3NVVA

Crystal structure of bovine xanthine oxidase in complex with arsenite
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
164
structure length
164
Chain Sequence
TADELVFFVNGKKVVEKNADPETTLLAYLRRKLGLRGTKLGCGEGGCGACTVMLSKYDRLQDKIIHFSANACLAPICTLHHVAVTTVEGIGSTKTRLHPVQERIAKSHGSQCGFCTPGIVMSMYTLLRNQPEPTVEEIEDAFQGNLCRCTGYRPILQGFRTFAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray Crystal Structure of Arsenite-Inhibited Xanthine Oxidase: Mu-Sulfido,Mu-Oxo Double Bridge between Molybdenum and Arsenic in the Active Site.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Xanthine dehydrogenase/oxidase
total genus 42
structure length 164
sequence length 164
chains with identical sequence J
ec nomenclature ec 1.17.1.4: Xanthine dehydrogenase.
pdb deposition date 2010-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 3nvvA02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3nvvA01
2LEKA 2W55A 1NYQA 1DOXA 1ZOYB 3AE1B 3AE3B 4YSXB 1IUEA 2BS2B 1KF6B 3L4PA 1N5WA 3SR6A 1J7CA 1L6UA 1YQ3B 2FBWB 3AEAB 3RPFC 3AN1A 3SFEB 2MJ3A 1AWDA 1JW9D 1NVID 1L5PA 1ZP0B 2Y5CA 3AE2B 4YSZB 3AEFB 1FFUA 1OQQA 3B9JA 1L6VA 4JX1C 1J7AA 1TKEA 1OFFA 2PKOA 1FFVA 3CWIA 1WWTA 4IDIA 1PDXA 1QOAA 1GAQB 1DGJA 4C7YA 2JX5A 2E3TA 3NVWA 3AE5B 2WU2B 5H8YE 3ETRA 4US9A 3LB8C 2CJNA 4FXCA 3VR9B 3W9CB 2BT6A 3ZYYX 1I7HA 1QF6A 1E6EB 1XO3A 2L83A 1SF0A 2PVOD 2K5PA 1XLNA 1FRDA 1DOYA 2Q5WD 3AECB 1ROEA 3FAHA 1V97A 1PUTA 3W5VB 4ZHOA 2DWQA 5C3JB 3AMZA 2H88B 5G5GA 2MJEA 2WP9B 3P4PB 1WYGA 1FRRA 3NS1A 1FM0D 2H89B 2OHFA 1NEKB 2M19A 5G5HA 1QOFA 1NYRA 1N61A 2L52A 1ZUD2 3KWLA 4JWUC 1DOIA 2M56B 4YXDB 5AUIA 1SIJA 1J7BA 1L0VB 1FO4A 2AX5A 5MPOA 2JQRB 5AUKA 1XLQA 3AM9A 1CJEA 2K9XA 3DWGC 3AEDB 4WQMA 1B9RA 5EE0A 4YTPB 4YT0B 1UWMA 3P63A 1QOBA 2QIEB 3AE4B 4JWSC 3W5UB 3B2GA 1JQ4A 1JWBD 1YJIA 2PIAA 3BIID 1E10A 1WXQA 3HVZA 1V8CA 1EWYC 3AEGB 3P4SB 1E9MA 2HTME 1VJKA 2WDRB 2CU3A 4WWMA 2KAJA 1N60A 1QOGA 2WS3B 1E7PB 4ZHPA 2EKIA 1NI3A 1RYJA 5EE3A 5GXGB 1JWAD 3AV8A 1AYFA 4N58A 1N63A 1GPXA 1TKYA 1XLOA 3LXFA 5C2TB 1KFYB 3NVZA 3AB5A 4N59A 2CJOA 1A70A 4C80A 1RFKA 3AE7B 3AEBB 3B2FA 1NENB 3CIRB 3P4RB 2W3SA 1KRHA 3SFDB 1FMAD 1YQ4B 2QJLA 3EUB2 2WDVB 1N5XA 2BS4B 2WQYB 3P1MA 3PO0A 1XLPA 1FIQA 2W3RA 1QT9A 4KX6B 3VRAB 4HRSA 3AH7A 4P6VF 1R7SA 4YSYB 2W54A 2K22A 1JRPA 1RM6C 2B76B 2N0SB 1WGKA 3AEEB 3DWMA 1E0ZA 1QLBB 5H92C 3AE9B 1N62A 2WU5B 1VDVA 4C7ZA 4US8A 1TYGB 3P4QB 1ZXIA 2MH7A 4LTUA 3WCQA 5EE1A 2G1EA 4YTNB 3FC4A 4USAA 1YJJA 2WDQB 3NVYA 4N6EB 1VLBA 1JALA 2ACZB 2MJDA 1TKGA 1CZPA 3HUIA 1SB3C 5EE9A 3VR8B 1T3QA 4ZOHC 1WRIA 3ABVB 3VRBB 3HRDD 3AE8B 1PFDA 4YTMB 3NRZA 1OQRA 3NVVA 1TJEA 2KMMA 4A9AA 1JROA 2WLBA 1FXAA 4HROA 4ITKA 2PVGC 3AE6B 1F0ZA 2BS3B 1RWSA 2DBYA 1FXIA
chains in the Genus database with same CATH superfamily
1SXDA 3THVA 2FLPA 3C21A 3JPTA 2R18A 1CK1A 4DDID 3SZ2A 4ICUA 1WYWB 4MF8A 2H3QA 3GP7A 3TANA 4TUQA 4TKNA 3X0WA 3UMGA 1P0RA 3H7SA 1WRDB 2CN1A 1HE8A 1S0MA 1UGMA 4DL3A 5AZHA 2MUTB 2MRLA 4C8NA 2QILA 1QSLA 1TT5B 4KITB 3M6KA 1FFVA 1SZHA 1YT3A 5KFFA 4FO6A 2PFQA 4MM3A 4G3XB 2HHQA 2KMCA 4FXCA 2FMQA 3Q3MC 5J0XA 4HKZE 4L1BA 4EZKA 2NO4A 5J2DA 2XCAA 2IO2B 2N9XA 1ISNA 2KD1A 3VUYA 1WF9A 3W5VB 3QEBZ 2BCRA 2MJEA 2WP9B 2KHQA 5KFKA 4B95A 2MP2A 3BQ7A 5KG0A 2H89B 7ICLA 2AQ2B 4J9KA 3F2BA 3B1LX 1NEKB 1ZD4A 4B9NA 4AYBC 1ZQJA 3K9OB 3UQBA 2KKPA 3HKZF 2M56B 3C29A 4FULA 2K8BB 4EEYA 2WF6A 2JQRB 3LYSA 2ZIUA 3RH6A 3ZJVA 1ZQEA 1ZQKA 2CRXA 3MC0B 1NK8A 2AH5A 4O3MA 2ASQA 1HUOA 2RGFA 4QZIA 3UMBA 4XUSA 3DVNV 2IGGA 5AEKB 4YP3A 4W9IA 3PZ7A 2CU3A 2FNJB 1E8WA 4KSLC 4IRCA 4GDKB 4P0QA 1E7PB 1HA5A 5ALKA 4C8OA 3H40A 2J52A 2JYTA 4ZYNA 4IWQA 4C4TA 2EZYA 3WAMA 2Y0SF 4M2YA 5KFXA 3AE7B 4KLTA 4YMOA 1YQ4B 5KFPA 4U7CA 2TSSA 5B66U 2JR5A 1NZBA 4RPZA 1FIQA 4I2HA 8ICUA 1KW4A 1GO3F 2YN4A 4N9F4 4DFKA 1ZOLA 2CPRA 5HMMA 4PH5A 5FKAC 4EUTA 1SJHD 8ICXA 2W9NA 3AE9B 3RH5A 3P4QB 2ZZPB 2HSZA 3MHZA 1ESFA 3T3NA 1YJJA 3IV6A 5AI5A 2BKEA 1ZQRA 2J6UA 2G4SA 3VR8B 5KFAA 4IR1A 2JXTA 2Y9TA 2LI6A 2RMMA 3RFAA 4GXBA 1KLNA 4P4PA 3NTUA 5KNIA 2PI5A 1IYFA 4DDGD 4ED1A 3R8BA 5AKYA 4NLZA 2O6VA 3V6JA 3PX6A 2JH1A 3QJZA 2HDEA 3PSIA 5ALJA 1EO6A 1OEYJ 2G09A 2C9WB 5KFLA 4B9VA 2LGYA 2SAKA 3NY5A 2BGWA 4BVUC 1X40A 4TQSA 1SE9A 4RM8A 3RPFC 3SMVA 5J2GA 4MDKE 4P1CC 5AI0A 1MHHE 7ICPA 2NRZA 2UVWA 3AU2A 3ZIMA 5J0RA 1YOVB 5IA7A 4REZA 5DQHA 3FILB 4JQWC 4HK2A 3GE8C 4KGTA 1QQ5A 2KFKA 5BMGA 4AJYB 5AKIA 2G9HD 3APFA 1VJ5A 2WF7A 3DBLI 1UA0A 4IKGA 4OZAA 2K1FA 4P0PA 1XQQA 2KZZA 1XF5L 2PJHA 2R61A 1F5SA 2YMMA 2MHJA 3W9CB 1HTQA 4K4IA 2BT6A 1T94A 2QB1A 1C4PA 2QEJC 2KJ6A 4ACFA 2K5PA 2BYEA 5F9NA 1KLGD 3CSTA 3BQTA 4I6LB 3AMZA 4XYCA 2IHMA 4PS7A 3LWLA 2D5GA 2VH1A 1KH0A 2DYMA 1WYGA 4OJLA 3UMCA 3QK0A 5G55A 3TJPA 4IR9A 4B9TA 4M9JA 5HP4A 5HR7A 1I4GA 3A4RA 3RNEC 1XC9A 1HZ5A 5J2RA 2OJRA 1S1QB 1PGAA 2ZUCA 1P9DU 2ZIVA 2RPQA 4P0PB 3TAPA 1FXTB 1PUZA 1A0PA 4DOAA 4CQNA 3RJKA 4KN4A 1SZPA 2GWSA 1SE4A 2IO0B 4DSLA 3PZPA 2UVVA 1I4XA 4K7UA 2FDRA 3HVZA 2L32A 2M1MA 1ZQUA 4HYKA 2V3PA 5KTQA 4ZHPA 1O08A 3WK7A 1WZ0A 2G4DB 1RYJA 4OVZA 2E5SA 2L05A 2DZJA 4JPSA 4IW0A 3CP8A 1D4BA 3NVZA 2V4QA 2AGPA 2KWVB 4WJOA 2PPHA 3P4RB 4ANUA 4EZLA 4FHKA 4FBUA 3I1YA 8ICNA 1JWMD 3BZDB 4J9LA 4W9LA 2BBCA 1PVQA 1QT9A 3RJGA 2KK8A 1UBQA 3LWMA 1R7SA 4KLEA 2PTLA 3PMLA 1Y56A 3QCAA 9ICKA 5TSSA 1X9XA 2ZJAA 2V4IB 2V3NA 4C4VB 4ELVA 1L7MA 4ELUA 4F3OA 4M0AA 3N3KB 3UF8A 1NKCA 4IQWA 3W1SA 3MC1A 2KFKB 2XC9A 3VRBB 5AKGA 5DDYA 4NL9A 2N1WA 1T3QA 4ZOHC 1IM4A 3IG3A 3T5KA 3S6JA 2QLTA 2XY7A 2KMMA 4A9AA 2KTRB 4WIPA 2P66A 5CX3A 3IHQB 2Z8LA 4A3PA 3DVGX 1WIAA 2W55A 2Y9UA 4J03A 4QIWF 4ECRA 1PK1B 1OEYA 4ZRJA 4BKSA 5E79U 2RRDA 2IBKA 4HCPB 1VD2A 5JZEB 4AP4C 3GZNB 5J2AA 1SIFA 5J8YA 1JW9D 2QDFA 1D5XC 5DPSA 1IXRA 8ICTA 2Q0ZX 3OG5A 4GIBA 4MEMA 2BQRA 4GC7A 1UF0A 3LDZE 8ICZA 2ZNVC 4L23A 4E71A 1DGJA 4MEYA 2E3TA 2LZ6A 4R8UA 5ALXA 2HMXA 1BPEA 4JV0A 3QYPA 2W9MA 5DLGA 5DDMA 7ICOA 2IYDB 3L3FX 3OJUA 3H4BA 2J7QB 3WKEA 3KYCD 4U6PA 4LNNA 4O1NA 1PUTA 1C1YB 2B0CA 2RLTA 4FZMA 1F2RI 4MT5A 2LI5A 3ZRFA 3IAM1 2E8PA 3B0YA 4C8LA 1C9FA 4QAYA 3SHQA 2F1IA 3R7RA 1NYRA 1ZUD2 1Y88A 1U45A 2LKYA 2BKFA 3DV9A 1WGDA 1T8EA 2WXJA 3F2DA 4ICVA 2K8HA 4KGRA 4UAUA 1LKYA 1WUDA 4GB9A 1PZNA 2L5YA 3WALA 1D8BA 4RGOS 1QKZA 3Q8RB 3DPDA 5DBCA 2KD0A 2KLCA 2BQ3A 1L5UA 2K25A 2JY6A 1L7YA 2VJ5A 3L5KA 3TEZA 2W9BA 3TADC 1Q1OA 3AEGB 4HPPA 4OJ6A 5J0PA 3JPRA 2W7PA 2P6RA 1ZQPA 3H0RB 4UDUC 3ISDA 2VRRB 4O5EA 1NJXA 5KG7A 5EE3A 2V0GA 2OJWA 2C7NB 7ICIA 5DB7A 1V6EA 4OO1J 1C3TA 3WK8A 4A20A 3PNCA 4N59A 1XXGA 4RQ1A 2HCFA 2W3SA 2HW3A 4GGQA 4RMAA 3UINB 2BCVA 4DL5A 2KTQA 3T79A 1V5TA 2KX3A 2V4LA 3M62B 3R2IA 4BKTA 2MSED 3ALBA 2PMZF 2K8AA 2ZTEA 2K89A 4DL6A 3V05A 4F4ZA 1QCKA 2XIDA 4XX5A 2X38A 1EF5A 2WXFA 3MTNB 2KWCA 3AXCA 5L1JA 2RD0A 3ML8A 3TEWA 1PQSA 4UAYA 1M6YA 3A0BU 2GO7A 3ZD8A 4R3DA 1SKRA 1TJEA 3WU2U 4CRXA 2WAQF 4YXJA 3TAQA 4DFPA 2L1AA 3VTUA 2XI9A 3B0XA 3VH4B 2PMVA 4RNMA 3GILA 2KYWA 4E74A 1FNWA 4KV2A 2MRPA 5F3XB 5AK5A 1E8YA 3L4PA 3TUOA 4F4WA 5D7GA 3NUQA 3PGEA 3M63B 4NM2A 1SV0A 2PFPA 1S0VA 2AQ3B 4NY8A 3NS8A 3V6EB 1OXJA 4RQ6A 1J7AA 3C2KA 4YG2A 4MELA 3RH4A 9ICRA 1F0MA 3KW5B 2A19A 4NAWA 4I2JA 1WR6E 4DWFA 3AE5B 2QC8A 4DEZA 2KHVA 2KQSA 4DFDA 5J2KA 2CJNA 3ZDAA 2XN9C 4CHKA 5D49A 3ZYYX 4BFRA 5BYQA 3HWTA 3I5JC 4NLKA 5ALDA 4WAAA 4F72A 2KE7A 2WF5A 1B1ZA 2KKVA 2KWUB 3AQEA 4ZHOA 1KTQA 2NRVA 5KFOA 7ICMA 2E8OA 2H88B 3V62A 3RN9C 2EZZA 2REXA 3GZNI 2LGDA 5ALPA 3HX0A 3HHMA 1KKXA 2M19A 1PK3A 5KFRA 1V81A 3BS7A 4KLOA 3BZCA 2YQEA 3I3TB 1K53A 3KUCB 1X1MA 2EELA 1WCLA 1Z3EB 3UXNA 1Z19A 1UD7A 1LVHA 2RHFA 3GZFA 3HJEA 4P2HA 2W7OA 2J0KA 2FCNA 1ZQWA 5CWRA 4DS4A 2XNAC 2D8CA 4KKIA 3L17A 4PZOA 2LYAA 4QZBA 3JPPA 1E8ZA 2ICIA 3VCBA 2FCSA 5J0WA 1EWYC 3JSVB 3Q8SB 3UGBB 2YTUA 2JSVX 3QC8B 4MGYE 1DXSA 2JU6X 2AQ1B 5EWFA 2NMQA 2O6KA 3QZ8A 2KN4A 2C2DA 2C60A 4O3RA 2RDBC 1XCQL 3W1SC 5CTRC 1N63A 3D2QA 2OXOA 5D46A 1UH6A 1L3SA 2DAFA 4CO7A 4R64A 2WXHA 5DB9A 1RFKA 5L83A 4IWOA 3IBEA 1V86A 5J2BA 4ED8A 3K1ZA 1NKEA 4JWNA 2JVCA 4NLCA 3VRAB 1JRUA 1MSWD 3A33B 1YD8U 3MJWA 5AZGA 3JPNA 3T3FA 3OHBA 4BAXA 4LNIA 2JF5A 2RSUA 4OW0A 1VDVA 3L13A 2VA8A 1XSNA 2KFJA 4WWNA 3ZNID 5LNK1 3K75D 3H8MA 2HHTA 4A8EA 2YB4A 2FIDA 1EUVB 3M95A 2IGDA 4W9EA 1JIHA 2LRUA 4FBJB 2KZRA 1DK3A 2KP7A 3NVVA 2ALZA 1L2NA 8ICEA 8ICKA 1JROA 2BCQA 1MJDA 2WLBA 3RNFC 8ICWA 4RPYA 2DKXA 2EANA 1ZQSA 3ZI4A 5AI9A 1HQRD 4J9PA 2GBMA 5LXHA 2BR0A 4XWWA 3H4DA 5IIJA 1HTOA 2LM1A 4NQKE 4Q8EA 1OGWA 3NG0A 1KF6B 2N1VA 1N5WA 4KVGB 3C5GA 4PHEA 4GLSC 2Z7JA 2ZW1A 3SU8X 1H8CA 3R2TA 2QCZA 3JYUA 1BXTA 1ZQQA 3GV7B 4FLHA 1MVKA 5TISU 3RMKC 3A0HU 4UATA 2K8CB 3PW7A 2PKOA 3QQ8B 2HOFA 2A5UA 2VZKB 3I9V1 4KLMA 3M9OB 4NLGA 4DF4A 4G50A 3BS5A 1J0GA 4ECYA 4RUCA 4ED0A 5E6NA 1K1QA 2L8JA 2E1EA 4Y2TA 3V6KA 1NK6A 4XRHA 1V97A 4IC9A 4QWAA 4B9SA 4MM3B 3ZXRA 1SKSA 1T7PA 2GI9A 5KT5A 4PGXA 3TADA 3P4PB 2IPKD 4W9FA 4M04A 3H7IA 2E1FA 5AM5A 3U26A 4RNNA 2LXCA 5J2IA 1Z1VA 1QOFA 5CP2A 1N61A 2WYQA 3N1ZC 5D94A 3LVVA 4BJQA 4NL9C 2W04A 4KZ0A 3HT3A 5J0TA 2L7RA 5ALOA 2IOFK 2VA3A 2C2RA 1XLQA 1ZD5A 3LK9A 3ZQ4A 3CW2C 2PW9A 2MLBA 3DWGC 2WXOA 2OWOA 5AICA 3T5JA 