2QB0B

Structure of the 2tel crystallization module fused to t4 lysozyme with an ala-gly-pro linker.
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
241
structure length
241
Chain Sequence
SIRLPAHLRLQPIYWSRDDVAQWLKWAENEFSLRPIDSNTFEMNGKALLLLTKEDFRYRSPHSGDVLYELLQHILKQAGPNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFCQDVDAAVRGILRNAKLKPVYDSLDCVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase regulator
molecule keywords E80-TELSAM domain
publication title Polymer-driven crystallization.
pubmed doi rcsb
source organism Escherichia coli
total genus 75
structure length 241
sequence length 241
chains with identical sequence D
ec nomenclature ec 3.2.1.17: Lysozyme.
pdb deposition date 2007-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00959 Phage_lysozyme Phage lysozyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2qb0B01
1.10.530.40 Mainly Alpha Orthogonal Bundle Lysozyme Lysozyme 2qb0B02
3HH6A 2B6WA 3SENA 1V85A 1SXEA 1L31A 1C69A 4EPFA 137LA 1DYDA 2Y9TA 2F32A 4I7KA 3BQ7A 152LA 157LA 4LDLA 1LWKA 210LA 1DYGA 3HUAA 1CX6A 1L26A 4I7OA 140LA 1CV0A 3SB8A 118LA 1P5CA 107LA 2QKQA 3NY9A 6LZMA 1L29A 4W54A 2EAOA 1CUPA 4YXAC 1L43A 1L50A 232LA 1JI7A 1L95A 2F8KA 1KW5A 1QT6A 3DN4A 3HDEA 2K4PA 1LYDA 160LA 1C65A 1C6CA 4W52A 1L05A 2ANXA 1C63A 195LA 1L13A 161LA 1T8AA 1C61A 1QTDA 3GUIA 253LA 4LDEA 1T8GA 1QUGA 1PK1A 2QARC 221LA 3TADC 2KMDA 1L92A 258LA 3GUJA 4W59A 1C67A 254LA 1L56A 3CDQA 191LA 165LA 2LCBA 2DL0A 3DN3A 1D3NA 2RB0X 4YXCA 1D3FA 4I7PA 1G1WA 3KKAA 2OU9A 1UCVA 1LLHA 1L64A 230LA 1SSWA 4DKLA 111LA 1L01A 4DJHA 1L47A 234LA 3GUKA 2OE7X 3C80A 2O79A 1QT7A 1L49A 2RAYX 3HDFA 4ARQB 3L64A 1C6KA 186LA 1C6PA 1L17A 1SV4A 7LZMA 3GULA 122LA 1L66A 1B0XA 1LYIA 4EKQA 1C6FA 1C62A 3HTBA 1OVJA 3UONA 189LA 222LA 1L18A 127LA 1ZYTA 2LC9A 1QTVA 3QAKA 1L42A 1NHBA 1LGXA 3FI5A 3DKEX 2Y9UA 1L60A 1PQDA 1C6BA 1P36A 3GUOA 3CDOA 1COKA 3G3WA 1QS5A 1L90A 5JRTA 1SXDA 1L34A 240LA 1C6GA 1QTCA 2OTZX 2HUMA 166LA 115LA 1SWYA 1B6IA 1P64A 2IGCA 3HU8A 3C7WA 3RZEA 1V38A 190LA 3OE0A 4I7SA 5F3XB 150LA 2O4WA 3FADA 212LA 3SN6R 247LA 235LA 125LA 1WWVA 2JV3A 219LA 3K1RB 248LA 257LA 3OE8A 1L76A 3V2YA 1Z1VA 4W55A 1CUQA 109LA 4EKRA 1L28A 182LA 2B6ZA 2B6YA 1CVKA 1WWUA 206LA 1G0PA 1L69A 104LA 3SEIA 1TLAA 1L88A 1L86A 3NYAA 2B74A 1OYUA 2QARB 1L89A 103LA 3HU9A 4NL9C 1L83A 168LA 1CU3A 1PQJA 1JTMA 3BS5B 3OE9A 233LA 3HWLA 4PZNA 1X66A 4ARQA 2B75A 2EANA 4IS7A 1L62A 242LA 2B7XA 139LA 178LA 1UQVA 170LA 3CDTA 3JR6A 3DN6A 1KW4A 2QB1A 2Q9EA 3HTFA 4EXMA 3DN2A 1QUOA 1L74A 3HTDA 1KNIA 187LA 1LKYB 2ES6A 151LA 1L22A 225LA 1C6JA 3PBLA 199LA 185LA 246LA 215LA 2RBRA 1QUHA 214LA 2F44A 1G07A 262LA 3SBBC 4IAPA 2ANVA 1L82A 1C6AA 1P6YA 4ZPUA 4I7TA 2Q9DA 2HUKA 3DMVA 4MHVA 236LA 3DMZA 3HT7A 4EKPA 2RBSA 2KIVA 123LA 3PDSA 1CTWA 1DXSA 1OWZA 2B70A 4YX7C 239LA 238LA 1LGWA 1L03A 3HT6A 149LA 5J8YC 1P3NA 1QTZA 255LA 3G3VA 1L68A 1ZWNA 1L55A 2QARA 3EMLA 1L70A 1L51A 3TADA 3C8SA 1L75A 1SSYA 1C6EA 3K2RA 3HTGA 2RB2X 2OEAX 145LA 143LA 3BS5A 1G0KA 1L0KA 1OXJA 4E97A 5JU5A 1T8FA 3C8QA 1SV0C 4AQNA 1L38A 4W56A 1G0QA 1LYGA 113LA 1SX7A 2QB0B 260LA 5L1MA 2RBPA 1RG6A 243LA 1L48A 1QSBA 1L94A 1QTBA 196LA 2F47A 126LA 2KSOB 3H8MA 172LA 1C6HA 1L61A 201LA 1LKYA 119LA 1L14A 1C64A 1DYAA 4LZMA 158LA 1G1VA 1L20A 3SB5A 1L02A 4ARLA 1DYEA 3DMXA 138LA 2GLEA 1QT8A 4OO9A 1C66A 2FE9A 1L37A 2A4TA 1QUDA 4W57A 3SB9A 1L71A 1ZURA 4S0WA 3HILA 2RAZX 142LA 1L65A 1LPYA 1LYHA 1X40A 1L00A 1L25A 2RBOA 2ESEA 3FA0A 5JTIA 1CV1A 213LA 3HH3A 1L11A 141LA 1XJTA 2D3DA 3G3XA 3BS7A 1L98A 110LA 164LA 1OVKA 2OU8A 218LA 1P7SA 1L59A 1L07A 4GRVA 1L58A 2F2QA 180LA 1K28A 223LA 3VW7A 2RBQA 3C8RA 2DKXA 1L10A 1L72A 2HULA 3F8VA 1C6IA 4RQNA 3GUNA 2F3NA 1C6QA 131LA 1L30A 1D2YA 229LA 1CU0A 1G0MA 120LA 1PQOA 1L63A 1L12A 2QB0A 1QT4A 1L44A 162LA 1KY0A 3D4SA 188LA 1QS9A 3SB7A 4NL9A 1DYFA 3CDVA 108LA 4NJ8A 3HUKA 1LWGA 2KSOA 1EPYA 4I7QA 1QTHA 1L06A 1L23A 175LA 3DNAA 4W58A 228LA 1KS3A 220LA 1F0MA 1L24A 2OU0X 4ARMB 3GUPA 1LGUA 167LA 1L21A 1L81A 1CX7A 4W53A 2KE7A 237LA 1L27A 4DAJA 245LA 1PQIA 1L09A 1L15A 4W51A 211LA 1OV5A 3TACB 1L97A 1LYJA 1L39A 2B6TA 2NTHA 1L79A 3DN1A 1LI3A 156LA 1P2LA 174LA 163LA 5LZMA 1I6SA 1P37A 250LA 261LA 5I14A 1L32A 1L67A 1LYFA 2B6GA 4EJ4A 1B4FA 4EKSA 1G06A 3DN0A 197LA 3LZMA 1L19A 1PQKA 184LA 2OE4X 4GBRB 2RBNA 3SBAA 1L85A 4RQMA 249LA 2O7AA 2EAMA 2L78A 1CU5A 2B72A 231LA 3HUQA 209LA 1X9XA 1C6NA 1CV5A 3L2XA 2E8PA 5J8YA 1XEPA 1L53A 205LA 224LA 181LA 1T97A 3HT9A 4PJZA 176LA 216LA 1SGGA 1QT3A 102LA 3KKAC 1T6HA 2B6XA 2EAPA 2YTUA 1L93A 169LA 1PK3A 1L91A 2E8OA 1P46A 4I7MA 1SV0A 3C82A 4PZOA 4I7RA 1L77A 4ARMA 5KNIA 128LA 1L08A 4ARJA 1L33A 1CV3A 1CV6A 1L99A 1DYBA 2CUUA 4I7NA 3C81A 171LA 4I7LA 1LW9A 3RUNA 2LPEA 217LA 259LA 2E8NA 159LA 192LA 1JQUA 1D3MA 3HT8A 2Z6BA 3SB6A 3CDRA 155LA 1LI2A 3C7ZA 2B73A 1CV4A 4LDOA 244LA 1KY1A 2LZMA 252LA 3C7YA 251LA 3NY8A 3V2WA 1WTHA 1G0LA 1C68A 227LA 3GUMA 3DN8A 1CU2A 2RB1X 1C6DA 1L16A 2L5YA 1XJUA 1CU6A 1L80A 4I7JA 1LYEA 2RH1A 2OTYX 1L36A 2DKZA 1L96A 1C6TA 1L04A 256LA 1L54A 1OW5A 2K60A 144LA 1L46A 3OE6A 1L52A 1L87A 1D2WA 198LA 1P56A 2D8CA 1SX2A 147LA 1L35A 130LA 2KG5A 1C6MA 1PK1B 3HH5A 1DYCA 1L84A 1L45A 1QSQA 4EPIA 1D3JA 112LA 183LA 226LA 1OVHA 1L41A 4ARPA 3C83A 1L40A 1C60A 148LE 1C6LA 1P2RA 177LA 1OWYA 1JTNA 1LI6A 1L73A 3IDWA 3F9LA 114LA 1PQMA 241LA 200LA 1G0JA 173LA 4PK0A 1G0GA 2LMRA 3HH4A 2NTGA 1OV7A 1D9WA 2E8MA 1SWZA 1QT5A 1KW7A 129LA 3ODUA 4K5YA 1L57A 146LA 2OE9X 1L0JA
chains in the Genus database with same CATH superfamily
3HH6A 2WB1C 1QCKA 4DLGA 3Q8LA 3RH6A 5AMYA 2XIDA 3C1YA 3SENA 4C4TA 1OUHA 4UW9A 2G4NA 4EPFA 4CCHA 8ICRA 2Y9TA 4R63A 3CRXA 3IV6A 3RJEA 5KFYA 2ASDA 4F4KA 4GN3A 4WM3A 3CB7A 1ZQGA 4Q43A 4ELVA 4OJOA 5KFBA 1CX6A 4I7OA 1LHLA 4G9SA 3QE9Y 4C4SA 1BWHA 3NY9A 1ZQNA 3WVXA 4W54A 4F2SA 2EAOA 1ZQZA 1GF9A 4GXIA 2HHWA 1LKRA 1UUZC 3GXRA 3EPGA 4YXAC 1KTQA 8ICYA 4NGWA 2DQEY 8ICNA 1GFGA 1L50A 1TVAA 5DGAA 4AYBC 1JI7A 1CJ8A 3D6JA 2H3IA 1GBSA 3RBDA 4CF3A 2I5HA 5DG7A 3ISBA 2C22A 1LYDA 5EE0A 5J2FA 1B43A 4B1AA 1C63A 5J0XA 195LA 1T8AA 161LA 1HUOA 1B5VA 2WARA 5AI9A 4LDEA 1NZBA 1T8GA 1JTPL 3ALRA 1SWWA 2N1RA 1GFVA 5HHHA 2W03A 3TADC 1JWRA 3GFKB 3QU9A 4M9NA 1LMAA 1ZXIA 4NHIA 5B05A 5AK6A 1D9UA 2AGPA 4NY8A 1ZVYB 2BQNA 4RPZA 254LA 4LT3A 7LYZA 3CDQA 3ZD8A 1X9WA 1SL0A 2LCBA 2RB0X 4NLZA 4DL6A 3M6ZA 4YF2A 1S5LU 2OU9A 1UCVA 3SI8A 1G7LC 5H2FU 230LA 1SSWA 2NV3A 4DJHA 4O3NA 2HHXA 3AW7A 4KITB 2G07A 2I25L 1LZEA 9ICMA 1WCNA 3RAQA 3H0LB 4ELTA 2IHLA 4DD7A 4KLFA 1C6KA 3FC4A 186LA 4YR3A 1GE1A 5AK5A 3BKVA 3GULA 2G08A 1LSDA 4LYOA 5KXKA 4HSFA 5ALWA 5J0RA 4J9RA 1LJHA 1C6FA 1D6QA 1LYIA 1KFTA 3UONA 222LA 2C2RA 1B7RA 5I4YA 4HJYA 4C8KA 2ZIWB 2R8IA 3KAMA 2YQEA 3WK4A 4ED1A 2DWQA 5DBBA 1COKA 4O3SA 3EW9A 5TISU 1LZ9A 1QS5A 154LA 4US9A 1L34A 1BGXT 1NK0A 1RI8B 5L3HA 2OTZX 2HUMA 4U3XB 2XGPA 1D9FA 1B6IA 3EUB2 3C7WA 4N0JA 3M7DA 3C23A 3NTUA 3QUBA 3T5LA 150LA 1G7JC 4M4OA 4IJ4A 247LA 125LA 1WWVA 4RU9A 4Z6EA 1JTTL 257LA 1MLCE 4NIJA 4KLQA 4M2YA 1L76A 3V2YA 2FMSA 5IDDA 4DQ5A 1RYRA 1QTKA 3A91A 2AGOA 2PFPA 4H9BA 3ULRA 3SMVA 3DEEA 3AN1A 1J1OY 2BDPA 1G0PA 1IP5A 4US8A 4XJDA 1HEMA 2ZIUA 5DN5A 4QZBA 1XGRC 2B74A 1OYUA 2MSNA 1L3TA 4G49A 4N1CC 4ED2A 2HHUA 1XS9D 2XBRA 4FFDA 1PVPA 4ED3A 1DPXA 1GB6A 1P2CC 4DD0A 3B0OA 1JTMA 1QUTA 2DPIA 233LA 1D8LA 1X66A 2B75A 4KMOB 4ET8A 1UICA 4ETEA 4IS7A 4YMOA 3WK8A 3HPOA 2HBKA 3ISDA 242LA 3TMUA 4DSLA 9ICTA 4BWJA 3JR6A 4WL6A 4C4RA 1KW4A 4IC9A 1NK5A 4EXMA 1A4VA 3DN2A 1JKCA 1J97A 1Q3UA 1DI4A 5HLLA 9ICNA 3LYOA 4I2HA 1NK7A 1BPBA 4M47A 2HU3A 4H9FA 1C7PA 4PPXA 1LKYB 4BXOB 1B5WA 2W1YA 5I4XA 4ECSA 215LA 2RBRA 3JPSA 1GAYA 2ZIVA 5LYTA 1BPXA 262LA 1Z55A 3SV3A 3HBHA 2FBDA 5B07A 2ANVA 193LA 1RQLA 2BQCA 4WLDA 1PZNA 3TQ1A 2MAXA 4KPMA 4EKPA 3WU2U 236LA 4PHPA 2RSCA 4ETAA 2MEAA 1TAMA 2EDUA 5AK4A 1WTNA 4NEBA 2I6XA 3T36A 1QTEA 2HTXA 208LA 4YENA 1INUA 5I53A 3PV8A 4QW8A 5KTQA 1S0VA 1CTWA 1DXSA 1OWZA 4H9HA 3RJIA 1O08A 5D5CA 5KG0A 1LGWA 2LHMA 1S76D 4OCZA 1L7OA 1QTZA 2Y8PA 3WPKA 1IC4Y 1WQPA 1L70A 1J1PY 2NWDX 2VB1A 1L75A 5AM4A 5FP0A 4KLDA 1C6EA 2XY6A 3LYTA 1BB6A 145LA 143LA 3BS5A 4CFOA 4YXMA 4H8YA 1X6JA 2CGIA 4MEYA 1G0QA 1GE3A 4DQ7A 2ZQ4A 4PGQA 3RRGA 113LA 2IMWP 1BQLY 1IY3A 1LSAA 2YSSC 3LHMA 260LA 3TXHA 5HNCA 4MFAA 3MR6A 3LWLA 4DFMA 4HAIA 4H91A 1QTBA 1LSBA 2Z37A 2NRZA 2F47A 4DYGA 4QWCA 2RDJA 3H8MA 1UIEA 4U6PA 201LA 4B49A 1LV5A 3LZTA 1GBXA 4QY9A 1TCYA 3FM9A 1FLUA 1G1VA 1LZ8A 3UXOA 4NG8A 4LT0A 4ARLA 5TZVA 3PX0A 2BCQA 4J1BA 2G5IB 4WLYA 138LA 3RR7A 1C66A 2FE9A 2DQNB 3SB9A 4S0WA 3AB6A 1LYHA 2HDOA 2WAQC 4OWAA 5L1LA 3N4MB 2XCPA 1CV1A 213LA 3TXFA 4J9KA 141LA 3WL2A 1XJTA 2D3DA 3G3XA 1L98A 110LA 2BZFA 4OWHA 3TMWA 1OVKA 4KTQA 5M1YA 2OU8A 218LA 1P7SA 1S8OA 4GRVA 3PNCA 1BB4A 3F2CA 4Z41A 9ICCA 4QZCA 1S0OA 3MGWA 2RBQA 1IP7A 2EZXA 1BB5A 2HULA 4ACOA 2FBBA 4PJ0U 1REMA 3WW6A 4RQNA 4F91B 1CKFA 5AM1A 3HX0A 4R66A 3WU8A 1ZQHA 5L1KA 4IR9A 4B9LA 3V7LA 1GB2A 2KK0A 2NO4A 1DK2A 3PSIA 1IWWA 2BCUA 229LA 4HTQA 1G0MA 1SLYA 1L63A 5DM9A 2QB0A 1QT4A 2H3ZA 1L44A 4O3QA 1QTMA 2PMZF 4BAFA 5ALLA 1XU4A 4XJGA 3MGIA 4I29A 5DBAA 5K7OA 2NRXA 4DWIA 1ZD3A 2G09A 3SD7A 5E9RA 3WH1A 2VA8A 4ELUA 2JH7A 2OU0X 4WLXA 1XSFA 1OUQA 1L21A 1QLNA 1C7YA 4W53A 3RJFA 2UVWA 1NNLA 245LA 3RH5A 2LKYA 1O23A 1LZ6A 1HEWA 4XYYA 4ECWA 4P0PA 1L09A 3NVYA 1L15A 211LA 2CWIA 2W9CB 1JISA 3L5KA 2NTHA 1SKWA 4GN5C 4FE3A 4I0CA 2F8LA 5IHGA 3JPNA 4DFKA 3BKHA 1RPLA 1IP6A 2NRWA 5B66U 2HECA 1GB0A 5KXYA 2KV2A 3GZFA 1LYFA 3RJHA 3QU5A 2ZIXA 8ICCA 1IP1A 4WM1A 5K4LA 1Z00B 1L19A 3K3TA 5BOLA 1T94A 4B4JA 184LA 2OE4X 3K4GA 4GBRB 5F9XA 3H4BA 2RBNA 3ONNA 2FPMA 1L85A 1GF5A 2O7AA 4H9AA 1BNPA 1HUZA 4U7CA 4RQ1A 1CNSA 4PGXA 1LYYA 4R6CA 4QZ8A 4XJHA 3J4GA 5KFPA 4UASA 2K89A 5F9NA 5J8YA 4MFFA 205LA 4QZIA 1EQEA 224LA 3SAHA 2DQHY 4W94A 5FDJA 4WO9A 4B9NA 3QNMA 4CRXA 1LHIA 3HT9A 1WUDA 1SGGA 1GFKA 4UB5A 5IIIA 3AEVA 1B5UA 1T6HA 2FMQA 2W9BA 1L93A 3F6ZA 5KFCA 5KFOA 1P46A 1SV0A 7ICGA 1V7SA 3C82A 1L3VA 128LA 3L4PA 4M9LA 7ICVA 1UA1A 1JKDA 4ARJA 1LZSA 1GBOA 1CV6A 5KT2A 1L99A 1WQNA 5KG4A 1LSPA 3C81A 171LA 4I7LA 1LW9A 3RUNA 2LPEA 4XA5A 1CJ9A 2E8NA 8ICXA 159LA 1AZFA 3NVVA 5DGBA 2DKVA 4GC7A 3CT5A 1QDRA 1IP3A 5EBHA 3SAFA 1KSPA 1I56A 3NGDA 3SB6A 3C2LA 4BUGA 4H9CA 2B73A 3V72A 4HV2A 3SR6A 5DLFA 4KLUA 1CV4A 1G7HC 4KX3A 4WMGA 5DN4A 1N63A 1XNSA 3ZDEA 1GE4A 3WUNA 1G0LA 3Q8KA 7ICUA 2ZQ3A 1GAZA 1VAUA 2XI9A 4BDPA 3OJUA 227LA 3GUMA 2RB1X 1C6DA 4ECQA 2L5YA 5ALZA 3N7SC 1L16A 3ZVQA 2HI0A 4LJXA 2RLTA 4Z3MA 2V4QA 4Z6DA 2DQGY 3RU5A 5J2KA 1L36A 2FLLA 3B0IA 4CHXA 4Q45A 1C6TA 256LA 5KFXA 144LA 3B72A 1HMKA 3A95A 8ICUA 1TDYA 2W3SA 5ALMA 4RQ3A 5LVIA 1ZQTA 1OP9B 4P0QB 5DQIA 1SQ2L 1UT5A 3RB4A 1OUAA 4KLJA 2DQJY 5D49A 1TKDA 5KFZA 1LMQA 4ECYA 5LVGA 3Q8RB 1HEKA 1N48A 3HH5A 4DLEA 4QIWC 1DYCA 4ED6A 2NO5A 4WM4A 3LN2A 183LA 2F4AA 1OVHA 1XGQC 2X0AA 5D4BA 4XRHA 3C83A 4NGZA 3C28A 4J1AA 1C6LA 1SB3C 1JTNA 1LOZA 1EQ5A 1G0JA 2WF6A 4PK0A 1V97A 3TI0A 2LMRA 3HH4A 1ZD5A 1L6NA 1C10A 2FMPA 1DQJC 3MR2A 1F10A 129LA 146LA 4B6JA 2BQLA 5LVJA 4Y2PA 4OOOA 2B6WA 4FZNA 4YD1A 1FKQA 5F81A 1NF5A 1SXEA 1B7SA 1L31A 4K4HA 1C69A 2BQFA 2ATLA 1IORA 1JX4A 1DYDA 4I7KA 5AIAA 3BQ7A 3OGUA 4LDLA 3IM1A 1D0KA 4HPEA 3IP4B 3HUAA 4GLAA 5HNLA 3WKEA 8ICZA 4J9QA 4UB6U 1GPQC 1N56A 1CV0A 3SB8A 2XGQA 4ETBA 5E4PA 4Y2TA 1QSYA 5LAFA 132LA 4NGLA 9ICFA 4NLKA 4EX6A 4JUZA 2E5SA 5KFQA 3S6JA 2BQJA 5J0TA 1HEPA 4M6DA 4HTNA 4DD1A 4DL3A 2BAAA 3NRZA 4K4IA 2V4RA 1ZQLA 2KVCA 2F4GA 1C6CA 4W52A 4UB1A 4H92A 5ILCA 2R8HA 253LA 1SKRA 2P6RA 3HFMY 3N9CA 2A1JB 2BQOA 1B5ZA 5ALSA 4TURA 258LA 3GUJA 1UIAA 4W59A 2H3FA 1HIWA 1KIRC 1XFPL 2K8BB 2XY5A 1IP2A 4TSCA 2BQUA 4UARA 5EE9A 2DL0A 5AKGA 4NGVA 4YXCA 1YZ7A 5AKXA 1D3FA 2HOFA 3WUMA 5A3ZA 1K5OA 4I7PA 5D5FA 2A19A 3HBDA 2KJ5A 4J7VA 2FLNA 4DD2A 5KFTA 4DKLA 4M9GA 4B9MA 111LA 1L01A 234LA 1D6PA 2LYAA 1XEKA 2YX8A 1LMPA 1QT7A 5J2GA 2RAYX 3OHBA 1ZD4A 3HDFA 4ARQB 