2HHQA

O6-methyl-guanine:t pair in the polymerase-10 basepair position
Total Genus 217
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
217
sequence length
580
structure length
580
Chain Sequence
KKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords 5'-D(*CP*AP*TP*(6OG)P*CP*GP*AP*GP*TP*CP*AP*GP*G)-3'
publication title The structural basis for the mutagenicity of O6-methyl-guanine lesions.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
total genus 217
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2006-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2hhqA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 2hhqA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hhqA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2hhqA01
4IG0A 5KFSA 3ZSXA 1IM4A 4AHUA 4K4GA 4FLXA 3I0RA 4QZ9A 4ZH4A 2R8KA 1WN7A 3QE9Y 4FLWA 1D9DA 2JEIA 2D0BA 4RNMA 1RT3A 3T5KA 9ICLA 4I2PA 1JMSA 1NK5A 8ICBA 3NAEA 3VA3A 4M6WB 4QZGA 3RAXA 1RYRA 3AO5A 4RQ3A 3OJUA 3LWLA 4MFAA 2FPKA 3C2KA 2IHNA 8ICEA 4I9QA 4GXJA 4CFDA 1ZQAA 4F5NA 5HBMA 4YVZA 2G8UA 5J2MA 2F8SA 1KFDA 2I5JA 2RDIA 4ECVA 3SCXA 4Q44A 2Y1IA 3RRHA 1N5YA 4CJRA 5D3GA 2HHXA 3OYKA 3K5OA 3RMAA 2YNIA 4DQPA 3QNNA 4H4MA 3ISBA 5J2JA 2IGIA 1B9FA 5KFEA 4TURA 3B6OA 3VQBA 3QERA 3QETA 4RNOA 4OLBA 2FMPA 1RTIA 3LP0A 4CEAA 7ICQA 3ZSOA 1JXLA 1RCHA 1RBTA 4Q43A 2JGUA 3RMBA 7ICPA 4BDPA 4I2FA 2YNFA 4RQ0A 3IS9A 2HHWA 3SV4A 2G8HA 2F1HA 2KTQA 2HHQA 4HUFA 3WNGA 1BHLA 5HHIA 5DMRA 5CP2A 3TR8A 4RUCA 2LYHA 3MBYA 4FZYA 2FC0A 5IIOA 4BACA 1IKVA 3NBPA 7ICVA 5IIKA 3AV9A 2RN2A 2ZJAA 2HHUA 2A1SA 3MXJA 1FKPA 7ICTA 1RT7A 4G1QA 5J2GA 1NJZA 2B4JA 4DSLA 3CM6A 4CECA 3OYNA 1C1AA 3BQ2A 3AO4A 2KZ3A 3OJSA 4O4GA 2OA8A 3KJVA 4J9LA 1BI4A 2ZUCA 1SL2A 1X9MA 1RDCA 9ICNA 1COOA 3ZSQA 4FJLA 3ZT0A 4RU9A 8ICSA 3BDPA 1TAUA 4CJ4A 4PH5A 1FKOA 3MEDA 1BVSA 2WONA 2I1QA 3MR5A 2FBTA 2ZUBA 4I2GA 1BPDA 1BISA 1HMVA 3TI0A 3OYJA 4FJGA 4KLOA 2OWOA 5DQIA 3KHHA 3GV7B 5IIMA 4BE0A 3H8JA 4H8KA 4RQ2A 4HVJA 5KFXA 8ICOA 3NDKA 4CGFA 5DKWA 5J2FA 3M8QA 2RDJA 4CCHA 5KFBA 4DTMA 4XUSA 3QEPA 4CJTA 4DQIA 4M41A 4R8UA 4YCXA 1TK8A 4UQGA 1HYZA 4FLZA 4RQ8A 2V4QA 3I0SA 4E89A 4X5VA 3B0YA 1SL0A 2J6SA 3DOLA 4CJSA 4I2BA 4OLAA 2HVIA 2GV9A 1CXQA 3Q8PB 2XY7A 2A1RA 3T5JA 5J0YA 3N97B 3UQ0A 3AA4A 4O3SA 3LPTA 4QZFA 3DM2A 4Z6DA 4R65A 3V1QA 2X6SA 4DSKA 3QLHA 1JLCA 2W9CA 4FZXC 3OS1A 3UIQA 4GVMA 3RB4A 3EPGA 3PNCA 2W42A 3HO1A 3G10A 3QEAZ 2C2EA 4DL3A 4KB1A 1XSNA 1QSLA 4YMNA 1CXUA 4M3WA 1RT2A 4EBDA 3KD1E 4M9JA 1ZYQA 4BE2A 1U4BA 4DMNA 4CEBA 1KVAA 1TAQA 3QINA 4ECUA 4DL4A 1SV5A 1KFTA 1Z00B 4O3OA 4ECQA 2XCPA 4F5RA 4BXOA 3PX6A 3AVJA 4E7KA 1XC9A 4OKEA 4HYKA 1QQCA 4J9RA 1L3UA 5DB7A 3AVFA 1A77A 4CJFA 3SI8A 4DSEA 1BPZA 3KTQA 3KK3A 4F4KA 4CIFA 4BDYA 1VRTA 4FYDA 1L3TA 5D49A 2DFHA 1VSFA 1ZBLA 2A1JB 2KFZA 3OGUA 1ZQPA 3ALYA 4CJUA 1SL1A 7ICKA 4FLUA 3C1YA 3PW0A 3TAGA 1KCFA 5HMLA 4NYNA 4IQUA 4GC7A 4M9NA 4B8AB 4FJKA 2AQ0A 3T3FA 4O9MA 5J0UA 1ASWA 3TAMA 4FXDA 3OYFA 4J2EA 4DS5A 4CIGA 1QLNA 3NGDA 5L9XA 1ITGA 1J9AA 3TFSA 4PQUA 2J6UA 4C8MA 1ZQOA 4LD0A 4MFFA 5JS1A 3T19A 4UBCA 3ZT4A 5KFUA 5KFHA 3U6FA 3LP1A 4CK3A 3NGIA 3Q8QB 4DOBA 2XHBA 4CIEA 4GXIA 5DBBA 3QEVA 1S1WA 4PGQA 3OYGA 3B0XA 3VQ6A 4KLTA 9ICHA 1RT6A 3DLRA 1S0MA 1D8YA 1C0MA 1TKXA 4YD2A 4LZDA 1A5WA 1VSEA 4ED1A 4FVMA 3ZT1A 5DG9A 1IG9A 8ICRA 4K8ZA 4DQQA 3H7IA 3PMNA 3JPSA 3OS0A 4B9TA 4DU4A 7ICFA 4R66A 7ICJA 2DPIA 3KK1A 4KB0A 4CESA 3ISCA 3AU6A 2XY8A 3QEIA 1DLOA 9ICTA 1UA1A 5C24A 1U45A 3KLIA 4KMUA 1RZTA 4CJ3A 1ZQLA 2RF2A 1ZQKA 3SQ4A 3NH1A 1WLJA 4AHTA 1LAWA 3NHGA 4AHRA 8ICLA 3C5GA 4NLKA 3GDXA 3K5LA 3E2EA 1EXQA 8ICFA 2KQ2A 4P4MA 3GIIA 1HPZA 1QS4A 1TL3A 4RW6A 1IKYA 4DFJA 5CY4A 2YNHA 3V6HA 4CHNA 2NRZA 1TL1A 3C94A 1X2IA 3ZDAA 5KT7A 2Z1IA 5I3UA 8ICZA 2O4GA 4F3TA 1NJYA 4QZCA 4F2SA 7ICMA 4M3YA 2P66A 3PW5A 3TFRA 4QAGA 3ZD9A 4QWAA 8ICNA 3UXOA 4QZHA 4ECRA 4NYFA 2IHMA 4P4OA 4DFPA 3K58A 3H08A 4CJKA 3DRSA 3OYDA 4EZ6A 7ICNA 3TAFA 2DPJA 2ASDA 2VG7A 3L2RA 2W8KA 1RT4A 2LSNA 4JUZA 5KG6A 2G8VA 4O5CA 3AVBA 1GOCA 3G6YA 3KLGA 2IBKA 3V81A 2YKNA 4KV8A 1RXWA 2ZTCA 3TARA 4P2HA 5J0PA 2R8IA 4J9SA 3AU2A 5CHGA 3MFHA 4IKFA 4YN4A 3UQ2A 4UB4A 1MSWD 8ICXA 2ISPA 4KFBA 3ZD8A 2E6LA 4M3TA 4DWIA 4M6WA 4PY5A 1R0AA 3SUQA 7ICOA 4J9QA 4CEOA 1S1VA 4Z6EA 2UVVA 4JK1A 4AHCA 4ED7A 4B3OA 3VN5A 2F8TA 4CF1A 1Z26A 1Y88A 1JLAA 5KFZA 1L3SA 1N56A 1WSGA 5KFDA 5EWGA 1Q8IA 4CK1A 1NJXA 3HT3A 1A5XA 5CJ7A 4EYIB 3PO4A 2IS3A 4DLEA 4J2DA 5CA7A 5J0RA 3ZSZA 4EYHB 4JWMA 3SI6A 3MXIA 1VK0A 1IKXA 2ITGA 4J2AA 5I42A 1TV6A 2YHBA 2ZTEA 4DO9A 5IIJA 4YR2A 4PGYA 3OYEA 2W9MA 5IINA 3GQCA 2YNGA 1ASUA 1WCNA 3HVTA 4FK2A 3RRGA 5J2BA 4DQRA 1U04A 3UXPA 4OPJA 2Z1GA 5FRMA 3QESA 1U47A 4GLXA 1RBSA 3VQ9A 1W0HA 5KFIA 2QXFA 5L1LA 3H8SA 3K4GA 3M9MB 2P6RA 7ICRA 3EPIA 1HRHA 4IQTA 2BPGA 2B5JA 1PZNA 5J0XA 1S1UA 2BQRA 1FXXA 4RZRA 2VWJA 3MR2A 3AA3A 5HHHA 2DTUA 4KHUA 9ICEA 5J2NA 3P1GA 4BDZA 4RQ7A 3KKSA 1WAFA 3KHRA 1I3AA 3TANA 4FS2A 3VQAA 4CEZA 4RPYA 4Q0BA 3DMJA 4DG1A 1T4GA 5CZ2A 3AO1A 1TKZA 4FM1A 1ZQSA 5KFGA 3LP3A 5KFRA 2D5RA 4HCBA 1KEJA 2IOCA 1S6PA 4M9HA 2PY5A 3PO5A 4DSFA 1VSKA 8ICWA 