2XY7A

Crystal structure of a salicylic aldehyde base in the pre-insertion site of fragment dna polymerase i from bacillus stearothermophilus
Total Genus 188
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
188
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHAAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWALERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGEELAEQLRTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKSKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQARLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Reversible Bond Formation Enables the Replication and Amplification of a Crosslinking Salen Complex as an Orthogonal Base Pair.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords DNA POLYMERASE I
total genus 188
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2010-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2xy7A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 2xy7A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2xy7A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2xy7A01
4I2DA 4HUEA 5J2BA 2RPIA 3BQTA 3DLGA 1VSLA 3OYIA 2R8IA 3PW4A 1XSNA 2XY6A 5DDYA 3SUOA 3EZ5A 3MABA 2HB5A 2JEGA 4FLZA 2RDIA 4MF8A 4KLMA 3K5OA 5KFTA 5KFDA 1C1AA 4CJ3A 4YQWA 8ICOA 3B0XA 1S77D 4FS1A 3ASMA 4OKEA 1B43A 1JKHA 3AVNA 2A1JA 5KGWA 1NOYA 3D0PA 3MFIA 4Z6DA 3OYAA 4I2BA 4EBCA 3OYMA 3I8DA 3K2PA 4H8KA 2O4IA 3Q8SB 4RW8A 1BPDA 8ICYA 1S76D 3RMBA 1YTUA 3LP2A 3TR8A 1WNSA 4FS2A 4QZGA 9ICAA 4FZZA 4ECTA 2AGOA 2VWKA 4RQ2A 4IDKA 3SUNA 2W9BA 3V6KA 3RH5A 2HHUA 2GV9A 3V9WA 5IIJA 1T8EA 4FYDA 2EHGA 4YXMA 3H4DA 1HNVA 3DRPA 3G6XA 9ICJA 3IHQB 2YNFA 1U49A 4KMUA 5F9LA 1L5UA 4RZRA 2BE2A 2BPCA 3ETLA 2AQ0A 5CHGA 1TK0A 4B9NA 1U47A 1TGOA 2Q0ZX 3LAKA 5L1IA 1NK5A 1RDCA 5DB6A 2RKIA 3S3MA 4CIFA 1ZQUA 4F4KA 3H7IA 4IG3A 1REVA 1JX4A 7ICOA 4CFCA 2FMQA 4ZH4A 3GIJA 3AO4A 3NGYA 2PI5A 2KZMA 3BGRA 2FMSA 4JLHA 4J9LA 1ZBHA 5HHIA 1Q9YA 4QZBA 1RPLA 8ICQA 2J6SA 4G1QA 5DGBA 2HHWA 5CYQA 1JLFA 4CGGA 5E41A 4DQQA 1VSHA 9ICFA 2YKNA 3ALYA 3MR3A 1N6QA 1A5XA 3O3GA 1TFRA 2KW4A 8ICWA 4KLFA 2F96A 4P4MA 3U6FA 1WSEA 1RTIA 3H08A 9ICUA 4ELUA 1RTHA 5J2IA 4M9NA 3Q8KA 1WAJA 3L3UA 2G8FA 4O5EA 1RDAA 3AA3A 3B6OA 4OJRA 1WSHA 4DLEA 4YR0A 4DTOA 2NRXA 1KDHA 4I2IA 2JZBA 1C7YA 3SI8A 1DTQA 5SZTA 3DI6A 3GIMA 3N97B 3AVFA 1W0HA 8ICFA 4FK4A 7ICUA 4L8RB 3K5NA 5CR0A 4E19A 1CEZA 3KK1A 4YD2A 1X9MA 2Y1JA 1BI4B 1J54A 3KKSA 4C8LA 4KHQA 4PHEA 4NCGA 5C5JA 2G8IA 4I28A 4E7KA 2ISOA 3M8SA 4DG1A 3TAMA 1VSJA 4OGEA 1Y97A 4I2AA 5KFEA 1Z00A 4QW9A 2IMWP 2P66A 4PPXA 1RYRA 2DFFA 1LW0A 3GIIA 1GOCA 1IKWA 4M47A 2FPLA 4BWMA 3QEBZ 2NUBA 1XO1A 3GILA 3MXMA 2VA2A 3DLBA 3Q8MA 4J9NA 5D46A 3O3FA 2W9CA 2QKKA 4DFJA 1QS4A 4KLQA 3SJJA 2W9AA 4MFAA 4IRCA 4JRPA 4DTMA 3AVIA 1LWEA 5CZ2A 4KLEA 4AH9A 1ZJNA 2F1IA 5D3GA 3AO5A 2PZSA 3QLHA 3Q8RB 3K57A 3LAMA 3MEDA 5KFPA 3V1RA 4RQ3A 2XHBA 4QCLA 1BPYA 4RQ0A 3AUOA 5DKWA 1ZQBA 4O44A 5J2NA 4OKKA 3ZT0A 4GXIA 4B9LA 8ICCA 1UAXA 1TK8A 2FLNA 3HP9A 2NRVA 2ZD1A 3C1YA 3LANA 4FJ7A 4Q8FA 3GQCA 3NFAA 3SI6A 5HMLA 1EXNA 1CXUA 4LH5A 3CFPA 5DB7A 3UQ0A 2BGGA 1WAFA 2IBKA 3C2MA 3AVLA 3DLKA 5KT7A 4O3QA 3IRXA 3L2RA 4DTXA 4GXKA 4FJGA 5DBCA 4I2JA 1I39A 3GV7B 3KLFA 4HVJA 1S9EA 3MR6A 3OHBA 2IGIA 5J0RA 4Z4HA 3PVXA 1S0OA 3T1AA 3K4GA 7ICQA 3ZCMA 3TFSA 4EZ6A 3HM9A 4LD0A 5KRTA 4KHUA 3OJSA 2GUIA 4FZXC 1YT3A 5J1EA 3AO2A 2ITGA 4RQ6A 4BDZA 1COOA 2V4QA 3RAXA 5DQGA 3QEXA 3KD5E 5J2HA 3E01A 4ECSA 3G0ZA 1ZBLA 2ZUCA 4KKOA 4YVZA 3NCIA 5KFBA 4I29A 2FMPA 4CHOA 1ZQLA 4FLYA 5J0WA 1CXQA 5KFVA 1JXLA 3NGZA 3PR5B 3RJJA 4KLHA 7ICMA 3V1QA 3HL8A 2FPKA 4I7FA 4IFVA 3H8SA 2R7YA 1C0UA 4FW1A 4I9LA 3DOKA 5BOLA 1WCNA 3GV8B 2FBXA 1C1CA 1ZQMA 3OSNA 4CFDA 2AGQA 9ICQA 2YV0X 1C0TA 1RBUA 4M04A 1RBVA 1BCMA 3FFIA 4ECRA 3AA2A 4PGYA 4KPYA 4EZ9A 5HRPA 1S1VA 4O9MA 1FKOA 3I0RA 2YKMA 4Z4FA 5HLFA 1T05A 1BISA 1ZQKA 3V7KA 1K1SA 2W9BB 1ZQQA 3V7LA 3AO3A 4J9SA 1IH7A 4CJUA 4QZEA 3PR4A 3RH4A 5J2PA 4CEZA 4E0DA 1ZBUA 3JSMA 4AHUA 2ZUBA 1NK4A 9ICPA 4CJQA 4FM0A 1EKEA 4DL6A 4I2QA 2ATLA 4KITB 3SV4A 1CUKA 4B08A 3U3GA 7ICPA 4DTUA 4MEXA 2BDPA 5DG7A 3UQ2A 5JS1A 2BHNA 4HUGA 5CJ7A 4C8MA 4JS5A 4DSEA 1NJWA 2D0CA 4DL4A 1EX4A 4YMMA 2H5XA 3TAGA 1A77A 1VK0A 4ED8A 4YFKA 3ZSWA 2LSNA 1UT5A 3DMJA 1TV9A 2G8UA 1UWBA 8ICXA 2PFPA 2B21A 5HHHA 1S0NA 1TKDA 4DSLA 1BI4A 2PI4A 1ZQZA 1C0MA 3MXIA 2OPRA 2DY4A 3RH6A 1VRTA 1UT8A 2JEJA 3HVRA 1VSFA 1ZQXA 4IQVA 2X6SA 2UVRA 1ZQYA 4CHYA 3RR8A 4PHAA 1A5WA 3IAYA 4Z4IA 4AHCA 4BWJA 3OYHA 4J2BA 3SUPA 4FJNA 3C2KA 2OPQA 3PW2A 3ISDA 3IG1A 2W8KA 1RCHA 2VWJA 4CIGA 7ICRA 4JK1A 1U45A 1NJYA 1SV5A 1HJRA 4J9MA 3RRGA 4KN4A 1JXBA 4BDYA 4CJTA 1ZQEA 4FBTA 5KFAA 2BCRA 4K4GA 1XHZA 2D0BA 1JXEA 3KHHA 4PWDA 2PFOA 3ZSVA 1RT5A 2BCVA 3HVTA 1FKPA 2IS3A 5HRRA 5C24A 2PFQA 3V72A 1BPBA 4BXOB 3HP6A 3PO4A 4H4MA 4RPXA 4M6WA 4R5PA 2OPPA 5L1JA 3BJYA 1SKRA 2XY8A 5KFRA 1G15A 3HXMA 3C5FA 1J5OA 3TQ1A 8ICIA 4DMNA 5DLFA 3JPOA 4O0IA 4DU1A 3LPUA 4KB1A 2LYHA 1JLCA 4G3IA 4NLGA 2HNZA 1HMVA 4BE0A 4M3TA 4DQPA 3OGUA 2ZTDA 2HHSA 3DM2A 4FJKA 4HUFA 1RTDA 3PX4A 1ITGA 2C28A 4DEZA 4EEYA 1YVUA 1MQ3A 3NGIA 3UXNA 3SNNA 2FC0A 2JGUA 4FLUA 3VQPA 