2DGZA 1A77A 5D46A 4NSHA 3L64A 3EO5A 2ASLA 2LI6A 1A0PA 2XICA 3ICXA 4ECUA 4I2GA 2NRVA 1B5XA 122LA 1L66A 4O5CA 5HMJA 2ZUDA 189LA 3HT3A 1L18A 3AJNA 4ETDA 1NOMA 2LC9A 4YQWA 4J9NA 1NHBA 1ZQIA 3DKEX 2Y9UA 1L60A 3RB0A 5IIJA 1ZQQA 134LA 1P36A 3GUOA 4HJZA 4XJIA 5KXXA 3N7PD 3W6DA 5KFWA 2KJ8A 5JRTA 1LZDA 4UWNA 2UVVA 2DQIY 3SP3A 115LA 1HSXA 2D4IA 2EKSC 4DSFA 1V7TA 1NDMC 5KFLA 3UQ2A 2IGCA 4H90A 1BPDA 3RZEA 1IOCA 4AP9A 3F5AA 3OE0A 3LYZA 5F3XB 4I7SA 1KIPC 5HR6A 1GXXA 3PSTA 2DQDY 3SN6R 5DB6A 2LYMA 235LA 1HFYA 2MUTA 3K1RB 2HHTA 5KXLA 4QZAA 1IOSA 4ET9A 3HWTA 1JRPA 1Z1VA 1NKBA 2EH9A 2HVHA 4BX9C 2CDSA 3TXKA 4PL1A 4I2BA 4KXIA 4RW2A 2KICA 4WG1A 1E8LA 3RJGA 182LA 1RYUA 2IOFK 206LA 2IOFA 4FBTA 8ICJA 104LA 3SEIA 4IASA 1IVMA 2UVRA 2JRZA 4DD9A 1L89A 3B0XA 1ZQSA 1WQMA 5FEKA 5DB9A 4HYKA 2YBMA 3PZPA 5L9XA 5ALHA 4N9RA 1YT3A 1CU3A 5AI5A 2HBJA 5C0YA 1BWJA 1U9LA 4PZNA 1ZETA 3TXJA 1HENA 4NGOA 2EANA 4YM8A 2OM6A 2W1LA 4F8RA 2ZIJA 2YMPA 139LA 170LA 5AM5A 3IJUA 1TAQA 2B0CA 3DN6A 1B0DA 1VDVA 2Y1JA 4NM2A 2I6ZA 4PHIA 5J2DA 5EWEA 1UACY 1LYZA 1QSWA 3C5GA 1YAMA 5J0WA 3C5FA 5AI0A 4NV0A 2ES6A 1ZQDA 2J6SA 4M0AA 1ZD2P 8ICEA 225LA 4HP0A 2WHEA 3PBLA 1Z3EB 4DEZA 4F93B 4DSJA 2F44A 1SL2A 3OTQA 1XGTC 1FO4A 4YD2A 4YXJA 1NHEA 2HBLA 4I2DA 1TV9A 1F6RA 5CB1A 3F2DA 1SWVA 3T3FA 8ICMA 3T5KA 4F71A 2I1QA 2EZYA 2YBHA 1ZQXA 3QZ8A 4DFJA 4UAZA 1IC7Y 1F44A 239LA 1P7DA 1GFEA 5CJ7A 3EXDA 4YEOA 3RB6A 1LZ1A 5J8YC 2ZTEA 2BQEA 2MU2A 4ECRA 2ISPA 3H0MB 255LA 9ICSA 1C45A 4EMNA 4RLMA 5HHIA 1L55A 2QARA 5AKZA 4RZRA 2W1XA 3RJKA 2E1FA 4J03A 2ZILA 4WJ3B 1VFBC 3K2RA 4GCEA 2BR0A 1UIDA 1G0KA 1CKCA 5JU5A 1T8FA 1SV0C 3H8SA 4NLCA 3CSRA 4FS2A 1L38A 4EYHB 3PW5A 5E79U 1IR9A 3CQLA 5ALJA 3QYPA 1YILA 2Q4TA 4ML7A 1LJJA 1JROA 3UM9A 4MEXA 2BCRA 3TXBA 9ICGA 1L48A 4LFPA 1N5WA 3WUAA 196LA 2D6BA 1T3PA 1LJ3A 126LA 5J7CA 2KSOB 4DCCA 172LA 1LZYA 1GB7A 1LZAA 5HNKA 1DYAA 4RW1A 158LA 2W8KA 4YFKA 5AKEA 1YAOA 1FLYA 5KG5A 2MEEA 4E0DA 3WU9A 1QT8A 1LAAA 5J2HA 2A4TA 3H8JA 2P66A 1QUDA 4M6WA 3WK5A 4UAWA 1X2IA 9ICEA 3EZ5A 4QNLA 2Z2FA 3HILA 2BQMA 1DGSA 2ZNXY 1L65A 1X40A 4CGZA 1ZVHL 5KXWA 1L00A 3KBBA 4AXTA 5KFHA 3LVWA 3A67Y 4R64A 4D9ZA 4YMNA 1LZGA 1XEJA 164LA 1OUCA 4OJ6A 3RB3A 1XSNA 4IRDA 2LYOA 3M3UA 1ED1A 3NVWA 5AKKA 3TARA 2NRTA 2KFNA 4F5RA 1GBWA 180LA 5C6IA 3IRUA 1ZQYA 1B7PA 1UIFA 223LA 3VW7A 1REZA 4A7DA 1L10A 3WKCA 5LINA 2W7OA 1KL9A 2W43A 1S97A 1AKIA 2F3NA 5ALOA 4C80A 5J0QA 3ZDCA 1L30A 5EE1A 4DD3A 3L3FX 4O3RA 3IHQB 2ZWBA 2QLTA 2KZMA 4TUSA 4UBBA 2JZBA 3DV9A 3OSNA 2EIZC 3AW6A 4Q44A 5KT5A 1KY0A 1LZRA 4QIWF 1QS9A 4DO9A 1GF8A 108LA 1LWGA 4F4WA 4I7QA 1QTHA 1LJEA 1L06A 5ILFA 8ICHA 4W58A 1K1SA 220LA 4DQQA 4ARMB 3GUPA 1LGUA 167LA 1XSPA 2N5ZA 1WCLA 4NY5A 2ZNWY 4QZHA 1KQQA 4DAJA 4CGEA 4TTDA 4W51A 1S77D 3TACB 1CKDA 1OV5A 4PHAA 2B21A 2PKEA 4EZ9A 2W9MA 3I28A 2AU0A 4O5EA 7ICTA 1B22A 2B6TA 1LI3A 3DN1A 2HSZA 2JEJA 1P2LA 4UAVA 3EYZA 2Z38A 2AGQA 2XO7A 3ETRA 163LA 1P37A 1SL1A 1MSWD 1Z1BA 1T7PA 1L32A 1JIHA 2HU1A 2AJQA 1IWTA 1B4FA 4EKSA 5ALTA 197LA 5APDA 3LZMA 2D91A 5DDMA 4P2HA 2BQRA 1KXWA 1AROP 1IP4A 5KL1B 2HOQA 4WM6A 3BQ2A 249LA 4MCKA 4CJ2A 2H3QA 1EL1A 2BQGA 2L78A 5BPCA 1I20A 1B7LA 2MEGA 5KT3A 3CYMA 3W6AA 2KZ3A 3GQCA 2LYHA 4ECXA 209LA 1X9XA 3TANA 3HUQA 5IIMA 2Z18A 2E8PA 5KFJA 1F0WA 2YVBA 3QEBZ 2R8JA 2YBIA 3P64A 1GB9A 181LA 1LYSA 5LYZA 5HQ1A 5ALIA 4FS1A 3AQEA 3LWMA 176LA 1U48A 1ZQOA 216LA 2KKVA 4DF4A 4R8UB 2K8CB 1HSWA 3PSFA 1HEQA 2EAPA 1L91A 1PK3A 2E8OA 3AM9A 4DOAA 1WVVA 4UAUA 3G6YA 1L3SA 4LYCA 3AU2A 1G7MC 5KNIA 1DK3A 1JKBA 4O9MA 1IY4A 1L08A 3T6UA 4ZH4A 1L33A 4IQWA 4J9MA 2XTHA 3RW8A 4RUAA 2VA2A 3NASA 4QJFB 2CUUA 2MEBA 1ZQVA 1SZHA 3A90A 3ZD9A 192LA 1B5YA 1D3MA 7ICJA 1GF3A 4DSIA 1KBUA 3HT8A 2BLYA 2Z6BA 1GO3F 3MGHA 1BVXA 4LYMA 3C7ZA 5DL9A 1JIYA 4KN7A 2BHNA 4H93A 4DDCA 1AT5A 2PXIA 3C7YA 2AQ0A 3V2WA 4C0ZA 2LYZA 3PO4A 1C43A 1YANA 5B06A 1GFJA 1JJ0A 1N2XA 1LSMA 5DG9A 1MC8A 4UWUA 3DN8A 1T8EA 1CU2A 4W96A 2J6UA 4L41A 1XJUA 4EENA 1L80A 2K8AA 1MQ2A 3HKZC 1LZ4A 2EPEA 4R0FA 2Z12A 1LYEA 5T3FA 4QZGA 3N97B 2DKZA 5FSTA 3HW8A 4H1PA 5LVKA 1KXYA 2D4KA 3T5JA 8ICPA 5CWRA 1RM6C 4MSTA 1OW5A 3KD3A 3OE6A 4J9OA 4QDNA 1HEOA 2R18A 3UQ0A 1JSFA 1L7MA 2ZXHA 1NK4A 1P56A 2FPLA 1IV8A 2KG5A 1C6MA 5F16A 5KFEA 3CW2C 1QSQA 2M9NA 1D3JA 2DF4B 3RTVA 226LA 1L41A 1D8YA 4Y2JA 3P4ZA 4MR1A 4UB4A 5DQGA 1P2RA 1SIJA 4LYBA 1IC5Y 2OEHA 1OWYA 3OJSA 1PQMA 241LA 4DSEA 3SYZA 3PX6A 1NK8A 1G0GA 4H8XA 4B9VA 2NTGA 4M9HA 3PMLA 2RHFA 5DLAA 3A3RX 4ZIXA 1IWYA 2Z19A 4IQVA 2WB1F 1LMCA 1LHMA 4RNNA 3RH4A 1HJPA 2JH1A 5KXMA 1H38A 1DRGA 3FDSA 210LA 2GOLA 4PHEA 1DYGA 1YIKA 1QQ5A 2HOIA 3AGHA 4LVSA 4CFPA 5CEHA 140LA 1IWZA 3OSPA 3THVA 3TXGA 4XQ8A 118LA 4XN6A 5KFKA 1P5CA 107LA 6LZMA 4NLNA 2BPGA 2J6TA 1T3QA 3PW2A 5LXWA 1L43A 4XUSA 1WG8A 5DB8A 3B6LA 1JEFA 1JPOA 232LA 4B4IA 3AL0B 2F8KA 1L95A 1OUDA 4AYBF 1QT6A 2K4PA 3DN4A 3HDEA 4LGKA 3ZI4A 1GDWA 5DDYA 1K1QA 4C7ZA 1OQMA 4IATA 2R8GA 2ANXA 4QEQA 2W11A 2CN1A 1BPZA 1L13A 3TMVA 8ICLA 3SAGA 3GUIA 3AMZA 3T5HA 4DOCA 1ZQBA 4K4GA 2OYYA 1ZRMA 5ALQA 1PK1A 1QUGA 4IR1A 2QARC 3TFRA 1L92A 3UXNA 2H9KA 3RFAA 3O0FA 5KFFA 1BHZA 1UIBA 1FDLY 1MA7A 1L56A 1ZQUA 2YN4A 2Z39A 1M6YA 4CDGA 5T14A 1D3NA 3DN3A 3WXUA 1YL1X 3RF9A 3KKAA 5L1IA 8ICWA 1TBYA 1JJ1A 3AGIA 2Y0SC 3M6KA 3HBEX 2ZIUB 4QW9A 1IWUA 4DL4A 3WKAA 1NKCA 9ICJA 1L47A 5AICA 1IWVA 3GUKA 4UATA 3A8ZA 4F5OA 5B5EU 2OE7X 3C80A 1BGIA 3P66A 4WM5A 4NHPA 2HHQA 1ALCA 3C1ZA 5A3EA 1L17A 1S10A 8ICVA 4OO1J 3TMXA 1SV4A 7LZMA 4B4EA 1KIQC 1FKVA 4EKQA 1Z4OA 2BQAA 3VWOA 1OVJA 4IL6U 4UQGA 4Y2RA 1N61A 1ZYTA 2F30A 1QTVA 4RT2A 1L42A 3FI5A 2YY6A 1LGXA 1LJNA 3GILA 1COOA 1S9FA 1IXRA 4DF8A 1C6BA 4YEMA 2LHTA 5ALGA 5B1GA 3KZXA 2Y1IA 2BPFA 3G3WA 1RFPA 2ZIVB 1IR7A 1YKYX 1U45A 1JXLA 1SXDA 5CP2A 1L90A 240LA 4RPYA 1C6GA 4DQIA 3LYSA 3RAXA 3EMSA 166LA 2NYVA 1SWYA 2BLXA 5AKJA 3HU8A 4NGIA 190LA 1UCOA 1T4GA 9LYZA 5CHGA 4Z98A 2AH5A 4KLIA 3KOOA 212LA 5I4WA 3GXKA 5AI4A 5KXRA 4F92B 4UB2A 1B7QA 219LA 2DFLA 4KLSA 5J0PA 4IRKA 248LA 3MR3A 1JALA 2PFQA 1CUQA 1GWDA 1ZMYL 1B7NA 5HMMA 1GF4A 3A34A 1L5UA 9ICIA 1NJWA 1L86A 3W3EA 3CSZA 4TUNA 1LB2B 5APCA 135LA 103LA 1GB8A 3Q8PB 4GXKA 1L83A 1CI4A 1CUKA 1PQJA 5KT6A 1YAQA 1VLBA 4B9SA 3BS5B 3OE9A 3GIMA 1DPWA 1C46A 2IFFY 4Z46A 1DKJA 1X6IA 4O3OA 1GBYA 1ZQKA 4IQTA 1BPEA 2D6FC 3CDTA 1S0NA 5KFSA 3H40A 2W55A 4FZLA 3HP6A 2BQHA 2G4PA 1LJFA 2B5ZA 3HTFA 2C8OA 3N9EA 4X5VA 3BZKA 1QUOA 2ZIWA 2WF7A 2LYBA 1L74A 4QWEA 1QSSA 3QEAZ 1KNIA 3ETLA 5KXZA 1L22A 4M9JA 3QUTA 1VDPA 3EBAB 199LA 185LA 3I76A 246LA 4X3BA 214LA 1CJ7A 3UMBA 1BNOA 1G07A 3SBBC 4Y2SA 5GTHU 3KHRA 2LM1A 6LYTA 5J2BA 1L7NA 4RQ8A 2DBTA 1L82A 5AM2A 1C6AA 4ZPUA 4G9BA 4I7TA 3JPRA 3DMVA 2A7FA 4JV0A 3DMZA 3CP8A 3NUQA 5KAIU 4KLEA 1GD6A 3HT7A 4GN4A 123LA 1LJKA 2ZG6A 3PDSA 1LZNA 4LT1A 2HHVA 4B9UA 1LSZA 3V7JA 1LJIA 4GCBA 1X42A 5EE3A 1LZBA 4ZOHC 1I1ZA 4DDAA 1ZQEA 3QUQA 4FO6A 1L03A 5KXPA 5AKYA 3AU6A 2W54A 3RJJA 2MEFA 149LA 1BB3A 5LYMA 5KFRA 2FLPA 3B0KA 4JV2A 3G3VA 1OUJA 4O5KA 2VKQA 5KG6A 3AYQA 2W04A 4NSJA 3H7IA 4RQ6A 1UIGA 4J9LA 8ICGA 2I26L 4YVZA 4RQ5A 3AQFA 2HW3A 3D2NA 4KX5A 1BWIA 5B59A 4N8ZA 5FELA 2KNJA 4E97A 2JEFA 5ALFA 3C8QA 3M9NB 2C2EA 4AQNA 2GO7A 4B9TA 3A93A 1ZQ1C 1X9MA 2M0NA 1LYGA 4XENA 4TQRA 2QB0B 2CRXA 1UHUA 5L1MA 2RBPA 1QSAA 1D0MA 4RNOA 243LA 1ZQJA 2OXOA 3FI7A 3QU2A 2F1IA 1L94A 1WVUA 3AGGG 5KL8B 1LMTA 4NWIA 4F4YA 1FIQA 4KN4A 4JV1A 1H87A 1KDHA 1C6HA 1N5XA 1L61A 1LKYA 4BXOA 5G5GA 5KFDA 1L14A 1CEZA 2YBNA 3UXPA 2EQYA 1L20A 5KFNA 1L02A 1TK0A 2GV0A 3SQIA 2JXJA 1DYEA 3DMXA 4I2IA 3ZEKA 4OO9A 1AQ6A 3H8WA 2IHMA 4P0PB 1L37A 4W57A 4OD0A 4RUCA 1NJYA 1L71A 3WPLA 1ZURA 4KMUA 1XGUC 2RAZX 142LA 1LPYA 3GIJA 2AHOB 3ZDBA 2WAQF 4RQ4A 3EWAA 1YKXX 4LFXA 3HH3A 1IO5A 1L11A 3P68A 2JMGA 3LDAA 1HHLA 4C8OA 3BS7A 2ZTDA 5AI6A 4EEYA 2ZIXB 3C21A 4NHTA 1YKZX 5KG3A 1XC9A 3H0RB 2BKEA 1VJ5A 5KG2A 207LA 1L07A 1L58A 1SKSA 1K28A 1OUFA 3HKZF 3D3DA 4DL2A 9ICWA 3C8RA 4PRUA 153LA 3P65A 1L72A 1XO1A 5KAFU 1KN5A 4MF2A 5ALKA 1C6QA 1RCMA 4WL7A 2F2AB 3WU7A 1XSLA 1B7MA 4P4PA 4YN4A 1HC0A 4F5PA 1O03A 120LA 5IIOA 2ZUCA 5KJ9A 2ZXIA 3E3DA 3JPOA 3QX7A 5BOMA 9ICXA 162LA 1WYGA 2P35A 5F9UA 4C5FA 188LA 3FAHA 4NL9A 4NLGA 1DYFA 2MEDA 3HUKA 2HCFA 2W9BB 2DQFC 1EPYA 5J29A 5CRXA 1QUSA 2RRDA 5GTIU 4II8A 3IWRA 1KS3A 1F0MA 2A1AA 1L24A 1URJA 5ALEA 4DQRA 2JHDA 194LA 5KFIA 2FI1A 3UMGA 4GLXA 2KE7A 237LA 2DQCY 1UT8A 1GFAA 5F9LA 4LZDA 1N4FA 3ZDAA 1PQIA 4ZFPA 2IBKA 3M1YA 9ICQA 1L79A 3R9KA 2UVUA 1VDTA 4TWSA 7ICLA 4J9PA 2DUYA 4G4CA 1I6SA 3QZ7A 5LZMA 261LA 3FYHA 1LKSA 250LA 5B1FA 5I14A 1L67A 1ZV5L 2ZJ5A 4CF4A 3DN0A 1RXWA 7ICNA 3PMNA 2A7DA 2KIWA 2FPKA 3RT5X 3ZVQB 3ED5A 2OH2A 1CU5A 5ALUA 4KL7A 231LA 4F4ZA 1CV5A 1QIOA 2ASJA 5DG8A 3RR8A 4F72A 1XEPA 3QY4A 1IIZA 2CXYA 4R65A 1LSCA 4OWEA 3JPQA 4PJZA 5J2AA 1RXVA 1NQIA 4DQJA 1KFSA 4FDYA 3SZ2A 1FFUA 3KKAC 5CA7A 2B6XA 4NHQA 2YTUA 1V9PA 169LA 1BB7A 2YMMA 7ICFA 1J1XY 1Y88A 4I7MA 2VIXA 4RNMA 4JK1A 1L77A 4EBEA 4LZTA 4G4HA 1LSNA 2ZTCA 3V6KA 1LJ4A 2EQLA 1DYBA 2YBLA 4I7NA 2F2NA 2Y0SF 2OCEA 1H6MA 1UPHA 1JN3A 1MN8A 2G5HB 2W9CA 4JB3A 4NFVA 1JQUA 1GB5A 2DPJA 1XEIA 1JITA 1LSEA 5HMVA 3F53A 1Q46A 3CDRA 155LA 4HTKA 2F77X 3CT0A 1YROA 3TFSA 1NJXA 2HUBA 3ATNA 5KY1A 4JWNA 5A0LA 1IOTA 4BAPA 3WKDA 4DC4A 3UMCA 244LA 3NRWA 1Z00A 3MBYA 3OPXA 8ICKA 251LA 3NY8A 1WTHA 4G3IA 3JPPA 1C68A 3PX4A 2IHNA 2ALZA 1ZQPA 3PO5A 5LIOA 1ZQAA 4DSKA 5KFGA 3VCBA 3A96A 1HF4A 2V9WA 5ALNA 1JJ3A 3N9AA 5ALXA 3N7RC 4GFJA 4QWAA 1B2KA 2RH1A 2OTYX 4DL5A 5J0OA 4KLTA 4JWMA 1L96A 1GF0A 4TUQA 1NI3A 5II3A 1YQVY 4OJPA 1ZYQA 6LYZA 7ICEA 3PW0A 2K60A 1L46A 1UBZA 1LTMA 1GFRA 3KHGA 1L87A 3RRHA 198LA 1TK8A 2D8CA 4I8SA 2KD1A 7ICHA 1ZQMA 1EQ4A 1ZJNA 130LA 4DT3A 4MFCA 3D2SA 1LSFA 3LYMA 1D9DA 2OWOA 1L84A 4QWDA 5DBCA 4BWMA 1LSGA 112LA 2YBJA 4RLNA 1IIPA 1IOQA 1GEVA 3K1ZA 2G4QA 9ICOA 3B9JA 4Y2XA 4GCDA 4ARPA 148LE 4LYTA 1YL0X 177LA 2RDIA 1GHLA 3FE0A 3RNXA 3IDWA 1GF6A 3F9LA 5APEA 200LA 4DWXA 4KLOA 1GXV2 4C8NA 5J2CA 2E8MA 1EXNA 3ODUA 1KW7A 3OHAA 3MR5A 3IG8A 1L57A 2OE9X 7ICOA 4WOAA 1OUEA 5LA8A 1V85A 3CNHA 4NWEA 5C6LA 4QGZA 2MRLA 137LA 2F32A 3T79A 152LA 157LA 2BQDA 1LWKA 4O0IA 1VDQA 1JXEA 1L26A 2DQAA 2CJLA 5J2EA 2KZZA 1NJZA 3PSPA 2QKQA 2JR5A 4DFDA 4ED8A 1L29A 1CUPA 4FBUA 3LZ2A 3KZIU 3HRDD 2A3VA 1A76A 1KLNA 1KW5A 3A6CY 3G6VA 4CF5A 160LA 1C65A 1DI5A 1LCNA 1NKEA 3WXTA 1L05A 4DL7A 4P0QA 3WK6A 4DDBA 1C61A 1QTDA 1KFDA 3H4DA 2BQ3A 4ED7A 5IIKA 3G6XA 3RBEA 221LA 8LYZA 2H5XA 2W9AA 3BQTA 2KMDA 5AI8A 1TAUA 3AZ7A 4USAA 2KN7A 1LPIA 4NXZA 2MUTB 133LA 5KKIA 1C67A 2HMXA 2PI4A 1BPYA 1HELA 2H5ZA 191LA 3Q8SB 165LA 3PY8A 1FEZA 3M9OB 2KFZA 1BVSA 2FYDA 1DI3A 3F5EA 4ECTA 1GDXA 3UPQA 3BQ0A 1G1WA 5ALDA 1B7OA 1LHKA 1CRXA 1RE2A 4GXJA 2K4HA 1T6VL 1LLHA 5DQHA 3F2BA 2LZ2A 1L64A 4RQ7A 5EWFA 2ZJAA 4ECVA 7ICPA 2XJWA 2E1EA 8ICAA 4BGDA 1RJCB 3NS1A 8ICIA 7ICIA 1VDSA 4LT2A 4NGYA 4BADA 2O79A 8ICSA 1KEJA 1TK5A 2ZIKA 3KTQA 1L49A 1TFRA 1IG6A 4ZEEA 2EZZA 3B0YA 3SV4A 1JUDA 2VJ5A 4F4XA 4PGJB 1C6PA 1HFXA 3QUCA 1UA6Y 4HPIA 3M8RA 1WQOA 5ALPA 4B0DA 4UAYA 4XJFA 1B0XA 3BDPA 3HTBA 1C62A 4GCFA 1NBYC 2XY7A 3G3AB 3TXEA 1CKHA 4QZFA 2ZYCA 127LA 2BGWA 4RPXA 5HR7A 3QAKA 3TAPA 4PGYA 5IINA 3LVVA 1A6SA 1G7IC 5AK3A 1LYOA 2O6KA 2D4JA 4TSBA 1PQDA 4NHSA 1T3NA 3BJYA 3AZ6A 3CDOA 1FBIX 4G4BA 2H3VA 4EEKA 3LK9A 2AQ4A 4OWCA 5G5HA 4NWHA 5JENB 1LMNA 2ISOA 1GEZA 1QTCA 3WKBA 3KFUF 2WF8A 1VEDA 2Q0ZX 2YB1A 1P64A 4DQSA 3AUOA 3TXDA 3A94A 2MEHA 1V38A 2A1JA 4ECZA 4ED0A 4YG2A 4EYIB 1VATA 2O4WA 3FADA 4J0LA 3W6BA 5KT4A 2JV3A 1DKKA 3G3BB 3MABA 3MFHA 3OE8A 4OOTA 4QWBA 3M18B 1GE0A 3GV5B 1DXJA 2P6UA 4W55A 1GF7A 3WYHA 109LA 4EKRA 2PC2A 1L28A 2B6ZA 2B6YA 4H8ZA 4OJLA 1WWUA 1CVKA 1RDFA 1L69A 4O3PA 1TLAA 1L88A 3E58A 5KXSA 4C7YA 3NYAA 3N28A 4PPOA 1UIHA 2QARB 5LA5A 4FJRA 1U4BA 1NZPA 4NL9C 3HU9A 2G0AA 168LA 2W7PA 4Y2VA 4NSGA 3MFIA 4DQPA 3AZ5A 1DZBX 5EOZA 3HWLA 2ZUBA 2HEDA 4ARQA 1XWLA 4H94A 4EELA 1IM4A 1N60A 1Z19A 1ZQCA 4Z6CA 2XC9A 4H9EA 3WMKA 1IR8A 1L62A 5KG7A 2B7XA 4UWVA 2Q0MX 3RZ4A 178LA 1UQVA 3GDXA 1Q8KA 1WQQA 1WQRA 