3NVVA

Crystal structure of bovine xanthine oxidase in complex with arsenite
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
164
structure length
164
Chain Sequence
TADELVFFVNGKKVVEKNADPETTLLAYLRRKLGLRGTKLGCGEGGCGACTVMLSKYDRLQDKIIHFSANACLAPICTLHHVAVTTVEGIGSTKTRLHPVQERIAKSHGSQCGFCTPGIVMSMYTLLRNQPEPTVEEIEDAFQGNLCRCTGYRPILQGFRTFAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Xanthine dehydrogenase/oxidase
publication title X-ray Crystal Structure of Arsenite-Inhibited Xanthine Oxidase: Mu-Sulfido,Mu-Oxo Double Bridge between Molybdenum and Arsenic in the Active Site.
pubmed doi rcsb
total genus 42
structure length 164
sequence length 164
chains with identical sequence J
ec nomenclature ec 1.17.1.4: Xanthine dehydrogenase.
pdb deposition date 2010-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 3nvvA02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3nvvA01
3NVWA 4IDIA 1FM0D 3FAHA 1JWAD 3AE9B 2HTME 1OQQA 1E7PB 1YJIA 3ABVB 3P4SB 1DOIA 1L6VA 1WWTA 1JWBD 3P4RB 5AUIA 1QF6A 1SIJA 2WP9B 2WDVB 4JWUC 1N5XA 3L4PA 3AEAB 2AX5A 3AE5B 3VR9B 1YQ4B 1L0VB 2L52A 1KRHA 4FXCA 4P6VF 2WS3B 1J7CA 4N58A 4JWSC 3ZYYX 1V8CA 2PIAA 2W55A 3AE2B 1T3QA 2K5PA 1YJJA 3FC4A 1RFKA 2CJOA 4JX1C 2DBYA 4ZOHC 4YTPB 1RYJA 3SFDB 2QJLA 3LB8C 1E10A 4N6EB 5EE3A 1OFFA 5GXGB 4A9AA 2BT6A 1SB3C 2WU2B 1B9RA 5MPOA 2WQYB 1CZPA 1E6EB 1IUEA 1N60A 1L6UA 1ZP0B 2PKOA 1GAQB 2W3SA 1QOFA 2CJNA 2JQRB 1FFUA 2KAJA 3CIRB 3CWIA 3W5UB 1JALA 3P63A 2QIEB 1L5PA 1J7BA 3DWGC 4KX6B 3VR8B 1GPXA 2K22A 1VJKA 5G5HA 3W9CB 2BS3B 3P1MA 1RM6C 4YSXB 2B76B 4N59A 5C2TB 1XLPA 3AEEB 3EUB2 4YT0B 1FRRA 3AM9A 2MJEA 2OHFA 1J7AA 1N5WA 1TKGA 3LXFA 4ITKA 1XLQA 2BS2B 2MJDA 2PVGC 1N63A 1WRIA 3B9JA 2M19A 1FRDA 1WYGA 3NRZA 5EE1A 1V97A 4US9A 3AEFB 1NVID 1PUTA 3SR6A 2FBWB 3ETRA 3AH7A 2W3RA 3HRDD 1NYRA 1JW9D 1TJEA 1TYGB 3AE8B 3AV8A 5H92C 1DOXA 1JQ4A 1VDVA 1QLBB 1XO3A 5G5GA 4US8A 1NI3A 2EKIA 2PVOD 3AEGB 2KMMA 5EE0A 1NYQA 3HVZA 4USAA 1TKEA 2MJ3A 2M56B 3BIID 3DWMA 1FFVA 1QOAA 1TKYA 3P4QB 3NVYA 1E9MA 1ZUD2 2G1EA 2WDQB 3B2GA 4YSZB 1CJEA 2DWQA 2W54A 3AE7B 3NS1A 4HRSA 1FXIA 1FO4A 1NENB 3AMZA 1JROA 2BS4B 3P4PB 3SFEB 1VLBA 1AYFA 1KFYB 1QOBA 3HUIA 1FXAA 3AB5A 3KWLA 1OQRA 1E0ZA 2WU5B 2Q5WD 2LEKA 2H88B 4C80A 3PO0A 5H8YE 1WGKA 2CU3A 2WDRB 1DGJA 3AEDB 1QOGA 2JX5A 1AWDA 4LTUA 3VRBB 4ZHOA 1F0ZA 1PDXA 1EWYC 1YQ3B 1KF6B 3WCQA 3AE6B 1R7SA 1DOYA 3AN1A 1RWSA 5AUKA 2ACZB 1ROEA 4YTNB 4YXDB 3RPFC 2Y5CA 4C7ZA 3NVZA 1XLOA 2H89B 1FMAD 1ZOYB 1FIQA 1N61A 1I7HA 4WQMA 1WXQA 4WWMA 1PFDA 4YSYB 1QT9A 1N62A 3AE1B 3AECB 1UWMA 2K9XA 3W5VB 2MH7A 1A70A 4HROA 1JRPA 1ZXIA 3VRAB 4C7YA 3AE3B 2N0SB 2WLBA 3AEBB 5C3JB 1SF0A 1XLNA 3AE4B 5EE9A 4YTMB 1NEKB 2L83A 3B2FA 3NVVA 2E3TA 4ZHPA
chains in the Genus database with same CATH superfamily
5HNKA 2C60A 3ZKJC 3FAHA 2BPGA 9ICXA 3L08A 2K25A 3E0FA 2WXGA 4FADA 1ZGUB 2K60A 1MC8A 4Y2PA 4HLEA 2KANA 4XDDA 4R8UB 4Y2SA 4UARA 4EENA 3RR7A 3Q8QB 9ICKA 3AE5B 2IO0B 3AULA 4FXCA 5F9LA 4R64A 4LNNA 3ICXA 4JUZA 3AL0B 3VH3B 4PPXA 3RJIA 4P7IA 2M9NA 4PS3A 2F1HA 1GC7A 3RUIB 2XNAC 1N2XA 2MP2B 4NPNA 2KFZA 4JMUA 2VH2A 3OJSA 2BPSA 3ISDA 2DHZA 3IV6A 3I9V1 4N6EB 1BNPA 1WZ3A 3M9NB 5CRXA 1X6JA 4LLGM 3U7DA 4RCOA 3ZRCA 3KHHA 2HBLA 1RG6A 3F53A 3NHEB 4Q45A 2PLPA 3EECA 2Y0SF 2UVWA 4ED0A 2INPE 4S17A 5J18A 3MBYA 3RNFC 3V60A 4KX6B 3ZI4A 3ZUNA 3NUQA 1T3NA 1C1YB 2K8HA 3VH4B 4DQOC 5KT5A 3ZNID 1Y56A 5D2MB 4HJKA 3C21A 4J9KA 1AARA 4DXFA 4MH0E 2ES6A 8ICRA 5AI8A 4RUAA 2A19A 1BGXT 1X9XA 3T5KA 8ICGA 1QCKA 4GXIA 4ED6A 1YNTE 3N1XC 3VTUA 4EEWA 3V6EB 2FMQA 4US9A 1RDFA 8ICBA 3I1YA 2CXYA 1V81A 2OJRA 3AV8A 4OJ6A 3C1YA 3MGVA 4EBDA 2FLNA 2RDJA 3O13A 5KG2A 1F2RC 3V6HA 1QOAA 4D2KA 2F1IA 4DBGA 3KOOA 4Z6CA 3FILA 3ECIA 4EUTA 3ML8A 2H3FA 3PY8A 2HHUA 1KRPA 2V3SA 4O1NA 5AM3A 3N9YC 1TZOA 2L00B 2D8CA 3OHAA 4ZRKA 2V4QA 5DLFA 5L1JA 1KTKA 1JRUA 2VZKD 1XF5L 1WX9A 1NZPA 4TUSA 4RQ7A 3H8HA 4M8MA 4HDQA 3N1ZC 1EWYC 5AI4A 2PFNA 1JWMD 4HDOA 2ASDA 4ZYNA 3DHIC 3AEVA 3EW9A 1Z00B 1UBQA 3UMCA 3RJFA 2YEPF 4MHVA 3IN5A 1GG3A 1A0PA 8ICJA 1XLOA 4GDLB 2QARA 4B0EA 2GBMA 1QT9A 3JVZX 4W9JA 4HKQA 4KGTA 4I2GA 2GWSA 4ASWC 4C7YA 3HKZC 3R3MA 1O03A 3AE4B 1IYFA 3EC8A 2J53A 1P7EA 2E3TA 4Y2XA 2VA3A 3Q3MC 3Q8AA 1UGJA 2KJHB 1PVQA 1YJIA 3P4SB 1DOIA 1KLGD 1QF6A 1JWBD 4YD2A 3C0RB 2LBOA 5KG1A 1FNUA 5EDSA 5GMVA 2OXOA 1OGWA 3Q3OC 3G6XA 2PJHA 3ENEA 3AE2B 3M95A 2ZW1A 2IO1B 3AQFA 9ICQA 4AJYB 5KFYA 5D6JB 2R8IA 3N20C 2E8MA 3C29A 1I4QA 2W9CA 3GZFA 3PSFA 4HYKA 9ICBA 1ZD5A 4R65A 4DL5A 3SDLC 3GV8B 9ICLA 1IPGA 1E7VA 3PW0A 1VJKA 5G5HA 2C2RA 4NM2A 2KLGA 3N32A 1RM6C 4NY0A 3TFSA 1NKBA 4M9NA 2WAQC 2EH9A 5KFLA 3AEEB 1WGGA 3VTWA 2C28A 2WHIA 1HEZE 1JWUD 1GUAB 2KJ5A 7ICRA 1QQRA 2KMAA 2MJEA 4KSLC 1BVSA 2EDUA 5DGBA 4IQWA 2DX5B 2AGQA 5HKHA 2KNBA 2JPHA 5AK6A 1N63A 3IG8A 3TEYA 4O5KA 2M19A 3ZD9A 4JLCA 4UAWA 2W3RA 5J2DA 4YR3A 3UQ2A 3GIJA 5HP4A 1NI3A 1C76A 1EUVB 3H6NA 5BYRA 3EWAA 3BIID 3AI5A 3WK6A 1FFVA 4GB9A 1WFYA 2KD0A 1VZ6A 2C2DA 2W04A 5BO4B 5I4DA 1E90A 4XZ4A 3E58A 2LASA 2W7PA 2DKXA 3HJEA 2LJ5A 1JROA 1SIFA 2YN4A 4Z6FA 2BS4B 3P4PB 2LGDA 3SFEB 5IP4D 5KFDA 2SAKA 4ARIA 1XU4A 1RQLA 2LEKA 2M17A 5AI5A 4EX6A 4BGDA 3M8SA 1SJED 3QK0A 1TBEA 5ALVA 1I4HA 1UGMA 3M6KA 3R2TA 2IO3B 1RYUA 5J2CA 1M6YA 4RPYA 2XY5A 1KF6B 1VR9A 1DOYA 1EWCA 2KJ9A 4C8OA 3ZDTA 2J4XA 4ANXA 9ICNA 2X38A 4AP4C 4YD1A 2KTFA 3NVZA 4OJLA 3Q8SB 4K7UA 2A4ZA 2F1JA 2RDIA 5JRTA 4I2HA 4A20A 3W1SA 1AQ6A 1AN8A 3N30A 2VZKB 2ZJ5A 5H2FU 5K4LA 4KLJA 2LVPA 3K4GA 3IDWA 3B2FA 4I29A 2KOXA 1ZQBA 4DSKA 2LGYA 3X0WA 2LD9A 2GLSA 3ABVB 3RJGA 1BUIC 4EZ6A 3WU2U 5J0YA 2LRUA 5J8YC 4CO7A 3GQCA 3ZDCA 3UM9A 1J7CA 2EANA 1WYWB 2Z0DB 3DVNV 4NAWB 1TS5A 4B95A 2R18A 2JXXA 3RB3A 3PO4A 3RH6A 2QJLA 2E8NA 1E10A 1L8OA 2YTUA 3IAM1 1PGXA 1CQVA 1LB2B 2JZBB 3DEEA 3U4EG 2K8CA 3OWEB 5T8IA 4QIWC 2INNE 2WXIA 1KBUA 5KFXA 2PKOA 2XEWA 1XC9A 2ASQA 4BKTA 2DQNB 2F44A 3JPRA 2KQSA 2JU6X 3QXGA 3PZPA 1U45A 2LYAA 3C2LA 2W9AA 1ZDXA 2K8BA 3IP4B 2K6DB 3PZDA 1QQ5A 9ICPA 2KNJA 1P1AA 2IMWP 2XVTA 4KLIA 3V3XA 2JXTA 2BKRB 2PFPA 4C00A 4I2FA 3PHXB 4IQTA 2F77X 1ZQXA 4DQSA 1HUZA 9ICRA 2KSOA 3WIMA 5CEHA 2HCFA 5HR7A 5F9NA 1X42A 2WF9A 3B0XA 4ECUA 4US8A 1BPXA 4IM3A 4XGAB 3PRMB 2KTRA 1CUKA 3RN9C 2GBRA 1RXVA 2K4PA 4F5OA 2LMCA 3CYMA 2KYWA 1V38A 4OZBA 1L8LA 2K6QA 3CP8A 3AE7B 3NS1A 1FXIA 5B66U 2G45B 3WANA 4UW9A 4K81A 4E0DA 4YXJA 4YL8A 5KL8B 2HHWA 8ICTA 4K1RB 1E0ZA 1MN8A 2Q5WD 2I9GA 3LDAA 2WXRA 8ICWA 3TADA 3SQIA 1V1PB 3RJKA 3RJJA 3GZNI 5FKAC 3JPNA 4EFOA 4TMAB 4DWFA 1Q0WB 9ICOA 4UAUA 3AUOA 2BCVA 4JK1A 5AUKA 3V72A 4Y2YA 5L1MA 4RQ5A 2P6RA 2IGGA 4E3CA 1C4PA 2KQ7A 4JB3A 3M63B 5B5EU 4O3SA 4B9KA 2DZJA 4N9F4 3QU9A 4FBTA 4FZMA 1N61A 4WQOB 1WXQA 5ALLA 1B4FA 5T14A 2ZCCA 2B3AA 3PTFC 2ON8A 3D32A 2Y5BB 4ZRPA 4NM1A 2AL3A 5LXHA 2XCPA 4WAFA 1MPEA 5AKYA 4KLDA 5KFNA 2WTFA 5DGAA 1JXEA 1Q5WB 3HPOA 3H4DA 4UB2A 1J0GA 2M0AA 2IHMA 4NLBA 3UI3A 1XSNA 5AZFA 2AX5A 4O3MA 3VR9B 1J19A 4P6VF 2GBKA 3PMLA 5JHAA 1UA1A 1RXWA 3GOEA 2ZIUA 5AKGA 5AIBA 1TY0A 4MJSB 3PZ8A 5C23A 4F8CB 3RF9A 4B0MA 4DF4A 3SMVA 2RD0A 4FJYA 2DUYA 4WJOA 4Y2VA 4EELA 5KFPA 2O2VA 3PX0A 5ALZA 5A0LA 2KN7A 5HHIA 2BGFA 7ICEA 1YZ6A 4NJ7A 1GAQB 3ZJTA 4B6JA 5J2IA 2YMMA 3V62A 3MDCA 4M0WB 4LJXA 1TV9A 5ALDA 4P0QB 3WK4A 3VUWA 3NZ3A 2FMPA 4F92B 5AICA 2IO2B 1GB4A 4XUSA 1ZETA 3RI7C 2WYQA 2MU2A 1ZYQA 3QQ8B 1KFSA 1SWWA 8ICEA 1ZQZA 8ICHA 1XSPA 2L7RA 2LGSA 2XK5B 3KWVA 5C0YA 5CHGA 1T94A 1ZD4A 3PW7A 4M9LA 3L54A 1WIAA 2ZPYA 4LNIA 2RPVA 3C5FA 2KMMA 4XE0A 3SD5A 2KVCA 5CHFA 1DXSA 4KLQA 3DBHB 2H3QA 2UVUA 2WDQB 1GO3F 2WDTB 1BPYA 1R4MI 2KQ4X 1ZQFA 2Z8LA 4IG7B 2D3GA 1PK1B 5JTIA 5AM1A 2KDIA 3VQIA 2DPJA 2H3ZA 4EX7A 4LJOB 1KFYB 1R4NI 4IUMB 3PVXA 4EEYA 5TISU 4HPMB 3N7RC 3L0WB 4J9RA 4QWEA 2KKCA 2LHDA 3RNEC 1WGKA 4P0PB 4F4ZA 2BTEA 1UA0A 1V49A 3BS5B 9ICMA 2HBMA 5JUMA 2LUMA 4J9LA 4LNKA 2JRHA 1WE7A 1S3SG 2KJRA 3NTUA 2OJWA 3BZDB 1RWSA 4MGYE 2M8SA 1JWSD 3VFKA 4PZOA 2BW2A 3CSFA 4WJPA 1ED1A 2W9BB 2V4LA 1LKYA 4WQMA 2BGWA 4PYZA 3RB6A 4IC9A 3BQ2A 1L3SA 2J6UA 4K3CA 5J0WA 2IHNA 1FNWA 3ZXVA 4EOYA 3H9DA 3W5VB 3UQAA 1E8XA 4EKUA 3ZVVA 1A77A 1T0YA 8ICXA 4FJZA 4RGMA 2D3DA 3KHRA 1PZNA 2FUHB 2L5YA 1E7PB 4QZGA 3AQEA 1L7OA 4TURA 2JF5A 2WP9B 2JEJA 1WRDB 1BPBA 1ZXHA 3B0AA 5BMIA 4WJQA 3PT2B 2KVRA 1HE8A 2K4EA 3D2SA 1V8CA 4PHAA 4R63A 3A1QB 3BINA 3KQ4A 2RHFA 1S9FA 3B0YA 4MGZE 2DPIA 3GFKB 4HCPB 1P0RA 3MHSD 3ZNZB 5ALWA 2IYDB 1L2NA 1SB3C 1UCVA 1RYRA 4AYBF 1N60A 5J0PA 1L0XB 2LUEA 2X8XX 3D2QA 3CNHA 1RRBA 4Q43A 2N9XA 2INCC 1M94A 4F2SA 4XRHA 4RQ1A 2CS4A 4RFBA 3VR8B 3BQTA 5ALQA 4GGQA 4QZIA 2B21A 3N1YC 3Q8BA 2AJQA 1TK8A 3C2MA 4FHJA 2EAMA 1ZKHA 3EUB2 3BVZA 3N7SC 3MFGA 2IDYA 1MQ2A 2FPMA 4W9KA 2BS2B 5DB7A 1XCQL 2DNFA 5AKKA 1WRIA 2GI9A 4MACA 5EE1A 1NK6A 4PGQA 7ICJA 2PE6B 1PUTA 1MA7A 2LHTA 2KICA 4UBBA 2Y1IA 4LCDE 5H92C 3AEGB 5KT4A 4W9IA 4NLGA 2HW3A 3E2EA 3TCAA 5BOLA 1CI4A 3DWMA 5BYQA 2ZIWA 1N48A 4J9QA 4KVGB 2LVOA 2JH1A 1MI0A 4MFAA 3JSVA 4YMOA 1WMHB 1QQ7A 1YN4A 4OCZA 1FO4A 2NYVA 1WR6E 1WM2A 2IPKD 5HR6A 3IAS1 4C8LA 1OEYA 1AYFA 1EO6A 4PYUA 4IM2A 4MM3A 5J0UA 1ZRMA 4A8XC 2BB5A 1S0MA 3V7JA 5IIJA 2DYOA 5AZHA 3ORYA 1DK2A 3PO0A 3ZJVA 3UMGA 