2KN7A

Structure of the xpf-single strand dna complex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
67
structure length
67
Chain Sequence
EKYNPGPQDFLLKMPGVNAKNCRSLMHHVKNIAELAALSQDELTSILGNAANAKQLYDFIHTSFAEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA repair endonuclease XPF
publication title The structure of the XPF-ssDNA complex underscores the distinct roles of the XPF and ERCC1 helix- hairpin-helix domains in ss/ds DNA recognition
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/dna
total genus 20
structure length 67
sequence length 67
chains with identical sequence D
ec nomenclature ec 3.1.-.-:
pdb deposition date 2009-08-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2kn7A00
1SKRA 3PNCA 4QZHA 2LYHA 5KG0A 4EYHB 1Z00B 5L1JA 3JPSA 4F8RA 4YN4A 1MQ3A 4DS5A 1UT8A 5KFKA 4DOBA 5EWEA 2BPFA 4DSEA 4TUSA 1ZQVA 4Q43A 5DB7A 1XSLA 4I2GA 4TURA 2IMWP 2ASLA 4DQPA 5HHIA 2KZ3A 5KG1A 7ICKA 2AGQA 7ICVA 5KFMA 2ISPA 1QSLA 4K4IA 5EWGA 5DGBA 4Q44A 3RJGA 9ICUA 1ZQMA 4DF4A 4QZGA 7ICUA 8ICOA 1KTQA 4UB1A 4F50A 3Q8RB 4ECVA 3MBYA 4IRKA 4MF8A 3H7IA 5KFCA 1LV5A 1BPZA 4O9MA 3UQ2A 5KG2A 3PO4A 4B9SA 3JPTA 4O3OA 3UXPA 3UPQA 3C1ZA 1ZQNA 3PMLA 4XQ8A 4PHPA 2C28A 1U48A 5HMMA 5KT7A 5J2DA 2F1HA 4RUAA 3ISBA 1L3UA 7ICPA 4QW8A 7ICIA 5J2BA 1NK9A 1S0NA 2ZUBA 4QZCA 1KEJA 1N56A 1ZQYA 1ZQDA 5J2FA 4UAWA 4O5CA 4GC7A 2ASDA 1XSNA 4TUQA 4IQTA 4DL4A 5KT2A 3E2EA 2ZJAA 3N4MB 3RRHA 2IBKA 1EXNA 4RNMA 3EPGA 3IHQB 3PX0A 4F5OA 3TANA 3RR7A 1SL2A 4YMOA 2ATLA 1MQ2A 3RAXA 4KLGA 1S0MA 4Z6EA 1B43A 1PZNA 4QZIA 1TVAA 4KLMA 1JIHA 9ICHA 5J0WA 3PR4A 1JXLA 1MSWD 4DLEA 5CP2A 7ICGA 1UA0A 1NJYA 3RRGA 4QWDA 7ICLA 3TAPA 3BJYA 4RQ3A 4KLUA 2C2RA 3B0YA 5L9XA 3LDAA 4M04A 4G3IA 2KZMA 4YD1A 8ICPA 5KFBA 9ICTA 5DQGA 3JPOA 3GIJA 3V7JA 4HYKA 4ECYA 3UXOA 2ZTDA 1KDHA 1NJZA 1DOQA 4RQ5A 5F9LA 5KFSA 4RQ4A 4M9LA 3RBDA 3Q8LA 9ICKA 9ICSA 3PW4A 3C5FA 5J2KA 4JUZA 2AGPA 2ZJ8A 2XY7A 4UAZA 2MUTA 1N48A 4DSLA 3AU6A 2R8GA 4DQRA 5KFEA 3KHLA 4ECXA 3SYZA 2JZBA 5KFAA 1T3NA 4IRDA 4K4GA 3K75D 2BQRA 1ZYQA 4RZRA 5DDYA 4EYIB 4ED0A 3Q8SB 4RNNA 2I9GA 1L3TA 2FMSA 3H8WA 5DLFA 4DS4A 4C8OA 5DBBA 2I1QA 3ORYA 4JV1A 2AGOA 1ZQJA 4JV2A 8ICSA 2JEIA 3GDXA 3ISCA 3GV8B 5DG9A 4LZDA 4ECSA 1RYRA 3C1YA 2PFNA 4YMNA 1ZQWA 4RQ8A 4YVZA 5CR0A 5J2IA 2WTFA 1D9DA 2FPMA 2XC9A 1UA1A 3C2MA 3ZDEA 2VA3A 3JPPA 2BPCA 4TQSA 2MUTB 5J0UA 4YP3A 3MDAA 4EBEA 2BPGA 4F93B 3GILA 4YXMA 4DL3A 1KSPA 3ZDCA 2JZBB 9ICGA 4F3OA 3BQ2A 1B22A 1BPEA 3BQTA 4O3PA 4ED8A 1XS9D 4IRCA 5C5JA 4UB3A 2FPLA 2HHTA 4ED2A 4M6WA 4F4KA 4J9QA 4NXZA 4KMUA 5KG4A 3MABA 3ZD8A 1ZQIA 9ICEA 1L3SA 1QSYA 4DFKA 2BR0A 8ICEA 8ICNA 1XSPA 1TK5A 4ELVA 9ICXA 3HX0A 2VA8A 5KFGA 4QWEA 2AQ4A 2KTQA 9ICVA 4DO9A 2UVVA 5J0TA 8ICRA 4M2YA 5JUMA 8ICZA 5HNKA 1BPYA 3H40A 3UQ0A 4UB5A 3EPIA 4UAYA 3V6KA 1CEZA 4I2JA 1K1SA 3G6YA 4QZFA 5J2CA 1ZQBA 4BDPA 4KLTA 2BCUA 3PW7A 3RJIA 2BHNA 3HPOA 1S9FA 3T5HA 4LVSA 4KN7A 4IQUA 1RPLA 2F1JA 3LWMA 2FMPA 7ICRA 3MR5A 4M6WB 5DBAA 4PHAA 2BQ3A 4GXJA 5DG7A 4ECWA 3SV3A 2HHSA 1BVSA 1RXWA 1H38A 1BPBA 4R66A 4J9SA 4DQQA 2J6TA 3OSPA 1CUKA 4JK1A 3ZDBA 4J9NA 4I29A 4F91B 1ZQFA 4P4OA 1Z3EB 2IHMA 5KFZA 2W9BA 2W9CA 4BXOA 1IM4A 4DQSA 4O3NA 2C2DA 4O3RA 4Q8FA 8ICTA 4FBUA 2NRZA 3G6XA 4RNOA 5EWFA 4ECRA 3RBEA 5KG3A 4I2HA 3RAQA 4FS2A 4DFJA 5DBCA 4M9HA 3M9OB 4O3SA 4F2RA 5J0PA 4Z6CA 5CB1A 4F92B 1WCLA 2R8IA 3PMNA 3PV8A 1SL0A 3TARA 1D9FA 4QZEA 2F1IA 4J9MA 2V9WA 2BCVA 4E0DA 5J0XA 5KFJA 3JPQA 3V6HA 1RYSA 2MAXA 4YD2A 5DDMA 4F4WA 3T5KA 4JWMA 4MFFA 3HP6A 3SZ2A 3M8SA 1NKBA 4UB2A 2M9NA 8ICWA 4FO6A 4FBTA 4PGYA 2P6UA 5KFWA 4UBCA 3PR5B 2Y1JA 2W9BB 4XA5A 4BXOB 4O5EA 3M9NB 3AUOA 3RB0A 1SL1A 4QWAA 1TKDA 3NGDA 2HHWA 3C2LA 2HVIA 1KFTA 3H8SA 5L1LA 1U45A 3FYHA 9ICIA 1XU4A 5KT6A 5IIJA 4ECQA 4B9VA 1WCNA 7ICEA 4M47A 2AU0A 4MEYA 2HHUA 4DLGA 5CJ7A 7ICQA 3GIMA 4DL5A 4DF8A 4DL7A 2J6UA 4KLIA 1L3VA 2HW3A 2FLPA 4GLXA 3KTQA 1L5UA 4QW9A 1ZJNA 3PW5A 3B0XA 5DB6A 4RT2A 3JPRA 1KFDA 3PW2A 8ICQA 5L1IA 3T3FA 4RPZA 3ZDDA 4ECZA 2OWOA 2HHXA 1T8EA 5D49A 9ICBA 1SKSA 3K4GA 2XO7A 4LZGA 1S77D 2KZZA 9ICNA 3OGUA 4YG2A 3RH6A 5J0RA 1ZQAA 5KFIA 4I2CA 3Q8PB 5KG6A 3PW0A 1NOMA 2IHNA 4F2SA 4IQVA 1A76A 1LB2B 4MEXA 3T5LA 4ZH4A 3PX6A 3Q8KA 3V6JA 5J2AA 1QSSA 2VA2A 2HHVA 9ICPA 1T7PA 5D4BA 5HHHA 4JWNA 4O0IA 4RU9A 2BDPA 2C2EA 8ICAA 3GV7B 5KFRA 4B9TA 1C7YA 1ZQUA 3KHRA 2BQUA 4BWMA 1A77A 5DB8A 2PI4A 1ZQLA 1JXEA 9ICMA 1KFSA 3EWAA 5DGAA 3C2KA 4EEYA 1UT5A 5KFVA 2RDIA 4Z6DA 5BPCA 2ASJA 1TK8A 1U49A 1TAQA 4KLFA 4PGXA 1ZQEA 3H4BA 2PFPA 4TUPA 2NRTA 3TI0A 3BQ0A 4MFAA 3MDCA 7ICFA 3JPNA 4YXJA 3OJUA 4M0AA 4B9MA 4QZ9A 5KFDA 4PHDA 1COOA 9ICCA 3PY8A 4O5KA 5KFQA 3MGIA 1V9PA 1KLNA 1XO1A 5BOLA 2DPJA 4C8MA 4P4MA 2W9MA 4JV0A 5KFXA 1NJWA 4ELTA 5IINA 4QWBA 3QZ7A 3KHGA 4I2EA 5KFPA 9ICJA 4M9JA 4GXKA 5KFHA 5J2GA 3QZ8A 2FMQA 3RH4A 9ICOA 3GFKB 4ED1A 1U4BA 1MC8A 4DSKA 2P66A 2UVRA 4I2AA 9ICLA 4BWJA 1TV9A 4DL6A 3RTVA 4UB4A 1HUZA 3RB6A 4F5RA 2ZTCA 4RQ1A 2PI5A 1X9SA 1ZQSA 1QTMA 2A1JA 5HP4A 1K1QA 5IIOA 1KRPA 4B9UA 1ZQOA 1S0OA 3ZD9A 3GV5B 4P4PA 4C8KA 2NRXA 3QE9Y 1X2IA 5KG7A 3RJHA 2KFZA 1TAUA 4QZBA 5KFOA 5J0QA 4RT3A 5CA7A 2W8LA 4RUCA 1SZPA 4KN4A 4RQ0A 3RJEA 4MFCA 4QZDA 3ISDA 4O3QA 2UVWA 3PO5A 1T4GA 2XGQA 4YMMA 2J6SA 5J2EA 3Q8QB 2H5XA 1S10A 1BGXT 4CCHA 3OHBA 4GXIA 4EZ9A 3M8RA 4UQGA 3V72A 4NY8A 4NLZA 8ICVA 8ICXA 4X5VA 3ETLA 1ZQXA 4F5QA 8ICHA 4F4ZA 4ED6A 2DPIA 4M9GA 7ICJA 4YFKA 2A1JB 4I2DA 3HW8A 5L1KA 2XY5A 1BPXA 4RQ6A 1NJXA 4PH5A 1X9MA 1IXRA 1Y88A 4J9KA 7ICOA 2JEFA 5KFUA 4XUSA 1NKCA 4DSJA 5IIMA 1JN3A 4IR9A 2ZTEA 4DOAA 3PVXA 2BKEA 4J9OA 4C8NA 5IILA 4ELUA 2BCQA 5DQHA 3G6VA 3MFIA 1NK5A 5KT5A 4KLOA 5DB9A 2Y1IA 5DG8A 1ZQQA 4R8UA 4RQ7A 4DL2A 2C22A 1NK7A 5J2HA 5IIKA 1RXVA 2BCSA 4M9NA 8ICYA 3EW9A 4R65A 5DKWA 2W9CB 3OJSA 3TAQA 5KFTA 4NM2A 4P2HA 4BGDA 2KN7A 4PPXA 2RDJA 1HJPA 5EOZA 8ICKA 8ICLA 4J9LA 4KITB 2R8HA 2B21A 2FLLA 3RJKA 4Z6FA 3BDPA 3ZDAA 4NM1A 3V7KA 2HVHA 3T5JA 8ICCA 8ICUA 7ICSA 5J2JA 5KT4A 4C8LA 1ZQPA 8ICBA 3PX4A 5J0YA 3RB3A 1HUOA 4KLSA 4EBCA 2PFQA 4B9LA 3N97B 2ISOA 4YR3A 9ICFA 2KFNA 3OSNA 4KLDA 4KLLA 3GIKA 2R8JA 4R8UB 3HWTA 5BOMA 5TZVA 3MR6A 3LWLA 4QZ8A 4KLEA 3IM1A 4I28A 1QLNA 2FPKA 5J0SA 3MGHA 4RPYA 1S97A 2BGWA 2AJQA 4MF2A 1XC9A 2JEJA 3C21A 4DEZA 3EYZA 1ZQCA 3C5GA 3TFSA 3Q8MA 4KLJA 7ICMA 1U47A 7ICTA 3QEBZ 1ZETA 4PGQA 3THVA 5DLGA 5CHGA 4IR1A 4FS1A 4YR2A 4TQRA 4R63A 4GC6A 1NK0A 4J9RA 3RJJA 4DSFA 1JX4A 5KFFA 3SI8A 4RPXA 2HHQA 3TQ1A 1TFRA 2VANA 4F5PA 1ZQGA 4DWIA 1XWLA 5HMLA 2JEGA 4DQIA 5KFYA 7ICHA 2XGPA 5J29A 4F4YA 3RH5A 3MR3A 3SV4A 3MR2A 4YR0A 4XRHA 1ZQZA 8ICJA 3OHAA 5CWRA 3NTUA 3TFRA 4NLGA 5KTQA 1ZQKA 4IQWA 1JMSA 1ZQHA 1TK0A 4NLKA 3HT3A 3M9MB 2FLNA 9ICQA 3QEAZ 3H8JA 5KFNA 4F4XA 2UVUA 4Q8EA 8ICFA 1NK8A 3RB4A 9ICWA 3EZ5A 2IA6A 5F9NA 2NRVA 4J9PA 4KLQA 2V4QA 1ZQTA 1D8YA 2BCRA 1X9WA 3C23A 5IIIA 2NRWA 4F5NA 3UXNA 4KLHA 4ED3A 4KTQA 2XCPA 2ZJ5A 3GQCA 4I2BA 1S0VA 4ECUA 2ZUCA 2PFOA 3RR8A 4I2FA 4ECTA 4R64A 3RJFA 1BPDA 2DFLA 7ICNA 3H4DA 4NLNA 1NK4A 4DFPA 4DOCA 1NKEA 1ZQRA 4DSIA 4Q45A 2V4RA 1D8LA 2PXIA 3LK9A 2XY6A 1ZJMA 2ALZA 5D46A 4EZ6A 2AQ0A 1Z00A 1SKWA 8ICMA 3AU2A 5DQIA 4YCXA 2Q0ZX 2XCAA 8ICGA 1AROP 4K4HA 4PHEA 2ZUDA 9ICAA 2R8KA 3V7LA 3KHHA 1RZTA 2GWSA 4UBBA 4I2IA 4YQWA 5J0OA 1U9LA 5KG5A 1NK6A 2W8KA 3FDSA 4B9NA 5KT3A 5KFLA 2W9AA 1S76D 4EBDA 4DFMA 3MFHA 4ED7A 4QWCA 3BQ1A 3GIIA 2P6RA 8ICIA 4RQ2A 4QZAA 9ICRA 1DGSA 4I27A
chains in the Genus database with same CATH superfamily
