2HHQA

O6-methyl-guanine:t pair in the polymerase-10 basepair position
Total Genus 217
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
217
sequence length
580
structure length
580
Chain Sequence
b'KKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*CP*AP*TP*(6OG)P*CP*GP*AP*GP*TP*CP*AP*GP*G)-3'
publication title The structural basis for the mutagenicity of O6-methyl-guanine lesions.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 217
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2006-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2hhqA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 2hhqA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hhqA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2hhqA01
1HNIA 3O3GA 1B22A 1J5OA 4QOZB 4UB4A 1GOCA 3PX6A 3AU6A 4CJ5A 3IRXA 3RJHA 1XO1A 1FXXA 1U47A 5KRSA 4IFVA 3QERA 1KFDA 2OPPA 1XU4A 2DFLA 2OPQA 4KB0A 3MEDA 3LP2A 4F3TA 3QEVA 3ZSVA 4Q8FA 4LSLA 4YN4A 1BI4A 4IFYA 3ZDBA 3ZT3A 3HW8A 4FZYA 4L8RB 1X9SA 1N48A 3LZIA 4E7IA 4J9LA 4IQWA 2HHUA 3ISDA 1B92A 1ITGA 1JL2A 4EEYA 4J2BA 3QEAZ 4IRDA 3SUQA 1EETA 3RBDA 3SI6A 2VG5A 4KLOA 3HX0A 5HBMA 7ICKA 4I28A 4Z4CA 5CJ7A 2ISPA 3OS1A 4QZHA 4RU9A 1CXUA 4Z4IA 3VA3A 2ZUBA 1QQCA 3NGZA 4F3OA 4CEOA 1KVAA 2B21A 3PNCA 8ICJA 3LZJA 2PY5A 2FMSA 1X1PA 2EX3A 3O4QA 4RZRA 3T5HA 3NH2A 4J9QA 1Y97A 5K14A 2BE2A 4J9MA 8ICIA 4RW6A 3KTQA 2ZTDA 1Q9XA 3GIKA 4PQUA 5DGBA 1ZYQA 4ICLA 4BXOA 4KHUA 4CJLA 4I2GA 3OYJA 4KLDA 3MFIA 9ICNA 4ELVA 3QESA 3ZD9A 1MQ2A 4CJSA 2MUTB 4UB5A 1XWLA 1S0OA 4ZH4A 1BPYA 2XCAA 5CYMA 3NCIA 5HNKA 3KD5E 2BGWA 4M04A 4MEXA 3NF6A 1S77D 4YD2A 2PFNA 1ZQOA 5IIOA 5KFQA 5J29A 1A76A 2VA3A 4J2AA 3PO4A 3EPGA 5C42A 4KLFA 1K1QA 3QEBZ 3PO5A 1BQMA 1D9DA 8ICZA 4OJRA 1ZQWA 3JPRA 3KHLA 1ZQCA 3ZT4A 3ZSZA 1J54A 1XS9D 1TK8A 5L1KA 4RPZA 1RT2A 4CIFA 3HP9A 4WE1A 4M3UA 4AHUA 4CEQA 3SUNA 3O3FA 4UB1A 2EHGA 3PW2A 3L2UA 4EZ6A 3HSTB 3OY9A 5DMRA 3AU2A 3JPPA 3AVLA 1D5AA 4R8UB 3V81A 1A5VA 4E1MA 1A5XA 3ISNC 2UVUA 1RYSA 3ZT2A 4CGJA 3Q8MA 2BHNA 4NLZA 2OWOA 4DTMA 3EWAA 4OKJA 4M3XA 4KHNA 4O5KA 4QZAA 4DOCA 4OVLA 2I1QA 4DU1A 3CM6A 1NJXA 3MBYA 3AA5X 5KFIA 4GXJA 2G8UA 4P4PA 3VQ7A 1HYSA 4TUQA 1NK6A 9ICLA 1J9AA 5L1LA 5SZTA 2MUTA 1ZQYA 5KFFA 2DFEA 3BQTA 3V7JA 1JLAA 4FBTA 5KFRA 4ID1A 3G6YA 3LDSA 4FJ8A 1Q8IA 1JKHA 5HP4A 5DBCA 4KLQA 3BDPA 3NGYA 4FM1A 1U9LA 5D49A 4IQUA 3VQ9A 3V9WA 4FVMA 2F1HA 3KLHA 1A77A 4EYIB 1GOAA 3TARA 4KB1A 5J2MA 4QZDA 4YMMA 4M9HA 9ICUA 5KFBA 3QLHA 4FJGA 4YFKA 3QIOA 2IAJA 3ZDCA 3Q8QB 3N97B 3TWHA 1ZBFA 3H4DA 3LWMA 4ED2A 4KTWA 3CFRA 4CHPA 2HVIA 3DLKA 5J0SA 1ASVA 3DYAA 2G8IA 4FK0A 1LWCA 9ICVA 2YKMA 3HL8A 5J2KA 4DTJA 3MAQA 1J53A 3I0RA 4M0AA 1I39A 4CESA 1XSLA 1WAJA 1EXNA 1UA1A 1ZQAA 4GMJB 2FBXA 4DU3A 3TANA 5KFZA 3LP1A 4M3TA 4K8ZA 1MQ3A 4KLTA 1BL3A 4KLEA 2E6LA 3UQ2A 3AVGA 1KCFA 3SV4A 4I2HA 3HPHA 1BQNA 1W0HA 1Z3EB 4OGEA 3ZSXA 2OZMA 1VSMA 1FKPA 3TFRA 1NK9A 5DGAA 2R7YA 9ICKA 4E19A 1RT4A 1L3TA 1ZBHA 3V9XA 4PGXA 3UIQA 4Z6CA 4O3PA 2HHTA 4CJTA 5DB8A 4KMUA 4I7FA 1HJRA 4DFJA 5KFUA 2C2EA 4P4MA 3F9KA 2HHWA 1SKWA 2BPFA 3WNEA 3O3HA 4DTXA 3QEXA 3L2QA 4HTUA 1VSEA 1ZJNA 9ICXA 4BE1A 4EYHB 3RMBA 3AVCA 5DKWA 2VG7A 3QEWA 4K8XA 2O4IA 8ICRA 1RXVA 4CFDA 3LAMA 3PV8A 4RT3A 4KRFA 4R66A 4ECQA 1RXWA 1S1XA 3SPYA 2OPSA 3P5JA 1IH7A 2C2RA 4M2YA 3VQ6A 4PH5A 3NDKA 3C1ZA 2XY5A 3PW0A 5DDMA 4IR1A 4RQ7A 5DG9A 4FJLA 4B8AB 2P6UA 4GVMA 4J9KA 4RG8A 2P51A 3GDXA 4W5RA 2X74A 4Z4HA 1NOYA 2FPLA 1U04A 2P66A 4E3SA 1NKBA 1ZQQA 1B9DA 4E7LA 1CLQA 3HPOA 2ZD1A 3ZSWA 1BPDA 2ZTCA 8ICKA 4H4OA 2FLLA 2VWJA 2PI4A 1VSHA 2Q3SA 3RMCA 4CFBA 5J2BA 5JS2A 4PHAA 5CP2A 3EZ5A 8ICGA 4I2IA 3B6OA 5KFOA 2PZSA 1WAFA 1COOA 5KFLA 4KHSA 3KLGA 3UXPA 4CJFA 3KD1E 3H7IA 1ZQHA 4F4WA 4KAZA 4KKOA 3DLGA 4DQPA 4CJKA 3GIJA 1ZBUA 1IKYA 3CYMA 8ICVA 1ZQNA 3LK9A 4BACA 3ZT1A 4W5NA 1VRTA 3QEIA 3SYZA 3QNOA 1RTDA 1DTQA 4F50A 2W9CB 5F9LA 3JSMA 2ASDA 1TV9A 5HROA 1MC8A 4RQ2A 1NK5A 2PYJA 8ICWA 3RAQA 4FYDA 4NLGA 3TI0A 4FM2A 4UAZA 4YP3A 4QZIA 3F73A 5J2FA 4DFPA 3RTVA 4CK3A 5J0PA 2Z1HA 4ECXA 3AUOA 2RPIA 5HHHA 4PHPA 4YXJA 4QWBA 2W8KA 1Z00A 2KFZA 4O5CA 2NRZA 4CF2A 4O44A 1YTAA 1EP4A 3K75D 1H38A 3RMDA 4H8KA 3K57A 5KG5A 4CEAA 8ICOA 3K5OA 4FJNA 4QZBA 4Q45A 3KJVA 4RNMA 1QS4A 4E0DA 4RQ6A 1S9GA 4ZTJA 5J0TA 3AO3A 4CGHA 2IHNA 4F93B 1X9WA 1L3VA 4CJ3A 4LVSA 3H4BA 2KZMA 3NHGA 3MXMA 4Z4FA 4J9NA 1BPZA 4KLUA 3B0YA 2O4GA 4O3SA 1ZBLA 3GILA 1AROP 4FS1A 4FLWA 4AHVA 1VK0A 1TL3A 4FK4A 3HVRA 1VSJA 4M45A 3VQ4A 1RCHA 2AJQA 3OYLA 1BGXT 1HRHA 4OGCA 5TZVA 3K2PA 3T3FA 1C0TA 1QSLA 3IM1A 3C23A 2D0AA 2XY6A 5EWFA 9ICGA 1U48A 4CGDA 3ZSRA 3ZDEA 3PY8A 1RT6A 4UBBA 4CJVA 4DQQA 1ZQDA 8ICMA 4C8MA 3AVMA 4YD1A 1JLGA 5J2AA 4BWMA 5CY4A 4CEZA 4DTSA 1HYZA 4PHDA 5I3UA 1LWEA 3IHQB 1RDAA 4NM1A 2W9CA 3NF8A 1WSIA 2HNZA 4M9NA 1JLQA 3DRPA 3MEEA 3OYDA 4IRKA 5DB7A 4F5RA 4FJIA 2IMWP 4DEZA 1C1BA 2DY4A 4CERA 4KLLA 2V4RA 5KFVA 1JMSA 4OLBA 4W5TA 3TR8A 1Z26A 5FRNA 3PX0A 2OYQA 4NLKA 1TVAA 3HXMA 4QZEA 3AO2A 3RAXA 2QKBA 2VANA 3PX4A 3CG7A 2HW3A 1FKOA 3MFHA 