2XY7A

Crystal structure of a salicylic aldehyde base in the pre-insertion site of fragment dna polymerase i from bacillus stearothermophilus
Total Genus 188
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
188
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHAAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWALERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGEELAEQLRTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKSKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQARLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Reversible Bond Formation Enables the Replication and Amplification of a Crosslinking Salen Complex as an Orthogonal Base Pair.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords DNA POLYMERASE I
total genus 188
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2010-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2xy7A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 2xy7A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2xy7A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2xy7A01
1BQNA 5DB8A 2MAXA 2F1JA 1L3SA 3Q8LA 3V7JA 2W8LA 3LANA 4E1NA 3NGZA 1KVAA 2HHWA 9ICAA 3AU6A 5J2GA 4OGCA 3Q8MA 4RPZA 3M9NB 3NDKA 7ICKA 3ZSRA 1YT3A 8ICXA 3SNNA 1LWEA 9ICVA 8ICTA 4O3SA 1C0UA 4B8CA 2E6LA 1C1AA 3MR3A 4MFAA 3TAFA 3CFPA 1Z00A 5KFEA 4UBCA 4B9VA 4FJ8A 7ICFA 5DQIA 3I8DA 4Z6DA 4F5RA 1KDHA 5JUMA 2HW3A 4KPYA 1U04A 3PX4A 4FS2A 4KN7A 1NJZA 1U48A 3MR6A 1XI1A 3RBEA 5KFHA 1JN3A 1ZQCA 2A1RA 3VQEA 4ZTJA 4HHTA 3RJFA 4XIUA 3FYHA 3MFIA 3L8BA 3L2RA 1BI4B 2LSNA 8ICIA 3ISCA 5KG3A 1XSLA 2HVIA 3QETA 4YVZA 1U9LA 1WSJA 3VQ4A 4ED3A 1XS9D 4KHQA 4GVMA 1G15A 3JYTA 2XO7A 3C6UA 1SL1A 2A1JA 3H7IA 4HYKA 4IQUA 4DQIA 3BDPA 2F8TA 5DBCA 1EXQA 4XUSA 4LY7A 3VQBA 3AVMA 4CF9A 1UA0A 8ICWA 4P4PA 4CHOA 3UXNA 3Q8QB 4F4WA 1IXRA 2VG7A 4FJ7A 3CG7A 4AHRA 4M3UA 3T5LA 2KW4A 5D4BA 1HUZA 5IINA 1Z25A 2P6RA 3WNEA 5J0PA 3H4DA 2VG5A 2A1SA 4ECYA 2W42A 8ICPA 1VSHA 2J6UA 2JGUA 4RNMA 4TURA 4I2CA 3TI0A 3OYAA 2BCRA 3EWAA 4FLUA 3VQ9A 3VN5A 4KFBA 1KEJA 4Q44A 4KLFA 4DFPA 1B9DA 4M6WB 2P51A 3O4QA 8ICZA 7ICQA 5J2AA 5D3GA 3SZ2A 4BDYA 4ECUA 4ECSA 4CK2A 1L5UA 1BPZA 1CXQA 1NKBA 5J2HA 4E7KA 2X78A 4P4OA 4C8KA 5KFSA 3UXOA 4E7HA 1IKXA 4J9LA 4R5PA 3SUPA 4P4MA 3O3HA 1XU4A 2YV0X 2HHQA 2B4JA 4KHSA 2XRIA 1X9MA 5L1JA 4NLNA 4E3SA 5HP4A 3GILA 3A2FA 3VQAA 5J0XA 4RQ7A 4M3WA 3DLHA 4UB2A 1HQEA 3PV8A 3OY9A 5J2JA 2A1JB 4CJWA 2HHSA 3MGIA 4PPXA 1NOZA 1W9HA 1QE1A 1X2IA 2G8FA 1HMVA 4BWJA 1RTIA 3RBDA 3PW7A 4M9GA 1XSNA 4PA1A 2YHAA 3NGDA 3AUOA 4E7IA 3AVJA 4JRQA 1RILA 4CJ3A 3G6YA 1C0MA 5KFBA 1C0TA 1XHXA 4KAZA 5SWMA 4OGEA 3QEBZ 3LAMA 5DQGA 4I2HA 4CJ5A 3O3GA 2IGIA 5J2DA 5J0WA 1BI4A 9ICCA 4KLQA 1ASVA 5KG4A 1ZQGA 1CXUA 1CZ9A 3C1YA 4M9LA 9ICPA 5HRSA 4OJRA 4IKFA 4BDPA 3GIJA 4Q5VA 3UPQA 2FBYA 4XRHA 2I9GA 2Z1GA 3ZSVA 4CHNA 5J2IA 4RQ6A 1A5XA 5DB6A 4J9RA 2IHMA 2X6SA 2G8WA 1RDDA 9ICFA 5F9NA 3AV9A 4KB0A 5CHGA 4IFYA 2B21A 2ZJ5A 1A77A 2W9MA 4CGFA 4KLHA 2FC0A 1D5AA 1B9FA 2XCAA 5L1KA 2OPSA 1LAWA 3PO5A 3V1QA 4BGDA 5J2EA 5EOZA 3KIOA 3ZT2A 3ETLA 4RQ4A 1NK4A 4QWDA 4IR1A 4LSNA 1QLNA 4LVSA 1CEZA 1S9GA 4RU9A 4CJPA 4KLOA 3AU2A 4YFKA 4PGXA 1KCFA 5DG8A 2BQRA 4KHWA 1K1SA 4FJJA 2ASJA 1ZJNA 4DO9A 3C5FA 4ZH4A 5KGWA 1Q9YA 4TQSA 4IDKA 3VQ5A 4QZBA 1JLCA 2HNZA 3SV4A 1WSIA 4ICLA 3FDSA 3HP6A 3OYCA 4QZDA 1MSWD 5DB7A 5HROA 2QKBA 4UB3A 2D0CA 3HYFA 2G8IA 1S0MA 5CA7A 1BPYA 3BJYA 4Z6FA 4J9KA 4DFKA 4NLGA 5DKWA 4M9JA 1X1PA 3SI8A 2IOCA 1NK6A 2P66A 4EYIB 3WNFA 3HX0A 1Z26A 4PQUA 4UAZA 4FLVA 3IAYA 7ICNA 2IHNA 4AHVA 1XC9A 5L9XA 4JS4A 3PW4A 4IG0A 3GIMA 4Q8EA 2BHNA 2Y1IA 2F1HA 4W5TA 3QIOA 8ICKA 3DI6A 3VQDA 2UVVA 4G1QA 4O5CA 5KG6A 4KLUA 4DSJA 1QSYA 5KFUA 4CJ4A 4CEFA 5CZ2A 3QINA 4J2BA 3CM5A 3HPOA 5CJ7A 3Q8RB 7ICHA 3HVRA 5J2PA 2PXIA 5DGBA 4C8MA 5KFPA 3I0SA 3KHLA 1HYVA 3AVGA 5DMRA 3HXMA 5HP1A 2NUBA 2O4GA 3EZ5A 1N5YA 1S1TA 4HUGA 3PW0A 3DRPA 3AO1A 4DQPA 4ED0A 3PW5A 3TR8A 1SKRA 1RBTA 4DQRA 4YQWA 1DTTA 1IM4A 3NFAA 2PI4A 2FPLA 2FLPA 3TAMA 4FZYA 1GOBA 1RXVA 2AJQA 3KHGA 4DF4A 2QXFA 3QEVA 5KFMA 4RW7A 4ED2A 3NHGA 3T5HA 5KT4A 1ZBFA 3RJIA 4CGDA 4LZDA 3PY8A 4CHQA 4TUQA 1S77D 4Q8FA 2W9BB 7ICMA 1JLGA 3JPNA 1T05A 2PFNA 3PW2A 2BPGA 1TAUA 1XHZA 1UT5A 3PR5B 1KLNA 2NRXA 4UAWA 3HPGA 4QZFA 3VQ8A 5I42A 1JLEA 2Q0ZX 4Q0BA 4GXKA 1VSLA 4EBEA 3RB6A 4FK4A 4QCLA 1ZQDA 2DFFA 2YNIA 3RH6A 2BANA 3AO5A 5KT3A 2HVHA 4NM1A 3B6OA 3NBPA 3ZT4A 3OS2A 4KLLA 4O55A 4CJQA 4J9QA 1JXLA 5KFRA 2BCUA 2GWSA 5KFGA 4EP5A 4CEDA 3KD5E 2C28A 3QNOA 4F5PA 4M9NA 2PYLA 4J2AA 1VSIA 4NLZA 4IFVA 3FFIA 4CE9A 4MF8A 4IRDA 1HPZA 2OPPA 4ECXA 4RPXA 4DL2A 1VSDA 4FCYA 3BQTA 4R66A 4O3RA 3MR2A 4J9MA 1JKHA 4GC7A 4M42A 1J53A 5DDYA 2C2DA 2HHUA 3LALA 1AROP 3ZDEA 9ICLA 5BPCA 4ED7A 2BPCA 4RW4A 4O0IA 3V7LA 5KFWA 4CGGA 2HHXA 9ICQA 4KTQA 3BGRA 1A76A 4KKOA 3SJJA 4CHPA 4E0DA 4CJRA 4I2EA 5D49A 4B08A 3TFRA 4M2YA 3V6DA 1RT7A 4Z6EA 2ZD1A 4KITB 3K75D 4I28A 3E2EA 1LAVA 8ICSA 4JV0A 3V1RA 3OYIA 2JZBB 3V9XA 3H40A 4BE0A 3S3OA 4KMUA 1HNVA 8ICAA 4PGYA 5J0SA 2JLEA 1RCHA 4F2SA 5KG7A 2VG6A 1SZPA 3KLIA 3HSTB 3K2PA 4OLAA 3HK2A 1S5JA 1TL3A 3ASMA 4FO6A 1N56A 2YKNA 5CY4A 4CCHA 