3NVVA

Crystal structure of bovine xanthine oxidase in complex with arsenite
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
164
structure length
164
Chain Sequence
b'TADELVFFVNGKKVVEKNADPETTLLAYLRRKLGLRGTKLGCGEGGCGACTVMLSKYDRLQDKIIHFSANACLAPICTLHHVAVTTVEGIGSTKTRLHPVQERIAKSHGSQCGFCTPGIVMSMYTLLRNQPEPTVEEIEDAFQGNLCRCTGYRPILQGFRTFAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Xanthine dehydrogenase/oxidase
publication title X-ray Crystal Structure of Arsenite-Inhibited Xanthine Oxidase: Mu-Sulfido,Mu-Oxo Double Bridge between Molybdenum and Arsenic in the Active Site.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 42
structure length 164
sequence length 164
chains with identical sequence J
ec nomenclature ec 1.17.1.4: Xanthine dehydrogenase.
pdb deposition date 2010-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 3nvvA02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3nvvA01
3AE8B 2WS3B 1JROA 1ZXIA 4N6EB 1ZOYB 3LB8C 3P63A 3AEAB 1XLPA 5AUIA 3HUIA 2DWQA 1V8CA 3AEDB 3AEBB 1N62A 2Q5WD 1F0ZA 3FC4A 3AEEB 3AE1B 4C7ZA 1OQRA 1JQ4A 2L83A 1TKGA 4YTMB 1E0ZA 3RPFC 2W55A 2WU2B 2WQYB 4ZOHC 1FRDA 1TYGB 3AE5B 4FXCA 4JWUC 1WYGA 3PO0A 1N5WA 1ZP0B 1RM6C 1IUEA 1A70A 1SB3C 2K9XA 1PDXA 2QJLA 4HROA 1V97A 4LTUA 4ZHPA 2JX5A 3FAHA 2W3RA 4YTNB 1WWTA 1FIQA 3AB5A 2B76B 3AN1A 1XLNA 1XO3A 1DOXA 2EKIA 2G1EA 1FMAD 1FFVA 1KF6B 1TKYA 5EE0A 4JWSC 3HVZA 1QOGA 3VR9B 3B9JA 1DOIA 1WXQA 2K5PA 1RWSA 2HTME 1RYJA 1DGJA 3CWIA 1NYQA 1QOBA 3NVWA 1QOAA 3NS1A 4N59A 3P4QB 2BS2B 4C80A 1WGKA 1YJJA 4C7YA 2PKOA 2L52A 3ZYYX 2WU5B 4USAA 4YTPB 5EE3A 1FFUA 1RFKA 2CJOA 1YQ4B 1J7AA 1NEKB 1L0VB 1KRHA 3NVVA 1L6VA 3ETRA 5EE9A 1N61A 2QIEB 3VR8B 1CZPA 1N60A 3HRDD 1E6EB 3LXFA 1NVID 2E3TA 2KAJA 1JW9D 1JALA 5MPOA 1SF0A 2BS3B 2WP9B 4YSZB 4A9AA 1E7PB 2OHFA 1OQQA 3ABVB 1NYRA 2KMMA 4YSXB 2N0SB 3AE3B 2BT6A 1GAQB 2H89B 3AMZA 3AM9A 3NVZA 1FXIA 3AE2B 1TKEA 3BIID 4HRSA 1VDVA 1OFFA 1XLOA 3CIRB 1QLBB 3AE9B 2WDVB 2JQRB 1N5XA 5H8YE 4YT0B 3AE4B 1AWDA 3AECB 2ACZB 1QF6A 3SR6A 2DBYA 4IDIA 2FBWB 1L6UA 4US8A 1FM0D 5G5GA 1N63A 3AE7B 3AEGB 3KWLA 4US9A 3W9CB 4YSYB 1VLBA 3SFDB 3P4SB 1E10A 1XLQA 4ZHOA 1E9MA 3P4PB 2CU3A 1SIJA 1AYFA 2LEKA 1J7BA 3DWMA 1FXAA 5AUKA 2H88B 3AH7A 4N58A 5EE1A 3VRAB 1DOYA 3P4RB 2K22A 1L5PA 2WDRB 5H92C 3AEFB 1PFDA 1VJKA 2PVGC 4YXDB 2WLBA 4JX1C 2BS4B 2W54A 1CJEA 1NI3A 2AX5A 2MJDA 3DWGC 3P1MA 1R7SA 2CJNA 3W5VB 1PUTA 5C3JB 2W3SA 3EUB2 3L4PA 1UWMA 2MH7A 5GXGB 1TJEA 1YJIA 2MJ3A 2WDQB 3VRBB 1J7CA 2MJEA 2Y5CA 4P6VF 5C2TB 3SFEB 1KFYB 1JRPA 3NVYA 2PIAA 4WWMA 3W5UB 3B2FA 1ROEA 3NRZA 1NENB 1YQ3B 1JWBD 1FRRA 3WCQA 1QOFA 1ZUD2 2PVOD 2M56B 1I7HA 3AE6B 4WQMA 1WRIA 1FO4A 4ITKA 1T3QA 2M19A 1GPXA 1QT9A 3B2GA 1JWAD 3AV8A 5G5HA 1EWYC 1B9RA 4KX6B
chains in the Genus database with same CATH superfamily
4P4MA 2J42A 3AE8B 4ED3A 1S5LU 4K1RB 3O65B 1PVPA 3NY5A 3VTVA 1B22A 3N97B 4YQWA 3AE1B 2KD1A 1WXSA 2AEHA 4BWJA 4MFAA 4K4HA 5CX3A 4EZKA 3RRGA 5ALEA 1BPYA 4LVSA 2BCVA 3SD5A 4XYCA 3HT3A 2PTLA 2Y0SF 3TBLD 1KLVA 3PO0A 1KL9A 3GV7B 1LM8B 1Y56A 4HVBA 5BO4B 2BYTA 2KJ8A 4DSIA 2C7HA 4I2FA 4Q2JA 3BDPA 5ALTA 1TZOA 5ALXA 1HQRD 4Z6EA 2VH2A 3UQ2A 2Y5PA 1KF6B 2D3BA 1XSNA 2O2VB 2IY1B 1I4PA 2XBBC 3T3FA 4KGRA 1DGJA 2LBOA 7ICJA 3UINB 2LJIA 2NV3A 3NS1A 2KN5A 1T8EA 4QNLA 2PKOA 4RQ1A 4IQUA 2HD5B 3JPPA 3WA0A 4QZDA 4W9GA 4IL6U 1RG6A 3HW8A 2LZ6A 2JH1A 1KRHA 3ONNA 3ZD9A 5IIMA 3RCZA 3KUDB 2WXJA 3KZIU 1V86A 2R61A 3VH4B 2E3TA 3VXWA 3U30A 5KFBA 1BGXT 5KG2A 2W9AA 2KZZA 1R4NB 4IW0A 4TUSA 2MCNB 2INPE 4LDTD 3IT4B 1U48A 3JPSA 5CJ7A 1SXEA 1ZKHA 5BYSA 3M1YA 1NK6A 2OYYA 5HMLA 3W1SA 8ICRA 1XLOA 3RJFA 2JQRB 3V62A 2N1RA 1AWDA 1ZQKA 1WMHB 2HSZA 2KEYA 1D9DA 2K3UA 1U4BA 4F4ZA 2OEDA 1ACCA 1WXMA 5J2DA 5AK5A 1XT9B 2GOLA 4P0QB 2LVPA 4M9NA 3K1RB 4KLEA 1J7BA 1K1QA 1FXAA 1S0MA 1GG3A 2JYEA 4DQOC 4I2CA 4FBJB 2NO4A 1L7YA 4RCOA 1F5SA 3JPQA 2KNBA 3C5GA 2DAJA 1KFDA 4G50A 2N9LA 3L10B 2J0JA 3F2BA 8ICJA 3KVFB 3RNBC 4AS1A 1R7SA 2M17A 3DDHA 4ELUA 4BKSD 3EUB2 3DBRI 4C4SA 1P7EA 1BMLC 3BZCA 4LZDA 3C2MA 1ZQSA 1F9JA 4QWAA 5ALVA 2IA6A 4KSLC 2KACA 2MBQA 3H0RB 3A9KA 1V6EA 1TKDA 2M0XA 4RPXA 7ICVA 2A1JB 2FLNA 1MQ3A 3PNCA 2ZPNA 1ZQRA 3AUOA 2Y1IA 2N7DA 1WJNA 4TURA 2JPHA 3N3KB 1JROA 1TGZB 4XA5A 4B95A 1HIWA 3G6XA 4G0NB 5JRTA 4RQ6A 3T5JA 3OAWA 4KDLB 1V8CA 3KZXA 1I4XA 1STEA 2W9NA 1YT3A 5KT3A 2PE6B 4IS7A 3WAMA 2N7JA 3PSFA 1L4ZB 2CHZA 4BBNF 2ZIXA 3JPRA 5AZHA 2FIDA 3UQBA 4FFDA 2K9XA 4ED7A 1N2XA 1NK4A 2LMCA 4ACFA 5L1JA 1P98A 3R7RA 4IWPA 2FI1A 3PLUA 2JX5A 3IHQB 2E8OA 1ZD4A 2IOFA 3ETLA 1UA1A 2ZCBA 1ZDVA 9ICRA 7ICNA 1E90A 2BQQA 4BWMA 3I76A 2KT7A 3EC8A 1VD2A 1VCBA 5KFPA 5KFKA 2OWOA 2ZIUB 4O3MA 1WXQA 3TJPA 5ALNA 3C23A 1QOBA 4DQRA 1UGMA 5EWFA 1T0RC 4HCNB 3P4QB 1V5OA 1DXSA 4C80A 3U2SC 4YD1A 4LNKA 4WWNA 4HAIA 3Q8CA 4YTPB 3WIMA 3RNEC 4GLSC 4DQIA 1TS4A 1ZD2P 4HYKA 2H3ZA 2P6UA 4DL4A 1SJHD 3C1ZA 3NVVA 1TBEA 3HRDD 5GMVA 2WTFA 1XSLA 3VQIA 4OO1J 4EKUA 2QLTA 2KK0A 5T8IA 4ASWC 1A0PA 3ABVB 1QQ5A 1HEKA 3VC8A 2KOBA 3BK1A 1X2IA 4F4XA 3K4GA 4JGHB 5CP2A 2CHWA 4KLDA 2JXXA 4GIBA 1XF5L 1QF6A 2WB1F 1SL0A 5KG3A 1SE2A 3W9CB 4LK0M 3I1YA 4M9LA 4IRCA 3ZI4A 2W82A 3WK7A 2CU3A 3QCAA 2LEKA 2Q4TA 2L76A 3PSIA 1HUZA 3IV6A 1GC7A 2DZIA 3EZ5A 4FULA 3RJGA 3M6ZA 2K25A 3H7SA 3P4RB 3M7DA 5J2BA 5T14A 2K22A 4W9CA 4NAWA 4QIWF 3EHVA 3N20C 4TKNA 5DB8A 5CHVC 3IFWB 5FR6A 1F0MA 4D2KA 1ZQBA 1KTQA 4YMMA 2FCSA 2CPRA 4UB8U 2NRWA 5KFQA 1L3TA 4DFDA 4DQPA 3RF9A 5KG7A 1UT5A 2JZBB 1PYWD 2E6XA 4PL1A 7ICEA 3RR8A 1U4AA 3CYMA 1XS9D 1FRRA 3ZVVA 1S3SG 3NZUA 5AKIA 1OTRB 4P1BC 3AQEA 3TMPB 4ELTA 2JRHA 4KX6B 4WH4A 3GV5B 1ZQJA 1L7MA 1FXTB 4DHJD 4IUMB 1KFTA 4FS2A 2JXJA 1XLPA 5L1LA 3AEAB 3HUIA 1Z00A 3V6EB 2LJ5A 3SV4A 3LDZE 3DBHB 4C7ZA 3KFUF 1AN8A 1SIFA 3V7LA 2DPJA 8ICWA 4YTMB 2FDRA 3VCBA 1R4MB 1EUVB 4ZOHC 5AM4A 4JWUC 3VHTC 2RP5A 3WALA 3O0FA 1MHHE 4JV1A 1BPDA 2WXFA 3HM3A 5DLGA 1MC8A 2JH7A 4DF4A 4QZFA 2KDBA 2W3RA 3KOOA 7ICSA 2C60A 4KGSA 2F76X 3AB5A 5J2EA 1IBXB 4NM2A 1XO3A 2EKIA 3UQ0A 1YJ1A 1DOXA 3NG0A 3ZTCA 4C4VA 2GLSA 2HTME 3OPXA 3ISCA 4F72A 3PO4A 2KDEB 2IGHA 2DKXA 2VH1A 4IWOA 8ICNA 4PHPA 3ZYYX 4U7CA 3MHSD 2WU5B 5F3XB 1C4PA 4DO9A 2EKEC 1RFKA 4FBUA 3OJ4B 3RN9C 4RF0A 2JMGA 1RZTA 2WNMA 1RDFA 3T8MA 2EZZA 4GU2A 1X42A 3MHZA 2KDMA 4PT5A 1COOA 3SZ2A 2A4ZA 3RZFA 2ZNVC 3KLSX 2ASLA 2QB0A 1NK8A 4KLOA 1E7PB 1DYQA 1WR1A 4NQLB 4FHJA 4DFKA 5KNIA 2KK8A 4M8MA 5EDSA 1T0SC 2N0SB 2R8KA 2KJ5A 3T3NA 1FXIA 2JV3A 3N1ZC 1OFFA 3CIRB 4WQOB 3UXOA 4A20A 2V3SA 5TR5A 4MSMB 1AROP 1QSYA 2ZCCA 4IDIA 1L6UA 2JT4B 1FM0D 3TEYA 2A3VA 3I5JC 4WURA 4UAUA 4C4TA 5HHHA 4ECUA 2OOBB 2M4NA 1TZ1A 2ONQA 2KVSA 2H3IA 2JWZA 1E8XA 4J9KA 2HDOA 1XSPA 3LK9A 3PW2A 1WE6A 3UXPA 5DBAA 2W9CB 2PEAA 4I6LB 2FPMA 4ECXA 2WGSA 4GDLA 4II3B 2IO1B 9ICQA 2IOFK 5DPWA 3M9MB 2BS4B 2W54A 2PMZF 1Q3UA 4G11A 3SEBA 4EEWA 5DQIA 3M9OB 2KNJA 4DDID 2ZPYA 5J2GA 1I35A 4DFPA 2CKHB 1WRDB 2UVUA 1Z3EB 3E56A 4A55A 2DKZA 2MEKA 3GE3C 3B2FA 1QZEA 1ECWA 5KFRA 4F71A 1OEYJ 2IY0B 3T3OA 3AU2A 3IT6B 3GOEA 2YMPA 3CP8A 3MR2A 1EM7A 9ICUA 4WIPA 2PFOA 3ZNID 4F1SA 4HPPA 5TZVA 2KHWB 4J9MA 3TADA 2AXTU 3QEAZ 2SEBD 2E8MA 2Q5WD 4I2DA 2EH9A 4R3DA 8ICMA 2ASQA 3TKAA 3NZSA 1E0ZA 4DS5A 5E6JA 4B9KA 1HA5A 2KD0A 3VTUA 2LHTA 2GMIC 1HUOA 1Q3VA 1L3SA 1WYGA 2V1YA 4OZCA 4AUQC 1N5WA 1IUEA 1A70A 1PGBA 4W9IA 4A3PA 1PDXA 2KTFA 3RJKA 1ZQNA 5D94A 1YN3A 3PX6A 2NVUI 2PW9A 1WWTA 1U9LA 3AN1A 1WXVA 1JUDA 2G1EA 1UBQA 2VA3A 2NTSA 2BKEA 4DSEA 3CRXA 4BOZB 3C8YA 1RYJA 2BVCA 5DDMA 4NV0A 2BCSA 1NJXA 4I2EA 3Q3JA 4QW9A 3PPAA 5ALFA 4IM2A 5DPSA 5ALKA 2AQ1B 2F1IA 4AYBC 2RPVA 4GLXA 5AZGA 5AI8A 3JPTA 1X66A 2BGFA 5HHDG 4C8MA 5DKWA 1YQ4B 3GIMA 1RLFA 2G4SA 1RAXA 3K9PB 3FM9A 2JZBA 4JMUA 7ICUA 1S0OA 5FK9C 8ICPA 1N6ZA 2KAJA 4P0PA 1JW9D 1XEEA 5J18A 4LNFA 3RNGC 4IR9A 5D7GA 1TAMA 1L8LA 3V6HA 3UIOB 4K81A 4DL6A 2VIXA 4MEXA 4K3BA 3TANA 3BS5A 2BR0A 2H5XA 2FMPA 1K5OA 1PGAA 2KC1A 2Y9TA 3HX0A 3UM9A 3QUTA 1WR6E 1C3TA 5KFGA 3RI7C 4ECSA 1N5XA 2HCFA 2RSUA 5DDYA 1GC6A 2Z0DB 4LNNA 3L17A 2PKEA 2WDTB 3WKBA 3OSPA 5EOZA 4MFFA 4GSWA 3CSTA 2WXHA 2Y3AA 2FPLA 2V3NA 1XLQA 1Q46A 3H8SA 1ZQLA 4PYUA 3NUHB 3PRPB 3ZDTA 4RQ7A 4N58A 1H38A 2F77X 5DGAA 5IIKA 1WI0A 3BQTA 5DQGA 5DPTA 2KN4A 1AQ6A 4KLQA 2KMAA 1KOTA 1GJZA 3N32A 1VJ5A 2WWZA 1T7PA 2MJDA 2P66A 1IG6A 1C1YB 2IGGA 2MA9B 4QJFB 4HXDA 1D5XC 3ZDMC 3VFKA 3GILA 4PS3A 2XGQA 3GZNI 4M8NA 3WKEA 5KFTA 4XQ8A 2MJEA 1FCLA 3H8JA 3NVYA 1L3UA 3GIJA 2HHVA 4RGMA 3PZPA 2EELA 1RQLA 3W5UB 3OHBA 4IKGA 1NJWA 4RU9A 1V1OA 3ZTDA 1QOFA 2WXMA 3OLMD 4GXIA 2HHSA 3AI5A 1VZ7A 3RH6A 3D32A 4L1BA 5J2IA 1QSLA 4ITKA 2KMCA 4A8XC 5JHBA 1GPXA 4I29A 5ALUA 2LPEA 1PVRA 1JXLA 3AU4A 2WXIA 4FLHA 3QU9A 2BBCA 3U8ZA 5BYRA 1NI2A 5CR0A 4MF8A 2O6KA 1ZPSA 2IZVB 2LUMA 2KWUB 3FC4A 4O1NA 4R63A 1CEZA 2J52A 2GBKA 2L7RA 1V49A 1XD3B 1Q5WB 5ALQA 3QEBZ 2NYVA 5IN7A 2EAPA 9ICIA 1P1AA 2AHOB 1DGSA 1J2MA 2KMDA 1A5RA 9ICTA 4HKQA 1Y88A 2LI5A 3HJEA 2V9HA 2BPSA 2BCQA 4IQVA 2V9WA 2BYVE 2RR9A 4YTNB 2Z7JA 4KTQA 1BT0A 1WCLA 1FFVA 1TKYA 2MW5A 2N9PC 4DFJA 5ALZA 1ZQMA 4GDKB 4NPNA 4PHEA 3Q6BA 3M8RA 2W9CA 2RLTA 9ICOA 4RQMA 1D8BA 2LM4A 1RXVA 2OJWA 3N4MB 2BQRA 1YJJA 2QCZA 4K7UA 3QX1A 5AM3A 