2ZIVB

Crystal structure of the mus81-eme1 complex
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
332
structure length
269
Chain Sequence
ECLKHIIVVLDPVLLQMEGGGQLLGALQTMECRCVIEAQAVPCSVTWRRDWVEEPTVLVLLRAEAFVSMIDNGKTLQGFVTDITAKTAGKALSLVIVDQEKYFRSQLPEVSRVDAEEALVDLQLHTEAQAQIVQSWKELADFTCAFTKAVAEAPLRDETTFSFCLESDWAGGVKVDLAGRGLALVWRRQIQQLNRVSLEMASAVVNAYPSPQLLVQAYQQCFSDKERQNLLADIQVRRGESTSRRIGPELSRRIYLQMTTLQPHLSLDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mus81 protein
publication title Crystal structure of the Mus81-Eme1 complex
pubmed doi rcsb
source organism Danio rerio
molecule tags Hydrolase
total genus 68
structure length 269
sequence length 332
ec nomenclature ec 3.1.22.-:
pdb deposition date 2008-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02732 ERCC4 ERCC4 domain
B PF02732 ERCC4 ERCC4 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.670 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2zivB02
3.40.50.10130 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2zivB01
4P0PB 2ZIWB 2ZIXA 2ZIVA 4P0QB 1J24A 4BXOA 4P0PA 2ZIWA 2BHNA 2JPDA 4P0QA 2BGWA 2M9MA 2ZIUB 2A1IA 4M6WB 1J22A 1J23A 2ZIUA 4M6WA 2JNWA 2ZIXB 2ZIVB 4BXOB 1J25A
chains in the Genus database with same CATH superfamily
1UBEA 4TRRA 3DE1X 4MQBA 1MIOA 3H5OA 3PUKA 2NWQA 3R5TA 4RVUA 1Y34E 1UDWA 2O7RA 3GLFE 4C3ZA 2A8YA 3F49S 4FINA 4BPBA 3D2LA 3GOHA 1UQTA 3RRFA 2XZTA 3GFVA 4FGUA 4R2JA 3ND9A 5P21A 4B3JA 2ZYHA 2CXTA 1ULHA 5FRDA 3USES 1BGWA 4HEHA 1FTWA 1GSIA 1V0JA 3HMKA 1QP8A 3TI0A 3GV7B 1GPDG 3EDQA 4RHEA 1MH9A 2GM5A 5DHSA 3L8ZA 4R05A 3LLMA 5ALXA 1F12A 1DOZA 1X74A 4CDNA 3T5PA 2HWXA 3QU9A 5B2EA 4O29A 1BE1A 3OZTA 1P1CA 4PPGA 4UHDA 3WYBA 5IM4F 4IPTA 4QXRA 3IVAA 1QGDA 2OFWA 3F3SA 5BSEA 1K5GA 3HYCA 4MLCA 2DYKA 1XKLA 1PZXA 2QX4A 5M5BA 4YQFA 721PA 1DG3A 2KFZA 2SECE 5KMGB 2V98A 4QUJA 1JIKA 1VHDA 4KOEC 2J6IA 4AZ3A 4XUCA 4TSFD 5ICFA 5FWAA 1ZGGA 1M2VB 4YXWA 5H9WA 2CNBA 1H1LA 4NQZA 4DBVO 2DR3A 1OZFA 3X2SA 3K96A 1FMJA 2Q2QA 2LRHA 4DYHA 1KO8A 1R5NA 4TLMB 3A6FA 2AYYA 3QVMA 3JQ9C 4FHCA 4H6PA 1UBNA 1KEZA 3KUDA 4QJFB 3MM4A 5E2IA 4QJ4A 4EVRA 4ZXFA 1K4KA 1QE3A 3UJ3X 3WGUA 2R5NA 4G0XA 1OXVA 2PRZA 3UMBA 1SUEA 1EUDB 5FPYA 4DL3A 4EKNB 4GD3Q 1BDIA 3RU9A 3U44A 3AOEA 2ONKA 1QQ6A 1Q7TA 4EBBA 3DHYA 1BFDA 3W2GA 4YD1A 1IOWA 2GUGA 3FIUA 1YGPA 2E4WA 4WIAA 1DK3A 4RMJA 2A9JA 3JWIA 4NBVA 1LVHA 2ACWA 4IY1A 4P2HA 1IEQA 1A2KC 5KJEA 2HU5A 1ZY2A 3M6XA 1NRWA 1CZUA 3W2HA 4HFNA 4PY2A 1XQ9A 3ZLBA 5KVQA 4AZVA 2A3NA 2GCPA 1ZH4A 3TBFA 1Z33A 3FY4A 4X0EA 2O6HA 4W6ZA 2XVYA 5FV4A 4QRDA 3GZ4A 3W9SA 4E5DA 2WWRA 2OV6A 3G5LA 2QPOA 1ZXLA 4DQIA 1GG2A 5EXXA 4IOKA 3SXPA 1PYGA 4IDHA 2DUWA 1E4YA 3KOOA 3K35A 4PN3A 1YZNA 3T3MB 4DS3A 1AHNA 5DXJA 2QR2A 4QOJA 2FLWA 2K8AA 4N3AA 1M8JA 1PJCA 1WW8A 5LYYA 2W71A 3EFOA 2ESEA 5KEIA 3K5IA 3MWJA 1PZFA 4U63A 1JR3A 3BGWA 1VPDA 3CINA 1BGXT 3FLMA 2C3MA 4RQTA 3T0GA 5LDGA 1PTKA 4GO1A 3B13B 1R0RE 3Q12A 4JBHA 1X9IA 2RKBA 4WCFA 2IS2A 3GNTA 3GIIA 3G0OA 1Z35A 1LPMA 4XRHA 2XBMA 4OHBA 3PQ2A 3PRYA 1FS4A 3OP4A 1FZQA 4HB3A 2Q5IA 1G5IA 5IF3A 3LA8A 2UZ1A 3AL3A 3DDCA 5J47A 2QL5A 2GKOA 3A28A 4RK6A 2ATVA 2FWAA 2O8NA 2YJNA 8ICTA 1CUGA 2XLCA 2PIDA 2ZAIA 3H17A 2OBBA 4HSGA 2YV2A 1A8IA 2W6ID 4I1PA 1VYHA 4R2LA 1HT3A 2J09A 5K0CA 1EFLA 3A9WA 3D2SA 4IWXA 4HQOA 4XSGA 3O4VA 4IFTA 4PU0A 4F3RA 2Q2OA 8ICGA 3R0XA 1UZMA 3HWRA 2GNOA 2H4FA 3A7DA 4MRMB 1DU4A 1C81A 1GYRA 3VC7A 4YRJA 4RGQA 1ZUHA 2ORED 3OHSX 2B1RA 3AG5A 4KQFA 1V85A 1SBYA 5KSYA 3IUMA 4JLUA 2FPKA 4B7AA 1DBWA 4V03A 1MV5A 3PW7A 4FOTA 3L7MA 3AONB 3CPJB 4IBOA 3HP1A 2YZ7A 1U5BB 5TJHA 8ICZA 3HKCA 3P2JA 4IL5A 1T6NA 1F14A 1TNDA 3IQDB 3RVBA 2RG7A 1AHHA 1KS2A 3V1TC 3DV2A 3I8OA 4UUBA 4Y1FA 3WRVA 4GH5A 4P93A 4DABA 4ZTUB 4P2BA 4MV7A 3FR7A 4M86A 5KFEA 3MWLA 3L8CA 4O4LB 1QUFA 1GR1A 4BNZA 1A4XA 4MMZB 4B9AA 5AVXA 2BCEA 4B6GA 2JFVA 4MYDA 4MJ3A 3E6AA 4PONA 4X66B 5HF5A 3PX7A 3BH0A 3CTMA 2FI1A 3A14A 1MQ8B 4OUDA 3UJHA 5J43A 3A7EA 1ZLXA 4DTCA 3DULA 5IU6A 2GWHA 1OYVA 1KZ9A 3CR8A 2XOKD 4YCBA 1EWYA 2HHLA 4D74A 3EJWA 1W5FA 2Q6IA 4G5OA 4DL2A 1OFGA 2CUKA 2O8BA 4CF7A 2X77A 4PBSA 3VAYA 4IM7A 2BM9A 4RIGA 1GTVA 4BVFA 4I4CA 1DV1A 2FCRA 2JAQA 5K2MA 4XAQA 1PUZA 1N4DA 1B6TA 4X1IB 4WZBE 2H3IA 2HCJB 2GYWA 2HK6A 1CDDA 1KQQA 3DG9A 1NJSA 2YUIA 4R1TA 3B3AA 2IHVA 3HO1A 2ZYAA 4QEZA 3C7AA 2R1VA 4E94A 2YOFA 4UEQA 3VNSA 9ICOA 4B17A 2CXQA 4HNUA 2ZJ1A 1LC3A 1KERA 5GADl 3R3ZA 3WGGA 2GJKA 4LQ4A 7ICEA 5ELLA 3HDVA 3GBVA 1VKOA 4DJFC 2JHDA 2WLTA 3D31A 1TK9A 2OBMA 4JBNA 421PA 1QHNA 3OZBA 4D4GA 5IT5A 1GCIA 1WKCA 2X9LA 3RBAA 1CKEA 1KYWA 3BMQA 4M0KA 1D0SA 1PJRA 4CLOB 2QE7D 2QMZA 3KTDA 4DV1B 1RQ2A 2V8BA 1ZESA 4FS8A 1CYEA 4DUYB 5CNJA 2Y9MB 7ICQA 4K9KA 2HU7A 4RD0A 2IYFA 3VAZA 3EF0A 5C46F 1L1QA 3VTFA 2Q5FA 4O0LA 4HOYA 1T4MA 4TVBA 5IKEA 3EY4A 3QKUA 5HYVA 3TW0A 1JGTA 3E7FA 4B9VA 1T6BY 4O3MA 2ZRPA 4BO4A 4E1AA 4DC1A 3PZPA 2J3HA 4WUVA 4M22A 2E1EA 4W1RA 4TMVA 2HFKA 1M8GA 3JRNA 3J7TA 1WUJS 2L42A 3NRCA 4IDDA 2PQMA 3QF7A 1L7MA 4JLMA 3WHPA 4QC2A 4XFDA 1H2AS 1MC4A 1E6CA 1MJGM 2ZBFA 1YZVA 5BNZA 1YCGA 2KOBA 4R2HA 3D6UA 3F5MA 3CISA 2GN4A 2D8AA 2WUWE 3KB6A 1T3TA 4I2HA 4HNQA 3HDTA 4JI7B 