2QB0B

Structure of the 2tel crystallization module fused to t4 lysozyme with an ala-gly-pro linker.
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
241
structure length
241
Chain Sequence
SIRLPAHLRLQPIYWSRDDVAQWLKWAENEFSLRPIDSNTFEMNGKALLLLTKEDFRYRSPHSGDVLYELLQHILKQAGPNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFCQDVDAAVRGILRNAKLKPVYDSLDCVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Polymer-driven crystallization.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase regulator
molecule keywords E80-TELSAM domain
total genus 75
structure length 241
sequence length 241
chains with identical sequence D
ec nomenclature ec 3.2.1.17: Lysozyme.
pdb deposition date 2007-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00959 Phage_lysozyme Phage lysozyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2qb0B01
1.10.530.40 Mainly Alpha Orthogonal Bundle Lysozyme Lysozyme 2qb0B02
1KNIA 3HH4A 138LA 2B6YA 3BS7A 1CU2A 1PQKA 200LA 4LDOA 2D3DA 1C69A 198LA 1C6LA 1QTHA 2Q9DA 1L75A 146LA 1CUQA 1DYDA 152LA 1C6BA 1D9WA 1L97A 1L02A 3HH6A 5J8YC 2ANVA 107LA 1L18A 1LGUA 1QT5A 4NJ8A 1L06A 1CV0A 1CV4A 1L67A 144LA 2GLEA 2KIVA 1L03A 2OE9X 3GUNA 2QB0A 1L15A 2E8PA 1L50A 2HUKA 1OXJA 5JTIA 102LA 1LYEA 1QS9A 211LA 3QAKA 1L56A 3D4SA 1QTDA 1PQOA 1UCVA 1TLAA 4I7KA 4AQNA 1L74A 1C6NA 2HULA 1L70A 2L5YA 1QTBA 2K4PA 2KG5A 3SEIA 244LA 2OEAX 1UQVA 220LA 237LA 2RB1X 4S0WA 4W52A 1C6TA 255LA 1QT3A 1L05A 1C64A 1L85A 3KKAC 1CU0A 1L90A 2LC9A 159LA 2OU0X 2QB1A 177LA 4IS7A 1L0KA 1L21A 3HDEA 1LYJA 1L0JA 3FI5A 4K5YA 3C8RA 1C6EA 257LA 118LA 1L27A 2OTZX 3JR6A 1L36A 1C6PA 2B6TA 165LA 3F8VA 3HILA 2YTUA 1L96A 1LYDA 112LA 1L49A 2O79A 1LYGA 2OE4X 169LA 2K60A 3HTDA 149LA 1SV4A 245LA 3DN6A 3NYAA 127LA 1CV5A 151LA 1G0GA 209LA 4LZMA 2EANA 260LA 3GUJA 3HDFA 187LA 1SWYA 3PDSA 3G3VA 1SV0A 1L91A 1OWYA 4ARQB 1KW4A 4PZOA 4ARMA 1L08A 160LA 1SV0C 1G1VA 3RUNA 174LA 1L72A 1PQMA 2RBPA 3DMVA 104LA 3HUAA 1L28A 3OE8A 148LE 1L65A 1SSWA 3ODUA 1DXSA 2Z6BA 1LI3A 192LA 199LA 2DL0A 2OTYX 250LA 215LA 1L13A 3CDTA 1PQIA 4ZPUA 176LA 4I7JA 1L83A 161LA 3SENA 1NHBA 1WTHA 3CDOA 1L77A 259LA 1L26A 1L14A 2RAYX 122LA 1LKYB 3NY9A 103LA 1L69A 5JU5A 2F47A 4YX7C 1KW5A 1C6HA 1QUGA 1DYGA 157LA 1C67A 2Q9EA 5J8YA 2F44A 4PJZA 2KSOB 1JTMA 2F2QA 109LA 1D3MA 3DNAA 143LA 3K1RB 2F32A 4ARQA 140LA 1KY0A 2HUMA 5JRTA 4RQNA 226LA 3CDQA 1L76A 3HUQA 4I7QA 3HH5A 1QT8A 1B0XA 2ESEA 3SB6A 1L55A 1LWKA 2B74A 1QT7A 1L73A 4I7MA 3HUKA 242LA 262LA 3L64A 4LDLA 4EXMA 2EAMA 1B4FA 5L1MA 168LA 229LA 4NL9C 4W56A 3HTFA 3HT6A 238LA 1DYCA 1C63A 1L44A 1C6AA 243LA 1L54A 1C6JA 1X40A 173LA 1C6KA 1SX7A 3IDWA 1LKYA 1COKA 1L84A 1P5CA 1L98A 1LYFA 1L66A 1L47A 1CU3A 184LA 1WWUA 1PQDA 1CV1A 1L30A 247LA 4W57A 1DYFA 1B6IA 2B7XA 3DMXA 2ANXA 1L07A 2NTGA 1L92A 2RBOA 1SSYA 1L42A 2QB0B 1L41A 227LA 191LA 1QTCA 1OVHA 125LA 4I7TA 3SB5A 236LA 1CUPA 1P36A 1C6DA 2A4TA 1CU5A 4E97A 1L71A 1L53A 1QTZA 212LA 2F8KA 4W59A 5F3XB 1XJUA 1QS5A 1L93A 2QKQA 1CV3A 1L80A 1L10A 182LA 1D3NA 2IGCA 2LCBA 1C6CA 3BS5B 1CU6A 155LA 217LA 3G3XA 111LA 2B70A 1JQUA 1P7SA 1G07A 3FADA 158LA 1L34A 1LI6A 1F0MA 2Y9UA 1LW9A 1K28A 2LZMA 3C8SA 4NL9A 3SBBC 1L17A 3BS5A 2RBQA 7LZMA 223LA 2E8OA 1L11A 1SWZA 1G0PA 1PK3A 1LWGA 1C6GA 3H8MA 178LA 1L04A 1L51A 128LA 1L24A 1T8AA 248LA 2KE7A 3K2RA 1D2WA 1P3NA 4I7OA 2NTHA 2B73A 156LA 2RBSA 2Y9TA 3GUOA 4DJHA 1T6HA 4ARJA 110LA 2JV3A 213LA 1JI7A 3HT7A 4MHVA 189LA 1L61A 3HT8A 3C82A 4I7RA 3RZEA 4EKPA 183LA 126LA 1DYAA 1OV5A 2B72A 6LZMA 1L59A 219LA 1QUOA 190LA 1LPYA 171LA 170LA 1G0KA 1QUHA 139LA 2QARA 1SX2A 1DYBA 1OYUA 3DN4A 1OVJA 232LA 1I6SA 166LA 3HTBA 3HU9A 3C8QA 2DKZA 2KMDA 1L22A 1L00A 1L35A 3VW7A 1C66A 4W58A 1QT6A 3PBLA 130LA 2DKXA 1L46A 1CX6A 2RH1A 3HU8A 4GBRB 1V85A 3C7WA 2FE9A 3BQ7A 3C83A 3DN3A 3GUIA 114LA 141LA 1QSQA 1XEPA 1L64A 4EKSA 119LA 3OE9A 1P56A 1L40A 120LA 1QT4A 185LA 1C62A 3UONA 249LA 3CDRA 4EPFA 5KNIA 1KY1A 3DN8A 1D2YA 4EPIA 1LGXA 216LA 253LA 1XJTA 2RBRA 115LA 113LA 1G1WA 1KW7A 3CDVA 1L57A 1G0JA 1P2RA 1L89A 4YXCA 3DMZA 254LA 4W51A 163LA 205LA 123LA 2KSOA 1C6IA 1P46A 1X66A 1C65A 2B75A 1P6YA 167LA 2B6GA 1L38A 4OO9A 221LA 145LA 4YXAC 3DN1A 150LA 1L45A 1CX7A 4GRVA 234LA 129LA 3SB9A 1L68A 3OE0A 1QSBA 1LLHA 4ARPA 1L60A 231LA 3DN0A 2RB2X 1L19A 2OU8A 2E8MA 147LA 1V38A 2RAZX 3L2XA 3SBAA 1G0LA 241LA 164LA 1L12A 230LA 1L79A 2OE7X 4ARLA 3TADC 1ZWNA 1SXEA 3OE6A 1WWVA 186LA 1L99A 3TADA 2LPEA 2F3NA 1L95A 4RQMA 225LA 4LDEA 1L23A 1T8FA 1X9XA 3V2WA 1L48A 197LA 1PK1A 2D8CA 108LA 196LA 1T97A 1OV7A 4EJ4A 181LA 1L25A 218LA 1C60A 1SGGA 201LA 4I7LA 2L78A 3SB7A 4W55A 3V2YA 1D3JA 4DAJA 195LA 3DKEX 3GUMA 3SB8A 1L87A 162LA 1CVKA 3HWLA 4PK0A 252LA 1SXDA 1OVKA 3DN2A 2LMRA 3F9LA 1G0QA 1L09A 4PZNA 2QARC 3FA0A 1G0MA 1L16A 1QTVA 2O4WA 3GUPA 3SN6R 1P2LA 3KKAA 4EKQA 3C81A 4IAPA 5LZMA 1CV6A 1L94A 1C6QA 2O7AA 1L43A 1C6FA 1P64A 1DYEA 1L88A 1L86A 1RG6A 5I14A 1L01A 1P37A 3HH3A 2ES6A 3C80A 2EAPA 1L20A 2QARB 1OW5A 235LA 4W54A 1PK1B 142LA 210LA 172LA 2EAOA 233LA 206LA 3HTGA 1T8GA 1L39A 1L32A 2B6WA 1QUDA 1L31A 3HT9A 251LA 239LA 137LA 258LA 4I7SA 1C68A 1ZYTA 214LA 3EMLA 3NY8A 4DKLA 1L82A 4ARMB 1LYIA 4I7PA 224LA 1ZURA 1OWZA 1C61A 1C6MA 180LA 1L33A 1L63A 222LA 1Z1VA 1L58A 188LA 246LA 1L62A 175LA 3LZMA 4EKRA 3C7YA 3GULA 1L37A 3TACB 2CUUA 1EPYA 1LGWA 1L81A 228LA 2OU9A 2E8NA 1L29A 1PQJA 3G3WA 1D3FA 2RB0X 2RBNA 4W53A 1CTWA 2B6XA 1G06A 3GUKA 4I7NA 3C7ZA 1L52A 261LA 1JTNA 240LA 131LA 1KS3A 1LI2A 1LYHA 2B6ZA 256LA
chains in the Genus database with same CATH superfamily
3GFKB 1KNIA 5F81A 2LYMA 3BKHA 200LA 2ZIUB 4F4XA 2IOHA 1VDVA 2D3DA 4Z3MA 1N5XA 1LJIA 5GTIU 2DQJY 1C6LA 2Q9DA 3P68A 5I54A 3J6KA 4G9BA 1CUQA 4GCEA 1DYDA 2YBJA 1L3TA 4IATA 1VLBA 5J8YC 4L41A 5AMYA 2ANVA 1L18A 4WLTA 3ZEKA 1PUZA 5D5CA 3KFUF 4UB3A 4UW9A 1L06A 5BOMA 4QWAA 4NLCA 144LA 4YMOA 9ICHA 1IVMA 1B5YA 1LHJA 1L50A 2NRZA 102LA 1LYEA 2F30A 4RNMA 4B9LA 3C23A 1GFVA 3QAKA 5AKEA 5ALTA 1U45A 1RQNA 2IFFY 1KFTA 1BHZA 2I1QA 2VKQA 1A6SA 4QEQA 1IC5Y 1MSWD 4ED3A 1QTBA 3N7RC 1UQVA 1NK9A 4EX6A 2OYYA 3WMKA 255LA 1LZ6A 1GWDA 1L05A 1L85A 3KKAC 1CU0A 3RZ4A 4NM1A 2W9CB 159LA 1YAPA 4WJ3B 4QGZA 3QE9Y 4IS7A 1F6SA 4DF4A 1L0KA 1LYJA 3QZ7A 2BQRA 4MFAA 2RDJA 2D4KA 3GV8B 2J6TA 1JHLA 4GN5C 4DL5A 4DO9A 3JR6A 1EQ5A 1XGRC 2RHFA 3GUNA 1YKZX 1VDQA 1B7OA 2LHMA 1RE2A 4H8XA 4ED0A 3HILA 1GE0A 4CF3A 2G06A 3MFHA 1L49A 4KTQA 3OTQA 3QYPA 1LSBA 3KOOA 2BDPA 2I5HA 1O08A 3GXRA 2K60A 2LYHA 4HTKA 4JV2A 3A6BY 1JROA 3Q8MA 1N2XA 4Q43A 3NYAA 3EMSA 1CV5A 151LA 4I27A 4QZFA 1CKFA 4QZIA 4LZMA 3RB0A 3HDFA 2Z7JA 3DV9A 3H8WA 3G3VA 1ZRMA 1SV0A 1BGIA 2XICA 5HMMA 4IASA 4ARMA 1URJA 1PS5A 4CFPA 1KIRC 4DD0A 1SL0A 3RUNA 2RSCA 5DM9A 9ICMA 1IC4Y 2E5SA 8ICAA 1YAOA 5DG8A 4PGYA 1I20A 1PQMA 2PI4A 2DQAA 2JGAA 5KG2A 5J0WA 4O3OA 1L28A 1GF6A 1L65A 1DXSA 4H8ZA 3JPOA 3W6DA 199LA 2I26L 2DL0A 1B7SA 2OTYX 2HEEA 215LA 2KJ9A 2FDRA 4RQ5A 1L3SA 3SENA 1GXXA 5ALWA 1JXLA 259LA 1IWZA 1L14A 2RAYX 4OWAA 4ETEA 3I76A 4ED2A 1YQVY 4FJRA 3W6AA 4IL6U 4PHAA 5DGBA 4YX7C 1QUGA 1JKBA 2BGWA 1QSYA 1NK8A 5KG3A 1B5WA 3JPRA 3FAHA 1BWIA 4J1BA 5J0YA 5KXXA 5J8YA 4DD1A 2F44A 4YD2A 4F50A 5ALRA 4R8UB 3F2DA 1JTPL 2XIDA 5E9RA 1D0LA 7ICOA 1UIBA 3A3QA 1XU4A 5F9LA 3L3FX 1NK6A 143LA 3L5KA 4ED8A 2PC2A 2ZQ3A 2KJ8A 2F32A 4ARQA 140LA 5HLLA 2KICA 4KMUA 1C46A 3A0HU 5JRTA 4RQNA 3HJEA 1CJ6A 1KY0A 2HUMA 2W11A 3CDQA 1TDYA 3HUQA 2A19A 3JPPA 4ET9A 3HH5A 1YANA 3N97B 5F9UA 3HW8A 4DSIA 3C1ZA 1L55A 2B74A 2BQKA 1QT7A 3P64A 4M6WB 4NHTA 4I7MA 1QSLA 5J0OA 3TARA 2OH2A 5KY1A 5M1YA 5J2JA 168LA 4K4HA 4NL9C 4J9QA 4DD3A 4KLOA 1SKWA 2A1JB 4J9MA 238LA 3Q8LA 1C6AA 243LA 2HEDA 1S8OA 1C6JA 5FEKA 4RW2A 4B4IA 4NGOA 153LA 2ZIWB 1NJYA 4Y2SA 4Y2XA 3F5EA 4QNLA 5HMLA 4C80A 1XO0A 4F4YA 1NNLA 4TSCA 2ZXHA 3QZ8A 4W57A 5KFBA 1NQIA 1DYFA 1HEPA 1KXYA 2WF6A 1B6IA 2B7XA 4DFDA 5KFKA 194LA 5KT2A 1B43A 4EELA 3QUTA 1S5LU 3CT5A 2NTGA 1L92A 3LZTA 5LXWA 1SSYA 2EZZA 2LBOA 4FBUA 2DQHY 2QB0B 1ZMYL 2NYVA 4WG1A 1XGPC 8ICVA 1NWGA 5ALNA 4I7TA 3Q8PB 2BCQA 3T79A 1LHMA 4XENA 3NVZA 2NWDX 4LT3A 2ZTDA 1JKAA 1AKIA 4M6WA 8ICJA 1CU5A 1L53A 1LHLA 212LA 4E97A 5F3XB 8ICNA 1XJUA 1QS5A 3P66A 2QKQA 3PMLA 1L80A 5LVIA 5KKJA 1UHUA 5AM3A 9ICIA 4FS1A 1CU6A 3MBYA 2AQ4A 3MGHA 3G3XA 2B70A 1JQUA 1IP6A 1UA6Y 1KFDA 1OUGA 4KITB 1LZ9A 2HU1A 2YBNA 4B9VA 5J0PA 2K8CB 1F0MA 4RZRA 1ZQPA 2OM6A 1K28A 2FYDA 1LZNA 2LZMA 3C8SA 4KXIA 5L3HA 4G49A 1ZD3A 1DQJC 4EEKA 1AT6A 3PX0A 3BS5A 3N28A 4NGIA 4I2IA 1J1XY 4O3SA 1GE3A 3WH1A 1ZQYA 4DYGA 3EWAA 1SWZA 1LWGA 4TWSA 3WW5A 5TZVA 6LYZA 1N63A 5FSTA 4BAPA 3KZIU 2RP5A 4IQTA 1T8AA 1UIGA 2G5IB 1HF4A 1OUCA 2Y8PA 5C6IA 4AYBC 2B73A 5LVKA 2ZXIA 1LMOA 1GFUA 5KXLA 4DJHA 8ICOA 4RNNA 3A6CY 5HNCA 4Q44A 1ALCA 3HT7A 4MHVA 189LA 1JIYA 3UMGA 3RZEA 2C22A 4C4RA 1BVSA 4KLLA 1NKHA 1TBYA 1LZ5A 1CKHA 4CJ2A 1B5VA 1DYAA 1B7PA 1UIFA 4JMUA 2BQ3A 5AKZA 1QUOA 1XGQC 2EDUA 5KFUA 8ICKA 7ICSA 170LA 2UVRA 2W43A 3H7IA 4RQ4A 3GQCA 5AKKA 5ALPA 4ZOHC 2RRDA 4Z6FA 5KXRA 1BVXA 1L7PA 4UAWA 2BDUA 133LA 3WU2U 3HU9A 4QZ8A 2GOLA 3K75D 3TXDA 2WFAA 4H9AA 1L46A 2RH1A 3C7WA 4I8SA 3JPSA 2KVCA 2W8LA 3MGVA 4XN6A 1GE1A 5IIKA 208LA 8ICCA 1P56A 1L40A 1YAMA 4QZBA 1Z4OA 5AKJA 4DSLA 2YSSC 5KNIA 1OUJA 1D2YA 3V7KA 5KG7A 3A8ZA 115LA 5B5EU 5L1KA 4CE6A 1MQ2A 4I0CA 3NASA 4UQGA 4TUNA 1P2RA 4GCFA 4K4IA 1HSWA 2MUTA 4I2DA 2BPGA 1LSMA 205LA 1X2IA 3MDCA 2N5ZA 2F77X 4YP3A 2FLNA 1X66A 2Z12A 1GFRA 4RUCA 4NLNA 1P6YA 1DGJA 4YD1A 2XBSA 4KLHA 3NUQA 3RBEA 8ICPA 4YXAC 2LM4A 2OEHA 4NXZA 150LA 2HBKA 2K89A 4GC7A 2M0NA 4RQ6A 2IBKA 1CKDA 1CX7A 5B06A 2PFQA 3ZDCA 5I4YA 4ARPA 4F4ZA 2FMSA 1IWYA 3HX0A 1VEDA 3DN0A 132LA 2RB2X 5ALMA 1V9PA 4ED7A 5AI9A 4HSFA 3NVWA 1F10A 4ET8A 3ED5A 4BX9C 2HEBA 4F5RA 1KEJA 1XSPA 3SAGA 3T6UA 1FLWA 2OE7X 2BQCA 4DSEA 1WWVA 4JWMA 5KL8B 4UAVA 4E3UA 4WLDA 2F3NA 5KXOA 4KN4A 3LWMA 1JTOL 3NS1A 2FPMA 5CA7A 1HC0A 3K1ZA 2Z2FA 3V2WA 1PK1A 5LYMA 4P0QB 108LA 1WUDA 1T97A 4PL1A 3RB3A 4WM4A 4WO6A 5IIJA 4ELUA 4YXMA 7ICFA 5AICA 1SGGA 201LA 1AT5A 2H9JA 4OJPA 4QWBA 4H9FA 3WYHA 4W55A 3NRWA 3T36A 2R18A 4DAJA 4F4WA 195LA 3VWOA 1D9DA 1SZHA 5KXYA 3CT1A 1Y88A 4RQ7A 3KHHA 1L87A 3C2LA 1REZA 3AW6A 1OVKA 4FBTA 3F9LA 1G0QA 4GLXA 1N56A 5C5JA 5A3ZA 3AQEA 4JB3A 3PSIA 4Y2JA 1JX4A 2KJ5A 1HEMA 3IJVA 1S0NA 1TAUA 4PGQA 4EKQA 1Z55A 2G4NA 2I25L 4IAPA 4NLZA 5LZMA 3TMUA 7ICTA 2EQYA 4F5QA 9ICOA 1L43A 1LZ1A 1P64A 3WU8A 5KT7A 4R63A 1S10A 5LINA 5CR0A 1ZQLA 1ZJNA 5EE1A 4QWEA 2CGIA 5DBAA 1L6NA 1ZQAA 1PK1B 4WM2A 1D9FA 1QUDA 1DI4A 1JALA 4X5VA 4DF8A 1ZQNA 258LA 3HBDA 2BPFA 5L9JA 1DK2A 3PR4A 5LAGA 4BWJA 1IOCA 5IINA 4TSBA 5KXWA 4HJVA 4RLNA 1JUDA 3TKAA 3K3TA 2BLYA 5T14A 4I7PA 1C6MA 180LA 1L33A 3S6JA 5B66U 4XJIA 222LA 188LA 1L3VA 1XSNA 1CKGA 1YKYX 5AKLA 1L62A 3TFSA 2HHVA 1WVUA 1GF3A 1LMNA 3IWRA 4H9IA 4H9HA 1KSPA 1LKSA 3P4ZA 1LMAA 1LYOA 3C7YA 5KFAA 3SV3A 3TACB 1IP2A 2DF4B 1LGWA 228LA 5EE0A 5K7OA 3G3WA 3V6HA 4CGZA 1A76A 4TUQA 3WW6A 1YZ7A 4W53A 2KIWA 4UB2A 3T5KA 4UAZA 2XVTA 3AYQA 3C7ZA 5D4BA 1TK0A 2ZNXY 3RH5A 4Z98A 3T5HA 4F4KA 5HR7A 240LA 131LA 4GCDA 1LYHA 3G6YA 4O5KA 1XSLA 1TV9A 1HMKA 4I2JA 1GFEA 256LA 3VW7A 2AUBA 3HH4A 4H93A 2KOBA 4GXJA 3BS7A 1CU2A 3GDXA 2BQDA 3ZDDA 5KG1A 1FKVA 3GIJA 1C69A 3B0IA 3OPXA 1IY4A 3RFAA 1PVQA 3FYHA 3V7JA 146LA 5AIAA 4IQWA 2H3ZA 3PSTA 2R8HA 1CNSA 1FDLY 4JV1A 1LSEA 2VA3A 3F5AA 3PR5B 1CV0A 4GCBA 2YMQA 5D5FA 2EQLA 5KFYA 4MFCA 2D4IA 2QB0A 1HEQA 1IWWA 1J1PY 4XYYA 2HEAA 4OD0A 1T8EA 211LA 4LYBA 2YMMA 3HFMY 3GIMA 2ISOA 3RU5A 4QZ9A 3BQ2A 1L74A 1C6NA 2HULA 3QUBA 2KG5A 3SEIA 244LA 220LA 2RB1X 5KFLA 1LPIA 2YMPA 3B6LA 4QZEA 1QSAA 2KFNA 4MEYA 1KTQA 1L90A 2LC9A 2OU0X 4OWCA 5C0YA 2QB1A 3HDEA 4TUPA 9ICFA 4K5YA 1DK3A 2ZIXB 5KFXA 3C8RA 3BDPA 2Z18A 2LZ2A 1FFUA 2BPCA 1IO5A 1T7PA 1GE2A 2OTZX 4F93B 2KV2A 3ZD8A 3TAPA 3CSRA 5AI5A 1S76D 2WF5A 5KL1B 1WQQA 2FBBA 4Q8EA 2K8AA 5DN5A 1LYDA 112LA 5DKWA 5HNLA 1LYGA 4J9OA 1FBIX 4I2CA 1NDGC 2LYZA 3PV8A 2H3IA 2XBRA 1NKEA 1SV4A 5DQIA 149LA 1GBSA 245LA 2D91A 