS4A 1TKDA 1ZQYA 4XUSA 5BPCA 3K75D 4QZEA 3OJSA 3TQ1A 2A1JB 8ICCA 2FPMA 2JZBB 5J0UA 4DOAA 3PVXA 4RQ1A 2M9NA 3UXPA 1L3TA 7ICMA 5L1LA 4BWMA 7ICUA 4PHDA 5TZVA 1NJZA 1SKRA 3NGDA 4DSLA 3B0XA 4J9LA 2AGOA 1ZQPA 4JK1A 4RQ3A 8ICPA 5KFSA 5DQHA 4DL5A 3PW5A 8ICQA 4NM2A 1HUOA 4C8NA 3GV5B 4FS1A 4F2RA 1T7PA 4PHEA 8ICJA 3BDPA 4F4ZA 3Q8RB 2BQRA 4YQWA 3MR6A 9ICWA 4KLOA 3ZDCA 1TV9A 4DSKA 2PI5A 5CP2A 9ICBA 3RTVA 3PNCA 1BPXA 4I2CA 4JV0A 8ICIA 8ICMA 1ZQMA 5EWGA 1BPBA 1SKSA 4DFPA 4P4MA 8ICHA 1BPDA 3SV3A 1IM4A 5DB9A 5KFGA 3ORYA 4DQIA 4M9JA 4X5VA 3PW4A 3PO4A 4GXIA 3BQ1A 1A76A 5J0WA 3RJFA 4ZH4A 4E0DA 8ICTA 5CA7A 2ALZA 8ICAA 1ZQHA 4I2BA 4I2IA 5KTQA 2F1IA 4I2EA 4RQ5A 7ICRA 2ZTDA 1XSNA 5KFIA 4IR1A 3UQ0A 4O5KA 1QTMA 1TK8A 4EYIB 2ZUDA 2WTFA 2AGPA 3KHGA 1RXVA 5IILA 2Y1JA 4QWEA 2F1HA 3OGUA 3PW2A 3GDXA 4EZ6A 4YN4A 3TANA 5HNKA 1S97A 4IR9A 2KZZA 4ED0A 5J29A 2J6TA 4YR3A 4F4XA 5KFYA 4QZ9A 1ZJMA 3RJKA 2NRXA 5IIJA 4KTQA 4B9LA 9ICTA 3Q8MA 3BQTA 3ZD8A 3JPNA 7ICNA 1ZQEA 8ICNA 4MFFA 5KFMA 4RQ6A 9ICAA 1BPYA 1IXRA 3Q8LA 4Q8FA 4C8LA 3ETLA 4F5PA 4ECZA 4DQSA 8ICYA 2XO7A 4YP3A 4DF8A 4TUPA 2KFNA 4DF4A 5J0SA 4R66A 2BCVA 4B9TA 3GIJA 5KFLA 4J9SA 2Y1IA 4DSJA 4O3QA 3MGIA 8ICOA 2ZJAA 4UB3A 4IRCA 1BVSA 1DGSA 2MUTB 4I2AA 4KLFA 3PX4A 5J0PA 1B43A 3JPPA 3PR4A 5DKWA 9ICQA 3GFKB 5DB6A 5KFZA 1TK0A 3T5HA 4FO6A 1KRPA 3C1YA 8ICVA 3OHAA 4RZRA 2IA6A 2HW3A 1KEJA 5L1IA 8ICXA 4DS5A 4M2YA 9ICFA 1N48A 1DOQA 2C2RA 1JX4A 4DO9A 9ICNA 3ZD9A 4B9VA 3MABA 1ZQJA 3V6JA 2C2DA 7ICOA 3H8SA
chains in the Genus database with same CATH superfamily
2C2EA 3OPXA 4PJ0U 5J0RA 2HMXA 2ODGA 5ALJA 5ALMA 3KKAC 4IQVA 1SL2A 3T5LA 4QZCA 3B0YA 5J2GA 3BZCA 2C22A 3LK9A 1TAUA 1ZD5A 2E8MA 4F5RA 2K4HA 4JV2A 1NNLA 1T8EA 4YD1A 3D2QA 4O3SA 3QUBA 1IG6A 8ICUA 3AUOA 1FFVA 4B9NA 4NLCA 3ZDDA 7ICHA 2GH1A 3C1ZA 4CDGA 5AKZA 2RP5A 1ZQUA 4ICAA 5L1KA 4NJ8A 2KN7A 5L9XA 2HHSA 5HHHA 2QKQA 5DLGA 5DDMA 3HJEA 4QWDA 4C8KA 4FBTA 3IV6A 1NKBA 3KFUF 2E1FA 2NV3A 2ZUBA 7ICFA 5B66U 2BZFA 1L8OA 5DQGA 1L7MA 1N2XA 1PK3A 3K1ZA 4C0ZA 3AL0B 3QEBZ 4QIWF 4EZ9A 2F1JA 1JMSA 5KG5A 3N7PD 5AK6A 2R18A 8ICKA 2BCUA 2OYYA 3MGVA 4TQSA 3N97B 2W7PA 1KSPA 1SXDA 2K4EA 3MC1A 2XCPA 8ICGA 4J9PA 1XWLA 4K4GA 3Q8KA 5GTIU 2KTQA 2B6GA 2HHVA 1X66A 2QB0B 1Z1BA 3ISDA 4EBEA 2HHWA 5KFWA 2BDUA 2G09A 2OM6A 2LM4A 2RHFA 2QLTA 1XU4A 1QQ6A 1T3QA 2K60A 2W43A 5A0LA 9ICRA 4YG2A 1N63A 3RR7A 1J97A 5KT2A 2W11A 4LZGA 4RNNA 1AQ6A 3E2EA 3C5GA 3QX7A 2XVTA 3AM9A 2W8KA 3IM1A 5J2CA 2KE7A 1KLNA 4IQWA 4YMOA 4KLJA 4QWCA 4O3RA 1T4GA 3QU9A 4QNLA 3QE9Y 2H3QA 1UQVA 3TARA 1MA7A 4DEZA 1TK5A 5KFOA 1S5LU 3RRGA 4M0AA 2KJ9A 3GIIA 4QZAA 4UB4A 2BKEA 2KOBA 4Y2YA 2ASLA 2ZJ5A 9ICEA 4J9KA 4MF8A 4WJ3B 5L1MA 4KLHA 2YN4A 4Q45A 4UAWA 5ALFA 4IC9A 2BPCA 5IIKA 1NJWA 3IRUA 2B0CA 1ZQRA 2KHVA 1CEZA 1NK5A 4CGZA 5L1JA 2G5HB 4PGYA 1ZQNA 3NVYA 3V6KA 1D9DA 5AHXA 4LVSA 4KN4A 3PSFA 5KG4A 4GXJA 4KLMA 3AU6A 3KHLA 2YTUA 4P0QB 4RPXA 4NLNA 1KFSA 2ZIUB 4RNMA 4TURA 1IIPA 4TUSA 5KFNA 2G08A 2Y0SC 4KMOB 3KZXA 5JRTA 8ICZA 3SQIA 3MR2A 1RYSA 2DPJA 1VDVA 4UBBA 1DK3A 3ALRA 1UT5A 4F91B 4F93B 9ICUA 2AQ0A 3QUTA 1SL1A 2NRVA 2I6XA 1UT8A 4B9UA 4P4PA 1D8LA 1ZQQA 3WK8A 4EENA 3V6HA 5AM3A 3LWLA 3L3FX 4DLGA 3GILA 2KZ3A 4QZGA 2F76X 3CNHA 3F2BA 5JUMA 5KFHA 2PFNA 4IL6U 3RH4A 4US9A 4QZFA 4RT3A 3TFSA 4R8UA 1B0XA 4YMMA 3FYHA 1JALA 2LI6A 4JV1A 2LHTA 5KG7A 4RQ0A 9ICOA 2VJ4A 4KLGA 3C28A 1ZQCA 2VANA 1VJ5A 2MUTA 2JV3A 4C4TA 1RM6C 7ICSA 2EAMA 3THVA 4KLEA 4BX9C 1K1SA 4EBDA 3RFAA 5KG1A 3EW9A 1T94A 2O6KA 2ZIXB 4EEYA 3HP6A 1JROA 2JR5A 2HOFA 1N62A 1ZXIA 2RDIA 5J0OA 2H5XA 2DPIA 3NVWA 4YR0A 2EZZA 3Q8SB 4PHAA 3C2KA 1ZQTA 2J6UA 3RJJA 2VJ5A 4DCCA 2P66A 3CYMA 1ZQGA 1XNSA 4BXOB 2KSOA 4O3NA 5KG2A 1A77A 2A3VA 3ZDEA 3OSPA 3EPGA 5ALOA 1XS9D 1S0NA 2OHFA 3GV8B 2W9CB 3PX6A 3ONNA 3QUCA 4DS4A 3TQ1A 3AQEA 2A1JB 2FPMA 7ICMA 3B9JA 2F8KA 3F2CA 4BWMA 4CRXA 2E8NA 4JK1A 2DF4B 4EEKA 5HR7A 4DL5A 4IS7A 3PW5A 8ICQA 3SD7A 4P0PB 4F4ZA 3Q8RB 4YQWA 3MR6A 1TV9A 4DSKA 5CP2A 3RTVA 5AKYA 1X40A 2W7OA 4DFPA 8ICHA 1UCVA 4OJOA 2AH5A 2ES6A 3PZPA 2KKPA 4M9JA 3PO4A 4GXIA 1A76A 4E0DA 2Y0SF 2D8CA 5CA7A 8ICAA 3ZI4A 4I2BA 1JRPA 2F1IA 2W54A 5ALZA 2WF6A 7ICRA 1DGJA 1XSNA 4IR1A 1O08A 5GTHU 2XI9A 5AM4A 1TK8A 4EYIB 2Q4TA 2WTFA 4UARA 1RXVA 5IILA 2F1HA 2QARA 3PW2A 3WKBA 5T14A 3GDXA 1S97A 4ED0A 3UMGA 2NRXA 4B9LA 3BQTA 3JPNA 8ICNA 3BS5A 2DGZA 2LPEA 3Q8LA 2LBOA 4TUPA 4DF4A 4R66A 4B9TA 5KFLA 2ZJAA 2MUTB 4KLFA 2D6FC 5ALSA 3PX4A 3JPPA 3PR4A 5KFZA 3T5HA 5ALYA 5ALDA 4RZRA 2IA6A 1KEJA 1DOQA 2ESEA 4DO9A 3MABA 3NVZA 1FFUA 4NM1A 4C8MA 2YX8A 3LVVA 1K1QA 4M04A 3TACB 3V7JA 3QZ7A 2BQ3A 1MQ2A 3CW2C 1PK1B 2F3NA 4OJPA 5HP4A 1X9MA 4GC7A 2OEHA 1KDHA 2ZXIA 5AM1A 2MAXA 3HPOA 1B22A 3NS1A 4LZDA 1KFDA 2HI0A 4EELA 1SZPA 1ZQBA 5J2JA 1P7DA 2NRTA 4ECRA 1A0PA 2HBJA 5KG6A 3MBYA 2EQYA 4I28A 4U6PA 3ZDBA 3AMZA 2W03A 4JB3A 4C7ZA 9ICHA 4YXMA 1JI7A 5J0TA 1QSYA 2K4PA 4NLKA 4PL2A 5KFEA 4DFMA 3PY8A 1VLBA 1U45A 2CRXA 1ZQFA 5AIBA 4P2HA 2R8IA 1PVPA 1MC8A 5KNIA 5J0YA 3ISCA 9ICXA 3T79A 2RQ5A 5DGBA 2QB0A 3V72A 4UBCA 1CRXA 4F2SA 4QZBA 1ZRMA 4O5CA 5DG8A 3UPQA 4JMUA 3UXOA 5HMMA 1ZYQA 4FZLA 4O9MA 2OH2A 4QWBA 4RQ7A 2XY7A 5EE9A 2QB1A 1NK6A 2AU0A 1KQQA 5E79U 3DV9A 2FLNA 2FLLA 1ZQWA 2QARB 1L3SA 4MF2A 2ZJ8A 1S0OA 4O3PA 3RJIA 4JUZA 3A0BU 1NK4A 1SKWA 2A19A 3BS5B 4NXZA 2E8OA 5J2EA 3TKAA 3HWTA 2F44A 1JXEA 5DG7A 4UAVA 4BGDA 4OJ5A 2ISPA 3OHBA 4UW9A 4DFDA 3PSTA 2FI1A 2ZTCA 4BDPA 3G6YA 3PW7A 4DSFA 1HJPA 4Z6EA 5CJ7A 7ICVA 3IG5A 3KBBA 3BJYA 1K5OA 3N4MB 5IIMA 4RPYA 5EWEA 4MFCA 3TAPA 2AQ4A 2VKQA 9ICCA 2R8GA 3JPRA 4NL9A 1C7YA 2PXIA 4P0QA 3PX0A 1X2IA 3JPSA 5AK5A 4ED2A 1WG8A 2FPLA 1RG6A 2ZIUA 2RRDA 4GFJA 4M6WA 1H38A 1RYRA 3QXGA 1V9PA 2JEJA 1TAMA 4FZNA 1SXEA 4CE6A 3RJEA 2AGQA 2W55A 3QNMA 4GC6A 2Z7JA 2JEFA 5KFFA 4QWAA 4ECQA 5EWFA 2YMLA 3VC8A 5F9LA 3NRZA 1JUDA 4ECVA 5KT7A 3C21A 2HBKA 4KLTA 2M0NA 1J2MA 1PVRA 2H3IA 4XQ8A 1MN8A 7ICTA 2ASJA 1J2NA 4GXKA 5FP0A 5CR0A 5AKXA 4DQRA 7ICJA 1Q3VA 7ICIA 3PV8A 3Q8PB 1ZQVA 1KL9A 2KIVA 4KLLA 4ED8A 4NL9C 4ED1A 2NRZA 1MSWD 3MFIA 5KG3A 4BWJA 5J0XA 3WKDA 3GV7B 1F0MA 3RJHA 3H0MB 4RQMA 4KLIA 1RDFA 3AQFA 5TISU 4Z6DA 4R64A 2EZYA 3M8RA 2P35A 1O03A 4PGQA 3S6JA 2WF7A 2HSZA 5F9NA 1ZQIA 4GLXA 3D2NA 1ZETA 3QUQA 3PO5A 1BNPA 3HT3A 5CB1A 3H4BA 2KJ5A 2XCAA 2PFOA 5J0QA 2K8BB 2JH1A 2ZIXA 2V4RA 2CN1A 2I9GA 1SL0A 2ZXHA 4RQ4A 1ZQXA 4J9RA 1S8OA 5AI4A 2AHOB 8ICBA 2LMRA 4DSEA 3JPQA 2W9MA 3G6VA 4F92B 2G06A 1X42A 1ZD3A 3RRHA 4BXOA 3ETRA 1S76D 3CRXA 4Y2XA 5DG9A 2W04A 1WCNA 4HAIA 3NUQA 5KFVA 1U49A 1L3VA 4MHVA 4ECSA 3VCBA 1RYUA 2HOIA 2FPKA 3LDAA 1SWVA 2MU2A 1TAQA 2W9CA 3D2SA 4M9NA 4PZOA 3QU5A 3HW8A 2A1JA 4BJQA 4M6WB 2R8JA 9ICVA 5D49A 1RZTA 3WU2U 4B9MA 4XUSA 1FEZA 1N61A 4DOAA 5J0UA 1L3TA 2WAQC 3UXPA 4ZOHC 4P0PA 5TZVA 1SKRA 3NGDA 4FFDA 3B0XA 3SAGA 2KG5A 2JRZA 5KFSA 2WF9A 2KICA 2YB4A 4OJLA 2IOHA 4NM2A 4C8NA 4US8A 8ICJA 9ICWA 4KLOA 3ZDCA 1ZOLA 4OJ6A 3WKCA 4JV0A 1ZQMA 1BPBA 3I1YA 1IM4A 5JU5A 5KFGA 2Y9UA 3AEVA 5J0WA 4ZH4A 3UM9A 1KBUA 8ICTA 5AKJA 1ZQHA 1YZ7A 1COKA 3QU4A 1OW5A 1C20A 2G0AA 4LJXA 1X6JA 2K8CB 4CF5A 3UQ0A 3M7DA 2JGAA 2WF8A 4KX5A 2AGPA 5ALLA 2Y1JA 2KEYA 1QCKA 5J29A 