3Q8BA 2EAOA 3RBEA 4BXOA 2KZMA 1V1PA 1D8YA 4TUPA 1YZ7A 8ICCA 1JWUD 5DG8A 4JLCA 1F1HA 4BVUC 4NNJB 4B9SA 1F52A 2WXGA 4IC9A 4F93B 3J81j 3SD7A 4XGAB 3SAFA 4MGKE 4KX3A 5ALHA 4W9FA 2XI9A 3TFSA 3QU4A 4DFMA 1ZQIA 4ECZA 3QWZB 8ICQA 1NKEA 1JRUA 4DXAB 3ZNZB 1SKSA 1JN3A 5J8YA 2GI9A 4W9JA 1JMLA 3AM9A 4DL3A 1ZJMA 3M6KA 4JWNA 4HJKA 4X57B 2M0NA 1UD7A 2J6UA 1UZXB 3AE9B 1BPEA 1NDDA 2AL3A 4M00A 4BKSA 2ACZB 3KTQA 5IILA 9ICKA 2INNE 3A9KB 4DHZB 1QCKA 2YMQA 2L8JA 4FZMA 3JVZX 3UXNA 3Q8SB 8ICKA 4LCDE 4QWEA 1X6IA 4Y2YA 4Y2XA 1EWCA 5L1IA 1DOYA 2BDPA 3MP9A 1SV0A 2JYTA 3ZJUA 3HILA 3P1MA 3N9YC 3EFUA 3PW5A 2WXKA 3IP4B 2KYWA 3VVWB 3UPQA 2ZIXB 3E58A 1J7CA 1KTKA 1X9SA 5J2HA 2AGQA 2I2YA 2B6GA 2WX0A 2ZJ5A 1ZE3D 3BQ0A 1QQ6A 2M0AA 2X38A 1QLNA 1K53A 5KFIA 1EF1A 3DBSA 1UELA 2W9BA 4W9KA 1XO1A 1L0XB 4MEMA 4AQ7A 3B0AA 5HNKA 1PVQA 2PPHA 4YWGG 3VUXA 2K8HA 5KFVA 4REZA 2WAQC 1OQRA 2XO7A 2GOWA 3RPFC 2W55A 4M9GA 4RQ4A 4RT3A 3KD3A 3IG5A 4PHDA 5DCNA 1XC9A 4ED2A 2K6QA 1U49A 3AL0B 1PK1A 3TUOA 2E5SA 1RM6C 1WJ6A 4FZLA 5KFSA 5C1ZA 3GIKA 4IR1A 1RPLA 4EX6A 2IMWP 4GOCA 5KT5A 2KWDA 3RD2A 2HBKA 5LXHA 5BPCA 3QUQA 2MBOA 1T5XD 1TT5B 2HI0A 2VZKB 4FHKA 5J2AA 1L6NA 1JWSD 5I4DA 3WAOA 2H3VA 4R65A 3KHRA 1S0NA 3KYCD 2JSVX 3GU3A 4DLGA 2Y5BB 4JPSA 1ZRMA 2REXA 3MABA 4ICUA 3DHHC 4EZLA 5JTIA 3V7JA 4DS4A 5KFDA 4QZGA 2DAFA 4NAWB 2K60A 3L0WB 3WANA 4DK5A 7ICFA 3PHXB 4OJPA 1D5MC 2Z8LA 2F1JA 4GC7A 1XQQA 4PL2A 1I42A 5IKCM 1SWWA 2EQYA 3NRWA 5E6OA 4YSXB 1FEZA 4XUSA 3TAQA 2ZW0A 4JV2A 3KHLA 2J4XA 4OJ6A 2G06A 1QLBB 2WXQA 1SZHA 1J19A 3I28A 9ICPA 8ICTA 1SEBD 3QNMA 2HHUA 3AE7B 1E7VA 2G9HD 4M9JA 3NUQA 2YMLA 9ICCA 4KLMA 2C22A 4S17A 3ZUNA 1LXDA 1E9MA 1NK7A 1KKXA 2K8CA 3OWEB 4FBTA 3ZW3A 2IPKD 2LHEA 4NWIA 5AM2A 4ZH4A 1L5PA 3L5KA 1Z00B 2KFJA 2FMSA 1ZQCA 1BXTA 1T0YA 4MF2A 3DWGC 2E8NA 5HMMA 1I4QA 3L4PA 9ICWA 3MDCA 1GOZA 2WDQB 4GDKA 4EOYA 3ENEA 3N30A 2B21A 4KVGB 1S77D 4QZIA 1OGWA 2KTQA 1C7YA 4LNIA 4NL9C 2G3QB 1D4BA 1WGGA 4I2BA 5HG2A 4NJ8A 3PRZA 4B6WA 4BDPA 1B4FA 2BYFA 3APDA 3MJ5A 4BBNC 2I1KA 4TQ0A 4A90A 1VRAB 4C4VB 3B2GA 3AV8A 1YX5B 4KN4A 1ZQXA 5AI9A 4EX7A 3MGIA 2WF5A 3A9JA 5KFZA 3W2DA 4K4GA 3Q8KA 4EEYA 9ICAA 2BKFA 2BQUA 3QZ7A 4BFRA 2G5IB 9ICNA 3DV9A 2UVWA 1JQ4A 2XY5A 1TKGA 1SKRA 1NKCA 3QU7A 4F91B 3F2CA 1TYGB 4AOFA 1L7PA 1I4HA 5KFMA 4IM0A 4JE3B 3GS2A 1TVAA 1SB3C 2QB0B 4C8KA 4OJ5A 2KSOA 5DB7A 3TQ1A 2I9GA 1WFYA 5AEKB 4UQGA 1XLNA 5ALDA 3HKZC 2LGDA 3RRHA 1X9XA 2ZJAA 1UBIA 2LRWA 1DOIA 2XK5A 5D2MB 5ALGA 5KT7A 3KH0A 2WXOA 3MJWA 3EECA 4LLGM 3H8MA 2RHFA 5IIOA 3SHQA 5HFYA 2C7MB 2KN7A 3T5HA 4I2HA 1J97A 4Q8EA 1L3VA 2GBMA 2WX1A 4B6JA 2CJOA 2DF4B 2WB1C 2ZEQA 3C19A 1L0VB 4RFBA 5EE9A 3Q8MA 2XCAA 3MFGA 3VR8B 2B0CA 2KKPA 1N60A 2CU1A 1C4AA 2RGFA 2XN9C 4GDLB 2N1WA 4NJ6A 4ANWA 4IOIE 5MPOA 3UMGA 1ZQVA 5ALLA 4Q44A 2NMQA 3F53A 4PZOA 3JPOA 2BQ3A 1T0QC 4UB6U 2E8PA 4QIWC 2BT6A 4RM8A 3BIID 4HRSA 5J0TA 1AW7A 4TV3A 4CHKA 2AGOA 2LYHA 1PQSA 4DDGD 4BX9C 3EW9A 5AKJA 4YXJA 5B66U 2K6DB 5FR3A 3RB3A 3BJYA 4HCPB 4KLJA 2IO0B 2IHNA 4F50A 2MQJA 3PW4A 4B9MA 4UBBA 2K0PA 2D3GA 3OJUA 2I5HA 3QHTA 4GMVA 2VKQA 2KOXA 3A4SC 2V3PA 5AK3A 4MFCA 4RGNA 3QXGA 2VA2A 2KO3A 2VJ5A 1WSPA 3AEFB 2F44A 1TE2A 1CQVA 2RRDA 4PGQA 1YOVB 2KKVA 5GTIU 1ZQTA 4QWDA 2L1AA 5GXGB 1F44A 1QQ7A 2D6FC 2NBWB 2ICIA 4I27A 1RRBA 2PFNA 3BY4B 4KZ0A 1KFYB 1E7UA 1MA7A 4QWCA 4P7IA 1E8ZA 4XDDA 2W11A 5DPRA 5B5EU 5KAIU 1NENB 2MBBB 4B9LA 4FJVB 1KQQA 1K52A 2BPGA 1KN5A 2HOQA 3ZD8A 3MC0B 1Z4NA 5C23A 1NZBA 2YY6A 3PMNA 5BYQA 4J9SA 4P2HA 5J0XA 3BQ1A 5KHQA 4R64A 3GE8C 4DF8A 3Q2AC 4J6IA 5CHFA 2HHWA 2DWQA 5AK4A 4A8EA 4DL5A 2PFQA 8ICVA 2KANA 3AEEB 4TQ1A 1F0ZA 5HP4A 4QZEA 4Q45A 1BPXA 2L0TA 4P4OA 4BZAA 3WK9A 1QTMA 1KW4A 4P0PB 9ICEA 1WIAA 4I6NB 4RGTA 3RJJA 2JU6X 2H3QA 1Y8RC 3BQ2A 2QARA 3BS5B 5KG5A 1TAQA 1FIQA 3RBDA 2MSNA 4OZAA 9ICHA 8ICGA 3DHIC 3BZKA 4ICAA 4F4YA 3HVZA 4G9BA 2KVZA 1SSNA 1NOMA 1WJUA 2QDFA 3I3TB 4N59A 4F5NA 3GFKB 1S10A 5ALYA 2ZVNA 3AU5A 5IO9A 1EXNA 2JGAA 1E8YA 3J9CA 4BKTA 4MH0E 2MUTA 2RDIA 4JUZA 1TK8A 2LFIA 4J9QA 1RXWA 3ETRA 4XWWA 2G5HB 4DCCA 4ARIA 2KDIA 2OXOA 4M04A 3WAPA 1WM2A 1SF0A 2SAKA 5D3IB 5FP0A 1FNWA 2K39A 2KJHB 4E3CA 3O13A 3IDWA 4C8LA 2LUEA 3ZJTA 2KMMA 1C79A 3E0FA 2FNJB 3ISDA 2RQ5A 3NVZA 4YD2A 4KLTA 2RMMA 2QHOA 2R8JA 4M2YA 4C00A 2MRLA 2MP2A 5J0RA 2ASDA 5EWEA 2W9MA 3PSEB 4O5EA 4FA6A 2IO2B 2KE7A 1NK5A 3GZFA 3BVMA 1U47A 5KTQA 2DYOA 3SFDB 3R66C 3B0XA 4DOAA 2JEJA 1AYFA 3RH5A 1PGXA 4DOCA 4CDGA 3QU5A 4EYIB 2ISOA 4M0WA 4X5VA 4RGOS 2RDGA 1UCVA 4KLIA 2LD9A 3NJTA 2PLPA 5AKKA 3PZ8A 4EFOA 4B9NA 1GB1A 1IYFA 1X9WA 1URJA 4LJXA 4WWOA 1TV9A 3R7QA 5C3JB 1H8CA 1Z4OA 1UWMA 2WXNA 3VUWA 2JRIB 3C0RB 4EZJA 3FKYA 2KHVA 4KLLA 4RNMA 2ZG6A 3S6JA 5HR6A 5IIIA 1ROEA 3PMLA 3MR6A 2LVOA 4IRDA 1ZUD2 2DX5B 2DUYA 4QZ9A 3TIXA 4UBCA 3DBLI 5J2CA 1KSPA 3AULA 1UT8A 3E9SA 1T3QA 4DLEA 1QT9A 3ICXA 2J53A 4XZ4A 2R8HA 1TFRA 4UAZA 2HVIA 4LDTB 3V6JA 8ICIA 4EENA 3T5LA 5AM0A 3RJHA 4OW0A 2N4FA 3ZDBA 1PUZA 3H7IA 5AM1A 2WF7A 3HM6X 1IXRA 1MFWA 1OEYA 4BXOB 1V1PB 2N9EB 2BYEA 1Q8KA 3VH3B 3RULA 2BB5A 3EGRA 3TAPA 2IHMA 1JX4A 2HHXA 5AI4A 2WHEA 5D6JB 2I1JA 4C0ZA 2KLCA 4RQNA 2ZTCA 4OJLA 2IYDB 2D2QA 3UMCA 2KZRA 5KFHA 4XX5A 3MGHA 3FAHA 5ALIA 3IAM1 1M6YA 2B76B 4DEZA 3WK8A 2FUHB 4IWQA 4BJQA 2KWCA 4BKGA 3JYUA 1MN8A 1YQBA 2BDUA 2NRXA 3SU8X 3IHPC 5AICA 4F5QA 2L00B 3CWIA 3RJEA 3NVWA 1NZPA 3KKAC 2D3DA 3DBRB 4FO6A 2C5LC 4KN7A 4ZRKA 5C0YA 3TARA 3M62B 4M02A 3PX4A 1HTOA 3DHGC 1NEKB 1XU4A 3OGUA 2GLEA 3NGDA 4RNNA 3MDAA 1Q10A 3LXFA 5LNK1 2TSSA 1S9FA 1MG4A 3KHHA 4E0DA 4ELVA 4MEYA 4ACOA 3OHAA 5KT6A 1SXDA 3THVA 1GB4A 4K7WA 1SL1A 3ONSA 2ON8A 3HHMA 1SZPA 9ICSA 1TY2A 4CYEA 1IPGA 1J2NA 1P0RA 1JWMD 2LYAA 5D49A 4MELA 4WJ3B 4TQSA 1NJYA 5KT2A 1WGDA 1N63A 1E8WA 2LYBA 3ECIA 2W9BB 1TS2A 1E10A 5BMHA 3NS8A 4YMOA 4MJSA 2N9XA 2LGIA 1ZQUA 1XXGA 4FS1A 1OQYA 1S8OA 2Z59B 2H3FA 4UAVA 3PW0A 3VRAB 3GV8B 4MH8A 4HEA1 4NLZA 2BB6A 5KL1B 4W9HA 1EU4A 5H92C 3U52E 4YXDB 1FCCC 4EBDA 1V9JA 1NI3A 2INDC 3K9OB 4EE2A 4NLKA 2CJNA 1C9FA 1MQ2A 4QZ8A 4DXGA 4F5OA 3MC8A 5J0QA 4Q8FA 4EZ6A 1WE7A 4UASA 1WZ0A 1L0YB 1JI7A 1PK1B 4C8NA 4YR3A 2YEPF 1SGGA 3VTWA 3N7PD 3IN5A 4L2YA 2GBRA 2V4IB 1ZJNA 5E79U 1JWBD 3KYDD 2FLLA 1T6BX 3FILA 5D4BA 4J03A 1YD8U 2KG5A 2MA1A 4Y2VA 2FE9A 4DL7A 1B9RA 1R4NI 1WM3A 2ESEA 2OJRA 3RT3B 2WS3B 1ZXIA 3M63B 1WXAA 4ARCA 7ICKA 2DLBA 2ASJA 4W9LA 1LVHA 1LB2B 3MC1A 1D6EC 2KVRA 1OXJA 4NLCA 3ZQ4A 9ICJA 4HWIB 4B0EA 3TFRA 5AI5A 5AI0A 4R8UA 1V81A 2D8CA 1X6JA 4J9RA 2JY6A 4BOSC 4DBGA 2YB4A 5L95C 2R2OA 1IP9A 2LVQA 2QILA 3HWTA 1JXEA 4Y2UA 1ZP0B 2G07A 2YN4A 2JUOA 2HOIA 5ALPA 5DLFA 4MGZE 2ZJ8A 3S2AA 3H9DA 1MJDA 3B1LX 4UATA 4E71A 1FPYA 2M9NA 4FADA 4RT2A 3QC8B 4C56C 4Y2TA 3RFZB 5KT4A 2GBJA 8ICAA 1WH3A 3HVDA 5KFUA 4AYBF 2K5PA 4RPYA 5JZEB 1UWXA 4B0MA 3L13A 3PTFC 3PR4A 3UI3A 2FCQA 2VANA 2KXJA 2P6RA 4NQKE 3PREA 2P35A 3IRUA 1XCQL 2Z0EB 2K8CB 2D5GA 1BNPA 3PV1A 1J7AA 2XIDA 4EBEA 1ZD5A 5CB1A 4IQWA 1AARA 2QIEB 1TK0A 1L8OA 4KSKC 2N1VA 3RFAA 5KHOA 4DHJB 3MTNB 4K7SA 4DSLA 3MBYA 8ICYA 1NYRA 1NKBA 2R18A 1ZXHA 1NNLA 3ZJVA 2H89B 1GAQB 3H40A 3AE2B 3IAS1 3JSVA 4WAFA 4UAWA 2WDVB 1YMHE 5H8YE 2K4IA 3PR5B 1SKWA 3IBEA 5AKHA 3RNAC 3F5AA 4DQQA 2O6VA 4XDCA 4CF4A 2KC2A 1L2NA 3P4SB 4KLUA 4EEKA 1SE3A 3V6KA 2XNAC 4TMAB 4UB2A 2XICA 3X23A 9ICXA 4O3SA 2FJ6A 1XNSA 2LMRA 4J3OD 2K4PA 8ICZA 3GIIA 3A9JB 4UB1A 4CQNA 2NRTA 7ICPA 3DCGA 4MM3A 1VJKA 2W43A 1TY0A 5KFNA 4PYZA 8ICOA 2AX5A 4I6PA 4M6WA 5D46A 2DNFA 3H6NA 4OHJA 4GIVA 3UIPB 1KFSA 2MH7A 5IAAC 5KG4A 1YJIA 3RNFC 4C8OA 2XC9A 1CI4A 1JRPA 3SAHA 3C2LA 3DPDA 2PIAA 2DZJA 4O9MA 3PRMB 3K1ZA 3AXCA 2L32A 3H7PA 2KSOB 2Y1JA 2PVOD 1NBFC 2MSED 3WK4A 2BHNA 2E1FA 5J2JA 4L23A 1MG8A 2XK5B 3B0YA 2A5UA 3DVNU 4OJOA 1ZQFA 2NS5A 1M94A 4QW8A 2BZFA 2ZUBA 7ICTA 2FIFA 2JF5A 5GTHU 3HP6A 3P63A 3ZDCA 5IA7A 3KUCB 2GWSA 3NOBA 1SBBB 2K89A 1UA0A 2L83A 1LKYB 3BS7A 1UHUA 1KDHA 3LB8C 4II2B 4A3OA 3SMVA 4F8CB 4HPLB 9ICLA 4RNAA 2ZIVA 9ICMA 5JH5C 3KQ4A 5D3DA 1DOQA 3MC9A 3DVNV 1RYSA 2NCNA 2Y0SC 4HROA 3PO5A 3DVGY 1V9PA 2HVHA 2MX2A 7ICOA 2MRPA 3C2KA 3C1YA 4ED1A 1SE4A 5JXVA 4PJ0U 3Q8LA 1SL2A 1WF9A 1RWSA 2RDHA 3Q8AA 3QIJA 3PZDA 3Q8FA 3R8BA 1V2YA 5JU5A 3V60A 4MDKE 5AKXA 2LHDA 2L52A 4IG7B 2J0KA 3WKCA 3IXSA 3RJIA 1TIFA 2FAZA 4DOBA 4I2AA 1IGDA 1TK5A 2I38A 2IDYA 3QARA 2W7OA 2LM1A 4O3NA 4F4WA 5DBBA 3CF6E 2NRVA 3QX7A 2EZXA 2G4DB 4CF3A 2DPIA 4LJPB 2K4HA 2OHFA 3MFIA 4CCHA 2CS4A 4F4KA 1OQQA 4ECTA 4ECYA 2G0AA 2M1MA 4PGXA 1K1SA 1TKEA 2XY6A 1VDVA 2YVCA 3DBHI 3T9LA 1S0VA 4EELA 2UVVA 4F92B 2LRUA 2WYQA 1R4MI 1Z5SB 3AECB 1KJTA 2K8AA 4ZRQA 3KWLA 2EAMA 4LNOA 3RTVA 2HOFA 4NY0A 1G6JA 3PV8A 1ET9A 4TUUA 3V05A 2E1EA 4CE6A 2LXCA 2RDJA 2K8BA 5AUKA 3AH7A 2ZXIA 7ICGA 2MBHA 5BMIA 3WK5A 4FJZA 1X9MA 4F2SA 2A19A 4HK2A 4JX1C 4GXKA 1CJEA 5ALWA 2C2DA 4AJYB 4O3PA 4EBCA 5KG1A 5HKHA 4P4PA 3H0LB 1I4GA 1X1MA 2V4LA 2HHTA 4J9NA 4RQ5A 5CA7A 3NRZA 4YMNA 3QYPA 1YQ3B 5AM5A 2JEIA 2QARB 5KFYA 1WWUA 1P9DU 4ECRA 3PSPA 1H4RA 2UU7A 2IGDA 1L7NA 4KV2A 1LFDA 2HE7A 2F2AB 1JWAD 2I6XA 1PZNA 3U4EG 2WAQF 4NL9A 5J0OA 2ISPA 5KFJA 2OEHA 3C29A 4IC7B 2NTTA 5AIAA 1OUQA 4W9EA 2D10A 2FLPA 3AEBB 1D3ZA 1IIPA 1UF0A 5J2FA 1UNSA 2KFKA 4HKZE 3D2NA 1QSSA 2MUTB 