1UT8A 3SR6A 1RG6A 4C4TA 4DSEA 2L5YA 3SENA 7ICKA 2Y9UA 7ICVA 5KFMA 4Q44A 1FFUA 4QZGA 1KTQA 4IRKA 4MF8A 1LV5A 1BPZA 3UQ2A 3UXPA 2E8NA 4O3OA 2DF4B 2A19A 3PMLA 5AKGA 2C28A 1U48A 4KLGA 5HMMA 2F1HA 7ICPA 1L3UA 2H3IA 7ICIA 1NK9A 2K8AA 1Z19A 4FE3A 3UMCA 1ZQDA 5J2FA 2KSOA 1XSNA 5AK5A 5KT2A 2AXTU 4RNMA 3EPGA 3PX0A 3HKZF 4F5OA 3TANA 5ALLA 2ATLA 4Z6EA 1PZNA 3VCBA 1JIHA 1KL9A 5F3XB 5CP2A 3LDAA 1ZD5A 4YD1A 9ICTA 4PZOA 3JPOA 3UXOA 3M6KA 2KSOB 2XVTA 3NRWA 5F9LA 2EZZA 2KMDA 4JUZA 1N48A 4DSLA 3AU6A 2HCFA 5GTIU 1F44A 2EH9A 4IRDA 1UQVA 4K4GA 1ZYQA 1N2XA 2LPEA 2E8PA 2FMSA 2B0CA 5DBBA 3GDXA 3ISCA 5DG9A 2H3VA 1Z4OA 3PZPA 4YVZA 5ALVA 1D9DA 2XC9A 2VA3A 2BPCA 5TISU 4TQSA 4EBEA 4YXMA 4KX5A 2YQEA 4ED8A 1XS9D 4UB3A 2FPLA 4ED2A 4M6WA 4F4KA 4NXZA 1JALA 2G0AA 1XNSA 1AQ6A 8ICNA 3WKCA 3UQ0A 4UAYA 1K1SA 5AIBA 3HPOA 1S9FA 3T5HA 1COKA 4LVSA 4IQUA 3MR5A 4M6WB 5DBAA 4RQNA 1L7MA 2F8KA 4DQQA 3ETRA 3OSPA 4JK1A 4J9NA 4F91B 1Z3EB 3L4PA 2W9BA 3PSFA 2W9CA 4O3RA 8ICTA 5AM0A 3KOOA 4Z6CA 3PV8A 1SL0A 1WCLA 3PMNA 2F1IA 4J9MA 5KFJA 2KNJA 3N7RC 4F4WA 3T5KA 3HP6A 4U6PA 3M8SA 3CW2C 1NKBA 4C0ZA 4FBTA 2W9BB 3RB0A 5ALXA 2N1RA 3C2LA 1KFTA 5L1LA 3I1YA 3FYHA 4ECQA 1WCNA 3E0FA 2DGZA 5G5GA 2AU0A 3ZI4A 7ICQA 3GIMA 2HW3A 3CYMA 4QW9A 3D2QA 3B0XA 3PSIA 1KFDA 2LM1A 1NNLA 3K4GA 2K4IA 4OJOA 5KL8B 5KFIA 3ALRA 3SAFA 4I2CA 5KG6A 3LYSA 1LB2B 2RHFA 4ZH4A 3PX6A 3CRXA 9ICPA 4JWNA 4O0IA 4RU9A 2F44A 5KFRA 1WWUA 5AM5A 2PI4A 2EQYA 2ZIXA 1UT5A 4Z6DA 2ASJA 3TADC 2PFPA 1PK3A 3BQ0A 2XIDA 5KFQA 1V9PA 5J8YA 5KFXA 1NJWA 4ELTA 5AI6A 2CPRA 4ED1A 1MC8A 3M6ZA 4DSKA 2ZIXB 3RTVA 1HUZA 5C0YA 1QTMA 2A1JA 5IIOA 4B9UA 4BUGA 2P35A 3GV5B 2DKZA 1TAUA 2W8LA 2D8CA 4KN4A 3RJEA 2UVWA 1T4GA 2XGQA 2J6SA 2DUYA 1BGXT 4CCHA 3OHBA 4GXIA 4EZ9A 2KG5A 4NLZA 4U7CA 2MSNA 4EENA 1SXEA 1ZQXA 3BS7A 4F4ZA 4YFKA 2A1JB 3HW8A 5L1KA 4PH5A 1IXRA 1PVPA 3LVWA 3D6JA 5KFUA 4OCZA 2ZTEA 2VJ5A 1X42A 3PVXA 2BCQA 4QJFB 3MFIA 4KLOA 5DB9A 2C22A 5J2HA 5IIKA 5JTIA 2ZXIA 2QARA 4NM2A 1HJPA 2CN1A 2FLLA 4KITB 2R8HA 2B21A 3RJKA 8ICCA 7ICSA 5KT4A 8ICBA 1DK3A 4NWIA 1HUOA 2RLTA 4EBCA 2AHOB 4UB6U 3N97B 9ICFA 4YR3A 4KLLA 3HWTA 5TZVA 1V97A 1F0MA 4Y2UA 2QARB 2BGWA 4MF2A 3EYZA 1ZQCA 3Q8MA 7ICMA 3B9JA 5AHXA 7ICTA 4PGQA 3F2CA 4TQRA 1NK0A 4PL1A 3FC4A 5KFFA 1L8OA 3H0MB 4F5PA 4DWIA 2JEGA 2K89A 4F4YA 3RH5A 3MR3A 3SV4A 3WKEA 3H0LB 1JMSA 1TK0A 4NLKA 3AL0B 2FLNA 3DDHA 3H8JA 1NK8A 3RB4A 5ALJA 2IA6A 2WAQC 5F9NA 2NRVA 4KLQA 3BZKA 1D8YA 2VKQA 1ZRNA 3C23A 3IG8A 3UXNA 4KLHA 2YB1A 3GQCA 4I2FA 1BPDA 3QNMA 4OJPA 1NK4A 1SGGA 1WG8A 1ZQRA 4Q45A 1N60A 3KKAA 2XY6A 1ZJMA 2ALZA 5D46A 1SKWA 3ED5A 4YCXA 4KMOB 9ICAA 3KHHA 1Q3UA 3RF9A 1C20A 4B9NA 1HIWA 1F5SA 4ED7A 2CRXA 4RQ2A 4I27A 2ESEA 4QZHA 4NLCA 4EYHB 5L1JA 3JPSA 4YN4A 1MQ3A 4DS5A 4DOBA 4MHVA 3TACB 4EX6A 1L7NA 4TUSA 1ZQVA 4I2GA 3M7DA 4DQPA 5HHIA 4K4IA 5EWGA 9ICUA 4DF4A 8ICOA 4OJ6A 1SB3C 3Q8RB 3MBYA 1Q46A 3H7IA 2PKEA 1L7PA 5KG2A 2KOBA 2NV3A 2KD1A 5J2BA 2KP7A 1S0NA 2EANA 3KZIU 4UAWA 2A1AA 4TUQA 3E2EA 3RRHA 1YZ7A 1X66A 4YMOA 1MQ2A 9ICHA 5GTHU 1JXLA 2FJ6A 2W11A 1MSWD 7ICGA 1UA0A 1NJYA 4KLUA 5L9XA 3SAHA 4M04A 4G3IA 1PVQA 3A0HU 3N28A 3GIJA 3V7JA 1NJZA 1DOQA 3RBDA 3F5AA 3C5FA 3QUQA 2ZJ8A 2FDRA 2R8GA 5ALTA 4ECXA 3SYZA 2JZBA 1T3NA 3AMZA 2Z7JA 2I9GA 5DLFA 2HMXA 4C8OA 2K60A 3WK4A 4IC9A 4JV1A 4JV2A 1ZQJA 2JEIA 3GV8B 4LZDA 5ALIA 1RYRA 1QH9A 4YMNA 1ZQWA 4RQ8A 5J2IA 1KW4A 3QU9A 2WTFA 2E3TA 3JPPA 1ZXIA 3OPXA 4YP3A 3UMBA 3GILA 4DL3A 9ICGA 2JZBB 3F53A 1O08A 4F3OA 5CRXA 5AM3A 3BQ2A 1B22A 3EUB2 5C5JA 2LBOA 5G5HA 5KG4A 3ZD8A 9ICEA 3ICXA 4DFKA 3WK5A 2YX8A 3KBBA 4KX3A 4QWEA 1IV8A 9ICVA 4UB5A 1FFVA 2QKQA 4I2JA 1DGJA 4QZFA 4BDPA 2BCUA 2H3QA 4PHAA 1PUZA 1BVSA 1RXWA 4R66A 2WB1F 1Z1BA 1CUKA 3ZDBA 4I29A 4P4OA 2IHMA 5KFZA 2M0NA 5AICA 2XI9A 2C2DA 1TAMA 2NRZA 3RBEA 5DBCA 3M9OB 4O3SA 4F2RA 3QUTA 4F92B 2R8IA 3BZCA 3TARA 4QZEA 2CXYA 5J0XA 3JPQA 2DBYA 3V6HA 1ECWA 4DCCA 2MAXA 4YD2A 5DDMA 5AI4A 2W03A 3PR5B 4XA5A 5HR6A 2Y9TA 1A0PA 2HHUA 2W7OA 1L3VA 2FLPA 1ZJNA 2ZIVA 3HILA 4Y2JA 2EZXA 4G9BA 8ICQA 4J03A 1T8EA 5D49A 1VDVA 1S77D 2MRLA 5ALYA 2B6GA 3WKAA 3Q8PB 3PW0A 1NOMA 2IHNA 4IQVA 1A76A 1TE2A 3LVVA 3T5LA 1QSSA 2ZIVB 2C2EA 2JXJA 4B9TA 3D2SA 4Y2VA 3EWAA 5DGAA 5KFVA 3NUQA 2ZXHA 4GFJA 1UCVA 4MFAA 7ICFA 4UAUA 1XO0A 4B9MA 5KFDA 2LHTA 5ALSA 4OD0A 5A0LA 2DPJA 4Y2YA 2DWQA 2YTUA 5L1MA 3KHGA 4I2EA 9ICJA 4GXKA 3AQFA 5KFHA 3QZ8A 2YMLA 3QUBA 1RQLA 3N7SC 2LKYA 1JROA 1SWVA 3MC1A 3I76A 4UB4A 1FO4A 1T3QA 4RQ1A 1OUQA 1ZQSA 2IOHA 5HP4A 1K1QA 1ZQOA 2EAMA 4HAIA 3WU2U 1S0OA 1JI7A 4P0PA 4C8KA 3QE9Y 1X2IA 5KFOA 3NASA 3F5EA 5CA7A 4RUCA 1SZPA 1SV4A 5AKYA 4QZDA 3ISDA 3HKZC 3PO5A 5J2EA 3QXGA 4AP9A 3V72A 4UQGA 8ICXA 8ICVA 1HEKA 3ETLA 4ED6A 2DPIA 7ICJA 4I2DA 1BPXA 4RQ6A 7ICOA 1Y88A 4J9KA 2KJ5A 2JEFA 4XUSA 4P0PB 4DSJA 5IIMA 4IR9A 5AK4A 3QYPA 4UB8U 3WK6A 4DOAA 1Q8KA 3CP8A 5DQHA 2ES6A 5AK3A 4RQ7A 4DL2A 1RXVA 2ODGA 8ICYA 2BCSA 3EW9A 4R65A 2W9CB 1SV0C 3OJSA 5KFTA 2HI0A 2KN7A 5AKKA 4J9LA 4OJLA 3ZDAA 2R18A 2HVHA 2OM6A 2A3VA 3MGVA 1ZQPA 3PX4A 5J0YA 2IOFA 2K4PA 1X9XA 1V85A 4B9LA 3ONNA 2KFNA 3OSNA 4KLDA 3GIKA 2R8JA 1L8LA 3T79A 4I28A 1CI4A 3IG5A 4WJ3B 2JEJA 1T94A 3C5GA 2D6FC 3S6JA 1KN5A 5KAFU 4GC6A 2HBLA 2PMZF 3SI8A 2HHQA 5EE1A 2NO4A 1ZQGA 2LYBA 4C4RA 5KFYA 1M6YA 3MR2A 4XRHA 8ICJA 2GO7A 4NLGA 5KTQA 5AK6A 1MA7A 3HT3A 3M9MB 9ICQA 3QEAZ 5KFNA 8ICFA 1ZQ1C 2UVUA 3EZ5A 1QCKA 2WF6A 5KAIU 1ZQTA 2BCRA 1A6SA 3J81j 1LVHA 3F2BA 4EX7A 1S0VA 3RR8A 3RJFA 2WF5A 2DFLA 3H4DA 2V4RA 1D8LA 2PXIA 3WK7A 1Z00A 1RYUA 4K4HA 1RZTA 2GWSA 3D2NA 5J0OA 4Y2RA 4CF4A 3FDSA 5KT3A 2W9AA 2KK0A 1CRXA 4EBDA 4DFMA 3MFHA 4NV0A 3GIIA 1SKRA 3UM9A 2LYHA 1Z00B 4F8RA 5EWEA 2BPFA 2YMPA 2WAQF 1XSLA 5ALOA 5DB7A 2IMWP 2KZ3A 5KG1A 2AGQA 2ISPA 1QSLA 4ACOA 5DGBA 2HOQA 5ALMA 3AQEA 7ICUA 4F50A 4ECVA 2JRZA 5KFCA 3IN5A 1ZQNA 5KT7A 5J2DA 5AIAA 1RM6C 4QW8A 2HBJA 2KKVA 3TADA 5ALEA 4GC7A 4PZNA 4IQTA 3N4MB 3QU2A 1EXNA 3IHQB 2HBKA 3SAGA 1SL2A 3RAXA 4KLMA 2QB1A 3NVWA 3FAHA 4IS7A 4QWDA 1KBUA 3BJYA 4RQ3A 3B0YA 1X40A 2OH2A 2JR5A 3F2DA 2KZMA 8ICPA 5DQGA 4HYKA 4ECYA 2ZTDA 1KDHA 4BJQA 4LJXA 2Y0SF 5KFSA 4Y2TA 4M9LA 3Q8LA 4FZMA 2HSZA 2NYVA 5J2KA 2XY7A 4DQRA 2YMQA 4NL9C 1S5LU 3K75D 4CF3A 2BQRA 5DDYA 4ED0A 4RNNA 3H8WA 1PK1A 2I1QA 3ORYA 8ICSA 4ECSA 2PFNA 1BNOA 5CR0A 4BX9C 3HRDD 2DKXA 3MDAA 2BPGA 3WK8A 4F93B 4QIWF 3ZDCA 2W43A 2HOFA 1Q3VA 2F2AB 4CRXA 4IRCA 2HHTA 1PK1B 2RQ5A 4KMUA 1JRPA 2BR0A 9ICXA 1TK5A 3SMVA 2VA8A 4DO9A 5J0TA 5JUMA 5AM2A 5HNKA 3H40A 1DK2A 3EPIA 1N62A 3G6YA 2I6XA 5J2CA 3RJIA 2BHNA 4USAA 3SEIA 3IDWA 1RPLA 7ICRA 5DG7A 4ECWA 3SV3A 3C29A 2H3ZA 5AI8A 2J6TA 1D8BA 1ZQFA 2QLTA 1FIQA 4BXOA 5AKJA 4DQSA 4O3NA 4Q8FA 4FBUA 2W7PA 3G6XA 4ECRA 5KG3A 4I2HA 4AYBF 4M9HA 2W3SA 5CB1A 2BCVA 4E0DA 1RYSA 5JU5A 4JWMA 3SZ2A 3QU5A 2WF9A 1Z1VA 4UB2A 1URJA 2M9NA 8ICWA 3E58A 2P6UA 4Y2QA 4BXOB 4US8A 3AUOA 1SL1A 3NGDA 5AI5A 2HHWA 2HVIA 3H8SA 1U45A 2ZIWA 5KT6A 1WWVA 4B9VA 7ICEA 2LYAA 4DLGA 1YZ6A 4DF8A 2K4HA 2J6UA 1Z4NA 4GLXA 4A8EA 3KTQA 3JPRA 1YT3A 2W3RA 4RT2A 5AI9A 5FP0A 5L1IA 3ZDDA 2WFAA 4ECZA 2OWOA 2HHXA 5ALWA 9ICBA 9ICNA 5E79U 3OGUA 2W55A 4PL2A 4YG2A 4UASA 3RH6A 2FI1A 3O0FA 2ZIWB 5B66U 4PJ0U 3Q8KA 5D4BA 1IIPA 8ICAA 3GV7B 4Y2XA 2G09A 1ED1A 4IL6U 4BWMA 5DB8A 5ALPA 1ZQLA 1JXEA 3C2KA 2RP5A 2RDIA 1TK8A 1TAQA 4KLFA 4PGXA 2KKPA 3QU7A 4TUPA 2NRTA 2RRDA 1RQNA 4YXJA 3GU3A 4M0AA 4PHDA 3PY8A 4O5KA 1KLNA 5BOLA 2ZIUA 3NS1A 2W9MA 4JV0A 5ALFA 3UMGA 5IINA 4M9JA 5J2GA 1N5WA 3RH4A 9ICOA 2UVRA 9ICLA 1KKXA 4BWJA 1TV9A 4DL6A 1N61A 3RB6A 2PI5A 1VJ5A 1X9SA 2JMGA 2ZG6A 1KRPA 3ZD9A 2NRXA 5AM4A 3SD7A 2ZIUB 3RJHA 2KFZA 5J0QA 3N7PD 4MFCA 2IOFK 3Q8QB 2H5XA 1S10A 4X5VA 3QX7A 8ICHA 4M9GA 5HR7A 3VC8A 4F72A 1UHUA 1NJXA 2HBMA 2BKEA 2H3FA 4J9OA 4ELUA 3AM9A 2Y1IA 1ZQQA 2AH5A 3TAQA 2G5HB 1J2NA 4P2HA 1WUDA 5ALQA 2RDJA 5ALUA 4CNQA 5EOZA 2KV2A 8ICLA 2E8MA 2MA1A 2W04A 3OTQA 4Z6FA 4NM1A 3V7KA 5J2JA 4C8LA 4B6JA 4UW9A 3I28A 4C80A 3BQ7A 2KEYA 3NVZA 2PFQA 5ALDA 3L5KA 2BZFA 5BOMA 3MR6A 2F76X 4KLEA 2FPKA 1S97A 1BNPA 2JH1A 3C21A 2W54A 4DEZA 5AKZA 4KLJA 5ALHA 1U47A 4IR1A 4YR2A 4R63A 3RJJA 4DSFA 3TQ1A 4US9A 1PVRA 1TFRA 4UARA 2VANA 4OO1J 2HOIA 2G07A 4DQIA 2XGPA 2KICA 2K8BB 1ZQZA 1SIJA 3OHAA 5CWRA 3TFRA 1ZD4A 1ZQKA 3NVVA 4FZNA 2KJ9A 1L7OA 2KVSA 2V4QA 2WB1C 3NRZA 5IIIA 1P7DA 2NRWA 