2QB0B

Structure of the 2tel crystallization module fused to t4 lysozyme with an ala-gly-pro linker.
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
241
structure length
241
Chain Sequence
SIRLPAHLRLQPIYWSRDDVAQWLKWAENEFSLRPIDSNTFEMNGKALLLLTKEDFRYRSPHSGDVLYELLQHILKQAGPNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFCQDVDAAVRGILRNAKLKPVYDSLDCVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Polymer-driven crystallization.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase regulator
molecule keywords E80-TELSAM domain
total genus 75
structure length 241
sequence length 241
chains with identical sequence D
ec nomenclature ec 3.2.1.17: Lysozyme.
pdb deposition date 2007-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00959 Phage_lysozyme Phage lysozyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2qb0B01
1.10.530.40 Mainly Alpha Orthogonal Bundle Lysozyme Lysozyme 2qb0B02
3D4SA 1LI3A 257LA 1L56A 1L60A 1NHBA 146LA 1L47A 1OWZA 1L86A 3SBBC 1C6KA 1L67A 1LWKA 2OU9A 160LA 261LA 127LA 1X40A 1SV0A 4I7SA 1L71A 223LA 2ANXA 2FE9A 1C66A 210LA 2LCBA 2HUMA 3CDRA 1L38A 2LC9A 3C82A 4RQMA 1CTWA 3ODUA 1L58A 1KNIA 1QT3A 131LA 1L74A 262LA 241LA 3IDWA 1C68A 1D3JA 1X66A 152LA 155LA 1C6IA 4I7MA 147LA 4I7TA 1PK1B 1L0JA 178LA 1C65A 1L45A 1L72A 1QUOA 3GUOA 1L0KA 1QTCA 4EKPA 2B6WA 1L04A 1SWYA 4YX7C 1L94A 1C63A 4W58A 3K2RA 1SXEA 192LA 4ARMA 1L88A 260LA 1G0PA 1L90A 141LA 1L29A 1CU5A 1C69A 2Y9UA 1L23A 1L07A 1G0MA 4PK0A 3BS5B 3GUIA 1QTZA 1LGXA 3SENA 1T8AA 3RZEA 120LA 3HT7A 1DYAA 1L11A 4NL9C 1LGWA 4LDEA 2DKZA 4IAPA 1L76A 3BQ7A 4W54A 4DKLA 1UCVA 1L31A 1LYDA 1P2LA 3DN1A 1C6LA 1L80A 1L55A 212LA 4EKRA 4W53A 258LA 4EJ4A 1T97A 3SB5A 2DKXA 211LA 4LDLA 143LA 1SV4A 1DYCA 1QT8A 172LA 1L21A 256LA 156LA 3KKAA 1L50A 1I6SA 1L84A 2L78A 1L01A 1L14A 1L79A 1ZWNA 1L81A 1L73A 157LA 173LA 3BS7A 186LA 1L09A 2RBSA 1L46A 3PDSA 2JV3A 1LGUA 1KW7A 255LA 6LZMA 1P3NA 177LA 1L25A 4DAJA 3L2XA 119LA 251LA 1L12A 2IGCA 1OWYA 3LZMA 2O79A 1PQMA 3OE9A 3HDFA 176LA 1CV1A 2RBPA 189LA 1C6AA 1CV4A 1L33A 1OVHA 1L64A 2OTYX 3C8QA 145LA 233LA 2RB2X 3C7WA 3G3WA 129LA 1C6MA 138LA 1DYDA 1PQDA 1Z1VA 2QARC 3DKEX 3GUPA 1L42A 3V2WA 3DMZA 1L93A 1C6GA 2QB0B 1CU3A 3F8VA 240LA 2OEAX 3C8RA 1C6PA 4W55A 1L19A 1G0LA 1LKYA 1QUDA 225LA 4EPFA 1DXSA 1OXJA 2QARB 1QTHA 174LA 170LA 1L39A 3K1RB 227LA 1P5CA 151LA 2OE9X 1P46A 1K28A 2GLEA 2B6GA 2EAPA 253LA 198LA 1L35A 3HUAA 2LPEA 108LA 4W52A 1L62A 213LA 3SEIA 3HH3A 4I7JA 5J8YA 3C83A 3F9LA 3TACB 1KS3A 1CV6A 3DN8A 1L27A 2RH1A 1KY1A 3DN4A 224LA 4LZMA 165LA 1L03A 1C6JA 148LE 2B6YA 3HTDA 196LA 2E8MA 2B73A 1JQUA 3FI5A 4ARMB 1CV5A 3HTBA 3HUQA 1G0QA 2RBNA 3TADC 4NJ8A 1C64A 3HH6A 5L1MA 1L98A 1G0JA 1L68A 1L34A 2QKQA 1T8FA 229LA 3DNAA 1LI2A 239LA 1P64A 1D3FA 150LA 1CUQA 1LWGA 2F47A 109LA 1L70A 1D2WA 1L00A 214LA 2KSOA 3C80A 249LA 1CU0A 1L22A 125LA 1QT7A 5KNIA 4I7RA 3RUNA 1PK3A 1CVKA 112LA 1LLHA 216LA 2O7AA 2K60A 1QUHA 1UQVA 1JI7A 1TLAA 2F32A 3NYAA 3FADA 1T8GA 2F8KA 1L91A 4ARLA 1B6IA 1QT4A 2E8OA 1L95A 2OE4X 2Z6BA 1G0KA 3OE8A 244LA 107LA 4S0WA 1L59A 1LYEA 181LA 4PZOA 1L89A 250LA 219LA 1V85A 4YXAC 115LA 1L10A 2HUKA 111LA 114LA 2F2QA 142LA 209LA 3TADA 184LA 1L26A 1L43A 3HU9A 4I7LA 144LA 3HWLA 1SX7A 104LA 1LYFA 1L08A 248LA 247LA 205LA 2F3NA 2ES6A 1WWVA 1P37A 1L16A 3HT6A 1QUGA 3PBLA 2YTUA 2QB1A 1C6CA 2K4PA 1RG6A 1G0GA 4LDOA 2B6TA 4I7QA 3DMXA 259LA 3FA0A 180LA 2B72A 3GUNA 2NTGA 2KG5A 1ZURA 2RBQA 1OV5A 4I7OA 1DYEA 1L15A 4NL9A 4EPIA 3G3VA 1L49A 5F3XB 162LA 149LA 1D3NA 197LA 220LA 166LA 4ARQA 3C8SA 1X9XA 188LA 245LA 1L99A 1WWUA 1L20A 1C6BA 1G1VA 3DN0A 110LA 1QS5A 3OE0A 2RB1X 4ARJA 1V38A 200LA 1L57A 3CDOA 3GUJA 4W59A 1L32A 2A4TA 1C6QA 1L85A 2B70A 3HH4A 122LA 2LMRA 1LW9A 5JU5A 1L51A 1SSWA 1WTHA 2Q9DA 3HT9A 1P6YA 137LA 1CX7A 243LA 2KE7A 1L18A 1L92A 4PZNA 1LYIA 3GULA 1LYJA 1L69A 1DYFA 161LA 4ARQB 1PQOA 4PJZA 1L53A 169LA 4IS7A 1LYHA 123LA 3DN3A 3H8MA 4AQNA 4EKQA 1PK1A 5J8YC 191LA 2RB0X 238LA 4YXCA 1L61A 139LA 1SSYA 130LA 3HUKA 234LA 1L75A 2B7XA 1P56A 4ARPA 2OE7X 1L02A 1OYUA 1SV0C 1L52A 2NTHA 164LA 4RQNA 3L64A 1D9WA 1PQIA 1QSBA 190LA 2ESEA 3EMLA 1XJUA 102LA 1G1WA 1L96A 168LA 4GRVA 1CX6A 3NY9A 1T6HA 3CDTA 1QT5A 3C81A 246LA 182LA 1ZYTA 2HULA 5I14A 231LA 1C67A 1OVKA 4W51A 1L87A 254LA 1LPYA 3HH5A 4W56A 3GUKA 232LA 3KKAC 195LA 1L41A 1L24A 1SX2A 1DYBA 2D3DA 3CDQA 4W57A 1L05A 3HTGA 242LA 2RBOA 199LA 1QTBA 2B74A 1F0MA 187LA 1G06A 1L30A 1C6NA 1L77A 1L82A 1LI6A 113LA 2B6ZA 1G07A 222LA 235LA 3DN6A 1D2YA 1SWZA 4I7NA 3V2YA 4EKSA 1L65A 1CV0A 163LA 1XJTA 1QS9A 3DN2A 2KIVA 3BS5A 237LA 103LA 158LA 221LA 1L83A 1L40A 1LYGA 4DJHA 1L54A 1CU2A 2O4WA 1B0XA 2QARA 183LA 1XEPA 3SBAA 1C6FA 118LA 1C62A 2E8PA 4EXMA 3DMVA 1L37A 1QSQA 171LA 1P36A 1PQJA 2OU0X 2RAZX 3SN6R 1OW5A 2EAOA 236LA 3G3XA 218LA 2KMDA 2EAMA 3UONA 1P7SA 3HTFA 2D8CA 206LA 1L28A 1LKYB 2EANA 3HDEA 3NY8A 4I7KA 1KW4A 175LA 1C6TA 1L06A 1CU6A 4OO9A 140LA 1P2RA 252LA 2OTZX 1COKA 226LA 4ZPUA 4E97A 2L5YA 3SB9A 2OU8A 1KY0A 217LA 4I7PA 4MHVA 1QTVA 3SB6A 3C7YA 4K5YA 1EPYA 1L63A 1L36A 1OV7A 2RAYX 1QTDA 2Q9EA 1L48A 228LA 2CUUA 1C6DA 1JTNA 230LA 2E8NA 1QT6A 2Y9TA 2DL0A 5JTIA 1C6EA 3HU8A 1D3MA 215LA 2LZMA 2RBRA 3SB7A 2B75A 5LZMA 1CUPA 1L13A 1PQKA 201LA 2F44A 1KW5A 1SGGA 3VW7A 1CV3A 3GUMA 159LA 1C6HA 3HT8A 2ANVA 3SB8A 4GBRB 2QB0A 167LA 1C61A 1SXDA 3C7ZA 3CDVA 2KSOB 1L66A 3JR6A 1B4FA 1L17A 3HILA 3OE6A 128LA 1L44A 185LA 1DYGA 126LA 1L97A 1C60A 3QAKA 1OVJA 1JTMA 2B6XA 5JRTA 7LZMA
chains in the Genus database with same CATH superfamily
257LA 1NJXA 1L56A 1L60A 6LYTA 2ZJ8A 2PI5A 1C6KA 1YZ7A 160LA 4ZFPA 3CRXA 1X40A 2ZTEA 1CKDA 4RQ7A 1L71A 2HBJA 4QZAA 4RNNA 3RT5X 5ALPA 5FDJA 2LCBA 3C2KA 1ZJMA 2W9MA 2ZIUB 1F6SA 4R0FA 2KFNA 1C45A 2FJ6A 4OO1J 1D9FA 4N1CC 3IM1A 1X66A 1Z55A 2KTQA 1UIAA 1K5OA 2OWOA 3MDAA 155LA 1C6IA 2IFFY 4I7MA 147LA 4GC7A 1KDHA 1QUOA 3BZCA 3WXUA 1QQYA 5I53A 2BQDA 1ZETA 4OD0A 4C5FA 1L04A 5AKJA 5AMYA 2NRWA 1C63A 4H8YA 3K2RA 2IOHA 4R6CA 3CSQA 2C22A 1KEJA 1HERA 260LA 4MF8A 2BQKA 3QUBA 1L90A 2EQYA 4WM2A 2Y9UA 1L23A 1L07A 4OJLA 4AXTA 2XVTA 1LHIA 4NGWA 2C28A 3WK9A 2BCRA 3S6JA 4DOBA 3SENA 4HSFA 4CF4A 3EBAB 2VANA 5HQ1A 1YAQA 1L11A 2XGQA 4PGQA 2HOIA 4DSKA 4GFJA 1CJ9A 3HBHA 1TEWA 1SZHA 4W54A 4N8ZA 1LPIA 1UCVA 4Z6FA 1L31A 4OWBA 4BUGA 1JUDA 2XO7A 1JKBA 1YKXX 4WM3A 4YEOA 2UVVA 4EKRA 1LJJA 1S0MA 4O0IA 3IG8A 3UMBA 258LA 2HHUA 2EH9A 5B1FA 4NWHA 3TXKA 5IIMA 4LDLA 1DI4A 1SV4A 3UQ2A 1OUAA 156LA 7ICGA 1VEDA 4K4HA 4OWCA 5IIIA 5KFOA 3EZ5A 3SD7A 1L01A 5HHHA 3PR4A 3ZD9A 2Y8PA 4B4EA 1LYZA 4OJ5A 2RBSA 3RJIA 4DFDA 1LCNA 1L46A 4QIWC 1N60A 4EX6A 1LGUA 3QX7A 1B5YA 1KW7A 5C0YA 5LAFA 4NWIA 4KLTA 1VDVA 8ICXA 1L25A 4F50A 2BPGA 1L12A 251LA 5AKIA 1CEZA 4HJYA 2O79A 8ICLA 2HEDA 4JV2A 1DKJA 4WL6A 1L33A 3F5EA 1IC4Y 4J03A 3MGIA 1L64A 3ATOA 4NSGA 3WXTA 1X9SA 4LGKA 145LA 1D0KA 3PR5B 2RB2X 4ED3A 4X3BA 1IWVA 5L1IA 138LA 2BLYA 1DYDA 2NV3A 4QZEA 2LYZA 4GCFA 4I0CA 3DMZA 1B9OA 2QB0B 1CU3A 3FDSA 5E79U 4PH5A 3C8RA 1N56A 1GAYA 3RBDA 1JHLA 1DXSA 4R8UB 1EL1A 2HDOA 2QARB 2BQMA 5KG0A 1REZA 2E3TA 1KFDA 4LZDA 5AHXA 5J0QA 2OE9X 1T4GA 4F8RA 4KMUA 1K28A 3A6BY 2B6GA 2XCAA 4DFMA 1GF0A 3H4DA 3QU5A 5B05A 3H40A 2Z7JA 4I2AA 1NKHA 1YAOA 1I56A 198LA 2K4IA 2GO7A 2JEGA 3AZ7A 2W11A 5KFHA 1L7OA 4XENA 5KG3A 3RRGA 8ICTA 1CKHA 5B59A 1L62A 213LA 3HH3A 4TUSA 2C2RA 1L7MA 1IR9A 5A0LA 5AI8A 1OUJA 2YBHA 1CV6A 2RH1A 4DFPA 4DQRA 4C3WA 2MUTA 4F5NA 4ECRA 3T3FA 3TXFA 4UW9A 2HOQA 5D49A 5K4LA 1F10A 3FI5A 2YVBA 4NG8A 7ICFA 1REYA 3W6BA 2G5HB 1N4FA 9ICNA 1BGIA 3TI0A 2EPEA 2DF4B 1IP5A 4CDGA 4PPOA 2QKQA 1IR7A 5LA5A 4FZNA 3M9NB 239LA 2D4JA 2DQGY 150LA 1LZ8A 4QGZA 3TQ1A 1V7SA 3ICXA 3WK4A 1L00A 2ZIJA 3C80A 2MEEA 3KHLA 1CU0A 1CJ6A 1O03A 1L22A 3OGUA 4R63A 3OHAA 1BVXA 4YXJA 1CVKA 1KXWA 5KFTA 4H92A 1NKCA 1RZTA 1NK0A 2K4EA 5KFBA 4Z98A 4ED6A 1UQVA 1TLAA 2HU3A 7ICJA 1BB6A 3LYOA 3MFIA 3N9AA 1S0NA 2F8KA 4ARLA 3SQIA 1IOSA 2AQ0A 2D4IA 2Z6BA 3WKCA 1G0KA 2YBLA 3WK5A 1BNOA 4C4RA 1L59A 2KKPA 3D6JA 5KFUA 1L89A 1ZQBA 4DS5A 4HAIA 219LA 1QDTA 4OWEA 5DBBA 4YXAC 1L10A 3IP4B 4DD3A 4KLIA 4DSEA 4F2SA 111LA 3OK0A 1L7NA 2PFNA 1LJNA 4EYHB 1B7OA 2AH5A 4DS4A 5C5JA 184LA 3Q8MA 1ZQFA 2NRXA 4TTDA 5F9NA 3SZ2A 3HWLA 2XC9A 1X6JA 4RQ5A 5KL1B 1JN3A 2BCVA 247LA 3DV9A 2HHQA 2LZTA 4QZCA 4OW1A 3ZVQB 3QU4A 4P0QB 1VFBC 5HR7A 2OHFA 1WWVA 2ASLA 1BPXA 2HW3A 4J0LA 3FM9A 1C6CA 5AK6A 1CJ7A 1RG6A 5F9UA 3RRHA 2IMWP 5KXWA 3A67Y 1GB2A 2B6TA 4NHTA 1RM6C 5KFXA 4IR9A 1CJ8A 3FA0A 4M6WA 1MQ2A 2G0AA 1LHMA 2VA8A 2J6TA 1ZURA 2RBQA 3RR8A 5HMMA 4IRKA 2HBKA 5LVHA 5GTIU 4NL9A 1XGTC 2G4NA 5L3IA 2ISPA 3J6KA 3PO4A 1LZAA 5EE1A 4Q8FA 1BPZA 197LA 5TISU 3MGWA 3AQEA 1X9XA 3PW5A 1YL0X 4ARQA 9ICIA 4DOAA 4RUCA 4ECYA 1L99A 1FFUA 8ICIA 1KFSA 1L20A 1JISA 4CCHA 1JALA 3A94A 5EBHA 4F4WA 1ZYQA 1RYUA 1PVRA 5ALSA 3OE0A 1C10A 2RB1X 4B9TA 4ARJA 5KXMA 1V38A 1JKDA 3CDOA 2AGOA 1LSAA 3HFMY 1SIJA 1LMQA 1QQ5A 2H3ZA 5LINA 1D6PA 2A4TA 1C6QA 2A1JA 1Z4OA 122LA 2LMRA 1LW9A 5JU5A 137LA 5KJ9A 2KE7A 3WUAA 4EBEA 1TDYA 3W6CA 4DD0A 1OUEA 1PVQA 2W54A 2KJ8A 4CF3A 2KK0A 1GEZA 3PSTA 4HTKA 1LHJA 2LYHA 4IRCA 4J9QA 169LA 123LA 1NDMC 3DN3A 5J8YC 1B7QA 1JTTL 2WF7A 4YXCA 1SSYA 2OYYA 1GF6A 4EYIB 234LA 4YMMA 4UAWA 4XA5A 4F72A 1IP7A 1L75A 2H3QA 4ARPA 1UA6Y 3TXBA 2FPKA 3RU5A 1L52A 4ET8A 2ZIKA 2ZIUA 4NSJA 2NRVA 3L64A 2YMMA 5DQGA 3GIIA 2LZ2A 1QSBA 3ISBA 3ZDBA 2ESEA 1IX0A 5KXNA 4L41A 2DQDY 2FLNA 2YBNA 3UXOA 168LA 5AK5A 4DQPA 4GRVA 3K1ZA 1T6HA 1IR8A 2A1AA 1ZQDA 2F8LA 1S0OA 1XU4A 4ACOA 1ZQ1C 1C67A 3CW2C 4KN7A 1FKVA 1L87A 1XEIA 1LPYA 1HELA 3ORYA 5J0WA 4H91A 1U4BA 7ICTA 2W04A 3WU8A 2Q0MX 4F71A 199LA 3C1YA 3WUMA 2Z2EA 7ICVA 5KFMA 1C6NA 4LT2A 1L77A 2AQ4A 5L1KA 4YP3A 3QEAZ 2GH1A 1L82A 3T5KA 2G4PA 5APFA 3VCBA 1TVAA 1HEPA 5DGBA 1T8EA 4H8XA 4FE3A 222LA 235LA 3DN6A 3V2YA 2CXYA 5FCPA 163LA 5KXYA 1QS9A 3QNMA 9ICUA 103LA 4FFDA 4J9RA 2D6FC 1ZD2P 2LM1A 3EO5A 1LJ4A 3B0OA 4HP0A 4H9HA 8ICFA 2F76X 3AB6A 5F81A 3MR2A 118LA 1C62A 2R8GA 2HOFA 2E8PA 2YBMA 9ICLA 3DMVA 171LA 1LMOA 3ZD8A 4LJXA 2OU0X 3IG5A 3L5KA 1L3SA 2HECA 2YSSC 4WL7A 1DI3A 4HTNA 1WQMA 1AT5A 2HBLA 1GF3A 4Q43A 3SN6R 2Z19A 5CRXA 9ICXA 4HJVA 3A96A 1ZQCA 2CGIA 8ICMA 4C80A 1GE3A 2XBRA 2ZIVA 3B72A 3LVWA 3SR6A 1Z3EB 4J9NA 5HHIA 1L28A 3HDEA 2KD1A 3IV6A 8ICJA 1XFPL 1KW4A 3NY8A 4IQVA 5ALNA 2KZ3A 4OO9A 140LA 252LA 5AM2A 1A2YC 2OTZX 3RW8A 2UVUA 226LA 1K1SA 3ZDAA 2BQIA 5KTQA 217LA 1YL1X 1PZNA 1F5SA 1L6NA 5ALUA 1IWUA 132LA 4Y2UA 5DKWA 4O5CA 2H3FA 1SWWA 2NO5A 1ZQLA 228LA 1GFAA 1G7MC 3AW6A 2E8NA 4QZ9A 3B9JA 2OEHA 1HC0A 5JTIA 4QZIA 2MEIA 1C7PA 3HU8A 5DN4A 4UATA 3H8SA 1DK3A 215LA 2LZMA 1NF5A 3SB7A 1DGSA 2B75A 1SKWA 5LZMA 1HENA 201LA 5KFAA 2J6UA 1JTOL 3N7PD 1KW5A 4NHIA 4WLDA 4B9MA 2MU2A 2BAAA 4ZIXA 4PL1A 3F53A 2BQUA 1QTMA 1C6HA 4CNQA 5KFFA 1UACY 2ANVA 5DL9A 1N63A 5T3FA 2KSOB 1KN5A 1J2MA 2H5ZA 4IQWA 1QUSA 1X9WA 1ZD5A 2MEDA 3OSNA 1A4VA 4LYTA 4PHIA 1YQVY 1LSBA 1GDXA 4KXIA 126LA 5KT3A 1X9MA 2C8PA 1JTMA 5J2GA 3AZ6A 3KD3A 2HEFA 4NLGA 4DSFA 1TKDA 1QUTA 5C6JA 3B6LA 2WARA 1OWZA 2ZTDA 5F16A 3I1YA 4PHEA 1I20A 1WYGA 2AJQA 5A3ZA 3KHHA 1L67A 2I9GA 3CB7A 4M47A 1W08A 5J2HA 2ZYCA 2DPIA 3WPKA 1IEEA 3RH5A 4FZLA 1LSPA 3NVYA 1L38A 3C82A 4DT3A 1ECWA 1A76A 4RQMA 2KFZA 3ODUA 1HFXA 6LYZA 1KNIA 1QT3A 1LSEA 4PHAA 1L74A 3BQ2A 1IP1A 1XNSA 4DC4A 4Y2TA 4DQQA 3RZ4A 2ASDA 1JJ1A 4MF2A 1ZQSA 1IO5A 4YENA 5AKZA 3M3UA 3A91A 1L0JA 178LA 3HT3A 1L72A 1YAPA 3GUOA 1L0KA 4EKPA 4F4ZA 2BQFA 4YX7C 1IXRA 1SQ2L 5J0XA 8ICPA 1L94A 3AMZA 5BOMA 192LA 1L88A 1ZQQA 4G4CA 4C8OA 1BGXT 4UQGA 1G0PA 1KIQC 1C69A 4X5VA 5L9JA 4XJGA 4PK0A 3KAMA 3MABA 2KVSA 3H0MB 5KG7A 2DKVA 3TXJA 1CRXA 3KOOA 3EW9A 4M9NA 4DEZA 5ALVA 4ECXA 5DLFA 1ZMYL 3WPJA 4NWEA 1S5LU 120LA 1DYAA 3HJEA 4E0DA 2KHQA 1LGWA 4LDEA 3W6DA 2DKZA 2X0AA 5J7CA 1KKXA 1L76A 3G6YA 1IIPA 1HMKA 1GXXA 2WF9A 4EBCA 2KICA 5AK3A 3GIJA 5HMLA 1L80A 212LA 8ICNA 153LA 4FO6A 4MEXA 4KLGA 3N9CA 1T97A 5DB6A 1WQNA 211LA 4DL4A 143LA 1LZ1A 1QT8A 