2KN7A

Structure of the xpf-single strand dna complex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
67
structure length
67
Chain Sequence
EKYNPGPQDFLLKMPGVNAKNCRSLMHHVKNIAELAALSQDELTSILGNAANAKQLYDFIHTSFAEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/dna
molecule keywords DNA repair endonuclease XPF
publication title The structure of the XPF-ssDNA complex underscores the distinct roles of the XPF and ERCC1 helix- hairpin-helix domains in ss/ds DNA recognition
pubmed doi rcsb
source organism Homo sapiens
total genus 20
structure length 67
sequence length 67
chains with identical sequence D
ec nomenclature ec 3.1.-.-:
pdb deposition date 2009-08-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2kn7A00
2ZJAA 1ZQLA 1HUZA 5KFBA 1QLNA 1T3NA 1JXLA 5BOLA 4TQSA 5DG7A 2ZUCA 4DO9A 4DF4A 4Z6CA 1NK8A 4F2RA 5IIJA 1XU4A 4JV1A 3EWAA 3H4DA 1HUOA 4EYIB 4R64A 1ZQMA 1UT8A 1ZQHA 9ICJA 4O3SA 4Q43A 1ZQWA 1UA0A 3GQCA 1ZQTA 4IRKA 2FPKA 3ZDEA 3KTQA 2J6UA 2W9CB 3MR6A 3PX0A 3RBEA 4QZEA 4ED0A 3RR8A 2P66A 3K75D 4QW8A 1L3TA 4I2IA 4FS2A 2XC9A 5KFRA 3H40A 1MQ2A 2HVIA 3MGHA 2NRZA 4DQQA 3V6KA 5DB6A 2XGPA 3C21A 5EOZA 8ICXA 1B22A 4ED2A 5DQGA 3RB3A 1K1SA 3GILA 2BHNA 4TUPA 1L3UA 4FS1A 1ZQPA 5KG6A 1S97A 1ZQXA 5KFHA 1ZQVA 4M2YA 1QSSA 4F4KA 8ICQA 9ICSA 5J0TA 5DBBA 8ICAA 4KMUA 3JPRA 3SZ2A 4QZCA 2UVWA 4KTQA 2F1JA 5KFYA 3JPPA 4KLIA 4M9GA 4PPXA 2ZUBA 2C2EA 4F3OA 3OHAA 1KEJA 2FPLA 2BCUA 3C1ZA 4KN4A 2BQRA 4ELVA 4UB3A 2V9WA 4R65A 5CR0A 3V72A 2BQUA 3PO4A 4DSIA 2JEIA 3OSNA 5KT2A 3RB6A 2AQ0A 4XA5A 4C8LA 1K1QA 2AGQA 4UAZA 3H8WA 4DSJA 1NJYA 4TQRA 9ICIA 1ZQUA 2B21A 1BPDA 3MR2A 3RJKA 2VA8A 3Q8SB 4O0IA 4R66A 1T8EA 2VA2A 3UXPA 3C23A 3Q8PB 3LWLA 4TURA 5HMLA 4EZ6A 4F5RA 4NLNA 4NLKA 8ICOA 3M9NB 3GIMA 2UVRA 4O3PA 5J2HA 3TARA 5HHHA 4RT2A 2W9BA 5KFZA 4K4IA 2IHNA 1RXWA 4RQ2A 4JWMA 2XCPA 1Z00A 1B43A 5KT3A 5J2DA 4RQ6A 2AQ4A 3GV7B 3BQ0A 4BXOB 1IM4A 2I1QA 4PHPA 3TQ1A 5KT5A 3PY8A 4GXIA 4DLEA 5KFXA 4ED1A 3Q8KA 3RJGA 1AROP 4C8NA 2F1IA 4NXZA 1BPYA 5KFMA 5IILA 3PNCA 3GIJA 1TAUA 9ICTA 2XY7A 2ATLA 1ZQBA 1NK4A 7ICRA 5KFSA 4O3NA 5DGBA 4RPZA 4EBDA 5IIKA 4KLLA 3LK9A 8ICJA 8ICKA 3B0YA 4ECTA 3MDCA 4PGYA 1BVSA 2MAXA 4RUAA 3G6VA 5DLFA 4DL3A 2BR0A 1NK5A 2DPIA 2ISPA 3C5GA 3C2KA 4IQUA 1TK0A 4GC7A 2KTQA 7ICOA 1X9MA 4JV0A 4F93B 2W9AA 1UA1A 2WTFA 5KFCA 4RPYA 3HPOA 3KHRA 1JX4A 3MR3A 2BCRA 4F92B 4KLGA 4PGXA 2R8IA 2PFOA 4J9RA 5KFPA 3TFRA 1ZQZA 2NRWA 8ICNA 5J2GA 4XUSA 3KHHA 4B9TA 2ALZA 4F5QA 2NRVA 5IIIA 2C2DA 2IMWP 2IBKA 1RYRA 8ICTA 9ICWA 3JPTA 4RQ5A 5F9LA 5D49A 1LB2B 2JEGA 1TV9A 1SL0A 4F4WA 5J2FA 8ICIA 3GIIA 4J9OA 3E2EA 5KT7A 2PFQA 1BGXT 1QSYA 4B9UA 5KFAA 3PR5B 3GFKB 3OHBA 4ECQA 4DFJA 8ICSA 5J2BA 1TK5A 1UT5A 1ZQRA 2HHWA 4BWJA 9ICUA 3MABA 4B9NA 4B9VA 4LZGA 4Z6DA 2HW3A 8ICLA 2BCSA 4YCXA 3GIKA 4HYKA 9ICRA 4QZDA 8ICUA 4KLDA 5HNKA 5TZVA 5CWRA 4EYHB 4QZAA 1L3VA 1CEZA 4YMNA 8ICPA 4O9MA 4ED8A 9ICXA 3BJYA 1BPXA 5J2AA 2C28A 3RH4A 4R8UB 4B9SA 5DBCA 2ZUDA 3T5JA 4ECXA 4YG2A 4F5OA 4MFFA 3G6YA 8ICVA 1XWLA 4Q44A 5KFQA 5J0UA 2ZTDA 2PI5A 4YMOA 2V4RA 2XCAA 2F1HA 4J9KA 4I2BA 9ICNA 2AGPA 3QEBZ 3LWMA 2JEFA 2JZBA 3MBYA 3AU6A 3GV8B 3IHQB 4IRDA 2KZZA 5EWFA 3T5KA 4RNNA 7ICUA 4PHEA 2ZJ5A 4YVZA 1BPBA 4PH5A 1X9SA 4RQ3A 4ED7A 9ICPA 3RAQA 5KFWA 5J2CA 4YR0A 4DOBA 4ED3A 5IINA 2C2RA 4M47A 4KLJA 1RXVA 3RJIA 3PW4A 2BKEA 4PHAA 2BCQA 5KFVA 5KTQA 4E0DA 4YD1A 3Q8RB 4EEYA 3RTVA 4K4HA 1S77D 4UAYA 5KG4A 5L1LA 1NJWA 1X2IA 4DQRA 9ICKA 4J9SA 4Q45A 1BPZA 4UB4A 2W8KA 7ICLA 4KLUA 5L9XA 4I2JA 3M9OB 3UXOA 3TFSA 1TK8A 2FLLA 4K4GA 4NLZA 5DQHA 5BPCA 3QE9Y 9ICHA 8ICBA 4RQ4A 2GWSA 4O5EA 1COOA 5KG5A 2DFLA 8ICHA 1L3SA 4M9JA 5HHIA 4R63A 4GLXA 1Z3EB 4DSLA 2ZTCA 5KT6A 4C8KA 3V7JA 4X5VA 4O3QA 4DL2A 4UBCA 4UAWA 4YXMA 4P4MA 1QSLA 2H5XA 4DQPA 3OGUA 4MFAA 3T3FA 4O5KA 4M9NA 4LZDA 1T7PA 4IRCA 1ZQIA 7ICHA 4XRHA 1NJZA 3OJUA 4DEZA 1DOQA 2Y1JA 2W8LA 3ZDBA 4I28A 1S0VA 5J0OA 5KG7A 3GDXA 1TVAA 1X9WA 1ZQYA 7ICMA 4IR1A 4RZRA 2FMSA 3QEAZ 4ECYA 4I2CA 1JXEA 1JIHA 4RUCA 5J0RA 1ZQCA 4KLEA 4C8OA 7ICNA 1JMSA 2VANA 1XC9A 4F4XA 4KLMA 3V6JA 3JPSA 5CP2A 4UB1A 1NK0A 3N97B 2W9BB 1RPLA 4O3OA 3HW8A 4BXOA 3MDAA 3PW7A 4YFKA 4XQ8A 3HP6A 5DDMA 3V6HA 4I2HA 3Q8LA 3MGIA 2PFPA 7ICFA 2A1JA 4DOAA 1ZQOA 5J0YA 3PW2A 2BCVA 3TAPA 3UPQA 5EWEA 3RH5A 1IXRA 3H8SA 4FBUA 4DFMA 4ED6A 9ICEA 5KFDA 7ICKA 1ZQFA 3PX4A 1N48A 4BWMA 4F50A 5KFJA 5KG2A 4RQ1A 5L1KA 4J9MA 5HMMA 1S0NA 4YP3A 4QWEA 3MR5A 3TI0A 4QZFA 2HHSA 4F5PA 3UQ2A 2ZJ8A 2XY5A 1LV5A 1D8YA 5J2JA 3UQ0A 1XS9D 1KRPA 4BGDA 4QW9A 4B9MA 2KFNA 4Z6FA 4YQWA 2ISOA 9ICLA 4ECSA 4KITB 4DS5A 2FLNA 4QZ9A 3BDPA 4I2EA 4ZH4A 1DGSA 5HP4A 5KFUA 4M9LA 3C5FA 4NM1A 5KG1A 2MUTA 4QZBA 4ECVA 5KG0A 7ICSA 5J0XA 1D9DA 3OJSA 3HT3A 5KFKA 3PMNA 1EXNA 4JK1A 1SZPA 4KLSA 4NY8A 4QWBA 5KG3A 5KFIA 2LYHA 4QZ8A 3GV5B 2HHXA 4IQTA 4F91B 2R8GA 2BGWA 2KN7A 4J9NA 1NJXA 4CCHA 1XSPA 4F2SA 5DKWA 4M6WA 1ZJMA 8ICWA 3NTUA 3AU2A 4BDPA 4GXKA 4EBEA 5CHGA 4YR3A 1SKSA 2XY6A 5F9NA 2AU0A 5J0WA 1QTMA 3PX6A 4R8UA 2XO7A 4TUSA 4GC6A 3ORYA 4I2DA 4QWDA 1NOMA 4F8RA 4ECUA 4YN4A 3RR7A 4O5CA 2C22A 1D9FA 2NRTA 4IQWA 1KSPA 2HHTA 8ICYA 5C5JA 2Y1IA 3RH6A 4QWAA 1S0MA 2P6RA 1ZJNA 5D4BA 8ICRA 3RRHA 1TKDA 3RJEA 2XGQA 2W9CA 1XSNA 2JZBB 3SYZA 2W9MA 3BQTA 1KDHA 1H38A 3FYHA 4ECRA 1RZTA 1C7YA 7ICJA 3ZDDA 2HHVA 5J0PA 1SKWA 1L5UA 1XO1A 5DQIA 4FO6A 4J9QA 2FLPA 2KZ3A 2HVHA 8ICCA 4O3RA 3V7LA 4ECZA 4J9LA 3PVXA 2J6SA 4YXJA 2R8JA 4RU9A 3BQ1A 4NLGA 3C2LA 8ICZA 3ZD8A 1S9FA 3M8SA 3UXNA 4MF2A 1MC8A 3JPOA 3IM1A 1U9LA 4J9PA 2FMQA 4Q8EA 1ZQDA 4M04A 7ICVA 5KFTA 4MEXA 2FMPA 1SL1A 5KT4A 5BOMA 9ICCA 4KLQA 3PW0A 3RJJA 3H8JA 2ASLA 4EBCA 4EZ9A 5CJ7A 2V4QA 9ICBA 3EYZA 1ZETA 1ZQQA 4JWNA 1Y88A 3K4GA 2UVVA 1T4GA 1A77A 3PR4A 5JUMA 4LVSA 5DB9A 3RJHA 3EPIA 1KFTA 5KFOA 4RNMA 1ZQGA 3PMLA 8ICMA 3HX0A 5DBAA 4DSEA 4DL6A 1S10A 2M9NA 2AJQA 4MFCA 2ZTEA 4FBTA 5KFEA 4RT3A 4QWCA 2BPFA 7ICGA 3ZD9A 3T5HA 3C1YA 1ZQJA 1ZYQA 1U48A 3ZDAA 1NKBA 4DQIA 8ICEA 2NRXA 3LDAA 4UQGA 2PXIA 4DFPA 5L1IA 7ICIA 1V9PA 1KFSA 2UVUA 1JN3A 1A76A 1HJPA 3FDSA 5DG9A 5DG8A 3ISCA 3SI8A 4ELTA 3RJFA 4UBBA 5IIMA 1Z00B 5J2IA 4GXJA 1NK7A 5DDYA 4DSFA 1ZQSA 4KN7A 3RRGA 4ELUA 9ICVA 1TAQA 2AGOA 4DWIA 3RAXA 4I2GA 2BPCA 1KTQA 3ISDA 3H4BA 1NKEA 4YD2A 2RDIA 1CUKA 3V7KA 4DLGA 2OWOA 3NGDA 5KFNA 3Q8QB 4KLOA 3PO5A 7ICTA 5DGAA 3EZ5A 7ICQA 4C8MA 1WCLA 5IIOA 3ISBA 1BPEA 2P6UA 5EWGA 4F5NA 4ECWA 3KHGA 4DF8A 2HHQA 9ICOA 4QZGA 4UB2A 4PHDA 2ASJA 5CA7A 3OSPA 1D8LA 1ZQKA 1WCNA 2J6TA 4M0AA 5DB8A 3N4MB 4DS4A 2A1JB 2HHUA 3G6XA 3H7IA 4MEYA 3JPNA 4DL4A 1XSLA 1N56A 9ICGA 1U49A 4KLHA 3QZ7A 4DSKA 4G3IA 4Z6EA 4RQ0A 3TAQA 5L1JA 1NK6A 1RYSA 1MSWD 4P4OA 3EW9A 1U4BA 4IR9A 3KHLA 3ETLA 5CB1A 4DL5A 3THVA 3JPQA 2Q0ZX 4P4PA 4MF8A 2IHMA 3BQ2A 2JEJA 2PI4A 1ZQEA 3C2MA 4PGQA 2I9GA 9ICAA 5J2KA 2BDPA 1KFDA 4RQ7A 5KFGA 1U47A 1SKRA 8ICGA 4QZHA 5D46A 1ZQAA 7ICPA 4RPXA 5J29A 4QZIA 3QZ8A 2RDJA 4IQVA 1U45A 3SV4A 2KZMA 1PZNA 1KLNA 4F4YA 5DB7A 2PFNA 4I2AA 3Q8MA 4JUZA 3RB4A 1MQ3A 2R8KA 2MUTB 5J0QA 3B0XA 4B9LA 4NM2A 3AUOA 3ZDCA 4P2HA 5KFFA 3RB0A 4I27A 5KFLA 4I2FA 4Q8FA 4DL7A 4UB5A 2ASDA 7ICEA 9ICQA 4I29A 3M9MB 4RNOA 1NK9A 4JV2A 4RQ8A 1NKCA 4DFKA 3RBDA 9ICFA 2R8HA 2FPMA 4DQSA 1SL2A 9ICMA 2DPJA 1S0OA 4DOCA 2VA3A 2KFZA 3M8RA 4M6WB 2BQ3A 5DLGA 3MFHA 4YMMA 3TANA 3HWTA 8ICFA 3EPGA 4KLFA 4M9HA 3PV8A 2BPGA 4F4ZA 3MFIA 3SV3A 1S76D 4YR2A 3T5LA 5J2EA 2IA6A 4KLTA 4TUQA 5J0SA 1ZQNA 3PW5A 1TFRA
chains in the Genus database with same CATH superfamily
