2XY7A

Crystal structure of a salicylic aldehyde base in the pre-insertion site of fragment dna polymerase i from bacillus stearothermophilus
Total Genus 188
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
188
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHAAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWALERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGEELAEQLRTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKSKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQARLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Reversible Bond Formation Enables the Replication and Amplification of a Crosslinking Salen Complex as an Orthogonal Base Pair.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords DNA POLYMERASE I
total genus 188
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2010-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2xy7A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 2xy7A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2xy7A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2xy7A01
3EYZA 4KLFA 3G10A 2JZBA 1KFSA 4Q5VA 7ICHA 3WNHA 4CJKA 3SQ0A 3AVCA 1BPBA 5J0UA 3H4DA 4F50A 4ECSA 3QLHA 2R8KA 3O3GA 1CXQA 1XO1A 5D4BA 2OZSA 1D8YA 4RQ0A 1BVSA 3JPNA 1NJXA 2HMIA 4CJUA 3ZSVA 3OSPA 3RMDA 9ICOA 4OVLA 5JS2A 1NKEA 4I2IA 1K6YA 1RDAA 2Z1GA 3M8PA 2D0AA 3OVNA 3KK3A 3PMLA 1BISA 4K4HA 2F96A 2FBVA 4LSLA 5IIIA 4RQ2A 3UPQA 4BACA 4OKJA 4FJ7A 5DGAA 4E1NA 4XUSA 3N97B 4TURA 5KFRA 2ISOA 4DSLA 4K8XA 1FXXA 4BE0A 5J0XA 1DTTA 5KFXA 2XHBA 3NF6A 1ZQWA 5IINA 3RH4A 4DTXA 4KLMA 3AVIA 3OYFA 1VSKA 3M9MB 4BE2A 4FM0A 4KLDA 2BKEA 4OJRA 2HHSA 4CJEA 4B9VA 1Z26A 4UB3A 4DQPA 4CEFA 1ZQBA 4Z4EA 4F4KA 3MEGA 2C22A 4PHDA 3H4BA 4K8ZA 3OYJA 4RQ7A 4I2FA 4QZ8A 4FJ9A 1JLFA 2P51A 4Y1DA 4DSKA 3DMJA 2ASJA 3BQ0A 3NBPA 5DDMA 3NH0A 3HYFA 3G0ZA 5HHHA 4ED6A 1RNHA 3K5OA 3CFOA 3SZ2A 2W9BA 4ED3A 2KW4A 2ZUDA 4B9UA 3CFRA 4E7JA 4ELUA 3PR5B 4C8NA 2W8LA 1NKCA 3ZSXA 3HWTA 4EP5A 3GV7B 1XWLA 1U9LA 1ASUA 2JLEA 3LAKA 5J2JA 5KG2A 1Q9XA 5JS1A 4DFJA 4TSXA 4QZGA 5SWMA 2W9MA 1QSLA 1HUZA 2BGGA 3WNFA 3B0XA 3C2KA 3AO4A 3OYKA 2E6LA 2FPKA 3MXIA 5KFUA 4Q43A 4NCGA 4YP3A 5DQHA 3LP1A 2BQRA 8ICCA 1W9HA 3QERA 4AHCA 3QNNA 5CYQA 1VSFA 8ICEA 1C0MA 1EX4A 4CHYA 3VA3A 4KTWA 4M9HA 1NOZA 4YMMA 3HK2A 4M0AA 4CF1A 4CFDA 4KTZA 8ICTA 2HNYA 4XIUA 2AU0A 2ETJA 3KLIA 2W9AA 1HQEA 3VQ6A 4QW9A 1S1UA 4GC6A 1N5YA 1BI4A 1JLEA 4QWEA 4FLUA 4KLJA 4IFYA 2FMQA 3C6UA 2OZMA 1XC9A 5EWFA 3V7JA 3G6YA 3RJIA 1TVRA 5J0QA 1XU4A 2ZTDA 3TR8A 3LWLA 4MEYA 3KHLA 1IO2A 3SUOA 4W5TA 2ZUBA 4TQSA 3KLHA 3VQBA 1RXVA 2R7YA 4ED0A 3L8BA 3OHAA 5C24A 3OYHA 1ZQJA 4KLIA 1REVA 4E7HA 2HNZA 4W5QA 3OJSA 5HLFA 3SPZA 2MAXA 4EYHB 4IQUA 1ZQQA 3SNNA 1JKHA 1RBUA 1L3TA 1T3NA 1NK0A 8ICUA 3AV9A 3MR3A 4OPJA 1NJWA 4BDZA 3EY1A 1JX4A 4IG0A 1X9SA 5KGWA 3HX0A 1NJYA 2ITGA 4TQRA 1CUKA 1WSGA 5C5JA 1ASVA 1N48A 1A5WA 2W8KA 1WN7A 4F4ZA 4N5SA 4M3YA 4FJKA 3OYNA 1ZQYA 1WSFA 4HTUA 4RPZA 2XCAA 2DFFA 4MQ3A 4FJLA 4KLGA 4ED2A 4O5CA 5F9NA 2FLLA 4FJXA 1XSLA 4QWBA 4DSIA 1UWBA 4Q45A 3RRHA 4FLYA 4I2EA 4KLQA 5D49A 2FLNA 1JL2A 4DTPA 2KQ2A 1XHXA 3DRPA 4IBNA 2BPCA 1TVAA 4Z6EA 1WAJA 7ICGA 3HP6A 1NJZA 4M47A 3TI0A 4CK3A 4KI4A 9ICCA 4P2HA 5J2BA 3H08A 1EETA 3C94A 1WNSA 2PY5A 3QE9Y 3RJHA 3RJJA 1Y97A 2NRWA 5KFGA 4JS5A 4ZHRA 4ICLA 5J2EA 4CJ4A 3HSTB 5FDLA 4FM1A 4EBCA 4YVZA 1Z00A 1SL2A 2PFPA 4K4GA 3S9HA 1HNIA 1IKYA 4LD0A 1XHZA 1N6QA 4NCBA 4M9GA 1TK0A 3P1GA 3JPPA 3VQDA 3IG1A 4NM1A 1LV5A 4FJIA 5HBMA 4F5OA 5KFMA 2PZSA 4M42A 3RAQA 1KVAA 3C5FA 2ATLA 4CE9A 4KHYA 3VQ8A 1VK0A 4FW2A 1UOCA 2BQ3A 1VSIA 4CEZA 5SZTA 4XQ8A 3KK2A 1D5AA 4FS2A 1VSDA 4ID5A 5IILA 4O0IA 3V9UA 3HL8A 4QZDA 4OKKA 4CJFA 8ICBA 4KLHA 2C2RA 3TAGA 2IDOA 5HRRA 5HRNA 1HYSA 3LK9A 1EXNA 4GLXA 4EYIB 3Q8SB 5KFLA 3OYIA 2KTQA 3EPGA 4UB1A 4CEQA 4M04A 3C1ZA 4J2DA 3MECA 4HCBA 4R8UA 5DQGA 2LYHA 2I9GA 5KFVA 4B9NA 4MFCA 5J2MA 3S3OA 1SKWA 5DBAA 3RRGA 4DMNA 3DLBA 4YR2A 4CCHA 4FCYA 2JEJA 3KD1E 7ICSA 2Q0ZX 5DDYA 1RDDA 4CEOA 4YR3A 1JIHA 1YTUA 4ECVA 2W9BB 3CYMA 4ID1A 3RJEA 3QESA 4KN4A 1S10A 4QWAA 1BGXT 1GOCA 5KG4A 1ZQKA 4HVJA 4FS1A 5KFFA 2XC9A 2IC3A 4J2AA 2R8HA 4CEDA 9ICMA 3OYDA 2G8IA 4FM2A 3RJGA 3FFIA 3Q8KA 3O3FA 3LALA 3KD5E 4QCLA 4N47A 7ICUA 1RTDA 3MFIA 2HVHA 3AO2A 4LSNA 4CHPA 4I2JA 4DS4A 3SCXA 1S0VA 3BDPA 1KVCA 1CEZA 5KT2A 4RW7A 3NGYA 3KTQA 3SQ4A 5CZ1A 3NGDA 4R65A 2PXIA 3RH6A 4UB5A 4EP4A 9ICWA 3TARA 2BCVA 1N56A 5J2HA 3KIOA 5KT3A 1DOQA 2QK9A 1HYZA 4LVSA 5HP4A 2IA6A 2A1SA 4TUPA 3QEPA 4RU9A 8ICRA 1C0UA 3D45A 2ZJ8A 1B9DA 3LZIA 4KLTA 3KKSA 9ICBA 4B9TA 4I27A 4YD1A 4FXDA 4RQ4A 3C2LA 1JN3A 4CJVA 1J5OA 3NF9A 1G15A 4RNMA 4FJJA 4DWIA 2AGQA 3QZ7A 3OYEA 4Z4CA 3L2UA 2FC0A 4CERA 2NRZA 2DFHA 1ZQEA 2UVVA 3KLFA 8ICSA 5KFNA 1X2IA 2D5RA 4MF2A 1RBVA 1XI1A 3PVXA 3N4MB 1ZQRA 2AJQA 4W5RA 4FJGA 5KFCA 4CGGA 3NF7A 4I2GA 5HROA 1VSMA 1HMVA 4P4OA 1RT2A 3RB3A 4CIGA 3GILA 1L3VA 1T7PA 1BL3A 1IH7A 2P66A 4J9OA 1ZJMA 1S1TA 1IKWA 4GMJB 3ISDA 2YKMA 2G8UA 3ZSYA 2F1IA 4AHVA 2ISPA 2ASDA 3RBEA 9ICSA 3K5MA 1ZQCA 1MC8A 4DOBA 1ZQTA 5D3GA 2A1JB 3OYMA 1CZBA 4PH5A 4CK1A 5CWRA 4LY7A 2PI5A 1ZQFA 5DK5A 3QO9A 4EEYA 4EBDA 3VQ9A 2KN7A 1D9FA 1I3AA 2NRXA 3AVFA 4DQSA 1RYSA 1ZQOA 3GIJA 4I9LA 3HPOA 3GV8B 1RT3A 3TAMA 3V9SA 3QEBZ 2O4IA 2QKKA 1HYVA 2X74A 4H8KA 5J2GA 2VWJA 1C7YA 2JZBB 1FKPA 1TKZA 3T1AA 3L2QA 3S3NA 4F3OA 9ICPA 1I39A 5CHGA 4GXKA 3K2PA 3SUPA 2RKIA 5DBCA 2AGOA 4YD2A 3AVAA 3KK1A 4CHZA 4KLOA 1BIUA 3TFRA 4M3UA 4FLTA 4RW6A 2KFZA 3SI6A 1KLNA 2EHGA 8ICQA 4DOAA 4B08A 4F92B 1DGSA 3AA3A 4J9QA 3JSMA 4DS5A 4CEBA 3SV4A 4Q8EA 1UT8A 1ZQDA 5DGBA 4P4PA 2HHWA 4PPXA 1ASWA 4RQ1A 4B8CA 3OJUA 4NCAA 3T5JA 2C2EA 3GV5B 4KRFA 5DB8A 2EX3A 3RTVA 4B9SA 4PA1A 4YG2A 3UXOA 1HQUA 4FVMA 3DI6A 1C1BA 3QEWA 1SL1A 1TGOA 1B9FA 3ZDEA 3DRSA 4B9MA 3SUNA 4KB1A 1ZBLA 3HVRA 4J2BA 5EOZA 1RTIA 5DMRA 4KN7A 4OLAA 3GIKA 4Q0BA 1SUQA 8ICLA 4I7FA 5HP1A 3C23A 2OWOA 1QS4A 3H8WA 4OGCA 1SZPA 4QOZB 2BQUA 5L1LA 3EWAA 3NDKA 2XO7A 3OS0A 3MAQA 1S9GA 5DB7A 3HW8A 1KDHA 1CLQA 2WTFA 3PW2A 2H5XA 2HW3A 4MFBA 4F2SA 4M9NA 3QIOA 5KFKA 4JV2A 2P1JA 4DSEA 4QZIA 4IG3A 3OYLA 3DLHA 5KG0A 3ULDA 3ZSRA 4UAYA 4Z6CA 4CGFA 4MF8A 4DU4A 5KG5A 4DQIA 5KFHA 9ICJA 4O9MA 1WSIA 2BCQA 2X78A 1TK5A 3HPHA 3OHBA 4O3PA 3DLGA 3K4GA 1MSWD 5KI6A 4EBEA 5C42A 4ZTJA 1D8LA 8ICOA 2W9CA 1TFRA 4J2EA 4J9RA 1JXBA 1U4BA 4O4GA 5DB6A 3JPQA 1HUOA 2OYQA 3RJKA 2JEGA 4CIEA 5CB1A 4E1MA 2UVRA 3F73A 5J2DA 3OYCA 4C8MA 1FKOA 3L3VA 4QWCA 1BQNA 2IOCA 2X6NA 1RPLA 1SV5A 1ZQAA 7ICQA 4I29A 4JWMA 3T19A 5KFJA 2D0CA 4DTSA 3DYAA 4CHOA 1WSEA 3PX4A 4PGXA 3MXJA 2HHTA 2PFQA 3MEEA 1KFDA 4KMUA 2HHXA 4TUSA 4RG8A 5J2NA 5J2IA 3PW5A 3QETA 1D9DA 5I42A 2GWSA 2XCPA 4DG1A 2YV0X 1O1WA 4DFMA 5CY4A 4DLEA 4YR0A 3RB4A 3TAEA 7ICTA 2FBYA 1ZQPA 4NLGA 4E89A 3H7IA 5KG3A 4LZGA 5DLFA 4DL3A 2WONA 1NK5A 4J9LA 2FLPA 1XS9D 4CESA 2HVIA 4ECUA 1V9PA 4I2CA 3FDSA 3U6FA 4B9LA 4BXOB 3U3GA 1VSLA 4RQ5A 1TL3A 5IIOA 1QSSA 1B22A 3OS1A 3UIQA 1S9EA 5KGXA 4RQ3A 1JLGA 4UBCA 5CR0A 2BHNA 2OPQA 3MXMA 3ASMA 3MGIA 3F9KA 3QEVA 4KHWA 3RMAA 4RZRA 1T4GA 4R66A 1RILA 2BPFA 5KT5A 4KHUA 3BJYA 1ZQIA 4M3XA 3V6HA 1BI4B 4CHQA 3RH5A 1IG9A 1U47A 3HXMA 1QHTA 5TZVA 2G8VA 3AVKA 5J2PA 5KFIA 4J9NA 3IS9A 4KHSA 8ICMA 4ED7A 4W5NA 1Q9YA 7ICEA 4CF8A 2O4GA 5CJ7A 2XGQA 1COOA 7ICOA 4KLEA 3GIIA 5DLGA 4ELVA 5K14A 2XY5A 1RT6A 4OKEA 4RW4A 3V1QA 2E4LA 4BDPA 3KHHA 9ICRA 2F8TA 2ZTEA 3OS2A 4RT2A 3QEIA 5J2AA 1EKEA 4DTJA 5J1EA 1JL1A 3PW0A 3RWUA 3ZT1A 3ZDDA 5FRNA 3M8SA 1Z3EB 4IRKA 4AILC 3ZSWA 5HRSA 7ICMA 3FYHA 4QZ9A 3C2MA 1NK8A 5KT7A 4N41A 5J2CA 3DOLA 2P6RA 4DF8A 5IIJA 2Z1JA 4PGYA 8ICWA 4BE1A 5J0WA 3VQCA 3SJJA 2ZJ5A 4GXJA 1AROP 9ICUA 1IM4A 2DY4A 3P83D 2A1JA 1U45A 2IHMA 3DLEA 3K75D 1WCNA 4N76A 4LZDA 4HUGA 3TQ1A 9ICFA 1Z25A 4RW8A 3JPSA 3AU2A 4ECYA 1SKSA 1RT7A 4O55A 1NOMA 3EW9A 1GOAA 3M8QA 4DL2A 5DG7A 1S97A 3T5LA 3AUOA 4F5NA 1ZBHA 3NHGA 4HUFA 5KRTA 1WCLA 4FLWA 4X5VA 5DB9A 4QZAA 4NM2A 3DOKA 4OLBA 5IIKA 3PW4A 2Q3SA 3ISBA 2FBXA 4I2AA 3VQ5A 5J0SA 2NRTA 2BR0A 2I1QA 4N56A 2AGPA 4PGQA 4KHNA 4R63A 3QNOA 1BIZA 3MBYA 1X9MA 3H8JA 4DTUA 5KRSA 3PW7A 4M3WA 2FBTA 1RDCA 4JS4A 5EWEA 3JPTA 1C1AA 3UQ2A 4IR9A 2IGIA 1BPDA 4FLXA 3AVNA 3M9OB 3V1RA 4YQWA 5BOMA 3QEXA 1VSEA 1TV9A 2IAJA 1XSPA 1BPEA 2E6MA 4O3SA 2F8SA 5J29A 2IBKA 3V6JA 9ICAA 4I2PA 3PUFA 2OPPA 4B8AB 5KFEA 1RXWA 1S0NA 3NFAA 3L2VA 3L2WA 4CJRA 2RF2A 2OPRA 3DRRA 4MFAA 3VQPA 4GVMA 9ICGA 4HHTA 1KSPA 4AH9A 3ZSZA 3NAEA 1JXLA 4CJ3A 4F5RA 1X1PA 4RUAA 4KHQA 1VSHA 1HNVA 4KI6A 3V9WA 2XY7A 1RT5A 4DF4A 4Z6FA 4PHAA 3PY8A 4KAZA 3UQ0A 1TKTA 4QZCA 3H8SA 4FYDA 2IS3A 4DU3A 1L3UA 3THVA 3VQQA 4PUOA 1S1VA 3IAYA 2M9NA 2P6UA 1LW0A 4J9MA 2BGWA 4ECQA 5KFQA 2ASLA 1ZQSA 3Q8QB 5L9XA 4M3RA 2ALZA 1VSJA 3QINA 3NCIA 3AVLA 3V7LA 4JWNA 2DTUA 4F93B 8ICFA 5KFOA 1YVUA 3V6KA 5J2FA 5BPCA 4J9PA 2BE2A 1LAWA 1IKVA 3RB0A 3DM2A 5KFDA 2YKNA 7ICLA 1B92A 4H4MA 3IM1A 4BWJA 4E7IA 3RAXA 2B4JA 3VA0A 3OSNA 3MGHA 3ZSOA 4J9KA 1BCMA 1LWCA 4Z6DA 4RPXA 4DO9A 2J6TA 1BPXA 4PHPA 1WSHA 3ZDCA 1TL1A 3QEAZ 1TAUA 1U49A 4GW6A 3PV8A 1FK9A 3BGRA 3KLEA 3KJVA 5L1JA 2VANA 3LPUA 2JEIA 1VRUA 1BPZA 1YT3A 2G8HA 4DTRA 4AHTA 3RBDA 3B6PA 4RNNA 3GFKB 1MU2A 3D0PA 3LP3A 1ZQHA 4FBTA 1S6QA 4AHSA 5J0YA 4JV0A 1ITGA 3BQTA 5KFAA 4KLLA 5J0OA 4I2HA 4M41A 3AVJA 2PFNA 3BQ1A 2QXFA 2GBZA 3PMNA 3E2EA 1ZQVA 1XSNA 3ALYA 1TKDA 4F4WA 5CZ2A 4AHUA 2X6SA 9ICKA 1S1WA 4QZEA 3T5KA 1PZNA 1S77D 1ZQNA 4W5OA 4B3OA 5KFTA 3C5GA 4IKFA 3K5LA 2Z1HA 1RBTA 3CFPA 3HT3A 2HHVA 3RB6A 3V81A 3CM5A 3SPYA 4KREA 3H40A 3AA5X 4UAWA 3AA2A 1JLCA 1C1CA 4M9JA 5DKWA 2QKBA 1S0MA 4EZ9A 1UAXA 1U48A 1RTJA 1NK7A 4CF0A 4CHNA 2ZJAA 1ZQUA 3ZT3A 4R64A 4O5KA 1RTHA 1RYRA 4YCXA 3PX0A 1NK6A 4M3TA 2XRIA 9ICVA 4CEAA 1F21A 2FMSA 3V6DA 1BHLA 3TFSA 4QAGA 4IFVA 4DOCA 4O3RA 3P5JA 1S9FA 5D46A 2XY6A 4I28A 4G3IA 1NKBA 3AO3A 3RJFA 2R8IA 3A2FA 4JLHA 4IRDA 3QIPA 1ZBFA 4DL5A 5E41A 4CFAA 1ZQMA 5F9LA 9ICQA 2OPSA 2RDIA 4ECXA 3TAQA 8ICGA 3CQ8A 1KCFA 3ZT2A 4PWDA 5FROA 4CF2A 4CJSA 4IDKA 3SUQA 2PYLA 4KV8A 3HM9A 3LDAA 2B6AA 1Q8IA 3ORYA 3PO5A 1QSYA 3TAPA 3K58A 3K59A 4DSJA 5KFSA 2VG6A 4E7KA 3MR5A 4UBBA 4YXMA 1A77A 1SL0A 3G6XA 5DG9A 4C8LA 3ZT4A 2IHNA 1IXRA 3LAMA 4EZ6A 4CJPA 4HCCA 4IQVA 5KTQA 4R8UB 2KZ3A 2VA8A 1TAQA 4RT3A 2I5JA 4CJLA 4DEZA 1RCHA 1UT5A 1QTMA 4NXZA 3HO1A 4NY8A 2DFLA 4NYFA 3ISCA 7ICKA 5KG7A 1RT4A 3ZD9A 4MFFA 3HPGA 1J53A 4CJTA 3AVMA 