2ZIVB

Crystal structure of the mus81-eme1 complex
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
332
structure length
269
Chain Sequence
ECLKHIIVVLDPVLLQMEGGGQLLGALQTMECRCVIEAQAVPCSVTWRRDWVEEPTVLVLLRAEAFVSMIDNGKTLQGFVTDITAKTAGKALSLVIVDQEKYFRSQLPEVSRVDAEEALVDLQLHTEAQAQIVQSWKELADFTCAFTKAVAEAPLRDETTFSFCLESDWAGGVKVDLAGRGLALVWRRQIQQLNRVSLEMASAVVNAYPSPQLLVQAYQQCFSDKERQNLLADIQVRRGESTSRRIGPELSRRIYLQMTTLQPHLSLDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mus81 protein
publication title Crystal structure of the Mus81-Eme1 complex
pubmed doi rcsb
source organism Danio rerio
molecule tags Hydrolase
total genus 68
structure length 269
sequence length 332
ec nomenclature ec 3.1.22.-:
pdb deposition date 2008-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02732 ERCC4 ERCC4 domain
B PF02732 ERCC4 ERCC4 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.670 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2zivB02
3.40.50.10130 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2zivB01
4BXOB 2ZIUA 1J24A 2M9MA 2ZIUB 4P0QA 2ZIVA 2BGWA 2BHNA 1J23A 2JNWA 1J25A 4P0PA 2ZIWA 4M6WA 2ZIXA 4P0QB 2ZIVB 4BXOA 4P0PB 2A1IA 4M6WB 2JPDA 2ZIWB 1J22A 2ZIXB
chains in the Genus database with same CATH superfamily
4M9QA 4RKFA 1RE1A 2X9LA 2XSZA 4LXYA 5LD2B 3W06A 1URPA 3O94A 4Y98A 3MQ2A 4RIGA 4C6HA 4ZOQI 3FCEA 1O2DA 2A1IA 2W2KA 4KODA 3SC6A 2WTEA 2C58A 5BORA 4L2IB 1SG0A 2DUNA 3ROQA 1O0SA 1MBZA 4ZI7A 3Q0TA 5EIOA 3ZW9A 4KMSA 2D13A 1LDMA 2AG5A 3DQPA 1JUDA 4DDTA 2QN3A 5JSYA 2A0KA 4P36A 5FUBA 4QUDA 5J5AA 5IZCC 3BZKA 4I9GA 2OYCA 1JBEA 5AJVB 1UKCA 5TPWB 1ZQUA 4ISCA 3I45A 3ZWPA 5BN5B 4TSFA 4EB0A 1KIFA 3NU1A 3K1TA 3IEMA 1YZYA 4M98A 5A5GA 5K3EA 1NN5A 3NP9A 2WF8A 1JQKA 3ZV3A 1XD2A 4MW5A 4F72A 2RGGA 3DOUA 2CHUA 4DBLE 3N2KA 2Z4RA 3AQIA 4JLJA 1RQXA 5CB0A 1FYVA 1W8IA 3BGVA 4LEIA 5C81A 4DAEA 1J1ZA 4MQMA 1XKTA 1TA0A 1HKUA 4BCDA 3W7BA 4QVGA 2V6GA 1XKXA 1AKMA 1D9FA 4H08A 1C3OA 2Q1SA 3QEBZ 3QVGB 1F4PA 3HSYA 1T6XA 2QDKA 1RLMA 3JQ7A 3WBKA 1L4NA 4QZHA 1NI5A 1NNSA 3DEYX 5E1BA 1HG0A 1VI2A 2O1WA 2PDAA 4OHWA 1QZXA 2HF8A 3TSYA 5KFGA 4F4IA 4RF2A 4Q1CA 5DLPA 2BCSA 4IIBA 2FA9A 1KOLA 4YDRA 4L2IA 3HCAA 3D8UA 1Z62A 4FGUA 3RJEA 4EZEA 1QSSA 4OOEA 4ZCTA 3V1UA 4UDNA 1BMFA 1W36C 3D02A 3D2BA 4GI1A 1OWOA 2I91A 3CH5A 5BSFA 2OCEA 2B2XA 5TPWA 4EG5A 2AYZA 5BN5A 1XMVA 1IEXA 3GVHA 2H63A 4NLGA 2DCMA 1WZIA 3DFIA 3NVZA 1TCUA 4PBSA 4ALMA 1LDGA 1TPYA 4KYUA 2ZJ8A 1J7KA 4Z4GA 3AMZA 3ZNQA 5HZMA 1GKKA 3BQ9A 1PJZA 2F64A 5HR7A 2JC3A 3EZLA 3NEPX 5JCOA 1GTRA 4RHCA 5H0IA 2EQ5A 8ICTA 4MMYB 3ESZA 3H1EA 3OSPA 5DNDA 3ISTA 1U47A 4RTQA 1S76D 3SQLA 1Z4PX 3QVGA 1ZUHA 3C70A 4O2BF 1KERA 4LXUA 4YRMA 2C28A 1OT3A 5SV2A 2IYVA 3O90A 1X9XA 4PZDA 1USVA 4Q82A 2GBGA 1GZ4A 1H38A 1MVLA 4O63O 4UOZA 4ER5A 4TS4A 1EWKA 1KYVA 1SL2A 2JCGA 1LGYA 1AV6A 2I2WA 3KAQA 4ELTA 2PR2A 4ZDWA 5ILQA 2XRZA 1C1XB 1EVLA 4HOYA 2QSZA 2IDJA 3KKNA 2XA9A 1Z25A 1D1QA 2JA1A 5C52B 2H29A 4DYHA 2LE0A 4DCMA 3KETA 3Q87B 4FOTA 5FEMA 2AT1A 2WYHA 5JS2A 2JMGA 4RPZA 5TSDA 2O54A 3L6RA 2WM3A 2YJZA 4OQYA 3FOEC 1OUQA 1DTEA 3BXXA 4BEBA 3DXZA 1BSVA 4LYHA 4FYKA 1QLNA 4R9UC 4G24A 1GKUB 2PPVA 4G67A 3AKEA 4EG0A 1PZGA 2LRHA 3A06A 4AFNA 2BKUA 3RLIA 4BVHA 5K8VA 3MGHA 3U1BA 4HH4A 5LPNA 3MWDB 1F0PA 2H16A 2B61A 2COEA 1DBIA 1TGYA 2GT1A 4NNJA 2GA8A 4UNPA 1H6CA 3MPUA 3L1JA 3EGDB 4I19A 3RJIA 2NSYA 4Y2TA 3IO5A 4MI6A 4DJAA 1TYCA 1V4VA 4RQ3A 4UKDA 2EZUA 4GEKA 2KIVA 5FPSA 1NBEA 3WQQA 3OUTA 4G3IA 3X1XA 2BI8A 2MR6A 3VR6D 3I0ZA 4KK3A 2Y4NA 3VR5A 3QUAA 1Y1TA 4GO1A 4O3QA 4NBSA 4ND7A 1XAHA 1LK0A 4Q1EA 1LZKA 3H8WA 1SRRA 3N05A 4B09A 1C1XA 5A7HA 1G2PA 4DLEA 9ICTA 1NBWB 2B3TA 4IH4A 1XP8A 4P80A 4NPHA 3G0GA 1MOQA 2TMYA 3EPJA 3F8WA 2IYLD 1JBKA 4A91A 3UCXA 3H1TA 1L1EA 4RSGA 2JXJA 3R5JA 4GZ5A 2ZFUA 1HXHA 4IRMA 1BGVA 1OWMA 1ECGA 3PDIB 2CBZA 1OREA 2AVDA 3RIMA 3EVBA 5K1ZA 3OQBA 4FKMA 2YNMC 2VC2B 2WSLA 2XMDA 4LMAA 1XK7A 1CY4A 4GDMA 1Y34E 3DS8A 1HMYA 1AXRA 2V0GA 1KAHA 1M1YB 4C4AA 3JSAA 5ALQA 4H3SA 3P32A 1V37A 1ZS9A 4DCCA 3MWDA 4YGXB 2EV9A 2A1TS 1H23A 1EBBA 4MAMA 4YB8A 4EJMA 3EGDA 2A59A 3UGKA 2YCLA 4JH0A 4AJJA 3B8EA 1NJYA 1US8B 4W82A 2AHRA 3NB0A 5C37A 3L1HA 1TYAE 3NNDA 5CURA 4NZYA 1UDWA 2OY0A 4PZNA 2ZJ2A 1SUDA 1P31A 3IVMA 4WN9B 2RDIA 2J30A 2GQ0A 1X13A 3RIXA 4RW0A 2XB6A 4K88A 3LF1A 2O6LA 3AY6A 2I4LA 1Y9AA 4JA2A 1E66A 4TWZA 3FKSD 2JIRA 1ML3A 1V26A 2HA0A 3NFYA 1Z5GA 4XSHA 1XQ1A 1NFFA 4ZZ3A 1G3MA 3ZEIA 2YIDA 2H0AA 1IIBA 4N3AA 5BOSB 5JW6A 3QQ5A 1BD4A 2IF2A 3SLGA 3G3EA 4N54A 3JZMA 5FIUA 1GPLA 1DNPA 2K89A 4UTOA 3GU3A 3PDIA 2AW5A 2XITA 3FPSA 1IAQA 2JEOA 1QFZA 4H6PA 4L08A 3DZJA 5HIIA 2G5HB 1ZL2A 4OFZA 1RRPA 2I80A 4BO3A 1G9TA 5AVKA 3G8DA 1M1YA 1W4LA 4MF2A 4W6QA 1BPYA 4JJIA 2NVWA 4K6KA 1M74A 4EUKA 7ICQA 1ELOA 3BF7A 4HB2A 4JKYA 1QYXA 3ZHZA 3FZGA 1FFHA 2HRCA 3LT1A 3AERB 2VZLA 4UM8B 1I2BA 2AG0A 2GH1A 1GUDA 4AN1A 1SU4A 4ESOA 2FRXA 4MMZB 9ICRA 1FDIA 3U7GA 1US8A 2X1VA 1C4XA 3HZHA 1ZNXA 4BWMA 2BBWA 5ALSA 3TSOA 3L18A 2HWYA 1IUKA 3I32A 2ZYVX 1BYIA 2JJ8A 4FUTA 4B9LA 2VQDA 4S04A 2F1JA 1ACLA 1LLCA 4WN9A 3SQIA 2E8PA 4WIAA 4KLEA 1MVOA 2CPRA 2JFHA 4MR9B 4V03A 1R9GA 4CCYB 5LP6B 4DR7B 