5KFBA 1T3NA 1JXLA 5BOLA 3CRXA 4DO9A 4EYIB 4EELA 9ICJA 4O3SA 1X66A 1OW5A 3ZDEA 3PX0A 3RBEA 4ED0A 2P66A 4I2IA 4BX9C 5A0LA 1MQ2A 2NRZA 4PZNA 2EAMA 4ED2A 2OYYA 2BHNA 4FS1A 1S97A 4M2YA 4F4KA 2HBLA 2UVWA 3M1YA 3SZ2A 2YMLA 2GOLA 4KLIA 5AKKA 4AYBC 4FZNA 4PPXA 2C2EA 3OHAA 2BCUA 1L6NA 2BQRA 4UB3A 5CR0A 3V72A 1K5OA 3RB6A 2RP5A 1NJYA 1ZQUA 2B21A 4C7ZA 1T8EA 3UMCA 3Q8PB 2E1EA 4EZ6A 1DK2A 4O3PA 3TARA 4Y2SA 5KFZA 4RQ2A 1Z00A 1B43A 4RQ6A 2AQ4A 3BQ0A 4NJ8A 3TQ1A 4GXIA 4DLEA 3IG5A 5KFXA 1N62A 4C8NA 5IILA 3D2NA 2F3NA 7ICRA 4O3NA 3SQIA 5IIKA 2MAXA 5KNIA 3G6VA 1N5XA 3C2KA 2EH9A 1TK0A 2JH1A 1X9MA 3AM9A 2W9AA 1UA1A 5KFCA 1JX4A 3MR3A 4IL6U 3TFRA 8ICNA 5GTHU 4CRXA 4B9TA 9ICWA 1N60A 3F2BA 2E8NA 5D49A 2KHVA 3LYSA 3NVVA 4J9OA 3E2EA 3OPXA 1BGXT 1QSYA 3PR5B 5J2BA 1TK5A 4B9NA 2W43A 5ALPA 4B9VA 4Z6DA 5ALGA 1FEZA 5AM3A 5CEHA 8ICPA 3BJYA 3N7RC 1BPXA 3SR6A 2E1FA 2EAPA 8ICVA 1XWLA 5J0UA 4YMOA 2V4RA 4I2BA 2I5HA 2JZBA 2F8LA 4IRDA 3BQ7A 1F44A 1N63A 4RNNA 7ICUA 2YQEA 1BPBA 3WKBA 2EZXA 5KL1B 5KFWA 5IINA 3DDHA 4KLJA 2W03A 5KTQA 4G9BA 3Q8RB 4EEYA 3RTVA 4DQRA 1L7MA 1SV4A 2Z7JA 3UXOA 1UPHA 1PK3A 2FJ6A 1L7OA 4M9JA 4R63A 1IG6A 4DSLA 5KT6A 4X5VA 4YXMA 5JU5A 4O5KA 2HBJA 1ED1A 3H0LB 4IRCA 2ZIVB 2Y1JA 5J0OA 3GDXA 1X9WA 1ZQYA 4RZRA 4ECYA 1RQNA 1JMSA 4UB1A 3H8MA 2JHDA 4XQ8A 2E5SA 1Z1VA 4DOAA 5ALZA 3PW2A 3TAPA 1IXRA 3QU7A 4DFMA 1UQVA 3QU4A 7ICKA 1Q3UA 1ZQFA 1S5LU 4J9MA 4YP3A 1O08A 4UB6U 2HHSA 2WHEA 2ZIUA 2HSZA 3UQ2A 1F0MA 2ZJ8A 1D8YA 2QB0A 3UQ0A 4BGDA 4B9MA 4Z6FA 4YQWA 3H0RB 2ISOA 4KITB 5C0YA 3C5FA 2G5HB 2NYVA 2YN4A 5J0XA 3ETRA 3HT3A 5KFKA 3IRUA 1D8BA 5KG3A 2EANA 3GV5B 2LYHA 2OXOA 4IQTA 5ALDA 2KN7A 4OD0A 1RDFA 3AU2A 4GXKA 3AMZA 2XY6A 3QUCA 1QTMA 2XO7A 3ORYA 2E8PA 4QWDA 3RR7A 5ALUA 2C22A 2WAQC 2HHTA 3L5KA 2P6RA 3F53A 8ICRA 2ZIXA 3RRHA 3BZKA 3BQTA 3ONNA 3FYHA 2D8CA 1C7YA 2HCFA 2B6GA 1XO1A 2FLPA 2HVHA 4O3RA 4ECZA 3BQ1A 2ZXHA 3UXNA 4P0PB 4M04A 3N7PD 5KFTA 9ICCA 1Z4OA 2RQ5A 3PW0A 2D6FC 2ASLA 4EBCA 1ZETA 4JWNA 5JUMA 2VKQA 3F2CA 3WKEA 1ZQGA 8ICMA 3HX0A 4DSEA 2AJQA 4MFCA 3KD3A 5E79U 4QWCA 2BPFA 7ICGA 3T5HA 1XO0A 3NRWA 1ZQJA 1ZYQA 8ICEA 3LDAA 3A0BU 4KMOB 1KFSA 3BS5A 3FDSA 1HJPA 4UARA 1X9XA 9ICVA 1NI3A 1RM6C 3I28A 3BZCA 4OO1J 3RAXA 3H4BA 1GO3F 2MRLA 3WK4A 4DLGA 5J8YA 3NGDA 3Q8QB 7ICTA 3PO5A 1NZPA 5IIOA 4F5NA 4ECWA 9ICOA 4J03A 5ALLA 4QZGA 4PHDA 3OSPA 1ZQKA 1X42A 2J6TA 2HHUA 4M0AA 3N4MB 3G6XA 1XSLA 1LKYA 1YZ6A 4Z6EA 2E8MA 4P4OA 4IR9A 3ETLA 4DL5A 3BQ2A 4PGQA 2HOIA 1T3QA 1U47A 4QIWC 2RDJA 2KZMA 2PFNA 1QQ6A 3CNHA 2MUTB 4B9LA 3B0XA 4NM2A 5KFFA 4I27A 4DL7A 3AQFA 4UB5A 4JV2A 3NVZA 1NKCA 3HKZF 9ICFA 2FPMA 2YB1A 1S0OA 2A19A 3M8RA 4M6WB 2W3SA 3HWTA 8ICFA 4M9HA 2DGZA 1S76D 4YR2A 5J2EA 2IA6A 4TUQA 2OHFA 5J0SA 1HUZA 2MU2A 2ZUCA 4DF4A 4F2RA 4Z6CA 1B0XA 4R64A 1UT8A 3D2SA 3GQCA 4IRKA 2FPKA 2GH1A 2K4HA 4FE3A 3RR8A 3K75D 4QW8A 1L3TA 1QQ5A 2QLTA 4F71A 2KNJA 2HVIA 2H3ZA 4MHVA 4DQQA 1PVRA 2XGPA 2FDRA 5EOZA 8ICXA 3RB3A 1RYUA 3GILA 4TUPA 5KG6A 9ICSA 4ICAA 8ICQA 5J0TA 2W55A 4CF4A 5KFYA 4CGZA 2G07A 4F3OA 4F72A 3C1ZA 2DQNB 2KK0A 2V9WA 2KKVA 2QARA 2JEIA 4NLCA 1CRXA 5KT2A 2D3DA 3H8WA 4ACOA 2WFAA 9ICIA 2VA8A 4O0IA 4R66A 8ICCA 3UXPA 3C23A 3TKAA 4NLNA 3GIMA 2KOBA 4RT2A 5AM2A 5KT3A 5J2DA 4BXOB 2I1QA 3PSTA 5ALHA 2FE9A 1Z4NA 3RJGA 1AROP 4UAVA 4ZOHC 5KFMA 3PNCA 3N7SC 1NNLA 1NK4A 5ALWA 2OCEA 2YMPA 3B0YA 1BVSA 2FI1A 2ISPA 2BR0A 2KP7A 3C5GA 2KTQA 4JV0A 4F93B 3A0HU 4KLGA 4PGXA 1L7NA 5J8YC 1V38A 5AKIA 2ALZA 4F5QA 5IIIA 2IMWP 1RYRA 2W7PA 4RQ5A 2JEGA 2KJ5A 5J2FA 3GIIA 2PFQA 3OHBA 1SWWA 4Y2YA 3MABA 2HW3A 3KZIU 4YCXA 2AH5A 1PUZA 5HNKA 5TZVA 2KVCA 5CWRA 4QZAA 1CEZA 4ED8A 3NVYA 2C28A 4R8UB 2ZUDA 4YG2A 1UCVA 3SAHA 4Q44A 1N5WA 2ZTDA 2LYAA 2AGPA 3LWMA 3GV8B 1ZRMA 2HOFA 4PHEA 5L1MA 4FFDA 4ED7A 3RAQA 5J2CA 4DOBA 2LYBA 4M47A 3LVVA 2LM4A 3RJIA 3PW4A 2BCQA 2WF9A 5KFVA 4YD1A 4A8EA 2NO5A 1S77D 4UAYA 5KG4A 5L1LA 5EE0A 9ICKA 2WB1F 4UW9A 4NLZA 4OJPA 2KIWA 4UAUA 4CE6A 4RQ4A 5B66U 2DUYA 1COOA 1VLBA 1KQQA 3BS7A 1QSLA 4NL9C 4UAWA 1KKXA 1ZXIA 2H5XA 4MFAA 1M6YA 4LZDA 1ZQIA 7ICHA 2B0CA 5ALEA 1NJZA 2XIDA 4U7CA 2KHQA 1S0VA 1TVAA 1ZD2P 4GIBA 3RF9A 4RUCA 5J0RA 2WF8A 7ICNA 3V6JA 2E8OA 2RHFA 5CP2A 1UHUA 1YT3A 3WK9A 4O3OA 5AK5A 3HW8A 3TACB 2H3VA 2W7OA 5DDMA 4I2HA 3MGIA 3WK7A 7ICFA 4KX3A 2W54A 4FBUA 9ICEA 4WJ3B 5AKZA 4F50A 4OCZA 4USAA 5HMMA 1S0NA 4QWEA 5AKXA 3MR5A 4QZFA 4Y2XA 1LV5A 5K4LA 4O3MA 5ALOA 2KFNA 2JMGA 9ICLA 4ECSA 3BDPA 4I2EA 1DGSA 4ECVA 5KG0A 1D9DA 1EXNA 4JK1A 1SZPA 4KLSA 5KFIA 5EE3A 2BGWA 5DKWA 1ZJMA 3NTUA 3B9JA 2PMZC 5J0WA 2F76X 4I2DA 1JI7A 5FP0A 4ECUA 4O5CA 2W04A 4IQWA 1KSPA 1J97A 5C5JA 1S0MA 3RJEA 2W9CA 1QCKA 2JZBB 3SYZA 1PK1A 1RZTA 2GLEA 3I1YA 1JALA 2L5YA 3KKAC 2EZZA 1V85A 2EAOA 5DQIA 1Q8KA 2ES6A 2G0AA 3NASA 2KZ3A 1L5UA 3V7LA 3FM9A 3PVXA 4RU9A 3C2LA 3ZD8A 1S9FA 1MC8A 1U9LA 2XICA 1ZQDA 5ALFA 4CDGA 7ICVA 3F5EA 4FZMA 4MEXA 2FMPA 3WKCA 3SAFA 3H8JA 5AM1A 1Y88A 2UVVA 1T4GA 2NO4A 1VJ5A 3IDWA 3KFUF 5KFOA 4OJLA 2ZTEA 2F77X 3ZD9A 5AHXA 4DQIA 5L1IA 1V9PA 2LKYA 1JN3A 3ISCA 2KJ8A 3PZPA 4ELTA 2KSOB 3RJFA 2K4IA 4UBBA 1NK7A 3RRGA 5DDYA 4DSFA 4DWIA 2BPCA 2RDIA 5ALTA 2OWOA 5KFNA 4KLOA 3CYMA 5DGAA 3ISBA 2P6UA 2HHQA 4PZOA 4UB2A 1D8LA 1DK3A 1S8OA 1N56A 2WF6A 4DL4A 2HOQA 9ICGA 4KLHA 3QZ7A 5JRTA 4DSKA 5L1JA 2ZIWA 1MA7A 5AI0A 2Q0ZX 2IHMA 2JEJA 3QNMA 2QKQA 4AP9A 2I9GA 5B5EU 1SWVA 9ICAA 4QJFB 2BDPA 5AKYA 2ZIUB 7ICPA 1ZQAA 2QB0B 5J29A 3QZ8A 5ALRA 1PZNA 4I2AA 5DB7A 5H2FU 1WUDA 5AK3A 3RB4A 1MQ3A 2R8KA 5AI4A 1L7PA 4I2FA 3E58A 5KFLA 4QNLA 9ICQA 2NV3A 4RNOA 3M9MB 2OM6A 1SL2A 5AKHA 2DPJA 5KAFU 2JGAA 2KFZA 2BQ3A 5DLGA 3TANA 3PV8A 3U26A 4KLTA 1ZQNA 3PW5A 1TFRA 2ZJAA 1QLNA 4TQSA 1NK8A 5DG7A 3ICXA 3NVWA 3AL0B 3EWAA 1ZQMA 4Q43A 1ZQWA 2ZIXB 1UA0A 3WU2U 5AI8A 3KTQA 5AIBA 2J6UA 4QZEA 3TADA 2JH7A 2JXJA 2XC9A 5KFRA 3H40A 1ZRNA 3MGHA 4Y2TA 3V6KA 1L8LA 3C21A 1B22A 3HJEA 2G09A 1K1SA 1HEKA 1L3UA 1ZQPA 4Y2PA 5KFHA 1ZQVA 1QSSA 5DBBA 3F2DA 4KTQA 1SZHA 2F1JA 2Q4TA 4M9GA 4C4RA 4KN4A 4ELVA 4R65A 3PO4A 3ED5A 2ODGA 4XA5A 1K1QA 2XI9A 2AGQA 4UAZA 4DSJA 3MR2A 3RJKA 3H0MB 3Q8SB 2VA2A 4TURA 2G06A 3WK5A 4F5RA 4NLKA 3M9NB 1IV8A 2UVRA 5J2HA 1KBUA 2W9BA 2H3IA 2KKPA 1RXWA 2YTUA 4JWMA 2XCPA 3BS5B 4KX5A 1IM4A 2F1IA 4NXZA 1BPYA 2ATLA 5KFSA 5DGBA 4RPZA 1SXEA 4EBDA 8ICJA 8ICKA 5DLFA 4ECTA 3MDCA 4PGYA 1NK5A 4DL3A 3QUTA 2K8AA 4IQUA 4AYBF 4GC7A 7ICOA 3L3FX 4DFDA 2F2AB 1LKYB 3HPOA 2BCRA 1OUQA 5ALNA 5KAIU 2R8IA 3EUB2 5KFPA 3LVWA 5J2GA 4XUSA 1C20A 2NRVA 2IBKA 3SEIA 8ICTA 1QQ7A 1LB2B 1CI4A 3WK6A 4B9UA 4Y2UA 5KFAA 4DFJA 4ECQA 2HHWA 1UT5A 4BWJA 9ICUA 4LZGA 2BCSA 3GIKA 4HYKA 4QZDA 1L3VA 4P0QB 1WWUA 3IP4B 3RH4A 4B9SA 5DBCA 3T5JA 4F5OA 2LPEA 2R18A 4FZLA 2KICA 2O6KA 2XCAA 2F1HA 4Y2QA 2E3TA 4J9KA 4BJQA 9ICNA 3MBYA 5AKEA 2KIVA 2KZZA 5EWFA 3T5KA 1Z1BA 4NL9A 4PH5A 1X9SA 4RQ3A 4C4TA 1FIQA 4YR0A 2C2RA 1RXVA 4RQNA 4K4HA 1X2IA 3CP8A 7ICLA 5L9XA 4I2JA 3TFSA 2FLLA 4K4GA 4EEKA 2W11A 5BPCA 5T14A 2GWSA 3WKAA 4O5EA 1L3SA 1J2MA 1ZD3A 4Y2RA 1Z3EB 2ZTCA 1DXSA 5EE9A 4PJ0U 3V7JA 3TADC 4DL2A 4P4MA 1RG6A 3T3FA 5ALYA 2IOFA 4M9NA 2MA1A 2QARB 4DEZA 5KL8B 2HMXA 4I2CA 1JXEA 4KLEA 1ZQCA 1OXJA 2VANA 2I6XA 1SB3C 4KLMA 3JPSA 2WF7A 1NK0A 4BXOA 3PSFA 2F44A 3V6HA 3MC1A 4C4SA 2PFPA 2A1JA 2BCVA 3UPQA 5EWEA 3RH5A 1XNSA 3H8SA 5ALMA 3AN1A 3QUBA 1KL9A 5KFJA 5KG2A 4RQ1A 3NRZA 3K1ZA 5HR6A 4F5PA 2XY5A 2CRXA 5AI9A 5AK4A 5J2JA 4QW9A 4DS5A 1N61A 2FLNA 3D6JA 4ZH4A 1KN5A 1B4FA 5KFUA 4M9LA 4NM1A 1A6SA 1L8OA 2EQYA 1WG8A 3E0FA 1MN8A 5AM0A 4QWBA 4NY8A 2HHXA 4QZ8A 3C29A 1VDVA 3KKAA 1XSPA 3QU5A 4BDPA 3FC4A 5AI5A 4EBEA 4UB8U 5CHGA 1JROA 1SKSA 5F9NA 3PX6A 4R8UA 5JTIA 4GC6A 1NOMA 2K89A 4F8RA 4YN4A 4C7YA 2KV2A 2Y1IA 2HBKA 4QWAA 1ZJNA 5D4BA 2DF4B 5AKGA 1TKDA 2XGQA 1XSNA 2W9MA 2DWQA 2KJ9A 4US9A 1KDHA 1Z19A 1T94A 7ICJA 3ZDDA 2IOHA 1SKWA 4FO6A 2J6SA 4NLGA 4YXJA 8ICZA 3K1RB 4Q8EA 3QUQA 1SL1A 4U6PA 3OTQA 5CJ7A 2V4QA 9ICBA 3WK8A 4HAIA 1A77A 3PR4A 2DBYA 4LVSA 1KFTA 3EPIA 3PMLA 4DL6A 5DBAA 2WAQF 1X6IA 4RT3A 3SAGA 1U48A 3IV6A 4NLBA 4UQGA 2HBMA 2UVUA 2KVSA 3SI8A 5DG8A 1WWVA 5IIMA 1Z00B 1ZQSA 5AI6A 4KN7A 2EDUA 2AGOA 2M0NA 1ZOLA 3HKZC 5AKLA 1FO4A 4YD2A 2CN1A 1CUKA 3ALRA 3EZ5A 2KEYA 4RQMA 4DF8A 5AK6A 2ZG6A 4IS7A 5CA7A 1PVPA 5DB8A 4DS4A 3NUQA 3H7IA 1V97A 1U49A 1SGGA 1P7DA 2CPRA 4GFJA 3TAQA 2JV3A 