1SL2A 2VA3A 4JRQA 1RBRA 5J2CA 4JUZA 2BCQA 4RNNA 4KTWA 3MBYA 2W42A 4F5PA 1BHLA 2HMIA 3JPRA 3TAEA 5T7BA 4F91B 4OPKA 1RTJA 3HPOA 1XS9D 1S1XA 2E4LA 7ICVA 4CE9A 3QZ8A 3CFOA 5HNKA 5KFQA 4NY8A 1X2IA 2BQRA 4Q44A 3HK2A 9ICTA 1HQUA 1QE1A 5J29A 3M9OB 5KFIA 3C2LA 4YR3A 4E3SA 4O3NA 4CF9A 4FJLA 8ICMA 2FBVA 5DQHA 3C23A 2Q3SA 4NM2A 1WSIA 1X9WA 2XY7A 2X6NA 1XI1A 3LDAA 4FO6A 5F9NA 3WNFA 4XQ8A 2R8HA 5KG3A 3SPYA 2P1JA 2ZTCA 4Q43A 4DQRA 3SV3A 1NJXA 2G8WA 1Z00B 5EWFA 4O5KA 4E7JA 5KG1A 3MGIA 1L3TA 1EXQA 4CEFA 1ZQNA 4ECYA 2XC9A 5KFLA 8ICUA 5FDLA 3T5JA 4AHVA 3RR7A 4RNOA 3PY8A 2EX3A 4IR9A 9ICWA 4RQ8A 4YXJA 4DL2A 5KFCA 2KZ3A 3ISBA 2ZJAA 4ED6A 3T5KA 2DPIA 4CECA 3HSTB 4DOBA 1JL1A 8ICLA 1S0MA 1RYSA 4CF1A 3UXOA 1XSPA 4J9RA 2KTQA 3VA0A 4QWBA 1C1BA 4W5TA 2XO7A 1RT2A 3V9XA 3NF8A 1K1QA 1ZQVA 1JN3A 4CHQA 4NYFA 3V7JA 3V6JA 1RZTA 3VQ7A 5KFOA 2IAJA 3NGDA 2BR0A 3IM1A 4JS4A 3BQ2A 3EPGA 5KT2A 4OLBA 3OSPA 2HNDA 2ZJ5A 2GBZA 5HROA 3EYZA 1NK0A 3RJIA 1S6PA 1S1TA 5J0TA 2P6UA 1TKXA 4CGDA 1B9DA 4ED7A 4J2AA 1GOAA 1IM4A 4B8AB 5JUMA 1LV5A 1KVBA 3PUFA 3MDCA 1JLBA 4FLXA 4ELTA 1W9HA 1HYSA 4UB1A 2J6UA 3S3NA 3ITHA 2XGQA 2KFNA 3ZT2A 1KLNA 4F4WA 5KFNA 3RWUA 3L2VA 1Z3EB 3NH0A 2BCUA 3HPHA 1KCFA 4QWCA 1JMSA 9ICLA 1S9FA 5J0SA 1ZQCA 2XGPA 3GDXA 3I0SA 8ICKA 3CM5A 4Q8EA 3PMNA 2I9GA 3KJVA 1B22A 3O4NA 4E89A 4DU4A 2JLEA 4KHYA 1NOZA 3C21A 4DU3A 9ICOA 3K75D 3TFRA 3TANA 4BGDA 1Q8IA 4LH4A 4LSLA 4AHRA 5KFJA 1KFDA 3JYTA 4UB3A 4RNMA 9ICBA 3AVMA 4YFUA 8ICEA 4DTPA 1XU4A 2KZZA 4O5CA 2ASLA 5J2EA 5I42A 9ICEA 4CGJA 3OS0A 2WTFA 1KFTA 2YNIA 3L8BA 4ELVA 4I2EA 1KLMA 4KLSA 3LWLA 2P5OA 4IQWA 4TQSA 2HHTA 4W5OA 5DGAA 4KLOA 3L3VA 2PYJA 1JIHA 4CF2A 5D4BA 4YNQA 3JPNA 1QSLA 1HUZA 2B6AA 5KG2A 8ICSA 1TK5A 3KK3A 1U04A 3CYMA 1ZQDA 3EY1A 4N41A 1VSDA 4CJVA 4O0JA 5KG4A 1JLQA 4DL5A 3HO1A 3PX0A 3DLHA 5KFSA 4M2YA 7ICEA 4CJRA 4DS5A 3SQ4A 3K5LA 5HRSA 2C22A 1UA1A 2RDJA 2I1QA 1EETA 4F93B 3BDPA 3KHLA 5KRSA 3H8JA 1ZQPA 1KVAA 1VSMA 4NLZA 3HX0A 3T19A 5J0XA 4IQTA 3AVCA 3GIKA 1IXRA 3Q8LA 1T4GA 3RJFA 4NM1A 3QNOA 1IKXA 5J0UA 5KTQA 3OY9A 8ICZA 4DFMA 8ICHA 3QEAZ 1A5VA 4O55A 2OYQA 3M8RA 1XSLA 4Q5VA 1DOQA 4CGHA 1S6QA 4CEDA 4Z6EA 1LW2A 4RT2A 4FK0A 4CJLA 5KT6A 2YNHA 2PY5A 2D5RA 1S97A 4CESA 5EWGA 3O4QA 4M42A 3BQ0A 2IA6A 4J2EA 3GV5B 1BPZA 2BGWA 5C25A 2BPGA 3ULDA 1F21A 2A1JB 4DTNA 2FLLA 4Z0UA 3WNHA 2V4RA 4QOZB 3NDKA 1LWCA 3TAQA 5CB1A 4CK1A 4EYHB 2F1JA 3RAQA 4ECQA 2MAXA 3V9ZA 4J2DA 5DB8A 3EWAA 1RDDA 4OLAA 3QIOA 2F8SA 3LP1A 4KLLA 4M3ZA 4QWDA 4F5NA 3AU6A 3RB4A 4ED3A 3WNGA 1EP4A 3QINA 4KI4A 2W9MA 3SPZA 9ICGA 4KN7A 2R8GA 2OA8A 3RTVA 4B9TA 1BGXT 7ICKA 3ZSRA 2WONA 5BOMA 1SUQA 2AQ4A 9ICCA 3TARA 4J9KA 5KI6A 4B8CA 4QZFA 2A1SA 5KFYA 4HYKA 3PW0A 4DL7A 3RJHA 3FDSA 3AVGA 2R8KA 3VQCA 3SUQA 2JEFA 3VQ5A 3FYHA 3VQ6A 3KTQA 4FXDA 3D45A 1ZQAA 4CCHA 3JPTA 3NF9A 5J0QA 4EYIB 1UOCA 3DRRA 1DGSA 3A2FA 1N48A 3QIPA 4GW6A 5CP2A 2E6MA 1HYZA 5J2MA 2Y1IA 3RRHA 4K4IA 1QHTA 3MEEA 1N5YA 4R65A 5EU7A 3ZT1A 3N4MB 5KFMA 4DTSA 3LP0A 5IIKA 1TV6A 4BXOA 2HHVA 2GWSA 4RW6A 1SKSA 4PGXA 5J0PA 2HVIA 3SQ0A 5KG6A 1QQCA 1ASVA 3L2UA 4RG8A 5J2DA 8ICBA 1U48A 3OYKA 4F50A 7ICSA 4BDPA 3VQ8A 4MQ3A 1D5AA 4R64A 4DL3A 2ATQA 1A76A 1RXWA 4M3WA 4DLGA 8ICRA 2Z1JA 3HWTA 3KKRA 4XA5A 1BVSA 7ICNA 5SWMA 4RUAA 3RJKA 3KLIA 4K4HA 4JWNA 3QEVA 4NXZA 3VQ4A 4FM1A 3F73A 1GOBA 4OKJA 1KTQA 4CF0A 3V6HA 1X1PA 2DFEA 1S1UA 4ED1A 4M9HA 3KLGA 4ZTJA 8ICVA 1TVRA 2MUTA 4F4XA 2ISPA 4CHNA 5DDMA 4TURA 4B9MA 2B5JA 4CJSA 4JWMA 1FXXA 4FJXA 4M3YA 1R0AA 4MFCA 5J2QA 2XRIA 1RILA 3AA5X 4KREA 4E7HA 3JPQA 3OYNA 4M3XA 3ZT4A 4DO9A 4GC7A 4YP3A 3G6YA 3VQ9A 1TAUA 2ASJA 4Z4EA 3TAFA 4UQGA 4CERA 4CJ5A 5KT3A 1BCOA 3SQ2A 5FROA 5CY4A 5HBMA 1WSFA 2XCPA 2HW3A 4F2RA 2C2DA 2YHBA 5KFXA 4FJ5A 4AILC 2ALZA 1KSPA 3KHRA 3ZT3A 4QW8A 2J6TA 4FJHA 1TKZA 4C8NA 4MFFA 8ICNA 4Z6CA 5J2AA 4IG0A 4O3OA 4I9QA 4UAWA 1B9FA 2XCAA 4IFYA 4KHNA 4NLNA 4GC6A 1HPZA 4QAGA 1KRPA 3C1ZA 4KTQA 3SCXA 3VQAA 5CZ1A 4E1MA 4FZYA 1TL3A 2OPSA 3RBDA 1SL0A 2ASDA 2IHNA 5HP1A 2JZBB 3M8QA 3LALA 3QZ7A 4M9GA 4CK2A 2C2EA 4M9JA 3KHGA 4EBDA 5HP4A 1H38A 3TI0A 7ICLA 4CIEA 4RQ4A 4H4OA 1QSSA 2IC3A 3C94A 1V9PA 2KQ2A 1BQNA 1NK9A 3ZSXA 4KB0A 4B3OA 1HRHA 5TZVA 3ZDBA 1TL1A 2G8KA 2HVHA 4CF8A 2W9CB 2UVWA 1MU2A 1RT4A 3NBPA 3UIQA 3TABA 3H4BA 5KGXA 3ZDDA 3SZ2A 1ZQIA 3QNNA 2ZJ8A 1SL1A 3VN5A 4RT3A 5BPCA 3QO9A 8ICAA 4PY5A 4O4GA 1NK8A 4E1NA 1TVAA 5KFZA 9ICXA 4YMOA 3UPQA 3T3FA 1QSYA 4K8ZA 4M6WB 4HCBA 5DQIA 3AV9A 3O3HA 4LVSA 1B92A 9ICRA 4ED0A 4FJJA 4KLTA 3VQEA 4FJ8A 4Z4GA 1K6YA 3MEGA 4OGCA 2BKEA 4XIUA 3OVNA 3KIOA 2G8VA 1WN7A 2I5JA 5DBAA 2MUTB 4ID1A 3DYAA 4I2PA 3JPSA 5J0YA 1XWLA 5KG0A 3RJGA 1IO2A 3NE6A 4YMNA 2PXIA 2B4JA 1IKVA 4CJFA 4NCAA 4DSIA 1HYVA 9ICVA 4LZDA 4KI6A 4RQ5A 4DWIA 4RW7A 4ZHRA 7ICIA 7ICTA 2HHQA 3K59A 1CZ9A 3QERA 4DOAA 1MSWD 2DFHA 3EW9A 1D9DA 2XY5A 4IRDA 4I2HA 1Y88A 3RBEA 1DLOA 4FVMA 1HQEA 1RDBA 4IQUA 4QZ9A 1NK7A 2HNYA 5DMRA 4DTRA 1ZBIA 4F92B 4GLXA 4I2CA 4QZCA 1ZQHA 3RMDA 3NHGA 3CFRA 4YD1A 1BIUA 5KFHA 3AU2A 4EP5A 4F5QA 5L9XA 4FCYA 3QE9Y 3MR5A 1YTAA 3MFHA 4CHPA 5KFGA 1X9SA 4R8UB 3RB3A 3P5JA 4CGIA 1Q9XA 4F4YA 1FK9A 4KLJA 4CEEA 1I3AA 3NH2A 3ZDAA 4N5SA 1D9FA 4KHWA 4F2SA 3PW5A 4M9LA 