2XY7A

Crystal structure of a salicylic aldehyde base in the pre-insertion site of fragment dna polymerase i from bacillus stearothermophilus
Total Genus 188
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
188
sequence length
580
structure length
580
Chain Sequence
b'AKMAFTLADRVTEEMLADKAALVVEVVEENYHAAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWALERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGEELAEQLRTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKSKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQARLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA POLYMERASE I
publication title Reversible Bond Formation Enables the Replication and Amplification of a Crosslinking Salen Complex as an Orthogonal Base Pair.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 188
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2010-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2xy7A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 2xy7A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2xy7A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2xy7A01
2F96A 4W5TA 1ZQXA 5CP2A 3KK3A 3AVBA 7ICQA 3HWTA 4CEZA 1HJPA 5F9LA 1TKZA 1VSHA 3OYJA 3BQ1A 1S1TA 5F9NA 5J2IA 4RQ8A 4F4YA 3V7KA 4FJXA 4QW8A 3O3GA 2B21A 2ASLA 4GXJA 3JSMA 4O55A 1ZJNA 5KI6A 5FROA 4YP3A 1ZQSA 3G6VA 3QIOA 3AO2A 3MXJA 4J9OA 3NH2A 4I2AA 4TUQA 5CR0A 2IHNA 1LW0A 3CYMA 2DPIA 3NF8A 5KRSA 5EWGA 4KB1A 3H08A 4E7HA 4CGJA 1B9FA 9ICHA 3GIJA 4LY7A 4HCBA 4Z6CA 1UAXA 2W42A 2QK9A 3B6OA 8ICSA 2EHGA 2E6MA 2AQ0A 1MQ2A 4O5EA 4M9HA 2E4LA 5HMLA 1A76A 4DL6A 4H4MA 3DMJA 2P5GA 4O0JA 4RW8A 3ISDA 8ICRA 4CFBA 2ZTDA 4FJ5A 4K8ZA 2W9BA 5C5JA 3HP9A 4CJ4A 1KSPA 3ZCMA 4C8OA 3ZSQA 2YHAA 3M8SA 5CHGA 4N41A 4DTUA 3NF7A 2Z1JA 3K5NA 3L3VA 3HM9A 2IOCA 3CQ8A 3ORYA 3NTUA 4F5PA 1S0MA 3NAEA 2NRVA 1DLOA 3QZ8A 3GV8B 3TAQA 3QERA 1ZBUA 3BQTA 1BPZA 7ICUA 3K58A 2QKKA 2VG5A 1FK9A 1XI1A 5KFAA 1J54A 4JS5A 2FC0A 2P5OA 2KN7A 4FJGA 4EEYA 5KFGA 3K57A 4E0DA 2DTUA 5KT3A 4KLIA 5FDLA 2O4GA 3ZT2A 2KFZA 4LZGA 3VQAA 3C23A 4J2AA 3UPQA 5KFMA 3AV9A 5J2BA 3BJYA 2BPCA 3HW8A 2XO7A 1KCFA 4KTWA 1IO2A 8ICGA 5J0XA 3QZ7A 2YNHA 2D0AA 4M3ZA 3M8QA 1ZBIA 3MABA 5CY4A 3C21A 5KFTA 2J6UA 4I2HA 3DRSA 3H8WA 4M42A 3SQ4A 3VQ8A 1VSIA 5KFEA 2AQ4A 4MF8A 4NLNA 2AGPA 4MFCA 2XY8A 1JLQA 3NBPA 3VQQA 4C8LA 3SUQA 4FYDA 3MFIA 4CEOA 4FW1A 4ED0A 4RQ0A 3OYCA 3UXNA 2BE2A 2Q3SA 2R8KA 4DOAA 4JS4A 4I2FA 3BDPA 3C6TA 4B8AB 2HMIA 4CEDA 2WONA 4KHNA 4RNOA 3FYHA 4DTNA 4KN4A 2W9BB 9ICKA 3Q8RB 4YD1A 1BCOA 3B0YA 5KFHA 4MQ3A 4PUOA 3RJJA 3PY8A 5BPCA 3KHHA 1TK0A 3JPQA 3V4IA 3OYKA 2UVRA 5J0OA 4I9QA 2RKIA 4AH9A 5J2CA 4OPJA 3Q8PB 3ZDBA 4Z6FA 3V9SA 4CJUA 3RB0A 5J2GA 4HUGA 3SJJA 3NF6A 4FM0A 1NJYA 4K4HA 4FM1A 2OWOA 3D0PA 5KGWA 4CE9A 1KLMA 4E1MA 2KW4A 3V6DA 4IDKA 3P1GA 4PH5A 4CJ3A 4UBBA 5BOLA 3GIKA 4AHRA 7ICEA 1BPEA 5FRMA 4N56A 2R8HA 4OKKA 3T19A 3MEEA 3K59A 4LZDA 2YHBA 4IQWA 5J0PA 1S1WA 4RW4A 5KT7A 1ZQHA 1RXVA 4GVMA 2HHWA 4BE0A 1VSJA 4UAZA 4ZTFA 1U4BA 4O44A 3N4MB 4B3OA 9ICOA 1QSLA 1JLCA 1LB2B 3I0RA 1XSNA 4EZ6A 4F91B 3JPNA 5J0QA 4CK2A 2JEGA 1ASVA 4DSFA 1I39A 3O3FA 4DFKA 1C1AA 5SZTA 4FZXC 4RQ1A 3OYBA 2GBZA 2MUTA 2JEIA 1DGSA 3TAPA 4BDZA 5KG0A 4DF4A 1L3VA 3LAKA 3VQDA 3G6YA 4CF0A 4RT3A 3CM6A 5J2AA 2BANA 4CCHA 4TSXA 4FJNA 4KHQA 3IG1A 1T03A 3V6JA 2HNDA 3LP3A 2W9AA 3T5LA 3OS0A 9ICVA 5KFQA 1ZQOA 3C2KA 4I2DA 2KZMA 4EBEA 5HP1A 4AHUA 3CFRA 3TAGA 3ZDDA 2ITGA 4R5PA 5J0UA 3LZIA 1LWEA 4W5RA 3WNEA 1UT5A 4C8MA 8ICQA 1BHLA 1NK8A 4ZTJA 7ICMA 2I1QA 3PV8A 3GDXA 4TURA 4CJTA 8ICNA 1VSEA 9ICJA 1NJXA 4QZCA 4BGDA 2ATQA 3VA0A 4QCLA 5KFKA 4FJ9A 3KLEA 1N5YA 3S3MA 4FLVA 4EP4A 3OJUA 4ID5A 4UAWA 5DLGA 5CYQA 3LWLA 4RUAA 3KLHA 3L2VA 2IMWP 3H7IA 1SKWA 4UB1A 3RH5A 1NK7A 4KREA 2AGQA 2RF2A 5KFVA 1RTJA 1QTMA 3Q8MA 3SI8A 4DU4A 3SV4A 9ICTA 5KFSA 5KFZA 4ECWA 3PUFA 2VA3A 1TVAA 3RRGA 4CEQA 5L9XA 1S5JA 3HO1A 3ISNC 1N6QA 2BQ3A 3VQ5A 4KLFA 4GW6A 3QIPA 3QEVA 4DOCA 1REVA 1Z3EB 4PGXA 5IINA 3DOKA 2LSNA 2JZBA 2AU0A 2ZJAA 4F4ZA 4FJMA 2MUTB 4DL2A 2XCAA 7ICOA 4KAZA 1Z00A 3LAMA 1IG9A 3WNGA 5KFOA 1ZQEA 3DLGA 9ICQA 3RMAA 2C22A 2C2RA 3K5OA 4I9LA 4M0AA 2KQ2A 4M41A 3M8RA 1BIZA 1D5AA 7ICVA 1LWFA 2VG7A 4Z6DA 1J5OA 2GWSA 1XWLA 5KFBA 4RQ4A 4FS2A 3T5HA 1TKTA 2PFOA 1C0MA 4ECUA 4MEYA 3LDAA 4OGEA 4JLHA 1PZNA 2G8IA 4DTSA 3OSPA 1LW2A 4O5BA 1JMSA 4B08A 2ZUDA 3OVNA 1NOYA 3KLFA 1BGXT 2XHBA 3HVRA 2W8KA 4AHVA 5L1KA 3DLKA 3BQ2A 2HVHA 4KHYA 2W9CA 1NJZA 1NK5A 2J6SA 1IKWA 4I2IA 1HQEA 4QZHA 3V6HA 1Q9YA 1GOCA 3NGIA 3RBDA 3NH0A 2F1HA 4DS5A 3F9KA 4FLZA 1BQMA 2IDOA 1NK0A 2IGIA 2R7YA 4DQQA 4KB0A 4TUSA 4F4KA 2YNIA 4QZIA 1B22A 1HNIA 2ZUBA 4E89A 1RT7A 4ICLA 1ZQGA 2FLPA 1EX4A 1TKDA 4YNQA 1XU4A 4NCAA 1UA1A 1U9LA 4RQ7A 3VQEA 3AU6A 2ZTEA 2ZJ8A 3Q8QB 4E7IA 4CJFA 4XA5A 3KK2A 1TAUA 8ICJA 4BDPA 1ZQRA 1XO1A 2JZBB 5DB8A 1KVAA 3ISCA 1ZQYA 4Q44A 1RBSA 4RU9A 4CIEA 1BPBA 1IM4A 3MDAA 5CJ7A 1Z00B 3UQ2A 4YD2A 3OSNA 2R8JA 2YNGA 3O3HA 5DMRA 1DTQA 3OS1A 1TAQA 4E7JA 5KFCA 3K5LA 1RXWA 3OYHA 4RUCA 1UA0A 3QEBZ 4Y1DA 1BCMA 4H4OA 1WSIA 4YR0A 1HYZA 1RBTA 4CJLA 4N5SA 3C95A 7ICKA 3AVKA 3RMCA 5I42A 3L2RA 4FM2A 4FK2A 4KHUA 3C1ZA 4FLYA 