2ZIVB

Crystal structure of the mus81-eme1 complex
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
332
structure length
269
Chain Sequence
ECLKHIIVVLDPVLLQMEGGGQLLGALQTMECRCVIEAQAVPCSVTWRRDWVEEPTVLVLLRAEAFVSMIDNGKTLQGFVTDITAKTAGKALSLVIVDQEKYFRSQLPEVSRVDAEEALVDLQLHTEAQAQIVQSWKELADFTCAFTKAVAEAPLRDETTFSFCLESDWAGGVKVDLAGRGLALVWRRQIQQLNRVSLEMASAVVNAYPSPQLLVQAYQQCFSDKERQNLLADIQVRRGESTSRRIGPELSRRIYLQMTTLQPHLSLDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the Mus81-Eme1 complex
pubmed doi rcsb
source organism Danio rerio
molecule tags Hydrolase
molecule keywords Mus81 protein
total genus 68
structure length 269
sequence length 332
ec nomenclature ec 3.1.22.-:
pdb deposition date 2008-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02732 ERCC4 ERCC4 domain
B PF02732 ERCC4 ERCC4 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.670 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2zivB02
3.40.50.10130 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2zivB01
4BXOB 4P0PB 2ZIUA 2ZIWB 2JPDA 4M6WA 2JNWA 4M6WB 2M9MA 4P0QB 2ZIUB 2ZIWA 4BXOA 2ZIVA 1J22A 2ZIVB 4P0QA 2BGWA 2ZIXB 2BHNA 1J23A 2A1IA 4P0PA 2ZIXA 1J24A 1J25A
chains in the Genus database with same CATH superfamily
2YC2C 4GYJA 2JD1A 4MYHA 5FUWA 5IZCC 3S1AB 3WK5A 3SV3A 3TLMA 1UJ6A 3DNMA 1IMJA 2HMTA 4Q9LA 4L8WB 1OLXB 3ADKA 2HHWA 3I64A 4PAWA 2EFGA 3GVHA 4O25A 1KDTA 1MABA 2P8JA 3IQDB 2PKEA 5B4VA 3PNLA 2CYBA 3TM4A 4BB6A 5KFWA 4L02A 3DS8A 5C46F 5LKRA 1B6RA 4KPYA 2VIIA 1OZGA 3AOEA 3LUJA 3H18A 2G8LA 4LDJA 4R3WA 3ED1A 3EVNA 4UDYX 1P18A 4Z8YA 3SR3A 1AKEA 2WSMA 3LQKA 4LY0A 4R9NA 3SF8A 3ZCXA 3O1HB 4CIYA 3INYA 4QZVA 1PJZA 3BC1A 2QQFA 3AHEA 4Q4HB 3PZPA 3IT0A 3AONB 3S8EA 4EM6A 1NOIA 2FE1A 2ZJBA 2H3QA 5B7GA 1E3EA 1KDOA 4ABYA 2DHRA 4DF8A 4R05A 2V7PA 3L06A 3PVCA 3QU5A 1QVWA 1E66A 1E9BA 1FBNA 3SFVA 2ZEJA 3IX7A 5FULA 1A96A 3DO6A 4KAJA 5K99A 1O94C 3CN9A 3Q85A 5JS6A 1JSRA 1N48A 3M9XA 2IHBA 2OXEA 3JQAD 3TTSA 1O9BA 1NPDA 1DC3A 1Z7WA 2CHQA 4BVFA 4ARZA 4BLSA 1TTTA 1KI2A 3C97A 5ALZA 3DVQX 2ZPUA 4WL0A 5TSDA 1CUHA 3IV6A 1I14A 4HWTA 4OXKA 3SPXA 5C1DA 1RACA 4RTJA 2QLLA 1U65A 3R44A 1Z33A 4QDUA 3KBBA 3TKAA 3PMNA 1IY9A 2QRKA 3VYTB 2GPAA 3B7PA 1W0KA 5GONB 4OQLA 1TM3E 1WEKA 3USES 4AZ3B 4E22A 1KEJA 2ZUBA 4FEAA 4Y1RA 3R8CA 2O2ZA 3I12A 4O3RA 2ZETA 1PQYA 3C6QA 3JD3A 2VJMA 1JR3E 1ZQ9A 1WVIA 2WB4A 4RD1A 3C2MA 1U7XA 1A98A 3A1VA 3D3NA 4C3VA 3OQBA 4NYIQ 4QW8A 3JYNA 2PH7A 3IMKA 4ZOLB 2JIOA 1ILEA 2WAOA 3TBFA 2JI4A 5B7QA 4B2IA 3KXPA 1KFBB 2F3PA 1EWYA 2COEA 1DARA 4XOIA 3UMCA 3HH8A 4FKBA 4XIFA 2RLTA 1NI4B 5C8DA 3AVWA 2BGWA 4MRMA 3WISA 5CXUA 2YWGA 5AESA 5ED4A 4TMZA 1P2TA 2ZRBA 3CKMA 5CNMA 5KSOA 4CKWA 2AHRA 4DZRA 1OAOC 3WJ2A 5LIPA 2QUAA 4QGBA 3M49A 3OLYA 5F2KA 1KY2A 4Q3OA 4Q9IA 4QZDA 3HFSA 2AJLI 2J9FA 4EBDA 4KAXA 5A05A 4R0NA 1WXFA 2PFOA 3DR5A 2X0IA 1JEEA 2RKWA 4E2YA 5J2EA 3KK0A 3AP2A 3PKIA 2RBKA 2PRJA 4L50A 5TS2A 3HJUA 4IIJA 4Y1RB 1CRQA 4NP6A 1T36B 4EKGA 5J2KA 1JR2A 1Y1TA 1XG5A 1AGYA 2O3SA 3MB8A 4FCVA 2HDWA 1KY4A 1TT7A 1I10A 1CP2A 1LKYA 1BS9A 2VOEA 3I23A 4TUQA 4F2RA 4YJ3A 4RQMA 3QU9A 4BNYA 4C2BA 1FPMA 4EO9A 5LDDC 3OF5A 4J0IA 5DASA 5HFAA 1W36B 1HH4A 2JAUA 2LCQA 3ZCSA 1CVLA 1J0XO 2I4IA 2XTMA 2BGKA 1N77A 9ICUA 1H23A 2DPJA 3UPTA 3I61A 4LOJA 5CVTA 2I99A 6NULA 2VZ9A 2QTFA 4DSZA 1LI4A 4NCIA 1G1AA 4G67A 1GTG1 3OHAA 1LV8A 2ZTCA 4HQNA 9MHTA 4N8EA 4F4IA 5CAEB 5FWDA 5KWVA 2O8CB 2A9QA 1W9MA 2XVXA 4H7IA 4MKGA 4BWFB 2F76X 4Q4LA 3H1EA 5JVDA 3T1OA 2NO0A 2CJWB 5JCOA 4KLUA 2WVHA 5CM8B 1PX0A 4FDLA 5DGIA 5EJFA 4EMSA 1GRNA 1P73A 3HY6A 4YONB 2WKPA 3WLAA 2GCIA 2JDID 3SJAA 3T5KA 4M9RA 1TDJA 1TGYA 4ZTBA 4ED0A 3MQFA 4RQ6A 3C8MA 4R1QA 4EI8A 1CUSA 2BBSA 2GBCA 2XD4A 1EVYA 4PXYA 4GGOA 1I7NA 1NPTO 2B7LA 1OILA 2GJ8A 2VF8A 3CP8A 1C4WA 3SZ2A 2R00A 1PUIA 2BFDA 1NDUA 4HXYA 4INPA 3T38A 3WA6A 3BXHA 3ESZA 3GVPA 4OQDA 5FKJA 4MW4A 5LQSA 3RT9A 3S2EA 2OWEA 4HP8A 1BW9B 3N4MB 3D3EA 3RUFA 5BR4A 3QVKA 2H5LA 1GHTA 1HNWB 2R11A 1YQDA 2F3RA 2QF7A 4P82A 4LF6B 2Y71A 2Q1SA 3CRMA 3I73A 4OHFA 3PZBA 5IAJA 3TLEA 5L1MA 2A5GA 1WPRA 3R5TA 5BUSA 2OD2A 1E8DA 4JC0A 1R10A 2YY7A 4UAGA 3WRYA 3C3PA 2VQFB 5K3FA 1FMCA 1KDZA 5KT3A 1E3TA 5I7AA 2A0FA 1C0KA 2F3UA 1DMRA 4R1OA 1PJLA 4YASA 2DL0A 4Y6RA 3EG9A 1C8KA 2NO1A 2DUUA 3LP5A 4BFTA 3BZWA 3LCJA 3IVGA 2BFFA 2QHXA 4UNRA 2UZ4A 2DXIA 3ZYZA 4FHZA 4M1ZA 4B3RB 3F3SA 4ZKDA 1KETA 5DB6A 4FYIA 4RY2A 4KJXA 2PX4A 1A1VA 2CL6X 1MQ2A 3UK1A 5BRNA 3NTVA 4DUGD 3QFHA 3D6TB 3GK3A 4MS4A 2KEYA 5KAMA 4NOLA 1DGQA 3I01A 4JT4A 7ICMA 2K8AA 3BHNA 2RH9B 3ND6A 3ZZTA 3PRJA 4CLRA 4IKOA 5BVGA 3GIKA 1IDN1 4MKZA 2N47A 2ISPA 1NXOA 4L08A 1BSVA 1ATIA 1WKCA 2IVZA 5BR7A 4O4HF 4YG2A 1N78A 4A5OA 1W6RA 3OM0A 4KHPB 1XQWA 4IIHA 4WKGA 3WTCA 4Q0MA 4MUBA 5GMOA 5EJAA 4X8LA 1TKRA 1NUPA 1WQ4A 2IC5A 4EJSB 2Z43A 1T0HB 1PRYA 8MHTA 4R3NA 4RXMA 5LYJA 1T35A 2LMRA 5HRUA 2FLVA 3PF8A 3UPQA 3PD1A 3BUSA 4JDUA 4OHVA 1I1QB 3AUAA 1BFUA 4IQTA 1JSLA 1QYDA 2A7XA 3FG9A 4FYJA 1JT2A 1YCFA 2JA2A 5GVRA 3ILYA 2D5IA 3DOFA 3ENQA 1NW5A 4A26A 3TWOA 3UK2A 2ZR7A 1MQ3A 4IIJB 1L5QA 2ZYAA 3ZY4A 3MGBA 4KOAA 1OKKA 2UZAA 3U37A 3ICXA 2YHSA 2WJJA 1Z4IA 3B2QA 4BRSA 1KWKA 