3NVVA

Crystal structure of bovine xanthine oxidase in complex with arsenite
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
164
structure length
164
Chain Sequence
TADELVFFVNGKKVVEKNADPETTLLAYLRRKLGLRGTKLGCGEGGCGACTVMLSKYDRLQDKIIHFSANACLAPICTLHHVAVTTVEGIGSTKTRLHPVQERIAKSHGSQCGFCTPGIVMSMYTLLRNQPEPTVEEIEDAFQGNLCRCTGYRPILQGFRTFAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray Crystal Structure of Arsenite-Inhibited Xanthine Oxidase: Mu-Sulfido,Mu-Oxo Double Bridge between Molybdenum and Arsenic in the Active Site.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Xanthine dehydrogenase/oxidase
total genus 42
structure length 164
sequence length 164
chains with identical sequence J
ec nomenclature ec 1.17.1.4: Xanthine dehydrogenase.
pdb deposition date 2010-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 3nvvA02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3nvvA01
4WQMA 1PUTA 4USAA 1V8CA 1GAQB 1L6UA 1WWTA 3AE1B 1FRRA 3AEBB 3AE3B 2CJOA 1L0VB 1WXQA 1J7CA 2WDVB 3HUIA 4LTUA 2PVGC 1B9RA 1E7PB 5H8YE 2W55A 3KWLA 1YJJA 3FC4A 1FFVA 1ZOYB 3AE7B 1E10A 3VRBB 1V97A 1CZPA 1N63A 1FM0D 1QT9A 2B76B 2WS3B 3CWIA 4P6VF 3NRZA 5GXGB 1PFDA 2E3TA 2Y5CA 1F0ZA 1QF6A 2W54A 1WYGA 1YQ4B 2WU2B 3AV8A 4N58A 4IDIA 1N5XA 1QOFA 3WCQA 1YJIA 1NEKB 1SB3C 1T3QA 1QLBB 1QOAA 2DWQA 1FRDA 1SIJA 1VJKA 3LB8C 2W3RA 3NVZA 5EE3A 3P63A 1JW9D 2QIEB 1XLOA 4HRSA 2WQYB 2MJDA 2LEKA 3BIID 3W5VB 3HRDD 1UWMA 3AEFB 4YXDB 2AX5A 2WU5B 3RPFC 1RFKA 2L83A 3P1MA 4YTPB 1FXIA 2WDQB 1E9MA 1JALA 1ZP0B 3FAHA 1TKGA 5EE0A 3W9CB 1L5PA 2BS4B 4A9AA 3ETRA 2K5PA 1OFFA 1PDXA 2HTME 2K9XA 1L6VA 1OQRA 1TJEA 2WLBA 5EE9A 1ZUD2 3AE5B 4JWUC 1I7HA 1E6EB 1FMAD 1OQQA 2QJLA 3EUB2 3NVWA 2FBWB 2KMMA 3P4QB 2BS2B 1VDVA 4FXCA 3B9JA 2M19A 1FO4A 4YSYB 4C7YA 4US8A 1XLNA 1ROEA 1CJEA 4WWMA 3VR8B 1GPXA 1NYQA 2OHFA 1KFYB 2JQRB 1R7SA 5EE1A 3L4PA 5G5GA 2DBYA 3W5UB 4US9A 4YT0B 4JX1C 2PKOA 4C7ZA 1N62A 1FXAA 1TKYA 2CU3A 3AH7A 1NVID 3PO0A 5AUIA 2H88B 4ITKA 4C80A 3SFDB 3DWGC 4YSZB 3AMZA 2MJEA 3ABVB 5H92C 3HVZA 2M56B 3B2GA 4JWSC 1J7AA 1QOGA 2CJNA 1N60A 3DWMA 1WGKA 1XO3A 3NVVA 1NYRA 2L52A 3AEEB 4HROA 4YTNB 4ZOHC 4KX6B 4ZHOA 3LXFA 2WDRB 3AECB 3AE4B 3AE8B 2H89B 3AEGB 4N59A 3NVYA 1N61A 1ZXIA 3AE2B 1AYFA 1JROA 1NENB 4YTMB 1E0ZA 1XLQA 3VR9B 2WP9B 3AE6B 3VRAB 1JRPA 1N5WA 2W3SA 1EWYC 2BT6A 1IUEA 1J7BA 2N0SB 1DOIA 1DOXA 5C2TB 3AN1A 3AE9B 3AEAB 5C3JB 1TYGB 3AEDB 2PIAA 2G1EA 5G5HA 1DOYA 3CIRB 3P4SB 2EKIA 3NS1A 2MH7A 3B2FA 5MPOA 3SR6A 1VLBA 1NI3A 1FFUA 1JWBD 3AM9A 1KRHA 4N6EB 1DGJA 2JX5A 2KAJA 3ZYYX 1TKEA 1AWDA 4ZHPA 1QOBA 4YSXB 1RM6C 1WRIA 3AB5A 2PVOD 1RYJA 5AUKA 3SFEB 2BS3B 1JWAD 1KF6B 3P4PB 1RWSA 1FIQA 1XLPA 2K22A 1SF0A 2MJ3A 1JQ4A 3P4RB 2ACZB 1YQ3B 2Q5WD 1A70A
chains in the Genus database with same CATH superfamily
3KUDB 3TFRA 1D5MC 4FA6A 2HOIA 2IO1B 1Z2MA 4OZAA 3ZDBA 1WE6A 4OZBA 1A77A 3M63B 3E0FA 2ISOA 2BQQA 3SMVA 3QU4A 3ETLA 3Q69A 5AM2A 4DQIA 2DYBA 3TMPB 3NRZA 2KZZA 3ZXVA 3ZNZB 2RDHA 4ARIA 2XICA 2RR9A 1AQ6A 1FCCC 5BMHA 1IM4A 1RYRA 3JPQA 3VXWA 4B9KA 2W04A 5EE3A 2AQ0A 4M2YA 3ZTCA 2JR5A 1UQVA 1CRXA 1XLOA 1ZYQA 3BK2A 3HRDD 1P9DU 2I1JA 4E3CA 4FADA 2CS4A 4LLGM 2WU5B 2JH7A 1L7NA 1HA5A 1HEZE 1SGHA 1IPGA 2OEDA 1BNOA 5KFGA 1WY8A 1WRDB 5IA7A 5EE0A 1D8YA 1X66A 3IDWA 2MBEA 1LVHA 2AXTU 4ZRJA 2QJLA 5KT4A 3A33B 5CHVC 2B0CA 1AROP 1VDVA 1WSPA 8ICWA 2EAPA 1KLUD 5J0XA 1CUKA 1VZ7A 1YZ6A 2I1QA 4PGYA 3I28A 2IO0B 4XZ4A 2HCFA 4I2HA 2MBHA 5J2KA 1QQ6A 1ZQJA 3AH7A 7ICUA 1YNTE 2N9LA 3ZDMC 2JZBA 2AHOB 4XWTA 2MJEA 3ABVB 3DBHI 1DK2A 3GS2A 2PKEA 1R4NI 5AK6A 1TFRA 5G2NA 1KW4A 4PK1A 3LXFA 2WDRB 2KP7A 3AE4B 2K39A 5K4LA 4NJ6A 1AYFA 1Q46A 1L7PA 3Q8SB 2WXRA 4I2JA 3V6HA 3M8SA 2V9HA 5G55A 3VCBA 2ZJDA 3TADC 3A9KB 3ZD8A 1PGAA 2Y9UA 3QUTA 2K4IA 2OJRA 1XF5L 2M4NA 1UPHA 8ICFA 4FZLA 2LJ5A 4W9KA 4FZNA 5J2FA 2MA9B 3V6JA 3CIRB 3D2NA 1FNWA 3SR6A 4M02A 4IWPA 4ACFA 1T94A 3TEXA 1TS3A 2MRLA 2J7QB 1HIWA 1V9PA 2E6XA 5KFFA 4PYUA 1U47A 4RNAA 3EFCA 4A55A 2V3SA 4DQOC 9ICAA 2MLBA 4DWIA 2WXQA 2IYDB 2BPFA 1RWSA 3NZSA 5BYSA 8ICTA 1TGZB 1H8CA 4FBUA 4J9PA 3SD7A 3TAQA 5ALIA 3HT3A 2JV3A 2Q5WD 4KVGB 1NJZA 3MHSD 1V8CA 4NJCA 2RD0A 4QJFB 2LXAA 1J2MA 5IIJA 2DPIA 5J8YA 1L0VB 1ZDVA 2ZVOA 4DHJB 4F4KA 5EDSA 2E1EA 4L23A 2ONQA 2EQYA 2W9NA 3E9SA 4FJZA 1FPYA 2DAJA 4UBCA 3N32A 2G06A 1Z1VA 2ICIA 3VTVA 4KLFA 1E8YA 1TZ1A 2DHZA 5BYQA 5JUMA 2V3NA 3BYYB 3T5LA 3ZDDA 4ELTA 2KD1A 1WXMA 1K52A 5GXGB 4KKJA 3AU4A 1F0ZA 1K1QA 2K4HA 2WU2B 4N58A 1AN8A 4EZJA 3ZLZA 2E1FA 5L83A 2INCC 5ALYA 3JPPA 3DEEA 4JV1A 3P63A 3QA8A 4MJSA 3IN5A 4J6IA 5KFXA 5KG3A 1AARA 5DGBA 1L3SA 2LGSA 4DQSA 1OXJA 2FIFA 4P16A 4DSKA 2ZIWA 4B0MA 3PZDA 4AOFA 2HVHA 1KFDA 2KDBA 2G5IB 7ICQA 2B3AA 4HWIB 3CNHA 4CRXA 4YXJA 5TISU 2BQRA 1TJEA 3SEBA 2KLGA 2VJ4A 4M0AA 1HEKA 1Q10A 5AK3A 3NVWA 4EELA 3CSFA 3PRPB 4GMVA 4FE3A 4JL9A 4DLGA 4F4YA 4US8A 2KHWB 2LI5A 3PZ8A 3A1QB 1NYQA 4M9GA 1XD3B 1ET6A 1R7SA 5IIKA 3EWAA 2KJ6A 3N1ZC 3QU5A 2MU2A 1XO0A 1JRUA 2TSSA 4JX1C 2W11A 5AI5A 1KFTA 2IPKD 2LYHA 1CQVA 3QX7A 5AICA 2H88B 1JCKB 4BBNF 2HJ8A 4P4OA 4O5EA 4IR1A 4C56C 3B2GA 4LK0M 1KTKA 2ASQA 2IOHA 4I2FA 2KHVA 5ALXA 4GXJA 3AEEB 3ZXRA 4BBNC 2QB1A 3HPOA 3PW4A 1F44A 3TFSA 2CRXA 2JZZA 4WWOA 3ZJTA 1NZBA 4N59A 3VUWA 3I9V1 4YTMB 2LASA 4ANWA 5J0YA 1EF5A 1N5WA 1T6BX 4DOBA 3H7PA 4EBDA 1DOIA 5T14A 2AH5A 5C3JB 2L32A 5E6NA 4C8KA 3AEDB 1SV0A 5AIBA 1WR6E 5G5HA 5LLIA 2B6GA 3T5HA 1FEHA 2EKIA 1NI3A 1MPEA 5L1KA 3GV7B 4G0NB 2QB0A 1RXWA 1KN5A 4PT5A 4I2GA 2X38A 1D5ZC 3W1YA 1GB1A 4RGMA 3UGBB 4DS4A 5KT3A 1U48A 3QK0A 1LM8B 2KHQA 5AI0A 3ZDCA 2I6XA 1S0OA 3KYCD 4DHZB 3AL0B 3KBBA 4PJ0U 7ICLA 2KN7A 3T9LA 2KVCA 3UQ0A 1S0NA 3BDPA 5KAIU 4IR9A 4JWNA 4O3OA 3B08A 2JWZA 2BZFA 4AS1A 5HHDG 4TV3A 4XA5A 5HNKA 3L17A 4OO1J 4DBGA 4GSWA 3OAWA 3UQ2A 3PT2B 2VKQA 4P6VF 3MDCA 1HZ6A 3RB0A 3PMLA 4W9IA 3RNBC 2R8IA 1SL1A 2Y5CA 2D3CA 2H3FA 2HI0A 3AV8A 2RRDA 2K8BB 2NO4A 1YJIA 3KKAA 3V6CB 3TI0A 3N3KB 2HBLA 1FRDA 4I6NB 2JEIA 2XI9A 3BK1A 1I35A 1N6ZA 2HOFA 4P0PB 3LK9A 1JMSA 4HRSA 2WX1A 3NG0A 2RQ5A 3RNFC 1V86A 4G3XB 4JLCA 1UWMA 1V49A 4KV2A 1HQRD 3W2DA 2G4DB 1ISNA 3U26A 1L0XB 4IOIE 1D6EC 1WF9A 2NTSA 2JYTA 2GO7A 3K4GA 5GTIU 5FK9C 3L3FX 3IG5A 3O65B 4J9RA 4RF0A 4Y2JA 3RB4A 4RF1A 3PZ7A 2G5HB 1WX7A 1MSWD 3SDLC 2GH1A 1ZQQA 2J6TA 4EYHB 5DBCA 4B9SA 2Y0SF 3H0MB 4UDUC 3VFKA 4PS7A 2JSVX 4A90A 1QLNA 1YN3A 4ECRA 5KHOA 2Y0SC 4R65A 1E90A 4CF4A 2K6QA 3KYDD 7ICEA 3I57A 3N20C 3IG3A 1YN4A 2CJNA 2KACA 4DEZA 5KFUA 2BKEA 1NYRA 5HI1A 5KG5A 2YB4A 1TAUA 3KLSX 2ODGA 3PGEA 4IWOA 2UVRA 1YX6B 5JRTA 1P98A 3MBYA 2ZVNA 4WJ3B 2MUTB 1I4XA 3IXSA 1NENB 5HR6A 1VR9A 2LXCA 5KFLA 1URJA 3L10B 3RJKA 1EWYC 2LM1A 2CKHB 2ZJ8A 3OGUA 2FLNA 4DF8A 2RDGA 2Z0EB 3AE9B 3I63C 4MACA 4OVZA 3SU8X 1ZJMA 2VIXA 1H38A 5AKGA 4FN2A 2EZXA 2ZIUA 1SE9A 3RH6A 2ZJAA 1MN8A 1WFYA 3M95A 5EWGA 4MGIE 4P4MA 4A8EA 4RQ0A 2ZEQA 1F2RI 2RMMA 2JEGA 2PMZC 5BOLA 4RQ8A 4RU9A 2ZIVA 1ZXHA 3EHVA 3A9JA 4B0EA 2Z59B 3M9NB 4NY0A 2K6DB 1SKSA 1IP9A 2KIVA 1YQ3B 4BOSC 3WAOA 2KG5A 1I42A 2AQ2B 1OEYJ 1UGMA 4O5KA 4NLZA 2JY6A 2I2YA 2REXA 4MF2A 1SXDA 4FJYA 3U4EG 5KFZA 2JZPA 2YX8A 1ZQ1C 3OHAA 5J0TA 5KFVA 3Q3MC 4WURA 5KFRA 3RBEA 1J2NA 3F2CA 1CZPA 2JUOA 2Y1JA 4KKIA 3PO4A 5HFYA 2KYWA 2KFKA 4ANUA 2G45B 4ECUA 4IWQA 2KJ5A 3PW7A 3PHWB 1WZ0A 5AKZA 4IDIA 3RUIB 2YVCA 5D2MB 3TBLD 2GBMA 4M47A 3R3MA 3VH4B 3A4SC 4BWMA 2Z0DB 2W82A 1PVPA 1UD7A 2JMGA 4HYKA 1VCBA 2NCNA 2EZZA 1WCNA 1SKRA 2KTFA 3C2KA 4LZDA 3R7RA 2QDFA 3TAPA 2KLCA 2WXNA 4Y2VA 2XGPA 2M1MA 3L0WB 3F5EA 1JXLA 1C78A 2K25A 2BS4B 2ZW0A 5DPWA 8ICCA 4QZ8A 1L7MA 1OQRA 2RDBC 3WU2U 3IT6B 4OVVA 2WAQF 3U8ZA 4NJ7A 3EUB2 4YR0A 4DQRA 1BPYA 4M00A 4YSYB 2FLLA 5KG2A 5IILA 3RI7C 3L4PA 1ZD2P 9ICBA 2J0MA 4ELUA 1V81A 3PHXB 2DZMA 1V2YA 3SEIA 4IM3A 1FNVA 3PY8A 4GOCA 3RH4A 2KWCA 3EFUA 3RRGA 2RHFA 3WKAA 3Q2AC 1RRBA 1WGKA 2YN4A 2L05A 9ICSA 2QC8A 3ZQ4A 5AKYA 2KDEB 2J4XA 3L13A 5DQHA 3MP9A 4DSJA 2WYQA 3SV3A 2CR5A 5AZFA 2E5SA 1L7YA 1GNUA 4NAWA 5TSSA 1BPZA 3OSNA 4WJPA 1SXEA 4F2SA 5AZHA 3VR9B 4E0DA 1ZRNA 1JRPA 3WK4A 1ZQCA 4DLEA 2RPQA 2L0TA 4QZFA 3B2FA 3PSPA 4ECQA 2P66A 4NL9A 1FFUA 3SAHA 2XIDA 4HPPA 5CRXA 1XT9B 2YMQA 1ZQFA 2PVOD 3P4PB 4ZYSA 5L95C 2OOBB 5KFEA 3PNCA 2MJ3A 2BQUA 2BKRB 2G09A 4CDGA 2N1RA 5J0SA 3RAXA 2AGQA 1X9SA 3W1SA 1ZW7A 3VQIA 4RQNA 4FULA 4DO9A 2DFLA 2V1YA 3C0RB 1MG4A 2JYEA 4BJQA 4KGSA 1WIAA 1WWTA 2LVOA 3AEBB 3DPDA 3FM9A 4IQUA 1M6YA 5AK4A 3EGRA 5DKWA 1PZNA 4OD0A 1Z1BA 4Y2TA 4S0RA 4QZ9A 2J6UA 2FPMA 4PHDA 2KICA 1YJJA 1ZOYB 3VRBB 3AU5A 2DUYA 1WI0A 4KMUA 1ZQYA 1Z3EB 3RFZB 2H3VA 1KLNA 1UGJA 3CWIA 4Z6FA 5JH5C 3M6KA 3DBLI 4PYZA 2C60A 4RFBA 1UCVA 3KFUF 1MHXA 3E58A 8ICHA 9ICRA 3S2AA 1T3QA 5AKEA 3CMMB 2DF4B 1QOAA 2GLSA 1SIJA 3C19A 4FO6A 2YEPF 5KFSA 1JW9D 3SYZA 1JMLA 5E6JA 4HPLB 4HVBA 2EMSA 2R8HA 4JPSA 1OTRB 4NXZA 1NK7A 3P42A 4WH4A 4KIKB 2UVWA 5AI8A 5D7GA 1QCKA 1HJPA 4NM1A 2FI1A 2Y3AA 4HKZE 4KZCA 4ED0A 1ZQAA 3BQ0A 2XBBC 1PUZA 2D11A 2WAQC 5DPTA 3L16A 1ZKHA 2PEAA 2ZCBA 4FXCA 5IN7A 3B9JA 5HP4A 3V7JA 4ZYNA 5KFJA 2OXOA 4DFKA 1ZQMA 3W5UB 3F2DA 2F1IA 3C2MA 1B1ZA 3H1UA 2AYOB 3WAMA 1RZTA 7ICPA 2IO3B 1RYUA 1Q3UA 4C80A 3JSVA 4HPMB 2V4QA 1OEYA 3PZPA 