1BPDA 4M9JA 3EZ5A 4R65A 2FMPA 4PHEA 1EKEA 2HNZA 4PHPA 3EY1A 2IAJA 3THVA 1K6YA 2AJQA 2FBXA 5DGBA 4J9PA 1WSEA 3LWMA 3DLEA 4O3PA 1ZQFA 2PYJA 1ZQKA 3KHRA 2W9CB 2IHMA 2Z1GA 3VQPA 1Q9XA 4ECZA 4YCXA 3KD1E 2PI4A 4NCBA 4NYNA 1C1BA 4I7FA 5J0SA 7ICFA 2ASJA 4QZBA 4O5KA 1UOCA 1RDBA 5KFUA 9ICSA 2FLNA 3V72A 1NOMA 2P6RA 5K14A 9ICCA 2DPJA 2VANA 3SQ1A 4CJ5A 1T05A 3NH1A 4P4MA 4DSEA 1SV5A 2ZD1A 4PPXA 3E01A 2Y1IA 3MAQA 2XY5A 5KG1A 4JUZA 2NRWA 3V1QA 4KKOA 3TWHA 3RJKA 5L1LA 3H4BA 1WCLA 3V9ZA 4QW9A 4KITB 4FO6A 3ZT0A 3RWUA 5DBAA 1ZQUA 1ZQWA 4B9VA 4NM1A 4CEBA 3KKSA 3B0XA 4O4GA 2BKEA 4KLOA 3UQ0A 3PO5A 2KZ3A 1YVUA 4Z0UA 4DS4A 3M9NB 4R63A 8ICYA 1X1PA 4XIUA 2A1SA 4F4WA 3OYFA 1HYSA 1CLQA 4B9SA 4KV8A 3H4DA 4KTQA 3CM5A 3TAMA 4M3WA 4UB5A 5JS2A 3TQ1A 2ISPA 4NLGA 2Z1IA 1KVBA 3OYEA 4Z4GA 4FJIA 4J9QA 5DK5A 1NK4A 4BXOA 4CJSA 9ICNA 4YMMA 1DTTA 3UIQA 4OLBA 4DL7A 4KRFA 4B9UA 2OPQA 4UB4A 7ICNA 9ICEA 2JLEA 4WE1A 1WN7A 2F1IA 3AVMA 4CESA 2ZUCA 3A2FA 1W9HA 5JUMA 9ICPA 3PVXA 4EYIB 4LSNA 4HHTA 1S77D 1Z26A 3LPUA 3DLBA 3C5GA 3HVTA 4KN7A 5HLFA 9ICFA 2D0BA 4F3TA 4H8KA 1IKVA 4J9KA 1CEZA 3ZSRA 3NF9A 3OYDA 3PX4A 3VQBA 4G1QA 4F2SA 4ECSA 1TL1A 1G15A 1GOAA 5FRNA 5HHIA 3V7JA 4Q45A 4PHAA 3JPSA 2HVIA 4CIFA 2PYLA 4FZZA 4Q43A 3MR3A 1BPYA 1NOZA 1RYRA 3C94A 3NHGA 4E7KA 4M9NA 4RNMA 4W5NA 1JX4A 4ECRA 3LDSA 4DSJA 3RJHA 3LZJA 3SPZA 2HNYA 1IKYA 4E1NA 5EWFA 5DDMA 3TFSA 4MFBA 3SCXA 1LAWA 4FZYA 3HL8A 4DO9A 4IG0A 1T7PA 4QWBA 4M45A 5KFLA 2IC3A 4J2BA 1RT1A 3G10A 2OZMA 3QEIA 4KLEA 2OA8A 5J0TA 3LALA 1CXUA 3RJEA 3QETA 3ASMA 5KFWA 3QE9Y 3AA3A 4ED8A 2BQRA 2A1JA 2DFEA 4FK0A 1RT5A 4YVZA 2AGOA 4UB2A 1ZQQA 4I2PA 4AILC 1AROP 3DLHA 5D4BA 2G8UA 3QNOA 3SV3A 3ALYA 1C1CA 4K8XA 5CZ2A 3AVGA 2HHVA 1K1SA 4PHDA 4BXOB 4DWIA 3M9MB 8ICBA 3ETLA 3PX6A 4M2YA 5I3UA 5KRTA 3RJFA 3K5MA 4FCYA 4CEEA 3NCIA 5DKWA 3ZT1A 3TI0A 8ICIA 3HXMA 3AUOA 1YTUA 2O4IA 3VQ7A 1RTDA 3OGUA 5KFFA 3QLHA 5KTQA 4TQRA 3ZT4A 4DTRA 1R0AA 2HHSA 1BI4A 4KO0A 4UAYA 1VRUA 4FJHA 2PFQA 3SNNA 2YNFA 3DRRA 3TFRA 4C8NA 3EWAA 1MU2A 3NGYA 2DFHA 2Y1JA 1HPZA 3L2WA 4KLTA 3MBYA 4PA1A 2JEJA 2ZJ5A 3MR6A 2D0CA 4M3XA 9ICRA 5KGXA 1HUZA 8ICXA 5KG7A 3AO1A 7ICJA 4KFBA 4I27A 4I2CA 4N76A 2RPIA 3CG7A 4JWMA 1KLNA 4RQ2A 3ZDCA 1TVRA 4CK3A 1S9EA 4XQ8A 3LP1A 1A77A 3RH4A 1KFTA 4FLUA 4DFPA 1ZQPA 2A1JB 4RQ3A 1D8LA 4RW6A 2BCSA 5DBCA 3T1AA 1FXXA 7ICGA 3KD5E 3MGIA 4BE2A 1ZQCA 2BGGA 1JLAA 1ZQBA 4B9NA 3P5JA 4IQTA 4TUPA 1X9MA 8ICKA 5D46A 4YFUA 3PMLA 4GXIA 3HPGA 2PZSA 4Z4IA 5EU7A 4M3RA 5HRNA 3CFPA 3L2UA 4FJ7A 1ZQNA 5J2PA 1ASUA 1D9DA 3PW7A 4IG3A 1CUKA 4OJRA 4YR2A 4AHCA 5J2NA 3N97B 4ELTA 1J53A 1WLJA 4F5NA 4J2EA 8ICMA 1CXQA 3S3OA 3HJFA 5DB9A 3IS9A 3T5KA 4GMJB 4F3OA 1A5WA 2DFLA 1JIHA 5KFJA 3U3GA 4ID1A 3ZT3A 1SZPA 4P2HA 4KMUA 8ICAA 3JYTA 2A1RA 1WSHA 4FJLA 1RPLA 1U48A 5C25A 4GC6A 3PW5A 3QEWA 1NKBA 5BOMA 3OY9A 3M9OB 2VWKA 1GOBA 3NE6A 2HHQA 2UVVA 3JPPA 2BCVA 2YKMA 4EP5A 1T3NA 3NFAA 3G0ZA 2QXFA 5JS1A 2VA2A 4QZAA 2I5JA 1S0OA 1U45A 8ICHA 4YQWA 3Q8KA 2PY5A 3U3YA 2F1JA 3V9XA 2XGPA 7ICPA 1U04A 2HB5A 2G8WA 1S0VA 3MFHA 4QZEA 8ICZA 4KLGA 4JV2A 1JLGA 3MR2A 3MGHA 1L3TA 1VSLA 2X6SA 3TAEA 7ICLA 4O3SA 2WOMA 1VSFA 4FVMA 3PW2A 3E2EA 3ULDA 1D9FA 4DLEA 4AHSA 2D5RA 4Z4HA 4DMNA 3RB3A 2PFNA 4IRCA 4IKFA 8ICCA 5KFYA 2BGWA 1MSWD 4DEZA 3MDCA 2P51A 1A5XA 1L3UA 4BDYA 2IA6A 2DY4A 4MFAA 3RAQA 3QINA 3OYIA 3HPHA 3AVIA 4RPYA 1ZJMA 1EXQA 4IBNA 1ZQMA 3UXOA 1S0NA 3OYAA 4YFKA 4DTMA 4MF2A 4NCGA 4X5VA 1RT4A 3C1YA 4JWNA 4M04A 4M9GA 5KFRA 1KEJA 4KLSA 1XHXA 1JL2A 5J2QA 5HMMA 1HJRA 4Q8FA 4P4OA 5IIKA 4KHWA 1RTHA 1TFRA 1RDCA 4CF2A 5CYMA 1MQ3A 2ETJA 4IRDA 3ZSYA 5KT5A 1ZQIA 5KFXA 3ZDEA 3QESA 1YTAA 2JEFA 3KHGA 2W9MA 4DSKA 1IKXA 4KLMA 1CZBA 5J2HA 9ICWA 4OGCA 3AVCA 2QKBA 1DOQA 2J6TA 1ZQJA 2XRIA 3Q8SB 4KLQA 3TABA 2HHXA 2YKNA 2X78A 1TK8A 3OYNA 2HHUA 4QWAA 4R66A 4CJEA 2FPMA 3G6XA 4PY5A 4KLHA 3SUNA 3RRHA 4W5QA 2ISOA 3ZSXA 2R8GA 4CJWA 4ECYA 3EPIA 1ZQAA 3T5JA 8ICLA 1XC9A 4JK1A 3F73A 1SL0A 3L8BA 4QWDA 3MR5A 2WTFA 4F50A 1U47A 1EXNA 3OHBA 5KG6A 4RPZA 4KPYA 5DDYA 5C24A 2V4QA 3V7LA 3HPOA 3GILA 4DSIA 4IRKA 4QAGA 4CHNA 3EW9A 4HYKA 4DFMA 5CA7A 5TZVA 3OS2A 4B8CA 2OZSA 4IQUA 4AHTA 5DG7A 4R64A 4RZRA 4JRPA 4OVLA 5DQGA 3JPTA 8ICPA 4OLAA 3H8SA 4Z4CA 3EYZA 5KG3A 4KHSA 4ECVA 5DLFA 1S1XA 4UBCA 4KTZA 5J0YA 4ECQA 1QSYA 5KFNA 4DF8A 4F5RA 4GXKA 4F2RA 2BR0A 4G3IA 1XSPA 4O3NA 1COOA 2BCQA 4OKEA 4HTUA 1C7YA 2ATLA 4IR9A 3HX0A 4FW2A 1ZBLA 4EBCA 2G8VA 5EWEA 1ZETA 3GQCA 3I8DA 3LP0A 3IM1A 4NLZA 1B43A 1FKOA 1TV6A 4CJPA 3RAXA 1SKRA 4LH5A 1BIUA 3VQCA 4IR1A 4OPKA 3GFKB 4FS1A 3NDKA 1ZBHA 4ECXA 3DM2A 4DTOA 3QEXA 4QOZB 5DQHA 2G8KA 1S9FA 3UXPA 3KHLA 1BVSA 3JPRA 2RDJA 2FPLA 5KFPA 2RDIA 4M6WA 1NKCA 4LVSA 2EX3A 4GLXA 5KFDA 5J2KA 4ZHRA 4CJKA 4DL3A 4M3YA 3AVFA 1RBVA 1N56A 1Q8IA 4JV1A 1T4GA 2P1JA 4QZGA 1SL2A 1MC8A 5HRPA 4O5CA 4KLDA 4L8RB 4HVJA 3ZSVA 3H40A 3K75D 2FBYA 4O3QA 4PGQA 4KLUA 3DI6A 5L1IA 1U49A 4C8KA 2UVWA 9ICAA 3U6FA 4NY8A 1Z25A 1S1VA 3ZD8A 3Q8LA 4O3RA 2KZZA 1IH7A 1VRTA 3AA4A 3VA3A 2BCRA 4J2DA 2Q0ZX 2V9WA 3QEPA 2LYHA 4CHYA 2FPKA 1VK0A 4F93B 4CERA 1RILA 3DRPA 4CGFA 4BE1A 4RG8A 3NGDA 1FKPA 1N48A 1SUQA 1QE1A 5KG5A 8ICTA 3K2PA 3V9UA 4HUEA 3LP2A 3V1OA 3RBEA 4CECA 