2ZIVB

Crystal structure of the mus81-eme1 complex
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
332
structure length
269
Chain Sequence
ECLKHIIVVLDPVLLQMEGGGQLLGALQTMECRCVIEAQAVPCSVTWRRDWVEEPTVLVLLRAEAFVSMIDNGKTLQGFVTDITAKTAGKALSLVIVDQEKYFRSQLPEVSRVDAEEALVDLQLHTEAQAQIVQSWKELADFTCAFTKAVAEAPLRDETTFSFCLESDWAGGVKVDLAGRGLALVWRRQIQQLNRVSLEMASAVVNAYPSPQLLVQAYQQCFSDKERQNLLADIQVRRGESTSRRIGPELSRRIYLQMTTLQPHLSLDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the Mus81-Eme1 complex
pubmed doi rcsb
source organism Danio rerio
molecule tags Hydrolase
molecule keywords Mus81 protein
total genus 68
structure length 269
sequence length 332
ec nomenclature ec 3.1.22.-:
pdb deposition date 2008-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02732 ERCC4 ERCC4 domain
B PF02732 ERCC4 ERCC4 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.670 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2zivB02
3.40.50.10130 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2zivB01
1J25A 2ZIUA 2BGWA 1J24A 2JNWA 2JPDA 2ZIVA 4BXOA 4P0PA 4M6WA 2ZIVB 2ZIXA 1J23A 2M9MA 4BXOB 4M6WB 2ZIWB 2A1IA 2BHNA 2ZIUB 4P0QB 2ZIWA 2ZIXB 4P0PB 4P0QA 1J22A
chains in the Genus database with same CATH superfamily
2FFBA 3PDIA 2ZIUA 2VDWB 1RXSA 1VYHA 4X9XA 4R7TA 5CYPA 3TQCA 4CFSA 1KI4A 4Q3KA 4U9HS 4K88A 3T5GA 2BP7A 5EXPA 4F45A 1ONNA 4RS3A 4F5NA 1QS0B 2FJPA 2C94A 1XAGA 3RB6A 4DFJA 2P4HX 3I30X 1FYFA 3ZXIA 1SD2A 4ZVQA 2C5AA 4DC1A 4B09A 5HKOA 3NWBA 3K0HA 4B4DA 4OF4A 1M2KA 1GA6A 4RF5A 5F1KA 3TIXB 3URKA 3NQ41 1TRKA 3CT4A 3HM2A 1IYZA 4RIIA 5AR1A 1AS3A 2CK3D 1ZS9A 3BFXA 1TEZA 3LBHA 2DF4B 1GGNA 2IUEA 3LLVA 3A1TA 2CL0X 3E9DA 3SHTA 4F9EA 5CA0B 6PFKA 1QV6A 1D9DA 1ZQXA 1KPHA 3CYMA 4DF4A 5ENZA 3PSTA 1SGWA 3LP5A 3VV2A 3WNCA 4HNVA 3M4ZA 2DPIA 4WSOA 4AFNA 4AKIA 4ZANA 2XXBA 4QQ8A 1HZZC 3HCOA 5IWAB 1DWUA 4Y6SA 3RIEA 4A26A 1H4VB 4OQXA 4MUYA 4P4MA 5K0BA 1DRJA 2VJMB 3RW9A 3BGDA 1C3EA 1GSHA 2XOKD 1GTRA 2NTVA 2W2VA 1FLVA 1XMPA 4EW6A 1TAMA 1CY2A 1E5VA 3HXLA 3L1JA 2ZRGA 4FZMA 5IARA 1KYZA 3H11A 1MOZA 3SHWA 2VHWA 3SKVA 1FU7A 5CLJA 3LA8A 3O2QB 5CR0A 3TQHA 4KLZA 4OB6A 3QUBA 1UMDA 3HLYA 1VJ1A 5K2OA 1AKWA 1FNBA 1YJQA 1M75A 2IPXA 9ICEA 5DW3A 3RG2A 3ZE2B 5I45A 1V48A 1M8GA 1JQJC 2JFYA 2PVPA 3R9IA 3DULA 1C14A 2W6ID 2R9VA 4POAA 4Y0AA 3MERA 3RSOA 2V9PA 2XKKA 5JU6A 5JAIA 2R1ZA 1L1RA 1XMOB 3FTDA 1XZQA 2SKCA 3JQPA 5H80A 5LZ4A 2IOQA 3L43A 5K0NA 4Z7NB 2Z09A 4C01A 3GRFA 8ICQA 2AGVA 3CUUA 3LZCA 3U3ZA 4PG7A 2LP4Y 1PG5A 4FMDF 3B78A 4JQOA 3S3TA 1KNQA 3UYLA 2EF1A 2MMGA 3HR7A 3CZ9A 3NPMA 3BL8A 4F6RA 2H3ZA 2GVDC 2ZETA 3AVOA 1P7CA 1FC0A 1M1YB 1TT5A 4FNMA 6GPBA 2ZIXB 1RHQA 1H5NA 2QV7A 3EUB2 4LXQA 4BX8A 5IF9A 2WUGA 4DL5A 1JG4A 2JGKA 2ZIZA 1V7CA 3BXOA 5EQJB 4D9GA 3QE3A 3RVMA 1CR4A 4TSFA 5LLDA 4B9AA 2JDID 2QUIA 3PDCA 4IIHA 2JLUA 3IPCA 2XCQA 1VPWA 1FXWA 4XPZA 1BMTA 3H1FA 5D3QA 4K9MA 1KJ9A 2LNDA 1J8VA 5BOMA 2DPJA 3AW8A 5JD3A 1XK6A 2CLIB 2EKZA 1HEKA 2ZI4A 3K94A 3FWYA 2XIDA 2BFFA 1W85B 1JXLA 1ULHA 1XCLA 3FE2A 5ED0A 3ROEA 1FCJA 2DQ4A 4RTOA 3FPFA 3LT0A 2PH3A 1E3DA 1TRHA 5BPCA 1U8XX 2JEJA 1ZD8A 4HLQB 4CMIA 1PEDA 3NVDA 4RFSB 4J0QA 1O5OA 1X7GA 5IC5A 1RQPA 2AJTA 3IVMA 1OTHA 4UPEA 1BQ3A 1WZIA 1NXTA 3RTAA 1XXHE 3CX8A 4QYXA 1R37A 1ZGBA 4EK9A 3FFXA 1MAAA 4YP0A 5DLPA 1GPH1 2CVHA 2HJ9A 1CV2A 2DUNA 2GWRA 4B7CA 4YXWD 3FYSA 1GPYA 5H3CA 2IS2A 4GXQA 4IY1A 4ARAA 5IYZB 3BH6A 5JI3E 3L5KA 4FI3F 1I1HA 3KQQA 4UQOA 2Q27A 4C88A 3ZY4A 3BEDA 4HNSA 5F3RA 2RGRA 3ZLBA 1A7AA 4FYXA 3RYHA 3H5OA 3N0WA 2EYUA 4M9RA 4N6GA 2WAMA 3GX1A 3SR6A 1Z2DA 2EFCB 4W5RA 4UMEA 1ZOIA 4MFAA 2OEPA 1LDGA 1IN6A 4YUAA 4CKZA 3DVQX 3QKWA 3DR3A 1BRMA 1CDZA 2XB9A 3K15A 1LVUA 5B6JA 1GAQA 5COAA 4CN9A 4QL3A 3JD3A 2PSHA 3EBPA 3KLOA 5AJWA 1SKMA 1DJNA 3Q2OA 4MV7A 3JPYA 3KQLA 2EP8A 1YCHA 1ISHA 4RHYA 4TQUS 2B3DA 4YECA 4J29A 4PFQA 4EY3A 2GBPA 4OP3A 2H1VA 2QI9C 1U49A 5CCDA 3THSA 3U4AA 2HCTA 1CB0A 4G2NA 3QU4A 3VAAA 8ICHA 4W8OA 4RPIA 2YXLA 3QUTA 2R5FA 5JYBA 2DULA 2BJVA 3MRXA 1Y3DE 3HACA 4KRXA 2P6MA 1O96A 3WWYA 1OXKB 4I1RA 4AJ9A 3X1KA 3EXG1 3ZLJA 5E9QA 8ICYA 5CVUA 3KZVA 2ZIAA 3BSSA 4J91A 3AEQB 1DKUA 3T7KA 3ZE8A 3BS5B 2HKIA 1ZLYA 2JAHA 4O4LB 5FUYA 1F2VA 1L7DA 1F12A 1D8YA 1D3AA 2I2XB 4KXVA 3OSZA 5IJWA 2ZJ6A 2QYHA 2E4AA 2G4VA 2Z2JA 3HO8A 3IOCA 4KACA 4PWZA 5KYXB 3F6PA 4IHJF 5C37A 3HO1A 4JXZA 1YTLA 2GZDA 3VO8A 1LQ2A 2OBBA 2QL7A 4CL3A 3RWOA 2I4NA 1I7DA 1RM6C 2X8WA 4K2HA 3UG6A 4KLIA 1W75A 1J9ZA 4DNOA 3CVXA 2OP1A 1YT5A 2PVCA 3CWCA 4X1OA 1KZ6A 4GOOD 3D6TB 4HDAA 3H5TA 4RHCA 5CW1A 6LDHA 2F9FA 1RWWA 3D3NA 1N2IA 1NOMA 1M1NB 3BMOB 3WGGA 1U1FA 4ETIA 1T34A 1R4ZA 2FFRA 4H1VA 1IL0A 1V85A 1P4RA 2COEA 2G7ZA 3TM5A 1GL9B 1JQKA 2HHQA 2WOOA 1GRCA 2BGNA 2VHZA 1J97A 3EG5A 3LXXA 1YA4A 2ZE5A 2UVDA 4MPDA 1KZ4A 5DB4A 4CG3A 2NU9A 1IH8A 3KEGA 3GFKB 2FA9A 2HX1A 3JVUA 1USUA 2ZWVA 1KR2A 3UMVA 5DTJA 5LQDA 1CI4A 4P58A 3AEUA 1MF7A 3NBQA 5KL8B 1UBNA 3B0YA 2JPDA 3NR2A 1T2EA 4IQ0A 2OORA 2PL1A 4XTCS 2B4YA 3CLUC 4JBLA 1YA6A 9GPBA 2A30A 4MIOA 4BKUA 3QPAA 4DIKA 5KFVA 3SI8A 3JATB 4O2BF 4O8ZA 5JEEA 2OK7A 2VHYA 1IWOA 3FUCA 1U6IA 4YP1A 1S3SA 2ETXA 1DE0A 1GILA 4Y2HA 5J1SB 1OH8A 2D7DA 4GLLA 