2M56B 1Q8KA 2PFPA 3KHRA 2MRPA 1XO3A 4M9HA 2CU1A 1UZXB 2BCSA 3H6NA 4M0WA 1ZETA 3CW2C 3UXOA 4G11A 2BHNA 2W9MA 4XGAB 1KTQA 2O2VB 2ISPA 3U30A 1GC7A 4HJGE 2EAOA 3HWTA 4AP4C 3WK6A 3VTUA 4CCHA 1QILA 3IBEA 3OJ4B 2NO5A 2WXOA 5J2EA 3A4RA 3R66C 1C77A 3TL5A 2WB1F 3ALRA 3H8HA 4KDIC 1UHUA 4A6QA 5IP4D 2B21A 2ZIVB 2ASDA 4KLEA 3KH0A 2G1EA 3KZXA 2BDUA 4YXMA 1UH6A 2QILA 3TEYA 3TCAA 3VUYA 3Q3FA 5KG6A 3V7KA 3FILA 2FPLA 5L9XA 1RM6C 3ECIA 3AB5A 2NRTA 3NGDA 4HK2A 4ECTA 1XLPA 4XDDA 5KL1B 4W9CA 1SGGA 5KFMA 2RPVA 3M1YA 2AU0A 5CA7A 2HE7A 2YEPB 4PH5A 8ICUA 2ZUBA 1ZQKA 5ALOA 1C4CA 1VZ6A 1PK1B 1L6UA 2GBKA 1FRRA 3V61A 2KWDA 3K1ZA 3H0LB 7ICOA 1E7PB 2DKZA 5J0UA 3V60A 1WWVA 4F4WA 2V4LA 1WJNA 2XNAC 1CMXB 2HJ1A 3RFAA 4DSEA 1QQ7A 4UW9A 4RUCA 1T0YA 3WAPA 3C21A 2WS3B 4I2BA 4BKSA 2EH9A 2D3BA 2IDYA 3VH3B 3RJJA 3WANA 5ALZA 2MEKA 3QU7A 4A3OA 1OW5A 2D8CA 8ICKA 3MC1A 2DQNB 4EENA 2HTHA 1ZQRA 4KLJA 1D8BA 2IBKA 3H7SA 3H7IA 4MM3B 4NZLB 1YJ1A 4PS3A 3BIID 4X5VA 4Y2SA 4FS1A 1Z19A 1RQLA 4B9MA 1GC6A 1RFKA 2L83A 1XNSA 1SJHD 3RBDA 4B9LA 1WXAA 1SE2A 3WALA 5L1MA 2K5PA 2JH1A 1PDXA 2ZTDA 4UB2A 4OHJA 3BYTB 2JGAA 3BQ2A 2N7DA 3P4QB 1L6NA 4RNNA 4Y2XA 2M19A 4IW0A 1WMHA 1ZQSA 3B0YA 1PK3A 2YY6A 3ZGZA 9ICVA 1STEA 4MM3A 2VRRB 3G6VA 3BVGA 4NY8A 4YT0B 2BQ3A 2XEWA 3H8JA 5J2GA 5C0YA 4UAZA 2FMSA 2WDTB 1D3ZA 2KWUB 2ESEA 3HIZA 3PSIA 3QXGA 2RDJA 3HX0A 2SAKA 2ALZA 2BCVA 4M9NA 5CHWA 4MH0E 1L0YB 1QOGA 3FILB 2FCSA 3R2IA 4JQWC 1MI0A 7ICJA 3QAQA 5LNK1 5TR5A 1TS5A 3BS7A 4AQ7A 4NV0A 2G07A 2XCPA 3HK0A 4B6WA 3DQVA 1U4AA 4EFOA 1NNLA 1TAQA 5J0OA 3IAS1 8ICGA 2MA1A 2YB1A 8ICMA 5HKHA 4RMAA 4MHVA 2L8JA 2YMLA 3AEAB 3NS8A 1M4VA 2KTRB 4YVZA 4DF4A 2PIAA 5J17A 2AGPA 1X6JA 5J2DA 4M0WB 2WXIA 2C7NB 5KG1A 3PV1A 5IAAC 2GBRA 2KVSA 5AK5A 2VA8A 5L1JA 1QOBA 2XY7A 1TS2A 1WRIA 3JPRA 4GIVA 5T8IA 2AGOA 4IUMB 8ICZA 4EEWA 5AM4A 1E8ZA 1JQ4A 2M0NA 5L1IA 1HZ5A 1P3QU 2BYFA 1ET9A 2Q4TA 5ALRA 1SE4A 2EELA 4WAAA 5JXVA 1ZQHA 4UB1A 1VRAB 1XS9D 4Y2PA 2X8XX 1YMHE 1S9FA 4GDLA 4DFDA 3EW9A 1UA0A 4II3B 4E74A 3PPAA 1SIFA 1FFVA 4J9LA 1C76A 1J8CA 2UVVA 2D2QA 1XO1A 1FM0D 5ALLA 2JRHA 4J3OD 4UARA 9ICJA 2E3TA 4B9UA 2KJHB 2IO2B 3PR4A 1YQ4B 4FBJB 4C4VA 1O03A 4LJXA 4RT2A 4UB3A 1HTOA 4QZAA 4ICAA 4WJNA 9ICPA 1WMHB 3NVZA 4R66A 2LHDA 1U9LA 5KG7A 4F91B 4DL2A 3CYMA 3H4BA 1QQRA 4EOYA 3GQCA 2PI4A 5TZVA 4GLXA 4R63A 2HDEA 5JHBA 1TK5A 2MSNA 2AX5A 2AQ3B 3CRXA 1WGHA 4NLGA 2WDQB 3ZNHB 1TKGA 4Q8EA 4DL5A 1WJUA 2HBJA 3ETRA 3I1YA 2AL6A 3S6JA 3PSEB 2HVIA 1WGRA 4CF3A 1FNUA 1XSLA 2K4PA 3GE3C 2OHFA 4Q45A 5J2IA 2L5YA 4I2EA 5KFIA 2KSOA 2KZRA 1V1PB 5DG7A 2LJIA 2A3VA 2CU3A 3GFKB 3WK8A 9ICOA 8ICLA 3RZWC 5BO4B 4M6WA 5ALTA 2NVUI 3AMZA 4IS7A 1NKEA 2LMCA 2LRUA 4EKUA 4RQ5A 5D49A 2QARA 2MSED 4K4HA 5ALVA 4XE0A 2ASJA 4A20A 4EZKA 1I4GA 4M8MA 3CF6E 3AEVA 3PX6A 2D10A 3DBHB 4DL4A 1E0ZA 3FKYA 3RN9C 4KLSA 9ICHA 8ICXA 2C22A 1NDDA 2ZIUB 3PTFC 4NAWB 5C2TB 4F5OA 3APCA 1KH0A 2W03A 2UU7A 5AHXA 2FJ6A 3AU2A 1D5XC 5KT7A 3D2SA 2BB6A 4KX5A 5AM1A 2ZPNA 3DHGC 4YQWA 2XY6A 3RULA 2QLTA 3UIPB 5JTIA 2KC2A 4FJVB 4TUUA 4YD1A 1L8LA 5FKAC 3RNAC 4AJWA 3TACB 3PR5B 3V6KA 3RB6A 4GC6A 3AUOA 2WWZA 4KLMA 3Q3OC 1A6SA 4OW0A 2BS3B 2HD5B 2IY0B 2FDRA 3RZFA 1B22A 4F4ZA 2K8CB 1D9DA 3Q14C 2ACZB 2BWFA 2F2AB 4XYCA 4DL6A 4ZOHC 4AYBF 2LUEA 2K4EA 4WQMA 2J6SA 2MP2B 2DENB 3AE3B 2CJOA 9ICTA 1J7CA 4RQ1A 2WF7A 4RQ3A 2KNJA 1K8RB 2LRWA 3CSTA 3DDCB 4M8NA 4QZEA 3L54A 4LNFA 2VZKD 4BX9C 3FC4A 5HHIA 2W9CB 3AQEA 1ZD5A 1WXSA 1BVSA 1DXSA 1IGCA 2KVZA 3MC0B 2C2RA 4IQTA 5AKJA 3NY5A 8ICOA 1WUDA 2XK5A 3Q8EA 1ZQWA 1K5OA 1ZGUB 3WCQA 9ICCA 1SB3C 1OUQA 4RNMA 5ALQA 1T5XD 3LJ3A 1VJKA 4MFAA 4M01A 3ONSA 4ZH4A 2BGFA 1F52A 2L7RA 4XC2A 2KOXA 1X9XA 5F9NA 4KGTA 2SEBD 2V9WA 4G50A 2INNE 3T3OA 2IMWP 2KVRA 2KMCA 5KFBA 4LCDE 2VH1A 3BVZA 2HW3A 3ENEA 3MHZA 4BFRA 2LYBA 2GI9A 3SHQA 3J81j 3GE8C 2G3QB 4RQMA 1IIPA 1P7EA 1ZOLA 1L5PA 4YD2A 3W9CB 1QSYA 4A9AA 4C4VB 4F8CB 1AW7A 1L6VA 4WIPA 2ZIXB 1KSPA 3AE5B 1OQQA 1PGBA 2K1FA 4JWUC 3BWUD 2LVPA 4KLIA 1WM2A 4BKTA 3DVNV 5I4DA 4HEA1 1ROEA 1CJEA 4WAFA 2XY5A 4R3DA 2IGDA 5EE1A 2F3NA 5G5GA 5CR0A 4O5CA 1WX8A 2IY1B 2WXFA 3QARA 3T3FA 2UWQA 2HBKA 5B5EU 5JU5A 1SL2A 4DSLA 3RNEC 5J29A 4R64A 4TUSA 4RT3A 2PFOA 4XWWA 1SV0C 2ZXIA 2XO7A 2ES6A 2JXJA 5ALFA 1Z00A 3AXCA 3MR2A 1MC8A 4TSSA 1B0XA 4YTNB 3KTQA 2OYYA 1V6EA 4KX6B 3VDZA 3U2SC 4F71A 4CE6A 2JF5A 1U45A 3PS6A 4P1BC 4A3PA 4MT5A 1T0RC 4I2CA 1YIWA 2N7EA 2R2OA 1JX4A 4PL2A 4UB4A 2BCUA 4KTQA 4K7UA 3O0FA 2Q0ZX 1RFAA 1KJTA 2PLPA 3MFHA 2IA6A 2VJ5A 3UINB 2C7HA 3B0XA 3D6JA 5AKLA 1EWCA 4GXBA 1RQNA 1L4DB 4NNJB 4OJLA 4QNLA 1V9JA 3RT3B 2NS5A 4GN1A 2J52A 2F8LA 4PL1A 1N2XA 1DGSA 4RPYA 3ZNID 2K8CA 2L3ZA 4ICVA 4UB8U 4KN4A 1KLGD 3SAFA 4KLTA 4GC7A 2WXKA 4F8RA 4Q43A 5AUKA 2WHIA 4BOZB 1XXGA 7ICGA 1JN3A 3UF8A 4ED1A 2JRIB 1T3NA 2JHDA 4EEYA 1RG6A 2AJQA 1FEZA 3MJ5A 2LBOA 3UMCA 5KNIA 2C5LC 2Y5BB 3KKAC 5CB1A 4LTUA 2PVGC 3IRUA 4KLQA 1C9FA 3T5JA 5AZGA 3M9MB 2HHXA 5BMGA 1T8EA 3H0RB 8ICNA 1QH9A 1B4FA 1XC9A 2D6FC 2L0FA 5J0RA 3NRWA 2KFJA 3K9OB 3QHTA 2ZNVB 2FCNA 1NKBA 3MC9A 4QZIA 1D9FA 1Z4OA 5KT6A 4REZA 2W54A 3GV8B 3L5KA 3MABA 3DBSA 4H2AA 5KG0A 3TSSA 1QLBB 1R4NB 2W8LA 8ICAA 3N7SC 4DDGD 3Q8BA 1I4HA 3T3NA 4PHEA 4PPXA 3V6EB 4LZGA 2H3QA 1O08A 4DK5A 2ZIXA 3H8MA 5DG9A 1TS4A 4F7ZA 1T0QC 1EM7A 3MGIA 5ALWA 3MFGA 4F1SA 3EECA 1NK8A 1WR1A 4JV0A 2W43A 5J2JA 2VANA 1EO6A 1S1QB 5J0WA 3MGHA 2WXHA 3RPFC 4YTPB 4K7SA 3QC8B 1K51A 3L08A 3EA6A 2D5GA 2KWVB 4QWBA 3Q8MA 2KX0A 4W9FA 2IOFK 4F72A 1QSSA 4RQ4A 5A0LA 3OJSA 1LXDA 2BW2A 1FMAD 4BXOB 2FBWB 5HR7A 2JPHA 2ZNVC 4WWNA 4F5NA 2A1AA 5KTQA 4JWMA 1YN5A 5KFOA 2BTEA 5DB9A 3HVDA 4D2KA 2OH2A 4YP3A 2FIDA 4NLCA 4QWAA 2E8MA 1WGDA 2W8KA 3RH5A 2WXGA 2BDPA 1CI4A 2PI5A 3Q8FA 3PLVA 3ISDA 4I6LB 4YWGG 4JWSC 4NLNA 2K8BA 2GMIC 4AWJA 1PGXA 4NAMA 4GDKA 1F1HA 3KZIU 5AIAA 4XX5A 5D3IB 5KFWA 2F1JA 3PMNA 1N56A 4WWPA 2HMXA 1ZQGA 4QAYA 2BYTA 2M0AA 1QKZA 9ICLA 4WQOB 2KK0A 1T7PA 1V5TA 1M94A 3TUOA 3UXNA 3A9JB 3JPNA 3C1ZA 3WA0A 2WFAA 5D6JB 4AP9A 3M9OB 4RGOS 1JWBD 1TBEA 4YN4A 3RF9A 1PVRA 4TMAB 1SV4A 3N1YC 4TQ0A 4CHKA 4XQ8A 2XGQA 2IGHA 1KF6B 2E8NA 2LHTA 3DBLB 4MEMA 1X1MA 3P4RB 4BKSD 3AI5A 5LXIB 1ESFA 3OJ3A 1UT8A 2I1KA 3M62B 1Y88A 2ZW1A 3GIIA 2KTRA 4UATA 2JZBB 4BDPA 1IG6A 1EU4A 1UNSA 1SE3A 1YX5B 2WXMA 1FXTB 5ALSA 3ZRCA 4ECSA 1B9RA 4GB9A 4B6JA 5KFNA 9ICIA 1TZOA 1UUPA 5IOIA 4EZ6A 4R8UA 2UVUA 2JZ3B 2LM4A 1KFSA 4ZRIA 1UA1A 2KK8A 2NPTB 2KFNA 3PLUA 2RP5A 4UB6U 2MBOA 4HCPB 1X2IA 4FS2A 3RJEA 4KMOB 5DLFA 3NHEB 2KSOB 3WKCA 3OPXA 1JUDA 1ZQXA 1VZ8A 4KIKA 4MJSB 3ZJUA 5CWRA 3LDAA 1J0GA 4L1BA 4DXFA 3Q8CA 2G9HD 2LEKA 3ZDTA 2FUG1 1XSNA 1WE7A 5IIMA 2ZUCA 2JXXA 3ONNA 2KJ9A 3PREA 4ELVA 4O3NA 8ICSA 4URKA 7ICVA 2KOBA 1P0RA 1ZP0B 4F5QA 3OSPA 4X57B 1NKCA 1NK4A 2K9XA 4C4TA 3UIOB 1H4RA 1I7HA 3TADA 1EUVB 2FAZA 2PXIA 4TUQA 9ICNA 2I38A 4DQQA 3ICXA 2ZG6A 3SENA 1XLNA 2KANA 4NQKE 2R8KA 2NRXA 3KOOA 3BINA 1HE8A 3SV4A 2C7MB 2BYVE 4C8MA 1ZQZA 1FXAA 1N62A 1TKYA 1NJXA 1GJZA 4HXDA 3PRMB 4ITKA 2KN5A 3MR6A 3J9CA 1ED1A 5KFAA 4NQLB 4OJOA 3SFDB 3ZDAA 3NUQA 3HM3A 3X23A 4AUQC 1S5LU 2N9XA 4RPZA 2NBUA 3HVZA 1PYWD 4O3PA 5ALKA 3V7LA 2LGIA 3RCZA 4ED6A 3NVVA 8ICYA 3ISBA 2GLEA 5CP2A 4TURA 4Y2YA 2FE8A 2VA2A 2QKQA 3AECB 4O3RA 1QQ5A 3ZJVA 1X42A 3TIXA 4C4RA 2A1JA 3VHTC 2V4IB 1WCLA 4UAUA 4PGQA 5ALDA 3GB1A 5C5JA 2WP9B 1TAMA 5HMLA 4KN7A 2NBVB 2RSUA 5AKXA 2V3PA 3BZCA 4NWIA 4P4PA 3TKAA 3BVMA 4DL7A 1KLVA 2BYEA 4GDKB 2MH7A 1KOTA 3DVNU 4C0ZA 1DGJA 3URYA 2JRZA 5JZEB 5D4BA 1WM3A 4YSXB 3LDZE 4ARCA 3GZNB 1C7YA 1QTMA 1BPXA 3UQAA 2GWSA 3H7PB 3PX4A 2AQ1B 1Z4NA 3DV9A 3PVXA 3VRAB 2BPSA 2DLBA 1ZQBA 4BGDA 1WXQA 1YT3A 2WDVB 4I6PA 1NK6A 3JPOA 4OZCA 1X40A 1C20A 4DCCA 1XEEA 1RAXA 5AKKA 5H8YE 3NASA 3KWLA 5DPRA 1E10A 4QWDA 2EDUA 2L00B 2YMPA 1A0PA 8ICEA 3HKZF 2B76B 5F3XB 2DZJA 3Q8RB 3NJTA 3N28A 4YMNA 2N9PC 1HTQA 1MHHE 1WWUA 3GILA 4II2B 4IM0A 2A19A 2FUHB 4GGQA 2FCQA 3WKEA 1NEKB 4EE2A 5J2HA 2YLMA 4LNOA 3A1QA 3R9KA 1PVQA 4LDTD 4CO7A 3GIJA 1ZQTA 1I4QA 5CEHA 4P2HA 4M9JA 2IHNA 1NOMA 3I3TB 4RPXA 1MFWA 2VZKB 5ALEA 4IRKA 1WG8A 5KFCA 1KRPA 2WXLA 2LHEA 3B1LX 4JV2A 1FXIA 3TQ1A 4BZAA 1JALA 5IO9A 2ZIWB 2FMPA 2KXJA 4W9LA 1ZQPA 2HHUA 1BMLC 4PS8A 3ZO5B 1OGWA 2EANA 5EE9A 1U49A 1ZUD2 2BB5A 2KN4A 4Y2QA 4TQRA 1E6EB 3MR3A 1J19A 4ED2A 2IJ0A 3KUZA 4LJPB 1TVAA 3GIKA 1QZEA 4C7YA 2NV3A 4DS5A 7ICTA 3H8WA 3MJWA 3RJIA 2GB1A 4GXKA 4MSQB 5C23A 4A8XC 2VA3A 4US9A 2K8HA 4NLKA 2KZMA 3SQIA 2PKOA 1Y8RC 4IG7B 1L8OA 5H2FU 2K60A 5AUIA 1WYWB 1JI7A 4S17A 2ZXHA 2C9WB 3QX1A 4KSKC 4KLUA 4DFPA 4RH6A 1X9MA 3RJGA 3ML8A 1EF1A 1WX9A 2KKPA 1WGGA 2JWUA 2IOFA 3KHLA 4ECZA 2XCAA 3UXPA 1Q5WB 4M9LA 4J9MA 4XRHA 3DDHA 3RNCC 4OCZA 3NVYA 7ICFA 2HHTA 4MFCA 1UBIA 2DZKA 2N9EB 4HKQA 1FCLA 2HOQA 1SSNA 2LI6A 1ZQNA 2DNFA 2D07B 4ZRKA 3R8BA 2WGSA 4HCNB 4PZOA 1NZPA 2ZTEA 9ICMA 1E7VA 1WZ3A 3AN1A 9ICUA 4OVUA 1TYGB 3IHPC 1JIHA 1RLFA 3AM9A 1SJED 1TKEA 1AWDA 1ZRMA 4UB5A 4F3OA 3D32A 3N9YC 5EOZA 1JWAD 3KWVA 4Z6CA 2C2EA 3QEBZ 2I5HA 3QUQA 2R8JA 2L76A 4CF5A 2NRWA 1TY0A 2DYMA 5E6OA 2A5UA 4Q2JA 2J53A 1TE2A 2PJHA 4OJPA 8ICBA 3UI3A 3IG8A 3MGVA 3QYPA 1ZQIA 3M6ZA 5AKIA 2KQSA 2I9GA 2Y9TA 1TIFA 3THVA 3QZ8A 2MAXA 4K81A 5KFDA 2DGZA 1BPDA 5ALPA 4O1NA 