2XY7A

Crystal structure of a salicylic aldehyde base in the pre-insertion site of fragment dna polymerase i from bacillus stearothermophilus
Total Genus 188
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
188
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHAAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWALERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGEELAEQLRTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKSKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQARLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords DNA POLYMERASE I
publication title Reversible Bond Formation Enables the Replication and Amplification of a Crosslinking Salen Complex as an Orthogonal Base Pair.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
total genus 188
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2010-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2xy7A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 2xy7A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2xy7A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2xy7A01
7ICQA 2F8SA 2EHGA 1TV6A 1ZQRA 3KLGA 3MXMA 3RJIA 4ID5A 2D0AA 9ICCA 5KFTA 4CIGA 1RTJA 4M3WA 4FJIA 4DU3A 2IOCA 2XCPA 4YMOA 2R8GA 4PHEA 2XHBA 4Q44A 1F21A 3OYBA 2ZD1A 3EYZA 3AVAA 2A1JB 4NM1A 4DTPA 4CERA 1Y88A 2MUTB 3VQDA 4FLYA 3IM1A 5J2QA 5D4BA 2BPCA 3LK9A 3LZJA 2ZJAA 3QESA 3CQ8A 2C28A 3PUFA 1GOAA 2Z1IA 3BQ2A 3HWTA 4UBCA 1D8YA 5DDYA 4ECRA 2KW4A 4EP5A 4RNNA 4DQIA 5L1JA 3G6YA 4AILC 3KD1E 4FK4A 4NXZA 1YTUA 4QZIA 4Q8EA 1L3SA 3EW9A 1ZQTA 4RPZA 1EETA 2P66A 2X6SA 4GXKA 4I2AA 1UWBA 4O5KA 2QK9A 4CHQA 4Z6DA 3OYIA 5J0UA 4JRQA 3NGYA 4TURA 3L2RA 4JV1A 2ITGA 3AVFA 3QERA 3P83D 3ISNC 3UXNA 3DLGA 1ZQSA 3GDXA 1QQCA 4FZZA 2WTFA 3V6JA 4CJLA 4G3IA 1ZQKA 1QSLA 4QZBA 3QETA 5KFHA 2BANA 4TQRA 4XA5A 4YCXA 3KK2A 4YFUA 3HW8A 1U49A 3E2EA 5DQIA 5KT2A 4MF8A 4F4WA 1D8LA 4M41A 4CECA 5JUMA 5D46A 9ICOA 1NK6A 4DTNA 1KVCA 3TFSA 1TVRA 2ZUCA 1I39A 1KFDA 1SL0A 3JPOA 3OYAA 3EPGA 5KTQA 3DLEA 1JXBA 4PHDA 5DBCA 5HHHA 3ZSQA 3KHLA 3AA4A 3PR4A 4Z0UA 5I42A 8ICQA 4RW4A 4MFCA 1QLNA 3H8SA 2B6AA 1J5OA 5IIKA 4KN7A 2F1HA 4IKFA 4YMNA 4Q45A 1N56A 3ZSVA 4E7KA 1C7YA 2W42A 3EWAA 4KHNA 4QWCA 3LP2A 3JPQA 4OKKA 3RWUA 1MC8A 5CY4A 4Z4CA 4KTQA 5J2JA 4KI4A 1N48A 2XGQA 3EPIA 2JEJA 5KFRA 4M04A 4PHAA 1X2IA 4NLNA 2FPLA 1NOMA 3TAQA 9ICQA 4CF0A 4UQGA 3V9XA 3HSTB 4CEDA 5KFSA 1REVA 4KLJA 1HYZA 3AVGA 2R8JA 3S9HA 9ICVA 1FK9A 4I2EA 1XHZA 2QKBA 4DSIA 3B6OA 1ZETA 1TKTA 4K4IA 9ICMA 4B08A 4I29A 3K75D 4EBCA 1CEZA 3K5OA 1NJWA 2IC3A 2ISOA 3V4IA 4EZ9A 1VSIA 5DB6A 5K14A 1T4GA 3C5FA 1DOQA 3OYKA 4M0AA 1S1XA 4BDPA 1MSWD 4EBDA 8ICRA 4B9NA 2G8HA 2BQ3A 4B9VA 4DFJA 3C6UA 4CCHA 4M6WA 2FBTA 1RYRA 3UIQA 4N5SA 1BCOA 4O5EA 4Q0BA 3VQ6A 4B3OA 5KRSA 5KFCA 5J0PA 5EWEA 3AU6A 1MQ3A 3JPRA 3MXIA 3L2WA 3AO3A 1ZQLA 2YNIA 3LALA 3MDAA 2C2RA 2HVIA 4UB2A 5CJ7A 2DFFA 5D49A 3TABA 1TVAA 1MQ2A 4FYDA 1JIHA 2MAXA 4JK1A 1KTQA 2Z1JA 3VQ8A 1ZBHA 1C0TA 8ICAA 1S9GA 5L1LA 5FRNA 4AHRA 3O4QA 1ZQDA 3C2KA 3C1YA 5IIJA 3SUPA 3N97B 3WNHA 3ZSRA 3NTUA 3L3UA 4ECUA 2BE2A 3PMLA 3DOLA 4JWNA 4LD0A 5CHGA 1UOCA 1TGOA 5KRTA 4J9MA 4UB4A 4F4YA 3SCXA 4I2CA 4I2QA 3TWHA 5DG8A 2A1SA 1T05A 1ZQWA 5J0OA 4UB3A 1U9LA 4E7LA 5L9XA 1IKYA 2B21A 5KGWA 4GC7A 3KLIA 4DQQA 1KSPA 4OLAA 4N47A 1RT2A 4HHTA 3FDSA 3HPGA 2JZBA 3KHHA 3U3YA 4KLSA 4OKJA 5J2PA 2VWJA 3ITHA 1Z25A 4CF9A 5KG2A 1VSEA 3ZDCA 3TAGA 8ICGA 4Q43A 4DFPA 3KK1A 4CK3A 7ICHA 2OZMA 1KDHA 3SUQA 2PZSA 5DKWA 4LH4A 4CEAA 9ICFA 3M8SA 3HPOA 3ULDA 4I2JA 4KB0A 1N5YA 3K2PA 2ZTCA 3GIMA 3GIIA 1X1PA 2ZJ5A 2AGQA 4M9LA 3OS1A 2JEFA 4Y1DA 1C0MA 1IKVA 2RDJA 5J0QA 2FPKA 4RQ1A 4HUEA 4LZDA 2PYLA 1JMSA 4RT3A 5IIOA 4IRKA 3HP9A 4RT2A 2VA2A 3QEPA 4CGGA 4FJ7A 3RB4A 4DTJA 3ZD9A 1LAVA 4HCBA 1S0VA 4KITB 1MU2A 1VRUA 1SL2A 4MFBA 3KLFA 3C95A 4DU1A 2DPIA 8ICZA 4DS4A 3LANA 3PW2A 4QAGA 1WN7A 1LW2A 4DF8A 1K1QA 4CJEA 1S77D 2XRIA 4Y1CA 4EBEA 1EX4A 2DPJA 4RQ3A 3MBYA 3HL8A 3QINA 3SUNA 3RMCA 4MFFA 4W5QA 3VQQA 5J0SA 4I28A 4NCBA 4QZEA 9ICAA 3JSMA 3H8WA 2XY5A 1TAUA 5HRSA 3SV4A 1WAFA 3B0XA 3GV7B 3QNOA 4BACA 3NF8A 4GMJB 4CGJA 1H38A 4I2DA 1C1BA 2R7YA 4CJVA 3OYDA 1RYSA 5KFXA 5DQHA 1NJXA 1S6PA 5J2CA 1HNIA 1RT4A 4ELUA 3V1OA 4CIEA 3V6HA 2PXIA 2AGPA 5CR0A 2GWSA 9ICJA 4QCLA 3U6FA 4RUAA 4KLOA 2IDOA 2ZE2A 2W9MA 4I9LA 2ISPA 4FK2A 4EP4A 1BI4A 1VSHA 5HROA 4NYFA 5HBMA 3SQ0A 5KFFA 3JPTA 5KFNA 3EZ5A 4KLQA 3AO2A 1HYVA 2P5GA 3LPTA 4DTUA 4BWJA 3C2LA 4CJ5A 1ZQQA 4CJWA 4ED0A 3SZ2A 1X9SA 3GV5B 7ICOA 4DL5A 3NCIA 2Z1HA 3PMNA 4KB1A 3HX0A 3HJFA 4DS5A 1RCHA 2IGIA 4CGFA 1XHXA 5HHIA 3QE9Y 2F96A 2PFNA 4F3OA 4Z4FA 4IG3A 5J0TA 4DOCA 4AH9A 1ZQGA 1IH7A 4DOAA 3ZDAA 3AVJA 4P4PA 1ZBLA 4CJSA 3BQTA 3WNFA 3V1QA 4LSLA 4DFMA 2GUIA 1Q9YA 1JKHA 3V9SA 4JWMA 4CJKA 7ICMA 3M9NB 1AROP 4ICLA 4CE9A 1RNHA 3FYHA 8ICOA 3OYNA 4FLVA 3LP3A 4FJLA 3QEXA 1B9FA 4CEFA 3Q8QB 4J9KA 4CEBA 1KLMA 4E89A 3OYCA 1Z00A 2IA6A 4H4MA 1Q8IA 3M8PA 2M9NA 4P2HA 3BDPA 1RTIA 1NKCA 4KV8A 3H4BA 1XSLA 4FJMA 3AO5A 4F5PA 4G1QA 4GVMA 4DL4A 2BGGA 4OVLA 3MR3A 2JEGA 2P5OA 4O44A 4KLUA 2IS3A 4QOZB 2LSNA 3RH5A 1GOCA 5L1IA 1S0NA 1RT5A 2HHWA 3KLEA 4R64A 4O3SA 