2ZIVB

Crystal structure of the mus81-eme1 complex
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
332
structure length
269
Chain Sequence
ECLKHIIVVLDPVLLQMEGGGQLLGALQTMECRCVIEAQAVPCSVTWRRDWVEEPTVLVLLRAEAFVSMIDNGKTLQGFVTDITAKTAGKALSLVIVDQEKYFRSQLPEVSRVDAEEALVDLQLHTEAQAQIVQSWKELADFTCAFTKAVAEAPLRDETTFSFCLESDWAGGVKVDLAGRGLALVWRRQIQQLNRVSLEMASAVVNAYPSPQLLVQAYQQCFSDKERQNLLADIQVRRGESTSRRIGPELSRRIYLQMTTLQPHLSLDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the Mus81-Eme1 complex
pubmed doi rcsb
source organism Danio rerio
molecule tags Hydrolase
molecule keywords Mus81 protein
total genus 68
structure length 269
sequence length 332
ec nomenclature ec 3.1.22.-:
pdb deposition date 2008-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02732 ERCC4 ERCC4 domain
B PF02732 ERCC4 ERCC4 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.670 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2zivB02
3.40.50.10130 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2zivB01
4M6WA 2BHNA 4M6WB 4P0PA 4P0QB 4P0PB 2A1IA 1J25A 4P0QA 2JPDA 2ZIUA 2ZIWA 2BGWA 1J23A 2ZIUB 2ZIWB 1J22A 1J24A 2ZIVA 4BXOA 2M9MA 2ZIXA 2ZIVB 4BXOB 2JNWA 2ZIXB
chains in the Genus database with same CATH superfamily
3KUXA 1GZ3A 1ABBA 1T5SA 5ITZB 3ZJTA 2OCBA 4YEDA 5ITZA 3TRJA 2IZZA 4WW0A 2B6HA 4XCXA 3WISA 2O0MA 3DDWA 1ZQYA 3EXIB 4E94A 1Z8HA 5DH9A 5DP1A 2COKA 2W2VA 3ZHYA 1QO9A 4ZOAA 1ZWKA 3A4LA 3R6WA 1QPGA 2PTGA 5A06A 1P0FA 4ILEA 3DEJA 1VYVA 1E2NA 4UASA 2W8LA 3A58B 4B48A 2BZSA 2P1RA 2ZQYA 3P5BA 5FBLB 3CRXA 3L7DA 5B66U 3GH3A 4RPHA 3F2CA 1IHYA 7ICMA 1M7BA 4KXMA 2F77X 4MPPA 4IRMA 4RXUA 3VVMA 1KFJB 4D3FA 1NW5A 1QHFA 4QDUA 1KXJA 4F46A 1OI4A 3EEYA 3FGOA 4ZWNA 5KYVA 1Y5NA 2I66A 2CLEB 3I4FA 4F92B 3LYAA 4ISCA 3QUSA 4NBKA 4M9CA 4YAEA 1CULC 3FNEA 6YASA 4DF4A 1QLHA 4QT0A 2BFMA 4B0PA 4KE6A 1TEHA 3N9IA 4HAYA 3GJ6A 4BMSA 4O2AA 3KSUA 4UAJA 1HZZC 2PZLA 1KDTA 5C34B 5LUAA 1H4SA 1CUFA 2OY0A 4OYLA 2XYGA 2BCVA 1ISJA 3KZXA 2G9UA 4GI5A 1FDTA 1PGNA 1Z0KA 1JG3A 4ADSG 3F6EX 5BR8B 1BXKA 1JQ5A 3IKMB 1ZETA 3ABIA 4Q7JB 4TXJA 4Y67A 1I13A 1BWSA 5KYXB 3A6GA 4A6EA 1M72A 1FLVA 2K4IA 1FPMA 1V11B 1XNJA 1DPFA 4GW3A 1J0AA 1TNDA 2RAUA 2RJ3A 2ZG6A 5ILGA 3N2GB 5JLJA 1USVA 3NV9A 1PYOA 2AB0A 1AKVA 2IF2A 2KMLA 3IAM1 3LY5A 3QRWA 2XT9A 1XQWA 1P1KA 3VR5A 1MAVA 4F3CA 5EHNA 4DSEA 2C0CA 5DEOA 3Q88A 3R20A 3M34A 3ZZNA 4R65A 1D1QA 3CWCA 5CW2A 1D3AA 2I54A 2A19A 3K72B 2MINA 3EPPA 3M5DA 2GWSA 2FPIA 3OU6A 2NSHA 5J2TB 5TVGA 1ZRHA 2O1EA 4HB2A 4Z54A 4Y18A 1E79D 4B6OA 1Q1AA 1UZLA 1BHO1 2ZYIA 5FOVA 4MVJI 4YCCA 2R97A 2FWIA 1NVDA 1WSDA 4MS1B 4C0AC 3WKAA 2WHEA 3IIIA 1XZJA 2FNAA 4BX9A 2ZUFA 5ALLA 3QEJA 2HC9A 4HDKA 3Q7PA 4P58A 4DANA 5JJCA 1E3IA 3RB6A 4CLDA 1COKA 2XCPA 4PO1A 4HDOB 1TMYA 1Y8QB 3I45A 4XQEA 1P2GA 1EVZA 4HH4A 4ZRNA 3MUNA 3NUZA 3IC5A 3NUQA 1ZCFA 3JYNA 1EUCA 4KLGA 4G0XA 3GHHA 2OESA 4NFLA 1N6RA 2DCMA 1T2NA 3K92A 4HDSB 1E7MA 4LXIA 2PNJA 1OJ7A 5FH9A 1B23P 4WXYB 1MAUA 3ANNA 3RS5A 2JEYA 3ZX4A 2OWDA 2FB9A 3SQLA 3DMNA 1YTLA 2X19A 4C14A 4PHTA 4QTUB 4NZNA 3T4UA 4FJ0A 1H85A 2HQBA 2OL4A 2ZYHA 4XDYA 5PGMA 1AGYA 1JEDA 5FTNA 1L4EA 2O6HA 3EZGA 3OZAA 2WB1C 1U7XA 4BX0A 2YMMA 3SHFA 3ZDEA 3CN7A 4RDHA 2R8HA 1F17A 1YBMA 1C41A 4QZIA 2DPIA 4P8RA 4MCAA 4JJ7A 2G70A 1F6BA 4YFKA 1CYDA 3SE0A 1FK8A 3V4RA 3AVVA 3C14C 4Q82A 4ZEMA 2VBFA 2LPMA 1AROP 1KC1A 3V48A 2R4TA 4QW8A 5I7RA 4W5WA 1QHEA 1X40A 5JAMA 1Z9BA 4IDBA 4BCDA 2QW8A 4QYWA 1TYEB 4G1CA 5D1HA 5FHQA 5AD1A 4IHJF 1TGVA 1C81A 3PXUA 2TECE 4QYTA 1KAOA 2C4VA 4KTVE 3TBKA 3VX4A 5T57A 4QDXA 1SUDA 4AB1A 3RUPA 2IVZA 5HF8A 4YBZA 4OHUA 5C53B 1GZSA 1L3BA 4TMYA 4AX8A 1M6NA 4KX5A 5DOZA 2CFCA 4BX3A 1SIWA 4RF5A 5IBCA 1USGA 2VPYA 4JCCA 1QC5B 4ZO8A 3FPFA 1TJ3A 4LI0A 2QB0A 4WT7A 2ODAA 2HBKA 3FJYA 3A6ZA 2M2IA 4HZGA 1FYWA 3K0CC 4QQNA 1KRWA 2DRIA 2DGDA 5GTHU 1CQXA 2OVFA 4FHZA 4Z6CA 5JZ9A 1N34B 1BS2A 1WMAA 1JQKA 3G89A 5DNAA 1C3EA 2O1SA 1CR4A 1N77A 3D7KA 2GZSA 3D6MA 3SJCA 4JI6B 3ZBQA 5BVGB 4IIGA 4OP1A 3I04M 3ANMA 4DM7A 4QRDA 3BHIA 5KFEA 1N9GB 1Q1NA 2BT4A 2WJ6A 2ZIAA 3QEKA 2F67A 2XMZA 3ZTYA 2C7OA 1GITA 3I4LA 3REGA 2HK7A 2ODQA 4P4TA 1NVBA 3JAWB 1LNZA 3W8NA 1MC4A 2C99A 3T1HB 5J0OA 4JEMA 4Y2UA 2JVJA 3EVFA 3FI9A 3TUZC 5DSZA 2FE9A 3HL4A 1EFHA 1MG0A 3WKDA 2W6MA 3IUJA 1KSJA 3PFWO 4LOLA 3KYCA 2ZM6B 1E92A 4J1QA 4U8HA 1TKBA 2WJ3A 3L7LA 4WJKB 1I5EA 3VKUA 3NOOA 3ZWOA 1T5DX 2NZUG 1ZQUA 4AXXA 1YS6A 2VHZA 4B7CA 2Z5LA 1CDDA 1MDFA 3JYPA 4NC9A 2J41A 4Y6OA 3V6MA 1M7GA 3ZK8A 2DERA 1C9NA 1QIMA 4XQ0A 2A7QA 2H4XA 1JLSA 4MP8A 4AG3A 3BMXA 3G2IA 4NENB 1TDJA 1TK2A 1T2EA 4J7XA 3M5CA 5B1DA 3EFHA 5JRZA 2R751 4H6XA 4EB6B 2FUG6 4IVNA 4Q43A 5BOVA 1HA3A 5IANA 3OEHA 3OZIA 3P4XA 5EWMB 5IH7A 3AZQA 3RV3A 2EQAA 2ZRBA 1D2RA 3MQ4A 3KQWA 2QGZA 3RYHA 2JCGA 2VO1A 4WY5A 1JJIA 3KZVA 2IHKA 1I2ZA 2ZETA 3ZW9A 3DZKA 3SVTA 2GCGA 2NO6A 4HQFA 1UR5A 1MO4A 4PLHA 8LDHA 2QUAA 1Y6JA 3INRA 4PPYA 3K6JA 1M2VB 2OV6A 1FFBA 2QKYA 3ECSA 3VHQA 1PJLA 3OESA 4OK5A 3JZDA 4Z0TA 3CSDA 3DZFA 5EE0A 3GLSA 4IBOA 1GO2A 3R7WB 2PUWA 2ZI7A 1QSLA 4HKTA 3WK9A 4O5OA 3SM9A 521PA 1TAUA 2IYZA 5IARA 2H4ZA 2GK3A 2ODWA 1IZ0A 3Q12A 4XIFA 3L6BA 2QMHA 4EMTA 5A7FA 