2KHQA 1PUZA 2QB1A 2Q9EA 1X9SA 4Y2YA 3U26A 2XBSA 2OHFA 4DOBA 2C28A 1QDTA 2YMLA 3HTDA 1NBZC 2CPRA 187LA 4I28A 151LA 4DS5A 4DS4A 2H9JA 2R8KA 4PH5A 1C6JA 3PR5B 3A0HU 4PJ2C 4RQ0A 2KJ9A 5EWGA 2LM4A 1GE2A 1L8LA 2JEIA 1QUHA 5KKJA 2LBOA 1C08C 3WPJA 2VANA 4IAPA 1WTMA 1LZ5A 3QE8A 5KXNA 1P6YA 4OW1A 5CR0A 3ISCA 4YMMA 4F2RA 2HUKA 2Q9DA 4MHVA 4NGKA 4M6WB 3V6HA 2RBSA 2FYCA 2VJ4A 2KIVA 4YR0A 2RQ5A 4A8EA 1NMMA 1GFTA 5LAGA 7ICQA 1OUBA 4WG7A 2KP7A 2B70A 4IQUA 2KOBA 1CJ6A 2HVIA 4YX7C 5AHXA 4NGJA 238LA 8ICFA 4P2EA 9ICKA 4PRQA 4Z6FA 3HT6A 3GU3A 3TAQA 3TXIA 3M8SA 1B9OA 2KEYA 1P3NA 2W1MA 3GIKA 2BPCA 3V6JA 5DB7A 1L68A 3WULA 1ZWNA 5C6JA 4Q8FA 3EMLA 5ALRA 1LJGA 1L51A 3TADA 3C8SA 2AXTU 1SSYA 3Q8MA 4Q8EA 5J0UA 4RT3A 1RYSA 1OUGA 2OEAX 2RB2X 2Z2EA 3HTGA 4ETCA 1HMLA 2KHVA 1L0KA 2W3RA 1OXJA 2C2DA 7ICKA 5AIBA 3HJEA 1C20A 3EPIA 1DOQA 3PW7A 4W56A 1L7PA 2F1HA 1OUIA 4HV1A 3JPTA 1SX7A 3PW4A 4KLGA 2JZBB 3K75D 5HP4A 2IA6A 3A3QA 1RG6A 1QSBA 5I5QA 2C8PA 1UA0A 5AKLA 2IOHA 4HJVA 4C3WA 4UB8U 1D0LA 3D9AC 4WO6A 4YOPA 1N62A 5IILA 2JEGA 3J81j 4UB3A 3C29A 2HHSA 3QU7A 4TQSA 119LA 5ALYA 1C64A 4LZMA 1QQ6A 4P4MA 1NWGA 1GB3A 3SB5A 4OJ5A 1J2NA 9ICHA 4XADA 1REYA 2F1JA 4I2JA 1NDGC 2GLEA 7ICRA 3OJPA 3J6KA 9ICBA 2BQIA 2PFNA 4CE6A 1LHHA 3AZ4A 1JKAA 4WM2A 4EBDA 1HFZA 1L25A 1PVQA 2RBOA 2ESEA 4QZEA 5I54A 3FA0A 5JTIA 8ICQA 1LHJA 4TX7A 3E2EA 3IN5A 3CT1A 3WK9A 1L59A 2ODGA 4WLTA 4QZDA 3CSQA 1JTOL 2F2QA 4O34A 1GFUA 3PR4A 5APFA 3GV7B 2DKXA 4GLVA 3A92A 4I2FA 3F8VA 1IX0A 1C6IA 9ICPA 2AUBA 2WF9A 3GUNA 1NKHA 3KHLA 131LA 4F50A 9ICVA 4KLMA 1TE2A 1NK9A 1D2YA 5KFVA 5AKHA 4F5NA 1XO0A 4XJBA 3BQ1A 4I2EA 1CU0A 1PQOA 1A2YC 1L12A 2RP5A 1GFHA 4DFPA 4OWBA 1DGJA 7ICSA 3ATOA 1L3UA 4UBCA 1YZ6A 1IEEA 3D4SA 2VA3A 4YCXA 2WF5A 4H9IA 3SB7A 2HEEA 3CDVA 1LZTA 4NJ8A 1UC0A 4EOFA 5HMLA 2KSOA 3VC8A 1SZPA 1ZJMA 3TKAA 4YR2A 3BZCA 4CNQA 3E0FA 1L23A 175LA 3DNAA 3MC1A 228LA 4C8LA 1CKGA 3QNGA 1QQYA 1TAYA 3GV8B 4Y2QA 9ICRA 4GCCA 4J9SA 1L81A 5F14A 4M04A 2GWSA 1CX7A 1S0MA 1L27A 4BS7A 5J2JA 3ZDDA 1Z4NA 2W8LA 1NK6A 2I9GA 2XCAA 4Y2UA 1L97A 4F3OA 2XVTA 1L39A 1LYJA 3MDCA 4BJQA 2YMQA 156LA 5FCPA 4ANRA 1KRPA 174LA 3WW5A 1LMOA 1QSLA 4TUPA 3W6CA 5AM3A 3WVYA 4EJ4A 2B6GA 1JSEA 1IWXA 1FN5A 2YDGA 4I27A 1G06A 4EX7A 1PQKA 5LVHA 1F5SA 1YAPA 1F6SA 2BPUA 1ZQWA 4ICAA 5IELA 3SBAA 1PS5A 4RDSA 3KHHA 4RQMA 2EAMA 1U47A 5KT7A 2ZYPA 3MDAA 2BQBA 3Q8QB 1MQ3A 1LSYA 5AM0A 1FLWA 2WTFA 2B72A 3OK0A 3L2XA 1C6NA 4YP3A 1BVKC 4NM1A 3GIIA 4PHDA 1L53A 4FZMA 1AM7A 4N5RA 5KFMA 2FDRA 2JGAA 1T97A 4LZGA 1MELL 1QT3A 102LA 4F5QA 2MEIA 1LZCA 1ZRNA 2WFAA 4NSIA 3C2KA 1ZQFA 2ZJ8A 2PI5A 8ICTA 1KXXA 4GC6A 4PZOA 4I7RA 9ICLA 4ARMA 3IG5A 4I2AA 1FLQA 3PVXA 2FJ6A 1QQ7A 1CV3A 1JHLA 2KKPA 1JMSA 1PVRA 4MF8A 3MGVA 4KT3A 217LA 5C5JA 8ICBA 1J2MA 4C8MA 4KLHA 259LA 2HEFA 2HEAA 5AKIA 5KG1A 1ECWA 5DLGA 3C2MA 1JUGA 4E3UA 1LVHA 2BCSA 3M9MB 1LI2A 1RZTA 2MA1A 2BCVA 2Z7JA 2YB4A 4LDOA 1TEWA 1QH9A 3D2QA 1KY1A 1PZYA 5J0SA 2LZMA 252LA 4LYZA 1HNLA 4NLBA 5J2IA 4EBCA 1W6ZA 2G06A 2BQKA 4I2CA 5JUMA 1HERA 1CU6A 5L9JA 3A0BU 4I7JA 2PFOA 4O3MA 8ICOA 5J0YA 3QU4A 1AT6A 2MECA 2DBYA 9ICAA 1L04A 5KXOA 1L54A 2F76X 2E3TA 2GH1A 2HEBA 1L8OA 4IRCA 1L52A 1D2WA 1ZOLA 5L3IA 3W6FA 2BDUA 4QZ9A 3W6EA 5KFUA 1SX2A 5KXTA 147LA 3I1YA 1L35A 4R8UA 2KVSA 4AGAA 5KFAA 2PMZC 7ICMA 3DDHA 1D8BA 1FFVA 5FHWA 1PK1B 1RQNA 1GBZA 1L45A 2XQOA 3IJVA 4EPIA 3ORYA 1ZQRA 4EZ6A 4KLLA 3QXGA 2K4EA 1L40A 1U49A 9ICUA 1C60A 3A6BY 4GIBA 1REXA 5ALVA 3WK7A 4RQ2A 4N1EI 1LI6A 2HBMA 1L73A 4PL2A 5L1JA 5DKWA 114LA 1W08A 1XGPC 4NG1A 173LA 4P4OA 3V7KA 1KKXA 2K4IA 1OV7A 1D9WA 1Q3VA 4JMUA 1QT5A 1SWZA 4K5YA 2LZTA 2KTQA 1L0JA 3NVZA
chains in the Genus database with same CATH topology
3HH6A 5AMYA 3SENA 1OUHA 2G4NA 4EPFA 2Y9TA 4GN3A 4WM3A 3CB7A 1CX6A 4I7OA 1LHLA 4G9SA 1BWHA 3NY9A 3WVXA 4W54A 1UUZC 2EAOA 1GF9A 1LKRA 3GXRA 4YXAC 4NGWA 2DQEY 1GFGA 1L50A 1GBSA 1CJ8A 1JI7A 1LYDA 4B1AA 1C63A 195LA 1T8AA 161LA 1B5VA 2WARA 4LDEA 1T8GA 1JTPL 1GFVA 3TADC 1JWRA 1LMAA 5B05A 4NHIA 1D9UA 1ZVYB 2BQNA 4LT3A 254LA 7LYZA 3CDQA 2LCBA 2RB0X 4YF2A 2OU9A 1UCVA 1G7LC 230LA 1SSWA 4DJHA 3AW7A 2I25L 1LZEA 2IHLA 4DD7A 1C6KA 186LA 1GE1A 3BKVA 3GULA 4LYOA 1LSDA 5KXKA 4HSFA 1LYIA 1LJHA 1C6FA 1D6QA 3UONA 222LA 1B7RA 5I4YA 4HJYA 3KAMA 1COKA 1LZ9A 1QS5A 154LA 1L34A 1RI8B 5L3HA 2OTZX 2HUMA 4U3XB 1B6IA 3C7WA 4N0JA 1G7JC 150LA 4M4OA 4IJ4A 247LA 125LA 1WWVA 1JTTL 257LA 1MLCE 4NIJA 1L76A 3V2YA 5IDDA 4DQ5A 1QTKA 3A91A 4H9BA 3ULRA 1J1OY 1G0PA 1IP5A 4XJDA 1HEMA 5DN5A 1XGRC 2B74A 1OYUA 4G49A 4N1CC 2XBRA 1DPXA 1GB6A 1P2CC 4DD0A 3B0OA 1JTMA 1QUTA 233LA 1X66A 2B75A 4ET8A 1UICA 4ETEA 4IS7A 242LA 3TMUA 3JR6A 4WL6A 1KW4A 4EXMA 1A4VA 3DN2A 1JKCA 1DI4A 5HLLA 3LYOA 2HU3A 4H9FA 1C7PA 1LKYB 1B5WA 2W1YA 5I4XA 215LA 2RBRA 1GAYA 5LYTA 262LA 1Z55A 3HBHA 2FBDA 5B07A 2ANVA 193LA 2BQCA 4WLDA 4KPMA 4EKPA 236LA 2RSCA 4ETAA 2MEAA 1WTNA 4NEBA 3T36A 1QTEA 2HTXA 208LA 4YENA 1INUA 5I53A 1CTWA 1DXSA 1OWZA 4H9HA 5D5CA 1LGWA 2LHMA 1QTZA 2Y8PA 3WPKA 1IC4Y 1WQPA 1L70A 1J1PY 2NWDX 2VB1A 1L75A 1C6EA 3LYTA 1BB6A 145LA 143LA 3BS5A 4CFOA 4H8YA 2CGIA 1G0QA 1GE3A 4DQ7A 2ZQ4A 113LA 1BQLY 1LSAA 1IY3A 2YSSC 3LHMA 3TXHA 260LA 5HNCA 4H91A 1QTBA 1LSBA 2Z37A 1L0JA 2F47A 4DYGA 3H8MA 1UIEA 201LA 4B49A 3LZTA 1GBXA 4QY9A 1TCYA 1FLUA 1G1VA 1LZ8A 4NG8A 4ARLA 4J1BA 4WLYA 138LA 1C66A 2FE9A 3SB9A 4S0WA 3AB6A 1LYHA 4OWAA 1CV1A 213LA 3TXFA 141LA 3WL2A 1XJTA 2D3DA 3G3XA 1L98A 110LA 4OWHA 3TMWA 1OVKA 5M1YA 2OU8A 218LA 1P7SA 4GRVA 1BB4A 4Z41A 3MGWA 2RBQA 1IP7A 1BB5A 2HULA 2FBBA 3WW6A 1REMA 4RQNA 1CKFA 3WU8A 1GB2A 1IWWA 229LA 4HTQA 1G0MA 1SLYA 1L63A 5DM9A 2QB0A 1QT4A 1L44A 4BAFA 4XJGA 5K7OA 5E9RA 3WH1A 2OU0X 4WLXA 1XSFA 1L21A 4W53A 245LA 1O23A 4XYYA 1LZ6A 1HEWA 1L09A 1L15A 211LA 2CWIA 1JISA 2NTHA 4GN5C 4I0CA 5IHGA 3BKHA 1IP6A 2HECA 1GB0A 5KXYA 1LYFA 1IP1A 4WM1A 1L19A 3K3TA 4B4JA 184LA 2OE4X 4GBRB 5F9XA 2RBNA 1L85A 1GF5A 2O7AA 4H9AA 1CNSA 1LYYA 4R6CA 4XJHA 3J4GA 5J8YA 205LA 1EQEA 224LA 2DQHY 4W94A 5FDJA 4WO9A 1LHIA 3HT9A 1SGGA 1GFKA 1B5UA 1T6HA 1L93A 3F6ZA 1P46A 1SV0A 1V7SA 3C82A 128LA 4ARJA 1JKDA 1LZSA 1GBOA 1CV6A 1L99A 1WQNA 1LSPA 3C81A 171LA 4I7LA 1LW9A 3RUNA 2LPEA 1CJ9A 2E8NA 159LA 1AZFA 2DKVA 3CT5A 1QDRA 1IP3A 5EBHA 1I56A 3SB6A 4H9CA 2B73A 4HV2A 1CV4A 1G7HC 4WMGA 5DN4A 1GE4A 3WUNA 1G0LA 2ZQ3A 1GAZA 1VAUA 227LA 3GUMA 2RB1X 1C6DA 1L16A 2L5YA 3ZVQA 4Z3MA 2DQGY 3RU5A 1L36A 3B0IA 4CHXA 1C6TA 256LA 3B72A 144LA 1HMKA 3A95A 1TDYA 5LVIA 1OP9B 1SQ2L 1OUAA 2DQJY 1LMQA 5LVGA 3HH5A 1DYCA 4WM4A 3LN2A 183LA 2F4AA 1OVHA 1XGQC 2X0AA 3C83A 4NGZA 4J1AA 1C6LA 1JTNA 1LOZA 1EQ5A 1G0JA 4PK0A 2LMRA 3HH4A 1C10A 1DQJC 1F10A 129LA 146LA 2BQLA 5LVJA 4OOOA 2B6WA 1FKQA 5F81A 1NF5A 1SXEA 1B7SA 1L31A 1C69A 2BQFA 1IORA 1DYDA 4I7KA 3BQ7A 4LDLA 1D0KA 4HPEA 3HUAA 4GLAA 5HNLA 1GPQC 1CV0A 3SB8A 4ETBA 5E4PA 5LAFA 132LA 4NGLA 2BQJA 1HEPA 4M6DA 4HTNA 4DD1A 2BAAA 2F4GA 1C6CA 4W52A 4H92A 5ILCA 253LA 3HFMY 3N9CA 2BQOA 1B5ZA 258LA 3GUJA 1UIAA 4W59A 1KIRC 1XFPL 1IP2A 4TSCA 2DL0A 4NGVA 4YXCA 1D3FA 3WUMA 5A3ZA 4I7PA 5D5FA 3HBDA 4J7VA 4DD2A 4DKLA 111LA 1L01A 234LA 1D6PA 1XEKA 1LMPA 1QT7A 2RAYX 3HDFA 4ARQB 4NSHA 3L64A 3EO5A 1B5XA 122LA 1L66A 5HMJA 189LA 1L18A 3AJNA 4ETDA 2LC9A 1NHBA 3DKEX 2Y9UA 1L60A 134LA 1P36A 3GUOA 4HJZA 4XJIA 5KXXA 3W6DA 1LZDA 5JRTA 4UWNA 2DQIY 3SP3A 115LA 1HSXA 2D4IA 2EKSC 1V7TA 1NDMC 2IGCA 4H90A 3RZEA 1IOCA 4I7SA 3OE0A 3LYZA 5F3XB 1KIPC 1GXXA 2DQDY 3SN6R 2LYMA 235LA 1HFYA 3K1RB 5KXLA 1IOSA 4ET9A 2CDSA 1Z1VA 3TXKA 4KXIA 4RW2A 1E8LA 4WG1A 182LA 206LA 4IASA 104LA 3SEIA 1IVMA 4DD9A 1L89A 1WQMA 5FEKA 2YBMA 4N9RA 1CU3A 1BWJA 4PZNA 3TXJA 1HENA 4NGOA 2EANA 4YM8A 2W1LA 2ZIJA 139LA 170LA 3IJUA 3DN6A 1B0DA 2I6ZA 4PHIA 1UACY 1LYZA 1QSWA 1YAMA 2ES6A 4HP0A 225LA 3PBLA 2F44A 1XGTC 1NHEA 1F6RA 2YBHA 1IC7Y 239LA 1GFEA 3EXDA 4YEOA 1LZ1A 5J8YC 2BQEA 255LA 1C45A 4RLMA 1L55A 2QARA 2W1XA 2ZILA 1VFBC 3K2RA 4GCEA 1UIDA 1G0KA 1CKCA 5JU5A 1T8FA 1SV0C 3CSRA 1L38A 1IR9A 3CQLA 1YILA 4ML7A 1LJJA 3TXBA 1L48A 4LFPA 3WUAA 196LA 2D6BA 1LJ3A 126LA 5J7CA 2KSOB 172LA 1LZYA 1GB7A 1LZAA 1DYAA 4RW1A 158LA 1YAOA 1FLYA 2MEEA 3WU9A 1QT8A 1LAAA 2A4TA 1QUDA 2Z2FA 3HILA 2BQMA 2ZNXY 1L65A 1X40A 1ZVHL 5KXWA 1L00A 4AXTA 3A67Y 4D9ZA 1LZGA 1XEJA 164LA 1OUCA 2LYOA 3M3UA 1GBWA 5C6IA 180LA 1UIFA 1B7PA 223LA 3VW7A 1REZA 4A7DA 1L10A 5LINA 1AKIA 2F3NA 1L30A 4DD3A 2ZWBA 2EIZC 3AW6A 1KY0A 1LZRA 1QS9A 1GF8A 108LA 1LWGA 4I7QA 1QTHA 1LJEA 1L06A 5ILFA 4W58A 220LA 4ARMB 3GUPA 1LGUA 167LA 2N5ZA 4NY5A 2ZNWY 4DAJA 4CGEA 4TTDA 4W51A 1OV5A 3TACB 1CKDA 2B6TA 3DN1A 1LI3A 1P2LA 2Z38A 163LA 1P37A 2HU1A 1L32A 1IWTA 1B4FA 4EKSA 197LA 5APDA 3LZMA 2D91A 1KXWA 1IP4A 4WM6A 249LA 4CJ2A 1EL1A 2BQGA 2L78A 1I20A 1B7LA 2MEGA 3W6AA 3HUQA 209LA 1X9XA 2Z18A 2E8PA 2YVBA 1F0WA 2YBIA 5LYZA 3P64A 5HQ1A 1GB9A 181LA 1LYSA 176LA 216LA 1HSWA 1HEQA 2EAPA 1L91A 1PK3A 2E8OA 1WVVA 4LYCA 1G7MC 5KNIA 1JKBA 1IY4A 1L08A 3T6UA 1L33A 2XTHA 3RW8A 2MEBA 2CUUA 3A90A 192LA 1B5YA 1D3MA 1GF3A 3HT8A 2BLYA 2Z6BA 1BVXA 4LYMA 3C7ZA 5DL9A 1JIYA 4H93A 4DDCA 1AT5A 3C7YA 3V2WA 2LYZA 1C43A 1YANA 5B06A 1GFJA 1JJ0A 1LSMA 4UWUA 3DN8A 1CU2A 4W96A 4L41A 1XJUA 1L80A 2EPEA 1LZ4A 4R0FA 2Z12A 1LYEA 5T3FA 2DKZA 5FSTA 4H1PA 5LVKA 1KXYA 2D4KA 4MSTA 1OW5A 3OE6A 4QDNA 1HEOA 1JSFA 1P56A 2KG5A 1C6MA 5F16A 1QSQA 1D3JA 226LA 1L41A 3P4ZA 4MR1A 1P2RA 4LYBA 1IC5Y 1OWYA 1PQMA 241LA 1G0GA 4H8XA 2NTGA 5DLAA 3A3RX 4ZIXA 1IWYA 2Z19A 1LMCA 1LHMA 5KXMA 210LA 1DYGA 1YIKA 4CFPA 3AGHA 140LA 1IWZA 3TXGA 118LA 4XN6A 1P5CA 107LA 6LZMA 5LXWA 1L43A 3B6LA 1JEFA 1JPOA 232LA 4B4IA 1L95A 2F8KA 1OUDA 1QT6A 3DN4A 3HDEA 2K4PA 4LGKA 1GDWA 4IATA 1OQMA 2ANXA 4QEQA 1L13A 3TMVA 3GUIA 1QUGA 1PK1A 2QARC 1L92A 2H9KA 1BHZA 1UIBA 1FDLY 1L56A 2Z39A 3DN3A 1D3NA 3WXUA 1YL1X 3KKAA 3AGIA 1TBYA 1JJ1A 3HBEX 1IWUA 1L47A 1IWVA 3GUKA 3A8ZA 2OE7X 3C80A 1BGIA 3P66A 4WM5A 4NHPA 1ALCA 5A3EA 1L17A 3TMXA 1SV4A 7LZMA 4B4EA 1KIQC 1FKVA 4EKQA 2BQAA 3VWOA 1OVJA 1ZYTA 2F30A 1QTVA 1L42A 3FI5A 1LGXA 1LJNA 4YEMA 1C6BA 5B1GA 3G3WA 1RFPA 1IR7A 1YKYX 4EMNA 1L90A 1SXDA 240LA 1C6GA 3EMSA 166LA 1SWYA 2BLXA 3HU8A 4NGIA 190LA 1UCOA 9LYZA 4Z98A 5I4WA 212LA 3GXKA 5KXRA 1B7QA 219LA 248LA 1CUQA 1GWDA 1ZMYL 1B7NA 1GF4A 3A34A 1L86A 3W3EA 3CSZA 4TUNA 5APCA 135LA 103LA 1GB8A 1L83A 1PQJA 1YAQA 3BS5B 3OE9A 1DPWA 1C46A 2IFFY 4Z46A 1DKJA 1GBYA 3CDTA 2G4PA 2BQHA 3N9EA 3HTFA 1LJFA 2B5ZA 2C8OA 1QUOA 1L74A 1KNIA 5KXZA 1L22A 1VDPA 3EBAB 199LA 185LA 246LA 4X3BA 214LA 1CJ7A 1G07A 3SBBC 6LYTA 2DBTA 1L82A 1C6AA 4ZPUA 4I7TA 3DMVA 2A7FA 3DMZA 3HT7A 4LT0A 1GD6A 4GN4A 123LA 1LJKA 3PDSA 1LZNA 4LT1A 1LSZA 1LJIA 4GCBA 1LZBA 1I1ZA 4DDAA 1L03A 5KXPA 2MEFA 149LA 1BB3A 5LYMA 3B0KA 3G3VA 1OUJA 3AYQA 4NSJA 1UIGA 2I26L 1BWIA 5B59A 4N8ZA 5FELA 4E97A 3C8QA 4AQNA 3A93A 1LYGA 4XENA 2QB0B 5L1MA 2RBPA 1QSAA 1D0MA 243LA 3FI7A 1L94A 1WVUA 3AGGG 1LMTA 1H87A 1C6HA 1L61A 1LKYA 1L14A 2YBNA 1L20A 2GV0A 1L02A 1DYEA 3DMXA 3ZEKA 4OO9A 1L37A 4W57A 1L71A 3WPLA 1ZURA 1XGUC 2RAZX 142LA 1LPYA 1YKXX 4LFXA 3HH3A 1IO5A 1L11A 3P68A 1HHLA 3BS7A 4NHTA 1YKZX 207LA 1L07A 1L58A 3D3DA 1K28A 1OUFA 3C8RA 4PRUA 153LA 3P65A 1L72A 1C6QA 4WL7A 1RCMA 3WU7A 1B7MA 1HC0A 120LA 5KJ9A 3E3DA 162LA 5F9UA 4C5FA 188LA 4NL9A 1DYFA 2MEDA 3HUKA 2DQFC 1EPYA 1QUSA 4II8A 3IWRA 1KS3A 1F0MA 1L24A 194LA 2KE7A 237LA 2DQCY 1GFAA 1N4FA 1PQIA 4ZFPA 1L79A 1VDTA 4TWSA 4G4CA 1I6SA 5LZMA 261LA 250LA 1LKSA 5B1FA 5I14A 1L67A 1ZV5L 3DN0A 2A7DA 3RT5X 3ZVQB 1CU5A 4KL7A 231LA 1QIOA 1CV5A 1XEPA 3QY4A 1IIZA 1LSCA 4OWEA 4PJZA 1NQIA 4DQJA 4FDYA 3KKAC 2B6XA 4NHQA 2YTUA 169LA 1BB7A 1J1XY 4I7MA 1L77A 4LZTA 4G4HA 1LSNA 1LJ4A 2EQLA 1DYBA 2YBLA 4I7NA 2F2NA 1H6MA 4NFVA 1JQUA 1GB5A 1XEIA 1JITA 1LSEA 5HMVA 3CDRA 4HTKA 155LA 3CT0A 1YROA 2HUBA 3ATNA 5KY1A 1IOTA 4BAPA 4DC4A 244LA 251LA 3NY8A 1WTHA 1C68A 5LIOA 3A96A 1HF4A 1JJ3A 3N9AA 1B2KA 2RH1A 2OTYX 1L96A 1GF0A 5II3A 1YQVY 6LYZA 2K60A 1L46A 1UBZA 1LTMA 1GFRA 1L87A 198LA 2D8CA 4I8SA 1EQ4A 130LA 4DT3A 1LSFA 3LYMA 1L84A 1LSGA 112LA 2YBJA 4RLNA 