2KN7A

Structure of the xpf-single strand dna complex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
67
structure length
67
Chain Sequence
EKYNPGPQDFLLKMPGVNAKNCRSLMHHVKNIAELAALSQDELTSILGNAANAKQLYDFIHTSFAEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of the XPF-ssDNA complex underscores the distinct roles of the XPF and ERCC1 helix- hairpin-helix domains in ss/ds DNA recognition
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/dna
molecule keywords DNA repair endonuclease XPF
total genus 20
structure length 67
sequence length 67
chains with identical sequence D
ec nomenclature ec 3.1.-.-:
pdb deposition date 2009-08-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2kn7A00
5BPCA 5KFXA 2ASJA 5EWFA 3Q8MA 2BQRA 3GV8B 4RQ8A 2FMQA 4ECSA 5J0SA 1KEJA 4C8OA 3LDAA 4MFFA 5DDMA 4UB2A 4ECTA 2BCUA 4JWNA 4C8KA 5KFNA 3MR6A 2J6TA 3KHGA 4YR3A 5KFLA 3MR3A 2RDJA 3PNCA 1ZQWA 1QTMA 8ICNA 3B0YA 4Q45A 1L3SA 1TAUA 1Y88A 3V72A 1BPDA 8ICSA 3MBYA 1DOQA 5CP2A 4M9GA 3V6HA 5KFZA 1U48A 1JX4A 1XSNA 9ICVA 3H7IA 2DPIA 2W9CA 4DF4A 5DB7A 3LWMA 8ICCA 5KFFA 1ZQRA 5KFYA 5J2IA 3T5JA 2XO7A 4UBCA 3EWAA 2VA3A 4NLKA 4J9MA 4DS4A 9ICBA 4IRKA 2HHSA 4LZDA 3JPTA 5KFCA 1XSLA 4ECQA 3SV4A 2BPFA 1HUOA 3BQ2A 2BQ3A 2FLNA 3Q8QB 1T4GA 5IIOA 4I2BA 3EZ5A 5KFSA 5J0WA 2ZTDA 4M6WA 4DQIA 9ICCA 5KT2A 1U47A 3RR7A 1NJXA 4YCXA 1S0OA 5HMLA 2I1QA 4KLSA 4RNOA 4R63A 3AU6A 3TQ1A 8ICQA 4UB4A 9ICXA 2NRTA 4KMUA 5DDYA 4P4OA 4M0AA 2V4RA 5KFMA 2C22A 2PI4A 4R64A 5J2FA 4NM2A 4EEYA 3THVA 1QSLA 3BQTA 4F50A 2NRWA 4KLTA 5EOZA 3JPSA 9ICEA 5DG9A 4QWCA 2HVHA 3T5KA 3LK9A 8ICUA 2BHNA 3H8SA 4XA5A 5KG5A 1NKEA 3PX0A 2IHMA 7ICPA 4RT3A 4I2FA 5CA7A 3KHHA 2R8JA 4B9LA 5EWEA 2ZJAA 9ICKA 4RZRA 4F93B 4J9OA 3LWLA 3M9MB 4YXMA 3H8JA 1BPEA 1ZJNA 4JK1A 4P2HA 1SL2A 2XY6A 2ASDA 4C8NA 1MSWD 4J9QA 5DB9A 4RQ0A 4TUPA 4M04A 4M2YA 1ZQUA 3TFSA 1NK9A 9ICIA 4J9PA 3H40A 5KT5A 3JPPA 4UAYA 3MR5A 2FLPA 3M9NB 5CHGA 4DSFA 4B9UA 7ICVA 3G6XA 4PGQA 9ICQA 5KFVA 5KFKA 1ZQFA 5IIKA 3MDAA 4ECZA 3SV3A 3PX4A 3V6KA 4EBCA 4I28A 4O3NA 4PHEA 1ZQPA 4R66A 4F4YA 2P6UA 3TFRA 1CUKA 2F1IA 2C2RA 1X9MA 1S0MA 1ZQDA 1XSPA 2DFLA 4I2AA 4KLJA 1CEZA 4O3QA 2ATLA 4QZDA 4GXIA 1NJYA 1ZQLA 5J0OA 4J9RA 4C8LA 1A76A 2ISOA 5DB8A 1UT5A 4PHPA 1ZQTA 4KLLA 3NTUA 2ZUCA 4J9SA 2BQUA 4GC6A 4KLIA 2KFNA 3ZDAA 4DSKA 3OHBA 5J0QA 3ZD9A 5IILA 5L1IA 2F1HA 4IRDA 4ZH4A 3V6JA 4YQWA 1U4BA 4I29A 5DQIA 5J2KA 1XWLA 1XO1A 3RB3A 2BR0A 4PHAA 2FPLA 4DFKA 3RB0A 1JN3A 3PMNA 2IBKA 4PGYA 1L3VA 4BDPA 4NY8A 4QWAA 3GQCA 1RPLA 4MFCA 4F5RA 4P4MA 1XU4A 4RNMA 5KFEA 4F5NA 2ISPA 2ZUDA 4F92B 1MQ3A 4ED8A 5KT6A 2DPJA 4HYKA 5D49A 5J2EA 9ICLA 1TKDA 2J6SA 4BWMA 1KDHA 2HHTA 2BCVA 5KFBA 4UAWA 8ICGA 1X9WA 3H8WA 4KN4A 9ICNA 5HHHA 4QZFA 4PHDA 3GDXA 2RDIA 4Z6CA 3GV7B 3OJUA 9ICJA 3UPQA 3HWTA 1L3TA 4YMOA 2J6UA 1NJWA 4BXOB 3BJYA 4FBTA 1UT8A 4UBBA 3FDSA 2FMPA 4YD1A 3BQ1A 5L1LA 1XC9A 5L1KA 1NKCA 4X5VA 4DQSA 4MF8A 1QSSA 1TV9A 5J0PA 4J9LA 2M9NA 4BWJA 4KITB 2HHXA 9ICWA 3QZ7A 4RU9A 3TAQA 2KZ3A 2VANA 1KFDA 3RBDA 2P6RA 4DQPA 2AGQA 8ICPA 4B9NA 3EPIA 1SZPA 3M8RA 5BOMA 5IINA 4Q43A 4JV0A 1D8YA 1D9DA 5CB1A 7ICEA 1TFRA 1SKRA 1BGXT 3C5GA 3C5FA 2JEGA 1JIHA 2BPCA 1EXNA 1S97A 4ECVA 2HHWA 4CCHA 3N97B 3N4MB 3C1ZA 8ICIA 3OGUA 1JXLA 4DFMA 1S0NA 5DG8A 2BCRA 3AUOA 2BCQA 4IR9A 5KFRA 2PFQA 1B22A 3GIJA 4F5OA 5DQHA 4ED2A 3OSNA 2R8IA 4G3IA 5L9XA 5KG0A 1ZJMA 5HNKA 4Q44A 4QWDA 4QZ9A 2IA6A 8ICRA 4IQUA 1T3NA 4RQ5A 4JV1A 4B9TA 1UA0A 1V9PA 4YMNA 4MF2A 3TARA 7ICNA 2XCAA 5KFUA 5J2HA 4F4WA 1COOA 3PW0A 4NLNA 4O3PA 2KZZA 3QEAZ 4DL7A 4UB1A 2FPKA 3JPRA 5KG4A 2AGOA 3SZ2A 4ED0A 7ICGA 5F9NA 3C21A 5IIJA 3RJIA 4C8MA 1ZQOA 4O3SA 1D9FA 4PH5A 2UVRA 4NLGA 3TAPA 2A1JB 4ELUA 8ICXA 4DL3A 2IHNA 5KFJA 4DQQA 3M9OB 4RUAA 4F4KA 9ICRA 1ZQAA 8ICOA 2MUTB 5DBAA 1X9SA 5CWRA 5KFAA 3JPQA 4K4IA 5KFWA 1ZQEA 4JV2A 3GFKB 3UQ2A 4RQ6A 3MFIA 9ICUA 3UXNA 3ISCA 1U45A 3RJHA 4I2GA 4F2SA 5KG2A 4RNNA 1UA1A 3IHQB 1ZQGA 3B0XA 3ZDCA 4YN4A 3HPOA 3SI8A 1PZNA 3PV8A 1S9FA 3HW8A 1K1QA 4KLUA 1QSYA 4QZIA 5J2AA 4F4XA 3Q8RB 2C28A 1L5UA 3KHRA 2OWOA 4I27A 2HVIA 3T3FA 2GWSA 4DWIA 4DSLA 3RRGA 3PW4A 4IQVA 3RH6A 1AROP 5KFPA 3MABA 1ZQCA 2Y1IA 2BPGA 1TK0A 2FMSA 2IMWP 4FBUA 3E2EA 4XRHA 2XCPA 3TANA 2KN7A 4M9JA 8ICYA 3HX0A 2PI5A 4DLEA 1ZYQA 1T7PA 4I2CA 4QZGA 7ICLA 1BPXA 2Q0ZX 4I2EA 3GV5B 2ZJ5A 4RQ2A 1N56A 4PPXA 1ZQXA 5DG7A 4YP3A 3ZD8A 3PVXA 1RXVA 2R8KA 5IIIA 4KLQA 3PX6A 2JZBA 4TQRA 3GILA 4TURA 2MAXA 3ZDDA 1ZQVA 1A77A 3V7JA 3RJKA 4BXOA 3RRHA 1TVAA 4Q8FA 1Z3EB 4EZ6A 2WTFA 3RH5A 1WCLA 2ALZA 1ZQJA 8ICAA 4O0IA 3EYZA 4GC7A 4F3OA 2W9AA 4YFKA 2BGWA 4K4GA 9ICHA 3Q8LA 1S10A 2KZMA 4ECYA 4I2JA 4RQ7A 7ICUA 4QZEA 4QW8A 4DSJA 1Z00B 4BGDA 4ED6A 3PW5A 2W8KA 3SYZA 3JPNA 1S0VA 4J9KA 4EYIB 4QZBA 9ICPA 2ZUBA 4XQ8A 4MEXA 5J0UA 2C2DA 4YXJA 1U49A 4KN7A 1QLNA 7ICMA 4DS5A 3ETLA 2Y1JA 4KLMA 4ECXA 3ZDEA 4KLHA 5KT7A 4RQ3A 5DQGA 3AU2A 4R8UB 4TUQA 3UQ0A 1ZQNA 8ICLA 4Z6EA 3PO5A 1NK4A 4YG2A 4P4PA 4GLXA 5D46A 3MDCA 4I2HA 4Z6FA 5J0TA 3GIKA 3T5HA 2HHVA 7ICHA 4RPXA 8ICFA 4XUSA 3MGHA 4ED1A 1KRPA 4QZ8A 7ICTA 4EYHB 7ICOA 2BKEA 3OSPA 5J2GA 4E0DA 7ICQA 7ICKA 1RYRA 4DL2A 4KLDA 9ICAA 1RZTA 4EZ9A 5EWGA 1SKSA 4EBEA 2PFOA 4R8UA 4J9NA 8ICVA 4M6WB 1NOMA 3HP6A 5CJ7A 5L1JA 3Q8PB 4YD2A 3BDPA 4DEZA 1LB2B 3C2KA 4FO6A 2NRZA 4M47A 5KT3A 1NK6A 4I2IA 3PR4A 2HHQA 2ASLA 5KFTA 1NK0A 4DO9A 4DOCA 3RB6A 5J0YA 3QZ8A 1NKBA 4YMMA 4ECRA 1RXWA 2UVUA 2XC9A 2F1JA 1TAQA 4QZCA 4DL6A 2UVVA 8ICEA 1RYSA 2HW3A 3RJJA 2P66A 3IM1A 2PFNA 2HHUA 1NJZA 8ICZA 4DOBA 5DBCA 3MFHA 3RJFA 5KFOA 3ORYA 7ICIA 5DKWA 4KTQA 1ZQBA 1Z00A 4QWBA 5DLGA 4DL5A 3C23A 3C2MA 3PY8A 4JUZA 1S77D 8ICTA 4JWMA 4YR2A 3H4BA 4QW9A 3UXOA 3EPGA 4O5KA 5HP4A 1ZQHA 5J2JA 4ELTA 1TK8A 2H5XA 1BPZA 1S76D 3OHAA 4F5QA 3NGDA 1ZQZA 1ZQSA 4O5EA 5KTQA 2R8HA 5HHIA 4RT2A 4RQ4A 4LZGA 5J0RA 5JUMA 2XY7A 1H38A 4RUCA 3JPOA 4RQ1A 3PR5B 1WCNA 4O5CA 1SL0A 3RR8A 2W9BA 3FYHA 2AJQA 4IRCA 1B43A 1D8LA 4FS1A 5KFGA 4O3OA 2FLLA 2VA8A 4TUSA 5J29A 2I9GA 9ICSA 4YVZA 4KLOA 3RH4A 4F2RA 1HUZA 2W9CB 3C2LA 4F5PA 4UB3A 3GIIA 5DB6A 1KSPA 1ZQQA 1XS9D 2B21A 4I2DA 5KG6A 3ZDBA 2C2EA 1IM4A 4IR1A 4O9MA 3PW2A 2KFZA 4Q8EA 1BVSA 5IIMA 4M9NA 4DLGA 4B9SA 4F91B 1ZQIA 4LVSA 2MUTA 3RAXA 4PGXA 1SL1A 8ICMA 4DFJA 5DGBA 1C7YA 4MFAA 2AGPA 2ZJ8A 2XGPA 4KLGA 3ISDA 5KG1A 4RPZA 2W8LA 1IXRA 3V7LA 5TZVA 5DBBA 3RB4A 1TK5A 3RAQA 4DF8A 4UQGA 1KFSA 1ZQYA 1KLNA 3PO4A 4EBDA 4M9HA 3GIMA 1N48A 3K75D 4O3RA 2A1JA 4Z6DA 4UB5A 4QZAA 1NK5A 4MEYA 5KFHA 3KHLA 1ZETA 3QE9Y 2UVWA 4F8RA 5HMMA 2V9WA 3T5LA 2FPMA 5J2CA 3V7KA 3RTVA 7ICSA 4K4HA 2ZTCA 5BOLA 8ICBA 5J0XA 4YR0A 4ECWA 2LYHA 2BCSA 2JEFA 4DSIA 1MC8A 7ICRA 1LV5A 2JEJA 1KFTA 4NXZA 1KTQA 1K1SA 2ZTEA 5DGAA 2BDPA 3RJGA 3MGIA 4RPYA 2NRXA 4IQTA 3M8SA 4NLZA 4DL4A 4GXJA 9ICTA 2V4QA 2XY5A 5C5JA 3OJSA 2W9MA 4ED7A 3RBEA 1ZQKA 3TI0A 1NK7A 3KTQA 3ISBA 4ELVA 2R8GA 1DGSA 3G6VA 1HJPA 1NK8A 2JEIA 3PMLA 2AU0A 1BPYA 1U9LA 4QZHA 4KLEA 4DSEA 4IQWA 1T8EA 2AQ4A 3PW7A 2KTQA 4ED3A 1X2IA 5J2BA 4DFPA 4B9MA 7ICFA 4DQRA 4B9VA 2AQ0A 4KLFA 4QWEA 2PFPA 4F4ZA 4NM1A 7ICJA 2NRVA 3BQ0A 1JMSA 2VA2A 5KFQA 5CR0A 3MR2A 4ECUA 1JXEA 3G6YA 5J2DA 3H4DA 3UXPA 3EW9A 1MQ2A 8ICWA 5KFIA 8ICHA 3C1YA 4M9LA 9ICGA 2JZBB 9ICFA 5KG7A 5KFDA 5F9LA 3QEBZ 5KT4A 3HT3A 4GXKA 1ZQMA 4UAZA 3K4GA 9ICMA 4FS2A 4DOAA 3Q8KA 1L3UA 5KG3A 4TQSA 1SKWA 2XGQA 8ICJA 4R65A 3Q8SB 9ICOA 1BPBA 3RJEA 5DLFA 8ICKA 2W9BB 2PXIA 5D4BA
chains in the Genus database with same CATH superfamily