4F5NA 4CGZA 2XCPA 1ZD2P 4ECUA 2ZUCA 2PFOA 4ECTA 4R64A 5ALGA 7ICNA 4NLNA 2I5HA 1NKEA 3QUCA 4GIBA 3LK9A 2AQ0A 5DQIA 2XCAA 2Q0ZX 8ICGA 1AROP 4PHEA 2ZUDA 2R8KA 3V7LA 5ALKA 3IP4B 4UBBA 4YQWA 1U9LA 1KQQA 5KG5A 2K4EA 2NO5A 2W8KA 2KE7A 5KFLA 3DEEA 5ALZA 1VLBA 1OW5A 5JRTA 9ICRA 3PNCA 5KG0A 5KFKA 4OJ5A 5AKXA 2BDUA 4UAVA 4Q43A 4TURA 4C7ZA 2ASLA 2GLEA 3FM9A 2WHEA 3RJGA 4FFDA 1ZQMA 4UB1A 2JGAA 3C28A 4O9MA 3PO4A 4B9SA 3JPTA 3UPQA 3C1ZA 4XQ8A 3IV6A 4PHPA 1JX4A 5J8YC 1B4FA 1JUDA 4RUAA 3ISBA 4NJ8A 2ZUBA 2DQNB 4QZCA 3U26A 2EAPA 1KEJA 1N56A 1ZQYA 4O5CA 2ASDA 4DL4A 3KD3A 2ZJAA 2IBKA 3RR7A 5EE0A 1S0MA 1B43A 1NI3A 4QZIA 1TVAA 3PSPA 5J0WA 3PR4A 3KFUF 4DLEA 7ICLA 3RRGA 3TAPA 3PSTA 2C2RA 2EDUA 2VIXA 2VJ4A 1NZPA 5KFBA 2F3NA 1DXSA 2EAOA 4RQ5A 4RQ4A 3L3FX 9ICKA 9ICSA 3PW4A 1MN8A 2AGPA 4UAZA 2MUTA 2G5IB 5KFEA 3KHLA 5KFAA 3NVYA 4RZRA 4EYIB 3Q8SB 4RQMA 1SWWA 1L3TA 4DS4A 2AGOA 2G06A 3C1YA 4EEKA 5EE3A 2FPMA 1UA1A 3C2MA 3ZDEA 2MUTB 5J0UA 3QU4A 1DRGA 3R9KA 1KSPA 5AKLA 1FEZA 3H0RB 2KIWA 1ZD3A 1SV0A 1BPEA 3BQTA 4O3PA 4J9QA 3MABA 1ZQIA 1L3SA 1QSYA 8ICEA 1OXJA 3K1RB 1ZOLA 1XSPA 4ELVA 3HX0A 2AQ4A 5KFGA 2KTQA 5AKEA 3WKBA 2UVVA 5CEHA 8ICRA 4M2YA 8ICZA 4FZLA 2YMMA 1BPYA 2Q4TA 3V6KA 1K5OA 1CEZA 3SQIA 1IG6A 1X6JA 1ZQBA 4KLTA 4ICAA 2KJ8A 3PW7A 2K8CB 4KN7A 2F1JA 3LWMA 2FMPA 4Y2SA 2OXOA 2BQ3A 2KIVA 4GXJA 2E1FA 2HHSA 2LMRA 1H38A 1BPBA 4J9SA 1N63A 5KL1B 1J97A 2GOLA 4CDGA 1IM4A 4RNOA 5EWFA 4UATA 3RAQA 4FS2A 4DFJA 3IRUA 5J0PA 1D9FA 2PMZC 5B5EU 2V9WA 1ZRMA 2OHFA 4MFFA 3KKAC 4FO6A 4PGYA 5KFWA 4UBCA 2XICA 2Y1JA 4O5EA 3M9NB 4P0QA 4DFDA 3H8MA 4QWAA 1TKDA 2JH7A 3HJEA 9ICIA 1XU4A 5EE9A 5IIJA 4M47A 1B0XA 4MEYA 3WKDA 5CJ7A 4DL5A 4KLIA 4C4SA 4DL7A 1L5UA 3PW5A 5DB6A 3PW2A 1RDFA 2JV3A 4RPZA 3T3FA 2JHDA 2KHQA 1SKSA 4P0QB 1N5XA 2XO7A 4LZGA 2KZZA 5J0RA 1ZQAA 3AN1A 4F2SA 4MEXA 2VA2A 3V6JA 5J2AA 2HHVA 3WK9A 1T7PA 5HHHA 2BDPA 5H2FU 1C7YA 1QQ6A 1ZQUA 3KHRA 2BQUA 1NZBA 1A77A 9ICMA 1KFSA 4EEYA 5T14A 5BPCA 1U49A 1ZQEA 3H4BA 3TI0A 3MDCA 3JPNA 3OJUA 2O6KA 5AKIA 4QZ9A 1COOA 9ICCA 2LI6A 2YY6A 3MGIA 1XO1A 4C8MA 4P4MA 2GH1A 4QWBA 2OCEA 3QZ7A 5KFPA 2FMQA 3GFKB 1U4BA 4Y2PA 2P66A 4I2AA 3M1YA 5AM1A 4F5RA 2ZTCA 2FE9A 1SZHA 4O3MA 1QQ7A 4C7YA 4P4PA 2DL0A 3TKAA 5KG7A 2HDOA 4QZBA 4RT3A 4RQ0A 4O3QA 1X6IA 4YMMA 5AKHA 3M8RA 4NY8A 4F5QA 3A0BU 2KHVA 2WF7A 2XY5A 2LM4A 1X9MA 2D3DA 4NL9A 1NKCA 1JN3A 2F77X 5IILA 2Y0SC 4C8NA 2QB0A 3BS5A 3G6VA 1NK5A 5KT5A 3GZFA 5DG8A 2F8LA 4R8UA 1NK7A 1WYGA 4M9NA 5DKWA 4QNLA 4BGDA 4PPXA 2OYYA 8ICKA 3BDPA 3DV9A 3T5JA 2OEHA 8ICUA 3K1ZA 1LKYA 1QQ5A 2MU2A 3AEVA 3RB3A 4CE6A 4KLSA 2QB0B 3BS5B 4NLBA 2ISOA 4EELA 1J2MA 2E1EA 4R8UB 3LWLA 4QZ8A 3IM1A 4QIWC 4CF5A 5K4LA 1QLNA 5J0SA 3MGHA 4RPYA 2YN4A 4JMUA 2AJQA 1XC9A 1O03A 3RFAA 3TFSA 1UPHA 2E8OA 3QEBZ 1ZETA 3THVA 5DLGA 5CHGA 1LKYB 4FS1A 4J9RA 1GO3F 4F71A 4RPXA 2E5SA 1S8OA 1XWLA 5HMLA 7ICHA 5J29A 3KZXA 5AI0A 5ALRA 4YR0A 2G08A 3NTUA 2EZYA 4IQWA 1ZQHA 4F4XA 4Q8EA 9ICWA 4J9PA 5ALNA 1X9WA 4ED3A 2YB4A 4KTQA 1V38A 2ZJ5A 4I2BA 2WF8A 4DFPA 4DOCA 4AYBC 4DSIA 4JB3A 2KVCA 4EZ6A 8ICMA 3AU2A 4I2IA 1NK6A 1L6NA 1S76D 4QWCA 1SXDA 3BQ1A 2P6RA 8ICIA 3CNHA 4QZAA 1DGSA 5KNIA 4ZOHC
chains in the Genus database with same CATH topology
1SKRA 3PNCA 4QZHA 2LYHA 5KG0A 4EYHB 1Z00B 5L1JA 3JPSA 4F8RA 4YN4A 1MQ3A 4DS5A 1UT8A 5KFKA 4DOBA 5EWEA 2BPFA 4DSEA 4TUSA 1ZQVA 4Q43A 5DB7A 1XSLA 4I2GA 4TURA 2IMWP 2ASLA 4DQPA 5HHIA 2KZ3A 5KG1A 7ICKA 2AGQA 7ICVA 5KFMA 2ISPA 1QSLA 4K4IA 5EWGA 5DGBA 4Q44A 3RJGA 9ICUA 1ZQMA 4DF4A 4QZGA 7ICUA 8ICOA 1KTQA 4UB1A 4F50A 3Q8RB 4ECVA 3MBYA 4IRKA 4MF8A 3H7IA 5KFCA 1LV5A 1BPZA 4O9MA 3UQ2A 5KG2A 3PO4A 4B9SA 3JPTA 4O3OA 3UXPA 3UPQA 3C1ZA 1ZQNA 3PMLA 4XQ8A 4PHPA 2C28A 1U48A 5HMMA 5KT7A 5J2DA 2F1HA 4RUAA 3ISBA 1L3UA 7ICPA 4QW8A 7ICIA 5J2BA 1NK9A 1S0NA 2ZUBA 4QZCA 1KEJA 1N56A 1ZQYA 1ZQDA 5J2FA 4UAWA 4O5CA 4GC7A 2ASDA 1XSNA 4TUQA 4IQTA 4DL4A 5KT2A 3E2EA 2ZJAA 3N4MB 3RRHA 2IBKA 1EXNA 4RNMA 3EPGA 3IHQB 3PX0A 4F5OA 3TANA 3RR7A 1SL2A 4YMOA 2ATLA 1MQ2A 3RAXA 4KLGA 1S0MA 4Z6EA 1B43A 1PZNA 4QZIA 1TVAA 4KLMA 1JIHA 9ICHA 5J0WA 3PR4A 1JXLA 1MSWD 4DLEA 5CP2A 7ICGA 1UA0A 1NJYA 3RRGA 4QWDA 7ICLA 3TAPA 3BJYA 4RQ3A 4KLUA 2C2RA 3B0YA 5L9XA 3LDAA 4M04A 4G3IA 2KZMA 4YD1A 8ICPA 5KFBA 9ICTA 5DQGA 3JPOA 3GIJA 3V7JA 4HYKA 4ECYA 3UXOA 2ZTDA 1KDHA 1NJZA 1DOQA 4RQ5A 5F9LA 5KFSA 4RQ4A 4M9LA 3RBDA 3Q8LA 9ICKA 9ICSA 3PW4A 3C5FA 5J2KA 4JUZA 2AGPA 2ZJ8A 2XY7A 4UAZA 2MUTA 1N48A 4DSLA 3AU6A 2R8GA 4DQRA 5KFEA 3KHLA 4ECXA 3SYZA 2JZBA 5KFAA 1T3NA 4IRDA 4K4GA 3K75D 2BQRA 1ZYQA 4RZRA 5DDYA 4EYIB 4ED0A 3Q8SB 4RNNA 2I9GA 1L3TA 2FMSA 3H8WA 5DLFA 4DS4A 4C8OA 5DBBA 2I1QA 3ORYA 4JV1A 2AGOA 1ZQJA 4JV2A 8ICSA 2JEIA 3GDXA 3ISCA 3GV8B 5DG9A 4LZDA 4ECSA 1RYRA 3C1YA 2PFNA 4YMNA 1ZQWA 4RQ8A 4YVZA 5CR0A 5J2IA 2WTFA 1D9DA 2FPMA 2XC9A 1UA1A 3C2MA 3ZDEA 2VA3A 3JPPA 2BPCA 4TQSA 2MUTB 5J0UA 4YP3A 3MDAA 4EBEA 2BPGA 4F93B 3GILA 4YXMA 4DL3A 1KSPA 3ZDCA 2JZBB 9ICGA 4F3OA 3BQ2A 1B22A 1BPEA 3BQTA 4O3PA 4ED8A 1XS9D 4IRCA 5C5JA 4UB3A 2FPLA 2HHTA 4ED2A 4M6WA 4F4KA 4J9QA 4NXZA 4KMUA 5KG4A 3MABA 3ZD8A 1ZQIA 9ICEA 1L3SA 1QSYA 4DFKA 2BR0A 8ICEA 8ICNA 1XSPA 1TK5A 4ELVA 9ICXA 3HX0A 2VA8A 5KFGA 4QWEA 2AQ4A 2KTQA 9ICVA 4DO9A 2UVVA 5J0TA 8ICRA 4M2YA 5JUMA 8ICZA 5HNKA 1BPYA 3H40A 3UQ0A 4UB5A 3EPIA 4UAYA 3V6KA 1CEZA 4I2JA 1K1SA 3G6YA 4QZFA 5J2CA 1ZQBA 4BDPA 4KLTA 2BCUA 3PW7A 3RJIA 2BHNA 3HPOA 1S9FA 3T5HA 4LVSA 4KN7A 4IQUA 1RPLA 2F1JA 3LWMA 2FMPA 7ICRA 3MR5A 4M6WB 5DBAA 4PHAA 2BQ3A 4GXJA 5DG7A 4ECWA 3SV3A 2HHSA 1BVSA 1RXWA 1H38A 1BPBA 4R66A 4J9SA 4DQQA 2J6TA 3OSPA 1CUKA 4JK1A 3ZDBA 4J9NA 4I29A 4F91B 1ZQFA 4P4OA 1Z3EB 2IHMA 5KFZA 2W9BA 2W9CA 4BXOA 1IM4A 4DQSA 4O3NA 2C2DA 4O3RA 4Q8FA 8ICTA 4FBUA 2NRZA 3G6XA 4RNOA 5EWFA 4ECRA 3RBEA 5KG3A 4I2HA 3RAQA 4FS2A 4DFJA 5DBCA 4M9HA 3M9OB 4O3SA 4F2RA 5J0PA 4Z6CA 5CB1A 4F92B 1WCLA 2R8IA 3PMNA 3PV8A 1SL0A 3TARA 1D9FA 4QZEA 2F1IA 4J9MA 2V9WA 2BCVA 4E0DA 5J0XA 5KFJA 3JPQA 3V6HA 1RYSA 2MAXA 4YD2A 5DDMA 4F4WA 3T5KA 4JWMA 4MFFA 3HP6A 3SZ2A 3M8SA 1NKBA 4UB2A 2M9NA 8ICWA 4FO6A 4FBTA 4PGYA 2P6UA 5KFWA 4UBCA 3PR5B 2Y1JA 2W9BB 4XA5A 4BXOB 4O5EA 3M9NB 3AUOA 3RB0A 1SL1A 4QWAA 1TKDA 3NGDA 2HHWA 3C2LA 2HVIA 1KFTA 3H8SA 5L1LA 1U45A 3FYHA 9ICIA 1XU4A 5KT6A 5IIJA 4ECQA 4B9VA 1WCNA 7ICEA 4M47A 2AU0A 4MEYA 2HHUA 4DLGA 5CJ7A 7ICQA 3GIMA 4DL5A 4DF8A 4DL7A 2J6UA 4KLIA 1L3VA 2HW3A 2FLPA 4GLXA 3KTQA 1L5UA 4QW9A 1ZJNA 3PW5A 3B0XA 5DB6A 4RT2A 3JPRA 1KFDA 3PW2A 8ICQA 5L1IA 3T3FA 4RPZA 3ZDDA 4ECZA 2OWOA 2HHXA 1T8EA 5D49A 9ICBA 1SKSA 3K4GA 2XO7A 4LZGA 1S77D 2KZZA 9ICNA 3OGUA 4YG2A 3RH6A 5J0RA 1ZQAA 5KFIA 4I2CA 3Q8PB 5KG6A 3PW0A 1NOMA 2IHNA 4F2SA 4IQVA 1A76A 1LB2B 4MEXA 3T5LA 4ZH4A 3PX6A 3Q8KA 3V6JA 5J2AA 1QSSA 2VA2A 2HHVA 9ICPA 1T7PA 5D4BA 5HHHA 4JWNA 4O0IA 4RU9A 2BDPA 2C2EA 8ICAA 3GV7B 5KFRA 4B9TA 1C7YA 1ZQUA 3KHRA 2BQUA 4BWMA 1A77A 5DB8A 2PI4A 1ZQLA 1JXEA 9ICMA 1KFSA 3EWAA 5DGAA 3C2KA 4EEYA 1UT5A 5KFVA 2RDIA 4Z6DA 5BPCA 2ASJA 1TK8A 1U49A 1TAQA 4KLFA 4PGXA 1ZQEA 3H4BA 2PFPA 4TUPA 2NRTA 3TI0A 3BQ0A 4MFAA 3MDCA 7ICFA 3JPNA 4YXJA 3OJUA 4M0AA 4B9MA 4QZ9A 5KFDA 4PHDA 1COOA 9ICCA 3PY8A 4O5KA 5KFQA 3MGIA 1V9PA 1KLNA 1XO1A 5BOLA 2DPJA 4C8MA 4P4MA 2W9MA 4JV0A 5KFXA 1NJWA 4ELTA 5IINA 4QWBA 3QZ7A 3KHGA 4I2EA 5KFPA 9ICJA 4M9JA 4GXKA 5KFHA 5J2GA 3QZ8A 2FMQA 3RH4A 9ICOA 3GFKB 4ED1A 1U4BA 1MC8A 4DSKA 2P66A 2UVRA 4I2AA 9ICLA 4BWJA 1TV9A 4DL6A 3RTVA 4UB4A 1HUZA 3RB6A 4F5RA 2ZTCA 4RQ1A 2PI5A 1X9SA 1ZQSA 1QTMA 2A1JA 5HP4A 1K1QA 5IIOA 1KRPA 4B9UA 1ZQOA 1S0OA 3ZD9A 3GV5B 4P4PA 4C8KA 2NRXA 3QE9Y 1X2IA 5KG7A 3RJHA 2KFZA 1TAUA 4QZBA 5KFOA 5J0QA 4RT3A 5CA7A 2W8LA 4RUCA 1SZPA 4KN4A 4RQ0A 3RJEA 4MFCA 4QZDA 3ISDA 4O3QA 2UVWA 3PO5A 1T4GA 2XGQA 4YMMA 2J6SA 5J2EA 3Q8QB 2H5XA 1S10A 1BGXT 4CCHA 3OHBA 4GXIA 4EZ9A 3M8RA 4UQGA 3V72A 4NY8A 4NLZA 8ICVA 8ICXA 4X5VA 3ETLA 1ZQXA 4F5QA 8ICHA 4F4ZA 4ED6A 