2HHQA

O6-methyl-guanine:t pair in the polymerase-10 basepair position
Total Genus 217
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
217
sequence length
580
structure length
580
Chain Sequence
KKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*CP*AP*TP*(6OG)P*CP*GP*AP*GP*TP*CP*AP*GP*G)-3'
publication title The structural basis for the mutagenicity of O6-methyl-guanine lesions.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 217
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2006-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2hhqA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 2hhqA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hhqA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2hhqA01
1ZQUA 4DU4A 8ICFA 4I2IA 5J2PA 3OYJA 1YTUA 5J2IA 4UBCA 4PHEA 1EP4A 2NRXA 1VRTA 1DTQA 4R5PA 4O4GA 2BANA 2C2EA 3HL8A 4E7JA 7ICTA 5J2EA 5KFJA 5K14A 4F5QA 4CJUA 3DOLA 2KZ3A 2FPLA 3VN5A 2AJQA 3SPZA 3KHGA 1U04A 1WSJA 4FM1A 3EZ5A 3NFAA 3V81A 5SZTA 4CEQA 2GBZA 1ASUA 2FMSA 4DMNA 2NRZA 5J2DA 3Q8MA 4CJ3A 4LSLA 3M9MB 3Q8LA 3HVTA 4CHZA 4HUEA 3QINA 2HHQA 5KFTA 4B9NA 4DSJA 3HP9A 4IDKA 1S9EA 1BQMA 1FK9A 3KLIA 1NJWA 1C1AA 4YMOA 1JXEA 3EWAA 3RB6A 1N5YA 3SQ4A 4PHAA 1MSWD 4Z4HA 2FPMA 5J0XA 3AUOA 3RMBA 2KZMA 3VQ5A 3MFHA 3MR3A 5D46A 3TQ1A 4DTRA 4RT3A 3NF9A 1XO1A 2ZD1A 3PO4A 3RTVA 4J9KA 2FLLA 4UB2A 4DF4A 3OHAA 1QQCA 3ZDAA 3V7LA 1QE1A 3HK2A 1BIUA 5KG7A 1S10A 3JPOA 4QWBA 3C95A 1IM4A 3S3MA 3SNNA 4BACA 3GFKB 4O3QA 5FDLA 1D8LA 3F9KA 1S6PA 4CJ5A 3U3GA 4KREA 1FXXA 5HMMA 3GIMA 1A5VA 4KV8A 5J0RA 4YXMA 4K4HA 4O3OA 4J9OA 3CQ8A 2ZTDA 2IHNA 1CLQA 1CZBA 1RDDA 1T05A 3K5MA 3LZJA 5HP1A 2YKNA 4N47A 1XS9D 4FYDA 5DG8A 3Q8SB 2V4RA 3AVMA 2DFHA 4CJEA 3NTUA 4DL3A 3B0XA 4AHVA 2PYJA 5KFEA 2P1JA 4JRQA 4GC7A 4O3SA 4PUOA 4ECTA 3VA3A 3H8SA 3ZD8A 3MR6A 3D0PA 2VG6A 2X78A 5KFGA 5DB7A 4ECXA 4CHPA 4J2BA 1J9AA 4UAWA 3TI0A 1KDHA 2D0BA 4DQSA 3SUQA 3FYHA 2YNIA 4CEDA 4IRDA 2Z1HA 4CEEA 2UVRA 3MXIA 1J54A 1KFTA 1UT8A 4O0IA 3RB3A 3TAGA 3DLRA 3AA4A 1V9PA 2LYHA 3HPGA 4QZCA 3QEPA 4ZHRA 4DTUA 4YFUA 1L3VA 9ICUA 1ZBHA 1QSLA 3WNHA 4DF8A 4DL2A 2OYQA 3TAFA 3HYFA 4FK2A 4K8XA 4BGDA 3HP6A 2DPJA 1VRUA 2I9GA 2P6RA 9ICJA 3E2EA 3ZSWA 3SUPA 4BDYA 1BPEA 5J0QA 5KGWA 3NGDA 1S1WA 1J5OA 3VQ4A 2F96A 4KLQA 2VWJA 3DMJA 3JSMA 3V4IA 3LWLA 5HRPA 3KK1A 1T3NA 3QEAZ 2VG7A 1KVBA 4BXOA 3L3UA 4DQPA 3DYAA 1C0UA 2JZBB 8ICAA 4BE1A 2HVHA 1ZQFA 3IS9A 4ECYA 1IKXA 2OA8A 2BQUA 3RMDA 2BPGA 3SUOA 3MECA 3C2MA 2JEJA 4FJNA 3LPTA 7ICMA 4DSEA 4XRHA 4CEFA 2DFFA 1HNVA 3AO5A 4JLHA 1RDCA 2ZJ8A 3PR4A 3L2RA 4QCLA 1REVA 4I2FA 4K4GA 4ECSA 3RR8A 3AVHA 4O3PA 4DTXA 3ZDDA 4IQWA 2W8LA 4O5KA 2ATLA 4CJ4A 9ICHA 4YXJA 1LAVA 3MGHA 4DTPA 3QIOA 4FVMA 2AQ0A 9ICSA 1ZBIA 2YNFA 3ETLA 4KTWA 5DDYA 2QXFA 4FJIA 8ICOA 3MR5A 9ICFA 2ITGA 4TUQA 3PW0A 5EWFA 1MQ3A 2XO7A 3MABA 3AVFA 1LWEA 5L1IA 3B6OA 4FS2A 5KRSA 4UB4A 1XHZA 2QKBA 4OLBA 5KFYA 2BCRA 4YR3A 4M3XA 1WSEA 2Q3SA 4CJPA 4DTMA 5I42A 1GOCA 2P51A 3RRGA 1QLNA 3EY1A 9ICAA 3LDAA 4DL5A 3ZT3A 3OSPA 1LW2A 3C6TA 3SUNA 1HYZA 1TVRA 8ICPA 3CM5A 5J0UA 3Q8KA 4NLKA 8ICWA 3HT3A 3DI6A 3OYLA 3V9UA 4M3RA 2BCUA 3Q8PB 5EU7A 3AO1A 2BDPA 1ZQLA 2PFOA 2R8KA 4UB3A 3N4MB 3VQAA 3PMLA 1RT3A 4M9LA 1WAFA 3I0RA 3HJFA 4QWCA 3NHGA 3RJGA 1TKDA 2BQRA 4FJMA 2W9CB 4YFKA 1X9SA 2W9AA 5KFHA 4W5OA 3KD5E 5HNKA 1N56A 1XC9A 4RW9A 1SUQA 4QAGA 1JXLA 2IHMA 4KHWA 4DFPA 1RTDA 2YV0X 3PVXA 3WNFA 3ZT4A 1SL2A 1LAWA 4DFKA 3IAYA 4NLNA 1DOQA 3HPOA 4I2AA 5HROA 1WSFA 9ICWA 2IS3A 7ICPA 8ICZA 2HHUA 9ICMA 2B21A 4I2JA 1BVSA 5HLFA 1QSSA 4J2DA 4HTUA 4I2DA 4CJRA 4Z4EA 3M8PA 4Q43A 2R8JA 2RN2A 4ECUA 3DRPA 4CFAA 4CECA 3UQ2A 1C7YA 4NCBA 4BWJA 5KFSA 3DM2A 4B9VA 4LVSA 5DK5A 1S1UA 5J2GA 1SKWA 4FJGA 1XI1A 1JXBA 2NRWA 4YD2A 3EYZA 4KPYA 4PY5A 9ICLA 4OKKA 3ZSQA 3PR5B 4CHOA 4KN4A 1A5WA 8ICHA 1U45A 1UOCA 4CJWA 1Q8IA 2F8SA 4J9LA 5IIOA 5J2FA 3PX6A 2Q0ZX 3QLHA 3GV7B 4FJLA 1NK7A 1L5UA 2H5XA 4KLHA 4HVJA 2ATQA 4FM0A 4EP4A 4FZXC 1RT7A 4CGHA 4DLEA 3DLEA 4RQ7A 4B8AB 3L2UA 1ZBUA 8ICJA 3QERA 2XGQA 4IRKA 1RZTA 4EBCA 2V4QA 1SV5A 4P4MA 2W9BB 3OY9A 3KK3A 3B0YA 1NK9A 3LANA 1HYSA 2OZSA 1ZQNA 4PGXA 2ZE2A 3NGYA 3RJJA 3T5KA 1EKEA 1ZQGA 1Z3EB 4M3ZA 4KTZA 1AROP 3CG7A 4HUGA 3AO3A 2RKIA 2FPKA 4FLTA 4I2HA 3QIPA 2MUTB 4RQ3A 2VWKA 5KFAA 3HM9A 4F5OA 1BI4B 3KLEA 5KFVA 4BE2A 4QZAA 3L3VA 2YHBA 5J2HA 3V9XA 4MFFA 4J9SA 3ISDA 5JS2A 4KFBA 3C5FA 3V6DA 3S3OA 4MEYA 4B9TA 3K2PA 4FXDA 1JLBA 1TKXA 3RR7A 3FFIA 4F4WA 4NM2A 7ICOA 2DTUA 5DGBA 2IDOA 4N5SA 4DTNA 3GDXA 4AHRA 5KFIA 2B6AA 3VA0A 4CK1A 4XQ8A 4AHCA 3HW8A 4LY7A 1ZYQA 1ASWA 4OPJA 5E41A 1ZQJA 3MEGA 1ZQHA 3CFPA 3KKRA 3PW5A 5FROA 3C6UA 5IIJA 4Q44A 3K75D 4YG2A 3AO2A 4W5RA 4FW1A 3QNOA 1FKOA 4B3OA 2J6UA 2D5RA 1Z25A 2HMIA 3RJHA 2PZSA 4IFVA 3SPYA 4RNOA 4DL7A 4GLXA 3M8RA 3NAEA 5CWRA 3AVIA 4RPYA 4F2RA 4JV2A 2BE2A 4IR1A 2FBYA 4DS4A 4M6WB 3SI8A 4J9MA 3HVRA 3ZD9A 5HHHA 4QZHA 4JRPA 3TFRA 1S0NA 4KMUA 3O3FA 4F5NA 4P2HA 2D0CA 3EW9A 5KFXA 2FC0A 3MDAA 3SQ1A 4XUSA 3LALA 2ASJA 4RU9A 3GV8B 2ZJ5A 1ZQEA 3CFOA 1VSFA 1LB2B 4CFDA 4FLUA 4NYNA 4Z4FA 3HSTB 4YCXA 1RPLA 2BPCA 3BGRA 4FJJA 5KFPA 1H38A 2G8WA 