2ZIVB

Crystal structure of the mus81-eme1 complex
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
332
structure length
269
Chain Sequence
ECLKHIIVVLDPVLLQMEGGGQLLGALQTMECRCVIEAQAVPCSVTWRRDWVEEPTVLVLLRAEAFVSMIDNGKTLQGFVTDITAKTAGKALSLVIVDQEKYFRSQLPEVSRVDAEEALVDLQLHTEAQAQIVQSWKELADFTCAFTKAVAEAPLRDETTFSFCLESDWAGGVKVDLAGRGLALVWRRQIQQLNRVSLEMASAVVNAYPSPQLLVQAYQQCFSDKERQNLLADIQVRRGESTSRRIGPELSRRIYLQMTTLQPHLSLDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Mus81 protein
publication title Crystal structure of the Mus81-Eme1 complex
pubmed doi rcsb
source organism Danio rerio
total genus 68
structure length 269
sequence length 332
ec nomenclature ec 3.1.22.-:
pdb deposition date 2008-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02732 ERCC4 ERCC4 domain
B PF02732 ERCC4 ERCC4 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.670 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2zivB02
3.40.50.10130 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2zivB01
1J24A 4P0PA 4M6WB 2ZIVA 1J22A 2ZIUA 4P0PB 2ZIVB 4P0QA 2ZIUB 2A1IA 2BHNA 4P0QB 1J23A 2JPDA 4BXOA 2BGWA 4BXOB 2ZIXA 1J25A 2JNWA 2ZIWA 2M9MA 2ZIXB 4M6WA 2ZIWB
chains in the Genus database with same CATH superfamily
2OO5C 3PUHA 1FRVA 3A9VA 1TM1E 3RKUA 5DTJA 4UDXX 1OGIA 3LT5A 2YFQA 3FVQA 1WZNA 4JYZA 3OPXA 1LRLA 4ND2A 1QHHB 2J9ZB 1CUDA 2C2WA 4JI3B 2QTHA 1F9EA 4V38A 3CRW1 5JAQA 4A1FA 3PJEA 4MB6A 1A2OA 3N2KB 2AZXA 3LT2A 5HJ2A 4OLBA 1R0XA 1NRXA 3THVA 3M9MB 4ZVSA 3DV9A 3GPCA 1B73A 5CH8A 1R3DA 1VBKA 4OQYA 1K75A 2GK3A 3E5NA 3KUXA 3ZZNA 4MHOA 5KYXA 3R0VA 2JFHA 2YNMA 2AOTA 4P4SB 1Y4AE 1WDWB 5IFLA 2VJLA 4EJ0A 2ZRCA 1YZNA 4XPIA 2QG4A 2WPNA 4YG2A 3X1MA 5JT1A 4PPGA 4IS7A 3D7LA 2E18A 2A88A 5ANRB 2FWPA 4GBED 3TFWA 7YASA 5LFAA 2VKQA 5JRZA 8ICWA 4CR7A 1JG6A 1J39A 3LWMA 1EIZA 1E3SA 5A7GA 2WT8A 4L5IA 3EQ7A 3L4BC 3ZU5A 2O3JA 1ZM7A 5LLTA 4C43A 4HEA6 2KHQA 4NDNE 3T4XA 3L0IB 3ZEIA 2FX2A 2GJ9A 3B3QA 4PYJA 1BFKA 1RWWA 1F0KA 4GLXA 2XQVA 1SPBS 3K0HA 1C80A 4BE4A 4BNIA 2BT4A 5IWAB 5ELXA 3GV0A 4BECA 4HPXB 3QUQA 4Q0MA 1WXFA 1BWQA 4MQEB 1H65A 2ZE7A 4WBSA 4TVKA 3MTBA 2WM8A 1GGVA 3GF4A 1DTWB 3AFIA 2QTVA 1PD1A 1ILWA 3K9HA 4OGGA 3A9TA 1OI3A 4OL9A 2FUCA 4US1R 3CE9A 2Q7OE 1HG0A 2VPQA 3EG9A 3ZX5A 3CC8A 4BMDA 3KPVA 3QOXA 1D6SA 2JLZA 4WZBE 2ZYHA 2OMKA 1R0CA 1ZXLA 3KB2A 2AMJA 3EXG1 3PYMA 2XQJA 1AV6A 1M5TA 2HIGA 2DX7A 4BNHA 2JANA 3UJCA 3U3XA 3KTOA 4FVTA 3QVUA 3WV4A 4OEHA 3AUAA 4LJYA 5L1MA 1WXIA 2PE5A 3DOEA 4QHTA 2GBCA 3CVJA 4EYHB 1L5LA 5FQNA 1ES9A 1FTNA 4KMSA 3JPOA 4H7FA 4X7BA 1GZ6A 3UOWA 4BTVA 4LZAA 1YR8A 3EUB2 4ESHA 1SU7A 4GQIA 5GZ1A 3X3HA 2IYZA 4E11A 3JAKA 1UUFA 4NQZA 4PU0A 4W7SA 4BNYA 3OIDA 5CURA 3NZEA 1IDOA 1VBMA 1XCLA 4NFYA 2W4MA 3WIBA 1KVQA 4XVUA 1ZETA 1NZJA 2I7TA 1XMIA 5CVDA 3G89A 4B44A 4QRIA 3BICA 1SBQA 2WYVA 5E1DA 2JFFA 4ZMBA 1XE3A 4U2DA 4MULA 4EECA 1HETA 4X60A 4RPHA 4ZMSA 5JZMA 1XC9A 1HE8B 4RJLA 1VL1A 3IQXA 3SV4A 3VJLA 4A1OA 2UZ4A 4X92A 1PO7A 4KYTA 4EUEA 4XIFA 2RHMA 3JCZA 3WBKA 2Z5VA 3U4QA 4E14A 4BVKA 2QG6A 4EB6B 1XTIA 3R3YA 3QLUA 5E3JA 2GPYA 4EJ6A 2I7DA 5I7OA 1T8YA 5L51A 3VZDA 5LB2A 1OD6A 2FSPA 2YXPX 2PFGA 3OJFA 4IDCA 2AC4A 1T6BY 3I2KA 4QIWF 1RQXA 3OFND 3PK0A 1YCGA 3E0QA 5JC1A 4FFNA 2G36A 4BJ1A 2QTWB 1TMYA 4HNGA 4H3VA 3L7MA 5JI2E 5KT7A 3TGLA 4M38A 5GV8A 1A6SA 3KU1A 3CW2C 3O8QA 1K8XB 4BAGA 3KUDA 3QG5A 4I1RA 4GG1A 4GC9A 4GSLA 3PPVA 3GIDA 4L4RA 3GHHA 1K4YA 4H27A 1JA0A 1FUYB 5FA6A 2IOYA 1KK1A 2C2RA 2JAWA 3U3OA 4JP2A 4BNWA 1VMDA 2EL7A 3T8YA 2BRUC 2WM3A 1SG9A 1YR6A 3ZWDA 1I7PA 3MJHA 2VWPA 3AUFA 4KXLA 3GMIA 1PRYA 2CXTA 3U7RA 4L15A 5M3BA 3WKBA 4OX9Y 2WTAA 5LZ9A 1C4WA 4U6SA 1C20A 1XSPA 1OBCA 4HYQA 4A23A 1C3OA 4EJSA 1CNMA 4PPXA 2HRQA 2P79A 4Q9JA 4FWIB 1ECLA 1C0PA 3A9SA 3LO5A 3WGUA 3KL2A 1Z5WA 2ZB4A 4YJ3F 4TV8F 4X65B 3ZDQA 2KLHA 3G85A 5BSUA 2REOA 1J33A 2GPTA 1OWMA 3W2TA 4EW6A 3C74A 2ONZA 3IKVA 4E51A 1YI1A 1IV8A 1R3UA 3CG0A 3NDPA 3KUUA 5I7UA 1OREA 2JEZA 4Q4LA 5I9TA 5ALGA 2PFQA 5FLXA 3ANMA 3HBNA 4DWWA 3AI7A 1L5FA 4UBMA 4KIUA 3W1VA 1BQ4A 1ZJJA 1TXGA 4HZUB 3HO8A 1Y6ZA 2PQMA 5AVRA 2PJUA 1EP3B 2BM9A 1DEAA 2GETA 4RVDA 3L3BA 2GD6A 5H8WA 4PXAA 5LQMA 5JH7B 5IXJA 5LBUA 3K09A 2PUBA 1KP3A 3RBEA 3PXXA 5DJ5A 3E0XA 1D8LA 4YV2A 4PZUA 1EP9A 2WYIA 2HQSA 2NO6A 4N7MA 3NOQA 2NU8B 4O1HA 4HNUA 4FZNA 4JUBA 1FPQA 3R7AA 1XD8A 2AK3A 5IVKA 2AEFA 2PKRA 3MLAA 3QVGB 3B13B 1RD4A 3ZIDA 4YCDA 3HEAA 1K1EA 4ZI7F 5AVZA 1KC3A 5HGJA 1S4MA 2EKLA 2ADFA 4J9UE 4YRSA 1XRPA 3DA8A 5HK8A 3P2IA 2GD0A 5DM0A 4IVQA 4L73A 4PC2A 2P9FA 2JCVA 4X20A 2CVHA 2AFRA 2V98A 1P0QA 2WIBA 3PQ3A 4JBGA 9ICCA 3NM4A 1WDMA 4C7JA 1QF6A 1NK7A 2VP3A 1M33A 3MJFA 4X7RA 3VVCA 1FTSA 4HH3C 3OQPA 2OHFA 4DABA 1JPVA 1HV8A 3SOZA 4KMUA 1JWAB 4PHTA 3HWTA 1KMMA 4RSRA 2ONCA 4MCIA 4KOAA 4RCYA 1U9LA 2VTDA 3AESB 2FUEA 2GEUA 4XGRA 1CK4A 2WFZA 1D8YA 3PTZA 4HRVA 4ZVKA 5T8KA 2WA2A 5AVVA 3TRDA 2HTFA 4BMSA 2C2YA 3FNQA 2KZZA 1X8JA 1OLUA 1H4VB 4CG1A 3C1ZA 5AMXA 4OQMA 4Z1MA 5FBKA 1K6XA 5B6IA 1PNVA 3OCJA 3U1VA 5J63A 1R9NA 1NXWA 1G4UR 2IDZA 4LOKA 1KKXA 1G6Q1 9ICKA 3N53A 1PAUA 2DHEA 2ZT6A 4K5QA 5E6SA 3ZH2A 3TM5A 1YCFA 1CRLA 5AVQA 4ECWA 5FPPA 2IBTA 2Z2KA 