2KFNA 1J54A 2WOMA 4FO6A 8ICHA 3GIMA 4IR1A 1S6PA 2LSNA 4BWMA 3S3MA 4NLNA 1TK8A 4L8RB 4NYNA 9ICTA 4PHEA 2YHAA 4KPYA 4BGDA 3TWHA 2BPGA 2RPIA 3IRXA 4QZBA 2FPLA 3OY9A 4MEXA 3Q8LA 3WNGA 2VG5A 2HHQA 2FPMA 3I8DA 2YNIA 3DLKA 1EP4A 2YHBA 1ZQLA 4JRQA 3HVTA 1H38A 4E0DA 2ZE2A 1KFTA 8ICZA 2UVWA 4Q8FA 8ICYA 4OGEA 2PYJA 4F2RA 3Q8RB 3O3HA 4JK1A 2G8KA 4FBUA 1BCOA 2ZD1A 3V4IA 1JXEA 2C28A 2HNDA 4CGHA 2A1RA 3G6VA 1CXUA 3OGUA 8ICJA 3V72A 2YNGA 1LAVA 4Y1CA 4CJWA 4O44A 1X9WA 4YFUA 5EU7A 4I2DA 3NE6A 2ZUCA 7ICVA 1UA1A 5HRPA 3VQAA 4PY5A 3B0YA 5KG6A 2HHUA 5J2KA 5T7BA 4CJ5A 4O5EA 1L3SA 1A76A 9ICEA 3HP9A 3SQ2A 1IKXA 5KFWA 2GV9A 9ICXA 3OYGA 2ATQA 3PNCA 3KKRA 4FZXC 4M45A 2VA2A 4KTQA 5CYMA 4ED8A 1ZYQA 5J0TA 1QLNA 5HMMA 4KO0A 3SQ1A 3M9NB 2BCUA 3RMCA 4DLGA 3NH2A 5J2QA 4DQRA 2Z1IA 2VA3A 4CJQA 4F5QA 4H4OA 1ZJNA 1NK4A 3NTUA 3AVGA 3I0RA 4UAZA 3MR6A 2V4RA 2PI4A 4UB4A 4CIFA 2C2DA 2Y1JA 3AO1A 2YNHA 4E7LA 3LWMA 1KLMA 4CGDA 4DTNA 4CGJA 1KTQA 3GQCA 4YFKA 5JUMA 2F1JA 4XRHA 4DU1A 2AQ0A 5HHIA 3MEDA 4FJ5A 2KZMA 3ETLA 3ZSQA 4FLZA 1A5VA 1QQCA 2P5OA 3OYBA 3RMBA 4DL6A 5J0RA 2IMWP 4C8OA 4CECA 2V9WA 3UXNA 3AO5A 4Z4IA 1RT1A 2FMPA 1JLAA 1WAFA 4PQUA 4TUQA 4WE1A 4YN4A 4RQ8A 1LW2A 3WNEA 4JRPA 4Q44A 2XGPA 3SI8A 1L5UA 2B21A 4FZZA 4R5PA 4FK4A 3JPOA 4CFCA 1RBRA 3NH1A 4KLSA 4CFBA 1J9AA 3MFHA 2NUBA 5KFZA 1SKRA 2J6UA 4AHRA 3ZCMA 2KZZA 4JV1A 3MABA 2F1HA 3L3UA 4NLZA 2YNFA 9ICLA 1HJRA 4O3NA 4FK0A 5BOLA 4F4XA 3TAFA 3VQEA 8ICPA 4OPKA 3EPIA 3VQ4A 1KRPA 3LZJA 3RR8A 2AQ4A 3O4NA 5KG1A 4M2YA 4KLUA 1T05A 3AU6A 4C8KA 7ICNA 3M8RA 4YXJA 2MUTB 2DPJA 4F4YA 3Q8MA 2RDJA 2R8JA 4M6WA 7ICRA 4ECZA 3C6TA 4FW1A 3LDSA 3B6OA 3TABA 3EZ5A 9ICNA 2W42A 2UVUA 1K1SA 4Z4FA 3DLRA 3L2RA 8ICAA 7ICIA 1TV6A 5KT6A 3NF8A 5KFPA 2D0BA 7ICFA 2ZTCA 4RQ6A 5L1KA 3LP0A 5HMLA 3C21A 3SV3A 3I0SA 3GDXA 1BQMA 4F8RA 3OYAA 1KVBA 1JLBA 3JPRA 1T8EA 1K1QA 4CGIA 3MDAA 2J6SA 4I9QA 4RW9A 2Y1IA 3PX6A 4FJHA 8ICVA 3C95A 1DLOA 1HPZA 4M3ZA 1RZTA 4UB2A 3CM6A 1HJPA 3UXPA 4F91B 4YMOA 4ECTA 1A5XA 4DL7A 5CP2A 9ICIA 1KEJA 1MQ3A 2JGUA 5DBBA 4XA5A 3MR2A 4CK2A 1ZQGA 3O4QA 1VRTA 4BDYA 4YNQA 4YMNA 4RPYA 3PO4A 4DSFA 2MUTA 4I2BA 3VN5A 1ZBIA 4FK2A 4O3QA 4IRCA 1CZ9A 4DFKA 4J9SA 4F3TA 1R0AA 3V9XA 4ECWA 4KFBA 4LH5A 1ZBUA 4KB0A 4GXIA 3T3FA 5HNKA 5I3UA 4O0JA 4DL4A 1QE1A 2XY8A 2P5GA 2VWKA 3LP2A 1JMSA 3BQ2A 2VG7A 4KKOA 4NLKA 2BCSA 4LH4A 4IQWA 4M9LA 5IIMA 2GUIA 4F5PA 2NRVA 1T03A 4O3OA 1U04A 1JLQA 4BXOA 4CEEA 4KITB 3NGIA 2G8FA 3VQ7A 2DFEA 4FJMA 3ISNC 1GOBA 8ICKA 1S1XA 4O5BA 2V4QA 1HRHA 4E19A 4DTMA 5J0PA 3JYTA 1C6VA 3AA4A 3IHQB 1BPYA 1EXQA 3V7KA 4IQTA 4DTOA 1Z00B 5EWGA 1ZQXA 1Y88A 5DG8A 1S76D 1YTAA 2PFOA 2OA8A 2G8WA 5CA7A 4K4IA 4QZHA 1DTQA 3MDCA 5KT4A 3K57A 4CF9A 4ELTA 1ZETA 1UA0A 1RBSA 2W9CB 3ZDBA 4Z4GA 7ICJA 1S5JA 3SYZA 1S0OA 4Z0UA 7ICPA 3ZT0A 4QZFA 5C25A 4DQQA 1LWEA 1WLJA 3KHRA 3C1YA 2HB5A 4ED1A 3AVBA 2DPIA 4FJ8A 4FLVA 4HYKA 1NOYA 4UQGA 2BDPA 4GC7A 3TANA 5KFBA 4P4MA 4QWDA 3T5HA 1ZQZA 2BCRA 3AVHA 3ITHA 5DQIA 1WSJA 4DFPA 4I2QA 4M6WB 2BANA 3QZ8A 3E01A 3K5NA 3RR7A 3ZDAA 8ICXA 1LWFA 1B43A 1C0TA 4G1QA 1MQ2A 3PR4A 1NK9A 5KFYA 4HUEA 1LB2B 3Q8PB 4RUCA 2B5JA 1RDBA 3ZD8A 4QW8A 3V9ZA 5L1IA 3LANA 3KHGA 4ZH4A 4ECRA 2R8GA 4ZTFA 3U3YA 8ICNA 3CG7A 3KLGA 9ICHA 3LPTA 3NGZA 4FJNA 2JEFA 4JUZA 3HJFA 4E3SA 4FZYA 4RNOA 2ZQBA 4Z4HA 8ICIA 2RN2A 3V1OA 5FRMA 1TKXA 1W0HA
chains in the Genus database with same CATH superfamily
1VQ4S 1KFSA 1HKBA 2LXUA 1KQGB 2UU9F 1BPBA 2EC2A 3IV6A 5EN1A 2IVFB 1L7PA 2IOHA 2IJFA 2MLXA 5D4BA 5DM7Q 3UMCA 3GJSB 2Z7JA 4RQ0A 2BRLA 1FO1A 4LF8J 3MM7A 3F9MA 4WF9L 5LL6d 3ZSVA 4LF6F 1RHUB 3LTOA 1RGVA 2ZVSA 4OX8A 2EFQA 3A8EA 3J7ZT 1Y5IB 2A40A 4I2IA 1XMQK 1RDAA 1TUVA 4UY8O 2I7PA 2K8BB 1BUXA 2XSFA 2F96A 1RBOB 3NOCA 4ANCA 2FBVA 4JP8A 4LSLA 5IIIA 2RP5A 2KL8A 4OKJA 4FJ7A 5DGAA 2BM0A 4E1NA 4UY85 4ILJA 2JVOA 2Z2MA 5J0XA 3D0GE 1QVFR 1ZQWA 4CD3A 3RH4A 4DTXA 4KLMA 5C25B 3CIPA 1RM6C 3OYFA 2HF3A 1S5ZA 1FX2A 1RCXB 2VDIA 3NGUA 3HRGA 4KLDA 2ZUGA 2BKEA 4RWTA 2Q3PA 1TKTB 3QRRA 1N5WA 5K14B 1JJ2M 2ZDPA 3M7DA 5DDOC 2CRXA 2K60A 1JRPA 3MEGA 4B3SF 4TVAB 4PHDA 3POTA 2QMUB 1TQLA 4OJHA 1IBKJ 3H4BA 3HFKA 4CH7A 3EUNA 4I2FA 4OO1J 1JLFA 2K4HA 3DMJA 3KZBA 2ASJA 3LYSA 2ZIVA 3MR7A 3NH0A 1T05B 5HHHA 1HBMA 4LRBA 1Q5VA 3CFOA 3SZ2A 2W9BA 4KYZA 3BPSP 2KW4A 1HWIA 4WZQA 4BS2A 1EQ0A 4X62J 3AD7C 1N4LA 2O01C 1UFLA 3AQOA 2HBZB 3C16B 5CHIA 1XWLA 1ASUA 4IC9A 3LAKA 1MLAA 5HL7L 2ILYA 4TSXA 2FI1A 4A2BA 2CGJA 4GNIA 4QZGA 3SIPB 3KUHA 5D4LA 2Q43A 8ATCB 1HUZA 3C2KA 3AQEA 3SQIA 2WVEA 4YHHJ 4DV3K 3CJ3A 3CJ2A 4KJIA 2XMJA 5DQHA 3BGUA 2FJ6A 4RTFD 3BSAA 4X64F 2XO6A 8ICEA 1UW9A 4CBUA 1X42A 5AM1A 4B1UB 1B7FA 4YMMA 2LECA 4M0AA 1L7MA 2YNHB 1TE2A 2W9AA 3D6MB 4GC6A 3W5ZA 4ZPAA 3GOIA 4FF2A 1JLEA 1R7IA 2VUGA 1R0CB 4FLUA 4KLJA 4IFYA 3C6UA 2QFJA 3CF5L 3D6RA 2HGNA 4ZVFA 1BO5O 2BABA 4YDDB 3F5EA 4E8UA 1NSAA 4PWUA 4MDBA 5J0QA 2JVRA 4MEYA 3KHLA 3R8YA 3DRRB 3SUOA 1DHMA 4KX5A 3VF4A 4RBTA 1RLDA 2IFXA 2POKA 5D4PA 3DOKB 2LHTA 1REVA 2CAJA 7AT1B 5EDWA 1RAAB 4DV1J 4NLBA 5FLXY 3SNNA 3CCLN 3GWCA 5AFUH 3AV9A 4CBWA 1WG1A 1D0EA 2IOFK 4OFZA 5CR4A 3BZKA 3J7AN 1NJWA 3WXJA 1YJVA 1HL6A 4BDZA 1B0PA 2DEIA 3G82B 3C0BA 1WG5A 4NRUA 1QM9A 