2ZJ2A 2WFLB 4KFUA 4A0GA 4TMXA 3RV3A 3DSRA 4EMTA 4NABA 1T36A 3NH6A 2VBCA 1H6DA 4GX5A 1NF2A 3NTOA 1Q1EA 1YC5A 1OX4B 5KFHA 2A19A 4F6RA 1EZZA 1F0NA 2ZBEA 4M8IA 4FEGA 5TE9A 1WZEA 5ECYA 3B6ZA 3AO0B 4Z6EA 4YP0A 2VQ3A 3NDJA 2AZXA 1ZQEA 1GILA 1DZ3A 4NM1A 2KP7A 5KFRA 5L3ZA 2A3VA 5E95A 4YUXA 3EQ2A 4JGBA 3IJRA 2OVBA 2COUA 3H5TA 4CM1A 1GIAA 4ZK6A 5SYMA 2XE7A 4M9QA 5I4CA 4MWOA 5G02A 2VK1A 3BFKA 1K97A 3ASVA 1C3LA 1E77A 4AQDA 1R15A 1UDRA 3QELA 4J0KA 3WGJA 2ZEJA 1SVLA 5E6UA 5FA5A 2PKQP 1RWMA 1H2BA 3N7RC 1QO0A 1X19A 2C0CA 1A8HA 1VJ5A 3JY6A 1N92A 4XIYA 4ZCMA 3KV1A 2PGOA 3RCBA 4KACA 1VMAA 1LB1B 5I4BA 2H9AA 4JEIA 3WXMA 4QZEA 1K5OA 4PYJA 3PV8A 4J91A 3ICCA 5C1BA 5G1OA 4ZVKA 1HV8A 3NVAA 2QIOA 2DT5A 4GKKB 4WL0A 1XXHA 1N2JA 1RYRA 1PUIA 1BVSA 3ZZTA 4HF7A 4ZCSA 4QM7A 4RHTA 1WIWA 3RJMA 5H16A 1QTRA 5AVUA 1JLRA 1NF9A 3B12A 4LZWA 5CHGA 1Z63A 4LKOA 5ADWA 4YRAA 1V6CA 3BGIA 2XXJA 4FPXA 1BH6A 2LE0A 5ED0A 3W5VA 4KZKA 4Y1EA 5HUJA 2E21A 3LYSA 2XDQB 2MT9A 5J3JA 4ZAZA 2HW3A 2QRNA 4PYOA 1OHHD 2J3DA 1CEEA 1DOQA 1LF5A 1OLOA 5LD2B 1W0JD 1C5KA 3UM9A 1AS0A 2EW2A 1PX2A 4CKWB 5MFPA 2JFBA 3AHEA 1MN6A 5C8XA 2FEWB 2QWXA 2NW6A 4L8FA 3F9RA 5L3VA 4HDRB 3HQ4O 1XP5A 4BGUA 4UTNA 1YZ6A 1W35A 2FN9A 3QVVA 3FOAA 4QWAA 5C52B 3GR6A 1EJ2A 4F4ZA 1M73E 4CJXA 1SHZA 2ZW9A 5CDSA 1ANKA 1EXDA 5DKFA 3CEHA 1QRTA 1SXPA 2WD8A 3DA8A 1YS9A 2ZR9A 3R44A 4L08A 3WDSA 3K1YA 1S2DA 3M8SA 1N2CA 4MVJG 5M29A 2KLHA 1F20A 4B6SA 1NAHA 4H31A 3MUNA 5ALYA 2DRIA 3IH5A 2GBFA 2BONA 3HFJA 2I4NA 4PTLA 2C9YA 1AURA 1JH8A 5K0FA 4OXQA 1DO2A 3AVUA 1YS1X 1N6NA 3NBZC 1E3EA 3Q2IA 4IIDA 1U0JA 2QX8A 1V39A 3A6ZA 4ID3A 3G5MA 4K6OA 1I7SB 1KFJB 4DS5A 1MJHA 4QEKA 2VLBA 2PV0A 2ZXHA 5IJWA 2VIXA 4HP8A 2Y2VA 5ADUS 2MR5A 1G55A 1HUOA 3B1KA 3MJTA 4A23A 2KZ3A 2QSUA 5C1OA 4QGHA 3CLTD 4NMHA 2X0NA 1F8FA 3OQOA 1U9ZA 6REQB 1DSSG 2JKVA 8ICQA 1TVMA 2XUQA 1LSUA 1ENYA 3TDKA 2XLBA 2Z3WA 4A2WA 3FYSA 2HYDA 2DECA 1SA0A 3AKYA 1E8DA 2DGDA 3CEAA 4BNVA 3BSYA 5AM1A 1UK9A 2KW5A 3F5SA 4HZUB 5IM4A 4A15A 1QIJA 4HO1X 4UVHA 3HG7A 2PO7A 4FCTA 2FEPA 4EZ9A 3EZGA 3UQYS 5COBA 4I55B 5CEJA 3C5FA 2AOUA 1RIIA 5JAHA 3L8FA 1TT7A 1HYEA 2QNBA 4ND4A 4L75A 5J5AA 1E1NA 2Q7OE 1Z74A 2IXTA 4CM5A 2PTGA 2ODAA 1GU7A 3KX2A 3TZKA 1B41A 1MFZA 2EW1A 8ICCA 4AYBC 3MJVA 1KJQA 3QVSA 2QN2A 1AQYA 3DONA 4YCMA 3W90A 1Y37A 2GS9A 5EKUA 5JWRA 4L73A 3B0YA 1WDKA 3OCZA 1HI9A 2W2TA 1BHSA 3PLRA 2XYPA 3CZQA 3GRAA 4D82A 1KI6B 2CUZA 1Z75A 1QRRA 2P0EA 1Y6JA 2APJA 3LDAA 3F6RA 4MULA 2Q9BA 5HF8A 3ZNQA 5KNIA 4LK3A 3U2QA 5E1MA 5KU1A 4J9LA 4JYPA 5FL7D 5IARA 1J0DA 3P2YA 4P53A 1UOPA 4CFYA 3NAGA 3G1WA 2KIWA 5DHUA 4H4CA 3VMFA 3AR3A 3PNKA 1ZQ1A 3R5KA 3ZHRA 3CVXA 5J5CA 3H4IA 3WHIA 3HYLA 4BKRA 3SV4A 3S29A 1AROP 1EBBA 1OY1A 4HATA 4Z4QA 4IDPA 1HETA 4AY4A 2NYVA 5CDFE 1SXEA 5BNTA 5DSZA 1F4PA 3K9FC 3BPSA 5LYJB 2BDPA 1YL7A 2QVYX 5C80A 2BKAA 4KMOB 5KQRA 4BNIA 3LKZA 3SHFA 3PU6A 2O19A 3CX6A 1SL0A 3OOHA 5KT5A 3ZZNA 1GU1A 4PSVA 4Y2TA 5K8LA 3DE7X 2BFOA 1UINA 5D1NA 1IM8A 2Q62A 2R751 1G7TA 1UUFA 2BMAA 3R40A 1GKIA 4CFZA 4U2EA 2DFVA 4AJPA 4UE6A 2ZIXB 2LYAA 4BNFA 1XRPA 3TLMA 2PMDA 3DTNA 3IR7A 4RXMA 2YX1A 5H02A 1X9MA 4C3UA 4KLNA 4NU0A 3DZDA 3Q7QA 5EWGA 4JBLA 4LE2A 4MQMA 1H8ED 2BM8A 3N2IA 3MR6A 1WV1A 3D2QA 3KO8A 4DSAA 3CONA 1NP7A 1NJ8A 4L0CA 4NVRA 2QMEA 5AXCA 3T0FA 5JROA 3CFYA 4HDKB 5KTNA 4D8TA 3FPCA 5JALA 1N75A 2F90A 1UCVA 1RYHA 2C4KA 1NJFA 2X3UA 4D9CA 2OXTA 3B9QA 1W75A 5D46A 5CCEA 1O6CA 2I99A 3BS5B 2H7VA 4WJZA 1RC1A 5ALNA 4ED9A 1L7NA 4D46A 2G70A 2PH3A 2IZZA 3GPDG 2PGLA 3FDZB 3TIGA 4FWIB 5JO0A 4L5CA 5EXPA 4J2OA 2IDMA 2Z9CA 3RUCA 2HF7A 1RCUA 3CLKA 1V16A 2BT4A 3BBPA 3ILSA 5BN4A 1YA6A 1NW9B 3F3MA 4ZALA 2P27A 1XP8A 4JLDA 2VAMA 2V7VA 1D07A 3PW0A 4OJKA 3O4GA 5DWQA 3GARA 3OJOA 3K5HA 1XX6A 1H6CA 1QH1A 1Y7PA 2Z0MA 4H7JA 5K4LA 3MTAA 4TLCA 2FZ4A 5HWSA 3NIDB 1GGHA 5JXJA 2ZIEA 4DG5A 5LQDA 5B3KA 2OLKA 5TF4A 5BV1A 1ZIYA 4LOHA 4LMPA 1WBJB 4BNGA 4Q7MB 2P1RA 1NG9A 3LPDA 4O6VA 2H63A 3QNMA 5C9ZA 4D6PA 2BH2A 4I2NA 7ICFA 3CPSA 2AN3A 2CHGA 3GMDA 2OXOA 3KHKA 4CRXA 3CZ5A 2C77A 4N1AA 2QOEA 2PLFA 1NFRA 5K3DA 3WE7A 5T41A 4HVTA 3OHMA 2V7QD 3L4BC 2OGUA 3GGSA 3AFIA 1ZM9A 4A91A 3TLYA 2VP2A 4DL7A 3EW7A 1MAUA 1QV7A 1A9PA 3WIBA 2CVHA 1U04A 3L02A 3HXMA 3WGHA 3DAFA 5KFNA 7ICVA 3C1UA 3LOQA 1X92A 2O7SA 2LR0A 4ABYA 2K4IA 3H0RB 2XICA 8ABPA 1CEXA 1WP4A 4BQQA 3GGPA 2CNWA 5DTQA 1WWUA 5FR1A 2AVDA 2R4TA 1QSGA 4N0DA 1ZM3A 4YRDA 1P18A 2OD2A 2UYGA 4RNMA 2WK1A 2GM9A 3ND5A 4JGGA 4ZVSA 2WVAA 5FAKA 4BEJA 4NDAA 2VKQA 3PDJA 1CFJA 1YE5A 4YRFA 1EWKA 4QBGB 1D4AA 4RENA 2JAHA 5BOMA 1CEYA 3GCWA 4R1OA 3RS8A 4DXHA 3GV5B 4YMLA 2ZULA 3OQJA 3MABA 1DAPA 3LT2A 3KQSA 3Q9UA 3ILHA 1SHTX 4WXEA 2CXSA 1W46A 3WL6A 3OHAA 4CR7A 3FMOB 5D84A 2ZYIA 3SBDA 1SZJG 3C1ZA 1Q16A 1U9IA 3RJZA 5TZVA 2FJ0A 3EXFA 2I03A 2XRFA 4W4TA 3DLIA 3K09A 4FMPA 1C2YA 3KSUA 3EZ7A 2ZRAA 4WI1A 2CDNA 4X6XA 3REQA 5HUHA 3COPA 1R6TA 4YJ2A 2AS0A 4EI7A 2E1PA 3EB9A 3RYIA 2C61A 4UPDA 4R41A 3BXHA 3R8CA 3DBLA 3KB8A 4EIWA 3ZJ4A 1XNSA 2H2HA 1ZCJA 3F8TA 4R65A 4AN1A 5ENDA 4D9KA 4KTVE 2BLLA 3OO0A 2J6UA 4FFOA 5MDHA 1N2HA 3E0XA 3QVLA 4RLHA 1YS4A 2CF5A 3SE7A 2Q5CA 5T5QA 3HGTA 3OETA 1EQ2A 4O2AB 2BSQA 4RWZA 5H2FU 1WHSA 4DIDA 