1W93A 3KSBC 2YJ3A 1FMFA 1RT9A 4AP5A 1TB4A 4P84A 5BV0A 1LK5A 3RE1A 4ZN6A 1LK0A 2GN4A 3EVTA 1I3MA 2XKJE 2F9LA 4ILKA 3PLAE 2LBOA 3KQWA 1MO3A 1JYSA 4A2QA 4N4AA 1M1NB 3RTEA 2VH5R 4ZU1X 4AMBA 4A4DA 1B1CA 3EIOA 5MDHA 4ER3A 2C29D 2GO1A 1CZKA 1SWWA 3M33A 3PJDA 3PFHA 3RJTA 1R74A 1SL0A 1B3BA 1SA0A 3WV5A 2WJVA 3A26A 2RKBA 4ZYUA 3PX2A 3A1CA 5HZKA 1NJ6A 3PDHA 2H3FA 1XQWA 5I8ZA 2VHCA 3SKXA 5T4EA 1WP9A 2XMRA 2BM1A 1AU9A 2DPXA 3PRJA 1U8ZA 1KEUA 2FMQA 3TBFA 2JGNA 4MDFA 3ZWOA 1M34A 2WDZA 4TMYA 4K9LA 4EYQA 2OAGA 4KW7A 4EKNB 5C7LO 3TL3A 2YHAA 4F6RA 4P2BA 2QN2A 4OJLA 2IOQA 4UNSA 2M6RA 1F14A 4MDHA 5LVAA 3TI0A 3CJQA 1WUYA 4RUCA 1XLWA 2EYUA 3BE6A 2FDRA 5JISA 1JLMA 3ENVA 2ZJ8A 4DSLA 5GIPE 4E22A 4L22A 1GADO 5MFZA 5JROA 4F8YA 2ST1A 4O63O 4UPEA 4MGIR 2VK2A 3R7FA 3D3KA 4HLUC 2AMVA 3Q9NA 3FZYA 4HSGA 3V7JA 4BVJA 3DZFA 1MJGM 2G8NA 1KYZA 4CQJA 2BZ0A 3CZCA 2EKQA 2O59A 2GUWA 1E1CB 2W11A 2F44A 3HI4A 1YE8A 1LDEA 2OORA 3AILA 4C0SA 3BS4A 3KHTA 3V5NA 2EH9A 3IHTA 4FMPA 2ROQA 4BNTA 4Q6BA 1WMBA 2EBFX 1NBHA 4ISCA 4C21A 2AKYA 1DIGA 1OHHA 3BMXA 4S3MA 3AVUA 2D06A 5DFAA 3VAAA 1TQHA 4DA9A 4DWVA 2B36A 5IS2A 3RS5A 3MTGA 2L42A 3NU1A 1S02A 1E77A 1V25A 4LFBB 3JASB 2CLOB 4AMYA 2JGFA 2B83A 4R3WA 4BRSA 1UJ4A 2NV3A 3VHLB 1DRJA 2GBLC 4JKYA 2DTXA 4JI4B 4K9RA 4MR8A 2P2SA 3AR3A 4B6OA 4MPDA 4TMFA 4EDFA 5H9WA 5GZ3A 3GRZA 3ES9A 1OTYA 1TO2E 3Q2KA 3SG0A 3H2BA 4M0DA 1UHUA 4EBBA 4OB7A 1VPLA 1JX6A 4O29A 2DYKA 3EPPA 4OHVA 3K71B 2GPBA 1CUSA 3NQ41 1GRRA 3I62A 4ILEA 3P96A 3BTSA 3MMXA 3VUFA 4EUSA 1KZHA 1MO2A 1ED1A 2IYQA 1Y1QA 3WWEA 4S1WA 2XTNA 1PFYA 2I9KA 8ICQA 4HXEB 4MQ4A 1HNNA 1BO6A 1K5GA 4U2EA 4TKLA 5AJHA 2B3TA 2MRLA 1IONA 2MSDB 3C15C 3NVDA 3FHLA 3FHJA 5J2TB 2G1JA 4LSGA 1DK2A 3FDXA 1JG4A 3E22A 3ESXA 4ZDJA 1XNGA 2E5FA 1OZGA 4IDAA 9ICBA 3NHLA 3VR3A 2X0EA 3PQ7A 4FEYA 4AL4A 3ZE1B 1EFRA 4QYWA 2PTHA 1X7WB 1BPEA 4NU6A 3CGWA 2A1TS 3ZQ4A 5LMCA 1N9ZA 2A59A 2HZBA 3HVRA 2CL0X 4Z3OA 4ED6A 2X5JO 3CUVA 5HQTA 3N0TA 3SNHA 3CNQS 1UL1X 3RJIA 2PH7A 1VMIA 3CVYA 5LZ7A 2WAXA 4QWWA 1XXHB 1UQTA 4YR0A 4BV8A 5KG2A 1GUZA 1RXVA 1OI7A 2QBYB 1T3GA 2KP7A 4TURA 3BL8A 4PYKA 5FEUA 4MICA 2HBKA 5FWYA 3N2GA 4YAKA 1XA3A 3WTBA 5FULA 3VC3A 1U3WA 1H8EA 2O14A 3JQ8A 2ZS9A 1BE0A 5KNBA 3LX5A 5F1OA 2A94A 3OTQA 5CNJA 5DYTA 1WDTA 2NSDA 4LWOA 3S5UA 4YRDA 4QJ5A 4CZ2A 4NFSA 4Q3EA 2PFNA 4TKVB 2WWGA 2D3TA 2E1PA 4AMUA 4B71A 5FL7D 3PGLA 1JIJA 3WYGA 3RG8A 2F1HA 1DQYA 5HIAA 3P27A 4CFYA 2FQWA 3RRFA 2JEYA 4G07A 1W36C 3ST7A 4RXTA 1U0EA 3H2IA 4HPWA 2AV6A 1ZVJA 4R16A 3EH2A 1RHRA 2OBMA 1E63A 3E0FA 4P3YA 4DLSA 1P6UA 1FNNA 3JYLA 1JQBA 4X7MA 3WNBA 1Q1GA 1Z38A 1KJIA 2Q4RA 3Q7RA 2PL5A 1UEJA 4C76A 2ILVA 1K7SN 4D44A 4M1KA 4KLSA 4QGHA 2QSJA 2E6KA 4RDHA 2HT1A 3PS9A 2OCKA 3AHDA 3U7QB 5J2UF 4EPXA 3U80A 3LXMA 3A3OA 1RI1A 4MCJA 3ZTYA 4IQ8A 2NZUG 4C0QC 4NAUA 2N75A 2D4HA 2DSNA 1ZQKA 5K3AA 1NVBA 2JIPA 3CRVA 3EEIA 1QGYA 2LKYA 4A6EA 1O6GA 2FG5A 5EJIA 6ADHA 3LVBA 4ES6A 5E9JA 3V2UA 3KKAA 4G3IA 4GFDA 3G2HA 1ADFA 3QMWA 2Q3LA 1SVMA 4C04A 4J29A 5AM2A 4RK4A 2BHTA 1ZM3A 3ZQ6A 3JWPA 3LZCA 1GZ5A 2V6GA 3EDYA 1GWNA 2EQAA 3CSSA 3QLJA 2IYYA 1I1QB 4H7IA 1E2PA 3L0CA 1PT9A 3H99A 4QYXA 4QARA 5HQ3A 2AL7A 1RRGA 1TQ8A 1KSJA 3NRCA 1WZEA 2NRTA 3LECA 5EJ5A 4CDRA 1WG8A 1SUCA 1Z9BA 3KPJA 4PZNA 4HDMA 1EFRD 2A5YB 2XMQA 4RFLA 5BWLA 3ME5A 2C61A 1Z45A 2AXQA 3KT0A 1JHDA 3V3TA 3RHZA 4L51A 3HXLA 5BSEA 4O4LB 5CA7A 5HF6A 4J0GA 2H18A 4MCHA 1LI7A 1T8TA 2I2CA 4KXMA 4ND7A 4RQ8A 2J6TA 1P73A 3A7EA 2R0QC 2RMKA 5TT0A 2I6SA 3QEAZ 1L4GA 3JVIA 3KSUA 4GSKA 1HUOA 4NMWA 4M98A 1DO8A 4CTJA 4LPKA 2ZQ5A 2PQ2A 2YJTD 2OO5A 1CY4A 1WVMA 4MW1A 4CNQA 2P77A 1RI3A 1OXVA 4B3CA 4GRAA 4LY9A 4F2DA 3O1LA 2PBZA 4JC5A 4DCMA 1P60A 2WTUA 4FCCA 1A82A 1WB9A 1GLNA 3LIIA 4F4YA 5IJXA 2D59A 2G72A 3TD9A 1JHVA 4ZAYA 5D4BA 1Z5OA 2B1GA 4BDTA 5AI8A 4Z4GA 3ZHSA 1PUXA 3KC2A 3FMGA 1T9DA 1P5ZB 1N61A 5HEKA 1LV7A 1SQGA 5DLFA 1II8A 1SIUA 4KPGA 1BX3A 2NN3C 3VM6A 2AI1A 1H93A 2PMCA 3CR8A 2FLNA 3E3MA 4DLTA 3KETA 1IBSA 1RIIA 1X1BA 3EPJA 4O3PA 4HF7A 1XLVA 4DLYA 1T2AA 2X13A 3FZNA 2YKGA 5K01A 3L4BA 3U4GA 1Z73A 4ZAFA 4ZDWA 2BM8A 3D3WA 4TSFD 3NIDB 1HE2A 1NW3A 1LV5A 4CDMA 3VU9A 3MSCA 4LF5B 1RLJA 1RKBA 4IS3A 3GY0A 3II6X 4G26A 3K9LA 2AGOA 3ZE7A 4BGEA 1H8HA 2CNLA 4Z49A 4RIEA 1BRTA 5K4HA 1P7PA 1FFXB 1C30A 3EA0A 4OATA 3GUCA 2EJWA 4RM3A 3VVBA 3GEIA 2WNSA 1T5HX 1OE0A 3MW8A 4MVJI 3L7DA 2VUTA 4TS9A 5THKA 4M60A 1IG0A 2SKEA 3LXUX 2CBGA 3OPYA 3VXKA 4MZDA 4Y2XA 3FHOA 4RYLA 5DGTA 4O3QA 5F7OA 2PXCA 1PL0A 5DN6A 4MWSA 4JMUA 4FFWA 4ZXFA 4YR7A 3BDAA 4BZZA 4NNPA 1YQTA 1SBZA 3AMZA 4QTTB 3ZDRA 3IO5A 1FJ2A 1VJTA 3K5WA 3MFIA 1NQUA 4HNVA 3NOOA 4UMDA 1OT3A 1Z4MA 6AT1A 1TZBA 3HJEA 3VR0A 2NU6A 4YLGA 3QE9Y 3MS7A 3WAKA 1GO3F 3ROXA 1NYRA 1GDHA 4RWZA 3NFYA 1BX0A 1QVZA 1M6VA 1FFSA 2FA9A 1VPEA 2EAPA 1E0AA 4DV6B 4OB8A 3BH7A 2VZ0A 4KUEA 3RABA 3VU1A 4YMGA 3PTLA 4L5CA 5JO0A 3UYKA 3LK7A 2A14A 2BHRA 1PL7A 2Q9UA 3OX2A 4AJOA 4HEJA 2OECA 5LZ4A 2O3TA 3RHFA 4F3OA 2OFOA 5B3JC 4Z9FA 1P8AA 4HRXA 1K1SA 1HH4A 4P2GA 4BWMA 4G25A 3UK7A 4JI8B 4R1QA 5HS6A 4AB1A 1Z0SA 4DZRA 5C8VA 1RC1A 2JI8A 1SOVA 4HQ0A 1PJ4A 3RPEA 1VRVA 5AW0A 2ZYWX 1M1YB 4C7OB 1KKMA 1SQ0A 4IDHA 1IN4A 4LYAA 1FE8A 2CW5A 