2J6TA 4QZ9A 1ZJMA 7ICNA 1ZQEA 2LM1A 1GO3F 9ICAA 1IXRA 3DEEA 4Q8FA 2ZIWB 3ETLA 4F5PA 8ICYA 3L5KA 1UHUA 4YP3A 2HCFA 3GIJA 4DSJA 3FC4A 1BVSA 5EE1A 5J0PA 9ICQA 3TADA 3GFKB 4FO6A 1XO0A 3HKZC 2CPRA 2D3DA 4M2YA 1JX4A 2KD1A 2I5HA 9ICNA 3ZD9A 4B9VA 2W3SA 3V6JA 1PK1A 1X6IA 7ICOA 1T7PA 5KFQA 1WUDA 3GIKA 5KFXA 9ICLA 2VIXA 4Y2PA 1PZNA 4C4RA 2PMZC 3TAQA 1RQNA 4IQTA 1T3NA 4KLSA 3GZFA 2HHXA 5ALPA 4DL2A 4YD2A 1WCLA 3N7RC 4RUAA 4NLZA 2JEIA 1Y88A 2F8LA 7ICLA 8ICRA 1L6NA 2JH7A 3T5JA 4G3IA 1KN5A 4UB6U 5AKEA 5KG0A 1NK0A 4I2FA 5D4BA 2H3FA 5ALIA 3M9MB 1RQLA 4DOCA 2VA8A 3KD3A 2NO5A 5KFTA 3RB4A 5ALWA 3TADC 2XIDA 4F72A 1X9WA 7ICEA 4HYKA 3KTQA 2ZUCA 3EZ5A 4KLQA 1X9SA 5JTIA 2JEGA 5C5JA 1UA1A 1HIWA 9ICGA 3QU2A 2I1QA 2WAQF 2PFQA 3M8SA 1OXJA 5J2FA 1B4FA 2GOLA 3FM9A 3ZDAA 2KNJA 2P6RA 3SR6A 3AN1A 3SZ2A 4MEYA 4NV0A 2WF5A 4NLBA 2LKYA 2OXOA 4F4WA 7ICPA 4DQPA 2ZIVA 4F3OA 3F5AA 1LV5A 4OD0A 3WK4A 2ATLA 5CEHA 2ZTEA 1OUQA 2YB1A 1AROP 4DSIA 9ICPA 5KFBA 3MFHA 3SAFA 5AKHA 1Q8KA 5ALQA 2UVRA 1V85A 4F5QA 3PR5B 4DFKA 4YMNA 2H3VA 3BQ0A 3FDSA 1NJXA 3T3FA 3H8JA 4F4YA 2LYBA 3OJUA 4ED6A 1CUKA 2WHEA 4QJFB 4KMUA 5F3XB 1NOMA 1KFTA 1EXNA 5BOMA 4KLDA 4C7YA 2KV2A 3MDAA 1FIQA 4XRHA 3C23A 4M9LA 1Q3UA 3UQ2A 4DL4A 4ELVA 1X9XA 2L5YA 1QSSA 5KFJA 2KZMA 2UVWA 2BR0A 5AK3A 9ICMA 1KKXA 2GO7A 5J2AA 4DLEA 3HKZF 3M9NB 1KW4A 2UVVA 3M6ZA 2BCSA 3E58A 5ALKA 4EX7A 4YCXA 4R65A 3SMVA 3G6XA 4DL6A 1ZQSA 2DKXA 2FMQA 3IDWA 2PMZF 3MR5A 4ECXA 1UPHA 3LYSA 2ISOA 2KFZA 5ALUA 4FZMA 4JWNA 8ICSA 4F5NA 5KFKA 4R63A 2E5SA 8ICLA 3F5EA 2KJ8A 4DFJA 3JPOA 2MSNA 3HX0A 2HHTA 3SI8A 1U48A 2HHQA 1ED1A 3D6JA 2NRWA 5ALVA 3PW0A 1NJYA 1L7PA 3AU2A 1BGXT 2EANA 5HHIA 1Z3EB 7ICGA 1WYGA 3C29A 4NY8A 7ICKA 3H4DA 2V4QA 5G5GA 2WB1C 1ZQ1C 1S9FA 3BQ7A 1ZQZA 2P6UA 4Q43A 4AYBC 4UB1A 1TE2A 4Y2TA 1N5WA 3Q8QB 2XY5A 8ICFA 3C2MA 4PHPA 2E8PA 4YXJA 2ZIVB 4PZNA 5IINA 1ZQKA 3T5KA 4NWIA 2VA3A 5AM2A 4USAA 4RU9A 4J03A 3EUB2 4QW9A 1Q46A 4PH5A 4PGXA 1QQ7A 4DL7A 1ZQDA 3V7KA 3C2LA 2BPFA 2HHUA 1F5SA 4I2GA 1Z4NA 1L3UA 1N60A 2PKEA 5J8YA 4RT2A 1SWWA 2EAPA 4U7CA 1U47A 3RH6A 1NKCA 4Q44A 4ED7A 2DKZA 5HR6A 3EPIA 4J9NA 5DLFA 1TFRA 3QYPA 4QW8A 1ZQOA 4ACOA 1QSLA 1S77D 4K4IA 4K4HA 2HDOA 2ASDA 4MFAA 4PL1A 2W9BA 1XSPA 3C5FA 3NASA 4J9OA 2GLEA 2IMWP 5DBBA 5KT6A 5KT4A 3IHQB 2JMGA 1LKYB 4F8RA 4I2HA 2DFLA 3HILA 5CHGA 2LYHA 4B6JA 2RLTA 4UASA 4Z6CA 3MR3A 2XGQA 3PSPA 1ZJNA 3SV4A 7ICQA 1TKDA 3RB0A 1IV8A 3WK7A 1ZQYA 5BPCA 3K75D 3OJSA 1SB3C 4Y2SA 4Y2UA 5K4LA 4OO1J 8ICCA 3H0RB 3PVXA 1QH9A 5L1LA 7ICUA 3KOOA 4PHDA 4DSLA 4J9LA 1ZQPA 2IOFA 5EE3A 1HUOA 3GV5B 4PHEA 3I76A 3SAHA 2PI5A 9ICBA 3PNCA 4OCZA 1SZHA 5J8YC 3QU7A 8ICMA 4P4MA 3SV3A 1BPDA 1M6YA 3KZIU 4X5VA 3PW4A 3BQ1A 3RJFA 2ALZA 3ED5A 4I2EA 3PSIA 2ZTDA 4UAUA 2DWQA 1QTMA 2ZUDA 5AKLA 2NYVA 3KHGA 3FAHA 3OGUA 2ZIWA 4EZ6A 1D8BA 5AI8A 4F4XA 5KFYA 3F53A 9ICTA 3Q8MA 4MFFA 5B5EU 5KFMA 2WB1F 1BPYA 1N5XA 1DXSA 4ECZA 4O3MA 2XO7A 2HOQA 2LYAA 2YMMA 5J0SA 4AYBF 8ICOA 2Y9TA 4J9SA 2Y1IA 4O3QA 2K89A 4IRCA 5ALEA 1ECWA 4CF3A 1B43A 4A8EA 5DKWA 1NZBA 1TK0A 1KRPA 3C1YA 3N7SC 4CNQA 8ICXA 4DS5A 1ZQJA 2FE9A 3H8SA 1D9FA 5DBAA 1UA0A 1LVHA 5BOLA 4ECTA 3PMLA 3ISBA 4UB8U 3BS7A 1L8LA 4UB5A 4I29A 3MGHA 4ECWA 3RB6A 5KFPA 4I2JA 3QEAZ 3RR8A 4TUQA 4C80A 2W9BB 4KLUA 5KFCA 2E3TA 8ICEA 4KITB 4QZHA 5J2IA 2W8LA 2IHMA 3RJGA 4UQGA 1RPLA 5DB7A 2OWOA 5DDYA 4DWIA 3BZKA 4DQQA 1TVAA 2N1RA 1S0MA 1SGGA 5KFRA 2H3ZA 1SIJA 4Z6FA 4ED3A 2AJQA 1ZRNA 2FLPA 2PFPA 4I2DA 3LWMA 2W3RA 5J2BA 4O5EA 2BPGA 1YT3A 2KVSA 3IG8A 4AP9A 2FMPA 1BPEA 2RDJA 3RAXA 5AM0A 4FBUA 5DBCA 2YMPA 3OTQA 4M47A 2OCEA 3WKAA 3RH5A 5KFDA 3TFRA 1HUZA 4UB2A 5DGAA 4DL3A 5AK4A 1WWUA 2R8KA 3KHHA 3SEIA 3GIMA 2AXTU 3M9OB 5KFUA 2YY6A 4XA5A 4QZDA 2K8AA 3JPTA 5DB8A 2Q0ZX 3H0LB 4RUCA 2JHDA 4RNOA 4UAZA 4ECYA 5DQIA 4EBCA 2UVUA 1Z00A 4Y2JA 3O0FA 1V38A 1L7OA 3KHRA 3U26A 4F50A 5AI9A 1CI4A 5AIAA 1NK7A 1ZD2P 3H8MA 4FE3A 5KFAA 2V9WA 2XY6A 4BUGA 3IP4B 5AKKA 4TQRA 5ALRA 4F5OA 3DDHA 1NK8A 4RQ8A 3RAQA 1NI3A 2F2AB 5IIIA 2VA2A 3SYZA 2HVHA 1NKEA 5H2FU 2KIWA 1JXLA 2BQUA 4EX6A 4IQUA 1ZQLA 3HRDD 5IIOA 3EYZA 1XC9A 9ICSA 1NK9A 5ALTA 3RBDA 2E1EA 5AKGA 4ECUA 1RXWA 1JIHA 2IHNA 1BNOA 4QZIA 4YR2A 2J6SA 3WK9A 3NVVA 4C8OA 1S0VA 3QZ8A 3RB3A 1LB2B 1BPZA 4MEXA 1D8YA 2KP7A 2JZBA 3OSNA 4UAYA 2HVIA 2A1AA 2XGPA 1XSLA 4NLGA 1N56A 4RPZA 2ZG6A 1L5UA 1DK2A 4ELUA 3UMBA 3BQ2A 4Y2QA 2YQEA 4O0IA 5C0YA 5HMLA 4KN7A 8ICWA 2NO4A 2KVCA 5D46A 5G5HA 3I28A 4O3OA 4B9SA 5AI0A 2MA1A 3R9KA 3PMNA 3RBEA 4YFKA 5J2KA 4P4OA 2EDUA 4KX3A 1YZ6A 1QQ5A 2HBMA 4YVZA 2XC9A 2G5IB 2BDPA 3SENA 1Z19A 4ELTA 5KL8B 3MDCA 2IOFK 1U4BA 2EZXA 5KT5A 4JWMA 2PI4A 2CXYA 4IRKA 9ICIA 1S10A 4Y2RA 1U9LA 9ICJA 4RQNA 3A0HU 3N28A 1KTQA 1FO4A 5CWRA 3IN5A 1MQ3A 5J2DA 2MRLA 3EWAA 4J9MA 2R8HA 1COOA 4QZ8A 5AI5A 3GQCA 1URJA 3H8WA 4R8UB 2IBKA 1Z00B 1QLNA 1XO1A 4CCHA 4F71A 4M9GA 5AM5A 2EH9A 3H40A 4EYHB 2B21A 5J2HA 2GWSA 2HBLA 2YMQA 1SV0A 4Y2VA 3NTUA 1Z1VA 4M9HA 2DQNB 3WK6A 2W9AA 5CRXA 4F4KA 2C28A 4FS2A 2BHNA 9ICKA 3GU3A 5EOZA 2WFAA 1PUZA 4CF4A 3UXNA 2BCRA 4RQ2A 3M6KA 4J9QA 3WK5A 3L4PA 5AICA 4DOBA 2FJ6A 2XICA 5KT3A 1LKYA 3K4GA 2FMSA 3E0FA 2BGWA 1JN3A 4I27A 3F2DA 1SV4A 1HEKA 5KAIU 4PPXA 3LVWA 3RF9A 5AI6A 5ALXA 3TI0A 4Q8EA 4IRDA 2BCQA 2DUYA 2KSOB 1ZQAA 4QIWC 3H7IA 3M1YA 3CP8A 3V7LA 2JXJA 4QZEA 3J81j 3UMCA 5ALNA 2JZBB 4RQ1A 2M9NA 1ZD4A 1SV0C 2FDRA 1NJZA 5AKIA 2AGOA 4RQ3A 2F77X 8ICPA 5DQHA 1A6SA 4F2RA 4FS1A 2KK0A 3BDPA 2BQRA 2DL0A 1BPXA 2KMDA 5EE0A 2EAOA 4I2CA 3ICXA 8ICIA 5ALHA 5EWGA 1SKSA 3WKEA 5DB9A 4GIBA 4DQIA 3ORYA 5KL1B 3KKAA 5KAFU 3NRWA 1DRGA 3K1RB 1Z4OA 4I2IA 5KTQA 4RQ5A 5KFIA 2K4IA 2DBYA 4O5KA 4QWEA 2KKVA 4YN4A 3TANA 5HNKA 4IR9A 4UATA 2KZZA 1NZPA 4YR3A 3RJKA 1WWVA 5IIJA 4KTQA 3ZD8A 4G9BA 4RQ6A 4C8LA 4DQSA 1L7NA 4DF8A 2KFNA 1V97A 2BCVA 3MGIA 4UB3A 1DGSA 4I2AA 4C4SA 5DB6A 2G07A 1PVQA 8ICVA 3OHAA 2HW3A 5L1IA 9ICFA 2KHQA 1N48A 2C2RA 1F44A 5ALGA 2C2DA
chains in the Genus database with same CATH topology
2C2EA 1D9FA 4C8MA 5KFQA 4NM1A 5DBAA 1UA0A 5J0RA 1K1QA 4M04A 5BOLA 4IQVA 5KFXA 3QZ7A 3GIKA 3V7JA 3PMLA 4ECTA 2BQ3A 1SL2A 9ICLA 3T5LA 1MQ2A 4QZCA 3B0YA 3ISBA 5J2GA 1PZNA 3TAQA 2C22A 5HP4A 1X9MA 4GC7A 3LK9A 1KDHA 1TAUA 4UB5A 4IQTA 4I29A 1T3NA 4KLSA 3MGHA 4ECWA 2HHXA 4F5RA 3RB6A 4JV2A 5KFPA 4I2JA 3QEAZ 1T8EA 4TUQA 3RR8A 2MAXA 4YD1A 3HPOA 4DL2A 4O3SA 1B22A 4YD2A 2W9BB 1WCLA 8ICUA 4KLUA 3AUOA 4RUAA 4NLZA 2JEIA 4LZDA 4B9NA 5KFCA 1Y88A 8ICEA 1KFDA 4KITB 4QZHA 5J2IA 7ICLA 2W8LA 2IHMA 8ICRA 3ZDDA 3RJGA 4UQGA 1RPLA 5DB7A 2OWOA 1SZPA 3C1ZA 1ZQBA 7ICHA 3T5JA 5DDYA 4G3IA 1ZQUA 5L1KA 4DWIA 4DQQA 5J2JA 2KN7A 1TVAA 2NRTA 4ECRA 1S0MA 5L9XA 5KG6A 3MBYA 5KFRA 2HHSA 5KG0A 5HHHA 1NK0A 4I28A 4I2FA 5DLGA 5DDMA 5D4BA 4Z6FA 4DOCA 3M9MB 4ED3A 4QWDA 3ZDBA 4C8KA 4FBTA 2AJQA 2FLPA 1NKBA 2VA8A 9ICHA 2ZUBA 4I2DA 2PFPA 7ICFA 5KFTA 4YXMA 3LWMA 3RB4A 5J0TA 1QSYA 5J2BA 4O5EA 2BPGA 5DQGA 1X9WA 4NLKA 4DFMA 5KFEA 3PY8A 1U45A 2FMPA 7ICEA 1BPEA 1ZQFA 4P2HA 4HYKA 3KTQA 2ZUCA 3EZ5A 2RDJA 3QEBZ 4KLQA 3RAXA 2R8IA 4EZ9A 1MC8A 2F1JA 5J0YA 3ISCA 5C5JA 1X9SA 2JEGA 1JMSA 5DBCA 5KG5A 4FBUA 9ICXA 1UA1A 9ICGA 8ICKA 2BCUA 4M47A 5DGBA 2I1QA 3RH5A 