1ZOLA 5IINA 3OG5A 1BUIC 3CW2C 2WQYB 1QH9A 2LGXA 4G3XB 2UVRA 2O6VD 5G55A 4KMUA 2JEGA 2IOHA 5ALMA 1KLUD 4ED6A 1L7OA 2F8LA 1ZDXA 5AKYA 2FPKA 3SV3A 4I2GA 2FCMA 5AI6A 4F2RA 2BWFA 2OM6A 1WGRA 4PHAA 2BTEA 2HMXA 2OCEA 1IM4A 4ZHPA 3SI8A 3DOWA 2JXTA 2F1HA 4AJWA 3L16A 3A0HU 4NM1A 2GRIA 5AIBA 1C76A 1B0XA 2MP2B 2ZNVB 1D9FA 4FJYA 5J0WA 2BF8B 2KTRA 4E74A 2J6TA 5ALRA 3KBBA 3GZNB 4OCZA 4XWTA 4DXFA 2HJ8A 1QILA 3IG3A 4UDUC 3L3FX 1T3NA 2PJHA 3A1QA 3ZO5B 2KJ9A 1HZ5A 2L5YA 3PW7A 3FYHA 5F9LA 1C4CA 1SGHA 1TS3A 4M0WB 1UGJA 3LYSA 3W1SC 3H8WA 3CSFA 3KHGA 1SXTA 2WHIA 3N7RC 5EWGA 2WP9B 1YN4A 1JIHA 5CWRA 4WJNA 1D5ZC 2DZKA 2J7QB 2XY7A 4UB4A 2C28A 3LVVA 8ICHA 2YLMA 3TEZA 3QUCA 3TACB 2QSDA 2W7PA 5DQHA 3ZDAA 2C2EA 1XO0A 2AQ4A 3ZDEA 5LLIA 4YT0B 2KIWA 4TSSA 2FUG1 1BVSA 5IIJA 3EPGA 3SR6A 2DBYA 1F2RC 3HK0A 2HJ1A 2AWTA 2DQNB 2HBMA 1YX6B 3TL5A 3SEIA 1LKYA 5CRXA 3EPIA 2NBUA 3HIZA 4MT5A 2XCPA 2OH2A 8ICSA 1CUKA 1KLGD 2IBIB 3N7SC 1WX7A 5EE1A 1WGYA 2KV2A 4O5KA 1XCTL 2YEPB 2BCRA 1O03A 2YX8A 3CNHA 4UB3A 2ZUCA 3LDAA 3H8HA 2MAXA 1NK9A 3KWVA 4RMAA 2PVGC 3U7ZA 4LJOB 4C4RA 4OVVA 1ZRNA 4YR0A 5J0SA 1P3QU 2Q0ZX 2NPTA 4WWPA 2C9WB 1ZQOA 4IRKA 4F7ZA 1GO3F 1TJEA 4LZGA 2Y5CA 4P6VF 2JWUA 1ZQZA 1MVKA 2ZJDA 1FD6A 1GNUA 2BGWA 4KKIA 3WKAA 2L05A 3BZDB 1HTQA 2KLGA 3Q8PB 4BAXA 5C5JA 1UPHA 7ICHA 3OJ3A 1FO4A 4Z6FA 2ZVOA 2KFZA 2DFLA 2M19A 2MWSB 2NR2A 4B9VA 2AJQA 4RM9A 4N6EB 3SAGA 3M8SA 2N7EA 1WJ4A 1TAUA 5CHGA 1LO5D 3R2IA 4CO7A 3AEDB 3Q3NC 2R8GA 1N48A 3NTUA 8ICBA 5AKGA 3U7DA 3BK2A 5JHAA 3AEVA 4JB3A 3ZNGC 5ALOA 4ECQA 4CGZA 4PS7A 3APFA 3D2QA 1V97A 4LTUA 3HKZF 1V38A 4YVZA 3OSNA 5KFLA 4Q43A 2BWES 3APCA 3TI0A 5E6NA 2KQ7A 4JIOU 1ZQWA 4JWSC 2XGPA 3T5KA 3MGVA 4ZYSA 4UARA 4RPZA 2KHQA 1KRPA 4JL9A 2KICA 4JWMA 1OW5A 1WGKA 4ANXA 4MJSB 5EE3A 5E6PA 1I4RA 4ZYNA 8ICFA 3W1YA 1KM7A 3RH4A 1A77A 1MI0A 3R2TA 3X0WA 2AU0A 1Z1VA 2WF6A 8ICEA 2UYZB 5K4LA 1T94A 3JPNA 5DG7A 4M01A 5CTRC 3TEWA 4YFKA 3BYTB 5DB6A 2M8SA 2AQ0A 3D6JA 5BMGA 2YTUA 3AU6A 3RB6A 2RD0A 2NBVB 1FEHA 4A9AA 3LJ3A 2INCC 3QK0A 3TSSA 3GP7A 2K4EA 3AMZA 4NLGA 3VDZA 4RQ3A 3N1YC 3D2SA 2O2VA 2LWPA 3A4RA 1IV8A 1SE9A 1ZQHA 4UAYA 3V3XA 3FILB 3ISBA 2YQEA 5G5GA 3AEGB 4WJOA 5ALJA 3NZ3A 1VLBA 4K3CA 4YCXA 5KFCA 1ZQGA 3EFCA 3QAQA 2NRZA 4M9HA 2KJ6A 4FN2A 8ICXA 1EU3A 3ZIMA 2AYOB 3URYA 4J9LA 1ESFA 4P16A 3VAWA 3CMMB 1NJZA 5J17A 1K50A 2BPCA 4EZ9A 4R8UB 3R3MA 4PZNA 3Q8QB 1PUTA 2ZIWB 2ODGA 2MJ3A 3VRBB 2PMZC 3WK6A 3IM1A 4BUGA 2KJRA 5AKZA 3C5FA 4TUQA 1DRGA 1V5TA 2ZZPB 5DBCA 2V0GA 1Q1OA 4O5CA 2A1AA 1WMHA 4FZNA 1F2RI 3AE6B 3IVFA 5AZFA 3ZRCA 1WRIA 3M95A 3QUBA 5LXIB 4HDOA 4P0QA 2W04A 3OTQA 4O3QA 4KITB 3RR7A 3V7KA 1YZ6A 1UQVA 2GH1A 3I63C 4KLHA 3RUIB 2YMMA 4OZBA 8ICLA 1HJPA 4KLGA 4EUTA 1N62A 1HZ6A 4MSQB 1COKA 2DHZA 1RYUA 4PK1A 2MLBA 2W03A 4CF5A 3K75D 4UW9A 4Y2RA 1KBUA 1FNUA 2XEWA 3EYZA 4YL8A 4B9UA 4DSJA 3PGEA 4WJPA 2KWVB 2R2QA 1V85A 2QJLA 1JCKB 2BKRB 4EYHB 3BINA 1SWVA 3ZKJC 1V80A 4I2JA 3NHEB 3JSVB 5J29A 1ET6A 4KZCA 1J0GA 2A1JA 2KDFB 3SQIA 3I57A 4QZAA 1HEZE 1HXYD 1N56A 4JK1A 4DSKA 4RH6A 3G6YA 2O6VB 2BS2B 1LQBA 4QWBA 1WZ3A 2FCNA 2FE8A 2UWQA 1FFUA 2WF8A 5G2NA 2V4QA 2CR5A 4KGTA 5IOIA 1JMSA 2JR5A 2LKYA 1X40A 5AKEA 1VZ6A 1K51A 4QZCA 3PS6A 4RQ2A 1CZPA 1L4DB 3SENA 3KKAA 3H4DA 1NK0A 2AL6A 4MM3B 4CNQA 2PE9A 4K4IA 4M6WB 3MR5A 4Y2JA 5KG0A 1PK3A 4Y2SA 5J0PA 3AE3B 3DDCB 2C7NB 4YN4A 4RQ8A 5BOLA 3PVLA 2KQSA 3H7PB 5KFOA 2ZIUA 2KX0A 4NLBA 4DSFA 3V6CB 2KZ3A 5KAFU 5L1MA 8ICUA 3GDXA 4HJGE 4YSYB 5AHXA 4DHZE 4RUCA 1S76D 4O0IA 4ZHOA 3P4PB 4GFJA 2ZTEA 3Q8RB 2ATLA 3BVZA 2EDUA 3UQAA 2H88B 2KVCA 1CRXA 1WCNA 3PX0A 3RMKC 4YP3A 4DL2A 3QE9Y 2DZMA 3FDSA 5HHIA 4JQWC 1UH6A 2RPQA 5L1KA 2WDRB 4Y2QA 2KKCA 4RZRA 2KIVA 5CEHA 3W5VB 2EZYA 2CN1A 5HR7A 4TQRA 2QMTA 2VZKD 3WU2U 4W9DA 2BCUA 2W8LA 4MHVA 4WJQA 1ZQQA 2ZIVB 2HDEA 1WX8A 1C20A 3GB1A 2VA8A 5C2TB 4Y2PA 4CRXA 4MGYE 1SJED 4BGDA 1Q0WB 1WUDA 3Q3MC 3RAXA 2MHJA 4WAAA 4WQMA 3TADC 1I7HA 2EMTA 1KLNA 3I9V1 4KX5A 4OVUA 1M4VA 4AWJA 1RFAA 4R66A 4O3OA 5G5HA 3JW0X 2IJ0A 3ORYA 4P1CC 4PPXA 3QA8A 4IQTA 3Q3FA 4MACA 1ISNA 2DYMA 3LWMA 2JRZA 3H0MB 1GUAB 2AQ3B 2D3AA 3N28A 1ZQAA 1T4GA 2ZXHA 5KFFA 4QZBA 4I28A 2KX3A 3BWUD 1BNOA 1HE8A 2WFAA 4OD0A 4JV0A 5IP4D 1B43A 2AQ2B 2EMSA 2KFNA 2AGPA 2JZ3B 3AE5B 4YR2A 3UGBB 3N1XC 3RZWC 2GBNA 4NAMA 4Z6CA 2CRXA 1FNVA 3ALBA 2PMVA 1BPBA 4KDIC 2D11A 5BOMA 2D07B 1EO6A 5TSSA 4H2AA 4YSZB 4NXZA 5JUMA 2BPFA 2WXPA 1QKZA 5EE0A 3A33B 4DWFA 5DGBA 3B9JA 7ICQA 3GQCA 3LVWA 3QZ8A 3LYYA 2PI5A 3B08A 3V61A 1B1ZA 4AP4C 4HPMB 3A0BU 4ZRJA 3SYZA 2LGSA 3LWLA 4A6QA 3ZGZA 4C7YA 2HBJA 4M47A 4KIKB 4XC2A 4B9TA 3OJSA 2K8BB 2J6SA 1O08A 4PS8A 2ZIWA 3ED5A 4DQSA 9ICBA 4F5PA 1TS5A 3MFHA 3KW5B 5DG9A 1WG8A 1CK1A 1E6EB 4RQ0A 2V4RA 1JALA 1WY8A 9ICVA 3PSTA 4ZRIA 2F8KA 4ANUA 4HLEA 1WWVA 1BPZA 3ZDDA 4U6PA 2X8XX 3KUZA 3VUYA 1WYWB 2LXAA 1IBXA 3U26A 1Z1BA 4GB9A 3NASA 4XE0A 4O3RA 2J0MA 1ZW7A 3AE4B 3L54A 2QKQA 4YG2A 5KL8B 4ZDVA 2FBWB 3C28A 4MGIE 9ICFA 2L3ZA 4GXBA 4KKJA 5AK6A 3DQVA 3H1UA 7ICLA 3P2BA 2C2RA 3ZXRA 2FMQA 2ZUDA 4M0AA 2DENB 2QB1A 3PT2B 3ZXVA 1C77A 3G6VA 2KFKB 4ANVA 2WLBA 5H2FU 3RB0A 2D3CA 3DEEA 2RDBC 1ZGUB 1YNTE 1LV5A 3QQ8B 3EWAA 4RNOA 5FKAC 2EANA 3C21A 3RAQA 1E5WA 1KH0A 1C78A 1TTNA 3L08A 2F3NA 3BQ7A 1LGRA 1UUPA 2MBEA 1D8LA 3WCQA 1ZYQA 1A76A 2BW2A 2QC8A 2M56B 3PHWB 5F9NA 4URKA 3BVGA 3UF8A 3ML8A 4ED8A 1WX9A 1A6SA 3ZNHB 5J2RA 4ECWA 2KTRB 1J8CA 1XWLA 2HBLA 2HW3A 1QQRA 1ZOYB 3M9NB 4J9PA 4ECVA 2Y9UA 2GO7A 4UB5A 3M3JA 3A1QB 3H4BA 5KFAA 5J0UA 1IGCA 1Z19A 2WU2B 3Q69A 5J0YA 4F3OA 1U45A 3WKDA 2JHDA 1FRDA 1RYRA 4AP9A 4FXCA 2ZTDA 2ES6A 3ALRA 1DK2A 1K8RB 3F2DA 3E2EA 2L0FA 4F5RA 4KLFA 2YB1A 1ED1A 2JEFA 2ALZA 4GC6A 4FE3A 1FMAD 3RYTA 3P42A 5DB9A 7ICIA 1QOGA 3VR9B 4ZRPA 4KMOB 1MPEA 4NJ7A 1NYQA 4GN1A 1QOAA 4XRHA 2N9KA 4GXJA 4GGQA 2PI4A 5L83A 2PFPA 2XVTA 3HPOA 3Q8EA 4USAA 4YXMA 2JZPA 3PY8A 1ZQDA 5J8YC 1L6VA 3PLVA 2ZW1A 1N61A 4QZHA 3DBLB 2IO3B 1EF5A 1P7DA 1NVID 2MU2A 3PZ7A 5HI1A 1WGHA 2BS3B 2WF9A 2G45B 4G3IA 2G09A 2NPTB 3PVXA 3RNCC 2DGZA 5KFWA 5CHWA 2K1FA 3R9KA 3Q3OC 3TEXA 5KFXA 4PH5A 3MR3A 3ML9A 4QAYA 1S1QB 4S0RA 3F5EA 2NO5A 5KFEA 2QEJC 4OVZA 3DVGX 3ZLZA 1SV4A 2W8KA 4DWIA 1ENFA 1YIWA 4NZLB 5TISU 5AUIA 1SV0C 4Z6DA 4US8A 5ALSA 1S97A 7ICMA 4US9A 5KG6A 4PGYA 2R8IA 4N9F4 3T79A 2VJ4A 4RUAA 4NLNA 2VRRB 2KP7A 3AQFA 2IBKA 1SIJA 1ZD3A 4KLSA 7ICRA 1CMXB 1Z2MA 3DWMA 4I2IA 4F8RA 1DK3A 2I1QA 3QJZA 3V72A 1PFDA 2HHQA 5L9XA 2WXRA 1P7FA 1ZETA 2CHXA 3IG8A 4ICVA 2AH5A 2GB1A 4IM3A 4HDQA 2G08A 3SDLC 3BYYB 2W3SA 1VR9A 3RB4A 1ZQEA 1MSWD 3TCAA 3SFEB 3Q14C 2DYBA 5AKLA 1RQNA 4WWMA 1ZQPA 2B3AA 1VZ8A 2JVCA 2LASA 4NJCA 3QU2A 4RF1A 2LI6A 4J9OA 1ZQYA 2DL0A 5J2KA 1L5UA 2HTHA 2WXLA 3UMBA 9ICGA 1MHXA 4KIKA 1F77A 3EA6A 2PXIA 4ED0A 5A0LA 2CXYA 2KQ4X 1KEJA 1YN5A 2JZZA 1EWYC 3ZRFA 2LGYA 1ZQ1C 4NY8A
chains in the Genus database with same CATH topology
2J42A 3AE8B 4N6EB 2BBCA 5BYRA 4OW0A 1ZPSA 2LUMA 1LO5D 3R2IA 3AEDB 3FC4A 3AE1B 4O1NA 2J52A 1V1PB 2BB5A 3BK2A 2PTLA 3EGRA 3PO0A 2BYTA 1Y56A 4HKQA 1V97A 4LTUA 4Q2JA 1TZOA 3FAHA 4YTNB 3IAM1 1HQRD 2B76B 2Y5PA 1FFVA 1KF6B 1TKYA 4GDKB 4JWSC 1I4PA 4ZYSA 4KGRA 1DGJA 3CWIA 2LJIA 3NVWA 3NS1A 1WGKA 1YJJA 2PKOA 5EE3A 1I4RA 3Q8BA 1NEKB 1V1PA 1KRHA 1MI0A 3R2TA 1JWUD 2WXJA 3TEWA 1Q10A 2R61A 2WXGA 3LXFA 2E3TA 5LNK1 2TSSA 3BYTB 5BMGA 4YSZB 4A9AA 1FEHA 2INPE 1GB4A 3TSSA 3GP7A 3IT4B 2GI9A 1JMLA 3AMZA 3AM9A 5BYSA 2ON8A 3W1SA 1XLOA 1TY2A 3AE9B 2JQRB 1JWMD 1AWDA 2ACZB 2INNE 2K3UA 3V3XA 3FILB 3AEGB 5G5GA 1N63A 2OEDA 1ACCA 1TS2A 3NZ3A 1VLBA 1E10A 5BMHA 2LGIA 1J7BA 1XXGA 1FXAA 2JYEA 1EWCA 4DQOC 1EU3A 1DOYA 3VRAB 4MH8A 3MP9A 4HEA1 4RCOA 3URYA 2BB6A 1ESFA 1EU4A 5H92C 4P16A 2N9LA 3U52E 2JYTA 3ZJUA 4YXDB 1FCCC 1K50A 1NI3A 4EE2A 3P1MA 4AS1A 1R7SA 2CJNA 3N9YC 1C9FA 1PUTA 4DXGA 3EUB2 2WXKA 2MJ3A 3VRBB 1L0YB 1J7CA 1BMLC 1P7EA 1KTKA 2YEPF 2I2YA 2V0GA 4L2YA 1ZE3D 2KACA 2V4IB 1JWBD 2M0AA 1F2RI 2X38A 3AE6B 1T6BX 3FILA 1K53A 1WRIA 1L0XB 4AQ7A 1B9RA 2WS3B 1JROA 1ZXIA 4YWGG 4ARCA 2DLBA 4OZBA 1D6EC 4REZA 3ZQ4A 1V8CA 1N62A 1I4XA 1HZ6A 1STEA 4B0EA 1OQRA 3RPFC 2W55A 2N7JA 1L4ZB 1FNUA 2QILA 3TUOA 1ZP0B 1RM6C 2K9XA 2QJLA 2LMCA 1JCKB 2JX5A 2KWDA 1ET6A 4C56C 1ZDVA 3RFZB 1T5XD 2VZKB 3HVDA 3I57A 1WXQA 2K5PA 1HEZE 1HXYD 1JWSD 1UWXA 1QOBA 4B0MA 5I4DA 4RH6A 3UI3A 3P4QB 3U2SC 2BS2B 4C80A 3Q8CA 2FE8A 2JSVX 4YTPB 1XCQL 1FFUA 2D5GA 4KGTA 4GLSC 4JPSA 1TS4A 1J7AA 1SJHD 3NVVA 1VZ6A 1K51A 2QIEB 1CZPA 1L4DB 4NAWB 3HRDD 4MM3B 3VQIA 1D5MC 2Z8LA 5T8IA 3ABVB 1NYRA 4YSXB 3AE3B 1ZXHA 3ZJVA 3BK1A 2H89B 1GAQB 3AE2B 3IAS1 4WAFA 2ZW0A 2J4XA 1QLBB 2WXQA 2WDVB 1YMHE 5H8YE 1XF5L 1QF6A 1SEBD 1SE2A 3AE7B 3W9CB 2G9HD 4LK0M 4XDCA 4HJGE 4YSYB 2W82A 3P4SB 1SE3A 4ZHOA 1E9MA 3P4PB 2CU3A 3BVZA 2XNAC 2LEKA 3OWEB 4TMAB 2H88B 2IPKD 2LHEA 4J3OD 3P4RB 4CQNA 2K22A 1L5PA 2WDRB 1VJKA 1BXTA 1TY0A 3DWGC 4D2KA 2AX5A 3W5VB 1I4QA 2QMTA 2VZKD 4OHJA 3L4PA 2MH7A 1GOZA 1YJIA 2WDQB 2HDEA 5C2TB 3GB1A 2E6XA 1JRPA 1PYWD 2PIAA 1SJED 2L32A 1D4BA 1FRRA 5HG2A 2PVOD 4WQMA 1I7HA 3MJ5A 3I9V1 4TQ0A 4A90A 1VRAB 1M4VA 4L23A 3B2GA 3AV8A 5G5HA 4KX6B 4WH4A 2IJ0A 4MACA 3W2DA 2DYMA 3LB8C 3P63A 2AQ3B 1XLPA 3AEAB 3HUIA 1SBBB 3BWUD 4C7ZA 1AN8A 1JQ4A 2L83A 1TKGA 