4FJHA 4DTPA 4CFAA 2V9WA 1T8EA 3I0SA 5IIMA 3T1AA 3JPNA 5KFXA 3NE6A 7ICNA 3TFSA 3UQ0A 9ICMA 1CZ9A 7ICEA 3MGHA 1EKEA 4PWDA 7ICPA 5EWGA 3VQPA 1TKDA 3PMLA 3CFOA 5KFHA 4E89A 1T4GA 3L3VA 1ZETA 2YNHA 3HT3A 1HYVA 4YCXA 4DS5A 2X78A 4JV2A 3ISBA 3QINA 3B6PA 4F8RA 5J1EA 3RB0A 4MQ3A 3SPZA 4RQ8A 2Y1IA 2KTQA 3NGDA 2DFFA 5HRRA 5KG2A 1L5UA 1SV5A 3M8QA 1L3SA 4DSFA 3H40A 4GXIA 1S0MA 1SZPA 4TQSA 4DLEA 2J6SA 3MECA 3BQ2A 1NJWA 4CECA 5KT4A 5DBBA 2JGUA 3I8DA 3S3MA 3DRSA 4FO6A 1ZQUA 4GLXA 4PUOA 2A1JA 1HUOA 3OYNA 1C0UA 2BKEA 4I9LA 4M6WB 1KFSA 2PYLA 7ICHA 7ICOA 4LH4A 3RJIA 2GWSA 4FJKA 3QIPA 1UT5A 3WNHA 3SQ4A 3TAQA 4M9GA 2B4JA 4AHRA 2G8FA 3LPTA 2ZJ5A 3QZ7A 1HQUA 4DSKA 3RWUA 4KI4A 2HNYA 2JEIA 1GOBA 4KFBA 2AU0A 3O4NA 3VA0A 2ZJ8A 1RDBA 3ITHA 4W5QA 3S9HA 4DL7A 1RTIA 1N6QA 5KFJA 4M47A 4QZCA 2P5OA 2HB5A 1IKXA 4DSJA 4FCYA 4AILC 3OYKA 1KDHA 4KO0A 4TUSA 1RT7A 4CF1A 4ZHRA 1TK0A 1KVBA 4O3QA 4CIGA 4CF9A 1RBTA 3M8SA 1WSGA 4DTUA 2ALZA 3OJSA 3JPTA 1RYRA 4PY5A 4ECTA 3G0ZA 4O5EA 4KLMA 4MEYA 2NUBA 4IRCA 4CJUA 4DL2A 3MR3A 3KKRA 1S1WA 2Z1GA 3C95A 4KLSA 1S97A 4KPYA 4YG2A 3EW9A 4I2JA 3P1GA 1NOMA 2HHSA 5DQHA 4FJMA 1ASUA 4RPYA 4LY7A 4RQ0A 3AV9A 4I2EA 1S9EA 3T5JA 1IKVA 2A1RA 2D0BA 2FLPA 4JV0A 5CZ2A 4ECZA 2YNIA 3VQ8A 5KFYA 4I2BA 4MF8A 2HHXA 1RT3A 4B3OA 3U3GA 4CFCA 3Q8SB 3BJYA 4NM2A 3OYCA 5KFTA 2G8HA 3RJKA 4KN4A 1RBVA 3OGUA 1TKZA 2FBTA 7ICVA 2Y1JA 3Q8KA 3LALA 5C24A 1ZQZA 1ZQKA 1LW2A 3OYMA 5DLFA 4AHTA 1BCOA 3QO9A 1KSPA 2KW4A 1XHXA 4KHQA 3AVKA 1VSLA 3OYFA 3MR5A 3FDSA 1JN3A 3RJEA 9ICOA 4O3RA 3ZSQA 3HYFA 2AGOA 1KTQA 5CR0A 2FBVA 4BDZA 4QAGA 9ICCA 4OPJA 2XRIA 2F1JA 1S10A 2QKKA 2KZZA 4NXZA 5KT2A 2KZ3A 4ID5A 3GIMA 1ZQPA 3H08A 3JYTA 1DLOA 2F8TA 3L2WA 4AHCA 4DTRA 4O0IA 4QWDA 2PXIA 2KN7A 3TAGA 3BQ1A 3D0PA 2W9MA 4GC7A 2YHAA 3DLRA 3K59A 5KFSA 4KTZA 3KLEA 2IHMA 2J6TA 9ICSA 4DQSA 2H5XA 4FLZA 4FLYA 3C2KA 4M3WA 3T5KA 4RQ5A 4R5PA 4HUGA 3TAEA 4DWIA 4Q44A 4R8UA 4DU4A 3WNGA 4CJQA 3TAMA 1ZQRA 8ICFA 4FLVA 4I2DA 4YQWA 3ZD8A 5IIKA 4DMNA 2IGIA 1YVUA 3AVNA 4CJEA 4JLHA 5KFWA 4MFBA 4DG1A 3VQEA 2R8GA 7ICUA 5J2PA 1B9FA 3HM9A 1MSWD 2PFPA 4BE0A 4M3YA 1S76D 1KLNA 2XCPA 3ZSOA 5J2IA 3C5GA 1KFTA 5KT6A 2R8IA 3VQCA 4QZGA 3U3YA 4ECRA 3RH6A 4DFMA 5F9NA 3PVXA 7ICQA 1LWFA 1NOZA 3AVAA 3LANA 2DPIA 3K5MA 3V6KA 5D46A 3E01A 3NF9A 1FK9A 4W5OA 1WSFA 5CZ1A 1DTTA 1C6VA 3RJJA 2D5RA 1IXRA 3ALYA 5T7BA 5HHIA 4F5NA 1A5WA 3Q8PB 4E7JA 1W9HA 3SNNA 2OPRA 1WCLA 3AA4A 4N41A 1BPEA 3AA3A 3Q8RB 5HMMA 3V72A 3RB6A 3HJFA 3DLBA 1Z25A 1TV6A 4M3RA 3A2FA 4R63A 2BDPA 3DI6A 4CHNA 3FYHA 4PGYA 4G3IA 1RT5A 9ICWA 4O9MA 3OVNA 5L1JA 1BPXA 3AVFA 4R65A 2B6AA 4OPKA 4UQGA 2JEJA 3HWTA 3DLHA 1XSPA 1ZQXA 1K6YA 4CHOA 2VWKA 2UVRA 3C2MA 4XA5A 1ZQEA 2I9GA 8ICNA 1S1VA 3JPOA 5D4BA 4RQ1A 3MXIA 3KKSA 1TK5A 4Y1DA 3AVBA 4N5SA 5IILA 4YR2A 5CYQA 4CEEA 1QE1A 5KG3A 3QE9Y 3K58A 2YNFA 4YFUA 3RRHA 4RUCA 4CJ4A 4PPXA 1ZQSA 2W9BB 2E6MA 2GV9A 1DOQA 4AHSA 1NK0A 8ICAA 7ICFA 5J0RA 4TUPA 1NKCA 2BCVA 3SUPA 4CHQA 4F92B 2J6UA 3GV8B 5IIJA 2W8LA 3KHRA 3Q8LA 3B0XA 7ICSA 3QEPA 3M8RA 1IM4A 3M9MB 8ICUA 4XRHA 4Q43A 4Z0UA 3UXNA 1LB2B 4FLTA 4YR3A 4DF4A 5KG1A 1VRUA 4ZTFA 9ICIA 1XC9A 1KEJA 3OS2A 2R8KA 1RBRA 3IS9A 3H8JA 4EZ9A 3FFIA 4Q0BA 4JS5A 2ZUCA 5J2JA 2XO7A 4ECYA 4YNQA 1Y88A 4FJXA 1WCNA 4B9VA 9ICFA 7ICIA 1RBUA 4I2CA 1WLJA 1BIUA 3AVIA 4EP4A 3SQ0A 5KFAA 4CEDA 3C1YA 4FZXC 4B9UA 4HHTA 4NCBA 1HUZA 1QHTA 5HLFA 1LV5A 5DDYA 7ICLA 5DK5A 3SUOA 2MAXA 1TFRA 4KN7A 5J2DA 5KFPA 4DL5A 1T7PA 4F2RA 1XSNA 2BQRA 1LAVA 4MFFA 1I3AA 2NRWA 4I2PA 1EX4A 5FRMA 3EYZA 4EBDA 3DOLA 4R64A 2RN2A 3CM5A 1F21A 2W9AA 4CE9A 2XGQA 2UVVA 1NJYA 2G8KA 1X2IA 3PMNA 4X5VA 1XI1A 1TAQA 8ICTA 5SWMA 1IKWA 4QCLA 2Z1JA 3GQCA 5C5JA 2RDJA 2RDIA 1C7YA 1TL1A 4B08A 1RBSA 4JWNA 2R8JA 2HNDA 4DQIA 4PHEA 3TAFA 4JS4A 1C0MA 1U49A 4BDYA 1S9FA 2JEGA 4OKEA 2C2DA 5FROA 2GUIA 3S3NA 4ED6A 1RDDA 1BI4B 3OS0A 1U4BA 4IQTA 4QZFA 5DBAA 4DL6A 8ICLA 3UXOA 2Z1IA 4CJRA 1YTUA 3ZT0A 4GC6A 3LP0A 3G6VA 3M9OB 1VSKA 2BPGA 4XUSA 5DB6A 4CEBA 1NKEA 5BOMA 3S3OA 1JXBA 1JXEA 3RH5A 3PR4A 3OYEA 3M8PA 1RT1A 3PW4A 1QTMA 2W42A 5L1IA 4CJWA 5KGWA 3QNNA 2AQ4A 9ICHA 5DQGA 3KHGA 4CJPA 3PW5A 4KHWA 3MDCA 3AO1A 4RUAA 9ICTA 5KG0A 4UBCA 2ASJA 1BHLA 4F4KA 3NH0A 3VN5A 8ICHA 4FK2A 3V9SA 4Z6FA 1R0AA 3OYIA 4Y1CA 4DTNA 4EBCA 4C8LA 2YHBA 2ASLA 4Q5VA 2AGQA 4RT2A 4M3ZA 1WSJA 1CXQA 1UOCA 3VQDA 5CWRA 4J9SA 1X9MA 1WNSA 5J0QA 2XY7A 4N47A 4FBUA 3CFPA 4BXOB 2QK9A 2DPJA 3BGRA 3AVHA 2FPMA 2PFQA 5J0WA 1VSFA 3ISCA 4Z4EA 4E7HA 5BPCA 5DLGA 3OYGA 3RB3A 2IOCA 3ZDAA 4IDKA 4F91B 2D0CA 4FW1A 5J2GA 4ED1A 4Q8EA 3C6UA 3NGIA 3IAYA 1HJPA 3D45A 4BDPA 4C8NA 3LDAA 5BOLA 1HMVA 4JK1A 2ZQBA 3V7LA 4JUZA 3PUFA 4FZZA 4DO9A 3SQ2A 2M9NA 2HHQA 3GV7B 4IR9A 3MDAA 1YT3A 4FLXA 2BCSA 3KLIA 1WN7A 3MXJA 4TSXA 1LAWA 2FMPA 4F5OA 1ZQMA 3L8BA 4HUEA 5D3GA 1IG9A 1BPBA 7ICTA 3NFAA 1B43A 1T3NA 2FMQA 3NBPA 3G6XA 4FJ5A 5CB1A 1CEZA 1SKRA 2V4QA 2LSNA 1NK4A 5DQIA 3MR6A 1ZQIA 3H8SA 4KITB 4FM0A 1T05A 1S0NA 3V6DA 3MR2A 4J9OA 4F4XA 4JRPA 2OA8A 4KREA 1C1AA 3V1QA 3V9UA 3T19A 1JIHA 2YNGA 4DOBA 4NLNA 