5KXLA 172LA 5AICA 2RQ5A 1SWVA 2L78A 1L14A 1L79A 2FBBA 1ZWNA 4Z41A 1L81A 1L73A 157LA 1Z00A 8ICQA 186LA 1L09A 1IWZA 1OUBA 5JENB 3SAHA 1ZQNA 2JV3A 4BXOB 3TKAA 4H93A 5B07A 255LA 3UMGA 2WAQC 3JPPA 1P3NA 177LA 1XSNA 1VDSA 2WF6A 4J9OA 1AT6A 1XEJA 4RU9A 1U48A 4O5KA 1GWDA 1C6AA 2Q4TA 3SI8A 4PJ2C 1LJGA 4RQ8A 4TUPA 5AKEA 4G3IA 5ILCA 1V7TA 1SL0A 2G5IB 1F0WA 2A7FA 5J2CA 3QU2A 3LK9A 3LYSA 1RYSA 3C7WA 4UB8U 4U6PA 1SZPA 2WB1C 1C6MA 2HEEA 1Q46A 4G9BA 4BWJA 4IRDA 1DRGA 2ZUDA 3DKEX 3QU7A 1IP2A 4B9VA 1L93A 3T5HA 1NHEA 2QLTA 1LSMA 1LOZA 1NWGA 3UQ0A 3F8VA 4DQIA 5KXTA 2Q0ZX 4I2DA 3PV8A 2H3VA 3WKDA 4KTQA 1L39A 4DFJA 2W03A 1NQIA 4DLEA 1P46A 5J2BA 3N97B 4PGYA 2KEYA 1LMAA 5BOLA 3T6UA 1ZD4A 1AROP 2EAPA 1XGPC 5E9RA 2MA1A 3RAQA 3TXEA 1V9PA 2ZG6A 4NM1A 1L35A 2ZNWY 1TAMA 4W52A 4O3SA 1LSCA 2CWIA 5J2IA 4R65A 3TACB 3WK6A 4P4MA 4YD1A 1FLUA 1SL1A 3B0KA 1JMSA 1L27A 1LZNA 1NOMA 5KFRA 4O9MA 1WVUA 1X2IA 3O0FA 3LHMA 4TWSA 4LZMA 3V72A 9ICWA 1LZBA 148LE 4J9KA 3MC1A 2I26L 3J81j 1TK0A 4UWUA 1GBXA 1XGRC 4WM1A 1D8YA 4YG2A 1JKAA 3HUQA 4GLAA 1G0QA 5KG5A 3TADC 3WK8A 4I29A 3OJUA 2BPUA 1ZQHA 5KFGA 1L68A 3F2BA 3NVVA 1N62A 5KY1A 3MR5A 5B06A 1LI2A 1A0PA 3RJGA 1JTPL 3NRZA 1LWGA 2F47A 3SYZA 109LA 4LFXA 5J0OA 2KNJA 1U47A 214LA 3E3DA 249LA 3C23A 1QT7A 5KXXA 5KXKA 4RPYA 5ALWA 3RUNA 5L9XA 112LA 3N7SC 216LA 5KG4A 2O7AA 5APEA 1HUOA 3D9AC 2K60A 5T14A 2HBMA 3QYPA 5CEHA 2W55A 1BB4A 1QUHA 3NVWA 2H3IA 1J1OY 4HPIA 4WO6A 1JI7A 1KRPA 1GE0A 1QT4A 2OH2A 4NGVA 4H9EA 3IRUA 7ICKA 1BVSA 1L95A 2OE4X 1QQ6A 1B43A 244LA 4ECUA 4M04A 5ALEA 3PMNA 1V85A 2HUKA 5ALKA 3SP3A 1QCKA 2J6SA 2P6RA 1JJ0A 4DQJA 2K89A 2ZYPA 2IOFA 1B5WA 1GFGA 209LA 2JZBB 3TADA 1L26A 4I2JA 4ELVA 1L43A 5DG9A 4KLSA 5EE0A 4PHDA 2JRZA 1T6VL 1SX7A 2W9BB 3PX0A 4KMOB 1LJIA 1LSYA 4YR3A 3BJYA 1L08A 4N0JA 3QUCA 4XJIA 2BCUA 4RQ1A 3ALRA 4BX9C 205LA 2F3NA 5HNCA 1ZQTA 4WG1A 1S77D 1H6MA 4US9A 1HEKA 1TK5A 1REXA 4O5EA 1QUGA 1UICA 3FE0A 4FBTA 3PSIA 4LDOA 2YMQA 2KKVA 1COOA 4ICAA 1QSSA 2ASJA 2KZMA 3LVVA 2B72A 2XY5A 5EOZA 4M6DA 2RLTA 2KG5A 1ZVHL 3ZI4A 1ZQYA 5KFWA 1HSXA 1GPQC 1AKIA 1SLYA 3PW2A 3TAQA 2VA3A 1L15A 3MGHA 4I28A 2R8IA 1RXVA 2Z12A 3H4BA 5KFPA 5F3XB 4XUSA 1AM7A 2O6KA 1D3NA 4ECTA 2XI9A 220LA 4II8A 166LA 3C8SA 3MR3A 188LA 1RCMA 3AZ5A 1JPOA 3P66A 2W8KA 5KFEA 1IOCA 2NRTA 3AW7A 3HBDA 1KLNA 3DN0A 2ZIWB 4DFKA 5EWGA 2ZQ4A 4YM8A 4LYBA 1BWHA 3WUNA 1RPLA 1L57A 2KV2A 8ICRA 2Z39A 5LVJA 2BQJA 4LT3A 2FMSA 2K4HA 5KT2A 1XEKA 3TMVA 5AM0A 1SSWA 1L51A 2MSNA 1P6YA 5H2FU 1NK6A 1LMNA 1CX7A 2RSCA 5KXPA 1LMCA 9LYZA 2MEAA 3G3AB 9ICGA 3M18B 4P0QA 1GF7A 3EUB2 3ZVQA 1TFRA 3FI7A 1ZOLA 9ICBA 8ICGA 4O34A 1S10A 1LYJA 2LKYA 3PW4A 1HJPA 4TQRA 3A34A 1PQOA 4PJZA 4UB2A 4IS7A 3UMCA 4OOTA 3PW7A 3H8MA 2WFAA 4AQNA 5KFJA 4EKQA 5KG2A 2ZTCA 1WQRA 2RB0X 4MFFA 8ICAA 139LA 3HUKA 5B5EU 1GFJA 3PY8A 2I25L 2FLPA 4O3OA 2BQCA 4GCBA 2OE7X 1L02A 1SV0C 2W1YA 4RQNA 3LYMA 1D9WA 1PQIA 2KOBA 4YFKA 1DXJA 3B0YA 4BWMA 7ICUA 4BXOA 1BB7A 3EMLA 1ZQKA 3HKZF 2ZQ3A 1LZ4A 1LZDA 5LYTA 1CX6A 3NY9A 2WF5A 4RT2A 3TMUA 3G6VA 1GHLA 4TURA 1IP4A 1HEOA 4W51A 1RXWA 1GB6A 4KLDA 232LA 3KKAC 5D4BA 2HI0A 2YMLA 1L41A 2IBKA 1SX2A 1JROA 3ZDCA 4W57A 1L05A 3HTGA 242LA 2RBOA 3UM9A 4UWNA 2AXTU 2HHSA 1F6RA 4J7VA 4WLYA 2HEBA 1G06A 3OSPA 3SV3A 2F4GA 5DN5A 3TFSA 9ICMA 5FSTA 1XWLA 4YD2A 4KLMA 1G07A 2ZIWA 3UXPA 4I7NA 2MEGA 1Z4NA 4UB6U 1CV0A 1I1ZA 3NASA 1YIKA 133LA 4C7ZA 1IY3A 4NGLA 3ULRA 1FLWA 5AM3A 4H8ZA 4I2GA 193LA 8LYZA 1WG8A 2NYVA 2VIXA 4XJHA 4ECSA 3CNHA 2BCQA 4FS2A 1N48A 4LYZA 1UIGA 4M0AA 2O4WA 1B0XA 2QARA 3PSFA 3KHGA 7ICSA 1C43A 1G7IC 1XEPA 3QE9Y 4P2HA 4WG7A 4A8EA 4ED7A 1IP3A 1C6FA 4EXMA 4WOAA 1L37A 1QSQA 1P36A 3C1ZA 3TXDA 1BWIA 1VDPA 1FO4A 3GV7B 3ISDA 2FBDA 4LFPA 4EX7A 1OW5A 1H87A 3F2CA 3KFUF 218LA 1EXNA 2KMDA 3H8JA 4YR0A 1HSWA 3UONA 1ZQOA 1S8OA 4R8UA 3IWRA 3Q8RB 4LZGA 2F1IA 4I7KA 1L06A 9ICPA 1NJYA 4QWCA 4XYYA 3D2NA 2N1RA 1SKRA 1ZQGA 2BQOA 4DSLA 5CWRA 2JZBA 4KLJA 2DGZA 1KY0A 3NRWA 4CGEA 4DWXA 4I7PA 4MHVA 3E58A 3GDXA 2CJLA 3OPXA 3AUOA 2DQHY 1LZ6A 4MSTA 5ILFA 3BQ0A 1LZSA 2JEJA 1YT3A 2CDSA 1GF8A 2RAYX 3CQLA 2DQEY 2K8CB 1L48A 3WKBA 2W3SA 1JTNA 230LA 8ICUA 3CT0A 4NV0A 1VATA 1GB7A 2K8AA 1T94A 1YANA 4XQ8A 1D3MA 1JJ3A 2RBRA 1ZQWA 4OOOA 1PQKA 1L8OA 4G49A 2HVIA 2E5SA 4DD7A 1GFKA 2ATLA 3VW7A 5KXZA 1UUZC 4DWIA 1LYOA 3HT8A 1J1PY 4B4IA 3TANA 2CN1A 3TMXA 4GBRB 3IN5A 1SXDA 3CDVA 5ALXA 3JR6A 3LWLA 5I4XA 3UXNA 1B4FA 2HTXA 3W6EA 2R8JA 1C46A 1L17A 4US8A 4GXJA 128LA 4WO9A 3JPSA 3A6CY 1GBOA 3WU2U 2KIWA 4DL5A 7ICIA 185LA 1WUDA 3RB0A 3T5LA 1QSYA 4M9LA 1JXLA 3QAKA 2ZNXY 2HHXA 4RQ6A 3GIMA 3RAXA 2FLLA 3D4SA 4RPZA 146LA 3ONNA 5DDYA 1D8BA 5I4WA 4GIBA 3SBBC 1WCNA 1LWKA 1B7NA 2OU9A 2EZXA 261LA 4GLXA 4DOCA 4TQSA 9ICKA 1GF5A 5DLAA 5KAFU 4F4XA 2D6BA 2K8BB 4I7SA 1MN8A 223LA 2N5ZA 2FE9A 1NKBA 1DGJA 1C66A 210LA 4XRHA 1HNLA 2HUMA 3CDRA 4LZTA 2I6XA 2CRXA 1LJHA 4UAUA 1CTWA 1REMA 2ZIVB 1GBYA 1LZCA 3F5AA 4M9GA 1GB0A 3HX0A 2FYCA 5DB9A 1GFEA 262LA 2XJWA 4B0DA 1UA1A 4EEYA 3AU2A 3B0IA 1D3JA 2PKEA 7ICQA 2NRZA 1QSWA 152LA 1VJ5A 1L5UA 4I7TA 1PK1B 2DWQA 9ICQA 1L45A 4PRUA 3GU3A 2W7PA 4WMGA 4ANRA 1IVMA 1QTCA 4KX3A 2HHTA 3D2SA 1HMLA 3A0HU 1SWYA 3H7IA 1KBUA 1ZQXA 3QU9A 5LVIA 5IIKA 4JV1A 8ICKA 2Z38A 5KT5A 1UHUA 4KN4A 1JKCA 3WH1A 3K3TA 4ARMA 5IDDA 1HF4A 5ALFA 1LZYA 9ICOA 1DPWA 1LJFA 4HV2A 2EQLA 3QXGA 3GUIA 5AI6A 1LGXA 1CKGA 2Y0SC 3BKHA 4ED8A 1LSNA 3RZEA 4ETCA 1KXXA 194LA 4YOPA 1WQOA 2DQIY 1TAQA 4C4SA 3BQ7A 3M7DA 4NGJA 1LYDA 3DN1A 1P2LA 3HPOA 2W9BA 4J9PA 1GAZA 4DL6A 1L55A 3RJEA 3QE8A 1NBYC 4W53A 3RF9A 1ZQMA 2M0NA 1OP9B 2DKXA 2YB1A 4IJ4A 1CI4A 1VDTA 3AYQA 1JEFA 3L4PA 1DYCA 5ALMA 3G6XA 1QSLA 1UC0A 1L21A 2EZYA 2G4QA 1T3PA 3WK7A 2MECA 5AM1A 2ZXIA 2HHVA 3ETLA 1GFVA 1I6SA 4LYOA 4UB3A 3T79A 2M9NA 3MFHA 2EKSC 3BKVA 5EE9A 4DDBA 173LA 3BS7A 4QWBA 4GCCA 5D5CA 5ALDA 1VDQA 4UAVA 4DD1A 3M9MB 1QSAA 1DPXA 6LZMA 3NGDA 2Y1JA 1GFRA 5AI4A 1RE2A 4DAJA 1IWWA 1XGUC 3LZMA 2W8LA 1NJZA 1OWYA 1QTEA 3OE9A 2ZJAA 3HDFA 2P6UA 1LMTA 1GBWA 189LA 1CV4A 5B1GA 2V9WA 4NIJA 4EMNA 4KL7A 3V6KA 2H9JA 4YCXA 3TFRA 3IHQB 2PMZF 4H90A 1QTKA 2NO4A 1IM4A 4CJ2A 1L8LA 2HVHA 4HV1A 5KT4A 134LA 1E8LA 2YN4A 1GBSA 240LA 4AGAA 5M1YA 2DUYA 1TAYA 1LKYA 4Z6EA 8ICOA 1JUGA 1QUDA 5I4YA 2KVCA 7ICPA 3IJUA 4I2FA 4GCEA 1OXJA 1B5XA 174LA 151LA 4E3UA 4GXIA 1N61A 4IQUA 1UIFA 2GLEA 1N5WA 2RP5A 1LB2B 2JEIA 2DQAA 1OUIA 5LYZA 4RPXA 2LYMA 4ED2A 2HU1A 3N9EA 1AQ6A 2XICA 3HUAA 2LPEA 108LA 2ZUCA 3C5GA 5KT7A 9ICRA 5ALYA 3SEIA 4QZGA 1IORA 3C83A 2AU0A 5J0TA 2E1FA 1GF4A 3M6ZA 3RBEA 4JK1A 3DN8A 1DQJC 3P65A 3RJJA 1QLNA 1VLBA 3N7RC 1KY1A 1JIHA 4RUAA 1LHHA 2MEFA 1B7MA 2R8KA 5KFDA 5CA7A 224LA 4JMUA 1C6JA 1L03A 2IHLA 2B6YA 1TCYA 2MEHA 3HTDA 196LA 5FEKA 2E8MA 2B73A 4LVSA 3V6HA 4KLHA 4M6WB 1U49A 1Z19A 2BDUA 1CV5A 1OUDA 3HTBA 4ARMB 4B1AA 2I1QA 4DF4A 5KL8B 4NJ8A 3HH6A 2F2NA 4YMOA 4QW9A 2C8OA 2BKEA 1G0JA 1LKRA 1NZBA 3LZTA 3D3DA 5J2DA 1HEMA 4GC6A 1URJA 229LA 5J2JA 1NNLA 3TARA 2W3RA 1D3FA 1P64A 2VKQA 3A0BU 4QNLA 3R9KA 2XCPA 3GV8B 4ELTA 3AL0B 9ICVA 4DSJA 1WQPA 4H9FA 1RQLA 4EZ9A 1L70A 1D2WA 2KSOA 3C28A 3LWMA 125LA 3I28A 5KNIA 4F5OA 1LHKA 3LZ2A 4I7RA 1PK3A 3T5JA 4UB5A 3N28A 5E4PA 4QEQA 2KJ5A 1G7JC 1FEZA 4CE6A 5C6IA 4Y2XA 9ICTA 4O3QA 3NYAA 1T8GA 2KP7A 2D4KA 4Z3MA 5J0YA 1L91A 4IC9A 1GFHA 2XY6A 1D9DA 1X42A 2XTHA 4AYBC 2E8OA 4PGXA 4IL6U 2XQOA 4QIWF 4S0WA 4RQ4A 1LYEA 4CFOA 2JGAA 2Z2FA 5KFNA 115LA 3GILA 4NSHA 2KJ9A 3AQFA 3TXIA 1O08A 1JX4A 4GN5C 114LA 2F2QA 5AIAA 4WJ3B 7ICNA 142LA 2F4AA 2IA6A 2ZXHA 4RLMA 1AZFA 2ODGA 4O3PA 4QWEA 4KX5A 3MDCA 4KLUA 3JPTA 9ICJA 3E2EA 144LA 1A77A 4ETBA 4QZHA 2ISOA 2B5ZA 104LA 1LYFA 2BQLA 4GN4A 1RFPA 5ALGA 3TMWA 9ICSA 1UIHA 1L16A 3QEBZ 5ALOA 1XO1A 3PBLA 1FLYA 7ICLA 1GE4A 1KIPC 5AI5A 5J0PA 1BWJA 1JSFA 3M6KA 5ALRA 180LA 4P4PA 2NTGA 1BPYA 2FPLA 4BGDA 5G5GA 1GFUA 1VAUA 1OV5A 4I7OA 1GE2A 2MUTB 1CUKA 1DYEA 1NK4A 3H8WA 3HBEX 4RQ0A 2R18A 3V7LA 3LYZA 1V97A 1BPDA 1L49A 4EPIA 1S0VA 1IP6A 149LA 3W6AA 4QY9A 3SAGA 1QQ7A 2JXJA 4WM4A 4OCZA 5J2KA 5LAGA 2BQ3A 3RH6A 4ETDA 2P66A 4D9ZA 1P2CC 1G1VA 2FMPA 110LA 4CRXA 4W96A 4YR2A 2BQHA 1G7HC 200LA 2IHMA 1IWTA 2DQCY 3HP6A 1HIWA 8ICBA 5DDMA 2A3VA 4EBDA 2B70A 2VB1A 4LT0A 1WTHA 4Z6DA 2GWSA 154LA 1DI5A 1HHLA 3WW5A 4Z46A 243LA 1L18A 1L92A 3GULA 4F5RA 3ATNA 1DYFA 4ZEEA 1NK7A 1UBZA 3ED5A 161LA 1FN5A 3K75D 3GXKA 4ARQB 1ZJNA 1LYHA 3EWAA 1PK1A 2W1MA 191LA 238LA 3GV5B 9ICCA 3PW0A 4JB3A 130LA 4HJZA 2RDJA 3RB3A 3ZDEA 1JWRA 4DD2A 2B7XA 4ML7A 2LBOA 1P56A 4NHQA 4PGJB 3SMVA 2NTHA 164LA 3F2DA 3V6JA 3WL2A 3A3RX 5AKKA 8ICWA 2R8HA 3MBYA 3AN1A 2W9CA 1FKQA 4IR1A 5DQIA 1KL9A 1XJUA 1L96A 5AKXA 2PI4A 1LZ5A 3CDTA 1QT5A 246LA 2Z37A 3JPNA 4DO9A 1LSZA 4N1EI 4F91B 1LSFA 254LA 2ZJ5A 5KFSA 3HH5A 1EQ5A 5KFQA 1D8LA 3D2QA 3RJHA 3GUKA 5I5QA 1L24A 2F30A 5CHGA 3SV4A 4ECZA 4YEMA 1QTBA 4ELUA 5CJ7A 5HP4A 3RB4A 4KLLA 4LYMA 4CGZA 8ICHA 4RNMA 4Y2RA 113LA 2B6ZA 2W1LA 1B22A 2BQGA 3RB6A 1IIZA 1LJEA 2VJ4A 2BLXA 4C8LA 4F3OA 1ZQRA 4NGKA 2GV0A 1QDRA 1LV5A 3DN2A 4USAA 2KIVA 4P4OA 3U26A 4R66A 237LA 2JH1A 1GB5A 3WKAA 1ZVYB 1BHZA 1L83A 1LYGA 4NGZA 4FS1A 1L54A 3QZ8A 5F9LA 1B7PA 1CU2A 4XJBA 1LJ3A 1FLQA 208LA 1LAAA 4O3NA 1PVPA 1Q3VA 4Q8EA 4ED1A 3HKZC 1IV8A 1OUQA 2NWDX 1LZTA 3C29A 2WTFA 4DL7A 2I6ZA 2EDUA 4UBBA 3AGIA 3E0FA 1NJWA 4G4BA 3G3XA 1YAMA 4I2EA 4OJPA 1FIQA 1XGQC 4MEYA 2FPMA 3BQTA 2EAMA 1XSPA 2KN7A 1KIRC 4FJRA 3PSPA 4KLQA 3HTFA 1JXEA 5IIOA 1OUGA 206LA 2EANA 2LI6A 3M9OB 4QZBA 4UWVA 4H1PA 3CP8A 1RDFA 4LYCA 5C6LA 4OWAA 1COKA 5LXWA 4EOFA 3EXDA 2L5YA 4EENA 2OU8A 2BDPA 3M8RA 4ZH4A 3KTQA 4XJDA 3SB6A 4B9LA 5KAIU 4FBUA 3TXGA 2OM6A 4M4OA 1EPYA 1DZBX 1NMMA 2BQNA 4TSCA 3KBBA 1QTDA 1UA0A 5GTHU 4DYGA 1SB3C 2BPCA 1QT6A 4UBCA 4NY8A 1KSPA 5KXRA 4NLNA 5DQHA 4MFAA 7ICHA 1XC9A 2FDRA 4J1AA 4RDSA 1GDWA 3Q8LA 3WPLA 3WU9A 5HR6A 5A3EA 4F2RA 1A6SA 1ZQIA 4BS7A 2MAXA 9ICHA 4TSBA 1FDLY 4DQ7A 2F44A 1GF9A 1OQMA 4PPXA 5LIOA 3QUQA 4Q45A 1CV3A 4HPEA 4J9SA 2LHTA 4YXMA 3Q8SB 1MELL 4U7CA 2PFPA 1KXYA 2QB0A 1C61A 3ZEKA 2VA2A 4J9MA 2HSZA 2F1HA 1RJCB 3HILA 4C8KA 3A93A 4C8MA 3P64A 1L44A 1DYGA 3EYZA 3PVXA 1OVJA 1ZXIA 2B6XA 3F6ZA 1WVVA 3KZXA 1TAUA 3C5FA 1LI3A 4NM2A 5KKJA 2XY7A 1NHBA 5HMVA 1L47A 8ICSA 5FHWA 1L86A 2P35A 2Y1IA 3JPQA 4NGOA 1ZRMA 4IQTA 127LA 3OHBA 1SV0A 7ICOA 3AJNA 1S76D 3H0LB 3TAPA 2ANXA 2ZILA 3G3BB 4G9SA 5AKGA 4H94A 5J2EA 5KFVA 5J0SA 5ALTA 2LC9A 4RQ2A 4AYBF 3NTUA 2W1XA 5F9XA 2HHWA 5JUMA 1L58A 2Y0SF 5ALQA 3C2LA 131LA 3JPRA 5KFYA 1BQLY 5DB8A 4AP9A 241LA 4WM6A 2DQNB 4RNOA 3IDWA 2HMXA 1LYYA 1C68A 4DQ5A 2FYDA 4ECQA 4Y2JA 4PRQA 1YROA 1C65A 4PHPA 5LVKA 1D9UA 4TUNA 2B6WA 4EEKA 4UAYA 5DG7A 4FZMA 1KFTA 4MCKA 3WULA 2DBYA 4W58A 5KG1A 1SXEA 4B6JA 3SAFA 7ICMA 5IIJA 4NSIA 141LA 1CU5A 1L29A 2Z18A 1G0MA 4Z6CA 2F77X 4I2BA 2A7DA 2HCFA 3EPIA 3BS5B 1QTZA 2B21A 4M9HA 1T8AA 3HT7A 3ISCA 9ICFA 2HEAA 4NL9C 5AM5A 4XN6A 3VWOA 4P0PA 4DL2A 3T36A 4IAPA 4G4HA 2E1EA 4ED0A 1RYRA 4R64A 1ZQZA 2OCEA 2F2AB 4Y2YA 1ZQUA 4DKLA 3CYMA 3K4GA 1XS9D 4P2EA 4M9JA 1BPEA 1C6LA 4NEBA 1B2KA 4RLNA 1DOQA 1D0LA 5KFKA 1KTQA 5LVGA 4EJ4A 2BQAA 4I8SA 1UT5A 5KG6A 4KLOA 3SB5A 4OJOA 1GBZA 9ICEA 5FP0A 1UCOA 5L1LA 1LTMA 256LA 1YKYX 3KKAA 1L50A 1IWXA 1CKFA 2IHNA 3B0XA 4I2IA 1MC8A 4BDPA 1L84A 5DM9A 5D46A 7LYZA 5KKIA 4GCDA 1B7RA 4NGIA 5DLGA 2OXOA 5CP2A 2FMQA 1HEWA 1ZQJA 1B7SA 3PDSA 5D5FA 4RT3A 1F44A 1J97A 3I76A 5AKHA 5DBCA 3L2XA 4B49A 2IOFK 2JEFA 4K4IA 119LA 1NDGC 2IGCA 3IJVA 1PQMA 4KT3A 5HNKA 3GFKB 176LA 3WW6A 1CV1A 2RBPA 2W43A 2JR5A 3C2MA 4ECVA 1T7PA 5ALJA 1JRPA 5DB7A 1OVHA 4HTQA 4GN3A 2OTYX 2BZFA 2BR0A 3C8QA 3ETRA 233LA 3G3WA 129LA 2YMPA 2ALZA 3AGHA 1LYSA 3AM9A 4DDCA 2W9CB 3PZPA 1NK5A 3H0RB 1PQDA 1Z1VA 1J2NA 1ED1A 3ZDDA 4MFCA 2QARC 3GUPA 1L42A 3V2WA 3MGVA 3LDAA 2BQEA 1C6GA 3AZ4A 2OEAX 1C6PA 4W55A 1L19A 1G0LA 225LA 4EPFA 3FYHA 4DLGA 4I27A 3GIKA 2CPRA 1QTHA 170LA 3THVA 3K1RB 5IINA 2AUBA 227LA 1SKSA 4NXZA 1SL2A 1L3TA 1P5CA 3WMKA 2GOLA 3GQCA 4P0PB 2WF8A 1DK2A 3GXRA 3DEEA 1ZQEA 4DSIA 4JWMA 253LA 4B9NA 4W94A 1X6IA 3QNGA 1IOTA 1GB8A 3CT1A 3EPGA 4JWNA 1LHLA 4UASA 3BZKA 4I7JA 