1RZTA 2H3IA 4P0QB 1UWMA 1URJA 3KQ4A 3KWVA 4II3B 3AE4B 1ZRNA 4PJ0U 2PXIA 3NOBA 4O3PA 1NK9A 3V6CB 3P4SB 1OTRB 4M9LA 2YLMA 5C0YA 2WDRB 1WMHA 4FJZA 4M9NA 3BVZA 4TQ0A 2YB1A 5BOLA 2RQ5A 2KV2A 2J53A 4UB8U 1EU4A 2DYOA 1I42A 5AKJA 2NYVA 5AM1A 3H8SA 1BUIC 1A77A 3QUBA 3JPOA 9ICXA 3N4MB 1MPEA 2KTRA 2NR2A 2LPEA 3SFDB 2ZVOA 3EUB2 4MEXA 1N5XA 4FZLA 5HNKA 1KN5A 2LHEA 2N9LA 4EFOA 1X66A 1C78A 1Q10A 2M17A 2BPGA 1WG8A 4YVZA 2AGQA 2Y5BB 2LHTA 5CHGA 4TUPA 5KAFU 1QLBB 3IHPC 5CR0A 4C7ZA 2LWPA 4QZGA 3ISBA 2MH7A 2IO1B 4YR3A 4AOFA 5C1ZA 1E90A 2N1RA 3FC4A 3SAFA 1R4NI 5J18A 3DBLB 3ABVB 1D3ZA 3Q8BA 4PS3A 1CRXA 2XICA 1K51A 1ZXHA 4EELA 3RR8A 4NXZA 4KDLB 2JPHA 3F53A 4WJQA 4PL1A 2KACA 3AE6B 3PR5B 2NS5A 3RYTA 3T9LA 1X6IA 1T6BX 2JYEA 3QU4A 1RWSA 2I5HA 3PLUA 3EFUA 1NYQA 3E56A 3C5FA 2WF8A 4RH6A 2I2YA 3E0FA 5BOMA 1SKWA 2GLEA 1D9DA 4LNOA 2HJ8A 1NVID 2XK5A 1ZQIA 3RJHA 2LGXA 1EU3A 2D11A 1SXTA 1WCNA 3ALRA 3BINA 1SJED 3TARA 4GMVA 4IDIA 4F71A 3QU7A 2MU2A 5JXVA 5ALZA 4C7YA 4QZ8A 5K4LA 2DZIA 3UXOA 2OYYA 9ICSA 4MFFA 4F4XA 1SF0A 4AS1A 1SGGA 4RQ4A 1T3NA 5CHWA 2BB6A 2BQUA 1S0NA 4O3SA 3VDZA 4A90A 4B9UA 4ECVA 2N7DA 1EF1A 7ICTA 4ED6A 2UU7A 2ZXHA 4F4KA 4PHDA 3Q8FA 1Q46A 3FKYA 4DXFA 1HZ6A 5JHBA 4YXMA 3C2MA 4HLEA 1SIJA 3QIJA 4DXGA 4A3OA 5AHXA 3ZDCA 1A5RA 2HHUA 3EFCA 3AM9A 4MH8A 4K3BA 2F8LA 1NOMA 5IIMA 4Q43A 4JWMA 3QX1A 3K1RB 2QARB 1ZQAA 2GH1A 4UB4A 3OWEB 5JH5C 3HPOA 1JWBD 3KVFB 3BIID 3KHHA 1NJWA 2ZIVB 3IM1A 2LYHA 1WR1A 4CCHA 2WNMA 1ZQZA 1V85A 5KFBA 2IY0B 4OJPA 3HW8A 4OVUA 2EH9A 3ZDBA 1WJ6A 1JN3A 2NPTA 1XU4A 3QE9Y 9ICIA 2FIFA 2C2EA 4YR2A 3EHVA 3LXFA 5AIBA 2RDIA 1C4AA 1LGRA 2FJ6A 2I1JA 2EAMA 4FZNA 4C80A 3AEBB 4MF2A 1NENB 3T8MA 2DF4B 2WXKA 3M7DA 4Q8FA 2FMSA 1BPXA 2PE9A 4E3CA 2ZTCA 4HRSA 3IVFA 4OD0A 2UVUA 3DVNU 1B4FA 5TZVA 4FS1A 3AEEB 4EZJA 2XGQA 1IBXB 4O5KA 3A9KA 3KFUF 2L0TA 1MG8A 2WX1A 5IN7A 1X42A 1FCLA 4DQIA 4W9HA 3T5LA 2WDQB 3H0LB 2HHWA 4F2RA 2IOHA 2NPTB 2JXXA 4PS8A 1LXDA 2FE8A 1TAMA 4RUAA 8ICLA 3Q8LA 1SE2A 2FPLA 4I2GA 2MBEA 1KFTA 4X5VA 1F0ZA 5JU5A 4NWIA 2BS3B 1K5OA 3N97B 3RJFA 1DYQA 2DBYA 2JWUA 1SWVA 3AUOA 1I4PA 1WI0A 2LEKA 2EAOA 5KG4A 1ZOYB 5D2MB 4WQOB 3AE3B 3RRGA 2BS2B 5AM0A 1J7CA 3SFEB 2LHDA 3UPQA 3KD3A 3KZXA 2KXJA 4AUQC 3TI0A 4ED3A 3KLSX 3AE2B 8ICYA 4YSZB 2ZJDA 5JHAA 1ZQDA 4JX1C 2JZBB 4CF4A 3FYHA 4FN2A 4L2YA 4IQTA 3E2EA 1JXLA 3VC8A 1FNVA 4X57B 3QZ7A 1QTMA 1PDXA 1BT0A 4B6WA 7ICFA 2JUOA 4M9GA 1TK8A 4JIOU 2Z0DB 1WJNA 3V3XA 2A1JB 4PHPA 4J3OD 3VR9B 1TE2A 1E6EB 4RM9A 3JW0X 3NGDA 1HUZA 1VCBA 4WJNA 3GQCA 2MBHA 3R9KA 3EW9A 5ALQA 2NBUA 5C3JB 2KSOB 3A1QA 4LCDE 3TMPB 2AXTU 3IFWB 2F44A 1ZQVA 4MH0E 1FCCC 1YMHE 1U49A 2WXPA 4JGHB 5J0SA 1WX8A 1AARA 1IIPA 3GDXA 3J9CA 4PGYA 4JL9A 2MUTA 4F5PA 1KDHA 1I4HA 2HDOA 1V80A 3BQ1A 1Z1BA 3WIMA 2NTSA 3SEIA 4ACOA 3M1YA 5A0LA 1VJKA 1UPHA 1XO0A 2EMSA 2WXMA 2NRWA 2KC1A 1OW5A 2VANA 5AIAA 2EKIA 5KL1B 2XVTA 1RRBA 2HBMA 5GMVA 5KG1A 1F77A 3PW4A 3RB0A 3Q3OC 2DHZA 3F2CA 4MFCA 5I4DA 4O3NA 1CMXB 4P4OA 4EBEA 9ICFA 2QJLA 2MAXA 2M0XA 1COKA 2ISOA 2XK5B 1T0YA 5DLFA 4O3QA 3Q8AA 4DL2A 2XEWA 4TUUA 1YNTE 3SAGA 3PW0A 1JRPA 4DXAB 3WK9A 1X6JA 1YZ7A 1IG6A 3UQAA 5J2CA 1TYGB 4IM0A 3WAOA 4LJPB 3KBBA 3A9JA 3BVMA 2FPMA 3PHWB 2HVIA 2ISPA 1UT5A 3HUIA 3QAQA 2D3GA 3URYA 1JMSA 1WRIA 1OQYA 4EEWA 1TIFA 3PPAA 1BPBA 1YN3A 3NRZA 1OQRA 4QWCA 5KG2A 4GDKA 4GU2A 2J6TA 1D5MC 1FXAA 5EDSA 1PVRA 3TSSA 1WGRA 3F5EA 5ALNA 3N7SC 1UWXA 3H6NA 4QIWC 4J9MA 2WXNA 2K0PA 3OJ4B 2B3AA 1L6UA 1ZGUB 1TY2A 2WXLA 5HI1A 4KLIA 3ZNHB 3KUZA 4UW9A 3PX0A 5IIOA 4F8RA 3PRMB 1C79A 7ICEA 4AQ7A 3WKCA 4WJPA 3UXPA 2ONQA 5D6JB 2E6XA 1P7FA 5BMIA 2DPIA 4EOYA 2MBOA 4JUZA 2QKQA 1GAQB 2ZW0A 4HVBA 1L3VA 4KLGA 4FJYA 1SL0A 4Y2RA 2AHOB 1I7HA 9ICLA 2QHOA 2PVOD 2PLPA 4W9CA 1FRDA 4S17A 4UBBA 3FAHA 5ALGA 2KLGA 4IG7B 2JEGA 2WXGA 3QARA 1LM8B 2GBNA 1UUPA 8ICIA 1UQVA 2V9HA 4DQPA 3RB3A 4I2AA 3VUWA 2P6UA 3AU4A 3PO5A 3TKAA 1DOIA 2HBJA 1TV9A 3MFIA 4EX7A 3GE3C 5KT3A 2ZJ5A 5B5EU 3MHSD 2LD9A 2GLSA 1U4AA 4G11A 3S2AA 4XC2A 1ZQNA 2KK0A 4QZ9A 3RTVA 2FLLA 2N9PC 4ECXA 3UIOB 2ASJA 3X23A 4YTPB 4ZDVA 2ZIXA 4DL7A 2LXAA 1Q8KA 5AM3A 4JWSC 5BPCA 3OAWA 1ZQXA 4PK1A 1WXQA 3IN5A 2J0JA 1F52A 2W8LA 2YEPB 5KG3A 4J9NA 1WH3A 2JZZA 2KJ5A 3EGRA 3FDSA 1QOGA 1UZXB 4IRKA 3MGVA 2LYBA 2MA1A 5DG7A 2MP2B 1GPXA 2AU0A 2DENB 3QX7A 5CA7A 2K3UA 5ALYA 4EZ9A 2CJOA 1A70A 2BVCA 3PVXA 2J0MA 1Q5WB 5KFMA 4IS7A 5IIKA 5JUMA 5L1LA 3GU3A 3H8WA 4PT5A 4K7WA 1CQVA 4UAVA 2D10A 5AM2A 1IP9A 2F76X 1U47A 3TIXA 1RM6C 2B76B 2N0SB 4Y2JA 2BYFA 2G45B 1M94A 1ZQOA 5IP4D 3RT3B 5HR6A 2DKZA 3EA6A 2V9WA 2HI0A 3M3JA 5T8IA 4C0ZA 2Y5PA 4W9KA 2MCNB 3WKBA 4JV1A 3ZD9A 2G3QB 3PR4A 1MA7A 1MHXA 3ZLZA 4B9KA 1JXEA 3PS6A 3O65B 2C22A 2ES6A 1GC6A 5AKZA 1NBFC 1KM7A 1XD3B 1N48A 1TK5A 1ZDVA 2UYZB 4RCOA 3K4GA 3GIKA 1R4NB 4QZDA 8ICSA 4P4MA 2KSOA 3PZDA 4NLNA 2LGIA 1RYRA 4HPMB 4KTQA 2ZXIA 3QXGA 3QUTA 1WM3A 4YL8A 1TAUA 1CEZA 2HD5B 3UQ0A 1ED1A 5ALHA 1YQ3B 3RB4A 5CRXA 5KAIU 3OJ3A 3U7DA 3CF6E 3RBEA 3BS5B 5ALIA 3U7ZA 2R2QA 4DSJA 1KSPA 1L6VA 4WJ3B 2I38A 4M02A 4RU9A 2K8BA 1ZQFA 3DCGA 4RNAA 4WURA 1OFFA 2C7MB 1NI2A 2JXJA 3RNBC 4EYIB 4F1SA 1YN5A 4YD1A 3KKAC 1WWTA 3CWIA 5J2EA 3NVWA 2JRZA 4IQVA 4CDGA 2G08A 2IDYA 3RJIA 3RJJA 1WMHB 3Q8EA 1SL1A 4M6WB 3MR5A 1XLNA 4NY0A 2D6FC 4HDQA 1HEZE 4R65A 5E6JA 4GN1A 1Y8RC 5DG9A 4RQ0A 8ICFA 2ZTDA 1YX6B 5G2NA 2AYOB 1X9WA 2NBWB 2NVUI 4R8UB 2FCMA 1C4CA 4FE3A 2N9EB 5DPRA 2JHDA 2K4HA 4B0EA 2OHFA 3IG8A 4UB6U 1I35A 2XCPA 3AU6A 3VAWA 1JI7A 4ECTA 1NZPA 4BUGA 4YXDB 4Y2PA 3G6YA 4W9DA 4JE3B 1F9JA 2LVQA 2AX5A 5J0YA 4I28A 8ICAA 1P7DA 4A8XC 3IXSA 1HXYD 2RDJA 5L9XA 3AEDB 2JH7A 1J19A 4II2B 2GMIC 5HG2A 3ED5A 4P7IA 2K4EA 3W5UB 4C4RA 2W9CA 1RXWA 2WDTB 1IBXA 5TR5A 4I6PA 2PIAA 4LZGA 1E10A 3WAPA 2YX8A 1NKBA 2I6XA 3GIJA 1LB2B 2NCNA 2LVPA 2FE9A 4PYZA 1MI0A 1XLOA 1OUQA 2WWZA 3HK0A 4MGKE 4ASWC 1E7UA 1SBBB 1UELA 4AWJA 4ZH4A 3Q8KA 2WDVB 1RQNA 2KOBA 3QU2A 2LJIA 4KX5A 1MQ3A 1WGHA 4M47A 2ODGA 4KMOB 3AH7A 4NJCA 3H8JA 2B6GA 2M0NA 1TZ1A 3ZDDA 2KO3A 1VZ6A 4FS2A 5H92C 2JGAA 3JPQA 1NK0A 3ZJUA 3RFZB 2WU5B 4KSKC 4US8A 4LTUA 1WXMA 4IUMB 3QUCA 2WXRA 1MFWA 4HAIA 4YTNB 2B21A 5ALWA 3V6HA 5KG6A 4F5NA 4BKSD 4MACA 4LVSA 3PSTA 4OHJA 1X9SA 2KVZA 4ECWA 2KOXA 5T14A 3VXWA 5L95C 2KG5A 1TS5A 2BQQA 4NQLB 1J8CA 5DG8A 4J9RA 1RXVA 2HHXA 1LO5D 1UNSA 2K39A 3PW2A 1IUEA 4BBNC 2DNFA 1WE6A 3A1QB 1IGDA 2FBWB 5GTHU 1ZKHA 1BMLC 3AEAB 3DDCB 1UHUA 2WGSA 2OM6A 4F5QA 1LQBA 3BK1A 2KNJA 2KJRA 1V5OA 1FFUA 3M9NB 5IOIA 2A1AA 2LASA 3TBLD 4NV0A 1ZQGA 7ICRA 5AKXA 5L1IA 9ICPA 3C8YA 4YCXA 3LB8C 1YQBA 4H2AA 3VUXA 4ECQA 3ZW3A 8ICGA 1E8XA 4J9QA 3KHRA 3QEAZ 3RBDA 1HEKA 2Y1JA 2PI4A 1ROEA 4I2DA 3IT4B 3NHEB 1V49A 3V61A 2DWQA 3RAQA 2ZVNA 4YMMA 4DSIA 3TL5A 1UCVA 3N7RC 3VH3B 4UAWA 1L4DB 1V1PA 5AKLA 3NRWA 3ZNGC 2FCQA 3AI5A 3WA0A 5EWEA 3PV8A 1CJEA 3V7LA 1WJUA 3R66C 3WK5A 4DHJB 4B6JA 3NZ3A 2BCSA 3BZKA 1YN4A 9ICOA 2Y1IA 3VQIA 2XGPA 2WTFA 2JZ3B 4EEKA 4OCZA 3BYTB 2G5IB 4Y2VA 9ICEA 4C8MA 5ALRA 3GIIA 5JTIA 1DRGA 1PGXA 2KAJA 3U52E 9ICAA 4ZRKA 1NI3A 5BO4B 4RT2A 4DSKA 1KRPA 4B9MA 1GC7A 3W2DA 1MQ2A 4F5RA 5KT2A 4AYBF 1TKYA 3Q8PB 3PW5A 4CE6A 1S10A 1TAQA 2BZFA 4G3IA 1UT8A 1ZYQA 1L4ZB 2BDUA 1T5XD 2IZVB 2O6VD 2WQYB 3PHXB 4LDTB 1KFSA 2V1YA 4JMUA 4HWIB 1RYUA 3SD5A 2KQ4X 1X2IA 3Q2AC 2ASLA 4QNLA 4QZAA 5J2FA 2LMRA 4YSYB 2LM4A 1IPGA 1Z5SB 7ICGA 4YFKA 2DQNB 4DF8A 1KTKA 3HM6X 3ZVVA 3KYDD 1XSPA 3ICXA 3O13A 1RG6A 4GDLB 3C28A 3RNAC 4N6EB 1XCTL 1F44A 3OSNA 4WH4A 3ISCA 1L0YB 3DHGC 2WHEA 4IRDA 3NZSA 2W9AA 4Y2XA 4GOCA 3HRDD 1SSNA 3BK2A 2IJ0A 5KFIA 1PFDA 2N9KA 3Q14C 4QZEA 4ANVA 4RQMA 9ICJA 1GNUA 4M0WA 1DK2A 1U48A 3RI7C 2QMTA 4KX3A 4DS5A 1ZQCA 3T5HA 2CKHB 4AP9A 2KMAA 2GB1A 2ZCBA 1V38A 4M8NA 7ICHA 4M00A 3U2SC 2Y3AA 2NV3A 2ZJ8A 2XO7A 1B0XA 3DQVA 3N1YC 2ZIUB 3PSPA 3Q8CA 8ICVA 4W9GA 4M6WA 4YD2A 1LV5A 1BPYA 4DOCA 2AJQA 1AW7A 4Y2QA 3WKDA 1T0QC 3NJTA 4I2BA 2JEJA 1NK5A 1X9MA 4Y2YA 3RNCC 4US9A 2KDIA 2PE6B 2G06A 4XE0A 4J6IA 3OSPA 1WXAA 3QUQA 2L3ZA 1DOYA 2W9BB 2I9GA 2KQ7A 1TK0A 5CHFA 4QZFA 4KKJA 2HE7A 5G5GA 1IGCA 1S77D 3KH0A 1FM0D 3PO4A 2M4NA 2JWZA 4BWMA 3WK4A 3TEYA 5G5HA 1JMLA 1R4MI 4JK1A 1VRAB 2L52A 3L16A 3TFRA 2YMLA 3U30A 3F5AA 3PSFA 2IMWP 2DGZA 2W82A 4YMNA 1FO4A 4OZCA 2PKEA 2FAZA 2WB1C 2G5HB 2RDGA 4KIKA 7ICJA 3N9YC 1Z00A 2K9XA 3CYMA 1B9RA 4TUSA 3SENA 5D3DA 2F77X 2QIEB 1SEBD 2NBVB 4Y2SA 4MGIE 4C4VA 4LNKA 1WSPA 1H4RA 5FK9C 1SGHA 3HKZC 1FD6A 5CB1A 1N60A 4ED7A 1K50A 4ZYSA 5AKKA 1C7YA 3MGHA 3UI3A 4UB3A 3TFSA 3UIPB 1JCKB 3V60A 2F2AB 5JRTA 4TMAB 3WK6A 3HP6A 2Z0EB 2BYTA 2OEHA 4ECUA 3A4SC 3NASA 3GB1A 1V1OA 4ELTA 4KLLA 9ICBA 2CXYA 1M4VA 1N2XA 8ICJA 2LUEA 4M0WB 4NPNA 3K9PB 5HMLA 3QNMA 3EC8A 3KKAA 3M8RA 3C23A 1L3TA 3NUHB 7ICKA 2V4RA 3D2NA 1WWUA 1U9LA 1YZ6A 1ZQBA 3BYYB 4URKA 1GB1A 4K4GA 2E8MA 1PVPA 5D3IB 3Q3FA 1L7NA 3EPGA 4RF1A 5KL8B 4RQ3A 5KT7A 4DBGA 2CR5A 5EE1A 2EQYA 5DQGA 1TKDA 1RYSA 5IILA 1FEZA 1TKGA 4RT3A 2BWFA 3APCA 1FPYA 2GRIA 4O0IA 3LJ3A 1Z4NA 2WXQA 1KBUA 2QB0A 2PFOA 3H7PA 2Z59B 2DX5B 2KANA 5J2JA 3PRPB 4DFMA 4ITKA 4XWTA 4LNFA 4GFJA 5AI8A 4PGQA 5KFDA 1ZETA 5IINA 3I63C 2BB5A 3GFKB 2C28A 4BOZB 4DOBA 4DK5A 4R63A 4F5OA 1DOXA 4O5CA 2JEIA 3DBHI 8ICQA 3RNGC 1DGSA 3GIMA 3APDA 3SR6A 1YJ1A 