3GRYA 1IN4A 2BRUA 3NV7A 3QOXA 3PPVA 2L82A 2QW1A 5L4SA 1QE3A 2V4QA 4KXMA 3ZVLA 2A3VA 2OGSA 1SPXA 4I7EA 5BOSA 4M1WA 4QICA 4PGHA 1HTWA 1UC5B 4O2LA 4ZWNA 1WXWA 4AJLA 3A04A 3CXUA 4XM2A 1C0PA 3AH8A 3KKAA 1KDVA 1DT5A 3TFOA 1SOWA 1U7WA 2OCLA 4YP6A 4PBRA 3RVMA 4UTRA 3GRUA 1JJFA 3IIJA 3GY0A 4PAGA 3AT1A 2QX6A 1DIOB 1MB0A 2W42A 3NHFA 3ND6A 3QPBA 5EMNA 4TZ0A 1MH9A 1NL3A 3OZSA 4W63A 4M0FA 3RYCB 3UYKA 5IUKC 3M9OB 3BJZA 3AKCA 4Z7NB 1NG1A 3AERA 1PK9A 3QM1A 1GGKA 3QMPA 3UANA 2BFPA 4MUXA 5TB5A 3KT3A 1NSYA 4YUYA 4BN5A 5BOVA 3R5TA 3BS5B 2DOKA 3N7UA 3C7TA 4HWTA 2GCNA 4LMPA 2BH2A 4JBXA 3OM8A 5HKKA 1BHJA 4MR9A 3QJGA 3ROZA 1FP6A 4CCYA 3G5TA 4ZT5A 2V4MA 5KYGA 1FSPA 5LP6A 4QTXA 3I6BA 1UDAA 1G3IA 3FAKA 3KUKA 3H75A 2XA1A 1KN5A 3DBOB 5JXJA 1KI9A 2OG2A 4ZN6A 2ASEA 3TUZC 3EBLA 1BXKA 3BHJA 4P7KA 6PFKA 1ODKA 5E4TA 2VAVA 2OYYA 2B1IA 1UOQA 4DXHA 4OYYA 1QX4A 5BT8A 3ONDA 5EGSA 1Z47A 1DO8A 1RHQA 3UGJA 3KFVA 3KTOA 3RBVA 3BBLA 4DLZA 5CFZA 1R9MA 4C7OB 4RK5A 4IC9A 1ZJWA 3WKDA 4MDYA 1QRAA 1P4AA 1OLUB 1BS1A 3LA8A 5IC6A 4RYLA 1Z19A 1LPPA 2Q4TA 1NVKA 3N7PD 5DX1A 4XQ9A 1KORA 3WYAA 5LOVF 4L9RA 2C0PA 3HRKA 1YL6A 2J3LA 3QTBA 4PCAA 2ZPTX 1MJNA 4RXUA 5BXYA 1IXRC 2I0FA 3AB8A 3BS5A 4HN9A 4INAA 4RIFA 5EI5A 4O2AF 1UPCA 5IJAA 2X6RA 5DSXA 1YZTA 4QBIA 1C7YA 2G6TA 4KLJA 2ZBVA 1EP3B 4OL9A 1TMYA 2ANCA 3ITDA 1C14A 3ULKA 4LOAA 2MWMA 4ZU3A 1OPXA 4LHXA 3NOOA 4QLAA 4CNQA 3JPNA 1K98A 4KWTA 4M1EA 2QR2A 1EUQA 4US1R 2XYHA 1EDOA 2VH1A 2R8XA 4OYHA 5CR9A 4HL6A 1S8OA 3ASYA 1B41A 3C8MA 3L7KA 4ZHSA 5CHGA 3KG2A 3D4NA 2AWOA 5GTHU 3B3QA 3BMCB 3UJBA 3AVVA 2ESRA 2MJLA 2O0KA 4YPOA 2WE7A 1Z2EA 2BPFA 2GS9A 3AI2A 1J8FA 1TVKB 2XW6A 2VF5X 2BPCA 2IW3A 3T7SA 3Q8XB 1B6RA 3VSBA 4HN4B 4C7OA 2VDNB 3KR1A 5FCDA 2O3RA 3UJPA 5L3SB 3SEFA 4FI3F 1OLUA 1Q74A 3PMNA 3HWWA 2PRJA 4C8MA 4H7DA 4R16A 1QYCA 3GUZA 5KYWB 9ICNA 4ZFNA 2G76A 3IR6A 5AXBA 4KK4A 5DGHA 1FQKA 3B7GA 5GV7A 1X1EA 4TZKA 4JX8A 4R3WA 1BEZA 1V25A 1NPDA 1ZQGA 5K45A 4HFMA 1XELA 4MRRA 4XARA 5AKGA 5HF8A 2ZI4A 4LDRA 3UPDA 4BPBA 5D2CA 3T1HB 1TYZA 4BNYA 3Q10A 3OQ6A 3PD1A 4AJIA 5IDYA 1A9TA 3WL5A 4IHJB 5DHUA 4ZI3A 1U2DC 1B0AA 2OCGA 2QD2A 4HC4A 4YRGA 2QVBA 3I01M 3PE3A 1Z1BA 5JMPA 2JZOA 1U2GC 3LVQE 3PXAA 2Z5LA 3WWPA 1Z0SA 2V0CA 5TMBA 1ZOIA 3W9YA 2K8CB 3FVQA 1Z12A 2PH5A 1E2PA 2YRWA 1ZK4A 8ICCA 4D43A 3ZK9A 3BMCA 2GM4A 1NBOA 2FLNA 1GPMA 2HC9A 1JHPA 1XVIA 3ANXA 3SBXA 4KV9A 3VTZA 3MRVA 4G9BA 3VM6A 3UMMA 5F33A 4DMHA 1TVKA 3STXA 4IG9A 1EWQA 2P2YA 2PH3A 1BROA 2DY1A 2FZCA 2QTAA 2VQEB 1ZHFA 5MGBA 4G6ZA 5CLIA 1ZD5A 2AQIA 5L3SA 3M6IA 3KOUA 4LK3A 1QQ5A 4YRAA 2DHEA 3NWJA 4A82A 5KYWA 2D62A 5LLTA 5DHQA 1BX1A 5I7AA 3KJIA 4G1UC 4G5SA 4FDUA 3LK9A 1R4ZA 3PTAA 3E7DA 3PWKA 4YAUA 2O8DA 3PXEA 5L6MB 5DNYB 2ZRPA 3VC7A 5DQHA 1A50B 5IX8A 1DZIA 3QVOA 4NU0A 4ZCIA 2Z1MA 4USAA 1RNLA 4JLKA 2JG3A 2UXDB 5KYYB 3FRIA 1GUYA 2PQ0A 4XWGA 1TIBA 5AKEA 4PXYA 1NDUA 3RF9A 3V6MA 3DBHA 4DQXA 2PGLA 4IHJA 3EGCA 3ETNA 4L4SA 3IO3A 4IGEA 8ICKA 3ZK7A 5A05A 5HKLA 5DLQC 4REMA 4CHGA 2VHWA 4JQCA 1VE1A 1JAXA 1EMDA 3OTIA 3TCXB 3SV3A 2V9CA 1NUSA 5E95A 1SD2A 3DPIA 3ZJUA 3DZ8A 1Z0UA 4ZGGA 2ZVDA 1Z8HA 1FTQA 1ISMA 2CBGA 3WGKA 3MB5A 3F5QA 1KMQA 1HNXB 3LP5A 1UBCA 1DWQA 4L76A 2QG4A 2BMVA 3X1ZA 5CIWA 4ZJUA 2QRJA 1LDNA 4K9RA 4R8KA 3PXXA 1JAYA 4OXQA 4G2TA 2GN4A 4PX5A 1JB9A 2JIDA 3IHKA 2AIRA 4B4VA 4Q48A 4QLBA 1XQYA 1A7AA 1NMXA 2G0NA 3DO5A 1O0BA 2FCRA 1AKYA 3AJRA 4D9IA 1QO0D 3WIBA 3ZWCA 5F4ZA 3I6MA 4JD5A 4IDDA 4ZRNA 4S2EA 2BFNA 4M9HA 5MHTA 2ZXFA 3W04A 4YMSA 2UXBB 2JCYA 4PGQA 1ADGA 2Q6TA 3EA0A 1CUBA 3ACBA 5KYYA 3NHUA 2QN8A 2CVFA 4WI1A 4HJRA 4DCJA 2ADOA 1C8KA 4YEDA 1VMDA 3USCS 4GT1A 2I4RA 2P5YA 2WPNA 1Z45A 1SV4A 2G06A 3O8QB 2D0IA 3EMVA 1P9WA 7ICKA 5JD3A 2OK7A 3ZD8A 3OFJA 2GCIA 3S70A 5TQ0B 4RPJA 4CT0A 3LIPA 1TA4A 1IY1A 4QXMA 3ENNA 3VNRA 1DDIA 3IIKA 3G2IA 1A8IA 3ZD6A 2OB1A 1RW4A 3NIDB 2WB1F 2ZRNA 1E77A 1NP3A 1O8BA 3IQXA 1E5LA 4BCCA 1HL3A 5CLLA 3M9NB 4GUDA 4JSYA 2DKFA 3PFKA 3G9UA 2JGAA 4D56A 3UQZA 3IUNA 2IEYA 3ENWA 1N6RA 2Q9BA 1C0EA 2CDRA 3FMOB 4JLUA 1LSOA 1AZTA 3KHTA 4RHXA 1M76A 3TAQA 3MYRA 3M9LA 4PG8A 2C2BA 1OAOA 7ICSA 3O75A 2QRVB 1K4MA 4BLRA 4R0NA 2Q3DA 4IY1A 1QHEA 2GYWA 5EE3A 1RRMA 1K8QA 3N86A 2GZDA 1VHLA 3DLBA 2EDCA 3SC2B 1N6LA 5J2HA 2C4NA 4EHHA 4HQNA 3ELUA 1GEGA 5LYYA 3DE2X 1YCFA 1FRZA 3NPAA 4IBOA 4LQDA 4U2EA 1FRFS 2IXDA 3JAMA 2QTMA 1QIJA 1RWXA 2NIPA 4J4BA 3O8QA 1P5RA 5J4LA 1GZUA 4CMBA 2XEXA 2BGLA 2W83A 3OICA 4RNNA 5HHTA 1IQPA 3LUHA 3NI2A 2HVHA 4BV3A 2QU8A 1ND6A 1ZGCA 2JJ2D 5TQ0A 4ZOLB 3G17A 3OC6A 3K73O 4F2RA 5KWVA 3MGVA 1Q1BA 2QV7A 1A77A 1EVJA 2XUGA 5K8CA 1N7JA 1RLOA 3O47A 4OAQA 4MRMB 4MRSA 4ZAYA 2BGIA 3VU8A 3TIVA 3AGPA 3MCUA 4DZRA 3L4SO 3D4LA 4M8KA 2VP5A 3UIEA 1EX9A 3TG8A 1R0YA 1JSXA 3H19A 3LT0A 2OESA 2AJ8A 1E7QA 3CZPA 3RJ9A 4JI1B 1T1RA 5HG0A 4LHZA 1PTJA 2ZTEA 4Z4FA 4WOJA 2LYBA 4XGKA 2QRVA 4ND1A 4J6EA 4NV3A 1ND5A 5DVZA 1FUIA 4J3JA 3FD8A 1ECWA 4U2DA 4F3CA 1E2IA 4ROTA 3SC2A 4UMDA 2OE2A 1T8EA 1L7BA 2HMUA 4Q1DA 1MO2A 3G0DA 3FZEA 2PJZA 3QPDA 2I3BA 4MIKA 4QD3A 2VJLA 3P9KA 4L0MA 2BM0A 3SM3A 1WP9A 1V8ZA 4M1QA 5A3QA 2ZBPA 3UFXB 4OQEA 1TLTA 2X1LA 5B7PA 2FUEA 3VMMA 1Z4NA 4L4ZA 5HK8A 4MH0R 1VA4A 5LQCA 5JCZA 1ETHA 