2QB0B

Structure of the 2tel crystallization module fused to t4 lysozyme with an ala-gly-pro linker.
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
241
structure length
241
Chain Sequence
SIRLPAHLRLQPIYWSRDDVAQWLKWAENEFSLRPIDSNTFEMNGKALLLLTKEDFRYRSPHSGDVLYELLQHILKQAGPNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFCQDVDAAVRGILRNAKLKPVYDSLDCVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E80-TELSAM domain
publication title Polymer-driven crystallization.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase regulator
total genus 75
structure length 241
sequence length 241
chains with identical sequence D
ec nomenclature ec 3.2.1.17: Lysozyme.
pdb deposition date 2007-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00959 Phage_lysozyme Phage lysozyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2qb0B01
1.10.530.40 Mainly Alpha Orthogonal Bundle Lysozyme Lysozyme 2qb0B02
228LA 1DYEA 3GULA 185LA 3CDQA 1EPYA 2RAZX 1L09A 210LA 1T8FA 1C6HA 1KY1A 4I7RA 3RZEA 7LZMA 197LA 5JU5A 1LI2A 1L30A 1LLHA 4EKPA 2NTGA 164LA 206LA 3HH6A 3BQ7A 1PK1A 243LA 3DMVA 1CV5A 1D2YA 3OE9A 1L06A 2B6GA 1DYFA 110LA 4YXCA 2OE9X 1F0MA 1G0GA 2DKZA 167LA 4OO9A 1L72A 249LA 256LA 2B7XA 1C63A 4DAJA 111LA 1KNIA 2LPEA 1T6HA 1QTBA 1QS9A 3CDVA 4EKQA 1DXSA 1PQMA 1L96A 3OE0A 2HUKA 4I7PA 149LA 2Q9EA 1QT5A 1SWYA 1P2LA 1CUQA 2ES6A 1D9WA 2KIVA 1C60A 1C6IA 2B6XA 3HDEA 4YX7C 4W54A 4W59A 1C6BA 3KKAC 1C6PA 1P7SA 1QTZA 115LA 1L16A 1C6NA 1L69A 1LW9A 1P2RA 4PJZA 162LA 3NY9A 163LA 2B6TA 188LA 139LA 1LGUA 2F2QA 1WWVA 1L58A 1OVJA 1DYBA 1C6AA 1LKYA 2QB1A 1L51A 114LA 2Y9TA 1L44A 3PDSA 1L85A 2FE9A 4I7TA 1C6CA 1T8AA 1G1WA 3C8QA 3HT6A 5F3XB 1DYDA 1L01A 1G0QA 1QTCA 3DMXA 3HUKA 186LA 2ANXA 4ARLA 1L02A 113LA 4NL9C 1L67A 1L92A 102LA 227LA 1L10A 2RBSA 1G0PA 4NJ8A 3SB5A 1KY0A 141LA 1CU6A 1L53A 2OEAX 1G0JA 1P3NA 3DN0A 174LA 229LA 3HUAA 4W52A 244LA 1CX7A 2B6YA 3SBAA 5L1MA 4EPIA 129LA 128LA 1L15A 4ARMB 1LYEA 187LA 1L13A 4PZOA 2EAPA 1KW5A 3BS7A 1L0KA 1QT4A 3DMZA 2D3DA 223LA 2RB1X 1SSYA 3NY8A 1SXDA 1L18A 1L66A 4LDLA 1C62A 1WWUA 3HU9A 1L56A 253LA 2EANA 1LWGA 4GBRB 4DKLA 4EKSA 2O79A 1L20A 1LPYA 1L76A 4ARQB 2QARB 2L5YA 180LA 1C6DA 1L28A 1L70A 1C6KA 1L49A 238LA 1PK3A 4W57A 1SV0A 4RQNA 1PQIA 3DN3A 1PQDA 2F8KA 4PK0A 1CU0A 1L0JA 2E8PA 127LA 233LA 2LZMA 225LA 176LA 4W55A 2HULA 3SBBC 170LA 1L03A 108LA 181LA 258LA 1QUOA 2K60A 1L34A 1OV5A 3GUJA 1L05A 3HDFA 126LA 3DN4A 1PQJA 3HWLA 1L63A 4W56A 3SB9A 123LA 239LA 252LA 1L95A 2B6ZA 3HH3A 1C65A 2E8NA 1L55A 5JTIA 177LA 2ESEA 1XJUA 1L79A 259LA 1B4FA 155LA 1CV4A 201LA 3CDTA 3CDOA 4DJHA 1G0KA 260LA 1KW7A 200LA 1C6QA 4ARJA 3HT8A 1L64A 195LA 1L90A 4I7MA 3GUOA 1D3JA 1L83A 3FA0A 169LA 3IDWA 1C6MA 1JI7A 119LA 1D3FA 157LA 1L74A 3OE6A 4EKRA 1CU2A 1JTNA 4IS7A 172LA 1QTDA 1SXEA 3V2WA 1JQUA 1X40A 1L89A 1P64A 2Q9DA 3SB8A 3HU8A 1K28A 1V85A 1C68A 1LYDA 1CV3A 1COKA 3VW7A 4YXAC 1OYUA 1L31A 3DNAA 1L42A 214LA 190LA 196LA 1LYJA 3TADA 2JV3A 3D4SA 2F44A 1I6SA 1L40A 168LA 246LA 1C69A 3TADC 4ARMA 251LA 171LA 3HTDA 3C7WA 4MHVA 1WTHA 205LA 2DL0A 3C8SA 1QSQA 1C6LA 2OTYX 1L39A 3C81A 3SB6A 1L35A 3HT7A 255LA 107LA 2DKXA 230LA 2NTHA 1CUPA 242LA 2F47A 1CX6A 1L87A 4ARQA 2QARA 3NYAA 1L47A 1L99A 1QUGA 1L22A 3HH4A 2K4PA 3EMLA 3F8VA 1G1VA 215LA 235LA 3ODUA 1L81A 1G07A 4W58A 2QKQA 178LA 1SX2A 3TACB 1DYGA 240LA 142LA 1C64A 1OXJA 3L64A 1B6IA 3SEIA 212LA 103LA 1L19A 4IAPA 1CV0A 3L2XA 1P46A 125LA 1T97A 160LA 1CVKA 1SWZA 3HTFA 1L57A 4I7SA 231LA 2OU9A 1L24A 2OU0X 247LA 2A4TA 2D8CA 184LA 4LDOA 120LA 3G3VA 145LA 4I7KA 4S0WA 3SN6R 5LZMA 118LA 1T8GA 209LA 2YTUA 3HILA 1L08A 1QS5A 3C7ZA 5JRTA 1LI6A 143LA 2KE7A 3BS5B 1L26A 245LA 2QB0B 1LWKA 222LA 3GUPA 1CV1A 3HTGA 3K2RA 224LA 2KG5A 3OE8A 218LA 2F3NA 1JTMA 3SB7A 1SV0C 2O7AA 189LA 161LA 1L59A 1L38A 2IGCA 3DN8A 130LA 1OWYA 3K1RB 1L45A 1QT7A 1XJTA 1QUDA 248LA 3G3XA 4RQMA 5KNIA 1P5CA 4LDEA 158LA 211LA 2CUUA 1L82A 4E97A 2B74A 1SGGA 1L68A 254LA 148LE 122LA 3DN2A 1C6JA 2LMRA 2RBPA 3HUQA 216LA 4ZPUA 1L48A 1P56A 1CU3A 1KW4A 1X9XA 3GUNA 1OVKA 3GUKA 3JR6A 2KSOA 156LA 3G3WA 1L62A 1L25A 3H8MA 1L54A 3UONA 1KS3A 1P37A 217LA 213LA 3HT9A 2RAYX 1L50A 236LA 2OE4X 1L73A 2OE7X 1RG6A 1V38A 4PZNA 1L07A 146LA 2F32A 1LGWA 1L98A 1L14A 2RBNA 1L88A 2Z6BA 1LYHA 4EXMA 1L33A 150LA 159LA 2RB0X 1P6YA 1C61A 1D3NA 4K5YA 1L12A 4I7QA 2GLEA 2HUMA 3KKAA 1L46A 3LZMA 4I7OA 2EAMA 1SV4A 1L84A 1C67A 3C83A 234LA 2B73A 1G0LA 262LA 2LCBA 2RBOA 4W53A 219LA 3DN6A 2O4WA 2KSOB 1L91A 2B70A 152LA 175LA 1L17A 1OV7A 3FADA 1PQKA 1G0MA 140LA 1L21A 1PQOA 1PK1B 1L77A 237LA 1D2WA 1L97A 1P36A 1C6EA 3GUIA 3BS5A 199LA 1QT6A 1QT3A 2B6WA 2QB0A 109LA 1CTWA 1DYCA 2QARC 1SSWA 1C66A 3C82A 1ZURA 1D3MA 165LA 221LA 4NL9A 2Y9UA 2EAOA 250LA 182LA 2LC9A 4I7JA 147LA 2RBQA 1B0XA 3DN1A 183LA 2B72A 2RBRA 1L75A 1L71A 1OVHA 2L78A 3SENA 3C8RA 1QSBA 1L36A 112LA 1QTHA 151LA 1QTVA 191LA 1L60A 1LGXA 4EPFA 1G06A 261LA 1L29A 4I7NA 3QAKA 1LI3A 1L94A 232LA 192LA 1ZWNA 2ANVA 1UCVA 5J8YA 1CU5A 2OTZX 1X66A 3C80A 2KMDA 1NHBA 1XEPA 1UQVA 104LA 1QT8A 4I7LA 1SX7A 1LYGA 4LZMA 1TLAA 5J8YC 2RH1A 3HH5A 1LKYB 1DYAA 4EJ4A 241LA 4ARPA 1C6GA 1L04A 1L80A 3V2YA 1LYFA 1L43A 1QUHA 1L11A 173LA 1ZYTA 3GUMA 2B75A 2E8MA 3F9LA 1OWZA 1L32A 1OW5A 131LA 3PBLA 3CDRA 1L41A 1L65A 144LA 3FI5A 2E8OA 166LA 1L23A 1L86A 138LA 1L93A 4W51A 3DKEX 226LA 1L27A 5I14A 1Z1VA 1L61A 1L37A 220LA 1C6FA 1L00A 3HTBA 257LA 4AQNA 198LA 137LA 3RUNA 1C6TA 1LYIA 1CV6A 1L52A 4GRVA 6LZMA 2RB2X 3C7YA 2OU8A
chains in the Genus database with same CATH superfamily
1QQ5A 1A6SA 1UIHA 2G07A 185LA 1NDMC 3CDQA 4XJIA 3SAFA 4R65A 1C6HA 5KL8B 1KY1A 4YP3A 2GV0A 3M1YA 5G5HA 1LLHA 1XFPL 1I56A 1IOCA 3CSRA 1X42A 3BQ7A 2G4NA 5KFKA 3OGUA 243LA 5E9RA 1T4GA 4P4MA 1DK2A 2HBJA 4EELA 1C10A 1FO4A 5F9UA 3PR5B 1BQLY 1DYFA 2KKPA 3A96A 4YXCA 5AI6A 1F0MA 3MABA 2EDUA 1G0GA 1DOQA 2DKZA 3LHMA 1GDXA 1HFYA 4OO9A 1L72A 1S8OA 2IA6A 3GDXA 4KLLA 3WVXA 111LA 5J2DA 2HI0A 1QTBA 3CDVA 2I25L 2BCRA 1DXSA 3NVWA 1PQMA 2HCFA 4AP9A 1L96A 2ZYCA 4I8SA 1GE0A 1NF5A 1QT5A 4F91B 1BVKC 3RJJA 3EBAB 3EZ5A 1CUQA 2ES6A 1JXLA 1UC0A 2ZIVA 1XGQC 5DN4A 2QLTA 2PMZF 2ZJ5A 4TQSA 1IG6A 1AZFA 2B6XA 2W1YA 4Y2JA 3BZKA 1F44A 1IP4A 3B9JA 4F93B 2W8LA 4YOPA 115LA 5CWRA 1C6NA 1LW9A 1P2RA 4PJZA 3NY9A 4DDCA 1HENA 4M4OA 139LA 4QEQA 2F2QA 3KHGA 5KXKA 1ZQLA 1L58A 3AN1A 1DYBA 5KXNA 5FP0A 4AYBC 5LYZA 1LZCA 4CRXA 3PX0A 5IIOA 5LXWA 4I7TA 3UQ2A 1LSEA 4DEZA 1LMQA 2VKQA 3WKEA 5EWGA 2XIDA 4I2JA 4EENA 3HUKA 5I4XA 4G9SA 2NO5A 3W6EA 2VA8A 2K8CB 1SQ2L 3TXEA 4NL9C 1KIQC 2HU3A 3V7LA 1L67A 5KXSA 5KFPA 4QZAA 3MDAA 1L92A 2KVSA 4NM2A 4DL4A 2FDRA 1X9WA 227LA 1L10A 2RBSA 2XJWA 1U48A 4GCBA 4DSEA 4L41A 2HBLA 1CU6A 1L53A 2LYZA 2AJQA 2OEAX 2WTFA 1WCNA 1KSPA 5IIIA 4BUGA 3DN0A 3W3EA 4LZGA 1GB0A 5D4BA 3RH6A 3C5FA 1NBZC 1U45A 2P6UA 5CR0A 1ZOLA 2ZTCA 5L1MA 1G7MC 4TUNA 5LA8A 2ZIUB 4FZNA 4JB3A 4LZDA 4ECQA 5KT4A 4H91A 1GD6A 4LYBA 4NGJA 2XBSA 4NLKA 4RUAA 3OHBA 2R8HA 5J0WA 5FSTA 3V72A 1JEFA 1QT4A 4DL3A 3OTQA 1L3VA 1OUDA 4P0QB 3AB6A 4KLQA 1GXV2 1L66A 2LZ2A 2JRZA 1DI3A 2D4JA 2ODGA 1L56A 2EANA 3HU9A 4GBRB 4EKSA 8ICQA 4DD2A 4N0JA 1L7OA 1GF5A 2L5YA 1ZVYB 3SQIA 2KJ8A 2ZJAA 1XGUC 5I5QA 4R64A 5AICA 238LA 1ZQHA 1XEJA 2MEIA 5J2CA 4CFPA 3KHRA 2K4IA 4QDNA 4UB5A 2BLXA 8ICEA 2ATLA 1GFHA 2LZMA 2CDSA 4O3RA 4RNMA 1L7MA 2D6FC 1SLYA 170LA 2E1FA 3ONNA 2HHTA 1B5YA 1L03A 181LA 4ECSA 5ILFA 5KFDA 5J2GA 3HDFA 2YBHA 4BAPA 5AKYA 7ICIA 1LJJA 1XGTC 2ZTDA 1ZQZA 1OUAA 4LYZA 2I5HA 4PPXA 1EQ5A 4GCEA 1BVSA 5AKEA 7ICEA 4PRUA 2ZTEA 4J0LA 3TXBA 1L55A 4HV1A 2ESEA 2B21A 3EPGA 4LYTA 1LZ1A 2BQGA 1YT3A 1MELL 1KW7A 1U9LA 1C6QA 3RF9A 1TAMA 3QE8A 194LA 4ARJA 3T36A 1L64A 4WM5A 4WG7A 195LA 1JUGA 5J0RA 5ALDA 5KT7A 4I7MA 3RJGA 2RQ5A 2I26L 4G9BA 5ALHA 3IDWA 4GIBA 4ELVA 1JI7A 4K4IA 7ICHA 1JTNA 9ICIA 4O5KA 1GBXA 3CQLA 5I4YA 1RQLA 2DFLA 2VJ5A 1H38A 1JQUA 1X40A 4QZIA 4O3SA 7ICJA 1L89A 1LHJA 5AI5A 5APEA 3SB8A 1RYUA 1S97A 3IRUA 2YDGA 1K28A 1UIBA 4RW1A 1O08A 2ZXHA 3QU4A 1ZQVA 1LMOA 3ALRA 1YQVY 4M6WA 1VDSA 4YXAC 1ZQEA 3WL2A 4WG1A 5IIKA 4IQWA 1CI4A 2G4QA 3DNAA 214LA 1ZRMA 5DLFA 3OK0A 134LA 5ILCA 3WW6A 5AM1A 4C4TA 3C21A 2KVCA 5DQGA 3NVYA 2C28A 168LA 4WM6A 246LA 5B05A 4O3MA 2ZJ8A 4C8MA 251LA 3GIMA 4JV1A 4CF5A 1N63A 2OH2A 1WTHA 3GXKA 3I1YA 4O3NA 3N9AA 4JV2A 4WM4A 1C6LA 4RQ6A 9ICAA 1L39A 4UB4A 3SB6A 3HT7A 2MEEA 2W1XA 1CEZA 1D9DA 1SKRA 2ZQ3A 4QZGA 2QARA 3NYAA 3O0FA 3AZ6A 2Z18A 4YF2A 2HEEA 1TK5A 153LA 3HH4A 4ICAA 4BX9C 3TFSA 2DQFC 3IG8A 3ODUA 1DGJA 3AQEA 8ICOA 2DKVA 7ICOA 3FAHA 3WKCA 4O0IA 3TACB 5KL1B 240LA 142LA 8ICNA 8ICUA 1Z55A 4NLGA 2H9KA 7ICQA 4OWHA 4DD7A 1J1OY 103LA 1JSEA 4I2AA 5LVIA 1LZ4A 1GF4A 4NGKA 3L2XA 2DBYA 1GFAA 1GE3A 1P46A 4KX5A 4DF4A 4PHAA 208LA 4ZH4A 4DOAA 4I7SA 4KLJA 2OU0X 4YD2A 184LA 2WARA 1GF0A 1LB2B 2KNJA 3G3VA 4I7KA 5FDJA 3WMKA 209LA 2YTUA 1L08A 1I1ZA 4QWDA 3H8JA 1P7DA 2W1LA 5KJ9A 2QB0B 4EYHB 5KXXA 4Y2XA 1IIZA 8ICTA 1LZAA 3HTGA 3P65A 9ICPA 2W9CA 1IR9A 1NJZA 1YAOA 2RDJA 1JN3A 3TKAA 1ZQJA 2KG5A 4KLUA 5KXPA 5I4WA 3LVWA 1IORA 4DOBA 5ALWA 4OWBA 2Z12A 1ZQQA 3K1RB 2G08A 2FPKA 1GB7A 4YQWA 4QWBA 4ECRA 1CNSA 1QUDA 5AK3A 5KFFA 3G3XA 1JITA 1NK0A 8ICMA 8ICAA 1GF9A 2DQAA 1B5XA 5AM4A 4GN5C 1QIOA 2A7FA 1L82A 4BWJA 1BWIA 4G4HA 5II3A 5AK5A 4IQVA 1SIJA 3H4BA 1SGGA 2B74A 122LA 3B0IA 4HP0A 3QNMA 4ZPUA 4DWXA 4I2IA 4N1EI 193LA 5DBCA 4DQRA 5CRXA 1CU3A 3D2SA 1X9XA 4F5PA 2VA3A 3GUNA 5DM9A 2AGOA 3TXFA 3FYHA 3HRDD 3HT3A 1OVKA 1IEEA 5APFA 3JPTA 2KSOA 1N4FA 7ICMA 5KTQA 2HECA 1L25A 3RZ4A 4QIWC 3H8MA 5KFAA 1QUSA 4EMNA 4XYYA 4BADA 213LA 5M1YA 8ICWA 3IV6A 1TK8A 1J2NA 8ICGA 4Y2RA 2OE4X 2ZUBA 2BQAA 4IL6U 3K75D 1LHIA 1L07A 5I53A 4HYKA 3TI0A 1IR8A 4ED3A 4RT2A 4QJFB 1L88A 3ICXA 2RBNA 3MR6A 3BJYA 5KFYA 1J97A 2Z6BA 4J1BA 5IHGA 1BNPA 2C2RA 4KMOB 150LA 4C7ZA 1T3PA 1N5XA 3SD7A 3BQ2A 2RHFA 2GLEA 5AKHA 4I7QA 4XJDA 3CT1A 4F5NA 1N62A 8ICSA 1NZPA 3AZ5A 4R0FA 4TSCA 4I7OA 5B1FA 2YVBA 1L84A 4UB6U 4OW1A 5D5CA 2EKSC 3N7PD 5CA7A 4W53A 219LA 2W3SA 5HMMA 4AYBF 1IWZA 2BQOA 3RR8A 2LYMA 1L17A 3TXKA 4BXOA 4HPIA 1A4VA 1L77A 5ALPA 1B5WA 4Q44A 1AQ6A 1ZQUA 1P36A 2MEBA 4I2DA 1ZRNA 199LA 1FLUA 5L1LA 4YENA 1BPBA 9ICVA 4RQ2A 3Q8RB 4NSIA 1Z1BA 1ALCA 1CTWA 4KITB 1XSFA 2QARC 4BWMA 2E3TA 3KFUF 5F9NA 1ZURA 3C82A 4FE3A 1D3MA 4C8OA 4G4BA 3JPSA 2YX8A 1MQ3A 1VAUA 1N56A 1LSZA 2EAOA 1G7IC 4M04A 1JTPL 5LAFA 2BQUA 1LJFA 3DN1A 1F5SA 2RBRA 2Z39A 2NO4A 2YMLA 2L78A 5KFSA 3TMXA 1GB5A 3WU7A 4Y2QA 112LA 4YMMA 2ALZA 9ICLA 1LMAA 2ZIVB 4XJGA 4BDPA 1WQMA 1JALA 1HEOA 1L29A 1VDVA 3KZXA 3OSPA 3M7DA 4KLDA 3M9NB 1LI3A 4J9RA 2K89A 1GBZA 4OJ5A 5KT2A 2ANVA 2OTZX 3M3UA 1X66A 5KG4A 1KBUA 1IP7A 3PVXA 3C2MA 4F50A 1KDHA 1LZBA 1BPZA 3GV8B 1GWDA 4KT3A 4RPZA 3JPPA 1URJA 5J2KA 4I0CA 4XJFA 1NJYA 3AEVA 4N9RA 5AIBA 4EJ4A 4GLAA 3ULRA 2NV3A 1V7SA 1IP5A 3ZVQA 5HMVA 3F53A 4H9EA 3B0YA 4EBCA 2ZXIA 1SB3C 1LVHA 3PO5A 4XADA 4BS7A 1EQEA 5C0YA 3F9LA 3N9EA 1OUBA 1OW5A 1V97A 5DQIA 1NDGC 4U7CA 4UWUA 3PBLA 5JENB 144LA 3FI5A 3AQFA 4YEOA 3N4MB 3LZTA 3S6JA 3Q8PB 3DKEX 1FKVA 1WQRA 2XBRA 3KHLA 2LHTA 4TUSA 2JZBA 1GE2A 1Z1VA 5BPCA 2BQHA 4ZFPA 1L00A 3HTBA 1X2IA 7ICLA 1F6SA 1BPDA 198LA 3QUQA 3M8RA 1U47A 1FN5A 3TXDA 1CV6A 2OCEA 1UIGA 2PC2A 5HLLA 1EQ4A 2XCAA 2H3FA 3NUQA 2OU8A 1JKCA 4Y2SA 3AL0B 1UCOA 1EPYA 2RAZX 5KFVA 210LA 2BZFA 3RZEA 197LA 2BCSA 1BNOA 1L30A 206LA 9ICRA 4I2BA 1B7MA 1S5LU 4UBCA 1ZQYA 4Q45A 2XGPA 1TAUA 4HJYA 1A77A 4RQ5A 1V9PA 1L06A 4J9PA 4M9HA 4W94A 3A93A 1DRGA 1Z3EB 2ZUDA 3RFAA 1ZXIA 2KK0A 4YN4A 2XY5A 4UASA 4O9MA 1LSGA 4DQ7A 1C63A 4DAJA 4WO9A 2ZYPA 2LPEA 1IP6A 2JH1A 5AKXA 4NHPA 4EKQA 2AXTU 1UICA 8ICIA 1ZD4A 2HUKA 4I7PA 1TEWA 1SWYA 7ICRA 1PVQA 4P2EA 1C6IA 4B9SA 3RB4A 1S10A 2F76X 4NG1A 4W59A 2N5ZA 1V7TA 3UMCA 1JJ3A 1GB8A 1LYOA 2BQBA 4P0PA 4YCXA 2AGPA 1NK6A 2B6TA 5DBBA 188LA 1INUA 5APCA 7ICFA 2WFAA 1NI3A 1WWVA 2WHEA 5EE9A 4DO9A 1AKIA 1T3QA 3PMNA 1OVJA 4ED0A 1LKYA 5CB1A 2PFPA 3SV3A 3B72A 5DL9A 1Q46A 3HBHA 4GLXA 5KT3A 3G3BB 5DB9A 1WVUA 