2XY7A

Crystal structure of a salicylic aldehyde base in the pre-insertion site of fragment dna polymerase i from bacillus stearothermophilus
Total Genus 188
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
188
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHAAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWALERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGEELAEQLRTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKSKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQARLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA POLYMERASE I
publication title Reversible Bond Formation Enables the Replication and Amplification of a Crosslinking Salen Complex as an Orthogonal Base Pair.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 188
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2010-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2xy7A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 2xy7A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2xy7A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2xy7A01
3HW8A 1Z3EB 4NM1A 1J53A 3O3FA 4DL3A 3K2PA 2ZJ5A 5J0UA 3CM6A 2BCSA 1BHLA 4DFJA 2ASDA 2FMPA 2YNIA 4FYDA 1NOYA 3AVIA 4QZ8A 9ICPA 4CEDA 5L9XA 5BOMA 1JXEA 1B9FA 2OPQA 4BE0A 3C2KA 4ECQA 3AVFA 3QE9Y 4I2QA 4RNOA 3LWLA 4JV2A 4O5EA 4Y1CA 3RR7A 1BISA 1JLAA 5JS2A 4F3TA 2RN2A 3TAFA 1BL3A 1R0AA 4FM2A 3IHQB 4O5KA 3TAPA 3LAKA 4RUAA 1VSDA 4FJJA 2BQUA 4J2DA 3C94A 1RPLA 5KFAA 1C1AA 7ICNA 5KFUA 4DTMA 7ICVA 4CJFA 4AHCA 1EP4A 1HQEA 3HT3A 3ZDDA 5J0TA 1KVBA 1BQMA 5KRTA 4KO0A 4YR3A 2FC0A 5I42A 4GC7A 1U04A 9ICJA 3Q8LA 5J2QA 1ZQXA 4XRHA 4J9NA 3DLHA 3V6JA 1KDHA 2G8FA 4KTZA 2HHTA 1ZQOA 4RW7A 3Q8KA 3SI8A 4RU9A 2UVUA 4I27A 3DYAA 1TL3A 3QEVA 5J2BA 2NRVA 5J2MA 4FJ8A 3RH5A 1T4GA 4HCCA 4JV0A 1RT5A 2IHMA 1Y97A 3M9OB 4PGYA 4DL5A 1N6QA 1QQCA 3LP1A 2W42A 3K58A 2BGWA 4ECRA 4N56A 4YMOA 3VQ6A 5KFWA 1BPDA 2IAJA 3SCXA 2BGGA 4M47A 4MEYA 4DTPA 2JLEA 2XHBA 3VQ4A 2IS3A 1XSLA 4R8UA 4J9PA 7ICJA 1YTAA 3TAMA 1XSPA 1HYVA 2WTFA 3QEPA 3IM1A 5KG5A 1JLBA 4KPYA 4IR1A 3PUFA 4L8RB 3M9MB 1U49A 4RQ7A 2P5GA 4DF8A 4R5PA 1TKTA 1JLQA 1TGOA 5K14A 2X74A 5EU7A 1RNHA 3FDSA 1NKCA 5DB8A 4BXOB 1XWLA 2A1JA 3CFOA 3MGIA 4IQTA 3GIJA 4UAWA 4W5NA 3LP2A 3L2QA 4FZXC 3ZSWA 4PHDA 1RXVA 3V1OA 1S5JA 2XGPA 4R64A 4DMNA 3RJJA 8ICYA 2ASLA 1RYSA 2YHAA 5KFEA 2WONA 4DG1A 3UXPA 4IG3A 5KFDA 2ATLA 5I3UA 4QWBA 1RT6A 3U3YA 4MF2A 3L2UA 4PGXA 2DTUA 2BHNA 2W8KA 1WN7A 3KKRA 4OGEA 4CHQA 4AHUA 4CIFA 5IIIA 3RMBA 4CGHA 3ISCA 5J0YA 2HHQA 3LP0A 1HYSA 4F4ZA 4E7KA 8ICBA 4E3SA 4DQRA 4DU1A 2J6SA 4FK2A 1NJYA 3TARA 4EBEA 3AA5X 1DTQA 1XSNA 1S10A 4Q8EA 3VN5A 4I2GA 3TQ1A 3HK2A 3KK2A 4JWMA 8ICFA 3O4QA 2PYLA 1K1SA 9ICWA 4KFBA 1U48A 4ECXA 5CB1A 1W0HA 4N41A 2IDOA 3CQ8A 3PY8A 5DBCA 1TVRA 1HJPA 1S1VA 3ASMA 3FFIA 4W5QA 4HYKA 5J2KA 3C5FA 4O5CA 3RB3A 4Q0BA 3NFAA 9ICCA 1IXRA 5E41A 4C8OA 3T5JA 3ETLA 5L1IA 5KTQA 4HUGA 3PW7A 4CHYA 3NH2A 4WE1A 4M3UA 2KTQA 3ZT4A 3ZD8A 4IQUA 1CUKA 1CLQA 2FLLA 4DTXA 4BDYA 4Z4GA 4IBNA 2G8IA 4ELUA 4FVMA 1Z00B 3TFSA 4RZRA 4FBTA 1DLOA 3KHRA 1ZQNA 1BCOA 4PHPA 5KFPA 4J9SA 1HNVA 4CIEA 4MEXA 5KG7A 3NTUA 4NM2A 2HVIA 4OPKA 4KLHA 1TKZA 3OJUA 4FK4A 3GIMA 4OKKA 1BQNA 1BPBA 2HHSA 1S1WA 2NRWA 3NH1A 4ECVA 5HRNA 9ICSA 5HROA 4J2EA 4AHTA 4Q45A 4I2PA 4J9MA 1U9LA 3MR3A 4ECTA 3PW5A 1HPZA 2FMSA 1SV5A 3OY9A 3OS0A 3HWTA 4F2SA 3ZCMA 1HMVA 3VQ9A 2G8HA 1IKXA 3VA3A 3RR8A 3DMJA 3Q8QB 2GBZA 2R7YA 4RG8A 4TUPA 3PR5B 5BOLA 2VG7A 5IINA 1NK7A 4M9HA 1C7YA 4FLZA 4DOCA 4Z4IA 4DQIA 3QEXA 1ZJMA 5FRMA 3KK3A 1NK6A 1JLGA 1ZETA 5J1EA 1ZQHA 1FKOA 4NYFA 1N5YA 2VWJA 1RTDA 4OPJA 1JN3A 4Z6CA 4QZIA 3H4DA 5HP1A 1LWFA 1UAXA 2RF2A 4YR2A 1L3UA 1C0TA 4NLKA 2ISPA 1BIZA 5KFOA 4I2BA 3U6FA 3P83D 4W5RA 4QZGA 1ZQBA 3LP3A 4RQ4A 4I2HA 4RQ1A 2QKKA 4KLDA 5CZ1A 1ZQCA 4CHPA 1QS4A 3V7JA 2DFFA 2BCQA 4ED6A 3NDKA 4KHQA 4KTWA 2VG6A 1KSPA 1D8LA 1NOZA 1C0UA 3ZSOA 1ZQRA 3MDCA 3NCIA 1BPYA 2YKMA 2ZTDA 3Q8SB 7ICLA 4KN4A 4M6WB 4M3YA 4C8NA 4QZBA 1B22A 2LYHA 5CHGA 3RB4A 5FRNA 2UVVA 2ZE2A 4DLGA 9ICKA 3DLBA 2W9CA 4E1MA 1ZQFA 4QZAA 5HP4A 4F5RA 2ASJA 4QWEA 4O3PA 3LAMA 5C5JA 3S9HA 4OKJA 1ZQAA 1ZQIA 4RQ5A 4I7FA 4CFDA 4LSNA 5KG0A 3JPTA 4LH5A 4CEAA 4XA5A 3RB6A 2IMWP 3AU6A 5IIOA 4O3NA 1AROP 5KT4A 9ICNA 3HX0A 1VSJA 2B6AA 2F1IA 9ICQA 3HPGA 3V9SA 9ICMA 4DSJA 3B0YA 4KHSA 1SZPA 4M3RA 3UPQA 4Z6EA 4UB4A 1RBUA 2W9BA 1RYRA 3SUOA 1QLNA 4GXIA 5J2HA 4I2EA 4CEOA 2AQ0A 4FM1A 4KHUA 1ZQQA 4IFYA 4QW9A 1JLFA 1JX4A 1WNSA 4CJLA 2PY5A 2ZTCA 4DQQA 1C6VA 3T3FA 5KT7A 4KHNA 3K57A 1YTUA 3RRHA 4FJ9A 4F4YA 2YNHA 4PWDA 3SZ2A 5DBBA 3C95A 3IRXA 4F5OA 1N56A 4CJSA 5J2FA 1XI1A 4CIGA 2BCVA 1S1TA 4GMJB 5J0WA 1S0NA 4TSXA 4YN4A 1ZQJA 4RQ0A 4N47A 4YR0A 3MBYA 2R8GA 4ID1A 5J2DA 1RBVA 3ITHA 4O4GA 5J2PA 3OHAA 2WOMA 5KFGA 1Y88A 3DRSA 3OYKA 4UBCA 3ISBA 1KFTA 3ALYA 2R8KA 3D0PA 4DEZA 1COOA 5DG8A 4ED7A 3JPQA 2BR0A 1X2IA 2FMQA 1SUQA 4KV8A 3OSPA 2JGUA 2UVRA 3QINA 5J2JA 3SJJA 3RMCA 4M3TA 1CZ9A 1FXXA 5DQIA 2YNFA 3GV5B 4AILC 2G8UA 2BPCA 3GQCA 2VG5A 5D46A 4CFAA 3HSTB 1RDBA 2XY6A 4KTQA 3SQ2A 3BQTA 3RAQA 2I1QA 3SI6A 3ZT2A 2ZJ8A 3NHGA 1UA1A 4DSKA 4ZHRA 3OYFA 1NKEA 4IDKA 2Z1GA 