4BE2A 1QTMA 3WNEA 5KG7A 4TQRA 8ICJA 4F5RA 5J2KA 4J9PA 7ICFA 3OYFA 2PFNA 1AROP 3PV8A 4RW9A 1SZPA 5DG9A 4IBNA 5JS2A 3VQDA 3NAEA 3LWMA 1ZQRA 3V81A 4CJKA 3HT3A 4W5NA 4CJPA 4KFBA 3OYCA 4Q0BA 4QZ8A 2DPJA 1DTTA 3MAQA 3OYEA 5HRNA 4CGFA 1RT6A 3VQQA 4E7LA 2AGPA 4ECVA 4R63A 1NJZA 2YHAA 4FW2A 2VG6A 4P4OA 4N47A 3OS1A 2QK9A 1TKTA 4GXJA 1J53A 4ECZA 1SKWA 3ZD8A 2G8HA 3L2WA 5CYMA 4OPJA 1U9LA 2Z1HA 3M9MB 5DB9A 4XRHA 1VSEA 2AU0A 9ICMA 1RBSA 4LY7A 3SQ1A 2DTUA 4CEAA 1ZQGA 1HNIA 8ICGA 4B9VA 3AVKA 4F5OA 4ZTFA 3KLEA 2BQUA 4FLVA 4ICLA 4ECWA 4NCBA 2ZUDA 3DLEA 1KFSA 3Q8QB 1N56A 3V1OA 4PQUA 2IDOA 1JLGA 3ISNC 1BIZA 1VRUA 4F4ZA 3IS9A 4PH5A 4MFBA 4B9UA 3RJEA 4N76A 4EP4A 5L1LA 3H40A 5K14A 3Q8PB 3OJUA 4YG2A 2HHXA 1NOMA 3ZSZA 8ICPA 3G10A 1D8YA 3NTUA 3MGHA 3NF7A 3M9NB 4LZGA 1S5JA 4QZAA 4N56A 2P6RA 3QESA 4C8OA 3ISCA 4K8XA 1ZQJA 4TUSA 4J9OA 1BPXA 4Q45A 2NRTA 3OS2A 5EWEA 9ICSA 4ECUA 2D0AA 4M45A 4UBBA 2V9WA 4F3TA 1NKCA 4HTUA 4O3SA 3QETA 4TUPA 3C6UA 3ZDEA 3OYGA 5KT4A 4J9QA 2FBYA 3TAPA 2QKBA 4RU9A 5DG8A 4FBUA 9ICKA 4DOCA 2YNGA 3V4IA 4M0AA 4NLKA 1CZBA 3ZDCA 1WSJA 3DOLA 2IOCA 4PHDA 4CEOA 3EPIA 2WOMA 1CLQA 4FM2A 2FBTA 4AHTA 2C2RA 3C5GA 1LAVA 4ID5A 1C6VA 1JLEA 2QXFA 4RPYA 1D8LA 3NF6A 4CHZA 4CEBA 5L1KA 1RT3A 2W8LA 2IHMA 4EBEA 3HJFA 5IIIA 1HJPA 1MQ2A 3ZSOA 3KK2A 2BQ3A 4Z6FA 4UB2A 3T5LA 4HCCA 1Z26A 5DK5A 1ZJMA 4C8KA 2FLPA 1TAQA 4YR2A 4ECXA 2X78A 4DF8A 1RNHA 2F1HA 3AVJA 5FRMA 3THVA 2UVVA 1S10A 2ZE2A 2E6LA 4GVMA 1VSIA 4XUSA 3DRSA 4CFAA 3U3YA 3AVAA 1ZBFA 4CK3A 3ZSQA 1UA0A 8ICTA 3HYFA 4FJIA 9ICIA 4PUOA 3GFKB 5KFKA 2AJQA 3C95A 1LWFA 3OYDA 1RT1A 1WSGA 4PGQA 3OYJA 4FK2A 4MF2A 3CQ8A 3S9HA 1KEJA 4DFPA 1L3SA 4ED2A 4QZDA 2UVUA 3HPGA 4BACA 4DFKA 2R8JA 5DLGA 3VQBA 2BANA 2OWOA 2M9NA 4QZHA 2KN7A 3SYZA 4KAZA 4UAZA 4RQ1A 4KO0A 4R66A 4WE1A 3KD1E 3MXJA 4PHPA 3F9KA 4BE1A 4HHTA 3K58A 3AA4A 4F8RA 1L3VA 4NYNA 1T03A 4E7IA 3ORYA 3V9SA 3PMLA 4AHSA 4TUQA 5KT5A 3QEIA 1LAWA 2FPMA 4O3RA 4FLWA 3AVBA 1ZQTA 3LP3A 3L2QA 3V9UA 3T5HA 1QLNA 1IG9A 4UB4A 1BPEA 4DF4A 3C6TA 4O3PA 2F8TA 3DLRA 3TWHA 5CA7A 3PO5A 1BL3A 3LZIA 3P1GA 4KLUA 3B0YA 4UB5A 1U4BA 1ZYQA 4YN4A 3RMCA 4RUCA 4I2GA 2X74A 1ASWA 4FJ9A 4M3UA 1J9AA 5D49A 4CFBA 4FLTA 5C42A 2VA8A 2ZTEA 1XC9A 1NKEA 3M8PA 4FJMA 5FRNA 3G6VA 4F3OA 4JV0A 2OZSA 2NRZA 4RW4A 1MC8A 3UXPA 1T3NA 3NH1A 5IILA 3H8WA 2OZMA 3PX6A 1L3UA 1RXVA 2VANA 3RB6A 5KFUA 3ZSYA 2BCSA 1NKBA 9ICHA 1JL2A 4OVLA 4M41A 5IIOA 1LB2B 4I27A 3LPTA 3MECA 5J2JA 4IKFA 5IINA 1ZQWA 3RMAA 1T7PA 2DFLA 4QWEA 4KHSA 2P51A 1PZNA 4IR1A 5I3UA 3ZD9A 5J0OA 2O4GA 1BQMA 4KLGA 4IRKA 2RF2A 1O1WA 1VSKA 1S1WA 2PYLA 4W5QA 9ICNA 3OHAA 1WLJA 4JV2A 4CEQA 3OYLA 2RN2A 4QWAA 1XHXA 4MEYA 4RQ7A 4LSNA 1HUOA 1S9GA 1RT7A 3LDSA 3MDAA 4CJEA 4KLIA 2VG7A 4M3RA 2BPFA 1ZETA 3KLHA 3AO1A 1S0VA 5HMMA 4QZIA 1JLAA 7ICGA 4RPZA 1NK6A 4GMJB 7ICJA 4O5BA 4CJWA 4UBCA 4B9SA 4P4PA 4Z4CA 1IKYA 4CJ4A 4R8UA 4DQSA 3K5MA 3V6DA 3OYBA 2KFZA 3PW7A 4X5VA 4DSJA 1KVCA 4KLDA 4Y1DA 3LK9A 3JPPA 2ZQBA 5KFWA 2A1RA 1ZQSA 3AVHA 4UAYA 4DQIA 4DS4A 3E2EA 3VA3A 3B6PA 4DSFA 4YCXA 1Z25A 4W5RA 3S3OA 1ASUA 7ICHA 5EOZA 3RB0A 4DTJA 2P5GA 2ETJA 3BQ1A 4PA1A 2Z1IA 3P83D 3HW8A 5KFFA 5J2FA 4TSXA 3LZJA 5DBBA 1ZQFA 4DSKA 2JEIA 4JV1A 4I2FA 3CG7A 2Z1GA 4KV8A 5IIMA 1RBTA 5KG5A 3MR2A 3CM6A 4KRFA 5CWRA 4Y1CA 3PNCA 3QEWA 4P2HA 2VG5A 5J2GA 1ZQOA 3QEPA 4KTZA 2NRWA 1WCLA
chains in the Genus database with same CATH superfamily
4HUEA 5J2BA 4WU3A 5JLFA 3DLGA 2DR9A 2R8IA 3PW4A 1XSNA 5EE3A 2HNZB 2RUSA 3EGNA 4MMOA 3BGFA 2GVZB 2HB5A 2G2OA 2D3DA 2RDIA 1L7MA 2COLA 3O6WA 2EWSA 5HAOA 2JWNA 5KFDA 1C1AA 2RS2A 1ZD4A 3U9DA 1NDKA 1T9XA 1S77D 4I67A 4LFCJ 4FE3A 4AP9A 1JKHA 3CJKB 3OR1B 4RW9B 5KGWA 3C15B 3D0PA 4H5WA 2V63A 4P2XA 1FWKA 1WNEA 3HFVA 3I8DA 4HHHA 2ADBA 3UDEA 2BKNA 2WB1F 2DGWA 2RQ4A 1FJGF 1BPDA 3D3BJ 4QIVA 3W7BA 4A8EA 3CC7N 3LP2A 3TR8A 4QZGA 3KDNA 4NLQA 2VQEJ 3A4TA 1VQ4N 2VWKA 4RQ2A 3SUNA 4QPXA 3BO4A 2WFBA 2G4BA 3RH5A 4KC5A 5CABA 3VEOA 2HHUA 5LJWA 1XQSC 1T8EA 1HNXJ 1UPHA 5ALSA 4FYDA 1V4TA 2H48B 3J7AP 3H4DA 3DV9A 1HNVA 3DRPA 3PDNA 2WHOA 5C42B 2GMJA 1YAGA 2V4JB 4CH1A 2AYEA 4CLFA 2XTJP 5L1IA 1NK5A 3AA8A 3EMTA 5IT4A 3HZEA 1K8AO 3S3MA 3MX2A 2Q0UA 2HIQA 2HMXA 4CIFA 3H7IA 3NCPA 4MT1A 4B02A 7ICOA 2CIMA 4ZH4A 2UXDF 4C4WA 4CI0B 1CULB 3SK3A 4K2XA 3QDKA 3JQKA 1T05B 5IV3A 3PYDA 2JX2A 2LLZA 1W26A 4C4RA 1T6CA 1X6JA 2LBOA 2P9IA 2J8SA 2LPEA 4LFAK 8ICQA 2G13A 5DGBA 2G5HB 3KK7A 1VSHA 1WF2A 1N6QA 4DU8A 1U1QA 3LVWA 2KW4A 1GTEA 3CMAS 8ICWA 2F96A 1KOOA 3U6FA 1X4CA 4PL7A 3RRKA 5HP1B 2O1PA 5ALNA 3CB4A 3H08A 4ELUA 4ZPVR 4O5EA 3TJ9A 1OY8A 4DB3A 4OYMA 4WP9A 4DTOA 5K8PA 5SZTA 5D4OA 3N9UC 3I96A 5G5GA 5LMUF 3AVFA 4I1TA 3UPFA 4E19A 1CEZA 4YD2A 4DR1K 2KG1A 2IDEA 1J54A 3KKSA 3HX9A 4C8LA 3A3NB 5JU5A 4NCGA 5E3CA 5B5EU 2G8IA 4I28A 5HI7A 4DG1A 3TAMA 4JEPA 4FXVA 4I2AA 1R59O 5KFEA 2PFFB 3G86A 1Z00A 4QW9A 3HFZB 1KAXA 2IMWP 3GB0A 3ZEUA 2N3OA 2DTJA 3HTVA 1RYRA 1YF5L 3ENQA 5GADP 1NZPA 4K43A 4BWMA 3GILA 2AA4A 2V50A 1P1TA 3DLBA 4J9NA 5C2FA 3O3FA 3BS5A 4DFJA 2MJUA 4MFAA 4IRCA 2HGNA 1X5OA 3CIPA 4USHA 4KLEA 1ZJNA 4RUHA 3ENAA 1VRTB 1BUXA 2ZZTA 2F1IA 1FCAA 5ADXA 3V1RA 2JVRA 2NZ4A 2FSNA 1KS2A 3ZT0A 1GLJO 3DFEA 1NLKL 1J6ZA 