2OCKA 2YQZA 4NYIQ 1M67A 3D0RA 3LXXA 1IJKA 3PXEA 4ASUA 4FSXA 1B2LA 1BSVA 2JNWA 4B4OA 4AJIA 2GD0A 4UEJA 1R6XA 2H2WA 1FTQA 3UHPA 5KTOA 2IKQA 5CDUA 3UJ6A 1UXIA 2WYWA 4FFMA 3FDFA 4KI0A 4QBKA 5EHGA 4DBLE 2MYTA 1A7AA 1MAWA 4GPZA 4Q7QA 2HRRA 2V5AA 3TSZA 1DX6A 4UJ5A 1A4IA 4DSIA 3ZWMA 1DJLA 3NTUA 3KB1A 1UANA 9ICRA 4IXWA 4H3VA 2AB0A 3E61A 1FS6A 5KWJA 2YVAA 3F6YA 2UU9B 2EP5A 3GFBA 4Z7NB 1SVNA 4V0RA 5DTIA 3M1LA 3HB5X 5WRFA 5CB1A 2O2HA 4UB3A 2MSKA 2Z57A 3DKIA 1IBRA 3WYAA 3HP7A 4DCMA 4AY6A 3CA8A 1X7DA 3NHJA 3PPYA 3KOXA 2CV0A 2IXEA 3WB9A 1EXVA 3A1CA 1XAJA 3K73O 4C7OA 2IY9A 1IBMB 4PYQA 3FYDA 4CQMB 2X4GA 3FOEC 2C8VA 1JLLB 1US8A 4XJVA 3WNBA 5AVKA 4RD6A 1I7DA 4WEOA 1NTOA 4CLHA 1DS6A 2AI1A 3WQBA 1IIBA 3SEAA 2QV0A 4KI7A 3WLTA 3ZKAA 2DLNA 4M1MA 1JN3A 1ZO8A 1TC2A 3WV4A 1PK8A 1E6UA 4QQNA 1J39A 3TFRA 1YQWA 4DT1A 1T6ZA 4KV9A 1T3SA 4LJ9A 1OFTA 4M9GA 3HZZA 4QNMA 4EI2A 2A0UA 4ZMSA 3SGLA 5CLGA 1LPPA 2WG0A 2IX3A 5CD1A 3QKIA 4YRTA 4JR1A 1NJYA 4MGYR 4XM2A 1QH9A 2JCBA 1ULUA 4DANA 3MBKA 4CCHA 2C42A 3A1NA 5LXTB 3UH0A 2ZB7A 2ASJA 3WK5A 5SZHB 3USZA 2C83A 2ERCA 1UAYA 4X8MA 1ISSA 3F67A 4EGJA 5FB3A 5J0RA 2L2QA 2MMCA 5GINE 2GBLA 1XSLA 2FEMA 1HNWB 2NSYA 2WHXA 2HJ9A 5C34B 3HBMA 4OJLA 2WKQA 3D2CA 2PUGA 4CT4B 2ZWMA 3G68A 2GN9A 3JQAA 4QPJC 2Q7DA 3RHZA 5F78A 3H05A 1RXVA 5BR7A 1N48A 1QNLA 4AYTA 3K70B 2Z2XA 4B40A 3ADCA 4L9SA 2GSWA 3L6EA 2I7VA 1JR3E 1LDMA 2C9OA 4EY4A 1WB5A 1EG2A 5FWXA 3KTOA 2X7XA 3BDAA 5DF1A 3OKFA 3OQNA 5HCUA 4BLQA 1C1YA 4BLVA 4Y2HA 2XA2A 3SNHA 4BB9A 5IT0A 1TT5B 1ZI9A 1WY7A 1QSSA 2X9GA 1E20A 4DMFA 3DP9A 3ENWA 3IAS6 1NN0A 2OUIA 2EHJA 4D80A 1N56A 4ZEVA 3VQTA 3BTOA 1C1DA 3DKKA 4YAGA 3ZGNA 3D7KA 1WPQA 4C0AC 5KFZA 2JVKA 3QZUA 3AEKB 4IJMA 3HO8A 2GI4A 1T0JB 2VSXA 3KFUF 3S28A 4DC9A 2AGQA 4K2HA 1EJ6A 4M04A 4JUCA 1QG6A 1KEVA 3N8DA 4KFCA 2X5KO 2FHSA 1XMQB 5DLDA 4F1KA 5ALVA 3P97A 1T8YA 3I05A 1U11A 5J23A 3VOBA 4JOQA 2JZBB 5CVUA 1BPYA 4MARA 1IU9A 3EVFA 3HV0A 3PHHA 3A3OA 3U9LA 1MOZA 3FKSA 2UUOA 3Q6MA 4GYWA 4ANFA 1XNGA 2LBPA 2V55B 2H1HA 4IXDA 2H3HA 4OJ6A 3AF4A 2GLXA 4IQUA 5A1JA 3T5JA 1UBFA 2YW2A 2Y1CA 4FYYA 2KVCA 4EF4A 3WIEA 2H18A 3OT1B 2WQ6A 3RLFA 4QFMA 1VKJA 5BQPA 4NBRA 4RA9B 4M8KA 1Q7GA 1UJ4A 5DM0A 5K1ZA 3HJTA 3MCUA 4YO8A 3JVVA 4DGQA 3W9UA 2DPIA 3N07A 2E2WA 1OI4A 3WBBA 1M76A 1NLMA 5CVJA 1LD3A 2O1WA 3RUEA 4QUKA 3HJGA 4HH3C 2HTEA 5CX1A 2B92A 1EK2A 2ZRIA 1TRHA 3U19A 5DQGA 4I55F 5A02A 5KMGA 1SKUA 5FHQA 2QTZA 3O82A 5CFLA 1LBQA 4KXUA 4BX3A 3KB2A 2P6PA 1M2VA 4NZYA 3E1KA 1EQUA 3EAFA 5EJ5A 1P2BA 3AEZA 4JLOA 4M21A 5DU2A 1QC5B 3RWMB 3LQQA 1GPYA 1E92A 5JZOA 4M0MA 3L7BA 1R37A 3VR6H 1ECGA 4ZVUA 1CQIB 5UKDA 1FRQA 2V4QA 4AJLA 3WZMA 3BWYA 3JWJA 1TK5A 4PLGA 3VSBA 2P35A 2PX5A 3E15A 1CK4A 4Q18A 2JFPA 4GMHA 1DQYA 5KT4A 4M9RA 3UB2A 1KZ6A 4W9NC 3ZQ4A 1K8QA 4ECZA 1ZR2A 4PH5A 4MPRA 1NVDA 3DL4A 1TTQB 1DBQA 2DG2A 9ICQA 3TGLA 1NN3A 2XGOA 4XWAA 4GM1A 3KTAB 3AVQA 3KKOA 2NX2A 2AMFA 2C03A 3NFYA 1QZUA 4KOAA 4O5EA 1U4SA 3QWAA 3UXEA 1TAGA 1S9HA 2HMYB 5KBYA 2I0FA 4DOMA 2DFKB 3GUHA 4QTZA 4YH1A 1G4UR 1KYZA 1M5RA 4OQ4A 3U1VA 2QTGA 3LVBA 1Z00B 5LYJF 1ADFA 3BMOA 4N49A 2NU9B 4KLIA 3PPIA 2R6DA 3QMPA 3M33A 3RC1A 4OHRA 2FLKA 3QENA 1ZBDA 1G3UA 1JDNA 1LH0A 4A0HA 3AM5A 3AUSA 4FI3F 3DQPA 1NIJA 1SG9A 3K4PA 1LV8A 4MROA 2LPMA 3VXKA 1RPNA 2CB9A 4MVJA 2W6JA 2C5EA 2A9OA 2HBZA 4BGVA 5J2TB 1HTBA 1WOMA 3ABOB 1G21A 4KQKA 4RD1A 4R9RA 3F98A 1UBCA 2PXAA 2ILVA 1JHXA 5CGQB 1ZJ6A 2Q0XA 3I04M 1HT1E 4I7EA 1XZHA 4MVWA 4X1YB 1GLGA 3G02A 4BEWA 3QPUA 1W88B 5FTKA 4XCQA 1EE1A 2JHAA 3MILA 3ABRB 4XD7D 2JZOA 3GA5A 1EFAA 4E1BA 3B38A 1L4LA 2I29A 4YRZA 1SXIA 1FIQA 3R76A 3U7IA 2YQ4A 1Y80A 2O7NA 4IO1A 5IINA 2PR2A 1VXRA 5KNDD 4HB0A 1ML3A 1GWNA 1JX6A 3IURA 5KG7A 2ZQ5A 1LFAA 2IUFA 2RFLA 3VH3A 5FUVA 1JTVA 4H7KA 3GY0A 1QLHA 4KLUA 1TYZA 5AI4A 5ALDA 5EQJB 4US1R 3VPFA 3H16A 2VN8A 1XLUA 3TEFA 1LB2B 1U7XA 2OPHA 1UKYA 4Y7DA 1UP7A 2GGSA 3DDUA 1HFEL 1TMYA 3OURA 4PO3X 4A6XA 4RD3A 5J0XA 4NU6A 2OB1A 4R98A 4R1UA 5EJEA 2BEWA 5LIPA 2PZAA 5JPIA 2O5VA 3UOWA 1LI5A 2RHGB 1QFJA 4JB0A 2GFIA 1U5BA 3JS5A 1NK4A 1QYRA 3ZWQA 1IJBA 4YMUA 4BE9A 2R4QA 4DKJA 3MGIA 1SQ0A 1KBZA 3ZVMA 4HV4A 4ZRMA 1DC3A 4I3GA 5LWQA 1RLIA 5EUMA 1NKSA 2FPPB 5JYBA 3E3OA 5F2OA 2B2XA 4ED1A 5FOQA 2IXBA 3RJEA 5EP4A 4G26A 2PSFA 4LSZA 3AEVA 2PEZA 3AYXB 1HA3A 5IBCA 4C21A 2Q99A 4REQB 4NZPA 1WHTB 4GM4A 2N46A 4M1SA 3IPXA 2KHVA 2ISPA 1KO4A 1WA5A 3LGXA 3B70A 1X77A 1YRHA 2K4PA 2VUUA 2ACVA 1MUUA 3VOAA 4LGYA 2VEDA 1INLA 4Z4CA 3U1TA 2GM4A 3O8CA 1XKXA 4DGSA 2BJVA 4HWGA 2AMYA 5CB0A 4ND1A 2ID8A 5KG0A 4GXTA 2WI8A 3DM5A 3IP8A 2WLSA 4BL5A 2KTQA 2FG5A 3NUGA 2Y2UA 1JB1A 3FHJA 4D8XA 1RM4A 4LGCA 3QW2A 2XRYA 1JVNA 4KXXA 1POXA 1XXHE 4ARUA 4C0LA 4V2IA 5CG2A 5A4IS 1XPUA 4IZ6A 2C04A 1L4KA 3MWEB 5HPYB 2JZCA 4UMFA 2MR6A 4IICA 3NEJA 5EA2A 4MQ6A 2XVTA 4J7AA 4G37A 7REQB 4PNEA 2EARA 3SYZA 1BRTA 3BUSA 1CY1A 5JANA 1HDZA 2K60A 2WT9A 5DX8A 1D1SA 4ETWA 3T41A 3K8OE 2LGJA 3KE8A 2KE7A 1VC2A 1Z0FA 1DLIA 4EO9A 2B4KA 5K0TA 2V7BA 1A2BA 1BJRE 3ANMA 2B5OA 2FYTA 4G25A 1JDBC 4NEGA 3IP7A 3C8ZA 4M2LA 1ZGHA 1CF4A 4AJ1A 3I2GA 5HHIA 3WDKA 3IRVA 1E1RA 2VLIA 3I92A 2I6XA 4RY9A 3TTXA 1V1RB 4GWKA 3F3YA 1XF9A 1PP4A 2X8JB 2J31A 