2QB0B

Structure of the 2tel crystallization module fused to t4 lysozyme with an ala-gly-pro linker.
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
241
structure length
241
Chain Sequence
b'SIRLPAHLRLQPIYWSRDDVAQWLKWAENEFSLRPIDSNTFEMNGKALLLLTKEDFRYRSPHSGDVLYELLQHILKQAGPNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFCQDVDAAVRGILRNAKLKPVYDSLDCVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E80-TELSAM domain
publication title Polymer-driven crystallization.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase regulator
total genus 75
structure length 241
sequence length 241
chains with identical sequence D
ec nomenclature ec 3.2.1.17: Lysozyme.
pdb deposition date 2007-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00959 Phage_lysozyme Phage lysozyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2qb0B01
1.10.530.40 Mainly Alpha Orthogonal Bundle Lysozyme Lysozyme 2qb0B02
1LYJA 224LA 2A4TA 2QB0A 220LA 4PZOA 2B6ZA 5LZMA 1D2YA 1T97A 1L42A 2RBOA 4W57A 2RBSA 160LA 3K1RB 2Y9TA 1L45A 112LA 1OXJA 3CDQA 171LA 3DN2A 1L08A 3PBLA 1L16A 3OE6A 222LA 3HUQA 1B0XA 1OV5A 3PDSA 137LA 3NYAA 2ANVA 2Y9UA 3C7ZA 1LYEA 3HDEA 3FI5A 1QT7A 251LA 4ARMA 163LA 3SBAA 3DKEX 1CV5A 3DN8A 3C80A 2B6WA 1JQUA 3HUAA 3SB8A 174LA 3QAKA 162LA 1D9WA 206LA 1QTHA 226LA 1C63A 1COKA 1PK3A 1SXEA 1CV6A 227LA 2Q9EA 1L63A 1QUHA 1ZURA 4E97A 1KW5A 4LDOA 3HT8A 1C68A 3TADC 3C83A 149LA 1D3FA 1C62A 3GUOA 188LA 3OE9A 4PK0A 5I14A 1L02A 1L27A 1WWVA 3TADA 4W54A 1L05A 1G0KA 5JTIA 1L06A 1L24A 1QTDA 3SEIA 3SN6R 247LA 1L85A 1G0MA 1L93A 104LA 142LA 1L28A 1L87A 1CU5A 196LA 2NTHA 3HTDA 232LA 1LI2A 2O79A 3GUJA 5J8YC 4W52A 1X66A 3GULA 2OU0X 1P7SA 3FADA 168LA 156LA 1L47A 1T8GA 4EKRA 1C6JA 130LA 2B75A 3HWLA 4PZNA 1F0MA 1LKYB 4I7OA 1KS3A 4EXMA 2QARA 3TACB 1QT5A 1QTVA 115LA 1D3JA 2Z6BA 2RH1A 1PK1A 2F3NA 120LA 2RBNA 199LA 1DXSA 129LA 3HU9A 249LA 3DMZA 119LA 4RQMA 1DYEA 2LZMA 1LYFA 3G3XA 2RBQA 4LDEA 1L17A 1L62A 3BQ7A 147LA 1SV0C 231LA 214LA 175LA 1QUDA 200LA 2LMRA 1DYDA 1C67A 2NTGA 2E8PA 1PQMA 140LA 1L43A 1SV0A 1OW5A 110LA 209LA 3HTBA 123LA 1C6PA 211LA 4RQNA 4K5YA 1DYGA 5JU5A 1L19A 2JV3A 166LA 3HDFA 4I7PA 1C6LA 1QTZA 3BS5A 125LA 161LA 5KNIA 187LA 1L68A 1SWYA 1LYDA 169LA 1L92A 201LA 1CU0A 2HUKA 1C69A 1G07A 5F3XB 3SENA 4IS7A 1QUGA 1C6CA 2F2QA 1C6BA 1D2WA 1LI3A 1QS9A 4GRVA 3HUKA 1L95A 3RUNA 2O4WA 1L33A 1CU3A 1L74A 3SB6A 2KG5A 1C6GA 4NL9C 2OE9X 2GLEA 2KSOB 127LA 240LA 1P37A 2RAZX 1KY0A 2F8KA 1L29A 1L20A 2B72A 2OE7X 4NL9A 2E8OA 1SWZA 150LA 2QB0B 1L18A 2B6XA 1QSBA 1L80A 212LA 3K2RA 2EAMA 1L31A 1DYAA 3HILA 216LA 1L53A 2D8CA 1P56A 4I7KA 3NY8A 234LA 1QT8A 1ZYTA 2B70A 3OE8A 3DN1A 1OWZA 1L67A 1L60A 1QSQA 2L78A 1L97A 189LA 4YXCA 1UCVA 1QT4A 1L36A 1LYIA 229LA 1C6AA 1UQVA 248LA 3GUNA 4I7QA 2B74A 1L61A 3DN4A 1LLHA 1L98A 3C81A 3G3VA 1PQDA 4PJZA 1L21A 2RB1X 1CV1A 1P5CA 158LA 2KE7A 1L86A 1L07A 3C8QA 1L88A 1CTWA 2F32A 4MHVA 1PQKA 172LA 1L64A 1LGUA 3DN0A 1L54A 3HU8A 1L58A 2QB1A 1L46A 1L26A 219LA 258LA 1CUQA 3GUKA 2OU9A 235LA 1I6SA 1L56A 118LA 1LGXA 4YXAC 1L84A 1L89A 1CV4A 2Q9DA 221LA 1C6TA 3GUMA 217LA 4W59A 2IGCA 4AQNA 4ARPA 4I7RA 4EPIA 1L71A 185LA 2RBRA 183LA 1L13A 4EKQA 1C6EA 1LGWA 1OVKA 3DMXA 255LA 3SB9A 3LZMA 4DAJA 1G1WA 1L14A 180LA 1SSYA 4DKLA 2B6GA 3C8RA 197LA 1PQOA 1SX2A 2KIVA 250LA 1L40A 2QARC 3L2XA 165LA 245LA 1L75A 126LA 1CU2A 1C6FA 1K28A 2RB0X 213LA 3F8VA 1V38A 1P3NA 111LA 178LA 3IDWA 1G0LA 1G06A 1T8AA 143LA 3DN6A 1QTBA 210LA 3DN3A 1L38A 4I7JA 1PQIA 4ZPUA 1NHBA 260LA 1LWKA 1CX6A 2DKZA 1P46A 4I7MA 3L64A 1L66A 1JI7A 2OTZX 1G0JA 2ESEA 164LA 1LW9A 1L90A 1C6IA 1C65A 1T6HA 1L48A 103LA 170LA 114LA 1L72A 1L0KA 252LA 1L44A 4I7NA 1QUOA 256LA 1QTCA 1JTMA 1QT6A 3JR6A 144LA 4W55A 4ARQB 2FE9A 1L81A 1ZWNA 3SB7A 262LA 1L11A 128LA 3C7WA 1L32A 2F47A 1CU6A 1L37A 1C66A 1L25A 238LA 242LA 3C8SA 138LA 1L35A 1L70A 3ODUA 1V85A 4W58A 1TLAA 3F9LA 1T8FA 3GUPA 218LA 1C6NA 236LA 141LA 254LA 1L83A 1CV0A 2LPEA 1QS5A 1L10A 3FA0A 3UONA 1L59A 1L82A 4DJHA 181LA 3HT7A 4IAPA 3RZEA 5L1MA 4W51A 2KSOA 1KY1A 1OYUA 3KKAA 1OVJA 1G0GA 1CVKA 2K60A 173LA 2L5YA 4LDLA 1C64A 261LA 1DYCA 1C61A 1XEPA 1XJTA 177LA 1SV4A 223LA 1L57A 2EAPA 2RB2X 3HTGA 1LWGA 4YX7C 225LA 4ARJA 146LA 1LYGA 4EPFA 1OWYA 1SX7A 3VW7A 4ARMB 2RBPA 1SXDA 1B6IA 3HH5A 1P2RA 205LA 3HH4A 2F44A 186LA 148LE 4I7LA 1L55A 3HTFA 1QT3A 122LA 2O7AA 1LI6A 4LZMA 1L00A 1C6DA 2LCBA 3HT6A 1P64A 239LA 4W53A 2DKXA 243LA 3C7YA 2DL0A 1OVHA 3EMLA 1WWUA 1L91A 182LA 246LA 1C6QA 2B6YA 1DYBA 1L41A 1L96A 1PQJA 215LA 3SBBC 1L99A 1WTHA 259LA 2CUUA 192LA 1JTNA 2OTYX 3HT9A 6LZMA 195LA 155LA 228LA 167LA 1CUPA 2QKQA 152LA 1LPYA 1X40A 1L0JA 113LA 2E8NA 1L12A 1LYHA 2OEAX 4W56A 1P2LA 159LA 4I7TA 1G0QA 1L09A 3BS7A 7LZMA 3CDTA 1OV7A 3CDOA 3DMVA 253LA 1L76A 1C6HA 102LA 1L30A 1Z1VA 1D3MA 2K4PA 4EKPA 151LA 3CDVA 5JRTA 2HUMA 1B4FA 2QARB 1L50A 3CDRA 1LKYA 184LA 3D4SA 2ANXA 1PK1B 3OE0A 2B7XA 1KW7A 1DYFA 2OE4X 1C60A 1C6KA 5J8YA 109LA 1L23A 1L22A 244LA 1L03A 4S0WA 157LA 1C6MA 2EAOA 241LA 237LA 1L39A 1L79A 1SGGA 2B6TA 1L65A 2D3DA 1L73A 2RAYX 3V2YA 1L04A 2HULA 4I7SA 1CV3A 1L94A 4OO9A 4EKSA 2EANA 2YTUA 1P6YA 1XJUA 131LA 230LA 2B73A 1EPYA 2OU8A 3V2WA 4ARQA 3BS5B 1L01A 233LA 1KW4A 257LA 3G3WA 1L15A 190LA 1D3NA 4NJ8A 191LA 3H8MA 1G0PA 1L49A 3HH6A 1X9XA 4ARLA 3SB5A 145LA 1P36A 1L77A 1G1VA 1SSWA 4GBRB 1RG6A 3C82A 176LA 3KKAC 139LA 4EJ4A 1CX7A 1KNIA 3GUIA 198LA 1L34A 1L69A 1L52A 2KMDA 3NY9A 2LC9A 3DNAA 3HH3A 107LA 2E8MA 1L51A 108LA 2ES6A
chains in the Genus database with same CATH superfamily
2W55A 1BNOA 1B7MA 3SV3A 4DFMA 1ZQWA 1TVAA 5B07A 2DQCY 2HHXA 2KEYA 2IHNA 1D2YA 4P0PB 2CPRA 3JPQA 1LZAA 2ZUDA 1GEVA 1T97A 3IHQB 2RBOA 4YG2A 4ED8A 3ZDEA 2Y9TA 1JJ1A 1UT8A 3TFRA 1OXJA 4ICAA 1SKRA 1L08A 4AYBC 3OGUA 2KKPA 2W9CB 222LA 4E0DA 4NV0A 2WAQF 2MEGA 3NYAA 5KXXA 132LA 3ZDBA 1ZRMA 4XADA 5L1IA 1T4GA 1LSNA 4U3XB 2W43A 2G4NA 4NGIA 2LYHA 5KFLA 3QEAZ 1HHLA 251LA 3GXRA 5CA7A 3OJPA 4HPEA 163LA 2NRWA 3LVVA 1JIYA 2M0NA 3RAQA 5BOLA 2B6WA 2JGAA 3L5KA 1MN8A 5LA8A 4HJYA 2YQEA 3QAKA 1HF4A 3A3QA 1F6RA 1PK3A 5AIAA 2K8AA 1K5OA 1SXEA 4Q45A 1CV6A 4BADA 4EENA 3HT3A 3WKCA 4YF2A 1ZURA 4LDOA 1BPXA 3ZVQA 4Q43A 4ECVA 3HT8A 1M6YA 1BB7A 3WPKA 193LA 2XGQA 1UA1A 3UQ0A 1D3FA 5KL1B 1B7PA 1C62A 2BQBA 1GE1A 4WO6A 3PX6A 3RU5A 5FDJA 2D6FC 1SIJA 4LT2A 3OK0A 3PNCA 1F5SA 3ALRA 7ICNA 1L06A 1L6NA 4RQ5A 4F5QA 3Q8KA 4O9MA 3KD3A 4YOPA 5KFJA 4DDCA 232LA 2XGPA 1LI2A 3A0HU 3WKEA 4W52A 3M8RA 2OU0X 1LSCA 4EMNA 5J0XA 2BZFA 4I27A 1T8GA 4F8RA 3PW5A 3HWLA 4GCCA 1QTEA 1ZD2P 1KS3A 2W1LA 3HFMY 4WJ3B 1C20A 1FBIX 3SAHA 3NTUA 2RH1A 2F3NA 2RBNA 5LAFA 5L1KA 4CGZA 4NSHA 1W6ZA 249LA 4DQSA 4DSFA 4ET8A 5IIOA 1NK7A 4KLMA 4LYCA 4N0JA 1LYFA 1NJXA 1QCKA 2OXOA 2DPIA 1L62A 2HBKA 3IG5A 1Q8KA 2DQAA 231LA 2AH5A 3TXIA 3A96A 2LMRA 1DPXA 1LJFA 3EYZA 1IOQA 1DYDA 4PPXA 1FN5A 2NTGA 3C1ZA 1HC0A 140LA 1L43A 1OW5A 4ET9A 110LA 1TCYA 2HHSA 3WKAA 4DQRA 2WAQC 2WF5A 4Y2XA 5EWGA 1DYGA 2W3SA 1NZBA 3JPNA 1VFBC 1D0LA 3HDFA 2HBMA 5T14A 4NGYA 1C6LA 5KFRA 1NK5A 8ICNA 161LA 5ALGA 2I9GA 5CWRA 1BWIA 8ICAA 3T5KA 1PVPA 1CU0A 2JXJA 3Q8MA 7ICTA 1U48A 1SWWA 3DEEA 1C6BA 1D2WA 1NKCA 4NGJA 1KFTA 8ICGA 2UVRA 1A77A 4LYTA 3RJJA 3TAQA 1DK2A 3RB3A 2OE9X 1Q3UA 2W1XA 8ICMA 5B1GA 2UVVA 1ZQLA 1A0PA 4TQSA 4WOAA 3T5LA 1JJ0A 4MFFA 1GFKA 4LYZA 4QIWF 4OJPA 1V97A 1YANA 1GXXA 4H8YA 4J9OA 2KFZA 8ICCA 1SZHA 1QSSA 2EAMA 4C8MA 1S97A 1L31A 2G4QA 5EE9A 1DYAA 4OD0A 1K1SA 1GFRA 2D8CA 1CJ9A 1QQYA 4GC7A 3Q8LA 4Y2YA 1LJ3A 4LZTA 1V9PA 3H8SA 5KT2A 2W7PA 4NLNA 3KZIU 1ZQJA 2B70A 3EW9A 3OE8A 5ALIA 3MGHA 2L78A 189LA 4I0CA 5KG4A 3JPRA 1A4VA 1UQVA 3GUNA 3N9AA 4ED6A 7ICLA 4QZGA 3DN4A 5DDYA 1LLHA 1L8OA 4C4SA 3C81A 5LYTA 3LYSA 5J0SA 4H9HA 4KX5A 158LA 2KE7A 3RB4A 2LBOA 5ALYA 1L07A 3FYHA 4KL7A 3D2NA 1GHLA 4P4PA 4IJ4A 3AM9A 1PQKA 4QDNA 5LVJA 1L46A 4MCKA 4XQ8A 3A93A 2F2NA 2CWIA 2KVSA 1LYOA 4YXAC 2IMWP 7ICMA 4LJXA 221LA 2WHEA 1C6TA 1GB5A 1LSBA 4PGXA 3W6CA 5ALEA 1BQLY 1IWXA 1C6EA 1OVKA 3E2EA 3SB9A 4I8SA 4B9UA 3RB6A 3PX4A 4F5PA 2B6GA 1DI5A 1L14A 1LZ4A 4MF2A 1SSYA 2FBDA 197LA 1ZVHL 1J1XY 1PQOA 1J1OY 2XI9A 1GB8A 3CT0A 3ZD8A 1L40A 3L2XA 5DG8A 2FYCA 134LA 1ZQKA 1IP6A 1CU2A 1IWTA 3C28A 2XCAA 4C4RA 2RB0X 3ZD9A 1CKHA 3TXJA 5M1YA 1P3NA 111LA 1WVUA 3QNGA 1QLNA 2D6BA 4B9VA 1G06A 2IOFK 143LA 1NJWA 3DN6A 4X5VA 1D9DA 1LMAA 1QTBA 1ECWA 4B9NA 4I7JA 5AKLA 3C2MA 1VAUA 1LWKA 4R64A 1P46A 1HEKA 2PI4A 4QZEA 1L66A 3RH4A 2BLYA 133LA 9ICVA 2G06A 1XWLA 4QIWC 1L90A 1S0OA 1T6HA 2H3FA 3AQEA 4WMGA 1L48A 2ISPA 103LA 170LA 3UMGA 4QY9A 1X9WA 1QTMA 4YM8A 3C2KA 4U6PA 4I7NA 1QUOA 5HMMA 1Z00B 2ZUCA 1QT6A 3A92A 4ARQB 4KLQA 1GF4A 4Z6DA 5F14A 1QDTA 3EBAB 5KFQA 2ODGA 3W6BA 3HBDA 3HPOA 128LA 5KFOA 1L32A 5KFCA 5HMLA 1L37A 1TAMA 2KZ3A 238LA 1LZBA 3PY8A 2YBLA 4H93A 4Q44A 2F4AA 3EMSA 3ODUA 4O0IA 4BJQA 4YMMA 9ICPA 4TWSA 2KD1A 4C7ZA 3F9LA 1NHEA 4IC9A 3GUPA 1CKFA 1C7YA 218LA 8ICUA 5KFBA 236LA 1PZNA 4M6DA 2LPEA 2ZNXY 3QU2A 3WUMA 4LT3A 5KJ9A 5KAIU 2ZUBA 2BPFA 181LA 3HT7A 2EIZC 4FDYA 2Z19A 4YP3A 3RZEA 5B05A 3V6JA 1BVKC 1IVMA 4O3PA 1FLYA 2HOFA 1QSWA 1OYUA 4C80A 4YMNA 3UXNA 1GBOA 3H8WA 4P0PA 3SMVA 4XJFA 1MQ3A 9ICHA 2L5YA 2FPMA 3MR2A 2BQLA 1GF9A 2XQOA 5I4WA 1ZOLA 1TK5A 2YBMA 2KJ8A 3ZDAA 1XGTC 1DYCA 1LPIA 3CQLA 1XJTA 4P4OA 177LA 2Z18A 4Q8FA 2EAPA 3AYQA 1LWGA 4YX7C 3O0FA 1HFXA 225LA 4ARJA 3N4MB 1SX7A 1KQQA 3CW2C 4PHEA 4ED0A 1ZQBA 7ICOA 1OUJA 1SXDA 1B6IA 2QLTA 4DS4A 1U47A 4DL3A 3SI8A 1LZ6A 1LZ5A 1OUHA 3MDCA 2G4PA 205LA 5B1FA 2DF4B 186LA 148LE 1UHUA 3CSQA 1QT3A 122LA 2H3IA 2O7AA 3V7LA 3H0MB 7ICRA 1B5XA 4HV2A 4W96A 3TMWA 4QZ8A 1KDHA 4I2DA 239LA 1I20A 1Y88A 2E5SA 2DL0A 9ICFA 1D0MA 3F6ZA 1Z19A 1L91A 5GTHU 4CGEA 3WUNA 1OUGA 1WQMA 2MRLA 4G49A 1PQJA 3D3DA 3RRHA 2E3TA 2R8JA 4ZEEA 4YMOA 1FIQA 1RCMA 4DQ7A 1EL1A 1L99A 3WW6A 2CUUA 1WTMA 4YXJA 5IDDA 4DEZA 9ICUA 3HT9A 4YVZA 1UIGA 5T3FA 5LA5A 4UAWA 1L3TA 4EYIB 2QKQA 3RW8A 1ZQTA 1L7MA 4UAUA 5J2AA 1LVHA 1X40A 1LPYA 1YL0X 2HEEA 3GV7B 3IP4B 3QZ7A 4G9SA 3NVVA 4UB4A 4I7TA 5DQIA 1B5YA 2XY7A 4FBTA 2YBIA 3BS7A 2HBJA 1OV7A 1KBUA 4NEBA 2CDSA 3MR5A 1YT3A 2MEFA 1C6HA 2LI6A 1OQMA 1BGXT 2ZQ3A 4QZBA 1OUCA 2HHWA 5HMJA 1L50A 3ED5A 1GE2A 1ZD4A 4XJGA 2Y1IA 3RB0A 4KX3A 2FYDA 1DYFA 2OE4X 2XY5A 1B7LA 4JK1A 1L22A 1GF5A 1DKKA 3LYTA 1YAQA 2UVUA 3OJSA 2WFAA 4KMOB 1SGGA 4GXKA 1L65A 1L73A 1BPDA 1KTQA 3A67Y 4I7SA 1CV3A 8ICTA 5F81A 4IR1A 4K4IA 4K4GA 4EEYA 5KXPA 2YTUA 1P6YA 4RQ6A 4PHIA 3V6KA 1GAYA 1EPYA 2FPKA 5L3IA 5AM5A 2JZBA 4JWNA 3AZ5A 1ZQQA 4ETCA 4NLGA 4NJ8A 4ECSA 4B4JA 1JXEA 1RPLA 4ECUA 5DM9A 5ALHA 4RQ1A 1RXVA 5I4YA 4F71A 1LHMA 1LZSA 3T3FA 4IR9A 1TKDA 2DQJY 1SSWA 3WUAA 3ETRA 2RDIA 2FMSA 3N7PD 3IJUA 2HBLA 1ZQCA 3KKAC 2A7DA 5KFTA 3WK6A 3KHGA 3I76A 5CR0A 2P6RA 4WLXA 2ATLA 4DSJA 1ZJMA 2ZXHA 4KT3A 1IC5Y 1ZMYL 4IRDA 4WL6A 9ICBA 5C6JA 108LA 2ES6A 5HHIA 1LZNA 1GXV2 3PO4A 1TAYA 3GDXA 4RDSA 1LMOA 4RT2A 3QXGA 3ISDA 2R18A 1L42A 1LKRA 5AMYA 2PC2A 3CNHA 4IL6U 3MBYA 4FS1A 2RQ5A 4QZIA 3W6EA 4D9ZA 4FZLA 112LA 2ZIUA 4UBBA 1GFUA 5LYMA 5D4BA 2IBKA 2KZMA 4AP9A 4F5RA 3PBLA 5KG5A 3OE6A 3HUQA 1BB4A 1UIEA 8ICWA 1IP2A 5KFNA 9ICLA 3MGIA 5TISU 2DQFC 3A90A 4UWUA 1KXXA 1TEWA 3C7ZA 5J2BA 2PFQA 4J9MA 4M9GA 2ZQ4A 4ARMA 4K4HA 4Y2RA 4LYMA 3DKEX 3C80A 4C3WA 4GLXA 3HUAA 1T3QA 1D9WA 3T36A 1D9UA 1DK3A 4GCEA 1IY4A 4HPIA 1QTHA 5DL9A 5LYZA 1COKA 4G4BA 1LZEA 2OHFA 4BAFA 227LA 4NWEA 4ETDA 1IWYA 5A0LA 2AGOA 5J0QA 1LHIA 1HFYA 4FZNA 1QUHA 1GE4A 4Y2QA 4E97A 1NK0A 3R9KA 7ICSA 2AU0A 1LAAA 3NVWA 3MFHA 1C68A 2MEEA 3A3RX 3MR6A 3V7JA 1DXJA 4R63A 1QUSA 5KFIA 1B2KA 4RUCA 2I26L 3GUOA 4C8LA 1I56A 2E1FA 1H38A 8ICBA 4YN4A 1WWVA 1N60A 3N7SC 4XJHA 4W54A 1L24A 2DQGY 1DQJC 3W6FA 1QTDA 1MELL 2HHTA 1G0MA 4H9CA 104LA 3M6KA 5KG3A 1CU5A 196LA 1XGRC 2NTHA 3GUJA 1BB3A 3ULRA 1X66A 1F10A 1GF8A 2ZTCA 1NBYC 2YVBA 4I2JA 5IINA 2KICA 8ICFA 168LA 4I29A 4IQVA 3I1YA 2JR5A 1F0MA 4IQUA 1SL1A 3QU5A 1QT5A 4DL2A 1QTVA 1UIHA 1LB2B 2F30A 2Z6BA 4C8OA 3TKAA 2KV2A 3C29A 3WK8A 1SKSA 