5AW4A 3U5ZB 1QCDA 1G17A 5CGQB 4Y3UA 5KINB 1J4AA 3ZW7A 1AMUA 1V25A 2GPYA 1R4AA 2J48A 2CJWA 2OCLA 4I5DA 1EM6A 1EBUA 2WWHA 4TX1A 4BNMA 2IY9A 4YRZA 1G2PA 1PJSA 4ZYXA 4YROA 4DAOA 4MV9A 4H15A 1R6DA 3MAJA 4B4VA 3QBJA 4J2TA 1E3WA 3VPSA 4FO6A 4NI5A 2P1ZA 3UG6A 4BVJA 2CV1A 4RELA 1Y1KE 5H4HA 5L1JA 2VA9A 4TLDA 4ZAYA 4CM9A 4OI2A 1U8TA 2O8DB 1LBIA 4OQLA 1PVOA 2YUTA 1ZUIA 1NG1A 2BR5A 3IQWA 1ZUNB 5EXDA 3RJ5A 1D4ZA 7YASA 5ITWA 2JJ2D 5AHKA 3A37A 2Q6LA 1RACA 3RNOA 4QGSA 4D5EA 5A9SA 1VIVA 1XTJA 4I2AA 4NE7A 5DI3B 4BY9E 2B6GA 1YR2A 3G2KA 4TT8A 4ZYZA 2PX0A 3EFBA 1DG1G 5A5DA 4GC6A 1Z82A 3KEOA 3WL7A 3RJKA 4QQRA 2F00A 3K09C 4URUR 2CXQA 1UBRS 4W5RA 1YMQA 2ZJFA 1R3DA 4BAZA 4YH1A 3B6EA 1EQAA 2ZJ5A 1L5UA 1CS0A 2YVUA 3BH7A 5DIFA 1TJYA 1BPZA 4MFCA 4X5VA 3N2LA 2ACKA 2EZ4A 3Q0IA 2VJPA 5DM60 4ZFNA 4ZT3A 2UZ4A 2AOXA 2V0NA 3NJRA 3KUDA 4TL8A 1C1XA 2W8KA 1R6VA 1QVRA 3G9ZA 5CA7A 4MIYA 4B73A 1O57A 4YRIA 5KNBH 3DAHA 4RU9A 3PQ6A 4H7FA 1E9EA 2QRQA 4UJ3A 1HRDA 5KU1A 4CNQA 3E35A 3O1LA 3DS8A 5DXJA 2IS1A 3C7DB 2XLCA 3W8DA 4M7PA 3GD7A 2NPFA 3MB8A 3UAOA 1CUDA 2ZS7A 4TQGA 2DJIA 2GB4A 3G17A 3IBFA 4MPDA 4PTZA 1PDWA 1NX6A 3CP8A 4LXTA 5IW8A 4GBGA 3TSZA 3RUCA 1DJOA 3DE6X 4WNIA 3QA9A 5HIIA 1CUHA 4EFNA 3I9LA 4KDRA 4UQGA 2W2TA 3VYRB 2BTEA 3PUYA 2VUSA 4YAKA 3CW2C 3V7LA 1A5SB 1HI9A 1WVMA 4RACA 5K0LA 3KG2A 3LW8A 4JB0A 5IT0A 5JU6A 3SXPA 3GV8B 5JPDA 1DT3A 3F0TA 3SI7A 2OV3A 3RSLA 2FHSA 3TW0A 2B2XA 3C85A 1QKIA 4MYTA 3GDWA 2QDKA 3INGA 3VR2A 2CUTA 2WU3A 4Q37A 1N8NA 3V80A 1YCFA 4BFUA 1ZGAA 2NTYC 4I2EA 3H17A 3BDAA 3Q3JB 2V7QA 4OQ4A 4PZPA 1IZYA 4MKRA 1V5FA 1QNFA 1Q16A 1MT3A 1JLMA 5B1EA 3FMVA 4RUAA 1LRKA 4PY2A 2OBLA 3IKJA 3OAAA 2LYAA 4LYAA 3A31A 3VH3A 1WF6A 2JEZA 2LIPA 3RR2A 2HHCA 1PD0A 2VHVA 3SJ7A 5LNK1 4AUMA 3UM9A 1XZCA 3O0TA 1KWKA 5IM4A 1SC9A 2I6UA 4FDMA 4OHKA 3UUFA 3G6XA 1RPJA 1CNMA 3DBLB 4R83A 1YT3A 4MKXA 4RGYA 3JQ8A 1KIMA 4OQNA 4XQ8A 4A15A 1E9VA 3I6BA 3WWEA 3ZY2A 4PZZA 4L4UA 1DAMA 5DBFA 1LLFA 3FWHA 3CGWA 1XJCA 5G0TA 3FLBA 3PVXA 1BDBA 3PX3A 1ZMBA 4GHWA 4LYGA 4X93A 4YO7A 3RAQA 1C0PA 2H0QA 1QRRA 1KY4A 2V4QA 4R64A 4KR9A 3BKWA 1PTJC 2VZ0A 3NU1A 3VFDA 5M04A 3H16A 4GWKA 4NV0A 3WS7A 3PDWA 1XLWA 1Y4UA 2ZDHA 3DEIA 2LDBA 1W4ZA 9ICQA 1S3IA 4CZ2A 3OUTA 4MAAA 1N8TA 3V8MA 2LBOA 1QFXA 5CLJA 1QIDA 1SHJA 3CRW1 3EAQA 3R6DA 2I3DA 1DGQA 2ISOA 3PU6A 3TQ1A 2EL7A 1V9SA 2PLWA 4Q18A 2X4GA 3RH0A 4DA7A 4TUYA 3ZUPA 1YJCA 3LWDA 3Q2OA 3P32A 3G9TA 5DTRA 1RXWA 1RYBA 1XHLA 2QR3A 2VTEA 4KH1A 4Z3KA 1F12A 3TFQA 1PS9A 1LA2A 2JK1A 4HSEA 5EJ6A 2QR2A 4MK4A 4W1RA 4ZDJA 5CRXA 2BEWB 1M2EA 1ZRMA 3A0BU 3A6FA 1ZY2A 2DC1A 3WIDA 4D3DA 3U7FB 3V6JA 4NDZA 4BB0A 1QCYA 3D1LA 2Q0QA 4YMGA 1JYSA 2PZ8A 1QYRA 1D5WA 1R0LA 2EZ8A 3OY7A 4FGUA 3JQ9A 4L73A 2QAGC 2AXTU 1GD1O 2E4XA 2JIOA 2V58A 4FHFA 2IEGA 2C5AA 3C5VA 3R7LA 3N70A 1XE3A 3FMPB 4G67A 5DJ5A 4AU1A 1ZLXA 3EYAA 4TTSA 5E6SB 2RKWA 5ECDA 3RS9A 1JEAA 4BUZA 4R98A 3UF0A 1KBQA 3GIJA 2FDRA 1IYZA 4ARBA 5B7GA 1P0IA 4YRGA 4R66A 3LO5A 1E1KA 4F50A 4KN9S 3TG2A 2R3SA 4L0QA 2PT9A 5KDDA 1G8JA 4N49A 3WOVA 1IN6A 3FNQA 4ED7A 2JLVA 1DZIA 4YQWA 3F4LA 1ML3A 3IJEB 2HREA 3OZWA 5F9MA 2Q5QA 7ICVA 2FTKE 3F5QA 4R2LA 2G7MC 3ETGA 3K1RB 2AFIA 4FFWA 2O57A 3C7KA 4F85A 1AK1A 3C48A 3B1WA 1G1AA 2OBXA 3KXLA 1ZGHA 2XX3A 2P2LA 1V7QA 2ASVA 2O3QA 2QM3A 3BB1A 5LXTA 1DOHA 4WZBE 1OHHD 2ZSJA 4I9FA 3PHJA 3V7JA 1CUUA 1DSSG 5AIAA 2Q5FA 2TSYB 1XXHB 3HFGA 4BNDA 5B4VA 2R48A 1VLHA 3E9RA 5IDXA 1JVNA 4I46A 1R4NB 3LQYA 4NP6A 3QYFA 4N18A 5BQOA 3AP3A 4WLOA 5D5QA 1XVIA 4C0ZA 1KGDA 3IBCA 4MGIR 3RQIA 1CF4A 5A3JA 2BAGA 1U0FA 2Z58A 3DDNA 3FOAA 3SKYA 4F4IA 1N0IA 2E49A 3GB9A 4D6PA 1S97A 2QMEA 4MKGA 2C92A 1L4NA 2ADFA 3NBMA 3OU2A 2OK8A 4KYVA 1Z5WA 4BP9A 1MEOA 3RVNA 2WG1A 4EGAA 4Z7NB 3IAUA 4XWOA 1YE5A 1LNQA 1ECCA 4QIWF 1LTKA 1VE3A 2J6BA 1ZL0A 4NMMA 1KRPA 1T6YA 4TQUS 3GI1A 1COWA 5EXTA 3SX2A 4KFCA 3UJ8A 2QVLA 4UNSA 3MBYA 1UEIA 3IERA 1RABA 3KKOA 5GPBA 3NTUA 2VHWA 4L8YA 3PQCA 1UBEA 4PPXA 1L5OA 3DTVB 2XWQA 3LJKA 4N3AA 1QF9A 4Y9SA 3UHFA 5IRCD 4MI9A 1GR0A 1H2HA 4GSLA 2KOBA 4ZO9A 3IJ5A 2AMJA 4BJ5A 4NZ9A 4KFTA 2FVXA 3AF1A 4KVFA 5TX7A 1NQAO 2HVIA 1TUEA 2CNDA 2XHZA 4UD2A 3WL4A 1J07A 2C5GA 3I8SA 1VSVA 1CQIA 1EFKA 3HKDB 5GTIU 1PNRA 1CUIA 5AKXA 4G5QA 4FYWA 2QRLA 3DE4X 1GL7A 2Y27A 4CU5A 1AO0A 1JMKC 4FT4A 2CN1A 2G1KA 2P90A 3IUNA 3K0AA 4NBLA 2FXIA 1SWWA 4UB1A 3KPYA 3LPNA 1I9GA 4MO2A 1UKVY 1W5TA 3W2IA 3W2TA 5FNVF 3SE7A 1PR1A 4R16A 5IKOA 2A1IA 2YV1A 5LA6B 5KFAA 2XYPA 1GTSA 3PFGA 1NY6A 3W3AA 2DUWA 3B1KA 1T1GA 4NJEA 2IEDA 2OD7A 3T94A 4ZJYA 1E1DA 1TZMA 5LQAA 1Z88A 1CUYA 2ZAGA 4LYJA 4BRWA 4MW6A 4JLPA 3FGPA 3K1TA 3LXXA 3NHAA 5LP6C 4EG4A 5CVTA 3UK7A 1A72A 4G65A 4MVJP 1CF9A 1DKNA 4PV7A 4NBVA 1CTQA 5JFTA 5BVHB 5E4FA 4I9GA 4MX8A 2Q3MA 4G0PA 4L02A 1Q2UA 3MT0A 3P5SA 3DDSA 1SOAA 2O3JA 3SDBA 1K2VN 1NUHA 3HVUA 2UVPA 1E3TA 4LRWA 3H5VA 4QT4A 4YAGA 5L3SB 3SM3A 3LFUA 4F7WA 5KOJB 2O2JA 4NQZA 4RQBA 3IESA 3BQNB 1Q3HA 2FFAA 4FEAA 1ST2A 1WB5A 5F1KA 2PE5A 2P6NA 4P92A 3C3EA 2XNSA 4HQKA 1DG9A 5HMLA 1NKBA 2JPDA 3RSQA 1L5KA 1UOPA 4BNHA 4ND6A 1KYWA 3BMNA 3MMXA 3VH2A 5HIAA 3D8TA 4I9UA 3BMNB 2WT4A 4I3FA 4MV7A 4N3BA 3NBUA 2GXUA 2J0UB 5AR1A 1NFRA 1GT91 3GK3A 4NKRA 1WCXA 