3Q8MA 4ECSA 1KEJA 5DDMA 2ZIVA 4C8KA 5KFNA 2J6TA 4DFDA 1FFVA 5KFLA 4OJOA 1L3SA 4P0PB 3V72A 1DOQA 5CP2A 2AXTU 5KFZA 5AK5A 2NYVA 2XO7A 4UBCA 2VA3A 9ICBA 4LZDA 1XSLA 4ECQA 2VJ4A 5AKJA 3BQ2A 4Y2SA 1YT3A 1UHUA 5ALMA 3BS5B 1QQ6A 9ICCA 1NJXA 4KLSA 5DDYA 2PI4A 3QUBA 2JRZA 3BQTA 4F50A 4KLTA 4EEKA 2WHEA 2YTUA 5DG9A 4QWCA 2HMXA 2HVHA 2LYAA 3VC8A 2IHMA 1UPHA 3KZIU 3KHHA 1RQNA 4J9OA 3LWLA 3M9MB 4U7CA 3H8JA 1BPEA 4P2HA 4JK1A 2K8AA 2ASDA 4RQ0A 4TUPA 3AQEA 5KT5A 4C80A 3MR5A 1XNSA 5CHGA 2JGAA 5KFKA 2XIDA 1ZQFA 2YMMA 3CNHA 4EBCA 4I28A 2QARB 2P6UA 1XSPA 2W55A 4I2AA 4KLJA 3QU7A 5J0OA 4J9RA 4GC6A 3ZDAA 4DSKA 5IILA 2A3VA 2F1HA 4YQWA 2G0AA 1PVQA 5KAIU 1XO1A 1UQVA 2FPLA 1L3VA 1J97A 4GIBA 1XU4A 5KFEA 1N5XA 2ZUDA 4F92B 2DPJA 2Y0SC 5D49A 4BWMA 2N1RA 4UAWA 1X9WA 3H8WA 5J8YC 5HHHA 3OJUA 3HWTA 3F53A 3BJYA 3FDSA 4YD1A 3BQ1A 4X5VA 4DQSA 2WF9A 2M9NA 4KITB 1K5OA 3QUCA 3QZ7A 4LJXA 4RU9A 1S5LU 2AGQA 4B9NA 1SZPA 4JV0A 3IG8A 2HHWA 2EAOA 3OGUA 2BCRA 3AUOA 3GIJA 3NASA 2VIXA 2HSZA 2MSNA 3OSNA 2HOFA 4Q44A 4JV1A 4RQ5A 1DRGA 2FE9A 4NLNA 5B66U 5J2HA 4O3PA 3JPRA 3SZ2A 2MA1A 7ICGA 5ALJA 2UVRA 4NLGA 3N7RC 2A1JB 4ELUA 3KBBA 1YZ7A 5KFJA 4DQQA 4RUAA 9ICRA 1ZQAA 1SB3C 5KFWA 1ZQEA 4JV2A 5G5HA 4RQ6A 3MFIA 9ICUA 3L4PA 5KG2A 1UA1A 1F0MA 3ZDCA 4YN4A 1PVRA 2E1FA 3PV8A 2HCFA 1QSYA 4CDGA 4I27A 3T3FA 2XI9A 1PK3A 3K1RB 3N28A 2IMWP 1TK0A 3UMGA 4UARA 8ICYA 3HX0A 1ZYQA 1T7PA 4QZGA 1BPXA 1RG6A 2ZJ5A 4RQ2A 1N56A 2OM6A 2JH1A 5AI8A 5AIBA 2R8KA 5IIIA 2W11A 3GILA 5AI5A 4TURA 1PVPA 1A77A 3RJKA 4EZ6A 3KOOA 4F3OA 4K4GA 3SEIA 1S10A 4I2JA 4RQ7A 4QZEA 4DSJA 2EAMA 2HBJA 4EYIB 5ALPA 4XQ8A 3FC4A 4MEXA 2K8BB 2C2DA 3CP8A 4KN7A 3ETLA 2DUYA 4ECXA 5DQGA 4R8UB 1ZQNA 8ICLA 3UQ0A 3PO5A 1NK4A 4P4PA 4AP9A 3MDCA 1DK3A 3AEVA 2A1AA 3AM9A 4IC9A 3GIKA 1KRPA 4QZ8A 2G06A 3NVVA 3OSPA 5JRTA 5HR6A 4DL2A 9ICAA 4PL2A 2YX8A 3NUQA 4EBEA 3I28A 4M6WB 1OW5A 3BDPA 3AMZA 3C2KA 3IN5A 3OTQA 1NK0A 3O0FA 3SENA 4ECRA 5B5EU 2UVUA 2DKZA 5T14A 3RJFA 1WG8A 2Z7JA 1ZRNA 7ICIA 1Z19A 3ICXA 3WK4A 1ZQBA 4QWBA 4US8A 4JUZA 1S77D 4O5KA 5HP4A 1NZPA 5GTHU 2H5XA 2F77X 1IG6A 3ONNA 2WF5A 2ODGA 2R8HA 4RT2A 4RQ4A 3DDHA 1FO4A 5HR7A 2AJQA 2K4HA 3MGVA 1D8LA 4O3OA 2FLLA 4TUSA 4QIWC 5J29A 2I9GA 9ICSA 4KLOA 1PUZA 3WKCA 3C2LA 1ZQ1C 2KFZA 2C2EA 2F8KA 4DLGA 4B6JA 1ZQIA 3WKAA 4LVSA 4DFJA 5KG1A 4RPZA 5DBBA 3RB4A 1TK5A 4DF8A 3H0LB 4M9HA 3K1ZA 2D3DA 1NK5A 1X66A 4F8RA 3T5LA 2KVCA 7ICSA 3ED5A 4K4HA 2HBKA 5BOLA 8ICBA 2JEFA 4DSIA 1KFTA 4NXZA 2ZTEA 2CRXA 2HBMA 4IQTA 3M8SA 4QJFB 3TI0A 2OCEA 3ISBA 2R8GA 3G6VA 2EDUA 1WYGA 1NK8A 2JEIA 5ALQA 1U9LA 5ALOA 4QZHA 4IQWA 1T8EA 4JMUA 3SMVA 4ED3A 4DQRA 3WK5A 4NM1A 4QWEA 2PFPA 2NRVA 1JMSA 1JXEA 3UXPA 4G9BA 3TADC 4EX7A 9ICFA 2NO5A 3HT3A 4UAZA 9ICMA 4FS2A 4DOAA 1O03A 2HBLA 1SKWA 2XGQA 3RJEA 4ACOA 3H0RB 2G09A 5KFXA 2YB1A 3SAFA 5ALWA 4JWNA 3KHGA 4YR3A 3MR3A 8ICNA 3B0YA 3IDWA 4UAUA 2LBOA 1U48A 1JX4A 1XSNA 9ICVA 1SXEA 3LWMA 1FFUA 5KFYA 3T5JA 3EWAA 4BX9C 4J9MA 3JPTA 2BPFA 1RDFA 1Q3VA 2WF7A 2JMGA 2FLNA 1T4GA 5KFSA 2R18A 1D8BA 3HKZC 3RR7A 1S0OA 1ZD3A 4RNOA 4R63A 9ICXA 4UB4A 4P4OA 1L7MA 4M0AA 3D2SA 5KFMA 2C22A 1MA7A 2JXJA 3CYMA 4NM2A 2E5SA 2HI0A 3NVWA 3T5KA 5EE3A 3EUB2 1NKEA 3H8SA 7ICPA 4I2FA 2R8JA 4FFDA 5AKHA 1Q8KA 4YXMA 3I76A 4OCZA 4Y2UA 2B6GA 1SL2A 2RLTA 1KBUA 4J9QA 2DF4B 4BUGA 4M2YA 9ICIA 4J9PA 3H40A 3JPPA 4UAYA 5EE1A 2FLPA 3M9NB 4DSFA 2E8PA 1RYUA 4B9UA 4CF5A 2FJ6A 5KFVA 5ALXA 4O3NA 4PHEA 4F4YA 2KIWA 3TFRA 2C2RA 1L8OA 1ZQDA 1SV0A 2DFLA 2ATLA 4PL1A 4QZDA 4GXIA 1A76A 5DB8A 4U6PA 4PHPA 3NTUA 2ZUCA 4KLIA 3OHBA 1C20A 4IRDA 1U4BA 5J2KA 5AHXA 4QNLA 1XWLA 3RB3A 1Z1BA 2XVTA 4PHAA 4DFKA 2CPRA 1URJA 4PGYA 1NZBA 3GQCA 4MFCA 4P4MA 2W3SA 1MQ3A 2BDUA 2ZIUA 4HYKA 4KX5A 5KFBA 4J03A 4KN4A 2JV3A 3GV7B 4Y2VA 4BXOB 2J6UA 4FBTA 2QLTA 4UBBA 5L1LA 1XC9A 3LVWA 1QSSA 3L5KA 5EE9A 4BWJA 2KHVA 9ICWA 3TADA 3T79A 3NRZA 2P6RA 3RBDA 4DQPA 1KFDA 3B9JA 3M8RA 5BOMA 3HJEA 5CB1A 7ICEA 3C5GA 2BPCA 1S97A 4CCHA 3C1ZA 8ICIA 4DFMA 5DG8A 1B22A 4G3IA 2Y9UA 5HNKA 8ICRA 8ICQA 3TKAA 1T3NA 1UA0A 1V9PA 5KFUA 2KSOA 4BJQA 5F9NA 3C21A 5AM5A 4C8MA 4O3SA 4PH5A 8ICXA 3QU2A 3PZPA 2MUTB 5CWRA 5KFAA 3JPQA 4K4IA 3IP4B 4F2SA 3RJHA 1L6NA 1MN8A 4RNNA 2IOFA 1ZQGA 3IHQB 1PZNA 1NI3A 1V97A 1S9FA 3WK6A 4KLUA 3Q8RB 2YB4A 3KHRA 4RQMA 2HVIA 3FM9A 3RRGA 5KFPA 1S0VA 3MABA 1ZQCA 4XRHA 1ZD4A 3H8MA 2Q0ZX 5ALLA 1FEZA 2KJ5A 5DG7A 1PK1B 3UMCA 5L1MA 3ZD8A 3PVXA 1RXVA 3KZXA 3PX6A 2DWQA 3V7JA 4BXOA 1TVAA 1Z3EB 2WTFA 2ALZA 3EYZA 1RM6C 4O0IA 4GC7A 4YFKA 1Z4NA 5ALSA 4BGDA 3E58A 4ED6A 2E3TA 2RRDA 3C29A 3JPNA 5AI9A 4NWIA 1KKXA 9ICPA 2ZUBA 1DXSA 2Q4TA 3SD7A 2OH2A 3ZDEA 4RQ3A 5ALEA 4TUQA 4GLXA 5D46A 4Z6FA 3WK9A 2HHVA 8ICFA 4C4TA 4E0DA 4KLDA 1RZTA 1TAMA 2PFOA 2HOQA 8ICVA 3HP6A 5CJ7A 2K8CB 5L1JA 3Q8PB 4P0QB 5EE0A 4DEZA 2H3IA 1NK6A 4QIWF 3PR4A 5KFTA 2ESEA 4DO9A 4DOCA 5J0YA 1RXWA 2F1JA 4DL6A 2UVVA 2G5HB 3RJJA 3PSTA 3WKEA 2HHUA 3M6KA 2LYBA 3MFHA 5ALGA 4UW9A 5DKWA 2RP5A 4KTQA 5DLGA 4QW9A 3EPGA 3F5AA 2F44A 1ZQHA 3CRXA 1TK8A 3A0BU 3OHAA 3D6JA 2LPEA 3NGDA 1ZQZA 1JROA 4LZGA 5AKEA 4RUCA 3PR5B 1WCNA 3AN1A 1SL0A 3RR8A 3FYHA 1WUDA 4FS1A 5KFGA 2QKQA 2IOHA 2VA8A 4F2RA 3IV6A 2W9CB 4UB3A 4EX6A 5DB6A 1XS9D 9ICKA 4O9MA 1SWWA 2OHFA 3QU5A 2KJ9A 1BVSA 4B9SA 1N63A 4F91B 2MUTA 3RAXA 4PGXA 1C7YA 4KLGA 3ISDA 5TZVA 4UQGA 3F2BA 3PO4A 4EBDA 3K75D 2A1JA 3NRWA 4UB5A 3H0MB 1SV0C 4MEYA 5ALNA 5HMMA 2B0CA 2V9WA 5J2CA 3QU9A 3RTVA 1A6SA 3MC1A 2BCSA 1MC8A 1KTQA 1K1SA 5DGAA 5AK4A 2NRXA 9ICTA 4IS7A 2XY5A 3OJSA 2KIVA 1ZQKA 1DGSA 1SIJA 2O6KA 2AU0A 4KLEA 2AQ4A 4O3MA 1T3QA 2VA2A 1N61A 1NNLA 5C0YA 4ECUA 2OXOA 3EW9A 4PJ0U 5KFIA 3M6ZA 2JZBB 2HDOA 5F9LA 5KT4A 4P0PA 2ZIXB 2WFAA 4R65A 3Q8SB 1BPBA 5DLFA 3SR6A 5A0LA 2F76X 1HIWA 5BPCA 4EELA 2ASJA 4RQ8A 5J0SA 4C8OA 5AKGA 3LDAA 4UB2A 4ECTA 2RDJA 5AKIA 1ZQWA 4Q45A 1T94A 1TAUA 1Y88A 1BPDA 3N7SC 2DPIA 1FIQA 2W9CA 4DF4A 1JUDA 1ZQRA 4DS4A 5KFCA 2ZIVB 1HUOA 2VJ5A 5CEHA 5TISU 4NLBA 3WU2U 2BQ3A 3DV9A 5IIOA 2LKYA 3EZ5A 3E0FA 1U47A 2ZIXA 2I1QA 3TQ1A 2NRTA 4KMUA 1L7NA 5J2FA 4EEYA 3THVA 2NRWA 1ZRMA 5EOZA 3JPSA 8ICUA 3PX0A 4RT3A 4RZRA 5DB9A 4M04A 1ZQUA 2LM4A 2KSOB 3PX4A 4UASA 1ZQPA 4R66A 2F1IA 4C7YA 2WAQC 2DQNB 1ZQLA 2CXYA 4GFJA 1ZQTA 4KLLA 5AM0A 5ALIA 4J9SA 2BQUA 5J0QA 3ZD9A 2LM1A 3V6JA 4I29A 5DQIA 3IG5A 3RB0A 2IBKA 4KMOB 4UAVA 4BDPA 4NY8A 4QWAA 2ISPA 4ED8A 4Y2RA 3I1YA 5AICA 5F3XB 9ICLA 1KDHA 2BCVA 2FI1A 1N5WA 2W3RA 9ICNA 4QZFA 3WK8A 2RDIA 1S8OA 1CRXA 3UPQA 4JB3A 4WJ3B 3KFUF 2FMPA 2W03A 1NKCA 5L1KA 2QB0A 1TV9A 5J0PA 2HHXA 3TAQA 5IINA 4Q43A 5KL8B 1SKRA 1BGXT 3C5FA 4ECVA 3N97B 3N4MB 1S0NA 2BCQA 2H3VA 4IR9A 5KFRA 2PFQA 2JHDA 1X6JA 5DQHA 4ED2A 5L9XA 5J8YA 4USAA 3QX7A 4B9TA 4MF2A 2QB1A 2XICA 1COOA 3A0HU 3QEAZ 3AL0B 3QUQA 2FPKA 2AGOA 3WK7A 4ED0A 5IIJA 4KX3A 4NL9C 2KE7A 1ECWA 5JTIA 4DL3A 3M9OB 1X9SA 3UQ2A 2W7PA 2EQYA 3ISCA 1U45A 1AQ6A 4I2GA 1VLBA 3B0XA 1ZXIA 2K60A 3HW8A 3S6JA 4QZIA 5J2AA 4F4XA 2C28A 2OWOA 2KHQA 1O08A 2E8OA 4DSLA 2F3NA 4DWIA 4IQVA 2BPGA 2FMSA 4FBUA 2Y1IA 2PMZC 3E2EA 3TANA 2PI5A 4DLEA 1ZOLA 2E1EA 3GZFA 2W04A 4I2EA 3GV5B 3BS5A 4PPXA 1ZQXA 4YP3A 4KLQA 2MAXA 3N7PD 3QUTA 4AYBC 4FZLA 3RRHA 2ZG6A 5AM2A 1WCLA 1QCKA 8ICAA 4OO1J 2QB0B 2W9AA 3Q8LA 2FDRA 4ECYA 7ICUA 4QW8A 1IIPA 1Z00B 2ZIUB 4MHVA 4AYBF 3SYZA 5KL1B 3F2DA 4DCCA 2M0NA 5FP0A 4QZBA 5AKYA 5J0UA 1U49A 1QLNA 3BZCA 2Y1JA 2KD1A 5KT7A 1KQQA 5ALHA 4FE3A 3UM9A 1SXDA 3M7DA 3T5HA 4HAIA 4RPXA 4ED1A 5K4LA 7ICTA 4EYHB 7ICOA 7ICQA 5H2FU 3HILA 1RYRA 4EZ9A 4EENA 1SKSA 1B0XA 4R8UA 4J9NA 5AK6A 1NOMA 5AKLA 4YD2A 1LB2B 4FO6A 2NRZA 5KT3A 4PZNA 2ASLA 3LVVA 3QZ8A 1NKBA 4YMMA 2PMZF 4UATA 1TAQA 4QZCA 8ICEA 4UB6U 1RYSA 2HW3A 2P66A 1JI7A 2PFNA 4Y2YA 4CF4A 8ICZA 4DOBA 1RQLA 2D8CA 2YQEA 3ORYA 1Z00A 3NVZA 3C23A 3C2MA 8ICTA 4JWMA 4YR2A 3UXOA 1N62A 3KD3A 1LVHA 1KL9A 1L7OA 2KG5A 5HHIA 4OJ6A 5J0RA 5JUMA 2XY7A 3LYSA 3JPOA 4RQ1A 4O5CA 5G5GA 2YMPA 4CRXA 3RF9A 4IRCA 1B43A 5CRXA 1VDVA 1HUZA 4ICAA 4ZOHC 4F5PA 4OD0A 3GIIA 1KSPA 1QH9A 3ZDBA 2B21A 5KG6A 3PW2A 2DKXA 5IIMA 4M9NA 5AI0A 3WKDA 2I5HA 8ICMA 3ETRA 5DGBA 2AGPA 2ZJ8A 3L3FX 3V7LA 3RAQA 1KFSA 2KVSA 1ZQYA 3GIMA 1N48A 5KFHA 3KHLA 1LKYB 1ZETA 3QE9Y 2KP7A 1YZ6A 2FPMA 1J2NA 2ZTCA 5J0XA 4ECWA 2LYHA 7ICRA 1LV5A 2JEJA 3UMBA 3MGIA 4NLZA 4GXJA 2V4QA 5C5JA 3RBEA 2W9MA 4OJPA 1NK7A 3KTQA 4ELVA 3J81j 1HJPA 