4TQSA 3N97B 2PFQA 1KSPA 3M8SA 3V72A 5KFDA 5J2FA 4UBCA 3TFRA 1HUZA 4UB2A 2XCPA 3ZDAA 4F2SA 4QZBA 4J9PA 1XWLA 4DL3A 5DGAA 3SZ2A 5DG8A 3UPQA 3Q8KA 2P6RA 4K4GA 4O5CA 4MEYA 2KTQA 2HHVA 2R8KA 3KHHA 3UXOA 3GIMA 5HMMA 1ZYQA 4O9MA 3M9OB 3ISDA 5KFUA 4EBEA 4QWBA 7ICPA 4F4WA 4XA5A 2HHWA 4RQ7A 5KFWA 2XY7A 4QZDA 4DQPA 3JPTA 5DB8A 2Q0ZX 4F3OA 1NK6A 1LV5A 1XU4A 2AU0A 4RUCA 4RNOA 4UAZA 4ECYA 5DQIA 2ATLA 4EBCA 2FLLA 2FLNA 4YG2A 2UVUA 1Z00A 9ICRA 2ZTEA 1ZQWA 1L3SA 3RR7A 3KHRA 5KT2A 4F50A 4MF2A 4LZGA 2ZJ8A 4RNNA 1S0OA 1AROP 4DSIA 9ICPA 3E2EA 3C5GA 4O3PA 3RJIA 1NK7A 4JUZA 5KFBA 3MFHA 1NK4A 2W8KA 5KFAA 1SKWA 3IM1A 5J2CA 1KLNA 4NXZA 4IQWA 4YMOA 2V9WA 4KLJA 4QWCA 2XY6A 2UVRA 5J2EA 4O3RA 3HWTA 4F5QA 3PR5B 1T4GA 4TQRA 1JXEA 4DFKA 4YMNA 5DG7A 3BQ0A 4BGDA 4F5OA 3FDSA 1NJXA 2ISPA 3QE9Y 3T3FA 3OHBA 3TARA 4DEZA 3H8JA 1TK5A 5KFOA 1NK8A 4F4YA 2ZTCA 4BDPA 4RQ8A 3G6YA 3PW7A 3RAQA 3RRGA 3OJUA 4M0AA 4DSFA 4ED6A 3GIIA 4QZAA 1HJPA 4Z6EA 1CUKA 5CJ7A 2BKEA 4UB4A 7ICVA 5IIIA 2VA2A 3SYZA 4KMUA 2ASLA 2HVHA 2ZJ5A 1NKEA 9ICEA 4J9KA 1NOMA 4MF8A 3BJYA 1KFTA 3N4MB 1EXNA 5BOMA 1JXLA 4KLDA 5IIMA 2BQUA 4KLHA 4IQUA 4Q45A 5EWEA 4RPYA 1ZQLA 4MFCA 5IIOA 4UAWA 3MDAA 3EYZA 4XRHA 3TAPA 1XC9A 2AQ4A 3C23A 4M9LA 9ICSA 2BPCA 3UQ2A 5IIKA 1NK9A 1NJWA 4DL4A 4ELVA 3RBDA 1QSSA 5KFJA 9ICCA 4ECUA 1RXWA 2KZMA 1ZQRA 2R8GA 2UVWA 3JPRA 1JIHA 2IHNA 1C7YA 2PXIA 2BR0A 1CEZA 1NK5A 3PX0A 1X2IA 9ICMA 3JPSA 5J2AA 5L1JA 4QZIA 4YR2A 4ED2A 4DLEA 2J6SA 2FPLA 4C8OA 4PGYA 3M9NB 1S0VA 1ZQNA 3QZ8A 3RB3A 2BCSA 1LB2B 2UVVA 3V6KA 4M6WA 1D9DA 4LVSA 4KN4A 5KG4A 4KLMA 4GXJA 1H38A 3AU6A 3KHLA 1BPZA 1RYRA 4YCXA 4R65A 4MEXA 1D8YA 1V9PA 3G6XA 4RPXA 2JEJA 4NLNA 1KFSA 4RNMA 4TURA 2JZBA 3RJEA 4DL6A 3OSNA 2AGQA 1ZQSA 4UAYA 2FMQA 4GC6A 2HVIA 2XGPA 1XSLA 4NLGA 1N56A 2JEFA 5KFFA 4QWAA 4TUSA 3MR5A 5KFNA 4RPZA 4ECXA 5EWFA 4ECQA 1L5UA 2ISOA 5F9LA 2KFZA 4ELUA 3BQ2A 4JWNA 8ICSA 8ICZA 4F5NA 5KFKA 3MR2A 4R63A 4O0IA 5HMLA 5KT7A 4ECVA 8ICLA 4KN7A 4DFJA 3C21A 8ICWA 1RYSA 5D46A 2DPJA 4O3OA 3JPOA 4B9SA 4KLTA 3HX0A 2HHTA 3PMNA 3SI8A 1U48A 4UBBA 4XQ8A 2HHQA 3RBEA 4YFKA 1UT5A 4F91B 4F93B 9ICUA 5J2KA 4P4OA 2NRWA 7ICTA 2AQ0A 2ASJA 4GXKA 1SL1A 5CR0A 2NRVA 3PW0A 1UT8A 1NJYA 4B9UA 3AU2A 4DQRA 4P4PA 1BGXT 7ICJA 5HHIA 1D8LA 1Z3EB 4YVZA 2XC9A 1ZQQA 7ICGA 3V6HA 7ICIA 2BDPA 4NY8A 3PV8A 7ICKA 3LWLA 4DLGA 3MDCA 3GILA 3H4DA 4ELTA 3Q8PB 2V4QA 1ZQVA 2KZ3A 1U4BA 4QZGA 5KT5A 4JWMA 2PI4A 4KLLA 4ED8A 5JUMA 4IRKA 9ICIA 5KFHA 1S9FA 2PFNA 4ED1A 1S10A 3RH4A 1ZQZA 1U9LA 2NRZA 2P6UA 3MFIA 1MSWD 9ICJA 5KG3A 4BWJA 4Q43A 5J0XA 4UB1A 1KTQA 5CWRA 3Q8QB 4QZFA 4RT3A 3GV7B 2XY5A 1MQ3A 3TFSA 4R8UA 3RJHA 5J2DA 8ICFA 3C2MA 4KLIA 4PHPA 4YXJA 3EWAA 4Z6DA 4YMMA 4R64A 3M8RA 2R8HA 1COOA 3FYHA 4J9MA 4PGQA 4QZ8A 5IINA 4JV1A 1ZQKA 3T5KA 3GQCA 5KG7A 2VA3A 5F9NA 4RQ0A 9ICOA 3H8WA 1ZQIA 4R8UB 2IBKA 1Z00B 4GLXA 1QLNA 1ZETA 4KLGA 1ZQCA 4RU9A 1XO1A 3PO5A 4QW9A 2VANA 4CCHA 4M9GA 3HT3A 5CB1A 4PH5A 3H40A 2MUTA 2B21A 4PGXA 3H4BA 5J2HA 4EYHB 2GWSA 2XCAA 2PFOA 5J0QA 4DL7A 7ICSA 2V4RA 1ZQDA 3NTUA 3V7KA 3C2LA 3THVA 2I9GA 4M9HA 4KLEA 1SL0A 1K1SA 4EBDA 2BPFA 2HHUA 4RQ4A 4I2GA 1ZQXA 5KG1A 2W9AA 1L3UA 4J9RA 4F4KA 2C28A 3EW9A 2BHNA 4FS2A 8ICBA 9ICKA 4DSEA 3JPQA 2W9MA 3G6VA 5EOZA 4RT2A 4F92B 4EEYA 3HP6A 1U47A 3RH6A 1NKCA 3UXNA 4Q44A 5J0OA 4ED7A 2RDIA 2BCRA 2H5XA 4RQ2A 3RRHA 4BXOA 3EPIA 4J9QA 4J9NA 5DLFA 1TFRA 4QW8A 1ZQOA 2DPIA 1S76D 4YR0A 4DOBA 1QSLA 3Q8SB 3C2KA 4PHAA 5DG9A 1ZQTA 2J6UA 3RJJA 4K4IA 4K4HA 1S77D 2ASDA 1WCNA 5KFVA 4B9MA 5KT3A 1U49A 1L3VA 3K4GA 4MFAA 4ECSA 2FMSA 2BGWA 2P66A 8ICGA 1ZQGA 1JN3A 4I27A 4BXOB 2W9BA 1XSPA 4O3NA 4PPXA 3C5FA 5KG2A 2FPKA 3LDAA 1A77A 4J9OA 2IMWP 3ZDEA 1TAQA 5DBBA 2W9CA 5KT6A 5KT4A 3TI0A 4M9NA 4Q8EA 3IHQB 4IRDA 3HW8A 3OSPA 2DFLA 2BCQA 4F8RA 2A1JA 4I2HA 3EPGA 5CHGA 2LYHA 1ZQAA 4M6WB 2R8JA 4Z6CA 3MR3A 5D49A 9ICVA 2XGQA 1ZJNA 3SV4A 1XS9D 1S0NA 3H7IA 7ICQA 2W9CB 3GV8B 3V7LA 3PX6A 3RB0A 1RZTA 4DS4A 1TKDA 1ZQYA 4XUSA 5BPCA 3K75D 4QZEA 3OJSA 3TQ1A 2A1JB 8ICCA 2FPMA 2JZBB 5J0UA 4DOAA 3PVXA 4RQ1A 2M9NA 3UXPA 1L3TA 7ICMA 5L1LA 4BWMA 7ICUA 4PHDA 5TZVA 1NJZA 1SKRA 3NGDA 4DSLA 3B0XA 4J9LA 2AGOA 1ZQPA 4JK1A 4RQ3A 8ICPA 5KFSA 5DQHA 4DL5A 3PW5A 8ICQA 4NM2A 1HUOA 4C8NA 3GV5B 4FS1A 4F2RA 1T7PA 4PHEA 8ICJA 3BDPA 4F4ZA 3Q8RB 2BQRA 4YQWA 3MR6A 9ICWA 4KLOA 3ZDCA 1TV9A 4DSKA 2PI5A 5CP2A 9ICBA 3RTVA 3PNCA 1BPXA 4I2CA 4JV0A 8ICIA 8ICMA 1ZQMA 5EWGA 1BPBA 1SKSA 4DFPA 4P4MA 8ICHA 1BPDA 3SV3A 1IM4A 5DB9A 5KFGA 3ORYA 4DQIA 4M9JA 4X5VA 3PW4A 3PO4A 4GXIA 3BQ1A 1A76A 5J0WA 3RJFA 4ZH4A 4E0DA 8ICTA 5CA7A 2ALZA 8ICAA 1ZQHA 4I2BA 4I2IA 5KTQA 2F1IA 4I2EA 4RQ5A 7ICRA 2ZTDA 1XSNA 5KFIA 4IR1A 3UQ0A 4O5KA 1QTMA 1TK8A 4EYIB 2ZUDA 2WTFA 2AGPA 3KHGA 1RXVA 5IILA 2Y1JA 4QWEA 2F1HA 3OGUA 3PW2A 3GDXA 4EZ6A 4YN4A 3TANA 5HNKA 1S97A 4IR9A 2KZZA 4ED0A 5J29A 2J6TA 4YR3A 4F4XA 5KFYA 4QZ9A 1ZJMA 3RJKA 2NRXA 5IIJA 4KTQA 4B9LA 9ICTA 3Q8MA 3BQTA 3ZD8A 3JPNA 7ICNA 1ZQEA 8ICNA 4MFFA 5KFMA 4RQ6A 9ICAA 1BPYA 1IXRA 3Q8LA 4Q8FA 4C8LA 3ETLA 4F5PA 4ECZA 4DQSA 8ICYA 2XO7A 4YP3A 4DF8A 4TUPA 2KFNA 4DF4A 5J0SA 4R66A 2BCVA 4B9TA 3GIJA 5KFLA 4J9SA 2Y1IA 4DSJA 4O3QA 3MGIA 8ICOA 2ZJAA 4UB3A 4IRCA 1BVSA 1DGSA 2MUTB 4I2AA 4KLFA 3PX4A 5J0PA 1B43A 3JPPA 3PR4A 5DKWA 9ICQA 3GFKB 5DB6A 5KFZA 1TK0A 3T5HA 4FO6A 1KRPA 3C1YA 8ICVA 3OHAA 4RZRA 2IA6A 2HW3A 1KEJA 5L1IA 8ICXA 4DS5A 4M2YA 9ICFA 1N48A 1DOQA 2C2RA 1JX4A 4DO9A 9ICNA 3ZD9A 4B9VA 3MABA 1ZQJA 3V6JA 2C2DA 7ICOA 3H8SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C2E A;  1D9F A;  4C8M A;  5KFQ A;  4NM1 A;  5DBA A;  1UA0 A;  5J0R A;  1K1Q A;  4M04 A;  5BOL A;  4IQV A;  5KFX A;  3QZ7 A;  3GIK A;  3V7J A;  3PML A;  4ECT A;  2BQ3 A;  1SL2 A;  9ICL A;  3T5L A;  1MQ2 A;  4QZC A;  3B0Y A;  3ISB A;  5J2G A;  1PZN A;  3TAQ A;  2C22 A;  5HP4 A;  1X9M A;  4GC7 A;  3LK9 A;  1KDH A;  1TAU A;  4UB5 A;  4IQT A;  4I29 A;  1T3N A;  4KLS A;  3MGH A;  4ECW A;  2HHX A;  4F5R A;  3RB6 A;  4JV2 A;  5KFP A;  4I2J A;  3QEA Z;  1T8E A;  4TUQ A;  3RR8 A;  2MAX A;  4YD1 A;  3HPO A;  4DL2 A;  4O3S A;  1B22 A;  4YD2 A;  2W9B B;  1WCL A;  8ICU A;  4KLU A;  3AUO A;  4RUA A;  4NLZ A;  2JEI A;  4LZD A;  4B9N A;  5KFC A;  1Y88 A;  8ICE A;  1KFD A;  4KIT B;  4QZH A;  5J2I A;  7ICL A;  2W8L A;  2IHM A;  8ICR A;  3ZDD A;  3RJG A;  4UQG A;  1RPL A;  5DB7 A;  2OWO A;  1SZP A;  3C1Z A;  1ZQB A;  7ICH A;  3T5J A;  5DDY A;  4G3I A;  1ZQU A;  5L1K A;  4DWI A;  4DQQ A;  5J2J A;  2KN7 A;  1TVA A;  2NRT A;  4ECR A;  1S0M A;  5L9X A;  5KG6 A;  3MBY A;  5KFR A;  2HHS A;  5KG0 A;  5HHH A;  1NK0 A;  4I28 A;  4I2F A;  5DLG A;  5DDM A;  5D4B A;  4Z6F A;  4DOC A;  3M9M B;  4ED3 A;  4QWD A;  3ZDB A;  4C8K A;  4FBT A;  2AJQ A;  2FLP A;  1NKB A;  2VA8 A;  9ICH A;  2ZUB A;  4I2D A;  2PFP A;  7ICF A;  5KFT A;  4YXM A;  3LWM A;  3RB4 A;  5J0T A;  1QSY A;  5J2B A;  4O5E A;  2BPG A;  5DQG A;  1X9W A;  4NLK A;  4DFM A;  5KFE A;  3PY8 A;  1U45 A;  2FMP A;  7ICE A;  1BPE A;  1ZQF A;  4P2H A;  4HYK A;  3KTQ A;  2ZUC A;  3EZ5 A;  2RDJ A;  3QEB Z;  4KLQ A;  3RAX A;  2R8I A;  4EZ9 A;  1MC8 A;  2F1J A;  5J0Y A;  3ISC A;  