2XY7A

Crystal structure of a salicylic aldehyde base in the pre-insertion site of fragment dna polymerase i from bacillus stearothermophilus
Total Genus 188
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
188
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHAAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWALERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGEELAEQLRTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKSKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQARLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Reversible Bond Formation Enables the Replication and Amplification of a Crosslinking Salen Complex as an Orthogonal Base Pair.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords DNA POLYMERASE I
total genus 188
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2010-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2xy7A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 2xy7A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2xy7A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2xy7A01
4CGFA 3QETA 2NRTA 4RW6A 3NH2A 4CJWA 5KFXA 3FDSA 1DTQA 4RQ8A 4ELVA 4ZHRA 1TL1A 4DTRA 1TKXA 3NF8A 3AVMA 3ZDDA 2O4GA 1R0AA 3V4IA 2AGPA 3PW7A 4F93B 8ICAA 3TI0A 1NOZA 3VA0A 1JXEA 3AVJA 1BQNA 5CJ7A 7ICUA 7ICRA 1ZQAA 3RJKA 2FLNA 4DTPA 4CF9A 4F4WA 4MFCA 1GOAA 4PHAA 5D49A 1FKPA 2ZD1A 4L8RB 2BPFA 2MUTB 5CA7A 4F4YA 1IM4A 2FMSA 3RH4A 5KFHA 1SZPA 4XIUA 3OS2A 3JPTA 1Z00A 8ICZA 3SJJA 5CR0A 4QWAA 1CXUA 4Q5VA 3C2KA 2ISOA 1T05A 4CJVA 4RQ6A 2HVIA 2PFNA 4CGHA 4QWBA 1RYRA 1Z3EB 2A1RA 9ICUA 4CJ5A 1PZNA 4YFUA 2VG7A 2PFPA 4KB1A 3HWTA 4NM2A 4PGYA 3OJSA 5J1EA 4QZBA 3PX6A 3LAMA 3SPYA 3HL8A 4FLTA 1BPBA 2ZJ5A 4IQWA 3K2PA 4OGCA 4KITB 4C8NA 2P6RA 1NOMA 5KFDA 1MU2A 3OYLA 4Z0UA 4QCLA 3ALYA 5HRPA 3OJUA 4J9KA 4K8ZA 4O0IA 3H8SA 5DGAA 2XGPA 3ISBA 3VQDA 2IC3A 5KT6A 1KDHA 1QE1A 4M9JA 4Z6CA 1JMSA 2KW4A 1ZQRA 4ELUA 1JXLA 2FBVA 8ICQA 3AO5A 4M0AA 3QEIA 8ICJA 3KLFA 4DFJA 1ZQHA 1A5VA 3JPSA 2KZ3A 2R8KA 4GXIA 4BACA 4P4PA 4JV0A 2AGQA 3RJJA 2G8WA 2ATLA 4FZZA 4IKFA 4Q8FA 4FYDA 7ICPA 4E3SA 5J2FA 4I7FA 2RKIA 2BCSA 4YD2A 3V6HA 4KLSA 4QZ9A 4CCHA 3M8PA 1K1QA 3NE6A 3PX0A 1TK8A 2IHMA 1ZQUA 5J2EA 1WSEA 4CJ4A 4O44A 1S5JA 2BGWA 1VSLA 4E7JA 3QIOA 2P51A 3Q8RB 3ZDCA 5KI6A 1BHLA 4CEOA 2C28A 1XSLA 4O5EA 1RILA 3OVNA 1ASUA 1ZETA 4EYHB 3TABA 3OYCA 2X78A 3DLHA 3RB6A 5J2NA 4J9RA 3KHGA 3AO3A 2IA6A 3ISDA 1MQ3A 4RW9A 4ZH4A 5KFKA 1HQEA 4BE1A 3EWAA 3FYHA 2BGGA 4CEQA 2YNHA 4AHRA 4QZCA 3QNOA 4W5TA 1UA0A 2JEIA 2ETJA 1S6PA 5J2KA 4KLQA 4E1NA 4KN4A 4ECQA 4DOAA 2BCQA 3U3GA 1HJPA 3MBYA 3TQ1A 3MEGA 4ECUA 4KLEA 3L2RA 1QSSA 4ECZA 9ICQA 2JZBB 4DFMA 9ICRA 4QOZB 2VG6A 8ICTA 5E41A 7ICGA 3D45A 1QSLA 1MQ2A 4YR3A 4J9PA 5KG7A 3KTQA 4FJ5A 4Y1DA 3LWLA 4X5VA 4KLOA 4N47A 2YNFA 3C6UA 1QSYA 2HHXA 1GOBA 4I2JA 4FJ8A 4BWMA 4HVJA 5DQHA 3PUFA 4AHTA 4IBNA 4MFFA 3LDSA 1RBVA 3MR5A 2OWOA 3RJGA 3QEVA 5DB9A 5FDLA 1C0UA 4LH4A 2A1JA 3OYAA 4PHEA 3PO5A 1VSMA 2IMWP 4DFKA 5KTQA 1ZBFA 4ECXA 4CGGA 2R8HA 3MDAA 4H8KA 2XY8A 3PO4A 4JS4A 3L2WA 2V9WA 2B21A 3L2VA 3AA4A 1EXNA 1NJWA 4CHPA 5KFTA 3HM9A 3TAGA 1LV5A 1KFSA 3VQCA 1UA1A 1XSNA 3RH5A 7ICKA 5KFSA 4J9LA 2W9CB 2I9GA 4YN4A 4R5PA 4RG8A 1HMVA 2OPRA 2ZJ8A 4G3IA 4EYIB 4GMJB 3VQ4A 3DRSA 2GWSA 4YD1A 3KD5E 5KT2A 2BE2A 4FK4A 5HHHA 4YQWA 5DQGA 4KHSA 3Q8PB 3WNGA 3ZT1A 4UB5A 1JKHA 4FJGA 1S76D 3OSPA 5CYQA 3PW4A 5DG9A 1ZYQA 3ZD8A 3RH6A 3KIOA 4RNNA 3Q8MA 1S0VA 3DLGA 5KFGA 2NUBA 3ZSQA 1ZQIA 4B8AB 3B0XA 3GQCA 3PMNA 1IG9A 1IO2A 4CJKA 1F21A 4MEXA 4CHZA 3JPPA 4O5CA 1QTMA 1RTIA 3HP6A 1RT7A 1HYZA 4NCAA 1S6QA 1VSFA 9ICVA 5KFOA 3RR8A 4ECRA 4DG1A 1IKWA 1HRHA 5T7BA 4O5KA 1WSGA 4HUFA 1WAJA 3S3OA 4M3WA 3SV4A 1Q8IA 1T3NA 1JLFA 1J9AA 1KVCA 1U9LA 3TFSA 5KFMA 3O3HA 2QK9A 4F91B 1RPLA 3M9MB 3LP2A 4FCYA 4CF0A 2M9NA 1H38A 3B6OA 2W9BA 4CIEA 1ZQSA 1AROP 4XQ8A 4E0DA 4KRFA 1QS4A 2AQ4A 3O3FA 9ICHA 3T19A 3IG1A 3JPNA 7ICJA 3ZT0A 5KT7A 4DF4A 5KRTA 3H7IA 3C23A 4EP4A 1S1WA 3OHAA 4NLKA 3T5KA 1HUOA 1N56A 2HMIA 3UPQA 4RQ1A 4KHNA 1Z25A 3DOLA 2WTFA 2ZQBA 4OPJA 1T8EA 4LSLA 4FJMA 5KFPA 2AGOA 2J6TA 2OZMA 3V7LA 2Z1JA 2IBKA 4DU1A 2ALZA 4BE0A 3AVNA 1KEJA 4R64A 3SYZA 5KG6A 2W9MA 1KFTA 5KRSA 1BIUA 3AVIA 4HUEA 4KLFA 3QO9A 3GV8B 4M3ZA 4C8MA 1BPDA 4ED1A 4DSKA 4LVSA 1IKXA 2VA3A 3QEWA 1ZQDA 4CGDA 3BDPA 4AHSA 3OYFA 4DTNA 1C1CA 3ZD9A 2W8KA 3QEBZ 1BCOA 4CJTA 2W9CA 4F2SA 4KTWA 4K4IA 4TQRA 2QKBA 9ICGA 5IINA 2LYHA 4I9QA 4NLNA 3HVRA 4B9NA 4IFVA 5KFEA 3TAPA 4NCGA 4P2HA 4DL3A 1CUKA 1BISA 1WSFA 4I2GA 5CZ1A 4JWMA 3AVCA 1TKDA 3HVTA 4I27A 4NM1A 2VWJA 5CB1A 5BOMA 1RDDA 4BE2A 2RPIA 3CFRA 4FLVA 5K14A 2ISPA 3NF9A 3OY9A 4IQTA 3GIIA 1IXRA 4UB2A 3MGIA 3N4MB 4RPXA 1LAWA 1A76A 7ICHA 3U3YA 5KFAA 4JS5A 7ICFA 3PR4A 2GV9A 2D0AA 3MR6A 2PFQA 1S9FA 4PA1A 4NYFA 4FZYA 5KG5A 5J2CA 1SL1A 9ICXA 4C8KA 3OYDA 3KK1A 2JEGA 1VSEA 5IILA 1L5UA 3K57A 4RQ3A 3MGHA 2R7YA 1EXQA 4FS2A 1S0OA 4CHNA 4KHUA 3G10A 1ITGA 3RJEA 4DTJA 2HNYA 4YR2A 4HYKA 2EX3A 3V1QA 5J2IA 5JUMA 4KMUA 3MDCA 8ICUA 1TGOA 3SPZA 3AVFA 1U4BA 2P5GA 3BQTA 7ICQA 4GLXA 2XC9A 5J0SA 9ICMA 3Q8QB 2X74A 2W9AA 3ITHA 3MABA 4PHDA 1KLNA 4DWIA 4DFPA 3SUOA 4QZAA 