3PSTA 1HSWA 2ZUCA 2IMWP 3PZPA 9ICQA 2YMQA 1L85A 3C8QA 3D2NA 3HT6A 5F3XB 1HIWA 1L01A 4J7VA 4DWIA 1QTCA 3TMVA 2P6RA 1LHLA 1AROP 3ETRA 4NGIA 3UQ0A 1IXRA 4KLFA 113LA 4ETBA 1TV9A 4NLCA 2MAXA 2F2AB 1L7PA 5J0XA 4EBEA 3SR6A 4DD9A 1G0PA 9ICSA 4J9LA 1KY0A 4M6WB 4FFDA 4P2HA 4II8A 4J9MA 4W96A 3H8WA 1RYSA 1JKAA 1GPQC 2AQ0A 2F1HA 3ZDBA 4W52A 2KZ3A 4ACOA 3FE0A 2KOBA 5HNCA 4QZ9A 5DDYA 4RT3A 6LYTA 3OJUA 1ZETA 1GDWA 5DBAA 4KN7A 5FHWA 1LYEA 187LA 5IDDA 2UVUA 1UIDA 3C1YA 2OEHA 4CHXA 1GO3F 4EX7A 1L0KA 3NTUA 1QUTA 2A1AA 1CJ7A 4WLYA 2RB1X 1SXDA 1SL0A 2KFNA 3RRHA 4LDLA 1C62A 2IBKA 2G5HB 1ZQXA 1LPIA 1LPYA 2QARB 1L28A 4B1AA 2DBTA 1LJGA 3QE9Y 2M0NA 4W57A 2BQRA 1PK3A 1XSPA 2Y0SC 1PQDA 1GFEA 4PK0A 3PSIA 1N48A 2E8PA 3M9MB 5HNLA 2BLYA 2ISOA 1QSWA 4B9VA 4H8YA 5HP4A 225LA 1HSXA 4Y2UA 2C8OA 3BQ0A 4W55A 5F81A 3SBBC 2GO7A 5DG8A 5KAFU 4B9UA 2C8PA 4H9BA 2MRLA 3GV5B 1QUOA 1Z00A 1J1PY 3HX0A 1L05A 3LVVA 2BQLA 3DN4A 1PQJA 2FJ6A 5J0YA 5AK6A 1ZQSA 2KJ9A 2HHSA 2LM1A 2BHNA 4W56A 4J9NA 1SL2A 1VFBC 9ICFA 1SZPA 239LA 2YN4A 2B6ZA 3HH3A 4JWMA 4DSLA 177LA 2ASDA 3MDCA 1B4FA 4DDBA 3QUCA 4J9QA 201LA 2UVVA 2V4RA 4DFDA 200LA 2JEJA 3IJUA 1NK5A 1KIPC 4HJVA 4E0DA 4OJ6A 1JJ0A 8ICPA 4QIWF 3MGIA 1KFSA 1L90A 4IR9A 3GUOA 1JISA 4DS5A 1D3JA 2WF6A 1L83A 4GXJA 2A3VA 2YBNA 169LA 1C6MA 1GF6A 5K4LA 2XGQA 2W9CB 2C2DA 1H87A 3PSPA 1CU2A 4IS7A 1LZ8A 2XI9A 3ED5A 1P64A 5J2IA 3HU8A 2I1QA 2PFNA 5AM2A 4UAUA 1V85A 3ISBA 4I2GA 4I29A 4WL7A 2K8BB 2BCQA 4KLMA 4LYOA 3A0BU 5CEHA 3CB7A 4M9GA 3VW7A 1OYUA 4CNQA 5B07A 4DC4A 2CGIA 1QQ6A 1LYJA 4MCKA 1IO5A 1LZ9A 2EH9A 3T5LA 1W6ZA 2CWIA 4PJ2C 3AW6A 1IOTA 1I6SA 1L40A 4DD1A 5A0LA 1S76D 2F1JA 3HBEX 5LYTA 5KY1A 3TADC 1CKCA 4ARMA 3PW7A 1XS9D 2W43A 3A8ZA 4MHVA 4WJ3B 5J2AA 3C7WA 2K8AA 1IWYA 1QSSA 1KLNA 2ZWBA 2ZIKA 1QSQA 8ICKA 4QZHA 2EZZA 255LA 3SAGA 1S0NA 4JK1A 5TZVA 4LT2A 3CSZA 3E58A 4WO6A 2F47A 1CX6A 4ARQA 4CF4A 2JHDA 3T79A 3KOOA 1L99A 3PW5A 1L22A 2O6KA 2XC9A 4GXKA 1KL9A 3H0LB 5AKZA 4PHPA 215LA 3V7JA 4DLEA 2YSSC 3EMLA 5J0PA 4IRCA 3T6UA 4H92A 1PZNA 178LA 1DYGA 1GFJA 2XVTA 1OXJA 1C64A 1XEKA 1B7PA 2W04A 2EQYA 3SEIA 4GN4A 5TISU 4GLVA 2KIWA 2F4AA 1CV0A 3PMLA 8ICYA 2Z7JA 5J29A 4DQIA 3RBDA 1CVKA 1SWZA 3TANA 2HSZA 4I2EA 231LA 2OU9A 1L24A 4WM1A 4B4EA 2KZMA 247LA 3CT5A 3GU3A 4PL2A 3WK9A 3RJIA 1S0OA 3SMVA 4PGXA 1QSLA 2HVIA 3GILA 120LA 4S0WA 4PL1A 2DPJA 3SN6R 5LZMA 1T8GA 2R18A 2YBLA 4FBTA 1B7QA 4BXOB 1QS5A 1GB6A 2DQHY 1LI6A 4LYMA 1BHZA 8ICZA 3A34A 3ZDCA 1JRPA 2FMSA 1L26A 245LA 9ICWA 4NGZA 222LA 3PY8A 3RRGA 4XUSA 2Z2FA 5L3HA 5DG7A 2C2EA 4C3WA 4ZEEA 1MA7A 1N61A 3F2DA 3ISCA 3T3FA 1JTMA 1LSYA 4YVZA 3SB7A 2VJ4A 1PVRA 3AGHA 5HMJA 2W7PA 1JWRA 7LYZA 3NASA 4NV0A 2AU0A 3RJKA 1L45A 4EYIB 1QT7A 1XJTA 2PFQA 2Y8PA 5AI8A 5KFLA 1LYZA 3MGVA 1RXVA 2H3IA 3PX4A 1A76A 1C46A 3PO4A 3E2EA 1P5CA 4LDEA 5KXYA 3K4GA 4PHDA 2CUUA 1D6QA 3IJVA 4NFVA 4F4ZA 4FJRA 2FLNA 4E97A 1LKRA 4DYGA 4NSGA 4K4HA 3QUBA 2LMRA 3HUQA 2K4EA 1L48A 1LJIA 1JTTL 4Y2PA 5EBHA 4DT3A 2BCVA 1IC5Y 3H4DA 1DGSA 1T6VL 3AU2A 4RQ8A 4EOFA 1H6MA 5KG6A 4PH5A 1VATA 1G7JC 3ZVQB 4QWAA 3TXGA 3A0HU 1FBIX 4F4XA 2FYCA 3AMZA 2Q0MX 4DL7A 4RQ4A 4ECYA 1NK9A 3E0FA 4TWSA 2IOFA 1L6NA 1DQJC 1OUCA 2BQNA 2RSCA 1BWJA 2VIXA 4F4YA 1GBYA 3ORYA 217LA 4NHQA 1IWWA 3EYZA 4HSFA 3P68A 1BPXA 1LZDA 2OYYA 1V38A 1YKZX 4PZNA 5EE1A 1EL1A 1WYGA 1LGWA 1YILA 2EQLA 4DD3A 4UBBA 3M6KA 5ALEA 4Y2YA 5J2FA 2BAAA 9ICEA 5EE0A 3ISDA 4KX3A 4UB2A 1L12A 3F5AA 5ALSA 1GFKA 2HUMA 4J03A 2IHNA 1ZQWA 4UATA 4LJXA 3GXRA 1IM4A 1GB2A 4C80A 3A90A 3HKZC 3DN6A 1L91A 2WF8A 4C5FA 1RCMA 5HHHA 1PQKA 1BB7A 1G0MA 4UW9A 2AUBA 3WYHA 2Y1IA 2KEYA 3BS5A 2NRXA 1QT6A 1TFRA 1QT3A 2E1EA 1LJNA 1DYCA 4A8EA 2JXJA 5J0OA 4H8XA 1SSWA 1YAMA 4Q8EA 2PFOA 221LA 1N5WA 1JJ1A 4O3OA 4ED7A 4NG8A 2HHWA 1KKXA 250LA 5KXZA 182LA 4IQUA 2HEBA 2JEIA 2RBQA 8LYZA 2B72A 4J1AA 4GXIA 3KZIU 1OVHA 4M6DA 1QSBA 1L36A 2HHUA 1JX4A 4HTKA 2XICA 4WM3A 151LA 2WAQC 5LIOA 4KMUA 1G06A 1LSNA 232LA 192LA 2XCPA 3JPNA 2KP7A 4P0PB 1CU5A 1LZTA 1UIAA 2KMDA 104LA 4ED6A 1HUZA 2NRVA 1NK8A 4LZMA 4TQRA 5KFEA 2HDOA 4E3UA 1BVXA 4F8RA 1TLAA 5J8YC 3UXOA 3HH5A 1LKYB 1DYAA 2DQJY 1TVAA 4RPYA 2F1IA 1PZYA 2Z37A 4IJ4A 3HFMY 2HHXA 1L80A 4KLSA 1D8YA 5D46A 2HEDA 4B49A 1L11A 1ZD2P 2G09A 3R9KA 2H3VA 4XA5A 1RE2A 7ICSA 1OWZA 2X0AA 4CJ2A 1YIKA 4KPMA 5I54A 3C29A 3KAMA 3BQTA 3LZ2A 2KJ5A 3A6BY 4PRQA 2XO7A 1TAQA 3A94A 3RAXA 3CDRA 1L41A 2VANA 2E8OA 1COOA 5AKGA 4DSJA 1DKKA 1HFXA 1DK3A 1NHEA 138LA 5DLGA 1D9FA 4BGDA 4YM8A 1REXA 3FDSA 2Q4TA 220LA 1UACY 8ICLA 3WUAA 3CSQA 4AQNA 5LINA 4RQ7A 4TUQA 5D5FA 3C1ZA 1C6TA 5J2HA 1C08C 3RW8A 1FFUA 3RB0A 1L52A 2EPEA 4GRVA 3WK7A 1WQPA 1B22A 3C7YA 4C0ZA 2G06A 2BQDA 3MGWA 1QSYA 2AGQA 3L5KA 3Q8LA 3TMUA 3RR7A 3UXPA 2LHMA 2CPRA 1GBSA 1RFPA 1REZA 1T8FA 6LYZA 5JU5A 4H8ZA 1X6JA 4OWEA 5KG5A 4Z3MA 5FCPA 4EKPA 4USAA 164LA 3GIIA 1JHLA 3EXDA 3HH6A 2KD1A 4R6CA 3OJSA 1PK1A 3DMVA 4OWAA 1XU4A 1OUGA 1QLNA 4WMGA 2KTQA 3B0OA 2W9AA 1FLYA 1D2YA 1JKDA 3G3AB 3AU6A 2F30A 2B6GA 2KHQA 4YFKA 3T5HA 4Z6DA 110LA 4C7YA 2KKVA 1MN8A 4UB3A 2OE9X 4R8UA 5AKIA 4IQTA 5ALNA 4G3IA 2B7XA 2MU2A 3RTVA 5LAGA 2OM6A 1KNIA 4LGKA 1A2YC 4Q43A 1T6HA 4LT1A 1LV5A 2DUYA 3OE0A 5ALYA 4ZOHC 149LA 2Q9EA 1P2LA 1KXXA 3WW5A 1C60A 1Z00B 2MUTA 4LFXA 3TXIA 3RB3A 3HDEA 5DB6A 4NXZA 3GIKA 3D2QA 1C6BA 1HEPA 1C6PA 1QTZA 4ELTA 1L69A 1JMSA 1QCKA 162LA 3LYSA 4RW2A 163LA 3RT5X 3RJEA 2DQDY 4DQJA 2PMZC 1LSPA 1ZQNA 2WB1C 3RNXA 4OCZA 3C28A 5LVKA 4NIJA 2ZIUA 2W9BA 2QB1A 1L51A 1IIPA 5ALJA 2XQOA 4P4PA 1K1QA 2FE9A 1T8AA 4NHTA 1G1WA 1UIEA 1DYDA 1G0QA 4GFJA 3AZ4A 3J81j 4DF8A 2BCUA 2NRWA 3C2LA 2A7DA 4DDAA 4ARLA 5J2EA 3AJNA 3B0KA 4NM1A 4QWCA 9ICKA 3WXTA 1JIYA 1GF8A 2D91A 1J2MA 102LA 1TCYA 3PX6A 1LSCA 2YBMA 4MR1A 3SB5A 4DSIA 2HOIA 2W3RA 1HNLA 1Z19A 1P3NA 1L3TA 3ZDAA 4HPEA 3SYZA 1UT8A 2Z19A 1GE1A 1KIRC 4M9JA 174LA 4ML7A 2F77X 3Q8KA 1YROA 2FMQA 3N28A 244LA 3SBAA 1LMNA 5HNKA 129LA 1S0VA 1BB5A 1RJCB 1RDFA 128LA 1L15A 4ARMB 5AI9A 1L13A 4PZOA 2EAPA 2W1MA 2D4KA 2OXOA 3H0RB 1L5UA 1WQOA 3I76A 2EZXA 1HJPA 3DMZA 2D3DA 223LA 4CGZA 1SSYA 3NY8A 5E4PA 1L18A 3AGGG 207LA 2W8KA 4NY8A 1UA6Y 1K1SA 1JSFA 3PNCA 3TXHA 1IP2A 1IOSA 4DKLA 1LWGA 4OO1J 1L20A 5CJ7A 1VEDA 4ARQB 1C6DA 180LA 1XEIA 4PHEA 8ICBA 1L70A 5AI4A 3RAQA 5AKJA 1QTKA 5KG3A 1ZQDA 1PQIA 3DN3A 4JUZA 2F8KA 1LHKA 5FELA 3AM9A 1L0JA 1OUEA 4AXTA 4ANRA 5KFGA 3GQCA 1HF4A 3QU9A 4UAZA 127LA 5AIAA 5AKLA 1CJ8A 2HULA 1ZQKA 2VB1A 3M8SA 4B4IA 4KN4A 3SP3A 1DPWA 4F5OA 1L8LA 1ZYQA 1L34A 2UVWA 1OV5A 3GUJA 4YR0A 126LA 4AGAA 4J9KA 1L63A 3SB9A 5ALGA 123LA 2FBDA 1L95A 2HEAA 2E8NA 2MA1A 3UXNA 1MSWD 1XJUA 5EE3A 1L79A 1N2XA 4HV2A 3HJEA 133LA 1IX0A 4O5CA 1IY3A 2BQFA 3FC4A 5DB7A 1CV4A 1LZNA 3CDTA 2PI4A 2HOQA 4NY5A 260LA 2DQIY 2MEHA 1VJ5A 2BPGA 4H90A 1UT5A 154LA 5KXOA 1F10A 3NRZA 2LBOA 1N60A 3FA0A 157LA 1L74A 4EKRA 2H9JA 3OE6A 3ATOA 4NHIA 1BPYA 3LDAA 3V2WA 3EW9A 5CHGA 8ICXA 1HEMA 2BGWA 1C68A 1JKBA 4CGEA 3HWTA 1CV3A 4XJBA 5C6LA 1LJHA 4FS1A 1L31A 1L42A 1MLCE 190LA 1DI4A 2A1JA 5FEKA 1FKQA 4TTDA 5G5GA 3TADA 3QXGA 2JV3A 1UA0A 5DGAA 1CKDA 4XENA 5DN5A 4X3BA 1PS5A 2F44A 3Q8QB 3UPQA 2I9GA 4GCFA 4BJQA 1BWHA 3HKZF 1C69A 1G7LC 5GTIU 1IC4Y 3HTDA 2WF7A 171LA 5KXMA 1U49A 4GN3A 4UB1A 5ALIA 1B7SA 4YD1A 2NRTA 1NOMA 2DL0A 3A92A 2DWQA 3ZDEA 2OTYX 3TAPA 2OWOA 1AT6A 3C81A 1B7NA 1JROA 4NWHA 2M9NA 3MC1A 242LA 4Z6EA 2H5XA 1RQNA 2EZYA 4O3PA 9ICHA 1AM7A 3PV8A 4UWVA 4FO6A 1GB3A 3I28A 3AUOA 2YQEA 1G07A 4W58A 2R8IA 1D0MA 2QKQA 3HBDA 5EWEA 4KL7A 4U6PA 2ZILA 5ALUA 2WAQF 3UMGA 4LFPA 7ICGA 212LA 1KN5A 3WKBA 1ZQFA 5KG1A 1L19A 1Z4NA 125LA 1T97A 1UA1A 2FMPA 160LA 5BOMA 3ETLA 1XGRC 1L57A 135LA 1YAPA 2CN1A 1LZ5A 4EZ9A 9ICCA 1LZEA 1IV8A 4DS4A 4LDOA 1T3NA 3GZFA 3NGDA 1NK7A 4ETAA 1RM6C 1JUDA 4CDGA 1X9MA 143LA 2KE7A 3BS5B 4NGOA 1D8LA 4Y2TA 3N7SC 2ZNWY 2P66A 4ET9A 2CXYA 2BPFA 2ZIXA 1TE2A 2IOHA 4Z6FA 1NKEA 3BDPA 1CV1A 5B06A 4H9HA 3RBEA 1NQIA 2IOFK 1DKJA 3WK8A 218LA 1HELA 1UBZA 2F3NA 1ZQCA 5KFIA 3MFHA 1RPLA 189LA 3KHHA 3NVVA 2FBBA 4TX7A 3BKVA 5KFJA 1L59A 4B9NA 4B9MA 1GEVA 2IFFY 2KHVA 5K7OA 5J0TA 1L38A 3BQ1A 1JIHA 2IGCA 3DN8A 130LA 4I27A 4OWCA 4BAFA 3A3QA 1XC9A 2BQKA 5IELA 4JWNA 1VLBA 4KLOA 1U4BA 1JTOL 4DOCA 1C20A 4MSTA 1HEQA 9ICXA 5F16A 2W9MA 5LA5A 3QZ7A 2BQEA 2LYAA 2LM4A 1L68A 148LE 2YBJA 5KXRA 2HEFA 2XTHA 2RBPA 4GCDA 216LA 3EO5A 2GH1A 2H5ZA 2K4HA 5KT6A 5L1IA 4DFMA 5AM0A 1S9FA 4FZLA 2BDPA 1Q3UA 2BQMA 3GUKA 4I2HA 3NVZA 156LA 4RU9A 3QNGA 1BB4A 1Z4OA 3Q8SB 1GFRA 1L62A 3H0MB 3G6VA 3UONA 5HHIA 4ECUA 1KS3A 4PGQA 3MR2A 1P37A 3HT9A 4ETCA 4H9IA 3JPQA 1L50A 3WPLA 2HVHA 1HERA 4KTQA 2OHFA 4JMUA 4UB8U 1RYRA 1L73A 8ICHA 3WU9A 4US8A 1Q3VA 1C45A 1NKCA 3SAHA 2F32A 1KEJA 1L14A 8ICJA 1NKBA 1LYHA 4QNLA 5KFZA 159LA 5ALQA 4QZ8A 2HOFA 1P6YA 8ICCA 1LHMA 1UPHA 1IWUA 1D3NA 1ZJMA 4NEBA 3KKAA 1L46A 3PW0A 4O3QA 3EMSA 1ZQIA 3QYPA 132LA 3V6KA 3C83A 5KXTA 234LA 1G0LA 1LOZA 2D6BA 2YBIA 2WB1F 5KFOA 3TARA 1XO0A 2LCBA 2RBOA 2Z2EA 3A95A 4F4WA 1B5VA 2KSOB 4EBDA 1B5UA 2B70A 152LA 3LK9A 1PUZA 5KFBA 4F2SA 1OV7A 3FADA 2ZIJA 5CP2A 1WQNA 1S0MA 3B0XA 1L21A 3LYOA 1PK1B 4M0AA 5C6IA 1D2WA 2EIZC 3VCBA 1C6EA 3A67Y 5ALXA 1TBYA 3OHAA 5ALMA 3H7IA 109LA 1ZD3A 4F71A 1LYSA 4TSBA 4R8UB 4OJOA 5AM5A 165LA 3ZEKA 1AT5A 2Y9UA 1OUFA 2RDIA 4OJLA 4QW8A 4I7JA 3EWAA 1B0XA 4RQ0A 2DGZA 3C8RA 5KKIA 2V9WA 4I28A 4IATA 1ZMYL 1GF3A 2BQIA 3WK6A 1GFTA 1QTVA 2E5SA 2H3QA 2MUTB 191LA 1LGXA 4HTNA 2Q0ZX 4EPFA 1Y88A 4IASA 2R8JA 4NLNA 2HHQA 1JPOA 4I7NA 1L94A 1LZYA 1UCVA 5J8YA 1LSAA 4QZBA 5L9XA 5T3FA 3DEEA 2HW3A 1NHBA 3RU5A 1XEPA 1BB3A 4YG2A 5DB8A 1O03A 3A91A 1LYGA 2FLPA 1DXJA 4O34A 1YL0X 3VC8A 4OOTA 5KFUA 2IHMA 1ZQ1C 4F3OA 4NGWA 1E8LA 2W9BB 4NLBA 4ARPA 1XO1A 1C6GA 1IWTA 1XGPC 2H3ZA 3V2YA 1L43A 1QUHA 4B9TA 2ZG6A 1J1XY 173LA 3TQ1A 1BB6A 1LTMA 2FPLA 1ZYTA 4UWNA 5KG2A 5E79U 1GFUA 5J7CA 4QZCA 5AI0A 4Z46A 3OPXA 4NLZA 5ALLA 4QWEA 1L65A 3LYMA 4ECWA 166LA 5ALZA 8ICVA 4MF2A 2G4PA 1B7LA 226LA 3LYZA 5HR7A 1L27A 5I14A 4N8ZA 1B43A 1NK4A 5DGBA 3A3RX 1ZQBA 5ALVA 1L37A 1L61A 1D8BA 1L7NA 257LA 1ZQPA 5KFHA 137LA 1SWWA 1XWLA 2BPUA 2FPMA 3ZDDA 5KFNA 5J0UA 3PR4A 4F72A 1WG8A 3WU8A 6LZMA 2W11A 1UIFA 2RB2X 4HJZA 4D9ZA 1ZQRA 5KXLA 3IP4B 3F6ZA 2KICA 1L3SA 4YMOA 1DYEA 228LA 3GULA 4NGYA 1LYYA 5KKJA 2N1RA 5ALFA 4DSFA 1L09A 3RB6A 4OOOA 4I7RA 7LZMA 1LI2A 2I6XA 5D49A 4LZTA 2NTGA 1GE4A 1NJWA 1NWGA 4UAWA 2RLTA 5F14A 3WKAA 2YMMA 1CV5A 3OE9A 3TAQA 4KLGA 1IY4A 4QZEA 2D4IA 2J6TA 5LVJA 3W6BA 3WH1A 1QTMA 3PSFA 5C6JA 167LA 4XRHA 249LA 3WPJA 1LZRA 256LA 2JZBB 2BR0A 2MEFA 1HEKA 9ICGA 4KLTA 1GAYA 1LCNA 4MEYA 1TK0A 1QS9A 1D0KA 4KLEA 3QY4A 4DQSA 1D9WA 2KIVA 4UAVA 3HPOA 4YX7C 3LWLA 5HR6A 4W54A 5KFQA 4U3XB 9ICMA 5A3ZA 3KKAC 5H2FU 1REYA 1L8OA 2ASLA 1P7SA 1L16A 1ZQTA 1GXXA 2JMGA 3D6JA 5IIMA 1ZD5A 3E3DA 1LGUA 4LYCA 1SZHA 4PJ0U 5J2JA 4YEMA 1C6AA 1KXYA 2UVRA 1YZ6A 4B0DA 3J6KA 5LVGA 114LA 4CFOA 1IVMA 2JEFA 2Y9TA 2PI5A 1L44A 1LJ3A 1LJEA 3PDSA 4CE6A 5IINA 1C6CA 2YMPA 3P64A 4FZMA 2R8KA 1KFTA 2ZIWA 1FLWA 4OJPA 4GCCA 3DMXA 4UQGA 1P2CC 5APDA 3MGHA 1G7HC 186LA 1LAAA 2ANXA 3WUNA 1L02A 1B7RA 2J6UA 3QX7A 1F6RA 4FDYA 4ECTA 2MECA 5J0QA 4Z98A 4NJ8A 4ED1A 1LJ4A 1KRPA 4QW9A 5J2BA 1UUZC 2BQCA 3N7RC 9ICJA 141LA 1YAQA 2NYVA 3F5EA 1G0JA 5KFWA 5AM3A 5L3IA 1CUKA 2A1JB 2YB1A 2G5IB 4Z6CA 4RZRA 2HHVA 4WM2A 5KAIU 229LA 3HUAA 4C4RA 1VDQA 1YZ7A 3SV4A 1KTQA 2HBKA 2B6YA 1CX7A 5EWFA 4WL6A 2G0AA 1CKHA 4EPIA 3MBYA 1XSNA 4ETDA 2JH7A 5KFCA 3KD3A 2MEDA 4ED2A 5KFRA 1KW5A 4YR2A 4GC7A 3BS7A 3N97B 4QY9A 4RUCA 4ECVA 3WK4A 2W03A 1KFDA 1IR7A 4F5RA 2Y0SF 1ED1A 1WWUA 2LYOA 4FS2A 2BPCA 253LA 2O79A 3ZI4A 4DQPA 1L76A 3CRXA 1S77D 4H93A 3K1ZA 1DZBX 2HBMA 2XY7A 1C6KA 1L49A 4DQQA 4ELUA 1SV0A 4RQNA 1ZVHL 5JUMA 3QEBZ 9ICBA 1IWXA 2LZTA 1QH9A 1YKXX 5KG0A 1CU0A 2B5ZA 3RH4A 1D6PA 1XSLA 1NZBA 8ICRA 233LA 3QEAZ 4MFCA 4ZIXA 2A19A 176LA 2DQEY 1NMMA 1IP1A 4RDSA 4A7DA 5L1JA 4NSHA 3QU7A 3HW8A 1LSDA 5KT5A 108LA 1TKDA 258LA 1IP3A 1OUHA 2K60A 4IC9A 3HWLA 1BGXT 4G4CA 2NWDX 3P66A 3WXUA 252LA 1C65A 3JPRA 1MC8A 4PGJB 2J6SA 5JTIA 4M47A 5B59A 4H9FA 3UMBA 1C7YA 3QU5A 259LA 