2YBLA 3W6FA 4PPXA 2EKSC 4NIJA 3IHQB 4B4EA 1BNPA 1G0GA 209LA 1SB3C 2EANA 1SWYA 2IA6A 4ML7A 4DL4A 1LSNA 1OWYA 1KW4A 4PZOA 4C7ZA 4GCCA 2CPRA 3QEBZ 4FDYA 1KLNA 7ICGA 4ECRA 174LA 1T3NA 1ZQMA 2BAAA 3RH4A 4EEYA 2F1JA 2Y1JA 2RBPA 3DMVA 104LA 1ZQKA 4O3QA 3OE8A 4XJFA 3ODUA 4KLFA 2ASDA 1LI3A 192LA 4J0LA 3MR6A 5HQ1A 3ORYA 4YG2A 8ICIA 1C7PA 1L13A 1XSFA 5KXTA 2PFOA 5KFJA 3A94A 1DOQA 1WTHA 1JN3A 3PO4A 5DB8A 1DI3A 1ZETA 9ICKA 103LA 1L69A 5JU5A 1LZ8A 1ZYQA 5KT4A 1JITA 1ZQDA 7ICLA 2ZJ8A 4UB4A 1A4VA 5ALQA 1C67A 1QSWA 2Q9EA 1NJWA 4XRHA 1UC0A 2OCEA 2AXTU 5KFPA 2ZIVB 2KSOB 4KLIA 5LYTA 1JTMA 4DSKA 2BQJA 1JKDA 4Z41A 4WLYA 3NVVA 4Z6CA 1UA0A 3D9AC 4Y2RA 1J2NA 3AEVA 2FMPA 1BWJA 3QUQA 3GXKA 5AKGA 4F5NA 5IHGA 3B0YA 226LA 5DL9A 2XGQA 4ECYA 1ED1A 4I2BA 1L76A 4BDPA 3MGWA 2XCAA 5LVJA 3MR3A 3SAFA 1B0XA 3EUB2 5AKXA 1NF5A 4G9SA 3SB6A 2XY6A 3ETLA 3A93A 4LFXA 1LWKA 3OJSA 2KZMA 1L73A 3SR6A 242LA 262LA 4EXMA 1JIHA 4Y2PA 4PRQA 1B4FA 5L1MA 1IIZA 4R0FA 229LA 1KRPA 3PNCA 3HTFA 4JV0A 7ICPA 2DQIY 2HHSA 4O9MA 2V4RA 1DYCA 4NG8A 1IORA 1L44A 2KEYA 2DFLA 4LZTA 1L54A 1ZQXA 3RRHA 2ZTEA 1GB8A 5J2CA 5ALUA 1LKYA 3FI7A 2BCVA 8ICLA 1L98A 4YOPA 2DQGY 2ZYPA 2C28A 1CU3A 4DQIA 3SAHA 2W1LA 3F53A 1HERA 1CV1A 1T94A 3C2MA 1KL9A 4DL7A 2XCPA 1GB3A 9ICCA 4P2EA 3DMXA 5ALEA 2ANXA 4DD2A 4F72A 9ICJA 4PHIA 3AZ5A 4HPIA 2JRZA 2RBOA 2H3FA 1L42A 3OHAA 3F6ZA 1HEOA 3FE0A 4NGLA 4YCXA 1G7IC 4RQ0A 1HUOA 7ICKA 4NG1A 4EOFA 1IX0A 4DS4A 125LA 3AU6A 2DUYA 3UPQA 2DPIA 3RH6A 3SB5A 3ZI4A 236LA 3A96A 3FM9A 3A0BU 4IJ4A 5F16A 5ALLA 5D46A 3PX6A 1BB3A 2GWSA 4F71A 1CV3A 1L10A 1NOMA 1D3NA 1SWWA 9ICEA 1HEKA 4C4SA 5ALHA 2HHWA 9ICRA 4G3IA 111LA 4DDBA 4NSIA 2NO5A 1SL2A 2K4IA 1G07A 4BXOA 3N9AA 1IP7A 4P4OA 1TK5A 1OUQA 2NRXA 1L34A 1U48A 1QTMA 2Y9UA 1LW9A 3BJYA 5KG6A 4GLVA 4BJQA 3SBBC 5AK6A 3SD7A 5I53A 7ICMA 2K8BB 2LYOA 8ICGA 2RBQA 1I1ZA 2JEJA 2GV0A 7LZMA 1GBZA 4IR1A 4DLEA 5J0UA 5DB6A 4H94A 1BPZA 3VC8A 2E8OA 2XY5A 3E3DA 3WK7A 1AROP 1G0PA 3OK0A 1KFSA 2FJ6A 4DSJA 1NMMA 5IELA 1C6GA 3H8MA 1JSFA 3E0FA 4RT2A 1L24A 248LA 4D9ZA 3M6KA 1XEJA 1DGSA 1P3NA 4WM6A 1LSYA 4I7OA 4N9RA 4C3WA 4HPEA 2Y9TA 2VJ5A 5AM0A 4H8YA 5KFEA 2HI0A 4FZLA 4R64A 2YY6A 3M8SA 1IWUA 1ZQ1C 1RYSA 3GUOA 5DLAA 2JV3A 3B9JA 5HHIA 4J9KA 1F44A 1JI7A 2PI5A 213LA 2VIXA 3CNHA 3BQ1A 4IC9A 4Q45A 4M47A 1L61A 3UQ2A 1E8LA 5KFTA 3RJFA 4EKPA 1UBZA 1Z1BA 183LA 3ZD9A 126LA 1KIQC 4TQRA 1IWTA 2FMQA 1WYGA 190LA 1LPYA 3WPJA 5KT5A 3RW8A 1B5ZA 3TAQA 1QUHA 2YBMA 4ETBA 4DCCA 2V9WA 1IM4A 5AIBA 1SX2A 4NHQA 1DYBA 1IP3A 1OYUA 5ALYA 1OVJA 3HTBA 4M6DA 2KMDA 1L3UA 1REXA 1L35A 4N8ZA 4W58A 1VATA 1GDWA 2FYCA 4DFMA 2FE9A 3C83A 4EYHB 3M9NB 1B5XA 3AM9A 3QU2A 5IIIA 114LA 1ZQFA 1ZQUA 2PFNA 4P0PA 1XEPA 1L64A 4OJLA 4Y2YA 4DOAA 3EYZA 2DQCY 4M2YA 4W96A 120LA 4ETAA 4PHDA 5ALDA 1ZQBA 4CHXA 4M9JA 2KKVA 2BPUA 2W04A 4EPFA 4JWNA 4DQ5A 1LGXA 3Q8KA 253LA 1L7NA 2RBRA 1JXEA 4XUSA 1G1WA 1ZQOA 1GFAA 1L57A 4NWEA 4TX7A 4YXCA 1D6PA 3DMZA 163LA 2XI9A 123LA 5FHWA 4X3BA 4P0QA 5KXKA 4QZHA 3T3FA 2AGPA 167LA 3B72A 1L38A 4GN3A 1BGXT 2DBTA 221LA 2DKVA 9ICSA 1UA1A 2HSZA 3AGHA 4YR2A 3D3DA 1L5UA 5EBHA 5B1GA 1L45A 1LZDA 4DT3A 5TISU 129LA 5KXZA 1L68A 1LMQA 4KT3A 1BWHA 1X9WA 2XO7A 1L60A 4ANRA 2E8MA 5DQHA 2LZTA 3SI8A 1KXXA 2ATLA 3JPQA 5HP4A 1JJ0A 2EZYA 3L2XA 2ZIVA 1IOQA 1LSDA 2BQFA 1IOSA 1PZNA 3TI0A 241LA 3AW7A 4JUZA 4ARLA 4TUSA 1SXEA 4QWDA 4F3OA 4U6PA 1ZQSA 186LA 1DXJA 4ELTA 1ZQGA 4LDEA 2K4EA 4IR9A 5AI8A 2JEFA 197LA 2D8CA 1LVHA 5KG0A 1LSAA 4NLBA 2N1RA 4FFDA 4H9EA 1ZQIA 1OV7A 1GFHA 1XWLA 4EJ4A 2ASLA 1XGUC 1L25A 1C60A 4HJYA 3M9OB 5BPCA 4PJ0U 3M7DA 2EIZC 3V2YA 1D3JA 2Q0ZX 4Y2TA 4LJXA 4NV0A 4F5PA 1B0DA 5ALGA 1WTMA 3RT5X 5ALVA 4RDSA 2HBMA 4WM3A 2BQLA 2LMRA 3W6CA 1L09A 4EBDA 2Q0MX 4PZNA 2W3SA 3MR2A 4ECUA 7ICHA 2W9BA 4I2FA 5KFOA 1RI8B 5J2FA 2BQHA 1LHKA 1G0MA 1UUZC 4UBBA 3GUPA 4H90A 3SN6R 1SWVA 1K5OA 1ZQWA 4XA5A 1LJJA 4B6JA 3C81A 4ZH4A 2BQUA 1T4GA 2HW3A 4QDNA 2O7AA 4XADA 1C6FA 3N9CA 9ICWA 4AP9A 1L88A 3LHMA 2ZWBA 2MEHA 2WB1C 1RG6A 3KD3A 2LI6A 1LMTA 2ISPA 4KLMA 1D8BA 2QLTA 5EE3A 2ES6A 1OUDA 3C80A 2EAPA 3WK4A 3H0RB 5KTQA 5JUMA 2C8OA 210LA 7ICRA 233LA 4M9LA 3HTGA 5ILCA 2E1EA 4DWIA 1L32A 2B6WA 3M8RA 4Z6EA 2Q4TA 1LZEA 239LA 2WB1F 137LA 5LA5A 3EZ5A 3NY8A 5G5GA 4RU9A 4CCHA 1GO3F 4Z6DA 3EXDA 3LN2A 2W9AA 1LYIA 5JENB 2E3TA 2W54A 224LA 5AI6A 2FLLA 1FIQA 3H40A 4IRDA 193LA 2HDOA 3WKBA 1ZXIA 1WVVA 5AM2A 1IR8A 1NK7A 3ZDBA 175LA 3C28A 3LZMA 3G6XA 9ICAA 1SIJA 1L81A 1PQJA 2RB0X 4XJDA 5AKHA 1CTWA 2HTXA 1G06A 3GUKA 2PMZF 5LA8A 1FKQA 3A92A 3ZDEA 2YBIA 4AGAA 1L52A 4KX5A 1JTNA 1FLUA 4NHSA 1LI2A 4ICAA 3MABA 4RQ8A 1EQ4A 2B6ZA 3TXGA 4YF2A 1WQMA 5KFDA 1IG6A 4DFKA 4C8MA 1PQKA 5IDDA 8ICQA 1J1OY 3PSPA 2ZIXA 4LDOA 5KXPA 2IHMA 4I29A 198LA 3GILA 2JH7A 4EX7A 4N0JA 5EWFA 1QTHA 3TXFA 1L75A 2KZZA 4J9SA 4O34A 3LYZA 152LA 5KT6A 1C6BA 1L97A 1LKRA 8ICWA 4AXTA 2Z38A 1KXWA 4DOCA 1MC8A 1B7NA 1HFXA 5J2BA 107LA 1RM6C 2GH1A 2VA8A 1LGUA 1M6YA 2A7DA 1QT5A 4NJ8A 4QZDA 5AM1A 2IHLA 1CV4A 3TXHA 2MAXA 3RB6A 1BB5A 3AMZA 1B7LA 1C08C 4RUAA 3RR7A 2HHUA 3RB4A 1OP9B 2W7OA 1QS9A 4A8EA 2BR0A 1AM7A 1SLYA 4P4PA 1QTDA 2ZIJA 4PJ2C 1PQOA 1UCVA 1TLAA 2MEBA 4I7KA 3TMXA 4AQNA 4DDCA 3H0LB 2JZBB 3KTQA 1L70A 3HH6A 2K4PA 2OEAX 237LA 1D0MA 1C6TA 2W03A 3UXNA 1F6RA 5B59A 1C64A 3HP6A 1K1QA 1L21A 2JMGA 1L0JA 5LIOA 3F2CA 3WKDA 1D8LA 4I2AA 2F1IA 1N5WA 4U7CA 1QTEA 2KN7A 1RYUA 2V4QA 3GU3A 4NGZA 2W55A 1X9SA 118LA 1ZQHA 4TQSA 4W94A 3ZVQA 1L36A 4QW9A 5ILFA 1Z19A 5FELA 1C6PA 2B6TA 165LA 4QIWF 5LYZA 4DS5A 2JHDA 3RJEA 1QLNA 4LYTA 2BCUA 5AI0A 4QZAA 2KFZA 1JUGA 2KVSA 3HT3A 4EZ9A 1LMPA 1YL1X 4IQUA 3MC1A 1L96A 2WF7A 1V7TA 1ZQZA 1CJ9A 2OE4X 169LA 1S0OA 1LSGA 1BPEA 3KHGA 2BQOA 3HTDA 1N62A 3RR8A 4DL6A 3GUJA 3PDSA 2FI1A 1BB7A 8LYZA 3G3AB 9ICNA 4H92A 4ARQB 1DZBX 1G1VA 1DRGA 2DBYA 1L72A 4HTQA 2W1MA 3MFIA 1G7LC 4B1AA 4LYZA 1LYSA 5ALZA 2KK0A 5J2KA 4UB1A 7ICEA 3OJPA 4YMMA 9LYZA 1Z00B 3Q8SB 4B9NA 250LA 3CDTA 4QZCA 5L9XA 1PQIA 3LYOA 176LA 2W9CA 4I7JA 161LA 2W3RA 1DPWA 1NHBA 2JEGA 3CDOA 5II3A 8ICTA 1L77A 5J2HA 1QQ5A 1LOZA 4ECZA 2ZIKA 1LKYB 2KHVA 2NRWA 2F47A 5E4PA 4PHEA 1C6HA 1DYGA 157LA 4CFOA 3QNGA 1XGTC 1HIWA 7ICJA 1UCOA 1G7JC 1IIPA 1O23A 4NSHA 1ZRNA 4TTDA 4M04A 2ZJ5A 2F2QA 1HNLA 4DEZA 1SKSA 9ICGA 2UVVA 5D49A 3GIIA 1D3MA 5B05A 5DG7A 1LZ4A 1L8LA 2DGZA 3TMWA 4ZIXA 2XJWA 4KL7A 3PW7A 4Y2VA 1RFPA 3K1RB 5KFIA 5J0TA 2ZQ4A 5J2GA 4NWIA 4R8UA 1IWXA 2WAQF 3N4MB 3RTVA 4I7QA 4NGWA 5APFA 2HBLA 5KFCA 2VJ4A 1QT8A 3T5JA 3RJGA 2ESEA 3HBEX 4WOAA 3UM9A 3ZDAA 3WK8A 1FO4A 1KBUA 4F91B 1OQMA 4OW1A 2F4GA 4R65A 3L64A 3RAQA 2HVHA 4LDLA 4RQ2A 1GF9A 1YROA 4USAA 4YXJA 2NV3A 1KQQA 2JZBA 2KZ3A 4W56A 1OUFA 5I4WA 4XJBA 4OJ5A 4PRUA 2P35A 1QQ6A 4WL6A 4DFPA 1L7MA 173LA 1SX7A 1COKA 2ZNWY 4PGJB 3B0XA 1VDTA 4EYIB 4EMNA 1L47A 184LA 1WWUA 1PQDA 4Q8FA 1TAMA 1QUTA 3AZ4A 3RBDA 3PSFA 5T3FA 1UT5A 1W08A 3WXTA 3FDSA 1RXWA 4C8KA 5A0LA 3C1YA 3EW9A 3AQFA 1JPOA 4NM2A 4QJFB 1HENA 4F92B 3HRDD 1JRPA 4MF2A 2LYBA 5K4LA 1L41A 227LA 4NSGA 1QTCA 1PVRA 1LHHA 1XS9D 2Y0SC 4P2HA 1LJFA 2C2RA 1D6QA 5EWGA 1CUPA 1UT8A 1NDMC 1GEVA 1QTZA 3GIKA 2F8KA 4W59A 5APCA 5I5QA 2IGCA 182LA 2H3QA 3QU4A 3KHRA 4NLGA 2LCBA 1LHIA 1ZJMA 1HMLA 1CEZA 217LA 2ALZA 3I1YA 2CJLA 1P7SA 1HUZA 1LJGA 4WMGA 2D6BA 3FADA 3NRZA 2BCSA 1WQPA 5DN4A 4NLKA 2BQNA 1KN5A 4PPOA 4CF5A 1BPXA 1RQLA 1EL1A 3W6EA 1GFTA 2WTFA 4EZ6A 4BADA 3QX7A 1KKXA 6LYTA 4ACOA 5J0XA 1NI3A 1QTKA 2BLXA 3WK5A 4CF4A 223LA 1XNSA 4NEBA 5CJ7A 2B5ZA 1GF8A 5J2DA 3CSZA 7ICVA 4ECVA 8ICYA 3KAMA 178LA 2BQBA 3TMVA 1L04A 1YL0X 1GHLA 5F9NA 4RLMA 2G4PA 4XJGA 5KFNA 3K2RA 5DBCA 4US8A 2YQEA 2VA2A 1TKDA 2NTHA 156LA 5CWRA 1BQLY 1NBZC 3QUCA 5A3EA 2W1XA 3RAXA 4ARJA 1FLYA 3AN1A 2WARA 4HV2A 8ICBA 3HT8A 5J0RA 4DQRA 3KHLA 4ED6A 9ICXA 1GAYA 1VDSA 3C82A 4I7RA 1N4FA 4WLXA 4MEXA 1HFZA 1YAQA 1LZCA 4I2EA 4KLSA 1L59A 1KDHA 4DL3A 1ZQJA 1EXNA 3BZCA 2RQ5A 2K4HA 3CB7A 2BQAA 2F2AB 4N5RA 4NGVA 1L7OA 1LZYA 4LYMA 1H6MA 2B21A 232LA 5L1IA 3C8QA 4N1CC 1C66A 2MU2A 2KKPA 1QT6A 4J9PA 3N7PD 1CX6A 3EO5A 1ZVHL 1GF0A 2BHNA 2EH9A 3O0FA 1BPDA 2R8IA 1LMCA 1WCNA 4C8LA 2HEFA 141LA 1QSQA 5FP0A 2MRLA 2HCFA 3OE9A 5B07A 1QT4A 5I4XA 4KLDA 2PMZC 3TXEA 4DQSA 1C62A 2A7FA 3WK9A 1KY1A 4YEMA 1UIHA 4EPIA 2CN1A 5AK4A 4OWEA 5KFSA 1YZ6A 3WPKA 216LA 3PMNA 1XJTA 4Y2QA 1DKJA 1LJNA 1BPYA 1N61A 1VJ5A 2PKEA 1CUKA 2VANA 4RPYA 113LA 2WF9A 1GPQC 5DDMA 1KW7A 3CDVA 1LV5A 1RCMA 8ICHA 1ZD4A 254LA 1LZAA 4O5CA 4W51A 3A91A 4O5EA 3AB6A 2KSOA 1C6IA 3B0KA 2XGPA 1P46A 2UVWA 1NHEA 5G5HA 5KG4A 2G07A 4H9BA 4OOOA 3E2EA 4J9RA 145LA 3RJJA 2ZIWA 3H8SA 4GRVA 4C4TA 3LK9A 234LA 3SB9A 4LYCA 3WULA 3OE0A 2JXJA 1LYZA 1X6JA 8ICUA 1XEKA 3OHBA 4NFVA 1MN8A 1IV8A 1L19A 3BKVA 147LA 4OOTA 5F9XA 1V38A 2RAZX 1C45A 4ED1A 3CYMA 3TQ1A 4GLAA 1QH9A 3D2NA 1G0LA 3QXGA 164LA 3TXKA 2B0CA 1Q3UA 1WQOA 1YT3A 3C2KA 3L4PA 2LPEA 3TADA 4ECWA 1UIEA 1G7MC 1L95A 2HBJA 4RQMA 1L23A 4R6CA 4YFKA 1X9XA 1UIDA 196LA 2R8JA 1JSEA 5DDYA 3WKEA 1JEFA 2H5XA 1QQ7A 181LA 1GBXA 5APEA 1OUIA 4EBCA 1GFGA 1IR9A 1B9OA 3SQIA 2L78A 4I7LA 2Y0SF 2YBHA 3SB7A 3HBHA 4KLQA 4BAFA 3GUMA 1CJ8A 1B7MA 1J97A 3M9MB 2IMWP 3HWLA 4PK0A 4O3RA 1X6IA 1AZFA 1SXDA 3DN2A 5KG5A 4KLGA 1YKXX 1RPLA 3KZXA 4B9SA 1LZTA 1Q3VA 4GC6A 1WTNA 1IOTA 4PGXA 3A34A 4YQWA 4XJHA 1C20A 2KD1A 1T3QA 3V6JA 2AGOA 3KKAA 1H87A 1X9MA 5APDA 4DQQA 1HJPA 4J9LA 3BZKA 4M9HA 4DQ7A 1DYEA 1L86A 4LVSA 5I14A 1TEWA 2DWQA 1L01A 2ZG6A 4I28A 3ISBA 2XC9A 1NBYC 1GBWA 3OJUA 2HHQA 1NJZA 142LA 3WUAA 2AHOB 2YB1A 4UB5A 2EAOA 206LA 1L39A 2RLTA 2W1YA 7LYZA 5J2IA 1A77A 4MF8A 4ELVA 4F8RA 1L31A 1GEZA 251LA 4N1EI 4RNOA 1F0WA 4UWNA 4I7SA 1ZYTA 2A3VA 4OWBA 4DKLA 3SZ2A 3IP4B 1IC7Y 1L82A 4J1AA 4GIBA 4RW1A 1GE4A 2HOFA 3RNXA 8ICFA 4XQ8A 4UAYA 1LZBA 3ALRA 5DGAA 4PHPA 5KAFU 1OWZA 1C61A 4C5FA 3SMVA 1L63A 7ICNA 2ODGA 1XC9A 246LA 3CP8A 2W8KA 4O3NA 4LT1A 4EKRA 4OCZA 1RYRA 2EPEA 4HTNA 3WK6A 1TFRA 2C2EA 2OU9A 3LDAA 3LYTA 4YENA 1L29A 4FE3A 3C5FA 1D3FA 1HHLA 3M3UA 4LT0A 4ETDA 3Q8QB 5KXMA 3H4DA 9ICBA 2MEDA 1GB6A 3JPTA 2Z2EA 1LZSA 2ZUCA 1B7QA 1IEEA 1KS3A 1MQ3A 1LCNA 1NJXA 1JTTL 1PZYA 3AL0B 2GO7A 2OXOA 138LA 2B6YA 3QY4A 2F76X 3H0MB 2HECA 1ZQEA 3CT0A 4CDGA 1KIPC 4YR3A 4F5OA 4QY9A 1FFVA 4HV1A 1U47A 3OGUA 2A1JA 2AH5A 3C5GA 2DQDY 5J7CA 1D9WA 1IP4A 2BQGA 3RJKA 1L02A 1JMSA 2LM1A 3SP3A 1NZBA 3PY8A 1LSZA 1ZV5L 5J2EA 4F2SA 4DQPA 5HMJA 2XY7A 3OSPA 3AGIA 1L67A 2M9NA 4YR0A 2GLEA 2KIVA 1L03A 3M6ZA 3NTUA 3QU5A 1DKKA 1L15A 4CRXA 2OE9X 2E8PA 1V7SA 5LVHA 1B22A 1VDPA 2Z39A 2HUKA 1OXJA 5JTIA 1IXRA 3ISDA 2Z37A 4KLUA 5KFGA 1LSCA 1GB7A 1L56A 3M18B 3D4SA 5CP2A 3NGDA 5BOLA 3MGIA 2AJQA 3AJNA 5FCPA 1B2KA 4CGEA 4NY5A 2L5YA 4II8A 2KTQA 3HKZC 4I2GA 4H1PA 2G5HB 4S0WA 3PW0A 4W52A 2J6UA 2FPKA 1QT3A 4UASA 4LZGA 4CNQA 1N48A 2G09A 2C2DA 4C7YA 2XTHA 4WM5A 3EPGA 1ZQCA 177LA 1A2YC 2PXIA 3FI5A 4KX3A 5AM4A 3ETRA 4LZDA 5KFHA 3QNMA 2UVUA 1CKCA 1YILA 4UWUA 3PW2A 4KMOB 1C6EA 3IV6A 5KFWA 5KKIA 3QU9A 257LA 1A0PA 4UARA 1L27A 4B0DA 4LT2A 3UQ0A 9ICPA 1BB6A 3GZFA 3F8VA 4HP0A 2R8GA 2BCRA 1GXV2 2YTUA 2MEIA 4FZMA 1UPHA 5J0QA 1CI4A 3MDAA 4DSFA 4B49A 3WKAA 1HELA 2YN4A 5CB1A 1LB2B 1RZTA 2O79A 3G3BB 3IJUA 1H38A 4O3MA 1ZD2P 4DD9A 8ICRA 2KHQA 3MR5A 4PL2A 4GXIA 5J0SA 4P4MA 1LYYA 3DN6A 127LA 1NK0A 1ZD5A 1OUHA 260LA 3WXUA 187LA 1GB2A 3QU7A 1MA7A 2MUTB 1IP1A 1L91A 3AU2A 4EBEA 2P66A 3T5LA 1L08A 160LA 1SL1A 1SV0C 1LSFA 1RXVA 8ICZA 3AZ7A 1NKBA 2FLPA 5AKIA 3HUAA 2HHXA 1ZQRA 4U3XB 148LE 2D6FC 1SSWA 2Z6BA 3LYMA 2DQEY 3AGGG 4H91A 2ZTCA 1GB0A 1P2CC 1LZGA 1GAZA 4ZPUA 2ZJAA 3LWLA 4F2RA 4M9GA 1L83A 3ULRA 1FEZA 3UXPA 4WO9A 3W6BA 1L26A 122LA 5DBBA 2H5ZA 3NY9A 3WVXA 2DPJA 1KW5A 3QE8A 1FLQA 2ZUBA 1QQYA 1D9UA 4E0DA 1WQNA 1GFJA 1VFBC 1ZOLA 4PJZA 3V7LA 3HPOA 2HOQA 5ALJA 1G7HC 4Z46A 2ZIUA 5AK5A 5AK3A 4J03A 109LA 4B4JA 1XO1A 5KFVA 1GF4A 1NKCA 4HAIA 4RT3A 3DNAA 2MSNA 5L3IA 1XEIA 1Q46A 3AUOA 2Y1IA 2W9MA 2BQMA 4J7VA 3LVVA 1RDFA 4KLJA 5J2AA 4G4BA 3K4GA 5AHXA 1T3PA 3G6VA 2JH1A 2IHNA 3I28A 3CRXA 1IY3A 9ICLA 2WF8A 4FS2A 5CRXA 4BGDA 3HUKA 1C7YA 4HYKA 5ALFA 2W9BB 2EAMA 3SYZA 2NO4A 3F2BA 5KJ9A 1GB5A 