1IOQA 1GEVA 4GCDA 2G4QA 4ARPA 148LE 4LYTA 1YL0X 177LA 1GHLA 3FE0A 3RNXA 3IDWA 1GF6A 3F9LA 5APEA 200LA 4DWXA 1GXV2 3ODUA 2E8MA 1KW7A 1L57A 2OE9X 4WOAA 1OUEA 5LA8A 1V85A 4NWEA 5C6LA 4QGZA 137LA 2F32A 152LA 157LA 2BQDA 1LWKA 1VDQA 1L26A 2DQAA 2CJLA 2QKQA 1L29A 1CUPA 3LZ2A 1KW5A 3A6CY 160LA 1C65A 1DI5A 1LCNA 3WXTA 1L05A 4DDBA 1C61A 1QTDA 221LA 8LYZA 2KMDA 3AZ7A 1LPIA 133LA 5KKIA 1C67A 1HELA 2H5ZA 191LA 165LA 2FYDA 1DI3A 1GDXA 1G1WA 1B7OA 1LHKA 1RE2A 1T6VL 1LLHA 2LZ2A 1L64A 2XJWA 1RJCB 1VDSA 4NGYA 4LT2A 4BADA 2O79A 2ZIKA 4ZEEA 1L49A 4PGJB 1C6PA 1HFXA 4HPIA 1UA6Y 1WQOA 4B0DA 4XJFA 1B0XA 3HTBA 1C62A 4GCFA 1NBYC 3TXEA 3G3AB 1CKHA 2ZYCA 127LA 3QAKA 1G7IC 4TSBA 1LYOA 2D4JA 1PQDA 4NHSA 3AZ6A 3CDOA 1FBIX 4G4BA 4OWCA 4NWHA 5JENB 1LMNA 1GEZA 1QTCA 1VEDA 1P64A 3TXDA 3A94A 2MEHA 1V38A 1VATA 4J0LA 2O4WA 3FADA 3W6BA 2JV3A 1DKKA 3G3BB 3OE8A 4OOTA 3M18B 1GE0A 4W55A 1DXJA 3WYHA 1GF7A 109LA 4EKRA 2PC2A 1L28A 2B6ZA 2B6YA 4H8ZA 1CVKA 1WWUA 1L69A 1TLAA 1L88A 5KXSA 4PPOA 3NYAA 1UIHA 2QARB 5LA5A 4FJRA 3HU9A 4NL9C 168LA 4NSGA 3AZ5A 1DZBX 3HWLA 2HEDA 4ARQA 4H94A 4H9EA 3WMKA 1IR8A 1L62A 4UWVA 2B7XA 3RZ4A 2Q0MX 178LA 1UQVA 1WQQA 1WQRA 2QB1A 2Q9EA 2XBSA 1QDTA 3HTDA 1NBZC 187LA 151LA 2H9JA 1C6JA 4PJ2C 1GE2A 1QUHA 1C08C 3WPJA 4IAPA 1WTMA 1LZ5A 3QE8A 5KXNA 1P6YA 4OW1A 2Q9DA 2HUKA 4NGKA 4MHVA 2RBSA 2FYCA 2KIVA 1NMMA 1GFTA 5LAGA 1OUBA 4WG7A 2B70A 1CJ6A 4YX7C 4NGJA 238LA 4P2EA 4PRQA 3HT6A 3TXIA 1B9OA 1P3NA 2W1MA 5C6JA 3WULA 1L68A 1ZWNA 3EMLA 1LJGA 1L51A 3TADA 3C8SA 1SSYA 3HTGA 1OUGA 2RB2X 2Z2EA 4MCKA 2OEAX 4ETCA 5KKJA 1HMLA 1L0KA 1OXJA 4W56A 1OUIA 4HV1A 1SX7A 3A3QA 1RG6A 1QSBA 5I5QA 2C8PA 4C3WA 4HJVA 3D9AC 1D0LA 4WO6A 4YOPA 119LA 1C64A 4LZMA 1NWGA 1GB3A 3SB5A 4XADA 1REYA 1NDGC 2GLEA 3OJPA 3J6KA 2BQIA 1LHHA 3AZ4A 1JKAA 4WM2A 1HFZA 1L25A 2RBOA 2ESEA 5I54A 3FA0A 5JTIA 1LHJA 4TX7A 3CT1A 1L59A 4WLTA 3CSQA 1JTOL 2F2QA 4O34A 1GFUA 5APFA 2DKXA 4GLVA 3A92A 3F8VA 1IX0A 1C6IA 2AUBA 3GUNA 1NKHA 131LA 1D2YA 4XJBA 1CU0A 1PQOA 1A2YC 1L12A 1GFHA 4OWBA 3ATOA 1IEEA 3D4SA 4H9IA 3SB7A 2HEEA 3CDVA 1LZTA 4NJ8A 1UC0A 4EOFA 2KSOA 1L23A 175LA 3DNAA 3QNGA 228LA 1CKGA 1QQYA 1TAYA 4GCCA 1L81A 5F14A 1CX7A 1L27A 4BS7A 1L97A 1LYJA 1L39A 156LA 5FCPA 4ANRA 3WW5A 174LA 1LMOA 3W6CA 3WVYA 4EJ4A 2B6GA 1JSEA 1IWXA 1FN5A 2YDGA 1G06A 1PQKA 5LVHA 1YAPA 1F6SA 2BPUA 5IELA 3SBAA 1PS5A 4RDSA 4RQMA 2EAMA 2ZYPA 2BQBA 1LSYA 2B72A 1FLWA 3OK0A 3L2XA 1C6NA 1BVKC 1L53A 1AM7A 4N5RA 1T97A 1MELL 1QT3A 102LA 2MEIA 1LZCA 4NSIA 1KXXA 4PZOA 4I7RA 4ARMA 1FLQA 1CV3A 1JHLA 4KT3A 217LA 259LA 2HEFA 2HEAA 1JUGA 4E3UA 1LI2A 4LDOA 1TEWA 1KY1A 1PZYA 2LZMA 4LYZA 252LA 1HNLA 1W6ZA 2BQKA 1HERA 1CU6A 5L9JA 4I7JA 1AT6A 2MECA 1L04A 5KXOA 1L54A 2HEBA 1L52A 1D2WA 5L3IA 3W6FA 3W6EA 1SX2A 5KXTA 147LA 1L35A 4AGAA 5FHWA 1PK1B 1GBZA 1L45A 2XQOA 3IJVA 4EPIA 1L40A 1C60A 3A6BY 1REXA 4N1EI 1LI6A 1L73A 114LA 1W08A 4NG1A 173LA 1OV7A 1SWZA 1D9WA 1QT5A 4K5YA 2LZTA 1XGPC 1T3PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HH6 A;  2B6W A;  3SEN A;  1V85 A;  1SXE A;  1L31 A;  1C69 A;  4EPF A;  137L A;  1DYD A;  2Y9T A;  2F32 A;  4I7K A;  3BQ7 A;  152L A;  157L A;  4LDL A;  1LWK A;  210L A;  1DYG A;  3HUA A;  1CX6 A;  1L26 A;  4I7O A;  140L A;  1CV0 A;  3SB8 A;  118L A;  1P5C A;  107L A;  2QKQ A;  3NY9 A;  6LZM A;  1L29 A;  4W54 A;  2EAO A;  1CUP A;  4YXA C;  1L43 A;  1L50 A;  232L A;  1JI7 A;  1L95 A;  2F8K A;  1KW5 A;  1QT6 A;  3DN4 A;  3HDE A;  2K4P A;  1LYD A;  160L A;  1C65 A;  1C6C A;  4W52 A;  1L05 A;  2ANX A;  1C63 A;  195L A;  1L13 A;  161L A;  1T8A A;  1C61 A;  1QTD A;  3GUI A;  253L A;  4LDE A;  1T8G A;  1QUG A;  1PK1 A;  2QAR C;  221L A;  3TAD C;  2KMD A;  1L92 A;  258L A;  3GUJ A;  4W59 A;  1C67 A;  254L A;  1L56 A;  3CDQ A;  191L A;  165L A;  2LCB A;  2DL0 A;  3DN3 A;  1D3N A;  2RB0 X;  4YXC A;  1D3F A;  4I7P A;  1G1W A;  3KKA A;  2OU9 A;  1UCV A;  1LLH A;  1L64 A;  230L A;  1SSW A;  4DKL A;  111L A;  1L01 A;  4DJH A;  1L47 A;  234L A;  3GUK A;  2OE7 X;  3C80 A;  2O79 A;  1QT7 A;  1L49 A;  2RAY X;  3HDF A;  4ARQ B;  3L64 A;  1C6K A;  186L A;  1C6P A;  1L17 A;  1SV4 A;  7LZM A;  3GUL A;  122L A;  1L66 A;  1B0X A;  1LYI A;  4EKQ A;  1C6F A;  1C62 A;  3HTB A;  1OVJ A;  3UON A;  189L A;  222L A;  1L18 A;  127L A;  1ZYT A;  2LC9 A;  1QTV A;  3QAK A;  1L42 A;  1NHB A;  1LGX A;  3FI5 A;  3DKE X;  2Y9U A;  1L60 A;  1PQD A;  1C6B A;  1P36 A;  3GUO A;  3CDO A;  1COK A;  3G3W A;  1QS5 A;  1L90 A;  5JRT A;  1SXD A;  1L34 A;  240L A;  1C6G A;  1QTC A;  2OTZ X;  2HUM A;  166L A;  115L A;  1SWY A;  1B6I A;  1P64 A;  2IGC A;  3HU8 A;  3C7W A;  3RZE A;  1V38 A;  190L A;  3OE0 A;  4I7S A;  5F3X B;  150L A;  2O4W A;  3FAD A;  212L A;  3SN6 R;  247L A;  235L A;  125L A;  1WWV A;  2JV3 A;  219L A;  3K1R B;  248L A;  257L A;  3OE8 A;  1L76 A;  3V2Y A;  1Z1V A;  4W55 A;  1CUQ A;  109L A;  4EKR A;  1L28 A;  182L A;  2B6Z A;  2B6Y A;  1CVK A;  1WWU A;  206L A;  1G0P A;  1L69 A;  104L A;  3SEI A;  1TLA A;  1L88 A;  1L86 A;  3NYA A;  2B74 A;  1OYU A;  2QAR B;  1L89 A;  103L A;  3HU9 A;  4NL9 C;  1L83 A;  168L A;  1CU3 A;  1PQJ A;  1JTM A;  3BS5 B;  3OE9 A;  233L A;  3HWL A;  4PZN A;  1X66 A;  4ARQ A;  2B75 A;  2EAN A;  4IS7 A;  1L62 A;  242L A;  2B7X A;  139L A;  178L A;  1UQV A;  170L A;  3CDT A;  3JR6 A;  3DN6 A;  1KW4 A;  2QB1 A;  2Q9E A;  3HTF A;  4EXM A;  3DN2 A;  1QUO A;  1L74 A;  3HTD A;  1KNI A;  187L A;  1LKY B;  2ES6 A;  151L A;  1L22 A;  225L A;  1C6J A;  3PBL A;  199L A;  185L A;  246L A;  215L A;  2RBR A;  1QUH A;  214L A;  2F44 A;  1G07 A;  262L A;  3SBB C;  4IAP A;  2ANV A;  1L82 A;  1C6A A;  1P6Y A;  4ZPU A;  4I7T A;  2Q9D A;  2HUK A;  3DMV A;  4MHV A;  236L A;  3DMZ A;  3HT7 A;  4EKP A;  2RBS A;  2KIV A;  123L A;  3PDS A;  1CTW A;  1DXS A;  1OWZ A;  2B70 A;  4YX7 C;  239L A;  238L A;  1LGW A;  1L03 A;  3HT6 A;  149L A;  5J8Y C;  1P3N A;  1QTZ A;  255L A;  3G3V A;  1L68 A;  1ZWN A;  1L55 A;  2QAR A;  3EML A;  1L70 A;  1L51 A;  3TAD A;  3C8S A;  1L75 A;  1SSY A;  1C6E A;  3K2R A;  3HTG A;  2RB2 X;  2OEA X;  145L A;  143L A;  3BS5 A;  1G0K A;  1L0K A;  1OXJ A;  4E97 A;  5JU5 A;  1T8F A;  3C8Q A;  1SV0 C;  4AQN A;  1L38 A;  4W56 A;  1G0Q A;  1LYG A;  113L A;  1SX7 A;  2QB0 B;  260L A;  5L1M A;  2RBP A;  1RG6 A;  243L A;  1L48 A;  1QSB A;  1L94 A;  1QTB A;  196L A;  2F47 A;  126L A;  2KSO B;  3H8M A;  172L A;  1C6H A;  1L61 A;  201L A;  1LKY A;  119L A;  1L14 A;  1C64 A;  1DYA A;  4LZM A;  158L A;  1G1V A;  1L20 A;  3SB5 A;  1L02 A;  4ARL A;  1DYE A;  3DMX A;  138L A;  2GLE A;  1QT8 A;  4OO9 A;  1C66 A;  2FE9 A;  1L37 A;  2A4T A;  1QUD A;  4W57 A;  3SB9 A;  1L71 A;  1ZUR A;  4S0W A;  3HIL A;  2RAZ X;  142L A;  1L65 A;  1LPY A;  1LYH A;  1X40 A;  1L00 A;  1L25 A;  2RBO A;  2ESE A;  3FA0 A;  5JTI A;  1CV1 A;  213L A;  3HH3 A;  1L11 A;  141L A;  1XJT A;  2D3D A;  3G3X A;  3BS7 A;  1L98 A;  110L A;  164L A;  1OVK A;  2OU8 A;  218L A;  1P7S A;  1L59 A;  1L07 A;  4GRV A;  1L58 A;  2F2Q A;  180L A;  1K28 A;  223L A;  3VW7 A;  2RBQ A;  3C8R A;  2DKX A;  1L10 A;  1L72 A;  2HUL A;  3F8V A;  1C6I A;  4RQN A;  3GUN A;  2F3N A;  1C6Q A;  131L A;  1L30 A;  1D2Y A;  229L A;  1CU0 A;  1G0M A;  120L A;  1PQO A;  1L63 A;  1L12 A;  2QB0 A;  1QT4 A;  1L44 A;  162L A;  1KY0 A;  3D4S A;  188L A;  1QS9 A;  3SB7 A;  4NL9 A;  1DYF A;  3CDV A;  108L A;  4NJ8 A;  3HUK A;  1LWG A;  2KSO A;  1EPY A;  4I7Q A;  1QTH A;  1L06 A;  1L23 A;  175L A;  3DNA A;  4W58 A;  228L A;  1KS3 A;  220L A;  1F0M A;  1L24 A;  2OU0 X;  4ARM B;  3GUP A;  1LGU A;  167L A;  1L21 A;  1L81 A;  1CX7 A;  4W53 A;  2KE7 A;  237L A;  1L27 A;  4DAJ A;  245L A;  1PQI A;  1L09 A;  1L15 A;  4W51 A;  211L A;  1OV5 A;  3TAC B;  1L97 A;  1LYJ A;  1L39 A;  2B6T A;  2NTH A;  1L79 A;  3DN1 A;  1LI3 A;  156L A;  1P2L A;  174L A;  163L A;  5LZM A;  1I6S A;  1P37 A;  250L A;  261L A;  5I14 A;  1L32 A;  1L67 A;  1LYF A;  2B6G A;  4EJ4 A;  1B4F A;  4EKS A;  1G06 A;  3DN0 A;  197L A;  3LZM A;  1L19 A;  1PQK A;  184L A;  2OE4 X;  4GBR B;  2RBN A;  3SBA A;  1L85 A;  4RQM A;  249L A;  2O7A A;  2EAM A;  2L78 A;  1CU5 A;  2B72 A;  231L A;  3HUQ A;  209L A;  1X9X A;  1C6N A;  1CV5 A;  3L2X A;  2E8P A;  5J8Y A;  1XEP A;  1L53 A;  205L A;  224L A;  181L A;  1T97 A;  3HT9 A;  4PJZ A;  176L A;  216L A;  1SGG A;  1QT3 A;  102L A;  3KKA C;  1T6H A;  2B6X A;  2EAP A;  2YTU A;  1L93 A;  169L A;  1PK3 A;  1L91 A;  2E8O A;  1P46 A;  4I7M A;  1SV0 A;  3C82 A;  4PZO A;  4I7R A;  1L77 A;  4ARM A;  5KNI A;  128L A;  1L08 A;  4ARJ A;  1L33 A;  1CV3 A;  1CV6 A;  1L99 A;  1DYB A;  2CUU A;  4I7N A;  3C81 A;  171L A;  4I7L A;  1LW9 A;  3RUN A;  2LPE A;  217L A;  259L A;  2E8N A;  159L A;  192L A;  1JQU A;  1D3M A;  3HT8 A;  2Z6B A;  3SB6 A;  3CDR A;  155L A;  1LI2 A;  3C7Z A;  2B73 A;  1CV4 A;  4LDO A;  244L A;  1KY1 A;  2LZM A;  252L A;  3C7Y A;  251L A;  3NY8 A;  3V2W A;  1WTH A;  1G0L A;  1C68 A;  227L A;  3GUM A;  3DN8 A;  1CU2 A;  2RB1 X;  1C6D A;  1L16 A;  2L5Y A;  1XJU A;  1CU6 A;  1L80 A;  4I7J A;  1LYE A;  2RH1 A;  2OTY X;  1L36 A;  2DKZ A;  1L96 A;  1C6T A;  1L04 A;  256L A;  1L54 A;  1OW5 A;  2K60 A;  144L A;  1L46 A;  3OE6 A;  1L52 A;  1L87 A;  1D2W A;  198L A;  1P56 A;  2D8C A;  1SX2 A;  147L A;  1L35 A;  130L A;  2KG5 A;  1C6M A;  1PK1 B;  3HH5 A;  1DYC A;  1L84 A;  1L45 A;  1QSQ A;  4EPI A;  1D3J A;  112L A;  183L A;  226L A;  1OVH A;  1L41 A;  4ARP A;  3C83 A;  1L40 A;  1C60 A;  148L E;  1C6L A;  1P2R A;  177L A;  1OWY A;  1JTN A;  1LI6 A;  1L73 A;  3IDW A;  3F9L A;  114L A;  1PQM A;  241L A;  200L A;  1G0J A;  173L A;  4PK0 A;  1G0G A;  2LMR A;  3HH4 A;  2NTG A;  1OV7 A;  1D9W A;  2E8M A;  1SWZ A;  1QT5 A;  1KW7 A;  129L A;  3ODU A;  4K5Y A;  1L57 A;  146L A;  2OE9 X;  1L0J A; 
#chains in the Genus database with same CATH topology
 3HH6 A;  2WB1 C;  1QCK A;  4DLG A;  3Q8L A;  3RH6 A;  5AMY A;  2XID A;  3C1Y A;  3SEN A;  4C4T A;  1OUH A;  4UW9 A;  2G4N A;  4EPF A;  4CCH A;  8ICR A;  2Y9T A;  4R63 A;  3CRX A;  3IV6 A;  3RJE A;  5KFY A;  2ASD A;  4F4K A;  4GN3 A;  4WM3 A;  3CB7 A;  1ZQG A;  4Q43 A;  4ELV A;  4OJO A;  5KFB A;  1CX6 A;  4I7O A;  1LHL A;  4G9S A;  3QE9 Y;  4C4S A;  1BWH A;  3NY9 A;  1ZQN A;  3WVX A;  4W54 A;  4F2S A;  2EAO A;  1ZQZ A;  1GF9 A;  4GXI A;  2HHW A;  1LKR A;  1UUZ C;  3GXR A;  3EPG A;  4YXA C;  1KTQ A;  8ICY A;  4NGW A;  2DQE Y;  8ICN A;  1GFG A;  1L50 A;  1TVA A;  5DGA A;  4AYB C;  1JI7 A;  1CJ8 A;  3D6J A;  2H3I A;  1GBS A;  3RBD A;  4CF3 A;  2I5H A;  5DG7 A;  3ISB A;  2C22 A;  1LYD A;  5EE0 A;  5J2F A;  1B43 A;  4B1A A;  1C63 A;  5J0X A;  195L A;  1T8A A;  161L A;  1HUO A;  1B5V A;  2WAR A;  5AI9 A;  4LDE A;  1NZB A;  1T8G A;  1JTP L;  3ALR A;  1SWW A;  2N1R A;  1GFV A;  5HHH A;  2W03 A;  3TAD C;  1JWR A;  3GFK B;  3QU9 A;  4M9N A;  1LMA A;  1ZXI A;  4NHI A;  5B05 A;  5AK6 A;  1D9U A;  2AGP A;  4NY8 A;  1ZVY B;  2BQN A;  4RPZ A;  254L A;  4LT3 A;  7LYZ A;  3CDQ A;  3ZD8 A;  1X9W A;  1SL0 A;  2LCB A;  2RB0 X;  4NLZ A;  4DL6 A;  3M6Z A;  4YF2 A;  1S5L U;  2OU9 A;  1UCV A;  3SI8 A;  1G7L C;  5H2F U;  230L A;  1SSW A;  2NV3 A;  4DJH A;  4O3N A;  2HHX A;  3AW7 A;  4KIT B;  2G07 A;  2I25 L;  1LZE A;  9ICM A;  1WCN A;  3RAQ A;  3H0L B;  4ELT A;  2IHL A;  4DD7 A;  4KLF A;  1C6K A;  3FC4 A;  186L A;  4YR3 A;  1GE1 A;  5AK5 A;  3BKV A;  3GUL A;  2G08 A;  1LSD A;  4LYO A;  5KXK A;  4HSF A;  5ALW A;  5J0R A;  4J9R A;  1LJH A;  1C6F A;  1D6Q A;  1LYI A;  1KFT A;  3UON A;  222L A;  2C2R A;  1B7R A;  5I4Y A;  4HJY A;  4C8K A;  2ZIW B;  2R8I A;  3KAM A;  2YQE A;  3WK4 A;  4ED1 A;  2DWQ A;  5DBB A;  1COK A;  4O3S A;  3EW9 A;  5TIS U;  1LZ9 A;  1QS5 A;  154L A;  4US9 A;  1L34 A;  1BGX T;  1NK0 A;  1RI8 B;  5L3H A;  2OTZ X;  2HUM A;  4U3X B;  2XGP A;  1D9F A;  1B6I A;  3EUB 2;  3C7W A;  4N0J A;  3M7D