4FJKA 3DOLA 2VA8A 2RN2A 3CFOA 1NK6A 3K4GA 3H8JA 3VQ9A 3KLIA 3BGRA 1C0UA 3B6PA 4YXJA 3DYAA 9ICBA 3O4QA 1T8EA 5E41A 1RDDA 5KFIA 3KLGA 4E19A 3JPOA 1RYSA 5J2FA 3MECA 3AVLA 4FK4A 1S1UA 3TR8A 1JXEA 4BWJA 4ED1A 1BL3A 2W8LA 3PNCA 2OPSA 3RR7A 4F5QA 3PMNA 3V9WA 2R8IA 1RZTA 2KTQA 4J9MA 3ZDAA 1JN3A 4DQPA 5DB6A 2XY7A 4CFDA 4QZDA 4CF1A 1XSLA 3C5FA 2G8HA 4TQSA 3C2MA 2ZQBA 3MEDA 3P83D 1CZ9A 4DTXA 4KI6A 5KT6A 4I2GA 4ED7A 1ZQLA 3SQ2A 9ICGA 5KT2A 4RPXA 4M6WB 4NM2A 1QHTA 5DG9A 1HMVA 3V6KA 4OKJA 4XUSA 1BPXA 1VSKA 3OYMA 1TKXA 1Y97A 2I9GA 3AVNA 3KIOA 1Y88A 4RT2A 3V81A 4FXDA 3RTVA 4IFYA 4CHPA 3D45A 1L3SA 2B4JA 1X9SA 5IIJA 5DQIA 4ELUA 2FBVA 4FLTA 4I29A 1UT8A 1JLEA 2BPGA 4I2JA 1QQCA 4RW7A 4YN4A 1S6PA 5CB1A 5SWMA 5HRRA 3S3NA 1VSMA 4PQUA 8ICOA 4BWMA 1V9PA 8ICWA 2H5XA 4YXMA 4DOBA 4K4GA 3WNFA 2XC9A 5DGAA 3QO9A 4DLGA 3SUPA 9ICUA 3IHQB 1JLFA 1C0TA 2C2DA 4CEAA 4JV0A 3AA2A 3QEAZ 4RNNA 2JGUA 5CZ1A 4DG1A 4Q5VA 7ICRA 3SUOA 2VG6A 4KLLA 1WSFA 2OPPA 8ICVA 3C6UA 7ICIA 3OYGA 2KFNA 1ZQTA 4UB3A 3V1RA 4CHZA 5HRSA 4FJJA 4B9TA 1HRHA 1LWCA 4FJ8A 3GV5B 3RH6A 4Q8EA 4O3OA 3IRXA 3RR8A 4J9LA 9ICXA 1HNVA 3QNNA 2F8SA 1A5VA 3LK9A 4EBDA 9ICMA 2B6AA 8ICUA 5J1EA 3KJVA 4DL5A 9ICIA 8ICFA 3MXMA 3HP6A 1QSSA 5DB7A 4CHQA 1S97A 4CHOA 5HHHA 4HUFA 4CEFA 1SKSA 4HCCA 3OHAA 4IFVA 3ZD9A 1W0HA 4F4XA 2FMSA 4B9MA 1KFSA 4DSLA 4E3SA 4F5OA 4DQSA 1SL1A 2BQUA 1ASWA 2P6UA 5IIIA 1F21A 4J9NA 4LH4A 3C2LA 3HSTB 3GIMA 1RNHA 4DFJA 4ELVA 1BQNA 4Z4FA 3ZSZA 4YMNA 4PWDA 5D49A 2B5JA 4QWEA 3LPTA 4F8RA 1D8YA 3PR4A 3ITHA 1RT3A 4CIGA 1BI4B 4ED3A 3AO5A 1O1WA 4CJRA 4ED2A 5IILA 1JL1A 1YT3A 3TANA 3PR5B 1B92A 5CWRA 3MEGA 1KRPA 3SQ0A 2XCPA 5KT4A 4FLWA 5J2EA 4CF9A 4EYHB 2NRXA 5IIOA 4CF8A 2ASDA 1ZBFA 3AO3A 2YV0X 3RMBA 4P4PA 4BACA 1S6QA 1QLNA 4J9RA 4M47A 5KG4A 4F92B 4CFCA 4YMOA 5HP4A 3FDSA 2BCUA 2BHNA 4ECTA 3HYFA 1WAJA 1JXLA 4CGGA 7ICSA 1S10A 2F8TA 3T3FA 8ICEA 3VQ6A 7ICHA 2ZE2A 1RBRA 5KG2A 2X6NA 4ED6A 3ZSOA 1J9AA 1QS4A 2Z1HA 1RTIA 4GC7A 3AVHA 3L3UA 4B9LA 3AVAA 1X2IA 2E6LA 1KVCA 4QZ8A 4CFAA 2GUIA 3OYLA 1NK9A 2P66A 2IS3A 4FBTA 3VQ4A 4ZH4A 1NKEA 4DU3A 4RQ6A 1VSDA 4PGYA 3TAFA 2G8FA 3KK1A 1HUOA 5J0WA 3HK2A 1WSJA 1S9GA 2OPRA 2UVUA 3LANA 3EPGA 3AA5X 3RB6A 4K4IA 2VWJA 2FLLA 4IQVA 4JRQA 1L5UA 5L1JA 1H38A 1NJWA 1JKHA 3NGZA 3ZSWA 2PI5A 4CGDA 3MXIA 1LV5A 3RJIA 4Z4EA 1TV9A 1I3AA 1RT2A 5J2DA 3L2QA 3PW4A 2GV9A 4E7LA 3M8PA 2FBTA 4XRHA 4DTPA 4O0IA 4KLJA 4LSLA 4M3TA 1JLBA 3DLRA 4J9SA 2HHTA 2PXIA 4CJQA 1C6VA 4Y1CA 3S9HA 2NRZA 4MEXA 4R8UA 2DFFA 1ZQDA 2NRTA 2ZTCA 3OJSA 3FFIA 3BQ0A 4CGHA 1WNSA 4DQIA 4NYFA 5D3GA 4DQRA 1RDAA 3SYZA 5EOZA 3WNHA 2C2EA 2C28A 1WCNA 4CK1A 5HBMA 5DG8A 2PFPA 3PO4A 2X74A 4FLXA 4Z6EA 4I2QA 4QZFA 1ZQVA 3TARA 3RMDA 4YG2A 3KTQA 3GV7B 5C42A 3AU2A 4RW9A 2XGQA 4NXZA 4I28A 1WSGA 5T7BA 4YR3A 3ISBA 2FMQA 2ALZA 4M3UA 4LD0A 3PW0A 2XY6A 2BDPA 1TGOA 3RJGA 1X9WA 4I2BA 4UQGA 4CGIA 1ITGA 3HT3A 4DU1A 3O4NA 1XS9D 2M9NA 1ZQZA 3SZ2A 5J2MA 5DBBA 3GIIA 3AO4A 1EP4A 5IIMA 2OYQA 1RCHA 4KI4A 4MFFA 2IBKA 1RT6A 3I0SA 2HW3A 1RBUA 1XHZA 4CJVA 4QWCA 1S76D 2BPFA 1K1QA 1HYVA 2V4RA 1TL3A 4O9MA 1LAVA 5J29A 9ICLA 1UWBA 1KTQA 4I2EA 7ICTA 4RQ5A 3SI6A 1IXRA 1B9DA 3SPYA 4Q0BA 1EETA 3KKRA 3AVJA 1HQUA 4M9LA 4N47A 4R8UB 1KFDA 4QZ9A 5J0RA 3RB4A 4EZ9A 4FBUA 4NLKA 1JXBA 2MAXA 1BISA 1WAFA 5HROA 5HNKA 4DL4A 3VN5A 1ZYQA 3IAYA 1TK5A 2NUBA 4DTJA 3PX0A 5J2JA 4W5OA 1KDHA
chains in the Genus database with same CATH superfamily
1ZQXA 1P8GA 2XNQA 4OZ3A 1HNZJ 4CEZA 3HOSA 5EN1A 4NXNJ 3BQ1A 3D2QA 2MDAA 3QSIA 3OTOK 1T9VA 3VZHA 4PG4A 1X9JA 5J2IA 2QJ3A 2O8DB 4MIWA 3ZZOA 2NXUA 2RDDA 3NCPA 4NV0A 2HLTA 3EVMA 1VDVA 5J2MB 1Q95G 2DKZA 3I76A 2BXJA 1XMQJ 2R2TA 3AO2A 3MTKA 2WAQD 5CR0A 2IHNA 2DPIA 4UY8O 3NF8A 4U7UD 4KB1A 3O44A 2K4IA 2OUGA 3TPQA 4DR6F 4LY7A 3VGUA 2W42A 3DGVA 2X1GA 8ICSA 2E6MA 1MQ2A 4F7VA 1NXIA 2E4LA 1IUJA 3DMJA 5CD4H 2LLZA 4Q0BB 3H6EA 2ZTDA 1WDTA 4CF5A 3H0RB 4K8ZA 1ZBTA 3NP5A 1CQMA 3MDQA 1RWOB 1KSPA 3MMJA 4C8OA 2Q6BA 2DVIA 3M8SA 1GNKA 3OFFA 4NI2A 3KK7A 4EHUA 3LP0B 1FESA 4B17A 4KGVB 5FLXY 1WC6A 2QLXA 3HM9A 2IOCA 1XMBA 5HROB 3NTUA 3CO0P 4F5PA 1VQKS 2DH8A 2ZBIA 2B7BB 1DLOA 4WQ5A 3QZ8A 4HHHA 3GV8B 1CG2A 3CJ0A 3DXSX 1ZBUA 3QERA 4IOBA 1FK9A 5AQLA 1J54A 2UXCF 4JS5A 4EENA 3LDNA 2P5OA 1QM9A 3CDWA 5KT3A 2JHEA 5AQVA 2LPEA 1RCXB 3GJQB 4HH0A 5BN9A 3VQAA 5MAOA 2LYAA 4USJC 3BJYA 2ATCB 2CGKA 2J8SA 4RU2A 4KTWA 1WKJA 8ICGA 3CWJA 3DXMA 2IBOA 2N82B 4CD3A 4PYAA 3CQXA 1ZBIA 3C21A 3R3LA 5CABA 3Q2TC 4M42A 1KNZA 1HHSA 4X64K 1TMMA 2AQ4A 1LW0B 1W7WA 4H4KA 3FC4A 3NBPA 5E33A 3VQQA 2QTWA 3IDHA 1R8AA 3SUQA 4CEOA 3F41A 1WYGA 4ED0A 4DV2F 3OYCA 5ALVA 4H4MB 2HGMA 5LMUF 1DEJA 4CW7B 3BUZB 3BDPA 4B8AB 4CEDA 2WONA 1NGEA 1RACB 4KN4A 2BOAA 2NR0A 3SFUA 3KWGA 5KFHA 3IGVA 1UEKA 5FPNA 3UDVA 3PY8A 1L8LA 3V4IA 2UVRA 5J0OA 4I9QA 2RKIA 2V8HA 2VH7A 3ZDBA 4NLCA 3V9SA 4CJUA 3RB0A 4EAHD 5L1MA 1YQHA 4TY8A 1Q8LA 3RBXA 1XMOF 1HBNB 2AJ0A 4WF9L 4K2XA 4CE9A 1KLMA 3F2KA 2O8FA 2KW4A 3OR1A 2VG5B 4B3TJ 5GTHU 3I4PA 4CJ3A 3GIKA 3R9PA 4P73A 4R79A 1GLBG 3M1VB 4WXOA 3H5XA 4YDUA 2DBYA 3KFUF 4N56A 5AQNA 3ET6A 2XS2A 1RHKB 3JAMY 4Z7CA 3NLCA 3MEEA 2MKKA 2GVZB 2YHBA 1D1UA 4X4NA 1S1WA 2R7OA 5C2DA 4BE0A 1ZQHA 3U9DA 