2J4XA 2KX0A 4UARA 4QWEA 3ETLA 1WM2A 3SAHA 3OHAA 1V1PB 2MJ3A 1RQLA 1ZP0B 5HKHA 2MX2A 3B0AA 2K6DB 4KMUA 1AQ6A 3AEFB 3VTVA 3B9JA 4RFBA 1QLNA 3EWAA 3HIZA 4G0NB 4QW8A 4DLGA 3WANA 2Q4TA 4K1RB 1S3SG 1V9JA 2ZUDA 1Q3UA 2WB1F 1L3UA 5KG5A 2IA6A 1PGBA 1XO3A 2L83A 1D8LA 3PREA 4I2FA 3V7KA 4JB3A 5KFCA 3C19A 5DB6A 1D9FA 1K1SA 4KLJA 2I1QA 1ZJMA 4BBNF 2C7HA 2RP5A 5DCNA 2VZKD 3CSFA 2XY6A 3RAXA 2WHIA 3ONSA 3SDLC 1ZQLA 2D2QA 3ZDTA 1ZQ1C 3KWLA 1XSLA 4B0MA 2R8JA 2KIVA 4JWUC 4RPXA 3GV5B 4M01A 3QU9A 5FP0A 3KZIU 5DKWA 1XNSA 1J7BA 5IIIA 2K8CA 5AUKA 5AM4A 8ICRA 2L00B 5EE0A 3MR3A 2KZ3A 3Q8QB 2ZIWA 4RQ8A 5KT4A 1SE3A 1ZQTA 4EZ6A 1FNUA 4ANXA 4PPXA 2SEBD 2G0AA 3MGIA 2BW2A 5ALSA 3FM9A 1S97A 5DGBA 2N7EA 3VTWA 1NK4A 1D5ZC 4BWJA 5AI6A 5J0UA 3BY4B 2K60A 2AQ4A 3G6XA 4ECZA 1KFYB 4MHVA 1R4MB 2BPCA 2INDC 1STEA 2Y0SC 4B9LA 3V7JA 2ZNVB 4ECSA 5DBBA 1FMAD 5AK3A 4I27A 5DPWA 1MN8A 3P1MA 2D3BA 1XLPA 4GDLA 5ALEA 4A55A 4GXIA 2R8GA 5C23A 3MC8A 3IRUA 4ANWA 4D2KA 2H5XA 2ZIWB 2NTTA 1WGKA 2YMPA 4CF5A 4NLBA 1K52A 2YVCA 3JSVA 4DSEA 2G07A 2R8IA 3W1YA 3WCQA 2K6QA 3SV3A 2KVSA 3NVYA 4J9SA 3RZWC 5EE9A 1SB3C 9ICNA 2H3FA 4IM3A 3JPSA 1RDFA 3A9KB 3MC9A 2QSDA 4EE2A 4EBDA 3ZUNA 4HROA 5DQIA 2OH2A 4XDCA 3MP9A 2KDEB 4F7ZA 3O0FA 4C8KA 4LZDA 2LJ5A 4C00A 2M9NA 5ALFA 3DOWA 3VVWB 2PMZC 2JEFA 3ZKJC 1COOA 5KFVA 3AL0B 1PYWD 3I57A 3ZGZA 3M8SA 3L54A 5J0QA 5KHOA 4KLFA 4ZRPA 1L8OA 1QQ6A 4KLUA 1BGXT 3BQ0A 1TKEA 2WFAA 2BPSA 4KDIC 3PV1A 4QWDA 2DYBA 2L0FA 2RDHA 4F8CB 4FA6A 1Q0WB 4K81A 4PL2A 3BDPA 4UASA 2I1KA 1ZPSA 1BNPA 5L1MA 4GC6A 3DHHC 4WWOA 4DQOC 3OJSA 2GBRA 2INPE 4DWIA 2CS4A 1KL9A 2XY5A 2KMDA 2IGHA 5D4BA 1WGGA 2HOQA 4HEA1 4I6NB 3TEXA 3AULA 1BPDA 1LKYB 1WX9A 5KFGA 1FRRA 1S0OA 2GBKA 2X8XX 3PVLA 1AN8A 4RNOA 1RPLA 2DZMA 1KLVA 4XZ4A 4EENA 2FI1A 5J0OA 4OVVA 2KN5A 3J81j 5AKEA 3BWUD 3ONNA 5ALTA 2LBOA 4F92B 2D3CA 1P7EA 3RB6A 2JZBA 4YT0B 2RPVA 1JX4A 5HHHA 3DBHB 1JQ4A 3B2GA 4XA5A 1QZEA 2JV3A 4NJ8A 3M9MB 2YY6A 3PT2B 4TV3A 5IAAC 1QQRA 3L08A 3H7PB 2W9CB 8ICMA 1JWAD 5CJ7A 3IAS1 5C2TB 3PX4A 3ZTCA 5E6OA 3ZDEA 1HIWA 4NAMA 7ICSA 4WAFA 2BS4B 2YEPF 3L0WB 9ICHA 4UAZA 2DLBA 4GXJA 4KX6B 4M8MA 4TQRA 4Z6EA 4Z6DA 3FILA 4KGSA 1UA1A 1TS2A 2W54A 1QILA 3U8ZA 3OTQA 5KFYA 4I2IA 9ICVA 1TS4A 3LDAA 4A6QA 1ZXIA 3MBYA 4F93B 2FLNA 5KFJA 2G1EA 4ARCA 1ECWA 3P2BA 2FUG1 1SV0C 3PMNA 2KT7A 1CZPA 5LXIB 5DGAA 3MFHA 3ORYA 1V2YA 4RGMA 5J29A 9ICCA 3ZJTA 4YTMB 3KUDB 2IO3B 3C1YA 3RUIB 2HVHA 3SYZA 4ED2A 4M9HA 1TVAA 1JWSD 3I28A 5GTIU 4EBCA 1WXVA 1TY0A 5IO9A 5KFTA 1TZOA 2KKCA 1J2NA 3AN1A 5BYRA 2Y5CA 4UB2A 1H38A 4Q45A 2R8HA 3MJ5A 3N32A 2IHNA 3UQ2A 1F2RC 2IBIB 2EKEC 3E9SA 2A4ZA 1MG4A 1P98A 8ICOA 1WGYA 2AGOA 2KHWB 3DBRB 4WWPA 3TCAA 2KZMA 2FPKA 2WF9A 3G6VA 3OPXA 5H8YE 1L7PA 1QSYA 2H3ZA 2WU2B 3SQIA 1GUAB 3ENEA 1QF6A 2FUHB 3T3OA 2IOFA 2JMGA 2KDBA 3TACB 2E8NA 4Z6CA 3RJEA 2UWQA 3Q69A 2AL6A 3HILA 5AI4A 4F2SA 2Q5WD 2UVRA 1QSSA 3AECB 4P16A 1QQ7A 7ICQA 9ICTA 1Q3VA 2KC2A 1GOZA 3Q3NC 5IKCM 2BYVE 2KVRA 4YR0A 3P42A 4K4HA 2ZPNA 4QWBA 1ET9A 3NS1A 3U4EG 4RQNA 4HCNB 3B08A 4RQ2A 3LYYA 2MSNA 4S0RA 3EYZA 9ICGA 4RZRA 3R7QA 4AJWA 1NNLA 3KHLA 2BPFA 3ZXVA 3N30A 5FR6A 1MC8A 2KJ8A 2ZCCA 5KFQA 2EMTA 3R3MA 3EECA 2CU1A 1TBEA 3ZDMC 1WJ4A 1AROP 2LGSA 1QOBA 2JRHA 3MR6A 1YJIA 5AZFA 3D32A 1TFRA 4MGZE 2NO5A 3MDAA 2CHWA 3LVWA 1XEEA 1A6SA 3SD7A 4WWMA 2ZIXB 5EOZA 1N6ZA 1V9PA 3DVGY 1WE7A 5KHQA 3AV8A 2YMQA 1S8OA 1CI4A 1EM7A 2OOBB 2QB0B 4FFDA 1TGZB 1N56A 3PSEB 3ZNZB 1GG3A 3B2FA 4FADA 3ZO5B 4CGZA 4K3CA 2VA2A 4MSMB 1HJPA 2ZUBA 3PO0A 2LMCA 3OLMD 2BWES 1KFDA 1VZ8A 4NNJB 4BDPA 1Z2MA 4HPLB 4ZRIA 2JZPA 2KJHB 1WZ3A 1J97A 4I29A 2DUYA 2PEAA 1E0ZA 1XWLA 2BHNA 2BGFA 4HXDA 1ENFA 4FHJA 2BKRB 3V72A 3RZFA 4DSFA 4FJVB 5J8YC 4CNQA 5KFEA 7ICUA 4ZRQA 4USAA 3H1UA 2IY1B 1VLBA 4PHAA 2MJDA 4I2CA 2LRWA 4XGAB 4NAWB 9ICMA 2F1JA 2MW5A 5F9LA 1NJZA 4GIVA 2KWDA 5ALMA 4YWGG 1KEJA 2EDUA 2GBJA 2VIXA 4OJ5A 2KJ9A 3H0MB 2GOLA 2D07B 4OZBA 3GV8B 4K7SA 1ZQYA 1WFYA 4IL6U 4UB5A 1ZW7A 4DQSA 3PZ8A 4KLQA 4CYEA 1KJTA 3C2LA 3WKAA 2XBBC 3SI8A 1AWDA 4NM1A 1IV8A 4DL4A 5L1KA 4OJOA 4C4SA 5DBAA 1Z4OA 8ICCA 2INCC 3PRZA 1OQQA 4KIKB 1ET6A 2N4FA 3A9JB 2KTFA 1B43A 1NK7A 4PYUA 1DOQA 1TTNA 2A3VA 4Y2UA 3Q8MA 4ARIA 2JT4B 1L6NA 4DHJD 4IQUA 5KFZA 3QA8A 3I76A 1E7VA 4HJKA 1RFAA 2KN7A 4LLGM 1SWWA 2EAPA 4BGDA 1ZRMA 4MSQB 1EWCA 2NRTA 4IC7B 3DEEA 2N7JA 4LJXA 2NRXA 2HTHA 3C0RB 2KDMA 2KFZA 2KFNA 2P35A 2DPJA 4EX6A 5KFNA 2KDFB 1C77A 8ICBA 1Z00B 2FMPA 1PK1A 2K4PA 4I2EA 3H8HA 4TURA 3MR2A 3NZUA 2ZPYA 5ALUA 2LFIA 3ZTDA 1L8LA 3HVDA 4NJ6A 5CHVC 4KLHA 1P1AA 2R8KA 3GS2A 1G6JA 1BPZA 4YQWA 4KN7A 2AQ0A 4GXKA 2A1JA 1I4QA 2MQJA 1XT9B 4DCCA 3CMMB 3QHTA 2DFLA 3EZ5A 4UQGA 5KFSA 8ICHA 1VR9A 1V8CA 2DZKA 2KIWA 2LVOA 5AK6A 1E9MA 2WXIA 4GSWA 5KT6A 4EYHB 1XS9D 2WS3B 2ESEA 2F3NA 4QW9A 2AL3A 4DHZE 4N58A 4Q44A 2CHZA 3PLVA 5H2FU 3CIRB 1S76D 4MJSB 3C1ZA 1KRHA 1NJYA 1FEHA 3KOOA 3ECIA 4QJFB 2MBQA 4RQ5A 3CNHA 4CF3A 2W3RA 1KQQA 5AKHA 3OGUA 1B22A 3Q3JA 3MDCA 5HHIA 1JWUD 2H3VA 1VZ7A 1ZE3D 2K22A 4RGNA 5AK4A 3DWMA 5J17A 4BXOA 4O9MA 1N62A 3IDWA 1QH9A 4DQQA 3GOEA 1BVSA 3D6JA 2J6SA 4DLEA 1C76A 4TSSA 2R2OA 2MBBB 3RCZA 4XDDA 1RLFA 5J2HA 4F4YA 4G9BA 3MFGA 5CEHA 2W03A 4DO9A 4TQ1A 1F1HA 4BX9C 2HBLA 5KFWA 4GLXA 3SV4A 4KZCA 3CRXA 5KFHA 2DAJA 1YIWA 4BKGA 4BOSC 1S5LU 4W9JA 5AUIA 3QWZB 1P3QU 3KHGA 2PFNA 2WAQC 2BDPA 3AE1B 2D3AA 4YSXB 3KTQA 4HJGE 1ZQHA 1GB4A 4XQ8A 3DBRI 4KLDA 3JVZX 5FR3A 4Z6FA 4DQRA 1L5PA 3DDHA 2MWSB 1SV4A 3EPIA 1TS3A 3RF9A 3QU5A 5ALLA 1UGJA 4HKQA 3SEBA 2AWTA 4LJOB 4NJ7A 7ICNA 3AQFA 4EKUA 3L10B 2K4IA 4P1BC 4BZAA 1QOAA 5ALVA 2JX5A 1KOTA 3ETRA 1KLUD 1U4BA 1ZQMA 2QARA 5KFUA 2HOIA 2OEDA 2AEHA 2KNBA 1ZD3A 1BNOA 2VKQA 4YN4A 1ACCA 4KLSA 5HFYA 2L76A 2ZEQA 1ZD2P 9ICUA 5C5JA 1S9FA 1WY8A 2O6VB 3D2SA 3BQ2A 4LDTD 4DFJA 3VHTC 1A76A 4LK0M 1EXNA 3IG5A 5LLIA 4MFAA 1D6EC 2C5LC 2HBKA 1RAXA 2RR9A 3RR7A 1I4RA 4MJSA 3VFKA 4O3OA 1L0VB 2M0AA 4QZHA 1T0SC 4ICAA 4NZLB 5MPOA 5E6PA 2LUMA 2ZG6A 5HHDG 3N1XC 2EZXA 1SL2A 1UBIA 2DL0A 1D8YA 2CHXA 4WQMA 1T4GA 5EWGA 3P63A 5DB8A 3PY8A 1ZDXA 2JRIB 3N20C 2BTEA 4BXOB 4DHZB 3DHIC 9ICWA 2ASDA 2O2VB 2BF8B 4RGTA 2VJ4A 3MABA 2HHSA 4R66A 4FBTA 2HTME 3N28A 3PTFC 3DBSA 3RD2A 1GJZA 1L0XB 3RRHA 2W8KA 5GXGB 8ICPA 1AYFA 2F8KA 3E58A 4F50A 4JV2A 2D3DA 4IWPA 2HJ1A 3AB5A 1LFDA 1SXEA 2GOWA 1K8RB 4IOIE 2VH2A 3Q6BA 7ICVA 1JUDA 2HHVA 2BCUA 3N7PD 2V3SA 4PZNA 4HDOA 4C56C 1XO1A 1YX5B 1T0RC 4F91B 4P6VF 2MEKA 3BJYA 5DPTA 4RF0A 3IP4B 3ZRCA 3RULA 4UB1A 3UM9A 4Q2JA 2O2VA 3BVGA 1E5WA 2F1HA 2INNE 3M6ZA 5BYSA 4JLCA 1NDDA 2KICA 1J2MA 2KVCA 9ICQA 1JALA 2ACZB 2J42A 3TQ1A 3AU5A 1C20A 2ATLA 3AE8B 2W11A 4QZCA 4RQ7A 4UBCA 3AEVA 2ON8A 2WX0A 3HM3A 3IT6B 1WWVA 5BMHA 1ZJNA 1WXSA 2W43A 1WX7A 2PVGC 4J9OA 1L7OA 3H9DA 4IM2A 2MA9B 1CUKA 2M8SA 2KEYA 4E0DA 3ML9A 2OCEA 1FXIA 1O03A
chains in the Genus database with same CATH topology
1KF6B 1N5WA 1CK1A 1PYWD 1YQ3B 3I57A 3ZGZA 3GP7A 4GLSC 2ZW1A 3R2TA 4ZRPA 3U7ZA 1BXTA 1L6VA 2I38A 1MVKA 2QILA 4RNAA 4WURA 1TKEA 1OFFA 2RDHA 2PKOA 1YN5A 1FFVA 3CWIA 1WWTA 2VZKB 3I9V1 3NVWA 2IDYA 1ZPSA 4FXCA 3Q8EA 4HKZE 4L1BA 4DQOC 1XLNA 2INPE 1HEZE 5E6JA 1V97A 3W5VB 2IGHA 4MM3B 4HEA1 3TEXA 2GI9A 1C4CA 2MJEA 2WP9B 3P4PB 2IPKD 1FRRA 4B0EA 2H89B 2AQ2B 2OHFA 1NEKB 1AN8A 1QOFA 4YXDB 1N61A 2M56B 4JE3B 2AX5A 2JQRB 4A8XC 1XLQA 3IXSA 1HXYD 3BWUD 3ZQ4A 3ZJVA 2PW9A 3DWGC 1P7EA 2WXOA 3AEDB 3MC0B 3KQ4A 4YT0B 1UWMA 2RPVA 3KWVA 5HG2A 3AE4B 3W5UB 1JQ4A 3B2GA 1IBXA 2PIAA 1E10A 3P4SB 1QQRA 2IGGA 2WDRB 3PZ7A 2CU3A 3BVZA 4TQ0A 4GDKB 1E7PB 1HA5A 2J53A 1EU4A 1JWAD 2DYOA 2J52A 2JYTA 1MI0A 1XLOA 3IAS1 1BUIC 5C2TB 3AE7B 1MPEA 3SFDB 1SBBB 1YQ4B 3EUB2 4NAMA 2TSSA 2WDVB 1N5XA 2BS4B 2LHEA 2LJIA 2N9LA 4WAFA 2YEPF 1FIQA 2DLBA 4KX6B 1C78A 1Q10A 3AH7A 4NJCA 3FILA 4KGSA 1TS2A 5FKAC 2W54A 1QILA 1SJHD 1VZ6A 1QLBB 5H92C 1TS4A 3AE9B 3ZJUA 3RFZB 2WU5B 4C7ZA 4US8A 3P4QB 4LTUA 4A6QA 1ZXIA 2MH7A 3MHZA 1ESFA 2WXRA 2G1EA 3T3NA 4YTNB 3FC4A 1YJJA 4ARCA 2FUG1 1CZPA 3VR8B 2JXTA 3ABVB 3Q8BA 2RMMA 4RGMA 4MACA 1K51A 3ZJTA 1ZXHA 4OHJA 4YTMB 2KACA 3AE6B 3R8BA 1TS5A 1T6BX 2JYEA 2HDEA 1RWSA 1JWSD 1NYQA 1TY0A 3E56A 1LO5D 1UNSA 2SAKA 4RH6A 1IUEA 2I2YA 1IGDA 2FBWB 1TZOA 3AEAB 1BMLC 3RPFC 3AN1A 5BYRA 1MHHE 1NVID 2Y5CA 3BK1A 1EU3A 3MJ5A 4REZA 3FILB 1FFUA 1F2RC 1SXTA 3E9SA 4KGTA 5BMGA 2G9HD 4IKGA 4OZAA 1SJED 4IDIA 5JXVA 3C8YA 4C7YA 5H8YE 1XF5L 2R61A 2WU2B 3LB8C 4H2AA 3W9CB 2BT6A 1QF6A 3T3OA 1C4PA 1SF0A 2QEJC 4AS1A 2K5PA 3Q69A 2BB6A 2Q5WD 3AECB 1ROEA 1KLGD 3IT4B 4P16A 4A90A 2DWQA 1GOZA 3AMZA 2D5GA 3P42A 1KH0A 2DYMA 1WYGA 1ET9A 3NS1A 3Q8FA 3U4EG 4DXFA 3LYYA 1HZ6A 1I4GA 1L4DB 1SIJA 1HZ5A 1V1PA 4DXGA 1PGAA 3AM9A 1CJEA 4MH8A 4CQNA 3NZ3A 1SE4A 1QOBA 1YN4A 3OWEB 1I4XA 1JWBD 1YJIA 3VQIA 3BIID 3HVZA 2L32A 3BYTB 1XEEA 2V3PA 2WNMA 4WWMA 1PGXA 2KAJA 3U52E 4ZHPA 1NI3A 1RYJA 4OVZA 4JPSA 3AV8A 1EM7A 3W2DA 1TKYA 3LXFA 1C4AA 1D4BA 3NVZA 4C80A 3AEBB 3B2FA 3P4RB 1NENB 2WXKA 3BZDB 1JWMD 1L4ZB 1T5XD 2LMCA 2WQYB 3PO0A 2BBCA 1QT9A 1VZ8A 2KQ4X 4HRSA 2JZPA 1R7SA 4YSYB 3AEEB 2PTLA 1Y56A 1E0ZA 1IBXB 1ENFA 1KTKA 5TSSA 2V4IB 2V3NA 3O13A 4GDLB 1FCLA 4ZRQA 3W1SA 4USAA 2WDQB 4N6EB 1XCTL 1VLBA 2MJDA 4WH4A 3VRBB 1L0YB 1T3QA 4ZOHC 3HRDD 2FE8A 