1B0XA 5AM5A 5H8YE 2MAXA 1IXRA 4LTUA 2OWOA 4QNLA 1H4RA 4ACOA 1WUDA 3JYUA 3IT4B 3RNAC 3AN1A 4EBEA 3WKEA 1L3VA 4BXOA 1WR1A 4WWNA 3W1SC 3ZO5B 2BYTA 2KHVA 2ZJDA 1XD3B 2JT4B 1XEEA 3MTNB 8ICIA 2PKEA 3JPPA 1LGRA 3MC9A 4IM0A 1F77A 3HHMA 5HG2A 4DSFA 1V86A 4QWAA 2LRWA 4A90A 3CRXA 1I7HA 2W8KA 3A9JA 3MHZA 1N62A 2K3UA 2HOQA 1UELA 1P98A 3JPQA 2BYVE 2MH7A 3IBEA 3VRAB 4WURA 4PZNA 2QCZA 4QWCA 2G4SA 4G0NB 2LJIA 4ECSA 2N7EA 1H8CA 7ICMA 2PIAA 2K4IA 1BPDA 1KLNA 5KFTA 4IDIA 4AQ7A 3H8WA 3SU8X 1KLUD 2MUTB 3V7LA 2PMZF 3U26A 2ZTCA 3T3FA 1SEBD 3QJZA 3KFUF 4C4TA 4DS5A 3KYDD 3D2NA 1KM7A 1VCBA 2FCQA 5IKCM 3QE9Y 3M7DA 1KDHA 2NRTA 1EM7A 4MT5A 3LB8C 1RYSA 3QU7A 3RAXA 1D9FA 2EKEC 2EELA 1ZQPA 2VA2A 1HTOA 3BYTB 2KG5A 4CRXA 4WJ3B 3SAGA 2AWTA 4FULA 1LVHA 2V9HA 4UAVA 1Q46A 4TQRA 3RTVA 1CMXB 2MQJA 5DPWA 2L3ZA 3ZQ4A 3W5UB 2VA8A 5J2BA 4QZ8A 2WF8A 3MR2A 2L8JA 4KLMA 5IIOA 1ZQGA 3UGBB 4F50A 1E8YA 4EEKA 2WXPA 1D5ZC 3AU5A 3ZDMC 4C4SA 4J9PA 2I1QA 2AQ1B 2BCUA 2SEBD 4UB5A 2A1JB 2JXJA 5KFQA 3Q3NC 3TJPA 3T9LA 3GIMA 2LWPA 1F0MA 3QIJA 1UT5A 2UVRA 1WXSA 2PVGC 5C5JA 1PUZA 5J2EA 3MGIA 3A9KA 3NUHB 4F1SA 2KP7A 1P7DA 3AEFB 1WXMA 3F2DA 3IVFA 3ETRA 2K39A 2EAOA 4PJ0U 4HWIB 4MGIE 4PHEA 2KLCA 4OD0A 4RGOS 3UQ0A 2IJ0A 2BZFA 4OJ5A 1Q10A 1HJPA 4QW9A 3PV1A 4G11A 2YX8A 4DL7A 1E9MA 1EF5A 2CU1A 2QARB 5D4BA 4YN4A 2JSVX 4QAYA 3TFRA 2FUG1 3IHQB 3TADC 4HPPA 1TAQA 4UB4A 4CYEA 1UF0A 4F91B 3ZTDA 3H7PA 4C4VB 1SBBB 4RM9A 3HKZF 3MC8A 1TZ1A 4IOIE 2KZMA 1ZQKA 5BMGA 3EYZA 1WJUA 4ACFA 3K1ZA 5IO9A 1KEJA 2D3CA 3AEDB 2AQ0A 2JX5A 3CF6E 4NJCA 4DSEA 2WHEA 4DEZA 3WCQA 4PL2A 5ALSA 1YN5A 5IIKA 4G3IA 1Q8KA 1JXLA 5JH5C 2KVZA 3I57A 4KN7A 4YQWA 4ELVA 2E6XA 2ONQA 1C3TA 3SEIA 4GDKA 2BF8B 2J52A 5KFFA 3TAQA 1WXAA 4RQ6A 1TAMA 5CWRA 1SF0A 3B1LX 4YTMB 3GS2A 4UDUC 4I27A 4FS1A 4ZHPA 3GE8C 3QHTA 1E8ZA 3A0HU 2HTME 2MA9B 4ECXA 4PS7A 4KTQA 1L4DB 4DXAB 3MR5A 3H7SA 3SD7A 4UB6U 2A3VA 4MFCA 3K75D 4FA6A 4R8UA 3QARA 4NV0A 1SL0A 2DYMA 4N58A 5DQHA 2C9WB 1T3QA 2KACA 3H40A 4I6LB 4TSSA 4RF1A 5AEKB 1S8OA 3KBBA 5D7GA 2MP2A 2RLTA 2FCSA 1NK5A 3WK8A 3QUCA 2H3VA 1SXTA 4OW0A 5L83A 4LJPB 3H1UA 5IIIA 1SKWA 2WU2B 2M0NA 5KL1B 4RNNA 1U49A 4MH8A 4NJ8A 4F4KA 4B9MA 2QB0B 2CHZA 1U47A 2MW5A 1HEKA 2Y0SC 2PFOA 1AW7A 2PXIA 1ET9A 4QW8A 3TEXA 1FEHA 3PR5B 2QIEB 4BBNF 3UXOA 1PVPA 5AHXA 2ISPA 3PW2A 5IAAC 4DOBA 1F44A 2FIFA 3TAPA 3DQVA 3V6KA 2HJ1A 2L32A 4LZGA 2C5LC 4GXKA 5ALFA 2NBUA 2LGIA 3JW0X 4P4MA 2BQRA 4FZNA 1ZQQA 2CRXA 2CR5A 3LXFA 4IWQA 4B9UA 2PE9A 3LVWA 8ICPA 3WA0A 3M62B 4W9CA 1MG4A 3QC8B 4KKJA 2R8JA 1EF1A 2LI5A 3PS6A 2YVCA 1TS2A 2IOFA 3AE8B 3UXPA 2RR9A 5AIAA 5C1ZA 2UU7A 1C20A 2E8OA 3OJUA 3T5LA 3RT3B 4P1BC 3H7IA 3PR4A 1N56A 5G55A 1GJZA 3NZUA 4FS2A 2NRZA 2FLLA 1NJXA 4HRSA 4NWIA 1PGBA 1HUOA 2UYZB 2JYEA 3EFUA 4GC6A 2PW9A 4MSQB 3W1YA 3A33B 4Y2QA 2UVVA 4KIKA 3SYZA 4LVSA 8ICNA 1VD2A 2MX2A 2MEKA 5KFSA 2WDRB 4Q44A 1AWDA 4II3B 1F0ZA 1NNLA 2QILA 1C78A 4L2YA 4QWBA 1Q3UA 1ZQRA 3KD3A 2HHXA 1Z00A 4F5RA 3TQ1A 5CJ7A 1ROEA 4RM8A 3UF8A 3GU3A 3QCAA 1SKRA 4GDLA 2W82A 3TBLD 1FIQA 4M01A 5AM4A 2KEYA 3V61A 4DLGA 4BVUC 3R66C 4DSJA 1HIWA 5HHDG 3TIXA 2MBOA 1ZXIA 5DG7A 3U2SC 4HEA1 1COOA 4ECYA 3WK7A 3SI8A 3FYHA 1KW4A 1K8RB 2EZXA 4PS8A 5DCNA 4ECZA 2DF4B 4BOZB 2KD1A 7ICUA 2KC1A 2KMDA 3GIIA 3AE9B 4TKNA 2LXCA 1NK9A 4CQNA 2KMCA 3P4RB 1SIJA 3NY5A 2NPTB 4IL6U 1UD7A 4BKSD 1T4GA 1KRHA 3TEZA 2DZIA 3RNCC 5J0TA 3QA8A 4GLSC 4F72A 2BPFA 3ZYYX 4P4OA 4RUCA 2EZZA 3V7KA 1F1HA 3CMMB 2KFKA 4EZLA 3BK2A 1FD6A 1IGDA 1SE2A 3B08A 4S0RA 4LNOA 3EA6A 4RQ8A 3UIPB 4DS4A 1U9LA 2ZCBA 2GOWA 1HQRD 4F93B 5J2AA 3EPGA 1KFTA 3DCGA 1OQYA 1Z4NA 2C2EA 2ZW0A 3KKAC 2EZYA 4UAZA 5KG0A 1MVKA 4YXMA 4KZCA 2N1WA 1IP9A 1G6JA 4RQ0A 1X6IA 1WJNA 4C0ZA 1C4AA 2JZZA 2KDBA 2W3SA 2NVUI 3KW5B 1T0QC 3FDSA 3DWGC 4ZH4A 5D46A 2VH1A 1UT8A 4NJ6A 3IXSA 3T5JA 2FNJB 1IBXB 1S0NA 3DBLI 4BOSC 3C8YA 3IG3A 3PSTA 1KLVA 2XCAA 4MEMA 1YX5B 2G9HD 4ED8A 2WF5A 4KX5A 2KKVA 1TKGA 3RB0A 2DKZA 3RB4A 2W43A 4I2AA 2NTTA 4TQ1A 5KT6A 3UMBA 4BDPA 4BX9C 4PHDA 1NYRA 1S77D 3BS7A 3ZNGC 1DOXA 4KX3A 2ZVNA 4P4PA 3RRHA 9ICFA 1LV5A 5KG3A 3PNCA 2WXKA 2M4NA 2QLTA 4Y2UA 4OJPA 3GDXA 2L0TA 5DG8A 1TTNA 4GIBA 2BQ3A 2QB1A 1V80A 5IOIA 2K8AA 1NENB 2KC2A 1X66A 3GILA 1VLBA 3L10B 3HUIA 3PREA 3OTQA 1ZE3D 4RU9A 3HIZA 5HI1A 4O5CA 7ICPA 3LWMA 1SE4A 2MHJA 4ZYSA 3KHGA 4L23A 3Q8KA 2N9LA 3L16A 1LXDA 3TUOA 4ZHOA 2XIDA 3BDPA 1YQ3B 4DO9A 3MJ5A 1DYQA 4NQLB 3C19A 5FK9C 2Y5CA 4KMOB 2HE7A 7ICNA 1YT3A 2MCNB 2A5UA 1WJ6A 5KFRA 3RZFA 1SV0A 1WF9A 1X2IA 5F3XB 4IRKA 1TFRA 4KITB 3N7PD 4CCHA 1K52A 4DFMA 2WNMA 5DG9A 4XQ8A 1JRPA 3PSEB 1DK3A 3TEWA 3AEBB 2LPEA 4I2DA 4EZ9A 3ZGZA 3QX1A 2H88B 5D94A 3V6JA 3JPTA 4XA5A 4DL4A 1UNSA 3VAWA 1FM0D 3ISCA 2DYBA 4IKGA 2I38A 7ICQA 5AM2A 4JWMA 2HHTA 1L6VA 1WWTA 3A0BU 3KTQA 4JPSA 2D07B 4RNMA 1N5XA 1L0VB 1XS9D 3EGRA 5DBAA 3PV8A 2WS3B 1WGDA 3F5AA 1LO5D 2JYTA 3L3FX 4JWSC 4K3BA 1KN5A 4OO1J 1IG6A 4NAWA 1RFKA 4KLLA 4RT3A 1TY2A 4M47A 2EMSA 3ZTCA 4EE2A 5KAIU 3SFDB 3SEBA 8ICSA 1VRAB 2O6VD 5LXIB 2YMQA 2E8PA 4HK2A 2JZBA 4XYCA 4YG2A 3GIKA 2VRRB 2LI6A 4P1CC 2VANA 4M9JA 2F2AB 1ET6A 3QEBZ 4K4IA 2D3AA 2KDFB 1D5XC 3Q6BA 2HI0A 1IM4A 2HDOA 1QZEA 1J7BA 4GU2A 1GPXA 5KAFU 1RZTA 1GNUA 4JE3B 4O9MA 2F8KA 3MGHA 3E9SA 3HILA 1V6EA 4K7WA 4NY8A 5E6NA 4I2JA 5AM0A 1LQBA 4F5PA 1QLNA 2HHQA 1WJ4A 1SXDA 3QU5A 1N5WA 5DB8A 2NRVA 4C4RA 3Q8EA 3T3OA 1RQNA 4TV3A 1V9PA 1FEZA 3OGUA 8ICZA 5IINA 1F5SA 3NRZA 3ISBA 2RP5A 2RDGA 5L1LA 1BPEA 3H8MA 1L5UA 4CGZA 1HTQA 4KLOA 5BOMA 4F4WA 1TYGB 4O3NA 1JQ4A 1L7PA 3L13A 1MHXA 3Q8CA 1YX6B 1XWLA 2G5IB 2ZNVC 4YR0A 4YMMA 1Z2MA 4Z6EA 2M56B 4J9MA 3PO5A 5CX3A 4ANUA 5KT7A 3ONSA 2MWSB 3NVYA 9ICEA 4IWOA 1K1QA 3IFWB 2MBBB 4BJQA 1WWUA 4G50A 5KG4A 3AMZA 4UAYA 1KFDA 4BZAA 4DOCA 4UQGA 3KVFB 3VC8A 3FKYA 3C2KA 1TS3A 4M0AA 1C77A 5FP0A 1MQ3A 2J6TA 1XSLA 2J0KA 3EHVA 1ECWA 3KUCB 2CU3A 5KFMA 1V1PA 4ELTA 1MFWA 2GB1A 3BQ0A 4WWPA 3VRBB 2GBNA 3TKAA 2PMVA 3KUZA 4MELA 1F9JA 3K1RB 4HAIA 3S6JA 2JEGA 1ZQTA 5HFYA 3RH4A 1JUDA 4F5NA 2K89A 5DB9A 4WWOA 3VCBA 1QKZA 3T3NA 2WXHA 5AI6A 2BQUA 5DQGA 1GOZA 2K9XA 2JVCA 4FZLA 2L1AA 4DOAA 3U7ZA 3MR6A 1E5WA 4NL9A 1I4XA 1S0OA 1I4RA 2C7NB 4B6WA 2Y1JA 4P2HA 5GTHU 5TZVA 3FM9A 4EZJA 1EXNA 3HW8A 5E6OA 2MRPA 2BCRA 1SE3A 2Y9UA 4A8EA 1NJZA 2WXNA 4JWUC 3L4PA 2WXJA 3HVDA 4MEXA 2JHDA 3I5JC 5FR3A 2HVHA 3PLVA 1PVRA 4JGHB 2KK0A 4MF8A 5ALJA 1FXTB 3IG5A 3FC4A 1XT9B 5EWGA 4UBCA 2E1EA 4MJSA 1YD8U 5CTRC 3U52E 2XGPA 5CHVC 3ZDAA 1ZW7A 1J8CA 2ZIXB 5HHHA 5GXGB 3QU2A 2R8GA 2KDMA 4YVZA 2G5HB 4Q8EA 2ZXIA 1FPYA 2V3PA 2WX1A 4UATA 1L6UA 1ZP0B 2ZIVB 4ED2A 4FBUA 2KAJA 1ZQLA 1T5XD 1QTMA 3P63A 2KHQA 3KH0A 5TR5A 2V4IB 4K4GA 8ICMA 3DV9A 8ICKA 4EBCA 2KT7A 2CN1A 2XO7A 2WXLA 3W9CB 4QWDA 4C8NA 1SJHD 2HOIA 4QZFA 4F2RA 2JUOA 3DBRB 3DDCB 3VVWB 4M0WA 2W9NA 3F2CA 4ED7A 2O6VB 4P0QA 3RBEA 2P66A 2JY6A 7ICGA 4BUGA 3M9MB 3OSPA 4M6WB 3Q8LA 2FJ6A 2K0PA 2ZUDA 3DDHA 4O3RA 4EYIB 1D6EC 2HSZA 1HXYD 2GH1A 1L7YA 1WM3A 4QZHA 2Y9TA 4BXOB 1XO3A 4GOCA 2BKFA 5EE0A 3ZDBA 1NYQA 4RF0A 4M2YA 4KV2A 1BNOA 1HA5A 2BCSA 2G1EA 4AP9A 3BZKA 4I28A 4B9NA 1QQ6A 3WAMA 1B1ZA 3PLUA 3DHGC 2LFIA 1V85A 2WB1C 4B9VA 5DBCA 2OYYA 1PK1A 5KT2A 5G2NA 3KWLA 4KMUA 2KX0A 4KGRA 3M1YA 3J9CA 2HTHA 3VUXA 8ICFA 3RNBC 4ICVA 2I1KA 5AI9A 5ALMA 4M04A 3C28A 4P0PA 4YP3A 2N7DA 1SSNA 2NV3A 2KFNA 5BMHA 4ED3A 3BS5A 2ASLA 4KN4A 2AQ2B 1IV8A 1ZQCA 5FR6A 1Z1VA 3PSIA 5J2KA 2BCQA 2ACZB 1ZQDA 1I4GA 4YXDB 4II2B 2BBCA 2KZZA 2H89B 2E1FA 4OZCA 2W9BA 2W03A 1WG8A 2Z0EB 4YSYB 1D3ZA 1PFDA 1AROP 3AE1B 4DFJA 5EWFA 2L76A 2DZKA 1D4BA 4HROA 4YFKA 1A6SA 5C3JB 3BVGA 1SGGA 3DVNU 2L83A 2AGPA 1PDXA 2AQ3B 1STEA 3Q3FA 3IHPC 3QUTA 2DFLA 4NAMA 3H0MB 1JWAD 3T8MA 4Y2JA 4QZCA 2V1YA 3Q14C 1SL2A 4NLNA 2K4HA 1ZJNA 2GMIC 1Z4OA 2HJ8A 4IRCA 2G3QB 3GV5B 4WIPA 5AKLA 2FLPA 4RPXA 4PGXA 1S76D 3RFAA 3M9OB 1VZ8A 1SZHA 4HCNB 2KK8A 2K5PA 2AQ4A 3A1QA 3OHBA 4DQPA 3CSTA 4J9SA 2BPCA 3U8ZA 2I2YA 1UWXA 3GV7B 3RCZA 2PI5A 2NBWB 4W9LA 5L9XA 1JMLA 3ZRFA 3PZ7A 4UB3A 5J29A 1NJYA 2CKHB 1WSPA 4YWGG 3LYSA 3ZDEA 1WWVA 4AYBC 4C8MA 3ONNA 4ED1A 2FMSA 2HMXA 3ALBA 4KKIA 4MSMB 5HMLA 1B9RA 1CZPA 1L6NA 2VKQA 2D10A 1ZQ1C 3NG0A 5J0QA 3VXWA 7ICTA 3OPXA 2NMQA 1JALA 1WCNA 4DLEA 2OEHA 3LWLA 3A4RA 2H5XA 1OXJA 2J6SA 3V6CB 4KLSA 1LM8B 5LLIA 2NS5A 4ECVA 2V0GA 1S10A 5C2TB 1XLPA 2ZNVB 5DQIA 4IR9A 9ICHA 1PYWD 3H7PB 4Q2JA 2GRIA 1MHHE 5TSSA 4W9HA 9ICCA 1S1QB 4I2BA 2BWES 2KXJA 5CP2A 1UHUA 2KO3A 2ODGA 2KWUB 4EYHB 2KVSA 2LKYA 2OOBB 2AHOB 2KHWB 1KH0A 2ALZA 3WAPA 1A5RA 1JW9D 5BYSA 3BZCA 1B43A 3PRPB 3RNGC 2PVOD 2KN5A 2RDHA 3HT3A 3EZ5A 5ALEA 3PX4A 2GOLA 4MDKE 2MJ3A 3VTVA 4AUQC 4ZDVA 2AL6A 7ICLA 1QILA 2JZPA 3B2GA 3OAWA 4GC7A 2G07A 2QKQA 5DKWA 3FILB 3RYTA 3SZ2A 5DDYA 4XC2A 3W2DA 1WMHA 2D6FC 1QOBA 1TKDA 2ZPNA 1TE2A 2LYHA 1YQBA 3F2BA 2NTSA 2Y3AA 3OJ3A 4QZAA 3RULA 3HM3A 5L1IA 2YMPA 2NBVB 1MJDA 5DB6A 3HX0A 2IZVB 4ECWA 3AE6B 5KFIA 2ASJA 1SV0C 3PSPA 4OJOA 2KZ3A 5IILA 1NKEA 1P7FA 2GBJA 2M0XA 4JQWC 1SL1A 2AEHA 4J3OD 1WX8A 3Q69A 3PPAA 4O5EA 2OEDA 4C7ZA 4DHZB 4KLGA 2LYBA 2WWZA 3QAQA 2L0FA 5IA7A 1FMAD 3LDZE 1ZPSA 1ZOYB 2I1JA 1QSYA 4IQUA 4OHJA 2KWDA 2R8KA 1X40A 9ICWA 1JX4A 2M1MA 4KSKC 1YMHE 1L0YB 4C8KA 3CIRB 3S2AA 1QSSA 1NK8A 3NVWA 