4MV0A 2QENA 5IUNC 2X23A 2PS0A 4HVAA 1OB2A 1JLRA 1EXMA 1SBIA 3SSAA 4US8A 3ZDBA 3OETA 5IVDA 2O20A 4TWBA 4H7PA 5A6SA 4IR7A 3QXHA 4ELVA 2NQ2C 4IHAA 1THZA 7ADHA 3PLRA 3PEFA 1T15A 1SHTX 3IV7A 3U60B 4ZC1A 4BVGA 3T3OA 3A31A 1GTL1 5BWBA 1XTUA 4C2UA 2RHOA 3TLJA 3CW2A 4RSGA 1ODSA 2ZSEA 3ADDA 4UXJA 4QQ8A 3JU3A 1KDYA 3WRWA 4C3ZA 1H8HD 4GVPA 3IVXA 1IUPA 1G3MA 1QHEA 1AD2A 2B6NA 2XQIA 1LDMA 5H3LA 1QS0A 1UAAA 3D4IA 4N49A 2PFSA 3NC1C 1NATA 1YRHA 3TGWA 2GLUA 4CM7A 3UUWA 3OE5A 3NMUF 3HKEB 4MR9A 1J2TA 2HQRA 2WRZA 2BRUA 2GBPA 3LY7A 4R98A 3HXKA 2CVPA 2GRJA 1FUIA 2QN3A 3F1KA 5IIMA 3TFOA 3BA1A 4B9MA 2QPTA 2FSIA 3BSFA 4CJXA 4QOFA 2JPDA 4BWGA 4FBTA 1N8TA 5JPDA 4YUWA 1FNCA 4YQZA 3QJGA 3WL8A 3NVZA 1ZQSA 2AUMA 1D2CA 1LBQA 1PT5A 2NZXA 1IY0A 1F2DA 2PQ6A 1JEYA 3I6QA 1K63A 4GC7A 4MVWA 2MU1A 3ELBA 5LZ5A 4W5HA 4MQFA 1XDDA 3LY8A 3EX7C 3TDMA 1F38A 1VLHA 4LG1A 5HCUA 5D3QA 1ACJA 1OBHA 1YNSA 4URUR 3DPUA 3H9UA 3QVTA 2XMGA 2I91A 4UAYA 4KLDA 4G4JA 2GAFA 1CZRA 4HBZA 4N1AA 5FKJA 2O1WA 4IGKA 3GHYA 4L3VA 2C7PA 3SPXA 3KKNA 3T5DA 2OCYC 3EZ2A 2ZDQA 4EFKA 3GDHA 2JZOA 4M22A 3WWCA 4R84A 1M3SA 1DMSA 2LYHA 4Y6OA 3GR6A 3VR4H 1E3JA 3IA7A 1XFDA 4ZRMA 4BWJA 2ECQA 1KAOA 3G5LA 4JLPA 1NURA 3U56A 4TX1A 2EGUA 4S24A 1M7HA 2HHCA 4B8ZA 4WNCA 2XX3A 3KJEA 3KQPA 3TYXA 2Q4OA 4NENB 5K05A 3TKAA 1DBIA 1EGHA 3W8FA 1BCRA 2ZJFA 2ZM5A 3CCCA 1LNQA 3F2CA 2IUUA 3WIUA 2GZDA 2WV7A 2EARA 2G5GX 2GCEA 1XU7A 5B36A 3VRHA 2GTPA 4Z1OA 5ILQA 3T15A 1WUDA 1SM4A 4B5KA 4PSDA 1MXFA 3N5KA 2QUAA 2XYRA 1QFSA 3OBBA 2DBYA 3PC6A 2AMYA 3T94A 1KS9A 3AZQA 1BN6A 1C4OA 1VIYA 4CWAA 4G84A 1YQXA 1L8QA 1U0FA 2YUTA 1WZIA 4XUGB 4ZYTA 4Z53A 1VKOA 3FROA 4L4ZA 3ZHUA 4ZEXA 3ZGOA 1YOVA 2IHTA 1AKUA 2Q5IA 4DIMA 1OIXA 1IUOA 3P4XA 4XKJA 5AK0A 3SZMA 2PLAA 4Y1RB 4M6WB 1IN1A 4M83A 4DADA 3NVYA 2WJGA 5DH9A 2GR9A 1T5OA 4LRYA 3RIYA 2IEBA 1HKUA 3DJYA 3EARA 4UNRA 3OQIB 2J5BA 3OQMA 1AHHA 2VPPA 1SVSA 1ECCA 1H6DA 2PFKA 1QU2A 5GVRA 2ZS7A 1VLZA 4G5XA 2VPXA 4CLHA 4U39A 2BFEA 2J9RA 3QX8A 4JODA 2ZYGA 4YCCA 4EEXA 4U9UA 4UREA 1V48A 1X0XA 3H6GA 5CVEA 1P2SA 4DCOA 1J7JA 3EW9A 3E9MA 1ZBDA 2CCGA 2DERA 4B6GA 4YP1A 2K2QB 1A96A 4ZT5A 4YRIA 2K4HA 1WXEA 3A32A 2A1TR 4NLBA 2DGZA 4BO9A 4GXQA 2EOAA 4UZFA 4TSRA 3HZHA 4FR0A 1R8XA 3NAMA 4E1VA 3HFRA 1NGSA 3ZK8A 2FVYA 2YYSA 4QULA 3O47A 5ALSA 2WB4A 2JI4A 4KNYA 3NBUA 4Q7MB 4JQCA 4LY3A 3AV0B 1QYDA 4C22A 3W5IA 2WAYA 3IP3A 4OYHA 4F92B 1B74A 4QDOA 2QQEA 2REXB 4ZDKA 2M1ZA 3C45A 2H5JA 2F9MA 3FHCB 3A7DA 5LYJB 3IP8A 3E3AA 2FUG6 2F67A 2DR3A 3UK1A 3AYXB 4F4IA 4FR2A 5I51A 1DRWA 2QHXA 3ESDA 3Q0IA 1P45A 5JPIA 4B3RB 2BPCA 2MYNA 1A9QA 3WGYA 1EE1A 3BFVA 1YT5A 5KFFA 2W55A 3RK1A 2POQX 1SRRA 1OKKD 4EPVA 3KQLA 4ZTBA 4G9EA 4O0IA 2IUTA 4HLUA 4KPUB 1ZQXA 5IDWA 4Q3KA 3I53A 3L8CA 2BFFA 2WD8A 2DC1A 2XGGA 2B5VA 2HWKA 1UZAA 3E7XA 1JE1A 1FNBA 1UMBA 4Q66C 1H3FA 1RQ2A 3BFKA 2ARKA 5KQRA 1DAFA 2VT6A 3D7SA 4L9RA 4JLNA 1IZ7A 1L5KA 2R751 3GFPA 4DWJA 5C4MA 5GZ6A 1MNQA 2JJ1A 4UULA 4OG2A 5IIJA 3V4OA 2E87A 5KYYB 2BZFA 4P22A 2O8FB 3F9IA 2BWJA 2XVZA 1W29A 4G41A 3EFHA 2GAJA 2AKEA 5MN6A 3O8RA 2HRRA 4DSNA 1K97A 2CMHA 1QRDA 2A1AA 2Q0ZX 1L5NA 2G9UA 4KNVA 4PN3A 4QO7A 3UANA 2DOKA 1XDUA 1VMKA 3NP9A 2HO4A 5J0UA 1RJDA 3EW7A 2YXLA 4GMDA 2GBLA 1DKQA 3VISA 5I9NA 4MOWA 4G89A 2VPWA 2J30A 5CPBA 4D8XA 3HH8A 4R31A 2CMGA 3HP4A 1DE0A 4RMGA 3KSMA 3AM1A 2D8AA 1VIAA 2R6JA 4U2KA 1IN5A 2Q1XA 3QZ8A 2UZAA 2FB9A 2TYSB 3VO9A 3K0AA 1JIHA 1UZLA 4ECUA 1HT3A 3AUSA 1XB2A 5EXEA 4DMKA 3SVLA 3N2YA 5K4GA 4ER7A 3QU7A 2H4FA 2QN6A 4Q7QA 4EY3A 2CUZA 4CMBA 2FWMX 4YV7A 1GXSA 3W7BA 2CJYA 3V4RA 4Q05A 3UXNA 5CA0B 5ALFA 2W9MA 1J5PA 1KI7A 4XPIB 4I3HA 1YSCA 5DGDA 5BNFA 5GOTA 4IJUA 4IDGA 1QIJA 1QF9A 1YRLA 4MW4A 2D54A 2J3HA 4I1OA 2VKTA 2ZUFA 4E6EA 3T38A 1YE3A 4W1QA 4JLJA 4C2BA 3KXKA 1X3LA 5BWOA 4XARA 1JBQA 4N5DA 4TQ9A 4MJ7A 3ZWQA 3V2HA 1T1GA 3VV2A 3KJZA 4KV9A 4RF3A 1SKMA 4OMCA 1YJ8A 3H0KA 5AW6A 2RG1A 5FBVB 5CPFA 4QPCA 2WFLA 1GCOA 1PDWA 4ZCQA 2YYYA 4HADA 2W8BA 2J3LA 2JGDB 2XIQA 4DO9A 3IOCA 2X5NA 5AJVB 5FI1B 1PX0A 3OJLA 2QTVB 1M9NA 4KXVA 4RT2A 1Y9JA 4OA5A 2GF0A 4CIVA 4G9BA 1YFJA 3EG9B 3UCXA 5ELLA 1NQVA 2DFKB 4F46A 2G7MC 3RI3A 4OU5A 3X43A 3Q40A 3S2ZA 4ZALA 2NU7B 4CKBA 5ED0A 2FI1A 1DAIA 3V9AA 1IHXA 3OD1A 3CEMA 3DXZA 3GNSA 3HLYA 3D8SA 4R2HA 3IOEA 3DOFA 2YY6A 2IU4A 4EI2A 2HHXA 1N2CB 2IEZA 2IHZA 4PQRA 1ZONA 4BNKA 3AKZA 2OCEA 5BN3A 1SZDA 1ULTA 4UVIA 1H6CA 4AY6A 3KHHA 2QVZX 3O4GA 2B0CA 5C7OO 3M2PA 1Q95A 5GY7A 2JKVA 2Q4EA 3X1JA 1NULA 4TT3A 3VSCA 5DGHA 4MB2A 3OC0A 1TMOA 2BJWA 3PWSA 3WGJA 3CM0A 2JI7A 2V65A 2ZSKA 4N5LA 4UVGA 2YWHA 2C3OA 3N7AA 3OMWA 3G2LA 1Q1AA 3P7MA 3UCFA 4G24A 3P2MA 3I76A 1D9DA 3ITDA 2OFXA 1V5WA 2H4ZA 3GT3A 2VHTA 5EZ6B 5D3MA 3LVQE 1NJ2A 1FW6A 1GY8A 2IY7A 1NRIA 3NEPX 2XCIA 4ARSA 3U3DA 1QRUA 3IG5A 4D5EA 1V11A 3AFGA 2Q3JA 4YY3B 1IJFA 2IHMA 3OHSX 5K7SA 3GLSA 4UPVA 5E9QA 4YP5A 2DVMA 4BYMA 4V0OA 1NJ1A 1DXSA 4E2XA 3GFRA 4JVMA 2YJNA 5EE9A 4FFMA 3H0EA 3JD3A 1HDZA 3U4QB 3SU8A 3HO1A 1M2HA 3VU3A 2XCOA 4YI3A 4TM7A 4DIOA 5K3SA 3AVYA 1ZA1A 3SR6A 3NTRA 4MDYA 1N0VC 3AIMA 4DC9A 2IELA 2OCGA 1LX6A 4EKGA 1WPQA 3IPRA 2EQYA 2PEZA 3F2VA 4AYBC 1G4AE 4AF8A 3RFFA 4CR6A 5TS3A 3LYHA 2DGDA 9ICEA 4ZDIA 3WGMA 