4ECZA 9ICXA 3MABA 4O3SA 2XGQA 3VQEA 1FK9A 4FJMA 4RT2A 4CK3A 3C1YA 3V6KA 4P2HA 4CJ3A 1MSWD 3RJGA 4YCXA 3A2FA 3G6XA 4O44A 2MUTA 5KFQA 4KLLA 1VSMA 3QIPA 3AA3A 4YNQA 4XQ8A 4UB1A 3PO4A 3O3HA 2I5JA 5EOZA 4KHYA 3KHHA 1WSJA 2JZBA 5KT5A 5DBAA 4DL6A 1ZQZA 4B9NA 2KW4A 4RNNA 1J9AA 1X9MA 2W9AA 4QZHA 4F5QA 1CXUA 1C1BA 4RPYA 3SV4A 3N97B 2BANA 3OYMA 3V9WA 3JPRA 1QTMA 1JLCA 3C2MA 4UAZA 3RH4A 1SL2A 2R8HA 2ZJAA 4CF0A 4M9GA 3NE6A 5J2AA 3HVTA 3N4MB 1DTTA 4CCHA 3T5LA 4ELVA 4DTSA 4TQSA 4J9RA 3QEWA 4E1NA 5KFNA 3ULDA 3QZ7A 2VWKA 5DG9A 2ZTEA 2ZD1A 4QZDA 2PFQA 3G10A 5D49A 2Q3SA 3IAYA 5L1KA 4KRFA 5CJ7A 4QZFA 1S97A 3RBEA 3C6UA 2P5OA 1S9FA 2ALZA 3DOKA 4FO6A 4MQ3A 5KFFA 4CJWA 4C8KA 5CA7A 4FLVA 3C6TA 1DGSA 4OVLA 2DFLA 2ISOA 3KTQA 3AVBA 3VQ5A 3IG1A 4AHVA 1GOCA 4Z0UA 4UB2A 2XY5A 5J0QA 1VRTA 4UB5A 3OYIA 5KFTA 4FBUA 4HUEA 1FKPA 4DFPA 4QZCA 5EWFA 3EZ5A 2YKNA 4M0AA 4O0IA 4B9UA 4CJRA 4KLFA 4NY8A 2PYJA 1SL1A 1RBRA 4FK0A 3AO1A 2OPPA 3GFKB 1WSFA 3L3UA 2G8VA 1L5UA 4LH4A 8ICTA 1VSIA 3WNEA 2M9NA 2XY7A 3ZT0A 4AHSA 1LW2A 5HMLA 5DDMA 4IG0A 3RJKA 1JL2A 3LDAA 3H8JA 4BGDA 3MFIA 4CERA 5L1LA 4RUCA 3KD1E 3V81A 4FLXA 2ITGA 5J2CA 2A1JB 2HVHA 3PMNA 4CJPA 4KLJA 1WAFA 1S77D 4YFKA 3GIKA 1RT3A 3T5HA 2EX3A 3I0SA 3OSNA 4C8MA 2Y1JA 3S3MA 4PHAA 2XO7A 3AO3A 2B5JA 4NCGA 3KK1A 1S76D 3K5NA 1SKSA 4J9LA 4QZEA 4DTUA 5JUMA 5KFXA 4E7IA 3UXNA 4KLIA 5C24A 5IILA 3C5GA 4KLQA 3VQDA 3KKSA 5L1JA 2F8SA 4YQWA 1BI4A 3TABA 1TL1A 2A1RA 2UVWA 1RT7A 3AVNA 4CGFA 4FJHA 4KLMA 3RJFA 3HO1A 2V4QA 4DOBA 4JRPA 5DB6A 4JS5A 4LY7A 5CZ2A 3AO5A 2C28A 3Q8RB 1WCNA 2B21A 3QNOA 4KI6A 3THVA 3RJHA 4YFUA 2W9MA 1PZNA 3MEGA 4LZGA 1IO2A 3FYHA 1GOAA 5HRRA 8ICXA 1NKBA 1LW0A 1ZQYA 5KG1A 2RKIA 5KG6A 4GC6A 2F8TA 4EBDA 3V6DA 3SUNA 3VQQA 4DSFA 4O9MA 1HQUA 4DO9A 3EPGA 3KLGA 3JSMA 4DL4A 3SNNA 2LSNA 1LV5A 1S6PA 3MFHA 1J54A 1TK0A 4YP3A 5KGWA 2GV9A 2P6UA 1KVCA 1F21A 4PY5A 5HRSA 1MU2A 2KQ2A 4EZ6A 3HM9A 7ICMA 3P5JA 4I2AA 4DL2A 3UXOA 5IIKA 4M9NA 3T19A 5DGAA 1UWBA 4YXMA 2HNZA 2JEGA 2H5XA 1SKWA 3WNFA 3BQ0A 4DSIA 5J2IA 4FLUA 3O3GA 4QAGA 4RW9A 1LAWA 4FXDA 3H4BA 4O3OA 3Q8MA 3QEIA 4KB0A 3ZDBA 2BPGA 9ICUA 4K4HA 4J2BA 3AA2A 5J0OA 1NOMA 1EX4A 4CK2A 3PW4A 2VA3A 2O4IA 4P4PA 4IQWA 3ZDEA 4PPXA 3NF7A 4F50A 1J5OA 3HVRA 3KIOA 1JXBA 3OYNA 4KLOA 4LSLA 2C2RA 3NAEA 2E6MA 7ICFA 9ICIA 3V9XA 3V9UA 4RT3A 2BPFA 3DLRA 5TZVA 3PV8A 4J9QA 2FLNA 4CGGA 4NCAA 4KLEA 4RNMA 3GDXA 3AA4A 5J29A 2Z1HA 4BE2A 5IIMA 5HNKA 1RT4A 3L8BA 4DTNA 9ICAA 3V4IA 4FLYA 3MECA 3DLGA 4CHNA 3T5KA 1ZBHA 4NXZA 4F5NA 1L3SA 3K75D 3SQ1A 5KFKA 2PFNA 4NCBA 1SKRA 4I2CA 1C1CA 4CF9A 2RDJA 1RT2A 4CJVA 1ZQVA 1UA0A 1RTJA 4R65A 3HXMA 2AGOA 4DLEA 4F4KA 1QSSA 4RW8A 4F91B 1B43A 3LANA 3AUOA 4KN7A 5DG7A 4HVJA 4E7LA 5SZTA 3ZSQA 7ICOA 3AVKA 3AO4A 1BGXT 3RTVA 4DQSA 2VA8A 4E7HA 1NJZA 2IA6A 3RB0A 2AU0A 4DOAA 3RAXA 3BDPA 4ICLA 3OYAA 4CHZA 1VRUA 3H8WA 2V9WA 5KFIA 1N48A 4DWIA 3MEEA 1CZBA 4BWMA 3OJSA 4FLWA 4TUSA 3QEBZ 5KFSA 4DFMA 1Q9XA 4F4WA 4NLZA 3LK9A 4CEBA 1EXQA 2D0CA 3RMAA 3V1RA 1HUOA 1IKYA 4M41A 4QCLA 5CWRA 1KFSA 1S1UA 3C2LA 3MDAA 1T7PA 5HLFA 8ICJA 4N5SA 1KTQA 3HPHA 4M45A 3GIIA 3T1AA 1VSLA 2W9CB 3V7KA 8ICVA 1S0MA 3ZSYA 5KT3A 5KG3A 4YMMA 3TAQA 3QNNA 2JEIA 3KHLA 2P51A 2FBYA 4KMUA 4ED1A 1S0VA 2OPRA 3NF8A 3QLHA 3LZJA 4CGJA 1WSGA 1KFDA 1XC9A 1KLNA 3L2WA 4M6WA 4EP4A 3TI0A 4FJGA 4Z6FA 5KFRA 5KFVA 1I3AA 3NF6A 3L3VA 3JPSA 3B6PA 1TFRA 2BDPA 3V1QA 4GXKA 5KT2A 4YD1A 2PFPA 3UIQA 1B92A 2V4RA 3HL8A 5DB7A 2NRXA 2BCRA 2YNGA 2W9BB 1LB2B 3I0RA 1CEZA 5EWGA 1TK8A 2I9GA 9ICVA 3K5LA 4CEEA 3K5OA 1RDCA 4Y1DA 1L3VA 1A77A 1V9PA 1TV9A 2D0BA 2DFHA 1RZTA 1QSYA 3JPNA 5HRPA 4LVSA 3OYLA 2DPJA 2Z1JA 1S1XA 3PR4A 4B08A 2FPKA 4JS4A 3ZT3A 9ICEA 4IFVA 3VQBA 5DMRA 1C0MA 3ISNC 2BKEA 4ED3A 3H7IA 4ED0A 4KHWA 4KAZA 1QHTA 3OYGA 4N76A 2HNDA 4K8XA 3V6HA 3RH6A 2G8KA 2KN7A 3ZDCA 4CF8A 4M2YA 1VSKA 4KI4A 1A76A 4YD2A 4F8RA 4TQRA 4J2AA 3M9NB 4KLUA 3KJVA 4FJXA 1EXNA 3K59A 8ICOA 2YV0X 3OYBA 5KFJA 3AVGA 3SUQA 4LD0A 4FZYA 3SYZA 1L3TA 4Z4FA 4E0DA 4F92B 3V72A 4PQUA 2EHGA 3HP9A 2PXIA 3EW9A 1CXQA 2VANA 2F1HA 4FW1A 4CK1A 1UT8A 1BIUA 3SV3A 3AO2A 1ZQTA 4FCYA 2F1JA 3OHBA 5DLFA 7ICHA 4Q44A 8ICIA 3KLEA 1YVUA 1LWCA 4DTJA 4I2DA 2KFZA 3DLKA 5KFLA 2GUIA 1NK5A 3F73A 1ZBIA 4B9TA 2AGPA 5IIJA 4CEQA 4UB3A 3GV7B 2KFNA 4M04A 3BGRA 4OJRA 3ZDAA 3E2EA 1KVAA 2R8JA 1DOQA 1D5AA 5CR0A 3VQPA 4DSEA 3V7LA 2X6NA 3CG7A 5J0RA 2NRTA 4CJ5A 3QETA 4UAYA 3PW0A 2MUTB 4XUSA 4ELTA 3VA0A 2FBXA 3DLEA 4Z4CA 8ICRA 4O55A 2IBKA 2X6SA 1K6YA 4J9KA 1RILA 4CEZA 1BVSA 3MR5A 8ICNA 3OVNA 2J6UA 4BE1A 2JZBB 3L2VA 1RT1A 3AVMA 2YHBA 3VQAA 4M9JA 4I9LA 3K5MA 4YXJA 1IM4A 4AH9A 5KGXA 4R66A 8ICEA 3QEAZ 3PNCA 7ICIA 3HJFA 3RJEA 4BACA 3AVCA 2C2EA 4BDPA 1JMSA 1BPEA 5J2EA 1Q9YA 1JXLA 2E6LA 4B9MA 4FJKA 3MGHA 4ECYA 4ED8A 2B4JA 4FJ7A 4ZH4A 2D0AA 9ICLA 1KCFA 1O1WA 1REVA 4BDZA 4I2JA 4LZDA 1ZBFA 4PA1A 3PO5A 1U47A 1NK9A 3BQ1A 2QXFA 1WSIA 8ICGA 4EEYA 4QZ9A 3E01A 3LALA 3RJIA 4CHOA 5C42A 4DF4A 5DDYA 3HPOA 4O3QA 1SL0A 1HJRA 4J9OA 5SWMA 2PI5A 4CFCA 2QK9A 5DQHA 3GILA 2JEJA 4I2FA 1IG9A 5BPCA 1Z25A 4CJKA 4H4MA 7ICQA 3OYJA 4KLSA 4DL7A 4MFBA 2PZSA 3M8QA 4R8UB 3S3NA 2J6TA 4I9QA 2OPSA 8ICHA 2XC9A 4H4OA 3MR2A 4RQ6A 1HUZA 3C23A 