2NO4A 1BPYA 3CW2C 3PW7A 1L7PA 1X2IA 4C4SA 4DFPA 4B9MA 7ICFA 2DL0A 2AQ0A 7ICJA 5KFQA 2AHOB 3G6YA 3H4DA 1MQ2A 1SGGA 8ICHA 3C1YA 9ICGA 5KG7A 3C28A 5KFDA 1X40A 3QEBZ 1GO3F 1KW4A 4GXKA 1ZQMA 2IOFK 2EH9A 1L3UA 4TQSA 5ALTA 3KKAA 3QNMA 8ICKA 2PXIA 4NV0A 3PSIA 4A8EA 5EWFA 2BQRA 1TE2A 3GV8B 3NVYA 2FMQA 2KV2A 4MFFA 1ZD2P 2BCUA 4C4RA 3MR6A 2ZXHA 1QTMA 3PNCA 8ICSA 3MBYA 2KNJA 4M9GA 3V6HA 2OYYA 2H3ZA 3H7IA 1X42A 1Q3UA 2EZYA 8ICCA 5AM3A 5DB7A 2W43A 5KFFA 5J2IA 1P7DA 4NLKA 4IRKA 2HHSA 5ALFA 3SV4A 2K89A 3Q8QB 4I2BA 3M1YA 5J0WA 4P0QA 2ZTDA 2EANA 4F72A 4M6WA 4DQIA 5KT2A 5JU5A 5AI4A 4YCXA 2YN4A 5HMLA 4NL9A 3AU6A 5ALVA 2V4RA 3R9KA 4R64A 1WWUA 1QSLA 1SZHA 2NV3A 9ICEA 2RQ5A 3D2QA 3LK9A 5AKKA 2BZFA 2BHNA 4XA5A 5KG5A 5CA7A 1OUQA 4B9LA 4Y2QA 5EWEA 2ZJAA 4F93B 1UCVA 1ZJNA 4NLCA 2XY6A 2YMQA 4C8NA 4CF3A 1MSWD 3TFSA 1NK9A 3F5EA 2E8MA 7ICVA 2GO7A 4PGQA 3G6XA 9ICQA 5IIKA 3MDAA 4ECZA 3SV3A 3V6KA 2MU2A 4Y2XA 1X9MA 1CUKA 1S0MA 5AM1A 1SWVA 5AKZA 1CEZA 4O3QA 1NJYA 4C8LA 2ISOA 1UT5A 4C7ZA 2KFNA 1J2MA 5L1IA 2VKQA 2KMDA 4ZH4A 2K4IA 2WB1F 1KN5A 2BR0A 5AIAA 1JN3A 3PMNA 5AKXA 2K4PA 1RPLA 2KKVA 4F5RA 4UB8U 3DEEA 4RNMA 4F5NA 2KKPA 5KT6A 5AI6A 5J2EA 1TKDA 2J6SA 8ICGA 5ALZA 1N2XA 4PHDA 3GDXA 4RQNA 4Z6CA 1M6YA 9ICJA 2ZIWA 1L3TA 4YMOA 1NJWA 1UT8A 5AM4A 4MF8A 2QARA 4J9LA 2RHFA 4NJ8A 9ICOA 2KZ3A 2VANA 1V38A 2CN1A 8ICPA 2GH1A 1WWVA 3EPIA 1D8YA 2HHTA 1D9DA 1TFRA 1F5SA 2JEGA 1JIHA 1Q46A 2DGZA 2GOLA 1EXNA 1BNOA 1JXLA 2YY6A 4F5OA 3FAHA 2KOBA 2R8IA 3ZI4A 5KG0A 4Y2JA 1ZJMA 4QWDA 4QZ9A 2IA6A 2JH7A 4IQUA 2WF6A 4YMNA 2Y0SF 3TARA 7ICNA 2XCAA 3PW0A 4F4WA 2KZZA 4DL7A 4UB1A 3OPXA 1F44A 5KG4A 3RJIA 1ZQOA 2ZXIA 1D9FA 3D2NA 2P35A 3TAPA 2ES6A 3HRDD 2IHNA 1X9XA 4F4KA 8ICOA 5DBAA 3GFKB 3UXNA 3SI8A 3HPOA 1K1QA 1L5UA 4Y2TA 2GWSA 3PW4A 3RH6A 1AROP 2JR5A 2XCPA 2W54A 2KN7A 4M9JA 4Y2PA 4I2CA 7ICLA 3NS1A 2JZBA 3PSPA 4TQRA 3ZDDA 1ZQVA 1DGJA 2GLEA 4Q8FA 3RH5A 4OJLA 1ZQJA 1A0PA 2EZXA 1QQ5A 5ALUA 2BGWA 9ICHA 2KZMA 2H3FA 2H3QA 3ALRA 2ZIWB 1L8LA 3PW5A 1V85A 2W8KA 1OXJA 4J9KA 2A19A 3PSFA 4IL6U 3SAHA 4YXJA 7ICMA 4DS5A 4KLMA 1B4FA 4KLHA 3AU2A 2YMLA 5ALDA 2E8NA 5ALRA 4Z6EA 2HOIA 1ED1A 4YG2A 4I2HA 2WF8A 3QXGA 5J0TA 2F2AB 7ICHA 5AK3A 5KAFU 4XUSA 3MGHA 2BKEA 2AH5A 5J2GA 1HEKA 7ICKA 4CGZA 4FZNA 1N60A 2WAQF 5EWGA 3BS7A 1VJ5A 3SQIA 4M47A 3GU3A 4OJ5A 4I2IA 2HHQA 3RB6A 2WB1C 2F8LA 4CE6A 4F71A 2XC9A 5KNIA 3SAGA 2L5YA 5GTIU 3BQ7A 3IM1A 1NJZA 3KKAC 5DBCA 5KFOA 1XO0A 2G5IB 1DK2A 4DL5A 1IV8A 3PY8A 2I6XA 3H4BA 1QQ7A 5J2JA 4ELTA 1PK1A 1BPZA 2MRLA 1S76D 4F5QA 2LI6A 1Z4OA 1ZQSA 3AQFA 4O5EA 5KTQA 2EAPA 2EZZA 1H38A 3IRUA 2PKEA 2W9BA 3QYPA 1CI4A 5ALYA 4YVZA 3RH4A 2W7OA 3U26A 1ZQQA 4I2DA 1IM4A 4IR1A 2G08A 4Q8EA 3BZKA 2D6FC 1SL1A 4MFAA 2XGPA 2KEYA 3WKBA 1IXRA 2W8LA 1SV4A 3VCBA 4CNQA 3HKZF 1KLNA 4O3RA 5ALKA 4Z6DA 5E79U 4QZAA 4FZMA 2UVWA 3F2CA 3V7KA 4YR0A 2BDPA 3RJGA 4RPYA 2K4EA 4DL4A 4ED7A 1LKYA 2Y9TA 3QU4A 2KK0A 2OEHA 1COKA 3PMLA 4PZOA 2KJ8A 4DSEA 3RFAA 1BNPA 1JALA 2KTQA 5J2BA 4B9VA 4KLFA 1ZD5A 4F4ZA 3BQ0A 2G07A 1X6IA 3TACB 5CR0A 3MR2A 5J2DA 8ICWA 2LHTA 4M9LA 1JRPA 4US9A 4C0ZA 2DBYA 1Z1VA 2KICA 3K4GA 3Q8KA 5KG3A 2LMRA 8ICJA 2W9BB 5D4BA
chains in the Genus database with same CATH topology
5BPCA 5KFXA 2ASJA 5EWFA 3Q8MA 2BQRA 3GV8B 4RQ8A 2FMQA 4ECSA 5J0SA 1KEJA 4C8OA 3LDAA 4MFFA 5DDMA 4UB2A 4ECTA 2BCUA 4JWNA 4C8KA 5KFNA 3MR6A 2J6TA 3KHGA 4YR3A 5KFLA 3MR3A 2RDJA 3PNCA 1ZQWA 1QTMA 8ICNA 3B0YA 4Q45A 1L3SA 1TAUA 1Y88A 3V72A 1BPDA 8ICSA 3MBYA 1DOQA 5CP2A 4M9GA 3V6HA 5KFZA 1U48A 1JX4A 1XSNA 9ICVA 3H7IA 2DPIA 2W9CA 4DF4A 5DB7A 3LWMA 8ICCA 5KFFA 1ZQRA 5KFYA 5J2IA 3T5JA 2XO7A 4UBCA 3EWAA 2VA3A 4NLKA 4J9MA 4DS4A 9ICBA 4IRKA 2HHSA 4LZDA 3JPTA 5KFCA 1XSLA 4ECQA 3SV4A 2BPFA 1HUOA 3BQ2A 2BQ3A 2FLNA 3Q8QB 1T4GA 5IIOA 4I2BA 3EZ5A 5KFSA 5J0WA 2ZTDA 4M6WA 4DQIA 9ICCA 5KT2A 1U47A 3RR7A 1NJXA 4YCXA 1S0OA 5HMLA 2I1QA 4KLSA 4RNOA 4R63A 3AU6A 3TQ1A 8ICQA 4UB4A 9ICXA 2NRTA 4KMUA 5DDYA 4P4OA 4M0AA 2V4RA 5KFMA 2C22A 2PI4A 4R64A 5J2FA 4NM2A 4EEYA 3THVA 1QSLA 3BQTA 4F50A 2NRWA 4KLTA 5EOZA 3JPSA 9ICEA 5DG9A 4QWCA 2HVHA 3T5KA 3LK9A 8ICUA 2BHNA 3H8SA 4XA5A 5KG5A 1NKEA 3PX0A 2IHMA 7ICPA 4RT3A 4I2FA 5CA7A 3KHHA 2R8JA 4B9LA 5EWEA 2ZJAA 9ICKA 4RZRA 4F93B 4J9OA 3LWLA 3M9MB 4YXMA 3H8JA 1BPEA 1ZJNA 4JK1A 4P2HA 1SL2A 2XY6A 2ASDA 4C8NA 1MSWD 4J9QA 5DB9A 4RQ0A 4TUPA 4M04A 4M2YA 1ZQUA 3TFSA 1NK9A 9ICIA 4J9PA 3H40A 5KT5A 3JPPA 4UAYA 3MR5A 2FLPA 3M9NB 5CHGA 4DSFA 4B9UA 7ICVA 3G6XA 4PGQA 9ICQA 5KFVA 5KFKA 1ZQFA 5IIKA 3MDAA 4ECZA 3SV3A 3PX4A 3V6KA 4EBCA 4I28A 4O3NA 4PHEA 1ZQPA 4R66A 4F4YA 2P6UA 3TFRA 1CUKA 2F1IA 2C2RA 1X9MA 1S0MA 1ZQDA 1XSPA 2DFLA 4I2AA 4KLJA 1CEZA 4O3QA 2ATLA 4QZDA 4GXIA 1NJYA 1ZQLA 5J0OA 4J9RA 4C8LA 1A76A 2ISOA 5DB8A 1UT5A 4PHPA 1ZQTA 4KLLA 3NTUA 2ZUCA 4J9SA 2BQUA 4GC6A 4KLIA 2KFNA 3ZDAA 4DSKA 3OHBA 5J0QA 3ZD9A 5IILA 5L1IA 2F1HA 4IRDA 4ZH4A 3V6JA 4YQWA 1U4BA 4I29A 5DQIA 5J2KA 1XWLA 1XO1A 3RB3A 2BR0A 4PHAA 2FPLA 4DFKA 3RB0A 1JN3A 3PMNA 2IBKA 4PGYA 1L3VA 4BDPA 4NY8A 4QWAA 3GQCA 1RPLA 4MFCA 4F5RA 4P4MA 1XU4A 4RNMA 5KFEA 4F5NA 2ISPA 2ZUDA 4F92B 1MQ3A 4ED8A 5KT6A 2DPJA 4HYKA 5D49A 5J2EA 9ICLA 1TKDA 2J6SA 4BWMA 1KDHA 2HHTA 2BCVA 5KFBA 4UAWA 8ICGA 1X9WA 3H8WA 4KN4A 9ICNA 5HHHA 4QZFA 4PHDA 3GDXA 2RDIA 4Z6CA 3GV7B 3OJUA 9ICJA 3UPQA 3HWTA 1L3TA 4YMOA 2J6UA 1NJWA 4BXOB 3BJYA 4FBTA 1UT8A 4UBBA 3FDSA 2FMPA 4YD1A 3BQ1A 5L1LA 1XC9A 5L1KA 1NKCA 4X5VA 4DQSA 4MF8A 1QSSA 1TV9A 5J0PA 4J9LA 2M9NA 4BWJA 4KITB 2HHXA 9ICWA 3QZ7A 4RU9A 3TAQA 2KZ3A 2VANA 1KFDA 3RBDA 2P6RA 4DQPA 2AGQA 8ICPA 4B9NA 3EPIA 1SZPA 3M8RA 5BOMA 5IINA 4Q43A 4JV0A 1D8YA 1D9DA 5CB1A 7ICEA 1TFRA 1SKRA 1BGXT 3C5GA 3C5FA 2JEGA 1JIHA 2BPCA 1EXNA 1S97A 4ECVA 2HHWA 4CCHA 3N97B 3N4MB 3C1ZA 8ICIA 3OGUA 1JXLA 4DFMA 1S0NA 5DG8A 2BCRA 3AUOA 2BCQA 4IR9A 5KFRA 2PFQA 1B22A 3GIJA 4F5OA 5DQHA 4ED2A 3OSNA 2R8IA 4G3IA 5L9XA 5KG0A 1ZJMA 5HNKA 4Q44A 4QWDA 4QZ9A 2IA6A 8ICRA 4IQUA 1T3NA 4RQ5A 4JV1A 4B9TA 1UA0A 1V9PA 4YMNA 4MF2A 3TARA 7ICNA 2XCAA 5KFUA 5J2HA 4F4WA 1COOA 3PW0A 4NLNA 4O3PA 2KZZA 3QEAZ 4DL7A 4UB1A 2FPKA 3JPRA 5KG4A 2AGOA 3SZ2A 4ED0A 7ICGA 5F9NA 3C21A 5IIJA 3RJIA 4C8MA 1ZQOA 4O3SA 1D9FA 4PH5A 2UVRA 4NLGA 3TAPA 2A1JB 4ELUA 8ICXA 4DL3A 2IHNA 5KFJA 4DQQA 3M9OB 4RUAA 4F4KA 9ICRA 1ZQAA 8ICOA 2MUTB 5DBAA 1X9SA 5CWRA 5KFAA 3JPQA 4K4IA 5KFWA 1ZQEA 4JV2A 3GFKB 3UQ2A 4RQ6A 3MFIA 9ICUA 3UXNA 3ISCA 1U45A 3RJHA 4I2GA 4F2SA 5KG2A 4RNNA 1UA1A 3IHQB 1ZQGA 3B0XA 3ZDCA 4YN4A 3HPOA 3SI8A 1PZNA 3PV8A 1S9FA 3HW8A 1K1QA 4KLUA 1QSYA 4QZIA 5J2AA 4F4XA 3Q8RB 2C28A 1L5UA 3KHRA 2OWOA 4I27A 2HVIA 3T3FA 2GWSA 4DWIA 4DSLA 3RRGA 3PW4A 4IQVA 3RH6A 1AROP 5KFPA 3MABA 1ZQCA 2Y1IA 2BPGA 1TK0A 2FMSA 2IMWP 4FBUA 3E2EA 4XRHA 2XCPA 3TANA 2KN7A 4M9JA 8ICYA 3HX0A 2PI5A 4DLEA 1ZYQA 1T7PA 4I2CA 4QZGA 7ICLA 1BPXA 2Q0ZX 4I2EA 3GV5B 2ZJ5A 4RQ2A 1N56A 4PPXA 1ZQXA 5DG7A 4YP3A 3ZD8A 3PVXA 1RXVA 2R8KA 5IIIA 4KLQA 3PX6A 2JZBA 4TQRA 3GILA 4TURA 2MAXA 3ZDDA 1ZQVA 1A77A 3V7JA 3RJKA 4BXOA 3RRHA 1TVAA 4Q8FA 1Z3EB 4EZ6A 2WTFA 3RH5A 1WCLA 2ALZA 1ZQJA 8ICAA 4O0IA 3EYZA 4GC7A 4F3OA 2W9AA 4YFKA 2BGWA 4K4GA 9ICHA 3Q8LA 1S10A 2KZMA 4ECYA 4I2JA 4RQ7A 7ICUA 4QZEA 4QW8A 4DSJA 1Z00B 4BGDA 4ED6A 3PW5A 2W8KA 3SYZA 3JPNA 1S0VA 4J9KA 4EYIB 4QZBA 9ICPA 2ZUBA 4XQ8A 4MEXA 5J0UA 2C2DA 4YXJA 1U49A 4KN7A 1QLNA 7ICMA 4DS5A 3ETLA 2Y1JA 4KLMA 4ECXA 3ZDEA 4KLHA 5KT7A 4RQ3A 5DQGA 3AU2A 4R8UB 4TUQA 3UQ0A 1ZQNA 8ICLA 4Z6EA 3PO5A 1NK4A 4YG2A 4P4PA 4GLXA 5D46A 3MDCA 4I2HA 4Z6FA 5J0TA 3GIKA 3T5HA 2HHVA 7ICHA 4RPXA 8ICFA 4XUSA 3MGHA 4ED1A 1KRPA 4QZ8A 7ICTA 4EYHB 7ICOA 2BKEA 3OSPA 5J2GA 4E0DA 7ICQA 7ICKA 1RYRA 4DL2A 4KLDA 9ICAA 1RZTA 4EZ9A 5EWGA 1SKSA 4EBEA 2PFOA 4R8UA 4J9NA 8ICVA 4M6WB 1NOMA 3HP6A 5CJ7A 5L1JA 3Q8PB 4YD2A 3BDPA 4DEZA 1LB2B 3C2KA 4FO6A 2NRZA 4M47A 5KT3A 1NK6A 4I2IA 3PR4A 2HHQA 2ASLA 5KFTA 1NK0A 4DO9A 4DOCA 3RB6A 5J0YA 3QZ8A 1NKBA 