4YTMB 2AQ2B 4ZOHC 1TYGB 3AE5B 4JWUC 4RNAA 1I4HA 1MHHE 2WXFA 4JE3B 3GS2A 3KQ4A 5D3DA 1SB3C 4NAMA 1FNVA 4HROA 2PMVA 2W3RA 4KGSA 5TSSA 1IBXB 3AB5A 1XLNA 1XO3A 4H2AA 2EKIA 1DOXA 2WXPA 1QKZA 5EE0A 1SE4A 5JXVA 3B9JA 1DOIA 2RDHA 1RWSA 3LYYA 2HTME 3Q8AA 3Q8FA 3R8BA 2WXOA 4LLGM 2IGHA 1B1ZA 5HFYA 4A6QA 2LHDA 3ZGZA 4C7YA 3ZYYX 2L52A 2WU5B 1C4PA 3IXSA 1RFKA 2CJOA 4RF0A 1L0VB 2WNMA 1IGDA 1TS5A 4RFBA 5EE9A 2I38A 2IDYA 3MFGA 3MHZA 2KDMA 1N60A 2XN9C 1C4AA 4PT5A 3VR8B 1CK1A 4GDLB 1E6EB 1JALA 4IOIE 5MPOA 3KLSX 2NMQA 1E7PB 1DYQA 2OHFA 1OQQA 2N0SB 2BT6A 1IBXA 3BIID 4HRSA 3T3NA 1FXIA 1AW7A 1TKEA 1VDVA 1OFFA 3CIRB 4XE0A 3AE4B 3AECB 5FR3A 4IDIA 4ZRQA 2FBWB 1L6UA 3KWLA 1FM0D 3TEYA 4WURA 4KKJA 1ET9A 3V05A 2K0PA 2ONQA 5AUKA 3AH7A 2V3PA 5BMIA 4RGNA 1WSPA 1C77A 3AEFB 2WLBA 4JX1C 1CQVA 2W54A 1CJEA 2BS4B 3SEBA 1YNTE 2L1AA 5GXGB 2ICIA 3E56A 1I4GA 1KFYB 5FKAC 4A55A 1KH0A 2MEKA 1C78A 3B2FA 4XDDA 3NRZA 1NENB 1YQ3B 1UUPA 3WCQA 3T3OA 2BW2A 3IT6B 1K52A 2M56B 3BVGA 2IGDA 3MC0B 1EM7A 5BYQA 1JWAD 4WIPA 3U4EG 1QQRA 1ZOYB 2NTTA 2DWQA 2SEBD 3AEBB 2Q5WD 4TQ1A 3AEEB 1F0ZA 1UNSA 4HKZE 4R3DA 1E0ZA 1IGCA 5E6JA 2WU2B 1BUIC 1HA5A 3Q69A 2WQYB 1FRDA 1KLUD 4FXCA 4OZCA 1WYGA 1ZDXA 4RGTA 1N5WA 1IUEA 1A70A 1PGBA 2JU6X 1PDXA 4ZHPA 1YN3A 2JXTA 2PW9A 1WWTA 1FIQA 4OZAA 3AN1A 2G1EA 1FMAD 3P42A 2NTSA 3HVZA 2GRIA 1QOGA 4ZRPA 1C76A 3VR9B 1MPEA 3C8YA 1RYJA 1NYQA 1SSNA 1QOAA 4N59A 2N9KA 2AQ1B 4XWTA 2RPVA 4DXFA 1QILA 3Q8EA 4USAA 4UDUC 3J9CA 5HHDG 1HZ5A 2JZPA 2LFIA 1YQ4B 1C4CA 1TS3A 1L6VA 3ETRA 2ZW1A 1N61A 1UGJA 4XWWA 4ARIA 5FK9C 1NVID 2KAJA 5HI1A 3PZ7A 1JW9D 1SXTA 1XEEA 1SF0A 2BS3B 2SAKA 1YN4A 2WP9B 5D3IB 5D7GA 1FNWA 1D5ZC 3O13A 3ZJTA 2BTEA 1PGAA 2KMMA 3TEZA 1C79A 3TEXA 2QSDA 3NVZA 2RMMA 4OVZA 2QEJC 1N5XA 4YT0B 4TSSA 1ENFA 2FUG1 1F2RC 3SR6A 2DBYA 4NZLB 5AUIA 4US8A 4US9A 2WXHA 2Y3AA 3BVMA 3SFDB 2V3NA 1XLQA 2DYOA 4MT5A 1PGXA 1SIJA 1AYFA 1KLGD 3DWMA 3NUHB 4N58A 4M0WA 4RGOS 2RDGA 5EE1A 2PLPA 3PZ8A 1XCTL 2YEPB 1GB1A 2KN4A 3H8HA 3KWVA 1PFDA 2WXRA 2PVGC 3U7ZA 1P7FA 2GB1A 2MJDA 2IGGA 5C3JB 1D5XC 2W3SA 1UWMA 1VR9A 3BYYB 2WXNA 1TJEA 1FCLA 2MJEA 2Y5CA 4P6VF 3SFEB 2JWUA 3NVYA 1MVKA 4WWMA 3W5UB 1VZ8A 4RGMA 2EELA 4KKIA 4NJCA 1ROEA 4RF1A 1FD6A 4IKGA 1V1OA 3BZDB 1QOFA 2WXMA 1ZUD2 2WXLA 1MHXA 1F77A 1VZ7A 3EA6A 1FO4A 3E9SA 4L1BA 4ITKA 1T3QA 2M19A 4A8XC 1QT9A 2J53A 1GPXA 2KQ4X 1YN5A 1EWYC 2WXIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AE8 B;  2WS3 B;  1JRO A;  1ZXI A;  4N6E B;  1ZOY B;  3LB8 C;  3P63 A;  3AEA B;  1XLP A;  5AUI A;  3HUI A;  2DWQ A;  1V8C A;  3AED B;  3AEB B;  1N62 A;  2Q5W D;  1F0Z A;  3FC4 A;  3AEE B;  3AE1 B;  4C7Z A;  1OQR A;  1JQ4 A;  2L83 A;  1TKG A;  4YTM B;  1E0Z A;  3RPF C;  2W55 A;  2WU2 B;  2WQY B;  4ZOH C;  1FRD A;  1TYG B;  3AE5 B;  4FXC A;  4JWU C;  1WYG A;  3PO0 A;  1N5W A;  1ZP0 B;  1RM6 C;  1IUE A;  1A70 A;  1SB3 C;  2K9X A;  1PDX A;  2QJL A;  4HRO A;  1V97 A;  4LTU A;  4ZHP A;  2JX5 A;  3FAH A;  2W3R A;  4YTN B;  1WWT A;  1FIQ A;  3AB5 A;  2B76 B;  3AN1 A;  1XLN A;  1XO3 A;  1DOX A;  2EKI A;  2G1E A;  1FMA D;  1FFV A;  1KF6 B;  1TKY A;  5EE0 A;  4JWS C;  3HVZ A;  1QOG A;  3VR9 B;  3B9J A;  1DOI A;  1WXQ A;  2K5P A;  1RWS A;  2HTM E;  1RYJ A;  1DGJ A;  3CWI A;  1NYQ A;  1QOB A;  3NVW A;  1QOA A;  3NS1 A;  4N59 A;  3P4Q B;  2BS2 B;  4C80 A;  1WGK A;  1YJJ A;  4C7Y A;  2PKO A;  2L52 A;  3ZYY X;  2WU5 B;  4USA A;  4YTP B;  5EE3 A;  1FFU A;  1RFK A;  2CJO A;  1YQ4 B;  1J7A A;  1NEK B;  1L0V B;  1KRH A;  3NVV A;  1L6V A;  3ETR A;  5EE9 A;  1N61 A;  2QIE B;  3VR8 B;  1CZP A;  1N60 A;  3HRD D;  1E6E B;  3LXF A;  1NVI D;  2E3T A;  2KAJ A;  1JW9 D;  1JAL A;  5MPO A;  1SF0 A;  2BS3 B;  2WP9 B;  4YSZ B;  4A9A A;  1E7P B;  2OHF A;  1OQQ A;  3ABV B;  1NYR A;  2KMM A;  4YSX B;  2N0S B;  3AE3 B;  2BT6 A;  1GAQ B;  2H89 B;  3AMZ A;  3AM9 A;  3NVZ A;  1FXI A;  3AE2 B;  1TKE A;  3BII D;  4HRS A;  1VDV A;  1OFF A;  1XLO A;  3CIR B;  1QLB B;  3AE9 B;  2WDV B;  2JQR B;  1N5X A;  5H8Y E;  4YT0 B;  3AE4 B;  1AWD A;  3AEC B;  2ACZ B;  1QF6 A;  3SR6 A;  2DBY A;  4IDI A;  2FBW B;  1L6U A;  4US8 A;  1FM0 D;  5G5G A;  1N63 A;  3AE7 B;  3AEG B;  3KWL A;  4US9 A;  3W9C B;  4YSY B;  1VLB A;  3SFD B;  3P4S B;  1E10 A;  1XLQ A;  4ZHO A;  1E9M A;  3P4P B;  2CU3 A;  1SIJ A;  1AYF A;  2LEK A;  1J7B A;  3DWM A;  1FXA A;  5AUK A;  2H88 B;  3AH7 A;  4N58 A;  5EE1 A;  3VRA B;  1DOY A;  3P4R B;  2K22 A;  1L5P A;  2WDR B;  5H92 C;  3AEF B;  1PFD A;  1VJK A;  2PVG C;  4YXD B;  2WLB A;  4JX1 C;  2BS4 B;  2W54 A;  1CJE A;  1NI3 A;  2AX5 A;  2MJD A;  3DWG C;  3P1M A;  1R7S A;  2CJN A;  3W5V B;  1PUT A;  5C3J B;  2W3S A;  3EUB 2;  3L4P A;  1UWM A;  2MH7 A;  5GXG B;  1TJE A;  1YJI A;  2MJ3 A;  2WDQ B;  3VRB B;  1J7C A;  2MJE A;  2Y5C A;  4P6V F;  5C2T B;  3SFE B;  1KFY B;  1JRP A;  3NVY A;  2PIA A;  4WWM A;  3W5U B;  3B2F A;  1ROE A;  3NRZ A;  1NEN B;  1YQ3 B;  1JWB D;  1FRR A;  3WCQ A;  1QOF A;  1ZUD 2;  2PVO D;  2M56 B;  1I7H A;  3AE6 B;  4WQM A;  1WRI A;  1FO4 A;  4ITK A;  1T3Q A;  2M19 A;  1GPX A;  1QT9 A;  3B2G A;  1JWA D;  3AV8 A;  5G5H A;  1EWY C;  1B9R A;  4KX6 B; 
#chains in the Genus database with same CATH topology
 4P4M A;  2J42 A;  3AE8 B;  4ED3 A;  1S5L U;  4K1R B;  3O65 B;  1PVP A;  3NY5 A;  3VTV A;  1B22 A;  3N97 B;  4YQW A;  3AE1 B;  2KD1 A;  1WXS A;  2AEH A;  4BWJ A;  4MFA A;  4K4H A;  5CX3 A;  4EZK A;  3RRG A;  5ALE A;  1BPY A;  4LVS A;  2BCV A;  3SD5 A;  4XYC A;  3HT3 A;  2PTL A;  2Y0S F;  3TBL D;  1KLV A;  3PO0 A;  1KL9 A;  3GV7 B;  1LM8 B;  1Y56 A;  4HVB A;  5BO4 B;  2BYT A;  2KJ8 A;  4DSI A;  2C7H A;  4I2F A;  4Q2J A;  3BDP A;  5ALT A;  1TZO A;  5ALX A;  1HQR D;  4Z6E A;  2VH2 A;  3UQ2 A;  2Y5P A;  1KF6 B;  2D3B A;  1XSN A;  2O2V B;  2IY1 B;  1I4P A;  2XBB C;  3T3F A;  4KGR A;  1DGJ A;  2LBO A;  7ICJ A;  3UIN B;  2LJI A;  2NV3 A;  3NS1 A;  2KN5 A;  1T8E A;  4QNL A;  2PKO A;  4RQ1 A;  4IQU A;  2HD5 B;  3JPP A;  3WA0 A;  4QZD A;  4W9G A;  4IL6 U;  1RG6 A;  3HW8 A;  2LZ6 A;  2JH1 A;  1KRH A;  3ONN A;  3ZD9 A;  5IIM A;  3RCZ A;  3KUD B;  2WXJ A;  3KZI U;  1V86 A;  2R61 A;  3VH4 B;  2E3T A;  3VXW A;  3U30 A;  5KFB A;  1BGX T;  5KG2 A;  2W9A A;  2KZZ A;  1R4N B;  4IW0 A;  4TUS A;  2MCN B;  2INP E;  4LDT D;  3IT4 B;  1U48 A;  3JPS A;  5CJ7 A;  1SXE A;  1ZKH A;  5BYS A;  3M1Y A;  1NK6 A;  2OYY A;  5HML A;  3W1S A;  8ICR A;  1XLO A;  3RJF A;  2JQR B;  3V62 A;  2N1R A;  1AWD A;  1ZQK A;  1WMH B;  2HSZ A;  2KEY A;  1D9D A;  2K3U A;  1U4B A;  4F4Z A;  2OED A;  1ACC A;  1WXM A;  5J2D A;  5AK5 A;  1XT9 B;  2GOL A;  4P0Q B;  2LVP A;  4M9N A;  3K1R B;  4KLE A;  1J7B A;  1K1Q A;  1FXA A;  1S0M A;  1GG3 A;  2JYE A;  4DQO C;  4I2C A;  4FBJ B;  2NO4 A;  1L7Y A;  4RCO A;  1F5S A;  3JPQ A;  2KNB A;  3C5G A;  2DAJ A;  1KFD A;  4G50 A;  2N9L A;  3L10 B;  2J0J A;  3F2B A;  8ICJ A;  3KVF B;  3RNB C;  4AS1 A;  1R7S A;  2M17 A;  3DDH A;  4ELU A;  4BKS D;  3EUB 2;  3DBR I;  4C4S A;  1P7E A;  1BML C;  3BZC A;  4LZD A;  3C2M A;  1ZQS A;  1F9J A;  4QWA A;  5ALV A;  2IA6 A;  4KSL C;  2KAC A;  2MBQ A;  3H0R B;  3A9K A;  1V6E A;  1TKD A;  2M0X A;  4RPX A;  7ICV A;  2A1J B;  2FLN A;  1MQ3 A;  3PNC A;  2ZPN A;  1ZQR A;  3AUO A;  2Y1I A;  2N7D A;  1WJN A;  4TUR A;  2JPH A;  3N3K B;  1JRO A;  1TGZ B;  4XA5 A;  4B95 A;  1HIW A;  3G6X A;  4G0N B;  5JRT A;  4RQ6 A;  3T5J A;  3OAW A;  4KDL B;  1V8C A;  3KZX A;  1I4X A;  1STE A;  2W9N A;  1YT3 A;  5KT3 A;  2PE6 B;  4IS7 A;  3WAM A;  2N7J A;  3PSF A;  1L4Z B;  2CHZ A;  4BBN F;  2ZIX A;  3JPR A;  5AZH A;  2FID A;  3UQB A;  4FFD A;  2K9X A;  4ED7 A;  1N2X A;  1NK4 A;  2LMC A;  4ACF A;  5L1J A;  1P98 A;  3R7R A;  4IWP A;  2FI1 A;  3PLU A;  2JX5 A;  3IHQ B;  2E8O A;  1ZD4 A;  2IOF A;  3ETL A;  1UA1 A;  2ZCB A;  1ZDV A;  9ICR A;  7ICN A;  1E90 A;  2BQQ A;  4BWM A;  3I76 A;  2KT7 A;  3EC8 A;  1VD2 A;  1VCB A;  5KFP A;  5KFK A;  2OWO A;  2ZIU B;  4O3M A;  1WXQ A;  3TJP A;  5ALN A;  3C23 A;  1QOB A;  4DQR A;  1UGM A;  5EWF A;  1T0R C;  4HCN B;  3P4Q B;  1V5O A;  1DXS A;  4C80 A;  3U2S C;  4YD1 A;  4LNK A;  4WWN A;  4HAI A;  3Q8C A;  4YTP B;  3WIM A;  3RNE C;  4GLS C;  4DQI A;  1TS4 A;  1ZD2 P;  4HYK A;  2H3Z A;  2P6U A;  4DL4 A;  1SJH D;  3C1Z A;  3NVV A;  1TBE A;  3HRD D;  5GMV A;  2WTF A;  1XSL A;  3VQI A;  4OO1 J;  4EKU A;  2QLT A;  2KK0 A;  5T8I A;  4ASW C;  1A0P A;  3ABV B;  1QQ5 A;  1HEK A;  3VC8 A;  2KOB A;  3BK1 A;  1X2I A;  4F4X A;  3K4G A;  4JGH B;  5CP2 A;  2CHW A;  4KLD A;  2JXX A;  4GIB A;  1XF5 L;  1QF6 A;  2WB1 F;  1SL0 A;  5KG3 A;  1SE2 A;  3W9C B;  4LK0 M;  3I1Y A;  4M9L A;  4IRC A;  3ZI4 A;  2W82 A;  3WK7 A;  2CU3 A;  3QCA A;  2LEK A;  2Q4T A;  2L76 A;  3PSI A;  1HUZ A;  3IV6 A;  1GC7 A;  2DZI A;  3EZ5 A;  4FUL A;  3RJG A;  3M6Z A;  2K25 A;  3H7S A;  3P4R B;  3M7D A;  5J2B A;  5T14 A;  2K22 A;  4W9C A;  4NAW A;  4QIW F;  3EHV A;  3N20 C;  4TKN A;  5DB8 A;  5CHV C;  3IFW B;  5FR6 A;  1F0M A;  4D2K A;  1ZQB A;  1KTQ A;  4YMM A;  2FCS A;  2CPR A;  4UB8 U;  2NRW A;  5KFQ A;  1L3T A;  4DFD A;  4DQP A;  