3F73A 3DVAB 4O25A 1M34E 4J4TA 4HYYA 1FBNA 2XQFA 1MOSA 1I1QB 1NI5A 4K46A 4PGGA 2RIRA 5FFFA 1RKXA 4ZOQI 3OX4A 5CYOA 3EXIB 1BMFD 1DV1A 3A7EA 3OUZA 1WL8A 2BH9A 1PX0A 2Z4TA 1CZHA 5LDDC 5LQRA 1PU2A 1BX3A 2H08A 3Q8WA 3ZDFA 3ZVMA 3AHJA 1DBWA 1U3FA 2Q6VA 1D9FA 1TUIA 2HOQA 2D3TA 2YOGA 3CQ9A 4HQNA 4DLKA 1QH8B 4QPPA 4UOQA 3VH2A 1ZW6A 5BWBA 3KFLA 1FP1D 3JARA 5IN4A 4MKHA 2TMGA 2LWIA 1XV5A 4KP7A 4NBKA 4NE7A 4CGZA 4DSIA 1AD2A 1YZLA 5BYAA 3F3YA 3OEEA 2EGGA 4OBEA 1WPGA 2YIVX 4LZAA 5JD6A 1EVZA 6ADHA 3AWIA 3I8XA 2OPBA 2FVXA 4PLFA 2BPCA 4A2WA 4D6XA 5M5BA 1JPNA 1UHUA 3OJ0A 4L74A 2YX8A 5C7YA 1T9BA 3PIIA 1ISJA 3QLUC 4L76A 1J0DA 2JCBA 4QJ5A 2XICA 4OGWA 3JARB 5J4LA 3YASA 2IQ5A 4MHTA 2ZDQA 1GSAA 4AZ3A 3SMVA 2WJ4A 1SH7A 1WXWA 1G3UA 2JIBA 3T5CA 4UQGA 4YAWA 5HR7A 3L0OA 13PKA 2GPTA 1TM1E 4XARA 3KPVA 4Q4AB 4D25A 2C22A 4FPXA 2PI4A 2G9ZA 2Q2OA 1AZSC 1ZQAA 1YUMA 1A5BB 3MG9A 3O93A 4GZ6A 4RYDA 2NUTA 1ZEMA 4QWCA 4AJIA 4ZI7B 2OYSA 1BX0A 1RJ9A 3A25A 3F46A 4TTTS 5DRYA 3SQLA 1JDZA 1UZNA 3I0MA 2E3TA 2JEZA 4WMLA 2JZOA 3F3SA 3FY4A 4PLVA 4Y8VA 3HLKA 3QPDA 3TQTA 3SS8A 5K8TA 2AI1A 2FNAA 3ZI7A 2WKQA 1P5JA 4B4OA 4DHEA 3HKZC 5KHOC 1NY6A 1ZRHA 2ZR9A 4NJOA 4LX0A 2J0UB 3OICA 3RGWS 3WNBA 2ZM5A 1DC8A 4H7FA 5KAIU 1SU7A 3UQ2A 2OECA 4QD3A 1JKXA 4F56A 2HHHB 3ZXXA 4LKRA 3F7TA 2MWMA 3EYAA 4NV1A 4NOKA 4PZZA 3DQQA 2I6UA 3LYUA 4QDJA 4LVNA 1SURA 5UKDA 2P3SA 4EATA 5JXHA 3W79A 1WX1A 3CTPA 1J8MF 2CJYA 2OGWA 4M9LA 1GGJA 1Z06A 2FQXA 2WSLA 2NO7A 1SPXA 1PFYA 2Q8NA 4TKMA 3ZU3A 1SHZA 1NR7A 5JLAA 2XRFA 5KT4A 1FMFA 1JX6A 1U8TA 5F52A 2CLCX 4IIUA 1NAHA 3AJAA 1T1IA 3G5LA 3KZCA 4CUZA 3ND9A 4LJAA 5J2BA 1Q2XA 4N76A 5AKEA 2AYXA 2F67A 3DVRX 3GPLA 2IOHA 5CFQA 4MUXA 2Q9CA 1KMCA 1THTA 1XAHA 2AS0A 1BXZA 2CEAA 2VT3A 3H9QA 4LCEA 5FTJA 2EW2A 1C0PA 1AGYA 1AXEA 3NNDA 2ZRQA 2ODEA 4L4YA 3GJQA 4G0QA 4FFSA 3UMFA 4BP9A 1J8QA 3BZUA 2ZK7A 1ACJA 2JD2A 3GEEA 4E51A 3PNBA 5L3SA 1WEKA 2Z6VA 2HXYA 2MSWA 5FTLA 1XEXB 1ZL0A 2Q1SA 1L7RA 2RCNA 1UJ4A 2WJPA 1MRNA 1ZIOA 2PZFA 2P9FA 3GJSA 4KCGA 2W6PA 4RKWA 4Z9YA 4ZH4A 2AF3C 2PVSA 3BD8A 5HW0A 5CB1A 1XC9A 2A84A 3Q3HA 5AJHA 1UZUA 3RBXA 3QPBA 1Y81A 1GG5A 2H48A 2FF5A 2N3ZA 3G1WA 3QVVA 4TMWA 1KK0A 3ORYA 3L06A 1O08A 2KBEA 4UFOA 3TINA 4AZWA 3SZUA 3IQGX 1KZHA 2A0WA 5BMVF 3SS9X 1FP6A 4KBFA 1B8NA 4BUJA 2B4KA 5H68A 1N2CA 4UHKA 3ZE9A 1QF9A 2FKAA 9MHTA 4BEBA 4J94A 4MWEA 3HB0A 3H1PA 4TTJA 5J2UB 4JB3A 3T5MA 7ICOA 1KK3A 1C0KA 2YWJA 4PPNA 1BO6A 5IEBA 1JH9A 1NMQA 4L85A 2PX8A 3ADOA 1QZ3A 2GMWA 1J21A 3WWPA 1O94A 2EAOA 2VDKB 2XF2A 3FNGA 5KWVA 4YV1A 2BZ1A 2Q99A 4JEMA 4V0RA 1LUAA 1UPFA 5HE9A 4RH1A 1QRTA 3C4JA 2PGJA 3KR1A 2FGKA 3EGXA 1GFSA 1NA5A 2Y2UA 3H9GA 3U4IA 4F0JA 1TLFA 2ZTEA 5JLJA 4LFBB 1D2CA 4IIFA 1IOLA 1TI7A 5D1HA 2E8PA 4IFIA 1C8VB 4ED6A 1QFYA 2O2IA 2HZ7A 1VJTA 5DMHA 4ON9A 1GJRA 4WY8A 2XTZA 4TWRA 1TJNA 2FLNA 1Z2EA 1PG0A 4K4HA 1S5LU 3NWPA 5JXGA 1I0LA 1PBNA 4L6CA 1LTKA 4HOYA 4RJKA 4RY9A 4XR4A 5L3SB 3L4JA 1G21B 2YX1A 3GCZA 3QLJA 1LRLA 2H1RA 1TQDA 2NX2A 4I8DA 4QG3A 1BPBA 2FPWA 4U02A 5A3RA 5IJZA 1Z0SA 3KEMA 1ZQYA 1ESDA 1UA1A 4EGCB 1JDBC 4GUDA 3R7SA 3UJBA 4IICA 1S1CA 3KVNA 2YIDA 1NP6A 1UC4B 3FTQA 4NCKA 2MT9A 3A3OA 5HQ3A 1SL2A 3G85A 4M86A 1G8PA 1A7UA 2V97A 3L7YA 2PZJA 4QU5A 3I05A 4URFA 5DHTA 4YAKA 4J9LA 1H85A 2ZTLA 1PNOA 1Q0SA 1Z25A 5DHSA 3SKYA 4UTVA 5D5QA 3W8EA 1EI9A 3W5AA 2I91A 1U5CA 2IH5A 3OUUA 4HPXB 3U62A 3HJUA 5I7RA 2WSSD 9ICOA 3SK0A 4JMPA 1YB4A 4B71A 1YFJA 5FF9A 1RRKA 5DKFA 3TZQA 4CXMA 1NNI1 3NAQA 521PA 1TIKA 2QQ5A 4OK5A 1P2BA 1TXGA 3GFOA 9ICFA 3KV3O 4W99A 3T95A 4BKRA 2OBXA 3MCAA 4IC9A 2VWGA 3GZFA 3GLVA 1MX9A 2YB4A 1DKRA 1GFWA 1HI9A 2PK3A 3R9KA 2P2YA 3E48A 4QC2A 1Z75A 5BXYA 4OHYA 5B64A 4CQLB 1Z6AA 1O0SA 4GP6A 2H4YA 4EA6A 1FB5A 5T67A 2E82A 1L4MA 3SC4A 3W9SA 1ST3A 4JCOA 2DPXA 2RIPA 2XB6A 1EGQA 3C7DB 1DC6A 3FFAA 3L4BA 3PEUA 6REQB 4DA4A 1T8TA 1ZOPA 4JUFA 4AUNA 2HSWA 2C9CA 1SWVA 3TW6A 2QP9X 4UDYX 2VZLA 3KJQA 5I5GA 3NRJA 3D8TA 4XLLA 5LMCA 4CQLA 3AM3A 1MJGM 4AF6A 1PI3A 4UOZA 2X7XA 1JEYA 2OOSA 3HO6A 1HXHA 5KYGA 1UFVA 1E3JA 1EAMA 1W4LA 3B3AA 4A82A 4MP3A 1J2NA 2IL1A 4J43A 3ZHCA 5TSDA 1F2TA 3DA8A 4TT3D 3DEFA 4BX9C 1PGPA 3K9CA 1ETUA 3WLIA 2DWOA 4JU8A 2O9JA 2ZBEA 2H51A 3CY6A 1R15A 2GJAA 4Q3AA 4CETA 5DLFA 1COKA 1MIOB 1NVFA 2ERCA 2FHSA 2AMLA 2FJ0A 5F51A 3ZY2A 2FSHA 1IE3A 3KQSA 1ZVQA 3X1YA 2CXSA 3I1YA 1LTQA 2OZVA 5B1YA 5IIMA 1NFQA 2D5CA 2HH9A 2WU4A 3HWX1 3R4VA 4G5FA 1YBHA 2Q6LA 1WPRA 4I9GA 4NYIR 2C2EA 1CUIA 3ON5A 5CDGA 1FU4A 4R41A 1HG0A 3DDSA 2BISA 1UXKA 3UNXA 5JFOA 3FZNA 5A6VA 2NU8A 4MI6A 2FDCA 4A16A 4LISA 3I4CA 4Y3UA 2ATIA 3FCXA 3QVMA 2ETVA 1XZAA 1ZUHA 1ZQIA 1A8QA 4E5MA 4ERXA 1SCUB 5GTHU 5DXFA 4Q4LA 2DWQA 5J2UA 3CCCA 2E87A 2C9BA 3PT5A 1OCEA 3L3BA 2FMQA 1XTIA 3RH6A 1J49A 2D1QA 2DPMA 3LCRA 4ZO9A 3B6ZA 4CF6A 2UZ4A 1E2FA 5DM0A 2PXCA 5SZHB 1EE9A 4FN4A 5BWOA 4ARZB 1GA4A 3D2NA 1RI4A 1OREA 5CMLA 3THWB 4DCCA 1Q3UA 1VA4A 3LHDA 3FB4A 4JI0B 5IT5A 1XGKA 1IVNA 3WADA 2X0EA 1L7BA 3GUHA 1VHTA 3KK0A 3LSYA 2XEXA 3TXAA 3WJ7A 5JJCA 4BNWA 4CJXA 1DO0A 3IR5A 1ZMOA 4FBGA 1DG1G 1UKAA 1NP7A 1Y80A 2G80A 2NZJA 1A76A 2Z2ZA 3KKNA 3NGLA 4GM1A 4HBZA 4Z9FA 1PN3A 2EKBA 3EF0A 5G4LA 3RS7A 4BMOB 4EAAA 1KTIA 3ZDYB 