1RNHA 4KHQA 3IM1A 4M42A 3DOKA 1Y88A 1YTUA 1CEZA 1ZBHA 4XRHA 1ZQEA 2H5XA 3EYZA 2W42A 1B92A 2BQUA 2HVHA 3LANA 1YT3A 1BQMA 1EP4A 2BCVA 3PV8A 4DQSA 8ICHA 9ICLA 4CK1A 5CWRA 3BGRA 4DLEA 3E01A 3RTVA 3C1YA 3NCIA 4YG2A 5L1IA 3U6FA 3TARA 1S9GA 4FM0A 5TZVA 3JPOA 3L3UA 4DTUA 2RN2A 3LALA 4UB3A 1RTDA 4DS4A 3FFIA 5CZ2A 4RQ7A 3K59A 3RBDA 2D0BA 3EPGA 7ICSA 4KREA 3OHBA 1JLGA 4F4XA 4LD0A 9ICNA 4R8UA 4KLJA 3OYIA 2KFZA 3OSNA 1ZBIA 3DI6A 2UVVA 2IOCA 4KI4A 2ZUDA 1WCNA 3EZ5A 5JS2A 4CEDA 5DDYA 3V9XA 1REVA 1XHZA 2YKMA 4UQGA 3V9ZA 3K5OA 1JLEA 4CF8A 3OYNA 2XRIA 3JSMA 3ORYA 4YVZA 4JWNA 1I39A 4DQQA 3T5LA 3G6XA 1TV9A 3A2FA 4PGXA 4B9TA 2WOMA 3L2QA 1U48A 2ZTEA 4CK3A 2P66A 4CJEA 3K5LA 1TL3A 4OKKA 3KHHA 4QZIA 3SUNA 2BKEA 4IR1A 1HNVA 1XI1A 1TFRA 4J9OA 4I2DA 2XY5A 4F4KA 4E19A 3ZDBA 2AJQA 3CG7A 4I28A 4DO9A 3AVBA 2KFNA 3TFRA 3QE9Y 2BHNA 4I2AA 5D3GA 3C5GA 2BCUA 3ZT3A 4O3QA 5KG1A 3NF7A 1VRUA 1BPXA 4BDPA 3NAEA 2ASJA 2G8IA 1RDCA 4CJFA 4DSEA 2FLPA 3RRGA 4KLUA 3SQ0A 3ISNC 4KO0A 4YNQA 1T03A 3ZSVA 3B0YA 1LB2B 4M41A 1JIHA 2X6SA 8ICBA 4ED0A 2E6MA 3HK2A 2YNGA 4FO6A 2FC0A 4DL7A 1C1BA 1Q9XA 2IAJA 1S1XA 5C42A 4M9NA 4PY5A 4C8LA 3LWMA 3LPTA 2D0CA 4NLZA 3P5JA 2AU0A 1ZQCA 4M45A 5KFNA 4N76A 4QW9A 1W9HA 2Z1HA 4CFAA 8ICOA 5BOLA 2W9BB 2Y1JA 3V6DA 3CYMA 3C95A 4AHVA 4GXKA 4M3XA 5J2DA 4UB1A 1ZQNA 5L1JA 1COOA 1J5OA 4HTUA 1LW0A 2QXFA 3TAMA 5KFJA 3K75D 3V72A 1BGXT 3ULDA 3QINA 1ZQVA 4RNOA 5KGWA 2J6UA 3CQ8A 4ZTFA 3H40A 5DK5A 3KHRA 2XCAA 3S3MA 4R8UB 3C2MA 3V1OA 3VQ7A 1ZQBA 8ICSA 3AVGA 4B9SA 3M8QA 4FBTA 4MQ3A 1BPYA 4I2QA 4DL2A 5HNKA 3CFPA 8ICMA 4DQPA 3MXMA 1KCFA 1EKEA 4DL5A 2ZUCA 4MF2A 1SUQA 1X9SA 4CF1A 1HNIA 1TVAA 5J2AA 4KLIA 1FXXA 4JV1A 4R65A 2PYLA 2DFLA 3UXOA 4KN7A 1XO1A 1L3VA 2DFFA 4QWDA 4OJRA 2X6NA 4Y1CA 5KFWA 4AHCA 5IIJA 4O9MA 7ICEA 4UAZA 4FS1A 1RBRA 3LZIA 4RQ4A 5J0RA 1O1WA 3ZSYA 2NRXA 3PX4A 1WLJA 3MECA 9ICPA 2HHWA 2YNIA 3AA3A 4KB0A 4E7HA 3MEEA 4GVMA 1B9FA 1UAXA 4F5RA 1NK9A 4M3TA 2JZBA 4ED8A 4O0JA 3V6JA 4Z4FA 4FJNA 1JLQA 4ED3A 4AH9A 2YV0X 3QLHA 4B8CA 2G8VA 2F96A 5IIMA 3OYEA 2XGQA 4HCBA 5HBMA 2BDPA 4J9MA 4IG3A 4J2AA 3GV7B 5DQIA 4EP5A 8ICLA 2VWKA 2ITGA 4TUQA 4UBCA 5KG2A 1NKEA 4I2EA 2FPLA 4CF2A 4BXOB 4FM2A 3ZSZA 4F2RA 3QZ7A 5DMRA 1HUZA 4OLBA 1DLOA 2FLLA 4DF8A 1FKOA 3O4QA 4FLWA 4YMNA 2WONA 2OZSA 1NK8A 3P1GA 1MC8A 1VSKA 5J0UA 3K5NA 2A1JB 2BQ3A 3GIJA 1FK9A 2HNDA 1UWBA 3SUPA 2PI5A 4P4MA 4K4GA 4YMMA 4J2EA 2HW3A 4F5OA 3SI8A 8ICPA 3GFKB 3NF6A 2MUTA 4WE1A 4QZHA 4JK1A 4RPZA 4MEYA 1KVBA 8ICEA 3VQ5A 4TUPA 4I29A 1EETA 2G8FA 8ICXA 9ICAA 4R66A 1NK7A 1NJZA 1RT1A 3WNFA 4RUCA 3PW5A 5HMLA 3AVAA 3OYMA 1HPZA 1D8YA 4IR9A 4FW2A 4F50A 5KFUA 4I9LA 1NK0A 9ICKA 2P5OA 2F1HA 3QEXA 3V9WA 4F4ZA 1VSDA 4PGQA 4ELTA 3DLRA 5IIKA 5J2GA 2PFOA 4IRKA 3RB4A 4FJJA 5L9XA 1BI4A 3Q8KA 2E6LA 2F8SA 3HO1A 5BPCA 1BPZA 4E7LA 2OPQA 3HW8A 3GV5B 4ECVA 3RMBA 4FJKA 2B5JA 1VK0A 3NBPA 3Q8LA 3M8RA 3IHQB 4Q8EA 5HP1A 1WSHA 1ZQLA 1XWLA 1B43A 4FLXA 2Q3SA 1N5YA 4GC7A 4RT3A 3AO2A 1TK0A 3S9HA 3GIMA 1XHXA 1BVSA 1UT5A 4K4HA 3HP9A 1D5AA 1L3SA 4CEZA 3KK3A 4Z4HA 2YHBA 2FBTA 5J0YA 3VQPA 3MXJA 4Q44A 1KRPA 2PZSA 2AQ0A 1RBUA 4JUZA 4UAYA 4IQUA 1RT5A 4E89A 1LWEA 8ICKA 4IG0A 2JGUA 4M04A 3VQBA 4FM1A 5KFZA 3RWUA 3JYTA 2FMQA 4M2YA 4FK0A 1S0MA 4HHTA 3DLBA 4KTZA 3MXIA 9ICTA 5HRRA 4ECTA 4Z4EA 1IH7A 3QIPA 2V4QA 4RUAA 1A77A 8ICWA 5D46A 4DSJA 3VQ9A 4F5QA 3L2UA 2Y1IA 3RAQA 1XSPA 1WAFA 2BQRA 4OGEA 3G6VA 4EZ6A 1S1TA 3JPQA 3Q8SB 4KLHA 5J2PA 4DTXA 4FJ7A 3SQ2A 1TKZA 5KG4A 1RTHA 2PY5A 5DG7A 3N97B 4MFBA 4QZEA 3EY1A 4O3SA 4ECSA 1CZ9A 3KJVA 1TVRA 1RYSA 2HHVA 3NGZA 3KLHA 3GDXA 3KD1E 5DBAA 5KFRA 1D8LA 3E2EA 1XC9A 4I2PA 3M9NB 3I0SA 2C22A 4FJHA 4GXJA 4F5NA 4I2BA 3ASMA 1TAUA 2DFEA 1WSIA 9ICCA 1ZQKA 5KT4A 1YTAA 8ICIA 3H4BA 3LAKA 4CJRA 1NK6A 1BI4B 3LPUA 1RXVA 1ZQPA 4RQ2A 2PYJA 3ISCA 2RDJA 4EEYA 4Q45A 3AVLA 4N5SA 3AVHA 3C21A 4CIFA 4B9VA 9ICIA 3SV3A 9ICFA 4CJLA 4FLZA 5KG3A 4XA5A 3OYBA 4DL6A 3OS0A 3TANA 3UXNA 3SZ2A 3QERA 5KT3A 3V1RA 2R8JA 1HYVA 1RDBA 2I5JA 2GUIA 3CFOA 4O3OA 3TAQA 5DLGA 4LZDA 2HB5A 1X9MA 1D9FA 1U04A 4KHYA 1UT8A 3M9OB 5EOZA 4CGIA 1BIZA 4DL4A 4B08A 3RB3A 2HHTA 4EBCA 2BPCA 4LY7A 4I2HA 5EWFA 2Z1GA 4DSLA 1X2IA 1A5WA 2V4RA 4RW7A 3V9UA 3ZSOA 4QZDA 4J9QA 4OVLA 1A5XA 2QKKA 5HRSA 2Q0ZX 4ID1A 1RTJA 3VA3A 4CJQA 5FRNA 3AU2A 3QEAZ 5KFLA 4CJSA 4I2CA 1RDAA 4KLGA 3TAEA 2JLEA 1SL2A 3RJHA 3BQ0A 4RPYA 5C5JA 1ZQWA 3O4NA 4FJIA 2ZE2A 9ICJA 4ECYA 3AO4A 1K1SA 4H4MA 1LW2A 1CLQA 5JS1A 3WNEA 2E4LA 2G8KA 3H4DA 4RNMA 2OPSA 4TURA 3UXPA 4NY8A 1RXWA 1C0MA 3NH1A 1X9WA 4M9HA 3PY8A 4AHUA 4JRPA 3V7KA 4Z4IA 4Z6FA 4M3UA 4N41A 4O3RA 3ETLA 5CHGA 5J0WA 4CJ3A 4QWCA 1D9DA 4KLLA 4CESA 2HHUA 3RRHA 4W5OA 3T1AA 4J2BA 2BPGA 2ATQA 3IAYA 1ZBUA 4DOBA 3ZT4A 1S77D 2BANA 5SZTA 2NRVA 5C25A 5HMMA 2RDIA 3V7JA 2B6AA 2XHBA 4KTQA 1VRTA 3AA2A 4YFKA 1JLBA 2KZZA 4Z4CA 3G6YA 5CY4A 2KQ2A 3OS1A 3DLEA 2IDOA 3SNNA 4CJUA 4PH5A 3QESA 1G15A 5HHIA 1Z26A 2OA8A 1ASWA 1XS9D 3K58A 4M9LA 4YCXA 3RJFA 4FJLA 3RAXA 4RZRA 4CGJA 4FXDA 2DY4A 3PW2A 2KTQA 1S10A 3TR8A 3KLGA 4ED7A 1HJRA 3NGDA 3H8WA 4C8OA 1IKYA 3OYJA 2ZTDA 3LZJA 1S9EA 3AO1A 1U47A 4J9SA 4NXZA 5EWGA 3EPIA 1RT4A 1DOQA 1JN3A 3THVA 3PNCA 1SKSA 4UAWA 1ZQGA 3HPHA 