2DPIA 4M9GA 7ICJA 4YFKA 2A1JB 4I2DA 3HW8A 5L1KA 2XY5A 1BPXA 4RQ6A 1NJXA 4PH5A 1X9MA 1IXRA 1Y88A 4J9KA 7ICOA 2JEFA 5KFUA 4XUSA 1NKCA 4DSJA 5IIMA 1JN3A 4IR9A 2ZTEA 4DOAA 3PVXA 2BKEA 4J9OA 4C8NA 5IILA 4ELUA 2BCQA 5DQHA 3G6VA 3MFIA 1NK5A 5KT5A 4KLOA 5DB9A 2Y1IA 5DG8A 1ZQQA 4R8UA 4RQ7A 4DL2A 2C22A 1NK7A 5J2HA 5IIKA 1RXVA 2BCSA 4M9NA 8ICYA 3EW9A 4R65A 5DKWA 2W9CB 3OJSA 3TAQA 5KFTA 4NM2A 4P2HA 4BGDA 2KN7A 4PPXA 2RDJA 1HJPA 5EOZA 8ICKA 8ICLA 4J9LA 4KITB 2R8HA 2B21A 2FLLA 3RJKA 4Z6FA 3BDPA 3ZDAA 4NM1A 3V7KA 2HVHA 3T5JA 8ICCA 8ICUA 7ICSA 5J2JA 5KT4A 4C8LA 1ZQPA 8ICBA 3PX4A 5J0YA 3RB3A 1HUOA 4KLSA 4EBCA 2PFQA 4B9LA 3N97B 2ISOA 4YR3A 9ICFA 2KFNA 3OSNA 4KLDA 4KLLA 3GIKA 2R8JA 4R8UB 3HWTA 5BOMA 5TZVA 3MR6A 3LWLA 4QZ8A 4KLEA 3IM1A 4I28A 1QLNA 2FPKA 5J0SA 3MGHA 4RPYA 1S97A 2BGWA 2AJQA 4MF2A 1XC9A 2JEJA 3C21A 4DEZA 3EYZA 1ZQCA 3C5GA 3TFSA 3Q8MA 4KLJA 7ICMA 1U47A 7ICTA 3QEBZ 1ZETA 4PGQA 3THVA 5DLGA 5CHGA 4IR1A 4FS1A 4YR2A 4TQRA 4R63A 4GC6A 1NK0A 4J9RA 3RJJA 4DSFA 1JX4A 5KFFA 3SI8A 4RPXA 2HHQA 3TQ1A 1TFRA 2VANA 4F5PA 1ZQGA 4DWIA 1XWLA 5HMLA 2JEGA 4DQIA 5KFYA 7ICHA 2XGPA 5J29A 4F4YA 3RH5A 3MR3A 3SV4A 3MR2A 4YR0A 4XRHA 1ZQZA 8ICJA 3OHAA 5CWRA 3NTUA 3TFRA 4NLGA 5KTQA 1ZQKA 4IQWA 1JMSA 1ZQHA 1TK0A 4NLKA 3HT3A 3M9MB 2FLNA 9ICQA 3QEAZ 3H8JA 5KFNA 4F4XA 2UVUA 4Q8EA 8ICFA 1NK8A 3RB4A 9ICWA 3EZ5A 2IA6A 5F9NA 2NRVA 4J9PA 4KLQA 2V4QA 1ZQTA 1D8YA 2BCRA 1X9WA 3C23A 5IIIA 2NRWA 4F5NA 3UXNA 4KLHA 4ED3A 4KTQA 2XCPA 2ZJ5A 3GQCA 4I2BA 1S0VA 4ECUA 2ZUCA 2PFOA 3RR8A 4I2FA 4ECTA 4R64A 3RJFA 1BPDA 2DFLA 7ICNA 3H4DA 4NLNA 1NK4A 4DFPA 4DOCA 1NKEA 1ZQRA 4DSIA 4Q45A 2V4RA 1D8LA 2PXIA 3LK9A 2XY6A 1ZJMA 2ALZA 5D46A 4EZ6A 2AQ0A 1Z00A 1SKWA 8ICMA 3AU2A 5DQIA 4YCXA 2Q0ZX 2XCAA 8ICGA 1AROP 4K4HA 4PHEA 2ZUDA 9ICAA 2R8KA 3V7LA 3KHHA 1RZTA 2GWSA 4UBBA 4I2IA 4YQWA 5J0OA 1U9LA 5KG5A 1NK6A 2W8KA 3FDSA 4B9NA 5KT3A 5KFLA 2W9AA 1S76D 4EBDA 4DFMA 3MFHA 4ED7A 4QWCA 3BQ1A 3GIIA 2P6RA 8ICIA 4RQ2A 4QZAA 9ICRA 1DGSA 4I27A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SKR A;  3PNC A;  4QZH A;  2LYH A;  5KG0 A;  4EYH B;  1Z00 B;  5L1J A;  3JPS A;  4F8R A;  4YN4 A;  1MQ3 A;  4DS5 A;  1UT8 A;  5KFK A;  4DOB A;  5EWE A;  2BPF A;  4DSE A;  4TUS A;  1ZQV A;  4Q43 A;  5DB7 A;  1XSL A;  4I2G A;  4TUR A;  2IMW P;  2ASL A;  4DQP A;  5HHI A;  2KZ3 A;  5KG1 A;  7ICK A;  2AGQ A;  7ICV A;  5KFM A;  2ISP A;  1QSL A;  4K4I A;  5EWG A;  5DGB A;  4Q44 A;  3RJG A;  9ICU A;  1ZQM A;  4DF4 A;  4QZG A;  7ICU A;  8ICO A;  1KTQ A;  4UB1 A;  4F50 A;  3Q8R B;  4ECV A;  3MBY A;  4IRK A;  4MF8 A;  3H7I A;  5KFC A;  1LV5 A;  1BPZ A;  4O9M A;  3UQ2 A;  5KG2 A;  3PO4 A;  4B9S A;  3JPT A;  4O3O A;  3UXP A;  3UPQ A;  3C1Z A;  1ZQN A;  3PML A;  4XQ8 A;  4PHP A;  2C28 A;  1U48 A;  5HMM A;  5KT7 A;  5J2D A;  2F1H A;  4RUA A;  3ISB A;  1L3U A;  7ICP A;  4QW8 A;  7ICI A;  5J2B A;  1NK9 A;  1S0N A;  2ZUB A;  4QZC A;  1KEJ A;  1N56 A;  1ZQY A;  1ZQD A;  5J2F A;  4UAW A;  4O5C A;  4GC7 A;  2ASD A;  1XSN A;  4TUQ A;  4IQT A;  4DL4 A;  5KT2 A;  3E2E A;  2ZJA A;  3N4M B;  3RRH A;  2IBK A;  1EXN A;  4RNM A;  3EPG A;  3IHQ B;  3PX0 A;  4F5O A;  3TAN A;  3RR7 A;  1SL2 A;  4YMO A;  2ATL A;  1MQ2 A;  3RAX A;  4KLG A;  1S0M A;  4Z6E A;  1B43 A;  1PZN A;  4QZI A;  1TVA A;  4KLM A;  1JIH A;  9ICH A;  5J0W A;  3PR4 A;  1JXL A;  1MSW D;  4DLE A;  5CP2 A;  7ICG A;  1UA0 A;  1NJY A;  3RRG A;  4QWD A;  7ICL A;  3TAP A;  3BJY A;  4RQ3 A;  4KLU A;  2C2R A;  3B0Y A;  5L9X A;  3LDA A;  4M04 A;  4G3I A;  2KZM A;  4YD1 A;  8ICP A;  5KFB A;  9ICT A;  5DQG A;  3JPO A;  3GIJ A;  3V7J A;  4HYK A;  4ECY A;  3UXO A;  2ZTD A;  1KDH A;  1NJZ A;  1DOQ A;  4RQ5 A;  5F9L A;  5KFS A;  4RQ4 A;  4M9L A;  3RBD A;  3Q8L A;  9ICK A;  9ICS A;  3PW4 A;  3C5F A;  5J2K A;  4JUZ A;  2AGP A;  2ZJ8 A;  2XY7 A;  4UAZ A;  2MUT A;  1N48 A;  4DSL A;  3AU6 A;  2R8G A;  4DQR A;  5KFE A;  3KHL A;  4ECX A;  3SYZ A;  2JZB A;  5KFA A;  1T3N A;  4IRD A;  4K4G A;  3K75 D;  2BQR A;  1ZYQ A;  4RZR A;  5DDY A;  4EYI B;  4ED0 A;  3Q8S B;  4RNN A;  2I9G A;  1L3T A;  2FMS A;  3H8W A;  5DLF A;  4DS4 A;  4C8O A;  5DBB A;  2I1Q A;  3ORY A;  4JV1 A;  2AGO A;  1ZQJ A;  4JV2 A;  8ICS A;  2JEI A;  3GDX A;  3ISC A;  3GV8 B;  5DG9 A;  4LZD A;  4ECS A;  1RYR A;  3C1Y A;  2PFN A;  4YMN A;  1ZQW A;  4RQ8 A;  4YVZ A;  5CR0 A;  5J2I A;  2WTF A;  1D9D A;  2FPM A;  2XC9 A;  1UA1 A;  3C2M A;  3ZDE A;  2VA3 A;  3JPP A;  2BPC A;  4TQS A;  2MUT B;  5J0U A;  4YP3 A;  3MDA A;  4EBE A;  2BPG A;  4F93 B;  3GIL A;  4YXM A;  4DL3 A;  1KSP A;  3ZDC A;  2JZB B;  9ICG A;  4F3O A;  3BQ2 A;  1B22 A;  1BPE A;  3BQT A;  4O3P A;  4ED8 A;  1XS9 D;  4IRC A;  5C5J A;  4UB3 A;  2FPL A;  2HHT A;  4ED2 A;  4M6W A;  4F4K A;  4J9Q A;  4NXZ A;  4KMU A;  5KG4 A;  3MAB A;  3ZD8 A;  1ZQI A;  9ICE A;  1L3S A;  1QSY A;  4DFK A;  2BR0 A;  8ICE A;  8ICN A;  1XSP A;  1TK5 A;  4ELV A;  9ICX A;  3HX0 A;  2VA8 A;  5KFG A;  4QWE A;  2AQ4 A;  2KTQ A;  9ICV A;  4DO9 A;  2UVV A;  5J0T A;  8ICR A;  4M2Y A;  5JUM A;  8ICZ A;  5HNK A;  1BPY A;  3H40 A;  3UQ0 A;  4UB5 A;  3EPI A;  4UAY A;  3V6K A;  1CEZ A;  4I2J A;  1K1S A;  3G6Y A;  4QZF A;  5J2C A;  1ZQB A;  4BDP A;  4KLT A;  2BCU A;  3PW7 A;  3RJI A;  2BHN A;  3HPO A;  1S9F A;  3T5H A;  4LVS A;  4KN7 A;  4IQU A;  1RPL A;  2F1J A;  3LWM A;  2FMP A;  7ICR A;  3MR5 A;  4M6W B;  5DBA A;  4PHA A;  2BQ3 A;  4GXJ A;  5DG7 A;  4ECW A;  3SV3 A;  2HHS A;  1BVS A;  1RXW A;  1H38 A;  1BPB A;  4R66 A;  4J9S A;  4DQQ A;  2J6T A;  3OSP A;  1CUK A;  4JK1 A;  3ZDB A;  4J9N A;  4I29 A;  4F91 B;  1ZQF A;  4P4O A;  1Z3E B;  2IHM A;  5KFZ A;  2W9B A;  2W9C A;  4BXO A;  1IM4 A;  4DQS A;  4O3N A;  2C2D A;  4O3R A;  4Q8F A;  8ICT A;  4FBU A;  2NRZ A;  3G6X A;  4RNO A;  5EWF A;  4ECR A;  3RBE A;  5KG3 A;  4I2H A;  3RAQ A;  4FS2 A;  4DFJ A;  5DBC A;  4M9H A;  3M9O B;  4O3S A;  4F2R A;  5J0P A;  4Z6C A;  5CB1 A;  4F92 B;  1WCL A;  2R8I A;  3PMN A;  3PV8 A;  1SL0 A;  3TAR A;  1D9F A;  4QZE A;  2F1I A;  4J9M A;  2V9W A;  2BCV A;  4E0D A;  5J0X A;  5KFJ A;  3JPQ A;  3V6H A;  1RYS A;  2MAX A;  4YD2 A;  5DDM A;  4F4W A;  3T5K A;  4JWM A;  4MFF A;  3HP6 A;  3SZ2 A;  3M8S A;  1NKB A;  4UB2 A;  2M9N A;  8ICW A;  4FO6 A;  4FBT A;  4PGY A;  2P6U A;  5KFW A;  4UBC A;  3PR5 B;  2Y1J A;  2W9B B;  4XA5 A;  4BXO B;  4O5E A;  3M9N B;  3AUO A;  3RB0 A;  1SL1 A;  4QWA A;  1TKD A;  3NGD A;  2HHW A;  3C2L A;  2HVI A;  1KFT A;  3H8S A;  5L1L A;  1U45 A;  3FYH A;  9ICI A;  1XU4 A;  5KT6 A;  5IIJ A;  4ECQ A;  4B9V A;  1WCN A;  7ICE A;  4M47 A;  2AU0 A;  4MEY A;  2HHU A;  4DLG A;  5CJ7 A;  7ICQ A;  3GIM A;  4DL5 A;  4DF8 A;  4DL7 A;  2J6U A;  4KLI A;  1L3V A;  2HW3 A;  2FLP A;  4GLX A;  3KTQ A;  1L5U A;  4QW9 A;  1ZJN A;  3PW5 A;  3B0X A;  5DB6 A;  4RT2 A;  3JPR A;  1KFD A;  3PW2 A;  8ICQ A;  5L1I A;  3T3F A;  4RPZ A;  3ZDD A;  4ECZ A;  2OWO A;  2HHX A;  1T8E A;  5D49 A;  9ICB A;  1SKS A;  3K4G A;  2XO7 A;  4LZG A;  1S77 D;  2KZZ A;  9ICN A;  3OGU A;  4YG2 A;  3RH6 A;  5J0R A;  1ZQA A;  5KFI A;  4I2C A;  3Q8P B;  5KG6 A;  3PW0 A;  1NOM A;  2IHN A;  4F2S A;  4IQV A;  1A76 A;  1LB2 B;  4MEX A;  3T5L A;  4ZH4 A;  3PX6 A;  3Q8K A;  3V6J A;  5J2A A;  1QSS A;  2VA2 A;  2HHV A;  9ICP A;  1T7P A;  5D4B A;  5HHH A;  4JWN A;  4O0I A;  4RU9 A;  2BDP A;  2C2E A;  8ICA A;  3GV7 B;  5KFR A;  4B9T A;  1C7Y A;  1ZQU A;  3KHR A;  2BQU A;  4BWM A;  1A77 A;  5DB8 A;  2PI4 A;  1ZQL A;  1JXE A;  9ICM A;  1KFS A;  3EWA A;  5DGA A;  3C2K A;  4EEY A;  1UT5 A;  5KFV A;  2RDI A;  4Z6D A;  5BPC A;  2ASJ A;  1TK8 A;  1U49 A;  1TAQ A;  4KLF A;  4PGX A;  1ZQE A;  3H4B A;  2PFP A;  4TUP A;  2NRT A;  3TI0 A;  3BQ0 A;  4MFA A;  3MDC A;  7ICF A;  3JPN A;  4YXJ A;  3OJU A;  4M0A A;  4B9M A;  4QZ9 A;  5KFD A;  4PHD