3AQEA 1RYSA 1MSWD 3EW9A 1U4BA 3KHLA 5CB1A 3THVA 4MF8A 1ZQEA 3QU2A 3C2MA 5J2KA 1SKRA 8ICGA 5D46A 4QZIA 4IQVA 1U45A 3SV4A 1KLNA 1SV0C 4JUZA 5J0QA 4UASA 2ASDA 4I29A 1YZ7A 4RQ8A 4DFKA 3GU3A 4NWIA 2A3VA 2VA3A 3DEEA 3MFHA 4YMMA 5CRXA 2YMQA 3EPGA 4KLFA 2BPGA 3N28A 3MFIA 4CF5A 2KMDA 2AXTU 4I2GA 2RRDA 1ZQLA 5IIJA 1XU4A 4JV1A 3H4DA 1HUOA 1ZQHA 1N2XA 1ZQTA 2W9CB 3MR6A 4QIWF 4FS2A 1SIJA 3KZXA 1PK1B 2KG5A 2LMRA 2YB4A 3HRDD 5DB6A 2K8CB 3SD7A 3S6JA 2HDOA 5DQGA 1HIWA 5G5HA 1ZQXA 8ICAA 4KMUA 3JPRA 4QZCA 1JUDA 3JPPA 4JMUA 2ZUBA 1KEJA 2FPLA 5HR7A 2ZIVA 2BQUA 1WYGA 4DSIA 3OSNA 2AQ0A 2Y0SF 2BDUA 4TQRA 1BPDA 1ZD4A 2K4PA 2VJ4A 5G5GA 2LM1A 3LWLA 8ICOA 5HMLA 2QB1A 4B6JA 1O03A 2H3QA 4NV0A 5HHHA 1SXDA 1TE2A 4K4IA 2IHNA 2KSOA 3GV7B 4PHPA 5KT5A 3PY8A 3Q8KA 4ED1A 4Y2JA 3GIJA 2JRZA 1TAUA 9ICTA 2XY7A 1ZQBA 3L4PA 4OJ6A 2K4EA 2W3RA 4KLLA 4JB3A 3O0FA 3LK9A 3D2QA 2Y9UA 4RUAA 3QYPA 2DPIA 3J81j 2GO7A 2WTFA 3KHRA 4RPYA 4F92B 2ZIWB 4J9RA 2PFOA 1ZQZA 2NRWA 3M7DA 1COKA 3KHHA 2YY6A 1ZQ1C 2C2DA 3JPTA 5F9LA 1QH9A 1TV9A 1SL0A 4F4WA 8ICIA 1KW4A 4OJOA 5KT7A 2CXYA 3SENA 3GFKB 2WB1C 8ICSA 1X40A 1ZQRA 8ICLA 9ICRA 8ICUA 4KLDA 4EYHB 3C28A 4YMNA 4O9MA 9ICXA 5J2AA 1FFVA 4ECXA 4MFFA 3G6YA 2JR5A 5KFQA 3QX7A 2PI5A 2XVTA 5AICA 5TISU 3GZFA 3QEBZ 3VC8A 3AU6A 2JEFA 3IHQB 3UM9A 3RFAA 2ZJ5A 3M6KA 4YVZA 2KD1A 4ED3A 2LI6A 4LJXA 2BKEA 3MGVA 1LVHA 4PHAA 3KOOA 4E0DA 2DKXA 5EE1A 4P0PA 2K60A 2G5IB 1NJWA 4J9SA 4EX7A 4Q45A 1BPZA 4UB4A 2W8KA 2EZYA 5ALKA 4KLUA 3M9OB 1PVQA 1TK8A 2AHOB 2LHTA 5DQHA 3QE9Y 9ICHA 8ICBA 5KG5A 8ICHA 2DFLA 5HHIA 4GLXA 2LBOA 2YX8A 4C8KA 4O3QA 4DQPA 4UBCA 3OGUA 5AM5A 1AQ6A 1T7PA 1IIPA 3CW2C 4XRHA 3OJUA 1DOQA 2W8LA 3ZDBA 4I28A 3HILA 5KG7A 3PSPA 7ICMA 4IR1A 4US8A 2FMSA 3QEAZ 1JIHA 2K8BB 4C8OA 1XC9A 4F4XA 1Q46A 4EENA 2W9BB 5AM4A 1RPLA 4IC9A 5GTIU 3MDAA 3PW7A 4YFKA 3HP6A 3Q8LA 1ZQOA 2H3FA 5J0YA 3M6ZA 4DCCA 4ED6A 2DKZA 5KFDA 3PX4A 1N48A 4BWMA 5L1KA 2ZXIA 3TI0A 1DGJA 2WF5A 1XS9D 1KRPA 4QZ9A 5HP4A 5KG1A 1Q3VA 2MUTA 4QZBA 4EX6A 7ICSA 3OJSA 3PMNA 1J2NA 2Y9TA 4F91B 2R8GA 4J9NA 3I76A 1NJXA 4CCHA 4F2SA 4M6WA 8ICWA 3NS1A 2RLTA 3KBBA 3IN5A 4YR3A 1URJA 4P0QA 2AU0A 3F5AA 4TUSA 2F8KA 1D9FA 2NRTA 8ICYA 3RH6A 2Y0SC 5ALSA 1H38A 4ECRA 3R9KA 5ALVA 2HHVA 5J0PA 4J9QA 3UMBA 2KE7A 2R8JA 4J9LA 2YMMA 3M8SA 4MF2A 3SMVA 3VCBA 3JPOA 3IM1A 4J9PA 1TAMA 2FMQA 1FFUA 5KT4A 5BOMA 5ALJA 1F5SA 4C80A 3RJJA 4EZ9A 3EYZA 2VJ5A 3T79A 1ZQQA 3K4GA 2PMZF 3AEVA 2PKEA 3DV9A 5ALXA 5DB9A 3RJHA 4RNMA 2BZFA 1S10A 2M9NA 1NZBA 4FBTA 5KFEA 3C1YA 5ALIA 3ZDAA 1NKBA 2NRXA 2PXIA 2OEHA 4DFPA 7ICIA 1JRPA 5DG9A 1A76A 1RQLA 5F3XB 5J2IA 4GXJA 1A0PA 4ELUA 2OH2A 1TAQA 5AIAA 4PL2A 4CNQA 2VIXA 3ISDA 1KTQA 1NKEA 3V7KA 1SV0A 2A1AA 3UMGA 7ICQA 4C8MA 1WCLA 4KLQA 1BNOA 1BPEA 5EWGA 4C0ZA 3KHGA 2ESEA 2ASJA 3ZI4A 1WCNA 1X6JA 1ZD5A 2A1JB 3FAHA 4MEYA 3JPNA 4G3IA 4RQ0A 2P35A 1NK6A 3JPQA 4P4PA 2PI4A 4UATA 1KFDA 4RQ7A 5KFGA 3QU9A 4QZHA 4RPXA 1DRGA 4F4YA 4OJ5A 3Q8MA 4CF3A 4BUGA 2G08A 3AUOA 3ZDCA 4P2HA 3QXGA 3RB0A 4Q8FA 2DL0A 7ICEA 1ECWA 5ALQA 3IG8A 1NK9A 3WKDA 2N1RA 4PL1A 5AKJA 3RBDA 1BNPA 2R8HA 2IOFK 4DQSA 3PSIA 9ICMA 4DOCA 2HI0A 4Y2VA 4F4ZA 3SV3A 3T5LA 2MSNA 9ICPA 4C8LA 3N97B
chains in the Genus database with same CATH topology
2ZJAA 1ZQLA 1HUZA 5KFBA 1QLNA 1T3NA 1JXLA 5BOLA 4TQSA 5DG7A 2ZUCA 4DO9A 4DF4A 4Z6CA 1NK8A 4F2RA 5IIJA 1XU4A 4JV1A 3EWAA 3H4DA 1HUOA 4EYIB 4R64A 1ZQMA 1UT8A 1ZQHA 9ICJA 4O3SA 4Q43A 1ZQWA 1UA0A 3GQCA 1ZQTA 4IRKA 2FPKA 3ZDEA 3KTQA 2J6UA 2W9CB 3MR6A 3PX0A 3RBEA 4QZEA 4ED0A 3RR8A 2P66A 3K75D 4QW8A 1L3TA 4I2IA 4FS2A 2XC9A 5KFRA 3H40A 1MQ2A 2HVIA 3MGHA 2NRZA 4DQQA 3V6KA 5DB6A 2XGPA 3C21A 5EOZA 8ICXA 1B22A 4ED2A 5DQGA 3RB3A 1K1SA 3GILA 2BHNA 4TUPA 1L3UA 4FS1A 1ZQPA 5KG6A 1S97A 1ZQXA 5KFHA 1ZQVA 4M2YA 1QSSA 4F4KA 8ICQA 9ICSA 5J0TA 5DBBA 8ICAA 4KMUA 3JPRA 3SZ2A 4QZCA 2UVWA 4KTQA 2F1JA 5KFYA 3JPPA 4KLIA 4M9GA 4PPXA 2ZUBA 2C2EA 4F3OA 3OHAA 1KEJA 2FPLA 2BCUA 3C1ZA 4KN4A 2BQRA 4ELVA 4UB3A 2V9WA 4R65A 5CR0A 3V72A 2BQUA 3PO4A 4DSIA 2JEIA 3OSNA 5KT2A 3RB6A 2AQ0A 4XA5A 4C8LA 1K1QA 2AGQA 4UAZA 3H8WA 4DSJA 1NJYA 4TQRA 9ICIA 1ZQUA 2B21A 1BPDA 3MR2A 3RJKA 2VA8A 3Q8SB 4O0IA 4R66A 1T8EA 2VA2A 3UXPA 3C23A 3Q8PB 3LWLA 4TURA 5HMLA 4EZ6A 4F5RA 4NLNA 4NLKA 8ICOA 3M9NB 3GIMA 2UVRA 4O3PA 5J2HA 3TARA 5HHHA 4RT2A 2W9BA 5KFZA 4K4IA 2IHNA 1RXWA 4RQ2A 4JWMA 2XCPA 1Z00A 1B43A 5KT3A 5J2DA 4RQ6A 2AQ4A 3GV7B 3BQ0A 4BXOB 1IM4A 2I1QA 4PHPA 3TQ1A 5KT5A 3PY8A 4GXIA 4DLEA 5KFXA 4ED1A 3Q8KA 3RJGA 1AROP 4C8NA 2F1IA 4NXZA 1BPYA 5KFMA 5IILA 3PNCA 3GIJA 1TAUA 9ICTA 2XY7A 2ATLA 1ZQBA 1NK4A 7ICRA 5KFSA 4O3NA 5DGBA 4RPZA 4EBDA 5IIKA 4KLLA 3LK9A 8ICJA 8ICKA 3B0YA 4ECTA 3MDCA 4PGYA 1BVSA 2MAXA 4RUAA 3G6VA 5DLFA 4DL3A 2BR0A 1NK5A 2DPIA 2ISPA 3C5GA 3C2KA 4IQUA 1TK0A 4GC7A 2KTQA 7ICOA 1X9MA 4JV0A 4F93B 2W9AA 1UA1A 2WTFA 5KFCA 4RPYA 3HPOA 3KHRA 1JX4A 3MR3A 2BCRA 4F92B 4KLGA 4PGXA 2R8IA 2PFOA 4J9RA 5KFPA 3TFRA 1ZQZA 2NRWA 8ICNA 5J2GA 4XUSA 3KHHA 4B9TA 2ALZA 4F5QA 2NRVA 5IIIA 2C2DA 2IMWP 2IBKA 1RYRA 8ICTA 9ICWA 3JPTA 4RQ5A 5F9LA 5D49A 1LB2B 2JEGA 1TV9A 1SL0A 4F4WA 5J2FA 8ICIA 3GIIA 4J9OA 3E2EA 5KT7A 2PFQA 1BGXT 1QSYA 4B9UA 5KFAA 3PR5B 3GFKB 3OHBA 4ECQA 4DFJA 8ICSA 5J2BA 1TK5A 1UT5A 1ZQRA 2HHWA 4BWJA 9ICUA 3MABA 4B9NA 4B9VA 4LZGA 4Z6DA 2HW3A 8ICLA 2BCSA 4YCXA 3GIKA 4HYKA 9ICRA 4QZDA 8ICUA 4KLDA 5HNKA 5TZVA 5CWRA 4EYHB 4QZAA 1L3VA 1CEZA 4YMNA 8ICPA 4O9MA 4ED8A 9ICXA 3BJYA 1BPXA 5J2AA 2C28A 3RH4A 4R8UB 4B9SA 5DBCA 2ZUDA 3T5JA 4ECXA 4YG2A 4F5OA 4MFFA 3G6YA 8ICVA 1XWLA 4Q44A 5KFQA 5J0UA 2ZTDA 2PI5A 4YMOA 2V4RA 2XCAA 2F1HA 4J9KA 4I2BA 9ICNA 2AGPA 3QEBZ 3LWMA 2JEFA 2JZBA 3MBYA 3AU6A 3GV8B 3IHQB 4IRDA 2KZZA 5EWFA 3T5KA 4RNNA 7ICUA 4PHEA 2ZJ5A 4YVZA 1BPBA 4PH5A 1X9SA 4RQ3A 4ED7A 9ICPA 3RAQA 5KFWA 5J2CA 4YR0A 4DOBA 4ED3A 5IINA 2C2RA 4M47A 4KLJA 1RXVA 3RJIA 3PW4A 2BKEA 4PHAA 2BCQA 5KFVA 5KTQA 4E0DA 4YD1A 3Q8RB 4EEYA 3RTVA 4K4HA 1S77D 4UAYA 5KG4A 5L1LA 1NJWA 1X2IA 4DQRA 9ICKA 4J9SA 4Q45A 1BPZA 4UB4A 2W8KA 7ICLA 4KLUA 5L9XA 4I2JA 3M9OB 3UXOA 3TFSA 1TK8A 2FLLA 4K4GA 4NLZA 5DQHA 5BPCA 3QE9Y 9ICHA 8ICBA 4RQ4A 2GWSA 4O5EA 1COOA 5KG5A 2DFLA 8ICHA 1L3SA 4M9JA 5HHIA 4R63A 4GLXA 1Z3EB 4DSLA 2ZTCA 5KT6A 4C8KA 3V7JA 4X5VA 4O3QA 4DL2A 4UBCA 4UAWA 4YXMA 4P4MA 1QSLA 2H5XA 4DQPA 3OGUA 4MFAA 3T3FA 4O5KA 4M9NA 4LZDA 1T7PA 4IRCA 1ZQIA 7ICHA 4XRHA 1NJZA 3OJUA 4DEZA 1DOQA 2Y1JA 2W8LA 3ZDBA 4I28A 1S0VA 5J0OA 5KG7A 3GDXA 1TVAA 1X9WA 1ZQYA 7ICMA 4IR1A 4RZRA 2FMSA 3QEAZ 4ECYA 4I2CA 1JXEA 1JIHA 4RUCA 5J0RA 1ZQCA 4KLEA 4C8OA 7ICNA 1JMSA 2VANA 1XC9A 4F4XA 4KLMA 3V6JA 3JPSA 5CP2A 4UB1A 1NK0A 3N97B 2W9BB 1RPLA 4O3OA 3HW8A 4BXOA 3MDAA 3PW7A 4YFKA 4XQ8A 3HP6A 5DDMA 3V6HA 4I2HA 3Q8LA 3MGIA 2PFPA 7ICFA 2A1JA 4DOAA 1ZQOA 5J0YA 3PW2A 2BCVA 3TAPA 3UPQA 5EWEA 3RH5A 1IXRA 3H8SA 4FBUA 4DFMA 4ED6A 9ICEA 5KFDA 7ICKA 1ZQFA 3PX4A 1N48A 4BWMA 4F50A 5KFJA 5KG2A 4RQ1A 5L1KA 4J9MA 5HMMA 1S0NA 4YP3A 4QWEA 3MR5A 3TI0A 4QZFA 2HHSA 4F5PA 3UQ2A 2ZJ8A 2XY5A 1LV5A 1D8YA 5J2JA 3UQ0A 1XS9D 1KRPA 4BGDA 4QW9A 4B9MA 2KFNA 4Z6FA 4YQWA 2ISOA 9ICLA 4ECSA 4KITB 4DS5A 2FLNA 4QZ9A 3BDPA 4I2EA 4ZH4A 1DGSA 5HP4A 5KFUA 4M9LA 3C5FA 4NM1A 5KG1A 2MUTA 4QZBA 4ECVA 5KG0A 7ICSA 5J0XA 1D9DA 3OJSA 3HT3A 5KFKA 3PMNA 1EXNA 4JK1A 1SZPA 4KLSA 4NY8A 4QWBA 5KG3A 5KFIA 2LYHA 4QZ8A 3GV5B 2HHXA 4IQTA 4F91B 2R8GA 2BGWA 2KN7A 4J9NA 1NJXA 4CCHA 1XSPA 4F2SA 5DKWA 4M6WA 1ZJMA 8ICWA 3NTUA 3AU2A 4BDPA 4GXKA 4EBEA 5CHGA 4YR3A 1SKSA 2XY6A 5F9NA 2AU0A 5J0WA 1QTMA 3PX6A 4R8UA 2XO7A 4TUSA 4GC6A 3ORYA 4I2DA 4QWDA 1NOMA 4F8RA 4ECUA 4YN4A 3RR7A 4O5CA 2C22A 1D9FA 2NRTA 4IQWA 1KSPA 2HHTA 8ICYA 5C5JA 2Y1IA 3RH6A 4QWAA 1S0MA 2P6RA 1ZJNA 5D4BA 8ICRA 3RRHA 1TKDA 3RJEA 2XGQA 2W9CA 1XSNA 2JZBB 3SYZA 2W9MA 3BQTA 1KDHA 1H38A 3FYHA 4ECRA 1RZTA 1C7YA 7ICJA 3ZDDA 2HHVA 5J0PA 1SKWA 1L5UA 1XO1A 5DQIA 4FO6A 4J9QA 2FLPA 2KZ3A 2HVHA 8ICCA 4O3RA 3V7LA 4ECZA 