3GDOA 1N6RA 1J20A 2OB1A 3KB6A 3TJZA 1TKDA 1VE9A 1VLMA 3O8QB 4Y9DA 1RWOA 1SZPA 2Z8XA 3Q7IA 1TUGA 3BJZA 1Y7HA 3DKIA 4XM2A 1WWUA 1F1JA 4PLPA 1I80A 2HBLA 1YS1X 7ICQA 3ZQKA 1JPUA 1RPJA 1PWHA 3A0HU 2B2NA 2TMGA 4PWYA 4R69A 1VE6A 1GPMA 1PEKE 4UVDA 1B8NA 4HFNA 5DK6A 1V43A 5FEMA 2VDQB 5JALA 2VP6A 3FWZA 1KGSA 3BJRA 1TFUA 3M4JA 1NXVA 1JJAA 1GGMA 3Q15C 3UAZA 1FFGA 2I6FA 3ZI4A 4L85A 5DT2A 3KVVA 3ZC3A 1C3OB 4EJSB 5ALRA 4NZ9A 4FFVA 4PAQA 4WNYA 1GA6A 4QASA 5G4KA 1WUJS 4NYIQ 2YVLA 5AI0A 1ZD4A 3F78A 2YC4C 1NVGA 2C5AA 3FNBA 4HO1X 4B6SA 1I4DD 2BGIA 3H3JA 2MCFA 1E89A 3TAPA 3KAKA 5DHTA 1BVUA 1QQ6A 3VYSB 1ZGCA 3L4KA 4FMDF 4KTQA 4DMUB 3IT3A 1X40A 3BM5A 4UCQA 2C54A 3C23A 2NTJA 1G0OA 3DNMA 4CIWA 1UXGA 3EZ7A 3DT6A 4MIEA 2YNMD 3UAVA 3CZ4A 5CB6A 1OF1A 3GEEA 5C1DA 5DGIA 4LFAB 3GP3A 5K8VA 2B0JA 4JB3A 3DQQA 4MYDA 3HO6A 1Z0KA 3GP8A 1LBSA 3NNDA 4YMLA 1D09A 2QTMA 3LDFA 4UBIA 1L5GB 2HK8A 3ZD6A 4WMLA 4ZYWA 4FN4A 1G4HA 2PV7A 1GPWB 4PEVA 1ISSA 1JSXA 2Q2WA 4DIFA 4AT1A 1OI4A 1BWSA 5THQA 5TJ9A 1A8PA 4F3RA 3CX3A 4HSEA 4NCIA 3PEYA 4P54A 4DQQA 5E7QA 4UVHA 1DBVO 2C4MA 4R1SA 3TPFA 1X42A 2R8HA 3WGIA 4A0RA 4ER5A 1GFWA 3UVEA 4W9RA 3U81A 2Q3HA 5KU7A 2VT3A 3R0XA 3W5CA 3TQHA 5AI5A 2CKDA 3QPWA 3N9IA 5BP7A 2H6EA 2QTZA 4O3RA 4HWKA 2J32A 3N6RA 4IQFA 3LHIA 5COBA 3ZHZA 1WXDA 4Q12A 1D1SA 1IBCA 3ZYCA 3AUJB 3ZJUA 1HDGO 1L4EA 3RFCA 4RZ3A 1X9XA 3NBXX 5A5EA 2DCUA 5HSGA 5IKEA 2GN0A 3OCXA 4X20B 2O3SA 3IQIX 2JFOA 1S2NA 4QVIA 2QS9A 5FDFA 1E2DA 1L5MA 3PIDA 4N01A 4LNUB 5DP1A 4C30A 3D6HA 2WWWA 2AJ8A 4TV9A 4OP2A 4WCVA 3T1VA 2FE1A 2J7KA 3ZY2A 4Y9SA 3S0JA 2H00A 1P9WA 3DMNA 1G5QA 5CFLA 4YDQA 3GFSA 2WTBA 3O8LA 4L76A 2I33A 1FJHA 3HA2A 3PDJA 2FEXA 2I99A 3E9NA 1QWSA 4RZUA 2C8LA 2OOSA 3JX9A 3WWZA 3N7RC 2WU1A 2Q3BA 3I9MA 3LDAA 4D3ZA 2QSYA 1J0DA 3F6PA 1PQ4A 3S7TA 4Z99A 1UPAA 3TM4A 3DB1A 2CWDA 1KRWA 3MBYA 4XWGA 4CT4B 2DFPA 1W9MA 2AQ8A 4I2CA 3H9JA 1LVGA 5E6SB 1QCKA 5AW3A 1S2LA 3JAWA 4GPAA 4LAFA 3D8NA 4CTNA 2NOAA 1PJLA 4ALIA 1YB4A 3KEQA 4L6CA 4XFJA 2IE0A 1BG6A 2A1JA 2PSFA 3RRXA 5CITA 2BH2A 4ARIA 3ZGXA 5AKLA 4Q6WA 1YBHA 3W4JA 3CONA 1N2BA 2J5XA 2C42A 3LRPA 1Y6JA 5CUQA 2XZOA 4R7TA 1Q14A 1PUJA 3PSTA 1CIJA 1OFTA 4QNLA 4LGCA 4Q4AA 4MVJE 4PPQA 1BVHA 2OY0A 4N8SA 3ESCA 2J3EA 4PTLA 1NQOA 4TZTA 3BIWA 4WFJA 5HIKA 3ZEAA 4DLKA 4F5RA 3IHKA 1SA0B 5BR8B 4CLXA 4C1NA 4G9GA 3HRKA 4LEIA 2H8GA 1JR6A 3EIFA 3F6BX 4JJEA 2FZCA 2W2TA 2QTRA 1G5FA 1MHTA 4YRAA 2PUTA 4EX7A 3TLAA 2ES6A 1KJWA 1OLOA 1OTHA 4U7PB 3MBKA 2OMEA 2HF9A 3NS7A 3D2LA 3RFTA 1I3NA 2OCLA 2GWHA 3M82A 3Q3JB 4F6RB 5BSKA 3V32A 4BNDB 1ABEA 1QV6A 4IHJA 3HYRA 1IN8A 1NXXA 2IJGX 1UC5B 4DEVA 1L6NA 2B61A 3H2HA 1AUQA 1UOPA 2ZIUA 3KB8A 5IAJA 2O06A 2A1UA 4JOBA 5BV2P 1J09A 3SQMA 1D2RA 3KQQA 1T26A 5T3YA 1BKDR 3TAQA 4I1IA 4RZRA 4LDQA 1UPHA 2O2YA 5GJCA 5BOSB 3WBJA 5GVSA 4NXNB 2JC3A 1T3LA 4BB5A 3HV2A 1ISPA 2ZJ4A 1AB5A 3QF4A 2FHPA 1M5UA 1KZ6A 2ORED 2E5SA 5K5EA 5AW4A 2F3SA 1W52X 1JKJA 3K6JA 2BFCA 9ICJA 2CXOA 2V7QA 9LDBA 2Z0MA 1QU3A 3I37X 1NNI1 4O8ZA 4D8WA 1XDBA 1YS6A 4HDQB 1OCEA 2FJPA 4OQLA 3RYHA 4K2AA 1AM4D 1KI6A 3OEHA 5REQB 3ZK9A 5L6MB 2ERCA 3DYBA 5BSWA 3KOXA 2XTAA 3JSXA 3GLGE 2LIVA 2PGJA 4JL5A 1V2HE 3D5TA 3GGSA 2H52A 4N82A 3NFRA 2B98A 1IUKA 5KDLA 5AI6A 3ICPA 2EWWA 4L74A 2JGLA 4HB0A 4ZO6A 4ZICA 5CD9A 1ZOSA 4Y1GA 2VLIA 2G83A 1U3VA 4LJLA 2DQYA 3EBOA 4MR8B 2QDXA 2IW1A 4OREX 1IQUA 3OZBA 3STYA 1P3Y1 1A76A 1P1BA 4CM6A 8ICRA 1Q74A 1BPBA 2HRDA 3OZEA 3EGXA 4BX0A 1ODKA 1KZ4A 3O2NA 2OO7A 4LXHA 1QV7A 1FP2A 2CFTA 3T9BA 3O8OA 5DXAA 4AP9A 4O02B 1S3IA 1MFPA 3HUTA 2JVKA 3U4HA 1XTSA 4Z9YA 3BXOA 2DQSA 3EPGA 4X1KB 3H7AA 4B7ZA 1S0OA 3C3BA 3DNFA 2OV2A 4UJ5A 3QH4A 1ADBA 3P32A 4FGSA 4MV7A 3NJ8A 1MVLA 1WSAA 4CIXA 3I1IA 2F8MA 2BTOA 1PEYA 3E22B 3A3NA 5LJLA 3G6VA 3E5HA 1L5WA 3HK2A 2AX4A 1SC1A 4H3KB 1U0SY 3BXEA 1PGOA 2H2HA 3OLVA 3RRYA 5H59A 1QG4A 2WWRA 1II0A 5A9SB 4ZQCB 8ICFA 3GDFA 4K6CA 1EVEA 2RDMA 4QJ4A 3IAHA 3W7VA 2Z6QA 4BUGA 2PJZA 2V7PA 4HTFB 1F4LA 2FN8A 3AUUA 3AGPA 2IHNA 1JAXA 2IYNA 1AS3A 2BBOA 3DV0A 3AUTA 3DE5X 5TB5A 3HC7A 4DCTA 3AF6A 3TNFA 4R63A 4G0XA 4KLAA 3FMVA 1VL0A 3SLRA 4B84A 4MV1A 3KHLA 2OXTA 5AK6A 3CJRA 2KPOA 1R0BA 2VSFA 4HL6A 5DLEA 3WHPA 1QTMA 2VJDA 1RQLA 1PZHA 3AVVA 1VFPA 1OPRA 4MGZR 4ARCA 5A06A 2GEDA 3M4ZA 4ED0A 4FGLA 1K92A 1CDOA 1FJXA 3JQ8B 4JYAB 1K0UA 1CUUA 4EIWA 3PPWA 3GXBA 5AUOB 2JH1A 2GRUA 4I5DA 3SENA 4Z1MD 2NZWA 3PUVA 2WFMA 3HEBA 1G0NA 3IBYA 2B6GA 4D0RA 4Y2QA 5BQOA 3NJRA 1CVLA 2BBTA 3J7AC 1U7OA 3MK31 3GZFA 2XCRB 2X3UA 5FI3A 1GL6A 2CFIA 3EPIA 1ULUA 1CS4C 1XQ9A 4JJ4A 4KPYA 2HSJA 3QI2A 1IY2A 4Z3DA 2P90A 2IPOA 5DT9A 2XNJA 1AUOA 4RH3A 3F74A 2WYUA 3NEAA 5JXIA 2VYCA 5C9ZA 4QECA 2Z2XA 4GOND 3OEHD 4FLFA 2CYCA 2JL1A 4Y30A 2QNRA 3C8DA 3QWHA 4QFCA 1OGJA 1E0KA 1T91A 3U4DA 2G5TA 3TVTA 1WB5A 3PWTA 1ESNA 1PG0A 1NK8A 2GM5A 3EODA 4D41A 2HDOA 1EK5A 1O4VA 1N6NA 4IIJB 4UFNA 3S1SA 2ZETA 2ONJA 1Z3CA 2Q5OA 4DQRA 3MRVA 1D9XA 4PQGA 3KHKA 3QJYA 4JQOA 2CLCX 1V3VA 2ZYVX 1ISJA 5A05A 2BGNA 2G7ZA 4M7WA 1AF7A 4QUKA 2VSXA 3UMYA 1D7OA 1RQNA 3QPCA 5HHTA 4L28A 2HJVA 4R1PA 4ZOLF 3GJ4A 1U9ZA 1PZEA 3PQ8A 3SZ3A 1V7PC 1Z7GA 5HHHA 2JCBA 2HA4A 4W4TA 3BT7A 4O2BF 4J0QA 1DUSA 1Z3IX 3O0DA 4G01B 4JHLA 