5C5J A;  1X9S A;  2JEG A;  1JMS A;  5DBC A;  5KG5 A;  4FBU A;  9ICX A;  1UA1 A;  9ICG A;  8ICK A;  2BCU A;  4M47 A;  5DGB A;  2I1Q A;  3RH5 A;  4TQS A;  3N97 B;  2PFQ A;  1KSP A;  3M8S A;  3V72 A;  5KFD A;  5J2F A;  4UBC A;  3TFR A;  1HUZ A;  4UB2 A;  2XCP A;  3ZDA A;  4F2S A;  4QZB A;  4J9P A;  1XWL A;  4DL3 A;  5DGA A;  3SZ2 A;  5DG8 A;  3UPQ A;  3Q8K A;  2P6R A;  4K4G A;  4O5C A;  4MEY A;  2KTQ A;  2HHV A;  2R8K A;  3KHH A;  3UXO A;  3GIM A;  5HMM A;  1ZYQ A;  4O9M A;  3M9O B;  3ISD A;  5KFU A;  4EBE A;  4QWB A;  7ICP A;  4F4W A;  4XA5 A;  2HHW A;  4RQ7 A;  5KFW A;  2XY7 A;  4QZD A;  4DQP A;  3JPT A;  5DB8 A;  2Q0Z X;  4F3O A;  1NK6 A;  1LV5 A;  1XU4 A;  2AU0 A;  4RUC A;  4RNO A;  4UAZ A;  4ECY A;  5DQI A;  2ATL A;  4EBC A;  2FLL A;  2FLN A;  4YG2 A;  2UVU A;  1Z00 A;  9ICR A;  2ZTE A;  1ZQW A;  1L3S A;  3RR7 A;  3KHR A;  5KT2 A;  4F50 A;  4MF2 A;  4LZG A;  2ZJ8 A;  4RNN A;  1S0O A;  1ARO P;  4DSI A;  9ICP A;  3E2E A;  3C5G A;  4O3P A;  3RJI A;  1NK7 A;  4JUZ A;  5KFB A;  3MFH A;  1NK4 A;  2W8K A;  5KFA A;  1SKW A;  3IM1 A;  5J2C A;  1KLN A;  4NXZ A;  4IQW A;  4YMO A;  2V9W A;  4KLJ A;  4QWC A;  2XY6 A;  2UVR A;  5J2E A;  4O3R A;  3HWT A;  4F5Q A;  3PR5 B;  1T4G A;  4TQR A;  1JXE A;  4DFK A;  4YMN A;  5DG7 A;  3BQ0 A;  4BGD A;  4F5O A;  3FDS A;  1NJX A;  2ISP A;  3QE9 Y;  3T3F A;  3OHB A;  3TAR A;  4DEZ A;  3H8J A;  1TK5 A;  5KFO A;  1NK8 A;  4F4Y A;  2ZTC A;  4BDP A;  4RQ8 A;  3G6Y A;  3PW7 A;  3RAQ A;  3RRG A;  3OJU A;  4M0A A;  4DSF A;  4ED6 A;  3GII A;  4QZA A;  1HJP A;  4Z6E A;  1CUK A;  5CJ7 A;  2BKE A;  4UB4 A;  7ICV A;  5III A;  2VA2 A;  3SYZ A;  4KMU A;  2ASL A;  2HVH A;  2ZJ5 A;  1NKE A;  9ICE A;  4J9K A;  1NOM A;  4MF8 A;  3BJY A;  1KFT A;  3N4M B;  1EXN A;  5BOM A;  1JXL A;  4KLD A;  5IIM A;  2BQU A;  4KLH A;  4IQU A;  4Q45 A;  5EWE A;  4RPY A;  1ZQL A;  4MFC A;  5IIO A;  4UAW A;  3MDA A;  3EYZ A;  4XRH A;  3TAP A;  1XC9 A;  2AQ4 A;  3C23 A;  4M9L A;  9ICS A;  2BPC A;  3UQ2 A;  5IIK A;  1NK9 A;  1NJW A;  4DL4 A;  4ELV A;  3RBD A;  1QSS A;  5KFJ A;  9ICC A;  4ECU A;  1RXW A;  2KZM A;  1ZQR A;  2R8G A;  2UVW A;  3JPR A;  1JIH A;  2IHN A;  1C7Y A;  2PXI A;  2BR0 A;  1CEZ A;  1NK5 A;  3PX0 A;  1X2I A;  9ICM A;  3JPS A;  5J2A A;  5L1J A;  4QZI A;  4YR2 A;  4ED2 A;  4DLE A;  2J6S A;  2FPL A;  4C8O A;  4PGY A;  3M9N B;  1S0V A;  1ZQN A;  3QZ8 A;  3RB3 A;  2BCS A;  1LB2 B;  2UVV A;  3V6K A;  4M6W A;  1D9D A;  4LVS A;  4KN4 A;  5KG4 A;  4KLM A;  4GXJ A;  1H38 A;  3AU6 A;  3KHL A;  1BPZ A;  1RYR A;  4YCX A;  4R65 A;  4MEX A;  1D8Y A;  1V9P A;  3G6X A;  4RPX A;  2JEJ A;  4NLN A;  1KFS A;  4RNM A;  4TUR A;  2JZB A;  3RJE A;  4DL6 A;  3OSN A;  2AGQ A;  1ZQS A;  4UAY A;  2FMQ A;  4GC6 A;  2HVI A;  2XGP A;  1XSL A;  4NLG A;  1N56 A;  2JEF A;  5KFF A;  4QWA A;  4TUS A;  3MR5 A;  5KFN A;  4RPZ A;  4ECX A;  5EWF A;  4ECQ A;  1L5U A;  2ISO A;  5F9L A;  2KFZ A;  4ELU A;  3BQ2 A;  4JWN A;  8ICS A;  8ICZ A;  4F5N A;  5KFK A;  3MR2 A;  4R63 A;  4O0I A;  5HML A;  5KT7 A;  4ECV A;  8ICL A;  4KN7 A;  4DFJ A;  3C21 A;  8ICW A;  1RYS A;  5D46 A;  2DPJ A;  4O3O A;  3JPO A;  4B9S A;  4KLT A;  3HX0 A;  2HHT A;  3PMN A;  3SI8 A;  1U48 A;  4UBB A;  4XQ8 A;  2HHQ A;  3RBE A;  4YFK A;  1UT5 A;  4F91 B;  4F93 B;  9ICU A;  5J2K A;  4P4O A;  2NRW A;  7ICT A;  2AQ0 A;  2ASJ A;  4GXK A;  1SL1 A;  5CR0 A;  2NRV A;  3PW0 A;  1UT8 A;  1NJY A;  4B9U A;  3AU2 A;  4DQR A;  4P4P A;  1BGX T;  7ICJ A;  5HHI A;  1D8L A;  1Z3E B;  4YVZ A;  2XC9 A;  1ZQQ A;  7ICG A;  3V6H A;  7ICI A;  2BDP A;  4NY8 A;  3PV8 A;  7ICK A;  3LWL A;  4DLG A;  3MDC A;  3GIL A;  3H4D A;  4ELT A;  3Q8P B;  2V4Q A;  1ZQV A;  2KZ3 A;  1U4B A;  4QZG A;  5KT5 A;  4JWM A;  2PI4 A;  4KLL A;  4ED8 A;  5JUM A;  4IRK A;  9ICI A;  5KFH A;  1S9F A;  2PFN A;  4ED1 A;  1S10 A;  3RH4 A;  1ZQZ A;  1U9L A;  2NRZ A;  2P6U A;  3MFI A;  1MSW D;  9ICJ A;  5KG3 A;  4BWJ A;  4Q43 A;  5J0X A;  4UB1 A;  1KTQ A;  5CWR A;  3Q8Q B;  4QZF A;  4RT3 A;  3GV7 B;  2XY5 A;  1MQ3 A;  3TFS A;  4R8U A;  3RJH A;  5J2D A;  8ICF A;  3C2M A;  4KLI A;  4PHP A;  4YXJ A;  3EWA A;  4Z6D A;  4YMM A;  4R64 A;  3M8R A;  2R8H A;  1COO A;  3FYH A;  4J9M A;  4PGQ A;  4QZ8 A;  5IIN A;  4JV1 A;  1ZQK A;  3T5K A;  3GQC A;  5KG7 A;  2VA3 A;  5F9N A;  4RQ0 A;  9ICO A;  3H8W A;  1ZQI A;  4R8U B;  2IBK A;  1Z00 B;  4GLX A;  1QLN A;  1ZET A;  4KLG A;  1ZQC A;  4RU9 A;  1XO1 A;  3PO5 A;  4QW9 A;  2VAN A;  4CCH A;  4M9G A;  3HT3 A;  5CB1 A;  4PH5 A;  3H40 A;  2MUT A;  2B21 A;  4PGX A;  3H4B A;  5J2H A;  4EYH B;  2GWS A;  2XCA A;  2PFO A;  5J0Q A;  4DL7 A;  7ICS A;  2V4R A;  1ZQD A;  3NTU A;  3V7K A;  3C2L A;  3THV A;  2I9G A;  4M9H A;  4KLE A;  1SL0 A;  1K1S A;  4EBD A;  2BPF A;  2HHU A;  4RQ4 A;  4I2G A;  1ZQX A;  5KG1 A;  2W9A A;  1L3U A;  4J9R A;  4F4K A;  2C28 A;  3EW9 A;  2BHN A;  4FS2 A;  8ICB A;  9ICK A;  4DSE A;  3JPQ A;  2W9M A;  3G6V A;  5EOZ A;  4RT2 A;  4F92 B;  4EEY A;  3HP6 A;  1U47 A;  3RH6 A;  1NKC A;  3UXN A;  4Q44 A;  5J0O A;  4ED7 A;  2RDI A;  2BCR A;  2H5X A;  4RQ2 A;  3RRH A;  4BXO A;  3EPI A;  4J9Q A;  4J9N A;  5DLF A;  1TFR A;  4QW8 A;  1ZQO A;  2DPI A;  1S76 D;  4YR0 A;  4DOB A;  1QSL A;  3Q8S B;  3C2K A;  4PHA A;  5DG9 A;  1ZQT A;  2J6U A;  3RJJ A;  4K4I A;  4K4H A;  1S77 D;  2ASD A;  1WCN A;  5KFV A;  4B9M A;  5KT3 A;  1U49 A;  1L3V A;  3K4G A;  4MFA A;  4ECS A;  2FMS A;  2BGW A;  2P66 A;  8ICG A;  1ZQG A;  1JN3 A;  4I27 A;  4BXO B;  2W9B A;  1XSP A;  4O3N A;  4PPX A;  3C5F A;  5KG2 A;  2FPK A;  3LDA A;  1A77 A;  4J9O A;  2IMW P;  3ZDE A;  1TAQ A;  5DBB A;  2W9C A;  5KT6 A;  5KT4 A;  3TI0 A;  4M9N A;  4Q8E A;  3IHQ B;  4IRD A;  3HW8 A;  3OSP A;  2DFL A;  2BCQ A;  4F8R A;  2A1J A;  4I2H A;  3EPG A;  5CHG A;  2LYH A;  1ZQA A;  4M6W B;  2R8J A;  4Z6C A;  3MR3 A;  5D49 A;  9ICV A;  2XGQ A;  1ZJN A;  3SV4 A;  1XS9 D;  1S0N A;  3H7I A;  7ICQ A;  2W9C B;  3GV8 B;  3V7L A;  3PX6 A;  3RB0 A;  1RZT A;  4DS4 A;  1TKD A;  1ZQY A;  4XUS A;  5BPC A;  3K75 D;  4QZE A;  3OJS A;  3TQ1 A;  2A1J B;  8ICC A;  2FPM A;  2JZB B;  5J0U A;  4DOA A;  3PVX A;  4RQ1 A;  2M9N A;  3UXP A;  1L3T A;  7ICM A;  5L1L A;  4BWM A;  7ICU A;  4PHD A;  5TZV A;  1NJZ A;  1SKR A;  3NGD A;  4DSL A;  3B0X A;  4J9L A;  2AGO A;  1ZQP A;  4JK1 A;  4RQ3 A;  8ICP A;  5KFS A;  5DQH A;  4DL5 A;  3PW5 A;  8ICQ A;  4NM2 A;  1HUO A;  4C8N A;  3GV5 B;  4FS1 A;  4F2R A;  1T7P A;  4PHE A;  8ICJ A;  3BDP A;  4F4Z A;  3Q8R B;  2BQR A;  4YQW A;  3MR6 A;  9ICW A;  4KLO A;  3ZDC A;  1TV9 A;  4DSK A;  2PI5 A;  5CP2 A;  9ICB A;  3RTV A;  3PNC A;  1BPX A;  4I2C A;  4JV0 A;  8ICI A;  8ICM A;  1ZQM A;  5EWG A;  1BPB A;  1SKS A;  4DFP A;  4P4M A;  8ICH A;  1BPD A;  3SV3 A;  1IM4 A;  5DB9 A;  5KFG A;  3ORY A;  4DQI A;  4M9J A;  4X5V A;  3PW4 A;  3PO4 A;  4GXI A;  3BQ1 A;  1A76 A;  5J0W A;  3RJF A;  4ZH4 A;  4E0D A;  8ICT A;  5CA7 A;  2ALZ A;  8ICA A;  1ZQH A;  4I2B A;  4I2I A;  5KTQ A;  2F1I A;  4I2E A;  4RQ5 A;  7ICR A;  2ZTD A;  1XSN A;  