2YB4A 5J8YA 3F9LA 1KS3A 4YMNA 8ICYA 3HWTA 4IASA 4YVZA 1HEQA 1LZRA 3DN4A 1L7PA 4DCCA 1B5ZA 3QZ7A 165LA 1KQQA 1LSDA 4I2HA 4JUZA 5LYMA 1GO3F 1LSGA 5AI9A 1JQUA 3A3QA 4KLEA 2RBNA 1BVKC 3NS1A 3PX4A 3LYTA 7ICRA 2YBJA 1C64A 1IY4A 2FI1A 5G5HA 5CB1A 5L1MA 2BQRA 3RJKA 1L98A 1ZD3A 3NUQA 1L34A 5J29A 1T8FA 3DNAA 1IC7Y 5J2AA 5KFZA 1NBZC 4EELA 4K4GA 1U45A 1CUQA 2YY6A 1GEVA 1GD6A 1HUZA 5AK4A 3KHRA 3V7KA 4NFVA 3WYHA 1TE2A 8ICCA 4IATA 5HNLA 2EZZA 1JITA 3EMSA 1NZPA 1LLHA 3AEVA 1B5VA 2LYBA 1C08C 1EQ4A 1ZQAA 1LJKA 3RR7A 2F32A 4N5RA 2DQJY 3FADA 2BGWA 4ECWA 8ICVA 3DDHA 1LZ9A 4EZ6A 1B6IA 4B4JA 3Q8QB 1UIEA 4ETEA 1S9FA 4OJ6A 3OE8A 4YN4A 2LYOA 4OWHA 4NHPA 107LA 3FC4A 207LA 181LA 4PZOA 250LA 3HRDD 4RZRA 3AGGG 1BB3A 5IHGA 3L3FX 2KZZA 3RH4A 5EWFA 1D0MA 5K7OA 1OUHA 2YQEA 1LMPA 2YDGA 5F14A 4UAZA 2UVWA 4B9UA 8ICEA 4NHSA 5DBAA 2XGPA 4LT1A 1Y88A 3HU9A 4I7LA 4CFPA 3N4MB 3CSRA 2VJ5A 5KFLA 4I2CA 248LA 2BQBA 2LYAA 5J0RA 1ZV5L 4NLKA 1RI8B 2KHVA 3BQ1A 2ES6A 5ALZA 1P37A 1NI3A 4N9RA 3HT6A 1FFVA 2YTUA 4PL2A 2QB1A 1N5XA 2I5HA 2K4PA 1Z00B 3PO5A 2DPJA 1G0GA 4QWDA 4ET9A 4I7QA 1Q8KA 3DMXA 2RRDA 4H9BA 3UPQA 259LA 1OUCA 3RNXA 1C7YA 2H9KA 4F5QA 3GUNA 1NK8A 1L3UA 5BPCA 4HYKA 4KITB 3V7JA 2C2EA 2F1JA 4ETAA 5KT6A 4QJFB 2DQFC 5TZVA 5AKLA 1PZYA 2MRLA 3M8SA 1XSFA 3G3VA 1GXV2 4A7DA 4DQSA 3WU7A 162LA 1HFYA 1LZGA 4WLTA 245LA 1K1QA 3WVYA 4GXKA 1WWUA 1BB5A 1D6QA 1BNPA 4B9SA 3OJSA 1UIDA 5KFIA 5AIBA 4F93B 3PMLA 1C6BA 3J4GA 1QS5A 2ZIXB 1ALCA 4Y2SA 3GUJA 1CNSA 4W59A 5II3A 1L32A 5FELA 1L85A 2YBIA 3A8ZA 3HH4A 3HT9A 2Q9DA 1GFTA 3AU6A 2ZIXA 3GZFA 3OTQA 9ICAA 4PZNA 1LYIA 1PS5A 5APDA 5L1JA 1TV9A 2UVRA 1WCLA 1L69A 3CSZA 4XADA 4QDNA 4UB1A 2H5XA 4RQ3A 1L53A 3RJFA 4KPMA 4F4KA 2WB1F 4J1BA 1L61A 5KFCA 1RQNA 3WVXA 1IG6A 3M1YA 2G08A 4C8NA 5J2FA 1OYUA 1ZQPA 2G06A 2PXIA 4NY5A 4NLZA 2PFOA 1OUFA 1PUZA 190LA 1QIOA 2HUBA 102LA 1G1WA 4GLVA 1TBYA 3MR6A 3PX6A 1MQ3A 1IC5Y 5LA8A 1XO0A 3QY4A 5B66U 1UIBA 2LHMA 3C81A 2JHDA 3TXHA 2WHEA 182LA 1ZYTA 3OJPA 2W9AA 2HULA 5I14A 231LA 1OVKA 2BCSA 4TUQA 2PFQA 4PJ0U 3CT5A 4W56A 195LA 2AGQA 3NVZA 1DYBA 2D3DA 3A90A 1GE1A 3CDQA 3QUTA 4Q44A 3BDPA 4YF2A 1MLCE 2B74A 1F0MA 187LA 2AGPA 1IWYA 1L30A 1ZRNA 4BJQA 4Y2VA 1IOQA 1LI6A 4C0ZA 3JPOA 1DKKA 3WKEA 2V4QA 1WQQA 4F4YA 3Q8PB 5ALIA 1D2YA 1SWZA 4EKSA 1YKZX 4O3MA 1L65A 4H9CA 5EE3A 1TK8A 5HMJA 4XJFA 1XJTA 3FAHA 3RTVA 1GB3A 4NLBA 4UARA 3BS5A 5I54A 158LA 1S97A 1YZ6A 2B0CA 221LA 1L40A 2WAQF 4DJHA 4KLFA 4NLCA 4C7YA 1JIYA 2BHNA 4WM5A 4DD9A 5AKYA 3W3EA 4F92B 1ZQVA 4M2YA 3P4ZA 2RDIA 1P7DA 4QZFA 1T3NA 183LA 4JV0A 3SBAA 2EIZC 1J1XY 1NKEA 4Y2PA 1WTNA 1GB9A 4DL3A 1PQJA 3A95A 2RAZX 5IILA 4NG1A 4CHXA 1M6YA 5J0UA 2EAOA 236LA 1XSLA 1T3QA 2RHFA 4ZOHC 2ZUBA 4BAFA 1W6ZA 1LVHA 1P7SA 1QH9A 2D8CA 1LKSA 1LKYB 4F5PA 3C21A 1G7LC 3PNCA 175LA 1C6TA 3Q8KA 1C20A 1CKCA 5L3HA 1CU6A 5KXOA 4WLXA 2JH7A 1P2RA 4QZ8A 4O3RA 1FBIX 2DBTA 4C4TA 3LN2A 4E97A 4ZPUA 3SB9A 4Y2QA 2A19A 2YX8A 3W6FA 4BAPA 2XBSA 4QWAA 1QTVA 4MR1A 4U3XB 3C7YA 2W7OA 4K5YA 2AHOB 5AI0A 4RW1A 4DF8A 1MA7A 1L63A 1L36A 1OV7A 4BADA 1HFZA 1WTMA 7ICEA 2Q9EA 4FDYA 2CUUA 1C6DA 4H9AA 1EQEA 2Y9TA 2DL0A 2G09A 1C6EA 5DG8A 5DGAA 4NGYA 4TX7A 1INUA 2C2DA 2PC2A 4RW2A 4YQWA 4DDAA 1U9LA 1B0DA 5ALLA 1O23A 3HW8A 1CUPA 1BPBA 1L13A 2D91A 5EWEA 1N2XA 3A92A 1SGGA 4H9IA 3KZIU 5IELA 1B5UA 2LM4A 1Z1BA 5KXSA 3GUMA 159LA 1MSWD 3P68A 1JSEA 1H38A 2MEBA 3SB8A 3VC8A 167LA 2XIDA 3C7ZA 1L66A 2DFLA 3RFAA 5ALHA 8ICZA 1L3VA 4J9LA 1UT8A 4UB4A 2V4RA 5HLLA 1LZEA 3OE6A 1B7LA 4CF5A 4QZDA 4QW8A 1NK9A 2JMGA 2ZWBA 1Q3UA 5CR0A 2A1JB 5APCA 1L97A 2BPFA 1C60A 1YILA 2G07A 5AM4A 135LA 5JRTA 1UPHA 2PMZC 7LZMA
chains in the Genus database with same CATH topology
257LA 1L56A 1L60A 6LYTA 1C6KA 160LA 4ZFPA 1X40A 1CKDA 1L71A 3RT5X 5FDJA 2LCBA 1F6SA 4R0FA 1C45A 4N1CC 1X66A 1Z55A 1UIAA 1C6IA 155LA 2IFFY 4I7MA 147LA 1QUOA 3WXUA 1QQYA 5I53A 2BQDA 4C5FA 1L04A 5AMYA 4H8YA 1C63A 3K2RA 4R6CA 3CSQA 260LA 1HERA 2BQKA 1L90A 4WM2A 2Y9UA 1L23A 1L07A 4AXTA 1LHIA 4NGWA 3SENA 4HSFA 3EBAB 5HQ1A 1YAQA 1L11A 1CJ9A 3HBHA 1TEWA 4W54A 4N8ZA 1LPIA 1UCVA 1L31A 4OWBA 1YKXX 1JKBA 4WM3A 4YEOA 4EKRA 1LJJA 258LA 5B1FA 4NWHA 3TXKA 4LDLA 1DI4A 1SV4A 1OUAA 156LA 1VEDA 4OWCA 1L01A 2Y8PA 4B4EA 1LYZA 2RBSA 1LCNA 1L46A 1LGUA 1KW7A 1B5YA 5LAFA 1L25A 4HJYA 1L12A 251LA 2O79A 2HEDA 1DKJA 4WL6A 1L33A 1IC4Y 1L64A 3ATOA 4NSGA 3WXTA 4LGKA 1D0KA 145LA 2RB2X 4X3BA 1IWVA 2BLYA 138LA 2LYZA 1DYDA 4GCFA 4I0CA 3DMZA 1B9OA 2QB0B 1CU3A 3C8RA 1GAYA 1JHLA 1DXSA 1EL1A 2QARB 2BQMA 1REZA 2OE9X 1K28A 3A6BY 2B6GA 1GF0A 5B05A 1YAOA 1NKHA 198LA 1I56A 3AZ7A 4XENA 1CKHA 5B59A 1L62A 213LA 3HH3A 1IR9A 1OUJA 2YBHA 1CV6A 2RH1A 4C3WA 3TXFA 1F10A 3FI5A 2YVBA 4NG8A 1REYA 3W6BA 1N4FA 1BGIA 2EPEA 5LA5A 1IP5A 4PPOA 2QKQA 1IR7A 239LA 2D4JA 2DQGY 150LA 1LZ8A 4QGZA 1V7SA 1L00A 2ZIJA 3C80A 2MEEA 1CU0A 1CJ6A 1L22A 1BVXA 1CVKA 1KXWA 4H92A 4Z98A 1UQVA 1TLAA 2HU3A 3N9AA 1BB6A 3LYOA 2F8KA 4ARLA 1IOSA 2D4IA 2Z6BA 1G0KA 2YBLA 1L59A 1L89A 4OWEA 219LA 1QDTA 4YXAC 1L10A 4DD3A 111LA 3OK0A 1LJNA 1B7OA 184LA 4TTDA 3HWLA 247LA 2LZTA 4OW1A 3ZVQB 1VFBC 1WWVA 4J0LA 1C6CA 1CJ7A 1RG6A 5F9UA 5KXWA 3A67Y 1GB2A 2B6TA 4NHTA 1CJ8A 3FA0A 1LHMA 1ZURA 2RBQA 5LVHA 1XGTC 4NL9A 5L3IA 2G4NA 3J6KA 1LZAA 197LA 3MGWA 4ARQA 1X9XA 1YL0X 1L99A 1L20A 1JISA 3A94A 5EBHA 3OE0A 1C10A 2RB1X 5KXMA 4ARJA 1V38A 1JKDA 3CDOA 1LSAA 3HFMY 1LMQA 5LINA 1D6PA 2A4TA 1C6QA 122LA 2LMRA 1LW9A 5JU5A 137LA 5KJ9A 2KE7A 3WUAA 1TDYA 3W6CA 4DD0A 1OUEA 1GEZA 4HTKA 1LHJA 169LA 1NDMC 123LA 3DN3A 5J8YC 1B7QA 1JTTL 4YXCA 1SSYA 1GF6A 234LA 1IP7A 1L75A 4ARPA 1UA6Y 3TXBA 3RU5A 1L52A 4ET8A 2ZIKA 4NSJA 3L64A 2LZ2A 1QSBA 2ESEA 1IX0A 5KXNA 4L41A 2DQDY 2YBNA 168LA 4GRVA 1T6HA 1IR8A 1C67A 1FKVA 1L87A 1XEIA 1LPYA 1HELA 4H91A 3WU8A 2Q0MX 199LA 3WUMA 2Z2EA 1C6NA 4LT2A 1L77A 5APFA 2G4PA 1L82A 1HEPA 4H8XA 222LA 235LA 3DN6A 3V2YA 5FCPA 163LA 5KXYA 1QS9A 103LA 3EO5A 1LJ4A 3B0OA 4HP0A 4H9HA 3AB6A 5F81A 118LA 1C62A 2E8PA 2YBMA 3DMVA 171LA 1LMOA 2OU0X 2YSSC 2HECA 4WL7A 1DI3A 4HTNA 1WQMA 1AT5A 1GF3A 3SN6R 2Z19A 4HJVA 3A96A 2CGIA 1GE3A 2XBRA 3B72A 1L28A 3HDEA 3NY8A 1XFPL 1KW4A 4OO9A 140LA 252LA 1A2YC 2OTZX 3RW8A 226LA 2BQIA 217LA 1YL1X 1IWUA 132LA 228LA 1GFAA 1G7MC 3AW6A 2E8NA 1HC0A 5JTIA 2MEIA 1C7PA 3HU8A 5DN4A 215LA 2LZMA 1NF5A 3SB7A 2B75A 5LZMA 1HENA 201LA 4ZIXA 1JTOL 4WLDA 1KW5A 4NHIA 2BAAA 1C6HA 1UACY 2ANVA 5DL9A 5T3FA 2KSOB 2H5ZA 1QUSA 2MEDA 1A4VA 4LYTA 4PHIA 1YQVY 1LSBA 1GDXA 4KXIA 126LA 2C8PA 1JTMA 3AZ6A 2HEFA 1QUTA 5C6JA 3B6LA 2WARA 1OWZA 5F16A 1I20A 5A3ZA 1L67A 3CB7A 1W08A 3WPKA 2ZYCA 1IEEA 1LSPA 1L38A 3C82A 4DT3A 4RQMA 3ODUA 6LYZA 1HFXA 1KNIA 1QT3A 1LSEA 1L74A 1IP1A 4DC4A 3RZ4A 1JJ1A 1IO5A 4YENA 3M3UA 3A91A 1L0JA 178LA 1L72A 1YAPA 3GUOA 1L0KA 4EKPA 2BQFA 4YX7C 1SQ2L 1L94A 192LA 1L88A 4G4CA 1G0PA 1KIQC 1C69A 5L9JA 4XJGA 4PK0A 3KAMA 2DKVA 3TXJA 1ZMYL 3WPJA 4NWEA 120LA 1DYAA 1LGWA 4LDEA 3W6DA 2DKZA 2X0AA 5J7CA 1L76A 1HMKA 1GXXA 1L80A 212LA 153LA 3N9CA 1T97A 1WQNA 211LA 143LA 1LZ1A 1QT8A 5KXLA 172LA 2L78A 1L14A 1L79A 2FBBA 1ZWNA 4Z41A 1L81A 1L73A 157LA 186LA 1L09A 1OUBA 1IWZA 5JENB 2JV3A 4H93A 5B07A 255LA 1P3NA 177LA 1VDSA 1AT6A 1XEJA 1GWDA 1C6AA 4PJ2C 1LJGA 5ILCA 1V7TA 1F0WA 2A7FA 3C7WA 1C6MA 2HEEA 3DKEX 1IP2A 1L93A 1NHEA 1NWGA 1LSMA 1LOZA 3F8VA 5KXTA 1L39A 1NQIA 1P46A 1LMAA 3T6UA 4M4OA 2EAPA 3TXEA 1XGPC 5E9RA 1L35A 2ZNWY 4W52A 1LSCA 2CWIA 3TACB 1FLUA 3B0KA 1L27A 1LZNA 1WVUA 3LHMA 4TWSA 4LZMA 1LZBA 148LE 2I26L 4UWUA 1GBXA 1XGRC 4WM1A 1JKAA 3HUQA 4GLAA 1G0QA 3TADC 2BPUA 1L68A 5KY1A 5B06A 1LI2A 1JTPL 2F47A 1LWGA 109LA 4LFXA 214LA 3E3DA 249LA 1QT7A 5KXXA 5KXKA 3RUNA 112LA 216LA 2O7AA 5APEA 3D9AC 2K60A 1BB4A 1QUHA 1J1OY 4WO6A 4HPIA 1JI7A 1GE0A 1QT4A 4NGVA 4H9EA 1L95A 2OE4X 244LA 1V85A 2HUKA 3SP3A 1JJ0A 4DQJA 2ZYPA 1B5WA 1GFGA 209LA 3TADA 1L26A 1L43A 1T6VL 1SX7A 1LJIA 1LSYA 4N0JA 1L08A 4XJIA 205LA 2F3NA 5HNCA 4WG1A 1H6MA 1REXA 1QUGA 1UICA 3FE0A 4LDOA 2B72A 4M6DA 2KG5A 1ZVHL 1HSXA 1GPQC 1AKIA 1SLYA 1L15A 2Z12A 5F3XB 1AM7A 1D3NA 4II8A 220LA 166LA 3C8SA 1RCMA 188LA 3AZ5A 1JPOA 3P66A 1IOCA 3AW7A 3HBDA 3DN0A 2ZQ4A 4YM8A 4LYBA 1BWHA 3WUNA 1L57A 2Z39A 5LVJA 2BQJA 4LT3A 1XEKA 3TMVA 1SSWA 1L51A 1P6YA 2RSCA 1LMNA 1CX7A 9LYZA 5KXPA 1LMCA 2MEAA 3G3AB 3M18B 1GF7A 3ZVQA 3FI7A 4O34A 1LYJA 3A34A 1PQOA 4PJZA 4IS7A 4OOTA 3H8MA 4AQNA 4EKQA 1WQRA 2RB0X 139LA 3HUKA 1GFJA 2I25L 2BQCA 4GCBA 2OE7X 1L02A 1SV0C 2W1YA 4RQNA 3LYMA 1D9WA 1PQIA 1DXJA 1BB7A 3EMLA 2ZQ3A 1LZ4A 1LZDA 5LYTA 1CX6A 3NY9A 3TMUA 1GHLA 1IP4A 1HEOA 4W51A 1GB6A 232LA 3KKAC 1L41A 1SX2A 4W57A 1L05A 3HTGA 242LA 2RBOA 4UWNA 1F6RA 4WLYA 4J7VA 2HEBA 1G06A 2F4GA 5DN5A 5FSTA 1G07A 4I7NA 2MEGA 1CV0A 1I1ZA 1YIKA 133LA 1IY3A 4NGLA 3ULRA 1FLWA 4H8ZA 193LA 8LYZA 4XJHA 4LYZA 1UIGA 2O4WA 1B0XA 2QARA 1C43A 1G7IC 1XEPA 4WG7A 1IP3A 1C6FA 4EXMA 4WOAA 1L37A 1QSQA 1P36A 3TXDA 1BWIA 1VDPA 2FBDA 4LFPA 1OW5A 1H87A 218LA 2KMDA 1HSWA 3UONA 3IWRA 4I7KA 1L06A 4XYYA 2BQOA 1KY0A 4CGEA 4DWXA 4I7PA 4MHVA 2CJLA 2DQHY 1LZ6A 4MSTA 5ILFA 1LZSA 2CDSA 1GF8A 2RAYX 3CQLA 2DQEY 1L48A 1JTNA 230LA 3CT0A 1VATA 1GB7A 1YANA 1D3MA 1JJ3A 2RBRA 4OOOA 1PQKA 4G49A 4DD7A 1GFKA 3VW7A 5KXZA 1UUZC 1LYOA 3HT8A 1J1PY 4B4IA 3TMXA 4GBRB 1SXDA 3CDVA 3JR6A 5I4XA 1B4FA 2HTXA 3W6EA 1C46A 1L17A 128LA 4WO9A 3A6CY 1GBOA 185LA 3QAKA 2ZNXY 3D4SA 146LA 5I4WA 3SBBC 1LWKA 1B7NA 2OU9A 261LA 1GF5A 5DLAA 2D6BA 4I7SA 223LA 2N5ZA 2FE9A 1C66A 210LA 2HUMA 1HNLA 3CDRA 4LZTA 1LJHA 1CTWA 1REMA 1GBYA 1LZCA 2XJWA 2FYCA 1GB0A 1GFEA 262LA 4B0DA 3B0IA 1D3JA 1QSWA 152LA 4PRUA 4I7TA 1PK1B 1IVMA 1L45A 4WMGA 4ANRA 1QTCA 1HMLA 1SWYA 5LVIA 2Z38A 4ARMA 1JKCA 3WH1A 3K3TA 5IDDA 1HF4A 1LZYA 1DPWA 1LJFA 4HV2A 2EQLA 3GUIA 1LGXA 1CKGA 3BKHA 1LSNA 3RZEA 4ETCA 1KXXA 194LA 4YOPA 1WQOA 2DQIY 3BQ7A 4NGJA 1LYDA 3DN1A 1P2LA 1GAZA 1L55A 3QE8A 1NBYC 4W53A 1OP9B 2DKXA 4IJ4A 1VDTA 3AYQA 1JEFA 1DYCA 1UC0A 1L21A 2G4QA 1T3PA 2MECA 1GFVA 4LYOA 1I6SA 2EKSC 3BKVA 4DDBA 173LA 3BS7A 4GCCA 5D5CA 1VDQA 4DD1A 1QSAA 1DPXA 6LZMA 1GFRA 4DAJA 1RE2A 1IWWA 1XGUC 3LZMA 1OWYA 1QTEA 3OE9A 3HDFA 1LMTA 1GBWA 189LA 1CV4A 5B1GA 4NIJA 4EMNA 4KL7A 2H9JA 4H90A 1QTKA 4CJ2A 4HV1A 134LA 1E8LA 1GBSA 240LA 4AGAA 5M1YA 1TAYA 1LKYA 1QUDA 1JUGA 5I4YA 3IJUA 4GCEA 1OXJA 1B5XA 174LA 151LA 4E3UA 1UIFA 2GLEA 2DQAA 1OUIA 5LYZA 2LYMA 2HU1A 3N9EA 3HUAA 2LPEA 108LA 3SEIA 1IORA 3C83A 1GF4A 3DN8A 1DQJC 3P65A 1KY1A 2MEFA 1LHHA 1B7MA 224LA 1L03A 1C6JA 2IHLA 2B6YA 1TCYA 2MEHA 3HTDA 196LA 5FEKA 2E8MA 2B73A 4ARMB 1OUDA 1CV5A 3HTBA 4B1AA 4NJ8A 3HH6A 2F2NA 2C8OA 1G0JA 1LKRA 3LZTA 3D3DA 1HEMA 229LA 1P64A 1D3FA 1WQPA 4H9FA 1L70A 1D2WA 2KSOA 125LA 5KNIA 1LHKA 3LZ2A 4I7RA 1PK3A 5E4PA 4QEQA 1G7JC 5C6IA 3NYAA 1T8GA 2D4KA 4Z3MA 1L91A 1GFHA 2XTHA 2E8OA 2XQOA 4S0WA 1LYEA 4CFOA 2Z2FA 115LA 4NSHA 3TXIA 4GN5C 114LA 2F2QA 142LA 2F4AA 4RLMA 1AZFA 144LA 4ETBA 2B5ZA 104LA 1LYFA 2BQLA 4GN4A 1RFPA 3TMWA 1UIHA 1L16A 3PBLA 1FLYA 1GE4A 1KIPC 1BWJA 1JSFA 180LA 2NTGA 1GFUA 1VAUA 1OV5A 4I7OA 1GE2A 1DYEA 3HBEX 4EPIA 3LYZA 1L49A 1IP6A 149LA 3W6AA 4QY9A 4WM4A 5LAGA 4ETDA 4D9ZA 1P2CC 1G1VA 110LA 4W96A 2BQHA 1G7HC 200LA 1IWTA 2DQCY 2B70A 2VB1A 4LT0A 1WTHA 154LA 1DI5A 1HHLA 3WW5A 4Z46A 243LA 1L18A 1L92A 3GULA 3ATNA 1DYFA 4ZEEA 1UBZA 161LA 1FN5A 3GXKA 4ARQB 1LYHA 1PK1A 2W1MA 191LA 238LA 130LA 4HJZA 1JWRA 4DD2A 2B7XA 4ML7A 1P56A 4NHQA 4PGJB 2NTHA 164LA 3WL2A 3A3RX 1FKQA 1XJUA 1L96A 1LZ5A 3CDTA 1QT5A 246LA 2Z37A 1LSZA 4N1EI 1LSFA 254LA 3HH5A 1EQ5A 3GUKA 5I5QA 1L24A 2F30A 4YEMA 1QTBA 4LYMA 113LA 2B6ZA 2W1LA 2BQGA 1LJEA 1IIZA 2BLXA 4NGKA 2GV0A 1QDRA 3DN2A 2KIVA 237LA 1GB5A 1ZVYB 1BHZA 1L83A 1LYGA 4NGZA 1L54A 1B7PA 1CU2A 4XJBA 1LJ3A 1FLQA 208LA 1LAAA 2NWDX 1LZTA 2I6ZA 3AGIA 4G4BA 3G3XA 1YAMA 1XGQC 2EAMA 1KIRC 4FJRA 3HTFA 1OUGA 206LA 2EANA 4UWVA 4H1PA 4LYCA 5C6LA 4OWAA 1COKA 5LXWA 4EOFA 3EXDA 2L5YA 2OU8A 4XJDA 3SB6A 3TXGA 1EPYA 1DZBX 1NMMA 2BQNA 4TSCA 1QTDA 4DYGA 1QT6A 5KXRA 4J1AA 4RDSA 1GDWA 3WPLA 3WU9A 5A3EA 4BS7A 4DQ7A 4TSBA 1FDLY 2F44A 1GF9A 1OQMA 5LIOA 