5ALNA 4C00A 2C2DA 1WGYA 4HDOA 2ON8A 1N63A 3BQ7A 3V62A 2KE7A 2PFQA 4I28A 2CXYA 2BPGA 2MBQA 3ZVVA 3UPQA 3UMBA 2ZZPB 1KL9A 3ML9A 2DWQA 1L2NA 1XQQA 2DYOA 5IIIA 3F53A 1XSPA 4K7WA 1LQBA 3JVZX 3VTWA 4I2DA 4MEYA 3SD5A 4LJOB 4ED3A 3QUBA 2BWES 3Q8AA 1E5WA 1V1OA 2P6UA 3N30A 2N1VA 4P0PA 2FNJB 4YXDB 2J42A 2KT7A 3Q3NC 4RM9A 3BZKA 1KBUA 1F77A 3MR5A 4GLSC 3ZTDA 2R2QA 1X9WA 3ZYYX 4ANXA 3NTUA 5KAFU 2CN1A 3RD2A 5IIOA 3JW0X 3PW2A 2KMMA 2J0KA 4NM2A 4UAVA 1OQYA 2PW9A 3BY4B 4C4SA 4WWMA 1G6JA 3A0HU 1ZE3D 2MP2A 4TQSA 3MFIA 3DHHC 5BOMA 3U7DA 4F93B 4ECVA 3GZFA 4CGZA 4KLLA 2NBWB 3WKBA 4JMUA 1TY2A 3BZDB 4C7ZA 4B9TA 3UQBA 1NVID 5FR6A 4P7IA 4MF8A 4ACOA 1COKA 1R4MB 1SXTA 1S76D 5J2AA 2V4RA 2BGWA 2KDMA 4F5RA 3C1YA 1N60A 4F2RA 3TEWA 3NZ3A 4IQVA 3I5JC 2G0AA 5DPSA 4CNQA 1EU3A 2K3UA 1IV8A 1F5SA 4YMMA 5FP0A 3WKDA 3RNGC 5CX3A 3ISCA 2WF6A 3E56A 3EPGA 5IKCM 3U7ZA 4QZBA 4I2AA 4XDCA 1P7DA 1NI2A 3RRHA 3RTVA 4YR3A 1Q1OA 2W3SA 4W9GA 1SWWA 1XWLA 3HJEA 1J7BA 4Z6DA 4DQPA 2MUTA 2WNMA 3APFA 5CHFA 4CYEA 5LXHA 4LVSA 4YFKA 2GOWA 5L1LA 4DHZE 2ASLA 3P4SB 3PVLA 4K3BA 4MH8A 2XC9A 3LVVA 4Y2UA 2KAJA 2E8PA 1IXRA 4I2IA 5AKHA 4O3MA 3QWZB 3V3XA 4E71A 4O3QA 1S10A 1V38A 2WXPA 2VH2A 1FIQA 2K22A 3P2BA 1K50A 7ICKA 9ICFA 1V1PA 2PMVA 2Y1IA 4BWJA 4IQWA 2CHZA 3GP7A 4IC9A 3NOBA 5J2CA 2LD9A 4YL8A 5DDMA 2BR0A 2LGDA 2H3IA 2XVTA 2CHXA 4QZGA 4RM8A 3HUIA 3C28A 1HXYD 3ZDEA 4C8OA 2Y5PA 1GG3A 4KITB 3WK5A 1Z00B 3H40A 1QT9A 1V5OA 4OJ5A 4YR2A 3PV8A 4MELA 2KJ8A 2LYAA 3AU6A 2K89A 1LKYB 3ED5A 4ICUA 3AQFA 2J0JA 1QF6A 4QWEA 4F4XA 1WYGA 1FD6A 4ANVA 3WIMA 3Q8QB 1I4PA 3SAGA 3IP4B 3JPSA 4KLDA 2BBCA 3BQTA 1ZQDA 2W3RA 2OJWA 4DXAB 2P35A 3W1SC 3APDA 4KDLB 5ALHA 5CTRC 4BVUC 1KEJA 2WQYB 4L2YA 2MWSB 5KFKA 2E8OA 5AM3A 2WB1C 3W5VB 1SEBD 2OWOA 2ZJ5A 3OLMD 1L3VA 1EXNA 2LGXA 2R8GA 5KFTA 5D94A 2BVCA 3LVWA 1J97A 2JXTA 2BKFA 1OFFA 2HTME 4HLEA 3RB3A 1LGRA 5KT5A 4ED7A 3E2EA 1WH3A 4GDLB 4O3SA 2KNBA 2NPTA 2PTLA 2WHEA 3GV5B 5C1ZA 3PSTA 1GUAB 3B0AA 3C8YA 2HDOA 4YMOA 2D3DA 4NJ8A 5J0PA 2LFIA 1ZQEA 4EBCA 5KG4A 4J9KA 2DBYA 2LUMA 4DSFA 2KZ3A 4KLOA 2XK5B 4BAXA 3HKZC 3LWLA 1XU4A 2ZCCA 3VUXA 3PO0A 2KFKB 3DWGC 4YSZB 3GDXA 4RCOA 2W9BB 2NTTA 1WJ6A 2IBIB 3BJYA 4PHAA 1J7AA 3QIJA 1V85A 3DWMA 3ZKJC 4KLGA 1BXTA 2L52A 4HROA 4RQ6A 4EEKA 3U52E 3C5FA 3DVGY 1VD2A 2GRIA 3T5KA 1ZXIA 5IINA 1TV9A 3R2TA 3T8MA 5KHQA 4PHPA 5HHHA 4HDQA 8ICIA 3M7DA 5J8YC 4DHJD 2QSDA 4ASWC 4KSLC 4LDTB 1A76A 2BT6A 4MGKE 4UBBA 7ICRA 3K9PB 5AEKB 2K8AA 2ATLA 2WX0A 4JE3B 4MEXA 4DFJA 3K1RB 5EWEA 1UF0A 5MPOA 2FE9A 4LNKA 2RDIA 1RDFA 8ICVA 4K3CA 3DVGX 1DRGA 1RYSA 7ICHA 4EYIB 5AI4A 1RYJA 4RNOA 1ENFA 9ICKA 3IT4B 2LVQA 1P7FA 1E8XA 1SWVA 4ZRQA 4P0QA 1NK9A 2JVCA 4Q44A 2DPJA 5AI9A 1UT5A 4XUSA 2HHQA 2A4ZA 2JU6X 4FZMA 1LB2B 1GAQB 2W7OA 2AWTA 3AE1B 3JSVB 2L1AA 2NRZA 4UAYA 8ICQA 1MVKA 1L7OA 2KIWA 5D46A 3SZ2A 2W7PA 3R7QA 3FYHA 5B66U 5EWFA 4ECXA 5GMVA 1SZHA 4EZ9A 2DAFA 3MC8A 4AYBC 3UMGA 5GTHU 2QCZA 1DOQA 4TKNA 1IGDA 3Q8PB 3ZUNA 2F44A 4UQGA 4BXOA 4W9JA 1YZ7A 2R61A 8ICRA 1PFDA 4HAIA 1ZQUA 1DYQA 3KUCB 2KQ7A 1NK0A 1L3TA 2D3AA 3HW8A 4KZ0A 4JGHB 3LB8C 3Q6BA 2JT4B 3LYYA 1BNPA 3RMKC 1IBXA 2RGFA 5BYRA 4MGZE 2K0PA 4ZRPA 5BMIA 2MJDA 2LZ6A 4IKGA 5J2BA 1WXVA 2AQ4A 2KKVA 3DBRI 3PO5A 3JYUA 5KT2A 3H4DA 1L4ZB 1MJDA 1E9MA 2N1WA 3TANA 3OJUA 2JEFA 1LO5D 3GZNI 1TK8A 5D3DA 3Q8KA 3QJZA 4EX7A 2INDC 4M04A 1LKYA 2D3GA 4LNNA 5DB7A 4I29A 1FO4A 2G4SA 3H8SA 3RAQA 2PE9A 3C2LA 4JUZA 2Z8LA 1PK1A 4RGTA 3MDAA 5KFYA 3KVFB 5CJ7A 2EKEC 4P0QB 3FDSA 1WJ4A 1ZJNA 4UAWA 2O6VA 2HBMA 2WTFA 2KO3A 4DOAA 4RUAA 2N7JA 3HM6X 2V0GA 2F76X 3QZ7A 1C4PA 1GOZA 1E7UA 1S0MA 2N4FA 2AL3A 5J2RA 1ZPSA 3V72A 3Q8LA 3AULA 1C3TA 3N1XC 4ECYA 2Z7JA 1K1SA 3C29A 1DK3A 2NYVA 1U4BA 4NL9C 1ZDXA 3AEGB 4F5PA 1RPLA 2DL0A 1N61A 3BS5A 3F5AA 1SL0A 5FR3A 3A9KA 3KQ4A 2DX5B 2O6VD 1K53A 2NR2A 3JPTA 3IVFA 2FLPA 4IC7B 3AE6B 3RYTA 4IRCA 1JWUD 2P6RA 3QE9Y 1IUEA 4U6PA 2N0SB 1HUZA 2PPHA 1S8OA 1NK5A 4MFFA 4RZRA 2O2VA 3LWMA 1D4BA 4EBEA 2QB0B 1LV5A 4DWFA 3OTQA 5E79U 1KRHA 1COOA 3N7RC 5DGAA 3MTNB 2KMAA 3WK7A 3EZ5A 4C8LA 2IHMA 1MQ3A 2W9BA 3EPIA 4LNIA 4QIWC 3NUHB 2F77X 3SFEB 3TJPA 2YTUA 1SF0A 1YOVB 5JHAA 5DQGA 3KHGA 4OJ6A 2MBBB 2M0XA 4JB3A 1MA7A 1ZQLA 2DZIA 2G08A 2A1JB 3QNMA 4N9F4 4TQ1A 3BS5B 4C8NA 1XCTL 2H3ZA 3LYSA 3ZRFA 4W9HA 3PRZA 4MDKE 3H9DA 4EZLA 1C4AA 4FHKA 4QW8A 2W55A 2BF8B 3AE7B 1XCQL 1YQBA 8ICJA 1Z5SB 2DKXA 5DBAA 4J9OA 4DXGA 3QU9A 1PQSA 5BPCA 4O0IA 4QW9A 2KMDA 3GU3A 2HSZA 3G6YA 4BUGA 2RLTA 5ALGA 3PW5A 1Q3VA 2F8KA 2IZVB 2LWPA 4GXIA 2FPKA 3BQ1A 2O6VB 4GIBA 4KGRA 2IGGA 3VAWA 1BGXT 4UASA 4TUPA 3RJFA 1QOFA 7ICMA 1SKWA 1NJWA 3HILA 2C28A 1CK1A 3DCGA 1F9JA 2OEHA 2MCNB 3GIMA 2CPRA 1S0VA 4IL6U 1S3SG 1S77D 1QSLA 5DDYA 3RR8A 1A5RA 3AEFB 2W9AA 3QU2A 1GO3F 3DOWA 2BPCA 3FAHA 5HMMA 4B9VA 2OCEA 2WLBA 3X0WA 4ZHOA 4J03A 3QCAA 3G6XA 1IBXB 2NRVA 5AM0A 4NPNA 1NBFC 3N97B 1T0SC 2WF9A 1L3UA 1GPXA 3C23A 4K4GA 2KDFB 1KFYB 4J9NA 4QZDA 2MX2A 3HP6A 1F0MA 3IV6A 4DFMA 1MG8A 1KDHA 4ED8A 4ZDVA 5H92C 5DG8A 1I4RA 4W9EA 2LPEA 1IYFA 3IM1A 4R8UB 1X6IA 3KD3A 2KTQA 1C1YB 2KX3A 1ZD4A 1ZQVA 4MSMB 1KQQA 4I27A 2LGYA 4K1RB 4O9MA 1SBBB 2O6KA 3F2BA 2H89B 3AE8B 3DBRB 2M17A 1C79A 3HHMA 2M9NA 3AE2B 4ECWA 4Y2RA 5ALUA 4GFJA 3GOEA 2KV2A 2YMMA 9ICXA 2JEJA 2PE6B 1V80A 2BCQA 1DOXA 1ZD3A 4G3IA 2MHJA 4FFDA 1Y56A 2PFNA 3PSFA 9ICEA 3NS1A 1BPEA 1VLBA 1L5UA 4N6EB 3QEAZ 3CP8A 5J18A 5DB8A 4PGXA 1KM7A 2N9KA 2XN9C 4ZHPA 5HG2A 4P1CC 4EUTA 2LKYA 2MW5A 2QARB 3OHBA 2F1HA 5AI6A 1JWSD 4WJOA 5DCNA 4Z6EA 2GBJA 2H5XA 1PUTA 2GBNA 3K75D 4USAA 3IFWB 3D2QA 1GB4A 4M6WB 4J9QA 4EX6A 3T79A 2WXJA 4WJQA 4DSIA 2MQJA 9ICWA 4J9SA 2BCRA 1MQ2A 5DLGA 2KJRA 1JWMD 2HHSA 2KEYA 3ORYA 1SZPA 4YG2A 1R4MI 3KW5B 3O13A 4DDID 1BUIC 4QIWF 1V97A 1D8LA 4QZHA 3I76A 2EZYA 3V05A 5DQIA 3ZNGC 2AEHA 3VVWB 4IM2A 2PMZF 5KFPA 4FHJA 1BPBA 1TKDA 1N5XA 2OM6A 3N4MB 5KL8B 1P1AA 4NLBA 5ALMA 2WF8A 2KQ4X 5DB6A 2QIEB 4AJYB 1TTNA 3ZI4A 3EYZA 4QWCA 4FLHA 3VC8A 2WF5A 7ICIA 3PW0A 4IRDA 4U7CA 3Q3JA 1UELA 1TT5B 2KFZA 4KX3A 4DOCA 4QZCA 3P1MA 3WK9A 4MGYE 1E8WA 1NJYA 2ZUDA 3RR7A 2INPE 3RJHA 2KDIA 3QQ8B 4HJKA 1S97A 3ALBA 4B9NA 1CEZA 2KKCA 4RGNA 2BS2B 1ECWA 2KD0A 4F50A 1YD8U 3TEZA 4RQ7A 2YQEA 1ZQOA 2UYZB 3VR8B 4PZNA 3QUCA 2JQRB 1T4GA 1F2RC 1N48A 5ALJA 1RXVA 2FMQA 4RQ2A 3M3JA 2QHOA 4GU2A 5CHGA 4YCXA 2QEJC 9ICGA 4F92B 2QMTA 4KLHA 1KKXA 2GOLA 4FBTA 4CQNA 3OWEB 4Q8FA 3DHIC 3TARA 4JK1A 3KHHA 2FCMA 1ACCA 5KFQA 1TK0A 3OG5A 4G9BA 7ICNA 2LMRA 2W9CA 1JROA 3PX0A 2ZPYA 2NMQA 4W9DA 1XLQA 3ZW3A 3N7PD 5DBBA 2EMTA 3IAM1 2CHWA 9ICQA 4B95A 3ZD9A 4JIOU 1HUOA 3SI8A 3M8RA 5KFHA 1B43A 1DOYA 5AM5A 3EC8A 3ZIMA 8ICPA 4K4IA 1BT0A 2JX5A 3A0BU 1LFDA 2M8SA 2ZTCA 5J0QA 4DL3A 2EAMA 4BKGA 2HHVA 3C5GA 3NZUA 1Q0WB 1VJ5A 1JXEA 5F9LA 2R18A 3IHQB 2HHWA 5E6PA 3UM9A 1UWXA 7ICSA 1A70A 2KC1A 1UBQA
chains in the Genus database with same CATH topology
2JYEA 4KGSA 3MJ5A 1WWTA 1D5MC 3AEBB 3EGRA 4OZAA 4OZBA 3HUIA 4LTUA 1HXYD 2PVGC 1C9FA 1YJJA 1ZOYB 2Y5PA 3VRBB 3Q69A 5BMGA 1QT9A 3RFZB 1UGJA 3CWIA 3NRZA 2RDHA 4ARIA 4REZA 1QF6A 2W54A 4RFBA 1WYGA 1MHXA 1FD6A 4H2AA 1FCCC 5BMHA 1I4PA 3TSSA 1T3QA 1QLBB 1QOAA 2BBCA 1SIJA 2W3RA 5EE3A 2YEPF 3Q8BA 1I4HA 1JW9D 3T3NA 1JMLA 1XLOA 5E6JA 2WQYB 4L2YA 1TS4A 3BK2A 1EM7A 4JPSA 3MFGA 1SEBD 3HRDD 3W5VB 3P42A 4WH4A 4LLGM 2WU5B 2WXHA 3RPFC 4YTPB 1HA5A 1HEZE 5D7GA 2OEDA 1K51A 3EA6A 2Y3AA 2D5GA 4HKZE 5EE0A 2JXTA 1OFFA 2HTME 2BW2A 1FMAD 2QJLA 4GDLB 2FBWB 2PTLA 1WSPA 1VDVA 4FXCA 3B9JA 1KLUD 1YN5A 3C8YA 2LFIA 1VZ7A 2BTEA 3HVDA 4D2KA 2DBYA 2LUMA 3W5UB 1B1ZA 3AH7A 1YNTE 3PO0A 2N9LA 4C80A 2WXGA 3DWGC 4XWTA 4YSZB 2MJEA 3ABVB 4RCOA 2NTTA 3Q8FA 2M56B 3GS2A 4YWGG 4JWSC 1J7AA 1PGXA 3DWMA 1XO3A 1BXTA 2L52A 4HROA 4NAMA 4M0WA 3LXFA 2WDRB 3U52E 3AE4B 2GRIA 4HJGE 3R2TA 1ZXIA 5D3IB 1AYFA 1QILA 2WXRA 2WXOA 2QSDA 1C77A 2BYTA 2M0AA 1QKZA 2BT6A 3H8HA 1PGAA 4A6QA 3TUOA 1XF5L 4JE3B 2G1EA 2QILA 3CIRB 3TEYA 5MPOA 1FNWA 3SR6A 4RGOS 1JWBD 3TEXA 1TS3A 3FILA 2E6XA 4TMAB 1RM6C 3AB5A 4RNAA 4A55A 4DQOC 1RYJA 4TQ0A 2IGHA 2WXQA 1ENFA 1KF6B 1RWSA 1XLPA 4XDDA 5BYSA 3IT4B 4ZRQA 1P7FA 2RPVA 3P4RB 2YEPB 1VZ6A 1ESFA 2Q5WD 1C4CA 1V8CA 2JU6X 1GAQB 1L6UA 2ZW1A 3AE1B 1FRRA 4NJCA 1EU4A 2L1AA 1UNSA 1SE3A 1L0VB 1ZDVA 2KWDA 1MVKA 2WXMA 4L23A 2ONQA 1B9RA 1E7PB 3E9SA 1TZOA 1UUPA 2XNAC 2ICIA 5BYQA 2V3NA 3BYYB 1IGDA 2WS3B 1K52A 2R61A 5GXGB 1PFDA 4KKJA 2IDYA 1DYQA 1F0ZA 2MEKA 2WU2B 1AN8A 4N58A 1VZ8A 3LB8C 3P63A 3LYYA 3ZJUA 1IBXA 5BYRA 4L1BA 4ZRPA 2K0PA 4DXFA 5BMIA 4MM3B 2MJDA 4NZLB 3Q8CA 2G9HD 2LEKA 4IKGA 2FUG1 3BIID 4P16A 4B0MA 1RFKA 2L83A 1L4ZB 1SJHD 1E9MA 1ZP0B 1SE2A 1LO5D 2K5PA 1PDXA 5D3DA 2K9XA 1TJEA 3SEBA 1Q10A 4OHJA 3BYTB 1I7HA 3NVWA 3P4QB 2I38A 2M19A 1FO4A 4US8A 1XLNA 3PZ8A 1NYQA 2Z8LA 4RGTA 1ET6A 1R7SA 3ZGZA 1STEA 3BVGA 4YT0B 2TSSA 4JX1C 1FXAA 1N62A 1TKYA 2IPKD 2N7JA 2V0GA 1CQVA 2H88B 4ITKA 3J9CA 1JCKB 1C4PA 1GOZA 3SFDB 2SAKA 3HVZA 4C56C 3B2GA 1L0YB 1PYWD 1KTKA 1QOGA 1ZPSA 2LGIA 3FILB 3R2IA 4LK0M 3NVVA 1MI0A 3AEEB 2FE8A 5LNK1 1TS5A 3AECB 4AQ7A 1ZDXA 3ZJVA 3ZJTA 3AEGB 4N59A 1N61A 5FR3A 3KQ4A 2V4IB 3I9V1 4YTMB 3IAS1 1K53A 3GB1A 2WP9B 3AE6B 1N5WA 1JWUD 1T6BX 1IUEA 2N0SB 1DOIA 3AEAB 5C3JB 2V3PA 2L32A 1M4VA 3BVMA 3AEDB 