A;  1COO A;  9ICC A;  3PY8 A;  4O5K A;  5KFQ A;  3MGI A;  1V9P A;  1KLN A;  1XO1 A;  5BOL A;  2DPJ A;  4C8M A;  4P4M A;  2W9M A;  4JV0 A;  5KFX A;  1NJW A;  4ELT A;  5IIN A;  4QWB A;  3QZ7 A;  3KHG A;  4I2E A;  5KFP A;  9ICJ A;  4M9J A;  4GXK A;  5KFH A;  5J2G A;  3QZ8 A;  2FMQ A;  3RH4 A;  9ICO A;  3GFK B;  4ED1 A;  1U4B A;  1MC8 A;  4DSK A;  2P66 A;  2UVR A;  4I2A A;  9ICL A;  4BWJ A;  1TV9 A;  4DL6 A;  3RTV A;  4UB4 A;  1HUZ A;  3RB6 A;  4F5R A;  2ZTC A;  4RQ1 A;  2PI5 A;  1X9S A;  1ZQS A;  1QTM A;  2A1J A;  5HP4 A;  1K1Q A;  5IIO A;  1KRP A;  4B9U A;  1ZQO A;  1S0O A;  3ZD9 A;  3GV5 B;  4P4P A;  4C8K A;  2NRX A;  3QE9 Y;  1X2I A;  5KG7 A;  3RJH A;  2KFZ A;  1TAU A;  4QZB A;  5KFO A;  5J0Q A;  4RT3 A;  5CA7 A;  2W8L A;  4RUC A;  1SZP A;  4KN4 A;  4RQ0 A;  3RJE A;  4MFC A;  4QZD A;  3ISD A;  4O3Q A;  2UVW A;  3PO5 A;  1T4G A;  2XGQ A;  4YMM A;  2J6S A;  5J2E A;  3Q8Q B;  2H5X A;  1S10 A;  1BGX T;  4CCH A;  3OHB A;  4GXI A;  4EZ9 A;  3M8R A;  4UQG A;  3V72 A;  4NY8 A;  4NLZ A;  8ICV A;  8ICX A;  4X5V A;  3ETL A;  1ZQX A;  4F5Q A;  8ICH A;  4F4Z A;  4ED6 A;  2DPI A;  4M9G A;  7ICJ A;  4YFK A;  2A1J B;  4I2D A;  3HW8 A;  5L1K A;  2XY5 A;  1BPX A;  4RQ6 A;  1NJX A;  4PH5 A;  1X9M A;  1IXR A;  1Y88 A;  4J9K A;  7ICO A;  2JEF A;  5KFU A;  4XUS A;  1NKC A;  4DSJ A;  5IIM A;  1JN3 A;  4IR9 A;  2ZTE A;  4DOA A;  3PVX A;  2BKE A;  4J9O A;  4C8N A;  5IIL A;  4ELU A;  2BCQ A;  5DQH A;  3G6V A;  3MFI A;  1NK5 A;  5KT5 A;  4KLO A;  5DB9 A;  2Y1I A;  5DG8 A;  1ZQQ A;  4R8U A;  4RQ7 A;  4DL2 A;  2C22 A;  1NK7 A;  5J2H A;  5IIK A;  1RXV A;  2BCS A;  4M9N A;  8ICY A;  3EW9 A;  4R65 A;  5DKW A;  2W9C B;  3OJS A;  3TAQ A;  5KFT A;  4NM2 A;  4P2H A;  4BGD A;  2KN7 A;  4PPX A;  2RDJ A;  1HJP A;  5EOZ A;  8ICK A;  8ICL A;  4J9L A;  4KIT B;  2R8H A;  2B21 A;  2FLL A;  3RJK A;  4Z6F A;  3BDP A;  3ZDA A;  4NM1 A;  3V7K A;  2HVH A;  3T5J A;  8ICC A;  8ICU A;  7ICS A;  5J2J A;  5KT4 A;  4C8L A;  1ZQP A;  8ICB A;  3PX4 A;  5J0Y A;  3RB3 A;  1HUO A;  4KLS A;  4EBC A;  2PFQ A;  4B9L A;  3N97 B;  2ISO A;  4YR3 A;  9ICF A;  2KFN A;  3OSN A;  4KLD A;  4KLL A;  3GIK A;  2R8J A;  4R8U B;  3HWT A;  5BOM A;  5TZV A;  3MR6 A;  3LWL A;  4QZ8 A;  4KLE A;  3IM1 A;  4I28 A;  1QLN A;  2FPK A;  5J0S A;  3MGH A;  4RPY A;  1S97 A;  2BGW A;  2AJQ A;  4MF2 A;  1XC9 A;  2JEJ A;  3C21 A;  4DEZ A;  3EYZ A;  1ZQC A;  3C5G A;  3TFS A;  3Q8M A;  4KLJ A;  7ICM A;  1U47 A;  7ICT A;  3QEB Z;  1ZET A;  4PGQ A;  3THV A;  5DLG A;  5CHG A;  4IR1 A;  4FS1 A;  4YR2 A;  4TQR A;  4R63 A;  4GC6 A;  1NK0 A;  4J9R A;  3RJJ A;  4DSF A;  1JX4 A;  5KFF A;  3SI8 A;  4RPX A;  2HHQ A;  3TQ1 A;  1TFR A;  2VAN A;  4F5P A;  1ZQG A;  4DWI A;  1XWL A;  5HML A;  2JEG A;  4DQI A;  5KFY A;  7ICH A;  2XGP A;  5J29 A;  4F4Y A;  3RH5 A;  3MR3 A;  3SV4 A;  3MR2 A;  4YR0 A;  4XRH A;  1ZQZ A;  8ICJ A;  3OHA A;  5CWR A;  3NTU A;  3TFR A;  4NLG A;  5KTQ A;  1ZQK A;  4IQW A;  1JMS A;  1ZQH A;  1TK0 A;  4NLK A;  3HT3 A;  3M9M B;  2FLN A;  9ICQ A;  3QEA Z;  3H8J A;  5KFN A;  4F4X A;  2UVU A;  4Q8E A;  8ICF A;  1NK8 A;  3RB4 A;  9ICW A;  3EZ5 A;  2IA6 A;  5F9N A;  2NRV A;  4J9P A;  4KLQ A;  2V4Q A;  1ZQT A;  1D8Y A;  2BCR A;  1X9W A;  3C23 A;  5III A;  2NRW A;  4F5N A;  3UXN A;  4KLH A;  4ED3 A;  4KTQ A;  2XCP A;  2ZJ5 A;  3GQC A;  4I2B A;  1S0V A;  4ECU A;  2ZUC A;  2PFO A;  3RR8 A;  4I2F A;  4ECT A;  4R64 A;  3RJF A;  1BPD A;  2DFL A;  7ICN A;  3H4D A;  4NLN A;  1NK4 A;  4DFP A;  4DOC A;  1NKE A;  1ZQR A;  4DSI A;  4Q45 A;  2V4R A;  1D8L A;  2PXI A;  3LK9 A;  2XY6 A;  1ZJM A;  2ALZ A;  5D46 A;  4EZ6 A;  2AQ0 A;  1Z00 A;  1SKW A;  8ICM A;  3AU2 A;  5DQI A;  4YCX A;  2Q0Z X;  2XCA A;  8ICG A;  1ARO P;  4K4H A;  4PHE A;  2ZUD A;  9ICA A;  2R8K A;  3V7L A;  3KHH A;  1RZT A;  2GWS A;  4UBB A;  4I2I A;  4YQW A;  5J0O A;  1U9L A;  5KG5 A;  1NK6 A;  2W8K A;  3FDS A;  4B9N A;  5KT3 A;  5KFL A;  2W9A A;  1S76 D;  4EBD A;  4DFM A;  3MFH A;  4ED7 A;  4QWC A;  3BQ1 A;  3GII A;  2P6R A;  8ICI A;  4RQ2 A;  4QZA A;  9ICR A;  1DGS A;  4I27 A; 
#chains in the Genus database with same CATH topology
 1UT8 A;  3SR6 A;  1RG6 A;  4C4T A;  4DSE A;  2L5Y A;  3SEN A;  7ICK A;  2Y9U A;  7ICV A;  5KFM A;  4Q44 A;  1FFU A;  4QZG A;  1KTQ A;  4IRK A;  4MF8 A;  1LV5 A;  1BPZ A;  3UQ2 A;  3UXP A;  2E8N A;  4O3O A;  2DF4 B;  2A19 A;  3PML A;  5AKG A;  2C28 A;  1U48 A;  4KLG A;  5HMM A;  2F1H A;  7ICP A;  1L3U A;  2H3I A;  7ICI A;  1NK9 A;  2K8A A;  1Z19 A;  4FE3 A;  3UMC A;  1ZQD A;  5J2F A;  2KSO A;  1XSN A;  5AK5 A;  5KT2 A;  2AXT U;  4RNM A;  3EPG A;  3PX0 A;  3HKZ F;  4F5O A;  3TAN A;  5ALL A;  2ATL A;  4Z6E A;  1PZN A;  3VCB A;  1JIH A;  1KL9 A;  5F3X B;  5CP2 A;  3LDA A;  1ZD5 A;  4YD1 A;  9ICT A;  4PZO A;  3JPO A;  3UXO A;  3M6K A;  2KSO B;  2XVT A;  3NRW A;  5F9L A;  2EZZ A;  2KMD A;  4JUZ A;  1N48 A;  4DSL A;  3AU6 A;  2HCF A;  5GTI U;  1F44 A;  2EH9 A;  4IRD A;  1UQV A;  4K4G A;  1ZYQ A;  1N2X A;  2LPE A;  2E8P A;  2FMS A;  2B0C A;  5DBB A;  3GDX A;  3ISC A;  5DG9 A;  2H3V A;  1Z4O A;  3PZP A;  4YVZ A;  5ALV A;  1D9D A;  2XC9 A;  2VA3 A;  2BPC A;  5TIS U;  4TQS A;  4EBE A;  4YXM A;  4KX5 A;  2YQE A;  4ED8 A;  1XS9 D;  4UB3 A;  2FPL A;  4ED2 A;  4M6W A;  4F4K A;  4NXZ A;  1JAL A;  2G0A A;  1XNS A;  1AQ6 A;  8ICN A;  3WKC A;  3UQ0 A;  4UAY A;  1K1S A;  5AIB A;  3HPO A;  1S9F A;  3T5H A;  1COK A;  4LVS A;  4IQU A;  3MR5 A;  4M6W B;  5DBA A;  4RQN A;  1L7M A;  2F8K A;  4DQQ A;  3ETR A;  3OSP A;  4JK1 A;  4J9N A;  4F91 B;  1Z3E B;  3L4P A;  2W9B A;  3PSF A;  2W9C A;  4O3R A;  8ICT A;  5AM0 A;  3KOO A;  4Z6C A;  3PV8 A;  1SL0 A;  1WCL A;  3PMN A;  2F1I A;  4J9M A;  5KFJ A;  2KNJ A;  3N7R C;  4F4W A;  3T5K A;  3HP6 A;  4U6P A;  3M8S A;  3CW2 C;  1NKB A;  4C0Z A;  4FBT A;  2W9B B;  3RB0 A;  5ALX A;  2N1R A;  3C2L A;  1KFT A;  5L1L A;  3I1Y A;  3FYH A;  4ECQ A;  1WCN A;  3E0F A;  2DGZ A;  5G5G A;  2AU0 A;  3ZI4 A;  7ICQ A;  3GIM A;  2HW3 A;  3CYM A;  4QW9 A;  3D2Q A;  3B0X A;  3PSI A;  1KFD A;  2LM1 A;  1NNL A;  3K4G A;  2K4I A;  4OJO A;  5KL8 B;  5KFI A;  3ALR A;  3SAF A;  4I2C A;  5KG6 A;  3LYS A;  1LB2 B;  2RHF A;  4ZH4 A;  3PX6 A;  3CRX A;  9ICP A;  4JWN A;  4O0I A;  4RU9 A;  2F44 A;  5KFR A;  1WWU A;  5AM5 A;  2PI4 A;  2EQY A;  2ZIX A;  1UT5 A;  4Z6D A;  2ASJ A;  3TAD C;  2PFP A;  1PK3 A;  3BQ0 A;  2XID A;  5KFQ A;  1V9P A;  5J8Y A;  5KFX A;  1NJW A;  4ELT A;  5AI6 A;  2CPR A;  4ED1 A;  1MC8 A;  3M6Z A;  4DSK A;  2ZIX B;  3RTV A;  1HUZ A;  5C0Y A;  1QTM A;  2A1J A;  5IIO A;  4B9U A;  4BUG A;  2P35 A;  3GV5 B;  2DKZ A;  1TAU A;  2W8L A;  2D8C A;  4KN4 A;  3RJE A;  2UVW A;  1T4G A;  2XGQ A;  2J6S A;  2DUY A;  1BGX T;  4CCH A;  3OHB A;  4GXI A;  4EZ9 A;  2KG5 A;  4NLZ A;  4U7C A;  2MSN A;  4EEN A;  1SXE A;  1ZQX A;  3BS7 A;  4F4Z A;  4YFK A;  2A1J B;  3HW8 A;  5L1K A;  4PH5 A;  1IXR A;  1PVP A;  3LVW A;  3D6J A;  5KFU A;  4OCZ A;  2ZTE A;  2VJ5 A;  1X42 A;  3PVX A;  2BCQ A;  4QJF B;  3MFI A;  4KLO A;  5DB9 A;  2C22 A;  5J2H A;  5IIK A;  5JTI A;  2ZXI A;  2QAR A;  4NM2 A;  1HJP A;  2CN1 A;  2FLL A;  4KIT B;  2R8H A;  2B21 A;  3RJK A;  8ICC A;  7ICS A;  5KT4 A;  8ICB A;  1DK3 A;  4NWI A;  1HUO A;  2RLT A;  4EBC A;  2AHO B;  4UB6 U;  3N97 B;  9ICF A;  4YR3 A;  4KLL A;  3HWT A;  5TZV A;  1V97 A;  1F0M A;  4Y2U A;  2QAR B;  2BGW A;  4MF2 A;  3EYZ A;  1ZQC A;  3Q8M A;  7ICM A;  3B9J A;  5AHX A;  7ICT A;  4PGQ A;  3F2C A;  4TQR A;  1NK0 A;  4PL1 A;  3FC4 A;  5KFF A;  1L8O A;  3H0M B;  4F5P A;  4DWI A;  2JEG A;  2K89 A;  4F4Y A;  3RH5 A;  3MR3 A;  3SV4 A;  3WKE A;  3H0L B;  1JMS A;  1TK0 A;  4NLK A;  3AL0 B;  2FLN A;  3DDH A;  3H8J A;  1NK8 A;  3RB4 A;  5ALJ A;  2IA6 A;  2WAQ C;  5F9N