2R2AA 4O2AF 5DEIA 3OZXA 4MW7A 3ZE0B 3F46A 2FMXA 3CCCA 3Q5GA 1ZAYA 1RYSA 3DOUA 3UXHA 1M0EA 4DSAA 3RCBA 2FX5A 2PUGA 1E62A 4J6EA 4WEQA 1P0QA 1A76A 4KWEA 4MJLA 5J8YC 4N5LA 4G6ZA 3REQA 1XAGA 3HWRA 3CA8A 2ZCUA 4K3VA 1OXJA 3KT6A 4K8RB 1DCFA 1VE6A 4KLSA 2A9QA 3K9FC 2ES6A 2Z8ZA 3EQ2A 1GV1A 1H2YA 1ZUHA 3DZCA 1X3SA 3UMCA 4XA5A 3KQYA 2I1LA 4ZALA 3KJZA 3U6BA 3Q9SA 1HZJA 2CLLB 2SKEA 1K9VF 4A8EA 2WSSA 2OM2A 4LY9A 5FA6A 1E99A 2O3UA 1PK1A 4KBGA 1PSDA 4QYSA 1CC1S 4DIBA 1G8YA 4JQCA 1FFCA 2Q0ZX 3RC8A 5F64A 4BE7B 4DSTA 2P4EA 1D4FA 1WUTA 1NURA 3GO4A 3KYDA 4K9KA 2CNNA 3TRKA 3VV3A 2P68A 4CGYA 3KV3O 3VZCA 3WHIA 1VIMA 2BFCA 2QYHA 1PFQA 5CDGA 1TM2A 2VK2A 3O4VA 3GAFA 3AM9A 2D1RA 3DT6A 3ILXA 4NBUA 3T1VA 3TZCA 5JO0A 3JATA 1KPHA 1SVKA 1D1SA 3P94A 4DPMA 5TB5A 1MFPA 4V0KA 1GFZA 3ZE6A 3RC3A 4HQRA 2ZUUA 3PL5A 5AK4A 1IBMB 9ICRA 1QDLB 5ALRA 1RPNA 4JGGA 4ZOCA 1SXQA 4IICA 4M2LA 5CIWA 5TQ0B 1V3QE 2PZGA 1U0GA 2Z2ZA 3HVKA 2HMTA 5EIBD 2BKEA 2R87A 4HNGA 5TEVA 3U7IA 1Z5GA 3UCEA 1KTQA 1V8OA 4WERA 4F4CA 3WTCA 4WL0A 2EZZA 2CXHA 2D5LA 3RT7A 3JASA 1FMJA 1UAYA 1NLUA 1PRYA 3TIVA 5ERGB 1TW2A 4EY8A 3DMFA 3WAGA 1NR1A 3AI7A 4OX9Y 5DM4A 4A0HA 1XMQB 1P4HA 4G41A 1RM6C 1G8KA 3WBJA 4CKBB 5KJFA 2ODBA 1XNQB 5CYFA 1GRVA 2WMYA 3IAM6 4LZAA 4MULA 2RB5A 4XM2A 4GO1A 4EEZA 1NBMA 3S2FA 1OXBB 1X2IA 3VGJA 2RD2A 3GFVA 4ZRDA 1W48A 1IBRA 4H31A 4HAOA 4QLAA 3SVLA 1NRIA 3KVRA 1D6NA 2WWXA 3OE7A 1R0WA 3THRA 2VYNA 4NEQA 1E6CA 5F9FA 2BHLA 2WR8A 3HU1A 3W6UA 3UGJA 1IQUA 2YY7A 5J0QA 4EYOA 2PFNA 2C82A 2CDRA 4NU6A 1ZCBA 4IQTA 3O4GA 4B2PA 3VH4A 4A73A 5AW7A 5F4BA 5HBRA 2AXPA 5A0FA 3QKSA 4PE5B 1PEYA 4JQYA 4KW7A 3OCXA 2KJ5A 3K6SB 3WO0A 2XUPA 4EYQA 4BC0A 3AZPA 5D3MA 1E2MA 2PM8A 2HJGA 1YHNA 2ECOA 1NC1A 3MBOA 2Q3LA 7REQA 3KYIB 4DLLA 4XFKA 2RSLA 1XTVA 1LX6A 1E4EB 1TKRA 7ICTA 2B3DA 1CHNA 2G17A 1ADGA 1BGVA 3PNBA 3Q72A 5FBWB 3N3BC 3HN7A 4E70A 1JHVA 5IKEA 3NVAA 3EUB2 5U4QA 5I8PA 2CMKA 3PQEA 3RS8A 1WKCA 1PU2A 1YOBA 3KZKA 1UKBA 1U9LA 1PI3A 2WC1A 4AZ3B 1X80A 1YQDA 2OKCA 4K4IA 4NBRA 1C3JA 4I1SA 2GBLC 3EARA 3KHLA 2KIVA 1ZYQA 1HGXA 2KE5A 5TVKA 1RM5A 2AS0A 5TARA 4LX8A 1FS5A 2RIPA 2NOAA 1HPLA 1TAHA 4OP3A 3YASA 2UXCB 2IVFA 1YS7A 1EE2A 3KSRA 3HJHA 4KE8A 5LYYA 3ZVNA 3E1KA 4D8YA 1T5HX 2I6FA 4UHKA 3RJIA 2ZP1A 4UBMA 4P7FA 2FLKA 3N6XA 2JGJA 4MWZA 1SKSA 1RXUA 2I2DA 4N9WA 3W79A 4CCYA 4IFBA 4IEEA 3FTQA 2XMBA 4G01B 2E8OA 1CWUA 4MO9A 5NLLA 2WICA 1E64A 1F6DA 1P0MA 4K9OA 4YAFA 1I9CA 3OO1A 8ICFA 4HWKA 2AMYA 1K5PA 1QRDA 1C4WA 4CI0B 2VA8A 1V26A 1U1DA 2GF9A 3IV6A 4MOWA 2DCUA 1SR8A 4GE3A 4HZUA 3WKCA 4P80A 2DYKA 1NY5A 4XQGA 2XOKD 4LI3X 4ZD6A 4EPVA 3WHPA 1KGSA 3DTNA 3KSAC 2O8EB 5E1BA 1ZH8A 1ENYA 2O2XA 4D80A 3B1JA 2ZRAA 4GNKA 1PVRA 3D3JA 4QOSA 1L7MA 1UEJA 1NXVA 2RK4A 4K3UA 3HGQA 1NJ1A 1ZXIA 3NCTA 4PQGA 2KN7A 3EUWA 4G1VA 2QPOA 3MJVA 4MVJG 3MC1A 4INJA 3OTQA 4PPFA 4CM8B 2XZDA 2K6GA 5EJFA 2G40A 4ZIRB 3TADA 1Y6GA 1OQAA 2QJRA 5KSPA 3R74A 2QAGA 3GUVA 3F97A 2DBVO 4J16C 4IDAA 3D0RA 5B1IA 1F51E 4JP5A 3A6PC 2IEIA 5FL3A 3UAZA 5B2EA 4FGJA 4ZO4A 2C2ZA 3EC7A 2WNHA 4FFDA 3HYTA 2Q7XA 1KR5A 3G8BA 3LFTA 3FVRA 2WAMA 3TOCA 1UXHA 3DQQA 3HGMA 4GOLD 3O74A 3ID6C 3KYJB 2XUDA 2NGRA 2YL2A 2ZJYA 2ZYSA 3DUWA 3E3OA 2VXCA 1SIOA 4D9MA 1B0UA 2QZJA 3PPXA 4AMZA 1L5QA 2W3RA 5CFNA 5I3ZA 2O7QA 2XCSB 1HNNA 2JARA 4JIMA 4MW0A 3GV7B 1OXXK 3HEAA 1WEKA 3VUFA 1X1QA 2XDAA 4KO8A 3TZEA 4EA9A 3L7BA 5K4AA 4BQSA 1LC0A 1UK8A 4BQFA 2Q3EA 1J7KA 1M74A 3GFOA 3K75D 4RENA 2LCIA 5DQIA 1TYCA 1DBQA 3H8SA 2A59A 2H85A 4LZOA 1L7DA 1MENA 1YC5A 1PNTA 1QE0A 2LWIA 2P3OA 4FYMA 4DA4A 3I01M 5CFRA 4E1AA 1U9JA 3TI7A 4DC1A 3IQHX 4JR0A 3EUFA 1YB6A 1NRWA 2Y2VA 4X90A 1MX3A 1MC1A 2FN7A 2PYZA 2WKQA 1I7DA 1OYVA 4JSYA 2FZKA 4DM4A 5IG2A 1ULAA 2FMFA 3WIBA 3GFPA 3S2UA 2DECA 3FKQA 1B6GA 1JP7A 3H7IA 1XD8A 3L6EA 4DQ0A 1OR8A 3WJ1A 1YZFA 3EZ5A 1GYRA 5F2EA 4KN4A 5FT9A 4AJIA 3U19A 5J0UA 1Z3CA 4J3JA 5SZIA 2OCAA 3IB6A 2RHLA 4QZHA 4KQGA 4QIHA 3I53A 4MV4A 4NTZA 4BVBA 4HDSA 5IBQA 4F12A 2OFFA 1XVLA 3PHLA 3GZJA 3QV1A 2C00A 3T95A 1I4TD 1FLAA 1BDMA 1RJEA 1ZQ9A 3G3EA 2IDKA 3EXEA 4QSHA 3O7MA 3QX9A 3A6HA 3RJFA 1V3TA 2QL7A 3H86A 4UEOA 1NQ5A 3QOFA 5K2OA 3NBKA 4M9XA 2EQ5A 2X41A 3PEWA 4I2JA 3F7NA 4S1WA 3LUBA 3ZLUA 5DGAA 2HNKA 3PNKA 2YXDA 1NN5A 4K9PA 1OIWA 5K0EA 2R62A 4MUMA 4BO2A 1BAPA 2HHVA 1T2CA 2OGTA 3D8HA 2YMQA 1RBQA 2P3QA 4KACA 4ZT7A 3UWPA 1IM5A 1PVQA 1R0SA 1WKVA 1ZSYA 2VF5X 2FPGA 3C8DA 3IURA 4XIJA 4ZTBA 5CJ7A 3N3AC 3RBZA 4YHHB 1IBCA 5JARA 5KDOA 2R79A 3CB2A 1W93A 5CK5A 4CKCB 3W3AH 4ROSA 5EJ5A 3P0FA 4FZNA 4P0PB 3IDSA 2W43A 4BUCA 3WBKA 4ZHQF 3QTTA 3WJAA 1X19A 1F0YA 4WX2B 3V32A 3HB1A 3Q8LA 4JIGA 4JT2A 4ZQEA 2XPCA 5FOUA 3UG7A 1MABA 5FBHA 1S0UA 3I83A 2HMAA 3ZD9A 2CLCX 1N5LA 2IJGX 4EJFA 4B71A 4DV3B 4L4YA 4XQ9A 2O2EA 3BQ1A 4O5KA 1GPWB 1Z0UA 2HLPA 2HW8A 2DWCA 1ZQIA 3VR6H 1ZQOA 2PKRA 3DBLA 3KJEA 1JXAA 1MNQA 5JRTA 1MOZA 2PZAA 4JLMA 4ZQBA 3HV0A 2E8PA 5E2IA 3S2EA 3AYXB 4ED9A 2DR0A 1V35A 2QB0B 1ZAKA 4NQRA 3LDAA 3I01A 2JI9A 3O8QA 4EF6A 5AW3A 4PGYA 1YQTA 1ZLYA 1W5SA 3ZVMA 1KDRA 2DOKA 3R4CA 4FCVA 5AVVA 4YV7A 1O0BA 1E2IA 1VFPA 5BV0A 1IOZA 1Z0SA 4LVSA 2WKWA 5D86A 1KZHA 2QJTA 3HA5A 4FZRA 3N4MB 4EHIA 3C8ZA 2BJHA 4JI8B 1YJXA 3ICOA 