3NVVA

Crystal structure of bovine xanthine oxidase in complex with arsenite
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
164
structure length
164
Chain Sequence
TADELVFFVNGKKVVEKNADPETTLLAYLRRKLGLRGTKLGCGEGGCGACTVMLSKYDRLQDKIIHFSANACLAPICTLHHVAVTTVEGIGSTKTRLHPVQERIAKSHGSQCGFCTPGIVMSMYTLLRNQPEPTVEEIEDAFQGNLCRCTGYRPILQGFRTFAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Xanthine dehydrogenase/oxidase
publication title X-ray Crystal Structure of Arsenite-Inhibited Xanthine Oxidase: Mu-Sulfido,Mu-Oxo Double Bridge between Molybdenum and Arsenic in the Active Site.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 42
structure length 164
sequence length 164
chains with identical sequence J
ec nomenclature ec 1.17.1.4: Xanthine dehydrogenase.
pdb deposition date 2010-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 3nvvA02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3nvvA01
1V97A 2Q5WD 3B2GA 3W5UB 3NVVA 3AE2B 1XLQA 3P4RB 5G5GA 1JALA 3KWLA 2WP9B 4JX1C 1V8CA 1JW9D 3AMZA 2WDRB 4YTPB 2WU2B 4YSZB 1QOAA 1TYGB 4ZHOA 2KMMA 2LEKA 1J7AA 2M19A 1N5WA 2QJLA 3FAHA 2Y5CA 2ACZB 5H92C 3NVZA 1KF6B 1L5PA 1WXQA 1OQQA 2AX5A 2W54A 3HUIA 3HVZA 3AE3B 3L4PA 3DWGC 1XO3A 2CJOA 2KAJA 4ITKA 1TKYA 5G5HA 3AE6B 1E6EB 4US9A 3B2FA 4C7YA 3RPFC 1E7PB 1RM6C 1KFYB 1SB3C 3AH7A 4JWUC 1R7SA 4C80A 1NYRA 1L0VB 3NVYA 3AEBB 1JWAD 5C3JB 1JROA 1IUEA 3BIID 2BS2B 1NI3A 1JQ4A 3AEGB 2QIEB 3AEDB 2L52A 1L6VA 5EE9A 4JWSC 4YXDB 5MPOA 4ZOHC 2K5PA 5EE3A 1ZXIA 1CJEA 2K9XA 5C2TB 4A9AA 1E10A 1QOGA 1GAQB 2B76B 2PKOA 2BT6A 3P1MA 1NEKB 2DBYA 2WQYB 2W3RA 1I7HA 2M56B 2OHFA 2WU5B 5EE0A 1OFFA 1WYGA 3SFDB 1QT9A 1DOXA 5EE1A 1E9MA 1KRHA 2WDVB 2BS3B 1QOFA 3DWMA 1JRPA 1T3QA 1TJEA 4HRSA 4N6EB 1ZOYB 3AEFB 3NVWA 5AUKA 1J7CA 5H8YE 1XLOA 1N62A 1FIQA 3HRDD 1WRIA 1E0ZA 1ROEA 1VJKA 2HTME 1FFUA 1NVID 2W55A 3AN1A 1TKGA 1UWMA 3FC4A 2MJEA 3ABVB 3CWIA 1FM0D 3SR6A 1FXAA 4YT0B 3VRBB 1PDXA 1TKEA 3SFEB 1J7BA 1B9RA 3AB5A 4YSXB 2EKIA 1FRDA 1F0ZA 1FMAD 4YTMB 1VLBA 1VDVA 4P6VF 3ZYYX 1WGKA 3P63A 4N59A 3EUB2 1A70A 2CU3A 3P4QB 3NS1A 3VR8B 1AYFA 1FO4A 3P4PB 1DOYA 1CZPA 3W9CB 1FFVA 1XLPA 4LTUA 4YTNB 1NYQA 1SF0A 3AE8B 4HROA 4YSYB 1ZP0B 1ZUD2 1QLBB 3AE4B 3CIRB 4IDIA 1XLNA 1YJIA 2MJ3A 2BS4B 2WLBA 3ETRA 2H89B 1FRRA 3AECB 4FXCA 3B9JA 1QOBA 2L83A 4N58A 2K22A 2H88B 1YQ3B 1QF6A 1RFKA 2WS3B 1PUTA 1SIJA 2E3TA 2JX5A 1FXIA 3LB8C 1DOIA 1RYJA 4WWMA 3WCQA 2N0SB 2PVOD 1DGJA 1WWTA 3VRAB 4US8A 1N5XA 3AE9B 3PO0A 1YJJA 3AV8A 3W5VB 1RWSA 3AE7B 1OQRA 1JWBD 5AUIA 3AM9A 3AEEB 1NENB 3NRZA 4USAA 3AEAB 3P4SB 2W3SA 2WDQB 1L6UA 2JQRB 1PFDA 4C7ZA 2DWQA 1N63A 5GXGB 2PIAA 4KX6B 4WQMA 1AWDA 2CJNA 2G1EA 3AE5B 3AE1B 3LXFA 3VR9B 1N61A 2MH7A 4ZHPA 1N60A 2FBWB 2PVGC 1EWYC 1GPXA 1YQ4B 2MJDA
chains in the Genus database with same CATH superfamily
5AIBA 5EWGA 4YG2A 1E8XA 4P4PA 8ICAA 1NI2A 1SZHA 3QK0A 4DL3A 4RQ4A 2MCNB 5HR7A 3H8WA 1QOAA 3C1ZA 1IGDA 1WSPA 3PX0A 3NG0A 4KDLB 1ZJNA 2F44A 2J42A 1Z4NA 2QILA 5LXHA 4QZ9A 2HI0A 2E1EA 5G5HA 1BUIC 3WA0A 4KLSA 1NOMA 2INDC 4ICAA 3BJYA 4C7YA 2KMDA 1KFYB 4YCXA 1E8YA 3LDZE 5ALIA 1L0VB 3VUYA 1SV4A 3AEBB 4PGQA 3VH3B 5ALOA 2VH1A 2YEPB 2G07A 5KFPA 2HJ8A 2C7HA 3TSSA 2ZG6A 4CDGA 1SEBD 3OJ3A 3SV3A 2NRWA 2CS4A 5C2TB 7ICTA 2KEYA 4Z6EA 4K4GA 3RN9C 2H3VA 5DPWA 2W04A 2BT6A 1NEKB 3BZKA 4QZFA 1WG8A 2HHWA 3BQTA 3W1SA 2PTLA 3F2BA 2PEAA 1KDHA 3TFSA 2LXCA 2KVCA 1QOFA 1RYRA 4XRHA 1T0SC 1SGHA 2O6VB 3UI3A 2KIVA 2BVCA 1I42A 4OO1J 3N32A 2WHEA 9ICXA 4C8KA 5JRTA 2BQQA 2FUG1 2FCNA 4ECVA 3TCAA 2JH7A 1PZNA 3FDSA 8ICRA 2K39A 4PZOA 2MLBA 5AKYA 2O6VD 3WK8A 5DB6A 1FNVA 1KL9A 1QQRA 8ICPA 3HIZA 3MJ5A 3QARA 1T6BX 2ZCBA 2YMLA 5DGAA 3BYYB 1XF5L 5HG2A 2AH5A 4RQ7A 2DZJA 2IO1B 4F91B 3ZO5B 1BGXT 3UQ0A 1YJ1A 4KZCA 1FFVA 1NJYA 5L1MA 4Q8EA 2KIWA 5K4LA 2VKQA 2YTUA 4KLMA 1ZXHA 3DBRB 3SEBA 3VVWB 2FJ6A 4ECQA 4OZBA 3BS7A 4JWMA 5AK6A 1TS4A 3PMLA 4I2AA 4NAWB 4ICUA 3NRWA 1FXTB 5AK3A 2XEWA 3PZ7A 1QQ6A 3UMCA 4O3SA 2Y5PA 4DFMA 4GMVA 5IO9A 4LZGA 5J0PA 4WIPA 1SV0C 3MDCA 3QEBZ 3TFRA 4M02A 3ZTCA 3U7DA 2VZKB 1WWTA 3FYHA 4US8A 2KJ9A 1UBIA 1BVSA 2JZBB 4XA5A 4URKA 2D6FC 9ICWA 4RGNA 2JZ3B 3L10B 2W3SA 2XIDA 4A20A 2K4IA 1COOA 3QEAZ 4IWPA 5ALXA 3H6NA 3W1YA 2OWOA 3T5JA 2KG5A 2VZKD 5HR6A 5FP0A 1RQLA 1C3TA 3HJEA 3UXNA 2DYMA 1OGWA 2C7NB 1EWYC 1V1OA 3CNHA 4DOCA 5IKCM 1URJA 3F2CA 2AQ1B 3HW8A 3HHMA 4FHJA 5CX3A 4JV2A 2F77X 2E1FA 1UGJA 4TQSA 3E56A 2AYOB 1V8CA 4IRDA 4WAFA 4E74A 5IA7A 2KMMA 2KLGA 2NO5A 3NVZA 1L5PA 2MRPA 3SQIA 4CQNA 2KVSA 3AE3B 7ICEA 1VZ6A 1XO3A 4K4HA 2AQ2B 1TS2A 2JU6X 3Q6BA 2AHOB 3C1YA 2LPEA 2V9WA 3SD7A 4LK0M 4JUZA 2MSNA 1T4GA 2ZIXB 4UBCA 8ICMA 8ICIA 1WZ0A 5KT4A 3IG3A 3K9OB 1VD2A 1XO0A 2D3DA 3TMPB 1KW4A 3V3XA 4YXDB 4QW9A 5EE3A 4KLIA 1Z5SB 2JXXA 3NUQA 4XGAB 2KDFB 4RF0A 4ANUA 1R4NI 1ZQBA 4ED1A 4M04A 4MJSB 4NAWA 1DRGA 4HVBA 2M1MA 4CGZA 2MBOA 2FMSA 2BS3B 1HUOA 2KWCA 4AOFA 3RH4A 1SE3A 1JRPA 3C23A 2JYEA 5TR5A 5KT3A 4DSFA 1OUQA 3GZNB 2XNAC 3VAWA 3SMVA 2JZBA 4IOIE 4Y2SA 3AN1A 1TKGA 3WKDA 2BQRA 3L0WB 4RMAA 4YMNA 3QE9Y 1J7BA 4WWOA 1TK5A 3GE8C 3WK5A 2QC8A 1FD6A 1I4GA 2JMGA 1C4CA 2L3ZA 3KVFB 4RUAA 1UA1A 1UZXB 2KZ3A 2LBOA 4YQWA 3UXPA 2EAPA 1WY8A 1ZQAA 2HJ1A 4I2IA 1IPGA 4ZRQA 2D8CA 2K60A 1WCNA 2ZIUB 4ECWA 2IZVB 3IV6A 5AK5A 2WXKA 4C8NA 1LQBA 3PHXB 4JQWC 1NYQA 3BQ1A 1TY0A 1SF0A 4LTUA 1U4BA 2LVOA 2LGDA 3GV7B 1XLNA 2HHTA 3WK4A 3NASA 4QZ8A 3IAS1 3O0FA 3ZVVA 2J6UA 1ZQUA 2ZIXA 3PMNA 1WWUA 4F2RA 1U49A 2ON8A 4LCDE 2MA1A 3JPPA 4YL8A 5KFUA 1ZD4A 2HBKA 2V1YA 4LNNA 1SWWA 3TADA 4AS1A 1MHHE 1MJDA 2M0AA 1MHXA 4TUPA 2HHXA 3L5KA 1NK4A 3A9JB 4YXJA 3C21A 4F5RA 4QZAA 3PV1A 4EZJA 1FEHA 3QU5A 3LXFA 3PGEA 1M6YA 1JMLA 2MH7A 5KG4A 2J6SA 1L3VA 4FLHA 5AKJA 4TSSA 3RI7C 2Q5WD 3RTVA 4MH8A 2ODGA 5ALSA 4TUSA 1T5XD 1OEYJ 1V81A 2VA8A 1JW9D 2CKHB 3JPRA 4ZRKA 3RH6A 2KDIA 3F5EA 3QUBA 1PVQA 5AM2A 2UU7A 5H92C 4AWJA 4B9TA 1F1HA 1ISNA 2C9WB 4XUSA 1WXQA 4ED3A 3RF9A 3DWGC 4W9DA 4HK2A 1HEZE 2BPCA 1RM6C 4GC7A 3C5GA 1NJXA 1RRBA 2KN5A 4LJOB 5C3JB 2K1FA 4ZYSA 9ICBA 3AEGB 1UT5A 3H40A 2KC2A 3VCBA 5KG2A 2G45B 1Q8KA 2K5PA 4J9LA 4GGQA 1ZXIA 2GRIA 3V7LA 2DAFA 2M9NA 3ZDCA 5IIMA 5J2FA 2WQYB 5B66U 4LJPB 3PX4A 2JWZA 1OW5A 2WDVB 4YP3A 3U4EG 1FNUA 4K4IA 1QZEA 2GBNA 3KZXA 4PL2A 4X57B 3RNEC 1IP9A 2ZJAA 8ICBA 3HRDD 1PGXA 2MUTB 3KHHA 1YQBA 3KW5B 4P1BC 1TK0A 1XSLA 3GU3A 3LYSA 3DVNV 1WR1A 4XX5A 2NRZA 3A9JA 5KG5A 2JR5A 3JPQA 4OZAA 1ZQLA 2K8BB 5TSSA 1Z1VA 2AL3A 3KBBA 3EPGA 2V3PA 3RUIB 3MHZA 3RBEA 4Q43A 2J4XA 4O5EA 2BWES 4R64A 1T0YA 2KD1A 4MFFA 4ZH4A 1S8OA 9ICUA 2DLBA 3VR8B 3SZ2A 1AYFA 2C60A 1FNWA 4C4RA 2O6KA 2LFIA 1KEJA 1ZQEA 4GFJA 4LZDA 1J19A 1L7NA 1QLBB 2F8LA 2WB1F 4ECXA 2MW5A 3ZDTA 1JCKB 2BS4B 1C7YA 2KC1A 4YR3A 4DDGD 1S1QB 2KHQA 4NL9A 2N1RA 3HX0A 1RFKA 1TT5B 3K4GA 1ZQPA 4F93B 5AKIA 4QZEA 2JEJA 3Q8MA 4JE3B 1CUKA 2KK8A 1KSPA 4B6JA 3PX6A 3AULA 1N2XA 1Z19A 2KZZA 1L3SA 2LUEA 4K7WA 2ZIWB 3IDWA 1SBBB 3AEAB 4DF8A 1L6UA 4KN7A 4DDID 2PXIA 9ICFA 4FZMA 1C77A 4P0QA 2CHZA 3BWUD 3AL0B 1BXTA 3FILA 4KX6B 9ICKA 1DXSA 4OJ5A 2V4RA 1KFSA 3DBLB 3N28A 3N97B 4QWDA 3OHBA 1ZQQA 2LASA 3DVGX 1SJED 5HI1A 4BOSC 1JALA 4PHAA 4PK1A 2NBVB 3WKCA 2JEGA 4KSLC 1E8ZA 1J7AA 4F4ZA 3SAFA 1L2NA 3OHAA 4MFCA 2K8BA 2WAQF 1IIPA 2CJOA 1IYFA 4I2FA 5KFCA 4AP9A 5ALYA 1SB3C 1C76A 1ZQZA 1RFAA 2RD0A 3RJKA 5AI0A 4KLHA 5AM4A 1MSWD 3BZDB 4UB8U 2LXAA 5ALVA 5J2IA 2EELA 3U7ZA 2DQNB 1TE2A 5KFTA 2YVCA 2MA9B 3TANA 3TAPA 2KQ7A 2IO0B 3ALRA 4EBDA 3EZ5A 2DFLA 3M6KA 8ICFA 2O2VA 1YOVB 1S9FA 2D3CA 4RGTA 2KTFA 2JT4B 5J29A 3M8RA 1WM3A 1UT8A 2UVUA 2I38A 2ZTDA 1K8RB 1NK7A 3EPIA 4F7ZA 4NPNA 8ICSA 3AU5A 2HBJA 3F2DA 2VA2A 3EA6A 3PRZA 1ZQKA 4EYHB 1TAUA 4DQIA 2OYYA 2E6XA 1V86A 1Q46A 1B9RA 3MC9A 4Q2JA 1L7PA 2RDBC 2BKFA 1RPLA 4NY8A 1OQYA 1CI4A 5IN7A 1FMAD 4YVZA 3DPDA 1U47A 1LXDA 1DK3A 1F2RI 3PREA 8ICEA 4NWIA 5DPSA 4IQTA 3KUCB 3KD3A 4UB2A 4BXOB 3ZD8A 1WRDB 2EAMA 1XSNA 1XCQL 3AXCA 3HVDA 2LKYA 3Q8KA 5CHGA 4O1NA 4F72A 1UBQA 1ZUD2 1A0PA 2EQYA 1S77D 3CIRB 3FKYA 3PLVA 4A6QA 8ICNA 4FE3A 2VA3A 2WF5A 3QUQA 4BWMA 5EWFA 2WB1C 4W9GA 1QH9A 4LNOA 1SIJA 1JWMD 2KFJA 2ES6A 3PW4A 3RR8A 4A8EA 5J0SA 5ALFA 4UW9A 2LHDA 3QYPA 4J9NA 2BGWA 2JRHA 3Q3FA 4TUUA 1JUDA 5J0OA 5AI9A 4USAA 4GXIA 4JV0A 4FZNA 1L8OA 5IIJA 4AQ7A 1JI7A 4RCOA 2LHTA 1TZOA 2JXJA 2A3VA 4IG7B 4BKGA 2WDTB 3ZIMA 1N61A 4I2CA 9ICNA 4CF4A 4UB4A 2EMSA 1RQNA 1MI0A 2FBWB 3PSTA 4YD1A 2KLCA 2WX0A 1V97A 2VANA 1RXVA 2ZPNA 3P4RB 3QZ7A 2EZYA 4FFDA 1AARA 2ZZPB 3KWLA 4Y2QA 3DVGY 3K75D 4UARA 4TKNA 5J0TA 1M94A 1ZDVA 1IG6A 2ACZB 1JN3A 2NTTA 1ZD5A 3ZDBA 3C29A 1WMHB 3RB0A 3KHGA 3G6XA 2CR5A 4GN1A 3KUDB 4MT5A 5I4DA 1ZQOA 4UB1A 5ALUA 3EGRA 3VDZA 1SE4A 5AI6A 4PS3A 3X0WA 2WAQC 4BDPA 4C80A 3V6HA 3QZ8A 3UQAA 4O3OA 2KO3A 1J2MA 3DBHI 1V85A 1OXJA 3GV5B 2QARB 4BXOA 3DHHC 3AEDB 2G4SA 1F5SA 4O3QA 1WIAA 1MVKA 2WXQA 4KGSA 2J52A 2XBBC 3PSFA 4S0RA 2LMRA 3PRMB 1TIFA 3ZDMC 1E10A 4P7IA 2WXLA 3MBYA 1HA5A 5D3IB 2KTRB 4KGRA 5D46A 1D9DA 3ISDA 3SFDB 5E6JA 2RR9A 3MGIA 5AKZA 4IM0A 1L7MA 4QZGA 3GQCA 2HOFA 1P3QU 5AKHA 1B0XA 2KD0A 4PHPA 4PHDA 1NKCA 3NVWA 3M8SA 3OSPA 2KN4A 3DV9A 3ISCA 1R4MB 1NK8A 4JGHB 4G50A 4AJYB 2IOFA 2W55A 4ED7A 4IKGA 3FC4A 2QKQA 5L9XA 