3RRHA 3QETA 9ICXA 3AVJA 4FK0A 1RNHA 4B08A 1NK4A 1S1TA 3C1ZA 3RB4A 2DPIA 1RXWA 3LZIA 2I5JA 3L8BA 3BJYA 2B5JA 4JWMA 3KD1E 1R0AA 4FJ5A 5KG5A 5JS1A 3VQPA 1IKWA 1NOYA 3JPSA 4KITB 3VQDA 2VANA 3BQ0A 3G0ZA 4YR2A 2FBTA 3C2LA 2OPRA 3OS0A 4E89A 4RT2A 3KHHA 3KK2A 1ZJNA 1TL3A 1A76A 3L2VA 1ZQIA 4CF2A 4OPKA 2XHBA 4CJKA 5EWEA 3TFSA 1C1BA 4M9JA 3M8SA 1D5AA 4CEZA 4ELTA 1NOMA 3C94A 4DEZA 3RJKA 5DG9A 5C42A 3I8DA 3RJFA 2DFEA 1KLMA 3VQCA 2R8GA 4F8RA 4IQVA 2YNHA 3BQ1A 1Z26A 3TAPA 1RBRA 4KAZA 4N56A 3P5JA 1TK8A 3HPHA 4DS5A 4IRCA 2IC3A 3LAMA 3TAMA 3SJJA 4IG3A 4GVMA 1HYVA 1JLEA 4DTJA 4NY8A 5KFKA 2XGPA 3PV8A 3MXJA 3EPIA 2ALZA 4KRFA 4J9RA 4IFYA 5KT3A 2ZJAA 4YMMA 2NRTA 5F9LA 1ZQTA 1Q9XA 4R64A 1WSIA 2AGOA 1XWLA 1QTMA 1C0TA 2E6MA 3ZSRA 3OYGA 2DFLA 1JN3A 2KFZA 1HUZA 4RQ1A 4ECVA 2XY7A 4F5PA 2JEFA 2R8IA 3SYZA 4DWIA 5DQHA 1HUOA 2JZBA 4KO0A 1SL1A 5BOLA 5EOZA 4B8CA 5DB6A 1LV5A 3GIJA 4CF9A 2ETJA 2HHSA 4JK1A 4RW8A 4ED0A 4B9LA 2KFNA 8ICRA 4RNMA 4KTQA 1BGXT 1RT6A 2UVVA 4LH5A 4J9NA 2IA6A 3DRSA 2BR0A 1ZQAA 1TV6A 2HNYA 1JX4A 3AVNA 4JWNA 3OYIA 2P5GA 1NKBA 1VSIA 4RNNA 3RH5A 4ZTJA 5J2QA 1BIZA 4CIGA 4M04A 2GV9A 3K4GA 4DFMA 4FBUA 2IMWP 5CR0A 4CGFA 5CJ7A 3S9HA 4E7LA 2HHWA 4EEYA 1TV9A 4CJFA 1XU4A 3E01A 4KHYA 5EWGA 4OGEA 2EX3A 3P83D 4PHDA 2KTQA 1RXVA 1DLOA 4CJSA 5J0WA 3BDPA 5HP4A 4DOAA 3QEXA 4OJRA 5L1JA 3MDCA 1KTQA 3NCIA 5J2AA 8ICTA 3IG1A 7ICNA 1D9DA 3DLBA 1RBUA 1MC8A 1RYRA 3KHLA 4ICLA 4TQSA 3AO4A 5J0YA 1NJZA 4J2AA 3OYHA 4J9PA 2G8KA 3V6KA 4W5NA 5KFRA 4ECRA 3C2KA 1ZQCA 1WN7A 1D8YA 2E6LA 5KFNA 4MFAA 2D0AA 3T3FA 4I7FA 1S76D 2RDIA 3CYMA 4KB1A 2W9CA 3G10A 4FLVA 4F4XA 2VA2A 4OVLA 3TAQA 3OYAA 2BCQA 2VA3A 1TGOA 4P4OA 1TFRA 1L3TA 4FZYA 2VA8A 3OYEA 2RDJA 4EYHB 1X9WA 3B6PA 3TWHA 1RTHA 4KLOA 2NRVA 5DMRA 1RT5A 3HXMA 3L2WA 3WNEA 1BPYA 4I29A 3OYFA 9ICBA 3K5OA 4C8NA 3UXPA 4B9UA 4M0AA 1VSKA 3IRXA 1NJYA 2F1JA 1IXRA 1IG9A 5KG1A 1RDAA 1TK0A 5KG0A 2Y1JA 7ICIA 2HHTA 4RW4A 4TUPA 3T19A 5HMLA 1TAUA 3SI6A 4I2CA 4G3IA 2HNDA 1I39A 1UWBA 5J2BA 4FK4A 4YD1A 4Z0UA 1DGSA 4DOCA 2OPSA 1RBVA 4PGYA 4KN7A 1JMSA 2XY5A 4LZGA 4Z4CA 5IIIA 1NK8A 3H4BA 4ELUA 3ZSZA 4CHNA 1L3UA 4QOZB 7ICGA 4FW2A 1K1SA 4FZZA 3QEBZ 4O5BA 1RTIA 4FO6A 3V7JA 1HJRA 1S1VA 3KLHA 5FRMA 4MF8A 5DG7A 4F3TA 1I3AA 5KT5A 4E7KA 3PW2A 9ICRA 2X6SA 1MU2A 4AHTA 3K58A 1RILA 4CEBA 3QEVA 1ZBLA 5J2CA 4KLMA 3GIKA 1NOZA 2J6SA 1XSNA 1IKYA 2W9BA 3RMAA 4TQRA 2KN7A 1KEJA 3GQCA 1ZQMA 4Q5VA 3RAQA 3LP3A 3QO9A 1LWFA 1CEZA 1KFDA 3M8QA 3MXMA 3NF6A 4UB1A 4QWAA 5KFDA 7ICLA 1EXQA 3RWUA 3QEIA 5DBCA 2C2DA 2PY5A 2ZTEA 1S77D 5KFOA 7ICSA 4TUSA 2MUTA 4Q8EA 2ZUCA 2JLEA 3WNGA 4FLYA 7ICVA 4Z6DA 4XA5A 4F2SA 1BI4A 3ZT2A 4DSFA 1HNIA 2GWSA 3VQ7A 5J1EA 1ZQZA 4DO9A 2AU0A 4I2EA 4Y1DA 1JL1A 2FMQA 3ZDBA 3N97B 1U49A 1UA1A 2Y1IA 4IBNA 4W5QA 3RAXA 2BKEA 5J0OA 3ISCA 2R8HA 2I1QA 3ZSOA 3A2FA 3O3HA 5J0SA 4Q45A 4QZBA 1BPZA 1RCHA 3OGUA 4PH5A 4RUAA 1VSHA 5J2NA 3SV3A 1ZQVA 4O5EA 9ICEA 2ASDA 1B43A 2C22A 3SZ2A 3LAKA 4PPXA 2A1RA 1SKSA 3HO1A 4FJ7A 3M9NB 2BCVA 4AILC 3IHQB 2ZTCA 3NF8A 1FKPA 1B9FA 9ICTA 3ITHA 8ICGA 2EHGA 4LZDA 5KFWA 1IKVA 2O4IA 4ED3A 4E1NA 5KFQA 5KT4A 3ALYA 1U48A 3V9WA 2J6TA 3OSNA 8ICSA 1VSLA 1LWCA 5IIKA 2HW3A 3AA5X 1T03A 3GIIA 1KVAA 3O4QA 4I2GA 5KFFA 1S9FA 4CIEA 4JV0A 3PX0A 1S5JA 4ID1A 1J53A 3V9SA 1VSJA 4M6WA 1NK0A 8ICCA 1IO2A 1JKHA 4CEOA 4ED7A 4TSXA 3THVA 7ICQA 3ZCMA 1LW0A 3V1OA 4M3YA 3JPQA 4O5CA 1Z00B 3AVKA 5C25A 3QNNA 4CFCA 3ZSVA 4CEAA 2M9NA 5L1LA 1K6YA 4KHQA 5F9NA 2FLNA 5C24A 4CF0A 1YVUA 4QZIA 5HHIA 4I28A 3PY8A 3PMNA 2JEIA 4R65A 4DSKA 3OYCA 2ISPA 4MQ3A 3VQ6A 2IAJA 3NGZA 4ZTFA 4DOBA 4DQIA 4KLTA 1WSHA 1HJPA 1JLQA 4M47A 3KJVA 3KKSA 3KTQA 4NLGA 3CM6A 3LPUA 3UXOA 4LH4A 4KLLA 3H8JA 4P4PA 2ZQBA 4ID5A 3LWMA 4KLIA 4KLFA 1YT3A 3K5NA 5DKWA 5J2KA 9ICGA 4DU3A 3MFIA 2C28A 1ZQXA 4Q8FA 5BPCA 4L8RB 3MR2A 4KLGA 4N76A 4JS4A 1N6QA 5KFBA 4FJKA 3ULDA 5DB9A 4ELVA 2A1JB 1EX4A 5D49A 4HHTA 9ICIA 2F1IA 2G8HA 3ZDCA 3EPGA 9ICKA 3C1YA 4XIUA 4CF1A 2XCAA 2VG5A 4CE9A 2PXIA 3HWTA 2IOCA 2AQ4A 4ED2A 5DDMA 3U3YA 4R66A 4DTSA 3C21A 4CJTA 1BCOA 4FCYA 3LP0A 3PNCA 1SKRA 1SL0A 3AA3A 2XY8A 3K59A 4CCHA 4RW6A 3QE9Y 4OKEA 1U9LA 5HRSA 3T5JA 4B9MA 1JLAA 2Z1IA 4NCAA 4JV1A 4N41A 2YHAA 1WSGA 4Q0BA 1JLGA 9ICOA 4OGCA 3V9ZA 4FLXA 3VQBA 5KFLA 4LD0A 1QSYA 5IIMA 4ED6A 1S0MA 4IR9A 1S1XA 2IGIA 1S97A 5KFCA 5KTQA 3RJEA 5HRRA 3AVBA 1CZ9A 1KFSA 3DLHA 1UT5A 4M45A 1ITGA 1RT4A 1EETA 4I2BA 4CGGA 4R8UB 1GOAA 1T8EA 5L1KA 2PI5A 3C5GA 4HUFA 3F73A 5D3GA 3RBDA 1ZETA 4BDPA 4UB5A 5DBBA 4FJ8A 3TANA 3V7KA 4Z4GA 5TZVA 1TKZA 3H7IA 3V72A 4RW7A 3I0SA 4AH9A 3OHBA 3BQTA 1ZQRA 3PO5A 3DLKA 4M3UA 3OJSA 2XC9A 2BPFA 8ICEA 1WCNA 4RQ0A 4RQ8A 5DLGA 1ZQSA 4M42A 3U6FA 2HVIA 1S0VA 2W42A 5J2MA 5DBAA 4YN4A 1TVAA 4PA1A 2PI4A 2RPIA 4J2EA 5JUMA 2FBVA 4F92B 1TK5A 3K57A 2DY4A 2G8FA 1QS4A 1U4BA 3QEWA 1A5XA 4IQTA 1BL3A 5SWMA 8ICXA 1VK0A 1WNSA 4KLUA 2P6UA 5KG2A 5CP2A 2X74A 4E7HA 3H4DA 2ASLA 4IG0A 4RPZA 2QKKA 1NJXA 1CXQA 1T4GA 2AGPA 4KLSA 3PX4A 4X5VA 4CIFA 4YP3A 2NUBA 3L2QA 8ICQA 1KLNA 2JGUA 4UQGA 4KB0A 2WOMA 2GUIA 1XSLA 4F50A 1ZQPA 3NDKA 2B4JA 4I2PA 4RQ4A 4ED1A 4JS5A 5D4BA 4E19A 5J29A 5KG3A 4B9SA 4YR0A 3NBPA 4KHSA 