4OVLA 1KVBA 2XY6A 4M45A 5KG5A 3ZD9A 4J9SA 2F96A 1VSJA 3ZT0A 4ID1A 3DLRA 5J2NA 2PYJA 1WAJA 3RMBA 2W9CB 3HJFA 3AO4A 3ZSYA 4NLKA 1L3TA 4M3ZA 3RB4A 4RQ5A 3M8SA 2FBXA 2RN2A 4RW6A 4CJLA 2R8JA 1S0OA 5T7BA 5J0OA 3VA3A 4I9LA 2BE2A 5KT6A 5HBMA 4RT3A 3VQPA 4AHCA 1HJPA 3GV7B 5L1LA 4N41A 4Z4CA 3RMAA 1VRUA 3MXJA 4M9HA 3TWHA 2XY7A 3BQ0A 4YMMA 4QWEA 5KFAA 3SUNA 1S1WA 4OKJA 5IIJA 2FPKA 1BIZA 4FW1A 4O44A 3KK2A 3PVXA 3DLBA 4P2HA 4ELTA 1Q9XA 5J29A 2RPIA 5KFDA 5J0QA 5F9LA 3ULDA 3LZIA 4KI4A 5C24A 3TAGA 4FZZA 1NKCA 1ZQXA 5IIIA 1XSPA 3OYEA 3RWUA 4ECQA 3BQ1A 4CJFA 4F8RA 1ITGA 4DOBA 8ICQA 3TFSA 5KFJA 4CEAA 1RBVA 4HUFA 3MDCA 1BCMA 2LYHA 3MGHA 3KD1E 5BOMA 4PGQA 1IG9A 4J9PA 4EYHB 2X74A 2ATLA 2DFHA 3HVTA 4F3TA 3V7KA 4DSKA 3K5LA 3LPUA 3V72A 5C42A 4DTXA 1YTAA 2ZUCA 1BPXA 3H8JA 3V9WA 2NRTA 3S3MA 4FYDA 2G8HA 1RT5A 5KG2A 4B9TA 2H5XA 3KLEA 1KSPA 4CJTA 3ORYA 4ED6A 5J2FA 9ICIA 9ICTA 8ICMA 4PY5A 4B8AB 2JZBA 3L2VA 4M0AA 3OYBA 3OYKA 3V1OA 4MFBA 3HW8A 4KO0A 3H08A 1T8EA 4NY8A 1XO1A 9ICEA 4RUCA 3EYZA 2BPFA 5KFYA 2QK9A 2P5OA 2XC9A 4KLGA 3SYZA 1VSKA 4O4GA 3T19A 1LW2A 1ZYQA 4ZHRA 3CM6A 8ICGA 1IH7A 2ATQA 5DLGA 3PX6A 3RH5A 3QE9Y 4F4ZA 2AQ0A 4R65A 2ZE2A 4FK2A 4DG1A 1TAQA 2O4IA 3JPSA 5KFXA 4R64A 1NK8A 1T7PA 4FM1A 7ICJA 3M9OB 3EPGA 8ICBA 3HPHA 1ZQLA 3OJUA 3V81A 5DG9A 1C7YA 3D45A 1LW0A 3MXMA 1T03A 8ICOA 7ICSA 3OYDA 5I3UA 4XA5A 4Y1CA 4DSFA 4CEZA 5DDMA 3SV3A 1CUKA 3PR4A 2HNDA 1VSEA 4NXZA 4F5OA 3F73A 2KFNA 5HHIA 2PFQA 1TGOA 1TKDA 7ICIA 3V9ZA 4DTMA 1ZQKA 3WNGA 4DSLA 2W8KA 5HHHA 3QZ7A 2R8KA 4HCBA 3L2WA 1RBSA 5KFZA 4M41A 4GXJA 1S9EA 4DSEA 3MEGA 3C5GA 2X6NA 4CGIA 4PH5A 3HO1A 3DLKA 1ZQFA 4CERA 2Z1HA 1SKSA 3JPQA 1FK9A 1UAXA 4CK1A 4O3PA 1X9SA 4N5SA 4H4MA 2FMSA 1IO2A 3QEPA 1J9AA 4DLEA 4KLMA 2C2RA 4FJ5A 2AU0A 5FROA 2UVWA 2HB5A 4DTRA 3RAXA 3ISNC 2W9CA 4CHZA 4OPKA 3RJKA 2UVUA 2D0AA 3OHBA 3H4BA 4FZXC 4CFCA 3KK3A 3OJSA 4M6WA 4DS5A 1UWBA 1ZQJA 2R8IA 3LPTA 4CFDA 2BQ3A 4EZ9A 5C25A 3C21A 2HHVA 2YNHA 3KLGA 5J2KA 2XY5A 4YFUA 2BR0A 4JK1A 3KJVA 4C8OA 3Q8KA 1IKVA 1EP4A 3MXIA 3NGYA 1RTHA 1TKXA 4DS4A 4IQVA 2OWOA 1RZTA 1L3UA 2BDPA 1KVCA 3ZCMA 3DYAA 4I2BA 1RDCA 2OA8A 1REVA 3TAPA 7ICLA 2QKKA 4FJGA 3LZJA 8ICYA 2R8GA 5J0UA 3IG1A 2ZTCA 9ICSA 2ASLA 2IBKA 1RBUA 4F92B 2YKMA 1Y88A 3HP9A 1KFSA 2NRZA 3M8PA 5KRTA 4XQ8A 1ZQUA 1K1QA 4ED1A 1TK0A 4I9QA 2FBVA 4RQ8A 1I3AA 3IRXA 5KI6A 1S6QA 1JMSA 4I27A 1TK5A 4O9MA 1O1WA 9ICRA 8ICUA 4CJVA 5J2BA 4RNOA 3LP1A 3GQCA 9ICKA 5L1IA 3THVA 3L3UA 2YNGA 2OPRA 3ITHA 2Q3SA 1ZBHA 2YHBA 4AHUA 3L2QA 1B92A 4DU4A 2NRWA 2WONA 4Z4IA 4FBUA 1T4GA 4O3NA 4NCGA 1EETA 4ECVA 4QZAA 4GC6A 4AHSA 3JPOA 3RRHA 4DTNA 2KFZA 3QEWA 1S10A 1MC8A 1VRTA 3PMNA 3K4GA 4I2GA 4DSIA 4IBNA 1RT3A 1F21A 3C1ZA 3GFKB 1DOQA 1KTQA 4GLXA 1IKYA 9ICHA 2OYQA 3V6KA 3ZSQA 1D8LA 3QO9A 4MEXA 2PY5A 3IS9A 1RPLA 2RKIA 4B9MA 4PHEA 1S0NA 4RUAA 4FM0A 1RT1A 3NE6A 3SQ2A 3SUOA 3CFOA 1RTDA 1EX4A 2ITGA 4B9NA 1GOCA 1ZQQA 2E4LA 2GUIA 1YVUA 4QZ8A 3MAQA 4BWMA 1ZQAA 4CEBA 2XY8A 4E1MA 4R8UA 3AVNA 1ZBUA 2WTFA 4M04A 4CJEA 4ECTA 3ISBA 3V9UA 2JEFA 5EU7A 4F5NA 4FLYA 3PO4A 1RTJA 3OSPA 4UB1A 3VQ7A 4FM2A 4YXJA 1T3NA 4CIEA 5HRNA 3C6TA 1TK8A 4YN4A 1HYZA 3HWTA 3RH4A 3MBYA 2HMIA 9ICNA 3QESA 3O4NA 3S9HA 1ZQEA 2DPJA 4AHTA 3OYMA 2ISOA 3N97B 1GOAA 5KFNA 5DBAA 3DMJA 3JSMA 1WNSA 1TFRA 4X5VA 5HRRA 4O3OA 2P1JA 5DQHA 3C2MA 3ALYA 3UQ2A 4B9SA 2HNYA 3QZ8A 3KKSA 2W9AA 1TV9A 4K4GA 3OYFA 5IILA 1RDBA 2BGWA 2JEGA 1Z3EB 1S1XA 1NK7A 5FRNA 3GV5B 4BE2A 3OYHA 9ICBA 3OHAA 7ICEA 2IAJA 4DOAA 4ED8A 1R0AA 4MQ3A 3GIIA 4DMNA 2PFOA 4KHYA 3T5KA 2KN7A 4CF2A 4F2RA 4KLDA 2AQ4A 1BPBA 2DPIA 1DGSA 2ZTEA 4FLTA 2Y1JA 3OYGA 2V4RA 2VWKA 4PWDA 2Z1IA 4GMJB 1ZBIA 5DB9A 2KZZA 5SZTA 3P5JA 4K8ZA 3TAQA 2JEIA 2ZUDA 1TVAA 3T1AA 1L3VA 2BCSA 4LSLA 3NF9A 3PX0A 2KZ3A 2NRVA 4TUSA 2IMWP 3H8SA 3ZSWA 4DL4A 4QZHA 1JXEA 3F9KA 4PHDA 4FJXA 2R7YA 9ICOA 1S1UA 3VA0A 4FJHA 3E01A 4UQGA 1SL2A 4IQTA 4FXDA 4DL7A 4DOCA 3NF8A 4KB1A 4J2DA 4CJSA 2G8VA 2RDIA 1DTQA 3ZSZA 4M3YA 4BE1A 4M3XA 5KG1A 7ICTA 4F4YA 4YR3A 4EBCA 4ECWA 3Q8PB 4LD0A 4JS5A 2RDJA 3UIQA 1QSLA 3TANA 4CGHA 1FXXA 5CWRA 2VA2A 4UB5A 3AVAA 3NH2A 2BKEA 4QWBA 1A5VA 5J2QA 3HT3A 4B3OA 5HRPA 1HYSA 3RJJA 4N47A 2ZTDA 3NF7A 1Z00B 1RBRA 3U3GA 4I2FA 4DF8A 1D9DA 3ZD8A 4YP3A 3UQ0A 4W5RA 5KFFA 5EWEA 1C6VA 5EWGA 3RMCA 2AGOA 5HMMA 5KT5A 1PZNA 3ZDCA 4M47A 3RMDA 1XWLA 5J0TA 1N6QA 3DLEA 4EBDA 4AH9A 5DLFA 4R63A 1ASUA 1RNHA 3L3VA 4E7LA 3TQ1A 4DL5A 3HL8A 4Z0UA 1I39A 1RDAA 2BCQA 2ALZA 3G6XA 2IDOA 4DFJA 1WCLA 3ZDAA 4CESA 4CGJA 4JUZA 2BCVA 1BISA 4MFCA 4KN4A 9ICXA 1JLQA 4NCAA 3T5JA 4O5BA 4HTUA 4GW6A 3NH1A 4DTUA 1TL1A 4MF2A 1DLOA 4BXOA 4I2QA 4E7JA 4O3QA 1JX4A 3BQ2A 3NGIA 8ICNA 2OZSA 2KQ2A 2XGQA 4QWCA 2EX3A 4MFFA 2D0BA 4PUOA 4FJ9A 3MEEA 7ICVA 4OPJA 3ZT3A 3PNCA 1MQ3A 4Z4FA 3DRRA 8ICJA 4J9NA 4KI6A 3LAKA 4CEQA 4CFAA 2FBTA 1J5OA 1EXNA 3GV8B 1S1VA 5KFIA 5HLFA 4N76A 9ICUA 4EEYA 2ZUBA 3LK9A 4FJIA 5HMLA 1JL1A 4CHYA 4FW2A 4QZ9A 3AVBA 4CF8A 5KFQA 2FMQA 4RQ0A 1NOYA 3QIPA 4CJKA 4DU3A 2WOMA 2YNFA 5KG0A 4RNNA 9ICWA 2RF2A 4I2PA 3QERA 4F93B 4TUPA 1VK0A 1RXWA 8ICLA 1ZETA 5KFKA 4CF1A 1ZBLA 4OLBA 4QZGA 4YXMA 2MUTA 4FS1A 5CYQA 1ZQBA 3KLFA 4YR0A 3V6HA 1ZQHA 1B43A 3RR8A 3ZT1A 4AILC 