3VC3A 4EBEA 2EDUA 4PYJA 3NHYA 3FCYA 1CW2B 5C1BA 2VANA 1WABA 1Y5MA 1N0WA 3NH9A 2P35A 5EHXA 3LNTA 3A6ZA 2YHIA 5C1OA 5A5EA 2H1OA 3UAYA 2XUHA 3D4BA 2J6IA 3Q7QA 4I1RA 4R9VA 4XB6B 5C5IA 5IFKA 1E2PA 2X9VA 1UANA 3SIPA 3PWSA 3W79A 3BREA 1JHQA 4AG6A 1BNCA 4NLNA 4HDSA 1PF7E 1EA7A 3NWJA 1Z0FA 2X3YA 1ZMBA 3ZWYA 4XWKA 2AKYA 3AUUA 3C4QA 3EEQA 3OF3A 3QGMA 4WXHA 3ZKWB 3L0SA 3DT8A 4K0KB 5HQTA 3RREA 2FA9A 1KKXA 3TADA 3O3NB 3OFSA 3M9NB 4D81A 2WIAA 2BKVA 4Q16A 1GUAA 2XRYA 3H16A 3QMWA 2IZ5A 4A15A 2O7SA 1NP3A 2OGSA 3PBKA 3LPAA 1PR6A 3IQZA 1P1FA 3UQ2A 4KAFA 1EEHA 2XX3A 3CX6A 5LWHA 3OOEA 4CCSA 3D5EA 3LLMA 1BAPA 5H70A 3KOOA 4EBBA 2DUMA 2DHCA 1UFOA 1IQPA 1B8VA 4LQ4A 3OJSA 1I5OA 1KJNA 1L3CA 2ZRMA 1DC6A 3KJGA 4H1UA 1VCOA 2FUG6 4IICA 2HDHA 2O2EA 2Q4RA 3FVVA 4Q02A 4ZCSA 3UMMA 1JH8A 2I4RA 3KE8A 2ODTX 4ONEA 2Y76A 7GPBA 2VRWA 4ZJYA 1LKZA 2O4CA 3CPHA 2WLSA 3RVMA 4FT2A 4AJ4A 5BV7A 2XB9A 1MA7A 3MCAA 4ECUA 3IIEA 2BGRA 3Q8RB 3B7WA 4BO7A 2O2YA 3SC6A 3ZXXA 3T5GA 3OZWA 2BGTA 3PF9A 4XYMA 1DV1A 7ICNA 1ZIDA 1YUNA 2GT1A 1WE2A 2IT1A 2C0CA 2GAIA 5CFNA 5HS6A 1B0ZA 3HJNA 1M76A 3QVJA 4RV4A 4Z7OB 5A7GA 5B7PA 1FE8A 2VXBA 4W9NA 4P0PB 4MFAA 1SA0A 3FDFA 1M2JA 2G83A 1K0UA 1E62A 2ST1A 2YN0A 3ISJA 4TSFD 4DSKA 1UBLS 3BFVA 4RFLA 1VKJA 4JWMA 4BNIA 1HM5A 5JZBA 2XUQA 1JKXA 2XUGA 3ODGA 4TMWA 5DV9A 3PD7A 2YASA 2X6TA 1CEEA 1EVIA 4LV5B 4AWBA 1GD1O 1QV6A 6PFKA 3KEMA 1DAPA 3WS7A 4ZI7F 4UTVA 2J5QA 2FCRA 3BJRA 3HRIA 4HR7A 4BAZA 3RAXA 4UM7A 1AXEA 3BEOA 2O7QA 3DUFA 4X1KA 3DA8A 3Q3EA 4KP7A 5FJJA 5M3BA 3N0XA 5P8WA 3WNZA 3A3KA 2OGUA 3LRXA 1IHPA 3WBFA 1NYLA 4NOJA 5IVHA 2Z6QA 5E9AA 3HT3A 1CJUC 4ZHQB 1LW7A 5IJ0A 3Q8PB 2A3NA 3MOIA 4P4LA 3ZZ0A 3W2TA 3RJGA 4O5OA 1FDSA 4PZOA 1LEHA 2GNPA 1LWNA 4M21A 4TSKA 4CKCA 5AVVA 3PGKA 3EVZA 5BV8A 4YAUA 5JANA 3FOWA 5L7YA 2R7LA 3A6EA 3L0IB 4C30A 3R6WA 3DD1A 3SHWA 5ITZA 2XDYA 3AIOA 4MAMA 1YT3A 4G0MA 4QM6A 2HF7A 2G1KA 4P31A 5JFTA 3EISA 1BXZA 1GCAA 3ZY5A 2BMFA 3WO0A 5BW8A 3KVVA 1WOMA 1ZQYA 1UJMA 3A6HA 4NMWA 4KL8S 4DCTA 2LBOA 1H4VB 4MGYR 3A6PC 1QLHA 1BGVA 4JQSA 4KVGA 3P9SA 5LYYA 3R7BA 3T5CA 4MB2A 3X1WA 9LDBA 2A0WA 4F1JA 2HSGA 2VL7A 3HHEA 2WUGA 1BMDA 1JDZA 2GBGA 1ZQCA 3SZOA 4DAOA 2RHTA 4EG5A 1AHPA 5AVOA 2GBLA 5FR1A 2HBLA 1YIAA 2MDTA 3RH5A 2GZ3A 3TH5A 3JALA 1XO0A 4JELA 1R5NA 3AWIA 2OVFA 3BQMB 3TCXB 5IKOA 2AYYA 4PHHA 1AIPA 1UBOS 2XY4A 3CUWA 3FNEA 1JDPA 4O33A 1GSIA 1XPOA 1Q3HA 3HSYA 4G5SA 1FEZA 1ZU5A 2H1VA 3RFCA 2ZKIA 3EVEA 5KAPA 5AJWA 1OMOA 2GYWA 2C5BA 3MF4A 2PGOA 5GZ6A 4RKRA 4EJ2A 5BRJA 1YV9A 1D9DA 1O6GA 1X0VA 3O8BA 1I4LD 3KQQA 3WHIA 5K8UA 4FYMA 4RIIA 1LPNA 4ZKEA 1QG2A 4NONA 3KQYA 3CUTA 1SM4A 1X7ZB 621PA 5I8PA 3G0BA 3BG5A 4L0QA 3ZGZA 3ASYA 1GDTA 3U39A 1XLWA 1NV9A 1JHVA 2O50A 3L6RA 1CS4C 4R8LA 4KQXA 2DT8A 2FWRA 2G6BA 2OP1A 2RHJA 2LHTA 4ESVA 2WF5A 3FB1A 3AF3A 3N59A 4P3KA 4BLRA 1XA0A 4NS4A 2YWXA 5LJLA 1T5LA 1E94E 5K51A 4LC0A 4V0ME 4UXIA 4CEHB 3AX6A 3UPDA 1SD2A 5DSXA 1TJPB 1SZDA 4Y2RA 3PV8A 2QZPA 3P32A 1H65A 2JGKA 1ABFA 1DG1G 2C2KA 4YCJA 2JLRA 1NP6A 4IO1A 1LS6A 4JSRA 4K9NA 1RWQA 5CX1B 4B6FA 3JPWA 3BDVA 3M7DA 3OMXA 5FX2A 1G4AE 9ICEA 3RANA 3RHZA 5EVJA 3WX0A 1OT5A 3LPNA 5C7OO 3PEYA 1QHYA 1FOEB 1QF6A 2B2NA 2BCEA 3MTDA 4PO3X 1G8FA 2PQ0A 3TLKA 3WMWA 9ICHA 3EGWA 2ZYVX 4BCDA 2ZJ8A 2E55A 3NIFB 5ICFA 1CRLA 3Q11A 5KDOA 2G08A 4R7ZA 4TWJA 4GC5A 1DZIA 1SOMA 3CLTD 4R1LA 4G86A 1BQ4A 2Q5OA 3M4XA 5K6RA 2ADMA 5LOVA 2ZRCA 4GHWA 3E3OA 3P9RA 3TLJA 2KK0A 2J8ZA 1U48A 3GDFA 4KNYA 1BX0A 2ENUA 1TJYA 3IQEA 4IL5A 3O0FA 4GLFA 5ICCA 5KTTA 4N5LA 521PA 4X6UA 3R3WA 4YQYA 3LVVA 4G5YA 2O54A 3AQEA 4KSBA 4GF5A 4IMIB 1OXBB 4XDHA 2C3MA 2P9GA 2NU6B 1EVQA 2LXNA 2ZZKA 1X38A 4J4HA 4NPAA 4FXOA 4EGAA 3N2KB 4ZZ1A 2Y27A 3CF0A 3MRSA 4II2A 4H77A 3FOBA 3H11A 4U9HS 2C8JA 5JMOA 2FF5A 2HKIA 4YMLA 1T36A 4JU8A 2VVTA 3DMNA 4CUJA 1ZHHA 2O1XA 2D5LA 4Z1MD 3FYCA 3VI4B 4RTKA 1II8A 2GJKA 4E2XA 1GGHA 3ZK7A 1FP2A 1ZUD1 4JB8A 4U7JA 5ABPA 1PEKE 2ZBFA 1W5FA 3DDZX 4MEBA 2VC2B 4HRYA 4XQ8A 2PMCA 2YDXA 3ME5A 3TOVA 3UY4A 2XRZA 1SZHA 3GDWA 4ECRA 2Z2IA 1VXRA 2IOQA 2VAVA 4UTOA 1PAUA 4ENRA 3EGEA 1NP7A 5CTAA 4D3SA 4OQ4A 3WSWA 3S5JA 1SXIA 3S7TA 7ICKA 1IB6A 2DE0X 5DF1A 2CV2A 3WWDA 5JPCA 2OGZA 3OCWA 4H15A 4LJ8A 1T9DA 2ATXA 4QOEA 4AVYA 1IAVA 4D3ZA 4BRWA 1WD7A 4QWMA 1PG0A 1RAHA 4RHUA 2EERA 5ECDA 2AOTB 3L7CA 5AKEA 3ZH9B 3ZQUA 3OSNA 4QUGA 3A4NA 1FU7A 1ULAA 1ZH6A 2G9QA 5J2HA 2CXUA 4H9GA 3BXFA 3GNLA 4M9CA 1DQSA 3MQ4A 5JQGA 3OPYA 4MDEA 1GLGA 3QZUA 3SXUA 4RNMA 1KH2A 2AS0A 3LRTA 4GMGA 2PG3A 1BA2A 4PYLA 5HP4A 3ZV3A 5J47A 3M8SA 2P67A 3MM4A 2R9VA 2ZB8A 2REOA 3SOZA 1VG8A 1Y6RA 3AQ4A 2IHVA 4HPJB 4TKZA 3QHQA 1PK1B 4AJ2A 2ECPA 5FYDA 1D5WA 2HMSA 2M6RA 3I9MA 5KNIA 1QSSA 3M6UA 4IFIA 2WA1A 1S8AA 3N8IA 4M89A 1SU6A 4D9CA 4DMCA 4CN9A 1H94A 4Y9TA 5HNKA 1KI7A 2YW2A 3RH4A 4N5MA 4MUXA 1VHQA 4JLNA 2G4CA 5DBAA 3ASVA 5JNLA 1N25A 1AQNA 1XTIA 1H2BA 5DX1A 2W43A 4Q47A 2WUDA 1JFFA 3HADA 4WTOA 1UPCA 1S6YA 3H83A 4MLCA 5K3OA 3V1UA 1E4EA 5H4HA 1M2OB 5F3XB 2EV9A 2W71A 3V8RA 3B2EA 1HLFA 2WNHA 3B53X 4LWPA 4KACA 3VDXA 2XV1A 3CY6A 1YQEA 2P90A 4HAUA 5CB4A 3L8GA 3OAAD 1UADA 7ICPA 3AQIA 5CJ2A 3SZMA 4P3XA 1N32B 2R5FA 3KWLA 3Q3GE 2WJ3A 3GGDA 2I9GA 4LGVA 2NPOA 5DHQA 