3SQ0A 3OYNA 4MFCA 4Z6CA 5CZ2A 4F5RA 1SZPA 1QHTA 4CGJA 4DU1A 5DQIA 2P5OA 4IQUA 1N48A 1ZQKA 4GC6A 2WONA 3O4NA 3TABA 3ISBA 4GW6A 2OWOA 4MFBA 4C8MA 1ZBFA 4E1MA 1S6QA 4YVZA 4I9LA 3OYDA 3BQ2A 4MF2A 3NH1A 1ZQYA 2ISOA 4J9QA 7ICFA 4F91B 2BQ3A 4H4OA 1CUKA 3UXNA 1TAQA 4E3SA 3SV4A 4EP5A 1HMVA 4YQWA 1HQUA 3T5LA 1RTJA 5C5JA 3OYKA 4BE0A 3RBEA 1C6VA 3OS1A 4KHNA 5HBMA 4EZ9A 3UQ0A 3P1GA 4CK2A 2PFPA 2ZUBA 4CJVA 2KZZA 4YMNA 1VSMA 4M3WA 5DGAA 1Y88A 5KG4A 4AHUA 1VSDA 2O4GA 4YNQA 4I27A 4RUCA 3QZ8A 1RDBA 7ICRA 1RT1A 4Y1CA 5KFZA 3ZT1A 5CB1A 7ICKA 3DOKA 1RBSA 2KW4A 3MBYA 3KIOA 5KRTA 3JYTA 4E7IA 1S9GA 5DQGA 3RJIA 5KGXA 3T5HA 3AVGA 4CFBA 4EYIB 4QWDA 1UAXA 4QWEA 2ZUDA 5T7BA 8ICIA 3CFRA 4GXIA 3Q8QB 4WE1A 3JPPA 1RYSA 1DTTA 2HHVA 4H8KA 3DLGA 4CF8A 3JPRA 3PUFA 1NKEA 1MQ2A 1HRHA 4K4IA 1KSPA 4O0JA 1WLJA 1NK5A 3ISNC 8ICYA 1KCFA 1XHXA 1JLCA 2FBXA 2AGQA 8ICVA 5L9XA 5CHGA 2OZMA 4PHPA 7ICEA 4F4ZA 2KQ2A 1BPBA 4BXOB 5J0TA 2R7YA 1X2IA 3UIQA 1WAJA 4I9QA 7ICUA 3AVLA 4DG1A 2UVWA 3MEDA 4HCCA 4OLAA 1YTAA 3K5LA 3PW7A 1W0HA 5IILA 8ICMA 3LK9A 4FJXA 3RH6A 7ICJA 5FRNA 4ECWA 4NLZA 3JPTA 4DQRA 1B92A 1UA0A 3M9OB 3H08A 4RQ6A 4W5TA 3UPQA 2PYLA 5DLFA 4F4YA 4ECZA 4KKOA 4M41A 2X6NA 4C8LA 5J2JA 3TARA 3C23A 2C2RA 4CESA 3V6JA 4UAYA 4CERA 4GMJB 4Z6EA 3H40A 3LP1A 4FS1A 1C1CA 4OKJA 2PFQA 2YKMA 2V9WA 1RT2A 4G1QA 2P66A 5KI6A 4ED8A 4CGIA 4F93B 4DSLA 1HPZA 4K8ZA 4JUZA 2FLPA 4E0DA 9ICNA 4GXKA 1EXNA 3H8WA 2UVUA 3AVCA 1JIHA 2BHNA 3OYMA 1COOA 4H4MA 1B22A 4PGQA 4QW9A 1NKCA 3V6HA 3G6XA 1O1WA 4KLJA 4CHYA 4RQ5A 8ICKA 1Y97A 4DFJA 3KLGA 1Q9YA 2HHXA 4IKFA 3G6VA 3S3NA 3PW4A 3SCXA 1BHLA 4KHUA 3VQQA 4CJQA 1G15A 3V1RA 4O9MA 4EBEA 8ICUA 2Z1GA 3MEEA 3SQ2A 1Z00A 3NH2A 4PQUA 2XY6A 5KT7A 9ICPA 4AHSA 3NGIA 3VQ8A 4R63A 1ZQBA 3HX0A 4F4KA 4FLZA 1TKTA 4FJ9A 3AV9A 4O3NA 3G6YA 1U47A 3ZSXA 1ASVA 2W9MA 4QZ8A 4M9NA 1XSPA 1BPDA 4NYFA 4MEXA 5KFMA 4M9GA 1C0MA 3JPNA 2IBKA 1TL1A 1K1QA 3T1AA 1F21A 3RMCA 4O55A 1KVCA 2F1HA 2Z1JA 4RG8A 3KHRA 4LSNA 1A77A 3MAQA 2YNGA 3DRRA 3ZSYA 7ICHA 5KG6A 9ICQA 1ZJMA 3OYBA 4QZDA 3RH4A 5J0PA 1IH7A 4HCBA 3LDSA 2MAXA 2BGWA 4PWDA 1ZQWA 1W9HA 3RB0A 2QK9A 3TR8A 2FMPA 2JEGA 4O3RA 2XRIA 5CYQA 2A1JA 1BPXA 1JLFA 4TURA 4CJLA 2HB5A 3O3GA 8ICLA 1ZQQA 4Z6FA 2G8VA 4DTOA 5BOMA 3AU2A 1CXUA 2A1SA 4M9HA 4QZFA 9ICVA 4BWMA 2E4LA 3VQEA 4ZH4A 4DL6A 5CA7A 2RF2A 3NF7A 3NE6A 3LP2A 4RPXA 1D9FA 1GOBA 4BDZA 4GXJA 4FLWA 4HYKA 1HQEA 1PZNA 4UBBA 4FM2A 4KI6A 4KI4A 4C8KA 5HRNA 4F3OA 3ASMA 3AA2A 3GV5B 4Z4IA 3ZT0A 5KFUA 1ZQDA 4O44A 3FDSA 3QZ7A 2OPQA 4QW8A 4QZEA 5KT2A 3MGIA 5IINA 5I3UA 4M3TA 3QESA 2F8TA 1BISA 3ZDEA 4RQ2A 5CZ1A 5CY4A 1X9MA 4UAZA 4R8UA 9ICCA 5DB8A 4CHQA 2PFNA 3OVNA 1VSEA 1S0OA 4ECQA 1RBTA 4DLGA 4I2QA 1L3SA 3OJUA 4DSIA 4QZGA 4NM1A 4CK3A 4KLDA 2LSNA 4EBDA 3ORYA 3KLFA 4DL4A 1NK6A 1T7PA 4QZ9A 4FJHA 5KT6A 3GILA 3AVAA 8ICBA 4NCGA 3V1QA 4EZ6A 1BCMA 3OS2A 4NXZA 2WTFA 2OPPA 4FBTA 2G8IA 1WCLA 2XCPA 2W8KA 3NH0A 4CGDA 1KRPA 4DQQA 3Q8RB 3TAEA 1JL2A 2BCSA 1B9DA 4KLEA 3AU6A 3VQ9A 3D45A 2HNZA 1ZQOA 4C8OA 4RZRA 4M2YA 3IM1A 8ICNA 5CYMA 2G8UA 2BGGA 1X1PA 1BQNA
chains in the Genus database with same CATH superfamily
3FCVA 4DU4A 2NRRA 3W9JA 1RG6A 4EUVA 1YTUA 5K4LA 4OX6A 4ILGB 4PHEA 1EP4A 2GJFA 4CGZA 1FW6A 3WXJA 5E7OB 4DV1K 4RX6A 4GKJJ 1HX1A 1UEKA 5J2EA 2FYXA 2I9SA 2CJXB 2V63A 1VJQA 3TSQA 2WUSA 2OYYA 3ZEUA 2B4OA 1Q1KA 3SPZA 4WKYA 5EE0A 2R7UA 3KHGA 1WSJA 3EZ5A 3NFAA 2RUSA 5SZTA 3D54A 1PJ6A 4NI2B 1SQFA 2XICA 1OPZA 4LSLA 1PKUA 4KHPK 3HVTA 1VQ8N 1HKAA 2HHQA 3HP9A 4TNOA 4CQ1A 3NMUA 1PCAA 3PIPL 1RWKB 2LXFA 3KLIA 4OLPA 5BPLA 1NJWA 2O8FA 2D1KA 3THXB 1XC3A 1S57A 4YMOA 2DHHA 3QGIA 3RB6A 2D9PA 2GIRA 3EL2A 4LIRA 3SQ4A 2L9DA 3VAHA 1MSWD 5J1PA 4Z4HA 2FPMA 4BHQA 2KZMA 1R8BA 3H2LA 3JTOA 4E98A 2ZD1A 2OEKA 3RTVA 4FYXB 3RFAA 4LFCJ 4UB2A 3CNHA 4DF4A 2QZ8A 2WBRA 3V7LA 4P52A 3GIRA 2VOPA 2ZXIA 4JI8K 4A8MP 3LF0A 2VDHA 4P0PB 3S3MA 4O3QA 2YHXA 1U1RA 2OD6A 1D8LA 2RSQA 2P9LB 3MOZA 2LHTA 3W7BA 3MMJA 3OPKA 3U3GA 3QUBA 1JJ2M 1RQLA 2I2YA 5HJYA 5AQNA 2B5JB 1FDAA 4J9OA 5GAHI 2IHNA 1R0AB 1YRUA 2F9JA 4GIBA 1IKWB 4BC7A 3LZJA 5HP1A 3QMLA 2PN6A 1EIYB 3Q8SB 1WOQA 2DFHA 3L7UA 2KP7A 3NTUA 4DL3A 4LSLB 4CBUA 4MK7A 2PYJA 3D28A 1TL3B 4ZP8A 2ZXHA 5ETMA 3MI7X 1VI7A 3UO0A 3H8SA 2DH8A 2MQMA 4BRIA 2NUUG 4XDCA 2WBMA 4X64K 4CHPA 4ECXA 2D0BA 3TI0A 4DQSA 3SUQA 3EE9A 3FYHA 3ENAA 4OX9F 3WU2U 2YNHB 1W2IA 2DY1A 3I1YA 3RB3A 3UVJA 1KHWA 5CH7B 3VEWA 4ZPVR 5AQRA 4D3HA 2LYHA 2ROPA 4QZCA 2DT9A 2XIDA 1OS5A 1E4FT 1FNOA 1V5IB 1QM9A 1L3VA 9ICUA 4ZPBA 2E1FA 3FJ2A 4IFYB 2F2AB 3HYFA 3D6JA 3PACA 1BD6A 1BNOA 3MCSA 2WRMA 2I9GA 4U7CA 2QX0A 4DX8H 1YJWN 3HSJA 1BPEA 4IS7A 3VCDA 3VQ4A 2F96A 3LVWA 2YI1A 4ZLJA 2KM8B 4KLQA 4FWSA 3KK1A 5HRPA 3QEAZ 1TUYA 3D3CJ 3DOMA 4DQPA 2GX9A 1C0UA 4M1KA 4N7TA 3G4SN 3NGTA 3MM5A 8ICAA 2DHXA 3MC1A 4ECYA 4MYUA 3J81U 3CCUN 2OIHA 4DR2K 5ETRA 2YQ0A 2HFOA 2J0QD 3D1QA 2JH1A 5I3QA 4DV7K 4C7QA 1HNVA 4F72A 1RDCA 4IKAA 1HNXF 3PCOB 1YLXA 3ZDDA 1O08A 2FJVA 3B82A 3OV7A 1R3NA 3BN7A 3QIOA 2I8EA 9ICSA 4ZN1A 2YNFA 3ETLA 3CCLN 5DDYA 2CH6A 4LFCK 4FJIA 3MR5A 9ICFA 3RGIA 5IC4B 2DISA 4TUQA 3PW0A 1NZAA 4YMEA 4C3KA 1WC1A 2E8OA 4IOAQ 