2IGHA 1YJ1A 5E6JA 2N1VA 3WKAA 2BYEA 5AUIA 1ZQYA 4B9SA 2XC9A 2J7QB 4RQ4A 2MUTA 2PMZC 8ICVA 1ZQVA 2JEIA 4W9FA 1C79A 4RNOA 1YJJA 1WH3A 2MSNA 1ZQSA 4AWJA 4YTPB 4FJVB 2RQ5A 3BY4B 3SV3A 2W9CB 1H38A 2MBQA 4LDTD 4RQMA 5AK3A 3BJYA 1SWVA 1KOTA 1NKCA 2FPKA 5KT3A 8ICLA 4HJGE 2IY1B 4J9NA 5KG5A 7ICFA 3PVLA 5JHBA 3VHTC 5KNIA 1JMSA 2XY7A 4RGNA 1TK5A 1TVAA 4AOFA 2ZJAA 2F3NA 2KOBA 2WXMA 1EU3A 5BPCA 3UXNA 9ICJA 5AK5A 1S0VA 3P1MA 5LNK1 2L05A 1ZQOA 2WAQF 3RRGA 2ICIA 3H0LB 1KL9A 4ECTA 1FRRA 3R7QA 2LGXA 4IQVA 2A1JA 4Z6DA 2AGOA 4KIKB 1Z1BA 4IS7A 1Z19A 2P6UA 8ICOA 5J2GA 1FRDA 3NZSA 4JL9A 3ETLA 2KKPA 3MC0B 1U48A 1UPHA 4X57B 5ALPA 2O6KA 3UPQA 4TUUA 4DQIA 4USAA 1TKEA 2IOFK 2LM1A 3RMKC 2R2QA 7ICOA 1CRXA 3ZDDA 1ZUD2 2YB1A 1T8EA 5AI0A 3QUBA 4CDGA 3AXCA 2FPLA 4PHPA 1P3QU 2PPHA 1I35A 4L1BA 3RBDA 3ZJUA 4RQ3A 2G06A 2HD5B 2LM4A 1NK0A 1T0RC 4C4VA 4RZRA 1BPZA 5KFGA 4H2AA 1D9DA 5E79U 3DHHC 5DPSA 3HP6A 4HXDA 2XICA 2ZVOA 1NJWA 2JWZA 1RPLA 1C9FA 1V5OA 2WFAA 1NOMA 3CW2C 2IOHA 2DZMA 2YQEA 3ZNHB 2EMTA 5AKJA 4RT2A 4I6NB 2KFKB 1T0SC 4BWMA 2LMRA 4M00A 4NL9C 4M8NA 9ICSA 5E6PA 2CHXA 4KLEA 2K1FA 3BQ7A 1A76A 2BYFA 4DL3A 5D3IB 1J2NA 3ALRA 3AECB 2NRXA 1L7MA 3R8BA 3DOWA 5ALOA 1ZQHA 3TL5A 5KFWA 5EE9A 2IBKA 5ALIA 2KZRA 3JPOA 1ZQMA 7ICSA 1WGHA 1VZ7A 2NRWA 2YMLA 2MLBA 5CB1A 3Q2AC 5DDMA 1T6BX 3R7RA 3DBLB 5KFBA 2C22A 1ENFA 3TARA 2W11A 4B9TA 2F8LA 4LZDA 3Q3JA 4NLCA 4WAAA 4YCXA 4UB1A 2C7HA 3G6VA 4PGYA 2HHSA 1K51A 4RNAA 2XN9C 3BWUD 3C5GA 2VJ4A 3PHWB 4CF3A 5L95C 3H8SA 3N4MB 4ZRQA 4IWPA 2D5GA 9ICGA 2LHEA 4FFDA 2JH7A 2R2OA 2EAPA 2IBIB 1FNVA 3VDZA 3QU4A 1HZ5A 1OFFA 2K8CB 3G6YA 4GLXA 1BT0A 2RMMA 1CK1A 4QIWF 1E6EB 2W7OA 4DFKA 4DDID 2RGFA 1QOFA 2QB0A 1COKA 2CJNA 3LJ3A 2C7MB 1NDDA 4W9DA 1E7UA 2BB6A 4BBNC 2DAJA 3I3TB 2KDEB 4O3QA 5CA7A 3APCA 2OH2A 8ICAA 2MRLA 2K22A 4NZLB 2K8BB 4K4HA 4DFDA 2R8HA 3PX6A 4CF4A 1YIWA 1N6ZA 4YSXB 5J0XA 3M3JA 2NR2A 1ACCA 2FCNA 3PRZA 4XDCA 4DK5A 3WK9A 1ZQNA 4A3PA 2LXAA 2UWQA 5AKEA 3UQBA 4LDTB 3ZW3A 4ITKA 2KTQA 4Y2RA 4J6IA 2ZUBA 2LZ6A 2KSOB 1WYGA 2KN4A 2FBWB 4O0IA 3H4BA 4JWNA 1UH6A 3J81j 2QC8A 1VDVA 5AKXA 1QLBB 5G5GA 2EKIA 2KTRB 4TUQA 3M8RA 4R66A 1XO1A 1MG8A 5ALNA 3R2IA 2INDC 4PL1A 1Q1OA 4LNFA 4XX5A 4DDGD 2DWQA 2W54A 1WZ0A 3PW5A 3T5HA 1SE9A 1Y88A 4UASA 1LFDA 4X5VA 1L3UA 2N9EB 4BFRA 2WGSA 3GZNB 2YLMA 2ATLA 2DAFA 4A55A 1TAUA 4GN1A 4JV1A 4C80A 2EQYA 3QNMA 3DBSA 3L17A 2R61A 1DGJA 4G9BA 4F4XA 5J0SA 4O3PA 2VIXA 1XCTL 1U4BA 5KFJA 1TGZB 1V9JA 4GIVA 4XWWA 4WH4A 2V4RA 3SAHA 3D6JA 7ICVA 4YTNB 1P9DU 3K9PB 1NI2A 1FCCC 2JGAA 2I5HA 3HM6X 3JPSA 2JRIB 2QHOA 5JZEB 4YMNA 4DCCA 1J97A 4MGKE 4ANVA 2Q4TA 2A1AA 2J0MA 4DL2A 4ICUA 3HWTA 1NEKB 4DHJD 1ZRNA 2FE9A 1PK3A 1JI7A 3PMNA 3IRUA 2B6GA 1WX7A 2J42A 1URJA 4NQKE 4QZDA 1DGSA 3WKBA 4KLFA 3OSNA 3UIOB 1EU4A 3AEAB 1VJ5A 2NPTA 5ALGA 4F8RA 1QSLA 1K5OA 2MSED 2ZIUB 4B9LA 3O0FA 3TACB 1J2MA 1Z3EB 2DBYA 1OTRB 3Q8FA 2ZUCA 3ZLZA 4QJFB 2O2VB 1XO0A 4A3OA 4P16A 1YZ7A 2AU0A 4M9GA 2AXTU 5KG7A 5ALYA 2WQYB 3RAQA 2IGDA 3EFCA 2JQRB 2ZTDA 4DQRA 4ARCA 1L5PA 1GC6A 3OLMD 3ZXRA 3U30A 3H8JA 2ZEQA 5ALUA 2W8LA 1YN3A 5AK4A 1XNSA 2ESEA 1TT5B 2B76B 2HVIA 2ZJ8A 2FDRA 1IBXA 1ZDVA 2D3BA 3GP7A 4HPLB 1KSPA 1PGAA 4YT0B 4URKA 3DVGX 2OHFA 4WJNA 2BDPA 1I4PA 1OUQA 3RJEA 5EWEA 2HBKA 2OCEA 1ZQJA 2BKEA 4KLHA 1XLQA 1UBIA 5ALRA 3B9JA 4AJWA 1V97A 4DWIA 1NVID 3A4SC 2V3NA 5ALXA 3AH7A 2B0CA 2KE7A 3L5KA 7ICIA 1R4MB 1IGCA 4M02A 3HVZA 4ECQA 2Q0ZX 4MFFA 1R4NB 4FLHA 4F3OA 2JV3A 2KWCA 4YSZB 1WY8A 2BR0A 5AKIA 1CJEA 3NOBA 3VUYA 4XWTA 4FHKA 1X9SA 9ICUA 2ZTEA 1NBFC 2FCMA 1PQSA 3AU6A 3APDA 3SAFA 5ALHA 5L1KA 1C7YA 1FXAA 1K50A 4OZAA 2QEJC 3KHLA 1SKSA 1Z5SB 4IW0A 5D3DA 4FE3A 2PEAA 5IN7A 2PI4A 1XQQA 3RH5A 2ZXHA 5J2HA 1WCLA 1F2RI 1ZJMA 3UINB 2JR5A 4F4YA 1QOGA 1OEYJ 5JXVA 2WXOA 4HKZE 1UZXB 9ICAA 2GO7A 1ZQEA 2KFJA 4PH5A 4MF2A 1Q3VA 2GLEA 3IT6B 4U7CA 4PT5A 2LVQA 5EOZA 5J2FA 3URYA 4F7ZA 1LKYB 1TK0A 2REXA 4ICAA 2KV2A 2WXQA 3SENA 3ML9A 1S5LU 2YEPB 2HOFA 5J2JA 2PFQA 1DOQA 1A70A 5AKZA 3AE3B 2WLBA 2MBEA 1XLNA 2KJ8A 3M6ZA 2NO4A 5KFUA 2V9WA 4CF5A 3O65B 4OVZA 4DQQA 3KZIU 3X23A 1K53A 5AKHA 1YQ4B 1YOVB 1WE6A 2E5SA 2ZG6A 1I42A 1ZOLA 2G08A 2YB4A 3PW4A 2TSSA 2DENB 4DXGA 2JEFA 4GXBA 4JX1C 5KFZA 2CPRA 4UB8U 4ZOHC 3APFA 3MP9A 2RRDA 4DSLA 1RFAA 4I6PA 5HMMA 2KX3A 3LYYA 5EE3A 3MFHA 4IRDA 3ED5A 3C23A 4U6PA 1L3TA 4Q8FA 4DHJB 4A9AA 2BT6A 1WGRA 3I28A 4E71A 4DFPA 2D2QA 4PK1A 5MPOA 3TANA 1KJTA 1V5TA 1IUEA 1FFUA 2I6XA 3CWIA 1TS4A 1ESFA 2XI9A 1KQQA 4BKSA 4RQ2A 3KLSX 3RJHA 3N3KB 4I2EA 4HVBA 4DL6A 4E74A 4J9OA 7ICKA 4TUPA 1B22A 2WB1F 1IIPA 4G3XB 5KFCA 2MBHA 3AM9A 2FAZA 3LK9A 1KTQA 1OW5A 4NXZA 1ZD2P 1J7AA 2AYOB 4C56C 3IM1A 2MJDA 4RH6A 1MSWD 3KZXA 2N9PC 4I2CA 1D8LA 8ICUA 1WGYA 3P2BA 4I2IA 3RFZB 2WF6A 1KKXA 3OJ4B 3QUQA 1L4ZB 3QEAZ 9ICVA 2ZIWB 3I76A 1GB1A 1TKYA 3QWZB 5DLGA 1L7NA 5KHQA 1D5MC 4RMAA 3NS8A 3JSVB 1JIHA 2RPQA 2BHNA 4QZEA 2MA1A 3Q8MA 2WX0A 4MM3B 2QSDA 1OQRA 1U4AA 3BVMA 4W9EA 1NK7A 2WU5B 4GMVA 2G0AA 1V1OA 2AH5A 3LVVA 3WKCA 8ICYA 2F76X 3MJWA 2ISOA 1JN3A 1ZQAA 1Y8RC 2XK5A 5DPRA 4F71A 3SV4A 4A6QA 3K9OB 1F52A 2XGQA 2JZ3B 3TI0A 3MFIA 4ECRA 3ZIMA 3WKDA 3N97B 3RPFC 4R3DA 1ZQWA 4KDLB 4RQNA 5AZGA 4RGTA 2G09A 3A9JB 4KZ0A 4NLKA 2J0JA 2VJ5A 3RR8A 5GTIU 3Q8RB 3I63C 3KYCD 1UWMA 3DBHI 1RAXA 3F5EA 3NRWA 3T79A 4GSWA 1NK4A 2N0SB 2XY6A 5DPTA 3RZWC 2JRZA 3NVVA 2KWVB 3MR3A 4REZA 2HDEA 1OQQA 4O3OA 3KKAA 2WDVB 4KLUA 4QZBA 3GB1A 4BAXA 1UQVA 5ALTA 4MEYA 3DVGY 2DGZA 3QX7A 4CE6A 2L52A 3Q8PB 3QZ8A 3RD2A 1WXVA 1X9MA 2W55A 3C1ZA 1X9WA 2KJ6A 2FE8A 2N7JA 3WALA 2CJOA 3NGDA 4LK0M 4QZ9A 1RYJA 4DSIA 5J8YA 1DRGA 2PTLA 2HBJA 5KTQA 2G4DB 3MDAA 4TQ0A 2ZIXA 5JU5A 4JV2A 4NLZA 2N1RA 5D49A 5J2RA 2Z7JA 3AU4A 3V05A 1SV4A 2RSUA 2Z59B 4IC7B 2ZIVA 2WXFA 2QDFA 3WAOA 5CR0A 1RLFA 4TQSA 3P42A 2N9KA 1BMLC 2QMTA 4BKGA 2BS3B 3NASA 1UUPA 1WI0A 8ICCA 3BQ1A 4N59A 1SGHA 4J03A 3MABA 1C4CA 3H0RB 4AS1A 2BWFA 2O6VA 1M4VA 1FCLA 5DBBA 1O08A 3A9KB 4M6WA 3N28A 2CHWA 2YY6A 3DBRI 4M9HA 1CEZA 9ICIA 2XBBC 3QZ7A 3HK0A 3SR6A 2H3IA 4BWJA 3OG5A 5CHWA 4JV0A 2KIWA 3HRDD 1JCKB 1E8WA 1TJEA 2BQQA 4DHZE 2JMGA 1TIFA 3GE3C 5J17A 1K1SA 4EZKA 2W9MA 3BYYB 1X1MA 3DPDA 3P4QB 2KIVA 9ICTA 5J0RA 4KLTA 2NO5A 3R9KA 5KHOA 3EPIA 5KFHA 4ZRJA 3TMPB 4IR1A 1S97A 2DLBA 2IY0B 2FI1A 3BK1A 4F5QA 3NJTA 3AB5A 4FN2A 5IIMA 5KG6A 4ELUA 2N4FA 2NCNA 2RDBC 1XXGA 1HZ6A 4NNJB 2BDUA 4RPZA 3PGEA 2FIDA 2WF7A 1ZQIA 4KDIC 1SXEA 3AU2A 4JIOU 1ZD3A 1T7PA 4CNQA 5KFEA 1R7SA 1BXTA 4OVUA 5KFVA 3WK5A 5J0OA 5KFAA 4W9GA 2P35A 4KGSA 1ISNA 3MC1A 4YR2A 3E56A 4ZRIA 4CHKA 1D8BA 3TSSA 4ANWA 2IA6A 3KUDB 3SHQA 2JWUA 4K7SA 2D11A 2ZZPB 4FBJB 1NZBA 1D8YA 8ICQA 4WWMA 5KFKA 3QYPA 4DF8A 2DL0A 1ZQUA 4GDKB 2Y5PA 5KFOA 1SZPA 1QH9A 4Y2TA 4GXJA 4FO6A 2BVCA 4GFJA 2HHVA 3ZD8A 7ICHA 4OVVA 1V2YA 3THVA 5ALKA 2OM6A
chains in the Genus database with same CATH topology
1UNSA 1VZ7A 1FM0D 4IKGA 3FAHA 1T6BX 2I38A 1E7PB 1L6VA 1ENFA 1WWTA 2WP9B 2WXGA 4JPSA 1N5XA 1ZXHA 4XDDA 5BMIA 3AE5B 4FXCA 1L0VB 3EGRA 4RNAA 1K51A 2WS3B 2XN9C 3BWUD 1LO5D 2JYTA 4JWSC 1V8CA 4ZRQA 2XNAC 3KQ4A 1RFKA 1TY2A 4EE2A 2D5GA 2LHEA 3SFDB 3SEBA 1FNVA 1VRAB 3I9V1 4N6EB 1HZ5A 1OFFA 1SB3C 4LLGM 4RCOA 2RMMA 1CK1A 1ET6A 1E6EB 1N60A 1L0XB 1QOFA 1D5XC 2CJNA 2PLPA 2INPE 2BB6A 4RFBA 4NZLB 1J7BA 4KX6B 3VR8B 1GPXA 2K22A 4DQOC 3Q8BA 4YSXB 4JE3B 1Y56A 3E9SA 1ACCA 4XDCA 3EUB2 3BVZA 3MFGA 2IDYA 4DXFA 1N5WA 3T3OA 3Q8EA 1YNTE 4ITKA 2BS2B 1XCQL 1WRIA 2GI9A 1WYGA 3NRZA 5EE1A 4US9A 2RDGA 1PUTA 2KN4A 2FBWB 1TYGB 1JQ4A 3AV8A 5H92C 1VDVA 1QLBB 2EKIA 5G5GA 1MHXA 3AEGB 3Q8CA 3O13A 1F2RC 2M56B 3R2IA 3DWMA 1QOAA 5BYQA 4D2KA 3NVYA 3FILA 1MI0A 2W54A 2DWQA 1YN4A 1FO4A 2IPKD 3IAS1 3AMZA 4O1NA 3N9YC 1TZOA 1AYFA 1TS3A 4A8XC 2BB5A 1C77A 1KTKA 4A55A 2DYOA 2VZKD 4C80A 1XF5L 3PO0A 3ZJVA 3H8HA 5H8YE 2R61A 2CU3A 1DGJA 1V1PA 2GB1A 4LTUA 3VRBB 1EWYC 1JWMD 1XCTL 2PMVA 3IT4B 4XWWA 3AN1A 4WH4A 5HFYA 2YEPF 2BYTA 4YTNB 1XEEA 1FCCC 4GDLB 1XLOA 1F77A 5HG2A 4A90A 1I7HA 4B0EA 3MHZA 1QT9A 1N62A 1QKZA 3T3NA 2WXHA 2K3UA 4HKQA 4KGTA 2K9XA 2MH7A 3VRAB 4C7YA 2L1AA 4WURA 3U7ZA 1I4XA 1I4RA 3AE4B 2LJIA 1NEKB 2J53A 1P7EA 2E3TA 2PIAA 4IDIA 3Q8AA 4AQ7A 1UGJA 1YJIA 2J42A 3P4SB 1DOIA 1KLGD 1QF6A 1JWBD 1SE3A 2WXNA 1KLUD 4JWUC 3L4PA 1EU4A 2WXJA 3AEAB 3HVDA 1FNUA 1SEBD 5FR3A 3AE2B 2ZW1A 3FC4A 1EM7A 2DBYA 4MT5A 3U52E 3Q8FA 3LB8C 1I4QA 5GXGB 2EELA 2KDMA 4P16A 3BYTB 2V3PA 2WQYB 2IGDA 1L6UA 1ZP0B 2JQRB 3ZQ4A 2KAJA 3W5UB 1T5XD 3P63A 4ARCA 1L5PA 2V4IB 1VJKA 2WXPA 5G5HA 3W9CB 1YN3A 2WXLA 1D5ZC 1RM6C 1SJHD 2B76B 1IBXA 3AEEB 1ZDVA 2AQ1B 3GP7A 4M0WA 1PGAA 4YT0B 1HEZE 1JWUD 2MJEA 2OHFA 2SEBD 1QQRA 1I4PA 1XLQA 2PVGC 1N63A 2K0PA 4MACA 3TEYA 3NUHB 3B9JA 2M19A 1V97A 3AEFB 1D6EC 1HXYD 1NVID 2V3NA 3ETRA 3AH7A 2W3RA 1IGCA 1XO3A 1NI3A 1C76A 4RGOS 5EE0A 1NYQA 2IJ0A 3HVZA 5BYRA 4RF0A 1Q10A 1HA5A 3BIID 1FFVA 1E9MA 2G1EA 1VZ6A 4YSZB 1CJEA 1B1ZA 2JSVX 4XWTA 2LFIA 5I4DA 2FUG1 1JROA 2BS4B 3P4PB 3SFEB 1FXAA 2SAKA 3KWLA 4ARIA 1K50A 1SBBB 4OZAA 2LEKA 2QEJC 4KGRA 4IOIE 3J9CA 5D3DA 5BMGA 1SJED 1F2RI 3AEDB 1I4HA 1QOGA 2JX5A 4NJCA 1SSNA 5JXVA 2WXOA 3R2TA 4HKZE 5BMHA 1KF6B 1VR9A 3WCQA 1DOYA 1EWCA 2AQ2B 2ACZB 2J4XA 1YN5A 3IT6B 4PT5A 1I4GA 2X38A 4YXDB 3URYA 