1NKEA 3Q3MC 4LDTB 3G6VA 1HEKA 1JMSA 3PR4A 3B0XA 3MR3A 4IWOA 1P7DA 3U2SC 2XCPA 1LV5A 3PSEB 4DHZB 4DSEA 2BR0A 1S0VA 4GSWA 1WGKA 5CHFA 2G9HD 4NZLB 3MC1A 4LDTD 3QU2A 1WX9A 2W8KA 1IXRA 3D6JA 1CZPA 2NPTB 3Q3JA 1TAQA 3AI5A 2INPE 2JSVX 2C2EA 3P2BA 5ALQA 3AE4B 1MC8A 2MJ3A 2QSDA 1P1AA 1WMHA 2KQSA 2REXA 1UELA 5BOLA 2DZMA 1WI0A 4RM8A 1X1MA 4FO6A 1GB4A 2RLTA 1QOBA 3ZW3A 4J6IA 2WS3B 1X6JA 2XGQA 4YMMA 3JYUA 4R3DA 2D11A 4WWMA 2QARA 3GS2A 3RNGC 2PVOD 2I5HA 3EFUA 2W9BB 1OQRA 4FBTA 2E8NA 1E90A 1P7EA 3QX7A 3QNMA 2XC9A 4A55A 4KGTA 2DF4B 2KTRA 5GXGB 4B0EA 1HTOA 2PIAA 4BUGA 4WQMA 4MHVA 2KJRA 3VR9B 4RQ5A 2ZNVB 3T8MA 8ICLA 9ICQA 4HPMB 4M2YA 1K1QA 4PJ0U 1BPDA 1N48A 5L1LA 2K6DB 3SHQA 2FCQA 2WXHA 3R9KA 1D5ZC 3NVVA 2DYBA 1K51A 4A90A 1GOZA 2IGDA 1G6JA 2DKXA 4M9JA 3M1YA 4ECZA 9ICAA 3DHIC 4RQ1A 3A0HU 2C28A 2JY6A 1GC6A 3N1XC 4KIKB 1UPHA 3E2EA 2UWQA 3HUIA 4GDKA 3BK2A 1C4PA 1SJHD 4QZBA 4WH4A 4MM3B 5ALJA 5ALMA 5L1KA 4IQVA 5CHWA 4O5CA 2CXYA 1S10A 4L23A 1KTKA 9ICIA 3GB1A 2NPTA 4F1SA 4QZCA 4NM2A 3DDCB 3HT3A 4M01A 3A33B 2MBQA 1KJTA 3EECA 2Y9TA 5IINA 3WKEA 3RJGA 2R2OA 1KFDA 3P42A 2OHFA 4M8MA 1C79A 4BBNC 3LVVA 1OFFA 7ICSA 2N1VA 5EE1A 4BJQA 4C4VA 1LO5D 2NBWB 4FN2A 2BPSA 2LJIA 4HRSA 3M7DA 4O3NA 2R8KA 4KTQA 4KV2A 3TJPA 5CB1A 5DG8A 1JXEA 2RDJA 4IC9A 5CTRC 1NK6A 5H8YE 4M6WA 3ZRFA 4YFKA 3QWZB 2W9BA 4Z6FA 3RR7A 5CHVC 4RT2A 2JPHA 7ICJA 2KSOB 2CPRA 1MPEA 1TKEA 1ACCA 4TQ1A 4DQSA 4ECRA 1ZQDA 4F4KA 2HHSA 2G5IB 1HQRD 2JEFA 4O5KA 1IM4A 4YR2A 1ZDXA 2GLEA 1JRUA 4MH0E 5ALZA 1U9LA 2L0FA 3EUB2 5AZGA 2CN1A 4P0PB 4UAVA 1D6EC 2HTHA 4BKSD 1X2IA 1ZRMA 3RJEA 4M0WB 1Z00A 3PO4A 5AEKB 4KIKA 2PFQA 1K53A 3U30A 2NRVA 1FRRA 1SXTA 1WJNA 5KFKA 4GC6A 5LLIA 1IV8A 4ANXA 4Y2RA 3RH5A 2SEBD 2H88B 1YQ3B 2HMXA 1AQ6A 2FIDA 2AGOA 4WAAA 2OM6A 4MFAA 2JH1A 1DGJA 2DPJA 5EDSA 5AKXA 4BKTA 3QUTA 3AM9A 1L7YA 3LK9A 2RGFA 8ICVA 4W9IA 1PFDA 2DENB 4EFOA 3V60A 4C7ZA 2N9EB 5AI4A 4RPYA 1XC9A 3V6EB 3A4RA 2D3AA 3WAMA 3JVZX 5BPCA 3NZ3A 2DZIA 2KFKB 1WZ3A 4DHZE 5DCNA 3R3MA 4B9MA 2C22A 5ALEA 3Q8CA 4KX5A 5IIKA 2W11A 1WM2A 4WJQA 2KSOA 3M95A 3PT2B 3AU6A 2ZIVB 2R8HA 1KF6B 5L1IA 1NKBA 2GOWA 3GIIA 1TKYA 2A1JB 2W9NA 3C2KA 4BKSA 3RPFC 4L2YA 4Q8FA 2C5LC 3AH7A 5KG3A 4UAWA 3KOOA 1YNTE 4BOZB 4UB6U 4JLCA 2YMMA 2LRUA 4RU9A 4P0PA 2Y0SC 5KG0A 4J03A 4Y2PA 2J6TA 1KTQA 2H3FA 5ALDA 2O6VA 2W9AA 3V72A 4M0WA 4EEYA 2IJ0A 4QJFB 3V7JA 3HPOA 4ELUA 3WK9A 2BF8B 1ED1A 1I4QA 2IBKA 2DBYA 3UF8A 2W3RA 1TBEA 1WH3A 3SV4A 4DQOC 5D94A 1WWVA 4RNOA 2MWSB 3KKAA 1HTQA 2W9CB 3DWMA 2KJ5A 2GWSA 2ISOA 2DZKA 1AROP 4OJOA 3NJTA 3KWVA 3CF6E 1F9JA 2KWVB 1N62A 1S5LU 5KT2A 4BGDA 3PVXA 4ICVA 5B5EU 2AGQA 3LJ3A 2NO4A 2MJEA 3TEXA 1D5MC 5DQIA 3M63B 3U52E 3RB4A 4DSLA 2LYHA 3T5KA 1V5OA 2CU1A 2L00B 4KVGB 5KHQA 1QSLA 5KFVA 2EKIA 2Y9UA 4KSKC 2PKEA 2ZUCA 2XCAA 2WXPA 2N7JA 4O3RA 4YTMB 3VH4B 3BVGA 1KQQA 4B9VA 2L1AA 2CHXA 4F71A 3NS1A 1QSYA 3DOWA 2G06A 2LM4A 3ZUNA 4G0NB 4FJVB 5AZFA 5AKGA 3RT3B 2DHZA 1AN8A 4DCCA 2KKVA 2HSZA 2ZIVA 4IDIA 4ZRIA 3PSIA 2ZW0A 9ICCA 2XVTA 4G3XB 4KITB 1TK8A 4J9PA 2A1JA 3H8MA 3WKAA 2ESEA 1ZQJA 1ZQMA 1ZQFA 1ZKHA 4N58A 7ICOA 3N30A 3ZJTA 3RAQA 2L0TA 5KNIA 5KFWA 1S76D 5ALNA 2G5HB 4NJ7A 1DOIA 4PYUA 1XT9B 1N5XA 4PS7A 4C00A 3ETLA 3AV8A 3AU2A 2PI4A 4KKIA 4UB3A 3VTUA 2BTEA 3AEEB 3WANA 1NENB 4EENA 4DSJA 4WURA 4F4XA 3GE3C 2GO7A 2RHFA 5J8YA 2L5YA 5KFHA 4F3OA 5J0XA 4U7CA 4R66A 4RGOS 1KN5A 2WF9A 1AWDA 3SD5A 2M0XA 2W9CA 4CYEA 1ZETA 2K8CB 2AU0A 3H0LB 2HHUA 4HAIA 3RRGA 3I1YA 3RCZA 5J17A 1TAMA 2L7RA 5T14A 4EE2A 4YTPB 1Z1BA 1B22A 1T7PA 4OJLA 4BX9C 4KX3A 2BDPA 2I1QA 2K25A 3N3KB 4Q45A 2BKRB 3ZDDA 4Y2XA 3TACB 2H3QA 3Q8FA 3QCAA 3VTWA 1ZQTA 1RZTA 1O03A 2HDEA 5CWRA 1QLNA 4CE6A 4QZIA 3KUZA 4F92B 1C78A 1FCCC 3CYMA 2W43A 1STEA 1YMHE 3OG5A 3R7QA 4MJSA 2F1IA 8ICKA 4O0IA 3ENEA 1ZQRA 4EX7A 3Q8RB 2BS2B 1ZQYA 1JQ4A 1ZQ1C 4RPXA 3UQBA 2ZXHA 4ELVA 3C28A 2K3UA 2YB4A 2B6GA 3A1QB 1TKDA 4JPSA 1CJEA 3IAM1 4W9CA 3QAQA 4HKQA 3QU4A 2PFPA 2PKOA 2QB0B 1YN4A 4TQRA 3PZDA 3TBLD 1TFRA 4CF5A 3I57A 2D10A 1PYWD 2BHNA 1KM7A 1GG3A 2WXRA 4AUQC 3NS8A 2CHWA 3V6KA 5JZEB 2G09A 2PMVA 4IR9A 2YB1A 3BZCA 4UAYA 1XEEA 2HCFA 1ZOYB 2PW9A 2W7OA 8ICHA 1J7CA 4DEZA 3BS5B 5JUMA 5CP2A 1UH6A 4YR0A 2ZEQA 3H8JA 5DQHA 2RMMA 3DHGC 2AQ4A 1FM0D 2ZIUA 2XICA 2P6RA 4NLKA 4QZDA 4O3PA 1XNSA 2YY6A 4K7UA 3WIMA 2BCRA 4YSXB 2MRLA 3N7RC 4ACOA 2LGIA 2WFAA 1VLBA 4BVUC 1PK3A 4UDUC 1SXDA 4OHJA 4J9RA 2YEPF 1Q10A 1WJ4A 8ICCA 4I2JA 3AE8B 3MC0B 2NYVA 1A76A 4E0DA 4IQWA 2ASDA 2KDBA 5J2GA 2WLBA 1WGRA 3EFCA 5J2DA 4UAZA 4ASWC 3WK7A 2UYZB 3IHQB 3C5FA 3N7SC 1WXAA 1JWUD 2K22A 3BY4B 4NAMA 4M8NA 5KT5A 1L5UA 3MR2A 1MQ3A 2LVQA 2PI5A 1DOQA 2ZW1A 1OEYA 2BYEA 3MHSD 1ECWA 3AE9B 4F5NA 1OTRB 3A1QA 4YXMA 3RULA 3A0BU 5T8IA 5ALHA 4PZNA 2QB0A 2KICA 2EH9A 2JRIB 1JX4A 4BAXA 2CJNA 2INNE 2W7PA 4M9NA 4P4MA 4NLNA 2M0NA 1YQ4B 2N1WA 2FAZA 4DL5A 1SZPA 2K6QA 5D6JB 3BS5A 3AE2B 4OVZA 5L83A 4DWFA 2PFOA 1WXVA 3APDA 1DYQA 2XY6A 2WDRB 5HFYA 4ELTA 3UIPB 1Q3UA 2JXTA 2DAJA 2KX0A 1PQSA 2JYTA 2Y5CA 2PJHA 1WFYA 3BVMA 1NZBA 3BQ0A 2JWUA 1WE7A 2Z0DB 3TEZA 5KFQA 1F2RC 2WF8A 4KLLA 1R4NB 3W1SC 3GP7A 2KOXA 4DS5A 2KHVA 3HK0A 1LKYB 3MFIA 1UD7A 2IGHA 5KFXA 3V6JA 2HHQA 1C4AA 1ET6A 2HVHA 1MA7A 4B9LA 3Q3OC 3RAXA 5EE9A 1L6VA 3ZNZB 5MPOA 4B6WA 4DL2A 4M47A 2FE8A 4QWCA 1L6NA 4ED6A 3O13A 1XO1A 4NXZA 2MUTA 5KFGA 3PV8A 4WJOA 5AKKA 1I7HA 3MP9A 2KP7A 2LJ5A 2WU5B 4B9SA 2Y1IA 1P9DU 2RP5A 4FS1A 3TL5A 2WYQA 2WXGA 4DQQA 2BYVE 2LD9A 1DK2A 1WRIA 4R65A 5H2FU 3RBDA 4KDIC 5HKHA 2JVCA 2LZ6A 2F2AB 2AJQA 1MG4A 4DHJB 5F3XB 1WX7A 5IAAC 5JXVA 1PDXA 2D3BA 1PUZA 2FLPA 3E58A 4FJYA 4XWWA 4XWTA 4EBEA 3DCGA 9ICTA 1L0YB 2JZPA 3KHLA 4DHJD 3ZDAA 4XYCA 5J0YA 8ICWA 4RF1A 5E6OA 1A70A 5ALLA 3MGHA 5G2NA 2LHEA 5DGBA 3RNFC 2LUMA 1CMXB 3TQ1A 3ZNID 1PK1B 1K5OA 2SAKA 1MG8A 4EBCA 4PH5A 2BYTA 3ETRA 1S0OA 8ICZA 4DXAB 3J9CA 5CR0A 1CK1A 1WXMA 1Y88A 2ZIWA 1L3UA 2N7DA 4S17A 4DXFA 1LVHA 3S6JA 2PPHA 3C2LA 4DSIA 3KH0A 2JUOA 5BYRA 2KOBA 2N9KA 1LKYA 5AM1A 3WCQA 2DPIA 1V9PA 5KFNA 1TS5A 3MJWA 3WKBA 1P98A 4J3OD 4MGIE 3T3FA 2V3NA 4DWIA 7ICMA 2V4IB 1SV0A 1Q0WB 3T5HA 9ICGA 3V61A 3AUOA 3HKZF 2LI5A 3KHRA 1SXEA 1RG6A 2P35A 5KFYA 1ZJMA 4WJ3B 1GNUA 3MFHA 1J97A 1V38A 3B2GA 3RJFA 2DUYA 1SE9A 1F0MA 5G5GA 4NY0A 4CF3A 4IL6U 2P6UA 2DNFA 4F2SA 1HJPA 1XCTL 1FCLA 1X9MA 2PE6B 1MN8A 2K4EA 4AYBF 2IY0B 4QNLA 1JXLA 4FBUA 1UWXA 3PTFC 5ALRA 4R63A 4LNKA 5DPRA 4F8RA 1MFWA 4C8OA 3I28A 4XDCA 1U45A 2LVPA 2FLLA 2FMQA 3KZIU 3T79A 4HJKA 3NGDA 2A4ZA 2ZUDA 2NCNA 4F8CB 1SE2A 2M56B 2G0AA 3LVWA 2KMAA 2XN9C 1WYGA 1TVAA 3U8ZA 4G11A 1E9MA 4PL1A 2WXOA 3NZSA 4KN4A 4TQ0A 2BGFA 2KJHB 3PY8A 2ASLA 1X9WA 1ZPSA 3C8YA 4MELA 4M9GA 4JWNA 1X66A 2JF5A 3LYYA 5ALGA 1ROEA 2MU2A 3PO5A 1FFUA 3RRHA 3QXGA 1L4DB 3O65B 3SR6A 2IMWP 2F1JA 4KLTA 4KKJA 3N7PD 2R61A 2PMZF 2W03A 5AM0A 4QW8A 3GOEA 1A77A 5HHDG 4NJ8A 3I63C 1F0ZA 2YMPA 4RT3A 3R2TA 3Q8AA 4W9JA 1A6SA 2LRWA 2KK0A 3Q8SB 3DDHA 4UASA 9ICRA 1CEZA 1WX8A 4UAUA 3WU2U 5CRXA 3VC8A 3H0RB 2I9GA 2IYDB 3VFKA 3URYA 4I2DA 4ED0A 3ZNGC 2KHWB 4RUCA 4PGXA 4ANWA 4GDLB 2HVIA 4RM9A 1J8CA 2ASQA 2GBJA 2V9HA 3H4DA 7ICQA 1M4VA 4MACA 5KAFU 3RNCC 7ICKA 3TADC 2BCVA 1E7VA 2KJ6A 4F50A 4JV1A 1Z3EB 3CP8A 2J7QB 3QA8A 4IRCA 2OH2A 3OJSA 1NK9A 1FXIA 3E0FA 3DBRI 1LFDA 3Q8LA 2IY1B 2Z7JA 3VHTC 7ICRA 4GOCA 3VRAB 3ZXRA 4NLBA 9ICVA 3W5VB 3JPSA 4HDOA 3BVZA 1MQ2A 2J0KA 2KZRA 2QLTA 1WXSA 5JH5C 4GIVA 1AW7A 4EOYA 2AEHA 2Z8LA 3MR6A 1N63A 4DLEA 4MGYE 1VZ8A 4RNNA 4J9OA 1QKZA 2GI9A 3AE1B 3S2AA 4ZHPA 1ENFA 4W9LA 2JRZA 4ED2A 4ANVA 4TUQA 2V4QA 2BQUA 2WXMA 1XSPA 4I6PA 3VTVA 2MEKA 2HOIA 1L3TA 3HKZC 2LM1A 4I2EA 3ICXA 2F8KA 1EM7A 2Q0ZX 7ICHA 1XLQA 3C0RB 3RNBC 3B1LX 4YSZB 2UVVA 4P1CC 2ZUBA 1YD8U 1PVPA 1EO6A 3K9PB 2KV2A 4I2HA 1DGSA 5KFEA 3GIJA 1ZQNA 2KKCA 4RFBA 1K52A 4KLOA 3OGUA 2Y3AA 3KYDD 2K89A 3AE6B 4LNFA 4W9FA 5JHBA 1D9FA 1E7PB 3IT4B 2OJWA 4PS8A 1ZOLA 2AQ0A 4JIOU 3DVNU 4W9EA 2ONQA 3NVYA 5E6PA 4DF4A 1GB1A 1I4PA 4GLSC 4IC7B 5DB7A 2D07B 4MF2A 4I29A 4I28A 2X38A 2NRTA 3V7KA 3V6CB 4HWIB 2MHJA 3UINB 1X40A 4C56C 7ICLA 1QCKA 3TI0A 1KRHA 5D4BA 4RPZA 3UQ2A 2XK5B 5BMIA 5BYSA 1JIHA 2L05A 3PS6A 3VXWA 2IBIB 4FS2A 1UGMA 4II2B 2PE9A 4EZKA 2IDYA 2K8HA 4F5OA 4PGYA 4MEYA 3H7SA 1D8YA 7ICVA 4YT0B 4XE0A 1YX6B 3RJHA 4E71A 5J2KA 3U26A 3SFEB 3WAPA 1WJUA 3AEVA 4M00A 3QC8B 1EF5A 3M9NB 2EKEC 2FCMA 2KTQA 3GZNI 5GTHU 4OVUA 5DQGA 5J2RA 3PVLA 3APFA 2QEJC 2BB6A 1K1SA 3CSTA 4ZRPA 2D5GA 1ET9A 2R8GA 3RFZB 4J9MA 1N6ZA 1WGHA 5HP4A 2CRXA 4NL9C 3F53A 4RH6A 3IM1A 1VJ5A 2FPMA 4W9HA 4LVSA 1HE8A 5ALKA 2VRRB 2KZMA 2KWDA 4G9BA 4EELA 3QU7A 5J2JA 2OJRA 1VR9A 3TUOA 2H89B 4QAYA 3TEWA 3PZPA 2AL6A 9ICMA 1FPYA 2W8LA 1QQ5A 2WTFA 2IA6A 3GIKA 3LDAA 2L76A 1QF6A 3K1RB 3M9MB 2JX5A 5DLGA 3CSFA 1KH0A 1RYJA 2YQEA 4FZLA 2KWUB 1ZD2P 3WAOA 9ICJA 3NHEB 5BMHA 1YJJA 1RWSA 2RPQA 3AE7B 1JWBD 1KKXA 3IG8A 4HYKA 1WYWB 2MP2B 4K7SA 2WF6A 4KLUA 5G55A 4E3CA 1K50A 5KFRA 3VQIA 9ICPA 1GUAB 2MAXA 4EZ9A 4REZA 2XK5A 1GPXA 5AI5A 2HHVA 2HBLA 2MJDA 2WNMA 7ICPA 3W5UB 4MM3A 3BDPA 3G6YA 4RQMA 1U48A 5KL1B 1UQVA 3AMZA 4C4SA 1NJWA 2MQJA 4ZHOA 2LEKA 2FIFA 2LYAA 2XI9A 3DBHB 4EUTA 4I2BA 3T3NA 2UVWA 5DPTA 5DDMA 1S3SG 2AX5A 4HEA1 3SDLC 1V1PB 2ZXIA 4ITKA 2N4FA 3HWTA 