1V3QE 1U1IA 4UUOA 3A9VA 4IZIA 1DJPA 3FCSB 1Y6QA 3OIVA 2QL5A 2RHTA 4U2GA 2ZRLA 3RS4A 2GPSA 1XEWY 2YICA 3OPMA 2G3YA 3V1NA 3T1QA 2O8DA 1PYDA 5JBNA 2WEKA 3ZDQA 5DHRA 1NYRA 3H18A 4R1OA 3AILA 3GZNA 5CVCA 5K0GA 3CCBA 3VNBA 1MB4A 1HDGO 5KNDD 2JVKA 2HN9A 3KJEA 2GVZC 1IJBA 1P1HA 1NU6A 4D46A 4M9JA 3LY8A 1N5WA 3HR4A 2C61A 2AZ4A 3M70A 3OQVA 5ICGA 3BTSA 3CNQS 4YCJA 1N7GA 2JGMA 3ZYCA 4E4TA 1VOTA 2H59A 1N2EA 4MW4A 1NF9A 2WAYA 4XQ9A 1E7YA 1ZJYA 1F3LA 3D7NA 3AF5A 4XIIA 1CUKA 2Q7DA 4YG2A 2FZGA 3PW5A 1WE2A 2O4CA 2P1DA 2P5YA 4P36A 4PHFA 5JG7A 3V7NA 4J0EA 3A05A 2ZVPX 3LTNC 1OUQA 2B5VA 2HBZA 4ZAWA 2P2CA 4IM7A 2WM3A 3OKPA 2ZBPA 5KWIA 1MRSA 2IXDA 3CF2A 1H3NA 1V8BA 5K3AA 1NVKA 1F06A 5K51A 4P0PB 2ZZKA 2ZSIA 2QE7A 3L9WA 2EG5A 1SHKA 4DT1B 3SVTA 3NOVA 2C29D 3QUAA 3ANMA 2EJBA 1FDVA 2GARA 1LEHA 5A02A 2EZ4A 3N2YA 4CF4A 2CF6A 1FP2A 3GPIA 1NVDA 2LRHA 4IS7A 4RNNA 2G0TA 3S99A 4E08A 1T9AA 1VBKA 2WUEA 4QWAA 1GEEA 4IHJA 4KRYA 5K5EA 3NGDA 1MEOA 1PR3A 2W9BB 4ZRDA 1QJCA 1XPOA 1HETA 3Q8MA 3TAQA 1YR6A 2EDUA 4F4YA 2PUBA 1IJEA 3UJ3X 4TMYA 3I4FA 2GLEA 1D1SA 3V4VB 1OA0A 3QEOA 2VDRB 1OGJA 4RH0A 3VYTB 3V4ZA 1N6HA 5EWGA 4GDFA 3PKZA 4YXMA 4KLDA 1F6DA 2OXCA 4II2A 4QTZA 2X9QA 3LXUX 1ECFA 4GXTA 1JT2A 4KQ9A 1T1JA 3FCYA 1XWFA 1K6MA 3F1LA 4CCWA 4OG2A 8ICFA 3S27A 4GX5A 4FYWA 1VQ1A 1UXJA 4NBSA 4RPGA 3AKZA 1BMQA 4IP0A 4P9NA 2H2GA 4UJ3A 2FSVC 2CUKA 2WIJA 4LZLA 4U9IS 4A5OA 1G17A 5C5DA 3SLGA 3IO5A 3O03A 4ZVTA 1FP4A 2YBDA 1J07A 5H7XA 3G2PA 4BUCA 2RMKA 2CMKA 2WJAA 1V26A 4CMCA 3B1ZA 3OF3A 4A27A 3S2YA 4WXYB 3T7SA 5CK5A 821PA 1TVKB 5K1ZA 5DRTA 1VE9A 3S5JA 3D6AA 4U2FA 2XAAA 4K8RB 3CRW1 2G7MC 4A15A 4QZ8A 4L4RA 2ZBGA 4PSAA 1JEEA 5EMJA 2QN8A 1PGQA 2F90A 2J5BA 3NJ4A 2YNMD 3A04A 3K8OE 2QRHA 3CF0A 1UXIA 2QR2A 1IPEA 1RYBA 3GIKA 3D6NB 4M0EA 2PBZA 3SDBA 1E3LA 1PK1A 2GQ0A 1T94A 4YQWA 1QQTA 2FHPA 3AHHA 3GLRA 4JLWA 4UXJA 5HKLA 5JXIA 1RWKA 1EGAA 4NICA 3F96A 3QPVA 1KDRA 3KTOA 1T36B 2I8CA 1DKLA 1EFTA 1WCIA 2WW8A 3O94A 5AI6A 3Q0TA 4LPSA 1XMVA 4OUDA 3EEFA 3JYHA 3RJZA 3L8EA 3Q5GA 3DLHA 3RUEA 1NASA 1ZQCA 1K0UA 1YS2X 3EXEA 3QM1A 2K8AA 2ZTDA 1QHYA 4Q1AA 5JDIC 1TEXA 2X3FA 3I6BA 5DM4A 3NIFB 5JCJA 3VPHA 5AD1A 1HX7A 1B8OA 1ZQKA 5EWLB 2DJIA 2FWJA 4M38A 4W5TA 1QOQB 3QZ8A 1E6WA 1IB0A 1ES9A 4HVTA 3RVJA 5KWJA 3GMIA 3OEHA 4YX9A 1KORA 2JAUA 2OHOA 1UPUA 3A3NA 2ATEA 5I4KA 2V5VA 4TVBA 2B98A 1XTZA 2C9MA 2JXJA 4FFBB 4EHIA 1JEAA 1BS2A 1UBFA 1Y82A 3PFFA 4ZVLA 4BNXA 3EPKA 4O0MA 4BHTA 4JXKA 4LQCA 4BVBA 2XOXA 1P17A 3NO4A 3H17A 2PUGA 1E2QA 2M32A 2B4TO 2YWHA 1HL7A 1SUIA 2NAPA 3K20A 1DEKA 4JA2A 4HT3B 4FFLA 4DSAA 1E20A 4A3SA 4LE2A 4QPNA 3QG1A 3DSRA 1Q8KA 4GPIB 1ODTC 1YR7A 2DAPA 4EA9A 3LI2A 3FRJA 4YQFA 2PWPA 2DPGA 5DN6D 4MGEA 1JU9A 4GL4A 3BXEA 1QVRA 1HKHA 3AUTA 1F8YA 2J0VA 3O74A 2QVZX 5DMXA 2Y9TA 2BAGA 2GHQA 3LAWA 3ONNA 2ESRA 1Z07A 2P79A 2VWHA 4ABTA 3RVLA 1E1CB 3I62A 1OI3A 1QGUB 1J56A 2QRGA 3FI0A 3CP8A 1DIBA 1JHQA 3IGFA 4HMPA 5FBZA 3GP8A 1RW4A 4DOCA 3ROMA 3TXXA 3ZCRA 3TI9A 4BVHA 4DQKA 3BKXA 4DR2B 1IHUA 3EW7A 5HZKA 1E9SA 4KNWA 4HDSB 3L0IB 4TGLA 1Y4ZA 1PTKA 1SUPA 1KBQA 2WFLB 4G26A 3VI4B 1TIBA 2BD0A 4PQFA 1DUSA 3CVYA 5HCNA 3GV7B 3Q3CA 9ATCA 3RAJA 5CYGA 2AN9A 4RGVA 2IOYA 4A0HA 2QN2A 3FGZA 3IBSA 3O91A 1O6BA 3BIFA 4IDQA 5JDIA 5HKBA 1ZN2A 2ZUTA 3CX4A 1ZIXA 2IU0A 5U1PA 1A9OA 2HREA 4YXFA 5JAMA 3R7DA 2C9YA 2BKLA 1ZGHA 5C4MA 2REQB 2IHMA 2FZVA 1ODSA 3IC5A 2KS6A 3IUNA 2O8BA 3DAOA 3OFVA 4MQFA 4MUKA 2CD9A 2FPPB 4NJEB 1NVTA 1EEXB 2X13A 3NTLA 3LX5A 4GR9A 3WGHA 5I4CA 4IIGA 5A1TA 2C5GA 1NV8A 3EQ2A 1BU8A 1VHWA 4G5OA 4HFRA 3SENA 5KFIA 4ZRMA 4EF5A 1QU2A 1EWTA 3EDYA 4NESA 2AFVA 2P9QA 4PLCA 1PYGA 3DP9A 2QT0A 3H6KA 4KHZA 3VKVA 3KYCB 4QWDA 4MW2A 1HT0A 5JNSA 2PZGA 1LGYA 4IKPA 5FQNA 2G9VA 4WJKB 4MQFB 1I7PA 4A7PA 3Q1LA 3CLKA 4PPFA 2ENWA 1EK0A 4QQNA 3TOSA 2IPLA 1IXRC 2ZRCA 3ZBQA 1SOWA 4E11A 3OM1A 3UN1A 4GRDA 4QDTA 5KTPA 2O2YA 3DTNA 1A27A 4IR9A 2WTUA 1HFWA 1L4YA 1R0YA 1HO3A 1Y88A 1NVUQ 4DBVO 4URYR 1QZTA 2VAMA 4NXZA 4TUQA 3KT6A 1KSFX 4M55A 4WCFA 3MLBA 1FTSA 4ENTA 4RTJA 5E8JA 1HR0B 2YBEA 3BXPA 3SFZA 2IHNA 2NP7A 4DVGA 2XTAA 3GDOA 1TF7A 4HDSA 3D7SA 2IPOA 2DLNA 2LKDA 1NRXA 1X1BA 3QUSA 1P39A 4R8MA 3FGNA 2DPLA 4R2WA 3PYXA 1UJ6A 2VSNA 3QEMA 4NHEA 4CMAA 2PMCA 3KJXA 1RKBA 1QGUA 1XWIA 3WL6A 3PCXA 2AGPA 2GM9A 1MVOA 1XRQA 1VLMA 4M21A 4PCLA 5IHPA 4OJQA 4QOSA 3DKRA 1RM5A 5LMUB 4RW0A 2XYVA 4LRYA 4MVJG 5LWHA 1TJYA 1VJGA 1UBSB 2HRDA 2BJWA 1K86A 3G5MA 4AJKA 2ADOA 2O7NA 1SG6A 2VA2A 4URVR 1KQPA 3GFRA 4P3PA 5FOUA 4TYNA 1NMXA 3UXOA 2CNBA 3PD7A 4B45A 3UXNA 4ELTA 5KIAA 2J59A 2PFPA 4HWGA 3Q1KA 1T2CA 4B4WA 4BZQA 1YIAA 5T41A 3U3OA 3OE1A 2GS9A 5DLQC 1FBTA 5IK2D 4UBJA 4ECYA 3GUZA 4YJ2A 1FUIA 7MHTA 1EVKA 1FFXB 2NNWB 4XGQA 4Y1RB 4ECVA 4TXNA 2JFNA 1DMRA 2ARKA 3JAWA 2QNRA 2JGFA 2YY5A 3GD7A 1H22A 3JSXA 3ZV7A 1K2WA 4AKGA 3CPSA 2J0UA 4ITRC 5K09A 1J39A 4C07A 4IVPA 1YRBA 1UPAA 3W5BA 2LD4A 2F1OA 3H2YA 3KBBA 3PEVA 1YI1A 3MC1A 2YTZA 4N7JA 4O1MA 1ISPA 2ISQA 2C0QA 2II6A 4PZEA 5IDXA 3GUYA 4TLBA 3LT1A 5G3YA 5B36A 3DJYA 4N48A 2CDNA 2P40A 1PEYA 3K5HA 5HM8A 4R4JA 4P3NA 4DNPA 4EFNA 2H4HA 4ZKEA 5EXTA 1UMCA 4IG9A 2XB4A 1IK4A 3GQCA 3BZCA 4EBCA 1K6IA 2R6CA 4H3VA 1KRWA 3QGMA 2X4IA 