2BBCA 3NVZA 2H89B 4OZCA 3I57A 4YSYB 2WXQA 1PFDA 3AE1B 2YEPB 2E6XA 1AN8A 3W1SA 2ONQA 2VZKB 1D4BA 1A70A 4HROA 2J52A 3AE3B 2WLBA 3BVGA 5C3JB 1SF0A 1XLNA 4YTMB 2L83A 3B2FA 3GS2A 4UDUC 2AQ3B 1PDXA 1STEA 4ZHPA 4NAMA 4OVZA 1JWAD 2HTME 3ABVB 1L4DB 1BUIC 1K53A 4WIPA 1YQ4B 2DYMA 1J7CA 4N58A 4NAWB 1VZ8A 1TS5A 1T3QA 2KACA 4TSSA 2K5PA 2TSSA 4RF1A 4DXGA 4JX1C 3MP9A 4ZOHC 5D7GA 2I2YA 1UWXA 2QJLA 1E10A 1SXTA 3LYYA 3IAM1 5EE3A 1JMLA 1CQVA 1PGXA 3PZ7A 4OW0A 4A9AA 2BT6A 1WSPA 4YWGG 2WU2B 3U4EG 1B9RA 4KKIA 3OWEB 4MH8A 5T8IA 2INNE 2WXIA 1CZPA 5MPOA 1IUEA 2PKOA 1AW7A 1FFUA 3CWIA 2NMQA 1ET9A 1JALA 3TEXA 1FEHA 1ESFA 1TS4A 2QIEB 2JU6X 3KLSX 1ZDXA 2V0GA 5C2TB 1XLPA 2L32A 1PYWD 3AM9A 4Q2JA 2GRIA 1MHHE 5TSSA 3V3XA 2LGIA 1J7AA 2JXTA 4C56C 3LXFA 4RH6A 2MJDA 1KH0A 4KKJA 1JW9D 1TS2A 3AE8B 5BYSA 3RFZB 4US8A 2PVOD 2RDHA 1L4ZB 2MJ3A 2LMCA 1TKYA 1QILA 2JZPA 4OZBA 1GB1A 3B2GA 3FILB 1D5MC 3AE7B 3NS1A 4HRSA 1FXIA 3W2DA 1PGBA 1QOBA 2JYEA 4MM3B 2QSDA 2PW9A 1OQRA 1E0ZA 3BVMA 2NTSA 2WU5B 2Q5WD 2Y3AA 1V1OA 2WXRA 1V1PB 2MEKA 2WDRB 1AWDA 1F0ZA 2QILA 1C78A 4L2YA 5FKAC 4TMAB 3AE6B 4A6QA 1P7FA 5AUKA 4J3OD 2IGGA 1ROEA 3Q69A 3RPFC 1C4PA 4R3DA 2OEDA 4C7ZA 4RGTA 1FMAD 1ZPSA 1ZOYB 2W82A 1FIQA 1N61A 1WXQA 2ON8A 1UWMA 4OHJA 4ZRPA 5HHDG 2KWDA 1ZXIA 3U2SC 4WAFA 1YMHE 1MPEA 1L0YB 2N0SB 4HEA1 3CIRB 3NVVA 3NVWA 4REZA 2IGHA 2HDEA 5E6JA 3AE9B 4CQNA 1OQQA 5AUIA 3P4RB 2M0AA 1SIJA 3GB1A 2WDVB 3UI3A 2AX5A 3VR9B 4P6VF 2L52A 1KRHA 3TEZA 4GLSC 1C79A 3ZYYX 2W55A 1FD6A 2FE8A 2N7JA 1YJJA 3BK2A 1IGDA 1SE2A 1TY0A 2CJOA 3PZ8A 4LK0M 4B0MA 4YTPB 1RYJA 3EA6A 2PTLA 1HQRD 4TQ0A 2ZW0A 1MVKA 4HJGE 3V05A 1C4AA 1GAQB 2W3SA 3ZJTA 2WXFA 4RGNA 3DWGC 2WXMA 1EU3A 2N9KA 1BMLC 3P42A 2QMTA 3IXSA 2BS3B 3P1MA 1UUPA 5LNK1 1IBXB 2ICIA 4N59A 1C4CA 3C8YA 4AS1A 1FRRA 2G9HD 3NZ3A 1M4VA 1FCLA 1TKGA 2NTTA 1GB4A 4TQ1A 1FRDA 3SR6A 3MC0B 3KWVA 1JCKB 3HRDD 1NYRA 1TJEA 1DOXA 2RPVA 2KMMA 4XE0A 4USAA 1TKEA 3BYYB 3P4QB 2WDQB 1ZUD2 2WXKA 2KQ4X 2Z8LA 1NENB 4L1BA 3VQIA 2DLBA 3ZJUA 1VLBA 1KFYB 3BK1A 3HUIA 3AB5A 1ZE3D 5HI1A 1SE4A 4ZYSA 4H2AA 4L23A 1XXGA 1HZ6A 2LHDA 2N9LA 1WGKA 3TUOA 4ZHOA 2BTEA 2LUMA 1YQ3B 1R7SA 1BXTA 3MJ5A 1C9FA 3BZDB 1DYQA 1RWSA 1JWSD 4KGSA 3E56A 5FK9C 2BW2A 3TSSA 2Y5CA 2JWUA 4WQMA 4WWMA 5D3IB 3AECB 1FNWA 1K52A 4GDKB 2WNMA 2Y5PA 3R8BA 3W5VB 1JRPA 3TEWA 3AEBB 3ZGZA 5EE9A 1GOZA 4RGMA 2H88B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NVW A;  4IDI A;  1FM0 D;  3FAH A;  1JWA D;  3AE9 B;  2HTM E;  1OQQ A;  1E7P B;  1YJI A;  3ABV B;  3P4S B;  1DOI A;  1L6V A;  1WWT A;  1JWB D;  3P4R B;  5AUI A;  1QF6 A;  1SIJ A;  2WP9 B;  2WDV B;  4JWU C;  1N5X A;  3L4P A;  3AEA B;  2AX5 A;  3AE5 B;  3VR9 B;  1YQ4 B;  1L0V B;  2L52 A;  1KRH A;  4FXC A;  4P6V F;  2WS3 B;  1J7C A;  4N58 A;  4JWS C;  3ZYY X;  1V8C A;  2PIA A;  2W55 A;  3AE2 B;  1T3Q A;  2K5P A;  1YJJ A;  3FC4 A;  1RFK A;  2CJO A;  4JX1 C;  2DBY A;  4ZOH C;  4YTP B;  1RYJ A;  3SFD B;  2QJL A;  3LB8 C;  1E10 A;  4N6E B;  5EE3 A;  1OFF A;  5GXG B;  4A9A A;  2BT6 A;  1SB3 C;  2WU2 B;  1B9R A;  5MPO A;  2WQY B;  1CZP A;  1E6E B;  1IUE A;  1N60 A;  1L6U A;  1ZP0 B;  2PKO A;  1GAQ B;  2W3S A;  1QOF A;  2CJN A;  2JQR B;  1FFU A;  2KAJ A;  3CIR B;  3CWI A;  3W5U B;  1JAL A;  3P63 A;  2QIE B;  1L5P A;  1J7B A;  3DWG C;  4KX6 B;  3VR8 B;  1GPX A;  2K22 A;  1VJK A;  5G5H A;  3W9C B;  2BS3 B;  3P1M A;  1RM6 C;  4YSX B;  2B76 B;  4N59 A;  5C2T B;  1XLP A;  3AEE B;  3EUB 2;  4YT0 B;  1FRR A;  3AM9 A;  2MJE A;  2OHF A;  1J7A A;  1N5W A;  1TKG A;  3LXF A;  4ITK A;  1XLQ A;  2BS2 B;  2MJD A;  2PVG C;  1N63 A;  1WRI A;  3B9J A;  2M19 A;  1FRD A;  1WYG A;  3NRZ A;  5EE1 A;  1V97 A;  4US9 A;  3AEF B;  1NVI D;  1PUT A;  3SR6 A;  2FBW B;  3ETR A;  3AH7 A;  2W3R A;  3HRD D;  1NYR A;  1JW9 D;  1TJE A;  1TYG B;  3AE8 B;  3AV8 A;  5H92 C;  1DOX A;  1JQ4 A;  1VDV A;  1QLB B;  1XO3 A;  5G5G A;  4US8 A;  1NI3 A;  2EKI A;  2PVO D;  3AEG B;  2KMM A;  5EE0 A;  1NYQ A;  3HVZ A;  4USA A;  1TKE A;  2MJ3 A;  2M56 B;  3BII D;  3DWM A;  1FFV A;  1QOA A;  1TKY A;  3P4Q B;  3NVY A;  1E9M A;  1ZUD 2;  2G1E A;  2WDQ B;  3B2G A;  4YSZ B;  1CJE A;  2DWQ A;  2W54 A;  3AE7 B;  3NS1 A;  4HRS A;  1FXI A;  1FO4 A;  1NEN B;  3AMZ A;  1JRO A;  2BS4 B;  3P4P B;  3SFE B;  1VLB A;  1AYF A;  1KFY B;  1QOB A;  3HUI A;  1FXA A;  3AB5 A;  3KWL A;  1OQR A;  1E0Z A;  2WU5 B;  2Q5W D;  2LEK A;  2H88 B;  4C80 A;  3PO0 A;  5H8Y E;  1WGK A;  2CU3 A;  2WDR B;  1DGJ A;  3AED B;  1QOG A;  2JX5 A;  1AWD A;  4LTU A;  3VRB B;  4ZHO A;  1F0Z A;  1PDX A;  1EWY C;  1YQ3 B;  1KF6 B;  3WCQ A;  3AE6 B;  1R7S A;  1DOY A;  3AN1 A;  1RWS A;  5AUK A;  2ACZ B;  1ROE A;  4YTN B;  4YXD B;  3RPF C;  2Y5C A;  4C7Z A;  3NVZ A;  1XLO A;  2H89 B;  1FMA D;  1ZOY B;  1FIQ A;  1N61 A;  1I7H A;  4WQM A;  1WXQ A;  4WWM A;  1PFD A;  4YSY B;  1QT9 A;  1N62 A;  3AE1 B;  3AEC B;  1UWM A;  2K9X A;  3W5V B;  2MH7 A;  1A70 A;  4HRO A;  1JRP A;  1ZXI A;  3VRA B;  4C7Y A;  3AE3 B;  2N0S B;  2WLB A;  3AEB B;  5C3J B;  1SF0 A;  1XLN A;  3AE4 B;  5EE9 A;  4YTM B;  1NEK B;  2L83 A;  3B2F A;  3NVV A;  2E3T A;  4ZHP A; 
#chains in the Genus database with same CATH topology
 5HNK A;  2C60 A;  3ZKJ C;  3FAH A;  2BPG A;  9ICX A;  3L08 A;  2K25 A;  3E0F A;  2WXG A;  4FAD A;  1ZGU B;  2K60 A;  1MC8 A;  4Y2P A;  4HLE A;  2KAN A;  4XDD A;  4R8U B;  4Y2S A;  4UAR A;  4EEN A;  3RR7 A;  3Q8Q B;  9ICK A;  3AE5 B;  2IO0 B;  3AUL A;  4FXC A;  5F9L A;  4R64 A;  4LNN A;  3ICX A;  4JUZ A;  3AL0 B;  3VH3 B;  4PPX A;  3RJI A;  4P7I A;  2M9N A;  4PS3 A;  2F1H A;  1GC7 A;  3RUI B;  2XNA C;  1N2X A;  2MP2 B;  4NPN A;  2KFZ A;  4JMU A;  2VH2 A;  3OJS A;  2BPS A;  3ISD A;  2DHZ A;  3IV6 A;  3I9V 1;  4N6E B;  1BNP A;  1WZ3 A;  3M9N B;  5CRX A;  1X6J A;  4LLG M;  3U7D A;  4RCO A;  3ZRC A;  3KHH A;  2HBL A;  1RG6 A;  3F53 A;  3NHE B;  4Q45 A;  2PLP A;  3EEC A;  2Y0S F;  2UVW A;  4ED0 A;  2INP E;  4S17 A;  5J18 A;  3MBY A;  3RNF C;  3V60 A;  4KX6 B;  3ZI4 A;  3ZUN A;  3NUQ A;  1T3N A;  1C1Y B;  2K8H A;  3VH4 B;  4DQO C;  5KT5 A;  3ZNI D;  1Y56 A;  5D2M B;  4HJK A;  3C21 A;  4J9K A;  1AAR A;  4DXF A;  4MH0 E;  2ES6 A;  8ICR A;  5AI8 A;  4RUA A;  2A19 A;  1BGX T;  1X9X A;  3T5K A;  8ICG A;  1QCK A;  4GXI A;  4ED6 A;  1YNT E;  3N1X C;  3VTU A;  4EEW A;  3V6E B;  2FMQ A;  4US9 A;  1RDF A;  8ICB A;  3I1Y A;  2CXY A;  1V81 A;  2OJR A;  3AV8 A;  4OJ6 A;  3C1Y A;  3MGV A;  4EBD A;  2FLN A;  2RDJ A;  3O13 A;  5KG2 A;  1F2R C;  3V6H A;  1QOA A;  4D2K A;  2F1I A;  4DBG A;  3KOO A;  4Z6C A;  3FIL A;  3ECI A;  4EUT A;  3ML8 A;  2H3F A;  3PY8 A;  2HHU A;  1KRP A;  2V3S A;  4O1N A;  5AM3 A;  3N9Y C;  1TZO A;  2L00 B;  2D8C A;  3OHA A;  4ZRK A;  2V4Q A;  5DLF A;  5L1J A;  1KTK A;  1JRU A;  2VZK D;  1XF5 L;  1WX9 A;  1NZP A;  4TUS A;  4RQ7 A;  3H8H A;  4M8M A;  4HDQ A;  3N1Z C;  1EWY C;  5AI4 A;  2PFN A;  1JWM D;  4HDO A;  2ASD A;  4ZYN A;  3DHI C;  3AEV A;  3EW9 A;  1Z00 B;  1UBQ A;  3UMC A;  3RJF A;  2YEP F;  4MHV A;  3IN5 A;  1GG3 A;  1A0P A;  8ICJ A;  1XLO A;  4GDL B;  2QAR A;  4B0E A;  2GBM A;  1QT9 A;  3JVZ X;  4W9J A;  4HKQ A;  4KGT A;  4I2G A;  2GWS A;  4ASW C;  4C7Y A;  3HKZ C;  3R3M A;  1O03 A;  3AE4 B;  1IYF A;  3EC8 A;  2J53 A;  1P7E A;  2E3T A;  4Y2X A;  2VA3 A;  3Q3M C;  3Q8A A;  1UGJ A;  2KJH B;  1PVQ A;  1YJI A;  3P4S B;  1DOI A;  1KLG D;  1QF6 A;  1JWB D;  4YD2 A;  3C0R B;  2LBO A;  5KG1 A;  1FNU A;  5EDS A;  5GMV A;  2OXO A;  1OGW A;  3Q3O C;  3G6X A;  2PJH A;  3ENE A;  3AE2 B;  3M95 A;  2ZW1 A;  2IO1 B;  3AQF A;  9ICQ A;  4AJY B;  5KFY A;  5D6J B;  2R8I A;  3N20 C;  2E8M A;  3C29 A;  1I4Q A;  2W9C A;  3GZF A;  3PSF A;  4HYK A;  9ICB A;  1ZD5 A;  4R65 A;  4DL5 A;  3SDL C;  3GV8 B;  9ICL A;  1IPG A;  1E7V A;  3PW0 A;  1VJK A;  5G5H A;  2C2R A;  4NM2 A;  2KLG A;  3N32 A;  1RM6 C;  4NY0 A;  3TFS A;  1NKB A;  4M9N A;  2WAQ C;  2EH9 A;  5KFL A;  3AEE B;  1WGG A;  3VTW A;  2C28 A;  2WHI A;  1HEZ E;  1JWU D;  1GUA B;  2KJ5 A;  7ICR A;  1QQR A;  2KMA A;  2MJE A;  4KSL C;  1BVS A;  2EDU A;  5DGB A;  4IQW A;  2DX5 B;  2AGQ A;  5HKH A;  2KNB A;  2JPH A;  5AK6 A;  1N63 A;  3IG8 A;  3TEY A;  4O5K A;  2M19 A;  3ZD9 A;  4JLC A;  4UAW A;  2W3R A;  5J2D A;  4YR3 A;  3UQ2 A;  3GIJ A;  5HP4 A;  1NI3 A;  1C76 A;  1EUV B;  3H6N A;  5BYR A;  3EWA A;  3BII D;  3AI5 A;  3WK6 A;  1FFV A;  4GB9 A;  1WFY A;  2KD0 A;  1VZ6 A;  2C2D A;  2W04 A;  5BO4 B;  5I4D A;  1E90 A;  4XZ4 A;  3E58 A;  2LAS A;  2W7P A;  2DKX A;  3HJE A;  2LJ5 A;  1JRO A;  1SIF A;  2YN4 A;  4Z6F A;  2BS4 B;  3P4P B;  2LGD A;  3SFE B;  5IP4 D;  5KFD A;  2SAK A;  4ARI A;  1XU4 A;  1RQL A;  2LEK A;  2M17 A;  5AI5 A;  4EX6 A;  4BGD A;  3M8S A;  1SJE D;  3QK0 A;  1TBE A;  5ALV A;  1I4H A;  1UGM A;  3M6K A;  3R2T A;  2IO3 B;  1RYU A;  5J2C A;  1M6Y A;  4RPY A;  2XY5 A;  1KF6 B;  1VR9 A;  1DOY A;  1EWC A;  2KJ9 A;  4C8O A;  3ZDT A;  2J4X A;  4ANX A;  9ICN A;  2X38 A;  4AP4 C;  4YD1 A;  2KTF A;  3NVZ A;  4OJL A;  3Q8S B;  4K7U A;  2A4Z A;  2F1J A;  2RDI A;  5JRT A;  4I2H A;  4A20 A;  3W1S