2PIAA 5G5HA 1D4BA 1FEHA 2EKIA 2MH7A 4GDKB 2WXIA 1MPEA 1NI3A 1KRHA 1DGJA 3URYA 1QOBA 4YSXB 4ARCA 4PT5A 1TS2A 1WRIA 2X38A 3NUHB 5T8IA 3SFEB 1D5ZC 1JQ4A 1SF0A 1GB1A 4RGMA 1HZ5A 2AQ1B 1ET9A 3VRAB 2DLBA 1SE4A 2EELA 5JXVA 4TQ1A 1XCTL 1VRAB 1WXQA 2WDVB 4OZCA 1YMHE 1C4AA 1XEEA 5H8YE 2W55A 3KWLA 3AE7B 1E10A 1FFVA 1XCQL 1C76A 4AS1A 5HHDG 4DXGA 1FM0D 4J3OD 2B76B 4P6VF 1HZ6A 2E3TA 2Y5CA 1MHHE 4KGRA 1YQ4B 2IGGA 3AV8A 1QOFA 1YJIA 1NEKB 4EE2A 1CK1A 1FRDA 3BK1A 3NVZA 2LHDA 1QQRA 1I4QA 4HRSA 1UWMA 2HDEA 2VZKB 3AEFB 1HQRD 3W2DA 2AX5A 2AQ3B 2WXLA 1L0XB 2LHEA 4IOIE 1D6EC 1FXIA 2WDQB 1JALA 2NTSA 2JYTA 3FAHA 1TKGA 5FK9C 3ETRA 1BMLC 2WLBA 4RF0A 4RF1A 5EE9A 1ZUD2 3PZ7A 2KN4A 2BB5A 1E6EB 2IJ0A 4ZHOA 1IBXB 1FNUA 4UDUC 4C7YA 2JSVX 1GPXA 4A90A 2OHFA 1KFYB 1YN3A 2GB1A 4A8XC 1V1PB 4US9A 2PKOA 2LJIA 2CU3A 5AUIA 3AMZA 3I57A 2LMCA 5H92C 1I4RA 4RH6A 1YN4A 2CJNA 2KACA 1NYRA 2JWUA 5HI1A 4XE0A 3KLSX 1I4GA 1SBBB 3AE8B 2H89B 3NVYA 1C79A 3AE2B 4HKQA 1FCLA 1I4XA 3IXSA 1NENB 1E0ZA 1SSNA 1VR9A 3R8BA 1EWYC 2RDGA 4MACA 4NAWB 1DOXA 5C2TB 4OVZA 3AN1A 3AE9B 1TYGB 1KH0A 1Y56A 1D5XC 2BB6A 3NS1A 1VLBA 4N6EB 3AM9A 1F2RI 1SJED 2N9KA 1TKEA 1AWDA 2RMMA 2XN9C 5FKAC 4ZHPA 4OW0A 5HG2A 3N9YC 1ZXHA 2BS3B 1JWAD 4B0EA 3KWVA 1TY0A 2ACZB 1JWSD 2DYMA 1YQ3B 4ZOHC 4Q2JA 2AQ2B 4WQMA 1PUTA 2J53A 4USAA 1GB4A 3AE3B 2CJOA 2WXJA 3UI3A 2I2YA 1J7CA 1JWMD 3U4EG 2JZPA 2VZKD 3O13A 4WURA 3FC4A 4O1NA 1BUIC 1V97A 1CZPA 1N63A 2ON8A 4KKIA 5HFYA 1IGCA 3MC0B 3V05A 3Q8EA 4IDIA 1N5XA 3WCQA 1SB3C 1T5XD 2DWQA 1VJKA 2KQ4X 2DYOA 2QIEB 2W82A 4KGTA 2SEBD 3Q8AA 1V1OA 2INNE 4YXDB 2J42A 3T3OA 3BVZA 3P1MA 2WXNA 3MHZA 1F77A 2GI9A 4GLSC 1C78A 1P7EA 1L5PA 2BS4B 2ZW0A 3W9CB 4A9AA 3ZYYX 1AW7A 1L6VA 1OQRA 2INPE 3IT6B 4WIPA 3AE5B 4JWUC 1OQQA 1PGBA 3BWUD 3EUB2 2KMMA 4RGNA 2BS2B 2PW9A 4YSYB 5I4DA 4HEA1 3TEZA 1ROEA 1CJEA 4WWMA 4WAFA 1ZE3D 3VR8B 4R3DA 2IGDA 5EE1A 2JQRB 3L4PA 5G5GA 1F2RC 2WXFA 1TY2A 3BZDB 4C7ZA 1NVID 1FNVA 2QEJC 2QMTA 4XWWA 1SXTA 2KDMA 4CQNA 3OWEB 1N60A 1WGKA 4TSSA 4YTNB 3TEWA 3ZQ4A 3NZ3A 4KX6B 1ACCA 3U2SC 2J4XA 1EU3A 2K3UA 4MT5A 3MP9A 3E56A 3U7ZA 4XDCA 1JROA 5TSSA 2NMQA 1XLQA 3VR9B 3IAM1 2PLPA 1JRPA 2W3SA 1J7BA 2WNMA 1EWCA 1L4DB 1DOYA 3P4SB 3B2FA 2J52A 1FFUA 4MH8A 2JX5A 2KAJA 3V3XA 1KLGD 2PVOD 5AUKA 2WXKA 3P4PB 4ZYSA 2WXPA 1FIQA 2K22A 2MJ3A 1K50A 1XXGA 3W1SA 1V1PA 1UWXA 2PMVA 3VQIA 1A70A 3GP7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WQM A;  1PUT A;  4USA A;  1V8C A;  1GAQ B;  1L6U A;  1WWT A;  3AE1 B;  1FRR A;  3AEB B;  3AE3 B;  2CJO A;  1L0V B;  1WXQ A;  1J7C A;  2WDV B;  3HUI A;  4LTU A;  2PVG C;  1B9R A;  1E7P B;  5H8Y E;  2W55 A;  3KWL A;  1YJJ A;  3FC4 A;  1FFV A;  1ZOY B;  3AE7 B;  1E10 A;  3VRB B;  1V97 A;  1CZP A;  1N63 A;  1FM0 D;  1QT9 A;  2B76 B;  2WS3 B;  3CWI A;  4P6V F;  3NRZ A;  5GXG B;  1PFD A;  2E3T A;  2Y5C A;  1F0Z A;  1QF6 A;  2W54 A;  1WYG A;  1YQ4 B;  2WU2 B;  3AV8 A;  4N58 A;  4IDI A;  1N5X A;  1QOF A;  3WCQ A;  1YJI A;  1NEK B;  1SB3 C;  1T3Q A;  1QLB B;  1QOA A;  2DWQ A;  1FRD A;  1SIJ A;  1VJK A;  3LB8 C;  2W3R A;  3NVZ A;  5EE3 A;  3P63 A;  1JW9 D;  2QIE B;  1XLO A;  4HRS A;  2WQY B;  2MJD A;  2LEK A;  3BII D;  3W5V B;  3HRD D;  1UWM A;  3AEF B;  4YXD B;  2AX5 A;  2WU5 B;  3RPF C;  1RFK A;  2L83 A;  3P1M A;  4YTP B;  1FXI A;  2WDQ B;  1E9M A;  1JAL A;  1ZP0 B;  3FAH A;  1TKG A;  5EE0 A;  3W9C B;  1L5P A;  2BS4 B;  4A9A A;  3ETR A;  2K5P A;  1OFF A;  1PDX A;  2HTM E;  2K9X A;  1L6V A;  1OQR A;  1TJE A;  2WLB A;  5EE9 A;  1ZUD 2;  3AE5 B;  4JWU C;  1I7H A;  1E6E B;  1FMA D;  1OQQ A;  2QJL A;  3EUB 2;  3NVW A;  2FBW B;  2KMM A;  3P4Q B;  2BS2 B;  1VDV A;  4FXC A;  3B9J A;  2M19 A;  1FO4 A;  4YSY B;  4C7Y A;  4US8 A;  1XLN A;  1ROE A;  1CJE A;  4WWM A;  3VR8 B;  1GPX A;  1NYQ A;  2OHF A;  1KFY B;  2JQR B;  1R7S A;  5EE1 A;  3L4P A;  5G5G A;  2DBY A;  3W5U B;  4US9 A;  4YT0 B;  4JX1 C;  2PKO A;  4C7Z A;  1N62 A;  1FXA A;  1TKY A;  2CU3 A;  3AH7 A;  1NVI D;  3PO0 A;  5AUI A;  2H88 B;  4ITK A;  4C80 A;  3SFD B;  3DWG C;  4YSZ B;  3AMZ A;  2MJE A;  3ABV B;  5H92 C;  3HVZ A;  2M56 B;  3B2G A;  4JWS C;  1J7A A;  1QOG A;  2CJN A;  1N60 A;  3DWM A;  1WGK A;  1XO3 A;  3NVV A;  1NYR A;  2L52 A;  3AEE B;  4HRO A;  4YTN B;  4ZOH C;  4KX6 B;  4ZHO A;  3LXF A;  2WDR B;  3AEC B;  3AE4 B;  3AE8 B;  2H89 B;  3AEG B;  4N59 A;  3NVY A;  1N61 A;  1ZXI A;  3AE2 B;  1AYF A;  1JRO A;  1NEN B;  4YTM B;  1E0Z A;  1XLQ A;  3VR9 B;  2WP9 B;  3AE6 B;  3VRA B;  1JRP A;  1N5W A;  2W3S A;  1EWY C;  2BT6 A;  1IUE A;  1J7B A;  2N0S B;  1DOI A;  1DOX A;  5C2T B;  3AN1 A;  3AE9 B;  3AEA B;  5C3J B;  1TYG B;  3AED B;  2PIA A;  2G1E A;  5G5H A;  1DOY A;  3CIR B;  3P4S B;  2EKI A;  3NS1 A;  2MH7 A;  3B2F A;  5MPO A;  3SR6 A;  1VLB A;  1NI3 A;  1FFU A;  1JWB D;  3AM9 A;  1KRH A;  4N6E B;  1DGJ A;  2JX5 A;  2KAJ A;  3ZYY X;  1TKE A;  1AWD A;  4ZHP A;  1QOB A;  4YSX B;  1RM6 C;  1WRI A;  3AB5 A;  2PVO D;  1RYJ A;  5AUK A;  3SFE B;  2BS3 B;  1JWA D;  1KF6 B;  3P4P B;  1RWS A;  1FIQ A;  1XLP A;  2K22 A;  1SF0 A;  2MJ3 A;  1JQ4 A;  3P4R B;  2ACZ B;  1YQ3 B;  2Q5W D;  1A70 A; 
#chains in the Genus database with same CATH topology
 3KUD B;  3TFR A;  1D5M C;  4FA6 A;  2HOI A;  2IO1 B;  1Z2M A;  4OZA A;  3ZDB A;  1WE6 A;  4OZB A;  1A77 A;  3M63 B;  3E0F A;  2ISO A;  2BQQ A;  3SMV A;  3QU4 A;  3ETL A;  3Q69 A;  5AM2 A;  4DQI A;  2DYB A;  3TMP B;  3NRZ A;  2KZZ A;  3ZXV A;  3ZNZ B;  2RDH A;  4ARI A;  2XIC A;  2RR9 A;  1AQ6 A;  1FCC C;  5BMH A;  1IM4 A;  1RYR A;  3JPQ A;  3VXW A;  4B9K A;  2W04 A;  5EE3 A;  2AQ0 A;  4M2Y A;  3ZTC A;  2JR5 A;  1UQV A;  1CRX A;  1XLO A;  1ZYQ A;  3BK2 A;  3HRD D;  1P9D U;  2I1J A;  4E3C A;  4FAD A;  2CS4 A;  4LLG M;  2WU5 B;  2JH7 A;  1L7N A;  1HA5 A;  1HEZ E;  1SGH A;  1IPG A;  2OED A;  1BNO A;  5KFG A;  1WY8 A;  1WRD B;  5IA7 A;  5EE0 A;  1D8Y A;  1X66 A;  3IDW A;  2MBE A;  1LVH A;  2AXT U;  4ZRJ A;  2QJL A;  5KT4 A;  3A33 B;  5CHV C;  2B0C A;  1ARO P;  1VDV A;  1WSP A;  8ICW A;  2EAP A;  1KLU D;  5J0X A;  1CUK A;  1VZ7 A;  1YZ6 A;  2I1Q A;  4PGY A;  3I28 A;  2IO0 B;  4XZ4 A;  2HCF A;  4I2H A;  2MBH A;  5J2K A;  1QQ6 A;  1ZQJ A;  3AH7 A;  7ICU A;  1YNT E;  2N9L A;  3ZDM C;  2JZB A;  2AHO B;  4XWT A;  2MJE A;  3ABV B;  3DBH I;  1DK2 A;  3GS2 A;  2PKE A;  1R4N I;  5AK6 A;  1TFR A;  5G2N A;  1KW4 A;  4PK1 A;  3LXF A;  2WDR B;  2KP7 A;  3AE4 B;  2K39 A;  5K4L A;  4NJ6 A;  1AYF A;  1Q46 A;  1L7P A;  3Q8S B;  2WXR A;  4I2J A;  3V6H A;  3M8S A;  2V9H A;  5G55 A;  3VCB A;  2ZJD A;  3TAD C;  3A9K B;  3ZD8 A;  1PGA A;  2Y9U A;  3QUT A;  2K4I A;  2OJR A;  1XF5 L;  2M4N A;  1UPH A;  8ICF A;  4FZL A;  2LJ5 A;  4W9K A;  4FZN A;  5J2F A;  2MA9 B;  3V6J A;  3CIR B;  3D2N A;  1FNW A;  3SR6 A;  4M02 A;  4IWP A;  4ACF A;  1T94 A;  3TEX A;  1TS3 A;  2MRL A;  2J7Q B;  1HIW A;  1V9P A;  2E6X A;  5KFF A;  4PYU A;  1U47 A;  4RNA A;  3EFC A;  4A55 A;  2V3S A;  4DQO C;  9ICA A;  2MLB A;  4DWI A;  2WXQ A;  2IYD B;  2BPF A;  1RWS A;  3NZS A;  5BYS A;  8ICT A;  1TGZ B;  1H8C A;  4FBU A;  4J9P A;  3SD7 A;  3TAQ A;  5ALI A;  3HT3 A;  2JV3 A;  2Q5W D;  4KVG B;  1NJZ A;  3MHS D;  1V8C A;  4NJC A;  2RD0 A;  4QJF B;  2LXA A;  1J2M A;  5IIJ A;  2DPI A;  5J8Y A;  1L0V B;  1ZDV A;  2ZVO A;  4DHJ B;  4F4K A;  5EDS A;  2E1E A;  4L23 A;  2ONQ A;  2EQY A;  2W9N A;  3E9S A;  4FJZ A;  1FPY A;  2DAJ A;  4UBC A;  3N32 A;  2G06 A;  1Z1V A;  2ICI A;  3VTV A;  4KLF A;  1E8Y A;  1TZ1 A;  2DHZ A;  5BYQ A;  5JUM A;  2V3N A;  3BYY B;  3T5L A;  3ZDD A;  4ELT A;  2KD1 A;  1WXM A;  1K52 A;  5GXG B;  4KKJ A;  3AU4 A;  1F0Z A;  1K1Q A;  2K4H A;  2WU2 B;  4N58 A;  1AN8 A;  4EZJ A;  3ZLZ A;  2E1F A;  5L83 A;  2INC C;  5ALY A;  3JPP A;  3DEE A;  4JV1 A;  3P63 A;  3QA8 A;  4MJS A;  3IN5 A;  4J6I A;  5KFX A;  5KG3 A;  1AAR A;  5DGB A;  1L3S A;  2LGS A;  4DQS A;  1OXJ A;  2FIF A;  4P16 A;  4DSK A;  2ZIW A;  4B0M A;  3PZD A;  4AOF A;  2HVH A;  1KFD A;  2KDB A;  2G5I B;  7ICQ A;  2B3A A;  4HWI B;  3CNH A;  4CRX A;  4YXJ A;  5TIS U;  2BQR A;  1TJE A;  3SEB A;  2KLG A;  2VJ4 A;  4M0A A;  1HEK A;  1Q10 A;  5AK3 A;  3NVW A;  4EEL A;  3CSF A;  3PRP B;  4GMV A;  4FE3 A;  4JL9 A;  4DLG A;  4F4Y A;  4US8 A;  2KHW B;  2LI5 A;  3PZ8 A;  3A1Q B;  1NYQ A;  4M9G A;  1XD3 B;  1ET6 A;  1R7S A;  5IIK A;  3EWA A;  2KJ6 A;  3N1Z C;  3QU5 A;  2MU2 A;  1XO0 A;  1JRU A;  2TSS A;  4JX1 C;  2W11 A;  5AI5 A;  1KFT A;  2IPK D;  2LYH A;  1CQV A;  3QX7 A;  5AIC A;  2H88 B;  1JCK B;  4BBN F;  2HJ8 A;  4P4O A;  4O5E A;  4IR1 A;  4C56 C;  3B2G A;  4LK0 M;  1KTK A;  2ASQ A;  2IOH A;  4I2F A;  2KHV A;  5ALX A;  4GXJ A;  3AEE B;  3ZXR A;  4BBN C;  2QB1 A;  3HPO A;  3PW4 A;  1F44 A;  3TFS A;  2CRX A;  2JZZ A;  4WWO A;  3ZJT A;  1NZB A;  4N59 A;  3VUW A;  3I9V 1;  4YTM B;  2LAS A;  4ANW A;  5J0Y A;  1EF5 A;  1N5W A;  1T6B X;  4DOB A;  3H7P A;  4EBD A;  1DOI A;  5T14 A;  2AH5 A;  5C3J B;  2L32 A;  5E6N A;  4C8K A;  3AED B;  1SV0 A;  5AIB A;  1WR6 E;  5G5H A;  5LLI A;  2B6G A;  3T5H A;  1FEH A;  2EKI A;  1NI3 A;  1MPE