2HHWA 4JI7K 4S0MA 1QSLA 2O67A 1Y9OA 3MM7B 3T1HF 4DSFA 1I39A 1L7NA 4WQ5C 4GVBB 5SZTA 4FZXC 3JS9A 1WELA 3M8QB 2IOFA 4DR4F 3DRSB 2MUTA 2ALYB 2N3LA 4ILHA 4DF4A 2NYIA 3G6YA 2V50A 1VBZA 3A12A 2FVCA 5DZ7A 4CCHA 4TSXA 4DPUA 2RNEA 1GXLA 1T03A 2CPDA 5T7LB 2IOFK 4JI4K 2HURA 4I0WA 4K43A 4KH4A 3PIPL 4ZS6A 2KZMA 1B7FA 1ZRMA 5HP1A 1NMEB 2J0WA 3AAQA 4YOVA 3C6TB 4JNEA 3CFRA 2AA4A 3P49B 5GAEP 2ITGA 1FFWB 1RAJA 3AHPA 3VTIA 4RUBA 2RT3A 5HAOA 2ES6A 1NK8A 3RAMA 2I1QA 3GDXA 4NOHA 3NWRA 4WCEQ 1NJXA 4GKKF 3AD7C 3O9QA 3VA0A 2DH9A 2CQIA 1MWYA 3U1MA 4H4KC 4ZPAA 2JZ5A 5ETNA 3RF9A 5DLGA 5CYQA 5IQ6A 3KLHA 3L2VA 1QQNA 3H7IA 3OVBA 4PZOA 1J2NA 4ZVOB 3HTVA 5KFVA 3EUB2 1GMVA 1YLXA 3C0BA 2AHOB 5ETTA 3SV4A 2E1AA 2JVRA 3GFYA 5M1OA 2CQDA 4NA2A 5KFZA 1DQAA 2B0CA 3EJMA 3L7OA 1CJTA 1NZBA 4DR5F 1OH5A 3HO1A 3SAGA 4GW6A 3AGKA 5B0DA 3VCDA 1K8KB 1Z3EB 5IINA 2K8BB 2LSNA 2HAFA 2ZNZA 2JZBA 2AU0A 2DR6A 4CDIA 2ZJAA 4FJMA 3IR6B 4DL2A 2EC2A 2W2NP 4ETZA 1PC4A 3AGRA 5M1FA 2EFVA 3WNGA 2LXFA 5B5EU 5KFOA 2YQ1A 1ZQEA 1NLKL 3DLGA 3P45B 4LVOP 9ICQA 1R3NA 4YDUC 2C2KB 2XYGB 3CD7A 3C46A 2RH3A 2KQ2A 1FWPA 4CO4A 4X2BA 1FFVA 3CMQA 3IG1B 1GMUA 3TSUA 1D5AA 2RHSB 4CLZA 5H9EJ 4FP9A 1CLFA 2VG7A 3QFWA 3F5AA 5AJ3J 5KFBA 1X5TA 1TKTA 3ZTPA 2F4FA 2PFOA 4MEYA 5HATA 2YWFA 4DJBA 1PZNA 2W41A 4RWWA 3L7PA 2W03A 3HOTA 2U2FA 3DDNA 2W8KA 4DX7A 4AHVA 4DOZA 3BQ2A 1GMWA 1PJ5A 3V6HA 1VQON 2LFVA 1V38A 3NGIA 2DNHA 3NH0A 3UDLA 2IGIA 1SBRA 1K9MO 4KY3A 3MD3A 1JJCB 2HOQA 4F4KA 3IWLA 3O8MA 3IA0A 2YQ3A 2YB1A 4NL5A 2DGQA 1RT7A 4O0NA 2QWOA 3WXIA 2FLPA 1EX4A 3TVKA 1CJUB 3MUVP 2VGNA 5LMNF 1RWMB 4YNQA 1XU4A 1UA1A 2RRDA 5ALZA 3GYXB 1F9HA 5AI4A 2B51A 4JI5K 2W1BA 4K4XA 3BYPA 2G0JA 3VQEA 3Q8QB 2VPYB 4H5TA 3CCUN 4IH5A 1KQSR 2MSSA 1R27B 3KK2A 4HVZA 3GFXA 2C42A 5AZJB 2MGZA 1KVAA 1XO1A 1RG6A 1Y00A 4M5JA 3IMQJ 1G4CA 1IM4A 2QLBB 5AIAA 2BW2A 1IG6A 3IGNA 1Z00B 3OSNA 4QZVB 3O3HA 5DMRA 2XZWA 3OS1A 1TAQA 4LIWA 4E7JA 2P9IB 3AQEA 4BRQA 1FNMA 2IJFA 3MI7X 4ZLLA 2GIRA 1WSIA 3W62A 5F3TA 4YR0A 2V7ZA 2ZEJA 4K7QA 5LT5A 7ICKA 4CT8A 2UXBF 3MHYA 4FK2A 4RCHA 4DHYA 1Q5VA 4M95A 1XTZA 5ITHA 4P10A 2Q66A 1LW2B 1J2MA 4M9JA 1KR4A 3VR1A 2G4BA 2LMIA 3DFEA 2ZC4A 2CQGA 4DR3F 2F5GA 1Q8BA 1DJ0A 1EKEA 4PHPA 3U4LA 2FBXA 5DGBA 4J9PA 1P1TA 3DLEA 2AV5A 1WSEA 1KS2A 4O3PA 3I5AA 1IG8A 1WORA 3EXCX 3HSDA 3FEZA 3T6JA 4DR1K 2K8AA 1HQEB 4UZBA 4YCXA 3KD1E 3N01A 4MH8A 1N36F 2H5JB 4DV3J 1BQMB 3EX7B 5GAEU 1HNWF 3MM5B 1RDBA 3RFAA 2YNIB 2KM8B 1F2GA 2P6RA 3VGTA 9ICCA 4QU6A 2VANA 5AK4A 2DHAA 3QRRA 1O0PA 5C2GA 2KOBA 4ICLB 4DSEA 3GE1A 4MKYA 2IA0A 4QQBA 2Y1IA 3MAQA 5AE2A 4GV3A 4OX9J 3K0JA 3OTOJ 2VIHA 3UCGA 3TWHA 4UASA 3HCXA 1WCLA 4U7CA 2PMZD 3TVYA 3V9ZA 4R0JA 1WHWA 5CEHA 4A8FA 4F72A 3B0XA 4O4GA 3N28A 2RQ5A 3UQ0A 2JSXA 2YNGB 1DTQB 1OY8A 2G5IB 1YVUA 4K4WA 3M9NB 3LUYA 3HSJA 2B9YA 1VQ4S 4A5BA 5HMZA 3OYFA 3EXYA 3KJFB 2K7JA 1PILA 1VBXA 4KTQA 4J03A 4M3WA 5JS2A 1D09B 5I42B 5D77A 2Z1IA 3ZO7A 1UVJA 2QYGA 1FJGF 2GHVC 3DNCA 4FJIA 1N8RT 1NK4A 4JKGA 4Z7YA 4YMMA 2HQFA 5KOXA 2GEMA 1FXDA 2HNZB 3I28A 4X4PA 4B9UA 2OPQA 1L8OA 4UB4A 1TL4A 3FLCO 2JLEA 3QFUA 4WK3A 1PBAA 2R7RA 1WN7A 2F1IA 3ETMA 2FHJA 4WYLA 3R97A 1U2VA 3AVMA 4CESA 5JUMA 3PVXA 3H1VX 4EYIB 1Z26A 3AB2B 2BABA 4PXBA 3O9UA 2NZCA 3C5GA 1S6UA 5HLFA 9ICFA 1C1BB 2JFDA 2YX8A 1IKVA 4URGA 5C2FA 2C2MB 3PX4A 3VQBA 1CZAN 4MAKA 1G15A 5K14B 1M1KT 3H45C 3OTBA 3NGRA 3ALRA 3M2RB 5AKXA 2MXYA 2HK2A 4BRNA 2J0QD 2PYLA 3HJEA 4Q43A 5J8YA 4KC5A 2NSCA 2EFGA 3CJ9A 2CXYA 3H5UA 4FYWB 2NZTA 4WF9Q 4RNMA 2GGPA 5FLXU 4ECRA 4YDDB 1RFQA 4J5OA 4QR2A 3LDSA 3KYLA 2M9KA 3H7HB 4B6JA 2UV8A 1T9TA 2NXNA 3ZC4A 4IXCA 2XQCA 3HL8A 1E4GT 1SC6A 2ZNYA 4H0YB 2P9SA 2JDJA 3QMQA 4C4RA 2VFVA 1RT1A 5H9FK 4X64J 4OYOA 2FC8A 2SXLA 3CMES 2G1HA 3JTNA 1CXUA 3R7SB 3QETA 2KJ8A 2QE5A 4P0QA 4ED8A 2BQRA 5D15A 2A1JA 4K50A 3CJKA 2RQKA 4UB2A 1ZQQA 1UP1A 4H5WA 2ZH8A 3CCVS 2UXCK 1ZM3A 2G8UA 4K8XA 1RA7A 2PD1A 5HR6A 3AOAA 4KGMA 4PHDA 4DWIA 2DGXA 4ZIWA 4PKIA 4PL1A 4UW2A 5E26A 2IYIA 4M2YA 1YF5L 5KRTA 1YZ7A 3K5MA 4WE1B 4PL7A 3PIPQ 4CEEA 4YB6A 3NCIA 4BVOA 1V3SA 3THWB 1XK8A 2BYCA 3VEWA 1RTDA 2IVMA 1DXSA 5KFFA 3J7AN 5KTQA 5ALKA 3SMVA 4DTRA 2Y0BB 2WHEA 1R0AA 1N2XA 4KO0A 4UAYA 3DRRA 5K8NA 4C8NA 2XLIA 1SZ2A 2CJQA 3FJ2A 3O6QA 2XO6A 1YJ9S 1YIJN 1B7YB 4DV2K 2V8GA 3O4WA 2QL5B 5BR8F 1ZQ1C 5LMUK 3BGFA 3DLLL 4M3XA 9ICRA 1VLYA 3ZXWA 3OL9A 5KG7A 1KWMA 4JI7J 4OI1A 1HARA 3POTB 2DXDA 4L3NA 3CC4S 1SJ4P 4EGLA 3O9TA 3GDQA 4PXDA 3NXZA 3CG7A 2LI6A 4QYZK 1KLNA 4IG0B 2EWSA 4RQ2A 1K5OA 1TVRA 3VF4A 2OSRA 2ZXHA 3LF0A 4CK3A 1S9EA 5M1KA 4XQ8A 3LP1A 5AKZA 4LIRA 3JAMU 5FPMA 4RW6A 3SSSA 1YI2N 1FFGB 2LQ9A 3CD6S 1RT5B 2A18A 2DNKA 1XMOK 4BE2A 1RISA 1ZQCA 4JI4J 1ZQBA 3CCLS 4B9NA 2R7QA 3P5JA 5D46A 2YHWA 2DGSA 4M3RA 5HRNA 3L2UA 2ZIUA 1P9QC 2FJDB 1ASUA 2Z7JA 1JCGA 1D9DA 4IG3A 4ELTA 3IN5A 3O08A 4I64A 3A3NB 2ZKUA 3UI3A 1IBCB 3HJFA 5J1NA 2VQEF 2HS0A 4GMJB 3T1HK 3VHQA 5GAHP 5TISU 2ZM6F 4HTJA 2C1EB 4RR5A 2ASYA 4DR4K 1U1PA 3BS5A 4OZLA 3UD4P 4KMUA 3JYTA 2NRHA 5DM6L 1VRUB 4JI6J 4FJLA 3B8AX 2YNFB 4DB3A 3PW5A 3QEWA 2VYPA 3NVWA 1NKBA 2QW9A 2EEYA 2E1EA 3CPWR 3G71S 2YTUA 5A6WA 3NY0A 4O3MA 4BCAA 3HLUA 4BG9A 5ETKA 1T3NA 5H1SV 3NFAA 3G0ZA 2QXFA 