5KFI A;  4IR1 A;  3UQ0 A;  4O5K A;  1QTM A;  1TK8 A;  4EYI B;  2ZUD A;  2WTF A;  2AGP A;  3KHG A;  1RXV A;  5IIL A;  2Y1J A;  4QWE A;  2F1H A;  3OGU A;  3PW2 A;  3GDX A;  4EZ6 A;  4YN4 A;  3TAN A;  5HNK A;  1S97 A;  4IR9 A;  2KZZ A;  4ED0 A;  5J29 A;  2J6T A;  4YR3 A;  4F4X A;  5KFY A;  4QZ9 A;  1ZJM A;  3RJK A;  2NRX A;  5IIJ A;  4KTQ A;  4B9L A;  9ICT A;  3Q8M A;  3BQT A;  3ZD8 A;  3JPN A;  7ICN A;  1ZQE A;  8ICN A;  4MFF A;  5KFM A;  4RQ6 A;  9ICA A;  1BPY A;  1IXR A;  3Q8L A;  4Q8F A;  4C8L A;  3ETL A;  4F5P A;  4ECZ A;  4DQS A;  8ICY A;  2XO7 A;  4YP3 A;  4DF8 A;  4TUP A;  2KFN A;  4DF4 A;  5J0S A;  4R66 A;  2BCV A;  4B9T A;  3GIJ A;  5KFL A;  4J9S A;  2Y1I A;  4DSJ A;  4O3Q A;  3MGI A;  8ICO A;  2ZJA A;  4UB3 A;  4IRC A;  1BVS A;  1DGS A;  2MUT B;  4I2A A;  4KLF A;  3PX4 A;  5J0P A;  1B43 A;  3JPP A;  3PR4 A;  5DKW A;  9ICQ A;  3GFK B;  5DB6 A;  5KFZ A;  1TK0 A;  3T5H A;  4FO6 A;  1KRP A;  3C1Y A;  8ICV A;  3OHA A;  4RZR A;  2IA6 A;  2HW3 A;  1KEJ A;  5L1I A;  8ICX A;  4DS5 A;  4M2Y A;  9ICF A;  1N48 A;  1DOQ A;  2C2R A;  1JX4 A;  4DO9 A;  9ICN A;  3ZD9 A;  4B9V A;  3MAB A;  1ZQJ A;  3V6J A;  2C2D A;  7ICO A;  3H8S A; 
#chains in the Genus database with same CATH topology
 2C2E A;  3OPX A;  4PJ0 U;  5J0R A;  2HMX A;  2ODG A;  5ALJ A;  5ALM A;  3KKA C;  4IQV A;  1SL2 A;  3T5L A;  4QZC A;  3B0Y A;  5J2G A;  3BZC A;  2C22 A;  3LK9 A;  1TAU A;  1ZD5 A;  2E8M A;  4F5R A;  2K4H A;  4JV2 A;  1NNL A;  1T8E A;  4YD1 A;  3D2Q A;  4O3S A;  3QUB A;  1IG6 A;  8ICU A;  3AUO A;  1FFV A;  4B9N A;  4NLC A;  3ZDD A;  7ICH A;  2GH1 A;  3C1Z A;  4CDG A;  5AKZ A;  2RP5 A;  1ZQU A;  4ICA A;  5L1K A;  4NJ8 A;  2KN7 A;  5L9X A;  2HHS A;  5HHH A;  2QKQ A;  5DLG A;  5DDM A;  3HJE A;  4QWD A;  4C8K A;  4FBT A;  3IV6 A;  1NKB A;  3KFU F;  2E1F A;  2NV3 A;  2ZUB A;  7ICF A;  5B66 U;  2BZF A;  1L8O A;  5DQG A;  1L7M A;  1N2X A;  1PK3 A;  3K1Z A;  4C0Z A;  3AL0 B;  3QEB Z;  4QIW F;  4EZ9 A;  2F1J A;  1JMS A;  5KG5 A;  3N7P D;  5AK6 A;  2R18 A;  8ICK A;  2BCU A;  2OYY A;  3MGV A;  4TQS A;  3N97 B;  2W7P A;  1KSP A;  1SXD A;  2K4E A;  3MC1 A;  2XCP A;  8ICG A;  4J9P A;  1XWL A;  4K4G A;  3Q8K A;  5GTI U;  2KTQ A;  2B6G A;  2HHV A;  1X66 A;  2QB0 B;  1Z1B A;  3ISD A;  4EBE A;  2HHW A;  5KFW A;  2BDU A;  2G09 A;  2OM6 A;  2LM4 A;  2RHF A;  2QLT A;  1XU4 A;  1QQ6 A;  1T3Q A;  2K60 A;  2W43 A;  5A0L A;  9ICR A;  4YG2 A;  1N63 A;  3RR7 A;  1J97 A;  5KT2 A;  2W11 A;  4LZG A;  4RNN A;  1AQ6 A;  3E2E A;  3C5G A;  3QX7 A;  2XVT A;  3AM9 A;  2W8K A;  3IM1 A;  5J2C A;  2KE7 A;  1KLN A;  4IQW A;  4YMO A;  4KLJ A;  4QWC A;  4O3R A;  1T4G A;  3QU9 A;  4QNL A;  3QE9 Y;  2H3Q A;  1UQV A;  3TAR A;  1MA7 A;  4DEZ A;  1TK5 A;  5KFO A;  1S5L U;  3RRG A;  4M0A A;  2KJ9 A;  3GII A;  4QZA A;  4UB4 A;  2BKE A;  2KOB A;  4Y2Y A;  2ASL A;  2ZJ5 A;  9ICE A;  4J9K A;  4MF8 A;  4WJ3 B;  5L1M A;  4KLH A;  2YN4 A;  4Q45 A;  4UAW A;  5ALF A;  4IC9 A;  2BPC A;  5IIK A;  1NJW A;  3IRU A;  2B0C A;  1ZQR A;  2KHV A;  1CEZ A;  1NK5 A;  4CGZ A;  5L1J A;  2G5H B;  4PGY A;  1ZQN A;  3NVY A;  3V6K A;  1D9D A;  5AHX A;  4LVS A;  4KN4 A;  3PSF A;  5KG4 A;  4GXJ A;  4KLM A;  3AU6 A;  3KHL A;  2YTU A;  4P0Q B;  4RPX A;  4NLN A;  1KFS A;  2ZIU B;  4RNM A;  4TUR A;  1IIP A;  4TUS A;  5KFN A;  2G08 A;  2Y0S C;  4KMO B;  3KZX A;  5JRT A;  8ICZ A;  3SQI A;  3MR2 A;  1RYS A;  2DPJ A;  1VDV A;  4UBB A;  1DK3 A;  3ALR A;  1UT5 A;  4F91 B;  4F93 B;  9ICU A;  2AQ0 A;  3QUT A;  1SL1 A;  2NRV A;  2I6X A;  1UT8 A;  4B9U A;  4P4P A;  1D8L A;  1ZQQ A;  3WK8 A;  4EEN A;  3V6H A;  5AM3 A;  3LWL A;  3L3F X;  4DLG A;  3GIL A;  2KZ3 A;  4QZG A;  2F76 X;  3CNH A;  3F2B A;  5JUM A;  5KFH A;  2PFN A;  4IL6 U;  3RH4 A;  4US9 A;  4QZF A;  4RT3 A;  3TFS A;  4R8U A;  1B0X A;  4YMM A;  3FYH A;  1JAL A;  2LI6 A;  4JV1 A;  2LHT A;  5KG7 A;  4RQ0 A;  9ICO A;  2VJ4 A;  4KLG A;  3C28 A;  1ZQC A;  2VAN A;  1VJ5 A;  2MUT A;  2JV3 A;  4C4T A;  1RM6 C;  7ICS A;  2EAM A;  3THV A;  4KLE A;  4BX9 C;  1K1S A;  4EBD A;  3RFA A;  5KG1 A;  3EW9 A;  1T94 A;  2O6K A;  2ZIX B;  4EEY A;  3HP6 A;  1JRO A;  2JR5 A;  2HOF A;  1N62 A;  1ZXI A;  2RDI A;  5J0O A;  2H5X A;  2DPI A;  3NVW A;  4YR0 A;  2EZZ A;  3Q8S B;  4PHA A;  3C2K A;  1ZQT A;  2J6U A;  3RJJ A;  2VJ5 A;  4DCC A;  2P66 A;  3CYM A;  1ZQG A;  1XNS A;  4BXO B;  2KSO A;  4O3N A;  5KG2 A;  1A77 A;  2A3V A;  3ZDE A;  3OSP A;  3EPG A;  5ALO A;  1XS9 D;  1S0N A;  2OHF A;  3GV8 B;  2W9C B;  3PX6 A;  3ONN A;  3QUC A;  4DS4 A;  3TQ1 A;  3AQE A;  2A1J B;  2FPM A;  7ICM A;  3B9J A;  2F8K A;  3F2C A;  4BWM A;  4CRX A;  2E8N A;  4JK1 A;  2DF4 B;  4EEK A;  5HR7 A;  4DL5 A;  4IS7 A;  3PW5 A;  8ICQ A;  3SD7 A;  4P0P B;  4F4Z A;  3Q8R B;  4YQW A;  3MR6 A;  1TV9 A;  4DSK A;  5CP2 A;  3RTV A;  5AKY A;  1X40 A;  2W7O A;  4DFP A;  8ICH A;  1UCV A;  4OJO A;  2AH5 A;  2ES6 A;  3PZP A;  2KKP A;  4M9J A;  3PO4 A;  4GXI A;  1A76 A;  4E0D A;  2Y0S F;  2D8C A;  5CA7 A;  8ICA A;  3ZI4 A;  4I2B A;  1JRP A;  2F1I A;  2W54 A;  5ALZ A;  2WF6 A;  7ICR A;  1DGJ A;  1XSN A;  4IR1 A;  1O08 A;  5GTH U;  2XI9 A;  5AM4 A;  1TK8 A;  4EYI B;  2Q4T A;  2WTF A;  4UAR A;  1RXV A;  5IIL A;  2F1H A;  2QAR A;  3PW2 A;  3WKB A;  5T14 A;  3GDX A;  1S97 A;  4ED0 A;  3UMG A;  2NRX A;  4B9L A;  3BQT A;  3JPN A;  8ICN A;  3BS5 A;  2DGZ A;  2LPE A;  3Q8L A;  2LBO A;  4TUP A;  4DF4 A;  4R66 A;  4B9T A;  5KFL A;  2ZJA A;  2MUT B;  4KLF A;  2D6F C;  5ALS A;  3PX4 A;  3JPP A;  3PR4 A;  5KFZ A;  3T5H A;  5ALY A;  5ALD A;  4RZR A;  2IA6 A;  1KEJ A;  1DOQ A;  2ESE A;  4DO9 A;  3MAB A;  3NVZ A;  1FFU A;  4NM1 A;  4C8M A;  2YX8 A;  3LVV A;  1K1Q A;  4M04 A;  3TAC B;  3V7J A;  3QZ7 A;  2BQ3 A;  1MQ2 A;  3CW2 C;  1PK1 B;  2F3N A;  4OJP A;  5HP4 A;  1X9M A;  4GC7 A;  2OEH A;  1KDH A;  2ZXI A;  5AM1 A;  2MAX A;  3HPO A;  1B22 A;  3NS1 A;  4LZD A;  1KFD A;  2HI0 A;  4EEL A;  1SZP A;  1ZQB A;  5J2J A;  1P7D A;  2NRT A;  4ECR A;  1A0P A;  2HBJ A;  5KG6 A;  3MBY A;  2EQY A;  4I28 A;  4U6P A;  3ZDB A;  3AMZ A;  2W03 A;  4JB3 A;  4C7Z A;  9ICH A;  4YXM A;  1JI7 A;  5J0T A;  1QSY A;  2K4P A;  4NLK A;  4PL2 A;  5KFE A;  4DFM A;  3PY8 A;  1VLB A;  1U45 A;  2CRX A;  1ZQF A;  5AIB A;  4P2H A;  2R8I A;  1PVP A;  1MC8 A;  5KNI A;  5J0Y A;  3ISC A;  9ICX A;  3T79 A;  2RQ5 A;  5DGB A;  2QB0 A;  3V72 A;  4UBC A;  1CRX A;  4F2S A;  4QZB A;  1ZRM A;  4O5C A;  5DG8 A;  3UPQ A;  4JMU A;  3UXO A;  5HMM A;  1ZYQ A;  4FZL A;  4O9M A;  2OH2 A;  4QWB A;  4RQ7 A;  2XY7 A;  5EE9 A;  2QB1 A;  1NK6 A;  2AU0 A;  1KQQ A;  5E79 U;  3DV9 A;  2FLN A;  2FLL A;  1ZQW A;  2QAR B;  1L3S A;  4MF2 A;  2ZJ8 A;  1S0O A;  4O3P A;  3RJI A;  4JUZ A;  3A0B U;  1NK4 A;  1SKW A;  2A19 A;  3BS5 B;  4NXZ A;  2E8O A;  5J2E A;  3TKA A;  3HWT A;  2F44 A;  1JXE A;  5DG7 A;  4UAV A;  4BGD A;  4OJ5 A;  2ISP A;  3OHB A;  4UW9 A;  4DFD A;  3PST A;  2FI1 A;  2ZTC A;  4BDP A;  3G6Y A;  3PW7 A;  4DSF A;  1HJP A;  4Z6E A;  5CJ7 A;  7ICV A;  3IG5 A;  3KBB A;  3BJY A;  