2IS3A 4M6WB 1RT3A 4B9LA 3VN5A 4DMNA 2B4JA 3IRXA 3TWHA 2LSNA 5HLFA 1B9DA 4QZFA 3RMDA 5KFIA 1DTTA 3ZSRA 1HYSA 3GILA 4M9GA 4YMOA 4Z6EA 4FJXA 3HYFA 4CHOA 5J2MA 2YKNA 4AILC 3RBEA 2OYQA 4QAGA 3F73A 4BWJA 1BCMA 4KPYA 5KFFA 3VQQA 2C2RA 1C7YA 4KLMA 3ZCMA 2FPKA 3KKSA 1NOYA 2XCPA 3P83D 7ICTA 3SUQA 1QHTA 4NCBA 4TQSA 2HNZA 3SCXA 3DM2A 3VQ6A 3OYHA 4J2DA 2F1IA 2JEJA 3SI6A 3S3NA 3MR3A 1ZQZA 1ZQXA 4HUGA 3M8SA 3UQ2A 1T4GA 5C24A 4E1MA 3O3GA 2DFHA 2UVWA 4OKJA 3DRPA 5F9LA 1CZBA 5J2QA 5I42A 3D0PA 3UQ0A 8ICCA 1WN7A 2KN7A 3K5MA 1LAVA 3HJFA 3DLKA 4RT2A 4LSNA 5J2BA 2ZUBA 2VANA 2O4IA 4CK2A 3GIKA 3C5FA 2HHQA 7ICOA 2NRZA 4UBBA 1JLAA 4ZTJA 4R63A 3WNHA 9ICEA 4TUSA 3PMLA 4M3RA 5I3UA 5DBBA 2DTUA 4GC6A 4O4GA 4MF8A 2YHAA 3CM6A 1IKVA 2DPJA 2D5RA 5DGBA 3I0RA 4FLUA 4B9MA 2ZTCA 8ICFA 9ICSA 1LWFA 5KFCA 1NKCA 4E7IA 5IIIA 3VQEA 3MFIA 3PW0A 3UIQA 5DBCA 4DTOA 4PQUA 4W5RA 3NGYA 4I2FA 2VG5A 1NK5A 4KV8A 2R8GA 4ED6A 2UVRA 2VA8A 1ZBLA 4PUOA 3OYGA 4OLAA 1RCHA 4DU4A 3OYKA 2FPMA 4DQIA 1JL2A 3RB0A 4CHYA 5DB7A 3V6KA 8ICGA 4O5BA 2XO7A 4KI6A 1C6VA 3K4GA 4GW6A 1ZJMA 3C2LA 1KFDA 4CHQA 3RMCA 2OPPA 5FRMA 4KAZA 4CEBA 1V9PA 1X1PA 4FW1A 4LH5A 2VA2A 4H4OA 3KK2A 3I8DA 1W0HA 3ZSXA 3L8BA 2R8IA 4FK2A 3LK9A 2IHNA 1L3TA 3ZT2A 1S0NA 3AUOA 4CFCA 1RBTA 1N6QA 1BPEA 4YP3A 3HPOA 1RT2A 4EZ9A 4BGDA 7ICMA 1Q9YA 1ZQQA 1WSJA 3L3VA 4IDKA 1U45A 4XUSA 2JEFA 3AA5X 3B6PA 3IS9A 3KLIA 3PVXA 3HSTB 5KFBA 1U49A 4DSIA 5KGXA 1L3UA 1RT6A 4EBEA 4PPXA 4KLDA 7ICNA 4YR0A 5HP4A 3QNNA 2XY6A 4LZGA 3C1ZA 3C94A 5KFYA 5DB8A 4KLTA 1S1UA 1KTQA 4DTSA 3SQ1A 3H8JA 5HROA 4FLYA 9ICOA 3BQ1A 4DEZA 4CERA 5IIOA 7ICLA 4FZXC 4Q43A 3NHGA 3TAFA 3DMJA 1JX4A 4KHWA 4CJPA 3ZDAA 4F3TA 1SV5A 8ICYA 1QLNA 5SWMA 3NDKA 3RR7A 7ICIA 4K8XA 4FBUA 1K6YA 2BCRA 4DU3A 1JXBA 4PWDA 5KG0A 4ECWA 4F5PA 1TK5A 5DDMA 1J54A 3MFHA 4O3NA 1JL1A 4RW4A 5CP2A 1C0TA 1QQCA 4RQ5A 3H08A 1Y97A 4O55A 1I3AA 4DTMA 4P4OA 1NK4A 1ZQOA 1SL0A 2F8TA 4TSXA 3SQ4A 2FMPA 4M3YA 3CM5A 4CEFA 1WNSA 3HPGA 1B22A 1UOCA 2F1JA 4FJ9A 3BJYA 4DLGA 3AV9A 5D4BA 2PXIA 5J29A 2FBYA 4J9NA 1RBSA 3NFAA 5KFVA 5DKWA 1VSJA 5J0PA 4M47A 1GOCA 3JPRA 1SKWA 5FROA 4DQRA 2GBZA 3V81A 4BXOA 5DB6A 3LP0A 4EBDA 5L1KA 4B9UA 3T3FA 4RQ0A 4M6WA 4QZ8A 5J0QA 3VQ8A 4FVMA 1TV6A 3AU6A 1S1VA 3VQAA 1KSPA 1HQUA 1ZQTA 4N56A 1DGSA 1BL3A 2Z1IA 1CXQA 2DPIA 1ASVA 3KLEA 2G8UA 5J2JA 1N48A 5HRNA 3OGUA 2ASLA 3NTUA 1VSHA 4Z6DA 7ICVA 2I1QA 2P6UA 4JRQA 4CEEA 1VSIA 4W5QA 4BDYA 4CIGA 2C2DA 4RU9A 4IRDA 1S97A 4O3PA 4JLHA 3T5HA 3QEPA 4KKOA 1SKRA 4UB4A 4IRCA 3HX0A 5CYMA 2FBXA 5DG8A 4CECA 3MEDA 3NGIA 4F3OA 2XY7A 1ZQYA 2J6SA 1NJXA 1ZQJA 3RMAA 4DOCA 1LWCA 1JLCA 4ICLA 4CE9A 4Q0BA 1T7PA 1ZQMA 2UVUA 8ICRA 3KKRA 2W8LA 4I2IA 5EU7A 9ICWA 1KLMA 4CEAA 5KT5A 1YVUA 5KFQA 4BDZA 4DS5A 2ZJAA 4CFDA 3QZ8A 5EWEA 1NKBA 2NRWA 3ZDEA 1RZTA 3MAQA 3MR2A 2HHSA 2ASDA 4CFBA 2P1JA 4OPKA 5J0TA 5DLFA 3LP1A 1WCLA 4G1QA 4ID5A 5J0XA 4ED2A 3G0ZA 4B3OA 4W5NA 4KFBA 3F9KA 4QWEA 4F8RA 1XU4A 1ZQFA 3DRRA 2RF2A 3NH0A 9ICBA 4F92B 1NJYA 5L1LA 3LP3A 4PHPA 3KHLA 4OKEA 4MFAA 3RJIA 4NLGA 4E7KA 8ICVA 4IFYA 5J2HA 3DYAA 5F9NA 4Z4GA 4NYNA 3HT3A 1ZJNA 4QZGA 4YXMA 4HCCA 4JV2A 1MSWD 2G8HA 2KZMA 4QW8A 2BR0A 4DSFA 2PI4A 1J53A 3BQ2A 3V9SA 4IQVA 3EW9A 1EX4A 8ICNA 1KVAA 3LDAA 3AVKA 4YXJA 2C2EA 3HXMA 3C6TA 3T5JA 1C1AA 1TAQA 3ZSWA 5J0OA 4RW8A 2A1SA 2EHGA 2MAXA 1Z00B 3PR5B 1TKTA 2IGIA
chains in the Genus database with same CATH superfamily
4X65F 3PRBA 2DNYA 4K4WA 3NH2A 4DV0K 4PUOB 4A8EA 1DTQA 4RQ8A 3KK2B 4LF8F 4DZDA 1KAXA 3NF8A 3AVMA 1BDGA 1WG4A 3V4IA 3AT1B 4F93B 2YH0A 3TI0A 5HQMA 2E2NA 5ALJA 3IDWA 2OHFA 3VA0A 5B0AA 1H98A 4LF9F 1JLCB 5CJ7A 2P2CB 7ICRA 2E66A 1HEKA 2FLNA 4DTPA 2YX4A 2VFRA 1FKPA 2H4YB 3CEDA 2E5JA 4WE1B 4UAVA 2QL9B 3KLHB 2GWJA 3CIZA 2RS2A 4ZITA 3K0JA 5KFHA 1KOOA 2MHEA 2Q97A 3SJJA 4MMOA 4QWAA 5K8OA 2ZJQL 3GG4A 4RQ6A 3ILLA 2W2OP 3CSKA 1Z3EB 3AQFA 5ETRA 4W4MA 2A1RA 2F40A 5AQSA 4RO0A 4YFUA 2R7XA 4KB1A 2E1RA 4B1YB 2O8FA 4YOUA 3WKDA 4DR5K 4IO8A 2D0OA 1N5XA 4FLTA 4LFAK 4NEZA 3F2DA 3H8MA 1HLUA 4IQWA 2KSOB 5AKZA 4KITB 5BN8A 2P6RA 1NOMA 4WFNL 2H3EB 5EE0A 1HIYA 1RADB 4K8ZA 4O0IA 1LEOA 4IYQA 2QMWA 1S5LU 5KT6A 4O44B 2B7CB 3B54A 4M9JA 3VGKA 1VQ9S 3HSDA 2DHGA 5GAHU 1ZQRA 1TL7B 3TA0A 1UJ4A 2POKA 1N5WA 1RWOB 2EDUA 1RCXB 8ICJA 3F56A 2I6XA 4B3TK 2W11A 2AIRB 5AQZA 2G06A 4FZZA 5AXLA 4E3SA 2FJBB 3H20A 3N0VA 5AQQA 2BCSA 4KYZA 3V6HA 2DH8A 2F63A 4KLSA 2MEWA 1K1QA 5H9FK 2IHMA 2Q0UA 3QDKA 2DCUB 3IBCB 2BGWA 4ILRA 3UDEA 3G4SN 3RZAA 4IH5A 5K8NA 2K4PA 2C3MA 3A12A 3AQOA 3IR5B 4CEOA 1XSLA 1IN0A 4P7TA 2WB1F 4JOUA 4V1Ak 2FTRA 2DO0A 1DTTB 2FHMA 5JVHQ 3WX4A 4EEKA 3OYCA 2NO5A 2X78A 3RB6A 1T3VA 2FZCB 2N1RA 3VOVA 3AO3A 3ISDA 4RW9A 2EBEA 5J1PA 3KLVA 3FYHA 1Q8BA 4TYBA 1M5PC 4AHRA 4QZCA 2JFKA 5LMUJ 4W5TA 2JEIA 3QX7A 3D6MB 2P9EA 4QIVA 4E1NA 3TWZA 2QT7A 2CPHA 2MLXA 4CD1A 2H3QA 3MEGA 2FDRA 1ED1A 1S1WB 3DLLL 1UFLA 1R8CA 2VG6A 2QWPA 3TR5A 3K0SA 5E41A 2IVYA 4F0KA 3D45A 3VENA 4WQ5A 2YI1A 2HRUA 3IRWP 3BO2A 4EK2A 1VJ5A 5JVHL 2DR9A 1R89A 3KG4A 4X5VA 3K9KA 5IT0A 3J81Y 4BRNA 4UOGA 3D67A 3H2VE 1XMOJ 5FJ4A 1RWNB 2HRYA 3R7BB 5HANA 3GDQA 3NRZA 3ZZOA 3O8WA 3PUFA 4LF5K 2F9TA 4IBNA 2ZNZA 3OFHA 2DRAA 4MFFA 1M5SA 5FLXO 4PL1A 