1QE1A 4EZ9A 5KFYA 3BJYA 4NYNA 4KLGA 3ZSZA 4OKEA 4KITB 4DSLA 3DRPA 4MF8A 3G6YA 3OS1A 2Y1IA 3VQ8A 5D3GA 3JPPA 4JUZA 4JLHA 2FLPA 4NLGA 1WSHA 3U3GA 5C25A 2RDIA 4MFAA 3NGIA 2MAXA 5F9LA 2XCAA 3Q8PB 2HNYA 4DU3A 5HBMA 4ZTJA 4O3RA 2FBTA 3NF9A 1A5WA 2PI4A 1X1PA 4IKFA 4P4OA 5J0XA 3TANA 3VQCA 3ZSRA 4CE9A 1ZQUA 4FS2A 1ZQSA 3G0ZA 5DGBA 4MFCA 2BE2A 3C21A 1ZQMA 4CF2A 2XY8A 3CM5A 3AVLA 4DQPA 2KZZA 3KLIA 4GW6A 1XS9D 3DOLA 4BXOA 5CP2A 9ICTA 1ZBUA 3RMDA 1BI4B 4JV1A 1KLMA 1T03A 5HHIA 1WAJA 3L2RA 4FZZA 3MEDA 3AV9A 7ICUA 4FW2A 2AGQA 1MQ3A 1A5XA 3MXMA 1ITGA 4B8AB 4DTOA 1ZQWA 3OYDA 3F9KA 2OA8A 2ETJA 1HRHA 4YG2A 2C22A 4AHRA 1ZQKA 1TAUA 4DTRA 1D9FA 1B9DA 9ICHA 4JWNA 1U45A 5DB9A 3P1GA 4EYHB 2HHVA 2ZUBA 4B3OA 4EBCA 1XHZA 2P66A 1QSLA 3LDSA 3ORYA 2NUBA 1Q8IA 3H8SA 3NH0A 4JK1A 4UBBA 1RXWA 3CYMA 3HYFA 3QIOA 4Z4HA 5CY4A 1MQ2A 1XU4A 8ICUA 3M8RA 1ZJNA 3IS9A 3LPTA 3AVJA 3QO9A 2C2DA 4IR9A 2XRIA 3PMLA 2ZUDA 1U4BA 5T7BA 2OYQA 1NK4A 4F2RA 2QKBA 3NBPA 4ED2A 8ICKA 1WSEA 2IGIA 4CEFA 4M3WA 1JIHA 1TKXA 2VA2A 3SPYA 5KFCA 7ICRA 3NGYA 4RPXA 1EETA 1ZQGA 4KB1A 1ASUA 3HP6A 4FS1A 4HHTA 4HCBA 4TURA 1WCLA 2JEFA 2RPIA 1RBSA 1H38A 3TFRA 9ICBA 4W5TA 4CJQA 2R8IA 2HHXA 1W9HA 3ZD9A 2FPMA 1RBTA 3ZT1A 1D8YA 4IRKA 3EYZA 8ICMA 4PH5A 3TAEA 3MXIA 7ICPA 3DM2A 2PFOA 3K4GA 1KRPA 4KREA 4FJLA 3B0XA 3C1ZA 1IH7A 4DS4A 2DFEA 4M42A 4QWDA 2ZQBA 1K1QA 1YT3A 1RDAA 2KZ3A 1BCMA 1Z00A 3CFPA 4IRDA 5J0PA 4DS5A 4O5BA 4B8CA 4QW8A 1KEJA 5KFZA 4RQ8A 4NLNA 4CGIA 3RBDA 3KLFA 3TWHA 3ISDA 1ZQEA 4ECSA 3OYHA 3EPIA 3RWUA 4QWCA 1TVAA 9ICGA 1VSHA 4RW4A 4GXJA 4CESA 3SQ0A 1NK8A 3OS2A 4F4XA 4B9LA 4XIUA 1TAQA 5KG4A 3M8PA 5KI6A 2AJQA 1IKWA 4Q5VA 4FJIA 1IKVA 2D5RA 1JL1A 1LAVA 4KKOA 3QESA 1ZQDA 4CJUA 4F93B 4E89A 1X9WA 4KLTA 4OLAA 4M3ZA 1TK5A 3RRGA 7ICGA 9ICOA 3DI6A 1UT5A 3SUPA 3AU2A 4G1QA 1VK0A 5KFBA 4F3OA 3PX4A 4RPZA 5HHHA 4UQGA 2HB5A 3KD5E 1NJXA 3GV8B 5FROA 8ICQA 1LWEA 2O4GA 1XHXA 1ASWA 1WLJA 1BPZA 8ICCA 1A5VA 3DRRA 3PX6A 9ICRA 3QZ8A 4TUQA 1TKDA 2HMIA 1RTIA 1T05A 1HYZA 3I8DA 3EY1A 4RQ2A 4I29A 1VSFA 4B9VA 3ZSVA 2GWSA 8ICLA 2FPLA 2XCPA 3B6OA 3JPOA 2BQ3A 1S9EA 4O0JA 3NGZA 2P1JA 4DU4A 2W8LA 5D4BA 1I39A 3ZSXA 3V9ZA 3BQ2A 3LPUA 4K4IA 1G15A 5DQGA 4B9SA 1S6QA 3O4NA 5J2GA 1T3NA 4I28A 1GOBA 4GVMA 3SPZA 4PUOA 1TV6A 5J2NA 1NJWA 3PW2A 1JKHA 3PX0A 2KZMA 2F96A 4CECA 4Q43A 5F9NA 4E19A 4GLXA 4HUFA 8ICWA 4K8ZA 2ATQA 8ICPA 1EKEA 4QWAA 4IQVA 2Q0ZX 3SQ4A 2BQRA 5KFMA 1UOCA 9ICFA 4DFKA 2HW3A 4FLTA 3OYCA 4RQ3A 8ICAA 3VQ7A 4YVZA 4QOZB 3TR8A 4ECUA 3WNGA 3CFRA 5DKWA 3WNHA 4P4MA 4M9LA 5DLGA 5KFHA 4HTUA 4FJNA 3D45A 5CYQA 3EWAA 4Z4EA 4H8KA 3UQ0A 4FM0A 4EP5A 3PVXA 2OZMA 4R63A 3LWMA 3OGUA 2OWOA 7ICSA 4X5VA 4ID5A 1D9DA 3QERA 4PHEA 1RCHA 4CJ4A 1RTHA 4YMNA 4PGQA 2X78A 1S0OA 4RW6A 2FBVA 4CJTA 1BPXA 4BWJA 3S3OA 2G8WA 4IRCA 3MXJA 1JLEA 4W5OA 2HHWA 4FJ5A 4I2IA 1XO1A 7ICEA 7ICKA 2IHNA 3KHGA 8ICSA 4F5PA 4ECWA 2A1SA 1ZQPA 5KT6A 4OGCA 1ZBLA 1HNIA 4OLBA 4E7JA 1Z26A 1ZQLA 2IOCA 4EYIB 1ZYQA 3JYTA 4Q8FA 4JRQA 3H08A 2Z1IA 2BCUA 1VSEA 4ZTFA 3M8SA 4CFBA 5J0SA 2HHUA 3LZIA 4MFFA 4M3XA 4CGDA 2ZUCA 8ICZA 3AVAA 3UQ2A 5HMMA 3MAQA 3MR6A 5KRSA 2E4LA 3OYEA 4K4GA 5EWEA 2NRZA 4CJEA 2IC3A 5DK5A 3KLHA 1RDDA 3TAGA 5FDLA 2AQ4A 3H40A 4G3IA 4Z6DA 2DY4A 1MC8A 3AVHA 5JS1A 2OZSA 3G6VA 1ASVA 4CF1A 1NK0A 5CYMA 2DPIA 1T8EA 1X9SA 1S9GA 7ICTA 5KG2A 3NGDA 2P6RA 4C8LA
chains in the Genus database with same CATH superfamily
2MZTA 1J53A 3P5TL 5L38A 4DL3A 2ZJ5A 4AP9A 3IA0A 5J0UA 4EK2A 2BCSA 1DK2A 4DFJA 3DLEB 4QZ8A 2A18A 2LQ5A 1NHUA 3NAIA 3L4IA 1JXEA 1B9FA 4IC9A 5F0WA 2V63A 2HZVA 3QE9Y 2YBVA 1HW8A 1UCNA 3LWLA 4JV2A 4O5EA 4Y1CA 1BISA 4A4JA 4F3TA 2RN2A 2KKPA 2RJZA 3HHLB 3TAPA 3LAKA 4RUAA 4FJJA 5D0GA 2BQUA 3C94A 1MN7A 2B56A 1RPLA 5KFUA 3F2BA 4RWWA 3D3BJ 4AHCA 1HQEA 3QATA 4QIVA 2EW9A 3S6EA 2C3MA 2PA8D 1Y4ZB 5KRTA 1HNWK 2RLTA 4M94A 3DOKB 5C42B 5I42A 5IV3A 3MUMP 4GC7A 2W25A 2HQGA 4LQ3A 9ICJA 5CABA 2BMBA 2CIMA 4ATNA 2GLEA 2KXFA 1UP1A 2EAPA 1WKLA 1SCJB 4KTZA 1ZQOA 2M70A 4Y34A 2QA2A 4RU9A 5A8WA 4WFXA 3DYAA 3QEVA 3TPQA 3TA0A 4H4MB 5LSOA 3DCAA 3M8QB 4HCCA 3FVYA 4ZITA 1Y97A 4DL5A 5H9FJ 3PRVA 1QQCA 2W42A 4WFAQ 3K58A 1VHFA 4C8YA 1XC3A 1QE1B 2HHHJ 1XR6A 3D2EA 4C48A 1XNQF 4NXNF 3ONQA 2IAJA 1LW2B 2G2ZA 1YBUA 3WK4A 3ZC4A 3A4TA 2CPEA 4NLTA 4J9PA 1WDTA 1HYVA 4QYZK 2DHGA 5HBMB 3QEPA 3FCVA 5IZHA 4PYDA 1JLBA 4NZ7A 4KPYA 4IR1A 3CE8A 3W61A 2UXBK 2P5GA 4R5PA 3VAIA 5AQLA 2BE2B 3ET6B 2D9PA 2KN4A 2X1GA 5EU7A 3IXQA 4JN4A 3TEHB 3FZKA 2ABYA 5AKXA 4U67Q 2QA4N 2Q6CA 4XDCA 3CFOA 4JYAF 2E1RA 5DJBA 3EEQA 3ED5A 4LF7J 4OJHA 1B7YB 3LP2A 2W7OA 4H5TA 2NPIA 5AFUH 1WUDA 4K0KJ 2BACA 3V1OA 1KVKA 2QO3A 4AD6A 2XGPA 1Y7PA 3QBXA 2ASLA 2V4JA 2LEPA 1NSQA 2MKHA 4GVLA 5KFEA 4F0KA 4USVA 4YOUA 3THXA 1WYGA 5KFDA 4CF4A 1UZDA 4MF2A 3L2UA 2DNKA 1ZD5A 4PGXA 2H5JB 8AT1B 2DTUA 2B4OA 5ALJA 3KKRA 2W8KA 2CPRA 3WXLA 4DX8H 2FJVA 2Y8YA 4CIFA 4CGHA 2HHQA 1HYSA 4E7KA 8ICBA 2KM8C 2YPZA 4WZMA 5D4OA 3R27A 2QARA 1NJYA 2HFVA 1T9VA 1ZZNA 1UPMB 4AL5A 3UB5A 1JJHA 1CJTA 3LW5C 3VETA 2RRAA 1V3ZA 1NZBA 3IFEA 3O4QA 3HRGA 4X64J 4HDHA 1VBKA 5M1KA 1VQ7N 3HD2A 4ZPBA 4Y2VA 1VQOS 5BN9A 4KFBA 4G9ZA 5CB1A 1W0HA 3E0FA 2WBRA 1APSA 3G6EN 3PY8A 1TVRA 2ILYA 