1S9FA 4NG8A 1ZQRA 1YAMA 3CRXA 2H9JA 4O3MA 1IOCA 1S8OA 3H40A 3HU9A 5AK5A 1TBYA 5ALNA 3UM9A 2KIWA 1NWGA 3RR8A 3G3XA 1IO5A 2YY6A 3SR6A 1AQ6A 1A2YC 3TAPA 2MA1A 1AZFA 214LA 3P68A 1BWJA 1QUDA 2MECA 200LA 4L41A 5HLLA 1HSXA 4DD7A 2YBHA 1IG6A 2VA8A 4KPMA 4GN4A 4Z6FA 3G6YA 4OO1J 1IP7A 2E8PA 4CDGA 1PQMA 4NGWA 209LA 123LA 211LA 3NASA 4HJVA 4W94A 2BQCA 4PGJB 1H87A 8ICJA 2NRZA 1PUZA 4RQ0A 2W9AA 4I7PA 3ZVQB 125LA 1DI3A 1LYDA 5J2FA 4H91A 1C69A 1QUGA 5F3XB 2I6ZA 9ICWA 2RDJA 2F2QA 3D2SA 2LYZA 3QE9Y 2CXYA 1S0NA 1ZJNA 1ZQMA 4EBDA 4YXMA 1GFAA 4GCFA 1IIPA 5ALWA 3RUNA 5HHHA 4HTQA 1Q46A 2YB1A 4DT3A 1SB3C 4NL9C 1A76A 4UWVA 2BHNA 1WQQA 3Q8PB 127LA 3P65A 1A6SA 4DOCA 4NHSA 1KY0A 2F8KA 3G6XA 2ISOA 1L20A 1L29A 2NRTA 4WM1A 2G07A 1LJGA 2OE7X 4NL9A 4US9A 2BCQA 4LGKA 2OEHA 1AT6A 150LA 4N9RA 4Z41A 1CI4A 3LDAA 1CKGA 3V72A 3GILA 1L18A 2B6XA 7ICJA 1D8YA 3HRDD 3A6CY 3K2RA 5ILFA 4ECQA 4ELVA 1L5UA 2W9BB 4R6CA 2HEBA 4RPZA 1JKCA 3FI7A 4O3QA 2ASLA 1P56A 4I7KA 4B9TA 5KFEA 3NY8A 1RXWA 234LA 1HENA 1QT8A 1ZYTA 2BQJA 4TSCA 4PPOA 1QSQA 3TARA 1SL2A 4YXCA 2W03A 4EEKA 1GO3F 9ICKA 229LA 4R8UB 5L1LA 2W11A 4OOOA 3HW8A 3AL0B 4FFDA 2A3VA 2VJ4A 7ICGA 1B0DA 2YMMA 3G3VA 4FJRA 4PJZA 4QWDA 1YZ7A 2G08A 3N97B 7ICVA 1P5CA 1V7TA 1XSPA 1WUDA 5ALKA 4YR0A 4F91B 1LHJA 5KL8B 1L88A 1CTWA 3C8QA 5AKXA 1LZRA 4TUQA 4MHVA 2HHQA 3UQ2A 2W3RA 2NRVA 5KFGA 3F2CA 3DN0A 3BQTA 3HU8A 1HMKA 2HW3A 1L26A 258LA 1CUQA 5ALJA 4YR3A 1I6SA 1L56A 3M8SA 118LA 1DI4A 1LGXA 3G6VA 3RJEA 3RJGA 1CJ6A 1CV4A 3OTQA 4G3IA 1SQ2L 2Q9DA 3A91A 2HI0A 2IGCA 4YEOA 1L71A 1T6VL 4EKQA 2LYMA 4NY5A 3P64A 3MDAA 3HWTA 1IR9A 3WU8A 4DAJA 9ICOA 4MF8A 1D6PA 4CHXA 4KXIA 1IR8A 3AMZA 180LA 4DKLA 4PJ2C 4NLKA 3M9OB 5LAGA 5L9XA 2ZYCA 1RJCB 1SX2A 4QZ9A 1L7OA 1LSYA 4G9BA 3GU3A 2FI1A 245LA 5DBCA 1JMSA 3RBEA 3LYOA 2CN1A 5CP2A 213LA 4DFPA 2BQUA 3F8VA 5KXZA 1V38A 2F1JA 1G0LA 3K4GA 5ALUA 1ZQSA 2C8OA 210LA 2HUBA 3M3UA 3WKDA 4II8A 1OUQA 4C8NA 4H9EA 3HBEX 4B4EA 1C45A 4I7MA 3L64A 4YENA 4DWXA 1G0JA 3LN2A 2F77X 3A6BY 2I6XA 3PSIA 2HU3A 164LA 5DKWA 2H3VA 5KFUA 1LYZA 4O5EA 4BX9C 207LA 2HDOA 3UXOA 4RUAA 1LZDA 3WU2U 1PVQA 114LA 4PL2A 5D49A 1ZQIA 1L72A 4XYYA 4KLIA 5AKYA 4DO9A 256LA 3B0KA 1JTMA 3HKZF 1SKWA 4C0ZA 4PRQA 3JR6A 4W55A 1QQ7A 2ZJ5A 4WM4A 3UPQA 4YD1A 4ECWA 2JZBB 1L81A 3SB7A 4DFJA 1YAPA 262LA 1HFZA 1GB2A 1L11A 5DN5A 1T94A 4IRKA 5ALMA 4GFJA 8ICIA 5EWFA 1CU6A 3ATOA 5FP0A 1WQRA 4OJ5A 1HERA 1L70A 2Z38A 3ETLA 5AK3A 1XSLA 2C8PA 4KLGA 1NZPA 1VLBA 1IR7A 5KFYA 3NGDA 1BB6A 4PHAA 1WCNA 4W58A 5F9XA 1L8LA 4DL7A 4O3SA 5FEKA 5J0OA 254LA 1CV0A 2E1EA 2DKVA 4M9JA 3BZCA 5BPCA 3TXBA 4OJOA 4BWMA 1L59A 2EH9A 2N1RA 4NY8A 2BQ3A 3WULA 2GWSA 5AKIA 3QUQA 3SAFA 2M9NA 3H0RB 5D5FA 4IAPA 4DYGA 4CFOA 4M04A 4DL4A 4Y2TA 5L1MA 4W51A 2KSOA 2YSSC 2R8GA 1B9OA 4N8ZA 3EUB2 3TXHA 4NLBA 3TXFA 3AZ4A 4QNLA 1B5UA 4X3BA 2AQ4A 5KFVA 1CVKA 2BQHA 173LA 4WM5A 3OPXA 2ZIUB 1CRXA 1Z1BA 4RW1A 1XEPA 2YX8A 5TZVA 4F72A 5CEHA 4DFDA 1L57A 4NHPA 2RB2X 3WU7A 1C08C 3KBBA 1GF7A 1FO4A 4NLZA 4ED2A 3M9MB 4HJZA 1UIAA 4J9NA 8ICKA 3FC4A 3W6AA 1UICA 9ICGA 4ARMB 3WXUA 5AI4A 5IIIA 1L55A 3HTFA 5AKJA 1B7NA 1CNSA 1DZBX 2H9KA 2JRZA 1KN5A 4LYBA 2BCVA 1C6DA 5J0RA 1IP1A 1P64A 3AU6A 3TMXA 4W53A 4O3RA 3SYZA 2EZZA 1HUOA 1VDSA 4ED7A 2BKEA 4KLHA 4ZOHC 1OVHA 1LSAA 5KXTA 4NLCA 182LA 5HNCA 2G5IB 1C6QA 4MSTA 5L9JA 2B6YA 7ICFA 2OM6A 1L41A 2LYAA 3N28A 1B22A 2XO7A 4OOTA 1LSZA 2LZTA 1BPBA 2XICA 215LA 3AZ6A 4DLEA 1XC9A 1GF3A 3SBBC 5KKJA 4WL7A 259LA 2XY6A 1KKXA 4J9LA 5HR6A 1ZQNA 1RZTA 228LA 5E9RA 3HKZC 4DQQA 1GF0A 1L0JA 113LA 4BWJA 2W54A 3WK4A 4YFKA 4W56A 1L7NA 4I2HA 5J2HA 1G0QA 1L09A 4NWIA 3T79A 3N9CA 4QEQA 5E79U 4F2SA 3B0IA 4WM2A 1B5WA 3CDOA 5EOZA 3RJHA 5J29A 1LSFA 4RPXA 4RLMA 1REMA 4RQ8A 1Q3VA 2FLNA 1L30A 2BCSA 4TX7A 2DQDY 4MR1A 2W1MA 5DN4A 2K4PA 5APFA 1NKHA 151LA 3CDVA 5JRTA 2HUMA 2KJ5A 3CDRA 4Y2VA 3B0OA 1KLNA 1N2XA 1GB0A 2Y1JA 184LA 3RAXA 4LT1A 1YKZX 1NJZA 5LVIA 1LJHA 1KW7A 3H4BA 4HTNA 4ETBA 2MAXA 5J8YA 109LA 1L3UA 1L23A 4TSBA 5KT3A 4S0WA 194LA 2P35A 3PW4A 5KFKA 2EAOA 2XIDA 5DGBA 1L39A 5J2DA 1GAZA 1B43A 2NWDX 3ICXA 2B6TA 1SLYA 4KTQA 1QQ6A 4DQPA 2KNJA 2HULA 4F5OA 4I2FA 5AM2A 4DD1A 1L94A 3D6JA 4EKSA 1JX4A 2V4RA 1B7RA 5KG0A 3PSFA 131LA 230LA 3LZ2A 3RH5A 2B73A 2RLTA 135LA 3V2WA 2KHQA 5ALPA 1ZVYB 5F16A 5ALZA 257LA 2A7FA 2LZ2A 3G3WA 4PGYA 2VA3A 5KFAA 2ZIKA 3C1YA 1BPYA 3QZ8A 1XSNA 3HH6A 1X9XA 1GPQC 2G5HB 1IIZA 145LA 4LT0A 3HJEA 3KZXA 5HNLA 4EELA 3GIMA 5C5JA 4P2EA 5DB9A 3D9AC 4EOFA 3TMVA 5KXOA 4JV0A 5F9UA 3GIKA 1NQIA 4WM6A 4CCHA 1L34A 4PHDA 1BGIA 1PZYA 5LVHA 3MC1A 3P4ZA 1HEMA 1L52A 2ZNWY 5KG6A 2ZYPA 2MEDA 2J6SA 107LA 3SAGA 5J2CA 2E8MA 3PDSA 4J9QA 2ASDA 1L51A 1X9MA 3GIIA 3RR7A 3NRZA 1UUZC 4OWCA 1JTPL 5LZMA 3SZ2A 4WM3A 3PZPA 2DQIY 2W9BA 9ICRA 1VDTA 4UQGA 1GF6A 3GV5B 2VB1A 3K1RB 4HAIA 2MEAA 3ISBA 1IWVA 5LIOA 2XVTA 1L45A 1HUZA 3CDQA 1I1ZA 1N62A 3K1ZA 4UATA 3RF9A 1B0XA 4KMUA 137LA 2KZZA 5EWEA 1XNSA 2Q0MX 1CKCA 2W8KA 3IRUA 154LA 1WG8A 4Y2SA 1UT5A 2Y9UA 3PR5B 3PO5A 4R8UA 1JN3A 1QT7A 2DPJA 1YL1X 2D4KA 3QUBA 2YDGA 2BCRA 4YEMA 1X42A 3LYZA 3QY4A 4DF8A 1CV5A 3H0LB 3DN8A 3WW5A 4NGZA 4KITB 1UACY 3WK9A 3SB8A 4USAA 4JWMA 9ICIA 3F5EA 4UB6U 3GXKA 162LA 5KTQA 2I25L 206LA 1JPOA 5CJ7A 2JMGA 4H1PA 4US8A 1BWHA 5B5EU 4E3UA 5J2IA 2IA6A 3EO5A 2PXIA 2BPUA 1L63A 1KW5A 5ALXA 2BQGA 4RQ3A 3TADC 3E3DA 4B9SA 3C83A 149LA 4ZH4A 5ALSA 3PSPA 1JSEA 4P0QA 188LA 2AQ0A 9ICXA 1LV5A 3CT5A 3BQ2A 3AQFA 1W08A 3TADA 3WPJA 4F5NA 1G0KA 4DOAA 3SEIA 3SN6R 1L85A 4LFPA 4F92B 1G7LC 1L93A 142LA 1IY3A 1L87A 3A8ZA 4NGLA 2BGWA 4F4YA 1ZQZA 2YBNA 7ICPA 1B5VA 2LM4A 4ACOA 4ECXA 1WQOA 1JEFA 156LA 1L47A 5KXSA 2B75A 4YQWA 4PZNA 1LKYB 1B7OA 4I7OA 1G7JC 2QARA 3TACB 1TAUA 5ALVA 1VATA 1C46A 3AB6A 115LA 1D3JA 5AICA 2V4QA 8ICHA 120LA 1GFVA 1TK0A 4NHTA 4JMUA 199LA 3EXDA 3DMZA 2ASJA 5DBAA 4RQMA 4FO6A 119LA 8ICLA 1VDQA 3MABA 3BQ0A 2LZMA 4GN3A 1COOA 3LZTA 4LDEA 4CJ2A 3TXGA 1L17A 4R66A 4C5FA 1JKAA 147LA 2PFOA 1VEDA 3PW2A 3A95A 2WF6A 1IOTA 4H8ZA 4XJIA 1YILA 4H94A 1GFEA 1OP9B 1LOZA 1IORA 1C67A 2JEIA 5KFFA 5APEA 5J2KA 2EZXA 1C6PA 2OYYA 1ZQ1C 4RQNA 4RQ4A 4IQWA 1IC7Y 1UA6Y 3BDPA 3GQCA 166LA 2OCEA 4N1CC 1G7IC 1JROA 3THVA 1ZQGA 3T5HA 1FLWA 1GFJA 1XEKA 4TURA 2ZIWB 169LA 1LMQA 1L92A 5HNKA 4F4ZA 2HUKA 1G07A 5ALRA 3SENA 4RNOA 1LI3A 2N5ZA 5DLGA 1Z3EB 4HV1A 4GRVA 3AN1A 9ICQA 3AUOA 1L95A 1MLCE 2O4WA 1L33A 1CU3A 1MC8A 2F1IA 2KP7A 2KG5A 4NSIA 2GLEA 3SV4A 2KK0A 2KSOB 4MEYA 3IN5A 1T7PA 4OWEA 2RAZX 1C7PA 4PGQA 2YMLA 2B72A 4NFVA 3D2QA 1Z4NA 3EPIA 4PH5A 4UW9A 5LVKA 1IP4A 2MEBA 2XBRA 3RRGA 2E8OA 2K8BB 1JHLA 1JTOL 1YQVY 4DOBA 2QB0B 2G0AA 4QW9A 3KOOA 1SL0A 2XJWA 4F4XA 4M0AA 1L80A 212LA 1BHZA 3SP3A 1F44A 1SWVA 4B4IA 4QZCA 216LA 1L53A 5HQ1A 8ICRA 1U49A 1GWDA 3RTVA 3VCBA 1ZQAA 2H5ZA 5LINA 4FZMA 5DG9A 5ALFA 1OWZA 5KXWA 7ICQA 1ZQDA 1JISA 3N7RC 1UCVA 4QZHA 8ICXA 2W8LA 1LJEA 1RYRA 1C6AA 4C7YA 248LA 2HEDA 3QE8A 4GN5C 4J1AA 2H3QA 1JSFA 5KT4A 4QWCA 8ICZA 1L98A 2GOLA 4DFKA 1EQEA 1L21A 2RB1X 1CV1A 4BAPA 1GB3A 3WH1A 1KEJA 2Y0SF 3ZDDA 1LZ8A 4NIJA 3BKHA 2WB1F 3QUCA 2ZILA 1IM4A 3J81j 4H90A 4ECTA 1L64A 4UB5A 2JHDA 2BQKA 5I4XA 4P4MA 2QB1A 4HTKA 1ZQVA 4Z3MA 4ZIXA 219LA 2IHMA 3IG8A 2OU9A 235LA 4CE6A 2JEJA 3ISCA 3GUMA 4W59A 217LA 4AQNA 4I7RA 2NO5A 2RBRA 1LGWA 3DMXA 2RRDA 5DQHA 3LZMA 4ECZA 5F9LA 3C8RA 4DF4A 1HNLA 4ED1A 4QWBA 3OJUA 2Z2EA 2A1JB 4RNNA 2XC9A 2MUTA 2PKEA 2BPGA 9ICCA 3PW7A 1L75A 4UAYA 126LA 1UIFA 1ZXIA 4J1BA 1C6FA 1K28A 2F4GA 2FBBA 5FHWA 1AKIA 3EZ5A 5FCPA 4OJ6A 4AYBF 5I54A 178LA 3MR3A 1FKVA 3IDWA 3B0XA 1T8AA 1RFPA 3RH6A 4UB2A 4Z46A 2ZIXA 2DQHY 1L38A 1IXRA 1LJJA 4DSIA 5AM3A 5KFDA 5DB6A 4ZPUA 3H8JA 3U26A 1CX6A 2DKZA 6LYTA 1WCLA 4TUNA 3AW6A 1JI7A 4KLDA 2KTQA 8ICVA 3A34A 2ESEA 5KXRA 1U45A 3Q8RB 4J03A 3TXEA 5AIBA 3M1YA 4EX7A 1REYA 4GXJA 2FLPA 1AM7A 1B7QA 3VWOA 2ZXIA 2JH1A 1DRGA 3QEBZ 5KT6A 1C6IA 1JTTL 1LSGA 3PMLA 4RPYA 3BQ1A 4QW8A 3W6DA 1BVXA 1L0KA 2PFNA 3FM9A 4J9RA 5L3HA 252LA 1L44A 1QTCA 1GB7A 1ZRNA 2FPLA 3B6LA 2HHVA 5AHXA 1G7HC 4A7DA 3IM1A 4XUSA 3L4PA 3BJYA 1GFHA 1ZWNA 3NRWA 4I2IA 5G5GA 4BXOA 1FLQA 1GE3A 1IOSA 4ZFPA 1TE2A 3CSRA 2XBSA 1WQPA 5KT7A 4KLEA 138LA 1G7MC 5KFZA 4H9IA 3QU4A 5ALOA 4DQ5A 3OSNA 2GH1A 2BQRA 4RW2A 1V85A 4I2BA 3PSTA 4J0LA 2BCUA 1LMPA 4EYHB 1TLAA 5EE1A 2OWOA 2A1AA 4N1EI 2Y0SC 141LA 3G3AB 1J2NA 2Q4TA 2WB1C 1ED1A 8ICPA 3FA0A 3UONA 2IOFA 2D4JA 1XSFA 5KG2A 4I2EA 4I2GA 4OWAA 4IATA 1IP3A 2RP5A 2B21A 2HEFA 1KY1A 2C2RA 2DBTA 4C4TA 4MEXA 1LJ4A 4LVSA 1G0GA 1OVJA 3CT1A 3WYHA 5J0UA 4LYOA 2K60A 1AT5A 1C64A 1GBZA 1C43A 2FLLA 2VKQA 5KT5A 1D8LA 4FBUA 3ONNA 2C2EA 1FFVA 223LA 2EKSC 4DD9A 1JJ3A 1QH9A 1IWUA 1XEJA 4DD3A 3KHLA 4H9BA 146LA 1LYGA 5KAFU 3VW7A 2VJ5A 1QSYA 1UIDA 2RBPA 2NO4A 4KLJA 3HH5A 3WMKA 3V6HA 3HH4A 4F93B 2F44A 1GBWA 1KSPA 5KFPA 2BAAA 2BQMA 5DLFA 3RT5X 4LZMA 2NV3A 1L00A 3WVXA 5AKZA 4UAZA 4CF4A 4QZDA 2LCBA 4QZFA 243LA 3B0YA 1ZQYA 1FDLY 2B0CA 4NM1A 1X6IA 3EMLA 1J1PY 2DUYA 1NMMA 5ALDA 5IIMA 4O5CA 1XGUC 1OUFA 3QU7A 3FDSA 3SQIA 4WG7A 5DQGA 4B1AA 7ICIA 4P0QB 192LA 2EQLA 1JTNA 4NG1A 5LXWA 1N63A 2Z12A 2OTYX 4XENA 4DL6A 195LA 2HOIA 1CUPA 2Z37A 3LWMA 3TI0A 4PL1A 1KFSA 3GIJA 1S0MA 2E8NA 2C22A 1L12A 1LSPA 4NWHA 4B9LA 1P2LA 159LA 1XEIA 5KXLA 4P2HA 1O08A 2AHOB 5AI0A 3CDTA 1KIPC 1NJYA 1E8LA 3C5FA 1L76A 2OH2A 1NKBA 3VC8A 3WPLA 4DSKA 4EKPA 4IQTA 1B4FA 2QARB 1OUBA 1LKYA 3LHMA 4B49A 3JPOA 2WARA 2YMQA 1FFUA 3D4SA 1JKDA 3UMCA 5EBHA 2FDRA 3OE0A 2KN7A 2B7XA 4J9PA 4EZ9A 9ICJA 4GLAA 2KFNA 2VA2A 1C60A 2WTFA 1JRPA 244LA 2D91A 1KFDA 2ZIVA 157LA 1C6MA 1N61A 2P66A 1D0KA 241LA 237LA 4PHPA 5JENB 4TUSA 2HVHA 1P7DA 1GDWA 3CSZA 1L79A 1DOQA 1KL9A 2WF7A 5J0WA 1IWWA 5KKIA 5L1JA 4KN4A 1DKJA 1JUGA 4N5RA 4QJFB 2C28A 2RAYX 5EE3A 1L04A 1X6JA 3C5GA 1GFTA 5LVGA 2BR0A 4OO9A 1BNPA 1ZQUA 4JUZA 1NKEA 1PVRA 1LSEA 1XJUA 1ZQEA 5AM1A 2J6UA 1N4FA 3QUTA 2OU8A 1JXLA 2V9WA 3UMBA 8ICSA 1L01A 233LA 1JKBA 1L15A 5CHGA 3EPGA 1DGJA 190LA 1D3NA 191LA 3H8MA 4HP0A 2ZIWA 4UB1A 1L49A 1LSDA 1D6QA 4ARLA 4ML7A 1P36A 5AI9A 1CJ7A 4AGAA 176LA 4M9NA 4I2AA 2YN4A 1LYSA 4DDBA 4OJLA 5E4PA 4KLFA 3KTQA 3TANA 1L69A 2KMDA 3RJKA 1INUA 1TFRA 4FE3A 2LC9A 7ICHA 4DCCA 3HH3A 3QU9A 2LM1A 3K3TA 1T8EA 1JITA 5A3EA 1LYJA 5AI5A 1EQ5A 224LA 2A4TA 1JIHA 2LYBA 2D4IA 2QB0A 220LA 4PZOA 5C0YA 2B6ZA 2BQNA 3AZ7A 1BB5A 1BVSA 1GFGA 4W57A 4RQ2A 2RBSA 160LA 4GIBA 4CRXA 4UASA 2K8CB 3B9JA 2C2DA 4BGDA 171LA 4OWBA 3DN2A 4RT3A 1L16A 4ETEA 1OV5A 3F2BA 3LYMA 1LZ9A 2HCFA 1T3PA 4M47A 1F0WA 1ZQFA 2BQAA 3TXDA 2ZTDA 2ANVA 1S10A 4LZGA 1FLUA 2FJ6A 1LYEA 3FI5A 3HDEA 4G4CA 1UBZA 1GBSA 1LZ1A 1T3NA 3M7DA 3SBAA 5KFSA 4DSEA 2KOBA 5DLAA 5AK4A 1JQUA 4JV2A 1P2CC 4Z98A 2DGZA 174LA 4O3NA 3ORYA 226LA 1C63A 1HSWA 1TK8A 3TMUA 2KJ9A 1IEEA 1ZV5L 2K4HA 1RM6C 2Q9EA 4GCBA 4QWAA 2EDUA 1LMNA 2LHTA 3PV8A 2JEGA 1IP5A 2DQEY 9ICTA 3J4GA 2R8HA 4MFCA 5AI8A 4QZAA 4U7CA 2IOHA 3OE9A 2WF9A 4PK0A 3IJVA 5I14A 1L02A 3Q8QB 1L27A 2MUTB 3T6UA 2A1JA 1L3SA 2P6UA 1L05A 5JTIA 1IV8A 247LA 1NI3A 2AGPA 2ZJ8A 1SZPA 2UVWA 3L3FX 2ZIJA 1EXNA 4BS7A 2W04A 1L28A 3LWLA 1KRPA 4AXTA 3HTDA 3FAHA 8LYZA 2DBYA 2O79A 3LK9A 3Q8SB 5J8YC 5I5QA 1DGSA 2ZIXB 3B72A 3GULA 1XO1A 2MSNA 3CB7A 2J6TA 1P7SA 5KG1A 3FADA 1KXWA 4EKRA 3WL2A 3G3BB 2PFPA 5HP4A 1MA7A 130LA 1C6JA 4UWNA 4EXMA 5ALQA 1D8BA 2I1QA 1D9FA 4NSJA 4CF5A 1PK1A 3KHHA 5DGAA 2VANA 2GO7A 4NGKA 1DXSA 129LA 2CRXA 5B06A 1TDYA 5JUMA 1DYEA 1NK9A 5DB8A 3ATNA 4M6WA 1FKQA 2RBQA 2W7OA 5AKKA 4Y2UA 3N9EA 4KN7A 4H9AA 4F2RA 3BQ7A 1SV0C 1LZTA 3A94A 175LA 2ZTEA 3MGVA 5C6IA 1NDGC 4BXOB 1O03A 9ICSA 4DL5A 2HSZA 4XJBA 4NGVA 3AGIA 1SV0A 4OCZA 3HTBA 2Y8PA 4K5YA 4O3OA 4QGZA 1S5LU 4PRUA 5JU5A 1L19A 3WVYA 2JV3A 1LZYA 4NHIA 1LHKA 2ZG6A 1QTZA 2HOQA 3BS5A 1NK8A 1L68A 5KNIA 187LA 1SWYA 4F4WA 2MEIA 3C21A 201LA 2EZYA 5APCA 3NVYA 4J9SA 208LA 4DQJA 5KFWA 4IS7A 7LYZA 1C6CA 1NOMA 4ECYA 1XGPC 2HEAA 2G09A 1YIKA 5A3ZA 1QS9A 1ZYQA 1BPEA 5KXNA 3HUKA 2H5XA 1L74A 1YAOA 4WLTA 3SB6A 9ICAA 3QNMA 1C6GA 1BPZA 3RNXA 240LA 1P37A 2R8IA 1RDFA 7ICKA 3WKBA 5FSTA 4A8EA 4NM2A 4M9LA 5IILA 1SWZA 1N5WA 2ZWBA 1OUDA 2KKVA 