1K1SA 8ICTA 4XIUA 4RUCA 1RBTA 3NH1A 5DGBA 2QXFA 5KFGA 4DLEA 4B8CA 4YP3A 9ICHA 2X6NA 1BPEA 1EXNA 4ED8A 3RBEA 9ICBA 4FJ5A 4ZH4A 9ICRA 4ZTJA 3HP6A 7ICJA 4M47A 3SI6A 5KFDA 3RH6A 3RH4A 5KT3A 4FXDA 3GFKB 4FM1A 1XSPA 2XCAA 1RT1A 4DSFA 3MEEA 4BGDA 1DTTA 5BOMA 4O4GA 4F92B 5J2FA 1HQUA 9ICEA 2IHMA 2V4RA 1VSFA 4O0IA 1RDBA 2RPIA 1RBUA 3AVMA 1SKRA 2W9AA 2FMSA 8ICNA 2OPSA 4M3XA 3PR5B 1RT6A 3OJUA 1SV5A 1X9WA 4RU9A 2A1RA 2YNGA 1HPZA 1KCFA 4FZXC 1CXUA 5KFLA 4ED7A 4DO9A 4KLEA 2BCUA 1J53A 4E7IA 3LDAA 3WNGA 9ICGA 3DM2A 3ETLA 4YXMA 5DBBA 2GV9A 3V72A 3VA0A 2G8FA 3SPZA 3LZIA 4FJGA 1I3AA 4ZHRA 2XY8A 3V6KA 4GXJA 2PFOA 3ZSYA 4CF8A 2W9BA 3TANA 4X5VA 4K4GA 2HVHA 1ZQYA 1RBRA 1C0UA 3TR8A 3OSPA 4CF2A 4I2PA 5CZ2A 4LSNA 4B9UA 2B5JA 1CLQA 4PA1A 1SKWA 4W5RA 3E01A 5DB8A 4CJTA 3OS2A 2I1QA 4PGXA 1RT3A 2W8KA 3MFIA 4J9OA 4OPJA 4NLGA 2VG5A 5EU7A 4AHVA 4F8RA 5BPCA 4ELVA 2JEIA 4EZ6A 4F4XA 2E6LA 5L1KA 1RXVA 8ICUA 7ICEA 2DY4A 3AA5X 2C22A 1NOZA 3G0ZA 3PX6A 9ICSA 5KFBA 4F5QA 3AVLA 4KMUA 4ZTFA 4DWIA 4KLHA 4M9NA 3RJJA 3PX0A 3OYFA 1L3VA 2BCSA 3OHAA 4KO0A 3MEGA 1WCLA 3IG1A 4IFYA 3ISCA 3TAFA 5EWFA 3C6TA 5DLGA 4B9TA 3DYAA 4CJUA 8ICVA 4M6WB 4KHSA 1UA1A 4E1MA 1KRPA 4FLUA 4F2RA 5DG9A 2NUBA 4IG0A 4F50A 3ISDA 4OJRA 2RN2A 4GLXA 1YTAA 2AQ4A 2VANA 3M8QA 3KK3A 1UT5A 2RKIA 8ICMA 9ICXA 2KZMA 4BXOA 4UB5A 1JLQA 4CFDA 3L2QA 4F3TA 5KG0A 2NRZA 4YFKA 5EWGA 4M9JA 3KIOA 5J0WA 1IM4A 3NDKA 5J2EA 2HW3A 2DFHA 2HMIA 2F1JA 1O1WA 4RQ5A 4IFVA 3K57A 2BR0A 3TARA 4RPYA 3VQBA 4FLXA 1U45A 3OYEA 4IR1A 4Z4EA 4M2YA 3T3FA 3T1AA 9ICIA 1IKWA 7ICVA 5HRNA 2E6MA 1W0HA 5C42A 3HXMA 2BPGA 1XI1A 5J2HA 3SI8A 3DLRA 1CUKA 4KLMA 1S76D 4LVSA 2FBYA 5KFVA 4Z4GA 4KLDA 4CJFA 4ECTA 5KFYA 4HVJA 4CHYA 4BDZA 4KTWA 1XS9D 2YNFA 3T5LA 3RMDA 4CEZA 4ED1A 1ZQJA 3IAYA 2JZBB 4IQUA 2ZJ8A 1ITGA 4LY7A 1EXQA 1FXXA 3TI0A 4FBUA 3O4NA 5KG1A 4J9LA 2IAJA 7ICNA 1XO1A 3AO4A 3ISBA 3OGUA 4JV0A 5J2DA 3O3HA 1U47A 2W8LA 1B43A 2XGPA 1JLAA 3GQCA 3PW0A 1RDDA 2PFQA 2BCRA 2F8TA 4DQRA 2O4GA 9ICPA 3RR7A 4I2IA 7ICPA 2DTUA 2I5JA 1WSJA 3HYFA 2KFZA 2YKNA 4RQ7A 2UVUA 3CYMA 4QZ8A 3ZT0A 2XY6A 4IRDA 4JLHA 3P1GA 4CK1A 4OGCA 1LWFA 2FBVA 1Y97A 4CESA 2P1JA 4C8KA 2FPMA 2J6TA 4YR2A 4E7HA 1T8EA 4RQ2A 3VQAA 1JLGA 3D45A 3NF6A 4DTOA 5KT4A 3DRPA 5KFQA 1QSYA 4XRHA 4IR9A 1K6YA 1XWLA 4C8NA 2J6SA 5DB9A 1UAXA 5FDLA 3D0PA 4QZ9A 1ZQPA 2E4LA 5KFWA 2ZUDA 4W5TA 4KLGA 7ICRA 3THVA 1T03A 3T19A 4TQSA 3ZDDA 3VQEA 4QWBA 8ICEA 4BE0A 2Q0ZX 4YN4A 4DSEA 1BGXT 2X74A 3AVHA 1VSJA 3LP0A 1DLOA 5J0YA 3G6VA 5E41A 3GILA 8ICYA 4H8KA 1TK5A 4KN4A 1FKOA 3CFOA 4QZGA 3OS0A 5DGAA 4KLTA 4FM2A 2C2DA 1N6QA 4Z6CA 1KVBA 2PFPA 1A77A 3C23A 3M9MB 3LAKA 1WAJA 1BL3A 3U3GA 3IHQB 3V1RA 3UXOA 1RDAA 2HNYA 3LPUA 1D5AA 4HYKA 1VSLA 1WSIA 4FJ9A 4NM2A 4LZGA 4E19A 4FJHA 2PI4A 4I2FA 3OVNA 3O3GA 4QZAA 1TFRA 4DQPA 3RRGA 3VQCA 4CK2A 4E3SA 4FJJA 3GIKA 8ICFA 4PQUA 3VQ5A 1T3NA 3ZD8A 3V81A 3NGZA 4R8UA 5HP1A 1BI4B 2AU0A 3H08A 5HRPA 1ZQZA 1NK7A 2ZTEA 3A2FA 4ED2A 5KT7A 4I7FA 4HTUA 1SZPA 4TUQA 3C2MA 5DG7A 1TV9A 3PW4A 1QSSA 1HNVA 4BWMA 2OYQA 4R63A 2BCQA 4DU4A 5HMMA 3T5KA 3DLHA 3HK2A 2DFEA 2GBZA 2VG7A 1WSGA 3LWMA 7ICKA 7ICIA 2R8IA 4ECXA 2BGWA 4PY5A 5J2NA 4FS1A 1C1CA 4M3RA 7ICTA 3MEDA 4KTZA 4J9NA 5CWRA 4YR3A 5KG6A 1EP4A 5DB7A 2HNDA 3RB0A 4ID1A 4EEYA 5J2GA 1BQMA 4RNMA 5KFEA 1ZQEA 1ASWA 3QIPA 2FLNA 1RBSA 1WSEA 3MAQA 4FBTA 2OPPA 7ICLA 2HHXA 4I27A 3QZ8A 4ECSA 4M3UA 1SUQA 3VQ9A 4ECWA 1B22A 1J9AA 3ZSZA 4QWAA 3BQ0A 1NKEA 3S3NA 4CFBA 4UAZA 4DMNA 4W5OA 2HHSA 4FW2A 2PYJA 3ZDBA 2ASJA 4QWDA 5J2AA 3IRXA 4M3ZA 4J9QA 1B92A 1CZBA 4J9SA 3B6PA 5F9LA 4FJKA 5KFJA 3SQ1A 1R0AA 3DLBA 1Z00B 3MXJA 4YQWA 1XSNA 2PI5A 2VG6A 4J2DA 4OLBA 4J2BA 4EYIB 1JL1A 4PPXA 3L8BA 3KKRA 3RAXA 5KG3A 1VK0A 3AVBA 2VA8A 2W9CA 3VQPA 2XY7A 1PZNA 2QKKA 3ZDEA 5DQGA 4JV2A 1BISA 4RZRA 1RBVA 3CM5A 2HB5A 1LWEA 1S1UA 3HT3A 5C25A 4JS5A 4YVZA 4HUFA 3OYGA 2OPRA 2V4QA 3VA3A 4IQTA 2NRXA 1D9FA 1S6QA 1TKZA 5CA7A 2Z1GA 4IRCA 3CFPA 3KTQA 8ICPA 1L5UA 1JL2A 1VSKA 3ALYA 1ZJNA 1UA0A 2HHTA 2V9WA 5J2MA 4KKOA 3L2VA 4K8XA 4RQ8A 1RPLA 1HUZA 4YG2A 1VRTA 4F4KA 2UVWA 2F1IA 8ICIA 3WNEA 3DLKA 1Z3EB 4KHQA 4QWEA 4XUSA 3JPNA 4O5CA 4I2GA 4CF1A 3H7IA 3M9OB 3RB3A 5KFAA 1TL3A 4I2BA 4GW6A 3FFIA 3V7JA 5CYMA 1DGSA 1ZQOA 1NK9A 4RPXA 3SQ4A 1U4BA 4CEOA 4MQ3A 4HUGA 3BJYA 5SWMA 3DI6A 4K8ZA 1EKEA 3T5JA 8ICSA 1W9HA 2OPQA 1TL1A 2YKMA 4QZFA 3RMBA 2IBKA 4FJ8A 1ZQFA 4GXIA 1A76A 4DEZA 2ALZA 1BIZA 3V9WA 2YHAA 1KEJA 4O3OA 2X78A 4NLKA 2G8VA 3MGIA 1IKXA 2FMPA 4BE1A 2W9BB 3PY8A 3CG7A 3Q8PB 3MABA 3KLHA 4E7JA 1ZQIA 2KZ3A 8ICKA 4R5PA 1TK8A 3VN5A 9ICWA 4F93B 3Q8SB 1NJYA 1S9EA 2ATQA 4O55A 4O3QA 3HM9A 5T7BA 5D3GA 4IDKA 4N41A 5BOLA 5KG4A 3OSNA 3HPHA 4M9HA 2NRWA 3V7KA 4QZCA 1U48A 4KPYA 4DSJA 2FC0A 1A5XA 4O3PA 3AA2A 3MGHA 4F5NA 1VSDA 2VWKA 1HRHA 1ZQHA 3UPQA 3PO4A 4KHWA 3EY1A 2P6UA 5DK5A 2UVRA 4LH5A 4H4OA 1S97A 1JX4A 2IHNA 4FO6A 3ORYA 1ZQMA 1YT3A 1IG9A 3ZT3A 5IIIA 3ZSWA 3H8JA 4M9GA 1RILA 1KLNA 3NHGA 3C21A 3RJFA 4B9LA 3JPPA 2G8KA 1HUOA 5J29A 1A5WA 2BPFA 4ELTA 1WSHA 4YR0A 3MR5A 2OWOA 1S1VA 3MECA 5HP4A 3Q8MA 1X9MA 1BPDA 4C8MA 3QEBZ 3QNNA 3KD5E 3JPSA 4BDYA 1KFSA 1L3UA 3F73A 4PGYA 5J2IA 4BXOB 4NCAA 4N56A 4UB1A 1S0MA 1HMVA 4ECQA 4O5BA 