3JPSA 1NJZA 5DG8A 4KLIA 3HK2A 3NTUA 1RPLA 2Q0ZX 5EU7A 2C28A 2NRXA 2AQ0A 4C8OA 2BQUA 2ZUDA 5L9XA 5JUMA 3LWLA 5IINA 8ICBA 3LPUA 1ZQLA 1ZJMA 4IG0A 4RW9A 1QSSA 4N76A 3HO1A 1LW0A 4K4HA 4J2EA 4RNOA 1UA0A 4YMNA 3KIOA 3VQAA 5HRPA 4NCGA 4UB3A 4FXDA 3OYBA 9ICRA 2RF2A 4CCHA 3ZSYA 3TABA 3KHHA 2FPKA 2BANA 1T03A 4RPXA 4ED7A 4B9MA 3ZDDA 1HQEA 2ISOA 2WTFA 1S1UA 3KK3A 5KTQA 4GXKA 4KHYA 4M6WA 4K4GA 5J0YA 4I2AA 4DQRA 3RR7A 1CUKA 1JLBA 4KTQA 2FBYA 4CHZA 2BQ3A 3K4GA 4ED3A 4LZGA 1N56A 3OJUA 5CA7A 3C5FA 4JWMA 3K5NA 5J2NA 3CQ8A 2BCUA 1HNVA 8ICSA 1RZTA 2IS3A 4B9SA 4UB2A 1N5YA 4K4IA 4J2DA 3EY1A 5KT7A 2OZSA 4I9QA 2DFHA 4B9LA 1RTHA 4HUFA 3ETLA 4CGIA 3SJJA 5HMLA 8ICYA 3ASMA 1BVSA 4DF8A 1S0VA 1NK8A 2XY8A 4HVJA 4FS2A 2ZTEA 3DM2A 3AVJA 4B8CA 5C25A 4YXMA 2UVWA 8ICQA 3L2RA 4GW6A 7ICGA 4KV8A 2E4LA 3V1OA 2X6NA 3BQ0A 4DOAA 4F5QA 1UT8A 3MEGA 3SV3A 2AGPA 4ED0A 1RILA 2JEFA 5KI6A 2LYHA 1QSYA 4O4GA 1RDCA 1K1SA 2BGGA 4YVZA 3MGIA 1U45A 2QXFA 3HPGA 3GIIA 3OYHA 2WOMA 5KFMA 4O3OA 4TQRA 4ED8A 4IQVA 4NCAA 3RJFA 2XGPA 3OSPA 1ZQTA 8ICXA 2F8SA 5J0XA 3HVTA 3JPQA 4N56A 1D9FA 4HYKA 2ZJAA 3WNFA 4E7KA 3KK2A 3TQ1A 2HMIA 1JX4A 4F5PA 4NY8A 3AO4A 3KLFA 3V1RA 4F4YA 2YKNA 2G8WA 4QZ8A 4KI6A 4ECWA 1PZNA 1ZBIA 5KG4A 4IBNA 1JLCA 2FC0A 4KLGA 4HCCA 5KG7A 4ELUA 1JLFA 5KFNA 4I29A 2DTUA 5J2EA 5IIIA 3RRGA 1V9PA 4KLJA 2A1SA 4M9LA 8ICCA 3GV5B 4LSNA 2ATQA 7ICRA 3DMJA 3SCXA 4RQ3A 4O55A 1BISA 3DOKA 4DS4A 4DL3A 1JXLA 4Z6DA 3DLEA 4DL4A 4XIUA 3NH1A 3AO5A 3EPIA 1SL2A 4CGFA 2IA6A 1TKXA 9ICJA 1TGOA 3QETA 3THVA 4CIEA 5J2QA 2F96A 3LP3A 2NRTA 1S5JA 4MF2A 1KLMA 1UAXA 2BPCA 4J9PA 3C21A 3V9ZA 7ICMA 3PW7A 4H4MA 4EP5A 2JZBB 3U6FA 3VQBA 9ICEA 3RMAA 4M41A 4NYFA 3GFKB 5KFGA 2YV0X 1ASWA 1TVRA 2XHBA 3L3UA 4O3NA 4M9JA 3C94A 4RQ4A 4MFAA 4FJ9A 2JLEA 3QZ8A 2X6SA 1BIZA 4FJ7A 4CHYA 2BCRA 4I27A 5KFDA 4IKFA 3V7KA 2C22A 1Z00B 3VQ5A 2RKIA 4ECSA 4AH9A 5KG6A 3RR8A 1BCMA 4G1QA 3RB4A 2VA2A 3UPQA 3SQ1A 5FDLA 4I2FA 4LD0A 2BR0A 4ECVA 3RBEA 1S6PA 3V6HA 4LH5A 5KRTA 4B9TA 5HRSA 4ELTA 1HPZA 1SUQA 3PR5B 4F4ZA 5EWEA 3C2LA 5HP1A 1WSHA 1ZQGA 4B9NA 4RW8A 4QZ9A 4QWCA 4OKKA 3N4MB 1XHZA 5E41A 5J0UA 2IC3A 2P6RA 1G15A 4IG3A 4O0JA 3IG1A 1JLEA 4M42A 4XQ8A 3MABA 9ICAA 1UWBA 1REVA 2B5JA 1VSIA 1KRPA 4OLAA 2P1JA 3ZCMA 4CF8A 4PGQA 3ULDA 3OHAA 1JL1A 3L2VA 2HHVA 4C8KA 4DSLA 1MU2A 8ICPA 4QWAA 1VSDA 1SKSA 1O1WA 3KK1A 4CF0A 3H8WA 3LAKA 4F2SA 3DRRA 2JZBA 1ZQFA 4BWJA 4CK2A 9ICQA 2IDOA 4BE2A 4HCBA 3T5LA 3RH4A 2ITGA 7ICJA 2VG6A 1L3UA 2F1IA 5KFKA 4Z6EA 4PA1A 3NAEA 5KGXA 1ZQVA 3VQQA 4TURA 5KT5A 2WONA 4KLHA 3OHBA 1CZBA 3OYAA 4EBEA 4UAYA 1Q9YA 4O5BA 2VA8A 2KQ2A 2FLNA 2R8HA 5J2CA 1C1CA 3NF7A 1ZQBA 4FLUA 4YR0A 5KFCA 3HP6A 4FJJA 5KFEA 5I42A 4LZDA 2ATLA 2PI5A 4JV1A 2W9BA 4E1NA 5KT3A 3SI8A 4RW4A 1QLNA 1D8LA 1TKTA 5CHGA 2PFOA 3V6JA 2HVHA 4UAWA 4BGDA 1DGSA 1KVCA 4MFCA 3OSNA 4Z4GA 2I5JA 3V4IA 3TAPA 2IBKA 1TAUA 5J2HA 4FW2A 4DFKA 1NK7A 1D8YA 2G8VA 2ETJA 3RJGA 2NRVA 3AA2A 2XC9A 5J0OA 1S6QA 4DSIA 5JS1A 4DSEA 1IO2A 4DTOA 2KFNA 3ORYA 9ICPA 4YMOA 4I2QA 1SL0A 9ICBA 3G10A 3P83D 4JRQA 4QWEA 2P5GA 5DG7A 2ZE2A 4CEFA 4CGGA 5HRNA 2A1JB 3SZ2A 1WSEA 3M9NB 8ICEA 1SL1A 4QW9A 4RNNA 1ZQJA 2GBZA 3E2EA 3C6TA 5EOZA 4DLGA 4ECUA 4P2HA 4CK1A 3K5LA 1EXQA 1RNHA 1RTJA 1S1TA 4RW7A 5DB9A 4QW8A 4P4OA 4J9RA 4NYNA 2BCQA
chains in the Genus database with same CATH superfamily
4HEA9 4Y2XA 4EENA 3ITHB 1F0XA 2GEMA 1QQ6A 2Y8WA 3R6GB 2ZIWA 1FXXA 3LPYA 1U47A 5KRSA 3A1YG 2GOLA 1H7XA 5BRFA 4YOXA 2R2UA 3D4JA 4NL9A 5HJYA 3QEVA 2P9UB 1LCUA 3OPXA 4X65J 1BI4A 1WBBA 2BJ3A 1YKWA 3KVGA 2XHCA 3HW8A 4FZYA 3OL6A 4DV2F 2I6WA 2LHTA 3CC2S 3VAHA 1B92A 5C42B 1JL2A 4JKHA 1WSRA 2UXDF 1REGX 2A6AA 2ZDOA 2WF5A 2HRUA 4A8QA 3ZYYX 3H2VE 3H5YA 1Z1VA 2H1YA 4NA3A 2HOIA 3ZX0A 4WE1B 2GV1A 5HJXA 5CJ7A 4RU9A 1CXUA 1ZM4A 2RNEA 2KM8C 3TEHB 4H0TB 4F3OA 2LQBA 4B3OB 2CJXB 1KVAA 3SDEA 1RDRA 8ICJA 2JC0A 2PY5A 2FMSA 1QVFM 4OI4A 5B66U 1UVNA 4EEKA 4RZRA 3T5HA 2HLTA 5IWAF 3O9QA 4LF7K 3G8SA 4YHHJ 5K14A 4J9MA 2OGUA 2YTUA 2ZTDA 2E5IA 2MYFA 1VQKS 4BXOA 5CCLA 4CJLA 3MFIA 2P9IB 3LUYA 4JI7F 2EG1A 4H4KA 2VFUA 3QO9B 4PKIA 1N33K 2DNQA 2GQCA 4JKGA 1OY6A 2XZWA 3MURP 2L9DA 4AL6A 1RP5A 3ED5A 3WHIA 4M04A 1ROFA 1VQ8S 2HSEB 5J29A 1AZSB 4LF9K 2VA3A 2FYXA 3PO4A 3H45C 5C42A 1HBMB 3T6JA 3AM9A 1RHQB 1VQ9N 1K1QA 4TNOA 3PO5A 2D0PA 4OJRA 2DH8A 5KOWA 2FC8A 3I4HX 1TK8A 4RPZA 4CIFA 3HP9A 4WE1A 1YZ7A 4KHPF 3AAQA 4AHUA 1NGGA 2XYGB 2W1BA 4A2AA 2FHKA 3SUNA 1X5TA 5AI4A 2QLXA 4BY9C 5AQHA 1T3OA 5AM4A 1S8OA 1Z2ZA 4CDIA 5DMRA 4I6MA 2LVWA 3AVLA 3PCOB 2KH9A 3DXMB 4ZVQB 1SH3A 4E1MA 4Y2VA 1A5XA 1RYSA 2MKSA 4CGJA 3Q8MA 4W90B 4DTMA 1JXVA 1PYOB 4LRAA 4A8OA 3BBFA 4DOCA 3OTOJ 2QWPA 3GU0A 2CGJA 3DOMA 3W8GA 4NZ7A 4P4PA 3VQ7A 4TUQA 1NK6A 4EHUA 3EGZA 4NV0A 5L1LA 1U1RA 1ZQYA 3PEHA 3BQTA 3ZXWA 1RBOB 1J2MA 5B0FA 1QAXA 3V7JA 1V6HA 3G6YA 3OV7A 3QJPA 3IP0A 4C11A 4UY85 1A7GE 4YY3K 1S48A 1PILA 1EWQA 5D49A 2RS8A 2XZTB 2IYGA 5LMUK 2P9NB 1AZSA 2E7XA 5FLXY 3KLHA 2ZGZA 3TUIC 4KB1A 4OZLA 9ICUA 2HAIA 5KFBA 1P7DA 3QLHA 5CYJA 3KYLA 4B1UB 3QIOA 2IAJA 