2FVRA 3KNGA 4Y2IA 3BR8A 3C5FA 3RB3A 4Q0BA 5AQGA 3NFAA 4ZPAA 5GMKa 1OJ4A 1YITN 4C8OA 5L1IA 5KTQA 4HUGA 2HHHF 2W41A 2UV8G 2QN6B 4CHYA 3KJFB 2KTQA 1D8BA 3PG9A 1RWXB 3ZT4A 2K3IA 3BZCA 4C1NK 2UXDK 3RU0A 3AL0B 4DTXA 4IBNA 2KYZA 1AUSL 4FVMA 1R6YA 2WAQF 4QOTA 1DLOA 4CIEA 1PK1A 3ILOA 4CF3A 3NTUA 2Q6BA 2HVIA 4K42A 2WF9A 3OJUA 4FK4A 1KKHA 4OKKA 3AAQA 2CQCA 2KHQA 3DLGB 5K8MA 4ECVA 5HRNA 5B0FA 5DM7Q 9ICSA 1MA7A 3D6JA 5AQFA 1VGYA 4LF7F 4AHTA 4HL9A 1VQ5N 2HF4A 1HD1A 2K89A 4DI6A 2DR7A 4K0KF 4I2PA 1U9LA 3PW5A 2XEXA 3OY9A 1IKWB 1IKVB 1FJ7A 3J7YI 4C3MA 2GS8A 3UN2A 4DCOB 5F3XB 4B1ZA 2QM1A 3PR5B 5AKLA 2DRBA 1HQ2A 2P9NB 2W2NP 1K9MO 5J8YA 2DIVA 4Z4IA 2KT5A 4DQIA 3QEXA 2G08A 1Q95G 3KK3A 1JLGA 1RQLA 2E1YA 1NNLA 1FKOA 3NNAA 2Q31A 5BN8A 3FKBA 5DM6L 3C15A 4LF4F 1VJQA 4DCJB 2U2FA 1N5YA 2KJVA 3RW7A 4Z6CA 4UT4A 2B7CB 1GLLO 1LWFA 2RF2A 4QNLA 1WTBA 3D54A 5C2DA 1L3UA 2PGCA 4A8KA 3QFUA 1NI3A 2H3GX 3EN9A 2YQEA 1OVQA 1WDDA 4I2BA 4K5SA 2WZ1A 3HRDD 4OPAA 4JI3J 4CZCA 3EO3A 2FVSA 5MLCQ 1IWAA 1ZQBA 1FX2A 4X64F 4I2HA 4RQ1A 1F5BA 3EMTA 4KLDA 1X4AA 2ZKTA 1VC5A 4CHPA 2ZIUA 2ZH7A 4KRWA 4W98A 1PYSB 2LMIA 1KSPA 4TU7A 1C0UA 4WF9Q 3ZFVA 3DDIA 1KP6A 3NCIA 3M30A 5KQ8A 1BPYA 2YKMA 2F3NA 2ZTDA 7ICLA 2EC2A 5AQUA 2UVVA 4NLQA 2ZE2A 3LH2S 1H74A 3W5YA 3CCRS 4E1MA 1ZQFA 2XYPB 5HP4A 4PXEA 4I68A 4A46A 1ZH5A 2VYPA 3W9HA 4QWEA 2QFJA 3S9HA 2I6WA 3VCBA 1VQKS 3PLAA 2OELA 1ZQIA 4I7FA 5KG0A 3A3NB 1RAOA 1OH6A 1CULB 1MNEA 1SQEA 5CYQB 4J5OA 3AU6A 5IIOA 4O3NA 4ENOA 5GVQA 4OYBA 5KT4A 4MLEA 3HX0A 2IJNA 1BDGA 2ZFHA 4ZVRB 3QICA 4L76A 2B6AA 2NNWA 4H0PA 4OJ3A 2GWJA 1VK3A 1IBMJ 3B0YA 5JLFA 1SZPA 1SWVA 2XS5A 1RAIB 3UPQA 3THPA 4UB4A 1QZ6A 1UVNA 2I1RA 2DNYA 2M9KA 1QLNA 4GXIA 5J2HA 3UKUB 4IFVB 4CEOA 3QAUA 1LCUA 2J76E 4KAIA 2IVPA 4KHUA 5KPTA 1ZQQA 2RIJA 3NGRA 3P49B 4B3MJ 4KHNA 3K57A 1YTUA 2E66A 1NB2A 5A8RB 4F4YA 1F9EB 2BW7A 3HCXA 4FPBA 2GJ2A 3C95A 4CIGA 1U1RA 1HI0P 1RM6C 1S1TA 2PMWA 2EFVA 3GZ7A 5E79U 2FQQB 3MN9A 2LHTA 5FPDA 2NYIA 2VODA 4ZN3A 2LXIA 4N47A 3MBYA 2R8GA 4JKGB 1Y10A 3L7OA 4ID1A 2FVPA 1RA6A 4O4GA 3HM8A 4MAKA 3OHAA 3IRUA 5A76A 3WQTA 4MJKA 4OFZA 4UBCA 3ISBA 1O51A 4B17A 4DR7K 2R8KA 3KWIA 4ZIVA 2MHEA 3MURP 3IBCB 2DF4B 2G0CA 2BR0A 1X2IA 2FMQA 1FFWB 1SUQA 4C2MA 4KV8A 2KIWA 1GLDG 5I3PA 3QINA 4JI3F 3CP8A 3IWNC 2P8IA 3GV5B 3UDVA 2G8UA 1WC5A 1BQXA 2VG5A 1CJKB 1UFWA 2CG8A 4H03B 2HOQA 1NGEA 4KTQA 2E9RX 1AZSA 4ZHRA 1NKEA 4IDKA 1P1TA 3MABA 5AQYA 4QIFA 4O3SA 2CA9A 3HJEA 3VQEA 5E3QA 2NUUG 4P2HA 4KC5A 3QT8A 4UY85 4IH6A 3RJGA 2FJEB 2ZH3A 4YCXA 1PILA 1AA1B 1XERA 4XQ8A 4UB1A 1Y3KA 1ZD3A 5JVHQ 2I5JA 4KHYA 2XSFA 2VICA 5KT5A 2L5YA 2Y0SF 1HQEB 1Y5NB 1U1QA 4OYPA 1BE4A 1J9AA 2W6LA 1XMQK 1FJGK 1WUAA 3EM1A 4F5QA 4QBUA 3N97B 1EQ0A 2BANA 1IBMF 3JPRA 1QTMA 5I42B 1JLCA 4Z37A 1SZHA 3C2MA 1SL2A 2R8HA 1YXQA 4DV4K 1EARA 4RU2A 4WU2A 3AB4B 4EGLA 5LMUK 4BHQA 4XEIA 4TQSA 4J9RA 4E98A 4E1NA 3ULDA 5I4MA 3R7SB 3GE9A 4HWIA 4FWLA 5BPNA 4C8ZA 5KAKA 1K44A 5A8WB 3DYAB 4F7VA 1S97A 2ALZA 1D8ZA 3F5AA 3R5BA 4UASA 4MQ3A 4J9VA 4CJWA 3CTRA 1YKWA 4B3MF 4FLVA 3SQGA 3H3OB 2DFLA 4OQJA 2ZXHA 3O8MA 3NY0A 2ZM6K 3CJ5A 3C7NA 1H73A 4AHVA 1B99A 1K8AT 3RBZA 2N7YA 3OYIA 4JI0J 4LRAA 3D2EB 1FKPA 4DFPA 2IAJB 1T94A 2LQBA 2AZ1A 4M0AA 2BW2A 2HFOA 2QB1A 4HTJA 2Q43A 1IR0A 4FK0A 2HNYB 4Y65A 3L3UA 4X4UA 1JLBB 1L5UA 8ICTA 2WMMA 2C42A 2M9NA 3AFGA 2BJEA 4R5PB 1XNSA 3DDHA 4OHYA 3VEWA 1JL2A 1O5JA 3LDAA 2CADA 3MM8A 4RUCA 2AJ1A 3CJQA 4OHWA 3KD1E 1OSCA 4FLXA 1RHMB 2C2OB 2ITGA 2FSNA 3GG4A 3HZ6A 1G7CB 4RQNA 4BROA 3LP2B 3M2VA 4ZK7M 1NGBA 3WHIA 5ALVA 5ETKA 2HBMA 4CE6A 4PHAA 2XO7A 3AO3A 3B8AX 4NCGA 4ZMMA 1SKSA 3H2VE 1TQLA 1WC6A 1HNXJ 2V4JB 4PL7A 3WXMB 5KFXA 5MLCV 4MK9A 4V19J 4KLQA 3P4UB 3KKSA 3J7A1 5L1JA 3T1HJ 3TABA 3IKMA 1TL1A 1RT7A 2X3GA 3THXB 2GHWA 2BA9A 2RS2A 4HH0A 3EWGA 2FZGB 3RJFA 2KT2A 4EO6A 3TO8A 3C28A 4CZIA 1VDVA 4IXCA 4JS5A 1N60A 3N6NA 5CZ2A 1FFGB 1HYSB 1VQ8N 4IOAQ 1BWFO 3QNOA 3RJHA 4OYMA 3PJXA 3FZLA 4JI6K 3A0BU 1PZNA 2QARB 3A5MC 5HRRA 1YAGA 8ICXA 2YX4A 3TSUA 1CJTB 2RKIA 5KG6A 1F3FA 2KV2A 4GC6A 1FDBA 2E8OA 4EBDA 3FSIA 2PFUA 3JTNA 3TX0A 1DARA 5HOOA 2G07A 1BWVA 1N36J 3F2DA 2JSXA 3EPGA 1HKBA 3JSMA 3F5TA 3ZTOA 4BRQA 4KFBB 1LV5A 3GG0A 2OEKA 1UFLA 4YP3A 1TVRB 4QIGA 2U1AA 1NLKL 2R7UA 4Q0BB 2KQ2A 4OYOA 3P5JA 4JI0F 1NDPA 4KX3A 4M9NA 3DRYA 3M8ZA 1LWXA 5DO2A 1UWBA 1QAJA 2E7WA 2H5XA 1IIPA 3WNFA 4GO7X 3S6JA 3O80A 4FLUA 1S6OA 2DGVA 2MEWA 1AXQA 2W2MP 2KIVA 1TTHB 1LAWA 4GNIA 4OJ1A 2YTCA 1UEVA 3DN9A 3ENVA 3QEIA 3BGFA 3N4PA 1DLOB 1UJ4A 1EX4A 1HD0A 2O4IA 1PK1B 3VV2B 4IQWA 1YJUA 2WAQC 3ZDEA 2W7AA 3F0NA 3NF7A 2X1AA 2MU2A 1L6NA 1Y5IB 3E3XA 3S1TA 3HVRA 2VF3A 3EVMA 3KIOA 1HPMA 1JXBA 3OYNA 3HSCA 2O8FA 2C2RA 3FK4A 3V9XA 1HWLA 3V9UA 4RT3A 4J9QA 2MY8A 4I2PB 4JK8A 3A3OB 3AA4A 1F60B 2Z1HA 2LYBA 1HNXF 3CCES 5HNKA 1RAJA 1XUPO 4NA3A 3O9TA 4MKBA 2APOA 3T1HF 3WK6A 3NS1A 3U9DA 4F5NA 1L3SA 3NUQA 1S6UA 5B66U 2PFNA 4I2CA 2H48B 4CF9A 2FVQA 1DZ5A 1RT2A 4FWQA 3AQEA 2AHOB 2F3JA 3HXMA 3KK3B 4F4KA 2IRXA 1JLGB 2YMLA 1NU0A 3PJ9A 1FKOB 4F91B 2CJXB 5L46A 4QS7A 2F8LA 3C15B 4K43A 2E1MC 1N5YB 1WHVA 5DG7A 1LWFB 3J80O 4E7LA 2K60A 4D3HA 2F44A 1GMVA 4EMDA 2BUNA 2ASOA 4AL6A 2LM1A 2EG1A 5EX3A 