A;  2NRV A;  4KLQ A;  3BZK A;  1D8Y A;  2VKQ A;  1ZRN A;  3C23 A;  3IG8 A;  3UXN A;  4KLH A;  2YB1 A;  3GQC A;  4I2F A;  1BPD A;  3QNM A;  4OJP A;  1NK4 A;  1SGG A;  1WG8 A;  1ZQR A;  4Q45 A;  1N60 A;  3KKA A;  2XY6 A;  1ZJM A;  2ALZ A;  5D46 A;  1SKW A;  3ED5 A;  4YCX A;  4KMO B;  9ICA A;  3KHH A;  1Q3U A;  3RF9 A;  1C20 A;  4B9N A;  1HIW A;  1F5S A;  4ED7 A;  2CRX A;  4RQ2 A;  4I27 A;  2ESE A;  4QZH A;  4NLC A;  4EYH B;  5L1J A;  3JPS A;  4YN4 A;  1MQ3 A;  4DS5 A;  4DOB A;  4MHV A;  3TAC B;  4EX6 A;  1L7N A;  4TUS A;  1ZQV A;  4I2G A;  3M7D A;  4DQP A;  5HHI A;  4K4I A;  5EWG A;  9ICU A;  4DF4 A;  8ICO A;  4OJ6 A;  1SB3 C;  3Q8R B;  3MBY A;  1Q46 A;  3H7I A;  2PKE A;  1L7P A;  5KG2 A;  2KOB A;  2NV3 A;  2KD1 A;  5J2B A;  2KP7 A;  1S0N A;  2EAN A;  3KZI U;  4UAW A;  2A1A A;  4TUQ A;  3E2E A;  3RRH A;  1YZ7 A;  1X66 A;  4YMO A;  1MQ2 A;  9ICH A;  5GTH U;  1JXL A;  2FJ6 A;  2W11 A;  1MSW D;  7ICG A;  1UA0 A;  1NJY A;  4KLU A;  5L9X A;  3SAH A;  4M04 A;  4G3I A;  1PVQ A;  3A0H U;  3N28 A;  3GIJ A;  3V7J A;  1NJZ A;  1DOQ A;  3RBD A;  3F5A A;  3C5F A;  3QUQ A;  2ZJ8 A;  2FDR A;  2R8G A;  5ALT A;  4ECX A;  3SYZ A;  2JZB A;  1T3N A;  3AMZ A;  2Z7J A;  2I9G A;  5DLF A;  2HMX A;  4C8O A;  2K60 A;  3WK4 A;  4IC9 A;  4JV1 A;  4JV2 A;  1ZQJ A;  2JEI A;  3GV8 B;  4LZD A;  5ALI A;  1RYR A;  1QH9 A;  4YMN A;  1ZQW A;  4RQ8 A;  5J2I A;  1KW4 A;  3QU9 A;  2WTF A;  2E3T A;  3JPP A;  1ZXI A;  3OPX A;  4YP3 A;  3UMB A;  3GIL A;  4DL3 A;  9ICG A;  2JZB B;  3F53 A;  1O08 A;  4F3O A;  5CRX A;  5AM3 A;  3BQ2 A;  1B22 A;  3EUB 2;  5C5J A;  2LBO A;  5G5H A;  5KG4 A;  3ZD8 A;  9ICE A;  3ICX A;  4DFK A;  3WK5 A;  2YX8 A;  3KBB A;  4KX3 A;  4QWE A;  1IV8 A;  9ICV A;  4UB5 A;  1FFV A;  2QKQ A;  4I2J A;  1DGJ A;  4QZF A;  4BDP A;  2BCU A;  2H3Q A;  4PHA A;  1PUZ A;  1BVS A;  1RXW A;  4R66 A;  2WB1 F;  1Z1B A;  1CUK A;  3ZDB A;  4I29 A;  4P4O A;  2IHM A;  5KFZ A;  2M0N A;  5AIC A;  2XI9 A;  2C2D A;  1TAM A;  2NRZ A;  3RBE A;  5DBC A;  3M9O B;  4O3S A;  4F2R A;  3QUT A;  4F92 B;  2R8I A;  3BZC A;  3TAR A;  4QZE A;  2CXY A;  5J0X A;  3JPQ A;  2DBY A;  3V6H A;  1ECW A;  4DCC A;  2MAX A;  4YD2 A;  5DDM A;  5AI4 A;  2W03 A;  3PR5 B;  4XA5 A;  5HR6 A;  2Y9T A;  1A0P A;  2HHU A;  2W7O A;  1L3V A;  2FLP A;  1ZJN A;  2ZIV A;  3HIL A;  4Y2J A;  2EZX A;  4G9B A;  8ICQ A;  4J03 A;  1T8E A;  5D49 A;  1VDV A;  1S77 D;  2MRL A;  5ALY A;  2B6G A;  3WKA A;  3Q8P B;  3PW0 A;  1NOM A;  2IHN A;  4IQV A;  1A76 A;  1TE2 A;  3LVV A;  3T5L A;  1QSS A;  2ZIV B;  2C2E A;  2JXJ A;  4B9T A;  3D2S A;  4Y2V A;  3EWA A;  5DGA A;  5KFV A;  3NUQ A;  2ZXH A;  4GFJ A;  1UCV A;  4MFA A;  7ICF A;  4UAU A;  1XO0 A;  4B9M A;  5KFD A;  2LHT A;  5ALS A;  4OD0 A;  5A0L A;  2DPJ A;  4Y2Y A;  2DWQ A;  2YTU A;  5L1M A;  3KHG A;  4I2E A;  9ICJ A;  4GXK A;  3AQF A;  5KFH A;  3QZ8 A;  2YML A;  3QUB A;  1RQL A;  3N7S C;  2LKY A;  1JRO A;  1SWV A;  3MC1 A;  3I76 A;  4UB4 A;  1FO4 A;  1T3Q A;  4RQ1 A;  1OUQ A;  1ZQS A;  2IOH A;  5HP4 A;  1K1Q A;  1ZQO A;  2EAM A;  4HAI A;  3WU2 U;  1S0O A;  1JI7 A;  4P0P A;  4C8K A;  3QE9 Y;  1X2I A;  5KFO A;  3NAS A;  3F5E A;  5CA7 A;  4RUC A;  1SZP A;  1SV4 A;  5AKY A;  4QZD A;  3ISD A;  3HKZ C;  3PO5 A;  5J2E A;  3QXG A;  4AP9 A;  3V72 A;  4UQG A;  8ICX A;  8ICV A;  1HEK A;  3ETL A;  4ED6 A;  2DPI A;  7ICJ A;  4I2D A;  1BPX A;  4RQ6 A;  7ICO A;  1Y88 A;  4J9K A;  2KJ5 A;  2JEF A;  4XUS A;  4P0P B;  4DSJ A;  5IIM A;  4IR9 A;  5AK4 A;  3QYP A;  4UB8 U;  3WK6 A;  4DOA A;  1Q8K A;  3CP8 A;  5DQH A;  2ES6 A;  5AK3 A;  4RQ7 A;  4DL2 A;  1RXV A;  2ODG A;  8ICY A;  2BCS A;  3EW9 A;  4R65 A;  2W9C B;  1SV0 C;  3OJS A;  5KFT A;  2HI0 A;  2KN7 A;  5AKK A;  4J9L A;  4OJL A;  3ZDA A;  2R18 A;  2HVH A;  2OM6 A;  2A3V A;  3MGV A;  1ZQP A;  3PX4 A;  5J0Y A;  2IOF A;  2K4P A;  1X9X A;  1V85 A;  4B9L A;  3ONN A;  2KFN A;  3OSN A;  4KLD A;  3GIK A;  2R8J A;  1L8L A;  3T79 A;  4I28 A;  1CI4 A;  3IG5 A;  4WJ3 B;  2JEJ A;  1T94 A;  3C5G A;  2D6F C;  3S6J A;  1KN5 A;  5KAF U;  4GC6 A;  2HBL A;  2PMZ F;  3SI8 A;  2HHQ A;  5EE1 A;  2NO4 A;  1ZQG A;  2LYB A;  4C4R A;  5KFY A;  1M6Y A;  3MR2 A;  4XRH A;  8ICJ A;  2GO7 A;  4NLG A;  5KTQ A;  5AK6 A;  1MA7 A;  3HT3 A;  3M9M B;  9ICQ A;  3QEA Z;  5KFN A;  8ICF A;  1ZQ1 C;  2UVU A;  3EZ5 A;  1QCK A;  2WF6 A;  5KAI U;  1ZQT A;  2BCR A;  1A6S A;  3J81 j;  1LVH A;  3F2B A;  4EX7 A;  1S0V A;  3RR8 A;  3RJF A;  2WF5 A;  2DFL A;  3H4D A;  2V4R A;  1D8L A;  2PXI A;  3WK7 A;  1Z00 A;  1RYU A;  4K4H A;  1RZT A;  2GWS A;  3D2N A;  5J0O A;  4Y2R A;  4CF4 A;  3FDS A;  5KT3 A;  2W9A A;  2KK0 A;  1CRX A;  4EBD A;  4DFM A;  3MFH A;  4NV0 A;  3GII A;  1SKR A;  3UM9 A;  2LYH A;  1Z00 B;  4F8R A;  5EWE A;  2BPF A;  2YMP A;  2WAQ F;  1XSL A;  5ALO A;  5DB7 A;  2IMW P;  2KZ3 A;  5KG1 A;  2AGQ A;  2ISP A;  1QSL A;  4ACO A;  5DGB A;  2HOQ A;  5ALM A;  3AQE A;  7ICU A;  4F50 A;  4ECV A;  2JRZ A;  5KFC A;  3IN5 A;  1ZQN A;  5KT7 A;  5J2D A;  5AIA A;  1RM6 C;  4QW8 A;  2HBJ A;  2KKV A;  3TAD A;  5ALE A;  4GC7 A;  4PZN A;  4IQT A;  3N4M B;  3QU2 A;  1EXN A;  3IHQ B;  2HBK A;  3SAG A;  1SL2 A;  3RAX A;  4KLM A;  2QB1 A;  3NVW A;  3FAH A;  4IS7 A;  4QWD A;  1KBU A;  3BJY A;  4RQ3 A;  3B0Y A;  1X40 A;  2OH2 A;  2JR5 A;  3F2D A;  2KZM A;  8ICP A;  5DQG A;  4HYK A;  4ECY A;  2ZTD A;  1KDH A;  4BJQ A;  4LJX A;  2Y0S F;  5KFS A;  4Y2T A;  4M9L A;  3Q8L A;  4FZM A;  2HSZ A;  2NYV A;  5J2K A;  2XY7 A;  4DQR A;  2YMQ A;  4NL9 C;  1S5L U;  3K75 D;  4CF3 A;  2BQR A;  5DDY A;  4ED0 A;  4RNN A;  3H8W A;  1PK1 A;  2I1Q A;  3ORY A;  8ICS A;  4ECS A;  2PFN A;  1BNO A;  5CR0 A;  4BX9 C;  3HRD D;  2DKX A;  3MDA A;  2BPG A;  3WK8 A;  4F93 B;  4QIW F;  3ZDC A;  2W43 A;  2HOF A;  1Q3V A;  2F2A B;  4CRX A;  4IRC A;  2HHT A;  1PK1 B;  2RQ5 A;  4KMU A;  1JRP A;  2BR0 A;  9ICX A;  1TK5 A;  3SMV A;  2VA8 A;  4DO9 A;  5J0T A;  5JUM A;  5AM2 A;  5HNK A;  3H40 A;  1DK2 A;  3EPI A;  1N62 A;  3G6Y A;  2I6X A;  5J2C A;  3RJI A;  2BHN A;  4USA A;  3SEI A;  3IDW A;  1RPL A;  7ICR A;  5DG7 A;  4ECW A;  3SV3 A;  3C29 A;  2H3Z A;  5AI8 A;  2J6T A;  1D8B A;  1ZQF A;  2QLT A;  1FIQ A;  4BXO A;  5AKJ A;  4DQS A;  4O3N A;  4Q8F A;  4FBU A;  2W7P A;  3G6X A;  4ECR A;  5KG3 A;  4I2H A;  4AYB F;  4M9H A;  2W3S A;  5CB1 A;  2BCV A;  4E0D A;  1RYS A;  5JU5 A;  4JWM A;  3SZ2 A;  3QU5 A;  2WF9 A;  1Z1V A;  4UB2 A;  1URJ A;  2M9N A;  8ICW A;  3E58 A;  2P6U A;  4Y2Q A;  4BXO B;  4US8 A;  3AUO A;  1SL1 A;  3NGD A;  5AI5 A;  2HHW A;  2HVI A;  3H8S A;  1U45 A;  2ZIW A;  5KT6 A;  1WWV A;  4B9V A;  7ICE A;  2LYA A;  4DLG A;  1YZ6 A;  4DF8 A;  2K4H A;  2J6U A;  1Z4N A;  4GLX A;  4A8E A;  3KTQ A;  3JPR A;  1YT3 A;  2W3R A;  4RT2 A;  5AI9 A;  5FP0 A;  5L1I A;  3ZDD A;  2WFA A;  4ECZ A;  2OWO A;  2HHX A;  5ALW A;  9ICB A;  9ICN A;  5E79 U;  3OGU A;  2W55 A;  4PL2 A;  4YG2 A;  4UAS A;  3RH6 A;  2FI1 A;  3O0F A;  2ZIW B;  5B66 U;  4PJ0 U;  3Q8K A;  5D4B A;  1IIP A;  8ICA A;  3GV7 B;  4Y2X A;  2G09 A;  1ED1 A;  4IL6 U;  4BWM A;  5DB8 A;  5ALP A;  1ZQL A;  1JXE A;  3C2K A;  2RP5 A;  2RDI A;  1TK8 A;  1TAQ A;  4KLF A;  4PGX A;  2KKP A;  3QU7 A;  4TUP A;  2NRT A;  2RRD A;  1RQN A;  4YXJ A;  3GU3 A;  4M0A A;  4PHD A;  3PY8 A;  4O5K A;  1KLN A;  5BOL A;  2ZIU A;  3NS1 A;  2W9M A;  4JV0 A;  5ALF A;  3UMG A;  5IIN A;  4M9J A;  5J2G A;  1N5W A;  3RH4 A;  9ICO A;  2UVR A;  9ICL A;  1KKX A;  4BWJ A;  1TV9 A;  4DL6 A;  1N61 A;  3RB6 A;  2PI5 A;  1VJ5 A;  1X9S A;  2JMG A;  2ZG6 A;  1KRP A;  3ZD9 A;  2NRX A;  5AM4 A;  3SD7 A;  2ZIU B;  3RJH A;  2KFZ A;  5J0Q A;  3N7P D;  4MFC A;  2IOF K;  3Q8Q B;  2H5X A;  1S10 A;  4X5V A;  3QX7 A;  8ICH A;  4M9G A;  5HR7 A;  3VC8 A;  4F72 A;  1UHU