1RB0A 4WCEL 4DR2J 2WBMA 2QARA 1VC0A 4GMKA 5AR0A 1MN8A 1ZQYA 2FGCA 2YWKA 1Q81O 5IT4A 4HTUA 3D2WA 1ZPVA 2HGMA 1F1BB 5HAOA 4NXMJ 4OZ3A 4WJ3B 4MQ3A 4FJLA 4KLGA 3K8VA 2HNDB 2VOOA 4FJXA 1RTHB 4QWBA 4DSIA 4FSVA 1C0FA 3RRHA 4FLYA 3OTCA 3FC4A 1JL2A 5H1SV 3D0IE 1QAIA 2DGZA 4UZCA 1ZAVA 1QQ6A 4Z6EA 3UR3C 2VPWB 2FJBB 2LQ8A 4MT1A 3NAIA 3H08A 1ZD4A 3TVZA 3PEJA 4WFBL 3RJHA 1Y97A 3CDEA 3ISZA 3CMEN 5KFGA 4JS5A 3TRGA 1GLDG 1CI4A 3CCLS 3HSTB 5THWA 4OX9F 2BUPA 3UD4P 3CJ7A 2WF9A 1NPRA 1Z00A 1DFDA 1NGCA 5AXNA 2IDEA 1S6QB 2VBXA 2OUGA 1XHZA 1N6QA 1HIWA 5CCLA 5K4LA 2BZFA 2ES6A 5HBMA 1NM1A 5TKYA 1BY9A 2YX4A 1Z2LA 2GQCA 3NG8A 1UW4A 2BX6A 2E2NA 3QT6A 3R3TA 4DL0C 3K5PA 2FHJD 1VSIA 4XQ8A 2YI1A 4FWRA 2LEPA 3GFXA 1WEZA 3OL8A 5KOXA 2WW8A 1D5AA 4IEEA 3ULHA 2NO4A 1E6VB 5IILA 3LL3A 4OKKA 2EFVA 3NY0A 1S6OA 3PRDA 1FRLA 1RK8A 4MYTA 1VLOA 1HBUB 4CLYA 1HFEL 5AFUA 4GLXA 3Q8SB 4DKWA 3H46O 3OQ2A 4UB1A 4CEQA 1H1VA 4FE3A 4R8UA 2I9GA 3DGPB 1QVGM 1X4DA 5DBAA 3RRGA 4DMNA 2E88A 2JEJA 4FCYA 3KD1E 4AQYJ 2Q0ZX 5DDYA 4DV2J 5EVZA 3MM9B 5DO2A 1V4TA 2QMXA 4ID1A 1IR2A 3RJEA 1S10A 1IKWB 3P39A 4QWAA 3GZFA 2DRDA 1U8SA 1GOCA 2OXOA 5KG4A 2EAOA 4FS1A 4CZHA 2ZE2B 2PMWA 3IR5B 3UQSA 5EE0A 4FM2A 5AJ3F 2OTJN 4OJ3A 3KD5E 2HKEA 7ICUA 2YWEA 2H51B 5I42B 4DPWA 3MFIA 3E9OA 4IL6U 2GQQA 4I2JA 1H7XA 1HKCA 3UCZP 5GMEA 4H5TA 3CJKB 3SCXA 1S0VA 1YRUA 3MURP 5C0YA 3FSIA 1G99A 5AQHA 5AK6A 3KTQA 3NGYA 3SQ4A 3NCPA 3NKYA 2I7NA 1FRJA 2E5JA 4EP4A 2BCVA 3L3FX 3VHQA 1N56A 3H59A 1RCOB 4BRGA 3KIOA 5GAGP 3CETA 4DV3J 2EZYA 2E1ZA 3R5BA 1HPMA 2C3UA 1KR4A 5HP4A 2ZG6A 1TUUA 2RJZA 4NLVA 4TU8A 2PD1A 2NYHA 4WQ4A 3KKSA 2EZXA 3CC2S 9ICBA 2DGSA 3BYRA 1MWQA 3DOLB 4FXDA 2CQIA 3SAGA 1AUDA 1S8OA 1J27A 1J5OA 5F3XB 2HSZA 2BYCA 3NF9A 4U95A 1WDDA 1FWKA 3R2CJ 4DWIA 2AGQA 1FDNA 4QNLA 3LF0A 3OUYA 3QZ7A 4Z4CA 1WD6A 5M2PA 2L9DA 1VGYA 1ZM2A 2DFHA 2UVVA 2P9LB 4AF1A 5KFNA 3TZWA 4BY9C 4F0MA 5AM0A 4C3LA 3NMRA 3M8YA 1W7AA 3U1LA 2DHHA 2P6TA 2AJQA 4WBFA 1UVIA 2Z57B 2R4FA 1HEKA 3NF7A 3VGMA 1NDKA 1ZXOA 1HMVA 1JI7A 1RT2A 3KK3B 4CIGA 1T7PA 2RQMA 1QH9A 5H9FK 1S1TA 2QZ8A 2HQFA 3DDKA 3LM9A 4A8WA 2QWOA 3ISDA 3AXKA 4I2QB 2RILA 1KQSM 2FTRA 2G8UA 1MNEA 2BKOA 4EIAA 5F8NA 4FWNA 1J2VA 3EZWA 2F1IA 9ICSA 2CGKA 1ZQCA 1MC8A 5D3GA 2A1JB 1SJ1A 3OYMA 2GFFA 1WHXA 4CF4A 2PI5A 1ATSA 1VQMS 3PIPQ 4JI1J 1VHFA 4OYAA 5DK5A 3QO9A 2B56A 4IQMA 4DQSA 3M32B 1ZQOA 3CNQP 2CQGA 1LNQA 4I9LA 5A0LA 3OT9A 3HPOA 3GV8B 2QG9B 3QEBZ 2O4IA 4JK8A 1HYVA 3FZ2A 8AT1B 2IJRA 2VWJA 4OCZA 4FWMA 1N5SA 4XPEA 4WP9A 2VYPA 1FKPA 1TKZA 2YKPA 3FC9A 9ICPA 2ROEA 3G8TA 4JI4J 4CTAA 1FJCA 5DBCA 3AVAA 3EXYA 3IP4B 2BEFA 1U2CA 1O8BA 1T9WA 4BRIA 4QBUA 4M3UA 1SV0A 1KLNA 3WKAA 1UPHA 3ZC4A 3SEOA 3DDIA 4A8EA 2Y0BB 3U7JA 2R2SA 1DGSA 4OQJA 4J9QA 4DS5A 3GPAA 4CEBA 3SV4A 4NXMF 4RQ1A 1OSCA 1ASWA 2G5IB 3OJUA 4H5WA 4NCAA 3Q89A 4NWBA 2VQEF 5M1QA 3D4JA 3RTVA 4B9SA 5K9FA 5D8HB 3WXMB 2WFAA 3WK5A 4PG5A 1SH3A 2LM1A 3T7ZA 1WHYA 3QEWA 2EBGA 1JB0C 3B78A 4NX9A 2H5JB 3ET6B 3K9KA 3JXUA 1V9OA 4FOIA 4RO0A 4B9MA 5DZ7A 4ILHA 3KYLA 4FVUA 1YQHA 4KB1A 1SIWB 3B54A 2YB4A 5DMRA 4CVNE 4KN7A 2MZTA 4H0VB 1S1XB 2D6FC 1KW4A 1PUZA 3D1QA 5C2DA 3HVWA 3SCKE 2OWOA 3KZIU 3H8WA 5I4MA 5L1LA 1F9HA 3WZ0A 1S9GA 4X66K 3C66A 1TZ0A 1KDHA 1CLQA 4NL9C 3VZIA 3PW2A 2Z0GA 3ETMA 4Z2XA 2H5XA 4MFBA 4XEIA 2BUNA 3WK4A 1HNZK 1AB8A 2F4VK 1T3VA 5HMZA 2P1JA 2QE5A 2K8GA 3OYLA 3DLHA 3ULDA 4CGFA 3QGGA 3TYTA 5KFHA 9ICJA 2HRTA 4P0PA 1WSIA 2BCQA 3KHYA 2ZDOA 2X78A 1X5PA 1ZBSA 3W66A 2EXUA 1ZZNA 4FXWA 1SVDA 3DLGA 1MSWD 1TL3B 3LUYA 1WC1A 2RDDA 1W25A 1URRA 2W9CA 4TXSA 5DB6A 2OYQA 2XMTA 2C2NA 3RJKA 1RTZA 2MDAA 4ZPCA 4CIEA 3J7YU 3CC7S 4MHVA 3NVMA 1RDRA 3AQFA 4NA1A 4I1TA 4WXWA 1FKOA 1GXUA 2YMQA 4ZPWR 3L3VA 4QWCA 1BQNA 2GIRA 4DV2F 3O1LA 2YKQA 2G08A 1QQMA 7ICQA 4ITSA 4QR1A 2F8MA 2ZZMA 3J7ZO 4AYBD 2X3DA 3QJJA 3BREA 2D0CA 2E5LK 3VGVA 4IZ9A 3NRWA 4EX6A 4GV3A 3TQEA 1RDUA 4X64K 2WC9A 1HR0J 1GQEA 3QGIA 1WSEA 3PX4A 4UAVA 3MXJA 3RW7A 5E33A 2HHTA 2HHXA 5HN0A 2VZ9A 5KPZA 5J2NA 3PW5A 4ER8A 3I4PA 3QETA 1D9DA 2GWSA 3THPA 1J2NA 4V19X 4DG1A 2HBLA 3G9CA 5CY4A 2H54B 3RB4A 5IS2A 1M5HA 2FBYA 1FW6A 4FP9A 5IQ6A 5GAGI 2P9UB 1MN7A 4E89A 1ZC6A 1K73O 3D2EB 4BROA 2PGCA 5CZVA 4ZPVR 2HHHF 3GCWP 5DLFA 3BUZB 1O6XA 4DL3A 5CAAA 1NK5A 1QE1B 1TFYA 1OQ3A 1IQZA 2MSTA 4BVPA 1OVYA 4BXOB 2ZKTA 3MPYA 2CPHA 1KWMA 3UIQA 2NXNA 3OS1A 2W03A 1ZA1B 5AM3A 2K8CB 2GEMA 1CULB 4PWDB 2R7QA 4R66A 3BJYA 3ENQA 3WT0A 1ZQIA 1VQMN 4M3XA 1BI4B 3C7NB 4HH1A 1G4CA 4J9VA 1IG9A 2OGUA 1T02A 3HXMA 2KE7A 3F0NA 3BPDA 5TZVA 4DUYK 3TKAA 3AVKA 5J2PA 5KFIA 2KT5A 2R7UA 4KHSA 2QLXA 1Q9YA 3HJVA 4C2MA 3CQXA 1TR0A 2XGQA 4RUBA 1WI6A 3JTNA 4KLEA 2XG8A 3QSIA 2XY5A 1RT6A 1B0XA 4B3MF 4PABA 3OW2R 3S6JA 2P9NB 2CZ4A 2E4LA 4L72B 1MMNA 4XH5A 3F44A 4BLGA 2PKEA 3A4TA 3QEIA 3R1XA 2UUBF 4DTJA 2DGQA 4P0PB 1UVKA 1HNWK 1H6KX 2NXEA 4WZMA 3JXOA 5FRNA 3QFUA 3O44A 5GTHU 4USWA 5HRSA 2B4PA 5K20B 2AYEA 5F0XA 2B3TB 1C2PA 1NPPA 5KT7A 3P49B 1WKLA 1A6LA 2GCFA 2E8OA 2EEYA 4DF8A 3ICXA 3BN7A 4WQ4C 4O44B 8ICWA 1NU0A 2LEBA 3SJJA 2D9PA 3LH2S 2OHFA 2OMLA 4FO0A 1JLEB 1IM4A 3MEEB 3WIVA 3DLEA 3K75D 3NMUA 1UMJA 4HUGA 2MGZB 2Q66A 2R7XA 5IT9U 5GAEU 4I6MA 2ERRA 1RT7A 1NOMA 