1RQGA 2ZJ5A 1V47A 1OLXA 3PA8A 4BNFA 2R6GA 3U0BA 5FUYA 3LC2O 4Y2PA 4NV1A 5A62A 4FSDA 1E9CA 5DVZA 5FI5A 1RJ9A 5HQ3B 2E5LB 4O4IF 1E8DA 4EGFA 4PINA 1TAMA 1GPLA 3BSSA 3O7MA 3K4GA 4AF6A 1Q92A 1RYSA 2J4DA 3RYIA 5B53A 2Y1GA 2ZRDA 4QUJA 4EB8A 1BHO1 1UFOA 1G55A 5J29A 1BFUA 3V8QA 5F9FA 4E0DA 9ICOA 1CR6A 1U9IC 2EIXA 4JA2A 1SCIA 1NU8A 2HJHA 4ZK6A 1S8AA 2UXDB 1RJGA 1MOSA 3V7KA 2OSVA 1IWBB 3OZSA 3F5FA 3LYUA 4IGEA 4IIFA 5SYNA 5JMOA 2O4CA 1E2BA 3FDZA 3RBVA 2J0SA 1F60A 5FI0B 3PO5A 2B1QA 5CTAA 4RY0A 1GEEA 1O7JA 4MV9A 1Z13A 4TYQA 1WZCA 4RDIA 1VCIA 1OHHD 1VDVA 3PQCA 3EXEA 1L9KA 1RZ3A 3SM9A 3MGAA 3MWLA 2QN9A 4AN4A 5ITSA 4MVJH 2V55B 1HIWA 4YYZA 4DQPA 2GJSA 2VH1A 3KJGA 4CLRA 1JLSA 3KOMA 2BHNA 4NCKA 4DHWA 3OM9A 4N8EA 4PS1A 3OZIA 1MZPA 4UAWA 2YVKA 4R8UA 2X9GA 2C0CA 5EMJA 1US8B 5K99A 3AHIA 2QGZA 3SJAA 5CR0A 4LXYA 4NCXA 2QOEA 3EIWA 2H17A 2X58A 4UJ3A 2C7VA 3ROKA 1TM4E 2GWRA 3FNGA 4GXKA 3HABA 3VOAA 1RKXA 2H5EA 1CUFA 1EU1A 4TTQA 4TYYA 4GO1A 1YBVA 4EEKA 3L05A 1CRPA 5E79U 1NVMB 2Q45A 2XIJA 3UKOA 3D64A 1I5EA 4P4MA 4MF8A 1PVVA 4YRJA 3CVUA 2YWJA 4Y6PA 5HE9A 2XXBA 2AZ4A 1QVVA 3VU9B 3D7KA 2FFBA 3VR3D 2R47A 1G5HA 3OF3A 3A0UA 1U4BA 2P9JA 5KNDH 5IW8A 1W2WB 1WHSB 5AK3A 4A8HA 3VVLA 2Q9CA 4HAUA 2PX0A 1M5RA 4B9EA 3GJ6A 5G3YA 4C4OA 3AQEA 1VXRA 5D85A 1H42A 5CJ2A 3BC1A 5EL0A 3P9IA 3Q72A 2PU7A 2Z1NA 3AY0A 3A1DA 4KDCA 3O0TA 5GGXA 1PVQA 1XZAA 1JFSA 3OPYB 5B57C 4UDOA 3NJ4A 1T2UA 3G6KA 3T3IA 4MF2A 1VSVA 4G4GA 1NZBA 1D2GA 3K4PA 2BR0A 1OFIA 5IC6A 4EO9A 5J58A 1GITA 3LYLA 1PHPA 3CR7A 1H8ED 2IP4A 4RKWA 3C97A 3B1FA 5KNBD 4DV0B 3BJMA 4Y0VA 4XTCS 1QFZA 3GLIB 3QQ5A 4P53A 1EE9A 3HVJA 1DUIA 2WA1A 3STVA 5CW1A 3BSWA 2HHJA 4QELA 4HTAA 1NNUA 3VA7A 3KQTA 3ASYA 5BSTA 3T5CA 5MN4A 3KDPA 1EX9A 4Q82A 3HVHA 2R66A 3EZLA 1CQIB 2AUTA 1KP2A 4WOBA 5JLAA 4WK6A 3AMVA 4EY4A 4XCQA 5DASA 4Q3BA 5JFOA 3FNEA 1C0IA 1SK9A 3TSAA 3RAEC 3LF1A 2ZBGA 1X7ZB 4MUXA 5KJ6A 3T5GA 3RSQA 1VL6A 4WCFC 3UV6A 1E0JA 3Q8LA 2VF4X 2ZK7A 3KPUA 3E84A 1U0OC 4U9HS 1TM7E 5BVGA 3L7LA 3TUIC 1NLZA 2ZJ7A 3OQ1A 4GC6A 1A1SA 2WFAA 1PU2A 2I67A 4RD6A 4BATA 2QXTA 3JPQA 1SUEA 3QWAA 4K81B 2DWUA 1W4BA 1ZKMA 2HAEA 1ZCZA 1P1JA 4RPIA 3NUGA 3S40A 2AIRA 5CXXA 4OPMA 1KOGA 2JLVA 3RVRA 2YV5A 4LFCB 1SULA 3KVOA 2WJYA 4WVFA 1KFCB 2G04A 1HNZB 5JIBA 1X1DA 4Q15A 5KTQA 1JRLA 3THXA 1S10A 3N07A 3K9CA 2PA3A 3CPJB 3VV3A 1MA7A 4WK2B 3NVMB 2JKZA 4BEVA 3E1KA 1Z74A 1JVSA 3AU2A 3SR0A 4HKTA 5HW0A 5A6SB 5KHOC 4RZ2A 2JD1A 4N0EA 1FVOA 1R4ZA 3B52X 5J2EA 4HBGA 2BJHA 2Y0EA 2YN0A 4GDMA 4Y3UA 4DCUA 4DHEA 1I6LA 4OHXA 2PVCA 3UFXA 4C0ZA 4LYEA 2VJPA 2WLSA 1PQUA 4II2A 3K2EA 4GDFA 1GRQA 4FNOA 4JVOA 4RHYA 1J2EA 3UW1A 3MHTA 2PZJA 4H1VA 4UM7A 4JIGA 2DFDA 2QTTA 4HZIA 4A8TA 2IS6A 1PV2A 4IRUB 3INYA 1LWOA 1JU3A 1QS0B 2VZ8A 2C2HA 3MT9A 1RBYA 1I1NA 1T6ZA 2JLWA 1LKYB 2C07A 4MR9B 5KT5A 5TVKA 2PZGA 1LWNA 3HJRA 5CHYA 4OI4A 5B1DA 1MB3A 3RAPR 3GEDA 1CQZA 1G7CA 2JJ8A 4BNXA 3UWDA 2VK1A 1DLIA 2QD3A 2HJGA 1SCQA 1H2YA 5K3FB 4QXAA 5DWVA 1ATZA 1JEQA 4B33A 3RARA 4CF4A 4QM6A 2Y99A 5CX4A 2CXXA 1F8UA 3ENWA 1JKFA 4Q43A 4I4TA 3MINA 2PWPA 4R54A 2I34A 1P75A 5DYGA 4FGZA 4WFIA 4JU9A 1M74A 4O2AA 2KD1A 4GEGA 4I50F 2JIQA 1JEYB 5IDVA 1F6BA 5FA8A 2PEYA 2YW2A 1R12A 3BORA 1E60A 2FDXA 5AVKA 1T2NA 5U9CA 1L4NA 2P4UA 1K08A 3LUHA 2HBRA 4K2HA 3A6GA 1G5RA 1VE5A 3SM3A 4RNOA 4D45A 3QHAA 3R0IA 2UYHA 4P92A 3RM3A 1XCBA 4REQB 4WW0A 3PXGA 2ZIFA 3RJEA 2IH5A 1MRNA 5GAJA 3PDUA 5BQPA 1D2MA 4J7XA 2P40A 1U3GA 4IQTA 3QXJA 2ZTMA 2VQFB 3TLBA 5IFKA 1CX9B 2YRWA 3QU5A 4HDCA 4BQOA 5D6NA 5LZ8A 2VF8A 3NT4A 2FJ6A 4B9VA 5LIPA 1L7OA 4MVCA 2QVXX 1KEJA 1PE0A 1GUFA 1JNYA 2PTGA 3DDCA 5A0TA 2FQQA 2AHOB 1LSOA 2VP4A 4ASUA 1J21A 4PIVA 4TXMA 1BHJA 5JWOA 3OZVA 1GYPA 3C29A 1CUCA 1APBA 4N48A 2BTEA 2DP4E 1GT6A 4MI1A 3NUZA 2VL7A 1EFCA 3EDMA 1L7RA 3KWJA 3TVDA 5FNVF 2WHPA 2ENWA 4IX9A 3E82A 2CB9A 2OPHA 4HXYA 2A9VA 4LYFA 1EJ0A 4XQ9A 5BYBA 2CLSA 3IKLA 2XBLA 1F7VA 5FORA 2BCJQ 2DULA 1HFJA 1V8FA 5DN6D 1FRQA 1TW3A 5I3CA 4FLEA 4O25A 1ICEA 3RS4A 3CNOA 1J23A 1PUZA 4ZVPA 1M1XB 1PHRA 3BGOS 3GQVA 1F2TB 4OKIA 2K4IA 3RRJA 1P2VA 3BEDA 2LMRA 2NRXA 5JI3E 3ZDDA 1VJ0A 4WKBA 1BNPA 3CRRA 4JB0A 1QHFA 5G0SA 1FNDA 2J45A 4M3NA 2EFGA 3UFBA 1YOVB 2XZDA 1F0MA 1QTIA 2ZJBA 2R8KA 3F53A 1BZYA 4E5VA 3I0ZA 3D9QX 2QRGA 4S05A 3UJ3X 2AFHB 2F2TA 2XYQA 5CNKA 5DNYB 4IRCA 5EOVA 4M8NE 3ZDCA 4HDKA 1VHWA 3SEAA 2XWSA 4FZLA 4BOYA 1I4OA 1OYVA 1J90A 3Q3VA 3Q7EA 4ZZ1A 4OKSA 1DEHA 2BKEA 2PL3A 4U00A 2A9RA 3SAJA 2ZBEA 1P2UA 4AD8A 1T0BA 2MHCA 2PR7A 3IQEA 2H16A 2YV3A 1AQNA 1WY7A 3P0FA 3RUEA 5AUPB 2I4RA 3RAXA 1U1CA 5CFMA 4FCWA 3LUAA 3EGIA 1FUUA 4P5EA 3DE4X 3AR9A 4FJ0A 4U7TB 1ORIA 2UYYA 4YUVA 1OAAA 1C1XA 1LBHA 4H4CA 5K8CA 4ZZ0A 1JFFA 5DM2A 4INAA 3M70A 4C8OA 1DAOA 4MW2A 2WHYA 4RACA 3CEAA 2VTBB 5ILOA 2NVOA 1PTJC 4AG5A 2Z43A 5KMGA 4M04A 5IK2A 1KQFA 1H0HA 1DB3A 3NI2A 5TLSA 4MKRA 1ISIA 2VK4A 3AVQA 3FYSA 4R1OA 3C7CB 4RXUA 3RD5A 3RC1A 5IC4A 3D6JA 1PT8A 1MN8A 1NBMA 4I9HA 3AI3A 4BE9A 3EVNA 1Z4PX 2VDOB 2ZIGA 1OY1A 1BMDA 3ROTA 4S0ZA 4C06A 4ZQHA 4C07A 2KOBA 2P9HA 4KLLA 4EKDA 2IOHA 1PV1A 2VXOA 3CP8A 5CBPB 2YV4A 4JNCA 3WMGA 4KE7A 4PCUA 3M6XA 2Z8YM 1OXSC 2R2GA 6NULA 1WF6A 2P9CA 2VDKB 3V8EA 5CJ7A 5CB4F 