3ZH9B 1KBZA 1LDMA 5KJEA 3TAHA 2HCFA 3ZCXA 1DDOA 2I67A 5LWHA 3SC2A 2NRVA 5J3JA 4HAUA 4J3NA 4XAQA 1SC3A 3MGIA 3SVZA 2JEGA 1BFUA 1P1BA 3V9PA 1E0JA 4DNXA 5A1JA 4KG7A 4P93A 1J90A 2AFHA 3DVLA 4LJ9A 3COVA 4LE1A 3HUTA 4M46A 9LDBA 4U9UA 5K51A 2HJSA 5FLEX 4BLSA 1HQDA 2E1FA 2WMOB 2YJ5A 3W4KA 5JD4A 2FJ0A 2F62A 1KEPA 3GRUA 5A6VA 4Z53A 4D0GA 3H5AA 1XTUA 2BBOA 2H2GA 1ZH0A 3IVRA 4PYLA 1MC5A 2OFOA 5H80A 4CCAA 5K45A 2X1HA 4Z6KA 2YV3A 1PJCA 1XN1A 4PGAA 3R4VA 4ZPJA 3A1DA 2PR7A 3I9JA 4A2CA 5DGDA 2G8LA 4EB8A 3T35A 1QH0A 3EXG1 1JB1A 5EWMA 1IEWA 1SBQA 2XUJA 1LBSA 1BH6A 1UPTA 2C4NA 3DT9A 3CHYA 3HYCA 4WUTA 1UKCA 1B26A 4JR1A 2CLSA 4GDFA 2AWNA 2HW3A 1P4SA 1XDDA 2JI8A 2VK1A 4QLOA 1HE5A 1QFJA 4EBCA 4WESB 3KAJA 3URKA 3GLIE 2F55A 1KF0A 3I23A 2C9CA 1KI6A 2Y05A 2NLOA 4DBLE 3B36A 1PL6A 3AXSA 3BQ9A 3ESXA 3QE2A 2N9UA 1X7XB 2IW1A 3GLQA 4MS3B 1QH1B 3G6VA 2DBZA 3CE9A 5JV5A 5C4IA 1T5IA 3FSGA 4FCCA 3UJNA 1PL8A 2QYTA 4JI3B 1ZXXA 2CEKA 5LQDA 2IDMA 4K6HA 2QQFA 4P34A 4JX8A 4YMVA 1TVKA 2AI3A 3ICVA 2HY7A 1TUBA 3B6IA 1UJ2A 4UU7A 2KTQA 5LU8A 3BHMA 1TXGA 3QYPA 1UEXC 2BCEA 4JHXA 4RF2A 3V4LA 5CFQA 4JMLA 2D3TA 4JUBA 5ALPA 4MS4B 4UU1A 5ELXA 1NULA 3VM6A 4KUEA 1DEKA 4DW8A 3PXDA 4Y2TA 1XFAA 2I4LA 1FX0B 1W73A 3M4XA 4EJ6A 4F5ZA 5EHQA 5HKKD 1MPXA 4EJ2A 5GINE 4CUJA 1Y7IA 4UNIA 1E1RD 1IM2A 3TLBA 9ICXA 4TMFA 5FFFA 4OXKA 3C3KA 4RZ2A 4ECQA 2E5SA 3PSFA 1GEEA 4FONA 3DCIA 3SBXA 3DDOA 1HDYA 2G0TA 1FYDA 3A6JA 2JGRA 2FW0A 4HG2A 1E58A 1YR9A 4JLBA 4EB0A 3E8XA 4G5SA 2VRCA 1SOMA 3E0XA 2ZE5A 1BMFA 1TJ5A 3H9QA 4JK1A 3C74A 3KWJA 1D9DA 4KJXA 5IAJA 4M76B 3TVDA 3ICPA 4FOTA 4H4EA 4C0SA 3NHYA 1NTRA 4P3YA 1Y37A 3A6KA 3HYRA 3BGDA 1XZKA 2D0DA 1RJ9A 3D02A 3M3PA 2JCXA 5LLSA 5CAEB 3ROPA 4E15A 4AP9A 4HVCA 1CIPA 3F2IA 1RJ9B 3KJGA 4M0FA 9ATCA 5KSWB 1MF7A 2Z6UA 1OXUA 1R37A 3ZR4B 5KSOA 3OOJA 1SUWA 5IJAA 4AW9A 5BMOA 1A8IA 4J1TC 2H3IA 1XZPA 1H4TA 4ZTZB 2G25A 2V98A 2YCBA 2DB3A 1LF0A 3P9IA 1UHUA 4PLYA 4WN9A 3QKWA 2YVKA 3C1UA 2VCEA 2XJ9A 4FB4A 5BQXA 4YJ2A 4Q1AA 4BLOA 5LSAA 1IXRC 5KT7A 3T5BA 3L01A 2VANA 5HX7A 3WQHA 3JAWA 3UQYS 3S2SA 5AXDA 2WSSD 1T1SA 4F0JA 4HDNB 5IMSA 4FUQA 5JEEA 1F7UA 4KVAA 3GX1A 1QMPA 3C2KA 1EFTA 2KSOB 4D0NA 1WXDA 5A5EA 5KSYA 2ZBQA 4J9VA 3UTCA 4BHTA 3U7JA 1TK5A 3NHPA 4PHHA 4HHEA 3FFXA 5IWCA 2FRXA 3BZUA 5T3UA 1OKKD 3PNSA 4NOJA 5LN1A 2YXLA 1ILEA 1ANKA 2CNKA 2G6TA 1PWZA 3MA0A 1K4MA 2MSEB 1Z00A 3EQ7A 2B25A 2R6HA 1WG8A 3D2SA 1TB4A 2Q4OA 2EQYA 2Z4SA 4M83A 4O8ZA 3RFUA 3WSVA 3CX8A 4P0QA 3EXIA 1N1DA 4Q3CA 4GH5A 2HK6A 2P2DA 2H1HA 1G5TA 4Z4FA 1TFRA 3IAXA 3RTBA 1CRXA 3TPZA 1KYZA 1JG1A 1T15A 4ACAA 3AXTA 3C6KA 2VT2A 4C20A 2C77A 5J4KA 1T4CA 5K3EA 3PSPA 1QTMA 1OPRA 2BMWA 3RYHB 1OF1A 2IITA 2UU9B 1G7RA 2EZTA 5FUBA 3AFNA 3B78A 4FCWA 4D9BA 3OJOA 5BSTA 1T7PA 3D5QA 3KVVA 4IHAA 4C87A 1X7YB 3F7OA 2ZRLA 2ZS9A 2GUGA 3BGWA 5D7BA 1OB2A 1YT5A 3MJRA 3TEJA 3CSUA 4YCNA 3RRMA 1WNFA 1W34A 5IT9A 1T2FA 3BE4A 3L6RA 1YSCA 4LJKA 1YI0A 1TPYA 3BXZA 4KRYA 4KQCA 1L9KA 2XF2A 4MWDA 4R4JA 2KHQA 2BISA 4DS5A 3H13A 5HBGA 4CU2A 2RDMA 1K7SN 2AN4A 3SZ2A 4RY8A 2OP1A 4YAWA 3I1FA 2NPIA 2QX6A 2VF8A 3FLAA 3OT4A 2EWMA 5HQJA 4POOA 1GTZA 1L5RA 4YRDA 3AINA 4YMLA 2UZ1B 4X66B 3QU4A 4YT4A 2QX8A 2P9HA 4TKVA 3KIPA 1YULA 4OSEA 2ORED 1A5AB 2O23A 2V3WA 3FFTA 2VH2A 4UUBA 5DFAA 1DEHA 3A28A 3C7CB 4JN6B 1HE1C 4R1NA 1I94B 4W5NA 5ENVA 3IPCA 3VSDA 3ZV3A 4RVGA 3OZEA 2H48A 2E1RA 4KRXA 1M0TA 3KUCA 3KOMA 2Q1SA 2PK3A 3CX6A 2ZRGA 4OFBA 3FBTA 4DBLC 4QG3A 2F3RA 4R2KA 1NLMA 2NSJA 2Y6VA 2JAWA 4IRUB 3IP4B 3KAKA 2E8MA 4BAUA 1CY0A 3AW9A 5E9AA 1HE8B 4BNIA 3SX4A 2G5TA 5K7SA 9MHTA 3D7NA 4BFSA 1IXRA 1UM9A 3DOCA 4IIVA 5CNMA 2H7XA 3ORQA 4L75A 2HJ9A 4DMHA 1HURA 1IHUA 4C4ZA 2ATLA 1ZQ1C 2GHIA 2LMRA 2O2DA 3DC7A 4C3UA 4PCAA 5ALEA 4H0NA 5CB8A 4O3MA 3TJMA 2Q99A 1QRTA 1YOVA 4P5EA 3ISDA 4QBTA 4BVKA 2IS4A 3IV9A 4X8LA 2NQ2C 4HK4A 5DLFA 3B6MA 2Z6VA 2AD1A 2GBIA 3AERB 1TO2E 4AJLA 4CL3A 3VU8A 2D7DA 4L5YA 2VDPB 1C3VA 3TTUA 2VS1A 2OHXA 2QTFA 1KYIA 3HC7A 1SHKA 3OKAA 1GGFA 1XVUA 3E9ZA 5DNDA 1USUA 5CEHA 3PEEA 1LH0A 4BZWA 4RFSB 4PW0A 1JRPA 4C4SA 5EEGA 3MYRA 3VU0A 3F6SA 5JYCA 3RVMA 4YDSA 4QW9A 2X86A 1W88B 3PXGA 4ERNA 3EG9A 3GEBA 1Y1RA 2VJ5A 1F0MA 2CDAA 3U4IA 2MJLA 1ZJ6A 3STYA 3ZU5A 2Y1XA 3OCJA 4F4WA 3WJ7A 4EUNA 4F5YA 2BHRA 3B5EA 2VPIA 2WJ4A 2WUWE 1Z4QA 3LYHA 1I1QB 4P2HA 1IN4A 3BORA 4KMOB 4DSOA 4PN3A 1BVSA 3BWEA 1JMVA 3MMZA 4DQRA 9ICOA 3H40A 2VDVE 4K88A 4YV1A 3JRNA 2NVBA 1JIIA 4BBPA 1AUXA 5EWLB 4GDMA 1WD7A 5L7YA 4BZQA 2QTBA 3FYTA 1E5VA 3MNFA 3R3XA 1XSEA 2BFPA 5IM5A 4OFXA 1O3YA 1U0HC 3LDUA 5TNXA 4D44A 1V8PA 1FP6A 1T3TA 1U65A 4MVJD 3GJ5A 4EZ6A 1M6HA 2VSQA 3DJFA 3GVPA 4PC7A 3HSSA 4J0FA 5JG7A 2EBWA 2G9RA 3DO8A 4L22A 4O1MA 2OV1A 1FO4A 3P1JA 3HKEB 3UTDA 3VSEA 1X6IA 5C3MA 4RMIA 5IJWA 5L51A 1LVGA 1UANA 4CLRB 3U4QA 4CEJB 1G5FA 5AXAA 4DCOA 2FPWA 2ZXIA 3ANSA 3NOQA 2H57A 1PLLA 2Y1KA 2LTAA 1YVRA 3OLVA 3QOYA 5AM4A 2NO9A 5E4TA 2OCYC 1T5TA 2JZBB 1SVOA 4XLZA 1H2RS 4QXPA 1XYVA 1IXZA 4PG4A 4RX1A 3UNXA 4AC9A 1WW8A 4MGZR 3CNHA 3RT1A 3RUFA 4DGSA 3FUUA 4I2CA 3ZNOA 3ADCA 4WLFA 4IDHA 2FQXA 3KT8A 5KG0A 5KIAA 2I8LA 4O0IA 1M2HA 1W9HA 3FI0A 1C20A 1NYTA 4EHBA 1Z17A 4G1MB 4RY2A 1N4AA 6AT1A 4US9A 5AKLA 