1BE0A 3CKMA 3GBPA 1K2WA 3ZYZA 4DR2B 5AW8A 5AUOB 1ZMOA 4Y9RA 3ITDA 2NT4A 4UHHA 5E3JA 2Q4TA 1BPDA 3JQGB 2OZEA 2XUJA 3MCVA 4K6GA 2VRBA 4TZ0A 1PZHA 1THTA 4K28A 3SKVA 1P1IA 1Y8RA 1VDMA 3HKZC 2WAQF 4YXMA 3OU6A 1ABFA 3JD1A 1HE1C 4F9GA 4EECA 4F86A 4L85A 4B43A 4CMJA 5JEEA 3RH0A 3SKYA 5LJLA 1J2MA 4FYPA 5E79U 4Z99A 3PHCA 4B2LA 4O2AF 1SHKA 1O77A 1N2CE 4H60A 3N28A 3QY0A 2BEJA 2I2WA 2OTCA 2GYUA 2WJZB 3F6SA 3GP3A 4DFPA 1GYQA 4W5OA 5AKYA 3EYZA 3RYTC 1JJAA 4HGNA 1AHIA 1EHCA 3DE3X 3W2EA 3VNRA 4P3PA 5DM60 4GLOA 3D0QA 3TMKA 1DTSA 1F8XA 4TUPA 1RZRA 2ISSD 2NGRA 3MXTA 3K9GA 1CNFA 4AFNA 1GOTA 3H11B 5HGJA 2AQ4A 4PL1A 4TTAA 4CL2A 5CTAA 4DZZA 3JTMA 1Z17A 2IYYA 1I6KA 3PUJA 1COZA 1ZBQA 3PW5A 5JYEA 5IJ9B 1U80A 1Q19A 1TLFA 1NYTA 5HW0A 2R62A 5HZMA 3M89A 1OX4A 4GP9A 3AWDA 1YC2A 1C9YA 3CB4A 2GPYA 1E9DA 2WU8A 4MWCA 1K7YA 4FLEA 1UBJS 3DCIA 3ONFA 1TVAA 1ESDA 5D87A 5DLEA 4UHJA 3LWMA 4DSJA 4XJTA 2HT6A 4IRDA 1JXQA 4EQZA 1OGIA 3NRWA 1X9SA 3RUIA 3H9UA 2AN1A 2HMTA 3UAWA 3EXHB 4U8HA 3NC4A 3HU1A 2P4SA 3LUPA 4WA7A 4D0LB 1GRRA 4JXKA 3KJIA 1JE1A 2WTUA 3HUTA 2XWQA 3C3DA 3OEYA 2WAXA 4OAOA 3FYCA 1KR2A 8LDHA 3KR1A 1M6VB 4MINA 1A5SB 4B6RA 3U3OA 1XEWY 2QD4A 2ZIWA 3RB0A 4F3TA 1Y1PA 5HTKA 2CUNA 3DFFA 3V8MA 2AJCA 5B1DA 4LYDA 3KRTA 1OI2A 1OKKD 1JIHA 2IL1A 3QZ7A 1M9NA 1F3OA 3DHWC 4QZ8A 4I2IA 1WVGA 3GDGA 1SBZA 2EAOA 1HYGA 3W6OA 1NTRA 4X93A 5ECGC 3VYWA 4JJZA 2EG9A 4R0MA 2BN4A 3KLPX 3N75A 4YK7A 4UW9A 1H0SA 4US9A 4PIPA 3IQWA 2ZAMA 3FOFC 4UOEA 1B74A 2IA6A 4AJJA 5LXTF 1GL3A 1DUVG 3TTWA 2VPYA 1JG7A 1KO5A 3EVEA 4ED8A 1DQNA 1E63A 2RC5A 4CTMA 1UBMS 3DKPA 3WICA 1JX4A 4ZDIA 2BEUA 1NR5A 4RVNA 4MMYB 4ODIA 3PBKA 1VE9A 3V33A 1HFWA 3KEQA 3MJCA 2X0KA 2IOFA 1WW3A 4GPEA 2QKYA 3FOBA 4YT8A 2M6SA 1ZH2A 2DGZA 2GCIA 3TLJA 2GN0A 1HZZC 4J1SA 5KYGA 3ZHUA 1T2VA 1UBKS 4DB4A 4OHFA 4ZOAA 3ZV5A 2F48A 3WJ2A 4NG5A 4UAJA 4ONEA 3EQZA 4R2XA 4CKWA 2V4UA 4RZRA 5KTQA 1ZGAA 2HTFA 3NWPA 1EFCA 1CIVA 4HDRA 4TS3A 2WJJA 4ZI7A 4UBKA 3I0ZA 4PO8A 1H65A 4NESA 1IBKB 1PX0A 2LTAA 4CGZA 3KD2A 2NXNA 2OG2A 3IXQA 2G63A 2JGJA 4MPPA 1H2HA 5DJ5A 2JIDA 5JIBA 2VTBA 3JR7A 1JKFA 3FNIA 3JZDA 1X2EA 5LWHA 2REOA 4D5EA 3DL7A 3VV2A 1GV0A 1QRDA 4Y6LA 4D45A 4PLFA 1DAEA 1I36A 3IUBA 4PZCA 1SU6A 3MSXA 3F7TA 3HDYA 1MA0A 4QA9A 2WVJA 4CR6A 4F4IA 4KDFA 1E2DA 3WB2A 2CMHA 2DPGA 5IHPA 3FUVA 5KYYA 1FQOA 1X7ZB 1SVSA 1L4EA 2FQYA 3RF6A 3P4XA 4RNCA 4PIVA 4R66A 5J4LA 4B2IA 4EI8A 5IAGA 4BVJA 4DR7B 4Z7QB 1L5SA 4D02A 9LDBA 4DJ5X 3AUFA 2P9CA 3GGJA 1IXZA 3TXXA 3HJNA 1X40A 3Q7RA 1K1QA 1K6JA 1Y0BA 3ZIDA 5EWLA 6GPBA 5B57C 4RW0A 1GNPA 2ZJYA 5M3BA 3M5CA 1RKBA 4FZJA 3N97B 3AYZB 3I76A 2E9SA 1QRSA 2EFEB 4OXIA 2FSVA 3N8GA 2Q0QA 3EGXA 1TTHA 4P54A 1XWFA 4Q5IA 4QXAA 3JQBC 2MSEB 3EFEA 2VSFA 2JZNA 4NRDA 2ZRFA 3AEQA 1T3NA 2KKPA 3D7RA 4E33A 2PWZA 4IVNA 3TIFA 3OCCA 4UKDA 1NXSA 3RG8A 5TT0A 4HZUA 3G23A 1E59A 2DY1A 4RANA 4FOOA 5I9LA 3NI2A 1YVRA 3TAHA 3WIOA 1DPGA 1X15A 2AFVA 2FZKA 1YB5A 2WZDA 4FIZA 2JBWA 2VHYA 1TAMA 3UJ8A 1H66A 4Q39A 3W78A 5T7BA 1CR4A 2Z3ZA 4H1TA 5L3RA 3BXGA 4IILA 2EOAA 4JSRA 2XTAA 1AV7A 4P92A 1KMHA 3W3AA 3F9IA 2ZT8A 3LVQE 1O58A 1B23P 3QYJA 3PUVA 3A32A 1IHDA 4OYYA 3IKTA 3PGA1 1EUZA 4MQFB 4RY8A 4WDQA 3NUZA 4ICAA 3TW6A 4KMRA 3D6HA 1BCSB 3VR5A 4AS1A 2AUNA 3SSNA 5GVSA 4EHJA 2C2GA 2NVOA 4DIMA 4LXGA 4IEFB 2XMRA 1WXQA 3NC0C 1X9XA 2RGDA 2FE9A 2XDYA 5KT3A 1YFZA 1BH2A 3NEPX 1UDBA 5IDQA 2VHZA 5B6IA 5K0ZA 4MGZR 1TJ5A 4RTNA 1LX7A 4KCGA 2YHUA 3I6MA 3DQZA 1LBSA 4WXMA 3FTEA 2EX1A 3DB1A 5G1NA 4AY5A 1O95A 2XCIA 5CW1A 5E9WA 4O2BB 3S8EA 1P6QA 2WUGA 4ZYVA 3LY8A 1UZLA 3NV9A 3JPTA 5IKMA 4TSRA 5J2TF 2IH2A 2PK3A 1EJBA 3LBAA 4ARBA 1XE3A 1ESMA 5AVRA 5LYJA 3ZY5A 5T64A 2AXNA 3CRQA 3V6MA 3S2UA 1M1YE 3GJ5A 4I36A 3RVLA 4UUOA 3AVPA 1N9GB 2CFTA 3PX6A 4ZT4A 4PX3A 2F00A 3W05A 4C4ZA 3QTBA 2FSUA 5HQ3B 1BJKA 3B36A 2GARA 4K1XA 2YW9A 4J07A 2O50A 2QVLA 4JP2A 4WN9B 1S0OA 2ECKA 1DJPA 2WFZA 5CLLA 3ZK8A 3VYUB 1T15A 3ED1A 1BAPA 5AR1A 2P9FA 1NK8A 3F74A 3K1JA 2E4UA 5CVCA 3EIOA 2G83A 4J9RA 4PFSA 1CY4A 3T5KA 1RMYA 1RRFA 4H4DA 2B35A 2ETVA 1WXIA 1ZA2A 1MRZA 4RQ0A 3S99A 1H5QA 4C88A 2WSSD 4ETNA 4I1SA 1CJUC 4LJXA 3R7NA 1Q0RA 3UQ2A 3MB5A 8ICBA 4FNGA 4N9WA 5K9ZA 2B0CA 4B34A 5CCBA 4LWQA 4M8LA 4Y6RA 4EGFA 1SIWA 5CH3A 1J2JA 3JATA 3EUWA 2OYRA 1I13A 1XQ1A 2HCFA 2NU7B 4YR9A 2PNFA 4DVGA 4WSOA 1UPCA 5A7GA 3GHYA 3LWLA 2XUZA 3BJZA 3HN7A 5C0OE 3BT7A 3DVAA 1XPRA 3FGNA 2QXYA 3SLRA 1NWCA 1HDXA 3SZUA 3TF5A 3QKRB 1HLDA 5DXFA 1CYDA 1TUBB 3A05A 3VJKA 5DBBA 4ROTA 1FB5A 2XKKA 3ZEAA 1OXXK 2JAWA 2ZRDA 2OYSA 1G8AA 4IDOA 1EFKA 4P2GA 4R2WA 4BX9A 2HQBA 4HYTA 1RKXA 2GNAA 5B7QA 3KT0A 4NL4H 2O1XA 4H0NA 1V48A 1L7BA 3WAKA 1K2VN 1QNFA 4UNPA 2VYVD 1Y4UA 4XPIA 2H5XA 1P2SA 1FF9A 4DMKA 1VZ3A 2VHTA 3TRIA 1I4DD 2YMPA 1Z34A 1BHQ1 3EMDA 4I5GA 2CEKA 1TO6A 4KMUA 4MSUA 1NK7A 4R54A 2CMKA 1QK3A 1RJGA 1Y3DE 2DE0X 3IMKA 1DEXA 1RJFA 4Q4HB 1F2UA 3HEMA 1PFVA 2DSNA 1ZN7A 1TD1A 2YVLA 3L1IA 1RBMA 4AYXA 4FHZA 4OXNA 2PT7A 5AHXA 7ICPA 1AA9A 4GOXA 3RV4A 3FLEA 3ODGA 3UENA 3IALA 4J03A 2WB1C 3JRWA 4OTZA 2IEGA 2LKCA 4ZYXA 3ISJA 3NORA 1J00A 3M2TA 2QD1A 4DS4A 3VAAA 3BL6A 4KLSA 3FSGD 2VJ5A 1E7QA 1NL3A 5B3JC 1QZ3A 2A86A 1VKNA 4D92A 4WESA 1U2GC 4DLBA 3IIJA 1ZD8A 