3K75D 5ALTA 1XU4A 2JH7A 4DS5A 1ZQHA 1QSBA 3MFIA 2LHMA 1GE0A 2YBJA 4DC4A 2Z2FA 5AK6A 1ZETA 4I2CA 1QSAA 3GV8B 3P66A 3RJIA 5K7OA 5K4LA 4RQ7A 3HILA 4NGOA 3H4DA 3NVZA 1RYSA 4HSFA 1WVVA 3FE0A 1VDVA 1L3VA 4XN6A 1HIWA 1CKDA 3DN1A 1L67A 1L60A 2W9CA 1L97A 2F2AB 5AM0A 4DD2A 5HMVA 4LFXA 3MGWA 1QT4A 1L36A 1LYIA 5KG7A 1TV9A 4I7QA 2B74A 1L61A 3F53A 2BDUA 1LMTA 3LVWA 1B5ZA 1LKSA 1PQDA 1Z55A 1LHLA 2HVIA 4IASA 2AUBA 5DBBA 1L86A 153LA 3ZEKA 1LJKA 3TFSA 1ZQOA 2O6KA 2F32A 1QUTA 172LA 1X2IA 1LGUA 5D46A 2BQFA 2HTXA 1HEPA 3AU2A 4DSLA 1L54A 1L58A 2W1YA 4OW1A 3BKVA 4H92A 4GCDA 6LYZA 1ALCA 1IC4Y 1OUAA 1MQ2A 3GUKA 3AJNA 2Q0ZX 1L84A 1L89A 2KHVA 1NNLA 1QQ5A 4F50A 1XO0A 4KLLA 1YKXX 4ARPA 3HX0A 4EPIA 185LA 183LA 1L13A 1V7SA 1U4BA 255LA 3UXPA 1NK4A 2W9MA 5IIJA 1G1WA 1RQNA 4M4OA 5KFHA 2BPCA 5F9NA 3PMNA 5ILCA 1VDPA 5HR7A 3WXTA 2B5ZA 3ZI4A 4WG1A 2KIVA 4UB3A 250LA 2QARC 4F4KA 4PJ0U 1LCNA 4YR2A 165LA 4NSGA 1L7PA 3QYPA 2PMZF 3DV9A 1NK6A 5AKGA 7ICEA 2DFLA 4B9MA 2WF8A 5C6LA 4DLGA 3OHBA 3DN3A 2YB4A 3HP6A 5KFMA 1PQIA 1NHBA 1IX0A 1RE2A 8ICOA 4UARA 1MSWD 260LA 2BQOA 3RFAA 4MFAA 2ZIVB 1C10A 5KXYA 5B66U 4LZDA 2OTZX 3PR4A 1GDXA 2BQEA 1LJIA 4J7VA 1LW9A 5DDMA 5KFXA 1C65A 2ALZA 2KVCA 3C23A 2CJLA 4GLVA 1WTNA 3CP8A 4RU9A 2VIXA 4ANRA 3OHAA 5IELA 9ICNA 1ZD5A 2HMXA 1F6SA 4RZRA 4DQIA 5GTIU 1LMCA 4ELUA 144LA 2FE9A 1UIBA 4ED3A 4IRCA 1CUKA 4XJDA 2HU1A 3QX7A 1DPWA 3V7KA 4GC6A 3C7WA 4M2YA 2F47A 1C66A 1L25A 4DDAA 1URJA 1HEQA 242LA 3C8SA 1L35A 1U9LA 4BDPA 5J2JA 2H3ZA 4TQRA 1N5XA 2PI5A 4H9FA 3PW0A 3J6KA 5AKEA 1T8FA 2BQDA 3PX0A 1KIQC 2AGQA 3F2DA 1X9SA 4QWEA 2I5HA 1C6NA 1L83A 5KXKA 4ETAA 4XA5A 4B6JA 4JV1A 1QS5A 4Q8EA 1L10A 5CRXA 1WQNA 4EZ6A 3GFKB 1L82A 3WK5A 4DJHA 4EBEA 9LYZA 1HELA 2MU2A 5B59A 1NDMC 3AEVA 5J0PA 3KKAA 5G5HA 4CNQA 2DWQA 5J2GA 3H7IA 3GZFA 2YMPA 4F3OA 4KLTA 1UC0A 1XFPL 1RI8B 3BZKA 1EQ4A 4TUPA 4LDLA 1GB6A 2HECA 261LA 1LZCA 3JPTA 3I28A 1C61A 4ELTA 5APDA 1SV4A 4RLNA 5KXMA 3C2LA 3HTGA 2IHLA 1XS9D 1LYYA 4Z6EA 3CYMA 1GBYA 1NF5A 1HJPA 4EPFA 1OWYA 3NUQA 4BUGA 1REXA 2Z39A 2PMZC 2BDPA 1RQLA 1P2RA 1LHHA 2HHUA 3AGGG 1S77D 4DWIA 3A0BU 3KHRA 4I7LA 4RNMA 8ICQA 5BOMA 1LI6A 1XGQC 2F1HA 3HT6A 3M9NB 4O5KA 2DKXA 1LZGA 4R0FA 3C7YA 1LJNA 1WYGA 1UA0A 3IWRA 3E58A 5FELA 3PVXA 1WWUA 1H6MA 1REZA 2RHFA 4YCXA 4M9HA 246LA 4EX6A 1OUIA 1DYBA 2EPEA 2XTHA 1L96A 1J2MA 2JEFA 7ICUA 4KLSA 4UAVA 5I53A 5J0TA 4Y2JA 3JPPA 1WTHA 3WU9A 5DB7A 1HEWA 3KAMA 3RBDA 4WLDA 4KLUA 8ICYA 1LTMA 4Y2PA 3DDHA 1KIRC 6LZMA 1OUEA 155LA 2LYOA 167LA 1ZD3A 5J2EA 4NXZA 152LA 1J97A 4B0DA 2F8LA 2AJQA 4FS2A 1LYHA 2OEAX 2FMPA 9ICEA 2Z7JA 1VJ5A 3E0FA 1QDRA 1Z4OA 2A19A 3SD7A 1QIOA 4R65A 2K4EA 1YROA 3TQ1A 1S76D 1TAQA 7LZMA 3DMVA 4WO9A 2CGIA 1GD6A 3RJFA 2EQYA 3WK7A 5EE0A 253LA 4XRHA 102LA 1Z1VA 2R8KA 4UBCA 1D3MA 4NHQA 1HMLA 2MEHA 3NS1A 1UPHA 4O34A 1ZQPA 5IIKA 3S6JA 4JB3A 2BLXA 4TTDA 4WLYA 5H2FU 1PK1B 2ANXA 5DG7A 5II3A 2AXTU 2XCPA 5KY1A 1KXYA 5IHGA 1YZ6A 2LKYA 4ECRA 1C6KA 1GB9A 4M6WB 1L03A 2RSCA 5J0YA 4YD2A 2IFFY 1FEZA 1GBXA 1CEZA 3HBHA 3W3EA 1N48A 3AW7A 4G4HA 2K89A 1N56A 1HEOA 4H8XA 1UCOA 2D3DA 2ZJAA 4UB8U 3OSPA 2NYVA 4KLOA 1IWZA 1B7SA 3V2YA 1LSMA 4GXIA 5D5CA 1AROP 4EBCA 1QTKA 2EANA 2NRXA 5J7CA 9ICMA 3AGHA 1Z00A 4HYKA 1GEZA 1JWRA 4Z6CA 3IV6A 1JUDA 3M6ZA 4CF3A 3T5JA 3KFUF 3BS5B 2GV0A 3M18B 4ARQA 1KW4A 4I28A 5AKHA 8ICEA 1S0VA 1NBZC 1YKYX 4C8KA 5AM4A 1G0PA 3EWAA 2K4IA 3SB5A 2FMQA 1L77A 1PS5A 4CFPA 1G1VA 4GBRB 3RZ4A 1RG6A 1RYUA 1O23A 5ALLA 5CB1A 3C82A 3F5AA 139LA 5AI6A 4EJ4A 1QSLA 1CX7A 1JALA 1KNIA 3GUIA 198LA 3ZDCA 4OWHA 2DQNB 1ZQXA 3NY9A 4DD0A 3JPSA 1K1QA 1CJ8A 2X0AA 3DNAA 2F76X 3TXKA 4J9KA 2BQIA
chains in the Genus database with same CATH topology
1B7MA 5B07A 2DQCY 1D2YA 1T97A 1LZAA 1GEVA 2RBOA 2Y9TA 1JJ1A 1OXJA 1L08A 222LA 2MEGA 3NYAA 5KXXA 132LA 4XADA 1LSNA 4U3XB 2G4NA 4NGIA 3OJPA 251LA 1HHLA 3GXRA 4HPEA 163LA 1JIYA 2B6WA 5LA8A 4HJYA 3QAKA 1HF4A 3A3QA 1F6RA 1PK3A 4BADA 1SXEA 1CV6A 4YF2A 1ZURA 4LDOA 3HT8A 1BB7A 3WPKA 193LA 1D3FA 1B7PA 1C62A 2BQBA 1GE1A 4WO6A 3RU5A 5FDJA 4LT2A 3OK0A 1L06A 4YOPA 4DDCA 232LA 1LI2A 4W52A 2OU0X 1LSCA 4EMNA 1T8GA 3HWLA 4GCCA 1QTEA 1KS3A 2W1LA 3HFMY 1FBIX 2RH1A 2F3NA 2RBNA 5LAFA 4NSHA 1W6ZA 249LA 4ET8A 4N0JA 4LYCA 1LYFA 1L62A 2DQAA 231LA 3TXIA 3A96A 2LMRA 1DPXA 1LJFA 1IOQA 1DYDA 1FN5A 2NTGA 1HC0A 140LA 1L43A 1OW5A 4ET9A 110LA 1TCYA 1DYGA 1VFBC 1D0LA 3HDFA 4NGYA 1C6LA 161LA 1BWIA 1CU0A 1C6BA 1D2WA 4NGJA 4LYTA 2W1XA 2OE9X 5B1GA 4WOAA 1JJ0A 1GFKA 4LYZA 1YANA 1GXXA 4H8YA 2EAMA 2G4QA 1L31A 1DYAA 1GFRA 2D8CA 1CJ9A 1QQYA 4LZTA 1LJ3A 2B70A 3OE8A 2L78A 189LA 4I0CA 1A4VA 1UQVA 3GUNA 3N9AA 3DN4A 1LLHA 3C81A 5LYTA 4H9HA 158LA 2KE7A 1L07A 4KL7A 1GHLA 4IJ4A 1PQKA 4QDNA 5LVJA 1L46A 4MCKA 3A93A 2F2NA 2CWIA 1LYOA 4YXAC 221LA 1C6TA 1GB5A 1LSBA 3W6CA 1BQLY 1C6EA 1IWXA 1OVKA 3SB9A 4I8SA 1DI5A 1L14A 1SSYA 2B6GA 1LZ4A 2FBDA 197LA 1ZVHL 1J1XY 1PQOA 1J1OY 1GB8A 3CT0A 1L40A 3L2XA 2FYCA 134LA 1IP6A 1CU2A 1IWTA 2RB0X 1CKHA 3TXJA 5M1YA 1P3NA 111LA 1WVUA 3QNGA 2D6BA 1G06A 143LA 3DN6A 1LMAA 1QTBA 4I7JA 1VAUA 1LWKA 1P46A 1L66A 2BLYA 133LA 1L90A 1T6HA 4WMGA 1L48A 103LA 170LA 4QY9A 4YM8A 4I7NA 1QUOA 1QT6A 3A92A 4ARQB 1GF4A 5F14A 1QDTA 3EBAB 3W6BA 3HBDA 128LA 1L32A 1L37A 238LA 1LZBA 2YBLA 4H93A 2F4AA 3EMSA 3ODUA 4TWSA 3F9LA 1NHEA 3GUPA 1CKFA 218LA 236LA 4M6DA 2LPEA 2ZNXY 3WUMA 4LT3A 5KJ9A 181LA 3HT7A 2EIZC 4FDYA 2Z19A 3RZEA 5B05A 1BVKC 1IVMA 1FLYA 1QSWA 1OYUA 1GBOA 4XJFA 2L5YA 2XQOA 2BQLA 5I4WA 1GF9A 2YBMA 1XGTC 1DYCA 1LPIA 3CQLA 1XJTA 177LA 2Z18A 2EAPA 3AYQA 1LWGA 4YX7C 1HFXA 225LA 4ARJA 1SX7A 1OUJA 1SXDA 1B6IA 1LZ6A 1LZ5A 1OUHA 2G4PA 3G3AB 5B1FA 205LA 186LA 148LE 3CSQA 1QT3A 122LA 2O7AA 3TMWA 1B5XA 4HV2A 4W96A 239LA 1I20A 2DL0A 3F6ZA 1D0MA 1L91A 4CGEA 3WUNA 1OUGA 1WQMA 4G49A 1PQJA 3D3DA 4ZEEA 1RCMA 4DQ7A 1EL1A 1L99A 3WW6A 2CUUA 1WTMA 5IDDA 3HT9A 1UIGA 5T3FA 5LA5A 2QKQA 3RW8A 1LPYA 1YL0X 1X40A 2HEEA 4G9SA 4I7TA 1B5YA 2YBIA 3BS7A 1OV7A 4NEBA 2CDSA 2MEFA 1C6HA 1OQMA 2ZQ3A 1OUCA 5HMJA 1L50A 1GE2A 4XJGA 2FYDA 1DYFA 2OE4X 1B7LA 1L22A 1GF5A 1DKKA 3LYTA 1YAQA 1SGGA 1L65A 1L73A 3A67Y 4I7SA 1CV3A 5F81A 5KXPA 2YTUA 1P6YA 4PHIA 1GAYA 1EPYA 5L3IA 3AZ5A 4ETCA 4NJ8A 4B4JA 5DM9A 5I4YA 1LHMA 1LZSA 2DQJY 1SSWA 3WUAA 3IJUA 3KKAC 2A7DA 4WLXA 4KT3A 1IC5Y 1ZMYL 4WL6A 5C6JA 108LA 2ES6A 1LZNA 1GXV2 1TAYA 4RDSA 1LMOA 1L42A 1LKRA 5AMYA 2PC2A 3W6EA 4D9ZA 112LA 1GFUA 5LYMA 3PBLA 3OE6A 3HUQA 1BB4A 1UIEA 1IP2A 2DQFC 3A90A 4UWUA 1KXXA 1TEWA 3C7ZA 2ZQ4A 4ARMA 4LYMA 3DKEX 3C80A 4C3WA 3HUAA 1D9WA 3T36A 1D9UA 4GCEA 1IY4A 4HPIA 1QTHA 5DL9A 5LYZA 1COKA 4G4BA 1LZEA 4BAFA 227LA 4NWEA 4ETDA 1IWYA 1LHIA 1HFYA 1QUHA 4E97A 1GE4A 1LAAA 2MEEA 1C68A 3A3RX 1DXJA 1QUSA 1B2KA 2I26L 3GUOA 1I56A 1WWVA 4XJHA 4W54A 1L24A 2DQGY 1DQJC 3W6FA 1QTDA 1MELL 1G0MA 4H9CA 104LA 1CU5A 196LA 1XGRC 2NTHA 3GUJA 1BB3A 3ULRA 1X66A 1F10A 1GF8A 1NBYC 2YVBA 168LA 1F0MA 1QT5A 1QTVA 1UIHA 2F30A 2Z6BA 4NG8A 1YAMA 2H9JA 1IOCA 3HU9A 1TBYA 1NWGA 3G3XA 1IO5A 1A2YC 1AZFA 214LA 3P68A 1BWJA 1QUDA 2MECA 200LA 4L41A 5HLLA 1HSXA 4DD7A 2YBHA 4KPMA 4GN4A 1IP7A 2E8PA 1PQMA 4NGWA 209LA 123LA 211LA 4HJVA 4W94A 2BQCA 4PGJB 1H87A 3ZVQB 4I7PA 125LA 1DI3A 1LYDA 4H91A 1C69A 1QUGA 5F3XB 2I6ZA 2F2QA 2LYZA 1GFAA 4GCFA 3RUNA 4HTQA 4DT3A 4NL9C 4UWVA 1WQQA 127LA 3P65A 4NHSA 1KY0A 2F8KA 1L29A 1L20A 4WM1A 1LJGA 2OE7X 4NL9A 4LGKA 1AT6A 150LA 4N9RA 4Z41A 1CKGA 1L18A 2B6XA 3A6CY 3K2RA 5ILFA 4R6CA 2HEBA 1JKCA 3FI7A 1P56A 4I7KA 3NY8A 234LA 1HENA 1QT8A 1ZYTA 2BQJA 4TSCA 4PPOA 1QSQA 4YXCA 229LA 4OOOA 1B0DA 3G3VA 4FJRA 4PJZA 1P5CA 1V7TA 1LHJA 3C8QA 1L88A 1CTWA 1LZRA 4MHVA 3DN0A 3HU8A 1HMKA 1L26A 258LA 1CUQA 1I6SA 1L56A 118LA 1DI4A 1LGXA 1SQ2L 1CJ6A 1CV4A 2Q9DA 3A91A 2IGCA 4YEOA 1L71A 1T6VL 4EKQA 2LYMA 4NY5A 3P64A 1IR9A 3WU8A 4DAJA 1D6PA 4CHXA 4KXIA 1IR8A 180LA 4DKLA 4PJ2C 5LAGA 2ZYCA 1RJCB 1SX2A 1LSYA 245LA 3LYOA 213LA 3F8VA 5KXZA 1V38A 1G0LA 2C8OA 210LA 2HUBA 3M3UA 4II8A 4H9EA 3HBEX 4B4EA 1C45A 4I7MA 3L64A 4YENA 4DWXA 1G0JA 3LN2A 3A6BY 2HU3A 164LA 1LYZA 207LA 1LZDA 114LA 1L72A 4XYYA 256LA 3B0KA 1JTMA 4PRQA 3JR6A 4W55A 4WM4A 1L81A 3SB7A 1YAPA 262LA 1HFZA 1GB2A 1L11A 5DN5A 1CU6A 3ATOA 1WQRA 1HERA 1L70A 2Z38A 2C8PA 1IR7A 5F9XA 1BB6A 4W58A 5FEKA 254LA 1CV0A 2DKVA 3TXBA 1L59A 3WULA 5D5FA 4IAPA 4DYGA 4CFOA 5L1MA 4W51A 2KSOA 2YSSC 1B9OA 4N8ZA 3TXHA 3TXFA 3AZ4A 1B5UA 4X3BA 1CVKA 2BQHA 173LA 4WM5A 4RW1A 1XEPA 1L57A 4NHPA 2RB2X 3WU7A 1C08C 1GF7A 4HJZA 1UIAA 3W6AA 1UICA 4ARMB 3WXUA 1L55A 3HTFA 1B7NA 1CNSA 1DZBX 2H9KA 4LYBA 1C6DA 1IP1A 1P64A 3TMXA 4W53A 1VDSA 1OVHA 1LSAA 5KXTA 182LA 5HNCA 1C6QA 4MSTA 5L9JA 2B6YA 1L41A 4OOTA 1LSZA 2LZTA 215LA 3AZ6A 1GF3A 3SBBC 5KKJA 4WL7A 259LA 228LA 5E9RA 1GF0A 1L0JA 113LA 4W56A 1G0QA 1L09A 3N9CA 4QEQA 3B0IA 4WM2A 1B5WA 3CDOA 1LSFA 4RLMA 1REMA 1L30A 4TX7A 2DQDY 4MR1A 2W1MA 5DN4A 2K4PA 5APFA 1NKHA 151LA 3CDVA 5JRTA 2HUMA 3CDRA 3B0OA 1GB0A 184LA 4LT1A 1YKZX 5LVIA 1LJHA 1KW7A 4HTNA 4ETBA 5J8YA 109LA 1L23A 4TSBA 4S0WA 194LA 2EAOA 1L39A 1GAZA 2NWDX 2B6TA 1SLYA 2HULA 4DD1A 1L94A 4EKSA 1B7RA 131LA 230LA 3LZ2A 2B73A 135LA 3V2WA 1ZVYB 5F16A 3ZVQA 257LA 2A7FA 2LZ2A 3G3WA 2ZIKA 3HH6A 1X9XA 1GPQC 1IIZA 145LA 4LT0A 5HNLA 4P2EA 3D9AC 4EOFA 3TMVA 5KXOA 5F9UA 1NQIA 4WM6A 1L34A 1PZYA 1BGIA 5LVHA 3P4ZA 1HEMA 1L52A 2ZNWY 2ZYPA 2MEDA 107LA 2E8MA 3PDSA 1L51A 1UUZC 4OWCA 1JTPL 5LZMA 4WM3A 2DQIY 1VDTA 1GF6A 2VB1A 3K1RB 2MEAA 1IWVA 5LIOA 1L45A 3CDQA 1I1ZA 1B0XA 137LA 2Q0MX 1CKCA 154LA 2Y9UA 1QT7A 1YL1X 2D4KA 2YDGA 4YEMA 3LYZA 3QY4A 1CV5A 3DN8A 3WW5A 4NGZA 1UACY 3SB8A 3GXKA 162LA 2I25L 206LA 1JPOA 4H1PA 1BWHA 4E3UA 3EO5A 2BPUA 1L63A 1KW5A 2BQGA 3TADC 3E3DA 3C83A 149LA 1JSEA 188LA 3CT5A 1W08A 3TADA 3WPJA 1G0KA 3SN6R 3SEIA 1L85A 4LFPA 1G7LC 1L93A 142LA 1IY3A 1L87A 3A8ZA 4NGLA 2YBNA 1B5VA 1WQOA 1JEFA 156LA 1L47A 5KXSA 2B75A 4PZNA 1LKYB 1B7OA 4I7OA 1G7JC 2QARA 3TACB 1VATA 1C46A 3AB6A 115LA 1D3JA 120LA 1GFVA 4NHTA 199LA 3EXDA 3DMZA 119LA 4RQMA 1VDQA 2LZMA 4GN3A 3LZTA 4LDEA 4CJ2A 3TXGA 1L17A 4C5FA 1JKAA 147LA 1VEDA 3A95A 1IOTA 4H8ZA 4XJIA 1YILA 4H94A 1GFEA 1OP9B 1LOZA 1IORA 1C67A 5APEA 1C6PA 4RQNA 1IC7Y 1UA6Y 166LA 4N1CC 1G7IC 1GFJA 1FLWA 1XEKA 169LA 1LMQA 1L92A 2HUKA 1G07A 3SENA 1LI3A 2N5ZA 4HV1A 4GRVA 1L95A 1MLCE 2O4WA 1L33A 1CU3A 2KG5A 4NSIA 2GLEA 2KSOB 4OWEA 2RAZX 1C7PA 2B72A 4NFVA 5LVKA 1IP4A 2MEBA 2XBRA 2E8OA 1JHLA 1JTOL 1YQVY 2QB0B 2XJWA 1L80A 212LA 1BHZA 3SP3A 4B4IA 216LA 1L53A 5HQ1A 1GWDA 2H5ZA 5LINA 1OWZA 5KXWA 1JISA 1UCVA 1LJEA 1C6AA 2HEDA 248LA 3QE8A 4GN5C 4J1AA 1JSFA 1L98A 1EQEA 1L21A 2RB1X 1CV1A 4BAPA 1GB3A 3WH1A 1LZ8A 4NIJA 3BKHA 2ZILA 4H90A 1L64A 2BQKA 5I4XA 4HTKA 2QB1A 4Z3MA 4ZIXA 219LA 2OU9A 235LA 3GUMA 4W59A 217LA 4AQNA 4I7RA 2RBRA 1LGWA 3DMXA 3LZMA 3C8RA 1HNLA 2Z2EA 1L75A 126LA 1UIFA 4J1BA 1C6FA 1K28A 2F4GA 2FBBA 5FHWA 1AKIA 5FCPA 5I54A 178LA 1FKVA 3IDWA 1T8AA 1RFPA 4Z46A 2DQHY 1L38A 1LJJA 4ZPUA 1CX6A 2DKZA 6LYTA 4TUNA 3AW6A 1JI7A 3A34A 2ESEA 5KXRA 3TXEA 1REYA 1B7QA 3VWOA 1AM7A 1C6IA 1JTTL 1LSGA 3W6DA 1BVXA 1L0KA 5L3HA 252LA 1L44A 1QTCA 1GB7A 3B6LA 1G7HC 4A7DA 1GFHA 1ZWNA 1GE3A 1FLQA 1IOSA 4ZFPA 3CSRA 2XBSA 1WQPA 138LA 1G7MC 4H9IA 4DQ5A 4RW2A 1V85A 4J0LA 1TLAA 1LMPA 4N1EI 141LA 3FA0A 3UONA 2D4JA 1XSFA 4OWAA 4IATA 1IP3A 2HEFA 1KY1A 2DBTA 1LJ4A 3CT1A 1OVJA 1G0GA 3WYHA 4LYOA 2K60A 1AT5A 1C64A 1GBZA 1C43A 223LA 2EKSC 4DD9A 1JJ3A 1XEJA 1IWUA 4DD3A 4H9BA 146LA 1LYGA 3VW7A 1UIDA 2RBPA 3HH5A 3WMKA 3HH4A 2F44A 1GBWA 2BAAA 2BQMA 3RT5X 4LZMA 1L00A 3WVXA 2LCBA 243LA 1FDLY 3EMLA 1J1PY 1NMMA 1XGUC 1OUFA 4WG7A 4B1AA 192LA 2EQLA 1JTNA 4NG1A 5LXWA 2Z12A 2OTYX 4XENA 195LA 1CUPA 2Z37A 2E8NA 1L12A 1LSPA 4NWHA 1P2LA 159LA 1XEIA 5KXLA 3CDTA 1KIPC 1E8LA 1L76A 3WPLA 4EKPA 1B4FA 2QARB 1OUBA 1LKYA 3LHMA 4B49A 2WARA 3D4SA 1JKDA 5EBHA 3OE0A 2B7XA 4GLAA 1C60A 244LA 2D91A 157LA 1C6MA 1D0KA 241LA 237LA 5JENB 1GDWA 3CSZA 1L79A 1IWWA 5KKIA 1DKJA 1JUGA 4N5RA 2RAYX 1L04A 1GFTA 5LVGA 4OO9A 1LSEA 1XJUA 1N4FA 2OU8A 1L01A 233LA 1JKBA 1L15A 190LA 1D3NA 191LA 3H8MA 