3FQKA 1YRXA 3FNNA 2VA8A 1S48A 3WKAA 2AU0A 2M2BA 3RAXA 4QZVB 1N36F 4RBTA 3R9KA 1F1BB 2DB1A 3OHRA 1RWVB 1EAYC 3PYGA 2GV1A 2YH0A 3KG4A 4DWIA 2ZIUB 4UARA 4BCAA 1VQ6S 4IUFA 4XK8C 4LF8K 2D0CA 3RMAA 1C0UB 5GAEI 2CWXA 2ROPA 3OUYA 1T7PA 2YKMB 5D4NA 1RGIA 4NX9A 2DNRA 3GJRB 3MCMA 1RCXB 3MMBA 1GH8A 4M45A 2LM4A 5M1NA 2ZE2B 3T1AA 1VSLA 2I7NA 3LF0A 1IM6A 1S0MA 1B0XA 2YMQA 5KT3A 5KG3A 2AMCB 2VFUA 2JEIA 3KMSA 3KHLA 3CJ2A 2DNNA 1V4SA 4YB1P 2OUGA 4EEKA 1WSGA 1KFDA 4I7FB 1KLNA 3W1YC 4BUGA 4CLYA 1S4FA 1UETA 3EZUA 3NVVA 5KFVA 1I3AA 1Z1ZA 5CCLA 5CCMA 3EVOA 1FW6A 4FVUA 4CLTA 4C4WA 2BDPA 3V1QA 4GXKA 1X3MA 4XPEA 3TEGA 3P8BB 1VQ4S 2V4RA 2NRXA 2BCRA 1NPPA 2YNGA 3DLJA 2V94A 2KOBA 2AA4A 4MDAA 2DVIA 1CEZA 1TK8A 4OX9J 9ICVA 2CYYA 3RF9A 4FYVB 3NCQA 1WUUA 5BXIA 4IH7A 2ZH9A 4Y1DA 3D6MB 2KMDA 3VAGA 1V9PA 5GMDA 2ZNZA 3S8SA 5AKIA 3OYLA 2DPJA 1S1XA 3PR4A 2YTUA 4KHPK 2LU1A 2E5JA 3ZT3A 3CEDA 4F36A 1DRZA 2ZBRA 1C0MA 2HI0A 1ZBTA 4ED0A 4UW9A 2HNDA 1CRXA 4FF4A 3MCAB 2KN7A 4CF8A 1MWQA 4XH1A 3QAEA 4TQRA 3M9NB 1KVJA 4O4GB 3BR9A 3VAKA 1M1GA 4FJXA 2LU2A 1U0HA 4Y2TA 2YKAA 4LD0A 4FZYA 4Z4FA 1L3TA 2EFNA 4F92B 3E8OA 3HULA 1RADB 3BO4A 2G4BA 3HP9A 2WAQD 3O3LA 1CXQA 1SUQB 4KV8B 1U6ZA 3VF6A 3TA2A 4CK1A 4OYIA 4OI0A 2VBYA 3AO2A 2F1JA 5GIPA 2VG5B 3SDEA 1NSKL 3ENHA 2JWLA 2KFZA 3VF0B 4EUVA 2EK6A 4OV1A 1AZSB 2RU9A 3R5AA 4ZHRB 3CD6N 2LKYA 2OGUA 4IDKB 4UB3A 2KFNA 4OJRA 4O23A 3E2EA 1TP7A 4JEPA 5CR0A 2AV5A 5ETTA 3OLAA 5ALFA 2EFQA 4YEAA 2OXOA 4FWNA 4PL1A 1RSCA 3PW0A 2I9SA 1I3OB 4MH8A 1ZRMA 3D2QA 5AKYA 1RK8A 1BVSA 3WC0A 8ICNA 2WSCC 2I5JB 2J6UA 3FC4A 5BR8J 3SMVA 4P0QA 1DGKN 2ZZTA 3L2VA 1RT1A 3OBYA 4EU0A 2Y0SC 1DBDA 4AH9A 3MCPA 3QEAZ 3PNCA 2O01C 2BANB 3CJ9A 3MPDA 1JLCB 1LEOA 2ZDOA 3MC1A 2C2EA 3CXCM 5HQ8A 2PA3A 4BDPA 5G5HA 1M5HA 5J2QB 5J2EA 1BPEA 4C7ZA 1LQ9A 2A19A 4ECYA 2ZOFA 1JRPA 4L3QA 3BH6B 1KCFA 4OX9F 2VJUA 2IIRA 2BZFA 5DM6Q 3UDCA 1MWMA 5BRFA 1PVRA 4CHOA 4DF4A 2HAFA 3HPOA 4FZNA 3CMAS 3M2RA 3WUHA 2AWZA 3C7NB 1H3DA 4NLWA 2V2QA 1HNWJ 3VCDA 4DR4K 4I2FA 3CCWA 3K8WA 3Q7BA 3FEYB 1NMDA 3OYJA 1PG5B 4KLSA 4DL7A 5T7LA 1SZ2A 3D2WA 1FE0A 2VJVA 3RSEA 5AK3A 4YB6A 2J6TA 1QVGM 1RAAB 8ICHA 4KGMA 4YN3B 1RP5A 1VQSA 2XC9A 4H4OA 3MR2A 1RBAA 1HUZA 4ZVFA 5KFYA 3ULHA 4K4SA 3SXLA 4KITB 4MF8A 3UDEA 5BPMA 5ETOA 2H5EA 2E20A 4YDUC 1H98A 5D3GA 3MM8B 2L41A 3JPPA 4JUZA 3UDLA 2FLPA 4NLGA 2PC6A 1WSHA 3U3GA 2GAGC 3NGIA 5F9LA 2L9DA 2CFXA 4DU3A 1U1PA 4A48A 2FBTA 3NF9A 3M2UA 2PI4A 4W90B 5A6WA 1YUWA 3HLUA 3EGVA 1JQGA 1XEZA 3SCKE 5J0XA 1HBMA 4QYZJ 4CE9A 4NCGB 1ZQMA 4LFAK 2XY8A 2B9WA 2F77X 5CXTA 2KZZA 3KLIA 2UXBJ 2QI2A 3IMQJ 5JMVA 2XYGB 3DOLA 2X1BA 9ICTA 3RYLA 4DCPB 1TL1B 3G96A 1RT7B 1KLMA 2MKIA 5LL6Z 1R89A 1T03A 1Q86T 1TUWA 1URJA 1KR4A 3TTDA 2G0IA 3SEIA 5AZIB 4JI5F 2K4HA 3IDWA 4FZMA 4DTOA 3EE9A 3O5BA 3IN5A 2DNZA 4ER8A 4MK8A 4ILJA 1M5SA 4ERDA 2GQCA 2BJ9A 1FXLA 4K7QA 3SSQA 3O1WA 5IC6B 2HQFA 4M5JA 4AYBD 2W3SA 4JWNA 1U45A 4DCHA 1UKUA 1SGGA 2ZUGA 1XMOK 5JRTA 4EYHB 2BJ8A 3WC2A 2HHVA 5D6GA 4NEZA 1PC5A 4EBCA 2RKIB 5M2PA 4QPXA 3M1VA 2CPJA 3NH0A 5I3QA 4UBBA 1RXWA 4JI2K 1Q18A 5CY4A 3JSMB 1ZJNA 4I69A 4DV5K 3AVJA 4A57A 4A8OA 3DXMA 4IR9A 3CJKB 3WKBA 3H59A 4NEYA 1HARA 1NK4A 2OAUA 2QKBA 2GQQA 3NBPA 3VGKA 4ED2A 2G0AA 8ICKA 1DAXA 2VPZB 4M3WA 2A1AA 5GIOA 1DXSA 5KFCA 1HNWF 4IOCL 4TNOA 4FF2A 4LVNP 3NGYA 1GMWD 3MI7X 1UWBB 3SD7A 4CQ1A 2AF6A 3K0SA 1ASUA 4AUKA 4FS1A 3UN5A 2W11A 1RABB 1WCLA 1RBSA 2FJDB 3M6GA 5LJ3Y 2KFYA 4USUA 4W5TA 2W6KA 2WFBA 2FPMA 2KK0A 1RBTA 3CPEA 3ZT1A 4IRKA 8ICMA 4PH5A 3TAEA 3L09A 5GADI 1CC8A 2I8EA 1E4FT 4O0NA 2LKZA 3D6FB 2PFOA 1KRPA 5B8HA 2LYAA 2O8FB 1EIYB 2DFEA 2YWGA 1RDAA 2KZ3A 1BCMA 1Z00A 2UXDJ 2JWKA 3DGVA 1KEJA 5KFZA 4RQ8A 2NUHA 3SSSA 2FGCA 3KFWX 3ISDA 3OYHA 3RUBL 2UXBF 2LYVA 5THWA 3PIOL 1SBRA 2MZQA 4QWCA 3G82A 3B9JA 3DLLL 1NK8A 3GZFA 2XTJP 2EBGA 1RT2B 4XIUA 3M8PA 2IRUA 2VD3A 1B0PA 2HDOA 3NS7B 2B9EA 2JOQA 4A5AA 3ZZYA 3GL1A 3VGSA 1QQ6A 2V50A 1ZQDA 2GX8A 3ZTPA 1X9WA 1W7WA 2CVIA 1CBKA 4L3KA 5E3CA 3EZWA 2R7QA 2QV6A 4G1QA 5KFBA 4F3OA 3VENA 3PX4A 3JTPA 4ILGB 4UQGA 4WFNL 4IWVA 5FROA 1LK7A 1BOTO 4LF6K 3R6MA 2E2NA 1WLJA 4ZVOB 1A5VA 1VQON 3DRRA 3PX6A 1MROA 3AOBA 2LEBA 3NVYA 2DNQA 1RTIA 1T05A 1HYZA 4RQ2A 2FZKB 2FB0A 2CKWA 5F0UA 4NWBA 1GLBG 2ZNYA 3MPVA 3JPOA 3CW2C 1S9EA 3OUYB 3NGZA 2DR5A 2VOOA 3H5YA 4X4NA 2CQ3A 1I39A 2P9UB 3LPUA 3MMBB 1S6QA 2CGJA 2CPYA 1GOBA 2KT3A 1T3QA 3SPZA 2VH7A 4M5IA 3RBXA 1JKHA 1NNDA 3PX0A 2E29A 1QUVA 2JL9A 2IRYA 3ZTRA 3SFUA 2F96A 2J8AA 1WORA 3GB0A 4A8QA 8ICPA 3BREA 2NXCA 3H0PA 3W9JA 2VIHA 2VJ5A 4NRTA 2GGPB 1HKCA 1VDHA 1GLFO 3FQLA 1UOCA 4DFKA 2HW3A 3AD9C 2PMZF 2N7CA 3WDOA 5EX5A 1E6YA 2HRTA 4ETZA 1SS6A 3TR8A 4GKKK 4QOZB 4NL9C 3PIPL 1NB7A 4V19X 4P4MA 1IV8A 4HTUA 4U7UD 2XVTA 1U09A 3D45A 1TUGB 2UXDF 3EWAA 2EAOA 4FM0A 4EP5A 1BG3A 2OZMA 1HBOA 5F8MA 3LWMA 4FP9A 5AQKA 3ZZUA 3J7ZT 3QERA 1RCHA 4J9UE 3CJAA 4CJ4A 1S99A 1H2TZ 4P2SA 2X78A 1S0OA 2L9WA 1SI9A 1S1XB 4RW6A 2FBVA 4CJTA 1FWPA 2G8WA 2HWTA 4HI2A 4B3TK 3A5NC 4W5OA 2HHWA 1XO1A 7ICEA 1SJ1A 2IHNA 1O0PA 2HNDB 4UB8U 1ED1A 3MMCA 1YG0A 4ILRA 1ZQPA 2VPWB 5LXRA 2CGLA 5KT6A 4NXNK 1ZBLA 5CEHA 1ZQLA 4DV0K 4AM6A 1OWXA 4UOFA 4IEIA 3MAAA 2Z1IA 4B9QA 3VMFB 