1P72A 2NU8B 4Z1OA 4L16A 4HAUA 4P4SB 1XS9D 2IYWA 3CC8A 1EMDA 3GRPA 2QQGA 2VP3A 3OH8A 4C4SA 1YRQA 3I83A 5KFQA 4M0FA 3RYHB 4EUKA 1SUWA 1PL7A 1Y3BE 3TZCA 1RYMA 1THZA 3ER6A 4HQ6A 1QVAA 2ZVJA 4GM0A 3W6ZA 1JHAA 2IHZA 3RJ5A 1ZQ9A 3Q2OA 1OLSB 3EMKA 4WMLA 3N2LA 2WQ7A 1Q57A 2G88A 1E3WB 2YINC 3AFOA 1MGOA 1S2IA 4YWJA 2C7BA 3AEUA 1Z4QA 1UBHS 1ULAA 4ED7A 1PWEA 1NI3A 5K8JB 4L8WB 1GNSA 1H23A 4Q1DA 1K06A 2XEXA 5KT2A 1FQJA 5G3YA 3P52A 2IITA 2PCJA 2GM3A 3WMXA 5I7AA 5BNIA 5COQA 2NSDA 1ZUNB 4EW3A 4UVEA 1S76D 2HHJA 1L4NA 4F4JA 4E4RA 4CU2A 1G98A 1MO4A 4RTOA 5TISU 2YVQA 5JXWA 4Q7JB 1ZETA 4NBKA 2G82A 1A9YA 1TQ4A 2ZI4A 3H4TA 3IV7A 1PR4A 2YNMC 4KPFC 2YIJA 2WTEA 1B0UA 2J0EA 2J4DA 1A95A 2XGPA 2PA0A 3LL7A 4N6GA 3DMTA 3EXIB 3CX4A 2JCYA 2I6FA 5HP4A 3U37A 1IM4A 3LCRA 5I3CA 1LNZA 2X7HA 4S2EA 4MUGA 4D9HA 3SJCA 1KXJA 2JMGA 4KIUA 4HYQA 4N18A 4NBWA 4C4AA 2Y0DA 1T10A 1UADA 1CUKA 4AQ7A 2PAAA 2GK6A 4F5QA 4UNIA 3U3RA 5LIRA 1QFYA 2WV7A 2Y1JA 3B7PA 1XZGA 3TUZC 3STTA 4YUZA 2HHXA 1R0LA 2VDKB 3OJUA 5B58T 1JG1A 4H3SA 5AVJA 1PO7A 4P38A 3WLQA 3OZIA 3IB3A 1N9KA 3K9QO 5AK0A 4ENQA 2HY7A 4RTMA 3PTAA 3PVSA 1X7HA 1Y6FA 3ESQA 4B3MB 2ZR0A 4U7PB 3C3KA 1DK2A 1IPFA 1E3IA 3I0NA 4C6SA 1P73A 2DERA 1PD0A 5BNWA 1AIPA 1GZSA 3V4LA 3T3FA 1Q15A 1N1GA 2J0VA 4BVBA 4M1TA 1O9BA 4DLRA 4EDFA 3DEHA 4B87A 3SFZA 2JL1A 1P0FA 4CTJA 3PZBA 1TGVA 2J5KA 2FN4A 4UTRA 4UNSA 4QWBA 1IOLA 3WL4A 4WK2B 1P2GA 2BY4A 4ER3A 4IUYA 4DILA 2P41A 3ZHZA 2DBQA 2VCEA 3S6JA 4CQMA 4GDFA 3A04A 1N1EA 4WOPA 4F7WA 1RYYA 1KVUA 3OG9A 4I1VA 1VE6A 3OE1A 2HNAA 1JEEA 1W8IA 3DBVO 2QD3A 3AX6A 3I9V6 5D7NA 2ODGA 5EVCA 2AOXA 2F8TA 5AVVA 4DUGD 4GG1A 4WDRA 5HX7A 3DV0A 5J8YC 4Q9NA 1AO0A 3IEXA 4EVSA 1WKVA 4TL6A 1HEYA 3BMXA 4P3XA 3OIDA 1ILEA 5KSPA 2QQEA 5ECWA 2OXIA 4Y2QA 4CQNA 2MOKA 3CW8X 1CR6A 3TOXA 4NFSA 2QTBA 1DC5A 4QYXA 5DZSA 4H6XA 3L4PA 1KNXA 3B2EA 4DIOA 1BVUA 4MIKA 3FMIA 3RSLA 5KPDA 1NBIA 4MDFA 3MR3A 1U8AA 4CMIB 2VF7A 2WAOA 1RP1A 1TZMA 3Q3EA 2MAXA 4ECWA 3DCJA 2B1JA 2QZZA 4BMZA 1L5UA 3HJBA 3NS1A 1GSOA 1WUDA 2VWPA 5AKHA 4EKEA 3FFAA 5A4MS 4IQGA 5SY6A 3NVMB 5L3QA 5LXTA 2XNKA 4AT1A 2PZKA 3MZ0A 5JAZA 3L0CA 3FYUC 4P4PA 1U8UA 4O4LF 2OXFA 1CHNA 4MW0A 1E9SA 3LSYA 2DY0A 1ORDA 1XBTA 1QG2A 4NBUA 1A1VA 4AZ0B 4G4SP 4RQ7A 2WA2A 1ZOOA 3WHKA 3LUBA 2BCGY 3A1WA 2L69A 2CL6X 2NZ8A 1GO2A 4MVJE 3MRSA 4ZXPA 4RX1A 2O2YA 1G21E 1AN0A 4UAGA 4EL5A 4RULA 1GXSA 1YT5A 2IPLA 2ZPAA 2O06A 4JITA 5I8PA 4DPMA 1IIPA 2ZYSA 2XCTB 5CDTA 4X3OA 4Q43A 5GOZA 1V7CA 2QX7A 3OLCX 1PNQA 5FWDA 1DIRA 1TF2A 1O54A 3I4CA 1H22A 5K6AC 4I9HA 1YKFA 3PK0A 1YZLA 4J3JA 5AW2A 1E5QA 1P1FA 4J9NA 3T7AA 2JEYA 1D7OA 4QZDA 3D59A 2ZE7A 2FN7A 3ND6A 1IJFA 5FEMA 3T3PB 3UCEA 3O0DA 5JD4A 4IS2A 1L7DA 3BRCA 2JEOA 1U4BA 2POQX 2D54A 2NQTA 3GAFA 5CEFA 1OAOC 2VHVA 2CL0X 4QGFA 1CT9A 3GJ4A 4KXYA 3ESDA 2IXGA 1T2NA 2PD4A 3ORHA 5H59A 4TT3D 4AF6A 2ZKIA 3LPLA 2XGSA 3G5TA 1ZQLA 2XCQA 4HRYA 5FPKA 3K0SA 3EMBA 2WF9A 4QWCA 5FOWA 4HX2A 4U7HA 4D4IA 2XE8A 1J5EB 2DEUA 5DFAA 3EVZA 4XYMA 4ZTBA 3JXEA 1WXDA 2Y9UA 4WBNB 3DOOA 5BSWA 2CMDA 4GC9A 2JZBA 2ZRHA 2CN1A 4RFSB 1VG8A 2QTNA 1I33A 5DHQA 4MS1A 2FJUA 3L0SA 3BGDA 1HYQA 5FUWA 2DVMA 3EGEA 4PZZA 1RJ9B 1TEVA 3MMNA 2JLUA 1NKBA 2WWIA 3LQYA 4MVJI 1Z4OA 5JFGA 1Z15A 4FNOA 2GRAA 1UHUA 2HEIA 1TW2A 1OFHA 5CXXA 1IWPB 5IK2A 3B1ZA 5IN5A 4RK7A 2FEOA 3NBFA 5DM1A 3WGQA 1XU9A 1J56A 1BDMA 2UXBB 1KHHA 4YJHB 2IZ1A 2GSDA 2FPGB 2XV1A 5B55A 2W03A 3NJ8A 4HMOA 5JC1A 3IP4B 3BAFA 4LZDA 2QTAA 3M6MD 3IEUA 4D56A 2XWBF 4BE7B 4M98A 4BC1A 3ZQUA 4WXYB 1DXHA 3JD0A 3UOAB 3DLHA 1W9MA 1Z6YA 3GV0A 5EJMA 4W8OA 2OORC 4O5CA 4LWPA 4LF9B 4HDSA 4LSWA 1I5EA 5HK9A 1YI1A 1WJGA 4JBXA 2XH8A 3C3MA 3B5JA 1ZIPA 5BUQA 1KR5A 5I7RA 1HTTA 1BD3A 2P75A 3EOBI 3WA7A 2OG1A 3E9EA 3ZG6A 1I4WA 2IDKA 5IUKC 4JOBA 3ECSA 1AA6A 5KG1A 5CBPA 2G5IB 4MUXA 1T1RA 5DLFA 1IXRC 2WKRA 2B4QA 1QAQA 1WXWA 4PGQA 1URPA 3PQ5A 2H0QA 1NVVQ 3EE6A 4WNAA 1GTJ1 4RPHA 1HOXA 3CX3A 1X66A 2YXPX 3NR2A 2ZWPA 4F6CA 1E2KA 4O2BF 4FD3A 4GL4A 2OCLA 2O5EA 1GLVA 2GO1A 1Q8KA 2F8SA 5JSZB 4CN9A 1A0PA 2PX2A 1N0WA 3GVXA 1Q5PA 3EGCA 3WBFA 3NO4A 1P62B 1PFKA 4E07A 1WO8A 1MX3A 3BFJA 5M2QA 1Z00A 4B47A 4KDCA 2X1LA 1V35A 1LRLA 8ICNA 5E1OA 3OX4A 1J8MF 2JB9A 2BRUA 3ZHTA 5U4QA 1H85A 1E3QA 5KTTA 2AFIB 4E21A 2XT9A 1ISRA 4TZTA 4ZOLB 2A5LA 1RMQA 4ZT2A 2C2MA 4XIIA 1Y6ZA 5J2TA 1V5GA 5DGBA 3DMDA 5T8KC 1ODCA 1VP3A 4IF6A 3B82A 4J0FA 4OL9A 4QUHA 4F4XA 2ZSKA 1RXSA 3AL2A 2JARA 3C4JA 3DGFC 3KKZA 3WRXC 3DOUA 3RHFA 1E1DA 3RT7A 4XQ8A 4ZAYA 5HZHA 4X1YA 1QF9A 1XNQB 6ADHA 5F12A 3K15A 1T2DA 4RKYA 3P71T 3AXSA 1LLFA 3I3OA 3N3AC 2ID9A 3WGTA 4UBIA 1ETUA 1MB9A 3I1JA 1ESEA 1Q1ZA 5KNBD 4G9BA 1QLNA 5JZ9A 1X0XA 3EHEA 5FBLB 4D79A 4CUKA 4NOLA 1ORIA 2ZTEA 2IYOA 3HFRA 1WXXA 1U47A 4RTLA 5ARCA 2DFTA 4EA9A 5DLYA 3G2PA 2O3TA 2HZ7A 3BKXA 4DCJA 3MLAA 1NASA 3VJRA 4G0MA 2H1VA 2OUKA 1L5MA 2CBZA 3KT6A 5KFVA 4E3ZA 3QM1A 4XJXA 3IV9A 3THYB 4OEHA 2CNKA 2A92A 3PDIB 2AGPA 3DZHA 1DO8A 4QLAA 2WJ4A 3UANA 4D0RA 4RXTA 3FIJA 2XX3A 2Q3LA 2D8CA 5BOVA 1Y5LA 5AT1A 3BXFA 1GZVA 2FW7A 1Z8DA 1I3MA 1APBA 2QUKA 3OP1A 3A11A 1T9BA 2EKQA 5B7PA 1PYDA 4E12A 3W8EA 1VSQA 1M0SA 2VSYA 4DJJA 1P17A 1GAEO 4DRYA 2H3VA 4YMHA 2QAGC 4NLCA 2H5JA 3IKMB 