1WC1A 2CH5A 2BJ7A 4Y2CA 3GQCA 3NFAA 5HMLA 4LH5A 2QMWA 3UQ0A 1NPKA 3GOIA 4J8FA 2IBKA 3JTNA 2WB4A 1FFWB 3DLKA 3IRXA 3L2RA 4JKGB 4FJGA 5DBCA 3QRPA 5AKZA 1HWJA 1N5TA 1I39A 5AQHA 1BC6A 4GKKF 2IGIA 2YVSA 4OJPA 1RDFA 3GBTA 1S0OA 1JQGA 3VCBA 1HKAA 7ICQA 4KYZA 5DO2A 3TFSA 4EZ6A 2Q2RA 2L9WA 4LD0A 4YY3K 4KHUA 3OJSA 4FZXC 4OZ3A 3G25A 5D4LA 4FZLA 2UZAA 2V4QA 4M5HA 3VF2A 3GL1A 4OZ0A 5J2HA 4ISGA 1SH0A 2KT5A 4KPCA 4LBIA 4I2PB 2DRAA 1FRHA 2VWBA 1JJ4A 3M2UA 2WAQF 3IXQA 2FMPA 3SQOP 1ZQLA 2HPUA 1XNSA 2IOHA 8AT1B 4FLYA 1CXQA 3GG4A 2H54B 1HD0A 3F2CA 3PR5B 4KLHA 2FPKA 4I7FA 2R7YA 1C0UA 1OYEA 3AQEA 4ZP8A 1H72C 3SBGA 3SLCA 4IZ9A 4CFDA 2AGQA 4X64F 2BRKA 1WC6A 2R3VA 4M7XA 1BCMA 4KPYA 2F9DA 2V4JA 4PGYA 4MYTA 2KI2A 1FKOA 1PK1A 2YKMA 2YQ0A 3HULA 3KKAA 4X4QA 2BYCA 3PKYA 3V7KA 1OH8A 1VBYA 2DCUB 1ZQQA 3THTA 4EMDA 1COKA 1YIJN 1HUXA 3M8ZA 4WK3A 3RH4A 1FI4A 1U0HB 3RW7A 3TX8A 1NJIT 1URRA 1HD1A 5JJBA 2BM0A 9ICPA 3BBBA 4M5NA 2LI6A 4DL6A 4ZVQB 2KV2A 2D9PA 1R27B 1EP4B 3ULEA 3RUBL 5HO4A 4M5JA 2GHWA 1F60B 4NO7A 2A1BA 5ALIA 2R2UA 4WP3A 3IWXA 3KWGA 4C3LA 3K17A 2CVEA 1N8RT 3C46A 5KQDA 2R7RA 1S57A 1YZ7A 2B7CB 1UETA 5U47A 2YHYA 4YORA 1VK0A 3MAAA 2LSNA 4ILLA 2KM8B 2GO9A 4YDUA 4QS7A 2EQYA 4DV6J 4PZNA 3JTPA 2NPIA 5ITHA 5B0DA 1BI4A 2PI4A 1XNRJ 3MXIA 1IV8A 3O3LA 1QAXA 5AXKA 2VGNA 4JI1F 3H25A 3RH6A 1UT8A 2CJBA 4XK8C 3HVRA 1F5SA 1KTVA 1NGBA 2RT3A 2UVRA 1ZQYA 3AQPA 3OL7A 2QGFB 2OCEA 4BC5A 3HSZA 5HN0A 2EPIA 2QG9B 5AQXA 4BWJA 3I4PA 4X4PA 3C2PA 1YITS 1VK8A 2KP7A 3D0IE 1RCHA 2VWJA 3IAS9 1N88A 3DDNA 4JK1A 3VAFA 3GMGA 3E01B 1NJYA 1DBDA 1HJRA 3FZKA 4GKJJ 3DGVA 2BDUA 1YTYA 4U9RA 2V67A 4BDYA 3LP2B 4TY9A 3LDPA 2YWKA 3W2VB 4FBTA 3ENOA 3MHYA 2BCRA 4K4GA 5HATA 3ILJA 4PG8A 2QARB 3QO9B 2PFOA 3GFXA 4ZJLA 3NMRA 2D69A 2R9LA 2KG0A 2PFDA 4HDHA 2EAPA 2VKQA 5AJ3F 5ETTA 1FKPA 2IS3A 5C24A 2NYVA 2CQDA 2L48A 3I56N 1CQNA 1Q78A 4BXOB 3HP6A 3KLVA 4JK8A 4RPXA 3HVAA 1X6IA 2KVQE 2FYXA 3W1YC 2ZNYA 3HXMA 3C5FA 2P9NA 3JPOA 3EKSA 4DU1A 4OLOA 4DCCA 5ETOA 1HMVA 1OS5A 2ZTDA 4FJKA 3PG9A 1VBXA 3PX4A 1OJ4A 1ITGA 2NR0A 2W03A 4GO7X 4DEZA 3HMJG 2QMUB 4BLGA 5LSLA 5MLCV 3W8PA 4H5TA 1LW2B 3L0QA 3K89A 2JGUA 3VTHA 2B3TB 5J2CA 2LYAA 3ELHA 4RNNA 5EX5A 4DCHA 4ID5B 3MBYA 2NO4A 2W42A 4A57A 3DRRB 1XQIA 2EI5A 1HQ2A 4CJ7A 3P3DA 1HNWK 4PABA 3WKEA 1XS9D 4M5KA 2WB1C 7ICVA 4C2MA 3VAKA 3FUYA 3IA0A 5HNKA 2FGOA 3J7ZT 1N60A 2Q97A 3OBYA 2QI2A 3AJ1A 2L9NA 3TUIC 4Y2PA 1HQUA 3OUYA 4I6MB 4YR3A 4E3SA 4I4BA 2I7NA 3J81U 1AW0A 3VQSA 8ICMA 4FJLA 3D3CJ 1WC5A 4DUZJ 1T11A 1X9WA 2RH3A 1YI2S 3O9RA 1VQ5N 3VOVA 3LDAA 2O8CA 2IVNA 4BC2A 2BRLA 4KH5A 4XQ8A 5BR8J 3SPYA 2P1JA 3JAMO 1ZH5A 3N6NA 3SV3A 1O8BA 4JI4J 2ESEA 4B1UB 3CJ9A 1NGJA 2UP1A 4ECYA 2FY8A 8ICUA 1NLVA 3ONNA 5D0EA 2F8HA 3RR7A 4ITSA 3PY8A 1NZAA 3SMPA 3D66A 1RKIA 5KFCA 2KZ3A 2ZJAA 5ALJA 3CCLS 3W65A 4NLOA 2VASA 1RYSA 3NMAA 1XSPA 2KTQA 3VA0A 4NXNJ 4ZPCA 3VALA 2XO7A 2UUAJ 3V9XA 3W2VA 1J2VA 3ILOA 4LF8F 2MGZB 1S22A 2HFSA 1BUPA 1EJ7L 2MQLA 4DV4F 4IL6U 3I56S 4NYFA 4BRGA 2ZVIA 5AXNA 4BG8A 2QL9B 2DNNA 5KFOA 4WQ5C 2XI9A 3KZIU 3EZWA 3EPGA 5KT2A 1F2HA 4UZBA 3OSPA 4BR7A 4UB6U 2KJ9A 3ZZYA 2VDHA 1HI1A 1UAWA 1RLCL 4CZJA 1AXQA 4JV5K 3UQSA 1YBUA 4O23A 4J2AA 5AE2A 1GOAA 3KK2B 3PUFA 5H2FU 3M32A 2L9DA 2M8HA 3BGUA 2Y1RI 1OO0B 2J9CA 3H3NO 4UB1A 1NWKA 1F44A 3ITHA 2XGQA 1GLFO 2RKIB 1O03A 5JVHL 3LPYA 3RWUA 5EE1A 4QJVA 2MSNA 1CS4B 1Z3EB 3NH0A 4BQZA 3HPHA 3PKMA 1KCFA 4LF7F 3CEDA 2J9DA 2P9PB 2CJ9A 3TACB 2AJ2A 2XGPA 1N33F 2GAGC 1HNZK 5AQNA 3C29A 4KH4A 4ZVPB 4DPOA 2DY1A 3R1HA 3O4NA 2QL7B 2E8PA 1GXLA 2JLEA 1HNWF 1XN9A 3C21A 3R1XA 4DU3A 1TVRB 9ICOA 3TFRA 4H4OB 5JRTA 3S6JA 1Q8IA 4LH4A 1YZ6A 4LSLA 4AHRA 4OYAA 2PMZD 2FC9A 1T9TA 3JYTA 3DU5A 4HHUA 5I3QA 1VFJA 2IDLA 4O5FA 1XU4A 2KZZA 4O5CA 2ZH8A 5J2EA 3J81j 4RBTA 4BR9A 3VF0B 2WMMA 1VJWA 2M2BA 3ZZ0A 2VOPA 1W25A 4C80A 2LA6A 3N4PA 3M7DA 1KFTA 2BX6A 4UW9A 2WVEA 2IVFB 4V19J 1GLAG 2RHKA 3CQXA 2IYIA 4ELVA 2VJ5A 4KLSA 3QSIA 3LWLA 4JKFA 4DR4K 4TQSA 4RW6B 4W5OA 4YDXA 3KUGA 1JIHA 5B0GA 2DCLA 3LDNA 5D4BA 3JPNA 3HHLB 5A2QO 3CYMA 2ZHOA 1MROA 2BV3A 5GAEI 5HQLA 1FFSB 4N41A 4CJVA 4O0JA 4XO0A 3VGVA 1NGDA 2LDIA 4DL5A 3GSIA 4Y6IA 1WBBA 2PKEA 2DJWA 2VHGA 2RUGA 4OZJA 3ATVA 4USJC 3R2DJ 4M2YA 7ICEA 4KE5A 3G8SA 4ZP7A 3K5LA 3TADA 2DXFA 3CETA 2C22A 1UA1A 3UFCX 4ZLJA 3KHLA 4HKQA 1OIAA 3G82B 1ZQPA 1KVAA 3M2VB 3J80O 1W97L 5J0XA 2VH7A 1ZD5A 3Q24A 2I5JB 1CC8A 1Y11A 5A8WB 2LP4A 1N32J 2CRLA 4N8NA 1QZ5A 4KV8B 1U7LA 3FZ2A 3ZZRA 3TOQA 2OYQA 3MK6A 3G2XA 2O8EB 1XSLA 3UD3P 1R7IA 2YWGA 1HWIA 5ALWA 4M5DA 4Z6EA 5J2PB 5GAEU 3IP0A 4OFZA 2QEXN 5T14A 2PY5A 1S8OA 1L7PA 1S97A 3M1YA 2Q1LA 3BQ0A 2GMLA 3TVZA 4QS9A 3GV5B 3EE8A 5C25A 4IO1A 2BPGA 1X5SA 5A8WA 2A1JB 2DR5A 2FDNA 2FLLA 1ZOTA 4QOZB 4FZVA 3TAQA 3IG8A 5CB1A 4NPOA 1N62A 4C0BA 4DFDA 3BB5A 1VYAA 3Q23A 3RAQA 1XNRF 2Y9UA 3U8XA 1OWXA 3QX7A 2BJ1A 2FPHX 4R5PB 3B9JA 2F8SA 2CH6A 3LP1A 3BZKA 3IP4B 4ANDA 2A18A 3ID6A 2LKZA 4ZLLA 2QX0A 2LU1A 5D0HA 2O8BB 3DAWA 2UU9J 1CPZA 3TUZC 4KN7A 2R8GA 2VU5A 5M1NA 3S1TA 1FRIA 3C65A 4DR3K 2OA8A 5A0YA 1BGXT 3ZSRA 2W25A 3HI9A 4PEOA 5L1MA 4O44B 1SUQA 1ATNA 4QZFA 3B8AX 4GVBB 4HYKA 3IFRA 1FD8A 2B0CA 5F3TA 1OH6A 1HLWA 3AVGA 2EG2A 