A;  3C23 A;  3NTU A;  3QUB A;  3T5L A;  150L A;  1G7J C;  4M4O A;  4IJ4 A;  247L A;  125L A;  1WWV A;  4RU9 A;  4Z6E A;  1JTT L;  257L A;  1MLC E;  4NIJ A;  4KLQ A;  4M2Y A;  1L76 A;  3V2Y A;  2FMS A;  5IDD A;  4DQ5 A;  1RYR A;  1QTK A;  3A91 A;  2AGO A;  2PFP A;  4H9B A;  3ULR A;  3SMV A;  3DEE A;  3AN1 A;  1J1O Y;  2BDP A;  1G0P A;  1IP5 A;  4US8 A;  4XJD A;  1HEM A;  2ZIU A;  5DN5 A;  4QZB A;  1XGR C;  2B74 A;  1OYU A;  2MSN A;  1L3T A;  4G49 A;  4N1C C;  4ED2 A;  2HHU A;  1XS9 D;  2XBR A;  4FFD A;  1PVP A;  4ED3 A;  1DPX A;  1GB6 A;  1P2C C;  4DD0 A;  3B0O A;  1JTM A;  1QUT A;  2DPI A;  233L A;  1D8L A;  1X66 A;  2B75 A;  4KMO B;  4ET8 A;  1UIC A;  4ETE A;  4IS7 A;  4YMO A;  3WK8 A;  3HPO A;  2HBK A;  3ISD A;  242L A;  3TMU A;  4DSL A;  9ICT A;  4BWJ A;  3JR6 A;  4WL6 A;  4C4R A;  1KW4 A;  4IC9 A;  1NK5 A;  4EXM A;  1A4V A;  3DN2 A;  1JKC A;  1J97 A;  1Q3U A;  1DI4 A;  5HLL A;  9ICN A;  3LYO A;  4I2H A;  1NK7 A;  1BPB A;  4M47 A;  2HU3 A;  4H9F A;  1C7P A;  4PPX A;  1LKY B;  4BXO B;  1B5W A;  2W1Y A;  5I4X A;  4ECS A;  215L A;  2RBR A;  3JPS A;  1GAY A;  2ZIV A;  5LYT A;  1BPX A;  262L A;  1Z55 A;  3SV3 A;  3HBH A;  2FBD A;  5B07 A;  2ANV A;  193L A;  1RQL A;  2BQC A;  4WLD A;  1PZN A;  3TQ1 A;  2MAX A;  4KPM A;  4EKP A;  3WU2 U;  236L A;  4PHP A;  2RSC A;  4ETA A;  2MEA A;  1TAM A;  2EDU A;  5AK4 A;  1WTN A;  4NEB A;  2I6X A;  3T36 A;  1QTE A;  2HTX A;  208L A;  4YEN A;  1INU A;  5I53 A;  3PV8 A;  4QW8 A;  5KTQ A;  1S0V A;  1CTW A;  1DXS A;  1OWZ A;  4H9H A;  3RJI A;  1O08 A;  5D5C A;  5KG0 A;  1LGW A;  2LHM A;  1S76 D;  4OCZ A;  1L7O A;  1QTZ A;  2Y8P A;  3WPK A;  1IC4 Y;  1WQP A;  1L70 A;  1J1P Y;  2NWD X;  2VB1 A;  1L75 A;  5AM4 A;  5FP0 A;  4KLD A;  1C6E A;  2XY6 A;  3LYT A;  1BB6 A;  145L A;  143L A;  3BS5 A;  4CFO A;  4YXM A;  4H8Y A;  1X6J A;  2CGI A;  4MEY A;  1G0Q A;  1GE3 A;  4DQ7 A;  2ZQ4 A;  4PGQ A;  3RRG A;  113L A;  2IMW P;  1BQL Y;  1IY3 A;  1LSA A;  2YSS C;  3LHM A;  260L A;  3TXH A;  5HNC A;  4MFA A;  3MR6 A;  3LWL A;  4DFM A;  4HAI A;  4H91 A;  1QTB A;  1LSB A;  2Z37 A;  2NRZ A;  2F47 A;  4DYG A;  4QWC A;  2RDJ A;  3H8M A;  1UIE A;  4U6P A;  201L A;  4B49 A;  1LV5 A;  3LZT A;  1GBX A;  4QY9 A;  1TCY A;  3FM9 A;  1FLU A;  1G1V A;  1LZ8 A;  3UXO A;  4NG8 A;  4LT0 A;  4ARL A;  5TZV A;  3PX0 A;  2BCQ A;  4J1B A;  2G5I B;  4WLY A;  138L A;  3RR7 A;  1C66 A;  2FE9 A;  2DQN B;  3SB9 A;  4S0W A;  3AB6 A;  1LYH A;  2HDO A;  2WAQ C;  4OWA A;  5L1L A;  3N4M B;  2XCP A;  1CV1 A;  213L A;  3TXF A;  4J9K A;  141L A;  3WL2 A;  1XJT A;  2D3D A;  3G3X A;  1L98 A;  110L A;  2BZF A;  4OWH A;  3TMW A;  1OVK A;  4KTQ A;  5M1Y A;  2OU8 A;  218L A;  1P7S A;  1S8O A;  4GRV A;  3PNC A;  1BB4 A;  3F2C A;  4Z41 A;  9ICC A;  4QZC A;  1S0O A;  3MGW A;  2RBQ A;  1IP7 A;  2EZX A;  1BB5 A;  2HUL A;  4ACO A;  2FBB A;  4PJ0 U;  1REM A;  3WW6 A;  4RQN A;  4F91 B;  1CKF A;  5AM1 A;  3HX0 A;  4R66 A;  3WU8 A;  1ZQH A;  5L1K A;  4IR9 A;  4B9L A;  3V7L A;  1GB2 A;  2KK0 A;  2NO4 A;  1DK2 A;  3PSI A;  1IWW A;  2BCU A;  229L A;  4HTQ A;  1G0M A;  1SLY A;  1L63 A;  5DM9 A;  2QB0 A;  1QT4 A;  2H3Z A;  1L44 A;  4O3Q A;  1QTM A;  2PMZ F;  4BAF A;  5ALL A;  1XU4 A;  4XJG A;  3MGI A;  4I29 A;  5DBA A;  5K7O A;  2NRX A;  4DWI A;  1ZD3 A;  2G09 A;  3SD7 A;  5E9R A;  3WH1 A;  2VA8 A;  4ELU A;  2JH7 A;  2OU0 X;  4WLX A;  1XSF A;  1OUQ A;  1L21 A;  1QLN A;  1C7Y A;  4W53 A;  3RJF A;  2UVW A;  1NNL A;  245L A;  3RH5 A;  2LKY A;  1O23 A;  1LZ6 A;  1HEW A;  4XYY A;  4ECW A;  4P0P A;  1L09 A;  3NVY A;  1L15 A;  211L A;  2CWI A;  2W9C B;  1JIS A;  3L5K A;  2NTH A;  1SKW A;  4GN5 C;  4FE3 A;  4I0C A;  2F8L A;  5IHG A;  3JPN A;  4DFK A;  3BKH A;  1RPL A;  1IP6 A;  2NRW A;  5B66 U;  2HEC A;  1GB0 A;  5KXY A;  2KV2 A;  3GZF A;  1LYF A;  3RJH A;  3QU5 A;  2ZIX A;  8ICC A;  1IP1 A;  4WM1 A;  5K4L A;  1Z00 B;  1L19 A;  3K3T A;  5BOL A;  1T94 A;  4B4J A;  184L A;  2OE4 X;  3K4G A;  4GBR B;  5F9X A;  3H4B A;  2RBN A;  3ONN A;  2FPM A;  1L85 A;  1GF5 A;  2O7A A;  4H9A A;  1BNP A;  1HUZ A;  4U7C A;  4RQ1 A;  1CNS A;  4PGX A;  1LYY A;  4R6C A;  4QZ8 A;  4XJH A;  3J4G A;  5KFP A;  4UAS A;  2K89 A;  5F9N A;  5J8Y A;  4MFF A;  205L A;  4QZI A;  1EQE A;  224L A;  3SAH A;  2DQH Y;  4W94 A;  5FDJ A;  4WO9 A;  4B9N A;  3QNM A;  4CRX A;  1LHI A;  3HT9 A;  1WUD A;  1SGG A;  1GFK A;  4UB5 A;  5III A;  3AEV A;  1B5U A;  1T6H A;  2FMQ A;  2W9B A;  1L93 A;  3F6Z A;  5KFC A;  5KFO A;  1P46 A;  1SV0 A;  7ICG A;  1V7S A;  3C82 A;  1L3V A;  128L A;  3L4P A;  4M9L A;  7ICV A;  1UA1 A;  1JKD A;  4ARJ A;  1LZS A;  1GBO A;  1CV6 A;  5KT2 A;  1L99 A;  1WQN A;  5KG4 A;  1LSP A;  3C81 A;  171L A;  4I7L A;  1LW9 A;  3RUN A;  2LPE A;  4XA5 A;  1CJ9 A;  2E8N A;  8ICX A;  159L A;  1AZF A;  3NVV A;  5DGB A;  2DKV A;  4GC7 A;  3CT5 A;  1QDR A;  1IP3 A;  5EBH A;  3SAF A;  1KSP A;  1I56 A;  3NGD A;  3SB6 A;  3C2L A;  4BUG A;  4H9C A;  2B73 A;  3V72 A;  4HV2 A;  3SR6 A;  5DLF A;  4KLU A;  1CV4 A;  1G7H C;  4KX3 A;  4WMG A;  5DN4 A;  1N63 A;  1XNS A;  3ZDE A;  1GE4 A;  3WUN A;  1G0L A;  3Q8K A;  7ICU A;  2ZQ3 A;  1GAZ A;  1VAU A;  2XI9 A;  4BDP A;  3OJU A;  227L A;  3GUM A;  2RB1 X;  1C6D A;  4ECQ A;  2L5Y A;  5ALZ A;  3N7S C;  1L16 A;  3ZVQ A;  2HI0 A;  4LJX A;  2RLT A;  4Z3M A;  2V4Q A;  4Z6D A;  2DQG Y;  3RU5 A;  5J2K A;  1L36 A;  2FLL A;  3B0I A;  4CHX A;  4Q45 A;  1C6T A;  256L A;  5KFX A;  144L A;  3B72 A;  1HMK A;  3A95 A;  8ICU A;  1TDY A;  2W3S A;  5ALM A;  4RQ3 A;  5LVI A;  1ZQT A;  1OP9 B;  4P0Q B;  5DQI A;  1SQ2 L;  1UT5 A;  3RB4 A;  1OUA A;  4KLJ A;  2DQJ Y;  5D49 A;  1TKD A;  5KFZ A;  1LMQ A;  4ECY A;  5LVG A;  3Q8R B;  1HEK A;  1N48 A;  3HH5 A;  4DLE A;  4QIW C;  1DYC A;  4ED6 A;  2NO5 A;  4WM4 A;  3LN2 A;  183L A;  2F4A A;  1OVH A;  1XGQ C;  2X0A A;  5D4B A;  4XRH A;  3C83 A;  4NGZ A;  3C28 A;  4J1A A;  1C6L A;  1SB3 C;  1JTN A;  1LOZ A;  1EQ5 A;  1G0J A;  2WF6 A;  4PK0 A;  1V97 A;  3TI0 A;  2LMR A;  3HH4 A;  1ZD5 A;  1L6N A;  1C10 A;  2FMP A;  1DQJ C;  3MR2 A;  1F10 A;  129L A;  146L A;  4B6J A;  2BQL A;  5LVJ A;  4Y2P A;  4OOO A;  2B6W A;  4FZN A;  4YD1 A;  1FKQ A;  5F81 A;  1NF5 A;  1SXE A;  1B7S A;  1L31 A;  4K4H A;  1C69 A;  2BQF A;  2ATL A;  1IOR A;  1JX4 A;  1DYD A;  4I7K A;  5AIA A;  3BQ7 A;  3OGU A;  4LDL A;  3IM1 A;  1D0K A;  4HPE A;  3IP4 B;  3HUA A;  4GLA A;  5HNL A;  3WKE A;  8ICZ A;  4J9Q A;  4UB6 U;  1GPQ C;  1N56 A;  1CV0 A;  3SB8 A;  2XGQ A;  4ETB A;  5E4P A;  4Y2T A;  1QSY A;  5LAF A;  132L A;  4NGL A;  9ICF A;  4NLK A;  4EX6 A;  4JUZ A;  2E5S A;  5KFQ A;  3S6J A;  2BQJ A;  5J0T A;  1HEP A;  4M6D A;  4HTN A;  4DD1 A;  4DL3 A;  2BAA A;  3NRZ A;  4K4I A;  2V4R A;  1ZQL A;  2KVC A;  2F4G A;  1C6C A;  4W52 A;  4UB1 A;  4H92 A;  5ILC A;  2R8H A;  253L A;  1SKR A;  2P6R A;  3HFM Y;  3N9C A;  2A1J B;  2BQO A;  1B5Z A;  5ALS A;  4TUR A;  258L A;  3GUJ A;  1UIA A;  4W59 A;  2H3F A;  1HIW A;  1KIR C;  1XFP L;  2K8B B;  2XY5 A;  1IP2 A;  4TSC A;  2BQU A;  4UAR A;  5EE9 A;  2DL0 A;  5AKG A;  4NGV A;  4YXC A;  1YZ7 A;  5AKX A;  1D3F A;  2HOF A;  3WUM A;  5A3Z A;  1K5O A;  4I7P A;  5D5F A;  2A19 A;  3HBD A;  2KJ5 A;  4J7V A;  2FLN A;  4DD2 A;  5KFT A;  4DKL A;  4M9G A;  4B9M A;  111L A;  1L01 A;  234L A;  1D6P A;  2LYA A;  1XEK A;  2YX8 A;  1LMP A;  1QT7 A;  5J2G A;  2RAY X;  3OHB A;  1ZD4 A;  3HDF A;  4ARQ B;  2DGZ A;  1A77 A;  5D46 A;  4NSH A;  3L64 A;  3EO5 A;  2ASL A;  2LI6 A;  1A0P A;  2XIC A;  3ICX A;  4ECU A;  4I2G A;  2NRV A;  1B5X A;  122L A;  1L66 A;  4O5C A;  5HMJ A;  2ZUD A;  189L A;  3HT3 A;  1L18 A;  3AJN A;  4ETD A;  1NOM A;  2LC9 A;  4YQW A;  4J9N A;  1NHB A;  1ZQI A;  3DKE X;  2Y9U A;  1L60 A;  3RB0 A;  5IIJ A;  1ZQQ A;  134L A;  1P36 A;  3GUO A;  4HJZ A;  4XJI A;  5KXX A;  3N7P D;  3W6D A;  5KFW A;  2KJ8 A;  5JRT A;  1LZD A;  4UWN A;  2UVV A;  2DQI Y;  3SP3 A;  115L A;  1HSX A;  2D4I A;  2EKS C;  4DSF A;  1V7T A;  1NDM C;  5KFL A;  3UQ2 A;  2IGC A;  4H90 A;  1BPD A;  3RZE A;  1IOC A;  4AP9 A;  3F5A A;  3OE0 A;  3LYZ A;  5F3X B;  4I7S A;  1KIP C;  5HR6 A;  1GXX A;  3PST A;  2DQD Y;  3SN6 R;  5DB6 A;  2LYM A;  235L A;  1HFY A;  2MUT A;  3K1R B;  2HHT A;  5KXL A;  4QZA A;  1IOS A;  4ET9 A;  3HWT A;  1JRP A;  1Z1V A;  1NKB A;  2EH9 A;  2HVH A;  4BX9 C;  2CDS A;  3TXK A;  4PL1 A;  4I2B A;  4KXI A;  4RW2 A;  2KIC A;  4WG1 A;  1E8L A;  3RJG A;  182L A;  1RYU A;  2IOF K;  206L A;  2IOF A;  4FBT A;  8ICJ A;  104L A;  3SEI A;  4IAS A;  1IVM A;  2UVR A;  2JRZ A;  4DD9 A;  1L89 A;  3B0X A;  1ZQS A;  1WQM A;  5FEK A;  5DB9 A;  4HYK A;  2YBM A;  3PZP A;  5L9X A;  5ALH A;  4N9R A;  1YT3 A;  1CU3 A;  5AI5 A;  2HBJ A;  5C0Y A;  1BWJ A;  1U9L A;  4PZN A;  1ZET A;  3TXJ A;  1HEN A;  4NGO A;  2EAN A;  4YM8 A;  2OM6 A;  2W1L A;  4F8R A;  2ZIJ A;  2YMP A;  139L A;  170L A;  5AM5 A;  3IJU A;  1TAQ A;  2B0C A;  3DN6 A;  1B0D A;  1VDV A;  2Y1J A;  4NM2 A;  2I6Z A;  4PHI A;  5J2D A;  5EWE A;  1UAC Y;  1LYZ A;  1QSW A;  3C5G A;  1YAM A;  5J0W A;  3C5F A;  5AI0 A;  4NV0 A;  2ES6 A;  1ZQD A;  2J6S A;  4M0A A;  1ZD2 P;  8ICE A;  225L A;  4HP0 A;  2WHE A;  3PBL A;  1Z3E B;  4DEZ A;  4F93 B;  4DSJ A;  2F44 A;  1SL2 A;  3OTQ A;  1XGT C;  1FO4 A;  4YD2 A;  4YXJ A;  1NHE A;  2HBL A;  4I2D A;  1TV9 A;  1F6R A;  5CB1 A;  3F2D A;  1SWV A;  3T3F A;  8ICM A;  3T5K A;  4F71 A;  2I1Q A;  2EZY A;  2YBH A;  1ZQX A;  3QZ8 A;  4DFJ A;  4UAZ A;  1IC7 Y;  1F44 A;  239L A;  1P7D A;  1GFE A;  5CJ7 A;  3EXD A;  4YEO A;  3RB6 A;  1LZ1 A;  5J8Y C;  2ZTE A;  2BQE A;  2MU2 A;  4ECR A;  2ISP A;  3H0M B;  255L A;  9ICS A;  1C45 A;  4EMN A;  4RLM A;  5HHI A;  1L55 A;  2QAR A;  5AKZ A;  4RZR A;  2W1X A;  3RJK A;  2E1F A;  4J03 A;  2ZIL A;  4WJ3 B;  1VFB C;  3K2R A;  4GCE A;  2BR0 A;  1UID A;  1G0K A;  1CKC A;  5JU5 A;  1T8F A;  1SV0 C;  3H8S A;  4NLC A;  3CSR A;  4FS2 A;  1L38 A;  4EYH B;  3PW5 A;  5E79 U;  1IR9 A;  3CQL A;  5ALJ A;  3QYP A;  1YIL A;  2Q4T A;  4ML7 A;  1LJJ A;  1JRO A;  3UM9 A;  4MEX A;  2BCR A;  3TXB A;  9ICG A;  1L48 A;  4LFP A;  1N5W A;  3WUA A;  196L A;  2D6B A;  1T3P A;  1LJ3 A;  126L A;  5J7C A;  2KSO B;  4DCC A;  172L A;  1LZY A;  1GB7 A;  1LZA A;  5HNK A;  1DYA A;  4RW1 A;  158L A;  2W8K A;  4YFK A;  5AKE A;  1YAO A;  1FLY A;  5KG5 A;  2MEE A;  4E0D A;  3WU9 A;  1QT8 A;  1LAA A;  5J2H A;  2A4T A;  3H8J A;  2P66 A;  1QUD A;  4M6W A;  3WK5 A;  4UAW A;  1X2I A;  9ICE A;  3EZ5 A;  4QNL A;  2Z2F A;  3HIL A;  2BQM A;  1DGS A;  2ZNX Y;  1L65 A;  1X40 A;  4CGZ A;  1ZVH L;  5KXW A;  1L00 A;  3KBB A;  4AXT A;  5KFH A;  3LVW A;  3A67 Y;  4R64 A;  4D9Z A;  4YMN A;  1LZG A;  1XEJ A;  164L A;  1OUC A;  4OJ6 A;  3RB3 A;  1XSN A;  4IRD A;  2LYO A;  3M3U A;  1ED1 A;  3NVW A;  5AKK A;  3TAR A;  2NRT A;  2KFN A;  4F5R A;  1GBW A;  180L A;  5C6I A;  3IRU A;  1ZQY A;  1B7P A;  1UIF A;  223L A;  3VW7 A;  1REZ A;  4A7D A;  1L10 A;  3WKC A;  5LIN A;  2W7O A;  1KL9 A;  2W43 A;  1S97 A;  1AKI A;  2F3N A;  5ALO A;  4C80 A;  5J0Q A;  3ZDC A;  1L30 A;  5EE1 A;  4DD3 A;  3L3F X;  4O3R A;  3IHQ B;  2ZWB A;  2QLT A;  2KZM A;  4TUS A;  4UBB A;  2JZB A;  3DV9 A;  3OSN A;  2EIZ C;  3AW6 A;  4Q44 A;  5KT5 A;  1KY0 A;  1LZR A;  4QIW F;  1QS9 A;  4DO9 A;  1GF8 A;  108L A;  1LWG A;  4F4W A;  4I7Q A;  1QTH A;  1LJE A;  1L06 A;  5ILF A;  8ICH A;  4W58 A;  1K1S A;  220L A;  4DQQ A;  4ARM B;  3GUP A;  1LGU A;  167L A;  1XSP A;  2N5Z A;  1WCL A;  4NY5 A;  2ZNW Y;  4QZH A;  1KQQ A;  4DAJ A;  4CGE A;  4TTD A;  4W51 A;  1S77 D;  3TAC B;  1CKD A;  1OV5 A;  4PHA A;  2B21 A;  2PKE A;  4EZ9 A;  2W9M A;  3I28 A;  2AU0 A;  4O5E A;  7ICT A;  1B22 A;  2B6T A;  1LI3 A;  3DN1 A;  2HSZ A;  2JEJ A;  1P2L A;  4UAV A;  3EYZ A;  2Z38 A;  2AGQ A;  2XO7 A;  3ETR A;  163L A;  1P37 A;  1SL1 A;  1MSW D;  1Z1B A;  1T7P A;  1L32 A;  1JIH