2OZSA 9ICNA 3VQ7A 2O4IA 1D9DA 1CZ9A 2UVVA 1JLEA 4CEQA 2A1JA 3LP1A 5DLFA 3ZT4A 3NAEA 1JLCA 2MUTA 4M3TA 3K5LA 4FLTA 4KLFA 3DRSA 4C8OA 1VSMA 3AVNA 3C94A 5SZTA 1BPZA 5C5JA 4N76A 4YMMA 1BPYA 4IQWA 4RNOA 4GC6A 4YNQA 1QHTA 1Z26A 4CJ3A 4J9PA 4CGHA 3T5HA 2FBXA 2PY5A 1TAQA 1ZQCA 1ZBFA 3F9KA 4QW8A 8ICCA 1JLFA 1A5VA 4Z6FA 2KN7A 1TKXA 1ZQVA 4TUPA 2ETJA 3CFRA 3RJGA 4OPKA 2KZZA 1GOBA 5J0RA 4RW9A 3ZSOA 3K5MA 3QEIA 5KGXA 1WSFA 4KHUA 2G8UA 3LDSA 3GIJA 4WE1A 4R66A 2YNHA 4FW1A 4F2SA 5HNKA 1QS4A 4KAZA 2WOMA 1C1AA 5J0XA 4DFKA 4OKEA 1NJZA 4TUSA 2R8HA 5IINA 3AVKA 4NYNA 1NOYA 4CHNA 3SYZA 3UXPA 4ED3A 1SL1A 5KFKA 2ZTDA 3PW5A 1T7PA 3G6XA 1HJRA 5CZ1A 1ZQAA 4CFCA 5DBAA 2RF2A 4JRPA 3NBPA 1ZBIA 5JS1A 3BQ1A 1ZJMA 4B9SA 1S10A 2RDIA 3OJSA 4J9RA 3BGRA 3ZT2A 1CXQA 5KI6A 2R8KA 3QEWA 4ECVA 1S5JA 1IO2A 4DSKA 3QEAZ 1ZQXA 5EOZA 3AVCA 5KT6A 3ZSXA 1ZQNA 3OYLA 4FJXA 3OYMA 1NK5A 4K4HA 5F9NA 3Q8KA 1S0OA 4DL7A 9ICKA 4RW7A 3HO1A 5KFOA 4QZDA 1JXLA 1J54A 1HQEA 3OYHA 4FZYA 3V9UA 3AA3A 2Y1IA 4QW9A 4PHPA 3L3VA 8ICBA 1U04A 5HMLA 2BCVA 3TAMA 4O3RA 1DTQA 2NRTA 3G10A 3TQ1A 1QTMA 2KFNA 3QEVA 4MEYA 2D0CA 4UBBA 4F5OA 3PV8A 3V6DA 1RTHA 4KREA 4ED6A 3KKSA 4F5RA 3N4MB 3QLHA 4RW6A 1TKDA 5J2KA 3L2UA 4Q5VA 3KHRA 2KTQA 4CIFA 2J6UA 4RQ6A 2YV0X 4FJNA 4E1NA 3ASMA 4KHYA 4DQSA 4DLGA 3JYTA 1ZQUA 2XC9A 5IILA 4M42A 4FLZA 2IMWP 4R8UB 3NGDA 3B0YA 4RQ4A 2VA3A 3DMJA 4AHUA 3SV3A 4MF2A 3TAEA 3SPYA 3IS9A 4P4OA 2D0BA 3RAQA 4DOBA 2HHQA 9ICUA 4J2EA 5FRMA 2H5XA 4DL3A 4PGQA 3VQ4A 4I9QA 2YHBA 8ICLA 5HRRA 1V9PA 4I2HA 2HNZA 4CJPA 2AQ0A 1NK0A 4PUOA 3K4GA 3KHGA 4RG8A 1LV5A 4EYHB 4YD1A 4YD2A 9ICLA 3AV9A 3RR8A 2FLPA 1ZBUA 2EX3A 4JUZA 4FLWA 4Z6EA 5KG7A 3LWLA 1NK8A 4KRFA 3OY9A 3MFHA 1ASUA 3AU2A 1YVUA 1NK4A 2BKEA 4DL2A 5KFZA 3I0RA 4DG1A 4FM0A 2XO7A 4W5NA 1RT7A 5KFPA 5FROA 2ASDA 1SKSA 4HCCA 5DDMA 1IXRA 2ASLA 4KLLA 3GV8B 2Y1JA 3ZT1A 1ZQBA 4Q8FA 4P4MA 2G8IA 3OYJA 1RDCA 4CFAA 2G8WA 1WNSA 3NH2A 1LAWA 3MDCA 2BQUA 3RJHA 1BCMA 4O3NA 2KQ2A 4AHCA 7ICUA 1HYSA 4YXJA 4XQ8A 4CGIA 3M8RA 4DSLA 3MR2A 4UAYA 3OHBA 1B9DA 3AO1A 4PH5A 4KLIA 3RJEA 1WLJA 3Q8LA 3LAMA 4OGEA 2B4JA 1XU4A 5KT5A 4KI6A 3QZ7A 3MR6A 4JS4A 1WCNA 3HVTA 2JLEA 1LB2B 4RQ0A 1COOA 5I3UA 1FKPA 2W9CB 3SUOA 4DTXA 4NLZA 4J2AA 1NKBA 3I8DA 4CGDA 4FK0A 2P51A 5KFUA 7ICGA 1Q9XA 1JLBA 4AHSA 4TSXA 3I0SA 2HHUA 1G15A 4M3YA 4O0JA 1JXEA 1LWCA 3S3OA 3V7LA 4R65A 4KFBA 1TK0A 3SJJA 4FVMA 4CHPA 5CP2A 3NH0A 3K59A 3HVRA 3K5NA 4IQVA 3ZCMA 2HHVA 2ATLA 5TZVA 3QIOA 5J2BA 8ICHA 4DTMA 3TFRA 4E0DA 4CHZA 1KVAA 3NFAA 3SNNA 5JS2A 1ZYQA 4RW8A 1BIUA 3C5GA 3H4DA 3NGIA 4B9MA 4C8LA 3Q8RB 1S1TA 3NF9A 5KFMA 4CJ4A 5CYQA 3SQ2A 4MFAA 2ZQBA 4Z4HA 3AVIA 4FCYA 4PWDA 5DMRA 4NY8A 2D5RA 2AJQA 2FMQA 3PVXA 2P6RA 2LYHA 3QO9A 3H40A 3V9ZA 3PX4A 1BVSA 8ICXA 3RJKA 4NCGA 4BE2A 5J1EA 3RBDA 4CJRA 3UQ2A 4CJQA 1RTDA 3O3FA 5IIMA 1RZTA 8ICWA 1LW0A 9ICTA 3CM6A 2I9GA 8ICJA 4O9MA 3RB6A 5KFIA 2DFLA 1XC9A 2Q3SA 2ZUBA 3KJVA 4IBNA 2OA8A 4M45A 1ASVA 1C6VA 4QZHA 2BDPA 3NF7A 1BHLA 3RTVA 2WONA 5C24A 2AGOA 4MEXA 3RRHA 2NRVA 5KG5A 4FS2A 2BQRA 2FLLA 4F91B 1S1WA 4ECYA 4B8AB 1BPXA 4DTSA 5CB1A 1S9FA 4L8RB 4DL6A 4Z4IA 1BPBA 4CEEA 1KFTA 3NE6A 3DRRA 1BQNA 1HJPA 1JN3A 4F4ZA 3K58A 1UT8A 3TAPA 5HLFA 4UAWA 2C2EA 4DTRA 1L3TA 3PW7A 4CHOA 3PO5A 3UQ0A 3S3MA 3C1ZA 4DF4A 3DOKA 3AUOA 3RMAA 1RXWA 1QE1A 4AHTA 2JGUA 2BHNA 7ICFA 3PNCA 4ECZA 7ICSA 3P5JA
chains in the Genus database with same CATH superfamily
1PILA 2VUGA 3FEXB 2HFUA 1ZQRA 2ODGA 2MSSA 3ETMA 5FPMA 3RJIA 3H0PA 2ZH4A 4ID5A 1JI7A 3GONA 3R3TA 4UY8O 4DV1F 5LY3A 2RLTA 4P71A 2R8GA 5K8PA 1F3VA 4LFBK 4NM1A 4X62F 4NLXA 5DM7L 2GOLA 4OV6A 3DRSB 3NRWA 4WWSA 2GO9A 2KSOB 2VKQA 1SS6A 5B0BA 3CJKB 4CE6A 3PUFA 4JBCA 4K50A 5IV3A 5GAEI 5ELZA 5FIIA 2RQ5A 3HMJG 4ECRA 1QVGR 2CNKB 2KW4A 4EP5A 1QD1A 2DGVA 2I2YA 3GZFA 1XNQK 4FK4A 4NXZA 1CRXA 1YTUA 4JB3A 4QZIA 3NRZA 3JAMU 1L3SA 2NQPA 2DNPA 5HI7A 1VDHA 5IOLA 1M5VC 1TKXB 2P66A 2AWZA 4I2AA 3MEKA 1F9FA 4DN9A 2AX1A 3EE3A 2QK9A 4CHQA 3M8YA 1O8BA 3OYIA 5F0XA 2W03A 4TURA 3NGYA 1LKZA 5E79U 4RX6A 3SQOP 4CH0S 2P9CA 1V3SA 4BRIA 1J2VA 3DLLL 1SV0C 3X1LB 3ULEA 2BANA 3DHWC 1WC1A 4MT1A 2HK3A 4YCXA 4UATA 2GX8A 5KQDA 5HOOA 3ONNA 3HW8A 3E2EA 5DQIA 1NGJA 4F4WA 1PC5A 1F1BB 1VK3A 4NI2B 5HVGA 2RB7A 3MDQA 4KX5A 1NK6A 2MSTA 2YJFA 3VGMA 4DTNA 3QYYA 1TVRA 1I39A 1SL0A 5KTQA 2XTJP 4ALZA 3AARA 2WB4A 1NGAA 2FJVA 4PHDA 3DRYA 3PIOL 1N60A 4UW9A 3A8JA 3IXQA 2FZCB 3SSRA 4FKYA 4LF5J 1QLNA 1FEEA 1J5OA 2A1AA 2D9PA 5IIKA 4KN7A 3IP4B 5E3QA 5ETPA 1N56A 2VBWA 3HHLB 1C7YA 2V69A 3AA8A 3PYDA 4KHNA 4O23A 3UW1A 4IOXA 1R0CB 4U8YA 3D2QA 3PEHA 3R5GA 4OKKA 3RWUA 4N8OA 4YB5A 5CY4A 3EICA 1N48A 4M04A 4FYXB 3BZKA 3IWXA 3C7NB 2M52A 9ICQA 4LIWA 3Q24A 3V9XA 1CBKA 4AM7A 4JI2F 3PIPQ 4LF9J 5KFSA 1WI6A 2OMLA 4Y2PA 3S9HA 2Q36A 9ICVA 2Z0GA 2P9PB 4M7XA 1XTZA 3OR1A 3RGIA 3M8WA 3QT7A 4I2EA 2VQEJ 1APSA 1RACB 4DV7J 3V6DB 3CMES 4B08A 3K75D 2GGPB 2A6MA 3I76A 5AI0A 3CD6N 3J7A1 5DM6Q 4AUKA 1T4GA 2AJ1A 1HNZK 3CDEA 4U96A 1ZD4A 1MSWD 4EBDA 2G8HA 4B9NA 4K25A 3MM6A 2BQ3A 1X5PA 4M1KA 3H46O 3SK3A 4DFJA 1UHUA 4CCHA 1VQ5S 4M6WA 2CWKA 1RYRA 1RWXB 5G5HA 4O5EA 1YRTA 2Z2ZA 1N5VA 3CCVN 4AYBD 1WC5A 2MKHA 3AU6A 1MQ3A 4OQJA 2AZ1A 2HNZB 