4J9LA 3PVXA 2J6SA 4YXJA 2R8JA 4RU9A 3BQ1A 4NLGA 3C2LA 8ICZA 3ZD8A 1S9FA 3M8SA 3UXNA 4MF2A 1MC8A 3JPOA 3IM1A 1U9LA 4J9PA 2FMQA 4Q8EA 1ZQDA 4M04A 7ICVA 5KFTA 4MEXA 2FMPA 1SL1A 5KT4A 5BOMA 9ICCA 4KLQA 3PW0A 3RJJA 3H8JA 2ASLA 4EBCA 4EZ9A 5CJ7A 2V4QA 9ICBA 3EYZA 1ZETA 1ZQQA 4JWNA 1Y88A 3K4GA 2UVVA 1T4GA 1A77A 3PR4A 5JUMA 4LVSA 5DB9A 3RJHA 3EPIA 1KFTA 5KFOA 4RNMA 1ZQGA 3PMLA 8ICMA 3HX0A 5DBAA 4DSEA 4DL6A 1S10A 2M9NA 2AJQA 4MFCA 2ZTEA 4FBTA 5KFEA 4RT3A 4QWCA 2BPFA 7ICGA 3ZD9A 3T5HA 3C1YA 1ZQJA 1ZYQA 1U48A 3ZDAA 1NKBA 4DQIA 8ICEA 2NRXA 3LDAA 4UQGA 2PXIA 4DFPA 5L1IA 7ICIA 1V9PA 1KFSA 2UVUA 1JN3A 1A76A 1HJPA 3FDSA 5DG9A 5DG8A 3ISCA 3SI8A 4ELTA 3RJFA 4UBBA 5IIMA 1Z00B 5J2IA 4GXJA 1NK7A 5DDYA 4DSFA 1ZQSA 4KN7A 3RRGA 4ELUA 9ICVA 1TAQA 2AGOA 4DWIA 3RAXA 4I2GA 2BPCA 1KTQA 3ISDA 3H4BA 1NKEA 4YD2A 2RDIA 1CUKA 3V7KA 4DLGA 2OWOA 3NGDA 5KFNA 3Q8QB 4KLOA 3PO5A 7ICTA 5DGAA 3EZ5A 7ICQA 4C8MA 1WCLA 5IIOA 3ISBA 1BPEA 2P6UA 5EWGA 4F5NA 4ECWA 3KHGA 4DF8A 2HHQA 9ICOA 4QZGA 4UB2A 4PHDA 2ASJA 5CA7A 3OSPA 1D8LA 1ZQKA 1WCNA 2J6TA 4M0AA 5DB8A 3N4MB 4DS4A 2A1JB 2HHUA 3G6XA 3H7IA 4MEYA 3JPNA 4DL4A 1XSLA 1N56A 9ICGA 1U49A 4KLHA 3QZ7A 4DSKA 4G3IA 4Z6EA 4RQ0A 3TAQA 5L1JA 1NK6A 1RYSA 1MSWD 4P4OA 3EW9A 1U4BA 4IR9A 3KHLA 3ETLA 5CB1A 4DL5A 3THVA 3JPQA 2Q0ZX 4P4PA 4MF8A 2IHMA 3BQ2A 2JEJA 2PI4A 1ZQEA 3C2MA 4PGQA 2I9GA 9ICAA 5J2KA 2BDPA 1KFDA 4RQ7A 5KFGA 1U47A 1SKRA 8ICGA 4QZHA 5D46A 1ZQAA 7ICPA 4RPXA 5J29A 4QZIA 3QZ8A 2RDJA 4IQVA 1U45A 3SV4A 2KZMA 1PZNA 1KLNA 4F4YA 5DB7A 2PFNA 4I2AA 3Q8MA 4JUZA 3RB4A 1MQ3A 2R8KA 2MUTB 5J0QA 3B0XA 4B9LA 4NM2A 3AUOA 3ZDCA 4P2HA 5KFFA 3RB0A 4I27A 5KFLA 4I2FA 4Q8FA 4DL7A 4UB5A 2ASDA 7ICEA 9ICQA 4I29A 3M9MB 4RNOA 1NK9A 4JV2A 4RQ8A 1NKCA 4DFKA 3RBDA 9ICFA 2R8HA 2FPMA 4DQSA 1SL2A 9ICMA 2DPJA 1S0OA 4DOCA 2VA3A 2KFZA 3M8RA 4M6WB 2BQ3A 5DLGA 3MFHA 4YMMA 3TANA 3HWTA 8ICFA 3EPGA 4KLFA 4M9HA 3PV8A 2BPGA 4F4ZA 3MFIA 3SV3A 1S76D 4YR2A 3T5LA 5J2EA 2IA6A 4KLTA 4TUQA 5J0SA 1ZQNA 3PW5A 1TFRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZJA A;  1ZQL A;  1HUZ A;  5KFB A;  1QLN A;  1T3N A;  1JXL A;  5BOL A;  4TQS A;  5DG7 A;  2ZUC A;  4DO9 A;  4DF4 A;  4Z6C A;  1NK8 A;  4F2R A;  5IIJ A;  1XU4 A;  4JV1 A;  3EWA A;  3H4D A;  1HUO A;  4EYI B;  4R64 A;  1ZQM A;  1UT8 A;  1ZQH A;  9ICJ A;  4O3S A;  4Q43 A;  1ZQW A;  1UA0 A;  3GQC A;  1ZQT A;  4IRK A;  2FPK A;  3ZDE A;  3KTQ A;  2J6U A;  2W9C B;  3MR6 A;  3PX0 A;  3RBE A;  4QZE A;  4ED0 A;  3RR8 A;  2P66 A;  3K75 D;  4QW8 A;  1L3T A;  4I2I A;  4FS2 A;  2XC9 A;  5KFR A;  3H40 A;  1MQ2 A;  2HVI A;  3MGH A;  2NRZ A;  4DQQ A;  3V6K A;  5DB6 A;  2XGP A;  3C21 A;  5EOZ A;  8ICX A;  1B22 A;  4ED2 A;  5DQG A;  3RB3 A;  1K1S A;  3GIL A;  2BHN A;  4TUP A;  1L3U A;  4FS1 A;  1ZQP A;  5KG6 A;  1S97 A;  1ZQX A;  5KFH A;  1ZQV A;  4M2Y A;  1QSS A;  4F4K A;  8ICQ A;  9ICS A;  5J0T A;  5DBB A;  8ICA A;  4KMU A;  3JPR A;  3SZ2 A;  4QZC A;  2UVW A;  4KTQ A;  2F1J A;  5KFY A;  3JPP A;  4KLI A;  4M9G A;  4PPX A;  2ZUB A;  2C2E A;  4F3O A;  3OHA A;  1KEJ A;  2FPL A;  2BCU A;  3C1Z A;  4KN4 A;  2BQR A;  4ELV A;  4UB3 A;  2V9W A;  4R65 A;  5CR0 A;  3V72 A;  2BQU A;  3PO4 A;  4DSI A;  2JEI A;  3OSN A;  5KT2 A;  3RB6 A;  2AQ0 A;  4XA5 A;  4C8L A;  1K1Q A;  2AGQ A;  4UAZ A;  3H8W A;  4DSJ A;  1NJY A;  4TQR A;  9ICI A;  1ZQU A;  2B21 A;  1BPD A;  3MR2 A;  3RJK A;  2VA8 A;  3Q8S B;  4O0I A;  4R66 A;  1T8E A;  2VA2 A;  3UXP A;  3C23 A;  3Q8P B;  3LWL A;  4TUR A;  5HML A;  4EZ6 A;  4F5R A;  4NLN A;  4NLK A;  8ICO A;  3M9N B;  3GIM A;  2UVR A;  4O3P A;  5J2H A;  3TAR A;  5HHH A;  4RT2 A;  2W9B A;  5KFZ A;  4K4I A;  2IHN A;  1RXW A;  4RQ2 A;  4JWM A;  2XCP A;  1Z00 A;  1B43 A;  5KT3 A;  5J2D A;  4RQ6 A;  2AQ4 A;  3GV7 B;  3BQ0 A;  4BXO B;  1IM4 A;  2I1Q A;  4PHP A;  3TQ1 A;  5KT5 A;  3PY8 A;  4GXI A;  4DLE A;  5KFX A;  4ED1 A;  3Q8K A;  3RJG A;  1ARO P;  4C8N A;  2F1I A;  4NXZ A;  1BPY A;  5KFM A;  5IIL A;  3PNC A;  3GIJ A;  1TAU A;  9ICT A;  2XY7 A;  2ATL A;  1ZQB A;  1NK4 A;  7ICR A;  5KFS A;  4O3N A;  5DGB A;  4RPZ A;  4EBD A;  5IIK A;  4KLL A;  3LK9 A;  8ICJ A;  8ICK A;  3B0Y A;  4ECT A;  3MDC A;  4PGY A;  1BVS A;  2MAX A;  4RUA A;  3G6V A;  5DLF A;  4DL3 A;  2BR0 A;  1NK5 A;  2DPI A;  2ISP A;  3C5G A;  3C2K A;  4IQU A;  1TK0 A;  4GC7 A;  2KTQ A;  7ICO A;  1X9M A;  4JV0 A;  4F93 B;  2W9A A;  1UA1 A;  2WTF A;  5KFC A;  4RPY A;  3HPO A;  3KHR A;  1JX4 A;  3MR3 A;  2BCR A;  4F92 B;  4KLG A;  4PGX A;  2R8I A;  2PFO A;  4J9R A;  5KFP A;  3TFR A;  1ZQZ A;  2NRW A;  8ICN A;  5J2G A;  4XUS A;  3KHH A;  4B9T A;  2ALZ A;  4F5Q A;  2NRV A;  5III A;  2C2D A;  2IMW P;  2IBK A;  1RYR A;  8ICT A;  9ICW A;  3JPT A;  4RQ5 A;  5F9L A;  5D49 A;  1LB2 B;  2JEG A;  1TV9 A;  1SL0 A;  4F4W A;  5J2F A;  8ICI A;  3GII A;  4J9O A;  3E2E A;  5KT7 A;  2PFQ A;  1BGX T;  1QSY A;  4B9U A;  5KFA A;  3PR5 B;  3GFK B;  3OHB A;  4ECQ A;  4DFJ A;  8ICS A;  5J2B A;  1TK5 A;  1UT5 A;  1ZQR A;  2HHW A;  4BWJ A;  9ICU A;  3MAB A;  4B9N A;  4B9V A;  4LZG A;  4Z6D A;  2HW3 A;  8ICL A;  2BCS A;  4YCX A;  3GIK A;  4HYK A;  9ICR A;  4QZD A;  8ICU A;  4KLD A;  5HNK A;  5TZV A;  5CWR A;  4EYH B;  4QZA A;  1L3V A;  1CEZ A;  4YMN A;  8ICP A;  4O9M A;  4ED8 A;  9ICX A;  3BJY A;  1BPX A;  5J2A A;  2C28 A;  3RH4 A;  4R8U B;  4B9S A;  5DBC A;  2ZUD A;  3T5J A;  4ECX A;  4YG2 A;  4F5O A;  4MFF A;  3G6Y A;  8ICV A;  1XWL A;  4Q44 A;  5KFQ A;  5J0U A;  2ZTD A;  2PI5 A;  4YMO A;  2V4R A;  2XCA A;  2F1H A;  4J9K A;  4I2B A;  9ICN A;  2AGP A;  3QEB Z;  3LWM A;  2JEF A;  2JZB A;  3MBY A;  3AU6 A;  3GV8 B;  3IHQ B;  4IRD A;  2KZZ A;  5EWF A;  3T5K A;  4RNN A;  7ICU A;  4PHE A;  2ZJ5 A;  4YVZ A;  1BPB A;  4PH5 A;  1X9S A;  4RQ3 A;  4ED7 A;  9ICP A;  3RAQ A;  5KFW A;  5J2C A;  4YR0 A;  4DOB A;  4ED3 A;  5IIN A;  2C2R A;  4M47 A;  4KLJ A;  1RXV A;  3RJI A;  3PW4 A;  2BKE A;  4PHA A;  2BCQ A;  5KFV A;  5KTQ A;  4E0D A;  4YD1 A;  3Q8R B;  4EEY A;  3RTV A;  4K4H A;  1S77 D;  4UAY A;  5KG4 A;  5L1L A;  1NJW A;  1X2I A;  4DQR A;  9ICK A;  4J9S A;  4Q45 A;  1BPZ A;  4UB4 A;  2W8K A;  7ICL A;  4KLU A;  5L9X A;  4I2J A;  3M9O B;  3UXO A;  3TFS A;  1TK8 A;  2FLL A;  4K4G A;  4NLZ A;  5DQH A;  5BPC A;  3QE9 Y;  9ICH A;  8ICB A;  4RQ4 A;  2GWS A;  4O5E A;  1COO A;  5KG5 A;  2DFL A;  8ICH A;  1L3S A;  4M9J A;  5HHI A;  4R63 A;  4GLX A;  1Z3E B;  4DSL A;  2ZTC A;  5KT6 A;  4C8K A;  3V7J A;  4X5V A;  4O3Q A;  4DL2 A;  4UBC A;  4UAW A;  4YXM A;  4P4M A;  1QSL A;  2H5X A;  4DQP A;  3OGU A;  4MFA A;  3T3F A;  4O5K A;  4M9N A;  4LZD A;  1T7P A;  4IRC A;  1ZQI A;  7ICH A;  4XRH A;  1NJZ A;  3OJU A;  4DEZ A;  1DOQ A;  2Y1J A;  2W8L A;  3ZDB A;  4I28 A;  1S0V A;  5J0O A;  5KG7 A;  3GDX A;  1TVA A;  1X9W A;  1ZQY A;  7ICM A;  4IR1 A;  4RZR A;  2FMS A;  3QEA Z;  4ECY A;  4I2C A;  1JXE A;  1JIH A;  4RUC A;  5J0R A;  1ZQC A;  4KLE A;  4C8O A;  7ICN A;  1JMS A;  2VAN A;  1XC9 A;  4F4X A;  4KLM A;  3V6J A;  3JPS A;  5CP2 A;  4UB1 A;  1NK0 A;  3N97 B;  2W9B B;  1RPL A;  4O3O A;  3HW8 A;  4BXO A;  3MDA A;  3PW7 A;  4YFK A;  4XQ8 A;  3HP6 A;  5DDM A;  3V6H A;  4I2H A;  3Q8L A;  3MGI A;  2PFP A;  7ICF A;  2A1J A;  4DOA A;  1ZQO A;  5J0Y A;  3PW2 A;  2BCV A;  3TAP A;  3UPQ A;  5EWE A;  3RH5 A;  1IXR A;  3H8S A;  4FBU A;  4DFM A;  4ED6 A;  9ICE A;  5KFD A;  7ICK A;  1ZQF A;  3PX4 A;  1N48 A;  4BWM A;  4F50 A;  5KFJ A;  5KG2 A;  4RQ1 A;  5L1K A;  4J9M A;  5HMM A;  1S0N A;  4YP3 A;  4QWE A;  3MR5 A;  3TI0 A;  4QZF A;  2HHS A;  4F5P A;  3UQ2 A;  2ZJ8 A;  2XY5 A;  1LV5 A;  1D8Y A;  5J2J A;  3UQ0 A;  1XS9 D;  1KRP A;  4BGD A;  4QW9 A;  4B9M A;  2KFN A;  4Z6F A;  4YQW A;  2ISO A;  9ICL A;  4ECS A;  4KIT B;  4DS5 A;  2FLN A;  4QZ9 A;  3BDP A;  4I2E A;  4ZH4 A;  1DGS A;  