4FDFA 2RQKA 2ZH3A 2V94A 2QKBA 4ILRA 4OLBA 2NREA 4TLRA 5KFYA 4F0KA 1BE4A 4OJ6A 4JI6J 3KKFA 4CLLA 4CJPA 1GOCA 3QBWA 1DLOB 1XMQJ 4OZ3A 3EY1A 2MMYA 2V5HG 3IWXA 4P0QA 2Y3YA 3QUTA 4DCPB 3G6EN 1ED1A 3K7RA 3AD9C 2QG9B 3DU6A 1TL7B 3MMAB 4K4VA 4NLKA 4CT8A 2GX8A 2P35A 5ETSA 5GAGU 3HT0A 4EFAC 1K8AT 1ZQLA 3C46A 3VQAA 4ZK7M 2ZBRA 4J37A 3I0RA 3HJFA 4I7FB 4QWCA 3VZIA 4MHVA 3TSPA 3P8BB 4FJMA 2W9CB 2YMMA 4H5WA 2F4VK 3DXSX 1CC7A 5KFHA 2WAQF 1FX4A 4OYOA 4HTJA 5F0UA 3EKUA 4JKCA 4DFPA 4ZN3A 4RBVA 3FQKA 4BRNA 2BBEA 2QM1A 3IAYA 3HPOA 2Q3PA 5GTHU 3B54A 3CCQN 2UUTA 1RT5B 1M1HA 4USTA 8ICZA 9ICMA 2B21A 2P6TA 3L0QA 1RKJA 1BVSA 1RHRB 3PYDA 4I2DA 3O9RA 2CPZA 4CJRA 2WFAA 4HT7A 4Q43A 1VRQC 2R8JA 4F36A 3NRWA 4CFAA 3J81j 3UQ2A 1C7YA 4NCBA 2OTLS 4WYBA 4BR9A 5KFSA 2ZOGA 3DXBA 3K89A 2WB4A 4LVSA 2MLZA 3TA1A 1T3OA 1SKWA 3CJ9A 4YD2A 3N5BA 1SV0C 1IBLJ 1D9AA 4QR1A 2CPRA 4KPYA 4WFAQ 1ZD3A 8ICHA 3A0BU 3ILOA 1Q3UA 1Q7YT 4GO5X 5IIOA 3I0RB 2GWJA 2PMZD 4QPXA 3BH6B 1VQMN 3VGTA 3PX6A 2M5YA 5K8MA 4R0EA 1TMJA 3DHXA 5AQIA 1L5UA 4KLHA 3KLHB 5AKHA 3LGMA 4M5JA 4EP4A 4OX8A 2NCKL 2XVTA 2L41A 1YI2S 4DLEA 2XMVA 3DLEA 2DXDA 4B8AB 2W1BA 1QTNB 8ICJA 3W2VB 4H5NA 2XGQA 4B3SK 4YOEA 3IWNC 1RZTA 1CPZA 5AM5A 2V4QA 2WSCC 1NGIA 4LF7F 2YXLA 5GMEA 3KK3A 3OY9A 2UXCF 1LFPA 2LA4A 1L7MA 3LANA 3IM8A 3M6ZA 2IFXA 3A5OC 3BO3A 1PVRA 4CM2A 3NGYA 2G0AA 2P9UB 3T5KA 3PG9A 4M3ZA 4KTZA 1E6YB 1VHFA 2VWBA 3AO3A 2F8EX 4FWRA 1IJFB 1T3QA 3H59A 3OL6A 1VQNS 2GAGC 1VQ7N 4Y0WA 3QIPA 3H3OB 5GAHP 1W26A 2JL9A 4F5OA 2BJ8A 1MA9B 3MMBA 2EFGA 5FLXU 4RNHA 4PG7A 4BUGA 5E33A 3BF4A 4H03B 3V9XA 4MFFA 3ISDA 3OXGA 4Y2SA 3M6VA 1EHWA 5M1PA 3B78A 1PAUB 4DV2J 1JLBA 1TKXA 3W2WA 5ALOA 4WP3A 3MM8B 3CCSN 3DDHA 4C98A 4TYBA 3FSIA 2JH3A 3CF5Q 4AHRA 3ZC4A 1YITN 3QBCA 1YDLA 4CO1A 1ZYQA 2KDOA 1ASWA 4A5BA 2UZAA 1ZQHA 5FROA 2FVCA 4CLWA 2YX7A 1H98A 3AOBA 3AO2A 1YSJA 4WFNL 3ITHB 1J2MA 1FO1A 4FSVA 2J6UA 3UD5A 2VQFJ 2QL5B 2HMIA 3FM9A 3R6MA 1DAXA 1R8CA 3F2DA 2PZSA 1GMWA 1VDHA 5G0RA 2MSNA 1X42A 3PEHA 3BH7B 4GLXA 4PWWA 4YOXA 5BYRA 2LVWA 1KQSR 4WBFA 4F2RA 3U4LA 4JV2A 4JB8B 1IBCB 3GE1A 3SI8A 4W92B 4J9MA 4EWTA 2K1RB 1WUUA 4JI5F 3ZD9A 5HHHA 2FVQA 5DZ6A 2VYPA 2MSTA 1U8SA 4FL9A 4LUBA 3O3FA 2D0CA 4USMA 2ZHBA 5EE9A 4AUKA 3NMAA 4RLEA 2IRUA 4DUYK 2DGXA 3ZO7A 4XUSA 2ASJA 3CFOA 4LFAK 1LB2B 4FLUA 3OQ2A 1JQGA 4YCXA 3CC2N 1RPLA 2UP1A 5AM3A 1TYQB 3F0NA 3J80Y 2ZJQQ 1SWVA 9ICXA 4B1YB 4FK0A 2AZ1A 1PBAA 2H3FA 5L1MA 3RB4A 1S1TA 2DPIA 4RWWA 1V6HA 2J9DE 4C80A 3FMBA 4JV5F 4P2SA 2GO9A 3M2RA 2AA4A 4FJ5A 1CSJA 3VQPA 2K4HA 1RWWB 3MK6A 1SJFA 3E51A 5E2QA 1YUWA 2B3TB 4KITB 2DR5A 3G8TA 3AAWB 1JLQB 4YR2A 1Q5VA 3KJVB 4AYBD 2OPRA 3OS0A 3KK2A 3KHHA 3D2WA 1ZJNA 4QPTA 3I55N 4LMZA 1Q81T 1GXLA 3L2VA 4C9DA 2VZ9A 1F0MA 2VL1A 5H1SV 2WVDA 1C1BA 4HVZA 2IDEA 4K0KJ 4ELTA 1NOMA 1XQIA 3T1YJ 4DEZA 3I8DA 1S59A 4DV3F 2R8GA 4F8RA 3JTNA 1OW5A 3OUYB 1U24A 3LW5C 3CMAN 3J7AN 1X4EA 2VG5B 2UUCJ 4DS5A 4JKDA 3LAMA 1WDDA 4IG3A 2J8AA 4GVMA 1HYVA 4PR6A 2F65A 4BVPA 3MXJA 4NMXA 2H51B 2DNNA 2HK2A 5KT3A 1WG4A 4YMMA 2YB1A 3LP0B 4Y0FA 4X66F 4USIA 2JLGA 2EVZA 1RZMA 2VBWA 2DFLA 1JN3A 4GVBB 2KFZA 4RW6B 1X31C 5JVHQ 5B8HA 4IH7A 3AT1B 2BDUA 4DFDA 3SYZA 3PRVA 4DWIA 4OL8A 2R18A 1TUUA 1HUOA 2JZBA 3MZIA 4KO0A 2MHNA 3UCGA 1SL1A 1YJ9S 4B8CA 1LV5A 3UN2A 4CBWA 5ALGA 2N4CA 3GG4A 1NMNA 4RW8A 2F8LA 4B9LA 2K8BB 3MAHA 3CB4A 4NYOA 2UXDF 4YY3F 3AY0A 2F5GA 2ZWOA 4WTYA 3TWZA 3OXLA 4EO8A 4OJOA 2W24A 3DRSA 1F3VA 4PG6A 1SVDA 2HNYA 4JWNA 3OYIA 4K5RA 1NKBA 4NMLA 1H72C 4US8A 4ZTJA 5J2QA 1BIZA 1T94A 1TKZB 3OL8A 4M04A 5ELZA 5C7PA 1MDUB 2IMWP 1YK9A 5CJ7A 1HPMA 4C6AA 3NAIA 4DV4F 4CH1A 4KHYA 5EWGA 4OGEA 4PHDA 3CHWA 3TA0A 2EZZA 2HQCA 2O8EA 3RUBL 2PMZC 2JLFA 2XNRA 3NCIA 5J2AA 1VQPS 3FZLA 7ICNA 1D9DA 1PUZA 1CG2A 3DLBA 2A42A 4LF9J 4KPCA 4AL6A 3KMSA 1RYRA 3HI0A 2AXTU 2NZ4A 2M9KA 4G65A 5J0YA 4DI6A 4J2AA 5ETLA 1ZPWX 4ZVTB 3V6KA 2CXEA 1HW9A 2V4JB 2XMTA 1HNZK 3RW7A 1N32F 1SH3A 4JD2B 3TEGA 2H1YA 2EW9A 1WC5A 3Q7CA 3O8WA 1JJCB 1HKBA 4OVLA 3QT7A 3R7BB 2BCQA 1BWVA 1TGOA 5IV3A 3CDBA 3QSYB 1CZAN 3DN9A 1FKAF 1L3TA 3TZYA 5A2QU 4L73A 2ZIWA 3O2IA 3AXMA 1FJGF 3B6PA 1HKGA 2KHDA 2KV2A 5LXRA 3OBYA 4OJHA 1SH2A 1N8RO 2KB2A 4JK7A 2MEWA 1Z6RA 5GAHU 5EE1A 9ICBA 1L7OA 3K5OA 4A8FA 3UXPA 2VOOA 4DPYA 4LF8F 1VSKA 2GJ2A 2V52B 1IXRA 4WFZA 5D0HA 1RDAA 3WZ0A 4YB7A 1J5EF 7ICIA 3CO9A 3OBIA 1F9FA 5EGYA 2HHTA 4CLYA 2C3YA 2CZ9A 3MEKA 4G3IA 4DR3F 2A40A 1DGSA 1EQ0A 1AA1B 2E2NA 4DOCA 3L3FX 2OPSA 2DY9A 4LZGA 4TU7A 3PRDA 4X62J 1RYUA 1LCUA 1WSVA 1HQUB 1L3UA 1O13A 4QOZB 1N61A 2GO8A 4F0HA 3MAAA 3N7SC 2W7OA 4ILLA 4U96A 3R7SB 2CUYA 1XNRK 4F3TA 1CJVA 1U1LA 3F53A 1HNWK 1TP7A 2X6SA 1FVSA 3K58A 2BW7A 4NXMF 4UARA 4J5OA 4P74A 4IH6A 1GH8A 1NOZA 2J6SA 1V3SA 3SMVA 2CPYA 1IKYA 2F9WA 2IPOB 3CE8A 1Y5LB 3R7NB 2ZM6K 2Z2MA 2KN7A 3LP3A 1LWFA 3UPFA 2NXCA 1CEZA 3M8QA 2MGZB 4B3MK 2FUG9 3CXCR 4NLWA 7ICLA 3DHWC 1EXQA 1RA7A 5DBCA 2C2DA 4WE1B 2PY5A 4LFBK 2ZIXB 7ICSA 4TUSA 2MUTA 2AEJA 2JLEA 3DLGB 1LXJA 3T7ZA 4E8UA 2VIXA 2YPYA 1HA1A 1GO3F 2W2NP 1ZQZA 1R43A 1NDCA 1JL1A 4UT4A 2BKNA 3ZDBA 4PJ0U 2EAMA 3N97B 1U49A 2E1EA 4OI3A 4V19X 4L74A 3TKAA 1T9WA 1SWWA 2BKEA 