1SSNA 3BK2A 2IJ0A 4NAWB 1PFDA 2N9KA 1SE2A 2KMMA 4A9AA 2KWDA 4WIPA 4YWGG 1F0ZA 4M0WA 2Z8LA 2BS3B 2QMTA 1DYQA 4OZBA 2DBYA 2JWUA 1I4PA 3PZ8A 2GB1A 2W55A 2LEKA 1ZOYB 3AE3B 2BS2B 1J7CA 3SFEB 3U2SC 2LHDA 2Y3AA 1AWDA 1JW9D 3KLSX 1D5XC 3AE2B 4YSZB 1OQQA 3Q8CA 1ET6A 4JX1C 1AW7A 4ARIA 4L2YA 4L23A 1FNVA 1PDXA 1DGJA 2E3TA 4US9A 3V3XA 4LLGM 3VR9B 4J3OD 1E6EB 1EWCA 4XE0A 1DOYA 2N7JA 4O1NA 1PUTA 2KDMA 4KKJA 5C3JB 1F2RI 5G5GA 4MT5A 1IGCA 1C77A 3IAM1 1FM0D 1C9FA 3TEYA 5G5HA 1JMLA 1VRAB 1NYRA 2L52A 1ZUD2 1FCCC 1YMHE 3H8HA 2W82A 1FO4A 2WXJA 2WXPA 4OZCA 4KGRA 2LFIA 2RDGA 3HVDA 3N9YC 2K9XA 3GS2A 3J9CA 4RGOS 1B9RA 1QKZA 1I4QA 5D3DA 2QIEB 1SEBD 1I4HA 1VR9A 3TEZA 2NTSA 1WSPA 5FK9C 1V8CA 3AEGB 1E9MA 2WXIA 1FD6A 1VJKA 2WXMA 1N60A 1K50A 4UDUC 2WS3B 4ZYSA 3UI3A 2EKIA 2V0GA 5EE3A 1JCKB 4TMAB 4N58A 2BYTA 1F77A 4N59A 1XXGA 3GB1A 5I4DA 1V1OA 3CIRB 1M4VA 2W3SA 1KRHA 2QJLA 1FEHA 3R2IA 2W3RA 3NUHB 3BYYB 3Q8AA 1GB1A 1JWUD 1VZ7A 1YNTE 1ZE3D 2K22A 1JRPA 5D3IB 4RGNA 3DWMA 3V05A 2X38A 1N62A 2WXFA 4RF1A 1TYGB 3BVMA 5EE1A 3TEWA 3HUIA 1C76A 1TKGA 4TSSA 3URYA 1WRIA 4XDDA 2GRIA 2WXQA 3MFGA 1YN3A 3NRZA 1OQRA 1TJEA 4R3DA 4TQ1A 1D5MC 1FXAA 2L1AA 4ITKA 4XWTA 3TSSA 2PMVA 5AUIA 2BB5A 1FNWA 1UWXA 2WXNA 2K0PA 1DOXA 3AE1B 4YSXB 4HJGE 1GB4A 3L4PA 1L6UA 3SR6A 3TUOA 1TY2A 2J4XA 2WXLA 5D7GA 5HI1A 5FR3A 1V1PB 2MJ3A 1ZP0B 1L5PA 1TS3A 2AQ3B 3AEFB 1C79A 3B9JA 4RFBA 1UGJA 4AQ7A 4HKQA 3SEBA 2ONQA 2E6XA 1J7AA 1P7FA 5BMIA 1QOAA 1GAQB 2ZW0A 2JX5A 3AE5B 3ETRA 1KLUD 2CJNA 2XN9C 2OEDA 3ZYYX 1I7HA 1PGBA 5BYQA 1XO3A 2L83A 2PVOD 2PLPA 1FRDA 1ACCA 1B1ZA 5HFYA 3FAHA 2WXGA 4ZHOA 1UUPA 2H88B 2VZKD 4LK0M 1D6EC 2M19A 3KWLA 4B0MA 4JWUC 1DOIA 1I4RA 1J7BA 1L0VB 2M0AA 5MPOA 4NZLB 5AUKA 1K53A 2EELA 2LUMA 5HHDG 4WQMA 5EE0A 4YTPB 3P63A 1ZDXA 2XNAC 4JWSC 4KKIA 2BTEA 1SE3A 2ICIA 1FNUA 4RGTA 1WXQA 2SEBD 1EWYC 2YEPB 2HTME 2JSVX 2BW2A 3EGRA 2JU6X 2AQ1B 2NMQA 1QOGA 2KN4A 1L0XB 5GXGB 1D5ZC 1AYFA 1XCQL 1GPXA 1N63A 1KFYB 2K3UA 2WXHA 3AB5A 2CJOA 1A70A 1RFKA 1STEA 4IOIE 1FMAD 3P1MA 4PT5A 1XLPA 4C56C 1CQVA 4A55A 3VRAB 4P6VF 2MEKA 4D2KA 2NTTA 1RM6C 2B76B 2N0SB 4RF0A 1WGKA 4Q2JA 3BVGA 1K52A 5BYSA 2INNE 4OW0A 3EA6A 1VDVA 5T8IA 3WCQA 2Y5PA 5LNK1 3NVYA 2J42A 1JALA 1MHXA 2ACZB 5EE9A 1SB3C 2IGDA 3AE8B 2ON8A 3IT6B 5BMHA 3NVVA 1ZDVA 2QSDA 4EE2A 1JROA 2WLBA 4RCOA 4HROA 2PVGC 4XDCA 3MP9A 1HQRD 2LGIA 1FXIA 4XWWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LEK A;  2W55 A;  1NYQ A;  1DOX A;  1ZOY B;  3AE1 B;  3AE3 B;  4YSX B;  1IUE A;  2BS2 B;  1KF6 B;  3L4P A;  1N5W A;  3SR6 A;  1J7C A;  1L6U A;  1YQ3 B;  2FBW B;  3AEA B;  3RPF C;  3AN1 A;  3SFE B;  2MJ3 A;  1AWD A;  1JW9 D;  1NVI D;  1L5P A;  1ZP0 B;  2Y5C A;  3AE2 B;  4YSZ B;  3AEF B;  1FFU A;  1OQQ A;  3B9J A;  1L6V A;  4JX1 C;  1J7A A;  1TKE A;  1OFF A;  2PKO A;  1FFV A;  3CWI A;  1WWT A;  4IDI A;  1PDX A;  1QOA A;  1GAQ B;  1DGJ A;  4C7Y A;  2JX5 A;  2E3T A;  3NVW A;  3AE5 B;  2WU2 B;  5H8Y E;  3ETR A;  4US9 A;  3LB8 C;  2CJN A;  4FXC A;  3VR9 B;  3W9C B;  2BT6 A;  3ZYY X;  1I7H A;  1QF6 A;  1E6E B;  1XO3 A;  2L83 A;  1SF0 A;  2PVO D;  2K5P A;  1XLN A;  1FRD A;  1DOY A;  2Q5W D;  3AEC B;  1ROE A;  3FAH A;  1V97 A;  1PUT A;  3W5V B;  4ZHO A;  2DWQ A;  5C3J B;  3AMZ A;  2H88 B;  5G5G A;  2MJE A;  2WP9 B;  3P4P B;  1WYG A;  1FRR A;  3NS1 A;  1FM0 D;  2H89 B;  2OHF A;  1NEK B;  2M19 A;  5G5H A;  1QOF A;  1NYR A;  1N61 A;  2L52 A;  1ZUD 2;  3KWL A;  4JWU C;  1DOI A;  2M56 B;  4YXD B;  5AUI A;  1SIJ A;  1J7B A;  1L0V B;  1FO4 A;  2AX5 A;  5MPO A;  2JQR B;  5AUK A;  1XLQ A;  3AM9 A;  1CJE A;  2K9X A;  3DWG C;  3AED B;  4WQM A;  1B9R A;  5EE0 A;  4YTP B;  4YT0 B;  1UWM A;  3P63 A;  1QOB A;  2QIE B;  3AE4 B;  4JWS C;  3W5U B;  3B2G A;  1JQ4 A;  1JWB D;  1YJI A;  2PIA A;  3BII D;  1E10 A;  1WXQ A;  3HVZ A;  1V8C A;  1EWY C;  3AEG B;  3P4S B;  1E9M A;  2HTM E;  1VJK A;  2WDR B;  2CU3 A;  4WWM A;  2KAJ A;  1N60 A;  1QOG A;  2WS3 B;  1E7P B;  4ZHP A;  2EKI A;  1NI3 A;  1RYJ A;  5EE3 A;  5GXG B;  1JWA D;  3AV8 A;  1AYF A;  4N58 A;  1N63 A;  1GPX A;  1TKY A;  1XLO A;  3LXF A;  5C2T B;  1KFY B;  3NVZ A;  3AB5 A;  4N59 A;  2CJO A;  1A70 A;  4C80 A;  1RFK A;  3AE7 B;  3AEB B;  3B2F A;  1NEN B;  3CIR B;  3P4R B;  2W3S A;  1KRH A;  3SFD B;  1FMA D;  1YQ4 B;  2QJL A;  3EUB 2;  2WDV B;  1N5X A;  2BS4 B;  2WQY B;  3P1M A;  3PO0 A;  1XLP A;  1FIQ A;  2W3R A;  1QT9 A;  4KX6 B;  3VRA B;  4HRS A;  3AH7 A;  4P6V F;  1R7S A;  4YSY B;  2W54 A;  2K22 A;  1JRP A;  1RM6 C;  2B76 B;  2N0S B;  1WGK A;  3AEE B;  3DWM A;  1E0Z A;  1QLB B;  5H92 C;  3AE9 B;  1N62 A;  2WU5 B;  1VDV A;  4C7Z A;  4US8 A;  1TYG B;  3P4Q B;  1ZXI A;  2MH7 A;  4LTU A;  3WCQ A;  5EE1 A;  2G1E A;  4YTN B;  3FC4 A;  4USA A;  1YJJ A;  2WDQ B;  3NVY A;  4N6E B;  1VLB A;  1JAL A;  2ACZ B;  2MJD A;  1TKG A;  1CZP A;  3HUI A;  1SB3 C;  5EE9 A;  3VR8 B;  1T3Q A;  4ZOH C;  1WRI A;  3ABV B;  3VRB B;  3HRD D;  3AE8 B;  1PFD A;  4YTM B;  3NRZ A;  1OQR A;  3NVV A;  1TJE A;  2KMM A;  4A9A A;  1JRO A;  2WLB A;  1FXA A;  4HRO A;  4ITK A;  2PVG C;  3AE6 B;  1F0Z A;  2BS3 B;  1RWS A;  2DBY A;  1FXI A; 
#chains in the Genus database with same CATH topology
 1SXD A;  3THV A;  2FLP A;  3C21 A;  3JPT A;  2R18 A;  1CK1 A;  4DDI D;  3SZ2 A;  4ICU A;  1WYW B;  4MF8 A;  2H3Q A;  3GP7 A;  3TAN A;  4TUQ A;  4TKN A;  3X0W A;  3UMG A;  1P0R A;  3H7S A;  1WRD B;  2CN1 A;  1HE8 A;  1S0M A;  1UGM A;  4DL3 A;  5AZH A;  2MUT B;  2MRL A;  4C8N A;  2QIL A;  1QSL A;  1TT5 B;  4KIT B;  3M6K A;  1FFV A;  1SZH A;  1YT3 A;  5KFF A;  4FO6 A;  2PFQ A;  4MM3 A;  4G3X B;  2HHQ A;  2KMC A;  4FXC A;  2FMQ A;  3Q3M C;  5J0X A;  4HKZ E;  4L1B A;  4EZK A;  2NO4 A;  5J2D A;  2XCA A;  2IO2 B;  2N9X A;  1ISN A;  2KD1 A;  3VUY A;  1WF9 A;  3W5V B;  3QEB Z;  2BCR A;  2MJE A;  2WP9 B;  2KHQ A;  5KFK A;  4B95 A;  2MP2 A;  3BQ7 A;  5KG0 A;  2H89 B;  7ICL A;  2AQ2 B;  4J9K A;  3F2B A;  3B1L X;  1NEK B;  1ZD4 A;  4B9N A;  4AYB C;  1ZQJ A;  3K9O B;  3UQB A;  2KKP A;  3HKZ F;  2M56 B;  3C29 A;  4FUL A;  2K8B B;  4EEY A;  2WF6 A;  2JQR B;  3LYS A;  2ZIU A;  3RH6 A;  3ZJV A;  1ZQE A;  1ZQK A;  2CRX A;  3MC0 B;  1NK8 A;  2AH5 A;  4O3M A;  2ASQ A;  1HUO A;  2RGF A;  4QZI A;  3UMB A;  4XUS A;  3DVN V;  2IGG A;  5AEK B;  4YP3 A;  4W9I A;  3PZ7 A;  2CU3 A;  2FNJ B;  1E8W A;  4KSL C;  4IRC A;  4GDK B;  4P0Q A;  1E7P B;  1HA5 A;  5ALK A;  4C8O A;  3H40 A;  2J52 A;  2JYT A;  4ZYN A;  4IWQ A;  4C4T A;  2EZY A;  3WAM A;  2Y0S F;  4M2Y A;  5KFX A;  3AE7 B;  4KLT A;  4YMO A;  1YQ4 B;  5KFP A;  4U7C A;  2TSS A;  5B66 U;  2JR5 A;  1NZB A;  4RPZ A;  1FIQ A;  4I2H A;  8ICU A;  1KW4 A;  1GO3 F;  2YN4 A;  4N9F 4;  4DFK A;  1ZOL A;  2CPR A;  5HMM A;  4PH5 A;  5FKA C;  4EUT A;  1SJH D;  8ICX A;  2W9N A;  3AE9 B;  3RH5 A;  3P4Q B;  2ZZP B;  2HSZ A;  3MHZ A;  1ESF A;  3T3N A;  1YJJ A;  3IV6 A;  5AI5 A;  2BKE A;  1ZQR A;  2J6U A;  2G4S A;  3VR8 B;  5KFA A;  4IR1 A;  2JXT A;  2Y9T A;  2LI6 A;  2RMM A;  3RFA A;  4GXB A;  1KLN A;  4P4P A;  3NTU A;  5KNI A;  2PI5 A;  1IYF A;  4DDG D;  4ED1 A;  3R8B A;  5AKY A;  4NLZ A;  2O6V A;  3V6J A;  3PX6 A;  2JH1 A;  3QJZ A;  2HDE A;  3PSI A;  5ALJ A;  1EO6 A;  1OEY J;  2G09 A;  2C9W B;  5KFL A;  4B9V A;  2LGY A;  2SAK A;  3NY5 A;  2BGW A;  4BVU C;  1X40 A;  4TQS A;  1SE9 A;  4RM8 A;  3RPF C;  3SMV A;  5J2G A;  4MDK E;  4P1C C;  5AI0 A;  1MHH E;  7ICP A;  2NRZ A;  2UVW A;  3AU2 A;  3ZIM A;  5J0R A;  1YOV B;  5IA7 A;  4REZ A;  5DQH A;  3FIL B;  4JQW C;  4HK2 A;  3GE8 C;  4KGT A;  1QQ5 A;  2KFK A;  5BMG A;  4AJY B;  5AKI A;  2G9H D;  3APF A;  1VJ5 A;  2WF7 A;  3DBL I;  1UA0 A;  4IKG A;  4OZA A;  2K1F A;  4P0P A;  1XQQ A;  2KZZ A;  1XF5 L;  2PJH A;  2R61 A;  1F5S A;  2YMM A;  2MHJ A;  3W9C B;  1HTQ A;  4K4I A;  2BT6 A;  1T94 A;  2QB1 A;  1C4P A;  2QEJ C;  2KJ6 A;  4ACF A;  2K5P A;  2BYE A;  5F9N A;  1KLG D;  3CST A;  3BQT A;  4I6L B;  3AMZ A;  4XYC A;  2IHM A;  4PS7 A;  3LWL A;  2D5G A;  2VH1 A;  1KH0 A;  2DYM A;  1WYG A;  4OJL A;  3UMC A;  3QK0 A;  5G55 A;  3TJP A;  4IR9 A;  4B9T A;  4M9J A;  5HP4 A;  5HR7 A;  1I4G A;  3A4R A;  3RNE C;  1XC9 A;  1HZ5 A;  5J2R A;  2OJR A;  1S1Q B;  1PGA A;  2ZUC A;  1P9D U;  2ZIV A;  2RPQ A;  4P0P B;  3TAP A;  1FXT B;  1PUZ A;  1A0P A;  4DOA A;  4CQN A;  3RJK A;  4KN4 A;  1SZP A;  2GWS A;  1SE4 A;  2IO0 B;  4DSL A;  3PZP A;  2UVV A;  1I4X A;  4K7U A;  2FDR A;  3HVZ A;  2L32 A;  2M1M A;  1ZQU A;  4HYK A;  2V3P A;  5KTQ A;  4ZHP A;  1O08 A;  3WK7 A;  1WZ0 A;  2G4D B;  1RYJ A;  4OVZ A;  2E5S A;  2L05 A;  2DZJ A;  4JPS A;  4IW0 A;  3CP8 A;  1D4B A;  3NVZ A;  2V4Q A;  2AGP A;  2KWV B;  4WJO A;  2PPH A;  3P4R B;  4ANU A;  4EZL A;  4FHK A;  4FBU A;  3I1Y A;  8ICN A;  1JWM D;  3BZD B;  4J9L A;  4W9L A;  2BBC A;  1PVQ A;  1QT9 A;  3RJG A;  2KK8 A;  1UBQ A;  3LWM A;  1R7S A;  4KLE A;  2PTL A;  3PML A;  1Y56 A;  3QCA A;  9ICK A;  5TSS A;  1X9X A;  2ZJA A;  2V4I B;  2V3N A;  4C4V B;  4ELV A;  1L7M A;  4ELU A;  4F3O A;  4M0A A;  3N3K B;  3UF8 A;  1NKC A;  4IQW A;  3W1S A;  3MC1 A;  2KFK