3DM2A 4DWIA 3M9MB 1ZQSA 3PUFA 1NOMA 4O5EA 3QEXA 4R8UB 4W5QA 1UA1A 4N56A 4RQ1A 4KLIA 5CZ1A 2VANA 3K5OA 3AA2A 1JIHA 4W5NA 4JLHA 3C94A 5K14A 3T3FA 1A5WA 4J2EA 4RT2A 1ZQVA 3GIKA 3SPYA 4LH4A 3ZSOA 4FLXA 1ZQRA 4NYFA 4KHUA 4ELVA 1MQ2A 4HUEA 3TABA 1VSFA 5IIMA 7ICPA 3O3FA 3SUQA 2J6TA 5DBBA 4DQQA 4I2JA 3RJGA 2GV9A 5CP2A 3Q8SB 3AA3A 3MEDA 4QWAA 3B0YA 2V4QA 3V4IA 1RYSA 3JPRA 3ISDA 4FLZA 5J0YA 3ZDDA 1QQCA 5J1EA 4I29A 1LWFA 3KLHA 2OZMA 3AVIA 4L8RB 3K5MA 3MECA 4QAGA 4KLEA 1YTUA 3G6VA 1HUOA 3SQ0A 3P1GA 4CIGA 1HQUA 3C2KA 3OYLA 4QZCA 2E6MA 1K6YA 1ZQOA 4FBTA 4YD1A 4DFMA 2I5JA 2VA8A 4CFBA 4FJLA 1S6PA 4ECZA 3AVLA 3OVNA 3D0PA 3OSNA 2XGPA 3NTUA 1KFDA 4EP4A 3KK1A 3NCIA 3JPTA 4K4HA 3MR5A 4O0JA 5KFVA 2F1IA 3UXPA 4I7FA 1D8YA 4PHAA 4YCXA 4QW8A 1WN7A 4OKEA 4YG2A 1UT8A 5KT7A 4RQ2A 1COOA 3IHQB 4RQ3A 3V6JA 3V9SA 3B6PA 1NJWA 4EZ6A 3EY1A 1WLJA 1ZQZA 2VA3A 4I2DA 4DTSA 7ICOA 1ZQIA 5DGAA 4F5QA 5KFOA 3L2UA 2P5GA 4PHPA 4DQSA 9ICMA 3VQQA 1W0HA 1B22A 1SV5A 3DLGA 2BGGA 4MEYA 4UB4A 3SQ4A 3SPZA 7ICUA 4NCBA 1BPEA 3EW9A 3U6FA 5DG7A 5BOLA 3N4MB 2FPMA 4YMOA 1U45A 1D9FA 1ZQTA 2JEJA 3RB3A 3OYJA 4LH5A 2ISPA 3NH0A 2UVRA 4DEZA 2EHGA 1SL0A 2PFPA 4DTOA 4WE1A 1WCNA 5CYMA 1EKEA 3VQCA 3B0XA 2HHTA 4KREA 5KFCA 5DK5A 3RR7A 4RW8A 3OS0A 4DLGA 4KLTA 4YD2A 4C8LA 3SQ1A 1S76D 3QNNA 4Z4GA 1X9WA 3LWLA 4GXIA 1N48A 3QEAZ 4Z4HA 1S0VA 5IIKA 1WSEA 1LV5A 1ZQPA 4KRFA 2ZJ8A 4J9OA 1BQMA 4RPYA 1WSFA 8ICHA 3K57A 4DL3A 3I0RA 8ICFA 2C22A 3AO2A 1JLAA 3DOKA 3LP2A 2V9WA 3AVFA 3NF6A 2ASDA 3RJEA 4M3RA 4QZIA 5FDLA 1Y97A 5FRMA 3RTVA 3P83D 1BCOA 1TV6A 5KFTA 3LP0A 1ZQWA 4JRPA 5J0RA 1IKWA 5IIOA 5TZVA 4KLSA 3AA5X 3JPPA 4LZGA 2W9BA 3G10A 3G0ZA 3M8RA 3RB0A 4DU1A 4Z6CA 3C23A 2XHBA 1C1BA 2DFEA 1MU2A 5CR0A 4HVJA 3QLHA 3C95A 4JV1A 3NAEA 1SUQA 1WSGA 4IG3A 3MFHA 4YNQA 4KV8A 4RG8A 4TSXA 2DFLA 2VWJA 4KLJA 4UAYA 2B5JA 1S9FA 3WNHA 5CB1A 2BQUA 1BGXT 5KTQA 4JV2A 2P6UA 3RRGA 1KLMA 4KTZA 3VQ6A 4DL6A 4DTJA 4F3OA 4F50A 3PMLA 1QSSA 2G8UA 4DTPA 3M8QA 1BIUA 3MDAA 1ZQNA 4IR9A 4BACA 4B9LA 3K58A 4UBBA 2IC3A 1LWCA 2ZQBA 4E19A 3LWMA 5EWFA 1CLQA 1JLBA 4IRCA 4QW9A 2R8HA 2I1QA 3K5NA 8ICVA 3S3NA 4W5OA 4O5KA 3C2LA 2FLLA 4H8KA 1U4BA 1NKEA 4CEOA 2OPQA 4CF0A 2ZJAA 3MABA 1WSHA 2XCPA 2Z1JA 1NK5A 4FK0A 4Z4EA 4CECA 4CK3A 3OGUA 4M3TA 1KFTA 4FLWA 3LDAA 3AVKA 5JS2A 1C1CA 9ICGA 4NYNA 7ICRA 4FJKA 1QTMA 4QZEA 4ID5A 1RT6A 1NJXA 4KTWA 3U3YA 4RW9A 1U49A 3DRSA 3AVCA 1LB2B 2G8KA 8ICEA 1ZJMA 7ICGA 3EPIA 1FKPA 4BXOB 1TVRA 3TAEA 1HNIA 2KTQA 5JS1A 1RT2A 4CIFA 2D5RA 2ETJA 5KFLA 2B6AA 3AO3A 4FJMA 4K4IA 3HM9A 1SKWA 2IA6A 2PZSA 5J2CA 4TQRA 5C5JA 1CZBA 1QS4A 3CQ8A 4G3IA 3CYMA 4Q45A 3TARA 3KHHA 1H38A 2M9NA 4RZRA 1Q8IA 2MUTB 1BVSA 2PI5A 1JXBA 4NM2A 3KTQA 1JL2A 3OYNA 1BL3A 4B9UA 1ZQMA 3QEIA 3LP3A 1QHTA 5KGXA 1NJYA 1RT4A 2KZMA 2DTUA 2AGQA 1U47A 5D46A 1J54A 1JLFA 1HJRA 4F4KA 4ZTFA 3ZDBA 4IQWA 3OS1A 2FMPA 1UOCA 4E89A 4FVMA 3KHRA 3AVHA 1NK0A 3KKRA 4CJUA 4Y1DA 3GDXA 4ELUA 4YMNA 1TKZA 4H4OA 2J6SA 1BHLA 1V9PA 3LDSA 4FJNA 3RAQA 1NK9A 3CFRA 1KRPA 8ICRA 4C8NA 5HNKA 3AA4A 4JWNA 8ICCA 4JWMA 1FKOA 3ZSXA 2FLNA 4YR2A 5KT2A 2C2EA 2AGPA 5E41A 1HRHA 4CEEA 4HCCA 3SI6A 1VSMA 1ZQYA 4IRKA 2DY4A 1S97A 3K59A 9ICJA 3RJHA 1WAFA 4BDZA 1ASWA 4I2IA 4F91B 1RYRA 3IM1A 3DOLA 2IS3A 5J2MA 3SCXA 4K8XA 1BPDA 4KHNA 3H8WA 4QOZB 4ECRA 4OKKA 2F8SA 4F4XA 2GBZA 5KRSA 4I2AA 4Q43A 1TKTA
chains in the Genus database with same CATH superfamily
4U8VA 3MN5A 3D2QA 4PQAA 5DB8A 5HMYA 3TEGA 4ETXA 3UFCX 3TRGA 3LANA 2BZ2A 1HQEB 1PG5B 2KB2A 3QSYB 1H1VA 1KVAA 2HHWA 3AU6A 1VC6A 4OGCA 4RPZA 5AHXA 2GVDB 3NDKA 1YT3A 3B4DA 3SNNA 2GO8A 1U26A 4RPFA 2WHOA 1C0UA 4B8CA 2GH1A 1UWAA 2EFPA 3GCWP 2A42A 4WQ4A 2H48B 3M7DA 1WI6A 2HG4A 3TA1A 4UBCA 4B9VA 2HGLA 2C2OB 2ZJQL 2IJFA 1F9EB 2F9JA 2MKCA 1NB7A 4Z6DA 1IBLJ 1QQ5A 4K4SA 2H3ZA 1U04A 2ZF5O 3L3CA 3L7OA 1NJZA 1KQGB 1U48A 3MR6A 3UKRB 3RBEA 1K73O 5KFHA 1JN3A 1ZQCA 2A1RA 4CYUB 3FYHA 2G9OA 3L8BA 2VOOA 3L2RA 5A8WB 1BI4B 2LSNA 2UUCK 4DR2K 1XSLA 3QETA 2ZWOA 3IR6B 1S59A 1GTHA 1IWGA 3EDQB 1FD2A 3VQ4A 4KHQA 3ETRA 4GVMA 1EZZB 1I94J 4PL2A 2F8TA 3PSTA 3KZBA 3QX7A 2EFGA 4ZP7A 2M0GB 4F4WA 1VLYA 2VG7A 4AHRA 1NG9A 3E58A 2YKOA 1HUZA 3IDWA 1Z25A 1YHQN 2FJAB 2MZSA 5LJ5Y 1U02A 4NCGB 5GAGP 5E3PA 3AB2B 5JLFA 3SDEB 3IDHA 1VSHA 2J6UA 3Q8YA 1RFQA 2OD6A 3MCOA 2I7PA 1Z05A 1WYGA 4B3MJ 3OYAA 5CRXA 3PYGA 1NZ8A 1EAYC 4DV7K 1R7IA 2J0SD 5AKEA 4M6WB 4AL6A 2QC3A 3U1NA 8ICZA 2OEJA 5D3GA 5LSLA 1MWYA 4YY3F 3BH6B 4CK2A 3PKYA 3LVVA 1BPZA 1G1XA 1CS4A 2BKPA 2QLWA 3PRBA 1P27B 5AKIA 5FD1A 4DR6J 3ET6B 2FDRA 2WCXA 1RKJA 5BRHA 2A1AA 4P4OA 3MTJA 2MYFA 1IKXA 3O8WA 5ALHA 5JVHQ 1FF2A 2P35A 2MY8A 1CJTA 2HBRB 1JWWA 2GOLA 2HHQA 2WBNA 4KHSA 1X9MA 3AL0B 1V6HA 4Y2TA 1QVGM 3I9ZA 2LMRA 4ZPAA 4K4ZA 5AKZA 3A2FA 4RQ7A 3EXYA 2C3YA 3DLHA 3IP4B 2BKNA 4XAKA 1X4DA 2A1JB 4CJWA 2HHSA 3MGIA 3BSOA 4EK2A 4S0MA 2G8FA 3ADAC 4BWJA 3ZTOA 1YGYA 2YHYA 1WC3A 4FKXA 2PBDA 5GIOA 5HQ8A 2MKYA 4CWBA 1RISA 2A18A 2XMVA 3L9ZA 2FVRA 4ZVOB 4A48A 5ALFA 5ADXA 4JRQA 2YNGB 1NSAA 1XHXA 1LWCB 2OEMA 2W2MP 3TO8A 1AFIA 5SWMA 3LAMA 4CJ5A 2IGIA 5J2DA 1SI9A 2EH9A 9ICCA 1VQ4S 1F0MA 2OMOA 1CZ9A 3UMGA 1VCTA 2F8EX 4O3MA 4OJRA 3CJ0A 3UPQA 2APOA 2A3VA 4JI3F 4XRHA 