4P4LA 2HXYA 4D0LB 4JQSA 5FJIA 2ZDHA 3MERA 3IR6A 1PBNA 4EFNA 4LC9A 3T9EA 1Q7EA 1J22A 1P91A 1VZ3A 3GFQA 4YAEA 4MKGA 1MPTA 3KQSA 4KHPB 3OZDA 1ACMA 1BD3A 1USUA 1SVWA 4WGGA 1YHZA 2RBKA 4WXRA 2VO1A 4NULA 4ZQFA 4M9QA 5HOQA 1C4XA 1D4OA 4XQGA 4C03A 3N8NA 5EWJB 3P9ZA 3SQXA 1X70A 2DE0X 4RQNA 1LW7A 4DOBA 5BUCA 2AYXA 2KNJA 2K6GA 4MHTA 1CR0A 3D6NB 1N2JA 3LUBA 2YRXA 3CLTC 1TVMA 1W0JA 2PMBA 3S68A 2C7GA 1GA4A 2O8EA 1GNVA 5TGZA 2LCFA 1P3DA 5LNK6 2HRZA 3FUXA 3AHGA 3GJYA 2V4RA 4DA0A 4DFMA 3IO3A 1ZNQO 2OLEA 1W59A 3JY6A 3C1UA 1RFGE 2RDJA 4MXDA 3HY3A 1DEXA 1EDOA 4A8PA 4DEXA 4WZAE 1BYIA 1M6NA 3DOCA 3SV3A 3LOUA 3M8KA 1ELOA 2JAPA 3TMAA 2KKVA 4MRVA 2ZVPX 3D0QA 4DLEA 1TM3E 3CA8A 5DB4A 1UWCA 1EXDA 3EEBA 1W4RA 1RAEA 4AZ3A 1QE5A 4BWFB 1L7MA 5K0TA 3KLPX 8MHTA 1SEPA 5F21A 2FJ0A 4F5PA 4CF3A 5KNLA 1SEVA 1XZNA 1OV4A 3ORHA 1D5WA 1GV0A 2ZS8A 1KFEB 4IOMA 3ZVKA 2ONKA 2JLQA 3IAFA 4PANA 5IBRA 3BWXA 2LGJA 4QWBA 1BXRA 1E3TA 1MABA 1R2QA 1Z4IA 4MLPA 3F47A 1KDZA 3AN1A 2XD9A 2BDTA 3RJMA 3NHUA 2P3QA 4Q1AA 4TTJA 1UKYA 3K0AB 4DMGA 4JLOA 2HHUA 4GP6A 5KSOA 3B1VA 1D7AA 1NVTA 4XM0A 1B23P 4FLMA 4PY2A 3N1UA 2R6CA 5AK4A 3DZBA 5LMNB 1RI2A 3QWBA 3R41A 3GEHA 1GXSB 3LDHA 4P5PA 5CLFA 4FYJA 1CJSA 2WP8J 4KXFB 2R8PA 1SUPA 4DIUA 1G8FA 3I34X 1NMEA 2IQIA 4OHMA 2NV0A 5GOZA 5BVHA 3I42A 2ZITA 1NBMD 4TYNA 1VIDA 1RYZA 4A8JC 3OUZA 4EY5A 1V37A 2J67A 2BFNA 1PQPA 2CDRA 3LQFA 3ILYA 2JKYA 3UHFA 1B6TA 2HBYA 2WABA 3RADC 5JY1A 1XNSA 4W82A 4MMZB 4NMMA 1KSGA 3I2JA 4AQDA 1KZ1A 5EMMA 3PSIA 4M8SA 2V9CA 1GL7A 2VP9A 3AL3A 3V80A 3QYJA 4E32A 5KVSA 3HUEA 5CM9C 2VDNB 1A04A 2Z1MA 4YK7A 9ICTA 4DV3B 2W8BB 5KTTA 4MS1A 3R1IA 1W5AA 4UFPA 1KY4A 2C31A 1TCVA 2B30A 2VJMA 4H2DA 1CY2A 1L3CA 3AM4A 4X45A 4ECSA 1S3GA 1E2QA 2NW6A 3MNFA 3L4SO 2QW0X 4RTQA 3GT7A 1W1UA 5D49A 4CKBB 5I48A 1PF7E 4WHMA 4BO3A 1KDOA 3WR5A 2R65A 5TX7A 3UGTA 5KEIA 4FC7A 3IVMA 1G16A 1OXXK 1R10A 5BN3B 1MC5A 3E9EA 4J7AA 2Q0XA 1W36B 1VKRA 5FWNA 4FBMA 1UBHS 2P6RA 1VYHA 2GPWA 3FSGA 3B5JA 2XGMA 3I2YX 4AROA 3AB7A 3UXHA 4TZKA 4RHEA 3RSOA 3GN1A 2PYDA 3G2PA 4X6YA 3MGKA 1YJAA 5KYXB 4FBUA 3N74A 1XJ0A 2AOTB 3CPSA 1CRXA 1Z7YA 2FZLA 4OBBA 1OXUA 2EW1A 2UXBB 1E2HA 2FLWA 2Z2JA 1TUIA 5TMEA 2KG5A 5GMOA 2QARA 3VX3A 2FOIA 3HRDD 5J2BA 3DBOB 3HCBA 4MGHA 3UQ0A 4JKOA 3D54D 4ZI2A 221PA 3LX6A 1I24A 3FM9A 3SDBA 1KBZA 5LOVF 1A8QA 4JI2B 3X44A 1V11B 4URVR 1G21A 3EXIA 5ES3A 4LQDA 3H2SA 3LVVA 2I8LA 2P4EA 2W90A 2JEGA 1YZLA 3V6LA 1Y6RA 5JARA 3V8BA 3C6BA 3GT0A 5DMXA 3QLTA 3ZLBA 3JRWA 3TPCA 1F8FA 1LSSA 4UB8U 1F4PA 3PEVA 1PP4A 3PHCA 4QJFB 1J8FA 1N7GA 3UV7A 4IY1A 4QO8A 4CV2A 1KMNA 1KP9A 3HCPA 3MGVA 3L84A 4ROSA 2A3NA 3NYWA 1N4AA 2R4TA 9ICFA 1GPYA 3O6VA 4WDQA 3IMFA 2MSKA 3WWOA 2QNIA 3R9WA 2GTIA 1BNOA 3HQ4O 2OHJA 3EWAA 3N75A 5CT9A 1JAYA 3C85A 4PCLA 3I5AA 1A4UA 4WZBA 1P81A 2MT9A 2JBAA 2KE7A 1J2YA 4I5EA 2AEMA 1T3QA 1KZYC 5KYKA 2Q6TA 3DC7A 1U9IA 3GD5A 3AI1A 5JDCC 2W22A 3WKDA 1MOZA 5HF5A 2OFFA 3FPFA 2H2WA 4G09A 2YQ5A 4LC1A 5CR9A 3CXUA 1KYTA 2JJ1D 2O9JA 5IJ9A 4B6JA 8ICLA 2WE8A 1JHRA 5JNSA 2NVUA 5FXMA 4LF4B 5KDOA 4ED2A 1UBMS 3OICA 2H7VA 1CIPA 1YGPA 2IHJA 1VA4A 2R87A 2QQ5A 3L43A 1JF8A 4E07A 2GNOA 1AMUA 1D4FA 3PPYA 3JAKB 4GPZA 3W34A 3PSFA 1CS0A 1VLLA 2XA9A 1UR5A 2A5DA 4OHUA 5K0NA 2WIAA 4TROA 4NH4A 3AUOA 4JU8A 2Q4BA 7ICKA 3C6YA 2PMEA 3GLFE 1GRCA 4KRXA 1WTAA 5FBHA 4NLZA 4H31A 5G4KB 1KR5A 3VAZA 2ZVQX 4A2CA 2ONYA 1PYOA 1CUKA 3AU8A 1T9BA 1KARA 2F8SA 2IOFK 2AFIE 1ZQFA 3P5BA 4QUDA 3GPBA 4BBZA 2QDKA 4NEHB 2FX5A 1NQ5A 1Z6PA 4PLYA 3GFOA 5IDXA 4MWEA 2LV8A 1R7RA 3THRA 5AIBA 4BV2A 3DLPX 3TCNA 3KTQA 1CB0A 1JXOA 4K4HA 3H8WA 3FF4A 2ZIAA 3KR9A 3LHFA 5EIHA 4IIXA 3NBYC 1X9IA 3ZKWA 4QA9A 3S1LA 1X6JA 4LCJA 1UMKA 4DOCA 3OOEA 4Q37A 5JQWA 3RAQA 5EMKA 4RA6A 2GI4A 3NRJA 4HQKA 5B7GA 3TZBA 4CGZA 4XCVA 3NT5A 2X86A 4E5SA 3I1JA 2I4NA 3FG9A 1KF0A 3CURA 4LYJA 3DXXA 1E64A 3B78A 4EHDA 3Q8RB 1S6YA 1GO2A 2KN7A 3KDSE 2V4UA 1W87A 4C7XA 1E1KA 5EAIA 2PY6A 4QDZA 4BXOA 5GJVC 5JSKA 1NKEA 1Q16A 3OE1A 1OFUA 2N1BA 1NDQA 1KAEA 1U1IA 4CHTA 2HHAA 4Z9XA 5JUMA 1SXIA 1KEPA 4D9BA 1RAIA 2QP4A 2E7ZA 1E3WA 1GQSA 4QZHA 1G20E 1V2GA 4GE3A 3SQDA 4Q03A 1Q0ZA 5E7IA 5GP1A 1CNFA 2DBRA 3VPHA 2N0SA 1SOAA 4R8KA 4LSWA 3O73A 1WKVA 3L8YA 3OX3A 1CULC 2QRMA 2HBZA 3CB2A 3T7TA 2UYOA 5FPHA 2EZTA 2N46A 3TECE 3VZQA 1I01A 5IZCC 3RT7A 1W48A 4Y1FA 1KMQA 1YAHA 5ARBA 3T9DA 4XUCA 1GQFA 1KH3A 3KZNA 3PQDA 1W36D 4UMVA 2W0SA 4DC0A 5C1BA 4J3FA 3JZFA 5KHAA 2Z09A 1TL7C 4AUKA 3A04A 1KMIY 1IZ9A 4GZ6A 1QIDA 4WCFA 4RPKA 4TT3D 4DA7A 2F55A 3EULA 5MF6A 4E4YA 4I99A 3O0FA 5C0OE 1YQUA 2DR2A 4LMBA 1RYFA 1Y1PA 2IIPA 3BHNA 4HX5A 4QXRA 4ZV9A 3C5GA 3WWPA 3MJ4A 4DA8A 4JT4A 2ZKIA 1FBNA 3ACDA 1LF0A 3BS5A 4ALNA 3TQFA 3I6MA 3QF7A 3TZKA 1O54A 1MV8A 3SI8A 2Q5EA 3BRWA 2A1JB 2FZ5A 3F4BA 2KICA 3ROGA 3FCXA 1VG9B 3NBMA 4ALMA 4TRJA 4J1SA 1CUBA 1ZQWA 1I4EB 1WF3A 3G2JA 3JS5A 1RU3A 2A9QA 1YNOA 5F9NA 1QB7A 2HIMA 1QZ3A 4Q4AB 2C22A 1EXVA 4P35A 1XPJA 1DVRA 3H9GA 4QSMA 4XVCA 1U8TA 3BBLA 1U0GA 2AWOA 1R0RE 4WLEA 4WADA 4JR2A 3OU2A 4ZV4A 4ZEMA 1HRDA 4OOFA 5DW0A 1NW8A 2XCAA 2REBA 4UCXA 3IRUA 1P2BA 1W73A 3KXPA 3CUKA 4XEUA 3FCAA 4CHGA 5KFIA 1W4CA 4JA0A 4PTYA 2BD0A 4KN8A 4GMGA 4C4YA 3BGDA 3HMKA 2CWWA 