3E9MA 2B4RO 3UW1A 4MLZA 3B7PA 2B9VA 5EP2A 5T4FA 3HFRA 1EE1A 1YAJA 2QD5A 3P2KA 1QM5A 4HQKA 4IJVA 3MJFA 4LE0A 3SYTA 3ZKAA 4EY8A 5HQTA 1H9BA 4YCSA 3Q6IA 1QZUA 4M8NE 2CN1A 3VTKA 3IVRA 3JVDA 4LMBA 1JQAA 1SBIA 2GLXA 3GPBA 3BGVA 1JLLA 4BY9E 1HDZA 4QLOA 4DDMA 2GHRA 1A50B 1KTQA 2GRUA 2BZSA 1YBAA 3N7SC 3RSHA 2HJWA 1E9FA 2ZKIA 3ANNA 5FWNA 1Z35A 2OM6A 2ZSBA 5A4JA 3FOFC 4M8IA 4X7MA 2NYVA 5ALYA 3PFGA 5KNBD 5C52B 2IYPA 2HQ1A 1XEWX 1AN9A 3H4MA 2XGQA 3KHTA 5A7HA 3WHKA 3COSA 2R1TA 2OV2A 3VZCA 1Q0ZA 4B0PA 4P4PA 2D1FA 2V9ZA 1GSIA 3A11A 4LQDA 4P6VF 3K75D 4PO8A 4WLFA 3V1TC 4G0PA 1W0KA 2VJDA 4GI5A 2WP0A 1HDXA 1EK6A 5IDYA 1ODFA 1Y5NA 5J0TA 4ZU1X 4A0FA 1T8EA 2HW8A 1YK0A 1WCNA 2YNMC 1PR5A 2CHQA 5SV2A 1GCOA 3H5RA 4ECXA 4HN9A 4Q7JB 5CX1B 3E2IA 1U2PA 4E5UA 3U7HB 1NVGA 3L7IA 1T9GR 1CLUA 1S6YA 2QVCA 1T9KA 5DH9A 3QRWA 3T9FA 4FCVA 1NFFA 1S8AA 4C4PA 2KJ8A 3L40A 4YVZA 2JIMA 1YVRA 5L1JA 2G5HB 1Z5VA 1K5PA 2PRKA 4IJQA 4QBHA 4DW8A 2J8ZA 4TLAA 1SXQA 3V2HA 1AMNA 2KJQA 3H1BA 3T7TA 4CRWB 1DFHA 3HU3A 5GIOE 1T8WA 1L5FA 2HL6A 2ZSHA 3SV3A 1CJMA 1BWRA 2WF7A 5AK4A 1GAWA 1SN7A 1UJ2A 2HJHA 3EULA 3K1JA 4L0DA 7ICGA 4UPVA 3O90A 1IBMB 3TAXA 3MMSA 1SZPA 2WSYB 2XE4A 4H4DA 4JVOA 4H7JA 4NPHA 3OZSA 2XMQA 1BCSB 4PTZA 5JFTA 1AV6A 4D3XA 3TLZA 1WV0A 1G64A 2YN2A 4ALKA 4IIYA 1UP4A 5K4LA 4N5DA 2ONCA 2IXAA 3GGDA 3VPFA 4BKMA 1K06A 3QYJA 3UT5A 2KSOA 3IDSA 3QXHA 3HYRA 4XYGA 4CQJA 4YPVA 4BFWA 2O8VA 3AERA 3HZOA 3IVAA 5CD1A 4HPWA 3BMNA 1JA1A 2QSYA 3I34X 3NHJA 4LI0A 4X41A 5IUKC 4HL6A 5CB4A 2DTDA 1MO4A 3E9RA 4JBHA 1OXVA 4JUAA 3NBZC 5LMZA 1BVHA 4BP3A 1A8UA 4EKDA 3CRXA 1NDHA 2G40A 4X92A 2PT6A 1WSBA 3IEIA 4Y1RA 5DNUA 2VYNA 2LPEA 2WQ6A 3PNCA 3SSAA 4NBRA 3V9AA 1QX4A 3ZQJA 3IDQA 3OLZA 2I7VA 1TE2A 4EKYA 7YASA 4G0YA 4U2EA 3WQSB 1C7RA 3SS7X 3E2MA 1Y7TA 1P29A 2JKYA 3NM4A 1BDBA 2HJGA 3AKDA 3BERA 3D2AA 1ESMA 3CA8A 2DB3A 2E6UX 2K4IA 1E1CA 4UD2A 2HOFA 1JFVA 1F6WA 3UPQA 5LWQA 3BG5A 4MIKA 2V6JA 1ZIDA 1A0PA 1QKJA 4ZDJA 3DJFA 6NULA 4Z3KA 3G9XA 4DCGA 4HLCA 2K4EA 3C21A 1T5LA 3ZE6A 1PJCA 1W9HA 3BGOS 3F9RA 3FDJA 1XRLA 4JBNA 1DAGA 3LJKA 4S05A 4W1SA 1JHAA 3MJCA 1YZ7A 2I3DA 4Z86A 5E7QA 4CF7A 1WQ3A 2NNLD 3LFTA 1FOEB 1PJAA 4QWMA 4P2BA 2CXOA 3IKMB 2PUWA 4JSRA 4R98A 4DBLC 1JH8A 4JLKA 5L4LA 3S2FA 4LWQA 3M3HA 1H9AA 4G0WA 4NU0A 2I5HA 1DBRA 1XCOA 2CVFA 3OF2A 4US1R 1B6SA 2PH5A 4BFLA 1EVJA 3M1AA 5ALTA 2CVQA 1EWRA 2QTMA 1YIDA 3KKOA 3L1UA 2CJWA 1UOEA 3SQNA 5EHXA 1N34B 3TEJA 4LCBA 1GPDG 4NPCA 5KOYA 5CNKA 7ICPA 3ZLUA 3FSEA 4XXHA 1SBHA 3E53A 3GRAA 1NQOA 4AYBC 1TJ3A 2QE6A 4ROTA 2HRQA 4RWZA 1D09A 4PL1A 4NAVA 2YHSA 4QDOA 3V8MA 5KJCA 3PC4A 4QODA 3TFOA 3FFBA 2X9LA 3NC1C 2FP4A 1DG3A 3IRUA 3Q85A 4V0LA 4C5CA 4HADA 4ERNA 1IG6A 3IKLA 4BPBA 1SIJA 3PUKA 2DFTA 3OIGA 5E7IA 5SZKB 4L4SA 1S3GA 2IYFA 4H1TA 4NJ8A 5CA1F 3A2NA 2IJGX 1KH1A 2JNWA 1BD4A 2FMXA 5KFTA 3FF4A 3IO3A 5JHHB 3U60B 2A7XA 3A6GA 3DONA 3TNDA 3TTWA 3N2KA 4RKEA 1COWD 3WX0A 2GYVA 4OA5A 2X0DA 1EHCA 1PZGA 4PINA 4L4UA 3RC2A 3UV3A 3TQSA 3TECE 1F1JA 1ORRA 1PLLA 1A7JA 3M6AA 5G4KA 1D4FA 1ZWKA 4BV2A 2R7AA 2ZVDA 4UB3A 1ZSNA 3AFGA 2L18A 4AUEA 1BHJA 1G20A 4B9EA 3GRRA 2A3RA 1M2VA 1RHKA 3D0RA 4WZBA 5FOSA 5HJ7A 1GCGA 3RFAA 1RZRA 3LDAA 2X9VA 2Q1UA 5DSZA 3DDUA 5A04A 2XBMA 3IESA 3GEDA 4BKPA 4BS9A 1T9HA 2UVQA 3K4PA 5IT9A 1CUGA 1TEVA 5BW8A 3BWDD 5C7LO 1TM2A 3JAWB 1D8AA 4GMHA 4NVRA 2NRVA 1ZQOA 3BDPA 4PPXA 5LU9A 1RQNA 2DZDA 2Z30A 2KQUA 2R11A 1FFSA 1QCZA 3CJQA 3EH1A 1N8NA 3DWIA 5D46A 3T1VA 1S5PA 1JQEA 2B82A 1NVAA 3C3DA 4RVHA 3R0IA 4R8UA 3C3XA 1I6WA 3GJ4A 3IUPA 4EEZA 4GRIA 3FDIA 3HEMA 2XUAA 2FY8A 2I3AA 2JCXA 3H9JA 1PL8A 2VSFA 3JPOA 2JHAA 4LECA 3TVDA 3ZGNA 3K6SA 5DGXA 2OXOA 1KJNA 4P4TA 2WZQA 4UE6A 4WESA 3E5RA 5G1PA 5FEMA 2IZ1A 2CHFA 4EBEA 1X40A 1FMCA 1R9MA 2Q3JA 4NLGA 2VZ0A 3QXXA 3WFIA 4RTSA 3JQRA 1SRQA 1Q7BA 4XKJA 5FO0A 3UXEA 3HM9A 4R8RA 3I2FA 3AOEC 3P1JA 3FOWA 2B2CA 2LV8A 4RVUA 4LTDA 1FDRA 4RBNA 1ADYA 1EG7A 2VJLA 3I39X 3FTEA 2WNSA 3QJGA 3V2UA 4RQ3A 4CI0B 4HXEB 5EA2A 2HSZA 3Q6NA 4CQMB 1VHQA 3EEBA 2XZTA 2E49A 2HHUA 2VZ9A 5DTMA 5HBGA 4FJ2A 3DBVO 3UWDA 3R9XB 1JKJA 4NJMB 1HZJA 2P2ZA 3K1ZA 2FQWA 5U9CA 2ID7A 1ZY2A 3RSLA 2H2FA 2O7RA 2NRWA 1SC6A 2XX3A 1JU4A 5L3RA 3U1VA 1NG9A 3HCFA 4JN6B 4NU8X 3BJYA 5EKXA 4ZT6A 4BEVA 2B34A 4DY4A 1ZXXA 3I52A 2V7BA 4Q93A 3C5FA 1BQEA 2FK8A 5HNKA 1YHZA 1D5WA 4UBOA 2CB0A 4WNYA 4ZU6X 2XCLA 1KWGA 3F2BA 1MT3A 3ESZA 2XO7A 4QPDA 1O9GA 5TMEA 2IIBA 4LYGA 1XZBA 4GP9A 2IF2A 4JELA 3LWMA 1EWKA 1TCCA 2BFDA 2UZ3A 3LC0A 5T64A 5TXGA 4GI2A 5HJEA 1DARA 4Z51A 1GQSA 1ZD3A 2ZPTX 3T9CA 3DOHA 4NKRA 3V7KA 3RH5A 2OHIA 4RXTA 4RZ3A 3WGTA 5KVAA 4DPMA 3MMNA 4J9UE 2F1IA 1ZETA 4NJEA 2L42A 3DMPA 1RM4A 3T3IA 1XYYA 3LSTA 4PG4A 3ACDA 3O8DA 1CZKA 1P1BA 4GM0A 1H0RA 1IEWA 1ZKMA 4PIPA 3ZHSA 1V3VA 2VXCA 2O0HA 3EXHC 3OE7D 4GHWA 3RANA 3VYUB 5L3QA 5CT6A 3T5HA 1PNVA 4BO6A 4OV6B 2ASDA 5DTIA 2MAXA 5KG1A 1PNQA 4EECA 1MCZA 3PXBA 1T2DA 3AFIA 2ZAOA 3Q7QA 2ZOSA 3DZDA 4CL0A 4Q15A 3MJTA 4Y7CA 5E1MA 3RT1A 4J9RA 5K0SA 1NM5C 3ONEA 3EXFA 1TZMA 3MS4A 2WJ6A 2JAPA 2HEGA 2R87A 3C8UA 4X63A 4GO1A 2OO7A 3AESA 4YRMA 1ZCJA 5JCOC 5K03A 2BFBA 5GOTA 2ZANA 2W9XA 2O5VA 4GLJA 4MQUA 1CY4A 3KZKA 3PC8C 4G0ZA 2VNJA 1WCLA 