2IHMA 1E6EB 4US9A 3B2FA 3Q8EA 3D2QA 4M9HA 1GO3F 5KFAA 1NBFC 3NUHB 1NYRA 2WXJA 4B9KA 1QTMA 1H38A 1NI3A 4NLZA 1L7OA 2EAOA 1SKRA 2B3AA 4OCZA 4R8UB 3WK6A 1BNOA 1YT3A 2WX1A 4IS7A 1YIWA 4Y2UA 1QOGA 5KFOA 3IBEA 1UHUA 4FULA 1J2NA 3RYTA 4RQ6A 4QWBA 1V9JA 3TAQA 4J9SA 2YX8A 1XQQA 3JSVB 3MABA 2N7EA 2K4HA 1NJZA 1T3QA 4G3IA 5EOZA 2KACA 3VUXA 1S0NA 4GLXA 2N9XA 2Q4TA 5FR3A 1F44A 2ZPYA 2Y1JA 4DQPA 4RQNA 2K8AA 2DKZA 2HTME 4DXGA 1NVID 3H1UA 1V5TA 2RDHA 3NZUA 2LMCA 8ICUA 1H4RA 7ICFA 4CO7A 2R8JA 2INCC 3SU8X 2MP2A 2Y5BB 1D4BA 1HZ6A 2G4DB 4RGMA 2ZJDA 3ZD9A 2BDUA 2YN4A 4A3OA 2EDUA 4C0ZA 1VDVA 3P63A 4UATA 4N59A 4QWAA 2CU3A 4XDDA 2D2QA 9ICLA 4KLGA 2JGAA 1C20A 2H3IA 3RB3A 4YTNB 1EUVB 2IGGA 2BKEA 2C7MB 5KFJA 1YX5B 4JMUA 5KFSA 1V1PA 3AECB 3R66C 5D7GA 3R7RA 3MDAA 2OXOA 5LNK1 1D8LA 2L83A 4GXJA 5HHIA 4DO9A 1SWVA 4LNIA 4BFRA 3Q14C 1ZQWA 3UMGA 4RQ3A 3ZNHB 2BW2A 1T8EA 4R8UA 1KFTA 2KFKA 3I76A 1KLUD 4XC2A 1TZ1A 2GBKA 3L08A 4JK1A 3SEIA 1ZQGA 1NDDA 4HXDA 2ZVOA 4RQ0A 3ZRCA 2HBMA 5BO4B 4EZLA 3R8BA 2K4PA 4IQUA 2G1EA 3QX1A 1P7FA 1ZD3A 3A4SC 3JSVA 1NZPA 5IIIA 1ZQIA 4AP4C 1T3NA 1D3ZA 3PPAA 3Q8PB 3TEYA 4K1RB 4UQGA 2A1AA 2AGPA 4JL9A 4P4OA 5AICA 1RXWA 5J0UA 2KKPA 3IN5A 1XWLA 3B08A 3ONSA 3ZJVA 1BPXA 2KFZA 3ZI4A 4OVVA 1TYGB 4U6PA 2M19A 1N5WA 8ICGA 3DBLI 5BMGA 2QCZA 3N4MB 4C8LA 2FE9A 2GLSA 3IFWB 5KFMA 2KAJA 3UMBA 1X9SA 1L8LA 4HKZE 1VRAB 2IO3B 4DL6A 4OJPA 1R7SA 3MR5A 1ZQSA 2OCEA 1IUEA 3BIID 4K81A 4RQ2A 3ZDEA 5C5JA 2QIEB 1SSNA 4ZRJA 4ARCA 1CQVA 1RYSA 2AQ3B 2X8XX 2H5XA 5L1JA 4F4WA 1S97A 1XXGA 4ZDVA 3RFAA 2GB1A 3QU9A 4BWJA 2FUHB 5KFDA 2IOHA 5IIOA 5KL8B 5EWEA 2RQ5A 3N20C 4HCPB 2Z59B 4IM3A 2KMCA 2WXIA 1FEZA 2VH2A 1NK5A 1Y56A 1B1ZA 4N6EB 2I2YA 3ZLZA 4WWPA 3OJUA 1TV9A 3MTNB 1SL2A 2KNJA 2FMPA 2BBCA 2MBEA 3T9LA 1E0ZA 3K1ZA 2ALZA 1PGBA 2NMQA 1VJKA 3RJIA 4HPLB 1UWMA 3ABVB 8ICQA 2RSUA 2TSSA 3VRBB 4Y2VA 7ICGA 1EXNA 3C19A 3SAHA 3L13A 1Z4OA 4PPXA 3CMMB 1FRDA 2L32A 1Q5WB 2W82A 2KDMA 3KYCD 2HE7A 2PFNA 2WWZA 3RJJA 2GOLA 1C1YB 5L95C 4YWGG 3ZTDA 3Q3NC 1BNPA 1DOYA 3M62B 4WWNA 3APCA 1TS3A 1V6EA 8ICJA 4HJGE 4EZ6A 8ICYA 4LLGM 2KE7A 2K0PA 3IT6B 2BZFA 4UB5A 5DG7A 2LGYA 5C0YA 3QHTA 4P16A 3KQ4A 1ZRNA 3KTQA 4NLCA 3HP6A 1I35A 1BPZA 5DBAA 5AM5A 5ALWA 4P2HA 2QHOA 3BQ7A 3QJZA 4FBJB 4W9KA 3BINA 5AKEA 5KTQA 4Y2YA 3HILA 2GBRA 1WGGA 2K8CA 2N0SB 5A0LA 2FPLA 1HUZA 3ML9A 4DFDA 2C2RA 4UBBA 1LB2B 1EF1A 1T0QC 1KLGD 3NRZA 1E8WA 1D8BA 3P4SB 1WJ6A 4GXKA 3OTQA 4KMOB 2JQRB 4GXBA 1T94A 2DWQA 3ED5A 1F52A 3HM3A 4CNQA 3N1ZC 5KAIU 4C8MA 5IOIA 2ZVNA 4A3PA 3GIMA 1SIFA 2H3ZA 1ZE3D 2XY7A 3MFGA 4KLJA 2B21A 2LGXA 4ECYA 9ICHA 4F5QA 4D2KA 4KMUA 2V4LA 4IWQA 5J2EA 1KOTA 4P0QB 3FILB 2E8PA 8ICOA 4CRXA 1L0XB 5KHOA 3KLSX 3GILA 2D3GA 2KANA 5AM3A 3L4PA 5F9NA 4NQLB 1Y8RC 3Q8QB 4IW0A 2MBBB 3F5AA 5CEHA 4O3MA 3OPXA 3C2MA 5D2MB 3PLUA 1WCLA 2LI6A 3R2IA 2BPFA 5J2CA 2XO7A 1KRPA 4ECSA 4KLDA 4EEWA 3D2SA 3Q2AC 3ZXVA 4ZOHC 5KFFA 3AU4A 5AKLA 2VJ5A 3THVA 3ECIA 4A9AA 2B76B 3PW0A 3ZJUA 4PT5A 3EC8A 3D2NA 2UVRA 4IRKA 3H0MB 4I6NB 4Q44A 1QT9A 5IILA 4TMAB 5CA7A 3SAGA 2AWTA 3IP4B 3M9OB 2YMQA 3JPTA 1TJEA 4Z6CA 4ARIA 4NJCA 2P66A 2ZNVC 3AEFB 5AUKA 4BZAA 3ALBA 2ICIA 2I1JA 2NTSA 2R2QA 2DGZA 4EYIB 1J0GA 4DL7A 5FKAC 3T3OA 2F1HA 5KFLA 1V49A 1ZYQA 4MEMA 3CWIA 4AJWA 2O2VB 2OEDA 3OAWA 1X6IA 4QZHA 5JTIA 3RD2A 3PSPA 5J2BA 4MF8A 2N9LA 2MSED 3EWAA 4B9NA 3KFUF 2KQ4X 3V62A 1R4MI 1WUDA 3X23A 5C1ZA 4P6VF 4F4YA 2JV3A 2DL0A 5BOMA 1SGGA 2M4NA 3P4QB 4IM2A 4J9QA 4ZYNA 2FPKA 2HW3A 3VUWA 3W9CB 2HOQA 3ONNA 3JW0X 5J2HA 4YSYB 2ZTEA 1ZP0B 3H7IA 3N1YC 5KFZA 3H8HA 3PW2A 2NS5A 3D32A 3UPQA 2KX3A 2PLPA 3T5LA 3I9V1 1BPYA 4JB3A 4DQRA 2KJ8A 3EHVA 3JPOA 3ISBA 2A19A 3M3JA 4HLEA 1A5RA 1B43A 4B95A 3CRXA 4GIBA 2E3TA 4DS4A 3OWEB 1VZ7A 2E5SA 2Z0EB 2VIXA 1GJZA 1KLVA 4DLGA 4DSKA 5KG7A 3MC8A 2MX2A 2F76X 1EU4A 4Z6DA 4O9MA 5AUIA 5HNKA 4HCNB 1B4FA 1UF0A 2WDQB 2E8MA 4QIWF 5KFIA 4M9LA 3M6ZA 1ESFA 5TISU 2M8SA 5KT7A 3AE5B 5DDYA 5JU5A 2G08A 1PGAA 2BCUA 4OJ6A 1N60A 1I4XA 1YZ6A 1H8CA 5J0RA 2KFNA 4DBGA 4M0AA 4RQ8A 4KLQA 2R18A 3QUCA 4X5VA 5D3DA 2KYWA 4JX1C 5C23A 2WP9B 4I6LB 1HZ5A 4MSQB 4NJ6A 4I27A 7ICNA 2AXTU 5AIAA 1LM8B 1TGZB 3FAHA 1YN5A 3FM9A 2G3QB 2QJLA 1TTNA 3H9DA 1SKSA 1UA0A 4WQOB 4DFPA 1OQQA 4RZRA 4MGZE 4KLEA 1XD3B 4H2AA 1BPEA 1YZ7A 4MSMB 3L54A 1L4ZB 1RAXA 2IOFK 1JWAD 2BPGA 3H7PB 3KKAC 2BCSA 4C4TA 1X42A 2BCQA 3PW5A 9ICEA 2HDOA 2RDIA 3GFKB 2XY5A 2EZXA 5IP4D 4B0MA 3PR5B 3P1MA 2FLNA 1ZGUB 1I4RA 4OD0A 3N9YC 5EE0A 1BMLC 4II3B 1E7UA 1T0RC 1DOXA 5E79U 3JPNA 3BK1A 3Q8BA 3SENA 4NM1A 1TY2A 4A8XC 5HMMA 5J0WA 5J2AA 3Q69A 1GC7A 1WGYA 2ZTCA 5CJ7A 2RRDA 8ICXA 4TURA 4IR1A 5KG1A 1D5XC 4B9UA 2I6XA 4MEXA 1V2YA 1FIQA 1WGDA 2RDGA 4JWSC 4DK5A 5FR6A 1FXAA 4WJNA 1RYUA 2N9PC 2QB1A 4NV0A 2KDEB 1PK1A 2WHIA 4ECUA 2W9MA 1O08A 1HIWA 3ZQ4A 2WGSA 1KBUA 1WF9A 1UCVA 4FADA 1IBXB 3SYZA 2QDFA 3IVFA 3B0YA 4KLFA 4OW0A 5GTIU 1XLPA 3RZWC 1LGRA 5FK9C 2B0CA 4EX6A 3B0AA 4IUMB 9ICSA 3J81j 1ZQCA 1YJIA 4MGKE 1XU4A 3TKAA 1Q1OA 3DBSA 4LJXA 3B9JA 2E8OA 5DBBA 1NK0A 1HXYD 5AZHA 5J0QA 3SI8A 1WR6E 2ZJ5A 5J8YC 3ZGZA 3IXSA 4Y2JA 1ZQVA 1YN3A 2HD5B 3H7PA 1UUPA 1F77A 3NTUA 2NRXA 3OJ4B 3PO0A 3I3TB 3ORYA 3L3FX 2OOBB 1RLFA 2NVUI 2NBUA 3LWLA 1KLNA 2KT7A 4ECTA 4EEKA 2JEIA 1ZW7A 3H4BA 4QIWC 4EKUA 2VJ4A 2J0JA 3HM6X 4PYZA 3EW9A 3DQVA 7ICUA 3TARA 1N56A 3BQ2A 7ICIA 5AI8A 1U4AA 1P0RA 2BB5A 4BBNF 2ZCCA 4Y2TA 2J0MA 2ISPA 4HDQA 3PNCA 4DFKA 1IGCA 1UNSA 2GMIC 2WU2B 3WALA 4HPPA 4K3BA 3AQEA 1ZQHA 4DFJA 2BYFA 3A9KB 4DL4A 2W54A 2L8JA 3HVZA 1I4HA 2JZZA 3RMKC 4XQ8A 3GDXA 4YD2A 2EANA 4JWUC 1QSSA 4CCHA 3L17A 3OLMD 3RZFA 2KN7A 4ACFA 1JROA 2FDRA 1IBXA 2NV3A 4K3CA 3UXOA 2EMTA 1QILA 2EZZA 2L52A 2RPVA 5DLFA 4YMOA 4GDKB 2K9XA 1E5WA 3L16A 3UM9A 1S0MA 1GAQB 2IPKD 3PW7A 2QMTA 3GZFA 4TV3A 1EWCA 5BYQA 5JHAA 3I5JC 4FJZA 5KG6A 1V80A 2DYOA 3ZKJC 1CRXA 2YLMA 3IHPC 4GB9A 4XZ4A 2V3SA 5F9LA 2C2DA 4YN4A 5AHXA 3EYZA 2R8IA 4DOBA 5LXIB 8ICTA 2IHNA 4NLGA 1WE6A 1XLOA 4AYBC 1C9FA 2F3NA 3H8SA 3OSNA 1SL0A 3ML8A 3UIOB 1ZQXA 1COKA 4OZCA 4C4VB 1JWSD 2WXNA 4GDLA 2KXJA 2M17A 4QWEA 1BT0A 2ATLA 2WXFA 3AB5A 3PHWB 5KFBA 1VCBA 3RB6A 2GH1A 4J9KA 2BWFA 5E6NA 2DX5B 1Z2MA 1XS9D 2ZJ8A 4M6WB 2LGSA 2LWPA 2FNJB 3ZYYX 1NNLA 4DOAA 4MDKE 2MBHA 2LYBA 5DB8A 1X9XA 2FCSA 3PRPB 4NQKE 5ALTA 1SKWA 2ASJA 3P4PB 1FO4A 5ALPA 5DB9A 2IO2B 4HROA 1PVRA 3GV8B 3A9KA 5J18A 2V0GA 3PZ8A 2KNBA 4N9F4 4NNJB 4FXCA 4KZ0A 3LWMA 4L1BA 4FA6A 4RNMA 2KVRA 5HMLA 2JHDA 3RNAC 4F5PA 1PUTA 2NR2A 1EU3A 5TZVA 2I1KA 5KT6A 3LB8C 3IG5A 3TIXA 1Z00B 2PMZC 3NOBA 3CW2C 5AK4A 3AQFA 2XGPA 3E9SA 4FHKA 1BPBA 5DBCA 1Q3VA 9ICOA 4CHKA 3IRUA 4GU2A 4RNAA 5DG9A 5HHHA 2BQ3A 3V05A 2A5UA 2OEHA 2Y0SF 3BYTB 4WJPA 5D49A 3MGVA 1RDFA 3DEEA 2J53A 2GBMA 1QQ7A 5DKWA 2FI1A 3QQ8B 2KVZA 4I2GA 5GMVA 3QIJA 3W2DA 3UGBB 4ED8A 2PVGC 1SL1A 4PHEA 2WF7A 3NY5A
chains in the Genus database with same CATH topology
1V97A 3AE2B 3P4RB 4OVZA 3ZJVA 3KWLA 1DYQA 5HFYA 2WDRB 1QOAA 1IGDA 1TYGB 2JXTA 1WSPA 2M19A 1N5WA 2JYTA 1ZDVA 2ACZB 2Y5CA 5BMGA 2J42A 2NTTA 2QILA 3BVMA 5I4DA 2KAJA 4MT5A 2JWUA 5G5HA 1BUIC 3EGRA 4HKZE 3TEZA 4C7YA 1SE4A 1F2RC 1KFYB 1VRAB 1R7SA 4C80A 1L0VB 3GP7A 3AEBB 1IUEA 3BIID 2YEPB 2QIEB 1SSNA 2IGHA 3AEDB 1C4AA 1ET6A 1CQVA 3TSSA 2AQ3B 4B0EA 4ARCA 1L6VA 4KGSA 5EE9A 5MPOA 1MVKA 1SEBD 2WXQA 2J52A 1XXGA 2FE8A 3O13A 5C2TB 1E10A 2GB1A 2WXLA 2BT6A 1HA5A 1NEKB 5D3IB 1I7HA 4KGRA 3MP9A 3W1SA 2WU5B 2PTLA 3SFDB 5E6JA 2WXIA 1QOFA 3UI3A 1Y56A 1B1ZA 4N6EB 2I2YA 3NVWA 2WXGA 2KN4A 2FUG1 2BBCA 1WRIA 1E0ZA 1PGBA 2NMQA 1VJKA 4IKGA 2W55A 1UWMA 3ABVB 3FC4A 2TSSA 3VRBB 5JXVA 1PDXA 1FNVA 1QQRA 3MJ5A 4XWWA 1T6BX 4XWTA 1FRDA 2L32A 2W82A 3U2SC 1L0YB 2JZPA 2KDMA 3BYYB 1XF5L 5HG2A 1WGKA 2G9HD 4NZLB 4RF1A 1A70A 4YWGG 1DOYA 1CZPA 2LHEA 1FFVA 2INPE 1TS3A 2JSVX 2LUMA 1ZXHA 4HJGE 3SEBA 4LLGM 2K0PA 3AE4B 4OZBA 2SAKA 3IT6B 2BYTA 2MJ3A 2QSDA 1TS4A 4P16A 3ETRA 3KQ4A 4NAWB 3J9CA 1CK1A 1GB4A 4DXFA 1QOBA 3PZ7A 2Y5PA 2WS3B 4WIPA 5BYRA 4R3DA 2N9KA 4WWMA 3GS2A 2N0SB 2PVOD 3WCQA 2VZKB 1WWTA 1TS5A 4US8A 1OQRA 4RGNA 4J3OD 1KLGD 1P7EA 3NRZA 3P4SB 2W3SA 2V3NA 2JQRB 4A55A 4KGTA 2DWQA 2V4IB 5GXGB 2PIAA 2VZKD 4WQMA 3VR9B 2DYMA 1EWYC 1V1OA 1ZE3D 2AQ1B 3MFGA 3B2GA 2WXHA 1D5ZC 3NVVA 1UGJA 1K51A 5G5GA 4A90A 1GOZA 2IGDA 1V8CA 3E56A 4WAFA 4D2KA 1FCLA 1XCTL 2KMMA 3FILB 1L0XB 3NVZA 1L5PA 3KLSX 4CQNA 3HUIA 3BK2A 1C4PA 3AE3B 3L4PA 1XO3A 1VZ6A 2AQ2B 1SJHD 1TS2A 2JU6X 4WH4A 4MM3B 1UWXA 3R2IA 4L23A 1KTKA 3GB1A 3V3XA 4XDCA 4YXDB 4ZOHC 5EE3A 4RF0A 4A9AA 2B76B 3ZJUA 4PT5A 1SE2A 3P42A 2OHFA 2M56B 1C79A 2XN9C 1OFFA 1WYGA 4TMAB 1QT9A 5EE1A 1E9MA 1LO5D 2BS3B 2WXOA 1SE3A 1JRPA 2LJIA 2JYEA 1TJEA 4HRSA 4TQ0A 4ARIA 4NJCA 3AEFB 5AUKA 1ZPSA 3C8YA 5H8YE 2ICIA 2NTSA 2XNAC 5FKAC 3LYYA 1ROEA 4IOIE 1FFUA 3T3OA 3AN1A 1TKGA 1L4DB 3CWIA 2OEDA 3SR6A 1TKEA 1MPEA 4KKJA 1ACCA 1J7BA 2R61A 4TQ1A 5HHDG 1FD6A 1I4GA 1C4CA 1HQRD 1F0ZA 2N9LA 3R2TA 2KQ4X 3Q8AA 1ZDXA 4P6VF 3EUB2 3P4QB 4ZRQA 3URYA 2WXKA 3W9CB 1D6EC 4LTUA 4GDLB 1NYQA 1TY0A 1SF0A 4YSYB 1ZP0B 3H8HA 1XLNA 1K53A 1M4VA 2PLPA 3I9V1 4MACA 3IAS1 1FRRA 1SXTA 2SEBD 2H88B 1YQ3B 3OWEB 2E3TA 1FXIA 1VZ7A 2ON8A 1DGJA 3VRAB 1EU4A 3W5VB 3BVZA 5AUIA 3AM9A 4AS1A 1MHHE 2M0AA 1AW7A 1MHXA 2WDQB 