1K5O A;  3N4M B;  5IIM A;  4RPY A;  5EWE A;  4MFC A;  3TAP A;  2AQ4 A;  2VKQ A;  9ICC A;  2R8G A;  3JPR A;  4NL9 A;  1C7Y A;  2PXI A;  4P0Q A;  3PX0 A;  1X2I A;  3JPS A;  5AK5 A;  4ED2 A;  1WG8 A;  2FPL A;  1RG6 A;  2ZIU A;  2RRD A;  4GFJ A;  4M6W A;  1H38 A;  1RYR A;  3QXG A;  1V9P A;  2JEJ A;  1TAM A;  4FZN A;  1SXE A;  4CE6 A;  3RJE A;  2AGQ A;  2W55 A;  3QNM A;  4GC6 A;  2Z7J A;  2JEF A;  5KFF A;  4QWA A;  4ECQ A;  5EWF A;  2YML A;  3VC8 A;  5F9L A;  3NRZ A;  1JUD A;  4ECV A;  5KT7 A;  3C21 A;  2HBK A;  4KLT A;  2M0N A;  1J2M A;  1PVR A;  2H3I A;  4XQ8 A;  1MN8 A;  7ICT A;  2ASJ A;  1J2N A;  4GXK A;  5FP0 A;  5CR0 A;  5AKX A;  4DQR A;  7ICJ A;  1Q3V A;  7ICI A;  3PV8 A;  3Q8P B;  1ZQV A;  1KL9 A;  2KIV A;  4KLL A;  4ED8 A;  4NL9 C;  4ED1 A;  2NRZ A;  1MSW D;  3MFI A;  5KG3 A;  4BWJ A;  5J0X A;  3WKD A;  3GV7 B;  1F0M A;  3RJH A;  3H0M B;  4RQM A;  4KLI A;  1RDF A;  3AQF A;  5TIS U;  4Z6D A;  4R64 A;  2EZY A;  3M8R A;  2P35 A;  1O03 A;  4PGQ A;  3S6J A;  2WF7 A;  2HSZ A;  5F9N A;  1ZQI A;  4GLX A;  3D2N A;  1ZET A;  3QUQ A;  3PO5 A;  1BNP A;  3HT3 A;  5CB1 A;  3H4B A;  2KJ5 A;  2XCA A;  2PFO A;  5J0Q A;  2K8B B;  2JH1 A;  2ZIX A;  2V4R A;  2CN1 A;  2I9G A;  1SL0 A;  2ZXH A;  4RQ4 A;  1ZQX A;  4J9R A;  1S8O A;  5AI4 A;  2AHO B;  8ICB A;  2LMR A;  4DSE A;  3JPQ A;  2W9M A;  3G6V A;  4F92 B;  2G06 A;  1X42 A;  1ZD3 A;  3RRH A;  4BXO A;  3ETR A;  1S76 D;  3CRX A;  4Y2X A;  5DG9 A;  2W04 A;  1WCN A;  4HAI A;  3NUQ A;  5KFV A;  1U49 A;  1L3V A;  4MHV A;  4ECS A;  3VCB A;  1RYU A;  2HOI A;  2FPK A;  3LDA A;  1SWV A;  2MU2 A;  1TAQ A;  2W9C A;  3D2S A;  4M9N A;  4PZO A;  3QU5 A;  3HW8 A;  2A1J A;  4BJQ A;  4M6W B;  2R8J A;  9ICV A;  5D49 A;  1RZT A;  3WU2 U;  4B9M A;  4XUS A;  1FEZ A;  1N61 A;  4DOA A;  5J0U A;  1L3T A;  2WAQ C;  3UXP A;  4ZOH C;  4P0P A;  5TZV A;  1SKR A;  3NGD A;  4FFD A;  3B0X A;  3SAG A;  2KG5 A;  2JRZ A;  5KFS A;  2WF9 A;  2KIC A;  2YB4 A;  4OJL A;  2IOH A;  4NM2 A;  4C8N A;  4US8 A;  8ICJ A;  9ICW A;  4KLO A;  3ZDC A;  1ZOL A;  4OJ6 A;  3WKC A;  4JV0 A;  1ZQM A;  1BPB A;  3I1Y A;  1IM4 A;  5JU5 A;  5KFG A;  2Y9U A;  3AEV A;  5J0W A;  4ZH4 A;  3UM9 A;  1KBU A;  8ICT A;  5AKJ A;  1ZQH A;  1YZ7 A;  1COK A;  3QU4 A;  1OW5 A;  1C20 A;  2G0A A;  4LJX A;  1X6J A;  2K8C B;  4CF5 A;  3UQ0 A;  3M7D A;  2JGA A;  2WF8 A;  4KX5 A;  2AGP A;  5ALL A;  2Y1J A;  2KEY A;  1QCK A;  5J29 A;  2J6T A;  4QZ9 A;  1ZJM A;  7ICN A;  1ZQE A;  2LM1 A;  1GO3 F;  9ICA A;  1IXR A;  3DEE A;  4Q8F A;  2ZIW B;  3ETL A;  4F5P A;  8ICY A;  3L5K A;  1UHU A;  4YP3 A;  2HCF A;  3GIJ A;  4DSJ A;  3FC4 A;  1BVS A;  5EE1 A;  5J0P A;  9ICQ A;  3TAD A;  3GFK B;  4FO6 A;  1XO0 A;  3HKZ C;  2CPR A;  2D3D A;  4M2Y A;  1JX4 A;  2KD1 A;  2I5H A;  9ICN A;  3ZD9 A;  4B9V A;  2W3S A;  3V6J A;  1PK1 A;  1X6I A;  7ICO A;  1T7P A;  5KFQ A;  1WUD A;  3GIK A;  5KFX A;  9ICL A;  2VIX A;  4Y2P A;  1PZN A;  4C4R A;  2PMZ C;  3TAQ A;  1RQN A;  4IQT A;  1T3N A;  4KLS A;  3GZF A;  2HHX A;  5ALP A;  4DL2 A;  4YD2 A;  1WCL A;  3N7R C;  4RUA A;  4NLZ A;  2JEI A;  1Y88 A;  2F8L A;  7ICL A;  8ICR A;  1L6N A;  2JH7 A;  3T5J A;  4G3I A;  1KN5 A;  4UB6 U;  5AKE A;  5KG0 A;  1NK0 A;  4I2F A;  5D4B A;  2H3F A;  5ALI A;  3M9M B;  1RQL A;  4DOC A;  2VA8 A;  3KD3 A;  2NO5 A;  5KFT A;  3RB4 A;  5ALW A;  3TAD C;  2XID A;  4F72 A;  1X9W A;  7ICE A;  4HYK A;  3KTQ A;  2ZUC A;  3EZ5 A;  4KLQ A;  1X9S A;  5JTI A;  2JEG A;  5C5J A;  1UA1 A;  1HIW A;  9ICG A;  3QU2 A;  2I1Q A;  2WAQ F;  2PFQ A;  3M8S A;  1OXJ A;  5J2F A;  1B4F A;  2GOL A;  3FM9 A;  3ZDA A;  2KNJ A;  2P6R A;  3SR6 A;  3AN1 A;  3SZ2 A;  4MEY A;  4NV0 A;  2WF5 A;  4NLB A;  2LKY A;  2OXO A;  4F4W A;  7ICP A;  4DQP A;  2ZIV A;  4F3O A;  3F5A A;  1LV5 A;  4OD0 A;  3WK4 A;  2ATL A;  5CEH A;  2ZTE A;  1OUQ A;  2YB1 A;  1ARO P;  4DSI A;  9ICP A;  5KFB A;  3MFH A;  3SAF A;  5AKH A;  1Q8K A;  5ALQ A;  2UVR A;  1V85 A;  4F5Q A;  3PR5 B;  4DFK A;  4YMN A;  2H3V A;  3BQ0 A;  3FDS A;  1NJX A;  3T3F A;  3H8J A;  4F4Y A;  2LYB A;  3OJU A;  4ED6 A;  1CUK A;  2WHE A;  4QJF B;  4KMU A;  5F3X B;  1NOM A;  1KFT A;  1EXN A;  5BOM A;  4KLD A;  4C7Y A;  2KV2 A;  3MDA A;  1FIQ A;  4XRH A;  3C23 A;  4M9L A;  1Q3U A;  3UQ2 A;  4DL4 A;  4ELV A;  1X9X A;  2L5Y A;  1QSS A;  5KFJ A;  2KZM A;  2UVW A;  2BR0 A;  5AK3 A;  9ICM A;  1KKX A;  2GO7 A;  5J2A A;  4DLE A;  3HKZ F;  3M9N B;  1KW4 A;  2UVV A;  3M6Z A;  2BCS A;  3E58 A;  5ALK A;  4EX7 A;  4YCX A;  4R65 A;  3SMV A;  3G6X A;  4DL6 A;  1ZQS A;  2DKX A;  2FMQ A;  3IDW A;  2PMZ F;  3MR5 A;  4ECX A;  1UPH A;  3LYS A;  2ISO A;  2KFZ A;  5ALU A;  4FZM A;  4JWN A;  8ICS A;  4F5N A;  5KFK A;  4R63 A;  2E5S A;  8ICL A;  3F5E A;  2KJ8 A;  4DFJ A;  3JPO A;  2MSN A;  3HX0 A;  2HHT A;  3SI8 A;  1U48 A;  2HHQ A;  1ED1 A;  3D6J A;  2NRW A;  5ALV A;  3PW0 A;  1NJY A;  1L7P A;  3AU2 A;  1BGX T;  2EAN A;  5HHI A;  1Z3E B;  7ICG A;  1WYG A;  3C29 A;  4NY8 A;  7ICK A;  3H4D A;  2V4Q A;  5G5G A;  2WB1 C;  1ZQ1 C;  1S9F A;  3BQ7 A;  1ZQZ A;  2P6U A;  4Q43 A;  4AYB C;  4UB1 A;  1TE2 A;  4Y2T A;  1N5W A;  3Q8Q B;  2XY5 A;  8ICF A;  3C2M A;  4PHP A;  2E8P A;  4YXJ A;  2ZIV B;  4PZN A;  5IIN A;  1ZQK A;  3T5K A;  4NWI A;  2VA3 A;  5AM2 A;  4USA A;  4RU9 A;  4J03 A;  3EUB 2;  4QW9 A;  1Q46 A;  4PH5 A;  4PGX A;  1QQ7 A;  4DL7 A;  1ZQD A;  3V7K A;  3C2L A;  2BPF A;  2HHU A;  1F5S A;  4I2G A;  1Z4N A;  1L3U A;  1N60 A;  2PKE A;  5J8Y A;  4RT2 A;  1SWW A;  2EAP A;  4U7C A;  1U47 A;  3RH6 A;  1NKC A;  4Q44 A;  4ED7 A;  2DKZ A;  5HR6 A;  3EPI A;  4J9N A;  5DLF A;  1TFR A;  3QYP A;  4QW8 A;  1ZQO A;  4ACO A;  1QSL A;  1S77 D;  4K4I A;  4K4H A;  2HDO A;  2ASD A;  4MFA A;  4PL1 A;  2W9B A;  1XSP A;  3C5F A;  3NAS A;  4J9O A;  2GLE A;  2IMW P;  5DBB A;  5KT6 A;  5KT4 A;  3IHQ B;  2JMG A;  1LKY B;  4F8R A;  4I2H A;  2DFL A;  3HIL A;  5CHG A;  2LYH A;  4B6J A;  2RLT A;  4UAS A;  4Z6C A;  3MR3 A;  2XGQ A;  3PSP A;  1ZJN A;  3SV4 A;  7ICQ A;  1TKD A;  3RB0 A;  1IV8 A;  3WK7 A;  1ZQY A;  5BPC A;  3K75 D;  3OJS A;  1SB3 C;  4Y2S A;  4Y2U A;  5K4L A;  4OO1 J;  8ICC A;  3H0R B;  3PVX A;  1QH9 A;  5L1L A;  7ICU A;  3KOO A;  4PHD A;  4DSL A;  4J9L A;  1ZQP A;  2IOF A;  5EE3 A;  1HUO A;  3GV5 B;  4PHE A;  3I76 A;  3SAH A;  2PI5 A;  9ICB A;  3PNC A;  4OCZ A;  1SZH A;  5J8Y C;  3QU7 A;  8ICM A;  4P4M A;  3SV3 A;  1BPD A;  1M6Y A;  3KZI U;  4X5V A;  3PW4 A;  3BQ1 A;  3RJF A;  2ALZ A;  3ED5 A;  4I2E A;  3PSI A;  2ZTD A;  4UAU A;  2DWQ A;  1QTM A;  2ZUD A;  5AKL A;  2NYV A;  3KHG A;  3FAH A;  3OGU A;  2ZIW A;  4EZ6 A;  1D8B A;  5AI8 A;  4F4X A;  5KFY A;  3F53 A;  9ICT A;  3Q8M A;  4MFF A;  5B5E U;  5KFM A;  2WB1 F;  1BPY A;  1N5X A;  1DXS A;  4ECZ A;  4O3M A;  2XO7 A;  2HOQ A;  2LYA A;  2YMM A;  5J0S A;  4AYB F;  8ICO A;  2Y9T A;  4J9S A;  2Y1I A;  4O3Q A;  2K89 A;  4IRC A;  5ALE A;  1ECW A;  4CF3 A;  1B43 A;  4A8E A;  5DKW A;  1NZB A;  1TK0 A;  1KRP A;  3C1Y A;  3N7S C;  4CNQ A;  8ICX A;  4DS5 A;  1ZQJ A;  2FE9 