2R8KA 2VJ4A 4C3KA 4E98A 1VC0A 4F0KA 3SUQA 1XMQF 4OHZA 3TSPA 4I2QB 5IFMA 3VQ6A 4JN4A 1MLAA 2HRTA 3CJRA 4DV2F 4FXDA 3MI7X 3D45A 2XMVA 4CCHA 4K8RA 2CG4A 1DZ5A 3JPTA 4JV5F 1R6YA 5J0QA 1C0FA 1PKUA 3A2FA 2P9EA 4BY9C 3QIPA 2I7PA 2E6MA 2DHSA 3CJ7A 1HYZA 2D7SA 4NYZA 1IKYB 3MEEA 2Q31A 2QIFA 1REGX 1UPMB 3FCWA 1HNZJ 3JXUA 1OYDA 2GQQA 4RCHA 4OZ2A 2XLJA 2EKYA 4BXOA 2D1KA 1YJNS 4R0JA 2M70A 4HI1A 2HVIA 3SQ0A 1G3OA 2CUYA 3OBWA 2QN6B 4EEKA 2CZVC 4RL1A 3WZ0A 2Y3YA 4WQ4A 2G06A 2MZTA 4DV6K 2AF6A 4IH5A 1WDTA 3VEVA 4RNFA 2ATQA 2W04A 1MG7A 3O1LA 4DLGA 1S5ZA 5A0YB 2ZVSA 3KKRA 4XA5A 1YBTA 4HR2A 4FZMA 1BWVA 1RACB 3DGPB 4JI3J 4FM1A 3F73A 4KMOB 4FF1A 3CJ0A 3HKZD 2ZXIA 2IRYA 2H9ZA 1FNOA 1X1PA 2DFEA 5ETSA 1PO6A 1JCGA 1LFWA 3I5AA 2MUTA 2ISPA 1NGIA 2FJVA 1F9HA 4TURA 4JBCA 4DUZF 1UFLA 1LWXA 5LSOA 2DNRA 3IBPA 2OTJN 4CDIA 2XRIA 3AA5X 4KREA 1OSCA 4GNIA 2F3JA 1VRQC 4M3XA 5IS2A 4GC7A 1FERA 4AT1B 1BG3A 3SDEB 1F5AA 4K4SA 2PD1A 5M2RA 2ASJA 5CRXA 3H2UB 3N7RC 2KHQA 4CERA 5KT3A 4H0PA 5CY4A 5HBMA 1BWFO 3MUMP 1TQLA 1M5SA 4H0XB 1RDUA 4OJ5A 3AAQA 1XMBA 2YKMB 1RHKB 2PMHA 1S72S 2E1MC 3LGHA 2D3ZA 3FZMA 4QW8A 4EENA 1ZM4A 4N8OA 1TKZA 3M5RA 1U02A 4RBVA 4KIAA 4MFFA 2KN4A 1FEHA 4PZOA 5J2AA 2GGPA 1EHWA 1NU0A 2XCAA 1N36F 4IFYA 1HNXK 1YJ9N 2ROPA 2V2ZA 3LOUA 2BANB 4ZPDA 3VQAA 4DPYA 2YNFB 2OPSA 3H5SA 1UVKA 4YB6A 3FK4A 4YOXA 1SL0A 3PIOQ 3KJFB 4NEZA 4NXMJ 1PSDA 5AXMA 1NGFA 3M8QA 3LALA 3ET6B 5AI9A 3QZ7A 2J7WA 1XMQJ 5HP4A 5BN8A 7ICLA 4CIEA 4IQMA 3AN1A 3CT9A 2KQ2A 3L6QA 2CQCA 2Z2MA 5FD1A 3ZSXA 4KB0A 2UXDK 3KZBA 5ALVA 1S48A 3ZDBA 3K0SA 1TL1A 2KKHA 5ALZA 3P49B 2QMXA 4XH4A 4NLUA 1HFEL 2W9CB 2ZM6J 1SZ2A 4B3RK 2JNJA 2FHKA 5CZVA 4DZ6A 3EXYA 5KGXA 4YDUC 3QNNA 4Y28C 5CYQB 2ZJ8A 1SL1A 2YBVA 2C3OA 4PY5A 2DBYA 1NK8A 5DM6Q 4CH7A 3BPSP 2YN4A 1TVAA 9ICXA 4YMOA 1AYEA 1Q3VA 3D1HA 3UPQA 1IBLK 3T3FA 2JFKA 2DR6A 3RSEB 4EIAA 2HI0A 4OPAA 2HHHF 2V52B 2D9OA 1JK9B 2YWEA 3EL2A 2GC8A 3HSCA 4CO4A 2MZSA 4A8MP 3D7SB 1NGEA 4AE5A 1GT8A 3MEGA 4X4NA 4P72A 3TQEA 4JI2F 2VPXB 4ZITA 4XIUA 3KIOA 1WHWA 1QY7A 4C1NK 1I5OB 4FP9A 1SPBP 1T94A 2QA2A 2LMIA 1WG1A 3DYAA 3HKZF 2YWHA 4YS2A 5BR8F 3S41A 4YMNA 2RQMA 4CNZA 1LEOA 5M1OA 3JSYA 5JVHQ 1L7OA 4KI6A 3OL9A 3VVUA 4DWIA 4ZA1A 4Y00A 7ICIA 2HHQA 5AM2A 3BR9A 2OTLS 4I7FB 4DOAA 2DFHA 3LVVA 2V2QA 2GEMA 3D2NA 5AXLA 1GO3F 3N4QA 4IRDA 3RBEA 1DLOA 4UUWA 4DR5K 4PCQA 1HQEA 1RDBA 4QZ9A 3MWBA 2HNYA 4F92B 1SQKA 1ZQHA 3C7NB 1LK7A 2DNOA 3CFRA 1BIUA 5KFHA 2R7OA 4EP5A 3N5FA 4CT9A 7AT1B 5L9XA 1N0UA 4PKHA 3CNQP 2H1YA 3LW5C 4U7UK 5GIPA 2KJVA 1FK9A 1PYSB 1HBOB 4C48A 2FVSA 1M5OC 4L3NA 1KVJA 3ZX2A 3ZDAA 4N5SA 1E3MA 2A2DA 2DXDA 2FSJA 1QTMA 3WNEA 4X66J 5GINA 2Z2ZA 1PJ7A 3WK9A 7ICFA 3MM5B 2PBDA 3VGKA 4K41A 5ETKA 3BPDA 3PV8A 4FYVB 1SZPA 3VQDA 3LWMA 1ZQRA 4KHMA 2VPYB 5D77A 4GVLA 3HT3A 3HM8A 2VBZA 3IRUA 2N7YA 4CJPA 3UCGA 4Q0BA 4AFFA 1FFVA 1A9NB 1XC3A 3MAQA 2ZDPA 1RT6A 3SR6A 3VQQA 3IR7B 4V19S 4RW4B 2AGPA 2OPPB 4QIGA 4DUZK 1CJUB 2YHAA 4K50A 2MQ8A 2MGZA 3ZD8A 2G8HA 3L2WA 5CYMA 1U9LA 2R2RA 1BOTO 2M7SA 4BGBA 2DGZA 2AU0A 9ICMA 1HNIA 2FZCB 4I6MA 4FPIA 4NA3A 4F5OA 3KLEA 2BQUA 5ETQA 1HEKA 4IO8A 2CQ1A 3RW6A 5AICA 1N56A 1Q53A 4X65F 2O5DA 1CG2A 4RLEA 2W01A 3R6MA 5AM3A 3M7VA 4B9UA 4DR4F 2XYHB 4KX5A 4EP4A 1VHIA 4LUBA 3H40A 1EB0A 3LDOA 5K14A 2CAJA 1IG8A 3ZSZA 3L95X 3J7A1 1LWFB 3NTUA 4CD1A 2U2FA 3QESA 4H0TB 1O6XA 3LUYA 1HYSB 3A8YA 3CJCA 3CCMN 1ITPA 4TUSA 4J9OA 2MA1A 1BPXA 2K4HA 2NRTA 3OS2A 4H03B 2VFVA 9ICSA 1LWCB 4ECUA 3MTKA 1KBRA 2OTLN 4HTUA 1ED1A 2V8HA 4TUPA 2EZXA 3CC4N 3ATUA 2YXLA 3P31A 3R8EA 2QKBA 4RU9A 4X4TA 3V4IA 9ICKA 2FVCA 4G1IA 3ZDCA 1WSJA 3DOLA 1WHYA 2D1CA 2RIJA 3TA2A 3KBBA 4DV0K 2XNRA 3UB5A 5E0OA 4P2FA 3BUZB 5F0WA 4DPTA 2CPDA 2ASPA 2FBTA 4AHTA 2FY1A 1LAVA 2PT0A 4ID5A 3FC4A 2K3IA 3ZETA 1KD1O 5ALRA 2Y0SD 1BNOA 4RPYA 3DLKB 1D8LA 1XMQK 3M05A 3N6MA 3MPDA 5TKWA 2E2OA 5IIIA 1X9JA 5IC4B 4MLEA 3PSFA 4Z6FA 2K8BB 1CBKA 5F1XA 4ANCA 4OV6A 3CIMA 5DK5A 4C8KA 4WTYA 3TZWA 1U26A 3M1VA 4DV7F 5GAGP 3GFYA 2KVSA 2UVVA 3F56A 1S10A 1WKLA 3U1LA 2PEBA 3WK4A 5G4DA 2VIXA 4CK3A 1RGVA 2KSOB 1U8SA 2GO8A 3F41A 4FJIA 3D2FA 4DI6A 2E5LK 3AODA 1HKCA 1FE4A 4DJBA 3GFKB 3J7YI 3BF3A 4PGQA 4NX9A 3OYJA 3MZIA 1RU1A 4ZIVA 2Y1LB 1Z2ZA 2WB1D 4FWMA 3WQUA 4QZDA 5GVQA 4DFKA 5LMNJ 4JI5F 5DLGA 5J1NA 2BANA 4NL5A 2OANA 3M3ZA 4KAZA 3UO0A 3THWB 4BE1A 2MZJA 3K58A 2HVZA 1L3VA 1OPIA 2B43A 1T03A 5AQKA 2QWQA 2RF2B 3ORYA 1VQLN 3EM1A 2A41A 2V51B 3TKAA 4AHSA 2CKWA 4PHTX 1TKZB 5LJ3Y 1AZSA 2DR8A 1ZBSA 3X3UA 3C6AA 3VAGA 3OTOJ 5GTHU 4YN3B 3SAGA 1TUWA 2BJ9A 2I0XA 2EK6A 3C6TA 3MMJA 3NOGA 3QWPA 5AKEA 4KLUA 2P9NB 1NMNA 1ZYQA 2P9LB 2X74A 4AQYK 1B7FA 1J9AA 4CFBA 4QS8A 5KPZA 2XS2A 2VA8A 2ZTEA 1NKEA 2EC0A 2QLTA 3M8PA 2G0IA 3Q22A 1E6VA 3IBFB 4FJMA 4OJ1A 4JV0A 3AAPA 4OJ3A 1N5XA 3KJVB 1QQ6A 1QQ5A 1T3NA 4AL6A 3NH1A 3H8WA 4PAAA 1REVB 3EGZA 3PX6A 2DUYA 3RB6A 4LF9J 3ZSYA 2BCSA 5DRKA 2NLWA 3T1YK 2PAVA 2LQ9A 2I2YA 3HKZC 2HQCA 3FMWA 2VFTA 2IVMA 4JKHA 2BE2B 3UMBA 4C8YA 2RE2A 4G65A 2DFLA 2B4VA 1PZNA 5I3UA 3HCXA 5IXUA 1SUQB 1RM6C 2K06A 4CP5A 1BQMA 4KLGA 4IRKA 2RF2A 1O1WA 1S1WA 2UUBF 3I5BA 2VF3A 3MMBA 3FBBA 3GCWP 1ATSA 3OHAA 2ZM6F 3AGRA 2G0CA 4HH0A 3THWA 4ZCMA 4Y2QA 4V19X 