4QZAA 3N4WA 4LF4F 3U3YA 4KFBB 4BQLA 3V9XA 2CPFA 2HB5A 4ZCKA 1SB3C 2AH5A 8ICZA 4RUHA 3QJLA 1QQ5A 1SV0A 4OZ5A 4GKKK 1PBUA 4A8XA 1KW4A 1S57A 1H74A 3TAEA 2H5IB 7ICLA 4TYAA 3PW2A 1OVYA 1L7PA 5AK6A 1R43A 3TYTA 1QQMA 1D9FA 4DLEA 3EGVA 5KPZA 3NVYA 4W98A 2J9DE 4P7TA 3OR2B 4CNQA 3VEYA 4IRCA 2ZXIA 2VPWB 1DK2A 5AM1A 1WEYA 2QKQA 1IBLF 3FMWA 3QIDA 3MDCA 2P51A 1A5XA 4M7XA 4BDYA 4A57A 2IA6A 4CGZA 5LSOA 3RAQA 3OYIA 5LSRA 3HPHA 4Y2RA 2JWNA 2Y9UA 4IBNA 1U1RA 2OEJA 1OYDA 4DV1K 1ZQMA 4YB5A 2CQ0A 5GINA 2YJFA 1WBBA 4DR5K 4X5VA 1S4FA 1RT4A 3SSQA 3VALA 1HBUB 4CD1A 4J90A 4M04A 1FI4A 2RQMA 3IS9B 5JMNA 2VD3A 5KFRA 5M1QA 1GXUA 4KH1B 5J2QA 5HMMA 4Q8FA 3UR0A 1OVQA 3QU9A 3LM2A 1TFRA 1RDCA 4DCJB 4IRDA 4H0XB 4E1JA 2YWEA 1QAYA 4BC3A 2A3JA 3ENAA 2WTUA 2JEFA 3PFEA 2JH7A 5ALIA 2HQIA 1IKXA 4KGZB 4KR0B 5L46A 4LFAK 3MMBB 3D2EA 2KFYA 4JK7A 3RG6A 4QS9A 2HF4A 2I5JB 2QKBA 4DQ8A 2J6TA 2XRIA 1VQ6N 1X3NA 4JI5J 1FRMA 2CG4A 2Q1NA 4R66A 3EZOA 3TQEA 2K3IA 5A8KA 4PY5A 1SJQA 3SUNA 4W5QA 4YB7A 2WOMB 2RAQA 1S12A 4U8YA 3DOKB 4Y2JA 4EU0A 3G4SN 3T5JA 1XC9A 2JLFA 3LDOA 4QWDA 3M8WA 1M5PC 3B8HA 3W5ZA 4XH1A 2OTLS 1FIQA 4FYYB 5E3AA 4F36A 2NUHA 5DDYA 5C24A 1WF1A 4YEAA 2FLOA 3HI9A 3W9HA 1AZSA 1OY9A 4PG7A 4YDXA 1CQNA 1JJ4A 2OI2A 4R25A 1YRTA 3MMAA 1EIYB 3C3LA 1SV0C 5LMNK 4A8OA 1N61A 4NCGB 3J7YP 5A0YA 2WBRA 2FJ6A 2BM1A 4OLAA 4Z4CA 3T79A 2WRMA 1RAGB 3BM7A 4ECVA 1XQSC 4KTZA 4QS7A 5J0YA 4L74A 4F67A 4NYZA 3T9NA 2J0XA 1RAHB 1MLAA 4AXIA 4DF8A 1RLCL 2R7SA 4B3SF 2WF7A 1S3XA 4O3NA 3CXCM 2BCQA 4OKEA 4HTUA 2UUBJ 4GO5X 2LHTA 3HX0A 3W8GA 2UXBK 2CN1A 1S6OA 3UD5A 5EWEA 2O8EB 3GQCA 3Q2SC 5GAHU 3LP0A 2YKNB 3ICLA 3IM1A 4K0KJ 3O9SA 4CO0A 4OYMA 1B43A 4CJPA 1SKRA 1IBKK 2I6WA 5AXKA 4DR3K 4LH5A 4JKFA 2Y1LB 4OPKA 4FS1A 5MLCQ 3AJ2A 3DM2A 3QEXA 4QOZB 4M7YA 5DQHA 3UXPA 1OO0B 1X8DA 3DEEA 2ASPA 2AZ1A 4UAVA 5JICA 4X4RA 1NB2A 2RDIA 4M6WA 5L38A 1N36K 2EX3A 5KFDA 3OVSA 2AP6A 4ZHRA 3TTFA 4K4VA 4DL3A 3CCJN 5IC6B 1HNWK 1MNEA 1N56A 4PCQA 1FEEA 1T4GA 4QZGA 2DNNA 2PAVA 2ZGZA 3ZSVA 2HFNA 3CJ1A 1BUPA 4O3QA 2DGUA 1OKJA 4PGQA 4P6QA 5L1IA 4BC5A 1QDUB 3OV7A 1X4CA 3A5MC 3ID8A 2KZZA 1RDUA 1N34F 3SMZA 3VA3A 2Q0ZX 4PEOA 1FX2A 3QEPA 2LYHA 1RKIA 2FPKA 3UM9A 2JWKA 1HWKA 1VK0A 1KEKA 1VQPS 3PIOL 1RILA 4MIAA 4BE1A 2VQFF 2KSOB 3NGDA 1N48A 3I87A 3CJCA 8ICTA 5GAEI 3K2PA 3MGVA 3V9UA 1LKYA 1N8RO 4FJKA 3GFHA 2Y8YA 2RN2A 2KKZA 3EDRB 4QPTA 1HBOA 4ZVHA 2H51B 1Y64A 3CJ8A 4DR6J 2NCKL 5D0HA 3QUQA 1SC3B 3DU5A 9ICBA 3DXKB 1HIWA 1T8EA 5KFIA 3HFKA 2AYGA 4EELA 2JNJA 2VONA 1GK8A 1PG5B 3HBTA 4PRFA 2ZBQA 1KVKA 1FKOB 4LF2A 3TUPA 1WD6A 4J9MA 2E8AA 3W2WA 4TU7A 2C2NA 4C7ZA 2XY7A 4U6PA 1M1KO 4GNIA 1ZD4A 3DLLQ 2G8HA 2DB1A 2WW4A 1TE2A 1WHYA 3NGSA 4ED7A 3SQ2A 5KT2A 1SIWB 2GVDA 4NM2A 4OKJA 4XUSA 1BPXA 3OYMA 1TKXA 1RCOB 1Y97A 3AVNA 1ZC6A 4D3GA 3CIPA 2UXCJ 4RT2A 3V81A 3PSFA 1GEHA 3D2FA 2J4RA 1FRHA 1F3FA 1X9SA 1NCLA 2YI1A 3FR0A 5DQIA 4FLTA 4IUFA 4DV6F 3QBCA 4IYQA 1S1VB 2KEYA 2VOPA 3OL8A 3PSPA 5ALNA 1QQCA 4YN4A 5AXNA 3KOAA 2VGMA 3K9JA 1NUEA 3W2VA 3S3NA 4PQUA 2KKHA 4CZHA 8ICOA 1FKPB 4BWMA 4GIBA 5F3XB 1QE1B 2KL8A 4YXMA 3GSIA 1ZXIA 2XC9A 1LK7A 1LXJA 2DO4A 3QO9A 2XVTA 4ED5A 4Y0FA 3ENQA 3I1YA 9ICUA 1Z6RA 1C0TA 1JLFA 4G9BA 1T11A 3QEAZ 2JGUA 2B4PA 5FPDA 4DG1A 3BGRB 3AQOA 1C0UB 4DV2J 1PYOB 3BN4A 3MDFA 4Q5VA 4GV6A 4CH0S 1BQXA 1YJNS 3E8OA 5LMUJ 4XEIA 1U6FA 3ZETA 1RWUA 2DT9A 2EFQA 2OELA 5DM6Q 2LEBA 2H3EB 7ICIA 1SWWA 1QY7A 3NAIA 3BSOA 3R2DJ 2YTCA 2JGAA 1YITS 3Q83A 2VB6A 2WAQF 4OJPA 4HACB 3EM1A 4QYZJ 4FWKA 4WIIA 1VMBA 4IQMA 3GV5B 2UU9K 3PJWA 4O3OA 1UEVA 2CJBA 1N54B 1HNVA 5AQXA 1A5VA 4M63A 1UMJA 1UEUA 9ICMA 2P9LA 5ELZA 2ASOA 1HMVB 2CQ1A 1XMOJ 4OV1A 3IG8A 2FVRA 3CCTA 4UB6U 2VPXB 4DL5A 3LDLA 4OJ6A 4Q2MA 3M6UA 4E2FB 1ZA1B 8ICFA 4U67L 3MXMA 2HWIA 4OI2A 1GMWD 2DITA 4US8A 4LFBF 2W2OP 3N4QA 1U0HB 4IH7A 2VICA 2CUYA 3MAAB 3PFOA 2KVSA 5ALOA 4YOUA 5BR8K 2CG8A 3LL3A 2XNRA 1ECWA 2E66A 4F4XA 2E8NA 3QT8A 1R59O 1KFSA 5A8RB 2YWWA 1S6PB 3BZKA 2BJ7A 3OPXA 1T94A 4DR2F 1NZPA 2BQUA 2EAMA 3T1HJ 2K89A 4LH4A 1C2PA 4DR4J 3GIMA 1RNHA 3FNNA 3BGOP 4Z4FA 2B56A 4LBHA 3H42A 4ZIVA 4EX7A 2X7IA 3N7RC 3R6MA 1D8YA 3ITHA 3NL0A 2R7VA 2VU5A 4UOCA 4CJRA 3MPYA 1NH7A 2OEHA 1JL1A 5LY3A 1MROA 2VG6B 2EFPA 4K25A 3TANA 1WWUA 1B92A 3SQ0A 4L73A 2QB0A 3C16B 4ZPBA 5J2EA 4C11B 4MO4A 4R0EA 2NRXA 3HJVA 4DPYA 3JS6A 2ASDA 3AO3A 2I1RA 4HKQA 2YV0X 4K8RA 4P4PA 1UVMA 4GKKJ 4BACA 3KBBA 1LWCB 3P39A 4CVNE 2B9EA 3IRXB 1RDRA 2CRLA 2FUG9 2VQEK 4YMOA 2UYTA 2AXTU 1ZD2P 2BHNA 4Y2MA 3IV6A 2XSJA 2P9CA 1WAJA 4CGGA 1S10A 7ICSA 2F8TA 2G5HB 2HG4A 5J1EB 3VQ6A 1UZDA 3KJVB 4TLRA 3CNHA 1GQEA 4ISGA 3C65A 2X6NA 2YX4A 3DC2A 3ZSOA 3BH7B 4BR4A 2OSQA 1ZPWX 3CJ4A 1RTIA 3K1ZA 1XNRF 3SD7A 3IRUA 5FD1A 3AVHA 2O3DA 4TNOA 1RHRB 4FWPA 2G0IA 5BYRA 4QZ8A 3F53A 3E3XA 2GUIA 4DR5J 4LF6K 1NK9A 3JB9k 1BD6A 4ZH4A 4RQ6A 3OFEA 3WT0A 4PGYA 2UUTA 3UO0A 2G8FA 4M63C 3A8EA 3BF4A 4O8UA 4NLUA 1RU1A 3I56S 2EH9A 3RB6A 1JJ2M 3VEZA 1T9XA 1S22A 4IZ9A 2FHOB 1NJWA 2HRUA 5CE3A 3NGZA 3QUTA 3BF3A 1HI1A 3NVVA 2Q0RA 3MXIA 5AQKA 1LV5A 3F9MA 3JQJA 3AOBA 3J81O 5IS2A 3PW4A 3PKYA 1IBLK 1FXRA 4E7LA 1CC8A 2EK1A 5L8RC 2GMLA 2XMTA 2FBTA 3TEGA 1JLBA 3I5CA 1FFSB 4QPXA 4CJQA 2HFUA 4U8VA 2GZOA 