3U13A 3N8NA 2D0PB 4HXEB 2HW8A 1ID8A 3LLSA 3SFVA 5EWJB 4DNPA 4DA9A 1D8AA 1NQTA 2OWEA 3K53A 2OZVA 3QUSA 3T7TA 1XZ8A 3VISA 1O8BA 2ECPA 2CT8A 3DBRB 4M76B 2RMKA 1CG6A 3F4KA 1L0BA 3AHCA 2BI7A 4CLEA 5KFCA 4Y6OA 1ZQCA 3NHPA 1ZSNA 2ZB4A 5I9SA 4BLRA 1OROA 5DYGA 2R6FA 5DT9A 3ISBA 1ATZA 2FQQA 9ICNA 2H4JA 4DV7B 2WP8J 3L5OA 1C9KA 1XEXB 1D1QA 4Y9DA 1DVRA 4MA4A 2Z6AA 3K0CC 4DUPA 1SMKA 3IO3A 1SZDA 4X92A 1JVBA 1AKNA 3TOCA 4RLSA 1XYVA 3LTEA 1U3WA 4KWTA 2YRFA 3QFFA 4RKEA 1QAOA 3NDBB 1KDYA 1DC7A 4MWSA 3ILVA 4I2CA 2PMFA 2UVQA 3M9XA 1XDSA 5JWHA 1BVHA 1QS0B 3IAFA 4P35A 2YWJA 1ZAYA 4K05A 2ECOA 1KU6A 3IRUA 3H8VA 4YHHB 3R0IA 2HF9A 4KLDA 1PJ4A 2PUJA 1ZSVA 1TKCA 1KOLA 3BILA 4J7CA 3KJZA 4M1QA 3FETA 1ZEJA 1JP7A 4UFNA 4IW3B 3ZZMA 4DN6A 1RE0A 3R3SA 5CT9A 3URMA 4A1FA 3OZVA 2EH9A 2FMIA 2IEBA 5A4JA 2JFXA 5FQNA 2HRQA 2YRWA 2R8IA 1NONA 1R4NB 3MTQA 2LPEA 1AZTA 1GPJA 1T1IA 3BD7A 4RMNA 4PLZA 1W36D 1UPUA 4AVYA 4NMWA 1Y6GA 3AUUA 4A7PA 4Z9BA 1XKTA 4CFSA 2LI6A 3L9XA 1HNXB 1TQDA 3ZQKA 6Q21A 3BOSA 2RGUA 4YMGA 5HKKA 2IHMA 4IUCS 3JVUA 1EUDA 3UXMA 1NY6A 5IXSA 5P8WA 3UA4A 1XL1A 2UVWA 1SM4A 2C2EA 3UNXA 5DH9A 3CNQS 1OPRA 4FFVA 3JX9A 3PI6A 1C3OB 4L5AA 2R8KA 4YUVA 5B66U 2NRVA 4I29A 2R65A 4RMIA 3H7IA 4RSHA 1E9EA 4MYHA 2ZXUA 4AW9A 2RGXA 1CE8B 1WUIS 4HH1A 5F9NA 4CMHA 4YP7A 4BZZA 5E1BA 2RI1A 3WGKA 1KTVA 2Y0CA 3PDWA 4ZGBA 1CP3A 2YB4A 4I19A 1HL7A 1OA0A 2OY0A 5HE9A 2NSJA 3NHYA 3L93A 5CFOA 1IDOA 1H3FA 4ZEXA 3COVA 2FA9A 1HT2E 3HO6A 2YDXA 5J40A 4C05A 1YJBA 5I9IA 3ER8A 1T3QA 1W0KA 5EKTA 2AMJA 4CM9A 2B1IA 3CHYA 4FHGA 3UXYA 2IEZA 3UHAA 3IT1A 5TC4A 1NRJB 2ET6A 4QYSA 4E0DA 4TV8B 1YB6A 1FYFA 4EG8A 1UC4B 5EHXA 3IBTA 3ZZUA 3L6BA 2ZK7A 3BTVA 3AIIA 3G2IA 1OI7A 2DPXA 4EYEA 5MFZA 2JLAA 4DDWA 1PDOA 5DMHA 4PLYA 4E0BA 1NPYA 5E0OA 2H2FA 1K7SN 2YCBA 5EL0A 3IJ5A 1D09A 1I51A 2YY7A 1MT3A 5BWNA 1M1XB 2J3EA 4PZUA 4EYGA 4KWHA 1L4BA 1FVXA 5J2KA 7ABPA 3AMVA 1AUOA 3C1OA 5KDOA 3V46A 4GXNA 1FZTA 1Z4LA 4RPXA 5IDXA 2KVSA 1EKXA 3BMCB 1YZFA 2VI5A 2HDNB 3WJAA 4EW1A 2P3OA 4E31A 2HNBA 2C2YA 1ZU4A 3MS7A 3JWGA 5ALGA 4IRMA 3C87A 4Q0MA 1QGOA 1EX9A 4HDNB 2GN2A 4MCHA 1N3LA 2A1TS 4M6WB 4ZH4A 2W2LA 4MRMA 2PH1A 4EI9A 4R9UC 3ONDA 3AF1A 1ULSA 4PSUA 4Y2GA 9ABPA 3GRRA 1QF6A 3ZNPA 4XDZA 4FYHA 1WUYA 3V8RA 4D3DA 1ZYQA 1DIGA 1W2GA 4QZ9A 1DFHA 3R7WB 4EF6A 1L8AA 4MCIA 1ZM7A 1YFKA 4LI0A 1NYQA 4U02A 2X0JA 3GJXC 1M7BA 5EWEA 1PS8A 3OM0A 1QHSA 5TT1A 1LGYA 4Y2SA 3M1IA 4U2BA 2RHHA 4K9NA 3H3JA 1B7GO 4K9LA 3L1VA 3JTEA 4G2TA 1O6BA 2ZRQA 5M7EA 3P0EA 1RM6C 1KYXA 4YRGA 2GASA 3CLSD 3ND7A 2DHDA 3DDHA 1OV6A 1QU3A 4J0HA 1ZVKA 2UYQA 3T1TA 2QTTA 1NIPA 3CUUA 4KTQA 4C2BA 3N0RA 1EVZA 1VCMA 4LVOA 1AQUA 4HN9A 2E55A 3UIEA 4O4LA 3WQSB 3CZRA 2Y77A 4YMNA 3KETA 4HFMA 1Q7RA 1UODA 4UE2A 4CTKA 3U81A 2JAUA 5EJ9A 1VB3A 4B3BA 4OI0A 3M3HA 3ILYA 3LFUA 1EZ1A 1FFBA 2GD2A 4LRYA 1JQ3A 3UH1A 3ESBA 5L45A 4FFBB 2YWEA 1IXSB 4P4UA 2V6GA 4EYOA 1D3AA 1E99A 3RSGA 4RZ2A 4IS7A 2EQYA 2ATCA 3DBOB 1A71A 2HK7A 2PL9A 3L6DA 5KTKA 1XLTA 2J3KA 5KFIA 3TAQA 2D3TA 3DZIA 2XTMA 3AVTA 4TQAA 1Q83A 3Q5DA 1BRMA 5CFNA 2VC2B 4X1IA 3WQHA 1TK3A 2BHNA 4P5DA 3OLZA 5EP2A 5CRXA 3IMFA 1LRJA 4CKBB 3S44A 4JQSA 3DO8A 3S2IA 5CH5A 3ZEIA 2HL6A 4UDOA 3PHBE 2IUYA 2LCQA 1BE8A 3EZLA 3C4VA 3QJ5A 4RORA 1VL2A 2OGWA 3TNDA 1BYIA 5EC8A 3A6GA 3IG5A 2IV2X 2KNJA 1ZQHA 2QB5A 3KC2A 2KS6A 4WBNF 3K4HA 3U3XA 2HVIA 3PD1A 1EB8A 1XMVA 3E4DA 3C3BA 3B1YA 4JI6B 4M36A 4LZAA 3H2SA 1NU8A 5CYOA 2QW8A 3VPBA 3AEXA 8ICSA 3LYHA 4C4PA 3HCEA 5AM2A 1NX6A 2C95A 4N3CA 2XUAA 1NNI1 4A0FA 5KFAA 4PR0A 5JR3A 1PR2A 3K8ZA 4CLOA 1TQHA 3BICA 3TZHA 4D9EA 2CFCA 4DLAA 3I3SR 1HYHA 4B4DA 3RT9A 1H4QA 4BO9A 4W7HA 4XWKA 3CB2A 5KVVA 2WJGA 4NI5A 5A1TA 3QVUA 4OQMA 1AMNA 3ZBTA 1LBHA 4LRSB 3ZK7A 8ICRA 3FZYA 1V41E 1HEUA 1U7PA 3VPSA 5AK4A 1G2OA 2PV7A 4ND8B 5GV8A 1NJ1A 5KSWB 4LXXA 1B93A 2AX3A 1COWD 1TZCA 1XCBA 3TCNA 4FDVA 3K0HA 1U94A 4IOLA 4Z4IA 1KETA 3NTVA 4URYR 3FE2A 5AICA 4C2AA 2J0UB 4PHFA 5MN6A 2CK3A 4IIHA 4E51A 4EPTA 2I65A 1CDOA 3COZA 3ZCPA 5KU7A 2GEKA 4RAQA 2JK1A 1VIVA 3OGUA 2H85A 2ODWA 3RSZA 3UAGA 4OJNA 3KKKA 1SCNE 3QH4A 5EMHA 3Q8SB 1H5UA 3O31A 2QM7A 3H0EA 1QDUA 4I5DA 1U1CA 1SU8A 2UZAA 2IXDA 1P5FA 1A04A 1TZBA 2ZBGA 4Q4CA 1J0BA 2W8BB 4BGEA 2XAAA 4L3VA 4AN0A 4PHHA 1Z19A 3UBMA 3L79A 2WFLA 1EP1B 3LDFA 1OVMA 5AK5A 1CJTC 1KW4A 1Y4AE 3LQ4A 3NVWA 4MQFA 3E22B 1F8UA 1PG5A 4GMFA 5HMLA 3KXDA 1BCSA 4H9GA 4A1OA 2HK8A 1PZNA 1UT5A 4W1QA 4Z5XA 1W6RA 3X1XA 2MU1A 2PXIA 3RSOA 3ABZA 5BVHB 3W3ZB 4LVSA 1FRNA 2V0CA 4TKMA 3EEOA 5CGZA 5FL3A 3GLVA 5B2FA 4DSKA 3L8DA 3ZWBA 1MB3A 3ZGVA 2XWJI 1WSBA 3KQMA 3RSQA 1JU4A 2H08A 3FPGA 3G9TA 1BMTA 1DMRA 1Z7YA 2RP5A 5BY2A 2HSZA 5F1KA 5MN4A 4HLCA 1ZK1A 4PTZA 1JZTA 3G1TA 5DNWA 1QDLB 4GSYA 4ZOLF 1V3QE 2VJQA 7ICIA 4L9AA 1BVYF 4OB8A 5HF9A 4DBZA 2Z58A 1W36C 4PCAA 3AL0C 2QX9A 3FCCA 4NLZA 3HL4A 1BNPA 1Z2OX 1FFGA 2I9GA 1N9GA 3Q5EA 1M6HA 5CVVA 4H17A 3L07A 4PO1A 1UKEA 2XD9A 4AG5A 4EDHA 2ECFA 2JDIA 2Q6LA 1RWOA 1S5LU 3ZE0B 1E79A 3F7MA 4OUKX 2YFYA 2VQEB 4AJHA 2YWBA 3G2HA 2IPAB 2IGBA 3UK7A 2YIDA 5DGXA 2EEPA 4RELA 3PYLA 1ZJYA 3IKJA 1Y7IA 5B5EU 3ENNA 2PKCA 2GJAA 3SYLA 5LP6B 2UUBB 2VR1A 2D0OB 3KXPA 1FFUA 1Z7BA 2GD6A 1B8OA 1Q3UA 2R00A 4GZ6A 