4OZLA 4DXLA 2CNNB 2NZCA 3VV2B 3VGLA 4CNQA 1Y10A 1RT7A 3MECB 1ZZNA 3DHWC 2J9DE 4KLIA 5JVGQ 2VG7A 3BKTA 2BPFA 1ZETA 3KLHA 2AH5A 3W5ZA 3O1WA 2V8DA 2QFIA 4QNLA 1JLAA 4ZVUB 7ICGA 3NBPB 4U96A 2PMZC 3QUTA 1MU2B 2FUG9 2OFHX 1OW5A 2HHHJ 4JYAJ 3D4JA 4KH1B 4ZVGA 1CQMA 4ZN3A 5F0XA 2LQBA 2Q79A 2QTWA 3E9OA 3CPEA 1GXTA 9RUBA 5I3UB 4P4PA 4Z4CA 2OXOA 1IKYA 3UD5A 4A8KA 3K5MA 4R8UA 4NI2A 1UJ4A 2O8EA 5GAHU 3HT0A 3C15A 1ESVA 3NP5A 2BM1A 4OX7A 1KQQA 4DR7J 3MURP 4R79A 1CRXA 3GR1A 1MWZA 4X4SA 3W5YA 2ZQBA 5KFWA 2GWJA 1ECWA 3J8AA 1ZQSA 4LSNB 3LL3A 2SXLA 2DK2A 3K8WA 5FP0A 3PJXA 3B6PA 4DSFA 3ZXWA 3VGMA 7ICHA 2R42A 2FE9A 5ALTA 4PA1A 2Z1IA 3MM6B 5IT9O 5KFFA 3MN5A 3H5XA 4JV1A 2QO3A 2O3DA 2Z1GA 1VDHA 9ATCB 4DUTA 1YQHA 4ZPAA 4KRFA 5DS7A 5CWRA 2XS7A 1HHTP 3TA0A 1RBLA 1CZAN 3QEWA 1IBLJ 3OPKA 3R6GB 5LY3A 4P2HA 3TR5A 5HQ8A 3THYB 2W54A 2V2KA 1PBUA 3QEPA 1Z2LA 3CMQA 1JMTA 4OL8A 4DHYA 1V5VA 2XQCA 2RPIA 2GA7A 3OYIA 1BQXA 1SIZA 2RVJA 3IN5A 4K4WA 5AQZA 5DDYA 2R7SA 2ZBPA 3EZ5A 3TWZA 1FX4A 3K5OA 2YQEA 4YQWA 8ICOA 2F4FA 4OKEA 3NGUA 2GVDA 3W0LA 1UEKA 1B43A 2KM8C 2A3ZA 3D6RA 2FVPA 2A1JA 2ZGZA 3BGOP 4K4TA 3OYAA 3HSJA 5K9FA 2UXDJ 2UUBK 2VG5B 3VZHA 1FNXH 4H8KA 4DN9A 2LMRA 1RAHB 1S76D 1GMUA 3RMBA 5DZ6A 4BCAA 5BR9A 4ECTA 2AGOA 1HX1A 3VERA 4WK1A 4EK2A 5BRDA 1P1LA 3LM9A 2GNKA 4ZVTB 3ZZUA 3ZEUB 3EKUA 2BVZA 2GV9A 4DU7A 3MXHP 2OIHA 4OHYA 3N7SC 2EHGA 4YXMA 2C3MA 3G6XA 2W11A 5I9EB 5LL6Z 2EH9A 4EX7A 4KMUA 1L5UA 4RZRA 3C8YA 3L7UA 2A1AA 2BPCA 4H5VA 1C1BB 2AQ0A 5CHGA 1TK0A 2JLFA 4MK7A 1U47A 1TGOA 2Q0ZX 3I55N 1YVNA 1RKJA 4LQ9A 2RKIA 2UXBK 4IG3A 4CFCA 3D6HB 1BA0A 3NVVA 2P6SA 1HW9A 1DRGA 2H5EA 2DGXA 3AGKA 3BGRA 2IRUA 4J9LA 4X84A 1ZBHA 4DV5K 2E1FA 2ZJPL 3BDEA 3LP0B 3CIZA 3N28A 4CRXA 1HBUB 1V38A 4EU0A 4QZBA 3WIVA 1F2GA 2J6SA 1X7VA 1RSCA 3VAJA 5LL6d 1JLFA 4OQJA 5AE3A 2YMLA 5E41A 5E84A 4DQQA 3ALYA 3MR3A 2RLTA 4OMFG 1A5XA 4AM7A 4PYAA 2Y0BB 3DXSX 3QRQA 3P96A 1FEZA 5AQVA 1X66A 2JWLA 2HGMA 1X4BA 3UDCA 2V68A 5J2IA 4OD0A 4MN4C 3L3UA 1WAJA 1FRXA 3AA3A 3O80A 4DLEA 2IVYA 3O9UA 1SGGA 4CQ1A 1DY3A 4I2IA 4UARA 1H7XA 4RWXA 1B4FA 1VLOA 1DTQA 5H9EK 3GIMA 1W0HA 7ICUA 3UKUA 5CR0A 2NRHA 1X9MA 4M8LA 1U1LA 2VOOA 2I6WA 2WFAA 2KHDA 4DV7J 4E7KA 5C10A 1VSJA 2M4MA 3KXDA 4WYBA 3V81B 1QUVA 2V69A 3NWGA 2WVDA 2P66A 1U25A 1NM2A 4NL9A 2HF3A 2HAIA 1GOCA 3TEGA 2X3GA 5FDLB 1X40A 2VG7B 2NUBA 1XO1A 3Q8MA 3F0NA 4KLQA 2W9AA 2K4IA 3MMAB 2E1AA 4O0NA 4GKKJ 3TPQA 4AH9A 3R9PA 1MMNA 2KMDA 3QFUA 5D3GA 5LMNF 4ES1A 2XEXA 4E8UA 1Q46A 2RHFA 4RQ3A 4CWBA 2K8GA 4QCLA 3T41A 2NRRA 5DKWA 3THYA 2EWHA 1HIYA 1QUPA 4TU9A 3NNHA 8ICCA 1UAXA 5ALKA 1ATRA 3A0HU 1T02A 2EC2A 5CD4A 2NRVA 2ZD1A 4FJ7A 2DEIA 1IBMF 1EXNA 3UW1A 2BGGA 1QM9A 4L72B 4IG3B 3MMCA 2OUGA 2K7JA 3C66A 3C2MA 3AVLA 1NPRA 3MM6A 4I2JA 4BC3A 3OHBA 5J0RA 3PVXA 2B5JB 3JSRA 4WTOB 2DKOB 2K2PA 3K4GA 5CZXA 4PJ0U 3QFWA 1UMJA 3HM9A 4B3OB 3VF6A 3DKDA 2GUIA 4J03A 4JB3A 1X4FA 1KN6A 2MZQA 3NNAA 3R7SB 2O67A 3R97A 3RAXA 3MGVA 3KD5E 3H6EA 3E01A 2QLFB 3G0ZA 1ZBLA 3KLFB 5KAFU 1RAIB 4FNHA 4KKOA 4YVZA 2KG5A 2VDIA 1S4FA 4NXNK 1M5PC 5J0WA 1JXLA 1DK3A 2XZTB 2KKVA 3V1QA 1Z1VA 3DOKA 3J7AN 2C2OB 2FBXA 3SSQA 1ZQMA 2BUPA 1P7DA 9ICQA 2HS4A 4LFAJ 1SV0C 3FFIA 4ECRA 3CXCR 3AA2A 2QLWA 2CFXA 1K5OA 2RD5C 3H8MA 1S1VA 5AQPA 1VQKN 3P39A 1PG5B 1T05A 1BISA 1ZQKA 5M1KA 5J2MB 4RX6A 2KSOA 1K1SA 4LRCA 3IGNA 2W9BB 3BF4A 2GQCA 4WYLA 3PM9A 5J1PA 3EGVA 4QZEA 3PR4A 1GMVA 1LXJA 4E0DA 4NE9C 3CCWA 4XTTA 3JSMA 1ZBUA 2ZJQL 3LYSA 4USTA 2WBMA 2ZC4A 3SJHA 2IM2A 5BJRA 4CJQA 3A3PB 3L09A 4LRBA 4KITB 1CUKA 3U3GA 4YY3J 4MEXA 4Y2TA 5DG7A 3TNVA 1BQMB 4WZQA 3NAIA 5FLXU 2KJ5A 1XK8A 5C24B 5CCMA 5CJ7A 4DSEA 3CNHA 4V1Ak 4HAIA 3M1FA 5ETNA 1NHKL 1NRKA 5F8IA 1EX4A 2ABYA 4YMMA 2H5XA 1S1TB 3A5MC 3C16B 2LQ5A 3GZ7A 3OTOF 4GIBA 4ED8A 4P0PA 2GIRA 4YFKA 2FXUA 4DR6J 3ZSWA 2MLXA 5IQQA 2G8UA 1IJJA 5HHHA 5BR8K 4B3SK 3SQGB 3QU7A 4NLPA 3OVSA 1DHMA 3BBFA 4FPRA 1RQ0A 5AQGA 1UW4A 3OV7A 1CC7A 4A4JA 2RAQA 1PYTA 3GJQB 3PRBA 2ZEJA 2KICA 4FL9A 5EUHA 4AHCA 4J2BA 3SUPA 3C2KA 1VS3A 2KRRA 1LW0B 2W8KA 5BPMA 4Z37A 1S12A 2BA9A 2XI3A 2GELA 7ICRA 2B9YA 5D0RA 4CO5A 1XTZA 3AOCA 4KN4A 1FFUA 1NCLA 4M5GA 4KO0B 3T1HJ 1JXBA 2DY9A 1X3MA 5E3QA 1S6OA 2ZWOA 3F9MA 3AY0A 5BYSA 2DHXA 4ENOA 4C23A 3IWNC 3KHHA 5H9FK 2MSTA 2BCVA 1JJ2M 2ZH6A 5F8NA 4CZCA 2PFQA 3V72A 2OAUA 3H20A 2E2QA 4H4MA 2R7QA 4R5PA 2OPPA 3US5A 2XY8A 2X3DA 5EE9A 5M1QA 5AHXA 2XM3A 1DKGD 1G15A 8ICIA 1XIQA 3GJSB 4UY8T 1B7YB 4KB1A 4JYAF 1TL5A 4MLHA 2XG8A 4M3TA 4DQPA 3P4IA 2DGUA 4B3MJ 3L3CA 2C28A 1J5EK 4EEYA 3AOBA 3Q2TC 1MQ3A 2MKCA 5ALGA 1FDAA 1ZPVA 1VQON 1YHQN 3C6TB 2XO6A 4CZHA 3QUCA 4FLUA 2E8AA 4JRQA 1RBRA 5ALMA 1HPZB 1K73O 4DUYK 3IWLA 3IV6A 2YNIB 2CN1A 2DH9A 2VC0A 3GONA 3TAEA 4AYBD 2KT3A 3TVKA 2QV6A 3WBZA 3OTOK 1RTJA 3OD2A 1S1XA 2A19A 4NMLA 3SSSA 1GTHA 3FFKB 1RAJA 1UJ5A 4JD2B 4PQUB 1X2IA 2FC8A 2BQRA 3UKRB 4Q44A 5AR0A 1FEEA 3I32A 1Q86T 5BN9A 4L6V3 1OUQA 4O3NA 2FBVA 2RB7A 3MAHA 2W55A 3HD2A 1SV5B 2QYCA 2Q3SA 3D68A 4Y2YA 1WI6A 5F9NA 4PKGA 2HFNA 2ZTCA 4DQRA 4ED5A 1KKXA 3HHLC 2K89A 1NJXA 1VIXA 4TYBA 3D0HE 2BTFA 1URJA 2KB2A 3D1OA 4CEFA 2FHOB 1IJFB 1GLDG 5KFLA 1DURA 2DNYA 5FDLA 4PG5A 4IR9A 9ICWA 2GFFA 4RQ8A 3A0BU 