4TTIA 3LQ4A 2XYPA 1E2FA 1TNDA 4R1TA 3ZWMA 4NHOA 3L6UA 2O7RA 3RU3A 4HC4A 2H1RA 3CUSA 3KZKA 2DJIA 2AD1A 2F1JA 2PHZA 2ZIUB 5GIOE 1PJCA 1X1CA 3IUQA 3LDUA 4M4SA 1OLUB 9ICRA 5J2CA 4KRGA 1Y7LA 3S28A 3CZ5A 2IHYA 3GFGA 3M8RA 4DY6A 4IFBA 2HPZA 1WE2A 2XO7A 3LD9A 3NLLA 3JQDA 3L2OB 3AFOA 4BZPA 5B3JA 3VHQA 3L3FX 4YAUA 2XUGA 2V03A 2BZGA 1YRAA 3UM9A 4KX3A 5K03A 2PZMA 3EZNA 4Z54A 2BR3A 2V5UA 3NHKA 1YFLA 1O97C 4NXMB 3E5MA 2FW7A 4Q7KA 5FIUA 1THGA 1QVRA 4XAQA 2FN4A 4EBCA 3GDXA 1YR2A 3NASA 3ADOA 2ECOA 4CNBA 4U6PA 1B22A 1P2FA 2NXJA 4IQGA 2WG0A 1NY6A 1IIRA 1W5EA 3F7TA 4O4JF 3PW2A 3M6VA 3F71A 1CEQA 2XGPA 3I8SA 2BKXA 1RMYA 4BQIA 3OM1A 1QPGA 3UA3A 1RHUA 4I2NA 3TLYA 4WBNA 5A6VA 1QG2A 1JSZA 3EGXB 2B9VA 2JZBA 3GPLA 2BJVA 5TISU 4DL6A 4YRMA 4NJ8A 3BRWD 3O8OB 1ESDA 2YZ2A 4NBUA 1M34B 2H54A 2BBWA 3B53X 4QZAA 3P9YA 2IH2A 2DY1A 3RS7A 1X1EA 2WZQA 3UV3A 3SXJA 2HRBA 2JFGA 3DCIA 1H5NA 5KWIA 1AE1A 2NV6A 1DOZA 3MRXA 2CJPA 2P30A 2ACVA 4AKTA 2H3QA 1G6HA 5E3IA 3RB0A 1NYTA 2E4AA 4OHKA 2SBTA 5H4HA 3FDIA 1G6OA 7ICFA 1RM3A 1RBQA 4NZMA 1IPHA 1Z5GA 1K4MA 1XWWA 3M6MD 1PBTA 2QVLA 4MA4A 1XZGA 2PMDA 3QEOA 1HI9A 1FLNA 4GPIB 4K6GA 4WJLA 4ZC8A 3MUEA 2ZJAA 1I0LA 1SELA 3VPFA 1ZNZA 2WIDA 1N6LA 4QOEA 3U31A 2GILA 3HZZA 3DV0B 2I22A 1RP1A 3CBQA 1YL6A 5AKJA 4Q4JA 1B8UA 3S3TA 4YAFA 1PS9A 3GIWA 4YNBA 5KVVA 2Y2UA 5D46A 3IAEA 1DP4A 5DLYA 2FMPA 1NIPA 3OQNA 1VL8A 3FYTA 1UBKS 4BFTA 1JUDA 4EKYA 1G6KA 3GUUA 4HLNA 5BNTA 3KP1A 4JFAA 3OO0A 1OFGA 2KJ8A 3K7EA 5E0OA 4TXJA 4BVHA 2FMFA 2IP1A 5HZMA 4WZ6A 1U7HA 1P2GA 3TAXA 2ESRA 2Q4DA 4ZVTA 7ICPA 1R50A 3LG2A 1J4AA 2R8XA 3VYUB 3PJRA 4LS3A 5CDUA 4LN1A 5DSTA 2C1EA 3IMEA 3ZCTA 1WCWA 2QM0A 1J24A 1FW8A 1L0BA 2OK8A 3GPDG 5H80A 1PTJA 1AKWA 3S5JA 2CMKA 1VTKA 5J0QA 2R44A 3RJJA 1XO1A 1Z6YA 5AW7A 3LUFA 4P58A 5J2FA 3F4LA 2CE2X 3PR3A 3RH6A 3I04A 1IM4A 3T3GA 1NMYA 3LYAA 2XE8A 1EUDA 2HA3A 2WQ6A 3K0FA 1XTBA 3KFVA 3QA9A 1OUQA 1TEZA 4UTZA 2G63A 1T4GA 1SD2A 2JBHA 1NRWA 3IE2A 3L9WA 3ESQA 1HTWA 2VA2A 1P0PA 1M6EX 4IDBA 1NVVR 4M9RA 1Z0UA 2LBPA 1NN0A 2IBSA 3QPAA 4B0PA 3L0SA 4F72A 1Z37A 4WH0A 3NYQA 2CUNA 4Q48A 3L02A 2L0XA 4RADA 3V4ZA 4UAJA 1T1IA 2R9VA 2VEOA 3BXXA 4EGQA 4NU5A 2VBIA 2BCVA 2X7HA 3C6KA 3OQOA 1FDWA 5AHWA 4IJMA 3O74A 1CQXA 5B7QA 5JPCA 5J59A 2JHCA 4KQEA 3EDQA 2P2YA 5CYGA 3NKFA 2FQYA 3IEVA 4UOEA 2VCYA 5AVTA 1DWUA 5JBQA 5F52A 3B6MA 3IQDB 5FWYB 3N2GB 1RJ9B 4WKOA 5TMDA 3D59A 4OVKA 1WMFA 3ZXUB 3KLOA 1XALA 4J75A 3CZAA 1ZIXA 1P29A 3RVLA 3EOZA 3LX8A 1ZQJA 1Z0AA 3C5EA 5CJJA 4G5OA 5D86A 5ESXA 2I03A 3V7LA 1A5AB 2O6LA 2WD7A 4YT8A 4LDPA 3H9BA 2JI6A 2YFKA 4ZU3A 5AM1A 2V5VA 4BO7A 2JD2A 2JH3A 4ND8A 3R7BA 2Z2IA 4ZO7A 2V7QD 3BMCA 3HWSA 4F21A 2D7DA 1WXXA 4HAXA 1DZIA 5HIIA 2QQFA 1ZPDA 5LQSA 2RARA 3A27A 2FSHA 3CISA 1NZPA 3BB4A 1KOLA 4B32A 4BTEA 1UKCA 5DSZA 4DYDA 3T99A 4E31A 2CVZA 4EZ6A 5B37A 3QVVA 2VCHA 1KWKA 4RXMA 3TCKA 4ZHSA 3G7UA 2QQGA 4CLRB 3HCFA 4ED1A 4YT2A 3PGMA 1KI9A 2EV9A 3I01A 3RH0A 1ORTA 3ZHVA 3GZTB 2ZJ3A 2HOFA 5HA5A 5CEJA 1Q1BA 3ZJ4A 2V8OA 1XZLA 2D8MA 5L53A 2Y9UA 3BIOA 4LKRA 4DN6A 3WK8A 1CJKC 5DSXA 1E3IA 3G59A 2F17A 3GU3A 3CB4A 4ECAA 5L7WA 1HSOA 5KNIA 1BW9A 1H2BA 4NZYA 4KZPA 1IHOA 4ND1A 3ZLVA 4D2IA 5COQA 3HB5X 2O05A 3IPXA 3FOBA 2OG1A 3E35A 2F77X 4FQ7A 1P17A 2FN7A 4A8JA 1I2DA 5FO1A 1JSLA 2YC2C 5IHXA 4HWTA 3SR3A 3EVGA 3H86A 3R5KA 4RLFA 3HM2A 4M21A 3ILVA 1N8KA 4P9NA 2CFSA 3VR4A 1FMLA 2Z8ZA 4MFCA 2ORIA 4FK8A 3G1WA 3OPQA 1DIBA 2BMFA 4HDMB 4OFXA 3EZGA 1TJPB 1IJBA 1SVLA 2CMDA 3INNA 4HFRA 2NYVA 2BHLA 1U28C 1DJNA 2JFNA 2B37A 2DT5A 3INRA 4MQUA 3DWEX 1TU3A 1CEEA 3ZHXA 2JK0A 3OOHA 1I2MA 2QGNA 1WCYA 2I6QA 1QIFA 3UBTA 2B5WA 3UQYS 2CXYA 3EC7A 1Z15A 3V7NA 2JNWA 4IUCS 1FSPA 4GP9A 1O8BA 5HPYB 1RWBA 4ZOBA 4J0IA 4FZ3A 1Y7TA 3DKPA 1KFTA 1EZ4A 1U2QA 2VYFA 2DECA 1ZQMA 3QOYA 4L7QA 2WU3A 1KQNA 5ICFA 5FTNA 5HRCA 4K1XA 1J56A 2INGX 4D46A 3IIIA 3VSAA 3SBOA 4FFRA 1PEDA 4DPKA 4RE6A 1PK7A 4R1UA 3QBDA 1PW5A 1P19A 3F8TA 4DY4A 4OSPA 1ZG3A 1N1EA 3EIQA 3R3VA 4D0NA 4DCVA 4QG3A 3UBMA 2HEIA 4UE6A 3ROFA 3P2EA 2EYQA 3F3KA 3WRVA 4KV7A 3QUTA 5BSMA 1QTQA 3L1JA 3ASVA 2NXNA 3IUBA 3W78A 4K9OA 1WR8A 4OFWA 2SICE 4QEDA 2CEAA 2WNHA 1II8B 5FLYA 1EX1A 1HE4A 1MW9X 3IOBA 1H9BA 1I33A 4OJYA 4R6WA 2BF7A 3ORYA 4KLCA 4UFOA 1KIAA 4GZLA 2P1RA 5DLDA 2LPMA 4BPRA 4OB6A 8LDHA 5TARA 2IUYA 1K6JA 5BVGB 2R1ZA 3D3WB 3NBKA 5J0YA 4BP3A 2BI4A 3AB3A 4AM8A 2P2NA 3ZBUA 5IASA 3TEJA 3OIYA 3E5RA 2KHZA 4FU0A 1ISGA 1Y6QA 2C9OA 2PX4A 4RJKA 4CI0B 5DNEA 3TLGA 4BO0A 5NLLA 3LLVA 4GX5A 3PUZA 4GMKA 3VC7A 3AR5A 1E59A 1WULS 3CWZA 4EF6A 3KKMA 5ITZA 1P7WA 3WAJA 3WLRA 2JIRA 3RUDA 1X74A 3REOA 1C30B 1P9LA 4H7DA 5LB4A 3S2IA 4OQFA 3ZS8A 4AC9A 3NC0C 3TE7A 3AF5A 3GVIA 3OJXA 2A9FA 4JV0A 1TRKA 1VCHA 5KVCA 2VHEA 4UU8A 3HKZF 3M83A 2I55A 1Z0DA 3MABA 2G3YA 3A4LA 1UJ5A 1PG2A 3EVEA 1N77A 1U2GC 5F2NA 2H3ZA 3VNBA 3GAMA 4MP8A 1ISFA 1CUYA 3K0EA 2BKUA 3RUPA 5EINA 3V42A 4XQ0A 4PCAA 1U3FA 1Y8AA 1SHLA 3KVNA 2VK8A 2NU6B 2OHGA 5KZMB 2OILA 1FFUA 3EWNA 1YDMA 4ZHQA 1BU8A 3MWKA 1M6VB 4YPVA 3C6QA 4D26A 1JHQA 4MA5A 5IG2A 2IEIA 4KIFA 1T9GS 3V7UA 2XZLA 1FXWF 2I3GA 2ZWOA 4BBAA 3DW3X 2CYBA 4GKBA 2FZEA 5B6JA 1DQPA 3RRGA 4BZXA 1JMSA 1SUWA 4G0YA 1JEQB 2QUZA 2KV2A 