1KVIA 2GELA 5J0OA 3ISCA 2I1QA 2IVYA 2QIFA 3OHRA 3ZSOA 3A2FA 2DF4B 3J7YI 3MEDB 5A8KA 2UUAF 4Q45A 1BPZA 4MIBA 3OVAA 3PSIA 5AIBA 3FE1A 1VSHA 1RDFA 4AYBC 1IM6A 3UCZP 3ENOA 1X4BA 3SQGA 5MLCV 4GY2B 3SZ2A 1VBXA 1NNEA 2NR0A 2DD8S 2CNOB 3HO1A 4FJ7A 3M9NB 2H3EB 3HMJG 4CLSA 2O8DB 3NF8A 2NSCA 3UR0A 9ICTA 2OJ3A 2J7UA 2EHGA 5IWAJ 4E1NA 5K8NA 5KFQA 1FJCA 1Y9OA 4O8KA 2YKMB 4CW7B 2FHOB 2KIVA 4JI7F 3OSNA 1LWCA 1YTYA 3UKUB 2ZIVB 4JMUA 3AA5X 3GIIA 4I2GA 1S9FA 2R2UA 4P7VA 4JV0A 2GHVC 4CTAB 1S5JA 2G0JA 4ID1A 2D3UA 2Q66A 3AEVA 3V9SA 3TJ8A 4M6WA 5E79U 2EXUA 3VV2B 4H4MB 4FP9A 4FO0A 3WKAA 3O0FA 4TSXA 4Y2CA 4DB3A 3THVA 2UXBJ 1DQ8A 4DN0A 2MZ1A 2DO0A 1VQ5N 3B4DA 3JPQA 3MEEB 1ECWA 1U0HB 4O5CA 1FHTA 4DV6J 3M30B 5C25A 3QNNA 4CFCA 2KFYA 3ISND 2W7AA 3HRDD 4CH0S 5L1LA 5F9NA 4USKA 4OYPA 4CF0A 1RAJA 4K4ZA 4WXOA 2KMDA 2ZOMA 2JJ4D 4MQ3A 2G2YA 3BSAA 1J27A 1U2FA 4DOBA 3O6QA 4DQIA 4RKUC 4JI3F 2GQCA 1WSHA 1HJPA 4M47A 1B0PA 4NA1A 4B1ZA 4LH4A 4KLLA 4ID5A 4LF6F 3EO3A 2G2OA 5LMNJ 3MGVA 4KLFA 3K5NA 4C0OC 3ZX0A 5F8NA 4EEKA 2WHEA 3GWCA 2NXJA 1N6QA 4FJKA 4RBUA 4IO9Q 1X4DA 1ULRA 1NWKA 5CYQB 4KX3A 1NZBA 2GHWA 4HHTA 3I4PA 3NASA 2QI2A 9ICIA 2QA2A 1HIWA 3VEVA 3KZXA 2LBOA 2VODA 1ZA2B 3C1YA 3T69A 4DR1F 2HBRB 1FERA 4NLXA 3B8AX 5F41A 5DDMA 4OV1A 2AYBA 2F4FA 4R66A 2L9NA 2PFFB 3S41A 4FCYA 1Z4NA 1AXQA 3QUQA 3MCOA 1X3MA 4GRSA 1V9OA 4JKHA 4ITSA 4CI6A 3C16A 2YX1A 1ZZFA 3Q23A 1RGVA 3G8QA 2D0OA 3UKRA 4NCAA 2YHAA 4NXNF 1HBUB 4Q0BA 3WKDA 3C14A 4M5DA 4DV0K 1M0SA 1QSYA 4PHTX 1RABB 4DR7F 1S1XA 5KFCA 2MKSA 1CZ9A 3QFUA 2H48B 4USWA 1MWZA 2B56A 2HZVA 5LJWA 5A6PA 5G5HA 4EHUA 1EETA 4J91A 1U2RA 4LC9B 3WXLA 1T8EA 2LCWA 3F73A 1YF5L 4U67L 1WACA 1ZETA 2HQ3A 4UB5A 4FJ8A 2CJQA 5B7WA 3V7KA 4F0MA 3I0SA 3CCTA 4AH9A 3GJRB 5AE1A 3OHBA 2QLXA 1NUEA 1ZQRA 3DLKA 1ACMB 3W1YC 3WEEA 3ZX3A 1WCNA 4RQ0A 2A6MA 4RQ8A 1F9EB 1CS4B 3U6FA 2DYAA 1S0VA 3BV8A 3G9CA 1K5OA 2YN4A 4NZ7A 1XNSA 5F3XB 2F44A 4GFJA 2HGNA 2HZAA 4UATA 1VQON 4DR6K 2FBVA 4B3RK 3CDWA 1GMWD 1K73T 7AT1B 3C14B 4QIEA 2DY4A 2KKHA 3H2VE 3H46O 5BR8K 4S0MA 1HBOB 1BL3A 4PZVA 5SWMA 8ICXA 1VK0A 2P6UA 4FVUA 5K14B 2R7TA 1VC6A 4RPZA 1CXQA 5CR4A 3V81B 1T4GA 1NSQA 4BRCA 3IFRA 2CQGA 4X5VA 5HI7A 3I5BA 1VK8A 2ZH4A 3BY5A 2J8SA 2YX6A 1UEUA 3QT8A 5CD4H 3BEGB 5ADXH 1U1QA 3IUCA 5A8WA 1KLNA 5H9FJ 5CYJA 1VIOA 1S9EB 4DCCA 4OJLA 4I2PA 3W5XA 1DGJA 2PA8D 3J7YP 1Q5YA 4WCEL 4OFZA 4CVNE 4FWKA 1X40A 2QV6A 4E19A 5J29A 5KG3A 4K4TA 2G1HA 1UFWA 2UU9F 4Y2JA 4KHSA 2F8KA 1URRA 4XH4A 3R1HA 4F5RA 4DU1A 4JI0K 5DQIA 2CQCA 4NLDA 2ZG6A 1UCNA 1FFVA 2WONA 3O4NA 4JB3A 2OWOA 2FVSA 2B0GA 3N79A 1QE1B 2JMGA 2DNMA 2JWNA 1KONA 4Y34A 3NH1A 1ZQYA 3NVVA 1WOPA 3LUYA 5FDLB 2ISOA 1S6PB 4A59A 2R7OA 1KAZA 2W41A 1TAQA 1JXVA 3SV4A 3IKMA 1D09B 5F8HA 3PRBA 4L3QA 4MK9A 1JRPA 4BE0A 2I6WA 1FDBA 3GZFA 2I1RA 4KY3A 2YKNB 4MYTA 3UQ0A 2PFPA 2KZZA 3C15B 1Y88A 3WKEA 4AHUA 4JI2J 5A8WB 2RMLA 1IIPA 3W64A 7ICRA 4Y1CA 1UVLA 1RHMB 1ZTWA 4KBOA 1ATRA 7ICKA 2LI6A 5ALTA 5A8RA 5K8PA 2EZXA 2QWQA 3I56S 2CQHA 2LKZA 4NLUA 1FEHA 2P9IB 4NB4A 5DQGA 2CQ3A 4WXWA 1UAXA 4QWEA 1JWWA 1KNZA 8ICIA 4ZVRB 3AB4B 5C2FA 4G1IA 3DGPA 1HHSA 4X4QA 4ZHRB 1AZSB 2BRKA 1GX5A 1J97A 2W01A 1L3KA 2JVRA 5BPMA 3ISNC 2QJ3A 3MX5A 2MKYA 1FNMA 4AT1B 4ZJLA 1XHXA 3OR1B 2KJ8A 5BRDA 3DMJB 2VFUA 3V4IB 4PHPA 1F60B 1CJKB 1HIYA 3JAMO 3IG5A 1ZZNA 3UIQA 2R3VA 3D7SB 2YH0A 7ICUA 1RLCL 2CPFA 3ZTSA 1IKXB 4CDIA 5BN9A 1PJ7A 1YJRA 2LXIA 2W25A 2RAQA 1YJ9N 3TX8A 3JPTA 5CD4A 1B92A 1UA0A 5ADXA 3OTOJ 3HSZA 3AAQA 4ECZA 4K2XA 5ETOA 4KKOA 4QYRA 3SK3A 1R8PA 3IDWA 1UVJA 3J80O 2FZGB 5J2JA 3C23A 1EQMA 2C2RA 4NRUA 3V6JA 1NLVA 2X7IA 1FFGB 4FS1A 3R8YA 4LF4F 2V9WA 1RT2A 2MHEA 5KI6A 2EEYA 8RUCA 5LMUF 4FZVA 5IXUA 1FCAA 1IBKJ 3VEXA 2CZ4A 2E20A 4K8ZA 2FLPA 2ILZA 3TU5A 2LYBA 3CO0P 2FE9A 2OXOA 9ICNA 1X4HA 4OHYA 5FIIA 2EFQA 5T7LB 3OYMA 3D1HA 2QN6B 3MD3A 3IGNA 4PGQA 4QW9A 2BABA 1V3ZA 3C6TB 2E9TA 1NCLA 4CHYA 1Q82O 3R1XA 1S4EA 2IVMA 3G6VA 1FRIA 2WFBA 4IEIA 3CJKA 3DI6B 2OMOA 1F5CA 1PC4A 4X4RA 1VQPN 3OFGA 1OY6A 3NH2A 2A19A 1IBMF 4JKEA 3S01A 2ASYA 2PA3A 5JICA 4AHSA 3NGIA 5ALFA 4DHVA 3UCUP 1OH6A 4FLZA 2FJAB 4FJ9A 4O3NA 4YUDA 1U47A 2E7VA 2HRYA 2DIVA 3DXMA 2CPXA 2ASPA 5D4OA 1SUQB 1TL1A 2DBBA 1K8AO 3EVOA 3X1LB 2XSJA 3I87A 4O55A 2HRTA 2Z1JA 4DOZA 3P49B 1FDNA 2DHGA 4LSNA 5H2FU 4W90B 3DRRA 2ZDPA 4C0HA 2IVPA 1SQEA 4QZDA 2HAFA 4U7UK 2HGLA 8ATCB 5AQTA 1SI9A 1GT8A 2U2FA 1IH7A 4HCBA 2VCPA 4KH4A 3LDSA 4MAKA 4CH7A 2BGWA 5HLFB 4PWDA 2IVOA 3B4MA 1X7VA 1N88A 4Y6IA 4EELA 3TR8A 5J8YA 2JEGA 2XRIA 1C2PA 2AJFE 3H0RB 3I32A 4QS7A 3DM2B 4TURA 1CRXA 2H9ZA 2LDYA 8ICLA 2IM2A 1MWKA 2ZJPL 1ZQQA 2HFZA 2A6AA 3ID8A 1U6FA 5BOMA 3AU2A 2EK6A 1R31A 2A1SA 2FSJA 4A8QA 3HVWA 4QZFA 3T1HK 5CA7A 5F0XA 3SJHA 4ZCLA 1D9FA 1M5PC 2YWKA 4GXJA 1PZNA 4QZVB 1TL1B 4FM2A 2NYVA 3HD2A 1Q7YO 4C8KA 4M5GA 4GVLA 3AA2A 3FGUA 3EWGA 2OPQA 2Q1NA 4K42A 5IINA 5I3UA 2KHOA 2LECA 3P96A 3UR3C 3TNVA 3ZDEA 4RQ2A 5AJ3K 5CZ1A 2B7CB 3MPDA 4FOEA 1X9MA 4Y00A 5AZIA 2FDNA 9ICCA 2CDRB 2N3LA 2D6FC 5DB8A 2PFNA 1A6LA 3BGFA 5AK5A 3J7YU 4PG5A 1L8LA 4CYUA 1F5SA 1MWYA 4I2QA 1JCFA 2PMHA 4HDGA 3A13A 3NCPA 4A4JA 2WVBA 2ZDOA 3DLLQ 3VENA 4EBDA 