1VHDA 4UVHA 4L6CA 3LKBA 1I24A 4PYMA 3UWKA 3DWEX 4EBEA 3HQ4O 4P3PA 2FFQA 3QZ7A 1P0PA 2JIDA 4KFSA 2M32A 3TLCA 1FNBA 2O14A 3P2OA 4UVIA 4ZI5A 3VU1A 2ZRCA 5FUYA 3LYSA 3IEMA 1OBHA 2P62A 1B6SA 2X6TA 3DE1X 2GTHA 1EGVB 3KB8A 4YR2A 3E22A 3BPSA 1L8LA 4PZAA 5IF3A 3W5UA 2G71A 5L7TA 3QWFA 1N2EA 3EDYA 4O4JA 1WSAA 1CQWA 2E0IA 4EQ6A 1L7AA 2JHGA 3F6RA 3EB9A 4QPCA 3TW8A 4ND4A 1XHFA 4NJEB 1PGQA 2X4LA 1REQA 3CUEF 4NMHA 2M0NA 2VNSA 3L0YA 2FMKA 1Z0AA 2C3OA 4RVNA 1K8YB 3RC2A 3V8NA 2CXPA 3NIDB 4MIEA 1NLFA 3QYJA 1B14A 2AFHE 2MOKA 3G0BA 4JBIA 1HNZB 5HG0A 4I0WB 5EIWA 1FFVA 4C0KA 4RTRA 1L1EA 3DAPA 3VI4B 3JQAB 5K0SA 4PFSA 4L85A 3KJIA 4AZTA 4LDQA 4BRUA 4LAFA 4QARA 2X9LA 1XQ9A 1YGYA 4NK5A 1YQXA 3L05A 4URHA 3V1KA 5IX8A 1RI5A 3HFJA 4L51A 1V6AA 3STXA 2UYCA 4A4DA 2R5WA 1IEXA 2XAUA 4LISA 4NCHA 3KJNA 1GV0A 1KYTA 4TTAA 3PGLA 3KKAC 2WTBA 3E5RA 3DVQX 3F5SA 4NHOA 3R7WA 4MB0A 1NNI1 4H9GA 1GUYA 4YONB 2YOGA 1T8EA 1I3CA 4U6QA 4DEYA 4MW2A 4DCNA 4WHMA 3W4IA 4AF8A 4E2FA 1I32A 3BJRA 1AH2A 4DA6A 1YMUA 4M98A 1DIHA 5CUQA 1SN7A 1SXEA 2VDMB 3LCRA 3HP6A 4FZVA 4H7JA 5TEWA 2H1FA 4QXQA 3H8MA 1SG9A 4OA5A 3GPDG 3TLGA 4GI2A 3IP1A 5H9VA 3KZMA 4J4TA 4D43A 1TU3A 2CLDX 4RH1A 4RNMA 2Q5OA 2P65A 1VKOA 4CR8A 3G49A 3K2EA 5AKYA 2QVZX 3U4HA 4AWAA 1NWHA 5KOYA 2ATCA 2W2OA 2ATIA 2YB1A 1JJAA 3EZYA 2AIRA 3R77A 5FUVA 5JAUA 2V8BA 1AKMA 2IMWP 3E6AA 3IAHA 1XCOA 5JQGF 2QQ5A 4EF5A 4KLIA 1C7YA 3AUOA 5FWDA 2NVOA 1ZH2A 4AY4A 3WLEA 4CRWB 5GIPE 1WV0A 2HHWA 4J16A 1P5JA 1Q50A 5EZ6B 4KQJA 1GPBA 4LVCA 3VGPA 3DV9A 3DZBA 3EA0A 3MGVA 3M9WA 4JLKA 1VB3A 2FPPB 5ALHA 1KLNA 2JBAB 3EWIA 3T9CA 1OY1A 3ONFA 4GSKA 4EFLA 1T4BA 1O8CA 2EG9A 2H59A 1OV6A 2G1AA 1N5KA 1ZJ4A 1Z6GA 1NAIA 2J3HA 3CNQS 2AOTB 4H77A 2G5IB 4M4SA 3QMMA 1M6YA 2HX1A 5LBUA 3SFTA 3G7SA 2OXCA 3KFLA 2KK0A 3FUXA 3RTEA 2NV2B 5LUBA 2KE7A 4DQLA 4Q6BA 1K89A 4NG4A 1KERA 3QUQA 1QGED 3E03A 3GIDA 1DI0A 4X3PA 6LDHA 4I6EA 1AKRA 1C1XB 2PKCA 4FMCF 2VTDA 1Y7PA 3V8VA 5KO2A 3ABSB 4N47A 5JW6A 3B3FA 2HH9A 3EQ6A 1XMPA 4P98A 1XQVA 5JSZB 3L0DA 4G2TA 3UWSA 4BEVA 4JC4A 2Z4TA 4I7EA 2Q29A 5K05A 4F5DA 1XRMA 3U60B 1DXOA 4MV8A 4EABA 3LCCA 1Y6RA 3IL2A 4BMCA 1N25A 5JS2A 3MAGA 4F4JA 4H16A 2JXJA 2OZPA 3TECE 5FAXA 4P2BA 4KXVA 3ENQA 1HDXA 2ONJA 3H19A 3RHZA 5EQDA 5FKJA 5E2AA 3DLAA 1CRLA 2NYRA 3NM5A 1TQHA 3JASB 3LOUA 4BMXA 3ICXA 2HBJA 1ZQCA 4DUGA 4P84A 1P8AA 4NOKA 3EMKA 3H3JA 4X1IA 3NHZA 3PQ2A 4QU5A 4JXXA 4ZHSA 1N6LA 3QLTA 3N58A 1SGGA 1XZBA 3EN0A 2QLNA 3I0NA 3QMVA 3RK0A 1CJKC 3MCWA 1HF3A 1KTVA 4HLQB 3RFCA 4EVIA 5IYZA 2OYSA 4BO0A 4E32A 1Z7YA 2XMGA 5D2CA 4XOUA 1JW9B 2X0EA 5KU7A 4CMBA 2F59A 2GUWA 1JR4A 3RFVA 4ER6A 3LC7O 3G2QA 3FUWA 2QB1A 1UK6A 3KSBC 3BS5A 1YNOA 3GXBA 4G36A 7ICGA 4OQEA 3B2EA 4HV4A 2VP9A 4F1KA 2FPRA 4KLTA 1ECLA 2HF8A 2HSEA 5DHPA 1G291 5J0PA 4NXZA 1CIVA 1XTZA 3COYA 1P6QA 4HJXA 4EKGA 4K1LA 1KAHA 5CXXA 2PSHA 2P4HX 4EELA 4Q7QA 4UMFA 2FUKA 1OW3B 3DEHA 3P2IA 2VG8A 4Z49A 1J1IA 3C8MA 3LBIA 1M8JA 5FBKA 1CEXA 1TPZA 1EDOA 3EZFA 3I62A 1ISIA 3HM2A 1C7IA 5GGYA 2PKXA 4R3NA 1W0JD 4ZOQI 1T0JB 2VEOA 1D0SA 3KR2A 3LXUX 4LOJA 1VJRA 2R6AA 2XCLA 4QDZA 3SR4A 1U2TA 4M0DA 1F2TB 1KOFA 1BCRB 4RULA 3QE3A 1PR4A 1L7BA 3P4UA 2ZB3A 3KPJA 1HJPA 3G5UA 4TGLA 3PTLA 1DAPA 3HPRA 1QVAA 2V4RA 1GPH1 2FPOA 4X24A 3W6NA 1SGWA 4Q44A 1SKWA 1ONSA 2PFSA 2YC2C 1ODCA 1QGZA 1SIBE 3HN2A 3RV4A 5K6TA 3JW8A 3VZRA 3TAQA 3VR1A 4YUAA 1KJNA 4B7AA 4OKSA 4WXHA 1E5XA 2Z56A 4NIMA 1S1MA 4C6TB 4W7IA 1XQ1A 2P6PA 4CWAA 2OLEA 3NNSA 3OOYA 2Q2WA 4M8SA 5FFMA 3VTAA 3O92A 4MARA 4PONA 1E7RA 4KQ2A 1SV0A 2X9VA 4MDYA 4E6EA 1MC8A 5KTPA 4GKBA 2PYDA 1RYNA 1DU4A 3V72A 4UNPA 2PKEA 1OYYA 4NPHA 1P7WA 3G23A 4LOIA 2Z3VA 2FPXA 3LW7A 4C2TA 1E79A 2ZJAA 3EGIA 3EIEA 4IRKA 2Y9TA 2IXGA 3ASUA 1I3LA 3INYA 2A94A 3IUQA 2H5XA 4WESA 4CQLB 4EKIA 2GNAA 2JD2A 2XD4A 4UTNA 5GVSA 2EZUA 3I3OA 4Q3DA 3WYEA 5E6SA 3JQPA 1E4YA 1XTPA 3M6MD 3JATB 3V4PB 2V45A 4QO8A 1QHNA 2HIMA 4EHNA 3TSYA 5D3KA 1I6MA 5DRTA 3WLKX 4CM4A 1GWNA 4KXLA 4TUPA 5KFZA 4RQ4A 3IHKA 3GEIA 4MKFA 1O95C 3GEMA 1HQKA 4ZIRA 1DOZA 4TVBA 3RK4A 4ARAA 3EOAI 5JTTA 1E59A 1NXXA 5FOQA 2LI6A 3G9UA 1U7OA 3MTGA 3T5GA 2WABA 2DKXA 3HG7A 3OTIA 2JLBA 1MRZA 1U8YA 2W9CB 4R1SA 4TXLA 3WNQA 5ALJA 2FWJA 1J2JA 1WEHA 1V6CA 1Q0PA 2CKDA 2R1TB 1E8DA 3JQBC 5HFJA 4CF6A 3OSPA 1GPJA 5DLGA 1DGJA 1EVEA 3SLRA 3U37A 3BC1A 2HMYB 4B45A 4D4LA 1VHTA 4JGBA 1J5XA 4WJLA 2BM1A 3NNNA 1SZJG 1FFSA 1S96A 1IY9A 3PSHA 2O1XA 6REQA 5AVUA 2ZUCA 2B3TA 3FPJA 1Q0SA 2XIDA 1KL7A 1F3LA 1UPBA 2QUHA 2GBGA 3JPOA 2J9GA 1U0EA 2BGTA 2BCJQ 3P2KA 4YQZA 1FW6A 3GCWA 4EHAA 2KFZA 3C6YA 1XRNA 3HMQA 1E2HA 3ME5A 1VBKA 4RADA 3S3TA 1PWYE 1LW6E 5GONA 2E37A 1OAOA 2Y9PB 5HF9A 5TQ2A 1ND6A 4BKUA 1QO0A 1B6TA 2Y67A 4RAOA 5AM5A 1S2IA 1SRRA 3KRTA 3IDWA 1DJPA 4BO1A 3KR9A 1O6ZA 1C9YA 1SVNA 1JPUA 5KFWA 3VDNB 3C3CA 4JBGA 3KTAB 4I5GA 4F7DA 2XRYA 4RIIA 3GOHA 1C0EA 2ZUVA 2FXVA 4F2SA 1VGRA 8MHTA 1ZISA 4V2UA 2WAYA 5AOCA 5IBPA 2CXSA 3QLUC 5H7XA 4QZGA 1Z6PA 4CR6A 4O4LF 3ZK7A 2IYYA 3T9BA 3QJYA 4TT3A 2XZPA 2VFAA 3HWX1 4ZP1A 3HCCA 3IS3A 5HNKA 4PHCA 4WKGA 4BO8A 4YJ2B 2PVPA 8ICJA 3NHBA 5JI2E 5BYJA 4CV0A 4FWBA 3LVVA 5HKBA 1UT8A 3HHPA 2V9PA 5MHTA 2ZZMA 1GLVA 1Y3FE 3T7RA 5KJ1A 4WSOA 2VHQA 1GQ2A 