3NFAA 1JL1A 1ZBFA 2WTFA 3HW8A 4KTWA 3CFRA 5C42A 1JXEA 1TK5A 1RBRA 2NRVA 3ZSYA 9ICVA 3RMDA 4NCGA 1HJRA 2BGWA 3KKRA 4I2AA 3SPZA 3E01A 3RB6A 4FO6A 1S1TA 2ZJ8A 4NCBA 5HMMA 2OPPA 3DYAA 4ECSA 3OVNA 9ICOA 4PHPA 4UAYA 1QE1A 3SYZA 1XSLA 3TQ1A 3GV8B 4OGEA 2KZZA 4YXMA 4DS4A 3C2LA 3RMCA 2Q3SA 4ECWA 3SUPA 4E1MA 2BCSA 5DDMA 3PR4A 5CZ1A 4YNQA 2C2DA 3AA2A 4C8NA 1B9DA 4FW2A 4O5EA 1JLGA 4TQRA 3VQEA 4PHEA 4E7JA 2PI5A 9ICFA 1NOYA 4M9LA 4KLDA 4KKOA 2FBXA 4ECZA 2OZMA 4KTZA 4RPXA 3V6KA 1K1QA 3JPRA 4IQVA 4Q45A 5DBAA 3PW4A 3BQ0A 2BHNA 3LDAA 1BL3A 4KPYA 2QK9A 5HRSA 1X9SA 2Y1JA 4XA5A 1S9GA 9ICGA 1ZQGA 4JWNA 4RUAA 1XSPA 3AVCA 1MQ3A 4CHZA 1VSLA 5EWEA 4KO0A 3EW9A 4CJPA 1ZQFA 3HP9A 4ECYA 3PVXA 3OSNA 1CEZA 3SV3A 4EBEA 4RPZA 3VQCA 5TZVA 5DG8A 1DTTA 4PUOA 4Z0UA 4KN7A 4IR1A 4KLEA 1VRUA 1LB2B 1L3VA 2VA3A 4O3PA 3JYTA 4F4YA 1Z00A 3C6UA 1ZQUA 3WNEA 3AVNA 1NOZA 1ZJNA 4CHOA 1ASVA 3LWMA 4CF0A 2IMWP 4G3IA 1S0VA 4FCYA 5DGBA 4CEDA 5E41A 4DTUA 5HRPA 3Q8SB 3T5LA 1REVA 4GXKA 4CGHA 4B9UA 2AU0A 9ICSA 3ISDA 2OZSA 3JPNA 5KT4A 5IILA 1ZQBA 4BWMA 4C8LA 4QW8A 4F5OA 3ZCMA 3ZDDA 1B43A 1KRPA 3OYIA 3EYZA 3CM5A 4KRFA 8ICVA 2VG5A 4W5OA 2VA2A 3F73A 3PR5B 4DFKA 3MDAA 1C0UA 5F9NA 1WSHA 4YR3A 4ED3A 3BGRA 4ELUA 3M8PA 9ICKA 4Q8FA 1EKEA 1XI1A 1CZ9A 5KFJA 1XS9D 1IO2A 1JL2A 3O4QA 3RH5A 4DF8A 4CJEA 1JLEA 1X1PA 1XWLA 2V4RA 4DU1A 4CF9A 5KG7A 8ICIA 3EZ5A 4O3QA 2RPIA 4NLZA 3EY1A 3OYHA 4QWBA 1K6YA 4IFVA 5DB9A 2JEFA 5KT2A 3JPOA 3OS2A 4FZZA 2Z1JA 4EEYA 2M9NA 5SZTA 1NOMA 5DB8A 1KLMA 4QCLA 4RT2A 4IRCA 9ICBA 2P1JA 4HCCA 1VSDA 3ZDEA 4ED0A 2ZD1A 3V9ZA 1QSYA 4IRDA 3PV8A 2ASLA 1T05A 1ZQHA 2AGQA 3O3HA 2F96A 4ELTA 5KFYA 4PPXA 4J9KA 4RQ1A 5DQGA 4CE9A 3PY8A 4DL7A 4RW7A 3GILA 3VQQA 4I2QA 1DOQA 4DTJA 3AVGA 1ZQDA 3SQ1A 1TVAA 1RXVA 4DOCA 4CK2A 3P83D 4O5KA 4B9VA 3V9WA 2PFNA 1TFRA 4KLIA 3Q8LA 1HNVA 1NKCA 3JPPA 5KFOA 2ZJ5A 2ZE2A 3FFIA 4M45A 3HX0A 2HHVA 3AVHA 4BE1A 1JIHA 4KLJA 4E7IA 4CJ5A 3TWHA 2ZUDA 5BOLA 4XRHA 3DRRA 2NRTA 3CFOA 5KT3A 2NRWA 4RQ5A 3PW2A 4Z4IA 4IQWA 4I27A 4J9OA 1NK7A 4MF8A 2RKIA 1KTQA 1T3NA 2W9CB 5KFWA 9ICIA 4DF4A 3NGZA 2FLPA 3NF8A 4ECTA 1JX4A 4RT3A 4CEFA 4W5TA 4TUQA 4I2CA 1KSPA 1KFSA 1BCMA 3QEXA 4KHSA 5D46A 1NK9A 3V1RA 9ICUA 4PA1A 4O0IA 2J6TA 4FJMA 2ISOA 3C95A 3RR7A 1UOCA 4AHSA 4CJQA 4CF8A 4N5SA 1ZQNA 4E7HA 1JXBA 4ZTFA 4UB2A 2JLEA 1EP4A 5J0QA 2MAXA 1AROP 5KG1A 4RNNA 2R8HA 3V9SA 4AILC 5L1JA 4DL6A 2BQUA 1RNHA 4B08A 1FK9A 2JZBB 4F93B 5J0TA 4IRKA 5CR0A 2WOMA 3KLFA 4JS4A 4KHQA 4Z4GA 3KLHA 4KLSA 4Z4HA 1W9HA 4QWCA 3FDSA 4CHYA 1MC8A 2KN7A 9ICQA 3B6PA 4DLGA 1H38A 1RBUA 1BIZA 5F9LA 4CERA 1D5AA 4B9SA 3IHQB 2GBZA 5KG5A 2IA6A 5K14A 3WNHA 1V9PA 1LW2A 3VQ7A 4M3RA 4CFCA 5J2KA 2PFPA 4DOAA 5L1KA 3GIJA 4LH5A 2UVWA 4AH9A 5FRNA 4E19A 4F4ZA 1WAJA 4MEYA 2BCUA 3JSMA 1BQMA 4KLMA 2FBYA 4QZBA 1X9WA 5IIIA 4KLQA 1Q9XA 4KI4A 2ZTDA 1F21A 1BPEA 1K1SA 4H4OA 4FJJA 4OGCA 1RBVA 1BQNA 2OPRA 7ICSA 2X78A 3V6DA 2YKMA 4OJRA 3ISNC 2NRXA 5FROA 8ICTA 2MUTA 1ZQIA 1TK0A 3CG7A 5KI6A 3SQ0A 3LPUA 1NK8A 3OYAA 4KN4A 4FW1A 3V72A 2XCAA 1SKSA 2AGOA 3V6JA 4DSIA 3Q8RB 3C2MA 2G8WA 3M8SA 4M3XA 4QWEA 4J2BA 2AJQA 1ZQXA 3NF6A 4R5PA 4NXZA 4LZGA 4KLFA 3DLHA 4DQSA 3NTUA 1J54A 4LVSA 2BPFA 4CGJA 5J29A 4IBNA 3LP2A 3RJGA 2FLNA 1UA0A 5DDYA 3RBEA 3HWTA 1GOBA 2B6AA 1JLFA 1A5VA 1YT3A 4RW4A 4F5PA 4JLHA 3AVIA 5J1EA 1ZQTA 1CUKA 3HSTB 4ID5A 5J0SA 1NJWA 1IXRA 4N47A 1GOAA 4RG8A 2HHSA 1KVCA 2D0AA 2P5OA 1T03A 2PFQA 4W5QA 5J2AA 1UAXA 4JV1A 1U48A 4ICLA 3OYCA 3HP6A 1EXNA 3ZT3A 3BJYA 4RQ6A 2F1IA 4K4IA 3MEGA 1KLNA 4CFBA 3NE6A 4JRPA 2BPCA 1SKWA 5EU7A 2R8JA 1IKWA 1C1CA 4UBBA 4I2EA 3RTVA 1HYSA 3RAQA 5JUMA 5KFPA 4CF2A 3SZ2A 1RDAA 4I7FA 3RJHA 4WE1A 5DLGA 3DI6A 3PX0A 4QW9A 4KTQA 5KT6A 1RTJA 4YG2A 1ZBUA 3DLKA 2HNYA 5DLFA 3AO2A 4CGGA 1ZBIA 1ZQJA 1HUOA 3K2PA 4FK4A 3Q8MA 4HHTA 3U3YA 4KLUA 3ZDCA 1I39A 1TGOA 3LDSA 1HNIA 8ICJA 3JPQA 3D45A 4B9LA 3HPGA 3SNNA 4BWJA 4TUSA 1SKRA 4C8KA 1ZQZA 1U49A 1C6VA 9ICWA 1LWCA 2HNDA 3IRXA 1LW0A 1G15A 4KHNA 4J9MA 1B92A 3SPYA 1A76A 5KG4A 3NGYA 5HP1A 2DFFA 1RYSA 3DLBA 3RJFA 3LAKA 3HPOA 4CEQA 3O3GA 1D9FA 2HMIA 3HPHA 4F8RA 3UXNA 3HK2A 3SQ2A 3I8DA 3V1OA 3VQ4A 1BPBA 3V7JA 4O55A 5EOZA 4N76A 4YP3A 2W9AA 3G6VA 1D8LA 2G8KA 2R7YA 5J2IA 1ZETA 3H8WA 4E7LA 2W8LA 2P6UA 4C8OA 3MGHA 5CYQA 5C5JA 4UAZA 7ICHA 4OVLA 2B21A 3GFKB 4CHPA 3TAQA 3S9HA 4DTRA 1S0OA 8ICYA 4DEZA 3OHBA 4LSLA 3OYMA 2AGPA 1RT1A 5KFQA 5J2CA 1XO1A 4QZIA 1YVUA 2YHAA 4FBTA 3PMLA 3OYBA 4I2DA 3TABA 1S76D 4FM2A 3V9XA 5SWMA 2FLLA 3KIOA 3BQTA 3VA0A 4FJ7A 3MR6A 2W9BB 2F1JA 3AVAA 4CJLA 3NCIA 4DU3A 3MECA 4QOZB 3MFIA 5HRNA 4B8CA 4RQ4A 4B9MA 4NY8A 2V9WA 3OHAA 4MFCA 1UT8A 2G8FA 3O3FA 1RT5A 4I28A 3WNFA 4UB1A 1MU2A 8ICUA 4I2HA 3HL8A 1O1WA 4MF2A 4DTOA 1T8EA 5C25A 4I9LA 1S0NA 2ZQBA 1ZQRA 5KFAA 3O4NA 1C7YA 3M9OB 5KFVA 3EWAA 1ZQMA 1BPYA 3H4DA 4KITB 3H4BA 4M0AA 5CB1A 7ICIA 2XY5A 4MQ3A 4ED2A 5J2DA 4TSXA 4FLVA 4NLNA 4W5RA 2HVHA 4FJXA 1HJPA 2HB5A 3KD5E 3GIKA 4JV0A 2R8GA 3NH2A 2ETJA 1S97A 3QEBZ 4R63A 3M9NB 3QZ8A 2QKKA 2HW3A 1QHTA 4M9GA 3ETLA 3HYFA 4QWDA 1RPLA 3MXMA 4M42A 3S3MA 4DTNA 1ZJMA 8ICPA 4YQWA 5HP4A 2BDPA 1ZQEA 5KTQA 3VQ5A 3AVLA 4I2JA 5CYMA 3BQ1A 4Z6CA 1ZQCA 