4YMMA 4ECRA 1RXWA 2UVUA 2XC9A 2F1JA 1TAQA 4QZCA 4DL6A 2UVVA 8ICEA 1RYSA 2HW3A 3RJJA 2P66A 3IM1A 2PFNA 2HHUA 1NJZA 8ICZA 4DOBA 5DBCA 3MFHA 3RJFA 5KFOA 3ORYA 7ICIA 5DKWA 4KTQA 1ZQBA 1Z00A 4QWBA 5DLGA 4DL5A 3C23A 3C2MA 3PY8A 4JUZA 1S77D 8ICTA 4JWMA 4YR2A 3H4BA 4QW9A 3UXOA 3EPGA 4O5KA 5HP4A 1ZQHA 5J2JA 4ELTA 1TK8A 2H5XA 1BPZA 1S76D 3OHAA 4F5QA 3NGDA 1ZQZA 1ZQSA 4O5EA 5KTQA 2R8HA 5HHIA 4RT2A 4RQ4A 4LZGA 5J0RA 5JUMA 2XY7A 1H38A 4RUCA 3JPOA 4RQ1A 3PR5B 1WCNA 4O5CA 1SL0A 3RR8A 2W9BA 3FYHA 2AJQA 4IRCA 1B43A 1D8LA 4FS1A 5KFGA 4O3OA 2FLLA 2VA8A 4TUSA 5J29A 2I9GA 9ICSA 4YVZA 4KLOA 3RH4A 4F2RA 1HUZA 2W9CB 3C2LA 4F5PA 4UB3A 3GIIA 5DB6A 1KSPA 1ZQQA 1XS9D 2B21A 4I2DA 5KG6A 3ZDBA 2C2EA 1IM4A 4IR1A 4O9MA 3PW2A 2KFZA 4Q8EA 1BVSA 5IIMA 4M9NA 4DLGA 4B9SA 4F91B 1ZQIA 4LVSA 2MUTA 3RAXA 4PGXA 1SL1A 8ICMA 4DFJA 5DGBA 1C7YA 4MFAA 2AGPA 2ZJ8A 2XGPA 4KLGA 3ISDA 5KG1A 4RPZA 2W8LA 1IXRA 3V7LA 5TZVA 5DBBA 3RB4A 1TK5A 3RAQA 4DF8A 4UQGA 1KFSA 1ZQYA 1KLNA 3PO4A 4EBDA 4M9HA 3GIMA 1N48A 3K75D 4O3RA 2A1JA 4Z6DA 4UB5A 4QZAA 1NK5A 4MEYA 5KFHA 3KHLA 1ZETA 3QE9Y 2UVWA 4F8RA 5HMMA 2V9WA 3T5LA 2FPMA 5J2CA 3V7KA 3RTVA 7ICSA 4K4HA 2ZTCA 5BOLA 8ICBA 5J0XA 4YR0A 4ECWA 2LYHA 2BCSA 2JEFA 4DSIA 1MC8A 7ICRA 1LV5A 2JEJA 1KFTA 4NXZA 1KTQA 1K1SA 2ZTEA 5DGAA 2BDPA 3RJGA 3MGIA 4RPYA 2NRXA 4IQTA 3M8SA 4NLZA 4DL4A 4GXJA 9ICTA 2V4QA 2XY5A 5C5JA 3OJSA 2W9MA 4ED7A 3RBEA 1ZQKA 3TI0A 1NK7A 3KTQA 3ISBA 4ELVA 2R8GA 1DGSA 3G6VA 1HJPA 1NK8A 2JEIA 3PMLA 2AU0A 1BPYA 1U9LA 4QZHA 4KLEA 4DSEA 4IQWA 1T8EA 2AQ4A 3PW7A 2KTQA 4ED3A 1X2IA 5J2BA 4DFPA 4B9MA 7ICFA 4DQRA 4B9VA 2AQ0A 4KLFA 4QWEA 2PFPA 4F4ZA 4NM1A 7ICJA 2NRVA 3BQ0A 1JMSA 2VA2A 5KFQA 5CR0A 3MR2A 4ECUA 1JXEA 3G6YA 5J2DA 3H4DA 3UXPA 3EW9A 1MQ2A 8ICWA 5KFIA 8ICHA 3C1YA 4M9LA 9ICGA 2JZBB 9ICFA 5KG7A 5KFDA 5F9LA 3QEBZ 5KT4A 3HT3A 4GXKA 1ZQMA 4UAZA 3K4GA 9ICMA 4FS2A 4DOAA 3Q8KA 1L3UA 5KG3A 4TQSA 1SKWA 2XGQA 8ICJA 4R65A 3Q8SB 9ICOA 1BPBA 3RJEA 5DLFA 8ICKA 2W9BB 2PXIA 5D4BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BPC A;  5KFX A;  2ASJ A;  5EWF A;  3Q8M A;  2BQR A;  3GV8 B;  4RQ8 A;  2FMQ A;  4ECS A;  5J0S A;  1KEJ A;  4C8O A;  3LDA A;  4MFF A;  5DDM A;  4UB2 A;  4ECT A;  2BCU A;  4JWN A;  4C8K A;  5KFN A;  3MR6 A;  2J6T A;  3KHG A;  4YR3 A;  5KFL A;  3MR3 A;  2RDJ A;  3PNC A;  1ZQW A;  1QTM A;  8ICN A;  3B0Y A;  4Q45 A;  1L3S A;  1TAU A;  1Y88 A;  3V72 A;  1BPD A;  8ICS A;  3MBY A;  1DOQ A;  5CP2 A;  4M9G A;  3V6H A;  5KFZ A;  1U48 A;  1JX4 A;  1XSN A;  9ICV A;  3H7I A;  2DPI A;  2W9C A;  4DF4 A;  5DB7 A;  3LWM A;  8ICC A;  5KFF A;  1ZQR A;  5KFY A;  5J2I A;  3T5J A;  2XO7 A;  4UBC A;  3EWA A;  2VA3 A;  4NLK A;  4J9M A;  4DS4 A;  9ICB A;  4IRK A;  2HHS A;  4LZD A;  3JPT A;  5KFC A;  1XSL A;  4ECQ A;  3SV4 A;  2BPF A;  1HUO A;  3BQ2 A;  2BQ3 A;  2FLN A;  3Q8Q B;  1T4G A;  5IIO A;  4I2B A;  3EZ5 A;  5KFS A;  5J0W A;  2ZTD A;  4M6W A;  4DQI A;  9ICC A;  5KT2 A;  1U47 A;  3RR7 A;  1NJX A;  4YCX A;  1S0O A;  5HML A;  2I1Q A;  4KLS A;  4RNO A;  4R63 A;  3AU6 A;  3TQ1 A;  8ICQ A;  4UB4 A;  9ICX A;  2NRT A;  4KMU A;  5DDY A;  4P4O A;  4M0A A;  2V4R A;  5KFM A;  2C22 A;  2PI4 A;  4R64 A;  5J2F A;  4NM2 A;  4EEY A;  3THV A;  1QSL A;  3BQT A;  4F50 A;  2NRW A;  4KLT A;  5EOZ A;  3JPS A;  9ICE A;  5DG9 A;  4QWC A;  2HVH A;  3T5K A;  3LK9 A;  8ICU A;  2BHN A;  3H8S A;  4XA5 A;  5KG5 A;  1NKE A;  3PX0 A;  2IHM A;  7ICP A;  4RT3 A;  4I2F A;  5CA7 A;  3KHH A;  2R8J A;  4B9L A;  5EWE A;  2ZJA A;  9ICK A;  4RZR A;  4F93 B;  4J9O A;  3LWL A;  3M9M B;  4YXM A;  3H8J A;  1BPE A;  1ZJN A;  4JK1 A;  4P2H A;  1SL2 A;  2XY6 A;  2ASD A;  4C8N A;  1MSW D;  4J9Q A;  5DB9 A;  4RQ0 A;  4TUP A;  4M04 A;  4M2Y A;  1ZQU A;  3TFS A;  1NK9 A;  9ICI A;  4J9P A;  3H40 A;  5KT5 A;  3JPP A;  4UAY A;  3MR5 A;  2FLP A;  3M9N B;  5CHG A;  4DSF A;  4B9U A;  7ICV A;  3G6X A;  4PGQ A;  9ICQ A;  5KFV A;  5KFK A;  1ZQF A;  5IIK A;  3MDA A;  4ECZ A;  3SV3 A;  3PX4 A;  3V6K A;  4EBC A;  4I28 A;  4O3N A;  4PHE A;  1ZQP A;  4R66 A;  4F4Y A;  2P6U A;  3TFR A;  1CUK A;  2F1I A;  2C2R A;  1X9M A;  1S0M A;  1ZQD A;  1XSP A;  2DFL A;  4I2A A;  4KLJ A;  1CEZ A;  4O3Q A;  2ATL A;  4QZD A;  4GXI A;  1NJY A;  1ZQL A;  5J0O A;  4J9R A;  4C8L A;  1A76 A;  2ISO A;  5DB8 A;  1UT5 A;  4PHP A;  1ZQT A;  4KLL A;  3NTU A;  2ZUC A;  4J9S A;  2BQU A;  4GC6 A;  4KLI A;  2KFN A;  3ZDA A;  4DSK A;  3OHB A;  5J0Q A;  3ZD9 A;  5IIL A;  5L1I A;  2F1H A;  4IRD A;  4ZH4 A;  3V6J A;  4YQW A;  1U4B A;  4I29 A;  5DQI A;  5J2K A;  1XWL A;  1XO1 A;  3RB3 A;  2BR0 A;  4PHA A;  2FPL A;  4DFK A;  3RB0 A;  1JN3 A;  3PMN A;  2IBK A;  4PGY A;  1L3V A;  4BDP A;  4NY8 A;  4QWA A;  3GQC A;  1RPL A;  4MFC A;  4F5R A;  4P4M A;  1XU4 A;  4RNM A;  5KFE A;  4F5N A;  2ISP A;  2ZUD A;  4F92 B;  1MQ3 A;  4ED8 A;  5KT6 A;  2DPJ A;  4HYK A;  5D49 A;  5J2E A;  9ICL A;  1TKD A;  2J6S A;  4BWM A;  1KDH A;  2HHT A;  2BCV A;  5KFB A;  4UAW A;  8ICG A;  1X9W A;  3H8W A;  4KN4 A;  9ICN A;  5HHH A;  4QZF A;  4PHD A;  3GDX A;  2RDI A;  4Z6C A;  3GV7 B;  3OJU A;  9ICJ A;  3UPQ A;  3HWT A;  1L3T A;  4YMO A;  2J6U A;  1NJW A;  4BXO B;  3BJY A;  4FBT A;  1UT8 A;  4UBB A;  3FDS A;  2FMP A;  4YD1 A;  3BQ1 A;  5L1L A;  1XC9 A;  5L1K A;  1NKC A;  4X5V A;  4DQS A;  4MF8 A;  1QSS A;  1TV9 A;  5J0P A;  4J9L A;  2M9N A;  4BWJ A;  4KIT B;  2HHX A;  9ICW A;  3QZ7 A;  4RU9 A;  3TAQ A;  2KZ3 A;  2VAN A;  1KFD A;  3RBD A;  2P6R A;  4DQP A;  2AGQ A;  8ICP A;  4B9N A;  3EPI A;  1SZP A;  3M8R A;  5BOM A;  5IIN A;  4Q43 A;  4JV0 A;  1D8Y A;  1D9D A;  5CB1 A;  7ICE A;  1TFR A;  1SKR A;  1BGX T;  3C5G A;  3C5F A;  2JEG A;  1JIH A;  2BPC A;  1EXN A;  1S97 A;  4ECV A;  2HHW A;  4CCH A;  3N97 B;  3N4M B;  3C1Z A;  8ICI A;  3OGU A;  1JXL A;  4DFM A;  1S0N A;  5DG8 A;  2BCR A;  3AUO A;  2BCQ A;  4IR9 A;  5KFR A;  2PFQ A;  1B22 A;  3GIJ A;  4F5O A;  5DQH A;  4ED2 A;  3OSN A;  2R8I A;  4G3I A;  5L9X A;  5KG0 A;  1ZJM A;  5HNK A;  4Q44 A;  4QWD A;  4QZ9 A;  2IA6 A;  8ICR A;  4IQU A;  1T3N A;  4RQ5 A;  4JV1 A;  4B9T A;  1UA0 A;  1V9P A;  4YMN A;  4MF2 A;  3TAR A;  7ICN A;  2XCA A;  5KFU A;  5J2H A;  4F4W A;  1COO A;  3PW0 A;  4NLN A;  4O3P A;  2KZZ A;  3QEA Z;  4DL7 A;  4UB1 A;  2FPK A;  3JPR A;  5KG4 A;  2AGO A;  3SZ2 A;  4ED0 A;  7ICG A;  5F9N A;  3C21 A;  5IIJ A;  3RJI A;  4C8M A;  1ZQO A;  4O3S A;  1D9F A;  4PH5 A;  2UVR A;  4NLG A;  3TAP A;  2A1J B;  4ELU A;  8ICX A;  4DL3 A;  2IHN A;  5KFJ A;  4DQQ A;  3M9O B;  4RUA A;  4F4K A;  9ICR A;  1ZQA A;  8ICO A;  2MUT B;  5DBA A;  1X9S A;  5CWR A;  5KFA A;  3JPQ A;  4K4I A;  5KFW A;  1ZQE A;  4JV2 A;  3GFK B;  3UQ2 A;  4RQ6 A;  3MFI A;  9ICU A;  3UXN A;  3ISC A;  1U45 A;  3RJH A;  4I2G A;  4F2S A;  5KG2 A;  4RNN A;  1UA1 A;  3IHQ B;  1ZQG A;  3B0X A;  3ZDC A;  4YN4 A;  3HPO A;  3SI8 A;  1PZN A;  3PV8 A;  1S9F A;  3HW8 A;  1K1Q A;  4KLU A;  1QSY A;  4QZI A;  5J2A A;  4F4X A;  3Q8R B;  2C28 A;  1L5U A;  3KHR A;  2OWO A;  4I27 A;  2HVI A;  3T3F A;  2GWS A;  4DWI A;  4DSL A;  3RRG A;  3PW4 A;  4IQV A;  3RH6 A;  1ARO P;  5KFP A;  3MAB A;  1ZQC A;  2Y1I A;  2BPG A;  1TK0 A;  2FMS A;  2IMW P;  4FBU A;  3E2E A;  4XRH A;  2XCP A;  3TAN A;  2KN7 A;  4M9J A;  8ICY A;  3HX0 A;  2PI5 A;  4DLE A;  1ZYQ A;  1T7P A;  4I2C A;  4QZG A;  7ICL A;  1BPX A;  2Q0Z X;  4I2E A;  3GV5 B;  2ZJ5 A;  4RQ2 A;  1N56 A;  4PPX A;  1ZQX A;  5DG7 A;  4YP3 A;  3ZD8 A;  3PVX A;  1RXV A;  2R8K A;  5III A;  4KLQ A;  3PX6 A;  2JZB A;  4TQR A;  3GIL A;  4TUR A;  2MAX A;  3ZDD A;  1ZQV A;  1A77 A;  3V7J A;  3RJK A;  4BXO A;  3RRH A;  1TVA A;  4Q8F A;  1Z3E B;  4EZ6 A;  2WTF A;  3RH5 A;  1WCL A;  2ALZ A;  1ZQJ A;  8ICA A;  4O0I A;  3EYZ A;  4GC7 A;  4F3O A;  2W9A A;  4YFK A;  2BGW A;  4K4G A;  9ICH A;  