3THWB 3GYGA 3CD6S 3I9ZA 3MUVP 2HYIB 4LIRA 3LDOA 4P75A 3OTEA 1WKJA 1OKJA 4OJ6A 2HVIA 3LGNA 3CD7A 2XS2A 1ASVA 3DYAA 3ZTSA 3OFEA 4P0PB 4FK0A 1Q82O 5M1QA 4ZCKA 4DV7J 4FPBA 3SSSA 4HHJA 2OPSB 3I0RA 4M0AA 1I39A 4CESA 1H6KX 2VDHA 4FZVA 3N79A 5GTIU 2EI5A 5G4DA 4EUVA 2QL5B 2E2QA 5G0RB 3TANA 5KFZA 1S1VB 2O8FB 2EFGA 1BL3A 2E6LA 3UQ2A 1J5EK 4AYBD 3AVGA 2IVYA 1NCLA 1W0HA 4ZVFA 1Z3EB 3JTNA 1H2VZ 4BRCA 1VSMA 2W4CA 4NL9C 3CWJA 4LF8F 1FKPA 4ILRA 3TFRA 4QOTA 5DGAA 1Q8LA 3U9ZA 3G25A 3VQSA 1FFVA 3O80A 2R7YA 1SC4B 2YNFB 9ICKA 1HKCA 2DGWA 3F44A 3AQFA 5ALYA 4E19A 2GLEA 4OPHA 3ALRA 2RMLA 4KJIA 2RH3A 5ALKA 3M4XA 3QU5A 4JOUA 4AM6A 3MR7A 1WUUA 4HTIA 3MN5A 4BRNA 1SKWA 2H51B 3WNEA 2UUAK 4Y2YA 1HNWJ 3O3HA 4X65F 4C8YA 3C2PA 1B0TA 5HROB 4OMFG 1DQ8A 2Q43A 4OLOA 3N0VA 4WKYA 5TKWA 9ICXA 4J37A 4BE1A 3IS9B 2WVBA 4XPCA 3RMBA 3MTJA 1YBUA 5DKWA 2O8EA 2HLUA 1LOUA 5DM6Q 1CC7A 4BROA 4CW7B 3PIPL 2X1FA 4P0PA 1HWIA 4O44B 5K8NA 4ECQA 1S1XA 3O2IA 2QJ3A 3MWPA 4BGAA 2OPSA 4JI1K 2NXNA 1N5VA 3M1VA 4RPFA 2BMBA 2CGKA 1IH7A 5HLFB 3PHEA 3VQ6A 3G82A 1EKSA 3C1ZA 2XY5A 3A0HU 3C6AA 4RQ7A 3WIVA 3WQTA 2CG4A 2P6UA 3ILOA 4J9KA 3ILIA 4IWVA 2QI2A 4D3HA 2YJFA 1OW5A 4CRJA 1HARA 4Z4HA 4H4KC 2UU9J 2GIQA 1WDTA 4E3SA 1CLQA 4YHHF 4WFZA 8ICKA 2VWJA 3MUMP 1ATRA 3RMCA 5JS2A 5CP2A 3NY0A 2OSQA 2YKPA 4WJ3B 1R89A 2FJEB 1COOA 4KHSA 1X8DA 3THTA 4CJFA 4JI8J 3CYMA 2UUBJ 3QUBA 2AEJA 3FE1A 2HQGA 3SYZA 1LWEB 1OUQA 2GWJA 3M8YA 5F9LA 4X66J 3IDHA 1WYGA 5HROA 4RQ2A 1NK5A 3RAQA 3DRPB 4NLGA 3CO9A 1FERA 4QZVB 1NO8A 1NH7A 3O6WA 5J0PA 5AKIA 3S41A 4NLWA 3MCOA 4ECXA 3AUOA 2RPIA 3U1NA 2CYYA 5D4PA 3PIOL 1X31C 4YXJA 2CAJA 2XSJA 2AX0A 2W8KA 4OYIA 3HHLC 4H5NA 3A8YA 1V3SA 4O44A 5GADU 4FF2A 1DRZA 2ZUAA 4CLTA 3H6EA 3K57A 4RUHA 5ETMA 1K8KB 2CN1A 4WFYA 4FJNA 3MMVA 4ED4A 1RWNB 3KJVA 2POKA 2I9SA 3GFHA 4RQ6A 2P9CA 1NB7A 4A62A 4CGHA 2IHNA 2OHFA 4DPYA 3QBCA 1FKOB 2VIXA 3I5CA 4N8NA 3H4BA 3BS7A 3MXMA 4J9NA 3AQEA 1UZHA 4CF5A 4O3SA 1P1TA 3OHRA 2V51B 3CPWM 4FK4A 4M45A 3VQ4A 4X4TA 2W7OA 4OGCA 3N4WA 3T3FA 2CADA 1KQSM 3M8WA 3SCJE 2JWKA 3C23A 4PQAA 2HS3A 5T41A 3OTOF 3BDEA 4CGDA 3ETMA 3PY8A 1ZBSA 4JI6J 3WXKA 3PYGA 5KPZA 4YD1A 1Z05A 2F7VA 2G5HB 3RVCA 3DWLA 1QUPA 4P2MA 4CH7A 1LWEA 2RUGA 4NM1A 2V94A 2B51A 3DRPA 5CD4A 4HWIA 4F5RA 2FVCA 1PJ5A 1K73T 4YORA 2IMWP 2AEFA 3PLAA 4DV0J 4C1NI 2W55A 3ENAA 5KFVA 4OLBA 4W5TA 1MN7A 3TR8A 4BG9A 2KHOA 4NLKA 2W04A 5AQJA 1S79A 4LQ9A 1H7WA 1K8KA 2G5IB 2XIDA 2YQ0A 3QWPA 1SS6A 2QKBA 2VANA 5FIIA 5BPMA 2KB2A 1FKOA 4YDUA 5ALQA 4LBIA 1RWOB 3NBPB 2V9WA 3I0SA 5IIMA 4DV7F 3VAGA 1N54B 3JPNA 2F4FA 4NRUA 4PEOA 2E20A 1KP6A 7ICEA 1YLXA 3MGHA 4PWDA 5EWGA 1X4CA 2J7WA 1TKDA 1WC3A 1XQIA 1EIYB 3L3VA 3QXGA 1UVLA 1ZETA 2X7IA 3CSKA 2UV8G 1VQNS 2A3VA 2OHDA 5E3AA 4PG8A 1HYVA 2DNOA 4YOEA 3VERA 5K4LA 3QINA 4BG8A 5AKHA 3SPZA 2KTQA 2DFFA 5HRRA 4OV6A 2NREA 2VU5A 3CC7N 1VK3A 1S1WB 2N3OA 2LEBA 3THYB 1CQNA 5ETQA 3UPFA 1SZPA 2J6SA 3CEDA 1NJWA 1OXJA 5KT4A 2HG4A 5DBBA 2JGUA 1HNWF 2CQ0A 2MA1A 4FO6A 3DRSA 1OH7A 1JALA 3MMAA 1D1UA 2V52B 1C0UA 1Y5IB 2Z4PA 3K17A 3SIPB 1S1UB 1L7PA 3PKMA 1KFSA 4NPOA 1M1HA 1KN5A 1F6TA 1VQMN 2GWSA 4L76A 1H73A 1LWXA 1G99A 3O4WA 2VDIA 2YXLA 4M9GA 2B4JA 4RCHA 1Q79A 4KR0B 4U7UD 3MEKA 4DUZJ 4KI4A 3CCZA 1GOBA 3D2FA 2ZJ8A 2NPFA 4JV5J 4CIOA 1NUEA 3TPQA 3E3XA 3BS9A 4OLPA 4FCYA 4DSJA 2L9NA 2E8AA 4LFBK 2RHQB 1D8BA 4ZITA 2XLKA 5SUHA 4ANCA 1O51A 1KAZA 2ZVIA 3FUYA 1MMDA 1YUWA 4ZHRA 3VQTA 3JB9k 3DM2B 3BSAA 2UU9F 4UUWA 1IBMK 3LH2S 2KSOB 2DRBA 3TOQA 1R7IA 4KV8B 1K0VA 1N34K 1GLFO 2ES6A 4F0HA 3VAIA 3G0ZA 4EU0A 4O5EA 3MEGB 1FRMA 3EZWA 4NLXA 1QQNA 3TSQA 4CJUA 3MWTA 4NLSA 3PXGa 3NP5A 4NLYA 1S1WA 5AQYA 3THYA 3PNIA 3W60A 2P35A 3L9ZA 2OFGX 3CP8A 3CW2C 4UOGA 3OFHA 4UATA 3H5XA 3P1GA 2UUBF 4Y6IA 5DQHA 4US8A 3TX0A 3MI7X 4LY7A 1SWWA 4X66F 4A48A 1BE4A 4DR2F 4FZLA 1VJ5A 3OQ2A 4BREA 4MN4C 3HFVA 4X4OA 2N7CA 2E1AA 1CJKB 1YI2S 5KFTA 1S49A 2BM1A 2EPIA 3RJKA 1LKZA 1R0BG 2E2PA 3D54A 4BUGA 2QW9A 1S22A 5LL6Z 2ZH1A 3LALA 2Z2MA 1PBUA 4EIAA 4X62F 1ZQKA 4JK8A 2GO8A 3CUNA 1BCOA 2GAGC 2GCFA 3WT0A 3TX8A 1PAUB 5AJ3K 5CHIA 4UASA 5M2PA 3HRDD 4O3RA 2VUGA 3DMJB 5C2DA 2KSOA 3JS9A 3I82A 3HYFA 3QU2A 1PUZA 2M7SA 4CNQA 1BQXA 3US5A 2GVZA 1D0EA 2C42A 2Y9HA 5GAHP 3L4PA 2KZZA 4NXZA 2VFSA 4DX5A 2KZ3A 4ID5A 4FOEA 3GIMA 1ZQPA 4UZBA 3OFGA 3JYTA 1DTTB 3L4IA 2EWHA 4JI6F 2G13A 4AHCA 4BR2A 3EDRB 4O0IA 4Y2SA 2KD1A 2PXIA 2OPRB 2Q3PA 4FVCA 4LR7A 4Y2MA 1X4FA 1YVFA 2FE9A 2W9MA 3C28A 4GC7A 1RA7A 2YHAA 4B1WB 1EO1A 3ZNJ1 1UW4A 5KFSA 4KTZA 3W2VB 4HI2A 4ANDA 4JI5K 3DI6B 9ICSA 1JCFA 4Y34A 4FLZA 4KPCA 1RT5B 1KW4A 1IBLK 2OIHA 1FDAA 1BUXA 4RQ5A 4R5PA 4AL7A 2GMLA 1WC4A 5B0BA 3DU6A 4K5RA 2K8AA 3NVWA 5DDRC 4DV0F 4YQWA 3MK6A 4DMNA 4LF6J 4LF4J 2DNPA 4CJEA 2RKIB 4E1JA 1ZPVA 2ZIUB 1SJRA 5HSPA 1B99A 5C12A 4G1QB 4MFBA 5KOXA 3KKAA 3VQEA 3MCAB 3FBEA 4HT7A 2C3YA 3LDNA 1DARA 2PFPA 3VEYA 5DDPC 4K4SA 5CYQB 2XMJA 3TR5A 4XPEA 2W3RA 3SJHA 1SUQB 4Z2XA 2R8IA 4TN2A 7ICQA 1TUYA 4PABA 2YQ1A 2NLWA 2LPEA 3IG1B 2P6SA 2JX2A 2BKOA 3O8MA 2RILA 2Y3YA 4PL7A 5EX3A 1DTTA 