1ESFA 1PFDA 2Z8LA 4C7ZA 1N63A 1VZ8A 1FEHA 1QKZA 1PGAA 2GI9A 3AE5B 3AE1B 3LXFA 1JMLA 4ZHPA 2MH7A 1ENFA 1N60A 1I4XA 3NZ3A 2WXMA 4TSSA 2MEKA 2Q5WD 4MH8A 1EM7A 1T5XD 1XLQA 5D3DA 4JX1C 2WP9B 3Q8CA 1JW9D 4YSZB 1HZ5A 5H92C 1YN5A 2QJLA 3FAHA 1KF6B 1WXQA 1OQQA 3DWGC 4RFBA 1K52A 1TKYA 2Y3AA 1HEZE 3AE6B 4H2AA 3RPFC 1E7PB 1RM6C 3AH7A 3IT4B 1YNTE 4L2YA 1L4ZB 2ONQA 3NVYA 5C3JB 1JWAD 4ZYSA 1GB1A 1I4PA 3AEGB 4GLSC 2X38A 2K5PA 4M0WA 1ZXIA 2GRIA 2IJ0A 4B0MA 1I4QA 3P1MA 2DBYA 2WQYB 2W3RA 3N9YC 1I4RA 1BMLC 5EE0A 4DQOC 1DOXA 4C56C 3BK1A 1KRHA 2WDVB 3Q8BA 3DWMA 3U4EG 1TY2A 1FNUA 4A8XC 5BMIA 3KWVA 5BYSA 3Q69A 1D5XC 1N62A 2IDYA 1FIQA 3HRDD 1PGXA 2RDGA 4JWSC 4YT0B 2MJEA 4XE0A 1FXAA 3TEXA 1D5MC 3SFEB 3U52E 4OZAA 5TSSA 2EKIA 2V3PA 2WXPA 2N7JA 3MHZA 4YTMB 2QEJC 2J4XA 2BB6A 4ZRPA 3BVGA 3ZQ4A 2D5GA 1ET9A 2L1AA 3RFZB 2DLBA 3NS1A 3VR8B 1AYFA 4RH6A 1IBXB 1FNWA 4OW0A 1XLPA 2LFIA 1AN8A 5FK9C 2KWDA 1QLBB 4IDIA 1YJIA 1JCKB 2BS4B 1VR9A 2ZW0A 3TUOA 2H89B 3TEWA 3B9JA 1HXYD 4N58A 1QF6A 1RFKA 3ZGZA 3IXSA 3ZJTA 2JX5A 4JE3B 1YN3A 1UUPA 1F77A 1DOIA 1KH0A 1RYJA 1N5XA 3PO0A 5BMHA 1YJJA 3AV8A 4KKIA 1RWSA 3AE7B 2BTEA 1JWBD 3AEEB 1NENB 4WURA 1SBBB 3AEAB 1L6UA 1C77A 4LK0M 3BWUD 1K50A 1BXTA 3FILA 4KX6B 1AWDA 4RGOS 3VQIA 4REZA 1GPXA 2MJDA 2WNMA 3W5UB 2BB5A 1SJED 5HI1A 4EE2A 1JALA 4YTPB 3AMZA 1IGCA 1UNSA 2WU2B 4ZHOA 2LEKA 1J7AA 3Q8FA 3T3NA 2AX5A 4HEA1 2W54A 3HVZA 1V1PB 2HDEA 2CJOA 4ITKA 1C78A 1FCCC 1I4HA 1E6EB 4US9A 3B2FA 3Q8EA 1YMHE 1STEA 1SB3C 1C76A 4JWUC 3NUHB 1NYRA 2WXJA 1JROA 2BS2B 1NI3A 1IBXA 1JQ4A 3BZDB 2K3UA 1QILA 2RPVA 2L52A 2EELA 4GDKB 3U7ZA 4JPSA 1CJEA 2K9XA 3IAM1 1QOGA 1GAQB 2IPKD 2PKOA 4HKQA 2QMTA 1YN4A 1EWCA 5BYQA 3I57A 1PYWD 2WXRA 2DYOA 4RGTA 2PMVA 1T3QA 2I38A 2KACA 1XEEA 1ZOYB 2PW9A 1J7CA 5FR3A 1XLOA 1C9FA 3EA6A 2HTME 4DXGA 1NVID 2RMMA 1FM0D 2RDHA 2LMCA 2E6XA 4OZCA 1JWSD 1B9RA 2WXNA 4Q2JA 1D4BA 1HZ6A 3AB5A 4RGMA 4YSXB 2WXFA 1FMAD 2LGIA 1VLBA 1VDVA 1F2RI 3ZYYX 3P63A 4UDUC 4N59A 2CU3A 4OHJA 4XDDA 2YEPF 3P4PB 1FO4A 1Q10A 1XCQL 4YTNB 3HVDA 3AE8B 4HROA 3MC0B 4O1NA 1ZUD2 2V0GA 2IGGA 3PZ8A 3CIRB 4A6QA 2WLBA 1V1PA 3AECB 5D7GA 4FXCA 5LNK1 4L1BA 2L83A 1JWUD 2K22A 4NAMA 1PUTA 1SIJA 1EU3A 1JWMD 3LB8C 2ZW1A 2BW2A 3E9SA 3AE9B 2LHDA 1KLUD 4RNAA 5T8IA 4USAA 3V05A 4AQ7A 3BYTB 4RCOA 3R8BA 1TZOA 2J53A 2G1EA 2CJNA 1P7FA 2INNE 1N61A 3W2DA 2FBWB 2PVGC 3TEYA 1MI0A 1YQ4B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V97 A;  2Q5W D;  3B2G A;  3W5U B;  3NVV A;  3AE2 B;  1XLQ A;  3P4R B;  5G5G A;  1JAL A;  3KWL A;  2WP9 B;  4JX1 C;  1V8C A;  1JW9 D;  3AMZ A;  2WDR B;  4YTP B;  2WU2 B;  4YSZ B;  1QOA A;  1TYG B;  4ZHO A;  2KMM A;  2LEK A;  1J7A A;  2M19 A;  1N5W A;  2QJL A;  3FAH A;  2Y5C A;  2ACZ B;  5H92 C;  3NVZ A;  1KF6 B;  1L5P A;  1WXQ A;  1OQQ A;  2AX5 A;  2W54 A;  3HUI A;  3HVZ A;  3AE3 B;  3L4P A;  3DWG C;  1XO3 A;  2CJO A;  2KAJ A;  4ITK A;  1TKY A;  5G5H A;  3AE6 B;  1E6E B;  4US9 A;  3B2F A;  4C7Y A;  3RPF C;  1E7P B;  1RM6 C;  1KFY B;  1SB3 C;  3AH7 A;  4JWU C;  1R7S A;  4C80 A;  1NYR A;  1L0V B;  3NVY A;  3AEB B;  1JWA D;  5C3J B;  1JRO A;  1IUE A;  3BII D;  2BS2 B;  1NI3 A;  1JQ4 A;  3AEG B;  2QIE B;  3AED B;  2L52 A;  1L6V A;  5EE9 A;  4JWS C;  4YXD B;  5MPO A;  4ZOH C;  2K5P A;  5EE3 A;  1ZXI A;  1CJE A;  2K9X A;  5C2T B;  4A9A A;  1E10 A;  1QOG A;  1GAQ B;  2B76 B;  2PKO A;  2BT6 A;  3P1M A;  1NEK B;  2DBY A;  2WQY B;  2W3R A;  1I7H A;  2M56 B;  2OHF A;  2WU5 B;  5EE0 A;  1OFF A;  1WYG A;  3SFD B;  1QT9 A;  1DOX A;  5EE1 A;  1E9M A;  1KRH A;  2WDV B;  2BS3 B;  1QOF A;  3DWM A;  1JRP A;  1T3Q A;  1TJE A;  4HRS A;  4N6E B;  1ZOY B;  3AEF B;  3NVW A;  5AUK A;  1J7C A;  5H8Y E;  1XLO A;  1N62 A;  1FIQ A;  3HRD D;  1WRI A;  1E0Z A;  1ROE A;  1VJK A;  2HTM E;  1FFU A;  1NVI D;  2W55 A;  3AN1 A;  1TKG A;  1UWM A;  3FC4 A;  2MJE A;  3ABV B;  3CWI A;  1FM0 D;  3SR6 A;  1FXA A;  4YT0 B;  3VRB B;  1PDX A;  1TKE A;  3SFE B;  1J7B A;  1B9R A;  3AB5 A;  4YSX B;  2EKI A;  1FRD A;  1F0Z A;  1FMA D;  4YTM B;  1VLB A;  1VDV A;  4P6V F;  3ZYY X;  1WGK A;  3P63 A;  4N59 A;  3EUB 2;  1A70 A;  2CU3 A;  3P4Q B;  3NS1 A;  3VR8 B;  1AYF A;  1FO4 A;  3P4P B;  1DOY A;  1CZP A;  3W9C B;  1FFV A;  1XLP A;  4LTU A;  4YTN B;  1NYQ A;  1SF0 A;  3AE8 B;  4HRO A;  4YSY B;  1ZP0 B;  1ZUD 2;  1QLB B;  3AE4 B;  3CIR B;  4IDI A;  1XLN A;  1YJI A;  2MJ3 A;  2BS4 B;  2WLB A;  3ETR A;  2H89 B;  1FRR A;  3AEC B;  4FXC A;  3B9J A;  1QOB A;  2L83 A;  4N58 A;  2K22 A;  2H88 B;  1YQ3 B;  1QF6 A;  1RFK A;  2WS3 B;  1PUT A;  1SIJ A;  2E3T A;  2JX5 A;  1FXI A;  3LB8 C;  1DOI A;  1RYJ A;  4WWM A;  3WCQ A;  2N0S B;  2PVO D;  1DGJ A;  1WWT A;  3VRA B;  4US8 A;  1N5X A;  3AE9 B;  3PO0 A;  1YJJ A;  3AV8 A;  3W5V B;  1RWS A;  3AE7 B;  1OQR A;  1JWB D;  5AUI A;  3AM9 A;  3AEE B;  1NEN B;  3NRZ A;  4USA A;  3AEA B;  3P4S B;  2W3S A;  2WDQ B;  1L6U A;  2JQR B;  1PFD A;  4C7Z A;  2DWQ A;  1N63 A;  5GXG B;  2PIA A;  4KX6 B;  4WQM A;  1AWD A;  2CJN A;  2G1E A;  3AE5 B;  3AE1 B;  3LXF A;  3VR9 B;  1N61 A;  2MH7 A;  4ZHP A;  1N60 A;  2FBW B;  2PVG C;  1EWY C;  1GPX A;  1YQ4 B;  2MJD A; 
#chains in the Genus database with same CATH topology
 5AIB A;  5EWG A;  4YG2 A;  1E8X A;  4P4P A;  8ICA A;  1NI2 A;  1SZH A;  3QK0 A;  4DL3 A;  4RQ4 A;  2MCN B;  5HR7 A;  3H8W A;  1QOA A;  3C1Z A;  1IGD A;  1WSP A;  3PX0 A;  3NG0 A;  4KDL B;  1ZJN A;  2F44 A;  2J42 A;  1Z4N A;  2QIL A;  5LXH A;  4QZ9 A;  2HI0 A;  2E1E A;  5G5H A;  1BUI C;  3WA0 A;  4KLS A;  1NOM A;  2IND C;  4ICA A;  3BJY A;  4C7Y A;  2KMD A;  1KFY B;  4YCX A;  1E8Y A;  3LDZ E;  5ALI A;  1L0V B;  3VUY A;  1SV4 A;  3AEB B;  4PGQ A;  3VH3 B;  5ALO A;  2VH1 A;  2YEP B;  2G07 A;  5KFP A;  2HJ8 A;  2C7H A;  3TSS A;  2ZG6 A;  4CDG A;  1SEB D;  3OJ3 A;  3SV3 A;  2NRW A;  2CS4 A;  5C2T B;  7ICT A;  2KEY A;  4Z6E A;  4K4G A;  3RN9 C;  2H3V A;  5DPW A;  2W04 A;  2BT6 A;  1NEK B;  3BZK A;  4QZF A;  1WG8 A;  2HHW A;  3BQT A;  3W1S A;  2PTL A;  3F2B A;  2PEA A;  1KDH A;  3TFS A;  2LXC A;  2KVC A;  1QOF A;  1RYR A;  4XRH A;  1T0S C;  1SGH A;  2O6V B;  3UI3 A;  2KIV A;  2BVC A;  1I42 A;  4OO1 J;  3N32 A;  2WHE A;  9ICX A;  4C8K A;  5JRT A;  2BQQ A;  2FUG 1;  2FCN A;  4ECV A;  3TCA A;  2JH7 A;  1PZN A;  3FDS A;  8ICR A;  2K39 A;  4PZO A;  2MLB A;  5AKY A;  2O6V D;  3WK8 A;  5DB6 A;  1FNV A;  1KL9 A;  1QQR A;  8ICP A;  3HIZ A;  3MJ5 A;  3QAR A;  1T6B X;  2ZCB A;  2YML A;  5DGA A;  3BYY B;  1XF5 L;  5HG2 A;  2AH5 A;  4RQ7 A;  2DZJ A;  2IO1 B;  4F91 B;  3ZO5 B;  1BGX T;  3UQ0 A;  1YJ1 A;  4KZC A;  1FFV A;  1NJY A;  5L1M A;  4Q8E A;  2KIW A;  5K4L A;  2VKQ A;  2YTU A;  4KLM A;  1ZXH A;  3DBR B;  3SEB A;  3VVW B;  2FJ6 A;  4ECQ A;  4OZB A;  3BS7 A;  4JWM A;  5AK6 A;  1TS4 A;  3PML A;  4I2A A;  4NAW B;  4ICU A;  3NRW A;  1FXT B;  5AK3 A;  2XEW A;  3PZ7 A;  1QQ6 A;  3UMC A;  4O3S A;  2Y5P A;  4DFM A;  4GMV A;  5IO9 A;  4LZG A;  5J0P A;  4WIP A;  1SV0 C;  3MDC A;  3QEB Z;  3TFR A;  4M02 A;  3ZTC A;  3U7D A;  2VZK B;  1WWT A;  3FYH A;  4US8 A;  2KJ9 A;  1UBI A;  1BVS A;  2JZB B;  4XA5 A;  4URK A;  2D6F C;  9ICW A;  4RGN A;  2JZ3 B;  3L10 B;  2W3S A;  2XID A;  4A20 A;  2K4I A;  1COO A;  3QEA Z;  4IWP A;  5ALX A;  3H6N A;  3W1Y A;  2OWO A;  3T5J A;  2KG5 A;  2VZK D;  5HR6 A;  5FP0 A;  1RQL A;  1C3T A;  3HJE A;  3UXN A;  2DYM A;  1OGW A;  2C7N B;  1EWY C;  1V1O A;  3CNH A;  4DOC A;  5IKC M;  1URJ A;  3F2C A;  2AQ1 B;  3HW8 A;  3HHM A;  4FHJ A;  5CX3 A;  4JV2 A;  2F77 X;  2E1F A;  1UGJ A;  4TQS A;  3E56 A;  2AYO B;  1V8C A;  4IRD A;  4WAF A;  4E74 A;  5IA7 A;  2KMM A;  2KLG A;  2NO5 A;  3NVZ A;  1L5P A;  2MRP A;  3SQI A;  4CQN A;  2KVS A;  3AE3 B;  7ICE A;  1VZ6 A;  1XO3 A;  4K4H A;  2AQ2 B;  1TS2 A;  2JU6 X;  3Q6B A;  2AHO B;  3C1Y A;  2LPE A;  2V9W A;  3SD7 A;  4LK0 M;  4JUZ A;  2MSN A;  1T4G A;  2ZIX B;  4UBC A;  8ICM A;  8ICI A;  1WZ0 A;  5KT4 A;  3IG3 A;  3K9O B;  1VD2 A;  1XO0 A;  2D3D A;  3TMP B;  1KW4 A;  3V3X A;  4YXD B;  4QW9 A;  5EE3 A;  4KLI A;  1Z5S B;  2JXX A;  3NUQ A;  4XGA B;  2KDF B;  4RF0 A;  4ANU A;  1R4N I;  1ZQB A;  4ED1 A;  4M04 A;  4MJS B;  4NAW A;  1DRG A;  4HVB A;  2M1M A;  4CGZ A;  2MBO A;  2FMS A;  2BS3 B;  1HUO A;  2KWC A;  4AOF A;  3RH4 A;  1SE3 A;  1JRP A;  3C23 A;  2JYE A;  5TR5 A;  5KT3 A;  4DSF A;  1OUQ A;  3GZN B;  2XNA C;  3VAW A;  3SMV A;  2JZB A;  4IOI E;  4Y2S A;  3AN1 A;  1TKG A;  3WKD A;  2BQR A;  3L0W B;  4RMA A;  4YMN A;  3QE9 Y;  1J7B A;  4WWO A;  1TK5 A;  3GE8 C;  3WK5 A;  2QC8 A;  1FD6 A;  1I4G A;  2JMG A;  1C4C A;  2L3Z A;  3KVF B;  4RUA A;  1UA1 A;  1UZX B;  2KZ3 A;  2LBO A;  4YQW A;  3UXP A;  2EAP A;  1WY8 A;  1ZQA A;  2HJ1 A;  4I2I A;  1IPG A;  4ZRQ A;  2D8C A;  2K60 A;  1WCN A;  2ZIU B;  4ECW A;  2IZV B;  3IV6 A;  5AK5 A;  2WXK A;  4C8N A;  1LQB A;  3PHX B;  4JQW C;  1NYQ A;  3BQ1 A;  1TY0 A;  1SF0 A;  4LTU A;  1U4B A;  2LVO A;  2LGD A;  3GV7 B;  1XLN A;  2HHT A;  3WK4 A;  3NAS A;  4QZ8 A;  3IAS 1;  3O0F A;  3ZVV A;  2J6U A;  1ZQU A;  2ZIX A;  3PMN A;  1WWU A;  4F2R A;  1U49 A;  