5FLXU 2C2KB 5ALWA 2LQ5A 4F5NA 4RJVA 3OLBA 1FNXH 2CFXA 3QU4A 1IR1A 2GHPA 1J5OB 1WCLA 2XNQA 4WE1B 2DHSA 1Q82O 1XNSA 1AUSL 4X5VA 2HG4A 4QZAA 2DVIA 2FSJA 4OLBA 3ZZTA 5IIKA 3GJTB 3IBCB 4R0JA 4DDFA 5J0SA 4JI4F 2I1QA 2AGPA 2E1MC 4ALZA 1I3OB 4PGQA 4CTAB 1BIZA 4YS2A 3TPQA 1X9MA 5BR9A 1XMOK 1JK9B 1N2XA 3PW7A 4M3WA 4JS4A 1RDCA 1WWHA 4TNOA 1WSVA 4Y2QA 4B3RK 4OX6A 4MH8A 2ZOMA 1NRKA 3M9OB 3RBXA 4J91A 2BJ7A 3JAMY 2R7SA 3QEXA 5M1KA 5J1PA 3EDQB 3QO9B 3H1QA 1UVNA 3V6JA 1HIYA 4I6MB 4JKBA 3PUFA 1M5PC 1KAZA 1S0NA 3TADA 4BJQA 4OX9J 1UAWA 3TO8A 5KL8B 4HHTA 3J7A1 1JXLA 4F5RA 4BRKA 2XSJB 2CJYB 4K4VA 2XY7A 3T9NA 1WG4A 1X31C 4KAZA 2D3UA 1TKTA 1MROA 2MJNA 5HL7Q 2DNRA 4I6YA 4C4WA 4FYDA 5GAEP 5E3QA 1RA6A 2AYMA 5JVGQ 3PXGa 1FD2A 4PEOA 1W2IA 5CZXA 2P6UA 2EKYA 5KQDA 4J9MA 2Y9HA 4ECQA 3KLHB 2WAQC 1ZQSA 5L9XA 5JVHQ 3TUPA 1EKSA 3O8WA 5AICA 3TACB 3QIPB 1N0VC 1UFKA 2WVCA 4J9PA 3C15B 4LQ3A 2I38A 2D3OR 1Y64A 2YNGB 4BR7A 1YJTA 1IKVA 2WBRA 2BMBA 4BG9A 2X1FA 4FWPA 1GO3F 1NGGA 2MZQA 5KFDA 1S1UB 3MM8A 4H4MA 1K0VA 3G8QA 3X3UA 4NZ0A 4OIXA 1I1GA 1IJFB 2B4JA 4FKYA 3VA0A 3ZSOA 4J9KA 2FJXA 3AMZA 4Z6DA 3FCWA 3E8OA 3NVYA 1NO8A 1UTAA 1WSHA 3NVKA 4K7QA 1TL1A 3D6JA 3A5OC 4BUGA 2OANA 1GMVA 3KLEA 4JI3J 3GDQA 3HHKA 1ZM4A 3POTB 4DTRA 1WNEA 4NOHA 4DR4K 3O5TB 1KS2A 2ZZTA 3VVUA 3B6PA 3GFKB 2DKOB 2RUGA 3D0PA 3UFCX 2OSRA 1ZQHA 2H4WB 4FBTA 1PVPA 3JSMB 4AHSA 1BQNB 5J0OA 1OW5A 2UXCF 3M2UB 3AVJA 1VQ8S 2QXFA 5AKYA 3PMNA 3FQLA 3O80A 2IIHA 2U2FA 1W2BM 4JI8F 3ALYA 3QU5A 4PKIA 3ZTRA 4DV6J 3O3LA 3C15A 2X6SA 1S1WA 4DV4F 1CG2A 4P73A 3NMAA 3C5GA 1Y5NB 5BRFA 4IKFA 1Q86O 3TZZA 5L8RC 2LQJA 3V81A 4KREA 3SPYA 3AA2A 2LA4A 3P5TL 4M9JA 5DKWA 4B1XB 4AM6A 1S0MA 2EZZA 3CJ4A 1NK7A 4C23A 3IMXA 3OBIA 4FWOA 2XS5A 3NCRA 4GKKF 3ZT3A 3GSIA 2CXYA 4EO8A 4R64A 4O5KA 3TAMB 3QBXA 2OSQA 3CD7A 2FMSA 4ZCLA 3KLIB 1YTYA 4QAGA 4FZNA 2DKZA 4KKOB 4DOCA 4QZVB 2MU2A 1HMVB 5HMXA 5E3AA 2CPYA 3P5JA 3C46A 4KH0B 3ATUA 3AO3A 4L3QA 2B8PA 1PILA 1P1TA 2R8IA 4NXNK 2NREA 1GTEA 3F56A 1IV0A 1U1MA 1ZBFA 4CFAA 5IXUA 3CRXA 1T95A 8ICGA 3FZKA 3ZT2A 4CF2A 4CJSA 2ZNZA 3HM9A 3LDAA 3FFIB 3TAPA 3K58A 3K59A 1OY9A 4DSJA 4QYZJ 4AYBF 2H1YA 1Q16B 1YJNS 4UBBA 3WKBA 5DZ6A 1SL0A 1D8ZA 1RACB 4UUXA 2WHEA 2N7YA 2G1DA 1MA9B 4B3MJ 2IHNA 2XMUA 3W8GA 3E9PA 3ZT4A 2P35A 5C2CA 3DHXA 4IQVA 3UMBA 4B3OB 1C0TB 2KG1A 3MN7A 5KTQA 2VA8A 1TAQA 2FJVA 5B0FA 4BGAA 1I94K 4F0KA 3OUYB 1QTMA 2J76E 4JI1F 2KK0A 2RKIB 3B6BA 3FGUA 5G5HA 2Z30B 3VAKA 2V94A 4CJTA 3UDCA 3GIMA 2XHCA 4AM7A 4IR1A 4FKXA 1TK8A 3D2FB 9ICTA 4EFAC 4KPYA 5AQFA 2F1FA 4BGDA 2BPGA 3O9SA 3O9UA 1BNOA 3IRXA 3ZZUA 1HBNB 3OY9A 2PC6A 3Q8LA 4LSNB 2FPMA 3R5DA 5JTIA 3QAUA 4PL2A 2YHBA 4BVOA 2O8FA 3O08A 1H38A 4J90A 3TA1A 2CQ0A 2MQMA 4C4RA 1T6DA 4C80A 4CLFA 3FE1A 4F3MA 8ICYA 4JD2B 5AQLA 4OGEA 2JHDA 4A61A 4F2RA 3Q8RB 2DR8A 4OYIA 3VEYA 2H3IA 3MN9A 4AL7A 3TJ8A 4DV7J 4KX3A 2HNDA 2PN6A 4KIAA 3G6VA 2ZGYA 3M6ZA 3UO0A 3AJDA 2W01A 3CJSA 3BGOP 3D1OA 2KV2A 1ACMB 5EU7A 3NE6A 4MIBA 5JVGL 2ZWHA 5K5MA 5KG6A 3PIOQ 2MQPA 5T7BA 4CJ5A 1RHRB 4BRCA 1Q4RA 3LOUA 2RRAA 9ICEA 1IBMK 2MZRA 1IKXA 2LCWA 3QFPA 2YQ0A 3OYGA 4J9UE 5M1PA 2YX6A 1N8RO 5BJRA 3KKRA 4DCHA 1KP6A 1CULA 2VA2A 1GMUA 2HHHK 2QA2A 2XMVA 2W2MP 5FJ4A 3J7AP 1ZYQA 5J0TA 1SV4A 3NRZA 1TAMA 3NXZA 2R7OA 2BCUA 2W4PA 1NSQA 1WWVA 2WF8A 2Z1IA 4JN4A 3LGHA 4LFBF 4H4OA 1J2MA 5LXRA 2P9IA 3IWNC 1RAGB 2DL0A 1XBWA 3AVGA 2GGPB 1B99A 1VBXA 1S9EB 1C0UB 5ALYA 4UAZA 4Q7AA 2V4RA 4CIFA 2C2DA 4FZVA 2I8EA 3G82A 3E0FA 1LWFB 4KV8B 3LWMA 1REGX 1SQGA 3H0RB 3W1YC 4CGDA 3CDBA 3Q86A 2EI5A 1ECWA 4PJ0U 4XRHA 3PSIA 2QXLA 5HHIA 1HI0P 3UE5A 3A8IA 4FYXB 1S9GB 4WYLA 3ISND 1FI4A 1N33J 4FLZA 3PACA 4K5SA 3OYBA 1SIZA 5HMWA 1Q53A 4C8OA 1K8KB 3N5BA 4DCJB 4U7CA 1RT1A 1Q7YO 1T9VA 4PZNA 4K4WA 4DR5F 4TUQA 4RQ8A 4CO5A 1LW2A 3WNEA 4LBHA 4Q44A 4BHQA 2XGPA 2XM3A 3O2IA 5F8GA 4YB1P 4FZZA 4IH6A 5ALOA 3NNAA 2K4EA 4CFCA 1RBRA 1ZA2B 4BQZA 1SKRA 1TL7B 2J6UA 4AHRA 3MABA 4YY3J 2F1HA 3L3UA 4X66J 3FEXB 5D4OA 2WBNA 3UWTA 1UEKA 3LM2A 1Q3UA 4DV5J 3OVAA 4KQZA 4A8YA 3HSGA 3THYA 4UASA 1NG9A 3BEGB 3RR8A 2RQKA 3AU6A 3AAQA 4ID8A 4QIWF 2RDJA 5DDQC 4DV6F 3PHTA 3RSEA 4G6VB 3WC0A 1KN6A 3C6TA 4B1YB 1RT1B 3RZAA 4U7UK 2W42A 4URSA 3FZFA 1ESVA 3AFGA 1FFWB 2PA8D 3GONA 1X4CA 4DR7J 7ICFA 2ZTCA 3MDFA 3M6VA 5HMLA 1ZOTA 3C21A 2IPOB 3SV3A 3I0SA 1BQMA 2JXJA 1KVBA 1JLBA 3JPRA 1RWPB 3IN5A 2FY8A 2B4UA 4XPCA 4GKKJ 5ALVA 2C3OA 3BZQA 3PNIA 3HILA 3DOMB 3MDAA 3OPKA 2E1RA 1JNZB 3PX6A 3FJ2A 4B1ZA 8ICVA 2LP4A 3TUZC 4JK9A 4M3ZA 5A2QO 2Q0UA 1YI2N 3UXPA 4YMOA 2QWQA 4ECTA 1H0HB 1R8CA 3EVMA 1KEJA 1MQ3A 2R42A 4EMDA 4PG7A 1UZDA 1YF5L 1TUWA 4XA5A 3DHWC 4ZVHA 2XLKA 5T7LA 1ZBIA 4O3QA 4BR0A 4DFKA 4F3TA 1G2EA 2OEMA 1R0AA 3PJ9A 1F9EB 1DURA 2G13A 4K4UA 3T3FA 2NPFA 5HATA 3EO3A 4USAA 2KKVA 4DL4A 1QE1A 5KAKA 2XY8A 3EMTA 2VWKA 2OHDA 4MK8A 2QARB 4YORA 3A5NC 3MUVP 4JK7A 1DK2A 3WC2A 4H4KA 4O3OA 3MAAB 2E9RX 4ZVRB 1YJUA 4ANDA 5AI0A 8ICKA 1R8BA 3K89A 3KKAC 2YY6A 1ZOLA 1HRHA 2UUAK 2MZ1A 3F2CA 2VBYA 4HR2A 4F36A 3ZTQA 3CPEA 2I2YA 1ZQXA 1OYEA 3HSDA 4JI1K 3PEHA 4PHTX 3LVWA 1TYQA 2UU9K 1DQ9A 4K4IA 2KJ9A 4ZVSB 4RW8B 2DR5A 3UE2A 3K57A 3L4PA 4CF9A 3D54A 1ZETA 4YOEA 5D6GA 3ONNA 2I9SA 4PXBA 4Z4GA 