1TDYA 1RZTA 155LA 2F8LA 1SKSA 3V7KA 3CDOA 1QSAA 4DJHA 1G0KA 2RP5A 4K4GA 4EEYA 9ICTA 3NS1A 4HAIA 4DFJA 3HT8A 5HQ1A 2XY6A 1F0WA 5KXWA 1QQ7A 4NHSA 2ZIXB 3W6FA 4IR1A 4WLXA 119LA 1D3FA 3WVYA 2DPIA 2AHOB 172LA 1QTDA 4YR3A 1SXEA 4GC6A 1CRXA 3CNHA 4I2FA 7ICNA 2Q9DA 1ZQAA 3WULA 4F4KA 1GB9A 5A3EA 2LKYA 3F2BA 3IWRA 4ETEA 1GFVA 4I2CA 1LYDA 3ATNA 1COKA 2DQGY 4MFFA 1LMTA 1M6YA 1GBOA 1PVPA 196LA 4NSJA 3DDHA 4IRDA 2Z38A 4C4SA 4Z41A 2DQNB 3KBBA 5DKWA 1OUIA 2Y1JA 1IOQA 3D4SA 3U26A 1OP9B 2P35A 4MEXA 5L9JA 4OD0A 3WK5A 1HHLA 1ZQGA 5C5JA 3Q8MA 2KN7A 4J9OA 1SL1A 4PHIA 4H9AA 2HMXA 3H8SA 205LA 1X6IA 4P0QA 1O23A 3C8SA 5KG7A 3T5KA 3AYQA 3H40A 1L35A 3OSNA 5F9LA 1BPEA 5KFXA 107LA 2HUBA 4DFPA 2DKXA 1LZSA 1QTEA 3G6YA 230LA 2NTHA 1CUPA 4RPXA 3JPOA 1L87A 2ZNXY 4KXIA 5ALRA 2WF5A 3IM1A 3C2KA 3W6AA 4ED8A 1L47A 2PXIA 1QUGA 4YMNA 1X9SA 1OQMA 3C23A 3L3FX 2K4PA 4IRKA 1HMKA 4DSKA 1LSMA 1QDTA 3F8VA 1G1VA 4F5QA 1NNLA 235LA 1L81A 4QZDA 4YXJA 3RJHA 1SX2A 5DG9A 4KLIA 1B2KA 4UARA 1RXWA 1CJ6A 3L64A 2MEAA 4LT3A 1B6IA 4M9LA 3WKDA 1LZ6A 4CCHA 2GOLA 1B5ZA 4IAPA 2PKEA 4R66A 4LT0A 5B66U 1C43A 2YB4A 2RRDA 2W54A 3HTFA 3QUTA 4US9A 3RH5A 2A4TA 2D8CA 2W7OA 5ALTA 2IHLA 4XJHA 3B6LA 8ICFA 145LA 1NBYC 2F4GA 118LA 3IN5A 3MR5A 3HILA 1WTMA 3TXJA 3C7ZA 2B0CA 5JRTA 4WLTA 3ZD9A 1CKGA 2CRXA 3AGIA 2JEGA 3DV9A 5HMLA 3K3TA 1B7OA 3SI8A 3NRWA 1LWKA 3GUPA 1REMA 1SKWA 5B5EU 3K2RA 4RNOA 4C8NA 1KXWA 224LA 3OE8A 4O5EA 1A0PA 4DL6A 4WLDA 4TUPA 1SV0C 4B9LA 2O7AA 2KFZA 2WF9A 161LA 4XQ8A 1NKHA 4LVSA 3LN2A 4RLMA 1D0LA 1WQQA 1OWYA 2W55A 3C5GA 2LYBA 2AQ4A 3IHQB 9ICNA 1GFGA 1YKYX 248LA 4CF3A 4RQMA 3M9OB 1WVVA 5KNIA 4Y2VA 3ZD8A 1GEZA 3BZCA 1OUJA 3CW2C 158LA 4DCCA 2KZZA 211LA 3OJPA 2LYHA 4UAYA 4DFKA 1B0DA 254LA 4EX6A 2GWSA 3GFKB 3DN2A 4RQ1A 4EZ6A 1C6JA 3M18B 3CT0A 5ALKA 2BQJA 2NRZA 1P56A 5DLAA 4F2RA 1GHLA 1KW4A 1GF7A 1VDTA 3W6DA 3EUB2 3GIJA 1HC0A 4DLGA 3QZ8A 1ZQOA 1D9UA 4KLHA 5KFMA 7ICVA 3JR6A 7ICKA 2AH5A 4X5VA 1YL1X 3G3WA 3HP6A 5LVHA 2JR5A 4M2YA 4QGZA 1L54A 5AHXA 5ALOA 1LSFA 2RAYX 3W6CA 5GTHU 1KQQA 2HTXA 236LA 1HFZA 4DQ5A 3L4PA 3A6CY 1LMPA 2HU1A 1RG6A 5IIJA 2OE7X 3P4ZA 4J9SA 1IWVA 146LA 1VDPA 3TMWA 3BKHA 1L98A 1ECWA 4EEKA 4F92B 4RNNA 4R63A 4TURA 1L33A 3D3DA 1C7PA 1GAZA 5T14A 1LSBA 4EXMA 2BDUA 2RB0X 4N1CC 1C61A 2BKEA 1QDRA 1SWVA 4K5YA 4HTQA 4B4JA 3FM9A 1RI8B 3LZMA 3VWOA 2JGAA 4C8KA 4H1PA 4ET8A 2F2NA 2EAMA 1SV4A 2C22A 1C67A 3LWMA 1HUOA 1TAYA 2B73A 5B1GA 4PGYA 262LA 2CJLA 5DQHA 5EOZA 1WTNA 5J0SA 4MF8A 4H9CA 4XN6A 2YY6A 4RQ3A 3EPIA 2O4WA 4ECXA 1FIQA 1Q8KA 175LA 1IC7Y 4DL2A 2DQCY 2BQ3A 3WPKA 2DF4B 4P4OA 9LYZA 140LA 1PQOA 1W08A 237LA 1HMLA 1L97A 3LYTA 5AMYA 3G6XA 3GUIA 1EXNA 3TFRA 1XNSA 1UHUA 2B6WA 2QB0A 4DD0A 4FBUA 1FDLY 3GV7B 3V6HA 1C66A 2ISPA 7ICUA 7ICPA 4NL9A 4NWIA 3FI7A 3RJFA 2VA2A 2MSNA 5LYMA 2LC9A 147LA 3MFIA 3AW7A 183LA 1HEWA 2FI1A 1FEZA 1B9OA 4M9NA 1GBWA 1T7PA 1L75A 1L71A 3PW4A 5IILA 3SENA 3KTQA 3MR3A 2FYDA 1QTHA 5AK4A 4PPOA 1L60A 1T8EA 3J4GA 261LA 3UM9A 4NGLA 9ICUA 1NJXA 3QAKA 1LKSA 1DPXA 1ZWNA 2V4QA 1ZJNA 4Q8FA 3T5JA 4DL5A 3C80A 3WUMA 1OUQA 1LMCA 1UQVA 5KFTA 1MQ2A 1LHHA 4YXMA 1QT8A 5F9XA 4I7LA 1SX7A 5AKKA 7ICTA 4JV0A 2RH1A 3N9CA 4C8LA 4N5RA 1ZV5L 241LA 1I20A 4B6JA 1L04A 1K5OA 3THVA 1BGIA 1LYFA 2ZQ4A 2KV2A 4WOAA 3GUMA 2I6ZA 2B75A 2E8MA 1T94A 2ZIWB 5DDMA 1L32A 4G49A 2LI6A 4MFAA 1DI5A 1FFVA 4H94A 1JXEA 1WCLA 131LA 3IG5A 4NWEA 4QZFA 3WU2U 2MEGA 2ASJA 1CJ9A 3M6ZA 1FLQA 5BOLA 3D9AC 1L23A 1L86A 3CYMA 1L93A 4W51A 3V6JA 1QQYA 3QU2A 3PW2A 1LZGA 1ZQMA 1C6FA 3SZ2A 3F2CA 1WUDA 3AZ7A 1YANA 1CKFA 4NGVA 3RUNA 1L3UA 1LYIA 4RLNA 2FLLA 2R8GA 9ICOA 1LJKA 3CP8A 5L1KA 4ECZA
chains in the Genus database with same CATH topology
1UIHA 185LA 1NDMC 3CDQA 4XJIA 1C6HA 1KY1A 2GV0A 1LLHA 1XFPL 1I56A 1IOCA 3CSRA 3BQ7A 2G4NA 243LA 5E9RA 1C10A 5F9UA 1BQLY 1DYFA 3A96A 4YXCA 1F0MA 1G0GA 2DKZA 3LHMA 1GDXA 1HFYA 4OO9A 1L72A 3WVXA 111LA 1QTBA 3CDVA 2I25L 1DXSA 2ZYCA 1PQMA 1L96A 4I8SA 1GE0A 1NF5A 1QT5A 1BVKC 3EBAB 1UC0A 1CUQA 2ES6A 1XGQC 5DN4A 1AZFA 2B6XA 2W1YA 1IP4A 4YOPA 115LA 1C6NA 1LW9A 1P2RA 4PJZA 3NY9A 4DDCA 1HENA 4M4OA 139LA 4QEQA 2F2QA 5KXKA 1L58A 1DYBA 5KXNA 5LYZA 1LZCA 5LXWA 4I7TA 1LSEA 1LMQA 3HUKA 5I4XA 4G9SA 3W6EA 1SQ2L 3TXEA 4NL9C 1KIQC 2HU3A 1L67A 5KXSA 1L92A 227LA 1L10A 2RBSA 2XJWA 4GCBA 4L41A 1CU6A 2LYZA 1L53A 2OEAX 3DN0A 3W3EA 1GB0A 1NBZC 5L1MA 4TUNA 1G7MC 5LA8A 4NGJA 4H91A 4LYBA 1GD6A 2XBSA 5FSTA 1JEFA 1QT4A 1OUDA 3AB6A 1L66A 1GXV2 2LZ2A 1DI3A 2D4JA 1L56A 3HU9A 2EANA 4GBRB 4EKSA 4DD2A 4N0JA 1GF5A 2L5YA 1ZVYB 1XGUC 5I5QA 238LA 1XEJA 2MEIA 4CFPA 4QDNA 2BLXA 1GFHA 2LZMA 2CDSA 1SLYA 170LA 1B5YA 1L03A 181LA 5ILFA 3HDFA 2YBHA 4BAPA 1LJJA 1XGTC 1OUAA 4LYZA 1EQ5A 4GCEA 4PRUA 3TXBA 4J0LA 1L55A 4HV1A 2ESEA 4LYTA 1LZ1A 2BQGA 1MELL 1KW7A 1C6QA 3QE8A 194LA 4ARJA 3T36A 1L64A 4WM5A 4WG7A 195LA 1JUGA 4I7MA 2I26L 3IDWA 1JI7A 1JTNA 1GBXA 3CQLA 5I4YA 1LHJA 1JQUA 1X40A 1L89A 5APEA 3SB8A 2YDGA 1K28A 1UIBA 4RW1A 1LMOA 1YQVY 1VDSA 4YXAC 3WL2A 4WG1A 2G4QA 3DNAA 214LA 3OK0A 134LA 5ILCA 3WW6A 168LA 4WM6A 246LA 5B05A 251LA 1WTHA 3GXKA 3N9AA 4WM4A 1C6LA 1L39A 3SB6A 3HT7A 2MEEA 2W1XA 2ZQ3A 2QARA 3NYAA 3AZ6A 2Z18A 4YF2A 2HEEA 153LA 3HH4A 2DQFC 3ODUA 2DKVA 3TACB 240LA 142LA 1Z55A 2H9KA 4OWHA 4DD7A 1J1OY 103LA 1JSEA 5LVIA 1LZ4A 1GF4A 4NGKA 3L2XA 1GFAA 1GE3A 1P46A 208LA 4I7SA 2OU0X 184LA 2WARA 1GF0A 5FDJA 3G3VA 4I7KA 3WMKA 209LA 2YTUA 1L08A 1I1ZA 2W1LA 5KJ9A 2QB0B 5KXXA 1IIZA 1LZAA 3HTGA 3P65A 1IR9A 5I4WA 1YAOA 5KXPA 2KG5A 1IORA 4OWBA 2Z12A 3K1RB 1GB7A 1CNSA 1QUDA 3G3XA 1JITA 1GF9A 2DQAA 1B5XA 4GN5C 1QIOA 2A7FA 1L82A 1BWIA 4G4HA 5II3A 2B74A 1SGGA 122LA 3B0IA 4HP0A 4ZPUA 4DWXA 4N1EI 193LA 1CU3A 1X9XA 3GUNA 5DM9A 3TXFA 1OVKA 1IEEA 5APFA 2KSOA 1N4FA 2HECA 1L25A 3RZ4A 3H8MA 1QUSA 4EMNA 4XYYA 4BADA 213LA 5M1YA 2OE4X 2BQAA 1LHIA 1L07A 5I53A 1IR8A 2RBNA 1L88A 2Z6BA 4J1BA 5IHGA 150LA 1T3PA 4I7QA 2GLEA 4XJDA 3CT1A 3AZ5A 4R0FA 4TSCA 4I7OA 5B1FA 2YVBA 1L84A 4OW1A 5D5CA 2EKSC 4W53A 219LA 1IWZA 2BQOA 2LYMA 1L17A 3TXKA 4HPIA 1A4VA 1L77A 1B5WA 1P36A 2MEBA 199LA 1FLUA 4YENA 4NSIA 1ALCA 1CTWA 1XSFA 2QARC 3C82A 1ZURA 1D3MA 4G4BA 1VAUA 1LSZA 2EAOA 1G7IC 1JTPL 5LAFA 1LJFA 3DN1A 2RBRA 2Z39A 2L78A 3TMXA 1GB5A 3WU7A 112LA 1LMAA 4XJGA 1WQMA 1HEOA 1L29A 1LI3A 1GBZA 2ANVA 2OTZX 3M3UA 1X66A 1IP7A 1LZBA 1GWDA 4KT3A 4I0CA 4XJFA 4N9RA 4EJ4A 4GLAA 3ULRA 1V7SA 1IP5A 3ZVQA 5HMVA 4H9EA 4XADA 4BS7A 1EQEA 3F9LA 3N9EA 1OUBA 1OW5A 1NDGC 4UWUA 3PBLA 5JENB 144LA 3FI5A 4YEOA 3LZTA 3DKEX 1FKVA 1WQRA 2XBRA 1GE2A 1Z1VA 2BQHA 4ZFPA 1L00A 3HTBA 1F6SA 198LA 1FN5A 3TXDA 1CV6A 1UIGA 2PC2A 5HLLA 1EQ4A 2OU8A 1JKCA 1UCOA 1EPYA 2RAZX 210LA 3RZEA 197LA 1L30A 206LA 1B7MA 4HJYA 1L06A 4W94A 3A93A 1LSGA 4DQ7A 1C63A 4DAJA 4WO9A 2ZYPA 2LPEA 1IP6A 4NHPA 4EKQA 1UICA 2HUKA 4I7PA 1TEWA 1SWYA 4P2EA 1C6IA 4NG1A 4W59A 2N5ZA 1V7TA 1JJ3A 1GB8A 1LYOA 2BQBA 2B6TA 188LA 1INUA 5APCA 1WWVA 1AKIA 1OVJA 3B72A 1LKYA 5DL9A 3HBHA 3G3BB 1WVUA 1HSWA 1L85A 3C8QA 3HT6A 5F3XB 1L01A 4J7VA 1QTCA 3TMVA 1LHLA 4NGIA 113LA 4ETBA 4DD9A 1G0PA 1KY0A 4II8A 4W96A 1JKAA 1GPQC 4W52A 3FE0A 5HNCA 6LYTA 1GDWA 5FHWA 1LYEA 187LA 5IDDA 1UIDA 4CHXA 1L0KA 1QUTA 1CJ7A 4WLYA 2RB1X 1SXDA 4LDLA 1C62A 1LPIA 1LPYA 2QARB 1L28A 4B1AA 2DBTA 1LJGA 4W57A 1PK3A 1PQDA 1GFEA 4PK0A 2E8PA 5HNLA 2BLYA 1QSWA 4H8YA 2C8OA 225LA 1HSXA 4W55A 5F81A 3SBBC 2C8PA 4H9BA 1QUOA 1J1PY 1L05A 2BQLA 3DN4A 1PQJA 4W56A 1VFBC 239LA 2B6ZA 3HH3A 177LA 1B4FA 4DDBA 201LA 200LA 3IJUA 1KIPC 4HJVA 1JJ0A 1L90A 3GUOA 1JISA 1D3JA 1L83A 2YBNA 169LA 1C6MA 1GF6A 1H87A 1CU2A 4IS7A 1LZ8A 1P64A 3HU8A 1V85A 4WL7A 4LYOA 3CB7A 3VW7A 1OYUA 5B07A 4DC4A 2CGIA 1LYJA 4MCKA 1IO5A 1LZ9A 2CWIA 1W6ZA 4PJ2C 3AW6A 1IOTA 1I6SA 1L40A 4DD1A 5LYTA 3HBEX 5KY1A 3TADC 1CKCA 4ARMA 3A8ZA 3C7WA 4MHVA 1IWYA 2ZWBA 2ZIKA 1QSQA 255LA 4LT2A 3CSZA 4WO6A 2F47A 1CX6A 4ARQA 1L99A 1L22A 3EMLA 215LA 2YSSC 3T6UA 4H92A 178LA 1DYGA 1GFJA 1C64A 1OXJA 1XEKA 1B7PA 3SEIA 4GN4A 4GLVA 2F4AA 1CV0A 1CVKA 1SWZA 231LA 2OU9A 1L24A 4WM1A 4B4EA 247LA 3CT5A 120LA 4S0WA 3SN6R 5LZMA 1T8GA 2YBLA 1QS5A 1B7QA 2DQHY 4LYMA 1GB6A 1LI6A 1BHZA 3A34A 1L26A 245LA 4NGZA 222LA 2Z2FA 5L3HA 4C3WA 4ZEEA 1LSYA 1JTMA 3SB7A 3AGHA 5HMJA 1JWRA 7LYZA 1L45A 1QT7A 1XJTA 2Y8PA 1LYZA 1C46A 1P5CA 4LDEA 5KXYA 2CUUA 1D6QA 3IJVA 4NFVA 4FJRA 4E97A 1LKRA 4DYGA 4NSGA 2LMRA 3HUQA 1L48A 1LJIA 1JTTL 5EBHA 4DT3A 1IC5Y 1T6VL 4EOFA 1H6MA 1VATA 3ZVQB 1G7JC 3TXGA 1FBIX 2FYCA 2Q0MX 4TWSA 2RSCA 1DQJC 1OUCA 2BQNA 1BWJA 217LA 4NHQA 1GBYA 1IWWA 4HSFA 3P68A 1LZDA 1V38A 1YKZX 4PZNA 1EL1A 1LGWA 2EQLA 1YILA 4DD3A 2BAAA 1L12A 2HUMA 1GFKA 3GXRA 1GB2A 3A90A 3DN6A 1L91A 4C5FA 1RCMA 1PQKA 1BB7A 1G0MA 2AUBA 3WYHA 3BS5A 1QT6A 1QT3A 1LJNA 1DYCA 4H8XA 1SSWA 1YAMA 221LA 1JJ1A 4NG8A 250LA 5KXZA 182LA 2HEBA 2RBQA 8LYZA 2B72A 4J1AA 1OVHA 4M6DA 1QSBA 1L36A 4HTKA 4WM3A 151LA 5LIOA 1G06A 1LSNA 232LA 192LA 1LZTA 1CU5A 1UIAA 2KMDA 104LA 4LZMA 4E3UA 1BVXA 1TLAA 5J8YC 3HH5A 1LKYB 1DYAA 2DQJY 1PZYA 2Z37A 4IJ4A 3HFMY 1L80A 2HEDA 4B49A 1L11A 1RE2A 1OWZA 2X0AA 4CJ2A 1YIKA 4KPMA 5I54A 3KAMA 3LZ2A 3A6BY 4PRQA 3A94A 3CDRA 1L41A 2E8OA 1DKKA 1HFXA 1NHEA 138LA 4YM8A 1REXA 220LA 1UACY 3WUAA 3CSQA 4AQNA 5LINA 5D5FA 1C6TA 3RW8A 1C08C 2EPEA 1L52A 4GRVA 1WQPA 3C7YA 2BQDA 3MGWA 3TMUA 2LHMA 1GBSA 1RFPA 1REZA 1T8FA 6LYZA 5JU5A 4H8ZA 5FCPA 4OWEA 4Z3MA 4EKPA 164LA 1JHLA 3EXDA 3HH6A 4R6CA 1PK1A 3DMVA 4OWAA 1OUGA 4WMGA 3B0OA 1FLYA 1D2YA 1JKDA 3G3AB 2F30A 2B6GA 110LA 2OE9X 2B7XA 5LAGA 4LGKA 1KNIA 1A2YC 1T6HA 4LT1A 3OE0A 149LA 2Q9EA 1P2LA 1KXXA 3WW5A 1C60A 4LFXA 3TXIA 3HDEA 1C6BA 1HEPA 1C6PA 1QTZA 1L69A 162LA 4RW2A 3RT5X 163LA 2DQDY 4DQJA 1LSPA 3RNXA 5LVKA 4NIJA 2QB1A 1L51A 2XQOA 2FE9A 1T8AA 4NHTA 1G1WA 1UIEA 1DYDA 1G0QA 3AZ4A 2A7DA 4DDAA 4ARLA 3AJNA 3B0KA 3WXTA 1JIYA 1GF8A 2D91A 102LA 1TCYA 1LSCA 2YBMA 4MR1A 3SB5A 1HNLA 1P3NA 4HPEA 2Z19A 1GE1A 1KIRC 174LA 4ML7A 1YROA 244LA 3SBAA 1LMNA 129LA 1BB5A 1RJCB 128LA 1L15A 4ARMB 1L13A 2W1MA 4PZOA 2EAPA 2D4KA 1WQOA 3DMZA 2D3DA 223LA 1SSYA 3NY8A 5E4PA 1L18A 3AGGG 207LA 1UA6Y 1JSFA 3TXHA 1IP2A 1IOSA 4DKLA 1LWGA 1L20A 1VEDA 4ARQB 1C6DA 180LA 1XEIA 1L70A 1QTKA 1PQIA 3DN3A 2F8KA 1LHKA 5FELA 1L0JA 1OUEA 4AXTA 4ANRA 1HF4A 127LA 1CJ8A 2HULA 2VB1A 4B4IA 3SP3A 1DPWA 1L34A 1OV5A 3GUJA 126LA 4AGAA 1L63A 3SB9A 123LA 2FBDA 1L95A 2HEAA 2E8NA 1XJUA 1L79A 4HV2A 133LA 1IX0A 1IY3A 2BQFA 1CV4A 1LZNA 3CDTA 4NY5A 260LA 2DQIY 2MEHA 4H90A 154LA 5KXOA 1F10A 3FA0A 157LA 1L74A 4EKRA 2H9JA 3OE6A 3ATOA 4NHIA 3V2WA 1HEMA 1C68A 1JKBA 4CGEA 1CV3A 4XJBA 5C6LA 1LJHA 1L31A 1L42A 1MLCE 190LA 1DI4A 5FEKA 1FKQA 4TTDA 3TADA 2JV3A 1CKDA 4XENA 5DN5A 4X3BA 1PS5A 2F44A 4GCFA 1BWHA 1C69A 1G7LC 1IC4Y 3HTDA 171LA 5KXMA 4GN3A 1B7SA 2DL0A 3A92A 2OTYX 1AT6A 3C81A 1B7NA 4NWHA 242LA 1AM7A 4UWVA 1GB3A 1G07A 4W58A 1D0MA 2QKQA 3HBDA 4KL7A 2ZILA 4LFPA 212LA 1L19A 125LA 1T97A 160LA 1XGRC 1L57A 135LA 1YAPA 1LZ5A 1LZEA 4LDOA 4ETAA 143LA 2KE7A 3BS5B 4NGOA 2ZNWY 4ET9A 1CV1A 5B06A 4H9HA 1NQIA 1DKJA 218LA 1HELA 1UBZA 2F3NA 189LA 2FBBA 4XN6A 4TX7A 3BKVA 1L59A 1GEVA 2IFFY 5K7OA 1L38A 2IGCA 3DN8A 130LA 4OWCA 4BAFA 3A3QA 2BQKA 5IELA 1JTOL 4MSTA 1HEQA 5F16A 5LA5A 2BQEA 1L68A 148LE 2YBJA 5KXRA 2HEFA 2XTHA 2RBPA 4GCDA 216LA 3EO5A 2H5ZA 2BQMA 3GUKA 156LA 3QNGA 1BB4A 1GFRA 1L62A 3UONA 1KS3A 4ETCA 1P37A 3HT9A 4H9IA 1L50A 3WPLA 1HERA 1L73A 3WU9A 1C45A 2F32A 1L14A 1LYHA 159LA 1P6YA 1LHMA 1D3NA 1IWUA 4NEBA 3KKAA 1L46A 3EMSA 132LA 3C83A 5KXTA 234LA 1G0LA 1LOZA 2D6BA 2YBIA 2LCBA 2RBOA 2Z2EA 3A95A 1B5VA 1B5UA 2KSOB 2B70A 152LA 1OV7A 3FADA 2ZIJA 1WQNA 1L21A 3LYOA 1PK1B 5C6IA 1D2WA 2EIZC 1C6EA 3A67Y 1TBYA 109LA 1LYSA 4TSBA 165LA 3ZEKA 1AT5A 2Y9UA 1OUFA 4I7JA 1B0XA 3C8RA 5KKIA 4IATA 1ZMYL 1GF3A 2BQIA 1QTVA 1GFTA 191LA 1LGXA 4EPFA 4HTNA 4IASA 1JPOA 4I7NA 1L94A 1LZYA 1UCVA 5J8YA 1LSAA 5T3FA 3RU5A 1NHBA 1XEPA 1BB3A 3A91A 1LYGA 1DXJA 4O34A 1YL0X 4OOTA 1E8LA 4NGWA 4ARPA 1C6GA 1IWTA 1XGPC 3V2YA 1L43A 1QUHA 1J1XY 173LA 1BB6A 1LTMA 1ZYTA 4UWNA 1GFUA 5J7CA 4Z46A 1L65A 3LYMA 166LA 