2QA4S 3MR5A 2OWOA 1GLDG 4USHA 4OFZA 1WEXA 2VQFK 4BC3A 4WK1A 2SXLA 4LH4A 1C0FA 3OYAA 3CPWR 5T7LB 2IMWP 4AFFA 6AT1B 1XNQJ 2IOFK 3B8HA 4CGGA 1F9HA 2IDLA 3W5XA 1QVFM 1T9VA 3MURP 4CF5A 2XY8A 2LMIA 3G2XA 2E9ZA 4NXMJ 2VQEF 3M3ZA 2V9WA 2UUCK 3L2VA 5BYSA 1EXNA 4Y2TA 1NJWA 4OYBA 3NMAA 1B4FA 5KFTA 4ZOSA 1X8DA 4RUHA 3HM9A 4WFXA 4DN9A 3VQCA 3RH5A 4J9LA 2I9GA 4NMXA 4YN4A 4R5PA 1HMVA 1BUPA 4G3IA 3CERA 2VJVA 4GMJB 4RG8A 4IUFA 5AM2A 2GHPA 4FK4A 4Z2XA 2WOMB 3PJXA 2CGJA 5ALEA 4M7XA 1Z6RA 1HBMA 3NNCA 4UB5A 5IWAF 6FDRA 1DXSA 2Q36A 2OAUA 1CJKA 3NS6A 1S76D 3OSPA 3AD8C 5HQ8A 5AZJB 4OHVA 5CYQA 3R5CA 2HOQA 3PW4A 5DG9A 3ZD8A 4RNNA 1S0VA 2P9NB 3K2YA 3I6PA 1L7NA 5AKHA 1QY7A 3PMNA 1IG9A 1IO2A 2AEJA 4MEXA 4CHZA 1DHMA 2EZZA 3KJFB 3HP6A 1OVYA 4NCAA 1RBOB 4C0OC 2GOLA 2YMPA 2OTLN 3ILIA 4QIWF 3GJTB 5F3XB 3MOJB 4I6MB 2O3DA 3DWLA 1W2IA 1Q8IA 1T3NA 2ZH9A 1KVCA 1U9LA 2NZCA 3ENWA 2XVTA 4MK9A 2ITMA 3R1XA 2L3MA 3M9MB 2HWHA 5I42B 3M7VA 3LP2A 2X3DA 1NO8A 1X5SA 2QLFB 3H59A 4CF0A 3TZWA 2M9NA 1FDAA 3P6YC 5JJBA 2FQQB 5A2QY 1R0AB 3Q86A 3GONA 4KRFA 9ICHA 1TELA 1KQSM 2LYVA 3T19A 2A5XA 4DV7J 4LJMA 3PEJA 2W43A 2UUAF 5LMNF 3W61A 7AT1B 4EP4A 2FXUA 1S1WA 4Y34A 1K9MT 3PFOA 4NLKA 1IKWB 4NLWA 1H6KX 3T5KA 5J2MB 2PT0A 2N3OA 1HUOA 1KAZA 3UPQA 4RQ1A 4KHNA 2E1FA 2HEKA 2BM1A 1FKAF 4CJ7A 2JH7A 2R18A 1JMTA 2MQLA 3PDNA 4K8RA 4US9A 4FJMA 5KFPA 3EN9A 1V3RA 1L7PA 2IJFA 4IOBA 4FE3A 5KG6A 1ZM3A 3O1LA 2Q2RA 2QA1A 4HUEA 5ALGA 4KLFA 1TUUA 3RF9A 3QO9A 5L8RC 2ZBCA 4B1UB 1Q95G 2BW7A 4DSKA 4KH5A 4CGDA 3BDPA 4OYAA 3MUMP 2JRSA 3QEBZ 3NGTA 4ZPVR 2IVOA 2UXBF 4K4IA 2L41A 2NQPA 5IINA 1UP1A 1VGYA 3BR8A 2LYHA 2WAQF 1W7AA 4I9QA 4YB5A 4IFVA 2VQFJ 1Z1BA 3CJCA 2XI9A 1HL6A 4EI2A 1S4EA 3HHKA 1BISA 3O9UA 4OI2A 3I28A 1U0HB 2DH9A 2VWJA 3UDCA 5CB1A 1U1OA 1UVLA 4BE2A 5H9FJ 4JYAF 3CJ9A 3LPYA 4PQAA 1YBTA 1TKTB 3DM2B 2YKQA 5K8MA 3OY9A 5ETPA 3VEZA 4K42A 2PAVA 1E4FT 1A76A 1RT7B 7ICHA 4B3SF 3U3YA 3W9IA 7ICFA 3MXHP 2PFQA 1X4DA 1H1VA 1WYGA 4NYFA 5B0GA 4JKDA 4FZYA 5KG5A 1SL1A 1U02A 1U1QA 2KVCA 5DETA 3OYDA 2JEGA 3Q24A 3JAMY 4RQ3A 4YB7A 2VUGA 1IBLJ 4DOZA 3NAIA 3NRBA 1WBDA 2ZD1B 2ZH5A 2P9UB 4LF2A 1FWKA 4XEIA 1BA1A 1BE4A 1OQ6A 4EFAC 4JI6J 5ALHA 4YB1P 2R7OA 4KMUA 1ZXIA 3Q7BA 3IN5A 1T05B 1P9YA 2ZWPA 5KPTA 2P5GA 4AD6A 3CCRN 1FXLA 1YJNN 4OJ6A 2ODGA 3PRDA 3CJ8A 4KGMA 2KKVA 3J7Z5 4DWIA 3MEDB 4K4TA 3SUOA 2VU5A 2B9WA 3FQLA 4J7CA 2Z56B 4QZAA 4MTPA 1SJ4P 3PCOB 3BZKA 3DOKA 4M42A 1FO4A 2KHVA 3DXMA 1CEZA 4CM2A 1IJFB 5D8HB 1ZQEA 2F5GA 3EYZA 2KMDA 2YB1A 5LMNJ 1NNEA 2XZTB 1NM2A 4M5JA 5AI5A 2WVEA 4CE6A 3WDOA 4BC5A 3LANA 1YT3A 2CWKA 1EP4A 4X62F 3PV8A 3CXCR 1RXOB 4CK1A 5IZHA 3IXQA 4NOHA 2CA9A 2YXLA 1HNZJ 5L1IA 4DPWA 1Z05A 3OFFA 1RE1B 4IC9A 3JTOA 1MWQA 1RTDA 5AQOA 3FZBA 4K50A 1A0PA 7ICSA 4KREA 3O1BA 3OHBA 4QIFA 4CO3A 3N7PD 4HH1A 4PG7A 3HSCA 4DPXA 2N3LA 1CJUB 1N52B 2N7YA 1X60A 2XS2A 3W7BA 1W7WA 2WHOA 4YDUC 2WAQC 3SMVA 3EZ5A 4OYPA 5JS2A 4CEDA 1IQTA 4X66K 2W04A 5DDYA 3MMVA 2V4JB 1XIQA 4F26A 3AAQA 4B3RF 5BPLA 5LSOA 4CZFA 4OV1A 2J9DE 1JLEA 4W98A 1DY3A 2NS1B 1I39A 2ZKUA 2ZWHA 2JMGA 4DQQA 4USTA 1ZRNA 2WOMA 4LQ9A 2QWQA 5ETSA 2VCPA 3K5LA 3O08A 4OKKA 4F9OA 3KHHA 4QZIA 1NSKL 4IR1A 1HNVA 5HN0A 3IMQJ 2RQMA 4GNIA 2XY5A 4I2DA 2HQIA 3ZDBA 1GK8A 2I5JB 5HOOA 1HW8A 3AVBA 3QE9Y 4CZEA 3R9LA 3G6EN 3DOKB 3ZT3A 2QI2A 3NF7A 1VRUA 4LR9A 5KPZA 3QT6A 1H2TZ 4CLFA 3Q22A 1PK1A 2ASJA 4PG6A 2QC3A 1RDCA 4CJFA 1X3NA 2FDNA 4NE9C 1RU2A 3TJ8A 3ZSVA 3FCWA 3CC2S 1XMOF 1Z1ZA 4DG1B 4B1XB 5M1PA 4DR2J 8ICBA 3I8BA 1XNQK 2LPEA 2YY3A 4PHTX 1AZSB 2YNGA 3IG1B 4IS7A 4DL7A 1BA0A 2E1CA 1YUWA 3PJWA 4DN0A 2J9CA 5IOLA 1YHQN 2D3UA 2JHEA 1T9UA 1TVRB 2AU0A 1ZQCA 2WB1D 4DV7F 1N32K 4ZVRB 4FWOA 4DV2F 1V85A 3WK4A 4ATNA 2Z1HA 1UW9A 3D54A 2W9BB 3A0BU 4AHVA 4GXKA 1FRIA 4M3XA 3MPDA 5J2DA 1NMDA 2XEXA 4HTUA 2VC1A 2DTJA 2HWTA 1EETB 1S9GB 2F76X 5KFJA 3QO9B 3DLKB 2JL9A 4WF9Q 3M32B 3IP4B 3T7ZA 4DMZA 1BGXT 1WDTA 3ULDA 3CC7S 4RNOA 2J6UA 1IV8A 1R6VA 3OUYB 3TRGA 3CQ8A 5BR8K 4ZTFA 1TUWA 2Q79A 3D2EB 3TU5A 2RH3A 3H40A 3S3MA 4R8UB 1FK9B 2VIHA 3J7YI 1NPKA 4B9SA 3M8QA 2P9GA 2UV8A 4MKVA 2WTUA 1QQ5A 3T6JA 3CFPA 2FVCA 4DQPA 2EBGA 3ZXWA 1MROB 1EKEA 1UPPA 3S8SA 3LDQA 3BR9A 3D1HA 2QFIA 2ZOMA 3J80O 3WXIA 5HVGA 3EL2A 2E8NA 3A3NB 5J2AA 4KLIA 3F2BA 2JH3A 5TISU 4X4OA 4JI3J 2DFLA 2ZDOA 2KIWA 1XO1A 2O5DA 3P39A 2GGPB 1AXQA 4ZDNA 2Q3PA 2KHDA 1VQOS 5LJVA 4UTGA 4AHCA 4O9MA 1BUXA 2EAPA 1RT4B 7ICEA 4UAZA 2GS8A 4PWDB 4FS1A 2J0QD 2YX1A 3WQUA 3AMZA 2J4RA 3PX4A 3ATVA 4B6JA 1XBWA 2WSEC 4BS2A 1V6HA 4NA2A 4KB0A 5AQGA 3MEEA 1UAXA 1T9WA 4CZIA 3AQEA 3PFEA 2OP5A 1KVIA 2BRKA 3IAS9 3R1LA 1ZXOA 1GLLO 1SS6A 2ZIXA 4OX9J 1PCAA 3AGKA 4JI4F 1UPMB 5B8HA 4AH9A 1VBYA 2GHWA 2F96A 1OJ4A 3GU0A 5HJXA 1VBKA 2CAJA 5IIMA 4JI5F 4X62K 1YRTA 3HSZA 3QMQA 4J2AA 1T0TV 4PWUA 5C2CA 3QPIA 4CLZA 4NYOA 1N60A 4XH5A 1HUZA 3L7PA 2P9PB 4DUYK 3GJRB 2WONA 1NK8A 3P1GA 1MC8A 1FJ7A 3K5NA 3T1HF 3FGUA 1M1GA 2FI1A 3C16B 2BQ3A 1Q82T 3GOIA 2XNRA 4DV1K 1B4SA 1UWBA 3SUPA 4P4MA 1UMJA 4K4GA 3NF6A 4WE1A 4KX3A 4DV6F 3JSYA 3BYPA 4QZHA 4L74A 1RP5A 3BM7A 2YTUA 2DNZA 3VQ5A 1T3OA 2LQ9A 4C4SA 4NRUA 1NK7A 4RUCA 3PW5A 2EANA 4DUTA 3AVAA 3NOCA 3ZTOA 2NPIA 2B9YA 3KBBA 2XWYA 3CNQP 