3ENWA 2Z1GA 2P9KA 5D0GA 5J2IA 3VEZA 2ZKUA 4DCPB 1A5XA 4ZCLA 3BR8A 5CQGA 1HNZF 3VEWA 4L75A 4YORA 1PSDA 3QBCA 2X6SA 1ZZNA 3J80U 2RAQA 1RDDA 4C7YA 1IBMJ 1BLUA 5L8RC 3OTOF 5CHGA 3W64A 2ZJ5A 2H3IA 3DXBA 2WMMA 2DB1A 4DMZA 5E84A 2NUHA 1U0HB 2G5IB 2ZH8A 1U1QA 3QU2A 3PO5A 3EE3A 3KIOA 3ZT2A 5J2MB 1GLAG 1XK8A 4I6WA 2W41A 2YMPA 2AEJA 3IGVA 3WQTA 5IWAK 4LVSA 1CEZA 1S9GA 3BBCA 4KLOA 1W7AA 4LF4J 3D2FB 2BQRA 3RRKA 2FLOA 4FJJA 2ASJA 1VR6A 2WC9A 4A61A 1A7GE 4DO9A 3EE9A 2MZRA 3C5FA 4ZH4A 2VJUA 2OTJN 3VQ5A 2V7ZA 4DV3F 2HNZA 1UJ6A 3FDSA 3GJQB 4QZDA 2H3GX 5HROA 2EQYA 4UB3A 2D69A 4WK1A 3NKYA 2JL9A 3ZZPA 1OY9A 4C11B 2G8IA 1V38A 2DRAA 4C7QA 2XMMA 3EUNA 3SI8A 2A0FB 1NK6A 1PBAA 1WUUA 2NPFA 1FRHA 3HULA 5EXWA 2IRXA 4KR0B 1KR4A 2KJVA 4ZVTB 1FKAF 2E1FA 1GNKA 2BXJA 2JRSA 1FRMA 2XIDA 2CPZA 3PKMA 2MQ8A 3P49B 3VCDA 2F1HA 1UEKA 1VRUB 4FYYB 3DI6A 3VQDA 3JXUA 2HSZA 1ZH5A 4O5CA 3DKDA 4MJKA 1QSYA 4GFJA 4TU8A 1S57A 1SJ1A 4CEFA 5CZ2A 1ELOA 5CJ7A 4JKGB 7ICHA 2CXEA 3CD5A 5HSPA 5KFPA 3KD3A 3QNWB 3KHLA 3AVGA 3HXMA 4BRKA 4FF2A 3KLGB 3GYXB 2PFUA 4B02A 2DGSA 5AQQA 3O44A 1N5YA 4MYTA 4HUGA 1FO1A 3BBBA 4M5JA 1YQHA 4DG1B 3UNGC 3TR8A 4IOCL 3W9IA 1RQLA 2GC8A 4DPOA 1IM4A 1NRKA 3OQ2A 4FZYA 4PG6A 3SCLE 5HR7A 2VPXB 2EAMA 4DF4A 4DR1J 3QEVA 5KFMA 1JK9B 5BREA 2O8BB 2M88A 3UD3P 3CCSS 1UPPA 4DR4J 3AD7C 5DZ6A 1S77D 3I4PA 2ZZTA 4TNOA 4OX9J 2W9BB 1WKLA 2KFYA 1NGJA 5I42B 2EC0A 2GIFA 3QDKA 1TAUA 3J8AA 2PGCA 2NRXA 4OMFG 3HPGA 1FFUA 3OR1A 3DOKB 1MROA 3C7NA 4GNIA 4EBEA 2ZH1A 4LR7A 5KT3A 2VF3A 3VPZA 3NBPA 5ADZA 3TA2A 4KLLA 4LFBK 2D4WA 3L0QA 3KUGA 5KFRA 2GWSA 1FE4A 3M1VA 4I7FB 2F65A 4PKDB 5FLXY 4CEDA 4PWUA 4J2AA 3Q22A 1VSIA 4NLZA 3CJ7A 3BEXA 1UJ4A 3FFIA 2LA6A 4DR7F 4CE9A 2OD4A 3BR9A 1HPZA 1VRQC 2YX1A 3E51A 2KIVA 4JI1J 3CCTA 5A2QY 1DJ0A 1JKHA 4ILHA 1J53A 2C2DA 3QB0A 1U1PA 3ZDEA 5BPCA 3RFAA 1WELA 4LVNP 4CLUA 4RW4A 2ZITA 5K4LA 3BKUA 3V7LA 5KFWA 1YITN 3T1YK 4IJNA 2K7KA 4J9VA 9ICQA 2CN1A 1WWUA 1Q18A 4ZLLA 5M1KA 2YQ1A 4B08A 3NGSA 4CZCA 1RT7A 5JJBA 2O8EB 1ZBTA 2ZD1A 4KITB 2F7VA 3E2EA 4IG0B 8ICSA 4FO0A 3QGHA 4R0EA 4JV0A 3A12A 2P9UA 4J9UE 3OYIA 3V9XA 4RW4B 3H40A 1VQNS 3HILA 4KMUA 1NGAA 2ZNZA 2R7OA 3A5MC 2NYVA 2Y9TA 5KG7A 1ULRA 2IM3A 3LP2B 2L41A 3KLIA 1S5JA 1TL3A 3ASMA 2A41A 5CY4A 4BRIA 4KHPK 1U2VA 1KVBA 1P6TA 1U2VB 2K4EA 1VSJA 1PCAA 2V50A 2LP4A 3OFEA 3CHWA 1TL3B 4P2SA 3TZXA 1UETA 3RMBA 2W9CB 3BS9A 3HJFA 1FO4A 4M3ZA 2I5HA 2HAIA 1PC4A 4Y2KA 1KWMA 5CR4A 1HA1A 1KEKA 5FLXO 1UEVA 1S0OA 2FHOB 5J0OA 4WQ5A 2YMQA 3UD4P 3G82A 4WP3A 3J81Y 4X4PA 1QH9A 3TZZA 1VHFA 1NM1A 3H5UA 2J9CA 4DV3J 1S1WB 4AE5A 3JQMA 3TWHA 4OO1J 2I9SA 3SUNA 4IZ9A 2YQ3A 1V4SA 4O44A 4YB5A 3P4IA 1TELA 1Q9XA 3K9JA 5C0YA 3ULDA 5C24A 4KSEB 3GMGA 4LFCK 3FZFA 3R5CA 4OX9F 5HR6A 3CJBA 4P0QA 4LF4F 3RVCA 3WHIA 2ZH9A 2FJEB 8ICQA 3TFSA 1LWXA 4ANDA 2AHOB 3LVWA 4AF1A 1LW0B 2RP5A 2LYHA 4L76A 1DY3A 4I2QB 4M5MA 4Q2LA 4X62K 3VAMA 4J9PA 4JP8A 4U8YA 3HVTA 4F3TA 1LEOA 2JR5A 5ETKA 4DSKA 2ZG6A 4QNLA 2UUTA 3GSIA 1WBDA 3PM9A 3BBFA 2ZUCA 2K8AA 3H8JA 1HQUB 2LU2A 4PKIA 4K2XA 4JKGA 3WQPA 3C29A 3KJQB 4FWQA 4ZHRB 3HSGA 2OFGX 1NZBA 2OPSB 4ED6A 5J2FA 9ICIA 3TU5A 2LEAA 9ICTA 3QXGA 3H90A 2DNGA 2MU2A 1T8EA 2E1YA 2HF4A 2EG2A 4UY8T 3IG5A 4FWRA 2KVQE 3L4QA 2BPFA 2XS7A 1SZ2A 3JB9k 1X6IA 4H0PA 3ILJA 2P5OA 1J6ZA 4KLGA 1VSKA 2AH5A 3L4BC 3ENOA 4FP9A 3IO1A 5ITHA 1HYSB 2ATQA 2DIVA 5CZVA 2GWJA 1IBCB 3C15B 3RH5A 3QE9Y 2ZE2A 2VASA 2W01A 4DG1A 1C2PA 1N32J 4MKAA 4R64A 5KFXA 1Q78A 3O1BA 3MM9B 3ZX0A 4OLPA 5GAHU 3CDEA 4UZCA 3RSEB 1PBUA 4NASA 4DUZJ 7ICJA 1N8RO 3NG8A 4JI2K 3MWTA 3R9KA 3UM9A 3V81A 1FDBA 2ASYA 2C2KB 3DXMB 3MCAB 2KK0A 3E01B 2E9TA 3MXMA 1T03A 1HNXJ 3DM2B 4H0YB 4XDDA 5KPZA 2Y0BB 2DXFA 4KV8B 2CKWA 3FZBA 4XH5A 3TSUA 5I3UA 1XNRF 2WOMB 2VFVA 4DSFA 1EKSA 5DDMA 1N63A 5LSOA 4DR5F 4NXZA 2HNDA 3F73A 4F5OA 2KFNA 5HHIA 3GJTB 2YHXA 5EX5A 1YIJN 1IJJA 4FOIA 5M2UA 3WNGA 4HDGA 4E98A 1WEXA 1KL9A 3UMCA 4M41A 4GXJA 1S9EA 3G25A 4URGA 4DSEA 1N0UA 1KQQA 4PH5A 2IHR1 4WXWA 3DLKA 2ZH5A 3O0FA 2Z1HA 4R79A 1B0PA 4RJVA 1BO5O 5A76A 1X9SA 1PVQA 1BUXA 1IO2A 1RLDA 1J9AA 4Y2CA 4B3TF 3A4TA 2NSBA 4GO5X 2DBYA 2B51A 1I1GA 5D0RA 4DTRA 3RAXA 4UZBA 3GWCA 2LM1A 4K4TA 1QJHA 2QTWA 3RJKA 1B7YB 5JMNA 1TYQB 3FZLA 1PYOB 3OHBA 2OP5A 3H4BA 4FZXC 4L3NA 2YWHA 4USVA 2WAQC 3F5EA 1ZQJA 4BROA 4DR3K 3A8KA 5F8NA 4CFDA 1SWWA 3C21A 1FJEB 3TUIC 3M2RB 4KB7A 4LSLB 2XY5A 4Z7CA 4UARA 1S6UA 4JK1A 4V1Ak 3KJVA 4C8OA 5IWAJ 3UVJB 4KIAA 4D3HA 5JLHA 3MXIA 5AKKA 2IPOB 4LSNB 1TKXA 4DS4A 3NVYA 1E6YB 2YWKA 2DGTA 4PPZA 3CUNA 3LDLA 1L3UA 1KVCA 3DYAA 1XNQF 4F7VA 2OA8A 2O1PA 4DU8A 5LY3A 2F7TA 1ZAWA 3I9V9 3LZJA 1YJ9N 4ES2A 2KT3A 2X3DA 4QIFA 4F92B 2XNQA 1OH8A 2GGPB 3VC8A 3BN7A 3EO3A 1KFSA 4I6YA 3B82A 2N1RA 4OCZA 1ATRA 5LMUJ 2F44A 2B3TB 5AZIA 5DETA 4KMOB 1VLOA 4I9QA 1IR2A 3BF3A 4BREA 2ZJQQ 4RU2A 3A8IA 1XNQK 4PYAA 5KI6A 1JMSA 2O8CA 3AA8A 2D6FC 2G5HB 4CJVA 2IOFK 2UUBJ 1PIEA 4RNOA 3PG9A 1FEZA 1XMBA 2JFKA 4G65A 3CF5L 2YNGA 1JCEA 4F02A 3ITHA 3CDWA 3PIOL 3S6JA 2AJ4A 2A40A 3I0SB 2XULA 2WONA 4FBUA 1T4GA 2ZNYA 2IM0A 1X4BA 3KOAA 1UEUA 4O3NA 4NCGA 2W6KA 1D09B 2M0NA 3HFVA 3AAPA 3O9UA 4DV2K 2O3DA 1HNWJ 2MLYA 1G4CA 4ZJOA 3AOAA 1AZSA 1VRTA 3K4GA 