A;  1NJX A;  2HBM A;  2BKE A;  2H3F A;  4J9O A;  4ELU A;  3AM9 A;  2Y1I A;  1ZQQ A;  2AH5 A;  3TAQ A;  2G5H B;  1J2N A;  4P2H A;  1WUD A;  5ALQ A;  2RDJ A;  5ALU A;  4CNQ A;  5EOZ A;  2KV2 A;  8ICL A;  2E8M A;  2MA1 A;  2W04 A;  3OTQ A;  4Z6F A;  4NM1 A;  3V7K A;  5J2J A;  4C8L A;  4B6J A;  4UW9 A;  3I28 A;  4C80 A;  3BQ7 A;  2KEY A;  3NVZ A;  2PFQ A;  5ALD A;  3L5K A;  2BZF A;  5BOM A;  3MR6 A;  2F76 X;  4KLE A;  2FPK A;  1S97 A;  1BNP A;  2JH1 A;  3C21 A;  2W54 A;  4DEZ A;  5AKZ A;  4KLJ A;  5ALH A;  1U47 A;  4IR1 A;  4YR2 A;  4R63 A;  3RJJ A;  4DSF A;  3TQ1 A;  4US9 A;  1PVR A;  1TFR A;  4UAR A;  2VAN A;  4OO1 J;  2HOI A;  2G07 A;  4DQI A;  2XGP A;  2KIC A;  2K8B B;  1ZQZ A;  1SIJ A;  3OHA A;  5CWR A;  3TFR A;  1ZD4 A;  1ZQK A;  3NVV A;  4FZN A;  2KJ9 A;  1L7O A;  2KVS A;  2V4Q A;  2WB1 C;  3NRZ A;  5III A;  1P7D A;  2NRW A;  4F5N A;  4CGZ A;  2XCP A;  1ZD2 P;  4ECU A;  2ZUC A;  2PFO A;  4ECT A;  4R64 A;  5ALG A;  7ICN A;  4NLN A;  2I5H A;  1NKE A;  3QUC A;  4GIB A;  3LK9 A;  2AQ0 A;  5DQI A;  2XCA A;  2Q0Z X;  8ICG A;  1ARO P;  4PHE A;  2ZUD A;  2R8K A;  3V7L A;  5ALK A;  3IP4 B;  4UBB A;  4YQW A;  1U9L A;  1KQQ A;  5KG5 A;  2K4E A;  2NO5 A;  2W8K A;  2KE7 A;  5KFL A;  3DEE A;  5ALZ A;  1VLB A;  1OW5 A;  5JRT A;  9ICR A;  3PNC A;  5KG0 A;  5KFK A;  4OJ5 A;  5AKX A;  2BDU A;  4UAV A;  4Q43 A;  4TUR A;  4C7Z A;  2ASL A;  2GLE A;  3FM9 A;  2WHE A;  3RJG A;  4FFD A;  1ZQM A;  4UB1 A;  2JGA A;  3C28 A;  4O9M A;  3PO4 A;  4B9S A;  3JPT A;  3UPQ A;  3C1Z A;  4XQ8 A;  3IV6 A;  4PHP A;  1JX4 A;  5J8Y C;  1B4F A;  1JUD A;  4RUA A;  3ISB A;  4NJ8 A;  2ZUB A;  2DQN B;  4QZC A;  3U26 A;  2EAP A;  1KEJ A;  1N56 A;  1ZQY A;  4O5C A;  2ASD A;  4DL4 A;  3KD3 A;  2ZJA A;  2IBK A;  3RR7 A;  5EE0 A;  1S0M A;  1B43 A;  1NI3 A;  4QZI A;  1TVA A;  3PSP A;  5J0W A;  3PR4 A;  3KFU F;  4DLE A;  7ICL A;  3RRG A;  3TAP A;  3PST A;  2C2R A;  2EDU A;  2VIX A;  2VJ4 A;  1NZP A;  5KFB A;  2F3N A;  1DXS A;  2EAO A;  4RQ5 A;  4RQ4 A;  3L3F X;  9ICK A;  9ICS A;  3PW4 A;  1MN8 A;  2AGP A;  4UAZ A;  2MUT A;  2G5I B;  5KFE A;  3KHL A;  5KFA A;  3NVY A;  4RZR A;  4EYI B;  3Q8S B;  4RQM A;  1SWW A;  1L3T A;  4DS4 A;  2AGO A;  2G06 A;  3C1Y A;  4EEK A;  5EE3 A;  2FPM A;  1UA1 A;  3C2M A;  3ZDE A;  2MUT B;  5J0U A;  3QU4 A;  1DRG A;  3R9K A;  1KSP A;  5AKL A;  1FEZ A;  3H0R B;  2KIW A;  1ZD3 A;  1SV0 A;  1BPE A;  3BQT A;  4O3P A;  4J9Q A;  3MAB A;  1ZQI A;  1L3S A;  1QSY A;  8ICE A;  1OXJ A;  3K1R B;  1ZOL A;  1XSP A;  4ELV A;  3HX0 A;  2AQ4 A;  5KFG A;  2KTQ A;  5AKE A;  3WKB A;  2UVV A;  5CEH A;  8ICR A;  4M2Y A;  8ICZ A;  4FZL A;  2YMM A;  1BPY A;  2Q4T A;  3V6K A;  1K5O A;  1CEZ A;  3SQI A;  1IG6 A;  1X6J A;  1ZQB A;  4KLT A;  4ICA A;  2KJ8 A;  3PW7 A;  2K8C B;  4KN7 A;  2F1J A;  3LWM A;  2FMP A;  4Y2S A;  2OXO A;  2BQ3 A;  2KIV A;  4GXJ A;  2E1F A;  2HHS A;  2LMR A;  1H38 A;  1BPB A;  4J9S A;  1N63 A;  5KL1 B;  1J97 A;  2GOL A;  4CDG A;  1IM4 A;  4RNO A;  5EWF A;  4UAT A;  3RAQ A;  4FS2 A;  4DFJ A;  3IRU A;  5J0P A;  1D9F A;  2PMZ C;  5B5E U;  2V9W A;  1ZRM A;  2OHF A;  4MFF A;  3KKA C;  4FO6 A;  4PGY A;  5KFW A;  4UBC A;  2XIC A;  2Y1J A;  4O5E A;  3M9N B;  4P0Q A;  4DFD A;  3H8M A;  4QWA A;  1TKD A;  2JH7 A;  3HJE A;  9ICI A;  1XU4 A;  5EE9 A;  5IIJ A;  4M47 A;  1B0X A;  4MEY A;  3WKD A;  5CJ7 A;  4DL5 A;  4KLI A;  4C4S A;  4DL7 A;  1L5U A;  3PW5 A;  5DB6 A;  3PW2 A;  1RDF A;  2JV3 A;  4RPZ A;  3T3F A;  2JHD A;  2KHQ A;  1SKS A;  4P0Q B;  1N5X A;  2XO7 A;  4LZG A;  2KZZ A;  5J0R A;  1ZQA A;  3AN1 A;  4F2S A;  4MEX A;  2VA2 A;  3V6J A;  5J2A A;  2HHV A;  3WK9 A;  1T7P A;  5HHH A;  2BDP A;  5H2F U;  1C7Y A;  1QQ6 A;  1ZQU A;  3KHR A;  2BQU A;  1NZB A;  1A77 A;  9ICM A;  1KFS A;  4EEY A;  5T14 A;  5BPC A;  1U49 A;  1ZQE A;  3H4B A;  3TI0 A;  3MDC A;  3JPN A;  3OJU A;  2O6K A;  5AKI A;  4QZ9 A;  1COO A;  9ICC A;  2LI6 A;  2YY6 A;  3MGI A;  1XO1 A;  4C8M A;  4P4M A;  2GH1 A;  4QWB A;  2OCE A;  3QZ7 A;  5KFP A;  2FMQ A;  3GFK B;  1U4B A;  4Y2P A;  2P66 A;  4I2A A;  3M1Y A;  5AM1 A;  4F5R A;  2ZTC A;  2FE9 A;  1SZH A;  4O3M A;  1QQ7 A;  4C7Y A;  4P4P A;  2DL0 A;  3TKA A;  5KG7 A;  2HDO A;  4QZB A;  4RT3 A;  4RQ0 A;  4O3Q A;  1X6I A;  4YMM A;  5AKH A;  3M8R A;  4NY8 A;  4F5Q A;  3A0B U;  2KHV A;  2WF7 A;  2XY5 A;  2LM4 A;  1X9M A;  2D3D A;  4NL9 A;  1NKC A;  1JN3 A;  2F77 X;  5IIL A;  2Y0S C;  4C8N A;  2QB0 A;  3BS5 A;  3G6V A;  1NK5 A;  5KT5 A;  3GZF A;  5DG8 A;  2F8L A;  4R8U A;  1NK7 A;  1WYG A;  4M9N A;  5DKW A;  4QNL A;  4BGD A;  4PPX A;  2OYY A;  8ICK A;  3BDP A;  3DV9 A;  3T5J A;  2OEH A;  8ICU A;  3K1Z A;  1LKY A;  1QQ5 A;  2MU2 A;  3AEV A;  3RB3 A;  4CE6 A;  4KLS A;  2QB0 B;  3BS5 B;  4NLB A;  2ISO A;  4EEL A;  1J2M A;  2E1E A;  4R8U B;  3LWL A;  4QZ8 A;  3IM1 A;  4QIW C;  4CF5 A;  5K4L A;  1QLN A;  5J0S A;  3MGH A;  4RPY A;  2YN4 A;  4JMU A;  2AJQ A;  1XC9 A;  1O03 A;  3RFA A;  3TFS A;  1UPH A;  2E8O A;  3QEB Z;  1ZET A;  3THV A;  5DLG A;  5CHG A;  1LKY B;  4FS1 A;  4J9R A;  1GO3 F;  4F71 A;  4RPX A;  2E5S A;  1S8O A;  1XWL A;  5HML A;  7ICH A;  5J29 A;  3KZX A;  5AI0 A;  5ALR A;  4YR0 A;  2G08 A;  3NTU A;  2EZY A;  4IQW A;  1ZQH A;  4F4X A;  4Q8E A;  9ICW A;  4J9P A;  5ALN A;  1X9W A;  4ED3 A;  2YB4 A;  4KTQ A;  1V38 A;  2ZJ5 A;  4I2B A;  2WF8 A;  4DFP A;  4DOC A;  4AYB C;  4DSI A;  4JB3 A;  2KVC A;  4EZ6 A;  8ICM A;  3AU2 A;  4I2I A;  1NK6 A;  1L6N A;  1S76 D;  4QWC A;  1SXD A;  3BQ1 A;  2P6R A;  8ICI A;  3CNH A;  4QZA A;  1DGS A;  5KNI A;  4ZOH C; 
#chains in the Genus database with same CATH homology
 1SKR A;  3PNC A;  4QZH A;  2LYH A;  5KG0 A;  4EYH B;  1Z00 B;  5L1J A;  3JPS A;  4F8R A;  4YN4 A;  1MQ3 A;  4DS5 A;  1UT8 A;  5KFK A;  4DOB A;  5EWE A;  2BPF A;  4DSE A;  4TUS A;  1ZQV A;  4Q43 A;  5DB7 A;  1XSL A;  4I2G A;  4TUR A;  2IMW P;  2ASL A;  4DQP A;  5HHI A;  2KZ3 A;  5KG1 A;  7ICK A;  2AGQ A;  7ICV A;  5KFM A;  2ISP A;  1QSL A;  4K4I A;  5EWG A;  5DGB A;  4Q44 A;  3RJG A;  9ICU A;  1ZQM A;  4DF4 A;  4QZG A;  7ICU A;  8ICO A;  1KTQ A;  4UB1 A;  4F50 A;  3Q8R B;  4ECV A;  3MBY A;  4IRK A;  4MF8 A;  3H7I A;  5KFC A;  1LV5 A;  1BPZ A;  4O9M A;  3UQ2 A;  5KG2 A;  3PO4 A;  4B9S A;  3JPT A;  4O3O A;  3UXP A;  3UPQ A;  3C1Z A;  1ZQN A;  3PML A;  4XQ8 A;  4PHP A;  2C28 A;  1U48 A;  5HMM A;  5KT7 A;  5J2D A;  2F1H A;  4RUA A;  3ISB A;  1L3U A;  7ICP A;  4QW8 A;  7ICI A;  5J2B A;  1NK9 A;  1S0N A;  2ZUB A;  4QZC A;  1KEJ A;  1N56 A;  1ZQY A;  1ZQD A;  5J2F A;  4UAW A;  4O5C A;  4GC7 A;  2ASD A;  1XSN A;  4TUQ A;  4IQT A;  4DL4 A;  5KT2 A;  3E2E A;  2ZJA A;  3N4M B;  3RRH A;  2IBK A;  1EXN A;  4RNM A;  3EPG A;  3IHQ B;  3PX0 A;  4F5O A;  3TAN A;  3RR7 A;  1SL2 A;  4YMO A;  2ATL A;  1MQ2 A;  3RAX A;  4KLG A;  1S0M A;  4Z6E A;  1B43 A;  1PZN A;  4QZI A;  1TVA A;  4KLM A;  1JIH A;  9ICH A;  5J0W A;  3PR4 A;  1JXL A;  1MSW D;  4DLE A;  5CP2 A;  7ICG A;  1UA0 A;  1NJY A;  3RRG A;  4QWD A;  7ICL A;  3TAP A;  3BJY A;  4RQ3 A;  4KLU A;  2C2R A;  3B0Y A;  5L9X A;  3LDA A;  4M04 A;  4G3I A;  2KZM A;  4YD1 A;  8ICP A;  5KFB A;  9ICT A;  5DQG A;  3JPO A;  3GIJ A;  3V7J A;  4HYK A;  4ECY A;  3UXO A;  2ZTD A;  1KDH A;  1NJZ A;  1DOQ A;  4RQ5 A;  5F9L A;  5KFS A;  4RQ4 A;  4M9L A;  3RBD A;  3Q8L A;  9ICK A;  9ICS A;  3PW4 A;  3C5F A;  5J2K A;  4JUZ A;  2AGP A;  2ZJ8 A;  2XY7 A;  4UAZ A;  2MUT A;  1N48 A;  4DSL A;  3AU6 A;  2R8G A;  4DQR A;  5KFE A;  3KHL A;  4ECX A;  3SYZ A;  2JZB A;  5KFA A;  1T3N A;  4IRD A;  4K4G A;  3K75 D;  2BQR A;  1ZYQ A;  4RZR A;  5DDY A;  4EYI B;  4ED0 A;  3Q8S B;  4RNN A;  2I9G A;  1L3T A;  2FMS A;  3H8W A;  5DLF A;  4DS4 A;  4C8O A;  5DBB A;  2I1Q A;  3ORY A;  4JV1 A;  2AGO