1AK2A 5BQPA 3TLGB 4BMYA 3H87A 1NY5A 4HVAA 5KWSA 3RBEA 3B12A 1OZ0A 3GEDA 9ICRA 3WSVA 1OIWA 4M0CA 2B21A 2QG9A 5CVUA 3TGWA 2X0RA 3STWA 1RBMA 1SBYA 1II9A 3WOVA 1X74A 3QUSA 2OAEA 3FLAA 4G26A 4K26A 4PC2A 4RGVA 2H51A 2VRBA 3R3JA 3X0DA 1L4LA 3TARA 1HWYA 4P33A 3TQOA 3WMFA 3HA2A 2GKSA 4RA6B 4BL5A 3IR6A 3V00A 4W8HA 1JN3A 2IOYA 4FYXA 4EFKA 4NV1A 3TR5A 4HL6A 1GY8A 3A1WA 1MHPA 2EGHA 1EE1A 3LYLA 4X85A 5EHIA 1BZYA 3T5AA 3ISVA 3V8BA 4XWWA 2ODAA 4BZPA 2QVLA 4EL5A 5FFNA 2G1AA 1P3JA 1JRPA 2GPNA 4KXUA 3A9UA 1DAOA 1BOOA 1FSFA 2C9YA 2LYBA 1Q2XA 2WD8A 2YN2A 3P27A 3RVOA 4N76A 1U1DA 1EFRD 1KAOA 4OYLA 3WIOA 4PHPA 3NTRA 1PDOA 5LA6F 3O2JA 3TQCA 4PICA 3QMVA 2FN9A 2QTVA 4TV9A 3E15A 4UUAA 3C7CB 1HL3A 3SFZA 3UW3A 2OUKA 1QOPB 3PVSA 2YRFA 4ED8A 3T5TA 1MRZA 5I7FA 1P17A 2YZ2A 3REOA 4FEEA 4RQ5A 4RDCA 3GJZA 2R6ZA 2OSBA 3JR7A 2XCPA 3A0HU 3LKVA 2ZCVA 3IESA 4FYPA 1DBSA 3UGQA 5A3RA 1MH1A 4URFA 1AE1A 5G0TA 4BAUA 4N49A 3HYSA 1G20B 3DTNA 3HXKA 4EEYA 1KZHA 1XTRA 4C4YA 2E5FA 3GJTA 4D4JA 4DLVA 1MO2A 4EHBA 1PN3A 4WE3A 5GIPE 3IAFA 5DM70 2XDWA 1W9HA 1IULA 1Y7TA 4R1NA 4AYBC 3MDCA 1DHRA 1OWMA 3FWHA 1O97C 3TZEA 3U1BA 1GM5A 3OT5A 4EZBA 1B14A 3BMNA 4EHKA 3VAYA 2VHTA 2JZNA 1K9SA 2C4HA 2W7TA 5EMJA 2C9DA 1T2NA 3H1PA 1JLSA 4RQ4A 3MWDA 3E7PA 5TR9A 3ROZA 4FEGA 1A8QA 2WF9A 5L1LA 5T14A 3KFUF 4MI6A 1Y5IA 5HCUA 2C3PA 5CA0A 3SS9X 5GWXA 4D3XA 2BW0A 3GEMA 1BIFA 1MAAA 5CT8A 3H3JA 3NMUF 2EP8A 2OXFA 1QGAA 4EYQA 4K9SA 2YYAA 3PXEA 2WTXA 1CR6A 4NYMQ 4EA6A 1C30B 1TZJA 2FP3A 2YKGA 2JXJA 4RENA 5JS7A 1VXOA 2H7XA 4KN4A 2ZSHA 3ID6C 4QU9A 3ROTA 2KE5A 3U4DA 2KP7A 4AZTA 1AGPA 1SVOA 3DB1A 5F78A 3IUQA 1OBFO 1EX1A 1HE4A 2H1SA 2W90A 3C3JA 5SY9A 1RHKA 1LTKA 1RHRA 2YY6A 1DBVO 1JIIA 4E1AA 2K8BB 3RIHA 4R63A 3WL6A 1MG5A 1GDHA 3NVVA 4ZPJA 1ZQGA 3DAPA 1H1LB 3PU6A 3BK1A 5JDCC 2JLCA 1Z0IA 2YVQA 1E3MA 1VPDA 3O92A 4IDGA 4KN8A 1F2VA 3KKMA 1Z2PX 1PR0A 1U31A 1XAIA 5EWJA 1V9SA 3DP7A 3UBMA 4DMFA 1IXSB 1B3RA 1PDWA 4KLSA 4O4LF 4TMVA 1KI9A 3KJHA 5F9MA 5CDFA 2JJ1D 2WKWA 2C4VA 2CLCX 2ZUVA 5G0SA 4BO6A 2HOIA 2NNLD 5FI1B 2C5HA 4IG4A 1KMQA 2G4LA 7REQB 4COKA 1ONPA 1ZW1A 2HHJA 3NTUA 1BHSA 1MR3F 1YVRA 3LECA 3OZEA 3R7AA 4BGUA 2WK1A 1HFEL 2EFJA 1A7UA 3GLSA 4ZVOA 1PS8A 2VZEA 4Q44A 3FKSD 1WB9A 1E6CA 4YCDA 3GJ8A 4COOA 4QUKA 4PG8A 4EQZA 1ORVA 3NB0A 4JIGA 4TXMA 1LDBA 3MC1A 3H19A 2IS4A 2RBGA 4UM9B 3AVOA 3FAZA 3MCWA 1F4LA 1I4EB 3HA7A 1A9XA 3D1LA 1SL0A 1XHFA 2W6JA 3TAXA 4AMGA 3RRXA 2QPLA 4PCLA 5IBQA 4IO0A 1N1GA 1T5HX 2V5VA 2J6SA 2VPZA 1OASA 3T52A 1GITA 2H48A 1RYNA 4Q9HA 4MW1A 3CR3C 1WIWA 2EKZA 4IXNA 4YACA 2C42A 3I8OA 3RC8A 3BGIA 3IP7A 3C7DB 4AW9A 5JZMA 3V34A 1WX1A 2IY7A 4GECA 5NLLA 3W3AD 5DLGA 2CXOA 4EGJA 4MRAA 4R3UC 1X42A 4LQLA 3E58A 4X93A 4NBRA 4D8VA 2O5CA 3M34A 1OPRA 3OTHA 4KPGA 5CFRA 4WBNB 4Z9YA 2BFBA 4PC3A 3W04A 4AMYA 2C5GA 2RAPA 2PUEA 1VLQA 1XZFA 2BT4A 4L85A 2IL1A 4U2FA 3SBDA 1WCYA 1C1HA 4DQDA 2ZI7A 4EJ6A 2ZE8A 4HDAA 4I5IA 1EXNA 1SNYA 1K98A 3SQNA 2ZZMA 1UQUA 4WY5A 2AFIA 1EA5A 5E4FA 3G8DA 5H82A 3UW1A 4MYRA 1NUQA 1SWWA 1AOXA 2JCGA 1H42A 2P3OA 1X2EA 4QBKA 2EARA 5JJCA 1V3QE 4X94A 4UZSA 1PGNA 3EC7A 1VI6A 4LK2A 1AJEA 4D8TA 3T9DA 5KNBD 1CRWG 4QZCA 1Y8QA 4M1OA 4W7SA 3R3VA 2SICE 2BM9A 3FI9A 3IJRA 3PFKA 2BLLA 2C31A 3MFHA 5KL8B 5A0LA 2AGVA 1G3RA 3AU8A 1ZWLA 1ECPA 1ZQVA 3X2EA 1ZA2A 2C8VA 4D98A 4E30A 3AEQA 1W5BA 2ZUDA 4WXRA 1UFKA 1TYZA 2IDZA 4JXZA 5BORA 1HURA 1OXUA 5ALOA 2QPOA 4PSUA 4POAA 3TNFA 4ELTA 1QO0A 1XAHA 3OFVA 4U1RA 1UBMS 1EAYA 1ZINA 5FPPA 5TV2A 5FV4A 3H1BA 4L3VA 1U3DA 1SKYE 3V32A 3AUKA 4BV9A 3K96A 2HA7A 2JLVA 4W5HA 2V55B 1G4UR 1XSNA 2H6EA 4XJVA 3HKDA 4M7PA 4KUGA 5A3SA 2UVDA 1J99A 3ADCA 1K3TA 1ANKA 2HA4A 2C3OA 2XGSA 1G5FA 8ICKA 2FPKA 2B6HA 2J30A 3PHJA 5KFXA 3NYRA 2BGLA 1VM6A 4O4LA 4JLPA 5FXMA 3Q8LA 2ZIVA 3VH3A 2B2XA 2GTIA 3CRXA 2O7NA 3EB9A 4H7KA 3NHFA 3PGVA 4YLYA 3CW9A 1DKRA 4Y30A 4AKSA 3B9BA 3D9QX 3D6NB 3LDHA 1B2LA 2WILA 4QFDA 1WZNA 2IX3A 1VIVA 3NH6A 3ENWA 4HGPA 2BY4A 1I5EA 3X1DA 4FDUA 5HZKA 3JZIA 4LRXA 4TTTS 5B1DA 2HF2A 3KTAB 1IJBA 3VZCA 2P4SA 1QHNA 1SVUA 3CH6A 1BS1A 1B8OA 2D13A 4ND3A 3FZEA 2QYTA 1R18A 5KHLB 1RRVA 1L3UA 2KIVA 2H5IA 2HJHA 2WDZA 3V6KA 4Q9NA 2PS3A 1L7OA 1W46A 3WIDA 3ASZA 4RNCA 1MP0A 1HLPA 5FRDA 3IOEA 1E7RA 4GPZA 4HDQB 4I66A 4WXYB 2JBHA 2ZCJA 2A58A 2I91A 1QAMA 4LTDA 3T35A 1E7YA 2HWKA 3TRHA 1K5HA 3EXHA 3O2QB 4Z4EA 3WJ7A 1NQ5A 3LLUA 3VOAA 5HMLA 4DIFA 5A5VA 2C2DA 5FNVB 4Y0VA 3N0WA 3KO8A 3RTDA 1SK9A 4L16A 1D2EA 3MNFA 4IJ5A 3ESYA 4M9JA 4XM1A 3PR3A 4YGYA 1UBTS 3PUKA 5K03A 1R6DA 4I50A 1D6JA 1VA4A 4Z4HA 1U9IA 4KDRA 3BTSA 2DGDA 4I36A 5I9TA 2HBRA 3I53A 4EHLA 4ZC1A 4DSAA 2UZ3A 2V3VA 4UVIA 5HDBB 5TQ2A 2VQEB 2J0UA 2GPWA 2MSCB 2NUPA 4HLUC 4ITRC 4EKDA 4HYKA 3RJFA 4JQCA 1W2WB 1I6MA 1NW8A 2C4TA 4JJZA 1UPTA 5DBOA 1JIUA 3EDCA 2FFRA 2GLXA 4J29A 5EFOA 1NVVQ 2PSJA 4NU8X 5EHGA 4BLTA 3PDUA 1NVFA 4IZIA 5HF8A 1VZ3A 2JIBA 1OB5A 4OLJA 4LISA 1BFKA 3D7LA 3ONWA 1IM8A 1ZGBA 3KZIU 4M9LA 1WMSA 4ZOAA 1ULSA 3ROPA 4Q9KA 4RAOA 1JIXA 2GLEA 3KOYA 4DOCA 2EWMA 2Z9CA 1ZK2A 3EIEA 4BRZA 4F5YA 4C22A 3SAHA 1G0NA 3HKEB 4XJTA 4GKBA 4W1SA 4O1HA 3ZZ1A 4DV7B 1JEAA 2LTAA 1F06A 3HFJA 3DF9A 3F9RA 4J1TA 5ERGB 3K0BA 4HQLA 3EGOA 2YV2A 3VJRA 1DRGA 