3IG1B 3BREA 2FI1A 1P8GA 1RT3A 4B17A 3C1ZA 1OY6A 2VIHA 3SQOP 3MMVA 4GLXA 1OJ4A 2OYQA 2KMDA 2GX9A 2RNEA 2AX0A 2JH7A 4FE3A 1RHUB 2GFFA 1RT1A 3SQ2A 5GMKa 2PKEA 3SUOA 2AX1A 3P5TL 1ZQQA 3WIUA 3PZPA 2X1BA 1IKVB 1FEEA 1Z1ZA 3CMQA 4BWMA 3WKCA 4WJBA 4ZVGA 2DNZA 2DHGA 4AFFA 4CJEA 4C3KA 2WFBA 1N0VC 3H1QA 2GQQA 3V9UA 4F5NA 2RT3A 2XWXA 5CHIA 4FLYA 4LIRA 4CLKA 4FM2A 2RQCA 4CIEA 3QRPA 2ZXIA 1KAZA 3THPA 3HWTA 1BA1A 4IFEA 3W3SA 1JRPA 4IO1A 3QESA 3QICA 3S9HA 2DPJA 2DNPA 2K3KA 1HBNB 2Y0SC 1H2VZ 3A8JA 2ISOA 3M8YA 3N97B 1R8CA 3DWLA 3UI3A 2OXOA 3ULEA 1S3XA 1WNSA 1TFRA 1D0EA 4K4GA 5JTIA 2JEGA 1Z3EB 2R7XA 4FPRA 3GV5B 1KQSR 3NVVA 4IWVA 1WC4A 2JVOA 2VG5B 4O5FA 1H7XA 4ED8A 4EI2A 2RILA 4DMNA 3BEGB 1VC0A 5GINA 3VVUA 4F2RA 4KLDA 1BPBA 4IH7A 2DPIA 1Z1VA 1DGSA 2ZTEA 4Y2JA 3CCMN 1JROA 4LRFA 4KT0C 4IUFA 2U1AA 1IBMF 4CNQA 1WOOA 1Y9OA 3FBCA 1L3VA 3I56N 5ALMA 3PX0A 5DS7A 5A8WA 4CH0S 4I67A 3CI5A 3W3DA 5HAOA 4C0BA 2O01C 2EZZA 2ZVIA 3ZFVA 1T44A 1N62A 1S8OA 2JVRA 4JB3A 2W7PA 1LKZA 3NF8A 3W62A 2Q1LA 2BW7A 2DWQA 1NPPA 2MHNA 4OI0A 1HNZJ 3ZSZA 4WFAQ 4YR3A 4EBCA 1D8BA 3Q8PB 2C2ZB 3R5AA 1PJ6A 1D3WA 1MG7A 3J7ZO 2B8PA 3F53A 2F40A 1Q0NA 3NH2A 2MZQA 1A5VA 4B3OA 3HT3A 1QQ7A 3F5AA 4N47A 3CGIA 5D4NA 3MM7A 1Z00B 4Y2AA 4BRPA 4I2FA 4CW7B 2FVCA 3AJ2A 2HF3A 3ZTSA 3K9KA 3KXDA 4L3KA 5KFFA 1C6VA 5EWGA 3RMCA 5EY4A 1ZZFA 4U7UD 1PZNA 4M47A 2E5LF 5G4DA 5CXTA 3D54A 1N6QA 1QAIA 5EOYA 1YZ6A 2UXBJ 3M4XA 1D4XA 3X3UA 1V3ZA 2QA4S 5M1QA 3J7AP 5AK4A 3C46A 4MO4A 2HDOA 3HL8A 3HDSA 1F1BB 1MLAA 1T0TV 2ALZA 3UW1A 3ENHA 3ZDAA 1YK9A 2BJ3A 2BCVA 1PUZA 5BN8A 4KH6A 3P31A 4MTPA 1NLKL 3RF9A 4UQTA 5LL6d 1Q7YT 2Q31A 2BVZA 9ICXA 1HHTP 1JLQA 1OSCA 3I6PA 1S99A 3T5JA 4NRTA 4HTUA 3NH1A 5AI5A 2XZDB 1U8WA 3D1QA 2RU3A 5FJ4A 2CJAA 2VICA 1DLOA 3FQLA 1F9FA 4BXOA 2Q1NA 4NZ7A 5CYMB 3H98A 2KQ2A 2XGQA 4P0PB 5D0HA 2F3NA 4QWCA 3N5BA 2EX3A 1C20A 4MFFA 7ICVA 3PNCA 1MQ3A 2CIMA 3OTOK 3M5RA 4J9NA 2FBTA 2BJ7A 3SAGA 1GLDG 4N76A 2RSQA 9ICUA 1FJGF 1A9NB 3Q24A 4DR6K 2IM1A 4P72A 5HO4A 3DLKB 1CJKB 5HMLA 3AEVA 2MQLA 1LVHA 1RTZA 1Q7LB 4CF8A 2FMQA 3POTB 5HVHA 1HLUA 3IRUA 1NOYA 1HIWA 4CJKA 4ZVPB 2YNFA 4LBHA 9ICWA 3WEEA 1RT5B 1SXLA 2ZVSA 1U1NA 5E3CA 2H54B 2E20A 1RAAB 1VBYA 3HKWA 4XTTA 1U09A 1RU1A 2AD9A 3T9NA 3MN9A 2VFSA 2OHFA 2E44A 2KKZA 4B3SJ 4BRGA 2PFDA 3V6HA 1ZQHA 4YHHF 1B43A 2RQ4A 4DUYJ 1XN9A 3OUYB 3DM2A 2VJVA 1ZQSA 2JWNA 3MN7A 4W5QA 4LFBF 1S72N 1O03A 2JGAA 4RUHA 3R97A 3NVKA 1F5CA 4JLHA 5K14A 4WFYA 1A5WA 5M2RA 4J2EA 3GIKA 3P45B 4DXLA 5F8JA 3U4LA 2JLGA 4M5KA 4JI2J 4NYFA 4ELVA 1WJ9A 4YOEA 1MQ2A 4HUEA 4NLVA 7ICPA 1ZTTA 3O3FA 2J6TA 2E5SA 1PK3A 2GV9A 1WC6A 4JV5K 1OPZA 2E7VA 4LF9K 4CRXA 2UUAK 2V4QA 2YWFA 1RYSA 3ISDA 2EAPA 5J1EA 4CIOA 4LF7J 4QAGA 3SQ0A 2QARB 2ADBA 3H3NO 4W98A 4CIGA 1RUSA 1Z19A 2FSKA 2E6MA 3IKMA 1K6YA 4QYRA 2XMKA 1NGBA 1M5KC 4MYUA 2H9ZA 1RP5A 1U7LA 2HOEA 4CFBA 2A3ZA 5A8RB 4DV6F 3OXGA 4ECZA 3AVLA 4CO2A 1TTHB 3WXMB 4X4TA 2AEFA 3NTUA 1I6JA 2JC0A 1XMOF 4EP4A 2ZIXB 2IYGA 2DTJA 1BG3A 2XYPB 3KWMA 1ITPA 1D8YA 4BY9C 1Y64A 2ABYA 4PHAA 3CCVS 4YCXA 4QW8A 4X84A 4OJ1A 1UT8A 4QZVB 5BXIA 3W2WA 4RQ3A 2VQFF 2W3SA 3V9SA 1DK2A 3NGTA 5E26A 3JAMU 4JV5F 2H4YB 2YKMB 3EY1A 1WLJA 2VA3A 4I2DA 7ICOA 4F5QA 1WOQA 1VHIA 2P5GA 2XLIA 2XG8A 2BV3A 4DX6A 1NU0A 2VV5A 2HSTA 3VQQA 1B3TA 5F1XA 1MU2B 5KOXA 1Y7PA 4HAIA 4O44B 1CZAN 2CGKA 4E8UA 1SV5A 2FD2A 3BF4A 3DLGA 2QSFA 2QA4N 3SQ4A 3SPZA 3VVTA 1FX4A 1LFPA 3EW9A 2FZCB 3AOBA 4OI3A 4ZPCA 3PRVA 3ETMA 2UUBK 3RB3A 2V52B 2OSRA 2HBYB 4ED4A 4RW8B 1SL0A 3J81j 4DTOA 4WE1A 5CYMA 1NHKL 4ZVUB 1RDFA 1DLOB 1FNMA 3H0MB 2VFTA 3Q7CA 4KLTA 3PSPA 3SQ1A 1TUVA 4NXNF 3T6BA 1X9WA 3LWLA 1GLCG 3BF1A 3QEAZ 3SSRA 2D0OA 5AI8A 1WSEA 1ZQPA 1XNSA 1Q5YA 3S01A 4KGKA 3K57A 3N79A 2R7TA 4DL3A 2MKHA 3AOCA 4FPAA 4MK9A 1WI8A 2RRDA 2YJEA 4DV7F 3LP2A 2V9WA 1UQVA 2JV3A 1FERA 4GVBA 5FDLA 1GEHA 1Y97A 2MLXA 1DBDA 4LBIA 1PAUB 3LP0A 2Z7JA 3IXQA 4YY3J 3I56S 2ADCA 2GJIA 2LKZA 1S6OA 1NJIT 1Y4ZB 2BEFA 4DR1K 3AGKA 2FUG9 5ALVA 2JX2A 4OZNA 3BUZB 4LF5J 1Y3JA 3M2VB 1U1RA 2RQKA 3H6EA 4EU0A 1UVIA 4Y34A 3QLHA 4JV1A 3PYEA 3NAEA 4MAKA 4JI2F 1R8HA 4I6MA 2M3DA 2VKZG 2WF6A 4DR5K 3QGPA 2J7KA 4M7YA 1NNEA 9ATCB 3AXMA 3WNHA 4ZOHC 3HHDA 2VOPA 4ICLB 1SZHA 3CJRA 3RRGA 4Y0FA 4DTJA 2O5DA 3Q8VA 2U2FA 1QSSA 3HKZF 3HVAA 2H3FA 3CC2S 4IR9A 2V69A 2DJWA 4AUKA 2CZ4A 2IC3A 1M1KO 2V2VA 1RQ0A 4E19A 3LWMA 1X6JA 4H54A 2PE8A 3O9TA 2P9SA 5DDRC 2H3QA 2I6XA 8ICVA 1WOPA 4I6MB 3CD0A 3WXJA 4K0KJ 3MMJA 4HDHA 2FLLA 1IIPA 5BYQA 1SQEA 1NKEA 1QVGR 1NNLA 4LC9B 4WZMA 5GTIU 3K7RA 1VQYA 4ENOA 3RBXA 2YX6A 2XCPA 2V7YA 2ZHOA 2JJ4D 4DCOB 4FK0A 2LQBA 4CECA 5AI6A 3IBFB 4RCHA 3QU4A 3AVKA 2QRRA 1K0TA 1HI8A 4LF8F 3BO2A 1RDWX 3CDAA 1RAGB 9ICGA 1ZTWA 3CQYA 3C6AA 3OW2R 4QZEA 1HFEL 2WVDA 3U3YA 1U49A 3S8SA 3AVCA 4CD1A 8ICEA 2FJXA 2KN4A 3EPIA 1PC5A 1TVRA 2B0CA 2D3DA 5DM6L 2F8MA 3MPYA 4Z7YA 1KVKA 2B43A 1X0FA 2KTQA 2AZ1A 4HHUA 3ZZZA 5EN1A 2KHQA 5KFLA 3H2LA 3E8OA 3BS5B 2Y8WA 1SKWA 3N7SC 4KHPJ 4L6V3 2E5JA 3K5PA 3CYMA 1SIJA 3FC4A 3CJ4A 1IBKJ 2LMIA 1KVJA 2PI5A 1JXBA 1AA1B 1W25A 1NDKA 4GKJF 4KBOA 4CZFA 4ZVEA 3OYNA 2MXYA 4Y2YA 1BL3A 2DGOA 3BKTA 2X1FA 4XEIA 1NJYA 2WB1C 1RG6A 1JLFA 5L9NA 3T1HK 4F4KA 1F3VA 1DAXA 