3RF9 A;  5KG7 A;  1UT5 A;  2JZB B;  1PYW D;  2E6X A;  4PL1 A;  7ICE A;  3RR8 A;  1U4A A;  3CYM A;  1XS9 D;  1FRR A;  3ZVV A;  1S3S G;  3NZU A;  5AKI A;  1OTR B;  4P1B C;  3AQE A;  3TMP B;  4ELT A;  2JRH A;  4KX6 B;  4WH4 A;  3GV5 B;  1ZQJ A;  1L7M A;  1FXT B;  4DHJ D;  4IUM B;  1KFT A;  4FS2 A;  2JXJ A;  1XLP A;  5L1L A;  3AEA B;  3HUI A;  1Z00 A;  3V6E B;  2LJ5 A;  3SV4 A;  3LDZ E;  3DBH B;  4C7Z A;  3KFU F;  1AN8 A;  1SIF A;  3V7L A;  2DPJ A;  8ICW A;  4YTM B;  2FDR A;  3VCB A;  1R4M B;  1EUV B;  4ZOH C;  5AM4 A;  4JWU C;  3VHT C;  2RP5 A;  3WAL A;  3O0F A;  1MHH E;  4JV1 A;  1BPD A;  2WXF A;  3HM3 A;  5DLG A;  1MC8 A;  2JH7 A;  4DF4 A;  4QZF A;  2KDB A;  2W3R A;  3KOO A;  7ICS A;  2C60 A;  4KGS A;  2F76 X;  3AB5 A;  5J2E A;  1IBX B;  4NM2 A;  1XO3 A;  2EKI A;  3UQ0 A;  1YJ1 A;  1DOX A;  3NG0 A;  3ZTC A;  4C4V A;  2GLS A;  2HTM E;  3OPX A;  3ISC A;  4F72 A;  3PO4 A;  2KDE B;  2IGH A;  2DKX A;  2VH1 A;  4IWO A;  8ICN A;  4PHP A;  3ZYY X;  4U7C A;  3MHS D;  2WU5 B;  5F3X B;  1C4P A;  4DO9 A;  2EKE C;  1RFK A;  4FBU A;  3OJ4 B;  3RN9 C;  4RF0 A;  2JMG A;  1RZT A;  2WNM A;  1RDF A;  3T8M A;  2EZZ A;  4GU2 A;  1X42 A;  3MHZ A;  2KDM A;  4PT5 A;  1COO A;  3SZ2 A;  2A4Z A;  3RZF A;  2ZNV C;  3KLS X;  2ASL A;  2QB0 A;  1NK8 A;  4KLO A;  1E7P B;  1DYQ A;  1WR1 A;  4NQL B;  4FHJ A;  4DFK A;  5KNI A;  2KK8 A;  4M8M A;  5EDS A;  1T0S C;  2N0S B;  2R8K A;  2KJ5 A;  3T3N A;  1FXI A;  2JV3 A;  3N1Z C;  1OFF A;  3CIR B;  4WQO B;  3UXO A;  4A20 A;  2V3S A;  5TR5 A;  4MSM B;  1ARO P;  1QSY A;  2ZCC A;  4IDI A;  1L6U A;  2JT4 B;  1FM0 D;  3TEY A;  2A3V A;  3I5J C;  4WUR A;  4UAU A;  4C4T A;  5HHH A;  4ECU A;  2OOB B;  2M4N A;  1TZ1 A;  2ONQ A;  2KVS A;  2H3I A;  2JWZ A;  1E8X A;  4J9K A;  2HDO A;  1XSP A;  3LK9 A;  3PW2 A;  1WE6 A;  3UXP A;  5DBA A;  2W9C B;  2PEA A;  4I6L B;  2FPM A;  4ECX A;  2WGS A;  4GDL A;  4II3 B;  2IO1 B;  9ICQ A;  2IOF K;  5DPW A;  3M9M B;  2BS4 B;  2W54 A;  2PMZ F;  1Q3U A;  4G11 A;  3SEB A;  4EEW A;  5DQI A;  3M9O B;  2KNJ A;  4DDI D;  2ZPY A;  5J2G A;  1I35 A;  4DFP A;  2CKH B;  1WRD B;  2UVU A;  1Z3E B;  3E56 A;  4A55 A;  2DKZ A;  2MEK A;  3GE3 C;  3B2F A;  1QZE A;  1ECW A;  5KFR A;  4F71 A;  1OEY J;  2IY0 B;  3T3O A;  3AU2 A;  3IT6 B;  3GOE A;  2YMP A;  3CP8 A;  3MR2 A;  1EM7 A;  9ICU A;  4WIP A;  2PFO A;  3ZNI D;  4F1S A;  4HPP A;  5TZV A;  2KHW B;  4J9M A;  3TAD A;  2AXT U;  3QEA Z;  2SEB D;  2E8M A;  2Q5W D;  4I2D A;  2EH9 A;  4R3D A;  8ICM A;  2ASQ A;  3TKA A;  3NZS A;  1E0Z A;  4DS5 A;  5E6J A;  4B9K A;  1HA5 A;  2KD0 A;  3VTU A;  2LHT A;  2GMI C;  1HUO A;  1Q3V A;  1L3S A;  1WYG A;  2V1Y A;  4OZC A;  4AUQ C;  1N5W A;  1IUE A;  1A70 A;  1PGB A;  4W9I A;  4A3P A;  1PDX A;  2KTF A;  3RJK A;  1ZQN A;  5D94 A;  1YN3 A;  3PX6 A;  2NVU I;  2PW9 A;  1WWT A;  1U9L A;  3AN1 A;  1WXV A;  1JUD A;  2G1E A;  1UBQ A;  2VA3 A;  2NTS A;  2BKE A;  4DSE A;  3CRX A;  4BOZ B;  3C8Y A;  1RYJ A;  2BVC A;  5DDM A;  4NV0 A;  2BCS A;  1NJX A;  4I2E A;  3Q3J A;  4QW9 A;  3PPA A;  5ALF A;  4IM2 A;  5DPS A;  5ALK A;  2AQ1 B;  2F1I A;  4AYB C;  2RPV A;  4GLX A;  5AZG A;  5AI8 A;  3JPT A;  1X66 A;  2BGF A;  5HHD G;  4C8M A;  5DKW A;  1YQ4 B;  3GIM A;  1RLF A;  2G4S A;  1RAX A;  3K9P B;  3FM9 A;  2JZB A;  4JMU A;  7ICU A;  1S0O A;  5FK9 C;  8ICP A;  1N6Z A;  2KAJ A;  4P0P A;  1JW9 D;  1XEE A;  5J18 A;  4LNF A;  3RNG C;  4IR9 A;  5D7G A;  1TAM A;  1L8L A;  3V6H A;  3UIO B;  4K81 A;  4DL6 A;  2VIX A;  4MEX A;  4K3B A;  3TAN A;  3BS5 A;  2BR0 A;  2H5X A;  2FMP A;  1K5O A;  1PGA A;  2KC1 A;  2Y9T A;  3HX0 A;  3UM9 A;  3QUT A;  1WR6 E;  1C3T A;  5KFG A;  3RI7 C;  4ECS A;  1N5X A;  2HCF A;  2RSU A;  5DDY A;  1GC6 A;  2Z0D B;  4LNN A;  3L17 A;  2PKE A;  2WDT B;  3WKB A;  3OSP A;  5EOZ A;  4MFF A;  4GSW A;  3CST A;  2WXH A;  2Y3A A;  2FPL A;  2V3N A;  1XLQ A;  1Q46 A;  3H8S A;  1ZQL A;  4PYU A;  3NUH B;  3PRP B;  3ZDT A;  4RQ7 A;  4N58 A;  1H38 A;  2F77 X;  5DGA A;  5IIK A;  1WI0 A;  3BQT A;  5DQG A;  5DPT A;  2KN4 A;  1AQ6 A;  4KLQ A;  2KMA A;  1KOT A;  1GJZ A;  3N32 A;  1VJ5 A;  2WWZ A;  1T7P A;  2MJD A;  2P66 A;  1IG6 A;  1C1Y B;  2IGG A;  2MA9 B;  4QJF B;  4HXD A;  1D5X C;  3ZDM C;  3VFK A;  3GIL A;  4PS3 A;  2XGQ A;  3GZN I;  4M8N A;  3WKE A;  5KFT A;  4XQ8 A;  2MJE A;  1FCL A;  3H8J A;  3NVY A;  1L3U A;  3GIJ A;  2HHV A;  4RGM A;  3PZP A;  2EEL A;  1RQL A;  3W5U B;  3OHB A;  4IKG A;  1NJW A;  4RU9 A;  1V1O A;  3ZTD A;  1QOF A;  2WXM A;  3OLM D;  4GXI A;  2HHS A;  3AI5 A;  1VZ7 A;  3RH6 A;  3D32 A;  4L1B A;  5J2I A;  1QSL A;  4ITK A;  2KMC A;  4A8X C;  5JHB A;  1GPX A;  4I29 A;  5ALU A;  2LPE A;  1PVR A;  1JXL A;  3AU4 A;  2WXI A;  4FLH A;  3QU9 A;  2BBC A;  3U8Z A;  5BYR A;  1NI2 A;  5CR0 A;  4MF8 A;  2O6K A;  1ZPS A;  2IZV B;  2LUM A;  2KWU B;  3FC4 A;  4O1N A;  4R63 A;  1CEZ A;  2J52 A;  2GBK A;  2L7R A;  1V49 A;  1XD3 B;  1Q5W B;  5ALQ A;  3QEB Z;  2NYV A;  5IN7 A;  2EAP A;  9ICI A;  1P1A A;  2AHO B;  1DGS A;  1J2M A;  2KMD A;  1A5R A;  9ICT A;  4HKQ A;  1Y88 A;  2LI5 A;  3HJE A;  2V9H A;  2BPS A;  2BCQ A;  4IQV A;  2V9W A;  2BYV E;  2RR9 A;  4YTN B;  2Z7J A;  4KTQ A;  1BT0 A;  1WCL A;  1FFV A;  1TKY A;  2MW5 A;  2N9P C;  4DFJ A;  5ALZ A;  1ZQM A;  4GDK B;  4NPN A;  4PHE A;  3Q6B A;  3M8R A;  2W9C A;  2RLT A;  9ICO A;  4RQM A;  1D8B A;  2LM4 A;  1RXV A;  2OJW A;  3N4M B;  2BQR A;  1YJJ A;  2QCZ A;  4K7U A;  3QX1 A;  5AM3 A;  3Q8B A;  2EAO A;  3RBE A;  4BXO A;  2KZM A;  1V1P A;  1D8Y A;  4TUP A;  1YZ7 A;  8ICC A;  1JWU D;  5DG8 A;  4JLC A;  1F1H A;  4BVU C;  4NNJ B;  4B9S A;  1F52 A;  2WXG A;  4IC9 A;  4F93 B;  3J81 j;  3SD7 A;  4XGA B;  3SAF A;  4MGK E;  4KX3 A;  5ALH A;  4W9F A;  2XI9 A;  3TFS A;  3QU4 A;  4DFM A;  1ZQI A;  4ECZ A;  3QWZ B;  8ICQ A;  1NKE A;  1JRU A;  4DXA B;  3ZNZ B;  1SKS A;  1JN3 A;  5J8Y A;  2GI9 A;  4W9J A;  1JML A;  3AM9 A;  4DL3 A;  1ZJM A;  3M6K A;  4JWN A;  4HJK A;  4X57 B;  2M0N A;  1UD7 A;  2J6U A;  1UZX B;  3AE9 B;  1BPE A;  1NDD A;  2AL3 A;  4M00 A;  4BKS A;  2ACZ B;  3KTQ A;  5IIL A;  9ICK A;  2INN E;  3A9K B;  4DHZ B;  1QCK A;  2YMQ A;  2L8J A;  4FZM A;  3JVZ X;  3UXN A;  3Q8S B;  8ICK A;  4LCD E;  4QWE A;  1X6I A;  4Y2Y A;  4Y2X A;  1EWC A;  5L1I A;  1DOY A;  2BDP A;  3MP9 A;  1SV0 A;  2JYT A;  3ZJU A;  3HIL A;  3P1M A;  3N9Y C;  3EFU A;  3PW5 A;  2WXK A;  3IP4 B;  2KYW A;  3VVW B;  3UPQ A;  2ZIX B;  3E58 A;  1J7C A;  1KTK A;  1X9S A;  5J2H A;  2AGQ A;  2I2Y A;  2B6G A;  2WX0 A;  2ZJ5 A;  1ZE3 D;  3BQ0 A;  1QQ6 A;  2M0A A;  2X38 A;  1QLN A;  1K53 A;  5KFI A;  1EF1 A;  3DBS A;  1UEL A;  2W9B A;  4W9K A;  1XO1 A;  1L0X B;  4MEM A;  4AQ7 A;  3B0A A;  5HNK A;  1PVQ A;  2PPH A;  4YWG G;  3VUX A;  2K8H A;  5KFV A;  4REZ A;  2WAQ C;  1OQR A;  2XO7 A;  2GOW A;  3RPF C;  2W55 A;  4M9G A;  4RQ4 A;  4RT3 A;  3KD3 A;  3IG5 A;  4PHD A;  5DCN A;  1XC9 A;  4ED2 A;  2K6Q A;  1U49 A;  3AL0 B;  1PK1 A;  3TUO A;  2E5S A;  1RM6 C;  1WJ6 A;  4FZL A;  5KFS A;  5C1Z A;  3GIK A;  4IR1 A;  1RPL A;  4EX6 A;  2IMW P;  4GOC A;  5KT5 A;  2KWD A;  3RD2 A;  2HBK A;  5LXH A;  5BPC A;  3QUQ A;  2MBO A;  1T5X D;  1TT5 B;  2HI0 A;  2VZK B;  4FHK A;  5J2A A;  1L6N A;  1JWS D;  5I4D A;  3WAO A;  2H3V A;  4R65 A;  3KHR A;  1S0N A;  3KYC D;  2JSV X;  3GU3 A;  4DLG A;  2Y5B B;  4JPS A;  1ZRM A;  2REX A;  3MAB A;  4ICU A;  3DHH C;  4EZL A;  5JTI A;  3V7J A;  4DS4 A;  5KFD A;  4QZG A;  2DAF A;  4NAW B;  2K60 A;  3L0W B;  3WAN A;  4DK5 A;  7ICF A;  3PHX B;  4OJP A;  1D5M C;  2Z8L A;  2F1J A;  4GC7 A;  1XQQ A;  4PL2 A;  1I42 A;  5IKC M;  1SWW A;  2EQY A;  3NRW A;  5E6O A;  4YSX B;  1FEZ A;  4XUS A;  3TAQ A;  2ZW0 A;  4JV2 A;  3KHL A;  2J4X A;  4OJ6 A;  2G06 A;  1QLB B;  2WXQ A;  1SZH A;  1J19 A;  3I28 A;  9ICP A;  8ICT A;  1SEB D;  3QNM A;  2HHU A;  3AE7 B;  1E7V A;  2G9H D;  4M9J A;  3NUQ A;  2YML A;  9ICC A;  4KLM A;  2C22 A;  4S17 A;  3ZUN A;  1LXD A;  1E9M A;  1NK7 A;  1KKX A;  2K8C A;  3OWE B;  4FBT A;  3ZW3 A;  2IPK D;  2LHE A;  4NWI A;  5AM2 A;  4ZH4 A;  1L5P A;  3L5K A;  1Z00 B;  2KFJ A;  2FMS A;  1ZQC A;  1BXT A;  1T0Y A;  4MF2 A;  3DWG C;  2E8N A;  5HMM A;  1I4Q A;  3L4P A;  9ICW A;  3MDC A;  1GOZ A;  2WDQ B;  4GDK A;  4EOY A;  3ENE A;  3N30 A;  2B21 A;  4KVG B;  1S77 D;  4QZI A;  1OGW A;  2KTQ A;  1C7Y A;  4LNI A;  4NL9 C;  2G3Q B;  1D4B A;  1WGG A;  4I2B A;  5HG2 A;  4NJ8 A;  3PRZ A;  4B6W A;  4BDP A;  1B4F A;  2BYF A;  3APD A;  3MJ5 A;  4BBN C;  2I1K A;  4TQ0 A;  4A90 A;  1VRA B;  4C4V B;  3B2G A;  3AV8 A;  1YX5 B;  4KN4 A;  1ZQX A;  5AI9 A;  4EX7 A;  3MGI A;  2WF5 A;  3A9J A;  5KFZ A;  3W2D A;  4K4G A;  3Q8K A;  4EEY A;  9ICA A;  2BKF A;  2BQU A;  3QZ7 A;  4BFR A;  2G5I B;  9ICN A;  3DV9 A;  2UVW A;  1JQ4 A;  2XY5 A;  1TKG A;  1SKR A;  1NKC A;  3QU7 A;  4F91 B;  3F2C A;  1TYG B;  4AOF A;  1L7P A;  1I4H A;  5KFM A;  4IM0 A;  4JE3 B;  3GS2 A;  1TVA A;  1SB3 C;  2QB0 B;  4C8K A;  4OJ5 A;  2KSO A;  5DB7 A;  3TQ1 A;  2I9G A;  1WFY A;  5AEK B;  4UQG A;  1XLN A;  