4L75A 2KKHA 1FRKA 4X4UA 1K9MO 3SNNA 4UT4A 2WCXA 2OPRA 5F0WA 1HBUB 1BPEA 1VJWA 2EFQA 2DB1A 3KDNA 5HMMA 3V72A 2RDDA 1Z25A 4GO5X 3MN7A 4MIAA 3UN2A 4PAAA 3W2VA 2YQEA 2BDPA 3HF5A 1NHKL 3DI6A 4GKKJ 1A9NB 1LOTB 1B7FA 4PGYA 1RT5A 2MRLA 1BPXA 2EFNA 1R8HA 2CG8A 3NGSA 2A2DA 3HWTA 1EKRA 2UV8A 1Q86O 2H54B 3PACA 5HI7A 2UVRA 3R3LA 1OJ4A 2WONB 2GHPA 1NZBA 1ZQEA 4OZNA 1RWMB 2HBKA 5BR9A 5D4BA 3DRYA 3K8WA 3KKSA 1TK5A 3OUYB 1E4FT 5IILA 3E58A 2WTUA 4OJHA 5CYQA 4M5NA 1FCAA 4DUZF 3QE9Y 3RRHA 1ZS6A 4PPXA 1ZQSA 4AHSA 4JV5F 3D6JA 3D7EO 8ICAA 5GTHU 2HNDB 4DB3A 3OR2A 1TU0B 2HURA 3I5BA 3AFGA 3L7OA 1IM4A 4KYZA 3IR5B 3NRZA 2XZDB 4Z0UA 1LB2B 4U7CA 3CD6N 2DNNA 2D3OR 1XC9A 1KEJA 3OS2A 2R8KA 1RBRA 2Z0GA 1HBUA 2MDAA 4CBXA 3MM8A 2RHKA 4FJXA 3HZEA 9ICFA 1FEZA 3MGJA 4AYBC 4IYQA 5KL1B 1HUZA 3EGNA 1QHTA 2IVMA 1PK1B 4B3RJ 4L3KA 2OTJS 4RNFA 1QH9A 2E1EA 4PZOA 3H8YA 1X4AA 2ZZTA 2RP5A 4UAUA 4DV3K 1LAVA 2NRWA 3NAHA 3OUYA 3UN3A 1RQLA 4B9QA 3CM5A 3B6BA 2XGQA 2G8KA 2WVFA 2Z1JA 5CA5A 3GQCA 2UUWA 4ZPDA 1VBZA 4NEYA 4ZP8A 2G07A 1RBSA 2KJ5A 3E0FA 5ALGA 3IRXB 2HNDA 5JLFA 1K73O 3HT0A 3R1XA 2VGNA 1P8ZA 3KD3A 5EE1A 3O9UA 3MEDB 1U49A 4IDKB 2DKXA 2BKPA 1GXUA 4IXCA 4F9OA 1B70B 2HBYB 4FNHA 1Z1ZA 4C7ZA 1U4BA 4DR7F 4P6QA 4DL6A 3H8MA 1BOTO 4CJRA 3ZT0A 4GC6A 3WK4A 4W92B 1VSKA 4NRTA 5DB6A 4BVPA 1UEKA 1X9XA 1F3VA 4OYWA 3J7YI 1XNRK 2F8MA 3UI3A 3OYEA 3BP8A 1RT1A 3OBYA 2KXNB 1QTMA 2FF6A 5L1IA 3C29A 2P9SB 5KGWA 3FM9A 5DQGA 3MDCA 1PK1A 5AXKA 3AO1A 1L7NA 1PSDA 3KKAC 5KG0A 1N63A 4BX9C 1OVYA 2YHWA 1NNLA 2OEMA 2HOEA 3SQGA 2C3OA 3V9SA 4FK2A 1VLYA 2XMAA 2VZ9A 1R8AA 3FLCO 1WKKA 2HHHJ 4EBCA 4LF6F 4BLGA 4LF4F 3UDVA 1HHTP 4Q5VA 2AGQA 4BC2A 3FMBA 4RT2A 1A0PA 1YVNA 2G08A 1UOCA 4J9SA 3IN5A 1WNSA 3MX2A 4OZ3A 1BY9A 2NYVA 2DPJA 2DNLA 2XMTA 3HHDA 1E6VA 3VEVA 2PFQA 5EHHA 1VSFA 4FXVA 3ISCA 2BKNA 2R9LA 3M2UA 4DZ6A 3NNCA 2IOCA 3M8ZA 1RA6A 4IDKA 2E1PA 2D0CA 1NM2A 2RHSB 3NGIA 1L7MA 3IAYA 4XTTA 1LW0B 2OEKA 2LMIA 2F44A 1F1BB 4DR5J 4ZVHA 5BOLA 2E8MA 5DM6L 3D2NA 5ALHA 1XMQJ 1URRA 1WUDA 1SPBP 2E5LJ 3AXKA 2R7VA 1NGIA 2ZITA 2GX8A 1OH5A 4DR3K 5A6WA 1BQMB 2CJYB 3FCHA 3J8AA 4NMXA 2BCSA 2CQPA 3MXJA 4TSXA 2MZSA 2JV3A 2P9SA 2W2PP 1IBCB 1IG9A 3F2DA 5GIOA 1NMEB 2FMQA 4ISFA 2HWIA 2V4QA 2F40A 2LXUA 1NK4A 1KAXA 1E6YA 3CQXA 5FPNA 3DLLL 3IBCB 1DT9A 2V6AA 4JRPA 2OA8A 4R25A 3V1QA 4DR1K 2FB0A 3V9UA 1EB0A 3T19A 1ZTWA 4WZMA 1JIHA 1RQ0A 2KT5A 4NLNA 3JPSA 2HFZA 5C0YA 2LQ8A 5H2FU 2FSKA 2Q0ZX 3E9OA 2C28A 4FWRA 4C8OA 5IINA 3LWLA 2FLOA 1JLAB 3GJQB 1CZAN 4IG0A 4RW9A 1KHVA 4AQYJ 2O8DB 3PKYA 2IOFA 2JLFA 4O4GB 2CXYA 1LW0A 3HO1A 4K4HA 1RXOB 1KHWA 4J2EA 2PGCA 3C0BA 1NEEA 3OYBA 3SSQA 4K4WA 3QNWB 3A3OB 4UF4A 1CBKA 4RPXA 3AJ1A 4ED7A 2K7JA 1JJCB 2WTFA 2ASOA 3R5BA 4KHYA 2OANA 3HVTB 3RR7A 1IBKJ 2XI3A 1IG8A 4C98A 4CHZA 2BQ3A 1KBRA 3OTCA 3EKUA 3K4GA 3EN9A 7FDRA 1N56A 2RVJA 1XMOJ 4CT9A 3GLJA 1VQ5S 1LWCB 3WC2A 4UB2A 4FWNA 1W2BM 4J2DA 3NS1A 4I9QA 2DFHA 1RTHA 1JLFB 3GG0A 4B3RF 2ASYA 4HUFA 3NVVA 4CGIA 3ASMA 1AA1B 2DGOA 3CCEN 3GR0A 2Q1NA 5JICA 1K47A 2QIFA 4LVOP 1NK8A 2XY8A 3AJ2A 5D4LA 5B0AA 4HVJA 4BRLA 4LSNB 3AVJA 1IM6A 1TFYA 1GK8A 5C25A 2FD2A 5C2CA 3DLEB 1AT1B 3DHWC 2R7RA 2AZ1A 2MKCA 2YH1A 4MIWA 5KI6A 2LYHA 1QSYA 4H5WA 5F8GA 4O4GA 3G9CA 4A59A 2K8BB 3HX9A 4RTFD 3GIIA 5LXYA 4ZCMA 2K8GA 1CRXA 1SC6A 2NSCA 1VOMA 1HKBA 2OP5A 1HNZJ 1FE0A 4IQVA 1YJNS 2ZJQQ 2F8HA 2PN6A 4X4QA 1WI6A 1QQMA 4JI2K 3I6PA 4LBPA 3OL7A 4M1KA 1HNXJ 3A8IA 4QIEA 4CO1A 1V85A 4P72A 3HVTA 4U96A 3JPQA 4NZ6A 1D9FA 4HKQA 2E1ZA 2VG7B 2QLTA 2BYCA 2VQFJ 2DT9A 3U9DA 4H0VB 2FXUA 3NMAA 4EAHD 2A19A 4QZ8A 1N32K 5FDLB 4ECWA 1FWKA 4PZVA 3M6UA 2FC0A 4KLGA 4ELUA 1JLFA 2CNLB 4TXSA 3QT7A 5KFNA 3PYFA 2XNQA 4USWA 1HR0K 3VOVA 4I29A 1HI0P 4JI3J 5J2EA 5IIIA 1YF5L 5IC4B 2C2KB 5HP1B 1V9PA 4KLJA 2A1SA 3N01A 3TTDA 4LSNA 2KYZA 7ICRA 1WJ9A 4O55A 2HHHF 1Q7LB 4AYBF 3VGUA 1T6DA 4Z6DA 3DLEA 2F2AB 2ZBIA 4AXJA 4XIUA 3CCVS 1KQKA 4C4TA 1REVB 1V5IB 3L95X 1XO0A 1TKXA 5GADI 4IQXA 1RACB 5EX0A 1PK3A 4FWQA 5AK6A 2FQQB 4JK7A 3C21A 4B1VA 3V9ZA 1TL4A 2JZBB 2IYIA 1XUPO 3VQBA 9ICEA 2BBEA 4DR5F 1TVRA 2CQBA 3GE1A 1YI2N 2F5GA 1W7AA 3LPEA 1QCKA 1XMQF 4DV6K 1ESVA 3QZ8A 3MX5A 4FJ7A 2E5LF 3SMZA 2MSSA 4I27A 1HIWA 4I68A 4IKFA 3KNGA 3AQPA 2C22A 3VQ5A 3NGRA 5AIAA 5KG6A 4X4PA 4GV3A 2A3ZA 3RB4A 2VA2A 3UPQA 4L73A 3BO3A 5FDLA 3F2KA 2F4VK 3PRDA 4ECVA 1S6PA 3IRWP 2EFPA 4NYOA 3L4BC 5GVQA 3V6HA 4LH5A 3EE8A 1YX2A 5E3CA 4JI0J 2EKYA 4P74A 2DNYA 3CT9A 1H74A 2OUGA 2FHMA 3FZLA 5F0UA 1RHJB 2V2KA 5HMXA 2V4JA 5HP1A 1VQOS 1ZQGA 5LM7E 1TKTB 4QZ9A 3WK7A 5CZVA 4X4VA 4DV2K 4OKKA 5J0UA 4X4RA 1S6UA 2P6RA 1G15A 2OMOA 2V8GA 4XQ8A 1GFWB 3ZZUA 2UXDK 1REVA 1KRPA 3D3CJ 4CF8A 2PEHA 3ULDA 1YRUA 1JL1A 2ADBA 1LFWA 3IWLA 5AQZA 1RT6B 1X66A 2NXJA 4NLUA 1MU2A 8ICPA 3Q83A 3QSYB 1SKSA 3WX8A 1O1WA 2IOHA 2BOPA 2DR6A 4FN5A 2RRNA 2LXFA 1NDKA 3DRRA 2DGVA 3FQKA 4P7VA 4PR6A 5GMEA 2JZBA 4AQYF 4BWJA 2LEAA 2HNZB 3O1LA 4IDHA 3T5LA 3RH4A 3VWSA 2XLIA 3VGMA 4AFFA 5KGXA 4TYAA 1RAAB 4I2QB 3AXMA 2ASPA 1R8CA 3R2DJ 5IWAK 4MLEA 2G09A 3WKBA 4R0EA 5H9EJ 