1GPNA 1PS9A 5D6NA 5H5JA 2B21A 5K3BA 2R6FA 2NW6A 4HZUB 4KQJA 1EPUA 1XLWA 4NBWA 4KPGA 5HM6A 3BRSA 1LBSA 1MC5A 4ML3A 4DJTA 4A4DA 4FHEA 5A06A 5AVSA 5KMGA 2GZ2A 4LJ9A 3W7BA 3HI6A 3RSSA 4AECA 4QO7A 4RQAA 1KW4A 1E0SA 1KZGB 5AHKA 4EO7A 4EHKA 5KTSA 2FN7A 2BSXA 121PA 3VR6H 1L2TA 1E2MA 2LUOA 3DLBA 2FPLA 3TI7A 3OO0A 4FYKA 1DTWB 2PV0A 3GP5A 3PHCA 2J08A 3QA9A 4H3KB 4PANA 5DX1A 3VNAA 1XYGA 5DB7A 3AR3A 3R7WB 3WYAA 7ICIA 5CT8A 3JQ7B 3O4FA 1LFAA 1XJ5A 1PHRA 1Y9JA 5GV8A 3OLCX 1T5IA 2QVXX 2WG1A 2AC4A 3WO0A 1Y48E 4BRSA 3R6LA 5AJYA 4LGVA 4HQOA 3ABRB 1JG7A 5E1OA 1C7EA 2JFPA 3R5KA 2BPFA 3BCHA 2CDAA 1D8TA 2JIDA 3BUSA 1R12A 3KL4A 3L1KA 3ABSB 3OA0A 2R2AA 3P71T 3GGJA 4G5YA 4IILA 4MYCA 3ZWAA 2WF9A 2KTQA 1VCIA 2NWQA 2W9CA 2BFCA 1YFZA 1AY0A 2CB9A 2VTKA 5CTAA 5KPDA 2RGYA 3PBKA 4Z9BA 3UUEA 3I23A 4IR1A 9ICNA 3LVQE 4LX8A 3V8PA 4ZQGA 2ZROA 1VA5A 3D7RA 2GYUA 4J2HA 2FRDC 4G1EB 2DLDA 3IM1A 1G63A 1YK1A 2J3DA 2R8ZA 2ZW9A 3DZJA 3O21A 3OU7A 1O1YA 1M6EX 5TQVA 3U7IA 1Z5GA 5L3QB 3OCZA 4ER5A 3A9TA 1YBFA 2O5CA 1RHRA 1I80A 3C5VA 3IJ5A 2JEFA 2JDIA 3INGA 5CR9A 3W8DA 3D6UA 4N3GA 3LKZA 3OQBA 2H3VA 1FVHA 4MYHA 4HGQA 3JQFC 3R3WA 1UFQA 1YE8A 5DNWA 2OCLA 2ORIA 2QZ9A 1B8PA 8ICZA 3DBRA 3NWOA 4XWWA 2VXYA 1E58A 4DMCA 6AT1A 3AY3A 1V7ZA 3I0NA 5T57A 5LNK1 5J4VA 2C2RA 1KYQA 1OROA 2WJIA 3ABZA 3WNQA 4ENVA 1SKRA 3Q3IA 2CXPA 3CURA 1JS1X 2PX5A 3LQ4A 2QRJA 3MNFA 3PUIA 4NIMA 4Y98A 4D81A 3V7WA 4DMHA 3VDXA 5CA1A 3KZIU 1E77A 1PP4A 1Q46A 4MK4A 3S1SA 1U80A 4RV9A 2CCGA 4L2IB 5JZOA 2A78A 4QPJC 1X1CA 2PUJA 3H5IA 3H3FA 1ORHA 1L6NA 4PZPA 3IP4B 1M0EA 2FZLA 2E89A 5CIWA 4CKYA 3PTLA 4KO1S 3TDKA 4I28A 2Y99A 4MVYA 1RADA 3EPJA 2I1WA 2JHGA 2WU3A 1EVIA 4BBZA 2R1TB 4A6EA 1NJYA 3MCWA 4PZ0A 4M36A 4IFBA 3C1TA 4Z6FA 2CHEA 4WDQA 3WLQA 4I3GA 3TSOA 3EIFA 3T7EA 4MOWA 4F8EA 4MUEA 1QRSA 2QBYB 4IBOA 3E7PA 1IK6A 2KB0A 3RJFA 2RDMA 2XGJA 2CNWD 1EEHA 5I9SA 3VPGA 4PAQA 4N4AA 3VPAA 2ASEA 3RRBA 2G8LA 1XJ0A 5A6SA 1RBQA 1KRXA 3OQJA 2PJZA 3NAMA 5BPHA 2GVNA 3DXZA 4MV5A 2JZNA 4TN5A 1XO0A 3LCUA 1KFTA 3O95A 1KL7A 2FCAA 1GQOA 1WVIA 4PPYA 4YLYA 2HHWA 1CF2O 1QP4A 3C3BA 4PR3A 2H1CA 1RAAA 3GRPA 3IRVA 1WZUA 1UDCA 2NPFA 2AMVA 1QGAA 4IXWA 4CV3A 5JJBA 1IOWA 4DF3A 2VF8A 1DIOB 3ETLA 4V0MA 2CMGA 2YTUA 1E79D 2Q5EA 2G5CA 3X2SA 4MR7A 3MJHA 5JARA 4NZYA 5JAUA 3LBFA 1IHPA 3MGKA 2UZAA 3T4PA 5FHQA 1WDMA 4DO9A 3GDGA 1QGDA 2FN9A 2KW5A 4MR8A 5KQGA 2MR5A 1U2ZA 1S01A 2BJHA 1SBYA 1L5OA 2K60A 2YVAA 1S97A 2F1RA 2OZEA 3PX3A 2N1RA 1TU4A 5HDBB 5JHGB 3SAHA 1ZQSA 1HQYE 2ZYSA 3VZDA 4DXDA 1NTRA 4ZYTA 4IW3B 3VJKA 1ZL2A 4N0MA 4WCVA 1QG4A 1BROA 4D4LA 3O4GA 1YKFA 3CVOA 3NHKA 1GGHA 3PFIA 2J5RA 3LHKA 4P5EA 3AFOA 3KDPA 2W2NA 2XBUA 5IIJA 5HG0A 4HKTA 3BD7A 5KOJB 4MB0A 4P0QB 3GEMA 4LFCB 3VOBA 2FN8A 1GUYA 3OIFA 4WZAA 1M6WA 2HA4A 3VU8A 3LVRE 1RKUA 4IXDA 1SG0A 3SI7A 5E3IA 2J9ZB 2O5RA 3JYOA 5LC1A 1OLSB 1RYDA 4WT7A 5K99A 3UBTA 3RYCA 3QV1A 1NR1A 4II3A 1T6BY 4BX0A 1W0CA 5LLSA 3HCCA 1XMIA 4MVJE 4B6RA 2PMFA 1KFJB 2AFHB 2XOKA 1SVUA 3PNPA 1GZUA 4O63O 4R6WA 3BZWA 1FJGB 1P61B 1L1EA 1SVNA 3H1GA 1IM4A 1TIPA 4KQ2A 3LUJA 1DJMA 1LW7A 5KJFA 1UJMA 1SKSA 2Q6IA 1Z4JA 4DY6A 4FDAA 4BQPA 3A31A 4JJ4A 4QXMA 2ZT5A 3H4DA 1XC7A 1M10A 2OQRA 1X3SA 1LNQA 2PFGA 2ZS7A 1QYWA 1U4NA 1XZDA 4NCBA 4MMYB 3CNNA 4EOGA 3D2QA 1SQ0A 4GU5A 5TT1A 5L9XA 1D0IA 2RGNA 2BHTA 2V6IA 3DUWA 2Z0MA 1R8SA 4L75A 3WRYC 4AAYA 4ZK2A 4KQ6A 4DMKA 2YW9A 1BAPA 3IAEA 5AVWA 4BKQA 4EHBA 5AW0A 2VTDA 4CIBA 3D2CA 5BW5A 3F6BX 2PMZF 2YXPX 4X45A 4YIKA 3VR5A 3C39A 1KAMA 1YU6A 4MQMA 1SGGA 2W48A 1DKOA 4PZAA 3ZV5A 4J9SA 1LH0A 1FLDA 1QTNA 3EIWA 1RXIA 3UMCA 2G36A 3RVRA 2B8WA 3U7JA 5EJ8A 1O5TA 3L93A 2EARA 3ST7A 5E9AA 3A14A 4ZJPA 4KR3A 5ARCA 2FR0A 3MJVA 1NVXQ 1XAIA 3SZRA 2WTFA 4ZCQA 4XDGA 3SZ3A 1YDGA 4RETA 4OPMA 1P80A 2G77B 1SY7A 1IVSA 1KDHA 3GLHE 3ZHYA 1QKKA 3DBOB 2QZSA 3KQPA 1OV4A 1GWNA 3OP4A 1G8KA 2QKQA 1X0XA 1ZN8A 4P80A 4RXMA 3WWCA 4JKIA 3PFWO 3H9UA 4I1YA 4MJLA 5DK4A 4PPGA 4DARA 1IY8A 3ELBA 4K4IA 5FUQA 1V1JA 4Y9DA 3LOQA 3WHLA 5EUMA 1U7HA 5IHXA 1OW5A 3NASA 2VBFA 4A0GA 2FW0A 3PRHA 3OPYI 5BYJA 1ZD4A 5EE0A 2YZKA 3C3PA 1NGSA 1W1UA 1KJQA 4UE2A 1SVKA 4W63A 1MO2A 1TFUA 2C5LA 2IZ6A 2O3TA 3PNYA 4QW9A 5CX4A 4WL0A 3T54A 2HGSA 3FFTA 3BN3A 3QH4A 4OBBA 4Q1EA 2PG3A 4YD1A 4N41A 3C1ZA 2ZUEA 4RPHA 1WMDA 1B0PA 2NXJA 4P4LA 3LA6A 3M4YA 3ONDA 1L4NA 1P2VA 3GDXA 4G5QA 2YZ7A 3KQVA 4FFOA 1JQ3A 1C1YA 1JIVA 1N3YA 1Y8RB 2QX4A 1B7GO 1I8TA 1I32A 2CXQA 3GYGA 1UM9B 3KYBA 2V0NA 2P3OA 2EZ9A 3JYNA 3NALA 5BNFA 3T8YA 5KQMA 4JIMA 4ARVA 5FHRA 1YBMA 3DWFA 3HCWA 2G08A 2OD7A 2GXUA 2VTVA 5EIWA 3U17A 1DKMA 1PT8A 3PZPA 1BDIA 4HJXA 5GGYA 3KQWA 3HA3A 1VMEA 3R3UA 4Q3NA 4LBWA 3UAWA 5L6MB 5HEKA 1Q0UA 1AURA 2R8YA 3C3YA 2F9MA 3PR3A 4XX0A 4CM5A 1EUDA 2OC4A 2X9GA 3NNNA 3L41A 5KKCA 3E0XA 2HBLA 4Y2SA 1F3OA 1LRKA 1WW3A 4XAQA 2M9MA 1M34A 1ZYQA 1TQ4A 2I66A 2ACEA 2H1LA 4YPFA 3U7RA 3ED1A 3UFXB 3UKOA 3M9OB 1I3MA 1NLYA 2NGRA 2GPNA 3DMNA 3LX8A 3RV4A 1WA5A 1Z8DA 2J46A 2C42A 1DZ3A 4KTVE 4QULA 1UCFA 1LW6E 5K0JA 3PVZA 2XUDA 1KARA 2AMYA 3M1LA 4YJ2F 1E96A 4KLUA 2C9ZA 1BJKA 1Q1QA 2HCJB 4KLGA 2QTNA 1E9VA 3BMQA 3IODA 4X6XA 2G5IB 4HH4A 4RSMA 5EQFA 4DPKA 1IXKA 3KPWA 1OYVA 3CH5A 4W7HA 3REOA 4XB2A 