1H6KX 2OJ3A 2HS3A 2DR9A 3M8SA 4EENA 2HHUA 3LZIA 4MFFA 4CGDA 3CPWM 4ED4A 2WSFC 2MYFA 5HMMA 1KVIA 2NRHA 3OYEA 5EWEA 2NRZA 3SDEB 1L8OA 1U25A 4F71A 5DK5A 1RDDA 3MPWA 5FDLA 4Y2KA 2RHSB 2E9TA 4YDXA 3CCSS 2HBYB 2CQ2A 4FVCA 2UP1A 2XYHB 1FA0A 5CYMA 4DR7J 5BRDA 1HWIA 2BE9B 3GJSB 4BRMA 2ADCA 3UR3C 3OL9A 4N8NA 3CCRN 2J9CA 3HW8A 2HFUA 1Z3EB 5ALQA 4PAAA 1N63A 2W01A 3CM6A 2YNIA 4H4KA 2FMPA 3G9CA 3KOOA 3AVIA 3K89A 1VQKN 1FEHA 2E8NA 4CEDA 5L9XA 1EO1A 4P0QB 1IN0A 1KN6A 4BE0A 3C2KA 1RAFB 5HMYA 1PYTA 1RT1B 4R0EA 1P6TA 4I2QA 4USWA 2OHFA 1T9WA 1DY3A 3RR7A 3R6LB 5K8PA 4QJFB 1R0AA 3TAFA 2P6SA 4CVNE 3TZXA 3ZX3A 2ZJPL 3TX8A 2W2QP 2KG1A 5I9EB 4CH0S 2Z2LA 3AQPA 5IC4B 2P2CB 1J6ZA 7ICNA 1HR0K 3THYA 3R9LA 4DPOA 1EP4A 1M0SA 3PXGa 4OJOA 4OO1J 3W62A 3HSJA 4JKAA 3HT3A 3O6WA 3ZDDA 5J0TA 3Q89A 5BYQA 2FC0A 2MSTA 1V6HA 1XMQJ 1ZQXA 4ILHA 4XRHA 1M90O 1FJGJ 3M2RB 4B3RK 2V6AA 2Z56B 3FE1A 4DV4J 3DC2A 2UVUA 2DPNA 2OM6A 1TL3A 3A5OC 5LMUJ 4K2JA 5J2BA 4FJ8A 2IM2A 2PD1A 1T4GA 5T7LB 2NZ4A 1X4CA 3H90A 5CZVA 3GU0A 4RBVA 2IHMA 2ZJRL 3RSEB 4PGYA 1NGHA 3CCUS 1YJWS 4WFBL 4ECRA 4RQMA 4YMOA 2FHKA 1TL7A 5KFWA 2CZVC 1WWVA 3MGVA 3D4JA 2ZF5O 4ILLA 5ALEA 2BGGA 5F41A 3SR6A 2ZM6J 2JLEA 4QPTA 1YJNS 2XHBA 3VQ4A 1N5XA 5D3GB 3I9V9 4RNHA 3K0JA 3GR1A 4R8UA 4OV6A 1JJCB 1XSPA 3RW6A 3M05A 3LPYA 1FWKA 2HZAA 3IM1A 1HJOA 1R0CB 3PUFA 3M9MB 1U49A 1S59A 4RQ7A 1X4FA 1BY9A 1YJVA 1HBMB 2QLXA 2P5VA 4MYTA 3QNWB 3FDSA 3A8IA 4DR7F 3KLIB 1AT1B 5DB8A 2DBBA 1XWLA 2A1JA 2ZHAA 1KLMB 4UAWA 2DY1A 1QD1A 1T03B 3M4XA 5BR9A 5E26A 2D7SA 3HT0A 3RJJA 4BRAA 4NLCA 8ICYA 2HGMA 5IV4A 2BOAA 2YY3A 1RYSA 3AARA 3TQEA 2V5HG 3TZZA 4PWUA 1QAXA 1XQIA 1ZAWA 4DG1A 1WF0A 2ATLA 4CBWA 5I3UA 2MLXA 2DGQA 4N77A 5FPMA 2BHNA 1EKSA 2VFVA 5E3AA 5AIBA 1WN7A 2FC9A 1YJ9S 1B7FA 2CUYA 3M1VB 2V2KA 4AHUA 1VR6A 2QTDA 3RMBA 3ISCA 5J0YA 3N6LA 4Y2RA 2AX0A 4DQRA 4DU1A 1V5IB 3TRGA 4RWXA 2BEFA 4LRBA 4FK2A 3UNGC 1FNOA 3A13A 2YH1A 3DXMB 3AA5X 1XSNA 1P8GA 4ITSA 1UPHA 3LDLA 3IR6B 9RUBA 3VN5A 3AOCA 4L72B 4J91A 3NBPB 4JI6J 1XMQF 5E33A 3TQ1A 3GDQA 1FJGF 4OI3A 3EGZA 2KJWA 5HN0A 2C3YA 5EE0A 3T69A 2DNLA 3I31A 4DV4F 4ZLJA 1O8BA 1U48A 5LMUF 4ECXA 1G1XA 4DN9A 1V4TA 4W5QA 1HJPA 1S1VA 2JFDA 1QUPA 4O5CA 4RKUC 3P45B 5E41A 3T5JA 4NZ0A 3C46A 4M5MA 3PW7A 4NLPA 4BRCA 3OTOK 2DTJA 2ZM6F 5FPEA 2C3UA 4WE1A 4M3UA 2WBNA 4LIRA 1CUKA 2GFFA 2GNKA 5A8KA 5BYSA 1RHRB 3L7UA 4LREA 4Z4GA 4P74A 3Q83A 3C65A 4OPHA 1Z00B 4RZRA 1Q7LB 3CMQA 4N7TA 1ZQNA 4AL7A 2NQPA 4PHPA 2F2AB 1MW7A 1QH9A 1RDUA 4C97A 2W1BA 3ZZTA 3BKUA 2Q3PA 5AQWA 3V4IB 1BPBA 2HHSA 2DGWA 1C0FA 1I51B 3NH1A 1WBDA 3G82B 3FLCO 3LGNA 5IM0A 1ZTWA 2DITA 3MR3A 4ECTA 2D0OA 3QUBA 4LJMA 1SV5A 3Q7CA 4A8YA 3M8PB 2P9KA 3ICLA 3ZCMA 4CT9A 1HMVA 2H4YB 3SCLE 4EX7A 4DR3J 3NMUA 4F67A 3VA3A 3BO3A 2DNPA 2GBZA 3ZX2A 2ZIXA 3A3PB 1V85A 2E5HA 4RG8A 3W64A 4TUPA 2UYTA 5BOLA 5IINA 1R8BA 1U2FA 5J1NA 1SH2A 4FLZA 4G1QB 4DOCA 2IVFB 1NHKL 2M5YA 1IBKK 1XO0A 2OKQA 1RWWB 3THTA 3RFAA 5FRMA 5AM2A 1GLCG 2XWYA 5ALXA 1T3VA 3D1OA 1GMUA 2NZTA 5J1EA 1ZQHA 1Q78A 4GY2B 3HHKA 4NYFA 2VWJA 5H1SQ 2KSOA 1JN3A 3DRRB 5ALOA 3IR7B 1OS5A 1MROB 4YR2A 3MCSA 5A0YA 4JI3K 1C0TA 3C19A 1ZD4A 4NLKA 3DOMB 4UOGA 2ISPA 1RTIB 1T05B 2VASA 2IVOA 4BVOA 4DV2K 2AT1B 5EHHA 3WQPA 4JI6F 3H8YA 2ZZMA 1N8RO 1S9EB 3LP3A 2EANA 4KIAA 4MT1A 1S6QB 3LOUA 3KUHA 2Q36A 1QS4A 3V7JA 2CNLB 1JKHB 2DFFA 4KHQA 4QYRA 3VR1A 4KTWA 1FDNA 3ZZ0A 2VOPA 4BG8A 4G9BA 1D8LA 2ZBPA 1NOZA 4JHDA 1NRKA 2NXJA 3ZSOA 1ZQRA 1GQEA 1BXNA 2CQBA 2JLFA 4L74A 4QS8A 1KEKA 4D3GA 4KN4A 3QU4A 4M6WB 3R9PA 2BTFA 3AQFA 4LF8J 1X5PA 2W9CA 2HVEA 1SIWB 4IH5A 1G2EA 1YBAA 3GONA 1E6YB 4O3PA 2PMZC 5E5NA 3M6WA 4RQ5A 1SC3B 4JKBA 1BA1A 4LH5A 2E1FA 3D0IE 4ZP8A 4CEAA 4CI0B 2IMWP 2BZ2A 4KH1B 1AROP 2J7KA 2ZVSA 1N8RT 5J1PA 1HBOB 2ILZA 2JDJA 3CCEN 2YX8A 3AXMA 3GG1A 2ACYA 5MAOA 3TSPA 4DSJA 3B4MA 4KHSA 4WJ3B 2KU7A 1ACMB 2OH2A 5F1XA 2OANA 4C1NI 4I2EA 4UW2A 2A40A 3BN4A 3KVGA 4DR3F 1Q7YT 3T9ZA 4BR7A 3MMCB 1JLFA 4IFYA 5C2GA 4QS9A 4BC3A 3BPSP 1WNSA 4CIOA 4CJLA 4KY3A 3HDSA 5GTIU 2ZTCA 3TUJC 2P35A 2VB6A 3IWLA 1SXLA 2Z2MA 3MM6A 2CXYA 3FSYA 3EE8A 2P9EA 5DBBA 1N5QA 3MAAB 5FIIA 2M0NA 2WF7A 1N56A 1XI1A 4KHPJ 5J0WA 1S0NA 2Y9UA 3JAMO 4IOCQ 4IEEA 5F8LA 1A7GE 3E9LA 1ZQJA 4WIIA 3AN1A 1DURA 1CI4A 1TYQB 2P9SA 3WXIA 4KX5A 3BY5A 1Q3VA 5KFGA 2QC3A 2V8VA 3AY0A 2DHHA 1GEHA 1VQ6N 5FDLB 4DEZA 3SAGA 1COOA 3I55S 3HFKA 2YHXA 5G0RA 3JPQA 4G1IA 3KBBA 5AK4A 3M6VA 2KVCA 1MG7A 2UVRA 4FPAA 1S5LU 1GTHA 3SJJA 5CYMB 4HT5A 5B0EA 2VL1A 2YNFA 4KE5A 1Z05A 3GQCA 1TL5A 3V5RA 3HSTB 1RDBA 4HR2A 3W66A 2XM3A 5AQQA 5AI8A 2J9DE 3FMBA 4NO7A 3MCOA 2I1QA 2YNIB 2ZJ8A 4DSKA 3O2IA 4I0WA 3NGTA 4JI8J 1JALA 4NLBA 4WU3A 4PL2A 2KVQE 2B3TB 4FJMA 2CQHA 4I2QB 4LF8F 4CK3A 3C1YA 4CJ3A 1MSWD 4WXWA 3D5MA 2MY7A 2J5AA 2E3TA 3G6XA 3PIOQ 4O44A 5KFQA 1R0AB 3QIPA 4EI2A 3I56S 2R4FA 4OHVA 3N4WA 1VQ4N 2KJ8A 4Y2PA 4IOBA 3DLLQ 2ASMA 4OYZA 1G99A 5EOZA 1WG1A 3KHHA 2JZBA 2WVFA 2NPFA 2DCLA 5FP0A 3MX2A 3THYB 5GMEA 3CMES 1WG5A 4B9NA 4PZOA 1EP4B 1REVB 3UQSA 2KW4A 2W9AA 1A0OB 2VU5A 4FN5A 1D3WA 3CCQS 2NSCA 3OYMA 2KL8A 3E58A 4KBIA 4QR2A 3BO2A 4UAZA 3RH4A 4ZOHC 4M9GA 1RWMB 3NE6A 5J2AA 1UVJA 3VF2A 3N4MB 2HCFA 4CCHA 3T5LA 4DX7A 