4IBOA 1P0PA 1YXMA 4MJ3A 4MV7A 2O3UA 4DNOA 5I51A 4JLKA 1IN1A 2BH9A 1QGED 1XEAA 5A4FS 4GPTA 3BS5B 4R8SA 3HN7A 1LK7A 4DLRA 3OQHA 3IHQB 3PQEA 1PGPA 3GRYA 5IAAA 1EWVA 3PR2B 1BJKA 1EINA 3DBIA 1LSJA 3HYTA 3N07A 1NLZA 4HO1X 3H5TA 3QWAA 4ZEXA 1XSPA 1QFJA 4P58A 1E2EA 2P41A 1PHPA 2Q1WA 2ONCA 3IAS6 4F5OA 5KG5A 1DJPA 1W5EA 2E9SA 2X5JO 2IYWA 2X8AA 3H65A 4GI2A 4PPNA 2FJ6A 5AW5A 3VR6D 3QPUA 4ZN6A 2QARA 1XRRA 5DQHA 1LBEA 1NAHA 4HNGA 5FV7A 1QCCA 5SYMA 4GPBA 4RHTA 3EQ7A 3CZ9A 3HKCB 5DKWA 3K2IA 4XQEA 3W5BA 1Z56C 1RKBA 3N2NA 5G5GA 2YB1A 4PRZA 3GA0A 2O57A 2JFPA 3X1KA 2XMZA 2JFVA 4QHYA 3FWPA 1WPXA 3K73O 4AY3A 4ED3A 1JXLA 1AGNA 1XQ1A 1U28A 1ITZA 1O77A 3N97B 4OHXA 2CLOB 1VPEA 5H0IA 1UT6A 3GCDA 4AY5A 1U8FO 2WPDD 1YZUA 1SUDA 2MSNA 1GN8A 2B20A 1E3IA 1I5RA 4TQSA 1K7SN 1V11B 1Z4KA 1U99A 2I2CA 3CVOA 2VDQB 4GGPA 2C9CA 4JENA 4PSAA 3REGA 3T3MB 1OB2A 1TKBA 4EB0A 1K3FA 3DEEA 2J87A 3JQFC 3ED5A 2QMEA 3DVAB 3G23A 3R6GA 4E5MA 3H0KA 4OX9B 2BEKA 1CF9A 1WXWA 3PIRA 3BIOA 4MGHA 5JO9A 4F7DA 1WQ1R 3ZE8A 2IY8A 4BFSA 5EIXA 4MWZA 3DLPX 2PH1A 5KT5A 1YB5A 2WABA 2F1RA 3EQ8A 1XWFA 1DNPA 1FS4A 1B42A 4W5OA 5SY6A 3TTVA 4J7CA 4MGIR 1V9PA 5ECWA 2QYSA 4CFSA 1XVTA 5TXGA 1PG5A 2WWVD 3SI7A 4PZ0A 3KZOA 3QF4B 4GI3A 5EGNA 1SH7A 1V47A 1FBTA 1YQTA 1DDGA 2FR8A 3LX6A 4L0CA 5D2CA 3ZX5A 4FZ5A 4WA7A 3VZRA 1H2EA 1Z7BA 2XA2A 3ND8A 4J91A 1Q95A 4R0MA 3ZLVA 1CZHA 2VYNA 3FMGA 4M6WB 4N5NA 5ALMA 3JTEA 2XZTA 3W5DA 1U11A 2VCYA 1US8B 2YJ3A 2WOOA 3MMSA 1V41E 2J3KA 5BV1A 2UYHA 2GM4A 3LYHA 3Q88A 1D1PA 1ORWA 2I62A 4UHJA 2OVBA 3RU9A 3CCFA 4URYR 4AF7A 1XDZA 1ZD5A 5HCNA 4NR0A 5LXTB 3AGPA 3BM5A 3E0XA 4XEUA 3CVUA 4BX9C 3HB5X 3Q2OA 4QELA 3U9LA 3EE6A 4PRYA 3INGA 2H1HA 2VK4A 3CRRA 1INLA 5B5EU 4LZDA 3OVMA 4CM4B 1A8PA 4FN4A 3AKCA 1M2EA 1UPBA 1VPWA 3ZTTA 1N75A 1AUOA 1GL9B 1VJ0A 4P4SA 3L43A 2B0CA 3I6IA 3AG5A 2C4MA 3NDPA 4ZOCA 3R5KA 1CR2A 4I81A 1E1CA 3M6XA 4CKEB 3RS2A 1G66A 3C5EA 2UZ0A 3MRTA 4PBSA 2WU8A 2R8PA 5DO9A 1ODSA 3KJEA 3MWJA 1K1EA 3WWPA 1SXJA 3S3TA 3K4PA 1U0SY 2OD9A 4ZWNA 2QL5A 3QYAA 2JARA 3C6KA 2E4VA 5KSPA 1TMKA 2HF8A 4DM3A 3T3OA 4AK9A 2FUG1 4B4OA 3OEYA 1RLOA 2N1MA 2NTVA 1P72A 1V37A 1JLHA 2KI5A 2QLFA 3ETGA 2NQ8A 2HHXA 3MJFA 1PHRA 4U3JB 2BTEA 3AZOA 4EZEA 4FT4A 4V02A 2Q50A 3BX1A 2XW6A 5JYDA 1HDXA 1H3NA 3GFTA 4DJJA 1C7RA 4G1VA 1SGGA 2F67A 2JGMA 1RZRD 2BLNA 5KFAA 4I2IA 2OQ2A 4WNAB 1LWOA 2J5RA 3G1UA 2CFCA 3G82C 1DBPA 3PTZA 4PFQA 4U02A 3JX9A 5G0VA 4E0BA 4F11A 2R7AA 1VHDA 1IZYA 5B3AA 3QEOA 4K9LA 3JWGA 3TZCA 5KQRA 5L7WA 3BVPA 4C08A 5LKAA 5TNXA 2HM7A 3HNOA 1VL8A 4W8OA 2LR0A 3TMYA 2XA9A 2Q6KA 3IP5A 3OPMA 4FSHA 4A6PA 5DNUA 2RGRA 2VJLA 4M1EA 1YVEI 3AL2A 3I04A 1PFYA 5JHHB 5FA6A 2Y3IA 2QT0A 1ST3A 2RJ3A 3L40A 1X9XA 1KFDA 3OPYB 4GBGA 4FLEA 3GW8A 1XFDA 1SQSA 1QLNA 2J4FA 3IIJA 3TW6A 4BWJA 1FRVA 4F9TA 1OH8A 4KMMA 2WFLA 4H16A 3DZFA 2FY8A 1HDYA 4MKXA 1NHGA 1OPXA 4ML3A 1VLBA 4NPHA 3RVPA 2XBMA 3CM0A 1ZL2A 7ICSA 2GD6A 4B5LA 5TMPA 2O6HA 2M32A 1L5YA 4KLZA 4JUAA 4RH3A 3OTGA 2FSIA 3DW1X 4D0RA 1K68A 5KYGA 4N9WA 5E2AA 1L5RA 1KI6B 2ORWA 3CXRA 3QIAA 4NV0A 2OCGA 2RCYA 2NPIA 1LRLA 2VBGA 3Q5EA 4LYEA 2BZFA 1Y1SA 1UKYA 1I4OA 1R0XA 4JX8A 4QQ8A 3W6PA 3QY0A 1I9CA 4QT0A 5KFTA 4U00A 1F6BA 1K06A 1RRGA 3DZBA 3K8QA 4XJSA 3ZVLA 3PEWA 1SC1A 2PBLA 3E7DA 3JQPA 2WF7A 5IC6A 5JAZA 1QX4A 4XX0A 4TM7A 2BCJQ 2W4MA 3VJLA 1F20A 1YDWA 3MT7A 3I5AA 6ADHA 2IPMA 5ALLA 4I4TB 4XARA 1QFSA 1JL3A 1I7SB 1LX6A 3BWEA 3HQ4O 1YAJA 3OWXA 4ZV9A 3OOYA 4DUZB 1MOZA 1DIAA 4DLLA 1EIZA 1NMZA 2BDTA 2HYDA 2NZWA 4X6XA 4BMZA 2BPGA 5KJEA 4D9HA 2OL4A 4UTPA 3PLAE 5E6RA 4Y9DA 1J90A 2VJPA 5LB2A 2W37A 3R3XA 3ILSA 1T1IA 3NUZA 5FO0A 3AESB 3IVXA 4JYAB 3FUVA 1CG6A 1TYBE 1TZCA 3WKAA 1J8DA 1WCNA 2I6TA 2WHPA 4N54A 4UB8U 4WV3A 1F1BA 4EZIA 3O73A 4GKVA 4DSUA 1X9HA 3SZUA 1X14A 2Q4OA 1Z8FA 3GX1A 4NDAA 1FVXA 1MB9A 1VCNA 4XASA 5K01A 4O3SA 2J9YB 2RIPA 4MQLA 1KKLA 1T2EA 4ZAWA 1O03A 5AOCA 5FTMA 1G2IA 2QVCA 2J3MA 5IEJA 4FNMA 2YIVX 1P7YA 2EZ8A 5JXHA 4DREA 1FQJA 1MRNA 2GLUA 5JCOC 1JI3A 2I6QA 3MGGA 4OJKA 2PMFA 2IDMA 1M34B 8ICTA 1NVWQ 4FS1A 1ICEA 1EU1A 4XSGA 1YE5A 4QJIA 2EYUA 4B9TA 1KI3A 2ZJ0A 2H0QA 3O4FA 4JBHA 3KHRA 4G8BA 4KBFA 4X65B 4Q93A 4DV6B 4QRDA 3GJXC 3G49A 4QT4A 1AHNA 4LE2A 4XCVA 1KFCB 3TK1A 3OQMA 1DOQA 2OCYC 4XX1A 5JADA 4RKFA 3UXHA 4DPKA 1S8FA 1C7EA 2HIAA 2PVCA 3KT0A 4NHOA 3KJIA 4X44A 2BD0A 1ORIA 2QN9A 3GN2A 4GVPA 2Q3BA 4WA8A 1UBUS 1AMOA 5M2QA 1YRYE 1Z2CA 2FFHA 4X1YA 3N2IA 1MZPA 3MUNA 2YQ5A 3MABA 4RKQA 3WYBA 4D44A 3UPUA 4XA5A 1OFTA 1CIPA 4QXAA 4JLMA 3O26A 2HIGA 1AT1A 1T9ZA 1U6KA 4KXVA 2WU0A 3ISCA 4DZTA 3O8OA 5I4CA 3BXPA 1EFVB 2P4EA 2O8BB 1BPZA 2WM3A 1DWPA 4QDTA 5KTOA 1HLGA 4YAWA 2GCNA 2AWOA 3MD0A 5I01A 1WOYA 2PXCA 4WZAB 1EM8B 3NHLA 1CKEA 1MTOA 3EW7A 4HEA6 2IU0A 3T06B 9ICOA 2Q2WA 1DOZA 3DDHA 4II3A 4G5OA 1JR3A 1KAMA 1G6HA 4MS1A 5AXAA 2R84A 1UH5A 1RCTE 4JP3A 1OH7A 3H2YA 4RLFA 1IZ0A 2E7ZA 1TEXA 2PR2A 5EUBA 4E94A 4F4KA 5BXQC 4IQ0A 1O87A 4RS3A 2BEUA 4U63A 4US2R 4DQPA 2ZRAA 3GPLA 3TVTA 2CLSA 4HZUA 4YUAA 4QZFA 2BE7A 4OH7A 4A4DA 1M33A 1T1GA 3DBOB 1W93A 1U94A 3AFOA 4A2CA 4YUXA 3MG9A 3DLBA 4ZVKA 4YRAA 1GKYA 4LF8B 4UHDA 3LK9A 2AN1A 3DE4X 1L5UA 1B1CA 1VFNA 5DLPA 3RU2A 1H66A 2DSTA 