5J5CA 3NYWA 1I6LA 4ZOLA 5FX2A 4O5AA 4BQPA 1SD1A 4WA7A 1GTG1 5DWVA 4OBWA 4EWLA 4GR9A 4MRMA 4ZP1A 4JVOA 2IZ0A 4BFWA 3OFVA 4WV3A 5CNJA 2AE1A 2PEYA 2OMEA 4MQLA 3LY7A 1BMDA 4ADSG 2HNBA 1GPWB 1JF8A 3WWZA 3IIIA 3OZAA 4G63A 5CA0B 3HCCA 1Y8RB 1EZZA 5C8XA 1OAOC 4FHDA 5ARCA 1N2CE 4U63A 4EA7A 1ZCJA 4U6NA 2DTEA 4C2BA 5D8DA 5GAJA 1DBPA 2Y1EA 3VKUA 1SUEA 1O9GA 4N76A 2VIXA 3ED5A 2H48A 4QYSA 3EY4A 2IYZA 3TVYA 1X1CA 1XZMA 1T9GR 5JR3A 4XIJA 4TVKA 2FQ1A 1CNEA 1G6OA 2I6FA 5C4IA 1HGXA 1RWKA 5TISU 3NM6B 2R5NA 1RWOA 2ZIUB 2XTMA 3EMKA 2ILTA 2PUBA 1XUOA 1SCJA 2IYOA 1KPIA 4F9FA 4W5QA 3ZX5A 4FGSA 3L7JA 2QNRA 2DXIA 2CLHB 3J81j 3P5BA 3T0IA 8ICPA 3VH4A 3H1PA 3IEVA 2LNDA 2JEJA 3GRPA 4BQEA 1IH8A 5IANA 4DV7B 1ZRHA 4UVHA 3UFXA 2NSDA 4BYMA 3QOWA 1FDWA 3MWKA 3VTAA 3LL7A 2HCRA 1KMIY 3N8IA 4M83A 1QF6A 3QV1A 5K51A 3IXQA 3KC2A 3V1NA 1XEFA 2GZ3A 4DS3A 3TSZA 3HCRA 3MJHA 1NBHA 1P4GA 1U2SA 1I0IA 3E03A 1MKYA 1H2AS 4C78A 1FQOA 2OHFA 3A4VA 4FYPA 4HFJA 4EA8A 4I5DA 5K6AA 2BL4A 5CA0A 1Y8RA 2PSSA 5J8YA 4HX2A 3G5AA 1OBHA 1ZKDA 4JLVA 1SJ9A 5JEDA 3JYLA 9ICBA 4XI9A 5HF6A 1DQYA 3S6JA 3I1JA 2I71A 3K6RA 4Y1GA 3FTQA 3GEIA 2CLMB 2WJHA 2G8LA 3HVUA 4R8MA 1SC1A 3FTNA 4J03A 5AHWA 4PZYA 3W2FA 1II0A 3AVXA 4DSNA 2ZIUA 5JJIA 1IK6A 2DHCA 3KB2A 2HIGA 4JJFA 4DRXB 5KQPA 3T41A 2NAPA 4AROA 1Z3IX 3SK0A 5CITA 2MSNA 3SR4A 2H2HA 4CQJA 1SR8A 3LHKA 1ZIPA 1EJ6A 5AWFC 3B3FA 4B6RA 4JA0A 4MWOA 3QKRB 4N8SA 1Y6RA 1IBLB 5I9IA 2JARA 1GYQA 1KAOA 3OLVA 4DDKA 1O1YA 3WP1B 1K66A 4YCCA 5KQSA 5KSWB 4MJ3A 1VDVA 4GW3A 2UZ0A 2UZ3A 4X61A 5E0OA 4YO7A 3LZCA 4NCKA 2ZYIA 1PE0A 1KEVA 3L4EA 4DABA 3PNLA 2JVJA 4UUMA 4XOUA 4HWOA 4EBBA 1NIJA 5CA1F 4GS5A 3BXHA 1JGTA 3MDCA 2YQ5A 2XUJA 2W6OA 2G71A 1EA5A 2JFBA 3MUFA 5ITSA 1CJVC 3IPYA 4YPFA 1OKKA 2GWSA 1HEUA 1H5NA 5FUYA 5BSTA 3V1LA 3WZLA 4IUYA 4B82A 4ZCMA 4P33A 4LYGA 3PW2A 3KWLA 2VK4A 1J25A 1N5OX 3UG6A 5HJ2A 1R9NA 2Y0DA 1GQ2A 5SICE 3MAGA 1H93A 4C3ZA 2C9OA 3VNQA 5H4GA 1IEQA 1AKUA 3ZLUA 4RZRA 3A37A 4J0DA 4U7WA 4PPQA 1A96A 5BSRA 1H65A 2RAUA 4RDCA 2IEAA 3IMEA 4DRXA 4RA9B 4HNHA 1YIAA 4TLMB 3RS8A 5KVVA 3WO0A 1ZMRA 5KNDH 1L7AA 4E22A 4MVJE 2Z6QA 3LF2A 4EJFA 3QKRA 2ZB8A 3ZU4A 5C5JA 1JFTA 4NAUA 3KTFA 1WXGA 4HATA 4MUNA 1GXSB 1ZWKA 3CW8X 1YRLA 3IL2A 1KRPA 3LVVA 4B7UA 1HOTA 1QIMA 2YN2A 1RJEA 4CFYA 4RELA 1NVTA 4LG1A 2VPQA 1OIWA 1DOQA 3G9QA 5B6JA 1S3IA 1FE8A 4UZFA 1GVHA 3SJAA 1ODTC 2NZWA 2VLIA 1DXYA 1IZ7A 3WWDA 3SYTA 5G4LA 1F5NA 4A23A 5BR7A 5DI9A 1Q0QA 1TC2A 1T3LA 4M9SA 2QN2A 3FGPA 4OYLA 4NBNA 3PEWA 3OHMA 4DADA 1O4VA 1RLTA 1H2HA 4DY4A 5DB7A 2DPHA 7GPBA 1TLFA 4NBKA 1I3NA 4A1FA 3A6DA 4A0SA 3EUEA 1JMSA 1YOVB 1BGWA 7ICJA 4N03A 4K4GA 2I7XA 4O25A 1JSRA 4J8PA 3DPSA 3NIBA 2ZIEA 4KR7A 5K5EA 1QHFA 5HR5A 4EKYA 4XTCS 4Z6EA 2B4RO 1GILA 2GPBA 4NSNA 1HDOA 4E5YA 4RA9A 1CP2A 1RQ2A 1RXWA 1L3CA 2C20A 1UINA 3I3SR 4URZR 5J0SA 1WR8A 4JC5A 1THZA 2H1IA 2FEPA 1CCWA 1DKLA 1G6Q1 2PBLA 1E9RA 2HQSA 1VKZA 1WMAA 3X3HA 2PJRA 4LUCA 9ICAA 4JR1A 3C8HA 1GXSA 4XUDA 4C29A 4EPVA 8ATCA 4RGBA 4MUGA 2YASA 5JCJA 1IXYA 4BIMA 2BI4A 4XUEA 1EQUA 4YCBA 2HVIA 3THSA 5JS6A 1NHWA 2EW8A 4F4JA 3DLTA 5HRAA 2DWOA 3R20A 4P82A 3DB2A 4OK5A 2O2HA 1ZGJA 5JFOA 3SFTA 3O4HA 4ECAA 3SZOA 3OM1A 4ES6A 4LPSA 3HBMA 1PNTA 3BMOB 4WADA 4RVGA 1BHSA 4ILKA 3M3PA 2F2AB 4I1OA 4HDQB 1H2RS 1YOVA 5CB6A 4B7ZA 2R8GA 2E82A 4K2HA 1G5IA 2AMLA 2QWXA 3ZDQA 5DLEA 3PR4A 2UYQA 2O7SA 2R8HA 2PWYA 4R01A 4QUEA 4F3NA 1ZVKA 2RHJA 3P4XA 3HGQA 2B1RA 1NE2A 3FWKA 5ESXA 1DHTA 4YRKA 3DZBA 1MB4A 2CLSA 1Z0DA 1OWPA 2DSNA 5FBKA 4C21A 1UDCA 3VPAA 4DF8A 1U80A 3LV8A 8ICNA 4HADA 3C7AA 3SXUB 5AM3A 2P41A 1F8FA 5BP7A 3T5AA 3I73A 3QMVA 3H05A 3FUWA 4KQEA 2DZDA 4QULA 3U6BA 3H0RB 2HHCA 2Z4TA 3H5WA 1KKUA 1B14A 4QE3A 4MUAA 2FUG1 5I9MA 3TH5A 1AIPA 1GU0A 4MW6A 2FWNA 1WV0A 3MJSA 2FMPA 1NDHA 2HWWA 1SXJC 2DLDA 2I9PA 1W5BA 2KI5A 2WJIA 1CIJA 3IQDB 4D41A 1HFJA 4X1KB 1P7VA 4R2IA 5LYJB 1GFSA 1U8CB 1ZBQA 3LTNC 3KZKA 4HKTA 3FSGD 4BBPA 2Q5JA 4RXTA 2PKRA 5KAPA 1PFVA 4NYIR 3BMOA 3JQQA 4CM3A 1U4NA 2M6KA 4I9HA 2JD1A 4QLOA 2J9FB 2C82A 1WVIA 3OJCA 3BERA 4ENWA 2YJNA 4UTVA 1K27A 1RRKA 2QQ0A 2F1RA 3KTAB 4Z86A 3EUAA 2Y0PA 4K8OA 4CF7A 3EXIB 1WMDA 1IDN1 3GMIA 8ICAA 5JH7F 1Q84A 1P0MA 1JLHA 2H51A 3K8QA 4UHJA 3ND8A 5K3FB 3DPUA 4LVNA 2YW9A 4MA5A 2CWDA 1CZNA 1WXXA 5IKOA 3FMGA 5KX5B 4Z54A 4QPCA 3Q1LA 1L4MA 1MG0A 3N76A 3UMRA 3L41A 4OHBA 4JNKA 3CG0A 1XROA 3SXUA 4B71A 4ONEA 1VJTA 5JCXA 2W8BB 4EY4A 1K88A 3I09A 2JHAA 3QUTA 1I2CA 4MI1A 3E9EA 2RG1A 2C5EA 3GBPA 2NW6A 2FSVC 5F9MA 3SHQA 3CVXA 1IN7A 1EA7A 4D80A 1M3SA 4FE3A 1TF5A 3A25A 4LY9A 4ED7A 2V5VA 1B2LA 2AYYA 4CL2A 3TIIA 1QJ4A 4HWRA 1X38A 2FSIA 4X1KA 1OYOA 3N70A 4K40A 2B92A 2KX7A 5LYJA 3HU3A 4RZHA 3AETB 2W58A 3SHOA 1Z4QA 4FJ2A 3NVDA 4XJSA 5IT5A 1X87A 2EIHA 2RQ5A 2JLVA 3DQZA 4QXQA 5BYKA 1QH0A 2H59A 2ZU0C 1NKBA 1E1YA 1K4KA 2J9FA 5AUQA 3H3JA 2AZMA 4FYJA 1B0PA 1X2EA 4FFDA 1DHRA 2VH5R 3KTAA 2FV8A 1RAAA 1ATZA 4QODA 1KSGA 3PLAE 3EXIA 1Y4ZA 4Z0TA 4LYFA 2VPZA 2J3JA 1W5TA 2VF2A 3AQ4A 4C6SA 1WQ3A 2F90A 3DUFB 1YJ8A 1BKSB 4DNXA 4TMKA 2NXWA 3FWYA 5K3FA 1WRBA 2ANBA 4JLPA 3KB1A 1KMCA 3L7CA 3CQ9A 4RWEA 5DFAA 2EDUA 4E12A 3DDOA 2DF8A 5KX5A 4M9CA 1A5AB 4V24A 4OQDA 2GWRA 2YV5A 4RETA 