A;  2HU1 A;  2AJQ A;  1IWT A;  1B4F A;  4EKS A;  5ALT A;  197L A;  5APD A;  3LZM A;  2D91 A;  5DDM A;  4P2H A;  2BQR A;  1KXW A;  1ARO P;  1IP4 A;  5KL1 B;  2HOQ A;  4WM6 A;  3BQ2 A;  249L A;  4MCK A;  4CJ2 A;  2H3Q A;  1EL1 A;  2BQG A;  2L78 A;  5BPC A;  1I20 A;  1B7L A;  2MEG A;  5KT3 A;  3CYM A;  3W6A A;  2KZ3 A;  3GQC A;  2LYH A;  4ECX A;  209L A;  1X9X A;  3TAN A;  3HUQ A;  5IIM A;  2Z18 A;  2E8P A;  5KFJ A;  1F0W A;  2YVB A;  3QEB Z;  2R8J A;  2YBI A;  3P64 A;  1GB9 A;  181L A;  1LYS A;  5LYZ A;  5HQ1 A;  5ALI A;  4FS1 A;  3AQE A;  3LWM A;  176L A;  1U48 A;  1ZQO A;  216L A;  2KKV A;  4DF4 A;  4R8U B;  2K8C B;  1HSW A;  3PSF A;  1HEQ A;  2EAP A;  1L91 A;  1PK3 A;  2E8O A;  3AM9 A;  4DOA A;  1WVV A;  4UAU A;  3G6Y A;  1L3S A;  4LYC A;  3AU2 A;  1G7M C;  5KNI A;  1DK3 A;  1JKB A;  4O9M A;  1IY4 A;  1L08 A;  3T6U A;  4ZH4 A;  1L33 A;  4IQW A;  4J9M A;  2XTH A;  3RW8 A;  4RUA A;  2VA2 A;  3NAS A;  4QJF B;  2CUU A;  2MEB A;  1ZQV A;  1SZH A;  3A90 A;  3ZD9 A;  192L A;  1B5Y A;  1D3M A;  7ICJ A;  1GF3 A;  4DSI A;  1KBU A;  3HT8 A;  2BLY A;  2Z6B A;  1GO3 F;  3MGH A;  1BVX A;  4LYM A;  3C7Z A;  5DL9 A;  1JIY A;  4KN7 A;  2BHN A;  4H93 A;  4DDC A;  1AT5 A;  2PXI A;  3C7Y A;  2AQ0 A;  3V2W A;  4C0Z A;  2LYZ A;  3PO4 A;  1C43 A;  1YAN A;  5B06 A;  1GFJ A;  1JJ0 A;  1N2X A;  1LSM A;  5DG9 A;  1MC8 A;  4UWU A;  3DN8 A;  1T8E A;  1CU2 A;  4W96 A;  2J6U A;  4L41 A;  1XJU A;  4EEN A;  1L80 A;  2K8A A;  1MQ2 A;  3HKZ C;  1LZ4 A;  2EPE A;  4R0F A;  2Z12 A;  1LYE A;  5T3F A;  4QZG A;  3N97 B;  2DKZ A;  5FST A;  3HW8 A;  4H1P A;  5LVK A;  1KXY A;  2D4K A;  3T5J A;  8ICP A;  5CWR A;  1RM6 C;  4MST A;  1OW5 A;  3KD3 A;  3OE6 A;  4J9O A;  4QDN A;  1HEO A;  2R18 A;  3UQ0 A;  1JSF A;  1L7M A;  2ZXH A;  1NK4 A;  1P56 A;  2FPL A;  1IV8 A;  2KG5 A;  1C6M A;  5F16 A;  5KFE A;  3CW2 C;  1QSQ A;  2M9N A;  1D3J A;  2DF4 B;  3RTV A;  226L A;  1L41 A;  1D8Y A;  4Y2J A;  3P4Z A;  4MR1 A;  4UB4 A;  5DQG A;  1P2R A;  1SIJ A;  4LYB A;  1IC5 Y;  2OEH A;  1OWY A;  3OJS A;  1PQM A;  241L A;  4DSE A;  3SYZ A;  3PX6 A;  1NK8 A;  1G0G A;  4H8X A;  4B9V A;  2NTG A;  4M9H A;  3PML A;  2RHF A;  5DLA A;  3A3R X;  4ZIX A;  1IWY A;  2Z19 A;  4IQV A;  2WB1 F;  1LMC A;  1LHM A;  4RNN A;  3RH4 A;  1HJP A;  2JH1 A;  5KXM A;  1H38 A;  1DRG A;  3FDS A;  210L A;  2GOL A;  4PHE A;  1DYG A;  1YIK A;  1QQ5 A;  2HOI A;  3AGH A;  4LVS A;  4CFP A;  5CEH A;  140L A;  1IWZ A;  3OSP A;  3THV A;  3TXG A;  4XQ8 A;  118L A;  4XN6 A;  5KFK A;  1P5C A;  107L A;  6LZM A;  4NLN A;  2BPG A;  2J6T A;  1T3Q A;  3PW2 A;  5LXW A;  1L43 A;  4XUS A;  1WG8 A;  5DB8 A;  3B6L A;  1JEF A;  1JPO A;  232L A;  4B4I A;  3AL0 B;  2F8K A;  1L95 A;  1OUD A;  4AYB F;  1QT6 A;  2K4P A;  3DN4 A;  3HDE A;  4LGK A;  3ZI4 A;  1GDW A;  5DDY A;  1K1Q A;  4C7Z A;  1OQM A;  4IAT A;  2R8G A;  2ANX A;  4QEQ A;  2W11 A;  2CN1 A;  1BPZ A;  1L13 A;  3TMV A;  8ICL A;  3SAG A;  3GUI A;  3AMZ A;  3T5H A;  4DOC A;  1ZQB A;  4K4G A;  2OYY A;  1ZRM A;  5ALQ A;  1PK1 A;  1QUG A;  4IR1 A;  2QAR C;  3TFR A;  1L92 A;  3UXN A;  2H9K A;  3RFA A;  3O0F A;  5KFF A;  1BHZ A;  1UIB A;  1FDL Y;  1MA7 A;  1L56 A;  1ZQU A;  2YN4 A;  2Z39 A;  1M6Y A;  4CDG A;  5T14 A;  1D3N A;  3DN3 A;  3WXU A;  1YL1 X;  3RF9 A;  3KKA A;  5L1I A;  8ICW A;  1TBY A;  1JJ1 A;  3AGI A;  2Y0S C;  3M6K A;  3HBE X;  2ZIU B;  4QW9 A;  1IWU A;  4DL4 A;  3WKA A;  1NKC A;  9ICJ A;  1L47 A;  5AIC A;  1IWV A;  3GUK A;  4UAT A;  3A8Z A;  4F5O A;  5B5E U;  2OE7 X;  3C80 A;  1BGI A;  3P66 A;  4WM5 A;  4NHP A;  2HHQ A;  1ALC A;  3C1Z A;  5A3E A;  1L17 A;  1S10 A;  8ICV A;  4OO1 J;  3TMX A;  1SV4 A;  7LZM A;  4B4E A;  1KIQ C;  1FKV A;  4EKQ A;  1Z4O A;  2BQA A;  3VWO A;  1OVJ A;  4IL6 U;  4UQG A;  4Y2R A;  1N61 A;  1ZYT A;  2F30 A;  1QTV A;  4RT2 A;  1L42 A;  3FI5 A;  2YY6 A;  1LGX A;  1LJN A;  3GIL A;  1COO A;  1S9F A;  1IXR A;  4DF8 A;  1C6B A;  4YEM A;  2LHT A;  5ALG A;  5B1G A;  3KZX A;  2Y1I A;  2BPF A;  3G3W A;  1RFP A;  2ZIV B;  1IR7 A;  1YKY X;  1U45 A;  1JXL A;  1SXD A;  5CP2 A;  1L90 A;  240L A;  4RPY A;  1C6G A;  4DQI A;  3LYS A;  3RAX A;  3EMS A;  166L A;  2NYV A;  1SWY A;  2BLX A;  5AKJ A;  3HU8 A;  4NGI A;  190L A;  1UCO A;  1T4G A;  9LYZ A;  5CHG A;  4Z98 A;  2AH5 A;  4KLI A;  3KOO A;  212L A;  5I4W A;  3GXK A;  5AI4 A;  5KXR A;  4F92 B;  4UB2 A;  1B7Q A;  219L A;  2DFL A;  4KLS A;  5J0P A;  4IRK A;  248L A;  3MR3 A;  1JAL A;  2PFQ A;  1CUQ A;  1GWD A;  1ZMY L;  1B7N A;  5HMM A;  1GF4 A;  3A34 A;  1L5U A;  9ICI A;  1NJW A;  1L86 A;  3W3E A;  3CSZ A;  4TUN A;  1LB2 B;  5APC A;  135L A;  103L A;  1GB8 A;  3Q8P B;  4GXK A;  1L83 A;  1CI4 A;  1CUK A;  1PQJ A;  5KT6 A;  1YAQ A;  1VLB A;  4B9S A;  3BS5 B;  3OE9 A;  3GIM A;  1DPW A;  1C46 A;  2IFF Y;  4Z46 A;  1DKJ A;  1X6I A;  4O3O A;  1GBY A;  1ZQK A;  4IQT A;  1BPE A;  2D6F C;  3CDT A;  1S0N A;  5KFS A;  3H40 A;  2W55 A;  4FZL A;  3HP6 A;  2BQH A;  2G4P A;  1LJF A;  2B5Z A;  3HTF A;  2C8O A;  3N9E A;  4X5V A;  3BZK A;  1QUO A;  2ZIW A;  2WF7 A;  2LYB A;  1L74 A;  4QWE A;  1QSS A;  3QEA Z;  1KNI A;  3ETL A;  5KXZ A;  1L22 A;  4M9J A;  3QUT A;  1VDP A;  3EBA B;  199L A;  185L A;  3I76 A;  246L A;  4X3B A;  214L A;  1CJ7 A;  3UMB A;  1BNO A;  1G07 A;  3SBB C;  4Y2S A;  5GTH U;  3KHR A;  2LM1 A;  6LYT A;  5J2B A;  1L7N A;  4RQ8 A;  2DBT A;  1L82 A;  5AM2 A;  1C6A A;  4ZPU A;  4G9B A;  4I7T A;  3JPR A;  3DMV A;  2A7F A;  4JV0 A;  3DMZ A;  3CP8 A;  3NUQ A;  5KAI U;  4KLE A;  1GD6 A;  3HT7 A;  4GN4 A;  123L A;  1LJK A;  2ZG6 A;  3PDS A;  1LZN A;  4LT1 A;  2HHV A;  4B9U A;  1LSZ A;  3V7J A;  1LJI A;  4GCB A;  1X42 A;  5EE3 A;  1LZB A;  4ZOH C;  1I1Z A;  4DDA A;  1ZQE A;  3QUQ A;  4FO6 A;  1L03 A;  5KXP A;  5AKY A;  3AU6 A;  2W54 A;  3RJJ A;  2MEF A;  149L A;  1BB3 A;  5LYM A;  5KFR A;  2FLP A;  3B0K A;  4JV2 A;  3G3V A;  1OUJ A;  4O5K A;  2VKQ A;  5KG6 A;  3AYQ A;  2W04 A;  4NSJ A;  3H7I A;  4RQ6 A;  1UIG A;  4J9L A;  8ICG A;  2I26 L;  4YVZ A;  4RQ5 A;  3AQF A;  2HW3 A;  3D2N A;  4KX5 A;  1BWI A;  5B59 A;  4N8Z A;  5FEL A;  2KNJ A;  4E97 A;  2JEF A;  5ALF A;  3C8Q A;  3M9N B;  2C2E A;  4AQN A;  2GO7 A;  4B9T A;  3A93 A;  1ZQ1 C;  1X9M A;  2M0N A;  1LYG A;  4XEN A;  4TQR A;  2QB0 B;  2CRX A;  1UHU A;  5L1M A;  2RBP A;  1QSA A;  1D0M A;  4RNO A;  243L A;  1ZQJ A;  2OXO A;  3FI7 A;  3QU2 A;  2F1I A;  1L94 A;  1WVU A;  3AGG G;  5KL8 B;  1LMT A;  4NWI A;  4F4Y A;  1FIQ A;  4KN4 A;  4JV1 A;  1H87 A;  1KDH A;  1C6H A;  1N5X A;  1L61 A;  1LKY A;  4BXO A;  5G5G A;  5KFD A;  1L14 A;  1CEZ A;  2YBN A;  3UXP A;  2EQY A;  1L20 A;  5KFN A;  1L02 A;  1TK0 A;  2GV0 A;  3SQI A;  2JXJ A;  1DYE A;  3DMX A;  4I2I A;  3ZEK A;  4OO9 A;  1AQ6 A;  3H8W A;  2IHM A;  4P0P B;  1L37 A;  4W57 A;  4OD0 A;  4RUC A;  1NJY A;  1L71 A;  3WPL A;  1ZUR A;  4KMU A;  1XGU C;  2RAZ X;  142L A;  1LPY A;  3GIJ A;  2AHO B;  3ZDB A;  2WAQ F;  4RQ4 A;  3EWA A;  1YKX X;  4LFX A;  3HH3 A;  1IO5 A;  1L11 A;  3P68 A;  2JMG A;  3LDA A;  1HHL A;  4C8O A;  3BS7 A;  2ZTD A;  5AI6 A;  4EEY A;  2ZIX B;  3C21 A;  4NHT A;  1YKZ X;  5KG3 A;  1XC9 A;  3H0R B;  2BKE A;  1VJ5 A;  5KG2 A;  207L A;  1L07 A;  1L58 A;  1SKS A;  1K28 A;  1OUF A;  3HKZ F;  3D3D A;  4DL2 A;  9ICW A;  3C8R A;  4PRU A;  153L A;  3P65 A;  1L72 A;  1XO1 A;  5KAF U;  1KN5 A;  4MF2 A;  5ALK A;  1C6Q A;  1RCM A;  4WL7 A;  2F2A B;  3WU7 A;  1XSL A;  1B7M A;  4P4P A;  4YN4 A;  1HC0 A;  4F5P A;  1O03 A;  120L A;  5IIO A;  2ZUC A;  5KJ9 A;  2ZXI A;  3E3D A;  3JPO A;  3QX7 A;  5BOM A;  9ICX A;  162L A;  1WYG A;  2P35 A;  5F9U A;  4C5F A;  188L A;  3FAH A;  4NL9 A;  4NLG A;  1DYF A;  2MED A;  3HUK A;  2HCF A;  2W9B B;  2DQF C;  1EPY A;  5J29 A;  5CRX A;  1QUS A;  2RRD A;  5GTI U;  4II8 A;  3IWR A;  1KS3 A;  1F0M A;  2A1A A;  1L24 A;  1URJ A;  5ALE A;  4DQR A;  2JHD A;  194L A;  5KFI A;  2FI1 A;  3UMG A;  4GLX A;  2KE7 A;  237L A;  2DQC Y;  1UT8 A;  1GFA A;  5F9L A;  4LZD A;  1N4F A;  3ZDA A;  1PQI A;  4ZFP A;  2IBK A;  3M1Y A;  9ICQ A;  1L79 A;  3R9K A;  2UVU A;  1VDT A;  4TWS A;  7ICL A;  4J9P A;  2DUY A;  4G4C A;  1I6S A;  3QZ7 A;  5LZM A;  261L A;  3FYH A;  1LKS A;  250L A;  5B1F A;  5I14 A;  1L67 A;  1ZV5 L;  2ZJ5 A;  4CF4 A;  3DN0 A;  1RXW A;  7ICN A;  3PMN A;  2A7D A;  2KIW A;  2FPK A;  3RT5 X;  3ZVQ B;  3ED5 A;  2OH2 A;  1CU5 A;  5ALU A;  4KL7 A;  231L A;  4F4Z A;  1CV5 A;  1QIO A;  2ASJ A;  5DG8 A;  3RR8 A;  4F72 A;  1XEP A;  3QY4 A;  1IIZ A;  2CXY A;  4R65 A;  1LSC A;  4OWE A;  3JPQ A;  4PJZ A;  5J2A A;  1RXV A;  1NQI A;  4DQJ A;  1KFS A;  4FDY A;  3SZ2 A;  1FFU A;  3KKA C;  5CA7 A;  2B6X A;  4NHQ A;  2YTU A;  1V9P A;  169L A;  1BB7 A;  2YMM A;  7ICF A;  1J1X Y;  1Y88 A;  4I7M A;  2VIX A;  4RNM A;  4JK1 A;  1L77 A;  4EBE A;  4LZT A;  4G4H A;  1LSN A;  2ZTC A;  3V6K A;  1LJ4 A;  2EQL A;  1DYB A;  2YBL A;  4I7N A;  2F2N A;  2Y0S F;  2OCE A;  1H6M A;  1UPH A;  1JN3 A;  1MN8 A;  2G5H B;  2W9C A;  4JB3 A;  4NFV A;  1JQU A;  1GB5 A;  2DPJ A;  1XEI A;  1JIT A;  1LSE A;  5HMV A;  3F53 A;  1Q46 A;  3CDR A;  155L A;  4HTK A;  2F77 X;  3CT0 A;  1YRO A;  3TFS A;  1NJX A;  2HUB A;  3ATN A;  5KY1 A;  4JWN A;  5A0L A;  1IOT A;  4BAP A;  3WKD A;  4DC4 A;  3UMC A;  244L A;  3NRW A;  1Z00 A;  3MBY A;  3OPX A;  8ICK A;  251L A;  3NY8 A;  1WTH A;  4G3I A;  3JPP A;  1C68 A;  3PX4 A;  2IHN A;  2ALZ A;  1ZQP A;  3PO5 A;  5LIO A;  1ZQA A;  4DSK A;  5KFG A;  3VCB A;  3A96 A;  1HF4 A;  2V9W A;  5ALN A;  1JJ3 A;  3N9A A;  5ALX A;  3N7R C;  4GFJ A;  4QWA A;  1B2K A;  2RH1 A;  2OTY X;  4DL5 A;  5J0O A;  4KLT A;  4JWM A;  1L96 A;  1GF0 A;  4TUQ A;  1NI3 A;  5II3 A;  1YQV Y;  4OJP A;  1ZYQ A;  6LYZ A;  7ICE A;  3PW0 A;  2K60 A;  1L46 A;  1UBZ A;  1LTM A;  1GFR A;  3KHG A;  1L87 A;  3RRH A;  198L A;  1TK8 A;  2D8C A;  4I8S A;  2KD1 A;  7ICH A;  1ZQM A;  1EQ4 A;  1ZJN A;  130L A;  4DT3 A;  4MFC A;  3D2S A;  1LSF A;  3LYM A;  1D9D A;  2OWO A;  1L84 A;  4QWD A;  5DBC A;  4BWM A;  1LSG A;  112L A;  2YBJ A;  4RLN A;  1IIP A;  1IOQ A;  1GEV A;  3K1Z A;  2G4Q A;  9ICO A;  3B9J A;  4Y2X A;  4GCD A;  4ARP A;  148L E;  4LYT A;  1YL0 X;  177L A;  2RDI A;  1GHL A;  3FE0 A;  3RNX A;  3IDW A;  1GF6 A;  3F9L A;  5APE A;  200L A;  4DWX A;  4KLO A;  1GXV 2;  4C8N A;  5J2C A;  2E8M A;  1EXN A;  3ODU A;  1KW7 A;  3OHA A;  3MR5 A;  3IG8 A;  1L57 A;  2OE9 X;  7ICO A;  4WOA A;  1OUE A;  5LA8 A;  1V85 A;  3CNH A;  4NWE A;  5C6L A;  4QGZ A;  2MRL A;  137L A;  2F32 A;  3T79 A;  152L A;  157L A;  2BQD A;  1LWK A;  4O0I A;  1VDQ A;  1JXE A;  1L26 A;  2DQA A;  2CJL A;  5J2E A;  2KZZ A;  1NJZ A;  3PSP A;  2QKQ A;  2JR5 A;  4DFD A;  4ED8 A;  1L29 A;  1CUP A;  4FBU A;  3LZ2 A;  3KZI U;  3HRD D;  2A3V A;  1A76 A;  1KLN A;  1KW5 A;  3A6C Y;  3G6V A;  4CF5 A;  160L A;  1C65 A;  1DI5 A;  1LCN A;  1NKE A;  3WXT A;  1L05 A;  4DL7 A;  4P0Q A;  3WK6 A;  4DDB A;  1C61 A;  1QTD A;  1KFD A;  3H4D A;  2BQ3 A;  4ED7 A;  5IIK A;  3G6X A;  3RBE A;  221L A;  8LYZ A;  2H5X A;  2W9A A;  3BQT A;  2KMD A;  5AI8 A;  1TAU A;  3AZ7 A;  4USA A;  2KN7 A;  1LPI A;  4NXZ A;  2MUT B;  133L A;  5KKI A;  1C67 A;  2HMX A;  2PI4 A;  1BPY A;  1HEL A;  2H5Z A;  191L A;  3Q8S B;  165L A;  3PY8 A;  1FEZ A;  3M9O B;  2KFZ A;  1BVS A;  2FYD A;  1DI3 A;  3F5E A;  4ECT A;  1GDX A;  3UPQ A;  3BQ0 A;  1G1W A;  5ALD A;  1B7O A;  1LHK A;  1CRX A;  1RE2 A;  4GXJ A;  2K4H A;  1T6V L;  1LLH A;  5DQH A;  3F2B A;  2LZ2 A;  1L64 A;  4RQ7 A;  5EWF A;  2ZJA A;  4ECV A;  7ICP A;  2XJW A;  2E1E A;  8ICA A;  4BGD A;  1RJC B;  3NS1 A;  8ICI A;  7ICI A;  1VDS A;  4LT2 A;  4NGY A;  4BAD A;  2O79 A;  8ICS A;  1KEJ A;  1TK5 A;  2ZIK A;  3KTQ A;  1L49 A;  1TFR A;  1IG6 A;  4ZEE A;  2EZZ A;  3B0Y A;  3SV4 A;  1JUD A;  2VJ5 A;  4F4X A;  4PGJ B;  1C6P A;  1HFX A;  3QUC A;  1UA6 Y;  4HPI A;  3M8R A;  1WQO A;  