4HP0A 1LSDA 1L49A 4ARLA 1D6QA 4ML7A 1P36A 1CJ7A 4AGAA 176LA 1LYSA 4DDBA 5E4PA 1L69A 2KMDA 1INUA 2LC9A 3HH3A 3K3TA 5A3EA 1JITA 1LYJA 1EQ5A 224LA 2A4TA 2D4IA 2QB0A 220LA 4PZOA 2B6ZA 2BQNA 3AZ7A 1BB5A 1GFGA 4W57A 2RBSA 160LA 171LA 4OWBA 3DN2A 1L16A 4ETEA 1OV5A 3LYMA 1LZ9A 1T3PA 1F0WA 2BQAA 3TXDA 2ANVA 1FLUA 1LYEA 3HDEA 3FI5A 4G4CA 1UBZA 1GBSA 1LZ1A 3SBAA 5DLAA 1JQUA 1P2CC 4Z98A 174LA 226LA 1C63A 1HSWA 3TMUA 1IEEA 1ZV5L 2Q9EA 4GCBA 1LMNA 1IP5A 2DQEY 3J4GA 3OE9A 4PK0A 3IJVA 5I14A 1L02A 1L27A 3T6UA 1L05A 5JTIA 247LA 2ZIJA 4BS7A 1L28A 4AXTA 3HTDA 8LYZA 2O79A 5J8YC 5I5QA 3B72A 3GULA 3CB7A 1P7SA 3FADA 1KXWA 4EKRA 3WL2A 3G3BB 1C6JA 130LA 4UWNA 4EXMA 4NSJA 1PK1A 4NGKA 1DXSA 129LA 5B06A 1TDYA 1DYEA 3ATNA 1FKQA 2RBQA 3N9EA 4H9AA 3BQ7A 1SV0C 1LZTA 3A94A 175LA 5C6IA 1NDGC 4XJBA 4NGVA 3AGIA 1SV0A 3HTBA 2Y8PA 4K5YA 4QGZA 4PRUA 5JU5A 1L19A 3WVYA 2JV3A 1LZYA 4NHIA 1LHKA 1QTZA 3BS5A 1L68A 5KNIA 187LA 1SWYA 2MEIA 201LA 5APCA 208LA 4DQJA 4IS7A 7LYZA 1C6CA 2HEAA 1XGPC 1YIKA 5A3ZA 1QS9A 5KXNA 3HUKA 1L74A 1YAOA 4WLTA 3SB6A 1C6GA 3RNXA 240LA 1P37A 5FSTA 1SWZA 2ZWBA 1OUDA 1QSBA 2LHMA 1GE0A 2YBJA 4DC4A 2Z2FA 1QSAA 3P66A 5K7OA 3HILA 4NGOA 4HSFA 1WVVA 3FE0A 4XN6A 1CKDA 3DN1A 1L67A 1L60A 1L97A 4DD2A 5HMVA 4LFXA 3MGWA 1QT4A 1L36A 1LYIA 4I7QA 2B74A 1L61A 1LMTA 1B5ZA 1LKSA 1PQDA 1Z55A 1LHLA 4IASA 2AUBA 1L86A 153LA 3ZEKA 1LJKA 2F32A 1QUTA 172LA 1LGUA 2BQFA 2HTXA 1HEPA 1L54A 1L58A 2W1YA 4OW1A 3BKVA 4H92A 4GCDA 6LYZA 1ALCA 1IC4Y 1OUAA 3GUKA 3AJNA 1L84A 1L89A 1YKXX 4ARPA 4EPIA 185LA 183LA 1L13A 1V7SA 255LA 1G1WA 4M4OA 5ILCA 1VDPA 3WXTA 2B5ZA 4WG1A 2KIVA 250LA 2QARC 4NSGA 1LCNA 165LA 5C6LA 3DN3A 1PQIA 1NHBA 1IX0A 1RE2A 260LA 2BQOA 1C10A 5KXYA 2OTZX 1GDXA 2BQEA 1LJIA 4J7VA 1LW9A 1C65A 2CJLA 4GLVA 1WTNA 4ANRA 5IELA 1F6SA 1LMCA 144LA 2FE9A 1UIBA 4XJDA 2HU1A 1DPWA 3C7WA 2F47A 1C66A 1L25A 4DDAA 1HEQA 242LA 3C8SA 1L35A 4H9FA 3J6KA 1T8FA 2BQDA 1KIQC 1C6NA 1L83A 5KXKA 4ETAA 1QS5A 1L10A 1WQNA 1L82A 4DJHA 9LYZA 1HELA 5B59A 1NDMC 3KKAA 1UC0A 1XFPL 1RI8B 1EQ4A 4LDLA 1GB6A 2HECA 261LA 1LZCA 1C61A 5APDA 1SV4A 4RLNA 5KXMA 3HTGA 2IHLA 1LYYA 1GBYA 1NF5A 4EPFA 1OWYA 1REXA 2Z39A 1P2RA 1LHHA 3AGGG 4I7LA 1XGQC 1LI6A 3HT6A 2DKXA 1LZGA 4R0FA 3C7YA 1LJNA 3IWRA 5FELA 1WWUA 1H6MA 1REZA 246LA 1OUIA 1DYBA 2EPEA 2XTHA 1L96A 5I53A 1WTHA 3WU9A 1HEWA 3KAMA 4WLDA 1LTMA 1KIRC 6LZMA 1OUEA 155LA 2LYOA 167LA 152LA 4B0DA 1LYHA 2OEAX 1QDRA 1QIOA 1YROA 7LZMA 3DMVA 4WO9A 2CGIA 1GD6A 253LA 102LA 1Z1VA 1D3MA 4NHQA 1HMLA 2MEHA 4O34A 2BLXA 4TTDA 4WLYA 2ANXA 1PK1B 5II3A 5KY1A 1KXYA 5IHGA 1C6KA 1GB9A 1L03A 2RSCA 2IFFY 1GBXA 3HBHA 3W3EA 3AW7A 4G4HA 1HEOA 4H8XA 1UCOA 2D3DA 3V2YA 1IWZA 1B7SA 1LSMA 5D5CA 1QTKA 2EANA 5J7CA 3AGHA 1JWRA 1GEZA 3M18B 2GV0A 4ARQA 3BS5B 1KW4A 1NBZC 1YKYX 1G0PA 3SB5A 1L77A 1PS5A 4CFPA 1G1VA 4GBRB 3RZ4A 1RG6A 1O23A 3C82A 139LA 4EJ4A 1CX7A 1KNIA 3GUIA 198LA 4OWHA 3NY9A 4DD0A 1CJ8A 2X0AA 3DNAA 3TXKA 2BQIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LYJ A;  224L A;  2A4T A;  2QB0 A;  220L A;  4PZO A;  2B6Z A;  5LZM A;  1D2Y A;  1T97 A;  1L42 A;  2RBO A;  4W57 A;  2RBS A;  160L A;  3K1R B;  2Y9T A;  1L45 A;  112L A;  1OXJ A;  3CDQ A;  171L A;  3DN2 A;  1L08 A;  3PBL A;  1L16 A;  3OE6 A;  222L A;  3HUQ A;  1B0X A;  1OV5 A;  3PDS A;  137L A;  3NYA A;  2ANV A;  2Y9U A;  3C7Z A;  1LYE A;  3HDE A;  3FI5 A;  1QT7 A;  251L A;  4ARM A;  163L A;  3SBA A;  3DKE X;  1CV5 A;  3DN8 A;  3C80 A;  2B6W A;  1JQU A;  3HUA A;  3SB8 A;  174L A;  3QAK A;  162L A;  1D9W A;  206L A;  1QTH A;  226L A;  1C63 A;  1COK A;  1PK3 A;  1SXE A;  1CV6 A;  227L A;  2Q9E A;  1L63 A;  1QUH A;  1ZUR A;  4E97 A;  1KW5 A;  4LDO A;  3HT8 A;  1C68 A;  3TAD C;  3C83 A;  149L A;  1D3F A;  1C62 A;  3GUO A;  188L A;  3OE9 A;  4PK0 A;  5I14 A;  1L02 A;  1L27 A;  1WWV A;  3TAD A;  4W54 A;  1L05 A;  1G0K A;  5JTI A;  1L06 A;  1L24 A;  1QTD A;  3SEI A;  3SN6 R;  247L A;  1L85 A;  1G0M A;  1L93 A;  104L A;  142L A;  1L28 A;  1L87 A;  1CU5 A;  196L A;  2NTH A;  3HTD A;  232L A;  1LI2 A;  2O79 A;  3GUJ A;  5J8Y C;  4W52 A;  1X66 A;  3GUL A;  2OU0 X;  1P7S A;  3FAD A;  168L A;  156L A;  1L47 A;  1T8G A;  4EKR A;  1C6J A;  130L A;  2B75 A;  3HWL A;  4PZN A;  1F0M A;  1LKY B;  4I7O A;  1KS3 A;  4EXM A;  2QAR A;  3TAC B;  1QT5 A;  1QTV A;  115L A;  1D3J A;  2Z6B A;  2RH1 A;  1PK1 A;  2F3N A;  120L A;  2RBN A;  199L A;  1DXS A;  129L A;  3HU9 A;  249L A;  3DMZ A;  119L A;  4RQM A;  1DYE A;  2LZM A;  1LYF A;  3G3X A;  2RBQ A;  4LDE A;  1L17 A;  1L62 A;  3BQ7 A;  147L A;  1SV0 C;  231L A;  214L A;  175L A;  1QUD A;  200L A;  2LMR A;  1DYD A;  1C67 A;  2NTG A;  2E8P A;  1PQM A;  140L A;  1L43 A;  1SV0 A;  1OW5 A;  110L A;  209L A;  3HTB A;  123L A;  1C6P A;  211L A;  4RQN A;  4K5Y A;  1DYG A;  5JU5 A;  1L19 A;  2JV3 A;  166L A;  3HDF A;  4I7P A;  1C6L A;  1QTZ A;  3BS5 A;  125L A;  161L A;  5KNI A;  187L A;  1L68 A;  1SWY A;  1LYD A;  169L A;  1L92 A;  201L A;  1CU0 A;  2HUK A;  1C69 A;  1G07 A;  5F3X B;  3SEN A;  4IS7 A;  1QUG A;  1C6C A;  2F2Q A;  1C6B A;  1D2W A;  1LI3 A;  1QS9 A;  4GRV A;  3HUK A;  1L95 A;  3RUN A;  2O4W A;  1L33 A;  1CU3 A;  1L74 A;  3SB6 A;  2KG5 A;  1C6G A;  4NL9 C;  2OE9 X;  2GLE A;  2KSO B;  127L A;  240L A;  1P37 A;  2RAZ X;  1KY0 A;  2F8K A;  1L29 A;  1L20 A;  2B72 A;  2OE7 X;  4NL9 A;  2E8O A;  1SWZ A;  150L A;  2QB0 B;  1L18 A;  2B6X A;  1QSB A;  1L80 A;  212L A;  3K2R A;  2EAM A;  1L31 A;  1DYA A;  3HIL A;  216L A;  1L53 A;  2D8C A;  1P56 A;  4I7K A;  3NY8 A;  234L A;  1QT8 A;  1ZYT A;  2B70 A;  3OE8 A;  3DN1 A;  1OWZ A;  1L67 A;  1L60 A;  1QSQ A;  2L78 A;  1L97 A;  189L A;  4YXC A;  1UCV A;  1QT4 A;  1L36 A;  1LYI A;  229L A;  1C6A A;  1UQV A;  248L A;  3GUN A;  4I7Q A;  2B74 A;  1L61 A;  3DN4 A;  1LLH A;  1L98 A;  3C81 A;  3G3V A;  1PQD A;  4PJZ A;  1L21 A;  2RB1 X;  1CV1 A;  1P5C A;  158L A;  2KE7 A;  1L86 A;  1L07 A;  3C8Q A;  1L88 A;  1CTW A;  2F32 A;  4MHV A;  1PQK A;  172L A;  1L64 A;  1LGU A;  3DN0 A;  1L54 A;  3HU8 A;  1L58 A;  2QB1 A;  1L46 A;  1L26 A;  219L A;  258L A;  1CUQ A;  3GUK A;  2OU9 A;  235L A;  1I6S A;  1L56 A;  118L A;  1LGX A;  4YXA C;  1L84 A;  1L89 A;  1CV4 A;  2Q9D A;  221L A;  1C6T A;  3GUM A;  217L A;  4W59 A;  2IGC A;  4AQN A;  4ARP A;  4I7R A;  4EPI A;  1L71 A;  185L A;  2RBR A;  183L A;  1L13 A;  4EKQ A;  1C6E A;  1LGW A;  1OVK A;  3DMX A;  255L A;  3SB9 A;  3LZM A;  4DAJ A;  1G1W A;  1L14 A;  180L A;  1SSY A;  4DKL A;  2B6G A;  3C8R A;  197L A;  1PQO A;  1SX2 A;  2KIV A;  250L A;  1L40 A;  2QAR C;  3L2X A;  165L A;  245L A;  1L75 A;  126L A;  1CU2 A;  1C6F A;  1K28 A;  2RB0 X;  213L A;  3F8V A;  1V38 A;  1P3N A;  111L A;  178L A;  3IDW A;  1G0L A;  1G06 A;  1T8A A;  143L A;  3DN6 A;  1QTB A;  210L A;  3DN3 A;  1L38 A;  4I7J A;  1PQI A;  4ZPU A;  1NHB A;  260L A;  1LWK A;  1CX6 A;  2DKZ A;  1P46 A;  4I7M A;  3L64 A;  1L66 A;  1JI7 A;  2OTZ X;  1G0J A;  2ESE A;  164L A;  1LW9 A;  1L90 A;  1C6I A;  1C65 A;  1T6H A;  1L48 A;  103L A;  170L A;  114L A;  1L72 A;  1L0K A;  252L A;  1L44 A;  4I7N A;  1QUO A;  256L A;  1QTC A;  1JTM A;  1QT6 A;  3JR6 A;  144L A;  4W55 A;  4ARQ B;  2FE9 A;  1L81 A;  1ZWN A;  3SB7 A;  262L A;  1L11 A;  128L A;  3C7W A;  1L32 A;  2F47 A;  1CU6 A;  1L37 A;  1C66 A;  1L25 A;  238L A;  242L A;  3C8S A;  138L A;  1L35 A;  1L70 A;  3ODU A;  1V85 A;  4W58 A;  1TLA A;  3F9L A;  1T8F A;  3GUP A;  218L A;  1C6N A;  236L A;  141L A;  254L A;  1L83 A;  1CV0 A;  2LPE A;  1QS5 A;  1L10 A;  3FA0 A;  3UON A;  1L59 A;  1L82 A;  4DJH A;  181L A;  3HT7 A;  4IAP A;  3RZE A;  5L1M A;  4W51 A;  2KSO A;  1KY1 A;  1OYU A;  3KKA A;  1OVJ A;  1G0G A;  1CVK A;  2K60 A;  173L A;  2L5Y A;  4LDL A;  1C64 A;  261L A;  1DYC A;  1C61 A;  1XEP A;  1XJT A;  177L A;  1SV4 A;  223L A;  1L57 A;  2EAP A;  2RB2 X;  3HTG A;  1LWG A;  4YX7 C;  225L A;  4ARJ A;  146L A;  1LYG A;  4EPF A;  1OWY A;  1SX7 A;  3VW7 A;  4ARM B;  2RBP A;  1SXD A;  1B6I A;  3HH5 A;  1P2R A;  205L A;  3HH4 A;  2F44 A;  186L A;  148L E;  4I7L A;  1L55 A;  3HTF A;  1QT3 A;  122L A;  2O7A A;  1LI6 A;  4LZM A;  1L00 A;  1C6D A;  2LCB A;  3HT6 A;  1P64 A;  239L A;  4W53 A;  2DKX A;  243L A;  3C7Y A;  2DL0 A;  1OVH A;  3EML A;  1WWU A;  1L91 A;  182L A;  246L A;  1C6Q A;  2B6Y A;  1DYB A;  1L41 A;  1L96 A;  1PQJ A;  215L A;  3SBB C;  1L99 A;  1WTH A;  259L A;  2CUU A;  192L A;  1JTN A;  2OTY X;  3HT9 A;  6LZM A;  195L A;  155L A;  228L A;  167L A;  1CUP A;  2QKQ A;  152L A;  1LPY A;  1X40 A;  1L0J A;  113L A;  2E8N A;  1L12 A;  1LYH A;  2OEA X;  4W56 A;  1P2L A;  159L A;  4I7T A;  1G0Q A;  1L09 A;  3BS7 A;  7LZM A;  3CDT A;  1OV7 A;  3CDO A;  3DMV A;  253L A;  1L76 A;  1C6H A;  102L A;  1L30 A;  1Z1V A;  1D3M A;  2K4P A;  4EKP A;  151L A;  3CDV A;  5JRT A;  2HUM A;  1B4F A;  2QAR B;  1L50 A;  3CDR A;  1LKY A;  184L A;  3D4S A;  2ANX A;  1PK1 B;  3OE0 A;  2B7X A;  1KW7 A;  1DYF A;  2OE4 X;  1C60 A;  1C6K A;  5J8Y A;  109L A;  1L23 A;  1L22 A;  244L A;  1L03 A;  4S0W A;  157L A;  1C6M A;  2EAO A;  241L A;  237L A;  1L39 A;  1L79 A;  1SGG A;  2B6T A;  1L65 A;  2D3D A;  1L73 A;  2RAY X;  3V2Y A;  1L04 A;  2HUL A;  4I7S A;  1CV3 A;  1L94 A;  4OO9 A;  4EKS A;  2EAN A;  2YTU A;  1P6Y A;  1XJU A;  131L A;  230L A;  2B73 A;  1EPY A;  2OU8 A;  3V2W A;  4ARQ A;  3BS5 B;  1L01 A;  233L A;  1KW4 A;  257L A;  3G3W A;  1L15 A;  190L A;  1D3N A;  4NJ8 A;  191L A;  3H8M A;  1G0P A;  1L49 A;  3HH6 A;  1X9X A;  4ARL A;  3SB5 A;  145L A;  1P36 A;  1L77 A;  1G1V A;  1SSW A;  4GBR B;  1RG6 A;  3C82 A;  176L A;  3KKA C;  139L A;  4EJ4 A;  1CX7 A;  1KNI A;  3GUI A;  198L A;  1L34 A;  1L69 A;  1L52 A;  2KMD A;  3NY9 A;  2LC9 A;  3DNA A;  3HH3 A;  107L A;  2E8M A;  1L51 A;  108L A;  2ES6 A; 
#chains in the Genus database with same CATH topology
 2W55 A;  1BNO A;  1B7M A;  3SV3 A;  4DFM A;  1ZQW A;  1TVA A;  5B07 A;  2DQC Y;  2HHX A;  2KEY A;  2IHN A;  1D2Y A;  4P0P B;  2CPR A;  3JPQ A;  1LZA A;  2ZUD A;  1GEV A;  1T97 A;  3IHQ B;  2RBO A;  4YG2 A;  4ED8 A;  3ZDE A;  2Y9T A;  1JJ1 A;  1UT8 A;  3TFR A;  1OXJ A;  4ICA A;  1SKR A;  1L08 A;  4AYB C;  3OGU A;  2KKP A;  2W9C B;  222L A;  4E0D A;  4NV0 A;  2WAQ F;  2MEG A;  3NYA A;  5KXX A;  132L A;  3ZDB A;  1ZRM A;  4XAD A;  5L1I A;  1T4G A;  1LSN A;  4U3X B;  2W43 A;  2G4N A;  4NGI A;  2LYH A;  5KFL A;  3QEA Z;  1HHL A;  251L A;  3GXR A;  5CA7 A;  3OJP A;  4HPE A;  163L A;  2NRW A;  3LVV A;  1JIY A;  2M0N A;  3RAQ A;  5BOL A;  2B6W A;  2JGA A;  3L5K A;  1MN8 A;  5LA8 A;  4HJY A;  2YQE A;  3QAK A;  1HF4 A;  3A3Q A;  1F6R A;  1PK3 A;  5AIA A;  2K8A A;  1K5O A;  1SXE A;  4Q45 A;  1CV6 A;  4BAD A;  4EEN A;  3HT3 A;  3WKC A;  4YF2 A;  1ZUR A;  4LDO A;  1BPX A;  3ZVQ A;  4Q43 A;  4ECV A;  3HT8 A;  1M6Y A;  1BB7 A;  3WPK A;  193L A;  2XGQ A;  1UA1 A;  3UQ0 A;  1D3F A;  5KL1 B;  1B7P A;  1C62 A;  2BQB A;  1GE1 A;  4WO6 A;  3PX6 A;  3RU5 A;  5FDJ A;  2D6F C;  1SIJ A;  4LT2 A;  3OK0 A;  3PNC A;  1F5S A;  3ALR A;  7ICN A;  1L06 A;  1L6N A;  4RQ5 A;  4F5Q A;  3Q8K A;  4O9M A;  3KD3 A;  4YOP A;  5KFJ A;  4DDC A;  232L A;  2XGP A;  1LI2 A;  3A0H U;  3WKE A;  4W52 A;  3M8R A;  2OU0 X;  1LSC A;  4EMN A;  5J0X A;  2BZF A;  4I27 A;  1T8G A;  4F8R A;  3PW5 A;  3HWL A;  4GCC A;  1QTE A;  1ZD2 P;  1KS3 A;  2W1L A;  3HFM Y;  4WJ3 B;  1C20 A;  1FBI X;  3SAH A;  3NTU A;  2RH1 A;  2F3N A;  2RBN A;  5LAF A;  5L1K A;  4CGZ A;  4NSH A;  1W6Z A;  249L A;  4DQS A;  4DSF A;  4ET8 A;  5IIO A;  1NK7 A;  4KLM A;  4LYC A;  4N0J A;  1LYF A;  1NJX A;  1QCK A;  2OXO A;  2DPI A;  1L62 A;  2HBK A;  3IG5 A;  1Q8K A;  2DQA A;  231L A;  2AH5 A;  3TXI A;  3A96 A;  2LMR A;  1DPX A;  1LJF A;  3EYZ A;  1IOQ A;  1DYD A;  4PPX A;  1FN5 A;  2NTG A;  3C1Z A;  1HC0 A;  140L A;  1L43 A;  1OW5 A;  4ET9 A;  110L A;  1TCY A;  2HHS A;  