2G4PA 1B7LA 226LA 3LYZA 1L27A 5I14A 4N8ZA 3A3RX 1L61A 1L37A 257LA 137LA 2BPUA 3WU8A 6LZMA 1UIFA 2RB2X 4HJZA 4D9ZA 5KXLA 3F6ZA 228LA 1DYEA 4NGYA 3GULA 5KKJA 1LYYA 1L09A 4OOOA 4I7RA 7LZMA 1LI2A 4LZTA 2NTGA 1GE4A 1NWGA 5F14A 1CV5A 3OE9A 1IY4A 2D4IA 5LVJA 3W6BA 3WH1A 5C6JA 167LA 249LA 3WPJA 1LZRA 256LA 2MEFA 1GAYA 1LCNA 1QS9A 1D0KA 3QY4A 1D9WA 2KIVA 4YX7C 4W54A 4U3XB 5A3ZA 3KKAC 1REYA 1P7SA 1L16A 1GXXA 3E3DA 4LYCA 1LGUA 4YEMA 1C6AA 1KXYA 4B0DA 3J6KA 5LVGA 114LA 4CFOA 1IVMA 2Y9TA 1L44A 1LJ3A 1LJEA 3PDSA 1C6CA 3P64A 1FLWA 4GCCA 3DMXA 1P2CC 5APDA 1G7HC 186LA 1LAAA 2ANXA 3WUNA 1L02A 1B7RA 1F6RA 4FDYA 2MECA 4Z98A 4NJ8A 1LJ4A 1UUZC 2BQCA 141LA 1YAQA 1G0JA 5L3IA 4WM2A 229LA 3HUAA 1VDQA 2B6YA 1CX7A 4WL6A 1CKHA 4EPIA 4ETDA 2MEDA 1KW5A 3BS7A 4QY9A 1IR7A 1WWUA 2LYOA 253LA 2O79A 1L76A 4H93A 1DZBX 1C6KA 1L49A 1SV0A 4RQNA 1ZVHL 1IWXA 2LZTA 1YKXX 1CU0A 2B5ZA 1D6PA 233LA 4ZIXA 176LA 2DQEY 1NMMA 1IP1A 4RDSA 4A7DA 4NSHA 1LSDA 108LA 258LA 1IP3A 1OUHA 2K60A 3HWLA 4G4CA 2NWDX 3P66A 3WXUA 252LA 1C65A 4PGJB 5JTIA 5B59A 4H9FA 259LA 1TDYA 155LA 3CDOA 1QSAA 4DJHA 1G0KA 5HQ1A 3HT8A 1F0WA 5KXWA 4NHSA 3W6FA 4WLXA 119LA 1D3FA 3WVYA 172LA 1QTDA 1SXEA 2Q9DA 3WULA 1GB9A 5A3EA 3IWRA 4ETEA 1GFVA 1LYDA 3ATNA 1COKA 2DQGY 1LMTA 1GBOA 196LA 4NSJA 4Z41A 2Z38A 1OUIA 1IOQA 3D4SA 1OP9B 5L9JA 1HHLA 4PHIA 4H9AA 205LA 1O23A 3C8SA 3AYQA 1L35A 2HUBA 107LA 2DKXA 1LZSA 1QTEA 230LA 2NTHA 1CUPA 1L87A 2ZNXY 4KXIA 3W6AA 1L47A 1QUGA 1OQMA 2K4PA 1HMKA 1QDTA 1LSMA 3F8VA 1G1VA 235LA 1L81A 1SX2A 1B2KA 1CJ6A 3L64A 2MEAA 4LT3A 1B6IA 1LZ6A 1B5ZA 4IAPA 4LT0A 1C43A 3HTFA 2A4TA 2D8CA 2IHLA 4XJHA 3B6LA 145LA 1NBYC 2F4GA 118LA 3HILA 1WTMA 3TXJA 3C7ZA 4WLTA 5JRTA 1CKGA 3AGIA 3K3TA 1B7OA 1LWKA 3GUPA 1REMA 3K2RA 1KXWA 224LA 3OE8A 4WLDA 1SV0C 2O7AA 161LA 1NKHA 3LN2A 4RLMA 1D0LA 1WQQA 1OWYA 1GFGA 1YKYX 248LA 4RQMA 1WVVA 5KNIA 1GEZA 1OUJA 158LA 211LA 3OJPA 1B0DA 254LA 3DN2A 1C6JA 3M18B 3CT0A 2BQJA 1P56A 5DLAA 1GHLA 1KW4A 1GF7A 1VDTA 3W6DA 1HC0A 1D9UA 3JR6A 1YL1X 3G3WA 5LVHA 4QGZA 1L54A 1LSFA 2RAYX 3W6CA 2HTXA 236LA 1HFZA 4DQ5A 3A6CY 1LMPA 2HU1A 1RG6A 2OE7X 3P4ZA 1IWVA 1VDPA 146LA 3TMWA 1L98A 4EXMA 3D3DA 1L33A 1C7PA 1GAZA 1LSBA 2RB0X 4N1CC 1C61A 1QDRA 4K5YA 4HTQA 4B4JA 1RI8B 3LZMA 3VWOA 4H1PA 4ET8A 2F2NA 2EAMA 1SV4A 1C67A 1TAYA 2B73A 5B1GA 262LA 2CJLA 1WTNA 4H9CA 2O4WA 175LA 1IC7Y 2DQCY 9LYZA 3WPKA 237LA 140LA 1PQOA 1W08A 1HMLA 1L97A 3LYTA 5AMYA 3GUIA 2B6WA 4DD0A 2QB0A 1FDLY 1C66A 4NL9A 3FI7A 5LYMA 2LC9A 147LA 3AW7A 183LA 1HEWA 1B9OA 1GBWA 1L75A 1L71A 3SENA 2FYDA 1QTHA 4PPOA 1L60A 3J4GA 261LA 4NGLA 3QAKA 1LKSA 1DPXA 1ZWNA 3C80A 3WUMA 1LMCA 1UQVA 1LHHA 1QT8A 5F9XA 4I7LA 1SX7A 2RH1A 3N9CA 4N5RA 1ZV5L 241LA 1I20A 1L04A 1BGIA 1LYFA 2ZQ4A 4WOAA 3GUMA 2I6ZA 2B75A 2E8MA 1L32A 4G49A 1DI5A 4H94A 131LA 4NWEA 2MEGA 1CJ9A 1FLQA 3D9AC 1L23A 1L86A 1L93A 4W51A 1QQYA 1LZGA 1C6FA 3AZ7A 1YANA 1CKFA 4NGVA 3RUNA 1LYIA 4RLNA 1LJKA 3BKHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 228L A;  1DYE A;  3GUL A;  185L A;  3CDQ A;  1EPY A;  2RAZ X;  1L09 A;  210L A;  1T8F A;  1C6H A;  1KY1 A;  4I7R A;  3RZE A;  7LZM A;  197L A;  5JU5 A;  1LI2 A;  1L30 A;  1LLH A;  4EKP A;  2NTG A;  164L A;  206L A;  3HH6 A;  3BQ7 A;  1PK1 A;  243L A;  3DMV A;  1CV5 A;  1D2Y A;  3OE9 A;  1L06 A;  2B6G A;  1DYF A;  110L A;  4YXC A;  2OE9 X;  1F0M A;  1G0G A;  2DKZ A;  167L A;  4OO9 A;  1L72 A;  249L A;  256L A;  2B7X A;  1C63 A;  4DAJ A;  111L A;  1KNI A;  2LPE A;  1T6H A;  1QTB A;  1QS9 A;  3CDV A;  4EKQ A;  1DXS A;  1PQM A;  1L96 A;  3OE0 A;  2HUK A;  4I7P A;  149L A;  2Q9E A;  1QT5 A;  1SWY A;  1P2L A;  1CUQ A;  2ES6 A;  1D9W A;  2KIV A;  1C60 A;  1C6I A;  2B6X A;  3HDE A;  4YX7 C;  4W54 A;  4W59 A;  1C6B A;  3KKA C;  1C6P A;  1P7S A;  1QTZ A;  115L A;  1L16 A;  1C6N A;  1L69 A;  1LW9 A;  1P2R A;  4PJZ A;  162L A;  3NY9 A;  163L A;  2B6T A;  188L A;  139L A;  1LGU A;  2F2Q A;  1WWV A;  1L58 A;  1OVJ A;  1DYB A;  1C6A A;  1LKY A;  2QB1 A;  1L51 A;  114L A;  2Y9T A;  1L44 A;  3PDS A;  1L85 A;  2FE9 A;  4I7T A;  1C6C A;  1T8A A;  1G1W A;  3C8Q A;  3HT6 A;  5F3X B;  1DYD A;  1L01 A;  1G0Q A;  1QTC A;  3DMX A;  3HUK A;  186L A;  2ANX A;  4ARL A;  1L02 A;  113L A;  4NL9 C;  1L67 A;  1L92 A;  102L A;  227L A;  1L10 A;  2RBS A;  1G0P A;  4NJ8 A;  3SB5 A;  1KY0 A;  141L A;  1CU6 A;  1L53 A;  2OEA X;  1G0J A;  1P3N A;  3DN0 A;  174L A;  229L A;  3HUA A;  4W52 A;  244L A;  1CX7 A;  2B6Y A;  3SBA A;  5L1M A;  4EPI A;  129L A;  128L A;  1L15 A;  4ARM B;  1LYE A;  187L A;  1L13 A;  4PZO A;  2EAP A;  1KW5 A;  3BS7 A;  1L0K A;  1QT4 A;  3DMZ A;  2D3D A;  223L A;  2RB1 X;  1SSY A;  3NY8 A;  1SXD A;  1L18 A;  1L66 A;  4LDL A;  1C62 A;  1WWU A;  3HU9 A;  1L56 A;  253L A;  2EAN A;  1LWG A;  4GBR B;  4DKL A;  4EKS A;  2O79 A;  1L20 A;  1LPY A;  1L76 A;  4ARQ B;  2QAR B;  2L5Y A;  180L A;  1C6D A;  1L28 A;  1L70 A;  1C6K A;  1L49 A;  238L A;  1PK3 A;  4W57 A;  1SV0 A;  4RQN A;  1PQI A;  3DN3 A;  1PQD A;  2F8K A;  4PK0 A;  1CU0 A;  1L0J A;  2E8P A;  127L A;  233L A;  2LZM A;  225L A;  176L A;  4W55 A;  2HUL A;  3SBB C;  170L A;  1L03 A;  108L A;  181L A;  258L A;  1QUO A;  2K60 A;  1L34 A;  1OV5 A;  3GUJ A;  1L05 A;  3HDF A;  126L A;  3DN4 A;  1PQJ A;  3HWL A;  1L63 A;  4W56 A;  3SB9 A;  123L A;  239L A;  252L A;  1L95 A;  2B6Z A;  3HH3 A;  1C65 A;  2E8N A;  1L55 A;  5JTI A;  177L A;  2ESE A;  1XJU A;  1L79 A;  259L A;  1B4F A;  155L A;  1CV4 A;  201L A;  3CDT A;  3CDO A;  4DJH A;  1G0K A;  260L A;  1KW7 A;  200L A;  1C6Q A;  4ARJ A;  3HT8 A;  1L64 A;  195L A;  1L90 A;  4I7M A;  3GUO A;  1D3J A;  1L83 A;  3FA0 A;  169L A;  3IDW A;  1C6M A;  1JI7 A;  119L A;  1D3F A;  157L A;  1L74 A;  3OE6 A;  4EKR A;  1CU2 A;  1JTN A;  4IS7 A;  172L A;  1QTD A;  1SXE A;  3V2W A;  1JQU A;  1X40 A;  1L89 A;  1P64 A;  2Q9D A;  3SB8 A;  3HU8 A;  1K28 A;  1V85 A;  1C68 A;  1LYD A;  1CV3 A;  1COK A;  3VW7 A;  4YXA C;  1OYU A;  1L31 A;  3DNA A;  1L42 A;  214L A;  190L A;  196L A;  1LYJ A;  3TAD A;  2JV3 A;  3D4S A;  2F44 A;  1I6S A;  1L40 A;  168L A;  246L A;  1C69 A;  3TAD C;  4ARM A;  251L A;  171L A;  3HTD A;  3C7W A;  4MHV A;  1WTH A;  205L A;  2DL0 A;  3C8S A;  1QSQ A;  1C6L A;  2OTY X;  1L39 A;  3C81 A;  3SB6 A;  1L35 A;  3HT7 A;  255L A;  107L A;  2DKX A;  230L A;  2NTH A;  1CUP A;  242L A;  2F47 A;  1CX6 A;  1L87 A;  4ARQ A;  2QAR A;  3NYA A;  1L47 A;  1L99 A;  1QUG A;  1L22 A;  3HH4 A;  2K4P A;  3EML A;  3F8V A;  1G1V A;  215L A;  235L A;  3ODU A;  1L81 A;  1G07 A;  4W58 A;  2QKQ A;  178L A;  1SX2 A;  3TAC B;  1DYG A;  240L A;  142L A;  1C64 A;  1OXJ A;  3L64 A;  1B6I A;  3SEI A;  212L A;  103L A;  1L19 A;  4IAP A;  1CV0 A;  3L2X A;  1P46 A;  125L A;  1T97 A;  160L A;  1CVK A;  1SWZ A;  3HTF A;  1L57 A;  4I7S A;  231L A;  2OU9 A;  1L24 A;  2OU0 X;  247L A;  2A4T A;  2D8C A;  184L A;  4LDO A;  120L A;  3G3V A;  145L A;  4I7K A;  4S0W A;  3SN6 R;  5LZM A;  118L A;  1T8G A;  209L A;  2YTU A;  3HIL A;  1L08 A;  1QS5 A;  3C7Z A;  5JRT A;  1LI6 A;  143L A;  2KE7 A;  3BS5 B;  1L26 A;  245L A;  2QB0 B;  1LWK A;  222L A;  3GUP A;  1CV1 A;  3HTG A;  3K2R A;  224L A;  2KG5 A;  3OE8 A;  218L A;  2F3N A;  1JTM A;  3SB7 A;  1SV0 C;  2O7A A;  189L A;  161L A;  1L59 A;  1L38 A;  2IGC A;  3DN8 A;  130L A;  1OWY A;  3K1R B;  1L45 A;  1QT7 A;  1XJT A;  1QUD A;  248L A;  3G3X A;  4RQM A;  5KNI A;  1P5C A;  4LDE A;  158L A;  211L A;  2CUU A;  1L82 A;  4E97 A;  2B74 A;  1SGG A;  1L68 A;  254L A;  148L E;  122L A;  3DN2 A;  1C6J A;  2LMR A;  2RBP A;  3HUQ A;  216L A;  4ZPU A;  1L48 A;  1P56 A;  1CU3 A;  1KW4 A;  1X9X A;  3GUN A;  1OVK A;  3GUK A;  3JR6 A;  2KSO A;  156L A;  3G3W A;  1L62 A;  1L25 A;  3H8M A;  1L54 A;  3UON A;  1KS3 A;  1P37 A;  217L A;  213L A;  3HT9 A;  2RAY X;  1L50 A;  236L A;  2OE4 X;  1L73 A;  2OE7 X;  1RG6 A;  1V38 A;  4PZN A;  1L07 A;  146L A;  2F32 A;  1LGW A;  1L98 A;  1L14 A;  2RBN A;  1L88 A;  2Z6B A;  1LYH A;  4EXM A;  1L33 A;  150L A;  159L A;  2RB0 X;  1P6Y A;  1C61 A;  1D3N A;  4K5Y A;  1L12 A;  4I7Q A;  2GLE A;  2HUM A;  3KKA A;  1L46 A;  3LZM A;  4I7O A;  2EAM A;  1SV4 A;  1L84 A;  1C67 A;  3C83 A;  234L A;  2B73 A;  1G0L A;  262L A;  2LCB A;  2RBO A;  4W53 A;  219L A;  3DN6 A;  2O4W A;  2KSO B;  1L91 A;  2B70 A;  152L A;  175L A;  1L17 A;  1OV7 A;  3FAD A;  1PQK A;  1G0M A;  140L A;  1L21 A;  1PQO A;  1PK1 B;  1L77 A;  237L A;  1D2W A;  1L97 A;  1P36 A;  1C6E A;  3GUI A;  3BS5 A;  199L A;  1QT6 A;  1QT3 A;  2B6W A;  2QB0 A;  109L A;  1CTW A;  1DYC A;  2QAR C;  1SSW A;  1C66 A;  3C82 A;  1ZUR A;  1D3M A;  165L A;  221L A;  4NL9 A;  2Y9U A;  2EAO A;  250L A;  182L A;  2LC9 A;  4I7J A;  147L A;  2RBQ A;  1B0X A;  3DN1 A;  183L A;  2B72 A;  2RBR A;  1L75 A;  1L71 A;  1OVH A;  2L78 A;  3SEN A;  3C8R A;  1QSB A;  1L36 A;  112L A;  1QTH A;  151L A;  1QTV A;  191L A;  1L60 A;  1LGX A;  4EPF A;  1G06 A;  261L A;  1L29 A;  4I7N A;  3QAK A;  1LI3 A;  1L94 A;  232L A;  192L A;  1ZWN A;  2ANV A;  1UCV A;  5J8Y A;  1CU5 A;  2OTZ X;  1X66 A;  3C80 A;  2KMD A;  1NHB A;  1XEP A;  1UQV A;  104L A;  1QT8 A;  4I7L A;  1SX7 A;  1LYG A;  4LZM A;  1TLA A;  5J8Y C;  2RH1 A;  3HH5 A;  1LKY B;  1DYA A;  4EJ4 A;  241L A;  4ARP A;  1C6G A;  1L04 A;  1L80 A;  3V2Y A;  1LYF A;  1L43 A;  1QUH A;  1L11 A;  173L A;  1ZYT A;  3GUM A;  2B75 A;  2E8M A;  3F9L A;  1OWZ A;  1L32 A;  1OW5 A;  131L A;  3PBL A;  3CDR A;  1L41 A;  1L65 A;  144L A;  3FI5 A;  2E8O A;  166L A;  1L23 A;  1L86 A;  138L A;  1L93 A;  4W51 A;  3DKE X;  226L A;  1L27 A;  5I14 A;  1Z1V A;  1L61 A;  1L37 A;  220L A;  1C6F A;  1L00 A;  3HTB A;  257L A;  4AQN A;  198L A;  137L A;  3RUN A;  1C6T A;  1LYI A;  1CV6 A;  1L52 A;  4GRV A;  6LZM A;  2RB2 X;  3C7Y A;  2OU8 A; 
#chains in the Genus database with same CATH topology
 1QQ5 A;  1A6S A;  1UIH A;  2G07 A;  185L A;  1NDM C;  3CDQ A;  4XJI A;  3SAF A;  4R65 A;  1C6H A;  5KL8 B;  1KY1 A;  4YP3 A;  2GV0 A;  3M1Y A;  5G5H A;  1LLH A;  1XFP L;  1I56 A;  1IOC A;  3CSR A;  1X42 A;  3BQ7 A;  2G4N A;  5KFK A;  3OGU A;  243L A;  5E9R A;  1T4G A;  4P4M A;  1DK2 A;  2HBJ A;  4EEL A;  1C10 A;  1FO4 A;  5F9U A;  3PR5 B;  1BQL Y;  1DYF A;  2KKP A;  3A96 A;  4YXC A;  5AI6 A;  1F0M A;  3MAB A;  2EDU A;  1G0G A;  1DOQ A;  2DKZ A;  3LHM A;  1GDX A;  1HFY A;  4OO9 A;  1L72 A;  1S8O A;  2IA6 A;  3GDX A;  4KLL A;  3WVX A;  111L A;  5J2D A;  2HI0 A;  1QTB A;  3CDV A;  2I25 L;  2BCR A;  1DXS A;  3NVW A;  1PQM A;  2HCF A;  4AP9 A;  1L96 A;  2ZYC A;  4I8S A;  1GE0 A;  1NF5 A;  1QT5 A;  4F91 B;  1BVK C;  3RJJ A;  3EBA B;  3EZ5 A;  1CUQ A;  2ES6 A;  1JXL A;  1UC0 A;  2ZIV A;  1XGQ C;  5DN4 A;  2QLT A;  2PMZ F;  2ZJ5 A;  4TQS A;  1IG6 A;  1AZF A;  2B6X A;  2W1Y A;  4Y2J A;  3BZK A;  1F44 A;  1IP4 A;  3B9J A;  4F93 B;  2W8L A;  4YOP A;  115L A;  5CWR A;  1C6N A;  1LW9 A;  1P2R A;  4PJZ A;  3NY9 A;  4DDC A;  1HEN A;  4M4O A;  139L A;  4QEQ A;  2F2Q A;  3KHG A;  5KXK A;  1ZQL A;  1L58 A;  3AN1 A;  1DYB A;  5KXN A;  5FP0 A;  4AYB C;  5LYZ A;  1LZC A;  4CRX A;  3PX0 A;  5IIO A;  5LXW A;  4I7T A;  3UQ2 A;  1LSE A;  4DEZ A;  1LMQ A;  2VKQ A;  3WKE A;  5EWG A;  2XID A;  4I2J A;  4EEN A;  3HUK A;  5I4X A;  4G9S A;  2NO5 A;  3W6E A;  2VA8 A;  2K8C B;  1SQ2 L;  3TXE A;  4NL9 C;  1KIQ C;  2HU3 A;  3V7L A;  1L67 A;  5KXS A;  5KFP A;  4QZA A;  3MDA A;  1L92 A;  2KVS A;  4NM2 A;  4DL4 A;  2FDR A;  1X9W A;  227L A;  1L10 A;  2RBS A;  2XJW A;  1U48 A;  4GCB A;  4DSE A;  4L41 A;  2HBL A;  1CU6 A;  1L53 A;  2LYZ A;  2AJQ A;  2OEA X;  2WTF A;  1WCN A;  1KSP A;  5III A;  4BUG A;  3DN0 A;  3W3E A;  4LZG A;  1GB0 A;  5D4B A;  3RH6 A;  3C5F A;  1NBZ C;  1U45 A;  2P6U A;  5CR0 A;  1ZOL A;  2ZTC A;  5L1M A;  1G7M C;  4TUN A;  5LA8 A;  2ZIU B;  4FZN A;  4JB3 A;  4LZD A;  4ECQ A;  5KT4 A;  4H91 A;  1GD6 A;  