5ALP A;  4B0D A;  4UAY A;  4XJF A;  1B0X A;  3BDP A;  3HTB A;  1C62 A;  4GCF A;  1NBY C;  2XY7 A;  3G3A B;  3TXE A;  1CKH A;  4QZF A;  2ZYC A;  127L A;  2BGW A;  4RPX A;  5HR7 A;  3QAK A;  3TAP A;  4PGY A;  5IIN A;  3LVV A;  1A6S A;  1G7I C;  5AK3 A;  1LYO A;  2O6K A;  2D4J A;  4TSB A;  1PQD A;  4NHS A;  1T3N A;  3BJY A;  3AZ6 A;  3CDO A;  1FBI X;  4G4B A;  2H3V A;  4EEK A;  3LK9 A;  2AQ4 A;  4OWC A;  5G5H A;  4NWH A;  5JEN B;  1LMN A;  2ISO A;  1GEZ A;  1QTC A;  3WKB A;  3KFU F;  2WF8 A;  1VED A;  2Q0Z X;  2YB1 A;  1P64 A;  4DQS A;  3AUO A;  3TXD A;  3A94 A;  2MEH A;  1V38 A;  2A1J A;  4ECZ A;  4ED0 A;  4YG2 A;  4EYI B;  1VAT A;  2O4W A;  3FAD A;  4J0L A;  3W6B A;  5KT4 A;  2JV3 A;  1DKK A;  3G3B B;  3MAB A;  3MFH A;  3OE8 A;  4OOT A;  4QWB A;  3M18 B;  1GE0 A;  3GV5 B;  1DXJ A;  2P6U A;  4W55 A;  1GF7 A;  3WYH A;  109L A;  4EKR A;  2PC2 A;  1L28 A;  2B6Z A;  2B6Y A;  4H8Z A;  4OJL A;  1WWU A;  1CVK A;  1RDF A;  1L69 A;  4O3P A;  1TLA A;  1L88 A;  3E58 A;  5KXS A;  4C7Y A;  3NYA A;  3N28 A;  4PPO A;  1UIH A;  2QAR B;  5LA5 A;  4FJR A;  1U4B A;  1NZP A;  4NL9 C;  3HU9 A;  2G0A A;  168L A;  2W7P A;  4Y2V A;  4NSG A;  3MFI A;  4DQP A;  3AZ5 A;  1DZB X;  5EOZ A;  3HWL A;  2ZUB A;  2HED A;  4ARQ A;  1XWL A;  4H94 A;  4EEL A;  1IM4 A;  1N60 A;  1Z19 A;  1ZQC A;  4Z6C A;  2XC9 A;  4H9E A;  3WMK A;  1IR8 A;  1L62 A;  5KG7 A;  2B7X A;  4UWV A;  2Q0M X;  3RZ4 A;  178L A;  1UQV A;  3GDX A;  1Q8K A;  1WQQ A;  1WQR A;  2KHQ A;  1PUZ A;  2QB1 A;  2Q9E A;  1X9S A;  4Y2Y A;  3U26 A;  2XBS A;  2OHF A;  4DOB A;  2C28 A;  1QDT A;  2YML A;  3HTD A;  1NBZ C;  2CPR A;  187L A;  4I28 A;  151L A;  4DS5 A;  4DS4 A;  2H9J A;  2R8K A;  4PH5 A;  1C6J A;  3PR5 B;  3A0H U;  4PJ2 C;  4RQ0 A;  2KJ9 A;  5EWG A;  2LM4 A;  1GE2 A;  1L8L A;  2JEI A;  1QUH A;  5KKJ A;  2LBO A;  1C08 C;  3WPJ A;  2VAN A;  4IAP A;  1WTM A;  1LZ5 A;  3QE8 A;  5KXN A;  1P6Y A;  4OW1 A;  5CR0 A;  3ISC A;  4YMM A;  4F2R A;  2HUK A;  2Q9D A;  4MHV A;  4NGK A;  4M6W B;  3V6H A;  2RBS A;  2FYC A;  2VJ4 A;  2KIV A;  4YR0 A;  2RQ5 A;  4A8E A;  1NMM A;  1GFT A;  5LAG A;  7ICQ A;  1OUB A;  4WG7 A;  2KP7 A;  2B70 A;  4IQU A;  2KOB A;  1CJ6 A;  2HVI A;  4YX7 C;  5AHX A;  4NGJ A;  238L A;  8ICF A;  4P2E A;  9ICK A;  4PRQ A;  4Z6F A;  3HT6 A;  3GU3 A;  3TAQ A;  3TXI A;  3M8S A;  1B9O A;  2KEY A;  1P3N A;  2W1M A;  3GIK A;  2BPC A;  3V6J A;  5DB7 A;  1L68 A;  3WUL A;  1ZWN A;  5C6J A;  4Q8F A;  3EML A;  5ALR A;  1LJG A;  1L51 A;  3TAD A;  3C8S A;  2AXT U;  1SSY A;  3Q8M A;  4Q8E A;  5J0U A;  4RT3 A;  1RYS A;  1OUG A;  2OEA X;  2RB2 X;  2Z2E A;  3HTG A;  4ETC A;  1HML A;  2KHV A;  1L0K A;  2W3R A;  1OXJ A;  2C2D A;  7ICK A;  5AIB A;  3HJE A;  1C20 A;  3EPI A;  1DOQ A;  3PW7 A;  4W56 A;  1L7P A;  2F1H A;  1OUI A;  4HV1 A;  3JPT A;  1SX7 A;  3PW4 A;  4KLG A;  2JZB B;  3K75 D;  5HP4 A;  2IA6 A;  3A3Q A;  1RG6 A;  1QSB A;  5I5Q A;  2C8P A;  1UA0 A;  5AKL A;  2IOH A;  4HJV A;  4C3W A;  4UB8 U;  1D0L A;  3D9A C;  4WO6 A;  4YOP A;  1N62 A;  5IIL A;  2JEG A;  3J81 j;  4UB3 A;  3C29 A;  2HHS A;  3QU7 A;  4TQS A;  119L A;  5ALY A;  1C64 A;  4LZM A;  1QQ6 A;  4P4M A;  1NWG A;  1GB3 A;  3SB5 A;  4OJ5 A;  1J2N A;  9ICH A;  4XAD A;  1REY A;  2F1J A;  4I2J A;  1NDG C;  2GLE A;  7ICR A;  3OJP A;  3J6K A;  9ICB A;  2BQI A;  2PFN A;  4CE6 A;  1LHH A;  3AZ4 A;  1JKA A;  4WM2 A;  4EBD A;  1HFZ A;  1L25 A;  1PVQ A;  2RBO A;  2ESE A;  4QZE A;  5I54 A;  3FA0 A;  5JTI A;  8ICQ A;  1LHJ A;  4TX7 A;  3E2E A;  3IN5 A;  3CT1 A;  3WK9 A;  1L59 A;  2ODG A;  4WLT A;  4QZD A;  3CSQ A;  1JTO L;  2F2Q A;  4O34 A;  1GFU A;  3PR4 A;  5APF A;  3GV7 B;  2DKX A;  4GLV A;  3A92 A;  4I2F A;  3F8V A;  1IX0 A;  1C6I A;  9ICP A;  2AUB A;  2WF9 A;  3GUN A;  1NKH A;  3KHL A;  131L A;  4F50 A;  9ICV A;  4KLM A;  1TE2 A;  1NK9 A;  1D2Y A;  5KFV A;  5AKH A;  4F5N A;  1XO0 A;  4XJB A;  3BQ1 A;  4I2E A;  1CU0 A;  1PQO A;  1A2Y C;  1L12 A;  2RP5 A;  1GFH A;  4DFP A;  4OWB A;  1DGJ A;  7ICS A;  3ATO A;  1L3U A;  4UBC A;  1YZ6 A;  1IEE A;  3D4S A;  2VA3 A;  4YCX A;  2WF5 A;  4H9I A;  3SB7 A;  2HEE A;  3CDV A;  1LZT A;  4NJ8 A;  1UC0 A;  4EOF A;  5HML A;  2KSO A;  3VC8 A;  1SZP A;  1ZJM A;  3TKA A;  4YR2 A;  3BZC A;  4CNQ A;  3E0F A;  1L23 A;  175L A;  3DNA A;  3MC1 A;  228L A;  4C8L A;  1CKG A;  3QNG A;  1QQY A;  1TAY A;  3GV8 B;  4Y2Q A;  9ICR A;  4GCC A;  4J9S A;  1L81 A;  5F14 A;  4M04 A;  2GWS A;  1CX7 A;  1S0M A;  1L27 A;  4BS7 A;  5J2J A;  3ZDD A;  1Z4N A;  2W8L A;  1NK6 A;  2I9G A;  2XCA A;  4Y2U A;  1L97 A;  4F3O A;  2XVT A;  1L39 A;  1LYJ A;  3MDC A;  4BJQ A;  2YMQ A;  156L A;  5FCP A;  4ANR A;  1KRP A;  174L A;  3WW5 A;  1LMO A;  1QSL A;  4TUP A;  3W6C A;  5AM3 A;  3WVY A;  4EJ4 A;  2B6G A;  1JSE A;  1IWX A;  1FN5 A;  2YDG A;  4I27 A;  1G06 A;  4EX7 A;  1PQK A;  5LVH A;  1F5S A;  1YAP A;  1F6S A;  2BPU A;  1ZQW A;  4ICA A;  5IEL A;  3SBA A;  1PS5 A;  4RDS A;  3KHH A;  4RQM A;  2EAM A;  1U47 A;  5KT7 A;  2ZYP A;  3MDA A;  2BQB A;  3Q8Q B;  1MQ3 A;  1LSY A;  5AM0 A;  1FLW A;  2WTF A;  2B72 A;  3OK0 A;  3L2X A;  1C6N A;  4YP3 A;  1BVK C;  4NM1 A;  3GII A;  4PHD A;  1L53 A;  4FZM A;  1AM7 A;  4N5R A;  5KFM A;  2FDR A;  2JGA A;  1T97 A;  4LZG A;  1MEL L;  1QT3 A;  102L A;  4F5Q A;  2MEI A;  1LZC A;  1ZRN A;  2WFA A;  4NSI A;  3C2K A;  1ZQF A;  2ZJ8 A;  2PI5 A;  8ICT A;  1KXX A;  4GC6 A;  4PZO A;  4I7R A;  9ICL A;  4ARM A;  3IG5 A;  4I2A A;  1FLQ A;  3PVX A;  2FJ6 A;  1QQ7 A;  1CV3 A;  1JHL A;  2KKP A;  1JMS A;  1PVR A;  4MF8 A;  3MGV A;  4KT3 A;  217L A;  5C5J A;  8ICB A;  1J2M A;  4C8M A;  4KLH A;  259L A;  2HEF A;  2HEA A;  5AKI A;  5KG1 A;  1ECW A;  5DLG A;  3C2M A;  1JUG A;  4E3U A;  1LVH A;  2BCS A;  3M9M B;  1LI2 A;  1RZT A;  2MA1 A;  2BCV A;  2Z7J A;  2YB4 A;  4LDO A;  1TEW A;  1QH9 A;  3D2Q A;  1KY1 A;  1PZY A;  5J0S A;  2LZM A;  252L A;  4LYZ A;  1HNL A;  4NLB A;  5J2I A;  4EBC A;  1W6Z A;  2G06 A;  2BQK A;  4I2C A;  5JUM A;  1HER A;  1CU6 A;  5L9J A;  3A0B U;  4I7J A;  2PFO A;  4O3M A;  8ICO A;  5J0Y A;  3QU4 A;  1AT6 A;  2MEC A;  2DBY A;  9ICA A;  1L04 A;  5KXO A;  1L54 A;  2F76 X;  2E3T A;  2GH1 A;  2HEB A;  1L8O A;  4IRC A;  1L52 A;  1D2W A;  1ZOL A;  5L3I A;  3W6F A;  2BDU A;  4QZ9 A;  3W6E A;  5KFU A;  1SX2 A;  5KXT A;  147L A;  3I1Y A;  1L35 A;  4R8U A;  2KVS A;  4AGA A;  5KFA A;  2PMZ C;  7ICM A;  3DDH A;  1D8B A;  1FFV A;  5FHW A;  1PK1 B;  1RQN A;  1GBZ A;  1L45 A;  2XQO A;  3IJV A;  4EPI A;  3ORY A;  1ZQR A;  4EZ6 A;  4KLL A;  3QXG A;  2K4E A;  1L40 A;  1U49 A;  9ICU A;  1C60 A;  3A6B Y;  4GIB A;  1REX A;  5ALV A;  3WK7 A;  4RQ2 A;  4N1E I;  1LI6 A;  2HBM A;  1L73 A;  4PL2 A;  5L1J A;  5DKW A;  114L A;  1W08 A;  1XGP C;  4NG1 A;  173L A;  4P4O A;  3V7K A;  1KKX A;  2K4I A;  1OV7 A;  1D9W A;  1Q3V A;  4JMU A;  1QT5 A;  1SWZ A;  4K5Y A;  2LZT A;  2KTQ A;  1L0J A;  3NVZ A; 
#chains in the Genus database with same CATH homology
 3HH6 A;  5AMY A;  3SEN A;  1OUH A;  2G4N A;  4EPF A;  2Y9T A;  4GN3 A;  4WM3 A;  3CB7 A;  1CX6 A;  4I7O A;  1LHL A;  4G9S A;  1BWH A;  3NY9 A;  3WVX A;  4W54 A;  1UUZ C;  2EAO A;  1GF9 A;  1LKR A;  3GXR A;  4YXA C;  4NGW A;  2DQE Y;  1GFG A;  1L50 A;  1GBS A;  1CJ8 A;  1JI7 A;  1LYD A;  4B1A A;  1C63 A;  195L A;  1T8A A;  161L A;  1B5V A;  2WAR A;  4LDE A;  1T8G A;  1JTP L;  1GFV A;  3TAD C;  1JWR A;  1LMA A;  5B05 A;  4NHI A;  1D9U A;  1ZVY B;  2BQN A;  4LT3 A;  254L A;  7LYZ A;  3CDQ A;  2LCB A;  2RB0 X;  4YF2 A;  2OU9 A;  1UCV A;  1G7L C;  230L A;  1SSW A;  4DJH A;  3AW7 A;  2I25 L;  1LZE A;  2IHL A;  4DD7 A;  1C6K A;  186L A;  1GE1 A;  3BKV A;  3GUL A;  4LYO A;  1LSD A;  5KXK A;  4HSF A;  1LYI A;  1LJH A;  1C6F A;  1D6Q A;  3UON A;  222L A;  1B7R A;  5I4Y A;  4HJY A;  3KAM A;  1COK A;  1LZ9 A;  1QS5 A;  154L A;  1L34 A;  1RI8 B;  5L3H A;  2OTZ X;  2HUM A;  4U3X B;  1B6I A;  3C7W A;  4N0J A;  1G7J C;  150L A;  4M4O A;  4IJ4 A;  247L A;  125L A;  1WWV A;  1JTT L;  257L A;  1MLC E;  4NIJ A;  1L76 A;  3V2Y A;  5IDD A;  4DQ5 A;  1QTK A;  3A91 A;  4H9B A;  3ULR A;  1J1O Y;  1G0P A;  1IP5 A;  4XJD A;  1HEM A;  5DN5 A;  1XGR C;  2B74 A;  1OYU A;  4G49 A;  4N1C C;  2XBR A;  1DPX A;  1GB6 A;  1P2C C;  4DD0 A;  3B0O A;  1JTM A;  1QUT A;  233L A;  1X66 A;  2B75 A;  4ET8 A;  1UIC A;  4ETE A;  4IS7 A;  242L A;  3TMU A;  3JR6 A;  4WL6 A;  1KW4 A;  4EXM A;  1A4V A;  3DN2 A;  1JKC A;  1DI4 A;  5HLL A;  3LYO A;  2HU3 A;  4H9F A;  1C7P A;  1LKY B;  1B5W A;  2W1Y A;  5I4X A;  215L A;  2RBR A;  1GAY A;  5LYT A;  262L A;  1Z55 A;  3HBH A;  2FBD A;  5B07 A;  2ANV A;  193L A;  2BQC A;  4WLD A;  4KPM A;  4EKP A;  236L A;  2RSC A;  4ETA A;  2MEA A;  1WTN A;  4NEB A;  3T36 A;  1QTE A;  2HTX A;  208L A;  4YEN A;  1INU A;  5I53 A;  1CTW A;  1DXS A;  1OWZ A;  4H9H A;  5D5C A;  1LGW A;  2LHM A;  1QTZ A;  2Y8P A;  3WPK A;  1IC4 Y;  1WQP A;  1L70 A;  1J1P Y;  2NWD X;  2VB1 A;  1L75 A;  1C6E A;  3LYT A;  1BB6 A;  145L A;  143L A;  3BS5 A;  4CFO A;  4H8Y A;  2CGI A;  1G0Q A;  1GE3 A;  4DQ7 A;  2ZQ4 A;  113L A;  1BQL Y;  1LSA A;  1IY3 A;  2YSS C;  3LHM A;  3TXH A;  260L A;  5HNC A;  4H91 A;  1QTB A;  1LSB A;  2Z37 A;  1L0J A;  2F47 A;  4DYG A;  3H8M A;  1UIE A;  201L A;  4B49 A;  3LZT A;  1GBX A;  4QY9 A;  1TCY A;  1FLU A;  1G1V A;  1LZ8 A;  4NG8 A;  4ARL A;  4J1B A;  4WLY A;  138L A;  1C66 A;  2FE9 A;  3SB9 A;  4S0W A;  3AB6 A;  1LYH A;  4OWA A;  1CV1 A;  213L A;  3TXF A;  141L A;  3WL2 A;  1XJT A;  2D3D A;  3G3X A;  1L98 A;  110L A;  4OWH A;  3TMW A;  1OVK A;  5M1Y A;  2OU8 A;  218L A;  1P7S A;  4GRV A;  1BB4 A;  4Z41 A;  3MGW A;  2RBQ A;  1IP7 A;  1BB5 A;  2HUL A;  2FBB A;  3WW6 A;  1REM A;  4RQN A;  1CKF A;  3WU8 A;  1GB2 A;  1IWW A;  229L A;  4HTQ A;  1G0M A;  1SLY A;  1L63 A;  5DM9 A;  2QB0 A;  1QT4 A;  1L44 A;  4BAF A;  4XJG A;  5K7O A;  5E9R A;  3WH1 A;  2OU0 X;  4WLX A;  1XSF A;  1L21 A;  4W53 A;  245L A;  1O23 A;  4XYY A;  1LZ6 A;  1HEW A;  1L09 A;  1L15 A;  211L A;  2CWI A;  1JIS A;  2NTH A;  4GN5 C;  4I0C A;  5IHG A;  3BKH A;  1IP6 A;  2HEC A;  1GB0 A;  5KXY A;  1LYF A;  1IP1 A;  4WM1 A;  1L19 A;  3K3T A;  4B4J A;  184L A;  2OE4 X;  4GBR B;  5F9X A;  2RBN A;  1L85 A;  1GF5 A;  2O7A A;  4H9A A;  1CNS A;  1LYY A;  4R6C A;  4XJH A;  3J4G A;  5J8Y A;  205L A;  1EQE A;  224L A;  2DQH Y;  4W94 A;  5FDJ A;  4WO9 A;  1LHI A;  3HT9 A;  1SGG A;  1GFK A;  1B5U A;  1T6H A;  1L93 A;  3F6Z A;  1P46 A;  1SV0 A;  1V7S A;  3C82 A;  128L A;  4ARJ A;  1JKD A;  1LZS A;  1GBO A;  1CV6 A;  1L99 A;  1WQN A;  1LSP A;  3C81 A;  171L A;  4I7L A;  1LW9 A;  3RUN A;  2LPE A;  1CJ9 A;  2E8N A;  159L A;  1AZF A;  2DKV A;  3CT5 A;  1QDR A;  1IP3 A;  5EBH A;  1I56 A;  3SB6 A;  4H9C A;  2B73 A;  4HV2 A;  1CV4 A;  1G7H C;  4WMG A;  5DN4 A;  1GE4 A;  3WUN A;  1G0L A;  2ZQ3 A;  1GAZ A;  1VAU A;  227L A;  3GUM A;  2RB1 X;  1C6D A;  1L16 A;  2L5Y A;  3ZVQ A;  4Z3M A;  2DQG Y;  3RU5 A;  1L36 A;  3B0I A;  4CHX A;  1C6T A;  256L A;  3B72 A;  144L A;  1HMK A;  3A95 A;  1TDY A;  5LVI A;  1OP9 B;  1SQ2 L;  1OUA A;  2DQJ Y;  1LMQ A;  5LVG A;  3HH5 A;  1DYC A;  4WM4 A;  3LN2 A;  183L A;  2F4A A;  1OVH A;  1XGQ C;  2X0A A;  3C83 A;  4NGZ A;  4J1A A;  1C6L A;  1JTN A;  1LOZ A;  1EQ5 A;  1G0J A;  4PK0 A;  2LMR A;  3HH4 A;  1C10 A;  1DQJ C;  1F10 A;  129L A;  146L A;  2BQL A;  5LVJ A;  4OOO A;  2B6W A;  1FKQ A;  5F81 A;  1NF5 A;  1SXE A;  1B7S A;  1L31 A;  1C69 A;  2BQF A;  1IOR A;  1DYD A;  4I7K A;  3BQ7 A;  4LDL A;  1D0K A;  4HPE A;  3HUA A;  4GLA A;  5HNL A;  1GPQ C;  1CV0 A;  3SB8 A;  4ETB A;  5E4P A;  5LAF A;  132L A;  4NGL A;  2BQJ A;  1HEP A;  4M6D A;  4HTN A;  4DD1 A;  2BAA A;  2F4G A;  1C6C A;  4W52 A;  4H92 A;  5ILC A;  253L A;  3HFM Y;  3N9C A;  2BQO A;  1B5Z A;  258L A;  3GUJ A;  1UIA A;  4W59 A;  1KIR C;  1XFP L;  1IP2 A;  4TSC A;  2DL0 