5HP4 A;  5KFU A;  4M9L A;  3C5F A;  4NM1 A;  5KG1 A;  2MUT A;  4QZB A;  4ECV A;  5KG0 A;  7ICS A;  5J0X A;  1D9D A;  3OJS A;  3HT3 A;  5KFK A;  3PMN A;  1EXN A;  4JK1 A;  1SZP A;  4KLS A;  4NY8 A;  4QWB A;  5KG3 A;  5KFI A;  2LYH A;  4QZ8 A;  3GV5 B;  2HHX A;  4IQT A;  4F91 B;  2R8G A;  2BGW A;  2KN7 A;  4J9N A;  1NJX A;  4CCH A;  1XSP A;  4F2S A;  5DKW A;  4M6W A;  1ZJM A;  8ICW A;  3NTU A;  3AU2 A;  4BDP A;  4GXK A;  4EBE A;  5CHG A;  4YR3 A;  1SKS A;  2XY6 A;  5F9N A;  2AU0 A;  5J0W A;  1QTM A;  3PX6 A;  4R8U A;  2XO7 A;  4TUS A;  4GC6 A;  3ORY A;  4I2D A;  4QWD A;  1NOM A;  4F8R A;  4ECU A;  4YN4 A;  3RR7 A;  4O5C A;  2C22 A;  1D9F A;  2NRT A;  4IQW A;  1KSP A;  2HHT A;  8ICY A;  5C5J A;  2Y1I A;  3RH6 A;  4QWA A;  1S0M A;  2P6R A;  1ZJN A;  5D4B A;  8ICR A;  3RRH A;  1TKD A;  3RJE A;  2XGQ A;  2W9C A;  1XSN A;  2JZB B;  3SYZ A;  2W9M A;  3BQT A;  1KDH A;  1H38 A;  3FYH A;  4ECR A;  1RZT A;  1C7Y A;  7ICJ A;  3ZDD A;  2HHV A;  5J0P A;  1SKW A;  1L5U A;  1XO1 A;  5DQI A;  4FO6 A;  4J9Q A;  2FLP A;  2KZ3 A;  2HVH A;  8ICC A;  4O3R A;  3V7L A;  4ECZ A;  4J9L A;  3PVX A;  2J6S A;  4YXJ A;  2R8J A;  4RU9 A;  3BQ1 A;  4NLG A;  3C2L A;  8ICZ A;  3ZD8 A;  1S9F A;  3M8S A;  3UXN A;  4MF2 A;  1MC8 A;  3JPO A;  3IM1 A;  1U9L A;  4J9P A;  2FMQ A;  4Q8E A;  1ZQD A;  4M04 A;  7ICV A;  5KFT A;  4MEX A;  2FMP A;  1SL1 A;  5KT4 A;  5BOM A;  9ICC A;  4KLQ A;  3PW0 A;  3RJJ A;  3H8J A;  2ASL A;  4EBC A;  4EZ9 A;  5CJ7 A;  2V4Q A;  9ICB A;  3EYZ A;  1ZET A;  1ZQQ A;  4JWN A;  1Y88 A;  3K4G A;  2UVV A;  1T4G A;  1A77 A;  3PR4 A;  5JUM A;  4LVS A;  5DB9 A;  3RJH A;  3EPI A;  1KFT A;  5KFO A;  4RNM A;  1ZQG A;  3PML A;  8ICM A;  3HX0 A;  5DBA A;  4DSE A;  4DL6 A;  1S10 A;  2M9N A;  2AJQ A;  4MFC A;  2ZTE A;  4FBT A;  5KFE A;  4RT3 A;  4QWC A;  2BPF A;  7ICG A;  3ZD9 A;  3T5H A;  3C1Y A;  1ZQJ A;  1ZYQ A;  1U48 A;  3ZDA A;  1NKB A;  4DQI A;  8ICE A;  2NRX A;  3LDA A;  4UQG A;  2PXI A;  4DFP A;  5L1I A;  7ICI A;  1V9P A;  1KFS A;  2UVU A;  1JN3 A;  1A76 A;  1HJP A;  3FDS A;  5DG9 A;  5DG8 A;  3ISC A;  3SI8 A;  4ELT A;  3RJF A;  4UBB A;  5IIM A;  1Z00 B;  5J2I A;  4GXJ A;  1NK7 A;  5DDY A;  4DSF A;  1ZQS A;  4KN7 A;  3RRG A;  4ELU A;  9ICV A;  1TAQ A;  2AGO A;  4DWI A;  3RAX A;  4I2G A;  2BPC A;  1KTQ A;  3ISD A;  3H4B A;  1NKE A;  4YD2 A;  2RDI A;  1CUK A;  3V7K A;  4DLG A;  2OWO A;  3NGD A;  5KFN A;  3Q8Q B;  4KLO A;  3PO5 A;  7ICT A;  5DGA A;  3EZ5 A;  7ICQ A;  4C8M A;  1WCL A;  5IIO A;  3ISB A;  1BPE A;  2P6U A;  5EWG A;  4F5N A;  4ECW A;  3KHG A;  4DF8 A;  2HHQ A;  9ICO A;  4QZG A;  4UB2 A;  4PHD A;  2ASJ A;  5CA7 A;  3OSP A;  1D8L A;  1ZQK A;  1WCN A;  2J6T A;  4M0A A;  5DB8 A;  3N4M B;  4DS4 A;  2A1J B;  2HHU A;  3G6X A;  3H7I A;  4MEY A;  3JPN A;  4DL4 A;  1XSL A;  1N56 A;  9ICG A;  1U49 A;  4KLH A;  3QZ7 A;  4DSK A;  4G3I A;  4Z6E A;  4RQ0 A;  3TAQ A;  5L1J A;  1NK6 A;  1RYS A;  1MSW D;  4P4O A;  3EW9 A;  1U4B A;  4IR9 A;  3KHL A;  3ETL A;  5CB1 A;  4DL5 A;  3THV A;  3JPQ A;  2Q0Z X;  4P4P A;  4MF8 A;  2IHM A;  3BQ2 A;  2JEJ A;  2PI4 A;  1ZQE A;  3C2M A;  4PGQ A;  2I9G A;  9ICA A;  5J2K A;  2BDP A;  1KFD A;  4RQ7 A;  5KFG A;  1U47 A;  1SKR A;  8ICG A;  4QZH A;  5D46 A;  1ZQA A;  7ICP A;  4RPX A;  5J29 A;  4QZI A;  3QZ8 A;  2RDJ A;  4IQV A;  1U45 A;  3SV4 A;  2KZM A;  1PZN A;  1KLN A;  4F4Y A;  5DB7 A;  2PFN A;  4I2A A;  3Q8M A;  4JUZ A;  3RB4 A;  1MQ3 A;  2R8K A;  2MUT B;  5J0Q A;  3B0X A;  4B9L A;  4NM2 A;  3AUO A;  3ZDC A;  4P2H A;  5KFF A;  3RB0 A;  4I27 A;  5KFL A;  4I2F A;  4Q8F A;  4DL7 A;  4UB5 A;  2ASD A;  7ICE A;  9ICQ A;  4I29 A;  3M9M B;  4RNO A;  1NK9 A;  4JV2 A;  4RQ8 A;  1NKC A;  4DFK A;  3RBD A;  9ICF A;  2R8H A;  2FPM A;  4DQS A;  1SL2 A;  9ICM A;  2DPJ A;  1S0O A;  4DOC A;  2VA3 A;  2KFZ A;  3M8R A;  4M6W B;  2BQ3 A;  5DLG A;  3MFH A;  4YMM A;  3TAN A;  3HWT A;  8ICF A;  3EPG A;  4KLF A;  4M9H A;  3PV8 A;  2BPG A;  4F4Z A;  3MFI A;  3SV3 A;  1S76 D;  4YR2 A;  3T5L A;  5J2E A;  2IA6 A;  4KLT A;  4TUQ A;  5J0S A;  1ZQN A;  3PW5 A;  1TFR A; 
#chains in the Genus database with same CATH topology
 5KFB A;  1T3N A;  1JXL A;  5BOL A;  3CRX A;  4DO9 A;  4EYI B;  4EEL A;  9ICJ A;  4O3S A;  1X66 A;  1OW5 A;  3ZDE A;  3PX0 A;  3RBE A;  4ED0 A;  2P66 A;  4I2I A;  4BX9 C;  5A0L A;  1MQ2 A;  2NRZ A;  4PZN A;  2EAM A;  4ED2 A;  2OYY A;  2BHN A;  4FS1 A;  1S97 A;  4M2Y A;  4F4K A;  2HBL A;  2UVW A;  3M1Y A;  3SZ2 A;  2YML A;  2GOL A;  4KLI A;  5AKK A;  4AYB C;  4FZN A;  4PPX A;  2C2E A;  3OHA A;  2BCU A;  1L6N A;  2BQR A;  4UB3 A;  5CR0 A;  3V72 A;  1K5O A;  3RB6 A;  2RP5 A;  1NJY A;  1ZQU A;  2B21 A;  4C7Z A;  1T8E A;  3UMC A;  3Q8P B;  2E1E A;  4EZ6 A;  1DK2 A;  4O3P A;  3TAR A;  4Y2S A;  5KFZ A;  4RQ2 A;  1Z00 A;  1B43 A;  4RQ6 A;  2AQ4 A;  3BQ0 A;  4NJ8 A;  3TQ1 A;  4GXI A;  4DLE A;  3IG5 A;  5KFX A;  1N62 A;  4C8N A;  5IIL A;  3D2N A;  2F3N A;  7ICR A;  4O3N A;  3SQI A;  5IIK A;  2MAX A;  5KNI A;  3G6V A;  1N5X A;  3C2K A;  2EH9 A;  1TK0 A;  2JH1 A;  1X9M A;  3AM9 A;  2W9A A;  1UA1 A;  5KFC A;  1JX4 A;  3MR3 A;  4IL6 U;  3TFR A;  8ICN A;  5GTH U;  4CRX A;  4B9T A;  9ICW A;  1N60 A;  3F2B A;  2E8N A;  5D49 A;  2KHV A;  3LYS A;  3NVV A;  4J9O A;  3E2E A;  3OPX A;  1BGX T;  1QSY A;  3PR5 B;  5J2B A;  1TK5 A;  4B9N A;  2W43 A;  5ALP A;  4B9V A;  4Z6D A;  5ALG A;  1FEZ A;  5AM3 A;  5CEH A;  8ICP A;  3BJY A;  3N7R C;  1BPX A;  3SR6 A;  2E1F A;  2EAP A;  8ICV A;  1XWL A;  5J0U A;  4YMO A;  2V4R A;  4I2B A;  2I5H A;  2JZB A;  2F8L A;  4IRD A;  3BQ7 A;  1F44 A;  1N63 A;  4RNN A;  7ICU A;  2YQE A;  1BPB A;  3WKB A;  2EZX A;  5KL1 B;  5KFW A;  5IIN A;  3DDH A;  4KLJ A;  2W03 A;  5KTQ A;  4G9B A;  3Q8R B;  4EEY A;  3RTV A;  4DQR A;  1L7M A;  1SV4 A;  2Z7J A;  3UXO A;  1UPH A;  1PK3 A;  2FJ6 A;  1L7O A;  4M9J A;  4R63 A;  1IG6 A;  4DSL A;  5KT6 A;  4X5V A;  4YXM A;  5JU5 A;  4O5K A;  2HBJ A;  1ED1 A;  3H0L B;  4IRC A;  2ZIV B;  2Y1J A;  5J0O A;  3GDX A;  1X9W A;  1ZQY A;  4RZR A;  4ECY A;  1RQN A;  1JMS A;  4UB1 A;  3H8M A;  2JHD A;  4XQ8 A;  2E5S A;  1Z1V A;  4DOA A;  5ALZ A;  3PW2 A;  3TAP A;  1IXR A;  3QU7 A;  4DFM A;  1UQV A;  3QU4 A;  7ICK A;  1Q3U A;  1ZQF A;  1S5L U;  4J9M A;  4YP3 A;  1O08 A;  4UB6 U;  2HHS A;  2WHE A;  2ZIU A;  2HSZ A;  3UQ2 A;  1F0M A;  2ZJ8 A;  1D8Y A;  2QB0 A;  3UQ0 A;  4BGD A;  4B9M A;  4Z6F A;  4YQW A;  3H0R B;  2ISO A;  4KIT B;  5C0Y A;  3C5F A;  2G5H B;  2NYV A;  2YN4 A;  5J0X A;  3ETR A;  3HT3 A;  5KFK A;  3IRU A;  1D8B A;  5KG3 A;  2EAN A;  3GV5 B;  2LYH A;  2OXO A;  4IQT A;  5ALD A;  2KN7 A;  4OD0 A;  1RDF A;  3AU2 A;  4GXK A;  3AMZ A;  2XY6 A;  3QUC A;  1QTM A;  2XO7 A;  3ORY A;  2E8P A;  4QWD A;  3RR7 A;  5ALU A;  2C22 A;  2WAQ C;  2HHT A;  3L5K A;  2P6R A;  3F53 A;  8ICR A;  2ZIX A;  3RRH A;  3BZK A;  3BQT A;  3ONN A;  3FYH A;  2D8C A;  1C7Y A;  2HCF A;  2B6G A;  1XO1 A;  2FLP A;  2HVH A;  4O3R A;  4ECZ A;  3BQ1 A;  2ZXH A;  3UXN A;  4P0P B;  4M04 A;  3N7P D;  5KFT A;  9ICC A;  1Z4O A;  2RQ5 A;  3PW0 A;  2D6F C;  2ASL A;  4EBC A;  1ZET A;  4JWN A;  5JUM A;  2VKQ A;  3F2C A;  3WKE A;  1ZQG A;  8ICM A;  3HX0 A;  4DSE A;  2AJQ A;  4MFC A;  3KD3 A;  5E79 U;  4QWC A;  2BPF A;  7ICG A;  3T5H A;  1XO0 A;  3NRW A;  1ZQJ A;  1ZYQ A;  8ICE A;  3LDA A;  3A0B U;  4KMO B;  1KFS A;  3BS5 A;  3FDS A;  1HJP A;  4UAR A;  1X9X A;  9ICV A;  1NI3 A;  1RM6 C;  3I28 A;  3BZC A;  4OO1 J;  3RAX A;  3H4B A;  1GO3 F;  2MRL A;  3WK4 A;  4DLG A;  5J8Y A;  3NGD A;  3Q8Q B;  7ICT A;  3PO5 A;  1NZP A;  5IIO A;  4F5N A;  4ECW A;  9ICO A;  4J03 A;  5ALL A;  4QZG A;  4PHD A;  3OSP A;  1ZQK A;  1X42 A;  2J6T A;  2HHU A;  4M0A A;  3N4M B;  3G6X A;  1XSL A;  1LKY A;  1YZ6 A;  