3Q8L A;  1S10 A;  2KZM A;  4ECY A;  4I2J A;  4RQ7 A;  7ICU A;  4QZE A;  4QW8 A;  4DSJ A;  1Z00 B;  4BGD A;  4ED6 A;  3PW5 A;  2W8K A;  3SYZ A;  3JPN A;  1S0V A;  4J9K A;  4EYI B;  4QZB A;  9ICP A;  2ZUB A;  4XQ8 A;  4MEX A;  5J0U A;  2C2D A;  4YXJ A;  1U49 A;  4KN7 A;  1QLN A;  7ICM A;  4DS5 A;  3ETL A;  2Y1J A;  4KLM A;  4ECX A;  3ZDE A;  4KLH A;  5KT7 A;  4RQ3 A;  5DQG A;  3AU2 A;  4R8U B;  4TUQ A;  3UQ0 A;  1ZQN A;  8ICL A;  4Z6E A;  3PO5 A;  1NK4 A;  4YG2 A;  4P4P A;  4GLX A;  5D46 A;  3MDC A;  4I2H A;  4Z6F A;  5J0T A;  3GIK A;  3T5H A;  2HHV A;  7ICH A;  4RPX A;  8ICF A;  4XUS A;  3MGH A;  4ED1 A;  1KRP A;  4QZ8 A;  7ICT A;  4EYH B;  7ICO A;  2BKE A;  3OSP A;  5J2G A;  4E0D A;  7ICQ A;  7ICK A;  1RYR A;  4DL2 A;  4KLD A;  9ICA A;  1RZT A;  4EZ9 A;  5EWG A;  1SKS A;  4EBE A;  2PFO A;  4R8U A;  4J9N A;  8ICV A;  4M6W B;  1NOM A;  3HP6 A;  5CJ7 A;  5L1J A;  3Q8P B;  4YD2 A;  3BDP A;  4DEZ A;  1LB2 B;  3C2K A;  4FO6 A;  2NRZ A;  4M47 A;  5KT3 A;  1NK6 A;  4I2I A;  3PR4 A;  2HHQ A;  2ASL A;  5KFT A;  1NK0 A;  4DO9 A;  4DOC A;  3RB6 A;  5J0Y A;  3QZ8 A;  1NKB A;  4YMM A;  4ECR A;  1RXW A;  2UVU A;  2XC9 A;  2F1J A;  1TAQ A;  4QZC A;  4DL6 A;  2UVV A;  8ICE A;  1RYS A;  2HW3 A;  3RJJ A;  2P66 A;  3IM1 A;  2PFN A;  2HHU A;  1NJZ A;  8ICZ A;  4DOB A;  5DBC A;  3MFH A;  3RJF A;  5KFO A;  3ORY A;  7ICI A;  5DKW A;  4KTQ A;  1ZQB A;  1Z00 A;  4QWB A;  5DLG A;  4DL5 A;  3C23 A;  3C2M A;  3PY8 A;  4JUZ A;  1S77 D;  8ICT A;  4JWM A;  4YR2 A;  3H4B A;  4QW9 A;  3UXO A;  3EPG A;  4O5K A;  5HP4 A;  1ZQH A;  5J2J A;  4ELT A;  1TK8 A;  2H5X A;  1BPZ A;  1S76 D;  3OHA A;  4F5Q A;  3NGD A;  1ZQZ A;  1ZQS A;  4O5E A;  5KTQ A;  2R8H A;  5HHI A;  4RT2 A;  4RQ4 A;  4LZG A;  5J0R A;  5JUM A;  2XY7 A;  1H38 A;  4RUC A;  3JPO A;  4RQ1 A;  3PR5 B;  1WCN A;  4O5C A;  1SL0 A;  3RR8 A;  2W9B A;  3FYH A;  2AJQ A;  4IRC A;  1B43 A;  1D8L A;  4FS1 A;  5KFG A;  4O3O A;  2FLL A;  2VA8 A;  4TUS A;  5J29 A;  2I9G A;  9ICS A;  4YVZ A;  4KLO A;  3RH4 A;  4F2R A;  1HUZ A;  2W9C B;  3C2L A;  4F5P A;  4UB3 A;  3GII A;  5DB6 A;  1KSP A;  1ZQQ A;  1XS9 D;  2B21 A;  4I2D A;  5KG6 A;  3ZDB A;  2C2E A;  1IM4 A;  4IR1 A;  4O9M A;  3PW2 A;  2KFZ A;  4Q8E A;  1BVS A;  5IIM A;  4M9N A;  4DLG A;  4B9S A;  4F91 B;  1ZQI A;  4LVS A;  2MUT A;  3RAX A;  4PGX A;  1SL1 A;  8ICM A;  4DFJ A;  5DGB A;  1C7Y A;  4MFA A;  2AGP A;  2ZJ8 A;  2XGP A;  4KLG A;  3ISD A;  5KG1 A;  4RPZ A;  2W8L A;  1IXR A;  3V7L A;  5TZV A;  5DBB A;  3RB4 A;  1TK5 A;  3RAQ A;  4DF8 A;  4UQG A;  1KFS A;  1ZQY A;  1KLN A;  3PO4 A;  4EBD A;  4M9H A;  3GIM A;  1N48 A;  3K75 D;  4O3R A;  2A1J A;  4Z6D A;  4UB5 A;  4QZA A;  1NK5 A;  4MEY A;  5KFH A;  3KHL A;  1ZET A;  3QE9 Y;  2UVW A;  4F8R A;  5HMM A;  2V9W A;  3T5L A;  2FPM A;  5J2C A;  3V7K A;  3RTV A;  7ICS A;  4K4H A;  2ZTC A;  5BOL A;  8ICB A;  5J0X A;  4YR0 A;  4ECW A;  2LYH A;  2BCS A;  2JEF A;  4DSI A;  1MC8 A;  7ICR A;  1LV5 A;  2JEJ A;  1KFT A;  4NXZ A;  1KTQ A;  1K1S A;  2ZTE A;  5DGA A;  2BDP A;  3RJG A;  3MGI A;  4RPY A;  2NRX A;  4IQT A;  3M8S A;  4NLZ A;  4DL4 A;  4GXJ A;  9ICT A;  2V4Q A;  2XY5 A;  5C5J A;  3OJS A;  2W9M A;  4ED7 A;  3RBE A;  1ZQK A;  3TI0 A;  1NK7 A;  3KTQ A;  3ISB A;  4ELV A;  2R8G A;  1DGS A;  3G6V A;  1HJP A;  1NK8 A;  2JEI A;  3PML A;  2AU0 A;  1BPY A;  1U9L A;  4QZH A;  4KLE A;  4DSE A;  4IQW A;  1T8E A;  2AQ4 A;  3PW7 A;  2KTQ A;  4ED3 A;  1X2I A;  5J2B A;  4DFP A;  4B9M A;  7ICF A;  4DQR A;  4B9V A;  2AQ0 A;  4KLF A;  4QWE A;  2PFP A;  4F4Z A;  4NM1 A;  7ICJ A;  2NRV A;  3BQ0 A;  1JMS A;  2VA2 A;  5KFQ A;  5CR0 A;  3MR2 A;  4ECU A;  1JXE A;  3G6Y A;  5J2D A;  3H4D A;  3UXP A;  3EW9 A;  1MQ2 A;  8ICW A;  5KFI A;  8ICH A;  3C1Y A;  4M9L A;  9ICG A;  2JZB B;  9ICF A;  5KG7 A;  5KFD A;  5F9L A;  3QEB Z;  5KT4 A;  3HT3 A;  4GXK A;  1ZQM A;  4UAZ A;  3K4G A;  9ICM A;  4FS2 A;  4DOA A;  3Q8K A;  1L3U A;  5KG3 A;  4TQS A;  1SKW A;  2XGQ A;  8ICJ A;  4R65 A;  3Q8S B;  9ICO A;  1BPB A;  3RJE A;  5DLF A;  8ICK A;  2W9B B;  2PXI A;  5D4B A; 
#chains in the Genus database with same CATH topology
 3Q8M A;  4ECS A;  1KEJ A;  5DDM A;  2ZIV A;  4C8K A;  5KFN A;  2J6T A;  4DFD A;  1FFV A;  5KFL A;  4OJO A;  1L3S A;  4P0P B;  3V72 A;  1DOQ A;  5CP2 A;  2AXT U;  5KFZ A;  5AK5 A;  2NYV A;  2XO7 A;  4UBC A;  2VA3 A;  9ICB A;  4LZD A;  1XSL A;  4ECQ A;  2VJ4 A;  5AKJ A;  3BQ2 A;  4Y2S A;  1YT3 A;  1UHU A;  5ALM A;  3BS5 B;  1QQ6 A;  9ICC A;  1NJX A;  4KLS A;  5DDY A;  2PI4 A;  3QUB A;  2JRZ A;  3BQT A;  4F50 A;  4KLT A;  4EEK A;  2WHE A;  2YTU A;  5DG9 A;  4QWC A;  2HMX A;  2HVH A;  2LYA A;  3VC8 A;  2IHM A;  1UPH A;  3KZI U;  3KHH A;  1RQN A;  4J9O A;  3LWL A;  3M9M B;  4U7C A;  3H8J A;  1BPE A;  4P2H A;  4JK1 A;  2K8A A;  2ASD A;  4RQ0 A;  4TUP A;  3AQE A;  5KT5 A;  4C80 A;  3MR5 A;  1XNS A;  5CHG A;  2JGA A;  5KFK A;  2XID A;  1ZQF A;  2YMM A;  3CNH A;  4EBC A;  4I28 A;  2QAR B;  2P6U A;  1XSP A;  2W55 A;  4I2A A;  4KLJ A;  3QU7 A;  5J0O A;  4J9R A;  4GC6 A;  3ZDA A;  4DSK A;  5IIL A;  2A3V A;  2F1H A;  4YQW A;  2G0A A;  1PVQ A;  5KAI U;  1XO1 A;  1UQV A;  2FPL A;  1L3V A;  1J97 A;  4GIB A;  1XU4 A;  5KFE A;  1N5X A;  2ZUD A;  4F92 B;  2DPJ A;  2Y0S C;  5D49 A;  4BWM A;  2N1R A;  4UAW A;  1X9W A;  3H8W A;  5J8Y C;  5HHH A;  3OJU A;  3HWT A;  3F53 A;  3BJY A;  3FDS A;  4YD1 A;  3BQ1 A;  4X5V A;  4DQS A;  2WF9 A;  2M9N A;  4KIT B;  1K5O A;  3QUC A;  3QZ7 A;  4LJX A;  4RU9 A;  1S5L U;  2AGQ A;  4B9N A;  1SZP A;  4JV0 A;  3IG8 A;  2HHW A;  2EAO A;  3OGU A;  2BCR A;  3AUO A;  3GIJ A;  3NAS A;  2VIX A;  2HSZ A;  2MSN A;  3OSN A;  2HOF A;  4Q44 A;  4JV1 A;  4RQ5 A;  1DRG A;  2FE9 A;  4NLN A;  5B66 U;  5J2H A;  4O3P A;  3JPR A;  3SZ2 A;  2MA1 A;  7ICG A;  5ALJ A;  2UVR A;  4NLG A;  3N7R C;  2A1J B;  4ELU A;  3KBB A;  1YZ7 A;  5KFJ A;  4DQQ A;  4RUA A;  9ICR A;  1ZQA A;  1SB3 C;  5KFW A;  1ZQE A;  4JV2 A;  5G5H A;  4RQ6 A;  3MFI A;  9ICU A;  3L4P A;  5KG2 A;  1UA1 A;  1F0M A;  3ZDC A;  4YN4 A;  1PVR A;  2E1F A;  3PV8 A;  2HCF A;  1QSY A;  4CDG A;  4I27 A;  3T3F A;  2XI9 A;  1PK3 A;  3K1R B;  3N28 A;  2IMW P;  1TK0 A;  3UMG A;  4UAR A;  8ICY A;  3HX0 A;  1ZYQ A;  1T7P A;  4QZG A;  1BPX A;  1RG6 A;  2ZJ5 A;  4RQ2 A;  1N56 A;  2OM6 A;  2JH1 A;  5AI8 A;  5AIB A;  2R8K A;  5III A;  2W11 A;  3GIL A;  5AI5 A;  4TUR A;  1PVP A;  1A77 A;  3RJK A;  4EZ6 A;  3KOO A;  4F3O A;  4K4G A;  3SEI A;  1S10 A;  4I2J A;  4RQ7 A;  4QZE A;  4DSJ A;  2EAM A;  2HBJ A;  4EYI B;  5ALP A;  4XQ8 A;  3FC4 A;  4MEX A;  2K8B B;  2C2D A;  3CP8 A;  4KN7 A;  3ETL A;  2DUY A;  4ECX A;  5DQG A;  4R8U B;  1ZQN A;  8ICL A;  3UQ0 A;  3PO5 A;  1NK4 A;  4P4P A;  4AP9 A;  3MDC A;  1DK3 A;  3AEV A;  2A1A A;  3AM9 A;  4IC9 A;  3GIK A;  1KRP A;  4QZ8 A;  2G06 A;  3NVV A;  3OSP A;  5JRT A;  5HR6 A;  4DL2 A;  9ICA A;  4PL2 A;  2YX8 A;  3NUQ A;  4EBE A;  3I28 A;  4M6W B;  1OW5 A;  3BDP A;  3AMZ A;  3C2K A;  3IN5 A;  3OTQ A;  1NK0 A;  3O0F A;  3SEN A;  4ECR A;  5B5E U;  2UVU A;  2DKZ A;  5T14 A;  3RJF A;  1WG8 A;  2Z7J A;  1ZRN A;  7ICI A;  1Z19 A;  3ICX A;  3WK4 A;  1ZQB A;  4QWB A;  4US8 A;  4JUZ A;  1S77 D;  4O5K A;  5HP4 A;  1NZP A;  5GTH U;  2H5X A;  2F77 X;  1IG6 A;  3ONN A;  2WF5 A;  2ODG A;  2R8H A;  4RT2 A;  4RQ4 A;  3DDH A;  1FO4 A;  5HR7 A;  2AJQ A;  2K4H A;  3MGV A;  1D8L A;  4O3O A;  2FLL A;  4TUS A;  4QIW C;  5J29 A;  2I9G A;  9ICS A;  4KLO A;  1PUZ A;  3WKC A;  3C2L A;  1ZQ1 C;  2KFZ A;  2C2E A;  2F8K A;  4DLG A;  4B6J A;  1ZQI A;  3WKA A;  4LVS A;  4DFJ A;  5KG1 A;  4RPZ A;  5DBB A;  3RB4 A;  1TK5 A;  4DF8 A;  3H0L B;  4M9H A;  3K1Z A;  2D3D A;  1NK5 A;  1X66 A;  4F8R A;  3T5L A;  2KVC A;  7ICS A;  3ED5 A;  4K4H A;  