7ICJA 1S5JA 4IG0B 3LO3A 5M1OA 3QUTA 5LJ5Y 4DQQA 1WLJA 3SSQA 3D3CJ 2HB5A 4ED1A 2DGVA 3MM6A 1AW0A 1AYEA 4ZP6A 1VBKA 1R6VA 2BDPA 2QB0B 2RNEA 4C3MA 1NDPA 4M5IA 2BACA 3ENWA 3AVHA 4DR3J 3OHRA 4DFPA 2QL5B 4CM0A 4Q0BB 2ZWOA 4Y34A 4C8YA 1RKIA 3E01A 3ZDAA 2EC0A 3RFAA 1LWFA 3CNHA 2DNGA 3PFOA 1ZRNA 5KFYA 1LB2B 2HFZA 1VIXA 5H9EK 2CJXB 2HPUA 1QVGR 1RDBA 2NS1B 4PL7A 1EZZB 2WSCC 2R8GA 3KBBA 3U3YA 3CG7A 3C19A 4MN4C 3LPTA 2JEFA 4JUZA 2E7VA 4FZYA 3MMAA 1WC0A 4RNOA 2ZQBA 4ZIVA 2XMMA 2B4OA 2CPXA 2JGAA 1LWEB 3NAHA 1NGHA 4KLFA 4Q5VA 1KBRA 4M5NA 2H3VA 2YQ1A 5ETLA 3SQ0A 2KMDA 5J0UA 1K9MT 4QIWD 2V8VA 1WOSA 4DR2K 4F50A 4ECSA 2D69A 3ILIA 1CXQA 3Q22A 1K44A 2JV3A 2NRRA 1D8YA 3P4UB 2V69A 1Z4OA 2XIDA 1FVSA 3HSCA 3Q24A 1NJXA 1QDUB 2HMIA 2ZHOA 2WF5A 1Q3VA 2Y0SD 5GIOA 2DGUA 2AYBA 4ZVEA 3U02A 3SCJE 9ICOA 1U1OA 4PG4A 1JLFB 5JS2A 1K6YA 3OVNA 1YGYA 2D0AA 3IGNA 4DPUA 4ES3A 4K4HA 3MCNA 3L7UA 1IN0A 2R2RA 8RUCA 1QJHA 1UZHA 4BACA 3UPQA 2JMGA 4WYBA 2GH1A 4XUSA 4LVOP 4TURA 4YDUC 1FXXA 1BA0A 3N6NA 2K06A 5KFXA 3DXMB 2ZOFA 3PCOB 2ZM6J 1YBUA 5H9EJ 1IG8A 2UUCK 3CO9A 1VQSA 2DGOA 2FIUA 3W61A 3D67A 2M70A 3N0VA 4OD0A 2N1RA 4BE2A 4NA3A 3I0SB 2VG5B 5D15A 4DQPA 3G71S 4ES1A 4CEFA 2KFYA 1RT6B 1XR5A 1W97L 1WF2A 2EKNA 1S1WB 1VQ5N 4DX7A 2HZVA 2GV1A 4HI2A 5GAEI 4WU3A 1AFJA 4IFVB 2AYGA 4ZLPA 4QZ8A 4FJ9A 2HQIA 1U6FA 4DI6A 2P51A 4RWXA 4DSKA 2HBJA 5HLFB 4AQYK 5DDMA 3HHLC 3H5SA 3PFEA 1NSPA 2LEAA 1CJVB 2QI2A 3K5OA 1HUXA 3DRYA 4ED3A 3UPFA 1D9AA 2GAHC 4DPOA 2ZUDA 2IY5B 4X66F 2HMXA 2G09A 4B9UA 4J5OA 3CFRA 4ELUA 3PR5B 4C8NA 2W8LA 3N4PA 4KGMA 3EKSA 1U9LA 3U27A 2JLEA 3UKRB 2BKNA 3NP5A 3BBFA 5KG2A 1ZXIA 3SAFA 4ID5B 3GZ7A 4B3TK 2G1HA 3UN5A 5JS1A 4DFJA 1Z1VA 2LDIA 3N79A 3WHIA 1U2VA 3MAAA 4NZ7A 2JWNA 1XNQJ 2W25A 3SMPA 2UV8A 3C6HA 3E1YA 2UUAF 5AQWA 2BGGA 4DR1J 1IQTA 3AO4A 3OYKA 2E6LA 2QSFA 4IXCA 3CTRA 2JH7A 1YLXA 5KFUA 5AKGA 4A8MP 5A6PA 2YJEA 4K4SA 1FNOA 3LP1A 8ICCA 3AH6A 2VJ4A 3QNNA 4ZJOA 3TZXA 1VSFA 4US8A 2IYIA 2MB0B 2U1AA 1IBKK 1RTJB 3WQTA 3HKWA 3BGFA 2HNYA 2AU0A 2MLZA 2KDOA 5AKXA 1CVJA 3KLIA 1HQEA 4QW9A 2QWPA 1S1UA 3MM8B 3QAEA 3FBEA 4DUZF 1N5YA 3TP2A 1BI4A 1OVQA 3C7NA 4QWEA 5AK5A 1OYDA 2ZNYA 2N7CA 3THYB 3BKFA 1XC9A 5GIPA 2QT7A 1FNMA 4TY9A 4WIQA 3VOVA 5EWFA 2DHGA 1I51B 3KG4A 2VFVA 3RJIA 1TVRA 4X4NA 2ZTDA 3TR8A 4P71A 4F7VA 1K47A 3DXKB 2LVWA 2RF2B 2OM6A 4RW9B 4W5TA 5A76A 2Q97A 4DV7K 2PIIA 1TUYA 4V19J 2J8SA 3K2YA 3OHAA 3OYHA 1JLCB 2HNZA 3OJSA 3ZX0A 2W7PA 4M95A 3W3SA 2F77X 4EYHB 3CSKA 2OJ3A 4IQUA 2QA4N 1ZQQA 1JKHA 1NK0A 4HT7A 1GLJO 2MKYA 5J8YA 1S1VB 2CJBA 5F8MA 2E7XA 5HJYA 4NXNJ 4JKEA 2RRBA 2B0CA 4USJC 5ALFA 4DV6K 4M5KA 3HX0A 1NJYA 5KGWA 1RXOB 2RHSB 3V6DB 1YWXA 4DFDA 4L75A 1CJUA 4G1QB 4ZOSA 3UVJB 4E98A 5AQKA 1SC1B 3MM5B 4YOXA 1HKGA 4F4ZA 1XK8A 1WN7A 4N5SA 4M3YA 4FJKA 3KWIA 2ZGZA 3OYNA 4I6AA 1Z6RA 3J81j 3IG1B 4A48A 1TP7A 1UEVA 3H2VE 4C0HA 3MXHP 3FBCA 4CDIA 2QA4S 3C2PA 4Q45A 1NDCA 1NBEB 3SK3A 1DY3A 4I2EA 4KLQA 5D49A 3PZPA 2FLNA 2HURA 1U26A 3LP2B 3VGUA 3N7RC 5KPRA 1S72N 1TVAA 2M4MA 1WAJA 1MWMA 3TI0A 4O3MA 5BYQA 5J1NA 2O8DB 4P2HA 5J2BA 2PEBA 1NBWA 3LPYA 1RWKB 4ZPBA 3C94A 1WNSA 3A5LC 2I6XA 1FFSB 4N7TA 4BR9A 4ICLA 5J2EA 4CJ4A 2VIHA 5FDLA 4FM1A 4EBCA 4YVZA 3NNCA 1AT1B 4W92B 1UFWA 4CQ1A 5ADXA 3VAHA 4FWKA 4K4GA 5E3CA 3F2KA 3CCJN 1IKYA 2V9KA 3AD8C 4C0BA 2FVSA 4LD0A 3MZIA 2F3JA 4CDGA 4M9GA 1FJGF 3OLAA 3P1GA 3JPPA 3IG1A 4NM1A 4GV9A 1JLBB 4FJIA 4EENA 3ENAA 4F5OA 3HI9A 2PZSA 4CZIA 5EY4A 1IWAA 2PMZC 1KC8O 4KHYA 1UOCA 2BQ3A 1FFUA 3GR0A 3O9TA 2FVQA 3EGVA 2B5JB 2GJFA 3MMJA 2DNYA 3K7RA 4BRPA 3M2UA 1KOHA 3I55N 1HYSA 5HRNA 3CCSN 1VQYA 4EYIB 5ADZA 1RADB 3CEDA 3OYIA 3TWZA 2KTQA 2DH7A 4HL9A 1RU2A 2BXJA 3MECA 3UNGC 5DQGA 2LYHA 2ZWPA 4B9NA 3OXGA 3S3OA 1HNIB 1N36F 4YR2A 3A8YA 1R31A 2Z56B 7ICSA 1R27B 4YR3A 3CYMA 2GVDB 1SAZA 3EDRB 1EKRA 2H4YB 1NGEA 3VAIA 4CLKA 1ZQKA 2X1BA 2JDJA 4P75A 5IM0A 3RU0A 2A6OA 2J9CA 2CPFA 2O6KA 2XC9A 4CEDA 4Y2YA 2YX7A 4QYRA 3O3FA 3LALA 4LREA 3OFHA 4QCLA 3CUNA 3TSPA 3C6UB 1TYQB 2JFKA 2HVHA 2WCXA 4F02A 1IIPA 4MO5A 2DNQA 1Q79A 3IFRA 2CJQA 3SSSA 1O5JA 4ZCIA 1NMNA 2QC3A 3BDPA 3BF1A 1P8GA 2P9LA 1CEZA 4LF9K 5KT2A 5CRXA 5LSRA 5F1XA 1JCFA 1Q7LB 4R65A 2PXIA 3RH6A 2VKQA 2HSEB 4M5GA 9ICWA 3W5YA 2AJ2A 3UI3A 4TU7A 5BN9A 2OO4A 2GAGC 2CDRB 1DOQA 5BR8F 4C4TA 4KGVB 4Y2MA 2YWFA 1DBDA 1FDBA 5GMDA 1FFGB 1B9DA 3LZIA 4KLTA 3CDWA 4JI7J 1NUEA 4I27A 4YD1A 1X7VA 2VFSA 1VRUB 3C2LA 2IC3B 1YKWA 4CJVA 1KAYA 3AHPA 1DLOB 2VV5A 2BRKA 3DU5A 2E1YA 4OZ5A 4MKAA 2QKQA 4BRNA 4OJOA 5F2RA 1CJKA 2HRUA 1KKHA 2AF6A 1FVQA 3I76A 3KK7A 2D5RA 1RBVA 2QX0A 1PCAA 3N4MB 2O8EA 4W5RA 3NGRA 5AXLA 1DRZA 3CCMN 2OD6A 3VTIA 4KHPJ 4H5RA 4OV6A 4OZNA 9ATCB 5JLFA 1BL3A 2P66A 2DRAA 4J9OA 2M2BA 4R5PB 1IKWA 3SLCA 5K8MA 4OL8A 3C6TB 4G1IA 3G8SA 2O8EB 1DQ8A 3T9ZA 3C16A 1F9FA 4AHVA 3DXBA 3QYPA 3RBEA 2OP5A 1ZH5A 2VHGA 4PH5A 2DCUB 5DS7A 2B7CB 2V5HG 1UPMB 2L3MA 2ACMA 4ZVGA 4WKYA 3J7YP 2YNIB 1VQPS 2NRXA 1R0AB 2ASPA 4FF3A 1RT3B 4BC9A 2ZXHA 3GE1A 3ZXWA 4IKAA 4ACOA 4BCAA 3BY5A 2QKKA 5CYJA 4B3SJ 1G7CB 2VWBA 1C7YA 1IBKF 2I6WA 1T44A 3FQKA 3S3NA 4F3OA 4LF7F 4JI0F 2IYGA 2B4VA 2BE9B 1WI8A 3QLHB 4CNZA 4MO4A 3ZLJA 2N4CA 2RKIA 2Q4TA 2AGOA 4YD2A 4CHZA 