2YH0A 4YXJA 3BKUA 1HL6A 2XVTA 3ISBA 2V8PA 5C2GA 1RT6B 1S0MA 3I0SB 4CF1A 3P45B 3UXOA 1M0SA 4J9RA 4QWBA 1C1BA 4W5TA 1C0GA 3BN7A 5B0AA 4CD3A 3H3OB 2AP6A 4F26A 1MA9B 1JN3A 4CHQA 1SWVA 3V7JA 4FXWA 5AK5A 1RZTA 3CCSN 2FHJA 2PFUA 4JS4A 4YOWA 2JDJA 4CDGA 3IDWA 5JVGL 1FT8A 2GBZA 1FWLA 3EYZA 4DR2F 1S6PA 3EVMA 5EVZA 1K9MT 3SCJE 1JLFB 4I69A 1TKXA 3BS5B 4ED7A 4LT6A 3SIPB 1IM4A 3CCTA 5JUMA 3CJAA 4UB8U 1JLBA 2JH1A 2NNWA 4WZMA 2KDOA 2JR5A 4FLXA 1W9HA 1HYSA 2ZNZA 2VFSA 2E29A 3HFKA 3S3NA 5F3XB 2FF3B 4F4WA 2ADCA 2KK0A 2WZ1A 3L2VA 4JHDA 1HI0P 4NRUA 4CLLA 4QWCA 3TUJC 2GTDA 1JMSA 3U02A 1S6QB 5AKIA 4H5NA 2MQNA 2N4CA 1SC4B 5A8RA 3BSNA 5J0SA 5IT9Y 2WC9A 3GDXA 2V2VA 3I0SA 5J2QB 4Q8EA 2BE9B 2K1RA 2YHXA 5FPMA 3ZLJA 4JI2J 2W3RA 4US9A 4KHYA 2E7XA 2P2CB 3K75D 2ZKTA 4BGDA 1JCEA 9ICBA 4J37A 4DTPA 2D8CA 1M90T 4I6WA 9ICEA 4CGJA 1CJUA 3I28A 2WTFA 1F0MA 1VLBA 2B51A 3EO3A 2YNIA 3FC9A 3T6BA 1N32F 3L8BA 3NOCA 4I2EA 2P5OA 4IQWA 2HHTA 3EZUA 4P71A 2QWOA 4KLOA 3O2IA 4YNQA 1QSLA 5CEHA 5KG2A 8ICSA 4BVOA 3EX7B 5ETPA 1ZQDA 2EXUA 1UZHA 2AJ1A 5KG4A 1SH2A 2BXJA 4IWVA 1WSRA 5E3RA 3CDUA 3PX0A 1SXEA 5A8KB 1QQOA 3BO2A 2GIQA 2PE8A 2CXYA 4QBUA 5KFSA 5LT5A 3OUYB 4CJRA 3SQ4A 5HRSA 3E8OA 1KAYA 1IWGA 1SC1B 4H0OA 3F2DA 1DFDA 5KRSA 5LMNK 4ILRA 3FMBA 4NLZA 1P9QC 3HX0A 2YKOA 2WAQC 4H4MB 3DRPB 3CCZA 2YPZA 3CHWA 2M8DB 3SFUA 3AVCA 3W2WB 3HD1A 2M88A 2UXCJ 3Q8LA 2ZBCA 4O3MA 3ID8A 1IKXA 8ICZA 3FCVA 4MKBA 2R7VA 3UVJB 3EE9A 1HWLA 3UN5A 3MUTP 2R4FA 4M95A 2XMUA 4Q5VA 3OL6A 3TTCA 3D6JA 4D3GA 4CEDA 1LW2A 4ZS6A 4MTPA 4RT2A 1AUSL 3Q7BA 4UY8O 1EQ0A 4M42A 3O4QA 3DXKB 2E5IA 3L4QA 1BPZA 2DH7A 1TFWA 2XS5A 1IXKA 4UAUA 4DTNA 2AWZA 3WNHA 3AL0B 2V4RA 2KKZA 2FHMA 2CGKA 4EYHB 1S59A 1JROA 3VGUA 4JMUA 3TX0A 4ECQA 2POKA 4F3QA 4W4MA 4URSA 3V9ZA 4J2DA 3EWAA 2HWHA 1RDDA 2YY6A 3WK7A 2GJ2A 4ILJA 3QIOA 2Z2YB 3IAM9 1DQ8A 4KLLA 1LOUA 4QWDA 3AU6A 2DPNA 4ED3A 3NXZA 4AQYJ 2YMPA 5C12A 4RW7B 2E2PA 3OL8A 3DXKA 3QLHB 3MD1A 1V4SA 3KZXA 2JC0A 3UNGC 5HQMA 1RT3B 3TSQA 1HNZF 2YMMA 4KGKA 5LXYA 2AD9A 3AAWB 3SCKE 4OYBA 2WONA 1JNRB 5BOMA 4YB5A 1D4XA 5AM5A 3UVJA 3TARA 4J9KA 5IT9U 2A1SA 4YOVA 2FVQA 3MMBB 3O8MA 1YJNN 2N82B 4DL7A 6AT1B 5AQOA 2JFDA 1T3OA 2AJ0A 5AQYA 2HOFA 3PYGA 2W2QP 3PJ9A 2H4WB 2LDYA 2JEFA 5FJ4A 3M6XA 2NQPA 2A5XA 3NF9A 3DM2B 2BKOA 5C2CA 4CI6A 2OEHA 3IM8A 5B0CA 3DRRA 5HVHA 1N48A 2KIWA 5CP2A 2XLIA 3CULA 2HBZB 1SJFA 4LR9A 1UZDA 5J2MA 3KUEA 1N5YA 3DI6B 1VC6A 1R8PA 3C19A 3QIDA 2LEAA 1F3FA 2HHVA 3FZLA 3EICA 2DVIA 5ALEA 5J0PA 4C8ZA 2ASYA 3U9ZA 1OY6A 3RZAA 2HBLA 3ZNJ1 3F5TA 3OYKA 4BDPA 2OD4A 5K4LA 3MCAB 2G1DA 4MH8A 1D5AA 2CWXA 1H98A 4J9UE 3M30B 2CGLA 4DBQA 5FIIA 1X60A 2F8MA 4M3WA 8ICRA 1RHMB 5CAAA 1TUUA 3MR7A 3A8IA 2ITMA 3MM8A 3MEEB 4D3HA 1SJ3P 2E1CA 1BVSA 2ZBIA 2A0FB 3H0MB 5SWMA 2KYZA 4RUAA 3G71N 4JWNA 2OP5A 4NXZA 1NI3A 2ZE2B 3NY0A 1K73T 3V6DB 1EZZB 1S1UA 2D0PA 4M9HA 3D1QA 4ZTJA 4NA2A 3ONQA 4OI0A 4CLZA 4F4XA 1QVFR 4CHNA 3ZX3A 2B5JA 1R0CB 4DMZA 3FSIA 5EN1A 4HWIA 4WF9L 1R0AA 4DV1K 5J2QA 3M6VA 1RG6A 3JPQA 4TU7A 4LF6K 1V3RA 2E5JA 5ADZA 1TU0B 3PNIA 3IMQJ 4B3TJ 1NUEA 2QWLA 4Y34A 1L8OA 3TAFA 5A76A 1AUDA 4OJLA 4ZVEA 4MK9A 4CJ5A 2E2NA 2VJVA 3A1YG 3TJ8A 1WSFA 4OLPA 4C1NI 4ZKAA 2JV3A 3ENWA 2RSQA 4F2RA 1X5PA 2F65A 1RTJB 1S99A 1KBUA 3R3TA 4ZIWA 2ALZA 1KSPA 2VBWA 4X62K 2AW0A 4KQZA 4OX6A 2DO4A 4FJHA 1VQ6S 4C8NA 4NLTA 4RJVA 4JOUA 5GMEA 4WXWA 4Z6CA 4O3OA 4I9QA 2W7OA 2DH8A 4PPZA 1XMOK 4B3SF 1U1KA 4P7TA 1D3WA 1KKHA 4WYWA 4GC6A 2K8AA 1FX2A 3C1ZA 4KTQA 3R5JB 4OX9K 5CYMB 5CZ1A 4FZYA 2G5IB 1A0PA 2PA8D 1AQ6A 4JKGA 1HHSA 4ZHRB 2HLUA 2ACYA 3QJPA 5HP1A 2MQOA 1P27B 4Y2RA 3JS6A 5C2DA 4M9JA 3KHGA 3DOLB 2IC3A 2ZJQQ 4PUOB 1RBAA 3E1YA 2KFYA 2AYMA 2XI2A 1PYOB 4JB8B 3OTDA 1HRHA 3CERA 2X51A 2RP5A 4UF4A 1H2UX 3IRWP 2DF4B 2CPEA 2JHDA 1U2CA 1XMOF 1NBWA 4I56A 3TABA 2WF6A 3I6PA 2VIHA 3ZDDA 1DRZA 1ZQIA 1XR5A 2M5YA 2M0NA 3FSYA 1IBKK 4OHVA 4W90B 4WIQA 4FN5A 3MM7B 5C25B 1DTTB 4F7VA 1A0OB 5MLCQ 3O3HA 1B92A 9ICRA 4ED0A 2XWXA 3VQEA 1K6YA 2HIYA 2MHEA 3KNGA 1W2BR 2XSFA 2YWWA 1G4CA 4XDDA 4FPBA 3N5BA 3O6QA 2I5JA 3OLAA 4URGA 2VICA 4DV1F 3G4SN 3FAHA 3B6BA 4ID1A 3T69A 2R18A 4I2PA 3JPSA 3IMXA 3NE6A 1M1KT 1Y00A 5HJYA 5GAGI 2O8CB 5B7WA 4DSIA 1HYVA 3IUCA 1G6BA 4LZDA 3CD6S 2DHAA 4LF8K 2IRXA 1GMWA 5MAOA 3QICA 4RQ5A 2ZZNA 1Q5VA 1RAOA 3IR5B 1D8BA 4LBPA 3QERA 3EW9A 2YX7A 4NOHA 1TYQB 1LKYB 5KL8B 2B6AB 3HDSA 1NK7A 4RTFD 5AM1A 3NGKA 1MROB 5DDQC 5DMRA 1ZBIA 4GLXA 5M2UA 3RMDA 1NPPA 1H3DA 3PEJA 3NKYA 1YRXA 2ZDOA 1OXJA 4FCYA 2OFGX 4P2MA 5KFGA 5G0RB 3DWLA 3KG1A 4KLJA 1NXIA 5AT1B 2XMMA 3GJTB 2W6LA 3DU6A 2HNYB 4BE2A 2OHDA 5KG7A 2IM1A 4TQRA 4DR2J 1Y4ZB 4J9PA 3OYFA 2PFNA 3HHDA 1NMDA 1DLOB 5DG9A 4IBNA 2F8LA 4USMA 3A5LC 3HHLA 3H0RB 5HVFA 4IFVB 2Q66A 1S1UB 1U1MA 4PKDB 3G87A 4QZ8A 2DPJA 4NXMK 5E33A 4OO1J 3OYEA 4OJ6A 4DUYJ 4DV3F 4Y3CA 5GMDA 2XICA 1TELA 1AFJA 4E7LA 2QA4N 2GS8A 4FW2A 2VG6A 3AJ2A 4N47A 3HSGA 3OS1A 2QK9A 4U7BA 1SKWA 2QWRA 3IBWA 1NGCA 4USAA 3M9MB 4BGAA 4H0YB 2P9LA 4XRHA 4YOYA 1ZQGA 2HCFA 2MLYA 1TUGB 5CH7B 1HBMA 1GX5A 2P35A 3NS6A 3ENBA 2G09A 3PXGa 1P6TA 1ZM3A 5KL1B 1NNEA 2FJEB 2ROEA 2QRRA 3EJMA 1U2VB 2GOLA 1EX8A 3CCJS 1C20A 1XMOJ 3BZQA 3WX8A 1VQ4S 4QIFA 1BIZA 