4E2FA 2UUCB 4BUGA 3S0JA 3EZNA 1ZXBA 4O4IA 3TL3A 4TYMA 3TZ6A 3QOFA 3L8YA 4XUGB 4OK6A 5JMTA 3W90A 2Q5LA 1URPA 4O4JA 5DBHX 4ZT4A 4DLWA 5ADWA 2FX2A 3REGA 1RLOA 2AB0A 3FDXA 5YASA 4CR6A 3CKKA 2ZIWA 4QELA 4CCYB 5B5SA 2GJ4A 3AF1A 2IMWP 1E0DA 5KVCA 2IYUA 1XA4A 1MORA 2NG1A 2Q1XA 3MLEA 3RRZA 3FIUA 2H2AA 4P8RA 4DA8A 1HUOA 2ATCA 2OFXA 4ND1A 4BWFB 1YL6A 1XNQB 2H9AA 2C3YA 3JYLA 2J9XB 4DQUA 5ALFA 3LYAA 3P9YA 1ECLA 3AZPA 4IFEA 1WZ2A 2FEXA 3RTEA 3LV8A 4DBLE 2IY7A 2A5JA 3MS2A 1P7PA 3EARA 4ZOCA 4CQMD 2RCYA 4WCDA 1NUPA 1BWQA 2PUEA 4B2IA 2GBIA 3VYRB 3INNA 4NYMQ 1G291 4JOQA 5A5DA 3PDUA 4BWMA 4Y9RA 1C1HA 4MRAA 2BHNA 1FLNA 3WK8A 4RT2A 2JJYA 3GGCA 4XSVA 4BFSA 3ZJVA 1TCVA 3C3WA 4E13A 3EUFA 5EUQB 4B8ZA 2BKEA 1F9AA 1R9NA 2ACKA 4A1FA 3E81A 2KMDA 2LKCA 1V9PA 2VOJA 2YWEA 3OOYA 3QKRB 4MA0A 4B3RB 3D8NA 5KTKA 5IMSA 5CG2A 3VBEA 3IEPA 2P9ZA 1W88B 4ITVA 4URZR 2ONKA 2UVPA 1LPBB 5BSUA 2IYRA 3E2PA 2FOXA 1BXRA 1YHNA 3D4BA 2BCVA 3QVJA 2VS1A 1KDPA 4WXPA 4MB6A 4RL4A 2IYVA 3WOHA 2A59A 5DQGA 2QPLA 2QTAA 3ER9A 3AFMA 3AY6A 2WUWE 4MCHA 5C18A 4RULA 1L5NA 9ICRA 4GPTA 1WKBA 1NL3A 4NEGA 3WB1A 2JHDA 2E4UA 4UZSA 2OXRA 5IYZF 4F4UA 2KZ3A 3ZW8A 3RD5A 2AFHA 4G36A 1CX9B 1PV1A 5D51S 1KN5A 4JLOA 2HBQA 5TB5A 2Y27A 4ZMSA 3I09A 3HPRA 2RSLA 3JWEA 5DLEA 4ONEA 2IV7A 1L7MA 1RI3A 4GLFA 1B73A 5EE1A 3L46A 4DT1A 4YP3A 4G3XA 4ZAGA 3OX3A 5J2UF 5DCLA 1ZQQA 2PUVA 3D1JA 1G18A 3PHLA 4L9AA 3PWTA 2PZBA 2WJWA 3RU2A 1SKYB 3P20A 3GJ5A 4GD3Q 3I1IA 3NOXA 4C5AA 5BMVA 1H93A 3N8HA 3FETA 3MR2A 3HDQA 2D7CA 4IH1A 5ER6A 3TVTA 4E46A 3AP3A 4RQ4A 4P98A 3DNFA 2EJWA 3E8SA 3MOIA 3ADKA 3T3EA 4QRDA 3VA7A 5A0LA 1RKVA 5U4QA 4YPOA 1JHXA 1ADGA 2ILVA 2LCIA 5G40A 1NOJA 1KERA 4XW2A 3BULA 2Q62A 4M1KA 5AJXA 3X1DA 5BUZA 4IJUA 1EXMA 1NQTA 4KMOB 2AHOA 8MHTA 3TAPA 1F0NA 1XSPA 3R20A 4LYDA 4ZT3A 1RWVA 3IOMA 3PKIA 4JJ8A 2DFNA 3IQEA 2HK7A 4TTSA 1VE3A 3NHWA 2BLNA 3FUWA 4ZQBA 2CV0A 4EPXA 4Z7OB 4DS4A 4OGFA 4YAIA 4RQ7A 3BQNB 3UBMA 2IWRA 4O3FA 4F2HA 1FO4A 1LZLA 4JWKA 1WSDA 1MO3A 4MKFA 3EYZA 1P9NA 2YS7A 3NBUA 3PLAE 3OKFA 2Q5OA 1DXQA 3HL4A 3SYLA 3QY9A 3MTEA 4TV9B 4RPXA 2XADA 1PQPA 1FFYA 4R1QA 1S9DA 1EMDA 2VHCA 4B85A 1E9DA 4Z3OA 2OB1A 4TSRA 2QEQA 1SBTA 2B6HA 3P4YA 2H2IA 2BFWA 1MAWA 3DPUA 3Q41A 4QO8A 5IX8A 2EKDA 4MIEA 4YRDA 3WQRA 3S1LA 1U47A 2H4JA 3MAAC 1G3RA 4NP6A 3UO8B 1NKTA 4L9RA 4FHDA 1D8BA 3QZ7A 3THRA 4Z49A 5DWDA 3K2IA 1GDDA 2IYWA 4ZQEA 4GC7A 4EMTA 3HMQA 4DEYA 1L5UA 3NP7A 4WTOA 3JD4A 4JVMA 1HE4A 4XSGA 5K8VA 5HKKD 4I4TA 1VL0A 4GDMA 2WIDA 1SWWA 1KGDA 2YMMA 1MA0A 4NZPA 4Z4IA 2O3SA 3IJRA 2VIXA 4I29A 3TQFA 3I2HA 1TQHA 1Z22A 2AEFA 1EESA 4JV1A 1X1EA 2JGJA 3SY8A 5JI2E 3F90A 5AICA 4OJLA 4AN4A 1ZZEA 3TOVA 4F2PA 3K1TA 4BBPA 2AXEA 2IXTA 3L6CA 2QRZA 3M3DA 4ZT2A 3RSFA 4EY7A 4ND2A 4DSUA 1RHUA 5BRNA 2AKAB 3VU3A 4LYJA 2PXIA 3NVWA 1AT1A 2QPTA 1M2FA 3B70A 2ZYVX 3N76A 4L8WB 4G0VA 5B3JA 1GNTA 2ZRAA 5F77A 4CQMA 2NMVA 5B2EA 1G41A 1I4TD 3CZRA 5CNMA 2TMDA 3U39A 1ZW1A 4ASUA 3LFUA 1KFKB 2AD1A 3FRHA 2W04A 4QZFA 1AN0A 1ELOA 2VL7A 3UWMA 3JALA 3E03A 2HHLA 1X1AA 4ZQCB 3BMXA 4ZVMA 5ERYA 4PVCA 2EQYA 5J4KA 4HYTA 3AEUB 3H2JA 4JR2A 1BWSA 4MV4A 3O2JA 2RGCA 1DOQA 5JS6A 2HHVA 3ZWQA 5H83A 5CDFE 3W3AA 4G9GA 1KPIA 4TV9F 1B4DA 4WI1A 1R7RA 3ZHOA 3G7SA 1AM4D 3EWIA 2BKVA 3WYDA 2B7LA 2R68A 5AHRA 2OG2A 3EY4A 3HPQA 3MWGA 2IPMA 2C2BA 2A57A 4Z6DA 2WDZA 2YXDA 3ZHXA 4C0KA 5B7NA 5CB0A 2VC2B 1KEWA 3OZWA 3INYA 2PSJA 4QTUB 4L8FA 2LKYA 1NJ1A 1DX4A 3RLFA 3TTXA 4DWJA 5CDSA 4DS3A 2H3HA 5GV7A 1KEEA 4AO6A 1Y3AA 1WAMA 3L8ZA 2GETA 2HQBA 1A5TA 4G0NA 3ROKA 3EYWA 4IV5A 2WTBA 5AUNB 5EMKA 5LNK6 3VZSA 1Y7LA 3FJOA 3U80A 4KMOA 3X2EA 3WIVA 3UFBA 3VKHA 5CLGA 1MVNA 2VP5A 4LK2A 2PAFA 4A10A 3N7RC 2Z8ZA 1ZR2A 4EM6A 1PR2A 3VNRA 3O8RA 2D5IA 2O1SA 2PMKA 2QD4A 4OOEA 4OI2A 1VGRA 1LK5A 2RI1A 1UBMS 3RVKA 5FULA 1S2OA 3JRNA 1CEEA 2CLEB 4G4SO 1PE0A 4CCSA 5BSEA 2HF2A 5TRTA 4KVAA 4BO1A 5JUMA 1IULA 4U6QA 1YJ5A 1G6KA 2I6FA 2QE7D 2YQZA 3W6UA 2FMKA 2DGDA 1B8UA 2W42A 2DWPA 2RG7A 4RCVA 4LV5B 4DILA 5AP9A 3FPJA 2O19A 3F5MA 1Z4KA 4BNKA 2GZRA 3OFJA 3O8OB 3V3KA 1E3TA 4M9NA 1OWNA 5KX5B 4I55B 2QAGA 3OPYB 4OJKA 3NBAA 1CUHA 1HTTA 4QZBA 4UEJA 3NCTA 2FR1A 2PGLA 3MRSA 4E0BA 3T9AA 1GPKA 4JBIA 4MAFA 2V9CA 5AW8A 3HRIA 3QSYA 4C4TA 1IUPA 3WJ2A 4RVGA 4LG1A 1RE0A 3KSZO 3QU7A 3I9JA 4DDWA 2P66A 3EXAA 1GUAA 1ABFA 4DSLA 3JATA 4OIMA 1CRPA 3MTQA 4X20B 3RH0A 2IHKA 2W6OA 3UWOA 1MB0A 3JR3A 3LMKA 3RS3A 1IZYA 2J3MA 1PJ4A 2J9FB 3OI7A 4HS9A 2G67A 3ZVNA 4AI6A 3KOYA 3ZR4B 3NUQA 4YUZA 4BQEA 1N1EA 1BE0A 5HIAA 1SHLA 3NV9A 5JBQA 3DKKA 5KDDA 5KSZA 4EZBA 2NU9B 2F8KA 5FTMA 4WY2A 3VMMA 3P9PA 3T3MB 2BM0A 2QYOA 4NMHA 3N8GA 4UULA 4K1LA 4QUKA 3IB6A 4ZO8A 3AVUA 4LRXA 4XUCA 1C8KA 1B0ZA 5CCEA 2X6RA 1XKTA 4GZLA 2OV4A 1E2JA 9ICMA 1P0PA 2AHOB 3DL4A 4JBXA 4LGMA 5AKJA 1XVTA 1DCMA 2ZQ5A 4MCIA 4M98A 2WHEA 5J0UA 2IYYA 5LVAA 2C98A 2D1SA 2JJ1D 3AUJB 3FTPA 4V1CA 2CDBA 3IP9A 3W4JA 5P8WA 2Z58A 1VE7A 2ES4A 3VZQA 4QBKA 4TMZA 5EZSA 2DERA 1RBYA 3MFQA 4RHUA 4R7GA 1WQ4A 4C2BA 3BSYA 2C3MA 1MPXA 2GUWA 1MJNA 3KB2A 4ZOAA 1C3LA 4MQ4A 3RV3A 4BNJA 1G5HA 5EZ5A 4Q43A 3ZD8A 1FE8A 1VG8A 2ZE6A 2IHUA 4KBGA 4HWKA 1IDN1 4OYYA 2YYYA 4ISCA 4JEIA 2QN3A 4KLJA 2ACVA 3IOEA 4MEAA 5BN4B 