3GZ4A 4AT1A 2DEUA 1SFRA 2PXXA 4ASUD 3PS9A 1XLVA 3F67A 4Y1RA 2G36A 3HN6A 4B83A 3O95A 2KMDA 1LBEA 3OPYB 2PGJA 4HX2A 2Y1DA 5AW2A 1UA1A 2ZATA 3J7AC 4KU4A 3EAGA 3KJHA 5KZMB 4UC0A 1JBQA 2RG1A 2HHTA 1AQLA 3HKBA 3MFYA 3NDPA 4YJHA 4F6RB 3I5MA 2APJA 3ICWA 3LV8A 4KUGA 4LK2A 2FE4A 2PS1A 3AB8A 4IZIA 1VP3A 1XVTA 4J29A 1E32A 4EG7A 3UY4A 3B6ZA 1UWVA 5B7PA 1SOVA 8ICCA 2X0KA 3LU1A 5TF4A 3ZWQA 2A0YA 5L40A 3JSXA 2CE2X 1B43A 1B6RA 3A36A 1DAFA 2YYAA 1UDRA 2IYQA 4L1KA 1SXJB 5LP6B 4W5TA 4MAFA 4HNTA 5AVSA 1W19A 2C04A 1BMFD 3D2LA 3PNQA 3IT0A 3S0JA 3ZIUA 4A8JB 5CIYA 3LL7A 4DSIA 2GZAA 3PXAA 2E48A 4YAIA 4UE6A 1CFZA 1WVGA 3EH1A 2FZ5A 3AHCA 1T2UA 4NCAA 1BPEA 3OUUA 3T8YA 3CRNA 3WSWA 4EIWA 1R10A 2OBNA 3I8OA 3ZX5A 4Q01A 3WWOA 2FSUA 2PVCA 4GP6A 1WJGA 1S76D 4XD7D 4ZT5A 1T9BA 3TXAA 4B31A 2JIRA 1CBUA 1KDOA 2KB0A 1JQJC 5ED4A 2ZYDA 1E5LA 1UAAA 2YWCA 3UH0A 5HWSA 2OEHA 1M6EX 2H54A 1PG2A 1RFGE 2FEPA 3W5BA 2ZTCA 4UUOA 2B98A 1R6BX 1Y4DE 2OH2A 1O6GA 2B5WA 1RLUA 3DA8A 1JLHA 4YDQA 1A7JA 3AHHA 5EUCA 5FWAA 4G25A 1S3SA 5EJ9A 5L53A 5MN6A 1JHMA 3ESCA 4HGZA 1M0WA 4AYXA 2DZDA 3UA4A 4DL6A 3ZZMA 4XVCA 2IZOA 4L8WB 4AN4A 4B34A 4W8OA 1VMKA 2AQHA 3DYBA 2WA1A 2NADA 4NX2A 1MOSA 1Z33A 1K1QA 3VOAA 2MA1A 1V16A 3GROA 5CVDA 3OPYI 1YWGO 5HE8A 3P9ZA 2Z9CA 3RSHA 4UZFA 2IU4A 2GPAA 1K1SA 1VDMA 3PLRA 4FEEA 4IDFA 5CLFA 2KP7A 3NHJA 4IJKA 1TM7E 2MINB 3KL4A 4ZC8A 3OM1A 5J2TA 3Q3GE 3CLTD 3RE1A 2XVAA 4LDAA 4GXJA 1VG1A 3TJZA 2FP3A 4C05A 5G0UA 3SC3A 5FDFA 2UYQA 1G38A 4JMUA 4WZ6A 3CZCA 4CLHA 1F8GA 1FJHA 4EATA 2ZI3A 2CB9A 2CNWD 4G4GA 3R1IA 1ZGZA 4HCJA 4L27A 1N1EA 2VDNB 2WVAA 5DV9A 2HXYA 3EZ9A 4HDKB 5EKTA 3I12A 5D6OA 2QN8A 1G6Q1 3AL0C 3RTCA 1VIYA 1ZQJA 1FDVA 5E8RA 2F1IA 4IS7A 1AZSC 5KFMA 2A1UA 3KYDB 3JZMA 4XQCA 3AERA 4KLNA 4OQDA 5L3ZA 3VR6D 3OJCA 1FNMA 1NJFA 3FZGA 3HH8A 3LMKA 4XUDA 2QD1A 3ENNA 3AUJB 3FCAA 1W5EA 4ZVTA 1RE0A 1L8QA 1Y5IA 2OXFA 2ZK7A 5JYDA 1BN6A 3F3SA 4I4IA 1ZBDA 1VYTA 4K7JA 5LQSA 1URPA 1T2VA 1Q22A 1NSTA 2AKAB 2HIGA 3FF1A 1LJ8A 3WB1A 4WLVA 2JI7A 4CMEC 5I4CA 2ZSUA 4DLSA 4IAOA 3SF8B 1EXMA 5AJVB 4G81A 2HQ1A 3WLMA 5KG6A 1YRAA 3VPCA 2LW7A 1XA3A 3HDQA 4RD4A 3VTKA 3LPAA 1GVNB 1W85B 3P9CA 4OJMX 5CPBA 5I9MA 3ETLA 3EVCA 3W2HA 4DJDC 2R8ZA 2YXBA 1W85A 3MWDA 1YBHA 1VLLA 2REQB 2SCUB 1XPRA 3H9UA 5LWQA 1OXSC 1MAHA 2XA9A 4JK3A 4KO2S 4QPNA 1W94A 4TWRA 4F2HA 1ECWA 1JBEA 3G6KA 3V4OA 5JXWA 5EWLA 4RQ8A 3B89A 1AE1A 3OIUA 4LRUA 3VNBA 3EZ7A 1J0BA 3ER6A 3EPGA 2JHPA 4ZHQA 1T34A 5BSFA 1COWD 2G76A 3PUWA 2JLYA 3GMTA 2BDPA 3FSEA 1DUSA 3JTMA 1PDVA 1XFDA 2ZR7A 1D8LA 5FL7A 4CM1A 3V3TA 5JWRA 2GEBA 1VGVA 4I4TA 4D4JA 2GK4A 3N1UA 3TARA 2D06A 4R54A 4YO8A 5TT0A 4BBJA 4J2OA 1B15A 3UMMA 4ED1A 4J9NA 3EHDA 1GQYA 1V9LA 2R6R1 3SSMA 3V6LA 4LWPA 3S7ZA 3VTZA 3PDIB 1Z5UA 1QNLA 1X1DA 3DOIA 2O8NA 3T79A 4OMDA 2Q6TA 4DLNA 3OPQA 1VB5A 2EGHA 1P8JA 2WU8A 3BKXA 3U3RA 2NP6A 2W2NA 7ICJA 3SNKA 2GBFA 3GY0A 4MFFA 3AUXA 5KNDD 4QU8A 4RD3A 3JAKB 1AKQA 1VKJA 1D9FA 1DAEA 5EIHA 4P4PA 2VLIA 4HGNA 4R1UA 4RQAA 3ZYCA 3E7DA 1W4BA 1EE9A 1FUKA 5D4BA 2CXNA 3E7WA 4RY0A 4CT0A 3DP7A 3C7TA 2D8CA 3MTAA 3NANA 4ENRA 1EQUA 3EXHC 1NQTA 2FEWB 2A1JB 4JD5A 2ZAYA 5FIUA 1HG1A 3BD6A 5JWOA 1KP3A 3N2KB 3HHEA 3WDMA 3PP8A 3SEFA 5F4ZA 3A9CA 3EPLA 3TQTA 1JR3A 5IVIA 4M9HA 1IHPA 3K6RA 4HGQA 4GPBA 4WI1A 4EY5A 3JV7A 3FG9A 3NUGA 4DDUA 5T8KA 3G1WA 5A3QA 5KYWA 2Y92A 4WLNA 4M0CA 5HFNA 4WRRA 1EVKA 4RK6A 3ZWAA 3GRPA 3V55A 1O8BA 3JD4A 1ODFA 5BWBA 2CZCA 4K2AA 3QE4A 4Q45A 1MA3A 1N92A 2KVCA 5JQGB 8ICLA 4D4GA 1JEEA 2I6SA 3GFGA 4XZ3A 3SCZA 2BR4A 4LJ8A 2QROA 4MR7A 2PEYA 3J81A 2RH4A 3AVQA 1SELA 4P36A 1EZ4A 4N76A 3N0TA 4N39A 3I1YA 1OJLA 1AS0A 2VRBA 1V8DA 2QD5A 4JWKA 1CUWA 2JBWA 5KFFA 1IG6A 3CZRA 3D1JA 1OAAA 1OE0A 5ALSA 4FJ2A 3UV3A 1T9DA 1G4AE 4EYGA 1NW3A 1YDEA 2BBWA 4C5BA 3U7HB 2D7CA 2DPYA 3RU3A 3B5IA 1K5DA 2J9XB 3FY4A 3QMPA 3VR3A 4M6WA 2B4YA 2ZJOA 1VBMA 4HQ0A 3DOJA 4MR9A 4TV8F 4YRAA 4ARIA 4IIBA 3EF0A 2HT1A 1TVMA 4C4PA 2ZTHA 5E9QA 5LP1A 1KTIA 3OEEA 1NJ6A 2D3DA 4QUGA 4LXGA 4XPIB 4EI7A 4POAA 2N42A 3HCBA 4O2AB 4LJXA 1HUOA 4R8KA 1EB9A 2C4WA 4EF4A 1OH7A 4YR3A 1DTEA 1H0HA 2JCSA 3OCWA 5SY4A 4BU1A 1NJGA 4GMDA 4GIBA 2BD0A 3EPHA 4PCLA 5JADA 2CLMB 5A5FA 2C31A 5EVCA 1EFCA 4Z7JA 4AQYB 4ZGBA 1AGXA 1EHCA 4HNAB 4FGWA 2QVGA 3M9XA 2GD2A 1XQ6A 4MP6A 1HORA 3NDIA 5GZ6A 5J2GA 1JNXX 4JSRA 1FW8A 3AYZB 4MYCA 2VIIA 4QGAA 4D74A 2CVZA 5IJ0B 5K2MA 3U1BA 3UHOA 2MSNA 3GEHA 4E07A 2VQFB 2C4MA 4B6GA 1Q77A 5IF9A 2Z98A 3X2SA 1Y6QA 1L4BA 3OF5A 5KFBA 4DWWA 3ZCRA 5DP2A 1C2YA 4XUGB 2BTQA 2G4LA 4TZ0A 4GLFA 3V7KA 4FK8A 2FFRA 4UMVA 5F3XB 4CMIA 3L0IB 1SXJC 8ICWA 1NF8A 2EP8A 4Q4HA 3NYIA 5JD5A 2FPPA 1KNQA 3CPJB 2I80A 3W90A 1G9XA 3L07A 2NX2A 1OZHA 2YYSA 4IZOA 5CIQA 2WIKA 4P7KA 4DMMA 3QM1A 1CS0B 1YBAA 2M6RA 4IW3B 3ZU6A 2HSGA 5BV2P 5AKEA 3KKMA 3PEFA 2XXAA 1KI7A 1Z4PX 4P5DA 3A1CA 2K60A 4MGEA 4KQWA 3R44A 1OOEA 4H08A 2CVQA 2XXAB 1J2NA 2R8RA 3LD9A 5ELLA 3VKFA 2XJ4A 3CLHA 3EISA 1LI5A 2EERA 3PJEA 2JLXA 2J4DA 1N5WA 3SV4A 1SK9A 3R3UA 5EJ4A 1WXXA 4BWGA 4DBVO 1KP2A 4AY3A 3EPKA 3LE8A 3HO1A 1NIPA 3RT9A 5IAEA 1EI9A 5CTAA 3QPAA 2AE1A 4U5QA 5T7BA 1CJCA 1MO6A 4UDOA 2CFIA 3EDMA 4RQ0A 4KIFA 4K9RA 3V7FA 2OLKA 4AECA 5I7OA 4IIHA 4TYYA 