1DSSG 1CDOA 4ZAVA 3SZGA 1V7ZA 2WHXA 3HA5A 1T1JA 4ZDKA 3W6ZA 1IXRA 1CULC 4ZEMA 2K4MA 1HUZA 3LGSA 3I1JA 3ITNA 4CKCB 1IJKA 2R7MA 1BXGA 3W2GA 4ZH4A 2Z9DA 4WK4B 2H3VA 3WL5A 1JKMA 1OWPA 3N5CA 4R54A 2YV1A 1H8ED 2ZRIA 5JJKA 3AC0A 1O4WA 1ZC3A 1EWTA 1Q15A 3DF7A 5KNLA 5T3UA 2CY0A 3C29A 2GHTA 2YYSA 1SRQA 1BTOA 4G1BA 4JXJA 4L4SA 4R8KA 5JHGB 3U19A 3QUCA 4QVIA 2OO7A 2YWRA 3ZD8A 1GTRA 1E0JA 3IMEA 1JJFA 3F3MA 4RPHA 3SSMA 4IQUA 4LUCA 1YJ8A 1N5JA 1GO3F 1KBZA 1YHYA 2ABWA 1Z00B 1QYVA 3NYIA 4NBSA 1DIGA 2PT9A 2W2TA 2H7VA 1SXJE 3IPLA 4K6MA 3TB4A 3ZJYA 4ZO6A 2PZEA 3ELUA 2CHGA 2OHVA 1VSBA 3HEBA 2FLLA 3UCFA 2D7DA 1SJ9A 1XZNA 1J0EA 2CNWA 4LXYA 1Q77A 5D84A 3GFPA 1VLVA 9ICBA 4XGQA 1PR9A 1KVUA 3O74A 1IVNA 3M82A 1URJA 4ZT7A 4DNPA 4NWIA 1KAHA 1WSAA 2GLTA 2PFGA 3W5UA 2EU8A 3LM8A 3GEPA 3JVDA 1UM8A 1WMAA 3S7ZA 1ADFA 1NXVA 3NHWA 2HCJB 4GAEA 2IMWP 1GTJ1 3AOEC 4X24A 5LMNB 4M6WA 1JB9A 2CVFA 2I4MA 3F8WA 3GNSA 3HUEA 1KY5A 1DUVG 4DV1B 2XQJA 1GZHB 3L4KA 1L0BA 2OCLA 4IXTA 2H31A 2P2DA 2Z5VA 3IEXA 1GA4A 2XPCA 2CL7X 3W8EA 3UMFA 5K6AA 3HUDA 1ZQXA 4DT1B 5DYGA 4CMBA 3VBEA 2YMMA 4KIWA 3N7UA 1EBFA 3KHSA 4L7QA 3QSGA 4N8SA 4LGMA 2BJHA 2MCFA 3UJCA 1TVKB 2J4DA 3FPFA 2XT0A 4XXHA 3KYDB 5C53B 1NK9A 4URHA 5IJXA 1QKKA 3QRWA 1XPUA 1AS0A 4UC0A 4KMSA 5HUQA 4WEQA 4AKTA 2ZRDA 1Z0ZA 2NMVA 5D01A 5GZ1A 2CK3A 2J0QA 3MBIA 3MWEB 5DCUA 5GAJA 4XYLA 4OGWA 1C9JA 1U9LA 4O3NA 4OMFG 3VGJA 4I7EA 4YAGA 3E2PA 2OY0A 4BKMA 1FYXA 2F6RA 1SBQA 2Q21A 2WSSD 3OMWA 4DSEA 1H2AS 1WXIA 1ETUA 1V0JA 2VTDA 3FSGA 3I0ZA 1LLUA 2JRZA 1JEDA 4I8IA 3U3MA 3QVTA 5AKZA 1ZQ1C 1XZ8A 1YRQA 3P0HA 4P4UA 2XUKA 3O4IA 1LPPA 3F5MA 4LQCA 4ZHSA 2D2IA 1EX7A 5AKYA 8ICUA 2VEDA 1YJ5A 1XSLA 2ZRJA 4KMOB 4Z4IA 4MV9A 2IBSA 4P5EA 1L8QA 4MR8B 1HT1E 4ESEA 1HQKA 2P5TB 5T41A 3TZHA 1TGVA 3LHDA 3NHBA 4FIZA 5FOVA 5LZ7A 1VB3A 4DIKA 8ICWA 1OFVA 3TAHA 1G6Q1 2EX1A 5GONF 1ELOA 2P8SA 5C7IO 2ZI4A 4HQRA 3TUZC 5KNCH 2XNJA 2OV4A 2RKBA 2WYVA 2FSPA 2SKEA 3U1VA 1NIJA 1E20A 4I1YA 4RZ2A 1X15A 4NCBA 5CA0B 3AVTA 5CPFA 4CDNA 4DA0A 5C8ZA 4LY6A 1PV1A 3FFTA 5HK8A 3VR5D 2VP4A 3SC3A 1CZLA 1SFRA 2AEMA 5AVZA 1NJYA 1K8YB 1DBQA 1ZNYA 1OTXA 3AR5A 3BGVA 4PC7A 4ZOEA 1KSPA 2ODQA 1PR3A 2PUTA 3ANSA 2FDCA 4HSGA 3MLBA 4KFSA 4YC7A 3UAGA 4RV5A 4KLNA 4F3TA 4ZEWA 1N0UA 1HT3A 1JKJB 3A25A 1PUXA 2Q8NA 4YPFA 1UFVA 2ZIZA 4TYYA 1UMCB 3HR7A 3DZGA 4MKIA 4QTXA 4F60A 3V4SA 3WLHA 4Y2SA 3VR5A 2BIFA 1L7PA 2HXYA 3GARA 3KJXA 1BU5A 5DTIA 1GFSA 2Y0EA 3SYLA 3MS2A 2W11A 1FMJA 1D0IA 3GJSA 2VWGA 4ARVA 1P9WA 4MZDA 3HYRA 4NG4A 4IDPA 4CLRB 1J39A 1UPHA 1YONA 1GADO 1AKVA 1HE2A 4TXHA 1P4SA 2FZVA 1W73A 2X0JA 4RA9B 3SR0A 3HXOA 3ZVRA 2XMPA 4UUNA 5ED0A 4DLGA 4WK0B 5LQAA 4UHKA 2UUCB 2F3TA 4NDZA 3M6ZA 1NJZA 2GEDA 4FQ7A 2YUTA 4G1UC 2HIMA 4MP3A 5EP1A 3ZDZB 3W2EA 3Q8KA 2PE5A 5EE1A 5EEHA 5G53C 3C3BA 7YASA 4RTOA 4YJHB 4YAEA 4O08A 3ZDDA 3WZLA 3IELA 3N2YA 3DBRB 3ALRA 2AI1A 1FPQA 5KYWB 2IZ7A 5CH3A 4KXNA 1VYTA 4OYYA 5JAOA 2Q9UA 5JW6A 5K8CA 3KAJA 3I2YX 3UMSA 1WXQA 2VP5A 4BKUA 4NZZA 4YWJA 2I66A 4QWWA 2DMRA 1C2TA 2ONYA 2X8LA 3KPUA 4AJOA 4BWGA 3IVCA 2OCPA 2XO7A 1QP0A 3AUFA 1M74A 2XNDA 2Y9PB 5LNK1 3THYB 2MOKA 2VDRB 2BDPA 2LNDA 2ZTSA 1GNLA 1AKTA 1J97A 1BCSA 2OD7A 1SC9A 1V3TA 4H3VA 4R6WA 2Z8XA 3B3FA 1H6BA 3HU1A 1MT0A 4TPKA 4MF8A 1JHPA 2OLEA 5JZ9A 2BZ1A 1HKUA 4GM0A 4KQ1A 3RKSA 4F38A 1ZXXA 2ZI5A 3SEIA 1SHKA 1HPLA 1P5RA 1QFZA 3I5XA 2Y2UA 2DQNB 1OX5A 3WKEA 4K40A 4MI1A 1DQYA 3B9PA 1Z8HA 4DR4B 5JCXA 2OBLA 3UYLA 3K0AA 4TTIA 3RC3A 2YWHA 1NBME 2EJBA 1JXEA 5LMUB 4P0TA 3ZW9A 5ADWA 4ZOHC 1WHTA 2Q0XA 1VA5A 1I3OA 4ECXA 1N5OX 2ZPTX 4W1PA 2GPBA 1KAGA 1XMVA 1D4FA 3KB1A 4X0EA 1N2GA 1KAEA 3HE3A 3SV4A 2PFNA 1S3SA 5D86A 5BSTA 3I0MA 5JCJD 3VAAA 4E5UA 1ARZA 1KPIA 2CDRA 4QUHA 2C1EA 1V1MA 2WB1F 5IAKA 2GKGA 5ILOA 4LYYA 3WYEA 2VDJA 3WC4A 2YJZA 4MVJF 4KH0A 2DFTA 5ICGA 1NF8A 5KINB 3PW7A 3HWWA 3LUBA 2WU4A 3EZXA 4TZ6A 2HBKA 1TVAA 4YYEA 4PHDA 3OEHD 4FBTA 2H17A 1Z6GA 4OLBA 3RGGA 4B17A 2E5LB 1CEYA 3PWTA 4Q3EA 5TEVA 4IW3B 4RD6A 3IXLA 3QU2A 4FBMA 2E5WA 4EVSA 3T7KA 3TDMA 3DBLA 4UB3A 3P7MA 1J0CA 3UFBA 4Q1CA 3J7TA 5BQ3A 5FWXB 1E63A 3MS7A 3T1HB 1T4BA 3HKBB 2FEAA 1NLUA 3EZ9A 4OOFA 1ZQUA 1SUSA 2VHYA 4Q66C 5J4HA 5LQDA 1TCUA 2EZTA 4PGGA 1ZMTA 2PX2A 1MOPA 3ESXA 2VATA 3LQ1A 3EW9A 3QOWA 4MW9A 4TVOA 5GJCA 4YRQA 2YDYA 3BS7A 3EGXA 4DMHA 2Z6UA 2XOKA 2HSWA 4RDIA 3KJNA 3R7FA 4OK3A 1GGNA 1SBTA 1TF5A 2OE2A 2P4HX 2Y77A 3ORHA 4L57A 4TQAA 1SOAA 3B1YA 3GEIA 4K86A 5BRAA 1U81A 2CKDA 2PZ8A 2XTNA 1ZD8A 2FPIB 3QHPA 3CUVA 3GN1A 4KWIA 3UJBA 4GXTA 3K16A 4D8UA 5A0VA 2QN6A 5EVCA 4BY9E 3SG0A 2R18A 4HNRA 1TK2A 2WD9A 3PC8C 4TYMA 4RADA 4CQMA 5EJ8A 2XE6A 1XZBA 3E3LA 4KQIA 3NAQA 3P2KA 3RRYA 4D9EA 3RIGA 2QS9A 4CTMA 2ERYA 2VEOA 2OTCA 4PCUA 4NJOA 5KYUB 1VMDA 1OLUB 2JEFA 2JEJA 4EGQA 1CZKA 3SZ3A 1UBJS 3DOUA 2HNAA 3ZDYB 2Z95A 3HA3A 3JZAA 2B4TO 2CVQA 1QIFA 5KFYA 4RPCA 3U6BA 3AKDA 5CGQB 1SL1A 5FFMA 3M5PA 3D43A 4O3MA 1PFQA 1BGWA 1CU1A 4P4PA 1CR1A 4KHZA 1U7TA 2DQKA 2ZAIA 4HLUA 4BWMA 2PBZA 2WSBA 3O3MB 2Q2QA 2LDBA 3C1OA 4RF2A 2IS6A 4KXLA 5EP2A 4BMPB 2JA1A 3A3OA 3N8KA 4WASA 2MT9A 3DTVD 3Q5GA 3UJ3X 4QUIA 4BE7B 1TJ4A 4E5KA 2H3EA 2JDIA 2ZWOA 4HWRA 1ZVKA 2MUTB 1AGRA 2KV2A 1A27A 1IM5A 2Q7OE 