4Z6E A;  2E8M A;  4P4O A;  4IR9 A;  3ETL A;  4DL5 A;  3BQ2 A;  4PGQ A;  2HOI A;  1T3Q A;  1U47 A;  4QIW C;  2RDJ A;  2KZM A;  2PFN A;  1QQ6 A;  3CNH A;  2MUT B;  4B9L A;  3B0X A;  4NM2 A;  5KFF A;  4I27 A;  4DL7 A;  3AQF A;  4UB5 A;  4JV2 A;  3NVZ A;  1NKC A;  3HKZ F;  9ICF A;  2FPM A;  2YB1 A;  1S0O A;  2A19 A;  3M8R A;  4M6W B;  2W3S A;  3HWT A;  8ICF A;  4M9H A;  2DGZ A;  1S76 D;  4YR2 A;  5J2E A;  2IA6 A;  4TUQ A;  2OHF A;  5J0S A;  1HUZ A;  2MU2 A;  2ZUC A;  4DF4 A;  4F2R A;  4Z6C A;  1B0X A;  4R64 A;  1UT8 A;  3D2S A;  3GQC A;  4IRK A;  2FPK A;  2GH1 A;  2K4H A;  4FE3 A;  3RR8 A;  3K75 D;  4QW8 A;  1L3T A;  1QQ5 A;  2QLT A;  4F71 A;  2KNJ A;  2HVI A;  2H3Z A;  4MHV A;  4DQQ A;  1PVR A;  2XGP A;  2FDR A;  5EOZ A;  8ICX A;  3RB3 A;  1RYU A;  3GIL A;  4TUP A;  5KG6 A;  9ICS A;  4ICA A;  8ICQ A;  5J0T A;  2W55 A;  4CF4 A;  5KFY A;  4CGZ A;  2G07 A;  4F3O A;  4F72 A;  3C1Z A;  2DQN B;  2KK0 A;  2V9W A;  2KKV A;  2QAR A;  2JEI A;  4NLC A;  1CRX A;  5KT2 A;  2D3D A;  3H8W A;  4ACO A;  2WFA A;  9ICI A;  2VA8 A;  4O0I A;  4R66 A;  8ICC A;  3UXP A;  3C23 A;  3TKA A;  4NLN A;  3GIM A;  2KOB A;  4RT2 A;  5AM2 A;  5KT3 A;  5J2D A;  4BXO B;  2I1Q A;  3PST A;  5ALH A;  2FE9 A;  1Z4N A;  3RJG A;  1ARO P;  4UAV A;  4ZOH C;  5KFM A;  3PNC A;  3N7S C;  1NNL A;  1NK4 A;  5ALW A;  2OCE A;  2YMP A;  3B0Y A;  1BVS A;  2FI1 A;  2ISP A;  2BR0 A;  2KP7 A;  3C5G A;  2KTQ A;  4JV0 A;  4F93 B;  3A0H U;  4KLG A;  4PGX A;  1L7N A;  5J8Y C;  1V38 A;  5AKI A;  2ALZ A;  4F5Q A;  5III A;  2IMW P;  1RYR A;  2W7P A;  4RQ5 A;  2JEG A;  2KJ5 A;  5J2F A;  3GII A;  2PFQ A;  3OHB A;  1SWW A;  4Y2Y A;  3MAB A;  2HW3 A;  3KZI U;  4YCX A;  2AH5 A;  1PUZ A;  5HNK A;  5TZV A;  2KVC A;  5CWR A;  4QZA A;  1CEZ A;  4ED8 A;  3NVY A;  2C28 A;  4R8U B;  2ZUD A;  4YG2 A;  1UCV A;  3SAH A;  4Q44 A;  1N5W A;  2ZTD A;  2LYA A;  2AGP A;  3LWM A;  3GV8 B;  1ZRM A;  2HOF A;  4PHE A;  5L1M A;  4FFD A;  4ED7 A;  3RAQ A;  5J2C A;  4DOB A;  2LYB A;  4M47 A;  3LVV A;  2LM4 A;  3RJI A;  3PW4 A;  2BCQ A;  2WF9 A;  5KFV A;  4YD1 A;  4A8E A;  2NO5 A;  1S77 D;  4UAY A;  5KG4 A;  5L1L A;  5EE0 A;  9ICK A;  2WB1 F;  4UW9 A;  4NLZ A;  4OJP A;  2KIW A;  4UAU A;  4CE6 A;  4RQ4 A;  5B66 U;  2DUY A;  1COO A;  1VLB A;  1KQQ A;  3BS7 A;  1QSL A;  4NL9 C;  4UAW A;  1KKX A;  1ZXI A;  2H5X A;  4MFA A;  1M6Y A;  4LZD A;  1ZQI A;  7ICH A;  2B0C A;  5ALE A;  1NJZ A;  2XID A;  4U7C A;  2KHQ A;  1S0V A;  1TVA A;  1ZD2 P;  4GIB A;  3RF9 A;  4RUC A;  5J0R A;  2WF8 A;  7ICN A;  3V6J A;  2E8O A;  2RHF A;  5CP2 A;  1UHU A;  1YT3 A;  3WK9 A;  4O3O A;  5AK5 A;  3HW8 A;  3TAC B;  2H3V A;  2W7O A;  5DDM A;  4I2H A;  3MGI A;  3WK7 A;  7ICF A;  4KX3 A;  2W54 A;  4FBU A;  9ICE A;  4WJ3 B;  5AKZ A;  4F50 A;  4OCZ A;  4USA A;  5HMM A;  1S0N A;  4QWE A;  5AKX A;  3MR5 A;  4QZF A;  4Y2X A;  1LV5 A;  5K4L A;  4O3M A;  5ALO A;  2KFN A;  2JMG A;  9ICL A;  4ECS A;  3BDP A;  4I2E A;  1DGS A;  4ECV A;  5KG0 A;  1D9D A;  1EXN A;  4JK1 A;  1SZP A;  4KLS A;  5KFI A;  5EE3 A;  2BGW A;  5DKW A;  1ZJM A;  3NTU A;  3B9J A;  2PMZ C;  5J0W A;  2F76 X;  4I2D A;  1JI7 A;  5FP0 A;  4ECU A;  4O5C A;  2W04 A;  4IQW A;  1KSP A;  1J97 A;  5C5J A;  1S0M A;  3RJE A;  2W9C A;  1QCK A;  2JZB B;  3SYZ A;  1PK1 A;  1RZT A;  2GLE A;  3I1Y A;  1JAL A;  2L5Y A;  3KKA C;  2EZZ A;  1V85 A;  2EAO A;  5DQI A;  1Q8K A;  2ES6 A;  2G0A A;  3NAS A;  2KZ3 A;  1L5U A;  3V7L A;  3FM9 A;  3PVX A;  4RU9 A;  3C2L A;  3ZD8 A;  1S9F A;  1MC8 A;  1U9L A;  2XIC A;  1ZQD A;  5ALF A;  4CDG A;  7ICV A;  3F5E A;  4FZM A;  4MEX A;  2FMP A;  3WKC A;  3SAF A;  3H8J A;  5AM1 A;  1Y88 A;  2UVV A;  1T4G A;  2NO4 A;  1VJ5 A;  3IDW A;  3KFU F;  5KFO A;  4OJL A;  2ZTE A;  2F77 X;  3ZD9 A;  5AHX A;  4DQI A;  5L1I A;  1V9P A;  2LKY A;  1JN3 A;  3ISC A;  2KJ8 A;  3PZP A;  4ELT A;  2KSO B;  3RJF A;  2K4I A;  4UBB A;  1NK7 A;  3RRG A;  5DDY A;  4DSF A;  4DWI A;  2BPC A;  2RDI A;  5ALT A;  2OWO A;  5KFN A;  4KLO A;  3CYM A;  5DGA A;  3ISB A;  2P6U A;  2HHQ A;  4PZO A;  4UB2 A;  1D8L A;  1DK3 A;  1S8O A;  1N56 A;  2WF6 A;  4DL4 A;  2HOQ A;  9ICG A;  4KLH A;  3QZ7 A;  5JRT A;  4DSK A;  5L1J A;  2ZIW A;  1MA7 A;  5AI0 A;  2Q0Z X;  2IHM A;  2JEJ A;  3QNM A;  2QKQ A;  4AP9 A;  2I9G A;  5B5E U;  1SWV A;  9ICA A;  4QJF B;  2BDP A;  5AKY A;  2ZIU B;  7ICP A;  1ZQA A;  2QB0 B;  5J29 A;  3QZ8 A;  5ALR A;  1PZN A;  4I2A A;  5DB7 A;  5H2F U;  1WUD A;  5AK3 A;  3RB4 A;  1MQ3 A;  2R8K A;  5AI4 A;  1L7P A;  4I2F A;  3E58 A;  5KFL A;  4QNL A;  9ICQ A;  2NV3 A;  4RNO A;  3M9M B;  2OM6 A;  1SL2 A;  5AKH A;  2DPJ A;  5KAF U;  2JGA A;  2KFZ A;  2BQ3 A;  5DLG A;  3TAN A;  3PV8 A;  3U26 A;  4KLT A;  1ZQN A;  3PW5 A;  1TFR A;  2ZJA A;  1QLN A;  4TQS A;  1NK8 A;  5DG7 A;  3ICX A;  3NVW A;  3AL0 B;  3EWA A;  1ZQM A;  4Q43 A;  1ZQW A;  2ZIX B;  1UA0 A;  3WU2 U;  5AI8 A;  3KTQ A;  5AIB A;  2J6U A;  4QZE A;  3TAD A;  2JH7 A;  2JXJ A;  2XC9 A;  5KFR A;  3H40 A;  1ZRN A;  3MGH A;  4Y2T A;  3V6K A;  1L8L A;  3C21 A;  1B22 A;  3HJE A;  2G09 A;  1K1S A;  1HEK A;  1L3U A;  1ZQP A;  4Y2P A;  5KFH A;  1ZQV A;  1QSS A;  5DBB A;  3F2D A;  4KTQ A;  1SZH A;  2F1J A;  2Q4T A;  4M9G A;  4C4R A;  4KN4 A;  4ELV A;  4R65 A;  3PO4 A;  3ED5 A;  2ODG A;  4XA5 A;  1K1Q A;  2XI9 A;  2AGQ A;  4UAZ A;  4DSJ A;  3MR2 A;  3RJK A;  3H0M B;  3Q8S B;  2VA2 A;  4TUR A;  2G06 A;  3WK5 A;  4F5R A;  4NLK A;  3M9N B;  1IV8 A;  2UVR A;  5J2H A;  1KBU A;  2W9B A;  2H3I A;  2KKP A;  1RXW A;  2YTU A;  4JWM A;  2XCP A;  3BS5 B;  4KX5 A;  1IM4 A;  2F1I A;  4NXZ A;  1BPY A;  2ATL A;  5KFS A;  5DGB A;  4RPZ A;  1SXE A;  4EBD A;  8ICJ A;  8ICK A;  5DLF A;  4ECT A;  3MDC A;  4PGY A;  1NK5 A;  4DL3 A;  3QUT A;  2K8A A;  4IQU A;  4AYB F;  4GC7 A;  7ICO A;  3L3F X;  4DFD A;  2F2A B;  1LKY B;  3HPO A;  2BCR A;  1OUQ A;  5ALN A;  5KAI U;  2R8I A;  3EUB 2;  5KFP A;  3LVW A;  5J2G A;  4XUS A;  1C20 A;  2NRV A;  2IBK A;  3SEI A;  8ICT A;  1QQ7 A;  1LB2 B;  1CI4 A;  3WK6 A;  4B9U A;  4Y2U A;  5KFA A;  4DFJ A;  4ECQ A;  2HHW A;  1UT5 A;  4BWJ A;  9ICU A;  4LZG A;  2BCS A;  3GIK A;  4HYK A;  4QZD A;  1L3V A;  4P0Q B;  1WWU A;  3IP4 B;  3RH4 A;  4B9S A;  5DBC A;  3T5J A;  4F5O A;  2LPE A;  2R18 A;  4FZL A;  2KIC A;  2O6K A;  2XCA A;  2F1H A;  4Y2Q A;  2E3T A;  4J9K A;  4BJQ A;  9ICN A;  3MBY A;  5AKE A;  2KIV A;  2KZZ A;  5EWF A;  3T5K A;  1Z1B A;  4NL9 A;  4PH5 A;  1X9S A;  4RQ3 A;  4C4T A;  1FIQ A;  4YR0 A;  2C2R A;  1RXV A;  4RQN A;  4K4H A;  1X2I A;  3CP8 A;  7ICL A;  5L9X A;  4I2J A;  3TFS A;  2FLL A;  4K4G A;  4EEK A;  2W11 A;  5BPC A;  5T14 A;  2GWS A;  3WKA A;  4O5E A;  1L3S A;  1J2M A;  1ZD3 A;  4Y2R A;  1Z3E B;  2ZTC A;  1DXS A;  5EE9 A;  4PJ0 U;  3V7J A;  3TAD C;  4DL2 A;  4P4M A;  1RG6 A;  3T3F A;  5ALY A;  2IOF A;  4M9N A;  2MA1 A;  2QAR B;  4DEZ A;  5KL8 B;  2HMX A;  4I2C A;  1JXE A;  4KLE A;  1ZQC A;  1OXJ A;  2VAN A;  2I6X A;  1SB3 C;  4KLM A;  3JPS A;  2WF7 A;  1NK0 A;  4BXO A;  3PSF A;  2F44 A;  3V6H A;  3MC1 A;  4C4S A;  2PFP A;  2A1J A;  2BCV A;  3UPQ A;  5EWE A;  3RH5 A;  1XNS A;  3H8S A;  5ALM A;  3AN1 A;  3QUB A;  1KL9 A;  5KFJ A;  5KG2 A;  4RQ1 A;  3NRZ A;  3K1Z A;  5HR6 A;  4F5P A;  2XY5 A;  2CRX A;  5AI9 A;  5AK4 A;  5J2J A;  4QW9 A;  4DS5 A;  1N61 A;  2FLN A;  3D6J A;  4ZH4 A;  1KN5 A;  1B4F A;  5KFU A;  4M9L A;  4NM1 A;  1A6S A;  1L8O A;  2EQY A;  1WG8 A;  3E0F A;  1MN8 A;  5AM0 A;  4QWB A;  4NY8 A;  2HHX A;  4QZ8 A;  3C29 A;  1VDV A;  3KKA A;  1XSP A;  3QU5 A;  4BDP A;  3FC4 A;  5AI5 A;  4EBE A;  4UB8 U;  5CHG A;  1JRO A;  1SKS A;  5F9N A;  3PX6 A;  4R8U A;  5JTI A;  4GC6 A;  1NOM A;  2K89 A;  4F8R A;  4YN4 A;  4C7Y A;  2KV2 A;  2Y1I A;  2HBK A;  4QWA A;  1ZJN A;  5D4B A;  