1D1UA 2EDUA 1BIUA 1XNRF 2MQ8A 2RRDA 3FBBA 2DBYA 3OXLA 2HK2A 3SI6A 2KVCA 5AQVA 4B08A 2O66A 3OR1A 3AA3A 1I94F 4LF9J 1SWVA 1WKJA 4ERDA 5DGBA 2HHWA 2DH9A 3I32A 4DU7A 2XS7A 2Q6BA 2Q1NA 5DB8A 2EX3A 5E26A 1OY8A 5IC4B 4YG2A 2DT9A 5E3RA 4WF9Q 3HZEA 1V3RA 4UT4A 4OMFG 1IBCB 1Z4UA 1TGOA 3VAGA 5AQOA 3ZDEA 4C0ZA 1M90O 4Y2VA 1DZ5A 2AEFA 1C1CB 2O8BA 4CLUA 2Q31A 2DITA 4LJMA 4NLPA 1RTIA 4U7BA 3GIKA 3IG8A 4ZA1A 2D74B 2CQ2A 5G0RA 5HP1A 1N36K 1BXNA 4HHUA 1AA1B 5LM7E 3NDKA 4FYVB 1MWZA 1Y3KA 1PK1A 3HW8A 2WTFA 1VRTB 4DV0K 1NSKL 2HBYB 2JFDA 3FZMA 2HW3A 4IOCQ 3N5FA 4M9NA 1HWKA 2OELA 3TA2A 1KQKA 2KH9A 2GA7A 2DXDA 4DPTA 4K42A 4DQIA 5GAGU 3QUQA 1OIAA 1VI7A 4PXEA 2NZ4A 1RHKB 3EKUA 4DR7K 3OHBA 1Q18A 5A8RA 4O3PA 4JBCA 2NR0A 4J03A 1X5SA 4EBEA 5K8NA 2V2VA 4ZTJA 1D8LA 1TFRA 2P9UA 4J9RA 2GHVC 4FPBA 1B0TA 4USTA 3JPQA 2DCLA 2CKWA 4G1PA 3TJ9A 2FVRA 3OTDA 1WHWA 1PIEA 3TNVA 4LFAF 2UVRA 3F73A 2QMWA 2JNJA 1PKUA 4WQ5C 3W2VA 1RPLA 2V8HA 1SV5A 1DKGD 4GIBA 2D1CA 5B0DA 1KHWA 1V85A 4I29A 4HHJA 4WFAL 4JWMA 2A5XA 2ILZA 3HHLA 1A9NB 1YRXA 2FGOA 1JUDA 4CHOA 3TR5A 3M6UA 1IBLK 2EAMA 2APOA 1KFDA 4KMUA 1BOTO 5L1MA 2HK3A 2HSTA 4RG8A 5J2IA 2ZH7A 5ALHA 2EFPA 2WRMA 3CWJA 3JTPA 2F4VJ 3SBTA 3VQSA 4WQ5A 4DG1B 2XCPA 5I3PA 4K5RA 1RU1A 2WK4A 4DLEA 5ALGA 1KL9A 1ZQPA 3L09A 1R43A 1G3OA 5A8KA 3ELHA 3M05A 3MEGB 2WONA 5GADU 4Y2IA 4HAIA 1RG6A 1XS9D 1RQNA 3QT8A 1GLEG 4ECUA 2W3SA 4P0QA 4I2CA 3FDSA 4WFAQ 4B9LA 4ZPDA 3ZTOA 1KC8T 3R6LB 4RQ5A 1S9EA 3M6KA 1XERA 4UAUA 3QX7A 1WHVA 2XMWA 4UBCA 5CR0A 1YJ9S 2UUAJ 3MGIA 3F9KA 2O3DA 3RMAA 2E5GA 4DPYA 3F41A 3A8JA 3CJAA 4KY3A 2BPFA 4KHUA 2Z58B 1LXNA 2AX0A 4IG3B 4CZMA 1LEOA 1QHTA 4HTJA 4OLOA 3ZETA 2BJ8A 3MX2A 4J9NA 2KHDA 2HHPA 1N54B 2C42A 4UATA 2AJ1A 2O4GA 3OFFA 3DLKB 2KVQE 5DLGA 4ELVA 5K14A 5T14A 2E1PA 1PSDA 3L4BC 4HKQA 3U1NA 2XNRA 1GLAG 2IM0A 4NASA 3KHHA 5E3PA 3BSCA 2B6AB 2ZTEA 4PWWA 3OS2A 5MLCQ 4BRFA 4CZGA 1EKEA 1JL1A 3PW0A 3RWUA 1NH8A 3ZT1A 1HHTP 5ETMA 2P9SA 4U6PA 4CP5A 3CJQA 4ISGA 3Q0AA 7ICMA 2ZBCA 2ZC3A 1VFJA 1ZBTA 3UN2A 3ZEUA 4N41A 4PAAA 3CJCA 5J2CA 2L9WA 4HACB 5AZJA 3U9ZA 2ZKUA 1NHVA 5T41A 4C97A 2KSOB 2VGMA 4BE1A 5J0WA 3VQCA 2DUYA 4GXJA 2BJ3A 3M1VA 4BC4A 9ICUA 4NLSA 4NI2B 4H4MB 2WVFA 2ITMA 1MN9A 1U45A 2VF3A 4YDXA 4FXVA 3ID8A 1Z25A 4RW8A 2K4PA 3JPSA 2EK6A 4BR5A 4ECYA 4O55A 1FRXA 2QIFA 4I67A 3M8QA 3WIUA 3QWPA 5ALNA 4YUDA 2XHWA 2GX9A 1VJQA 3MMAB 3AA8A 2AIRB 1X4AA 4HTIA 3M2VB 2CPZA 1WF0A 3DOKA 3CCEN 3PW4A 2Q3SA 2WFBA 4LF7J 4DV3F 3RAMA 2NRTA 4N56A 1UP1A 1FESA 4R63A 3QNOA 2ACYA 5AI6A 3MBYA 1X9JA 4RCHA 3AN1A 1U02A 3V4IB 1WC4A 3H8JA 4DTUA 3AARA 2XMAA 1DJ0A 2JC0A 3HHEA 4ZJQA 1WYGA 5EWEA 3M2RA 3JPTA 3EEQA 1RAHB 3IGVA 2ZM6K 4EX7A 2UXDK 1O51A 1JJCB 4CLTA 2IGIA 3QICA 1K8AO 4FLXA 2NXUA 2M88A 2G2YA 2OTLN 3AVNA 4NLCA 2F9TA 3HOSA 4UW9A 1RAOA 2IAJA 3T41A 2QM1A 1XSPA 1BPEA 4JKGB 2F8SA 1VBZA 2IBKA 3CMQA 4C1NK 1SCJB 4M5HA 3HHDA 4B9QA 1GEHA 3O9QA 1RXWA 2NCKL 3L2VA 4MFAA 3FNNA 4GVMA 1MW7A 1B70B 1MMLA 1NCLA 2W54A 5IQQA 2YMMA 3E58A 1KSPA 4AH9A 1ZAWA 3SDEA 1OPZA 1X1PA 3NS6A 3R7NB 4XDDA 2KIVA 2MGZA 5KPTA 1FJGJ 4P9SA 4Y2TA 4JKGA 3PY8A 2AJFE 1SV0C 2W40A 1KVJA 3H8SA 4K0KF 3HHLD 2YXLA 3CCSS 4MJKA 5LSOA 3THVA 3VQQA 2O1PA 1WUUA 3DYAB 2GIFA 5CQGA 2ASLA 3M2RB 2YPZA 3Q2SC 2AJ0A 1X9XA 1T03B 3FCHA 3AVLA 2R7RA 3N6LA 3V7LA 4I64A 3ZTPA 4DOZA 2IM2A 3MEKA 1EP4B 5BPCA 3THTA 2YCHA 3TTCA 3IBFB 4FZLA 2H9ZA 3N9UC 4A8OA 2HLTA 2XYHB 2E3TA 2AHOB 4PQAA 2YKNA 1HD0A 1B92A 3O6WA 3IM1A 4LR9A 1N36J 4BWJA 5IV4A 3RAXA 5SUHA 2M8DB 1HNVB 4AE5A 3OSNA 1VOMA 2GMHA 1LWCA 1BCMA 4RPXA 3TADC 2VFTA 2H3ZA 3MMVA 3QEAZ 3ENHA 2AZ1A 1A0OB 4OHXA 2KOBA 4Q2LA 3GYNA 5E0OA 2NSBA 3AGRA 1FT8A 2KYXA 2JEIA 3AD9C 1YT3A 4KBOA 2WB1C 4EHUA 3OTQA 4BC3A 4RNNA 3QXGA 4V19S 3QFHA 3A0IX 4G9ZA 5FLXO 2EBEA 4O8UA 4ZLJA 1SB6A 5J0YA 3FRZA 5HMYA 1ITGA 3BQTA 5KFAA 4I2HA 2GBZA 4GO7X 4JI3K 4P72A 2BE2B 1TKDA 4F4WA 3G96A 3P31A 5CZ2A 3S7RA 2J0WA 1FCAA 4QZEA 3T5KA 2IA0A 5CXTA 4ISEA 1ZQNA 4F71A 2V2ZA 4AL5A 2G2ZA 2Z1HA 5FP0A 1V38A 2B6GA 4H0XB 4ZMMA 2K7JA 1K8AT 3H40A 2XZWA 5BR8J 4BR4A 4UAWA 1NNDA 1VQ7S 3DCAA 2F4FA 4FZMA 2IIRA 1GLLO 2DH8A 4KSEB 1ED1A 2ZJPQ 4CF0A 4CHNA 4C8ZA 3SMSA 2ZJAA 2UUWA 3DXKA 4M5DB 3NNHA 4YCXA 4M3TA 1N61A 2A2CA 4A2AA 3V6DA 3TFSA 4LFCJ 1SZHA 2I1RA 3EVWA 1WF1A 5D46A 3AB2B 1V4SA 3G25A 4OJ1A 1VQLN 4URGA 5E41A 3GG4A 5F9LA 1VC6A 4USMA 4K4TA 4PYAA 3D6FB 5AKLA 3CQ8A 1KCFA 2ZIWA 1U1RA 1RISA 1BWFO 4NMLA 4OHVA 5GMKa 2PYLA 4IDKB 5BPNA 4FL9A 2K2PA 5HVFA 2Q36A 2BW7A 5KFSA 3HD2A 4BGBA 4YXMA 1A77A 4URQU 2VFUA 1O08A 1T3QA 3G6XA 1QD1A 5DG9A 1NPKA 4PXDA 3CD5A 3LAMA 2MKIA 4EZ6A 4Y6IA 3CCQS 4HCCA 3H0PA 2O8CB 1N0UA 2E5HA 3M1VB 2E9ZA 5B8HA 1TELA 1Z4NA 4R8UB 2D0PA 3HDSA 2I5JB 3PYFA 1RCHA 2Q2RA 2ADCA 3BKTA 3HO1A 4FWSA 2YQEA 4PL1A 3R8EA 2DFLA 4F04B 3ISCA 3KOAA 2F8KA 1RT4A 3ZD9A 3NS1A 4P2XA 1N52B 1J53A 1XQSC 3AVMA 2KFNA 1J54A 3HULA 4WK1A 3K9JA 1VHXA 4GKKK 4BQLA 4Y00A 1S6PA 3S3MA 4NLNA 4PHEA 3IM8A 4PL8A 2OEKA 4ZLNA 2ZH2A 1P9YA 3SENA 2RPIA 2Y9TA 4JI0J 4DQ8A 4IOAL 1NZAA 4I4BA 3DLLL 1URJA 4MEXA 5LMNJ 3VAMA 1QTNB 1U0SA 5ALZA 1Q81T 1ZQLA 2OD4A 4O4GB 4KMOB 3D1HA 4LF5K 4Y28C 4WXOA 5LOQA 5J8YC 3O0FA 1KFTA 8ICZA 1ZS6A 2UVWA 4JOUA 1GH8A 