3PHTA 4P71A 4EBEA 4UAYA 2EBEA 2VA8A 4DCPB 4JD2A 1IBKF 2FUG9 4NMLA 1C1CA 5ETTA 3H1VX 4ZPVR 4JP8A 1H0HB 3NCPA 1HJOA 3D0HE 3J81O 2KJ9A 4A8XA 5JJBA 4RW7B 4ACOA 1XMOF 1RAJA 1PGZA 2QMXA 4WPAA 2PI5A 2ATLA 4MH8A 3DEEA 4JV1A 2XM3A 3BO4A 2W9BA 4I6WA 1LNQA 5KT3A 3SI8A 3NGTA 1QLNA 2DJWA 3CCJS 1HWUA 5CHGA 1TKTA 1FA0A 2QEXS 3AOAA 3QT6A 4BGDA 2LQ5A 4IFVB 1KVCA 2OPPB 2JWLA 1SIZA 4IS7A 3OSNA 1DXSA 2Z8QA 4QU7A 4ZS6A 2WAQC 3BZQA 1TAUA 2M2BA 2MLYA 2CNOB 4L72B 3GU3A 3R9KA 4A47A 4TKTA 4USUA 4DCJB 2DPNA 4C0ZA 3TWZA 5BPNA 2CNNB 4KHPK 2UUCJ 2DKOB 4MAKA 5E0OA 2OEJA 2RU3A 4F0KA 3O6QA 4NLRA 5AM0A 4LR8A 4C2MA 2B4VA 2L9WA 4DTOA 4ZIVA 2VG5B 4I2QA 2N82B 9ICBA 4YN3B 2HQ3A 1HNZF 2P5GA 1IWAA 4Q2LA 3FRYA 3UE5A 5HRNA 2OTLS 3SZ2A 1HNXF 1RJJA 4JHDA 2GBZA 5EOZA 1D9AA 1QTNB 4ECUA 3K7RA 1R59O 1RNHA 2KU7A 2AJ4A 1S5LU 4RW7A 2VQFF 4FFDA 2M52A 5HANA 4L3NA 1CSJA 3T69A 2AJFE 2P6TA 1J6ZA 3P38A 2BJ1A 2VKZG 4KFBB 3PM9A 1ZD2P 1B22A 2IPOB 1J5OA 4KMOB 4UB4A 2DRDA 5K5MA 5AZJA 5F41A 4WF9Q 4JBCA 3RJHA 2Q97A 4DPXA 1XO1A 2VPWB 4IFVA 3H3NO 4IEIA 4UQTA 2OPPA 3DGPB 4M5IA 2LP4A 4JI3F 4CO4A 1JK9B 1MMLA 4WIQA 2L41A 1CJVB 1RDUA 3CTRA 4LSLA 3IGNA 4IFYA 3CJ3A 5U47A 1DEJA 4PJ0U 3ZDBA 4L8RB 1N48A 4KGXB 3K1RB 2HHUA 2WBNA 3S1TA 1SXLA 2M0GB 3SUQA 3FCVA 3VVTA 2A1AA 3RBDA 3SI6A 4ERDA 3TVYA 2VG5A 3KHYA 5LL6d 2DNHA 4KLOA 4DV1K 5C2FA 4YOYA 3WK8A 4DBQA 2OTJN 7ICKA 4Z4CA 3OS1A 4QZHA 7AT1B 4Z4IA 5BJRA 1UHUA 1S9EB 3O8WA 4FF3A 1IKVB 2VIHA 1OYDA 2LYVA 2DXFA 3RUBL 3CJ1A 3ETRA 3HRGA 5AK4A 2KYXA 3C15A 2B21A 1RAIB 3KKFA 3V81B 2QLFB 4O5FA 1XIQA 1X1PA 3F5EA 3IO1A 4J9QA 1HBOB 1Y97A 4KH5A 2BE2A 4G65A 2PA3A 1Q9XA 5DGBA 1U0SA 4ICLA 5F0XA 5C24B 1SAZA 3GSDA 2X1GA 2M8DB 4WU2A 3GDQA 2E44A 5GAEU 1LW2B 2Z2YB 2W4PA 2AYBA 1XMBA 3NVMA 4ELVA 4WXOA 4CJSA 3F56A 4UB5A 2JRZA 2VJ4A 2YB1A 2ZBCA 2XCAA 3KD5E 4WKRA 2PFNA 3TTFA 3V5RA 2KJVA 3QRRA 3WQUA 3E66A 5KFQA 2YCHA 1QAIA 4C4SA 2GGPB 2IJRA 2G2ZA 4KAIA 2BVZA 1JJ2M 4CF4A 5J2MB 1B4SA 3QEBZ 2AX1A 2KHQA 1D9DA 3RBZA 8ICZA 1GQEA 3HZ6A 3KHLA 4MKVA 4CI0B 5L1KA 4P0QB 5DZ6A 3LVVA 4M3UA 3LW5C 4FE3A 4UB1A 5IV3A 4HTJA 1AQ6A 4OI2A 1B0PA 5F8HA 4RBUA 3AU2A 2OKQA 4DZDA 3JPPA 3HJVA 1D5AA 3QFUA 4BBYA 3TAMB 3V81A 3TEGA 4YHHK 4ZCIA 3IFRA 2RRAA 1QVGR 3NWGA 4B3SJ 1HBOA 4NLZA 3T7ZA 3EWAA 4K8RA 4M3XA 3AN1A 4HACA 2RHFA 4QZAA 2I1QA 4NXMJ 3CM6A 1LVHA 1UEVA 2ZVSA 3MBYA 4LF5J 1VK8A 2R18A 5KFIA 1T3QA 2AYMA 4TVAB 5AQQA 4OHZA 2MZTA 2AD9A 1NMNA 1SCJB 2FHOB 1J9AA 5SZTA 1UETA 3CIMA 3O08A 3MD1A 5KQDA 2JFDA 2DUYA 1WOQA 3G87A 4BRPA 5B0DA 4FBTA 3LDLA 2A41A 3LDSA 2WHOA 2J5AA 4CF3A 5DBCA 2F9TA 4FM1A 2O8BA 2VPYB 1DQAA 3V9WA 2G2OA 1NU0A 4ZLJA 4ZVTB 2F1HA 2K1RB 5HQMA 4EYIB 3VGTA 3VESA 5J2MA 1D4XA 1XR6A 2M8HA 4YMMA 4M9HA 2ZH6A 4FJGA 3Q8QB 3N97B 1APSA 1NZ8A 2UYTA 2MZJA 4P0QA 2ERRA 4KTWA 4CM0A 5J0SA 1EHWA 1J27A 4P9SA 1TP7A 2KHVA 4ZDNA 1XBWA 3QGIA 9ICVA 3HL8A 3UFCX 4RLEA 1YJVA 2B6AB 1WG8A 1XSLA 1RBAA 1WAJA 1FTRA 1ZQAA 4Y0FA 3VEWA 3UCGA 2FBXA 1F9EB 4HI1A 5HMYA 3MGVA 1FNXH 4HVZA 1MQ3A 4KLTA 2V50A 3OTOK 4CE6A 2KI2A 4KLEA 5FJ4A 1BMQB 5D77A 3B78A 2P9KA 2EAPA 2QLJB 5A8RB 3C7NB 1WEYA 1NK9A 3VF6A 4NLQA 5BN8A 3VTIA 3C14B 2EC0A 3MM7B 5E3PA 3V9XA 1F5BA 4PGXA 4Y2RA 3M32B 4O3PA 2CQ3A 1XN9A 5DB8A 4Y3CA 3FEXB 4ZJLA 1HJRA 3LDPA 3VPZA 3EVMA 5KFUA 3WDOA 4GVBA 2K1RA 2A42A 3I28A 2Y9UA 2RRBA 1NM1A 1Q7YT 2L3MA 4HHHA 1WC6A 1SXEA 4B02A 2Q0UA 2HVEA 3CRXA 4QYZK 2ZBQA 3FRZA 2C2ZB 3KUEA 4UB8U 2BRLA 1FJ7A 1RXVA 3LAMA 3PV8A 4PL1A 3I4PA 2Q2RA 2WAQF 3DV9A 4DV4K 3CCLS 2N4DA 4PZNA 2B7CB 4PH5A 2GJIA 4CO5A 4X84A 4FYVB 3P96A 2EC2A 3F0NA 2FZKB 1BA1A 2X74A 4OZJA 5AI9A 2P66A 5A8RA 1NKBA 2GTDA 4MO4A 3UMCA 2E1YA 1ZQQA 4JK9A 1ZA2B 4ISEA 1BPDA 2HHPA 2ZTCA 3IXQA 2JL9A 1Q5VA 1RI7A 1M1KO 3C14A 2PSZA 3KK7A 3JSYA 8ICGA 5JVHQ 3B6OA 1QQOA 3M32A 3KD1E 3H7IA 4JEPA 2E5HA 4KAZA 4DQPA 2HBJA 3GIJA 3UKUA 4CJKA 1YJNN 1UMJA 2ESEA 1HNWK 5DZ7A 1RTDA 5AT1B 2W9CB 2HDOA 2ASDA 4C3LA 1X7VA 3JSMA 3A5LC 1MC8A 1L7OA 4FYDA 3SBGA 4ZLPA 4FM2A 4UAZA 3OXFA 1FJCA 1RAFB 4C8ZA 4CK3A 4Y0WA 2AIRB 3T1HJ 5EXWA 3DNCA 3LP0B 2CPRA 5TKYA 4M7XA 5HHHA 1VQ7S 3OW2R 1X5SA 2KMDA 2V0NA 3NS5A 4CF2A 4EO8A 1YTAA 1EP4A 1F9HA 4RQMA 3UN5A 3OPKA 8ICOA 4QZBA 2EK1A 2XSFA 2Q4TA 1WF1A 4OI1A 2HZCA 4IL6U 4WIIA 2DY9A 3CJ0A 2HGLA 2CVIA 3R2CJ 2BA9A 3SK3A 4F93B 1L3VA 3VAKA 1Q5YA 4LVSA 2FC9A 2KZMA 4KLUA 5D6GA 1ZBLA 3GILA 2J0WA 2XULA 3CMEN 4F0MA 3UO0A 1JNRB 2E8OA 1ZD3A 3WEEB 2DHGA 4KH6A 3IM1A 3EGVA 3WZ0A 4USIA 4NXMF 2XY6A 1S12A 2D3DA 4LF5F 3H0MB 4JI8K 4PWWA 2UUBK 4FYWB 3AD8C 3BSOA 2FTRA 5CY4A 3VETA 4CEZA 4DTSA 1GAOA 4B3MF 4FWLA 2R2TA 1SV5B 5I3UA 5L8RC 1RDAA 2W9CA 1FWLA 1FRIA 1M5VC 1OVQA 3DXBA 3MECB 3P45B 3SCKE 4CYUB 1ZH5A 5T7LB 4A5BA 4JI4K 2HGNA 2MLZA 2ZH3A 1I51B 1MDUB 4PG5A 5B09A 3TJAA 4O3MA 2M9KA 4KLLA 5IC6B 2K4PA 1Z26A 1RHKB 1HKGA 5FRNA 3PX0A 3K9KA 4YOTA 5AFUH 5AQUA 5BRHA 2DY1A 1ILYA 3PX4A 3CG7A 2A6MA 1VQON 2FY8A 2HNYB 4DTPA 5AKYA 2ZNYA 3W66A 5KFXA 3NE6A 1FFGB 3J81j 1GTHA 3M6GA 2JWNA 3TFSA 9ICMA 1N6QB 4K41A 3FBCA 1CZ9A 3TJ8A 8ATCB 3A8JA 1FI4A 4ZJQA 1IKXB 3PMLA 2J0SD 