5K4GA 3A3OA 4TYPA 4NARA 2BMEA 3MWYW 4V0MA 3MCTA 3TDNA 2PFGA 3EG9B 2C57A 3LK9A 3JWHA 1A8SA 4D9NA 5K0BA 2NRTA 3LWLA 1SOUA 2E55A 1U99A 4R2XA 3DEFA 3WKBA 1LI4A 3RABA 4U02A 2H1OA 3TSCA 4G1FA 3I9FA 1B3BA 2ZKLA 1HDIA 5I6DA 1PQ4A 2QT9A 3U3XA 1Z00B 3AJDA 3F5DA 3EG5A 4KI0A 4ZC1A 1L1FA 2KZ3A 4CKCA 3HI4A 3V7NA 4FFVA 3UWDA 5CFPA 2O5EA 2GX6A 3EQ8A 5FD8A 2B69A 2IHVA 1T26A 1PEKE 2PD4A 1IH8A 3HRHA 4O1HA 4YAJA 2H3ZA 3WKEA 4UM9B 2A3VA 2FWNA 1PF7E 3IUYA 4XIYA 5HA5A 2OSBA 4OXIA 4IINA 4EHLA 4K6FA 3CV3A 2P2YA 3JRWA 2QUKA 4CEJA 2FMTA 3KHTA 1XLTC 2OFXA 3A1TA 3B0YA 3B1FA 3FTDA 4X6LA 2W7OA 1JR2A 3A2MA 5KPJA 1G8SA 1M2WA 4H3VA 4FJ1A 4YRPA 4C30A 2X7JA 3K0CA 5EP1A 3HB5X 1T1EA 3O73A 4RA9B 3M7DA 1N2ZA 3OHMA 5NULA 2IX3A 1EWTA 1RVV1 3EAFA 1PFUA 1IMJA 5G5GA 1NI4A 4EW3A 5JCOC 4ARSA 2H2IA 1YB1A 4FGSA 1UJ6A 4UHHA 1G6OA 3PO4A 2XI9A 4UB3A 3GPIA 1JGTA 3U26A 5TS2A 3W2FA 1BIFA 1ESCA 4B2LA 4LF6B 3NWEA 1OFUA 5KYXA 3QKRA 1NV9A 1V1RB 3IMKA 2IUFA 3WGJA 3A1EA 3ZJVA 1SG0A 3LXMA 1OFIA 3IQGX 3HJUA 5EJIA 2PFPA 3GOQA 1QFYA 3ZV7A 3M6ZA 1D1TA 4X61A 4JCOA 5M3BA 1DQSA 4CTJA 1AD2A 3LVQE 2HNAA 3R0IA 3AF3A 4HS4A 3UBTA 1C9DB 2BH9A 1Y9JA 1FXUA 4UB2A 1P6XA 2QENA 2Y1WA 4YT5A 2X8BA 1JLLB 2QQGA 2R4QA 4M49A 1E9BA 4ZCTA 2XE4A 1RQ2A 1R8QA 4Y0NA 2FWMX 2O52A 4ZAZA 3GBVA 1G7SA 3LUHA 2FV8A 4J0HA 3WGKA 5CWRA 1AN0A 4C1NA 4CKEA 1IV8A 1ZM7A 2ECFA 1J7JA 4N41A 1PL7A 4QAQA 2DQZA 2D5AA 3DFUA 3GJQA 4LMAA 4GXNA 2HTEA 3BQ2A 2J09A 4FFBB 5ARCA 4D4HA 4V1CB 3MT8A 1UC9A 1U7DA 2YWFA 3ECAA 1EB8A 3PQ7A 1X74A 4HRAA 3A9VA 3W8FA 1Z4LA 5JC8A 3GP5A 2CMDA 4L0CA 4UHJA 2IP2A 4LXYA 3RGWS 4YYZA 1TCBA 1NUUA 2I22A 3MFQA 3QZUA 4IIDA 3QGMA 1XK7A 3U2QA 4H27A 3NVVA 4ZI2A 4ZYWA 3USES 3SMVA 1NK9A 1Q17A 2J5KA 3CX7A 1QG0A 2FMIA 1NBIA 1YJ8A 4B3JA 1SUFA 2F7SA 2YRXA 1WHSB 2C28A 5BRJA 2BGMA 1GJRA 3B7GA 1DARA 2DBRA 2RGAA 3RB3A 2AUMA 3O26A 5EIAA 2CD9A 2GN6A 2OAP1 2TMKA 4DR2B 4BMPB 5EXSA 4S1VA 4OM7A 1BXGA 3QYAA 4DS4A 5JSFA 4XUCA 4YXWA 1NSYA 1H2FA 3IP8A 4BVAA 2FJUA 2IZ7A 1A2BA 1F44A 3IP5A 5E8JA 4MV1A 1XXHE 2R4UA 1WHTA 3U3DA 1VPWA 2MIIA 2X5NA 1G8PA 2G9QA 1S10A 3A05A 4Q1BA 3WY9A 1WTCA 3FKSA 4IMRA 3L3FX 1Q15A 1SEPA 4IH9A 4ZYLA 5BT8A 5JYEA 2W98A 3O90A 4DR4B 2HQOA 1FUIA 4CMKA 2C1ZA 1C1DA 1Z7BA 2WILA 3CH7A 3LUCA 1S77D 4QDKA 3CBGA 1DKOA 3AEYA 4O3NA 2NNLD 4GM1A 3T7EA 4ZTUB 1P44A 1SG6A 2DM6A 4C07A 1M34E 1IK6A 2W2LD 3K2IA 2LP4Y 3OOSA 4H7DA 3SLKA 1ID8A 2OO5C 4O3PA 3KJXA 2QRPA 1W30A 3AEZA 2J33A 3AI1A 3NXKA 3K30A 1E5TA 1M1UA 5EMMA 2PIAA 4TM7A 3T3HA 3EW9A 4FD3A 3MUEA 2WU4A 3IIEA 1P5ZB 3FAKA 3HS3A 4RQ3A 4ZH4A 1G98A 4KUHA 1YR7A 4RV5A 5KVCA 3MG9A 2XKBA 1IEQA 1BJTA 3HXLA 4P4MA 3PXXA 3KQNA 3QF7A 1GKUB 1YV9A 4BX2A 1W35A 1WOMA 1PBNA 1YJAA 3LQQA 1UAGA 4ZU1X 2V4ZA 4G0YA 2XY6A 4ER0A 2V7QD 4KMUA 1CNEA 4GMXA 4IOLA 2GGSA 4OA8A 4Q1FA 4CDRA 1MJHA 5I7EA 1Z0ZA 1T43A 2PZFA 4U7HA 4X91A 1MG5A 3N2IA 1GAWA 2YY6A 2AG8A 2YXNA 3WAKA 4WXMA 2A9VA 5HOEA 4EI9A 2OB1A 1WLSA 2IX9A 3CVWA 2XNJA 1XDUA 2BCGY 1QZXA 4I2FA 4FHGA 1ZDMA 2J6UA 1T9CA 2ATEA 4BIMA 2OG2A 3AOGA 5AI0A 1HOXA 2V54A 4EW6A 1TI7A 5GJCA 5FLYA 3I5AA 1U8CB 1NVXQ 3E2EA 3I37X 3FM9A 1F60A 3B3QA 4G9BA 1T36A 4MV3A 4WKPA 5EXXA 4HDNA 4D0RA 1RPAA 2XOEA 4LWZA 5COQA 3O4RA 2QXYA 1A7KA 2EANA 2HU7A 2IUYA 1D07A 4ISBA 2BR3A 3FH0A 1D8YA 5KX5A 1ZRNA 3BWVA 1I2DA 2H0RA 3B8EA 4NU5A 3ZHOA 1WUIS 3OJFA 4C8OA 3WWZA 5ERYA 1T0HB 2GJ8A 1W0KD 5KT4A 4GGOA 4P3XA 4G0NA 2UYHA 2FF5A 1U3VA 4C0QC 4FWIB 1JX4A 3B6KA 1U11A 3AB3A 2ZPAA 3I92A 3R8FA 1X8LA 3HY4A 1CRPA 4QJ3A 1HEIA 1FJGB 3U1VA 2ZIUA 1TO1E 4JL5A 4M0AA 4D3ZA 5LQJA 3E15A 4A2QA 4UTXA 4M53A 4QTYA 4ZDWA 3BAFA 4QXOA 3R7AA 4AICA 5BY2A 2NVUB 2FW8A 5EINA 2Y4NA 4IF4A 2GPJA 2GPSA 1OLSA 3M82A 4L4SA 4Y9TA 4AYWA 4FS1A 4IR1A 3COSA 4K05A 5KC9A 1X7YA 1O95D 5EZYF 4QOEA 3OLYA 4M0UA 2BRUA 3SHVA 1E0KA 2EX0A 2C7BA 1BVYF 4Q1EA 1QDUA 2JJ1D 4V38A 4Y7DA 5HCIA 3UT0A 2X7XA 5JAZA 2TYSB 1O96A 5CB6A 1TM5E 4RPYA 1HNXB 3DG9A 3ZDYB 4LVOA 4RXTA 1DIAA 2R9VA 4URFA 1XO1A 2J6TA 1WIWA 2Q2VA 3M5PA 4J4BA 3QVWA 5TS3A 1RYMA 1VOTA 1ZIOA 4YUZA 2C2YA 2V5UA 1NKEA 4JSTA 4LHYA 4ACOA 4C4YA 4B3CA 3WLRA 3JD1A 3OSUA 1QIHA 4W82A 5AW9A 2DHEA 5IT4A 3M6IA 4HEHA 1BROA 2EKDA 2FWBA 2IYNA 4NULA 5CBPB 2RMKA 5C0YA 1FXWA 1DRVA 2QY6A 3KLBA 1CDZA 1U7PA 2DUYA 5I51A 2QD2A 2WIFA 1UWCA 1P2VA 4QO7A 3REQB 5CD1A 2C20A 3LRPA 4HRXA 4U7TB 3DXYA 3C6MA 4RW0A 2PLNA 3KE9A 3G0DA 3QLJA 4F5EA 3HBLA 1EBFA 3BD8A 3VOSA 1S8AA 4TVKA 1UFKA 4JT4A 2ZDGA 2P4QA 2VWGA 5LLTA 3RSCA 1V37A 2X4IA 2WHXA 2PCLA 2YN2A 1C3OA 1Y9EA 4PPQA 4ASUA 1DX9A 1C7QA 4WK0B 3NTLA 5EYPA 4DXDA 3O8BA 3ZVKA 1NK7A 5F1OA 3WIUA 2D13A 1NBME 1GYPA 2G08A 3GLUA 4I81A 4YXWD 1JA9A 1M1ZA 2BFCB 2MMCA 4YLGA 2CCJA 5GZ1A 1BQ4A 4GU5A 4Q34A 4K46A 4JJGA 4AJHA 4HB3A 3CXUA 4RPIA 3G8YA 3NBXX 1WLYA 3E3AA 4O2BF 1QCZA 2AG1A 1AG9A 4YALA 4G5FA 4EENA 4ITUA 1CVIA 4QTXA 1UC4B 2RGUA 4KVZA 1H2XA 2QMUA 2EEZA 2IYXA 1VG0B 1BHJA 4KZKA 1ZN2A 1JH8A 2H31A 1AU9A 2PGIA 4AQDA 5M7EA 4ZPXA 4B7ZA 5IVDA 2QBYA 3R7NA 4IRCA 2EATA 1XTKA 3H18A 1L4LA 3RVKA 1DC6A 4CHTA 3OZSA 3HE3A 4DL5A 2G9VA 5HEKA 5KKCA 1XDSA 4LN1A 3WGIA 4XEUA 4AY2A 4Z4QA 4J6FA 4B6QA 3ZU3A 5IVKA 1G8FA 3MVEA 1CETA 1E18A 4G9EA 2B1IA 1QE5A 4R7ZA 2Q27A 3AM4A 1K8XB 1YA4A 