1CV3A 4HPEA 1MELL 1KXYA 2QB0A 1C61A 3ZEKA 1RJCB 3HILA 3A93A 3P64A 1L44A 1DYGA 1OVJA 2B6XA 3F6ZA 1WVVA 1LI3A 5KKJA 5HMVA 1NHBA 1L47A 5FHWA 1L86A 4NGOA 127LA 1SV0A 3AJNA 2ZILA 2ANXA 3G3BB 4G9SA 4H94A 2LC9A 2W1XA 5F9XA 1L58A 131LA 1BQLY 4WM6A 241LA 3IDWA 1LYYA 4DQ5A 1C68A 2FYDA 4PRQA 1YROA 1C65A 5LVKA 1D9UA 4TUNA 2B6WA 4MCKA 3WULA 4W58A 1SXEA 4NSIA 141LA 1CU5A 1L29A 2Z18A 1G0MA 2A7DA 3BS5B 1QTZA 1T8AA 3HT7A 3VWOA 2HEAA 4NL9C 4XN6A 3T36A 4IAPA 4G4HA 4DKLA 4P2EA 1C6LA 4NEBA 1B2KA 4RLNA 1D0LA 5LVGA 4EJ4A 2BQAA 4I8SA 3SB5A 1GBZA 1UCOA 1LTMA 256LA 1YKYX 3KKAA 1L50A 1IWXA 1CKFA 1L84A 5DM9A 7LYZA 5KKIA 4GCDA 1B7RA 4NGIA 1HEWA 1B7SA 3PDSA 5D5FA 3L2XA 4B49A 119LA 1NDGC 2IGCA 3IJVA 1PQMA 4KT3A 3WW6A 176LA 1CV1A 2RBPA 1OVHA 4HTQA 4GN3A 2OTYX 3C8QA 233LA 3G3WA 129LA 4DDCA 3AGHA 1LYSA 1PQDA 1Z1VA 2QARC 3GUPA 1L42A 3V2WA 2BQEA 1C6GA 3AZ4A 2OEAX 1C6PA 4W55A 1L19A 1G0LA 225LA 4EPFA 1QTHA 170LA 3K1RB 2AUBA 227LA 1P5CA 3WMKA 3GXRA 253LA 4W94A 3QNGA 1IOTA 1GB8A 3CT1A 1LHLA 4I7JA 5J8YA 3F9LA 1KS3A 4IASA 1HEQA 1LZRA 3DN4A 1B5ZA 165LA 1LSDA 5LYMA 1LSGA 1JQUA 3A3QA 2RBNA 1BVKC 3LYTA 2YBJA 1C64A 1IY4A 5L1MA 1L98A 1L34A 1T8FA 3DNAA 1IC7Y 1NBZC 1CUQA 1GEVA 1GD6A 4NFVA 3WYHA 4IATA 5HNLA 1JITA 3EMSA 1LLHA 1B5VA 1C08C 1EQ4A 1LJKA 2F32A 4N5RA 2DQJY 3FADA 1LZ9A 1B6IA 4B4JA 1UIEA 4ETEA 3OE8A 2LYOA 4OWHA 4NHPA 107LA 207LA 181LA 4PZOA 250LA 3AGGG 1BB3A 5IHGA 1D0MA 5K7OA 1OUHA 1LMPA 2YDGA 5F14A 4NHSA 4LT1A 3HU9A 4I7LA 4CFPA 3CSRA 248LA 2BQBA 1ZV5L 1RI8B 2ES6A 1P37A 4N9RA 3HT6A 2YTUA 2QB1A 2K4PA 1G0GA 4ET9A 4I7QA 3DMXA 4H9BA 259LA 3RNXA 1OUCA 2H9KA 3GUNA 4ETAA 2DQFC 1XSFA 1PZYA 3G3VA 1GXV2 4A7DA 3WU7A 162LA 1HFYA 1LZGA 4WLTA 245LA 3WVYA 1BB5A 1WWUA 1D6QA 1UIDA 1C6BA 3J4GA 1QS5A 1ALCA 3GUJA 1CNSA 4W59A 5II3A 1L32A 5FELA 1L85A 2YBIA 3A8ZA 3HT9A 3HH4A 2Q9DA 1GFTA 4PZNA 1LYIA 1PS5A 5APDA 1L69A 3CSZA 4XADA 4QDNA 1L53A 4KPMA 4J1BA 1L61A 3WVXA 1OYUA 4NY5A 1OUFA 190LA 1QIOA 2HUBA 102LA 1G1WA 4GLVA 1TBYA 1IC5Y 5LA8A 3QY4A 1UIBA 2LHMA 3C81A 3TXHA 182LA 1ZYTA 3OJPA 2HULA 5I14A 231LA 1OVKA 3CT5A 4W56A 195LA 1DYBA 2D3DA 3A90A 1GE1A 3CDQA 4YF2A 1MLCE 2B74A 1F0MA 187LA 1IWYA 1L30A 1IOQA 1LI6A 1DKKA 1WQQA 1D2YA 1SWZA 4EKSA 1YKZX 1L65A 4H9CA 5HMJA 4XJFA 1XJTA 1GB3A 5I54A 3BS5A 158LA 221LA 1L40A 4DJHA 1JIYA 4WM5A 4DD9A 3W3EA 3P4ZA 183LA 3SBAA 2EIZC 1J1XY 1WTNA 1GB9A 3A95A 1PQJA 4NG1A 2RAZX 4CHXA 2EAOA 236LA 4BAFA 1W6ZA 1P7SA 2D8CA 1LKSA 1LKYB 1G7LC 175LA 1C6TA 5L3HA 5KXOA 1CKCA 1CU6A 4WLXA 1P2RA 1FBIX 2DBTA 3LN2A 4E97A 4ZPUA 3SB9A 4BAPA 3W6FA 2XBSA 1QTVA 4U3XB 4MR1A 3C7YA 4K5YA 4RW1A 1L63A 4BADA 1L36A 1OV7A 1HFZA 1WTMA 2Q9EA 4FDYA 2CUUA 1C6DA 4H9AA 1EQEA 2Y9TA 2DL0A 1C6EA 4NGYA 4TX7A 1INUA 2PC2A 4RW2A 4DDAA 1B0DA 1O23A 1CUPA 1L13A 2D91A 3A92A 1SGGA 4H9IA 5IELA 1B5UA 5KXSA 3P68A 3GUMA 159LA 1JSEA 2MEBA 3SB8A 167LA 3C7ZA 1L66A 5HLLA 1LZEA 3OE6A 1B7LA 2ZWBA 5APCA 1L97A 1C60A 1YILA 135LA 5JRTA 7LZMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D4S A;  1LI3 A;  257L A;  1L56 A;  1L60 A;  1NHB A;  146L A;  1L47 A;  1OWZ A;  1L86 A;  3SBB C;  1C6K A;  1L67 A;  1LWK A;  2OU9 A;  160L A;  261L A;  127L A;  1X40 A;  1SV0 A;  4I7S A;  1L71 A;  223L A;  2ANX A;  2FE9 A;  1C66 A;  210L A;  2LCB A;  2HUM A;  3CDR A;  1L38 A;  2LC9 A;  3C82 A;  4RQM A;  1CTW A;  3ODU A;  1L58 A;  1KNI A;  1QT3 A;  131L A;  1L74 A;  262L A;  241L A;  3IDW A;  1C68 A;  1D3J A;  1X66 A;  152L A;  155L A;  1C6I A;  4I7M A;  147L A;  4I7T A;  1PK1 B;  1L0J A;  178L A;  1C65 A;  1L45 A;  1L72 A;  1QUO A;  3GUO A;  1L0K A;  1QTC A;  4EKP A;  2B6W A;  1L04 A;  1SWY A;  4YX7 C;  1L94 A;  1C63 A;  4W58 A;  3K2R A;  1SXE A;  192L A;  4ARM A;  1L88 A;  260L A;  1G0P A;  1L90 A;  141L A;  1L29 A;  1CU5 A;  1C69 A;  2Y9U A;  1L23 A;  1L07 A;  1G0M A;  4PK0 A;  3BS5 B;  3GUI A;  1QTZ A;  1LGX A;  3SEN A;  1T8A A;  3RZE A;  120L A;  3HT7 A;  1DYA A;  1L11 A;  4NL9 C;  1LGW A;  4LDE A;  2DKZ A;  4IAP A;  1L76 A;  3BQ7 A;  4W54 A;  4DKL A;  1UCV A;  1L31 A;  1LYD A;  1P2L A;  3DN1 A;  1C6L A;  1L80 A;  1L55 A;  212L A;  4EKR A;  4W53 A;  258L A;  4EJ4 A;  1T97 A;  3SB5 A;  2DKX A;  211L A;  4LDL A;  143L A;  1SV4 A;  1DYC A;  1QT8 A;  172L A;  1L21 A;  256L A;  156L A;  3KKA A;  1L50 A;  1I6S A;  1L84 A;  2L78 A;  1L01 A;  1L14 A;  1L79 A;  1ZWN A;  1L81 A;  1L73 A;  157L A;  173L A;  3BS7 A;  186L A;  1L09 A;  2RBS A;  1L46 A;  3PDS A;  2JV3 A;  1LGU A;  1KW7 A;  255L A;  6LZM A;  1P3N A;  177L A;  1L25 A;  4DAJ A;  3L2X A;  119L A;  251L A;  1L12 A;  2IGC A;  1OWY A;  3LZM A;  2O79 A;  1PQM A;  3OE9 A;  3HDF A;  176L A;  1CV1 A;  2RBP A;  189L A;  1C6A A;  1CV4 A;  1L33 A;  1OVH A;  1L64 A;  2OTY X;  3C8Q A;  145L A;  233L A;  2RB2 X;  3C7W A;  3G3W A;  129L A;  1C6M A;  138L A;  1DYD A;  1PQD A;  1Z1V A;  2QAR C;  3DKE X;  3GUP A;  1L42 A;  3V2W A;  3DMZ A;  1L93 A;  1C6G A;  2QB0 B;  1CU3 A;  3F8V A;  240L A;  2OEA X;  3C8R A;  1C6P A;  4W55 A;  1L19 A;  1G0L A;  1LKY A;  1QUD A;  225L A;  4EPF A;  1DXS A;  1OXJ A;  2QAR B;  1QTH A;  174L A;  170L A;  1L39 A;  3K1R B;  227L A;  1P5C A;  151L A;  2OE9 X;  1P46 A;  1K28 A;  2GLE A;  2B6G A;  2EAP A;  253L A;  198L A;  1L35 A;  3HUA A;  2LPE A;  108L A;  4W52 A;  1L62 A;  213L A;  3SEI A;  3HH3 A;  4I7J A;  5J8Y A;  3C83 A;  3F9L A;  3TAC B;  1KS3 A;  1CV6 A;  3DN8 A;  1L27 A;  2RH1 A;  1KY1 A;  3DN4 A;  224L A;  4LZM A;  165L A;  1L03 A;  1C6J A;  148L E;  2B6Y A;  3HTD A;  196L A;  2E8M A;  2B73 A;  1JQU A;  3FI5 A;  4ARM B;  1CV5 A;  3HTB A;  3HUQ A;  1G0Q A;  2RBN A;  3TAD C;  4NJ8 A;  1C64 A;  3HH6 A;  5L1M A;  1L98 A;  1G0J A;  1L68 A;  1L34 A;  2QKQ A;  1T8F A;  229L A;  3DNA A;  1LI2 A;  239L A;  1P64 A;  1D3F A;  150L A;  1CUQ A;  1LWG A;  2F47 A;  109L A;  1L70 A;  1D2W A;  1L00 A;  214L A;  2KSO A;  3C80 A;  249L A;  1CU0 A;  1L22 A;  125L A;  1QT7 A;  5KNI A;  4I7R A;  3RUN A;  1PK3 A;  1CVK A;  112L A;  1LLH A;  216L A;  2O7A A;  2K60 A;  1QUH A;  1UQV A;  1JI7 A;  1TLA A;  2F32 A;  3NYA A;  3FAD A;  1T8G A;  2F8K A;  1L91 A;  4ARL A;  1B6I A;  1QT4 A;  2E8O A;  1L95 A;  2OE4 X;  2Z6B A;  1G0K A;  3OE8 A;  244L A;  107L A;  4S0W A;  1L59 A;  1LYE A;  181L A;  4PZO A;  1L89 A;  250L A;  219L A;  1V85 A;  4YXA C;  115L A;  1L10 A;  2HUK A;  111L A;  114L A;  2F2Q A;  142L A;  209L A;  3TAD A;  184L A;  1L26 A;  1L43 A;  3HU9 A;  4I7L A;  144L A;  3HWL A;  1SX7 A;  104L A;  1LYF A;  1L08 A;  248L A;  247L A;  205L A;  2F3N A;  2ES6 A;  1WWV A;  1P37 A;  1L16 A;  3HT6 A;  1QUG A;  3PBL A;  2YTU A;  2QB1 A;  1C6C A;  2K4P A;  1RG6 A;  1G0G A;  4LDO A;  2B6T A;  4I7Q A;  3DMX A;  259L A;  3FA0 A;  180L A;  2B72 A;  3GUN A;  2NTG A;  2KG5 A;  1ZUR A;  2RBQ A;  1OV5 A;  4I7O A;  1DYE A;  1L15 A;  4NL9 A;  4EPI A;  3G3V A;  1L49 A;  5F3X B;  162L A;  149L A;  1D3N A;  197L A;  220L A;  166L A;  4ARQ A;  3C8S A;  1X9X A;  188L A;  245L A;  1L99 A;  1WWU A;  1L20 A;  1C6B A;  1G1V A;  3DN0 A;  110L A;  1QS5 A;  3OE0 A;  2RB1 X;  4ARJ A;  1V38 A;  200L A;  1L57 A;  3CDO A;  3GUJ A;  4W59 A;  1L32 A;  2A4T A;  1C6Q A;  1L85 A;  2B70 A;  3HH4 A;  122L A;  2LMR A;  1LW9 A;  5JU5 A;  1L51 A;  1SSW A;  1WTH A;  2Q9D A;  3HT9 A;  1P6Y A;  137L A;  1CX7 A;  243L A;  2KE7 A;  1L18 A;  1L92 A;  4PZN A;  1LYI A;  3GUL A;  1LYJ A;  1L69 A;  1DYF A;  161L A;  4ARQ B;  1PQO A;  4PJZ A;  1L53 A;  169L A;  4IS7 A;  1LYH A;  123L A;  3DN3 A;  3H8M A;  4AQN A;  4EKQ A;  1PK1 A;  5J8Y C;  191L A;  2RB0 X;  238L A;  4YXC A;  1L61 A;  139L A;  1SSY A;  130L A;  3HUK A;  234L A;  1L75 A;  2B7X A;  1P56 A;  4ARP A;  2OE7 X;  1L02 A;  1OYU A;  1SV0 C;  1L52 A;  2NTH A;  164L A;  4RQN A;  3L64 A;  1D9W A;  1PQI A;  1QSB A;  190L A;  2ESE A;  3EML A;  1XJU A;  102L A;  1G1W A;  1L96 A;  168L A;  4GRV A;  1CX6 A;  3NY9 A;  1T6H A;  3CDT A;  1QT5 A;  3C81 A;  246L A;  182L A;  1ZYT A;  2HUL A;  5I14 A;  231L A;  1C67 A;  1OVK A;  4W51 A;  1L87 A;  254L A;  1LPY A;  3HH5 A;  4W56 A;  3GUK A;  232L A;  3KKA C;  195L A;  1L41 A;  1L24 A;  1SX2 A;  1DYB A;  2D3D A;  3CDQ A;  4W57 A;  1L05 A;  3HTG A;  242L A;  2RBO A;  199L A;  1QTB A;  2B74 A;  1F0M A;  187L A;  1G06 A;  1L30 A;  1C6N A;  1L77 A;  1L82 A;  1LI6 A;  113L A;  2B6Z A;  1G07 A;  222L A;  235L A;  3DN6 A;  1D2Y A;  1SWZ A;  4I7N A;  3V2Y A;  4EKS A;  1L65 A;  1CV0 A;  163L A;  1XJT A;  1QS9 A;  3DN2 A;  2KIV A;  3BS5 A;  237L A;  103L A;  158L A;  221L A;  1L83 A;  1L40 A;  1LYG A;  4DJH A;  1L54 A;  1CU2 A;  2O4W A;  1B0X A;  2QAR A;  183L A;  1XEP A;  3SBA A;  1C6F A;  118L A;  1C62 A;  2E8P A;  4EXM A;  3DMV A;  1L37 A;  1QSQ A;  171L A;  1P36 A;  1PQJ A;  2OU0 X;  2RAZ X;  3SN6 R;  1OW5 A;  2EAO A;  236L A;  3G3X A;  218L A;  2KMD A;  2EAM A;  3UON A;  1P7S A;  3HTF A;  2D8C A;  206L A;  1L28 A;  1LKY B;  2EAN A;  3HDE A;  3NY8 A;  4I7K A;  1KW4 A;  175L A;  1C6T A;  1L06 A;  1CU6 A;  4OO9 A;  140L A;  1P2R A;  252L A;  2OTZ X;  1COK A;  226L A;  4ZPU A;  4E97 A;  2L5Y A;  3SB9 A;  2OU8 A;  1KY0 A;  217L A;  4I7P A;  4MHV A;  1QTV A;  3SB6 A;  3C7Y A;  4K5Y A;  1EPY A;  1L63 A;  1L36 A;  1OV7 A;  2RAY X;  1QTD A;  2Q9E A;  1L48 A;  228L A;  2CUU A;  1C6D A;  1JTN A;  230L A;  2E8N A;  1QT6 A;  2Y9T A;  2DL0 A;  5JTI A;  1C6E A;  3HU8 A;  1D3M A;  215L A;  2LZM A;  2RBR A;  3SB7 A;  2B75 A;  5LZM A;  1CUP A;  1L13 A;  1PQK A;  201L A;  2F44 A;  1KW5 A;  1SGG A;  3VW7 A;  1CV3 A;  3GUM A;  159L A;  1C6H A;  3HT8 A;  2ANV A;  3SB8 A;  4GBR B;  2QB0 A;  167L A;  1C61 A;  1SXD A;  3C7Z A;  3CDV A;  2KSO B;  1L66 A;  3JR6 A;  1B4F A;  1L17 A;  3HIL A;  3OE6 A;  128L A;  1L44 A;  185L A;  1DYG A;  126L A;  1L97 A;  1C60 A;  3QAK A;  1OVJ A;  1JTM A;  2B6X A;  5JRT A;  7LZM A; 
#chains in the Genus database with same CATH topology
 257L A;  1NJX A;  1L56 A;  1L60 A;  6LYT A;  2ZJ8 A;  2PI5 A;  1C6K A;  1YZ7 A;  160L A;  4ZFP A;  3CRX A;  1X40 A;  2ZTE A;  1CKD A;  4RQ7 A;  1L71 A;  2HBJ A;  4QZA A;  4RNN A;  3RT5 X;  5ALP A;  5FDJ A;  2LCB A;  3C2K A;  1ZJM A;  2W9M A;  2ZIU B;  1F6S A;  4R0F A;  2KFN A;  1C45 A;  2FJ6 A;  4OO1 J;  1D9F A;  4N1C C;  3IM1 A;  1X66 A;  1Z55 A;  2KTQ A;  1UIA A;  1K5O A;  2OWO A;  3MDA A;  155L A;  1C6I A;  2IFF Y;  4I7M A;  147L A;  4GC7 A;  1KDH A;  1QUO A;  3BZC A;  3WXU A;  1QQY A;  5I53 A;  2BQD A;  1ZET A;  4OD0 A;  4C5F A;  1L04 A;  5AKJ A;  5AMY A;  2NRW A;  1C63 A;  4H8Y A;  3K2R A;  2IOH A;  4R6C A;  3CSQ A;  2C22 A;  1KEJ A;  1HER A;  260L A;  4MF8 A;  2BQK A;  3QUB A;  1L90 A;  2EQY A;  4WM2 A;  2Y9U A;  1L23 A;  1L07 A;  4OJL A;  4AXT A;  2XVT A;  1LHI A;  4NGW A;  2C28 A;  3WK9 A;  2BCR A;  3S6J A;  4DOB A;  3SEN A;  4HSF A;  4CF4 A;  3EBA B;  2VAN A;  5HQ1 A;  1YAQ A;  1L11 A;  2XGQ A;  4PGQ A;  2HOI A;  4DSK A;  4GFJ A;  1CJ9 A;  3HBH A;  1TEW A;  1SZH A;  4W54 A;  4N8Z A;  1LPI A;  1UCV A;  4Z6F A;  1L31 A;  4OWB A;  4BUG A;  1JUD A;  2XO7 A;  1JKB A;  1YKX X;  4WM3 A;  4YEO A;  2UVV A;  4EKR A;  1LJJ A;  1S0M A;  4O0I A;  3IG8 A;  3UMB A;  258L A;  2HHU A;  2EH9 A;  5B1F A;  4NWH A;  3TXK A;  5IIM A;  4LDL A;  1DI4 A;  1SV4 A;  3UQ2 A;  1OUA A;  156L A;  7ICG A;  1VED A;  4K4H A;  4OWC A;  5III A;  5KFO A;  3EZ5 A;  3SD7 A;  1L01 A;  5HHH A;  3PR4 A;  3ZD9 A;  2Y8P A;  4B4E A;  1LYZ A;  4OJ5 A;  2RBS A;  3RJI A;  4DFD A;  1LCN A;  1L46 A;  4QIW C;  1N60 A;  4EX6 A;  1LGU A;  3QX7 A;  1B5Y A;  1KW7 A;  5C0Y A;  5LAF A;  4NWI A;  4KLT A;  1VDV A;  8ICX A;  1L25 A;  4F50 A;  2BPG A;  1L12 A;  251L A;  5AKI A;  1CEZ A;  4HJY A;  2O79 A;  8ICL A;  2HED A;  4JV2 A;  1DKJ A;  4WL6 A;  1L33 A;  3F5E A;  1IC4 Y;  4J03 A;  3MGI A;  1L64 A;  3ATO A;  4NSG A;  3WXT A;  1X9S A;  4LGK A;  145L A;  1D0K A;  3PR5 B;  2RB2 X;  4ED3 A;  4X3B A;  1IWV A;  5L1I A;  138L A;  2BLY A;  