2YNIA 3QBXA 2R7UA 2C2RA 2ZWHA 1T11A 1Y7PA 5JU5A 1VQLS 3TABA 1KKXA 1NDCA 2Z1JA 4IO9Q 2QARB 1PGZA 8ICAA 1S9GA 1IWGA 4AHRA 2IVYA 1BHNA 1GAOA 5BN9A 4FYWB 1RXOB 2XMUA 2W6LA 1P9YA 4LF6K 2GMJA 3G8SA 2JH7A 2BE2A 1ZM9A 3I0RB 3B8HA 1N34F 4JWNA 4LD0A 5CHGA 1RT7B 1FF2A 2HGMA 2ZXHA 4ISFA 1U2VB 5KNIA 4I2CA 1GO3F 3OBIA 1YAGA 4NE9C 5JMNA 1VHIA 5DM7Q 5AI4A 1T05A 5HK4A 2P9UA 1ZQWA 4E7LA 4DR4F 1BWFO 2YKOA 3IA0A 3THYA 4BY9C 1RT2A 4HHTA 3QT8A 1RKIA 5J2PA 3ITHA 4F36A 2VOOA 1G99A 8ICGA 2GVZB 1NMEB 1KDHA 3PJXA 1RWMB 4TLRA 3W2VA 3ETRA 3IP0A 2F63A 3F2DA 1AUSL 2P5VA 4IYQA 1NNEA 2KIVA 2QT7A 4MK7A 3EEQA 3M8SA 5HJYA 2QL9B 3OS1A 1T02A 1YTYA 4DX7A 2JEFA 2H3ZA 5LMUK 4URSA 1NGFA 1SC1B 2EK1A 3CCMN 3DLLQ 2HQDA 1C0MA 1IKVA 2FHJD 4LMZA 4LR9A 2OSRA 4DCJB 4KFBB 3CI5A 1NM1A 2NV3A 3P5TL 4E98A 2XICA 3KOAA 1ZPVA 2PEBA 1LCUA 2N7YA 4CGGA 3RAMA 1UZHA 3B78A 2O67A 4OZ3A 3NGRA 1LAVA 1PJ5A 3UDLA 5CYJA 1S0VA 2N82B 3PHEA 2RHKA 3MM7B 4QAGA 3ZXWA 3T9NA 1WN7A 2Y8YA 3TO8A 5AKEA 4DV3K 3PIOQ 3BH6B 2XYPB 1S77D 4PXCA 4K4XA 2NYVA 2XRIA 3CJBA 4EBEA 1EX4A 5JICA 4RQ3A 2BACA 2CJ9A 4A8QA 2DR8A 4RW8B 1SQEA 1PVPA 5T7LB 3W8GA 2CADA 4I28A 4QZEA 3VGUA 3H8WA 1PC4A 3A5OC 2XY5A 2ABYA 2FJDB 1BA1A 3DXKA 3EKSA 1WAFA 3B0XA 3GV7B 3OBYA 3PHTA 1T94A 1RU1A 1J27A 3U1MA 3PSFA 1OY6A 4Y2KA 1C1BA 3L4PA 4AE5A 4CYUA 2P9KB 4B1UB 4CJVA 5J1EB 1RYSA 1ZBTA 3D28A 1QVGM 1VQON 3V1OA 1LW0B 3TZYA 3D3CJ 5CR0A 2AGPA 3MCAB 4ZJLA 1LXJA 4M5NA 3C0BA 1VQSA 2IDOA 3QGHA 4NLWA 2ZJRL 5CXTA 4FK2A 4OI2A 1D09B 3GSIA 2WONB 1P7DA 5HROA 1QJHA 2WVFA 2YCHA 3ZX2A 3WXIA 3R9PA 5TISU 2BYCA 3F53A 1XNSA 1U0HA 4OHZA 4DR2F 4HDGA 3LPTA 2I6XA 3OW2R 4DB3A 1ZQQA 3SZ2A 3UKUA 4DL5A 4Q2LA 1E6YA 1VI7A 1OQ3A 2DB1A 3LVWA 4DS5A 5HAOA 3D2NA 1XHXA 2RE2A 5AKJA 2O8DB 5F1XA 4IG3A 5J0TA 4JI5F 3GG0A 4DOCA 4AH9A 1ZQGA 2WMMA 4ID5B 4OX9F 4CJSA 2A41A 3UVJA 4DR6F 7ICMA 1AROP 4NJ8A 2R7VA 5JTIA 3QEXA 2XLKA 2DY9A 1IG8A 5AQMA 1J2MA 4CEFA 4J9KA 3W9IA 5A0LA 1Z00A 3A8YA 2VD3A 2H1YA 1Q8IA 3DU6A 4GV3A 2R4FA 1HKAA 1S99A 1Q0NA 3TUJC 1WUAA 3H4BA 1XSLA 3AO5A 3D5MA 4GVMA 4OVLA 2IRUA 3E9PA 4O44A 4KLUA 1IQZA 4M8LA 5L1IA 4MK9A 5JLHA 2UU9K 3QU2A 4IC9A 2HAIA 4CZCA 1IBLF 3KLEA 4CW7B 3SCKE 2M8HA 2A6OA 4JI1K 3NH1A 4DPOA 1EKRA 1H7WA 3OLAA 1R89A 2RILA 4DLEA 3FZHA 3VERA 1CJKA 2XULA 3HFKA 2X6NA 1RABB 4ZH4A 9ICRA 4JKGA 3PJ9A 4ILHA 1B0VA 3IM9A 5KT3A 3GFKB 4FM1A 2UXDK 3BGUA 1RT1A 1HEKA 3G8QA 3ULEB 4DSFA 1Z05A 1WF1A 3DDNA 1WWHA 2BANB 4P7VA 5KPZA 2P6TA 3BGFA 4OI0A 4O4GA 9ICEA 4KHPJ 4PG7A 2BZ2A 4BC9A 3CCWA 1BUXA 4ES3A 2Z8QA 2LP4A 2ZOGA 5E84A 2FMSA 3M2RA 3T6BA 1YK9A 4JB8B 1SV5A 3G6ES 2F8EX 4ZVFA 1M90T 2YNGA 1YVFA 1TVRB 3D1QA 1HIYA 4E7IA 3OTDA 9ICGA 3DM2A 4V1Ak 2ZH8A 3UE5A 3ETLA 5ALMA 4LC9B 5DBBA 3HSGA 2QM1A 1M5HA 1S7HA 3A13A 3LDPA 3CRXA 5GAHI 3VA0A 1TUGB 3GG1A 1RAEB 2WHEA 3JS9A 5GMKa 4TU9A 3PRVA 4GVBA 4ZHRA 1J5OB 4GXJA 1M90O 2BZFA 3EGNA 2P9SA 2R7SA 3W5ZA 4CF8A 3NUQA 4X5VA 4K4GA 2GVDA 3HHLD 3UQSA 3HFVA 2CDQA 1Y0HA 4CF2A 4ZVGA 2VKZG 4K4ZA 1N4LA 1GLAG 2O5DA 2IMOA 4JNEA 1HNWF 1RT3A 1SH3A 4X65J 2CPYA 2V94A 5F8GA 1E4GT 3ZO7A 4Y2TA 4LF8K 3MFIA 1P1LA 4I1TA 2DF4B 2VG5A 5EU7A 4WQ4C 5BPCA 1FFVA 4DKWA 4F4XA 3OR1B 1HPMA 4K0KF 4KH6A 5EN1A 1ZBSA 1RXVA 8ICUA 2F65A 2ZJRQ 1KN5A 3AA5X 2C22A 3MM5A 5KFBA 4F5QA 2A2DA 4QR2A 3UKRA 2MXYA 3VTIA 3OHAA 1RG6A 4Y28C 4WFAL 1ITPA 4NXMK 1GXUA 3A0IX 4FWPA 3MM6B 2QWMA 4WQ5C 4C4SA 3QFPA 4S0MA 4M6WB 2MMYA 4KHSA 5HJXA 2WB1F 1UA1A 3FC4A 3OBWA 2J7WA 3DU5A 4LFAJ 1M0SA 4E1MA 4F2RA 3HT0A 1L7NA 1VQ7S 2OELA 2ZBIA 3NS5A 5GTIU 2JH3A 2RN2A 2YNIB 1T9WA 1YTAA 4MDAA 3KK3A 2DGTA 8ICMA 2MQMA 2VONA 1EWQA 2EBGA 1XMQF 5KG0A 1H72C 1X40A 3KIOA 3SBTA 1S9GB 1IM4A 5J2EA 2DFHA 3JAMO 4DV4J 1O1WA 4RPYA 2BE2B 1KQGB 3D1OA 1QQ5A 4DI6A 1ACMB 5GIOA 2L41A 2NREA 3T1AA 1X8DA 3GP9A 3HFZB 1XI1A 3BH7B 3DLRA 1PJ6A 4KLMA 2ZOMA 4LVSA 1SCJB 2DITA 1HWUA 1T05B 2P9UB 1OYEA 4ECTA 4CHYA 3IS9B 3OFEA 1XMBA 3MZIA 3THYB 3T5LA 2MKSA 2XI3A 2MJNA 1NNDA 1RT2B 4F26A 3BM7A 2R7OA 2ZVIA 4LY7A 1FXXA 1SB6A 5J2PB 3O4NA 3ITHB 3IBCB 1EARA 3ICXA 1OQ6A 4UZBA 3G82A 5AKGA 2DXDA 3W2VB 3BPSP 1AA1B 1B43A 1RBLA 1G4CA 4NWBA 2PFQA 2WUSA 2F8TA 2O4GA 2X51A 3KOOA 2GX9A 1YJNS 3RR7A 1Q4RA 1NH8A 4I2IA 1VQYA 4J03A 4WP9A 3OW2M 4RQ7A 4JI3K 4WK3A 1IKVB 4LR7A 4DCCA 2XY6A 4HVZA 2HWHA 5AZIA 2EAPA 1LWFA 4YN3B 1E4FT 2G4BA 2P1JA 2J6TA 4YR2A 4F67A 4E7HA 3QBCA 3VQAA 2BABA 4BQLA 4Q7AA 3D45A 3KFUF 2NXJA 4XRHA 4JKBA 3KMQA 4ER8A 2EVZA 2HQ3A 5EVZA 5ALXA 1WUUA 2KXHA 1ZC6A 4QZ9A 5KAFU 1ZQPA 1FNOA 1NH7A 4FYYB 1QAIA 3THVA 1F5AA 2QL7B 4TQSA 3VQEA 8ICEA 4BE0A 1RAGB 1BGXT 2F3NA 3NVWA 2MQQA 2YB4A 3MMCA 4HKQA 3ENQA 5AFUA 3PEJA 3DXKB 1R6YA 2VV5A 1B70B 2E8MA 1NU4A 2PAVA 4KLTA 2DNOA 2C2DA 4MIBA 3TVZA 3KUEA 4JI7K 1C1BB 3H59A 1KW4A 2VOPA 4CYUB 3R9KA 2WF9A 3M1YA 3L5KA 3LAKA 3K1RB 1WAJA 3U3GA 4C1NK 4X4TA 3UXOA 5A0YA 4PYAA 2FVQA 3LPUA 1OH7A 4HYKA 4DX6A 1IXKA 5BRFA 4FJHA 1RE1B 4I2FA 2LXUA 3WXKA 2A40A 3O3GA 4QZAA 1TFRA 4KR0B 1M1KT 3MN7A 1I5OB 3EXCX 3GIKA 1DRZA 3THTA 2OM6A 2A6AA 3HZEA 2AU0A 3H08A 4CWBA 4L6V3 3A8KA 4URGA 5HROB 4USTA 4ED2A 2CNNB 4NV0A 4I7FA 4H5RA 4HTUA 1IBKJ 2GWKA 4K4UA 2DRBA 3VOVA 3MAHA 1M1KO 3CCRS 1U0HB 4WFAQ 3PW4A 1QSSA 2OYQA 2JFDA 2OTLS 3RYLA 3OR2A 