3WKA A;  4DQR A;  2WAQ C;  2WF5 A;  4Y2X A;  5EWG A;  1DYG A;  2W3S A;  1NZB A;  3JPN A;  1VFB C;  1D0L A;  3HDF A;  2HBM A;  5T14 A;  4NGY A;  1C6L A;  5KFR A;  1NK5 A;  8ICN A;  161L A;  5ALG A;  2I9G A;  5CWR A;  1BWI A;  8ICA A;  3T5K A;  1PVP A;  1CU0 A;  2JXJ A;  3Q8M A;  7ICT A;  1U48 A;  1SWW A;  3DEE A;  1C6B A;  1D2W A;  1NKC A;  4NGJ A;  1KFT A;  8ICG A;  2UVR A;  1A77 A;  4LYT A;  3RJJ A;  3TAQ A;  1DK2 A;  3RB3 A;  2OE9 X;  1Q3U A;  2W1X A;  8ICM A;  5B1G A;  2UVV A;  1ZQL A;  1A0P A;  4TQS A;  4WOA A;  3T5L A;  1JJ0 A;  4MFF A;  1GFK A;  4LYZ A;  4QIW F;  4OJP A;  1V97 A;  1YAN A;  1GXX A;  4H8Y A;  4J9O A;  2KFZ A;  8ICC A;  1SZH A;  1QSS A;  2EAM A;  4C8M A;  1S97 A;  1L31 A;  2G4Q A;  5EE9 A;  1DYA A;  4OD0 A;  1K1S A;  1GFR A;  2D8C A;  1CJ9 A;  1QQY A;  4GC7 A;  3Q8L A;  4Y2Y A;  1LJ3 A;  4LZT A;  1V9P A;  3H8S A;  5KT2 A;  2W7P A;  4NLN A;  3KZI U;  1ZQJ A;  2B70 A;  3EW9 A;  3OE8 A;  5ALI A;  3MGH A;  2L78 A;  189L A;  4I0C A;  5KG4 A;  3JPR A;  1A4V A;  1UQV A;  3GUN A;  3N9A A;  4ED6 A;  7ICL A;  4QZG A;  3DN4 A;  5DDY A;  1LLH A;  1L8O A;  4C4S A;  3C81 A;  5LYT A;  3LYS A;  5J0S A;  4H9H A;  4KX5 A;  158L A;  2KE7 A;  3RB4 A;  2LBO A;  5ALY A;  1L07 A;  3FYH A;  4KL7 A;  3D2N A;  1GHL A;  4P4P A;  4IJ4 A;  3AM9 A;  1PQK A;  4QDN A;  5LVJ A;  1L46 A;  4MCK A;  4XQ8 A;  3A93 A;  2F2N A;  2CWI A;  2KVS A;  1LYO A;  4YXA C;  2IMW P;  7ICM A;  4LJX A;  221L A;  2WHE A;  1C6T A;  1GB5 A;  1LSB A;  4PGX A;  3W6C A;  5ALE A;  1BQL Y;  1IWX A;  1C6E A;  1OVK A;  3E2E A;  3SB9 A;  4I8S A;  4B9U A;  3RB6 A;  3PX4 A;  4F5P A;  2B6G A;  1DI5 A;  1L14 A;  1LZ4 A;  4MF2 A;  1SSY A;  2FBD A;  197L A;  1ZVH L;  1J1X Y;  1PQO A;  1J1O Y;  2XI9 A;  1GB8 A;  3CT0 A;  3ZD8 A;  1L40 A;  3L2X A;  5DG8 A;  2FYC A;  134L A;  1ZQK A;  1IP6 A;  1CU2 A;  1IWT A;  3C28 A;  2XCA A;  4C4R A;  2RB0 X;  3ZD9 A;  1CKH A;  3TXJ A;  5M1Y A;  1P3N A;  111L A;  1WVU A;  3QNG A;  1QLN A;  2D6B A;  4B9V A;  1G06 A;  2IOF K;  143L A;  1NJW A;  3DN6 A;  4X5V A;  1D9D A;  1LMA A;  1QTB A;  1ECW A;  4B9N A;  4I7J A;  5AKL A;  3C2M A;  1VAU A;  1LWK A;  4R64 A;  1P46 A;  1HEK A;  2PI4 A;  4QZE A;  1L66 A;  3RH4 A;  2BLY A;  133L A;  9ICV A;  2G06 A;  1XWL A;  4QIW C;  1L90 A;  1S0O A;  1T6H A;  2H3F A;  3AQE A;  4WMG A;  1L48 A;  2ISP A;  103L A;  170L A;  3UMG A;  4QY9 A;  1X9W A;  1QTM A;  4YM8 A;  3C2K A;  4U6P A;  4I7N A;  1QUO A;  5HMM A;  1Z00 B;  2ZUC A;  1QT6 A;  3A92 A;  4ARQ B;  4KLQ A;  1GF4 A;  4Z6D A;  5F14 A;  1QDT A;  3EBA B;  5KFQ A;  2ODG A;  3W6B A;  3HBD A;  3HPO A;  128L A;  5KFO A;  1L32 A;  5KFC A;  5HML A;  1L37 A;  1TAM A;  2KZ3 A;  238L A;  1LZB A;  3PY8 A;  2YBL A;  4H93 A;  4Q44 A;  2F4A A;  3EMS A;  3ODU A;  4O0I A;  4BJQ A;  4YMM A;  9ICP A;  4TWS A;  2KD1 A;  4C7Z A;  3F9L A;  1NHE A;  4IC9 A;  3GUP A;  1CKF A;  1C7Y A;  218L A;  8ICU A;  5KFB A;  236L A;  1PZN A;  4M6D A;  2LPE A;  2ZNX Y;  3QU2 A;  3WUM A;  4LT3 A;  5KJ9 A;  5KAI U;  2ZUB A;  2BPF A;  181L A;  3HT7 A;  2EIZ C;  4FDY A;  2Z19 A;  4YP3 A;  3RZE A;  5B05 A;  3V6J A;  1BVK C;  1IVM A;  4O3P A;  1FLY A;  2HOF A;  1QSW A;  1OYU A;  4C80 A;  4YMN A;  3UXN A;  1GBO A;  3H8W A;  4P0P A;  3SMV A;  4XJF A;  1MQ3 A;  9ICH A;  2L5Y A;  2FPM A;  3MR2 A;  2BQL A;  1GF9 A;  2XQO A;  5I4W A;  1ZOL A;  1TK5 A;  2YBM A;  2KJ8 A;  3ZDA A;  1XGT C;  1DYC A;  1LPI A;  3CQL A;  1XJT A;  4P4O A;  177L A;  2Z18 A;  4Q8F A;  2EAP A;  3AYQ A;  1LWG A;  4YX7 C;  3O0F A;  1HFX A;  225L A;  4ARJ A;  3N4M B;  1SX7 A;  1KQQ A;  3CW2 C;  4PHE A;  4ED0 A;  1ZQB A;  7ICO A;  1OUJ A;  1SXD A;  1B6I A;  2QLT A;  4DS4 A;  1U47 A;  4DL3 A;  3SI8 A;  1LZ6 A;  1LZ5 A;  1OUH A;  3MDC A;  2G4P A;  205L A;  5B1F A;  2DF4 B;  186L A;  148L E;  1UHU A;  3CSQ A;  1QT3 A;  122L A;  2H3I A;  2O7A A;  3V7L A;  3H0M B;  7ICR A;  1B5X A;  4HV2 A;  4W96 A;  3TMW A;  4QZ8 A;  1KDH A;  4I2D A;  239L A;  1I20 A;  1Y88 A;  2E5S A;  2DL0 A;  9ICF A;  1D0M A;  3F6Z A;  1Z19 A;  1L91 A;  5GTH U;  4CGE A;  3WUN A;  1OUG A;  1WQM A;  2MRL A;  4G49 A;  1PQJ A;  3D3D A;  3RRH A;  2E3T A;  2R8J A;  4ZEE A;  4YMO A;  1FIQ A;  1RCM A;  4DQ7 A;  1EL1 A;  1L99 A;  3WW6 A;  2CUU A;  1WTM A;  4YXJ A;  5IDD A;  4DEZ A;  9ICU A;  3HT9 A;  4YVZ A;  1UIG A;  5T3F A;  5LA5 A;  4UAW A;  1L3T A;  4EYI B;  2QKQ A;  3RW8 A;  1ZQT A;  1L7M A;  4UAU A;  5J2A A;  1LVH A;  1X40 A;  1LPY A;  1YL0 X;  2HEE A;  3GV7 B;  3IP4 B;  3QZ7 A;  4G9S A;  3NVV A;  4UB4 A;  4I7T A;  5DQI A;  1B5Y A;  2XY7 A;  4FBT A;  2YBI A;  3BS7 A;  2HBJ A;  1OV7 A;  1KBU A;  4NEB A;  2CDS A;  3MR5 A;  1YT3 A;  2MEF A;  1C6H A;  2LI6 A;  1OQM A;  1BGX T;  2ZQ3 A;  4QZB A;  1OUC A;  2HHW A;  5HMJ A;  1L50 A;  3ED5 A;  1GE2 A;  1ZD4 A;  4XJG A;  2Y1I A;  3RB0 A;  4KX3 A;  2FYD A;  1DYF A;  2OE4 X;  2XY5 A;  1B7L A;  4JK1 A;  1L22 A;  1GF5 A;  1DKK A;  3LYT A;  1YAQ A;  2UVU A;  3OJS A;  2WFA A;  4KMO B;  1SGG A;  4GXK A;  1L65 A;  1L73 A;  1BPD A;  1KTQ A;  3A67 Y;  4I7S A;  1CV3 A;  8ICT A;  5F81 A;  4IR1 A;  4K4I A;  4K4G A;  4EEY A;  5KXP A;  2YTU A;  1P6Y A;  4RQ6 A;  4PHI A;  3V6K A;  1GAY A;  1EPY A;  2FPK A;  5L3I A;  5AM5 A;  2JZB A;  4JWN A;  3AZ5 A;  1ZQQ A;  4ETC A;  4NLG A;  4NJ8 A;  4ECS A;  4B4J A;  1JXE A;  1RPL A;  4ECU A;  5DM9 A;  5ALH A;  4RQ1 A;  1RXV A;  5I4Y A;  4F71 A;  1LHM A;  1LZS A;  3T3F A;  4IR9 A;  1TKD A;  2DQJ Y;  1SSW A;  3WUA A;  3ETR A;  2RDI A;  2FMS A;  3N7P D;  3IJU A;  2HBL A;  1ZQC A;  3KKA C;  2A7D A;  5KFT A;  3WK6 A;  3KHG A;  3I76 A;  5CR0 A;  2P6R A;  4WLX A;  2ATL A;  4DSJ A;  1ZJM A;  2ZXH A;  4KT3 A;  1IC5 Y;  1ZMY L;  4IRD A;  4WL6 A;  9ICB A;  5C6J A;  108L A;  2ES6 A;  5HHI A;  1LZN A;  1GXV 2;  3PO4 A;  1TAY A;  3GDX A;  4RDS A;  1LMO A;  4RT2 A;  3QXG A;  3ISD A;  2R18 A;  1L42 A;  1LKR A;  5AMY A;  2PC2 A;  3CNH A;  4IL6 U;  3MBY A;  4FS1 A;  2RQ5 A;  4QZI A;  3W6E A;  4D9Z A;  4FZL A;  112L A;  2ZIU A;  4UBB A;  1GFU A;  5LYM A;  5D4B A;  2IBK A;  2KZM A;  4AP9 A;  4F5R A;  3PBL A;  5KG5 A;  3OE6 A;  3HUQ A;  1BB4 A;  1UIE A;  8ICW A;  1IP2 A;  5KFN A;  9ICL A;  3MGI A;  5TIS U;  2DQF C;  3A90 A;  4UWU A;  1KXX A;  1TEW A;  3C7Z A;  5J2B A;  2PFQ A;  4J9M A;  4M9G A;  2ZQ4 A;  4ARM A;  4K4H A;  4Y2R A;  4LYM A;  3DKE X;  3C80 A;  4C3W A;  4GLX A;  3HUA A;  1T3Q A;  1D9W A;  3T36 A;  1D9U A;  1DK3 A;  4GCE A;  1IY4 A;  4HPI A;  1QTH A;  5DL9 A;  5LYZ A;  1COK A;  4G4B A;  1LZE A;  2OHF A;  4BAF A;  227L A;  4NWE A;  4ETD A;  1IWY A;  5A0L A;  2AGO A;  5J0Q A;  1LHI A;  1HFY A;  4FZN A;  1QUH A;  1GE4 A;  4Y2Q A;  4E97 A;  1NK0 A;  3R9K A;  7ICS A;  2AU0 A;  1LAA A;  3NVW A;  3MFH A;  1C68 A;  2MEE A;  3A3R X;  3MR6 A;  3V7J A;  1DXJ A;  4R63 A;  1QUS A;  5KFI A;  1B2K A;  4RUC A;  2I26 L;  3GUO A;  4C8L A;  1I56 A;  2E1F A;  1H38 A;  8ICB A;  4YN4 A;  1WWV A;  1N60 A;  3N7S C;  4XJH A;  4W54 A;  1L24 A;  2DQG Y;  1DQJ C;  3W6F A;  1QTD A;  1MEL L;  2HHT A;  1G0M A;  4H9C A;  104L A;  3M6K A;  5KG3 A;  1CU5 A;  196L A;  1XGR C;  2NTH A;  3GUJ A;  1BB3 A;  3ULR A;  1X66 A;  1F10 A;  1GF8 A;  2ZTC A;  1NBY C;  2YVB A;  4I2J A;  5IIN A;  2KIC A;  8ICF A;  168L A;  4I29 A;  4IQV A;  3I1Y A;  2JR5 A;  1F0M A;  4IQU A;  1SL1 A;  3QU5 A;  1QT5 A;  4DL2 A;  1QTV A;  1UIH A;  1LB2 B;  2F30 A;  2Z6B A;  4C8O A;  3TKA A;  2KV2 A;  3C29 A;  3WK8 A;  1SKS A;  1S9F A;  4NG8 A;  1ZQR A;  1YAM A;  3CRX A;  2H9J A;  4O3M A;  1IOC A;  1S8O A;  3H40 A;  3HU9 A;  5AK5 A;  1TBY A;  5ALN A;  3UM9 A;  2KIW A;  1NWG A;  3RR8 A;  3G3X A;  1IO5 A;  2YY6 A;  3SR6 A;  1AQ6 A;  1A2Y C;  3TAP A;  2MA1 A;  1AZF A;  214L A;  3P68 A;  1BWJ A;  1QUD A;  2MEC A;  200L A;  4L41 A;  5HLL A;  1HSX A;  4DD7 A;  2YBH A;  1IG6 A;  2VA8 A;  4KPM A;  4GN4 A;  4Z6F A;  3G6Y A;  4OO1 J;  1IP7 A;  2E8P A;  4CDG A;  1PQM A;  4NGW A;  209L A;  123L A;  211L A;  3NAS A;  4HJV A;  4W94 A;  2BQC A;  4PGJ B;  1H87 A;  8ICJ A;  2NRZ A;  1PUZ A;  4RQ0 A;  2W9A A;  4I7P A;  3ZVQ B;  125L A;  1DI3 A;  1LYD A;  5J2F A;  4H91 A;  1C69 A;  1QUG A;  5F3X B;  2I6Z A;  9ICW A;  2RDJ A;  2F2Q A;  3D2S A;  2LYZ A;  3QE9 Y;  2CXY A;  1S0N A;  1ZJN A;  1ZQM A;  4EBD A;  4YXM A;  1GFA A;  4GCF A;  1IIP A;  5ALW A;  3RUN A;  5HHH A;  4HTQ A;  1Q46 A;  2YB1 A;  4DT3 A;  1SB3 C;  4NL9 C;  1A76 A;  4UWV A;  2BHN A;  1WQQ A;  3Q8P B;  127L A;  3P65 A;  1A6S A;  4DOC A;  4NHS A;  1KY0 A;  2F8K A;  3G6X A;  2ISO A;  1L20 A;  1L29 A;  2NRT A;  4WM1 A;  2G07 A;  1LJG A;  2OE7 X;  4NL9 A;  4US9 A;  2BCQ A;  4LGK A;  2OEH A;  1AT6 A;  150L A;  4N9R A;  4Z41 A;  1CI4 A;  3LDA A;  1CKG A;  3V72 A;  3GIL A;  1L18 A;  2B6X A;  7ICJ A;  1D8Y A;  3HRD D;  3A6C Y;  3K2R A;  5ILF A;  4ECQ A;  4ELV A;  1L5U A;  2W9B B;  4R6C A;  2HEB A;  4RPZ A;  1JKC A;  3FI7 A;  4O3Q A;  2ASL A;  1P56 A;  4I7K A;  4B9T A;  5KFE A;  3NY8 A;  1RXW A;  234L A;  1HEN A;  1QT8 A;  1ZYT A;  2BQJ A;  4TSC A;  4PPO A;  1QSQ A;  3TAR A;  1SL2 A;  4YXC A;  2W03 A;  4EEK A;  1GO3 F;  9ICK A;  229L A;  4R8U B;  5L1L A;  2W11 A;  4OOO A;  3HW8 A;  3AL0 B;  4FFD A;  2A3V A;  2VJ4 A;  7ICG A;  1B0D A;  2YMM A;  3G3V A;  4FJR A;  4PJZ A;  4QWD A;  1YZ7 A;  2G08 A;  3N97 B;  7ICV A;  1P5C A;  1V7T A;  1XSP A;  1WUD A;  5ALK A;  4YR0 A;  4F91 B;  1LHJ A;  5KL8 B;  1L88 A;  1CTW A;  3C8Q A;  5AKX A;  1LZR A;  4TUQ A;  4MHV A;  2HHQ A;  3UQ2 A;  2W3R A;  2NRV A;  5KFG A;  3F2C A;  3DN0 A;  3BQT A;  3HU8 A;  1HMK A;  2HW3 A;  1L26 A;  258L A;  1CUQ A;  5ALJ A;  4YR3 A;  1I6S A;  1L56 A;  3M8S A;  118L A;  1DI4 A;  1LGX A;  3G6V A;  3RJE A;  3RJG A;  1CJ6 A;  1CV4 A;  3OTQ A;  4G3I A;  1SQ2 L;  2Q9D A;  3A91 A;  2HI0 A;  2IGC A;  4YEO A;  1L71 A;  1T6V L;  4EKQ A;  2LYM A;  4NY5 A;  3P64 A;  3MDA A;  3HWT A;  1IR9 A;  3WU8 A;  4DAJ A;  9ICO A;  4MF8 A;  1D6P A;  4CHX A;  4KXI A;  1IR8 A;  3AMZ A;  180L A;  4DKL A;  4PJ2 C;  4NLK A;  3M9O B;  5LAG A;  5L9X A;  2ZYC A;  1RJC B;  1SX2 A;  4QZ9 A;  1L7O A;  1LSY A;  4G9B A;  3GU3 A;  2FI1 A;  245L A;  5DBC A;  1JMS A;  3RBE A;  3LYO A;  2CN1 A;  5CP2 A;  213L A;  4DFP A;  2BQU A;  3F8V A;  5KXZ A;  1V38 A;  2F1J A;  1G0L A;  3K4G A;  5ALU A;  1ZQS A;  2C8O A;  210L A;  2HUB A;  3M3U A;  3WKD A;  4II8 A;  1OUQ A;  4C8N A;  4H9E A;  3HBE X;  4B4E A;  1C45 A;  4I7M A;  3L64 A;  4YEN A;  4DWX A;  1G0J A;  3LN2 A;  2F77 X;  3A6B Y;  2I6X A;  3PSI A;  2HU3 A;  164L A;  5DKW A;  2H3V A;  5KFU A;  1LYZ A;  4O5E A;  4BX9 C;  207L A;  2HDO A;  3UXO A;  4RUA A;  1LZD A;  3WU2 U;  1PVQ A;  114L A;  4PL2 A;  5D49 A;  1ZQI A;  1L72 A;  4XYY A;  4KLI A;  5AKY A;  4DO9 A;  256L A;  3B0K A;  1JTM A;  3HKZ F;  1SKW A;  4C0Z A;  4PRQ A;  3JR6 A;  4W55 A;  1QQ7 A;  2ZJ5 A;  4WM4 A;  3UPQ A;  4YD1 A;  4ECW A;  2JZB B;  1L81 A;  3SB7 A;  4DFJ A;  1YAP A;  262L A;  1HFZ A;  1GB2 A;  1L11 A;  5DN5 A;  1T94 A;  4IRK A;  5ALM A;  4GFJ A;  8ICI A;  5EWF A;  1CU6 A;  3ATO A;  5FP0 A;  1WQR A;  4OJ5 A;  1HER A;  1L70 A;  2Z38 A;  3ETL A;  5AK3 A;  1XSL A;  2C8P A;  4KLG A;  1NZP A;  1VLB A;  1IR7 A;  5KFY A;  3NGD A;  1BB6 A;  4PHA A;  1WCN A;  4W58 A;  5F9X A;  1L8L A;  4DL7 A;  4O3S A;  5FEK A;  5J0O A;  254L A;  1CV0 A;  2E1E A;  2DKV A;  4M9J A;  3BZC A;  5BPC A;  3TXB A;  4OJO A;  4BWM A;  1L59 A;  2EH9 A;  2N1R A;  4NY8 A;  2BQ3 A;  3WUL A;  2GWS A;  5AKI A;  3QUQ A;  3SAF A;  2M9N A;  3H0R B;  5D5F A;  4IAP A;  4DYG A;  4CFO A;  4M04 A;  4DL4 A;  4Y2T A;  5L1M A;  4W51 A;  2KSO A;  2YSS C;  2R8G A;  1B9O A;  4N8Z A;  3EUB 2;  3TXH A;  4NLB A;  3TXF A;  3AZ4 A;  4QNL A;  1B5U A;  4X3B A;  2AQ4 A;  5KFV A;  1CVK A;  2BQH A;  173L A;  4WM5 A;  3OPX A;  2ZIU B;  1CRX A;  1Z1B A;  4RW1 A;  1XEP A;  2YX8 A;  5TZV A;  4F72 A;  5CEH A;  4DFD A;  1L57 A;  4NHP A;  2RB2 X;  3WU7 A;  1C08 