4P0PB 4QWCA 2XQOA 3HT6A 3ICXA 2YVBA 2FPLA 2YMLA 1C63A 1LJEA 1F5SA 2ZUDA 4C8OA 1SKRA 1X40A 3TFRA 5IILA 1C6KA 4DL2A 2OHFA 1LJHA 5EOZA 2MEGA 3IDWA 3TXJA 1WCLA 1L84A 1P5CA 3ONNA 3OSNA 1BVKC 1L66A 1LYFA 3D2SA 8ICEA 1LTMA 1D0KA 2CRXA 1PVPA 1L30A 4QW8A 2W7PA 9ICUA 247LA 5KXSA 4MFFA 3EPIA 1GF5A 3P65A 4ECTA 3KBBA 4YN4A 3SV4A 1Z3EB 5AM5A 1L07A 2I6ZA 1LJ3A 3PW4A 3LVWA 1LJ4A 4YM8A 2HHTA 2O6KA 4B9MA 1C43A 3RJIA 1P7DA 3DDHA 3VCBA 191LA 4O3PA 1TK8A 1OVHA 3AZ6A 4GFJA 3PX4A 4M9NA 3PO5A 1VAUA 1P36A 2LHTA 1C6DA 2A4TA 2WAQC 4JK1A 1L71A 1FN5A 3Q8RB 4LGKA 4TURA 2ZYCA 1L93A 4I2HA 2PFPA 5DQGA 4O0IA 3W3EA 5C6LA 1C6CA 4MR1A 3WKCA 1IWVA 5AI4A 3BS5B 2F1HA 155LA 4RQ1A 3M1YA 4YEOA 1BB4A 3HKZF 2A1AA 2AQ0A 3IG8A 2HU3A 5DB7A 4G4HA 1OUBA 158LA 1D8YA 2I6XA 7ICIA 5KFMA 3GV7B 1LI6A 4UB8U 1V97A 2EZXA 2G4QA 4DDAA 4UBCA 4NL9A 3IG5A 2J6SA 1TVAA 3A90A 1L17A 7ICUA 4B9UA 1UIAA 2MEEA 3ATOA 2R8KA 2JEIA 1REYA 3D6JA 2F8LA 5L1JA 2H3VA 1TAQA 4UB6U 5KFQA 1CJ7A 1MLCE 3UMCA 3IM1A 1L11A 1PK3A 2BKEA 4KN7A 4LFPA 2KP7A 2I9GA 1JWRA 1DPXA 5DLFA 1LAAA 1TE2A 3TXBA 1L51A 128LA 2AU0A 2KE7A 1HFYA 5C6JA 1ZQQA 1D2WA 4PH5A 3GV5B 5H2FU 2LYAA 1NZPA 1GBOA 1GDXA 3ZVQB 2RBSA 1Z00A 1T6HA 154LA 110LA 1K1SA 1JJ3A 1BPBA 3J4GA 4HJZA 3WPLA 4H9CA 5DG9A 3IN5A 1TCYA 2NRTA 4RQ3A 4GXKA 1OV5A 2F2NA 2B72A 4NHIA 6LZMA 219LA 2C8PA 4DD7A 4OJOA 1SZPA 5E79U 171LA 135LA 1G0KA 4UATA 3WU9A 2CDSA 1SQ2L 1XFPL 3PZPA 2QARA 139LA 2MA1A 4ECXA 3B0OA 4ECSA 4NGYA 4DQJA 3CQLA 4NGJA 3QEAZ 3DN4A 5DB9A 3A3RX 1I6SA 3CW2C 166LA 2RDIA 1DI5A 1UICA 2DKZA 1L22A 2NRVA 1B7RA 1L00A 4KLEA 7ICQA 2YDGA 3PBLA 130LA 2DKXA 3HU8A 4GBRB 1BNOA 1V85A 3PVXA 3BQ7A 3DN3A 3GUIA 4OWHA 3EBAB 1MELL 2DQFC 4YMNA 3WU7A 4EKSA 3E58A 1QDRA 119LA 2BQEA 1AQ6A 2ASJA 185LA 1C10A 3V6KA 2ZILA 2CWIA 3UONA 5EE9A 1QIOA 249LA 3CDRA 5HR6A 4UWVA 5KFFA 4BS7A 3DN8A 3BQ0A 9ICTA 1REMA 3CSQA 1G0JA 1T6VL 5KAIU 1HSXA 1L89A 1RJCB 9ICVA 1NK4A 5ALSA 1ZVYB 4KLTA 4R66A 1ECWA 2CXYA 1I56A 1QUSA 5KFRA 3ISCA 3C29A 3V72A 4B9TA 8ICSA 1GD6A 1C65A 2OWOA 2B75A 2IOFK 1INUA 3JPNA 1QCKA 4LYOA 2B6GA 1CRXA 4OO9A 5AKYA 4AYBF 2H9KA 4DWXA 1S97A 4QIWC 3DN1A 1WQRA 2G0AA 3RF9A 3HWTA 4EENA 3RRGA 1JISA 2E1FA 2X0AA 1QSBA 4GN4A 2LKYA 4J9NA 1LLHA 1L8OA 4C0ZA 4WL7A 4M0AA 1W6ZA 231LA 3J81j 5LAFA 2YB4A 9ICQA 1ZQVA 5DLGA 5L1LA 2HVIA 5J29A 4OJ6A 1QDTA 4BXOB 2D4JA 2FBDA 2OU8A 5ALKA 4IQVA 5HMVA 1LZRA 3D2QA 4RPZA 8ICXA 4KPMA 5ALIA 5HNKA 3N9EA 1B5UA 4YVZA 4Y2UA 5ALOA 1OUEA 4DC4A 3SBAA 1OUAA 1L12A 230LA 1L79A 5IIOA 3TADC 1ZWNA 1COOA 3OE6A 1GBYA 3WUNA 1YIKA 2BQIA 1Z4NA 2HOIA 1L99A 4NSJA 2P6RA 5LVGA 225LA 1T8FA 5KFZA 1L48A 5CEHA 3C21A 5FDJA 1TAYA 1S0VA 2MEAA 1S0MA 3ATNA 218LA 3TXIA 4FZNA 5ALXA 3UMBA 2WHEA 4QZGA 1LSPA 3TANA 3DKEX 3SB8A 4A7DA 4WG7A 4M4OA 162LA 3U26A 2HMXA 4FO6A 1CVKA 252LA 2F4AA 5CHGA 4OO1J 4IRCA 2QARC 3A67Y 4ZEEA 2P6UA 2AGQA 3FA0A 1S9FA 1L16A 1QTVA 2O4WA 4K4GA 1IP5A 1P2LA 1UACY 5F14A 4UAUA 1S77D 1X42A 4BWMA 3N7SC 4RPXA 5KT3A 1CV6A 1L94A 1C6QA 4ZFPA 4ECQA 5KXNA 4DFJA 3PW5A 1EQEA 1U9LA 2HUBA 4G4CA 4WM1A 4MCKA 1QSSA 2MECA 4C8NA 1P37A 3HH3A 1L20A 2QARB 5GTHU 1O03A 1OW5A 235LA 2VB1A 4W54A 1N60A 1JKCA 207LA 172LA 3BQTA 5EWEA 1T8GA 3HT9A 2Z19A 1C68A 214LA 1IR7A 3EMLA 3WVYA 3IRUA 3H4BA 3A95A 4ARMB 5IIMA 2G08A 4US9A 1ZURA 3LYSA 1HEWA 1J2MA 4NHPA 3WL2A 1GB9A 5HHHA 4NY8A 1LJKA 1Z1VA 1JJ1A 1L58A 4ETCA 1GF7A 1U4BA 3GULA 1L37A 134LA 2DQNB 1U49A 1EPYA 2CUUA 3FC4A 2E8NA 3LZ2A 3UXOA 2KNJA 2RBNA 4MSTA 5B1FA 1GFKA 3THVA 1NK5A 2B6XA 4DLGA 2MEFA 4NWHA 1WG8A 4BUGA 3NVYA 3RJHA 1Q8KA 2YX8A 4IRKA 8ICMA 4I7NA 2IOFA 3H8JA 4DOBA 261LA 4NGKA 2BZFA 1ZQTA 3DEEA 3WUMA 2JR5A 3R9KA
chains in the Genus database with same CATH topology
1KNIA 5F81A 2LYMA 3BKHA 200LA 2D3DA 4Z3MA 1LJIA 2DQJY 1C6LA 2Q9DA 3P68A 5I54A 3J6KA 1CUQA 4GCEA 1DYDA 2YBJA 4IATA 4L41A 5J8YC 5AMYA 2ANVA 1L18A 4WLTA 3ZEKA 5D5CA 1L06A 144LA 1IVMA 1B5YA 1LHJA 1L50A 2F30A 102LA 1LYEA 1GFVA 3QAKA 2IFFY 1BHZA 4QEQA 1IC5Y 1QTBA 1UQVA 3WMKA 255LA 1LZ6A 1GWDA 1L05A 1L85A 3KKAC 1CU0A 3RZ4A 159LA 1YAPA 4QGZA 4IS7A 1F6SA 1L0KA 1LYJA 2D4KA 1JHLA 4GN5C 3JR6A 1EQ5A 1XGRC 1YKZX 1VDQA 1B7OA 2LHMA 1RE2A 4H8XA 3HILA 1GE0A 1L49A 1LSBA 3GXRA 2K60A 4HTKA 3A6BY 3NYAA 3EMSA 1CV5A 151LA 1CKFA 4LZMA 3HDFA 3G3VA 1SV0A 1BGIA 4IASA 4ARMA 4DD0A 1PS5A 4CFPA 1KIRC 3RUNA 2RSCA 5DM9A 1IC4Y 1YAOA 1I20A 1PQMA 2DQAA 1L28A 1GF6A 1L65A 1DXSA 4H8ZA 3W6DA 199LA 2I26L 2DL0A 1B7SA 2OTYX 2HEEA 215LA 3SENA 1GXXA 259LA 1IWZA 1L14A 2RAYX 4OWAA 4ETEA 1YQVY 4FJRA 4YX7C 3W6AA 1QUGA 1JKBA 1B5WA 1BWIA 4J1BA 5KXXA 5J8YA 4DD1A 2F44A 1JTPL 5E9RA 1D0LA 1UIBA 3A3QA 143LA 2ZQ3A 2PC2A 2F32A 4ARQA 140LA 5HLLA 1KY0A 2HUMA 1C46A 1CJ6A 5JRTA 4RQNA 3CDQA 1TDYA 3HUQA 4ET9A 3HH5A 1YANA 5F9UA 1L55A 2B74A 2BQKA 1QT7A 3P64A 4NHTA 4I7MA 5KY1A 5M1YA 168LA 4NL9C 4DD3A 238LA 1C6AA 243LA 2HEDA 1C6JA 5FEKA 4RW2A 4B4IA 4NGOA 153LA 4TSCA 4W57A 1NQIA 1DYFA 1HEPA 1KXYA 1B6IA 2B7XA 194LA 5LXWA 3CT5A 3LZTA 2NTGA 1L92A 1SSYA 2DQHY 2QB0B 1ZMYL 4WG1A 1XGPC 1NWGA 4I7TA 4XENA 1LHMA 2NWDX 4LT3A 1JKAA 1AKIA 1CU5A 1LHLA 4E97A 1L53A 212LA 5F3XB 3P66A 1XJUA 1QS5A 2QKQA 1L80A 5LVIA 5KKJA 1CU6A 3G3XA 2B70A 1JQUA 1IP6A 1UA6Y 1OUGA 1LZ9A 2HU1A 2YBNA 1F0MA 2LZMA 4KXIA 1K28A 2FYDA 3C8SA 5L3HA 1LZNA 4G49A 1DQJC 1AT6A 3BS5A 4NGIA 1J1XY 1GE3A 3WH1A 4DYGA 1SWZA 1LWGA 4TWSA 3WW5A 6LYZA 5FSTA 4BAPA 1T8AA 1UIGA 1HF4A 1OUCA 2Y8PA 5C6IA 2B73A 5LVKA 1LMOA 1GFUA 5KXLA 4DJHA 3A6CY 5HNCA 1ALCA 3HT7A 4MHVA 189LA 1JIYA 3RZEA 1NKHA 1TBYA 1LZ5A 1CKHA 4CJ2A 1B5VA 1DYAA 1B7PA 1UIFA 1XGQC 1QUOA 170LA 5KXRA 1BVXA 133LA 3HU9A 3TXDA 4H9AA 1L46A 2RH1A 3C7WA 4I8SA 4XN6A 1GE1A 208LA 1P56A 1L40A 1YAMA 2YSSC 5KNIA 1OUJA 1D2YA 3A8ZA 115LA 4I0CA 4TUNA 1P2RA 4GCFA 1HSWA 1LSMA 205LA 2N5ZA 2Z12A 1X66A 1GFRA 1P6YA 2XBSA 4YXAC 150LA 5B06A 1CX7A 1CKDA 5I4YA 4ARPA 1IWYA 1VEDA 3DN0A 132LA 2RB2X 4HSFA 1F10A 4ET8A 2HEBA 3T6UA 1FLWA 2OE7X 2BQCA 1WWVA 4E3UA 4WLDA 2F3NA 5KXOA 1JTOL 1HC0A 2Z2FA 3V2WA 1PK1A 5LYMA 108LA 1T97A 4WM4A 4WO6A 1SGGA 201LA 1AT5A 2H9JA 4H9FA 3WYHA 4W55A 3T36A 4DAJA 195LA 3VWOA 5KXYA 3CT1A 1L87A 1REZA 3AW6A 1OVKA 3F9LA 1G0QA 5A3ZA 1HEMA 3IJVA 4EKQA 1Z55A 2G4NA 2I25L 4IAPA 5LZMA 3TMUA 1L43A 1LZ1A 1P64A 3WU8A 5LINA 2CGIA 1PK1B 4WM2A 1QUDA 1DI4A 3HBDA 258LA 5L9JA 5LAGA 1IOCA 4TSBA 5KXWA 4HJVA 4RLNA 4I7PA 3K3TA 2BLYA 1C6MA 180LA 1L33A 4XJIA 222LA 1CKGA 188LA 1YKYX 1L62A 4H9IA 1WVUA 3IWRA 1GF3A 1LMNA 4H9HA 1LKSA 3P4ZA 1LMAA 1LYOA 3C7YA 3TACB 1IP2A 1LGWA 228LA 5K7OA 3G3WA 3WW6A 4W53A 3AYQA 3C7ZA 2ZNXY 4Z98A 4GCDA 240LA 131LA 1LYHA 256LA 1HMKA 1GFEA 2AUBA 3HH4A 4H93A 3BS7A 1CU2A 2BQDA 1FKVA 1C69A 3B0IA 1IY4A 146LA 1CNSA 1FDLY 1LSEA 1CV0A 4GCBA 5D5FA 2EQLA 2D4IA 2QB0A 1HEQA 1IWWA 1J1PY 4XYYA 2HEAA 211LA 4LYBA 3HFMY 3RU5A 1L74A 1C6NA 2HULA 2KG5A 3SEIA 244LA 220LA 2RB1X 1LPIA 3B6LA 1QSAA 1L90A 2LC9A 2OU0X 4OWCA 2QB1A 3HDEA 4K5YA 3C8RA 2Z18A 2LZ2A 1IO5A 1GE2A 2OTZX 3CSRA 1WQQA 2FBBA 5DN5A 1LYDA 112LA 5HNLA 1LYGA 1FBIX 1NDGC 2LYZA 2XBRA 149LA 1SV4A 1GBSA 245LA 2D91A 2YBLA 3W6FA 2EKSC 4NIJA 4B4EA 1G0GA 209LA 2EANA 1SWYA 4ML7A 1LSNA 1OWYA 1KW4A 4PZOA 4GCCA 4FDYA 174LA 2BAAA 2RBPA 3DMVA 104LA 3OE8A 4XJFA 3ODUA 1LI3A 4J0LA 192LA 5HQ1A 5KXTA 1C7PA 1L13A 1XSFA 3A94A 1WTHA 1DI3A 103LA 1L69A 5JU5A 1LZ8A 1JITA 1A4VA 1C67A 1QSWA 2Q9EA 1UC0A 2KSOB 5LYTA 1JTMA 2BQJA 1JKDA 4Z41A 4WLYA 3D9AC 1BWJA 3GXKA 5IHGA 226LA 5DL9A 1L76A 3MGWA 5LVJA 1B0XA 1NF5A 4G9SA 3SB6A 3A93A 4LFXA 1LWKA 1L73A 242LA 262LA 4EXMA 4PRQA 1B4FA 5L1MA 1IIZA 4R0FA 229LA 3HTFA 2DQIY 1DYCA 4NG8A 1IORA 1L44A 4LZTA 1L54A 1GB8A 3FI7A 1LKYA 1L98A 4YOPA 2DQGY 2ZYPA 1CU3A 2W1LA 1HERA 1CV1A 1GB3A 4P2EA 3DMXA 2ANXA 4DD2A 4PHIA 3AZ5A 4HPIA 2RBOA 1L42A 3F6ZA 1HEOA 3FE0A 4NGLA 1G7IC 4EOFA 4NG1A 1IX0A 125LA 3SB5A 236LA 3A96A 5F16A 4IJ4A 1BB3A 1CV3A 1L10A 1D3NA 111LA 4DDBA 4NSIA 1G07A 3N9AA 1IP7A 1L34A 2Y9UA 1LW9A 4GLVA 3SBBC 5I53A 2LYOA 2RBQA 1I1ZA 2GV0A 7LZMA 1GBZA 4H94A 2E8OA 3E3DA 1G0PA 3OK0A 1NMMA 5IELA 1C6GA 3H8MA 1JSFA 4D9ZA 1L24A 248LA 1XEJA 1P3NA 4WM6A 1LSYA 4I7OA 4N9RA 4C3WA 4HPEA 2Y9TA 4H8YA 3GUOA 1IWUA 5DLAA 2JV3A 213LA 1JI7A 1L61A 1E8LA 4EKPA 1UBZA 183LA 126LA 1KIQC 1IWTA 190LA 1LPYA 3WPJA 3RW8A 1B5ZA 2YBMA 1QUHA 4ETBA 1SX2A 4NHQA 1DYBA 1IP3A 1OYUA 1OVJA 3HTBA 4M6DA 2KMDA 1REXA 1L35A 4N8ZA 4W58A 1VATA 1GDWA 2FYCA 2FE9A 3C83A 1B5XA 114LA 1XEPA 1L64A 2DQCY 4ETAA 4W96A 120LA 4CHXA 2BPUA 4EPFA 4DQ5A 1LGXA 253LA 2RBRA 1G1WA 1GFAA 1L57A 4NWEA 4TX7A 4YXCA 1D6PA 3DMZA 163LA 123LA 5FHWA 4X3BA 5KXKA 167LA 3B72A 1L38A 4GN3A 2DBTA 2DKVA 221LA 3AGHA 3D3DA 5B1GA 5EBHA 1L45A 1LZDA 4DT3A 129LA 5KXZA 1L68A 1LMQA 4KT3A 1BWHA 1L60A 4ANRA 2E8MA 2LZTA 1KXXA 1JJ0A 3L2XA 1IOQA 1LSDA 2BQFA 1IOSA 241LA 3AW7A 4ARLA 1SXEA 186LA 1DXJA 4LDEA 197LA 2D8CA 1LSAA 4H9EA 1OV7A 1GFHA 4EJ4A 1XGUC 1L25A 1C60A 4HJYA 2EIZC 3V2YA 1D3JA 1B0DA 1WTMA 3RT5X 4RDSA 4WM3A 2BQLA 2LMRA 3W6CA 1L09A 2Q0MX 4PZNA 1RI8B 2BQHA 1LHKA 1G0MA 1UUZC 3GUPA 4H90A 3SN6R 1LJJA 3C81A 4QDNA 2O7AA 4XADA 1C6FA 3N9CA 1L88A 3LHMA 2ZWBA 2MEHA 1RG6A 1LMTA 2ES6A 1OUDA 3C80A 2EAPA 2C8OA 210LA 233LA 3HTGA 5ILCA 1L32A 2B6WA 1LZEA 239LA 137LA 5LA5A 3NY8A 3EXDA 3LN2A 1LYIA 5JENB 224LA 193LA 1WVVA 1IR8A 175LA 3LZMA 1L81A 1PQJA 2RB0X 4XJDA 1CTWA 2HTXA 1G06A 3GUKA 5LA8A 1FKQA 3A92A 2YBIA 4AGAA 1L52A 1JTNA 1FLUA 4NHSA 1LI2A 1EQ4A 2B6ZA 3TXGA 4YF2A 1WQMA 1PQKA 5IDDA 1J1OY 4LDOA 5KXPA 198LA 4N0JA 1QTHA 3TXFA 1L75A 4O34A 3LYZA 152LA 1C6BA 1L97A 1LKRA 4AXTA 2Z38A 1KXWA 1B7NA 1HFXA 107LA 2A7DA 1LGUA 1QT5A 4NJ8A 2IHLA 1CV4A 3TXHA 1BB5A 1B7LA 1C08C 1OP9B 1QS9A 1AM7A 1SLYA 2ZIJA 1QTDA 4PJ2C 1PQOA 1UCVA 1TLAA 2MEBA 4I7KA 3TMXA 4AQNA 4DDCA 1L70A 3HH6A 2K4PA 2OEAX 237LA 1D0MA 1C6TA 5B59A 1F6RA 1C64A 1L21A 1L0JA 5LIOA 1QTEA 4NGZA 118LA 4W94A 3ZVQA 1L36A 5ILFA 5FELA 1C6PA 2B6TA 165LA 5LYZA 4LYTA 1JUGA 1YL1X 1LMPA 1L96A 1V7TA 2OE4X 1CJ9A 169LA 1LSGA 2BQOA 3HTDA 3GUJA 3PDSA 1BB7A 8LYZA 3G3AB 4H92A 4ARQB 1DZBX 1G1VA 4HTQA 1L72A 2W1MA 1G7LC 4B1AA 4LYZA 1LYSA 3OJPA 9LYZA 250LA 3CDTA 1PQIA 3LYOA 176LA 4I7JA 161LA 1DPWA 1NHBA 3CDOA 5II3A 1L77A 1LOZA 2ZIKA 1LKYB 2F47A 5E4PA 1C6HA 1DYGA 157LA 4CFOA 3QNGA 1XGTC 1UCOA 1G7JC 1O23A 4NSHA 4TTDA 2F2QA 1HNLA 1D3MA 5B05A 1LZ4A 3TMWA 4ZIXA 2XJWA 4KL7A 1RFPA 3K1RB 2ZQ4A 1IWXA 4I7QA 4NGWA 5APFA 1QT8A 2ESEA 3HBEX 4WOAA 1OQMA 4OW1A 2F4GA 3L64A 4LDLA 1GF9A 1YROA 4W56A 5I4WA 1OUFA 4XJBA 4PRUA 4WL6A 173LA 1SX7A 1COKA 2ZNWY 4PGJB 1VDTA 4EMNA 1L47A 184LA 1WWUA 1PQDA 1QUTA 3AZ4A 5T3FA 1W08A 3WXTA 1JPOA 1HENA 1L41A 227LA 4NSGA 1QTCA 1LHHA 1LJFA 1D6QA 1CUPA 1NDMC 1GEVA 1QTZA 2F8KA 4W59A 5APCA 5I5QA 2IGCA 182LA 2LCBA 1LHIA 1HMLA 217LA 2CJLA 1P7SA 1LJGA 4WMGA 2D6BA 3FADA 1WQPA 5DN4A 2BQNA 4PPOA 1EL1A 3W6EA 1GFTA 4BADA 6LYTA 1QTKA 2BLXA 223LA 4NEBA 2B5ZA 1GF8A 3CSZA 3KAMA 2BQBA 178LA 3TMVA 1L04A 1YL0X 1GHLA 4RLMA 2G4PA 4XJGA 3K2RA 2NTHA 156LA 1BQLY 1NBZC 5A3EA 2W1XA 4ARJA 1FLYA 4HV2A 2WARA 3HT8A 1GAYA 1VDSA 3C82A 4I7RA 4WLXA 1N4FA 1HFZA 1YAQA 1LZCA 1L59A 3CB7A 2BQAA 4N5RA 4NGVA 1LZYA 4LYMA 1H6MA 232LA 3C8QA 4N1CC 1C66A 1QT6A 1CX6A 3EO5A 1ZVHL 1GF0A 2HEFA 1LMCA 141LA 1QSQA 5B07A 3OE9A 1QT4A 5I4XA 3TXEA 1C62A 2A7FA 1KY1A 4YEMA 1UIHA 4EPIA 3WPKA 4OWEA 216LA 1XJTA 1LJNA 1DKJA 113LA 1KW7A 1GPQC 3CDVA 1RCMA 254LA 1LZAA 4W51A 3A91A 3AB6A 2KSOA 1C6IA 3B0KA 1P46A 1NHEA 4H9BA 4OOOA 145LA 4GRVA 234LA 3SB9A 4LYCA 3WULA 3OE0A 1LYZA 1XEKA 4NFVA 1L19A 3BKVA 147LA 4OOTA 5F9XA 1V38A 2RAZX 1C45A 4GLAA 1G0LA 164LA 3TXKA 1WQOA 3TADA 2LPEA 1UIEA 1G7MC 1L95A 4RQMA 1L23A 4R6CA 1X9XA 1UIDA 196LA 1JSEA 1JEFA 181LA 1GBXA 5APEA 1OUIA 1GFGA 1IR9A 1B9OA 2L78A 4I7LA 3SB7A 2YBHA 3HBHA 4BAFA 3GUMA 1CJ8A 1B7MA 3HWLA 4PK0A 1AZFA 1SXDA 3DN2A 1YKXX 1LZTA 1WTNA 1IOTA 3A34A 4XJHA 3KKAA 5APDA 1H87A 4DQ7A 1DYEA 1L86A 5I14A 1TEWA 1L01A 1NBYC 1GBWA 142LA 2EAOA 206LA 1L39A 2W1YA 7LYZA 1L31A 4N1EI 1GEZA 251LA 1F0WA 4UWNA 4I7SA 1ZYTA 4OWBA 4DKLA 1IC7Y 1L82A 4J1AA 4RW1A 1GE4A 3RNXA 1LZBA 1OWZA 1C61A 4C5FA 1L63A 246LA 4LT1A 4EKRA 4HTNA 2EPEA 