1SJ4P 2OTJS 2WHEA 5DG9A 2RQ4A 5IXUA 3HMJG 5F3TA 3G10A 5D49A 2V9KA 1F5AA 1GTEA 1TL3B 3ZI4A 2Q3SA 5ALWA 1YGYA 2VPYB 4QZFA 4A47A 3RBEA 4CZJA 3DOKA 4FO6A 7FD1A 4C8KA 4DPWA 3AY9A 3C6TA 5LXYA 4ID8A 3VQ5A 3CF5Q 3IG1A 4PRFA 2JRSA 2XY5A 1VRTA 1UJ5A 2R7TA 1TL7B 3QT5A 4FBUA 4Z7YA 3BSCA 1NJIO 2CH5A 3NL0A 5EWFA 4KHPF 1R43A 2E7VA 5HO4A 4CJRA 4KLFA 1F44A 2PYJA 4UUWA 4DR4J 1FTRA 1RBRA 5AQIA 2PMZD 5JU5A 2XS2A 5AFUA 4PKDB 2IJRA 4Y00A 3AO1A 5RUBA 3GFKB 1WSFA 2HGLA 3ETRA 1FESA 4LH4A 1WG8A 4NLYA 1SXEA 3P4IA 1VSIA 1JJ4A 3CCZA 1QJHA 1R7IA 1ILYA 3CRXA 3L3CA 1NGJA 3GLJA 2QJ3A 1LW2A 4AHSA 5HMLA 3WKDA 1FERA 1HLUA 3FBEA 1TUVA 4CERA 3ENOA 5L1LA 5H1SV 1FXDA 2CH6A 3V81A 2CVEA 4CDGA 2QSFA 4KYZA 3L9ZA 2JC0A 3M6KA 2A1JB 4LIWA 1H2UX 3VAMA 2DL0A 1KQSM 5HI7A 1WAFA 4WF9L 4YFKA 3GIKA 1RT3A 3T5HA 2RP5A 2LFVA 3I82A 3AQOA 2RUSA 3HTVA 3RVCA 1OH5A 3PIPQ 2Y1JA 3KK1A 2B5JA 3H8MA 4AE5A 4QZEA 4DTUA 1M1HA 2MQ8A 1NJIT 5C24A 2QWLA 2GA7A 2F8SA 1RE1B 2A1RA 2YMMA 2UVWA 4LFAJ 3AVNA 4PWWA 3QYYA 3CCJS 2G09A 1FEZA 5I3UB 4FJHA 2FHJD 2UV8A 5AI5A 2QLWA 4JRPA 2QWMA 4B3OB 4C3LA 5EXWA 3GFZA 4LY7A 4C4SA 1X31C 2OFHX 2GC8A 3E9OA 4FF1A 3WK7A 4BRFA 4XTTA 1WCNA 3CT9A 4B3SK 4KI6A 3THVA 9ATCB 3J7YU 3CETA 2W03A 3CERA 1IO2A 4YOVA 1GOAA 2FVCA 1NKBA 1ZQYA 2WHOA 4QR0A 3CMAN 3V6DA 3CO0P 1XMOJ 1RAGB 4LQ9A 5AE3A 4JNEA 4LC9B 1ZOTA 3S7RA 4BC7A 1SWWA 4DL4A 2YJFA 2Z4PA 1YWXA 5HVHA 3MZIA 3U27A 5JVGQ 2W2OP 3CD0A 4JI2J 4K4VA 1TK0A 1IR1A 4P75A 1NH7A 3VAJA 2KP7A 5KGWA 2PBDA 4DV5J 4W4MA 1KVCA 5A2QO 5HRSA 2E1CA 4DR1K 2Q97A 3HSGA 2B8PA 2WSEC 5IIKA 1I5OB 5HQLA 1TE2A 2HNZA 2JEGA 1SKWA 4WE1B 3BQ0A 1FFSB 5ETPA 2WF8A 4L3NA 3SQIA 3TSQA 4DR4F 5A8KB 2PAVA 3AODA 2KICA 3H4BA 2DKXA 1YI2S 1T9XA 3UMBA 3C14A 3I33A 2FGOA 5AQNA 2MPUA 1YVNA 4J2BA 1FDDA 3TVZA 3CGIA 3J7YP 2IIHA 4PPXA 3LM2A 1JUDA 1J5OA 3ZX0A 4USJC 1NPKA 3NAEA 5L8RC 4CH1A 3TUPA 4F3MA 1EJ7L 2CNKB 3CJTA 4PG7A 2BPFA 3AJ2A 1WD6A 4NCAA 4KLEA 3W0LA 4RNMA 4NI2A 3BQ7A 4GIBA 2ZJPQ 4YY3K 4H5RA 1SV5B 1ZXIA 4CLWA 2CJKA 2P9KB 1HMVB 2CPIA 2ZOMA 4NLDA 2ZGYA 3FGVA 4FLYA 2EPIA 3K9JA 2AJ0A 3DLGA 3UO0A 2ZIXB 4US8A 2BH1A 4IFEA 2D69A 4JK7A 2OEJA 4LFAF 3BN7A 1RU1A 4NXZA 2IMOA 5LJ5Y 1CS4A 5AT1B 1W26A 2V0NA 4PXDA 3P38A 4CJVA 1UA0A 3IG5A 1RTJA 4B1XB 1HWKA 1F5SA 1JROA 1D1UA 4RW8A 5J1EB 1SJ3P 1V5VA 1CG2A 1T6CA 1BC6A 2IJFA 4NXMK 2KSOB 2D3O1 1NXIA 5H9EK 1ZA2B 1K47A 3ZSQA 3FFKB 1C0TB 2JZ5A 2AEFA 2ZJRQ 3VEXA 3AVKA 5ALZA 3AO4A 3TUZC 2MB0B 3RTVA 4WFBQ 2FSJA 5HL7L 4LF1A 4E7HA 5HATA 1XMOF 3OTEA 3BDPA 4A59A 3R7BB 1S49A 5AQRA 3MX5A 4JKHA 4CHZA 2W3RA 5KFIA 2IYIA 3MEEA 4JI2F 3AA8A 1ZM2A 5AHXA 4BWMA 4LF6J 3RZAA 5KFSA 4TLRA 3LK9A 4DV5F 1EXQA 2BV3A 3H3NO 4JHDB 4CEBA 3V1RA 2H1YA 1HUOA 4QCLA 4LF9J 2XHCA 3C2LA 2G2YA 1K73O 2B4UA 3JSYA 3PYEA 5AQJA 5CAAA 1KTQA 2W9CB 2K06A 4ZCIA 2R2TA 3CQXA 4WCEL 4URQU 4Z7CA 2FBYA 2MSNA 2IOHA 2LVWA 3QLHA 4CGJA 3LZJA 5M1FA 1HKAA 4PCQA 5AK6A 3L2WA 4EP4A 2O1PA 4KT0C 4Z6FA 5KFRA 5EUHA 3E1YA 2DRAA 4LVOP 4TYAA 3R2CJ 1S79A 1TFRA 1GFWB 2ADBA 4ID5B 1FNXH 2W4PA 3F5EA 2M4MA 2VKQA 1RTHB 3CNHA 4QU7A 3IM8A 1B92A 3HL8A 1Q1KA 2FXUA 3PFOA 2MZRA 4H0TB 1H1VA 3RAMA 3I0RA 2UZAA 1QQNA 3M6XA 4RL1A 4GKKJ 4LBPA 3MM7A 8ATCB 1D0EA 3K5LA 1NU4A 2KXHA 3IFRA 4A8SA 2HSTA 4IFYB 1RDCA 2C3OA 3RJMB 1TV9A 1HBNA 4GRSA 2DR8A 4HAIA 4B08A 4WPAA 4ALZA 5CHIA 9ICEA 1S3XA 1E6VA 4IFVA 3KZBA 3DJCA 3DFEA 1FO4A 3BM7A 2BKEA 4OZ5A 4ED3A 2A42A 3JS9A 4KHWA 1QHTA 4N76A 2J0SD 4K8XA 2QX0A 3RH6A 4CW7B 2G8KA 1XN9A 1MMNA 1VSKA 3ZEUB 4B3TJ 2P9SB 3KUGA 3K59A 4CI6A 8ICOA 1KQQA 4JD2B 2YV0X 3HI9A 1W7AA 1RBOB 1LNQA 4E0DA 2MQLA 2BRKA 4YOXA 4ETXA 4DV0J 5G0RB 4PQUA 2UUCK 3EW9A 3W5XA 1G6BA 4YDDB 3ILLA 2IY5B 2ALYB 3TTCA 2AX1A 3SV3A 2YNFB 4FCYA 3M1FA 4RCHA 5DLFA 1SIZA 4OZJA 4LF6F 4FWRA 3Q22A 1NK5A 4BR9A 2BE7D 4BVPA 1XNRK 4U7CA 5IIJA 4WTYA 3SMZA 4M04A 3BGRA 3HSDA 4YHHK 3ZDAA 4KH5A 2R8JA 2DK2A 1JB0C 1OPZA 3CO9A 5EN1A 5K8OA 3MDQA 3VQPA 2A6OA 4DSEA 3MK6A 3CG7A 4HEA9 2RHFA 5J0RA 3N5BA 5D0RA 4CJ5A 5BR8K 4S0MA 3AGKA 3KLVA 5IQQA 4O44B 4ELTA 4XUSA 3VA0A 3QIPB 8ICRA 2PN6A 2IBKA 1K6YA 4Z94A 1RILA 3MR5A 2B9YA 1SH3A 2AEJA 3OVAA 2JHDA 1VK8A 1RAEB 1NG9A 2JZBB 4OI2A 5C15A 1UZHA 1BLUA 3AVMA 3P96A 2LXFA 2YHBA 4H0XB 4JI4J 1NO8A 1S72S 1F0XA 3Q8UA 3O1BA 2DRDA 2DGSA 3RJEA 4M5LA 1L8LA 3J80U 1VHXA 1VIOA 5ALKA 4B9MA 3MGHA 4ED8A 4K4WA 2B4JA 4FJ7A 4ZH4A 5A0LA 2AJ2A 4GKKF 1O1WA 4BRDA 4I2JA 4PA1A 2JV3A 2W55A 3IM9A 3BQ1A 3VTHA 1OKJA 2QXFA 2LCWA 3FC9A 1WSIA 2ZWHA 2Y0BB 3LALA 1LFWA 1HR0J 3RJIA 4ISEA 3CXCR 3G25A 1PUZA 5DDYA 1N5TA 1SB6A 3C6TB 1SL0A 2QG9B 1RBLA 2E2QA 3CDAA 3IG1B 5SWMA 2QK9A 2E9ZA 3LP1B 3H5SA 2ZH6A 1I6JA 3AAPA 2SXLA 4DMZA 1VRTB 5EE1A 3GILA 3R1LA 3OW2M 2HF3A 3NG8A 3FCHA 4ES1A 4B3RJ 4LR9A 2KRBA 3PJWA 4B3TF 4K25A 3WZ0A 3S3NA 4DR5J 4I9QA 2OPSA 1OSDA 4JMUA 3C23A 3ZSZA 4OKEA 3NGKA 6FDRA 3CCSN 1R8AA 4DV0F 3G6YA 3TUIC 1D09B 5C25A 1QQ5A 4MFAA 3B4DA 3V81B 1QVGR 2MAXA 4WQ4C 2XCAA 2YWFA 3Q8PB 2HNYA 1J97A 3NWGA 4ZTJA 4R25A 2DEJA 1X1PA 1RT3B 1X4HA 1RKIA 5FJ4A 3C3LA 4P73A 3KK1B 4FS2A 2B5JB 4IOXA 3G0ZA 3GP9A 4MFCA 2FF3B 1SJRA 3NS6A 2K4EA 3AVLA 4TN2A 4DQPA 3QGGA 4GW6A 5C24B 1VBYA 4ANCA 5ALNA 2KHDA 5CP2A 3PEHA 4Y2UA 2WB4A 1LXJA 5T41A 2L9NA 1UVKA 