3SKXA 2OFOA 1D2RA 3B7GA 2CDBA 3FFXA 4ED9A 1B1AA 5BNTA 2PEZA 2RHGB 4CXMA 1TPZA 3RJ9A 4JWNA 4MROA 2EATA 2J9RA 2P91A 2VNSA 4L73A 2Z2ZA 4YT8A 3VH1A 2JGDB 3JQ9A 1T3LA 3MELA 4P81A 1QHSA 1OA0A 2VQ6A 5H3CA 8ICGA 4RZIA 2OFPA 3IUSA 2G80A 5H3HA 3WOHA 5EMLA 4E46A 2M9NA 1QV7A 5KI6A 3OJXA 5B1EA 3EPHA 4LJKA 2YV3A 4I50F 4KRFA 3ZH2A 4UMDA 3H0RB 1YT5A 2QE6A 3CLRC 2J0EA 2JIMA 4XQ0A 4MDHA 3HKCA 3HM2A 1ESEA 4GWGA 4JDPA 2KZZA 2OCAA 4FCTA 3RS9A 1RADA 3UKDA 1ED1A 3KYDA 2G9UA 2MINB 4R8VA 3SLGA 3H5VA 1WSBA 1I4DD 4MUMA 3L0YA 3ROMA 1VIYA 3UYKA 3CF2A 5FHRA 2F2AB 2XSZD 5COQA 4EPXA 5KS2A 1YACA 1L4MA 3DOOA 2O5EA 4J9OA 3RYCB 1RE1A 3B1KA 1GRRA 2C2WA 3BILA 4WZBA 3G2QA 1TLTA 5A4IS 1BHJA 1V8BA 4FGLA 5CDFE 1LC0A 3MW8A 4H6XA 5JOQA 4CEJB 1O95C 4NC9A 2A5FA 1HOXA 1M72A 1KDPA 2OHIA 1TMGE 4I8DA 2F1KA 2AD5A 2WVGA 2JFGA 3FMVA 5LPNA 2CYAA 2JKYA 1U7DA 1KIAA 5KNDD 5ALGA 1W581 4LYGA 5LLDA 5IJWA 3ROGA 2XVYA 1NVTA 2GYVA 3I1FA 5CB8A 3SVTA 3IERA 3TUIC 3ZHBA 2VP9A 3KLNA 3ETLA 5LZ2A 1JI7A 1N3IA 2C07A 1IAQA 2ZR9A 3E05A 3M6VA 4ECAA 3AB8A 4W9RA 1JHXA 1WCIA 2M1XA 4ZHQF 2H9IA 1XUOA 3BF8A 4BJ6A 4F5EA 4IV8A 4UB1A 3G8AA 1Z3EB 2QUIA 4WJLA 4YP9A 3LU1A 1GZ6A 1VI5A 3KJQA 4H35A 5ICEA 5BWBA 8ICEA 4IILA 1ZR4A 1R8XA 4IFBA 2BMEA 2PNFA 1YBAA 3D0RA 3OKAA 3VVCA 4DS4A 4KR3A 2XXAA 2R5NA 3IIKA 4DXDA 3NNNA 2G5IB 1MX1A 2FVXA 2IYOA 1CF2O 2NAPA 3LXRA 4ALKA 4KI7A 3DAYA 2GJAA 3VPGA 5B4UA 2G63A 1U2TA 1RI5A 1XNQB 2PQ6A 1D4ZA 1O96A 4YP3A 2JK0A 4B3GA 4I6EA 2XCTB 1JLLA 5CNIA 4CM8B 3KTDA 4I9FA 3N7AA 5AVSA 3PHIA 2WD7B 3NO4A 4C4RA 1B4FA 2KN7A 1VYVA 2ZDQA 2EAOA 3RODA 2YL2A 5JD4A 5LWQA 4RA6A 4YD1A 2NU7A 1EYZA 2P9YA 4B0PA 3AL0B 4A23A 4G09A 1WDKA 4QODA 4BYGA 4D1YA 1J1IA 3L0ZA 3TPFA 4RSHA 3SQIA 1U1CA 2CB9A 3BE4A 4C1NA 4CG0A 1JAXA 3DE5X 4EUKA 3O1LA 3K9FC 2FPSA 4B6QA 1QOZA 1SUIA 4FFPA 1K08A 4KZKA 4MI9A 1LK0A 1RI4A 3E9QA 1N7HA 3JPRA 3V2HA 3NCTA 1CRXA 2X8WA 3A9TA 4OB8A 2Q45A 3P8ZA 1KYQA 4XI9A 3TW4A 2HBQA 3FBWA 2AZDA 1WSDA 2DHEA 2I03A 1PJCA 2HPHA 4UEQA 3SEAA 4MQ5A 5BUCA 1HRKA 1JPNA 1NJ1A 2ZS8A 4CQNA 4MVXA 2F3SA 1BEEA 1X1AA 1FXWA 2Q3MA 3GEEA 2ZUEA 3E9YA 3DWEX 4EA9A 1B7GO 4P2BA 5CCBA 3GT3A 4NOMA 3D8BA 3WYAA 2AXQA 2KMLA 4KQCA 3O3CA 1RS0A 1Y1PA 4FYVA 3GELA 2AGOA 3RKUA 1Z39A 3U7QA 1P1IA 2GUWA 3RFXA 1BVUA 3JY6A 1T4MA 4YMNA 4KEAA 2B1RA 1NJFA 4IQGA 4F2SA 5CBPA 1PZFA 3DW3X 1KK0A 4HH0A 3QI2A 3WICA 2QAGA 2W2LD 5IH7A 2E8PA 1LDYA 3PEEA 2ZIAA 3L0PA 4GKKB 1K2VN 1E79D 3F2IA 2FWBA 2RHRA 3H2KA 5CT4A 4YV1A 1QB8A 4R40A 2FPLA 2VNIA 3BBLA 3EFOB 1ZN2A 2JI8A 1PK3A 1MC4A 4HMPA 2RP5A 1PE0A 4INZA 4MVCA 4AKGA 1YZ7A 3NRCA 3DEYX 2LM1A 2XVAA 4HGNA 1A4IA 5CT9A 2R6FA 4RO0A 3QFTA 5HQ3B 3W9YA 5DDYA 2I7CA 2QTAA 4QSMA 5IHXA 3WRYC 5C1PA 2H7CA 4MO9A 4B3SB 3I39X 3PFIA 4BUJA 2HT1A 5IT5A 5EUQB 2FU5C 4KR9A 1X70A 3RD5A 1S3IA 4TSFA 4B9MA 3W9UA 2QQ5A 3SJBA 4P4TA 4UBCA 4RETA 3ZPXA 4X97A 5J2TA 1JBKA 1XRNA 2EHDA 1R2QA 1JYEA 4GGMX 2WINI 3N05A 5FT9A 1EXVA 2O8DA 1T8WA 1MPTA 3KIPA 2JW5A 4GXKA 3L8FA 4DJFC 5KX5F 4DMGA 1CD5A 3RQSA 1ZEJA 3EYWA 2D1YA 3TTUA 1G5TA 1I6WA 4UAVA 5AI0A 1Y8CA 4FDAA 4JWTA 5C8YA 1KEKA 4NM2A 1Y8QB 2IFTA 3LXUX 2BVNA 3T7TA 3W6NA 3TO5A 1F0MA 5CJJA 1G18A 4X61A 4MO2A 3TQFA 4DSOA 3JVEA 5F33A 3HJFA 2HD4A 5TVGA 3BSFA 5IEBA 3HK2A 4HLDA 1LJ8A 2NSHA 5CYOA 3SOPA 3WRXA 7AT1A 3SQLA 2JGAA 4BB5A 4RCVA 3VU1A 5BN1A 2RGYA 1PNVA 2ZRKA 4PRKA 4UM5A 2W6OA 4HTFA 1FJHA 4LRWA 2AA3A 5E38A 1W35A 2WTFA 1L5VA 1XT6A 4JT9A 1A6SA 1NT4A 5K8LA 2FYTA 2RGEA 3K9CA 4N0DA 1J1ZA 1YS7A 2VNJA 2XWJI 1TM4E 3N2GB 4U7HA 3RFTA 1PU2A 5J0TA 3A3PA 1DAFA 1L6IA 1KEPA 3CBQA 3A6JA 1P6UA 2E6KA 3QVGB 1F12A 3PPXA 3GRZA 3OQJA 2W8LA 3QI7A 4JLUA 4LVNA 3IUYA 5DXFA 3AP1A 1GPH1 5TMBA 1Y6QA 4NZYA 5FFFA 5IT0A 3L7JA 3GBVA 5I48A 1Y7LA 3LBAA 1KQOA 4FYYA 2H5JA 2QT1A 4EYHB 1FQWA 4PSCA 5A9SB 1NN5A 2VRCA 3RK1A 4D57A 4EYSA 2OG1A 4JHXA 2AGPA 1CNMA 4JGIA 4BN0A 1VRVA 1QQ7A 4U8HA 1IIRA 4C6RA 4IR9A 2ATVA 1N2EA 2N42A 3D8TA 3QV2A 4AJEA 2J45A 3NC1C 1FDUA 3R5SA 1JF8A 4JB3A 4Y2XA 1MHTA 5JBIA 7ICQA 3EMVA 3VM6A 1GZVA 3AY6A 1O9GA 3A4TA 3BQ0A 1Q0SA 3QFCA 3TX2A 1GTMA 1WZIA 4DMLA 3K1AA 2IWRA 2QZJA 4BB0A 4XWOA 1JVBA 4ZYLA 1BYIA 5BV2P 2PKYX 3G2MA 4HGOA 4ICAA 2FQXA 2HO4A 3U7IA 4C8MA 4TWRA 3R7NA 4XIYA 4QA9A 3P45A 4LZPA 1OV6A 3VKHA 4DL7A 3BD7A 3PE6A 1GXSB 2BR0A 1YWGO 4G36A 2HREA 3DEZA 3LRPA 2ILTA 1JAYA 3IM1A 2VYVA 3KKKA 4TV8A 2AXNA 5F7JA 5FQOA 4DV5B 1PK1A 3GB9A 3DEHA 3T4EA 2XTJA 4BNUA 4D0NA 1AXRA 4PX2A 1ZW6A 4P0QB 2BDEA 2UYQA 3FW1A 5FHQA 5T4BA 4ER7A 5F64A 1CY0A 4NYMR 4C05A 4OLAA 2J4CA 4PLZA 4MKFA 4NFSA 1MTZA 5CBPB 2B9VA 4Q37A 3OZDA 3SBEA 3BS4A 4F8JA 3H3XA 4UNSA 5BO5A 5J8YA 4WRRA 3MR6A 6Q21A 3GU3A 3AW9A 3QE3A 2B6GA 4UU8A 1UAYA 5FPHA 4YQFA 5CDHA 3OQIA 2K4EA 3VZDA 1Z25A 5AKKA 3ZWDA 2VQDA 4IF4A 4HAOA 5D1NA 5K0NA 5ALVA 1R88A 2EF0A 2AZXA 4AX4A 2BHSA 5B3LA 3OIWA 1KJJA 2POCA 4S05A 4UB6U 3BQ7A 3LY8A 5KFOA 3M9OB 4JCCA 3VPDA 4ZCMA 2CV0A 5EZQA 1UKBA 2PN1A 4WLEA 2HJGA 4DG8A 5DK4A 3LGAA 1A72A 1TV9A 3GJQA 3EIUA 4I4LA 3ANLA 2VNKA 5EZSA 4P0QA 3S1AA 4A27A 2H4YA 3RAPR 2JLZA 3QLEA 3VO9A 5L40A 2HSEA 1QCZA 3KTQA 2CLKB 5DM4A 1I2MA 1KYIA 1WKVA 3L0BA 4JFAA 1Q0QA 5EWLA 3EQ6A 5F3RA 3ZWPA 4EDHA 3CEJA 3OKPA 5AQEA 3IV9A 3UK0A 5JSZB 4MUNA 