A;  1ZQJ A;  4JV2 A;  8ICS A;  2JEI A;  3GDX A;  3ISC A;  3GV8 B;  5DG9 A;  4LZD A;  4ECS A;  1RYR A;  3C1Y A;  2PFN A;  4YMN A;  1ZQW A;  4RQ8 A;  4YVZ A;  5CR0 A;  5J2I A;  2WTF A;  1D9D A;  2FPM A;  2XC9 A;  1UA1 A;  3C2M A;  3ZDE A;  2VA3 A;  3JPP A;  2BPC A;  4TQS A;  2MUT B;  5J0U A;  4YP3 A;  3MDA A;  4EBE A;  2BPG A;  4F93 B;  3GIL A;  4YXM A;  4DL3 A;  1KSP A;  3ZDC A;  2JZB B;  9ICG A;  4F3O A;  3BQ2 A;  1B22 A;  1BPE A;  3BQT A;  4O3P A;  4ED8 A;  1XS9 D;  4IRC A;  5C5J A;  4UB3 A;  2FPL A;  2HHT A;  4ED2 A;  4M6W A;  4F4K A;  4J9Q A;  4NXZ A;  4KMU A;  5KG4 A;  3MAB A;  3ZD8 A;  1ZQI A;  9ICE A;  1L3S A;  1QSY A;  4DFK A;  2BR0 A;  8ICE A;  8ICN A;  1XSP A;  1TK5 A;  4ELV A;  9ICX A;  3HX0 A;  2VA8 A;  5KFG A;  4QWE A;  2AQ4 A;  2KTQ A;  9ICV A;  4DO9 A;  2UVV A;  5J0T A;  8ICR A;  4M2Y A;  5JUM A;  8ICZ A;  5HNK A;  1BPY A;  3H40 A;  3UQ0 A;  4UB5 A;  3EPI A;  4UAY A;  3V6K A;  1CEZ A;  4I2J A;  1K1S A;  3G6Y A;  4QZF A;  5J2C A;  1ZQB A;  4BDP A;  4KLT A;  2BCU A;  3PW7 A;  3RJI A;  2BHN A;  3HPO A;  1S9F A;  3T5H A;  4LVS A;  4KN7 A;  4IQU A;  1RPL A;  2F1J A;  3LWM A;  2FMP A;  7ICR A;  3MR5 A;  4M6W B;  5DBA A;  4PHA A;  2BQ3 A;  4GXJ A;  5DG7 A;  4ECW A;  3SV3 A;  2HHS A;  1BVS A;  1RXW A;  1H38 A;  1BPB A;  4R66 A;  4J9S A;  4DQQ A;  2J6T A;  3OSP A;  1CUK A;  4JK1 A;  3ZDB A;  4J9N A;  4I29 A;  4F91 B;  1ZQF A;  4P4O A;  1Z3E B;  2IHM A;  5KFZ A;  2W9B A;  2W9C A;  4BXO A;  1IM4 A;  4DQS A;  4O3N A;  2C2D A;  4O3R A;  4Q8F A;  8ICT A;  4FBU A;  2NRZ A;  3G6X A;  4RNO A;  5EWF A;  4ECR A;  3RBE A;  5KG3 A;  4I2H A;  3RAQ A;  4FS2 A;  4DFJ A;  5DBC A;  4M9H A;  3M9O B;  4O3S A;  4F2R A;  5J0P A;  4Z6C A;  5CB1 A;  4F92 B;  1WCL A;  2R8I A;  3PMN A;  3PV8 A;  1SL0 A;  3TAR A;  1D9F A;  4QZE A;  2F1I A;  4J9M A;  2V9W A;  2BCV A;  4E0D A;  5J0X A;  5KFJ A;  3JPQ A;  3V6H A;  1RYS A;  2MAX A;  4YD2 A;  5DDM A;  4F4W A;  3T5K A;  4JWM A;  4MFF A;  3HP6 A;  3SZ2 A;  3M8S A;  1NKB A;  4UB2 A;  2M9N A;  8ICW A;  4FO6 A;  4FBT A;  4PGY A;  2P6U A;  5KFW A;  4UBC A;  3PR5 B;  2Y1J A;  2W9B B;  4XA5 A;  4BXO B;  4O5E A;  3M9N B;  3AUO A;  3RB0 A;  1SL1 A;  4QWA A;  1TKD A;  3NGD A;  2HHW A;  3C2L A;  2HVI A;  1KFT A;  3H8S A;  5L1L A;  1U45 A;  3FYH A;  9ICI A;  1XU4 A;  5KT6 A;  5IIJ A;  4ECQ A;  4B9V A;  1WCN A;  7ICE A;  4M47 A;  2AU0 A;  4MEY A;  2HHU A;  4DLG A;  5CJ7 A;  7ICQ A;  3GIM A;  4DL5 A;  4DF8 A;  4DL7 A;  2J6U A;  4KLI A;  1L3V A;  2HW3 A;  2FLP A;  4GLX A;  3KTQ A;  1L5U A;  4QW9 A;  1ZJN A;  3PW5 A;  3B0X A;  5DB6 A;  4RT2 A;  3JPR A;  1KFD A;  3PW2 A;  8ICQ A;  5L1I A;  3T3F A;  4RPZ A;  3ZDD A;  4ECZ A;  2OWO A;  2HHX A;  1T8E A;  5D49 A;  9ICB A;  1SKS A;  3K4G A;  2XO7 A;  4LZG A;  1S77 D;  2KZZ A;  9ICN A;  3OGU A;  4YG2 A;  3RH6 A;  5J0R A;  1ZQA A;  5KFI A;  4I2C A;  3Q8P B;  5KG6 A;  3PW0 A;  1NOM A;  2IHN A;  4F2S A;  4IQV A;  1A76 A;  1LB2 B;  4MEX A;  3T5L A;  4ZH4 A;  3PX6 A;  3Q8K A;  3V6J A;  5J2A A;  1QSS A;  2VA2 A;  2HHV A;  9ICP A;  1T7P A;  5D4B A;  5HHH A;  4JWN A;  4O0I A;  4RU9 A;  2BDP A;  2C2E A;  8ICA A;  3GV7 B;  5KFR A;  4B9T A;  1C7Y A;  1ZQU A;  3KHR A;  2BQU A;  4BWM A;  1A77 A;  5DB8 A;  2PI4 A;  1ZQL A;  1JXE A;  9ICM A;  1KFS A;  3EWA A;  5DGA A;  3C2K A;  4EEY A;  1UT5 A;  5KFV A;  2RDI A;  4Z6D A;  5BPC A;  2ASJ A;  1TK8 A;  1U49 A;  1TAQ A;  4KLF A;  4PGX A;  1ZQE A;  3H4B A;  2PFP A;  4TUP A;  2NRT A;  3TI0 A;  3BQ0 A;  4MFA A;  3MDC A;  7ICF A;  3JPN A;  4YXJ A;  3OJU A;  4M0A A;  4B9M A;  4QZ9 A;  5KFD A;  4PHD A;  1COO A;  9ICC A;  3PY8 A;  4O5K A;  5KFQ A;  3MGI A;  1V9P A;  1KLN A;  1XO1 A;  5BOL A;  2DPJ A;  4C8M A;  4P4M A;  2W9M A;  4JV0 A;  5KFX A;  1NJW A;  4ELT A;  5IIN A;  4QWB A;  3QZ7 A;  3KHG A;  4I2E A;  5KFP A;  9ICJ A;  4M9J A;  4GXK A;  5KFH A;  5J2G A;  3QZ8 A;  2FMQ A;  3RH4 A;  9ICO A;  3GFK B;  4ED1 A;  1U4B A;  1MC8 A;  4DSK A;  2P66 A;  2UVR A;  4I2A A;  9ICL A;  4BWJ A;  1TV9 A;  4DL6 A;  3RTV A;  4UB4 A;  1HUZ A;  3RB6 A;  4F5R A;  2ZTC A;  4RQ1 A;  2PI5 A;  1X9S A;  1ZQS A;  1QTM A;  2A1J A;  5HP4 A;  1K1Q A;  5IIO A;  1KRP A;  4B9U A;  1ZQO A;  1S0O A;  3ZD9 A;  3GV5 B;  4P4P A;  4C8K A;  2NRX A;  3QE9 Y;  1X2I A;  5KG7 A;  3RJH A;  2KFZ A;  1TAU A;  4QZB A;  5KFO A;  5J0Q A;  4RT3 A;  5CA7 A;  2W8L A;  4RUC A;  1SZP A;  4KN4 A;  4RQ0 A;  3RJE A;  4MFC A;  4QZD A;  3ISD A;  4O3Q A;  2UVW A;  3PO5 A;  1T4G A;  2XGQ A;  4YMM A;  2J6S A;  5J2E A;  3Q8Q B;  2H5X A;  1S10 A;  1BGX T;  4CCH A;  3OHB A;  4GXI A;  4EZ9 A;  3M8R A;  4UQG A;  3V72 A;  4NY8 A;  4NLZ A;  8ICV A;  8ICX A;  4X5V A;  3ETL A;  1ZQX A;  4F5Q A;  8ICH A;  4F4Z A;  4ED6 A;  2DPI A;  4M9G A;  7ICJ A;  4YFK A;  2A1J B;  4I2D A;  3HW8 A;  5L1K A;  2XY5 A;  1BPX A;  4RQ6 A;  1NJX A;  4PH5 A;  1X9M A;  1IXR A;  1Y88 A;  4J9K A;  7ICO A;  2JEF A;  5KFU A;  4XUS A;  1NKC A;  4DSJ A;  5IIM A;  1JN3 A;  4IR9 A;  2ZTE A;  4DOA A;  3PVX A;  2BKE A;  4J9O A;  4C8N A;  5IIL A;  4ELU A;  2BCQ A;  5DQH A;  3G6V A;  3MFI A;  1NK5 A;  5KT5 A;  4KLO A;  5DB9 A;  2Y1I A;  5DG8 A;  1ZQQ A;  4R8U A;  4RQ7 A;  4DL2 A;  2C22 A;  1NK7 A;  5J2H A;  5IIK A;  1RXV A;  2BCS A;  4M9N A;  8ICY A;  3EW9 A;  4R65 A;  5DKW A;  2W9C B;  3OJS A;  3TAQ A;  5KFT A;  4NM2 A;  4P2H A;  4BGD A;  2KN7 A;  4PPX A;  2RDJ A;  1HJP A;  5EOZ A;  8ICK A;  8ICL A;  4J9L A;  4KIT B;  2R8H A;  2B21 A;  2FLL A;  3RJK A;  4Z6F A;  3BDP A;  3ZDA A;  4NM1 A;  3V7K A;  2HVH A;  3T5J A;  8ICC A;  8ICU A;  7ICS A;  5J2J A;  5KT4 A;  4C8L A;  1ZQP A;  8ICB A;  3PX4 A;  5J0Y A;  3RB3 A;  1HUO A;  4KLS A;  4EBC A;  2PFQ A;  4B9L A;  3N97 B;  2ISO A;  4YR3 A;  9ICF A;  2KFN A;  3OSN A;  4KLD A;  4KLL A;  3GIK A;  2R8J A;  4R8U B;  3HWT A;  5BOM A;  5TZV A;  3MR6 A;  3LWL A;  4QZ8 A;  4KLE A;  3IM1 A;  4I28 A;  1QLN A;  2FPK A;  5J0S A;  3MGH A;  4RPY A;  1S97 A;  2BGW A;  2AJQ A;  4MF2 A;  1XC9 A;  2JEJ A;  3C21 A;  4DEZ A;  3EYZ A;  1ZQC A;  3C5G A;  3TFS A;  3Q8M A;  4KLJ A;  7ICM A;  1U47 A;  7ICT A;  3QEB Z;  1ZET A;  4PGQ A;  3THV A;  5DLG A;  5CHG A;  4IR1 A;  4FS1 A;  4YR2 A;  4TQR A;  4R63 A;  4GC6 A;  1NK0 A;  4J9R A;  3RJJ A;  4DSF A;  1JX4 A;  5KFF A;  3SI8 A;  4RPX A;  2HHQ A;  3TQ1 A;  1TFR A;  2VAN A;  4F5P A;  1ZQG A;  4DWI A;  1XWL A;  5HML A;  2JEG A;  4DQI A;  5KFY A;  7ICH A;  2XGP A;  5J29 A;  4F4Y A;  3RH5 A;  3MR3 A;  3SV4 A;  3MR2 A;  4YR0 A;  4XRH A;  1ZQZ A;  8ICJ A;  3OHA A;  5CWR A;  3NTU A;  3TFR A;  4NLG A;  5KTQ A;  1ZQK A;  4IQW A;  1JMS A;  1ZQH A;  1TK0 A;  4NLK A;  3HT3 A;  3M9M B;  2FLN A;  9ICQ A;  3QEA Z;  3H8J A;  5KFN A;  4F4X A;  2UVU A;  4Q8E A;  8ICF A;  1NK8 A;  3RB4 A;  9ICW A;  3EZ5 A;  2IA6 A;  5F9N A;  2NRV A;  4J9P A;  4KLQ A;  2V4Q A;  1ZQT A;  1D8Y A;  2BCR A;  1X9W A;  3C23 A;  5III A;  2NRW A;  4F5N A;  3UXN A;  4KLH A;  4ED3 A;  4KTQ A;  2XCP A;  2ZJ5 A;  3GQC A;  4I2B A;  1S0V A;  4ECU A;  2ZUC A;  2PFO A;  3RR8 A;  4I2F A;  4ECT A;  4R64 A;  3RJF A;  1BPD A;  2DFL A;  7ICN A;  3H4D A;  4NLN A;  1NK4 A;  4DFP A;  4DOC A;  1NKE A;  1ZQR A;  4DSI A;  4Q45 A;  2V4R A;  1D8L A;  2PXI A;  3LK9 A;  2XY6 A;  1ZJM A;  2ALZ A;  5D46 A;  4EZ6 A;  2AQ0 A;  1Z00 A;  1SKW A;  8ICM A;  3AU2 A;  5DQI A;  4YCX A;  2Q0Z X;  2XCA A;  8ICG A;  1ARO P;  4K4H A;  4PHE A;  2ZUD A;  9ICA A;  2R8K A;  3V7L A;  3KHH A;  1RZT A;  2GWS A;  4UBB A;  4I2I A;  4YQW A;  5J0O A;  1U9L A;  5KG5 A;  1NK6 A;  2W8K A;  3FDS A;  4B9N A;  5KT3 A;  5KFL A;  2W9A A;  1S76 D;  4EBD A;  4DFM A;  3MFH A;  4ED7 A;  4QWC A;  3BQ1 A;  3GII A;  2P6R A;  8ICI A;  4RQ2 A;  4QZA A;  9ICR A;  1DGS A;  4I27 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...