C;  3KBB A;  1GF7 A;  1FO4 A;  4NLZ A;  4ED2 A;  3M9M B;  4HJZ A;  1UIA A;  4J9N A;  8ICK A;  3FC4 A;  3W6A A;  1UIC A;  9ICG A;  4ARM B;  3WXU A;  5AI4 A;  5III A;  1L55 A;  3HTF A;  5AKJ A;  1B7N A;  1CNS A;  1DZB X;  2H9K A;  2JRZ A;  1KN5 A;  4LYB A;  2BCV A;  1C6D A;  5J0R A;  1IP1 A;  1P64 A;  3AU6 A;  3TMX A;  4W53 A;  4O3R A;  3SYZ A;  2EZZ A;  1HUO A;  1VDS A;  4ED7 A;  2BKE A;  4KLH A;  4ZOH C;  1OVH A;  1LSA A;  5KXT A;  4NLC A;  182L A;  5HNC A;  2G5I B;  1C6Q A;  4MST A;  5L9J A;  2B6Y A;  7ICF A;  2OM6 A;  1L41 A;  2LYA A;  3N28 A;  1B22 A;  2XO7 A;  4OOT A;  1LSZ A;  2LZT A;  1BPB A;  2XIC A;  215L A;  3AZ6 A;  4DLE A;  1XC9 A;  1GF3 A;  3SBB C;  5KKJ A;  4WL7 A;  259L A;  2XY6 A;  1KKX A;  4J9L A;  5HR6 A;  1ZQN A;  1RZT A;  228L A;  5E9R A;  3HKZ C;  4DQQ A;  1GF0 A;  1L0J A;  113L A;  4BWJ A;  2W54 A;  3WK4 A;  4YFK A;  4W56 A;  1L7N A;  4I2H A;  5J2H A;  1G0Q A;  1L09 A;  4NWI A;  3T79 A;  3N9C A;  4QEQ A;  5E79 U;  4F2S A;  3B0I A;  4WM2 A;  1B5W A;  3CDO A;  5EOZ A;  3RJH A;  5J29 A;  1LSF A;  4RPX A;  4RLM A;  1REM A;  4RQ8 A;  1Q3V A;  2FLN A;  1L30 A;  2BCS A;  4TX7 A;  2DQD Y;  4MR1 A;  2W1M A;  5DN4 A;  2K4P A;  5APF A;  1NKH A;  151L A;  3CDV A;  5JRT A;  2HUM A;  2KJ5 A;  3CDR A;  4Y2V A;  3B0O A;  1KLN A;  1N2X A;  1GB0 A;  2Y1J A;  184L A;  3RAX A;  4LT1 A;  1YKZ X;  1NJZ A;  5LVI A;  1LJH A;  1KW7 A;  3H4B A;  4HTN A;  4ETB A;  2MAX A;  5J8Y A;  109L A;  1L3U A;  1L23 A;  4TSB A;  5KT3 A;  4S0W A;  194L A;  2P35 A;  3PW4 A;  5KFK A;  2EAO A;  2XID A;  5DGB A;  1L39 A;  5J2D A;  1GAZ A;  1B43 A;  2NWD X;  3ICX A;  2B6T A;  1SLY A;  4KTQ A;  1QQ6 A;  4DQP A;  2KNJ A;  2HUL A;  4F5O A;  4I2F A;  5AM2 A;  4DD1 A;  1L94 A;  3D6J A;  4EKS A;  1JX4 A;  2V4R A;  1B7R A;  5KG0 A;  3PSF A;  131L A;  230L A;  3LZ2 A;  3RH5 A;  2B73 A;  2RLT A;  135L A;  3V2W A;  2KHQ A;  5ALP A;  1ZVY B;  5F16 A;  5ALZ A;  257L A;  2A7F A;  2LZ2 A;  3G3W A;  4PGY A;  2VA3 A;  5KFA A;  2ZIK A;  3C1Y A;  1BPY A;  3QZ8 A;  1XSN A;  3HH6 A;  1X9X A;  1GPQ C;  2G5H B;  1IIZ A;  145L A;  4LT0 A;  3HJE A;  3KZX A;  5HNL A;  4EEL A;  3GIM A;  5C5J A;  4P2E A;  5DB9 A;  3D9A C;  4EOF A;  3TMV A;  5KXO A;  4JV0 A;  5F9U A;  3GIK A;  1NQI A;  4WM6 A;  4CCH A;  1L34 A;  4PHD A;  1BGI A;  1PZY A;  5LVH A;  3MC1 A;  3P4Z A;  1HEM A;  1L52 A;  2ZNW Y;  5KG6 A;  2ZYP A;  2MED A;  2J6S A;  107L A;  3SAG A;  5J2C A;  2E8M A;  3PDS A;  4J9Q A;  2ASD A;  1L51 A;  1X9M A;  3GII A;  3RR7 A;  3NRZ A;  1UUZ C;  4OWC A;  1JTP L;  5LZM A;  3SZ2 A;  4WM3 A;  3PZP A;  2DQI Y;  2W9B A;  9ICR A;  1VDT A;  4UQG A;  1GF6 A;  3GV5 B;  2VB1 A;  3K1R B;  4HAI A;  2MEA A;  3ISB A;  1IWV A;  5LIO A;  2XVT A;  1L45 A;  1HUZ A;  3CDQ A;  1I1Z A;  1N62 A;  3K1Z A;  4UAT A;  3RF9 A;  1B0X A;  4KMU A;  137L A;  2KZZ A;  5EWE A;  1XNS A;  2Q0M X;  1CKC A;  2W8K A;  3IRU A;  154L A;  1WG8 A;  4Y2S A;  1UT5 A;  2Y9U A;  3PR5 B;  3PO5 A;  4R8U A;  1JN3 A;  1QT7 A;  2DPJ A;  1YL1 X;  2D4K A;  3QUB A;  2YDG A;  2BCR A;  4YEM A;  1X42 A;  3LYZ A;  3QY4 A;  4DF8 A;  1CV5 A;  3H0L B;  3DN8 A;  3WW5 A;  4NGZ A;  4KIT B;  1UAC Y;  3WK9 A;  3SB8 A;  4USA A;  4JWM A;  9ICI A;  3F5E A;  4UB6 U;  3GXK A;  162L A;  5KTQ A;  2I25 L;  206L A;  1JPO A;  5CJ7 A;  2JMG A;  4H1P A;  4US8 A;  1BWH A;  5B5E U;  4E3U A;  5J2I A;  2IA6 A;  3EO5 A;  2PXI A;  2BPU A;  1L63 A;  1KW5 A;  5ALX A;  2BQG A;  4RQ3 A;  3TAD C;  3E3D A;  4B9S A;  3C83 A;  149L A;  4ZH4 A;  5ALS A;  3PSP A;  1JSE A;  4P0Q A;  188L A;  2AQ0 A;  9ICX A;  1LV5 A;  3CT5 A;  3BQ2 A;  3AQF A;  1W08 A;  3TAD A;  3WPJ A;  4F5N A;  1G0K A;  4DOA A;  3SEI A;  3SN6 R;  1L85 A;  4LFP A;  4F92 B;  1G7L C;  1L93 A;  142L A;  1IY3 A;  1L87 A;  3A8Z A;  4NGL A;  2BGW A;  4F4Y A;  1ZQZ A;  2YBN A;  7ICP A;  1B5V A;  2LM4 A;  4ACO A;  4ECX A;  1WQO A;  1JEF A;  156L A;  1L47 A;  5KXS A;  2B75 A;  4YQW A;  4PZN A;  1LKY B;  1B7O A;  4I7O A;  1G7J C;  2QAR A;  3TAC B;  1TAU A;  5ALV A;  1VAT A;  1C46 A;  3AB6 A;  115L A;  1D3J A;  5AIC A;  2V4Q A;  8ICH A;  120L A;  1GFV A;  1TK0 A;  4NHT A;  4JMU A;  199L A;  3EXD A;  3DMZ A;  2ASJ A;  5DBA A;  4RQM A;  4FO6 A;  119L A;  8ICL A;  1VDQ A;  3MAB A;  3BQ0 A;  2LZM A;  4GN3 A;  1COO A;  3LZT A;  4LDE A;  4CJ2 A;  3TXG A;  1L17 A;  4R66 A;  4C5F A;  1JKA A;  147L A;  2PFO A;  1VED A;  3PW2 A;  3A95 A;  2WF6 A;  1IOT A;  4H8Z A;  4XJI A;  1YIL A;  4H94 A;  1GFE A;  1OP9 B;  1LOZ A;  1IOR A;  1C67 A;  2JEI A;  5KFF A;  5APE A;  5J2K A;  2EZX A;  1C6P A;  2OYY A;  1ZQ1 C;  4RQN A;  4RQ4 A;  4IQW A;  1IC7 Y;  1UA6 Y;  3BDP A;  3GQC A;  166L A;  2OCE A;  4N1C C;  1G7I C;  1JRO A;  3THV A;  1ZQG A;  3T5H A;  1FLW A;  1GFJ A;  1XEK A;  4TUR A;  2ZIW B;  169L A;  1LMQ A;  1L92 A;  5HNK A;  4F4Z A;  2HUK A;  1G07 A;  5ALR A;  3SEN A;  4RNO A;  1LI3 A;  2N5Z A;  5DLG A;  1Z3E B;  4HV1 A;  4GRV A;  3AN1 A;  9ICQ A;  3AUO A;  1L95 A;  1MLC E;  2O4W A;  1L33 A;  1CU3 A;  1MC8 A;  2F1I A;  2KP7 A;  2KG5 A;  4NSI A;  2GLE A;  3SV4 A;  2KK0 A;  2KSO B;  4MEY A;  3IN5 A;  1T7P A;  4OWE A;  2RAZ X;  1C7P A;  4PGQ A;  2YML A;  2B72 A;  4NFV A;  3D2Q A;  1Z4N A;  3EPI A;  4PH5 A;  4UW9 A;  5LVK A;  1IP4 A;  2MEB A;  2XBR A;  3RRG A;  2E8O A;  2K8B B;  1JHL A;  1JTO L;  1YQV Y;  4DOB A;  2QB0 B;  2G0A A;  4QW9 A;  3KOO A;  1SL0 A;  2XJW A;  4F4X A;  4M0A A;  1L80 A;  212L A;  1BHZ A;  3SP3 A;  1F44 A;  1SWV A;  4B4I A;  4QZC A;  216L A;  1L53 A;  5HQ1 A;  8ICR A;  1U49 A;  1GWD A;  3RTV A;  3VCB A;  1ZQA A;  2H5Z A;  5LIN A;  4FZM A;  5DG9 A;  5ALF A;  1OWZ A;  5KXW A;  7ICQ A;  1ZQD A;  1JIS A;  3N7R C;  1UCV A;  4QZH A;  8ICX A;  2W8L A;  1LJE A;  1RYR A;  1C6A A;  4C7Y A;  248L A;  2HED A;  3QE8 A;  4GN5 C;  4J1A A;  2H3Q A;  1JSF A;  5KT4 A;  4QWC A;  8ICZ A;  1L98 A;  2GOL A;  4DFK A;  1EQE A;  1L21 A;  2RB1 X;  1CV1 A;  4BAP A;  1GB3 A;  3WH1 A;  1KEJ A;  2Y0S F;  3ZDD A;  1LZ8 A;  4NIJ A;  3BKH A;  2WB1 F;  3QUC A;  2ZIL A;  1IM4 A;  3J81 j;  4H90 A;  4ECT A;  1L64 A;  4UB5 A;  2JHD A;  2BQK A;  5I4X A;  4P4M A;  2QB1 A;  4HTK A;  1ZQV A;  4Z3M A;  4ZIX A;  219L A;  2IHM A;  3IG8 A;  2OU9 A;  235L A;  4CE6 A;  2JEJ A;  3ISC A;  3GUM A;  4W59 A;  217L A;  4AQN A;  4I7R A;  2NO5 A;  2RBR A;  1LGW A;  3DMX A;  2RRD A;  5DQH A;  3LZM A;  4ECZ A;  5F9L A;  3C8R A;  4DF4 A;  1HNL A;  4ED1 A;  4QWB A;  3OJU A;  2Z2E A;  2A1J B;  4RNN A;  2XC9 A;  2MUT A;  2PKE A;  2BPG A;  9ICC A;  3PW7 A;  1L75 A;  4UAY A;  126L A;  1UIF A;  1ZXI A;  4J1B A;  1C6F A;  1K28 A;  2F4G A;  2FBB A;  5FHW A;  1AKI A;  3EZ5 A;  5FCP A;  4OJ6 A;  4AYB F;  5I54 A;  178L A;  3MR3 A;  1FKV A;  3IDW A;  3B0X A;  1T8A A;  1RFP A;  3RH6 A;  4UB2 A;  4Z46 A;  2ZIX A;  2DQH Y;  1L38 A;  1IXR A;  1LJJ A;  4DSI A;  5AM3 A;  5KFD A;  5DB6 A;  4ZPU A;  3H8J A;  3U26 A;  1CX6 A;  2DKZ A;  6LYT A;  1WCL A;  4TUN A;  3AW6 A;  1JI7 A;  4KLD A;  2KTQ A;  8ICV A;  3A34 A;  2ESE A;  5KXR A;  1U45 A;  3Q8R B;  4J03 A;  3TXE A;  5AIB A;  3M1Y A;  4EX7 A;  1REY A;  4GXJ A;  2FLP A;  1AM7 A;  1B7Q A;  3VWO A;  2ZXI A;  2JH1 A;  1DRG A;  3QEB Z;  5KT6 A;  1C6I A;  1JTT L;  1LSG A;  3PML A;  4RPY A;  3BQ1 A;  4QW8 A;  3W6D A;  1BVX A;  1L0K A;  2PFN A;  3FM9 A;  4J9R A;  5L3H A;  252L A;  1L44 A;  1QTC A;  1GB7 A;  1ZRN A;  2FPL A;  3B6L A;  2HHV A;  5AHX A;  1G7H C;  4A7D A;  3IM1 A;  4XUS A;  3L4P A;  3BJY A;  1GFH A;  1ZWN A;  3NRW A;  4I2I A;  5G5G A;  4BXO A;  1FLQ A;  1GE3 A;  1IOS A;  4ZFP A;  1TE2 A;  3CSR A;  2XBS A;  1WQP A;  5KT7 A;  4KLE A;  138L A;  1G7M C;  5KFZ A;  4H9I A;  3QU4 A;  5ALO A;  4DQ5 A;  3OSN A;  2GH1 A;  2BQR A;  4RW2 A;  1V85 A;  4I2B A;  3PST A;  4J0L A;  2BCU A;  1LMP A;  4EYH B;  1TLA A;  5EE1 A;  2OWO A;  2A1A A;  4N1E I;  2Y0S C;  141L A;  3G3A B;  1J2N A;  2Q4T A;  2WB1 C;  1ED1 A;  8ICP A;  3FA0 A;  3UON A;  2IOF A;  2D4J A;  1XSF A;  5KG2 A;  4I2E A;  4I2G A;  4OWA A;  4IAT A;  1IP3 A;  2RP5 A;  2B21 A;  2HEF A;  1KY1 A;  2C2R A;  2DBT A;  4C4T A;  4MEX A;  1LJ4 A;  4LVS A;  1G0G A;  1OVJ A;  3CT1 A;  3WYH A;  5J0U A;  4LYO A;  2K60 A;  1AT5 A;  1C64 A;  1GBZ A;  1C43 A;  2FLL A;  2VKQ A;  5KT5 A;  1D8L A;  4FBU A;  3ONN A;  2C2E A;  1FFV A;  223L A;  2EKS C;  4DD9 A;  1JJ3 A;  1QH9 A;  1IWU A;  1XEJ A;  4DD3 A;  3KHL A;  4H9B A;  146L A;  1LYG A;  5KAF U;  3VW7 A;  2VJ5 A;  1QSY A;  1UID A;  2RBP A;  2NO4 A;  4KLJ A;  3HH5 A;  3WMK A;  3V6H A;  3HH4 A;  4F93 B;  2F44 A;  1GBW A;  1KSP A;  5KFP A;  2BAA A;  2BQM A;  5DLF A;  3RT5 X;  4LZM A;  2NV3 A;  1L00 A;  3WVX A;  5AKZ A;  4UAZ A;  4CF4 A;  4QZD A;  2LCB A;  4QZF A;  243L A;  3B0Y A;  1ZQY A;  1FDL Y;  2B0C A;  4NM1 A;  1X6I A;  3EML A;  1J1P Y;  2DUY A;  1NMM A;  5ALD A;  5IIM A;  4O5C A;  1XGU C;  1OUF A;  3QU7 A;  3FDS A;  3SQI A;  4WG7 A;  5DQG A;  4B1A A;  7ICI A;  4P0Q B;  192L A;  2EQL A;  1JTN A;  4NG1 A;  5LXW A;  1N63 A;  2Z12 A;  2OTY X;  4XEN A;  4DL6 A;  195L A;  2HOI A;  1CUP A;  2Z37 A;  3LWM A;  3TI0 A;  4PL1 A;  1KFS A;  3GIJ A;  1S0M A;  2E8N A;  2C22 A;  1L12 A;  1LSP A;  4NWH A;  4B9L A;  1P2L A;  159L A;  1XEI A;  5KXL A;  4P2H A;  1O08 A;  2AHO B;  5AI0 A;  3CDT A;  1KIP C;  1NJY A;  1E8L A;  3C5F A;  1L76 A;  2OH2 A;  1NKB A;  3VC8 A;  3WPL A;  4DSK A;  4EKP A;  4IQT A;  1B4F A;  2QAR B;  1OUB A;  1LKY A;  3LHM A;  4B49 A;  3JPO A;  2WAR A;  2YMQ A;  1FFU A;  3D4S A;  1JKD A;  3UMC A;  5EBH A;  2FDR A;  3OE0 A;  2KN7 A;  2B7X A;  4J9P A;  4EZ9 A;  9ICJ A;  4GLA A;  2KFN A;  2VA2 A;  1C60 A;  2WTF A;  1JRP A;  244L A;  2D91 A;  1KFD A;  2ZIV A;  157L A;  1C6M A;  1N61 A;  2P66 A;  1D0K A;  241L A;  237L A;  4PHP A;  5JEN B;  4TUS A;  2HVH A;  1P7D A;  1GDW A;  3CSZ A;  1L79 A;  1DOQ A;  1KL9 A;  2WF7 A;  5J0W A;  1IWW A;  5KKI A;  5L1J A;  4KN4 A;  1DKJ A;  1JUG A;  4N5R A;  4QJF B;  2C28 A;  2RAY X;  5EE3 A;  1L04 A;  1X6J A;  3C5G A;  1GFT A;  5LVG A;  2BR0 A;  4OO9 A;  1BNP A;  1ZQU A;  4JUZ A;  1NKE A;  1PVR A;  1LSE A;  1XJU A;  1ZQE A;  5AM1 A;  2J6U A;  1N4F A;  3QUT A;  2OU8 A;  1JXL A;  2V9W A;  3UMB A;  8ICS A;  1L01 A;  233L A;  1JKB A;  1L15 A;  5CHG A;  3EPG A;  1DGJ A;  190L A;  1D3N A;  191L A;  3H8M A;  4HP0 A;  2ZIW A;  4UB1 A;  1L49 A;  1LSD A;  1D6Q A;  4ARL A;  4ML7 A;  1P36 A;  5AI9 A;  1CJ7 A;  4AGA A;  176L A;  4M9N A;  4I2A A;  2YN4 A;  1LYS A;  4DDB A;  4OJL A;  5E4P A;  4KLF A;  3KTQ A;  3TAN A;  1L69 A;  2KMD A;  3RJK A;  1INU A;  1TFR A;  4FE3 A;  2LC9 A;  7ICH A;  4DCC A;  3HH3 A;  3QU9 A;  2LM1 A;  3K3T A;  1T8E A;  1JIT A;  5A3E A;  1LYJ A;  5AI5 A;  1EQ5 A;  224L A;  2A4T A;  1JIH A;  2LYB A;  2D4I A;  2QB0 A;  220L A;  4PZO A;  5C0Y A;  2B6Z A;  2BQN A;  3AZ7 A;  1BB5 A;  1BVS A;  1GFG A;  4W57 A;  4RQ2 A;  2RBS A;  160L A;  4GIB A;  4CRX A;  4UAS A;  2K8C B;  3B9J A;  2C2D A;  4BGD A;  171L A;  4OWB A;  3DN2 A;  4RT3 A;  1L16 A;  4ETE A;  1OV5 A;  3F2B A;  3LYM A;  1LZ9 A;  2HCF A;  1T3P A;  4M47 A;  1F0W A;  1ZQF A;  2BQA A;  3TXD A;  2ZTD A;  2ANV A;  1S10 A;  4LZG A;  1FLU A;  2FJ6 A;  1LYE A;  3FI5 A;  3HDE A;  4G4C A;  1UBZ A;  1GBS A;  1LZ1 A;  1T3N A;  3M7D A;  3SBA A;  5KFS A;  4DSE A;  2KOB A;  5DLA A;  5AK4 A;  1JQU A;  4JV2 A;  1P2C C;  4Z98 A;  2DGZ A;  174L A;  4O3N A;  3ORY A;  226L A;  1C63 A;  1HSW A;  1TK8 A;  3TMU A;  2KJ9 A;  1IEE A;  1ZV5 L;  2K4H A;  1RM6 C;  2Q9E A;  4GCB A;  4QWA A;  2EDU A;  1LMN A;  2LHT A;  3PV8 A;  2JEG A;  1IP5 A;  2DQE Y;  9ICT A;  3J4G A;  2R8H A;  4MFC A;  5AI8 A;  4QZA A;  4U7C A;  2IOH A;  3OE9 A;  2WF9 A;  4PK0 A;  3IJV A;  5I14 A;  1L02 A;  3Q8Q B;  1L27 A;  2MUT B;  3T6U A;  2A1J A;  1L3S A;  2P6U A;  1L05 A;  5JTI A;  1IV8 A;  247L A;  1NI3 A;  2AGP A;  2ZJ8 A;  1SZP A;  2UVW A;  3L3F X;  2ZIJ A;  1EXN A;  4BS7 A;  2W04 A;  1L28 