2HBK A;  5BOL A;  8ICB A;  2JEF A;  4DSI A;  1KFT A;  4NXZ A;  2ZTE A;  2CRX A;  2HBM A;  4IQT A;  3M8S A;  4QJF B;  3TI0 A;  2OCE A;  3ISB A;  2R8G A;  3G6V A;  2EDU A;  1WYG A;  1NK8 A;  2JEI A;  5ALQ A;  1U9L A;  5ALO A;  4QZH A;  4IQW A;  1T8E A;  4JMU A;  3SMV A;  4ED3 A;  4DQR A;  3WK5 A;  4NM1 A;  4QWE A;  2PFP A;  2NRV A;  1JMS A;  1JXE A;  3UXP A;  4G9B A;  3TAD C;  4EX7 A;  9ICF A;  2NO5 A;  3HT3 A;  4UAZ A;  9ICM A;  4FS2 A;  4DOA A;  1O03 A;  2HBL A;  1SKW A;  2XGQ A;  3RJE A;  4ACO A;  3H0R B;  2G09 A;  5KFX A;  2YB1 A;  3SAF A;  5ALW A;  4JWN A;  3KHG A;  4YR3 A;  3MR3 A;  8ICN A;  3B0Y A;  3IDW A;  4UAU A;  2LBO A;  1U48 A;  1JX4 A;  1XSN A;  9ICV A;  1SXE A;  3LWM A;  1FFU A;  5KFY A;  3T5J A;  3EWA A;  4BX9 C;  4J9M A;  3JPT A;  2BPF A;  1RDF A;  1Q3V A;  2WF7 A;  2JMG A;  2FLN A;  1T4G A;  5KFS A;  2R18 A;  1D8B A;  3HKZ C;  3RR7 A;  1S0O A;  1ZD3 A;  4RNO A;  4R63 A;  9ICX A;  4UB4 A;  4P4O A;  1L7M A;  4M0A A;  3D2S A;  5KFM A;  2C22 A;  1MA7 A;  2JXJ A;  3CYM A;  4NM2 A;  2E5S A;  2HI0 A;  3NVW A;  3T5K A;  5EE3 A;  3EUB 2;  1NKE A;  3H8S A;  7ICP A;  4I2F A;  2R8J A;  4FFD A;  5AKH A;  1Q8K A;  4YXM A;  3I76 A;  4OCZ A;  4Y2U A;  2B6G A;  1SL2 A;  2RLT A;  1KBU A;  4J9Q A;  2DF4 B;  4BUG A;  4M2Y A;  9ICI A;  4J9P A;  3H40 A;  3JPP A;  4UAY A;  5EE1 A;  2FLP A;  3M9N B;  4DSF A;  2E8P A;  1RYU A;  4B9U A;  4CF5 A;  2FJ6 A;  5KFV A;  5ALX A;  4O3N A;  4PHE A;  4F4Y A;  2KIW A;  3TFR A;  2C2R A;  1L8O A;  1ZQD A;  1SV0 A;  2DFL A;  2ATL A;  4PL1 A;  4QZD A;  4GXI A;  1A76 A;  5DB8 A;  4U6P A;  4PHP A;  3NTU A;  2ZUC A;  4KLI A;  3OHB A;  1C20 A;  4IRD A;  1U4B A;  5J2K A;  5AHX A;  4QNL A;  1XWL A;  3RB3 A;  1Z1B A;  2XVT A;  4PHA A;  4DFK A;  2CPR A;  1URJ A;  4PGY A;  1NZB A;  3GQC A;  4MFC A;  4P4M A;  2W3S A;  1MQ3 A;  2BDU A;  2ZIU A;  4HYK A;  4KX5 A;  5KFB A;  4J03 A;  4KN4 A;  2JV3 A;  3GV7 B;  4Y2V A;  4BXO B;  2J6U A;  4FBT A;  2QLT A;  4UBB A;  5L1L A;  1XC9 A;  3LVW A;  1QSS A;  3L5K A;  5EE9 A;  4BWJ A;  2KHV A;  9ICW A;  3TAD A;  3T79 A;  3NRZ A;  2P6R A;  3RBD A;  4DQP A;  1KFD A;  3B9J A;  3M8R A;  5BOM A;  3HJE A;  5CB1 A;  7ICE A;  3C5G A;  2BPC A;  1S97 A;  4CCH A;  3C1Z A;  8ICI A;  4DFM A;  5DG8 A;  1B22 A;  4G3I A;  2Y9U A;  5HNK A;  8ICR A;  8ICQ A;  3TKA A;  1T3N A;  1UA0 A;  1V9P A;  5KFU A;  2KSO A;  4BJQ A;  5F9N A;  3C21 A;  5AM5 A;  4C8M A;  4O3S A;  4PH5 A;  8ICX A;  3QU2 A;  3PZP A;  2MUT B;  5CWR A;  5KFA A;  3JPQ A;  4K4I A;  3IP4 B;  4F2S A;  3RJH A;  1L6N A;  1MN8 A;  4RNN A;  2IOF A;  1ZQG A;  3IHQ B;  1PZN A;  1NI3 A;  1V97 A;  1S9F A;  3WK6 A;  4KLU A;  3Q8R B;  2YB4 A;  3KHR A;  4RQM A;  2HVI A;  3FM9 A;  3RRG A;  5KFP A;  1S0V A;  3MAB A;  1ZQC A;  4XRH A;  1ZD4 A;  3H8M A;  2Q0Z X;  5ALL A;  1FEZ A;  2KJ5 A;  5DG7 A;  1PK1 B;  3UMC A;  5L1M A;  3ZD8 A;  3PVX A;  1RXV A;  3KZX A;  3PX6 A;  2DWQ A;  3V7J A;  4BXO A;  1TVA A;  1Z3E B;  2WTF A;  2ALZ A;  3EYZ A;  1RM6 C;  4O0I A;  4GC7 A;  4YFK A;  1Z4N A;  5ALS A;  4BGD A;  3E58 A;  4ED6 A;  2E3T A;  2RRD A;  3C29 A;  3JPN A;  5AI9 A;  4NWI A;  1KKX A;  9ICP A;  2ZUB A;  1DXS A;  2Q4T A;  3SD7 A;  2OH2 A;  3ZDE A;  4RQ3 A;  5ALE A;  4TUQ A;  4GLX A;  5D46 A;  4Z6F A;  3WK9 A;  2HHV A;  8ICF A;  4C4T A;  4E0D A;  4KLD A;  1RZT A;  1TAM A;  2PFO A;  2HOQ A;  8ICV A;  3HP6 A;  5CJ7 A;  2K8C B;  5L1J A;  3Q8P B;  4P0Q B;  5EE0 A;  4DEZ A;  2H3I A;  1NK6 A;  4QIW F;  3PR4 A;  5KFT A;  2ESE A;  4DO9 A;  4DOC A;  5J0Y A;  1RXW A;  2F1J A;  4DL6 A;  2UVV A;  2G5H B;  3RJJ A;  3PST A;  3WKE A;  2HHU A;  3M6K A;  2LYB A;  3MFH A;  5ALG A;  4UW9 A;  5DKW A;  2RP5 A;  4KTQ A;  5DLG A;  4QW9 A;  3EPG A;  3F5A A;  2F44 A;  1ZQH A;  3CRX A;  1TK8 A;  3A0B U;  3OHA A;  3D6J A;  2LPE A;  3NGD A;  1ZQZ A;  1JRO A;  4LZG A;  5AKE A;  4RUC A;  3PR5 B;  1WCN A;  3AN1 A;  1SL0 A;  3RR8 A;  3FYH A;  1WUD A;  4FS1 A;  5KFG A;  2QKQ A;  2IOH A;  2VA8 A;  4F2R A;  3IV6 A;  2W9C B;  4UB3 A;  4EX6 A;  5DB6 A;  1XS9 D;  9ICK A;  4O9M A;  1SWW A;  2OHF A;  3QU5 A;  2KJ9 A;  1BVS A;  4B9S A;  1N63 A;  4F91 B;  2MUT A;  3RAX A;  4PGX A;  1C7Y A;  4KLG A;  3ISD A;  5TZV A;  4UQG A;  3F2B A;  3PO4 A;  4EBD A;  3K75 D;  2A1J A;  3NRW A;  4UB5 A;  3H0M B;  1SV0 C;  4MEY A;  5ALN A;  5HMM A;  2B0C A;  2V9W A;  5J2C A;  3QU9 A;  3RTV A;  1A6S A;  3MC1 A;  2BCS A;  1MC8 A;  1KTQ A;  1K1S A;  5DGA A;  5AK4 A;  2NRX A;  9ICT A;  4IS7 A;  2XY5 A;  3OJS A;  2KIV A;  1ZQK A;  1DGS A;  1SIJ A;  2O6K A;  2AU0 A;  4KLE A;  2AQ4 A;  4O3M A;  1T3Q A;  2VA2 A;  1N61 A;  1NNL A;  5C0Y A;  4ECU A;  2OXO A;  3EW9 A;  4PJ0 U;  5KFI A;  3M6Z A;  2JZB B;  2HDO A;  5F9L A;  5KT4 A;  4P0P A;  2ZIX B;  2WFA A;  4R65 A;  3Q8S B;  1BPB A;  5DLF A;  3SR6 A;  5A0L A;  2F76 X;  1HIW A;  5BPC A;  4EEL A;  2ASJ A;  4RQ8 A;  5J0S A;  4C8O A;  5AKG A;  3LDA A;  4UB2 A;  4ECT A;  2RDJ A;  5AKI A;  1ZQW A;  4Q45 A;  1T94 A;  1TAU A;  1Y88 A;  1BPD A;  3N7S C;  2DPI A;  1FIQ A;  2W9C A;  4DF4 A;  1JUD A;  1ZQR A;  4DS4 A;  5KFC A;  2ZIV B;  1HUO A;  2VJ5 A;  5CEH A;  5TIS U;  4NLB A;  3WU2 U;  2BQ3 A;  3DV9 A;  5IIO A;  2LKY A;  3EZ5 A;  3E0F A;  1U47 A;  2ZIX A;  2I1Q A;  3TQ1 A;  2NRT A;  4KMU A;  1L7N A;  5J2F A;  4EEY A;  3THV A;  2NRW A;  1ZRM A;  5EOZ A;  3JPS A;  8ICU A;  3PX0 A;  4RT3 A;  4RZR A;  5DB9 A;  4M04 A;  1ZQU A;  2LM4 A;  2KSO B;  3PX4 A;  4UAS A;  1ZQP A;  4R66 A;  2F1I A;  4C7Y A;  2WAQ C;  2DQN B;  1ZQL A;  2CXY A;  4GFJ A;  1ZQT A;  4KLL A;  5AM0 A;  5ALI A;  4J9S A;  2BQU A;  5J0Q A;  3ZD9 A;  2LM1 A;  3V6J A;  4I29 A;  5DQI A;  3IG5 A;  3RB0 A;  2IBK A;  4KMO B;  4UAV A;  4BDP A;  4NY8 A;  4QWA A;  2ISP A;  4ED8 A;  4Y2R A;  3I1Y A;  5AIC A;  5F3X B;  9ICL A;  1KDH A;  2BCV A;  2FI1 A;  1N5W A;  2W3R A;  9ICN A;  4QZF A;  3WK8 A;  2RDI A;  1S8O A;  1CRX A;  3UPQ A;  4JB3 A;  4WJ3 B;  3KFU F;  2FMP A;  2W03 A;  1NKC A;  5L1K A;  2QB0 A;  1TV9 A;  5J0P A;  2HHX A;  3TAQ A;  5IIN A;  4Q43 A;  5KL8 B;  1SKR A;  1BGX T;  3C5F A;  4ECV A;  3N97 B;  3N4M B;  1S0N A;  2BCQ A;  2H3V A;  4IR9 A;  5KFR A;  2PFQ A;  2JHD A;  1X6J A;  5DQH A;  4ED2 A;  5L9X A;  5J8Y A;  4USA A;  3QX7 A;  4B9T A;  4MF2 A;  2QB1 A;  2XIC A;  1COO A;  3A0H U;  3QEA Z;  3AL0 B;  3QUQ A;  2FPK A;  2AGO A;  3WK7 A;  4ED0 A;  5IIJ A;  4KX3 A;  4NL9 C;  2KE7 A;  1ECW A;  5JTI A;  4DL3 A;  3M9O B;  1X9S A;  3UQ2 A;  2W7P A;  2EQY A;  3ISC A;  1U45 A;  1AQ6 A;  4I2G A;  1VLB A;  3B0X A;  1ZXI A;  2K60 A;  3HW8 A;  3S6J A;  4QZI A;  5J2A A;  4F4X A;  2C28 A;  2OWO A;  2KHQ A;  1O08 A;  2E8O A;  4DSL A;  2F3N A;  4DWI A;  4IQV A;  2BPG A;  2FMS A;  4FBU A;  2Y1I A;  2PMZ C;  3E2E A;  3TAN A;  2PI5 A;  4DLE A;  1ZOL A;  2E1E A;  3GZF A;  2W04 A;  4I2E A;  3GV5 B;  3BS5 A;  4PPX A;  1ZQX A;  4YP3 A;  4KLQ A;  2MAX A;  3N7P D;  3QUT A;  4AYB C;  4FZL A;  3RRH A;  2ZG6 A;  5AM2 A;  1WCL A;  1QCK A;  8ICA A;  4OO1 J;  2QB0 B;  2W9A A;  3Q8L A;  2FDR A;  4ECY A;  7ICU A;  4QW8 A;  1IIP A;  1Z00 B;  2ZIU B;  4MHV A;  4AYB F;  3SYZ A;  5KL1 B;  3F2D A;  4DCC A;  2M0N A;  5FP0 A;  4QZB A;  5AKY A;  5J0U A;  1U49 A;  1QLN A;  3BZC A;  2Y1J A;  2KD1 A;  5KT7 A;  1KQQ A;  5ALH A;  4FE3 A;  3UM9 A;  1SXD A;  3M7D A;  3T5H A;  4HAI A;  4RPX A;  4ED1 A;  5K4L A;  7ICT A;  4EYH B;  7ICO A;  7ICQ A;  5H2F U;  3HIL A;  1RYR A;  4EZ9 A;  4EEN A;  1SKS A;  1B0X A;  4R8U A;  4J9N A;  5AK6 A;  1NOM A;  5AKL A;  4YD2 A;  1LB2 B;  4FO6 A;  2NRZ A;  5KT3 A;  4PZN A;  2ASL A;  3LVV A;  3QZ8 A;  1NKB A;  4YMM A;  2PMZ F;  4UAT A;  1TAQ A;  4QZC A;  8ICE A;  4UB6 U;  1RYS A;  2HW3 A;  2P66 A;  1JI7 A;  2PFN A;  4Y2Y A;  4CF4 A;  8ICZ A;  4DOB A;  1RQL A;  2D8C A;  