5KFFA 1DTQA 3PW7A 3S3NA 3ASMA 4F50A 3RR8A 3LZIA 4CGDA 4Y1DA 2QKBA 4E3SA 1XHXA 3QIPA 9ICRA 1J53A 1WCLA 5EWFA 2UVRA 4ELVA 1HQEA 4MEXA 4LY7A 4IR9A 3ORYA 1Z25A 1HUZA 4M3ZA 4PHAA 4EBCA 1XU4A 4CGIA 3NH0A 2O4IA 1BPXA 4M2YA 3ZSVA 2XRIA 5T7BA 3K59A 4KLGA 3RH4A 1RILA 3H40A 2A1JA 4O3NA 5DQHA 3L2VA 2HHTA 2IC3A 5J2HA 4ZTJA 3QNOA 2BCQA 4K8XA 4YFUA 4DFMA 2X74A 1ZQVA 3LANA 3L3VA 2NUBA 4EZ9A 4F4XA 3S3OA 4ZHRA 4FLYA 3RH6A 1WSEA 2ATLA 1NK6A 8ICQA 5BPCA 3MGIA 3RB0A 8ICCA 4EP5A 3G6XA 4XIUA 4RW9A 2GWSA 4ECXA 4R64A 4QZAA 3QIOA 5D4BA 2D0CA 4O44A 4UB3A 1JLQA 3D0PA 4YFKA 1N6QA 3C23A 4Y1CA 1QTMA 1YTUA 5BOMA 3DRPA 4DTPA 2OYQA 9ICJA 7ICUA 1B22A 2PZSA 1BI4B 2JEJA 2OPQA 3OY9A 4CEEA 3QEWA 4KLHA 3RBDA 2XGQA 3OSPA 1TKTA 3PUFA 3RJKA 8ICHA 4DL2A 5DG7A 3DLEA 3GIMA 4OKKA 1BCOA 3VQ8A 3V9UA 4FJ5A 4KHYA 2BE2A 1HYVA 2KZMA 3DLGA 5HROA 4DTXA 3LAMA 4Z4FA 3HM9A 1LV5A 2BCVA 5DK5A 4NM1A 2HNZA 4O3RA 2C22A 4W5NA 4K4HA 2X6NA 3MR3A 1RTHA 4EP4A 3V7LA 5KFKA 3T5HA 4NLGA 3AVKA 1S9EA 5KFTA 2XC9A 5KG3A 2JZBA 2VWKA 1BIUA 4R8UB 1NKBA 2Q0ZX 2P51A 2BQ3A 4FJIA 4QZEA 4NM2A 1MQ2A 4FS1A 4PGXA 2PYLA 4DL5A 1IH7A 2JEGA 5KG2A 1NKEA 3ZDBA 2E6MA 3MEEA 4TUPA 5CWRA 3THVA 2VANA 3V7KA 4Q5VA 1S1XA 3CQ8A 4FJNA 4F92B 3C6TA 4M3UA 3ITHA 3ZSWA 2DY4A 5HLFA 4LH4A 4JV2A 1L5UA 2KFNA 3NF7A 7ICLA 1ZQYA 4JS5A 4N41A 1ZQQA 3C1ZA 1S10A 1N48A 4J9PA 2YV0X 3NF9A 3RJJA 4F91B 3UPQA 2P5GA 4YXJA 4DTSA 4QZ8A 3OYLA 4IDKA 4LSNA 3T1AA 5J2QA 3RB3A 2DFLA 5KGXA 1RTDA 1Y97A 2G8IA 5DBCA 5KFCA 3VQDA 3ULDA 3C21A 4RW8A 1C0TA 3KHLA 9ICMA 5DGAA 3G0ZA 4FM0A 4GMJB 2BCRA 2PFOA 1WNSA 5J0WA 3Q8KA 1VSIA 1QSSA 4BXOB 4E1NA 1C1BA 4F2RA 3AUOA 2DFEA 2GUIA 1JLBA 1EETA 2Z1HA 5JS2A 7ICEA 3LK9A 5KFNA 4ID1A 4F5QA 3TAPA 4E0DA 8ICGA 1WSIA 4FLTA 1J5OA 1EX4A 1UT5A 2IAJA 1HQUA 1LWFA 4IG3A 1NK4A 2KW4A 4UB5A 1WSJA 4F4WA 4F3OA 1RDDA 3CFPA 4Q8EA 4HTUA 3IAYA 4KI6A 4FJ8A 2H5XA 4J9NA 4KAZA 4CJVA 4L8RB 3L2WA 3QZ7A 1JKHA 1S5JA 1ZBHA 1CZBA 1TVRA 3K5NA 4MFBA 4B9NA 3SUNA 1Z3EB 4BGDA 3K5MA 2FPLA 2OPSA 2PXIA 3SUOA 4HUGA 1KVBA 1S6QA 3C5FA 4P4PA 5HNKA 4CJWA 3L3UA 4QZDA 5J2EA 4N56A 1VSJA 2E4LA 3V4IA 2BKEA 4YMOA 2FMQA 5KGWA 1SZPA 4TQSA 3KHGA 4JRQA 4FK0A 4M47A 4AHVA 2FMSA 4FJHA 1VSMA 2PI4A 3DOKA 1BGXT 2BR0A 4GW6A 5L1IA 3MABA 4ED6A 1NK0A 1LWEA 1U9LA 4OPKA 4YR0A 4OKJA 4Z6FA 2EX3A 3RJEA 4KREA 3L2UA 3PX4A 1WSFA 4HUEA 4CHQA 4YD1A 5KRSA 3RWUA 2PYJA 4M04A 5J0OA 4DSJA 1KDHA 2BANA 3N4MB 1S9FA 1TKDA 8ICAA 4PWDA 1CLQA 3JPTA 4YMMA 4KLLA 9ICAA 5KRTA 3A2FA 4XQ8A 3IM1A 3HXMA 3K75D 5KFMA 2XO7A 2I9GA 4I29A 3GV5B 1S77D 2IDOA 3AVMA 4O5BA 7ICGA 3KLEA 3CYMA 4FBUA 4Z4EA 5KT5A 4PHDA 5HRRA 4NCAA 4KHWA 3HJFA 3QO9A 1XHZA 2UVUA 3LZJA 2FBVA 2C28A 2ALZA 2XGPA 4I2IA 1JN3A 1LAVA 2W9BA 4FJ9A 3P5JA 4GC6A 3MDCA 2ATQA 1Q9YA 4CFAA 2BGGA 3KK2A 2ASJA 4IFYA 3FYHA 9ICCA 1UWBA 9ICXA 3U3GA 1T7PA 5KG0A 1DGSA 5DB6A 5J2PA 8ICKA 1TV9A 3ZSRA 3IG1A 5FDLA 3MAQA 2EHGA 3AO3A 1YTAA 2C2RA 3LALA 3RJIA 4UAWA 3M8RA 8ICMA 1RDBA 2MUTB 4O0JA 9ICPA 3VQPA 2FPMA 5KFLA 2AQ4A 4Z4CA 3L8BA 3F9KA 2VG6A 3TAEA 4ED8A 3K57A 1ZQWA 3L2QA 3SJJA 1SUQA 2VA8A 1VSHA 3HVRA 3ZT2A 2XY6A 3AA5X
chains in the Genus database with same CATH superfamily
3PEJA 1NH7A 4IG0A 2ZH9A 3ZSXA 4AHUA 4K4GA 1U1QA 2CPIA 4M5IA 4DHVA 4FLWA 1URNA 4PZOA 1RFQA 4I2PA 1JMSA 8ICBA 4BC9A 3VA3A 4CO2A 2CJBA 3LWLA 3BSAA 8ICEA 2KEYA 4I9QA 4CFDA 3T79A 2YHWA 1ZQAA 3WUHA 3JQMA 5HBMA 5LOQA 5J2MA 3R6MA 2F8SA 3FSIA 1ZM4A 1NGJA 2RDIA 2IJNA 4ZITA 1G7CB 4CNQA 3IV6A 4Q44A 1Q8BA 1X60A 5K8OA 2DR8A 1PK1B 4NL9C 4CLWA 2EI5A 1DQ9A 2HHXA 3N7SC 2MRLA 3A5MC 1TV6B 4WFXA 2LM4A 3R6GB 2HHPA 2M0NA 4DQPA 4LRBA 4GKJK 1VC0A 3ISBA 3NEKA 1RDWX 4UAUA 2FGOA 2IGIA 4Y2MA 3B6OA 5DM6Q 3QERA 4OLBA 4WYBA 2XWXA 3F0NA 3DI6B 1RTIA 3LP0A 4LUBA 2HNYB 2I8EA 5ALPA 1RBTA 2ES6A 3SDEB 1NPRA 5IT9O 1FO4A 4BDPA 4I2FA 2GVDA 3IS9A 1RB0A 4NLOA 1QUVA 1U1KA 1VBKA 4FF4A 5THWA 3R1HA 2BEFA 5CP2A 4FZYA 3MBYA 2FC0A 3WXMB 3J7Z5 5IIOA 4C3KA 2VC0A 1Q53A 5BYQA 2W4CA 3IRXB 3SLCA 4HH0A 3ENAA 3VTHA 2MSTA 2A1SA 4TNOA 5K20B 1FKPA 2N82B 4Q0BB 1RT7A 2Q1NA 5J2GA 3HZ6A 1NJZA 3F9MA 1LXNA 4DSLA 3CM6A 4BR5A 2FHKA 2R7UA 3OXFA 2EXUA 1N61A 3AO4A 2F7TA 3MN6A 3W9HA 2ZUCA 3VAMA 1X9MA 4A5AA 2F5GA 2FJ6A 5AM3A 3UNGC 2K7KA 5GIOA 2KHOA 2IHR1 1A0OB 1TAUA 3MEDA 4GRSA 2I5HA 2QFIA 2WONA 3MR5A 4IYQA 1GLCG 2FBTA 1BISA 3E9OA 4LSLB 2ZM6F 2KV2A 3E01B 2OWOA 3KHHA 4P2XA 3GV7B 3W5YA 1O0PA 1Y11A 1L7OA 4H8KA 4BG8A 1PUZA 3C6HA 4YY3F 3FRYA 2RDJA 1FRKA 2K7JA 4DTMA 2ASMA 4USTA 1ZM9A 1VQOS 4DQIA 3NL0A 4R8UA 2IM2A 1FNMA 3NVKA 4P2FA 2ITMA 3S6JA 3JTOA 4V19X 4H54A 2XVTA 3B0YA 4CTAA 5HSPA 3ADAC 4CJSA 3UKUB 4JI1J 5GADU 1NU0A 4Y2IA 4GKJF 1TR0A 3AJ1A 1BOTO 1PK3A 4Y00A 3SCLE 2XY7A 3T5JA 3J7ZO 3GDQA 4KC5A 4LF5J 4DFDA 3UQ0A 3CDWA 2G0AA 2PO4A 4QZFA 1T9XA 3WIUA 3B54A 1C2PA 3ZEUB 1TL7B 2X6SA 3QLHA 2H65B 1JLCA 4IXCA 2A18A 5CRXA 1NMDA 3OS1A 3UIQA 4X4NA 5B0GA 4DPOA 3RB4A 1I3OB 3HO1A 3KOOA 4C8ZA 3SJHA 4KQZA 4FZNA 4DL3A 2V94A 2ZUGA 1N2XA 4W92B 2P9UB 4M3WA 1RT2A 1RZMA 3KD1E 1RCXB 1VQ7S 2QRRA 4KGMA 4WQ5A 3U4LA 1SWWA 4DV2F 5GMDA 3QINA 1RCOB 4DL4A 4JI3J 1KL9A 2AYMA 4JKFA 1F5AA 1Z00B 3CCMN 2VL1A 4X66F 4K4WA 2DIVA 1WUAA 3CJ4A 2FGCA 3SSSA 3CD6S 3SI8A 2BKPA 4DSEA 4F4KA 3EGVA 2WCXA 1VRTA 4KGVB 3OLAA 2EDUA 5D49A 1V3RA 4CO5A 1VSFA 3OGUA 1ZQPA 3IG8A 1AUDA 7ICKA 3QUCA 3UPFA 3TAGA 3W63A 1J2NA 3P5BP 2AP1A 4B8AB 4JKGA 4O9MA 2PFFB 1N34J 1ASWA 4FXDA 4CH0S 1ZD4A 3OYFA 4DS5A 4RUHA 2VG5B 3LTOA 2J0WA 2DRAA 1ZQOA 5JS1A 1OPZA 2AX0A 1C0UB 4B3RK 2EBEA 3T19A 3MPDA 1Y9OA 3A5NC 3LDOA 1Q81T 4OX7A 1YHQN 4A8SA 2MSNA 4DOBA 4PXBA 4PABA 5A8WA 4GXIA 4PGQA 4ZLLA 3OYGA 3C8YA 4Y3CA 1SWVA 3VQ6A 4KLTA 9ICHA 1SQKA 4Y2XA 1UPPA 3D0GE 5AHXA 2IVNA 3VEVA 2M52A 1TKXA 3EXCX 4FVMA 4H0VB 4A8WA 8ICRA 3M8WA 2E5LJ 4OO1J 1VISA 1F60B 4L3NA 2QE5A 4C1NK 1CJKA 3L4IA 4FPRA 1YJ9S 2K4EA 1Z4OA 3OS0A 4B9TA 4R66A 4RJVA 2ZD1B 2V69A 2DR5A 4NXNJ 3I32A 2HIYA 1CJTA 1B7YB 3PJ9A 4B3SF 3VEWA 2PA8D 2YY3A 9ICTA 1RZTA 4BRLA 4FSVA 1ZQLA 3VZHA 1M5PC 1R43A 1IV8A 2A6OA 8ICLA 5D0HA 2G2ZA 4C4TA 3GDXA 3M2VA 4BRHA 3ZZUA 5L46A 4JD2B 2KQ2A 1T11A 2XO6A 4JI5J 1VDVA 1KONA 3GR0A 4AYBC 2F44A 1B7FA 1NDCA 5AKEA 1SKUB 3EGWB 4ZVGA 1XO0A 2ASYA 3JQJA 1VQ5N 1VQKS 2YB4A 3FBBA 2OTJS 2ZE2B 2NRZA 4HH1A 2KT2A 1SC1B 2YQEA 2DGQA 3FFIB 5AK5A 3K2YA 3WKEA 3OFGA 4WBFA 3R9PA 5KT7A 5HVHA 1F0MA 4TY8A 4O0NA 1TYQB 4DUZK 2YWKA 1IJEB 3MM5B 1UVNA 3PW5A 4DN9A 1Y0HA 4BC5A 1ZBTA 3SMZA 3ZD9A 5DETA 2DITA 4BRDA 4HTIA 5IFMA 3DRSA 1UZHA 7ICNA 3QUTA 4TU8A 2H3IA 2CRXA 2VG7A 3L2RA 3VCBA 2XLKA 4CLTA 4O5CA 3FSYA 3G4SN 5GAGI 5TKWA 1K9MO 1GOCA 1WYGA 1L7MA 3G6YA 2IVMA 3GSIA 1RBLA 1SPBP 3V81A 4JV5F 2YKNA 1RXWA 5F0UA 1HPMA 3TARA 5A0YA 3ZNJ1 2VJVA 4P2HA 2D7SA 3EVMA 1EP4B 3AU2A 2YWWA 5CHGA 2C1EB 3W62A 4ZCIA 3O9SA 4IKFA 2I7NA 3KKFA 3EKSA 4CZFA 2VV5A 2KG0A 2VDIA 1FK9B 1NMEB 5IXUA 2RRAA 1DAXA 4EUVA 3KLFB 3ZD8A 4ZN1A 3EMTA 1Q5YA 2KSOB 2J7KA 2KHDA 4CQ1A 4DV7F 3SUQA 4ITSA 3D68A 4AHCA 1OUQA 5KAFU 4P6QA 4X4OA 3F44A 2VBYA 5KFDA 4CK1A 2F8KA 5ALKA 3L4QA 4MO4A 3CMQA 1K8KB 1PK1A 3CCWA 1RGIA 2D41A 3ZZZA 1TV6A 4DO9A 1BQMB 5IIJA 3OBIA 4PGYA 3AD8C 2JZ5A 4ILHA 1SC4B 1HBUB 3IKMA 4FK2A 2QC3A 1TP7A 4H4OB 1U04A 2FC8A 5AXMA 3JSRA 3IWLA 2EWSA 1BNOA 2HWTA 2CJAA 2NCKL 3H8SA 5J1PA 3K4GA 4EO6A 7ICRA 2GMJA 2HI0A 3H90A 4PQAA 3EPIA 3SDEA 2BPGA 3CJ8A 1PZNA 4EX7A 2BQRA 4ILGB 3CCUS 5H2FU 2VWJA 3MR2A 1PC5A 3AA3A 3E51A 2VQEK 5ITHA 4A8YA 2B0GA 3GYXB 1IN0A 5AJ3F 3I55N 2XQCA 1KQGB 4BDZA 1NU4A 3M30B 4FWMA 2O8FB 1N36J 4U67Q 3VAHA 4CLPA 3V4MA 1FF2A 2ZJRQ 4Q0BA 3LVWA 2HGLA 4DG1A 5CZ2A 4HHUA 1ZQSA 4OX6A 5KFRA 2IJRA 2C2MB 1FX4A 4A46A 3PO5A 4HT5A 1ZD2P 2BX6A 3ULEB 8ICWA 4IUFA 1VHXA 3FZBA 1IBMK 3HW8A 2DB1A 1T03B 4KTWA 3CFRA 1JXEA 1IM6A 2H54B 2LYAA 2ZJPL 4UOGA 3GZFA 2UXBK 4LF4J 3CMEN 3AJDA 2QKQA 1N33F 4L3KA 4ZCLA 1HJRA 2IM3A 3D6HB 3KKRA 3BO4A 1SJ1A 3E01A 2E1EA 4FO6A 3ZZOA 1KXPA 5JTIA 1VK8A 5HMMA 4Y2QA 2V68A 2HOFA 3EGNA 1QE1A 3K0SA 1XSLA 3M8ZA 4MK8A 3GV8B 1RTJB 4C3MA 2HKEA 3QICA 4DV1J 2YJEA 2Q36A 3C2LA 1Y5LB 4ECWA 2AJ1A 3SUPA 2BCSA 3BGOP 4DMZA 3PR4A 3QYPA 4YNQA 4W90B 1YBTA 4USAA 2UUCK 3A8JA 3FEXB 3J80Y 2HQIA 3VQEA 3UKUA 4PHEA 2PI5A 2Z2ZA 2HNDB 2ZHBA 4QOTA 4M9LA 1D8ZA 4C2MA 4DI6A 2VONA 3M6VA 2EFQA 4RPXA 3FZKA 2HMIB 3JPRA 4Q45A 1W2BM 2BHNA 1WB9A 3ZEUA 1TL7A 2ILYA 1AT1B 1VCTA 4QBUA 3OFEA 1S9GA 1ZQGA 5BREA 4MIBA 1SQEA 3MN9A 5EXWA 2MZRA 4CHZA 1BA1A 4DKWA 2FVCA 1XK8A 4CWBA 3HP9A 3BEGB 3PVXA 3OSNA 2P9UA 2QA1A 2J9DE 1FEHA 5F0WA 1G99A 2VFVA 3TJ9A 2ZWHA 1RT1B 4LBPA 4IR1A 1DRZA 3UCZP 4KLEA 5EY4A 1LB2B 2FQQB 3PRBA 2YMQA 2J9DA 2DR7A 2N1RA 1Z00A 5DDRC 5DDQC 1T6CA 1VQ8N 1YBUA 1NOZA 1S99A 4CHOA 3MECB 1ASVA 1R8HA 2VHGA 4CF0A 3O0FA 1S0VA 1HBNA 4FCYA 5DGBA 5HRPA 2RU3A 3Q0AA 3T5LA 1MU2B 3H0RB 3VTIA 2AU0A 4Y34A 3OL7A 2OZSA 4FO0A 2V52B 5ADXH 5ALFA 3QFUA 2UUWA 3CCQS 4QW8A 2R9LA 5C2DA 1B43A 1KRPA 4P75A 3UVJB 3NP5A 4DJBA 2MQMA 2XYHB 4KRFA 1I94F 4ZPWR 2QARB 1H2VZ 2VG5A 2OEKA 4I0WA 4FDFA 5LL6d 3GOIA 1ATNA 4IL6U 1N62A 5JMVA 1C0UA 5HVFA 3IDHA 4YR3A 3GG4A 2N4DA 3D2EB 2W3SA 2UV8A 2M3DA 1IO2A 1JL2A 3CJ5A 3IWXA 2J9EA 4Y28C 4JI6K 3BGLA 5JLHA 1X1PA 1R31A 3M1YA 4CF9A 3NXZA 5KG7A 3OT9A 3EZ5A 1UEUA 2LLZA 2SXLA 2RPIA 4NLZA 5CYMB 5IV4A 3EY1A 3NMUA 1FRHA 5DM7Q 2R2SA 1K6YA 4P7TA 2JEFA 3EUB2 3LVVA 3TVYA 2Z1JA 3C0BA 2M9NA 4KT0C 1A7GE 1NGGA 5DB8A 3UN2A 2WRMA 1FKOB 5BR9A 4IRCA 9ICBA 1PYOB 4CBUA 5D0GA 4HCCA 1YVNA 1VSDA 3ZDEA 2ZD1A 3QT7A 1NZPA 4DX7A 3WXIA 4JMUA 4CH7A 4BR9A 1M1KT 5KFYA 4PPXA 4DR6K 4LF8K 5DQGA 2FY1A 4CE9A 4NZ0A 2IFXA 1X0FA 3BSCA 2K4IA 1TUGB 1ZQDA 4JD2A 4BUGA 3KDOA 4O5KA 3RZAA 1TFRA 3I87A 4KLIA 3DU6A 3Q8LA 2K60A 4KAIA 2L3MA 2VKZG 4PXDA 2ZE2A 2FDNA 4JKHA 3HCXA 3O80A 3FFIA 3HMJG 5M1OA 4Y0WA 3O5TB 1SC3B 4AQYK 2MHNA 4E7IA 2V63A 1TYQA 2H3QA 4XRHA 2PIIA 2H3ZA 2NRTA 3QRQA 1JQGA 2J5AA 3MM5A 2V8VA 3CQXA 5A2QO 1YUWA 1JI7A 3PW2A 1CS4B 4Z4IA 4IQWA 4I27A 3PRDA 2NXNA 3HF5A 3PACA 2ODGA 1RAEB 2ZDPA 1BUPA 5GINA 1JCGA 1HI1A 3NGZA 2FLPA 4K42A 3NF8A 1JX4A 4TUQA 3NGUA 2DXFA 2FUG9 4I2CA 1BCMA 3DFEA 1WUUA 1VJQA 4FZMA 2YWFA 3BBFA 2HBYB 3DLGB 3WX8A 1AXQA 1SGGA 4CJQA 4CF8A 3EE9A 2NZCA 1ZQNA 2ZXHA 2ROPA 4UB2A 1EP4A 1ZM2A 2V8PA 2HNZB 1HHTP 1X9XA 3MMCA 1R59O 4RNNA 2R8HA 2ZNYA 3V9SA 1OH8A 5L1JA 4DL6A 1BA0A 4WTYA 1RNHA 3GJQB 5D6GA 2JC1A 1WG5A 1FRJA 1FK9A 2JZBB 4LFAK 3KLFA 2RJZA 4Z4GA 2KSOA 1W9HA 4QWCA 1Q3UA 2GFFA 4CHYA 