3LYTA 2OU9A 4YENA 1L29A 1D3FA 1HHLA 3M3UA 4LT0A 4ETDA 5KXMA 2MEDA 1GB6A 2Z2EA 1LZSA 1B7QA 1IEEA 1KS3A 1LCNA 1JTTL 1PZYA 138LA 2B6YA 3QY4A 2HECA 3CT0A 1KIPC 4QY9A 4HV1A 2DQDY 5J7CA 1D9WA 1IP4A 2BQGA 1L02A 3SP3A 1LSZA 1ZV5L 5HMJA 3AGIA 1L67A 2GLEA 2KIVA 1L03A 2OE9X 1DKKA 3GUNA 1L15A 2E8PA 1V7SA 5LVHA 1VDPA 2Z39A 2HUKA 1OXJA 5JTIA 2Z37A 1LSCA 1GB7A 1L56A 3M18B 3D4SA 3AJNA 5FCPA 1B2KA 4CGEA 4NY5A 2L5YA 4II8A 4H1PA 4S0WA 4W52A 1QT3A 2XTHA 4WM5A 177LA 1A2YC 3FI5A 1CKCA 1YILA 4UWUA 1C6EA 5KKIA 257LA 1L27A 4B0DA 4LT2A 1BB6A 3F8VA 4HP0A 1GXV2 2MEIA 2YTUA 4B49A 1HELA 3IJUA 3G3BB 2O79A 4DD9A 3DN6A 1LYYA 127LA 1OUHA 260LA 3WXUA 187LA 1GB2A 1IP1A 1L91A 1L08A 160LA 1SV0C 1LSFA 3AZ7A 3HUAA 4U3XB 148LE 1SSWA 2Z6BA 3LYMA 2DQEY 3AGGG 4H91A 1GB0A 1P2CC 1LZGA 1GAZA 4ZPUA 1L83A 3ULRA 4WO9A 3W6BA 1L26A 122LA 2H5ZA 3NY9A 3WVXA 1KW5A 3QE8A 1FLQA 1QQYA 1D9UA 1WQNA 1GFJA 1VFBC 4PJZA 4Z46A 1G7HC 109LA 4B4JA 1GF4A 3DNAA 5L3IA 1XEIA 2BQMA 4J7VA 4G4BA 1T3PA 1IY3A 3HUKA 2EAMA 5KJ9A 1GB5A 2XQOA 3HT6A 2YVBA 1C63A 1LJEA 1X40A 1C6KA 1LJHA 2MEGA 3TXJA 3IDWA 1L84A 1P5CA 1BVKC 1L66A 1LYFA 1LTMA 1D0KA 1L30A 247LA 5KXSA 1GF5A 3P65A 1L07A 2I6ZA 1LJ3A 1LJ4A 4YM8A 1C43A 191LA 1OVHA 3AZ6A 1VAUA 1P36A 1C6DA 2A4TA 1L71A 1FN5A 4LGKA 2ZYCA 1L93A 3W3EA 5C6LA 1C6CA 4MR1A 1IWVA 3BS5B 155LA 4YEOA 1BB4A 2HU3A 4G4HA 1OUBA 158LA 1LI6A 2G4QA 4DDAA 4NL9A 3A90A 1L17A 2MEEA 1UIAA 3ATOA 1REYA 1CJ7A 1MLCE 1L11A 1PK3A 4LFPA 1JWRA 1DPXA 1LAAA 3TXBA 1L51A 128LA 2KE7A 1HFYA 5C6JA 1D2WA 1GBOA 1GDXA 3ZVQB 2RBSA 1T6HA 154LA 110LA 1JJ3A 3J4GA 4HJZA 3WPLA 4H9CA 1TCYA 1OV5A 4NHIA 2F2NA 2B72A 6LZMA 219LA 2C8PA 4DD7A 171LA 135LA 1G0KA 3WU9A 2CDSA 1SQ2L 1XFPL 139LA 2QARA 3B0OA 4NGYA 4DQJA 3CQLA 4NGJA 3DN4A 3A3RX 1I6SA 1UICA 1DI5A 166LA 3VW7A 2DKZA 1L22A 1B7RA 1L00A 2YDGA 4GBRB 130LA 2DKXA 3HU8A 3PBLA 1V85A 4OWHA 3BQ7A 3DN3A 3GUIA 3EBAB 1MELL 2DQFC 3WU7A 4EKSA 1QDRA 119LA 2BQEA 185LA 1C10A 2ZILA 2CWIA 3UONA 1QIOA 249LA 3CDRA 4UWVA 4BS7A 3DN8A 1REMA 3CSQA 1G0JA 1T6VL 1HSXA 1L89A 1RJCB 1ZVYB 1I56A 1QUSA 1GD6A 1C65A 2B75A 1INUA 4LYOA 2B6GA 4OO9A 4DWXA 2H9KA 3DN1A 1WQRA 1JISA 2X0AA 1QSBA 4GN4A 1LLHA 4WL7A 5LAFA 1W6ZA 231LA 1QDTA 2OU8A 2D4JA 5HMVA 2FBDA 1LZRA 4KPMA 3N9EA 1B5UA 1OUEA 4DC4A 3SBAA 1OUAA 1L12A 230LA 1L79A 3TADC 1ZWNA 3OE6A 1GBYA 3WUNA 1YIKA 2BQIA 1L99A 4NSJA 5LVGA 225LA 1T8FA 1L48A 5FDJA 1TAYA 2MEAA 3ATNA 218LA 3TXIA 1LSPA 3DKEX 3SB8A 4A7DA 4WG7A 4M4OA 162LA 1CVKA 2F4AA 252LA 2QARC 3A67Y 4ZEEA 3FA0A 1L16A 1QTVA 2O4WA 1IP5A 1P2LA 1UACY 5F14A 1CV6A 1L94A 1C6QA 4ZFPA 5KXNA 2HUBA 1EQEA 4G4CA 4WM1A 4MCKA 2MECA 1P37A 3HH3A 1L20A 2QARB 2VB1A 1OW5A 235LA 4W54A 207LA 1JKCA 172LA 1T8GA 3HT9A 2Z19A 1C68A 214LA 1IR7A 3EMLA 3WVYA 3A95A 4ARMB 1ZURA 1HEWA 4NHPA 3WL2A 1GB9A 1LJKA 4ETCA 1Z1VA 1JJ1A 1L58A 1GF7A 3GULA 1L37A 134LA 2CUUA 1EPYA 2E8NA 3LZ2A 2RBNA 4MSTA 5B1FA 1GFKA 2B6XA 2MEFA 3WUAA 4NWHA 4I7NA 261LA 4NGKA 3WUMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KNI A;  3HH4 A;  138L A;  2B6Y A;  3BS7 A;  1CU2 A;  1PQK A;  200L A;  4LDO A;  2D3D A;  1C69 A;  198L A;  1C6L A;  1QTH A;  2Q9D A;  1L75 A;  146L A;  1CUQ A;  1DYD A;  152L A;  1C6B A;  1D9W A;  1L97 A;  1L02 A;  3HH6 A;  5J8Y C;  2ANV A;  107L A;  1L18 A;  1LGU A;  1QT5 A;  4NJ8 A;  1L06 A;  1CV0 A;  1CV4 A;  1L67 A;  144L A;  2GLE A;  2KIV A;  1L03 A;  2OE9 X;  3GUN A;  2QB0 A;  1L15 A;  2E8P A;  1L50 A;  2HUK A;  1OXJ A;  5JTI A;  102L A;  1LYE A;  1QS9 A;  211L A;  3QAK A;  1L56 A;  3D4S A;  1QTD A;  1PQO A;  1UCV A;  1TLA A;  4I7K A;  4AQN A;  1L74 A;  1C6N A;  2HUL A;  1L70 A;  2L5Y A;  1QTB A;  2K4P A;  2KG5 A;  3SEI A;  244L A;  2OEA X;  1UQV A;  220L A;  237L A;  2RB1 X;  4S0W A;  4W52 A;  1C6T A;  255L A;  1QT3 A;  1L05 A;  1C64 A;  1L85 A;  3KKA C;  1CU0 A;  1L90 A;  2LC9 A;  159L A;  2OU0 X;  2QB1 A;  177L A;  4IS7 A;  1L0K A;  1L21 A;  3HDE A;  1LYJ A;  1L0J A;  3FI5 A;  4K5Y A;  3C8R A;  1C6E A;  257L A;  118L A;  1L27 A;  2OTZ X;  3JR6 A;  1L36 A;  1C6P A;  2B6T A;  165L A;  3F8V A;  3HIL A;  2YTU A;  1L96 A;  1LYD A;  112L A;  1L49 A;  2O79 A;  1LYG A;  2OE4 X;  169L A;  2K60 A;  3HTD A;  149L A;  1SV4 A;  245L A;  3DN6 A;  3NYA A;  127L A;  1CV5 A;  151L A;  1G0G A;  209L A;  4LZM A;  2EAN A;  260L A;  3GUJ A;  3HDF A;  187L A;  1SWY A;  3PDS A;  3G3V A;  1SV0 A;  1L91 A;  1OWY A;  4ARQ B;  1KW4 A;  4PZO A;  4ARM A;  1L08 A;  160L A;  1SV0 C;  1G1V A;  3RUN A;  174L A;  1L72 A;  1PQM A;  2RBP A;  3DMV A;  104L A;  3HUA A;  1L28 A;  3OE8 A;  148L E;  1L65 A;  1SSW A;  3ODU A;  1DXS A;  2Z6B A;  1LI3 A;  192L A;  199L A;  2DL0 A;  2OTY X;  250L A;  215L A;  1L13 A;  3CDT A;  1PQI A;  4ZPU A;  176L A;  4I7J A;  1L83 A;  161L A;  3SEN A;  1NHB A;  1WTH A;  3CDO A;  1L77 A;  259L A;  1L26 A;  1L14 A;  2RAY X;  122L A;  1LKY B;  3NY9 A;  103L A;  1L69 A;  5JU5 A;  2F47 A;  4YX7 C;  1KW5 A;  1C6H A;  1QUG A;  1DYG A;  157L A;  1C67 A;  2Q9E A;  5J8Y A;  2F44 A;  4PJZ A;  2KSO B;  1JTM A;  2F2Q A;  109L A;  1D3M A;  3DNA A;  143L A;  3K1R B;  2F32 A;  4ARQ A;  140L A;  1KY0 A;  2HUM A;  5JRT A;  4RQN A;  226L A;  3CDQ A;  1L76 A;  3HUQ A;  4I7Q A;  3HH5 A;  1QT8 A;  1B0X A;  2ESE A;  3SB6 A;  1L55 A;  1LWK A;  2B74 A;  1QT7 A;  1L73 A;  4I7M A;  3HUK A;  242L A;  262L A;  3L64 A;  4LDL A;  4EXM A;  2EAM A;  1B4F A;  5L1M A;  168L A;  229L A;  4NL9 C;  4W56 A;  3HTF A;  3HT6 A;  238L A;  1DYC A;  1C63 A;  1L44 A;  1C6A A;  243L A;  1L54 A;  1C6J A;  1X40 A;  173L A;  1C6K A;  1SX7 A;  3IDW A;  1LKY A;  1COK A;  1L84 A;  1P5C A;  1L98 A;  1LYF A;  1L66 A;  1L47 A;  1CU3 A;  184L A;  1WWU A;  1PQD A;  1CV1 A;  1L30 A;  247L A;  4W57 A;  1DYF A;  1B6I A;  2B7X A;  3DMX A;  2ANX A;  1L07 A;  2NTG A;  1L92 A;  2RBO A;  1SSY A;  1L42 A;  2QB0 B;  1L41 A;  227L A;  191L A;  1QTC A;  1OVH A;  125L A;  4I7T A;  3SB5 A;  236L A;  1CUP A;  1P36 A;  1C6D A;  2A4T A;  1CU5 A;  4E97 A;  1L71 A;  1L53 A;  1QTZ A;  212L A;  2F8K A;  4W59 A;  5F3X B;  1XJU A;  1QS5 A;  1L93 A;  2QKQ A;  1CV3 A;  1L80 A;  1L10 A;  182L A;  1D3N A;  2IGC A;  2LCB A;  1C6C A;  3BS5 B;  1CU6 A;  155L A;  217L A;  3G3X A;  111L A;  2B70 A;  1JQU A;  1P7S A;  1G07 A;  3FAD A;  158L A;  1L34 A;  1LI6 A;  1F0M A;  2Y9U A;  1LW9 A;  1K28 A;  2LZM A;  3C8S A;  4NL9 A;  3SBB C;  1L17 A;  3BS5 A;  2RBQ A;  7LZM A;  223L A;  2E8O A;  1L11 A;  1SWZ A;  1G0P A;  1PK3 A;  1LWG A;  1C6G A;  3H8M A;  178L A;  1L04 A;  1L51 A;  128L A;  1L24 A;  1T8A A;  248L A;  2KE7 A;  3K2R A;  1D2W A;  1P3N A;  4I7O A;  2NTH A;  2B73 A;  156L A;  2RBS A;  2Y9T A;  3GUO A;  4DJH A;  1T6H A;  4ARJ A;  110L A;  2JV3 A;  213L A;  1JI7 A;  3HT7 A;  4MHV A;  189L A;  1L61 A;  3HT8 A;  3C82 A;  4I7R A;  3RZE A;  4EKP A;  183L A;  126L A;  1DYA A;  1OV5 A;  2B72 A;  6LZM A;  1L59 A;  219L A;  1QUO A;  190L A;  1LPY A;  171L A;  170L A;  1G0K A;  1QUH A;  139L A;  2QAR A;  1SX2 A;  1DYB A;  1OYU A;  3DN4 A;  1OVJ A;  232L A;  1I6S A;  166L A;  3HTB A;  3HU9 A;  3C8Q A;  2DKZ A;  2KMD A;  1L22 A;  1L00 A;  1L35 A;  3VW7 A;  1C66 A;  4W58 A;  1QT6 A;  3PBL A;  130L A;  2DKX A;  1L46 A;  1CX6 A;  2RH1 A;  3HU8 A;  4GBR B;  1V85 A;  3C7W A;  2FE9 A;  3BQ7 A;  3C83 A;  3DN3 A;  3GUI A;  114L A;  141L A;  1QSQ A;  1XEP A;  1L64 A;  4EKS A;  119L A;  3OE9 A;  1P56 A;  1L40 A;  120L A;  1QT4 A;  185L A;  1C62 A;  3UON A;  249L A;  3CDR A;  4EPF A;  5KNI A;  1KY1 A;  3DN8 A;  1D2Y A;  4EPI A;  1LGX A;  216L A;  253L A;  1XJT A;  2RBR A;  115L A;  113L A;  1G1W A;  1KW7 A;  3CDV A;  1L57 A;  1G0J A;  1P2R A;  1L89 A;  4YXC A;  3DMZ A;  254L A;  4W51 A;  163L A;  205L A;  123L A;  2KSO A;  1C6I A;  1P46 A;  1X66 A;  1C65 A;  2B75 A;  1P6Y A;  167L A;  2B6G A;  1L38 A;  4OO9 A;  221L A;  145L A;  4YXA C;  3DN1 A;  150L A;  1L45 A;  1CX7 A;  4GRV A;  234L A;  129L A;  3SB9 A;  1L68 A;  3OE0 A;  1QSB A;  1LLH A;  4ARP A;  1L60 A;  231L A;  3DN0 A;  2RB2 X;  1L19 A;  2OU8 A;  2E8M A;  147L A;  1V38 A;  2RAZ X;  3L2X A;  3SBA A;  1G0L A;  241L A;  164L A;  1L12 A;  230L A;  1L79 A;  2OE7 X;  4ARL A;  3TAD C;  1ZWN A;  1SXE A;  3OE6 A;  1WWV A;  186L A;  1L99 A;  3TAD A;  2LPE A;  2F3N A;  1L95 A;  4RQM A;  225L A;  4LDE A;  1L23 A;  1T8F A;  1X9X A;  3V2W A;  1L48 A;  197L A;  1PK1 A;  2D8C A;  108L A;  196L A;  1T97 A;  1OV7 A;  4EJ4 A;  181L A;  1L25 A;  218L A;  1C60 A;  1SGG A;  201L A;  4I7L A;  2L78 A;  3SB7 A;  4W55 A;  3V2Y A;  1D3J A;  4DAJ A;  195L A;  3DKE X;  3GUM A;  3SB8 A;  1L87 A;  162L A;  1CVK A;  3HWL A;  4PK0 A;  252L A;  1SXD A;  1OVK A;  3DN2 A;  2LMR A;  3F9L A;  1G0Q A;  1L09 A;  4PZN A;  2QAR C;  3FA0 A;  1G0M A;  1L16 A;  1QTV A;  2O4W A;  3GUP A;  3SN6 R;  1P2L A;  3KKA A;  4EKQ A;  3C81 A;  4IAP A;  5LZM A;  1CV6 A;  1L94 A;  1C6Q A;  2O7A A;  1L43 A;  1C6F A;  1P64 A;  1DYE A;  1L88 A;  1L86 A;  1RG6 A;  5I14 A;  1L01 A;  1P37 A;  3HH3 A;  2ES6 A;  3C80 A;  2EAP A;  1L20 A;  2QAR B;  1OW5 A;  235L A;  4W54 A;  1PK1 B;  142L A;  210L A;  172L A;  2EAO A;  233L A;  206L A;  3HTG A;  1T8G A;  1L39 A;  1L32 A;  2B6W A;  1QUD A;  1L31 A;  3HT9 A;  251L A;  239L A;  137L A;  258L A;  4I7S A;  1C68 A;  1ZYT A;  214L A;  3EML A;  3NY8 A;  4DKL A;  1L82 A;  4ARM B;  1LYI A;  4I7P A;  224L A;  1ZUR A;  1OWZ A;  1C61 A;  1C6M A;  180L A;  1L33 A;  1L63 A;  222L A;  1Z1V A;  1L58 A;  188L A;  246L A;  1L62 A;  175L A;  3LZM A;  4EKR A;  3C7Y A;  3GUL A;  1L37 A;  3TAC B;  2CUU A;  1EPY A;  1LGW A;  1L81 A;  228L A;  2OU9 A;  2E8N A;  1L29 A;  1PQJ A;  3G3W A;  1D3F A;  2RB0 X;  2RBN A;  4W53 A;  1CTW A;  2B6X A;  1G06 A;  3GUK A;  4I7N A;  3C7Z A;  1L52 A;  261L A;  1JTN A;  240L A;  131L A;  1KS3 A;  1LI2 A;  1LYH A;  2B6Z A;  256L A; 
#chains in the Genus database with same CATH topology
 3GFK B;  1KNI A;  5F81 A;  2LYM A;  3BKH A;  200L A;  2ZIU B;  4F4X A;  2IOH A;  1VDV A;  2D3D A;  4Z3M A;  1N5X A;  1LJI A;  5GTI U;  2DQJ Y;  1C6L A;  2Q9D A;  3P68 A;  5I54 A;  3J6K A;  4G9B A;  1CUQ A;  4GCE A;  1DYD A;  2YBJ A;  1L3T A;  4IAT A;  1VLB A;  5J8Y C;  4L41 A;  5AMY A;  2ANV A;  1L18 A;  4WLT A;  3ZEK A;  1PUZ A;  5D5C A;  3KFU F;  4UB3 A;  4UW9 A;  1L06 A;  5BOM A;  4QWA A;  4NLC A;  144L A;  4YMO A;  9ICH A;  1IVM A;  1B5Y A;  1LHJ A;  1L50 A;  2NRZ A;  102L A;  1LYE A;  2F30 A;  4RNM A;  4B9L A;  3C23 A;  1GFV A;  3QAK A;  5AKE A;  5ALT A;  1U45 A;  1RQN A;  2IFF Y;  1KFT A;  1BHZ A;  2I1Q A;  2VKQ A;  1A6S A;  4QEQ A;  1IC5 Y;  1MSW D;  4ED3 A;  1QTB A;  3N7R C;  1UQV A;  1NK9 A;  4EX6 A;  2OYY A;  3WMK A;  255L A;  1LZ6 A;  1GWD A;  1L05 A;  1L85 A;  3KKA C;  1CU0 A;  3RZ4 A;  4NM1 A;  2W9C B;  159L A;  1YAP A;  4WJ3 B;  4QGZ A;  3QE9 Y;  4IS7 A;  1F6S A;  4DF4 A;  1L0K A;  1LYJ A;  3QZ7 A;  2BQR A;  4MFA A;  2RDJ A;  2D4K A;  3GV8 B;  2J6T A;  1JHL A;  4GN5 C;  4DL5 A;  4DO9 A;  3JR6 A;  1EQ5 A;  1XGR C;  2RHF A;  3GUN A;  1YKZ X;  1VDQ A;  1B7O A;  2LHM A;  1RE2 A;  4H8X A;  4ED0 A;  3HIL A;  1GE0 A;  4CF3 A;  2G06 A;  3MFH A;  1L49 A;  4KTQ A;  3OTQ A;  3QYP A;  1LSB A;  3KOO A;  2BDP A;  2I5H A;  1O08 A;  3GXR A;  2K60 A;  2LYH A;  4HTK A;  4JV2 A;  3A6B Y;  1JRO A;  3Q8M A;  1N2X A;  4Q43 A;  3NYA A;  3EMS A;  1CV5 A;  151L A;  4I27 A;  4QZF A;  1CKF A;  4QZI A;  4LZM A;  3RB0 A;  3HDF A;  2Z7J A;  3DV9 A;  3H8W A;  3G3V A;  1ZRM A;  1SV0 A;  1BGI A;  2XIC A;  5HMM A;  4IAS A;  4ARM A;  1URJ A;  1PS5 A;  4CFP A;  1KIR C;  4DD0 A;  1SL0 A;  3RUN A;  2RSC A;  5DM9 A;  9ICM A;  1IC4 Y;  2E5S A;  8ICA A;  1YAO A;  5DG8 A;  4PGY A;  1I20 A;  1PQM A;  2PI4 A;  2DQA A;  2JGA A;  5KG2 A;  5J0W A;  4O3O A;  1L28 A;  1GF6 A;  1L65 A;  1DXS A;  4H8Z A;  3JPO A;  3W6D A;  199L A;  2I26 L;  2DL0 A;  1B7S A;  2OTY X;  2HEE A;  215L A;  2KJ9 A;  2FDR A;  4RQ5 A;  1L3S A;  