1RYDA 4WLUA 2JLUA 2ODAA 2W2VA 1BVYF 2W8BA 3WSWA 2JLWA 1VQ1A 3QPVA 4XSVA 5KFWA 2QGZA 2XVAA 3GMDA 3OQVA 5TNXA 1RQNA 1UFOA 2IHVA 2ZOSA 3BZUA 3BCSA 4ECEA 1IULA 3CGWA 3TFRA 1BE6A 5FNVB 2XKAA 4RFVA 1FVHA 1DL5A 3H1AA 4U9IS 1FVOA 4M9LA 2W2QA 3RJJA 1HE5A 2V55B 2H1LA 2XD9A 4I36A 3CN7A 4IUCS 4HGYA 4RV5A 3AETA 3TQQA 3A4TA 4EF5A 1F14A 3RWMB 5AUNB 3GDFA 1Y0BA 4C0SA 2VXBA 1COWD 2GPNA 2BLLA 1I30A 3V9PA 1CG6A 2Y1WA 2O5EA 1ZN7A 2PHZA 2P66A 5L8VA 5E9AA 5ENZA 5A9RA 3QI2A 3CEPB 4D4MA 2C5HA 3RBAA 1RP1A 3DV2A 5AJWA 4FHEA 7MDHA 3ETCA 4NG4A 2B21A 4M47A 1STOA 3LJKA 4Q0MA 5J2FA 5K4AA 2VDLB 1J1UA 3DUFA 1BE1A 4NNOA 4JITA 7ICUA 1XLVA 2RHLA 3TQTA 3U6KA 4HVAA 4Z8XA 4KLHA 4F9GA 4UB5A 2WFLB 5T64A 1VJ5A 3RB4A 3M89A 3BQTA 4Y7CA 3NETA 3PTZA 3CGGA 1BXRB 3PR2B 4TWBA 3KVOA 3DAFA 3R7NA 1GCGA 4EITA 1INLA 3BTVA 3BFXA 4F4WA 4KI0A 3C5CA 4B3JA 1CUXA 1OWLA 1DQRA 1RPNA 3C5VA 4WEQA 2B7LA 2FPGB 4TV9B 1SRQA 2H2GA 3L0PA 1EWVA 3RJMA 5F9FA 4LCBA 5FNVA 3BJYA 3DD1A 1MAWA 1SEPA 3FJYA 4RJTA 1N1DA 3K20A 4F4KA 2FK8A 2YYSA 3LLMA 1QTIA 1WEHA 4H35A 4AF7A 4HGZA 2FWIA 1JXLA 3A1SA 4D3DA 3NS1A 1E6UA 4LMRA 2HXGA 4P4PA 1Y7PA 2CXSA 4M1OA 4R0MA 1QZUA 1OVGA 3MB8A 4KGDA 2D0DA 5KFYA 3K4HA 4JY7A 1K9VF 3LP8A 1C9DB 3NTXA 1GD1O 3QVLA 4O3NA 4HQRA 1UBSB 2OGZA 8ICIA 1KYIA 1JX6A 2IUUA 1B8PA 2OXOA 2CMDA 4QUBA 2ZW9A 2FPPB 3R5SA 5HCIA 1U3WA 1CR6A 3UH1A 4MK4A 4Y0AA 5IUNC 2DFLA 5TGDA 3DT9A 3SPXA 5ESRA 3QJ5A 4IP0A 3GMTA 2WFLA 1G8FA 4LIPD 4GXKA 4PQRA 5K6TA 3IE2A 1L4HA 1BXRA 4ECVA 1JB1A 3K4PA 2FYTA 4QUJA 1F1BA 4FWBA 4MOWA 3P1JA 1RRFA 5H5JA 4LC9A 4OV6B 4RJ2A 2AEJA 1DFIA 2FWBA 1D09A 1GPUA 1HT3A 1KEZA 4P92A 4NCJA 2XTJA 5B4TA 1JE1A 2FPGA 3W8FA 4TV9A 2QZPA 1QU3A 4JQZA 4RY8A 1SUWA 1S8NA 3L9XA 4M6WA 2FMIA 4KLQA 2PUJA 2AQHA 1UKBA 4F11A 2EP5A 2GZ1A 4ZEOA 4D4LA 5JY1A 2X86A 3NGMA 4S1OA 1BEUB 2OMKA 4CUJA 2PLAA 1UKYA 5LD2C 1GQRA 2RGNA 3Q5DA 1X7YB 1XJQA 1E2JA 5IN4A 1BWQA 3EQZA 4QRHA 4XR4A 5FTNA 4K9MA 1P0QA 1Q46A 4FJ0A 1IE3A 3CRZA 5F1YA 4K1XA 3AZPA 1WDWB 1OV4A 3WNQA 3MUEA 3RRNA 3U09A 2Q1XA 1QZTA 1W4CA 2FPPA 2Q1UA 3KJXA 3NOXA 4QFBA 3KSRA 7ICVA 3DXFA 2QTLA 3TBHA 4KLUA 1KQGA 3EXHB 5C8VA 1EZ4A 3FTCA 4JJZA 1JAIA 1E5QA 2P9YA 3C24A 1UBUS 3ZGZA 1E1QA 1ESEA 5FOTA 4OVKA 3PSTA 1AURA 2Q9UA 3ILYA 3HBNA 4HN2A 2CUNA 1BWRA 4FYIA 3HI6A 3EF1A 5FUXA 1KZ6A 3I9V6 3KHSA 5J4VA 3NQ41 4QJBA 3WJ1A 4F92B 4X95A 5IIMA 4H7KA 3PNVA 2HBKA 5JCOC 5EE1A 1ABFA 1DKNA 1YIDA 1NIPA 3H8MA 5G2OA 2JLBA 3X0DA 3RU2A 4D25A 1JIVA 4M86A 2XDYA 5BSVA 4R8RA 2XUOA 1C7QA 3RROA 5KG0A 4W7IA 3NMUF 2JD2A 3I53A 3UHJA 2YHIB 1FW6A 3AF0A 2ZWVA 2NZJA 5ALYA 5KJ1A 3OFKA 1VSVA 1X7YA 3PFFA 1MA3A 5CP2A 1LX7A 2RH8A 3F7MA 1UR5A 2AWNA 1UEJA 4H0CA 3MFQA 5E9WA 1JXQA 2WJZB 4QM6A 2C22A 1AN0A 1R0KA 1TK8A 4G5QA 4MWZA 4BRWA 1ZK3A 5KYVA 5T3YA 3BJMA 5KVCA 1OYWA 3TW6A 2GOYA 5IIIA 3A9TA 3EXHA 1HR0B 4EHAA 4V0OA 3A3NA 5EJ4A 3B53X 2CNDA 3K3PA 5KTYA 1ZICA 3FI9A 1T25A 3X1WA 1DARA 1KEUA 3HKDB 1HIWA 4UASA 2FMUA 4LRQA 3H1BA 1EX7A 1PNVA 1V3UA 3U39A 5AKJA 2JCVA 2KE5A 5EHNA 2H11A 3RJKA 2MHCA 4GLOA 4MO2A 2ZE7A 4KLFA 3B5EA 2QTTA 3PW5A 5I3CA 1HE2A 2JAUA 3HVHA 5F52A 2HPHA 1BPDA 3BPSA 3MQ4A 3EVDA 2BEWB 3KUUA 4Y2GA 5AXAA 3ZY3A 1E8NA 5IPFA 3SXJA 4AULA 4X65B 2RGNC 1NXSA 3L93A 1NW6A 4JI5B 3BSWA 3L04A 1PR6A 4WJLA 1EVZA 4I5FA 2BEKA 3REGA 2YHIA 2J32A 4JVMA 2IU3A 3DWFA 2WAMA 4WY5A 2L2QA 2PZLA 1SXPA 4LCEA 1H1DA 1Z5VA 2GJ9A 1FZTA 2XNCA 3M6MD 4EW6A 5KIAA 5KVQA 4AIRA 3EVNA 3TXAA 3Q3GE 4MP8A 1KBZA 4C7YA 2X6TA 1E3WB 3IAUA 5HFNA 3R3VA 3VPHA 1NJSA 1T8SA 4DS4A 4IR1A 2FI1A 1C2TA 3DBRB 2RC6A 3Q41A 2PZJA 4CLEA 1XZNA 3CZAA 4AMBA 4I9FA 4Y2QA 3UG7A 1CJCA 3HKDA 4JYPA 2OXIA 1COOA 4M21A 5BYJA 2Z98A 3KAPA 4JV1A 3LWNA 2JAPA 3C2LA 4ZAXA 2VUTA 5K09A 3PP8A 3AVUA 2XCSB 1OU0A 1AXGA 3S29A 3HDTA 1X7XB 1A27A 2E5SA 1T5BA 4REOA 4HXFB 2BEWA 4X90A 3ZTTA 3NUGA 4B81A 3EF0A 1X9WA 3GJ7A 4EI2A 1AK9A 4WJKB 4EVIA 3HXMA 1R6TA 1OJ7A 2WSYB 5AW0A 2IZOA 4S1NA 1HDCA 1VOTA 4XWKA 3D2NA 4MICA 1T1IA 1DGJA 4KWIA 5C18A 3R3XA 1W5SA 3B82A 1EB8A 4X5VA 5KPDA 1YJAA 3ITNA 4UAYA 4DG9A 2G0TA 1QE0A 2C59A 4TVBA 2BFAA 3TL2A 1TM5E 4C1NA 3L1UA 4V0QA 3DXXA 3IN5A 3JX9A 3FGNA 3ZWQA 3Q7IA 3BWMA 1HOXA 1E3WA 4EO7A 5A3SA 3F78A 1G5TA 4X3PA 4JROA 1DBQA 2A4MA 4RQ0A 3RLFA 1DRJA 4FBGA 1A1SA 3TBKA 3DBRA 4BVEA 2GZSA 3ND5A 3PE4A 4FT2A 3ZCVA 2ZI5A 2IUSA 1S6YA 4RV4A 2K5UA 1U7PA 3I2IA 2IJGX 5CPFA 4NOMA 2J0EA 1IRIA 4RQ5A 4NZZA 4ZOEA 5BQOA 2RLTA 4INZA 3UAOA 1RMYA 2F3RA 2D3DA 4JLBA 3B52X 3QF7A 2I7DA 1X7XA 3WWEA 5ED0A 4ZYWA 3Q0EA 1IN5A 3OUZA 4KPGA 4KQWA 2PI4A 5T4BA 4JXZA 4IIXA 3AR4A 3FETA 3DGEC 2WIAA 4C5BA 5DSZA 2O7NA 4CM5A 5SZIA 2ARKA 1DBWA 3NH9A 1AS0A 1PX0A 1YR8A 3BM5A 2H65A 2C7OA 1FDTA 4KLCA 2O19A 2F55A 5GGYA 1MP0A 4WY2A 2GMWA 2WPDA 1U8YA 2NAFA 2XGQA 3UW3A 1GRNA 2HAEA 1BCRB 4Q1FA 5KNCD 1TUEA 2XBUA 1QYVA 4RZSA 3KRTA 1NBIA 1VLQA 5L95A 3BGOS 2BRUC 1HEYA 2JB9A 4OJPA 5FLXA 3PHLA 5J0QA 4JN6B 1E3IA 2WUEA 3GLFB 4P4MA 1UADA 3PX6A 4KO8A 1YI1A 2O3JA 3ZUGA 2HU8A 5TMDA 2VZ0A 5KREA 5ALZA 2IE8A 3FFTA 4RE6A 4IGFA 3IT2A 1MQSA 1JA9A 4EG3A 3COJA 3LX6A 2IUFA 2BCEA 3KKAC 4D9MA 2P67A 3W1EA 1VL2A 2LBOA 2SBTA 4M0CA 5TQVA 4LTNA 4UQPA 4DLAA 4PPFA 1N25A 2XB9A 2Y71A 4CM6A 4W5OA 3B6EA 3RF7A 4C8KA 9LDBA 