A;  3H8S A;  1D9F A;  5DBA A;  1UA0 A;  1LVH A;  5BOL A;  4ECT A;  3PML A;  3ISB A;  4UB8 U;  3BS7 A;  1L8L A;  4UB5 A;  4I29 A;  3MGH A;  4ECW A;  3RB6 A;  5KFP A;  4I2J A;  3QEA Z;  3RR8 A;  4TUQ A;  4C80 A;  2W9B B;  4KLU A;  5KFC A;  2E3T A;  8ICE A;  4KIT B;  4QZH A;  5J2I A;  2W8L A;  2IHM A;  3RJG A;  4UQG A;  1RPL A;  5DB7 A;  2OWO A;  5DDY A;  4DWI A;  3BZK A;  4DQQ A;  1TVA A;  2N1R A;  1S0M A;  1SGG A;  5KFR A;  2H3Z A;  1SIJ A;  4Z6F A;  4ED3 A;  2AJQ A;  1ZRN A;  2FLP A;  2PFP A;  4I2D A;  3LWM A;  2W3R A;  5J2B A;  4O5E A;  2BPG A;  1YT3 A;  2KVS A;  3IG8 A;  4AP9 A;  2FMP A;  1BPE A;  2RDJ A;  3RAX A;  5AM0 A;  4FBU A;  5DBC A;  2YMP A;  3OTQ A;  4M47 A;  2OCE A;  3WKA A;  3RH5 A;  5KFD A;  3TFR A;  1HUZ A;  4UB2 A;  5DGA A;  4DL3 A;  5AK4 A;  1WWU A;  2R8K A;  3KHH A;  3SEI A;  3GIM A;  2AXT U;  3M9O B;  5KFU A;  2YY6 A;  4XA5 A;  4QZD A;  2K8A A;  3JPT A;  5DB8 A;  2Q0Z X;  3H0L B;  4RUC A;  2JHD A;  4RNO A;  4UAZ A;  4ECY A;  5DQI A;  4EBC A;  2UVU A;  1Z00 A;  4Y2J A;  3O0F A;  1V38 A;  1L7O A;  3KHR A;  3U26 A;  4F50 A;  5AI9 A;  1CI4 A;  5AIA A;  1NK7 A;  1ZD2 P;  3H8M A;  4FE3 A;  5KFA A;  2V9W A;  2XY6 A;  4BUG A;  3IP4 B;  5AKK A;  4TQR A;  5ALR A;  4F5O A;  3DDH A;  1NK8 A;  4RQ8 A;  3RAQ A;  1NI3 A;  2F2A B;  5III A;  2VA2 A;  3SYZ A;  2HVH A;  1NKE A;  5H2F U;  2KIW A;  1JXL A;  2BQU A;  4EX6 A;  4IQU A;  1ZQL A;  3HRD D;  5IIO A;  3EYZ A;  1XC9 A;  9ICS A;  1NK9 A;  5ALT A;  3RBD A;  2E1E A;  5AKG A;  4ECU A;  1RXW A;  1JIH A;  2IHN A;  1BNO A;  4QZI A;  4YR2 A;  2J6S A;  3WK9 A;  3NVV A;  4C8O A;  1S0V A;  3QZ8 A;  3RB3 A;  1LB2 B;  1BPZ A;  4MEX A;  1D8Y A;  2KP7 A;  2JZB A;  3OSN A;  4UAY A;  2HVI A;  2A1A A;  2XGP A;  1XSL A;  4NLG A;  1N56 A;  4RPZ A;  2ZG6 A;  1L5U A;  1DK2 A;  4ELU A;  3UMB A;  3BQ2 A;  4Y2Q A;  2YQE A;  4O0I A;  5C0Y A;  5HML A;  4KN7 A;  8ICW A;  2NO4 A;  2KVC A;  5D46 A;  5G5H A;  3I28 A;  4O3O A;  4B9S A;  5AI0 A;  2MA1 A;  3R9K A;  3PMN A;  3RBE A;  4YFK A;  5J2K A;  4P4O A;  2EDU A;  4KX3 A;  1YZ6 A;  1QQ5 A;  2HBM A;  4YVZ A;  2XC9 A;  2G5I B;  2BDP A;  3SEN A;  1Z19 A;  4ELT A;  5KL8 B;  3MDC A;  2IOF K;  1U4B A;  2EZX A;  5KT5 A;  4JWM A;  2PI4 A;  2CXY A;  4IRK A;  9ICI A;  1S10 A;  4Y2R A;  1U9L A;  9ICJ A;  4RQN A;  3A0H U;  3N28 A;  1KTQ A;  1FO4 A;  5CWR A;  3IN5 A;  1MQ3 A;  5J2D A;  2MRL A;  3EWA A;  4J9M A;  2R8H A;  1COO A;  4QZ8 A;  5AI5 A;  3GQC A;  1URJ A;  3H8W A;  4R8U B;  2IBK A;  1Z00 B;  1QLN A;  1XO1 A;  4CCH A;  4F71 A;  4M9G A;  5AM5 A;  2EH9 A;  3H40 A;  4EYH B;  2B21 A;  5J2H A;  2GWS A;  2HBL A;  2YMQ A;  1SV0 A;  4Y2V A;  3NTU A;  1Z1V A;  4M9H A;  2DQN B;  3WK6 A;  2W9A A;  5CRX A;  4F4K A;  2C28 A;  4FS2 A;  2BHN A;  9ICK A;  3GU3 A;  5EOZ A;  2WFA A;  1PUZ A;  4CF4 A;  3UXN A;  2BCR A;  4RQ2 A;  3M6K A;  4J9Q A;  3WK5 A;  3L4P A;  5AIC A;  4DOB A;  2FJ6 A;  2XIC A;  5KT3 A;  1LKY A;  3K4G A;  2FMS A;  3E0F A;  2BGW A;  1JN3 A;  4I27 A;  3F2D A;  1SV4 A;  1HEK A;  5KAI U;  4PPX A;  3LVW A;  3RF9 A;  5AI6 A;  5ALX A;  3TI0 A;  4Q8E A;  4IRD A;  2BCQ A;  2DUY A;  2KSO B;  1ZQA A;  4QIW C;  3H7I A;  3M1Y A;  3CP8 A;  3V7L A;  2JXJ A;  4QZE A;  3J81 j;  3UMC A;  5ALN A;  2JZB B;  4RQ1 A;  2M9N A;  1ZD4 A;  1SV0 C;  2FDR A;  1NJZ A;  5AKI A;  2AGO A;  4RQ3 A;  2F77 X;  8ICP A;  5DQH A;  1A6S A;  4F2R A;  4FS1 A;  2KK0 A;  3BDP A;  2BQR A;  2DL0 A;  1BPX A;  2KMD A;  5EE0 A;  2EAO A;  4I2C A;  3ICX A;  8ICI A;  5ALH A;  5EWG A;  1SKS A;  3WKE A;  5DB9 A;  4GIB A;  4DQI A;  3ORY A;  5KL1 B;  3KKA A;  5KAF U;  3NRW A;  1DRG A;  3K1R B;  1Z4O A;  4I2I A;  5KTQ A;  4RQ5 A;  5KFI A;  2K4I A;  2DBY A;  4O5K A;  4QWE A;  2KKV A;  4YN4 A;  3TAN A;  5HNK A;  4IR9 A;  4UAT A;  2KZZ A;  1NZP A;  4YR3 A;  3RJK A;  1WWV A;  5IIJ A;  4KTQ A;  3ZD8 A;  4G9B A;  4RQ6 A;  4C8L A;  4DQS A;  1L7N A;  4DF8 A;  2KFN A;  1V97 A;  2BCV A;  3MGI A;  4UB3 A;  1DGS A;  4I2A A;  4C4S A;  5DB6 A;  2G07 A;  1PVQ A;  8ICV A;  3OHA A;  2HW3 A;  5L1I A;  9ICF A;  2KHQ A;  1N48 A;  2C2R A;  1F44 A;  5ALG A;  2C2D A; 
#chains in the Genus database with same CATH homology
 2C2E A;  1D9F A;  4C8M A;  5KFQ A;  4NM1 A;  5DBA A;  1UA0 A;  5J0R A;  1K1Q A;  4M04 A;  5BOL A;  4IQV A;  5KFX A;  3QZ7 A;  3GIK A;  3V7J A;  3PML A;  4ECT A;  2BQ3 A;  1SL2 A;  9ICL A;  3T5L A;  1MQ2 A;  4QZC A;  3B0Y A;  3ISB A;  5J2G A;  1PZN A;  3TAQ A;  2C22 A;  5HP4 A;  1X9M A;  4GC7 A;  3LK9 A;  1KDH A;  1TAU A;  4UB5 A;  4IQT A;  4I29 A;  1T3N A;  4KLS A;  3MGH A;  4ECW A;  2HHX A;  4F5R A;  3RB6 A;  4JV2 A;  5KFP A;  4I2J A;  3QEA Z;  1T8E A;  4TUQ A;  3RR8 A;  2MAX A;  4YD1 A;  3HPO A;  4DL2 A;  4O3S A;  1B22 A;  4YD2 A;  2W9B B;  1WCL A;  8ICU A;  4KLU A;  3AUO A;  4RUA A;  4NLZ A;  2JEI A;  4LZD A;  4B9N A;  5KFC A;  1Y88 A;  8ICE A;  1KFD A;  4KIT B;  4QZH A;  5J2I A;  7ICL A;  2W8L A;  2IHM A;  8ICR A;  3ZDD A;  3RJG A;  4UQG A;  1RPL A;  5DB7 A;  2OWO A;  1SZP A;  3C1Z A;  1ZQB A;  7ICH A;  3T5J A;  5DDY A;  4G3I A;  1ZQU A;  5L1K A;  4DWI A;  4DQQ A;  5J2J A;  2KN7 A;  1TVA A;  2NRT A;  4ECR A;  1S0M A;  5L9X A;  5KG6 A;  3MBY A;  5KFR A;  2HHS A;  5KG0 A;  5HHH A;  1NK0 A;  4I28 A;  4I2F A;  5DLG A;  5DDM A;  5D4B A;  4Z6F A;  4DOC A;  3M9M B;  4ED3 A;  4QWD A;  3ZDB A;  4C8K A;  4FBT A;  2AJQ A;  2FLP A;  1NKB A;  2VA8 A;  9ICH A;  2ZUB A;  4I2D A;  2PFP A;  7ICF A;  5KFT A;  4YXM A;  3LWM A;  3RB4 A;  5J0T A;  1QSY A;  5J2B A;  4O5E A;  2BPG A;  5DQG A;  1X9W A;  4NLK A;  4DFM A;  5KFE A;  3PY8 A;  1U45 A;  2FMP A;  7ICE A;  1BPE A;  1ZQF A;  4P2H A;  4HYK A;  3KTQ A;  2ZUC A;  3EZ5 A;  2RDJ A;  3QEB Z;  4KLQ A;  3RAX A;  2R8I A;  4EZ9 A;  1MC8 A;  2F1J A;  5J0Y A;  3ISC A;  5C5J A;  1X9S A;  2JEG A;  1JMS A;  5DBC A;  5KG5 A;  4FBU A;  9ICX A;  1UA1 A;  9ICG A;  8ICK A;  2BCU A;  4M47 A;  5DGB A;  2I1Q A;  3RH5 A;  4TQS A;  3N97 B;  2PFQ A;  1KSP A;  3M8S A;  3V72 A;  5KFD A;  5J2F A;  4UBC A;  3TFR A;  1HUZ A;  4UB2 A;  2XCP A;  3ZDA A;  4F2S A;  4QZB A;  4J9P A;  1XWL A;  4DL3 A;  5DGA A;  3SZ2 A;  5DG8 A;  3UPQ A;  3Q8K A;  2P6R A;  4K4G A;  4O5C A;  4MEY A;  2KTQ A;  2HHV A;  2R8K A;  3KHH A;  3UXO A;  3GIM A;  5HMM A;  1ZYQ A;  4O9M A;  3M9O B;  3ISD A;  5KFU A;  4EBE A;  4QWB A;  7ICP A;  4F4W A;  4XA5 A;  2HHW A;  4RQ7 A;  5KFW A;  2XY7 A;  4QZD A;  4DQP A;  3JPT A;  5DB8 A;  2Q0Z X;  4F3O A;  1NK6 A;  1LV5 A;  1XU4 A;  2AU0 A;  4RUC A;  4RNO A;  4UAZ A;  4ECY A;  5DQI A;  2ATL A;  4EBC A;  2FLL A;  2FLN A;  4YG2 A;  2UVU A;  1Z00 A;  9ICR A;  2ZTE A;  1ZQW A;  1L3S A;  3RR7 A;  3KHR A;  5KT2 A;  4F50 A;  4MF2 A;  4LZG A;  2ZJ8 A;  4RNN A;  1S0O A;  1ARO P;  4DSI A;  9ICP A;  3E2E A;  3C5G A;  4O3P A;  3RJI A;  1NK7 A;  4JUZ A;  5KFB A;  3MFH A;  1NK4 A;  2W8K A;  5KFA A;  1SKW A;  3IM1 A;  5J2C A;  1KLN A;  4NXZ A;  4IQW A;  4YMO A;  2V9W A;  4KLJ A;  4QWC A;  2XY6 A;  2UVR A;  5J2E A;  4O3R A;  3HWT A;  4F5Q A;  3PR5 B;  1T4G A;  4TQR