2KN7A 4WZMA 2XICA 4M63C 1BIZA 2BXJA 4CERA 1D5AA 2HFOA 4ACOA 1FO1A 4OI2A 4GVBB 5KG5A 2DISA 3GE9A 2VKRA 3L09A 4CO3A 1NJIO 5AZIB 3NKYA 5J2KA 3DNCA 4PL2A 1WI8A 2JRSA 1K8KA 5FRNA 1BHNA 1DK3A 4LF8F 1BQMA 4N8NA 1XNQF 5IIIA 4M5LA 5CH7B 4OL8A 4EEKA 1HBUA 2ZTDA 2VH7A 3E0FA 3WHIA 1UJ5A 4H4OA 4QIVA 2YMMA 1BQNA 2A3JA 1K73T 1B0PA 5AKIA 3CULA 1ZQIA 3CG7A 1NK8A 4KN4A 4CZLA 2W2PP 3TZYA 4X4TA 4AQYF 1Q3VA 5JVGQ 3C2MA 5EE1A 3SBTA 3M8SA 1NCLA 4PZVA 1JK9B 3TJAA 1FDNA 3MPVA 4R5PA 1TMJA 2DTJA 3AM9A 1DKGD 3NTUA 2BPFA 4YDXA 3M30A 2O8FA 1HKCA 2UXDK 5J29A 1VK3A 2KU7A 2QWNA 4RWXA 3K17A 3OQ2A 2V34A 2CQDA 1UA0A 3HWTA 2QGFB 4D3GA 3A3NB 4O5FA 2ASPA 1YT3A 2HMPA 3KLIB 4NLYA 5J1EA 2JVOA 1J5OB 2IAJB 1HQUB 1CUKA 5LY3A 2GX9A 2E8OA 3Q24A 3ULEA 3NS7B 2W01A 4DV4K 3Q83A 4YDUA 1T03A 3IBWA 3A3PB 1HNWF 3N6MA 2V7YA 5GAEI 3OV7A 4HL9A 3FLCO 1EXNA 4K7QA 2VU5A 3ZTSA 3ZT3A 4RQ6A 1R89A 2CPXA 2FPHX 5EU7A 3HSCA 2GH1A 2YWEA 2R4FA 5BRFA 1CQMA 1EARA 1HYSA 2B9WA 2Z2MA 5KFPA 4CF2A 1NNDA 4WE1A 5DLGA 4KE5A 3PX0A 1RTJA 4YG2A 3D5MA 1ZBUA 2E66A 4KSEB 2YTUA 1A6LA 2ROEA 3E66A 4QPTA 1ZQJA 4ZPVR 2QM1A 2AKWB 2W2QP 3ZTOA 4KLUA 1TGOA 3LDSA 1RE1B 3DOKB 4B3RJ 3JPQA 3HPGA 3RBZA 4BWJA 1LWEB 2KKPA 2YKPA 1YJWN 2D9PA 2HNDA 3T41A 3RG6A 1G15A 3H0LB 3SPYA 4YMEA 2DFFA 1RYSA 4CEQA 3SSQA 2K2PA 5EX5A 2HMIA 3RBXA 2K89A 3KG0A 4ZPAA 3VQ4A 2CVIA 4WF9Q 1IWGA 4O55A 1FESA 3CF5Q 2N3OA 2A42A 1D8LA 2G8KA 2AJ2A 4MHVA 5J2IA 3H8WA 1MLAA 1RLDA 3ISZA 2P6UA 4C8OA 3PYDA 7ICHA 3GFKB 3N28A 4DTRA 3KLEB 3OHBA 2HRUA 2AGPA 2AZ3A 1RT1A 1XO1A 4QZIA 4LF9K 1UJ6A 1YVUA 1FDDA 1S76D 2WSEC 4FM2A 2FJBB 2FLLA 3PYEA 2QA4N 1FT8A 3BQTA 4GV6A 4FJ7A 2W9BB 4JHDB 2F1JA 3AVAA 4CJLA 4LIWA 2OP5A 4TLQA 3MECA 3NCIA 4QOZB 3KK2B 3MFIA 4M7YA 2DQNB 2XLIA 1VQSA 4IFYB 2V9WA 4MFCA 3U1LA 2G8FA 4DCCA 3NCPA 1MU2A 2ESEA 2MKYA 3TNVA 3L7PA 2V4JB 3QJPA 5JVHL 4EHUA 1B4FA 1O1WA 5FDLB 4DTOA 4WYWA 1PIEA 1T8EA 3NCQA 2WUSA 1S0NA 3NAHA 5KFAA 4UOHA 4H0PA 1QUPA 3M9OB 2LQJA 4EU0A 3AOBA 3FC4A 2NV3A 3UVJA 3H4DA 4KITB 3HI0A 4M0AA 3EE3A 1EO1A 5CB1A 1PSDA 1E4GT 1VQ9S 3CB4A 2QARA 4UOCA 3D6JA 2I6WA 4TSXA 4FLVA 4PXEA 1ZBSA 2HVHA 4FJXA 7AT1B 4RO0A 3NS5A 1HJPA 2HB5A 1OQ3A 4OHYA 2BBEA 3PCOB 4XO0A 4PKIA 1GH8A 3EL2A 2EVZA 4DV3J 4R63A 1XBWA 2QKKA 2HW3A 4IOAL 2PA3A 2WF6A 5ETOA 5HP4A 2G13A 4B3MK 2KLAA 3ATUA 2QT7A 4I2JA 1WKKA 1WOPA 5CYMA 2VPYB 3UWTA 4M5HA 5KFFA 3NGSA 3JSYA 3THPA 1KQSR 4CDIA 3QGPA 4CGDA 2BKOA 3QWUA 1YI2N 4Y1DA 3L7UA 3KJQB 4KR0B 1WCLA 3L5KA 5EWFA 4L73A 1GTEA 1JB0C 4MEXA 4LY7A 3IAM9 4IR9A 1IBKF 2IPOB 2NYHA 1HUZA 4QQBA 2LA6A 3QIDA 4H4MB 4AL6A 2O4IA 2YX6A 4CBWA 5T7BA 4HAIA 3K59A 3RH4A 2OPPB 4MLEA 3H40A 1ZTWA 3H3OB 3L2VA 2HHTA 2QWRA 5D4NA 3THYB 3QNOA 4FNIA 1N5VA 1X4AA 1JJ2R 5G5HA 2CQHA 3VVUA 4EZ9A 1DQ8A 1H73A 2YNFB 4YOWA 4PRFA 3P6YC 4B17A 3MUVP 3CC2N 2Q0RA 1WG1A 4ZP7A 3MGIA 2H4YB 5D15A 4KHPK 4OHVA 1TZ0A 3UNYA 3RB0A 1QZ6A 1EQMA 1OH7A 4FFDA 2KVSA 4KKOB 4ECXA 2B4VA 1FFVA 5EVZA 4QZAA 1NPKA 3HJEA 1UHUA 5AXKA 2MMYA 1K44A 1UVJA 2K8CB 1CS4A 4YFKA 1JNZB 1N6QA 4Y1CA 1YTUA 4BJQA 1WKLA 1D1UA 4O4GB 9ICJA 1LOUA 7ICUA 2DXDA 2JLGA 2PZSA 4A4JA 3UD4P 2VQEJ 1TL5A 3MCPA 4CEEA 2E1FA 4EWTA 3C28A 3LL3A 3OSPA 3MCSA 1YDLA 5EE3A 1UVIA 3GIMA 4FXVA 5HL7Q 4NLBA 4OKKA 1YITN 2U2FA 4FJ5A 3LH2S 2BE2A 3DLGA 2GIQA 4J9VA 1LKYB 4DTXA 2HFNA 5AE3A 3LAMA 1HD1A 2GAHC 2OD6A 4NV0A 3KFUF 4NM1A 1RHJB 1F5SA 2HNZA 1RWUA 4CYUB 3MR3A 3OTOF 4KH1B 4DBQA 3KZXA 2LHTA 5KFKA 1ZZNA 4IC9A 1IBMJ 5JICA 2A2DA 2DGWA 2JZBA 1NKBA 1KAXA 2C3PA 2Q0ZX 2P51A 1C4CA 4FJIA 2WHEA 2UXBJ 3CO0P 2K8BB 4CI0B 4ID8A 1MQ2A 1HKAA 1ZAWA 4NASA 3THWB 2PYLA 2P9KB 5KG2A 1NKEA 1UEKA 3DOLB 1D8BA 4WZQA 2FC9A 3THVA 5F1XA 4WWSA 5AQVA 2VANA 4BGAA 5ETTA 2DR6A 5AZIA 1S1XA 4OHXA 2VJ4A 1I6JA 3ZSWA 2VFRA 1FJGJ 2Z2LA 3R3TA 4ZVTB 3W1YC 1CLFA 3ILJA 1L5UA 5J8YC 3EWGA 4RR5A 4USWA 1S10A 1KBUA 3NAIA 1LOTB 5ALUA 2YV0X 3NF9A 5LXYA 4DV0F 3CCRS 3AH6A 1SIZA 1RU1A 1T9WA 3G86A 3RB3A 2DFLA 2HVDA 5E0OA 2X1AA 1HBMA 5DBCA 2OUGA 2MJUA 3I8BA 2E5IA 5FLXY 5AKJA 5AQFA 2IRYA 3KHLA 4WP3A 1FNOA 1H7XA 9ICMA 4IFVB 2NQPA 5DGAA 1XN9A 4F02A 2GELA 5EUHA 1SV5B 4DPTA 4GMJB 1U0HB 1R8CA 2DCUB 1T0TV 4H0YB 2PMZC 4ETXA 1Q4RA 4UW2A 3QAEA 1R7IA 2A5XA 2GUIA 4DV5K 2Z1HA 3KD3A 1W7WA 5KFNA 5FPDA 4C80A 1WEYA 3H5UA 1JROA 2OD4A 4E0DA 4FVUA 3IBPA 3T69A 2DKXA 4DHYA 1VHIA 1J5OA 2IAJA 3F5EA 1HQUA 4LFBK 2F8EX 2VODA 1O51A 1RHUB 3CO9A 2KW4A 3PM9A 1WSJA 2HZVA 4HTUA 2CQ1A 5BR8K 1CG2A 3R7SB 1X4CA 3G87A 1HR0K 3W2WA 2DNNA 1UETA 2BJ8A 3ENHA 2WB1D 3L2WA 1RWXB 2E7VA 2HG4A 4PQUB 2APOA 1ZBHA 3FMWA 3SBMA 1PYSB 1B64A 3SUNA 1NEEA 1Z3EB 3BZKA 2VICA 4BRFA 4K0KK 4BGDA 2JMGA 3K5MA 3HRGA 3LP1B 4Y2PA 2ZWOA 2AZ1A 2PXIA 2XNRA 3C5FA 2I2YA 1K9MT 2GVZB 2E4LA 4QR2A 4AUKA 1SV4A 1XNRF 2FMQA 1IJFB 4BRKA 3ZETB 1JJ2M 1Z19A 5GAGU 3PYFA 4AHVA 3D1QA 4FJHA 2N7CA 2GO7A 2Z2YB 3DOKA 3SBGA 2VFSA 4KH4A 2DHSA 4GW6A 3T1HK 1KC8T 2KHCA 3T1YK 4ED6A 2MQQA 1LWEA 1RWVB 3LPYA 3AB2B 4USIA 4B3TF 4OKJA 3RJEA 2HBLA 1W7AA 3KK1B 1MMNA 2HZCA 2LXFA 2LBOA 1WSFA 4JI6J 1PKUA 2PYJA 4OJ6A 1OXJA 2W3RA 4DR7F 4YN3B 3TUPA 3GFXA 2IY5B 5H1SV 2RF2B 4ZS6A 4WFNL 2GQ2A 4FWKA 3O1LA 5CD4H 1P8GA 1QJHA 4KLLA 1JCFA 3HKZC 2RDDA 