A;  1AQ6 A;  1AN8 A;  3N30 A;  2VZK B;  2ZJ5 A;  5H2F U;  5K4L A;  4KLJ A;  2LVP A;  3K4G A;  3IDW A;  3B2F A;  4I29 A;  2KOX A;  1ZQB A;  4DSK A;  2LGY A;  3X0W A;  2LD9 A;  2GLS A;  3ABV B;  3RJG A;  1BUI C;  4EZ6 A;  3WU2 U;  5J0Y A;  2LRU A;  5J8Y C;  4CO7 A;  3GQC A;  3ZDC A;  3UM9 A;  1J7C A;  2EAN A;  1WYW B;  2Z0D B;  3DVN V;  4NAW B;  1TS5 A;  4B95 A;  2R18 A;  2JXX A;  3RB3 A;  3PO4 A;  3RH6 A;  2QJL A;  2E8N A;  1E10 A;  1L8O A;  2YTU A;  3IAM 1;  1PGX A;  1CQV A;  1LB2 B;  2JZB B;  3DEE A;  3U4E G;  2K8C A;  3OWE B;  5T8I A;  4QIW C;  2INN E;  2WXI A;  1KBU A;  5KFX A;  2PKO A;  2XEW A;  1XC9 A;  2ASQ A;  4BKT A;  2DQN B;  2F44 A;  3JPR A;  2KQS A;  2JU6 X;  3QXG A;  3PZP A;  1U45 A;  2LYA A;  3C2L A;  2W9A A;  1ZDX A;  2K8B A;  3IP4 B;  2K6D B;  3PZD A;  1QQ5 A;  9ICP A;  2KNJ A;  1P1A A;  2IMW P;  2XVT A;  4KLI A;  3V3X A;  2JXT A;  2BKR B;  2PFP A;  4C00 A;  4I2F A;  3PHX B;  4IQT A;  2F77 X;  1ZQX A;  4DQS A;  1HUZ A;  9ICR A;  2KSO A;  3WIM A;  5CEH A;  2HCF A;  5HR7 A;  5F9N A;  1X42 A;  2WF9 A;  3B0X A;  4ECU A;  4US8 A;  1BPX A;  4IM3 A;  4XGA B;  3PRM B;  2KTR A;  1CUK A;  3RN9 C;  2GBR A;  1RXV A;  2K4P A;  4F5O A;  2LMC A;  3CYM A;  2KYW A;  1V38 A;  4OZB A;  1L8L A;  2K6Q A;  3CP8 A;  3AE7 B;  3NS1 A;  1FXI A;  5B66 U;  2G45 B;  3WAN A;  4UW9 A;  4K81 A;  4E0D A;  4YXJ A;  4YL8 A;  5KL8 B;  2HHW A;  8ICT A;  4K1R B;  1E0Z A;  1MN8 A;  2Q5W D;  2I9G A;  3LDA A;  2WXR A;  8ICW A;  3TAD A;  3SQI A;  1V1P B;  3RJK A;  3RJJ A;  3GZN I;  5FKA C;  3JPN A;  4EFO A;  4TMA B;  4DWF A;  1Q0W B;  9ICO A;  4UAU A;  3AUO A;  2BCV A;  4JK1 A;  5AUK A;  3V72 A;  4Y2Y A;  5L1M A;  4RQ5 A;  2P6R A;  2IGG A;  4E3C A;  1C4P A;  2KQ7 A;  4JB3 A;  3M63 B;  5B5E U;  4O3S A;  4B9K A;  2DZJ A;  4N9F 4;  3QU9 A;  4FBT A;  4FZM A;  1N61 A;  4WQO B;  1WXQ A;  5ALL A;  1B4F A;  5T14 A;  2ZCC A;  2B3A A;  3PTF C;  2ON8 A;  3D32 A;  2Y5B B;  4ZRP A;  4NM1 A;  2AL3 A;  5LXH A;  2XCP A;  4WAF A;  1MPE A;  5AKY A;  4KLD A;  5KFN A;  2WTF A;  5DGA A;  1JXE A;  1Q5W B;  3HPO A;  3H4D A;  4UB2 A;  1J0G A;  2M0A A;  2IHM A;  4NLB A;  3UI3 A;  1XSN A;  5AZF A;  2AX5 A;  4O3M A;  3VR9 B;  1J19 A;  4P6V F;  2GBK A;  3PML A;  5JHA A;  1UA1 A;  1RXW A;  3GOE A;  2ZIU A;  5AKG A;  5AIB A;  1TY0 A;  4MJS B;  3PZ8 A;  5C23 A;  4F8C B;  3RF9 A;  4B0M A;  4DF4 A;  3SMV A;  2RD0 A;  4FJY A;  2DUY A;  4WJO A;  4Y2V A;  4EEL A;  5KFP A;  2O2V A;  3PX0 A;  5ALZ A;  5A0L A;  2KN7 A;  5HHI A;  2BGF A;  7ICE A;  1YZ6 A;  4NJ7 A;  1GAQ B;  3ZJT A;  4B6J A;  5J2I A;  2YMM A;  3V62 A;  3MDC A;  4M0W B;  4LJX A;  1TV9 A;  5ALD A;  4P0Q B;  3WK4 A;  3VUW A;  3NZ3 A;  2FMP A;  4F92 B;  5AIC A;  2IO2 B;  1GB4 A;  4XUS A;  1ZET A;  3RI7 C;  2WYQ A;  2MU2 A;  1ZYQ A;  3QQ8 B;  1KFS A;  1SWW A;  8ICE A;  1ZQZ A;  8ICH A;  1XSP A;  2L7R A;  2LGS A;  2XK5 B;  3KWV A;  5C0Y A;  5CHG A;  1T94 A;  1ZD4 A;  3PW7 A;  4M9L A;  3L54 A;  1WIA A;  2ZPY A;  4LNI A;  2RPV A;  3C5F A;  2KMM A;  4XE0 A;  3SD5 A;  2KVC A;  5CHF A;  1DXS A;  4KLQ A;  3DBH B;  2H3Q A;  2UVU A;  2WDQ B;  1GO3 F;  2WDT B;  1BPY A;  1R4M I;  2KQ4 X;  1ZQF A;  2Z8L A;  4IG7 B;  2D3G A;  1PK1 B;  5JTI A;  5AM1 A;  2KDI A;  3VQI A;  2DPJ A;  2H3Z A;  4EX7 A;  4LJO B;  1KFY B;  1R4N I;  4IUM B;  3PVX A;  4EEY A;  5TIS U;  4HPM B;  3N7R C;  3L0W B;  4J9R A;  4QWE A;  2KKC A;  2LHD A;  3RNE C;  1WGK A;  4P0P B;  4F4Z A;  2BTE A;  1UA0 A;  1V49 A;  3BS5 B;  9ICM A;  2HBM A;  5JUM A;  2LUM A;  4J9L A;  4LNK A;  2JRH A;  1WE7 A;  1S3S G;  2KJR A;  3NTU A;  2OJW A;  3BZD B;  1RWS A;  4MGY E;  2M8S A;  1JWS D;  3VFK A;  4PZO A;  2BW2 A;  3CSF A;  4WJP A;  1ED1 A;  2W9B B;  2V4L A;  1LKY A;  4WQM A;  2BGW A;  4PYZ A;  3RB6 A;  4IC9 A;  3BQ2 A;  1L3S A;  2J6U A;  4K3C A;  5J0W A;  2IHN A;  1FNW A;  3ZXV A;  4EOY A;  3H9D A;  3W5V B;  3UQA A;  1E8X A;  4EKU A;  3ZVV A;  1A77 A;  1T0Y A;  8ICX A;  4FJZ A;  4RGM A;  2D3D A;  3KHR A;  1PZN A;  2FUH B;  2L5Y A;  1E7P B;  4QZG A;  3AQE A;  1L7O A;  4TUR A;  2JF5 A;  2WP9 B;  2JEJ A;  1WRD B;  1BPB A;  1ZXH A;  3B0A A;  5BMI A;  4WJQ A;  3PT2 B;  2KVR A;  1HE8 A;  2K4E A;  3D2S A;  1V8C A;  4PHA A;  4R63 A;  3A1Q B;  3BIN A;  3KQ4 A;  2RHF A;  1S9F A;  3B0Y A;  4MGZ E;  2DPI A;  3GFK B;  4HCP B;  1P0R A;  3MHS D;  3ZNZ B;  5ALW A;  2IYD B;  1L2N A;  1SB3 C;  1UCV A;  1RYR A;  4AYB F;  1N60 A;  5J0P A;  1L0X B;  2LUE A;  2X8X X;  3D2Q A;  3CNH A;  1RRB A;  4Q43 A;  2N9X A;  2INC C;  1M94 A;  4F2S A;  4XRH A;  4RQ1 A;  2CS4 A;  4RFB A;  3VR8 B;  3BQT A;  5ALQ A;  4GGQ A;  4QZI A;  2B21 A;  3N1Y C;  3Q8B A;  2AJQ A;  1TK8 A;  3C2M A;  4FHJ A;  2EAM A;  1ZKH A;  3EUB 2;  3BVZ A;  3N7S C;  3MFG A;  2IDY A;  1MQ2 A;  2FPM A;  4W9K A;  2BS2 B;  5DB7 A;  1XCQ L;  2DNF A;  5AKK A;  1WRI A;  2GI9 A;  4MAC A;  5EE1 A;  1NK6 A;  4PGQ A;  7ICJ A;  2PE6 B;  1PUT A;  1MA7 A;  2LHT A;  2KIC A;  4UBB A;  2Y1I A;  4LCD E;  5H92 C;  3AEG B;  5KT4 A;  4W9I A;  4NLG A;  2HW3 A;  3E2E A;  3TCA A;  5BOL A;  1CI4 A;  3DWM A;  5BYQ A;  2ZIW A;  1N48 A;  4J9Q A;  4KVG B;  2LVO A;  2JH1 A;  1MI0 A;  4MFA A;  3JSV A;  4YMO A;  1WMH B;  1QQ7 A;  1YN4 A;  4OCZ A;  1FO4 A;  2NYV A;  1WR6 E;  1WM2 A;  2IPK D;  5HR6 A;  3IAS 1;  4C8L A;  1OEY A;  1AYF A;  1EO6 A;  4PYU A;  4IM2 A;  4MM3 A;  5J0U A;  1ZRM A;  4A8X C;  2BB5 A;  1S0M A;  3V7J A;  5IIJ A;  2DYO A;  5AZH A;  3ORY A;  1DK2 A;  3PO0 A;  3ZJV A;  3UMG A;  1B0X A;  5AM5 A;  5H8Y E;  2MAX A;  1IXR A;  4LTU A;  2OWO A;  4QNL A;  1H4R A;  4ACO A;  1WUD A;  3JYU A;  3IT4 B;  3RNA C;  3AN1 A;  4EBE A;  3WKE A;  1L3V A;  4BXO A;  1WR1 A;  4WWN A;  3W1S C;  3ZO5 B;  2BYT A;  2KHV A;  2ZJD A;  1XD3 B;  2JT4 B;  1XEE A;  3MTN B;  8ICI A;  2PKE A;  3JPP A;  1LGR A;  3MC9 A;  4IM0 A;  1F77 A;  3HHM A;  5HG2 A;  4DSF A;  1V86 A;  4QWA A;  2LRW A;  4A90 A;  3CRX A;  1I7H A;  2W8K A;  3A9J A;  3MHZ A;  1N62 A;  2K3U A;  2HOQ A;  1UEL A;  1P98 A;  3JPQ A;  2BYV E;  2MH7 A;  3IBE A;  3VRA B;  4WUR A;  4PZN A;  2QCZ A;  4QWC A;  2G4S A;  4G0N B;  2LJI A;  4ECS A;  2N7E A;  1H8C A;  7ICM A;  2PIA A;  2K4I A;  1BPD A;  1KLN A;  5KFT A;  4IDI A;  4AQ7 A;  3H8W A;  3SU8 X;  1KLU D;  2MUT B;  3V7L A;  2PMZ F;  3U26 A;  2ZTC A;  3T3F A;  1SEB D;  3QJZ A;  3KFU F;  4C4T A;  4DS5 A;  3KYD D;  3D2N A;  1KM7 A;  1VCB A;  2FCQ A;  5IKC M;  3QE9 Y;  3M7D A;  1KDH A;  2NRT A;  1EM7 A;  4MT5 A;  3LB8 C;  1RYS A;  3QU7 A;  3RAX A;  1D9F A;  2EKE C;  2EEL A;  1ZQP A;  2VA2 A;  1HTO A;  3BYT B;  2KG5 A;  4CRX A;  4WJ3 B;  3SAG A;  2AWT A;  4FUL A;  1LVH A;  2V9H A;  4UAV A;  1Q46 A;  4TQR A;  3RTV A;  1CMX B;  2MQJ A;  5DPW A;  2L3Z A;  3ZQ4 A;  3W5U B;  2VA8 A;  5J2B A;  4QZ8 A;  2WF8 A;  3MR2 A;  2L8J A;  4KLM A;  5IIO A;  1ZQG A;  3UGB B;  4F50 A;  1E8Y A;  4EEK A;  2WXP A;  1D5Z C;  3AU5 A;  3ZDM C;  4C4S A;  4J9P A;  2I1Q A;  2AQ1 B;  2BCU A;  2SEB D;  4UB5 A;  2A1J B;  2JXJ A;  5KFQ A;  3Q3N C;  3TJP A;  3T9L A;  3GIM A;  2LWP A;  1F0M A;  3QIJ A;  1UT5 A;  2UVR A;  1WXS A;  2PVG C;  5C5J A;  1PUZ A;  5J2E A;  3MGI A;  3A9K A;  3NUH B;  4F1S A;  2KP7 A;  1P7D A;  3AEF B;  1WXM A;  3F2D A;  3IVF A;  3ETR A;  2K39 A;  2EAO A;  4PJ0 U;  4HWI B;  4MGI E;  4PHE A;  2KLC A;  4OD0 A;  4RGO S;  3UQ0 A;  2IJ0 A;  2BZF A;  4OJ5 A;  1Q10 A;  1HJP A;  4QW9 A;  3PV1 A;  4G11 A;  2YX8 A;  4DL7 A;  1E9M A;  1EF5 A;  2CU1 A;  2QAR B;  5D4B A;  4YN4 A;  2JSV X;  4QAY A;  3TFR A;  2FUG 1;  3IHQ B;  3TAD C;  4HPP A;  1TAQ A;  4UB4 A;  4CYE A;  1UF0 A;  4F91 B;  3ZTD A;  3H7P A;  4C4V B;  1SBB B;  4RM9 A;  3HKZ F;  3MC8 A;  1TZ1 A;  4IOI E;  2KZM A;  1ZQK A;  5BMG A;  3EYZ A;  1WJU A;  4ACF A;  3K1Z A;  5IO9 A;  1KEJ A;  2D3C A;  3AED B;  2AQ0 A;  2JX5 A;  3CF6 E;  4NJC A;  4DSE A;  2WHE A;  4DEZ A;  3WCQ A;  4PL2 A;  5ALS A;  1YN5 A;  5IIK A;  4G3I A;  1Q8K A;  1JXL A;  5JH5 C;  2KVZ A;  3I57 A;  4KN7 A;  4YQW A;  4ELV A;  2E6X A;  2ONQ A;  1C3T A;  3SEI A;  4GDK A;  2BF8 B;  2J52 A;  5KFF A;  3TAQ A;  1WXA A;  4RQ6 A;  1TAM A;  5CWR A;  1SF0 A;  3B1L X;  4YTM B;  3GS2 A;  4UDU C;  4I27 A;  4FS1 A;  4ZHP A;  3GE8 C;  3QHT A;  1E8Z A;  3A0H U;  2HTM E;  2MA9 B;  4ECX A;  4PS7 A;  4KTQ A;  1L4D B;  4DXA B;  3MR5 A;  3H7S A;  3SD7 A;  4UB6 U;  2A3V A;  4MFC A;  3K75 D;  4FA6 A;  4R8U A;  3QAR A;  4NV0 A;  1SL0 A;  2DYM A;  4N58 A;  5DQH A;  2C9W B;  1T3Q A;  2KAC A;  3H40 A;  4I6L B;  4TSS A;  4RF1 A;  5AEK B;  1S8O A;  3KBB A;  5D7G A;  2MP2 A;  2RLT A;  2FCS A;  1NK5 A;  3WK8 A;  3QUC A;  2H3V A;  1SXT A;  4OW0 A;  5L83 A;  4LJP B;  3H1U A;  5III A;  1SKW A;  2WU2 B;  2M0N A;  5KL1 B;  4RNN A;  1U49 A;  4MH8 A;  4NJ8 A;  4F4K A;  4B9M A;  2QB0 B;  2CHZ A;  1U47 A;  2MW5 A;  1HEK A;  2Y0S C;  2PFO A;  1AW7 A;  2PXI A;  1ET9 A;  4QW8 A;  3TEX A;  1FEH A;  3PR5 B;  2QIE B;  4BBN F;  3UXO A;  1PVP A;  5AHX A;  2ISP A;  3PW2 A;  5IAA C;  4DOB A;  1F44 A;  2FIF A;  3TAP A;  3DQV A;  3V6K A;  2HJ1 A;  2L32 A;  4LZG A;  