3SEN A;  1GXX A;  5ALW A;  1JXL A;  259L A;  1IWZ A;  1L14 A;  2RAY X;  4OWA A;  4ETE A;  3I76 A;  4ED2 A;  1YQV Y;  4FJR A;  3W6A A;  4IL6 U;  4PHA A;  5DGB A;  4YX7 C;  1QUG A;  1JKB A;  2BGW A;  1QSY A;  1NK8 A;  5KG3 A;  1B5W A;  3JPR A;  3FAH A;  1BWI A;  4J1B A;  5J0Y A;  5KXX A;  5J8Y A;  4DD1 A;  2F44 A;  4YD2 A;  4F50 A;  5ALR A;  4R8U B;  3F2D A;  1JTP L;  2XID A;  5E9R A;  1D0L A;  7ICO A;  1UIB A;  3A3Q A;  1XU4 A;  5F9L A;  3L3F X;  1NK6 A;  143L A;  3L5K A;  4ED8 A;  2PC2 A;  2ZQ3 A;  2KJ8 A;  2F32 A;  4ARQ A;  140L A;  5HLL A;  2KIC A;  4KMU A;  1C46 A;  3A0H U;  5JRT A;  4RQN A;  3HJE A;  1CJ6 A;  1KY0 A;  2HUM A;  2W11 A;  3CDQ A;  1TDY A;  3HUQ A;  2A19 A;  3JPP A;  4ET9 A;  3HH5 A;  1YAN A;  3N97 B;  5F9U A;  3HW8 A;  4DSI A;  3C1Z A;  1L55 A;  2B74 A;  2BQK A;  1QT7 A;  3P64 A;  4M6W B;  4NHT A;  4I7M A;  1QSL A;  5J0O A;  3TAR A;  2OH2 A;  5KY1 A;  5M1Y A;  5J2J A;  168L A;  4K4H A;  4NL9 C;  4J9Q A;  4DD3 A;  4KLO A;  1SKW A;  2A1J B;  4J9M A;  238L A;  3Q8L A;  1C6A A;  243L A;  2HED A;  1S8O A;  1C6J A;  5FEK A;  4RW2 A;  4B4I A;  4NGO A;  153L A;  2ZIW B;  1NJY A;  4Y2S A;  4Y2X A;  3F5E A;  4QNL A;  5HML A;  4C80 A;  1XO0 A;  4F4Y A;  1NNL A;  4TSC A;  2ZXH A;  3QZ8 A;  4W57 A;  5KFB A;  1NQI A;  1DYF A;  1HEP A;  1KXY A;  2WF6 A;  1B6I A;  2B7X A;  4DFD A;  5KFK A;  194L A;  5KT2 A;  1B43 A;  4EEL A;  3QUT A;  1S5L U;  3CT5 A;  2NTG A;  1L92 A;  3LZT A;  5LXW A;  1SSY A;  2EZZ A;  2LBO A;  4FBU A;  2DQH Y;  2QB0 B;  1ZMY L;  2NYV A;  4WG1 A;  1XGP C;  8ICV A;  1NWG A;  5ALN A;  4I7T A;  3Q8P B;  2BCQ A;  3T79 A;  1LHM A;  4XEN A;  3NVZ A;  2NWD X;  4LT3 A;  2ZTD A;  1JKA A;  1AKI A;  4M6W A;  8ICJ A;  1CU5 A;  1L53 A;  1LHL A;  212L A;  4E97 A;  5F3X B;  8ICN A;  1XJU A;  1QS5 A;  3P66 A;  2QKQ A;  3PML A;  1L80 A;  5LVI A;  5KKJ A;  1UHU A;  5AM3 A;  9ICI A;  4FS1 A;  1CU6 A;  3MBY A;  2AQ4 A;  3MGH A;  3G3X A;  2B70 A;  1JQU A;  1IP6 A;  1UA6 Y;  1KFD A;  1OUG A;  4KIT B;  1LZ9 A;  2HU1 A;  2YBN A;  4B9V A;  5J0P A;  2K8C B;  1F0M A;  4RZR A;  1ZQP A;  2OM6 A;  1K28 A;  2FYD A;  1LZN A;  2LZM A;  3C8S A;  4KXI A;  5L3H A;  4G49 A;  1ZD3 A;  1DQJ C;  4EEK A;  1AT6 A;  3PX0 A;  3BS5 A;  3N28 A;  4NGI A;  4I2I A;  1J1X Y;  4O3S A;  1GE3 A;  3WH1 A;  1ZQY A;  4DYG A;  3EWA A;  1SWZ A;  1LWG A;  4TWS A;  3WW5 A;  5TZV A;  6LYZ A;  1N63 A;  5FST A;  4BAP A;  3KZI U;  2RP5 A;  4IQT A;  1T8A A;  1UIG A;  2G5I B;  1HF4 A;  1OUC A;  2Y8P A;  5C6I A;  4AYB C;  2B73 A;  5LVK A;  2ZXI A;  1LMO A;  1GFU A;  5KXL A;  4DJH A;  8ICO A;  4RNN A;  3A6C Y;  5HNC A;  4Q44 A;  1ALC A;  3HT7 A;  4MHV A;  189L A;  1JIY A;  3UMG A;  3RZE A;  2C22 A;  4C4R A;  1BVS A;  4KLL A;  1NKH A;  1TBY A;  1LZ5 A;  1CKH A;  4CJ2 A;  1B5V A;  1DYA A;  1B7P A;  1UIF A;  4JMU A;  2BQ3 A;  5AKZ A;  1QUO A;  1XGQ C;  2EDU A;  5KFU A;  8ICK A;  7ICS A;  170L A;  2UVR A;  2W43 A;  3H7I A;  4RQ4 A;  3GQC A;  5AKK A;  5ALP A;  4ZOH C;  2RRD A;  4Z6F A;  5KXR A;  1BVX A;  1L7P A;  4UAW A;  2BDU A;  133L A;  3WU2 U;  3HU9 A;  4QZ8 A;  2GOL A;  3K75 D;  3TXD A;  2WFA A;  4H9A A;  1L46 A;  2RH1 A;  3C7W A;  4I8S A;  3JPS A;  2KVC A;  2W8L A;  3MGV A;  4XN6 A;  1GE1 A;  5IIK A;  208L A;  8ICC A;  1P56 A;  1L40 A;  1YAM A;  4QZB A;  1Z4O A;  5AKJ A;  4DSL A;  2YSS C;  5KNI A;  1OUJ A;  1D2Y A;  3V7K A;  5KG7 A;  3A8Z A;  115L A;  5B5E U;  5L1K A;  4CE6 A;  1MQ2 A;  4I0C A;  3NAS A;  4UQG A;  4TUN A;  1P2R A;  4GCF A;  4K4I A;  1HSW A;  2MUT A;  4I2D A;  2BPG A;  1LSM A;  205L A;  1X2I A;  3MDC A;  2N5Z A;  2F77 X;  4YP3 A;  2FLN A;  1X66 A;  2Z12 A;  1GFR A;  4RUC A;  4NLN A;  1P6Y A;  1DGJ A;  4YD1 A;  2XBS A;  4KLH A;  3NUQ A;  3RBE A;  8ICP A;  4YXA C;  2LM4 A;  2OEH A;  4NXZ A;  150L A;  2HBK A;  2K89 A;  4GC7 A;  2M0N A;  4RQ6 A;  2IBK A;  1CKD A;  1CX7 A;  5B06 A;  2PFQ A;  3ZDC A;  5I4Y A;  4ARP A;  4F4Z A;  2FMS A;  1IWY A;  3HX0 A;  1VED A;  3DN0 A;  132L A;  2RB2 X;  5ALM A;  1V9P A;  4ED7 A;  5AI9 A;  4HSF A;  3NVW A;  1F10 A;  4ET8 A;  3ED5 A;  4BX9 C;  2HEB A;  4F5R A;  1KEJ A;  1XSP A;  3SAG A;  3T6U A;  1FLW A;  2OE7 X;  2BQC A;  4DSE A;  1WWV A;  4JWM A;  5KL8 B;  4UAV A;  4E3U A;  4WLD A;  2F3N A;  5KXO A;  4KN4 A;  3LWM A;  1JTO L;  3NS1 A;  2FPM A;  5CA7 A;  1HC0 A;  3K1Z A;  2Z2F A;  3V2W A;  1PK1 A;  5LYM A;  4P0Q B;  108L A;  1WUD A;  1T97 A;  4PL1 A;  3RB3 A;  4WM4 A;  4WO6 A;  5IIJ A;  4ELU A;  4YXM A;  7ICF A;  5AIC A;  1SGG A;  201L A;  1AT5 A;  2H9J A;  4OJP A;  4QWB A;  4H9F A;  3WYH A;  4W55 A;  3NRW A;  3T36 A;  2R18 A;  4DAJ A;  4F4W A;  195L A;  3VWO A;  1D9D A;  1SZH A;  5KXY A;  3CT1 A;  1Y88 A;  4RQ7 A;  3KHH A;  1L87 A;  3C2L A;  1REZ A;  3AW6 A;  1OVK A;  4FBT A;  3F9L A;  1G0Q A;  4GLX A;  1N56 A;  5C5J A;  5A3Z A;  3AQE A;  4JB3 A;  3PSI A;  4Y2J A;  1JX4 A;  2KJ5 A;  1HEM A;  3IJV A;  1S0N A;  1TAU A;  4PGQ A;  4EKQ A;  1Z55 A;  2G4N A;  2I25 L;  4IAP A;  4NLZ A;  5LZM A;  3TMU A;  7ICT A;  2EQY A;  4F5Q A;  9ICO A;  1L43 A;  1LZ1 A;  1P64 A;  3WU8 A;  5KT7 A;  4R63 A;  1S10 A;  5LIN A;  5CR0 A;  1ZQL A;  1ZJN A;  5EE1 A;  4QWE A;  2CGI A;  5DBA A;  1L6N A;  1ZQA A;  1PK1 B;  4WM2 A;  1D9F A;  1QUD A;  1DI4 A;  1JAL A;  4X5V A;  4DF8 A;  1ZQN A;  258L A;  3HBD A;  2BPF A;  5L9J A;  1DK2 A;  3PR4 A;  5LAG A;  4BWJ A;  1IOC A;  5IIN A;  4TSB A;  5KXW A;  4HJV A;  4RLN A;  1JUD A;  3TKA A;  3K3T A;  2BLY A;  5T14 A;  4I7P A;  1C6M A;  180L A;  1L33 A;  3S6J A;  5B66 U;  4XJI A;  222L A;  188L A;  1L3V A;  1XSN A;  1CKG A;  1YKY X;  5AKL A;  1L62 A;  3TFS A;  2HHV A;  1WVU A;  1GF3 A;  1LMN A;  3IWR A;  4H9I A;  4H9H A;  1KSP A;  1LKS A;  3P4Z A;  1LMA A;  1LYO A;  3C7Y A;  5KFA A;  3SV3 A;  3TAC B;  1IP2 A;  2DF4 B;  1LGW A;  228L A;  5EE0 A;  5K7O A;  3G3W A;  3V6H A;  4CGZ A;  1A76 A;  4TUQ A;  3WW6 A;  1YZ7 A;  4W53 A;  2KIW A;  4UB2 A;  3T5K A;  4UAZ A;  2XVT A;  3AYQ A;  3C7Z A;  5D4B A;  1TK0 A;  2ZNX Y;  3RH5 A;  4Z98 A;  3T5H A;  4F4K A;  5HR7 A;  240L A;  131L A;  4GCD A;  1LYH A;  3G6Y A;  4O5K A;  1XSL A;  1TV9 A;  1HMK A;  4I2J A;  1GFE A;  256L A;  3VW7 A;  2AUB A;  3HH4 A;  4H93 A;  2KOB A;  4GXJ A;  3BS7 A;  1CU2 A;  3GDX A;  2BQD A;  3ZDD A;  5KG1 A;  1FKV A;  3GIJ A;  1C69 A;  3B0I A;  3OPX A;  1IY4 A;  3RFA A;  1PVQ A;  3FYH A;  3V7J A;  146L A;  5AIA A;  4IQW A;  2H3Z A;  3PST A;  2R8H A;  1CNS A;  1FDL Y;  4JV1 A;  1LSE A;  2VA3 A;  3F5A A;  3PR5 B;  1CV0 A;  4GCB A;  2YMQ A;  5D5F A;  2EQL A;  5KFY A;  4MFC A;  2D4I A;  2QB0 A;  1HEQ A;  1IWW A;  1J1P Y;  4XYY A;  2HEA A;  4OD0 A;  1T8E A;  211L A;  4LYB A;  2YMM A;  3HFM Y;  3GIM A;  2ISO A;  3RU5 A;  4QZ9 A;  3BQ2 A;  1L74 A;  1C6N A;  2HUL A;  3QUB A;  2KG5 A;  3SEI A;  244L A;  220L A;  2RB1 X;  5KFL A;  1LPI A;  2YMP A;  3B6L A;  4QZE A;  1QSA A;  2KFN A;  4MEY A;  1KTQ A;  1L90 A;  2LC9 A;  2OU0 X;  4OWC A;  5C0Y A;  2QB1 A;  3HDE A;  4TUP A;  9ICF A;  4K5Y A;  1DK3 A;  2ZIX B;  5KFX A;  3C8R A;  3BDP A;  2Z18 A;  2LZ2 A;  1FFU A;  2BPC A;  1IO5 A;  1T7P A;  1GE2 A;  2OTZ X;  4F93 B;  2KV2 A;  3ZD8 A;  3TAP A;  3CSR A;  5AI5 A;  1S76 D;  2WF5 A;  5KL1 B;  1WQQ A;  2FBB A;  4Q8E A;  2K8A A;  5DN5 A;  1LYD A;  112L A;  5DKW A;  5HNL A;  1LYG A;  4J9O A;  1FBI X;  4I2C A;  1NDG C;  2LYZ A;  3PV8 A;  2H3I A;  2XBR A;  1NKE A;  1SV4 A;  5DQI A;  149L A;  1GBS A;  245L A;  2D91 A;  2YBL A;  3W6F A;  4PPX A;  2EKS C;  4NIJ A;  3IHQ B;  4B4E A;  1BNP A;  1G0G A;  209L A;  1SB3 C;  2EAN A;  1SWY A;  2IA6 A;  4ML7 A;  4DL4 A;  1LSN A;  1OWY A;  1KW4 A;  4PZO A;  4C7Z A;  4GCC A;  2CPR A;  3QEB Z;  4FDY A;  1KLN A;  7ICG A;  4ECR A;  174L A;  1T3N A;  1ZQM A;  2BAA A;  3RH4 A;  4EEY A;  2F1J A;  2Y1J A;  2RBP A;  3DMV A;  104L A;  1ZQK A;  4O3Q A;  3OE8 A;  4XJF A;  3ODU A;  4KLF A;  2ASD A;  1LI3 A;  192L A;  4J0L A;  3MR6 A;  5HQ1 A;  3ORY A;  4YG2 A;  8ICI A;  1C7P A;  1L13 A;  1XSF A;  5KXT A;  2PFO A;  5KFJ A;  3A94 A;  1DOQ A;  1WTH A;  1JN3 A;  3PO4 A;  5DB8 A;  1DI3 A;  1ZET A;  9ICK A;  103L A;  1L69 A;  5JU5 A;  1LZ8 A;  1ZYQ A;  5KT4 A;  1JIT A;  1ZQD A;  7ICL A;  2ZJ8 A;  4UB4 A;  1A4V A;  5ALQ A;  1C67 A;  1QSW A;  2Q9E A;  1NJW A;  4XRH A;  1UC0 A;  2OCE A;  2AXT U;  5KFP A;  2ZIV B;  2KSO B;  4KLI A;  5LYT A;  1JTM A;  4DSK A;  2BQJ A;  1JKD A;  4Z41 A;  4WLY A;  3NVV A;  4Z6C A;  1UA0 A;  3D9A C;  4Y2R A;  1J2N A;  3AEV A;  2FMP A;  1BWJ A;  3QUQ A;  3GXK A;  5AKG A;  4F5N A;  5IHG A;  3B0Y A;  226L A;  5DL9 A;  2XGQ A;  4ECY A;  1ED1 A;  4I2B A;  1L76 A;  4BDP A;  3MGW A;  2XCA A;  5LVJ A;  3MR3 A;  3SAF A;  1B0X A;  3EUB 2;  5AKX A;  1NF5 A;  4G9S A;  3SB6 A;  2XY6 A;  3ETL A;  3A93 A;  4LFX A;  1LWK A;  3OJS A;  2KZM A;  1L73 A;  3SR6 A;  242L A;  262L A;  4EXM A;  1JIH A;  4Y2P A;  4PRQ A;  1B4F A;  5L1M A;  1IIZ A;  4R0F A;  229L A;  1KRP A;  3PNC A;  3HTF A;  4JV0 A;  7ICP A;  2DQI Y;  2HHS A;  4O9M A;  2V4R A;  1DYC A;  4NG8 A;  1IOR A;  1L44 A;  2KEY A;  2DFL A;  4LZT A;  1L54 A;  1ZQX A;  3RRH A;  2ZTE A;  1GB8 A;  5J2C A;  5ALU A;  1LKY A;  3FI7 A;  2BCV A;  8ICL A;  1L98 A;  4YOP A;  2DQG Y;  2ZYP A;  2C28 A;  1CU3 A;  4DQI A;  3SAH A;  2W1L A;  3F53 A;  1HER A;  1CV1 A;  1T94 A;  3C2M A;  1KL9 A;  4DL7 A;  2XCP A;  1GB3 A;  9ICC A;  4P2E A;  3DMX A;  5ALE A;  2ANX A;  4DD2 A;  4F72 A;  9ICJ A;  4PHI A;  3AZ5 A;  4HPI A;  2JRZ A;  2RBO A;  2H3F A;  1L42 A;  3OHA A;  3F6Z A;  1HEO A;  3FE0 A;  4NGL A;  4YCX A;  1G7I C;  4RQ0 A;  1HUO A;  7ICK A;  4NG1 A;  4EOF A;  1IX0 A;  4DS4 A;  125L A;  3AU6 A;  2DUY A;  3UPQ A;  2DPI A;  3RH6 A;  3SB5 A;  3ZI4 A;  236L A;  3A96 A;  3FM9 A;  3A0B U;  4IJ4 A;  5F16 A;  5ALL A;  5D46 A;  3PX6 A;  1BB3 A;  2GWS A;  4F71 A;  1CV3 A;  1L10 A;  1NOM A;  1D3N A;  1SWW A;  9ICE A;  1HEK A;  4C4S A;  5ALH A;  2HHW A;  9ICR A;  4G3I A;  111L A;  4DDB A;  4NSI A;  2NO5 A;  1SL2 A;  2K4I A;  1G07 A;  4BXO A;  3N9A A;  1IP7 A;  4P4O A;  1TK5 A;  1OUQ A;  2NRX A;  1L34 A;  1U48 A;  1QTM A;  2Y9U A;  1LW9 A;  3BJY A;  5KG6 A;  4GLV A;  4BJQ A;  3SBB C;  5AK6 A;  3SD7 A;  5I53 A;  7ICM A;  2K8B B;  2LYO A;  8ICG A;  2RBQ A;  1I1Z A;  2JEJ A;  2GV0 A;  7LZM A;  1GBZ A;  4IR1 A;  4DLE A;  5J0U A;  5DB6 A;  4H94 A;  1BPZ A;  3VC8 A;  2E8O A;  2XY5 A;  3E3D A;  3WK7 A;  1ARO P;  1G0P A;  3OK0 A;  1KFS A;  2FJ6 A;  4DSJ A;  1NMM A;  5IEL A;  1C6G A;  3H8M A;  1JSF A;  3E0F A;  4RT2 A;  1L24 A;  248L A;  4D9Z A;  3M6K A;  1XEJ A;  1DGS A;  1P3N A;  4WM6 A;  1LSY A;  4I7O A;  4N9R A;  4C3W A;  4HPE A;  2Y9T A;  2VJ5 A;  5AM0 A;  4H8Y A;  5KFE A;  2HI0 A;  4FZL A;  4R64 A;  2YY6 A;  3M8S A;  1IWU A;  1ZQ1 C;  1RYS A;  3GUO A;  5DLA A;  2JV3 A;  3B9J A;  5HHI A;  4J9K A;  1F44 A;  1JI7 A;  2PI5 A;  213L A;  2VIX A;  3CNH A;  3BQ1 A;  4IC9 A;  4Q45 A;  4M47 A;  1L61 A;  3UQ2 A;  1E8L A;  5KFT A;  3RJF A;  4EKP A;  1UBZ A;  1Z1B A;  183L A;  3ZD9 A;  126L A;  1KIQ C;  4TQR A;  1IWT A;  2FMQ A;  1WYG A;  190L A;  1LPY A;  3WPJ A;  5KT5 A;  3RW8 A;  1B5Z A;  3TAQ A;  1QUH A;  2YBM A;  4ETB A;  4DCC A;  2V9W A;  1IM4 A;  5AIB A;  1SX2 A;  4NHQ A;  1DYB A;  1IP3 A;  1OYU A;  5ALY A;  1OVJ A;  3HTB A;  4M6D A;  2KMD A;  1L3U A;  1REX A;  1L35 A;  4N8Z A;  4W58 A;  1VAT A;  1GDW A;  2FYC A;  4DFM A;  2FE9 A;  3C83 A;  4EYH B;  3M9N B;  1B5X A;  3AM9 A;  3QU2 A;  5III A;  114L A;  1ZQF A;  1ZQU A;  2PFN A;  4P0P A;  1XEP A;  1L64 A;  4OJL A;  4Y2Y A;  4DOA A;  3EYZ A;  2DQC Y;  4M2Y A;  4W96 A;  120L A;  4ETA A;  4PHD A;  5ALD A;  1ZQB A;  4CHX A;  4M9J A;  2KKV A;  2BPU A;  2W04 A;  4EPF A;  4JWN A;  4DQ5 A;  1LGX A;  3Q8K A;  253L A;  1L7N A;  2RBR A;  1JXE A;  4XUS A;  1G1W A;  1ZQO A;  1GFA A;  1L57 A;  4NWE A;  4TX7 A;  4YXC A;  1D6P A;  3DMZ A;  163L A;  2XI9 A;  123L A;  5FHW A;  4X3B