1BFUA 1JQ5A 3CRVA 4C7MA 4P34A 4CMEC 4D82A 3EGWA 3O47A 4FBLA 1C4WA 4IIJF 4RUCA 3U7QB 4TRJA 2CYBA 1WMSA 1ZPDA 2ERXA 3GJRA 3NGXA 4KK4A 3ZGVA 3MINB 4XRGA 3HB1A 1Y5RA 2AZMA 4AJNA 4RZXA 5A03A 1ND5A 1D9XA 3M82A 1M1UA 2UZ1A 3EGVA 1WPXA 2C84A 1GNVA 3G0BA 4B83A 4DCPA 3ILYA 2A9JA 4R66A 1L7QA 5KFUA 2IXBA 1AXRA 3DLTA 2NQ2C 3QELA 4IRUB 4F2RA 4WECA 2VCEA 2XF8A 1QHNA 1Y1LA 5LBIA 3TTYA 5CEHA 1WB9A 1RPZA 3OCVA 1WZNA 1N7JA 2Z5FA 3K9LA 4LNAA 2ZUSA 1DCTA 4D02A 4YRPA 1O77A 2BR0A 3E9EA 4KB5A 2QP3A 3D6VA 3DXXA 3FF1A 2WIGA 2PGAA 4XUDA 3G0DA 3IV9A 1QSSA 2H63A 1YD7A 4I2BA 4R31A 4TVKA 1GCAA 1HT3A 3AUKA 4RIGA 3ESBA 1QVAA 3TFSA 5DBBA 1LNSA 3ETCA 3HXKA 4QREA 4YNBA 3TSZA 1Z3IX 5TMPA 3NYIA 2PS1A 2F8MA 1CJKC 1M1YE 5E6SB 3WJAA 2GN4A 3M6FA 3B13B 5DCUA 4ZDIA 2RGDA 3RRJA 3AQ4A 4G1CA 3AIKA 2A0UA 2V03A 4NG5A 2YMPA 1BXKA 2QW1A 3TD6A 2WA2A 2RGGA 1K6EA 1Q1EA 4ZU3A 3KHHA 4FZ5A 4CI9A 1YB6A 4BMYA 4F3CA 1H2HA 1RACA 3DHEA 4JR1A 4K5QA 1P9WA 4LOAA 1I10A 1MZPA 2FW7A 2UYGA 3TCNA 3PFNA 2DHEA 1JI3A 3PQCA 1ZICA 3CZQA 2EC5A 5CJJA 4OHPA 4B9LA 4IHQA 2ZB2A 3LXRA 1C7ZA 3OPQA 3HCRA 1XTSA 3RS2A 2PRJA 1OX5A 2DH5A 4G4SP 4BB5A 4DZTA 1KR5A 2BPGA 3EOAI 2PSEA 4NEHB 4IF4A 2NUBA 1AUXA 2QUHA 2Q46A 4RKFA 1T2FA 2DKXA 1CNMA 3C23A 2FSGA 3R3XA 4YJHA 1WBDA 3MYRA 1DP4A 4RANA 4Z8YA 1TJ5A 4RK1A 3LF1A 1GYRA 4EYIB 3GCWA 2P62A 5FJIA 1FX0A 3BBLA 2XYRA 3FMIA 1ZQUA 2G0AA 3TGLA 3JY6A 3V8EA 1FF9A 3UTDA 3V7LA 5KFKA 1T43A 1FXWF 2UUPA 5D1NA 4DQPA 2PYIA 4EPYA 4NV0A 2A9OA 2V45A 2GF0A 3AYXB 3D31A 3GA7A 3PUXA 4M1TA 5AJVB 5KDLA 3KKZA 1RRPA 2BMDA 3KU1A 3H4BA 1UKCA 2XCIA 3JXEA 4UXIA 4UU0A 4ZOBA 4A6PA 1Z00B 1OZGA 2EANA 4YB8A 3IG5A 1Z0KA 3WL4A 4EA8A 3QU5A 2R6DA 4X94A 3AUFA 3ZCUA 5I9LA 2GSDA 3FMOB 2VDLB 3ZGXA 2PNJA 5K6AA 4XR9A 3VNVA 3GA0A 5CJ2A 1DIRA 3DT6A 1Z34A 1V43A 4OHVA 5C1DA 2J41A 4DA7A 1YHYA 1DL5A 4GX1A 5KQLA 1JPVA 1QFXA 3R7WA 6REQA 1W9MA 4S1VA 4MXDA 4GI3A 2WJVA 3PW7A 2Q6TA 1UCVA 5HIMA 4E88A 2C59A 1A8HA 3O9ZA 4DADA 1V4NA 4B7XA 4TKUA 3MYYA 4K9LA 5I7SA 2SHKA 3VPXA 4FYHA 3N2ZB 5SZJA 4LJKA 3GU3A 1SL1A 1N61A 4BNHA 5KFFA 1ZJJA 1FSZA 4XUEA 2BCEA 2PX2A 4AY6A 2J4FA 5I9NA 1UT8A 5AKIA 2WOJA 2C04A 3HLTA 5BV0A 5JAZA 5EEGA 5BPFA 2B36A 2QARB 3DB2A 2NSLA 3E4CA 1X8XA 1ISSA 2BFBB 2JV3A 4OJOA 3T61A 1NWCA 3EEIA 3KO8A 3HXTA 3F74A 4DSTA 3EY9A 5DNCA 2Q7OE 2QX7A 2YNMA 4K28A 1T8SA 1JROA 1KI1A 3U0VA 4GI7A 1KSJA 5IK2A 3OAAD 4FGJA 2E85A 4UNQA 3GLHA 4INJA 5ALXA 4EJMA 3CX6A 3F6CA 1CZRA 3LG2A 4DE5A 4HQLA 4MVJD 2AG6A 2OY0A 4FX2A 3VAYA 4K6CA 3LPDA 1OY1A 3PR1A 4WLOA 4O3RA 3FIJA 1TK3A 3D3QA 3PC6A 1GZVA 1QFSA 4M6WA 2EOAA 2G9NA 1EKXA 4QYIA 2OA0A 5GY7A 4EKNB 1EFRD 2ZB8A 1O5IA 2BL4A 1HQCA 1EFVB 2C8LA 1WLYA 2OD2A 1YQWA 2QLNA 3HFJA 3WTBA 1N77A 4WK6A 1YC2A 5L51A 4HDKA 4C1BA 3F2IA 3HCEA 4F9TA 4MA4A 2WHXA 3M9LA 4JU9A 5FNVA 4Y2UA 2BV3A 2MMCA 3ZDDA 1VI6A 2BSAA 3JQGA 5CHGA 1TQ8A 1ZBQA 2VR1A 4GSLA 3QW2A 3S7ZA 5BNTA 3EZ2A 3N6RA 5EWMA 3B1FA 4Z3DA 1Y7HA 3QVUA 4RMIA 2MIIA 3P9RA 4NOLA 3PR4A 1SFRA 3GAZA 4L22A 4NDZA 1B76A 2F4VB 1QYCA 2R00C 2NV0A 4JQCA 4Q02A 1YZKA 1HNWB 1JSRA 3MR6A 1NBME 2PN1A 1QHIA 4KV7A 4PAMA 3KKLA 5HQ3B 4MW5A 1B6GA 3NFYA 3IT0A 3SYKA 1P60A 1VRVA 3OLQA 3QBTA 4ARBA 3W5DA 1BNOA 1KP2A 3UHOA 3GLGA 1QHEA 1RYEA 5KJEA 1V4BA 3R0XA 4MW7A 3KBOA 3KE9A 4YAOA 4YCNA 4TLDA 8ICUA 1KAEA 5LZ7A 9ICXA 1NJ2A 3QY0A 4FC6A 3VU0A 4D0RA 4R0MA 2F3PA 3BIWA 3GYBA 5KTOA 3CW2C 5IYZA 3TWOA 3RIXA 3WL5A 2P2LA 2ZIGA 3A9UA 4IGKA 1ZC4A 4M8KA 1MO5A 3BKWA 3ETHA 4WRRA 2AVDA 1TNDA 2IZ5A 3FVQA 4D41A 3PY8A 4OX9Y 1KXZA 4KLEA 3OIYA 1V9LA 3ISTA 5AK0A 2Z6QA 5BORA 2QR5A 2MUTB 1Z08A 2X40A 2LI6A 5ALGA 4UBBA 1XS9D 1GAJA 2W6CX 3BXFA 4WZAB 3S55A 2PSDA 2H17A 2IU4A 1E3QA 2QTTA 3I2IA 4S2UA 5IAGA 4G0UA 1E8MA 3MHTA 4KPUB 1NNSA 2O3UA 2Z2KA 2XQKA 2M2IA 2P68A 4L4ZA 4D3ZA 3ZV4A 2ZIWB 1RM3A 4M0KA 1AGXA 2JZCA 3CW2A 3WLPA 4CCYA 3LL4A 4NWIA 4C2TA 1RWNA 1XL1A 3BORA 3SAJA 1VLHA 4O2BA 3WV5A 2OYYA 4EW1A 3K6SB 3GRKA 1LLDA 2NP6A 3PNSA 1OFHA 5DI9A 4IIJA 2GGSA 2VPWA 4PO1A 3L0DA 3VHRA 3K1YA 3IP8A 5JE8A 2EW1A 1KY4A 4RH3A 4Q00A 4C20A 1DIHA 3FHJA 1K4KA 4S1OA 4AK9A 4G6ZA 4CM4A 2JGDB 9LDBA 4KU4A 4WLEA 4L0MA 3TGWA 1IIPA 3GQBA 3V6MA 1MC8A 2VF5X 4KNYA 1MN8A 2B9EA 2FH5B 2DR2A 5H0IA 2HO4A 4QEDA 5EY5B 3PMLA 2F8LA 1BJTA 4C08A 1GL6A 2H2HA 1PR4A 1U11A 1JBKA 2ACWA 1Y4DE 1G20B 5KTMA 4FUTA 4W9MC 4AP6A 3FYHA 3NTQA 1OF1A 1D6NA 1O6ZA 1OWMA 2A9VA 2LW7A 1BX1A 4IS2A 3VH3A 3WMGA 3DL7A 4LNUA 4KN4A 2KG5A 4E94A 4ZT7A 2DBYA 4CMHA 3GRUA 3A27A 3EIXA 3DMTA 2ZIVA 1WDWB 5GADl 1E6LA 4IDAA 1ZOSA 3JQ9C 4JZYA 5EMHA 1CLEA 1EZ1A 4MRNA 3NRBA 5IJAA 3RG8A 4BYGA 2ODTX 3AL0B 1ZJ6A 2I3ZA 2JIZD 2O0JA 1NSYA 4ZO4A 2W9AA 2FMUA 3LRTA 5TDHA 4E15A 4B84A 4MTLA 2ISPA 2O6KA 1VBMA 1VI2A 1OHHA 3IHTA 1RC0A 1P4JA 1YS6A 1ZGAA 2CUNA 3JRWA 1XLTC 3FKSA 4O1HA 3X43A 3ZGYA 3G9UA 3FNHA 3AIIA 5FA6A 3DFMA 3HBFA 1PJ2A 2A35A 2PZAA 3Q9UA 3SE0A 4KX3A 3T4XA 1VPEA 3NT4A 5JQGA 4EYGA 2BSQA 2V7TA 2VPQA 3KOZA 3MSCA 3M2TA 2AJDA 2H5EA 5FPQA 5FYQA 1NUUA 5CH5A 1KWKA 3FD8A 1V3UA 3MJSA 4BJQA 1KBUA 3TPZA 3DDWA 3EF3A 1G7SA 4ECWA 1Z37A 4DL7A 1KEKA 1QGOA 2GZ3A 4RUAA 2YRWA 3Q7EA 4Q24A 3WLFA 2R6JA 5L3ZA 1LPPA 1KVUA 3A9WA 3GJ7A 1U4OA 3BIXA 3EXFB 4WQMA 4E2XA 1UOPA 4IGAA 3P2YA 