2C5L C;  4GXK A;  5ALF A;  2NBU A;  2LGI A;  3JW0 X;  4P4M A;  2BQR A;  4FZN A;  1ZQQ A;  2CRX A;  2CR5 A;  3LXF A;  4IWQ A;  4B9U A;  2PE9 A;  3LVW A;  8ICP A;  3WA0 A;  3M62 B;  4W9C A;  1MG4 A;  3QC8 B;  4KKJ A;  2R8J A;  1EF1 A;  2LI5 A;  3PS6 A;  2YVC A;  1TS2 A;  2IOF A;  3AE8 B;  3UXP A;  2RR9 A;  5AIA A;  5C1Z A;  2UU7 A;  1C20 A;  2E8O A;  3OJU A;  3T5L A;  3RT3 B;  4P1B C;  3H7I A;  3PR4 A;  1N56 A;  5G55 A;  1GJZ A;  3NZU A;  4FS2 A;  2NRZ A;  2FLL A;  1NJX A;  4HRS A;  4NWI A;  1PGB A;  1HUO A;  2UYZ B;  2JYE A;  3EFU A;  4GC6 A;  2PW9 A;  4MSQ B;  3W1Y A;  3A33 B;  4Y2Q A;  2UVV A;  4KIK A;  3SYZ A;  4LVS A;  8ICN A;  1VD2 A;  2MX2 A;  2MEK A;  5KFS A;  2WDR B;  4Q44 A;  1AWD A;  4II3 B;  1F0Z A;  1NNL A;  2QIL A;  1C78 A;  4L2Y A;  4QWB A;  1Q3U A;  1ZQR A;  3KD3 A;  2HHX A;  1Z00 A;  4F5R A;  3TQ1 A;  5CJ7 A;  1ROE A;  4RM8 A;  3UF8 A;  3GU3 A;  3QCA A;  1SKR A;  4GDL A;  2W82 A;  3TBL D;  1FIQ A;  4M01 A;  5AM4 A;  2KEY A;  3V61 A;  4DLG A;  4BVU C;  3R66 C;  4DSJ A;  1HIW A;  5HHD G;  3TIX A;  2MBO A;  1ZXI A;  5DG7 A;  3U2S C;  4HEA 1;  1COO A;  4ECY A;  3WK7 A;  3SI8 A;  3FYH A;  1KW4 A;  1K8R B;  2EZX A;  4PS8 A;  5DCN A;  4ECZ A;  2DF4 B;  4BOZ B;  2KD1 A;  7ICU A;  2KC1 A;  2KMD A;  3GII A;  3AE9 B;  4TKN A;  2LXC A;  1NK9 A;  4CQN A;  2KMC A;  3P4R B;  1SIJ A;  3NY5 A;  2NPT B;  4IL6 U;  1UD7 A;  4BKS D;  1T4G A;  1KRH A;  3TEZ A;  2DZI A;  3RNC C;  5J0T A;  3QA8 A;  4GLS C;  4F72 A;  2BPF A;  3ZYY X;  4P4O A;  4RUC A;  2EZZ A;  3V7K A;  1F1H A;  3CMM B;  2KFK A;  4EZL A;  3BK2 A;  1FD6 A;  1IGD A;  1SE2 A;  3B08 A;  4S0R A;  4LNO A;  3EA6 A;  4RQ8 A;  3UIP B;  4DS4 A;  1U9L A;  2ZCB A;  2GOW A;  1HQR D;  4F93 B;  5J2A A;  3EPG A;  1KFT A;  3DCG A;  1OQY A;  1Z4N A;  2C2E A;  2ZW0 A;  3KKA C;  2EZY A;  4UAZ A;  5KG0 A;  1MVK A;  4YXM A;  4KZC A;  2N1W A;  1IP9 A;  1G6J A;  4RQ0 A;  1X6I A;  1WJN A;  4C0Z A;  1C4A A;  2JZZ A;  2KDB A;  2W3S A;  2NVU I;  3KW5 B;  1T0Q C;  3FDS A;  3DWG C;  4ZH4 A;  5D46 A;  2VH1 A;  1UT8 A;  4NJ6 A;  3IXS A;  3T5J A;  2FNJ B;  1IBX B;  1S0N A;  3DBL I;  4BOS C;  3C8Y A;  3IG3 A;  3PST A;  1KLV A;  2XCA A;  4MEM A;  1YX5 B;  2G9H D;  4ED8 A;  2WF5 A;  4KX5 A;  2KKV A;  1TKG A;  3RB0 A;  2DKZ A;  3RB4 A;  2W43 A;  4I2A A;  2NTT A;  4TQ1 A;  5KT6 A;  3UMB A;  4BDP A;  4BX9 C;  4PHD A;  1NYR A;  1S77 D;  3BS7 A;  3ZNG C;  1DOX A;  4KX3 A;  2ZVN A;  4P4P A;  3RRH A;  9ICF A;  1LV5 A;  5KG3 A;  3PNC A;  2WXK A;  2M4N A;  2QLT A;  4Y2U A;  4OJP A;  3GDX A;  2L0T A;  5DG8 A;  1TTN A;  4GIB A;  2BQ3 A;  2QB1 A;  1V80 A;  5IOI A;  2K8A A;  1NEN B;  2KC2 A;  1X66 A;  3GIL A;  1VLB A;  3L10 B;  3HUI A;  3PRE A;  3OTQ A;  1ZE3 D;  4RU9 A;  3HIZ A;  5HI1 A;  4O5C A;  7ICP A;  3LWM A;  1SE4 A;  2MHJ A;  4ZYS A;  3KHG A;  4L23 A;  3Q8K A;  2N9L A;  3L16 A;  1LXD A;  3TUO A;  4ZHO A;  2XID A;  3BDP A;  1YQ3 B;  4DO9 A;  3MJ5 A;  1DYQ A;  4NQL B;  3C19 A;  5FK9 C;  2Y5C A;  4KMO B;  2HE7 A;  7ICN A;  1YT3 A;  2MCN B;  2A5U A;  1WJ6 A;  5KFR A;  3RZF A;  1SV0 A;  1WF9 A;  1X2I A;  5F3X B;  4IRK A;  1TFR A;  4KIT B;  3N7P D;  4CCH A;  1K52 A;  4DFM A;  2WNM A;  5DG9 A;  4XQ8 A;  1JRP A;  3PSE B;  1DK3 A;  3TEW A;  3AEB B;  2LPE A;  4I2D A;  4EZ9 A;  3ZGZ A;  3QX1 A;  2H88 B;  5D94 A;  3V6J A;  3JPT A;  4XA5 A;  4DL4 A;  1UNS A;  3VAW A;  1FM0 D;  3ISC A;  2DYB A;  4IKG A;  2I38 A;  7ICQ A;  5AM2 A;  4JWM A;  2HHT A;  1L6V A;  1WWT A;  3A0B U;  3KTQ A;  4JPS A;  2D07 B;  4RNM A;  1N5X A;  1L0V B;  1XS9 D;  3EGR A;  5DBA A;  3PV8 A;  2WS3 B;  1WGD A;  3F5A A;  1LO5 D;  2JYT A;  3L3F X;  4JWS C;  4K3B A;  1KN5 A;  4OO1 J;  1IG6 A;  4NAW A;  1RFK A;  4KLL A;  4RT3 A;  1TY2 A;  4M47 A;  2EMS A;  3ZTC A;  4EE2 A;  5KAI U;  3SFD B;  3SEB A;  8ICS A;  1VRA B;  2O6V D;  5LXI B;  2YMQ A;  2E8P A;  4HK2 A;  2JZB A;  4XYC A;  4YG2 A;  3GIK A;  2VRR B;  2LI6 A;  4P1C C;  2VAN A;  4M9J A;  2F2A B;  1ET6 A;  3QEB Z;  4K4I A;  2D3A A;  2KDF B;  1D5X C;  3Q6B A;  2HI0 A;  1IM4 A;  2HDO A;  1QZE A;  1J7B A;  4GU2 A;  1GPX A;  5KAF U;  1RZT A;  1GNU A;  4JE3 B;  4O9M A;  2F8K A;  3MGH A;  3E9S A;  3HIL A;  1V6E A;  4K7W A;  4NY8 A;  5E6N A;  4I2J A;  5AM0 A;  1LQB A;  4F5P A;  1QLN A;  2HHQ A;  1WJ4 A;  1SXD A;  3QU5 A;  1N5W A;  5DB8 A;  2NRV A;  4C4R A;  3Q8E A;  3T3O A;  1RQN A;  4TV3 A;  1V9P A;  1FEZ A;  3OGU A;  8ICZ A;  5IIN A;  1F5S A;  3NRZ A;  3ISB A;  2RP5 A;  2RDG A;  5L1L A;  1BPE A;  3H8M A;  1L5U A;  4CGZ A;  1HTQ A;  4KLO A;  5BOM A;  4F4W A;  1TYG B;  4O3N A;  1JQ4 A;  1L7P A;  3L13 A;  1MHX A;  3Q8C A;  1YX6 B;  1XWL A;  2G5I B;  2ZNV C;  4YR0 A;  4YMM A;  1Z2M A;  4Z6E A;  2M56 B;  4J9M A;  3PO5 A;  5CX3 A;  4ANU A;  5KT7 A;  3ONS A;  2MWS B;  3NVY A;  9ICE A;  4IWO A;  1K1Q A;  3IFW B;  2MBB B;  4BJQ A;  1WWU A;  4G50 A;  5KG4 A;  3AMZ A;  4UAY A;  1KFD A;  4BZA A;  4DOC A;  4UQG A;  3KVF B;  3VC8 A;  3FKY A;  3C2K A;  1TS3 A;  4M0A A;  1C77 A;  5FP0 A;  1MQ3 A;  2J6T A;  1XSL A;  2J0K A;  3EHV A;  1ECW A;  3KUC B;  2CU3 A;  5KFM A;  1V1P A;  4ELT A;  1MFW A;  2GB1 A;  3BQ0 A;  4WWP A;  3VRB B;  2GBN A;  3TKA A;  2PMV A;  3KUZ A;  4MEL A;  1F9J A;  3K1R B;  4HAI A;  3S6J A;  2JEG A;  1ZQT A;  5HFY A;  3RH4 A;  1JUD A;  4F5N A;  2K89 A;  5DB9 A;  4WWO A;  3VCB A;  1QKZ A;  3T3N A;  2WXH A;  5AI6 A;  2BQU A;  5DQG A;  1GOZ A;  2K9X A;  2JVC A;  4FZL A;  2L1A A;  4DOA A;  3U7Z A;  3MR6 A;  1E5W A;  4NL9 A;  1I4X A;  1S0O A;  1I4R A;  2C7N B;  4B6W A;  2Y1J A;  4P2H A;  5GTH U;  5TZV A;  3FM9 A;  4EZJ A;  1EXN A;  3HW8 A;  5E6O A;  2MRP A;  2BCR A;  1SE3 A;  2Y9U A;  4A8E A;  1NJZ A;  2WXN A;  4JWU C;  3L4P A;  2WXJ A;  3HVD A;  4MEX A;  2JHD A;  3I5J C;  5FR3 A;  2HVH A;  3PLV A;  1PVR A;  4JGH B;  2KK0 A;  4MF8 A;  5ALJ A;  1FXT B;  3IG5 A;  3FC4 A;  1XT9 B;  5EWG A;  4UBC A;  2E1E A;  4MJS A;  1YD8 U;  5CTR C;  3U52 E;  2XGP A;  5CHV C;  3ZDA A;  1ZW7 A;  1J8C A;  2ZIX B;  5HHH A;  5GXG B;  3QU2 A;  2R8G A;  2KDM A;  4YVZ A;  2G5H B;  4Q8E A;  2ZXI A;  1FPY A;  2V3P A;  2WX1 A;  4UAT A;  1L6U A;  1ZP0 B;  2ZIV B;  4ED2 A;  4FBU A;  2KAJ A;  1ZQL A;  1T5X D;  1QTM A;  3P63 A;  2KHQ A;  3KH0 A;  5TR5 A;  2V4I B;  4K4G A;  8ICM A;  3DV9 A;  8ICK A;  4EBC A;  2KT7 A;  2CN1 A;  2XO7 A;  2WXL A;  3W9C B;  4QWD A;  4C8N A;  1SJH D;  2HOI A;  4QZF A;  4F2R A;  2JUO A;  3DBR B;  3DDC B;  3VVW B;  4M0W A;  2W9N A;  3F2C A;  4ED7 A;  2O6V B;  4P0Q A;  3RBE A;  2P66 A;  2JY6 A;  7ICG A;  4BUG A;  3M9M B;  3OSP A;  4M6W B;  3Q8L A;  2FJ6 A;  2K0P A;  2ZUD A;  3DDH A;  4O3R A;  4EYI B;  1D6E C;  2HSZ A;  1HXY D;  2GH1 A;  1L7Y A;  1WM3 A;  4QZH A;  2Y9T A;  4BXO B;  1XO3 A;  4GOC A;  2BKF A;  5EE0 A;  3ZDB A;  1NYQ A;  4RF0 A;  4M2Y A;  4KV2 A;  1BNO A;  1HA5 A;  2BCS A;  2G1E A;  4AP9 A;  3BZK A;  4I28 A;  4B9N A;  1QQ6 A;  3WAM A;  1B1Z A;  3PLU A;  3DHG C;  2LFI A;  1V85 A;  2WB1 C;  4B9V A;  5DBC A;  2OYY A;  1PK1 A;  5KT2 A;  5G2N A;  3KWL A;  4KMU A;  2KX0 A;  4KGR A;  3M1Y A;  3J9C A;  2HTH A;  3VUX A;  8ICF A;  3RNB C;  4ICV A;  2I1K A;  5AI9 A;  5ALM A;  4M04 A;  3C28 A;  4P0P A;  4YP3 A;  2N7D A;  1SSN A;  2NV3 A;  2KFN A;  5BMH A;  4ED3 A;  3BS5 A;  2ASL A;  4KN4 A;  2AQ2 B;  1IV8 A;  1ZQC A;  5FR6 A;  1Z1V A;  3PSI A;  5J2K A;  2BCQ A;  2ACZ B;  1ZQD A;  1I4G A;  4YXD B;  4II2 B;  2BBC A;  2KZZ A;  2H89 B;  2E1F A;  4OZC A;  2W9B A;  2W03 A;  1WG8 A;  2Z0E B;  4YSY B;  1D3Z A;  1PFD A;  1ARO P;  3AE1 B;  4DFJ A;  5EWF A;  2L76 A;  2DZK A;  1D4B A;  4HRO A;  4YFK A;  1A6S A;  5C3J B;  3BVG A;  1SGG A;  3DVN U;  2L83 A;  2AGP A;  1PDX A;  2AQ3 B;  1STE A;  3Q3F A;  3IHP C;  3QUT A;  2DFL A;  4NAM A;  3H0M B;  1JWA D;  3T8M A;  4Y2J A;  4QZC A;  2V1Y A;  3Q14 C;  1SL2 A;  4NLN A;  2K4H A;  1ZJN A;  2GMI C;  1Z4O A;  2HJ8 A;  4IRC A;  2G3Q B;  3GV5 B;  4WIP A;  5AKL A;  2FLP A;  4RPX A;  4PGX A;  1S76 D;  3RFA A;  3M9O B;  1VZ8 A;  1SZH A;  4HCN B;  2KK8 A;  2K5P A;  2AQ4 A;  3A1Q A;  3OHB A;  4DQP A;  3CST A;  4J9S A;  2BPC A;  3U8Z A;  2I2Y A;  1UWX A;  3GV7 B;  3RCZ A;  2PI5 A;  2NBW B;  4W9L A;  5L9X A;  1JML A;  3ZRF A;  3PZ7 A;  4UB3 A;  5J29 A;  1NJY A;  2CKH B;  1WSP A;  4YWG G;  3LYS A;  3ZDE A;  1WWV A;  4AYB C;  4C8M A;  3ONN A;  4ED1 A;  2FMS A;  2HMX A;  3ALB A;  4KKI A;  4MSM B;  5HML A;  1B9R A;  1CZP A;  1L6N A;  2VKQ A;  2D10 A;  1ZQ1 C;  3NG0 A;  5J0Q A;  3VXW A;  7ICT A;  3OPX A;  2NMQ A;  1JAL A;  1WCN A;  4DLE A;  2OEH A;  3LWL A;  3A4R A;  2H5X A;  1OXJ A;  2J6S A;  3V6C B;  4KLS A;  1LM8 B;  5LLI A;  2NS5 A;  4ECV A;  2V0G A;  1S10 A;  5C2T B;  1XLP A;  2ZNV B;  5DQI A;  4IR9 A;  9ICH A;  1PYW D;  3H7P B;  4Q2J A;  2GRI A;  1MHH E;  5TSS A;  4W9H A;  9ICC A;  1S1Q B;  4I2B A;  2BWE S;  2KXJ A;  5CP2 A;  1UHU A;  2KO3 A;  2ODG A;  2KWU B;  4EYH B;  2KVS A;  2LKY A;  2OOB B;  2AHO B;  2KHW B;  1KH0 A;  2ALZ A;  3WAP A;  1A5R A;  1JW9 D;  5BYS A;  3BZC A;  1B43 A;  3PRP B;  3RNG C;  2PVO D;  2KN5 