3D28A 3A2FA 3RF9A 1AUSL 1HPZB 2I9GA 4I29A 1TL3B 1G4CA 1S77D 3AVMA 2CQBA 7ICGA 3KLEA 2O8DB 3NGRA 3A0HU 4XEIA 1JJCB 4FBUA 4UF4A 2E8PA 4NCAA 4KHWA 3PDNA 4BR2A 3HJFA 3GL1A 2B3TB 1HFEL 4NLCA 2ALZA 4I2IA 1RHKB 4DR6J 4LIRA 3WDOA 2FF3B 2W9BA 3M1VB 4JHDA 5AQOA 3P5JA 3HDSA 4ES3A 2CN1A 2FJWA 3KK2A 2ASJA 1G1XA 3OTQA 3TTFA 1SZHA 4IFYA 3FYHA 3U27A 1SIWB 3FBCA 2ZGYA 1XR7A 1HR0F 4CLLA 8ICKA 1J5EF 2V4JA 5FDLA 3Q2TC 4LF7F 3AO3A 3CI5A 1RT4B 2L9WA 4I69A 1YTAA 2HAFA 4KX3A 4CF5A 3SEIA 4WFAQ 1NZ8A 4OI3A 3VQPA 2AQ4A 3DLLQ 1U1RA 4LJXA 3BF1A 3TAEA 4KV8B 2I1RA 1EZZB 3PSIA 3K57A 5AQJA 3L2QA 3SJJA 1UVKA 1MWQA 1T95A 3AA5X 3HSGA 3ZNUA 4K2JA 4US8A 3CSKA 2LECA 2R8KA 2LQ8A 3QE9Y 3I6PA 2E8NA 3LP2B 4JKAA 3M2UB 1O08A 2RT3A 4M6WB 2RD5C 5HN0A 3MN7A 2DNRA 4A8KA 1RBOB 1S1VB 4DCPB 1UFLA 4F5NA 1VBXA 4X64K 1PAUB 4YVZA 1TUYA 2CH5A 1HWKA 1Q7LB 1JLAB 1KFDA 2QLJB 2GAGC 1I51B 1GXTA 3CCMS 3RRHA 1CJVA 4CT9A 4DR3J 1TFWA 4BBYA 2JVRA 3K5OA 1IKXB 5I42B 4LFAJ 2JFKA 2R7XA 1NGHA 4H4MA 2NUHA 5J2JA 2I38A 3N5FA 3I33A 2WF8A 1F2HA 1Y3JA 3HVTB 3ENQA 5KFEA 1ZZFA 2C3UA 2YKOA 4PG6A 4L3QA 1WF0A 2LQ9A 3CMAN 1RU2A 3JTPA 4U7CA 1EIYB 3THYA 4F71A 1QY7A 1PC4A 4JYAK 7ICQA 4ANCA 1JXLA 3DLKB 1RCHA 4J9UE 2G5IB 2XWYA 2ZIXB 3T6BA 3SAGA 3RMBA 1IBLF 2EFVA 4EO8A 3QFHA 5K5MA 4FF2A 1S1UB 5AK3A 2YNFA 3CJ9A 3ILLA 5ALMA 3CCSN 1Q95G 1WUDA 2HHQA 3CP8A 5HHIA 1VQYA 1N5QA 1Z2LA 2LYVA 4OQJA 1LW0B 3K7RA 4FPIA 3SIPB 5AKXA 4CLYA 4JI4F 3AV9A 3QT6A 5TISU 4FYYB 7ICTA 2WF7A 3Q89A 3WU2U 1V97A 2GUPA 3SQGB 2I7PA 1C1AA 3BQ2A 4NLTA 2UUBF 2E5HA 3OJSA 4O4GA 3TWZA 5ETRA 4MH8A 4V19J 2N3LA 3ZZTA 9ICNA 1P1LA 1COOA 3O9UA 2JX2A 3ZT0A 3FVYA 4UB8U 2V2ZA 8ICSA 3CCLN 3QJJA 4PH5A 4O4RA 3CPEA 2UXDJ 2IJFA 4KIAA 4I2GA 1BPDA 3IAS9 5D0RA 2DGXA 1VQLS 5I9EB 5DQIA 2KVIA 1S1TB 3IDWA 2IOHA 3OXGA 1YX2A 1HLWA 4RQ2A 3DYAB 2CH6A 1NZBA 4CYUA 2KIVA 2DGTA 2YHXA 3CJBA 4E1JA 1OW5A 1FI4A 1YQHA 4DV4J 2VJUA 5LSLA 1WORA 1BC6A 3X3UA 5HAOA 2A1AA 2CPEA 4NYPA 4X62F 1X6JA 4M41A 4YCXA 3CERA 5DM6L 4DCJB 2KHVA 4WQ4C 3PNIA 5DZ6A 1WDDA 3UW1A 4F7VA 4E89A 4X5VA 3THWA 4ZOHC 3JAMY 2P9KA 4DUYF 1SL0A 1QTNB 4OYAA 1BU6O 3SD7A 3DOLA 2ZOGA 2XI9A 2UZAA 1R3NA 3U7JA 3D7EO 2YXLA 5ETLA 3Q8PB 3EICA 2RE2A 2DGOA 1OIAA 9ATCB 1NZAA 2E1RA 4CZIA 5K4LA 4RQMA 5IT4A 5IC6B 5GADI 5E3AA 3WKAA 3THTA 1PVPA 2VQFK 1RABB 3JSBA 3J80O 3EPGA 3PNCA 2W42A 3G10A 4CLZA 3D1HA 1SVDA 2A19A 1QSLA 1YJRA 1SXDA 4EBDA 3WQPA 2B6GA 1QZ5A 3OL8A 3G4SS 4DMNA 4OPAA 2Q3PA 3LDLA 3DRYA 5EDWA 5AQLA 2M4MA 2WB1F 1SV5A 3JYTB 4JI8K 3C6UB 1RA6A 2M70A 1DGJA 2LA4A 3DJCA 1F5CA 3OTDA 1S4FA 4OV1A 4J9RA 4KRWA 1TQLA 3J7AP 1FD2A 1M1GA 3N4PA 1DZ5A 3CDUA 2R7RA 1ZTTA 1L3TA 4ILLA 2KFZA 1U1NA 3ALYA 4W98A 1SL1A 3SEOA 4FLUA 4LF9J 3L4BC 3VESA 2G5HB 4GC7A 4M9NA 3EM1A 4IO1A 2CKWA 2AQ0A 2OHFA 5J0UA 1Y7PA 4RBVA 3HFVA 4J2EA 5ALLA 1X42A 2KE7A 3C2PA 2L9NA 3GG0A 1ITGA 4PQUA 3RRKA 4LD0A 5ALIA 3D0HE 1U1MA 1TMMA 2E8MA 5AFUA 2BABA 2LVWA 3ZT4A 2O8CB 3LP1A 4C0ZA 1JWWA 4BRIA 3DDNA 3NGIA 1T94A 2VJ5A 2AW0A 4CIEA 2GVZA 1JLEB 3ID8A 3QEVA 1YAGA 2O01C 3TTDA 1QH9A 2WBMA 3DRPB 5HO4A 1FTCA 1NAQA 2MKIA 1RT6A 3DLRA 1S0MA 3CRXA 2BYCA 1C0MA 1A5WA 4LZDA 2QL9B 1VSEA 2X1BA 1OVYA 3MN5A 1IG9A 2CVEA 1Q81O 1FTRA 4USVA 2AP6A 2O8EB 4WXWA 3CDAA 4CVNE 3PMNA 3E3XA 3I55S 4DXLA 2WVDA 1URJA 1CI4A 1WOOA 3KK1A 4ZP8A 5CE3A 1X8DA 4OCZA 5F3ZA 3FGUA 2PE8A 3BR8A 4B3MJ 1UA1A 2W4DA 2RF2A 3HVWA 1MN9A 3NH1A 2MPUA 1WLJA 2ZH4A 1LAWA 3VMFB 3CQYA 2ASOA 1RAAB 1WF1A 3K5LA 4NWBA 3G82B 2AJ4A 1EXQA 4JI2K 1RUSA 1Q16B 3WK8A 1HPZA 1NHUA 5FD1A 5B0EA 1TL3A 4DFJA 5F8JA 2O8DA 5JRTA 4HACB 3VAKA 3CMES 4CHNA 2X51A 1U1PA 4YOUA 4ZVHA 4K4YA 1HL6A 3UMGA 5K8PA 3ZDAA 3OHRA 4IQMA 8ICZA 3ITHB 2E1AA 4F3TA 5KQ8A 3DRRB 4F2SA 3M1VA 3BGUA 3ATVA 2ZJQL 1QQ6A 1BD6A 1SC6A 3E9PA 1WEZA 1U1LA 2M8HA 1P27B 4P9SA 3UXOA 4NYFA 2MZTA 1K5OA 2MQLA 4P4OA 4DFPA 1VLBA 2X7IA 3H08A 4CJKA 4EZ6A 2WHOA 1QDUB 2RHQB 4KHPJ 3P8BB 2W8KA 2DGVA 1RT4A 4JUZA 2OGUA 5L8RC 2OTLN 3BZCA 2HQ3A 3CD7A 3AVBA 1C0TB 4MKVA 3J81Y 2GIRA 4KV8A 2ZTCA 2QTDA 2NXCA 5J0PA 2R8IA 4J9SA 2PSZA 2XMTA 3MFHA 4JKEA 4U7UD 1LFPA 3ETOA 4K41A 1N5WA 2KI2A 2ISPA 4I68A 1K47A 2ROGA 2Q6BA 1HJOA 3M2UA 1N5XA 2EFGA 2DK2A 2FHJA 2XEXA 1M5VC 4DWIA 1HWLA 1NLKL 1F5BA 2ZHOA 4M6WA 5I3QA 4PY5A 4JB3A 1S1VA 5ALOA 4JK1A 2HS3A 4ED7A 4PWUA 3DGVA 1RM6C 5ALHA 2DL0A 4FPBA 4KH6A 4ZJLA 4CF1A 1Y88A 1JLAA 1LW2B 5KFZA 1L3SA 3N4QA 1WSGA 3QBXA 3HT3A 5CJ7A 4LBHA 3QMLA 4KGKA 2WMMA 5F8HA 4J2DA 1RQ0A 5CA7A 5J0RA 3ZSZA 4JWMA 2Q97A 3V2UC 3SI6A 1VQ8S 1KWMA 1IKXA 4J2AA 5I42A 4QIGA 2KICA 3MR7A 3JSMB 4RTFD 1DJ0A 4L72B 2PGCA 2HVEA 3ZZRA 3SCJE 4ZIWA 4C1NI 5IINA 1WC5A 3HVTA 2ZH8A 3A5OC 4OPJA 1NRKA 2Z1GA 3ISND 3QESA 4P2MA 3VQ9A 2MQOA 4P7VA 3W2VB 2KG1A 3LGHA 2XI3A 2MHEA 1HRHA 2ZIXA 2ZOFA 4IQTA 5J0XA 1FJCA 1S1UA 1DGKN 3M8YA 1FXXA 1UAWA 3I28A 5HHHA 1V85A 2DNOA 2HS0A 1LEOA 3ZTRA 2I6XA 3E8OA 3KKSA 4CIOA 3EVWA 2B8QA 1E3MA 1FXRA 4DV6J 2JHDA 2F4VK 4FS2A 4RPYA 3ILOA 4FM1A 5KFGA 1OYDA 4ZVRB 2D5RA 2D1KA 3SQGA 2XMMA 1KEJA 3HKZD 3W7BA 1S6PA 2PY5A 1X4FA 5AIBA 5DRKA 4DSFA 2QA2A 2RMLA 1S22A 1D09B 5FPNA 3VAGA 2KVQE 4BRQA 3NMRA 2D3OR 1B3TA 1ZBFA 2WTFA 2AEFA 2BOPA 3J7A1 1KTVA 2Z0GA 