3WX8A 3ORYA 5GMDA 4JI4F 4UW9A 3ZYYX 3GILA 3AVAA 3K8WA 2J0WA 4KBIA 3PKYA 2D9OA 1WCLA 4KFBB 1UAWA 2RQ5A 3ZX2A 3BZQA 3WQPA 2A2DA 3FFIB 3D68A 1ZQOA 4C8OA 4M2YA 2EDUA 8ICNA 5CYMA 3PIOL 2BGGA 1X1PA 4WF9L 1ZQUA 1NEEA 4HEA9 2Y1RI 3S6EA 2X3GA 1ROFA 2DGOA 3ICLA 3MEGB 4M5LA 5J2IA 4UASA 1XTZA 2NRXA 4GKJF 1VRTA 2BM1A 2F76X 4DX5A 4V19S 5KAFU 2AP1A 1OMSA 2BANA 2C2EA 3HL8A 1YVNA 7ICTA 5KFJA 3TVYA 4CJUA 2GO7A 2KZ3A 1VC5A 2YX8A 1XO0A 4AQYJ 3VN5A 1JMTA 1PYSB 3W60A 1S6OA 1NBEB 4B3OB 4CEQA 1IR0A 5H1SQ 1ASUA 3CCVS 4DPOA 4WIQA 4U67Q 2NRZA 5J2DA 4CJ3A 2YMLA 2NLXA 5FPEA 3VQTA 4HUEA 1NZ8A 3IM9A 1B70B 1BQMA 4BCAA 1K0VA 4IJNA 1YJNN 1UMJA 2J7KA 4AXJA 2VKQA 5ALSA 4PHAA 3AUOA 1NHVA 3RMBA 4Y2UA 2GEMA 1ZXIA 5HOOA 4DTRA 2CZVC 2ZBCA 1Q7LB 1XO1A 1MLAA 3LDNA 2F77X 1WUDA 1SV4A 5BRFA 2QWLA 2FLLA 2J9CA 3MCNA 3OHAA 1QQCA 1VMBA 1KVJA 4NWIA 3CJ3A 5KG7A 1G2EA 1S10A 2EBGA 4QWBA 4CO3A 4FWLA 2EH9A 3SNNA 2ZGZA 4W4MA 5GADI 4MDBA 3F9KA 1QAIA 2FHJA 3QYYA 3GIMA 4KV8A 4TY8B 2I5JB 2H3VA 2WF9A 1JUDA 3ILIA 1XEZA 4O3OA 3CQ8A 5D0GA 1KS2A 2EPIA 1CZBA 2ZH6A 2Q0UA 4CO2A 3CD7A 1T05A 3K5MA 2VV5A 4MN4C 4CBXA 3FZKA 4N47A 2M0NA 4FYDA 5DG8A 1N54B 3KMQA 3DKDA 1YZ7A 4TXSA 3Q89A 2WF6A 3A5MC 4U7BA 4CJEA 2A3VA 5CHCB 2FVPA 5KFEA 1YJUA 2QMXA 1QQ5A 3M32A 2HK3A 4FXVA 5EVZA 2CQ0A 4GC7A 4GV9A 3ZD8A 3ENQA 5JMVA 4WCEQ 1E4GT 2VG6A 2D3O1 3CI5A 2X78A 5KFGA 4EU0A 3HZEA 3OTBA 5AXNA 1KLMB 1Q81O 2LQJA 4A57A 1J54A 1X0FA 1UT8A 1ZAXA 4O0IA 1COKA 5B5EU 3DLRA 1V9PA 3QEPA 1JLEB 4OV6A 3D5MA 1HI8A 4BJQA 1ZBHA 1AFJA 3WNHA 1RKIA 1UETA 1APSA 2HMPA 3TAFA 5D0RA 2J0XA 3POTB 4EX6A 2R2SA 1NGBA 3HP6A 1CBKA 1VRUA 2WCXA 3E2EA 3ZSWA 1ZS6A 5B0CA 1S1WA 2QA4N 3N01A 2GH1A 3LWLA 4DCJB 2BEFA 3WQUA 4NPOA 4UY8T 2C2MB 4BXOA 1N5XA 3PHEA 3DYAA 3AXKA 3GB0A 4K43A 4BE1A 3P5BP 3WK7A 2HVHA 1ZOLA 2GQQA 2OA8A 2BQUA 4I6MA 4C11A 2W43A 5M1NA 2A1BA 3MECA 2JEJA 2BXJA 3LPTA 4DSEA 3CP8A 3LGNA 4CEFA 2DFFA 2WC9A 3AO5A 4JLHA 1Z19A 2ZF5O 5A0YA 3PR4A 4IFEA 2EC2A 1RCOB 4OHVA 2NSBA 4DTXA 3MM6B 2W8LA 4O5KA 2KXFA 3MMCB 4CJ4A 1HW8A 9ICHA 3J7ZT 4YXJA 4U6PA 4Y2IA 4DTPA 4HI1A 4KTWA 2QXFA 2IRXA 3ZETB 3W61A 3U7JA 4I6WA 4YEAA 2XO7A 3MABA 4CM0A 3AVFA 1N33J 1SC1B 5D0EA 3B6OA 2E2PA 1XHZA 4JI6F 3E01B 3CD6N 2P9PB 2CH5A 1NGHA 2BCRA 1XMQF 4M3XA 1WSEA 2Q3SA 1NRKA 2P51A 1ZRMA 2YBVA 1YRTA 2FC8A 3CPEA 5ALWA 1NGAA 4MMOA 3GR0A 3OSPA 3KDOA 1OVYA 2P9CA 5B0DA 1ICEB 4HI2A 1TVRA 1HYZA 3FCWA 3SDEB 1KXPA 5J0UA 2I7NA 2YKOA 3THWB 2BRLA 8ICWA 3HT3A 4ICLB 5F2RA 4NZ0A 2BCUA 1S72S 3Q8PB 1CJUA 4RL1A 5M2RA 4I6MB 2DO4A 2PFOA 2W11A 2EG1A 1E3MA 3HKWA 5D4PA 1TMMA 5AFUH 4K5SA 3RJGA 1UW9A 2I38A 5A0YB 1FRXA 1FWLA 1X9SA 1DFDA 5HNKA 1YQHA 2BA9A 2IHMA 5BYSA 4KHWA 3R2CJ 2QW9A 4BR7A 2YV0X 2DGQA 3WNFA 2GIQA 2KG1A 1I94J 3A3PB 1UPHA 4K50A 3CTRA 1CC8A 4I2AA 1RTHB 1K8KA 1NZPA 1TTHB 2IS3A 3D6FB 7ICPA 2GVDB 3VERA 4QBUA 3RBZA 3QSIA 1LK7A 1Y3JA 3HJVA 5EY4A 5AICA 2P9GA 1YKWA 3QFPA 4QU6A 1KR4A 2QARA 2M0GB 1QSSA 1WF1A 2DH7A 2QEXN 2MKIA 3Q22A 1HD0A 3M8PA 3BS5A 3OL7A 5E84A 4ECUA 2MKJA 4PCQA 3DRPA 3HZ6A 4ANCA 5IV4A 3ETRA 4BWJA 4RU2A 4B9VA 3AJ2A 4RW4B 4QQBA 5J2GA 3PEJA 1IBLF 1VQ9S 2NRWA 3EYZA 4KB7A 4Y2AA 2ZBIA 1MWMA 3PR5B 4OI4A 4KN4A 4CHOA 1U45A 4OMFG 4ES3A 1F1BB 3P45B 1DEJA 2OD4A 1KC8T 3W3SA 3QLHA 5MLCQ 3QYPA 4FJLA 1NK7A 1RAHB 2KT2A 1V4SA 1RTIB 1S1VB 2ESEA 1SJ4P 2ZIUA 4RQNA 4EENA 2P8IA 4FM0A 1RT7A 3C7NB 4QS8A 1MU2B 3VF0B 4A46A 3P39A 4ZVSB 3NL0A 1ZBUA 5TKYA 1SJ1A 1TZ0A 3QERA 4F02A 4N77A 4EBCA 4WP9A 2UYTA 2W9BB 1VQ8S 2RHFA 2DEIA 2OZSA 4LR7A 3QO9B 1UPPA 2ZE2A 4NLYA 3WK5A 1EKEA 5GADP 3L09A 1AROP 1DK2A 3Q8UA 4HUGA 2RKIA 3EDRB 4WIIA 4FLTA 2VWKA 2W3RA 3HM9A 1BI4B 3KLEA 1HNIB 4CP5A 5J1EB 3ADAC 4QZAA 3L3VA 5AI9A 3NRBA 2YHBA 5J2HA 4LF5K 2IIHA 4DV2F 3GYGA 3V6DA 3HULA 4MEYA 4ZPCA 4FXDA 3V4MA 3RR7A 1XR6A 2B9XA 2HWIA 3Q8YA 4NM2A 5DGBA 4DTNA 4I56A 2P6SA 3I5AA 3GPAA 4CF5A 1Q86O 2B6AA 3VA0A 4CK1A 4XQ8A 2CJ9A 4PXBA 4LY7A 3J81Y 5J2NB 2HS0A 1SCJB 2NUHA 3C6UA 3K75D 4YG2A 4JI1J 2VKZG 4L72B 2JHEA 1VISA 4CIOA 3DDIA 3ONNA 4FYYB 1FKOA 3P31A 5AQLA 2GOLA 3U1MA 1HHQA 2VQFF 4GKKJ 4GO7X 2D5RA 3VTIA 3ISZA 4PYAA 5CE3A 2GLEA 4IFVA 3A1YG 4RNOA 3ZZ0A 2CPIA 2HI0A 4DL7A 1WHVA 2HVEA 3NS7B 1UJ5A 1KTVA 3U9DA 3VESA 5CWRA 2EFOA 1RQ0A 1D8ZA 2V2VA 4RPYA 5IT9O 2KNJA 1NJIT 1CQMA 2L48A 1OPIA 3IN5A 2BE2A 4IC9A 1JJHA 2FBYA 5HL7Q 2JC0A 4HDHA 5ALKA 4CE6A 3TFRA 4HKQA 2M70A 4P2HA 3EW9A 5KFXA 2FC0A 4PWUA 2MU2A 2VASA 3SQ1A 1NSKL 3LALA 1PO6A 4RU9A 2ZJ5A 1ZQEA 1YJWS 4NYNA 4Z4FA 3HSTB 3AH6A 3EDQB 3HHNB 2BPCA 1E6VA 3BGRA 3RYLA 4FJJA 1H38A 4DR5K 2G8WA 3RRHA 4PG4A 4OYAA 3AVJA 2IOHA 3G4SS 3TTDA 4B08A 2GVZA 5C24B 5EE3A 4BQZA 2CA9A 1RXWA 3KD3A 1WTFA 4LQ9A 3CCUS 1KP6A 3L8BA 1JCEA 4JWMA 3ONQA 3KD1E 1HR0J 5KPZA 5KG5A 5JS1A 4FF4A 2XB2D 5AE3A 2VANA 3BQ0A 2H4YB 3NUQA 4OI0A 2MKCA 3ZZRA 1V38A 4K4YA 2UUBJ 1LKYB 3IC1A 3CJ8A 4E89A 4RT2A 1Z4OA 4HHJA 2KVIA 1ZQIA 5AKZA 2IHR1 3TUZC 5H9EJ 3D2FA 4UUWA 3TFSA 4K0KF 1O6XA 4CNYA 4CNZA 1UVKA 5T41A 3T1YF 4M9JA 3M8SA 2BE2B 2FD2A 3EX7B 1KEKA 5DG9A 5C42A 3RJFA 2DFEA 3SSQA 2K3KA 4YHHJ 1UTAA 3VQCA 4IQVA 4M5IA 4PABA 4OJ5A 3D2EA 1Z26A 4DV5J 4NLVA 1RBRA 4KAZA 2C3OA 2UUCF 4M63A 5IQQA 