4LYB A;  4NGJ A;  2XBS A;  4NLK A;  4RUA A;  3OHB A;  2R8H A;  5J0W A;  5FST A;  3V72 A;  1JEF A;  1QT4 A;  4DL3 A;  3OTQ A;  1L3V A;  1OUD A;  4P0Q B;  3AB6 A;  4KLQ A;  1GXV 2;  1L66 A;  2LZ2 A;  2JRZ A;  1DI3 A;  2D4J A;  2ODG A;  1L56 A;  2EAN A;  3HU9 A;  4GBR B;  4EKS A;  8ICQ A;  4DD2 A;  4N0J A;  1L7O A;  1GF5 A;  2L5Y A;  1ZVY B;  3SQI A;  2KJ8 A;  2ZJA A;  1XGU C;  5I5Q A;  4R64 A;  5AIC A;  238L A;  1ZQH A;  1XEJ A;  2MEI A;  5J2C A;  4CFP A;  3KHR A;  2K4I A;  4QDN A;  4UB5 A;  2BLX A;  8ICE A;  2ATL A;  1GFH A;  2LZM A;  2CDS A;  4O3R A;  4RNM A;  1L7M A;  2D6F C;  1SLY A;  170L A;  2E1F A;  3ONN A;  2HHT A;  1B5Y A;  1L03 A;  181L A;  4ECS A;  5ILF A;  5KFD A;  5J2G A;  3HDF A;  2YBH A;  4BAP A;  5AKY A;  7ICI A;  1LJJ A;  1XGT C;  2ZTD A;  1ZQZ A;  1OUA A;  4LYZ A;  2I5H A;  4PPX A;  1EQ5 A;  4GCE A;  1BVS A;  5AKE A;  7ICE A;  4PRU A;  2ZTE A;  4J0L A;  3TXB A;  1L55 A;  4HV1 A;  2ESE A;  2B21 A;  3EPG A;  4LYT A;  1LZ1 A;  2BQG A;  1YT3 A;  1MEL L;  1KW7 A;  1U9L A;  1C6Q A;  3RF9 A;  1TAM A;  3QE8 A;  194L A;  4ARJ A;  3T36 A;  1L64 A;  4WM5 A;  4WG7 A;  195L A;  1JUG A;  5J0R A;  5ALD A;  5KT7 A;  4I7M A;  3RJG A;  2RQ5 A;  2I26 L;  4G9B A;  5ALH A;  3IDW A;  4GIB A;  4ELV A;  1JI7 A;  4K4I A;  7ICH A;  1JTN A;  9ICI A;  4O5K A;  1GBX A;  3CQL A;  5I4Y A;  1RQL A;  2DFL A;  2VJ5 A;  1H38 A;  1JQU A;  1X40 A;  4QZI A;  4O3S A;  7ICJ A;  1L89 A;  1LHJ A;  5AI5 A;  5APE A;  3SB8 A;  1RYU A;  1S97 A;  3IRU A;  2YDG A;  1K28 A;  1UIB A;  4RW1 A;  1O08 A;  2ZXH A;  3QU4 A;  1ZQV A;  1LMO A;  3ALR A;  1YQV Y;  4M6W A;  1VDS A;  4YXA C;  1ZQE A;  3WL2 A;  4WG1 A;  5IIK A;  4IQW A;  1CI4 A;  2G4Q A;  3DNA A;  214L A;  1ZRM A;  5DLF A;  3OK0 A;  134L A;  5ILC A;  3WW6 A;  5AM1 A;  4C4T A;  3C21 A;  2KVC A;  5DQG A;  3NVY A;  2C28 A;  168L A;  4WM6 A;  246L A;  5B05 A;  4O3M A;  2ZJ8 A;  4C8M A;  251L A;  3GIM A;  4JV1 A;  4CF5 A;  1N63 A;  2OH2 A;  1WTH A;  3GXK A;  3I1Y A;  4O3N A;  3N9A A;  4JV2 A;  4WM4 A;  1C6L A;  4RQ6 A;  9ICA A;  1L39 A;  4UB4 A;  3SB6 A;  3HT7 A;  2MEE A;  2W1X A;  1CEZ A;  1D9D A;  1SKR A;  2ZQ3 A;  4QZG A;  2QAR A;  3NYA A;  3O0F A;  3AZ6 A;  2Z18 A;  4YF2 A;  2HEE A;  1TK5 A;  153L A;  3HH4 A;  4ICA A;  4BX9 C;  3TFS A;  2DQF C;  3IG8 A;  3ODU A;  1DGJ A;  3AQE A;  8ICO A;  2DKV A;  7ICO A;  3FAH A;  3WKC A;  4O0I A;  3TAC B;  5KL1 B;  240L A;  142L A;  8ICN A;  8ICU A;  1Z55 A;  4NLG A;  2H9K A;  7ICQ A;  4OWH A;  4DD7 A;  1J1O Y;  103L A;  1JSE A;  4I2A A;  5LVI A;  1LZ4 A;  1GF4 A;  4NGK A;  3L2X A;  2DBY A;  1GFA A;  1GE3 A;  1P46 A;  4KX5 A;  4DF4 A;  4PHA A;  208L A;  4ZH4 A;  4DOA A;  4I7S A;  4KLJ A;  2OU0 X;  4YD2 A;  184L A;  2WAR A;  1GF0 A;  1LB2 B;  2KNJ A;  3G3V A;  4I7K A;  5FDJ A;  3WMK A;  209L A;  2YTU A;  1L08 A;  1I1Z A;  4QWD A;  3H8J A;  1P7D A;  2W1L A;  5KJ9 A;  2QB0 B;  4EYH B;  5KXX A;  4Y2X A;  1IIZ A;  8ICT A;  1LZA A;  3HTG A;  3P65 A;  9ICP A;  2W9C A;  1IR9 A;  1NJZ A;  1YAO A;  2RDJ A;  1JN3 A;  3TKA A;  1ZQJ A;  2KG5 A;  4KLU A;  5KXP A;  5I4W A;  3LVW A;  1IOR A;  4DOB A;  5ALW A;  4OWB A;  2Z12 A;  1ZQQ A;  3K1R B;  2G08 A;  2FPK A;  1GB7 A;  4YQW A;  4QWB A;  4ECR A;  1CNS A;  1QUD A;  5AK3 A;  5KFF A;  3G3X A;  1JIT A;  1NK0 A;  8ICM A;  8ICA A;  1GF9 A;  2DQA A;  1B5X A;  5AM4 A;  4GN5 C;  1QIO A;  2A7F A;  1L82 A;  4BWJ A;  1BWI A;  4G4H A;  5II3 A;  5AK5 A;  4IQV A;  1SIJ A;  3H4B A;  1SGG A;  2B74 A;  122L A;  3B0I A;  4HP0 A;  3QNM A;  4ZPU A;  4DWX A;  4I2I A;  4N1E I;  193L A;  5DBC A;  4DQR A;  5CRX A;  1CU3 A;  3D2S A;  1X9X A;  4F5P A;  2VA3 A;  3GUN A;  5DM9 A;  2AGO A;  3TXF A;  3FYH A;  3HRD D;  3HT3 A;  1OVK A;  1IEE A;  5APF A;  3JPT A;  2KSO A;  1N4F A;  7ICM A;  5KTQ A;  2HEC A;  1L25 A;  3RZ4 A;  4QIW C;  3H8M A;  5KFA A;  1QUS A;  4EMN A;  4XYY A;  4BAD A;  213L A;  5M1Y A;  8ICW A;  3IV6 A;  1TK8 A;  1J2N A;  8ICG A;  4Y2R A;  2OE4 X;  2ZUB A;  2BQA A;  4IL6 U;  3K75 D;  1LHI A;  1L07 A;  5I53 A;  4HYK A;  3TI0 A;  1IR8 A;  4ED3 A;  4RT2 A;  4QJF B;  1L88 A;  3ICX A;  2RBN A;  3MR6 A;  3BJY A;  5KFY A;  1J97 A;  2Z6B A;  4J1B A;  5IHG A;  1BNP A;  2C2R A;  4KMO B;  150L A;  4C7Z A;  1T3P A;  1N5X A;  3SD7 A;  3BQ2 A;  2RHF A;  2GLE A;  5AKH A;  4I7Q A;  4XJD A;  3CT1 A;  4F5N A;  1N62 A;  8ICS A;  1NZP A;  3AZ5 A;  4R0F A;  4TSC A;  4I7O A;  5B1F A;  2YVB A;  1L84 A;  4UB6 U;  4OW1 A;  5D5C A;  2EKS C;  3N7P D;  5CA7 A;  4W53 A;  219L A;  2W3S A;  5HMM A;  4AYB F;  1IWZ A;  2BQO A;  3RR8 A;  2LYM A;  1L17 A;  3TXK A;  4BXO A;  4HPI A;  1A4V A;  1L77 A;  5ALP A;  1B5W A;  4Q44 A;  1AQ6 A;  1ZQU A;  1P36 A;  2MEB A;  4I2D A;  1ZRN A;  199L A;  1FLU A;  5L1L A;  4YEN A;  1BPB A;  9ICV A;  4RQ2 A;  3Q8R B;  4NSI A;  1Z1B A;  1ALC A;  1CTW A;  4KIT B;  1XSF A;  2QAR C;  4BWM A;  2E3T A;  3KFU F;  5F9N A;  1ZUR A;  3C82 A;  4FE3 A;  1D3M A;  4C8O A;  4G4B A;  3JPS A;  2YX8 A;  1MQ3 A;  1VAU A;  1N56 A;  1LSZ A;  2EAO A;  1G7I C;  4M04 A;  1JTP L;  5LAF A;  2BQU A;  1LJF A;  3DN1 A;  1F5S A;  2RBR A;  2Z39 A;  2NO4 A;  2YML A;  2L78 A;  5KFS A;  3TMX A;  1GB5 A;  3WU7 A;  4Y2Q A;  112L A;  4YMM A;  2ALZ A;  9ICL A;  1LMA A;  2ZIV B;  4XJG A;  4BDP A;  1WQM A;  1JAL A;  1HEO A;  1L29 A;  1VDV A;  3KZX A;  3OSP A;  3M7D A;  4KLD A;  3M9N B;  1LI3 A;  4J9R A;  2K89 A;  1GBZ A;  4OJ5 A;  5KT2 A;  2ANV A;  2OTZ X;  3M3U A;  1X66 A;  5KG4 A;  1KBU A;  1IP7 A;  3PVX A;  3C2M A;  4F50 A;  1KDH A;  1LZB A;  1BPZ A;  3GV8 B;  1GWD A;  4KT3 A;  4RPZ A;  3JPP A;  1URJ A;  5J2K A;  4I0C A;  4XJF A;  1NJY A;  3AEV A;  4N9R A;  5AIB A;  4EJ4 A;  4GLA A;  3ULR A;  2NV3 A;  1V7S A;  1IP5 A;  3ZVQ A;  5HMV A;  3F53 A;  4H9E A;  3B0Y A;  4EBC A;  2ZXI A;  1SB3 C;  1LVH A;  3PO5 A;  4XAD A;  4BS7 A;  1EQE A;  5C0Y A;  3F9L A;  3N9E A;  1OUB A;  1OW5 A;  1V97 A;  5DQI A;  1NDG C;  4U7C A;  4UWU A;  3PBL A;  5JEN B;  144L A;  3FI5 A;  3AQF A;  4YEO A;  3N4M B;  3LZT A;  3S6J A;  3Q8P B;  3DKE X;  1FKV A;  1WQR A;  2XBR A;  3KHL A;  2LHT A;  4TUS A;  2JZB A;  1GE2 A;  1Z1V A;  5BPC A;  2BQH A;  4ZFP A;  1L00 A;  3HTB A;  1X2I A;  7ICL A;  1F6S A;  1BPD A;  198L A;  3QUQ A;  3M8R A;  1U47 A;  1FN5 A;  3TXD A;  1CV6 A;  2OCE A;  1UIG A;  2PC2 A;  5HLL A;  1EQ4 A;  2XCA A;  2H3F A;  3NUQ A;  2OU8 A;  1JKC A;  4Y2S A;  3AL0 B;  1UCO A;  1EPY A;  2RAZ X;  5KFV A;  210L A;  2BZF A;  3RZE A;  197L A;  2BCS A;  1BNO A;  1L30 A;  206L A;  9ICR A;  4I2B A;  1B7M A;  1S5L U;  4UBC A;  1ZQY A;  4Q45 A;  2XGP A;  1TAU A;  4HJY A;  1A77 A;  4RQ5 A;  1V9P A;  1L06 A;  4J9P A;  4M9H A;  4W94 A;  3A93 A;  1DRG A;  1Z3E B;  2ZUD A;  3RFA A;  1ZXI A;  2KK0 A;  4YN4 A;  2XY5 A;  4UAS A;  4O9M A;  1LSG A;  4DQ7 A;  1C63 A;  4DAJ A;  4WO9 A;  2ZYP A;  2LPE A;  1IP6 A;  2JH1 A;  5AKX A;  4NHP A;  4EKQ A;  2AXT U;  1UIC A;  8ICI A;  1ZD4 A;  2HUK A;  4I7P A;  1TEW A;  1SWY A;  7ICR A;  1PVQ A;  4P2E A;  1C6I A;  4B9S A;  3RB4 A;  1S10 A;  2F76 X;  4NG1 A;  4W59 A;  2N5Z A;  1V7T A;  3UMC A;  1JJ3 A;  1GB8 A;  1LYO A;  2BQB A;  4P0P A;  4YCX A;  2AGP A;  1NK6 A;  2B6T A;  5DBB A;  188L A;  1INU A;  5APC A;  7ICF A;  2WFA A;  1NI3 A;  1WWV A;  2WHE A;  5EE9 A;  4DO9 A;  1AKI A;  1T3Q A;  3PMN A;  1OVJ A;  4ED0 A;  1LKY A;  5CB1 A;  2PFP A;  3SV3 A;  3B72 A;  5DL9 A;  1Q46 A;  3HBH A;  4GLX A;  5KT3 A;  3G3B B;  5DB9 A;  1WVU A;  3PST A;  1HSW A;  2ZUC A;  2IMW P;  3PZP A;  9ICQ A;  2YMQ A;  1L85 A;  3C8Q A;  3D2N A;  3HT6 A;  5F3X B;  1HIW A;  1L01 A;  4J7V A;  4DWI A;  1QTC A;  3TMV A;  2P6R A;  1LHL A;  1ARO P;  3ETR A;  4NGI A;  3UQ0 A;  1IXR A;  4KLF A;  113L A;  4ETB A;  1TV9 A;  4NLC A;  2MAX A;  2F2A B;  1L7P A;  5J0X A;  4EBE A;  3SR6 A;  4DD9 A;  1G0P A;  9ICS A;  4J9L A;  1KY0 A;  4M6W B;  4FFD A;  4P2H A;  4II8 A;  4J9M A;  4W96 A;  3H8W A;  1RYS A;  1JKA A;  1GPQ C;  2AQ0 A;  2F1H A;  3ZDB A;  4W52 A;  2KZ3 A;  4ACO A;  3FE0 A;  2KOB A;  5HNC A;  4QZ9 A;  5DDY A;  4RT3 A;  6LYT A;  3OJU A;  1ZET A;  1GDW A;  5DBA A;  4KN7 A;  5FHW A;  1LYE A;  187L A;  5IDD A;  2UVU A;  1UID A;  3C1Y A;  2OEH A;  4CHX A;  1GO3 F;  4EX7 A;  1L0K A;  3NTU A;  1QUT A;  2A1A A;  1CJ7 A;  4WLY A;  2RB1 X;  1SXD A;  1SL0 A;  2KFN A;  3RRH A;  4LDL A;  1C62 A;  2IBK A;  2G5H B;  1ZQX A;  1LPI A;  1LPY A;  2QAR B;  1L28 A;  4B1A A;  2DBT A;  1LJG A;  3QE9 Y;  2M0N A;  4W57 A;  2BQR A;  1PK3 A;  1XSP A;  2Y0S C;  1PQD A;  1GFE A;  4PK0 A;  3PSI A;  1N48 A;  2E8P A;  3M9M B;  5HNL A;  2BLY A;  2ISO A;  1QSW A;  4B9V A;  4H8Y A;  5HP4 A;  225L A;  1HSX A;  4Y2U A;  2C8O A;  3BQ0 A;  4W55 A;  5F81 A;  3SBB C;  2GO7 A;  5DG8 A;  5KAF U;  4B9U A;  2C8P A;  4H9B A;  2MRL A;  3GV5 B;  1QUO A;  1Z00 A;  1J1P Y;  3HX0 A;  1L05 A;  3LVV A;  2BQL A;  3DN4 A;  1PQJ A;  2FJ6 A;  5J0Y A;  5AK6 A;  1ZQS A;  2KJ9 A;  2HHS A;  2LM1 A;  2BHN A;  4W56 A;  4J9N A;  1SL2 A;  1VFB C;  9ICF A;  1SZP A;  239L A;  2YN4 A;  2B6Z A;  3HH3 A;  4JWM A;  4DSL A;  177L A;  2ASD A;  3MDC A;  1B4F A;  4DDB A;  3QUC A;  4J9Q A;  201L A;  2UVV A;  2V4R A;  4DFD A;  200L A;  2JEJ A;  3IJU A;  1NK5 A;  1KIP C;  4HJV A;  4E0D A;  4OJ6 A;  1JJ0 A;  8ICP A;  4QIW F;  3MGI A;  1KFS A;  1L90 A;  4IR9 A;  3GUO A;  1JIS A;  4DS5 A;  1D3J A;  2WF6 A;  1L83 A;  4GXJ A;  2A3V A;  2YBN A;  169L A;  1C6M A;  1GF6 A;  5K4L A;  2XGQ A;  2W9C B;  2C2D A;  1H87 A;  3PSP A;  1CU2 A;  4IS7 A;  1LZ8 A;  2XI9 A;  3ED5 A;  1P64 A;  5J2I A;  3HU8 A;  2I1Q A;  2PFN A;  5AM2 A;  4UAU A;  1V85 A;  3ISB A;  4I2G A;  4I29 A;  4WL7 A;  2K8B B;  2BCQ A;  4KLM A;  4LYO A;  3A0B U;  5CEH A;  3CB7 A;  4M9G A;  3VW7 A;  1OYU A;  4CNQ A;  5B07 A;  4DC4 A;  2CGI A;  1QQ6 A;  1LYJ A;  4MCK A;  1IO5 A;  1LZ9 A;  2EH9 A;  3T5L A;  1W6Z A;  2CWI A;  4PJ2 C;  3AW6 A;  1IOT A;  1I6S A;  1L40 A;  4DD1 A;  5A0L A;  1S76 D;  2F1J A;  3HBE X;  5LYT A;  5KY1 A;  3TAD C;  1CKC A;  4ARM A;  3PW7 A;  1XS9 D;  2W43 A;  3A8Z A;  4MHV A;  4WJ3 B;  5J2A A;  3C7W A;  2K8A A;  1IWY A;  1QSS A;  1KLN A;  2ZWB A;  2ZIK A;  1QSQ A;  8ICK A;  4QZH A;  2EZZ A;  255L A;  3SAG A;  1S0N A;  4JK1 A;  5TZV A;  4LT2 A;  3CSZ A;  3E58 A;  4WO6 A;  2F47 A;  1CX6 A;  4ARQ A;  4CF4 A;  2JHD A;  3T79 A;  3KOO A;  1L99 A;  3PW5 A;  1L22 A;  2O6K A;  2XC9 A;  4GXK A;  1KL9 A;  3H0L B;  5AKZ A;  4PHP A;  215L A;  3V7J A;  4DLE A;  2YSS C;  3EML A;  5J0P A;  4IRC A;  3T6U A;  4H92 A;  1PZN A;  178L A;  1DYG A;  1GFJ A;  2XVT A;  1OXJ A;  1C64 A;  1XEK A;  1B7P A;  2W04 A;  2EQY A;  3SEI A;  4GN4 A;  5TIS U;  4GLV A;  2KIW A;  2F4A A;  1CV0 A;  3PML A;  8ICY A;  2Z7J A;  5J29 A;  4DQI A;  3RBD A;  1CVK A;  1SWZ A;  3TAN A;  2HSZ A;  4I2E A;  231L A;  2OU9 A;  1L24 A;  4WM1 A;  4B4E A;  2KZM A;  247L A;  3CT5 A;  3GU3 A;  4PL2 A;  3WK9 A;  3RJI A;  1S0O A;  3SMV A;  4PGX A;  1QSL A;  2HVI A;  3GIL A;  120L A;  4S0W A;  4PL1 A;  2DPJ A;  3SN6 R;  5LZM A;  1T8G A;  2R18 A;  2YBL A;  4FBT A;  1B7Q A;  4BXO B;  1QS5 A;  1GB6 A;  2DQH Y;  1LI6 A;  4LYM A;  1BHZ A;  8ICZ A;  3A34 A;  3ZDC A;  1JRP A;  2FMS A;  1L26 A;  245L A;  9ICW A;  4NGZ A;  222L A;  3PY8 A;  3RRG A;  4XUS A;  2Z2F A;  5L3H A;  5DG7 A;  2C2E A;  4C3W A;  4ZEE A;  1MA7 A;  1N61 A;  3F2D A;  3ISC A;  3T3F A;  1JTM A;  1LSY A;  4YVZ A;  3SB7 A;  2VJ4 A;  1PVR A;  3AGH A;  5HMJ A;  2W7P A;  1JWR A;  7LYZ A;  3NAS A;  4NV0 A;  2AU0 A;  3RJK A;  1L45 A;  4EYI B;  1QT7 A;  1XJT A;  2PFQ A;  2Y8P A;  5AI8 A;  5KFL A;  1LYZ A;  3MGV A;  1RXV A;  2H3I A;  3PX4 A;  1A76 A;  1C46 A;  3PO4 A;  3E2E A;  1P5C A;  4LDE A;  5KXY A;  3K4G A;  4PHD A;  2CUU A;  1D6Q A;  3IJV A;  4NFV A;  4F4Z A;  4FJR A;  2FLN A;  4E97 A;  1LKR A;  4DYG A;  4NSG A;  4K4H A;  3QUB A;  2LMR A;  3HUQ A;  2K4E A;  1L48 A;  1LJI A;  1JTT L;  4Y2P A;  5EBH A;  4DT3 