1DYD A;  2NV3 A;  4QZE A;  2LYZ A;  4GCF A;  4I0C A;  3DMZ A;  1B9O A;  2QB0 B;  1CU3 A;  3FDS A;  5E79 U;  4PH5 A;  3C8R A;  1N56 A;  1GAY A;  3RBD A;  1JHL A;  1DXS A;  4R8U B;  1EL1 A;  2HDO A;  2QAR B;  2BQM A;  5KG0 A;  1REZ A;  2E3T A;  1KFD A;  4LZD A;  5AHX A;  5J0Q A;  2OE9 X;  1T4G A;  4F8R A;  4KMU A;  1K28 A;  3A6B Y;  2B6G A;  2XCA A;  4DFM A;  1GF0 A;  3H4D A;  3QU5 A;  5B05 A;  3H40 A;  2Z7J A;  4I2A A;  1NKH A;  1YAO A;  1I56 A;  198L A;  2K4I A;  2GO7 A;  2JEG A;  3AZ7 A;  2W11 A;  5KFH A;  1L7O A;  4XEN A;  5KG3 A;  3RRG A;  8ICT A;  1CKH A;  5B59 A;  1L62 A;  213L A;  3HH3 A;  4TUS A;  2C2R A;  1L7M A;  1IR9 A;  5A0L A;  5AI8 A;  1OUJ A;  2YBH A;  1CV6 A;  2RH1 A;  4DFP A;  4DQR A;  4C3W A;  2MUT A;  4F5N A;  4ECR A;  3T3F A;  3TXF A;  4UW9 A;  2HOQ A;  5D49 A;  5K4L A;  1F10 A;  3FI5 A;  2YVB A;  4NG8 A;  7ICF A;  1REY A;  3W6B A;  2G5H B;  1N4F A;  9ICN A;  1BGI A;  3TI0 A;  2EPE A;  2DF4 B;  1IP5 A;  4CDG A;  4PPO A;  2QKQ A;  1IR7 A;  5LA5 A;  4FZN A;  3M9N B;  239L A;  2D4J A;  2DQG Y;  150L A;  1LZ8 A;  4QGZ A;  3TQ1 A;  1V7S A;  3ICX A;  3WK4 A;  1L00 A;  2ZIJ A;  3C80 A;  2MEE A;  3KHL A;  1CU0 A;  1CJ6 A;  1O03 A;  1L22 A;  3OGU A;  4R63 A;  3OHA A;  1BVX A;  4YXJ A;  1CVK A;  1KXW A;  5KFT A;  4H92 A;  1NKC A;  1RZT A;  1NK0 A;  2K4E A;  5KFB A;  4Z98 A;  4ED6 A;  1UQV A;  1TLA A;  2HU3 A;  7ICJ A;  1BB6 A;  3LYO A;  3MFI A;  3N9A A;  1S0N A;  2F8K A;  4ARL A;  3SQI A;  1IOS A;  2AQ0 A;  2D4I A;  2Z6B A;  3WKC A;  1G0K A;  2YBL A;  3WK5 A;  1BNO A;  4C4R A;  1L59 A;  2KKP A;  3D6J A;  5KFU A;  1L89 A;  1ZQB A;  4DS5 A;  4HAI A;  219L A;  1QDT A;  4OWE A;  5DBB A;  4YXA C;  1L10 A;  3IP4 B;  4DD3 A;  4KLI A;  4DSE A;  4F2S A;  111L A;  3OK0 A;  1L7N A;  2PFN A;  1LJN A;  4EYH B;  1B7O A;  2AH5 A;  4DS4 A;  5C5J A;  184L A;  3Q8M A;  1ZQF A;  2NRX A;  4TTD A;  5F9N A;  3SZ2 A;  3HWL A;  2XC9 A;  1X6J A;  4RQ5 A;  5KL1 B;  1JN3 A;  2BCV A;  247L A;  3DV9 A;  2HHQ A;  2LZT A;  4QZC A;  4OW1 A;  3ZVQ B;  3QU4 A;  4P0Q B;  1VFB C;  5HR7 A;  2OHF A;  1WWV A;  2ASL A;  1BPX A;  2HW3 A;  4J0L A;  3FM9 A;  1C6C A;  5AK6 A;  1CJ7 A;  1RG6 A;  5F9U A;  3RRH A;  2IMW P;  5KXW A;  3A67 Y;  1GB2 A;  2B6T A;  4NHT A;  1RM6 C;  5KFX A;  4IR9 A;  1CJ8 A;  3FA0 A;  4M6W A;  1MQ2 A;  2G0A A;  1LHM A;  2VA8 A;  2J6T A;  1ZUR A;  2RBQ A;  3RR8 A;  5HMM A;  4IRK A;  2HBK A;  5LVH A;  5GTI U;  4NL9 A;  1XGT C;  2G4N A;  5L3I A;  2ISP A;  3J6K A;  3PO4 A;  1LZA A;  5EE1 A;  4Q8F A;  1BPZ A;  197L A;  5TIS U;  3MGW A;  3AQE A;  1X9X A;  3PW5 A;  1YL0 X;  4ARQ A;  9ICI A;  4DOA A;  4RUC A;  4ECY A;  1L99 A;  1FFU A;  8ICI A;  1KFS A;  1L20 A;  1JIS A;  4CCH A;  1JAL A;  3A94 A;  5EBH A;  4F4W A;  1ZYQ A;  1RYU A;  1PVR A;  5ALS A;  3OE0 A;  1C10 A;  2RB1 X;  4B9T A;  4ARJ A;  5KXM A;  1V38 A;  1JKD A;  3CDO A;  2AGO A;  1LSA A;  3HFM Y;  1SIJ A;  1LMQ A;  1QQ5 A;  2H3Z A;  5LIN A;  1D6P A;  2A4T A;  1C6Q A;  2A1J A;  1Z4O A;  122L A;  2LMR A;  1LW9 A;  5JU5 A;  137L A;  5KJ9 A;  2KE7 A;  3WUA A;  4EBE A;  1TDY A;  3W6C A;  4DD0 A;  1OUE A;  1PVQ A;  2W54 A;  2KJ8 A;  4CF3 A;  2KK0 A;  1GEZ A;  3PST A;  4HTK A;  1LHJ A;  2LYH A;  4IRC A;  4J9Q A;  169L A;  123L A;  1NDM C;  3DN3 A;  5J8Y C;  1B7Q A;  1JTT L;  2WF7 A;  4YXC A;  1SSY A;  2OYY A;  1GF6 A;  4EYI B;  234L A;  4YMM A;  4UAW A;  4XA5 A;  4F72 A;  1IP7 A;  1L75 A;  2H3Q A;  4ARP A;  1UA6 Y;  3TXB A;  2FPK A;  3RU5 A;  1L52 A;  4ET8 A;  2ZIK A;  2ZIU A;  4NSJ A;  2NRV A;  3L64 A;  2YMM A;  5DQG A;  3GII A;  2LZ2 A;  1QSB A;  3ISB A;  3ZDB A;  2ESE A;  1IX0 A;  5KXN A;  4L41 A;  2DQD Y;  2FLN A;  2YBN A;  3UXO A;  168L A;  5AK5 A;  4DQP A;  4GRV A;  3K1Z A;  1T6H A;  1IR8 A;  2A1A A;  1ZQD A;  2F8L A;  1S0O A;  1XU4 A;  4ACO A;  1ZQ1 C;  1C67 A;  3CW2 C;  4KN7 A;  1FKV A;  1L87 A;  1XEI A;  1LPY A;  1HEL A;  3ORY A;  5J0W A;  4H91 A;  1U4B A;  7ICT A;  2W04 A;  3WU8 A;  2Q0M X;  4F71 A;  199L A;  3C1Y A;  3WUM A;  2Z2E A;  7ICV A;  5KFM A;  1C6N A;  4LT2 A;  1L77 A;  2AQ4 A;  5L1K A;  4YP3 A;  3QEA Z;  2GH1 A;  1L82 A;  3T5K A;  2G4P A;  5APF A;  3VCB A;  1TVA A;  1HEP A;  5DGB A;  1T8E A;  4H8X A;  4FE3 A;  222L A;  235L A;  3DN6 A;  3V2Y A;  2CXY A;  5FCP A;  163L A;  5KXY A;  1QS9 A;  3QNM A;  9ICU A;  103L A;  4FFD A;  4J9R A;  2D6F C;  1ZD2 P;  2LM1 A;  3EO5 A;  1LJ4 A;  3B0O A;  4HP0 A;  4H9H A;  8ICF A;  2F76 X;  3AB6 A;  5F81 A;  3MR2 A;  118L A;  1C62 A;  2R8G A;  2HOF A;  2E8P A;  2YBM A;  9ICL A;  3DMV A;  171L A;  1LMO A;  3ZD8 A;  4LJX A;  2OU0 X;  3IG5 A;  3L5K A;  1L3S A;  2HEC A;  2YSS C;  4WL7 A;  1DI3 A;  4HTN A;  1WQM A;  1AT5 A;  2HBL A;  1GF3 A;  4Q43 A;  3SN6 R;  2Z19 A;  5CRX A;  9ICX A;  4HJV A;  3A96 A;  1ZQC A;  2CGI A;  8ICM A;  4C80 A;  1GE3 A;  2XBR A;  2ZIV A;  3B72 A;  3LVW A;  3SR6 A;  1Z3E B;  4J9N A;  5HHI A;  1L28 A;  3HDE A;  2KD1 A;  3IV6 A;  8ICJ A;  1XFP L;  1KW4 A;  3NY8 A;  4IQV A;  5ALN A;  2KZ3 A;  4OO9 A;  140L A;  252L A;  5AM2 A;  1A2Y C;  2OTZ X;  3RW8 A;  2UVU A;  226L A;  1K1S A;  3ZDA A;  2BQI A;  5KTQ A;  217L A;  1YL1 X;  1PZN A;  1F5S A;  1L6N A;  5ALU A;  1IWU A;  132L A;  4Y2U A;  5DKW A;  4O5C A;  2H3F A;  1SWW A;  2NO5 A;  1ZQL A;  228L A;  1GFA A;  1G7M C;  3AW6 A;  2E8N A;  4QZ9 A;  3B9J A;  2OEH A;  1HC0 A;  5JTI A;  4QZI A;  2MEI A;  1C7P A;  3HU8 A;  5DN4 A;  4UAT A;  3H8S A;  1DK3 A;  215L A;  2LZM A;  1NF5 A;  3SB7 A;  1DGS A;  2B75 A;  1SKW A;  5LZM A;  1HEN A;  201L A;  5KFA A;  2J6U A;  1JTO L;  3N7P D;  1KW5 A;  4NHI A;  4WLD A;  4B9M A;  2MU2 A;  2BAA A;  4ZIX A;  4PL1 A;  3F53 A;  2BQU A;  1QTM A;  1C6H A;  4CNQ A;  5KFF A;  1UAC Y;  2ANV A;  5DL9 A;  1N63 A;  5T3F A;  2KSO B;  1KN5 A;  1J2M A;  2H5Z A;  4IQW A;  1QUS A;  1X9W A;  1ZD5 A;  2MED A;  3OSN A;  1A4V A;  4LYT A;  4PHI A;  1YQV Y;  1LSB A;  1GDX A;  4KXI A;  126L A;  5KT3 A;  1X9M A;  2C8P A;  1JTM A;  5J2G A;  3AZ6 A;  3KD3 A;  2HEF A;  4NLG A;  4DSF A;  1TKD A;  1QUT A;  5C6J A;  3B6L A;  2WAR A;  1OWZ A;  2ZTD A;  5F16 A;  3I1Y A;  4PHE A;  1I20 A;  1WYG A;  2AJQ A;  5A3Z A;  3KHH A;  1L67 A;  2I9G A;  3CB7 A;  4M47 A;  1W08 A;  5J2H A;  2ZYC A;  2DPI A;  3WPK A;  1IEE A;  3RH5 A;  4FZL A;  1LSP A;  3NVY A;  1L38 A;  3C82 A;  4DT3 A;  1ECW A;  1A76 A;  4RQM A;  2KFZ A;  3ODU A;  1HFX A;  6LYZ A;  1KNI A;  1QT3 A;  1LSE A;  4PHA A;  1L74 A;  3BQ2 A;  1IP1 A;  1XNS A;  4DC4 A;  4Y2T A;  4DQQ A;  3RZ4 A;  2ASD A;  1JJ1 A;  4MF2 A;  1ZQS A;  1IO5 A;  4YEN A;  5AKZ A;  3M3U A;  3A91 A;  1L0J A;  178L A;  3HT3 A;  1L72 A;  1YAP A;  3GUO A;  1L0K A;  4EKP A;  4F4Z A;  2BQF A;  4YX7 C;  1IXR A;  1SQ2 L;  5J0X A;  8ICP A;  1L94 A;  3AMZ A;  5BOM A;  192L A;  1L88 A;  1ZQQ A;  4G4C A;  4C8O A;  1BGX T;  4UQG A;  1G0P A;  1KIQ C;  1C69 A;  4X5V A;  5L9J A;  4XJG A;  4PK0 A;  3KAM A;  3MAB A;  2KVS A;  3H0M B;  5KG7 A;  2DKV A;  3TXJ A;  1CRX A;  3KOO A;  3EW9 A;  4M9N A;  4DEZ A;  5ALV A;  4ECX A;  5DLF A;  1ZMY L;  3WPJ A;  4NWE A;  1S5L U;  120L A;  1DYA A;  3HJE A;  4E0D A;  2KHQ A;  1LGW A;  4LDE A;  3W6D A;  2DKZ A;  2X0A A;  5J7C A;  1KKX A;  1L76 A;  3G6Y A;  1IIP A;  1HMK A;  1GXX A;  2WF9 A;  4EBC A;  2KIC A;  5AK3 A;  3GIJ A;  5HML A;  1L80 A;  212L A;  8ICN A;  153L A;  4FO6 A;  4MEX A;  4KLG A;  3N9C A;  1T97 A;  5DB6 A;  1WQN A;  211L A;  4DL4 A;  143L A;  1LZ1 A;  1QT8 A;  5KXL A;  172L A;  5AIC A;  2RQ5 A;  1SWV A;  2L78 A;  1L14 A;  1L79 A;  2FBB A;  1ZWN A;  4Z41 A;  1L81 A;  1L73 A;  157L A;  1Z00 A;  8ICQ A;  186L A;  1L09 A;  1IWZ A;  1OUB A;  5JEN B;  3SAH A;  1ZQN A;  2JV3 A;  4BXO B;  3TKA A;  4H93 A;  5B07 A;  255L A;  3UMG A;  2WAQ C;  3JPP A;  1P3N A;  177L A;  1XSN A;  1VDS A;  2WF6 A;  4J9O A;  1AT6 A;  1XEJ A;  4RU9 A;  1U48 A;  4O5K A;  1GWD A;  1C6A A;  2Q4T A;  3SI8 A;  4PJ2 C;  1LJG A;  4RQ8 A;  4TUP A;  5AKE A;  4G3I A;  5ILC A;  1V7T A;  1SL0 A;  2G5I B;  1F0W A;  2A7F A;  5J2C A;  3QU2 A;  3LK9 A;  3LYS A;  1RYS A;  3C7W A;  4UB8 U;  4U6P A;  1SZP A;  2WB1 C;  1C6M A;  2HEE A;  1Q46 A;  4G9B A;  4BWJ A;  4IRD A;  1DRG A;  2ZUD A;  3DKE X;  3QU7 A;  1IP2 A;  4B9V A;  1L93 A;  3T5H A;  1NHE A;  2QLT A;  1LSM A;  1LOZ A;  1NWG A;  3UQ0 A;  3F8V A;  4DQI A;  5KXT A;  2Q0Z X;  4I2D A;  3PV8 A;  2H3V A;  3WKD A;  4KTQ A;  1L39 A;  4DFJ A;  2W03 A;  1NQI A;  4DLE A;  1P46 A;  5J2B A;  3N97 B;  4PGY A;  2KEY A;  1LMA A;  5BOL A;  3T6U A;  1ZD4 A;  1ARO P;  2EAP A;  1XGP C;  5E9R A;  2MA1 A;  3RAQ A;  3TXE A;  1V9P A;  2ZG6 A;  4NM1 A;  1L35 A;  2ZNW Y;  1TAM A;  4W52 A;  4O3S A;  1LSC A;  2CWI A;  5J2I A;  4R65 A;  3TAC B;  3WK6 A;  4P4M A;  4YD1 A;  1FLU A;  1SL1 A;  3B0K A;  1JMS A;  1L27 A;  1LZN A;  1NOM A;  5KFR A;  4O9M A;  1WVU A;  1X2I A;  3O0F A;  3LHM A;  4TWS A;  4LZM A;  3V72 A;  9ICW A;  1LZB A;  148L E;  4J9K A;  3MC1 A;  2I26 L;  3J81 j;  1TK0 A;  4UWU A;  1GBX A;  1XGR C;  4WM1 A;  1D8Y A;  4YG2 A;  1JKA A;  3HUQ A;  4GLA A;  1G0Q A;  5KG5 A;  3TAD C;  3WK8 A;  4I29 A;  3OJU A;  2BPU A;  1ZQH A;  5KFG A;  1L68 A;  3F2B A;  3NVV A;  1N62 A;  5KY1 A;  3MR5 A;  5B06 A;  1LI2 A;  1A0P A;  3RJG A;  1JTP L;  3NRZ A;  1LWG A;  2F47 A;  3SYZ A;  109L A;  4LFX A;  5J0O A;  2KNJ A;  1U47 A;  214L A;  3E3D A;  249L A;  3C23 A;  1QT7 A;  5KXX A;  5KXK A;  4RPY A;  5ALW A;  3RUN A;  5L9X A;  112L A;  3N7S C;  216L A;  5KG4 A;  2O7A A;  5APE A;  1HUO A;  3D9A C;  2K60 A;  5T14 A;  2HBM A;  3QYP A;  5CEH A;  2W55 A;  1BB4 A;  1QUH A;  3NVW A;  2H3I A;  1J1O Y;  4HPI A;  4WO6 A;  1JI7 A;  1KRP A;  1GE0 A;  1QT4 A;  2OH2 A;  4NGV A;  4H9E A;  3IRU A;  7ICK A;  1BVS A;  1L95 A;  2OE4 X;  1QQ6 A;  1B43 A;  244L A;  4ECU A;  4M04 A;  5ALE A;  3PMN A;  1V85 A;  2HUK A;  5ALK A;  3SP3 A;  1QCK A;  2J6S A;  2P6R A;  1JJ0 A;  4DQJ A;  2K89 A;  2ZYP A;  2IOF A;  1B5W A;  1GFG A;  209L A;  2JZB B;  3TAD A;  1L26 A;  4I2J A;  4ELV A;  1L43 A;  5DG9 A;  4KLS A;  5EE0 A;  4PHD A;  2JRZ A;  1T6V L;  1SX7 A;  2W9B B;  3PX0 A;  4KMO B;  1LJI A;  1LSY A;  4YR3 A;  3BJY A;  1L08 A;  4N0J A;  3QUC A;  4XJI A;  2BCU A;  4RQ1 A;  3ALR A;  4BX9 C;  205L A;  2F3N A;  5HNC A;  1ZQT A;  4WG1 A;  1S77 D;  1H6M A;  4US9 A;  1HEK A;  1TK5 A;  1REX A;  4O5E A;  1QUG A;  1UIC A;  3FE0 A;  4FBT A;  3PSI A;  4LDO A;  2YMQ A;  2KKV A;  1COO A;  4ICA A;  1QSS A;  2ASJ A;  2KZM A;  3LVV A;  2B72 A;  2XY5 A;  5EOZ A;  4M6D A;  2RLT A;  2KG5 A;  1ZVH L;  3ZI4 A;  1ZQY A;  5KFW A;  1HSX A;  1GPQ C;  1AKI A;  1SLY A;  3PW2 A;  3TAQ A;  2VA3 A;  1L15 A;  3MGH A;  4I28 A;  2R8I A;  1RXV A;  2Z12 A;  3H4B A;  5KFP A;  5F3X B;  4XUS A;  1AM7 A;  2O6K A;  1D3N A;  4ECT A;  2XI9 A;  220L A;  4II8 A;  166L A;  3C8S A;  3MR3 A;  188L A;  1RCM A;  3AZ5 A;  1JPO A;  3P66 A;  2W8K A;  5KFE A;  1IOC A;  2NRT A;  3AW7 A;  3HBD A;  1KLN A;  3DN0 A;  2ZIW B;  4DFK A;  5EWG A;  2ZQ4 A;  4YM8 A;  4LYB A;  1BWH A;  3WUN A;  1RPL A;  1L57 A;  2KV2 A;  8ICR A;  2Z39 A;  5LVJ A;  2BQJ A;  4LT3 A;  2FMS A;  2K4H A;  5KT2 A;  1XEK A;  3TMV A;  5AM0 A;  1SSW A;  1L51 A;  2MSN A;  1P6Y A;  5H2F U;  1NK6 A;  1LMN A;  1CX7 A;  2RSC A;  5KXP A;  1LMC A;  9LYZ A;  2MEA A;  3G3A B;  9ICG A;  3M18 B;  4P0Q A;  1GF7 A;  3EUB 2;  3ZVQ A;  1TFR A;  3FI7 A;  1ZOL A;  9ICB A;  8ICG A;  4O34 A;  1S10 A;  1LYJ A;  2LKY A;  3PW4 A;  1HJP A;  4TQR A;  3A34 A;  1PQO A;  4PJZ A;  4UB2 A;  4IS7 A;  3UMC A;  4OOT A;  3PW7 A;  3H8M A;  2WFA A;  4AQN A;  5KFJ A;  4EKQ A;  5KG2 A;  2ZTC A;  1WQR A;  2RB0 X;  4MFF A;  8ICA A;  139L A;  3HUK A;  5B5E U;  1GFJ A;  3PY8 A;  2I25 L;  2FLP A;  4O3O A;  2BQC A;  4GCB A;  2OE7 X;  1L02 A;  1SV0 C;  2W1Y A;  4RQN A;  3LYM A;  1D9W A;  1PQI A;  2KOB A;  4YFK A;  1DXJ A;  3B0Y A;  4BWM A;  7ICU A;  4BXO A;  1BB7 A;  3EML A;  1ZQK A;  3HKZ F;  2ZQ3 A;  1LZ4 A;  1LZD A;  5LYT A;  1CX6 A;  3NY9 A;  2WF5 A;  4RT2 A;  3TMU A;  3G6V A;  1GHL A;  4TUR A;  1IP4 A;  1HEO A;  4W51 A;  1RXW A;  1GB6 A;  4KLD A;  232L A;  3KKA C;  5D4B A;  2HI0 A;  2YML A;  1L41 A;  2IBK A;  1SX2 A;  1JRO A;  3ZDC A;  4W57 A;  1L05 A;  3HTG A;  242L A;  2RBO A;  3UM9 A;  4UWN A;  2AXT U;  2HHS A;  1F6R A;  4J7V A;  4WLY A;  2HEB A;  1G06 A;  3OSP A;  3SV3 A;  2F4G A;  5DN5 A;  3TFS A;  9ICM A;  5FST A;  1XWL A;  4YD2 A;  4KLM A;  1G07 A;  2ZIW A;  3UXP A;  4I7N A;  2MEG A;  1Z4N A;  4UB6 U;  1CV0 A;  1I1Z A;  3NAS A;  1YIK A;  133L A;  4C7Z A;  1IY3 A;  4NGL A;  3ULR A;  1FLW A;  5AM3 A;  4H8Z A;  4I2G A;  193L A;  8LYZ A;  1WG8 A;  2NYV A;  2VIX A;  4XJH A;  4ECS A;  3CNH A;  2BCQ A;  4FS2 A;  1N48 A;  4LYZ A;  1UIG A;  4M0A A;  2O4W A;  1B0X A;  2QAR A;  3PSF A;  3KHG A;  7ICS A;  1C43 A;  1G7I C;  1XEP A;  3QE9 Y;  4P2H A;  4WG7 A;  4A8E A;  4ED7 A;  1IP3 A;  1C6F A;  4EXM A;  4WOA A;  1L37 A;  1QSQ A;  1P36 A;  3C1Z A;  3TXD A;  1BWI A;  1VDP A;  1FO4 A;  3GV7 B;  3ISD A;  2FBD A;  4LFP A;  4EX7 A;  1OW5 A;  1H87 A;  3F2C A;  3KFU F;  218L A;  1EXN A;  2KMD A;  3H8J A;  4YR0 A;  1HSW A;  3UON A;  1ZQO A;  1S8O A;  4R8U A;  3IWR A;  3Q8R B;  4LZG A;  2F1I A;  4I7K A;  1L06 A;  9ICP A;  1NJY A;  4QWC A;  4XYY A;  3D2N A;  2N1R A;  1SKR A;  1ZQG A;  2BQO A;  4DSL A;  5CWR A;  2JZB A;  4KLJ A;  2DGZ A;  1KY0 A;  3NRW A;  4CGE A;  4DWX A;  4I7P A;  4MHV A;  3E58 A;  3GDX A;  2CJL A;  3OPX A;  3AUO A;  2DQH Y;  1LZ6 A;  4MST A;  5ILF A;  3BQ0 A;  1LZS A;  2JEJ A;  1YT3 A;  2CDS A;  1GF8 A;  2RAY X;  3CQL A;  2DQE Y;  2K8C B;  1L48 A;  3WKB A;  2W3S A;  1JTN A;  230L A;  8ICU A;  3CT0 A;  4NV0 A;  1VAT A;  1GB7 A;  2K8A A;  1T94 A;  1YAN A;  4XQ8 A;  1D3M A;  1JJ3 A;  2RBR A;  1ZQW A;  4OOO A;  1PQK A;  1L8O A;  4G49 A;  2HVI A;  2E5S A;  4DD7 A;  1GFK A;  2ATL A;  3VW7 A;  5KXZ A;  1UUZ C;  4DWI A;  1LYO A;  3HT8 A;  1J1P Y;  4B4I A;  3TAN A;  2CN1 A;  3TMX A;  4GBR B;  3IN5 A;  1SXD A;  3CDV A;  5ALX A;  3JR6 A;  3LWL A;  5I4X A;  3UXN A;  1B4F A;  2HTX A;  3W6E A;  2R8J A;  1C46 A;  1L17 A;  4US8 A;  4GXJ A;  128L A;  4WO9 A;  3JPS A;  3A6C Y;  1GBO A;  3WU2 U;  2KIW A;  4DL5 A;  7ICI A;  185L A;  1WUD A;  3RB0 A;  3T5L A;  1QSY A;  4M9L A;  1JXL A;  3QAK A;  2ZNX Y;  2HHX A;  4RQ6 A;  3GIM A;  3RAX A;  2FLL A;  3D4S A;  4RPZ A;  146L A;  3ONN A;  5DDY A;  1D8B A;  5I4W A;  4GIB A;  3SBB C;  1WCN A;  1LWK A;  1B7N A;  2OU9 A;  2EZX A;  261L A;  4GLX A;  4DOC A;  4TQS A;  9ICK A;  1GF5 A;  5DLA A;  5KAF U;  4F4X A;  2D6B A;  2K8B B;  4I7S A;  1MN8 A;  223L A;  2N5Z A;  2FE9 A;  1NKB A;  1DGJ A;  1C66 A;  210L A;  4XRH A;  1HNL A;  2HUM A;  3CDR A;  4LZT A;  2I6X A;  2CRX A;  1LJH A;  4UAU A;  1CTW A;  1REM A;  2ZIV B;  1GBY A;  1LZC A;  3F5A A;  4M9G A;  1GB0 A;  3HX0 A;  2FYC A;  5DB9 A;  1GFE A;  262L A;  2XJW A;  4B0D A;  1UA1 A;  4EEY A;  3AU2 A;  3B0I A;  1D3J A;  2PKE A;  7ICQ A;  2NRZ A;  1QSW A;  152L A;  1VJ5 A;  1L5U A;  4I7T A;  1PK1 B;  2DWQ A;  9ICQ A;  1L45 A;  4PRU A;  3GU3 A;  2W7P A;  4WMG A;  4ANR A;  1IVM A;  1QTC A;  4KX3 A;  2HHT A;  3D2S A;  1HML A;  3A0H U;  1SWY A;  3H7I A;  1KBU A;  1ZQX A;  3QU9 A;  5LVI A;  5IIK A;  4JV1 A;  8ICK A;  2Z38 A;  5KT5 A;  1UHU A;  4KN4 A;  1JKC A;  3WH1 A;  3K3T A;  4ARM A;  5IDD A;  1HF4 A;  5ALF A;  1LZY A;  9ICO A;  1DPW A;  1LJF A;  4HV2 A;  2EQL A;  3QXG A;  3GUI A;  5AI6 A;  1LGX A;  1CKG A;  2Y0S C;  3BKH A;  4ED8 A;  1LSN A;  3RZE A;  4ETC A;  1KXX A;  194L A;  4YOP A;  1WQO A;  2DQI Y;  1TAQ A;  4C4S A;  3BQ7 A;  3M7D A;  4NGJ A;  1LYD A;  3DN1 A;  1P2L A;  3HPO A;  2W9B A;  4J9P A;  1GAZ A;  4DL6 A;  1L55 A;  3RJE A;  3QE8 A;  1NBY C;  4W53 A;  3RF9 A;  1ZQM A;  2M0N A;  1OP9 B;  2DKX A;  2YB1 A;  4IJ4 A;  1CI4 A;  1VDT A;  3AYQ A;  1JEF A;  3L4P A;  1DYC A;  5ALM A;  3G6X A;  1QSL A;  1UC0 A;  1L21 A;  2EZY A;  2G4Q A;  1T3P A;  3WK7 A;  2MEC A;  5AM1 A;  2ZXI A;  2HHV A;  3ETL A;  1GFV A;  1I6S A;  4LYO A;  4UB3 A;  3T79 A;  2M9N A;  3MFH A;  2EKS C;  3BKV A;  5EE9 A;  4DDB A;  173L A;  3BS7 A;  4QWB A;  4GCC A;  5D5C A;  5ALD A;  1VDQ A;  4UAV A;  4DD1 A;  3M9M B;  1QSA A;  1DPX A;  6LZM A;  3NGD A;  2Y1J A;  1GFR A;  5AI4 A;  1RE2 A;  4DAJ A;  1IWW A;  1XGU C;  3LZM A;  2W8L A;  1NJZ A;  1OWY A;  1QTE A;  3OE9 A;  2ZJA A;  3HDF A;  2P6U A;  1LMT A;  1GBW A;  189L A;  1CV4 A;  5B1G A;  2V9W A;  4NIJ A;  4EMN A;  4KL7 A;  3V6K A;  2H9J A;  4YCX A;  3TFR A;  3IHQ B;  2PMZ F;  4H90 A;  1QTK A;  2NO4 A;  1IM4 A;  4CJ2 A;  1L8L A;  2HVH A;  4HV1 A;  5KT4 A;  134L A;  1E8L A;  2YN4 A;  1GBS A;  240L A;  4AGA A;  5M1Y A;  2DUY A;  1TAY A;  1LKY A;  4Z6E A;  8ICO A;  1JUG A;  1QUD A;  5I4Y A;  2KVC A;  7ICP A;  3IJU A;  4I2F A;  4GCE A;  1OXJ A;  1B5X A;  174L A;  151L A;  4E3U A;  4GXI A;  1N61 A;  4IQU A;  1UIF A;  2GLE A;  1N5W A;  2RP5 A;  1LB2 B;  2JEI A;  2DQA A;  1OUI A;  5LYZ A;  4RPX A;  2LYM A;  4ED2 A;  2HU1 A;  3N9E A;  1AQ6 A;  2XIC A;  3HUA A;  2LPE A;  108L A;  2ZUC A;  3C5G A;  5KT7 A;  9ICR A;  5ALY A;  3SEI A;  4QZG A;  1IOR A;  3C83 A;  2AU0 A;  5J0T A;  2E1F A;  1GF4 A;  3M6Z A;  3RBE A;  4JK1 A;  3DN8 A;  1DQJ C;  3P65 A;  3RJJ A;  1QLN A;  1VLB A;  3N7R C;  1KY1 A;  1JIH A;  4RUA A;  1LHH A;  2MEF A;  1B7M A;  2R8K A;  5KFD A;  5CA7 A;  224L A;  4JMU A;  1C6J A;  1L03 A;  2IHL A;  2B6Y A;  1TCY A;  2MEH A;  3HTD A;  196L A;  5FEK A;  2E8M A;  2B73 A;  4LVS A;  3V6H A;  4KLH A;  4M6W B;  1U49 A;  1Z19 A;  2BDU A;  1CV5 A;  1OUD A;  3HTB A;  4ARM B;  4B1A A;  2I1Q A;  4DF4 A;  5KL8 B;  4NJ8 A;  3HH6 A;  2F2N A;  4YMO A;  4QW9 A;  2C8O A;  2BKE A;  1G0J A;  1LKR A;  1NZB A;  3LZT A;  3D3D A;  5J2D A;  1HEM A;  4GC6 A;  1URJ A;  229L A;  5J2J A;  1NNL A;  3TAR A;  2W3R A;  1D3F A;  1P64 A;  2VKQ A;  3A0B U;  4QNL A;  3R9K A;  2XCP A;  3GV8 B;  4ELT A;  3AL0 B;  9ICV A;  4DSJ A;  1WQP A;  4H9F A;  1RQL A;  4EZ9 A;  1L70 A;  1D2W A;  2KSO A;  3C28 A;  3LWM A;  125L A;  3I28 A;  5KNI A;  4F5O A;  1LHK A;  3LZ2 A;  4I7R A;  1PK3 A;  3T5J A;  4UB5 A;  3N28 A;  5E4P A;  4QEQ A;  2KJ5 A;  1G7J C;  1FEZ A;  4CE6 A;  5C6I A;  4Y2X A;  9ICT A;  4O3Q A;  3NYA A;  1T8G A;  2KP7 A;  2D4K A;  4Z3M A;  5J0Y A;  1L91 A;  4IC9 A;  1GFH A;  2XY6 A;  1D9D A;  1X42 A;  2XTH A;  4AYB C;  2E8O A;  4PGX A;  4IL6 U;  2XQO A;  4QIW F;  4S0W A;  4RQ4 A;  1LYE A;  4CFO A;  2JGA A;  2Z2F A;  5KFN A;  115L A;  3GIL A;  4NSH A;  2KJ9 A;  3AQF A;  3TXI A;  1O08 A;  1JX4 A;  4GN5 C;  114L A;  2F2Q A;  5AIA A;  4WJ3 B;  7ICN A;  142L A;  2F4A A;  2IA6 A;  2ZXH A;  4RLM A;  1AZF A;  2ODG A;  4O3P A;  4QWE A;  4KX5 A;  3MDC A;  4KLU A;  3JPT A;  9ICJ A;  3E2E A;  144L A;  1A77 A;  4ETB A;  4QZH A;  2ISO A;  2B5Z A;  104L A;  1LYF A;  2BQL A;  4GN4 A;  1RFP A;  5ALG A;  3TMW A;  9ICS A;  1UIH A;  1L16 A;  3QEB Z;  5ALO A;  1XO1 A;  3PBL A;  1FLY A;  7ICL A;  1GE4 A;  1KIP C;  5AI5 A;  5J0P A;  1BWJ A;  1JSF A;  3M6K A;  5ALR A;  180L A;  4P4P A;  2NTG A;  1BPY A;  2FPL A;  4BGD A;  5G5G A;  1GFU A;  1VAU A;  1OV5 A;  4I7O A;  1GE2 A;  2MUT B;  1CUK A;  1DYE A;  1NK4 A;  3H8W A;  3HBE X;  4RQ0 A;  2R18 A;  3V7L A;  3LYZ A;  1V97 A;  1BPD A;  1L49 A;  4EPI A;  1S0V A;  1IP6 A;  149L A;  3W6A A;  4QY9 A;  3SAG A;  1QQ7 A;  2JXJ A;  4WM4 A;  4OCZ A;  5J2K A;  5LAG A;  2BQ3 A;  3RH6 A;  4ETD A;  2P66 A;  4D9Z A;  1P2C C;  1G1V A;  2FMP A;  110L A;  4CRX A;  4W96 A;  4YR2 A;  2BQH A;  1G7H C;  200L A;  2IHM A;  1IWT A;  2DQC Y;  3HP6 A;  1HIW A;  8ICB A;  5DDM A;  2A3V A;  4EBD A;  2B70 A;  2VB1 A;  4LT0 A;  1WTH A;  4Z6D A;  2GWS A;  154L A;  1DI5 A;  1HHL A;  3WW5 A;  4Z46 A;  243L A;  1L18 A;  1L92 A;  3GUL A;  4F5R A;  3ATN A;  1DYF A;  4ZEE A;  1NK7 A;  1UBZ A;  3ED5 A;  161L A;  1FN5 A;  3K75 D;  3GXK A;  4ARQ B;  1ZJN A;  1LYH A;  3EWA A;  1PK1 A;  2W1M A;  191L A;  238L A;  3GV5 B;  9ICC A;  3PW0 A;  4JB3 A;  130L A;  4HJZ A;  2RDJ A;  3RB3 A;  3ZDE A;  1JWR A;  4DD2 A;  2B7X A;  4ML7 A;  2LBO A;  1P56 A;  4NHQ A;  4PGJ B;  3SMV A;  2NTH A;  164L A;  3F2D A;  3V6J A;  3WL2 A;  3A3R X;  5AKK A;  8ICW A;  2R8H A;  3MBY A;  3AN1 A;  2W9C A;  1FKQ A;  4IR1 A;  5DQI A;  1KL9 A;  1XJU A;  1L96 A;  5AKX A;  2PI4 A;  1LZ5 A;  3CDT A;  1QT5 A;  246L A;  2Z37 A;  3JPN A;  4DO9 A;  1LSZ A;  4N1E I;  4F91 B;  1LSF A;  254L A;  2ZJ5 A;  5KFS A;  3HH5 A;  1EQ5 A;  5KFQ A;  1D8L A;  3D2Q A;  3RJH A;  3GUK A;  5I5Q A;  1L24 A;  2F30 A;  5CHG A;  3SV4 A;  4ECZ A;  4YEM A;  1QTB A;  4ELU A;  5CJ7 A;  5HP4 A;  3RB4 A;  4KLL A;  4LYM A;  4CGZ A;  8ICH A;  4RNM A;  4Y2R A;  113L A;  2B6Z A;  2W1L A;  1B22 A;  2BQG A;  3RB6 A;  1IIZ A;  1LJE A;  2VJ4 A;  2BLX A;  4C8L A;  4F3O A;  1ZQR A;  4NGK A;  2GV0 A;  1QDR A;  1LV5 A;  3DN2 A;  4USA A;  2KIV A;  4P4O A;  3U26 A;  4R66 A;  237L A;  2JH1 A;  1GB5 A;  3WKA A;  1ZVY B;  1BHZ A;  1L83 A;  1LYG A;  4NGZ A;  4FS1 A;  1L54 A;  3QZ8 A;  5F9L A;  1B7P A;  1CU2 A;  4XJB A;  1LJ3 A;  1FLQ A;  208L A;  1LAA A;  4O3N A;  1PVP A;  1Q3V A;  4Q8E A;  4ED1 A;  3HKZ C;  1IV8 A;  1OUQ A;  2NWD X;  1LZT A;  3C29 A;  2WTF A;  4DL7 A;  2I6Z A;  2EDU A;  4UBB A;  3AGI A;  3E0F A;  1NJW A;  4G4B A;  3G3X A;  1YAM A;  4I2E A;  4OJP A;  1FIQ A;  1XGQ C;  4MEY A;  2FPM A;  3BQT A;  2EAM A;  1XSP A;  2KN7 A;  1KIR C;  4FJR A;  3PSP A;  4KLQ A;  3HTF A;  1JXE A;  5IIO A;  1OUG A;  206L A;  2EAN A;  2LI6 A;  3M9O B;  4QZB A;  4UWV A;  4H1P A;  3CP8 A;  1RDF A;  4LYC A;  5C6L A;  4OWA A;  1COK A;  5LXW A;  4EOF A;  3EXD A;  2L5Y A;  4EEN A;  2OU8 A;  2BDP A;  3M8R A;  4ZH4 A;  3KTQ A;  4XJD A;  3SB6 A;  4B9L A;  5KAI U;  4FBU A;  3TXG A;  2OM6 A;  4M4O A;  1EPY A;  1DZB X;  1NMM A;  2BQN A;  4TSC A;  3KBB A;  1QTD A;  1UA0 A;  5GTH U;  4DYG A;  1SB3 C;  2BPC A;  1QT6 A;  4UBC A;  4NY8 A;  1KSP A;  5KXR A;  4NLN A;  5DQH A;  4MFA A;  7ICH A;  1XC9 A;  2FDR A;  4J1A A;  4RDS A;  1GDW A;  3Q8L A;  3WPL A;  3WU9 A;  5HR6 A;  5A3E A;  4F2R A;  1A6S A;  1ZQI A;  4BS7 A;  2MAX A;  9ICH A;  4TSB A;  1FDL Y;  4DQ7 A;  2F44 A;  1GF9 A;  1OQM A;  4PPX A;  5LIO A;  3QUQ A;  4Q45 A;  1CV3 A;  4HPE A;  4J9S A;  2LHT A;  4YXM A;  3Q8S B;  1MEL L;  4U7C A;  2PFP A;  1KXY A;  2QB0 A;  1C61 A;  3ZEK A;  2VA2 A;  4J9M A;  2HSZ A;  2F1H A;  1RJC B;  3HIL A;  4C8K A;  3A93 A;  4C8M A;  3P64 A;  1L44 A;  1DYG A;  3EYZ A;  3PVX A;  1OVJ A;  1ZXI A;  2B6X A;  3F6Z A;  1WVV A;  3KZX A;  1TAU A;  3C5F A;  1LI3 A;  4NM2 A;  5KKJ A;  2XY7 A;  1NHB A;  5HMV A;  1L47 A;  8ICS A;  5FHW A;  1L86 A;  2P35 A;  2Y1I A;  3JPQ A;  4NGO A;  1ZRM A;  4IQT A;  127L A;  3OHB A;  1SV0 A;  7ICO A;  3AJN A;  1S76 D;  3H0L B;  3TAP A;  2ANX A;  2ZIL A;  3G3B B;  4G9S A;  5AKG A;  4H94 A;  5J2E A;  5KFV A;  5J0S A;  5ALT A;  2LC9 A;  4RQ2 A;  4AYB F;  3NTU A;  2W1X A;  5F9X A;  2HHW A;  5JUM A;  1L58 A;  2Y0S F;  5ALQ A;  3C2L A;  131L A;  3JPR A;  5KFY A;  1BQL Y;  5DB8 A;  4AP9 A;  241L A;  4WM6 A;  2DQN B;  4RNO A;  3IDW A;  2HMX A;  1LYY A;  1C68 A;  4DQ5 A;  2FYD A;  4ECQ A;  4Y2J A;  4PRQ A;  1YRO A;  1C65 A;  4PHP A;  5LVK A;  1D9U A;  4TUN A;  2B6W A;  4EEK A;  4UAY A;  5DG7 A;  4FZM A;  1KFT A;  4MCK A;  3WUL A;  2DBY A;  4W58 A;  5KG1 A;  1SXE A;  4B6J A;  3SAF A;  7ICM A;  5IIJ A;  4NSI A;  141L A;  1CU5 A;  1L29 A;  2Z18 A;  1G0M A;  4Z6C A;  2F77 X;  4I2B A;  2A7D A;  2HCF A;  3EPI A;  3BS5 B;  1QTZ A;  2B21 A;  4M9H A;  1T8A A;  3HT7 A;  3ISC A;  9ICF A;  2HEA A;  4NL9 C;  5AM5 A;  4XN6 A;  3VWO A;  4P0P A;  4DL2 A;  3T36 A;  4IAP A;  4G4H A;  2E1E A;  4ED0 A;  1RYR A;  4R64 A;  1ZQZ A;  2OCE A;  2F2A B;  4Y2Y A;  1ZQU A;  4DKL A;  3CYM A;  3K4G A;  1XS9 D;  4P2E A;  4M9J A;  1BPE A;  1C6L A;  4NEB A;  1B2K A;  4RLN A;  1DOQ A;  1D0L A;  5KFK