A;  2RDH A;  3HT3 A;  3EZ5 A;  5ALE A;  3PX4 A;  2GOL A;  4MDK E;  2MJ3 A;  3VTV A;  4AUQ C;  4ZDV A;  2AL6 A;  7ICL A;  1QIL A;  2JZP A;  3B2G A;  3OAW A;  4GC7 A;  2G07 A;  2QKQ A;  5DKW A;  3FIL B;  3RYT A;  3SZ2 A;  5DDY A;  4XC2 A;  3W2D A;  1WMH A;  2D6F C;  1QOB A;  1TKD A;  2ZPN A;  1TE2 A;  2LYH A;  1YQB A;  3F2B A;  2NTS A;  2Y3A A;  3OJ3 A;  4QZA A;  3RUL A;  3HM3 A;  5L1I A;  2YMP A;  2NBV B;  1MJD A;  5DB6 A;  3HX0 A;  2IZV B;  4ECW A;  3AE6 B;  5KFI A;  2ASJ A;  1SV0 C;  3PSP A;  4OJO A;  2KZ3 A;  5IIL A;  1NKE A;  1P7F A;  2GBJ A;  2M0X A;  4JQW C;  1SL1 A;  2AEH A;  4J3O D;  1WX8 A;  3Q69 A;  3PPA A;  4O5E A;  2OED A;  4C7Z A;  4DHZ B;  4KLG A;  2LYB A;  2WWZ A;  3QAQ A;  2L0F A;  5IA7 A;  1FMA D;  3LDZ E;  1ZPS A;  1ZOY B;  2I1J A;  1QSY A;  4IQU A;  4OHJ A;  2KWD A;  2R8K A;  1X40 A;  9ICW A;  1JX4 A;  2M1M A;  4KSK C;  1YMH E;  1L0Y B;  4C8K A;  3CIR B;  3S2A A;  1QSS A;  1NK8 A;  3NVW A;  2IGH A;  1YJ1 A;  5E6J A;  2N1V A;  3WKA A;  2BYE A;  5AUI A;  1ZQY A;  4B9S A;  2XC9 A;  2J7Q B;  4RQ4 A;  2MUT A;  2PMZ C;  8ICV A;  1ZQV A;  2JEI A;  4W9F A;  1C79 A;  4RNO A;  1YJJ A;  1WH3 A;  2MSN A;  1ZQS A;  4AWJ A;  4YTP B;  4FJV B;  2RQ5 A;  3BY4 B;  3SV3 A;  2W9C B;  1H38 A;  2MBQ A;  4LDT D;  4RQM A;  5AK3 A;  3BJY A;  1SWV A;  1KOT A;  1NKC A;  2FPK A;  5KT3 A;  8ICL A;  4HJG E;  2IY1 B;  4J9N A;  5KG5 A;  7ICF A;  3PVL A;  5JHB A;  3VHT C;  5KNI A;  1JMS A;  2XY7 A;  4RGN A;  1TK5 A;  1TVA A;  4AOF A;  2ZJA A;  2F3N A;  2KOB A;  2WXM A;  1EU3 A;  5BPC A;  3UXN A;  9ICJ A;  5AK5 A;  1S0V A;  3P1M A;  5LNK 1;  2L05 A;  1ZQO A;  2WAQ F;  3RRG A;  2ICI A;  3H0L B;  1KL9 A;  4ECT A;  1FRR A;  3R7Q A;  2LGX A;  4IQV A;  2A1J A;  4Z6D A;  2AGO A;  4KIK B;  1Z1B A;  4IS7 A;  1Z19 A;  2P6U A;  8ICO A;  5J2G A;  1FRD A;  3NZS A;  4JL9 A;  3ETL A;  2KKP A;  3MC0 B;  1U48 A;  1UPH A;  4X57 B;  5ALP A;  2O6K A;  3UPQ A;  4TUU A;  4DQI A;  4USA A;  1TKE A;  2IOF K;  2LM1 A;  3RMK C;  2R2Q A;  7ICO A;  1CRX A;  3ZDD A;  1ZUD 2;  2YB1 A;  1T8E A;  5AI0 A;  3QUB A;  4CDG A;  3AXC A;  2FPL A;  4PHP A;  1P3Q U;  2PPH A;  1I35 A;  4L1B A;  3RBD A;  3ZJU A;  4RQ3 A;  2G06 A;  2HD5 B;  2LM4 A;  1NK0 A;  1T0R C;  4C4V A;  4RZR A;  1BPZ A;  5KFG A;  4H2A A;  1D9D A;  5E79 U;  3DHH C;  5DPS A;  3HP6 A;  4HXD A;  2XIC A;  2ZVO A;  1NJW A;  2JWZ A;  1RPL A;  1C9F A;  1V5O A;  2WFA A;  1NOM A;  3CW2 C;  2IOH A;  2DZM A;  2YQE A;  3ZNH B;  2EMT A;  5AKJ A;  4RT2 A;  4I6N B;  2KFK B;  1T0S C;  4BWM A;  2LMR A;  4M00 A;  4NL9 C;  4M8N A;  9ICS A;  5E6P A;  2CHX A;  4KLE A;  2K1F A;  3BQ7 A;  1A76 A;  2BYF A;  4DL3 A;  5D3I B;  1J2N A;  3ALR A;  3AEC B;  2NRX A;  1L7M A;  3R8B A;  3DOW A;  5ALO A;  1ZQH A;  3TL5 A;  5KFW A;  5EE9 A;  2IBK A;  5ALI A;  2KZR A;  3JPO A;  1ZQM A;  7ICS A;  1WGH A;  1VZ7 A;  2NRW A;  2YML A;  2MLB A;  5CB1 A;  3Q2A C;  5DDM A;  1T6B X;  3R7R A;  3DBL B;  5KFB A;  2C22 A;  1ENF A;  3TAR A;  2W11 A;  4B9T A;  2F8L A;  4LZD A;  3Q3J A;  4NLC A;  4WAA A;  4YCX A;  4UB1 A;  2C7H A;  3G6V A;  4PGY A;  2HHS A;  1K51 A;  4RNA A;  2XN9 C;  3BWU D;  3C5G A;  2VJ4 A;  3PHW B;  4CF3 A;  5L95 C;  3H8S A;  3N4M B;  4ZRQ A;  4IWP A;  2D5G A;  9ICG A;  2LHE A;  4FFD A;  2JH7 A;  2R2O A;  2EAP A;  2IBI B;  1FNV A;  3VDZ A;  3QU4 A;  1HZ5 A;  1OFF A;  2K8C B;  3G6Y A;  4GLX A;  1BT0 A;  2RMM A;  1CK1 A;  4QIW F;  1E6E B;  2W7O A;  4DFK A;  4DDI D;  2RGF A;  1QOF A;  2QB0 A;  1COK A;  2CJN A;  3LJ3 A;  2C7M B;  1NDD A;  4W9D A;  1E7U A;  2BB6 A;  4BBN C;  2DAJ A;  3I3T B;  2KDE B;  4O3Q A;  5CA7 A;  3APC A;  2OH2 A;  8ICA A;  2MRL A;  2K22 A;  4NZL B;  2K8B B;  4K4H A;  4DFD A;  2R8H A;  3PX6 A;  4CF4 A;  1YIW A;  1N6Z A;  4YSX B;  5J0X A;  3M3J A;  2NR2 A;  1ACC A;  2FCN A;  3PRZ A;  4XDC A;  4DK5 A;  3WK9 A;  1ZQN A;  4A3P A;  2LXA A;  2UWQ A;  5AKE A;  3UQB A;  4LDT B;  3ZW3 A;  4ITK A;  2KTQ A;  4Y2R A;  4J6I A;  2ZUB A;  2LZ6 A;  2KSO B;  1WYG A;  2KN4 A;  2FBW B;  4O0I A;  3H4B A;  4JWN A;  1UH6 A;  3J81 j;  2QC8 A;  1VDV A;  5AKX A;  1QLB B;  5G5G A;  2EKI A;  2KTR B;  4TUQ A;  3M8R A;  4R66 A;  1XO1 A;  1MG8 A;  5ALN A;  3R2I A;  2IND C;  4PL1 A;  1Q1O A;  4LNF A;  4XX5 A;  4DDG D;  2DWQ A;  2W54 A;  1WZ0 A;  3PW5 A;  3T5H A;  1SE9 A;  1Y88 A;  4UAS A;  1LFD A;  4X5V A;  1L3U A;  2N9E B;  4BFR A;  2WGS A;  3GZN B;  2YLM A;  2ATL A;  2DAF A;  4A55 A;  1TAU A;  4GN1 A;  4JV1 A;  4C80 A;  2EQY A;  3QNM A;  3DBS A;  3L17 A;  2R61 A;  1DGJ A;  4G9B A;  4F4X A;  5J0S A;  4O3P A;  2VIX A;  1XCT L;  1U4B A;  5KFJ A;  1TGZ B;  1V9J A;  4GIV A;  4XWW A;  4WH4 A;  2V4R A;  3SAH A;  3D6J A;  7ICV A;  4YTN B;  1P9D U;  3K9P B;  1NI2 A;  1FCC C;  2JGA A;  2I5H A;  3HM6 X;  3JPS A;  2JRI B;  2QHO A;  5JZE B;  4YMN A;  4DCC A;  1J97 A;  4MGK E;  4ANV A;  2Q4T A;  2A1A A;  2J0M A;  4DL2 A;  4ICU A;  3HWT A;  1NEK B;  4DHJ D;  1ZRN A;  2FE9 A;  1PK3 A;  1JI7 A;  3PMN A;  3IRU A;  2B6G A;  1WX7 A;  2J42 A;  1URJ A;  4NQK E;  4QZD A;  1DGS A;  3WKB A;  4KLF A;  3OSN A;  3UIO B;  1EU4 A;  3AEA B;  1VJ5 A;  2NPT A;  5ALG A;  4F8R A;  1QSL A;  1K5O A;  2MSE D;  2ZIU B;  4B9L A;  3O0F A;  3TAC B;  1J2M A;  1Z3E B;  2DBY A;  1OTR B;  3Q8F A;  2ZUC A;  3ZLZ A;  4QJF B;  2O2V B;  1XO0 A;  4A3O A;  4P16 A;  1YZ7 A;  2AU0 A;  4M9G A;  2AXT U;  5KG7 A;  5ALY A;  2WQY B;  3RAQ A;  2IGD A;  3EFC A;  2JQR B;  2ZTD A;  4DQR A;  4ARC A;  1L5P A;  1GC6 A;  3OLM D;  3ZXR A;  3U30 A;  3H8J A;  2ZEQ A;  5ALU A;  2W8L A;  1YN3 A;  5AK4 A;  1XNS A;  2ESE A;  1TT5 B;  2B76 B;  2HVI A;  2ZJ8 A;  2FDR A;  1IBX A;  1ZDV A;  2D3B A;  3GP7 A;  4HPL B;  1KSP A;  1PGA A;  4YT0 B;  4URK A;  3DVG X;  2OHF A;  4WJN A;  2BDP A;  1I4P A;  1OUQ A;  3RJE A;  5EWE A;  2HBK A;  2OCE A;  1ZQJ A;  2BKE A;  4KLH A;  1XLQ A;  1UBI A;  5ALR A;  3B9J A;  4AJW A;  1V97 A;  4DWI A;  1NVI D;  3A4S C;  2V3N A;  5ALX A;  3AH7 A;  2B0C A;  2KE7 A;  3L5K A;  7ICI A;  1R4M B;  1IGC A;  4M02 A;  3HVZ A;  4ECQ A;  2Q0Z X;  4MFF A;  1R4N B;  4FLH A;  4F3O A;  2JV3 A;  2KWC A;  4YSZ B;  1WY8 A;  2BR0 A;  5AKI A;  1CJE A;  3NOB A;  3VUY A;  4XWT A;  4FHK A;  1X9S A;  9ICU A;  2ZTE A;  1NBF C;  2FCM A;  1PQS A;  3AU6 A;  3APD A;  3SAF A;  5ALH A;  5L1K A;  1C7Y A;  1FXA A;  1K50 A;  4OZA A;  2QEJ C;  3KHL A;  1SKS A;  1Z5S B;  4IW0 A;  5D3D A;  4FE3 A;  2PEA A;  5IN7 A;  2PI4 A;  1XQQ A;  3RH5 A;  2ZXH A;  5J2H A;  1WCL A;  1F2R I;  1ZJM A;  3UIN B;  2JR5 A;  4F4Y A;  1QOG A;  1OEY J;  5JXV A;  2WXO A;  4HKZ E;  1UZX B;  9ICA A;  2GO7 A;  1ZQE A;  2KFJ A;  4PH5 A;  4MF2 A;  1Q3V A;  2GLE A;  3IT6 B;  4U7C A;  4PT5 A;  2LVQ A;  5EOZ A;  5J2F A;  3URY A;  4F7Z A;  1LKY B;  1TK0 A;  2REX A;  4ICA A;  2KV2 A;  2WXQ A;  3SEN A;  3ML9 A;  1S5L U;  2YEP B;  2HOF A;  5J2J A;  2PFQ A;  1DOQ A;  1A70 A;  5AKZ A;  3AE3 B;  2WLB A;  2MBE A;  1XLN A;  2KJ8 A;  3M6Z A;  2NO4 A;  5KFU A;  2V9W A;  4CF5 A;  3O65 B;  4OVZ A;  4DQQ A;  3KZI U;  3X23 A;  1K53 A;  5AKH A;  1YQ4 B;  1YOV B;  1WE6 A;  2E5S A;  2ZG6 A;  1I42 A;  1ZOL A;  2G08 A;  2YB4 A;  3PW4 A;  2TSS A;  2DEN B;  4DXG A;  2JEF A;  4GXB A;  4JX1 C;  5KFZ A;  2CPR A;  4UB8 U;  4ZOH C;  3APF A;  3MP9 A;  2RRD A;  4DSL A;  1RFA A;  4I6P A;  5HMM A;  2KX3 A;  3LYY A;  5EE3 A;  3MFH A;  4IRD A;  3ED5 A;  3C23 A;  4U6P A;  1L3T A;  4Q8F A;  4DHJ B;  4A9A A;  2BT6 A;  1WGR A;  3I28 A;  4E71 A;  4DFP A;  2D2Q A;  4PK1 A;  5MPO A;  3TAN A;  1KJT A;  1V5T A;  1IUE A;  1FFU A;  2I6X A;  3CWI A;  1TS4 A;  1ESF A;  2XI9 A;  1KQQ A;  4BKS A;  4RQ2 A;  3KLS X;  3RJH A;  3N3K B;  4I2E A;  4HVB A;  4DL6 A;  4E74 A;  4J9O A;  7ICK A;  4TUP A;  1B22 A;  2WB1 F;  1IIP A;  4G3X B;  5KFC A;  2MBH A;  3AM9 A;  2FAZ A;  3LK9 A;  1KTQ A;  1OW5 A;  4NXZ A;  1ZD2 P;  1J7A A;  2AYO B;  4C56 C;  3IM1 A;  2MJD A;  4RH6 A;  1MSW D;  3KZX A;  2N9P C;  4I2C A;  1D8L A;  8ICU A;  1WGY A;  3P2B A;  4I2I A;  3RFZ B;  2WF6 A;  1KKX A;  3OJ4 B;  3QUQ A;  1L4Z B;  3QEA Z;  9ICV A;  2ZIW B;  3I76 A;  1GB1 A;  1TKY A;  3QWZ B;  5DLG A;  1L7N A;  5KHQ A;  1D5M C;  4RMA A;  3NS8 A;  3JSV B;  1JIH A;  2RPQ A;  2BHN A;  4QZE A;  2MA1 A;  3Q8M A;  2WX0 A;  4MM3 B;  2QSD A;  1OQR A;  1U4A A;  3BVM A;  4W9E A;  1NK7 A;  2WU5 B;  4GMV A;  2G0A A;  1V1O A;  2AH5 A;  3LVV A;  3WKC A;  8ICY A;  2F76 X;  3MJW A;  2ISO A;  1JN3 A;  1ZQA A;  1Y8R C;  2XK5 A;  5DPR A;  4F71 A;  3SV4 A;  4A6Q A;  3K9O B;  1F52 A;  2XGQ A;  2JZ3 B;  3TI0 A;  3MFI A;  4ECR A;  3ZIM A;  3WKD A;  3N97 B;  3RPF C;  4R3D A;  1ZQW A;  4KDL B;  4RQN A;  5AZG A;  4RGT A;  2G09 A;  3A9J B;  4KZ0 A;  4NLK A;  2J0J A;  2VJ5 A;  3RR8 A;  5GTI U;  3Q8R B;  3I63 C;  3KYC D;  1UWM A;  3DBH I;  1RAX A;  3F5E A;  3NRW A;  3T79 A;  4GSW A;  1NK4 A;  2N0S B;  2XY6 A;  5DPT A;  3RZW C;  2JRZ A;  3NVV A;  2KWV B;  3MR3 A;  4REZ A;  2HDE A;  1OQQ A;  4O3O A;  3KKA A;  2WDV B;  4KLU A;  4QZB A;  3GB1 A;  4BAX A;  1UQV A;  5ALT A;  4MEY A;  3DVG Y;  2DGZ A;  3QX7 A;  4CE6 