A;  2BCV A;  1IC5 Y;  3H4D A;  1DGS A;  1T6V L;  3AU2 A;  4RQ8 A;  4EOF A;  1H6M A;  5KG6 A;  4PH5 A;  1VAT A;  1G7J C;  3ZVQ B;  4QWA A;  3TXG A;  3A0H U;  1FBI X;  4F4X A;  2FYC A;  3AMZ A;  2Q0M X;  4DL7 A;  4RQ4 A;  4ECY A;  1NK9 A;  3E0F A;  4TWS A;  2IOF A;  1L6N A;  1DQJ C;  1OUC A;  2BQN A;  2RSC A;  1BWJ A;  2VIX A;  4F4Y A;  1GBY A;  3ORY A;  217L A;  4NHQ A;  1IWW A;  3EYZ A;  4HSF A;  3P68 A;  1BPX A;  1LZD A;  2OYY A;  1V38 A;  1YKZ X;  4PZN A;  5EE1 A;  1EL1 A;  1WYG A;  1LGW A;  1YIL A;  2EQL A;  4DD3 A;  4UBB A;  3M6K A;  5ALE A;  4Y2Y A;  5J2F A;  2BAA A;  9ICE A;  5EE0 A;  3ISD A;  4KX3 A;  4UB2 A;  1L12 A;  3F5A A;  5ALS A;  1GFK A;  2HUM A;  4J03 A;  2IHN A;  1ZQW A;  4UAT A;  4LJX A;  3GXR A;  1IM4 A;  1GB2 A;  4C80 A;  3A90 A;  3HKZ C;  3DN6 A;  1L91 A;  2WF8 A;  4C5F A;  1RCM A;  5HHH A;  1PQK A;  1BB7 A;  1G0M A;  4UW9 A;  2AUB A;  3WYH A;  2Y1I A;  2KEY A;  3BS5 A;  2NRX A;  1QT6 A;  1TFR A;  1QT3 A;  2E1E A;  1LJN A;  1DYC A;  4A8E A;  2JXJ A;  5J0O A;  4H8X A;  1SSW A;  1YAM A;  4Q8E A;  2PFO A;  221L A;  1N5W A;  1JJ1 A;  4O3O A;  4ED7 A;  4NG8 A;  2HHW A;  1KKX A;  250L A;  5KXZ A;  182L A;  4IQU A;  2HEB A;  2JEI A;  2RBQ A;  8LYZ A;  2B72 A;  4J1A A;  4GXI A;  3KZI U;  1OVH A;  4M6D A;  1QSB A;  1L36 A;  2HHU A;  1JX4 A;  4HTK A;  2XIC A;  4WM3 A;  151L A;  2WAQ C;  5LIO A;  4KMU A;  1G06 A;  1LSN A;  232L A;  192L A;  2XCP A;  3JPN A;  2KP7 A;  4P0P B;  1CU5 A;  1LZT A;  1UIA A;  2KMD A;  104L A;  4ED6 A;  1HUZ A;  2NRV A;  1NK8 A;  4LZM A;  4TQR A;  5KFE A;  2HDO A;  4E3U A;  1BVX A;  4F8R A;  1TLA A;  5J8Y C;  3UXO A;  3HH5 A;  1LKY B;  1DYA A;  2DQJ Y;  1TVA A;  4RPY A;  2F1I A;  1PZY A;  2Z37 A;  4IJ4 A;  3HFM Y;  2HHX A;  1L80 A;  4KLS A;  1D8Y A;  5D46 A;  2HED A;  4B49 A;  1L11 A;  1ZD2 P;  2G09 A;  3R9K A;  2H3V A;  4XA5 A;  1RE2 A;  7ICS A;  1OWZ A;  2X0A A;  4CJ2 A;  1YIK A;  4KPM A;  5I54 A;  3C29 A;  3KAM A;  3BQT A;  3LZ2 A;  2KJ5 A;  3A6B Y;  4PRQ A;  2XO7 A;  1TAQ A;  3A94 A;  3RAX A;  3CDR A;  1L41 A;  2VAN A;  2E8O A;  1COO A;  5AKG A;  4DSJ A;  1DKK A;  1HFX A;  1DK3 A;  1NHE A;  138L A;  5DLG A;  1D9F A;  4BGD A;  4YM8 A;  1REX A;  3FDS A;  2Q4T A;  220L A;  1UAC Y;  8ICL A;  3WUA A;  3CSQ A;  4AQN A;  5LIN A;  4RQ7 A;  4TUQ A;  5D5F A;  3C1Z A;  1C6T A;  5J2H A;  1C08 C;  3RW8 A;  1FFU A;  3RB0 A;  1L52 A;  2EPE A;  4GRV A;  3WK7 A;  1WQP A;  1B22 A;  3C7Y A;  4C0Z A;  2G06 A;  2BQD A;  3MGW A;  1QSY A;  2AGQ A;  3L5K A;  3Q8L A;  3TMU A;  3RR7 A;  3UXP A;  2LHM A;  2CPR A;  1GBS A;  1RFP A;  1REZ A;  1T8F A;  6LYZ A;  5JU5 A;  4H8Z A;  1X6J A;  4OWE A;  5KG5 A;  4Z3M A;  5FCP A;  4EKP A;  4USA A;  164L A;  3GII A;  1JHL A;  3EXD A;  3HH6 A;  2KD1 A;  4R6C A;  3OJS A;  1PK1 A;  3DMV A;  4OWA A;  1XU4 A;  1OUG A;  1QLN A;  4WMG A;  2KTQ A;  3B0O A;  2W9A A;  1FLY A;  1D2Y A;  1JKD A;  3G3A B;  3AU6 A;  2F30 A;  2B6G A;  2KHQ A;  4YFK A;  3T5H A;  4Z6D A;  110L A;  4C7Y A;  2KKV A;  1MN8 A;  4UB3 A;  2OE9 X;  4R8U A;  5AKI A;  4IQT A;  5ALN A;  4G3I A;  2B7X A;  2MU2 A;  3RTV A;  5LAG A;  2OM6 A;  1KNI A;  4LGK A;  1A2Y C;  4Q43 A;  1T6H A;  4LT1 A;  1LV5 A;  2DUY A;  3OE0 A;  5ALY A;  4ZOH C;  149L A;  2Q9E A;  1P2L A;  1KXX A;  3WW5 A;  1C60 A;  1Z00 B;  2MUT A;  4LFX A;  3TXI A;  3RB3 A;  3HDE A;  5DB6 A;  4NXZ A;  3GIK A;  3D2Q A;  1C6B A;  1HEP A;  1C6P A;  1QTZ A;  4ELT A;  1L69 A;  1JMS A;  1QCK A;  162L A;  3LYS A;  4RW2 A;  163L A;  3RT5 X;  3RJE A;  2DQD Y;  4DQJ A;  2PMZ C;  1LSP A;  1ZQN A;  2WB1 C;  3RNX A;  4OCZ A;  3C28 A;  5LVK A;  4NIJ A;  2ZIU A;  2W9B A;  2QB1 A;  1L51 A;  1IIP A;  5ALJ A;  2XQO A;  4P4P A;  1K1Q A;  2FE9 A;  1T8A A;  4NHT A;  1G1W A;  1UIE A;  1DYD A;  1G0Q A;  4GFJ A;  3AZ4 A;  3J81 j;  4DF8 A;  2BCU A;  2NRW A;  3C2L A;  2A7D A;  4DDA A;  4ARL A;  5J2E A;  3AJN A;  3B0K A;  4NM1 A;  4QWC A;  9ICK A;  3WXT A;  1JIY A;  1GF8 A;  2D91 A;  1J2M A;  102L A;  1TCY A;  3PX6 A;  1LSC A;  2YBM A;  4MR1 A;  3SB5 A;  4DSI A;  2HOI A;  2W3R A;  1HNL A;  1Z19 A;  1P3N A;  1L3T A;  3ZDA A;  4HPE A;  3SYZ A;  1UT8 A;  2Z19 A;  1GE1 A;  1KIR C;  4M9J A;  174L A;  4ML7 A;  2F77 X;  3Q8K A;  1YRO A;  2FMQ A;  3N28 A;  244L A;  3SBA A;  1LMN A;  5HNK A;  129L A;  1S0V A;  1BB5 A;  1RJC B;  1RDF A;  128L A;  1L15 A;  4ARM B;  5AI9 A;  1L13 A;  4PZO A;  2EAP A;  2W1M A;  2D4K A;  2OXO A;  3H0R B;  1L5U A;  1WQO A;  3I76 A;  2EZX A;  1HJP A;  3DMZ A;  2D3D A;  223L A;  4CGZ A;  1SSY A;  3NY8 A;  5E4P A;  1L18 A;  3AGG G;  207L A;  2W8K A;  4NY8 A;  1UA6 Y;  1K1S A;  1JSF A;  3PNC A;  3TXH A;  1IP2 A;  1IOS A;  4DKL A;  1LWG A;  4OO1 J;  1L20 A;  5CJ7 A;  1VED A;  4ARQ B;  1C6D A;  180L A;  1XEI A;  4PHE A;  8ICB A;  1L70 A;  5AI4 A;  3RAQ A;  5AKJ A;  1QTK A;  5KG3 A;  1ZQD A;  1PQI A;  3DN3 A;  4JUZ A;  2F8K A;  1LHK A;  5FEL A;  3AM9 A;  1L0J A;  1OUE A;  4AXT A;  4ANR A;  5KFG A;  3GQC A;  1HF4 A;  3QU9 A;  4UAZ A;  127L A;  5AIA A;  5AKL A;  1CJ8 A;  2HUL A;  1ZQK A;  2VB1 A;  3M8S A;  4B4I A;  4KN4 A;  3SP3 A;  1DPW A;  4F5O A;  1L8L A;  1ZYQ A;  1L34 A;  2UVW A;  1OV5 A;  3GUJ A;  4YR0 A;  126L A;  4AGA A;  4J9K A;  1L63 A;  3SB9 A;  5ALG A;  123L A;  2FBD A;  1L95 A;  2HEA A;  2E8N A;  2MA1 A;  3UXN A;  1MSW D;  1XJU A;  5EE3 A;  1L79 A;  1N2X A;  4HV2 A;  3HJE A;  133L A;  1IX0 A;  4O5C A;  1IY3 A;  2BQF A;  3FC4 A;  5DB7 A;  1CV4 A;  1LZN A;  3CDT A;  2PI4 A;  2HOQ A;  4NY5 A;  260L A;  2DQI Y;  2MEH A;  1VJ5 A;  2BPG A;  4H90 A;  1UT5 A;  154L A;  5KXO A;  1F10 A;  3NRZ A;  2LBO A;  1N60 A;  3FA0 A;  157L A;  1L74 A;  4EKR A;  2H9J A;  3OE6 A;  3ATO A;  4NHI A;  1BPY A;  3LDA A;  3V2W A;  3EW9 A;  5CHG A;  8ICX A;  1HEM A;  2BGW A;  1C68 A;  1JKB A;  4CGE A;  3HWT A;  1CV3 A;  4XJB A;  5C6L A;  1LJH A;  4FS1 A;  1L31 A;  1L42 A;  1MLC E;  190L A;  1DI4 A;  2A1J A;  5FEK A;  1FKQ A;  4TTD A;  5G5G A;  3TAD A;  3QXG A;  2JV3 A;  1UA0 A;  5DGA A;  1CKD A;  4XEN A;  5DN5 A;  4X3B A;  1PS5 A;  2F44 A;  3Q8Q B;  3UPQ A;  2I9G A;  4GCF A;  4BJQ A;  1BWH A;  3HKZ F;  1C69 A;  1G7L C;  5GTI U;  1IC4 Y;  3HTD A;  2WF7 A;  171L A;  5KXM A;  1U49 A;  4GN3 A;  4UB1 A;  5ALI A;  1B7S A;  4YD1 A;  2NRT A;  1NOM A;  2DL0 A;  3A92 A;  2DWQ A;  3ZDE A;  2OTY X;  3TAP A;  2OWO A;  1AT6 A;  3C81 A;  1B7N A;  1JRO A;  4NWH A;  2M9N A;  3MC1 A;  242L A;  4Z6E A;  2H5X A;  1RQN A;  2EZY A;  4O3P A;  9ICH A;  1AM7 A;  3PV8 A;  4UWV A;  4FO6 A;  1GB3 A;  3I28 A;  3AUO A;  2YQE A;  1G07 A;  4W58 A;  2R8I A;  1D0M A;  2QKQ A;  3HBD A;  5EWE A;  4KL7 A;  4U6P A;  2ZIL A;  5ALU A;  2WAQ F;  3UMG A;  4LFP A;  7ICG A;  212L A;  1KN5 A;  3WKB A;  1ZQF A;  5KG1 A;  1L19 A;  1Z4N A;  125L A;  1T97 A;  1UA1 A;  2FMP A;  160L A;  5BOM A;  3ETL A;  1XGR C;  1L57 A;  135L A;  1YAP A;  2CN1 A;  1LZ5 A;  4EZ9 A;  9ICC A;  1LZE A;  1IV8 A;  4DS4 A;  4LDO A;  1T3N A;  3GZF A;  3NGD A;  1NK7 A;  4ETA A;  1RM6 C;  1JUD A;  4CDG A;  1X9M A;  143L A;  2KE7 A;  3BS5 B;  4NGO A;  1D8L A;  4Y2T A;  3N7S C;  2ZNW Y;  2P66 A;  4ET9 A;  2CXY A;  2BPF A;  2ZIX A;  1TE2 A;  2IOH A;  4Z6F A;  1NKE A;  3BDP A;  1CV1 A;  5B06 A;  4H9H A;  3RBE A;  1NQI A;  2IOF K;  1DKJ A;  3WK8 A;  218L A;  1HEL A;  1UBZ A;  2F3N A;  1ZQC A;  5KFI A;  3MFH A;  1RPL A;  189L A;  3KHH A;  3NVV A;  2FBB A;  4TX7 A;  3BKV A;  5KFJ A;  1L59 A;  4B9N A;  4B9M A;  1GEV A;  2IFF Y;  2KHV A;  5K7O A;  5J0T A;  1L38 A;  3BQ1 A;  1JIH A;  2IGC A;  3DN8 A;  130L A;  4I27 A;  4OWC A;  4BAF A;  3A3Q A;  1XC9 A;  2BQK A;  5IEL A;  4JWN A;  1VLB A;  4KLO A;  1U4B A;  1JTO L;  4DOC A;  1C20 A;  4MST A;  1HEQ A;  9ICX A;  5F16 A;  2W9M A;  5LA5 A;  3QZ7 A;  2BQE A;  2LYA A;  2LM4 A;  1L68 A;  148L E;  2YBJ A;  5KXR A;  2HEF A;  2XTH A;  2RBP A;  4GCD A;  216L A;  3EO5 A;  2GH1 A;  2H5Z A;  2K4H A;  5KT6 A;  5L1I A;  4DFM A;  5AM0 A;  1S9F A;  4FZL A;  2BDP A;  1Q3U A;  2BQM A;  3GUK A;  4I2H A;  3NVZ A;  156L A;  4RU9 A;  3QNG A;  1BB4 A;  1Z4O A;  3Q8S B;  1GFR A;  1L62 A;  3H0M B;  3G6V A;  3UON A;  5HHI A;  4ECU A;  1KS3 A;  4PGQ A;  3MR2 A;  1P37 A;  3HT9 A;  4ETC A;  4H9I A;  3JPQ A;  1L50 A;  3WPL A;  2HVH A;  1HER A;  4KTQ A;  2OHF A;  4JMU A;  4UB8 U;  1RYR A;  1L73 A;  8ICH A;  3WU9 A;  4US8 A;  1Q3V A;  1C45 A;  1NKC A;  3SAH A;  2F32 A;  1KEJ A;  1L14 A;  8ICJ A;  1NKB A;  1LYH A;  4QNL A;  5KFZ A;  159L A;  5ALQ A;  4QZ8 A;  2HOF A;  1P6Y A;  8ICC A;  1LHM A;  1UPH A;  1IWU A;  1D3N A;  1ZJM A;  4NEB A;  3KKA A;  1L46 A;  3PW0 A;  4O3Q A;  3EMS A;  1ZQI A;  3QYP A;  132L A;  3V6K A;  3C83 A;  5KXT A;  234L A;  1G0L A;  1LOZ A;  2D6B A;  2YBI A;  2WB1 F;  5KFO A;  3TAR A;  1XO0 A;  2LCB A;  2RBO A;  2Z2E A;  3A95 A;  4F4W A;  1B5V A;  2KSO B;  4EBD A;  1B5U A;  2B70 A;  152L A;  3LK9 A;  1PUZ A;  5KFB A;  4F2S A;  1OV7 A;  3FAD A;  2ZIJ A;  5CP2 A;  1WQN A;  1S0M A;  3B0X A;  1L21 A;  3LYO A;  1PK1 B;  4M0A A;  5C6I A;  1D2W A;  2EIZ C;  3VCB A;  1C6E A;  3A67 Y;  5ALX A;  1TBY A;  3OHA A;  5ALM A;  3H7I A;  109L A;  1ZD3 A;  4F71 A;  1LYS A;  4TSB A;  4R8U B;  4OJO A;  5AM5 A;  165L A;  3ZEK A;  1AT5 A;  2Y9U A;  1OUF A;  2RDI A;  4OJL A;  4QW8 A;  4I7J A;  3EWA A;  1B0X A;  4RQ0 A;  2DGZ A;  3C8R A;  5KKI A;  2V9W A;  4I28 A;  4IAT A;  1ZMY L;  1GF3 A;  2BQI A;  3WK6 A;  1GFT A;  1QTV A;  2E5S A;  2H3Q A;  2MUT B;  191L A;  1LGX A;  4HTN A;  2Q0Z X;  4EPF A;  1Y88 A;  4IAS A;  2R8J A;  4NLN A;  2HHQ A;  1JPO A;  4I7N A;  1L94 A;  1LZY A;  1UCV A;  5J8Y A;  1LSA A;  4QZB A;  5L9X A;  5T3F A;  3DEE A;  2HW3 A;  1NHB A;  3RU5 A;  1XEP A;  1BB3 A;  4YG2 A;  5DB8 A;  1O03 A;  3A91 A;  1LYG A;  2FLP A;  1DXJ A;  4O34 A;  1YL0 X;  3VC8 A;  4OOT A;  5KFU A;  2IHM A;  1ZQ1 C;  4F3O A;  4NGW A;  1E8L A;  2W9B B;  4NLB A;  4ARP A;  1XO1 A;  1C6G A;  1IWT A;  1XGP C;  2H3Z A;  3V2Y A;  1L43 A;  1QUH A;  4B9T A;  2ZG6 A;  1J1X Y;  173L A;  3TQ1 A;  1BB6 A;  1LTM A;  2FPL A;  1ZYT A;  4UWN A;  5KG2 A;  5E79 U;  1GFU A;  5J7C A;  4QZC A;  5AI0 A;  4Z46 A;  3OPX A;  4NLZ A;  5ALL A;  4QWE A;  1L65 A;  3LYM A;  4ECW A;  166L A;  5ALZ A;  8ICV A;  4MF2 A;  2G4P A;  1B7L A;  226L A;  3LYZ A;  5HR7 A;  1L27 A;  5I14 A;  4N8Z A;  1B43 A;  1NK4 A;  5DGB A;  3A3R X;  1ZQB A;  5ALV A;  1L37 A;  1L61 A;  1D8B A;  1L7N A;  257L A;  1ZQP A;  5KFH A;  137L A;  1SWW A;  1XWL A;  2BPU A;  2FPM A;  3ZDD A;  5KFN A;  5J0U A;  3PR4 A;  4F72 A;  1WG8 A;  3WU8 A;  6LZM A;  2W11 A;  1UIF A;  2RB2 X;  4HJZ A;  4D9Z A;  1ZQR A;  5KXL A;  3IP4 B;  3F6Z A;  2KIC A;  1L3S A;  4YMO A;  1DYE A;  228L A;  3GUL A;  4NGY A;  1LYY A;  5KKJ A;  2N1R A;  5ALF A;  4DSF A;  1L09 A;  3RB6 A;  4OOO A;  4I7R A;  7LZM A;  1LI2 A;  2I6X A;  5D49 A;  4LZT A;  2NTG A;  1GE4 A;  1NJW A;  1NWG A;  4UAW A;  2RLT A;  5F14 A;  3WKA A;  2YMM A;  1CV5 A;  3OE9 A;  3TAQ A;  4KLG A;  1IY4 A;  4QZE A;  2D4I A;  2J6T A;  5LVJ A;  3W6B A;  3WH1 A;  1QTM A;  3PSF A;  5C6J A;  167L A;  4XRH A;  249L A;  3WPJ A;  1LZR A;  256L A;  2JZB B;  2BR0 A;  2MEF A;  1HEK A;  9ICG A;  4KLT A;  1GAY A;  1LCN A;  4MEY A;  1TK0 A;  1QS9 A;  1D0K A;  4KLE A;  3QY4 A;  4DQS A;  1D9W A;  2KIV A;  4UAV A;  3HPO A;  4YX7 C;  3LWL A;  5HR6 A;  4W54 A;  5KFQ A;  4U3X B;  9ICM A;  5A3Z A;  3KKA C;  5H2F U;  1REY A;  1L8O A;  2ASL A;  1P7S A;  1L16 A;  1ZQT A;  1GXX A;  2JMG A;  3D6J A;  5IIM A;  1ZD5 A;  3E3D A;  1LGU A;  4LYC A;  1SZH A;  4PJ0 U;  5J2J A;  4YEM A;  1C6A A;  1KXY A;  2UVR A;  1YZ6 A;  4B0D A;  3J6K A;  5LVG A;  114L A;  4CFO A;  1IVM A;  2JEF A;  2Y9T A;  2PI5 A;  1L44 A;  1LJ3 A;  1LJE A;  3PDS A;  4CE6 A;  5IIN A;  1C6C A;  2YMP A;  3P64 A;  4FZM A;  2R8K A;  1KFT A;  2ZIW A;  1FLW A;  4OJP A;  4GCC A;  3DMX A;  4UQG A;  1P2C C;  5APD A;  3MGH A;  1G7H C;  186L A;  1LAA