4QIWF 5HM8A 2F3UA 3FHTA 5CA0B 4RIFA 2CXRA 2ETXA 5EHNA 3TLEA 2NN3C 3KPJA 3DLPX 2VNSA 3OQ6A 1WX1A 4IQVA 3UT5B 4GC7A 5ETJA 1B3BA 3TRFA 1QTIA 3EVBA 3P9RA 1RXCA 2XDQA 2R0QC 3GJYA 1QLJA 3H86A 3UUWA 3ZJTA 1X7GA 1GZ6A 4CCWA 1EYZA 2R85A 4PPYA 1AXRA 2CLFB 4GC5A 4FYIA 3CH7A 1YCDA 4Q02A 2P6NA 1KK3A 4FILA 3D3JA 3TDNA 1W29A 3OTIA 2P66A 4Q9IA 4ZVRA 3RC3A 1WBDA 3PUXA 1TJNA 3BB4A 1MA7A 3DUFB 1SRQA 3W5JA 3O4HA 3QU7A 5U1PA 2QMHA 5EMJA 2Q27A 2ZANA 4CKEB 2C9DA 4E5SA 3ZH9B 2F7SA 2ANBA 4UASA 4D9MA 1AGNA 2Z2YA 2OESA 5D3ZA 2C29D 2YNMD 2B4YA 1XHFA 2XYHA 3L8MA 4HG2A 1FDRA 3WK6A 3UYLA 3OM9A 3NMUF 3H5RA 4Q00A 4BYGA 1JQBA 1VLQA 1XVUA 3MDAA 4PHDA 4PAGA 1IC6A 3FB4A 3WRYA 3LUAA 2Q5QA 2BCRA 2AJTA 1YQUA 4NYJR 2KJ8A 5CD9A 2R1UA 5J0OA 5L1LA 4L8VA 1YDFA 4C76A 2VBGA 4FEYA 3AW9A 3NHUA 2B3DA 4Z7OB 2FLVA 3FNFA 1HO3A 5EEGA 1MDBA 4NU8X 1YNOA 2QGZA 3WR5A 4M3NA 3EXG1 5I8WA 3UMMA 3PD0A 4YYZA 5FPQA 3LQKA 1ORWA 4UAUA 5L95A 3NHRA 1IQPA 4MFAA 5AW5A 2ES6A 3OFNA 2AL7A 4URWR 4KR6A 1Z2AA 1JV2B 1E2LA 2JCVA 4BKUA 3LWDA 4YXFA 2E3JA 4G1BA 5C0YA 3TD2A 3VHLB 3RYHA 2BFPA 3R20A 4NLLA 4XEHA 3E3MA 3G8BA 1XWWA 3PMLA 3OA2A 3UY4A 1ZICA 5HZKA 5ILQA 3G8CA 2VBFA 1J8QA 2B7BA 2V74B 2A94A 3RKSA 6REQA 1FFXB 3CLSC 2H1WA 3TFWA 1JDVA 1C7FA 5J5VA 3TI7A 4O0IA 4C06A 3DZJA 5IYZB 2BV3A 3AJDA 1NW8A 5DGHA 1F5SA 1K4MA 2BQUA 2ZSDA 3UJCA 1B14A 2PXHA 5G5HA 4ACOA 1KZ1A 4FNAA 3T7RA 4I3FA 4EPRA 3B78A 3QV1A 1FFEA 1BX1A 2G1PA 4QL3A 3IVCA 4U3JB 3GD5A 1S96A 1UDXA 2MMGA 4I55A 5F33A 4FK8A 4JB8A 2HJGA 5KFLA 5FPHA 4CXMA 3W5UA 4UEOA 4JLJA 3AR5A 1G3IA 3UOGA 4R1QA 2GHIA 2WJYA 3D3EA 3OJ0A 2EFDB 3G8DA 2VANA 1NX9A 4N12A 3F96A 4U2KA 4XDYA 3NVKI 3AY6A 2F2TA 2HH9A 4ZYLA 5DHAA 1ND6A 2OWOA 3GOQA 2HPHA 1IDN1 2IGTA 1ECBA 4CIDA 3K8QA 4PNPA 5AUNB 1G6HA 1H94A 1TX4B 3EXG2 1EGVB 1KI6A 3H9JA 4AKGA 5HFNA 1FMFA 1KJ8A 2E4YA 3IPRA 2DTDA 3HFGA 2Q9AA 1LBEA 4GX0A 3JQEA 3AVYA 4TM8A 1O96B 2VBIA 3H42B 4IUBS 3ORFA 1XEFA 3HA7A 4Q3EA 1Z2CA 1R9JA 3H1FA 1IY0A 2QYOA 2DKFA 1NVEA 1YJAA 4IQ0A 5LA6B 4XYGA 4J9VA 5EP3A 2HO5A 5A2QA 5T57A 2J48A 3INYA 1T4DA 2B82A 3UXHA 2H54A 2YXBA 1GTL1 4Y0VA 1JVSA 1QYIA 4QBIA 4RF5A 1T1SA 1ZHHA 4YP1A 4KXVA 3N3BC 1HBJA 5A0FA 4GICA 2NAPA 5DOZA 4PSKA 2A4MA 4EENA 3BREA 4RTSA 2ZDGA 2Z9DA 5H82A 5EN4A 4MF8A 4KMOA 4TV8F 1PQ4A 4ECEA 4B6EA 3RWBA 1LXCA 3A9UA 4DMCA 2QTCA 1Z88A 4M37A 3ZGLA 4DR5B 3Q11A 3NCHA 4CCAA 2VJYA 3KZ1E 2R6HA 3RKUA 4R8SA 3DR5A 1QP4A 4KR3A 1F0YA 1W8DA 1WG8A 1ZQKA 1U3DA 5F2NA 3KKAA 1QK4A 1LBTA 3GJ7A 2ZIXA 1PK7A 4EGCB 2VRCA 4AS3A 4MUKA 4TKUB 4B81A 1U3TA 1NOMA 5ALRA 2JIRA 5AHWA 8ICAA 3FAZA 1OWNA 1CUDA 3ELUA 1NW6A 3TWOA 3PFWO 2E1RA 2QZ4A 4ZYTA 5C32A 1I2CA 3CT4A 4QARA 2CVPA 3A36A 2JV3A 4M9XA 3SI8A 3BJYA 3EFHA 2I9KA 4YJFB 3VKFA 4UVIA 4HDKA 1G8JA 4R01A 1RAEA 4ZDKA 5HHTA 3KXLA 4EEZA 5J2HA 1EXWA 3VR3D 3KHSA 5B7NA 4FBLA 5D00A 3KJGA 5A9TA 4B73A 1X1TA 1HEIA 2ENUA 3SC3A 2PBRA 1MRNA 2A1UB 4G81A 3BS5A 1Y9JA 3HU2A 4NOKA 5F1YA 4R8VA 2XUIA 3Q6IA 3JQ7B 1W0CA 3FDZA 4M1EA 2D0DA 3AIMA 2HJSA 3PNBA 3TL2A 4JC4A 1SKBA 4N5IX 4OJOA 4OK5A 4YDSA 3QPWA 4LPKA 1BFKA 3O94A 2QMUA 2HHVA 2PGNA 3IAXA 1T6XA 3A10A 1SH7A 1FFYA 4KW7A 2IUTA 4MDHA 1C4KA 3OZWA 1X1EA 1W87A 5CURA 1EJ0A 3PB3A 5KFTA 1WMEA 1NW4A 3RIMA 4XUEA 3DMYA 3QZ8A 7ICOA 1E1CB 4DQLA 1X13A 4IR7A 4RM3A 4DIEA 1PE0A 3G2LA 2A0KA 4WOKA 4KITB 3W5SA 2FX3A 2ZE6A 4KZPA 3QLEA 4KVGA 4QXOA 3AM3A 2GJ8A 1JHYA 5A06A 2W9MA 3ZE6A 3FFXA 1QKIA 2P30A 4MZDA 4F4DA 4YDQA 4NK5A 3Q9NA 4DM4A 2J9XB 3JYNA 2FUG6 3EDYA 4LTNA 5HQJA 4JV2A 5DNUA 2ZJ0A 3DKRA 3CVWA 3LO5A 4BMXA 3ESXA 3IVXA 1JPVA 1XO0A 3CVJA 2MRLA 1FP7A 5JD6A 1QIIA 5JNTA 3M4XA 2VUSA 3TFQA 3OEHA 3CVOA 5DTJA 3PJRA 4Q9AA 2ONJA 3ZV4A 1CQJB 1H1TA 4O33A 1HUQA 1KP9A 3SWWA 1W52X 3VDNB 4P4GA 3WFIA 5DP2A 3NXKA 2C78A 7AT1A 1KGDA 2EKBA 1YVUA 2ORIA 3IDZA 2V7TA 1WE2A 2PSSA 3AB8A 3JQCA 1E58A 2EERA 1O2DA 3E9CA 1TW3A 2XQJA 4JLKA 3O9ZA 3BGOS 5GGYA 3L1JA 4MEJA 4YC7A 3ZC3A 2LDXA 1CVIA 2W0MA 3HCAA 4U7GA 1RPAA 4JQYA 2GJ4A 2RGCA 3WK8A 1ADYA 1REQB 1JIXA 1A7UA 4J0JA 1DAGA 3NIBA 1TMKA 1E69A 1RSZA 2BKLA 4C4YA 4OB6A 1FNDA 4WBNA 1OC2A 4DCOA 1KPIA 4AB1A 1K08A 1O87A 4DOCA 1ZRMA 3CLVA 3I6QA 3N6VA 3T38A 1KZ4A 2V5UA 3N70A 2JHGA 4LNHA 1RJ9A 2YICA 4RE6A 4EHFA 2FG6C 2W6CX 2HR1A 1J33A 3BWVA 2RCYA 2BW0A 4B82A 1N6OA 3LK9A 2R87A 3V6JA 1JHRA 4C20A 1ZL2A 3MPUA 3LUGA 1MD9A 2AF3C 2IE0A 3OY2A 4EJFA 3ZLTA 1TO1E 2GLTA 5KO2A 4GPAA 1RTKA 4BP1A 4H77A 1KYQA 3G49A 4H6VA 1ZH0A 5C81A 5J4VA 4HAWA 4UCXA 4ECXA 5IPFA 3PEUA 4DMGA 1F9EA 1P7CA 2GZAA 1F0PA 4S1OA 2EXXA 3JAWB 4J1TA 5IJXA 4HMPA 2O7VA 2AIRA 4MR9B 4O2AA 4V3CA 1QHHB 1DJNA 1USWA 4O1IA 3NRZA 2UDPA 1BEZA 4FYVA 5IFLA 5KJ6A 3EZXA 4CYMA 3BK1A 4UHKA 2FJPA 4GYKA 1DWPA 5L6LB 2HBQA 4XIJA 4G65A 2IU4A 4PWYA 4KPYA 1BWSA 4GOND 3K0AB 5DX0A 1KQFA 4BVHA 2FK7A 5J59A 1DINA 1PGPA 4AZWA 4G0VA 2WUFA 3KQKA 3JAMA 4AX8A 1G16A 3O9VA 2VPXA 3PF8A 2QN7A 3TADC 2WWGA 1ZQPA 5B1HA 1YHYA 1PU2A 4A8JC 1DRVA 4ZICA 4ACBA 3TGPA 3SAGA 1Y63A 1GU0A 2G36A 3ZVNA 1GPKA 4L72A 3RU7A 1N7HA 2MHCA 4RJ2A 4CKYA 4R68A 3TQOA 1N2GA 3O4FA 3ELBA 4RXUA 4QG7A 4BASA 4NZMA 2RH4A 3PR1A 1AT1A 5DLGA 1QBGA 3ONNA 1I01A 3TLBA 2RAPA 3LPMA 3IT0A 4TS1A 5EVJA 4BV9A 2P65A 3QG5A 2XE4A 1JLLA 1S10A 2FPIB 1P6UA 