1S3XA 4UZBA 1TK5A 2HFSA 3BKTA 3GBTA 5CHIA 4ICLB 1RTZA 4Y2TA 1KW4A 5B8HA 3RMDA 1UMJA 3OXLA 4DV5J 1OS5A 1ULRA 2BGWA 3GYNA 4OLPA 1P8ZA 1S1TA 2R7QA 3CVKA 2HCFA 1JUDA 1C1CB 4FWPA 4ZN3A 4NCBA 4DR5J 5CZVA 3MCOA 4HEA9 2OAUA 3DYAA 4ECSA 9ICOA 4LFBJ 4OX9K 1G2EA 4PHPA 2CJ9A 3CC7N 4UAYA 3SYZA 1S49A 4OYZA 5BR8J 4YXMA 4ZDNA 4DS4A 2Q3SA 4OZNA 5T14A 2LFVA 4PKHA 4K0KJ 4OI6A 3NGTA 3AA2A 3IO1A 4TQRA 2ZNZA 1QQOA 4KLDA 2AEJA 4JI1F 1IQTA 2FBXA 4DU7A 3Q86A 4ECZA 3WEEB 2W2MP 5ALVA 3AB4B 4B1ZA 1N54B 2XS2A 4LF5F 2P6TA 3LDAA 5HRSA 4U67L 4ZLNA 4K4TA 3I9ZA 4F26A 3O4WA 2ZJRL 2HBZB 1XSPA 3AXMA 1NWKA 3FEYB 3AVCA 1MQ3A 3T1HJ 4NLDA 3T1YJ 2GW8A 4TN2A 5CYQB 3R2DJ 4R79A 1NH8A 4BC3A 2OH2A 4M5DB 2G1HA 2Q79A 4M94A 5LJ3Y 5J2MB 1QAIA 4X65K 3JYTA 1S7HA 3QT5A 4YB5A 3S7RA 3VERA 3C6UA 3U9ZA 4JI3F 5B0DA 1ZJNA 3KK7A 3LWMA 2IMWP 1FFWB 4G3IA 1RWMB 3IMQJ 4Q7AA 2GNKA 2DNZA 5E41A 3Q8SB 4QIFA 2H5EA 5F8NA 1YSJA 5MLCV 4WFYA 2GLEA 3CCTA 3EUNA 5F8LA 3SMSA 2OMLA 5IILA 1ZQBA 1LK7A 4BWMA 3CJ3A 5FLXU 5JLFA 2LMIA 2V51B 2CQIA 3A13A 3OYIA 5F2RA 5CEHA 3TACB 5HOOA 1RAJA 8ICVA 2KFYA 3PSPA 1N34F 2QJ3A 2VA2A 2CNNB 3H98A 3F73A 3W64A 2WK4A 2FF6A 1B0XA 1P90A 5F9NA 1WSHA 4CW7B 2XBPA 3BDEA 2W7PA 3GJSB 4MT1A 2KD1A 4Q8FA 1TFYA 2HAIA 1ZXIA 3UDEA 2BUPA 3GIRA 3KKAA 5KFJA 1CJUB 4CJEA 1RT7B 1JLEA 1B0VA 3WZ0A 4B1VA 1LXJA 4DU1A 2WFBA 2DKZA 3MM9B 4DCOB 1B0TA 3OYHA 3SMVA 5KT2A 3JPOA 3OS2A 1T9UA 2OI2A 2NS1B 3Q22A 1U25A 3IN5A 4JAXA 2CA9A 2WAQD 4QCLA 4JN4A 2E5LF 1ZAVA 1DBDA 3ZC4A 3VF6A 3D1OA 3V9ZA 4IRDA 2ASLA 3O1BA 2AGQA 2NRRA 1N8RO 3A8KA 5M1FA 4ELTA 4NXNF 4E2FB 4RQ1A 1JCEA 1U6BA 4X64J 4CH1A 3PY8A 4DL7A 3B4MA 2Y3YA 3GMGA 3GILA 4C7YA 4DTJA 5LM7E 3G82A 3SQ1A 4CK2A 4PAAA 4U8YA 3V9WA 1FCAA 4JI5F 1NKCA 4CTAB 2EG1A 2ZJ5A 3MM6B 3ZO7A 2HHHJ 4JI7K 4RW9B 4USHA 3IUCA 3AVHA 4BE1A 4KLJA 4CJ5A 2WSCC 3TWHA 3RFAA 5BOLA 3DRRA 1MA7A 5T41A 4X84A 3UE2A 4JYAJ 3CFOA 5KT3A 4RQ5A 5H9EK 1NK7A 4J03A 2KOBA 1KTQA 4A8XA 1T3NA 2NO4A 3OVSA 5KFWA 2OLWA 1XMOJ 2ZH6A 2H9ZA 1O6XA 3VQTA 3ICXA 4ECTA 2UUAK 4W5TA 3HZGA 4G1PA 1KSPA 1KFSA 5LMNK 3DLEB 2CG4A 4NA3A 2H1YA 1RT2B 1GEHA 5A76A 2J6TA 1YJWS 3RR7A 2FJDB 1UOCA 2Y9UA 3J8AA 4DR4J 2U1AA 1OMSA 3D9BA 4ZTFA 4F36A 3DXKB 1MROB 5KG1A 1NGFA 3DHWC 3VAFA 3TUIC 1CSJA 1RTHB 4US9A 3IFEA 2A3ZA 3IBCB 3Q23A 5J0TA 1GLLO 4KHQA 4JS4A 3KLHA 2V2QA 2B43A 3HX9A 4AT1B 2P9LA 4Z4HA 2HYIB 2NYVA 5HATA 1VRTB 1CC8A 2J7UA 3HI9A 3QUBA 4LF1A 1RBUA 2RHKA 1WKJA 3MEEB 3WXLA 2VPXB 4DPXA 2GBZA 3TZXA 3D2WA 3WNHA 1V9PA 4ANEA 4NL9A 1LW2A 3LM9A 3O3LA 4DV1K 4DOAA 4IO9Q 5L1KA 3EE8A 4LR7A 4NRTA 5E33A 2QA4S 4OYPA 5EX3A 3TKAA 2CXEA 1WAJA 4MEYA 2BCUA 3JSMA 4O8UA 3Q7BA 2JWKA 2QV6A 3S1TA 4DPUA 1X9WA 1SAZA 4KI4A 2ZH1A 1K1SA 4LSNB 4FJJA 3HKZF 1RBVA 2X78A 7ICSA 3Q8UA 2JGAA 2CNLB 5LMUK 3W2VA 1YGYA 1ZPVA 1ROFA 5KQDA 2BOAA 4M5NA 5HMWA 4X4RA 1VQ7N 3W61A 2MUTA 2EEYA 1TK0A 4B1UB 5KI6A 3SQ0A 4UTGA 3LPUA 3J81j 4FW1A 3V72A 1NPPA 2XCAA 1SKSA 2AGOA 1TKXB 1UPMB 2IRUA 4OYWA 2G8WA 2Q4TA 1C0GA 5AK4A 4ZPBA 2AJQA 3NF6A 3A0IX 4LZGA 1E6VB 2V5HG 2VQFJ 1C1BB 3QBCA 3HSDA 2MQNA 3K9JA 3RJGA 2D1CA 2YB1A 3PHEA 4FL9A 1K73O 3HD2A 3KNGA 4IOXA 1N36F 5M1QA 1CJTB 4DR1K 1L8LA 3P49B 4BR7A 3SQIA 3CDEA 3DLJA 4ZKAA 3HSTB 2RRDA 5J0SA 5ALZA 4A59A 1IXRA 4Y2CA 2G4BA 3G71N 2OFHX 1XQIA 1SIJA 2HHSA 3N5BA 4JI8J 3R5AA 1NNLA 2D0AA 1VYAA 1N5TA 2ZBRA 2P5OA 5HK4A 3KG1A 1YI2S 1XUPO 2PFQA 1UAXA 4JV1A 3I5CA 5TKYA 1DT9A 2A2CA 1U48A 4ICLA 5IT9Y 3HP6A 3HBTA 3LYSA 2ZBIA 4IZ9A 1TVRB 1HARA 1N88A 3AEVA 1YJUA 2RU9A 4OHZA 4LF4F 4K4IA 1KLNA 4CFBA 2BPCA 2OPSB 5D4LA 1RKIA 1C1CA 4UBBA 2P5VA 3RAMA 3UD3P 4ZP6A 2HSZA 4WJ3B 4H5RA 5CXTA 3SZ2A 1RDAA 3RJHA 3SAFA 4QW9A 4KTQA 1U8SA 5DLFA 2GOLA 4OJOA 4CGGA 3K8VA 3K2PA 3Q8MA 3U3YA 4DV1F 3KVGA 4UY8O 4HI1A 1FWLA 1ELOA 1YJ9N 1ZQZA 3H2VE 5HMXA 3B9JA 1DEJA 2ACMA 2DGZA 5JVGL 1B92A 3CJ0A 1A76A 3NGYA 3K0JA 2ZITA 4Y2UA 2E2OA 2D3DA 3DLBA 3HPOA 3WEEA 5A0YB 2NNWA 1D9FA 2CDQA 4IJNA 2HQFA 1XR6A 3HVAA 1VS3A 3KOAA 4LJMA 1H3DA 5B0CA 4N76A 4YP3A 1M5OC 3S8SA 2DJWA 3G6VA 5ETSA 2G9OA 2R7YA 5G4DA 3A0BU 2FZGB 3O8MA 4E7LA 1Q79A 2W8LA 2QG9B 4ICAA 5CYQA 4UAZA 2WFAA 2NR0A 1CVJA 3C15B 3JAMU 1VQKN 3NVVA 3I9V9 1YITS 2OTJN 4OD0A 4M5DA 3ENOA 3OYMA 1FXDA 4DPYA 2KXHA 2IM0A 3M7DA 3D0IE 3FZ2A 3LDNA 3VGLA 3PMLA 3VEYA 4I2DA 3O9TA 4ILRA 3V9XA 3KIOA 4X2BA 3MR6A 3HHEA 3FQLA 4B8CA 4BVPA 4B9MA 5I3PA 4JI2J 3OHAA 4OZJA 1UT8A 2RQKA 1FEEA 2CZ9A 2W7AA 4WK3A 4UB1A 5J2PB 2Q1LA 1WC1A 5LSRA 4MF2A 1UFWA 2PEBA 1FFSB 1IXKA 2GC8A 3CD0A 1E6YB 1VQ6N 2XB2D 4UARA 2CIMA 3CJ7A 3EWAA 1BPYA 1HA1A 2RQ4A 2DIUA 2JL9A 3H4BA 1U2FA 2VG6B 1T9YA 2M88A 2R3VA 3BBBA 4CZJA 3TJ8A 2P6SA 2WAQF 1FA0A 3CIPA 3OA9A 2V6AA 2LU1A 4W5RA 3H1QA 1QQNA 2LCWA 3ETRA 2HSTA 4EAHD 2DNQA 4MLHA 2ETJA 5AM4A 5G0RB 1S97A 2GMLA 3Q8YA 1CJUA 1RT3B 5AQQA 2P9CA 3OLBA 4DG1B 3MXMA 1VQNN 4DR2K 1EHWA 4N77A 1WTBA 3CJCA 1NBEB 4YQWA 2D4WA 5ALNA 2BDPA 3MM9A 3RVCA 3CF5L 3BQ1A 2EG2A 4Z6CA 3FR0A 1ZQCA 2OMOA 4BC4A 3PW7A 1R8BA 3OR2A 3MD3A 2CZ4A 3ZYYX 3WK6A 1XHXA 2W7OA 2V8HA 3LOUA 2UVRA 4GVLA 4IH5A 1N5YB 4ELVA 4H5WA 1WG4A 1Z25A 2YNIB 4CO1A 3DRXA 1XU4A 1YRUA 3JQKA 1PVQA 2PAVA 1BPXA 4M2YA 2ZH3A 5AXNA 2DBYA 3M1FA 2W43A 1RILA 