4US9A 4ILJA 2BCQA 2QTDA 3T5KA 3UKUB 2KU7A 4HT5A 1NBWA 1E6YB 4DV1J 7ICKA 2XS2A 7ICIA 1SGGA 1OH6A 1Q3VA 2CNOB 3G71S 4M5IA 5C15A 2XG8A 4X62J 3ILLA 4YR3A 2KN4A 5DB7A 3LOUA 4K41A 1VBYA 4X64F 3RB0A 4ID1A 3VAGA 3B54A 5J2GA 5IXUA 4IG3B 3CJRA 4RNMA 4ANCA 5KFEA 1ASWA 1VS3A 3QIPA 1RBSA 1WSEA 3L9ZA 4OX6A 2IVOA 4FBTA 1B0XA 4WFXA 4M3UA 2UUAF 5AI8A 1B22A 1J9AA 1NKEA 3UVJB 3S3NA 4DMNA 2HHSA 4FW2A 5FLXO 5J2AA 1B92A 1A0OB 1UJ5A 4FJKA 2BJEA 3IFEA 1CC7A 1Z00B 2OIHA 4YQWA 3EKUA 2PI5A 1WC0A 2VG6A 2DO0A 5ALPA 2LI6A 2V5HG 4PPXA 3L8BA 1MA7A 3LH2S 1FIQA 1BE4A 4HL9A 3RAXA 5KG3A 1VK0A 3A5MC 1F60B 1X3NA 3ZNUA 4TKTA 4O44B 3PSIA 4RZRA 3NOGA 1RBVA 1B99A 1NO8A 1F3FA 1S1UA 2BTFA 3KLEB 4RQMA 3HT3A 4JS5A 5DRKA 4YVZA 2FJWA 2YWKA 4A62A 2V4QA 2NRXA 4IJAA 1S6QA 3Q2SC 2Z1GA 1CJKB 3KTQA 2A3JA 1VSKA 1TUYA 3ALYA 2RP5A 3DGVA 2HHTA 4AT1B 4EWTA 1F0XA 3O5TB 4JKGB 1RPLA 2KLAA 2GCFA 4N7TA 2YHYA 1RT1B 8ICIA 3U26A 3WNEA 3DLKA 2L9DA 4O4GB 4QWEA 4XUSA 4DPXA 3HF5A 4CF1A 3O9UA 3M9OB 3RB3A 4WCEL 3NGTA 3M2RB 4QPXA 4P73A 4DR5F 4FSVA 2DL0A 2MZTA 4KX3A 1NK9A 1SV5B 4CEOA 2DNRA 3RU0A 2YNGB 4MTPA 2D1KA 2ZC3A 2CJBA 4K4WA 5IZHA 2QWNA 8ICSA 2OPQA 2EAOA 1HI1A 2YKMA 2HBLA 2R18A 4NX9A 3UDVA 3CD0A 3DM2B 1MLAA 4BR2A 1VQ4S 1GTEA 1PYSB 3BSCA 1HHTP 5EX5A 2OHFA 2DGOA 4Y2AA 4O3OA 4ZHRB 3GJQB 2CPIA 2RUSA 1IKXA 2P9SB 1MN9A 2FMPA 1P6TA 4JMUA 4QS7A 2NO5A 3PY8A 2DIVA 2GVDB 2ASMA 4I6MA 5IC6B 8ICKA 1OH5A 3NL0A 2KICA 5M2UA 4B3MK 1U8WA 2V8GA 4TN2A 1H73A 1NJYA 5CCMA 3PJWA 1NGEA 1RT3B 1VQKN 3GYGA 2PMZC 4OMFG 3L3CA 3OSNA 5AHXA 1KTVA 2VG5B 3HPHA 3MPYA 3R1HA 4M9HA 2QC3A 3IAS9 3MPUB 2B7BB 2BH1A 1U48A 4KPYA 1OJ4A 3MGHA 5IQ6A 3TPQA 1URJA 3MM5B 2V51B 1FNXH 2KJ9A 5DK5A 1SV4A 2G06A 4H4OA 3D3BJ 3VAFA 3AQEA 2BKOA 3UKRB 4L73A 5BR8K 3CF5L 2RQCA 3EZWA 5E3CA 1ZQMA 3I56S 4BC5A 3I82A 2GV1A 4R0EA 4PG4A 2C2NA 4DR3K 3K0JA 5IIIA 4B9LA 3BR9A 2O8EA 1WUDA 3CCLN 1FKAF 1VDVA 1FVQA 4KBOA 1A5WA 4LF4K 2BPFA 1WSHA 1N34J 4RUBA 1BPDA 3A12A 3QFHA 3JPSA 3KK3B 2EWHA 1L3UA 5M1PA 3F73A 4PGYA 2K4IA 1PK1A 1BMQB 5T14A 2RDDA 4ZCIA 2CJXB 4GKKK 2KJVA 5DDQC 4UY85 3MX5A 2HZVA 3CC4S 4RU2A 1NXIA 2OZSA 1H98A 5EHHA 2UP1A 5M1OA 2GO8A 1TQLA 1ZA1B 3OL7A 2UVVA 2E1RA 2G1DA 3N28A 5DLFA 4CGZA 2RJZA 3QUTA 4M3TA 4KLFA 1EKSA 3SAHA 1VHXA 4IDHA 2F3JA 5ALHA 3HBTA 2JOQA 1F5CA 5SZTA 1WKJA 4DR1F 3ZZTA 1VMBA 4YMMA 4FF1A 4IQWA 4GC6A 4YNQA 1NB7A 4CJ3A 2KO1A 4HHHA 4CGHA 4LJMA 3SFGA 3ATVA 2R7TA 5GAEP 2YTCA 2Z58B 1ZQCA 2A5XA 1YIJS 1VQ8N 3F9KA 2E1YA 1JLFA 1XMOJ 2R9LA 4DUZK 2KN7A 2VASA 3NAHA 3CFRA 1FJ7A 3RJGA 1O5JA 2VB6A 4OPKA 2KZZA 1GOBA 3G82B 1KKHA 2M8DB 3OFFA 4RL1A 2D3OR 3R7SB 3GIJA 1DZ5A 1SC4B 2JH1A 5HNKA 2JV3A 3N0VA 1TMJA 4DFKA 4FWOA 2QV6A 1W2IA 2XYHB 3UXPA 1OPZA 4CM2A 1SL1A 3FZKA 5AZIB 3PW5A 3BS7A 3G6XA 1LWFB 1ELOA 1S6UA 2RF2A 4OJGA 4M5KA 2VIHA 4JRPA 1S4EA 4WCEQ 4CH1A 3BEXA 2V34A 4JKHA 4LRDA 1VQMN 1ZJMA 4B9SA 1GXTA 3N4QA 2RDIA 2YWGA 3OJSA 4JI4F 1WG1A 3G9CA 1CXQA 5KI6A 2R8KA 3QEWA 3HSDA 2DXEA 4KGMA 1IO2A 2RAQA 1L3KA 5EOZA 2JR5A 5KPRA 5KT6A 4A8YA 2HMXA 3TR5A 1FO1A 3DC2A 3OYMA 4OYAA 2KHVA 3CD7A 4EK2A 3Q8KA 4AXIA 3KMSA 3HRGA 4LF5K 4QZDA 4O8UA 2VPWB 2IHR1 5SUHA 4A8EA 3MMCB 3O9SA 3QUQA 1RKJA 5JVGL 3IR7B 4G9BA 5K5MA 4MYTA 2BCVA 3NRBA 3T1YJ 4NXNF 2D1CA 3TQ1A 2KFNA 2NXCA 4GVEA 2D0CA 3C2PA 4DR2J 1T44A 2OUGA 2KRRA 5A0YB 2HK2A 3PV8A 1RTHA 4ACOA 4BG8A 2W4CA 4LF9K 4RW6A 2YWEA 3IAM9 4Q5VA 3FRYA 3KHRA 2ZF5O 4ZITA 4DQSA 4XDCA 4DLGA 4GFJA 3AGKA 2DNMA 3JYTA 5IILA 3UN5A 2MHNA 1MG7A 3NGDA 4R25A 1XNRF 2VA3A 2I1RA 1HW8A 5BYRA 2MKJA 4CZIA 2NXNA 3CF5Q 1BO5O 3TAEA 3SPYA 4I7FB 1U02A 3D7SB 4P4OA 2D0BA 2FY1A 4NRTA 3EDRB 2JNJA 4JI5J 5FRMA 2H5XA 1JQGA 3OR2B 1P27B 2XB2D 2Q31A 3C6HA 8ICLA 2JX2A 4MJKA 1V9PA 4OX9J 1NK0A 3K4GA 3O9QA 4WYBA 3VR1A 1VAZA 4USIA 1JK9B 4B1YB 4DR6J 2ZUGA 3AV9A 3RR8A 3EX7B 3FEYB 1LK5A 2H5IB 1LK7A 2EFNA 2OD4A 3H0RB 1UVIA 2EC0A 5AICA 1ULRA 1NK8A 4U67L 4KRFA 2JRSA 4B3SF 3MFHA 3ED5A 1ASUA 3AQFA 1YVUA 2GQ2A 4DL2A 3QIPB 2AIRB 3RZAA 1TZ0A 3GV8B 3J7Z5 1MN7A 2G8IA 3OYJA 1RDCA 4G6VB 2HLUA 1WNSA 1LAWA 3AMZA 2BOPA 1IBLJ 1DK2A 1BCMA 4O3NA 3G2XA 2ZGZA 1WWUA 3CJ2A 2HFVA 2ZFHA 4CGIA 2RRNA 3IM8A 3AD7C 2Z7JA 4BVPA 3M8RA 2YPYA 3SMZA 5GINA 1WF0A 1B9DA 1SVDA 2KRBA 4PH5A 4KRWA 3FSIA 2VG6B 4KI6A 2UXBF 1WCNA 3HVTA 1WG8A 4ZVEA 3TZXA 5AKZA 1GLDG 2FD2A 2IRXA 1HHQA 3WC2A 1RHQB 2J0XA 3VEZA 1QH9A 4WU3A 2KI2A 4CGDA 2A10A 5KFUA 2H4YB 2BJ7A 1S1UB 3OFGA 2ZZNA 1PAEX 1JLBA 2IJNA 2GS8A 2CUYA 2ILZA 4DV0F 2CKWA 5BRDA 4DN0A 4ZMMA 1G15A 3CJQA 1S6QB 4O0JA 1M6YA 2X1GA 2WFBA 1X0FA 2V50A 1ZD3A 3CB4A 2L9WA 1FO4A 4A4JA 2J0WA 3ZC4A 4OYPA 4TXSA 3K59A 4IQVA 3DLKB 1JALA 1REGX 3EL2A 4OJ1A 3D6MB 5TZVA 2XMMA 4XH1A 2BJ8A 4CHZA 3L95X 2LXFA 2ZDPA 3NFAA 3WXJA 2F4FA 3T9ZA 4JEPA 2OPQB 2DCUB 2YKMB 3H4DA 4CF3A 3WEEA 4C8LA 1S1TA 1HNWJ 2E1ZA 2K3IA 2V4JA 5F8NA 2DRAA 2ZM6F 1S6OA 2Y0SC 5AE1A 1AUDA 1YITN 4FFDA 1RT5B 4PG6A 4LRFA 4NY8A 4ICAA 1IKXB 5IT9U 4DBQA 4YS2A 3BZQA 1OSCA 4K0KJ 5HVHA 2LYHA 1YRXA 2R3VA 3V9ZA 8ICXA 4QR0A 2YY6A 4I6MB 3POTA 4J91A 5JVGQ 2QA4N 3UQ2A 3FBBA 3QMQA 2ZG6A 4Y00A 4Q2MA 5D0RA 9ICTA 4X4RA 2KXNB 2Q1LA 3WKAA 3ENBA 1Q78A 1RCOB 2DFLA 1PSDA 1F5SA 4IBNA 2OA8A 2MQPA 1COKA 4B02A 4M5MA 5C24A 4M5LA 3CGIA 