4ZTFA 3ALRA 3VAKA 4TY8A 4QYZJ 1TUGB 3FZ2A 3N0VA 4M5LA 2HBKA 3KHRA 3AVHA 4OYXA 2OI2A 3OBYA 4RNFA 3GDXA 3BPDA 3MMBA 4ELUA 2FSNA 3D68A 2W3RA 4RX6A 2LECA 2J6SA 3CC2N 2WW8A 4EFAC 2KNJA 4FJNA 4CT9A 4P6QA 2K8BB 2LPEA 3KK7A 1KRPA 8ICRA 4C8NA 1SS6A 2E8MA 1XMQK 1G2EA 4OI1A 3WC0A 4IKAA 4KGVB 1KS2A 2WONB 1O08A 2FLNA 4YR2A 5KT2A 4ZPVR 2DVIA 1DXSA 3QUQA 4LFCJ 4KGXB 2AGPA 1HRHA 1DRGA 4HCCA 4ZVQB 1ZQYA 4Y3CA 4BQZA 2BACA 1VYAA 3NP5A 4ZPDA 1V3SA 2VIXA 5CYQB 3IM1A 1KNZA 1X3NA 2KM8C 5CE3A 1K8AO 4DOZA 3H8WA 5KL1B 4ECRA 3BKFA 2J0QD 2F8SA 1B4SA 5BR8K 3SCKE 2KE7A 4F4XA 5KRSA 3AM9A 1XQIA 4DR4F 3G8SA 1RT1B 3SSQA 2M70A 2HFVA 4LREA 2W8LA 1SV0C 5LJWA 3NGZA 4B6JA 9ICAA 5ETQA 4K8RA 3FCWA 3TUPA 3JTPA 3K8VA 8ICXA 2XSJB 5HLFB 2RH3A 3DYAB 1AZSB 5EDWA 3NCRA 4O3SA 3FC9A 1TKXB 3MAAB 1VLBA 3MR3A 3U7JA 1T9UA 1VI7A 3TAFA 2YX4A 2XLJA 3CFPA 2IA0A 3UVJA 3DGPB 4F26A 4A8YA 2V34A 4ILMA 4DUYK 3TAMB 3M6XA 5DQIA 1CC7A 2J9DE 4H0VB 1KDHA 1YIJS 5JUMA 2AJ2A 4KPYA 3MGVA 4P2XA 3PX4A 3TADC 1D8ZA 4KN7A 3MUTP 2HWIA 3CPEA 4HHTA 3ZZTA 2GIRA 4QJFB 1N32K 3VF2A 1ZM4A 2JOQA 3L4IA 2HVIA 5LJ3Y 4NLYA 1U9LA 2NRRA 1PK1A 1YX2A 2ALYB 1Q16B 4UAVA 5AZIB 2ZKTA 4H5VA 3WEEB 3MM8B 2CPJA 2XO7A 2V4JA 3C6UA 5EUHA 1SL1A 2H5EA 3D2WA 4ZN3A 3BDPA 4XUSA 4LY7A 3AVMA 5AQGA 4CF9A 5ALGA 2CPDA 4CD3A 4C3MA 1IXRA 3DN9A 2XZWA 3M30B 3CCVN 4FJ7A 1OO0B 2Q6BA 2MQPA 4PQUB 2BW2A 2ZOGA 2P6RA 2LQ8A 1IBLF 2YWEA 4QPTA 1JALA 8ICPA 5K9FA 2UXDF 4RNMA 2CQDA 3OR2A 3KBBA 1D9AA 1S5LU 2HS0A 4P10A 4ATNA 2D1KA 1SIWB 3P3DA 2VQEK 2HEKA 5D77A 3O4QA 3FEZA 3OTBA 7ICQA 1SH2A 3OR2B 4ECUA 4ECSA 3R7SB 1FXLA 4TYBA 1IV0A 3PJ9A 2E5IA 1WACA 2FF3B 1NZPA 1ZA1B 2COLA 1NKBA 4A8OA 2VGMA 2EEYA 4F0MA 4C8KA 4JI3J 5FPMA 2I8EA 1SH3A 5KFSA 4J9LA 4P4MA 3SBGA 4C8YA 4WU2A 1WDTA 4PL8A 3CTRA 3POTA 1NDLA 3LQVA 2YV0X 3ED5A 3CJKA 1TZ0A 2DD8S 3C66A 3KJNB 5HP4A 4E3SA 2BM1A 3J80O 5J0XA 1UZHA 3KWGA 2HVZA 1ICEB 1NOZA 2PMWA 1QE1A 1Y5NB 1X2IA 3MUMP 2XLKA 2YWGA 1S72S 2E5LK 2FVSA 1CVJA 2E5LJ 4C97A 3PW7A 2CDQA 1XSNA 1WKKA 5THWA 3T6JA 3CJ5A 4JHDA 4P0PA 2E5GA 1L7OA 2KIWA 3H8YA 1MN7A 4NB4A 2O8DA 3G6YA 5FLXU 2NXJA 4OGEA 5LMUK 3QEBZ 3W8GA 3ETOA 4FFDA 1SGGA 2XTJP 2YHWA 4J5OA 2MZJA 5AKYA 1BI4A 1ASVA 3DXSX 4RLEA 5KG4A 1KDNA 2ZH4A 4M9LA 3MAAA 5F8MA 1NH8A 2DNYA 2GMLA 1HD1A 2AYEA 1ZXOA 3FCHA 4IKFA 1YRXA 4BDPA 3FR0A 3GIJA 4Q5VA 4CH7A 2FJDB 2FBYA 1REGX 2HZVA 3R9PA 3W0LA 2CQIA 3PLAA 3MEGB 2MPUA 5K20B 2QL7B 4Z37A 9ICFA 5F9NA 2G2YA 2K7JA 1A77A 2Z57B 3M6GA 1PYTA 2W9MA 3WQUA 4A8EA 4CGFA 4KLHA 4CO1A 6AT1B 4KC5A 3HT0A 1QQ6A 4BC7A 5A6PA 2OPSA 1GMVA 3V1QA 3ZXWA 3H20A 5EOZA 1NK4A 4B1YB 3DU5A 2YH1A 2Z0GA 2WRMA 5HL7Q 5DDOC 1HIYA 4CJPA 3D2NA 1NGEA 4PGXA 3DU6A 3MURP 1KCFA 1QM9A 1UMJA 5AK5A 4ZJLA 3KWIA 3AY9A 4WCEL 3IM9A 1HI0P 3TVKA 1IG8A 3W7BA 4DPYA 4TQSA 4FNIA 4IDKA 1VBXA 1A0OB 5E7OB 1JLCA 3HP6A 4CQ1A 5AXLA 2QKBA 3M2UA 2A19A 3HYFA 3H5XA 1Z4NA 1FDDA 3BM7A 3WDOA 5LL6Z 3B78A 1R43A 5FPDA 3QAUA 4Z6FA 4DR5J 2IBOA 4EX7A 2WF5A 3ATUA 2QX0A 4DUZF 3NY0A 3HX0A 2IVOA 1FWPA 1YXQA 4UAZA 4FLVA 3IAYA 4JI5F 1FK9B 4JS4A 3S6EA 4IG0A 5E3AA 1P1LA 2ZD1B 3ZZOA 1QAXA 1LXJA 1X4HA 4G1QA 3OL6A 4YMEA 2MKJA 2V94A 4KLUA 4DZ6A 3ULEB 4Y2RA 4DI6A 5IQ6A 1UVKA 3QINA 2H65B 4ZVHA 1Q8LA 4F04B 5DGBA 2NV3A 3I0SA 1HYVA 2BYCA 3EGVA 4CBUA 3CCSN 2WB4A 2O4GA 3SMVA 1JKHB 3WKAA 3TSQA 1BWEA 3D3CJ 2KJ5A 3KK1B 3WXLA 4DQPA 4A5BA 2V67A 4IH6A 3PW5A 1TFYA 4DQRA 1DTTA 5B0BA 3NFAA 2PI4A 4KY3A 2FLPA 2H5JB 3CCMS 4ISFA 3CP8A 4ZVFA 3KG4A 1SUQB 3SBTA 1RXVA 1E4FT 2W54A 2M52A 4YDUC 4DPUA 2EAOA 2QXLA 4MKBA 5HQMA 5B0FA 3KDOA 4CZMA 2JWKA 4IOXA 1FFWB 2OGUA 3RJIA 5IM0A 2CQGA 4QYZK 4BQLA 4K50A 3C6HA 1HNZK 2LQ9A 1VISA 3JPNA 2NO4A 2PFNA 2BPGA 1VGYA 3T1YF 1UT5A 1FRKA 1X5SA 3HBTA 4YOXA 1VOMA 1KLNA 3ID6A 3VQ8A 4Y2MA 5I42A 1COKA 1JLEA 2Q0ZX 4PEOA 2K06A 4GXKA 4QCLA 5EHHA 2Y3YA 2DFFA 3J81O 3AO5A 3UNYA 2OMLA 2XHWA 2KSOB 5A6WA 4NM1A 1M5HA 3B6OA 5ETLA 3ZT4A 4OJ5A 3THWB 3D0HE 4RWTA 1X5TA 2GWKA 2BCUA 4X4QA 2DITA 2LI6A 2BKOA 3GJSB 4USUA 2UP1A 2PYLA 3SAFA 2R4FA 2F2AB 4IRDA 2EK1A 4PG8A 3O5TB 1Q4RA 4RPXA 1KOOA 1RHKB 4M8LA 1S7HA 4O3RA 3MR2A 3AAQA 4WFBQ 2HHUA 2MSSA 4WYLA 1C0GA 4ZCIA 1AROP 3PIPQ 2OTJS 3UWTA 1WDDA 4ZLNA 4BR0A 2ZIWA 1UZDA 2HHXA 1QAYA 2B0GA 3CETA 2R7UA 4KTQA 3BGRA 1A76A 4KKOA 3LP0B 3R8EA 1VJWA 4FVUA 3A5NC 4J7CA 4WK3A 3IWLA 3N7PD 1PJ7A 1E6YA 2EK6A 3MWBA 2CQ3A 3M1FA 1QY7A 1RAIB 4YN3B 2JZBB 1BNOA 3ZEUB 3VAHA 1TP7A 1HD0A 3OTQA 3FAHA 2BE7D 1AW0A 2B7BB 8ICAA 4PGYA 2ASMA 3MEEB 4F2SA 2ESEA 2VG6A 2KHVA 2O66A 2HI0A 2XWYA 2KKPA 3HSTB 1VJQA 3K2PA 4BR5A 3PEHA 3QQCD 4CCHA 2HRUA 3B54A 2KYXA 1YBAA 2XY6A 4K2JA 5KG5A 2F96A 3ZT0A 2GJ2A 3JS6A 1MDUB 4L3QA 1WAJA 2CRLA 3H25A 2KLAA 1WG5A 2EFOA 3TJ9A 3NUQA 3M8SA 1YJ9S 2ACMA 4RW6A 1VQ4N 4DCCA 2B5JB 3VHQA 5ALOA 2ES6A 3N4QA 4K25A 2HLTA 3MPDA 5K8MA 4I4BA 1TL7A 4USHA 2OAUA 5L1LA 1FFGB 4N41A 1LK5A 1ZOLA 4CO0A 1VRUA 4ZP6A 1MN8A 3MXJA 2G09A 2XY7A 3BQ0A 4BRLA 3VV2B 5KFAA 4OKJA 1BIZA 4FW1A 3UN2A 3PVXA 3LM2A 3DLBA 4ELTA 2P9NA 5F9LA 3KUEA 3GJRB 3EE8A 1NKCA 1KKXA 2FY1A 2PMZD 3U1LA 1ZQXA 3HVWA 3N6MA 2VBXA 4F8RA 1FD8A 1ITGA 3VEXA 1FDAA 2K8GA 1T03B 3MDCA 4LF9J 3MGHA 4AM6A 3KD1E 2KHOA 2X74A 5AQIA 2DFHA 3TR5A 1QVFM 2RQ5A 3R9LA 