2XSFA 4F50A 4CM0A 3TVKA 1CQNA 2EK1A 1BNOA 2VFUA 1SJ1A 4NCGB 2ZH4A 2VQFF 3UE2A 1ZM2A 4K0KK 4F4ZA 1VSDA 4PGQA 2O8CB 4J91A 3GJQB 4NJ8A 3VGUA 4IRKA 5KNIA 4FJJA 4JD2A 2HAIA 1N8RO 1XR5A 3HO1A 1X7VA 2DGUA 3HW8A 3GV5B 3RMBA 4PCQA 2DGVA 3BF3A 2GMLA 2GWKA 5EXWA 3PSIA 1VK0A 5T41A 3ZZUA 3MMCA 1U2RA 2GGPA 5HP1A 3HSGA 1M1KO 1XWLA 1B43A 2VJ5A 4CNYA 2X7IA 2AKWB 2RU3A 4ZLJA 2YH1A 1RWVB 2EK6A 1QQNA 4IO9L 3FUYA 2YKMB 4NI2A 5G0RA 2XYHB 3AO2A 1TK0A 3S9HA 3GIMA 2CJBA 4JKGA 1MNEA 3RRKA 3LGHA 4ZPWR 1IV0A 1D5AA 3J8AA 1ZOTA 2M52A 2A6OA 2FBTA 2KH9A 1PK3A 5J0YA 3VQPA 1FTRA 3WK7A 2AQ0A 2NYIA 4QZVB 3G96A 1RT5A 4B17A 3L4BC 8ICKA 2IRYA 1LNQA 1FDNA 1NGAA 3OT9A 4FM1A 4A5BA 3RWUA 4OQJA 5D0GA 2DNGA 2DF4B 3ENAA 1S0MA 3DLBA 2DGQA 2B0CA 5AQPA 1U2CA 3MM8A 1UVMA 1IH7A 2VQEK 4U7UD 1HQ2A 2JWKA 3QAEA 4Z7YA 3ETMA 3VQ9A 4F5QA 5IM0A 2G1DA 4KAIA 1WAFA 2XICA 1J5EJ 3L09A 1R43A 2HBRB 1YJWN 2HG4A 3GCXP 1KEKA 2BZ2A 1PBUA 4KLHA 2ZC3A 4FJ7A 4NEYA 4OL8A 2BUPA 5C2FA 2D3OR 3SQ2A 4LF5J 1R6YA 4Y2XA 2E1YA 3A0IX 3CMES 2PY5A 5DG7A 1F0MA 5AICA 3N97B 1XNQF 3HKZF 3TOQA 1NZBA 4Y2VA 4O3SA 4LF1A 1KWMA 2PMZD 2KT5A 4K4XA 1HNXJ 1CZ9A 2RHKA 3KJVA 1TVRA 1RYSA 1VDVA 3BF4A 3GSIA 1Q5VA 3DHWC 1D4XA 5HP1B 3E2EA 3I0SA 1RSCA 4GXJA 4JI7J 4I2BA 2DEIA 1FX4A 4CBWA 5JVGL 2DFEA 1WSIA 2O8DA 3CDUA 4M7YA 2OANA 2C3YA 2K60A 2XZWA 2HYIB 3P31A 1PO6A 3RU0A 4DV1J 3SIPB 5D0RA 2W01A 1WOPA 1DK2A 4X4SA 2A3JA 4RQ2A 1NXIA 1B0VA 2GVZB 2ADCA 3HHNB 4Q45A 4UY8T 2DGOA 5F8MA 2AW0A 2IHR1 4CIFA 3NL0A 3HT0A 1WTFA 3SV3A 3J7ZO 1V5IB 2A41A 1KQFB 1GMUA 4DL6A 2A40A 3OS0A 2FLOA 4AM7A 3ULEA 2LU2A 3WXLA 3QERA 2HGLA 1HYVA 4JD2B 3M8WA 3G82B 4RNFA 5DLGA 5FD1A 4C3MA 3SSQA 4I56A 2GQCA 4E8UA 1AT1B 1UT8A 3M9OB 4DV4J 5EOZA 2XLJA 4CGIA 2AH5A 4GKKK 2MQNA 2BPCA 4I2HA 5EWFA 2Z1GA 4YY3F 4DSLA 2DIUA 1A5WA 2CJQA 4O5FA 2RRBA 1SAZA 2W40A 4HTLA 3IR6B 3H0RB 1U7LA 3V9UA 3D1QA 4QZDA 2QKKA 2WF8A 1QUPA 3K9JA 4BRDA 4ID1A 4IJAA 3DRPB 3MECB 4P2FA 5IFMA 2V0NA 1WACA 5FRNA 2BVZA 1YHQS 4EUVA 4Q2LA 1U6BA 5KFLA 4FL9A 4CJSA 2YJFA 2JLEA 1Q7LB 3EGZA 1WC4A 4CNZA 3BQ0A 4DR4F 5C5JA 4OJLA 3V6DB 2NXEA 2W1BA 4TU7A 9ICJA 5E3CA 1I5OB 3MK6A 4WFBQ 2CPFA 2MZ1A 2FSNA 2ROGA 2E5LJ 3O1WA 3WNEA 2G8KA 4RNMA 4NY8A 1VQPN 1NSPA 1C0MA 3NH1A 3HD1A 2E5HA 2KVQE 4M9HA 2VGMA 4JRPA 5G4DA 4Z6FA 3T1HJ 4P0QA 3HI9A 3C6UB 4CZMA 5J0WA 4QWCA 2QSFA 2HS0A 2CQ0A 5KL1B 3RRHA 3MPWA 2IFXA 4C1NK 1SZHA 1M5KC 4MIWA 2QB0B 4P73A 4WYBA 4UW2A 1S77D 2BANA 3A8KA 5GAEU 5C25A 1ATSA 3QQCD 2MY7A 2VASA 2B6AA 2XHBA 4WJBA 4JI8F 3AA2A 3N7RC 4YFKA 2E7WA 3IGNA 2KZZA 1IM6A 4Z4CA 3OS1A 3VAFA 2EC2A 4CJUA 4Y2MA 3QESA 4C2MA 1DQAA 4OZNA 3Q8VA 1NBEB 1F6TA 4CZLA 1Z26A 1GTHA 3VF4A 2OA8A 1QAIA 4G1QB 1ASWA 3VQTA 1EKRA 1CJTB 3RJFA 4RZRA 2VKQA 4CGJA 2DY4A 1SKUB 1SB6A 3FM9A 1S10A 1JLFB 1HJRA 3LZJA 1S9EA 3LW5C 4OPHA 2X1FA 2RE2A 3D3CJ 4NXZA 2NV3A 1MROA 2VWBA 3MD1A 4CLUA 4XH4A 4RW8B 3MCSA 2FVSA 1WWVA 1HPMA 5IV4A 1WOQA 2RB7A 2F8HA 3VZIA 1ZRMA 3BY5A 1FTCA 4HKQA 3FRZA 3VEWA 4B9LA 3VN5A 4DMNA 3BP8A 1HQEB 3JS9A 2G09A 3IRXA 3TADC 5HLFA 1DGJA 4QZFA 4B3TF 2Y0BB 3N4QA 3RMDA 4U8YA 3ZSRA 2NNWA 2WF6A 1KQGB 1G99A 4X64K 4YMOA 3H7HB 4ZLPA 3NP5A 4IOXA 1COKA 4QAGA 4G9BA 4MKBA 2LQ5A 2C3PA 1IKYB 1C7YA 2IYGA 4M5NA 4KLMA 1N36J 2FPKA 2MKSA 3ILOA 5AKIA 2RMLA 3KKSA 2M0NA 3P83D 3BGUA 1S72N 1RHMB 3SUQA 1HR0F 2EZYA 3DDNA 2FYXA 3DCAA 2WSFC 2HNZA 3DM2A 3OYHA 5M1OA 3BPSP 1QAXA 3QBWA 3CCLN 3BSCA 1NEEA 1YZ6A 2RHSB 2QE5A 5DS7A 3MCOA 4M5MA 5D0EA 2GX9A 4OKJA 1BQMB 4PL7A 5J2QA 2ZVSA 4QYRA 4AF1A 8ICCA 3EX7B 1I1GA 4DV3F 4J03A 1Z19A 3HJFA 3DLKA 2K8BB 4RT2A 4IL6U 3O9QA 4A2AA 3P4IA 3R97A 2HHQA 3EGVA 4M63A 5IS2A 2V7YA 3IP0A 4ZTJA 1NGIA 4TUSA 5T14A 4A8OA 2O1PA 2DT9A 2DTUA 4GC6A 2JH1A 4O4GA 5IT9U 2YHAA 3CM6A 1IKVA 2V4JA 3I4HX 1R8BA 4B3SJ 1Q0NA 3Q2SC 8ICFA 3UVJB 1LWFA 1A9NB 1HBNB 1OH8A 3CPEA 3CJBA 4HHJA 4ZCKA 1Z4NA 4DTOA 3DRXA 1X4EA 4W5RA 5HJYA 3NGYA 3LTOA 2B6AB 1GH8A 3DGPA 4ANCA 3SMSA 1NK5A 1F5CA 1DEJA 2QA4N 2UVRA 4XAKA 2IJNA 4DU4A 3OYKA 1JL2A 3RB0A 4CTAA 1T6DA 1RAOA 1Z4UA 3V6KA 4KI6A 4C6AA 1CJTA 4ZVOB 4BC2A 3JXOA 1MWYA 2V8PA 4DR3J 1WKJA 2WBNA 3RMCA 3UM9A 4ZOHC 2CQ4A 4DR5F 2OEKA 1ROFA 3KK2A 4JI2K 1PVRA 4BRQA 4TYAA 1ITPA 4I6AA 2L48A 2UUTA 1GMWD 1S1UB 3S6EA 4JBCA 3AUOA 4FNHA 2LP4A 2J9DA 3SR6A 1NDPA 4B1ZA 2KKHA 5B0DA 3CC2N 2AX1A 4OV6A 3O9RA 7ICMA 1FJGK 3UI3A 5E3AA 1FE0A 2XLIA 3G8SA 4IDKA 1U45A 1QQMA 3LM9A 3S41A 3IS9A 5KFBA 1U49A 5KGXA 2E8OA 1RT6A 4EBEA 3ET6A 1NGHA 4DPOA 2NREA 4JI8K 2JOQA 3PNIA 4DR2K 4USVA 4PPXA 4OYZA 4KLDA 4QR1A 3C7NB 5HP4A 3VGLA 3CI5A 3UQSA 1UFWA 4EO8A 4DR4J 3C1ZA 1GX5A 2AZ1A 1KTQA 4DTSA 3SQ1A 2QZ8A 4WFBL 1X0FA 3BEGB 3LGMA 1GQEA 3UMBA 4H0XB 4CERA 7ICLA 1KS2A 2CQIA 4F3TA 1C0GA 4UASA 3AD9C 3RSEA 4CW7B 2KVSA 5EE1A 5SWMA 1V38A 2FF6A 2G2ZA 1ZPVA 1NJIT 4FBUA 2BCRA 2R2RA 4PWDA 2CIMA 2YNGB 1AZSA 3M1YA 2J8AA 1JJ2M 4F5PA 3MFHA 1JL1A 3KZXA 2QM1A 5MLCV 3HHLB 4P2SA 3H08A 3NEKA 2FC9A 1VAZA 3T6BA 1W25A 2KRBA 1ZQOA 3ICXA 1Q16B 2HFUA 2LECA 2BANB 1N32J 2HKEA 2MRLA 2H65B 2I9SA 3W9HA 3G6ES 2UYTA 3SD7A 2F8TA 2EKNA 1OYDA 3GZ7A 3CM5A 5ALKA 2NYHA 4KHPJ 1OIAA 3OTOF 3HPGA 1B22A 3AXKA 2FJ6A 3RUBL 2F1JA 5CCLA 4A8KA 5G0RB 3M05A 2PO4A 5EDWA 3QU7A 5AQWA 1RK8A 4LREA 4C8YA 