5GIPA 4I4BA 4NL5A 4BC3A 2MKJA 1N33J 1SKUB 4CLUA 3IM9A 2YNGB 3MUTP 4JI6K 4DS5A 4C4WA 2X78A 1FJEB 4F8RA 4ZP7A 1UAWA 3RB0A 3L3FX 2V2VA 3W61A 4EO6A 1T44A 3FCWA 1VGYA 5KG2A 4LFCJ 2I1RA 1Z4OA 4EK2A 2XHWA 1SV5A 2DGUA 3KJNB 4WYLA 3M8QA 4KBOA 5A76A 4YB1P 2DIUA 2XQCA 2MY8A 4A5AA 4ZVPB 2QA1A 4BR0A 3T1YJ 4DLEA 4UUXA 3MECA 4W98A 2F8LA 1U24A 1L8LA 2RIJA 5AZIA 1RUSA 4A8SA 4AXIA 1LXNA 4PUOA 2A1JA 4QBUA 1FFWB 4U6PA 3KK3B 2VJVA 2YNIB 5IFMA 5E3QA 4UW9A 2PYLA 3C16B 2GAHC 4YMEA 3QRQA 4B17A 1JLBB 4F67A 2E9ZA 3RJIA 4GIBA 1U6BA 4DR6J 3F2CA 3R7NB 1UT5A 5LJWA 3SQ4A 2CH6A 4OI0A 2B43A 2ZJ5A 3LQVA 1HQUA 3VENA 2HNYA 5AKGA 3CCJN 2NXUA 3BQ7A 4ZKAA 2NUUG 3L4QA 3IBPA 1R6VA 3DN9A 1Q53A 3S9HA 1RTIA 1N6QA 5KFJA 3SFUA 2P5OA 4NI2B 2YBVA 1ITPA 2V8DA 1IKXA 1FX2A 5J1NA 3BSCA 1Q4RA 1UWAA 3P8BB 1KL9A 1ZD5A 4MKBA 2I7NA 4L3QA 1TK0A 1ED1A 1MA9B 4AP9A 3IMXA 4DR4J 1VQLS 1WSGA 2Z58B 2ALZA 3LL3A 4RO0A 4MEYA 2IJNA 4J90A 3ZETB 3KKRA 1DK3A 2Z1GA 1LKYB 4KLSA 1S97A 1T9UA 1AFIA 5ALOA 1TL5A 2X3GA 1RB0A 4I2JA 2B8PA 4HLBA 2WOMB 4JMUA 4FJMA 1ASUA 1MWZA 4IO8A 2OTLN 5M1KA 3GOIA 5AR0A 4IOBA 4M5DA 2FLPA 4JV0A 5FD1A 3JS6A 4XEIA 2CDRB 2YNIA 2PO4A 3VQ8A 1N5XA 3BH6B 4FSVA 3J7A1 2FSNA 3C16A 1AB8A 2Q66A 3U3GA 1YGYA 1WUAA 3BJYA 2G8HA 4DUZK 4KN4A 1RBVA 4K7QA 3OGUA 2EWSA 2AWZA 3KLFB 2FBTA 4ILHA 7ICVA 1YRXA 2YKNB 4JV5K 4P73A 4DG1B 1OSCA 1PBAA 3CCUS 2VB6A 4NLCA 3SMSA 1NPKA 4NI2A 2ILZA 1XNSA 1U0HA 4EI2A 1KSPA 2KW4A 1MNEA 3VCBA 3J81U 5EUHA 1XHXA 1Y5NB 2F3NA 2BUPA 3T41A 3UCUP 3ZSQA 3PJXA 2ZIVA 2CZ9A 3C65A 6FDRA 5CR0A 1FTCA 1U1PA 3ZTPA 3VZIA 2F1JA 3E01B 2QKKA 4BQLA 5IT9O 1DLOA 1P8GA 1F9FA 3PSIA 5J2QB 2XICA 4C0BA 2F8TA 1KR4A 3D1QA 2I7PA 2W3SA 1KLMB 1ZTTA 4KC5A 1N4LA 3BGUA 3ULEB 4KX3A 2WFBA 4H4MB 1LFPA 2ZHOA 3KLEA 2QE5A 2J6TA 4DQSA 2H5XA 2K3KA 3ZC4A 5AQWA 2MGZB 3C2KA 4M3WA 3T5KA 3WBZA 2OI2A 1HBNB 4DWIA 4Q44A 4R8UA 4DU4A 2AKWB 4QS9A 4PYAA 2D41A 2RD5C 2IGIA 1YVUA 5D0RA 3AVNA 3BF3A 3M3ZA 4LMZA 2HZAA 3KWGA 2JDJA 1RWVB 5KFWA 2IVPA 5BYRA 1N8RO 4DG1A 2R8GA 2KM8B 1B9FA 1KNZA 3NRWA 2V68A 1OQ3A 2GJFA 1MSWD 1KLNA 2NSBA 2Z2LA 3ZSOA 5A8WB 1XERA 1QE1B 3HHLD 2GO7A 1RHUB 1Q82T 4QZGA 5JTIA 4ECRA 3E51A 3HSDA 5F9NA 3PVXA 4JKCA 4ZJOA 1NOZA 3AVAA 1GEHA 3LANA 4DQ8A 1YHQS 3NGUA 4M95A 1BXNA 3V6KA 1N33F 2B5JB 3E01A 2EEYA 1WSFA 1GX6A 5CZ1A 1ATNA 3ALYA 5HHIA 1UEUA 1A5WA 1HHSA 1VRUB 3ET6B 1WG1A 2J0QD 2QN6B 1MN8A 5ETLA 3BPDA 5F8MA 3AA3A 3Q8RB 4LF9F 4Q0BB 2DEIA 3DLBA 3A2FA 4R63A 3X1LB 2FF3B 2F63A 5AQPA 1NGEA 4G3IA 4BC5A 4O9MA 3T1YF 5L1JA 3FC4A 3QBXA 1HBNA 4OPKA 4GV9A 4LF6K 1YSJA 1ZQXA 1K6YA 3MAAA 2WMMA 1RAHB 2HMXA 3MM6A 3HULA 1FHTA 4IEEA 1I6JA 8ICNA 1WD6A 1VQ4N 3VMFB 1HQ2A 1WTFA 4DR6F 4N5SA 4CZIA 3LM9A 3R1HA 3HKZD 1S7HA 1NBWA 4CEEA 1QE1A 5I42B 1IKWB 3QUTA 2C1EB 1QVFR 1NJIT 4J9VA 2CPIA 2GV9A 1TL1B 4RW4B 1WORA 3L6QA 5LJ5Y 2P9LA 7ICFA 4AUKA 4YB6A 3KOOA 2OH2A 4RWTA 1SJ1A 5IIJA 2D7SA 2FVPA 3WKEA 4A57A 1U8WA 3B0XA 3M8RA 2I5JB 3UXNA 2AXTU 4FLTA 1JB0C 2VV5A 4CLFA 4DF4A 3VCDA 4DR4F 4NYPA 2EQYA 3VC8A 1VRUA 3CB4A 3ET6A 9ICIA 4CLLA 3BY5A 2CPFA 1RADB 1NNDA 1X4BA 4H5TA 3G4SS 1KTVA 2KG0A 2XWYA 4Q0BA 3MPWA 4GKKK 4JS5A 4ETXA 1QHAA 2ZUCA 3M6KA 4C4RA 8AT1B 4YNQA 2B3TB 1WCNA 4B9VA 5GAGU 4JNEA 4GRSA 1AXQA 2ZUGA 2QZ8A 5AQMA 4I2CA 3NCRA 2W54A 3SBTA 2BRKA 2I5HA 4EP4A 4CTAB 3SQ0A 2DL0A 2CH5A 4BCAA 4CEDA 1H2TZ 4FZXC 4B9UA 4HHTA 3HSZA 3P49B 3R7BB 2W2OP 2MAXA 4PG6A 4KBIA 2WRMA 4G1IA 2V8PA 2HBRB 2A0FB 4F2RA 4ZPAA 3QICA 2BOAA 3QAEA 5JLHA 3V2UC 1I3AA 4I2PA 2W2MP 4R64A 5LSRA 1S1TB 1VQMS 5F3XB 1NJYA 3PMNA 2ROEA 1XI1A 1TAQA 5ETVA 2ZH4A 4QJVA 1IKWA 3MCMA 1WF2A 2RDIA 2YX8A 1GLCG 1C7YA 1TL1A 1V4TA 4PXEA 4CGZA 4OI6A 4JWNA 5TISU 2QSFA 2XVTA 2ZIWB 1KDNA 4WFNQ 4PHEA 5HK4A 1O5JA 1SH0A 1U02A 5EX5A 5H9FK 2E88A 5HMZA 2C2DA 4BR4A 5FROA 5CCMA 3S3NA 3G6ES 3L7UA 1RDDA 1BI4B 1TUVA 4IQTA 4IQMA 4K4TA 1UVIA 2FVSA 4QYRA 1HMVB 4CD3A 1YTUA 1L8OA 2QB0B 4YDXA 3M9OB 2BPGA 4AD6A 4TYBA 1KQGB 3BF4A 2Q1LA 2NRHA 2YWKA 1RABB 3CCLN 4OX6A 3M8PA 3KUGA 5GAEI 4CTAA 2CPJA 3IG8A 2W6KA 4B3RK 4CJWA 4ZP6A 2AQ4A 2ADCA 9ICHA 4CJPA 3KHGA 1KS2A 3PW5A 4KHWA 4LJMA 2H5EA 2XNRA 2W25A 2XMKA 3VN5A 1NG9A 4OYAA 2WB1D 8ICHA 4Z6FA 1YTYA 3ZFVA 4JI1F 5IT4A 2YMMA 3IG5A 3H7HB 3OYIA 4DTNA 4C8LA 1QUVA 1RSCA 1E3MA 2M88A 2RQ4A 4NO7A 3ZZOA 2L5YA 2G1DA 5CWRA 1F60B 3P3DA 1MWMA 1X0FA 4LFBJ 4N47A 4BXOB 1SZ2A 3CJ5A 5CR4A 2VFRA 2BZFA 3ATUA 2ZHBA 2NS1B 1RE1B 3TO8A 2FPMA 1IBMJ 5J0WA 2DR9A 2YX4A 5LJVA 2XLJA 3VGLA 4ZPBA 4WK1A 3RB3A 3AA9A 1N34J 5AICA 5L38A 4JKGB 4KH4A 2OFHX 4ILJA 4ZVUB 2JRSA 3UB5A 4H03B 1GTEA 4BDPA 4N8OA 4C8NA 1JRPA 3LDAA 2ZJPQ 2HSZA 1V3ZA 2HZVA 1VQ7N 5EE0A 4YS2A 1HMVA 4JK1A 4U9RA 2QB0A 3V7LA 1RU2A 1FRJA 1EQMA 1X42A 3GFYA 4USMA 5J1PA 2E1RA 3C19A 3W65A 2R7TA 2FDRA 5DJBA 2CUYA 2E8PA 5RUBA 3MDAA 5ALJA 3UNYA 3KLIA 2QV6A 1WN7A 2NXEA 3FQLA 1LAWA 4F5OA 1EJ7L 1ZQMA 5H1SV 2W7PA 2NZTA 1HL6A 3RU0A 2IVFB 4FZNA 3FBFA 1B43A 1F2HA 3BREA 4U7BA 3G6XA 4FJ5A 5CB1A 2QA4S 1CEZA 4I6MB 2FZCB 3HHLB 4AL5A 2ACYA 8RUCA 3CDAA 5C2GA 3QWUA 1N60A 1VS3A 3H8SA 4KITB 2XS5A 4FM0A 