5ALD A;  3HKZ C;  2LGD A;  3RRH A;  1X9X A;  2ZJA A;  1UBI A;  2LRW A;  1DOI A;  2XK5 A;  5D2M B;  5ALG A;  5KT7 A;  3KH0 A;  2WXO A;  3MJW A;  3EEC A;  4LLG M;  3H8M A;  2RHF A;  5IIO A;  3SHQ A;  5HFY A;  2C7M B;  2KN7 A;  3T5H A;  4I2H A;  1J97 A;  4Q8E A;  1L3V A;  2GBM A;  2WX1 A;  4B6J A;  2CJO A;  2DF4 B;  2WB1 C;  2ZEQ A;  3C19 A;  1L0V B;  4RFB A;  5EE9 A;  3Q8M A;  2XCA A;  3MFG A;  3VR8 B;  2B0C A;  2KKP A;  1N60 A;  2CU1 A;  1C4A A;  2RGF A;  2XN9 C;  4GDL B;  2N1W A;  4NJ6 A;  4ANW A;  4IOI E;  5MPO A;  3UMG A;  1ZQV A;  5ALL A;  4Q44 A;  2NMQ A;  3F53 A;  4PZO A;  3JPO A;  2BQ3 A;  1T0Q C;  4UB6 U;  2E8P A;  4QIW C;  2BT6 A;  4RM8 A;  3BII D;  4HRS A;  5J0T A;  1AW7 A;  4TV3 A;  4CHK A;  2AGO A;  2LYH A;  1PQS A;  4DDG D;  4BX9 C;  3EW9 A;  5AKJ A;  4YXJ A;  5B66 U;  2K6D B;  5FR3 A;  3RB3 A;  3BJY A;  4HCP B;  4KLJ A;  2IO0 B;  2IHN A;  4F50 A;  2MQJ A;  3PW4 A;  4B9M A;  4UBB A;  2K0P A;  2D3G A;  3OJU A;  2I5H A;  3QHT A;  4GMV A;  2VKQ A;  2KOX A;  3A4S C;  2V3P A;  5AK3 A;  4MFC A;  4RGN A;  3QXG A;  2VA2 A;  2KO3 A;  2VJ5 A;  1WSP A;  3AEF B;  2F44 A;  1TE2 A;  1CQV A;  2RRD A;  4PGQ A;  1YOV B;  2KKV A;  5GTI U;  1ZQT A;  4QWD A;  2L1A A;  5GXG B;  1F44 A;  1QQ7 A;  2D6F C;  2NBW B;  2ICI A;  4I27 A;  1RRB A;  2PFN A;  3BY4 B;  4KZ0 A;  1KFY B;  1E7U A;  1MA7 A;  4QWC A;  4P7I A;  1E8Z A;  4XDD A;  2W11 A;  5DPR A;  5B5E U;  5KAI U;  1NEN B;  2MBB B;  4B9L A;  4FJV B;  1KQQ A;  1K52 A;  2BPG A;  1KN5 A;  2HOQ A;  3ZD8 A;  3MC0 B;  1Z4N A;  5C23 A;  1NZB A;  2YY6 A;  3PMN A;  5BYQ A;  4J9S A;  4P2H A;  5J0X A;  3BQ1 A;  5KHQ A;  4R64 A;  3GE8 C;  4DF8 A;  3Q2A C;  4J6I A;  5CHF A;  2HHW A;  2DWQ A;  5AK4 A;  4A8E A;  4DL5 A;  2PFQ A;  8ICV A;  2KAN A;  3AEE B;  4TQ1 A;  1F0Z A;  5HP4 A;  4QZE A;  4Q45 A;  1BPX A;  2L0T A;  4P4O A;  4BZA A;  3WK9 A;  1QTM A;  1KW4 A;  4P0P B;  9ICE A;  1WIA A;  4I6N B;  4RGT A;  3RJJ A;  2JU6 X;  2H3Q A;  1Y8R C;  3BQ2 A;  2QAR A;  3BS5 B;  5KG5 A;  1TAQ A;  1FIQ A;  3RBD A;  2MSN A;  4OZA A;  9ICH A;  8ICG A;  3DHI C;  3BZK A;  4ICA A;  4F4Y A;  3HVZ A;  4G9B A;  2KVZ A;  1SSN A;  1NOM A;  1WJU A;  2QDF A;  3I3T B;  4N59 A;  4F5N A;  3GFK B;  1S10 A;  5ALY A;  2ZVN A;  3AU5 A;  5IO9 A;  1EXN A;  2JGA A;  1E8Y A;  3J9C A;  4BKT A;  4MH0 E;  2MUT A;  2RDI A;  4JUZ A;  1TK8 A;  2LFI A;  4J9Q A;  1RXW A;  3ETR A;  4XWW A;  2G5H B;  4DCC A;  4ARI A;  2KDI A;  2OXO A;  4M04 A;  3WAP A;  1WM2 A;  1SF0 A;  2SAK A;  5D3I B;  5FP0 A;  1FNW A;  2K39 A;  2KJH B;  4E3C A;  3O13 A;  3IDW A;  4C8L A;  2LUE A;  3ZJT A;  2KMM A;  1C79 A;  3E0F A;  2FNJ B;  3ISD A;  2RQ5 A;  3NVZ A;  4YD2 A;  4KLT A;  2RMM A;  2QHO A;  2R8J A;  4M2Y A;  4C00 A;  2MRL A;  2MP2 A;  5J0R A;  2ASD A;  5EWE A;  2W9M A;  3PSE B;  4O5E A;  4FA6 A;  2IO2 B;  2KE7 A;  1NK5 A;  3GZF A;  3BVM A;  1U47 A;  5KTQ A;  2DYO A;  3SFD B;  3R66 C;  3B0X A;  4DOA A;  2JEJ A;  1AYF A;  3RH5 A;  1PGX A;  4DOC A;  4CDG A;  3QU5 A;  4EYI B;  2ISO A;  4M0W A;  4X5V A;  4RGO S;  2RDG A;  1UCV A;  4KLI A;  2LD9 A;  3NJT A;  2PLP A;  5AKK A;  3PZ8 A;  4EFO A;  4B9N A;  1GB1 A;  1IYF A;  1X9W A;  1URJ A;  4LJX A;  4WWO A;  1TV9 A;  3R7Q A;  5C3J B;  1H8C A;  1Z4O A;  1UWM A;  2WXN A;  3VUW A;  2JRI B;  3C0R B;  4EZJ A;  3FKY A;  2KHV A;  4KLL A;  4RNM A;  2ZG6 A;  3S6J A;  5HR6 A;  5III A;  1ROE A;  3PML A;  3MR6 A;  2LVO A;  4IRD A;  1ZUD 2;  2DX5 B;  2DUY A;  4QZ9 A;  3TIX A;  4UBC A;  3DBL I;  5J2C A;  1KSP A;  3AUL A;  1UT8 A;  3E9S A;  1T3Q A;  4DLE A;  1QT9 A;  3ICX A;  2J53 A;  4XZ4 A;  2R8H A;  1TFR A;  4UAZ A;  2HVI A;  4LDT B;  3V6J A;  8ICI A;  4EEN A;  3T5L A;  5AM0 A;  3RJH A;  4OW0 A;  2N4F A;  3ZDB A;  1PUZ A;  3H7I A;  5AM1 A;  2WF7 A;  3HM6 X;  1IXR A;  1MFW A;  1OEY A;  4BXO B;  1V1P B;  2N9E B;  2BYE A;  1Q8K A;  3VH3 B;  3RUL A;  2BB5 A;  3EGR A;  3TAP A;  2IHM A;  1JX4 A;  2HHX A;  5AI4 A;  2WHE A;  5D6J B;  2I1J A;  4C0Z A;  2KLC A;  4RQN A;  2ZTC A;  4OJL A;  2IYD B;  2D2Q A;  3UMC A;  2KZR A;  5KFH A;  4XX5 A;  3MGH A;  3FAH A;  5ALI A;  3IAM 1;  1M6Y A;  2B76 B;  4DEZ A;  3WK8 A;  2FUH B;  4IWQ A;  4BJQ A;  2KWC A;  4BKG A;  3JYU A;  1MN8 A;  1YQB A;  2BDU A;  2NRX A;  3SU8 X;  3IHP C;  5AIC A;  4F5Q A;  2L00 B;  3CWI A;  3RJE A;  3NVW A;  1NZP A;  3KKA C;  2D3D A;  3DBR B;  4FO6 A;  2C5L C;  4KN7 A;  4ZRK A;  5C0Y A;  3TAR A;  3M62 B;  4M02 A;  3PX4 A;  1HTO A;  3DHG C;  1NEK B;  1XU4 A;  3OGU A;  2GLE A;  3NGD A;  4RNN A;  3MDA A;  1Q10 A;  3LXF A;  5LNK 1;  2TSS A;  1S9F A;  1MG4 A;  3KHH A;  4E0D A;  4ELV A;  4MEY A;  4ACO A;  3OHA A;  5KT6 A;  1SXD A;  3THV A;  1GB4 A;  4K7W A;  1SL1 A;  3ONS A;  2ON8 A;  3HHM A;  1SZP A;  9ICS A;  1TY2 A;  4CYE A;  1IPG A;  1J2N A;  1P0R A;  1JWM D;  2LYA A;  5D49 A;  4MEL A;  4WJ3 B;  4TQS A;  1NJY A;  5KT2 A;  1WGD A;  1N63 A;  1E8W A;  2LYB A;  3ECI A;  2W9B B;  1TS2 A;  1E10 A;  5BMH A;  3NS8 A;  4YMO A;  4MJS A;  2N9X A;  2LGI A;  1ZQU A;  1XXG A;  4FS1 A;  1OQY A;  1S8O A;  2Z59 B;  2H3F A;  4UAV A;  3PW0 A;  3VRA B;  3GV8 B;  4MH8 A;  4HEA 1;  4NLZ A;  2BB6 A;  5KL1 B;  4W9H A;  1EU4 A;  5H92 C;  3U52 E;  4YXD B;  1FCC C;  4EBD A;  1V9J A;  1NI3 A;  2IND C;  3K9O B;  4EE2 A;  4NLK A;  2CJN A;  1C9F A;  1MQ2 A;  4QZ8 A;  4DXG A;  4F5O A;  3MC8 A;  5J0Q A;  4Q8F A;  4EZ6 A;  1WE7 A;  4UAS A;  1WZ0 A;  1L0Y B;  1JI7 A;  1PK1 B;  4C8N A;  4YR3 A;  2YEP F;  1SGG A;  3VTW A;  3N7P D;  3IN5 A;  4L2Y A;  2GBR A;  2V4I B;  1ZJN A;  5E79 U;  1JWB D;  3KYD D;  2FLL A;  1T6B X;  3FIL A;  5D4B A;  4J03 A;  1YD8 U;  2KG5 A;  2MA1 A;  4Y2V A;  2FE9 A;  4DL7 A;  1B9R A;  1R4N I;  1WM3 A;  2ESE A;  2OJR A;  3RT3 B;  2WS3 B;  1ZXI A;  3M63 B;  1WXA A;  4ARC A;  7ICK A;  2DLB A;  2ASJ A;  4W9L A;  1LVH A;  1LB2 B;  3MC1 A;  1D6E C;  2KVR A;  1OXJ A;  4NLC A;  3ZQ4 A;  9ICJ A;  4HWI B;  4B0E A;  3TFR A;  5AI5 A;  5AI0 A;  4R8U A;  1V81 A;  2D8C A;  1X6J A;  4J9R A;  2JY6 A;  4BOS C;  4DBG A;  2YB4 A;  5L95 C;  2R2O A;  1IP9 A;  2LVQ A;  2QIL A;  3HWT A;  1JXE A;  4Y2U A;  1ZP0 B;  2G07 A;  2YN4 A;  2JUO A;  2HOI A;  5ALP A;  5DLF A;  4MGZ E;  2ZJ8 A;  3S2A A;  3H9D A;  1MJD A;  3B1L X;  4UAT A;  4E71 A;  1FPY A;  2M9N A;  4FAD A;  4RT2 A;  3QC8 B;  4C56 C;  4Y2T A;  3RFZ B;  5KT4 A;  2GBJ A;  8ICA A;  1WH3 A;  3HVD A;  5KFU A;  4AYB F;  2K5P A;  4RPY A;  5JZE B;  1UWX A;  4B0M A;  3L13 A;  3PTF C;  3PR4 A;  3UI3 A;  2FCQ A;  2VAN A;  2KXJ A;  2P6R A;  4NQK E;  3PRE A;  2P35 A;  3IRU A;  1XCQ L;  2Z0E B;  2K8C B;  2D5G A;  1BNP A;  3PV1 A;  1J7A A;  2XID A;  4EBE A;  1ZD5 A;  5CB1 A;  4IQW A;  1AAR A;  2QIE B;  1TK0 A;  1L8O A;  4KSK C;  2N1V A;  3RFA A;  5KHO A;  4DHJ B;  3MTN B;  4K7S A;  4DSL A;  3MBY A;  8ICY A;  1NYR A;  1NKB A;  2R18 A;  1ZXH A;  1NNL A;  3ZJV A;  2H89 B;  1GAQ B;  3H40 A;  3AE2 B;  3IAS 1;  3JSV A;  4WAF A;  4UAW A;  2WDV B;  1YMH E;  5H8Y E;  2K4I A;  3PR5 B;  1SKW A;  3IBE A;  5AKH A;  3RNA C;  3F5A A;  4DQQ A;  2O6V A;  4XDC A;  4CF4 A;  2KC2 A;  1L2N A;  3P4S B;  4KLU A;  4EEK A;  1SE3 A;  3V6K A;  2XNA C;  4TMA B;  4UB2 A;  2XIC A;  3X23 A;  9ICX A;  4O3S A;  2FJ6 A;  1XNS A;  2LMR A;  4J3O D;  2K4P A;  8ICZ A;  3GII A;  3A9J B;  4UB1 A;  4CQN A;  2NRT A;  7ICP A;  3DCG A;  4MM3 A;  1VJK A;  2W43 A;  1TY0 A;  5KFN A;  4PYZ A;  8ICO A;  2AX5 A;  4I6P A;  4M6W A;  5D46 A;  2DNF A;  3H6N A;  4OHJ A;  4GIV A;  3UIP B;  1KFS A;  2MH7 A;  5IAA C;  5KG4 A;  1YJI A;  3RNF C;  4C8O A;  2XC9 A;  1CI4 A;  1JRP A;  3SAH A;  3C2L A;  3DPD A;  2PIA A;  2DZJ A;  4O9M A;  3PRM B;  3K1Z A;  3AXC A;  2L32 A;  3H7P A;  2KSO B;  2Y1J A;  2PVO D;  1NBF C;  2MSE D;  3WK4 A;  2BHN A;  2E1F A;  5J2J A;  4L23 A;  1MG8 A;  2XK5 B;  3B0Y A;  2A5U A;  3DVN U;  4OJO A;  1ZQF A;  2NS5 A;  1M94 A;  4QW8 A;  2BZF A;  2ZUB A;  7ICT A;  2FIF A;  2JF5 A;  5GTH U;  3HP6 A;  3P63 A;  3ZDC A;  5IA7 A;  3KUC B;  2GWS A;  3NOB A;  1SBB B;  2K89 A;  1UA0 A;  2L83 A;  1LKY B;  3BS7 A;  1UHU A;  1KDH A;  3LB8 C;  4II2 B;  4A3O A;  3SMV A;  4F8C B;  4HPL B;  9ICL A;  4RNA A;  2ZIV A;  9ICM A;  5JH5 C;  3KQ4 A;  5D3D A;  1DOQ A;  3MC9 A;  3DVN V;  1RYS A;  2NCN A;  2Y0S C;  4HRO A;  3PO5 A;  3DVG Y;  1V9P A;  2HVH A;  2MX2 A;  7ICO A;  2MRP A;  3C2K A;  3C1Y A;  4ED1 A;  1SE4 A;  5JXV A;  4PJ0 U;  3Q8L A;  1SL2 A;  1WF9 A;  1RWS A;  2RDH A;  3Q8A A;  3QIJ A;  3PZD A;  3Q8F A;  3R8B A;  1V2Y A;  5JU5 A;  3V60 A;  4MDK E;  5AKX A;  2LHD A;  2L52 A;  4IG7 B;  2J0K A;  3WKC A;  3IXS A;  3RJI A;  1TIF A;  2FAZ A;  4DOB A;  4I2A A;  1IGD A;  1TK5 A;  2I38 A;  2IDY A;  3QAR A;  2W7O A;  2LM1 A;  4O3N A;  4F4W A;  5DBB A;  3CF6 E;  2NRV A;  3QX7 A;  2EZX A;  2G4D B;  4CF3 A;  2DPI A;  4LJP B;  2K4H A;  2OHF A;  3MFI A;  4CCH A;  2CS4 A;  4F4K A;  1OQQ A;  4ECT A;  4ECY A;  2G0A A;  2M1M A;  4PGX A;  1K1S A;  1TKE A;  2XY6 A;  1VDV A;  2YVC A;  3DBH I;  3T9L A;  1S0V A;  4EEL A;  2UVV A;  4F92 B;  2LRU A;  2WYQ A;  1R4M I;  1Z5S B;  