2E1YA 3HPHA 4IRCA 2IC3A 3TAMA 5HQLA 2XTJP 1H6KX 2QA1A 1KQSM 3W0LA 5KFKA 2XGPA 3PV8A 2OKQA 3FNNA 2Q31A 3A12A 2ALZA 3G6ES 5LL6Z 4J9RA 3SMPA 2CNNB 2ZJAA 2HHHK 3VAJA 4NLQA 2H5JB 4XPCA 1XWLA 3C29A 1OY9A 2HWTA 4PYDA 1C0TA 4FF3A 3OYGA 3JSYA 1I5OB 2D41A 3QWUA 3KJFB 2XY7A 2OFGX 3FUYA 3NXZA 2JEFA 2MQOA 4GKKK 4CNQA 2F9TA 4MKBA 3FEZA 3HOSA 2VJ5A 4M7XA 2HSTA 1T95A 5EOZA 5DB6A 4DR4K 5EOYA 2VJ4A 3JSRA 3PYGA 4HACA 2FPHX 2AIRB 2KFNA 8ICRA 3WDOA 3KJNB 3D1OA 3HVAA 1BGXT 1RT6A 2UVVA 5CZXA 1NO8A 4QYZK 3LYSA 1WF0A 1TV6A 3CCQS 5D3GB 5TISU 3WXMB 2OTJN 1JX4A 4XPEA 2WB1D 3HFZB 3G82B 3R5JB 4NV0A 2P5GA 4ZVUB 3WKCA 3TJ9A 3GZ7A 2IC3B 2WVEA 4C8YA 1WBBA 3M6UA 1X60A 3QX7A 5CR0A 5FLXY 3OL9A 3CERA 2KSOA 4E7LA 3OD2A 2HHWA 4USAA 4EEYA 1SIWB 2J76E 1X8DA 4CJFA 4OZ1A 4ZS6A 1X0PA 3NGKA 2B0CA 4ZJQA 2W4CA 4ER8A 2H3ZA 3ULEB 3E8OA 3H8YA 4OYXA 2NYIA 1RXVA 5J2MB 5IM0A 4OJRA 5L1JA 1KTQA 3IG1A 2KU7A 4KIAA 4AP9A 4LF9F 1U1PA 1DKGD 3SAFA 1NLKL 3H6EA 4KX5A 1RBLA 3KHLA 3VALA 2OLWA 2R7VA 2VH7A 1VQMS 1N36J 3NS5A 3PFEA 3AFGA 4WQ4A 1ZPVA 1VGYA 4ECRA 3C2KA 2V8VA 4OZJA 5HQMA 3CCRN 1BMQB 4MFAA 3WK6A 4A62A 3T3FA 5A6WA 1K73O 1S76D 3DC2A 2WW8A 3CYMA 2Y0SF 1F0XA 4XO0A 3T79A 2JWKA 1RHKB 4OZ0A 2JR5A 2E66A 3AJDA 2W04A 3OYAA 2VA3A 4P4OA 6FDRA 2WOMB 4MJKA 1BG3A 1L7NA 1Q8BA 2JC1A 3OYEA 4OJ1A 5GADU 2RDJA 3TWHA 1NMEB 3SBTA 4IYQA 1BPYA 2QO3A 2PEBA 1VQ7S 2FHJD 3FEYB 1ZBTA 3JAMU 3G8SA 3MPUB 4M0AA 2W6LA 3IRXA 5ALZA 2XS2A 2OUGA 2F1JA 2BKOA 2VQEJ 5ETKA 1GAOA 4MFBB 1TK0A 1FJEB 5KG0A 2Y1JA 1DRGA 1S6QB 3BSNA 1FD2A 2Z58B 5KL1B 3T19A 3I5CA 4IOAL 1TAUA 2PE8A 4H0XB 4I2CA 2HNDA 3M6KA 3H5YA 3ALRA 5FJ4A 1UWBA 5J2BA 4FK4A 1MW7A 4YD1A 2FZCB 3SLCA 5LSLA 1FD8A 4ZVEA 3BN4A 4PGYA 1YITS 1IWGA 5AQJA 4H4OB 4KN7A 1JMSA 2XY5A 1OH5A 3CW2C 2CIMA 4X62F 2EANA 3VGMA 2RE2A 3U9ZA 3ZSZA 4CHNA 1RTJB 7ICGA 4FW2A 3CC7N 1K1SA 2G2ZA 5HBMB 3V7JA 1HJRA 1VQLN 1P8ZA 5DDQC 2YCHA 4OX9K 1BA1A 2G4BA 2V9KA 4JP8A 4E7KA 4ZVGA 1YRXA 5CEHA 4JHDB 3QEVA 3Q86A 4XH5A 2E1CA 3PJXA 1VK3A 5J2CA 1HWJA 1XSNA 4A8XA 1WWHA 1WHYA 3KFWX 3SAGA 1NDLA 4TQRA 3GQCA 4Q5VA 2K2PA 1S9GB 1KFDA 2YQ1A 3MXMA 3WXKA 1HLWA 4HH1A 1A9NB 3NF6A 5EHHA 5BYQA 4ETZA 2XLJA 1LFWA 1S77D 3W9IA 2HBYB 5E5NA 1DTTB 4OYIA 4Q8EA 2ZUCA 1N5QA 1AUDA 4Z6DA 3LOUA 4K4WA 1UJ4A 4ANEA 4DSFA 2GWSA 3VQ7A 3BP8A 5DZ7A 3N0VA 4DUZJ 2AU0A 4I2EA 4ZMMA 5I3PA 2KG5A 3CC2S 3O9QA 2FMQA 2E5LJ 1UA1A 4KR0B 2Y1IA 4IBNA 3RAXA 2RHSB 2JOQA 2MZSA 1O8BA 5J8YC 2BTFA 1HNXK 3LQVA 4DG1B 1WOSA 4UTGA 1KBUA 3TA2A 2FHMA 1FWKA 1SS6A 4PQAA 1ZD2P 3F5EA 3D6RA 3SV3A 2LYVA 2ASDA 4UOCA 1IJEB 3LAKA 4QOTA 4PPXA 3UB5A 3P6YC 2A1RA 3BZKA 4CWBA 2BCVA 5ALRA 1ESVA 5THWA 3IA0A 3I55S 3L7PA 3H42A 4P73A 1WI6A 5IWAF 5JRTA 2UXCJ 4URGA 5F8JA 3DEEA 2O4IA 5KT4A 4KJIA 3MM7A 4OYBA 3NEKA 2J6TA 3QATA 4TU9A 3ILJA 5IIKA 4DV1J 3O5TB 1T03A 2ZVIA 1HPZB 2K7JA 1DQ9A 2R2RA 4F3MA 1EAYC 2MY7A 4CIEA 2DRBA 3G71N 4C0ZA 3UD4P 1J53A 3VAMA 1VSJA 2HIYA 1NK0A 2ZZTA 2HZCA 3CIPA 4B9QA 1IO2A 1P8GA 1JKHA 2CVEA 2UXBF 4KHPJ 1X5TA 4TVAB 2HMXA 3KLGB 2KJVA 1GXUA 1LW0A 1BO5O 2KXHA 3BSOA 4DV6F 1EKSA 3I6PA 2X51A 4OHXA 1Z00B 3AVKA 4PQUB 1BC6A 3FBCA 3MDFA 4ZOSA 5KQDA 1K6YA 3NRZA 4P10A 2W2PP 4U7UD 1OYDA 3CJQA 1YVUA 5ALMA 4USJC 3PY8A 3PMNA 3IBPA 2HLTA 4R65A 3F2BA 1Q79A 1WG1A 5GIPA 1PK1B 4ZOHC 3R6GB 2DR9A 1HKCA 4CLZA 3CCJN 2IAJA 3NGZA 1HWLA 2JFKA 1WUAA 1WYGA 2WB1C 4ZTFA 4KLTA 3AMZA 4X4SA 3MWTA 3TZWA 2YNGB 2F3JA 3I9ZA 5I4MA 3VGKA 3BUZB 5LMNF 4XH1A 3UE5A 3H8JA 2CRLA 2HBQB 2QWNA 2EFVA 5JVGL 2BX6A 5J2KA 4DUZK 2SXLA 3QDKA 2JZ5A 3MR2A 1K9MT 1KW4A 3O1WA 4KHMA 3ULDA 5DB9A 3AHPA 2Q0RA 2A1JB 5D4NA 5HVFA 1MNEA 1L6NA 2HF4A 4BGBA 4WFBL 1NNLA 2G8HA 1JLFB 2P9NA 2VB6A 1WKKA 5DM7L 4PKGA 4KSEB 1FESA 4CF1A 5K20B 2PXIA 3G86A 2VDIA 3HWTA 3CMQA 4WFXA 2ZH9A 3DXKB 3UMGA 1U1OA 5LJ3Y 4X64J 3QIDA 2MQLA 3C21A 1BCOA 1VQ9N 4G1PA 5HMZA 1Y64A 3PNCA 1NHUA 3HSDA 3AL0B 3ZZTA 2XY8A 3JXOA 3LP2B 3FBEA 3QE9Y 4LF7K 4J9UE 2UXCK 4B9MA 1JLAA 1HQEB 1RWMB 2ITMA 1GLDG 1JLGA 4V1Ak 4OGCA 2Y8YA 2ZJQL 2YKQA 5KAKA 4LD0A 5IIMA 5HSPA 3A8JA 1S0MA 1RCXB 2D74B 5KTQA 3RJEA 2CQDA 4K25A 2KRRA 3AVBA 2E8NA 3FCHA 1Q3VA 1FXDA 4DUTA 3O4WA 1ITGA 3ZFVA 1HI1A 4I2BA 2OO4A 4PL1A 4R8UB 1CQNA 4BC3A 3ENWA 3GFHA 3C5GA 1WI8A 4HUFA 5D6GA 2M4MA 2V8DA 4TYAA 5AI4A 3PM9A 4O4RA 4DR2J 2ACMA 3ETMA 4BC2A 1YHQN 1OY8A 3H7IA 2Y0BB 3KLFB 1LNQA 4RW7A 3IP0A 5HANA 4DV7J 2H4WB 4NCGB 2MRLA 1WNEA 3CJBA 2YQ3A 3CNQP 3OJSA 8ICEA 2LP4A 2JWLA 4K41A 3A8YA 1ELOA 1ZQSA 1MROA 2BJ3A 2V2KA 5DBAA 1TVAA 1RAIB 3HFVA 2PT0A 3D2SA 1QAYA 1UVNA 5D77A 3EEQA 2A0FB 1TK5A 4L6V3 2KT5A 4M5NA 1T44A 1U4BA 3QEWA 1DY3A 4IQTA 1EP4B 4K4XA 1FT8A 4KLUA 2MDAA 1NGJA 1OH8A 1FTRA 5JVHL 3ZEUB 4B3TJ 4IG0A 4AL5A 4MDAA 3BF3A 2FI1A 1WORA 4CIFA 3H25A 5E0OA 4JI5K 4K8RA 2ERRA 4YP3A 3OPXA 1FTCA 5HMYA 3CD0A 3HVTB 3E66A 2JGUA 4UQGA 2LEAA 2CJKA 1XSLA 3KLIB 2O8FB 2B4JA 2QC3A 1VQKN 4JS5A 3CC4N 1OJ4A 4LREA 4B9SA 1QQ7A 4YR0A 3NBPA 2F4VJ 1FEZA 3IMQJ 3K2YA 3SQ0A 2E5GA 5CZ2A 4CI0B 1JCGA 3DCAA 2CJAA 4JKGA 1N48A 3KWMA 3CGIA 2D3DA 5AR0A 2HBKA 5ALNA 3KZBA 1ZD4A 3ISBA 4GW6A 2ZD1B 4JV5K 2ZNYA 2QLBB 2RS2A 2WF7A 3ATUA 3M7DA 5ETVA 4MF2A 3G25A 1QUVA 2KVQE 2QLFB 1JB0C 2ZOFA 