3PHEA 3NFAA 1SKWA 3OUYA 4H0YB 2MYFA 4ILLA 1GX6A 4BXOA 2ZF5O 1O8BA 2DQNB 5DB6A 1NBWA 3G25A 3T3FA 1YITS 2BRLA 3BQ7A 4FVMA 3CJ2A 3ADAC 3AU6A 3D3BJ 2OHDA 5CH7B 2LKZA 3VQAA 4CTAB 4LFCK 1MWMA 3MMAA 3N4WA 1RZMA 1QVGM 1DGSA 2YHWA 4PXEA 1BL3A 5KQDA 2PD1A 4EO6A 2DKZA 3BKFA 2DPIA 2VHGA 4J8FA 5HR7A 2QX0A 4CO2A 1SXDA 3JSBA 3M8ZA 3NTUA 1VSHA 2XO6A 1NU4A 1LK7A 2QWMA 7ICVA 2P6UA 5B08A 4QU6A 2QTWA 3I55S 2EKYA 1KKXA 3SQGB 4RU9A 3NVMA 5AI4A 4DV5F 1GT8A 5L38A 1RU1A 2QJ3A 1BC6A 1Q8KA 1Q86O 3VR1A 2WZ1A 4FOIA 3GFZA 4GVEA 1NSQA 1HBOB 2UVUA 4RBTA 2D1CA 3ZFVA 4I68A 1HNWK 2Y9TA 4WTOB 2IM2A 5EU7A 4LF6K 9ICWA 3FAHA 1KLMA 4UW9A 1RT6B 2ZBRA 2CZ4A 5B0CA 1NKBA 3M8YA 1FRKA 3N79A 3O4WA 3ZDEA 4JI1K 3E9PA 2R2UA 2HHSA 2ASDA 4OPKA 1KW4A 1FIQA 3OPXA 3C15A 4W92B 1Z1VA 2LYBA 2H5IB 2FJWA 5AK5A 4DUYJ 1Y4ZB 1ZQFA 1VC6A 4OIXA 2CQPA 2RF2A 3C14A 1W2BR 9ICBA 3LP0B 3UR0A 2K3IA 1YX2A 2EWHA 4UY85 1CC7A 3DYAA 4ZIWA 4OJ3A 1YBUA 1ZJNA 4QZGA 4QW8A 3J7ZT 1XERA 4O4GB 1VQSA 2ZHBA 3L4QA 1KVAA 2C2EA 3AFGA 1H3DA 3HXMA 1OY8A 4BBYA 1DFDA 1EB0A 5AFUA 3EE8A 4BJQA 5AM3A 1U6ZA 2ZEJA 3QMLA 3HFVA 4PEOA 3KLFB 4UOHA 2MAXA 3UPFA 1TKTA 2IGIA 3QETA 1RUSA 4RW6A 3A5MC 2A18A 2Y0SF 1BLUA 2KYZA 3BEXA 2W7AA 1FHTA 1FEEA 1OUQA 4YB6A 4A8FA 1R0AA 2DNPA 5BREA 8ICAA 4IOCL 2V63A 2OPPB 5AQXA 3R7NB 3MM8B 3CJ7A 3MM6A 1BQNA 2E9TA 1H72C 2KSOA 4LF6F 1ZQAA 4QIWC 1MU2B 4MFCA 2UXDK 1TL3B 1KVJA 4BR7A 2ZD1A 5EHHA 2BPFA 2MKYA 5HLFB 4LBPA 4F4YA 4F25A 3FLCO 1LXNA 4MH8A 1Z00A 8ICZA 5CR0A 2D8CA 5A76A 1IJJA 2FY8A 1Y64A 1T05A 1CS4A 4AE5A 5ALZA 3NRWA 2ZIWB 1QD1A 1P6TA 1RYRA 1FA0A 2PA8D 2KXFA 3ENVA 1HHSA 2VG7A 1GNKA 3C7NA 3HWTA 2GC8A 4NM2A 4QZBA 3I76A 4KR0B 3HL8A 1VQ4N 1RT5B 1ZTWA 4M5DA 1BPBA 4P52A 1OO0B 3OV7A 1HKAA 4OGCA 4CDGA 4LFBJ 3TSPA 3OYLA 2P9SB 4QCLA 1SXLA 3ALYA 3KG0A 1WEYA 5DGAA 2PEHA 3ISBA 2E7XA 2GAHC 2OSQA 4ZP6A 1FWPA 2CJYB 2IC3A 4NXMF 1QE1A 3WXJA 3WUHA 2P9CA 2F2AB 4Z6CA 2H3FA 4OI4A 2KW4A 3JS6A 4ICLB 1WSVA 1D8ZA 2ZXIA 3NGUA 1JXLA 1HBUB 4F7VA 5DM6L 2DGSA 1UVNA 3CPWM 8ICQA 1PGZA 1J2NA 3KZIU 2VFTA 3KLGB 4DFJA 1ZQHA 1U1LA 2Z2YB 2R8KA 4JV0A 4JKFA 1F9EB 1WKLA 4OX7A 2G8WA 3WEEB 2ATLA 1U8WA 3HVTB 2PA3A 2VV5A 1LWXA 3PKYA 2KOBA 4P0PB 4YD2A 1ULRA 5F2RA 3AOAA 1D09B 2KK0A 1KVKA 1TK8A 4UQTA 4YHHJ 5J2EA 4CJ4A 4B3SK 5BPMA 3GWCA 4DR3F 1U2FA 1C0TB 2HFVA 1S5JA 4E7JA 1K47A 2RT3A 2LXIA 3DNCA 1Q7YO 2P51A 3I5CA 3MWTA 3ZDCA 2MZJA 1WUDA 5KI6A 2BXJA 9RUBA 2Z7JA 2I8EA 1RILA 3DU5A 3OVNA 2O8BA 4EYHB 3UKUB 2WK4A 3MM7B 1VMBA 3DLHA 4J9RA 1VOMA 4K4UA 1MQ3A 4DR6F 2Q1NA 2O8CA 4ZH4A 5KFKA 3ISZA 4BE1A 2C3UA 2VF3A 2IVNA 1VQ5N 3QICA 1U1RA 3EE9A 2DO4A 1YJ7A 2R42A 1CPZA 4Y2YA 4L6V3 3JAMO 3QNOA 4RUBA 1ECWA 4UT4A 4DOAA 1HJPA 2C2ZB 4AQYJ 4ECUA 9ICQA 1NH7A 4DFMA 5T7LA 1IBMK 1RQLA 4BUGA 7ICGA 3C66A 3DDKA 4JN4A 3IA0A 3J7AP 2ASOA 4CLTA 3KK7A 3OR2B 5ETKA 3KTQA 2RAQA 4EHTA 5HBMB 3LWLA 4KLOA 2LQJA 1R8HA 4UZCA 1VQLN 1SIZA 1PG5B 2IIHA 1VQPS 2F4VF 3O80A 3MDFA 4QS7A 4EFHA 2KM8B 4BWMA 4AHTA 3QAUA 4C11A 4URQU 1HNZK 4WQ4C 1A7GE 2J7KA 5ALNA 2NXJA 3J7AN 4H0TB 2G08A 5HVFA 2UUBF 5FDLA 2IA0A 4MLHA 4PHEA 2FZGB 2J76E 4DX5A 3PO5A 1VSMA 2Z57B 4DFKA 3VETA 1R59O 1Q81T 5KTQA 3MDAA 4PPDA 2HS3A 4ZK7M 4H8KA 3PO4A 1YIJS 5D78A 3L2WA 1R7IA 3AA4A 4CI0B 4PYAA 2GIFA 4CHPA 2W3SA 2DJWA 1UA1A 1XSNA 4K5RA 7ICKA 2W9CB 3ED5A 3KNGA 3NMUA 2OPRA 5JLHA 1ZOLA 4EYIB 5LL6d 3C65A 4DPUA 4JI6K 4DV1F 4KHSA 3Q8PB 5E84A 4ERDA 3SAHA 3ETRA 1C0UB 3WNGA 3H98A 3NWGA 4Y00A 3OXFA 3RH6A 3KIOA 2CZVC 2CJ9A 2XYGB 1KHWA 5KFGA 4Y2JA 1HNIB 3A4TA 1ZQIA 4ZPTR 1WOOA 2ROEA 5D3GB 3WK9A 4DR4K 1U6FA 1RTIA 1QTMA 2PFFB 4OZJA 2XZDB 1HYZA 4AYBC 9ICVA 2PMHA 1VQON 4DG1A 4IG3B 1IKWA 1HQUB 4OX6A 4O5KA 4FWNA 3AXMA 4B3RK 4DCOB 1X5TA 1SVDA 3L4PA 2EEYA 4M1KA 3TFSA 3BO3A 3TSQA 1JWWA 2CH5A 3RGIA 2BJ9A 4NLDA 3ENBA 2QK9A 1PUZA 3M2UB 1APSA 4LF6J 2CQDA 4EX7A 3ET6B 4FCYA 5A2QO 5A2QU 5F0UA 4ZPDA 2XQCA 2AT1B 3B6OA 2RU9A 1YRXA 2W9BA 4LRDA 1AROP 3HSJA 1O08A 4XQ8A 3JYTB 1QS4A 1JNZB 3HLUA 4JI2J 2UXDF 2IM3A 4IG0B 1UCNA 4E2FB 3IG1A 3WKCA 1LQ9A 3I32A 3C23A 4C0BA 1GTEA 1VLYA 3DKDA 3M2VB 1X4CA 1Z25A 2ZQBA 4OPJA 1T8EA 4DX6A 3L9ZA 4IQMA 2AGOA 4DU1A 4NLXA 2W9MA 1OPZA 4NYPA 4C11B 2AZ3A 4M3ZA 1BPDA 1NGCA 1IKXA 1Y3KA 2XULA 1I94K 4FF2A 2VA3A 4FF1A 3OTOJ 4DTNA 3ZD9A 2QW9A 3LF0A 1IUJA 1BCOA 4PKIA 2GVDB 4CD3A 1URJA 1ZC6A 4NXMK 4U67Q 4IQXA 4KTWA 2NSBA 1NDKA 4TQRA 3JQMA 3OR1A 1G4CA 2U2FA 3M1FA 4I64A 3C28A 1IIPA 4B9NA 4CYUB 1PKUA 2MZRA 2K8GA 1YDLA 3A13A 2RUGA 2K7JA 4P2HA 5A8WB 2E5SA 3LA0A 3W62A 2GH1A 1WSFA 5CZ1A 4JWMA 1TTHB 3HVTA 1TKDA 4RL1A 3FBEA 4DDFA 3R27A 5I4MA 1CLFA 1LOTB 2MQ8A 4CZJA 2Z8QA 3TZYA 2HRTA 2ISPA 5LL6Z 5KAIU 3GIIA 1P1LA 4Y2QA 1RWKB 3BSNA 2H4WB 5BRDA 3N4MB 4DU7A 3NXZA 1FD8A 1JLQB 3C6TB 2GV9A 2E1AA 3ZZPA 4PA1A 4BC7A 1BOTO 3KK1A 3DXMB 2UUCJ 2HI0A 3TTDA 5CHCB 4WU2A 2R7YA 5CABA 3K1ZA 2CUYA 3K5PA 4R79A 1S0OA 4CHNA 3J81U 4KHUA 3OTDA 2JDJA 3GR1A 2D74B 2B4PA 4YR2A 3NOGA 3V1QA 4KGVB 3VC8A 5JUMA 3MDCA 1QVGR 4X4QA 1TGOA 1T03B 3LO3A 3O0FA 2J9EA 4USAA 9ICMA 4G1PA 1AW0A 2FGCA 3Q8QB 4DV6J 1Y0HA 3ITHA 2X74A 4GV3A 3MABA 1IBCB 1KLNA 5LM7E 1F2GA 4A46A 5C2DA 1FERA 4B3MF 3S1TA 4PR6A 4C3KA 5IXUA 1RNHA 3RYLA 1GO3F 1YTUA 2XB2D 5DM6Q 2R2TA 2G0JA 