4F4ZA 3IS9A 1S6UA 4N76A 3M8YA 5LJVA 2AHOB 3P6YC 3PRVA 1N34J 2NSBA 4ILMA 3OJUA 4YG2A 2D3OR 2CG8A 8ICPA 4LZGA 1S5JA 4QZAA 1N8RO 2YB4A 4C8OA 2XSJA 4OJHA 4F04B 4C0OC 4JI8K 3WHIA 4Q45A 4IEEA 2CPYA 1KAZA 4BC4A 1VQ5S 1IBMK 1RU2A 2APOA 1TP7A 2LXFA 2YQ3A 2H3VA 1RB0A 4DOCA 3W3DA 1CZBA 5E26A 3R2CJ 2AP1A 3MPVA 4G1PA 1MWMA 1KONA 2DB1A 2WOMA 3MX5A 1UEUA 2DKXA 4FYWB 3ILLA 2C2RA 1Z4OA 1Z1BA 1OY9A 1KWMA 2EKNA 3NF6A 2CJQA 5L1KA 1RT3A 2W8LA 2B6GA 3HJFA 5HR7A 3W8GA 1HJPA 2P8IA 3ULEB 4DR7K 1SC6A 2AEJA 3T5LA 1UCVA 4HCCA 1HWUA 4ZVRB 2A6AA 5AQWA 2FLPA 1TAQA 3R5BA 2F9TA 4DF8A 3R7NB 3NUQA 4UATA 1RNHA 3AVJA 5FRMA 4JYAK 4KJIA 3MWTA 3OTCA 3MWPA 1GLEG 2VYPA 1UA0A 1FTRA 4LF5F 3QPIA 4GKJF 1KHVA 4C97A 1VQ9S 1T44A 2H5JB 1M1KO 4FWSA 1M5HA 3LM2A 5LMUK 1V6HA 4LC9B 3FRYA 4FK2A 2DO0A 3FGUA 1FJEB 2LCWA 4M1KA 2HF4A 4DFPA 2OLWA 3CJKA 2JGAA 1U6BA 3WEEA 4ZVSB 2OH2A 1YDLA 3O5BA 5B8HA 4MHVA 1W7AA 2UVUA 3VHQA 5KPRA 5CD4H 3CCVS 3VQBA 4QPTA 5K20B 4DL0C 1XBWA 3AXMA 2KN7A 3OFEA 4WE1A 4MKVA 4PHPA 1VJQA 2Y0SF 2ZD1B 5AKYA 4KY3A 4F8RA 3IDHA 2B9EA 3EUNA 4L76A 4E7IA 1V97A 4M5IA 4A8QA 1OQ6A 3MMCB 2ZJRQ 4P9SA 1LAWA 2OSQA 2F4VJ 4O3RA 4FLWA 3AVBA 3LP3A 5AI8A 2AZ1A 3V9UA 3GCXP 3T5HA 1IG9A 1ZXOA 3BBCA 1IV0A 1BPEA 4O3PA 3PO5A 1HBUA 4ZLNA 3P1GA 1M5KC 1IBKF 1QAJA 2D4WA 2UUBJ 1QAIA 5A0LA 4NZ6A 2OPRB 3CD0A 4EELA 3CCUS 1FW6A 4YN4A 4OZNA 3VPZA 3L5KA 4I2GA 4FJ9A 4M3UA 3K1ZA 3O8WA 4FLTA 3UR3C 4CH0S 3HI0A 4F3OA 2OZSA 2QE5A 2NRZA 4RW4A 1MC8A 3UXPA 1RDRA 4ILGB 3BSOA 5FLXO 3QU9A 2RS8A 1FD2A 1RXVA 1QVGR 4FWLA 3G8QA 1JL2A 1SVDA 4Y2SA 4M41A 5IIOA 2IMOA 1VDVA 3MN6A 5J2JA 2GWKA 1T7PA 2IFXA 4HH1A 2P51A 2AKWB 1MDUB 3FNNA 4B3TK 2O4GA 3DDHA 3GU3A 1R0BG 1VSKA 2PYLA 4KHPF 2OGUA 9ICNA 4CEQA 3OR2B 3UMGA 4JI4F 2RN2A 3KWMA 5AZIA 4B3MK 2BJDA 3TADC 1RA6A 1XHXA 4RQ7A 1HUOA 2FGCA 3BH6B 3LDSA 2VQFJ 4YHHK 3LGNA 3R5GA 3PACA 4M3RA 5A8KA 4W92B 1S0VA 3MOJB 1ELOA 1ACMB 3M2VA 4KRWA 1NK6A 4HDGA 3JQJA 7ICJA 1BE4A 1BMQB 1U1PA 2DNPA 2OEJA 3TAMB 2XYGB 4B9SA 2UUAF 2MEWA 1KN5A 5AI6A 4L73A 3UCUP 1RWKB 4CJ4A 3EGWB 4EO8A 4Q2MA 4NCGB 3OYBA 4QIWF 2LXIA 3CGIA 1BD6A 3KUHA 5HMZA 2GCFA 2HQIA 2MLZA 4WFZA 5AZJA 5L9NA 3AVHA 4KGZB 4RW8B 3VA3A 4PXDA 3BYPA 4LFCF 3LDQA 2DRBA 1LFPA 3MC1A 4YCXA 1Z25A 5LXRA 3FGVA 1VQ6N 3ZZTA 1RYUA 2ZH4A 1EO1A 3QU4A 4HHJA 5GAEP 1K47A 5J1EB 5JMVA 3P83D 3HW8A 4NZ7A 1PIEA 1QTNB 4DSKA 2JEIA 4OX9J 1SIJA 3CCQS 2VCPA 4KV8A 3WDOA 2CYYA 4K4YA 1HKGA 3Q83A 4LBHA 1RBTA 2QWNA 2E8MA 5KG5A 1NGGA 3JSBA 3CCEN 3T79A 2K4PA 4J7CA 4JKDA 3HSDA 3EXCX 5HMYA 4NXMF 1ZQOA 4BC7A 1WEXA 2NRWA 3UKUB 1WCLA 5A2QU 2F4VF 1TAMA 3CCRN 2E66A 1VSLA 4BHQA 3LF0A 2NXCA 4P0QB 4ZCKA 2N1RA 2XY6A 3M4XA 2ZZMA 3PLAA 2EFOA 3OTBA 3MABA 2CPIA 4WJBA 1DGKN 4FLZA 3CDEA 3QMQA 4MF8A 3W62A 5KFTA 3C6HA 5B0EA 1NAQA 2E1RA 3VMFB 1KD1T 3VAMA 4KHRA 1YSJA 1ZOLA 2W2MP 4RU2A 3I33A 1RADB 3GLJA 4A2BA 4Y2VA 3AVNA 2HHPA 2PO4A 1NOYA 3MFIA 4Z6DA 1UPPA 3TP2A 3H0LB 3F2KA 1EKRA 3OYMA 2DGTA 2AIRB 2O4IA 2HK3A 3S7RA 2MQPA 3SENA 2KT2A 4WCEQ 3OBIA 4RW8A 5ALYA 4FS2A 2ZIWA 3AEVA 1WACA 1ZA2B 4BJQA 5HR6A 5CXTA 4FZZA 4PG7A 3CP8A 1V5IB 3ZZZA 2HFUA 1WG4A 3F5EA 2EFPA 2DL0A 5IIJA 1QHAA 3MM8B 2W41A 2PIIA 4BR5A 2MJNA 3EVWA 4BG9A 3DOMB 2IOFA 3NS5A 5B0FA 4ER8A 3PSPA 5F9LA 1R89A 3GFHA 2KIVA 1OSDA 2H3FA 3D67A 2CQ0A 3LAKA 1N61A 1X3NA 5DB6A 3RBXA 5JMNA 2OKQA 2XMTA 3AQFA 2Z7JA 1ZQUA 4DV1J 3FKBA 3UWTA 2UUCK 2FI1A 1JX4A 1Q81O 2FMQA 1H73A 3M8PB 3TTFA 2HS3A 2J4RA 3AO4A 2QWPA 5AZIB 2M52A 2ZG6A 2LU2A 2OHFA 2KZMA 3MN9A 2FMSA 3GYGA 4JLHA 2K60A 3WU2U 4QIWD 3O4WA 1FVSA 1Q9YA 2DT9A 3HHNB 4DDFA 2HHWA 5CYQA 2BABA 3QYYA 4CGGA 2L08A 9ICFA 2CZ9A 3DXMB 3WT0A 3SQIA 2M0GB 4P4MA 1WSEA 3F44A 4UZCA 1RTIA 1GNKA 2A2CA 2DIVA 4A2AA 3Q8KA 2G8FA 4WFXA 1RDAA 3B6OA 2EZYA 4QU6A 1WSHA 1RHJB 2P9IB 1UP1A 3L4BC 2NRXA 1TFYA 1KDHA 2XZWA 2C2ZB 4N77A 3WK6A 1T9VA 8ICFA 2CADA 5D78A 5IV4A 4FPAA 1R0AB 4FK4A 4HACA 3SCLE 3I8BA 4L8RB 3K5NA 1PILA 3PYFA 1UFWA 2Y1JA 1RJJA 1BI4B 3T9ZA 4PHEA 4CBWA 3M6ZA 1FE0A 1JLQB 2OO4A 4HEA9 1B99A 1N34K 5AI5A 2ISOA 3M8SA 1Y97A 3POTB 4BRMA 3OW2M 1LXNA 2RHSB 2Z2LA 1D0EA 1LW0A 3QYPA 3GIIA 1JKHB 1YITN 1TL7A 3DOKB 5F8JA 5CYJA 1P90A 4UT4A 3MXMA 2VA2A 5D46A 2W9CA 1BLUA 3SJJA 2BJ3A 1QS4A 2YKNB 2F2AB 2QKKA 3I9ZA 3CJ1A 4BVPA 2VJUA 2PGCA 4AXIA 2J9EA 1Q1KA 4DTMA 3AVIA 1LWEA 1UWAA 2LYVA 4X65J 2A40A 3NGTA 3RAMA 2KLAA 3MPUB 3AO5A 4M5MA 3MEDA 1N6QB 1KC8O 1QQMA 1ZM9A 1QAYA 4FO0A 3MDQA 1X0FA 3AUOA 2MKYA 3W61A 2OEMA 4O44A 2DRDA 2PC6A 4OKKA 3NEKA 4B9LA 1FFGB 3D6TB 4K0KJ 3GE1A 2ZHBA 5HBMB 1NM1A 2FLNA 3HP9A 4DR1F 1NZ8A 2YJFA 1KLMB 1J5OB 3L4IA 4IFYB 1CXUA 2RQCA 2ZH2A 1L6NA 2O66A 2IPOB 3OFGA 5D8HB 4X64J 1WAFA 3H5UA 2CJAA 3AM9A 5KT7A 4OYXA 3W2WA 3DLGB 4NYPA 4GXKA 4K5RA 3GV7B 3KLFA 4HVJA 3MR6A 2HURA 1PUZA 3HVTB 4Z4HA 4L3KA 2MTLA 1FDDA 3FSXA 2R2TA 3ZCMA 4WFNL 5KRTA 4DPUA 2E3TA 1FJCA 1YT3A 3AO2A 2ITGA 4RQ6A 1JJCB 2NYHA 2HQFA 4LMZA 4BDZA 2WVFA 1QDUB 4JI6J 3PYEA 3QEXA 2O8DB 4ECSA 5RUBA 5AKXA 5F2RA 5AM4A 3A3OB 4LF2A 4TNOA 2E44A 3O0FA 5BPLA 2Y8WA 2QTDA 4OHWA 2HYIB 3J7YP 5KFBA 3NCIA 3D2SA 4C0HA 4I29A 1ZRMA 4FWPA 5KFVA 4QQBA 2Q6BA 4DR6K 1Q7YT 2CQGA 1G1XA 3HL8A 2WF9A 4IFVA 3TU5A 3H8SA 4FW1A 4I9LA 5BOLA 1WCNA 1YHQS 1GMWD 3CUNA