1A2KC 5F1PA 2PMEA 2IGBA 3VDXA 4RUCA 3V5NA 4HDAA 2GN1A 4L9AA 4EEYA 5REQB 2JW5A 1N9KA 1V35A 2XDWA 3WAJA 1FP2A 4KQGA 2Z5GA 1THGA 2O6HA 1VGRA 4QOGA 1GU1A 1AHPA 3ZXYA 4KFRA 5FI1B 4YV2A 3ZJ5A 3EIFA 3UNXA 2X5NA 2O8DB 2P6NA 4H1TA 2RIRA 1BCRA 2JFXA 1RVDA 1OXVA 3DB1A 2CLEB 1L9XA 4UFPA 1MJGM 1A5TA 4GPAA 5AXDA 4QC2A 4K8RB 1QAOA 8ICUA 5LP6C 1R4NB 1ENOA 4MLCA 1WVGA 4J9PA 4MXDA 1FXUA 4NG5A 5G41A 2O0LA 5ELXA 3DBHB 1FF9A 3RYHB 3U4AA 1NPYA 3GLFA 3ANYB 4EJ6A 2PL1A 4IS3A 1DJOA 4IDGA 3FB4A 1C7EA 3OT1B 1QO9A 1WKVA 4J0EA 4XQ0A 3HKZC 2QLNA 3AW9A 2VNKA 2GF0A 4R69A 1YMUA 4GWKA 1JLKA 3M6VA 1KY3A 2JLYA 3GRZA 1HLFA 2J45A 5FORA 4D82A 5CLQA 5CK4A 3MR3A 2C4KA 2QK4A 4KJZA 1ZA2A 4I1SA 3F7NA 5H3CA 4FOLA 1Q1GA 2BY4A 5K8TA 3SVLA 4B7CA 4XD7A 3OA0A 1KETA 1FY2A 1K7XB 2WVAA 3KL4A 2DPLA 3L1KA 2QLBA 4KRFA 3OLCX 1YJCA 1G21B 1K6IA 1ZLXA 1RBYA 4DLUA 4C2UA 3U81A 1K68A 4I6GA 2V6JA 5REQA 5J2UB 4B6PA 2IZ5A 3RV3A 3GPIA 2PGDA 4E5VA 1G8AA 3DW1X 4BB5A 2IH5A 1PYOA 1TMOA 1Z6GA 5AUOB 1ZLYA 4EYSA 1D8AA 5AM1A 2DYKA 2EJCA 1KI2A 2OHJA 2OFPA 1YVRA 1EESA 4B9VA 1QIEA 4YAWA 4ENSA 4B3SB 1P5JA 3EPKA 2CFSA 4XFJA 5E2IA 4UTPA 1D8LA 3PV8A 2I6UA 3T12A 3WWYA 1CS4C 5DHPA 1RACA 3KQLA 4P2GA 4EEKA 3HUEA 3KFXA 2OO5A 4M04A 1R4NA 2GN8A 3NHAA 5HGXA 4HYKA 3V9AA 3HK2A 2ENUA 5TVKA 3RYHA 3BCHA 4I3FA 3DWGA 1OFUX 4P4NA 4BLVA 3OT1A 4IV0A 3H9GA 3TL6A 4I81A 4ZO6A 1N2ZA 3MZ0A 3CLHA 5BYAA 4A16A 5AIAA 3QUSA 5AW2A 1IHXA 4U7DA 1RRCA 3CZMA 3DL7A 1S3FA 3ZGNA 5CB4F 1UPHA 3AEQB 3WMXA 5AESA 4G8JA 3H5IA 2ZJ0A 2ZG6A 4L4RA 1SUCA 3W77A 4OQ4A 2K8BB 3EWIA 2EJUA 2E37A 4ZH4A 1NK9A 3D4BA 1MRZA 1UJNA 1G21A 2CD9A 3NHSA 4NR0A 1ULTA 2MOKA 1EI9A 1AUQA 1ZM7A 4OB7A 5J2UA 1MH1A 4RORA 2LIPA 1V97A 4DLWA 4N47A 4M49A 1K2WA 4YNBA 3OC0A 2I3AA 2JANA 4W6ZA 4GVLA 2IBTA 3D6AA 3V32A 2LTAA 1MHPA 2EZ8A 3CNHA 2GZ2A 1WW3A 4NLZA 3ENVA 1YQUA 3ID6C 2WINI 2WJAA 4PG6A 1UJ4A 4KQXA 4E7PA 3ZI7A 4C0KA 1MORA 4G81A 4R83A 5EP1A 3VU9B 4HDNB 4C08A 1Q8KA 5EUBA 1RM5A 4FHCA 4AM8A 3IT3A 5CFPA 4GEGA 4C4XA 4OAOA 4LZWA 4KXLA 3BREA 4G1FA 1L5RA 1P2TA 5FLEX 3RSLA 2I4IA 3NORA 4DWVA 3HU1A 1LS6A 4PS1A 3PXUA 1O54A 3N5KA 3RS2A 1VJCA 1JFVA 4QXAA 4BQQA 2FE4A 4UHKA 3EW7A 3WV4A 2W6JA 2FHSA 2PMZC 4ZVUA 4YT4A 2WDPA 2R8EA 3AEQA 5KEIA 2D1FA 1V2GA 1FMJA 3LUDA 2OKGA 3WDSA 3H9EO 3BWBA 3CCBA 1K06A 1NVVQ 2ZDHA 5FR2A 2V98A 1J2JA 5FV7A 1M7GA 2EX0A 2FDRA 4KHZA 4EHLA 1N78A 4FXOA 4JU9A 2SCUB 2GA9A 3X44A 8ICXA 4ZU6X 5C4MA 4WZBB 2EVWX 3L7IA 5ALKA 2ZIZA 3CM0A 3TM4A 3HXKA 4J9NA 4LRUA 1RWMA 4OK3A 3WNCA 2P4EA 1JSLA 4BECA 1L5UA 4U4AA 1EVEA 4TL9A 1JSZA 3R3SA 3FVVA 3R8FA 3DCJA 1HT0A 1PU2A 4O08A 2B6HA 3VZCA 2W4IA 2OO5C 3OZCA 2CGEA 3SC4A 2JFOA 4Q00A 4AXBA 3VU9A 4WXEA 2JRCA 3ILHA 2YDXA 2R2GA 4HDNA 5KNIA 1IC6A 5KFKA 2OWDA 1MGPA 1U0SY 3EBOA 3ET4A 5DHFA 5IJ9B 2H3ZA 3ER9A 2KG5A 3EW9A 4B5KA 3TOVA 2CHGA 3UCFA 1NJ1A 2YFHA 4C07A 3E53A 2V5AA 5AFSA 5LMNB 3PL1A 4B9MA 4WY8A 4Y2JA 3P94A 3U3XA 3WLQA 3AJDA 2A86A 4BMPB 2FUNB 4CF3A 2ZWOA 3VPCA 4NATA 2Z5FA 1R0ZA 5K3BA 4DC0A 1O5OA 3E18A 1N3LA 1SU7A 1C50A 3PEYA 3OZFA 2GZAA 2WWXA 2P30A 4RPGA 2Q4RA 2FWMX 4MKFA 4KR0A 3T94A 3FTFA 4K6MA 2C5FA 2RGBA 4WOKA 1O03A 3LKZA 3HR8A 2SHKA 3BC1A 3LRPA 4NBTA 2Q1YA 3DSRA 2AXQA 3M7DA 4KDFA 5AK3A 3KKMA 4IRDA 3RUDA 3ZWAA 2SCUA 1FNSA 5EZ6B 1H1TA 1SB9A 3PK0A 4TLEA 4IJUA 5B53A 2PA0A 3V4SA 4JB2A 1H9AA 4IF6A 2BT4A 4ZDIA 2UKDA 4DIMA 4WZBA 4UM5A 3L3FX 2WAQF 4YRZA 1B0XA 1UEIA 4J2TA 1V3QE 5SYAA 5ALVA 3HU2A 1PGPA 1XDSA 2OCPA 3BK1A 5JSHA 4F5RA 3VPGA 4Q8EA 4J0FA 3A27A 1OHHA 1TKCA 1XKQA 2HU2A 2C04A 3VPBA 4G0ZA 3A7EA 2C9CA 1P9RA 5EUCA 2V7UA 3G23A 2PG3A 4BNZA 1Q3TA 3JWHA 4TYQA 5A0FA 2C3OA 2D2EA 3QXGA 1F48A 2CBXA 1BH2A 5IJ9A 4MQ5A 5AW6A 2Q9CA 2CVQA 3BGIA 2I6XA 3BVPA 3VU1A 2WJGA 4RMJA 1ODIA 4W5HA 3DBLB 2JV3A 4ZVSA 3CLTD 5JVDB 3UAGA 4MHVA 3ICOA 2B3DA 3LBFA 3PVXA 1EEXB 4FFWA 3NRZA 1NUPA 1G19A 2BTQB 2DUUA 5A1TA 4HQOA 3ZCSA 4E2ZA 1HUOA 1U3FA 5JMWA 3L8CA 2B7CA 3O74A 1QR6A 2BHSA 3E6AA 3IP9A 3GT7A 4XVQA 4UUNA 3R2JA 4PYNA 5BN1A 5JHHB 4EB8A 3CWZA 2J4FA 2RH9B 4GP9A 3U1VA 4G0WA 5B4VA 2OBMA 3N53A 2ZI9A 4ZGBA 2YHSA 3NGLA 2G7ZA 4O8ZA 1TE2A 3UK0A 4RL6A 5LQMA 2PLNA 2YVLA 4GQAA 1NRJB 1UPTA 4QGHA 2F6RA 2H4JA 4EYEA 3HDQA 2J3EA 1R8XA 2WLTA 4MEYA 3TEJA 1GPJA 1CUVA 4XB1A 4I8IA 3CCFA 5KJCA 1R6BX 4Q44A 2ZAYA 1MF7A 3DF7A 4N9QA 2VTBB 3ZGVA 3DNFA 4DA6A 4EQ6B 2KFZA 3PQ2A 4MKGA 1M33A 4R5MA 2PL5A 5AW3A 5TX7A 4AVYA 3BGDA 3DBLA 3K72B 4X8HA 5JVDA 1QRTA 4QX6A 2EW1A 4LC1A 5ARDA 4LRTB 5J0UA 3S0JA 1OFUA 3U56A 3T95A 2XMSA 4X1OA 2WZDA 2MSCB 3IP8A 1Z2OX 1G8PA 2BTQA 1W1WA 5HW0A 4F4YA 3X1JA 5JBNA 4AURA 2BCVA 3N28A 2AI2A 3H3XA 1XMXA 3WBJA 1EM6A 3NO4A 3KSMA 5ALPA 3RO7A 1XWLA 1RI2A 1TZKA 5I7EA 1S2DA 1MOPA 1WCIB 3E0QA 3TE6A 1ULBA 2GX6A 1O97C 2HCTA 1PTJC 2G82A 4LYYA 4X6XA 2GEVA 1JHYA 3HLTA 5JWOA 2RK4A 3LSYA 1NFQA 2O2EA 1R10A 3T4UA 3ZU2A 4K3UA 3JPSA 2LKYA 4Y6LA 3EN0A 3R5FA 1N8SA 2WA2A 5FL7A 2PKQP 4J3NA 4DG8A 5EKXA 4OP2A 3RUAA 1QTQA 1E9BA 2YBEA 5DTEA 4BGDA 1Y8CA 1AUPA 5TF0A 3D3WB 2QNBA 4HUTA 2KWIA 1NMEA 3V2GA 1MQAA 5DOVA 4DIUA 1N9GB 2GJSA 2MSWA 4N5MA 1A4XA 3PITA 5KTTA 4P7FA 2VI5A 4PHGA 4GBGA 2VTBA 4TUPA 2H3HA 1D4ZA 4EQ6A 4MUJA 3D2CA 3L0BA 1P5HA 5BSMA 1NWHA 4GLLA 5JJLA 3NDBB 