2ON8 A;  4LCD E;  2MA1 A;  3JPP A;  4YL8 A;  5KFU A;  1ZD4 A;  2HBK A;  2V1Y A;  4LNN A;  1SWW A;  3TAD A;  4AS1 A;  1MHH E;  1MJD A;  2M0A A;  1MHX A;  4TUP A;  2HHX A;  3L5K A;  1NK4 A;  3A9J B;  4YXJ A;  3C21 A;  4F5R A;  4QZA A;  3PV1 A;  4EZJ A;  1FEH A;  3QU5 A;  3LXF A;  3PGE A;  1M6Y A;  1JML A;  2MH7 A;  5KG4 A;  2J6S A;  1L3V A;  4FLH A;  5AKJ A;  4TSS A;  3RI7 C;  2Q5W D;  3RTV A;  4MH8 A;  2ODG A;  5ALS A;  4TUS A;  1T5X D;  1OEY J;  1V81 A;  2VA8 A;  1JW9 D;  2CKH B;  3JPR A;  4ZRK A;  3RH6 A;  2KDI A;  3F5E A;  3QUB A;  1PVQ A;  5AM2 A;  2UU7 A;  5H92 C;  4AWJ A;  4B9T A;  1F1H A;  1ISN A;  2C9W B;  4XUS A;  1WXQ A;  4ED3 A;  3RF9 A;  3DWG C;  4W9D A;  4HK2 A;  1HEZ E;  2BPC A;  1RM6 C;  4GC7 A;  3C5G A;  1NJX A;  1RRB A;  2KN5 A;  4LJO B;  5C3J B;  2K1F A;  4ZYS A;  9ICB A;  3AEG B;  1UT5 A;  3H40 A;  2KC2 A;  3VCB A;  5KG2 A;  2G45 B;  1Q8K A;  2K5P A;  4J9L A;  4GGQ A;  1ZXI A;  2GRI A;  3V7L A;  2DAF A;  2M9N A;  3ZDC A;  5IIM A;  5J2F A;  2WQY B;  5B66 U;  4LJP B;  3PX4 A;  2JWZ A;  1OW5 A;  2WDV B;  4YP3 A;  3U4E G;  1FNU A;  4K4I A;  1QZE A;  2GBN A;  3KZX A;  4PL2 A;  4X57 B;  3RNE C;  1IP9 A;  2ZJA A;  8ICB A;  3HRD D;  1PGX A;  2MUT B;  3KHH A;  1YQB A;  3KW5 B;  4P1B C;  1TK0 A;  1XSL A;  3GU3 A;  3LYS A;  3DVN V;  1WR1 A;  4XX5 A;  2NRZ A;  3A9J A;  5KG5 A;  2JR5 A;  3JPQ A;  4OZA A;  1ZQL A;  2K8B B;  5TSS A;  1Z1V A;  2AL3 A;  3KBB A;  3EPG A;  2V3P A;  3RUI B;  3MHZ A;  3RBE A;  4Q43 A;  2J4X A;  4O5E A;  2BWE S;  4R64 A;  1T0Y A;  2KD1 A;  4MFF A;  4ZH4 A;  1S8O A;  9ICU A;  2DLB A;  3VR8 B;  3SZ2 A;  1AYF A;  2C60 A;  1FNW A;  4C4R A;  2O6K A;  2LFI A;  1KEJ A;  1ZQE A;  4GFJ A;  4LZD A;  1J19 A;  1L7N A;  1QLB B;  2F8L A;  2WB1 F;  4ECX A;  2MW5 A;  3ZDT A;  1JCK B;  2BS4 B;  1C7Y A;  2KC1 A;  4YR3 A;  4DDG D;  1S1Q B;  2KHQ A;  4NL9 A;  2N1R A;  3HX0 A;  1RFK A;  1TT5 B;  3K4G A;  1ZQP A;  4F93 B;  5AKI A;  4QZE A;  2JEJ A;  3Q8M A;  4JE3 B;  1CUK A;  2KK8 A;  1KSP A;  4B6J A;  3PX6 A;  3AUL A;  1N2X A;  1Z19 A;  2KZZ A;  1L3S A;  2LUE A;  4K7W A;  2ZIW B;  3IDW A;  1SBB B;  3AEA B;  4DF8 A;  1L6U A;  4KN7 A;  4DDI D;  2PXI A;  9ICF A;  4FZM A;  1C77 A;  4P0Q A;  2CHZ A;  3BWU D;  3AL0 B;  1BXT A;  3FIL A;  4KX6 B;  9ICK A;  1DXS A;  4OJ5 A;  2V4R A;  1KFS A;  3DBL B;  3N28 A;  3N97 B;  4QWD A;  3OHB A;  1ZQQ A;  2LAS A;  3DVG X;  1SJE D;  5HI1 A;  4BOS C;  1JAL A;  4PHA A;  4PK1 A;  2NBV B;  3WKC A;  2JEG A;  4KSL C;  1E8Z A;  1J7A A;  4F4Z A;  3SAF A;  1L2N A;  3OHA A;  4MFC A;  2K8B A;  2WAQ F;  1IIP A;  2CJO A;  1IYF A;  4I2F A;  5KFC A;  4AP9 A;  5ALY A;  1SB3 C;  1C76 A;  1ZQZ A;  1RFA A;  2RD0 A;  3RJK A;  5AI0 A;  4KLH A;  5AM4 A;  1MSW D;  3BZD B;  4UB8 U;  2LXA A;  5ALV A;  5J2I A;  2EEL A;  3U7Z A;  2DQN B;  1TE2 A;  5KFT A;  2YVC A;  2MA9 B;  3TAN A;  3TAP A;  2KQ7 A;  2IO0 B;  3ALR A;  4EBD A;  3EZ5 A;  2DFL A;  3M6K A;  8ICF A;  2O2V A;  1YOV B;  1S9F A;  2D3C A;  4RGT A;  2KTF A;  2JT4 B;  5J29 A;  3M8R A;  1WM3 A;  1UT8 A;  2UVU A;  2I38 A;  2ZTD A;  1K8R B;  1NK7 A;  3EPI A;  4F7Z A;  4NPN A;  8ICS A;  3AU5 A;  2HBJ A;  3F2D A;  2VA2 A;  3EA6 A;  3PRZ A;  1ZQK A;  4EYH B;  1TAU A;  4DQI A;  2OYY A;  2E6X A;  1V86 A;  1Q46 A;  1B9R A;  3MC9 A;  4Q2J A;  1L7P A;  2RDB C;  2BKF A;  1RPL A;  4NY8 A;  1OQY A;  1CI4 A;  5IN7 A;  1FMA D;  4YVZ A;  3DPD A;  1U47 A;  1LXD A;  1DK3 A;  1F2R I;  3PRE A;  8ICE A;  4NWI A;  5DPS A;  4IQT A;  3KUC B;  3KD3 A;  4UB2 A;  4BXO B;  3ZD8 A;  1WRD B;  2EAM A;  1XSN A;  1XCQ L;  3AXC A;  3HVD A;  2LKY A;  3Q8K A;  5CHG A;  4O1N A;  4F72 A;  1UBQ A;  1ZUD 2;  1A0P A;  2EQY A;  1S77 D;  3CIR B;  3FKY A;  3PLV A;  4A6Q A;  8ICN A;  4FE3 A;  2VA3 A;  2WF5 A;  3QUQ A;  4BWM A;  5EWF A;  2WB1 C;  4W9G A;  1QH9 A;  4LNO A;  1SIJ A;  1JWM D;  2KFJ A;  2ES6 A;  3PW4 A;  3RR8 A;  4A8E A;  5J0S A;  5ALF A;  4UW9 A;  2LHD A;  3QYP A;  4J9N A;  2BGW A;  2JRH A;  3Q3F A;  4TUU A;  1JUD A;  5J0O A;  5AI9 A;  4USA A;  4GXI A;  4JV0 A;  4FZN A;  1L8O A;  5IIJ A;  4AQ7 A;  1JI7 A;  4RCO A;  2LHT A;  1TZO A;  2JXJ A;  2A3V A;  4IG7 B;  4BKG A;  2WDT B;  3ZIM A;  1N61 A;  4I2C A;  9ICN A;  4CF4 A;  4UB4 A;  2EMS A;  1RQN A;  1MI0 A;  2FBW B;  3PST A;  4YD1 A;  2KLC A;  2WX0 A;  1V97 A;  2VAN A;  1RXV A;  2ZPN A;  3P4R B;  3QZ7 A;  2EZY A;  4FFD A;  1AAR A;  2ZZP B;  3KWL A;  4Y2Q A;  3DVG Y;  3K75 D;  4UAR A;  4TKN A;  5J0T A;  1M94 A;  1ZDV A;  1IG6 A;  2ACZ B;  1JN3 A;  2NTT A;  1ZD5 A;  3ZDB A;  3C29 A;  1WMH B;  3RB0 A;  3KHG A;  3G6X A;  2CR5 A;  4GN1 A;  3KUD B;  4MT5 A;  5I4D A;  1ZQO A;  4UB1 A;  5ALU A;  3EGR A;  3VDZ A;  1SE4 A;  5AI6 A;  4PS3 A;  3X0W A;  2WAQ C;  4BDP A;  4C80 A;  3V6H A;  3QZ8 A;  3UQA A;  4O3O A;  2KO3 A;  1J2M A;  3DBH I;  1V85 A;  1OXJ A;  3GV5 B;  2QAR B;  4BXO A;  3DHH C;  3AED B;  2G4S A;  1F5S A;  4O3Q A;  1WIA A;  1MVK A;  2WXQ A;  4KGS A;  2J52 A;  2XBB C;  3PSF A;  4S0R A;  2LMR A;  3PRM B;  1TIF A;  3ZDM C;  1E10 A;  4P7I A;  2WXL A;  3MBY A;  1HA5 A;  5D3I B;  2KTR B;  4KGR A;  5D46 A;  1D9D A;  3ISD A;  3SFD B;  5E6J A;  2RR9 A;  3MGI A;  5AKZ A;  4IM0 A;  1L7M A;  4QZG A;  3GQC A;  2HOF A;  1P3Q U;  5AKH A;  1B0X A;  2KD0 A;  4PHP A;  4PHD A;  1NKC A;  3NVW A;  3M8S A;  3OSP A;  2KN4 A;  3DV9 A;  3ISC A;  1R4M B;  1NK8 A;  4JGH B;  4G50 A;  4AJY B;  2IOF A;  2W55 A;  4ED7 A;  4IKG A;  3FC4 A;  2QKQ A;  5L9X A;  1NKE A;  3Q3M C;  4LDT B;  3G6V A;  1HEK A;  1JMS A;  3PR4 A;  3B0X A;  3MR3 A;  4IWO A;  1P7D A;  3U2S C;  2XCP A;  1LV5 A;  3PSE B;  4DHZ B;  4DSE A;  2BR0 A;  1S0V A;  4GSW A;  1WGK A;  5CHF A;  2G9H D;  4NZL B;  3MC1 A;  4LDT D;  3QU2 A;  1WX9 A;  2W8K A;  1IXR A;  3D6J A;  1CZP A;  2NPT B;  3Q3J A;  1TAQ A;  3AI5 A;  2INP E;  2JSV X;  2C2E A;  3P2B A;  5ALQ A;  3AE4 B;  1MC8 A;  2MJ3 A;  2QSD A;  1P1A A;  1WMH A;  2KQS A;  2REX A;  1UEL A;  5BOL A;  2DZM A;  1WI0 A;  4RM8 A;  1X1M A;  4FO6 A;  1GB4 A;  2RLT A;  1QOB A;  3ZW3 A;  4J6I A;  2WS3 B;  1X6J A;  2XGQ A;  4YMM A;  3JYU A;  4R3D A;  2D11 A;  4WWM A;  2QAR A;  3GS2 A;  3RNG C;  2PVO D;  2I5H A;  3EFU A;  2W9B B;  1OQR A;  4FBT A;  2E8N A;  1E90 A;  1P7E A;  3QX7 A;  3QNM A;  2XC9 A;  4A55 A;  4KGT A;  2DF4 B;  2KTR A;  5GXG B;  4B0E A;  1HTO A;  2PIA A;  4BUG A;  4WQM A;  4MHV A;  2KJR A;  3VR9 B;  4RQ5 A;  2ZNV B;  3T8M A;  8ICL A;  9ICQ A;  4HPM B;  4M2Y A;  1K1Q A;  4PJ0 U;  1BPD A;  1N48 A;  5L1L A;  2K6D B;  3SHQ A;  2FCQ A;  2WXH A;  3R9K A;  1D5Z C;  3NVV A;  2DYB A;  1K51 A;  4A90 A;  1GOZ A;  2IGD A;  1G6J A;  2DKX A;  4M9J A;  3M1Y A;  4ECZ A;  9ICA A;  3DHI C;  4RQ1 A;  3A0H U;  2C28 A;  2JY6 A;  1GC6 A;  3N1X C;  4KIK B;  1UPH A;  3E2E A;  2UWQ A;  3HUI A;  4GDK A;  3BK2 A;  1C4P A;  1SJH D;  4QZB A;  4WH4 A;  4MM3 B;  5ALJ A;  5ALM A;  5L1K A;  4IQV A;  5CHW A;  4O5C A;  2CXY A;  1S10 A;  4L23 A;  1KTK A;  9ICI A;  3GB1 A;  2NPT A;  4F1S A;  4QZC A;  4NM2 A;  3DDC B;  3HT3 A;  4M01 A;  3A33 B;  2MBQ A;  1KJT A;  3EEC A;  2Y9T A;  5IIN A;  3WKE A;  3RJG A;  2R2O A;  1KFD A;  3P42 A;  2OHF A;  4M8M A;  1C79 A;  4BBN C;  3LVV A;  1OFF A;  7ICS A;  2N1V A;  5EE1 A;  4BJQ A;  4C4V A;  1LO5 D;  2NBW B;  4FN2 A;  2BPS A;  2LJI A;  4HRS A;  3M7D A;  4O3N A;  2R8K A;  4KTQ A;  4KV2 A;  3TJP A;  5CB1 A;  5DG8 A;  1JXE A;  2RDJ A;  4IC9 A;  5CTR C;  1NK6 A;  5H8Y E;  4M6W A;  3ZRF A;  4YFK A;  3QWZ B;  2W9B A;  4Z6F A;  3RR7 A;  5CHV C;  4RT2 A;  2JPH A;  7ICJ A;  2KSO B;  2CPR A;  1MPE A;  1TKE A;  1ACC A;  4TQ1 A;  4DQS A;  4ECR A;  1ZQD A;  4F4K A;  2HHS A;  2G5I B;  1HQR D;  2JEF A;  4O5K A;  1IM4 A;  4YR2 A;  1ZDX A;  2GLE A;  1JRU A;  4MH0 E;  5ALZ A;  1U9L A;  2L0F A;  3EUB 2;  5AZG A;  2CN1 A;  4P0P B;  4UAV A;  1D6E C;  2HTH A;  4BKS D;  1X2I A;  1ZRM A;  3RJE A;  4M0W B;  1Z00 A;  3PO4 A;  5AEK B;  4KIK A;  2PFQ A;  1K53 A;  3U30 A;  2NRV A;  1FRR A;  1SXT A;  1WJN A;  5KFK A;  4GC6 A;  5LLI A;  1IV8 A;  4ANX A;  4Y2R A;  3RH5 A;  2SEB D;  2H88 B;  1YQ3 B;  2HMX A;  1AQ6 A;  2FID A;  2AGO A;  4WAA A;  2OM6 A;  4MFA A;  2JH1 A;  1DGJ A;  2DPJ A;  5EDS A;  5AKX A;  4BKT A;  3QUT A;  3AM9 A;  1L7Y A;  3LK9 A;  2RGF A;  8ICV A;  4W9I A;  1PFD A;  2DEN B;  4EFO A;  3V60 A;  4C7Z A;  2N9E B;  5AI4 A;  4RPY A;  1XC9 A;  3V6E B;  3A4R A;  2D3A A;  3WAM A;  3JVZ X;  5BPC A;  3NZ3 A;  2DZI A;  2KFK B;  1WZ3 A;  4DHZ E;  5DCN A;  3R3M A;  4B9M A;  2C22 A;  5ALE A;  3Q8C A;  4KX5 A;  5IIK A;  2W11 A;  1WM2 A;  4WJQ A;  2KSO A;  3M95 A;  3PT2 B;  3AU6 A;  2ZIV B;  2R8H A;  1KF6 B;  5L1I A;  1NKB A;  2GOW A;  3GII A;  1TKY A;  2A1J B;  2W9N A;  3C2K A;  4BKS A;  3RPF C;  4L2Y A;  4Q8F A;  2C5L C;  3AH7 A;  5KG3 A;  4UAW A;  3KOO A;  1YNT E;  4BOZ B;  4UB6 U;  4JLC A;  2YMM A;  2LRU A;  4RU9 A;  4P0P A;  2Y0S C;  5KG0 A;  4J03 A;  4Y2P A;  2J6T A;  1KTQ A;  2H3F A;  5ALD A;  2O6V A;  2W9A A;  3V72 A;  4M0W A;  4EEY A;  2IJ0 A;  4QJF B;  3V7J A;  3HPO A;  4ELU A;  3WK9 A;  2BF8 B;  