1YBAA 4MKAA 1V3ZA 1FVQA 3D7EO 3C46A 2Y8WA 3F5TA 3TZXA 3W5ZA 3ZEUB 3OBWA 3J7YU 4CBXA 2PKEA 8ICHA 2OPSB 1RCOB 4C3LA 4XPEA 4BY9C 5ALWA 4DLEA 3VGMA 5GMDA 2OH2A 3CDBA 2HF3A 2XMJA 1YI2S 2IBOA 3TARA 4FM0A 1C20A 3U6FA 3JPOA 3L3UA 4DTUA 4UB3A 4ZIVA 2HBMA 4RQ7A 1OXJA 3CCJS 2ZNYA 2QLTA 3HOSA 3EPGA 2ZH7A 3OTOK 1R0BG 2WW8A 1RAIB 4KLJA 3OYIA 3OSNA 4DX8H 1ZBIA 3VTHA 1MA9B 5ALIA 2UVVA 4JAXA 4JKGB 1VHFA 4WP3A 3H3NO 2GJFA 1S6OA 3KKAA 3CXCM 3V9XA 4X84A 5U47A 1REVA 1FJCA 5EY4A 4UQGA 1ZD4A 4YORA 3NCPA 2UXBK 4OI1A 4C7ZA 1E6YB 4PYDA 4K4ZA 3JSMA 2XRIA 5KOWA 4JWNA 1QQOA 4H5RA 1TV9A 3L2QA 1U48A 2ZTEA 2E1ZA 3HHLC 2P66A 3MM5A 5A0LA 3KLIB 3ZETA 4H5NA 5L39A 2BKEA 1SV0A 3PIOQ 4J9OA 4IH6A 4C9DA 4Y65A 3ENOA 4E19A 2PMZF 2AJQA 3CG7A 4I28A 1IBKK 4ZS6A 4PL8A 2KFNA 2N82B 4NLSA 4DU8A 5I3PA 5D3GA 3C5GA 3TO8A 2MQMA 4PG5A 4O3QA 5KG1A 3MMJA 1LWEB 3IGVA 1BPXA 3VEXA 4BDPA 4YY3J 5ADXA 3NAEA 3LDNA 3KUGA 1R8AA 2YWWA 4B1VA 4DSEA 2AMCB 2FLPA 4C1NI 4KO0A 4L3KA 1T03A 4HLBA 4K5SA 3W2WB 3V4MA 2ES6A 2V8GA 1JIHA 2X6SA 4MLEA 3EICA 3R3TA 4BRAA 1RABB 2E6MA 3HK2A 4ZJLA 3C2PA 1B3TA 4FO6A 3IM8A 2VB6A 1RTDB 1HNWJ 1C1BA 2UXCJ 5C10A 1S1XA 3HZ6A 4M9NA 4DR7F 2XYPB 4O0NA 2D0CA 2O8FB 5CA5A 5LJWA 1UVKA 3THTA 4ZN3A 3BUZB 4M45A 3N5FA 2HVZA 4HEA9 4CFAA 1XNRK 3CDWA 2VICA 1O0PA 3D0HE 1N5QA 1KNZA 4A47A 2FD2A 1ZQNA 1TYQA 3BYRA 5L1JA 4JI7F 1COOA 1T9TA 1J5OA 3M2VA 1OY9A 1LW0A 2YMMA 2ZIUA 3TAMA 1RA6A 2HBZB 1C4CA 2QB0A 4OO1J 4OZ3A 2J7UA 3DXKA 3QINA 1ZQVA 1FRLA 5KGWA 2DNQA 5LJ5Y 3M8PB 2R2SA 1N33F 3ZX0A 2YBVA 3H1QA 1VISA 5CEHA 1VLBA 3NS5A 2CQ2A 3V1OA 4MQ3A 4I2QA 1RLDA 1KCFA 3M6KA 5EVZA 1KLMB 4MF2A 3E3XA 4CF1A 1RM6C 2KL8A 1FXXA 4JV1A 2IY5B 4WBFA 4R65A 2PYLA 4KN7A 1DTQB 3D6FB 3PXGa 3BBCA 2DFFA 2OEHA 3E66A 2E1MC 4OJRA 2FPHX 2X6NA 2PGCA 1SJ3P 4QNLA 4DJBA 1N5VA 1E3MA 4NO7A 1S99A 3CMAS 2NRXA 3M30B 3MECA 2V5HG 3UFCX 9ICPA 2HHWA 2X1GA 4U8VA 1OH5A 2RRDA 1HLWA 3LUYA 2YHYA 3ATUA 4E7HA 2BBEA 4GVMA 4KGXB 1NK9A 4M3TA 2O8EA 4QR0A 4LF9K 2DNRA 1RWMB 4FJNA 2BKPA 3BN7A 2FZKB 2YV0X 2EQYA 3FMWA 3MEGB 4WQ4A 3R5BA 4OJGA 2HQ3A 2BDPA 4IG3A 2MU2A 3GV7B 2ZC4A 4UBCA 1NKEA 4I2EA 2AV5A 4M5DB 4RW6B 4OYIA 4CF2A 4BXOB 1FXRA 3P38A 4GKJJ 4F2RA 2HDOA 4OLBA 1DLOA 3W60A 1K0TA 4JEPA 3UB5A 4YMNA 4FVCA 2F7TA 3H0PA 4QYZJ 1FFWB 1NGJA 3GIJA 1FK9A 2CPEA 2HNDA 2GX8A 3CD7A 2PI5A 1FNMA 2ATCB 4ZVFA 4J2EA 2R9LA 1VQ9N 2ILZA 3JSRA 3QBCA 2QWRA 1VQMS 3OTBA 1C4AA 2YMQA 1RLCL 3UWTA 8ICEA 4TUPA 1EETA 4AYBF 2DIVA 1NJZA 1RT1A 2M9KA 4QPXA 4UAUA 2R3VA 2YPYA 1KDNA 1LKYB 2O67A 4DX7A 4IR9A 2OPRB 3KXDA 4FW2A 5KFUA 2B3TB 1T95A 1NK0A 2EI5A 3MDQA 2CFXA 5HATA 1T11A 2VOOA 4OLOA 7FDRA 1L7OA 2RUSA 1BI4A 3Q8KA 1IBKJ 2OPQA 3QGPA 2KDOA 4FJKA 3FEYB 2B5JA 3BDEA 2QYGA 3M8RA 2CQGA 4FYVB 3IHQB 4Q8EA 1L8LA 2AWZA 1NHKL 2I0XA 1N5YA 1VQ6N 1XC3A 1XJWB 1RDRA 2ZZMA 2KHCA 2N4DA 5LJ3Y 4X64F 5ALMA 2ASMA 3M30A 3QRRA 2E2OA 1BVSA 1RHKB 3CDEA 5FPEA 4BC9A 4K4HA 3HP9A 4CEZA 4OZ2A 4FDFA 3KK3A 4JK7A 1SCJB 2YHBA 1WC1A 2OMLA 5B7WA 1N0VC 2BEFA 3MXJA 3OVBA 4C4TA 4OJ5A 4U6PA 4QIEA 3P49B 2HZVA 4UAYA 4IQUA 4UOFA 1LWEA 4FPRA 1DQ8A 3VQBA 1LKZA 4FKXA 1F1BB 3JYTA 4BRFA 2WBRA 3BH6B 4RLEA 1IR1A 2FC8A 4FK0A 2DD8S 4KTZA 1QAYA 3DOMA 2CXEA 2HQFA 5HRRA 4NRTA 5HI7A 4Z4EA 5DO2A 1X4BA 1WF1A 4WU3A 3HFKA 4EHUA 3RAQA 3KJQB 5ITHA 1J5EK 3J81O 4DBQA 5EX3A 3AJ1A 3CMAN 4MJKA 1MMNA 3SK3A 5DDPC 4OX8A 5J2PA 4LUBA 5FLXY 3UDVA 5HMYA 3H3OB 5AKYA 5KG4A 1HWUA 4ALZA 1AFJA 4K0KF 2P9PA 3M6VA 3EY1A 2MJUA 2J0SD 4FXWA 1IKXB 4U7BA 9ATCB 3BF1A 2WONB 4WFZA 2QGFB 3OW2R 1L6NA 1YVFA 2CQCA 3CD0A 1U2VA 5KFRA 3KUEA 2HLTA 4ZPAA 3TX0A 2CQ3A 2C22A 4FJHA 2JLGA 1L3KA 2DWQA 3ASMA 4NLYA 2V8HA 1TAUA 2F9JA 5MLCQ 2Y1RI 9ICCA 5KT4A 3GFXA 5KOXA 8ICIA 4KIAA 3H4BA 1Y5NB 4CJRA 4ED5A 2VPWB 3BS7A 1XNSA 4BX9C 4ITSA 3LPUA 2D69A 2MKCA 1ZQPA 1IWGA 3ID8A 2PYJA 2RDJA 3D6RA 3K1RB 2ZBQA 1U0HA 3Q8YA 2COLA 4N5SA 2WVFA 3SENA 1Q3UA 1GAOA 1YGYA 2DKOB 2GZOA 4B9VA 3SQIA 4DUYF 4P71A 3OYBA 2YN4A 2CGLA 3EJMA 3JAMU 3V1RA 1V9OA 1ESVA 1O13A 2I5JA 2GUIA 4O3OA 1UQVA 4LZDA 1D9FA 1DT9A 1U04A 3P3DA 4KHYA 1J5EF 4GKKF 2KJ9A 3RB3A 3P96A 4PPZA 4LY7A 1W97L 3F9MA 3CP8A 2HBYB 3LOUA 2MPUA 2Q1LA 4WZQA 3ZSOA 1IJEB 4OVLA 4K0KJ 1F60B 3U1MA 5HRSA 2Q0ZX 3A5LC 3VAMA 3SMPA 2E8MA 5AXNA 1NPRA 1RTJA 2HHPA 4C23A 4CJQA 3DEEA 2HIQA 3R5JB 3PIPL 3QEAZ 1TL1B 2CRLA 2LEBA 2FY1A 4KLGA 3TAEA 1WC5A 4P6QA 1SL2A 4MYUA 2GFFA 2KG1A 4RPYA 1ZQWA 5DDOC 3F44A 1JUDA 4FYWB 4FJIA 1A6LA 4MDAA 4F71A 3NAHA 1SQFA 3MWPA 2ADBA 3ZZ0A 1CLQA 3DXBA 2UU9K 4ZP9A 1NNLA 3UD3P 3QT7A 3PY8A 4AHUA 5C12A 3V7KA 3WC0A 1SI9A 3KWIA 3CCES 3NNHA 4O3RA 5CHGA 4C97A 5A8WA 3VAKA 3ZYYX 2FVPA 4X4UA 5E0OA 1XQIA 1RAEB 4RTFD 1OH7A 5AQJA 3OR1B 2RQKA 4J2BA 2B7BB 4UARA 1ZBUA 4DOBA 1HHQA 3FGVA 1UZHA 1SH2A 3QUBA 4KGKA 2RDIA 3V7JA 2YY6A 4KTQA 3M2RB 2QA2A 1VRTA 3Q8UA 3C15B 3G6YA 2IOHA 2DXDA 4ZLLA 1G15A 3GPAA 1E6YA 3LP1B 2R7TA 4K4VA 4CQ1A 1RT1B 4HR2A 1OH6A 1M5VC 1XMQF 3L7OA 4FJLA 1N61A 2O66A 3MAHA 3PW2A 3R6GB 3MN7A 2JRZA 3NGDA 2N4CA 3H8WA 4C8OA 1EZZB 3BZCA 1U1NA 3OYJA 2ZHOA 3N28A 1RHJB 3CCVS 1U47A 3CE8A 4J9SA 1AUSL 3EXCX 5EWGA 2BE2B 1HKBA 1DOQA 5GINA 1TL4A 2B5JB 1M1HA 2UUWA 2NRHA 3UKRA 1PIEA 4UAWA 1KN5A 1TMJA 1KBUA 2IS3A 1P90A 1PK1B 