A;  5L1K A;  3GV7 B;  4G0N B;  2QB0 A;  1RXW A;  1KN5 A;  4PT5 A;  4I2G A;  2X38 A;  1D5Z C;  3W1Y A;  1GB1 A;  4RGM A;  3UGB B;  4DS4 A;  5KT3 A;  1U48 A;  3QK0 A;  1LM8 B;  2KHQ A;  5AI0 A;  3ZDC A;  2I6X A;  1S0O A;  3KYC D;  4DHZ B;  3AL0 B;  3KBB A;  4PJ0 U;  7ICL A;  2KN7 A;  3T9L A;  2KVC A;  3UQ0 A;  1S0N A;  3BDP A;  5KAI U;  4IR9 A;  4JWN A;  4O3O A;  3B08 A;  2JWZ A;  2BZF A;  4AS1 A;  5HHD G;  4TV3 A;  4XA5 A;  5HNK A;  3L17 A;  4OO1 J;  4DBG A;  4GSW A;  3OAW A;  3UQ2 A;  3PT2 B;  2VKQ A;  4P6V F;  3MDC A;  1HZ6 A;  3RB0 A;  3PML A;  4W9I A;  3RNB C;  2R8I A;  1SL1 A;  2Y5C A;  2D3C A;  2H3F A;  2HI0 A;  3AV8 A;  2RRD A;  2K8B B;  2NO4 A;  1YJI A;  3KKA A;  3V6C B;  3TI0 A;  3N3K B;  2HBL A;  1FRD A;  4I6N B;  2JEI A;  2XI9 A;  3BK1 A;  1I35 A;  1N6Z A;  2HOF A;  4P0P B;  3LK9 A;  1JMS A;  4HRS A;  2WX1 A;  3NG0 A;  2RQ5 A;  3RNF C;  1V86 A;  4G3X B;  4JLC A;  1UWM A;  1V49 A;  4KV2 A;  1HQR D;  3W2D A;  2G4D B;  1ISN A;  3U26 A;  1L0X B;  4IOI E;  1D6E C;  1WF9 A;  2NTS A;  2JYT A;  2GO7 A;  3K4G A;  5GTI U;  5FK9 C;  3L3F X;  3IG5 A;  3O65 B;  4J9R A;  4RF0 A;  4Y2J A;  3RB4 A;  4RF1 A;  3PZ7 A;  2G5H B;  1WX7 A;  1MSW D;  3SDL C;  2GH1 A;  1ZQQ A;  2J6T A;  4EYH B;  5DBC A;  4B9S A;  2Y0S F;  3H0M B;  4UDU C;  3VFK A;  4PS7 A;  2JSV X;  4A90 A;  1QLN A;  1YN3 A;  4ECR A;  5KHO A;  2Y0S C;  4R65 A;  1E90 A;  4CF4 A;  2K6Q A;  3KYD D;  7ICE A;  3I57 A;  3N20 C;  3IG3 A;  1YN4 A;  2CJN A;  2KAC A;  4DEZ A;  5KFU A;  2BKE A;  1NYR A;  5HI1 A;  5KG5 A;  2YB4 A;  1TAU A;  3KLS X;  2ODG A;  3PGE A;  4IWO A;  2UVR A;  1YX6 B;  5JRT A;  1P98 A;  3MBY A;  2ZVN A;  4WJ3 B;  2MUT B;  1I4X A;  3IXS A;  1NEN B;  5HR6 A;  1VR9 A;  2LXC A;  5KFL A;  1URJ A;  3L10 B;  3RJK A;  1EWY C;  2LM1 A;  2CKH B;  2ZJ8 A;  3OGU A;  2FLN A;  4DF8 A;  2RDG A;  2Z0E B;  3AE9 B;  3I63 C;  4MAC A;  4OVZ A;  3SU8 X;  1ZJM A;  2VIX A;  1H38 A;  5AKG A;  4FN2 A;  2EZX A;  2ZIU A;  1SE9 A;  3RH6 A;  2ZJA A;  1MN8 A;  1WFY A;  3M95 A;  5EWG A;  4MGI E;  4P4M A;  4A8E A;  4RQ0 A;  2ZEQ A;  1F2R I;  2RMM A;  2JEG A;  2PMZ C;  5BOL A;  4RQ8 A;  4RU9 A;  2ZIV A;  1ZXH A;  3EHV A;  3A9J A;  4B0E A;  2Z59 B;  3M9N B;  4NY0 A;  2K6D B;  1SKS A;  1IP9 A;  2KIV A;  1YQ3 B;  4BOS C;  3WAO A;  2KG5 A;  1I42 A;  2AQ2 B;  1OEY J;  1UGM A;  4O5K A;  4NLZ A;  2JY6 A;  2I2Y A;  2REX A;  4MF2 A;  1SXD A;  4FJY A;  3U4E G;  5KFZ A;  2JZP A;  2YX8 A;  1ZQ1 C;  3OHA A;  5J0T A;  5KFV A;  3Q3M C;  4WUR A;  5KFR A;  3RBE A;  1J2N A;  3F2C A;  1CZP A;  2JUO A;  2Y1J A;  4KKI A;  3PO4 A;  5HFY A;  2KYW A;  2KFK A;  4ANU A;  2G45 B;  4ECU A;  4IWQ A;  2KJ5 A;  3PW7 A;  3PHW B;  1WZ0 A;  5AKZ A;  4IDI A;  3RUI B;  2YVC A;  5D2M B;  3TBL D;  2GBM A;  4M47 A;  3R3M A;  3VH4 B;  3A4S C;  4BWM A;  2Z0D B;  2W82 A;  1PVP A;  1UD7 A;  2JMG A;  4HYK A;  1VCB A;  2NCN A;  2EZZ A;  1WCN A;  1SKR A;  2KTF A;  3C2K A;  4LZD A;  3R7R A;  2QDF A;  3TAP A;  2KLC A;  2WXN A;  4Y2V A;  2XGP A;  2M1M A;  3L0W B;  3F5E A;  1JXL A;  1C78 A;  2K25 A;  2BS4 B;  2ZW0 A;  5DPW A;  8ICC A;  4QZ8 A;  1L7M A;  1OQR A;  2RDB C;  3WU2 U;  3IT6 B;  4OVV A;  2WAQ F;  3U8Z A;  4NJ7 A;  3EUB 2;  4YR0 A;  4DQR A;  1BPY A;  4M00 A;  4YSY B;  2FLL A;  5KG2 A;  5IIL A;  3RI7 C;  3L4P A;  1ZD2 P;  9ICB A;  2J0M A;  4ELU A;  1V81 A;  3PHX B;  2DZM A;  1V2Y A;  3SEI A;  4IM3 A;  1FNV A;  3PY8 A;  4GOC A;  3RH4 A;  2KWC A;  3EFU A;  3RRG A;  2RHF A;  3WKA A;  3Q2A C;  1RRB A;  1WGK A;  2YN4 A;  2L05 A;  9ICS A;  2QC8 A;  3ZQ4 A;  5AKY A;  2KDE B;  2J4X A;  3L13 A;  5DQH A;  3MP9 A;  4DSJ A;  2WYQ A;  3SV3 A;  2CR5 A;  5AZF A;  2E5S A;  1L7Y A;  1GNU A;  4NAW A;  5TSS A;  1BPZ A;  3OSN A;  4WJP A;  1SXE A;  4F2S A;  5AZH A;  3VR9 B;  4E0D A;  1ZRN A;  1JRP A;  3WK4 A;  1ZQC A;  4DLE A;  2RPQ A;  2L0T A;  4QZF A;  3B2F A;  3PSP A;  4ECQ A;  2P66 A;  4NL9 A;  1FFU A;  3SAH A;  2XID A;  4HPP A;  5CRX A;  1XT9 B;  2YMQ A;  1ZQF A;  2PVO D;  3P4P B;  4ZYS A;  5L95 C;  2OOB B;  5KFE A;  3PNC A;  2MJ3 A;  2BQU A;  2BKR B;  2G09 A;  4CDG A;  2N1R A;  5J0S A;  3RAX A;  2AGQ A;  1X9S A;  3W1S A;  1ZW7 A;  3VQI A;  4RQN A;  4FUL A;  4DO9 A;  2DFL A;  2V1Y A;  3C0R B;  1MG4 A;  2JYE A;  4BJQ A;  4KGS A;  1WIA A;  1WWT A;  2LVO A;  3AEB B;  3DPD A;  3FM9 A;  4IQU A;  1M6Y A;  5AK4 A;  3EGR A;  5DKW A;  1PZN A;  4OD0 A;  1Z1B A;  4Y2T A;  4S0R A;  4QZ9 A;  2J6U A;  2FPM A;  4PHD A;  2KIC A;  1YJJ A;  1ZOY B;  3VRB B;  3AU5 A;  2DUY A;  1WI0 A;  4KMU A;  1ZQY A;  1Z3E B;  3RFZ B;  2H3V A;  1KLN A;  1UGJ A;  3CWI A;  4Z6F A;  5JH5 C;  3M6K A;  3DBL I;  4PYZ A;  2C60 A;  4RFB A;  1UCV A;  3KFU F;  1MHX A;  3E58 A;  8ICH A;  9ICR A;  3S2A A;  1T3Q A;  5AKE A;  3CMM B;  2DF4 B;  1QOA A;  2GLS A;  1SIJ A;  3C19 A;  4FO6 A;  2YEP F;  5KFS A;  1JW9 D;  3SYZ A;  1JML A;  5E6J A;  4HPL B;  4HVB A;  2EMS A;  2R8H A;  4JPS A;  1OTR B;  4NXZ A;  1NK7 A;  3P42 A;  4WH4 A;  4KIK B;  2UVW A;  5AI8 A;  5D7G A;  1QCK A;  1HJP A;  4NM1 A;  2FI1 A;  2Y3A A;  4HKZ E;  4KZC A;  4ED0 A;  1ZQA A;  3BQ0 A;  2XBB C;  1PUZ A;  2D11 A;  2WAQ C;  5DPT A;  3L16 A;  1ZKH A;  2PEA A;  2ZCB A;  4FXC A;  5IN7 A;  3B9J A;  5HP4 A;  3V7J A;  4ZYN A;  5KFJ A;  2OXO A;  4DFK A;  1ZQM A;  3W5U B;  3F2D A;  2F1I A;  3C2M A;  1B1Z A;  3H1U A;  2AYO B;  3WAM A;  1RZT A;  7ICP A;  2IO3 B;  1RYU A;  1Q3U A;  4C80 A;  3JSV A;  4HPM B;  2V4Q A;  1OEY A;  3PZP A;  2M56 B;  1Q8K A;  2PFP A;  3KHR A;  2MRP A;  1XO3 A;  4M9H A;  2CU1 A;  1UZX B;  2BCS A;  3H6N A;  4M0W A;  1ZET A;  3CW2 C;  3UXO A;  4G11 A;  2BHN A;  2W9M A;  4XGA B;  1KTQ A;  2O2V B;  2ISP A;  3U30 A;  1GC7 A;  4HJG E;  2EAO A;  3HWT A;  4AP4 C;  3WK6 A;  3VTU A;  4CCH A;  1QIL A;  3IBE A;  3OJ4 B;  2NO5 A;  2WXO A;  5J2E A;  3A4R A;  3R66 C;  1C77 A;  3TL5 A;  2WB1 F;  3ALR A;  3H8H A;  4KDI C;  1UHU A;  4A6Q A;  5IP4 D;  2B21 A;  2ZIV B;  2ASD A;  4KLE A;  3KH0 A;  2G1E A;  3KZX A;  2BDU A;  4YXM A;  1UH6 A;  2QIL A;  3TEY A;  3TCA A;  3VUY A;  3Q3F A;  5KG6 A;  3V7K A;  3FIL A;  2FPL A;  5L9X A;  1RM6 C;  3ECI A;  3AB5 A;  2NRT A;  3NGD A;  4HK2 A;  4ECT A;  1XLP A;  4XDD A;  5KL1 B;  4W9C A;  1SGG A;  5KFM A;  2RPV A;  3M1Y A;  2AU0 A;  5CA7 A;  2HE7 A;  2YEP B;  4PH5 A;  8ICU A;  2ZUB A;  1ZQK A;  5ALO A;  1C4C A;  1VZ6 A;  1PK1 B;  1L6U A;  2GBK A;  1FRR A;  3V61 A;  2KWD A;  3K1Z A;  3H0L B;  7ICO A;  1E7P B;  2DKZ A;  5J0U A;  3V60 A;  1WWV A;  4F4W A;  2V4L A;  1WJN A;  2XNA C;  1CMX B;  2HJ1 A;  3RFA A;  4DSE A;  1QQ7 A;  4UW9 A;  4RUC A;  1T0Y A;  3WAP A;  3C21 A;  2WS3 B;  4I2B A;  4BKS A;  2EH9 A;  2D3B A;  2IDY A;  3VH3 B;  3RJJ A;  3WAN A;  5ALZ A;  2MEK A;  3QU7 A;  4A3O A;  1OW5 A;  2D8C A;  8ICK A;  3MC1 A;  2DQN B;  4EEN A;  2HTH A;  1ZQR A;  4KLJ A;  1D8B A;  2IBK A;  3H7S A;  3H7I A;  4MM3 B;  4NZL B;  1YJ1 A;  4PS3 A;  3BII D;  4X5V A;  4Y2S A;  4FS1 A;  1Z19 A;  1RQL A;  4B9M A;  1GC6 A;  1RFK A;  2L83 A;  1XNS A;  1SJH D;  3RBD A;  4B9L A;  1WXA A;  1SE2 A;  3WAL A;  5L1M A;  2K5P A;  2JH1 A;  1PDX A;  2ZTD A;  4UB2 A;  4OHJ A;  3BYT B;  2JGA A;  3BQ2 A;  2N7D A;  3P4Q B;  1L6N A;  4RNN A;  4Y2X A;  2M19 A;  4IW0 A;  1WMH A;  1ZQS A;  3B0Y A;  1PK3 A;  2YY6 A;  3ZGZ A;  9ICV A;  1STE A;  4MM3 A;  2VRR B;  3G6V A;  3BVG A;  4NY8 A;  4YT0 B;  2BQ3 A;  2XEW A;  3H8J A;  5J2G A;  5C0Y A;  4UAZ A;  2FMS A;  2WDT B;  1D3Z A;  2KWU B;  2ESE A;  3HIZ A;  3PSI A;  3QXG A;  2RDJ A;  3HX0 A;  2SAK A;  2ALZ A;  2BCV A;  4M9N A;  5CHW A;  4MH0 E;  1L0Y B;  1QOG A;  3FIL B;  2FCS A;  3R2I A;  4JQW C;  1MI0 A;  7ICJ A;  3QAQ A;  5LNK 1;  5TR5 A;  1TS5 A;  3BS7 A;  4AQ7 A;  4NV0 A;  2G07 A;  2XCP A;  3HK0 A;  4B6W A;  3DQV A;  1U4A A;  4EFO A;  1NNL A;  1TAQ A;  5J0O A;  3IAS 1;  8ICG A;  2MA1 A;  2YB1 A;  8ICM A;  5HKH A;  4RMA A;  4MHV A;  2L8J A;  2YML A;  3AEA B;  3NS8 A;  1M4V A;  2KTR B;  4YVZ A;  4DF4 A;  2PIA A;  5J17 A;  2AGP A;  1X6J A;  5J2D A;  4M0W B;  2WXI A;  2C7N B;  5KG1 A;  3PV1 A;  5IAA C;  2GBR A;  2KVS A;  5AK5 A;  2VA8 A;  5L1J A;  1QOB A;  2XY7 A;  1TS2 A;  1WRI A;  3JPR A;  4GIV A;  5T8I A;  2AGO A;  4IUM B;  8ICZ A;  4EEW A;  5AM4 A;  1E8Z A;  1JQ4 A;  2M0N A;  5L1I A;  1HZ5 A;  1P3Q U;  2BYF A;  1ET9 A;  2Q4T A;  5ALR A;  1SE4 A;  2EEL A;  4WAA A;  5JXV A;  1ZQH A;  4UB1 A;  1VRA B;  1XS9 D;  4Y2P A;  2X8X X;  1YMH E;  1S9F A;  4GDL A;  4DFD A;  3EW9 A;  1UA0 A;  4II3 B;  4E74 A;  3PPA A;  1SIF A;  1FFV A;  4J9L A;  1C76 A;  1J8C A;  2UVV A;  2D2Q A;  1XO1 A;  1FM0 D;  5ALL A;  2JRH A;  4J3O D;  4UAR A;  9ICJ A;  2E3T A;  4B9U A;  2KJH B;  2IO2 B;  3PR4 A;  1YQ4 B;  4FBJ B;  4C4V A;  1O03 A;  4LJX A;  4RT2 A;  4UB3 A;  1HTO A;  4QZA A;  4ICA A;  4WJN A;  9ICP A;  1WMH B;  3NVZ A;  4R66 A;  2LHD A;  1U9L A;  5KG7 A;  4F91 B;  4DL2 A;  3CYM A;  3H4B A;  1QQR A;  4EOY A;  3GQC A;  2PI4 A;  5TZV A;  4GLX A;  4R63 A;  2HDE A;  5JHB A;  1TK5 A;  2MSN A;  2AX5 A;  2AQ3 B;  3CRX A;  1WGH A;  4NLG A;  2WDQ B;  3ZNH B;  1TKG A;  4Q8E A;  4DL5 A;  1WJU A;  2HBJ A;  3ETR A;  3I1Y A;  2AL6 A;  3S6J A;  3PSE B;  2HVI A;  1WGR A;  4CF3 A;  1FNU A;  1XSL A;  2K4P A;  3GE3 C;  2OHF A;  4Q45 A;  5J2I A;  2L5Y A;  4I2E A;  5KFI A;  2KSO A;  2KZR A;  1V1P B;  5DG7 A;  2LJI A;  2A3V A;  2CU3 A;  3GFK B;  3WK8 A;  9ICO A;  8ICL A;  3RZW C;  5BO4 B;  4M6W A;  5ALT A;  2NVU I;  3AMZ A;  4IS7 A;  1NKE A;  2LMC A;  2LRU A;  4EKU A;  4RQ5 A;  5D49 A;  2QAR A;  2MSE D;  4K4H A;  5ALV A;  4XE0 A;  2ASJ A;  4A20 A;  4EZK A;  1I4G A;  4M8M A;  3CF6 E;  3AEV A;  3PX6 A;  2D10 A;  3DBH B;  4DL4 A;  1E0Z A;  3FKY A;  3RN9 C;  4KLS A;  9ICH A;  8ICX A;  2C22 A;  1NDD A;  2ZIU B;  3PTF C;  4NAW B;  5C2T B;  4F5O A;  3APC A;  1KH0 A;  2W03 A;  2UU7 A;  5AHX A;  2FJ6 A;  3AU2 A;  1D5X C;  5KT7 A;  3D2S A;  2BB6 A;  4KX5 A;  5AM1 A;  2ZPN A;  3DHG C;  4YQW A;  2XY6 A;  3RUL A;  2QLT A;  3UIP B;  5JTI A;  2KC2 A;  4FJV B;  4TUU A;  4YD1 A;  1L8L A;  5FKA C;  3RNA C;  4AJW A;  3TAC B;  3PR5 B;  3V6K A;  3RB6 A;  4GC6 A;  3AUO A;  2WWZ A;  4KLM A;  3Q3O C;  1A6S A;  4OW0 A;  2BS3 B;  2HD5 B;  2IY0 B;  2FDR A;  3RZF A;  1B22 A;  4F4Z A;  2K8C B;  1D9D A;  3Q14 C;  2ACZ B;  2BWF A;  2F2A B;  4XYC A;  4DL6 A;  4ZOH C;  4AYB F;  2LUE A;  2K4E A;  4WQM A;  2J6S A;  2MP2 B;  2DEN B;  3AE3 B;  2CJO A;  9ICT A;  1J7C A;  4RQ1 A;  2WF7 A;  4RQ3 A;  2KNJ A;  1K8R B;  2LRW A;  3CST A;  3DDC B;  4M8N A;  4QZE A;  3L54 A;  4LNF A;  2VZK D;  4BX9 C;  3FC4 A;  5HHI A;  2W9C B;  3AQE A;  1ZD5 A;  1WXS A;  1BVS A;  1DXS A;  1IGC A;  2KVZ A;  3MC0 B;  2C2R A;  4IQT A;  5AKJ A;  3NY5 A;  8ICO A;  1WUD A;  2XK5 A;  3Q8E A;  1ZQW A;  1K5O A;  1ZGU B;  3WCQ A;  9ICC A;  1SB3 C;  1OUQ A;  4RNM A;  5ALQ A;  1T5X D;  3LJ3 A;  1VJK A;  4MFA A;  4M01 A;  3ONS A;  4ZH4 A;  2BGF A;  1F52 A;  2L7R A;  4XC2 A;  2KOX A;  1X9X A;  5F9N A;  4KGT A;  2SEB D;  2V9W A;  4G50 A;  2INN E;  3T3O A;  2IMW P;  2KVR A;  2KMC A;  5KFB A;  4LCD E;  2VH1 A;  3BVZ A;  2HW3 A;  3ENE A;  3MHZ A;  4BFR A;  2LYB A;  2GI9 A;  3SHQ A;  3J81 j;  3GE8 C;  2G3Q B;  4RQM A;  1IIP A;  1P7E A;  1ZOL A;  1L5P A;  4YD2 A;  3W9C B;  1QSY A;  4A9A A;  4C4V B;  4F8C B;  1AW7 A;  1L6V A;  4WIP A;  2ZIX B;  1KSP A;  3AE5 B;  1OQQ A;  1PGB A;  2K1F A;  4JWU C;  3BWU D;  2LVP A;  4KLI A;  1WM2 A;  4BKT A;  3DVN V;  5I4D A;  4HEA 1;  1ROE A;  1CJE A;  4WAF A;  2XY5 A;  4R3D A;  2IGD A;  5EE1 A;  2F3N A;  5G5G A;  5CR0 A;  4O5C A;  1WX8 A;  2IY1 B;  2WXF A;  3QAR A;  3T3F A;  2UWQ A;  2HBK A;  5B5E U;  5JU5 A;  1SL2 A;  4DSL A;  3RNE C;  5J29 A;  4R64 A;  4TUS A;  4RT3 A;  2PFO A;  4XWW A;  1SV0 C;  2ZXI A;  2XO7 A;  2ES6 A;  2JXJ A;  5ALF A;  1Z00 A;  3AXC A;  3MR2 A;  1MC8 A;  4TSS A;  1B0X A;  4YTN B;  3KTQ A;  2OYY A;  1V6E A;  4KX6 B;  3VDZ A;  3U2S C;  4F71 A;  4CE6 A;  2JF5 A;  1U45 A;  3PS6 A;  4P1B C;  4A3P A;  4MT5 A;  1T0R C;  4I2C A;  1YIW A;  2N7E A;  2R2O A;  1JX4 A;  4PL2 A;  4UB4 A;  2BCU A;  4KTQ A;  4K7U A;  3O0F A;  2Q0Z X;  1RFA A;  1KJT A;  2PLP A;  3MFH A;  2IA6 A;  2VJ5 A;  3UIN B;  2C7H A;  3B0X A;  3D6J A;  5AKL A;  1EWC A;  4GXB A;  1RQN A;  1L4D B;  4NNJ B;  4OJL A;  4QNL A;  1V9J A;  3RT3 B;  2NS5 A;  4GN1 A;  2J52 A;  2F8L A;  4PL1 A;  1N2X A;  1DGS A;  4RPY A;  3ZNI D;  2K8C A;  2L3Z A;  4ICV A;  4UB8 U;  4KN4 A;  1KLG D;  3SAF A;  4KLT A;  4GC7 A;  2WXK A;  4F8R A;  4Q43 A;  5AUK A;  2WHI A;  4BOZ B;  1XXG A;  7ICG A;  1JN3 A;  3UF8 A;  4ED1 A;  2JRI B;  1T3N A;  2JHD A;  4EEY A;  1RG6 A;  2AJQ A;  1FEZ A;  3MJ5 A;  2LBO A;  3UMC A;  5KNI A;  2C5L C;  2Y5B B;  3KKA C;  5CB1 A;  4LTU A;  2PVG C;  3IRU A;  4KLQ A;  1C9F A;  3T5J A;  5AZG A;  3M9M B;  2HHX A;  5BMG A;  1T8E A;  3H0R B;  8ICN A;  1QH9 A;  1B4F A;  1XC9 A;  2D6F C;  2L0F A;  5J0R A;  3NRW A;  2KFJ A;  3K9O B;  3QHT A;  2ZNV B;  2FCN A;  1NKB A;  3MC9 A;  4QZI A;  1D9F A;  1Z4O A;  5KT6 A;  4REZ A;  2W54 A;  3GV8 B;  3L5K A;  3MAB A;  3DBS A;  4H2A A;  5KG0 A;  3TSS A;  1QLB B;  1R4N B;  2W8L A;  8ICA A;  3N7S C;  4DDG D;  3Q8B A;  1I4H A;  3T3N A;  4PHE A;  4PPX A;  3V6E B;  4LZG A;  2H3Q A;  1O08 A;  4DK5 A;  2ZIX A;  3H8M A;  5DG9 A;  1TS4 A;  4F7Z A;  1T0Q C;  1EM7 A;  3MGI A;  5ALW A;  3MFG A;  4F1S A;  3EEC A;  1NK8 A;  1WR1 A;  4JV0 A;  2W43 A;  5J2J A;  2VAN A;  1EO6 A;  1S1Q B;  5J0W A;  3MGH A;  2WXH A;  3RPF C;  4YTP B;  4K7S A;  3QC8 B;  1K51 A;  3L08 A;  3EA6 A;  2D5G A;  2KWV B;  4QWB A;  3Q8M A;  2KX0 A;  4W9F A;  2IOF K;  4F72 A;  1QSS A;  4RQ4 A;  5A0L A;  3OJS A;  1LXD A;  2BW2 A;  1FMA D;  4BXO B;  2FBW B;  5HR7 A;  2JPH A;  2ZNV C;  4WWN A;  4F5N A;  2A1A A;  5KTQ A;  4JWM A;  1YN5 A;  5KFO A;  2BTE A;  5DB9 A;  3HVD A;  4D2K A;  2OH2 A;  4YP3 A;  2FID A;  4NLC A;  4QWA A;  2E8M A;  1WGD A;  2W8K A;  3RH5 A;  2WXG A;  2BDP A;  1CI4 A;  2PI5 A;  3Q8F A;  3PLV A;  3ISD A;  4I6L B;  4YWG G;  4JWS C;  4NLN A;  2K8B A;  2GMI C;  4AWJ A;  1PGX A;  4NAM A;  4GDK A;  1F1H A;  3KZI U;  5AIA A;  4XX5 A;  5D3I B;  5KFW A;  2F1J A;  3PMN A;  1N56 A;  4WWP A;  2HMX A;  1ZQG A;  4QAY A;  2BYT A;  2M0A A;  1QKZ A;  9ICL A;  4WQO B;  2KK0 A;  1T7P A;  1V5T A;  1M94 A;  3TUO A;  3UXN A;  3A9J B;  3JPN A;  3C1Z A;  3WA0 A;  2WFA A;  5D6J B;  4AP9 A;  3M9O B;  4RGO S;  1JWB D;  1TBE A;  4YN4 A;  3RF9 A;  1PVR A;  4TMA B;  1SV4 A;  3N1Y C;  4TQ0 A;  4CHK A;  4XQ8 A;  2XGQ A;  2IGH A;  1KF6 B;  2E8N A;  2LHT A;  3DBL B;  4MEM A;  1X1M A;  3P4R B;  4BKS D;  3AI5 A;  5LXI B;  1ESF A;  3OJ3 A;  1UT8 A;  2I1K A;  3M62 B;  1Y88 A;  2ZW1 A;  3GII A;  2KTR A;  4UAT A;  2JZB B;  4BDP A;  1IG6 A;  1EU4 A;  1UNS A;  1SE3 A;  1YX5 B;  2WXM A;  1FXT B;  5ALS A;  3ZRC A;  4ECS A;  1B9R A;  4GB9 A;  4B6J A;  5KFN A;  9ICI A;  1TZO A;  1UUP A;  5IOI A;  4EZ6 A;  4R8U A;  2UVU A;  2JZ3 B;  2LM4 A;  1KFS A;  4ZRI A;  1UA1 A;  2KK8 A;  2NPT B;  2KFN A;  3PLU A;  2RP5 A;  4UB6 U;  2MBO A;  4HCP B;  1X2I A;  4FS2 A;  3RJE A;  4KMO B;  5DLF A;  3NHE B;  2KSO B;  3WKC A;  3OPX A;  1JUD A;  1ZQX A;  1VZ8 A;  4KIK A;  4MJS B;  3ZJU A;  5CWR A;  3LDA A;  1J0G A;  4L1B A;  4DXF A;  3Q8C A;  2G9H D;  2LEK A;  3ZDT A;  2FUG 1;  1XSN A;  1WE7 A;  5IIM A;  2ZUC A;  2JXX A;  3ONN A;  2KJ9 A;  3PRE A;  4ELV A;  4O3N A;  8ICS A;  4URK A;  7ICV A;  2KOB A;  1P0R A;  1ZP0 B;  4F5Q A;  3OSP A;  4X57 B;  1NKC A;  1NK4 A;  2K9X A;  4C4T A;  3UIO B;  1H4R A;  1I7H A;  3TAD A;  1EUV B;  2FAZ A;  2PXI A;  4TUQ A;  9ICN A;  2I38 A;  4DQQ A;  3ICX A;  2ZG6 A;  3SEN A;  1XLN A;  2KAN A;  4NQK E;  2R8K A;  2NRX A;  3KOO A;  3BIN A;  1HE8 A;  3SV4 A;  2C7M B;  2BYV E;  4C8M A;  1ZQZ A;  1FXA A;  1N62 A;  1TKY A;  1NJX A;  1GJZ A;  4HXD A;  3PRM B;  4ITK A;  2KN5 A;  3MR6 A;  3J9C A;  1ED1 A;  5KFA A;  4NQL B;  4OJO A;  3SFD B;  3ZDA A;  3NUQ A;  3HM3 A;  3X23 A;  4AUQ C;  1S5L U;  2N9X A;  4RPZ A;  2NBU A;  3HVZ A;  1PYW D;  4O3P A;  5ALK A;  3V7L A;  2LGI A;  3RCZ A;  4ED6 A;  3NVV A;  8ICY A;  3ISB A;  2GLE A;  5CP2 A;  4TUR A;  4Y2Y A;  2FE8 A;  2VA2 A;  2QKQ A;  3AEC B;  4O3R A;  1QQ5 A;  3ZJV A;  1X42 A;  3TIX A;  4C4R A;  2A1J A;  3VHT C;  2V4I B;  1WCL A;  4UAU A;  4PGQ A;  5ALD A;  3GB1 A;  5C5J A;  2WP9 B;  1TAM A;  5HML A;  4KN7 A;  2NBV B;  2RSU A;  5AKX A;  2V3P A;  3BZC A;  4NWI A;  4P4P A;  3TKA A;  3BVM A;  4DL7 A;  1KLV A;  2BYE A;  4GDK B;  2MH7 A;  1KOT A;  3DVN U;  4C0Z A;  1DGJ A;  3URY A;  2JRZ A;  5JZE B;  5D4B A;  1WM3 A;  4YSX B;  3LDZ E;  4ARC A;  3GZN B;  1C7Y A;  1QTM A;  1BPX A;  3UQA A;  2GWS A;  3H7P B;  3PX4 A;  2AQ1 B;  1Z4N A;  3DV9 A;  3PVX A;  3VRA B;  2BPS A;  2DLB A;  1ZQB A;  4BGD A;  1WXQ A;  1YT3 A;  2WDV B;  4I6P A;  1NK6 A;  3JPO A;  4OZC A;  1X40 A;  1C20 A;  4DCC A;  1XEE A;  1RAX A;  5AKK A;  5H8Y E;  3NAS A;  3KWL A;  5DPR A;  1E10 A;  4QWD A;  2EDU A;  2L00 B;  2YMP A;  1A0P A;  8ICE A;  3HKZ F;  2B76 B;  5F3X B;  2DZJ A;  3Q8R B;  3NJT A;  3N28 A;  4YMN A;  2N9P C;  1HTQ A;  1MHH E;  1WWU A;  3GIL A;  4II2 B;  4IM0 A;  2A19 A;  2FUH B;  4GGQ A;  2FCQ A;  3WKE A;  1NEK B;  4EE2 A;  5J2H A;  2YLM A;  4LNO A;  3A1Q A;  3R9K A;  1PVQ A;  4LDT D;  4CO7 A;  3GIJ A;  1ZQT A;  1I4Q A;  5CEH A;  4P2H A;  4M9J A;  2IHN A;  1NOM A;  3I3T B;  4RPX A;  1MFW A;  2VZK B;  5ALE A;  4IRK A;  1WG8 A;  5KFC A;  1KRP A;  2WXL A;  2LHE A;  3B1L X;  4JV2 A;  1FXI A;  3TQ1 A;  4BZA A;  1JAL A;  5IO9 A;  2ZIW B;  2FMP A;  2KXJ A;  4W9L A;  1ZQP A;  2HHU A;  1BML C;  4PS8 A;  3ZO5 B;  1OGW A;  2EAN A;  5EE9 A;  1U49 A;  1ZUD 2;  2BB5 A;  2KN4 A;  4Y2Q A;  4TQR A;  1E6E B;  3MR3 A;  1J19 A;  4ED2 A;  2IJ0 A;  3KUZ A;  4LJP B;  1TVA A;  3GIK A;  1QZE A;  4C7Y A;  2NV3 A;  4DS5 A;  7ICT A;  3H8W A;  3MJW A;  3RJI A;  2GB1 A;  4GXK A;  4MSQ B;  5C23 A;  4A8X C;  2VA3 A;  4US9 A;  2K8H A;  4NLK A;  2KZM A;  3SQI A;  2PKO A;  1Y8R C;  4IG7 B;  1L8O A;  5H2F U;  2K60 A;  5AUI A;  1WYW B;  1JI7 A;  4S17 A;  2ZXH A;  2C9W B;  3QX1 A;  4KSK C;  4KLU A;  4DFP A;  4RH6 A;  1X9M A;  3RJG A;  