3AEC B;  1KJT A;  2K8A A;  4ZRQ A;  3KWL A;  2EAM A;  4LNO A;  3RTV A;  2HOF A;  4NY0 A;  1G6J A;  3PV8 A;  1ET9 A;  4TUU A;  3V05 A;  2E1E A;  4CE6 A;  2LXC A;  2RDJ A;  2K8B A;  5AUK A;  3AH7 A;  2ZXI A;  7ICG A;  2MBH A;  5BMI A;  3WK5 A;  4FJZ A;  1X9M A;  4F2S A;  2A19 A;  4HK2 A;  4JX1 C;  4GXK A;  1CJE A;  5ALW A;  2C2D A;  4AJY B;  4O3P A;  4EBC A;  5KG1 A;  5HKH A;  4P4P A;  3H0L B;  1I4G A;  1X1M A;  2V4L A;  2HHT A;  4J9N A;  4RQ5 A;  5CA7 A;  3NRZ A;  4YMN A;  3QYP A;  1YQ3 B;  5AM5 A;  2JEI A;  2QAR B;  5KFY A;  1WWU A;  1P9D U;  4ECR A;  3PSP A;  1H4R A;  2UU7 A;  2IGD A;  1L7N A;  4KV2 A;  1LFD A;  2HE7 A;  2F2A B;  1JWA D;  2I6X A;  1PZN A;  3U4E G;  2WAQ F;  4NL9 A;  5J0O A;  2ISP A;  5KFJ A;  2OEH A;  3C29 A;  4IC7 B;  2NTT A;  5AIA A;  1OUQ A;  4W9E A;  2D10 A;  2FLP A;  3AEB B;  1D3Z A;  1IIP A;  1UF0 A;  5J2F A;  1UNS A;  2KFK A;  4HKZ E;  3D2N A;  1QSS A;  2MUT B;  1ZOL A;  5IIN A;  3OG5 A;  1BUI C;  3CW2 C;  2WQY B;  1QH9 A;  2LGX A;  4G3X B;  2UVR A;  2O6V D;  5G55 A;  4KMU A;  2JEG A;  2IOH A;  5ALM A;  1KLU D;  4ED6 A;  1L7O A;  2F8L A;  1ZDX A;  5AKY A;  2FPK A;  3SV3 A;  4I2G A;  2FCM A;  5AI6 A;  4F2R A;  2BWF A;  2OM6 A;  1WGR A;  4PHA A;  2BTE A;  2HMX A;  2OCE A;  1IM4 A;  4ZHP A;  3SI8 A;  3DOW A;  2JXT A;  2F1H A;  4AJW A;  3L16 A;  3A0H U;  4NM1 A;  2GRI A;  5AIB A;  1C76 A;  1B0X A;  2MP2 B;  2ZNV B;  1D9F A;  4FJY A;  5J0W A;  2BF8 B;  2KTR A;  4E74 A;  2J6T A;  5ALR A;  3KBB A;  3GZN B;  4OCZ A;  4XWT A;  4DXF A;  2HJ8 A;  1QIL A;  3IG3 A;  4UDU C;  3L3F X;  1T3N A;  2PJH A;  3A1Q A;  3ZO5 B;  2KJ9 A;  1HZ5 A;  2L5Y A;  3PW7 A;  3FYH A;  5F9L A;  1C4C A;  1SGH A;  1TS3 A;  4M0W B;  1UGJ A;  3LYS A;  3W1S C;  3H8W A;  3CSF A;  3KHG A;  1SXT A;  2WHI A;  3N7R C;  5EWG A;  2WP9 B;  1YN4 A;  1JIH A;  5CWR A;  4WJN A;  1D5Z C;  2DZK A;  2J7Q B;  2XY7 A;  4UB4 A;  2C28 A;  3LVV A;  8ICH A;  2YLM A;  3TEZ A;  3QUC A;  3TAC B;  2QSD A;  2W7P A;  5DQH A;  3ZDA A;  2C2E A;  1XO0 A;  2AQ4 A;  3ZDE A;  5LLI A;  4YT0 B;  2KIW A;  4TSS A;  2FUG 1;  1BVS A;  5IIJ A;  3EPG A;  3SR6 A;  2DBY A;  1F2R C;  3HK0 A;  2HJ1 A;  2AWT A;  2DQN B;  2HBM A;  1YX6 B;  3TL5 A;  3SEI A;  1LKY A;  5CRX A;  3EPI A;  2NBU A;  3HIZ A;  4MT5 A;  2XCP A;  2OH2 A;  8ICS A;  1CUK A;  1KLG D;  2IBI B;  3N7S C;  1WX7 A;  5EE1 A;  1WGY A;  2KV2 A;  4O5K A;  1XCT L;  2YEP B;  2BCR A;  1O03 A;  2YX8 A;  3CNH A;  4UB3 A;  2ZUC A;  3LDA A;  3H8H A;  2MAX A;  1NK9 A;  3KWV A;  4RMA A;  2PVG C;  3U7Z A;  4LJO B;  4C4R A;  4OVV A;  1ZRN A;  4YR0 A;  5J0S A;  1P3Q U;  2Q0Z X;  2NPT A;  4WWP A;  2C9W B;  1ZQO A;  4IRK A;  4F7Z A;  1GO3 F;  1TJE A;  4LZG A;  2Y5C A;  4P6V F;  2JWU A;  1ZQZ A;  1MVK A;  2ZJD A;  1FD6 A;  1GNU A;  2BGW A;  4KKI A;  3WKA A;  2L05 A;  3BZD B;  1HTQ A;  2KLG A;  3Q8P B;  4BAX A;  5C5J A;  1UPH A;  7ICH A;  3OJ3 A;  1FO4 A;  4Z6F A;  2ZVO A;  2KFZ A;  2DFL A;  2M19 A;  2MWS B;  2NR2 A;  4B9V A;  2AJQ A;  4RM9 A;  4N6E B;  3SAG A;  3M8S A;  2N7E A;  1WJ4 A;  1TAU A;  5CHG A;  1LO5 D;  3R2I A;  4CO7 A;  3AED B;  3Q3N C;  2R8G A;  1N48 A;  3NTU A;  8ICB A;  5AKG A;  3U7D A;  3BK2 A;  5JHA A;  3AEV A;  4JB3 A;  3ZNG C;  5ALO A;  4ECQ A;  4CGZ A;  4PS7 A;  3APF A;  3D2Q A;  1V97 A;  4LTU A;  3HKZ F;  1V38 A;  4YVZ A;  3OSN A;  5KFL A;  4Q43 A;  2BWE S;  3APC A;  3TI0 A;  5E6N A;  2KQ7 A;  4JIO U;  1ZQW A;  4JWS C;  2XGP A;  3T5K A;  3MGV A;  4ZYS A;  4UAR A;  4RPZ A;  2KHQ A;  1KRP A;  4JL9 A;  2KIC A;  4JWM A;  1OW5 A;  1WGK A;  4ANX A;  4MJS B;  5EE3 A;  5E6P A;  1I4R A;  4ZYN A;  8ICF A;  3W1Y A;  1KM7 A;  3RH4 A;  1A77 A;  1MI0 A;  3R2T A;  3X0W A;  2AU0 A;  1Z1V A;  2WF6 A;  8ICE A;  2UYZ B;  5K4L A;  1T94 A;  3JPN A;  5DG7 A;  4M01 A;  5CTR C;  3TEW A;  4YFK A;  3BYT B;  5DB6 A;  2M8S A;  2AQ0 A;  3D6J A;  5BMG A;  2YTU A;  3AU6 A;  3RB6 A;  2RD0 A;  2NBV B;  1FEH A;  4A9A A;  3LJ3 A;  2INC C;  3QK0 A;  3TSS A;  3GP7 A;  2K4E A;  3AMZ A;  4NLG A;  3VDZ A;  4RQ3 A;  3N1Y C;  3D2S A;  2O2V A;  2LWP A;  3A4R A;  1IV8 A;  1SE9 A;  1ZQH A;  4UAY A;  3V3X A;  3FIL B;  3ISB A;  2YQE A;  5G5G A;  3AEG B;  4WJO A;  5ALJ A;  3NZ3 A;  1VLB A;  4K3C A;  4YCX A;  5KFC A;  1ZQG A;  3EFC A;  3QAQ A;  2NRZ A;  4M9H A;  2KJ6 A;  4FN2 A;  8ICX A;  1EU3 A;  3ZIM A;  2AYO B;  3URY A;  4J9L A;  1ESF A;  4P16 A;  3VAW A;  3CMM B;  1NJZ A;  5J17 A;  1K50 A;  2BPC A;  4EZ9 A;  4R8U B;  3R3M A;  4PZN A;  3Q8Q B;  1PUT A;  2ZIW B;  2ODG A;  2MJ3 A;  3VRB B;  2PMZ C;  3WK6 A;  3IM1 A;  4BUG A;  2KJR A;  5AKZ A;  3C5F A;  4TUQ A;  1DRG A;  1V5T A;  2ZZP B;  5DBC A;  2V0G A;  1Q1O A;  4O5C A;  2A1A A;  1WMH A;  4FZN A;  1F2R I;  3AE6 B;  3IVF A;  5AZF A;  3ZRC A;  1WRI A;  3M95 A;  3QUB A;  5LXI B;  4HDO A;  4P0Q A;  2W04 A;  3OTQ A;  4O3Q A;  4KIT B;  3RR7 A;  3V7K A;  1YZ6 A;  1UQV A;  2GH1 A;  3I63 C;  4KLH A;  3RUI B;  2YMM A;  4OZB A;  8ICL A;  1HJP A;  4KLG A;  4EUT A;  1N62 A;  1HZ6 A;  4MSQ B;  1COK A;  2DHZ A;  1RYU A;  4PK1 A;  2MLB A;  2W03 A;  4CF5 A;  3K75 D;  4UW9 A;  4Y2R A;  1KBU A;  1FNU A;  2XEW A;  3EYZ A;  4YL8 A;  4B9U A;  4DSJ A;  3PGE A;  4WJP A;  2KWV B;  2R2Q A;  1V85 A;  2QJL A;  1JCK B;  2BKR B;  4EYH B;  3BIN A;  1SWV A;  3ZKJ C;  1V80 A;  4I2J A;  3NHE B;  3JSV B;  5J29 A;  1ET6 A;  4KZC A;  1J0G A;  2A1J A;  2KDF B;  3SQI A;  3I57 A;  4QZA A;  1HEZ E;  1HXY D;  1N56 A;  4JK1 A;  4DSK A;  4RH6 A;  3G6Y A;  2O6V B;  2BS2 B;  1LQB A;  4QWB A;  1WZ3 A;  2FCN A;  2FE8 A;  2UWQ A;  1FFU A;  2WF8 A;  5G2N A;  2V4Q A;  2CR5 A;  4KGT A;  5IOI A;  1JMS A;  2JR5 A;  2LKY A;  1X40 A;  5AKE A;  1VZ6 A;  1K51 A;  4QZC A;  3PS6 A;  4RQ2 A;  1CZP A;  1L4D B;  3SEN A;  3KKA A;  3H4D A;  1NK0 A;  2AL6 A;  4MM3 B;  4CNQ A;  2PE9 A;  4K4I A;  4M6W B;  3MR5 A;  4Y2J A;  5KG0 A;  1PK3 A;  4Y2S A;  5J0P A;  3AE3 B;  3DDC B;  2C7N B;  4YN4 A;  4RQ8 A;  5BOL A;  3PVL A;  2KQS A;  3H7P B;  5KFO A;  2ZIU A;  2KX0 A;  4NLB A;  4DSF A;  3V6C B;  2KZ3 A;  5KAF U;  5L1M A;  8ICU A;  3GDX A;  4HJG E;  4YSY B;  5AHX A;  4DHZ E;  4RUC A;  1S76 D;  4O0I A;  4ZHO A;  3P4P B;  4GFJ A;  2ZTE A;  3Q8R B;  2ATL A;  3BVZ A;  2EDU A;  3UQA A;  2H88 B;  2KVC A;  1CRX A;  1WCN A;  3PX0 A;  3RMK C;  4YP3 A;  4DL2 A;  3QE9 Y;  2DZM A;  3FDS A;  5HHI A;  4JQW C;  1UH6 A;  2RPQ A;  5L1K A;  2WDR B;  4Y2Q A;  2KKC A;  4RZR A;  2KIV A;  5CEH A;  3W5V B;  2EZY A;  2CN1 A;  5HR7 A;  4TQR A;  2QMT A;  2VZK D;  3WU2 U;  4W9D A;  2BCU A;  2W8L A;  4MHV A;  4WJQ A;  1ZQQ A;  2ZIV B;  2HDE A;  1WX8 A;  1C20 A;  3GB1 A;  2VA8 A;  5C2T B;  4Y2P A;  4CRX A;  4MGY E;  1SJE D;  4BGD A;  1Q0W B;  1WUD A;  3Q3M C;  3RAX A;  2MHJ A;  4WAA A;  4WQM A;  3TAD C;  1I7H A;  2EMT A;  1KLN A;  3I9V 1;  4KX5 A;  4OVU A;  1M4V A;  4AWJ A;  1RFA A;  4R66 A;  4O3O A;  5G5H A;  3JW0 X;  2IJ0 A;  3ORY A;  4P1C C;  4PPX A;  3QA8 A;  4IQT A;  3Q3F A;  4MAC A;  1ISN A;  2DYM A;  3LWM A;  2JRZ A;  3H0M B;  1GUA B;  2AQ3 B;  2D3A A;  3N28 A;  1ZQA A;  1T4G A;  2ZXH A;  5KFF A;  4QZB A;  4I28 A;  2KX3 A;  3BWU D;  1BNO A;  1HE8 A;  2WFA A;  4OD0 A;  4JV0 A;  5IP4 D;  1B43 A;  2AQ2 B;  2EMS A;  2KFN A;  2AGP A;  2JZ3 B;  3AE5 B;  4YR2 A;  3UGB B;  3N1X C;  3RZW C;  2GBN A;  4NAM A;  4Z6C A;  2CRX A;  1FNV A;  3ALB A;  2PMV A;  1BPB A;  4KDI C;  2D11 A;  5BOM A;  2D07 B;  1EO6 A;  5TSS A;  4H2A A;  4YSZ B;  4NXZ A;  5JUM A;  2BPF A;  2WXP A;  1QKZ A;  5EE0 A;  3A33 B;  4DWF A;  5DGB A;  3B9J A;  7ICQ A;  3GQC A;  3LVW A;  3QZ8 A;  3LYY A;  2PI5 A;  3B08 A;  3V61 A;  1B1Z A;  4AP4 C;  4HPM B;  3A0B U;  4ZRJ A;  3SYZ A;  2LGS A;  3LWL A;  4A6Q A;  3ZGZ A;  4C7Y A;  2HBJ A;  4M47 A;  4KIK B;  4XC2 A;  4B9T A;  3OJS A;  2K8B B;  2J6S A;  1O08 A;  4PS8 A;  2ZIW A;  3ED5 A;  4DQS A;  9ICB A;  4F5P A;  1TS5 A;  3MFH A;  3KW5 B;  5DG9 A;  1WG8 A;  1CK1 A;  1E6E B;  4RQ0 A;  2V4R A;  1JAL A;  1WY8 A;  9ICV A;  3PST A;  4ZRI A;  2F8K A;  4ANU A;  4HLE A;  1WWV A;  1BPZ A;  3ZDD A;  4U6P A;  2X8X X;  3KUZ A;  3VUY A;  1WYW B;  2LXA A;  1IBX A;  3U26 A;  1Z1B A;  4GB9 A;  3NAS A;  4XE0 A;  4O3R A;  2J0M A;  1ZW7 A;  3AE4 B;  3L54 A;  2QKQ A;  4YG2 A;  5KL8 B;  4ZDV A;  2FBW B;  3C28 A;  4MGI E;  9ICF A;  2L3Z A;  4GXB A;  4KKJ A;  5AK6 A;  3DQV A;  3H1U A;  7ICL A;  3P2B A;  2C2R A;  3ZXR A;  2FMQ A;  2ZUD A;  4M0A A;  2DEN B;  2QB1 A;  3PT2 B;  3ZXV A;  1C77 A;  3G6V A;  2KFK B;  4ANV A;  2WLB A;  5H2F U;  3RB0 A;  2D3C A;  3DEE A;  2RDB C;  1ZGU B;  1YNT E;  1LV5 A;  3QQ8 B;  3EWA A;  4RNO A;  5FKA C;  2EAN A;  3C21 A;  3RAQ A;  1E5W A;  1KH0 A;  1C78 A;  1TTN A;  3L08 A;  2F3N A;  3BQ7 A;  1LGR A;  1UUP A;  2MBE A;  1D8L A;  3WCQ A;  1ZYQ A;  1A76 A;  2BW2 A;  2QC8 A;  2M56 B;  3PHW B;  5F9N A;  4URK A;  3BVG A;  3UF8 A;  3ML8 A;  4ED8 A;  1WX9 A;  1A6S A;  3ZNH B;  5J2R A;  4ECW A;  2KTR B;  1J8C A;  1XWL A;  2HBL A;  2HW3 A;  1QQR A;  1ZOY B;  3M9N B;  4J9P A;  4ECV A;  2Y9U A;  2GO7 A;  4UB5 A;  3M3J A;  3A1Q B;  3H4B A;  