A;  1JXE A;  4DFK A;  4YMN A;  5DG7 A;  3BQ0 A;  4BGD A;  4F5O A;  3FDS A;  1NJX A;  2ISP A;  3QE9 Y;  3T3F A;  3OHB A;  3TAR A;  4DEZ A;  3H8J A;  1TK5 A;  5KFO A;  1NK8 A;  4F4Y A;  2ZTC A;  4BDP A;  4RQ8 A;  3G6Y A;  3PW7 A;  3RAQ A;  3RRG A;  3OJU A;  4M0A A;  4DSF A;  4ED6 A;  3GII A;  4QZA A;  1HJP A;  4Z6E A;  1CUK A;  5CJ7 A;  2BKE A;  4UB4 A;  7ICV A;  5III A;  2VA2 A;  3SYZ A;  4KMU A;  2ASL A;  2HVH A;  2ZJ5 A;  1NKE A;  9ICE A;  4J9K A;  1NOM A;  4MF8 A;  3BJY A;  1KFT A;  3N4M B;  1EXN A;  5BOM A;  1JXL A;  4KLD A;  5IIM A;  2BQU A;  4KLH A;  4IQU A;  4Q45 A;  5EWE A;  4RPY A;  1ZQL A;  4MFC A;  5IIO A;  4UAW A;  3MDA A;  3EYZ A;  4XRH A;  3TAP A;  1XC9 A;  2AQ4 A;  3C23 A;  4M9L A;  9ICS A;  2BPC A;  3UQ2 A;  5IIK A;  1NK9 A;  1NJW A;  4DL4 A;  4ELV A;  3RBD A;  1QSS A;  5KFJ A;  9ICC A;  4ECU A;  1RXW A;  2KZM A;  1ZQR A;  2R8G A;  2UVW A;  3JPR A;  1JIH A;  2IHN A;  1C7Y A;  2PXI A;  2BR0 A;  1CEZ A;  1NK5 A;  3PX0 A;  1X2I A;  9ICM A;  3JPS A;  5J2A A;  5L1J A;  4QZI A;  4YR2 A;  4ED2 A;  4DLE A;  2J6S A;  2FPL A;  4C8O A;  4PGY A;  3M9N B;  1S0V A;  1ZQN A;  3QZ8 A;  3RB3 A;  2BCS A;  1LB2 B;  2UVV A;  3V6K A;  4M6W A;  1D9D A;  4LVS A;  4KN4 A;  5KG4 A;  4KLM A;  4GXJ A;  1H38 A;  3AU6 A;  3KHL A;  1BPZ A;  1RYR A;  4YCX A;  4R65 A;  4MEX A;  1D8Y A;  1V9P A;  3G6X A;  4RPX A;  2JEJ A;  4NLN A;  1KFS A;  4RNM A;  4TUR A;  2JZB A;  3RJE A;  4DL6 A;  3OSN A;  2AGQ A;  1ZQS A;  4UAY A;  2FMQ A;  4GC6 A;  2HVI A;  2XGP A;  1XSL A;  4NLG A;  1N56 A;  2JEF A;  5KFF A;  4QWA A;  4TUS A;  3MR5 A;  5KFN A;  4RPZ A;  4ECX A;  5EWF A;  4ECQ A;  1L5U A;  2ISO A;  5F9L A;  2KFZ A;  4ELU A;  3BQ2 A;  4JWN A;  8ICS A;  8ICZ A;  4F5N A;  5KFK A;  3MR2 A;  4R63 A;  4O0I A;  5HML A;  5KT7 A;  4ECV A;  8ICL A;  4KN7 A;  4DFJ A;  3C21 A;  8ICW A;  1RYS A;  5D46 A;  2DPJ A;  4O3O A;  3JPO A;  4B9S A;  4KLT A;  3HX0 A;  2HHT A;  3PMN A;  3SI8 A;  1U48 A;  4UBB A;  4XQ8 A;  2HHQ A;  3RBE A;  4YFK A;  1UT5 A;  4F91 B;  4F93 B;  9ICU A;  5J2K A;  4P4O A;  2NRW A;  7ICT A;  2AQ0 A;  2ASJ A;  4GXK A;  1SL1 A;  5CR0 A;  2NRV A;  3PW0 A;  1UT8 A;  1NJY A;  4B9U A;  3AU2 A;  4DQR A;  4P4P A;  1BGX T;  7ICJ A;  5HHI A;  1D8L A;  1Z3E B;  4YVZ A;  2XC9 A;  1ZQQ A;  7ICG A;  3V6H A;  7ICI A;  2BDP A;  4NY8 A;  3PV8 A;  7ICK A;  3LWL A;  4DLG A;  3MDC A;  3GIL A;  3H4D A;  4ELT A;  3Q8P B;  2V4Q A;  1ZQV A;  2KZ3 A;  1U4B A;  4QZG A;  5KT5 A;  4JWM A;  2PI4 A;  4KLL A;  4ED8 A;  5JUM A;  4IRK A;  9ICI A;  5KFH A;  1S9F A;  2PFN A;  4ED1 A;  1S10 A;  3RH4 A;  1ZQZ A;  1U9L A;  2NRZ A;  2P6U A;  3MFI A;  1MSW D;  9ICJ A;  5KG3 A;  4BWJ A;  4Q43 A;  5J0X A;  4UB1 A;  1KTQ A;  5CWR A;  3Q8Q B;  4QZF A;  4RT3 A;  3GV7 B;  2XY5 A;  1MQ3 A;  3TFS A;  4R8U A;  3RJH A;  5J2D A;  8ICF A;  3C2M A;  4KLI A;  4PHP A;  4YXJ A;  3EWA A;  4Z6D A;  4YMM A;  4R64 A;  3M8R A;  2R8H A;  1COO A;  3FYH A;  4J9M A;  4PGQ A;  4QZ8 A;  5IIN A;  4JV1 A;  1ZQK A;  3T5K A;  3GQC A;  5KG7 A;  2VA3 A;  5F9N A;  4RQ0 A;  9ICO A;  3H8W A;  1ZQI A;  4R8U B;  2IBK A;  1Z00 B;  4GLX A;  1QLN A;  1ZET A;  4KLG A;  1ZQC A;  4RU9 A;  1XO1 A;  3PO5 A;  4QW9 A;  2VAN A;  4CCH A;  4M9G A;  3HT3 A;  5CB1 A;  4PH5 A;  3H40 A;  2MUT A;  2B21 A;  4PGX A;  3H4B A;  5J2H A;  4EYH B;  2GWS A;  2XCA A;  2PFO A;  5J0Q A;  4DL7 A;  7ICS A;  2V4R A;  1ZQD A;  3NTU A;  3V7K A;  3C2L A;  3THV A;  2I9G A;  4M9H A;  4KLE A;  1SL0 A;  1K1S A;  4EBD A;  2BPF A;  2HHU A;  4RQ4 A;  4I2G A;  1ZQX A;  5KG1 A;  2W9A A;  1L3U A;  4J9R A;  4F4K A;  2C28 A;  3EW9 A;  2BHN A;  4FS2 A;  8ICB A;  9ICK A;  4DSE A;  3JPQ A;  2W9M A;  3G6V A;  5EOZ A;  4RT2 A;  4F92 B;  4EEY A;  3HP6 A;  1U47 A;  3RH6 A;  1NKC A;  3UXN A;  4Q44 A;  5J0O A;  4ED7 A;  2RDI A;  2BCR A;  2H5X A;  4RQ2 A;  3RRH A;  4BXO A;  3EPI A;  4J9Q A;  4J9N A;  5DLF A;  1TFR A;  4QW8 A;  1ZQO A;  2DPI A;  1S76 D;  4YR0 A;  4DOB A;  1QSL A;  3Q8S B;  3C2K A;  4PHA A;  5DG9 A;  1ZQT A;  2J6U A;  3RJJ A;  4K4I A;  4K4H A;  1S77 D;  2ASD A;  1WCN A;  5KFV A;  4B9M A;  5KT3 A;  1U49 A;  1L3V A;  3K4G A;  4MFA A;  4ECS A;  2FMS A;  2BGW A;  2P66 A;  8ICG A;  1ZQG A;  1JN3 A;  4I27 A;  4BXO B;  2W9B A;  1XSP A;  4O3N A;  4PPX A;  3C5F A;  5KG2 A;  2FPK A;  3LDA A;  1A77 A;  4J9O A;  2IMW P;  3ZDE A;  1TAQ A;  5DBB A;  2W9C A;  5KT6 A;  5KT4 A;  3TI0 A;  4M9N A;  4Q8E A;  3IHQ B;  4IRD A;  3HW8 A;  3OSP A;  2DFL A;  2BCQ A;  4F8R A;  2A1J A;  4I2H A;  3EPG A;  5CHG A;  2LYH A;  1ZQA A;  4M6W B;  2R8J A;  4Z6C A;  3MR3 A;  5D49 A;  9ICV A;  2XGQ A;  1ZJN A;  3SV4 A;  1XS9 D;  1S0N A;  3H7I A;  7ICQ A;  2W9C B;  3GV8 B;  3V7L A;  3PX6 A;  3RB0 A;  1RZT A;  4DS4 A;  1TKD A;  1ZQY A;  4XUS A;  5BPC A;  3K75 D;  4QZE A;  3OJS A;  3TQ1 A;  2A1J B;  8ICC A;  2FPM A;  2JZB B;  5J0U A;  4DOA A;  3PVX A;  4RQ1 A;  2M9N A;  3UXP A;  1L3T A;  7ICM A;  5L1L A;  4BWM A;  7ICU A;  4PHD A;  5TZV A;  1NJZ A;  1SKR A;  3NGD A;  4DSL A;  3B0X A;  4J9L A;  2AGO A;  1ZQP A;  4JK1 A;  4RQ3 A;  8ICP A;  5KFS A;  5DQH A;  4DL5 A;  3PW5 A;  8ICQ A;  4NM2 A;  1HUO A;  4C8N A;  3GV5 B;  4FS1 A;  4F2R A;  1T7P A;  4PHE A;  8ICJ A;  3BDP A;  4F4Z A;  3Q8R B;  2BQR A;  4YQW A;  3MR6 A;  9ICW A;  4KLO A;  3ZDC A;  1TV9 A;  4DSK A;  2PI5 A;  5CP2 A;  9ICB A;  3RTV A;  3PNC A;  1BPX A;  4I2C A;  4JV0 A;  8ICI A;  8ICM A;  1ZQM A;  5EWG A;  1BPB A;  1SKS A;  4DFP A;  4P4M A;  8ICH A;  1BPD A;  3SV3 A;  1IM4 A;  5DB9 A;  5KFG A;  3ORY A;  4DQI A;  4M9J A;  4X5V A;  3PW4 A;  3PO4 A;  4GXI A;  3BQ1 A;  1A76 A;  5J0W A;  3RJF A;  4ZH4 A;  4E0D A;  8ICT A;  5CA7 A;  2ALZ A;  8ICA A;  1ZQH A;  4I2B A;  4I2I A;  5KTQ A;  2F1I A;  4I2E A;  4RQ5 A;  7ICR A;  2ZTD A;  1XSN A;  5KFI A;  4IR1 A;  3UQ0 A;  4O5K A;  1QTM A;  1TK8 A;  4EYI B;  2ZUD A;  2WTF A;  2AGP A;  3KHG A;  1RXV A;  5IIL A;  2Y1J A;  4QWE A;  2F1H A;  3OGU A;  3PW2 A;  3GDX A;  4EZ6 A;  4YN4 A;  3TAN A;  5HNK A;  1S97 A;  4IR9 A;  2KZZ A;  4ED0 A;  5J29 A;  2J6T A;  4YR3 A;  4F4X A;  5KFY A;  4QZ9 A;  1ZJM A;  3RJK A;  2NRX A;  5IIJ A;  4KTQ A;  4B9L A;  9ICT A;  3Q8M A;  3BQT A;  3ZD8 A;  3JPN A;  7ICN A;  1ZQE A;  8ICN A;  4MFF A;  5KFM A;  4RQ6 A;  9ICA A;  1BPY A;  1IXR A;  3Q8L A;  4Q8F A;  4C8L A;  3ETL A;  4F5P A;  4ECZ A;  4DQS A;  8ICY A;  2XO7 A;  4YP3 A;  4DF8 A;  4TUP A;  2KFN A;  4DF4 A;  5J0S A;  4R66 A;  2BCV A;  4B9T A;  3GIJ A;  5KFL A;  4J9S A;  2Y1I A;  4DSJ A;  4O3Q A;  3MGI A;  8ICO A;  2ZJA A;  4UB3 A;  4IRC A;  1BVS A;  1DGS A;  2MUT B;  4I2A A;  4KLF A;  3PX4 A;  5J0P A;  1B43 A;  3JPP A;  3PR4 A;  5DKW A;  9ICQ A;  3GFK B;  5DB6 A;  5KFZ A;  1TK0 A;  3T5H A;  4FO6 A;  1KRP A;  3C1Y A;  8ICV A;  3OHA A;  4RZR A;  2IA6 A;  2HW3 A;  1KEJ A;  5L1I A;  8ICX A;  4DS5 A;  4M2Y A;  9ICF A;  1N48 A;  1DOQ A;  2C2R A;  1JX4 A;  4DO9 A;  9ICN A;  3ZD9 A;  4B9V A;  3MAB A;  1ZQJ A;  3V6J A;  2C2D A;  7ICO A;  3H8S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...