B;  2XC9 A;  3VRB B;  5AKG A;  5DDY A;  4NL9 A;  2N1W A;  1T3Q A;  4ZOH C;  1IM4 A;  3IG3 A;  3T5K A;  3S6J A;  2QLT A;  2XY7 A;  2KMM A;  4A9A A;  2KTR B;  4WIP A;  2P66 A;  5CX3 A;  3IHQ B;  2Z8L A;  4A3P A;  3DVG X;  1WIA A;  2W55 A;  2Y9U A;  4J03 A;  4QIW F;  4ECR A;  1PK1 B;  1OEY A;  4ZRJ A;  4BKS A;  5E79 U;  2RRD A;  2IBK A;  4HCP B;  1VD2 A;  5JZE B;  4AP4 C;  3GZN B;  5J2A A;  1SIF A;  5J8Y A;  1JW9 D;  2QDF A;  1D5X C;  5DPS A;  1IXR A;  8ICT A;  2Q0Z X;  3OG5 A;  4GIB A;  4MEM A;  2BQR A;  4GC7 A;  1UF0 A;  3LDZ E;  8ICZ A;  2ZNV C;  4L23 A;  4E71 A;  1DGJ A;  4MEY A;  2E3T A;  2LZ6 A;  4R8U A;  5ALX A;  2HMX A;  1BPE A;  4JV0 A;  3QYP A;  2W9M A;  5DLG A;  5DDM A;  7ICO A;  2IYD B;  3L3F X;  3OJU A;  3H4B A;  2J7Q B;  3WKE A;  3KYC D;  4U6P A;  4LNN A;  4O1N A;  1PUT A;  1C1Y B;  2B0C A;  2RLT A;  4FZM A;  1F2R I;  4MT5 A;  2LI5 A;  3ZRF A;  3IAM 1;  2E8P A;  3B0Y A;  4C8L A;  1C9F A;  4QAY A;  3SHQ A;  2F1I A;  3R7R A;  1NYR A;  1ZUD 2;  1Y88 A;  1U45 A;  2LKY A;  2BKF A;  3DV9 A;  1WGD A;  1T8E A;  2WXJ A;  3F2D A;  4ICV A;  2K8H A;  4KGR A;  4UAU A;  1LKY A;  1WUD A;  4GB9 A;  1PZN A;  2L5Y A;  3WAL A;  1D8B A;  4RGO S;  1QKZ A;  3Q8R B;  3DPD A;  5DBC A;  2KD0 A;  2KLC A;  2BQ3 A;  1L5U A;  2K25 A;  2JY6 A;  1L7Y A;  2VJ5 A;  3L5K A;  3TEZ A;  2W9B A;  3TAD C;  1Q1O A;  3AEG B;  4HPP A;  4OJ6 A;  5J0P A;  3JPR A;  2W7P A;  2P6R A;  1ZQP A;  3H0R B;  4UDU C;  3ISD A;  2VRR B;  4O5E A;  1NJX A;  5KG7 A;  5EE3 A;  2V0G A;  2OJW A;  2C7N B;  7ICI A;  5DB7 A;  1V6E A;  4OO1 J;  1C3T A;  3WK8 A;  4A20 A;  3PNC A;  4N59 A;  1XXG A;  4RQ1 A;  2HCF A;  2W3S A;  2HW3 A;  4GGQ A;  4RMA A;  3UIN B;  2BCV A;  4DL5 A;  2KTQ A;  3T79 A;  1V5T A;  2KX3 A;  2V4L A;  3M62 B;  3R2I A;  4BKT A;  2MSE D;  3ALB A;  2PMZ F;  2K8A A;  2ZTE A;  2K89 A;  4DL6 A;  3V05 A;  4F4Z A;  1QCK A;  2XID A;  4XX5 A;  2X38 A;  1EF5 A;  2WXF A;  3MTN B;  2KWC A;  3AXC A;  5L1J A;  2RD0 A;  3ML8 A;  3TEW A;  1PQS A;  4UAY A;  1M6Y A;  3A0B U;  2GO7 A;  3ZD8 A;  4R3D A;  1SKR A;  1TJE A;  3WU2 U;  4CRX A;  2WAQ F;  4YXJ A;  3TAQ A;  4DFP A;  2L1A A;  3VTU A;  2XI9 A;  3B0X A;  3VH4 B;  2PMV A;  4RNM A;  3GIL A;  2KYW A;  4E74 A;  1FNW A;  4KV2 A;  2MRP A;  5F3X B;  5AK5 A;  1E8Y A;  3L4P A;  3TUO A;  4F4W A;  5D7G A;  3NUQ A;  3PGE A;  3M63 B;  4NM2 A;  1SV0 A;  2PFP A;  1S0V A;  2AQ3 B;  4NY8 A;  3NS8 A;  3V6E B;  1OXJ A;  4RQ6 A;  1J7A A;  3C2K A;  4YG2 A;  4MEL A;  3RH4 A;  9ICR A;  1F0M A;  3KW5 B;  2A19 A;  4NAW A;  4I2J A;  1WR6 E;  4DWF A;  3AE5 B;  2QC8 A;  4DEZ A;  2KHV A;  2KQS A;  4DFD A;  5J2K A;  2CJN A;  3ZDA A;  2XN9 C;  4CHK A;  5D49 A;  3ZYY X;  4BFR A;  5BYQ A;  3HWT A;  3I5J C;  4NLK A;  5ALD A;  4WAA A;  4F72 A;  2KE7 A;  2WF5 A;  1B1Z A;  2KKV A;  2KWU B;  3AQE A;  4ZHO A;  1KTQ A;  2NRV A;  5KFO A;  7ICM A;  2E8O A;  2H88 B;  3V62 A;  3RN9 C;  2EZZ A;  2REX A;  3GZN I;  2LGD A;  5ALP A;  3HX0 A;  3HHM A;  1KKX A;  2M19 A;  1PK3 A;  5KFR A;  1V81 A;  3BS7 A;  4KLO A;  3BZC A;  2YQE A;  3I3T B;  1K53 A;  3KUC B;  1X1M A;  2EEL A;  1WCL A;  1Z3E B;  3UXN A;  1Z19 A;  1UD7 A;  1LVH A;  2RHF A;  3GZF A;  3HJE A;  4P2H A;  2W7O A;  2J0K A;  2FCN A;  1ZQW A;  5CWR A;  4DS4 A;  2XNA C;  2D8C A;  4KKI A;  3L17 A;  4PZO A;  2LYA A;  4QZB A;  3JPP A;  1E8Z A;  2ICI A;  3VCB A;  2FCS A;  5J0W A;  1EWY C;  3JSV B;  3Q8S B;  3UGB B;  2YTU A;  2JSV X;  3QC8 B;  4MGY E;  1DXS A;  2JU6 X;  2AQ1 B;  5EWF A;  2NMQ A;  2O6K A;  3QZ8 A;  2KN4 A;  2C2D A;  2C60 A;  4O3R A;  2RDB C;  1XCQ L;  3W1S C;  5CTR C;  1N63 A;  3D2Q A;  2OXO A;  5D46 A;  1UH6 A;  1L3S A;  2DAF A;  4CO7 A;  4R64 A;  2WXH A;  5DB9 A;  1RFK A;  5L83 A;  4IWO A;  3IBE A;  1V86 A;  5J2B A;  4ED8 A;  3K1Z A;  1NKE A;  4JWN A;  2JVC A;  4NLC A;  3VRA B;  1JRU A;  1MSW D;  3A33 B;  1YD8 U;  3MJW A;  5AZG A;  3JPN A;  3T3F A;  3OHB A;  4BAX A;  4LNI A;  2JF5 A;  2RSU A;  4OW0 A;  1VDV A;  3L13 A;  2VA8 A;  1XSN A;  2KFJ A;  4WWN A;  3ZNI D;  5LNK 1;  3K75 D;  3H8M A;  2HHT A;  4A8E A;  2YB4 A;  2FID A;  1EUV B;  3M95 A;  2IGD A;  4W9E A;  1JIH A;  2LRU A;  4FBJ B;  2KZR A;  1DK3 A;  2KP7 A;  3NVV A;  2ALZ A;  1L2N A;  8ICE A;  8ICK A;  1JRO A;  2BCQ A;  1MJD A;  2WLB A;  3RNF C;  8ICW A;  4RPY A;  2DKX A;  2EAN A;  1ZQS A;  3ZI4 A;  5AI9 A;  1HQR D;  4J9P A;  2GBM A;  5LXH A;  2BR0 A;  4XWW A;  3H4D A;  5IIJ A;  1HTO A;  2LM1 A;  4NQK E;  4Q8E A;  1OGW A;  3NG0 A;  1KF6 B;  2N1V A;  1N5W A;  4KVG B;  3C5G A;  4PHE A;  4GLS C;  2Z7J A;  2ZW1 A;  3SU8 X;  1H8C A;  3R2T A;  2QCZ A;  3JYU A;  1BXT A;  1ZQQ A;  3GV7 B;  4FLH A;  1MVK A;  5TIS U;  3RMK C;  3A0H U;  4UAT A;  2K8C B;  3PW7 A;  2PKO A;  3QQ8 B;  2HOF A;  2A5U A;  2VZK B;  3I9V 1;  4KLM A;  3M9O B;  4NLG A;  4DF4 A;  4G50 A;  3BS5 A;  1J0G A;  4ECY A;  4RUC A;  4ED0 A;  5E6N A;  1K1Q A;  2L8J A;  2E1E A;  4Y2T A;  3V6K A;  1NK6 A;  4XRH A;  1V97 A;  4IC9 A;  4QWA A;  4B9S A;  4MM3 B;  3ZXR A;  1SKS A;  1T7P A;  2GI9 A;  5KT5 A;  4PGX A;  3TAD A;  3P4P B;  2IPK D;  4W9F A;  4M04 A;  3H7I A;  2E1F A;  5AM5 A;  3U26 A;  4RNN A;  2LXC A;  5J2I A;  1Z1V A;  1QOF A;  5CP2 A;  1N61 A;  2WYQ A;  3N1Z C;  5D94 A;  3LVV A;  4BJQ A;  4NL9 C;  2W04 A;  4KZ0 A;  3HT3 A;  5J0T A;  2L7R A;  5ALO A;  2IOF K;  2VA3 A;  2C2R A;  1XLQ A;  1ZD5 A;  3LK9 A;  3ZQ4 A;  3CW2 C;  2PW9 A;  2MLB A;  3DWG C;  2WXO A;  2OWO A;  5AIC A;  3T5J A;  1RZT A;  2H3I A;  4P0Q B;  1UWM A;  1URJ A;  3KQ4 A;  3KWV A;  4II3 B;  3AE4 B;  1ZRN A;  4PJ0 U;  2PXI A;  3NOB A;  4O3P A;  1NK9 A;  3V6C B;  3P4S B;  1OTR B;  4M9L A;  2YLM A;  5C0Y A;  2WDR B;  1WMH A;  4FJZ A;  4M9N A;  3BVZ A;  4TQ0 A;  2YB1 A;  5BOL A;  2RQ5 A;  2KV2 A;  2J53 A;  4UB8 U;  1EU4 A;  2DYO A;  1I42 A;  5AKJ A;  2NYV A;  5AM1 A;  3H8S A;  1BUI C;  1A77 A;  3QUB A;  3JPO A;  9ICX A;  3N4M B;  1MPE A;  2KTR A;  2NR2 A;  2LPE A;  3SFD B;  2ZVO A;  3EUB 2;  4MEX A;  1N5X A;  4FZL A;  5HNK A;  1KN5 A;  2LHE A;  2N9L A;  4EFO A;  1X66 A;  1C78 A;  1Q10 A;  2M17 A;  2BPG A;  1WG8 A;  4YVZ A;  2AGQ A;  2Y5B B;  2LHT A;  5CHG A;  4TUP A;  5KAF U;  1QLB B;  3IHP C;  5CR0 A;  4C7Z A;  2LWP A;  4QZG A;  3ISB A;  2MH7 A;  2IO1 B;  4YR3 A;  4AOF A;  5C1Z A;  1E90 A;  2N1R A;  3FC4 A;  3SAF A;  1R4N I;  5J18 A;  3DBL B;  3ABV B;  1D3Z A;  3Q8B A;  4PS3 A;  1CRX A;  2XIC A;  1K51 A;  1ZXH A;  4EEL A;  3RR8 A;  4NXZ A;  4KDL B;  2JPH A;  3F53 A;  4WJQ A;  4PL1 A;  2KAC A;  3AE6 B;  3PR5 B;  2NS5 A;  3RYT A;  3T9L A;  1X6I A;  1T6B X;  2JYE A;  3QU4 A;  1RWS A;  2I5H A;  3PLU A;  3EFU A;  1NYQ A;  3E56 A;  3C5F A;  2WF8 A;  4RH6 A;  2I2Y A;  3E0F A;  5BOM A;  1SKW A;  2GLE A;  1D9D A;  4LNO A;  2HJ8 A;  1NVI D;  2XK5 A;  1ZQI A;  3RJH A;  2LGX A;  1EU3 A;  2D11 A;  1SXT A;  1WCN A;  3ALR A;  3BIN A;  1SJE D;  3TAR A;  4GMV A;  4IDI A;  4F71 A;  3QU7 A;  2MU2 A;  5JXV A;  5ALZ A;  4C7Y A;  4QZ8 A;  5K4L A;  2DZI A;  3UXO A;  2OYY A;  9ICS A;  4MFF A;  4F4X A;  1SF0 A;  4AS1 A;  1SGG A;  4RQ4 A;  1T3N A;  5CHW A;  2BB6 A;  2BQU A;  1S0N A;  4O3S A;  3VDZ A;  4A90 A;  4B9U A;  4ECV A;  2N7D A;  1EF1 A;  7ICT A;  4ED6 A;  2UU7 A;  2ZXH A;  4F4K A;  4PHD A;  3Q8F A;  1Q46 A;  3FKY A;  4DXF A;  1HZ6 A;  5JHB A;  4YXM A;  3C2M A;  4HLE A;  1SIJ A;  3QIJ A;  4DXG A;  4A3O A;  5AHX A;  3ZDC A;  1A5R A;  2HHU A;  3EFC A;  3AM9 A;  4MH8 A;  4K3B A;  2F8L A;  1NOM A;  5IIM A;  4Q43 A;  4JWM A;  3QX1 A;  3K1R B;  2QAR B;  1ZQA A;  2GH1 A;  4UB4 A;  3OWE B;  5JH5 C;  3HPO A;  1JWB D;  3KVF B;  3BII D;  3KHH A;  1NJW A;  2ZIV B;  3IM1 A;  2LYH A;  1WR1 A;  4CCH A;  2WNM A;  1ZQZ A;  1V85 A;  5KFB A;  2IY0 B;  4OJP A;  3HW8 A;  4OVU A;  2EH9 A;  3ZDB A;  1WJ6 A;  1JN3 A;  2NPT A;  1XU4 A;  3QE9 Y;  9ICI A;  2FIF A;  2C2E A;  4YR2 A;  3EHV A;  3LXF A;  5AIB A;  2RDI A;  1C4A A;  1LGR A;  2FJ6 A;  2I1J A;  2EAM A;  4FZN A;  4C80 A;  3AEB B;  4MF2 A;  1NEN B;  3T8M A;  2DF4 B;  2WXK A;  3M7D A;  4Q8F A;  2FMS A;  1BPX A;  2PE9 A;  4E3C A;  2ZTC A;  4HRS A;  3IVF A;  4OD0 A;  2UVU A;  3DVN U;  1B4F A;  5TZV A;  4FS1 A;  3AEE B;  4EZJ A;  2XGQ A;  1IBX B;  4O5K A;  3A9K A;  3KFU F;  2L0T A;  1MG8 A;  2WX1 A;  5IN7 A;  1X42 A;  1FCL A;  4DQI A;  4W9H A;  3T5L A;  2WDQ B;  3H0L B;  2HHW A;  4F2R A;  2IOH A;  2NPT B;  2JXX A;  4PS8 A;  1LXD A;  2FE8 A;  1TAM A;  4RUA A;  8ICL A;  3Q8L A;  1SE2 A;  2FPL A;  4I2G A;  2MBE A;  1KFT A;  4X5V A;  1F0Z A;  5JU5 A;  4NWI A;  2BS3 B;  1K5O A;  3N97 B;  3RJF A;  1DYQ A;  2DBY A;  2JWU A;  1SWV A;  3AUO A;  1I4P A;  1WI0 A;  2LEK A;  2EAO A;  5KG4 A;  1ZOY B;  5D2M B;  4WQO B;  3AE3 B;  3RRG A;  2BS2 B;  5AM0 A;  1J7C A;  3SFE B;  2LHD A;  3UPQ A;  3KD3 A;  3KZX A;  2KXJ A;  4AUQ C;  3TI0 A;  4ED3 A;  3KLS X;  3AE2 B;  8ICY A;  4YSZ B;  2ZJD A;  5JHA A;  1ZQD A;  4JX1 C;  2JZB B;  4CF4 A;  3FYH A;  4FN2 A;  4L2Y A;  4IQT A;  3E2E A;  1JXL A;  3VC8 A;  1FNV A;  4X57 B;  3QZ7 A;  1QTM A;  1PDX A;  1BT0 A;  4B6W A;  7ICF