A;  2ANX A;  3WUN A;  1L02 A;  1B7R A;  2J6U A;  3QX7 A;  1F6R A;  4FDY A;  4ECT A;  2MEC A;  5J0Q A;  4Z98 A;  4NJ8 A;  4ED1 A;  1LJ4 A;  1KRP A;  4QW9 A;  5J2B A;  1UUZ C;  2BQC A;  3N7R C;  9ICJ A;  141L A;  1YAQ A;  2NYV A;  3F5E A;  1G0J A;  5KFW A;  5AM3 A;  5L3I A;  1CUK A;  2A1J B;  2YB1 A;  2G5I B;  4Z6C A;  4RZR A;  2HHV A;  4WM2 A;  5KAI U;  229L A;  3HUA A;  4C4R A;  1VDQ A;  1YZ7 A;  3SV4 A;  1KTQ A;  2HBK A;  2B6Y A;  1CX7 A;  5EWF A;  4WL6 A;  2G0A A;  1CKH A;  4EPI A;  3MBY A;  1XSN A;  4ETD A;  2JH7 A;  5KFC A;  3KD3 A;  2MED A;  4ED2 A;  5KFR A;  1KW5 A;  4YR2 A;  4GC7 A;  3BS7 A;  3N97 B;  4QY9 A;  4RUC A;  4ECV A;  3WK4 A;  2W03 A;  1KFD A;  1IR7 A;  4F5R A;  2Y0S F;  1ED1 A;  1WWU A;  2LYO A;  4FS2 A;  2BPC A;  253L A;  2O79 A;  3ZI4 A;  4DQP A;  1L76 A;  3CRX A;  1S77 D;  4H93 A;  3K1Z A;  1DZB X;  2HBM A;  2XY7 A;  1C6K A;  1L49 A;  4DQQ A;  4ELU A;  1SV0 A;  4RQN A;  1ZVH L;  5JUM A;  3QEB Z;  9ICB A;  1IWX A;  2LZT A;  1QH9 A;  1YKX X;  5KG0 A;  1CU0 A;  2B5Z A;  3RH4 A;  1D6P A;  1XSL A;  1NZB A;  8ICR A;  233L A;  3QEA Z;  4MFC A;  4ZIX A;  2A19 A;  176L A;  2DQE Y;  1NMM A;  1IP1 A;  4RDS A;  4A7D A;  5L1J A;  4NSH A;  3QU7 A;  3HW8 A;  1LSD A;  5KT5 A;  108L A;  1TKD A;  258L A;  1IP3 A;  1OUH A;  2K60 A;  4IC9 A;  3HWL A;  1BGX T;  4G4C A;  2NWD X;  3P66 A;  3WXU A;  252L A;  1C65 A;  3JPR A;  1MC8 A;  4PGJ B;  2J6S A;  5JTI A;  4M47 A;  5B59 A;  4H9F A;  3UMB A;  1C7Y A;  3QU5 A;  259L A;  1TDY A;  1RZT A;  155L A;  2F8L A;  1SKS A;  3V7K A;  3CDO A;  1QSA A;  4DJH A;  1G0K A;  2RP5 A;  4K4G A;  4EEY A;  9ICT A;  3NS1 A;  4HAI A;  4DFJ A;  3HT8 A;  5HQ1 A;  2XY6 A;  1F0W A;  5KXW A;  1QQ7 A;  4NHS A;  2ZIX B;  3W6F A;  4IR1 A;  4WLX A;  119L A;  1D3F A;  3WVY A;  2DPI A;  2AHO B;  172L A;  1QTD A;  4YR3 A;  1SXE A;  4GC6 A;  1CRX A;  3CNH A;  4I2F A;  7ICN A;  2Q9D A;  1ZQA A;  3WUL A;  4F4K A;  1GB9 A;  5A3E A;  2LKY A;  3F2B A;  3IWR A;  4ETE A;  1GFV A;  4I2C A;  1LYD A;  3ATN A;  1COK A;  2DQG Y;  4MFF A;  1LMT A;  1M6Y A;  1GBO A;  1PVP A;  196L A;  4NSJ A;  3DDH A;  4IRD A;  2Z38 A;  4C4S A;  4Z41 A;  2DQN B;  3KBB A;  5DKW A;  1OUI A;  2Y1J A;  1IOQ A;  3D4S A;  3U26 A;  1OP9 B;  2P35 A;  4MEX A;  5L9J A;  4OD0 A;  3WK5 A;  1HHL A;  1ZQG A;  5C5J A;  3Q8M A;  2KN7 A;  4J9O A;  1SL1 A;  4PHI A;  4H9A A;  2HMX A;  3H8S A;  205L A;  1X6I A;  4P0Q A;  1O23 A;  3C8S A;  5KG7 A;  3T5K A;  3AYQ A;  3H40 A;  1L35 A;  3OSN A;  5F9L A;  1BPE A;  5KFX A;  107L A;  2HUB A;  4DFP A;  2DKX A;  1LZS A;  1QTE A;  3G6Y A;  230L A;  2NTH A;  1CUP A;  4RPX A;  3JPO A;  1L87 A;  2ZNX Y;  4KXI A;  5ALR A;  2WF5 A;  3IM1 A;  3C2K A;  3W6A A;  4ED8 A;  1L47 A;  2PXI A;  1QUG A;  4YMN A;  1X9S A;  1OQM A;  3C23 A;  3L3F X;  2K4P A;  4IRK A;  1HMK A;  4DSK A;  1LSM A;  1QDT A;  3F8V A;  1G1V A;  4F5Q A;  1NNL A;  235L A;  1L81 A;  4QZD A;  4YXJ A;  3RJH A;  1SX2 A;  5DG9 A;  4KLI A;  1B2K A;  4UAR A;  1RXW A;  1CJ6 A;  3L64 A;  2MEA A;  4LT3 A;  1B6I A;  4M9L A;  3WKD A;  1LZ6 A;  4CCH A;  2GOL A;  1B5Z A;  4IAP A;  2PKE A;  4R66 A;  4LT0 A;  5B66 U;  1C43 A;  2YB4 A;  2RRD A;  2W54 A;  3HTF A;  3QUT A;  4US9 A;  3RH5 A;  2A4T A;  2D8C A;  2W7O A;  5ALT A;  2IHL A;  4XJH A;  3B6L A;  8ICF A;  145L A;  1NBY C;  2F4G A;  118L A;  3IN5 A;  3MR5 A;  3HIL A;  1WTM A;  3TXJ A;  3C7Z A;  2B0C A;  5JRT A;  4WLT A;  3ZD9 A;  1CKG A;  2CRX A;  3AGI A;  2JEG A;  3DV9 A;  5HML A;  3K3T A;  1B7O A;  3SI8 A;  3NRW A;  1LWK A;  3GUP A;  1REM A;  1SKW A;  5B5E U;  3K2R A;  4RNO A;  4C8N A;  1KXW A;  224L A;  3OE8 A;  4O5E A;  1A0P A;  4DL6 A;  4WLD A;  4TUP A;  1SV0 C;  4B9L A;  2O7A A;  2KFZ A;  2WF9 A;  161L A;  4XQ8 A;  1NKH A;  4LVS A;  3LN2 A;  4RLM A;  1D0L A;  1WQQ A;  1OWY A;  2W55 A;  3C5G A;  2LYB A;  2AQ4 A;  3IHQ B;  9ICN A;  1GFG A;  1YKY X;  248L A;  4CF3 A;  4RQM A;  3M9O B;  1WVV A;  5KNI A;  4Y2V A;  3ZD8 A;  1GEZ A;  3BZC A;  1OUJ A;  3CW2 C;  158L A;  4DCC A;  2KZZ A;  211L A;  3OJP A;  2LYH A;  4UAY A;  4DFK A;  1B0D A;  254L A;  4EX6 A;  2GWS A;  3GFK B;  3DN2 A;  4RQ1 A;  4EZ6 A;  1C6J A;  3M18 B;  3CT0 A;  5ALK A;  2BQJ A;  2NRZ A;  1P56 A;  5DLA A;  4F2R A;  1GHL A;  1KW4 A;  1GF7 A;  1VDT A;  3W6D A;  3EUB 2;  3GIJ A;  1HC0 A;  4DLG A;  3QZ8 A;  1ZQO A;  1D9U A;  4KLH A;  5KFM A;  7ICV A;  3JR6 A;  7ICK A;  2AH5 A;  4X5V A;  1YL1 X;  3G3W A;  3HP6 A;  5LVH A;  2JR5 A;  4M2Y A;  4QGZ A;  1L54 A;  5AHX A;  5ALO A;  1LSF A;  2RAY X;  3W6C A;  5GTH U;  1KQQ A;  2HTX A;  236L A;  1HFZ A;  4DQ5 A;  3L4P A;  3A6C Y;  1LMP A;  2HU1 A;  1RG6 A;  5IIJ A;  2OE7 X;  3P4Z A;  4J9S A;  1IWV A;  146L A;  1VDP A;  3TMW A;  3BKH A;  1L98 A;  1ECW A;  4EEK A;  4F92 B;  4RNN A;  4R63 A;  4TUR A;  1L33 A;  3D3D A;  1C7P A;  1GAZ A;  5T14 A;  1LSB A;  4EXM A;  2BDU A;  2RB0 X;  4N1C C;  1C61 A;  2BKE A;  1QDR A;  1SWV A;  4K5Y A;  4HTQ A;  4B4J A;  3FM9 A;  1RI8 B;  3LZM A;  3VWO A;  2JGA A;  4C8K A;  4H1P A;  4ET8 A;  2F2N A;  2EAM A;  1SV4 A;  2C22 A;  1C67 A;  3LWM A;  1HUO A;  1TAY A;  2B73 A;  5B1G A;  4PGY A;  262L A;  2CJL A;  5DQH A;  5EOZ A;  1WTN A;  5J0S A;  4MF8 A;  4H9C A;  4XN6 A;  2YY6 A;  4RQ3 A;  3EPI A;  2O4W A;  4ECX A;  1FIQ A;  1Q8K A;  175L A;  1IC7 Y;  4DL2 A;  2DQC Y;  2BQ3 A;  3WPK A;  2DF4 B;  4P4O A;  9LYZ A;  140L A;  1PQO A;  1W08 A;  237L A;  1HML A;  1L97 A;  3LYT A;  5AMY A;  3G6X A;  3GUI A;  1EXN A;  3TFR A;  1XNS A;  1UHU A;  2B6W A;  2QB0 A;  4DD0 A;  4FBU A;  1FDL Y;  3GV7 B;  3V6H A;  1C66 A;  2ISP A;  7ICU A;  7ICP A;  4NL9 A;  4NWI A;  3FI7 A;  3RJF A;  2VA2 A;  2MSN A;  5LYM A;  2LC9 A;  147L A;  3MFI A;  3AW7 A;  183L A;  1HEW A;  2FI1 A;  1FEZ A;  1B9O A;  4M9N A;  1GBW A;  1T7P A;  1L75 A;  1L71 A;  3PW4 A;  5IIL A;  3SEN A;  3KTQ A;  3MR3 A;  2FYD A;  1QTH A;  5AK4 A;  4PPO A;  1L60 A;  1T8E A;  3J4G A;  261L A;  3UM9 A;  4NGL A;  9ICU A;  1NJX A;  3QAK A;  1LKS A;  1DPX A;  1ZWN A;  2V4Q A;  1ZJN A;  4Q8F A;  3T5J A;  4DL5 A;  3C80 A;  3WUM A;  1OUQ A;  1LMC A;  1UQV A;  5KFT A;  1MQ2 A;  1LHH A;  4YXM A;  1QT8 A;  5F9X A;  4I7L A;  1SX7 A;  5AKK A;  7ICT A;  4JV0 A;  2RH1 A;  3N9C A;  4C8L A;  4N5R A;  1ZV5 L;  241L A;  1I20 A;  4B6J A;  1L04 A;  1K5O A;  3THV A;  1BGI A;  1LYF A;  2ZQ4 A;  2KV2 A;  4WOA A;  3GUM A;  2I6Z A;  2B75 A;  2E8M A;  1T94 A;  2ZIW B;  5DDM A;  1L32 A;  4G49 A;  2LI6 A;  4MFA A;  1DI5 A;  1FFV A;  4H94 A;  1JXE A;  1WCL A;  131L A;  3IG5 A;  4NWE A;  4QZF A;  3WU2 U;  2MEG A;  2ASJ A;  1CJ9 A;  3M6Z A;  1FLQ A;  5BOL A;  3D9A C;  1L23 A;  1L86 A;  3CYM A;  1L93 A;  4W51 A;  3V6J A;  1QQY A;  3QU2 A;  3PW2 A;  1LZG A;  1ZQM A;  1C6F A;  3SZ2 A;  3F2C A;  1WUD A;  3AZ7 A;  1YAN A;  1CKF A;  4NGV A;  3RUN A;  1L3U A;  1LYI A;  4RLN A;  2FLL A;  2R8G A;  9ICO A;  1LJK A;  3CP8 A;  5L1K A;  4ECZ A; 
#chains in the Genus database with same CATH homology
 1UIH A;  185L A;  1NDM C;  3CDQ A;  4XJI A;  1C6H A;  1KY1 A;  2GV0 A;  1LLH A;  1XFP L;  1I56 A;  1IOC A;  3CSR A;  3BQ7 A;  2G4N A;  243L A;  5E9R A;  1C10 A;  5F9U A;  1BQL Y;  1DYF A;  3A96 A;  4YXC A;  1F0M A;  1G0G A;  2DKZ A;  3LHM A;  1GDX A;  1HFY A;  4OO9 A;  1L72 A;  3WVX A;  111L A;  1QTB A;  3CDV A;  2I25 L;  1DXS A;  2ZYC A;  1PQM A;  1L96 A;  4I8S A;  1GE0 A;  1NF5 A;  1QT5 A;  1BVK C;  3EBA B;  1UC0 A;  1CUQ A;  2ES6 A;  1XGQ C;  5DN4 A;  1AZF A;  2B6X A;  2W1Y A;  1IP4 A;  4YOP A;  115L A;  1C6N A;  1LW9 A;  1P2R A;  4PJZ A;  3NY9 A;  4DDC A;  1HEN A;  4M4O A;  139L A;  4QEQ A;  2F2Q A;  5KXK A;  1L58 A;  1DYB A;  5KXN A;  5LYZ A;  1LZC A;  5LXW A;  4I7T A;  1LSE A;  1LMQ A;  3HUK A;  5I4X A;  4G9S A;  3W6E A;  1SQ2 L;  3TXE A;  4NL9 C;  1KIQ C;  2HU3 A;  1L67 A;  5KXS A;  1L92 A;  227L A;  1L10 A;  2RBS A;  2XJW A;  4GCB A;  4L41 A;  1CU6 A;  2LYZ A;  1L53 A;  2OEA X;  3DN0 A;  3W3E A;  1GB0 A;  1NBZ C;  5L1M A;  4TUN A;  1G7M C;  5LA8 A;  4NGJ A;  4H91 A;  4LYB A;  1GD6 A;  2XBS A;  5FST A;  1JEF A;  1QT4 A;  1OUD A;  3AB6 A;  1L66 A;  1GXV 2;  2LZ2 A;  1DI3 A;  2D4J A;  1L56 A;  3HU9 A;  2EAN A;  4GBR B;  4EKS A;  4DD2 A;  4N0J A;  1GF5 A;  2L5Y A;  1ZVY B;  1XGU C;  5I5Q A;  238L A;  1XEJ A;  2MEI A;  4CFP A;  4QDN A;  2BLX A;  1GFH A;  2LZM A;  2CDS A;  1SLY A;  170L A;  1B5Y A;  1L03 A;  181L A;  5ILF A;  3HDF A;  2YBH A;  4BAP A;  1LJJ A;  1XGT C;  1OUA A;  4LYZ A;  1EQ5 A;  4GCE A;  4PRU A;  3TXB A;  4J0L A;  1L55 A;  4HV1 A;  2ESE A;  4LYT A;  1LZ1 A;  2BQG A;  1MEL L;  1KW7 A;  1C6Q A;  3QE8 A;  194L A;  4ARJ A;  3T36 A;  1L64 A;  4WM5 A;  4WG7 A;  195L A;  1JUG A;  4I7M A;  2I26 L;  3IDW A;  1JI7 A;  1JTN A;  1GBX A;  3CQL A;  5I4Y A;  1LHJ A;  1JQU A;  1X40 A;  1L89 A;  5APE A;  3SB8 A;  2YDG A;  1K28 A;  1UIB A;  4RW1 A;  1LMO A;  1YQV Y;  1VDS A;  4YXA C;  3WL2 A;  4WG1 A;  2G4Q A;  3DNA A;  214L A;  3OK0 A;  134L A;  5ILC A;  3WW6 A;  168L A;  4WM6 A;  246L A;  5B05 A;  251L A;  1WTH A;  3GXK A;  3N9A A;  4WM4 A;  1C6L A;  1L39 A;  3SB6 A;  3HT7 A;  2MEE A;  2W1X A;  2ZQ3 A;  2QAR A;  3NYA A;  3AZ6 A;  2Z18 A;  4YF2 A;  2HEE A;  153L A;  3HH4 A;  2DQF C;  3ODU A;  2DKV A;  3TAC B;  240L A;  142L A;  1Z55 A;  2H9K A;  4OWH A;  4DD7 A;  1J1O Y;  103L A;  1JSE A;  5LVI A;  1LZ4 A;  1GF4 A;  4NGK A;  3L2X A;  1GFA A;  1GE3 A;  1P46 A;  208L A;  4I7S A;  2OU0 X;  184L A;  2WAR A;  1GF0 A;  5FDJ A;  3G3V A;  4I7K A;  3WMK A;  209L A;  2YTU A;  1L08 A;  1I1Z A;  2W1L A;  5KJ9 A;  2QB0 B;  5KXX A;  1IIZ A;  1LZA A;  3HTG A;  3P65 A;  1IR9 A;  5I4W A;  1YAO A;  5KXP A;  2KG5 A;  1IOR A;  4OWB A;  2Z12 A;  3K1R B;  1GB7 A;  1CNS A;  1QUD A;  3G3X A;  1JIT A;  1GF9 A;  2DQA A;  1B5X A;  4GN5 C;  1QIO A;  2A7F A;  1L82 A;  1BWI A;  4G4H A;  5II3 A;  2B74 A;  1SGG A;  122L A;  3B0I A;  4HP0 A;  4ZPU A;  4DWX A;  4N1E I;  193L A;  1CU3 A;  1X9X A;  3GUN A;  5DM9 A;  3TXF A;  1OVK A;  1IEE A;  5APF A;  2KSO A;  1N4F A;  2HEC A;  1L25 A;  3RZ4 A;  3H8M A;  1QUS A;  4EMN A;  4XYY A;  4BAD A;  213L A;  5M1Y A;  2OE4 X;  2BQA A;  1LHI A;  1L07 A;  5I53 A;  1IR8 A;  2RBN A;  1L88 A;  2Z6B A;  4J1B A;  5IHG A;  150L A;  1T3P A;  4I7Q A;  2GLE A;  4XJD A;  3CT1 A;  3AZ5 A;  4R0F A;  4TSC A;  4I7O A;  5B1F A;  2YVB A;  1L84 A;  4OW1 A;  5D5C A;  2EKS C;  4W53 A;  219L A;  1IWZ A;  2BQO A;  2LYM A;  1L17 A;  3TXK A;  4HPI A;  1A4V A;  1L77 A;  1B5W A;  1P36 A;  2MEB A;  199L A;  1FLU A;  4YEN A;  4NSI A;  1ALC A;  1CTW A;  1XSF A;  2QAR C;  3C82 A;  1ZUR A;  1D3M A;  4G4B A;  1VAU A;  1LSZ A;  2EAO A;  1G7I C;  1JTP L;  5LAF A;  1LJF A;  3DN1 A;  2RBR A;  2Z39 A;  2L78 A;  3TMX A;  1GB5 A;  3WU7 A;  112L A;  1LMA A;  4XJG A;  1WQM A;  1HEO A;  1L29 A;  1LI3 A;  1GBZ A;  2ANV A;  2OTZ X;  3M3U A;  1X66 A;  1IP7 A;  1LZB A;  1GWD A;  4KT3 A;  4I0C A;  4XJF A;  4N9R A;  4EJ4 A;  4GLA A;  3ULR A;  1V7S A;  1IP5 A;  3ZVQ A;  5HMV A;  4H9E A;  4XAD A;  4BS7 A;  1EQE A;  3F9L A;  3N9E A;  1OUB A;  1OW5 A;  1NDG C;  4UWU A;  3PBL A;  5JEN B;  144L A;  3FI5 A;  4YEO A;  3LZT A;  3DKE X;  1FKV A;  1WQR A;  2XBR A;  1GE2 A;  1Z1V A;  2BQH A;  4ZFP A;  1L00 A;  3HTB A;  1F6S A;  198L A;  1FN5 A;  3TXD A;  1CV6 A;  1UIG A;  2PC2 A;  5HLL A;  1EQ4 A;  2OU8 A;  1JKC A;  1UCO A;  1EPY A;  2RAZ X;  210L A;  3RZE A;  197L A;  1L30 A;  206L A;  1B7M A;  4HJY A;  1L06 A;  4W94 A;  3A93 A;  1LSG A;  4DQ7 A;  1C63 A;  4DAJ A;  4WO9 A;  2ZYP A;  2LPE A;  1IP6 A;  4NHP A;  4EKQ A;  1UIC A;  2HUK A;  4I7P A;  1TEW A;  1SWY A;  4P2E A;  1C6I A;  4NG1 A;  4W59 A;  2N5Z A;  1V7T A;  1JJ3 A;  1GB8 A;  1LYO A;  2BQB A;  2B6T A;  188L A;  1INU A;  5APC A;  1WWV A;  1AKI A;  1OVJ A;  3B72 A;  1LKY A;  5DL9 A;  3HBH A;  3G3B B;  1WVU A;  1HSW A;  1L85 A;  3C8Q A;  3HT6 A;  5F3X B;  1L01 A;  4J7V A;  1QTC