2NS1B 4PEOA 2FLLA 2Y9HA 2N4CA 4B8AB 2K4EA 1S9FA 4DL6A 5C10A 2OEJA 3C8YA 4H4OB 3G96A 1XNQJ 8ATCB 4NL9C 1UT8A 1O0PA 2Q3PA 1WYGA 3QRQA 1XMQJ 5HLFA 4A5BA 2C2EA 4DTRA 3PW7A 2O8EB 1UVJA 3PO5A 3CIZA 1GLLO 3AGRA 3DOKA 3AUOA 2FI1A 3KFWX 1VYAA 5M1KA 2UV8G 2YWFA 3C3LA 4I64A 3SIPB 1SIZA 5ETRA 4J5OA 2W7AA 2VU5A 1N54B 2XEXA 2QW9A 4WYWA 1WC4A 4U67Q 1NGDA 2D0AA 1PK1B 3J8AA 1T9VA 2QEXS 2DNQA 2C1EB 4CIGA 1RTJA 3VQTA 3BPDA 1RLCL 4DU3A 1HNXF 2IOCA 2XCPA 5AK4A 3KG1A 1F44A 5AI5A 4Q44A 3WX8A 1F21A 2ZD1A 1SQKA 1HR0F 5K8NA 1Q46A 1Y88A 2HS4A 5I9EB 3VQDA 3IM1A 3H5SA 2WC9A 3BS5A 3LZJA 3THWA 5F8HA 2AP1A 5AT1B 3W2WA 2G1HA 3Q7BA 1HD1A 1WSVA 2E8AA 3E8OA 2Z1IA 4P10A 3O6QA 2OHDA 5T41A 3HWTA 2K60A 2GEMA 1VJ5A 5DDYA 1NZ8A 3CP8A 4F04B 1FWPA 2ZHBA 2AEMA 3EZOA 2EKNA 4PABA 3JB9k 3EE9A 1FJEB 1JLFB 5EUHA 3OVBA 4C3MA 1ZQTA 2HI0A 4QS8A 2X6SA 4GXKA 2PA3A 4B1WB 4O5KA 3UD4P 5F8IA 4ZVQB 4GMKA 3ZEUA 3P38A 4JRQA 3OT9A 1XEZA 4JV1A 1Y3KA 3AVFA 3N6LA 3GOIA 3P83D 1ZQSA 2QA1A 2WAQF 2WTFA 3ZX3A 3V6JA 2HMIB 1PUZA 4G3IA 3NXZA 1U6FA 5ALDA 2CGLA 4TQRA 3KK2A 3JQKA 1NG9A 1U49A 2V67A 1D8LA 2HG4A 3OPXA 5M1QA 3JTPA 5JUMA 9ICOA 1NSKL 1R27B 4DV6F 4CI0B 2ZUCA 3CJ5A 3RJMB 2RF2B 3OYAA 3EPGA 1GMWA 3U7JA 2CXYA 4H5NA 1PBUA 4KHPK 4XPEA 2XMAA 3ZSQA 1N36F 4GNIA 2N3OA 3IR5B 3WK7A 5I42A 4Z0UA 8ICQA 4RW4A 3VENA 2O8BA 4MH8A 5LXYA 2DKZA 4HHJA 1GX6A 3GSDA 4LQ9A 3H8SA 5GAHP 4WP8A 3OVSA 3K8VA 5IWAF 2W11A 1WBDA 3EWAA 2O3DA 1K0VA 3QBWA 3FRZA 5LJ5Y 4CI6A 3JPQA 1ZRNA 3BO2A 1UP1A 2HVEA 1RYUA 4Z4CA 4KI4A 1ZS6A 3RRKA 4CF0A 4UQGA 4K59A 1NUEA 4H0TB 3IG5A 4CEDA 1REVA 1Q82T 3KUHA 4KLJA 2LYAA 1HYZA 3R5AA 2IJRA 3TACB 2B0GA 1UEVA 2YB1A 1MWKA 3L4IA 2HPUA 2QWQA 1ZETA 1H6KX 1RTHB 4DV2F 4X65K 4QS9A 4I29A 4ZVTB 4LF7K 3HHDA 1O6XA 3SSSA 2D0OA 4RW6B 2ISOA 3V4IA 2ZKTA 1Q82O 5DB6A 3C5FA 4KH1B 3D0IE 2X1FA 1S1XA 4BDPA 3KYLA 3KWIA 1JNZB 3US5A 4X64J 1Y00A 4DPWA 4B3OA 4LQ3A 3W5YA 1NU0A 4WJ3B 3H45C 2IBOA 3JPRA 3MXIA 2A3ZA 3L2WA 3N6MA 3AO3A 2QJ3A 3MDAA 2I7NA 2HVIA 2UUAJ 2NSCA 2IDEA 3FQKA 2DHAA 4G1IA 1HW9A 1OSDA 4NLVA 4OJ3A 4JI6F 1FTRA 4X2BA 4FYDA 1JIHA 2MAXA 4LFAK 3VQ8A 3WX4A 3OTOK 1C0TA 1WHWA 1ZQDA 3C1YA 2VCPA 3SUPA 3N97B 3ZSRA 4PG8A 3PMLA 2IYGA 3ID6A 1ZA2B 4PWWA 1UOCA 3UI3A 4FVCA 2OTJS 3U27A 2BUPA 1V9OA 3TWHA 1YI2S 4JI0F 1WHYA 4RR5A 4EHUA 5J0OA 1IKYA 2B21A 1LOTB 3KLIA 1IV0A 4WU2A 2KVSA 2JZBA 3KHHA 3C15A 1S59A 2BRKA 2EXUA 3W0LA 2LQ8A 4KLSA 1CJVA 2LEBA 2HFNA 3C16B 3KK1A 3I8BA 4I6YA 2ZC4A 2OZMA 4KHRA 4XPCA 3ZI4A 3SFUA 5AFUH 2PZSA 4F71A 2AYEA 1SJ4P 4CEAA 1U1MA 4W92B 4I2JA 2FJEB 3K2PA 3GIMA 1X1PA 1JLBB 2ZJ5A 1A6LA 1S72S 4DR5J 2ZWPA 2HF3A 3F44A 4Y1DA 5L9NA 3CCJS 1FWLA 2G09A 2RDJA 2FPKA 4HUEA 1AZSA 1VQ9S 4LZDA 3MGJA 2V8PA 4RT3A 2AJFE 2JRZA 3H90A 4IWVA 3HP9A 4RT2A 1KP6A 4NPOA 5B8HA 1NGGA 1HBUA 3BO4A 4DTJA 4QPTA 1WEYA 1X0PA 3MM8A 4KITB 3KLFA 4DU1A 1SL2A 1T3QA 2JJ4D 8ICZA 3GFXA 4DZ6A 3CC7S 2GAGC 1AYEA 2ZITA 1LW2A 2CZ4A 4DZDA 2PFUA 3W61A 4HH0A 4Y1CA 1XBWA 3O6WA 4C3KA 4B1ZA 3HL8A 3CCSS 2UUCF 3QINA 3WEEB 1S1TB 2DT9A 3VQQA 2V4JB 2KKPA 1XO0A 5L39A 4PJ0U 9ICAA 5LSLA 3JSMA 1KQFB 4CDGA 3C14A 3SV4A 3QNOA 1WDTA 4BACA 3NF8A 4GMJB 1N32F 4CGJA 4I2DA 3QU7A 2R7YA 3M2UA 3POTB 2P8IA 2PMWA 3J7YI 1HBOA 5DQHA 1NJXA 3OQ2A 5J2CA 2VICA 2G2YA 5AK5A 5AXMA 2FJBB 2ES6A 2KHOA 1IIPA 2GWSA 2RVJA 4RUAA 1QM9A 2ZE2A 2W9MA 3S6JA 1VR6A 1R59O 2R2RA 3TSUA 2B9EA 3L0QA 3QICA 3S41A 4EP4A 3D6JA 3FCVA 2E5GA 5C24B 4NYFA 3R6MA 5C2CA 5AQQA 4DHYA 2WHOA 3JPTA 3GYNA 5KFNA 5CE3A 4YB6A 4KLQA 3AO2A 5BPLA 3MMVA 3BN7A 2C3MA 1VLOA 4DTUA 1RHUB 3HLUA 2HOEA 3DWLA 5G5GA 5H9FK 1N5TA 4LRAA 4CF4A 7ICOA 1UEUA 3NCIA 5HLFB 1WWVA 3CJ0A 1IBKK 2LKYA 2NUHA 1Q5VA 1TL7A 2P9NA 2V7YA 3HJFA 1YSJA 2H54B 5AJ3F 3DOKB 3KWMA 3WK5A 3AOCA 3QE9Y 3AAQA 5JMVA 2PFNA 1Q8BA 4F3OA 3A4TA 2EQYA 5AM2A 2UXDJ 4DV1K 3LM9A 2AMCB 4Y2JA 2FHJA 2ZBPA 2D3ZA 4LVOP 1M5PC 3AVJA 1RGVA 2E1MC 4UQTA 3FBCA 4LSLA 4DFMA 4X62K 1JKHA 3V9SA 3W5XA 1RTJB 4XH4A 4JWMA 1IJEB 3M9NB 1EB0A 2D8CA 2G5IB 2ZD1B 1VQNS 2ZZMA 3GFHA 2J7KA 3SMPA 3CCUN 3WIUA 2EW9A 2KD1A 1B9FA 2VGMA 3IKMA 4O8KA 4JD2A 2Q6CA 1G6BA 1NGBA 1KLMA 1X9JA 3VAMA 3OYCA 2LDIA 3BS5B 3THWB 3M8PA 2GH1A 4DMZA 3MURP 3W2WB 1UFWA 1NKCA 1XR6A 2CPZA 4MMOA 2GWJA 4BRGA 5AQLA 2ATCB 8AT1B 5ALNA 4G1QA 3NNCA 1RHRB 4HEA9 2LSNA 3OD2A 1TTHB 3FZBA 2AJ0A 3RH5A 4BRLA 2GELA 1BWEA 2M70A 4EUVA 2HHWA 1DY3A 2DCLA 3VPZA 1K1SA 4Y2CA 4XIUA 3R97A 2D3O1 4EX6A 5DGBA 2IOHA 1R31A 4J9VA 4RTFD 4B8CA 4YP3A 9ICHA 2KE7A 2BEFA 3ZEUB 4ED8A 4WFZA 1RWWB 1HLWA 3HP6A 4JI4J 4M47A 2OI2A 3SI6A 3RH6A 3RH4A 3K9JA 4LREA 5D15A 3MEEA 3RG6A 3J80Y 3KK2B 5GADI 2F8LA 1HQUA 1VSFA 4O0IA 2R7WA 3UCUP 1HKBA 4A59A 4BBYA 1SKRA 8ICNA 3I5CA 7FDRA 2ROGA 3PR5B 2WSEC 1X9WA 4RU9A 2A1RA 1HPZA 4KB7A 1D3WA 1CXUA 5KFLA 4KGVB 1LXNA 4DO9A 2RRDA 2BCUA 2J8AA 2XIDA 2XI9A 3WNGA 6FDRA 3MR7A 4AQYF 4F9OA 2FIUA 2M9KA 2QWPA 2G8FA 4PQAA 5I42B 4RW4B 3LZIA 1WTBA 2O8BB 1BG3A 2D3UA 2O8CA 4Y2SA 2XY8A 3CDAA 1N5WA 3V6KA 2D41A 1CQNA 2F9WA 1S12A 4NXNJ 4BUGA 3TANA 2HVHA 4EFHA 1ZQYA 2BUNA 2P6SA 4WZQA 3OSPA 5LMNF 5M1NA 5B66U 2B5JA 2Q4TA 4JI2K 3E01A 2C2OB 4WFYA 3OS2A 2BM1A 3ILIA 2KKVA 1DRGA 2XM3A 1DAXA 2QYCA 1NDLA 4BVOA 3D68A 1XNRJ 4J9OA 1WD6A 4FYVB 4H0XB 