A;  4NGV A;  4YXC A;  1D3F A;  3WUM A;  5A3Z A;  4I7P A;  5D5F A;  3HBD A;  4J7V A;  4DD2 A;  4DKL A;  111L A;  1L01 A;  234L A;  1D6P A;  1XEK A;  1LMP A;  1QT7 A;  2RAY X;  3HDF A;  4ARQ B;  4NSH A;  3L64 A;  3EO5 A;  1B5X A;  122L A;  1L66 A;  5HMJ A;  189L A;  1L18 A;  3AJN A;  4ETD A;  2LC9 A;  1NHB A;  3DKE X;  2Y9U A;  1L60 A;  134L A;  1P36 A;  3GUO A;  4HJZ A;  4XJI A;  5KXX A;  3W6D A;  1LZD A;  5JRT A;  4UWN A;  2DQI Y;  3SP3 A;  115L A;  1HSX A;  2D4I A;  2EKS C;  1V7T A;  1NDM C;  2IGC A;  4H90 A;  3RZE A;  1IOC A;  4I7S A;  3OE0 A;  3LYZ A;  5F3X B;  1KIP C;  1GXX A;  2DQD Y;  3SN6 R;  2LYM A;  235L A;  1HFY A;  3K1R B;  5KXL A;  1IOS A;  4ET9 A;  2CDS A;  1Z1V A;  3TXK A;  4KXI A;  4RW2 A;  1E8L A;  4WG1 A;  182L A;  206L A;  4IAS A;  104L A;  3SEI A;  1IVM A;  4DD9 A;  1L89 A;  1WQM A;  5FEK A;  2YBM A;  4N9R A;  1CU3 A;  1BWJ A;  4PZN A;  3TXJ A;  1HEN A;  4NGO A;  2EAN A;  4YM8 A;  2W1L A;  2ZIJ A;  139L A;  170L A;  3IJU A;  3DN6 A;  1B0D A;  2I6Z A;  4PHI A;  1UAC Y;  1LYZ A;  1QSW A;  1YAM A;  2ES6 A;  4HP0 A;  225L A;  3PBL A;  2F44 A;  1XGT C;  1NHE A;  1F6R A;  2YBH A;  1IC7 Y;  239L A;  1GFE A;  3EXD A;  4YEO A;  1LZ1 A;  5J8Y C;  2BQE A;  255L A;  1C45 A;  4RLM A;  1L55 A;  2QAR A;  2W1X A;  2ZIL A;  1VFB C;  3K2R A;  4GCE A;  1UID A;  1G0K A;  1CKC A;  5JU5 A;  1T8F A;  1SV0 C;  3CSR A;  1L38 A;  1IR9 A;  3CQL A;  1YIL A;  4ML7 A;  1LJJ A;  3TXB A;  1L48 A;  4LFP A;  3WUA A;  196L A;  2D6B A;  1LJ3 A;  126L A;  5J7C A;  2KSO B;  172L A;  1LZY A;  1GB7 A;  1LZA A;  1DYA A;  4RW1 A;  158L A;  1YAO A;  1FLY A;  2MEE A;  3WU9 A;  1QT8 A;  1LAA A;  2A4T A;  1QUD A;  2Z2F A;  3HIL A;  2BQM A;  2ZNX Y;  1L65 A;  1X40 A;  1ZVH L;  5KXW A;  1L00 A;  4AXT A;  3A67 Y;  4D9Z A;  1LZG A;  1XEJ A;  164L A;  1OUC A;  2LYO A;  3M3U A;  1GBW A;  5C6I A;  180L A;  1UIF A;  1B7P A;  223L A;  3VW7 A;  1REZ A;  4A7D A;  1L10 A;  5LIN A;  1AKI A;  2F3N A;  1L30 A;  4DD3 A;  2ZWB A;  2EIZ C;  3AW6 A;  1KY0 A;  1LZR A;  1QS9 A;  1GF8 A;  108L A;  1LWG A;  4I7Q A;  1QTH A;  1LJE A;  1L06 A;  5ILF A;  4W58 A;  220L A;  4ARM B;  3GUP A;  1LGU A;  167L A;  2N5Z A;  4NY5 A;  2ZNW Y;  4DAJ A;  4CGE A;  4TTD A;  4W51 A;  1OV5 A;  3TAC B;  1CKD A;  2B6T A;  3DN1 A;  1LI3 A;  1P2L A;  2Z38 A;  163L A;  1P37 A;  2HU1 A;  1L32 A;  1IWT A;  1B4F A;  4EKS A;  197L A;  5APD A;  3LZM A;  2D91 A;  1KXW A;  1IP4 A;  4WM6 A;  249L A;  4CJ2 A;  1EL1 A;  2BQG A;  2L78 A;  1I20 A;  1B7L A;  2MEG A;  3W6A A;  3HUQ A;  209L A;  1X9X A;  2Z18 A;  2E8P A;  2YVB A;  1F0W A;  2YBI A;  5LYZ A;  3P64 A;  5HQ1 A;  1GB9 A;  181L A;  1LYS A;  176L A;  216L A;  1HSW A;  1HEQ A;  2EAP A;  1L91 A;  1PK3 A;  2E8O A;  1WVV A;  4LYC A;  1G7M C;  5KNI A;  1JKB A;  1IY4 A;  1L08 A;  3T6U A;  1L33 A;  2XTH A;  3RW8 A;  2MEB A;  2CUU A;  3A90 A;  192L A;  1B5Y A;  1D3M A;  1GF3 A;  3HT8 A;  2BLY A;  2Z6B A;  1BVX A;  4LYM A;  3C7Z A;  5DL9 A;  1JIY A;  4H93 A;  4DDC A;  1AT5 A;  3C7Y A;  3V2W A;  2LYZ A;  1C43 A;  1YAN A;  5B06 A;  1GFJ A;  1JJ0 A;  1LSM A;  4UWU A;  3DN8 A;  1CU2 A;  4W96 A;  4L41 A;  1XJU A;  1L80 A;  2EPE A;  1LZ4 A;  4R0F A;  2Z12 A;  1LYE A;  5T3F A;  2DKZ A;  5FST A;  4H1P A;  5LVK A;  1KXY A;  2D4K A;  4MST A;  1OW5 A;  3OE6 A;  4QDN A;  1HEO A;  1JSF A;  1P56 A;  2KG5 A;  1C6M A;  5F16 A;  1QSQ A;  1D3J A;  226L A;  1L41 A;  3P4Z A;  4MR1 A;  1P2R A;  4LYB A;  1IC5 Y;  1OWY A;  1PQM A;  241L A;  1G0G A;  4H8X A;  2NTG A;  5DLA A;  3A3R X;  4ZIX A;  1IWY A;  2Z19 A;  1LMC A;  1LHM A;  5KXM A;  210L A;  1DYG A;  1YIK A;  4CFP A;  3AGH A;  140L A;  1IWZ A;  3TXG A;  118L A;  4XN6 A;  1P5C A;  107L A;  6LZM A;  5LXW A;  1L43 A;  3B6L A;  1JEF A;  1JPO A;  232L A;  4B4I A;  1L95 A;  2F8K A;  1OUD A;  1QT6 A;  3DN4 A;  3HDE A;  2K4P A;  4LGK A;  1GDW A;  4IAT A;  1OQM A;  2ANX A;  4QEQ A;  1L13 A;  3TMV A;  3GUI A;  1QUG A;  1PK1 A;  2QAR C;  1L92 A;  2H9K A;  1BHZ A;  1UIB A;  1FDL Y;  1L56 A;  2Z39 A;  3DN3 A;  1D3N A;  3WXU A;  1YL1 X;  3KKA A;  3AGI A;  1TBY A;  1JJ1 A;  3HBE X;  1IWU A;  1L47 A;  1IWV A;  3GUK A;  3A8Z A;  2OE7 X;  3C80 A;  1BGI A;  3P66 A;  4WM5 A;  4NHP A;  1ALC A;  5A3E A;  1L17 A;  3TMX A;  1SV4 A;  7LZM A;  4B4E A;  1KIQ C;  1FKV A;  4EKQ A;  2BQA A;  3VWO A;  1OVJ A;  1ZYT A;  2F30 A;  1QTV A;  1L42 A;  3FI5 A;  1LGX A;  1LJN A;  4YEM A;  1C6B A;  5B1G A;  3G3W A;  1RFP A;  1IR7 A;  1YKY X;  4EMN A;  1L90 A;  1SXD A;  240L A;  1C6G A;  3EMS A;  166L A;  1SWY A;  2BLX A;  3HU8 A;  4NGI A;  190L A;  1UCO A;  9LYZ A;  4Z98 A;  5I4W A;  212L A;  3GXK A;  5KXR A;  1B7Q A;  219L A;  248L A;  1CUQ A;  1GWD A;  1ZMY L;  1B7N A;  1GF4 A;  3A34 A;  1L86 A;  3W3E A;  3CSZ A;  4TUN A;  5APC A;  135L A;  103L A;  1GB8 A;  1L83 A;  1PQJ A;  1YAQ A;  3BS5 B;  3OE9 A;  1DPW A;  1C46 A;  2IFF Y;  4Z46 A;  1DKJ A;  1GBY A;  3CDT A;  2G4P A;  2BQH A;  3N9E A;  3HTF A;  1LJF A;  2B5Z A;  2C8O A;  1QUO A;  1L74 A;  1KNI A;  5KXZ A;  1L22 A;  1VDP A;  3EBA B;  199L A;  185L A;  246L A;  4X3B A;  214L A;  1CJ7 A;  1G07 A;  3SBB C;  6LYT A;  2DBT A;  1L82 A;  1C6A A;  4ZPU A;  4I7T A;  3DMV A;  2A7F A;  3DMZ A;  3HT7 A;  4LT0 A;  1GD6 A;  4GN4 A;  123L A;  1LJK A;  3PDS A;  1LZN A;  4LT1 A;  1LSZ A;  1LJI A;  4GCB A;  1LZB A;  1I1Z A;  4DDA A;  1L03 A;  5KXP A;  2MEF A;  149L A;  1BB3 A;  5LYM A;  3B0K A;  3G3V A;  1OUJ A;  3AYQ A;  4NSJ A;  1UIG A;  2I26 L;  1BWI A;  5B59 A;  4N8Z A;  5FEL A;  4E97 A;  3C8Q A;  4AQN A;  3A93 A;  1LYG A;  4XEN A;  2QB0 B;  5L1M A;  2RBP A;  1QSA A;  1D0M A;  243L A;  3FI7 A;  1L94 A;  1WVU A;  3AGG G;  1LMT A;  1H87 A;  1C6H A;  1L61 A;  1LKY A;  1L14 A;  2YBN A;  1L20 A;  2GV0 A;  1L02 A;  1DYE A;  3DMX A;  3ZEK A;  4OO9 A;  1L37 A;  4W57 A;  1L71 A;  3WPL A;  1ZUR A;  1XGU C;  2RAZ X;  142L A;  1LPY A;  1YKX X;  4LFX A;  3HH3 A;  1IO5 A;  1L11 A;  3P68 A;  1HHL A;  3BS7 A;  4NHT A;  1YKZ X;  207L A;  1L07 A;  1L58 A;  3D3D A;  1K28 A;  1OUF A;  3C8R A;  4PRU A;  153L A;  3P65 A;  1L72 A;  1C6Q A;  4WL7 A;  1RCM A;  3WU7 A;  1B7M A;  1HC0 A;  120L A;  5KJ9 A;  3E3D A;  162L A;  5F9U A;  4C5F A;  188L A;  4NL9 A;  1DYF A;  2MED A;  3HUK A;  2DQF C;  1EPY A;  1QUS A;  4II8 A;  3IWR A;  1KS3 A;  1F0M A;  1L24 A;  194L A;  2KE7 A;  237L A;  2DQC Y;  1GFA A;  1N4F A;  1PQI A;  4ZFP A;  1L79 A;  1VDT A;  4TWS A;  4G4C A;  1I6S A;  5LZM A;  261L A;  250L A;  1LKS A;  5B1F A;  5I14 A;  1L67 A;  1ZV5 L;  3DN0 A;  2A7D A;  3RT5 X;  3ZVQ B;  1CU5 A;  4KL7 A;  231L A;  1QIO A;  1CV5 A;  1XEP A;  3QY4 A;  1IIZ A;  1LSC A;  4OWE A;  4PJZ A;  1NQI A;  4DQJ A;  4FDY A;  3KKA C;  2B6X A;  4NHQ A;  2YTU A;  169L A;  1BB7 A;  1J1X Y;  4I7M A;  1L77 A;  4LZT A;  4G4H A;  1LSN A;  1LJ4 A;  2EQL A;  1DYB A;  2YBL A;  4I7N A;  2F2N A;  1H6M A;  4NFV A;  1JQU A;  1GB5 A;  1XEI A;  1JIT A;  1LSE A;  5HMV A;  3CDR A;  4HTK A;  155L A;  3CT0 A;  1YRO A;  2HUB A;  3ATN A;  5KY1 A;  1IOT A;  4BAP A;  4DC4 A;  244L A;  251L A;  3NY8 A;  1WTH A;  1C68 A;  5LIO A;  3A96 A;  1HF4 A;  1JJ3 A;  3N9A A;  1B2K A;  2RH1 A;  2OTY X;  1L96 A;  1GF0 A;  5II3 A;  1YQV Y;  6LYZ A;  2K60 A;  1L46 A;  1UBZ A;  1LTM A;  1GFR A;  1L87 A;  198L A;  2D8C A;  4I8S A;  1EQ4 A;  130L A;  4DT3 A;  1LSF A;  3LYM A;  1L84 A;  1LSG A;  112L A;  2YBJ A;  4RLN A;  1IOQ A;  1GEV A;  4GCD A;  2G4Q A;  4ARP A;  148L E;  4LYT A;  1YL0 X;  177L A;  1GHL A;  3FE0 A;  3RNX A;  3IDW A;  1GF6 A;  3F9L A;  5APE A;  200L A;  4DWX A;  1GXV 2;  3ODU A;  2E8M A;  1KW7 A;  1L57 A;  2OE9 X;  4WOA A;  1OUE A;  5LA8 A;  1V85 A;  4NWE A;  5C6L A;  4QGZ A;  137L A;  2F32 A;  152L A;  157L A;  2BQD A;  1LWK A;  1VDQ A;  1L26 A;  2DQA A;  2CJL A;  2QKQ A;  1L29 A;  1CUP A;  3LZ2 A;  1KW5 A;  3A6C Y;  160L A;  1C65 A;  1DI5 A;  1LCN A;  3WXT A;  1L05 A;  4DDB A;  1C61 A;  1QTD A;  221L A;  8LYZ A;  2KMD A;  3AZ7 A;  1LPI A;  133L A;  5KKI A;  1C67 A;  1HEL A;  2H5Z A;  191L A;  165L A;  2FYD A;  1DI3 A;  1GDX A;  1G1W A;  1B7O A;  1LHK A;  1RE2 A;  1T6V L;  1LLH A;  2LZ2 A;  1L64 A;  2XJW A;  1RJC B;  1VDS A;  4NGY A;  4LT2 A;  4BAD A;  2O79 A;  2ZIK A;  4ZEE A;  1L49 A;  4PGJ B;  1C6P A;  1HFX A;  4HPI A;  1UA6 Y;  1WQO A;  4B0D A;  4XJF A;  1B0X A;  3HTB A;  1C62 A;  4GCF A;  1NBY C;  3TXE A;  3G3A B;  1CKH A;  2ZYC A;  127L A;  3QAK A;  1G7I C;  4TSB A;  1LYO A;  2D4J A;  1PQD A;  4NHS A;  3AZ6 A;  3CDO A;  1FBI X;  4G4B A;  4OWC A;  4NWH A;  5JEN B;  1LMN A;  1GEZ A;  1QTC A;  1VED A;  1P64 A;  3TXD A;  3A94 A;  2MEH A;  1V38 A;  1VAT A;  4J0L A;  2O4W A;  3FAD A;  3W6B A;  2JV3 A;  1DKK A;  3G3B B;  3OE8 A;  4OOT A;  3M18 B;  1GE0 A;  4W55 A;  1DXJ A;  3WYH A;  1GF7 A;  109L A;  4EKR A;  2PC2 A;  1L28 A;  2B6Z A;  2B6Y A;  4H8Z A;  1CVK A;  1WWU A;  1L69 A;  1TLA A;  1L88 A;  5KXS A;  4PPO A;  3NYA A;  1UIH A;  2QAR B;  5LA5 A;  4FJR A;  3HU9 A;  4NL9 C;  168L A;  4NSG A;  3AZ5 A;  1DZB X;  3HWL A;  2HED A;  4ARQ A;  4H94 A;  4H9E A;  3WMK A;  1IR8 A;  1L62 A;  4UWV A;  2B7X A;  3RZ4 A;  2Q0M X;  178L A;  1UQV A;  1WQQ A;  1WQR A;  2QB1 A;  2Q9E A;  2XBS A;  1QDT A;  3HTD A;  1NBZ C;  187L A;  151L A;  2H9J A;  1C6J A;  4PJ2 C;  1GE2 A;  1QUH A;  1C08 C;  3WPJ A;  4IAP A;  1WTM A;  1LZ5 A;  3QE8 A;  5KXN A;  1P6Y A;  4OW1 A;  2Q9D A;  2HUK A;  4NGK A;  4MHV A;  2RBS A;  2FYC A;  2KIV A;  1NMM A;  1GFT A;  5LAG A;  1OUB A;  4WG7 A;  2B70 A;  1CJ6 A;  4YX7 C;  4NGJ A;  238L A;  4P2E A;  4PRQ A;  3HT6 A;  3TXI A;  1B9O A;  1P3N A;  2W1M A;  5C6J A;  3WUL A;  1L68 A;  1ZWN A;  3EML A;  1LJG A;  1L51 A;  3TAD A;  3C8S A;  1SSY A;  3HTG A;  1OUG A;  2RB2 X;  2Z2E A;  4MCK A;  2OEA X;  4ETC A;  5KKJ A;  1HML A;  1L0K A;  1OXJ A;  4W56 A;  1OUI A;  4HV1 A;  1SX7 A;  3A3Q A;  1RG6 A;  1QSB A;  5I5Q A;  2C8P A;  4C3W A;  4HJV A;  3D9A C;  1D0L A;  4WO6 A;  4YOP A;  119L A;  1C64 A;  4LZM A;  1NWG A;  1GB3 A;  3SB5 A;  4XAD A;  1REY A;  1NDG C;  2GLE A;  3OJP A;  3J6K A;  2BQI A;  1LHH A;  3AZ4 A;  1JKA A;  4WM2 A;  1HFZ A;  1L25 A;  2RBO A;  2ESE A;  5I54 A;  3FA0 A;  5JTI A;  1LHJ A;  4TX7 A;  3CT1 A;  1L59 A;  4WLT A;  3CSQ A;  1JTO L;  2F2Q A;  4O34 A;  1GFU A;  5APF A;  2DKX A;  4GLV A;  3A92 A;  3F8V A;  1IX0 A;  1C6I A;  2AUB A;  3GUN A;  1NKH A;  131L A;  1D2Y A;  4XJB A;  1CU0 A;  1PQO A;  1A2Y C;  1L12 A;  1GFH A;  4OWB A;  3ATO A;  1IEE A;  3D4S A;  4H9I A;  3SB7 A;  2HEE A;  3CDV A;  1LZT A;  4NJ8 A;  1UC0 A;  4EOF A;  2KSO A;  1L23 A;  175L A;  3DNA A;  3QNG A;  228L A;  1CKG A;  1QQY A;  1TAY A;  4GCC A;  1L81 A;  5F14 A;  1CX7 A;  1L27 A;  4BS7 A;  1L97 A;  1LYJ A;  1L39 A;  156L A;  5FCP A;  4ANR A;  3WW5 A;  174L A;  1LMO A;  3W6C A;  3WVY A;  4EJ4 A;  2B6G A;  1JSE A;  1IWX A;  1FN5 A;  2YDG A;  1G06 A;  1PQK A;  5LVH A;  1YAP A;  1F6S A;  2BPU A;  5IEL A;  3SBA A;  1PS5 A;  4RDS A;  4RQM A;  2EAM A;  2ZYP A;  2BQB A;  1LSY A;  2B72 A;  1FLW A;  3OK0 A;  3L2X A;  1C6N A;  1BVK C;  1L53 A;  1AM7 A;  4N5R A;  1T97 A;  1MEL L;  1QT3 A;  102L A;  2MEI A;  1LZC A;  4NSI A;  1KXX A;  4PZO A;  4I7R A;  4ARM A;  1FLQ A;  1CV3 A;  1JHL A;  4KT3 A;  217L A;  259L A;  2HEF A;  2HEA A;  1JUG A;  4E3U A;  1LI2 A;  4LDO A;  1TEW A;  1KY1 A;  1PZY A;  2LZM A;  4LYZ A;  252L A;  1HNL A;  1W6Z A;  2BQK A;  1HER A;  1CU6 A;  5L9J A;  4I7J A;  1AT6 A;  2MEC A;  1L04 A;  5KXO A;  1L54 A;  2HEB A;  1L52 A;  1D2W A;  5L3I A;  3W6F A;  3W6E A;  1SX2 A;  5KXT A;  147L A;  1L35 A;  4AGA A;  5FHW A;  1PK1 B;  1GBZ A;  1L45 A;  2XQO A;  3IJV A;  4EPI A;  1L40 A;  1C60 A;  3A6B Y;  1REX A;  4N1E I;  1LI6 A;  1L73 A;  114L A;  1W08 A;  4NG1 A;  173L A;  1OV7 A;  1SWZ A;  1D9W A;  1QT5 A;  4K5Y A;  2LZT A;  1XGP C;  1T3P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...