4ZO4A 3S2IA 5IJAA 5ICSA 4YUWA 4FOLA 3HGTA 4MTCA 2IPOA 1A2QA 4PNPA 3RSOA 2BSAA 1CLEA 3K15A 4LZAA 1QLWA 2DHQA 1FYFA 5LA6B 3ONNA 1UKZA 3I2HA 4GRAA 4XVQA 2G77B 6YASA 3WAJA 1GPKA 4O8ZA 4H0FA 2PT7A 4Q48A 3BF7A 1J5PA 1FU8A 2PANA 3CLSD 3NOVA 4AJKA 5CB0A 1FF9A 4XKJA 2KSQA 3FUCA 5CRIA 3WVNA 2NTNA 4MPTA 1EVKA 3O31A 3EOAI 3GH1A 4JVOA 4UMVA 3HWRA 4HPWA 4MP6A 2QA5A 2WT4A 1RU3A 1XNJA 2Z2JA 4Y2QA 3ONFA 2YNMC 3NIDB 3RAQA 1C0EA 3I04M 5JSYA 2Z4SA 3W1WA 2O2HA 4DQLA 2W3RA 1NMQA 3CIOA 3GUUA 1WCIB 3OECA 3T34A 9ICVA 3TJRA 3AL3A 1NJXA 2GK7A 4NKRA 1U45A 4TLCA 1E61A 3A9RA 4C4TA 5FNVA 4ARBA 3W8FA 1IXYA 3UUGA 2OZEA 3OEWA 3TI0A 4KKXB 4XFJA 2YHIB 4FMDF 3R75A 5JS8A 3FR8A 3NBYC 4LOIA 5ITVA 4BJHB 3U7HB 2ZOSA 1KERA 2G0TA 3KU1A 4J1NA 4Q15A 1SOUA 1OTYA 2WTBA 2JCBA 2HOFA 4QBIA 2MSLA 3LXMA 4WGGA 3O8OB 1IXZA 2QRMA 5IC4A 5IK2D 3E1GA 1W6UA 2Z7JA 1E3WA 1E5XA 4JIMA 2W6ID 5ANRB 2LYAA 5EJMA 2HA2A 4BJ3A 4GC9A 1A82A 2HUPA 3BQ2A 2CLLB 3BL5A 3NRBA 3F5DA 1ZISA 4ZALA 4EUEA 2X9QA 3R9IA 1VLHA 2JI9A 1KPGA 2ZIGA 2W2XA 1TQ8A 1A77A 5CNJA 4PYIA 3CINA 1KYVA 5KVVA 3CJQA 4W6QA 4MMZB 4BC1A 3GA7A 3G7SA 5CG1A 5L1JA 3CWCA 1N2OA 3CYFA 2JHDA 3CLTC 3UHOA 4R4JA 3ZTWA 5D46A 4C8OA 1S2IA 1T3ZA 4WT7A 2BRUC 1J7KA 5AWFC 2KG5A 2IPNA 4ND8A 1U7ZA 1ODIA 2W2LA 3Q7TA 2BHLA 3IAAA 4OJYA 3R5XA 4AKHA 1PFVA 4B9VA 5L8VA 1R8SA 3FAKA 4I2FA 1M1NB 1AKUA 3VNVA 2C29D 2Y1WA 3EPRA 2OV1A 1J8MF 4RORA 3VV2A 3HKDB 4JLOA 4AMUA 5CB1A 4MB0A 5AQ1A 4RTMA 2X6RA 2ZVPX 1NUUA 2WTEA 2JGLA 1USUA 4NEHB 3U09A 3COZA 4DR6B 4K3VA 3G7NA 3GGPA 3BMCA 4OJ5A 4KRGA 5D6NA 1X8XA 2PLRA 3FC4A 1ZYQA 2D3DA 3BEDA 1NTRA 3QEMB 4OKIA 1BPEA 1LLCA 3DD5A 4LGCA 5KOHB 1GRCA 1C1YA 1YUMA 1Z6QA 2F8TA 5LQRA 3OIGA 5ALIA 3SQDA 1UZUA 1ZLXA 5HIKA 4E21A 3STYA 4BNKA 5JPDA 3FCCA 1RVDA 2IPLA 3AEVA 1YS2X 2ZU0C 3PHGA 4JI8B 3T79A 1RW4A 1L5KA 1VIDA 4MGEA 4NMMA 2E8MA 5AKLA 4UAUA 4U5XA 4R8MA 4E33A 4CG1A 1R9NA 3ILVA 3LX4A 3MCUA 1PVQA 3EHEA 3ROXA 5DLFA 2XZDA 5BW6B 3R76A 3EVFA 4DJEC 2PQ2A 2FE4A 4WKNA 4BFXA 4CLHA 2Q28A 3OH8A 4TTPA 4TQUS 4BATA 2RI1A 4CR7A 3GLRA 4R1SA 5J4LA 1A7AA 2Y6VA 3ER6A 3M83A 1G4HA 2FHSA 1U9JA 3FGPA 1OYYA 2L0XA 2W8BB 2NVUA 3ILXA 5JSHA 2WHQA 2QVZX 4YPVA 1J06A 1U7PA 2Q41A 1BPXA 4F6CA 3NDBB 4FONA 4QOSA 2XMRA 4QZEA 1PVRA 1R37A 3AR9A 5SY4A 2I87A 3A31A 1SVIA 3I52A 2O2CA 5I8WA 4WBNF 2JIZA 2JFYA 3IILA 3OCXA 4G0YA 1L5FA 4HNUA 1K8QA 3DAHA 5BW5A 3HBLA 3R3HA 1JWBB 3WLJA 3R4CA 1DJMA 3HDYA 4K4GA 3PNYA 3MTEA 3KSAC 3U13A 3ZUGA 2GBLC 4DLZA 3AR3A 3KWFA 1MDFA 5F5NA 4C7YA 4RVSA 3E9CA 5F77A 2E3TA 3I6QA 4QULA 1SXPA 2GAAA 2H3FA 3C5CA 3DBLB 4DW8A 1GPNA 1I2AA 5LQMA 3DO5A 1MENA 2OGWA 4P92A 2O8VA 3U56A 3V8NA 5EPEA 3T3IA 2RCNA 2TECE 4FDVA 3IA2A 3CMCO 1SBCA 3D4LA 4E88A 2O2GA 1A9YA 2KIWA 4MXDA 4DKXA 2HSJA 4LCEA 3JWJA 1G2OA 3M4JA 4BCBA 3B6IA 4O0MA 1OU0A 3PSIA 4HZUB 1QZ3A 3MVEA 4NDNE 2H5EA 1OIXA 1Y5LA 2IHTA 3I09A 2HHVA 4L5JA 4K2HA 1C14A 3R8FA 1Y3FE 3FPCA 4Y18A 2P77A 3H4MA 2VWPA 4Q43A 1B15A 4WXPA 1F2TB 2OGTA 3KG2A 4MJLA 4N0MA 3KQLA 1L4KA 2VA8A 3L7AA 4NNPA 3LHIA 5DYYA 3HYNA 3S5UA 3ZWWA 5JSQA 1DX4A 3GEGA 1TRHA 3LMKA 4PPFA 4JJFA 5FBQB 1A2KC 4GOLD 4HNAA 4YEDA 1CX9B 3HRHA 3LH5A 5IMSA 4UAYA 1FCJA 1OBCA 2ZTVA 1BOFA 2ONZA 1N6IA 3EJWA 3PUVA 2ZSKA 5E0KB 3VV3A 3V4VB 4IJQA 3VR2D 3LJKA 3RABA 1SXQA 2JGIA 4EATA 4XIJA 3IOYA 3NAMA 2ZG6A 4GOMD 5EZYA 1NLMA 1N2SA 2DPXA 4DCMA 3LX8A 1YOVA 3BA6A 4BVAA 3KHHA 1ECJA 1USKA 2FPGA 4JBYA 3UMJA 4DF3A 3E2IA 4MV5A 3I34X 4B4VA 6AT1A 3V1YA 5HS4A 4J8PA 2CVHA 4ZCPA 4C6SA 5JVDF 4YD2A 2R44A 3F1KA 1QPGA 4I3HA 4BIIA 3NM4A 3LL7A 3WYGA 1JA0A 1RRPA 1J4AA 4JLAA 4WACA 1HE3A 2OCXA 2DP4E 3DBHB 4DQKA 4OI0A 5I7RA 4FFSA 3THYA 2JGRA 1VDMA 2ZDGA 3Q3HA 3BD6A 2PXHA 4POOA 2KTQA 1XQYA 1U3VA 2QV7A 1TZMA 3AOGA 4Y7DA 3KX2A 4D4GA 2P65A 5BWLA 1L7EA 3UAWA 1U3WA 1ABBA 1ISPA 5KFIA 1Z35A 4EZ6A 1GPMA 1DWUA 3VKGA 1ZKMA 2HRRA 2Y05A 2H9AA 3OTWA 2W6MA 4YALA 4C76A 2O8EA 4CLXA 1QORA 3NKFA 2Z5LA 4R51A 1GZ5A 1IZ7A 3SX2A 2FFQA 2PWPA 5EKTA 4XGRA 4E11A 5KNDA 4PGQA 1KJIA 5FPKA 1PX2A 2G88A 2PH3A 4LDNA 4Q7EA 4QTZA 3AM3A 3OZXA 4OSEA 4TQRA 4QPZA 4O0IA 1RJFA 2Q0SA 1RJWA 5IDXA 3OMLA 4P8RA 4BNLA 3ZDXB 4UE6A 2WSYB 1WW8A 1FP6A 2D1FA 4RBNA 5FOWA 2WG0A 2O3QA 2F1JA 4I1OA 5K0ZA 2FW9A 1I7LA 3IEUA 4PEVA 4X8HA 5FUMA 1AKNA 4MGZR 5IUJC 1H4QA 4NJMB 4QGSA 2A5YB 4IP0A 4WFIA 1VZ2A 2H1LA 4KIUA 5F4BA 1XLUA 3BDIA 4MLZA 4LDPA 5B7NA 4UCFA 4E15A 3ICOA 1NJ2A 3TE7A 5IX8A 5LZ4A 4QNRA 4OHZA 3GGJA 4Z8XA 5AVYA 1P4JA 3Q12A 2Q3JA 1CQZA 3L7KA 4UM8B 1T6YA 4CM8A 5JSZA 1CJBA 4QOIA 4ZOQI 1TK0A 3RAEC 3PGMA 2EAUA 2ZI3A 3E1SA 4RJ2A 3BB4A 4P2HA 4HZIA 3JATB 4LX0A 1T91A 1N5MA 3DMHA 2Y67A 3F1LA 1AO3A 1Q84A 5CLLA 4EK9A 2P7HA 1FUEA 2JVKA 4LVSA 1P33A 4UVHA 1SCIA 1KO5A 1T43A 4OFBA 1C0PA 2J7KA 3C41J 5TY0A 2BF7A 2Y99A 1OX4B 4IHKA 2OWOA 3WY9A 3LG2A 3JQFA 3G6XA 4NI5A 4RQ2A 3TSWA 3V4PB 1XEWX 1XKLA 4FX5A 4H27A 1C1DA 4RVFA 3UENA 2EAPA 4ZI2A 4G63A 3UBTA 3K0CA 1CIJA 3OQNA 1GNSA 4BO0A 2G4VA 2AMFA 3Q3JB 1A0PA 4UAZA 2J9FB 1WPQA 5TLSA 1EGHA 3QELA 1UQRA 1Z2DA 4IUYA 3QUBA 1LBIA 2AFHE 5K3DA 2IU4A 2ZLBA 4ZJUA 5FLEX 9ICJA 3U2QA 4JI4B 4GZ5A 4JV5B 3FMOB 4KXWA 1YHZA 1KQGA 2GARA 1X7XB 3CIFA 1I3NA 1V7PC 3LY5A 4MVWA 4N47A 5F9LA 1V8FA 2WU3A 3BSSA 5DX0A 