A;  1KTQ A;  5LVG A;  4EJ4 A;  2BQA A;  4I8S A;  1UT5 A;  5KG6 A;  4KLO A;  3SB5 A;  4OJO A;  1GBZ A;  9ICE A;  5FP0 A;  1UCO A;  5L1L A;  1LTM A;  256L A;  1YKY X;  3KKA A;  1L50 A;  1IWX A;  1CKF A;  2IHN A;  3B0X A;  4I2I A;  1MC8 A;  4BDP A;  1L84 A;  5DM9 A;  5D46 A;  7LYZ A;  5KKI A;  4GCD A;  1B7R A;  4NGI A;  5DLG A;  2OXO A;  5CP2 A;  2FMQ A;  1HEW A;  1ZQJ A;  1B7S A;  3PDS A;  5D5F A;  4RT3 A;  1F44 A;  1J97 A;  3I76 A;  5AKH A;  5DBC A;  3L2X A;  4B49 A;  2IOF K;  2JEF A;  4K4I A;  119L A;  1NDG C;  2IGC A;  3IJV A;  1PQM A;  4KT3 A;  5HNK A;  3GFK B;  176L A;  3WW6 A;  1CV1 A;  2RBP A;  2W43 A;  2JR5 A;  3C2M A;  4ECV A;  1T7P A;  5ALJ A;  1JRP A;  5DB7 A;  1OVH A;  4HTQ A;  4GN3 A;  2OTY X;  2BZF A;  2BR0 A;  3C8Q A;  3ETR A;  233L A;  3G3W A;  129L A;  2YMP A;  2ALZ A;  3AGH A;  1LYS A;  3AM9 A;  4DDC A;  2W9C B;  3PZP A;  1NK5 A;  3H0R B;  1PQD A;  1Z1V A;  1J2N A;  1ED1 A;  3ZDD A;  4MFC A;  2QAR C;  3GUP A;  1L42 A;  3V2W A;  3MGV A;  3LDA A;  2BQE A;  1C6G A;  3AZ4 A;  2OEA X;  1C6P A;  4W55 A;  1L19 A;  1G0L A;  225L A;  4EPF A;  3FYH A;  4DLG A;  4I27 A;  3GIK A;  2CPR A;  1QTH A;  170L A;  3THV A;  3K1R B;  5IIN A;  2AUB A;  227L A;  1SKS A;  4NXZ A;  1SL2 A;  1L3T A;  1P5C A;  3WMK A;  2GOL A;  3GQC A;  4P0P B;  2WF8 A;  1DK2 A;  3GXR A;  3DEE A;  1ZQE A;  4DSI A;  4JWM A;  253L A;  4B9N A;  4W94 A;  1X6I A;  3QNG A;  1IOT A;  1GB8 A;  3CT1 A;  3EPG A;  4JWN A;  1LHL A;  4UAS A;  3BZK A;  4I7J A;  2YB4 A;  5J8Y A;  3F9L A;  1KS3 A;  4YMN A;  8ICY A;  3HWT A;  4IAS A;  4YVZ A;  1HEQ A;  1LZR A;  3DN4 A;  1L7P A;  4DCC A;  1B5Z A;  3QZ7 A;  165L A;  1KQQ A;  1LSD A;  4I2H A;  4JUZ A;  5LYM A;  1GO3 F;  1LSG A;  5AI9 A;  1JQU A;  3A3Q A;  4KLE A;  2RBN A;  1BVK C;  3NS1 A;  3PX4 A;  3LYT A;  7ICR A;  2YBJ A;  1C64 A;  1IY4 A;  2FI1 A;  5G5H A;  5CB1 A;  5L1M A;  2BQR A;  3RJK A;  1L98 A;  1ZD3 A;  3NUQ A;  1L34 A;  5J29 A;  1T8F A;  3DNA A;  1IC7 Y;  5J2A A;  5KFZ A;  1NBZ C;  4EEL A;  4K4G A;  1U45 A;  1CUQ A;  2YY6 A;  1GEV A;  1GD6 A;  1HUZ A;  5AK4 A;  3KHR A;  3V7K A;  4NFV A;  3WYH A;  1TE2 A;  8ICC A;  4IAT A;  5HNL A;  2EZZ A;  1JIT A;  3EMS A;  1NZP A;  1LLH A;  3AEV A;  1B5V A;  2LYB A;  1C08 C;  1EQ4 A;  1ZQA A;  1LJK A;  3RR7 A;  2F32 A;  4N5R A;  2DQJ Y;  3FAD A;  2BGW A;  4ECW A;  8ICV A;  3DDH A;  1LZ9 A;  4EZ6 A;  1B6I A;  4B4J A;  3Q8Q B;  1UIE A;  4ETE A;  1S9F A;  4OJ6 A;  3OE8 A;  4YN4 A;  2LYO A;  4OWH A;  4NHP A;  107L A;  3FC4 A;  207L A;  181L A;  4PZO A;  250L A;  3HRD D;  4RZR A;  3AGG G;  1BB3 A;  5IHG A;  3L3F X;  2KZZ A;  3RH4 A;  5EWF A;  1D0M A;  5K7O A;  1OUH A;  2YQE A;  1LMP A;  2YDG A;  5F14 A;  4UAZ A;  2UVW A;  4B9U A;  8ICE A;  4NHS A;  5DBA A;  2XGP A;  4LT1 A;  1Y88 A;  3HU9 A;  4I7L A;  4CFP A;  3N4M B;  3CSR A;  2VJ5 A;  5KFL A;  4I2C A;  248L A;  2BQB A;  2LYA A;  5J0R A;  1ZV5 L;  4NLK A;  1RI8 B;  2KHV A;  3BQ1 A;  2ES6 A;  5ALZ A;  1P37 A;  1NI3 A;  4N9R A;  3HT6 A;  1FFV A;  2YTU A;  4PL2 A;  2QB1 A;  1N5X A;  2I5H A;  2K4P A;  1Z00 B;  3PO5 A;  2DPJ A;  1G0G A;  4QWD A;  4ET9 A;  4I7Q A;  1Q8K A;  3DMX A;  2RRD A;  4H9B A;  3UPQ A;  259L A;  1OUC A;  3RNX A;  1C7Y A;  2H9K A;  4F5Q A;  3GUN A;  1NK8 A;  1L3U A;  5BPC A;  4HYK A;  4KIT B;  3V7J A;  2C2E A;  2F1J A;  4ETA A;  5KT6 A;  4QJF B;  2DQF C;  5TZV A;  5AKL A;  1PZY A;  2MRL A;  3M8S A;  1XSF A;  3G3V A;  1GXV 2;  4A7D A;  4DQS A;  3WU7 A;  162L A;  1HFY A;  1LZG A;  4WLT A;  245L A;  1K1Q A;  3WVY A;  4GXK A;  1WWU A;  1BB5 A;  1D6Q A;  1BNP A;  4B9S A;  3OJS A;  1UID A;  5KFI A;  5AIB A;  4F93 B;  3PML A;  1C6B A;  3J4G A;  1QS5 A;  2ZIX B;  1ALC A;  4Y2S A;  3GUJ A;  1CNS A;  4W59 A;  5II3 A;  1L32 A;  5FEL A;  1L85 A;  2YBI A;  3A8Z A;  3HH4 A;  3HT9 A;  2Q9D A;  1GFT A;  3AU6 A;  2ZIX A;  3GZF A;  3OTQ A;  9ICA A;  4PZN A;  1LYI A;  1PS5 A;  5APD A;  5L1J A;  1TV9 A;  2UVR A;  1WCL A;  1L69 A;  3CSZ A;  4XAD A;  4QDN A;  4UB1 A;  2H5X A;  4RQ3 A;  1L53 A;  3RJF A;  4KPM A;  4F4K A;  2WB1 F;  4J1B A;  1L61 A;  5KFC A;  1RQN A;  3WVX A;  1IG6 A;  3M1Y A;  2G08 A;  4C8N A;  5J2F A;  1OYU A;  1ZQP A;  2G06 A;  2PXI A;  4NY5 A;  4NLZ A;  2PFO A;  1OUF A;  1PUZ A;  190L A;  1QIO A;  2HUB A;  102L A;  1G1W A;  4GLV A;  1TBY A;  3MR6 A;  3PX6 A;  1MQ3 A;  1IC5 Y;  5LA8 A;  1XO0 A;  3QY4 A;  5B66 U;  1UIB A;  2LHM A;  3C81 A;  2JHD A;  3TXH A;  2WHE A;  182L A;  1ZYT A;  3OJP A;  2W9A A;  2HUL A;  5I14 A;  231L A;  1OVK A;  2BCS A;  4TUQ A;  2PFQ A;  4PJ0 U;  3CT5 A;  4W56 A;  195L A;  2AGQ A;  3NVZ A;  1DYB A;  2D3D A;  3A90 A;  1GE1 A;  3CDQ A;  3QUT A;  4Q44 A;  3BDP A;  4YF2 A;  1MLC E;  2B74 A;  1F0M A;  187L A;  2AGP A;  1IWY A;  1L30 A;  1ZRN A;  4BJQ A;  4Y2V A;  1IOQ A;  1LI6 A;  4C0Z A;  3JPO A;  1DKK A;  3WKE A;  2V4Q A;  1WQQ A;  4F4Y A;  3Q8P B;  5ALI A;  1D2Y A;  1SWZ A;  4EKS A;  1YKZ X;  4O3M A;  1L65 A;  4H9C A;  5EE3 A;  1TK8 A;  5HMJ A;  4XJF A;  1XJT A;  3FAH A;  3RTV A;  1GB3 A;  4NLB A;  4UAR A;  3BS5 A;  5I54 A;  158L A;  1S97 A;  1YZ6 A;  2B0C A;  221L A;  1L40 A;  2WAQ F;  4DJH A;  4KLF A;  4NLC A;  4C7Y A;  1JIY A;  2BHN A;  4WM5 A;  4DD9 A;  5AKY A;  3W3E A;  4F92 B;  1ZQV A;  4M2Y A;  3P4Z A;  2RDI A;  1P7D A;  4QZF A;  1T3N A;  183L A;  4JV0 A;  3SBA A;  2EIZ C;  1J1X Y;  1NKE A;  4Y2P A;  1WTN A;  1GB9 A;  4DL3 A;  1PQJ A;  3A95 A;  2RAZ X;  5IIL A;  4NG1 A;  4CHX A;  1M6Y A;  5J0U A;  2EAO A;  236L A;  1XSL A;  1T3Q A;  2RHF A;  4ZOH C;  2ZUB A;  4BAF A;  1W6Z A;  1LVH A;  1P7S A;  1QH9 A;  2D8C A;  1LKS A;  1LKY B;  4F5P A;  3C21 A;  1G7L C;  3PNC A;  175L A;  1C6T A;  3Q8K A;  1C20 A;  1CKC A;  5L3H A;  1CU6 A;  5KXO A;  4WLX A;  2JH7 A;  1P2R A;  4QZ8 A;  4O3R A;  1FBI X;  2DBT A;  4C4T A;  3LN2 A;  4E97 A;  4ZPU A;  3SB9 A;  4Y2Q A;  2A19 A;  2YX8 A;  3W6F A;  4BAP A;  2XBS A;  4QWA A;  1QTV A;  4MR1 A;  4U3X B;  3C7Y A;  2W7O A;  4K5Y A;  2AHO B;  5AI0 A;  4RW1 A;  4DF8 A;  1MA7 A;  1L63 A;  1L36 A;  1OV7 A;  4BAD A;  1HFZ A;  1WTM A;  7ICE A;  2Q9E A;  4FDY A;  2CUU A;  1C6D A;  4H9A A;  1EQE A;  2Y9T A;  2DL0 A;  2G09 A;  1C6E A;  5DG8 A;  5DGA A;  4NGY A;  4TX7 A;  1INU A;  2C2D A;  2PC2 A;  4RW2 A;  4YQW A;  4DDA A;  1U9L A;  1B0D A;  5ALL A;  1O23 A;  3HW8 A;  1CUP A;  1BPB A;  1L13 A;  2D91 A;  5EWE A;  1N2X A;  3A92 A;  1SGG A;  4H9I A;  3KZI U;  5IEL A;  1B5U A;  2LM4 A;  1Z1B A;  5KXS A;  3GUM A;  159L A;  1MSW D;  3P68 A;  1JSE A;  1H38 A;  2MEB A;  3SB8 A;  3VC8 A;  167L A;  2XID A;  3C7Z A;  1L66 A;  2DFL A;  3RFA A;  5ALH A;  8ICZ A;  1L3V A;  4J9L A;  1UT8 A;  4UB4 A;  2V4R A;  5HLL A;  1LZE A;  3OE6 A;  1B7L A;  4CF5 A;  4QZD A;  4QW8 A;  1NK9 A;  2JMG A;  2ZWB A;  1Q3U A;  5CR0 A;  2A1J B;  5APC A;  1L97 A;  2BPF A;  1C60 A;  1YIL A;  2G07 A;  5AM4 A;  135L A;  5JRT A;  1UPH A;  2PMZ C;  7LZM A; 
#chains in the Genus database with same CATH homology
 257L A;  1L56 A;  1L60 A;  6LYT A;  1C6K A;  160L A;  4ZFP A;  1X40 A;  1CKD A;  1L71 A;  3RT5 X;  5FDJ A;  2LCB A;  1F6S A;  4R0F A;  1C45 A;  4N1C C;  1X66 A;  1Z55 A;  1UIA A;  1C6I A;  155L A;  2IFF Y;  4I7M A;  147L A;  1QUO A;  3WXU A;  1QQY A;  5I53 A;  2BQD A;  4C5F A;  1L04 A;  5AMY A;  4H8Y A;  1C63 A;  3K2R A;  4R6C A;  3CSQ A;  260L A;  1HER A;  2BQK A;  1L90 A;  4WM2 A;  2Y9U A;  1L23 A;  1L07 A;  4AXT A;  1LHI A;  4NGW A;  3SEN A;  4HSF A;  3EBA B;  5HQ1 A;  1YAQ A;  1L11 A;  1CJ9 A;  3HBH A;  1TEW A;  4W54 A;  4N8Z A;  1LPI A;  1UCV A;  1L31 A;  4OWB A;  1YKX X;  1JKB A;  4WM3 A;  4YEO A;  4EKR A;  1LJJ A;  258L A;  5B1F A;  4NWH A;  3TXK A;  4LDL A;  1DI4 A;  1SV4 A;  1OUA A;  156L A;  1VED A;  4OWC A;  1L01 A;  2Y8P A;  4B4E A;  1LYZ A;  2RBS A;  1LCN A;  1L46 A;  1LGU A;  1KW7 A;  1B5Y A;  5LAF A;  1L25 A;  4HJY A;  1L12 A;  251L A;  2O79 A;  2HED A;  1DKJ A;  4WL6 A;  1L33 A;  1IC4 Y;  1L64 A;  3ATO A;  4NSG A;  3WXT A;  4LGK A;  1D0K A;  145L A;  2RB2 X;  4X3B A;  1IWV A;  2BLY A;  138L A;  2LYZ A;  1DYD A;  4GCF A;  4I0C A;  3DMZ A;  1B9O A;  2QB0 B;  1CU3 A;  3C8R A;  1GAY A;  1JHL A;  1DXS A;  1EL1 A;  2QAR B;  2BQM A;  1REZ A;  2OE9 X;  1K28 A;  3A6B Y;  2B6G A;  1GF0 A;  5B05 A;  1YAO A;  1NKH A;  198L A;  1I56 A;  3AZ7 A;  4XEN A;  1CKH A;  5B59 A;  1L62 A;  213L A;  3HH3 A;  1IR9 A;  1OUJ A;  2YBH A;  1CV6 A;  2RH1 A;  4C3W A;  3TXF A;  1F10 A;  3FI5 A;  2YVB A;  4NG8 A;  1REY A;  3W6B A;  1N4F A;  1BGI A;  2EPE A;  5LA5 A;  1IP5 A;  4PPO A;  2QKQ A;  1IR7 A;  239L A;  2D4J A;  2DQG Y;  150L A;  1LZ8 A;  4QGZ A;  1V7S A;  1L00 A;  2ZIJ A;  3C80 A;  2MEE A;  1CU0 A;  1CJ6 A;  1L22 A;  1BVX A;  1CVK A;  1KXW A;  4H92 A;  4Z98 A;  1UQV A;  1TLA A;  2HU3 A;  3N9A A;  1BB6 A;  3LYO A;  2F8K A;  4ARL A;  1IOS A;  2D4I A;  2Z6B A;  1G0K A;  2YBL A;  1L59 A;  1L89 A;  4OWE A;  219L A;  1QDT A;  4YXA C;  1L10 A;  4DD3 A;  111L A;  3OK0 A;  1LJN A;  1B7O A;  184L A;  4TTD A;  3HWL A;  247L A;  2LZT A;  4OW1 A;  3ZVQ B;  1VFB C;  1WWV A;  4J0L A;  1C6C A;  1CJ7 A;  1RG6 A;  5F9U A;  5KXW A;  3A67 Y;  1GB2 A;  2B6T A;  4NHT A;  1CJ8 A;  3FA0 A;  1LHM A;  1ZUR A;  2RBQ A;  5LVH A;  1XGT C;  4NL9 A;  5L3I A;  2G4N A;  3J6K A;  1LZA A;  197L A;  3MGW A;  4ARQ A;  1X9X A;  1YL0 X;  1L99 A;  1L20 A;  1JIS A;  3A94 A;  5EBH A;  3OE0 A;  1C10 A;  2RB1 X;  5KXM A;  4ARJ A;  1V38 A;  1JKD A;  3CDO A;  1LSA A;  3HFM Y;  1LMQ A;  5LIN A;  1D6P A;  2A4T A;  1C6Q A;  122L A;  2LMR A;  1LW9 A;  5JU5 A;  137L A;  5KJ9 A;  2KE7 A;  3WUA A;  1TDY A;  3W6C A;  4DD0 A;  1OUE A;  1GEZ A;  4HTK A;  1LHJ A;  169L A;  1NDM C;  123L A;  3DN3 A;  5J8Y C;  1B7Q A;  1JTT L;  4YXC A;  1SSY A;  1GF6 A;  234L A;  1IP7 A;  1L75 A;  4ARP A;  1UA6 Y;  3TXB A;  3RU5 A;  1L52 A;  4ET8 A;  2ZIK A;  4NSJ A;  3L64 A;  2LZ2 A;  1QSB A;  2ESE A;  1IX0 A;  5KXN A;  4L41 A;  2DQD Y;  2YBN A;  168L A;  4GRV A;  1T6H A;  1IR8 A;  1C67 A;  1FKV A;  1L87 A;  1XEI A;  1LPY A;  1HEL A;  4H91 A;  3WU8 A;  2Q0M X;  199L A;  3WUM A;  2Z2E A;  1C6N A;  4LT2 A;  1L77 A;  5APF A;  2G4P A;  1L82 A;  1HEP A;  4H8X A;  222L A;  235L A;  3DN6 A;  3V2Y A;  5FCP A;  163L A;  5KXY A;  1QS9 A;  103L A;  3EO5 A;  1LJ4 A;  3B0O A;  4HP0 A;  4H9H A;  3AB6 A;  5F81 A;  118L A;  1C62 A;  2E8P A;  2YBM A;  3DMV A;  171L A;  1LMO A;  2OU0 X;  2YSS C;  2HEC A;  4WL7 A;  1DI3 A;  4HTN A;  1WQM A;  1AT5 A;  1GF3 A;  3SN6 R;  2Z19 A;  4HJV A;  3A96 A;  2CGI A;  1GE3 A;  2XBR A;  3B72 A;  1L28 A;  3HDE A;  3NY8 A;  1XFP L;  1KW4 A;  4OO9 A;  140L A;  252L A;  1A2Y C;  2OTZ X;  3RW8 A;  226L A;  2BQI A;  217L A;  1YL1 X;  1IWU A;  132L A;  228L A;  1GFA A;  1G7M C;  3AW6 A;  2E8N A;  1HC0 A;  5JTI A;  2MEI A;  1C7P A;  3HU8 A;  5DN4 A;  215L A;  2LZM A;  1NF5 A;  3SB7 A;  2B75 A;  5LZM A;  1HEN A;  201L A;  4ZIX A;  1JTO L;  4WLD A;  1KW5 A;  4NHI A;  2BAA A;  1C6H A;  1UAC Y;  2ANV A;  5DL9 A;  5T3F A;  2KSO B;  2H5Z A;  1QUS A;  2MED A;  1A4V A;  4LYT A;  4PHI A;  1YQV Y;  1LSB A;  1GDX A;  4KXI A;  126L A;  2C8P A;  1JTM A;  3AZ6 A;  2HEF A;  1QUT A;  5C6J A;  3B6L A;  2WAR A;  1OWZ A;  5F16 A;  1I20 A;  5A3Z A;  1L67 A;  3CB7 A;  1W08 A;  3WPK A;  2ZYC A;  1IEE A;  1LSP A;  1L38 A;  3C82 A;  4DT3 A;  4RQM A;  3ODU A;  6LYZ A;  1HFX A;  1KNI A;  1QT3 A;  1LSE A;  1L74 A;  1IP1 A;  4DC4 A;  3RZ4 A;  1JJ1 A;  1IO5 A;  4YEN A;  3M3U A;  3A91 A;  1L0J A;  178L A;  1L72 A;  1YAP A;  3GUO A;  1L0K A;  4EKP A;  2BQF A;  4YX7 C;  1SQ2 L;  1L94 A;  192L A;  1L88 A;  4G4C A;  1G0P A;  1KIQ C;  1C69 A;  5L9J A;  4XJG A;  4PK0 A;  3KAM A;  2DKV A;  3TXJ A;  1ZMY L;  3WPJ A;  4NWE A;  120L A;  1DYA A;  1LGW A;  4LDE A;  3W6D A;  2DKZ A;  2X0A A;  5J7C A;  1L76 A;  1HMK A;  1GXX A;  1L80 A;  212L A;  153L A;  3N9C A;  1T97 A;  1WQN A;  211L A;  143L