1KVIA 3G87A 2UV8A 3K5LA 2E1CA 1VBKA 3TKAA 5C42A 4DTXA 1BPXA 3V9WA 3QBXA 2BJDA 3HHKA 1L6NA 1ZS6A 4Q0BB 4DN9A 5KG2A 4KGZB 1JB0C 4IG3B 4JKAA 1HKGA 2LLZA 2KYZA 2HFNA 4WU3A 2C2MB 3ORYA 2UXDK 3KG1A 4LUBA 2JZBA 4RUBA 2CJBA 2J5AA 3L2VA 4M0AA 3HW8A 3H08A 3WK7A 1IKWB 3WC2A 1ZA2B 1DGKN 3W63A 2ROEA 3H2VE 1YHQS 2QK9A 3TJAA 4CLPA 3UE2A 2P9KB 4QQBA 4O4GA 4M94A 3VF0B 1FDNA 3BGRB 4ZHRA 3CM6A 8ICGA 5HI7A 3OA9A 3LH2S 2ZIWB 1XNRJ 1RCOB 3FSYA 4F4ZA 4R65A 1NGGA 4FK2A 3NNCA 2O4IA 2G08A 3CT9A 1NK8A 2PC6A 1T7PA 1XNQJ 4FM1A 4DUTA 4OJLA 2UUWA 3HVTB 5HP1B 4BRDA 3HPHA 3OFFA 1ZQLA 4AYBC 3OJUA 4C9DA 1NM2A 1SC4B 1C7YA 3D45A 3R5BA 1LW0A 1HLWA 8ICOA 1IQTA 5AXMA 3MGJA 5ALDA 2A2DA 1WUAA 3EX7B 4CEZA 1CUKA 5CD4A 3TX8A 1VSEA 2KI2A 3HI9A 2XMAA 7ICIA 3T1HF 2AF6A 4DSLA 2W8KA 5HHHA 3QZ7A 2R8KA 4HCBA 3CIMA 2W4CA 1NAQA 3UCGA 3C5GA 4M7XA 1M5OC 4AL5A 1YRUA 5KOWA 3HD1A 5CAAA 4CERA 3JPQA 1FK9A 4O3PA 4HACB 2CZ9A 2G2ZA 1EQMA 4DLEA 3BZKA 4KLMA 2V5HG 3BGUA 1FVQA 3DRRB 4PKGA 5FROA 5T7LB 4LF5K 2W9CA 3ZTRA 1RWNB 4BR2A 3MPVA 2ZBQA 5D3GB 3GU0A 4YB1P 1C0TB 4QR0A 4M6WA 3SR6A 2NS1B 2R8IA 4DBQA 3LPTA 1TL1B 4JI5K 4EZ9A 4OYWA 2DR7A 1ILYA 5C25A 2HHVA 3M1VB 1J2VA 5J2KA 1SB6A 4JI8F 3SK3A 5U47A 4CLZA 1Y11A 1SQKA 4RWXA 4CLWA 4G1IA 1V97A 3NGYA 2CNNB 1FVSA 3IN5A 1RTHA 4DV5F 4WYBA 4IQVA 2OWOA 2CDRB 4OV1A 5GMEA 4XPEA 2CFXA 1DQAA 1VQOS 2Z4PA 1RWKB 3FMBA 4I2BA 1YWXA 1GLLO 2LKYA 1RDCA 1CI4A 1REVA 3OL8A 3MM7B 4K0KK 8ICYA 3M8WA 1RQNA 3HD2A 2ZIVA 1J2MA 2HQCA 5AQZA 3LDPA 2IVNA 4BBYA 3PTWA 3EXCX 1YG0A 1IR0A 2EZXA 3VERA 4NEYA 1I3AA 3IRXA 5F8LA 3HTVA 3W65A 2WVEA 4NV0A 3C6TB 3M8ZA 5A0YB 9ICRA 4C1NI 2O6KA 5J2BA 5AKLA 3Q86A 3GBTA 3IV6A 3GQCA 3OPKA 1FFVA 4HH0A 1JLCB 3RUBL 1VQNN 4US9A 1S4EA 2Q3SA 4NEZA 1ZBHA 3PJXA 2HWHA 1GH8A 2M9KA 3A5OC 2IDLA 2QO3A 3W5XA 4DU4A 4LF7F 3EVOA 4Z4IA 3GG4A 2CGJA 4TU9A 4QIEA 1IJFB 3NCQA 3KLHB 4ECVA 2WVFA 4QZAA 1RTDB 4GC6A 4AHSA 5AZJB 3RRHA 3OR1B 3QEWA 3NCPA 3PMNA 3QO9B 1N54B 1GLFO 2W4DA 4DSIA 1YITS 3ONNA 4KE5A 4NI2A 5M1FA 3R6MA 1IKYA 4BR9A 9ICHA 3ZSQA 1D8LA 1QE1B 2PD1A 3QO9A 4C4RA 4MEXA 5BPLA 1E6VA 4NWBA 4B9MA 5CH7B 3NE6A 1RTDA 2ZZMA 4OHYA 5AQHA 3T1HJ 4EELA 2ITGA 4B9NA 3NEKA 4FXWA 1OY8A 3UDVA 2MSNA 2XY8A 3F2KA 4R8UA 3AVNA 1R3NA 4XH4A 4M04A 3QUBA 1MA7A 4B3RK 5IC6B 2JEFA 3U8XA 3SJHA 3PO4A 2IVMA 3VF6A 2LDIA 3MOJB 3OSPA 1OVQA 2VC1A 2MZ1A 2QWMA 3VQ7A 3BSCA 4FWKA 2Z2MA 3C6TA 3IBWA 1ZQ1C 3HJEA 4YN4A 1NDCA 1B7FA 2HMIA 4U6PA 2Q6CA 5D0EA 2HAFA 4AHTA 3OYMA 1YTYA 3BYPA 4JI4K 3OVSA 5DBAA 3TNVA 2M8DB 5HRRA 1YJVA 1M5PC 2P1JA 5DQHA 3C2MA 3UQ2A 1LWEB 3QZ8A 2VBYA 2W9AA 1TV9A 3W5ZA 3IAS9 2BGWA 2GUPA 2PMZC 4OZ3A 1RACB 2M2BA 3GIIA 3LL3A 3HHLA 5ALSA 1N5QA 4KHYA 1N33J 4CF2A 4X62J 2D8CA 1MWMA 1K9MT 3JYTB 3OFHA 2G1DA 4MFBB 2Y1JA 2JMGA 4H4KA 3OYGA 1N36J 4PWDA 2VWKA 1FI4A 3CJQA 4GMJB 2LU1A 2NXUA 3LGHA 1ZBIA 5DB9A 1RSCA 2WSCC 3CJKB 5A0LA 4PPDA 1TVAA 2HNYB 2L08A 2NRVA 3R7BB 1U1LA 2MKIA 4USIA 2MJNA 3M6ZA 1YVFA 4H0XB 4ZS6A 1WWVA 2W2QP 3ZSWA 4DL4A 3VGUA 1JLBB 3F9KA 2RB7A 3GB0A 4FJXA 2R7YA 5H1SQ 9ICOA 1QDUB 4BLGA 4QS8A 1S1UA 3VA0A 4FJHA 2PSZA 1SL2A 4IQTA 3P96A 3MM6A 2HFUA 2HCFA 1URRA 2G8VA 5E79U 3CCQS 4GV9A 1MMDA 4YOTA 7ICTA 2VCPA 2XZTB 3SCIE 2FJWA 5AI0A 4ECWA 4PKHA 2RDJA 2GO7A 1MWZA 3UIQA 1WHXA 2ZWPA 2J7UA 4UB5A 4QWBA 3SFGA 1VQKN 1OWXA 3RJJA 4NLCA 2ZBRA 3NF7A 1SC3B 4PR6A 3L6QA 3DGPA 1U0HA 4ZMMA 1RBRA 1JCFA 3I31A 4I0WA 2OEHA 2EANA 3UQ0A 2M8HA 3I96A 3ZDCA 3RMDA 4DUZK 2D3OR 5HVGA 4NOHA 5HMZA 4AH9A 5DLFA 4GIBA 4R63A 3G96A 1ASUA 1QD1A 3KJVB 1HNXK 1ZC6A 3EEQA 4LT6A 2K60A 3TQ1A 2ZH2A 1I39A 2KU7A 1RDAA 3J7A1 2KD1A 3G6XA 2QYCA 3OTCA 4CGJA 4RBVA 2WFAA 3LDOA 5IFMA 1VS3A 4ALZA 3BN4A 4RNHA 5AQSA 2VODA 3LTOA 5H9FK 1N8RT 2CNOB 2EVZA 3C16A 2BOPA 4GW6A 2OSQA 4DTUA 2UXCF 1JNRB 3LPYA 2QI2A 4MF2A 1N5WA 3IM8A 4E7JA 2FC9A 4O3QA 3VALA 4N7TA 1JX4A 3U1MA 1O13A 3FM9A 8ICNA 2VPWB 1YJWS 1O8BA 2QKQA 2VQEJ 2SXLA 1S6QB 3D66A 1Q46A 2D0BA 4BRCA 4PUOA 4DV0F 1SJFA 5AE3A 4FSVA 4OPJA 5CABA 3THYB 1I5OB 5GAEP 4MMOA 1NGDA 3D2SA 8ICJA 4CBXA 1WTFA 1RI7A 4KI6A 3OVBA 4IC9A 4QS7A 3DCAA 2VG7B 2XSJA 5HLFA 1U1OA 3I82A 2FVPA 4WQ5C 4F71A 2QA4G 4FJIA 3U9ZA 5CA5A 5GAEU 1JL1A 4JK9A 4CHYA 4QZ9A 1OW5A 2OPQB 4K59A 2DGXA 2FGCA 4GY2B 3QIPA 1IKXB 5AXKA 2WOMA 2POKA 2NREA 3WBZA 1TL5A 4NLWA 4RNNA 2RF2A 2DR5A 1MA9B 2UXCK 2CGLA 1TUWA 2RHSB 5KFKA 5H2FU 4CF1A 1AT1B 3R6LB 4OLBA 5ETVA 2GEMA 4OZ1A 2I2YA 2RS2A 5CYQA 3KLFA 3RSEA 4YUDA 4OYBA 1R89A 3ZT1A 2V8GA 3CC7N 3DRSB 3T9ZA 3QEXA 4R8UB 4H5NA 5HMXA 2NXNA 4N56A 4RQ1A 4KLIA 1XNRK 1BXNA 4YOYA 2A5XA 2HFZA 2CRXA 3C94A 1M90O 2DKZA 4ANEA 2QWPA 1GLEG 2G1HA 4CDGA 4FLXA 4RQMA 1ZQRA 2BTFA 3NS1A 3J7Z5 3TABA 2NZTA 5IIMA 1AQ6A 3AQOA 4DQQA 5C2CA 2XEXA 3SCJE 1R31A 5CP2A 3MEDA 2VYPA 2G0JA 4IJAA 5GAHI 4YY3K 2D3ZA 4B9QA 1JLFB 3NWRA 3O6QA 4FLZA 1QQCA 4I29A 4BC5A 3FGUA 3KLHA 2OTLS 2OZMA 3MECA 4KLEA 1VBZA 4W90B 4NL9C 4R0JA 4RW6B 1HQUA 3C2KA 3OYLA 2QJ3A 4QZCA 3K2YA 4MH8A 2HGNA 4KH1B 4HEA9 1ZQOA 1KAXA 4FBTA 4TVAB 1H74A 2VA8A 3J7AN 4FJLA 1HNWK 1S6PA 3ZETB 2ZJRQ 2P9SB 3I87A 1HKBA 3KKAC 1TQLA 5TISU 3LM9A 1T9VA 2H3EB 3DRPB 4MKVA 3NCIA 3JPTA 4K4HA 4IH5A 4JI0K 4OHWA 4P0QB 4O0JA 5KFVA 1N88A 3UXPA 1XUPO 3IBPA 3D7SB 4YG2A 