A;  3LWL A;  1KRP A;  4AXT A;  3HTD A;  3FAH A;  8LYZ A;  2DBY A;  2O79 A;  3LK9 A;  3Q8S B;  5J8Y C;  5I5Q A;  1DGS A;  2ZIX B;  3B72 A;  3GUL A;  1XO1 A;  2MSN A;  3CB7 A;  2J6T A;  1P7S A;  5KG1 A;  3FAD A;  1KXW A;  4EKR A;  3WL2 A;  3G3B B;  2PFP A;  5HP4 A;  1MA7 A;  130L A;  1C6J A;  4UWN A;  4EXM A;  5ALQ A;  1D8B A;  2I1Q A;  1D9F A;  4NSJ A;  4CF5 A;  1PK1 A;  3KHH A;  5DGA A;  2VAN A;  2GO7 A;  4NGK A;  1DXS A;  129L A;  2CRX A;  5B06 A;  1TDY A;  5JUM A;  1DYE A;  1NK9 A;  5DB8 A;  3ATN A;  4M6W A;  1FKQ A;  2RBQ A;  2W7O A;  5AKK A;  4Y2U A;  3N9E A;  4KN7 A;  4H9A A;  4F2R A;  3BQ7 A;  1SV0 C;  1LZT A;  3A94 A;  175L A;  2ZTE A;  3MGV A;  5C6I A;  1NDG C;  4BXO B;  1O03 A;  9ICS A;  4DL5 A;  2HSZ A;  4XJB A;  4NGV A;  3AGI A;  1SV0 A;  4OCZ A;  3HTB A;  2Y8P A;  4K5Y A;  4O3O A;  4QGZ A;  1S5L U;  4PRU A;  5JU5 A;  1L19 A;  3WVY A;  2JV3 A;  1LZY A;  4NHI A;  1LHK A;  2ZG6 A;  1QTZ A;  2HOQ A;  3BS5 A;  1NK8 A;  1L68 A;  5KNI A;  187L A;  1SWY A;  4F4W A;  2MEI A;  3C21 A;  201L A;  2EZY A;  5APC A;  3NVY A;  4J9S A;  208L A;  4DQJ A;  5KFW A;  4IS7 A;  7LYZ A;  1C6C A;  1NOM A;  4ECY A;  1XGP C;  2HEA A;  2G09 A;  1YIK A;  5A3Z A;  1QS9 A;  1ZYQ A;  1BPE A;  5KXN A;  3HUK A;  2H5X A;  1L74 A;  1YAO A;  4WLT A;  3SB6 A;  9ICA A;  3QNM A;  1C6G A;  1BPZ A;  3RNX A;  240L A;  1P37 A;  2R8I A;  1RDF A;  7ICK A;  3WKB A;  5FST A;  4A8E A;  4NM2 A;  4M9L A;  5IIL A;  1SWZ A;  1N5W A;  2ZWB A;  1OUD A;  2KKV A;  3K75 D;  5ALT A;  1XU4 A;  2JH7 A;  4DS5 A;  1ZQH A;  1QSB A;  3MFI A;  2LHM A;  1GE0 A;  2YBJ A;  4DC4 A;  2Z2F A;  5AK6 A;  1ZET A;  4I2C A;  1QSA A;  3GV8 B;  3P66 A;  3RJI A;  5K7O A;  5K4L A;  4RQ7 A;  3HIL A;  4NGO A;  3H4D A;  3NVZ A;  1RYS A;  4HSF A;  1WVV A;  3FE0 A;  1VDV A;  1L3V A;  4XN6 A;  1HIW A;  1CKD A;  3DN1 A;  1L67 A;  1L60 A;  2W9C A;  1L97 A;  2F2A B;  5AM0 A;  4DD2 A;  5HMV A;  4LFX A;  3MGW A;  1QT4 A;  1L36 A;  1LYI A;  5KG7 A;  1TV9 A;  4I7Q A;  2B74 A;  1L61 A;  3F53 A;  2BDU A;  1LMT A;  3LVW A;  1B5Z A;  1LKS A;  1PQD A;  1Z55 A;  1LHL A;  2HVI A;  4IAS A;  2AUB A;  5DBB A;  1L86 A;  153L A;  3ZEK A;  1LJK A;  3TFS A;  1ZQO A;  2O6K A;  2F32 A;  1QUT A;  172L A;  1X2I A;  1LGU A;  5D46 A;  2BQF A;  2HTX A;  1HEP A;  3AU2 A;  4DSL A;  1L54 A;  1L58 A;  2W1Y A;  4OW1 A;  3BKV A;  4H92 A;  4GCD A;  6LYZ A;  1ALC A;  1IC4 Y;  1OUA A;  1MQ2 A;  3GUK A;  3AJN A;  2Q0Z X;  1L84 A;  1L89 A;  2KHV A;  1NNL A;  1QQ5 A;  4F50 A;  1XO0 A;  4KLL A;  1YKX X;  4ARP A;  3HX0 A;  4EPI A;  185L A;  183L A;  1L13 A;  1V7S A;  1U4B A;  255L A;  3UXP A;  1NK4 A;  2W9M A;  5IIJ A;  1G1W A;  1RQN A;  4M4O A;  5KFH A;  2BPC A;  5F9N A;  3PMN A;  5ILC A;  1VDP A;  5HR7 A;  3WXT A;  2B5Z A;  3ZI4 A;  4WG1 A;  2KIV A;  4UB3 A;  250L A;  2QAR C;  4F4K A;  4PJ0 U;  1LCN A;  4YR2 A;  165L A;  4NSG A;  1L7P A;  3QYP A;  2PMZ F;  3DV9 A;  1NK6 A;  5AKG A;  7ICE A;  2DFL A;  4B9M A;  2WF8 A;  5C6L A;  4DLG A;  3OHB A;  3DN3 A;  2YB4 A;  3HP6 A;  5KFM A;  1PQI A;  1NHB A;  1IX0 A;  1RE2 A;  8ICO A;  4UAR A;  1MSW D;  260L A;  2BQO A;  3RFA A;  4MFA A;  2ZIV B;  1C10 A;  5KXY A;  5B66 U;  4LZD A;  2OTZ X;  3PR4 A;  1GDX A;  2BQE A;  1LJI A;  4J7V A;  1LW9 A;  5DDM A;  5KFX A;  1C65 A;  2ALZ A;  2KVC A;  3C23 A;  2CJL A;  4GLV A;  1WTN A;  3CP8 A;  4RU9 A;  2VIX A;  4ANR A;  3OHA A;  5IEL A;  9ICN A;  1ZD5 A;  2HMX A;  1F6S A;  4RZR A;  4DQI A;  5GTI U;  1LMC A;  4ELU A;  144L A;  2FE9 A;  1UIB A;  4ED3 A;  4IRC A;  1CUK A;  4XJD A;  2HU1 A;  3QX7 A;  1DPW A;  3V7K A;  4GC6 A;  3C7W A;  4M2Y A;  2F47 A;  1C66 A;  1L25 A;  4DDA A;  1URJ A;  1HEQ A;  242L A;  3C8S A;  1L35 A;  1U9L A;  4BDP A;  5J2J A;  2H3Z A;  4TQR A;  1N5X A;  2PI5 A;  4H9F A;  3PW0 A;  3J6K A;  5AKE A;  1T8F A;  2BQD A;  3PX0 A;  1KIQ C;  2AGQ A;  3F2D A;  1X9S A;  4QWE A;  2I5H A;  1C6N A;  1L83 A;  5KXK A;  4ETA A;  4XA5 A;  4B6J A;  4JV1 A;  1QS5 A;  4Q8E A;  1L10 A;  5CRX A;  1WQN A;  4EZ6 A;  3GFK B;  1L82 A;  3WK5 A;  4DJH A;  4EBE A;  9LYZ A;  1HEL A;  2MU2 A;  5B59 A;  1NDM C;  3AEV A;  5J0P A;  3KKA A;  5G5H A;  4CNQ A;  2DWQ A;  5J2G A;  3H7I A;  3GZF A;  2YMP A;  4F3O A;  4KLT A;  1UC0 A;  1XFP L;  1RI8 B;  3BZK A;  1EQ4 A;  4TUP A;  4LDL A;  1GB6 A;  2HEC A;  261L A;  1LZC A;  3JPT A;  3I28 A;  1C61 A;  4ELT A;  5APD A;  1SV4 A;  4RLN A;  5KXM A;  3C2L A;  3HTG A;  2IHL A;  1XS9 D;  1LYY A;  4Z6E A;  3CYM A;  1GBY A;  1NF5 A;  1HJP A;  4EPF A;  1OWY A;  3NUQ A;  4BUG A;  1REX A;  2Z39 A;  2PMZ C;  2BDP A;  1RQL A;  1P2R A;  1LHH A;  2HHU A;  3AGG G;  1S77 D;  4DWI A;  3A0B U;  3KHR A;  4I7L A;  4RNM A;  8ICQ A;  5BOM A;  1LI6 A;  1XGQ C;  2F1H A;  3HT6 A;  3M9N B;  4O5K A;  2DKX A;  1LZG A;  4R0F A;  3C7Y A;  1LJN A;  1WYG A;  1UA0 A;  3IWR A;  3E58 A;  5FEL A;  3PVX A;  1WWU A;  1H6M A;  1REZ A;  2RHF A;  4YCX A;  4M9H A;  246L A;  4EX6 A;  1OUI A;  1DYB A;  2EPE A;  2XTH A;  1L96 A;  1J2M A;  2JEF A;  7ICU A;  4KLS A;  4UAV A;  5I53 A;  5J0T A;  4Y2J A;  3JPP A;  1WTH A;  3WU9 A;  5DB7 A;  1HEW A;  3KAM A;  3RBD A;  4WLD A;  4KLU A;  8ICY A;  1LTM A;  4Y2P A;  3DDH A;  1KIR C;  6LZM A;  1OUE A;  155L A;  2LYO A;  167L A;  1ZD3 A;  5J2E A;  4NXZ A;  152L A;  1J97 A;  4B0D A;  2F8L A;  2AJQ A;  4FS2 A;  1LYH A;  2OEA X;  2FMP A;  9ICE A;  2Z7J A;  1VJ5 A;  3E0F A;  1QDR A;  1Z4O A;  2A19 A;  3SD7 A;  1QIO A;  4R65 A;  2K4E A;  1YRO A;  3TQ1 A;  1S76 D;  1TAQ A;  7LZM A;  3DMV A;  4WO9 A;  2CGI A;  1GD6 A;  3RJF A;  2EQY A;  3WK7 A;  5EE0 A;  253L A;  4XRH A;  102L A;  1Z1V A;  2R8K A;  4UBC A;  1D3M A;  4NHQ A;  1HML A;  2MEH A;  3NS1 A;  1UPH A;  4O34 A;  1ZQP A;  5IIK A;  3S6J A;  4JB3 A;  2BLX A;  4TTD A;  4WLY A;  5H2F U;  1PK1 B;  2ANX A;  5DG7 A;  5II3 A;  2AXT U;  2XCP A;  5KY1 A;  1KXY A;  5IHG A;  1YZ6 A;  2LKY A;  4ECR A;  1C6K A;  1GB9 A;  4M6W B;  1L03 A;  2RSC A;  5J0Y A;  4YD2 A;  2IFF Y;  1FEZ A;  1GBX A;  1CEZ A;  3HBH A;  3W3E A;  1N48 A;  3AW7 A;  4G4H A;  2K89 A;  1N56 A;  1HEO A;  4H8X A;  1UCO A;  2D3D A;  2ZJA A;  4UB8 U;  3OSP A;  2NYV A;  4KLO A;  1IWZ A;  1B7S A;  3V2Y A;  1LSM A;  4GXI A;  5D5C A;  1ARO P;  4EBC A;  1QTK A;  2EAN A;  2NRX A;  5J7C A;  9ICM A;  3AGH A;  1Z00 A;  4HYK A;  1GEZ A;  1JWR A;  4Z6C A;  3IV6 A;  1JUD A;  3M6Z A;  4CF3 A;  3T5J A;  3KFU F;  3BS5 B;  2GV0 A;  3M18 B;  4ARQ A;  1KW4 A;  4I28 A;  5AKH A;  8ICE A;  1S0V A;  1NBZ C;  1YKY X;  4C8K A;  5AM4 A;  1G0P A;  3EWA A;  2K4I A;  3SB5 A;  2FMQ A;  1L77 A;  1PS5 A;  4CFP A;  1G1V A;  4GBR B;  3RZ4 A;  1RG6 A;  1RYU A;  1O23 A;  5ALL A;  5CB1 A;  3C82 A;  3F5A A;  139L A;  5AI6 A;  4EJ4 A;  1QSL A;  1CX7 A;  1JAL A;  1KNI A;  3GUI A;  198L A;  3ZDC A;  4OWH A;  2DQN B;  1ZQX A;  3NY9 A;  4DD0 A;  3JPS A;  1K1Q A;  1CJ8 A;  2X0A A;  3DNA A;  2F76 X;  3TXK A;  4J9K A;  2BQI A; 
#chains in the Genus database with same CATH homology
 1B7M A;  5B07 A;  2DQC Y;  1D2Y A;  1T97 A;  1LZA A;  1GEV A;  2RBO A;  2Y9T A;  1JJ1 A;  1OXJ A;  1L08 A;  222L A;  2MEG A;  3NYA A;  5KXX A;  132L A;  4XAD A;  1LSN A;  4U3X B;  2G4N A;  4NGI A;  3OJP A;  251L A;  1HHL A;  3GXR A;  4HPE A;  163L A;  1JIY A;  2B6W A;  5LA8 A;  4HJY A;  3QAK A;  1HF4 A;  3A3Q A;  1F6R A;  1PK3 A;  4BAD A;  1SXE A;  1CV6 A;  4YF2 A;  1ZUR A;  4LDO A;  3HT8 A;  1BB7 A;  3WPK A;  193L A;  1D3F A;  1B7P A;  1C62 A;  2BQB A;  1GE1 A;  4WO6 A;  3RU5 A;  5FDJ A;  4LT2 A;  3OK0 A;  1L06 A;  4YOP A;  4DDC A;  232L A;  1LI2 A;  4W52 A;  2OU0 X;  1LSC A;  4EMN A;  1T8G A;  3HWL A;  4GCC A;  1QTE A;  1KS3 A;  2W1L A;  3HFM Y;  1FBI X;  2RH1 A;  2F3N A;  2RBN A;  5LAF A;  4NSH A;  1W6Z A;  249L A;  4ET8 A;  4N0J A;  4LYC A;  1LYF A;  1L62 A;  2DQA A;  231L A;  3TXI A;  3A96 A;  2LMR A;  1DPX A;  1LJF A;  1IOQ A;  1DYD A;  1FN5 A;  2NTG A;  1HC0 A;  140L A;  1L43 A;  1OW5 A;  4ET9 A;  110L A;  1TCY A;  1DYG A;  1VFB C;  1D0L A;  3HDF A;  4NGY A;  1C6L A;  161L A;  1BWI A;  1CU0 A;  1C6B A;  1D2W A;  4NGJ A;  4LYT A;  2W1X A;  2OE9 X;  5B1G A;  4WOA A;  1JJ0 A;  1GFK A;  4LYZ A;  1YAN A;  1GXX A;  4H8Y A;  2EAM A;  2G4Q A;  1L31 A;  1DYA A;  1GFR A;  2D8C A;  1CJ9 A;  1QQY A;  4LZT A;  1LJ3 A;  2B70 A;  3OE8 A;  2L78 A;  189L A;  4I0C A;  1A4V A;  1UQV A;  3GUN A;  3N9A A;  3DN4 A;  1LLH A;  3C81 A;  5LYT A;  4H9H A;  158L A;  2KE7 A;  1L07 A;  4KL7 A;  1GHL A;  4IJ4 A;  1PQK A;  4QDN A;  5LVJ A;  1L46 A;  4MCK A;  3A93 A;  2F2N A;  2CWI A;  1LYO A;  4YXA C;  221L A;  1C6T A;  1GB5 A;  1LSB A;  3W6C A;  1BQL Y;  1C6E A;  1IWX A;  1OVK A;  3SB9 A;  4I8S A;  1DI5 A;  1L14 A;  1SSY A;  2B6G A;  1LZ4 A;  2FBD A;  197L A;  1ZVH L;  1J1X Y;  1PQO A;  1J1O Y;  1GB8 A;  3CT0 A;  1L40 A;  3L2X A;  2FYC A;  134L A;  1IP6 A;  1CU2 A;  1IWT A;  2RB0 X;  1CKH A;  3TXJ A;  5M1Y A;  1P3N A;  111L A;  1WVU A;  3QNG A;  2D6B A;  1G06 A;  143L A;  3DN6 A;  1LMA A;  1QTB A;  4I7J A;  1VAU A;  1LWK A;  1P46 A;  1L66 A;  2BLY A;  133L A;  1L90 A;  1T6H A;  4WMG A;  1L48 A;  103L A;  170L A;  4QY9 A;  4YM8 A;  4I7N A;  1QUO A;  1QT6 A;  3A92 A;  4ARQ B;  1GF4 A;  5F14 A;  1QDT A;  3EBA B;  3W6B A;  3HBD A;  128L A;  1L32 A;  1L37 A;  238L A;  1LZB A;  2YBL A;  4H93 A;  2F4A A;  3EMS A;  3ODU A;  4TWS A;  3F9L A;  1NHE A;  3GUP A;  1CKF A;  218L A;  236L A;  4M6D A;  2LPE A;  2ZNX Y;  3WUM A;  4LT3 A;  5KJ9 A;  181L A;  3HT7 A;  2EIZ C;  4FDY A;  2Z19 A;  3RZE A;  5B05 A;  1BVK C;  1IVM A;  1FLY A;  1QSW A;  1OYU A;  1GBO A;  4XJF A;  2L5Y A;  2XQO A;  2BQL A;  5I4W A;  1GF9 A;  2YBM A;  1XGT C;  1DYC A;  1LPI A;  3CQL A;  1XJT A;  177L A;  2Z18 A;  2EAP A;  3AYQ A;  1LWG A;  4YX7 C;  1HFX A;  225L A;  4ARJ A;  1SX7 A;  1OUJ A;  1SXD A;  1B6I A;  1LZ6 A;  1LZ5 A;  1OUH A;  2G4P A;  3G3A B;  5B1F A;  205L A;  186L A;  148L E;  3CSQ A;  1QT3 A;  122L A;  2O7A A;  3TMW A;  1B5X A;  4HV2 A;  4W96 A;  239L A;  1I20 A;  2DL0 A;  3F6Z A;  1D0M A;  1L91 A;  4CGE A;  3WUN A;  1OUG A;  1WQM A;  4G49 A;  1PQJ A;  3D3D A;  4ZEE A;  1RCM A;  4DQ7 A;  1EL1 A;  1L99 A;  3WW6 A;  2CUU A;  1WTM A;  5IDD A;  3HT9 A;  1UIG A;  5T3F A;  5LA5 A;  2QKQ A;  3RW8 A;  1LPY A;  1YL0 X;  1X40 A;  2HEE A;  4G9S A;  4I7T A;  1B5Y A;  2YBI A;  3BS7 A;  1OV7 A;  4NEB A;  2CDS A;  2MEF A;  1C6H A;  1OQM A;  2ZQ3 A;  1OUC A;  5HMJ A;  1L50 A;  1GE2 A;  4XJG A;  2FYD A;  1DYF A;  2OE4 X;  1B7L A;  1L22 A;  1GF5 A;  1DKK A;  3LYT A;  1YAQ A;  1SGG A;  1L65 A;  1L73 A;  3A67 Y;  4I7S A;  1CV3 A;  5F81 A;  5KXP A;  2YTU A;  1P6Y A;  4PHI A;  1GAY A;  1EPY A;  5L3I A;  3AZ5 A;  4ETC A;  4NJ8 A;  4B4J A;  5DM9 A;  5I4Y A;  1LHM A;  1LZS A;  2DQJ Y;  1SSW A;  3WUA A;  3IJU A;  3KKA C;  2A7D A;  4WLX A;  4KT3 A;  1IC5 Y;  1ZMY L;  4WL6 A;  5C6J A;  108L A;  2ES6 A;  1LZN A;  1GXV 2;  1TAY A;  4RDS A;  1LMO A;  1L42 A;  1LKR A;  5AMY A;  2PC2 A;  3W6E A;  4D9Z A;  112L A;  1GFU A;  5LYM A;  3PBL A;  3OE6 A;  3HUQ A;  1BB4 A;  1UIE A;  1IP2 A;  2DQF C;  3A90 A;  4UWU A;  1KXX A;  1TEW A;  3C7Z A;  2ZQ4 A;  4ARM A;  4LYM A;  3DKE X;  3C80 A;  4C3W A;  3HUA A;  1D9W A;  3T36 A;  1D9U A;  4GCE A;  1IY4 A;  4HPI A;  1QTH A;  5DL9 A;  5LYZ A;  1COK A;  4G4B A;  1LZE A;  4BAF A;  227L A;  4NWE A;  4ETD A;  1IWY A;  1LHI A;  1HFY A;  1QUH A;  4E97 A;  1GE4 A;  1LAA A;  2MEE A;  1C68 A;  3A3R X;  1DXJ A;  1QUS A;  1B2K A;  2I26 L;  3GUO A;  1I56 A;  1WWV A;  4XJH A;  4W54 A;  1L24 A;  2DQG Y;  1DQJ C;  3W6F A;  1QTD A;  1MEL L;  1G0M A;  4H9C A;  104L A;  1CU5 A;  196L A;  1XGR C;  2NTH A;  3GUJ A;  1BB3 A;  3ULR A;  1X66 A;  1F10 A;  1GF8 A;  1NBY C;  2YVB A;  168L A;  1F0M A;  1QT5 A;  1QTV A;  1UIH A;  2F30 A;  2Z6B A;  4NG8 A;  1YAM A;  2H9J A;  1IOC A;  3HU9 A;  1TBY A;  1NWG A;  3G3X A;  1IO5 A;  1A2Y C;  1AZF A;  214L A;  3P68 