A;  1LZ1 A;  1QT8 A;  5KXL A;  172L A;  2L78 A;  1L14 A;  1L79 A;  2FBB A;  1ZWN A;  4Z41 A;  1L81 A;  1L73 A;  157L A;  186L A;  1L09 A;  1OUB A;  1IWZ A;  5JEN B;  2JV3 A;  4H93 A;  5B07 A;  255L A;  1P3N A;  177L A;  1VDS A;  1AT6 A;  1XEJ A;  1GWD A;  1C6A A;  4PJ2 C;  1LJG A;  5ILC A;  1V7T A;  1F0W A;  2A7F A;  3C7W A;  1C6M A;  2HEE A;  3DKE X;  1IP2 A;  1L93 A;  1NHE A;  1NWG A;  1LSM A;  1LOZ A;  3F8V A;  5KXT A;  1L39 A;  1NQI A;  1P46 A;  1LMA A;  3T6U A;  4M4O A;  2EAP A;  3TXE A;  1XGP C;  5E9R A;  1L35 A;  2ZNW Y;  4W52 A;  1LSC A;  2CWI A;  3TAC B;  1FLU A;  3B0K A;  1L27 A;  1LZN A;  1WVU A;  3LHM A;  4TWS A;  4LZM A;  1LZB A;  148L E;  2I26 L;  4UWU A;  1GBX A;  1XGR C;  4WM1 A;  1JKA A;  3HUQ A;  4GLA A;  1G0Q A;  3TAD C;  2BPU A;  1L68 A;  5KY1 A;  5B06 A;  1LI2 A;  1JTP L;  2F47 A;  1LWG A;  109L A;  4LFX A;  214L A;  3E3D A;  249L A;  1QT7 A;  5KXX A;  5KXK A;  3RUN A;  112L A;  216L A;  2O7A A;  5APE A;  3D9A C;  2K60 A;  1BB4 A;  1QUH A;  1J1O Y;  4WO6 A;  4HPI A;  1JI7 A;  1GE0 A;  1QT4 A;  4NGV A;  4H9E A;  1L95 A;  2OE4 X;  244L A;  1V85 A;  2HUK A;  3SP3 A;  1JJ0 A;  4DQJ A;  2ZYP A;  1B5W A;  1GFG A;  209L A;  3TAD A;  1L26 A;  1L43 A;  1T6V L;  1SX7 A;  1LJI A;  1LSY A;  4N0J A;  1L08 A;  4XJI A;  205L A;  2F3N A;  5HNC A;  4WG1 A;  1H6M A;  1REX A;  1QUG A;  1UIC A;  3FE0 A;  4LDO A;  2B72 A;  4M6D A;  2KG5 A;  1ZVH L;  1HSX A;  1GPQ C;  1AKI A;  1SLY A;  1L15 A;  2Z12 A;  5F3X B;  1AM7 A;  1D3N A;  4II8 A;  220L A;  166L A;  3C8S A;  1RCM A;  188L A;  3AZ5 A;  1JPO A;  3P66 A;  1IOC A;  3AW7 A;  3HBD A;  3DN0 A;  2ZQ4 A;  4YM8 A;  4LYB A;  1BWH A;  3WUN A;  1L57 A;  2Z39 A;  5LVJ A;  2BQJ A;  4LT3 A;  1XEK A;  3TMV A;  1SSW A;  1L51 A;  1P6Y A;  2RSC A;  1LMN A;  1CX7 A;  9LYZ A;  5KXP A;  1LMC A;  2MEA A;  3G3A B;  3M18 B;  1GF7 A;  3ZVQ A;  3FI7 A;  4O34 A;  1LYJ A;  3A34 A;  1PQO A;  4PJZ A;  4IS7 A;  4OOT A;  3H8M A;  4AQN A;  4EKQ A;  1WQR A;  2RB0 X;  139L A;  3HUK A;  1GFJ A;  2I25 L;  2BQC A;  4GCB A;  2OE7 X;  1L02 A;  1SV0 C;  2W1Y A;  4RQN A;  3LYM A;  1D9W A;  1PQI A;  1DXJ A;  1BB7 A;  3EML A;  2ZQ3 A;  1LZ4 A;  1LZD A;  5LYT A;  1CX6 A;  3NY9 A;  3TMU A;  1GHL A;  1IP4 A;  1HEO A;  4W51 A;  1GB6 A;  232L A;  3KKA C;  1L41 A;  1SX2 A;  4W57 A;  1L05 A;  3HTG A;  242L A;  2RBO A;  4UWN A;  1F6R A;  4WLY A;  4J7V A;  2HEB A;  1G06 A;  2F4G A;  5DN5 A;  5FST A;  1G07 A;  4I7N A;  2MEG A;  1CV0 A;  1I1Z A;  1YIK A;  133L A;  1IY3 A;  4NGL A;  3ULR A;  1FLW A;  4H8Z A;  193L A;  8LYZ A;  4XJH A;  4LYZ A;  1UIG A;  2O4W A;  1B0X A;  2QAR A;  1C43 A;  1G7I C;  1XEP A;  4WG7 A;  1IP3 A;  1C6F A;  4EXM A;  4WOA A;  1L37 A;  1QSQ A;  1P36 A;  3TXD A;  1BWI A;  1VDP A;  2FBD A;  4LFP A;  1OW5 A;  1H87 A;  218L A;  2KMD A;  1HSW A;  3UON A;  3IWR A;  4I7K A;  1L06 A;  4XYY A;  2BQO A;  1KY0 A;  4CGE A;  4DWX A;  4I7P A;  4MHV A;  2CJL A;  2DQH Y;  1LZ6 A;  4MST A;  5ILF A;  1LZS A;  2CDS A;  1GF8 A;  2RAY X;  3CQL A;  2DQE Y;  1L48 A;  1JTN A;  230L A;  3CT0 A;  1VAT A;  1GB7 A;  1YAN A;  1D3M A;  1JJ3 A;  2RBR A;  4OOO A;  1PQK A;  4G49 A;  4DD7 A;  1GFK A;  3VW7 A;  5KXZ A;  1UUZ C;  1LYO A;  3HT8 A;  1J1P Y;  4B4I A;  3TMX A;  4GBR B;  1SXD A;  3CDV A;  3JR6 A;  5I4X A;  1B4F A;  2HTX A;  3W6E A;  1C46 A;  1L17 A;  128L A;  4WO9 A;  3A6C Y;  1GBO A;  185L A;  3QAK A;  2ZNX Y;  3D4S A;  146L A;  5I4W A;  3SBB C;  1LWK A;  1B7N A;  2OU9 A;  261L A;  1GF5 A;  5DLA A;  2D6B A;  4I7S A;  223L A;  2N5Z A;  2FE9 A;  1C66 A;  210L A;  2HUM A;  1HNL A;  3CDR A;  4LZT A;  1LJH A;  1CTW A;  1REM A;  1GBY A;  1LZC A;  2XJW A;  2FYC A;  1GB0 A;  1GFE A;  262L A;  4B0D A;  3B0I A;  1D3J A;  1QSW A;  152L A;  4PRU A;  4I7T A;  1PK1 B;  1IVM A;  1L45 A;  4WMG A;  4ANR A;  1QTC A;  1HML A;  1SWY A;  5LVI A;  2Z38 A;  4ARM A;  1JKC A;  3WH1 A;  3K3T A;  5IDD A;  1HF4 A;  1LZY A;  1DPW A;  1LJF A;  4HV2 A;  2EQL A;  3GUI A;  1LGX A;  1CKG A;  3BKH A;  1LSN A;  3RZE A;  4ETC A;  1KXX A;  194L A;  4YOP A;  1WQO A;  2DQI Y;  3BQ7 A;  4NGJ A;  1LYD A;  3DN1 A;  1P2L A;  1GAZ A;  1L55 A;  3QE8 A;  1NBY C;  4W53 A;  1OP9 B;  2DKX A;  4IJ4 A;  1VDT A;  3AYQ A;  1JEF A;  1DYC A;  1UC0 A;  1L21 A;  2G4Q A;  1T3P A;  2MEC A;  1GFV A;  4LYO A;  1I6S A;  2EKS C;  3BKV A;  4DDB A;  173L A;  3BS7 A;  4GCC A;  5D5C A;  1VDQ A;  4DD1 A;  1QSA A;  1DPX A;  6LZM A;  1GFR A;  4DAJ A;  1RE2 A;  1IWW A;  1XGU C;  3LZM A;  1OWY A;  1QTE A;  3OE9 A;  3HDF A;  1LMT A;  1GBW A;  189L A;  1CV4 A;  5B1G A;  4NIJ A;  4EMN A;  4KL7 A;  2H9J A;  4H90 A;  1QTK A;  4CJ2 A;  4HV1 A;  134L A;  1E8L A;  1GBS A;  240L A;  4AGA A;  5M1Y A;  1TAY A;  1LKY A;  1QUD A;  1JUG A;  5I4Y A;  3IJU A;  4GCE A;  1OXJ A;  1B5X A;  174L A;  151L A;  4E3U A;  1UIF A;  2GLE A;  2DQA A;  1OUI A;  5LYZ A;  2LYM A;  2HU1 A;  3N9E A;  3HUA A;  2LPE A;  108L A;  3SEI A;  1IOR A;  3C83 A;  1GF4 A;  3DN8 A;  1DQJ C;  3P65 A;  1KY1 A;  2MEF A;  1LHH A;  1B7M A;  224L A;  1L03 A;  1C6J A;  2IHL A;  2B6Y A;  1TCY A;  2MEH A;  3HTD A;  196L A;  5FEK A;  2E8M A;  2B73 A;  4ARM B;  1OUD A;  1CV5 A;  3HTB A;  4B1A A;  4NJ8 A;  3HH6 A;  2F2N A;  2C8O A;  1G0J A;  1LKR A;  3LZT A;  3D3D A;  1HEM A;  229L A;  1P64 A;  1D3F A;  1WQP A;  4H9F A;  1L70 A;  1D2W A;  2KSO A;  125L A;  5KNI A;  1LHK A;  3LZ2 A;  4I7R A;  1PK3 A;  5E4P A;  4QEQ A;  1G7J C;  5C6I A;  3NYA A;  1T8G A;  2D4K A;  4Z3M A;  1L91 A;  1GFH A;  2XTH A;  2E8O A;  2XQO A;  4S0W A;  1LYE A;  4CFO A;  2Z2F A;  115L A;  4NSH A;  3TXI A;  4GN5 C;  114L A;  2F2Q A;  142L A;  2F4A A;  4RLM A;  1AZF A;  144L A;  4ETB A;  2B5Z A;  104L A;  1LYF A;  2BQL A;  4GN4 A;  1RFP A;  3TMW A;  1UIH A;  1L16 A;  3PBL A;  1FLY A;  1GE4 A;  1KIP C;  1BWJ A;  1JSF A;  180L A;  2NTG A;  1GFU A;  1VAU A;  1OV5 A;  4I7O A;  1GE2 A;  1DYE A;  3HBE X;  4EPI A;  3LYZ A;  1L49 A;  1IP6 A;  149L A;  3W6A A;  4QY9 A;  4WM4 A;  5LAG A;  4ETD A;  4D9Z A;  1P2C C;  1G1V A;  110L A;  4W96 A;  2BQH A;  1G7H C;  200L A;  1IWT A;  2DQC Y;  2B70 A;  2VB1 A;  4LT0 A;  1WTH A;  154L A;  1DI5 A;  1HHL A;  3WW5 A;  4Z46 A;  243L A;  1L18 A;  1L92 A;  3GUL A;  3ATN A;  1DYF A;  4ZEE A;  1UBZ A;  161L A;  1FN5 A;  3GXK A;  4ARQ B;  1LYH A;  1PK1 A;  2W1M A;  191L A;  238L A;  130L A;  4HJZ A;  1JWR A;  4DD2 A;  2B7X A;  4ML7 A;  1P56 A;  4NHQ A;  4PGJ B;  2NTH A;  164L A;  3WL2 A;  3A3R X;  1FKQ A;  1XJU A;  1L96 A;  1LZ5 A;  3CDT A;  1QT5 A;  246L A;  2Z37 A;  1LSZ A;  4N1E I;  1LSF A;  254L A;  3HH5 A;  1EQ5 A;  3GUK A;  5I5Q A;  1L24 A;  2F30 A;  4YEM A;  1QTB A;  4LYM A;  113L A;  2B6Z A;  2W1L A;  2BQG A;  1LJE A;  1IIZ A;  2BLX A;  4NGK A;  2GV0 A;  1QDR A;  3DN2 A;  2KIV A;  237L A;  1GB5 A;  1ZVY B;  1BHZ A;  1L83 A;  1LYG A;  4NGZ A;  1L54 A;  1B7P A;  1CU2 A;  4XJB A;  1LJ3 A;  1FLQ A;  208L A;  1LAA A;  2NWD X;  1LZT A;  2I6Z A;  3AGI A;  4G4B A;  3G3X A;  1YAM A;  1XGQ C;  2EAM A;  1KIR C;  4FJR A;  3HTF A;  1OUG A;  206L A;  2EAN A;  4UWV A;  4H1P A;  4LYC A;  5C6L A;  4OWA A;  1COK A;  5LXW A;  4EOF A;  3EXD A;  2L5Y A;  2OU8 A;  4XJD A;  3SB6 A;  3TXG A;  1EPY A;  1DZB X;  1NMM A;  2BQN A;  4TSC A;  1QTD A;  4DYG A;  1QT6 A;  5KXR A;  4J1A A;  4RDS A;  1GDW A;  3WPL A;  3WU9 A;  5A3E A;  4BS7 A;  4DQ7 A;  4TSB A;  1FDL Y;  2F44 A;  1GF9 A;  1OQM A;  5LIO A;  1CV3 A;  4HPE A;  1MEL L;  1KXY A;  2QB0 A;  1C61 A;  3ZEK A;  1RJC B;  3HIL A;  3A93 A;  3P64 A;  1L44 A;  1DYG A;  1OVJ A;  2B6X A;  3F6Z A;  1WVV A;  1LI3 A;  5KKJ A;  5HMV A;  1NHB A;  1L47 A;  5FHW A;  1L86 A;  4NGO A;  127L A;  1SV0 A;  3AJN A;  2ZIL A;  2ANX A;  3G3B B;  4G9S A;  4H94 A;  2LC9 A;  2W1X A;  5F9X A;  1L58 A;  131L A;  1BQL Y;  4WM6 A;  241L A;  3IDW A;  1LYY A;  4DQ5 A;  1C68 A;  2FYD A;  4PRQ A;  1YRO A;  1C65 A;  5LVK A;  1D9U A;  4TUN A;  2B6W A;  4MCK A;  3WUL A;  4W58 A;  1SXE A;  4NSI A;  141L A;  1CU5 A;  1L29 A;  2Z18 A;  1G0M A;  2A7D A;  3BS5 B;  1QTZ A;  1T8A A;  3HT7 A;  3VWO A;  2HEA A;  4NL9 C;  4XN6 A;  3T36 A;  4IAP A;  4G4H A;  4DKL A;  4P2E A;  1C6L A;  4NEB A;  1B2K A;  4RLN A;  1D0L A;  5LVG A;  4EJ4 A;  2BQA A;  4I8S A;  3SB5 A;  1GBZ A;  1UCO A;  1LTM A;  256L A;  1YKY X;  3KKA A;  1L50 A;  1IWX A;  1CKF A;  1L84 A;  5DM9 A;  7LYZ A;  5KKI A;  4GCD A;  1B7R A;  4NGI A;  1HEW A;  1B7S A;  3PDS A;  5D5F A;  3L2X A;  4B49 A;  119L A;  1NDG C;  2IGC A;  3IJV A;  1PQM A;  4KT3 A;  3WW6 A;  176L A;  1CV1 A;  2RBP A;  1OVH A;  4HTQ A;  4GN3 A;  2OTY X;  3C8Q A;  233L A;  3G3W A;  129L A;  4DDC A;  3AGH A;  1LYS A;  1PQD A;  1Z1V A;  2QAR C;  3GUP A;  1L42 A;  3V2W A;  2BQE A;  1C6G A;  3AZ4 A;  2OEA X;  1C6P A;  4W55 A;  1L19 A;  1G0L A;  225L A;  4EPF A;  1QTH A;  170L A;  3K1R B;  2AUB A;  227L A;  1P5C A;  3WMK A;  3GXR A;  253L A;  4W94 A;  3QNG A;  1IOT A;  1GB8 A;  3CT1 A;  1LHL A;  4I7J A;  5J8Y A;  3F9L A;  1KS3 A;  4IAS A;  1HEQ A;  1LZR A;  3DN4 A;  1B5Z A;  165L A;  1LSD A;  5LYM A;  1LSG A;  1JQU A;  3A3Q A;  2RBN A;  1BVK C;  3LYT A;  2YBJ A;  1C64 A;  1IY4 A;  5L1M A;  1L98 A;  1L34 A;  1T8F A;  3DNA A;  1IC7 Y;  1NBZ C;  1CUQ A;  1GEV A;  1GD6 A;  4NFV A;  3WYH A;  4IAT A;  5HNL A;  1JIT A;  3EMS A;  1LLH A;  1B5V A;  1C08 C;  1EQ4 A;  1LJK A;  2F32 A;  4N5R A;  2DQJ Y;  3FAD A;  1LZ9 A;  1B6I A;  4B4J A;  1UIE A;  4ETE A;  3OE8 A;  2LYO A;  4OWH A;  4NHP A;  107L A;  207L A;  181L A;  4PZO A;  250L A;  3AGG G;  1BB3 A;  5IHG A;  1D0M A;  5K7O A;  1OUH A;  1LMP A;  2YDG A;  5F14 A;  4NHS A;  4LT1 A;  3HU9 A;  4I7L A;  4CFP A;  3CSR A;  248L A;  2BQB A;  1ZV5 L;  1RI8 B;  2ES6 A;  1P37 A;  4N9R A;  3HT6 A;  2YTU A;  2QB1 A;  2K4P A;  1G0G A;  4ET9 A;  4I7Q A;  3DMX A;  4H9B A;  259L A;  3RNX A;  1OUC A;  2H9K A;  3GUN A;  4ETA A;  2DQF C;  1XSF A;  1PZY A;  3G3V A;  1GXV 2;  4A7D A;  3WU7 A;  162L A;  1HFY A;  1LZG A;  4WLT A;  245L A;  3WVY A;  1BB5 A;  1WWU A;  1D6Q A;  1UID A;  1C6B A;  3J4G A;  1QS5 A;  1ALC A;  3GUJ A;  1CNS A;  4W59 A;  5II3 A;  1L32 A;  5FEL A;  1L85 A;  2YBI A;  3A8Z A;  3HT9 A;  3HH4 A;  2Q9D A;  1GFT A;  4PZN A;  1LYI A;  1PS5 A;  5APD A;  1L69 A;  3CSZ A;  4XAD A;  4QDN A;  1L53 A;  4KPM A;  4J1B A;  1L61 A;  3WVX A;  1OYU A;  4NY5 A;  1OUF A;  190L A;  1QIO A;  2HUB A;  102L A;  1G1W A;  4GLV A;  1TBY A;  1IC5 Y;  5LA8 A;  3QY4 A;  1UIB A;  2LHM A;  3C81 A;  3TXH A;  182L A;  1ZYT A;  3OJP A;  2HUL A;  5I14 A;  231L A;  1OVK A;  3CT5 A;  4W56 A;  195L A;  1DYB A;  2D3D A;  3A90 A;  1GE1 A;  3CDQ A;  4YF2 A;  1MLC E;  2B74 A;  1F0M A;  187L A;  1IWY A;  1L30 A;  1IOQ A;  1LI6 A;  1DKK A;  1WQQ A;  1D2Y A;  1SWZ A;  4EKS A;  1YKZ X;  1L65 A;  4H9C A;  5HMJ A;  4XJF A;  1XJT A;  1GB3 A;  5I54 A;  3BS5 A;  158L A;  221L A;  1L40 A;  4DJH A;  1JIY A;  4WM5 A;  4DD9 A;  3W3E A;  3P4Z A;  183L A;  3SBA A;  2EIZ C;  1J1X Y;  1WTN A;  1GB9 A;  3A95 A;  1PQJ A;  4NG1 A;  2RAZ X;  4CHX A;  2EAO A;  236L A;  4BAF A;  1W6Z A;  1P7S A;  2D8C A;  1LKS A;  1LKY B;  1G7L C;  175L A;  1C6T A;  5L3H A;  5KXO A;  1CKC A;  1CU6 A;  4WLX A;  1P2R A;  1FBI X;  2DBT A;  3LN2 A;  4E97 A;  4ZPU A;  3SB9 A;  4BAP A;  3W6F A;  2XBS A;  1QTV A;  4U3X B;  4MR1 A;  3C7Y A;  4K5Y A;  4RW1 A;  1L63 A;  4BAD A;  1L36 A;  1OV7 A;  1HFZ A;  1WTM A;  2Q9E A;  4FDY A;  2CUU A;  1C6D A;  4H9A A;  1EQE A;  2Y9T A;  2DL0 A;  1C6E A;  4NGY A;  4TX7 A;  1INU A;  2PC2 A;  4RW2 A;  4DDA A;  1B0D A;  1O23 A;  1CUP A;  1L13 A;  2D91 A;  3A92 A;  1SGG A;  4H9I A;  5IEL A;  1B5U A;  5KXS A;  3P68 A;  3GUM A;  159L A;  1JSE A;  2MEB A;  3SB8 A;  167L A;  3C7Z A;  1L66 A;  5HLL A;  1LZE A;  3OE6 A;  1B7L A;  2ZWB A;  5APC A;  1L97 A;  1C60 A;  1YIL A;  135L A;  5JRT A;  7LZM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...