A;  4P0Q A;  5KXK A;  4QZH A;  3T3F A;  2AGP A;  167L A;  3B72 A;  1L38 A;  4GN3 A;  1BGX T;  2DBT A;  221L A;  2DKV A;  9ICS A;  1UA1 A;  2HSZ A;  3AGH A;  4YR2 A;  3D3D A;  1L5U A;  5EBH A;  5B1G A;  1L45 A;  1LZD A;  4DT3 A;  5TIS U;  129L A;  5KXZ A;  1L68 A;  1LMQ A;  4KT3 A;  1BWH A;  1X9W A;  2XO7 A;  1L60 A;  4ANR A;  2E8M A;  5DQH A;  2LZT A;  3SI8 A;  1KXX A;  2ATL A;  3JPQ A;  5HP4 A;  1JJ0 A;  2EZY A;  3L2X A;  2ZIV A;  1IOQ A;  1LSD A;  2BQF A;  1IOS A;  1PZN A;  3TI0 A;  241L A;  3AW7 A;  4JUZ A;  4ARL A;  4TUS A;  1SXE A;  4QWD A;  4F3O A;  4U6P A;  1ZQS A;  186L A;  1DXJ A;  4ELT A;  1ZQG A;  4LDE A;  2K4E A;  4IR9 A;  5AI8 A;  2JEF A;  197L A;  2D8C A;  1LVH A;  5KG0 A;  1LSA A;  4NLB A;  2N1R A;  4FFD A;  4H9E A;  1ZQI A;  1OV7 A;  1GFH A;  1XWL A;  4EJ4 A;  2ASL A;  1XGU C;  1L25 A;  1C60 A;  4HJY A;  3M9O B;  5BPC A;  4PJ0 U;  3M7D A;  2EIZ C;  3V2Y A;  1D3J A;  2Q0Z X;  4Y2T A;  4LJX A;  4NV0 A;  4F5P A;  1B0D A;  5ALG A;  1WTM A;  3RT5 X;  5ALV A;  4RDS A;  2HBM A;  4WM3 A;  2BQL A;  2LMR A;  3W6C A;  1L09 A;  4EBD A;  2Q0M X;  4PZN A;  2W3S A;  3MR2 A;  4ECU A;  7ICH A;  2W9B A;  4I2F A;  5KFO A;  1RI8 B;  5J2F A;  2BQH A;  1LHK A;  1G0M A;  1UUZ C;  4UBB A;  3GUP A;  4H90 A;  3SN6 R;  1SWV A;  1K5O A;  1ZQW A;  4XA5 A;  1LJJ A;  4B6J A;  3C81 A;  4ZH4 A;  2BQU A;  1T4G A;  2HW3 A;  4QDN A;  2O7A A;  4XAD A;  1C6F A;  3N9C A;  9ICW A;  4AP9 A;  1L88 A;  3LHM A;  2ZWB A;  2MEH A;  2WB1 C;  1RG6 A;  3KD3 A;  2LI6 A;  1LMT A;  2ISP A;  4KLM A;  1D8B A;  2QLT A;  5EE3 A;  2ES6 A;  1OUD A;  3C80 A;  2EAP A;  3WK4 A;  3H0R B;  5KTQ A;  5JUM A;  2C8O A;  210L A;  7ICR A;  233L A;  4M9L A;  3HTG A;  5ILC A;  2E1E A;  4DWI A;  1L32 A;  2B6W A;  3M8R A;  4Z6E A;  2Q4T A;  1LZE A;  239L A;  2WB1 F;  137L A;  5LA5 A;  3EZ5 A;  3NY8 A;  5G5G A;  4RU9 A;  4CCH A;  1GO3 F;  4Z6D A;  3EXD A;  3LN2 A;  2W9A A;  1LYI A;  5JEN B;  2E3T A;  2W54 A;  224L A;  5AI6 A;  2FLL A;  1FIQ A;  3H40 A;  4IRD A;  193L A;  2HDO A;  3WKB A;  1ZXI A;  1WVV A;  5AM2 A;  1IR8 A;  1NK7 A;  3ZDB A;  175L A;  3C28 A;  3LZM A;  3G6X A;  9ICA A;  1SIJ A;  1L81 A;  1PQJ A;  2RB0 X;  4XJD A;  5AKH A;  1CTW A;  2HTX A;  1G06 A;  3GUK A;  2PMZ F;  5LA8 A;  1FKQ A;  3A92 A;  3ZDE A;  2YBI A;  4AGA A;  1L52 A;  4KX5 A;  1JTN A;  1FLU A;  4NHS A;  1LI2 A;  4ICA A;  3MAB A;  4RQ8 A;  1EQ4 A;  2B6Z A;  3TXG A;  4YF2 A;  1WQM A;  5KFD A;  1IG6 A;  4DFK A;  4C8M A;  1PQK A;  5IDD A;  8ICQ A;  1J1O Y;  3PSP A;  2ZIX A;  4LDO A;  5KXP A;  2IHM A;  4I29 A;  198L A;  3GIL A;  2JH7 A;  4EX7 A;  4N0J A;  5EWF A;  1QTH A;  3TXF A;  1L75 A;  2KZZ A;  4J9S A;  4O34 A;  3LYZ A;  152L A;  5KT6 A;  1C6B A;  1L97 A;  1LKR A;  8ICW A;  4AXT A;  2Z38 A;  1KXW A;  4DOC A;  1MC8 A;  1B7N A;  1HFX A;  5J2B A;  107L A;  1RM6 C;  2GH1 A;  2VA8 A;  1LGU A;  1M6Y A;  2A7D A;  1QT5 A;  4NJ8 A;  4QZD A;  5AM1 A;  2IHL A;  1CV4 A;  3TXH A;  2MAX A;  3RB6 A;  1BB5 A;  3AMZ A;  1B7L A;  1C08 C;  4RUA A;  3RR7 A;  2HHU A;  3RB4 A;  1OP9 B;  2W7O A;  1QS9 A;  4A8E A;  2BR0 A;  1AM7 A;  1SLY A;  4P4P A;  1QTD A;  2ZIJ A;  4PJ2 C;  1PQO A;  1UCV A;  1TLA A;  2MEB A;  4I7K A;  3TMX A;  4AQN A;  4DDC A;  3H0L B;  2JZB B;  3KTQ A;  1L70 A;  3HH6 A;  2K4P A;  2OEA X;  237L A;  1D0M A;  1C6T A;  2W03 A;  3UXN A;  1F6R A;  5B59 A;  1C64 A;  3HP6 A;  1K1Q A;  1L21 A;  2JMG A;  1L0J A;  5LIO A;  3F2C A;  3WKD A;  1D8L A;  4I2A A;  2F1I A;  1N5W A;  4U7C A;  1QTE A;  2KN7 A;  1RYU A;  2V4Q A;  3GU3 A;  4NGZ A;  2W55 A;  1X9S A;  118L A;  1ZQH A;  4TQS A;  4W94 A;  3ZVQ A;  1L36 A;  4QW9 A;  5ILF A;  1Z19 A;  5FEL A;  1C6P A;  2B6T A;  165L A;  4QIW F;  5LYZ A;  4DS5 A;  2JHD A;  3RJE A;  1QLN A;  4LYT A;  2BCU A;  5AI0 A;  4QZA A;  2KFZ A;  1JUG A;  2KVS A;  3HT3 A;  4EZ9 A;  1LMP A;  1YL1 X;  4IQU A;  3MC1 A;  1L96 A;  2WF7 A;  1V7T A;  1ZQZ A;  1CJ9 A;  2OE4 X;  169L A;  1S0O A;  1LSG A;  1BPE A;  3KHG A;  2BQO A;  3HTD A;  1N62 A;  3RR8 A;  4DL6 A;  3GUJ A;  3PDS A;  2FI1 A;  1BB7 A;  8LYZ A;  3G3A B;  9ICN A;  4H92 A;  4ARQ B;  1DZB X;  1G1V A;  1DRG A;  2DBY A;  1L72 A;  4HTQ A;  2W1M A;  3MFI A;  1G7L C;  4B1A A;  4LYZ A;  1LYS A;  5ALZ A;  2KK0 A;  5J2K A;  4UB1 A;  7ICE A;  3OJP A;  4YMM A;  9LYZ A;  1Z00 B;  3Q8S B;  4B9N A;  250L A;  3CDT A;  4QZC A;  5L9X A;  1PQI A;  3LYO A;  176L A;  2W9C A;  4I7J A;  161L A;  2W3R A;  1DPW A;  1NHB A;  2JEG A;  3CDO A;  5II3 A;  8ICT A;  1L77 A;  5J2H A;  1QQ5 A;  1LOZ A;  4ECZ A;  2ZIK A;  1LKY B;  2KHV A;  2NRW A;  2F47 A;  5E4P A;  4PHE A;  1C6H A;  1DYG A;  157L A;  4CFO A;  3QNG A;  1XGT C;  1HIW A;  7ICJ A;  1UCO A;  1G7J C;  1IIP A;  1O23 A;  4NSH A;  1ZRN A;  4TTD A;  4M04 A;  2ZJ5 A;  2F2Q A;  1HNL A;  4DEZ A;  1SKS A;  9ICG A;  2UVV A;  5D49 A;  3GII A;  1D3M A;  5B05 A;  5DG7 A;  1LZ4 A;  1L8L A;  2DGZ A;  3TMW A;  4ZIX A;  2XJW A;  4KL7 A;  3PW7 A;  4Y2V A;  1RFP A;  3K1R B;  5KFI A;  5J0T A;  2ZQ4 A;  5J2G A;  4NWI A;  4R8U A;  1IWX A;  2WAQ F;  3N4M B;  3RTV A;  4I7Q A;  4NGW A;  5APF A;  2HBL A;  5KFC A;  2VJ4 A;  1QT8 A;  3T5J A;  3RJG A;  2ESE A;  3HBE X;  4WOA A;  3UM9 A;  3ZDA A;  3WK8 A;  1FO4 A;  1KBU A;  4F91 B;  1OQM A;  4OW1 A;  2F4G A;  4R65 A;  3L64 A;  3RAQ A;  2HVH A;  4LDL A;  4RQ2 A;  1GF9 A;  1YRO A;  4USA A;  4YXJ A;  2NV3 A;  1KQQ A;  2JZB A;  2KZ3 A;  4W56 A;  1OUF A;  5I4W A;  4XJB A;  4OJ5 A;  4PRU A;  2P35 A;  1QQ6 A;  4WL6 A;  4DFP A;  1L7M A;  173L A;  1SX7 A;  1COK A;  2ZNW Y;  4PGJ B;  3B0X A;  1VDT A;  4EYI B;  4EMN A;  1L47 A;  184L A;  1WWU A;  1PQD A;  4Q8F A;  1TAM A;  1QUT A;  3AZ4 A;  3RBD A;  3PSF A;  5T3F A;  1UT5 A;  1W08 A;  3WXT A;  3FDS A;  1RXW A;  4C8K A;  5A0L A;  3C1Y A;  3EW9 A;  3AQF A;  1JPO A;  4NM2 A;  4QJF B;  1HEN A;  4F92 B;  3HRD D;  1JRP A;  4MF2 A;  2LYB A;  5K4L A;  1L41 A;  227L A;  4NSG A;  1QTC A;  1PVR A;  1LHH A;  1XS9 D;  2Y0S C;  4P2H A;  1LJF A;  2C2R A;  1D6Q A;  5EWG A;  1CUP A;  1UT8 A;  1NDM C;  1GEV A;  1QTZ A;  3GIK A;  2F8K A;  4W59 A;  5APC A;  5I5Q A;  2IGC A;  182L A;  2H3Q A;  3QU4 A;  3KHR A;  4NLG A;  2LCB A;  1LHI A;  1ZJM A;  1HML A;  1CEZ A;  217L A;  2ALZ A;  3I1Y A;  2CJL A;  1P7S A;  1HUZ A;  1LJG A;  4WMG A;  2D6B A;  3FAD A;  3NRZ A;  2BCS A;  1WQP A;  5DN4 A;  4NLK A;  2BQN A;  1KN5 A;  4PPO A;  4CF5 A;  1BPX A;  1RQL A;  1EL1 A;  3W6E A;  1GFT A;  2WTF A;  4EZ6 A;  4BAD A;  3QX7 A;  1KKX A;  6LYT A;  4ACO A;  5J0X A;  1NI3 A;  1QTK A;  2BLX A;  3WK5 A;  4CF4 A;  223L A;  1XNS A;  4NEB A;  5CJ7 A;  2B5Z A;  1GF8 A;  5J2D A;  3CSZ A;  7ICV A;  4ECV A;  8ICY A;  3KAM A;  178L A;  2BQB A;  3TMV A;  1L04 A;  1YL0 X;  1GHL A;  5F9N A;  4RLM A;  2G4P A;  4XJG A;  5KFN A;  3K2R A;  5DBC A;  4US8 A;  2YQE A;  2VA2 A;  1TKD A;  2NTH A;  156L A;  5CWR A;  1BQL Y;  1NBZ C;  3QUC A;  5A3E A;  2W1X A;  3RAX A;  4ARJ A;  1FLY A;  3AN1 A;  2WAR A;  4HV2 A;  8ICB A;  3HT8 A;  5J0R A;  4DQR A;  3KHL A;  4ED6 A;  9ICX A;  1GAY A;  1VDS A;  3C82 A;  4I7R A;  1N4F A;  4WLX A;  4MEX A;  1HFZ A;  1YAQ A;  1LZC A;  4I2E A;  4KLS A;  1L59 A;  1KDH A;  4DL3 A;  1ZQJ A;  1EXN A;  3BZC A;  2RQ5 A;  2K4H A;  3CB7 A;  2BQA A;  2F2A B;  4N5R A;  4NGV A;  1L7O A;  1LZY A;  4LYM A;  1H6M A;  2B21 A;  232L A;  5L1I A;  3C8Q A;  4N1C C;  1C66 A;  2MU2 A;  2KKP A;  1QT6 A;  4J9P A;  3N7P D;  1CX6 A;  3EO5 A;  1ZVH L;  1GF0 A;  2BHN A;  2EH9 A;  3O0F A;  1BPD A;  2R8I A;  1LMC A;  1WCN A;  4C8L A;  2HEF A;  141L A;  1QSQ A;  5FP0 A;  2MRL A;  2HCF A;  3OE9 A;  5B07 A;  1QT4 A;  5I4X A;  4KLD A;  2PMZ C;  3TXE A;  4DQS A;  1C62 A;  2A7F A;  3WK9 A;  1KY1 A;  4YEM A;  1UIH A;  4EPI A;  2CN1 A;  5AK4 A;  4OWE A;  5KFS A;  1YZ6 A;  3WPK A;  216L A;  3PMN A;  1XJT A;  4Y2Q A;  1DKJ A;  1LJN A;  1BPY A;  1N61 A;  1VJ5 A;  2PKE A;  1CUK A;  2VAN A;  4RPY A;  113L A;  2WF9 A;  1GPQ C;  5DDM A;  1KW7 A;  3CDV A;  1LV5 A;  1RCM A;  8ICH A;  1ZD4 A;  254L A;  1LZA A;  4O5C A;  4W51 A;  3A91 A;  4O5E A;  3AB6 A;  2KSO A;  1C6I A;  3B0K A;  2XGP A;  1P46 A;  2UVW A;  1NHE A;  5G5H A;  5KG4 A;  2G07 A;  4H9B A;  4OOO A;  3E2E A;  4J9R A;  145L A;  3RJJ A;  2ZIW A;  3H8S A;  4GRV A;  4C4T A;  3LK9 A;  234L A;  3SB9 A;  4LYC A;  3WUL A;  3OE0 A;  2JXJ A;  1LYZ A;  1X6J A;  8ICU A;  1XEK A;  3OHB A;  4NFV A;  1MN8 A;  1IV8 A;  1L19 A;  3BKV A;  147L A;  4OOT A;  5F9X A;  1V38 A;  2RAZ X;  1C45 A;  4ED1 A;  3CYM A;  3TQ1 A;  4GLA A;  1QH9 A;  3D2N A;  1G0L A;  3QXG A;  164L A;  3TXK A;  2B0C A;  1Q3U A;  1WQO A;  1YT3 A;  3C2K A;  3L4P A;  2LPE A;  3TAD A;  4ECW A;  1UIE A;  1G7M C;  1L95 A;  2HBJ A;  4RQM A;  1L23 A;  4R6C A;  4YFK A;  1X9X A;  1UID A;  196L A;  2R8J A;  1JSE A;  5DDY A;  3WKE A;  1JEF A;  2H5X A;  1QQ7 A;  181L A;  1GBX A;  5APE A;  1OUI A;  4EBC A;  1GFG A;  1IR9 A;  1B9O A;  3SQI A;  2L78 A;  4I7L A;  2Y0S F;  2YBH A;  3SB7 A;  3HBH A;  4KLQ A;  4BAF A;  3GUM A;  1CJ8 A;  1B7M A;  1J97 A;  3M9M B;  2IMW P;  3HWL A;  4PK0 A;  4O3R A;  1X6I A;  1AZF A;  1SXD A;  3DN2 A;  5KG5 A;  4KLG A;  1YKX X;  1RPL A;  3KZX A;  4B9S A;  1LZT A;  1Q3V A;  4GC6 A;  1WTN A;  1IOT A;  4PGX A;  3A34 A;  4YQW A;  4XJH A;  1C20 A;  2KD1 A;  1T3Q A;  3V6J A;  2AGO A;  3KKA A;  1H87 A;  1X9M A;  5APD A;  4DQQ A;  1HJP A;  4J9L A;  3BZK A;  4M9H A;  4DQ7 A;  1DYE A;  1L86 A;  4LVS A;  5I14 A;  1TEW A;  2DWQ A;  1L01 A;  2ZG6 A;  4I28 A;  3ISB A;  2XC9 A;  1NBY C;  1GBW A;  3OJU A;  2HHQ A;  1NJZ A;  142L A;  3WUA A;  2AHO B;  2YB1 A;  4UB5 A;  2EAO A;  206L A;  1L39 A;  2RLT A;  2W1Y A;  7LYZ A;  5J2I A;  1A77 A;  4MF8 A;  4ELV A;  4F8R A;  1L31 A;  1GEZ A;  251L A;  4N1E I;  4RNO A;  1F0W A;  4UWN A;  4I7S A;  1ZYT A;  2A3V A;  4OWB A;  4DKL A;  3SZ2 A;  3IP4 B;  1IC7 Y;  1L82 A;  4J1A A;  4GIB A;  4RW1 A;  1GE4 A;  2HOF A;  3RNX A;  8ICF A;  4XQ8 A;  4UAY A;  1LZB A;  3ALR A;  5DGA A;  4PHP A;  5KAF U;  1OWZ A;  1C61 A;  4C5F A;  3SMV A;  1L63 A;  7ICN A;  2ODG A;  1XC9 A;  246L A;  3CP8 A;  2W8K A;  4O3N A;  4LT1 A;  4EKR A;  4OCZ A;  1RYR A;  2EPE A;  4HTN A;  3WK6 A;  1TFR A;  2C2E A;  2OU9 A;  3LDA A;  3LYT A;  4YEN A;  1L29 A;  4FE3 A;  3C5F A;  1D3F A;  1HHL A;  3M3U A;  4LT0 A;  4ETD A;  3Q8Q B;  5KXM A;  3H4D A;  9ICB A;  2MED A;  1GB6 A;  3JPT A;  2Z2E A;  1LZS A;  2ZUC A;  1B7Q A;  1IEE A;  1KS3 A;  1MQ3 A;  1LCN A;  1NJX A;  1JTT L;  1PZY A;  3AL0 B;  2GO7 A;  2OXO A;  138L A;  2B6Y A;  3QY4 A;  2F76 X;  3H0M B;  2HEC A;  1ZQE A;  3CT0 A;  4CDG A;  1KIP C;  4YR3 A;  4F5O A;  4QY9 A;  1FFV A;  4HV1 A;  1U47 A;  3OGU A;  2A1J A;  2AH5 A;  3C5G A;  2DQD Y;  5J7C A;  1D9W A;  1IP4 A;  2BQG A;  3RJK A;  1L02 A;  1JMS A;  2LM1 A;  3SP3 A;  1NZB A;  3PY8 A;  1LSZ A;  1ZV5 L;  5J2E A;  4F2S A;  4DQP A;  5HMJ A;  2XY7 A;  3OSP A;  3AGI A;  1L67 A;  2M9N A;  4YR0 A;  2GLE A;  2KIV A;  1L03 A;  3M6Z A;  3NTU A;  3QU5 A;  1DKK A;  1L15 A;  4CRX A;  2OE9 X;  2E8P A;  1V7S A;  5LVH A;  1B22 A;  1VDP A;  2Z39 A;  2HUK A;  1OXJ A;  5JTI A;  1IXR A;  3ISD A;  2Z37 A;  4KLU A;  5KFG A;  1LSC A;  1GB7 A;  1L56 A;  3M18 B;  3D4S A;  5CP2 A;  3NGD A;  5BOL A;  3MGI A;  2AJQ A;  3AJN A;  5FCP A;  1B2K A;  4CGE A;  4NY5 A;  2L5Y A;  4II8 A;  2KTQ A;  3HKZ C;  4I2G A;  4H1P A;  2G5H B;  4S0W A;  3PW0 A;  4W52 A;  2J6U A;  2FPK A;  1QT3 A;  4UAS A;  4LZG A;  4CNQ A;  1N48 A;  2G09 A;  2C2D A;  4C7Y A;  2XTH A;  4WM5 A;  3EPG A;  1ZQC A;  177L A;  1A2Y C;  2PXI A;  3FI5 A;  4KX3 A;  5AM4 A;  3ETR A;  4LZD A;  5KFH A;  3QNM A;  2UVU A;  1CKC A;  1YIL A;  4UWU A;  3PW2 A;  4KMO B;  1C6E A;  3IV6 A;  5KFW A;  5KKI A;  3QU9 A;  257L A;  1A0P A;  4UAR A;  1L27 A;  4B0D A;  4LT2 A;  3UQ0 A;  9ICP A;  1BB6 A;  3GZF A;  3F8V A;  4HP0 A;  2R8G A;  2BCR A;  1GXV 2;  2YTU A;  2MEI A;  4FZM A;  1UPH