A;  2L52 A;  3Q8P B;  3QZ8 A;  3RD2 A;  1WXV A;  1X9M A;  2W55 A;  3C1Z A;  1X9W A;  2KJ6 A;  2FE8 A;  2N7J A;  3WAL A;  2CJO A;  3NGD A;  4LK0 M;  4QZ9 A;  1RYJ A;  4DSI A;  5J8Y A;  1DRG A;  2PTL A;  2HBJ A;  5KTQ A;  2G4D B;  3MDA A;  4TQ0 A;  2ZIX A;  5JU5 A;  4JV2 A;  4NLZ A;  2N1R A;  5D49 A;  5J2R A;  2Z7J A;  3AU4 A;  3V05 A;  1SV4 A;  2RSU A;  2Z59 B;  4IC7 B;  2ZIV A;  2WXF A;  2QDF A;  3WAO A;  5CR0 A;  1RLF A;  4TQS A;  3P42 A;  2N9K A;  1BML C;  2QMT A;  4BKG A;  2BS3 B;  3NAS A;  1UUP A;  1WI0 A;  8ICC A;  3BQ1 A;  4N59 A;  1SGH A;  4J03 A;  3MAB A;  1C4C A;  3H0R B;  4AS1 A;  2BWF A;  2O6V A;  1M4V A;  1FCL A;  5DBB A;  1O08 A;  3A9K B;  4M6W A;  3N28 A;  2CHW A;  2YY6 A;  3DBR I;  4M9H A;  1CEZ A;  9ICI A;  2XBB C;  3QZ7 A;  3HK0 A;  3SR6 A;  2H3I A;  4BWJ A;  3OG5 A;  5CHW A;  4JV0 A;  2KIW A;  3HRD D;  1JCK B;  1E8W A;  1TJE A;  2BQQ A;  4DHZ E;  2JMG A;  1TIF A;  3GE3 C;  5J17 A;  1K1S A;  4EZK A;  2W9M A;  3BYY B;  1X1M A;  3DPD A;  3P4Q B;  2KIV A;  9ICT A;  5J0R A;  4KLT A;  2NO5 A;  3R9K A;  5KHO A;  3EPI A;  5KFH A;  4ZRJ A;  3TMP B;  4IR1 A;  1S97 A;  2DLB A;  2IY0 B;  2FI1 A;  3BK1 A;  4F5Q A;  3NJT A;  3AB5 A;  4FN2 A;  5IIM A;  5KG6 A;  4ELU A;  2N4F A;  2NCN A;  2RDB C;  1XXG A;  1HZ6 A;  4NNJ B;  2BDU A;  4RPZ A;  3PGE A;  2FID A;  2WF7 A;  1ZQI A;  4KDI C;  1SXE A;  3AU2 A;  4JIO U;  1ZD3 A;  1T7P A;  4CNQ A;  5KFE A;  1R7S A;  1BXT A;  4OVU A;  5KFV A;  3WK5 A;  5J0O A;  5KFA A;  4W9G A;  2P35 A;  4KGS A;  1ISN A;  3MC1 A;  4YR2 A;  3E56 A;  4ZRI A;  4CHK A;  1D8B A;  3TSS A;  4ANW A;  2IA6 A;  3KUD B;  3SHQ A;  2JWU A;  4K7S A;  2D11 A;  2ZZP B;  4FBJ B;  1NZB A;  1D8Y A;  8ICQ A;  4WWM A;  5KFK A;  3QYP A;  4DF8 A;  2DL0 A;  1ZQU A;  4GDK B;  2Y5P A;  5KFO A;  1SZP A;  1QH9 A;  4Y2T A;  4GXJ A;  4FO6 A;  2BVC A;  4GFJ A;  2HHV A;  3ZD8 A;  7ICH A;  4OVV A;  1V2Y A;  3THV A;  5ALK A;  2OM6 A; 
#chains in the Genus database with same CATH homology
 1UNS A;  1VZ7 A;  1FM0 D;  4IKG A;  3FAH A;  1T6B X;  2I38 A;  1E7P B;  1L6V A;  1ENF A;  1WWT A;  2WP9 B;  2WXG A;  4JPS A;  1N5X A;  1ZXH A;  4XDD A;  5BMI A;  3AE5 B;  4FXC A;  1L0V B;  3EGR A;  4RNA A;  1K51 A;  2WS3 B;  2XN9 C;  3BWU D;  1LO5 D;  2JYT A;  4JWS C;  1V8C A;  4ZRQ A;  2XNA C;  3KQ4 A;  1RFK A;  1TY2 A;  4EE2 A;  2D5G A;  2LHE A;  3SFD B;  3SEB A;  1FNV A;  1VRA B;  3I9V 1;  4N6E B;  1HZ5 A;  1OFF A;  1SB3 C;  4LLG M;  4RCO A;  2RMM A;  1CK1 A;  1ET6 A;  1E6E B;  1N60 A;  1L0X B;  1QOF A;  1D5X C;  2CJN A;  2PLP A;  2INP E;  2BB6 A;  4RFB A;  4NZL B;  1J7B A;  4KX6 B;  3VR8 B;  1GPX A;  2K22 A;  4DQO C;  3Q8B A;  4YSX B;  4JE3 B;  1Y56 A;  3E9S A;  1ACC A;  4XDC A;  3EUB 2;  3BVZ A;  3MFG A;  2IDY A;  4DXF A;  1N5W A;  3T3O A;  3Q8E A;  1YNT E;  4ITK A;  2BS2 B;  1XCQ L;  1WRI A;  2GI9 A;  1WYG A;  3NRZ A;  5EE1 A;  4US9 A;  2RDG A;  1PUT A;  2KN4 A;  2FBW B;  1TYG B;  1JQ4 A;  3AV8 A;  5H92 C;  1VDV A;  1QLB B;  2EKI A;  5G5G A;  1MHX A;  3AEG B;  3Q8C A;  3O13 A;  1F2R C;  2M56 B;  3R2I A;  3DWM A;  1QOA A;  5BYQ A;  4D2K A;  3NVY A;  3FIL A;  1MI0 A;  2W54 A;  2DWQ A;  1YN4 A;  1FO4 A;  2IPK D;  3IAS 1;  3AMZ A;  4O1N A;  3N9Y C;  1TZO A;  1AYF A;  1TS3 A;  4A8X C;  2BB5 A;  1C77 A;  1KTK A;  4A55 A;  2DYO A;  2VZK D;  4C80 A;  1XF5 L;  3PO0 A;  3ZJV A;  3H8H A;  5H8Y E;  2R61 A;  2CU3 A;  1DGJ A;  1V1P A;  2GB1 A;  4LTU A;  3VRB B;  1EWY C;  1JWM D;  1XCT L;  2PMV A;  3IT4 B;  4XWW A;  3AN1 A;  4WH4 A;  5HFY A;  2YEP F;  2BYT A;  4YTN B;  1XEE A;  1FCC C;  4GDL B;  1XLO A;  1F77 A;  5HG2 A;  4A90 A;  1I7H A;  4B0E A;  3MHZ A;  1QT9 A;  1N62 A;  1QKZ A;  3T3N A;  2WXH A;  2K3U A;  4HKQ A;  4KGT A;  2K9X A;  2MH7 A;  3VRA B;  4C7Y A;  2L1A A;  4WUR A;  3U7Z A;  1I4X A;  1I4R A;  3AE4 B;  2LJI A;  1NEK B;  2J53 A;  1P7E A;  2E3T A;  2PIA A;  4IDI A;  3Q8A A;  4AQ7 A;  1UGJ A;  1YJI A;  2J42 A;  3P4S B;  1DOI A;  1KLG D;  1QF6 A;  1JWB D;  1SE3 A;  2WXN A;  1KLU D;  4JWU C;  3L4P A;  1EU4 A;  2WXJ A;  3AEA B;  3HVD A;  1FNU A;  1SEB D;  5FR3 A;  3AE2 B;  2ZW1 A;  3FC4 A;  1EM7 A;  2DBY A;  4MT5 A;  3U52 E;  3Q8F A;  3LB8 C;  1I4Q A;  5GXG B;  2EEL A;  2KDM A;  4P16 A;  3BYT B;  2V3P A;  2WQY B;  2IGD A;  1L6U A;  1ZP0 B;  2JQR B;  3ZQ4 A;  2KAJ A;  3W5U B;  1T5X D;  3P63 A;  4ARC A;  1L5P A;  2V4I B;  1VJK A;  2WXP A;  5G5H A;  3W9C B;  1YN3 A;  2WXL A;  1D5Z C;  1RM6 C;  1SJH D;  2B76 B;  1IBX A;  3AEE B;  1ZDV A;  2AQ1 B;  3GP7 A;  4M0W A;  1PGA A;  4YT0 B;  1HEZ E;  1JWU D;  2MJE A;  2OHF A;  2SEB D;  1QQR A;  1I4P A;  1XLQ A;  2PVG C;  1N63 A;  2K0P A;  4MAC A;  3TEY A;  3NUH B;  3B9J A;  2M19 A;  1V97 A;  3AEF B;  1D6E C;  1HXY D;  1NVI D;  2V3N A;  3ETR A;  3AH7 A;  2W3R A;  1IGC A;  1XO3 A;  1NI3 A;  1C76 A;  4RGO S;  5EE0 A;  1NYQ A;  2IJ0 A;  3HVZ A;  5BYR A;  4RF0 A;  1Q10 A;  1HA5 A;  3BII D;  1FFV A;  1E9M A;  2G1E A;  1VZ6 A;  4YSZ B;  1CJE A;  1B1Z A;  2JSV X;  4XWT A;  2LFI A;  5I4D A;  2FUG 1;  1JRO A;  2BS4 B;  3P4P B;  3SFE B;  1FXA A;  2SAK A;  3KWL A;  4ARI A;  1K50 A;  1SBB B;  4OZA A;  2LEK A;  2QEJ C;  4KGR A;  4IOI E;  3J9C A;  5D3D A;  5BMG A;  1SJE D;  1F2R I;  3AED B;  1I4H A;  1QOG A;  2JX5 A;  4NJC A;  1SSN A;  5JXV A;  2WXO A;  3R2T A;  4HKZ E;  5BMH A;  1KF6 B;  1VR9 A;  3WCQ A;  1DOY A;  1EWC A;  2AQ2 B;  2ACZ B;  2J4X A;  1YN5 A;  3IT6 B;  4PT5 A;  1I4G A;  2X38 A;  4YXD B;  3URY A;  2BBC A;  3NVZ A;  2H89 B;  4OZC A;  3I57 A;  4YSY B;  2WXQ A;  1PFD A;  3AE1 B;  2YEP B;  2E6X A;  1AN8 A;  3W1S A;  2ONQ A;  2VZK B;  1D4B A;  1A70 A;  4HRO A;  2J52 A;  3AE3 B;  2WLB A;  3BVG A;  5C3J B;  1SF0 A;  1XLN A;  4YTM B;  2L83 A;  3B2F A;  3GS2 A;  4UDU C;  2AQ3 B;  1PDX A;  1STE A;  4ZHP A;  4NAM A;  4OVZ A;  1JWA D;  2HTM E;  3ABV B;  1L4D B;  1BUI C;  1K53 A;  4WIP A;  1YQ4 B;  2DYM A;  1J7C A;  4N58 A;  4NAW B;  1VZ8 A;  1TS5 A;  1T3Q A;  2KAC A;  4TSS A;  2K5P A;  2TSS A;  4RF1 A;  4DXG A;  4JX1 C;  3MP9 A;  4ZOH C;  5D7G A;  2I2Y A;  1UWX A;  2QJL A;  1E10 A;  1SXT A;  3LYY A;  3IAM 1;  5EE3 A;  1JML A;  1CQV A;  1PGX A;  3PZ7 A;  4OW0 A;  4A9A A;  2BT6 A;  1WSP A;  4YWG G;  2WU2 B;  3U4E G;  1B9R A;  4KKI A;  3OWE B;  4MH8 A;  5T8I A;  2INN E;  2WXI A;  1CZP A;  5MPO A;  1IUE A;  2PKO A;  1AW7 A;  1FFU A;  3CWI A;  2NMQ A;  1ET9 A;  1JAL A;  3TEX A;  1FEH A;  1ESF A;  1TS4 A;  2QIE B;  2JU6 X;  3KLS X;  1ZDX A;  2V0G A;  5C2T B;  1XLP A;  2L32 A;  1PYW D;  3AM9 A;  4Q2J A;  2GRI A;  1MHH E;  5TSS A;  3V3X A;  2LGI A;  1J7A A;  2JXT A;  4C56 C;  3LXF A;  4RH6 A;  2MJD A;  1KH0 A;  4KKJ A;  1JW9 D;  1TS2 A;  3AE8 B;  5BYS A;  3RFZ B;  4US8 A;  2PVO D;  2RDH A;  1L4Z B;  2MJ3 A;  2LMC A;  1TKY A;  1QIL A;  2JZP A;  4OZB A;  1GB1 A;  3B2G A;  3FIL B;  1D5M C;  3AE7 B;  3NS1 A;  4HRS A;  1FXI A;  3W2D A;  1PGB A;  1QOB A;  2JYE A;  4MM3 B;  2QSD A;  2PW9 A;  1OQR A;  1E0Z A;  3BVM A;  2NTS A;  2WU5 B;  2Q5W D;  2Y3A A;  1V1O A;  2WXR A;  1V1P B;  2MEK A;  2WDR B;  1AWD A;  1F0Z A;  2QIL A;  1C78 A;  4L2Y A;  5FKA C;  4TMA B;  3AE6 B;  4A6Q A;  1P7F A;  5AUK A;  4J3O D;  2IGG A;  1ROE A;  3Q69 A;  3RPF C;  1C4P A;  4R3D A;  2OED A;  4C7Z A;  4RGT A;  1FMA D;  1ZPS A;  1ZOY B;  2W82 A;  1FIQ A;  1N61 A;  1WXQ A;  2ON8 A;  1UWM A;  4OHJ A;  4ZRP A;  5HHD G;  2KWD A;  1ZXI A;  3U2S C;  4WAF A;  1YMH E;  1MPE A;  1L0Y B;  2N0S B;  4HEA 1;  3CIR B;  3NVV A;  3NVW A;  4REZ A;  2IGH A;  2HDE A;  5E6J A;  3AE9 B;  4CQN A;  1OQQ A;  5AUI A;  3P4R B;  2M0A A;  1SIJ A;  3GB1 A;  2WDV B;  3UI3 A;  2AX5 A;  3VR9 B;  4P6V F;  2L52 A;  1KRH A;  3TEZ A;  4GLS C;  1C79 A;  3ZYY X;  2W55 A;  1FD6 A;  2FE8 A;  2N7J A;  1YJJ A;  3BK2 A;  1IGD A;  1SE2 A;  1TY0 A;  2CJO A;  3PZ8 A;  4LK0 M;  4B0M A;  4YTP B;  1RYJ A;  3EA6 A;  2PTL A;  1HQR D;  4TQ0 A;  2ZW0 A;  1MVK A;  4HJG E;  3V05 A;  1C4A A;  1GAQ B;  2W3S A;  3ZJT A;  2WXF A;  4RGN A;  3DWG C;  2WXM A;  1EU3 A;  2N9K A;  1BML C;  3P42 A;  2QMT A;  3IXS A;  2BS3 B;  3P1M A;  1UUP A;  5LNK 1;  1IBX B;  2ICI A;  4N59 A;  1C4C A;  3C8Y A;  4AS1 A;  1FRR A;  2G9H D;  3NZ3 A;  1M4V A;  1FCL A;  1TKG A;  2NTT A;  1GB4 A;  4TQ1 A;  1FRD A;  3SR6 A;  3MC0 B;  3KWV A;  1JCK B;  3HRD D;  1NYR A;  1TJE A;  1DOX A;  2RPV A;  2KMM A;  4XE0 A;  4USA A;  1TKE A;  3BYY B;  3P4Q B;  2WDQ B;  1ZUD 2;  2WXK A;  2KQ4 X;  2Z8L A;  1NEN B;  4L1B A;  3VQI A;  2DLB A;  3ZJU A;  1VLB A;  1KFY B;  3BK1 A;  3HUI A;  3AB5 A;  1ZE3 D;  5HI1 A;  1SE4 A;  4ZYS A;  4H2A A;  4L23 A;  1XXG A;  1HZ6 A;  2LHD A;  2N9L A;  1WGK A;  3TUO A;  4ZHO A;  2BTE A;  2LUM A;  1YQ3 B;  1R7S A;  1BXT A;  3MJ5 A;  1C9F A;  3BZD B;  1DYQ A;  1RWS A;  1JWS D;  4KGS A;  3E56 A;  5FK9 C;  2BW2 A;  3TSS A;  2Y5C A;  2JWU A;  4WQM A;  4WWM A;  5D3I B;  3AEC B;  1FNW A;  1K52 A;  4GDK B;  2WNM A;  2Y5P A;  3R8B A;  3W5V B;  1JRP A;  3TEW A;  3AEB B;  3ZGZ A;  5EE9 A;  1GOZ A;  4RGM A;  2H88 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...