2YQE A;  3ORY A;  1Z00 A;  3NVZ A;  3C23 A;  3C2M A;  8ICT A;  4JWM A;  4YR2 A;  3UXO A;  1N62 A;  3KD3 A;  1LVH A;  1KL9 A;  1L7O A;  2KG5 A;  5HHI A;  4OJ6 A;  5J0R A;  5JUM A;  2XY7 A;  3LYS A;  3JPO A;  4RQ1 A;  4O5C A;  5G5G A;  2YMP A;  4CRX A;  3RF9 A;  4IRC A;  1B43 A;  5CRX A;  1VDV A;  1HUZ A;  4ICA A;  4ZOH C;  4F5P A;  4OD0 A;  3GII A;  1KSP A;  1QH9 A;  3ZDB A;  2B21 A;  5KG6 A;  3PW2 A;  2DKX A;  5IIM A;  4M9N A;  5AI0 A;  3WKD A;  2I5H A;  8ICM A;  3ETR A;  5DGB A;  2AGP A;  2ZJ8 A;  3L3F X;  3V7L A;  3RAQ A;  1KFS A;  2KVS A;  1ZQY A;  3GIM A;  1N48 A;  5KFH A;  3KHL A;  1LKY B;  1ZET A;  3QE9 Y;  2KP7 A;  1YZ6 A;  2FPM A;  1J2N A;  2ZTC A;  5J0X A;  4ECW A;  2LYH A;  7ICR A;  1LV5 A;  2JEJ A;  3UMB A;  3MGI A;  4NLZ A;  4GXJ A;  2V4Q A;  5C5J A;  3RBE A;  2W9M A;  4OJP A;  1NK7 A;  3KTQ A;  4ELV A;  3J81 j;  1HJP A;  2NO4 A;  1BPY A;  3CW2 C;  3PW7 A;  1L7P A;  1X2I A;  4C4S A;  4DFP A;  4B9M A;  7ICF A;  2DL0 A;  2AQ0 A;  7ICJ A;  5KFQ A;  2AHO B;  3G6Y A;  3H4D A;  1MQ2 A;  1SGG A;  8ICH A;  3C1Y A;  9ICG A;  5KG7 A;  3C28 A;  5KFD A;  1X40 A;  3QEB Z;  1GO3 F;  1KW4 A;  4GXK A;  1ZQM A;  2IOF K;  2EH9 A;  1L3U A;  4TQS A;  5ALT A;  3KKA A;  3QNM A;  8ICK A;  2PXI A;  4NV0 A;  3PSI A;  4A8E A;  5EWF A;  2BQR A;  1TE2 A;  3GV8 B;  3NVY A;  2FMQ A;  2KV2 A;  4MFF A;  1ZD2 P;  2BCU A;  4C4R A;  3MR6 A;  2ZXH A;  1QTM A;  3PNC A;  8ICS A;  3MBY A;  2KNJ A;  4M9G A;  3V6H A;  2OYY A;  2H3Z A;  3H7I A;  1X42 A;  1Q3U A;  2EZY A;  8ICC A;  5AM3 A;  5DB7 A;  2W43 A;  5KFF A;  5J2I A;  1P7D A;  4NLK A;  4IRK A;  2HHS A;  5ALF A;  3SV4 A;  2K89 A;  3Q8Q B;  4I2B A;  3M1Y A;  5J0W A;  4P0Q A;  2ZTD A;  2EAN A;  4F72 A;  4M6W A;  4DQI A;  5KT2 A;  5JU5 A;  5AI4 A;  4YCX A;  2YN4 A;  5HML A;  4NL9 A;  3AU6 A;  5ALV A;  2V4R A;  3R9K A;  4R64 A;  1WWU A;  1QSL A;  1SZH A;  2NV3 A;  9ICE A;  2RQ5 A;  3D2Q A;  3LK9 A;  5AKK A;  2BZF A;  2BHN A;  4XA5 A;  5KG5 A;  5CA7 A;  1OUQ A;  4B9L A;  4Y2Q A;  5EWE A;  2ZJA A;  4F93 B;  1UCV A;  1ZJN A;  4NLC A;  2XY6 A;  2YMQ A;  4C8N A;  4CF3 A;  1MSW D;  3TFS A;  1NK9 A;  3F5E A;  2E8M A;  7ICV A;  2GO7 A;  4PGQ A;  3G6X A;  9ICQ A;  5IIK A;  3MDA A;  4ECZ A;  3SV3 A;  3V6K A;  2MU2 A;  4Y2X A;  1X9M A;  1CUK A;  1S0M A;  5AM1 A;  1SWV A;  5AKZ A;  1CEZ A;  4O3Q A;  1NJY A;  4C8L A;  2ISO A;  1UT5 A;  4C7Z A;  2KFN A;  1J2M A;  5L1I A;  2VKQ A;  2KMD A;  4ZH4 A;  2K4I A;  2WB1 F;  1KN5 A;  2BR0 A;  5AIA A;  1JN3 A;  3PMN A;  5AKX A;  2K4P A;  1RPL A;  2KKV A;  4F5R A;  4UB8 U;  3DEE A;  4RNM A;  4F5N A;  2KKP A;  5KT6 A;  5AI6 A;  5J2E A;  1TKD A;  2J6S A;  8ICG A;  5ALZ A;  1N2X A;  4PHD A;  3GDX A;  4RQN A;  4Z6C A;  1M6Y A;  9ICJ A;  2ZIW A;  1L3T A;  4YMO A;  1NJW A;  1UT8 A;  5AM4 A;  4MF8 A;  2QAR A;  4J9L A;  2RHF A;  4NJ8 A;  9ICO A;  2KZ3 A;  2VAN A;  1V38 A;  2CN1 A;  8ICP A;  2GH1 A;  1WWV A;  3EPI A;  1D8Y A;  2HHT A;  1D9D A;  1TFR A;  1F5S A;  2JEG A;  1JIH A;  1Q46 A;  2DGZ A;  2GOL A;  1EXN A;  1BNO A;  1JXL A;  2YY6 A;  4F5O A;  3FAH A;  2KOB A;  2R8I A;  3ZI4 A;  5KG0 A;  4Y2J A;  1ZJM A;  4QWD A;  4QZ9 A;  2IA6 A;  2JH7 A;  4IQU A;  2WF6 A;  4YMN A;  2Y0S F;  3TAR A;  7ICN A;  2XCA A;  3PW0 A;  4F4W A;  2KZZ A;  4DL7 A;  4UB1 A;  3OPX A;  1F44 A;  5KG4 A;  3RJI A;  1ZQO A;  2ZXI A;  1D9F A;  3D2N A;  2P35 A;  3TAP A;  2ES6 A;  3HRD D;  2IHN A;  1X9X A;  4F4K A;  8ICO A;  5DBA A;  3GFK B;  3UXN A;  3SI8 A;  3HPO A;  1K1Q A;  1L5U A;  4Y2T A;  2GWS A;  3PW4 A;  3RH6 A;  1ARO P;  2JR5 A;  2XCP A;  2W54 A;  2KN7 A;  4M9J A;  4Y2P A;  4I2C A;  7ICL A;  3NS1 A;  2JZB A;  3PSP A;  4TQR A;  3ZDD A;  1ZQV A;  1DGJ A;  2GLE A;  4Q8F A;  3RH5 A;  4OJL A;  1ZQJ A;  1A0P A;  2EZX A;  1QQ5 A;  5ALU A;  2BGW A;  9ICH A;  2KZM A;  2H3F A;  2H3Q A;  3ALR A;  2ZIW B;  1L8L A;  3PW5 A;  1V85 A;  2W8K A;  1OXJ A;  4J9K A;  2A19 A;  3PSF A;  4IL6 U;  3SAH A;  4YXJ A;  7ICM A;  4DS5 A;  4KLM A;  1B4F A;  4KLH A;  3AU2 A;  2YML A;  5ALD A;  2E8N A;  5ALR A;  4Z6E A;  2HOI A;  1ED1 A;  4YG2 A;  4I2H A;  2WF8 A;  3QXG A;  5J0T A;  2F2A B;  7ICH A;  5AK3 A;  5KAF U;  4XUS A;  3MGH A;  2BKE A;  2AH5 A;  5J2G A;  1HEK A;  7ICK A;  4CGZ A;  4FZN A;  1N60 A;  2WAQ F;  5EWG A;  3BS7 A;  1VJ5 A;  3SQI A;  4M47 A;  3GU3 A;  4OJ5 A;  4I2I A;  2HHQ A;  3RB6 A;  2WB1 C;  2F8L A;  4CE6 A;  4F71 A;  2XC9 A;  5KNI A;  3SAG A;  2L5Y A;  5GTI U;  3BQ7 A;  3IM1 A;  1NJZ A;  3KKA C;  5DBC A;  5KFO A;  1XO0 A;  2G5I B;  1DK2 A;  4DL5 A;  1IV8 A;  3PY8 A;  2I6X A;  3H4B A;  1QQ7 A;  5J2J A;  4ELT A;  1PK1 A;  1BPZ A;  2MRL A;  1S76 D;  4F5Q A;  2LI6 A;  1Z4O A;  1ZQS A;  3AQF A;  4O5E A;  5KTQ A;  2EAP A;  2EZZ A;  1H38 A;  3IRU A;  2PKE A;  2W9B A;  3QYP A;  1CI4 A;  5ALY A;  4YVZ A;  3RH4 A;  2W7O A;  3U26 A;  1ZQQ A;  4I2D A;  1IM4 A;  4IR1 A;  2G08 A;  4Q8E A;  3BZK A;  2D6F C;  1SL1 A;  4MFA A;  2XGP A;  2KEY A;  3WKB A;  1IXR A;  2W8L A;  1SV4 A;  3VCB A;  4CNQ A;  3HKZ F;  1KLN A;  4O3R A;  5ALK A;  4Z6D A;  5E79 U;  4QZA A;  4FZM A;  2UVW A;  3F2C A;  3V7K A;  4YR0 A;  2BDP A;  3RJG A;  4RPY A;  2K4E A;  4DL4 A;  4ED7 A;  1LKY A;  2Y9T A;  3QU4 A;  2KK0 A;  2OEH A;  1COK A;  3PML A;  4PZO A;  2KJ8 A;  4DSE A;  3RFA A;  1BNP A;  1JAL A;  2KTQ A;  5J2B A;  4B9V A;  4KLF A;  1ZD5 A;  4F4Z A;  3BQ0 A;  2G07 A;  1X6I A;  3TAC B;  5CR0 A;  3MR2 A;  5J2D A;  8ICW A;  2LHT A;  4M9L A;  1JRP A;  4US9 A;  4C0Z A;  2DBY A;  1Z1V A;  2KIC A;  3K4G A;  3Q8K A;  5KG3 A;  2LMR A;  8ICJ A;  2W9B B;  5D4B A; 
#chains in the Genus database with same CATH homology
 5BPC A;  5KFX A;  2ASJ A;  5EWF A;  3Q8M A;  2BQR A;  3GV8 B;  4RQ8 A;  2FMQ A;  4ECS A;  5J0S A;  1KEJ A;  4C8O A;  3LDA A;  4MFF A;  5DDM A;  4UB2 A;  4ECT A;  2BCU A;  4JWN A;  4C8K A;  5KFN A;  3MR6 A;  2J6T A;  3KHG A;  4YR3 A;  5KFL A;  3MR3 A;  2RDJ A;  3PNC A;  1ZQW A;  1QTM A;  8ICN A;  3B0Y A;  4Q45 A;  1L3S A;  1TAU A;  1Y88 A;  3V72 A;  1BPD A;  8ICS A;  3MBY A;  1DOQ A;  5CP2 A;  4M9G A;  3V6H A;  5KFZ A;  1U48 A;  1JX4 A;  1XSN A;  9ICV A;  3H7I A;  2DPI A;  2W9C A;  4DF4 A;  5DB7 A;  3LWM A;  8ICC A;  5KFF A;  1ZQR A;  5KFY A;  5J2I A;  3T5J A;  2XO7 A;  4UBC A;  3EWA A;  2VA3 A;  4NLK A;  4J9M A;  4DS4 A;  9ICB A;  4IRK A;  2HHS A;  4LZD A;  3JPT A;  5KFC A;  1XSL A;  4ECQ A;  3SV4 A;  2BPF A;  1HUO A;  3BQ2 A;  2BQ3 A;  2FLN A;  3Q8Q B;  1T4G A;  5IIO A;  4I2B A;  3EZ5 A;  5KFS A;  5J0W A;  2ZTD A;  4M6W A;  4DQI A;  9ICC A;  5KT2 A;  1U47 A;  3RR7 A;  1NJX A;  4YCX A;  1S0O A;  5HML A;  2I1Q A;  4KLS A;  4RNO A;  4R63 A;  3AU6 A;  3TQ1 A;  8ICQ A;  4UB4 A;  9ICX A;  2NRT A;  4KMU A;  5DDY A;  4P4O A;  4M0A A;  2V4R A;  5KFM A;  2C22 A;  2PI4 A;  4R64 A;  5J2F A;  4NM2 A;  4EEY A;  3THV A;  1QSL A;  3BQT A;  4F50 A;  2NRW A;  4KLT A;  5EOZ A;  3JPS A;  9ICE A;  5DG9 A;  4QWC A;  2HVH A;  3T5K A;  3LK9 A;  8ICU A;  2BHN A;  3H8S A;  4XA5 A;  5KG5 A;  1NKE A;  3PX0 A;  2IHM A;  7ICP A;  4RT3 A;  4I2F A;  5CA7 A;  3KHH A;  2R8J A;  4B9L A;  5EWE A;  2ZJA A;  9ICK A;  4RZR A;  4F93 B;  4J9O A;  3LWL A;  3M9M B;  4YXM A;  3H8J A;  1BPE A;  1ZJN A;  4JK1 A;  4P2H A;  1SL2 A;  2XY6 A;  2ASD A;  4C8N A;  1MSW D;  4J9Q A;  5DB9 A;  4RQ0 A;  4TUP A;  4M04 A;  4M2Y A;  1ZQU A;  3TFS A;  1NK9 A;  9ICI A;  4J9P A;  3H40 A;  5KT5 A;  3JPP A;  4UAY A;  3MR5 A;  2FLP A;  3M9N B;  5CHG A;  4DSF A;  4B9U A;  7ICV A;  3G6X A;  4PGQ A;  9ICQ A;  5KFV A;  5KFK A;  1ZQF A;  5IIK A;  3MDA A;  4ECZ A;  3SV3 A;  3PX4 A;  3V6K A;  4EBC A;  4I28 A;  4O3N A;  4PHE A;  1ZQP A;  4R66 A;  4F4Y A;  2P6U A;  3TFR A;  1CUK A;  2F1I A;  2C2R A;  1X9M A;  1S0M A;  1ZQD A;  1XSP A;  2DFL A;  4I2A A;  4KLJ A;  1CEZ A;  4O3Q A;  2ATL A;  4QZD A;  4GXI A;  1NJY A;  1ZQL A;  5J0O A;  4J9R A;  4C8L A;  1A76 A;  2ISO A;  5DB8 A;  1UT5 A;  4PHP A;  1ZQT A;  4KLL A;  3NTU A;  2ZUC A;  4J9S A;  2BQU A;  4GC6 A;  4KLI A;  2KFN A;  3ZDA A;  4DSK A;  3OHB A;  5J0Q A;  3ZD9 A;  5IIL A;  5L1I A;  2F1H A;  4IRD A;  4ZH4 A;  3V6J A;  4YQW A;  1U4B A;  4I29 A;  5DQI A;  5J2K A;  1XWL A;  1XO1 A;  3RB3 A;  2BR0 A;  4PHA A;  2FPL A;  4DFK A;  3RB0 A;  1JN3 A;  3PMN A;  2IBK A;  4PGY A;  1L3V A;  4BDP A;  4NY8 A;  4QWA A;  3GQC A;  1RPL A;  4MFC A;  4F5R A;  4P4M A;  1XU4 A;  4RNM A;  5KFE A;  4F5N A;  2ISP A;  2ZUD A;  4F92 B;  1MQ3 A;  4ED8 A;  5KT6 A;  2DPJ A;  4HYK A;  5D49 A;  5J2E A;  9ICL A;  1TKD A;  2J6S A;  4BWM A;  1KDH A;  2HHT A;  2BCV A;  5KFB A;  4UAW A;  8ICG A;  1X9W A;  3H8W A;  4KN4 A;  9ICN A;  5HHH A;  4QZF A;  4PHD A;  3GDX A;  2RDI A;  4Z6C A;  3GV7 B;  3OJU A;  9ICJ A;  3UPQ A;  3HWT A;  1L3T A;  4YMO A;  2J6U A;  1NJW A;  4BXO B;  3BJY A;  4FBT A;  1UT8 A;  4UBB A;  3FDS A;  2FMP A;  4YD1 A;  3BQ1 A;  5L1L A;  1XC9 A;  5L1K A;  1NKC A;  4X5V A;  4DQS A;  4MF8 A;  1QSS A;  1TV9 A;  5J0P A;  4J9L A;  2M9N A;  4BWJ A;  4KIT B;  2HHX A;  9ICW A;  3QZ7 A;  4RU9 A;  3TAQ A;  2KZ3 A;  2VAN A;  1KFD A;  3RBD A;  2P6R A;  4DQP A;  2AGQ A;  8ICP A;  4B9N A;  3EPI A;  1SZP A;  3M8R A;  5BOM A;  5IIN A;  4Q43 A;  4JV0 A;  1D8Y A;  1D9D A;  5CB1 A;  7ICE A;  1TFR A;  1SKR A;  1BGX T;  3C5G A;  3C5F A;  2JEG A;  1JIH A;  2BPC A;  1EXN A;  1S97 A;  4ECV A;  2HHW A;  4CCH A;  3N97 B;  3N4M B;  3C1Z A;  8ICI A;  3OGU A;  1JXL A;  4DFM A;  1S0N A;  5DG8 A;  2BCR A;  3AUO A;  2BCQ A;  4IR9 A;  5KFR A;  2PFQ A;  1B22 A;  3GIJ A;  4F5O A;  5DQH A;  4ED2 A;  3OSN A;  2R8I A;  4G3I A;  5L9X A;  5KG0 A;  1ZJM A;  5HNK A;  4Q44 A;  4QWD A;  4QZ9 A;  2IA6 A;  8ICR A;  4IQU A;  1T3N A;  4RQ5 A;  4JV1 A;  4B9T A;  1UA0 A;  1V9P A;  4YMN A;  4MF2 A;  3TAR A;  7ICN A;  2XCA A;  5KFU A;  5J2H A;  4F4W A;  1COO A;  3PW0 A;  4NLN A;  4O3P A;  2KZZ A;  3QEA Z;  4DL7 A;  4UB1 A;  2FPK A;  3JPR A;  5KG4 A;  2AGO A;  3SZ2 A;  4ED0 A;  7ICG A;  5F9N A;  3C21 A;  5IIJ A;  3RJI A;  4C8M A;  1ZQO A;  4O3S A;  1D9F A;  4PH5 A;  2UVR A;  4NLG A;  3TAP A;  2A1J B;  4ELU A;  8ICX A;  4DL3 A;  2IHN A;  5KFJ A;  4DQQ A;  3M9O B;  4RUA A;  4F4K A;  9ICR A;  1ZQA A;  8ICO A;  2MUT B;  5DBA A;  1X9S A;  5CWR A;  5KFA A;  3JPQ A;  4K4I A;  5KFW A;  1ZQE A;  4JV2 A;  3GFK B;  3UQ2 A;  4RQ6 A;  3MFI A;  9ICU A;  3UXN A;  3ISC A;  1U45 A;  3RJH A;  4I2G A;  4F2S A;  5KG2 A;  4RNN A;  1UA1 A;  3IHQ B;  1ZQG A;  3B0X A;  3ZDC A;  4YN4 A;  3HPO A;  3SI8 A;  1PZN A;  3PV8 A;  1S9F A;  3HW8 A;  1K1Q A;  4KLU A;  1QSY A;  4QZI A;  5J2A A;  4F4X A;  3Q8R B;  2C28 A;  1L5U A;  3KHR A;  2OWO A;  4I27 A;  2HVI A;  3T3F A;  2GWS A;  4DWI A;  4DSL A;  3RRG A;  3PW4 A;  4IQV A;  3RH6 A;  1ARO P;  5KFP A;  3MAB A;  1ZQC A;  2Y1I A;  2BPG A;  1TK0 A;  2FMS A;  2IMW P;  4FBU A;  3E2E A;  4XRH A;  2XCP A;  3TAN A;  2KN7 A;  4M9J A;  8ICY A;  3HX0 A;  2PI5 A;  4DLE A;  1ZYQ A;  1T7P A;  4I2C A;  4QZG A;  7ICL A;  1BPX A;  2Q0Z X;  4I2E A;  3GV5 B;  2ZJ5 A;  4RQ2 A;  1N56 A;  4PPX A;  1ZQX A;  5DG7 A;  4YP3 A;  3ZD8 A;  3PVX A;  1RXV A;  2R8K A;  5III A;  4KLQ A;  3PX6 A;  2JZB A;  4TQR A;  3GIL A;  4TUR A;  2MAX A;  3ZDD A;  1ZQV A;  1A77 A;  3V7J A;  3RJK A;  4BXO A;  3RRH A;  1TVA A;  4Q8F A;  1Z3E B;  4EZ6 A;  2WTF A;  3RH5 A;  1WCL A;  2ALZ A;  1ZQJ A;  8ICA A;  4O0I A;  3EYZ A;  4GC7 A;  4F3O A;  2W9A A;  4YFK A;  2BGW A;  4K4G A;  9ICH A;  3Q8L A;  1S10 A;  2KZM A;  4ECY A;  4I2J A;  4RQ7 A;  7ICU A;  4QZE A;  4QW8 A;  4DSJ A;  1Z00 B;  4BGD A;  4ED6 A;  3PW5 A;  2W8K A;  3SYZ A;  3JPN A;  1S0V A;  4J9K A;  4EYI B;  4QZB A;  9ICP A;  2ZUB A;  4XQ8 A;  4MEX A;  5J0U A;  2C2D A;  4YXJ A;  1U49 A;  4KN7 A;  1QLN A;  7ICM A;  4DS5 A;  3ETL A;  2Y1J A;  4KLM A;  4ECX A;  3ZDE A;  4KLH A;  5KT7 A;  4RQ3 A;  5DQG A;  3AU2 A;  4R8U B;  4TUQ A;  3UQ0 A;  1ZQN A;  8ICL A;  4Z6E A;  3PO5 A;  1NK4 A;  4YG2 A;  4P4P A;  4GLX A;  5D46 A;  3MDC A;  4I2H A;  4Z6F A;  5J0T A;  3GIK A;  3T5H A;  2HHV A;  7ICH A;  4RPX A;  8ICF A;  4XUS A;  3MGH A;  4ED1 A;  1KRP A;  4QZ8 A;  7ICT A;  4EYH B;  7ICO A;  2BKE A;  3OSP A;  5J2G A;  4E0D A;  7ICQ A;  7ICK A;  1RYR A;  4DL2 A;  4KLD A;  9ICA A;  1RZT A;  4EZ9 A;  5EWG A;  1SKS A;  4EBE A;  2PFO A;  4R8U A;  4J9N A;  8ICV A;  4M6W B;  1NOM A;  3HP6 A;  5CJ7 A;  5L1J A;  3Q8P B;  4YD2 A;  3BDP A;  4DEZ A;  1LB2 B;  3C2K A;  4FO6 A;  2NRZ A;  4M47 A;  5KT3 A;  1NK6 A;  4I2I A;  3PR4 A;  2HHQ A;  2ASL A;  5KFT A;  1NK0 A;  4DO9 A;  4DOC A;  3RB6 A;  5J0Y A;  3QZ8 A;  1NKB A;  4YMM A;  4ECR A;  1RXW A;  2UVU A;  2XC9 A;  2F1J A;  1TAQ A;  4QZC A;  4DL6 A;  2UVV A;  8ICE A;  1RYS A;  2HW3 A;  3RJJ A;  2P66 A;  3IM1 A;  2PFN A;  2HHU A;  1NJZ A;  8ICZ A;  4DOB A;  5DBC A;  3MFH A;  3RJF A;  5KFO A;  3ORY A;  7ICI A;  5DKW A;  4KTQ A;  1ZQB A;  1Z00 A;  4QWB A;  5DLG A;  4DL5 A;  3C23 A;  3C2M A;  3PY8 A;  4JUZ A;  1S77 D;  8ICT A;  4JWM A;  4YR2 A;  3H4B A;  4QW9 A;  3UXO A;  3EPG A;  4O5K A;  5HP4 A;  1ZQH A;  5J2J A;  4ELT A;  1TK8 A;  2H5X A;  1BPZ A;  1S76 D;  3OHA A;  4F5Q A;  3NGD A;  1ZQZ A;  1ZQS A;  4O5E A;  5KTQ A;  2R8H A;  5HHI A;  4RT2 A;  4RQ4 A;  4LZG A;  5J0R A;  5JUM A;  2XY7 A;  1H38 A;  4RUC A;  3JPO A;  4RQ1 A;  3PR5 B;  1WCN A;  4O5C A;  1SL0 A;  3RR8 A;  2W9B A;  3FYH A;  2AJQ A;  4IRC A;  1B43 A;  1D8L A;  4FS1 A;  5KFG A;  4O3O A;  2FLL A;  2VA8 A;  4TUS A;  5J29 A;  2I9G A;  9ICS A;  4YVZ A;  4KLO A;  3RH4 A;  4F2R A;  1HUZ A;  2W9C B;  3C2L A;  4F5P A;  4UB3 A;  3GII A;  5DB6 A;  1KSP A;  1ZQQ A;  1XS9 D;  2B21 A;  4I2D A;  5KG6 A;  3ZDB A;  2C2E A;  1IM4 A;  4IR1 A;  4O9M A;  3PW2 A;  2KFZ A;  4Q8E A;  1BVS A;  5IIM A;  4M9N A;  4DLG A;  4B9S A;  4F91 B;  1ZQI A;  4LVS A;  2MUT A;  3RAX A;  4PGX A;  1SL1 A;  8ICM A;  4DFJ A;  5DGB A;  1C7Y A;  4MFA A;  2AGP A;  2ZJ8 A;  2XGP A;  4KLG A;  3ISD A;  5KG1 A;  4RPZ A;  2W8L A;  1IXR A;  3V7L A;  5TZV A;  5DBB A;  3RB4 A;  1TK5 A;  3RAQ A;  4DF8 A;  4UQG A;  1KFS A;  1ZQY A;  1KLN A;  3PO4 A;  4EBD A;  4M9H A;  3GIM A;  1N48 A;  3K75 D;  4O3R A;  2A1J A;  4Z6D A;  4UB5 A;  4QZA A;  1NK5 A;  4MEY A;  5KFH A;  3KHL A;  1ZET A;  3QE9 Y;  2UVW A;  4F8R A;  5HMM A;  2V9W A;  3T5L A;  2FPM A;  5J2C A;  3V7K A;  3RTV A;  7ICS A;  4K4H A;  2ZTC A;  5BOL A;  8ICB A;  5J0X A;  4YR0 A;  4ECW A;  2LYH A;  2BCS A;  2JEF A;  4DSI A;  1MC8 A;  7ICR A;  1LV5 A;  2JEJ A;  1KFT A;  4NXZ A;  1KTQ A;  1K1S A;  2ZTE A;  5DGA A;  2BDP A;  3RJG A;  3MGI A;  4RPY A;  2NRX A;  4IQT A;  3M8S A;  4NLZ A;  4DL4 A;  4GXJ A;  9ICT A;  2V4Q A;  2XY5 A;  5C5J A;  3OJS A;  2W9M A;  4ED7 A;  3RBE A;  1ZQK A;  3TI0 A;  1NK7 A;  3KTQ A;  3ISB A;  4ELV A;  2R8G A;  1DGS A;  3G6V A;  1HJP A;  1NK8 A;  2JEI A;  3PML A;  2AU0 A;  1BPY A;  1U9L A;  4QZH A;  4KLE A;  4DSE A;  4IQW A;  1T8E A;  2AQ4 A;  3PW7 A;  2KTQ A;  4ED3 A;  1X2I A;  5J2B A;  4DFP A;  4B9M A;  7ICF A;  4DQR A;  4B9V A;  2AQ0 A;  4KLF A;  4QWE A;  2PFP A;  4F4Z A;  4NM1 A;  7ICJ A;  2NRV A;  3BQ0 A;  1JMS A;  2VA2 A;  5KFQ A;  5CR0 A;  3MR2 A;  4ECU A;  1JXE A;  3G6Y A;  5J2D A;  3H4D A;  3UXP A;  3EW9 A;  1MQ2 A;  8ICW A;  5KFI A;  8ICH A;  3C1Y A;  4M9L A;  9ICG A;  2JZB B;  9ICF A;  5KG7 A;  5KFD A;  5F9L A;  3QEB Z;  5KT4 A;  3HT3 A;  4GXK A;  1ZQM A;  4UAZ A;  3K4G A;  9ICM A;  4FS2 A;  4DOA A;  3Q8K A;  1L3U A;  5KG3 A;  4TQS A;  1SKW A;  2XGQ A;  8ICJ A;  4R65 A;  3Q8S B;  9ICO A;  1BPB A;  3RJE A;  5DLF A;  8ICK A;  2W9B B;  2PXI A;  5D4B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...