1FFUA 5D4OA 3WQUA 1ZH5A 5THWA 2NRZA 1ITPA 2FF6A 4MEXA 4YORA 4R8UA 3H90A 2VUGA 3VEXA 1ZQDA 5C2CA 3QQCD 5ALEA 3FFIA 4CGHA 4JHDB 1WNSA 3SSRA 3NOGA 4RO0A 5D3GA 1TTHB 3WNHA 3UE2A 2W6KA 1WCNA 3CIMA 3ILJA 5HBMA 4US9A 1NH8A 1DQ8A 1VJWA 2X74A 4P2XA 2AT1B 1URRA 2FHJD 4ILLA 3TARA 3AA8A 3RMDA 2Y3YA 1HKBA 3KTQA 1EKRA 5A76A 5AK3A 4RW9A 3WQTA 4B1WB 2E5IA 4HT7A 1HFEL 2FYXA 2MHNA 5DDQC 1WSGA 4YR3A 2OIHA 5LMNJ 3ISBA 5JMVA 3G9CA 1R89A 4W90B 2WC9A 4UQGA 3KK1B 3SMPA 2RS2A 1ITGA 1Y5NB 4C3LA 2Z0GA 2M2BA 4DU1A 3O4NA 4LBPA 1XS9D 5CHIA 2WVBA 2M9NA 4UB8U 1ZQZA 4OI4A 3GIIA 2VJUA 1JKHB 5IV4A 1RCHA 5AE1A 3CCES 1RT6A 2QA4S 2JV3A 2HW3A 2KXNB 1RBUA 2EXUA 1XHZA 1RT2B 4QWCA 4CT9A 3HHLA 4F4AA 2BPFA 2N1RA 2D3UA 2MQNA 2P9PB 1TL3A 1IWAA 1KTQA 2DHXA 2UXBJ 4CTAA 4NMXA 2M52A 3PLAA 2A1AA 2MKCA 4QOTA 4FE3A 2CPRA 4M9LA 5C0YA 4ANCA 1IBKJ 2I7PA 3VOVA 4DR3J 3E9PA 4EZ9A 4FBUA 4NLKA 2K60A 4P7VA 2E9RX 4DCHA 4K2JA 4JI0F 1N36J 4JI1F 1HD0A 3NS5A 1CPZA 3DAWA 3SMSA 1HNWJ 4DL4A 3PZPA 4B3SK 1KBUA 3H3OB 4IH6A 3IAYA 1TK5A 1Y3KA 2QMWA 4DTJA 2FY8A 3PX0A 3GZ7A 4LFCF 5IM0B 2F96A 2JMGA 4W5TA 4Y3CA 5CP2A 2IJRA 3NNHA 3WKBA 1TKZA 3QT5A 3OYJA 1NGIA 3ZFVA 4PXCA 2GAGC 1SJ1A 4M5GA 4YY3F 4F4YA 2B21A 5CRXA 4ZJQA 3MEKA 2KM8C 2ASLA 1YJWN 1RABB 3JSMA 1ZJNA 3GJTB 4YP3A 1ZQSA 5A0LA 1EP4B 3QIOA 4MLEA 5E3RA 5HMXA 3CCMN 3QFHA 4J9OA 4I2AA 4NRUA 5B0AA 3CYMA 3I31A 3IMXA 5KRSA 2DEJA 2HGNA 4E7HA 4HCBA 2XWYA 1UAXA 2QK9A 4OHVA 2MZQA 4XPEA 4A48A 3R1HA 2ZJRL 2AQ0A 4M9HA 4DL6A 3H2VE 2OH2A 1FD2A 4RW8A 3TA2A 1FJGJ 5GAHI 5KAKA 3OFHA 4OYIA 5C5JA 3HP9A 1RQNA 3ZSQA 3O6WA 4I4BA 5TKYA 5CHGA 1N34K 1YVNA 1SH2A 1MMLA 2HGLA 1O51A 4W92B 3Q89A 2FSKA 1WC4A 1S0MA 2QWQA 3C6AA 2DNPA 4FWRA 5AI6A 1LVHA 3HHLC 1YVFA 2QFJA 5JXSA 1DAXA 3VENA 3HSZA 1ATSA 5CCMA 2AD9A 4FZMA 7ICUA 3K58A 4EI2A 3X1LB 1NBWA 2DY1A 3PSTA 1WG8A 4NE9C 2FC0A 1V5IB 4H03B 4LF9F 2KN7A 4DBQA 5ADZA 5KFGA 3K57A 2DTUA 3ETOA 4H0TB 3OLBA 2VKQA 3IAM9 5FDLA 2O4GA 3ZT2A 1HIYA 1BA0A 4LZGA 3ADAC 2ZWHA 4J2AA 1I94F 1UAWA 3UPQA 4U67Q 4FYXB 2BPCA 5AKIA 2GJFA 3WK7A 1IO2A 1FRIA 5J0XA 4JI2K 2D0AA 3GYGA 5CY4A 3VESA 5KFTA 5F41A 3H8WA 2QG9B 5E3PA 1VSIA 1FT8A 2W25A 4Y2UA 2XY8A 2KMDA 1JLQA 1NNDA 3DDHA 3QUCA 1SH0A 4FW1A 4RQ0A 1ULRA 4PXEA 5DO2A 2Q3SA 2VJ4A 2PMZF 2R8KA 4RQMA 4JS4A 3DMJB 4I2FA 3IP4B 2F44A 2HZCA 3MOZA 2FJVA 2G0CA 3BKFA 3FZ2A 2WFBA 1L7MA 3ULEA 5JJBA 2BE9B 5AM2A 4YD1A 2H65B 4DV6K 3VAIA 1M5HA 4NI2B 3KXDA 4UOHA 2OCEA 4PUOA 3RJJA 1NG9A 2NRRA 3OYKA 5KL8B 5J2CA 2QV6A 1OWXA 1SS6A 2ZBRA 1NPRA 5ALGA 1DLOB 3J8AA 1WWHA 2B4VA 3SJJA 1VDHA 2A5XA 2OWOA 3D0PA 2DY9A 5B0GA 5KGWA 4F25A 2DL0A 1FK9B 4IDKA 2AF6A 4PH5A 4AHRA 2GJIA 1XO0A 2XYHB 4CIOA 2R8HA 4OKKA 2FVPA 2BZ2A 3T19A 5BR8J 4URQU 3CP8A 1S49A 4ED4A 4GMKA 1JJHA 1VQ5N 5J0PA 4WFNL 3OA9A 4RW4A 5KT7A 2DR5A 2Q97A 2XI2A 2E88A 4UAZA 2V6AA 1U4BA 5AQGA 3N4MB 5AQTA 1JB0C 5F8JA 4F91B 1X6JA 2JEGA 3DXMB 3O3FA 2CFXA 4WPAA 4U7UK 5DM7Q 2D0PA 2C3OA 3OYBA 3CCRN 2GBZA 2F4VF 4HI2A 3M05A 4BY9C 3TAPA 3B6BA 3UR3C 4H0PA 3SR6A 1V9OA 1J2VA 3J81Y 4CF0A 1U2RA 1BXNA 3NBPB 5E2QA 2DEIA 2RU3A 5J2AA 1ROFA 3DOMA 3CERA 4FPAA 5AK5A 4KHQA 3J7YI 2H3GX 3T5LA 3OS0A 9ICVA 4QJFB 4KHPF 4NB4A 3ZDDA 1EWRA 2WONB 2E5JA 4R5PA 1VHIA 4LFBK 4C8MA 8ICQA 1RK8A 4ZVGA 2GQCA 3W63A 4CJTA 3PSIA 2C3YA 4ZDNA 9ICJA 2YKAA 4QZCA 2CNLB 4QCLA 3V4IB 2KN4A 4DR2K 2RKIB 2VQEJ 4PL8A 1FKAF 3CMAS 3OJUA 3EVOA 4ID5A 2ZM6J 1UL3A 3LWLA 2PGCA 4FF1A 4ZP7A 3D28A 2IMWP 4TY8B 1SKWA 3RH5A 4QNLA 4HI1A 4KREA 4ZPDA 1RTJA 1KLMB 2O8FB 3Q8MA 3OR1B 2JC0A 1FWLA 1JXVA 2IVOA 1S72N 5M1PA 9ICTA 3ET6B 3MEEB 1F3VA 3PUFA 2VA3A 1P6TA 2D3DA 1S1WB 5L9XA 3R2CJ 2YWKA 2ZBPA 2HHHF 4LF4J 1N6QA 3OLAA 2L9WA 3PRBA 3CCQS 3QEVA 2Z2YB 3DOKA 1RE1B 4ZLNA 1Z05A 2EG2A 4D3HA 2MUTB 3DV9A 1O08A 4KAZA 4PPDA 1MDUB 2HF3A 1U1MA 2MQMA 4IOAQ 3E51A 4IO9Q 2HI0A 2FZKB 2WAQC 2C2RA 4LRFA 4I9LA 1UCVA 4DUZK 3BS7A 1T03B 3GU3A 3W64A 1IBLJ 1BIZA 4KH6A 1FNOA 5F8LA 4W4MA 5E5NA 7ICVA 1LWFA 3BR9A 5B0CA 1J5OA 4MMOA 5HP1B 3HSCA 5EX5A 2ZWPA 3T5HA 5AQSA 2HQDA 1XNRK 4ECUA 2VC0A 1BE4A 3I32A 5GMKa 4IJAA 3CD0A 3TJ9A 2MYFA 4O5BA 4B08A 2GLEA 2H3VA 3MN6A 2ZUDA 3OVNA 2QTDA 1BU6O 4Y2IA 5C10A 3T69A 1BGXT 2H3IA 3K17A 2WUSA 2VBXA 4JKEA 3DLKA 1KP6A 2Z2MA 4FWMA 4KHYA 2BV3A 2JVOA 3FCWA 5CYQB 3KLHB 2BJDA 4I2IA 1Q9YA 2DNOA 3RBDA 1PVQA 4CNZA 3MMVA 3OTQA 4DS5A 3VAMA 3NUQA 3BV8A 3J7AP 2ZBCA 1NK0A 3PCOB 4DQQA 2WF9A 4KB0A 4QZIA 1B22A 3EZUA 1HNIA 2NV3A 2KRBA 3ENWA 2J0SD 1ZQGA 3R1XA 1Z1VA 3C8YA 2HOEA 1CJTB 2PBDA 2XEXA 3WKCA 3JXOA 1R8BA 4E7IA 3I96A 3ZYYX 1X4HA 4CJFA 4XA5A 2M70A 1VQ8N 1PVPA 1N60A 2JZBB 1ZQRA 5DB8A 4BDPA 5AQYA 3ISCA 4X65F 1RBSA 2M8DB 3CCUS 1BPBA 1RYUA 5JLFA 3HILA 5CJ7A 3CXCR 3UQ2A 3ZTSA 2Q36A 1OS5A 5E3QA 1MWKA 2DIVA 2IVYA 3DLGB 3VETA 1RXWA 3OYHA 1RBOB 2AJ4A 1UA0A 3CJRA 5ALXA 5AQUA 2VG7B 3HFZB 2E8MA 1TKTB 3BBFA 3UVJA 4TYBA 1N5QA 3TWZA 2CJYB 2WF6A 4PWUA 3EY1A 1IJEB 2IAJA 2ZJRQ 5K8OA 3GL1A 1WJ9A 2JXJA 4XDDA 3H3NO 1W25A 2POKA 4USIA 3R27A 1TELA 2IHMA 1BC6A 5E3CA 1B70B 2YWHA 4ECZA 4ZPVR 5I9EB 2D9PA 4ISEA 2ASJA 4O5KA 1DURA 3KG4A 4B1XB 2HBZB 3K2YA 4B3SJ 9ICSA 3WKEA 1HLUA 3V72A 3W65A 1NOMA 2W7AA 1RT7B 4P4MA 5BYQA 1SV5A 3E01A 4IL6U 2XY5A 1U2CA 2LM4A 3V1QA 1NZ8A 4KKOA 