2BFFB 1AGYA 4R81A 3CRVA 5C1BA 5THQA 2F4VB 4IX1A 1KSPA 4MVJF 5EIBD 5ED4A 5GVSA 4EGSA 2BM8A 2H1CA 3QRWA 5HX7A 4RD2A 5K0ZA 3ZZUA 1TF7A 2P9JA 3HB4X 3KQTA 2FQQA 4NS1A 3KT6A 2ZBGA 4KE6A 2UYHA 3AILA 3NATA 1WX1A 4XH9B 2KHZA 2W71A 3BQNB 1C9EA 4UBCA 3K9QO 4D92A 1K5DA 1UZMA 2J5RA 1SCAA 1WCIA 1OZGA 4OO1J 1N2BA 5IF9A 4JKIA 1VMEA 2RDMA 1YGYA 4CM7A 2ODWA 1UKAA 4M46A 1JEDA 2I66A 4HPXB 3SV4A 1OX6A 4R98A 4D97A 1P61B 1JU4A 1QQTA 4MB6A 3H0LB 3WYEA 3ZV6A 3FW1A 4HVTA 1Z7YA 3UVEA 1UM8A 2ZSHA 5CX4A 2OBXA 2PX4A 1C7IA 4B8ZA 1PWZA 3D3WA 4ZO4A 3UUFA 3BIJA 4BQNA 2PLRA 4RULA 3T7CA 2BPGA 2VJCA 3EZ7A 1N9GA 3IAAA 1L4LA 4ZYYA 4BTVA 3R9KA 8ADHA 3AQEA 3QE2A 3FIUA 3VOSA 1P7ZA 3KDAA 3HLYA 2XRFA 4JOBA 5CJ2A 4DQ0A 3UQYS 1PJ8A 4N7MA 4LVUA 2Q8PA 4L5JA 3MLBA 1E3DA 5IHXA 3R5KA 1NN0A 2BFFA 4LTMA 4LOKA 2XMGA 4N1AA 2VJKA 3G02A 1UXJA 4EP1A 2IXFA 4XWTA 2AI1A 2NZVG 4H6WA 1IG0A 4MIYA 5DBHX 7ICEA 4D42A 4I5EA 4WSOA 1LVHA 5JO0A 1L3BA 4D9JA 5K6AC 2ALJA 1A9YA 4I2NA 2IA5A 5CG1A 4EELA 1G16A 4LXXA 1RWNA 1UBTS 3EQ9A 3VISA 1YRWA 2JIMA 3O3NB 5K8UA 5M5BA 5FPQA 5J8YC 1C2YA 4N7JA 3RT9A 3VV2A 3OX2A 2ZEJA 5KDDA 3E4CA 2GHTA 2C96A 4M9RA 5AHRA 3SAHA 1BWSA 4JMLA 2HJRA 3VX3A 4KAFA 1NQXA 2HFKA 3TRJA 1TCBA 1XJ0A 3REOA 3P9SA 2FN7A 3K05A 1GAEO 5FTMA 3KKZA 2VK2A 4CKWB 1Z56C 2GLXA 3OGUA 4F7DA 2B78A 4FB4A 1YS6A 4Q02A 2DBVO 4F1JA 3FDFA 1CY6A 4AG5A 1LDEA 1IUPA 2BBSA 2GEJA 4Q6WA 3T1VA 3F6EX 4E1BA 4BQSA 4U3JB 3LA6A 5ETJA 2NV6A 1L6NA 1QNFA 5AR1A 2EARA 1IN1A 5EJGA 3TTWA 1NU8A 5ANRB 5LM3A 3OEHA 4LF9B 3GUUA 1U0HC 3AOEA 2PL3A 1ODJA 3GGGA 3W3ZB 4OHRA 4JL6A 2KTQA 5IVIA 1W96A 4O4HF 1RBMA 2AR9A 3ENZA 4EARA 3RC8A 1V48A 1ZXIA 2QMYA 2AYXA 2WNHA 3F0TA 1EBFA 2KS6A 3PEEA 1SU6A 3WKAA 1WIWA 3H5VA 2P9QA 4WXMA 1ORTA 1QRSA 1XNJA 1I3CA 4B1FA 4XVHA 3HACA 4WUVA 3DTNA 4PBTA 1PF7E 3EZ5A 2AD1A 4X41A 5BSKA 3HCNA 2GF2A 1I4OA 3QWAA 2P79A 2PYDA 2ZI7A 3L0YA 3T9BA 3P4YA 4OD0A 4G56A 1F2VA 1DUVG 1P1RA 3A0RB 2GETA 4H27A 2OOSA 1XZCA 5LZ8A 5IIOA 2W9CB 4CKWA 1EP9A 1E4OA 5JC8A 4IDAA 3H97A 5DP1A 5F5LA 4EHFA 3LX4A 2ZM6B 4ND2A 3WLKX 5IJZA 1V3VA 4TLLB 5KKAA 3MQFA 1B93A 2XE8A 1GSOA 3CMCO 1DRWA 3HG7A 1SQ0A 5DM0A 1P77A 4DV5B 3WGNA 2WWTA 3LRXA 5L1KA 4MYDA 4U3JA 3EG5A 2L5YA 2VWPA 2H2DA 1B1AA 4H4CA 1CZOA 1ZJZA 1GFZA 3E7FA 4O4IF 4TLDA 1Z74A 1KY5A 4EMSA 3PRJA 4U6QA 3F74A 4OQXA 1LLDA 1XEXB 5AI9A 2C8VA 2V9PA 3STUA 3EOAI 4LDNA 3SQDA 3ETLA 1R3UA 3V00A 3JYOA 4UTZA 3ZHSA 3ONFA 4U7TB 1GUAA 2IOYA 4LF4B 1JMYA 1L1QA 1PQPA 4FD3A 4AJEA 9LDTA 1KR5A 2DBQA 1AUVA 1PAUA 3HS3A 4ZGWA 1N5XA 1PUJA 3HA3A 4J75A 2GPJA 4UATA 2GLTA 2J3IA 4GP6A 1Z7BA 1UBHS 4G26A 4X6YA 1Z28A 9ICLA 2O2JA 2YY5A 1SELA 4IDBA 2G1JA 4X54A 4HDOB 2YWDA 4MLZA 3ES9A 3SNKA 5G3ZA 3IP5A 5KT2A 2P2DA 4X92A 4IMJB 2XNKA 3PE6A 3VC8A 4XKJA 4ZYXA 2RHWA 2W48A 4IDCA 5JPDA 2DECA 2FWAA 2EWVA 5EHXA 1U0GA 4PXSA 2W9CA 3DVRX 1VE6A 2JIZD 2UYOA 4FJ1A 1D2HA 3G0HA 3SHWA 3DLPX 4HYYA 1P2BA 4I4CA 1Z35A 3HWRA 2ON6A 1V6CA 1OGIA 4FPXA 1CI4A 4NY8A 3G2HA 3PSHA 1U7DA 1U9ZA 1AKEA 1XRJA 2YL2A 4AYBC 1ZXXA 4E5SA 2WJPA 1GFWA 4CM9A 3H6HA 4QQ8A 2FK7A 1SKMA 1XEXA 5EWGA 4IMPA 4NV0A 3O95A 4RK1A 3MWFA 3U4IA 4C89A 5F3WB 4Z1OA 5IABA 6CHYA 1MA7A 3NV9A 4NJEB 3SIWA 4Q4LA 4DC9A 2Y4OA 4UQGA 4M9XA 4KV7A 2Y6VA 1RIIA 4ASUA 5B30A 3WGUA 2GHQA 4IIFA 3VNUA 1K8RA 2FR8A 2J6TA 4KSBA 1QQAA 3FGZA 4LZDA 2ZRAA 4RNDB 2ZZKA 1SVMA 2Y1DA 3AG6A 1DAMA 1OPRA 3Q8WA 4UMFA 4GP7A 3BGWA 3QKTA 4XQGA 3S81A 3PRYA 5WRFA 1DKPA 4I8XA 3FYTA 2K7FA 3SZLA 3AEZA 4CLRB 4HEA1 1OI3A 2G07A 3K9BA 3KB6A 1U5BB 4CIWA 3BDIA 1W29A 3K4QA 1H3EA 4DPKA 3OZVA 1K8XB 2CXOA 4MUHA 1LBSA 2O8VA 1E1LA 4EA6A 3MLEA 1A9RA 3NJ8A 1KE2A 4ROSA 4CIYA 1ZEJA 3ZGXA 3M7IA 3O0FA 4XX0B 4WACA 2JLSA 3TGWA 3FPHA 3PFNA 4C5AA 3SCZA 4D4JA 2IDMA 4EW3A 1ZQVA 4FBLA 4LKRA 4NH4A 1QGZA 3DMNA 1O6FA 1BG6A 1V5GA 4XW2A 3AV0B 2RH4A 1CUJA 1Z6PA 2WG2A 2BOVA 2XC9A 3HJNA 2WHEA 4MJLA 2IF0A 4B4UA 1NK4A 2Q99A 4NJEA 3AHGA 4L8FA 4BWVA 5LDHA 1NBMA 4JX9A 2CV0A 3R77A 1KJYA 4YRFA 4GZ6A 1ZMXA 4HX5A 3QBDA 1G8SA 4FLMA 4OXRA 3E15A 3L77A 4U0KA 4A73A 2FWJA 2QMQA 4KFCA 1K6JA 1YB2A 1YI0A 4H15A 5BQXA 1EFVB 2BGNA 3LQQA 2RB4A 1ISIA 1E94E 4WZAE 3UC9A 3KR0A 2ZYGA 1E8MA 2QLTA 4CLRA 2CVHA 1XZIA 3WRXA 4XQ8A 1U5BA 2FEKA 3R3ZA 1HWYA 5TC4A 1RRGA 2GM5A 1OIXA 1KSFX 2HPVA 1PBNA 3X2SA 1SKAA 3G8YA 4B3HA 3KSUA 3B6IA 3QVJA 1AH2A 1OTHA 1P7CA 3JRNA 2YUIA 1T2DA 1M6VB 1YJXA 5JNLA 4XX0A 2F1KA 3RS4A 5AVTA 1YA4A 2DPMA 1GT91 5ALHA 3MBOA 4QQFA 1V4BA 4G01B 2ZR8A 1PS0A 1QANA 2CNNA 2WW8A 1NWCA 2XT0A 3JQAD 3B3GA 5EINA 1N33B 4IO0A 1H6BA 4K81B 1JR3D 3LY5A 3M4JA 1CJMA 1VLMA 4CDRA 2HO4A 2XJ9A 2ZAIA 1YZUA 4ZVMA 4YMVA 1GNPA 5EN4A 2QENA 3R0JA 4GOKA 1ZQPA 2Y1OA 1JH9A 2DGDA 5A4DA 3I61A 4HGOA 1Z15A 3U7JA 1JIJA 3WMFA 2R1VB 2G67A 2AZXA 2Z2YA 1VSTA 1XZQA 1B73A 1NHGA 2CCGA 3DV9A 4H7JA 5KFLA 3G6VA 1QU2A 1ZJMA 4M6WB 1N77A 1MFPA 4PC1A 2OWOA 1E0KA 3UUWA 1IHDA 2FOIA 4AZSA 1GA1A 1LFDB 4FKBA 3SDSA 1BIFA 1EFVA 4YT5A 1Q5PA 3K94A 2KN7A 1CZRA 3JPWA 3C3CA 4IDNA 3V8BA 3MBIA 2G7MC 4OIMA 3ZE0B 4OHMA 1TO2E 3A2KA 4ELVA 3UY4A 4MW2A 2XMBA 3K9CA 5AHXA 1M2FA 4RHTA 1XXHE 1NMQA 5IWCA 2IX9A 3T7EA 3WKCA 1L3VA 3E81A 4LWPA 4K9NA 1TRHA 4LJKA 4RF3A 3JQDA 4NYMQ 1D6MA 3PX4A 2HLDA 4PXAA 4UXIA 1M6VA 