1T9AA 1OI3A 3DV9A 3JRWA 3CUUA 3RC1A 2G5HB 4KN7A 4AUMA 1IOLA 3FFWA 4JKYA 4KITB 4WLNA 4QYXA 5CB4B 4LJ6A 3SF8B 3M4NA 5BMVB 1Z15A 2CJPA 2FSGA 3SYNA 1U8XX 1L5LA 4C6HA 2RGNA 4GE0A 3VR6A 3ZHSA 4ZCIA 3AVYA 4UOEA 3NPMA 1MQSA 3C5VA 4G9GA 4F12A 2VPXA 1TMYA 4O5CA 3GQBB 2YN4A 1U2SA 1G55A 1TYAE 3F5SA 3ELBA 1ZITA 4TV8B 4FINA 3ZXIA 4CEIB 3SYRA 3BD9A 1P61B 1MMFB 5KFBA 1CEQA 1J07A 3E5NA 3HNRA 4TLLB 4YAFA 2H57A 3WLQA 4EG1A 1U0BB 2P2CA 2ZT7A 4CKZA 1BPBA 1JQLB 3H99A 1RTTA 3A4YA 1TEZA 1YVPA 1XRSB 4X20A 3UT6A 1ZSVA 1OZFA 4Q1DA 5G40A 1UEIA 3Q9LA 3CEHA 2B1GA 3UOWA 3DKKA 8ICYA 4U7FA 1M2NA 4PAGA 2GKOA 4S2EA 3CEMA 2R47A 4UNIA 1GVNB 3Q6IA 4O59O 1TM2A 4FVTA 1KP2A 2QX6A 4GSKA 1P29A 2FI1A 1ZMOA 3C14C 5LSAA 1OBOA 4OHMA 4KQEA 3AFIA 4LBYA 3G6VA 2QXTA 4EPYA 3BL6A 3V7FA 9ICSA 2AJTA 3L3FX 3ZU6A 1CZNA 3UUWA 1XZJA 4JBIA 1KE2A 5J0XA 4WINA 1Q20A 1T0PA 2BZ0A 3NRJA 4G2TA 3K0CC 1R0LA 1B3BA 3D2NA 1AUXA 1PL8A 2YHUA 3BOSA 5IUKC 4BMOB 2WYOA 3KZ1E 4KSCA 1RQRA 1FA9A 1TA9A 2KQUA 1N3BA 4LKRA 2XXJA 3LC7O 4BX0A 3H5IA 1ZP6A 3W5CA 2OYSA 3RFAA 1DPFA 5DG8A 3GFOA 1J2NA 4M04A 5KT4A 1HMYA 1Z08A 1PEDA 4BVEA 3K70D 2RD2A 2AQ4A 1M2VA 3NGLA 1V1JA 1L8XA 2D5BA 4PQEA 4E5DA 1F2UB 2P1ZA 3IR7A 1V25A 2ISOA 1P9OA 4XRHA 1BU8A 3H2BA 4B9NA 3GPBA 4GX1A 1FRZA 1JU3A 4RKWA 1PSZA 4RVNA 5JAMA 5FI0B 2UVRA 1XK6A 4JMLA 2A1JB 3TNYA 1BJTA 1F4PA 2CW5A 4MICA 4HVCA 1OSNA 3RVJA 5JFOA 4I4IA 4QVGA 3JSXA 1MFZA 4M9SA 4MQ6A 3LZCA 4YCMA 5L4LA 2X15A 2J3LA 1N0HA 1MD9A 3HPRA 4L3WA 1GG8A 4S3MA 3WHPA 1JH9A 2Y2VA 3FX2A 1G3IA 4NRDA 3SIWA 5FF9A 3ICPA 3J81k 4WKOA 1RPLA 4DZZA 1F4VA 5EWMA 3WGJA 4IDEA 3R0ZA 2JV3A 1PLKA 1ADYA 3JD4A 3OLZA 2O20A 3SN6A 4BV8A 2DQSA 1MOQA 3SIXA 2KSOA 1GNPA 1XEXA 1E5DA 3FROA 3RWBA 2NT3A 2Y0BA 1COWA 3KR0A 4ZYUA 1TAUA 4MJXA 1ZIXA 2JZBA 5K4LA 4CL3A 2AEFA 2JH3A 1I24A 2CUZA 3L04A 4MA5A 2IS2A 1J2EA 3FLMA 5KAFU 1Y7PA 2POQX 2ZE5A 4H4CA 5E3HA 3GIIA 1T9HA 3NUGA 2EP7A 1KP9A 1X9SA 2QZ4A 2WQ6A 1JDUA 1FUKA 3ICEA 2MYTA 2WYUA 3A0RB 4Z2AA 5JTIA 3AM4A 3H5OA 4K8OA 5EFZA 5KZMB 3PXGA 1GO2A 5C4IA 4JT2A 4TKUA 4XB2A 5DI9A 5KPJA 1MN6A 3GR6A 1QP8A 3HVIA 1VJ5A 2FRVA 2HGSA 1TA0A 4EF6A 1T34A 1R5JA 3PC2A 4BUZA 3EJ6A 3WGVA 3LI2A 4EOGA 1SB3C 2FJPA 2ZRLA 4I5EA 1ADGA 5D5PA 1ZD4A 2J3QA 3ZWQA 1WWKA 2P3SA 2WZQA 1JR4A 5UKDA 1O94D 4Z6DA 3EX7C 4G41A 3T3FA 3BIWA 4B75A 3L18A 4Z54A 5KPDA 1Q1GA 2Z2KA 4NXNB 2R85A 2YNMA 1QO0D 4EUFA 4R9SA 4QGGA 5KT6A 3HCNA 5CEEA 3E5MA 2VR1A 4B79A 1IATA 2AGQA 2B9EA 3QV1A 4N3AA 2EW2A 3DDUA 3ZZUA 4BZQA 3UMYA 1E1DA 1EK5A 1ZJ4A 4WW0A 4CM3A 5AJHA 4PNHA 4IKEA 3THRA 2R6JA 3AMZA 4O3OA 1SOVA 5E4YA 2WFLB 2V8BA 5EJEA 4L5IA 2P9TA 3D8NA 4K1XA 4FNGA 1YNSA 5BN5B 5FLXA 3CHYA 2A57A 5LP1A 4OJNA 4CTJA 1KMNA 1KNXA 4Y67A 2C59A 1JLMA 2K2QB 3DMTC 5DHPA 3IEMA 2WFAA 1K8RA 2GBPA 3ENVA 3N87A 3JAKB 4J2OA 3W6OA 4GP7A 4BFWA 3PW2A 4URVR 8ICXA 3I8XA 2R97A 1D4OA 2R8RA 2FMPA 4Y6GB 4Z3OA 1A50B 3CC8A 1RSZA 1K88A 2DY1A 3GLKA 1P6QA 2BZGA 3ZHVA 2BUAA 2HTFA 1Y80A 4PLWA 3PX2A 3CNNA 2DLDA 5CLJA 2Z2YA 2BM0A 1FJGB 1BE1A 3GRVA 3GHYA 5ELMA 3TDKA 5CJ7A 2VT2A 3L6OO 4BX2A 2BQ3A 2CJFA 2X77A 1I0LA 3L79A 2WV9A 3VOTA 3ENKA 3LUKA 4OSOA 1GL6A 2GM5A 5CA7A 3IT3A 1CQJA 3CUYA 4BKPA 4EWLA 5G1NA 2G9NA 1PT5A 3IXQA 4V0RA 5CEFA 2IYZA 1PJTA 1QWOA 4IJMA 4M86A 1H4TA 4M7RA 2H5XA 1VFPA 2NU9A 2ROQA 5B53A 1E1QA 1FVOA 3O0TA 2JEGA 4MRSA 4TMXA 2B5WA 3BZBA 2H2WA 3ZYCA 5HMMA 1BWPA 1D6NA 1U0JA 2K4IA 4NU5A 1A97A 4TKVB 2W9AA 2A7QA 2W2MA 1BN7A 2PR7A 3WBJA 4NCXA 5KYXA 2XUOA 2JFXA 2Q0QA 5CXXA 5JNWA 1RC8A 1Y3AA 3OT1A 2ATIA 3JYLA 4ROTA 3TRKA 2SECE 3BFPA 4ZQHA 5CHYA 4QTTB 1PK7A 1PJBA 4INJA 4F2DA 3FPBA 1OLOA 1DAHA 3DUFB 2RH8A 3U3DA 4BIMA 4OAOA 5JNSA 1DL5A 2NSYA 2WMOB 4L8VA 4BNDB 1KJYA 3GVCA 1MQ8B 2VLIA 2C2EA 4IZOA 4MS3B 1V95A 2P68A 3G59A 4JJ6A 4AICA 3PE4A 3U7JA 4B5KA 4AC9A 2XQKA 3PO4A 3ZQJA 5CP8A 2QBYB 2R1VA 3D59A 2GGSA 3IUJA 5M04A 1S8NA 5DE3A 2LKDA 2MYUA 3VSDA 1OAOA 1M7HA 3SENA 1N0VC 2I54A 5JYCA 5JC1A 1SU7A 1F8YA 2A9KA 2OO5C 2W9MA 1DXHA 4B8YA 4E1VA 5AVTA 3OETA 5EP4A 3VUEA 4CLEA 4NATA 6CHYA 2I76A 6GPBA 1UJBA 3PIDA 3WYDA 4DYHA 2PVPA 1OJLA 3KOUA 3S0JA 1EJ2A 1U90A 4ETMA 3ADDA 2W5UA 3VR4H 4PHFA 1BKYA 2OOKA 4P35A 2A94A 3BXOA 3A1UA 1QJCA 2Z83A 3AILA 3RADC 4BZZA 1G8YA 1MRSA 2O0HA 2ZIVB 1G1MA 2QMHA 3K31A 4Q4AA 4KPFC 1HC7A 4OKSA 3L7BA 4BFZA 3SWWA 1CNEA 1RQLA 3K7EA 3Q10A 5D87A 5AUOB 821PA 5C8YB 3T1YB 2QKQA 2H29A 3U0BA 3FZGA 2QYHA 4S35A 4XUGB 5T57A 2ZIXB 2ZJAA 4KGZA 3KT3A 3SJCA 4D5EA 1BQ3A 1NOMA 2I3DA 2PYIA 2D2VA 3LE8A 5TDHA 3I9JA 3FCXA 1RRMA 3I83A 4U2BA 4P4MA 1TAMA 3I2IA 1J1UA 4HUTA 4KLIA 3EIXA 4RGBA 5AXBA 4LYAA 2IW1A 1PQPA 3AEUA 1EM8A 1LDGA 4B44A 3OHPA 4LDRA 2JLBA 4MVJP 4CIVA 4P4OA 5C7LO 4QGFA 1KR5A 3COVA 1QIJA 2AC4A 2ZBEA 2P6UA 4I2BA 1LD3A 4LA4A 4PZCA 2NYAA 2ZJ4A 4K6KA 1EP1B 4QAQA 4DCOA 3O47A 2GCGA 5A03A 1CEXA 2QTVB 3FVWA 3P20A 4NYJQ 4TV9B 2DUYA 2V3CC 1UKEA 1N60A 1SUWA 2CJXA 3DNPA 4DL2A 5JTTA 5BQFA 3PFWO 2OEPA 1FS6A 2A4MA 2MYNA 5CXSA 4R5MA 3F4KA 1PZMA 1MJGA 1SC6A 1JEJA 4DFPA 2UZ1B 2VJNA 2BEWA 1DVRA 2D4AA 2XCLA 3OBBA 5BN4B 3UJ8A 5EKUA 3WGGA 3PX7A 4CUKA 3TFSA 2VXCA 3O5AA 3M3PA 1MF7A 3A2NA 4IEFB 4J9PA 3ZBPA 1JDBB 4UE3S 1P74A 3DP9A 1GZSA 1HT0A 4XCQA 2WUEA 3L7OA 4AUEA 4DSTA