A;  2JUO A;  4M9G A;  1TK8 A;  4JIO U;  2Z0D B;  1WJN A;  3V3X A;  2A1J B;  4PHP A;  4J3O D;  3VR9 B;  1TE2 A;  1E6E B;  4RM9 A;  3JW0 X;  3NGD A;  1HUZ A;  1VCB A;  4WJN A;  3GQC A;  2MBH A;  3R9K A;  3EW9 A;  5ALQ A;  2NBU A;  5C3J B;  2KSO B;  3A1Q A;  4LCD E;  3TMP B;  2AXT U;  3IFW B;  2F44 A;  1ZQV A;  4MH0 E;  1FCC C;  1YMH E;  1U49 A;  2WXP A;  4JGH B;  5J0S A;  1WX8 A;  1AAR A;  1IIP A;  3GDX A;  3J9C A;  4PGY A;  4JL9 A;  2MUT A;  4F5P A;  1KDH A;  1I4H A;  2HDO A;  1V80 A;  3BQ1 A;  1Z1B A;  3WIM A;  2NTS A;  3SEI A;  4ACO A;  3M1Y A;  5A0L A;  1VJK A;  1UPH A;  1XO0 A;  2EMS A;  2WXM A;  2NRW A;  2KC1 A;  1OW5 A;  2VAN A;  5AIA A;  2EKI A;  5KL1 B;  2XVT A;  1RRB A;  2HBM A;  5GMV A;  5KG1 A;  1F77 A;  3PW4 A;  3RB0 A;  3Q3O C;  2DHZ A;  3F2C A;  4MFC A;  5I4D A;  4O3N A;  1CMX B;  4P4O A;  4EBE A;  9ICF A;  2QJL A;  2MAX A;  2M0X A;  1COK A;  2ISO A;  2XK5 B;  1T0Y A;  5DLF A;  4O3Q A;  3Q8A A;  4DL2 A;  2XEW A;  4TUU A;  1YNT E;  3SAG A;  3PW0 A;  1JRP A;  4DXA B;  3WK9 A;  1X6J A;  1YZ7 A;  1IG6 A;  3UQA A;  5J2C A;  1TYG B;  4IM0 A;  3WAO A;  4LJP B;  3KBB A;  3A9J A;  3BVM A;  2FPM A;  3PHW B;  2HVI A;  2ISP A;  1UT5 A;  3HUI A;  3QAQ A;  2D3G A;  3URY A;  1JMS A;  1WRI A;  1OQY A;  4EEW A;  1TIF A;  3PPA A;  1BPB A;  1YN3 A;  3NRZ A;  1OQR A;  4QWC A;  5KG2 A;  4GDK A;  4GU2 A;  2J6T A;  1D5M C;  1FXA A;  5EDS A;  1PVR A;  3TSS A;  1WGR A;  3F5E A;  5ALN A;  3N7S C;  1UWX A;  3H6N A;  4QIW C;  4J9M A;  2WXN A;  2K0P A;  3OJ4 B;  2B3A A;  1L6U A;  1ZGU B;  1TY2 A;  2WXL A;  5HI1 A;  4KLI A;  3ZNH B;  3KUZ A;  4UW9 A;  3PX0 A;  5IIO A;  4F8R A;  3PRM B;  1C79 A;  7ICE A;  4AQ7 A;  3WKC A;  4WJP A;  3UXP A;  2ONQ A;  5D6J B;  2E6X A;  1P7F A;  5BMI A;  2DPI A;  4EOY A;  2MBO A;  4JUZ A;  2QKQ A;  1GAQ B;  2ZW0 A;  4HVB A;  1L3V A;  4KLG A;  4FJY A;  1SL0 A;  4Y2R A;  2AHO B;  1I7H A;  9ICL A;  2QHO A;  2PVO D;  2PLP A;  4W9C A;  1FRD A;  4S17 A;  4UBB A;  3FAH A;  5ALG A;  2KLG A;  4IG7 B;  2JEG A;  2WXG A;  3QAR A;  1LM8 B;  2GBN A;  1UUP A;  8ICI A;  1UQV A;  2V9H A;  4DQP A;  3RB3 A;  4I2A A;  3VUW A;  2P6U A;  3AU4 A;  3PO5 A;  3TKA A;  1DOI A;  2HBJ A;  1TV9 A;  3MFI A;  4EX7 A;  3GE3 C;  5KT3 A;  2ZJ5 A;  5B5E U;  3MHS D;  2LD9 A;  2GLS A;  1U4A A;  4G11 A;  3S2A A;  4XC2 A;  1ZQN A;  2KK0 A;  4QZ9 A;  3RTV A;  2FLL A;  2N9P C;  4ECX A;  3UIO B;  2ASJ A;  3X23 A;  4YTP B;  4ZDV A;  2ZIX A;  4DL7 A;  2LXA A;  1Q8K A;  5AM3 A;  4JWS C;  5BPC A;  3OAW A;  1ZQX A;  4PK1 A;  1WXQ A;  3IN5 A;  2J0J A;  1F52 A;  2W8L A;  2YEP B;  5KG3 A;  4J9N A;  1WH3 A;  2JZZ A;  2KJ5 A;  3EGR A;  3FDS A;  1QOG A;  1UZX B;  4IRK A;  3MGV A;  2LYB A;  2MA1 A;  5DG7 A;  2MP2 B;  1GPX A;  2AU0 A;  2DEN B;  3QX7 A;  5CA7 A;  2K3U A;  5ALY A;  4EZ9 A;  2CJO A;  1A70 A;  2BVC A;  3PVX A;  2J0M A;  1Q5W B;  5KFM A;  4IS7 A;  5IIK A;  5JUM A;  5L1L A;  3GU3 A;  3H8W A;  4PT5 A;  4K7W A;  1CQV A;  4UAV A;  2D10 A;  5AM2 A;  1IP9 A;  2F76 X;  1U47 A;  3TIX A;  1RM6 C;  2B76 B;  2N0S B;  4Y2J A;  2BYF A;  2G45 B;  1M94 A;  1ZQO A;  5IP4 D;  3RT3 B;  5HR6 A;  2DKZ A;  3EA6 A;  2V9W A;  2HI0 A;  3M3J A;  5T8I A;  4C0Z A;  2Y5P A;  4W9K A;  2MCN B;  3WKB A;  4JV1 A;  3ZD9 A;  2G3Q B;  3PR4 A;  1MA7 A;  1MHX A;  3ZLZ A;  4B9K A;  1JXE A;  3PS6 A;  3O65 B;  2C22 A;  2ES6 A;  1GC6 A;  5AKZ A;  1NBF C;  1KM7 A;  1XD3 B;  1N48 A;  1TK5 A;  1ZDV A;  2UYZ B;  4RCO A;  3K4G A;  3GIK A;  1R4N B;  4QZD A;  8ICS A;  4P4M A;  2KSO A;  3PZD A;  4NLN A;  2LGI A;  1RYR A;  4HPM B;  4KTQ A;  2ZXI A;  3QXG A;  3QUT A;  1WM3 A;  4YL8 A;  1TAU A;  1CEZ A;  2HD5 B;  3UQ0 A;  1ED1 A;  5ALH A;  1YQ3 B;  3RB4 A;  5CRX A;  5KAI U;  3OJ3 A;  3U7D A;  3CF6 E;  3RBE A;  3BS5 B;  5ALI A;  3U7Z A;  2R2Q A;  4DSJ A;  1KSP A;  1L6V A;  4WJ3 B;  2I38 A;  4M02 A;  4RU9 A;  2K8B A;  1ZQF A;  3DCG A;  4RNA A;  4WUR A;  1OFF A;  2C7M B;  1NI2 A;  2JXJ A;  3RNB C;  4EYI B;  4F1S A;  1YN5 A;  4YD1 A;  3KKA C;  1WWT A;  3CWI A;  5J2E A;  3NVW A;  2JRZ A;  4IQV A;  4CDG A;  2G08 A;  2IDY A;  3RJI A;  3RJJ A;  1WMH B;  3Q8E A;  1SL1 A;  4M6W B;  3MR5 A;  1XLN A;  4NY0 A;  2D6F C;  4HDQ A;  1HEZ E;  4R65 A;  5E6J A;  4GN1 A;  1Y8R C;  5DG9 A;  4RQ0 A;  8ICF A;  2ZTD A;  1YX6 B;  5G2N A;  2AYO B;  1X9W A;  2NBW B;  2NVU I;  4R8U B;  2FCM A;  1C4C A;  4FE3 A;  2N9E B;  5DPR A;  2JHD A;  2K4H A;  4B0E A;  2OHF A;  3IG8 A;  4UB6 U;  1I35 A;  2XCP A;  3AU6 A;  3VAW A;  1JI7 A;  4ECT A;  1NZP A;  4BUG A;  4YXD B;  4Y2P A;  3G6Y A;  4W9D A;  4JE3 B;  1F9J A;  2LVQ A;  2AX5 A;  5J0Y A;  4I28 A;  8ICA A;  1P7D A;  4A8X C;  3IXS A;  1HXY D;  2RDJ A;  5L9X A;  3AED B;  2JH7 A;  1J19 A;  4II2 B;  2GMI C;  5HG2 A;  3ED5 A;  4P7I A;  2K4E A;  3W5U B;  4C4R A;  2W9C A;  1RXW A;  2WDT B;  1IBX A;  5TR5 A;  4I6P A;  2PIA A;  4LZG A;  1E10 A;  3WAP A;  2YX8 A;  1NKB A;  2I6X A;  3GIJ A;  1LB2 B;  2NCN A;  2LVP A;  2FE9 A;  4PYZ A;  1MI0 A;  1XLO A;  1OUQ A;  2WWZ A;  3HK0 A;  4MGK E;  4ASW C;  1E7U A;  1SBB B;  1UEL A;  4AWJ A;  4ZH4 A;  3Q8K A;  2WDV B;  1RQN A;  2KOB A;  3QU2 A;  2LJI A;  4KX5 A;  1MQ3 A;  1WGH A;  4M47 A;  2ODG A;  4KMO B;  3AH7 A;  4NJC A;  3H8J A;  2B6G A;  2M0N A;  1TZ1 A;  3ZDD A;  2KO3 A;  1VZ6 A;  4FS2 A;  5H92 C;  2JGA A;  3JPQ A;  1NK0 A;  3ZJU A;  3RFZ B;  2WU5 B;  4KSK C;  4US8 A;  4LTU A;  1WXM A;  4IUM B;  3QUC A;  2WXR A;  1MFW A;  4HAI A;  4YTN B;  2B21 A;  5ALW A;  3V6H A;  5KG6 A;  4F5N A;  4BKS D;  4MAC A;  4LVS A;  3PST A;  4OHJ A;  1X9S A;  2KVZ A;  4ECW A;  2KOX A;  5T14 A;  3VXW A;  5L95 C;  2KG5 A;  1TS5 A;  2BQQ A;  4NQL B;  1J8C A;  5DG8 A;  4J9R A;  1RXV A;  2HHX A;  1LO5 D;  1UNS A;  2K39 A;  3PW2 A;  1IUE A;  4BBN C;  2DNF A;  1WE6 A;  3A1Q B;  1IGD A;  2FBW B;  5GTH U;  1ZKH A;  1BML C;  3AEA B;  3DDC B;  1UHU A;  2WGS A;  2OM6 A;  4F5Q A;  1LQB A;  3BK1 A;  2KNJ A;  2KJR A;  1V5O A;  1FFU A;  3M9N B;  5IOI A;  2A1A A;  2LAS A;  3TBL D;  4NV0 A;  1ZQG A;  7ICR A;  5AKX A;  5L1I A;  9ICP A;  3C8Y A;  4YCX A;  3LB8 C;  1YQB A;  4H2A A;  3VUX A;  4ECQ A;  3ZW3 A;  8ICG A;  1E8X A;  4J9Q A;  3KHR A;  3QEA Z;  3RBD A;  1HEK A;  2Y1J A;  2PI4 A;  1ROE A;  4I2D A;  3IT4 B;  3NHE B;  1V49 A;  3V61 A;  2DWQ A;  3RAQ A;  2ZVN A;  4YMM A;  4DSI A;  3TL5 A;  1UCV A;  3N7R C;  3VH3 B;  4UAW A;  1L4D B;  1V1P A;  5AKL A;  3NRW A;  3ZNG C;  2FCQ A;  3AI5 A;  3WA0 A;  5EWE A;  3PV8 A;  1CJE A;  3V7L A;  1WJU A;  3R66 C;  3WK5 A;  4DHJ B;  4B6J A;  3NZ3 A;  2BCS A;  3BZK A;  1YN4 A;  9ICO A;  2Y1I A;  3VQI A;  2XGP A;  2WTF A;  2JZ3 B;  4EEK A;  4OCZ A;  3BYT B;  2G5I B;  4Y2V A;  9ICE A;  4C8M A;  5ALR A;  3GII A;  5JTI A;  1DRG A;  1PGX A;  2KAJ A;  3U52 E;  9ICA A;  4ZRK A;  1NI3 A;  5BO4 B;  4RT2 A;  4DSK A;  1KRP A;  4B9M A;  1GC7 A;  3W2D A;  1MQ2 A;  4F5R A;  5KT2 A;  4AYB F;  1TKY A;  3Q8P B;  3PW5 A;  4CE6 A;  1S10 A;  1TAQ A;  2BZF A;  4G3I A;  1UT8 A;  1ZYQ A;  1L4Z B;  2BDU A;  1T5X D;  2IZV B;  2O6V D;  2WQY B;  3PHX B;  4LDT B;  1KFS A;  2V1Y A;  4JMU A;  4HWI B;  1RYU A;  3SD5 A;  2KQ4 X;  1X2I A;  3Q2A C;  2ASL A;  4QNL A;  4QZA A;  5J2F A;  2LMR A;  4YSY B;  2LM4 A;  1IPG A;  1Z5S B;  7ICG A;  4YFK A;  2DQN B;  4DF8 A;  1KTK A;  3HM6 X;  3ZVV A;  3KYD D;  1XSP A;  3ICX A;  3O13 A;  1RG6 A;  4GDL B;  3C28 A;  3RNA C;  4N6E B;  1XCT L;  1F44 A;  3OSN A;  4WH4 A;  3ISC A;  1L0Y B;  3DHG C;  2WHE A;  4IRD A;  3NZS A;  2W9A A;  4Y2X A;  4GOC A;  3HRD D;  1SSN A;  3BK2 A;  2IJ0 A;  5KFI A;  1PFD A;  2N9K A;  3Q14 C;  4QZE A;  4ANV A;  4RQM A;  9ICJ A;  1GNU A;  4M0W A;  1DK2 A;  1U48 A;  3RI7 C;  2QMT A;  4KX3 A;  4DS5 A;  1ZQC A;  3T5H A;  2CKH B;  4AP9 A;  2KMA A;  2GB1 A;  2ZCB A;  1V38 A;  4M8N A;  7ICH A;  4M00 A;  3U2S C;  2Y3A A;  2NV3 A;  2ZJ8 A;  2XO7 A;  1B0X A;  3DQV A;  3N1Y C;  2ZIU B;  3PSP A;  3Q8C A;  8ICV A;  4W9G A;  4M6W A;  4YD2 A;  1LV5 A;  1BPY A;  4DOC A;  2AJQ A;  1AW7 A;  4Y2Q A;  3WKD A;  1T0Q C;  3NJT A;  4I2B A;  2JEJ A;  1NK5 A;  1X9M A;  4Y2Y A;  3RNC C;  4US9 A;  2KDI A;  2PE6 B;  2G06 A;  4XE0 A;  4J6I A;  3OSP A;  1WXA A;  3QUQ A;  2L3Z A;  1DOY A;  2W9B B;  2I9G A;  2KQ7 A;  1TK0 A;  5CHF A;  4QZF A;  4KKJ A;  2HE7 A;  5G5G A;  1IGC A;  1S77 D;  3KH0 A;  1FM0 D;  3PO4 A;  2M4N A;  2JWZ A;  4BWM A;  3WK4 A;  3TEY A;  5G5H A;  1JML A;  1R4M I;  4JK1 A;  1VRA B;  2L52 A;  3L16 A;  3TFR A;  2YML A;  3U30 A;  3F5A A;  3PSF A;  2IMW P;  2DGZ A;  2W82 A;  4YMN A;  1FO4 A;  4OZC A;  2PKE A;  2FAZ A;  2WB1 C;  2G5H B;  2RDG A;  4KIK A;  7ICJ A;  3N9Y C;  1Z00 A;  2K9X A;  3CYM A;  1B9R A;  4TUS A;  3SEN A;  5D3D A;  2F77 X;  2QIE B;  1SEB D;  2NBV B;  4Y2S A;  4MGI E;  4C4V A;  4LNK A;  1WSP A;  1H4R A;  5FK9 C;  1SGH A;  3HKZ C;  1FD6 A;  5CB1 A;  1N60 A;  4ED7 A;  1K50 A;  4ZYS A;  5AKK A;  1C7Y A;  3MGH A;  3UI3 A;  4UB3 A;  3TFS A;  3UIP B;  1JCK B;  3V60 A;  2F2A B;  5JRT A;  4TMA B;  3WK6 A;  3HP6 A;  2Z0E B;  2BYT A;  2OEH A;  4ECU A;  3A4S C;  