2HSJA 3IODA 4LA4A 4E51A 3BTUA 3I2JA 1G7TA 4K0KB 3BL8A 3AC0A 1QMPA 5KFEA 1OU4A 3BHIA 5DTRA 4V2IA 2X19A 2G1KA 4EHIA 2P4SA 1A2OA 1UT8A 2CKMA 4P5DA 1W0JA 2HHWA 5B57C 2A67A 4BBJA 5DP2A 2J0UB 3IVAA 4FO6A 3Q5GA 3O83A 5NLLA 3DAYA 3ER6A 1WSDA 3GFTA 2YCBA 3KIPA 4QHSA 3C0KA 5KDOA 1FUKA 4EHDA 1Q83A 2R1VA 5CT4A 4JLSA 5J2GA 2CXHA 5CRIA 2CFCA 4LF7B 4HGQA 3ZQUA 2DFVA 5KT4A 3LC7O 2A9PA 3LCUA 1GV1A 4OJMX 1ZQ9A 5DBIA 4GRAA 4ALLA 3I3OA 2Q21A 3ZGYA 2FP4B 1G59A 3MCVA 5T14A 2ZTLA 4GHWA 1JJBA 4R1UA 2PX6A 4D9EA 2VATA 4AU1A 4GDFA 1EJ0A 1M72A 4PQEA 1OZAA 2H0RA 5CYFA 1WKBA 4GSLA 4FCTA 3EEFA 2QE7A 3VSDA 4E32A 1CPYA 2Y6UA 3D43A 1PR2A 4JUAA 1FU4A 1PNQA 3F7OA 5I3ZA 1X1BA 1YZNA 2XUIA 2RI6A 2VCHA 4C4ZA 4B0OA 1YV9A 2A3NA 1XZKA 3HN7A 3DDCA 1E8DA 1JJVA 1XU4A 3QA3E 3SZUA 1SIUA 4RL4A 1XZFA 3O2QB 3BK2A 3GDXA 2PA3A 4DGQA 3HCBA 4KLMA 4YUZA 2J0UA 3W5CA 4BASA 2GPAA 2O05A 4HB4A 2W93A 3NWPA 3LP6A 3WOVA 4GX0A 4MF8A 5THXA 2FEXA 3OPNA 2Y99A 4J07A 2I67A 2H4ZA 3TECE 2X2EA 1E2DA 3V6JA 1BQ4A 5AVUA 3N2YA 1YH3A 1F0MA 2E1EA 5LMZA 3L8HA 2XCLA 2YZMA 3GNQA 3RHZA 2EJTA 4BJ5A 3IBGA 5CA7A 1VCIA 5LIPA 1KYZA 3ADBA 1P9OA 3A6KA 3LPAA 2IHMA 2FP4A 1ZHHA 2WSBA 4TUYB 1SA0B 4YHBA 1NNEA 3OPVA 1AHIA 4JS0A 4AC9A 4NCHA 3TDMA 3GLVA 2E1PA 1OVMA 4XDYA 1XFDA 3ICPA 4E07A 1Z0JA 5HJ5A 1CRQA 5HEKA 3LFHA 3EPRA 3MEQA 1IPFA 3VO8A 4AMGA 3ZYZA 4YG2A 4P4OA 2MYPA 5M2QA 3GC6A 2IEZA 2F8TA 1XA0A 4C0XA 1COKA 4REQB 2I3GA 1Z3EB 1YCGA 4PLGA 2ODTX 1FFEA 4UPEA 1I2MA 2ZQYA 3QE9Y 4O3MA 4CCAA 1LVGA 1D07A 1MX1A 4MW4A 4TGLA 3CEMA 3PC4A 1P4HA 4ZARA 3SAFA 2FLKA 2ZUFA 1K8YB 3C1YA 1WUHS 5IZ4A 2IXEA 4UAWA 1J5XA 1FUUA 3I23A 1G18A 2BJWA 3PC3A 4ZAWA 5AQEA 1H4TA 3OQHA 2PKXA 4Y6GB 3F4BA 5IBCA 2JH1A 4CFZA 5EJ9A 4QUGA 3FN4A 2Q7XA 4PY2A 1H5UA 1KFEB 1VHQA 3BD8A 4BTLA 3QY0A 3VU3A 4I5GA 1JHZA 1VCNA 4BGEA 1QWSA 3DULA 3EVCA 2OD7A 4TM7A 2H1HA 8ICWA 5CG2A 3L6DA 4TUYA 1SA0A 4LGCA 2BJHA 4UPVA 2DHQA 3GNSA 4KLRA 3NVAA 2AXTU 3MR5A 4N12A 5D1HA 4NJOA 4DCSA 4TMXA 2A3RA 1TT5B 3GJRA 2PX0A 1XDUA 1PUXA 2UVUA 3PEUA 2EF0A 1JQEA 2DCUA 5J2KA 3D0OA 3RAPR 3U80A 4DQQA 1DKUA 2IYRA 3VH1A 4FTWA 3MMZA 3OG9A 1P1BA 2BFEB 3T4EA 1Y3FE 4REQA 1ZM9A 5DLFA 3RVRA 3C8ZA 1TM2A 2J1LA 1SN7A 1NC3A 2VPPA 4UEWA 5KTMA 5LZ4A 1FFUA 3QBTA 3T7AA 1YS4A 3UJNA 1V9CA 2HT1A 2LI6A 4QG7A 1AQIA 4J7UA 3C39A 2ZB3A 7ICHA 4EY7A 2O14A 3OPYB 4L7QA 4MV7A 3RF6A 3L1VA 4IM7A 1ZONA 2YHAA 2VDUE 3LW7A 3ZI0A 2ZT7A 1D7OA 1X6VA 1MCZA 3HB1A 3CXRA 1ORIA 5A71A 3T15A 2ERCA 4JJ6A 1RXCA 3KFLA 3STTA 3U7EB 4CU2A 1XF9A 4HBGA 5BUCA 2VAMA 5J4HA 1JTVA 1GHTA 4I55B 1GTJ1 2PR7A 3ZVRA 3E05A 4ICAA 3HE3A 4DLPA 4AG6A 1MC8A 2EJVA 3IERA 4AKHA 4H2DA 4R1LA 5ALXA 2ZETA 5IVHA 1R4AA 1SHZA 1T9DA 3OLXA 1G5FA 2E4XA 1T5SA 3GP5A 2HQRA 1OD6A 4LF8B 1ZD1A 5H9VA 1TT5A 4FDTA 3ZWOA 3RUEA 3EXHC 4HB3A 2MT9A 3G89A 4Q3AA 5TMPA 3E4DA 3H8VA 1PV2A 3QG1A 2BFEA 3HYSA 1F4VA 4NS4A 1Y1LA 3TO5A 3TEFA 3HEMA 4NI5A 1BNOA 1GNRA 2EFHB 1K1EA 3NVWA 4GBJA 4KO3S 2ECPA 4PTZA 5FDFA 2XF2A 4R1PA 2FCAA 4RQ1A 4PL2A 1EKXA 1S3SA 3IVCA 1U4SA 3OPYA 4YCLA 5ICGA 2HJSA 3DOHA 5IXYA 4FGZA 4QWBA 4LZAA 3G1UA 4M4SA 4X7PA 3GP8A 2IXAA 2C1ZA 3PC7A 2IQ5A 2KKVA 2DHRA 3NVVA 3V7UA 1JS1X 1FJHA 1P1HA 3GLIE 3FUUA 2CXPA 2WQ6A 3OIVA 2B69A 1SV0A 4V39A 4MIOA 4BO9A 4A26A 3TLGB 1R37A 2WYWA 1Z6TA 2PQ2A 3BHMA 4I55A 4TV8F 2WILA 3K53A 1HQKA 1KU6A 3MCTA 4GSKA 2G5PA 4ZVVA 3K2IA 3Q9LA 5JYEA 3I1FA 9ICOA 1ZH8A 4S1VA 1N5DA 1I51A 4OA8A 3JZFA 1XMOB 3ZXXA 3KQKA 5FBLB 1PEKE 1RHUA 4OU5A 1P19A 2NACA 3BFKA 3FAZA 3IILA 5TEVA 4FYYA 2C9BA 4DT1B 4AZ0B 5K99A 4IGAA 1JDZA 5IVPA 3GJTA 1PBTA 2HRZA 4GOMD 2C84A 1EJ2A 3W34A 4CT5A 3P2KA 3R41A 4QIWF 2G5CA 1HA3A 1OTXA 3NWBA 3WQHA 1M8FA 3GARA 2W2LD 3QVKA 5LVAA 4O5CA 2HDNB 2HNAA 4FYXA 1Z38A 1RYRA 1V7ZA 4K2AA 3CIOA 1WTCA 3II6X 4L73A 2FOXA 3BSFA 3ZWDA 2ZCUA 3IUYA 1NX9A 4XAQA 2CMKA 2XI9A 1JI7A 4CV2A 2IOHA 2LIVA 1IBRA 3CO5A 1ZQEA 2C1EA 2VKQA 3EASA 3ZDDA 3OJXA 4EBDA 1WHSB 1G2QA 4XYMA 3TLGA 2P90A 2MIIA 4JJ7A 5G1PA 2E5WA 3GT0A 2CXUA 1JA0A 1ECLA 5BWOA 1L4BA 4MKRA 2B4TO 3OJ0A 5KU7A 2ZPUA 3C8DA 4ZVLA 3PR3A 3OT4A 3PQ8A 2IDZA 3K0KA 4XRRA 2G25A 2PGNA 2ZJ1A 1XXLA 4B6OA 4DT1A 3RM3A 4AZ0A 1A8PA 5DTJA 3RR2A 5DN6A 2R8PA 3SZGA 4NAVA 3JQGB 1ZXLA 2V7BA 3LUAA 5U1PA 1SUIA 1H69A 3QKIA 3JVVA 2PBZA 1CXZA 4C06A 3LUKA 2QQGA 3VGPA 4BZXA 2H2WA 3GN2A 1FLNA 4I6EA 2BR4A 3WB0A 1AGPA 4AAYA 1TQHA 3FHLA 5I9NA 2P77A 5FOUA 3F7TA 4JENA 2FH5B 5CYGA 1OI7A 3T5CA 3GJ0A 4KR3A 4ZRDA 3TADA 3OE7A 4RGVA 2I78A 1XJCA 4WFIA 5LLSA 3UBMA 4BUZA 1CBUA 4PAQA 3B2EA 1PKXA 3F2IA 1WHSA 4PZ9A 2RGYA 3DO8A 2XMRA 3OT5A 4RFLA 4A0FA 2BSQA 1YB5A 4WBXC 1QG4A 3IXMA 1EDDA 1CNMA 1Y88A 2WSSA 3C6QA 1RLIA 3UH0A 3K9WA 1T1JA 2Z3VA 5FBHA 1T4CB 1FVXA 4U8HA 2RHFA 4EL0A 4WBNF 1YR9A 4YXWA 4F5OA 2BUBA 3N87A 4B9TA 4DL9A 2DPXA 4BFLA 3UA3A 4CUZA 1MJ5A 1X9HA 2HMSA 1V1JA 2YJ5A 4CBVA 3BH6A 3HJHA 2FB9A 4UBBA 3IEIA 3UM9A 4DQIA 3JQGA 1N0VC 4QYXA 3NM4A 5HDQA 3D1VA 4TT8A 4R6XA 4NZOA 1IJFA 2HGSA 5L1JA 4JUDX 4RQNA 2WJ3A 3IJ5A 4PNEA 1BPZA 3FCUB 3BORA 5HS4A 1P8AA 3FCSB 4YAGA 2P2CA 4L74A 2JKZA 1YZ7A 4A2PA 1JXOA 1FSZA 4YXMA 3FE2A 3G8AA 3V7LA 3WBFA 1BA3A 1HTBA 1XQWA 1QSYA 5TY0A 4XLTA 4KN8A 3LKVA 2P6OA 1QJCA 2R6DA 1RCTE 1OC4A 5FUWA 3R40A 2J48A 3WVNA 