4W8GA 5T3UA 1U7DA 4IKOA 4YAWA 1UCFA 2IP2A 3IT1A 4U7FA 4OJOA 3MCVA 1D2NA 2BGJA 1OASA 4FXPA 1M0WA 3CX6A 2VCEA 5A5FA 1AHNA 4JC0A 2QUHA 4LMAA 3STUA 1ESMA 5SYMA 4J90A 1YACA 4MUKA 4NBNA 4ZEWA 5BUQA 2X1VA 3VNAA 4M76B 3L7JA 1M8GA 3B9JA 3HJCA 1YVUA 1CT9A 1MIOA 2PAFA 2FWJA 4ETMA 1TZKA 2C83A 5ALHA 3RTCA 2O4UX 4CG0A 2HMTA 1IBKB 3OIUA 5ALYA 4DFPA 1CQPA 4B4WA 2YWDA 4LZGA 2V1UA 3L1VA 3G2QA 2PFOA 4QTZA 1T29A 2QMHA 2YOHA 3NTVA 2V4ZA 3CLRC 1AVTA 1L7AA 3ZU6A 5HOEA 2ZTEA 2UZ0A 4D9JA 4BVLA 3JPWA 3W1EA 1Q7CA 3WYNA 4G36A 2HDWA 1LPNA 1A1VA 1CKEA 1G8SA 1XDZA 2ZJ1A 3JQRA 1KY3A 2NADA 3N0XA 3DHYA 2C4WA 1CUIA 3GV8B 4ACBA 1CXZA 5DNVA 4E5UA 1XMPA 2OESA 1RHQA 2O2GA 4YN4A 4QTYA 4M46A 4DNPA 1PGPA 2WHPB 2C1XA 3VH3A 2VHQA 3WOVA 2PI5A 5LQAA 5BRAA 3GJXC 1GAWA 4NCAA 2YFYA 4P83A 3PJGA 3CZPA 2R86A 2ACKA 1BRMA 1QNLA 2R60A 2Y0BA 5FTLA 1FYWA 2XB4A 4GNRA 1JVBA 1WSDA 5CA1F 4X6LA 5ITWA 5IZCA 4BO5A 2C5SA 4Z0HO 3GRRA 2GJ4A 4LHWA 1EDDA 3BYZA 4YBZA 3E05A 1NFFA 2BH9A 5F3WB 6GPBA 3WZLA 1FDSA 4IGAA 4DR2B 4RVOA 2VOEA 1BU5A 4B3FX 2P5YA 8ICJA 4DREA 4GHWA 3Q6IA 3RS3A 1EFPA 4B9UA 4FINA 4N0DA 3OA0A 4MQFB 2O0HA 5CFPA 3RSFA 3SEZA 1G3RA 2XMDA 4HDKB 1V8PA 2ZIWA 3PUIA 3CLUC 3V46A 3DQZA 3TCXB 2CN1A 5J4VA 4J9RA 2DRIA 3WDSA 1HY3A 1VJGA 2H2IA 1QKKA 5KPDA 4UM9D 2N42A 2DF8A 3LZ6A 3RRNA 3BK7A 4DL9A 3IQWA 3BXPA 2A57A 1G2QA 4POAA 1YJXA 3O94A 5E4YA 1Z82A 3AEQA 5HRUA 4ONEA 1QMPA 1X14A 2NVBA 1C1XB 5A3JA 4DA6A 4GMHA 2QIPA 1JFFB 3BHMA 3D2QA 1SUBA 3EMBA 1J2UA 2VFAA 3P2KA 5H3CA 5CDYA 2OQRA 4DARA 5BMVF 4QWAA 4OFZA 5SZKB 3B9QA 1I5RA 5KMGB 1WVIA 2XCLA 3SWWA 1CFZA 4GZMA 4HYKA 1DADA 4UB4A 4LOHA 1IM8A 3FDJA 1BWRA 2PK3A 4UNPA 1BCRB 1M75A 5F76A 5AUQA 3MJCA 5GJWC 3UGKA 1AMOA 2G5PA 4JJKA 2OLJA 2BDEA 3RIMA 1F5NA 2O8CA 4NZNA 3L49A 1G19A 3QTTA 2ZWMA 1GZ4A 3W0LB 2WAQF 2EKBA 4DYHA 5DHAA 2Y9MB 3HNPA 2ZR9A 3FOAA 3HLKA 1HNXB 1SKRA 4HGYA 3DW1X 3UEOA 2R68A 1BGXT 4L6AA 1A9PA 1AN9A 5MN5A 1Y9ZA 1RYEA 1Q0HA 5A03A 4ER6A 4NZOA 3GWGA 3JARA 3WLLA 2XY6A 4MQBA 2GS9A 2IITA 4EVSA 4J76A 1RHKA 3H3FA 1Y88A 3LXXA 5FUQA 1TK3A 3RNLA 3A4MA 1WAMA 4KQMA 1OSNA 1DC6A 4KVGA 4ENVA 2FEWB 1NWCA 1Q44A 3HTXA 5G1PA 2P6NA 5KBYA 1ZR4A 2GCIA 2XXAA 2Y9TA 4H17A 2JHFA 2CCJA 1PR0A 2WYWA 4TYMA 4GD3Q 2X1MA 3WVNA 2ZSBA 4TLBA 1Q11A 2BFEB 2VSNA 2CZQA 3JWJA 4FS3A 2NT4A 1UF9A 4NOMA 2VLBA 1HYGA 5B3LA 5L3QA 5DG9A 1U7WA 1M2WA 1Q1QA 2OT3B 2YYZA 3BD6A 2BTQA 4ZOAA 1T2VA 2PR2A 1Q21A 3KAPA 3LL7A 2QV7A 2QKYA 3ILXA 1E5VA 2KM1A 4YMMA 3N28A 5DWDA 4CM4A 1PVOA 1XDGA 4ZT6A 1JIUA 1ZOIA 1YVPA 1TT7A 5G53C 2KVSA 3HVIA 2EZYA 4XPZA 4RFSA 3LT0A 4B7CA 3KFLA 5DGCA 1S4QA 2EVWX 4C8KA 3W9UA 1Q2UA 2ZRIA 3HJUA 2R6DA 4DQLA 1DBRA 1LC0A 5K3DA 5JBIA 5DQIA 4AZ3B 2FPGA 3RHTA 3LCCA 2W4QA 1E8NA 3ZG6A 3HR7A 2FXVA 2NNLD 4J43A 4YHHB 4Z4FA 1LA2A 2F4VB 2CXPA 1BN7A 2CZCA 1PWEA 4NBTA 5C1PA 2MA1A 2J6HA 1LBEA 2IYAA 4FOOA 2SKCA 2E3JA 3I6YA 3RSLA 1HUZA 16PKA 3M81A 2FETA 1FSSA 1DWQA 4M1MA 1WUHS 1YS2X 5KYWA 4IJKA 1T34A 5AOBA 2R8RA 2IQ5A 2FWIA 1FYDA 3HPRA 1E2MA 1V95A 1JSCA 3MJDA 5CM2Z 2ZRHA 1CDZA 4JV1A 1SIOA 2XYHA 4ASUD 2QRUA 3FX2A 4V1CI 1S2IA 4XFDA 1AQIA 2GPNA 1BJTA 3MLBA 2AGVA 2XVMA 5L95A 3MQ2A 1N1MA 3DT8A 3FLAA 3N6XA 1E7QA 1X7XA 1W49A 5AM3A 5BVHB 1R16A 1QAOA 5CLQA 4IIYA 4P7KA 5EPEA 2FH5B 3FB4A 2JCSA 4NCJA 3V97A 3F5EA 2BFFB 1P39A 4EA7A 4HGRA 4UE3S 2ZRGA 1ILEA 5J4HA 4KQIA 2L5YA 5SZIA 2ABWA 5JO9A 4FBLA 3I4LA 1UMBB 4V24A 5IIIA 3BCHA 1AKNA 5UKDA 4WNIA 4XWYA 1HEUA 2BKAA 2YWBA 1GZHB 1R00A 4HAWA 3JVUA 1WO8A 4JUCA 1UEIA 2ATXA 2V4QA 1EDBA 1ZUWA 3ELYA 2QZPA 2HYIC 1FLVA 4QGSA 3TIXB 4DVJA 4JMLA 4J9NA 2XKAA 4MEXA 1XTJA 1XC7A 3ON5A 3T9AA 3NM6B 1GP2A 2XOKA 4QOIA 5IT4A 3B2EA 4AS1A 5T67A 4YFYA 1XU9A 3NALA 5TV2A 2NO0A 2VHWA 4PFJA 4KSBA 1NJWA 3WFJA 5HYVA 1XOIA 3IT2A 4EYKA 3QUSA 1RYMA 1NBOA 3T41A 4KB5A 1MORA 3ZNPA 1Z8HA 2WJAA 5FV4A 1GKKA 4INOA 1FDUA 3JALA 4M2LA 5FTKA 2TMDA 4C7MA 4AN1A 3MGBA 1EFTA 2IA5A 2NNWB 1SIJA 2Q9BA 4MYCA 4K9SA 1X7DA 4LZOA 4EUNA 1E5DA 4IIDA 2HF2A 3PICA 5TXGA 1QH0A 3ER8A 5ALIA 3BQ2A 2F76X 1U3DA 4ARZA 5IK2D 3NT2A 1F6DA 5IYZF 3L7NA 2J6IA 5BXYA 2UZIR 3TAHA 1OUMA 4BPBA 3NHFA 4Z8YA 4I9FA 3K75D 4UHDA 2WIKA 3I05A 2HM7A 2DPJA 1ZH0A 4OK6A 5LQNA 2QN7A 2QARB 4I4LA 2FGJA 4MTCA 2GHTA 3A2MA 1N6OA 3ISVA 2JFBA 1Z0JA 1N63A 1XQYA 1S1MA 3L06A 4DCGA 1JN3A 5ADUS 4PLZA 3DP9A 1AKTA 2IRWA 3NNNA 1SG0A 1G21B 3EXIB 2BCEA 1U49A 1IH8A 2BMJA 3EBLA 4L4UA 3C7KA 4LDRA 1HMPA 2DKZA 1TKAA 2LM1A 4NC9A 2XICA 2WFLB 2FSVC 3W2IA 4YP9A 1NBAA 2O2ZA 4Q47A 5C80A 4GX0A 2WSIA 1Y1TA 3MGHA 2JAHA 1ZQ9A 2YB4A 4ND5A 4HLQB 5JD5A 4ZGGA 3T5LA 4F7WA 5JU5A 1Q0QA 2BI8A 3C87A 1W5TA 3CIOA 1KYIA 3G17A 3O7WA 2BMEA 3JVVA 4BCDA 3PE4A 4D0GA 4F3TA 2QD2A 4PVCA 4DR5B 1YVRA 4N76A 3DYIA 2GAOA 2PJRA 3IUNA 5LPNA 1RYRA 4IMRA 2JBAB 1UDAA 1NVUQ 4MUJA 1A0OA 1SBTA 4K6KA 2N1RA 4J9OA 3GFFA 1JILA 1A8HA 1SKQA 1T8UA 1UK6A 2AXTU 1W0JD 1G3QA 5DV9A 1KFSA 3VGPA 4CVNA 2A30A 3CPHA 1Z2CA 5J5AA 4DSFA 2LHTA 3IIEA 3KFUF 3OIWA 1U5AA 4DMMA 2YZMA 3FCCA 1BA3A 3H1AA 4QXMA 3VYVA 4WWHA 5KTNA 1XYVA 4BJQA 1EESA 4CMHA 1ORHA 3R44A 5DEIA 1EXNA 4FHCA 5BN4A 2CNKA 5CB0A 3RS8A 3ITKA 2CJWA 3RRHA 3DCJA 1U3CA 2CHGA 3OLCX 4OTZA 3F7OA 2GDJA 1NW9B 1HDIA 4QREA 2G9RA 2PT5A 3IUSA 2L82A <