4FE7A 1HYHA 4HH0A 2IWHA 4LJAA 3GYBA 2VF2A 2A1TS 1CR1A 3QNUA 4C6RA 5CB4F 1YL6A 2F1HA 1FNDA 5AVXA 1T3SA 5AVZA 3D31A 3OH8A 3CYFA 4GOJA 4WBNB 3M4JA 5KFGA 2B92A 2I71A 1KDZA 4B3XA 1EFUA 5DTMA 5JNSA 4YUXA 1JKFA 1HUQA 2O3TA 1GTVA 1BX3A 2BKXA 5D8DA 5EHZA 2YXPX 5FOXA 3BSWA 4ON9A 1FXSA 1FSSA 2WG0A 1QUEA 3AJRA 2OYRA 3BH6A 4Q1DA 1ZRSA 5FO0A 1M0SA 4MZXA 1QKKA 4I2DA 1FA9A 1ZM4A 2WWYA 3I61A 5JJLA 5DMHA 1JHAA 2I7VA 2OFPA 3KNZA 4ZZ2A 2EC5A 4GMGA 1QOZA 3Q6MA 1ZC4A 3KTAA 3Q85A 5BSMA 1SZCA 4HWPA 1O77A 1GXSB 2EFHB 3CKYA 4GFDA 1WPRA 2G04A 2ASLA 4TYWA 2C7QA 2G06A 3TL6A 2MSDB 1M7HA 2CEAA 3BRQA 3I9MA 4Q00A 2Y0EA 1PLKA 3Q7IA 5IABA 2PX4A 5C8VA 4F56A 5IMBA 5EMNA 1GUBA 2C2KA 1XP5A 1Y1TA 2ZJ3A 3IYLW 4PC6A 4PYIA 4DMUB 4YRSA 3L0OA 3PEYA 5KQMA 3K0SA 3KVOA 3DBRB 2X9GA 1NXPA 2XITA 1PT8A 1EX7A 1LX7A 2FF7A 4NZZA 4JJ6A 1DE0A 1IWBB 4LRXA 1YZQA 2X77A 4PIMA 3ZE8A 4Q39A 1RT9A 2LXNA 4FYKA 3FPGA 3KWFA 3PHIA 2EJUA 5H3LA 4ECRA 5LDGA 4IJMA 4Q3BA 3X1MA 4ZXPA 2V6JA 2ZJ6A 1RJDA 4JJ4A 1VP9A 4JH0A 1SA0A 2H3EA 4Q15A 1HOTA 3ZHCA 1LJUA 3ELYA 1SKUA 5KJCA 1K68A 2ZSAA 4IHKA 3VVLA 1AA6A 4UB5A 2PGNA 3R0XA 1JFLA 2Q07A 2WAAA 1OLXB 4O4JB 1GQRA 3H3XA 3RQSA 1TF2A 1HYGA 4YJ3B 4KLMA 4L8FA 1K7EB 4TMXA 4ECAA 3EPIA 4PAQA 4TZKA 1SC1A 3AV0B 3UUGA 4B9UA 2E5WA 4UBCA 1VLJA 1XA0A 5AM3A 3NDRA 4J2HA 4AJEA 2R18A 2H2WA 3V2UA 1VCIA 3T5CA 3X1YA 1JR6A 3IKTA 1KPIA 3FNIA 3X1KA 5HHHA 4KDEA 4L72A 1A9QA 3HILA 1UT6A 3NQ41 4B7XA 4ZAVA 3SYZA 3PR5B 1P74A 4EA6A 2FX2A 4FR5A 4XFDA 3M49A 1VMEA 1C30B 2NSLA 1FYEA 4BRSA 1PX2A 2ZJZA 3CNOA 4YCJA 3RWBA 5JVDA 5KWSA 1D8AA 1P1FA 3KOUA 1Q20A 4MRMB 1GLGA 2BKLA 3ADPA 3UJ9A 4YG2A 5A4MS 4Z99A 1V5EA 2RI0A 2B8JA 5JRJA 5JJKA 5B55A 2AQIA 2AFIB 4XGIA 3HT3A 1ZWLA 1UH5A 1ZK1A 2HF7A 2F3NA 4TL7A 4IIJF 3R3HA 3EBPA 5BV8A 2ADOA 2VT6A 3O9VA 5ECWA 2JKVA 3VX3A 3CVYA 5KFYA 3KDPA 5JU5A 3SICE 1FF9A 1H8HA 2XMDA 1CFJA 2XXJA 4YUYA 1Q8KA 4QHTA 2GZRA 1PHRA 3KELA 2WUVA 1VI6A 1U5BB 2BKVA 3A1NA 2WMDA 3OFNA 1ZIDA 5JY6A 3U7GA 3N5CA 4PICA 1C9EA 1IJBA 2BQUA 3X1JA 4QQKA 3ZLVA 4RJKA 4HWGA 4YFYA 5GM1A 1QIIA 4A1FA 3DZJA 4Y9RA 5CX1A 4D92A 3QELB 4IC9A 2A9PA 5D00A 3WLJA 1KQNA 3AILA 4YN4A 1T8PA 4ZCMA 3W9SA 2EP5A 4EJSA 4H35A 4JB3A 1G2IA 2XTJA 2WIAA 1V0JA 1KZ1A 3TQOA 4OIMA 3TKAA 2HOFA 4KLJA 3SDZA 2XY7A 3FYSA 3L9XA 5ED0A 1PZGA 1QQBA 3V8QA 4N1AA 2B8WA 2XBMA 3SS7X 1PUJA 2M1ZA 2WBLC 4ARZB 1Z8DA 2C1EA 3EMVA 3SR0A 1SB8A 3IQFA 1DAKA 1FFHA 2XKJE 4M7RA 3IOCA 4RDCA 3RRNA 2NXNA 1BE1A 3RFAA 1XU7A 1BD4A 1MU0A 3OFJA 2EZXA 3R6GA 4S1PA 2A1UB 2P2CA 5BP7A 4L3OA 4RHFA 4FQ8A 3RSOA 4LEIA 4YHBA 3ZH2A 3UXEA 1AHIA 3V9AA 1Z16A 4A26A 1RIIA 2P4SA 4TS4A 4RY9A 3MJHA 2JEIA 1PJTA 5B4UA 1Y82A 1F2UA 2IE0A 3H4TA 3P9SA 2RIRA 2VYFA 1J6UA 2ZT5A 3L7NA 5DASA 1YRLA 3QEMB 4OKNA 3A4IA 1T6BY 1AV7A 2KICA 1T1JA 2FW9A 1E9SA 3EVBA 3GDFA 4YXJA 3PFCA 1YQEA 2R7KA 2BP7A 4P0TA 4KN7A 1FP4B 4D4MA 2H18A 2QVCA 3RUEA 5HJ2A 5CH8A 1NV8A 4A2WA 4BNUA 5CXUA 2ZSKA 5DXAA 4ZMBA 3I6MA 4NM1A 3R0JA 2QM8A 1F0KA 4YMNA 1QO7A 3VKGA 3PR4A 4RZXA 2REQA 2R8JA 3DZIA 4KLQA 4F4XA 4D98A 4CMHA 3AU2A 4RZIA 2L2QA 4EUFA 2EAOA 3NTQA 5ILQA 3VNRA 4DV7B 8ICPA 1J2YA 2GJAA 4KI7A 3ZZUA 1XT6A 3OY2A 1US8B 1JG7A 1AB5A 4LOHA 3C45A 4EAQA 3L77A 3PSTA 4PAWA 4QE3A 4XWGA 1X9IA 2GR9A 1ZIXA 3DTYA 3NH9A 3MZ0A 3IBYA 1A71A 2HA5A 2J08A 2GVZC 1H8ED 3RU9A 4ES6A 4WIAA 1QJ4A 5JJ5A 4OB8A 1Z07A 3U3KA 1XZEA 4XGKA 2KHZA 2MSKA 1E96A 2BDTA 1SAYA 1FBNA 2X5KO 4LGVA 2EP7A 2QL9A 3HJCA 4KB5A 4CT4B 1X1RA 3UMVA 1KK2A 4PPNA 4KIJA 4BUGA 3QKSB 1LPAB 3NKVA 2UYGA 4W6ZA 2JHCA 4WKOA 5CMLA 4IIUA 4IHJB 3RODA 4YI3A 1ZM3A 4X20A 4EG3A 4JYAB 1X38A 2DQNB 1JSXA 4HFRA 4X3OA 2J30A 4RCVA 1TL7C 1X39A 3RTVA 1A0OA 2B6NA 2Q3FA 1NSFA 1KZ7B 2PJDA 3AIMA 2YIDA 2VNHA 4LC0A 1YUMA 3PPWA 4LUCA 5K3FA 1S7CA 1USKA 5T6BA 2ALZA 2K4HA 9ICMA 1SUIA 2GD6A 3Q6NA 4UJ5A 4XSGA 1KPGA 4MH0R 3X1ZA 2VUUA 1DKRA 3R7DA 1YAHA 1SRQA 2PWZA 2N1RA 2D1TA 4WZBA 1YDMA 3S70A 1VJDA 4OCZA 1LEHA 1OTHA 4LNUB 2G07A 1W1UA 1S1CA 1HTTA 2R8BA 4WCVA 3TEMA 3LOPA 3A6EA 5CM8B 1Q3UA 4TTVA 5I01A 4RZRA 1E3EA 4MRNA 4RKQA 4KXUA 1P1CA 1V7PC 3B48A 4J0JA 4K6CA 3HL0A 4LA4A 4E3ZA 5JNRA 2PG3A 1X9SA 1XSNA 4EYHB 1G8MA 1HEYA 2HA0A 3ZXUB 1ZMRA 1IXYA 4BFYA 1U6IA 3KPUA 4LOAA 1B4DA 1UBKS 3Q0EA 4RPCA 1EE1A 4YRQA 1S0OA 2VWQA 3DLHA 3VR3D 2CWWA 4U7DA 3RVLA 4RHUA 2PGAA 3NGMA 5HSGA 3U3JA 1DAGA 2YWRA 4JNCA 5LB2A 4WZAB 1IDOA 2JGKA 4EPYA 1SIJA 3I39X 1Z13A 5C1DA 1AGRA 3IHTA 5JSUA 2WHYA 4J3FA 1KSGA 2ZRNA 2JLWA 5C3UA 3TR6A 2C29D 1T4GA 1QFMA 1XKLA 1DMRA 2JAHA 3SS8A 3KLMX 3FSRA 1L7VC 1I6LA 2RGNA 2MT9A 4QVKA 3UFXB 4FBLA 3ZHSA 4DLXA 1YHZA 2GN2A 1HUZA 1CY8A 3F3KA 4A0RA 3IDOA 4GICA 3KWLA 4J75A 3BL5A 2QQ0A 4DN6A 4DEZA 1LK0A 2H17A 4MUXA 4QAJA 5CGZA 4TKZA 1U3TA 2KI5A 3L1KA 3UJDA 1PNQA 3V6KA 4KXNA 4ZI3A 4LF4B 5LMNB 3CNLA 4L28A 1O2DA 4EUKA 1G42A 4HYKA 3EA5A 4YPVA 5KB3A 2QZPA 4MR8A 3O8RA 4DLZA 3LGSA 3N86A 1E1QD 1XI2A 5LIRA 5D84A 3A4VA 3OT1B 1HSOA 4DQXA 2A92A 2ISSD 4DR5B 5DWVA 3IHQB 2NZVG 2NAPA 5EJAA 3VJMA 2SCUA 3C3XA 4FSHA 4C9BA 2WZQA 3ZU4A 2Q50A 2QXTA 1OWMA 5A3SA 3F6PA 4BFVA 4XH9B 3SBEA 1L7PA 3IHLA 2EJVA 2K4MA 1DX6A 3H2KA 1KS9A 1XMIA 5H0IA 4E21A 4HDAA 5JBQA 3U6KA 2GNPA 7ICOA 2XVYA 1XELA 2IPLA 3AEXA 3H05A 2OQRA