1R0SA 1KRXA 5DNWA 4CMJA 5H4HA 5BV7A 2C83A 1Z2DA 5DBOA 4A5OA 3RTCA 5B2ZA 2EEZA 1Y4UA 3R76A 1CJTC 5DGIA 3I34X 4A0GA 1C20A 2YC2C 2Z6UA 1V9PA 1T4CA 2C7QA 4BWFB 3FUXA 3MT7A 2HADA 1X2BA 1QRUA 1CW2B 2AD5A 4J9QA 5AM5A 1CE8B 3BWYA 1MFZA 3HSKA 1P7DA 2NUTB 4UM7A 3ZQJA 1AKWA 3R4VA 4B6JA 4L51A 4Q3CA 3PS9A 2NO6A 3ETEA 3NT2A 5CK5A 3K8ZA 2BEVB 3AHCA 4R2LA 3RK4A 2O2CA 2ZIFA 1CU1A 1QDLB 3LBIA 2VT7A 3V7NA 2AZTA 2A5JA 1NZBA 3W0LB 1PQ4A 3ITKA 4X64B 1T0BA 4GXIA 5F7OA 1HYEA 5B6IA 3PENA 3IQZA 3FLBA 4LY3A 4LOJA 3EAFA 1N4DA 2JI9A 3CZCA 3MJVA 2EFGA 4AZVA 2HRQA 3S1AB 5JRJA 3LO5A 3JZDA 3TNJA 5SYMA 1P33A 4BVAA 2QRUA 2IYTA 3N2LA 3D4OA 4ZU1X 1IXKA 1CULC 4FE4A 1C0LA 1LU9A 2RCNA 4K9LA 3AKDA 4A3SA 5CH8A 1XYGA 4WCFB 5J23A 3PTLA 4JQSA 1KZHA 2UVDA 2Y67A 4Q3BA 1GTZA 3USZA 4H7PA 1WG8A 1T5LA 5DHAA 2NO1A 3U44B 4TROA 1H8EA 4P58A 1RBQA 2DB3A 3OZBA 4JP8A 3DGFC 4AY3A 2Q5EA 2PMBA 1PT5A 3AUKA 1UP6A 1FTGA 4MULA 5AK0A 3BDAA 3WLHA 3W5VA 3HZOA 2AXPA 4ESHA 1ZNYA 3QMMA 1JQDA 1CE8A 3MS4A 1P5ZB 1G38A 4D26A 4UDXX 3H84A 2NUTA 1XPRA 3IT0A 3O91A 4BJ3A 2VRCD 2HBRA 2R6FA 3OIUA 1N2EA 2ZSKA 5D7NA 1SEVA 3L6EA 3KOMA 2WYOA 1VLVA 4MVXA 2BEVA 3JRXA 3ZNOA 5CT5A 1KSJA 1R0WA 1ZU4A 3T5BA 1U99A 7ADHA 4O3FA 4S24A 5AYVA 2D2VA 5A2QA 4BVJA 4TT3D 1E7RA 4LK2A 3WS7A 4HNTA 2VNAA 3A32A 3H8JA 4FS1A 3GNTA 1X3LA 2XGMA 1FNNA 4AUEA 4OMCA 1I10A 5E4FA 1KQ3A 3JYQA 4G9EA 3KKKA 1YKFA 3S1AA 3PUVA 2XGJA 2NXNA 5BMVB 2DKOA 1B16A 5ELLA 4MW1A 3AL0B 1TV9A 3NKLA 4Q24A 1U9JA 2APJA 5JISA 5J1SB 5KZMB 4J9MA 1PRYA 1XJWA 3D3KA 2ACKA 4LV8B 2JFQA 4WCFA 4WKGA 5G0WA 2BE9A 2CXRA 2DUJA 2N42A 3I01A 4YXFA 1IY9A 1CJSA 3RRZA 4IS7A 4IEIA 1W25A 1R8JA 3U44A 1IDOA 3UBTA 1M0WA 4K9DA 2KB0A 1XMSA 3DW3X 3CNEA 4NKRA 4P98A 3MPOA 3H9CA 1PZHA 1XR3A 5EZYF 2GYVA 3EOZA 2BKEA 1JILA 2XYRA 3PW4A 3RCBA 3ZHUA 1QZZA 3TLZA 2QLLA 3G9XA 2C3YA 2WKSA 4G8DA 2YHBA 3O21A 1RZTA 4CV3A 4QHYA 1MOZA 3HMKA 3FZYA 1JG1A 1C9KA 2NMVA 4PHEA 5AW8A 5AVSA 4CKZA 1EK5A 4WX2B 4PC3A 2WQ7A 3FNHA 2W6ZA 1XFAA 3AHDA 1HLDA 2GLUA 3W5HA 1I8TA 2V97A 4DTIA 4C7ZA 5DHRA 3UC5A 4ZO7A 1KZ9A 2PUWA 4HNVA 4MWGA 4J0CA 2YYYA 1NJGA 3QE0A 1GOTA 4LVOA 4FBMA 4JFRA 4E1AA 5LQSA 3VJKA 3DOOA 1J1IA 5BMVA 2HI0A 3RUIA 2FN3A 3I6YA 1XWIA 3DTVD 4I66A 5CIQA 3RS0A 4DIOA 5E1MA 4HAUA 3QW2A 4IYJA 4BXOB 2HWUA 2H3VA 2WM8A 1I13A 5ITZB 3UENA 3CLUC 2B4AA 3BAFA 2C5SA 4BJ6A 1NP7A 2VBCA 3I39X 5SY6A 1UAYA 2ZQ5A 1F0YA 5EGNA 4ECXA 1YA6A 3TE7A 3ZEAA 3TLJA 4X9XA 2FZ5A 4XM1A 3DZFA 2GKGA 3CUWA 3DE6X 5HBRA 4OJ6A 3MMPA 3IMFA 1ECJA 1KL7A 2R6AA 2OAGA 2AFIE 5IVKA 2G4CA 4YCJA 2HIAA 4F86A 3OIFA 3MTIA 3TNYA 5L45A 4E33A 1WBBA 2IW1A 3DMTA 3FOWA 1WBDA 3IIMA 1J33A 3QIAA 1AY0A 2ODNA 2VHJA 2SKDA 5DQGA 3BJRA 3RRGA 4EMUA 5HZKA 2JGIA 3ADKA 3AJ8A 2KSQA 3NAMA 2C4VA 1T8RA 3P2YA 1K9SA 4RVFA 2QUHA 3AO0B 1T5DX 1E32A 3TOZA 4I2GA 4O0IA 2XQIA 2BHRA 1T4BA 4LDJA 3VZPA 1ZUNB 1G63A 1XCJA 4L8YA 3OMWA 5DE3A 3KQVA 4KMOB 3GFQA 4FE7A 1NATA 5EIEA 1YE3A 3LHFA 1BJKA 4D8WA 3GFGA 4BXOA 3HY4A 4OI4A 1A1VA 4TTAA 1RTKA 5ITZA 2CL0X 3C3JA 2LPMA 3AHIA 3PDCA 2HHHB 5EOZA 1JVNA 3OJOA 3NHKA 4NMXB 3GH1A 3O1IC 1F1JA 4OUKX 3FR8A 3S7TA 4LJ7A 2E87A 2OGUA 4C8NA 2XAAA 4M0KA 3DCYA 3V8RA 1CF9A 2VYNA 1CQXA 1KZ4A 4YCDA 4IQVA 3IHWA 4RZXA 4G65A 4UPDA 2MMCA 3D3QA 4DA0A 4R9NA 4D0NA 1SVLA 1TQ6A 2XUDA 1GPNA 3AUTA 5F78A 1SVNA 5A4MS 1UXIA 3B9RA 4TXHA 3DE4X 5AHKA 2WU1A 1WM1A 3FWNA 1GAJA 2DQNB 4D81A 5ICEA 5ILGA 2AJBA 3ZYCA 5GGXA 1BNPA 5C51B 1T9HA 3LBHA 3IP3A 4CV0A 5L3RA 3AU2A 2D2XA 1W4BA 3OSUA 3TXYA 5GJVC 1NZPA 2VJOA 3IR5A 3QYFA 3AL0C 1J42A 2X8LA 3BILA 3RUPA 2W0SA 1IVNA 1P0PA 1CJUC 3TWOA 3EK2A 1KP9A 4D9HA 4ZAZA 1GT6A 1VGVA 3EZ2A 3KYJB 2YBDA 1ZUNA 5P21A 4KMOA 1OWNA 4V0KA 5EIXA 3QU9A 3E3AA 3S4YA 1ZETA 3ADDA 2FQXA 3TFSA 1JKMA 1DK3A 2OZVA 2YOFA 1E7YA 1GSIA 1ID8A 2AVNA 5FO0A 4YT2A 4ZJZA 4FFBB 1TGVA 1IZ8A 3QPAA 4B31A 1RKBA 5J0TA 1FYXA 2AJLI 1X15A 4R5HA 2RGAA 1E7SA 1FUEA 2PV7A 4YCAA 4AKSA 4R64A 2PIAA 1J6UA 3DMTC 3OTWA 1WLYA 3BXPA 4IDEA 3KP1A 4RQBA 2J5XA 4UC0A 4OFXA 2H1RA 4B9SA 1GJRA 2ERXA 3BEDA 2W37A 3ZQ6A 2MUTB 3C6YA 1KO1A 4HSEA 4B40A 4ENVA 1ABBA 1KTVA 1YB7A 1FXWF 4TMVA 5IMBA 1XRPA 2CMHA 4LDAA 1YQTA 2VDVE 3QEMB 4W5WA 5KTRA 3VJRA 3ORYA 1NFRA 4BU1A 5FA5A 1E62A 3E82A 1QLWA 4EAAA 1ECCA 5BSUA 1WHTB 2NVBA 4TRRA 5LCXA 2OGWA 3UJCA 4Z4CA 5JSZB 1TIPA 4E15A 3FMPB 2C2XA 3AUOA 1JHUA 3PFBA 5TARA 3F5AA 1V9SA 2D2IA 2V9ZA 3WL4A 1UT6A 1C9NA 2NTJA 4EUHA 1G0NA 2X9VA 1MX5A 3DFZA 4OH1A 2GXUA 5AVRA 1GDDA 2ZUBA 3QVTA 4FFBA 5EZ5A 1SL1A 5LQJA 3WIEA 1Q19A 2YXBA 1KAQA 3ZWWA 1D9XA 2DFKB 4URXR 4CVNA 3LWMA 2P11A 2J7PD 4M53A 3FNEA 4M0PA 2ZR7A 5MF6A 4Q7JB 1D4AA 1CSEE 3W78A 3AWIA 1G291 2C4HA 3L9WA 2XMZA 1F2TB 3PR1A 5A4JA 3RGWS 5LR6A 4QELA 3TD6A 1SHJA 8ICJA 1IBKB 1KJIA 5HYVA 2MUTA 3U0BA 3DDUA 1EP1B 3VR6H 3E9RA 2OEHA 5DGTA 3AVWA 1BVHA 5K2MA 3ZBUA 3D9QX 3VSCA 2AZ4A 3UA4A 4KXQA 1ZC4A 2Q2QA 3QEMA 4A8PA 3E70C 2MSLA 1ES9A 1XTSA 1U9LA 5AJHA 2XE4A 4TWIA 2VUUA 1KAGA 1TZCA 5K0FA 1WHTA 3INRA 3Q9NA 4DJJA 5KFSA 1MRNA 1RFLA 1VKJA 5JSZA 2I29A 3L6UA 4M89A 5DGDA 5ALDA 2CNKA 2JLCA 4TSKA 5BPFA 4GPTA 1XRQA 4DOCA 1S9FA 2OLJA 3F3SA 2LCIA 1XCLA 1G5PA 3THOA 1SXJE 2YQZA 2O2IA 3RRXA 2B4QA 4I2EA 2BGKA 1VHWA 3Q7EA 1N4AA 1P4RA 4FYVA