5D4LA 2B4JA 1B0TA 2LSNA 3VERA 3IO1A 3SQGA 2V2ZA 5KFIA 5FPNA 3A8EA 4ENOA 1M5HA 1PILA 2GJIA 3GYNA 4LC9B 4M9GA 2LQ8A 5CQGA 5IQ6A 4FJXA 4CHOA 2YKNA 3AOCA 4AILC 3SQOP 4RWXA 1H2UX 4BWJA 1RAJA 1UW4A 4LRBA 3F73A 2ZIWA 4KPYA 2C2RA 2ERRA 2CKWA 2XS5A 3ZNUA 3HFZB 2QXLA 3KOOA 1QHTA 3VQ6A 4AT1B 4EMDA 4DUZJ 3S3NA 4DCCA 1ZQXA 2Z2LA 3M8SA 3CC4S 4HUGA 2I7NA 2K06A 1T4GA 5C24A 4JB8B 1RTIB 1NGEA 2UVWA 1EP4B 3DRPA 2I2YA 5F9LA 1H7XA 2BJ1A 4C8ZA 4GVLA 1JI7A 1RHRB 2K89A 4IO1A 1WN7A 2KN7A 2K7KA 3QATA 5GADU 3D2EA 1WSRA 1RT2B 5J2BA 2GMHA 4RCHA 5AJ3K 4BRCA 4MFBB 4KH0B 2VG5B 2O4IA 3GIKA 4HDHA 2HK3A 5HMXA 3I9V9 2ZH1A 3FSXA 9ICEA 2XS7A 2VC0A 4KBIA 5I3UA 1HWIA 1SIJA 3PACA 4L72B 2UUBJ 1BWVA 2DPJA 2H3IA 2D5RA 5DGBA 1KONA 2B8PA 3I0RA 4K59A 4B9MA 2ZTCA 1RTZA 3MMCB 2CH6A 9ICSA 5KFCA 5M1NA 4TLQA 5IIIA 4CF3A 3PW0A 3MFIA 3UIQA 4PQUA 5AI6A 3HMJG 2M8DB 1OSCA 3C0BA 3MD3A 4ED6A 3DV9A 3QSIA 1F0XA 4OLAA 1WI6A 2Z30B 2CRXA 2EC0A 3MM6B 1J6ZA 3HD2A 2D0PA 5DB7A 4V19J 2VBZA 4O5BA 5KL8B 4LFAF 4GW6A 4MYTA 1ZJMA 1WF0A 3UCGA 1KFDA 4CHQA 2ABYA 4UY8O 5FRMA 5BYQA 4KAZA 1LVHA 1X1PA 2LFVA 3D28A 2AEFA 4OJ1A 3UO0A 4JI5K 3ZSXA 4CLKA 1N32F 4U7UK 2IHNA 1IR0A 1Q78A 3OTEA 3QIPB 4P10A 1RG6A 3J81j 2NCKL 1S6QB 3PG9A 4KH4A 3D0GE 2ZH2A 4YP3A 1UAWA 1DARA 1TYQB 1RT2A 4RR5A 3R6MA 2DNNA 2W2QP 1Q9YA 1ZQQA 1D1UA 1WSJA 4GV9A 3L95X 3OPKA 4DL0C 3RFAA 4XUSA 2JEFA 4XPCA 3B6PA 1S72S 2GMJA 3PVXA 2HBJA 3HSTB 3QFHA 4DSIA 1SGGA 2AJ1A 5I3UB 3CB4A 4Y2KA 1HI1A 1YJTA 4YR0A 1N34F 3DOMB 4OI3A 1ZD2P 2UZAA 2OFGX 1RBAA 4ETZA 5DB8A 4KLTA 2GTDA 5HROA 2F4VJ 1RGIA 2CJXB 1KQQA 9ICOA 1U8SA 1FI4A 2D7SA 4Q43A 1G3OA 4U7CA 2HGMA 2LDIA 4KHWA 2R7QA 1N2XA 4U96A 4DHVA 1QLNA 7ICIA 2Z4PA 1BQXA 1RGVA 4DI6A 4KT0C 1K6YA 4DU3A 3EMTA 1JXBA 2HBKA 1RA7A 4CLLA 4ECWA 3M2RA 4V19X 2OXOA 4OD0A 1URRA 4RW4A 5CP2A 1C0TA 2RS8A 2X1BA 3HHLD 2IPOB 4O55A 4F04B 1X4HA 1I3AA 2YCHA 2CDRB 4UUWA 2QARB 1J97A 4AUKA 1PC5A 4RBVA 2ZJPL 1S22A 2HK2A 4IFYB 4H0PA 5AKGA 2AHOB 1RDUA 5F3ZA 2JLFA 3L3FX 1RWXB 4ILJA 1FRJA 5M2RA 5CCMA 3H5YA 1UKUA 5J0PA 2VZ9A 4M47A 3R2DJ 1CULA 4NXNF 5FROA 4DQRA 1BY9A 2GBZA 4LIRA 4GKJK 5D6GA 2AJFE 3CC7N 2E5LK 3BZQA 4B9UA 5J0QA 4QZ8A 2YWFA 1JK9B 4CLPA 3QUTA 1S1VA 3M2UA 4GIBA 1YJUA 1RDWX 4BLGA 2E8PA 4N56A 3QJJA 3MTJA 5C7PA 4CWBA 4QQBA 1M90T 3T79A 4ZA1A 1CXQA 2HQCA 3KLEA 3PYGA 4F36A 1ASVA 2MQPA 2QKQA 3BO4A 1WF2A 2GO8A 3EGNA 2R7WA 3UMCA 4LMZA 1SBRA 4CEEA 1M1KT 3CCSN 2P5VA 4W5QA 3LP2B 5DRKA 4PZNA 2C2DA 2BA9A 3VEOA 4IRDA 1KOHA 4ES2A 1S97A 3C3LA 4A57A 3OR2A 1NDCA 1HNXK 4JLHA 2H3ZA 3G71N 4IRCA 3HX0A 3EKSA 5A0YA 4Y6IA 2AP1A 4EAHD 2Q66A 1ZQYA 3HKZD 1R8PA 2W54A 5IV3A 1WWUA 1LWCA 1Q8LA 2V52B 4CGZA 2BJEA 2ROPA 4CE9A 5JMNA 1LKYA 4KHPK 1SH3A 2RD5C 3O9TA 3CCQS 4LF4J 5KFQA 5B0EA 1X40A 2D9PA 2ZJAA 2KM8C 4CFDA 5EWEA 4DV3J 2XIDA 3MPUB 1TZ0A 5J0TA 4BREA 4G1QA 1WCLA 5J0XA 4WFYA 4B3OA 2WRMA 5IWAJ 3MX2A 4BROA 3EEQA 1GLBG 3DRRA 3THWB 1NJYA 3I82A 3A8YA 3AAPA 4OKEA 3RJIA 4IFYA 4K4SA 2IOFA 4LFCJ 4JV5J 3Q83A 4Z4GA 2XSJA 3MTKA 1N33K 1JJHA 4GVBB 4HCCA 4RX6A 1OYEA 3DLGB 2F7VA 3H5SA 2G8HA 3UD4P 1Y5LB 5TKWA 3BQ2A 3V9SA 4RW4B 4F3QA 3CMQA 1NU0A 4YXJA 1T3QA 2GQ2A 2BDUA 3C6TA 4CZGA 4O8UA 4F3MA 4W90B 2DNHA 3EZWA 1F3FA 4IFVB 4IXCA 4HVZA 2A1SA 2PBDA 2KKPA 3D6HB 3NGKA 4CGFA 2JC1A 1RT3B 1NHVA 4R0EA 5KFXA 2GAGC 1S1VB 2YJEA 3ZZTA 2ZM6K 1H0HB 5J2NB 7FD1A 4ZHRA 2A19A 2KB2A 4DTRA 4QJVA 1TKXA 4CH7A 3ZDDA 3U9DA 2AGPA 3ETOA 2ZHAA 1JXEA 3AVJA 2BTFA 3JQJA 3RJKA 4CF9A 3FVYA 3Q0AA 4PHAA 1FW6A 3SCKE 1SB3C 1SPBP 3R2CJ 1NDLA 4PG4A 5CA7A 1RI7A 2CNOB 2FMSA 4JI1F 2V9KA 4XIUA 6FD1A 3OS2A 3HCXA 3QWPA 5AXKA 2AA4A 5F3TA 1CXUA 3C2KA 3EUB2 2ISOA 2BKNA 1ZAVA 4CGHA 5ALDA 4QWBA 4F67A 1M5OC 9ICUA 4CJ5A 1PZNA 3IM9A 4P74A 1F5BA 4WQ5C 1PC4A 2YPZA 2YVSA 1Q18A 4PGYA 3PX6A 3SPYA 2HFZA 1YI2N 3GLJA 1NB7A 3THYB 3K2PA 2DK2A 4C8NA 1FVSA 5HROB 3QFPA 4P0PA 5KFDA 3R8YA 4C98A 1I94F 2G9OA 3H8SA 3S6JA 3AHPA 3VQDA 3BB5A 1DKGD 1N34K 1VRTB 1KDHA 1JMSA 4BGAA 2L9WA 3L4IA 2GVZA 3FRYA 3GP9A 1PSDA 3U8XA 4CZHA 4M0AA 1U09A 4OZLA 3KLFA 2WBMA 1A5VA 5IWAK 4M5LA 4L75A 4BACA 4GXIA 3EZOA 4LR8A 2OEMA 2DNKA 1XUPO 2AGQA 1YJRA 1YJWS 3OTCA 2V8DA 4RU2A 1CJVB 3JXUA 4ZCIA 4FYDA 7ICPA 2VONA 5J2FA 1FE4A 3AGRA 4I7FA 2RKIA 1N33J 4K4YA 3N01A 4QZ9A 4CCHA 3NE6A 3IBPA 3R9KA 4DCJB 1FNXH 3GBTA 4JYAJ 3MN6A 1ZQUA 1WSEA 1TUGB 5E79U 4FYXB 5D4PA 4FPIA 3IC1A 3QIOA 5CAAA 4DV7K 3Q8RB 2YHXA 4FWMA 2DHAA 2V68A 3G86A 5EX0A 2MY8A 3CJRA 4O5EA 1QZ5A 4MO4A 1GXTA 1ASUA 2XG8A 1GLAG 3TABA 4A8QA 1VQ6S 2NYVA 4FYYB 5D4NA 3M7DA 5E7OB 4DHYA 3KHGA 4NL9A 1HQEA 1VQKS 1Q82O 3BSOA 2BGGA 2VFVA 1VQ4S 2JXJA 2WC9A 2HVEA 4BVPA 2MZSA 2GV1A 4EENA 1Y00A 1GXUA 2AEMA 3CCZA 2NLXA 4IDKB 1S6PA 4LRFA 3I96A 4YOYA 4M5GA 3SBTA 4KLQA 1Z2LA 4ECQA 2A3VA 5FDLB 3MBYA 3TQ1A 5AQRA 3ZNJ1 3R9PA 3CNHA 1WC3A 2DHSA 4G65A 2P9SA 3L2RA 5ALXA 1QSSA 3TEHB 2JZBB 9ICRA 4PL2A 4I67A 1NHUA 4JKAA 1N88A 2A0FB 3OXGA 2CQHA 4RQMA 1QE1B 3PHTA 2YTCA 5KG7A 3M6WA 3THXA 4FJ5A 3KHYA 2W25A 3C19A 3C6UA 3ZC4A 1SWVA 1QSYA 2HHXA 2LBOA 1GOBA 3QLHB 2NZ4A 4QS9A 4FJ8A 4WXOA 5DQHA 1K73T 2M0GB 4WXWA 3A1YG 2LKYA 1VQ8S 3RJGA 3ZTRA 1R31A 4DPYA 2AYGA 2PSZA 4GKJF 3QEVA 5DB9A 2CDQA 5A0YB 3C6AA 1IG8A 1YWXA 1C0UA 1ZZNA 2A1JA