1H98A 2AEMA 3GPAA 2A1JA 3SENA 1QE1B 3IM9A 3MGVA 4ZTJA 1HEKA 2FSKA 2EFNA 1T9VA 1DURA 4YFUA 2ZC4A 4DFMA 3QSIA 3IM8A 2HF4A 3LANA 4LMZA 1WBDA 1VBZA 6FDRA 2KT3A 4C11B 3AOCA 4ZHRA 5L1MA 5C2FA 4P0PB 2BJ1A 1NK6A 2RS8A 8ICQA 3O08A 3MM6A 3GFYA 2NZ4A 3NBPB 3MC1A 4S0MA 4RW9A 2POKA 3NOCA 2GWSA 1G6BA 4A8MP 3M6UA 2NPFA 4BROA 4FWLA 4R64A 2GHVC 3QIOA 2ZVIA 1W97L 2D0CA 4O44A 4MKAA 2CYYA 4G1QB 4JNEA 3D0PA 3HD1A 1QTMA 4RLEA 1Q5VA 3AXKA 4DTPA 2QLXA 1CZAN 3H3NO 1ED1A 1S9GB 2XMJA 3IXQA 1BI4B 2JEJA 2MZQA 3QU9A 1RAHB 3TX0A 3RBDA 4YHHK 3PUFA 3RJKA 4NLUA 3DLEA 2OYYA 3MPUB 3V9UA 1HMVB 1NNEA 2O8BB 2KZMA 2F4VJ 3QU4A 4CE6A 1Z6RA 4GV9A 3D4JA 4Z4FA 1KKHA 2VWBA 2F7VA 3DXKA 1MROA 2YQ1A 4O3RA 3M8QB 4W5NA 4K4HA 2NSBA 2X6NA 3H1VX 3RW6A 1RTHA 3GLJA 5MAOA 3AVKA 1HBNB 2XC9A 4MK9A 1X9JA 1UPHA 1WJ9A 2W25A 3T9ZA 1XMQK 3DDHA 3P96A 2NXEA 3AOAA 2BQ3A 3DKDA 2EAOA 4QZEA 3FCHA 4CLFA 4K4ZA 3WT0A 4GKKK 4FS1A 4PGXA 1IH7A 2JEGA 5AI8A 3ENBA 2G09A 3MEEA 2GO8A 3ID6A 4TUPA 2EC0A 2LI6A 5CWRA 4NLRA 1IJJA 3C65A 3TEGA 3CPWM 5ALEA 2M2BA 4FJNA 4Q5VA 3J81U 3CQ8A 4F92B 4M3UA 4OX9J 3MMAB 4LH4A 3BO3A 3UI3A 3I4PA 1RQNA 3KJNB 4N41A 5B0AA 4BRGA 1SQFA 5IWAK 2QFJA 1N48A 3RJJA 4F91B 2P5GA 4XPEA 1FRIA 4YXJA 4DTSA 4OI0A 4ZPDA 3OYLA 4C48A 4LSNA 1UKUA 1RTDA 2G8IA 2RILA 2UXCK 4BRCA 2Y0BB 2K8GA 5KFCA 4F67A 3VQDA 4CJ7A 2QL7B 2Y8YA 5AM5A 3C21A 2KDOA 2K1RB 2XMWA 1VFJA 5FPEA 2XI2A 2R2UA 3HSZA 2BJEA 2OKQA 1T3QA 2R7WA 4OYOA 4FM0A 2ZBQA 5HANA 3DXBA 1VSIA 5BPNA 1QSSA 2F9JA 4BXOB 3CCZA 1BWEA 2XHWA 4E1NA 1E6VA 2VOPA 1C1BA 4K8RA 4GIBA 2HIQA 4HHHA 4EHTA 5JS2A 4F5QA 4LR8A 2AIRB 4A2AA 3TAPA 8ICGA 3M7VA 4FLTA 3GYGA 2ZZTA 3I76A 2IYGA 2GX8A 2HQGA 4C0OC 1LKZA 4X65J 4F3OA 2DH8A 2NPIA 3TEHB 3IAYA 4KI6A 4CJVA 3SQOP 2DVIA 4ZVOB 4XH4A 3ZI4A 4TKTA 3W3DA 4GNIA 5KL1B 4LSZB 3W0LA 3QZ7A 1TVRA 3K5NA 4B9NA 1GMUA 1HNXK 3UMCA 4I67A 3BQ7A 2FPLA 2OPSA 3KWIA 4P4PA 3L3UA 2DHHA 2BJ7A 1S1WB 3CMAS 4ETZA 2BKEA 4FKYA 4NLVA 4YMOA 1W2BR 3I4HX 1SZPA 3R6LB 5F41A 3KHGA 3UR0A 4GMKA 4C6AA 2FDRA 2QEXN 4ISFA 2EZYA 1EWQA 2E88A 4MO5A 3O6QA 1VSMA 2HBQB 3ZX3A 4DV3K 3CCSS 2BR0A 5L1IA 2HZAA 5KOXA 4V1Ak 4WFZA 2E5JA 4OPKA 4B3RF 3UR3C 4Z6FA 3HILA 4RNFA 4CHQA 2UU9K 2GJ2A 2V50A 5KRSA 3RWUA 4LFCK 1GLJO 3H45C 5D0EA 4JK8A 5C24B 2WZ1A 1GK8A 1RDFA 3N4MB 3MMCB 2ZWPA 2HBMA 1M6YA 1CLQA 1BDGA 3KMQA 4YMMA 1KC8O 2L08A 2B51A 9ICAA 1QAYA 5KRTA 1O03A 2DH9A 2RRNA 3HXMA 3K75D 5KFMA 2XO7A 2AYBA 1SJ3P 3GV5B 1I1GA 2JC0A 1IKYB 3CCLS 3C15A 3IP0A 1GLFO 3CYMA 1TL1B 1HBOB 4PHDA 3W8GA 1UZDA 2LKYA 1XHZA 2C28A 1GXUA 2EC2A 2G08A 5I3UB 4RU2A 3U02A 1C4AA 2WVFA 4CF4A 1Q9YA 4CFAA 2BGGA 3E9LA 1OPIA 4QR0A 3NASA 1N32J 5DB6A 5J2PA 1B70B 3BBCA 3GG1A 4PL8A 1KVJA 4AXJA 4EIAA 4BC2A 2DO0A 1TV9A 1VGYA 3IG1A 3MAQA 2EHGA 1BQNB 2MKCA 3LUYA 2F9TA 1WEXA 1E6YA 4JI7J 4UAWA 4U6PA 5C2CA 1RDBA 4B1XB 5A6PA 3C7NA 2HOEA 4I1TA 4LRFA 3F9KA 2FI1A 2VG6A 4ED8A 4DUZF 1VSHA 3VV2B 5H9EJ 2HSEB 3HVRA 4IOAQ 3TUZC 4R5PB 3H2UB 3DDKA 3DAWA 2LP4A 3HHDA 5KFSA 4FLXA 4H4KA 1WN7A 3PG9A 2UUAJ 5G0RA 2JEIA 3TRGA 1RT3A 4C7ZA 1KD1T 2E2PA 5LMNJ 2AWZA 3QFWA 3CXCR 9ICLA 5AKGA 1NK5A 2NSCA 8RUCA 2P9SB 4DV3F 4QZGA 2JR5A 2E29A 4Q2LA 4Z7CA 3OJUA 4A8QA 1PBUA 1XJWB 1R0AB 2Y0SC 5J1EB 4MFAA 2FPKA 4FZLA 2QL5B 4LF6K 3C2KA 2IHNA 1RAOA 4J37A 4B6JA 2YJFA 1DARA 4PWWA 1VIOA 3FZFA 3R5BA 2CPFA 5AKYA 3VGUA 1GFWB 1N5YA 4U8VA 4JKDA 1P9QC 4MDAA 3C19A 3CCVN 3RMAA 2YBVA 3OTEA 1ICEB 1HQ2A 2YNIA 2MA1A 3QQCD 3I82A 4F72A 2KO1A 2AF6A 3A1YG 2YNGB 1B9FA 1HYSB 3L4PA 3VQBA 2FSJA 4A8EA 5K8MA 1QVFM 3QETA 4RNOA 2FMPA 1FJGK 4WE1B 5B09A 1TUUA 4CEAA 3ZSOA 3MWPA 1YBAA 5HJYA 4ZA1A 1OWXA 4JI0K 5AKZA 5ALGA 4M5KA 2JNJA 4C11A 4RQ0A 4AD6A 4RPFA 2GHPA 1QD1A 4P0PA 2G8HA 2F1HA 2KTQA 2FY8A 3WNGA 2C42A 1BHLA 5DMRA 3TR8A 3MCNA 5J2NB 4WFAL 3NBPA 2CGKA 2F1FA 2WVEA 7ICVA 1NHVA 4DZDA 2KN4A 4Z94A 3R9KA 2JDJA 2VCPA 2RN2A 3M4XA 4K5SA 2GJIA 2BUNA 3MTKA 3SFGA 5LMUJ 5AQHA 2MSSA 4O3MA 3DMJB 4G1QA 2B4JA 2PDAA 4CECA 5AI0A 1I5OB 1SB6A 2KZ3A 4UAVA 1YF5L 1Q86T 2OA8A 4J9LA 1BI4A 1XTZA 1SL2A 4PL1A 1H7WA 3GJTB 2E1MC 4KHRA 5T7LB 2AXTU 5C42B 3NGKA 2VQEF 4CJ4A 3CTRA 1GNKA 1BVSA 2I1QA 3NNAA 2ZUBA 4A8OA 1D0EA 1HMVA 2M8DB 2ZF5O 3TI0A 2YKAA 3OYJA 2O8BA 4L74A 4KLOA 5KPTA 4DR1J 5GAHP 2RVJA 1S72S 4ZPTR 1XERA 5H9FJ 9RUBA 1L3KA 3H8JA 3R5DA 3NDKA 5JJBA 5DKWA 5J2FA 3M8QA 4DPWA 3VGVA 1OVQA 1CQNA 5M1NA 4CCHA 2KJWA 3FSXA 5KFBA 4XUSA 3BSNA 2WTUA 5JMNA 2GQCA 5A2QY 2W55A 3G8SA 1IBMF 3HULA 3US5A 3N7RC 3AFGA 2V4QA 1RWPB 5BN9A 1S5ZA 1S6UA 1UJ4A 2UXBF 5DS7A 5ETQA 2KP7A 1FW6A 1NBWA 4I2BA 5AICA 1RHQB 4OLAA 4K4VA 3AT1B 2HVIA 3D2FA 3GU0A 1CXQA 2RLTA 4LREA 3LGMA 3MMAA 3OFHA 2ZZNA 5J0YA 1Q7YT 2IBOA 3AA4A 2QWQA 4O3SA 3LPTA 1UCNA 3DM2A 4Z6DA 4R65A 1FJGF 1IR1A 3VF4A 2UV8G 2W9CA 4X4VA 1U8WA 3CEDA 2E20A 3R7NB 3LA0A 3MMJA 1X6IA 2YH0A 3QEAZ 2C2EA 4KB1A 2UUCF 1CXUA 4YMNA 1N8RT 2OTLS 3G6ES 2K1RA 2ZKTA 2FJVA 1DTTB 3VZIA 2MYFA 4CEBA 2H48B 4H5NA 1UP1A 4F04B 1KFTA 1F3FA 4QU7A 3VGKA 4MMOA 8AT1B 4C4WA 4ECQA 1RLCL 4BXOA 3PX6A 3FCWA 2ZIWB 1HLUA 4E7KA 5AI9A 2CPDA 1XC9A 4OKEA 3M2RB 4HYKA 2GQQA 1QQCA 2LXIA 3AVFA 1A77A 3CXCM 1BPZA 5FIIA 4BDYA 4BRAA 4FYDA 1RWNB 1J2VA 1QQMA 3C1YA 1H72C