A;  5J0Q A;  1CI4 A;  3MDA A;  4DSF A;  4B49 A;  3WKA A;  1HEL A;  2YN4 A;  5CB1 A;  1LB2 B;  1RZT A;  2O79 A;  3G3B B;  3IJU A;  1H38 A;  4O3M A;  1ZD2 P;  4DD9 A;  8ICR A;  2KHQ A;  3MR5 A;  4PL2 A;  4GXI A;  5J0S A;  4P4M A;  1LYY A;  3DN6 A;  127L A;  1NK0 A;  1ZD5 A;  1OUH A;  260L A;  3WXU A;  187L A;  1GB2 A;  3QU7 A;  1MA7 A;  2MUT B;  1IP1 A;  1L91 A;  3AU2 A;  4EBE A;  2P66 A;  3T5L A;  1L08 A;  160L A;  1SL1 A;  1SV0 C;  1LSF A;  1RXV A;  8ICZ A;  3AZ7 A;  1NKB A;  2FLP A;  5AKI A;  3HUA A;  2HHX A;  1ZQR A;  4U3X B;  148L E;  2D6F C;  1SSW A;  2Z6B A;  3LYM A;  2DQE Y;  3AGG G;  4H91 A;  2ZTC A;  1GB0 A;  1P2C C;  1LZG A;  1GAZ A;  4ZPU A;  2ZJA A;  3LWL A;  4F2R A;  4M9G A;  1L83 A;  3ULR A;  1FEZ A;  3UXP A;  4WO9 A;  3W6B A;  1L26 A;  122L A;  5DBB A;  2H5Z A;  3NY9 A;  3WVX A;  2DPJ A;  1KW5 A;  3QE8 A;  1FLQ A;  2ZUB A;  1QQY A;  1D9U A;  4E0D A;  1WQN A;  1GFJ A;  1VFB C;  1ZOL A;  4PJZ A;  3V7L A;  3HPO A;  2HOQ A;  5ALJ A;  1G7H C;  4Z46 A;  2ZIU A;  5AK5 A;  5AK3 A;  4J03 A;  109L A;  4B4J A;  1XO1 A;  5KFV A;  1GF4 A;  1NKC A;  4HAI A;  4RT3 A;  3DNA A;  2MSN A;  5L3I A;  1XEI A;  1Q46 A;  3AUO A;  2Y1I A;  2W9M A;  2BQM A;  4J7V A;  3LVV A;  1RDF A;  4KLJ A;  5J2A A;  4G4B A;  3K4G A;  5AHX A;  1T3P A;  3G6V A;  2JH1 A;  2IHN A;  3I28 A;  3CRX A;  1IY3 A;  9ICL A;  2WF8 A;  4FS2 A;  5CRX A;  4BGD A;  3HUK A;  1C7Y A;  4HYK A;  5ALF A;  2W9B B;  2EAM A;  3SYZ A;  2NO4 A;  3F2B A;  5KJ9 A;  1GB5 A;  4P0P B;  4QWC A;  2XQO A;  3HT6 A;  3ICX A;  2YVB A;  2FPL A;  2YML A;  1C63 A;  1LJE A;  1F5S A;  2ZUD A;  4C8O A;  1SKR A;  1X40 A;  3TFR A;  5IIL A;  1C6K A;  4DL2 A;  2OHF A;  1LJH A;  5EOZ A;  2MEG A;  3IDW A;  3TXJ A;  1WCL A;  1L84 A;  1P5C A;  3ONN A;  3OSN A;  1BVK C;  1L66 A;  1LYF A;  3D2S A;  8ICE A;  1LTM A;  1D0K A;  2CRX A;  1PVP A;  1L30 A;  4QW8 A;  2W7P A;  9ICU A;  247L A;  5KXS A;  4MFF A;  3EPI A;  1GF5 A;  3P65 A;  4ECT A;  3KBB A;  4YN4 A;  3SV4 A;  1Z3E B;  5AM5 A;  1L07 A;  2I6Z A;  1LJ3 A;  3PW4 A;  3LVW A;  1LJ4 A;  4YM8 A;  2HHT A;  2O6K A;  4B9M A;  1C43 A;  3RJI A;  1P7D A;  3DDH A;  3VCB A;  191L A;  4O3P A;  1TK8 A;  1OVH A;  3AZ6 A;  4GFJ A;  3PX4 A;  4M9N A;  3PO5 A;  1VAU A;  1P36 A;  2LHT A;  1C6D A;  2A4T A;  2WAQ C;  4JK1 A;  1L71 A;  1FN5 A;  3Q8R B;  4LGK A;  4TUR A;  2ZYC A;  1L93 A;  4I2H A;  2PFP A;  5DQG A;  4O0I A;  3W3E A;  5C6L A;  1C6C A;  4MR1 A;  3WKC A;  1IWV A;  5AI4 A;  3BS5 B;  2F1H A;  155L A;  4RQ1 A;  3M1Y A;  4YEO A;  1BB4 A;  3HKZ F;  2A1A A;  2AQ0 A;  3IG8 A;  2HU3 A;  5DB7 A;  4G4H A;  1OUB A;  158L A;  1D8Y A;  2I6X A;  7ICI A;  5KFM A;  3GV7 B;  1LI6 A;  4UB8 U;  1V97 A;  2EZX A;  2G4Q A;  4DDA A;  4UBC A;  4NL9 A;  3IG5 A;  2J6S A;  1TVA A;  3A90 A;  1L17 A;  7ICU A;  4B9U A;  1UIA A;  2MEE A;  3ATO A;  2R8K A;  2JEI A;  1REY A;  3D6J A;  2F8L A;  5L1J A;  2H3V A;  1TAQ A;  4UB6 U;  5KFQ A;  1CJ7 A;  1MLC E;  3UMC A;  3IM1 A;  1L11 A;  1PK3 A;  2BKE A;  4KN7 A;  4LFP A;  2KP7 A;  2I9G A;  1JWR A;  1DPX A;  5DLF A;  1LAA A;  1TE2 A;  3TXB A;  1L51 A;  128L A;  2AU0 A;  2KE7 A;  1HFY A;  5C6J A;  1ZQQ A;  1D2W A;  4PH5 A;  3GV5 B;  5H2F U;  2LYA A;  1NZP A;  1GBO A;  1GDX A;  3ZVQ B;  2RBS A;  1Z00 A;  1T6H A;  154L A;  110L A;  1K1S A;  1JJ3 A;  1BPB A;  3J4G A;  4HJZ A;  3WPL A;  4H9C A;  5DG9 A;  3IN5 A;  1TCY A;  2NRT A;  4RQ3 A;  4GXK A;  1OV5 A;  2F2N A;  2B72 A;  4NHI A;  6LZM A;  219L A;  2C8P A;  4DD7 A;  4OJO A;  1SZP A;  5E79 U;  171L A;  135L A;  1G0K A;  4UAT A;  3WU9 A;  2CDS A;  1SQ2 L;  1XFP L;  3PZP A;  2QAR A;  139L A;  2MA1 A;  4ECX A;  3B0O A;  4ECS A;  4NGY A;  4DQJ A;  3CQL A;  4NGJ A;  3QEA Z;  3DN4 A;  5DB9 A;  3A3R X;  1I6S A;  3CW2 C;  166L A;  2RDI A;  1DI5 A;  1UIC A;  2DKZ A;  1L22 A;  2NRV A;  1B7R A;  1L00 A;  4KLE A;  7ICQ A;  2YDG A;  3PBL A;  130L A;  2DKX A;  3HU8 A;  4GBR B;  1BNO A;  1V85 A;  3PVX A;  3BQ7 A;  3DN3 A;  3GUI A;  4OWH A;  3EBA B;  1MEL L;  2DQF C;  4YMN A;  3WU7 A;  4EKS A;  3E58 A;  1QDR A;  119L A;  2BQE A;  1AQ6 A;  2ASJ A;  185L A;  1C10 A;  3V6K A;  2ZIL A;  2CWI A;  3UON A;  5EE9 A;  1QIO A;  249L A;  3CDR A;  5HR6 A;  4UWV A;  5KFF A;  4BS7 A;  3DN8 A;  3BQ0 A;  9ICT A;  1REM A;  3CSQ A;  1G0J A;  1T6V L;  5KAI U;  1HSX A;  1L89 A;  1RJC B;  9ICV A;  1NK4 A;  5ALS A;  1ZVY B;  4KLT A;  4R66 A;  1ECW A;  2CXY A;  1I56 A;  1QUS A;  5KFR A;  3ISC A;  3C29 A;  3V72 A;  4B9T A;  8ICS A;  1GD6 A;  1C65 A;  2OWO A;  2B75 A;  2IOF K;  1INU A;  3JPN A;  1QCK A;  4LYO A;  2B6G A;  1CRX A;  4OO9 A;  5AKY A;  4AYB F;  2H9K A;  4DWX A;  1S97 A;  4QIW C;  3DN1 A;  1WQR A;  2G0A A;  3RF9 A;  3HWT A;  4EEN A;  3RRG A;  1JIS A;  2E1F A;  2X0A A;  1QSB A;  4GN4 A;  2LKY A;  4J9N A;  1LLH A;  1L8O A;  4C0Z A;  4WL7 A;  4M0A A;  1W6Z A;  231L A;  3J81 j;  5LAF A;  2YB4 A;  9ICQ A;  1ZQV A;  5DLG A;  5L1L A;  2HVI A;  5J29 A;  4OJ6 A;  1QDT A;  4BXO B;  2D4J A;  2FBD A;  2OU8 A;  5ALK A;  4IQV A;  5HMV A;  1LZR A;  3D2Q A;  4RPZ A;  8ICX A;  4KPM A;  5ALI A;  5HNK A;  3N9E A;  1B5U A;  4YVZ A;  4Y2U A;  5ALO A;  1OUE A;  4DC4 A;  3SBA A;  1OUA A;  1L12 A;  230L A;  1L79 A;  5IIO A;  3TAD C;  1ZWN A;  1COO A;  3OE6 A;  1GBY A;  3WUN A;  1YIK A;  2BQI A;  1Z4N A;  2HOI A;  1L99 A;  4NSJ A;  2P6R A;  5LVG A;  225L A;  1T8F A;  5KFZ A;  1L48 A;  5CEH A;  3C21 A;  5FDJ A;  1TAY A;  1S0V A;  2MEA A;  1S0M A;  3ATN A;  218L A;  3TXI A;  4FZN A;  5ALX A;  3UMB A;  2WHE A;  4QZG A;  1LSP A;  3TAN A;  3DKE X;  3SB8 A;  4A7D A;  4WG7 A;  4M4O A;  162L A;  3U26 A;  2HMX A;  4FO6 A;  1CVK A;  252L A;  2F4A A;  5CHG A;  4OO1 J;  4IRC A;  2QAR C;  3A67 Y;  4ZEE A;  2P6U A;  2AGQ A;  3FA0 A;  1S9F A;  1L16 A;  1QTV A;  2O4W A;  4K4G A;  1IP5 A;  1P2L A;  1UAC Y;  5F14 A;  4UAU A;  1S77 D;  1X42 A;  4BWM A;  3N7S C;  4RPX A;  5KT3 A;  1CV6 A;  1L94 A;  1C6Q A;  4ZFP A;  4ECQ A;  5KXN A;  4DFJ A;  3PW5 A;  1EQE A;  1U9L A;  2HUB A;  4G4C A;  4WM1 A;  4MCK A;  1QSS A;  2MEC A;  4C8N A;  1P37 A;  3HH3 A;  1L20 A;  2QAR B;  5GTH U;  1O03 A;  1OW5 A;  235L A;  2VB1 A;  4W54 A;  1N60 A;  1JKC A;  207L A;  172L A;  3BQT A;  5EWE A;  1T8G A;  3HT9 A;  2Z19 A;  1C68 A;  214L A;  1IR7 A;  3EML A;  3WVY A;  3IRU A;  3H4B A;  3A95 A;  4ARM B;  5IIM A;  2G08 A;  4US9 A;  1ZUR A;  3LYS A;  1HEW A;  1J2M A;  4NHP A;  3WL2 A;  1GB9 A;  5HHH A;  4NY8 A;  1LJK A;  1Z1V A;  1JJ1 A;  1L58 A;  4ETC A;  1GF7 A;  1U4B A;  3GUL A;  1L37 A;  134L A;  2DQN B;  1U49 A;  1EPY A;  2CUU A;  3FC4 A;  2E8N A;  3LZ2 A;  3UXO A;  2KNJ A;  2RBN A;  4MST A;  5B1F A;  1GFK A;  3THV A;  1NK5 A;  2B6X A;  4DLG A;  2MEF A;  4NWH A;  1WG8 A;  4BUG A;  3NVY A;  3RJH A;  1Q8K A;  2YX8 A;  4IRK A;  8ICM A;  4I7N A;  2IOF A;  3H8J A;  4DOB A;  261L A;  4NGK A;  2BZF A;  1ZQT A;  3DEE A;  3WUM A;  2JR5 A;  3R9K A; 
#chains in the Genus database with same CATH homology
 1KNI A;  5F81 A;  2LYM A;  3BKH A;  200L A;  2D3D A;  4Z3M A;  1LJI A;  2DQJ Y;  1C6L A;  2Q9D A;  3P68 A;  5I54 A;  3J6K A;  1CUQ A;  4GCE A;  1DYD A;  2YBJ A;  4IAT A;  4L41 A;  5J8Y C;  5AMY A;  2ANV A;  1L18 A;  4WLT A;  3ZEK A;  5D5C A;  1L06 A;  144L A;  1IVM A;  1B5Y A;  1LHJ A;  1L50 A;  2F30 A;  102L A;  1LYE A;  1GFV A;  3QAK A;  2IFF Y;  1BHZ A;  4QEQ A;  1IC5 Y;  1QTB A;  1UQV A;  3WMK A;  255L A;  1LZ6 A;  1GWD A;  1L05 A;  1L85 A;  3KKA C;  1CU0 A;  3RZ4 A;  159L A;  1YAP A;  4QGZ A;  4IS7 A;  1F6S A;  1L0K A;  1LYJ A;  2D4K A;  1JHL A;  4GN5 C;  3JR6 A;  1EQ5 A;  1XGR C;  1YKZ X;  1VDQ A;  1B7O A;  2LHM A;  1RE2 A;  4H8X A;  3HIL A;  1GE0 A;  1L49 A;  1LSB A;  3GXR A;  2K60 A;  4HTK A;  3A6B Y;  3NYA A;  3EMS A;  1CV5 A;  151L A;  1CKF A;  4LZM A;  3HDF A;  3G3V A;  1SV0 A;  1BGI A;  4IAS A;  4ARM A;  4DD0 A;  1PS5 A;  4CFP A;  1KIR C;  3RUN A;  2RSC A;  5DM9 A;  1IC4 Y;  1YAO A;  1I20 A;  1PQM A;  2DQA A;  1L28 A;  1GF6 A;  1L65 A;  1DXS A;  4H8Z A;  3W6D A;  199L A;  2I26 L;  2DL0 A;  1B7S A;  2OTY X;  2HEE A;  215L A;  3SEN A;  1GXX A;  259L A;  1IWZ A;  1L14 A;  2RAY X;  4OWA A;  4ETE A;  1YQV Y;  4FJR A;  4YX7 C;  3W6A A;  1QUG A;  1JKB A;  1B5W A;  1BWI A;  4J1B A;  5KXX A;  5J8Y A;  4DD1 A;  2F44 A;  1JTP L;  5E9R A;  1D0L A;  1UIB A;  3A3Q A;  143L A;  2ZQ3 A;  2PC2 A;  2F32 A;  4ARQ A;  140L A;  5HLL A;  1KY0 A;  2HUM A;  1C46 A;  1CJ6 A;  5JRT A;  4RQN A;  3CDQ A;  1TDY A;  3HUQ A;  4ET9 A;  3HH5 A;  1YAN A;  5F9U A;  1L55 A;  2B74 A;  2BQK A;  1QT7 A;  3P64 A;  4NHT A;  4I7M A;  5KY1 A;  5M1Y A;  168L A;  4NL9 C;  4DD3 A;  238L A;  1C6A A;  243L A;  2HED A;  1C6J A;  5FEK A;  4RW2 A;  4B4I A;  4NGO A;  153L A;  4TSC A;  4W57 A;  1NQI A;  1DYF A;  1HEP A;  1KXY A;  1B6I A;  2B7X A;  194L A;  5LXW A;  3CT5 A;  3LZT A;  2NTG A;  1L92 A;  1SSY A;  2DQH Y;  2QB0 B;  1ZMY L;  4WG1 A;  1XGP C;  1NWG A;  4I7T A;  4XEN A;  1LHM A;  2NWD X;  4LT3 A;  1JKA A;  1AKI A;  1CU5 A;  1LHL A;  4E97 A;  1L53 A;  212L A;  5F3X B;  3P66 A;  1XJU A;  1QS5 A;  2QKQ A;  1L80 A;  5LVI A;  5KKJ A;  1CU6 A;  3G3X A;  2B70 A;  1JQU A;  1IP6 A;  1UA6 Y;  1OUG A;  1LZ9 A;  2HU1 A;  2YBN A;  1F0M A;  2LZM A;  4KXI A;  1K28 A;  2FYD A;  3C8S A;  5L3H A;  1LZN A;  4G49 A;  1DQJ C;  1AT6 A;  3BS5 A;  4NGI A;  1J1X Y;  1GE3 A;  3WH1 A;  4DYG A;  1SWZ A;  1LWG A;  4TWS A;  3WW5 A;  6LYZ A;  5FST A;  4BAP A;  1T8A A;  1UIG A;  1HF4 A;  1OUC A;  2Y8P A;  5C6I A;  2B73 A;  5LVK A;  1LMO A;  1GFU A;  5KXL A;  4DJH A;  3A6C Y;  5HNC A;  1ALC A;  3HT7 A;  4MHV A;  189L A;  1JIY A;  3RZE A;  1NKH A;  1TBY A;  1LZ5 A;  1CKH A;  4CJ2 A;  1B5V A;  1DYA A;  1B7P A;  1UIF A;  1XGQ C;  1QUO A;  170L A;  5KXR A;  1BVX A;  133L A;  3HU9 A;  3TXD A;  4H9A A;  1L46 A;  2RH1 A;  3C7W A;  4I8S A;  4XN6 A;  1GE1 A;  208L A;  1P56 A;  1L40 A;  1YAM A;  2YSS C;  5KNI A;  1OUJ A;  1D2Y A;  3A8Z A;  115L A;  4I0C A;  4TUN A;  1P2R A;  4GCF A;  1HSW A;  1LSM A;  205L A;  2N5Z A;  2Z12 A;  1X66 A;  1GFR A;  1P6Y A;  2XBS A;  4YXA C;  150L A;  5B06 A;  1CX7 A;  1CKD A;  5I4Y A;  4ARP A;  1IWY A;  1VED A;  3DN0 A;  132L A;  2RB2 X;  4HSF A;  1F10 A;  4ET8 A;  2HEB A;  3T6U A;  1FLW A;  2OE7 X;  2BQC A;  1WWV A;  4E3U A;  4WLD A;  2F3N A;  5KXO A;  1JTO L;  1HC0 A;  2Z2F A;  3V2W A;  1PK1 A;  5LYM A;  108L A;  1T97 A;  4WM4 A;  4WO6 A;  1SGG A;  201L A;  1AT5 A;  2H9J A;  4H9F A;  3WYH A;  4W55 A;  3T36 A;  4DAJ A;  195L A;  3VWO A;  5KXY A;  3CT1 A;  1L87 A;  1REZ A;  3AW6 A;  1OVK A;  3F9L A;  1G0Q A;  5A3Z A;  1HEM A;  3IJV A;  4EKQ A;  1Z55 A;  2G4N A;  2I25 L;  4IAP A;  5LZM A;  3TMU A;  1L43 A;  1LZ1 A;  1P64 A;  3WU8 A;  5LIN A;  2CGI A;  1PK1 B;  4WM2 A;  1QUD A;  1DI4 A;  3HBD A;  258L A;  5L9J A;  5LAG A;  1IOC A;  4TSB A;  5KXW A;  4HJV A;  4RLN A;  4I7P A;  3K3T A;  2BLY A;  1C6M A;  180L A;  1L33 A;  4XJI A;  222L A;  1CKG A;  188L A;  1YKY X;  1L62 A;  4H9I A;  1WVU A;  3IWR A;  1GF3 A;  1LMN A;  4H9H A;  1LKS A;  3P4Z A;  1LMA A;  1LYO A;  3C7Y A;  3TAC B;  1IP2 A;  1LGW A;  228L A;  5K7O A;  3G3W A;  3WW6 A;  4W53 A;  3AYQ A;  3C7Z A;  2ZNX Y;  4Z98 A;  4GCD A;  240L A;  131L A;  1LYH A;  256L A;  1HMK A;  1GFE A;  2AUB A;  3HH4 A;  4H93 A;  3BS7 A;  1CU2 A;  2BQD A;  1FKV A;  1C69 A;  3B0I A;  1IY4 A;  146L A;  1CNS A;  1FDL Y;  1LSE A;  1CV0 A;  4GCB A;  5D5F A;  2EQL A;  2D4I A;  2QB0 A;  1HEQ A;  1IWW A;  1J1P Y;  4XYY A;  2HEA A;  211L A;  4LYB A;  3HFM Y;  3RU5 A;  1L74 A;  1C6N A;  2HUL A;  2KG5 A;  3SEI A;  244L A;  220L A;  2RB1 X;  1LPI A;  3B6L A;  1QSA A;  1L90 A;  2LC9 A;  2OU0 X;  4OWC A;  2QB1 A;  3HDE A;  4K5Y A;  3C8R A;  2Z18 A;  2LZ2 A;  1IO5 A;  1GE2 A;  2OTZ X;  3CSR A;  1WQQ A;  2FBB A;  5DN5 A;  1LYD A;  112L A;  5HNL A;  1LYG A;  1FBI X;  1NDG C;  2LYZ A;  2XBR A;  149L A;  1SV4 