2RRBA 2P35A 2E6LA 5ALJA 2Y9TA 3P49B 2HHHF 1NM2A 2LVWA 3AAPA 3FBEA 4RNFA 2DY4A 3RW7A 2QXLA 2W2PP 1NOZA 3PX6A 9ICSA 2HBYB 5A6WA 4OZ1A 4DUYF 4ZN3A 4KMUA 4B6JA 5DETA 5IC4B 1L3VA 4JKDA 1WCLA 1S1XB 3IG1A 1JB0C 3R1XA 4B9TA 3MGVA 2YXLA 4B3SJ 3PCOB 4EAHD 4E1JA 4B3OB 2YMMA 3GBTA 1CC8A 4KT0C 2DY1A 4FLUA 4ILGB 2EH9A 1CJUA 1BNOA 1EQ0A 3E1YA 5ETQA 2E5LF 4F50A 4OPHA 4K7QA 4Y2XA 1KEKA 1HQ2A 3M8QA 4CBUA 1UT5A 2RKIA 2F8HA 2E7WA 9ICXA 3HCXA 4LJXA 4BXOA 5IV4A 3L2QA 3I9ZA 5CQGA 3KKAA 1C0TB 4NASA 1N34K 5J0WA 3MPVA 2LYBA 1DT9A 1PYOB 3Q7CA 3TARA 1U45A 2OLWA 1FFGB 3OYEA 4IR1A 4M2YA 4HWIA 4FXVA 2UXBJ 3NNAA 1IKWA 5CZVA 4ZLPA 2DNNA 2W04A 1F5BA 4DR4K 4NI2A 4B1XB 3K17A 3HXMA 5J1NA 2RU3A 3SI8A 1WC6A 3AH6A 1S76D 1RA6A 2AA4A 1CLFA 3CJ7A 2HBJA 4KLDA 2B51A 3CE8A 1MROB 2RS8A 3Q22A 3KLIB 4BDZA 1KS2A 2YNFA 2RUGA 4HHUA 4DV0J 4H4KA 2JZBB 4IQUA 3C15B 1MMNA 1RAOA 1CJVB 5KG1A 3CERA 2YN4A 2IM1A 1VBXA 3KK1B 2E3TA 3ISBA 4EEKA 4JV0A 5J2DA 2APOA 1VQ6N 3ZTRA 4KH0B 1U47A 2JWLA 4CQ1A 2XBPA 2PD1A 2OGUA 2WVEA 3PW0A 2V2VA 5AKYA 4DQRA 2AYMA 4DPTA 2CQCA 1LEOA 7ICPA 3H5YA 2I5JA 1WSJA 5FJ4A 2UV8A 5C2DA 3ZZZA 3CYMA 1O08A 4CZLA 3ZT0A 4CP5A 4IRDA 1AZSB 3I96A 2P9PA 3P1GA 5RUBA 4FO0A 2YX1A 3KBBA 3I28A 4A2AA 3VMFB 4IQXA 2M5YA 1VQ8S 1Y97A 2ZM6J 2M4MA 2XVTA 3H2UB 4FWQA 1HBUB 1T8EA 2NLXA 3H2VE 1JLGA 2FHMA 2V6AA 3CVKA 4A8KA 3MM8B 3TWZA 5KFQA 4IR9A 3CDUA 1XWLA 4C8NA 4QJVA 1UVNA 1VFJA 1LW2B 1JROA 5KFWA 2ZUDA 7ICRA 2NYHA 5AI9A 1T03A 3ZDDA 3MCMA 2MLZA 1JJ4A 3L7PA 2ZH7A 4DSEA 1UL3A 2WVCA 1JCFA 1VSJA 3A5NC 4NA3A 2FZKB 3JSMB 3KJQB 4DX5A 4J9UE 3UCGA 2DHGA 1DLOA 5J0YA 4LFCF 3C14B 3P4IA 3GILA 1N2XA 8ICYA 5HQMA 4KN4A 4CZMA 3CFOA 4FM2A 4CO1A 3MPDA 2BKNA 2R7RA 5ITHA 4CM0A 2PFPA 1A77A 3M2UB 4EI2A 1BL3A 4H0OA 1HBOB 3V1RA 2QWLA 3D2FA 3HKZC 2EZYA 1D5AA 4ED4A 1MDUB 2NUUG 1D0EA 4NM2A 4NLTA 2PI4A 2E1PA 1WEXA 3W9HA 3LDOA 3OVNA 3CDWA 4FZVA 3NMRA 3RRGA 4CD1A 2C3PA 2CPJA 5ALTA 2ZE2B 4FJJA 1TL5A 2W2OP 4PQUA 3LM2A 2AT1B 3M6GA 4DR2K 3TYTA 3A0BU 1ZQZA 5CRXA 1RB0A 5KT7A 4QU7A 4JOUA 1SZPA 4TUQA 3C2MA 2HMPA 1AB8A 3PRBA 2PMHA 1Z1BA 1JJHA 4A5AA 4ANEA 1DQ9A 2VG7A 2GBZA 5AM4A 2G0JA 1NSPA 3TX0A 5LSOA 5LJVA 1HNXJ 2ZIVA 1TL7B 4PY5A 2PN6A 1RAAB 2P9NB 4FS1A 3JXOA 3FEZA 1Y5NB 4M3RA 7ICTA 4JI5K 4X4NA 2DR6A 3VEWA 4NEYA 1S22A 2C2MB 4OYWA 1HR0J 4KTZA 4J9NA 3G4SN 1EP4A 3J80U 4OX9K 2EPIA 2G08A 4EEYA 2DUYA 2CPDA 3VESA 1ILYA 4DR6K 1XR5A 1LQ9A 4DPUA 2OPPA 1Q79A 2HHXA 4I27A 4LSLB 3QZ8A 8RUCA 1JKHB 4ECWA 3E9OA 3FGUA 4QWAA 3BQ0A 4CFBA 4TYBA 4NLCA 2PBDA 2W4DA 1A6SA 2QA2A 4PKDB 4CO3A 4OV1A 4ZLNA 3HTVA 4X4QA 2HBKA 1SQFA 5IS2A 4J9QA 4JD2B 5F9LA 1GLCG 3TTCA 1KLMB 4OJ6A 4IL6U 1UEKA 1SV0A 1XSNA 4X4VA 3M8PB 1BUPA 1MMDA 1IBLK 4KSEB 4G1QB 3VQPA 2E8OA 3DGPA 4JV2A 2XHWA 1BISA 3SCJE 1LWEA 3IG8A 3K2YA 3CC2N 4B3MJ 2K3KA 2M2BA 3D4JA 2EFPA 3D66A 4DV6J 5CA7A 2ZIWA 2NZCA 1ZJNA 4KKOA 4RQ8A 2X3GA 1RJJA 1N36J 3HRDD 2GMLA 1BD6A 4V19S 4F4KA 1Y64A 3GR0A 3MEEB 3CCTA 2YTUA 3JSBA 4FWSA 2RQ4A 4O5CA 1V97A 4I2GA 1HQUB 1JCGA 5IWAJ 1TL3A 2O8FA 5IM0A 4UW2A 1DGSA 5DS7A 1QQ7A 3SQ4A 1U4BA 2HBZB 2EBEA 3JXUA 1HPZB 4DDFA 1NHKL 1Q8KA 2MLYA 1SH0A 3N9UC 1F2HA 1GMWD 2XSFA 1OWXA 4GXIA 1A76A 5B0AA 1KQKA 2YHAA 1KEJA 2BVZA 2O8CB 5ALYA 1N0VC 2EK6A 3WDOA 2G8VA 1WOSA 3UR0A 3OXFA 2AX0A 1HNWK 4DV2J 1Y3JA 3KLHA 4E7JA 1W2BR 3GU3A 3K9KA 2B5JB 4A8FA 1V4TA 3E01B 4FZMA 2VDHA 3KHYA 4CZGA 3ZZYA 4U7UD 2YKQA 4NYOA 4O55A 3O4WA 1GNKA 2DRDA 4K0KK 3AL0B 5ALRA 5D3GA 1ATSA 1UTAA 2DNLA 5BOLA 1UPMB 2IIRA 1DQ8A 1RA7A 3V7KA 1ZOLA 2MJUA 4JK9A 1Y11A 2J0SD 4F5NA 4HACA 1VSDA 1HRHA 1TUWA 4KHWA 4BROA 2VDIA 3O08A 2LCWA 4M7YA 2IHNA 1FCAA 3CMEN 3KNGA 2ZH2A 3AXMA 1SH2A 4JI6J 3VGVA 1N63A 1YT3A 5EE3A 3IG1B 1C2PA 4DUZJ 3ZT3A 2C2KB 3DXSX 3FCHA 4M9GA 3NHGA 1KLNA 2F5GA 1X4BA 4WXOA 3F5AA 4MHVA 2I38A 3JPPA 5K4LA 1X5TA 4QIWF 3TQEA 5J29A 3OV7A 4YR0A 3MR5A 2OWOA 1CJUB 1S1VA 2ZZTA 1XMQK 4H5TA 1VQ5N 5GAGU 3HVWA 2XZTB 3ONQA 1FERA 5KPTA 3M8QB 5F8MA 2OCEA 2RKIB 3JQMA 4YOWA 4NLRA 4BXOB 4JI0J 2CPEA 4N56A 2HSZA 1HMVA 7AT1B 2HCFA 3M2VA 4O5BA 2L08A 1KVIA 1NGIA 3I5BA 2BXJA 1VQLN 5B7WA 1RFQA 1X7VA 3LP1A 3N7PD 4Z7YA 1JLCA 3UR3C 5EX3A 3PRDA 1SXDA 4ZPBA 1GT8A 4KQZA 3R27A 3HSZA 1IKWB 2XS7A 3KK7A 4FWNA 3H0MB 4TLQA 4I6AA 5M1FA 2F8KA 2P2CB 4NA2A 4N76A 6AT1B 5AI6A 1BPYA 4RNOA 3QT6A 4HTLA 2XWYA 2DH8A 5AQWA 3QB0A 4UOFA 2YNFB 2UZAA 4JYAF 1ZBFA 4QW8A 4ZPDA 2OXOA 1O13A 2GIQA 1ZQVA 5E3AA 3CPEA 3DFEA 1T9YA 4TUPA 2ETJA 4A61A 3B82A 4KGZB 3ZSOA 3AFGA 4IO1A 5AQIA 3PDNA 2RT3A 1RK8A 1H0HB 2WBMA 1WSFA 4KHUA 1WG4A 2DXFA 4FW1A 3W1YC 4F2SA 3A8IA 1TR0A 2I5JB 2WOMA 3CSKA 4JN4A 3U4LA 5EE0A 4TUSA 1PAUB 3W60A 4O3MA 2KJWA 3M6XA 4UB8U 1FE0A 2FSJA 2M3DA 2ZTDA 2UUCJ 2KHDA 5CZ1A 2UUBF 4NLSA 3VCDA 3NBPA 3MWTA 3BQ1A 3NMAA 5IT0A 2DQNB 2LBOA 3MDFA 1KVKA 1JLGB 4J9RA 1HWJA 5CHCB 4EFAC 4RBTA 5AQSA 3QT5A 2BJ3A 2Z56B 1Z6RA 5B0CA 1N32J 3QEAZ 1ZQXA 3H20A 5FP0A 3HKZF 1ZQNA 1FE4A 1T3OA 2N7CA 1T03B 2QB0A 4DL7A 4I68A 1U2CA 4RW7A 2H3GX 5JLFA 1J54A 2ACYA 5F8LA 2KT2A 1P1TA 1URNA 2DHXA 2HRYA 4Y0FA 2YMQA 1DLOB 1N33F 3BB5A 1KHVA 3V9UA 1MWZA 2Y1IA 3ET6A 2E9RX 1WOQA 5B5EU 4Y0WA 3FZLA 1U04A 5HMLA 1H2TZ 4O3RA 1DTQA 3AY0A 2NRTA 4EX7A 3VHQA 4MO5A 1G7CB 3CCES 2YKAA 3QEVA 