2DF4 B;  5AKG A;  1TKD A;  2XGQ A;  1XSN A;  2W9M A;  2DWQ A;  2KJ9 A;  4US9 A;  1KDH A;  1Z19 A;  1T94 A;  7ICJ A;  3ZDD A;  2IOH A;  1SKW A;  4FO6 A;  2J6S A;  4NLG A;  4YXJ A;  8ICZ A;  3K1R B;  4Q8E A;  3QUQ A;  1SL1 A;  4U6P A;  3OTQ A;  5CJ7 A;  2V4Q A;  9ICB A;  3WK8 A;  4HAI A;  1A77 A;  3PR4 A;  2DBY A;  4LVS A;  1KFT A;  3EPI A;  3PML A;  4DL6 A;  5DBA A;  2WAQ F;  1X6I A;  4RT3 A;  3SAG A;  1U48 A;  3IV6 A;  4NLB A;  4UQG A;  2HBM A;  2UVU A;  2KVS A;  3SI8 A;  5DG8 A;  1WWV A;  5IIM A;  1Z00 B;  1ZQS A;  5AI6 A;  4KN7 A;  2EDU A;  2AGO A;  2M0N A;  1ZOL A;  3HKZ C;  5AKL A;  1FO4 A;  4YD2 A;  2CN1 A;  1CUK A;  3ALR A;  3EZ5 A;  2KEY A;  4RQM A;  4DF8 A;  5AK6 A;  2ZG6 A;  4IS7 A;  5CA7 A;  1PVP A;  5DB8 A;  4DS4 A;  3NUQ A;  3H7I A;  1V97 A;  1U49 A;  1SGG A;  1P7D A;  2CPR A;  4GFJ A;  3TAQ A;  2JV3 A;  3AQE A;  1RYS A;  1MSW D;  3EW9 A;  1U4B A;  3KHL A;  5CB1 A;  3THV A;  4MF8 A;  1ZQE A;  3QU2 A;  3C2M A;  5J2K A;  1SKR A;  8ICG A;  5D46 A;  4QZI A;  4IQV A;  1U45 A;  3SV4 A;  1KLN A;  1SV0 C;  4JUZ A;  5J0Q A;  4UAS A;  2ASD A;  4I29 A;  1YZ7 A;  4RQ8 A;  4DFK A;  3GU3 A;  4NWI A;  2A3V A;  2VA3 A;  3DEE A;  3MFH A;  4YMM A;  5CRX A;  2YMQ A;  3EPG A;  4KLF A;  2BPG A;  3N28 A;  3MFI A;  4CF5 A;  2KMD A;  2AXT U;  4I2G A;  2RRD A;  1ZQL A;  5IIJ A;  1XU4 A;  4JV1 A;  3H4D A;  1HUO A;  1ZQH A;  1N2X A;  1ZQT A;  2W9C B;  3MR6 A;  4QIW F;  4FS2 A;  1SIJ A;  3KZX A;  1PK1 B;  2KG5 A;  2LMR A;  2YB4 A;  3HRD D;  5DB6 A;  2K8C B;  3SD7 A;  3S6J A;  2HDO A;  5DQG A;  1HIW A;  5G5H A;  1ZQX A;  8ICA A;  4KMU A;  3JPR A;  4QZC A;  1JUD A;  3JPP A;  4JMU A;  2ZUB A;  1KEJ A;  2FPL A;  5HR7 A;  2ZIV A;  2BQU A;  1WYG A;  4DSI A;  3OSN A;  2AQ0 A;  2Y0S F;  2BDU A;  4TQR A;  1BPD A;  1ZD4 A;  2K4P A;  2VJ4 A;  5G5G A;  2LM1 A;  3LWL A;  8ICO A;  5HML A;  2QB1 A;  4B6J A;  1O03 A;  2H3Q A;  4NV0 A;  5HHH A;  1SXD A;  1TE2 A;  4K4I A;  2IHN A;  2KSO A;  3GV7 B;  4PHP A;  5KT5 A;  3PY8 A;  3Q8K A;  4ED1 A;  4Y2J A;  3GIJ A;  2JRZ A;  1TAU A;  9ICT A;  2XY7 A;  1ZQB A;  3L4P A;  4OJ6 A;  2K4E A;  2W3R A;  4KLL A;  4JB3 A;  3O0F A;  3LK9 A;  3D2Q A;  2Y9U A;  4RUA A;  3QYP A;  2DPI A;  3J81 j;  2GO7 A;  2WTF A;  3KHR A;  4RPY A;  4F92 B;  2ZIW B;  4J9R A;  2PFO A;  1ZQZ A;  2NRW A;  3M7D A;  1COK A;  3KHH A;  2YY6 A;  1ZQ1 C;  2C2D A;  3JPT A;  5F9L A;  1QH9 A;  1TV9 A;  1SL0 A;  4F4W A;  8ICI A;  1KW4 A;  4OJO A;  5KT7 A;  2CXY A;  3SEN A;  3GFK B;  2WB1 C;  8ICS A;  1X40 A;  1ZQR A;  8ICL A;  9ICR A;  8ICU A;  4KLD A;  4EYH B;  3C28 A;  4YMN A;  4O9M A;  9ICX A;  5J2A A;  1FFV A;  4ECX A;  4MFF A;  3G6Y A;  2JR5 A;  5KFQ A;  3QX7 A;  2PI5 A;  2XVT A;  5AIC A;  5TIS U;  3GZF A;  3QEB Z;  3VC8 A;  3AU6 A;  2JEF A;  3IHQ B;  3UM9 A;  3RFA A;  2ZJ5 A;  3M6K A;  4YVZ A;  2KD1 A;  4ED3 A;  2LI6 A;  4LJX A;  2BKE A;  3MGV A;  1LVH A;  4PHA A;  3KOO A;  4E0D A;  2DKX A;  5EE1 A;  4P0P A;  2K60 A;  2G5I B;  1NJW A;  4J9S A;  4EX7 A;  4Q45 A;  1BPZ A;  4UB4 A;  2W8K A;  2EZY A;  5ALK A;  4KLU A;  3M9O B;  1PVQ A;  1TK8 A;  2AHO B;  2LHT A;  5DQH A;  3QE9 Y;  9ICH A;  8ICB A;  5KG5 A;  8ICH A;  2DFL A;  5HHI A;  4GLX A;  2LBO A;  2YX8 A;  4C8K A;  4O3Q A;  4DQP A;  4UBC A;  3OGU A;  5AM5 A;  1AQ6 A;  1T7P A;  1IIP A;  3CW2 C;  4XRH A;  3OJU A;  1DOQ A;  2W8L A;  3ZDB A;  4I28 A;  3HIL A;  5KG7 A;  3PSP A;  7ICM A;  4IR1 A;  4US8 A;  2FMS A;  3QEA Z;  1JIH A;  2K8B B;  4C8O A;  1XC9 A;  4F4X A;  1Q46 A;  4EEN A;  2W9B B;  5AM4 A;  1RPL A;  4IC9 A;  5GTI U;  3MDA A;  3PW7 A;  4YFK A;  3HP6 A;  3Q8L A;  1ZQO A;  2H3F A;  5J0Y A;  3M6Z A;  4DCC A;  4ED6 A;  2DKZ A;  5KFD A;  3PX4 A;  1N48 A;  4BWM A;  5L1K A;  2ZXI A;  3TI0 A;  1DGJ A;  2WF5 A;  1XS9 D;  1KRP A;  4QZ9 A;  5HP4 A;  5KG1 A;  1Q3V A;  2MUT A;  4QZB A;  4EX6 A;  7ICS A;  3OJS A;  3PMN A;  1J2N A;  2Y9T A;  4F91 B;  2R8G A;  4J9N A;  3I76 A;  1NJX A;  4CCH A;  4F2S A;  4M6W A;  8ICW A;  3NS1 A;  2RLT A;  3KBB A;  3IN5 A;  4YR3 A;  1URJ A;  4P0Q A;  2AU0 A;  3F5A A;  4TUS A;  2F8K A;  1D9F A;  2NRT A;  8ICY A;  3RH6 A;  2Y0S C;  5ALS A;  1H38 A;  4ECR A;  3R9K A;  5ALV A;  2HHV A;  5J0P A;  4J9Q A;  3UMB A;  2KE7 A;  2R8J A;  4J9L A;  2YMM A;  3M8S A;  4MF2 A;  3SMV A;  3VCB A;  3JPO A;  3IM1 A;  4J9P A;  1TAM A;  2FMQ A;  1FFU A;  5KT4 A;  5BOM A;  5ALJ A;  1F5S A;  4C80 A;  3RJJ A;  4EZ9 A;  3EYZ A;  2VJ5 A;  3T79 A;  1ZQQ A;  3K4G A;  2PMZ F;  3AEV A;  2PKE A;  3DV9 A;  5ALX A;  5DB9 A;  3RJH A;  4RNM A;  2BZF A;  1S10 A;  2M9N A;  1NZB A;  4FBT A;  5KFE A;  3C1Y A;  5ALI A;  3ZDA A;  1NKB A;  2NRX A;  2PXI A;  2OEH A;  4DFP A;  7ICI A;  1JRP A;  5DG9 A;  1A76 A;  1RQL A;  5F3X B;  5J2I A;  4GXJ A;  1A0P A;  4ELU A;  2OH2 A;  1TAQ A;  5AIA A;  4PL2 A;  4CNQ A;  2VIX A;  3ISD A;  1KTQ A;  1NKE A;  3V7K A;  1SV0 A;  2A1A A;  3UMG A;  7ICQ A;  4C8M A;  1WCL A;  4KLQ A;  1BNO A;  1BPE A;  5EWG A;  4C0Z A;  3KHG A;  2ESE A;  2ASJ A;  3ZI4 A;  1WCN A;  1X6J A;  1ZD5 A;  2A1J B;  3FAH A;  4MEY A;  3JPN A;  4G3I A;  4RQ0 A;  2P35 A;  1NK6 A;  3JPQ A;  4P4P A;  2PI4 A;  4UAT A;  1KFD A;  4RQ7 A;  5KFG A;  3QU9 A;  4QZH A;  4RPX A;  1DRG A;  4F4Y A;  4OJ5 A;  3Q8M A;  4CF3 A;  4BUG A;  2G08 A;  3AUO A;  3ZDC A;  4P2H A;  3QXG A;  3RB0 A;  4Q8F A;  2DL0 A;  7ICE A;  1ECW A;  5ALQ A;  3IG8 A;  1NK9 A;  3WKD A;  2N1R A;  4PL1 A;  5AKJ A;  3RBD A;  1BNP A;  2R8H A;  2IOF K;  4DQS A;  3PSI A;  9ICM A;  4DOC A;  2HI0 A;  4Y2V A;  4F4Z A;  3SV3 A;  3T5L A;  2MSN A;  9ICP A;  4C8L A;  3N97 B; 
#chains in the Genus database with same CATH homology
 2ZJA A;  1ZQL A;  1HUZ A;  5KFB A;  1QLN A;  1T3N A;  1JXL A;  5BOL A;  4TQS A;  5DG7 A;  2ZUC A;  4DO9 A;  4DF4 A;  4Z6C A;  1NK8 A;  4F2R A;  5IIJ A;  1XU4 A;  4JV1 A;  3EWA A;  3H4D A;  1HUO A;  4EYI B;  4R64 A;  1ZQM A;  1UT8 A;  1ZQH A;  9ICJ A;  4O3S A;  4Q43 A;  1ZQW A;  1UA0 A;  3GQC A;  1ZQT A;  4IRK A;  2FPK A;  3ZDE A;  3KTQ A;  2J6U A;  2W9C B;  3MR6 A;  3PX0 A;  3RBE A;  4QZE A;  4ED0 A;  3RR8 A;  2P66 A;  3K75 D;  4QW8 A;  1L3T A;  4I2I A;  4FS2 A;  2XC9 A;  5KFR A;  3H40 A;  1MQ2 A;  2HVI A;  3MGH A;  2NRZ A;  4DQQ A;  3V6K A;  5DB6 A;  2XGP A;  3C21 A;  5EOZ A;  8ICX A;  1B22 A;  4ED2 A;  5DQG A;  3RB3 A;  1K1S A;  3GIL A;  2BHN A;  4TUP A;  1L3U A;  4FS1 A;  1ZQP A;  5KG6 A;  1S97 A;  1ZQX A;  5KFH A;  1ZQV A;  4M2Y A;  1QSS A;  4F4K A;  8ICQ A;  9ICS A;  5J0T A;  5DBB A;  8ICA A;  4KMU A;  3JPR A;  3SZ2 A;  4QZC A;  2UVW A;  4KTQ A;  2F1J A;  5KFY A;  3JPP A;  4KLI A;  4M9G A;  4PPX A;  2ZUB A;  2C2E A;  4F3O A;  3OHA A;  1KEJ A;  2FPL A;  2BCU A;  3C1Z A;  4KN4 A;  2BQR A;  4ELV A;  4UB3 A;  2V9W A;  4R65 A;  5CR0 A;  3V72 A;  2BQU A;  3PO4 A;  4DSI A;  2JEI A;  3OSN A;  5KT2 A;  3RB6 A;  2AQ0 A;  4XA5 A;  4C8L A;  1K1Q A;  2AGQ A;  4UAZ A;  3H8W A;  4DSJ A;  1NJY A;  4TQR A;  9ICI A;  1ZQU A;  2B21 A;  1BPD A;  3MR2 A;  3RJK A;  2VA8 A;  3Q8S B;  4O0I A;  4R66 A;  1T8E A;  2VA2 A;  3UXP A;  3C23 A;  3Q8P B;  3LWL A;  4TUR A;  5HML A;  4EZ6 A;  4F5R A;  4NLN A;  4NLK A;  8ICO A;  3M9N B;  3GIM A;  2UVR A;  4O3P A;  5J2H A;  3TAR A;  5HHH A;  4RT2 A;  2W9B A;  5KFZ A;  4K4I A;  2IHN A;  1RXW A;  4RQ2 A;  4JWM A;  2XCP A;  1Z00 A;  1B43 A;  5KT3 A;  5J2D A;  4RQ6 A;  2AQ4 A;  3GV7 B;  3BQ0 A;  4BXO B;  1IM4 A;  2I1Q A;  4PHP A;  3TQ1 A;  5KT5 A;  3PY8 A;  4GXI A;  4DLE A;  5KFX A;  4ED1 A;  3Q8K A;  3RJG A;  1ARO P;  4C8N A;  2F1I A;  4NXZ A;  1BPY A;  5KFM A;  5IIL A;  3PNC A;  3GIJ A;  1TAU A;  9ICT A;  2XY7 A;  2ATL A;  1ZQB A;  1NK4 A;  7ICR A;  5KFS A;  4O3N A;  5DGB A;  4RPZ A;  4EBD A;  5IIK A;  4KLL A;  3LK9 A;  8ICJ A;  8ICK A;  3B0Y A;  4ECT A;  3MDC A;  4PGY