4WPAA 1MDUB 3GJRB 2EPIA 5AZIA 2G2OA 1MWYA 2NXJA 3O3HA 1NM2A 2ZJRQ 4NWIA 1BCOA 3C65A 2LI6A 4CGHA 3SAHA 1CXUA 1Y3JA 3TEGA 3WDOA 3OGUA 4Y1CA 3T79A 4JKFA 1GXTA 4CJWA 1SI9A 4YFUA 4C4SA 5C10A 2HQDA 5ETVA 4GY2B 3VVTA 3B0YA 4JKAA 2LYBA 4P2SA 3AJ2A 1S6UA 4LIRA 2MPUA 3QDKA 1RABB 3SQ2A 2M0NA 4BC7A 2GV9A 9ICXA 1BWVA 5K8PA 3SXLA 3PJWA 2E8AA 3MMCB 4B3SK 2HZAA 1YBTA 4X65J 4FZXC 4M45A 1S49A 3N7SC 4R0EA 4E1JA 1C0GA 4KTQA 1RDWX 1CLFA 3NVVA 3DXMA 5BYRA 5HMMA 1NNEA 2FHMA 4KO0B 3W2WA 1IBMJ 4FPAA 3RMCA 3QU7A 4DLGA 3ET6A 4DXLA 2MSNA 5J2QA 1DGKN 5AI5A 1Q5YA 4GV6A 1NK4A 1HBMB 1QAJA 3WKEA 2DIUA 3I0RA 2MEWA 3AY9A 4UB4A 1M5SA 2HWHA 2HFVA 3WUHA 2YNHA 2UUTA 4K50A 4YFKA 4B3RF 2F1JA 1VQOS 3MEDA 5ALUA 2AX1A 1VQ4N 2KZMA 1GLFO 3ZSQA 1ITPA 3AQPA 1A5VA 1T9YA 1QQCA 4IOXA 2P5OA 3KKFA 3BF4A 1X4FA 5D4NA 1ZM3A 1FXRA 2V9WA 3AO5A 3KFUF 4Z4IA 3PTWA 1JLAA 1WAFA 2BV3A 4CI0B 1WOQA 4CBXA 4PQUA 2JSXA 4MDAA 3WX4A 1O13A 2Y0SF 2LLZA 4LFAJ 5B08A 1REVB 1L5UA 2B21A 1R8PA 5HK4A 1J97A 2WF6A 4OPHA 3I56N 3JPOA 4Y3CA 3DJCA 2V2KA 3TX0A 3H90A 2PFUA 3DGVA 1QHAA 3PKMA 3VQEA 2F76X 5BXIA 4F0HA 1ZZFA 2RU9A 3LZJA 3C14A 4RL1A 2ZIXA 2ZJRL 2DGWA 2MY8A 3IA0A 3Q8MA 5H1SQ 2ZC4A 3ZFVA 3O6QA 4FW1A 2R7WA 3LDSA 3B6OA 3D7EO 1X0PA 3TABA 3EZ5A 3GL1A 2QWRA 3GU3A 1RWMB 5AQYA 4PRFA 3EVOA 1HD1A 3DLRA 3QT5A 3CGIA 2UUBK 3L2RA 1FHTA 7ICIA 1TV6A 5KT6A 1P8ZA 4MLHA 3NF8A 1OWXA 5KFPA 4IJAA 2D0BA 5L1KA 4RQ6A 1U8WA 5BREA 3LP0A 2F8HA 3R7BB 3TVYA 3KMSA 3MMCA 1FDAA 4DPXA 4CGIA 4A8XA 1F60B 4DV1K 3AEVA 4RW9A 3Q7BA 2VD3A 3KLEB 4FJHA 3OTBA 2HFOA 3AXMA 2DGXA 2V8PA 1DLOA 4C48A 2WVDA 2WZ1A 1PYTA 9ICIA 3EJMA 1DARA 5CHCB 2UU9J 3LQVA 1M5OC 1ZQGA 5GAHP 4YMNA 4RPYA 3PO4A 4OZLA 4ILMA 4DSFA 2MUTA 4LQ9A 3VN5A 4FK2A 4H5VA 3PDNA 2QB1A 2EK1A 3ZZYA 2JRZA 4ECWA 4LH5A 1UVJA 1ZBUA 4JV5J 4ZIWA 4LF6J 4O0JA 2RQ5A 1GK8A 1WC3A 1N5QA 3GG1A 2VG7A 3M30A 5FPMA 4NLKA 2BCSA 4IQWA 1S57A 5IIMA 2COLA 1KOOA 2E8PA 2KLAA 1V5IB 1VLYA 4GO5X 4DB3A 1GMWD 4CEEA 3ILLA 1WORA 2BJEA 4KITB 3DLGB 2E2QA 2KG5A 4FJMA 4U67L 3KZXA 1GOBA 1M1KO 1S1XA 2V4QA 7FDRA 4E19A 1IJJA 3JYTA 3CJ9A 2WAQF 4WU2A 2KICA 4JI3F 1Y0HA 1C6VA 2IVYA 3AA4A 3IHQB 5C12A 3F53A 1M1GA 3DGPA 2WB4A 3G86A 4M63C 1F5CA 4DN0A 3BO2A 5DM6Q 4Y2PA 2J7KA 5K8OA 1GXLA 2PFOA 2HOQA 1RTDB 1VJ5A 2OA8A 4IJNA 5ALIA 1LWCB 1DTQA 3MDCA 3WEEA 5IOLA 4HDHA 4Y2JA 1DT9A 2DD8S 3VF6A 3ZEUB 3TUJC 1OXJA 1UA0A 4TLRA 2GQ2A 5L46A 3ZDBA 4JI8J 3DWLA 7ICPA 1XIQA 2A1AA 3OW2M 2Y9UA 3CCES 4QZFA 3KK2B 2YH0A 4X62K 4C3KA 3S6EA 4CRJA 3VEXA 1NOYA 4UQGA 1NAQA 3CD0A 2EW9A 4GC7A 2BBEA 2O5DA 5KFBA 9RUBA 4X4VA 2OEHA 3G71N 1WSJA 2HBMA 1OS5A 3MN5A 4I68A 1TL4A 2C3PA 2KP7A 3K5NA 3CHWA 4JI5J 1RSCA 3KDNA 1C0TA 5ETQA 3L6QA 2ZH4A 3PR4A 1NK9A 4F72A 2XULA 2HLUA 4A57A 3V9ZA 5CD4H 1DTQB 2FSKA 4XK8C 1H2VZ 1MMDA 3O1BA 3ADAC 2OPSB 1EETB 3KLGA 9ICHA 3I55S 1X4HA 3NGZA 3TA0A 1RJJA 1VLBA 2VASA 3TTDA 1FK9B 2FHKA 4E3SA 1VQPN 3H6EA 5AQXA 3V1OA 4K43A 5FRMA 1W0HA 4CZLA 3EYZA 1OKJA 2JZBA 3RYLA 4CM2A 4DV2K 4X64J 4CJKA 1B4FA 2UXBF 5TISU 3IRXB 1JLQB 5ETOA 2P2CB 4BRAA 2R8KA 3O3GA 4X65F 3TW0A 3L4QA 1BVSA 3HI0A 2M3DA 3JPNA 4CT9A 1VISA 2B0GA 3RMDA 1FTCA 4C6AA 1SPBP 1NWKA 1TV6B 3M8PA 2D3DA 3KK3A 5AJ3K 2CQ3A 1S4EA 4EFHA 4RQ2A 2VDHA 5KFRA 4K8XA 2F40A 4BE0A 4M5JA 3S41A 4MTPA 3BP8A 5EOYA 5GAHI 4OX9K 3AVIA 2F3NA 1LWXA 3OBYA 1VSKA 3M9MB 4FM0A 5BYSA 4P52A 5LL6Z 2HHSA 2LA6A 3KD3A 1AZSA 4B9VA 1IKXB 2KM8C 4UB3A 3EICA 4Z4EA 3RGIA 2A3VA 4F4KA 2X51A 1X3NA 5AQMA 2VL1A 3R9LA 1OQ6A 3CCUN 1YDLA 4K8ZA 3OYJA 2WMMA 4RQ7A 2CPDA 4Y1DA 4A5AA 2W2PP 5EX0A 3ZNJ1 2OTJS 2P9KB 3HYFA 2DNNA 1KTVA 3G0ZA 4USUA 4ED6A 1RNHA 1N8RT 2M52A 1KQFB 4P74A 1ZAXA 2N3LA 4CF3A 4DV7F 4OZ1A 1P6TA 2JZ5A 1QQ7A 5F8LA 1JJ2R 2YNFB 1BLUA 2OYYA 3HWTA 4QIGA 3GV7B 4F3QA 4X4OA 2HIYA 4JB8B 4WTOB 1RT2B 2DNKA 4CYUA 5J2JA 5CE3A 2E8NA 1F3VA 2D3ZA 4F26A 3F2BA 2PDAA 3ENBA 1BQMB 3CPWM 1QUPA 5SWMA 2AZ3A 4OLPA 2XI9A 2AV5A 1QSLA 3JS9A 3WNFA 1RYUA 2EG1A 2FDNA 1J5EF 1NGFA 3MXIA 4LFCF 1DQAA 4NPOA 4FNIA 4WIIA 4ZN3A 2BQRA 2VKRA 3JAMO 1W9HA 2IRXA 4N8NA 4GKJF 5IT9Y 2KXFA 2IRUA 1IKYB 3QERA 3QSYB 5LMUK 6FDRA 2ZH6A 1C0MA 4JHDA 1EX4A 4Y0WA 3VA3A 1JMTA 2GGPA 2N4DA 4M9HA 4LVNP 5D0EA 3N28A 3MD1A 3SQGB 1R89A 4U7UD 5AQZA 4LRFA 4KTZA 8ICTA 4XIUA 1TMMA 3QU2A 1RFQA 2ETJA 1V3SA 3VQ6A 3ULEA 2P9CA 3FMBA 3CP8A 3BZCA 3ONQA 2XVTA 3I6PA 1YJRA 2FMQA 2OZMA 3CCJS 3W60A 1YI2S 3V7JA 4PXCA 1CJVA 5IV3A 3OVBA 2GO8A 1XU4A 3BGLA 2V50A 3DU6A 1Q95G 1IO2A 4CI6A 4H0TB 4FWLA 4TQSA 4UARA 3L95X 5ALPA 3VQBA 4DR5J 3UB5A 2WTUA 1JXVA 1RXVA 2R7YA 3L8BA 4ZDNA 2C2MB 5C24A 1ZQJA 4KLIA 2CQPA 4W5QA 2LDYA 4AQYF 5JXSA 3IDWA 5CYQB 2MAXA 5IZHA 2H3QA 1FERA 4MKYA 1L3TA 1T3NA 3GMGA 2YH1A 4LSLB 8ICUA 3G4SN 1H74A 4OPJA 1VJWA 3I5BA 4OV1A 2ODGA 1F0XA 1JX4A 1VQ9S 4IG0A 3EY1A 4JYAK 1X9SA 2B9WA 3P38A 4YY3F 1ATNA 3HOTA 1NEEA 1WSGA 4NI2A 1ASVA 2GWKA 3PYDA 3H8MA 5ALLA 2LXIA 1A5WA 2W8KA 3W64A 3OFEA 2HYIB 3P45B 2AEMA 5M2RA 1T3OA 3NUQA 1WSFA 1DEJA 4BBYA 5HQ8A 3KWGA 2XCAA 2W1BA 2QJ3A 2DFFA 4NEYA 1KBUA 4A59A 3FAHA 4ED4A 3THWA 4ED2A 4O5CA 2FLLA 2CNLB 3QUBA 4ETXA 1N32J 4M5DA 1QVFM 2XTJP 1UWBA 1N33K 1U7LA 4X62F 3DM2B 1D4XA 4J8FA 2KQ2A 5HROB 4WKRA 2CXEA 1SXEA 5GTIU 3DRPA 3CO0P 1U1QA 4IBNA 2RLTA