2WK4A 3EUNA 3D2FB 1U8SA 3VF4A 3O3LA 4KREA 1K9MT 3DHXA 4ED6A 3I55S 4P6QA 2UXCF 2WB1C 1GK8A 2HRUA 5HN0A 2YQ1A 3KKSA 4USJC 2KTQA 4CLKA 4FJNA 3GTYX 3ASMA 5CAAA 2XMJA 1WG5A 3W64A 5EDWA 2HQCA 4PQUB 1ZQUA 5CR4A 2IMWP 2IA0A 1JMTA 5AJ3J 4I6WA 2Q0RA 3DMJA 2LKZA 4MF2A 1K9MO 3IS9A 5F0UA 4QBUA 1A9NB 2I6WA 1WORA 4J2EA 4PZOA 4TU7A 2OAUA 3WIVA 5E3RA 5HRRA 1YF5L 4I2HA 2LXIA 2AQ0A 4PUOA 4TYAA 4C7ZA 1QDUB 2B3TB 3T1HF 2VG7B 2R2UA 4EYHB 2FZGB 1BY9A 1SJRA 5AM1A 4YD1A 3Q8VA 4X64K 2ZIVB 9ICLA 4RWTA 2FLPA 4IUFA 1ZBUA 1SZHA 2X7IA 1DURA 2EX3A 5M2RA 4JUZA 4EHTA 4AP9A 2QMXA 2XMWA 1EP4B 1FRIA 1RT4B 2YHWA 2UUAK 3AU2A 1NK4A 5KFZA 3OTQA 3WXMB 3BF1A 3SBGA 2XO7A 3QPIA 4W5NA 2OPPB 5FROA 2ASDA 5DDMA 1T9XA 2Y1JA 4CO2A 4Q8FA 3PFEA 1RDWX 4CFAA 5ALSA 3BQ7A 1W2BM 3KG4A 3CMAS 4LRBA 3LVVA 2HWIA 3SD7A 4USAA 1DKGD 4YXJA 2VQEF 5J8YA 2KEYA 2BX6A 4DV7F 3AM9A 3LQVA 4NLPA 2DBBA 3OHBA 3RJEA 1FRHA 1RBOB 3LAMA 1XU4A 5KT5A 1V5IB 2Z2YB 3PYFA 1Z4NA 4X4SA 3OTCA 2JLEA 4F0KA 2A42A 2B56A 2E9ZA 5I3UA 1FKPA 1YJ9S 2DNKA 3DGPB 4NLZA 4GVLA 3C19A 3LTOA 5H1SV 2ZGYA 4L3QA 1LWEB 1FRLA 3HHNB 2EAMA 1PBAA 2E5SA 2NNWA 5HQLA 4WFBL 4M95A 3I0SA 2KT3A 4ETXA 4K4SA 4FL9A 2ZIWB 4AL7A 1M1HA 2PIIA 1R8AA 4U7BA 4BG9A 3V7LA 2MZRA 1NZPA 4KKOB 2K8BB 3NH0A 2IOFK 2NZ4A 4NLQA 2E2QA 5D78A 3S6EA 4C8YA 4DR5K 3IMXA 2BOAA 2ZIUA 3HVRA 4PKIA 1SIWB 5EY4A 4EO8A 4LSZB 3ZCMA 1NHVA 1YHQS 3H6EA 1TL3B 3QIOA 2DGXA 2O8FB 5IM0B 1MW7A 2MQ8A 1UVMA 2CAJA 1WOPA 5LMNJ 4C11A 3KZXA 1FJCA 3SNNA 5JS2A 1XJWB 3HSJA 1BIUA 3O0FA 3NGIA 2FVCA 3H98A 3GDQA 1L6NA 5KFMA 3G6EN 4WQ4A 4ZVSB 5CYQA 3J81Y 3G87A 4MKAA 4MFAA 1NBEB 1RAHB 4Z4HA 2GHWA 3AVIA 4PWDA 4FXWA 5DMRA 3QFWA 2FMQA 2K06A 2VJ5A 4JV5F 2HHHJ 1NDKA 4LIRA 4CD3A 3PX4A 3QUCA 3KLHB 1ZAVA 4CLUA 1Y5LB 3RJKA 1K5OA 4P0PA 2DNHA 4CJRA 4DUYJ 2MZJA 2CH5A 1EZZB 2YVSA 2K8CB 4WIIA 3RW6A 1RZTA 1VGYA 2QG9B 2ZH3A 4WQ5A 3J7YP 5JVHL 3D0GE 1HKCA 3CM6A 1FI4A 2HBQB 4M94A 4O9MA 1FWKA 3GWCA 3A8EA 2DR7A 1XC9A 5D3GB 2Q3SA 4HTIA 3D0HE 2M88A 3KJVA 4LF1A 4M45A 9ATCB 2BDPA 3J80O 1RI7A 5AM3A 3FVYA 3PG9A 1BHLA 3RTVA 1HI8A 4MIAA 1FW6A 2E20A 3L6QA 2E44A 4FS2A 2BQRA 1Y4ZB 3H8YA 4F91B 1S1WA 4HACB 2E5LJ 3AOAA 4DTSA 1AQ6A 4L8RB 4YY3F 4Z4IA 3IV6A 3O9TA 3FBFA 3FJ2A 1RWNB 4CEEA 2QLTA 4CLTA 4FDFA 3LW5C 4ZJOA 5AQXA 3TSQA 3DRRA 1BQNA 1F9EB 3ENAA 4JP8A 3TAPA 3M1VA 1U6ZA 2CQ1A 2OFGX 4C0OC 1L3TA 4CHOA 4NL5A 2FUG9 3D2EA 4ZKAA 2A0FB 5L1MA 3AB2B 3P4UB 1BU6O 5LXRA 4YOXA 4K4VA 1RXWA 2BE9B 3FMWA 1QE1A 2GMHA 1S1VB 2BHNA 7ICFA 3PNCA 4ECZA 3QGGA 2ZH9A 2F8SA 1JJ2R 1TV6A 3KLGA 3MXMA 2LHTA 4MKBA 2Z30B 1VQ7N 1BWVA 5AQTA 2GNKA 1XQSC 3H1QA 2K89A 4BLGA 2F7VA 1HMVB 1PK3A 4AL6A 3M2VB 2YX6A 3OYBA 2QB1A 1L7OA 2VQFF 5JRTA 3LP1B 1JLCB 4DR1K 4PL2A 1X60A 4Y2RA 5J2QA 5D4BA 2CPXA 3CTRA 2IM2A 3QESA 5D0EA 5CABA 1HJOA 3CQ8A 2F4VF 2QMUB 2C28A 1R8BA 2MSNA 5AXNA 3ZZUA 4UBCA 2FC9A 1D8YA 4BRKA 4JKCA 1SI9A 3G6YA 2XSJA 4B3RF 4UUWA 3KKFA 1X4AA 4RPZA 3A3PB 2E1AA 1F6TA 3DKDA 2UYTA 2VZ9A 1TP7A 3L2RA 4JI8F 4X84A 3TA1A 4WFBQ 3QGPA 2G13A 3QRRA 3ISNC 3UXNA 3ADAC 3GDXA 1QQCA 3FZFA 4FZZA 1PIEA 2KV2A 4CJLA 1ZQKA 4HI2A 1QSLA 4QZBA 3TNVA 3MTJA 3HZ6A 3QETA 4XA5A 4CJ7A 2WOMB 4YFUA 4LF7J 4MF8A 5GADP 1YJNN 1M5OC 4M41A 4JI4K 2AXTU 2G0CA 5D46A 2ASOA 3BKTA 1S5ZA 3TFSA 2DR9A 1ATNA 1KFDA 3JPOA 5E5NA 3NBPB 2CJQA 1JXBA 5DBCA 5HHHA 1D9AA 1K8KA 3KHLA 4ZIWA 4LFCJ 3AA4A 2HVZA 2YX4A 4MFCA 1A7GE 1EQMA 2J7UA 1VJWA 4BR4A 2KM8C 2LM4A 4IKFA 4YMNA 3ICLA 4Q45A 5KAIU 4ZPWR 4GY2B 2F77X 2XMVA 2LQ9A 4A57A 4QWCA 3F5TA 2QB0B 1IVZA 3LP2A 4RW7B 3OTOJ 1LKYA 2IFXA 5ALUA 1MC8A 3BS9A 2XGQA 4UUXA 3SCIE 2Q2RA 5KFRA 4PHAA 2O01C 3IWNC 4NXNK 2FSKA 1X6JA 3QWPA 3ET6B 3FC9A 1FJGF 3HSTB 1RAJA 1KAXA 1J5EF 4PZVA 2R8JA 1DTQB 5ALWA 4NMLA 3NS6A 5JVHQ 4BR7A 1FK9A 1DBDA 1XHZA 1H2UX 2QKBA 4DSIA 3TUZC 1X5OA 3BBFA 9ICMA 2J9DA 3A5LC 5GIPA 2ZH6A 1XNRK 4H0YB 1GLEG 4EZ9A 1VSIA 1HKGA 5K14A 4LBIA 3OYKA 2HFZA 4B1VA 1CI4A 3I1YA 3DMJB 1DFDA 4USWA 5ALEA 3ATUA 2FBTA 3SXLA 1BCOA 4Q0BA 3TADA 1T0TV 3R5DA 1KAYA 3K7RA 1H1VA 5KRSA 2Q97A 5EWEA 5D77A 1ZQLA 4FZNA 3B4MA 4PUOB 2OMOA 3A1YG 1OKJA 4OPAA 2WTUA 3JQJA 4UB2A 5CJ7A 2DFFA 3CCRN 5D49A 1SC3B 3E51A 4YB1P 2OTLN 2QTWA 4B3SK 1TVAA 1MQ2A 4JK1A 3R5CA 5FRNA 2OFHX 2W43A 4UTGA 3C2KA 5IIJA 3I33A 3WNHA 3NTUA 2HHPA 3G71N 5ALFA 3MMBA 1ZZNA 3F9MA 1VCTA 2AW0A 1MWMA 1NRKA 3OL8A 1U1QA 2JWKA 1KVJA 3ZLJA 2KG5A 1N52B 2B4OA 2KDOA 4UB4A 4F4YA 2F76X 4I2QA 2AH5A 2QZ8A 4ITSA 2A1SA 2GJ2A 3PXGa 2QL5B 5THWA 1U9LA 3IBPA 3FZ2A 5KGWA 3J81U 4GC7A 3ENHA 4Z2XA 3LYSA 4DQQA 2EC2A 2E1EA 2EG1A 2UXBK 3FQLA 2FQQB 1CSJA 4ZDNA 4YDXA 3HPGA 1SWVA 1HBMA 2ILYA 3U3YA 4CF9A 5KG2A 1VSEA 2GAHC 3ZDCA 4TY9A 4DFPA 1G2EA 4ZK7M 1RGIA 4CK3A 3CCQS 1DARA 7ICHA 5I3UB 1FKPB 2FF6A 1YBAA 3SUQA 2CZVC 2IRYA 4X66F 1B3TA 2MU2A 1N0UA 4DV0K 2DGUA 1VQPS 3PTWA 5ALQA 4OLOA 4LH4A 4BREA 2YKPA 4DXLA 3D9BA 4YHHF 4KB0A 2OP5A 4XTTA 1N5YA 3GIIA 2AGQA 1ROFA 4ZLJA 2KYZA 5A8RA 1R8HA 3BV8A 3I0SB 4QIEA 3BN4A 4EELA 2KXFA 3CJTA 5KL1B 2BE7D 3DJCA 3GIRA 5J0QA 4RQ1A 3D67A 2C3OA 2PYLA 1B7FA 1JMSA 3DDIA 1Y10A 4FNHA 4IRKA 2B8PA 2VA2A 5I3QA 4FJ7A 1DXSA 3RB4A 4URQU 1X5SA 1YVNA 2ZIUB 1U09A 3DDKA 1MU2A 4BRHA 4MFBA 2DPIA 4DV4F 5BYQA 1S49A 2NXUA 1JJ2M 3VF2A 1OMSA