1ED1 A;  1I4Q A;  2IBK A;  2DBY A;  3UF8 A;  2W3R A;  1TBE A;  1WH3 A;  3SV4 A;  4DQO C;  5D94 A;  1WWV A;  4RNO A;  2MWS B;  3KKA A;  1HTQ A;  2W9C B;  3DWM A;  2KJ5 A;  2GWS A;  2ISO A;  2DZK A;  1ARO P;  4OJO A;  3NJT A;  3KWV A;  3CF6 E;  1F9J A;  2KWV B;  1N62 A;  1S5L U;  5KT2 A;  4BGD A;  3PVX A;  4ICV A;  5B5E U;  2AGQ A;  3LJ3 A;  2NO4 A;  2MJE A;  3TEX A;  1D5M C;  5DQI A;  3M63 B;  3U52 E;  3RB4 A;  4DSL A;  2LYH A;  3T5K A;  1V5O A;  2CU1 A;  2L00 B;  4KVG B;  5KHQ A;  1QSL A;  5KFV A;  2EKI A;  2Y9U A;  4KSK C;  2PKE A;  2ZUC A;  2XCA A;  2WXP A;  2N7J A;  4O3R A;  4YTM B;  3VH4 B;  3BVG A;  1KQQ A;  4B9V A;  2L1A A;  2CHX A;  4F71 A;  3NS1 A;  1QSY A;  3DOW A;  2G06 A;  2LM4 A;  3ZUN A;  4G0N B;  4FJV B;  5AZF A;  5AKG A;  3RT3 B;  2DHZ A;  1AN8 A;  4DCC A;  2KKV A;  2HSZ A;  2ZIV A;  4IDI A;  4ZRI A;  3PSI A;  2ZW0 A;  9ICC A;  2XVT A;  4G3X B;  4KIT B;  1TK8 A;  4J9P A;  2A1J A;  3H8M A;  3WKA A;  2ESE A;  1ZQJ A;  1ZQM A;  1ZQF A;  1ZKH A;  4N58 A;  7ICO A;  3N30 A;  3ZJT A;  3RAQ A;  2L0T A;  5KNI A;  5KFW A;  1S76 D;  5ALN A;  2G5H B;  4NJ7 A;  1DOI A;  4PYU A;  1XT9 B;  1N5X A;  4PS7 A;  4C00 A;  3ETL A;  3AV8 A;  3AU2 A;  2PI4 A;  4KKI A;  4UB3 A;  3VTU A;  2BTE A;  3AEE B;  3WAN A;  1NEN B;  4EEN A;  4DSJ A;  4WUR A;  4F4X A;  3GE3 C;  2GO7 A;  2RHF A;  5J8Y A;  2L5Y A;  5KFH A;  4F3O A;  5J0X A;  4U7C A;  4R66 A;  4RGO S;  1KN5 A;  2WF9 A;  1AWD A;  3SD5 A;  2M0X A;  2W9C A;  4CYE A;  1ZET A;  2K8C B;  2AU0 A;  3H0L B;  2HHU A;  4HAI A;  3RRG A;  3I1Y A;  3RCZ A;  5J17 A;  1TAM A;  2L7R A;  5T14 A;  4EE2 A;  4YTP B;  1Z1B A;  1B22 A;  1T7P A;  4OJL A;  4BX9 C;  4KX3 A;  2BDP A;  2I1Q A;  2K25 A;  3N3K B;  4Q45 A;  2BKR B;  3ZDD A;  4Y2X A;  3TAC B;  2H3Q A;  3Q8F A;  3QCA A;  3VTW A;  1ZQT A;  1RZT A;  1O03 A;  2HDE A;  5CWR A;  1QLN A;  4CE6 A;  4QZI A;  3KUZ A;  4F92 B;  1C78 A;  1FCC C;  3CYM A;  2W43 A;  1STE A;  1YMH E;  3OG5 A;  3R7Q A;  4MJS A;  2F1I A;  8ICK A;  4O0I A;  3ENE A;  1ZQR A;  4EX7 A;  3Q8R B;  2BS2 B;  1ZQY A;  1JQ4 A;  1ZQ1 C;  4RPX A;  3UQB A;  2ZXH A;  4ELV A;  3C28 A;  2K3U A;  2YB4 A;  2B6G A;  3A1Q B;  1TKD A;  4JPS A;  1CJE A;  3IAM 1;  4W9C A;  3QAQ A;  4HKQ A;  3QU4 A;  2PFP A;  2PKO A;  2QB0 B;  1YN4 A;  4TQR A;  3PZD A;  3TBL D;  1TFR A;  4CF5 A;  3I57 A;  2D10 A;  1PYW D;  2BHN A;  1KM7 A;  1GG3 A;  2WXR A;  4AUQ C;  3NS8 A;  2CHW A;  3V6K A;  5JZE B;  2G09 A;  2PMV A;  4IR9 A;  2YB1 A;  3BZC A;  4UAY A;  1XEE A;  2HCF A;  1ZOY B;  2PW9 A;  2W7O A;  8ICH A;  1J7C A;  4DEZ A;  3BS5 B;  5JUM A;  5CP2 A;  1UH6 A;  4YR0 A;  2ZEQ A;  3H8J A;  5DQH A;  2RMM A;  3DHG C;  2AQ4 A;  1FM0 D;  2ZIU A;  2XIC A;  2P6R A;  4NLK A;  4QZD A;  4O3P A;  1XNS A;  2YY6 A;  4K7U A;  3WIM A;  2BCR A;  4YSX B;  2MRL A;  3N7R C;  4ACO A;  2LGI A;  2WFA A;  1VLB A;  4BVU C;  1PK3 A;  4UDU C;  1SXD A;  4OHJ A;  4J9R A;  2YEP F;  1Q10 A;  1WJ4 A;  8ICC A;  4I2J A;  3AE8 B;  3MC0 B;  2NYV A;  1A76 A;  4E0D A;  4IQW A;  2ASD A;  2KDB A;  5J2G A;  2WLB A;  1WGR A;  3EFC A;  5J2D A;  4UAZ A;  4ASW C;  3WK7 A;  2UYZ B;  3IHQ B;  3C5F A;  3N7S C;  1WXA A;  1JWU D;  2K22 A;  3BY4 B;  4NAM A;  4M8N A;  5KT5 A;  1L5U A;  3MR2 A;  1MQ3 A;  2LVQ A;  2PI5 A;  1DOQ A;  2ZW1 A;  1OEY A;  2BYE A;  3MHS D;  1ECW A;  3AE9 B;  4F5N A;  1OTR B;  3A1Q A;  4YXM A;  3RUL A;  3A0B U;  5T8I A;  5ALH A;  4PZN A;  2QB0 A;  2KIC A;  2EH9 A;  2JRI B;  1JX4 A;  4BAX A;  2CJN A;  2INN E;  2W7P A;  4M9N A;  4P4M A;  4NLN A;  2M0N A;  1YQ4 B;  2N1W A;  2FAZ A;  4DL5 A;  1SZP A;  2K6Q A;  5D6J B;  3BS5 A;  3AE2 B;  4OVZ A;  5L83 A;  4DWF A;  2PFO A;  1WXV A;  3APD A;  1DYQ A;  2XY6 A;  2WDR B;  5HFY A;  4ELT A;  3UIP B;  1Q3U A;  2JXT A;  2DAJ A;  2KX0 A;  1PQS A;  2JYT A;  2Y5C A;  2PJH A;  1WFY A;  3BVM A;  1NZB A;  3BQ0 A;  2JWU A;  1WE7 A;  2Z0D B;  3TEZ A;  5KFQ A;  1F2R C;  2WF8 A;  4KLL A;  1R4N B;  3W1S C;  3GP7 A;  2KOX A;  4DS5 A;  2KHV A;  3HK0 A;  1LKY B;  3MFI A;  1UD7 A;  2IGH A;  5KFX A;  3V6J A;  2HHQ A;  1C4A A;  1ET6 A;  2HVH A;  1MA7 A;  4B9L A;  3Q3O C;  3RAX A;  5EE9 A;  1L6V A;  3ZNZ B;  5MPO A;  4B6W A;  4DL2 A;  4M47 A;  2FE8 A;  4QWC A;  1L6N A;  4ED6 A;  3O13 A;  1XO1 A;  4NXZ A;  2MUT A;  5KFG A;  3PV8 A;  4WJO A;  5AKK A;  1I7H A;  3MP9 A;  2KP7 A;  2LJ5 A;  2WU5 B;  4B9S A;  2Y1I A;  1P9D U;  2RP5 A;  4FS1 A;  3TL5 A;  2WYQ A;  2WXG A;  4DQQ A;  2BYV E;  2LD9 A;  1DK2 A;  1WRI A;  4R65 A;  5H2F U;  3RBD A;  4KDI C;  5HKH A;  2JVC A;  2LZ6 A;  2F2A B;  2AJQ A;  1MG4 A;  4DHJ B;  5F3X B;  1WX7 A;  5IAA C;  5JXV A;  1PDX A;  2D3B A;  1PUZ A;  2FLP A;  3E58 A;  4FJY A;  4XWW A;  4XWT A;  4EBE A;  3DCG A;  9ICT A;  1L0Y B;  2JZP A;  3KHL A;  4DHJ D;  3ZDA A;  4XYC A;  5J0Y A;  8ICW A;  4RF1 A;  5E6O A;  1A70 A;  5ALL A;  3MGH A;  5G2N A;  2LHE A;  5DGB A;  3RNF C;  2LUM A;  1CMX B;  3TQ1 A;  3ZNI D;  1PK1 B;  1K5O A;  2SAK A;  1MG8 A;  4EBC A;  4PH5 A;  2BYT A;  3ETR A;  1S0O A;  8ICZ A;  4DXA B;  3J9C A;  5CR0 A;  1CK1 A;  1WXM A;  1Y88 A;  2ZIW A;  1L3U A;  2N7D A;  4S17 A;  4DXF A;  1LVH A;  3S6J A;  2PPH A;  3C2L A;  4DSI A;  3KH0 A;  2JUO A;  5BYR A;  2KOB A;  2N9K A;  1LKY A;  5AM1 A;  3WCQ A;  2DPI A;  1V9P A;  5KFN A;  1TS5 A;  3MJW A;  3WKB A;  1P98 A;  4J3O D;  4MGI E;  3T3F A;  2V3N A;  4DWI A;  7ICM A;  2V4I B;  1SV0 A;  1Q0W B;  3T5H A;  9ICG A;  3V61 A;  3AUO A;  3HKZ F;  2LI5 A;  3KHR A;  1SXE A;  1RG6 A;  2P35 A;  5KFY A;  1ZJM A;  4WJ3 B;  1GNU A;  3MFH A;  1J97 A;  1V38 A;  3B2G A;  3RJF A;  2DUY A;  1SE9 A;  1F0M A;  5G5G A;  4NY0 A;  4CF3 A;  4IL6 U;  2P6U A;  2DNF A;  4F2S A;  1HJP A;  1XCT L;  1FCL A;  1X9M A;  2PE6 B;  1MN8 A;  2K4E A;  4AYB F;  2IY0 B;  4QNL A;  1JXL A;  4FBU A;  1UWX A;  3PTF C;  5ALR A;  4R63 A;  4LNK A;  5DPR A;  4F8R A;  1MFW A;  4C8O A;  3I28 A;  4XDC A;  1U45 A;  2LVP A;  2FLL A;  2FMQ A;  3KZI U;  3T79 A;  4HJK A;  3NGD A;  2A4Z A;  2ZUD A;  2NCN A;  4F8C B;  1SE2 A;  2M56 B;  2G0A A;  3LVW A;  2KMA A;  2XN9 C;  1WYG A;  1TVA A;  3U8Z A;  4G11 A;  1E9M A;  4PL1 A;  2WXO A;  3NZS A;  4KN4 A;  4TQ0 A;  2BGF A;  2KJH B;  3PY8 A;  2ASL A;  1X9W A;  1ZPS A;  3C8Y A;  4MEL A;  4M9G A;  4JWN A;  1X66 A;  2JF5 A;  3LYY A;  5ALG A;  1ROE A;  2MU2 A;  3PO5 A;  1FFU A;  3RRH A;  3QXG A;  1L4D B;  3O65 B;  3SR6 A;  2IMW P;  2F1J A;  4KLT A;  4KKJ A;  3N7P D;  2R61 A;  2PMZ F;  2W03 A;  5AM0 A;  4QW8 A;  3GOE A;  1A77 A;  5HHD G;  4NJ8 A;  3I63 C;  1F0Z A;  2YMP A;  4RT3 A;  3R2T A;  3Q8A A;  4W9J A;  1A6S A;  2LRW A;  2KK0 A;  3Q8S B;  3DDH A;  4UAS A;  9ICR A;  1CEZ A;  1WX8 A;  4UAU A;  3WU2 U;  5CRX A;  3VC8 A;  3H0R B;  2I9G A;  2IYD B;  3VFK A;  3URY A;  4I2D A;  4ED0 A;  3ZNG C;  2KHW B;  4RUC A;  4PGX A;  4ANW A;  4GDL B;  2HVI A;  4RM9 A;  1J8C A;  2ASQ A;  2GBJ A;  2V9H A;  3H4D A;  7ICQ A;  1M4V A;  4MAC A;  5KAF U;  3RNC C;  7ICK A;  3TAD C;  2BCV A;  1E7V A;  2KJ6 A;  4F50 A;  4JV1 A;  1Z3E B;  3CP8 A;  2J7Q B;  3QA8 A;  4IRC A;  2OH2 A;  3OJS A;  1NK9 A;  1FXI A;  3E0F A;  3DBR I;  1LFD A;  3Q8L A;  2IY1 B;  2Z7J A;  3VHT C;  7ICR A;  4GOC A;  3VRA B;  3ZXR A;  4NLB A;  9ICV A;  3W5V B;  3JPS A;  4HDO A;  3BVZ A;  1MQ2 A;  2J0K A;  2KZR A;  2QLT A;  1WXS A;  5JH5 C;  4GIV A;  1AW7 A;  4EOY A;  2AEH A;  2Z8L A;  3MR6 A;  1N63 A;  4DLE A;  4MGY E;  1VZ8 A;  4RNN A;  4J9O A;  1QKZ A;  2GI9 A;  3AE1 B;  3S2A A;  4ZHP A;  1ENF A;  4W9L A;  2JRZ A;  4ED2 A;  4ANV A;  4TUQ A;  2V4Q A;  2BQU A;  2WXM A;  1XSP A;  4I6P A;  3VTV A;  2MEK A;  2HOI A;  1L3T A;  3HKZ C;  2LM1 A;  4I2E A;  3ICX A;  2F8K A;  1EM7 A;  2Q0Z X;  7ICH A;  1XLQ A;  3C0R B;  3RNB C;  3B1L X;  4YSZ B;  2UVV A;  4P1C C;  2ZUB A;  1YD8 U;  1PVP A;  1EO6 A;  3K9P B;  2KV2 A;  4I2H A;  1DGS A;  5KFE A;  3GIJ A;  1ZQN A;  2KKC A;  4RFB A;  1K52 A;  4KLO A;  3OGU A;  2Y3A A;  3KYD D;  2K89 A;  3AE6 B;  4LNF A;  4W9F A;  5JHB A;  1D9F A;  1E7P B;  3IT4 B;  2OJW A;  4PS8 A;  1ZOL A;  2AQ0 A;  4JIO U;  3DVN U;  4W9E A;  2ONQ A;  3NVY A;  5E6P A;  4DF4 A;  1GB1 A;  1I4P A;  4GLS C;  4IC7 B;  5DB7 A;  2D07 B;  4MF2 A;  4I29 A;  4I28 A;  2X38 A;  2NRT A;  3V7K A;  3V6C B;  4HWI B;  2MHJ A;  3UIN B;  1X40 A;  4C56 C;  7ICL A;  1QCK A;  3TI0 A;  1KRH A;  5D4B A;  4RPZ A;  3UQ2 A;  2XK5 B;  5BMI A;  5BYS A;  1JIH A;  2L05 A;  3PS6 A;  3VXW A;  2IBI B;  4FS2 A;  1UGM A;  4II2 B;  2PE9 A;  4EZK A;  2IDY A;  2K8H A;  4F5O A;  4PGY A;  4MEY A;  3H7S A;  1D8Y A;  7ICV A;  4YT0 B;  4XE0 A;  1YX6 B;  3RJH A;  4E71 A;  5J2K A;  3U26 A;  3SFE B;  3WAP A;  1WJU A;  3AEV A;  4M00 A;  3QC8 B;  1EF5 A;  3M9N B;  2EKE C;  2FCM A;  2KTQ A;  3GZN I;  5GTH U;  4OVU A;  5DQG A;  5J2R A;  3PVL A;  3APF A;  2QEJ C;  2BB6 A;  1K1S A;  3CST A;  4ZRP A;  2D5G A;  1ET9 A;  2R8G A;  3RFZ B;  4J9M A;  1N6Z A;  1WGH A;  5HP4 A;  2CRX A;  4NL9 C;  3F53 A;  4RH6 A;  3IM1 A;  1VJ5 A;  2FPM A;  4W9H A;  4LVS A;  1HE8 A;  5ALK A;  2VRR B;  2KZM A;  2KWD A;  4G9B A;  