5HHIA 3AEVA 1WAJA 1R8HA 4P71A 2NSBA 5LSLA 4CZHA 3AV9A 1VISA 5D0EA 1NDCA 4ICAA 2A41A 1MQ3A 3MXMA 4B8AB 3L4PA 3OYDA 3FZFA 2OA8A 4BJQA 2VKZG 3CNQP 1ZQKA 1TAUA 3IAM9 4MIAA 9ICHA 4I4BA 2F8EX 5DRKA 5EX0A 2KM8B 2P66A 1AUDA 3L4BC 1ATNA 2G5IB 1NEEA 3V6DB 2R2UA 1YBTA 3FZ2A 3OFHA 1Z4UA 4P2MA 4MKAA 1MQ2A 3HVWA 1RCOB 2Z30B 2KXNB 3E66A 4RUHA 4NZ6A 4WYWA 1FVQA 2C2DA 3MUVP 1NZPA 1U4BA 1CJVA 2HHPA 1HR0F 2YWKA 1YF5L 5KL1B 2YCHA 1N5VA 2PO4A 4F2RA 4P9SA 3RG6A 5ETLA 2XB2D 1WSEA 3CCUN 2IGIA 1EZZB 1YJWN 4DPUA 2KO1A 2VA2A 3SPYA 2ZC4A 1IUJA 4ZCKA 3ZZZA 3D2NA 3MPUB 2PE8A 3QIDA 2HNZB 4OZ1A 1M1KO 1YJNN 4KB1A 3UPFA 3HP6A 4B3RF 4HCBA 4NPOA 3AT1B 1Q82O 3TFRA 4OI4A 3IR5B 2HWHA 2R7SA 2R8IA 4CJQA 2HHXA 1W9HA 3ZD9A 3C14B 4FE3A 4CM2A 2KG0A 4A2AA 5GAEU 3EYZA 3IGVA 4IYQA 3K7RA 7ICPA 2LDYA 3HBTA 1J5OB 4ZJLA 3DM2A 3TP2A 1YRTA 3G2XA 1JJ2M 3QJJA 4WZQA 2V7ZA 1BHNA 2XNRA 3KJNB 3OTOJ 4B1YB 2XWXA 2RQMA 5D15A 3C1ZA 3BKFA 4DS4A 3EE3A 4QWDA 1GX6A 3CDWA 4J90A 1FRLA 4NI2B 5J0PA 4DS5A 2V8HA 3VQTA 4B8CA 4QW8A 4JI7K 4NLNA 5JXSA 3NP5A 4ZPDA 4ECSA 2OMLA 1DHMA 3R5JB 1UVLA 1LOTB 3OV7A 3R5DA 1WEYA 1TVAA 9ICGA 1SC4B 4GXJA 2ZBCA 1CS4B 3H1VX 1LKYA 2QRRA 1RTJB 4LMZA 3DHXA 2AJQA 1YJ9N 1KTVA 1LAVA 1HKGA 4RW8B 1JK9B 2EWSA 1J5EK 2DJWA 3QBCA 3X3UA 4KLTA 3AOAA 2R7VA 2XMJA 5LSRA 3SUPA 1UT5A 4CNQA 1VK0A 3CCLN 4AF1A 4M63C 4RPZA 5GAEP 3SLCA 5ALYA 1EWQA 5KL8B 4M7XA 3QU2A 1LWEA 1HHTP 1IBKJ 2DNGA 1WC1A 3EUB2 3EXCX 2ES6A 4Y2CA 2P9CA 1KDNA 3FCWA 3H0RB 3D2FA 3ID8A 5IT9O 3MEEB 4KH6A 4Y0WA 3Q8YA 2Q1LA 3R97A 3THWA 3I8DA 3EY1A 1ZM3A 4I29A 3ZSVA 2D9OA 4NLOA 2XCPA 2Y8WA 2GUPA 3CVKA 3JQMA 3QFHA 2JGAA 2Y1RI 3W2VA 4DU4A 4DV2J 2GVDA 5D4BA 4YB5A 4JKEA 3V9ZA 5KOXA 4B9SA 4ZCMA 2R7OA 5J2GA 1T3NA 2OIHA 3W8PA 3KYLA 3J81O 1TV6A 1CJUA 1MMLA 5J2NA 2ACMA 3GCXP 1HI8A 2J0XA 1PSDA 1MWYA 1K9MT 4BS2A 4CECA 2ZHBA 4A62A 4E19A 3QLHB 1XQSC 4CBXA 2AXTU 3M32A 4GLXA 3QPIA 8ICWA 4JB3A 2Q0ZX 1CQMA 2BQRA 2MMYA 3A12A 3UN3A 2H3ZA 4M7YA 2AW0A 2FC8A 4PKGA 3OYCA 3KKAC 1B4SA 4FOEA 3A1YG 2QB0A 3OTOF 1OMSA 2UUWA 4FJNA 3I0RB 4OX6A 2N3LA 4Z4EA 3Q2SC 3EXYA 4H8KA 3MM7B 1X0PA 3AXKA 3TYTA 2F9TA 3OGUA 2OWOA 7ICSA 3CIMA 2DGXA 1ZOLA 1D9DA 4AM7A 3J80Y 4OZ0A 3SFGA 4YOEA 4YMNA 4PGQA 1HBNB 5GAHI 4FNHA 1WOPA 3CJCA 4Q2MA 2QW9A 4BWJA 1Y64A 3S3OA 4L73A 2CQPA 1E6VB 2YNHB 3MXJA 3M6ZA 3UCZP 5AZJA 4FJ5A 1X6IA 2GTDA 2IOFA 3BPDA 3F2KA 3KHGA 4BR5A 2A1SA 1ZRNA 3AHPA 1TAMA 4OGCA 4OLBA 4E7JA 1X8DA 2IOCA 2JNJA 1U0SA 5HMZA 2J4RA 3ZO7A 3O9SA 4JRQA 1RYUA 2BCUA 3T6BA 1PK3A 1PYOB 4PQUB 4BQZA 1Y11A 5J0SA 4OZ3A 1UW9A 3AVAA 1IBKF 2MZ1A 3NASA 3MR6A 1RAHB 2E4LA 4LF5K 4OIXA 4BLGA 3UI3A 2IC3A 1YQHA 3KLHA 2HIYA 2CZ9A 2E5SA 3H40A 3CPWR 4Z6DA 1IG6A 2DY4A 3UFCX 4WQ5C 1QAIA 2OZSA 3G6VA 1ASVA 1NK0A 3BGRB 2DPIA 4DV2F 2YN4A 7ICTA 4A2BA 1N34J 5KG2A 1Z1VA 2HFZA 3NGDA 4C8LA 2RUGA 4IQMA 2K8GA 4LUBA 4FXVA 3SSRA 1TFYA 3O3FA 3K2PA 2XMMA 2ASDA 1BHLA 4FFDA 4FYDA 1NOYA 3PZPA 4I6MA 1B0TA 5BOMA 3LDQA 4NLUA 4EWTA 2OPQA 5AK5A 1IWGA 4F72A 1ECWA 3WK9A 4ZVPB 4O5KA 3MTJA 1PJ5A 1IXKA 1F9FA 3PRBA 4DPYA 1VSDA 1PKUA 4M5HA 4J2DA 2OD4A 4ZN1A 2RSQA 2O67A 2VJ4A 1RQ0A 4DJBA 2MZSA 4DZDA 4CRJA 4DTMA 5L9NA 4CJFA 2XICA 1Q8KA 1KVBA 2Y1LB 1UL3A 4ZPWR 2AYEA 1X0FA 1IBCB 3CC2S 5TKWA 1U04A 5C2CA 4LJXA 5J2QA 3KG0A 2KJ5A 1UWAA 1IJJA 3DLHA 3V6JA 4U9RA 3QMLA 1KDHA 1FRXA 2G8FA 2HHTA 4RW7A 5HL7Q 5B0GA 3SI8A 4BG9A 4I27A 1XR7A 2OCEA 2HS4A 4CBUA 2AH5A 2NRVA 1PJ6A 1ZPWX 3RH5A 4K8RA 3BBFA 4JV0A 1N6QA 2OPSB 1V3SA 2R2SA 2C1EB 2BGWA 5ITHA 1F6TA 1BPDA 5ALDA 3I55N 2QWNA 2V8GA 3SCXA 1NBEB 4M47A 2IS3A 3GU3A 1NMEB 3BSAA 3KZXA 5C25B 7ICJA 1YTAA 3TAMA 3VGVA 1KHVA 2EBEA 2WTFA 5GAGI 4YDUA 2XSJA 3JTOA 1ZXOA 4WFZA 4WCEQ 4L8RB 4HVZA 4LSZB 1B4FA 4M5NA 1TKTA 3VGLA 3N6MA 1JLQA 1TGOA 2OTLS 3SQOP 3OR1A 5L39A 4FWMA 4DPTA 1RNHA 5BREA 3MGJA 2CQ4A 1DRGA 5HJXA 5F2RA 2WUSA 2BM0A 3KUEA 1N34F 2PIIA 1YHQS 5GADU 5M1OA 2RHQB 4IQTA 3GIJA 3HHEA 4UOHA 4W5NA 3H46O 3BEGB 3NRBA 4MYUA 1RXVA 3D2SA 3UD5A 4MK7A 3I56N 2BKNA 4GVEA 4R64A 4DMNA 4X62K 2YPYA 2G0JA 3OVSA 3U4LA 2DY9A 3SMPA 3JSRA 3WKEA 1KC8O 1KOHA 3CMEN 4I6AA 3UKRA 4IG3A 3NVWA 4ZLLA 4RBUA 4OHZA 4UTGA 4QWBA 1RT6A 2KVIA 2MLZA 2RMLA 3VAHA 3CCQN 5AZIA 5JLHA 2H3FA 2NO5A 2HFNA 3S01A 1MN8A 5AKJA 3R2DJ 1B70B 4CHQA 3EGNA 3QUCA 1U6FA 3LP0A 4F4ZA 3PYDA 2OTJN 3R6GB 1FJEB 3VGTA 5DETA 2MZJA 1EX8A 4PKHA 2DYAA 4K4UA 3WIVA 3V2UC 3AAWB 4CLSA 3TARA 5ETQA 5AQXA 1CJVB 1X4DA 4Q8EA 4B3SJ 3HI0A 5FLXO 3O5TB 2JLGA 3HK2A 4C9DA 3CCTA 2J9DA 2Q0UA 1K1SA 9ICWA 4P10A 1KC8T 3QT7A 4MDBA 5GADP 3PACA 4OJ5A 4JAXA 3CJKA 3JB9k 3U02A 3CQ8A 4BREA 5DBCA 5J2KA 2RRNA 4BC9A 2F4VK 5AM5A 2L48A 4GMKA 3LGHA 1OIAA 3IWXA 2FLOA 2GVZA 3NH2A 1Z2LA 4DR1J 2QSWA 3DM2B 3ZD8A 4IQUA 1CLQA 2E2OA 2JH7A 1SB3C 1GXUA 4YORA 4BDYA 2G8IA 4BC4A 2KD1A 3QT6A 1RTZA 3TFSA 3LTOA 2I6XA 4MEXA 5KG7A 4OHXA 4NM2A 2YQ3A 4CNZA 4OPKA 4CF5A 1N4LA 3GIMA 1BQNA 2J0QD 2M8HA 2QYGA 2AYGA 3PHTA 3QYPA 1PBAA 4J2EA 4DR3K 4OD0A 2F9DA 4LFCK 3CCJN 2DXEA 1HPZA 4C0ZA 1RWUA 1LKYB 2ZJQL 4E8UA 3HWTA 2FY8A 2ERRA 2PKEA 2FHMA 3VQ9A 2HVDA 2WRMA 2F9JA 3DMJA 3Q8QB 1N52B 4YY3J 2VG7A 5EDWA 2VZ9A 4M5GA 1OPIA 4M9HA 1Y5LB 2J7UA 1OVYA 4NYZA 1ZJMA 3KDOA 1NK6A 2G1DA 1ZETA 1HEKA 3P39A 1LWEB 2XMTA