3NAS A;  3GB1 A;  1V1O A;  4ELT A;  4KLL A;  9ICB A;  2CXY A;  1M4V A;  1N2X A;  8ICJ A;  2LUE A;  4M0W B;  4NPN A;  3K9P B;  5HML A;  3QNM A;  3EC8 A;  3KKA A;  3M8R A;  3C23 A;  1L3T A;  3NUH B;  7ICK A;  2V4R A;  3D2N A;  1WWU A;  1U9L A;  1YZ6 A;  1ZQB A;  3BYY B;  4URK A;  1GB1 A;  4K4G A;  2E8M A;  1PVP A;  5D3I B;  3Q3F A;  1L7N A;  3EPG A;  4RF1 A;  5KL8 B;  4RQ3 A;  5KT7 A;  4DBG A;  2CR5 A;  5EE1 A;  2EQY A;  5DQG A;  1TKD A;  1RYS A;  5IIL A;  1FEZ A;  1TKG A;  4RT3 A;  2BWF A;  3APC A;  1FPY A;  2GRI A;  4O0I A;  3LJ3 A;  1Z4N A;  2WXQ A;  1KBU A;  2QB0 A;  2PFO A;  3H7P A;  2Z59 B;  2DX5 B;  2KAN A;  5J2J A;  3PRP B;  4DFM A;  4ITK A;  4XWT A;  4LNF A;  4GFJ A;  5AI8 A;  4PGQ A;  5KFD A;  1ZET A;  5IIN A;  3I63 C;  2BB5 A;  3GFK B;  2C28 A;  4BOZ B;  4DOB A;  4DK5 A;  4R63 A;  4F5O A;  1DOX A;  4O5C A;  2JEI A;  3DBH I;  8ICQ A;  3RNG C;  1DGS A;  3GIM A;  3APD A;  3SR6 A;  1YJ1 A;  2J4X A;  2KX0 A;  4UAR A;  4QWE A;  3ETL A;  1WM2 A;  3SAH A;  3OHA A;  1V1P B;  2MJ3 A;  1RQL A;  1ZP0 B;  5HKH A;  2MX2 A;  3B0A A;  2K6D B;  4KMU A;  1AQ6 A;  3AEF B;  3VTV A;  3B9J A;  4RFB A;  1QLN A;  3EWA A;  3HIZ A;  4G0N B;  4QW8 A;  4DLG A;  3WAN A;  2Q4T A;  4K1R B;  1S3S G;  1V9J A;  2ZUD A;  1Q3U A;  2WB1 F;  1L3U A;  5KG5 A;  2IA6 A;  1PGB A;  1XO3 A;  2L83 A;  1D8L A;  3PRE A;  4I2F A;  3V7K A;  4JB3 A;  5KFC A;  3C19 A;  5DB6 A;  1D9F A;  1K1S A;  4KLJ A;  2I1Q A;  1ZJM A;  4BBN F;  2C7H A;  2RP5 A;  5DCN A;  2VZK D;  3CSF A;  2XY6 A;  3RAX A;  2WHI A;  3ONS A;  3SDL C;  1ZQL A;  2D2Q A;  3ZDT A;  1ZQ1 C;  3KWL A;  1XSL A;  4B0M A;  2R8J A;  2KIV A;  4JWU C;  4RPX A;  3GV5 B;  4M01 A;  3QU9 A;  5FP0 A;  3KZI U;  5DKW A;  1XNS A;  1J7B A;  5III A;  2K8C A;  5AUK A;  5AM4 A;  8ICR A;  2L00 B;  5EE0 A;  3MR3 A;  2KZ3 A;  3Q8Q B;  2ZIW A;  4RQ8 A;  5KT4 A;  1SE3 A;  1ZQT A;  4EZ6 A;  1FNU A;  4ANX A;  4PPX A;  2SEB D;  2G0A A;  3MGI A;  2BW2 A;  5ALS A;  3FM9 A;  1S97 A;  5DGB A;  2N7E A;  3VTW A;  1NK4 A;  1D5Z C;  4BWJ A;  5AI6 A;  5J0U A;  3BY4 B;  2K60 A;  2AQ4 A;  3G6X A;  4ECZ A;  1KFY B;  4MHV A;  1R4M B;  2BPC A;  2IND C;  1STE A;  2Y0S C;  4B9L A;  3V7J A;  2ZNV B;  4ECS A;  5DBB A;  1FMA D;  5AK3 A;  4I27 A;  5DPW A;  1MN8 A;  3P1M A;  2D3B A;  1XLP A;  4GDL A;  5ALE A;  4A55 A;  4GXI A;  2R8G A;  5C23 A;  3MC8 A;  3IRU A;  4ANW A;  4D2K A;  2H5X A;  2ZIW B;  2NTT A;  1WGK A;  2YMP A;  4CF5 A;  4NLB A;  1K52 A;  2YVC A;  3JSV A;  4DSE A;  2G07 A;  2R8I A;  3W1Y A;  3WCQ A;  2K6Q A;  3SV3 A;  2KVS A;  3NVY A;  4J9S A;  3RZW C;  5EE9 A;  1SB3 C;  9ICN A;  2H3F A;  4IM3 A;  3JPS A;  1RDF A;  3A9K B;  3MC9 A;  2QSD A;  4EE2 A;  4EBD A;  3ZUN A;  4HRO A;  5DQI A;  2OH2 A;  4XDC A;  3MP9 A;  2KDE B;  4F7Z A;  3O0F A;  4C8K A;  4LZD A;  2LJ5 A;  4C00 A;  2M9N A;  5ALF A;  3DOW A;  3VVW B;  2PMZ C;  2JEF A;  3ZKJ C;  1COO A;  5KFV A;  3AL0 B;  1PYW D;  3I57 A;  3ZGZ A;  3M8S A;  3L54 A;  5J0Q A;  5KHO A;  4KLF A;  4ZRP A;  1L8O A;  1QQ6 A;  4KLU A;  1BGX T;  3BQ0 A;  1TKE A;  2WFA A;  2BPS A;  4KDI C;  3PV1 A;  4QWD A;  2DYB A;  2L0F A;  2RDH A;  4F8C B;  4FA6 A;  1Q0W B;  4K81 A;  4PL2 A;  3BDP A;  4UAS A;  2I1K A;  1ZPS A;  1BNP A;  5L1M A;  4GC6 A;  3DHH C;  4WWO A;  4DQO C;  3OJS A;  2GBR A;  2INP E;  4DWI A;  2CS4 A;  1KL9 A;  2XY5 A;  2KMD A;  2IGH A;  5D4B A;  1WGG A;  2HOQ A;  4HEA 1;  4I6N B;  3TEX A;  3AUL A;  1BPD A;  1LKY B;  1WX9 A;  5KFG A;  1FRR A;  1S0O A;  2GBK A;  2X8X X;  3PVL A;  1AN8 A;  4RNO A;  1RPL A;  2DZM A;  1KLV A;  4XZ4 A;  4EEN A;  2FI1 A;  5J0O A;  4OVV A;  2KN5 A;  3J81 j;  5AKE A;  3BWU D;  3ONN A;  5ALT A;  2LBO A;  4F92 B;  2D3C A;  1P7E A;  3RB6 A;  2JZB A;  4YT0 B;  2RPV A;  1JX4 A;  5HHH A;  3DBH B;  1JQ4 A;  3B2G A;  4XA5 A;  1QZE A;  2JV3 A;  4NJ8 A;  3M9M B;  2YY6 A;  3PT2 B;  4TV3 A;  5IAA C;  1QQR A;  3L08 A;  3H7P B;  2W9C B;  8ICM A;  1JWA D;  5CJ7 A;  3IAS 1;  5C2T B;  3PX4 A;  3ZTC A;  5E6O A;  3ZDE A;  1HIW A;  4NAM A;  7ICS A;  4WAF A;  2BS4 B;  2YEP F;  3L0W B;  9ICH A;  4UAZ A;  2DLB A;  4GXJ A;  4KX6 B;  4M8M A;  4TQR A;  4Z6E A;  4Z6D A;  3FIL A;  4KGS A;  1UA1 A;  1TS2 A;  2W54 A;  1QIL A;  3U8Z A;  3OTQ A;  5KFY A;  4I2I A;  9ICV A;  1TS4 A;  3LDA A;  4A6Q A;  1ZXI A;  3MBY A;  4F93 B;  2FLN A;  5KFJ A;  2G1E A;  4ARC A;  1ECW A;  3P2B A;  2FUG 1;  1SV0 C;  3PMN A;  2KT7 A;  1CZP A;  5LXI B;  5DGA A;  3MFH A;  3ORY A;  1V2Y A;  4RGM A;  5J29 A;  9ICC A;  3ZJT A;  4YTM B;  3KUD B;  2IO3 B;  3C1Y A;  3RUI B;  2HVH A;  3SYZ A;  4ED2 A;  4M9H A;  1TVA A;  1JWS D;  3I28 A;  5GTI U;  4EBC A;  1WXV A;  1TY0 A;  5IO9 A;  5KFT A;  1TZO A;  2KKC A;  1J2N A;  3AN1 A;  5BYR A;  2Y5C A;  4UB2 A;  1H38 A;  4Q45 A;  2R8H A;  3MJ5 A;  3N32 A;  2IHN A;  3UQ2 A;  1F2R C;  2IBI B;  2EKE C;  3E9S A;  2A4Z A;  1MG4 A;  1P98 A;  8ICO A;  1WGY A;  2AGO A;  2KHW B;  3DBR B;  4WWP A;  3TCA A;  2KZM A;  2FPK A;  2WF9 A;  3G6V A;  3OPX A;  5H8Y E;  1L7P A;  1QSY A;  2H3Z A;  2WU2 B;  3SQI A;  1GUA B;  3ENE A;  1QF6 A;  2FUH B;  3T3O A;  2IOF A;  2JMG A;  2KDB A;  3TAC B;  2E8N A;  4Z6C A;  3RJE A;  2UWQ A;  3Q69 A;  2AL6 A;  3HIL A;  5AI4 A;  4F2S A;  2Q5W D;  2UVR A;  1QSS A;  3AEC B;  4P16 A;  1QQ7 A;  7ICQ A;  9ICT A;  1Q3V A;  2KC2 A;  1GOZ A;  3Q3N C;  5IKC M;  2BYV E;  2KVR A;  4YR0 A;  3P42 A;  4K4H A;  2ZPN A;  4QWB A;  1ET9 A;  3NS1 A;  3U4E G;  4RQN A;  4HCN B;  3B08 A;  4RQ2 A;  3LYY A;  2MSN A;  4S0R A;  3EYZ A;  9ICG A;  4RZR A;  3R7Q A;  4AJW A;  1NNL A;  3KHL A;  2BPF A;  3ZXV A;  3N30 A;  5FR6 A;  1MC8 A;  2KJ8 A;  2ZCC A;  5KFQ A;  2EMT A;  3R3M A;  3EEC A;  2CU1 A;  1TBE A;  3ZDM C;  1WJ4 A;  1ARO P;  2LGS A;  1QOB A;  2JRH A;  3MR6 A;  1YJI A;  5AZF A;  3D32 A;  1TFR A;  4MGZ E;  2NO5 A;  3MDA A;  2CHW A;  3LVW A;  1XEE A;  1A6S A;  3SD7 A;  4WWM A;  2ZIX B;  5EOZ A;  1N6Z A;  1V9P A;  3DVG Y;  1WE7 A;  5KHQ A;  3AV8 A;  2YMQ A;  1S8O A;  1CI4 A;  1EM7 A;  2OOB B;  2QB0 B;  4FFD A;  1TGZ B;  1N56 A;  3PSE B;  3ZNZ B;  1GG3 A;  3B2F A;  4FAD A;  3ZO5 B;  4CGZ A;  4K3C A;  2VA2 A;  4MSM B;  1HJP A;  2ZUB A;  3PO0 A;  2LMC A;  3OLM D;  2BWE S;  1KFD A;  1VZ8 A;  4NNJ B;  4BDP A;  1Z2M A;  4HPL B;  4ZRI A;  2JZP A;  2KJH B;  1WZ3 A;  1J97 A;  4I29 A;  2DUY A;  2PEA A;  1E0Z A;  1XWL A;  2BHN A;  2BGF A;  4HXD A;  1ENF A;  4FHJ A;  2BKR B;  3V72 A;  3RZF A;  4DSF A;  4FJV B;  5J8Y C;  4CNQ A;  5KFE A;  7ICU A;  4ZRQ A;  4USA A;  3H1U A;  2IY1 B;  1VLB A;  4PHA A;  2MJD A;  4I2C A;  2LRW A;  4XGA B;  4NAW B;  9ICM A;  2F1J A;  2MW5 A;  5F9L A;  1NJZ A;  4GIV A;  2KWD A;  5ALM A;  4YWG G;  1KEJ A;  2EDU A;  2GBJ A;  2VIX A;  4OJ5 A;  2KJ9 A;  3H0M B;  2GOL A;  2D07 B;  4OZB A;  3GV8 B;  4K7S A;  1ZQY A;  1WFY A;  4IL6 U;  4UB5 A;  1ZW7 A;  4DQS A;  3PZ8 A;  4KLQ A;  4CYE A;  1KJT A;  3C2L A;  3WKA A;  2XBB C;  3SI8 A;  1AWD A;  4NM1 A;  1IV8 A;  4DL4 A;  5L1K A;  4OJO A;  4C4S A;  5DBA A;  1Z4O A;  8ICC A;  2INC C;  3PRZ A;  1OQQ A;  4KIK B;  1ET6 A;  2N4F A;  3A9J B;  2KTF A;  1B43 A;  1NK7 A;  4PYU A;  1DOQ A;  1TTN A;  2A3V A;  4Y2U A;  3Q8M A;  4ARI A;  2JT4 B;  1L6N A;  4DHJ D;  4IQU A;  5KFZ A;  3QA8 A;  3I76 A;  1E7V A;  4HJK A;  1RFA A;  2KN7 A;  4LLG M;  1SWW A;  2EAP A;  4BGD A;  1ZRM A;  4MSQ B;  1EWC A;  2NRT A;  4IC7 B;  3DEE A;  2N7J A;  4LJX A;  2NRX A;  2HTH A;  3C0R B;  2KDM A;  2KFZ A;  2KFN A;  2P35 A;  2DPJ A;  4EX6 A;  5KFN A;  2KDF B;  1C77 A;  8ICB A;  1Z00 B;  2FMP A;  1PK1 A;  2K4P A;  4I2E A;  3H8H A;  4TUR A;  3MR2 A;  3NZU A;  2ZPY A;  5ALU A;  2LFI A;  3ZTD A;  1L8L A;  3HVD A;  4NJ6 A;  5CHV C;  4KLH A;  1P1A A;  2R8K A;  3GS2 A;  1G6J A;  1BPZ A;  4YQW A;  4KN7 A;  2AQ0 A;  4GXK A;  2A1J A;  1I4Q A;  2MQJ A;  1XT9 B;  4DCC A;  3CMM B;  3QHT A;  2DFL A;  3EZ5 A;  4UQG A;  5KFS A;  8ICH A;  1VR9 A;  1V8C A;  2DZK A;  2KIW A;  2LVO A;  5AK6 A;  1E9M A;  2WXI A;  4GSW A;  5KT6 A;  4EYH B;  1XS9 D;  2WS3 B;  2ESE A;  2F3N A;  4QW9 A;  2AL3 A;  4DHZ E;  4N58 A;  4Q44 A;  2CHZ A;  3PLV A;  5H2F U;  3CIR B;  1S76 D;  4MJS B;  3C1Z A;  1KRH A;  1NJY A;  1FEH A;  3KOO A;  3ECI A;  4QJF B;  2MBQ A;  4RQ5 A;  3CNH A;  4CF3 A;  2W3R A;  1KQQ A;  5AKH A;  3OGU A;  1B22 A;  3Q3J A;  3MDC A;  5HHI A;  1JWU D;  2H3V A;  1VZ7 A;  1ZE3 D;  2K22 A;  4RGN A;  5AK4 A;  3DWM A;  5J17 A;  4BXO A;  4O9M A;  1N62 A;  3IDW A;  1QH9 A;  4DQQ A;  3GOE A;  1BVS A;  3D6J A;  2J6S A;  4DLE A;  1C76 A;  4TSS A;  2R2O A;  2MBB B;  3RCZ A;  4XDD A;  1RLF A;  5J2H A;  4F4Y A;  4G9B A;  3MFG A;  5CEH A;  2W03 A;  4DO9 A;  4TQ1 A;  1F1H A;  4BX9 C;  2HBL A;  5KFW A;  4GLX A;  3SV4 A;  4KZC A;  3CRX A;  5KFH A;  2DAJ A;  1YIW A;  4BKG A;  4BOS C;  1S5L U;  4W9J A;  5AUI A;  3QWZ B;  1P3Q U;  3KHG A;  2PFN A;  2WAQ C;  2BDP A;  3AE1 B;  2D3A A;  4YSX B;  3KTQ A;  4HJG E;  1ZQH A;  1GB4 A;  4XQ8 A;  3DBR I;  4KLD A;  3JVZ X;  5FR3 A;  4Z6F A;  4DQR A;  1L5P A;  3DDH A;  2MWS B;  1SV4 A;  3EPI A;  1TS3 A;  3RF9 A;  