4GVEA 4DV1J 1T9YA 2UUAF 2AA4A 1SC1B 1K9MO 1JLEB 5DGAA 3TEHB 3ENAA 4PHPA 3D1HA 3JQJA 1REVB 3P5BP 4CVNE 2KJ9A 1NMDA 3M2VA 1VQ6S 2QL9B 6FDRA 1RTHB 5DM7Q 1HBUB 4K43A 3KZIU 5ALNA 2WF9A 3GONA 4DHYA 3N4MB 4NA2A 2E2OA 4YMOA 5AI4A 4USMA 2CQ0A 1B70B 3Q83A 4LH5A 3OYJA 3T79A 5L39A 2NNWA 4DEZA 2LVWA 2GS8A 5CCMA 1K0VA 1X42A 3O9QA 1DTTB 1EKEA 2OLWA 2RHFA 5DK5A 3RR7A 3A13A 4DLGA 4DFDA 5F8IA 2I5JB 3VF4A 5RUBA 3DHXA 3JSBA 1HNIB 4Z4GA 3S41A 1IXKA 1S0VA 4TN2A 2FXUA 1P9YA 8ATCB 4UOCA 3H5SA 1UPMB 2K4PA 5ALXA 4LF5F 4RPYA 3US5A 2WTUA 4YDDB 4BC2A 2QSWA 5JVGQ 4DX8H 2V51B 1U2CA 4U95A 3RJEA 3NF6A 2JH3A 3OLAA 1WTBA 1IQZA 1TV6A 2VC0A 2PAVA 4OI6A 1SXDA 5IIOA 4G1PA 4KLSA 1T9WA 1ACMB 5DJBA 3JPPA 3G10A 5EE0A 3G0ZA 3M8RA 3RB0A 4DU1A 4Z6CA 4KQZA 2HWTA 1O6XA 3EUB2 1C1BA 2BDUA 2B4PA 3THXB 2DFEA 1MU2A 3M6WA 4JYAF 4HVJA 2IM2A 1WF0A 1MMNA 1SUQA 3CMEN 3CMAS 2E8NA 3IFRA 3MFHA 4YNQA 3CULA 4RG8A 1GK8A 3ENBA 2VWJA 4KLJA 5AKGA 4UAYA 5CB1A 2QB0B 2CPHA 3FJ2A 3V4MA 5KTQA 2CQ2A 1VMBA 1VK8A 3IA0A 2R7RA 2P6UA 2QM1A 2JRZA 4DL6A 4X66K 5F41A 3WZ0A 2KRBA 2KT2A 1X9XA 2VDIA 1UAWA 3M8QA 2G8UA 1R8BA 1ZQNA 1KP6A 2HYIB 3K58A 2O8FB 4UBBA 2WVBA 2UUCF 3NBPB 3HJVA 2FF6A 1ZM2A 4GO7X 4A5AA 2R8HA 1G7CB 3S3NA 1AUDA 2JZ5A 4O5KA 3C2LA 2JFDA 4DR7J 4NL9A 4FNHA 4C0OC 2ZJAA 3Q8UA 3OT9A 5ETMA 2MKSA 1WSHA 5AQNA 4XO0A 3AMZA 1HMVB 2Z2LA 5T41A 5J1EB 1L8LA 5G5HA 4DV4K 4M63A 4DV4J 4CK3A 3OGUA 2R3VA 4M3TA 4FLWA 3LDAA 2NYHA 4WTYA 1OIAA 4JI4J 3D6MB 3O9SA 4FJKA 2EC2A 2QLTA 5EX3A 1QTMA 5ALQA 3UD5A 1XTZA 3P4UB 1NJXA 3HZ6A 4ZPBA 1BHNA 3HFKA 4YEAA 4QIWD 1NUEA 2BRLA 4IOCQ 4F72A 2KL8A 4A57A 4HT5A 2GW8A 4HHJA 4NA1A 3CJTA 4AQYK 2ETJA 3KYLA 1VAZA 3MWPA 3AO3A 4AQYJ 1RWPB 1Q81T 3HM9A 2IA6A 1N5SA 2CPIA 2C3OA 2IOHA 4NO7A 1CZBA 3CQ8A 1N34J 4G3IA 3NL0A 2V2ZA 1RWUA 4H0TB 4HTLA 4KGMA 2M9NA 4RZRA 1Q8IA 4I56A 3C14A 4UOGA 4NM2A 1JL2A 3FVYA 2YQEA 3LP3A 4MIAA 1OYDA 1Y5IB 3CJ9A 1RT4A 3QMLA 2Q2RA 1XJWB 5I9EB 2CQHA 4F4AA 9RUBA 3V6DB 1VQ9S 3D0IE 1R0AB 4E89A 1T05B 4NYZA 1NHVA 3QT6A 3EMTA 2V8PA 4CJUA 3EWGA 1XR7A 3BGLA 3N5FA 1Z4OA 1TUYA 3FSIA 1YAGA 3N6LA 2QWQA 3CFRA 4QR2A 5HNKA 3BO3A 3AA4A 4JWNA 3ZSXA 1FRIA 4CO3A 4J03A 2K1RB 1UVMA 5ALUA 1O51A 2ZC4A 1YI2N 1RCXB 1ZBSA 4LSZB 5E41A 3LA0A 4CEEA 3O1LA 3SI6A 1F9HA 1W2BM 2QA1A 3L7PA 4IRKA 1F44A 3SQGB 1ZRMA 4BDZA 2HBZB 4RKUC 4K7QA 4PG5A 1BC6A 1ASWA 2EWSA 1LQ9A 1QUVA 3GDQA 2ZHAA 5J2MA 4BRNA 4JHDB 5DO2A 4EAHD 4Q43A 1BWVA 3IP0A 4JI3K 2BJEA 4OL8A 3NMUA 2DGQA 1RWXB 2F1JA 1FTCA 2V63A 4JOUA 3CJCA 1L3SA 3Q8LA 3UN3A 3D2EB 2VQFJ 5M2PA 3GP9A 1S22A 3G4SN 1FT8A 2V2KA 2IAJB 4Y00A 4NXMF 4MN4C 2HKEA 3MMAB 3RG6A 3DV9A 4USJC 4DV6J 1QAJA 4YDUA 3UDLA 9ICVA 8ICTA 5ETRA 2UXDJ 5LMUF 2AJFE 2DY9A 3DMJB 3KNAA 4FL9A 3D6RA 1RDRA 3HX9A 3M6KA 1Z00A 3BY5A 3UKUA 7ICFA 4B3OB 2G0AA 2HS4A 3H8MA 2F8KA 3I8DA 2UUBF 1KQKA 3WK9A 5GADI 5B66U 3SXLA 1SBRA 4P71A 1XI1A 2W7OA 2RUGA 4RL1A 4LR8A 4OPHA 2VUGA 3VQEA 3RJFA 4XIUA 3KK3B 1DURA 3Q0AA 4W4MA 3ISCA 1FW6A 4CM2A 1XC3A 3CJ1A 3LGMA 2IVFB 5IOLA 3I55N 3GCXP 1F0XA 3TPQA 2NZ4A 3F41A 4NE9C 2EXUA 1WHWA 1FJCA 2A1JA 3H7IA 4H4MB 4HYKA 2CPRA 4WFBL 2GLEA 3G71S 4P4PA 2VGNA 4CHOA 5DRKA 2LYBA 2J0XA 1P8ZA 1UL3A 3DEEA 3NGRA 3U02A 3T5LA 3O4WA 5LM7E 2KW4A 3NGKA 3D7EO 3N6NA 4RR5A 5IINA 4I1TA 3PSFA 3JSYA 1YF5L 3WNEA 3MC1A 5J0PA 2GMJA 2VG5A 2A1SA 1CS4B 2W42A 3CC4N 1SH0A 2GAGC 3SMPA 2R2TA 4I2CA 2M7SA 4HI2A 2KG5A 3NVWA 2BCRA 1BWFO 4FLUA 3VQ9A 3VN5A 4KFBA 4A8SA 3O08A 3CO9A 4KLFA 1B9DA 4DCHA 1UWBB 4ILGB 3NAHA 1N60A 2DHSA 2P51A 3CIPA 1VJ5A 2EKNA 3SZ2A 4BDYA 1RAOA 5CZXA 3NASA 5AM5A 1FXDA 3B4MA 4UTGA 2VBWA 3W8PA 2ZM6F 1L5UA 4OX6A 3ID8A 4KX5A 4QU6A 5KPRA 4E7KA 4X62F 2YY3A 4EHTA 2X78A 1NU4A 3UXOA 1SB3C 4E7HA 3SUPA 4R5PA 3N7RC 3UMBA 2KHCA 3O3HA 1XU4A 3D1OA 4F3QA 4NWIA 2B4JA 2XRIA 2D9PA 3NS7B 3AAWB 4NLNA 1RWWB 3GILA 4BRMA 5AIBA 4UB2A 4AYBD 1X4AA 4H5TA 3BGOP 4OYZA 2F77X 2QEXN 1HMVA 2FHJA 1JJCB 2AW0A 3AN1A 4ZVSB 1QQNA 4WP8A 4M9GA 1VIOA 2OYYA 4TYAA 3BO4A 3D6TB 2QLFB 5E3RA 3KLEB 2KG0A 3NGDA 2MTLA 2YHAA 1IM6A 4QOTA 4CYUA 5B5EU 3AVJA 4DQ8A 1DHMA 1HBNA 1K73T 4CJ3A 2DGWA 1KOHA 1C0MA 2KDOA 5KFBA 4CZIA 5F0UA 2XNRA 2HQFA 2J9EA 1J97A 4PXDA 5DQGA 3PEJA 3O3GA 3M3ZA 2O8FA 3ZTPA 4U9RA 5J0WA 4FYVB 1Q5VA 4FXVA 4KLQA 3FZHA 3DLLQ 1KD1O 5C12A 3C1YA 5IV4A 3H1VX 3QIDA 4LFAJ 3OD2A 4JI8K 2FTRA 3TA0A 1Q82O 2HZAA 4LFAK 4JK8A 4BCAA 3QGGA 1NLVA 2YCHA 2I9GA 2HHHF 2IJNA 4CHNA 4RQ6A 2W2PP 3AH6A 2L48A 5DB6A 3CCJS 3QMQA 1OQ6A 1VQ7N 2G8WA 1RB0A 3R1XA 3QUCA 4OHZA 4KB0A 2B21A 5B7WA 3PHTA 1FRLA 2XCAA 1B9FA 5L1KA 4M63C 2FGOA 1HWJA 1LAWA 4HI1A 4CT8A 4A8KA 3ETLA 4RQ4A 1WWHA 2Z2YB 2OIHA 3DOLB 1B99A 1X8DA 4IR1A 4LSNA 2B56A 1J27A 2DNNA 4RU9A 5BRFA 3KZXA 2JXJA 3TADA 5DG8A 3OL9A 3OBWA 2OFHX 2AJ0A 2UXBK 1WHYA 4PABA 1ZJNA 4ZN1A 1H2TZ 2D7SA 5KGWA 1Q9YA 5F8HA 3AJDA 1TVRB 3SV4A 2E8AA 4ICLA 4KFBB 5E2QA 3OYCA 1NHUA 1KC8T 1MSWD 4LFCF 5CEHA 3CCUS 2ILYA 2D0CA 1Q7YO 2VDHA 4V19S 1BPYA 2CG4A 1OKJA 3BJYA 1RBLA 5G0RA 1FKOB 1X9JA 3GOIA 3IGNA 4NLGA 2DPNA 3QSIA 1X1PA 2X51A 3ZO7A 2BUNA 1P1TA 4EYIB 3W60A 1ZM9A 3QJLA 2DR8A 2PMZF 1XMQJ 5ALYA 7ICNA 4X66J 5JXSA 2IHNA 4F9OA 5L9XA 1SJ3P 3B8AX 4I64A 5HQLA 1Y3KA 3PW4A 5HOOA 2DISA 4Q8EA 1J2NA 1VQ5N 2Y1IA 1XIQA