A;  1BWJ A;  1QUD A;  2MEC A;  200L A;  4L41 A;  5HLL A;  1HSX A;  4DD7 A;  2YBH A;  4KPM A;  4GN4 A;  1IP7 A;  2E8P A;  1PQM A;  4NGW A;  209L A;  123L A;  211L A;  4HJV A;  4W94 A;  2BQC A;  4PGJ B;  1H87 A;  3ZVQ B;  4I7P A;  125L A;  1DI3 A;  1LYD A;  4H91 A;  1C69 A;  1QUG A;  5F3X B;  2I6Z A;  2F2Q A;  2LYZ A;  1GFA A;  4GCF A;  3RUN A;  4HTQ A;  4DT3 A;  4NL9 C;  4UWV A;  1WQQ A;  127L A;  3P65 A;  4NHS A;  1KY0 A;  2F8K A;  1L29 A;  1L20 A;  4WM1 A;  1LJG A;  2OE7 X;  4NL9 A;  4LGK A;  1AT6 A;  150L A;  4N9R A;  4Z41 A;  1CKG A;  1L18 A;  2B6X A;  3A6C Y;  3K2R A;  5ILF A;  4R6C A;  2HEB A;  1JKC A;  3FI7 A;  1P56 A;  4I7K A;  3NY8 A;  234L A;  1HEN A;  1QT8 A;  1ZYT A;  2BQJ A;  4TSC A;  4PPO A;  1QSQ A;  4YXC A;  229L A;  4OOO A;  1B0D A;  3G3V A;  4FJR A;  4PJZ A;  1P5C A;  1V7T A;  1LHJ A;  3C8Q A;  1L88 A;  1CTW A;  1LZR A;  4MHV A;  3DN0 A;  3HU8 A;  1HMK A;  1L26 A;  258L A;  1CUQ A;  1I6S A;  1L56 A;  118L A;  1DI4 A;  1LGX A;  1SQ2 L;  1CJ6 A;  1CV4 A;  2Q9D A;  3A91 A;  2IGC A;  4YEO A;  1L71 A;  1T6V L;  4EKQ A;  2LYM A;  4NY5 A;  3P64 A;  1IR9 A;  3WU8 A;  4DAJ A;  1D6P A;  4CHX A;  4KXI A;  1IR8 A;  180L A;  4DKL A;  4PJ2 C;  5LAG A;  2ZYC A;  1RJC B;  1SX2 A;  1LSY A;  245L A;  3LYO A;  213L A;  3F8V A;  5KXZ A;  1V38 A;  1G0L A;  2C8O A;  210L A;  2HUB A;  3M3U A;  4II8 A;  4H9E A;  3HBE X;  4B4E A;  1C45 A;  4I7M A;  3L64 A;  4YEN A;  4DWX A;  1G0J A;  3LN2 A;  3A6B Y;  2HU3 A;  164L A;  1LYZ A;  207L A;  1LZD A;  114L A;  1L72 A;  4XYY A;  256L A;  3B0K A;  1JTM A;  4PRQ A;  3JR6 A;  4W55 A;  4WM4 A;  1L81 A;  3SB7 A;  1YAP A;  262L A;  1HFZ A;  1GB2 A;  1L11 A;  5DN5 A;  1CU6 A;  3ATO A;  1WQR A;  1HER A;  1L70 A;  2Z38 A;  2C8P A;  1IR7 A;  5F9X A;  1BB6 A;  4W58 A;  5FEK A;  254L A;  1CV0 A;  2DKV A;  3TXB A;  1L59 A;  3WUL A;  5D5F A;  4IAP A;  4DYG A;  4CFO A;  5L1M A;  4W51 A;  2KSO A;  2YSS C;  1B9O A;  4N8Z A;  3TXH A;  3TXF A;  3AZ4 A;  1B5U A;  4X3B A;  1CVK A;  2BQH A;  173L A;  4WM5 A;  4RW1 A;  1XEP A;  1L57 A;  4NHP A;  2RB2 X;  3WU7 A;  1C08 C;  1GF7 A;  4HJZ A;  1UIA A;  3W6A A;  1UIC A;  4ARM B;  3WXU A;  1L55 A;  3HTF A;  1B7N A;  1CNS A;  1DZB X;  2H9K A;  4LYB A;  1C6D A;  1IP1 A;  1P64 A;  3TMX A;  4W53 A;  1VDS A;  1OVH A;  1LSA A;  5KXT A;  182L A;  5HNC A;  1C6Q A;  4MST A;  5L9J A;  2B6Y A;  1L41 A;  4OOT A;  1LSZ A;  2LZT A;  215L A;  3AZ6 A;  1GF3 A;  3SBB C;  5KKJ A;  4WL7 A;  259L A;  228L A;  5E9R A;  1GF0 A;  1L0J A;  113L A;  4W56 A;  1G0Q A;  1L09 A;  3N9C A;  4QEQ A;  3B0I A;  4WM2 A;  1B5W A;  3CDO A;  1LSF A;  4RLM A;  1REM A;  1L30 A;  4TX7 A;  2DQD Y;  4MR1 A;  2W1M A;  5DN4 A;  2K4P A;  5APF A;  1NKH A;  151L A;  3CDV A;  5JRT A;  2HUM A;  3CDR A;  3B0O A;  1GB0 A;  184L A;  4LT1 A;  1YKZ X;  5LVI A;  1LJH A;  1KW7 A;  4HTN A;  4ETB A;  5J8Y A;  109L A;  1L23 A;  4TSB A;  4S0W A;  194L A;  2EAO A;  1L39 A;  1GAZ A;  2NWD X;  2B6T A;  1SLY A;  2HUL A;  4DD1 A;  1L94 A;  4EKS A;  1B7R A;  131L A;  230L A;  3LZ2 A;  2B73 A;  135L A;  3V2W A;  1ZVY B;  5F16 A;  3ZVQ A;  257L A;  2A7F A;  2LZ2 A;  3G3W A;  2ZIK A;  3HH6 A;  1X9X A;  1GPQ C;  1IIZ A;  145L A;  4LT0 A;  5HNL A;  4P2E A;  3D9A C;  4EOF A;  3TMV A;  5KXO A;  5F9U A;  1NQI A;  4WM6 A;  1L34 A;  1PZY A;  1BGI A;  5LVH A;  3P4Z A;  1HEM A;  1L52 A;  2ZNW Y;  2ZYP A;  2MED A;  107L A;  2E8M A;  3PDS A;  1L51 A;  1UUZ C;  4OWC A;  1JTP L;  5LZM A;  4WM3 A;  2DQI Y;  1VDT A;  1GF6 A;  2VB1 A;  3K1R B;  2MEA A;  1IWV A;  5LIO A;  1L45 A;  3CDQ A;  1I1Z A;  1B0X A;  137L A;  2Q0M X;  1CKC A;  154L A;  2Y9U A;  1QT7 A;  1YL1 X;  2D4K A;  2YDG A;  4YEM A;  3LYZ A;  3QY4 A;  1CV5 A;  3DN8 A;  3WW5 A;  4NGZ A;  1UAC Y;  3SB8 A;  3GXK A;  162L A;  2I25 L;  206L A;  1JPO A;  4H1P A;  1BWH A;  4E3U A;  3EO5 A;  2BPU A;  1L63 A;  1KW5 A;  2BQG A;  3TAD C;  3E3D A;  3C83 A;  149L A;  1JSE A;  188L A;  3CT5 A;  1W08 A;  3TAD A;  3WPJ A;  1G0K A;  3SN6 R;  3SEI A;  1L85 A;  4LFP A;  1G7L C;  1L93 A;  142L A;  1IY3 A;  1L87 A;  3A8Z A;  4NGL A;  2YBN A;  1B5V A;  1WQO A;  1JEF A;  156L A;  1L47 A;  5KXS A;  2B75 A;  4PZN A;  1LKY B;  1B7O A;  4I7O A;  1G7J C;  2QAR A;  3TAC B;  1VAT A;  1C46 A;  3AB6 A;  115L A;  1D3J A;  120L A;  1GFV A;  4NHT A;  199L A;  3EXD A;  3DMZ A;  119L A;  4RQM A;  1VDQ A;  2LZM A;  4GN3 A;  3LZT A;  4LDE A;  4CJ2 A;  3TXG A;  1L17 A;  4C5F A;  1JKA A;  147L A;  1VED A;  3A95 A;  1IOT A;  4H8Z A;  4XJI A;  1YIL A;  4H94 A;  1GFE A;  1OP9 B;  1LOZ A;  1IOR A;  1C67 A;  5APE A;  1C6P A;  4RQN A;  1IC7 Y;  1UA6 Y;  166L A;  4N1C C;  1G7I C;  1GFJ A;  1FLW A;  1XEK A;  169L A;  1LMQ A;  1L92 A;  2HUK A;  1G07 A;  3SEN A;  1LI3 A;  2N5Z A;  4HV1 A;  4GRV A;  1L95 A;  1MLC E;  2O4W A;  1L33 A;  1CU3 A;  2KG5 A;  4NSI A;  2GLE A;  2KSO B;  4OWE A;  2RAZ X;  1C7P A;  2B72 A;  4NFV A;  5LVK A;  1IP4 A;  2MEB A;  2XBR A;  2E8O A;  1JHL A;  1JTO L;  1YQV Y;  2QB0 B;  2XJW A;  1L80 A;  212L A;  1BHZ A;  3SP3 A;  4B4I A;  216L A;  1L53 A;  5HQ1 A;  1GWD A;  2H5Z A;  5LIN A;  1OWZ A;  5KXW A;  1JIS A;  1UCV A;  1LJE A;  1C6A A;  2HED A;  248L A;  3QE8 A;  4GN5 C;  4J1A A;  1JSF A;  1L98 A;  1EQE A;  1L21 A;  2RB1 X;  1CV1 A;  4BAP A;  1GB3 A;  3WH1 A;  1LZ8 A;  4NIJ A;  3BKH A;  2ZIL A;  4H90 A;  1L64 A;  2BQK A;  5I4X A;  4HTK A;  2QB1 A;  4Z3M A;  4ZIX A;  219L A;  2OU9 A;  235L A;  3GUM A;  4W59 A;  217L A;  4AQN A;  4I7R A;  2RBR A;  1LGW A;  3DMX A;  3LZM A;  3C8R A;  1HNL A;  2Z2E A;  1L75 A;  126L A;  1UIF A;  4J1B A;  1C6F A;  1K28 A;  2F4G A;  2FBB A;  5FHW A;  1AKI A;  5FCP A;  5I54 A;  178L A;  1FKV A;  3IDW A;  1T8A A;  1RFP A;  4Z46 A;  2DQH Y;  1L38 A;  1LJJ A;  4ZPU A;  1CX6 A;  2DKZ A;  6LYT A;  4TUN A;  3AW6 A;  1JI7 A;  3A34 A;  2ESE A;  5KXR A;  3TXE A;  1REY A;  1B7Q A;  3VWO A;  1AM7 A;  1C6I A;  1JTT L;  1LSG A;  3W6D A;  1BVX A;  1L0K A;  5L3H A;  252L A;  1L44 A;  1QTC A;  1GB7 A;  3B6L A;  1G7H C;  4A7D A;  1GFH A;  1ZWN A;  1GE3 A;  1FLQ A;  1IOS A;  4ZFP A;  3CSR A;  2XBS A;  1WQP A;  138L A;  1G7M C;  4H9I A;  4DQ5 A;  4RW2 A;  1V85 A;  4J0L A;  1TLA A;  1LMP A;  4N1E I;  141L A;  3FA0 A;  3UON A;  2D4J A;  1XSF A;  4OWA A;  4IAT A;  1IP3 A;  2HEF A;  1KY1 A;  2DBT A;  1LJ4 A;  3CT1 A;  1OVJ A;  1G0G A;  3WYH A;  4LYO A;  2K60 A;  1AT5 A;  1C64 A;  1GBZ A;  1C43 A;  223L A;  2EKS C;  4DD9 A;  1JJ3 A;  1XEJ A;  1IWU A;  4DD3 A;  4H9B A;  146L A;  1LYG A;  3VW7 A;  1UID A;  2RBP A;  3HH5 A;  3WMK A;  3HH4 A;  2F44 A;  1GBW A;  2BAA A;  2BQM A;  3RT5 X;  4LZM A;  1L00 A;  3WVX A;  2LCB A;  243L A;  1FDL Y;  3EML A;  1J1P Y;  1NMM A;  1XGU C;  1OUF A;  4WG7 A;  4B1A A;  192L A;  2EQL A;  1JTN A;  4NG1 A;  5LXW A;  2Z12 A;  2OTY X;  4XEN A;  195L A;  1CUP A;  2Z37 A;  2E8N A;  1L12 A;  1LSP A;  4NWH A;  1P2L A;  159L A;  1XEI A;  5KXL A;  3CDT A;  1KIP C;  1E8L A;  1L76 A;  3WPL A;  4EKP A;  1B4F A;  2QAR B;  1OUB A;  1LKY A;  3LHM A;  4B49 A;  2WAR A;  3D4S A;  1JKD A;  5EBH A;  3OE0 A;  2B7X A;  4GLA A;  1C60 A;  244L A;  2D91 A;  157L A;  1C6M A;  1D0K A;  241L A;  237L A;  5JEN B;  1GDW A;  3CSZ A;  1L79 A;  1IWW A;  5KKI A;  1DKJ A;  1JUG A;  4N5R A;  2RAY X;  1L04 A;  1GFT A;  5LVG A;  4OO9 A;  1LSE A;  1XJU A;  1N4F A;  2OU8 A;  1L01 A;  233L A;  1JKB A;  1L15 A;  190L A;  1D3N A;  191L A;  3H8M A;  4HP0 A;  1LSD A;  1L49 A;  4ARL A;  1D6Q A;  4ML7 A;  1P36 A;  1CJ7 A;  4AGA A;  176L A;  1LYS A;  4DDB A;  5E4P A;  1L69 A;  2KMD A;  1INU A;  2LC9 A;  3HH3 A;  3K3T A;  5A3E A;  1JIT A;  1LYJ A;  1EQ5 A;  224L A;  2A4T A;  2D4I A;  2QB0 A;  220L A;  4PZO A;  2B6Z A;  2BQN A;  3AZ7 A;  1BB5 A;  1GFG A;  4W57 A;  2RBS A;  160L A;  171L A;  4OWB A;  3DN2 A;  1L16 A;  4ETE A;  1OV5 A;  3LYM A;  1LZ9 A;  1T3P A;  1F0W A;  2BQA A;  3TXD A;  2ANV A;  1FLU A;  1LYE A;  3HDE A;  3FI5 A;  4G4C A;  1UBZ A;  1GBS A;  1LZ1 A;  3SBA A;  5DLA A;  1JQU A;  1P2C C;  4Z98 A;  174L A;  226L A;  1C63 A;  1HSW A;  3TMU A;  1IEE A;  1ZV5 L;  2Q9E A;  4GCB A;  1LMN A;  1IP5 A;  2DQE Y;  3J4G A;  3OE9 A;  4PK0 A;  3IJV A;  5I14 A;  1L02 A;  1L27 A;  3T6U A;  1L05 A;  5JTI A;  247L A;  2ZIJ A;  4BS7 A;  1L28 A;  4AXT A;  3HTD A;  8LYZ A;  2O79 A;  5J8Y C;  5I5Q A;  3B72 A;  3GUL A;  3CB7 A;  1P7S A;  3FAD A;  1KXW A;  4EKR A;  3WL2 A;  3G3B B;  1C6J A;  130L A;  4UWN A;  4EXM A;  4NSJ A;  1PK1 A;  4NGK A;  1DXS A;  129L A;  5B06 A;  1TDY A;  1DYE A;  3ATN A;  1FKQ A;  2RBQ A;  3N9E A;  4H9A A;  3BQ7 A;  1SV0 C;  1LZT A;  3A94 A;  175L A;  5C6I A;  1NDG C;  4XJB A;  4NGV A;  3AGI A;  1SV0 A;  3HTB A;  2Y8P A;  4K5Y A;  4QGZ A;  4PRU A;  5JU5 A;  1L19 A;  3WVY A;  2JV3 A;  1LZY A;  4NHI A;  1LHK A;  1QTZ A;  3BS5 A;  1L68 A;  5KNI A;  187L A;  1SWY A;  2MEI A;  201L A;  5APC A;  208L A;  4DQJ A;  4IS7 A;  7LYZ A;  1C6C A;  2HEA A;  1XGP C;  1YIK A;  5A3Z A;  1QS9 A;  5KXN A;  3HUK A;  1L74 A;  1YAO A;  4WLT A;  3SB6 A;  1C6G A;  3RNX A;  240L A;  1P37 A;  5FST A;  1SWZ A;  2ZWB A;  1OUD A;  1QSB A;  2LHM A;  1GE0 A;  2YBJ A;  4DC4 A;  2Z2F A;  1QSA A;  3P66 A;  5K7O A;  3HIL A;  4NGO A;  4HSF A;  1WVV A;  3FE0 A;  4XN6 A;  1CKD A;  3DN1 A;  1L67 A;  1L60 A;  1L97 A;  4DD2 A;  5HMV A;  4LFX A;  3MGW A;  1QT4 A;  1L36 A;  1LYI A;  4I7Q A;  2B74 A;  1L61 A;  1LMT A;  1B5Z A;  1LKS A;  1PQD A;  1Z55 A;  1LHL A;  4IAS A;  2AUB A;  1L86 A;  153L A;  3ZEK A;  1LJK A;  2F32 A;  1QUT A;  172L A;  1LGU A;  2BQF A;  2HTX A;  1HEP A;  1L54 A;  1L58 A;  2W1Y A;  4OW1 A;  3BKV A;  4H92 A;  4GCD A;  6LYZ A;  1ALC A;  1IC4 Y;  1OUA A;  3GUK A;  3AJN A;  1L84 A;  1L89 A;  1YKX X;  4ARP A;  4EPI A;  185L A;  183L A;  1L13 A;  1V7S A;  255L A;  1G1W A;  4M4O A;  5ILC A;  1VDP A;  3WXT A;  2B5Z A;  4WG1 A;  2KIV A;  250L A;  2QAR C;  4NSG A;  1LCN A;  165L A;  5C6L A;  3DN3 A;  1PQI A;  1NHB A;  1IX0 A;  1RE2 A;  260L A;  2BQO A;  1C10 A;  5KXY A;  2OTZ X;  1GDX A;  2BQE A;  1LJI A;  4J7V A;  1LW9 A;  1C65 A;  2CJL A;  4GLV A;  1WTN A;  4ANR A;  5IEL A;  1F6S A;  1LMC A;  144L A;  2FE9 A;  1UIB A;  4XJD A;  2HU1 A;  1DPW A;  3C7W A;  2F47 A;  1C66 A;  1L25 A;  4DDA A;  1HEQ A;  242L A;  3C8S A;  1L35 A;  4H9F A;  3J6K A;  1T8F A;  2BQD A;  1KIQ C;  1C6N A;  1L83 A;  5KXK A;  4ETA A;  1QS5 A;  1L10 A;  1WQN A;  1L82 A;  4DJH A;  9LYZ A;  1HEL A;  5B59 A;  1NDM C;  3KKA A;  1UC0 A;  1XFP L;  1RI8 B;  1EQ4 A;  4LDL A;  1GB6 A;  2HEC A;  261L A;  1LZC A;  1C61 A;  5APD A;  1SV4 A;  4RLN A;  5KXM A;  3HTG A;  2IHL A;  1LYY A;  1GBY A;  1NF5 A;  4EPF A;  1OWY A;  1REX A;  2Z39 A;  1P2R A;  1LHH A;  3AGG G;  4I7L A;  1XGQ C;  1LI6 A;  3HT6 A;  2DKX A;  1LZG A;  4R0F A;  3C7Y A;  1LJN A;  3IWR A;  5FEL A;  1WWU A;  1H6M A;  1REZ A;  246L A;  1OUI A;  1DYB A;  2EPE A;  2XTH A;  1L96 A;  5I53 A;  1WTH A;  3WU9 A;  1HEW A;  3KAM A;  4WLD A;  1LTM A;  1KIR C;  6LZM A;  1OUE A;  155L A;  2LYO A;  167L A;  152L A;  4B0D A;  1LYH A;  2OEA X;  1QDR A;  1QIO A;  1YRO A;  7LZM A;  3DMV A;  4WO9 A;  2CGI A;  1GD6 A;  253L A;  102L A;  1Z1V A;  1D3M A;  4NHQ A;  1HML A;  2MEH A;  4O34 A;  2BLX A;  4TTD A;  4WLY A;  2ANX A;  1PK1 B;  5II3 A;  5KY1 A;  1KXY A;  5IHG A;  1C6K A;  1GB9 A;  1L03 A;  2RSC A;  2IFF Y;  1GBX A;  3HBH A;  3W3E A;  3AW7 A;  4G4H A;  1HEO A;  4H8X A;  1UCO A;  2D3D A;  3V2Y A;  1IWZ A;  1B7S A;  1LSM A;  5D5C A;  1QTK A;  2EAN A;  5J7C A;  3AGH A;  1JWR A;  1GEZ A;  3M18 B;  2GV0 A;  4ARQ A;  3BS5 B;  1KW4 A;  1NBZ C;  1YKY X;  1G0P A;  3SB5 A;  1L77 A;  1PS5 A;  4CFP A;  1G1V A;  4GBR B;  3RZ4 A;  1RG6 A;  1O23 A;  3C82 A;  139L A;  4EJ4 A;  1CX7 A;  1KNI A;  3GUI A;  198L A;  4OWH A;  3NY9 A;  4DD0 A;  1CJ8 A;  2X0A A;  3DNA A;  3TXK A;  2BQI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...