3QU5 A;  5ALL A;  1UGJ A;  4HKQ A;  3SEB A;  2AWT A;  4LJO B;  4NJ7 A;  7ICN A;  3AQF A;  4EKU A;  3L10 B;  2K4I A;  4P1B C;  4BZA A;  1QOA A;  5ALV A;  2JX5 A;  1KOT A;  3ETR A;  1KLU D;  1U4B A;  1ZQM A;  2QAR A;  5KFU A;  2HOI A;  2OED A;  2AEH A;  2KNB A;  1ZD3 A;  1BNO A;  2VKQ A;  4YN4 A;  1ACC A;  4KLS A;  5HFY A;  2L76 A;  2ZEQ A;  1ZD2 P;  9ICU A;  5C5J A;  1S9F A;  1WY8 A;  2O6V B;  3D2S A;  3BQ2 A;  4LDT D;  4DFJ A;  3VHT C;  1A76 A;  4LK0 M;  1EXN A;  3IG5 A;  5LLI A;  4MFA A;  1D6E C;  2C5L C;  2HBK A;  1RAX A;  2RR9 A;  3RR7 A;  1I4R A;  4MJS A;  3VFK A;  4O3O A;  1L0V B;  2M0A A;  4QZH A;  1T0S C;  4ICA A;  4NZL B;  5MPO A;  5E6P A;  2LUM A;  2ZG6 A;  5HHD G;  3N1X C;  2EZX A;  1SL2 A;  1UBI A;  2DL0 A;  1D8Y A;  2CHX A;  4WQM A;  1T4G A;  5EWG A;  3P63 A;  5DB8 A;  3PY8 A;  1ZDX A;  2JRI B;  3N20 C;  2BTE A;  4BXO B;  4DHZ B;  3DHI C;  9ICW A;  2ASD A;  2O2V B;  2BF8 B;  4RGT A;  2VJ4 A;  3MAB A;  2HHS A;  4R66 A;  4FBT A;  2HTM E;  3N28 A;  3PTF C;  3DBS A;  3RD2 A;  1GJZ A;  1L0X B;  3RRH A;  2W8K A;  5GXG B;  8ICP A;  1AYF A;  2F8K A;  3E58 A;  4F50 A;  4JV2 A;  2D3D A;  4IWP A;  2HJ1 A;  3AB5 A;  1LFD A;  1SXE A;  2GOW A;  1K8R B;  4IOI E;  2VH2 A;  3Q6B A;  7ICV A;  1JUD A;  2HHV A;  2BCU A;  3N7P D;  2V3S A;  4PZN A;  4HDO A;  4C56 C;  1XO1 A;  1YX5 B;  1T0R C;  4F91 B;  4P6V F;  2MEK A;  3BJY A;  5DPT A;  4RF0 A;  3IP4 B;  3ZRC A;  3RUL A;  4UB1 A;  3UM9 A;  4Q2J A;  2O2V A;  3BVG A;  1E5W A;  2F1H A;  2INN E;  3M6Z A;  5BYS A;  4JLC A;  1NDD A;  2KIC A;  1J2M A;  2KVC A;  9ICQ A;  1JAL A;  2ACZ B;  2J42 A;  3TQ1 A;  3AU5 A;  1C20 A;  2ATL A;  3AE8 B;  2W11 A;  4QZC A;  4RQ7 A;  4UBC A;  3AEV A;  2ON8 A;  2WX0 A;  3HM3 A;  3IT6 B;  1WWV A;  5BMH A;  1ZJN A;  1WXS A;  2W43 A;  1WX7 A;  2PVG C;  4J9O A;  1L7O A;  3H9D A;  4IM2 A;  2MA9 B;  1CUK A;  2M8S A;  2KEY A;  4E0D A;  3ML9 A;  2OCE A;  1FXI A;  1O03 A; 
#chains in the Genus database with same CATH homology
 1KF6 B;  1N5W A;  1CK1 A;  1PYW D;  1YQ3 B;  3I57 A;  3ZGZ A;  3GP7 A;  4GLS C;  2ZW1 A;  3R2T A;  4ZRP A;  3U7Z A;  1BXT A;  1L6V A;  2I38 A;  1MVK A;  2QIL A;  4RNA A;  4WUR A;  1TKE A;  1OFF A;  2RDH A;  2PKO A;  1YN5 A;  1FFV A;  3CWI A;  1WWT A;  2VZK B;  3I9V 1;  3NVW A;  2IDY A;  1ZPS A;  4FXC A;  3Q8E A;  4HKZ E;  4L1B A;  4DQO C;  1XLN A;  2INP E;  1HEZ E;  5E6J A;  1V97 A;  3W5V B;  2IGH A;  4MM3 B;  4HEA 1;  3TEX A;  2GI9 A;  1C4C A;  2MJE A;  2WP9 B;  3P4P B;  2IPK D;  1FRR A;  4B0E A;  2H89 B;  2AQ2 B;  2OHF A;  1NEK B;  1AN8 A;  1QOF A;  4YXD B;  1N61 A;  2M56 B;  4JE3 B;  2AX5 A;  2JQR B;  4A8X C;  1XLQ A;  3IXS A;  1HXY D;  3BWU D;  3ZQ4 A;  3ZJV A;  2PW9 A;  3DWG C;  1P7E A;  2WXO A;  3AED B;  3MC0 B;  3KQ4 A;  4YT0 B;  1UWM A;  2RPV A;  3KWV A;  5HG2 A;  3AE4 B;  3W5U B;  1JQ4 A;  3B2G A;  1IBX A;  2PIA A;  1E10 A;  3P4S B;  1QQR A;  2IGG A;  2WDR B;  3PZ7 A;  2CU3 A;  3BVZ A;  4TQ0 A;  4GDK B;  1E7P B;  1HA5 A;  2J53 A;  1EU4 A;  1JWA D;  2DYO A;  2J52 A;  2JYT A;  1MI0 A;  1XLO A;  3IAS 1;  1BUI C;  5C2T B;  3AE7 B;  1MPE A;  3SFD B;  1SBB B;  1YQ4 B;  3EUB 2;  4NAM A;  2TSS A;  2WDV B;  1N5X A;  2BS4 B;  2LHE A;  2LJI A;  2N9L A;  4WAF A;  2YEP F;  1FIQ A;  2DLB A;  4KX6 B;  1C78 A;  1Q10 A;  3AH7 A;  4NJC A;  3FIL A;  4KGS A;  1TS2 A;  5FKA C;  2W54 A;  1QIL A;  1SJH D;  1VZ6 A;  1QLB B;  5H92 C;  1TS4 A;  3AE9 B;  3ZJU A;  3RFZ B;  2WU5 B;  4C7Z A;  4US8 A;  3P4Q B;  4LTU A;  4A6Q A;  1ZXI A;  2MH7 A;  3MHZ A;  1ESF A;  2WXR A;  2G1E A;  3T3N A;  4YTN B;  3FC4 A;  1YJJ A;  4ARC A;  2FUG 1;  1CZP A;  3VR8 B;  2JXT A;  3ABV B;  3Q8B A;  2RMM A;  4RGM A;  4MAC A;  1K51 A;  3ZJT A;  1ZXH A;  4OHJ A;  4YTM B;  2KAC A;  3AE6 B;  3R8B A;  1TS5 A;  1T6B X;  2JYE A;  2HDE A;  1RWS A;  1JWS D;  1NYQ A;  1TY0 A;  3E56 A;  1LO5 D;  1UNS A;  2SAK A;  4RH6 A;  1IUE A;  2I2Y A;  1IGD A;  2FBW B;  1TZO A;  3AEA B;  1BML C;  3RPF C;  3AN1 A;  5BYR A;  1MHH E;  1NVI D;  2Y5C A;  3BK1 A;  1EU3 A;  3MJ5 A;  4REZ A;  3FIL B;  1FFU A;  1F2R C;  1SXT A;  3E9S A;  4KGT A;  5BMG A;  2G9H D;  4IKG A;  4OZA A;  1SJE D;  4IDI A;  5JXV A;  3C8Y A;  4C7Y A;  5H8Y E;  1XF5 L;  2R61 A;  2WU2 B;  3LB8 C;  4H2A A;  3W9C B;  2BT6 A;  1QF6 A;  3T3O A;  1C4P A;  1SF0 A;  2QEJ C;  4AS1 A;  2K5P A;  3Q69 A;  2BB6 A;  2Q5W D;  3AEC B;  1ROE A;  1KLG D;  3IT4 B;  4P16 A;  4A90 A;  2DWQ A;  1GOZ A;  3AMZ A;  2D5G A;  3P42 A;  1KH0 A;  2DYM A;  1WYG A;  1ET9 A;  3NS1 A;  3Q8F A;  3U4E G;  4DXF A;  3LYY A;  1HZ6 A;  1I4G A;  1L4D B;  1SIJ A;  1HZ5 A;  1V1P A;  4DXG A;  1PGA A;  3AM9 A;  1CJE A;  4MH8 A;  4CQN A;  3NZ3 A;  1SE4 A;  1QOB A;  1YN4 A;  3OWE B;  1I4X A;  1JWB D;  1YJI A;  3VQI A;  3BII D;  3HVZ A;  2L32 A;  3BYT B;  1XEE A;  2V3P A;  2WNM A;  4WWM A;  1PGX A;  2KAJ A;  3U52 E;  4ZHP A;  1NI3 A;  1RYJ A;  4OVZ A;  4JPS A;  3AV8 A;  1EM7 A;  3W2D A;  1TKY A;  3LXF A;  1C4A A;  1D4B A;  3NVZ A;  4C80 A;  3AEB B;  3B2F A;  3P4R B;  1NEN B;  2WXK A;  3BZD B;  1JWM D;  1L4Z B;  1T5X D;  2LMC A;  2WQY B;  3PO0 A;  2BBC A;  1QT9 A;  1VZ8 A;  2KQ4 X;  4HRS A;  2JZP A;  1R7S A;  4YSY B;  3AEE B;  2PTL A;  1Y56 A;  1E0Z A;  1IBX B;  1ENF A;  1KTK A;  5TSS A;  2V4I B;  2V3N A;  3O13 A;  4GDL B;  1FCL A;  4ZRQ A;  3W1S A;  4USA A;  2WDQ B;  4N6E B;  1XCT L;  1VLB A;  2MJD A;  4WH4 A;  3VRB B;  1L0Y B;  1T3Q A;  4ZOH C;  3HRD D;  2FE8 A;  1SSN A;  3BK2 A;  2IJ0 A;  4NAW B;  1PFD A;  2N9K A;  1SE2 A;  2KMM A;  4A9A A;  2KWD A;  4WIP A;  4YWG G;  1F0Z A;  4M0W A;  2Z8L A;  2BS3 B;  2QMT A;  1DYQ A;  4OZB A;  2DBY A;  2JWU A;  1I4P A;  3PZ8 A;  2GB1 A;  2W55 A;  2LEK A;  1ZOY B;  3AE3 B;  2BS2 B;  1J7C A;  3SFE B;  3U2S C;  2LHD A;  2Y3A A;  1AWD A;  1JW9 D;  3KLS X;  1D5X C;  3AE2 B;  4YSZ B;  1OQQ A;  3Q8C A;  1ET6 A;  4JX1 C;  1AW7 A;  4ARI A;  4L2Y A;  4L23 A;  1FNV A;  1PDX A;  1DGJ A;  2E3T A;  4US9 A;  3V3X A;  4LLG M;  3VR9 B;  4J3O D;  1E6E B;  1EWC A;  4XE0 A;  1DOY A;  2N7J A;  4O1N A;  1PUT A;  2KDM A;  4KKJ A;  5C3J B;  1F2R I;  5G5G A;  4MT5 A;  1IGC A;  1C77 A;  3IAM 1;  1FM0 D;  1C9F A;  3TEY A;  5G5H A;  1JML A;  1VRA B;  1NYR A;  2L52 A;  1ZUD 2;  1FCC C;  1YMH E;  3H8H A;  2W82 A;  1FO4 A;  2WXJ A;  2WXP A;  4OZC A;  4KGR A;  2LFI A;  2RDG A;  3HVD A;  3N9Y C;  2K9X A;  3GS2 A;  3J9C A;  4RGO S;  1B9R A;  1QKZ A;  1I4Q A;  5D3D A;  2QIE B;  1SEB D;  1I4H A;  1VR9 A;  3TEZ A;  2NTS A;  1WSP A;  5FK9 C;  1V8C A;  3AEG B;  1E9M A;  2WXI A;  1FD6 A;  1VJK A;  2WXM A;  1N60 A;  1K50 A;  4UDU C;  2WS3 B;  4ZYS A;  3UI3 A;  2EKI A;  2V0G A;  5EE3 A;  1JCK B;  4TMA B;  4N58 A;  2BYT A;  1F77 A;  4N59 A;  1XXG A;  3GB1 A;  5I4D A;  1V1O A;  3CIR B;  1M4V A;  2W3S A;  1KRH A;  2QJL A;  1FEH A;  3R2I A;  2W3R A;  3NUH B;  3BYY B;  3Q8A A;  1GB1 A;  1JWU D;  1VZ7 A;  1YNT E;  1ZE3 D;  2K22 A;  1JRP A;  5D3I B;  4RGN A;  3DWM A;  3V05 A;  2X38 A;  1N62 A;  2WXF A;  4RF1 A;  1TYG B;  3BVM A;  5EE1 A;  3TEW A;  3HUI A;  1C76 A;  1TKG A;  4TSS A;  3URY A;  1WRI A;  4XDD A;  2GRI A;  2WXQ A;  3MFG A;  1YN3 A;  3NRZ A;  1OQR A;  1TJE A;  4R3D A;  4TQ1 A;  1D5M C;  1FXA A;  2L1A A;  4ITK A;  4XWT A;  3TSS A;  2PMV A;  5AUI A;  2BB5 A;  1FNW A;  1UWX A;  2WXN A;  2K0P A;  1DOX A;  3AE1 B;  4YSX B;  4HJG E;  1GB4 A;  3L4P A;  1L6U A;  3SR6 A;  3TUO A;  1TY2 A;  2J4X A;  2WXL A;  5D7G A;  5HI1 A;  5FR3 A;  1V1P B;  2MJ3 A;  1ZP0 B;  1L5P A;  1TS3 A;  2AQ3 B;  3AEF B;  1C79 A;  3B9J A;  4RFB A;  1UGJ A;  4AQ7 A;  4HKQ A;  3SEB A;  2ONQ A;  2E6X A;  1J7A A;  1P7F A;  5BMI A;  1QOA A;  1GAQ B;  2ZW0 A;  2JX5 A;  3AE5 B;  3ETR A;  1KLU D;  2CJN A;  2XN9 C;  2OED A;  3ZYY X;  1I7H A;  1PGB A;  5BYQ A;  1XO3 A;  2L83 A;  2PVO D;  2PLP A;  1FRD A;  1ACC A;  1B1Z A;  5HFY A;  3FAH A;  2WXG A;  4ZHO A;  1UUP A;  2H88 B;  2VZK D;  4LK0 M;  1D6E C;  2M19 A;  3KWL A;  4B0M A;  4JWU C;  1DOI A;  1I4R A;  1J7B A;  1L0V B;  2M0A A;  5MPO A;  4NZL B;  5AUK A;  1K53 A;  2EEL A;  2LUM A;  5HHD G;  4WQM A;  5EE0 A;  4YTP B;  3P63 A;  1ZDX A;  2XNA C;  4JWS C;  4KKI A;  2BTE A;  1SE3 A;  2ICI A;  1FNU A;  4RGT A;  1WXQ A;  2SEB D;  1EWY C;  2YEP B;  2HTM E;  2JSV X;  2BW2 A;  3EGR A;  2JU6 X;  2AQ1 B;  2NMQ A;  1QOG A;  2KN4 A;  1L0X B;  5GXG B;  1D5Z C;  1AYF A;  1XCQ L;  1GPX A;  1N63 A;  1KFY B;  2K3U A;  2WXH A;  3AB5 A;  2CJO A;  1A70 A;  1RFK A;  1STE A;  4IOI E;  1FMA D;  3P1M A;  4PT5 A;  1XLP A;  4C56 C;  1CQV A;  4A55 A;  3VRA B;  4P6V F;  2MEK A;  4D2K A;  2NTT A;  1RM6 C;  2B76 B;  2N0S B;  4RF0 A;  1WGK A;  4Q2J A;  3BVG A;  1K52 A;  5BYS A;  2INN E;  4OW0 A;  3EA6 A;  1VDV A;  5T8I A;  3WCQ A;  2Y5P A;  5LNK 1;  3NVY A;  2J42 A;  1JAL A;  1MHX A;  2ACZ B;  5EE9 A;  1SB3 C;  2IGD A;  3AE8 B;  2ON8 A;  3IT6 B;  5BMH A;  3NVV A;  1ZDV A;  2QSD A;  4EE2 A;  1JRO A;  2WLB A;  4RCO A;  4HRO A;  2PVG C;  4XDC A;  3MP9 A;  1HQR D;  2LGI A;  1FXI A;  4XWW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...