5KFA A;  5J0U A;  1IGC A;  1Z19 A;  2WU2 B;  3Q69 A;  5J0Y A;  4F3O A;  1U45 A;  3WKD A;  2JHD A;  1FRD A;  1RYR A;  4AP9 A;  4FXC A;  2ZTD A;  2ES6 A;  3ALR A;  1DK2 A;  1K8R B;  3F2D A;  3E2E A;  2L0F A;  4F5R A;  4KLF A;  2YB1 A;  1ED1 A;  2JEF A;  2ALZ A;  4GC6 A;  4FE3 A;  1FMA D;  3RYT A;  3P42 A;  5DB9 A;  7ICI A;  1QOG A;  3VR9 B;  4ZRP A;  4KMO B;  1MPE A;  4NJ7 A;  1NYQ A;  4GN1 A;  1QOA A;  4XRH A;  2N9K A;  4GXJ A;  4GGQ A;  2PI4 A;  5L83 A;  2PFP A;  2XVT A;  3HPO A;  3Q8E A;  4USA A;  4YXM A;  2JZP A;  3PY8 A;  1ZQD A;  5J8Y C;  1L6V A;  3PLV A;  2ZW1 A;  1N61 A;  4QZH A;  3DBL B;  2IO3 B;  1EF5 A;  1P7D A;  1NVI D;  2MU2 A;  3PZ7 A;  5HI1 A;  1WGH A;  2BS3 B;  2WF9 A;  2G45 B;  4G3I A;  2G09 A;  2NPT B;  3PVX A;  3RNC C;  2DGZ A;  5KFW A;  5CHW A;  2K1F A;  3R9K A;  3Q3O C;  3TEX A;  5KFX A;  4PH5 A;  3MR3 A;  3ML9 A;  4QAY A;  1S1Q B;  4S0R A;  3F5E A;  2NO5 A;  5KFE A;  2QEJ C;  4OVZ A;  3DVG X;  3ZLZ A;  1SV4 A;  2W8K A;  4DWI A;  1ENF A;  1YIW A;  4NZL B;  5TIS U;  5AUI A;  1SV0 C;  4Z6D A;  4US8 A;  5ALS A;  1S97 A;  7ICM A;  4US9 A;  5KG6 A;  4PGY A;  2R8I A;  4N9F 4;  3T79 A;  2VJ4 A;  4RUA A;  4NLN A;  2VRR B;  2KP7 A;  3AQF A;  2IBK A;  1SIJ A;  1ZD3 A;  4KLS A;  7ICR A;  1CMX B;  1Z2M A;  3DWM A;  4I2I A;  4F8R A;  1DK3 A;  2I1Q A;  3QJZ A;  3V72 A;  1PFD A;  2HHQ A;  5L9X A;  2WXR A;  1P7F A;  1ZET A;  2CHX A;  3IG8 A;  4ICV A;  2AH5 A;  2GB1 A;  4IM3 A;  4HDQ A;  2G08 A;  3SDL C;  3BYY B;  2W3S A;  1VR9 A;  3RB4 A;  1ZQE A;  1MSW D;  3TCA A;  3SFE B;  3Q14 C;  2DYB A;  5AKL A;  1RQN A;  4WWM A;  1ZQP A;  2B3A A;  1VZ8 A;  2JVC A;  2LAS A;  4NJC A;  3QU2 A;  4RF1 A;  2LI6 A;  4J9O A;  1ZQY A;  2DL0 A;  5J2K A;  1L5U A;  2HTH A;  2WXL A;  3UMB A;  9ICG A;  1MHX A;  4KIK A;  1F77 A;  3EA6 A;  2PXI A;  4ED0 A;  5A0L A;  2CXY A;  2KQ4 X;  1KEJ A;  1YN5 A;  2JZZ A;  1EWY C;  3ZRF A;  2LGY A;  1ZQ1 C;  4NY8 A; 
#chains in the Genus database with same CATH homology
 2J42 A;  3AE8 B;  4N6E B;  2BBC A;  5BYR A;  4OW0 A;  1ZPS A;  2LUM A;  1LO5 D;  3R2I A;  3AED B;  3FC4 A;  3AE1 B;  4O1N A;  2J52 A;  1V1P B;  2BB5 A;  3BK2 A;  2PTL A;  3EGR A;  3PO0 A;  2BYT A;  1Y56 A;  4HKQ A;  1V97 A;  4LTU A;  4Q2J A;  1TZO A;  3FAH A;  4YTN B;  3IAM 1;  1HQR D;  2B76 B;  2Y5P A;  1FFV A;  1KF6 B;  1TKY A;  4GDK B;  4JWS C;  1I4P A;  4ZYS A;  4KGR A;  1DGJ A;  3CWI A;  2LJI A;  3NVW A;  3NS1 A;  1WGK A;  1YJJ A;  2PKO A;  5EE3 A;  1I4R A;  3Q8B A;  1NEK B;  1V1P A;  1KRH A;  1MI0 A;  3R2T A;  1JWU D;  2WXJ A;  3TEW A;  1Q10 A;  2R61 A;  2WXG A;  3LXF A;  2E3T A;  5LNK 1;  2TSS A;  3BYT B;  5BMG A;  4YSZ B;  4A9A A;  1FEH A;  2INP E;  1GB4 A;  3TSS A;  3GP7 A;  3IT4 B;  2GI9 A;  1JML A;  3AMZ A;  3AM9 A;  5BYS A;  2ON8 A;  3W1S A;  1XLO A;  1TY2 A;  3AE9 B;  2JQR B;  1JWM D;  1AWD A;  2ACZ B;  2INN E;  2K3U A;  3V3X A;  3FIL B;  3AEG B;  5G5G A;  1N63 A;  2OED A;  1ACC A;  1TS2 A;  3NZ3 A;  1VLB A;  1E10 A;  5BMH A;  2LGI A;  1J7B A;  1XXG A;  1FXA A;  2JYE A;  1EWC A;  4DQO C;  1EU3 A;  1DOY A;  3VRA B;  4MH8 A;  3MP9 A;  4HEA 1;  4RCO A;  3URY A;  2BB6 A;  1ESF A;  1EU4 A;  5H92 C;  4P16 A;  2N9L A;  3U52 E;  2JYT A;  3ZJU A;  4YXD B;  1FCC C;  1K50 A;  1NI3 A;  4EE2 A;  3P1M A;  4AS1 A;  1R7S A;  2CJN A;  3N9Y C;  1C9F A;  1PUT A;  4DXG A;  3EUB 2;  2WXK A;  2MJ3 A;  3VRB B;  1L0Y B;  1J7C A;  1BML C;  1P7E A;  1KTK A;  2YEP F;  2I2Y A;  2V0G A;  4L2Y A;  1ZE3 D;  2KAC A;  2V4I B;  1JWB D;  2M0A A;  1F2R I;  2X38 A;  3AE6 B;  1T6B X;  3FIL A;  1K53 A;  1WRI A;  1L0X B;  4AQ7 A;  1B9R A;  2WS3 B;  1JRO A;  1ZXI A;  4YWG G;  4ARC A;  2DLB A;  4OZB A;  1D6E C;  4REZ A;  3ZQ4 A;  1V8C A;  1N62 A;  1I4X A;  1HZ6 A;  1STE A;  4B0E A;  1OQR A;  3RPF C;  2W55 A;  2N7J A;  1L4Z B;  1FNU A;  2QIL A;  3TUO A;  1ZP0 B;  1RM6 C;  2K9X A;  2QJL A;  2LMC A;  1JCK B;  2JX5 A;  2KWD A;  1ET6 A;  4C56 C;  1ZDV A;  3RFZ B;  1T5X D;  2VZK B;  3HVD A;  3I57 A;  1WXQ A;  2K5P A;  1HEZ E;  1HXY D;  1JWS D;  1UWX A;  1QOB A;  4B0M A;  5I4D A;  4RH6 A;  3UI3 A;  3P4Q B;  3U2S C;  2BS2 B;  4C80 A;  3Q8C A;  2FE8 A;  2JSV X;  4YTP B;  1XCQ L;  1FFU A;  2D5G A;  4KGT A;  4GLS C;  4JPS A;  1TS4 A;  1J7A A;  1SJH D;  3NVV A;  1VZ6 A;  1K51 A;  2QIE B;  1CZP A;  1L4D B;  4NAW B;  3HRD D;  4MM3 B;  3VQI A;  1D5M C;  2Z8L A;  5T8I A;  3ABV B;  1NYR A;  4YSX B;  3AE3 B;  1ZXH A;  3ZJV A;  3BK1 A;  2H89 B;  1GAQ B;  3AE2 B;  3IAS 1;  4WAF A;  2ZW0 A;  2J4X A;  1QLB B;  2WXQ A;  2WDV B;  1YMH E;  5H8Y E;  1XF5 L;  1QF6 A;  1SEB D;  1SE2 A;  3AE7 B;  3W9C B;  2G9H D;  4LK0 M;  4XDC A;  4HJG E;  4YSY B;  2W82 A;  3P4S B;  1SE3 A;  4ZHO A;  1E9M A;  3P4P B;  2CU3 A;  3BVZ A;  2XNA C;  2LEK A;  3OWE B;  4TMA B;  2H88 B;  2IPK D;  2LHE A;  4J3O D;  3P4R B;  4CQN A;  2K22 A;  1L5P A;  2WDR B;  1VJK A;  1BXT A;  1TY0 A;  3DWG C;  4D2K A;  2AX5 A;  3W5V B;  1I4Q A;  2QMT A;  2VZK D;  4OHJ A;  3L4P A;  2MH7 A;  1GOZ A;  1YJI A;  2WDQ B;  2HDE A;  5C2T B;  3GB1 A;  2E6X A;  1JRP A;  1PYW D;  2PIA A;  1SJE D;  2L32 A;  1D4B A;  1FRR A;  5HG2 A;  2PVO D;  4WQM A;  1I7H A;  3MJ5 A;  3I9V 1;  4TQ0 A;  4A90 A;  1VRA B;  1M4V A;  4L23 A;  3B2G A;  3AV8 A;  5G5H A;  4KX6 B;  4WH4 A;  2IJ0 A;  4MAC A;  3W2D A;  2DYM A;  3LB8 C;  3P63 A;  2AQ3 B;  1XLP A;  3AEA B;  3HUI A;  1SBB B;  3BWU D;  4C7Z A;  1AN8 A;  1JQ4 A;  2L83 A;  1TKG A;  4YTM B;  2AQ2 B;  4ZOH C;  1TYG B;  3AE5 B;  4JWU C;  4RNA A;  1I4H A;  1MHH E;  2WXF A;  4JE3 B;  3GS2 A;  3KQ4 A;  5D3D A;  1SB3 C;  4NAM A;  1FNV A;  4HRO A;  2PMV A;  2W3R A;  4KGS A;  5TSS A;  1IBX B;  3AB5 A;  1XLN A;  1XO3 A;  4H2A A;  2EKI A;  1DOX A;  2WXP A;  1QKZ A;  5EE0 A;  1SE4 A;  5JXV A;  3B9J A;  1DOI A;  2RDH A;  1RWS A;  3LYY A;  2HTM E;  3Q8A A;  3Q8F A;  3R8B A;  2WXO A;  4LLG M;  2IGH A;  1B1Z A;  5HFY A;  4A6Q A;  2LHD A;  3ZGZ A;  4C7Y A;  3ZYY X;  2L52 A;  2WU5 B;  1C4P A;  3IXS A;  1RFK A;  2CJO A;  4RF0 A;  1L0V B;  2WNM A;  1IGD A;  1TS5 A;  4RFB A;  5EE9 A;  2I38 A;  2IDY A;  3MFG A;  3MHZ A;  2KDM A;  1N60 A;  2XN9 C;  1C4A A;  4PT5 A;  3VR8 B;  1CK1 A;  4GDL B;  1E6E B;  1JAL A;  4IOI E;  5MPO A;  3KLS X;  2NMQ A;  1E7P B;  1DYQ A;  2OHF A;  1OQQ A;  2N0S B;  2BT6 A;  1IBX A;  3BII D;  4HRS A;  3T3N A;  1FXI A;  1AW7 A;  1TKE A;  1VDV A;  1OFF A;  3CIR B;  4XE0 A;  3AE4 B;  3AEC B;  5FR3 A;  4IDI A;  4ZRQ A;  2FBW B;  1L6U A;  3KWL A;  1FM0 D;  3TEY A;  4WUR A;  4KKJ A;  1ET9 A;  3V05 A;  2K0P A;  2ONQ A;  5AUK A;  3AH7 A;  2V3P A;  5BMI A;  4RGN A;  1WSP A;  1C77 A;  3AEF B;  2WLB A;  4JX1 C;  1CQV A;  2W54 A;  1CJE A;  2BS4 B;  3SEB A;  1YNT E;  2L1A A;  5GXG B;  2ICI A;  3E56 A;  1I4G A;  1KFY B;  5FKA C;  4A55 A;  1KH0 A;  2MEK A;  1C78 A;  3B2F A;  4XDD A;  3NRZ A;  1NEN B;  1YQ3 B;  1UUP A;  3WCQ A;  3T3O A;  2BW2 A;  3IT6 B;  1K52 A;  2M56 B;  3BVG A;  2IGD A;  3MC0 B;  1EM7 A;  5BYQ A;  1JWA D;  4WIP A;  3U4E G;  1QQR A;  1ZOY B;  2NTT A;  2DWQ A;  2SEB D;  3AEB B;  2Q5W D;  4TQ1 A;  3AEE B;  1F0Z A;  1UNS A;  4HKZ E;  4R3D A;  1E0Z A;  1IGC A;  5E6J A;  2WU2 B;  1BUI C;  1HA5 A;  3Q69 A;  2WQY B;  1FRD A;  1KLU D;  4FXC A;  4OZC A;  1WYG A;  1ZDX A;  4RGT A;  1N5W A;  1IUE A;  1A70 A;  1PGB A;  2JU6 X;  1PDX A;  4ZHP A;  1YN3 A;  2JXT A;  2PW9 A;  1WWT A;  1FIQ A;  4OZA A;  3AN1 A;  2G1E A;  1FMA D;  3P42 A;  2NTS A;  3HVZ A;  2GRI A;  1QOG A;  4ZRP A;  1C76 A;  3VR9 B;  1MPE A;  3C8Y A;  1RYJ A;  1NYQ A;  1SSN A;  1QOA A;  4N59 A;  2N9K A;  2AQ1 B;  4XWT A;  2RPV A;  4DXF A;  1QIL A;  3Q8E A;  4USA A;  4UDU C;  3J9C A;  5HHD G;  1HZ5 A;  2JZP A;  2LFI A;  1YQ4 B;  1C4C A;  1TS3 A;  1L6V A;  3ETR A;  2ZW1 A;  1N61 A;  1UGJ A;  4XWW A;  4ARI A;  5FK9 C;  1NVI D;  2KAJ A;  5HI1 A;  3PZ7 A;  1JW9 D;  1SXT A;  1XEE A;  1SF0 A;  2BS3 B;  2SAK A;  1YN4 A;  2WP9 B;  5D3I B;  5D7G A;  1FNW A;  1D5Z C;  3O13 A;  3ZJT A;  2BTE A;  1PGA A;  2KMM A;  3TEZ A;  1C79 A;  3TEX A;  2QSD A;  3NVZ A;  2RMM A;  4OVZ A;  2QEJ C;  1N5X A;  4YT0 B;  4TSS A;  1ENF A;  2FUG 1;  1F2R C;  3SR6 A;  2DBY A;  4NZL B;  5AUI A;  4US8 A;  4US9 A;  2WXH A;  2Y3A A;  3BVM A;  3SFD B;  2V3N A;  1XLQ A;  2DYO A;  4MT5 A;  1PGX A;  1SIJ A;  1AYF A;  1KLG D;  3DWM A;  3NUH B;  4N58 A;  4M0W A;  4RGO S;  2RDG A;  5EE1 A;  2PLP A;  3PZ8 A;  1XCT L;  2YEP B;  1GB1 A;  2KN4 A;  3H8H A;  3KWV A;  1PFD A;  2WXR A;  2PVG C;  3U7Z A;  1P7F A;  2GB1 A;  2MJD A;  2IGG A;  5C3J B;  1D5X C;  2W3S A;  1UWM A;  1VR9 A;  3BYY B;  2WXN A;  1TJE A;  1FCL A;  2MJE A;  2Y5C A;  4P6V F;  3SFE B;  2JWU A;  3NVY A;  1MVK A;  4WWM A;  3W5U B;  1VZ8 A;  4RGM A;  2EEL A;  4KKI A;  4NJC A;  1ROE A;  4RF1 A;  1FD6 A;  4IKG A;  1V1O A;  3BZD B;  1QOF A;  2WXM A;  1ZUD 2;  2WXL A;  1MHX A;  1F77 A;  1VZ7 A;  3EA6 A;  1FO4 A;  3E9S A;  4L1B A;  4ITK A;  1T3Q A;  2M19 A;  4A8X C;  1QT9 A;  2J53 A;  1GPX A;  2KQ4 X;  1YN5 A;  1EWY C;  2WXI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...