3GFYA 2NXEA 1NBWA 4M7YA 4J90A 1NI3A 7ICFA 2LEBA 1ZM3A 5DO2A 4F91B 4LJMA 3IP4B 2BQ3A 5AQYA 3HHDA 4EO6A 4EP5A 2D3OR 1HJOA 1HMVA 3AQPA 3T5LA 5C5JA 1WHXA 2MXYA 2VFVA 2CN1A 4ZCMA 3BB5A 2ZGYA 3AJ1A 5HP1B 4EZ9A 3EJMA 3PYFA 1IUJA 2QT7A 1C4AA 2QYGA 4JI2F 3SENA 1N63A 2R7QA 4DV3K 1VQYA 4UQTA 2O4GA 2N7CA 1HQ2A 1SAZA 4ILJA 3RVCA 4I27A 4RUCA 3QZ8A 1RT1A 1HUXA 2CADA 3ZT1A 5CB1A 3CJTA 2IYIA 3DOKA 2X1AA 2YKAA 2KW4A 3GSIA 5ETPA 3UDCA 2DRAA 3J81O 3JYTA 2VJVA 2JH7A 5KGXA 2EFPA 3AVGA 1QQ6A 4CFBA 3THYA 4QWDA 5AQGA 3UVJB 4X66K 1K44A 3CFRA 2YQEA 2GWKA 1RYSA 4B3SJ 1YBTA 4H8KA 1RXOB 3SFUA 1RU2A 3BM7A 4CF8A 2HVDA 4FZLA 3T41A 5MAOA 3M1FA 1NKEA 4K4IA 3H2UB 1KSPA 4O0JA 1H7WA 1WLJA 1WTBA 1WJ9A 4X4TA 1VQ5S 1KCFA 2AGQA 4B3TK 8ICVA 1XERA 3MDQA 3MWPA 3KK1B 2UXDK 3BEXA 4WTOB 4JOUA 3JQMA 4YY3K 3DOMB 4QJVA 5J0TA 2R7YA 1C0UB 3TYTA 3KG1A 3D6HB 3M2VA 1QUPA 3MM5B 4I9QA 3BS7A 2WTUA 2MY8A 4OD0A 1YIJN 4HCCA 3BS9A 2OAUA 1GQEA 1C20A 1YTAA 5AZJA 1IV8A 2W03A 3NNHA 1W0HA 3CJ4A 8ICMA 1NH7A 1SPBP 4BX9C 3RH6A 7ICJA 4DZDA 3KG4A 5M1KA 1HNVB 2HQGA 3BREA 4O0NA 3OTOF 4DQRA 1NM2A 1FI4A 3M9OB 1FNXH 4NXMJ 3NGUA 2VFRA 4RQ6A 2F1FA 5DLFA 1GLFO 3RU0A 3LPYA 3CIMA 2P5VA 5AM4A 2E2OA 1HWKA 4PXCA 2X6NA 1SXDA 3IR5B 5IZHA 3JYTB 3LDPA 5ALUA 4CESA 3S6JA 3IAS9 4WK3A 2HQDA 1XBWA 2YNFB 1N4LA 1FWPA 1RAEB 3LP1A 5AQFA 4DXLA 1U6BA 1C1CA 3EM1A 3CWJA 2U1AA 2P66A 1RWVB 4PZNA 4CZFA 3PYEA 1IBKF 1ZM2A 1OYEA 1Q8KA 5B0BA 2LKYA 4F93B 4DSLA 3D4JA 5BPNA 2Q6CA 1D4XA 4E0DA 4GXKA 1EXNA 3H8WA 1R0CB 1MWQA 4BLGA 1JIHA 4C23A 4P0QB 4ZPWR 1NPPA 1B22A 3GMGA 2B6GA 3V6HA 2XYHB 1N32K 1VHIA 4YDUA 1O1WA 1N2XA 4RQ5A 8ICKA 4C7ZA 2MB0B 2HHXA 3DV9A 3S3NA 2BACA 1BHLA 2BW2A 1QQNA 1G15A 4QIGA 1W7AA 3SQ2A 2XY6A 3N9UC 3M6GA 1RDUA 2KT3A 4R63A 2ADCA 3HX0A 5IT4A 1FJGK 1TKTA 1VIXA 3R3LA 2W9MA 4YB1P 4DUYJ 2C42A 4QZ8A 3EUB2 1FFWB 5JXSA 4Z94A 2ZVSA 4Z7YA 2PDAA 4LFAJ 4FPBA 3CJCA 1C0MA 3JPNA 2IBKA 4KH5A 3T1AA 1VHXA 1UJ6A 2GMJA 4B17A 2IJRA 3BO4A 2F1HA 4DDFA 2ZH1A 4LF8K 5B0GA 3P4IA 2AF6A 1A77A 7ICHA 4Y2XA 2CPEA 3EE3A 1ZJMA 1J5EK 3OYBA 4ZLLA 2O66A 3RH4A 4JI7J 3CQYA 5J0PA 4ES1A 2FB0A 2ZKTA 3GDQA 2MAXA 1TQLA 1M5HA 1ZQWA 2FJEB 1NB2A 4PRFA 1B64A 5JLHA 1RI7A 1HBNA 3VGVA 1SZHA 2P9SA 4O3RA 1IJJA 3EGVA 3QNWB 1UEVA 2CQ4A 3MM9A 2OHDA 3NS6A 4CJLA 1RISA 1BWEA 2RILA 3O3GA 2O3DA 1YJVA 3F2CA 2G8VA 4DTOA 4LF2A 1CXUA 2DEJA 4ZCIA 4B1VA 3I31A 1UL3A 4HTIA 1VQOS 2DITA 4R0JA 3W62A 4NXMK 1LVHA 2RF2A 4WZQA 4OYZA 2ZC3A 5FLXO 4BDZA 4A61A 4FLWA 2QLTA 3SEIA 2DNZA 4HYKA 4YS2A 4R79A 1F5AA 4KI6A 2P9KA 1VQ4N 4NL5A 4KI4A 5IT9U 3ZT0A 1KC8O 1RDRA 3DLEB 4MH8A 4CF4A 1ZQDA 1Z1ZA 4O44A 3FDSA 3QZ7A 4QZEA 3BDEA 4JI3J 3SCLE 4HTLA 4LJXA 1VR6A 3QESA 1BWFO 1CJTA 3KK3B 5JVGQ 3CMEN 2GTDA 1Q46A 2CG8A 1TUWA 4OZ5A 5GTIU 3NGSA 3NVKA 4B1XB 5KNIA 4ECQA 4B02A 1RBTA 4DSIA 4QZGA 2KO1A 2A41A 4WFBQ 3LM2A 1KBRA 3MM9B 3QIPB 3OVBA 2XHWA 3C66A 3FQLA 5SUHA 5DM7Q 2LSNA 3EXCX 4ED4A 2GGPA 2HBLA 3MUVP 4Q7AA 1NK6A 1T7PA 1RWOB 4KGXB 2G08A 1SZ2A 5KT6A 3MMBB 4FJHA 8ICBA 1UW4A 2UUAK 3HM8A 3N6LA 2OPPA 4FBTA 4IO9L 1N52B 2N1RA 2W8KA 4QNLA 3Q8RB 1JLBB 1TKXB 3W2WB 4LF1A 1HEKA 4KQZA 2Y8WA 1H74A 4KLEA 4DX6A 3SXLA 5ITHA 3AU6A 3MURP 4NJ8A 1YJTA 1MN9A 2BZ2A 4F04B 2CPJA 3ZLJA 1BQNA 4QIVA 2H65B 4M63C 4X84A 8ICFA 1X5SA 3FAHA 4I2IA 5J2PA 1SGGA 1TAMA 4UBCA 4GV6A 4C97A 4O44B 1DTQA 1XUPO 4JI7K 4R5PA 2RHQB 4O4GA 1U1KA 3H8MA 3TR5A 4F5QA 2F8MA 1M90T 4AQYF 3DOLA 3M4XA 2IVFB 2A10A 4B1UB 2QE5A 3IV6A 3GE9A 2F7TA 2GBZA 2FMSA 1YZ6A 2HMIB 4OX7A 1FE4A 3Q8MA 4WU2A 4FWPA 1KQGB 1XNQJ 5G0RB 4CHZA 2MQNA 3QINA 5KFTA 4B9NA 5GINA 3IMXA 2QLWA 2Z56B 3M1VA 3D7EO 1FK9A 3KFUF 2EBEA 3ENBA 1HNZJ 4PL8A 1C1AA 5AKKA 2NPFA 3GBTA 3BSCA 1JXEA 3EWAA 1N5YA 4QS9A 5J0XA 2XMJA 4HL9A 4QIWD 3QNMA 3VQ5A 2K8CB 3MFHA 4HH0A 4I6AA 2B9WA 3CJ5A 4MKAA 2IJFA 1J6ZA 3PO4A 3GCWP 2ASMA 4WWSA 3ZDAA 1BOTO 4X4OA 2PFDA 2F8HA 1W97L 2XYGB 2CWKA 1BIUA 3C0BA 4B1WB 3THPA 1RBAA 3C95A 3NNAA 4JI3K 3A8IA 4JYAJ 1VCTA 5ALVA 1S1TB 4KREA 1FXXA 2FC9A 2OH2A 4PZOA 2BJ9A 1A5VA 1KD1T 4LF6K 2E5IA 4YXMA 3M2RB 1NU4A 1CLQA 4Y28C 2W4PA 2MQQA 1F6TA 3ID6A 4OO1J 1Y5IB 3OR2A 3Q2TC 1DARA 3O08A 1N8RT 3AVMA 3ZTQA 4YB5A 2OPRB 2F40A 4NRTA 3KK2B 4YB6A 4AHVA 3A0IX 2P1JA 2VGNA 3VAIA 4JRQA 1EKRA 3OFHA 4DR1K 4PUOA 3MR6A 1C1BB 3WBZA 1H2UX 1F9HA 4FPAA 3AA9A 4Y2YA 1UKUA 4WQ4C 3RF9A 5DB7A 3N4PA 4J2BA 4UZBA 2YNIA 2DPNA 2L08A 2KKZA 4C7YA 4B6JA 1UWAA 2ZJRQ 1XNRJ 3MXIA 4OI1A 3OBWA 2MQPA 1HNWJ 3TAGA 1D8BA 3JQJA 4PPZA 3HPGA 4IG3B 2PMZF 3EVWA 1QJHA 2HS3A 4NXNK 2Y9TA 4DF8A 1ZM4A 3GJQB 2ZM6J 2V68A 4MLHA 4FK2A 2AHOB 4BGDA 3CJSA 3A3NB 2P6RA 5HATA 1YGYA 9ICJA 4B3MJ 4DR7K 4BDYA 5J0QA 5KGWA 4NOHA 3NGDA 1J5OA 3LL3A 2VWJA 3JSMA 3W8PA 2E88A 2FJXA 4LFBJ 1T3NA 3TADA 2VG7A 1KVBA 3L3UA 2PMWA 2XWXA 2KKVA 2JZBB 4KO0B 3FR0A 1XNQK 2HFVA 2QB0A 3CCES 3RMDA 1Q78A 2BPGA 3SUOA 3L3CA 3C2MA 3O1LA 4FJNA 4RW8B 3SBGA 7ICMA 5JMNA 4XRHA 5FD1A 4O3MA 3L2RA 1WKLA 1REVA 4I2FA 4K4GA 4ECSA 2J9DA 1T6CA 3RR8A 3QT5A 3AVHA 1B0VA 3DRSB 4IQWA 2LU2A 3UMCA 4ZP6A 2HNYB 3VEYA 2ATLA 3R97A 1LAVA 3MGHA 3ETOA 4E1JA 4FVMA 4YOTA 2HOIA 1ZBIA 5J2QB 5HVGA 2Y9UA 8ICOA 2L3MA 1S5LU 2M88A 4USUA 1MQ3A 1N33F 3MN5A 1S5ZA