3RJKA 5HSPA 4X84A 2K1RA 3KK2B 4QW9A 2V68A 4FO6A 3ZT0A 2MGZB 3OQ2A 2JX2A 1WOSA 3V5RA 3DHWC 1K0TA 5EE9A 3KKSA 2BKEA 4KLOA 2CRXA 3G6ES 2KZ3A 4DS4A 4HWIA 2ERRA 1X1PA 1N0UA 2W2MP 2WVCA 4MK7A 4B9SA 5A2QY 5HVFA 1VIOA 3CM5A 2MJNA 1D9AA 3AXKA 5ETQA 3V4MA 1WEXA 4UB5A 2ISPA 2YX6A 2KJWA 1HNZK 3O9RA 4NLGA 3KNGA 4JAXA 3OYEA 2FSNA 2QYCA 3MF5A 1Z4NA 3D1OA 5DK5A 3VF6A 9ICNA 4B02A 4OLBA 2BEFA 2E2QA 1EETB 3GR0A 4FPIA 1N34J 4Q7AA 3DLEB 3O1BA 2AIRB 3M8YA 1Z1ZA 4YY3K 3QGHA 3A2FA 4FWLA 2VQFJ 1VQKN 4HHTA 2FSJA 1FE0A 1RWVB 3LPUA 4ERDA 2LXUA 4H8KA 4J9KA 1CEZA 4FXVA 3BS9A 4H5NA 1VISA 3NF9A 3HZ6A 4F2SA 1GOAA 2MB0B 1N5XA 1KAYA 5FRNA 1PIEA 5HHIA 4NJ8A 3VCBA 3EGWB 1P1LA 1RYRA 1QQ7A 4OJ1A 3C94A 4DSJA 2HPUA 2H3FA 5EWFA 1WF0A 5D0RA 3GJRB 3TFSA 1XIQA 1AQ6A 4MFBA 3SCXA 3LGMA 4DO9A 3FM9A 3CI5A 2IC3A 4EK2A 4O4GB 2OZMA 3ENVA 2L5YA 4HHJA 4UQTA 3RJEA 2MZTA 1X9XA 2LQJA 5KFWA 3R5CA 3AA3A 4FOEA 3BR8A 2LP4A 4NZ0A 3AQFA 5AI9A 1H7XA 2AGOA 2CZ4A 1N32F 1FXLA 2LECA 4CO3A 2PFUA 1AROP 3DLHA 2DRBA 5D4BA 3AJDA 3GCXP 3SV3A 3ALYA 1KQQA 3KFWX 2HHVA 3N6NA 4JKGB 8ICBA 4DV6J 4A8KA 4WJBA 1YWXA 3H5SA 2OPQB 5BPNA 5I3UA 2F3JA 2QWLA 2UP1A 3THXA 4P74A 1I94K 2ZH3A 1U2VB 4NPOA 5LL6d 4DCOB 1PO6A 3CC7N 3CVKA 4KSEB 1OMSA 2EW9A 3TI0A 2HVZA 2F2AB 8ICIA 3HXMA 1K0VA 1YTUA 2BDUA 2MPUA 2O4IA 2E1ZA 3OGUA 3ILOA 3KOOA 5HLFB 3QLHA 3VGVA 1IKVB 2JRSA 3N6MA 5LL6Z 3ZZPA 4IOCQ 3FBEA 3A8KA 3L2WA 4KLTA 3MBYA 1Q1KA 2HHPA 2R2SA 2Y9TA 5KGXA 2MKYA 1YIJS 1HUZA 1EAYC 2GGPB 4JYAF 2ZVSA 1Q3UA 3MUTP 1X7VA 3FGVA 3AO1A 2J7UA 4I27A 4I2CA 4N76A 4XTTA 3HULA 1S5ZA 5HMYA 2H4YB 2RPIA 2NPFA 3F56A 1H72C 2P9SB 1RT1B 1U09A 3SCLE 2ZUGA 3RH4A 4P0QB 4DFPA 4J37A 2A1JB 4ICAA 1WC1A 1D8LA 2IM1A 3O5TB 3CJKB 5DBCA 2EK6A 2E1RA 5BR9A 3NKYA 2V63A 2KDOA 5F3ZA 5ALTA 1JLAA 4FSVA 3IKMA 1WACA 3MCAB 4CRXA 1U1OA 1Q53A 3DU6A 4UARA 3M2UA 3PMLA 3HPGA 3QUBA 5EU7A 4LFBJ 1KHVA 5MLCV 4AL7A 1ZQNA 5J2PA 1NHUA 3QYPA 1G99A 4BRDA 3FBFA 2E1MC 3PW7A 3AY9A 1J53A 4F5NA 1Q5YA 4DR2J 8ICMA 3J81U 1CXQA 4BQZA 5DB9A 1EQMA 5ALHA 4U9RA 2A6OA 4YS2A 1A5WA 1RTDB 3FSXA 4ID1A 2W11A 2G9OA 2RMLA 4NWBA 2F4VK 4P2HA 1R0AB 5B66U 3BH6B 1VQLS 2A1RA 1PC5A 1WSHA 2GX9A 1U48A 2DD8S 3G25A 3DRRB 5C25A 7FD1A 3OY9A 3M9OB 4UUWA 3I33A 4O8KA 4CLPA 4CO1A 1U24A 2IIRA 2B0GA 4FWSA 4IEEA 1WC3A 1NSKL 1U45A 3DCAA 3PTWA 4YQWA 3Q8KA 1QCKA 3IO1A 4ILGB 3H25A 5U47A 4C1NI 2B4OA 1JJ2R 4USUA 1U04A 4GVEA 4ACOA 3AEVA 2BKOA 3HHLD 3S41A 1JLGA 1RWXB 1L3TA 1VSLA 2PMZC 4M5MA 3MGJA 2EWHA 1TVRB 2IRYA 4FVMA 2O8BA 1S9EB 1SI9A 5K8PA 3MAHA 3LP1B 2C3MA 4AHSA 4DMNA 3RB3A 4RW6B 2PFNA 2E3TA 4IKFA 3KUHA 4DUZJ 3EO3A 5KFYA 1URJA 2K8GA 4NL9A 1SZHA 1LKZA 4MFAA 4OYAA 1KONA 1XNRJ 2ZIUB 1NMNA 3W9JA 2VODA 2ODGA 3UXOA 3BB5A 1S0NA 4IG3B 3W3SA 1XC3A 4MF2A 1N0VC 2HHHK 2CGJA 5HQ8A 1F1BB 2VKZG 3MM8A 2RIJA 3R8EA 1SH3A 4M9GA 2GAHC 2ROGA 1S59A 1XHXA 1JL2A 3UE5A 3BS5B 2MA1A 3TVZA 3T9ZA 4KHWA 1RTHA 3JYTB 4DN9A 5CYMA 5KT5A 3D68A 1ZQIA 5H9EK 1RBLA 4RPFA 4EFAC 1K73T 2O6KA 4ZVSB 5HN0A 1TZ0A 4JK9A 2GO7A 2MSTA 3ZTRA 3M30A 4HDHA 5D0EA 4OHZA 4EO8A 5J2HA 4JEPA 3HSGA 3MWTA 1Q7LB 3Q8SB 2EAOA 1MWMA 4A4JA 1Z2LA 4GKJF 1WTFA 4DZ6A 2KYZA 5LXYA 3CT9A 2R9LA 5AQMA 4PKHA 2BW7A 2R8GA 3ZZYA 1GLEG 1NAQA 1DK3A 1ZS6A 4CJWA 3X3UA 1U25A 3UMGA 3AFGA 3AJ1A 3EE3A 2B3TB 1SL0A 3L8BA 4YUDA 2MZRA 2DNRA 2WTFA 1U47A 3CCSS 5KG6A 3E9LA 3G4SS 1ZBSA 1P8ZA 5B0BA 2V4QA 1P7DA 3GILA 4IRKA 5DRKA 2LBOA 1RKJA 3EKSA 4HYKA 1ZPVA 1OPIA 1V3RA 4EX6A 1O13A 3BSNA 3TX0A 4IQUA 1R7IA 4RZRA 4CRJA 4OVLA 2G13A 1RT4B 2MZJA 4DUTA 1Y0HA 2FE9A 5B8HA 5IWAF 4J9UE 4EO6A 4UBCA 5J2QB 4M5LA 4E98A 1H2UX 1FCAA 1NRKA 5KFNA 1Z2ZA 4NL9C 4WFBL 1BDGA 3U27A 2BR0A 3O2IA 4G3IA 5JVHQ 1NB7A 3KMQA 4BC2A 1IKXB 1HWIA 4ZVUB 2QWRA 2CNKB 3KZIU 2UUCF 3D2EB 4IR9A 3KG1A 5HL7L 4JOUA 4EBCA 1ZETA 3KVGA 3TUIC 2HWTA 4C0BA 2W43A 4NLZA 3A3OB 1TV6A 1D3WA 3H1QA 5IXUA 5A8KB 2O01C 4DV5F 4FWNA 3GFKB 4WFAL 1KXPA 4ECXA 5JVGL 2V8PA 1S9FA 5IC4B 2CADA 3M1YA 1S99A 4USTA 2HQ3A 2X3GA 2AEJA 5BRFA 4ZA1A 4JI0J 1NKCA 4C97A 1VQ4N 4JI1J 4ILJA 4PHTX 5J2KA 1HWUA 1MWQA 2UZAA 1C4AA 2GQQA 1RBVA 4M94A 5C24B 2DHSA 4RNFA 2YB4A 4JV1A 1AZSB 1MC8A 2HFVA 3G82A 4O5CA 3VZIA 3J80O 4OX9K 2G0AA 4LFCJ 4HVJA 4CZCA 3H40A 3K75D 3A8JA 2MKSA 2AJ1A 4C6AA 3MMAB 5JLHA 2IVNA 4KLUA 4UATA 2N7YA 2E5LF 3K5PA 1Z25A 3ZD8A 3FRZA 3N0VA 3P8BB 4WFZA 3Q86A 2ZZTA 1L6NA 5A0YB 4J2DA 2E2OA 1HUXA 4YY3J 5KQ8A 1P9YA 4DHVA 4CGFA 1FTRA 2Z4PA 2D3O1 4RG8A 5E7OB 2HIQA 4OIXA 5A2QU 1LXNA 1SUQA 1U02A 4X66F 1EHWA 1SXDA 2KT5A 3LP2A 3V1OA 4CECA 3G8TA 4QIGA 3DOLA 1V85A 2VA8A 2QZ8A 3CFOA 3K4GA 5EE0A 2E2PA 3PHEA 5ALYA 3DRXA 2CYYA 2LCWA 1NLVA 3LVWA 4YXJA 3DYAA 5AQRA 4QIEA 3KLGA 2H1YA 3IR5B 1RYSA 2DUYA 3MECA 1S1UA 3OW2M 5AQPA 2GMHA 3VTHA 4ZCIA 1F5AA 4ED1A 1QVGM 2OPSA 1H1VA 1Q4RA 4P0PA 3RR7A 4F5QA 3TZWA 3T1YF 3TTCA 2UXDF 5ALSA 1JN3A 4DQPA 5DB6A 4M5DA 4XO0A 4EUVA 4QZDA 2E7WA 4CF1A 1GAOA 2FXUA 4KQZA 1XSLA 3DM2B 4TQSA 4ES3A 4OJ3A 2ZQBA 3CMEN 1CZ9A 4OO1J 1ZQLA 3C19A 9ICGA 1X3MA 3KNAA 1OIAA 4M6WB 3L3CA 5F8MA 1KBRA 4ZHRB 3HHDA 4YMEA 1RWPB 1U7LA 1Y88A 1H3DA 3TSPA 2P9NA 1UFLA 4LF9J 1J27A 5AZIA 4CHPA 1L3SA 2WB1D 2LEAA 2K4HA 4LF7K 4OHYA 2OTJN 2QARA 4M5IA 2BPGA 1I94J 4RW7A 4F0KA 1PGZA 2HOIA 5SWMA 