5CITA 1TVAA 2FGJA 4FXPA 4C7OA 1QK4A 4QE3A 3NM5A 3CUSA 4FDMA 4OD0A 4GYYA 4C29A 2HMVA 3PFHA 2EHJA 4P92A 5BN3A 3GRVA 4WOPA 2C2KA 1U3DA 1QIMA 4KO3S 1J7KA 1H6BA 3CRNA 3MBYA 4ZO6A 4CM7A 1NI4A 2HU8A 1NUAA 3WYFA 3G49A 3HN6A 3QQPA 4XM2A 1RHJA 3RFUA 4B79A 2JARA 1RM0A 4H4EA 4KI7A 4NV3A 1BPXA 3D3KA 3T34A 3QEKA 1RC1A 3O92A 3RGGA 1GFIA 4RF3A 3M8RA 5CFMA 1JMYA 1VB3A 4QBTA 2P8JA 2Y1XA 4QUHA 1SKBA 1F7VA 2PKRA 1BVYF 3JQBC 4OL9A 2EZTA 2XMZA 2AC7A 4DMUB 3GGGA 3PL1A 1XMQB 2I29A 4TKZA 1RYYA 5KG0A 3T3HA 2CXRA 4FLMA 3QVOA 2ZPAA 3K0FB 3N0VA 1CY0A 1RXCA 3OEWA 4MHSA 1PX2A 1NQUA 2ZR0A 3GV5B 1Z1VA 3KP1A 2E4VA 4JJFA 2YS6A 4M47A 4KN5A 4KVZA 4XJTA 3LF2A 3NRCA 4L8LA 5I7AA 3TIVA 4DNQA 1CHNA 2R8HA 1QHXA 1ZM2A 2VQDA 4RJJA 4PHEA 3SEQA 4BFVA 2QKYA 5JRJA 3SQXA 3K71B 4W5NA 4UJ5A 4DQSA 3AEXA 3N59A 4G5SA 4ZOHC 5EJEA 8AT1A 1LBHA 4EENA 3O31A 5LIRA 3MUEA 2WVAA 1VMIA 5AXBA 2IH2A 4FN5A 1RI5A 3CO0S 3L8FA 1I7SB 1PSZA 1E7MA 1G55A 2IV2X 2LYHA 1M2WA 1NN3A 1L8AA 4KO2S 2DG2A 5G53C 5JS2A 4ZEXA 1Y3CE 3B89A 1FP7A 4YMGA 4A8JC 5B1EA 1JV2B 3EQ7A 4MO2A 1KO7A 4C6TB 2F76X 1Z17A 3CPHA 2WABA 3BIOA 5A9SB 4TZ0A 1UKYA 1WKCA 2IHVA 3NC0C 2FW1A 3ZJYA 1WV1A 2HV8A 3CE9A 4BZPA 2A0FA 2ZIFA 4NENB 2EP5A 2FSVA 4BLVA 4BO3A 1EUQA 3OQ6A 1T6YA 1GLVA 3OO1A 4EG5A 5GVRA 4L5BA 5GAJA 4FHFA 3FAKA 2IELA 4O3NA 5BR1A 1Z13A 3N7PD 5KFBA 5L1IA 4O3SA 1RWOA 1R0ZA 1RQGA 2D5BA 1DAMA 2IEGA 3BXXA 3CSUA 3DVLA 3B7WA 3HSSA 2FWPA 2OHGA 3PPIA 5LQUA 1GUDA 2RH4A 4DV7B 1VJDA 3GLGE 1A2QA 1FQWA 1M83A 4KIWA 3KCQA 5TQ2A 2P4SA 1YGPA 4V0OA 1N9GB 3X44A 1KVRA 2JLZA 4LVOA 2FOIA 2V7UA 5CM2Z 5A4MS 1YB5A 3JQBA 1D7AA 4LYYA 4F86A 3E0FA 1QIEA 4NCNA 1FS4A 5THXA 4UCFA 2QXUA 3W05A 2R8KA 3NDJA 4C0BA 5J2TA 2ZAMA 2QT1A 3G8YA 3QLTA 4OHXA 3HT3A 5J2IA 1GARA 1P2DA 2FX5A 4PLZA 5EIHA 4MV9A 4OVKA 3IKTA 2C4KA 2AR0A 2CXXA 4GVLA 2RBEA 3U7GA 4C0XA 2FE1A 3AO0B 5KYTA 1J0CA 2A94A 3HHEA 3SYZA 1I4EB 3WY9A 5J2CA 4ACOA 4O3PA 5C0YA 2IYSA 3BYZA 3TFQA 4EI2A 2AQIA 3Q3EA 3EOBI 3TLBA 2Q5QA 2J87A 2ADFA 3PF9A 3MCTA 4Y9UA 2G1AA 2F6RA 4N40A 3N3BC 4TQRA 4WUTA 5FA5A 4Q0MA 4EI7A 1XKQA 4B9VA 1EFUA 2A1UA 2PXHA 2O2JA 2H18A 4B4KA 3WGIA 2XZLA 2I2DA 3OOHA 5I8PA 2PANA 3FSJX 3QEJA 2XI4A 5G1OA 2I4OA 4HDOB 2GUGA 3F8SA 1Z16A 1PW7A 2OV3A 2VH1A 3W2GA 1T8RA 4M7RA 3B5JA 3RJ5A 4CGYA 5C53B 1D2GA 2HBJA 2ZBDA 2HNBA 2OFOA 2XE8A 5MN5A 1RZVA 4NDNE 5T4HA 1JE1A 2BT4A 1UDAA 4FT4A 2X5KO 3RRNA 1GDHA 2YJGA 9ICLA 4US9A 2X7JA 1K4MA 1NPDA 1RRVA 3IMGA 3QLVC 4QJIA 5M7EA 1I9CA 1C30A 5KAMA 5BW4A 2Y1WA 4B7UA 3R5SA 1PWZA 4F50A 4GGOA 3SM3A 2ZIXA 4BV9A 1OI2A 2WFMA 5B7GA 3H65A 5F3DA 1P7WA 4BB6A 4Q45A 2YYZA 4H59A 2A5FA 2WB1F 1IZ7A 1XSLA 2IYOA 2CJPA 5KTQA 3FWKA 1RYZA 1XCBA 3NU1A 4YR0A 2CJWB 4Y2XA 5EE9A 4J0KA 2AOUA 4DXHA 1LLQA 4FZNA 2R8IA 2DKFA 4RQ6A 4L9WA 4N03A 1NU8A 3K4HA 5J2DA 3MM4A 4RTQA 2BYTA 1JYFA 1OKKA 1GNSA 1U0FA 4B17A 1O03A 1XHFA 4KDCA 1BU5A 1M33A 4NFYA 4XDZA 4PNPA 2ZUUA 4XX1A 4ALMA 3QLEA 4PICA 1N8TA 5E3HA 1L4FA 2I99A 4LI3X 3WLLA 4FM9A 4TROA 1JG6A 4OXXA 3D0OA 3RF7A 3AU8A 4L02A 1QNFA 1F8XA 3DAFA 4RLHA 5EOZA 3PJDA 4MRVA 1M8JA 1T35A 5GM1A 4F46A 1KI3A 2W3RA 4HPJB 5CB8A 1VL5A 4F12A 4DPLA 2JGNA 4DJ5X 4JJ7A 3PXUA 1OXBB 3QEAZ 2ZP1A 3G1UA 3RJJA 3T94A 2XPCA 2ZJAA 2XCRB 2QB5A 3TACB 3M1IA 1EU1A 2VTBA 2Q5IA 4MV8A 3O4IA 1TFRA 3DMGA 3WL3A 2PWYA 2WIFA 1M6VA 1AF4A 4ZAFA 1EGVB 1XJQA 4AS2A 4WXEA 4WBNF 1BTOA 2VXBA 2WJHA 2R8GA 3ROZA 1NYLA 4CKBA 1NX6A 4LF6B 3VC8A 3PLRA 5JZBA 1EWQA 4LHYA 4NOMA 3TUJC 5JALA 4ZQIA 4NCAA 5C8DA 1V41E 3R7LA 1G16A 4RQNA 2YQ5A 2YOFA 1BXRB 2Z4SA 4AYWA 4F4JA 2NXWA 3OTOB 3PTAA 3GILA 1Q92A 2RD2A 2W6IA 5CURA 3NVKI 1VE6A 2FSFA 4P3KA 3I76A 4JBWA 2FPOA 1FW6A 3QLVA 3Q7SA 4YQYA 5A71A 1QDEA 5IASA 4RD3A 3GDHA 3KUUA 3SR4A 2RK3A 3BBPA 3BS4A 1HDIA 3QE9Y 3HDTA 2P9JA 3AKCA 3OCXA 3UF0A 4GLOA 3VKUA 2CKMA 1KE1A 4HDKB 3PZBA 2JEOA 3QTTA 1L3VA 1FUYB 1ZMBA 2C96A 2WF5A 3I28A 2IE8A 2M0NA 2JGAA 1AK9A 2GLTA 2OC9A 4JNKA 1SC4A 4XGNA 4J9KA 1GUBA 1P31A 1QG2A 2AL7A 3FAZA 4MJ3A 4F4FA 3MGCA 3IG8A 1SVOA 3A26A 3JW8A 4EZEA 1M9NA 1Z28A 1LSJA 4I55F 4YROA 2R6ZA 1BD3A 1Q1AA 1FXSA 1W2HA 3G9QA 1EK2A 1MJ5A 1DAHA 1GADO 3E15A 3GD5A 3D7MA 4IX1A 5DBEX 1JXEA 2OHJA 3EAQA 5HZMA 2A5DA 3FH0A 1IY0A 2O52A 4J7AA 3EF1A 2BMAA 4G09A 4OL0A 4M76B 1WEHA 1Y6FA 2AWOA 3IDWA 3RFVA 2JFXA 1VRWA 3GP3A 4IKOA 1M6VB 3M89A 2BGKA 3BXZA 3URMA 4TTVA 3SNHA 1JDJA 5DNYB 4EB3A 3HK2A 5CM8B 2J6TA 1R6BX 3BQ7A 2O7VA 1W36C 1J1IA 3BJZA 4G9BA 2KWIA 3N75A 5K4AA 5MFPA 1N60A 4R84A 5LB2A 1SULA 1Q20A 5AW2A 4EGAA 3PC2A 3EQ9A 1U98A 3EXG2 4F11A 1RR6A 2Z57A 4P31A 1K5GA 3WJ1A 4Y67A 3KQHA 2GTIA 3Q11A 4WWHA 3H84A 5TGDA 4IMJB 2TS1A 2V7EA 2X14A 3CUYA 4TSKA 4XJXA 4EL5A 3WGMA 4HWPA 2H7VA 4ARUA 5LDGA 3VHQA 5AI5A 2PS9A 2F62A 2Z98A 2WZDA 3AHCA 4LMRA 3UMJA 4Q9DA 4M8LA 4BFUA 1O89A 3TB6A 4Y0VA 2HU2A 3C8MA 1EBUA 5FUBA 3H7IA 2OGTA 3LS2A 1Y8QA 4U8GA 2R7LA 4F60A 3K4QA 4J1TA 2QLJA 3ACBA 1JP7A 2EL7A 4A2CA 5ECGC 4BFZA 2IP4A 3KHUA 1G8FA 3NDIA 4CWAA 2OBNA 5LBTA 2HR1A 1C4OA 3W34A 3UXMA 4ZIRA 5I3ZA 1ADFA 3QOWA 1M0WA 1A96A 2X5OA 1XN1A 2XWQA 3B1XA 3OWXA 3R40A 5J0PA 4F2SA 3D1VA 2IS6A 1QFJA 2PR2A 4ZK6A 4CLRB 1KDOA 3VCBA 4MDYA 4HTAA 3HJAA 1XB2A 4DMGA 5F98A 2YY7A 5HDQA 2AR7A 4RC9A 1S1MA 4YRKA