3ML8 A;  1EF1 A;  1WX9 A;  2KKP A;  1WGG A;  2JWU A;  2IOF A;  3KHL A;  4ECZ A;  2XCA A;  3UXP A;  1Q5W B;  4M9L A;  4J9M A;  4XRH A;  3DDH A;  3RNC C;  4OCZ A;  3NVY A;  7ICF A;  2HHT A;  4MFC A;  1UBI A;  2DZK A;  2N9E B;  4HKQ A;  1FCL A;  2HOQ A;  1SSN A;  2LI6 A;  1ZQN A;  2DNF A;  2D07 B;  4ZRK A;  3R8B A;  2WGS A;  4HCN B;  4PZO A;  1NZP A;  2ZTE A;  9ICM A;  1E7V A;  1WZ3 A;  3AN1 A;  9ICU A;  4OVU A;  1TYG B;  3IHP C;  1JIH A;  1RLF A;  3AM9 A;  1SJE D;  1TKE A;  1AWD A;  1ZRM A;  4UB5 A;  4F3O A;  3D32 A;  3N9Y C;  5EOZ A;  1JWA D;  3KWV A;  4Z6C A;  2C2E A;  3QEB Z;  2I5H A;  3QUQ A;  2R8J A;  2L76 A;  4CF5 A;  2NRW A;  1TY0 A;  2DYM A;  5E6O A;  2A5U A;  4Q2J A;  2J53 A;  1TE2 A;  2PJH A;  4OJP A;  8ICB A;  3UI3 A;  3IG8 A;  3MGV A;  3QYP A;  1ZQI A;  3M6Z A;  5AKI A;  2KQS A;  2I9G A;  2Y9T A;  1TIF A;  3THV A;  3QZ8 A;  2MAX A;  4K81 A;  5KFD A;  2DGZ A;  1BPD A;  5ALP A;  4O1N A;  5ALN A;  4C00 A;  2C2D A;  1WGY A;  4HDO A;  2ON8 A;  1N63 A;  3BQ7 A;  3V62 A;  2KE7 A;  2PFQ A;  4I28 A;  2CXY A;  2BPG A;  2MBQ A;  3ZVV A;  3UPQ A;  3UMB A;  2ZZP B;  1KL9 A;  3ML9 A;  2DWQ A;  1L2N A;  1XQQ A;  2DYO A;  5III A;  3F53 A;  1XSP A;  4K7W A;  1LQB A;  3JVZ X;  3VTW A;  4I2D A;  4MEY A;  3SD5 A;  4LJO B;  4ED3 A;  3QUB A;  2BWE S;  3Q8A A;  1E5W A;  1V1O A;  2P6U A;  3N30 A;  2N1V A;  4P0P A;  2FNJ B;  4YXD B;  2J42 A;  2KT7 A;  3Q3N C;  4RM9 A;  3BZK A;  1KBU A;  1F77 A;  3MR5 A;  4GLS C;  3ZTD A;  2R2Q A;  1X9W A;  3ZYY X;  4ANX A;  3NTU A;  5KAF U;  2CN1 A;  3RD2 A;  5IIO A;  3JW0 X;  3PW2 A;  2KMM A;  2J0K A;  4NM2 A;  4UAV A;  1OQY A;  2PW9 A;  3BY4 B;  4C4S A;  4WWM A;  1G6J A;  3A0H U;  1ZE3 D;  2MP2 A;  4TQS A;  3MFI A;  3DHH C;  5BOM A;  3U7D A;  4F93 B;  4ECV A;  3GZF A;  4CGZ A;  4KLL A;  2NBW B;  3WKB A;  4JMU A;  1TY2 A;  3BZD B;  4C7Z A;  4B9T A;  3UQB A;  1NVI D;  5FR6 A;  4P7I A;  4MF8 A;  4ACO A;  1COK A;  1R4M B;  1SXT A;  1S76 D;  5J2A A;  2V4R A;  2BGW A;  2KDM A;  4F5R A;  3C1Y A;  1N60 A;  4F2R A;  3TEW A;  3NZ3 A;  4IQV A;  3I5J C;  2G0A A;  5DPS A;  4CNQ A;  1EU3 A;  2K3U A;  1IV8 A;  1F5S A;  4YMM A;  5FP0 A;  3WKD A;  3RNG C;  5CX3 A;  3ISC A;  2WF6 A;  3E56 A;  3EPG A;  5IKC M;  3U7Z A;  4QZB A;  4I2A A;  4XDC A;  1P7D A;  1NI2 A;  3RRH A;  3RTV A;  4YR3 A;  1Q1O A;  2W3S A;  4W9G A;  1SWW A;  1XWL A;  3HJE A;  1J7B A;  4Z6D A;  4DQP A;  2MUT A;  2WNM A;  3APF A;  5CHF A;  4CYE A;  5LXH A;  4LVS A;  4YFK A;  2GOW A;  5L1L A;  4DHZ E;  2ASL A;  3P4S B;  3PVL A;  4K3B A;  4MH8 A;  2XC9 A;  3LVV A;  4Y2U A;  2KAJ A;  2E8P A;  1IXR A;  4I2I A;  5AKH A;  4O3M A;  3QWZ B;  3V3X A;  4E71 A;  4O3Q A;  1S10 A;  1V38 A;  2WXP A;  2VH2 A;  1FIQ A;  2K22 A;  3P2B A;  1K50 A;  7ICK A;  9ICF A;  1V1P A;  2PMV A;  2Y1I A;  4BWJ A;  4IQW A;  2CHZ A;  3GP7 A;  4IC9 A;  3NOB A;  5J2C A;  2LD9 A;  4YL8 A;  5DDM A;  2BR0 A;  2LGD A;  2H3I A;  2XVT A;  2CHX A;  4QZG A;  4RM8 A;  3HUI A;  3C28 A;  1HXY D;  3ZDE A;  4C8O A;  2Y5P A;  1GG3 A;  4KIT B;  3WK5 A;  1Z00 B;  3H40 A;  1QT9 A;  1V5O A;  4OJ5 A;  4YR2 A;  3PV8 A;  4MEL A;  2KJ8 A;  2LYA A;  3AU6 A;  2K89 A;  1LKY B;  3ED5 A;  4ICU A;  3AQF A;  2J0J A;  1QF6 A;  4QWE A;  4F4X A;  1WYG A;  1FD6 A;  4ANV A;  3WIM A;  3Q8Q B;  1I4P A;  3SAG A;  3IP4 B;  3JPS A;  4KLD A;  2BBC A;  3BQT A;  1ZQD A;  2W3R A;  2OJW A;  4DXA B;  2P35 A;  3W1S C;  3APD A;  4KDL B;  5ALH A;  5CTR C;  4BVU C;  1KEJ A;  2WQY B;  4L2Y A;  2MWS B;  5KFK A;  2E8O A;  5AM3 A;  2WB1 C;  3W5V B;  1SEB D;  2OWO A;  2ZJ5 A;  3OLM D;  1L3V A;  1EXN A;  2LGX A;  2R8G A;  5KFT A;  5D94 A;  2BVC A;  3LVW A;  1J97 A;  2JXT A;  2BKF A;  1OFF A;  2HTM E;  4HLE A;  3RB3 A;  1LGR A;  5KT5 A;  4ED7 A;  3E2E A;  1WH3 A;  4GDL B;  4O3S A;  2KNB A;  2NPT A;  2PTL A;  2WHE A;  3GV5 B;  5C1Z A;  3PST A;  1GUA B;  3B0A A;  3C8Y A;  2HDO A;  4YMO A;  2D3D A;  4NJ8 A;  5J0P A;  2LFI A;  1ZQE A;  4EBC A;  5KG4 A;  4J9K A;  2DBY A;  2LUM A;  4DSF A;  2KZ3 A;  4KLO A;  2XK5 B;  4BAX A;  3HKZ C;  3LWL A;  1XU4 A;  2ZCC A;  3VUX A;  3PO0 A;  2KFK B;  3DWG C;  4YSZ B;  3GDX A;  4RCO A;  2W9B B;  2NTT A;  1WJ6 A;  2IBI B;  3BJY A;  4PHA A;  1J7A A;  3QIJ A;  1V85 A;  3DWM A;  3ZKJ C;  4KLG A;  1BXT A;  2L52 A;  4HRO A;  4RQ6 A;  4EEK A;  3U52 E;  3C5F A;  3DVG Y;  1VD2 A;  2GRI A;  3T5K A;  1ZXI A;  5IIN A;  1TV9 A;  3R2T A;  3T8M A;  5KHQ A;  4PHP A;  5HHH A;  4HDQ A;  8ICI A;  3M7D A;  5J8Y C;  4DHJ D;  2QSD A;  4ASW C;  4KSL C;  4LDT B;  1A76 A;  2BT6 A;  4MGK E;  4UBB A;  7ICR A;  3K9P B;  5AEK B;  2K8A A;  2ATL A;  2WX0 A;  4JE3 B;  4MEX A;  4DFJ A;  3K1R B;  5EWE A;  1UF0 A;  5MPO A;  2FE9 A;  4LNK A;  2RDI A;  1RDF A;  8ICV A;  4K3C A;  3DVG X;  1DRG A;  1RYS A;  7ICH A;  4EYI B;  5AI4 A;  1RYJ A;  4RNO A;  1ENF A;  9ICK A;  3IT4 B;  2LVQ A;  1P7F A;  1E8X A;  1SWV A;  4ZRQ A;  4P0Q A;  1NK9 A;  2JVC A;  4Q44 A;  2DPJ A;  5AI9 A;  1UT5 A;  4XUS A;  2HHQ A;  2A4Z A;  2JU6 X;  4FZM A;  1LB2 B;  1GAQ B;  2W7O A;  2AWT A;  3AE1 B;  3JSV B;  2L1A A;  2NRZ A;  4UAY A;  8ICQ A;  1MVK A;  1L7O A;  2KIW A;  5D46 A;  3SZ2 A;  2W7P A;  3R7Q A;  3FYH A;  5B66 U;  5EWF A;  4ECX A;  5GMV A;  1SZH A;  4EZ9 A;  2DAF A;  3MC8 A;  4AYB C;  3UMG A;  5GTH U;  2QCZ A;  1DOQ A;  4TKN A;  1IGD A;  3Q8P B;  3ZUN A;  2F44 A;  4UQG A;  4BXO A;  4W9J A;  1YZ7 A;  2R61 A;  8ICR A;  1PFD A;  4HAI A;  1ZQU A;  1DYQ A;  3KUC B;  2KQ7 A;  1NK0 A;  1L3T A;  2D3A A;  3HW8 A;  4KZ0 A;  4JGH B;  3LB8 C;  3Q6B A;  2JT4 B;  3LYY A;  1BNP A;  3RMK C;  1IBX A;  2RGF A;  5BYR A;  4MGZ E;  2K0P A;  4ZRP A;  5BMI A;  2MJD A;  2LZ6 A;  4IKG A;  5J2B A;  1WXV A;  2AQ4 A;  2KKV A;  3DBR I;  3PO5 A;  3JYU A;  5KT2 A;  3H4D A;  1L4Z B;  1MJD A;  1E9M A;  2N1W A;  3TAN A;  3OJU A;  2JEF A;  1LO5 D;  3GZN I;  1TK8 A;  5D3D A;  3Q8K A;  3QJZ A;  4EX7 A;  2IND C;  4M04 A;  1LKY A;  2D3G A;  4LNN A;  5DB7 A;  4I29 A;  1FO4 A;  2G4S A;  3H8S A;  3RAQ A;  2PE9 A;  3C2L A;  4JUZ A;  2Z8L A;  1PK1 A;  4RGT A;  3MDA A;  5KFY A;  3KVF B;  5CJ7 A;  2EKE C;  4P0Q B;  3FDS A;  1WJ4 A;  1ZJN A;  4UAW A;  2O6V A;  2HBM A;  2WTF A;  2KO3 A;  4DOA A;  4RUA A;  2N7J A;  3HM6 X;  2V0G A;  2F76 X;  3QZ7 A;  1C4P A;  1GOZ A;  1E7U A;  1S0M A;  2N4F A;  2AL3 A;  5J2R A;  1ZPS A;  3V72 A;  3Q8L A;  3AUL A;  1C3T A;  3N1X C;  4ECY A;  2Z7J A;  1K1S A;  3C29 A;  1DK3 A;  2NYV A;  1U4B A;  4NL9 C;  1ZDX A;  3AEG B;  4F5P A;  1RPL A;  2DL0 A;  1N61 A;  3BS5 A;  3F5A A;  1SL0 A;  5FR3 A;  3A9K A;  3KQ4 A;  2DX5 B;  2O6V D;  1K53 A;  2NR2 A;  3JPT A;  3IVF A;  2FLP A;  4IC7 B;  3AE6 B;  3RYT A;  4IRC A;  1JWU D;  2P6R A;  3QE9 Y;  1IUE A;  4U6P A;  2N0S B;  1HUZ A;  2PPH A;  1S8O A;  1NK5 A;  4MFF A;  4RZR A;  2O2V A;  3LWM A;  1D4B A;  4EBE A;  2QB0 B;  1LV5 A;  4DWF A;  3OTQ A;  5E79 U;  1KRH A;  1COO A;  3N7R C;  5DGA A;  3MTN B;  2KMA A;  3WK7 A;  3EZ5 A;  4C8L A;  2IHM A;  1MQ3 A;  2W9B A;  3EPI A;  4LNI A;  4QIW C;  3NUH B;  2F77 X;  3SFE B;  3TJP A;  2YTU A;  1SF0 A;  1YOV B;  5JHA A;  5DQG A;  3KHG A;  4OJ6 A;  2MBB B;  2M0X A;  4JB3 A;  1MA7 A;  1ZQL A;  2DZI A;  2G08 A;  2A1J B;  3QNM A;  4N9F 4;  4TQ1 A;  3BS5 B;  4C8N A;  1XCT L;  2H3Z A;  3LYS A;  3ZRF A;  4W9H A;  3PRZ A;  4MDK E;  3H9D A;  4EZL A;  1C4A A;  4FHK A;  4QW8 A;  2W55 A;  2BF8 B;  3AE7 B;  1XCQ L;  1YQB A;  8ICJ A;  1Z5S B;  2DKX A;  5DBA A;  4J9O A;  4DXG A;  3QU9 A;  1PQS A;  5BPC A;  4O0I A;  4QW9 A;  2KMD A;  3GU3 A;  2HSZ A;  3G6Y A;  4BUG A;  2RLT A;  5ALG A;  3PW5 A;  1Q3V A;  2F8K A;  2IZV B;  2LWP A;  4GXI A;  2FPK A;  3BQ1 A;  2O6V B;  4GIB A;  4KGR A;  2IGG A;  3VAW A;  1BGX T;  4UAS A;  4TUP A;  3RJF A;  1QOF A;  7ICM A;  1SKW A;  1NJW A;  3HIL A;  2C28 A;  1CK1 A;  3DCG A;  1F9J A;  2OEH A;  2MCN B;  3GIM A;  2CPR A;  1S0V A;  4IL6 U;  1S3S G;  1S77 D;  1QSL A;  5DDY A;  3RR8 A;  1A5R A;  3AEF B;  2W9A A;  3QU2 A;  1GO3 F;  3DOW A;  2BPC A;  3FAH A;  5HMM A;  4B9V A;  2OCE A;  2WLB A;  3X0W A;  4ZHO A;  4J03 A;  3QCA A;  3G6X A;  1IBX B;  2NRV A;  5AM0 A;  4NPN A;  1NBF C;  3N97 B;  1T0S C;  2WF9 A;  1L3U A;  1GPX A;  3C23 A;  4K4G A;  2KDF B;  1KFY B;  4J9N A;  4QZD A;  2MX2 A;  3HP6 A;  1F0M A;  3IV6 A;  4DFM A;  1MG8 A;  1KDH A;  4ED8 A;  4ZDV A;  5H92 C;  5DG8 A;  1I4R A;  4W9E A;  2LPE A;  1IYF A;  3IM1 A;  4R8U B;  1X6I A;  3KD3 A;  2KTQ A;  1C1Y B;  2KX3 A;  1ZD4 A;  1ZQV A;  4MSM B;  1KQQ A;  4I27 A;  2LGY A;  4K1R B;  4O9M A;  1SBB B;  2O6K A;  3F2B A;  2H89 B;  3AE8 B;  3DBR B;  2M17 A;  1C79 A;  3HHM A;  2M9N A;  3AE2 B;  4ECW A;  4Y2R A;  5ALU A;  4GFJ A;  3GOE A;  2KV2 A;  2YMM A;  9ICX A;  2JEJ A;  2PE6 B;  1V80 A;  2BCQ A;  1DOX A;  1ZD3 A;  4G3I A;  2MHJ A;  4FFD A;  1Y56 A;  2PFN A;  3PSF A;  9ICE A;  3NS1 A;  1BPE A;  1VLB A;  1L5U A;  4N6E B;  3QEA Z;  3CP8 A;  5J18 A;  5DB8 A;  4PGX A;  1KM7 A;  2N9K A;  2XN9 C;  4ZHP A;  5HG2 A;  4P1C C;  4EUT A;  2LKY A;  2MW5 A;  2QAR B;  3OHB A;  2F1H A;  5AI6 A;  