4EEL A;  3QU7 A;  5J2J A;  2OJR A;  1VR9 A;  3TUO A;  2H89 B;  4QAY A;  3TEW A;  3PZP A;  2AL6 A;  9ICM A;  1FPY A;  2W8L A;  1QQ5 A;  2WTF A;  2IA6 A;  3GIK A;  3LDA A;  2L76 A;  1QF6 A;  3K1R B;  3M9M B;  2JX5 A;  5DLG A;  3CSF A;  1KH0 A;  1RYJ A;  2YQE A;  4FZL A;  2KWU B;  1ZD2 P;  3WAO A;  9ICJ A;  3NHE B;  5BMH A;  1YJJ A;  1RWS A;  2RPQ A;  3AE7 B;  1JWB D;  1KKX A;  3IG8 A;  4HYK A;  1WYW B;  2MP2 B;  4K7S A;  2WF6 A;  4KLU A;  5G55 A;  4E3C A;  1K50 A;  5KFR A;  3VQI A;  9ICP A;  1GUA B;  2MAX A;  4EZ9 A;  4REZ A;  2XK5 A;  1GPX A;  5AI5 A;  2HHV A;  2HBL A;  2MJD A;  2WNM A;  7ICP A;  3W5U B;  4MM3 A;  3BDP A;  3G6Y A;  4RQM A;  1U48 A;  5KL1 B;  1UQV A;  3AMZ A;  4C4S A;  1NJW A;  2MQJ A;  4ZHO A;  2LEK A;  2FIF A;  2LYA A;  2XI9 A;  3DBH B;  4EUT A;  4I2B A;  3T3N A;  2UVW A;  5DPT A;  5DDM A;  1S3S G;  2AX5 A;  4HEA 1;  3SDL C;  1V1P B;  2ZXI A;  4ITK A;  2N4F A;  3HWT A;  2IHM A;  1E6E B;  4US9 A;  3B2F A;  3Q8E A;  3D2Q A;  4M9H A;  1GO3 F;  5KFA A;  1NBF C;  3NUH B;  1NYR A;  2WXJ A;  4B9K A;  1QTM A;  1H38 A;  1NI3 A;  4NLZ A;  1L7O A;  2EAO A;  1SKR A;  2B3A A;  4OCZ A;  4R8U B;  3WK6 A;  1BNO A;  1YT3 A;  2WX1 A;  4IS7 A;  1YIW A;  4Y2U A;  1QOG A;  5KFO A;  3IBE A;  1UHU A;  4FUL A;  1J2N A;  3RYT A;  4RQ6 A;  4QWB A;  1V9J A;  3TAQ A;  4J9S A;  2YX8 A;  1XQQ A;  3JSV B;  3MAB A;  2N7E A;  2K4H A;  1NJZ A;  1T3Q A;  4G3I A;  5EOZ A;  2KAC A;  3VUX A;  1S0N A;  4GLX A;  2N9X A;  2Q4T A;  5FR3 A;  1F44 A;  2ZPY A;  2Y1J A;  4DQP A;  4RQN A;  2K8A A;  2DKZ A;  2HTM E;  4DXG A;  1NVI D;  3H1U A;  1V5T A;  2RDH A;  3NZU A;  2LMC A;  8ICU A;  1H4R A;  7ICF A;  4CO7 A;  2R8J A;  2INC C;  3SU8 X;  2MP2 A;  2Y5B B;  1D4B A;  1HZ6 A;  2G4D B;  4RGM A;  2ZJD A;  3ZD9 A;  2BDU A;  2YN4 A;  4A3O A;  2EDU A;  4C0Z A;  1VDV A;  3P63 A;  4UAT A;  4N59 A;  4QWA A;  2CU3 A;  4XDD A;  2D2Q A;  9ICL A;  4KLG A;  2JGA A;  1C20 A;  2H3I A;  3RB3 A;  4YTN B;  1EUV B;  2IGG A;  2BKE A;  2C7M B;  5KFJ A;  1YX5 B;  4JMU A;  5KFS A;  1V1P A;  3AEC B;  3R66 C;  5D7G A;  3R7R A;  3MDA A;  2OXO A;  5LNK 1;  1D8L A;  2L83 A;  4GXJ A;  5HHI A;  4DO9 A;  1SWV A;  4LNI A;  4BFR A;  3Q14 C;  1ZQW A;  3UMG A;  4RQ3 A;  3ZNH B;  2BW2 A;  1T8E A;  4R8U A;  1KFT A;  2KFK A;  3I76 A;  1KLU D;  4XC2 A;  1TZ1 A;  2GBK A;  3L08 A;  4JK1 A;  3SEI A;  1ZQG A;  1NDD A;  4HXD A;  2ZVO A;  4RQ0 A;  3ZRC A;  2HBM A;  5BO4 B;  4EZL A;  3R8B A;  2K4P A;  4IQU A;  2G1E A;  3QX1 A;  1P7F A;  1ZD3 A;  3A4S C;  3JSV A;  1NZP A;  5III A;  1ZQI A;  4AP4 C;  1T3N A;  1D3Z A;  3PPA A;  3Q8P B;  3TEY A;  4K1R B;  4UQG A;  2A1A A;  2AGP A;  4JL9 A;  4P4O A;  5AIC A;  1RXW A;  5J0U A;  2KKP A;  3IN5 A;  1XWL A;  3B08 A;  3ONS A;  3ZJV A;  1BPX A;  2KFZ A;  3ZI4 A;  4OVV A;  1TYG B;  4U6P A;  2M19 A;  1N5W A;  8ICG A;  3DBL I;  5BMG A;  2QCZ A;  3N4M B;  4C8L A;  2FE9 A;  2GLS A;  3IFW B;  5KFM A;  2KAJ A;  3UMB A;  1X9S A;  1L8L A;  4HKZ E;  1VRA B;  2IO3 B;  4DL6 A;  4OJP A;  1R7S A;  3MR5 A;  1ZQS A;  2OCE A;  1IUE A;  3BII D;  4K81 A;  4RQ2 A;  3ZDE A;  5C5J A;  2QIE B;  1SSN A;  4ZRJ A;  4ARC A;  1CQV A;  1RYS A;  2AQ3 B;  2X8X X;  2H5X A;  5L1J A;  4F4W A;  1S97 A;  1XXG A;  4ZDV A;  3RFA A;  2GB1 A;  3QU9 A;  4BWJ A;  2FUH B;  5KFD A;  2IOH A;  5IIO A;  5KL8 B;  5EWE A;  2RQ5 A;  3N20 C;  4HCP B;  2Z59 B;  4IM3 A;  2KMC A;  2WXI A;  1FEZ A;  2VH2 A;  1NK5 A;  1Y56 A;  1B1Z A;  4N6E B;  2I2Y A;  3ZLZ A;  4WWP A;  3OJU A;  1TV9 A;  3MTN B;  1SL2 A;  2KNJ A;  2FMP A;  2BBC A;  2MBE A;  3T9L A;  1E0Z A;  3K1Z A;  2ALZ A;  1PGB A;  2NMQ A;  1VJK A;  3RJI A;  4HPL B;  1UWM A;  3ABV B;  8ICQ A;  2RSU A;  2TSS A;  3VRB B;  4Y2V A;  7ICG A;  1EXN A;  3C19 A;  3SAH A;  3L13 A;  1Z4O A;  4PPX A;  3CMM B;  1FRD A;  2L32 A;  1Q5W B;  2W82 A;  2KDM A;  3KYC D;  2HE7 A;  2PFN A;  2WWZ A;  3RJJ A;  2GOL A;  1C1Y B;  5L95 C;  4YWG G;  3ZTD A;  3Q3N C;  1BNP A;  1DOY A;  3M62 B;  4WWN A;  3APC A;  1TS3 A;  1V6E A;  8ICJ A;  4HJG E;  4EZ6 A;  8ICY A;  4LLG M;  2KE7 A;  2K0P A;  3IT6 B;  2BZF A;  4UB5 A;  5DG7 A;  2LGY A;  5C0Y A;  3QHT A;  4P16 A;  3KQ4 A;  1ZRN A;  3KTQ A;  4NLC A;  3HP6 A;  1I35 A;  1BPZ A;  5DBA A;  5AM5 A;  5ALW A;  4P2H A;  2QHO A;  3BQ7 A;  3QJZ A;  4FBJ B;  4W9K A;  3BIN A;  5AKE A;  5KTQ A;  4Y2Y A;  3HIL A;  2GBR A;  1WGG A;  2K8C A;  2N0S B;  5A0L A;  2FPL A;  1HUZ A;  3ML9 A;  4DFD A;  2C2R A;  4UBB A;  1LB2 B;  1EF1 A;  1T0Q C;  1KLG D;  3NRZ A;  1E8W A;  1D8B A;  3P4S B;  1WJ6 A;  4GXK A;  3OTQ A;  4KMO B;  2JQR B;  4GXB A;  1T94 A;  2DWQ A;  3ED5 A;  1F52 A;  3HM3 A;  4CNQ A;  3N1Z C;  5KAI U;  4C8M A;  5IOI A;  2ZVN A;  4A3P A;  3GIM A;  1SIF A;  2H3Z A;  1ZE3 D;  2XY7 A;  3MFG A;  4KLJ A;  2B21 A;  2LGX A;  4ECY A;  9ICH A;  4F5Q A;  4D2K A;  4KMU A;  2V4L A;  4IWQ A;  5J2E A;  1KOT A;  4P0Q B;  3FIL B;  2E8P A;  8ICO A;  4CRX A;  1L0X B;  5KHO A;  3KLS X;  3GIL A;  2D3G A;  2KAN A;  5AM3 A;  3L4P A;  5F9N A;  4NQL B;  1Y8R C;  3Q8Q B;  4IW0 A;  2MBB B;  3F5A A;  5CEH A;  4O3M A;  3OPX A;  3C2M A;  5D2M B;  3PLU A;  1WCL A;  2LI6 A;  3R2I A;  2BPF A;  5J2C A;  2XO7 A;  1KRP A;  4ECS A;  4KLD A;  4EEW A;  3D2S A;  3Q2A C;  3ZXV A;  4ZOH C;  5KFF A;  3AU4 A;  5AKL A;  2VJ5 A;  3THV A;  3ECI A;  4A9A A;  2B76 B;  3PW0 A;  3ZJU A;  4PT5 A;  3EC8 A;  3D2N A;  2UVR A;  4IRK A;  3H0M B;  4I6N B;  4Q44 A;  1QT9 A;  5IIL A;  4TMA B;  5CA7 A;  3SAG A;  2AWT A;  3IP4 B;  3M9O B;  2YMQ A;  3JPT A;  1TJE A;  4Z6C A;  4ARI A;  4NJC A;  2P66 A;  2ZNV C;  3AEF B;  5AUK A;  4BZA A;  3ALB A;  2ICI A;  2I1J A;  2NTS A;  2R2Q A;  2DGZ A;  4EYI B;  1J0G A;  4DL7 A;  5FKA C;  3T3O A;  2F1H A;  5KFL A;  1V49 A;  1ZYQ A;  4MEM A;  3CWI A;  4AJW A;  2O2V B;  2OED A;  3OAW A;  1X6I A;  4QZH A;  5JTI A;  3RD2 A;  3PSP A;  5J2B A;  4MF8 A;  2N9L A;  2MSE D;  3EWA A;  4B9N A;  3KFU F;  2KQ4 X;  3V62 A;  1R4M I;  1WUD A;  3X23 A;  5C1Z A;  4P6V F;  4F4Y A;  2JV3 A;  2DL0 A;  5BOM A;  1SGG A;  2M4N A;  3P4Q B;  4IM2 A;  4J9Q A;  4ZYN A;  2FPK A;  2HW3 A;  3VUW A;  3W9C B;  2HOQ A;  3ONN A;  3JW0 X;  5J2H A;  4YSY B;  2ZTE A;  1ZP0 B;  3H7I A;  3N1Y C;  5KFZ A;  3H8H A;  3PW2 A;  2NS5 A;  3D32 A;  3UPQ A;  2KX3 A;  2PLP A;  3T5L A;  3I9V 1;  1BPY A;  4JB3 A;  4DQR A;  2KJ8 A;  3EHV A;  3JPO A;  3ISB A;  2A19 A;  3M3J A;  4HLE A;  1A5R A;  1B43 A;  4B95 A;  3CRX A;  4GIB A;  2E3T A;  4DS4 A;  3OWE B;  1VZ7 A;  2E5S A;  2Z0E B;  2VIX A;  1GJZ A;  1KLV A;  4DLG A;  4DSK A;  5KG7 A;  3MC8 A;  2MX2 A;  2F76 X;  1EU4 A;  4Z6D A;  4O9M A;  5AUI A;  5HNK A;  4HCN B;  1B4F A;  1UF0 A;  2WDQ B;  2E8M A;  4QIW F;  5KFI A;  4M9L A;  3M6Z A;  1ESF A;  5TIS U;  2M8S A;  5KT7 A;  3AE5 B;  5DDY A;  5JU5 A;  2G08 A;  1PGA A;  2BCU A;  4OJ6 A;  1N60 A;  1I4X A;  1YZ6 A;  1H8C A;  5J0R A;  2KFN A;  4DBG A;  4M0A A;  4RQ8 A;  4KLQ A;  2R18 A;  3QUC A;  4X5V A;  5D3D A;  2KYW A;  4JX1 C;  5C23 A;  2WP9 B;  4I6L B;  1HZ5 A;  4MSQ B;  4NJ6 A;  4I27 A;  7ICN A;  2AXT U;  5AIA A;  1LM8 B;  1TGZ B;  3FAH A;  1YN5 A;  3FM9 A;  2G3Q B;  2QJL A;  1TTN A;  3H9D A;  1SKS A;  1UA0 A;  4WQO B;  4DFP A;  1OQQ A;  4RZR A;  4MGZ E;  4KLE A;  1XD3 B;  4H2A A;  1BPE A;  1YZ7 A;  4MSM B;  3L54 A;  1L4Z B;  1RAX A;  2IOF K;  1JWA D;  2BPG A;  3H7P B;  3KKA C;  2BCS A;  4C4T A;  1X42 A;  2BCQ A;  3PW5 A;  9ICE A;  2HDO A;  2RDI A;  3GFK B;  2XY5 A;  2EZX A;  5IP4 D;  4B0M A;  3PR5 B;  3P1M A;  2FLN A;  1ZGU B;  1I4R A;  4OD0 A;  3N9Y C;  5EE0 A;  1BML C;  4II3 B;  1E7U A;  1T0R C;  1DOX A;  5E79 U;  3JPN A;  3BK1 A;  3Q8B A;  3SEN A;  4NM1 A;  1TY2 A;  4A8X C;  5HMM A;  5J0W A;  5J2A A;  3Q69 A;  1GC7 A;  1WGY A;  2ZTC A;  5CJ7 A;  2RRD A;  8ICX A;  4TUR A;  4IR1 A;  5KG1 A;  1D5X C;  4B9U A;  2I6X A;  4MEX A;  1V2Y A;  1FIQ A;  1WGD A;  2RDG A;  4JWS C;  4DK5 A;  5FR6 A;  1FXA A;  4WJN A;  1RYU A;  2N9P C;  2QB1 A;  4NV0 A;  2KDE B;  1PK1 A;  2WHI A;  4ECU A;  2W9M A;  1O08 A;  1HIW A;  3ZQ4 A;  2WGS A;  1KBU A;  1WF9 A;  1UCV A;  4FAD A;  1IBX B;  3SYZ A;  2QDF A;  3IVF A;  3B0Y A;  4KLF A;  4OW0 A;  5GTI U;  1XLP A;  3RZW C;  1LGR A;  5FK9 C;  2B0C A;  4EX6 A;  3B0A A;  4IUM B;  9ICS A;  3J81 j;  1ZQC A;  1YJI A;  4MGK E;  1XU4 A;  3TKA A;  1Q1O A;  3DBS A;  4LJX A;  3B9J A;  2E8O A;  5DBB A;  1NK0 A;  1HXY D;  5AZH A;  5J0Q A;  3SI8 A;  1WR6 E;  2ZJ5 A;  5J8Y C;  3ZGZ A;  3IXS A;  4Y2J A;  1ZQV A;  1YN3 A;  2HD5 B;  3H7P A;  1UUP A;  1F77 A;  3NTU A;  2NRX A;  3OJ4 B;  3PO0 A;  3I3T B;  3ORY A;  3L3F X;  2OOB B;  1RLF A;  2NVU I;  2NBU A;  3LWL A;  1KLN A;  2KT7 A;  4ECT A;  4EEK A;  2JEI A;  1ZW7 A;  3H4B A;  4QIW C;  4EKU A;  2VJ4 A;  2J0J A;  3HM6 X;  4PYZ A;  3EW9 A;  3DQV A;  7ICU A;  3TAR A;  1N56 A;  3BQ2 A;  7ICI A;  5AI8 A;  1U4A A;  1P0R A;  2BB5 A;  4BBN F;  2ZCC A;  4Y2T A;  2J0M A;  2ISP A;  4HDQ A;  3PNC A;  4DFK A;  1IGC A;  1UNS A;  2GMI C;  2WU2 B;  3WAL A;  4HPP A;  4K3B A;  3AQE A;  1ZQH A;  4DFJ A;  2BYF A;  3A9K B;  