1XNQF 5HRRA 3FSYA 3JSRA 1VI7A 1X5OA 1V9PA 3VAGA 2HVDA 2C3UA 1NSAA 4GV9A 3NNAA 4K4GA 3OBWA 3M7DA 1LKYB 4Y2QA 2BRLA 1V6HA 4FWOA 4OI0A 4CEAA 1FEHA 1HBOB 3MN9A 5CZ1A 1VQMS 1YJ9N 5B0EA 5BRHA 1HW8A 3TTDA 2YPYA 2PFDA 2W55A 1N32K 2J9DA 3WK6A 4JP8A 7ICRA 3NASA 2YHYA 3C7NA 2OPPA 2R42A 1S7HA 3C6UA 2WSCC 2KFNA 1YJVA 4UB3A 3W2WB 5HRSA 4YB1P 1ZTTA 1DFDA 1TL7A 3T6BA 1RQLA 1D8ZA 2WVDA 3MWBA 1HRHA 4BR9A 2ACYA 4JN4A 2GELA 4QS8A 3WBZA 2F8SA 3LK9A 1SGGA 2GVDB 4EWTA 2HBRB 2B6AA 2MQ8A 3CD6N 5ADXA 1TKXB 1RDWX 3HZGA 9ICIA 3RSEA 2YH0A 3V81B 1W2BM 1TR0A 1QVFM 3W5XA 1VQ7S 2NZ4A 3D2FB 4CHOA 2YN4A 4I2PB 1SWVA 2V52B 3GR1A 2NNWA 1SKSA 2QWPA 2V2ZA 4IFVA 3MCSA 4B9MA 4JYAK 5AQIA 2J8AA 4E3SA 4F5OA 1SL1A 4CLFA 2FJWA 4H0OA 2MU2A 4Y2PA 3W2VB 2E1FA 5IIIA 4PQUB 5AQFA 1N4LA 2DNGA 1PYTA 3HSTB 1SAZA 3SBTA 1TYQA 4ZITA 2RRNA 2YY3A 2F4VJ 2MQLA 3KHYA 3ZSZA 3QO9B 3M4XA 1XR6A 1C0TB 1JLFB 4C8ZA 2H5EA 4TU9A 2LKZA 2QN6B 4DG1B 2JR5A 1RT3A 4CIGA 3G71N 1OSDA 1BHNA 4N77A 1BI4B 3SBGA 2KXHA 3VQTA 3AO5A 4ED2A 4GY2B 1YT3A 5EHHA 2NUUG 3ZETB 2XWXA 5DS7A 1KVIA 4ILMA 4KHPJ 4NLVA 3PR5B 1Y5LB 2HCFA 3S7RA 4F0MA 5KT4A 4LF5F 4CF9A 4DKWA 5IIOA 1B0TA 4KMOB 4LR8A 1QLNA 3PNIA 1HLWA 4J9RA 4M47A 4ZPCA 4PG8A 3WC2A 5KG4A 2ROEA 3O80A 3L5KA 1U6BA 1HNVB 2QI2A 1IIPA 4JI6K 2AKWB 4ECTA 2P9LB 5AKGA 3HYFA 2I8EA 2MY7A 3NAHA 3D7EO 4I6MA 3EL2A 8ICEA 4IC9A 2ZE2A 4P2MA 2CJ9A 1F0MA 3AM9A 2DK2A 4A46A 2A3ZA 3KWIA 4ED6A 1MA7A 3K7RA 1SQEA 4BRLA 1J9AA 3AA9A 1GLJO 4WKYA 4C7YA 1T3OA 2NREA 3L3UA 3AVAA 1Q82T 1PSDA 3KKFA 2HHHJ 2IS3A 4FBTA 1NKEA 4OLPA 3WQPA 2A2CA 1OH8A 1XNSA 5J0WA 2MHEA 3HK2A 1S9GA 4MKAA 5GMEA 3LANA 3EPGA 3O1LA 2KD1A 4TU8A 2FLLA 2HFZA 4J9VA 2OO4A 2D3ZA 2MSNA 4FNHA 2N7CA 1WI8A 2VBZA 2PI5A 4CGDA 3IWNC 3ITHB 3PYFA 2N4DA 1F60B 3LDQA 3L2QA 1L3KA 3M8PA 2UUAF 1MROB 1BLUA 1MMNA 1O8BA 4WFBQ 3TW0A 2W04A 2BUPA 3I9ZA 3UN2A 3CC2S 2QB0B 1E6VA 2PXIA 2W6LA 4IOXA 3M6KA 3S9HA 2FJBB 3HDSA 4A8WA 3IFEA 2DFFA 2NRTA 5GMDA 1K73O 2J5AA 3TACB 5HL7Q 2MKHA 4C23A 4DQIA 3DRYA 3PYDA 4CLKA 5CXTA 1AW0A 1SV4A 4URSA 1NDCA 2XSJB 4BROA 2AEFA 2F65A 2GOLA 1FDNA 3PYEA 4CLUA 2OTLN 1EARA 2PFPA 3J80Y 3R1LA 3PO4A 4LF1A 4WFAQ 2YH1A 5JVGQ 1RTIB 4YG2A 1WSRA 3UPFA 1J5EF 2VFRA 4TN2A 5C42A 2FGOA 4NXZA 4HLBA 5T7BA 3W1YC 2QWMA 4GRSA 4LD0A 5AHXA 1RJJA 2F9TA 2BDPA 1TGOA 3RJGA 2X1FA 5F1XA 4J8FA 2CQ3A 3UW1A 2C3PA 1AYEA 2FZGB 1U8SA 3BSAA 1B0VA 3LPEA 2OMLA 4OYBA 3SZ2A 3M6ZA 2NSBA 3AO4A 4QIFA 3QT6A 1XBWA 3EE8A 4ZPWR 3SBMA 1YKWA 1HR0F 5E79U 2IBKA 3I0SA 4A61A 2DCUB 3W9IA 1FW6A 4NX9A 1HYVA 4P2FA 5ETLA 1VRQC 1LAVA 5J29A 9ICLA 1UWBA 1YK9A 4I68A 3JTPA 4RQ5A 3J7ZT 1IXRA 2E2NA 4C7QA 4FYVB 1EETA 3KKRA 1JLBB 3R7NB 3BF1A 3AVJA 1HQUA 1TFYA 4N47A 2OXOA 3CULA 4R8UB 2RHQB 2A42A 3IUCA 5J0RA 3RB4A 1G7CB 2DNMA 3OTOF 3FFIB 5AFUA 3DGPA 1HI8A 3TR5A 5D3GB 2VV5A 4CM2A 5IWAK 2WSEC 1Z1BA 5HNKA 3D6JA 3GZFA 2HZVA 3SLCA 5HBMB 2XTJP 2UUBK 2IYGA 4QU7A 3EE9A 4L75A 2PFFB 1XN9A 3CB4A 4ZOHC 1EJ7L 4XDCA 2NUBA 1Q81T 4RW9B 4Y2YA 1RA6A 1A7GE 2UUCK 4PL2A 4K0KK 4KT0C 3THTA 3KK3A 1ZD5A 1LFWA 1HJPA 2KIWA 5F9LA 2A40A 1S1TA 4CP5A 4RQ8A 4I6WA 4HTIA 1LOUA 2EFNA 3V7KA 1UJ4A 5ETSA 3O3GA 2IRXA 3RZAA 3JQKA 5DDRC 4GXJA 4DV5K 5D8HB 4WKRA 5KI6A 2CWXA 4UY85 3G6VA 3MXJA 5H1SQ 3F5EA 1PAEX 1WG5A 4TUQA 1GXTA 3CTRA 1RT6B 3KWMA 2CJXB 3L6QA 3WK9A 1B9FA 3HHLB 4Z6CA 2YMLA 3B6OA 3IC1A 1TL3B 3EEQA 2EHGA 5HMLA 1A76A 2VASA 2QGFB 1RP5A 4CTAB 3B54A 8ICRA 4RKUC 4Y65A 2V4JA 1RHMB 4FJ5A 3S8SA 2HMXA 1NDLA 2W9BA 4CJ4A 2E5LK 2LQ8A 2NYVA 3ZCMA 4WYBA 1AT1B 3SQGA 2YHAA 3IWXA 4N41A 3CSKA 3NF7A 1I3OB 3HI0A 2EZYA 2KKVA 3CQ8A 4UUXA 3NAEA 4DZDA 5F0UA 5AKLA 1N62A 3TAQA 4X66K 3BQTA 4DR6K 2IPOB 3CUNA 1BPZA 2QKKA 2CQHA 1S7IA 3SAFA 1WUDA 1W26A 1F9FA 2RD5C 2XI3A 1IBMF 1RXOB 4FJGA 4EEYA 4E0DA 3A0HU 5GIPA 2VC1A 1SIZA 3L4QA 4LF7J 2KFZA 1TKZB 4BC9A 3A5OC 1MMDA 2F8EX 1VQNS 2RQ4A 5KFMA 3AV9A 4OX8A 4BJQA 3VF2A 3T1YK 3HW8A 4A2BA 3WIVA 1KCFA 2FJAB 3RJMB 2PMHA 3QZ7A 3JSMB 2YNHA 2XI9A 2VJVA 1YJRA 2J6UA 4I2HA 3SQ4A 3VQ8A 4FKYA 2RRAA 4JI8F 5KFEA 1OH7A 2AGPA 4OZ1A 4KYZA 4WP9A 1I5OB 1U8WA 1M5KC 3NGUA 3RVCA 1TMJA 3H0LB 1N32J 3TJ8A 3UXNA 2BE2A 1YJNN 5GAGP 3DKDA 1RI7A 1DQ9A 2ZH7A 2YMMA 3MX2A 3W66A 1YZ6A 1VJ5A 1CULA 3N9UC 4RW8B 4MDBA 2HMIA 5M1NA 2DKXA 1O5JA 1LEOA 4RNOA 3EVWA 1G2EA 4KHNA 1X5PA 3FYHA 9ICKA 4RX6A 3Q8RB 4NEZA 3B0YA 4NRTA 5G5HA 3CJBA 5ALDA 3GWCA 4MQ3A 3L4BC 2OEKA 1TK0A 2LU2A 2YJEA 1XNQK 3QX7A 3P5TL 3BPDA 3THYA 4Z6FA 2GS8A 2CVEA 5IQQA 4HUGA 4X4VA 1WOOA 4FM0A 1NSPA 1AFIA 3CJTA 1NJYA 4EFHA 4K4HA 4ANDA 2P9UA 4E1MA 3V6DA 2IFXA 5FPEA 5BYSA 1CRXA 7ICEA 1T9YA 1A6LA 3R9KA 1BPEA 1I51B 3JXUA 3IP0A 3K59A 1F44A 5FDLB 2QM1A 1M1GA 4IQWA 5IV3A 4PG5A 4A8EA 4JYAJ 3U02A 3ZZUA 4GVMA 1RXVA 2ASMA 3FZBA 4EHTA 3TA1A 4O44A 2ZJPL 4B3OA 1M6YA 1JLCA 2ZH6A 1LB2B 3I0RA 1XSNA 3D0GE 4CI6A 5J0QA 2I9SA 1ASVA 1C1AA 1YJUA 2IOHA 4RQ1A 5AM4A 4BGBA 2MQQA 2D74B 2JEIA 1DGSA 4FPBA 5J8YC 2NXJA 3SJHA 5KG0A 1FX4A 5JU5A 1VS3A 1SJRA 1JLQB 2XLJA 1RWWB 3ZZ0A 3CM6A 3CCRS 2BANA 1U1QA 2HQGA 4NLTA 3IM9A 2MLZA 3V6JA 2HNDA 2F76X 4YOTA 2VDIA 5KFQA 1ZQOA 3C2KA 4I2DA 1SQKA 4EBEA 2CPJA 3TAGA 4KB7A 5J0UA 3K8WA 2O1PA 3BPSP 3ULEB 3LZIA 1LWEA 3WNEA 2NXEA 3W0LA 1BHLA 2E9ZA 4ZTJA 7ICMA