1JWS D;  4WJO A;  5DCN A;  4Z6E A;  2GBJ A;  2H5X A;  1PUT A;  2GBN A;  3K75 D;  4USA A;  3IFW B;  3D2Q A;  1GB4 A;  4M6W B;  4J9Q A;  4EX6 A;  3T79 A;  2WXJ A;  4WJQ A;  4DSI A;  2MQJ A;  9ICW A;  4J9S A;  2BCR A;  1MQ2 A;  5DLG A;  2KJR A;  1JWM D;  2HHS A;  2KEY A;  3ORY A;  1SZP A;  4YG2 A;  1R4M I;  3KW5 B;  3O13 A;  4DDI D;  1BUI C;  4QIW F;  1V97 A;  1D8L A;  4QZH A;  3I76 A;  2EZY A;  3V05 A;  5DQI A;  3ZNG C;  2AEH A;  3VVW B;  4IM2 A;  2PMZ F;  5KFP A;  4FHJ A;  1BPB A;  1TKD A;  1N5X A;  2OM6 A;  3N4M B;  5KL8 B;  1P1A A;  4NLB A;  5ALM A;  2WF8 A;  2KQ4 X;  5DB6 A;  2QIE B;  4AJY B;  1TTN A;  3ZI4 A;  3EYZ A;  4QWC A;  4FLH A;  3VC8 A;  2WF5 A;  7ICI A;  3PW0 A;  4IRD A;  4U7C A;  3Q3J A;  1UEL A;  1TT5 B;  2KFZ A;  4KX3 A;  4DOC A;  4QZC A;  3P1M A;  3WK9 A;  4MGY E;  1E8W A;  1NJY A;  2ZUD A;  3RR7 A;  2INP E;  3RJH A;  2KDI A;  3QQ8 B;  4HJK A;  1S97 A;  3ALB A;  4B9N A;  1CEZ A;  2KKC A;  4RGN A;  2BS2 B;  1ECW A;  2KD0 A;  4F50 A;  1YD8 U;  3TEZ A;  4RQ7 A;  2YQE A;  1ZQO A;  2UYZ B;  3VR8 B;  4PZN A;  3QUC A;  2JQR B;  1T4G A;  1F2R C;  1N48 A;  5ALJ A;  1RXV A;  2FMQ A;  4RQ2 A;  3M3J A;  2QHO A;  4GU2 A;  5CHG A;  4YCX A;  2QEJ C;  9ICG A;  4F92 B;  2QMT A;  4KLH A;  1KKX A;  2GOL A;  4FBT A;  4CQN A;  3OWE B;  4Q8F A;  3DHI C;  3TAR A;  4JK1 A;  3KHH A;  2FCM A;  1ACC A;  5KFQ A;  1TK0 A;  3OG5 A;  4G9B A;  7ICN A;  2LMR A;  2W9C A;  1JRO A;  3PX0 A;  2ZPY A;  2NMQ A;  4W9D A;  1XLQ A;  3ZW3 A;  3N7P D;  5DBB A;  2EMT A;  3IAM 1;  2CHW A;  9ICQ A;  4B95 A;  3ZD9 A;  4JIO U;  1HUO A;  3SI8 A;  3M8R A;  5KFH A;  1B43 A;  1DOY A;  5AM5 A;  3EC8 A;  3ZIM A;  8ICP A;  4K4I A;  1BT0 A;  2JX5 A;  3A0B U;  1LFD A;  2M8S A;  2ZTC A;  5J0Q A;  4DL3 A;  2EAM A;  4BKG A;  2HHV A;  3C5G A;  3NZU A;  1Q0W B;  1VJ5 A;  1JXE A;  5F9L A;  2R18 A;  3IHQ B;  2HHW A;  5E6P A;  3UM9 A;  1UWX A;  7ICS A;  1A70 A;  2KC1 A;  1UBQ A; 
#chains in the Genus database with same CATH homology
 2JYE A;  4KGS A;  3MJ5 A;  1WWT A;  1D5M C;  3AEB B;  3EGR A;  4OZA A;  4OZB A;  3HUI A;  4LTU A;  1HXY D;  2PVG C;  1C9F A;  1YJJ A;  1ZOY B;  2Y5P A;  3VRB B;  3Q69 A;  5BMG A;  1QT9 A;  3RFZ B;  1UGJ A;  3CWI A;  3NRZ A;  2RDH A;  4ARI A;  4REZ A;  1QF6 A;  2W54 A;  4RFB A;  1WYG A;  1MHX A;  1FD6 A;  4H2A A;  1FCC C;  5BMH A;  1I4P A;  3TSS A;  1T3Q A;  1QLB B;  1QOA A;  2BBC A;  1SIJ A;  2W3R A;  5EE3 A;  2YEP F;  3Q8B A;  1I4H A;  1JW9 D;  3T3N A;  1JML A;  1XLO A;  5E6J A;  2WQY B;  4L2Y A;  1TS4 A;  3BK2 A;  1EM7 A;  4JPS A;  3MFG A;  1SEB D;  3HRD D;  3W5V B;  3P42 A;  4WH4 A;  4LLG M;  2WU5 B;  2WXH A;  3RPF C;  4YTP B;  1HA5 A;  1HEZ E;  5D7G A;  2OED A;  1K51 A;  3EA6 A;  2Y3A A;  2D5G A;  4HKZ E;  5EE0 A;  2JXT A;  1OFF A;  2HTM E;  2BW2 A;  1FMA D;  2QJL A;  4GDL B;  2FBW B;  2PTL A;  1WSP A;  1VDV A;  4FXC A;  3B9J A;  1KLU D;  1YN5 A;  3C8Y A;  2LFI A;  1VZ7 A;  2BTE A;  3HVD A;  4D2K A;  2DBY A;  2LUM A;  3W5U B;  1B1Z A;  3AH7 A;  1YNT E;  3PO0 A;  2N9L A;  4C80 A;  2WXG A;  3DWG C;  4XWT A;  4YSZ B;  2MJE A;  3ABV B;  4RCO A;  2NTT A;  3Q8F A;  2M56 B;  3GS2 A;  4YWG G;  4JWS C;  1J7A A;  1PGX A;  3DWM A;  1XO3 A;  1BXT A;  2L52 A;  4HRO A;  4NAM A;  4M0W A;  3LXF A;  2WDR B;  3U52 E;  3AE4 B;  2GRI A;  4HJG E;  3R2T A;  1ZXI A;  5D3I B;  1AYF A;  1QIL A;  2WXR A;  2WXO A;  2QSD A;  1C77 A;  2BYT A;  2M0A A;  1QKZ A;  2BT6 A;  3H8H A;  1PGA A;  4A6Q A;  3TUO A;  1XF5 L;  4JE3 B;  2G1E A;  2QIL A;  3CIR B;  3TEY A;  5MPO A;  1FNW A;  3SR6 A;  4RGO S;  1JWB D;  3TEX A;  1TS3 A;  3FIL A;  2E6X A;  4TMA B;  1RM6 C;  3AB5 A;  4RNA A;  4A55 A;  4DQO C;  1RYJ A;  4TQ0 A;  2IGH A;  2WXQ A;  1ENF A;  1KF6 B;  1RWS A;  1XLP A;  4XDD A;  5BYS A;  3IT4 B;  4ZRQ A;  1P7F A;  2RPV A;  3P4R B;  2YEP B;  1VZ6 A;  1ESF A;  2Q5W D;  1C4C A;  1V8C A;  2JU6 X;  1GAQ B;  1L6U A;  2ZW1 A;  3AE1 B;  1FRR A;  4NJC A;  1EU4 A;  2L1A A;  1UNS A;  1SE3 A;  1L0V B;  1ZDV A;  2KWD A;  1MVK A;  2WXM A;  4L23 A;  2ONQ A;  1B9R A;  1E7P B;  3E9S A;  1TZO A;  1UUP A;  2XNA C;  2ICI A;  5BYQ A;  2V3N A;  3BYY B;  1IGD A;  2WS3 B;  1K52 A;  2R61 A;  5GXG B;  1PFD A;  4KKJ A;  2IDY A;  1DYQ A;  1F0Z A;  2MEK A;  2WU2 B;  1AN8 A;  4N58 A;  1VZ8 A;  3LB8 C;  3P63 A;  3LYY A;  3ZJU A;  1IBX A;  5BYR A;  4L1B A;  4ZRP A;  2K0P A;  4DXF A;  5BMI A;  4MM3 B;  2MJD A;  4NZL B;  3Q8C A;  2G9H D;  2LEK A;  4IKG A;  2FUG 1;  3BII D;  4P16 A;  4B0M A;  1RFK A;  2L83 A;  1L4Z B;  1SJH D;  1E9M A;  1ZP0 B;  1SE2 A;  1LO5 D;  2K5P A;  1PDX A;  5D3D A;  2K9X A;  1TJE A;  3SEB A;  1Q10 A;  4OHJ A;  3BYT B;  1I7H A;  3NVW A;  3P4Q B;  2I38 A;  2M19 A;  1FO4 A;  4US8 A;  1XLN A;  3PZ8 A;  1NYQ A;  2Z8L A;  4RGT A;  1ET6 A;  1R7S A;  3ZGZ A;  1STE A;  3BVG A;  4YT0 B;  2TSS A;  4JX1 C;  1FXA A;  1N62 A;  1TKY A;  2IPK D;  2N7J A;  2V0G A;  1CQV A;  2H88 B;  4ITK A;  3J9C A;  1JCK B;  1C4P A;  1GOZ A;  3SFD B;  2SAK A;  3HVZ A;  4C56 C;  3B2G A;  1L0Y B;  1PYW D;  1KTK A;  1QOG A;  1ZPS A;  2LGI A;  3FIL B;  3R2I A;  4LK0 M;  3NVV A;  1MI0 A;  3AEE B;  2FE8 A;  5LNK 1;  1TS5 A;  3AEC B;  4AQ7 A;  1ZDX A;  3ZJV A;  3ZJT A;  3AEG B;  4N59 A;  1N61 A;  5FR3 A;  3KQ4 A;  2V4I B;  3I9V 1;  4YTM B;  3IAS 1;  1K53 A;  3GB1 A;  2WP9 B;  3AE6 B;  1N5W A;  1JWU D;  1T6B X;  1IUE A;  2N0S B;  1DOI A;  3AEA B;  5C3J B;  2V3P A;  2L32 A;  1M4V A;  3BVM A;  3AED B;  2PIA A;  5G5H A;  1D4B A;  1FEH A;  2EKI A;  2MH7 A;  4GDK B;  2WXI A;  1MPE A;  1NI3 A;  1KRH A;  1DGJ A;  3URY A;  1QOB A;  4YSX B;  4ARC A;  4PT5 A;  1TS2 A;  1WRI A;  2X38 A;  3NUH B;  5T8I A;  3SFE B;  1D5Z C;  1JQ4 A;  1SF0 A;  1GB1 A;  4RGM A;  1HZ5 A;  2AQ1 B;  1ET9 A;  3VRA B;  2DLB A;  1SE4 A;  2EEL A;  5JXV A;  4TQ1 A;  1XCT L;  1VRA B;  1WXQ A;  2WDV B;  4OZC A;  1YMH E;  1C4A A;  1XEE A;  5H8Y E;  2W55 A;  3KWL A;  3AE7 B;  1E10 A;  1FFV A;  1XCQ L;  1C76 A;  4AS1 A;  5HHD G;  4DXG A;  1FM0 D;  4J3O D;  2B76 B;  4P6V F;  1HZ6 A;  2E3T A;  2Y5C A;  1MHH E;  4KGR A;  1YQ4 B;  2IGG A;  3AV8 A;  1QOF A;  1YJI A;  1NEK B;  4EE2 A;  1CK1 A;  1FRD A;  3BK1 A;  3NVZ A;  2LHD A;  1QQR A;  1I4Q A;  4HRS A;  1UWM A;  2HDE A;  2VZK B;  3AEF B;  1HQR D;  3W2D A;  2AX5 A;  2AQ3 B;  2WXL A;  1L0X B;  2LHE A;  4IOI E;  1D6E C;  1FXI A;  2WDQ B;  1JAL A;  2NTS A;  2JYT A;  3FAH A;  1TKG A;  5FK9 C;  3ETR A;  1BML C;  2WLB A;  4RF0 A;  4RF1 A;  5EE9 A;  1ZUD 2;  3PZ7 A;  2KN4 A;  2BB5 A;  1E6E B;  2IJ0 A;  4ZHO A;  1IBX B;  1FNU A;  4UDU C;  4C7Y A;  2JSV X;  1GPX A;  4A90 A;  2OHF A;  1KFY B;  1YN3 A;  2GB1 A;  4A8X C;  1V1P B;  4US9 A;  2PKO A;  2LJI A;  2CU3 A;  5AUI A;  3AMZ A;  3I57 A;  2LMC A;  5H92 C;  1I4R A;  4RH6 A;  1YN4 A;  2CJN A;  2KAC A;  1NYR A;  2JWU A;  5HI1 A;  4XE0 A;  3KLS X;  1I4G A;  1SBB B;  3AE8 B;  2H89 B;  3NVY A;  1C79 A;  3AE2 B;  4HKQ A;  1FCL A;  1I4X A;  3IXS A;  1NEN B;  1E0Z A;  1SSN A;  1VR9 A;  3R8B A;  1EWY C;  2RDG A;  4MAC A;  4NAW B;  1DOX A;  5C2T B;  4OVZ A;  3AN1 A;  3AE9 B;  1TYG B;  1KH0 A;  1Y56 A;  1D5X C;  2BB6 A;  3NS1 A;  1VLB A;  4N6E B;  3AM9 A;  1F2R I;  1SJE D;  2N9K A;  1TKE A;  1AWD A;  2RMM A;  2XN9 C;  5FKA C;  4ZHP A;  4OW0 A;  5HG2 A;  3N9Y C;  1ZXH A;  2BS3 B;  1JWA D;  4B0E A;  3KWV A;  1TY0 A;  2ACZ B;  1JWS D;  2DYM A;  1YQ3 B;  4ZOH C;  4Q2J A;  2AQ2 B;  4WQM A;  1PUT A;  2J53 A;  4USA A;  1GB4 A;  3AE3 B;  2CJO A;  2WXJ A;  3UI3 A;  2I2Y A;  1J7C A;  1JWM D;  3U4E G;  2JZP A;  2VZK D;  3O13 A;  4WUR A;  3FC4 A;  4O1N A;  1BUI C;  1V97 A;  1CZP A;  1N63 A;  2ON8 A;  4KKI A;  5HFY A;  1IGC A;  3MC0 B;  3V05 A;  3Q8E A;  4IDI A;  1N5X A;  3WCQ A;  1SB3 C;  1T5X D;  2DWQ A;  1VJK A;  2KQ4 X;  2DYO A;  2QIE B;  2W82 A;  4KGT A;  2SEB D;  3Q8A A;  1V1O A;  2INN E;  4YXD B;  2J42 A;  3T3O A;  3BVZ A;  3P1M A;  2WXN A;  3MHZ A;  1F77 A;  2GI9 A;  4GLS C;  1C78 A;  1P7E A;  1L5P A;  2BS4 B;  2ZW0 A;  3W9C B;  4A9A A;  3ZYY X;  1AW7 A;  1L6V A;  1OQR A;  2INP E;  3IT6 B;  4WIP A;  3AE5 B;  4JWU C;  1OQQ A;  1PGB A;  3BWU D;  3EUB 2;  2KMM A;  4RGN A;  2BS2 B;  2PW9 A;  4YSY B;  5I4D A;  4HEA 1;  3TEZ A;  1ROE A;  1CJE A;  4WWM A;  4WAF A;  1ZE3 D;  3VR8 B;  4R3D A;  2IGD A;  5EE1 A;  2JQR B;  3L4P A;  5G5G A;  1F2R C;  2WXF A;  1TY2 A;  3BZD B;  4C7Z A;  1NVI D;  1FNV A;  2QEJ C;  2QMT A;  4XWW A;  1SXT A;  2KDM A;  4CQN A;  3OWE B;  1N60 A;  1WGK A;  4TSS A;  4YTN B;  3TEW A;  3ZQ4 A;  3NZ3 A;  4KX6 B;  1ACC A;  3U2S C;  2J4X A;  1EU3 A;  2K3U A;  4MT5 A;  3MP9 A;  3E56 A;  3U7Z A;  4XDC A;  1JRO A;  5TSS A;  2NMQ A;  1XLQ A;  3VR9 B;  3IAM 1;  2PLP A;  1JRP A;  2W3S A;  1J7B A;  2WNM A;  1EWC A;  1L4D B;  1DOY A;  3P4S B;  3B2F A;  2J52 A;  1FFU A;  4MH8 A;  2JX5 A;  2KAJ A;  3V3X A;  1KLG D;  2PVO D;  5AUK A;  2WXK A;  3P4P B;  4ZYS A;  2WXP A;  1FIQ A;  2K22 A;  2MJ3 A;  1K50 A;  1XXG A;  3W1S A;  1V1P A;  1UWX A;  2PMV A;  3VQI A;  1A70 A;  3GP7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...