4DL4 A;  2W54 A;  2L8J A;  3HVZ A;  1I4H A;  2JZZ A;  3RMK C;  4XQ8 A;  3GDX A;  4YD2 A;  2EAN A;  4JWU C;  1QSS A;  4CCH A;  3L17 A;  3OLM D;  3RZF A;  2KN7 A;  4ACF A;  1JRO A;  2FDR A;  1IBX A;  2NV3 A;  4K3C A;  3UXO A;  2EMT A;  1QIL A;  2EZZ A;  2L52 A;  2RPV A;  5DLF A;  4YMO A;  4GDK B;  2K9X A;  1E5W A;  3L16 A;  3UM9 A;  1S0M A;  1GAQ B;  2IPK D;  3PW7 A;  2QMT A;  3GZF A;  4TV3 A;  1EWC A;  5BYQ A;  5JHA A;  3I5J C;  4FJZ A;  5KG6 A;  1V80 A;  2DYO A;  3ZKJ C;  1CRX A;  2YLM A;  3IHP C;  4GB9 A;  4XZ4 A;  2V3S A;  5F9L A;  2C2D A;  4YN4 A;  5AHX A;  3EYZ A;  2R8I A;  4DOB A;  5LXI B;  8ICT A;  2IHN A;  4NLG A;  1WE6 A;  1XLO A;  4AYB C;  1C9F A;  2F3N A;  3H8S A;  3OSN A;  1SL0 A;  3ML8 A;  3UIO B;  1ZQX A;  1COK A;  4OZC A;  4C4V B;  1JWS D;  2WXN A;  4GDL A;  2KXJ A;  2M17 A;  4QWE A;  1BT0 A;  2ATL A;  2WXF A;  3AB5 A;  3PHW B;  5KFB A;  1VCB A;  3RB6 A;  2GH1 A;  4J9K A;  2BWF A;  5E6N A;  2DX5 B;  1Z2M A;  1XS9 D;  2ZJ8 A;  4M6W B;  2LGS A;  2LWP A;  2FNJ B;  3ZYY X;  1NNL A;  4DOA A;  4MDK E;  2MBH A;  2LYB A;  5DB8 A;  1X9X A;  2FCS A;  3PRP B;  4NQK E;  5ALT A;  1SKW A;  2ASJ A;  3P4P B;  1FO4 A;  5ALP A;  5DB9 A;  2IO2 B;  4HRO A;  1PVR A;  3GV8 B;  3A9K A;  5J18 A;  2V0G A;  3PZ8 A;  2KNB A;  4N9F 4;  4NNJ B;  4FXC A;  4KZ0 A;  3LWM A;  4L1B A;  4FA6 A;  4RNM A;  2KVR A;  5HML A;  2JHD A;  3RNA C;  4F5P A;  1PUT A;  2NR2 A;  1EU3 A;  5TZV A;  2I1K A;  5KT6 A;  3LB8 C;  3IG5 A;  3TIX A;  1Z00 B;  2PMZ C;  3NOB A;  3CW2 C;  5AK4 A;  3AQF A;  2XGP A;  3E9S A;  4FHK A;  1BPB A;  5DBC A;  1Q3V A;  9ICO A;  4CHK A;  3IRU A;  4GU2 A;  4RNA A;  5DG9 A;  5HHH A;  2BQ3 A;  3V05 A;  2A5U A;  2OEH A;  2Y0S F;  3BYT B;  4WJP A;  5D49 A;  3MGV A;  1RDF A;  3DEE A;  2J53 A;  2GBM A;  1QQ7 A;  5DKW A;  2FI1 A;  3QQ8 B;  2KVZ A;  4I2G A;  5GMV A;  3QIJ A;  3W2D A;  3UGB B;  4ED8 A;  2PVG C;  1SL1 A;  4PHE A;  2WF7 A;  3NY5 A; 
#chains in the Genus database with same CATH homology
 1V97 A;  3AE2 B;  3P4R B;  4OVZ A;  3ZJV A;  3KWL A;  1DYQ A;  5HFY A;  2WDR B;  1QOA A;  1IGD A;  1TYG B;  2JXT A;  1WSP A;  2M19 A;  1N5W A;  2JYT A;  1ZDV A;  2ACZ B;  2Y5C A;  5BMG A;  2J42 A;  2NTT A;  2QIL A;  3BVM A;  5I4D A;  2KAJ A;  4MT5 A;  2JWU A;  5G5H A;  1BUI C;  3EGR A;  4HKZ E;  3TEZ A;  4C7Y A;  1SE4 A;  1F2R C;  1KFY B;  1VRA B;  1R7S A;  4C80 A;  1L0V B;  3GP7 A;  3AEB B;  1IUE A;  3BII D;  2YEP B;  2QIE B;  1SSN A;  2IGH A;  3AED B;  1C4A A;  1ET6 A;  1CQV A;  3TSS A;  2AQ3 B;  4B0E A;  4ARC A;  1L6V A;  4KGS A;  5EE9 A;  5MPO A;  1MVK A;  1SEB D;  2WXQ A;  2J52 A;  1XXG A;  2FE8 A;  3O13 A;  5C2T B;  1E10 A;  2GB1 A;  2WXL A;  2BT6 A;  1HA5 A;  1NEK B;  5D3I B;  1I7H A;  4KGR A;  3MP9 A;  3W1S A;  2WU5 B;  2PTL A;  3SFD B;  5E6J A;  2WXI A;  1QOF A;  3UI3 A;  1Y56 A;  1B1Z A;  4N6E B;  2I2Y A;  3NVW A;  2WXG A;  2KN4 A;  2FUG 1;  2BBC A;  1WRI A;  1E0Z A;  1PGB A;  2NMQ A;  1VJK A;  4IKG A;  2W55 A;  1UWM A;  3ABV B;  3FC4 A;  2TSS A;  3VRB B;  5JXV A;  1PDX A;  1FNV A;  1QQR A;  3MJ5 A;  4XWW A;  1T6B X;  4XWT A;  1FRD A;  2L32 A;  2W82 A;  3U2S C;  1L0Y B;  2JZP A;  2KDM A;  3BYY B;  1XF5 L;  5HG2 A;  1WGK A;  2G9H D;  4NZL B;  4RF1 A;  1A70 A;  4YWG G;  1DOY A;  1CZP A;  2LHE A;  1FFV A;  2INP E;  1TS3 A;  2JSV X;  2LUM A;  1ZXH A;  4HJG E;  3SEB A;  4LLG M;  2K0P A;  3AE4 B;  4OZB A;  2SAK A;  3IT6 B;  2BYT A;  2MJ3 A;  2QSD A;  1TS4 A;  4P16 A;  3ETR A;  3KQ4 A;  4NAW B;  3J9C A;  1CK1 A;  1GB4 A;  4DXF A;  1QOB A;  3PZ7 A;  2Y5P A;  2WS3 B;  4WIP A;  5BYR A;  4R3D A;  2N9K A;  4WWM A;  3GS2 A;  2N0S B;  2PVO D;  3WCQ A;  2VZK B;  1WWT A;  1TS5 A;  4US8 A;  1OQR A;  4RGN A;  4J3O D;  1KLG D;  1P7E A;  3NRZ A;  3P4S B;  2W3S A;  2V3N A;  2JQR B;  4A55 A;  4KGT A;  2DWQ A;  2V4I B;  5GXG B;  2PIA A;  2VZK D;  4WQM A;  3VR9 B;  2DYM A;  1EWY C;  1V1O A;  1ZE3 D;  2AQ1 B;  3MFG A;  3B2G A;  2WXH A;  1D5Z C;  3NVV A;  1UGJ A;  1K51 A;  5G5G A;  4A90 A;  1GOZ A;  2IGD A;  1V8C A;  3E56 A;  4WAF A;  4D2K A;  1FCL A;  1XCT L;  2KMM A;  3FIL B;  1L0X B;  3NVZ A;  1L5P A;  3KLS X;  4CQN A;  3HUI A;  3BK2 A;  1C4P A;  3AE3 B;  3L4P A;  1XO3 A;  1VZ6 A;  2AQ2 B;  1SJH D;  1TS2 A;  2JU6 X;  4WH4 A;  4MM3 B;  1UWX A;  3R2I A;  4L23 A;  1KTK A;  3GB1 A;  3V3X A;  4XDC A;  4YXD B;  4ZOH C;  5EE3 A;  4RF0 A;  4A9A A;  2B76 B;  3ZJU A;  4PT5 A;  1SE2 A;  3P42 A;  2OHF A;  2M56 B;  1C79 A;  2XN9 C;  1OFF A;  1WYG A;  4TMA B;  1QT9 A;  5EE1 A;  1E9M A;  1LO5 D;  2BS3 B;  2WXO A;  1SE3 A;  1JRP A;  2LJI A;  2JYE A;  1TJE A;  4HRS A;  4TQ0 A;  4ARI A;  4NJC A;  3AEF B;  5AUK A;  1ZPS A;  3C8Y A;  5H8Y E;  2ICI A;  2NTS A;  2XNA C;  5FKA C;  3LYY A;  1ROE A;  4IOI E;  1FFU A;  3T3O A;  3AN1 A;  1TKG A;  1L4D B;  3CWI A;  2OED A;  3SR6 A;  1TKE A;  1MPE A;  4KKJ A;  1ACC A;  1J7B A;  2R61 A;  4TQ1 A;  5HHD G;  1FD6 A;  1I4G A;  1C4C A;  1HQR D;  1F0Z A;  2N9L A;  3R2T A;  2KQ4 X;  3Q8A A;  1ZDX A;  4P6V F;  3EUB 2;  3P4Q B;  4ZRQ A;  3URY A;  2WXK A;  3W9C B;  1D6E C;  4LTU A;  4GDL B;  1NYQ A;  1TY0 A;  1SF0 A;  4YSY B;  1ZP0 B;  3H8H A;  1XLN A;  1K53 A;  1M4V A;  2PLP A;  3I9V 1;  4MAC A;  3IAS 1;  1FRR A;  1SXT A;  2SEB D;  2H88 B;  1YQ3 B;  3OWE B;  2E3T A;  1FXI A;  1VZ7 A;  2ON8 A;  1DGJ A;  3VRA B;  1EU4 A;  3W5V B;  3BVZ A;  5AUI A;  3AM9 A;  4AS1 A;  1MHH E;  2M0A A;  1AW7 A;  1MHX A;  2WDQ B;  1ESF A;  1PFD A;  2Z8L A;  4C7Z A;  1N63 A;  1VZ8 A;  1FEH A;  1QKZ A;  1PGA A;  2GI9 A;  3AE5 B;  3AE1 B;  3LXF A;  1JML A;  4ZHP A;  2MH7 A;  1ENF A;  1N60 A;  1I4X A;  3NZ3 A;  2WXM A;  4TSS A;  2MEK A;  2Q5W D;  4MH8 A;  1EM7 A;  1T5X D;  1XLQ A;  5D3D A;  4JX1 C;  2WP9 B;  3Q8C A;  1JW9 D;  4YSZ B;  1HZ5 A;  5H92 C;  1YN5 A;  2QJL A;  3FAH A;  1KF6 B;  1WXQ A;  1OQQ A;  3DWG C;  4RFB A;  1K52 A;  1TKY A;  2Y3A A;  1HEZ E;  3AE6 B;  4H2A A;  3RPF C;  1E7P B;  1RM6 C;  3AH7 A;  3IT4 B;  1YNT E;  4L2Y A;  1L4Z B;  2ONQ A;  3NVY A;  5C3J B;  1JWA D;  4ZYS A;  1GB1 A;  1I4P A;  3AEG B;  4GLS C;  2X38 A;  2K5P A;  4M0W A;  1ZXI A;  2GRI A;  2IJ0 A;  4B0M A;  1I4Q A;  3P1M A;  2DBY A;  2WQY B;  2W3R A;  3N9Y C;  1I4R A;  1BML C;  5EE0 A;  4DQO C;  1DOX A;  4C56 C;  3BK1 A;  1KRH A;  2WDV B;  3Q8B A;  3DWM A;  3U4E G;  1TY2 A;  1FNU A;  4A8X C;  5BMI A;  3KWV A;  5BYS A;  3Q69 A;  1D5X C;  1N62 A;  2IDY A;  1FIQ A;  3HRD D;  1PGX A;  2RDG A;  4JWS C;  4YT0 B;  2MJE A;  4XE0 A;  1FXA A;  3TEX A;  1D5M C;  3SFE B;  3U52 E;  4OZA A;  5TSS A;  2EKI A;  2V3P A;  2WXP A;  2N7J A;  3MHZ A;  4YTM B;  2QEJ C;  2J4X A;  2BB6 A;  4ZRP A;  3BVG A;  3ZQ4 A;  2D5G A;  1ET9 A;  2L1A A;  3RFZ B;  2DLB A;  3NS1 A;  3VR8 B;  1AYF A;  4RH6 A;  1IBX B;  1FNW A;  4OW0 A;  1XLP A;  2LFI A;  1AN8 A;  5FK9 C;  2KWD A;  1QLB B;  4IDI A;  1YJI A;  1JCK B;  2BS4 B;  1VR9 A;  2ZW0 A;  3TUO A;  2H89 B;  3TEW A;  3B9J A;  1HXY D;  4N58 A;  1QF6 A;  1RFK A;  3ZGZ A;  3IXS A;  3ZJT A;  2JX5 A;  4JE3 B;  1YN3 A;  1UUP A;  1F77 A;  1DOI A;  1KH0 A;  1RYJ A;  1N5X A;  3PO0 A;  5BMH A;  1YJJ A;  3AV8 A;  4KKI A;  1RWS A;  3AE7 B;  2BTE A;  1JWB D;  3AEE B;  1NEN B;  4WUR A;  1SBB B;  3AEA B;  1L6U A;  1C77 A;  4LK0 M;  3BWU D;  1K50 A;  1BXT A;  3FIL A;  4KX6 B;  1AWD A;  4RGO S;  3VQI A;  4REZ A;  1GPX A;  2MJD A;  2WNM A;  3W5U B;  2BB5 A;  1SJE D;  5HI1 A;  4EE2 A;  1JAL A;  4YTP B;  3AMZ A;  1IGC A;  1UNS A;  2WU2 B;  4ZHO A;  2LEK A;  1J7A A;  3Q8F A;  3T3N A;  2AX5 A;  4HEA 1;  2W54 A;  3HVZ A;  1V1P B;  2HDE A;  2CJO A;  4ITK A;  1C78 A;  1FCC C;  1I4H A;  1E6E B;  4US9 A;  3B2F A;  3Q8E A;  1YMH E;  1STE A;  1SB3 C;  1C76 A;  4JWU C;  3NUH B;  1NYR A;  2WXJ A;  1JRO A;  2BS2 B;  1NI3 A;  1IBX A;  1JQ4 A;  3BZD B;  2K3U A;  1QIL A;  2RPV A;  2L52 A;  2EEL A;  4GDK B;  3U7Z A;  4JPS A;  1CJE A;  2K9X A;  3IAM 1;  1QOG A;  1GAQ B;  2IPK D;  2PKO A;  4HKQ A;  2QMT A;  1YN4 A;  1EWC A;  5BYQ A;  3I57 A;  1PYW D;  2WXR A;  2DYO A;  4RGT A;  2PMV A;  1T3Q A;  2I38 A;  2KAC A;  1XEE A;  1ZOY B;  2PW9 A;  1J7C A;  5FR3 A;  1XLO A;  1C9F A;  3EA6 A;  2HTM E;  4DXG A;  1NVI D;  2RMM A;  1FM0 D;  2RDH A;  2LMC A;  2E6X A;  4OZC A;  1JWS D;  1B9R A;  2WXN A;  4Q2J A;  1D4B A;  1HZ6 A;  3AB5 A;  4RGM A;  4YSX B;  2WXF A;  1FMA D;  2LGI A;  1VLB A;  1VDV A;  1F2R I;  3ZYY X;  3P63 A;  4UDU C;  4N59 A;  2CU3 A;  4OHJ A;  4XDD A;  2YEP F;  3P4P B;  1FO4 A;  1Q10 A;  1XCQ L;  4YTN B;  3HVD A;  3AE8 B;  4HRO A;  3MC0 B;  4O1N A;  1ZUD 2;  2V0G A;  2IGG A;  3PZ8 A;  3CIR B;  4A6Q A;  2WLB A;  1V1P A;  3AEC B;  5D7G A;  4FXC A;  5LNK 1;  4L1B A;  2L83 A;  1JWU D;  2K22 A;  4NAM A;  1PUT A;  1SIJ A;  1EU3 A;  1JWM D;  3LB8 C;  2ZW1 A;  2BW2 A;  3E9S A;  3AE9 B;  2LHD A;  1KLU D;  4RNA A;  5T8I A;  4USA A;  3V05 A;  4AQ7 A;  3BYT B;  4RCO A;  3R8B A;  1TZO A;  2J53 A;  2G1E A;  2CJN A;  1P7F A;  2INN E;  1N61 A;  3W2D A;  2FBW B;  2PVG C;  3TEY A;  1MI0 A;  1YQ4 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...