A;  1GBS A;  245L A;  2D91 A;  2YBL A;  3W6F A;  2EKS C;  4NIJ A;  4B4E A;  1G0G A;  209L A;  2EAN A;  1SWY A;  4ML7 A;  1LSN A;  1OWY A;  1KW4 A;  4PZO A;  4GCC A;  4FDY A;  174L A;  2BAA A;  2RBP A;  3DMV A;  104L A;  3OE8 A;  4XJF A;  3ODU A;  1LI3 A;  4J0L A;  192L A;  5HQ1 A;  5KXT A;  1C7P A;  1L13 A;  1XSF A;  3A94 A;  1WTH A;  1DI3 A;  103L A;  1L69 A;  5JU5 A;  1LZ8 A;  1JIT A;  1A4V A;  1C67 A;  1QSW A;  2Q9E A;  1UC0 A;  2KSO B;  5LYT A;  1JTM A;  2BQJ A;  1JKD A;  4Z41 A;  4WLY A;  3D9A C;  1BWJ A;  3GXK A;  5IHG A;  226L A;  5DL9 A;  1L76 A;  3MGW A;  5LVJ A;  1B0X A;  1NF5 A;  4G9S A;  3SB6 A;  3A93 A;  4LFX A;  1LWK A;  1L73 A;  242L A;  262L A;  4EXM A;  4PRQ A;  1B4F A;  5L1M A;  1IIZ A;  4R0F A;  229L A;  3HTF A;  2DQI Y;  1DYC A;  4NG8 A;  1IOR A;  1L44 A;  4LZT A;  1L54 A;  1GB8 A;  3FI7 A;  1LKY A;  1L98 A;  4YOP A;  2DQG Y;  2ZYP A;  1CU3 A;  2W1L A;  1HER A;  1CV1 A;  1GB3 A;  4P2E A;  3DMX A;  2ANX A;  4DD2 A;  4PHI A;  3AZ5 A;  4HPI A;  2RBO A;  1L42 A;  3F6Z A;  1HEO A;  3FE0 A;  4NGL A;  1G7I C;  4EOF A;  4NG1 A;  1IX0 A;  125L A;  3SB5 A;  236L A;  3A96 A;  5F16 A;  4IJ4 A;  1BB3 A;  1CV3 A;  1L10 A;  1D3N A;  111L A;  4DDB A;  4NSI A;  1G07 A;  3N9A A;  1IP7 A;  1L34 A;  2Y9U A;  1LW9 A;  4GLV A;  3SBB C;  5I53 A;  2LYO A;  2RBQ A;  1I1Z A;  2GV0 A;  7LZM A;  1GBZ A;  4H94 A;  2E8O A;  3E3D A;  1G0P A;  3OK0 A;  1NMM A;  5IEL A;  1C6G A;  3H8M A;  1JSF A;  4D9Z A;  1L24 A;  248L A;  1XEJ A;  1P3N A;  4WM6 A;  1LSY A;  4I7O A;  4N9R A;  4C3W A;  4HPE A;  2Y9T A;  4H8Y A;  3GUO A;  1IWU A;  5DLA A;  2JV3 A;  213L A;  1JI7 A;  1L61 A;  1E8L A;  4EKP A;  1UBZ A;  183L A;  126L A;  1KIQ C;  1IWT A;  190L A;  1LPY A;  3WPJ A;  3RW8 A;  1B5Z A;  2YBM A;  1QUH A;  4ETB A;  1SX2 A;  4NHQ A;  1DYB A;  1IP3 A;  1OYU A;  1OVJ A;  3HTB A;  4M6D A;  2KMD A;  1REX A;  1L35 A;  4N8Z A;  4W58 A;  1VAT A;  1GDW A;  2FYC A;  2FE9 A;  3C83 A;  1B5X A;  114L A;  1XEP A;  1L64 A;  2DQC Y;  4ETA A;  4W96 A;  120L A;  4CHX A;  2BPU A;  4EPF A;  4DQ5 A;  1LGX A;  253L A;  2RBR A;  1G1W A;  1GFA A;  1L57 A;  4NWE A;  4TX7 A;  4YXC A;  1D6P A;  3DMZ A;  163L A;  123L A;  5FHW A;  4X3B A;  5KXK A;  167L A;  3B72 A;  1L38 A;  4GN3 A;  2DBT A;  2DKV A;  221L A;  3AGH A;  3D3D A;  5B1G A;  5EBH A;  1L45 A;  1LZD A;  4DT3 A;  129L A;  5KXZ A;  1L68 A;  1LMQ A;  4KT3 A;  1BWH A;  1L60 A;  4ANR A;  2E8M A;  2LZT A;  1KXX A;  1JJ0 A;  3L2X A;  1IOQ A;  1LSD A;  2BQF A;  1IOS A;  241L A;  3AW7 A;  4ARL A;  1SXE A;  186L A;  1DXJ A;  4LDE A;  197L A;  2D8C A;  1LSA A;  4H9E A;  1OV7 A;  1GFH A;  4EJ4 A;  1XGU C;  1L25 A;  1C60 A;  4HJY A;  2EIZ C;  3V2Y A;  1D3J A;  1B0D A;  1WTM A;  3RT5 X;  4RDS A;  4WM3 A;  2BQL A;  2LMR A;  3W6C A;  1L09 A;  2Q0M X;  4PZN A;  1RI8 B;  2BQH A;  1LHK A;  1G0M A;  1UUZ C;  3GUP A;  4H90 A;  3SN6 R;  1LJJ A;  3C81 A;  4QDN A;  2O7A A;  4XAD A;  1C6F A;  3N9C A;  1L88 A;  3LHM A;  2ZWB A;  2MEH A;  1RG6 A;  1LMT A;  2ES6 A;  1OUD A;  3C80 A;  2EAP A;  2C8O A;  210L A;  233L A;  3HTG A;  5ILC A;  1L32 A;  2B6W A;  1LZE A;  239L A;  137L A;  5LA5 A;  3NY8 A;  3EXD A;  3LN2 A;  1LYI A;  5JEN B;  224L A;  193L A;  1WVV A;  1IR8 A;  175L A;  3LZM A;  1L81 A;  1PQJ A;  2RB0 X;  4XJD A;  1CTW A;  2HTX A;  1G06 A;  3GUK A;  5LA8 A;  1FKQ A;  3A92 A;  2YBI A;  4AGA A;  1L52 A;  1JTN A;  1FLU A;  4NHS A;  1LI2 A;  1EQ4 A;  2B6Z A;  3TXG A;  4YF2 A;  1WQM A;  1PQK A;  5IDD A;  1J1O Y;  4LDO A;  5KXP A;  198L A;  4N0J A;  1QTH A;  3TXF A;  1L75 A;  4O34 A;  3LYZ A;  152L A;  1C6B A;  1L97 A;  1LKR A;  4AXT A;  2Z38 A;  1KXW A;  1B7N A;  1HFX A;  107L A;  2A7D A;  1LGU A;  1QT5 A;  4NJ8 A;  2IHL A;  1CV4 A;  3TXH A;  1BB5 A;  1B7L A;  1C08 C;  1OP9 B;  1QS9 A;  1AM7 A;  1SLY A;  2ZIJ A;  1QTD A;  4PJ2 C;  1PQO A;  1UCV A;  1TLA A;  2MEB A;  4I7K A;  3TMX A;  4AQN A;  4DDC A;  1L70 A;  3HH6 A;  2K4P A;  2OEA X;  237L A;  1D0M A;  1C6T A;  5B59 A;  1F6R A;  1C64 A;  1L21 A;  1L0J A;  5LIO A;  1QTE A;  4NGZ A;  118L A;  4W94 A;  3ZVQ A;  1L36 A;  5ILF A;  5FEL A;  1C6P A;  2B6T A;  165L A;  5LYZ A;  4LYT A;  1JUG A;  1YL1 X;  1LMP A;  1L96 A;  1V7T A;  2OE4 X;  1CJ9 A;  169L A;  1LSG A;  2BQO A;  3HTD A;  3GUJ A;  3PDS A;  1BB7 A;  8LYZ A;  3G3A B;  4H92 A;  4ARQ B;  1DZB X;  1G1V A;  4HTQ A;  1L72 A;  2W1M A;  1G7L C;  4B1A A;  4LYZ A;  1LYS A;  3OJP A;  9LYZ A;  250L A;  3CDT A;  1PQI A;  3LYO A;  176L A;  4I7J A;  161L A;  1DPW A;  1NHB A;  3CDO A;  5II3 A;  1L77 A;  1LOZ A;  2ZIK A;  1LKY B;  2F47 A;  5E4P A;  1C6H A;  1DYG A;  157L A;  4CFO A;  3QNG A;  1XGT C;  1UCO A;  1G7J C;  1O23 A;  4NSH A;  4TTD A;  2F2Q A;  1HNL A;  1D3M A;  5B05 A;  1LZ4 A;  3TMW A;  4ZIX A;  2XJW A;  4KL7 A;  1RFP A;  3K1R B;  2ZQ4 A;  1IWX A;  4I7Q A;  4NGW A;  5APF A;  1QT8 A;  2ESE A;  3HBE X;  4WOA A;  1OQM A;  4OW1 A;  2F4G A;  3L64 A;  4LDL A;  1GF9 A;  1YRO A;  4W56 A;  5I4W A;  1OUF A;  4XJB A;  4PRU A;  4WL6 A;  173L A;  1SX7 A;  1COK A;  2ZNW Y;  4PGJ B;  1VDT A;  4EMN A;  1L47 A;  184L A;  1WWU A;  1PQD A;  1QUT A;  3AZ4 A;  5T3F A;  1W08 A;  3WXT A;  1JPO A;  1HEN A;  1L41 A;  227L A;  4NSG A;  1QTC A;  1LHH A;  1LJF A;  1D6Q A;  1CUP A;  1NDM C;  1GEV A;  1QTZ A;  2F8K A;  4W59 A;  5APC A;  5I5Q A;  2IGC A;  182L A;  2LCB A;  1LHI A;  1HML A;  217L A;  2CJL A;  1P7S A;  1LJG A;  4WMG A;  2D6B A;  3FAD A;  1WQP A;  5DN4 A;  2BQN A;  4PPO A;  1EL1 A;  3W6E A;  1GFT A;  4BAD A;  6LYT A;  1QTK A;  2BLX A;  223L A;  4NEB A;  2B5Z A;  1GF8 A;  3CSZ A;  3KAM A;  2BQB A;  178L A;  3TMV A;  1L04 A;  1YL0 X;  1GHL A;  4RLM A;  2G4P A;  4XJG A;  3K2R A;  2NTH A;  156L A;  1BQL Y;  1NBZ C;  5A3E A;  2W1X A;  4ARJ A;  1FLY A;  4HV2 A;  2WAR A;  3HT8 A;  1GAY A;  1VDS A;  3C82 A;  4I7R A;  4WLX A;  1N4F A;  1HFZ A;  1YAQ A;  1LZC A;  1L59 A;  3CB7 A;  2BQA A;  4N5R A;  4NGV A;  1LZY A;  4LYM A;  1H6M A;  232L A;  3C8Q A;  4N1C C;  1C66 A;  1QT6 A;  1CX6 A;  3EO5 A;  1ZVH L;  1GF0 A;  2HEF A;  1LMC A;  141L A;  1QSQ A;  5B07 A;  3OE9 A;  1QT4 A;  5I4X A;  3TXE A;  1C62 A;  2A7F A;  1KY1 A;  4YEM A;  1UIH A;  4EPI A;  3WPK A;  4OWE A;  216L A;  1XJT A;  1LJN A;  1DKJ A;  113L A;  1KW7 A;  1GPQ C;  3CDV A;  1RCM A;  254L A;  1LZA A;  4W51 A;  3A91 A;  3AB6 A;  2KSO A;  1C6I A;  3B0K A;  1P46 A;  1NHE A;  4H9B A;  4OOO A;  145L A;  4GRV A;  234L A;  3SB9 A;  4LYC A;  3WUL A;  3OE0 A;  1LYZ A;  1XEK A;  4NFV A;  1L19 A;  3BKV A;  147L A;  4OOT A;  5F9X A;  1V38 A;  2RAZ X;  1C45 A;  4GLA A;  1G0L A;  164L A;  3TXK A;  1WQO A;  3TAD A;  2LPE A;  1UIE A;  1G7M C;  1L95 A;  4RQM A;  1L23 A;  4R6C A;  1X9X A;  1UID A;  196L A;  1JSE A;  1JEF A;  181L A;  1GBX A;  5APE A;  1OUI A;  1GFG A;  1IR9 A;  1B9O A;  2L78 A;  4I7L A;  3SB7 A;  2YBH A;  3HBH A;  4BAF A;  3GUM A;  1CJ8 A;  1B7M A;  3HWL A;  4PK0 A;  1AZF A;  1SXD A;  3DN2 A;  1YKX X;  1LZT A;  1WTN A;  1IOT A;  3A34 A;  4XJH A;  3KKA A;  5APD A;  1H87 A;  4DQ7 A;  1DYE A;  1L86 A;  5I14 A;  1TEW A;  1L01 A;  1NBY C;  1GBW A;  142L A;  2EAO A;  206L A;  1L39 A;  2W1Y A;  7LYZ A;  1L31 A;  4N1E I;  1GEZ A;  251L A;  1F0W A;  4UWN A;  4I7S A;  1ZYT A;  4OWB A;  4DKL A;  1IC7 Y;  1L82 A;  4J1A A;  4RW1 A;  1GE4 A;  3RNX A;  1LZB A;  1OWZ A;  1C61 A;  4C5F A;  1L63 A;  246L A;  4LT1 A;  4EKR A;  4HTN A;  2EPE A;  3LYT A;  2OU9 A;  4YEN A;  1L29 A;  1D3F A;  1HHL A;  3M3U A;  4LT0 A;  4ETD A;  5KXM A;  2MED A;  1GB6 A;  2Z2E A;  1LZS A;  1B7Q A;  1IEE A;  1KS3 A;  1LCN A;  1JTT L;  1PZY A;  138L A;  2B6Y A;  3QY4 A;  2HEC A;  3CT0 A;  1KIP C;  4QY9 A;  4HV1 A;  2DQD Y;  5J7C A;  1D9W A;  1IP4 A;  2BQG A;  1L02 A;  3SP3 A;  1LSZ A;  1ZV5 L;  5HMJ A;  3AGI A;  1L67 A;  2GLE A;  2KIV A;  1L03 A;  2OE9 X;  1DKK A;  3GUN A;  1L15 A;  2E8P A;  1V7S A;  5LVH A;  1VDP A;  2Z39 A;  2HUK A;  1OXJ A;  5JTI A;  2Z37 A;  1LSC A;  1GB7 A;  1L56 A;  3M18 B;  3D4S A;  3AJN A;  5FCP A;  1B2K A;  4CGE A;  4NY5 A;  2L5Y A;  4II8 A;  4H1P A;  4S0W A;  4W52 A;  1QT3 A;  2XTH A;  4WM5 A;  177L A;  1A2Y C;  3FI5 A;  1CKC A;  1YIL A;  4UWU A;  1C6E A;  5KKI A;  257L A;  1L27 A;  4B0D A;  4LT2 A;  1BB6 A;  3F8V A;  4HP0 A;  1GXV 2;  2MEI A;  2YTU A;  4B49 A;  1HEL A;  3IJU A;  3G3B B;  2O79 A;  4DD9 A;  3DN6 A;  1LYY A;  127L A;  1OUH A;  260L A;  3WXU A;  187L A;  1GB2 A;  1IP1 A;  1L91 A;  1L08 A;  160L A;  1SV0 C;  1LSF A;  3AZ7 A;  3HUA A;  4U3X B;  148L E;  1SSW A;  2Z6B A;  3LYM A;  2DQE Y;  3AGG G;  4H91 A;  1GB0 A;  1P2C C;  1LZG A;  1GAZ A;  4ZPU A;  1L83 A;  3ULR A;  4WO9 A;  3W6B A;  1L26 A;  122L A;  2H5Z A;  3NY9 A;  3WVX A;  1KW5 A;  3QE8 A;  1FLQ A;  1QQY A;  1D9U A;  1WQN A;  1GFJ A;  1VFB C;  4PJZ A;  4Z46 A;  1G7H C;  109L A;  4B4J A;  1GF4 A;  3DNA A;  5L3I A;  1XEI A;  2BQM A;  4J7V A;  4G4B A;  1T3P A;  1IY3 A;  3HUK A;  2EAM A;  5KJ9 A;  1GB5 A;  2XQO A;  3HT6 A;  2YVB A;  1C63 A;  1LJE A;  1X40 A;  1C6K A;  1LJH A;  2MEG A;  3TXJ A;  3IDW A;  1L84 A;  1P5C A;  1BVK C;  1L66 A;  1LYF A;  1LTM A;  1D0K A;  1L30 A;  247L A;  5KXS A;  1GF5 A;  3P65 A;  1L07 A;  2I6Z A;  1LJ3 A;  1LJ4 A;  4YM8 A;  1C43 A;  191L A;  1OVH A;  3AZ6 A;  1VAU A;  1P36 A;  1C6D A;  2A4T A;  1L71 A;  1FN5 A;  4LGK A;  2ZYC A;  1L93 A;  3W3E A;  5C6L A;  1C6C A;  4MR1 A;  1IWV A;  3BS5 B;  155L A;  4YEO A;  1BB4 A;  2HU3 A;  4G4H A;  1OUB A;  158L A;  1LI6 A;  2G4Q A;  4DDA A;  4NL9 A;  3A90 A;  1L17 A;  2MEE A;  1UIA A;  3ATO A;  1REY A;  1CJ7 A;  1MLC E;  1L11 A;  1PK3 A;  4LFP A;  1JWR A;  1DPX A;  1LAA A;  3TXB A;  1L51 A;  128L A;  2KE7 A;  1HFY A;  5C6J A;  1D2W A;  1GBO A;  1GDX A;  3ZVQ B;  2RBS A;  1T6H A;  154L A;  110L A;  1JJ3 A;  3J4G A;  4HJZ A;  3WPL A;  4H9C A;  1TCY A;  1OV5 A;  4NHI A;  2F2N A;  2B72 A;  6LZM A;  219L A;  2C8P A;  4DD7 A;  171L A;  135L A;  1G0K A;  3WU9 A;  2CDS A;  1SQ2 L;  1XFP L;  139L A;  2QAR A;  3B0O A;  4NGY A;  4DQJ A;  3CQL A;  4NGJ A;  3DN4 A;  3A3R X;  1I6S A;  1UIC A;  1DI5 A;  166L A;  3VW7 A;  2DKZ A;  1L22 A;  1B7R A;  1L00 A;  2YDG A;  4GBR B;  130L A;  2DKX A;  3HU8 A;  3PBL A;  1V85 A;  4OWH A;  3BQ7 A;  3DN3 A;  3GUI A;  3EBA B;  1MEL L;  2DQF C;  3WU7 A;  4EKS A;  1QDR A;  119L A;  2BQE A;  185L A;  1C10 A;  2ZIL A;  2CWI A;  3UON A;  1QIO A;  249L A;  3CDR A;  4UWV A;  4BS7 A;  3DN8 A;  1REM A;  3CSQ A;  1G0J A;  1T6V L;  1HSX A;  1L89 A;  1RJC B;  1ZVY B;  1I56 A;  1QUS A;  1GD6 A;  1C65 A;  2B75 A;  1INU A;  4LYO A;  2B6G A;  4OO9 A;  4DWX A;  2H9K A;  3DN1 A;  1WQR A;  1JIS A;  2X0A A;  1QSB A;  4GN4 A;  1LLH A;  4WL7 A;  5LAF A;  1W6Z A;  231L A;  1QDT A;  2OU8 A;  2D4J A;  5HMV A;  2FBD A;  1LZR A;  4KPM A;  3N9E A;  1B5U A;  1OUE A;  4DC4 A;  3SBA A;  1OUA A;  1L12 A;  230L A;  1L79 A;  3TAD C;  1ZWN A;  3OE6 A;  1GBY A;  3WUN A;  1YIK A;  2BQI A;  1L99 A;  4NSJ A;  5LVG A;  225L A;  1T8F A;  1L48 A;  5FDJ A;  1TAY A;  2MEA A;  3ATN A;  218L A;  3TXI A;  1LSP A;  3DKE X;  3SB8 A;  4A7D A;  4WG7 A;  4M4O A;  162L A;  1CVK A;  2F4A A;  252L A;  2QAR C;  3A67 Y;  4ZEE A;  3FA0 A;  1L16 A;  1QTV A;  2O4W A;  1IP5 A;  1P2L A;  1UAC Y;  5F14 A;  1CV6 A;  1L94 A;  1C6Q A;  4ZFP A;  5KXN A;  2HUB A;  1EQE A;  4G4C A;  4WM1 A;  4MCK A;  2MEC A;  1P37 A;  3HH3 A;  1L20 A;  2QAR B;  2VB1 A;  1OW5 A;  235L A;  4W54 A;  207L A;  1JKC A;  172L A;  1T8G A;  3HT9 A;  2Z19 A;  1C68 A;  214L A;  1IR7 A;  3EML A;  3WVY A;  3A95 A;  4ARM B;  1ZUR A;  1HEW A;  4NHP A;  3WL2 A;  1GB9 A;  1LJK A;  4ETC A;  1Z1V A;  1JJ1 A;  1L58 A;  1GF7 A;  3GUL A;  1L37 A;  134L A;  2CUU A;  1EPY A;  2E8N A;  3LZ2 A;  2RBN A;  4MST A;  5B1F A;  1GFK A;  2B6X A;  2MEF A;  3WUA A;  4NWH A;  4I7N A;  261L A;  4NGK A;  3WUM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...