A;  1BVS A;  2MAX A;  4RUA A;  3G6V A;  5DLF A;  4DL3 A;  2BR0 A;  1NK5 A;  2DPI A;  2ISP A;  3C5G A;  3C2K A;  4IQU A;  1TK0 A;  4GC7 A;  2KTQ A;  7ICO A;  1X9M A;  4JV0 A;  4F93 B;  2W9A A;  1UA1 A;  2WTF A;  5KFC A;  4RPY A;  3HPO A;  3KHR A;  1JX4 A;  3MR3 A;  2BCR A;  4F92 B;  4KLG A;  4PGX A;  2R8I A;  2PFO A;  4J9R A;  5KFP A;  3TFR A;  1ZQZ A;  2NRW A;  8ICN A;  5J2G A;  4XUS A;  3KHH A;  4B9T A;  2ALZ A;  4F5Q A;  2NRV A;  5III A;  2C2D A;  2IMW P;  2IBK A;  1RYR A;  8ICT A;  9ICW A;  3JPT A;  4RQ5 A;  5F9L A;  5D49 A;  1LB2 B;  2JEG A;  1TV9 A;  1SL0 A;  4F4W A;  5J2F A;  8ICI A;  3GII A;  4J9O A;  3E2E A;  5KT7 A;  2PFQ A;  1BGX T;  1QSY A;  4B9U A;  5KFA A;  3PR5 B;  3GFK B;  3OHB A;  4ECQ A;  4DFJ A;  8ICS A;  5J2B A;  1TK5 A;  1UT5 A;  1ZQR A;  2HHW A;  4BWJ A;  9ICU A;  3MAB A;  4B9N A;  4B9V A;  4LZG A;  4Z6D A;  2HW3 A;  8ICL A;  2BCS A;  4YCX A;  3GIK A;  4HYK A;  9ICR A;  4QZD A;  8ICU A;  4KLD A;  5HNK A;  5TZV A;  5CWR A;  4EYH B;  4QZA A;  1L3V A;  1CEZ A;  4YMN A;  8ICP A;  4O9M A;  4ED8 A;  9ICX A;  3BJY A;  1BPX A;  5J2A A;  2C28 A;  3RH4 A;  4R8U B;  4B9S A;  5DBC A;  2ZUD A;  3T5J A;  4ECX A;  4YG2 A;  4F5O A;  4MFF A;  3G6Y A;  8ICV A;  1XWL A;  4Q44 A;  5KFQ A;  5J0U A;  2ZTD A;  2PI5 A;  4YMO A;  2V4R A;  2XCA A;  2F1H A;  4J9K A;  4I2B A;  9ICN A;  2AGP A;  3QEB Z;  3LWM A;  2JEF A;  2JZB A;  3MBY A;  3AU6 A;  3GV8 B;  3IHQ B;  4IRD A;  2KZZ A;  5EWF A;  3T5K A;  4RNN A;  7ICU A;  4PHE A;  2ZJ5 A;  4YVZ A;  1BPB A;  4PH5 A;  1X9S A;  4RQ3 A;  4ED7 A;  9ICP A;  3RAQ A;  5KFW A;  5J2C A;  4YR0 A;  4DOB A;  4ED3 A;  5IIN A;  2C2R A;  4M47 A;  4KLJ A;  1RXV A;  3RJI A;  3PW4 A;  2BKE A;  4PHA A;  2BCQ A;  5KFV A;  5KTQ A;  4E0D A;  4YD1 A;  3Q8R B;  4EEY A;  3RTV A;  4K4H A;  1S77 D;  4UAY A;  5KG4 A;  5L1L A;  1NJW A;  1X2I A;  4DQR A;  9ICK A;  4J9S A;  4Q45 A;  1BPZ A;  4UB4 A;  2W8K A;  7ICL A;  4KLU A;  5L9X A;  4I2J A;  3M9O B;  3UXO A;  3TFS A;  1TK8 A;  2FLL A;  4K4G A;  4NLZ A;  5DQH A;  5BPC A;  3QE9 Y;  9ICH A;  8ICB A;  4RQ4 A;  2GWS A;  4O5E A;  1COO A;  5KG5 A;  2DFL A;  8ICH A;  1L3S A;  4M9J A;  5HHI A;  4R63 A;  4GLX A;  1Z3E B;  4DSL A;  2ZTC A;  5KT6 A;  4C8K A;  3V7J A;  4X5V A;  4O3Q A;  4DL2 A;  4UBC A;  4UAW A;  4YXM A;  4P4M A;  1QSL A;  2H5X A;  4DQP A;  3OGU A;  4MFA A;  3T3F A;  4O5K A;  4M9N A;  4LZD A;  1T7P A;  4IRC A;  1ZQI A;  7ICH A;  4XRH A;  1NJZ A;  3OJU A;  4DEZ A;  1DOQ A;  2Y1J A;  2W8L A;  3ZDB A;  4I28 A;  1S0V A;  5J0O A;  5KG7 A;  3GDX A;  1TVA A;  1X9W A;  1ZQY A;  7ICM A;  4IR1 A;  4RZR A;  2FMS A;  3QEA Z;  4ECY A;  4I2C A;  1JXE A;  1JIH A;  4RUC A;  5J0R A;  1ZQC A;  4KLE A;  4C8O A;  7ICN A;  1JMS A;  2VAN A;  1XC9 A;  4F4X A;  4KLM A;  3V6J A;  3JPS A;  5CP2 A;  4UB1 A;  1NK0 A;  3N97 B;  2W9B B;  1RPL A;  4O3O A;  3HW8 A;  4BXO A;  3MDA A;  3PW7 A;  4YFK A;  4XQ8 A;  3HP6 A;  5DDM A;  3V6H A;  4I2H A;  3Q8L A;  3MGI A;  2PFP A;  7ICF A;  2A1J A;  4DOA A;  1ZQO A;  5J0Y A;  3PW2 A;  2BCV A;  3TAP A;  3UPQ A;  5EWE A;  3RH5 A;  1IXR A;  3H8S A;  4FBU A;  4DFM A;  4ED6 A;  9ICE A;  5KFD A;  7ICK A;  1ZQF A;  3PX4 A;  1N48 A;  4BWM A;  4F50 A;  5KFJ A;  5KG2 A;  4RQ1 A;  5L1K A;  4J9M A;  5HMM A;  1S0N A;  4YP3 A;  4QWE A;  3MR5 A;  3TI0 A;  4QZF A;  2HHS A;  4F5P A;  3UQ2 A;  2ZJ8 A;  2XY5 A;  1LV5 A;  1D8Y A;  5J2J A;  3UQ0 A;  1XS9 D;  1KRP A;  4BGD A;  4QW9 A;  4B9M A;  2KFN A;  4Z6F A;  4YQW A;  2ISO A;  9ICL A;  4ECS A;  4KIT B;  4DS5 A;  2FLN A;  4QZ9 A;  3BDP A;  4I2E A;  4ZH4 A;  1DGS A;  5HP4 A;  5KFU A;  4M9L A;  3C5F A;  4NM1 A;  5KG1 A;  2MUT A;  4QZB A;  4ECV A;  5KG0 A;  7ICS A;  5J0X A;  1D9D A;  3OJS A;  3HT3 A;  5KFK A;  3PMN A;  1EXN A;  4JK1 A;  1SZP A;  4KLS A;  4NY8 A;  4QWB A;  5KG3 A;  5KFI A;  2LYH A;  4QZ8 A;  3GV5 B;  2HHX A;  4IQT A;  4F91 B;  2R8G A;  2BGW A;  2KN7 A;  4J9N A;  1NJX A;  4CCH A;  1XSP A;  4F2S A;  5DKW A;  4M6W A;  1ZJM A;  8ICW A;  3NTU A;  3AU2 A;  4BDP A;  4GXK A;  4EBE A;  5CHG A;  4YR3 A;  1SKS A;  2XY6 A;  5F9N A;  2AU0 A;  5J0W A;  1QTM A;  3PX6 A;  4R8U A;  2XO7 A;  4TUS A;  4GC6 A;  3ORY A;  4I2D A;  4QWD A;  1NOM A;  4F8R A;  4ECU A;  4YN4 A;  3RR7 A;  4O5C A;  2C22 A;  1D9F A;  2NRT A;  4IQW A;  1KSP A;  2HHT A;  8ICY A;  5C5J A;  2Y1I A;  3RH6 A;  4QWA A;  1S0M A;  2P6R A;  1ZJN A;  5D4B A;  8ICR A;  3RRH A;  1TKD A;  3RJE A;  2XGQ A;  2W9C A;  1XSN A;  2JZB B;  3SYZ A;  2W9M A;  3BQT A;  1KDH A;  1H38 A;  3FYH A;  4ECR A;  1RZT A;  1C7Y A;  7ICJ A;  3ZDD A;  2HHV A;  5J0P A;  1SKW A;  1L5U A;  1XO1 A;  5DQI A;  4FO6 A;  4J9Q A;  2FLP A;  2KZ3 A;  2HVH A;  8ICC A;  4O3R A;  3V7L A;  4ECZ A;  4J9L A;  3PVX A;  2J6S A;  4YXJ A;  2R8J A;  4RU9 A;  3BQ1 A;  4NLG A;  3C2L A;  8ICZ A;  3ZD8 A;  1S9F A;  3M8S A;  3UXN A;  4MF2 A;  1MC8 A;  3JPO A;  3IM1 A;  1U9L A;  4J9P A;  2FMQ A;  4Q8E A;  1ZQD A;  4M04 A;  7ICV A;  5KFT A;  4MEX A;  2FMP A;  1SL1 A;  5KT4 A;  5BOM A;  9ICC A;  4KLQ A;  3PW0 A;  3RJJ A;  3H8J A;  2ASL A;  4EBC A;  4EZ9 A;  5CJ7 A;  2V4Q A;  9ICB A;  3EYZ A;  1ZET A;  1ZQQ A;  4JWN A;  1Y88 A;  3K4G A;  2UVV A;  1T4G A;  1A77 A;  3PR4 A;  5JUM A;  4LVS A;  5DB9 A;  3RJH A;  3EPI A;  1KFT A;  5KFO A;  4RNM A;  1ZQG A;  3PML A;  8ICM A;  3HX0 A;  5DBA A;  4DSE A;  4DL6 A;  1S10 A;  2M9N A;  2AJQ A;  4MFC A;  2ZTE A;  4FBT A;  5KFE A;  4RT3 A;  4QWC A;  2BPF A;  7ICG A;  3ZD9 A;  3T5H A;  3C1Y A;  1ZQJ A;  1ZYQ A;  1U48 A;  3ZDA A;  1NKB A;  4DQI A;  8ICE A;  2NRX A;  3LDA A;  4UQG A;  2PXI A;  4DFP A;  5L1I A;  7ICI A;  1V9P A;  1KFS A;  2UVU A;  1JN3 A;  1A76 A;  1HJP A;  3FDS A;  5DG9 A;  5DG8 A;  3ISC A;  3SI8 A;  4ELT A;  3RJF A;  4UBB A;  5IIM A;  1Z00 B;  5J2I A;  4GXJ A;  1NK7 A;  5DDY A;  4DSF A;  1ZQS A;  4KN7 A;  3RRG A;  4ELU A;  9ICV A;  1TAQ A;  2AGO A;  4DWI A;  3RAX A;  4I2G A;  2BPC A;  1KTQ A;  3ISD A;  3H4B A;  1NKE A;  4YD2 A;  2RDI A;  1CUK A;  3V7K A;  4DLG A;  2OWO A;  3NGD A;  5KFN A;  3Q8Q B;  4KLO A;  3PO5 A;  7ICT A;  5DGA A;  3EZ5 A;  7ICQ A;  4C8M A;  1WCL A;  5IIO A;  3ISB A;  1BPE A;  2P6U A;  5EWG A;  4F5N A;  4ECW A;  3KHG A;  4DF8 A;  2HHQ A;  9ICO A;  4QZG A;  4UB2 A;  4PHD A;  2ASJ A;  5CA7 A;  3OSP A;  1D8L A;  1ZQK A;  1WCN A;  2J6T A;  4M0A A;  5DB8 A;  3N4M B;  4DS4 A;  2A1J B;  2HHU A;  3G6X A;  3H7I A;  4MEY A;  3JPN A;  4DL4 A;  1XSL A;  1N56 A;  9ICG A;  1U49 A;  4KLH A;  3QZ7 A;  4DSK A;  4G3I A;  4Z6E A;  4RQ0 A;  3TAQ A;  5L1J A;  1NK6 A;  1RYS A;  1MSW D;  4P4O A;  3EW9 A;  1U4B A;  4IR9 A;  3KHL A;  3ETL A;  5CB1 A;  4DL5 A;  3THV A;  3JPQ A;  2Q0Z X;  4P4P A;  4MF8 A;  2IHM A;  3BQ2 A;  2JEJ A;  2PI4 A;  1ZQE A;  3C2M A;  4PGQ A;  2I9G A;  9ICA A;  5J2K A;  2BDP A;  1KFD A;  4RQ7 A;  5KFG A;  1U47 A;  1SKR A;  8ICG A;  4QZH A;  5D46 A;  1ZQA A;  7ICP A;  4RPX A;  5J29 A;  4QZI A;  3QZ8 A;  2RDJ A;  4IQV A;  1U45 A;  3SV4 A;  2KZM A;  1PZN A;  1KLN A;  4F4Y A;  5DB7 A;  2PFN A;  4I2A A;  3Q8M A;  4JUZ A;  3RB4 A;  1MQ3 A;  2R8K A;  2MUT B;  5J0Q A;  3B0X A;  4B9L A;  4NM2 A;  3AUO A;  3ZDC A;  4P2H A;  5KFF A;  3RB0 A;  4I27 A;  5KFL A;  4I2F A;  4Q8F A;  4DL7 A;  4UB5 A;  2ASD A;  7ICE A;  9ICQ A;  4I29 A;  3M9M B;  4RNO A;  1NK9 A;  4JV2 A;  4RQ8 A;  1NKC A;  4DFK A;  3RBD A;  9ICF A;  2R8H A;  2FPM A;  4DQS A;  1SL2 A;  9ICM A;  2DPJ A;  1S0O A;  4DOC A;  2VA3 A;  2KFZ A;  3M8R A;  4M6W B;  2BQ3 A;  5DLG A;  3MFH A;  4YMM A;  3TAN A;  3HWT A;  8ICF A;  3EPG A;  4KLF A;  4M9H A;  3PV8 A;  2BPG A;  4F4Z A;  3MFI A;  3SV3 A;  1S76 D;  4YR2 A;  3T5L A;  5J2E A;  2IA6 A;  4KLT A;  4TUQ A;  5J0S A;  1ZQN A;  3PW5 A;  1TFR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...