4PGXA 2VXCA 4F06A 3K5PA 1QRUA 5K3EA 3PLNA 4Z9XA 1ZK0A 2GK7A 4AP5A 4ZOLA 3PFGA 3CVYA 3UYKA 3CUEF 5BUSA 2IYLD 4D44A 1YE8A 2QARB 4CR8A 3OICA 1ZQFA 3S5UA 2NRXA 1TYAE 1SAYA 1N2ZA 2OWDA 2H3FA 3PHLA 2XHEA 1WCNA 1GUFA 1U0LA 1FUIA 4KE7A 1E1LA 4DCSA 3KALA 1PL0A 1E9AA 1DJQA 1ZXIA 1XWLA 5LP6F 3QUBA 3ETCA 1ILWA 4BFZA 5E7MA 3OMXA 5E4JA 1WL8A 1VKRA 4HN2A 4Y6PA 2ZJ5A 3SYNA 4IMIB 2O5RA 2ZSEA 4R69A 1Z26A 1U7ZA 1NQVA 4WT7A 1D1TA 1WS6A 5JCJD 3CE9A 5CA0F 1MB0A 3R6TA 3U3MA 3OBIA 1RYEA 1BN6A 3EDRA 2PPLA 1Q74A 2N0SA 2C7VA 1F6WA 1NK9A 3KLMX 4PZ0A 1XTJA 2DFLA 1V8DA 1Z5OA 3GDXA 2ZI9A 2QG9A 4UBBA 6CHYA 1CY2A 3RTBA 3RAFC 1IBCA 2ZWIA 3IULA 1ZD3A 5FI3A 4I9UA 2G6TA 1CQZA 1BKYA 1QVVA 2O0HA 3KHLA 1HNNA 2OCGA 1B6GA 1GUZA 4KN9S 1UQVA 3CVUA 1JWBB 4Q45A 2H1CA 4ZYZA 3THYA 2QPAA 3WB1A 5CLIA 5JAUA 3MA0A 3T1NA 5EOZA 2W04A 3SXJA 5DULA 1XAHA 4P33A 2BHRA 2HYIC 3IAM6 4YAWA 5J0PA 4E2XA 3DLCA 2ERXA 1ZFNA 3QHQA 2NSLA 4NULA 1PJAA 1LNSA 4BCDA 3TKLA 1I14A 3CIFA 1V2GA 2YVKA 1TT5A 2ZQZA 4Q9HA 4ARSA 1PGJA 4QDTA 4L95C 1TVKB 2B21A 5KCMA 2O9JA 4QBHA 5EWJA 4JUZA 3VNVA 3R9XB 5EZ6B 1O4WA 3QI2A 5EMNA 2AH5A 2DLCX 4OB7A 4TS4A 4RQAA 3DBRA 3AEKA 5CH8A 1FX0B 5K8VA 2LIPA 3KWFA 1O89A 2UYHA 3DVSX 4L4UA 4TURA 3BWBA 2EFGA 1E2GA 3QUQA 2NTEA 2H65A 1NVBA 1QCDA 1GN9A 3IHWA 1JRPA 4C0XA 3LX5A 1EK5A 4OXKA 3FR8A 3FOWA 4B4KA 3PTLA 3U4DA 5DYIA 3D1VA 1FNCA 4BZWA 1JIQA 5LL6P 5FNZA 1EFRD 2R7AA 3MD0A 3AUJB 1T6YA 1M2HA 5F3DA 3VNQA 4C4XA 1XXLA 3OT1A 5IYZF 5C7LO 1R6DA 4PYIA 2NYUA 4IIEA 4RA9A 1P8AA 4JK3A 1QS0A 2BFCB 4JI2B 3PEFA 4XYEA 2HD4A 1DUIA 4PWZA 2WUVA 1WZNA 1S7CA 3U48A 3T5MA 3HM9A 2NLOA 4YA6A 4AUKA 4EPXA 4Q44A 3IYLW 1T35A 5GTHU 2RBKA 1Y8QB 1KE2A 3Q9LA 3MMPA 2EU8A 3QSYA 3WFZA 3R75A 3EVNA 3HB4X 5TR9A 2WPDA 4EY3A 4L5YA 4NBTA 2H07A 3GEGA 4U9UA 1BG6A 2GYVA 1ECLA 1DUSA 4B3DA 2QT0A 4J3FA 5LNK6 3QJYA 2OO5C 1ZN9A 3GLGB 1QB7A 1CZKA 1QC5A 1NJZA 2R5FA 3TOZA 4F97A 2EGHA 1YMUA 1OTYA 1XJWA 5FUXA 4OA5A 1R4NA 1XNHA 1Z2DA 1VPWA 4MB0A 3L82B 1CQIA 5IDWA 2B8WA 1OT5A 2B7CA 3B89A 3O8NA 2QE6A 5FLEX 1U0OC 2M98A 1VKHA 3HDJA 2L5YA 2CNDA 2VQDA 1ST2A 1YCHA 5GGXA 2Q6KA 4DSFA 4ZGWA 1RJWA 3LYUA 1O08A 4OKNA 3KQLA 1JBQA 3FRHA 3O4IA 4DWVA 4TLLB 1W48A 4WLFA 4BWGA 1Z1VA 3DE0X 3KTAA 5LA6F 5IC4A 3WZLA 2XR1A 1U8EA 4CM8B 3R1IA 1C3OA 5ALTA 2ESRA 3BIOA 4INPA 3DM9B 1W1UA 4EFKA 3WKEA 1HLGA 1D2HA 5B4UA 1ECJA 5JSFA 1CE8A 1F2TB 3ESRA 1PT8A 1A27A 1MVLA 3VNBA 2WIAA 1HDCA 4GMGA 3T3NA 4BMDA 4QG3A 2NU9A 1LSJA 1TMOA 5DTEA 3O75A 1Y4SA 1EDEA 5EIXA 5DHPA 5A6VA 1RQLA 3KQQA 3I01A 4C78A 2OBYA 1OWMA 4TTIA 5E6SB 1FNBA 3WU2U 4R8RA 1IZ8A 1NKEA 3MGHA 1ZONA 3CN9A 3LBIA 4O02B 3FCSB 3RABA 1HQCA 5HIKA 2LBOA 4N6OA 2C22A 3II6X 2CVOA 5FI1B 4Y8VA 2G6BA 2H3EA 3TW8B 4AYWA 2XUOA 2FMUA 4X64B 1I8TA 3GRFA 1QP7A 4GXKA 4YB8A 4MV5A 3ZV6A 5BMOA 1NVAA 2FZCA 1W88A 3DPIA 2C2RA 1AKWA 4CV1A 4KO1S 2FVXA 5M34A 1TM7E 5NULA 4O1MA 3ZHVA 2VJOA 5J2AA 4RPYA 1W5TA 1CQWA 1E6LA 2X8WA 4IYRA 5LU9A 3E9RA 3VSCA 4KLHA 1PR0A 5JDCA 3JQFA 1G7CA 3CV3A 4OJTA 3NRJA 4V0NA 4FGWA 5F73A 5CM9C 3RJGA 1LU9A 2GHTA 5J63A 4UPVA 2HOFA 3H87A 2A5FA 3CW2A 4LY3A 3LQFA 4JLNA 1P7VA 5AOAA 5I7OA 3K75D 5GJBA 4R8MA 4PGAA 1L4GA 2ZWAA 3BMCA 1K5PA 5C1IA 1JE0A 2W22A 2ZBUA 1YDEA 1JQLB 4IZOA 3FVTA 4HDNA 3ISCA 1U9LA 3ETLA 5K6TA 4F0JA 4OK3A 5LQCA 3EARA 1YR9A 1T3ZA 3IQFA 2WE7A 1OIVA 3FJYA 1NUPA 2CHQA 1DP4A 3OC0A 2OB2A 2CVQA 1RBYA 3ZHYA 4UATA 2PUVA 1XQVA 5JJCA 4FX2A 1DL5A 3MT8A 1AK1A 4IQ8A 1C3VA 2Q1UA 1EIZA 2PMKA 5SYNA 4MVJH 1C14A 1PS0A 3ZLUA 1DBPA 1TV9A 3QLTA 4XPZA 3HNPA 4U7JA 2YJTD 3MJHA 2Y9PB 1GFZA 3HJUA 2HREA 2JLBA 2AC7A 4H7FA 4PGFA 1QPBA 5JD3A 4H08A 4B3HA 1F0MA 1QV6A 1WOYA 1YQEA 4IQTA 4YG2A 5GJVC 3RTVA 4OFZA 3LP8A 3ZK9A 1A4UA 2FPPA 4BQIA 4ND3A 4UFPA 3SC4A 1Y8AA 5JPDA 4LYYA 2VRNA 3FUUA 3L7LA 3RI3A 3ETNA 5CJ7A 5ADHA 2FF5A 3V1UA 3N8HA 4REQA 3V2UA 1WHTA 1OVGA 2BSXA 1G8FA 2FZGA 2WF5A 2FN8A 2JCXA 3PGJA 2R97A 3FNBA 3P9XA 5K05A 3R7AA 2B69A 5A05A 4EUHA 4QWEA 2HCTA 3GGDA 2IEDA 4L9RA 1JLHA 1E9VA 3PE4A 4NZ9A 4ALJA 2MYPA 2CJPA 1NBEA 1GNLA 2Z1NA 1JSZA 3ROZA 3C8DA 2FEXA 4O3PA 2PU5A 3G0DA 3R5SA 4PTYA 4XGRA 2GVDC 2VK4A 1W1IA 4NCJA 4FFWA 1JKJB 1CXZA 3F4LA 2KX7A 3G0IA 1DB3A 1P1HA 2QGNA 4OP2A 1JIVA 3BXZA 4BRZA 2OHOA 3BSWA 1CB7A 1NQAO 4RAOA 2XF2A 3HWSA 4TKLA 3NX4A 3MWEA 1GY8A 2WNSA 3QK7A 4OXXA 4Q4AB 4CKBA 3KT8A 7REQA 4L4YA 3V3TA 2X1HA 4D4MA 4P31A 1E9CA 1IVYA 5BYAA 1NATA 2XRZA 1VJ1A 1TM2A 1JR4A 5MGBA 4UB1A 4G1UC 1XF1A 2G09A 1Q44A 1T8RA 2VT3A 4ADSG 1OF1A 4RADA 3NIWA 2JH3A 1EDOA 3AINA 3CU5A 4XQ0A 1I2BA 4YCLA 2ONCA 1F7UA 2RG1A 4FE4A 1V1RA 1YZHA 3H1GA 3SJUA 4POAA 2WKWA 2X8JA 1GO3F 3HT3A 3C8HA 3CSDA 3A27A 5TQJA 9ICVA 1FTYA 3LOUA 1UJ5A 1ZAKA 1MOQA 3CWCA 2ZROA 1HF3A 1FNSA 4BXOB 2P9ZA 2EAUA 1Y33E 3K1ZA 1EHIA 3JQGA 3H2YA 5DRTA 1Y1LA 4ND8A 3KUXA 4XWOA 3SMQA 5C35A 4LZLA 2W70A 2YIMA 2C5GA 4EG0A 1SVUA 3A9TA 1TZKA 2DAPA 3R4VA 4MQUA 4ZQHA 3TRKA 2PUFA 3COWA 1PGOA 2PZ8A 3DC2A 3M6WA 3DPSA 3EIQA 5SV2A 1I3KA 4FR2A 3VJMA 1EFVB 3OD1A 2JASA 4FN5A 4LDPA 2VDLB 3ZJVA 5DYTA 4E08A 4FT4A 3OEEA 3HWWA 5LZ5A 3MBIA 4UAYA 1SKWA 2C7GA 3AVOA 3M1AA 4LC1A 3WC4A 4ZCLA 4EGSA 1RAIA 4D2IA 4XQEA 4PC7A 2W8BA 3DCNA 2AN9A 4TWJA 5ELXA 2PWBA 2BDUA 3OJXA 2BI8A 3H11A