A;  3TMV A;  1LHL A;  4NGI A;  113L A;  4ETB A;  4DD9 A;  1G0P A;  1KY0 A;  4II8 A;  4W96 A;  1JKA A;  1GPQ C;  4W52 A;  3FE0 A;  5HNC A;  6LYT A;  1GDW A;  5FHW A;  1LYE A;  187L A;  5IDD A;  1UID A;  4CHX A;  1L0K A;  1QUT A;  1CJ7 A;  4WLY A;  2RB1 X;  1SXD A;  4LDL A;  1C62 A;  1LPI A;  1LPY A;  2QAR B;  1L28 A;  4B1A A;  2DBT A;  1LJG A;  4W57 A;  1PK3 A;  1PQD A;  1GFE A;  4PK0 A;  2E8P A;  5HNL A;  2BLY A;  1QSW A;  4H8Y A;  2C8O A;  225L A;  1HSX A;  4W55 A;  5F81 A;  3SBB C;  2C8P A;  4H9B A;  1QUO A;  1J1P Y;  1L05 A;  2BQL A;  3DN4 A;  1PQJ A;  4W56 A;  1VFB C;  239L A;  2B6Z A;  3HH3 A;  177L A;  1B4F A;  4DDB A;  201L A;  200L A;  3IJU A;  1KIP C;  4HJV A;  1JJ0 A;  1L90 A;  3GUO A;  1JIS A;  1D3J A;  1L83 A;  2YBN A;  169L A;  1C6M A;  1GF6 A;  1H87 A;  1CU2 A;  4IS7 A;  1LZ8 A;  1P64 A;  3HU8 A;  1V85 A;  4WL7 A;  4LYO A;  3CB7 A;  3VW7 A;  1OYU A;  5B07 A;  4DC4 A;  2CGI A;  1LYJ A;  4MCK A;  1IO5 A;  1LZ9 A;  2CWI A;  1W6Z A;  4PJ2 C;  3AW6 A;  1IOT A;  1I6S A;  1L40 A;  4DD1 A;  5LYT A;  3HBE X;  5KY1 A;  3TAD C;  1CKC A;  4ARM A;  3A8Z A;  3C7W A;  4MHV A;  1IWY A;  2ZWB A;  2ZIK A;  1QSQ A;  255L A;  4LT2 A;  3CSZ A;  4WO6 A;  2F47 A;  1CX6 A;  4ARQ A;  1L99 A;  1L22 A;  3EML A;  215L A;  2YSS C;  3T6U A;  4H92 A;  178L A;  1DYG A;  1GFJ A;  1C64 A;  1OXJ A;  1XEK A;  1B7P A;  3SEI A;  4GN4 A;  4GLV A;  2F4A A;  1CV0 A;  1CVK A;  1SWZ A;  231L A;  2OU9 A;  1L24 A;  4WM1 A;  4B4E A;  247L A;  3CT5 A;  120L A;  4S0W A;  3SN6 R;  5LZM A;  1T8G A;  2YBL A;  1QS5 A;  1B7Q A;  2DQH Y;  4LYM A;  1GB6 A;  1LI6 A;  1BHZ A;  3A34 A;  1L26 A;  245L A;  4NGZ A;  222L A;  2Z2F A;  5L3H A;  4C3W A;  4ZEE A;  1LSY A;  1JTM A;  3SB7 A;  3AGH A;  5HMJ A;  1JWR A;  7LYZ A;  1L45 A;  1QT7 A;  1XJT A;  2Y8P A;  1LYZ A;  1C46 A;  1P5C A;  4LDE A;  5KXY A;  2CUU A;  1D6Q A;  3IJV A;  4NFV A;  4FJR A;  4E97 A;  1LKR A;  4DYG A;  4NSG A;  2LMR A;  3HUQ A;  1L48 A;  1LJI A;  1JTT L;  5EBH A;  4DT3 A;  1IC5 Y;  1T6V L;  4EOF A;  1H6M A;  1VAT A;  3ZVQ B;  1G7J C;  3TXG A;  1FBI X;  2FYC A;  2Q0M X;  4TWS A;  2RSC A;  1DQJ C;  1OUC A;  2BQN A;  1BWJ A;  217L A;  4NHQ A;  1GBY A;  1IWW A;  4HSF A;  3P68 A;  1LZD A;  1V38 A;  1YKZ X;  4PZN A;  1EL1 A;  1LGW A;  2EQL A;  1YIL A;  4DD3 A;  2BAA A;  1L12 A;  2HUM A;  1GFK A;  3GXR A;  1GB2 A;  3A90 A;  3DN6 A;  1L91 A;  4C5F A;  1RCM A;  1PQK A;  1BB7 A;  1G0M A;  2AUB A;  3WYH A;  3BS5 A;  1QT6 A;  1QT3 A;  1LJN A;  1DYC A;  4H8X A;  1SSW A;  1YAM A;  221L A;  1JJ1 A;  4NG8 A;  250L A;  5KXZ A;  182L A;  2HEB A;  2RBQ A;  8LYZ A;  2B72 A;  4J1A A;  1OVH A;  4M6D A;  1QSB A;  1L36 A;  4HTK A;  4WM3 A;  151L A;  5LIO A;  1G06 A;  1LSN A;  232L A;  192L A;  1LZT A;  1CU5 A;  1UIA A;  2KMD A;  104L A;  4LZM A;  4E3U A;  1BVX A;  1TLA A;  5J8Y C;  3HH5 A;  1LKY B;  1DYA A;  2DQJ Y;  1PZY A;  2Z37 A;  4IJ4 A;  3HFM Y;  1L80 A;  2HED A;  4B49 A;  1L11 A;  1RE2 A;  1OWZ A;  2X0A A;  4CJ2 A;  1YIK A;  4KPM A;  5I54 A;  3KAM A;  3LZ2 A;  3A6B Y;  4PRQ A;  3A94 A;  3CDR A;  1L41 A;  2E8O A;  1DKK A;  1HFX A;  1NHE A;  138L A;  4YM8 A;  1REX A;  220L A;  1UAC Y;  3WUA A;  3CSQ A;  4AQN A;  5LIN A;  5D5F A;  1C6T A;  3RW8 A;  1C08 C;  2EPE A;  1L52 A;  4GRV A;  1WQP A;  3C7Y A;  2BQD A;  3MGW A;  3TMU A;  2LHM A;  1GBS A;  1RFP A;  1REZ A;  1T8F A;  6LYZ A;  5JU5 A;  4H8Z A;  5FCP A;  4OWE A;  4Z3M A;  4EKP A;  164L A;  1JHL A;  3EXD A;  3HH6 A;  4R6C A;  1PK1 A;  3DMV A;  4OWA A;  1OUG A;  4WMG A;  3B0O A;  1FLY A;  1D2Y A;  1JKD A;  3G3A B;  2F30 A;  2B6G A;  110L A;  2OE9 X;  2B7X A;  5LAG A;  4LGK A;  1KNI A;  1A2Y C;  1T6H A;  4LT1 A;  3OE0 A;  149L A;  2Q9E A;  1P2L A;  1KXX A;  3WW5 A;  1C60 A;  4LFX A;  3TXI A;  3HDE A;  1C6B A;  1HEP A;  1C6P A;  1QTZ A;  1L69 A;  162L A;  4RW2 A;  3RT5 X;  163L A;  2DQD Y;  4DQJ A;  1LSP A;  3RNX A;  5LVK A;  4NIJ A;  2QB1 A;  1L51 A;  2XQO A;  2FE9 A;  1T8A A;  4NHT A;  1G1W A;  1UIE A;  1DYD A;  1G0Q A;  3AZ4 A;  2A7D A;  4DDA A;  4ARL A;  3AJN A;  3B0K A;  3WXT A;  1JIY A;  1GF8 A;  2D91 A;  102L A;  1TCY A;  1LSC A;  2YBM A;  4MR1 A;  3SB5 A;  1HNL A;  1P3N A;  4HPE A;  2Z19 A;  1GE1 A;  1KIR C;  174L A;  4ML7 A;  1YRO A;  244L A;  3SBA A;  1LMN A;  129L A;  1BB5 A;  1RJC B;  128L A;  1L15 A;  4ARM B;  1L13 A;  2W1M A;  4PZO A;  2EAP A;  2D4K A;  1WQO A;  3DMZ A;  2D3D A;  223L A;  1SSY A;  3NY8 A;  5E4P A;  1L18 A;  3AGG G;  207L A;  1UA6 Y;  1JSF A;  3TXH A;  1IP2 A;  1IOS A;  4DKL A;  1LWG A;  1L20 A;  1VED A;  4ARQ B;  1C6D A;  180L A;  1XEI A;  1L70 A;  1QTK A;  1PQI A;  3DN3 A;  2F8K A;  1LHK A;  5FEL A;  1L0J A;  1OUE A;  4AXT A;  4ANR A;  1HF4 A;  127L A;  1CJ8 A;  2HUL A;  2VB1 A;  4B4I A;  3SP3 A;  1DPW A;  1L34 A;  1OV5 A;  3GUJ A;  126L A;  4AGA A;  1L63 A;  3SB9 A;  123L A;  2FBD A;  1L95 A;  2HEA A;  2E8N A;  1XJU A;  1L79 A;  4HV2 A;  133L A;  1IX0 A;  1IY3 A;  2BQF A;  1CV4 A;  1LZN A;  3CDT A;  4NY5 A;  260L A;  2DQI Y;  2MEH A;  4H90 A;  154L A;  5KXO A;  1F10 A;  3FA0 A;  157L A;  1L74 A;  4EKR A;  2H9J A;  3OE6 A;  3ATO A;  4NHI A;  3V2W A;  1HEM A;  1C68 A;  1JKB A;  4CGE A;  1CV3 A;  4XJB A;  5C6L A;  1LJH A;  1L31 A;  1L42 A;  1MLC E;  190L A;  1DI4 A;  5FEK A;  1FKQ A;  4TTD A;  3TAD A;  2JV3 A;  1CKD A;  4XEN A;  5DN5 A;  4X3B A;  1PS5 A;  2F44 A;  4GCF A;  1BWH A;  1C69 A;  1G7L C;  1IC4 Y;  3HTD A;  171L A;  5KXM A;  4GN3 A;  1B7S A;  2DL0 A;  3A92 A;  2OTY X;  1AT6 A;  3C81 A;  1B7N A;  4NWH A;  242L A;  1AM7 A;  4UWV A;  1GB3 A;  1G07 A;  4W58 A;  1D0M A;  2QKQ A;  3HBD A;  4KL7 A;  2ZIL A;  4LFP A;  212L A;  1L19 A;  125L A;  1T97 A;  160L A;  1XGR C;  1L57 A;  135L A;  1YAP A;  1LZ5 A;  1LZE A;  4LDO A;  4ETA A;  143L A;  2KE7 A;  3BS5 B;  4NGO A;  2ZNW Y;  4ET9 A;  1CV1 A;  5B06 A;  4H9H A;  1NQI A;  1DKJ A;  218L A;  1HEL A;  1UBZ A;  2F3N A;  189L A;  2FBB A;  4XN6 A;  4TX7 A;  3BKV A;  1L59 A;  1GEV A;  2IFF Y;  5K7O A;  1L38 A;  2IGC A;  3DN8 A;  130L A;  4OWC A;  4BAF A;  3A3Q A;  2BQK A;  5IEL A;  1JTO L;  4MST A;  1HEQ A;  5F16 A;  5LA5 A;  2BQE A;  1L68 A;  148L E;  2YBJ A;  5KXR A;  2HEF A;  2XTH A;  2RBP A;  4GCD A;  216L A;  3EO5 A;  2H5Z A;  2BQM A;  3GUK A;  156L A;  3QNG A;  1BB4 A;  1GFR A;  1L62 A;  3UON A;  1KS3 A;  4ETC A;  1P37 A;  3HT9 A;  4H9I A;  1L50 A;  3WPL A;  1HER A;  1L73 A;  3WU9 A;  1C45 A;  2F32 A;  1L14 A;  1LYH A;  159L A;  1P6Y A;  1LHM A;  1D3N A;  1IWU A;  4NEB A;  3KKA A;  1L46 A;  3EMS A;  132L A;  3C83 A;  5KXT A;  234L A;  1G0L A;  1LOZ A;  2D6B A;  2YBI A;  2LCB A;  2RBO A;  2Z2E A;  3A95 A;  1B5V A;  1B5U A;  2KSO B;  2B70 A;  152L A;  1OV7 A;  3FAD A;  2ZIJ A;  1WQN A;  1L21 A;  3LYO A;  1PK1 B;  5C6I A;  1D2W A;  2EIZ C;  1C6E A;  3A67 Y;  1TBY A;  109L A;  1LYS A;  4TSB A;  165L A;  3ZEK A;  1AT5 A;  2Y9U A;  1OUF A;  4I7J A;  1B0X A;  3C8R A;  5KKI A;  4IAT A;  1ZMY L;  1GF3 A;  2BQI A;  1QTV A;  1GFT A;  191L A;  1LGX A;  4EPF A;  4HTN A;  4IAS A;  1JPO A;  4I7N A;  1L94 A;  1LZY A;  1UCV A;  5J8Y A;  1LSA A;  5T3F A;  3RU5 A;  1NHB A;  1XEP A;  1BB3 A;  3A91 A;  1LYG A;  1DXJ A;  4O34 A;  1YL0 X;  4OOT A;  1E8L A;  4NGW A;  4ARP A;  1C6G A;  1IWT A;  1XGP C;  3V2Y A;  1L43 A;  1QUH A;  1J1X Y;  173L A;  1BB6 A;  1LTM A;  1ZYT A;  4UWN A;  1GFU A;  5J7C A;  4Z46 A;  1L65 A;  3LYM A;  166L A;  2G4P A;  1B7L A;  226L A;  3LYZ A;  1L27 A;  5I14 A;  4N8Z A;  3A3R X;  1L61 A;  1L37 A;  257L A;  137L A;  2BPU A;  3WU8 A;  6LZM A;  1UIF A;  2RB2 X;  4HJZ A;  4D9Z A;  5KXL A;  3F6Z A;  228L A;  1DYE A;  4NGY A;  3GUL A;  5KKJ A;  1LYY A;  1L09 A;  4OOO A;  4I7R A;  7LZM A;  1LI2 A;  4LZT A;  2NTG A;  1GE4 A;  1NWG A;  5F14 A;  1CV5 A;  3OE9 A;  1IY4 A;  2D4I A;  5LVJ A;  3W6B A;  3WH1 A;  5C6J A;  167L A;  249L A;  3WPJ A;  1LZR A;  256L A;  2MEF A;  1GAY A;  1LCN A;  1QS9 A;  1D0K A;  3QY4 A;  1D9W A;  2KIV A;  4YX7 C;  4W54 A;  4U3X B;  5A3Z A;  3KKA C;  1REY A;  1P7S A;  1L16 A;  1GXX A;  3E3D A;  4LYC A;  1LGU A;  4YEM A;  1C6A A;  1KXY A;  4B0D A;  3J6K A;  5LVG A;  114L A;  4CFO A;  1IVM A;  2Y9T A;  1L44 A;  1LJ3 A;  1LJE A;  3PDS A;  1C6C A;  3P64 A;  1FLW A;  4GCC A;  3DMX A;  1P2C C;  5APD A;  1G7H C;  186L A;  1LAA A;  2ANX A;  3WUN A;  1L02 A;  1B7R A;  1F6R A;  4FDY A;  2MEC A;  4Z98 A;  4NJ8 A;  1LJ4 A;  1UUZ C;  2BQC A;  141L A;  1YAQ A;  1G0J A;  5L3I A;  4WM2 A;  229L A;  3HUA A;  1VDQ A;  2B6Y A;  1CX7 A;  4WL6 A;  1CKH A;  4EPI A;  4ETD A;  2MED A;  1KW5 A;  3BS7 A;  4QY9 A;  1IR7 A;  1WWU A;  2LYO A;  253L A;  2O79 A;  1L76 A;  4H93 A;  1DZB X;  1C6K A;  1L49 A;  1SV0 A;  4RQN A;  1ZVH L;  1IWX A;  2LZT A;  1YKX X;  1CU0 A;  2B5Z A;  1D6P A;  233L A;  4ZIX A;  176L A;  2DQE Y;  1NMM A;  1IP1 A;  4RDS A;  4A7D A;  4NSH A;  1LSD A;  108L A;  258L A;  1IP3 A;  1OUH A;  2K60 A;  3HWL A;  4G4C A;  2NWD X;  3P66 A;  3WXU A;  252L A;  1C65 A;  4PGJ B;  5JTI A;  5B59 A;  4H9F A;  259L A;  1TDY A;  155L A;  3CDO A;  1QSA A;  4DJH A;  1G0K A;  5HQ1 A;  3HT8 A;  1F0W A;  5KXW A;  4NHS A;  3W6F A;  4WLX A;  119L A;  1D3F A;  3WVY A;  172L A;  1QTD A;  1SXE A;  2Q9D A;  3WUL A;  1GB9 A;  5A3E A;  3IWR A;  4ETE A;  1GFV A;  1LYD A;  3ATN A;  1COK A;  2DQG Y;  1LMT A;  1GBO A;  196L A;  4NSJ A;  4Z41 A;  2Z38 A;  1OUI A;  1IOQ A;  3D4S A;  1OP9 B;  5L9J A;  1HHL A;  4PHI A;  4H9A A;  205L A;  1O23 A;  3C8S A;  3AYQ A;  1L35 A;  2HUB A;  107L A;  2DKX A;  1LZS A;  1QTE A;  230L A;  2NTH A;  1CUP A;  1L87 A;  2ZNX Y;  4KXI A;  3W6A A;  1L47 A;  1QUG A;  1OQM A;  2K4P A;  1HMK A;  1QDT A;  1LSM A;  3F8V A;  1G1V A;  235L A;  1L81 A;  1SX2 A;  1B2K A;  1CJ6 A;  3L64 A;  2MEA A;  4LT3 A;  1B6I A;  1LZ6 A;  1B5Z A;  4IAP A;  4LT0 A;  1C43 A;  3HTF A;  2A4T A;  2D8C A;  2IHL A;  4XJH A;  3B6L A;  145L A;  1NBY C;  2F4G A;  118L A;  3HIL A;  1WTM A;  3TXJ A;  3C7Z A;  4WLT A;  5JRT A;  1CKG A;  3AGI A;  3K3T A;  1B7O A;  1LWK A;  3GUP A;  1REM A;  3K2R A;  1KXW A;  224L A;  3OE8 A;  4WLD A;  1SV0 C;  2O7A A;  161L A;  1NKH A;  3LN2 A;  4RLM A;  1D0L A;  1WQQ A;  1OWY A;  1GFG A;  1YKY X;  248L A;  4RQM A;  1WVV A;  5KNI A;  1GEZ A;  1OUJ A;  158L A;  211L A;  3OJP A;  1B0D A;  254L A;  3DN2 A;  1C6J A;  3M18 B;  3CT0 A;  2BQJ A;  1P56 A;  5DLA A;  1GHL A;  1KW4 A;  1GF7 A;  1VDT A;  3W6D A;  1HC0 A;  1D9U A;  3JR6 A;  1YL1 X;  3G3W A;  5LVH A;  4QGZ A;  1L54 A;  1LSF A;  2RAY X;  3W6C A;  2HTX A;  236L A;  1HFZ A;  4DQ5 A;  3A6C Y;  1LMP A;  2HU1 A;  1RG6 A;  2OE7 X;  3P4Z A;  1IWV A;  1VDP A;  146L A;  3TMW A;  1L98 A;  4EXM A;  3D3D A;  1L33 A;  1C7P A;  1GAZ A;  1LSB A;  2RB0 X;  4N1C C;  1C61 A;  1QDR A;  4K5Y A;  4HTQ A;  4B4J A;  1RI8 B;  3LZM A;  3VWO A;  4H1P A;  4ET8 A;  2F2N A;  2EAM A;  1SV4 A;  1C67 A;  1TAY A;  2B73 A;  5B1G A;  262L A;  2CJL A;  1WTN A;  4H9C A;  2O4W A;  175L A;  1IC7 Y;  2DQC Y;  9LYZ A;  3WPK A;  237L A;  140L A;  1PQO A;  1W08 A;  1HML A;  1L97 A;  3LYT A;  5AMY A;  3GUI A;  2B6W A;  4DD0 A;  2QB0 A;  1FDL Y;  1C66 A;  4NL9 A;  3FI7 A;  5LYM A;  2LC9 A;  147L A;  3AW7 A;  183L A;  1HEW A;  1B9O A;  1GBW A;  1L75 A;  1L71 A;  3SEN A;  2FYD A;  1QTH A;  4PPO A;  1L60 A;  3J4G A;  261L A;  4NGL A;  3QAK A;  1LKS A;  1DPX A;  1ZWN A;  3C80 A;  3WUM A;  1LMC A;  1UQV A;  1LHH A;  1QT8 A;  5F9X A;  4I7L A;  1SX7 A;  2RH1 A;  3N9C A;  4N5R A;  1ZV5 L;  241L A;  1I20 A;  1L04 A;  1BGI A;  1LYF A;  2ZQ4 A;  4WOA A;  3GUM A;  2I6Z A;  2B75 A;  2E8M A;  1L32 A;  4G49 A;  1DI5 A;  4H94 A;  131L A;  4NWE A;  2MEG A;  1CJ9 A;  1FLQ A;  3D9A C;  1L23 A;  1L86 A;  1L93 A;  4W51 A;  1QQY A;  1LZG A;  1C6F A;  3AZ7 A;  1YAN A;  1CKF A;  4NGV A;  3RUN A;  1LYI A;  4RLN A;  1LJK A;  3BKH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...