4ES1A 4Y2JA 5AKKA 1T05A 1S0NA 4J9OA 5JVHL 2FDNA 2W2NP 4KREA 2J9DE 1KXPA 3J7YU 1NMDA 2HK2A 4DOBA 5AJ3J 5DG8A 2GO9A 2E1FA 3DOMB 1Q81T 4OQJA 3DHXA 3BV8A 3HK2A 4QQBA 4DCCA 3UCZP 1AFJA 3UVJA 5EU7A 1N0UA 1J97A 2PMZC 2AQ0A 3BF1A 2D8CA 3RYLA 4AE5A 4C23A 4P10A 3O3LA 4YB7A 5JUMA 1P6TA 1ZJMA 1FXDA 2LYBA 4DR5K 4C11B 3EVOA 1WSVA 4EHTA 5IQQA 1UA0A 4YMNA 3VQAA 4F3MA 2HQFA 1XMQK 5HRPA 1EQ0A 3IRUA 1B4FA 4FXDA 2E5LK 4K2XA 9ICRA 2RF2A 2E2OA 2VF3A 3EE3A 3KLHB 2E66A 1RHRB 4JKDA 3POTB 1HQEA 2VBZA 2ISOA 1Q3VA 3DAWA 4J03A 3QLHB 3S8SA 4TU8A 5KTQA 2ZJRQ 2IAJB 5AQIA 4M6WA 3ZZTA 1L3KA 4I2AA 4DQRA 5ADZA 3F5AA 5M1PA 2QTWA 4J5OA 1VC5A 3CO0P 4LZGA 4HT5A 3OJUA 3DYAB 1RQNA 1KQFB 3TZZA 3CQ8A 4O4RA 3PTWA 2DBBA 1U2VB 3KLVA 1Z6RA 2GA7A 1RKIA 2EZYA 3DDNA 3VAMA 4XDDA 2RQMA 1N5YA 3M6VA 1NSPA 3HHLA 3I0RB 3VR1A 1QAJA 4EX7A 3ETLA 4MTPA 4DCOB 3TUZC 3U4LA 8ICYA 3D3BJ 4Y2TA 2GELA 1R0CB 4KGKA 1FJGJ 4ZMMA 2OYYA 3G96A 4KHMA 4FS2A 2W03A 3KG4A 1DHMA 1VLOA 4CWBA 1S6OA 8ICQA 2CJQA 5D0GA 1XC3A 1SJ4P 4GW6A 3MMBA 1FKPB 1XTZA 2GNKA 2PMHA 3WKDA 3BQ0A 4DOAA 3T6BA 3CPWR 5HL7Q 5A2QO 2U1AA 3P4IA 2JEFA 5E2QA 1KQSR 1FW6A 2CVEA 2CFXA 1RDCA 2BGGA 2GVDB 4K4VA 2QXFA 4B3TJ 2D4WA 2V63A 3CCRS 3VHQA 5BREA 2QT7A 1CS4A 2J9CA 2G2YA 1YJTA 3POTA 3K1ZA 3QJJA 4DOZA 3P39A 1S72S 1IBKK 3OSPA 4ID8A 3FZ2A 3HSJA 5J0XA 2F8SA 3W1YC 3KJQB 1QDUB 1XMOK 2ZJAA 3WNFA 2O8EB 4KSEB 3D67A 1X4EA 2HMIA 4F5PA 5FLXO 1U2VA 2G8WA 2VBWA 3MMCA 1S1XB 3QT5A 4IBNA 3AB4B 3M1VB 3TSPA 3M6ZA 2QFIA 1R3NA 5L9NA 3G82B 4F72A 4WFAQ 4NASA 3I8BA 4K25A 2KRRA 3VV2B 3CXCM 3K0SA 2VC1A 1QM9A 4GVLA 3EJMA 2DIVA 2EDUA 2BABA 1S4FA 3IR7B 1K8AO 2ZWPA 8ICCA 4HH0A 4P2XA 1VQLN 2BV3A 2ATQA 1ZQ1C 4RW8B 1QJHA 3SCXA 3DOKA 1JXLA 1JLEB 3FVYA 1KWMA 1YRTA 1Q8KA 4LFBF 3IKMA 4L74A 1SGGA 4FNIA 9ICJA 1TGOA 3QETA 3HOSA 5FPDA 1DZ5A 3TNVA 3A3NB 2E5GA 1KC8T 2GVDA 1IBMF 2NRTA 1OMSA 1KVJA 1UAXA 3EO3A 1CPZA 1M5SA 4CRXA 1HNZK 2D1KA 3AD7C 7ICMA 1H2UX 1NU4A 4CLZA 1N34F 4EP5A 4MJKA 3FEZA 1HNXK 1S57A 2QM1A 4NYFA 3FZHA 5IT0A 2YV0X 3H90A 1ASWA 3NOGA 4O3NA 4MFAA 4FJ9A 2X6SA 2VQFK 3IBFB 3OXGA 4C3KA 4CHYA 5KFDA 2VH7A 3KBBA 2XSJB 1NJIO 4ECSA 3CCUN 2G0CA 1YBAA 3QJLA 2PFDA 2JZ5A 4TLRA 3SQ1A 4I2FA 4LD0A 3RBEA 1K9MT 3KJVB 4WCEQ 5BYQA 3LVWA 3SD7A 2B8QA 3NNAA 4JI3K 4V19J 1NGDA 4Z7YA 2R2RA 4ELTA 1UFWA 4PKDB 2KRBA 4F4ZA 2PEBA 2KOBA 3BKUA 4JKAA 3C2LA 1Q8BA 3MPUB 3OBWA 2MU2A 2LCWA 4NOHA 1B64A 5JMNA 2PFUA 1UVKA 4QWCA 3BGOP 4RW8A 3UMBA 3N4MB 4LF2A 2HBQB 2QWLA 2CJBA 1UVMA 2IC3A 2AZ3A 4IG3A 1JLEA 2PMWA 2MQQA 3GWCA 3J7AP 1Q86T 2LLZA 3V4IB 1TYQB 1R8PA 2P1JA 4PGQA 4F3QA 1FO4A 5LMNJ 2WFAA 5AJ3F 1XNQJ 4B6JA 2R4FA 2HHVA 1IG6A 1XEZA 2AEMA 1VSDA 4ZP9A 4CF0A 3H8WA 1G3OA 4LRFA 3UQSA 4UAVA 3TJ9A 1ZQFA 2ACMA 1ECWA 2IDOA 4BE2A 3MOZA 4HCBA 4DR2J 2N4CA 3Q86A 2ITGA 7ICJA 2VG6A 1L3UA 4A2BA 2F1IA 3O44A 1WG4A 4Z6EA 4PA1A 3NAEA 2FJXA 4PRFA 1ZQVA 3CJ7A 3VQQA 5FPEA 4TURA 5KT5A 4J91A 3ZEUA 4ZN1A 2EKNA 4CZFA 2CXEA 3OYAA 1NSKL 1Q9YA 2IM1A 4U7UK 5ALDA 1PIEA 2IDLA 3IAS9 2YWGA 4HH1A 2LECA 2KQ2A 4EFHA 3WXIA 1URJA 1N36J 4OJGA 2AHOB 2UP1A 4X62J 4JI0K 3BZKA 3VVUA 5KFCA 4FJJA 1Y3JA 2ZIXB 5KFEA 3UE2A 3HM8A 4RR5A 4ENOA 1HEKA 1WF0A 3I0SB 5AHXA 4E1NA 5GADP 2FY1A 1YHQN 2R42A 3DKDA 2B9YA 1X4HA 4LJXA 2APOA 2PFOA 2CPXA 2ROPA 3OL8A 1M5KC 4UAWA 4PWDB 1DGSA 4UB6U 1NGFA 1FJGF 3LOUA 4P2FA 1TL7A 4Z4GA 3V4IA 2YX1A 3LP2B 1TYQA 3TAPA 2IBKA 1ATSA 3CJQA 2E5JA 5J2HA 5F1XA 3WKAA 3PRVA 2DNKA 1G2EA 4QR0A 4CBWA 3BEXA 3HSCA 1D8YA 2V69A 1T0TV 4CBUA 5I3PA 1IIPA 3N7PD 3RJGA 3L0QA 2NRVA 4MKYA 4QS7A 1EZZB 5EGYA 5J0OA 1S6QA 1IJEB 4DSIA 5JS1A 4S0MA 1CJUA 3EMTA 5IT9U 4B3TF 3TACB 4YB5A 4BRHA 9ICPA 3OL9A 1SIJA 4YMOA 2HVZA 1SL0A 5H9EK 4ZLLA 2CPHA 4QWEA 2IIHA 5IM0A 2M70A 3HKZC 3DRSB 2ZE2A 4CEFA 4CGGA 2PMZF 2XYHB 3MMAB 1NRKA 1C0UB 3AY9A 4NWIA 2UUTA 1WSEA 8ICEA 3P5TL 4RNNA 4LVNP 3A4TA 2H3QA 3E2EA 1WB9A 3HFKA 1GX5A 1BUPA 3K5LA 4CK1A 1EXQA 2PKEA 5CABA 2VBYA 2ZIXA 1FNMA 4RW6B 2DF4B 5AKJA 2B4UA 3D2FB 1UCNA 3O3GA 4QOZB 4DR1J 3PX6A 1C2PA 4CJ5A 1IVZA 1BHNA 3C46A 2E1CA 2LI6A 1VHFA 4FL9A 4DU7A 3K9JA 3WC0A 3O9TA 4OZ5A 4CDGA 1XU4A 2OPQA 4KB0A 5BRDA 1T9YA 2JMGA 3LP2A 4F3TA 3MCNA 2NQPA 5CYMB 4PHTX 4GV6A 2DNZA 3U1MA 5ETOA 4Q8FA 4ZHRB 3KUHA 3GYNA 4YN4A 3CCES 2MJNA 3G4SN 2UUCK 1X9SA 4KGMA 1LK5A 4DN0A 1SZHA 4NLBA 4E7IA 2V34A 3ISDA 3BO2A 3QU4A 3GYXB 4EEYA 3QEAZ 3TYTA 2IOFK 3IC1A 2SXLA 1T3VA 1SC1B 1CVJA 3BB5A 2MHEA 4OJOA 2M4MA 2VD3A 1ZOLA 3U8XA 1FRLA 3FFKB 2HFSA 2E29A 1RCOB 4TY8A 2GS8A 1FDBA 2J9DA 4I64A 3CCQS 4DMZA 2QWRA 3QSIA 1QQCA 3NGZA 3SSRA 5H1SQ 2HQIA 1Q81O 4WFBL 4ER8A 4CEOA 1HLUA 5ALTA 1O8BA 3PIPQ 3AGKA 3PNCA 3D9BA 3LZJA 2EX3A 1H72C 3O4QA 4M5MA 3NH2A 4OYMA 4LBHA 1YIJS 8ICIA 4RW6A 2A2CA 1ZYQA 1M5PC 3H59A 4DV3F 2QARA 3I55S 2ZKTA 3OXLA 2AP1A 4CJ7A 4G6VB 1HW9A 2NPIA 1OH6A 3ZD9A 1MQ2A 3CCMS 1S0OA 3G6EN 4IO9L 1BPYA 5CYMA 3NCIA 5HNKA 2DNGA 1JKHB 3SAGA 2ZOFA 1U26A 2J4RA 1CG2A 5DM7L 2GVZB 1NPRA 4J2AA 1XJWB 4OYBA 3UR3C 3EPGA 1YITN 3RG6A 4ID5B 5LMNF 1XNQF 2PDAA 4U95A 3JYTB 2CQCA 3EWGA 3PSPA 1ZQWA 1FDNA 1ZQCA 3BGLA 4Y2AA 2QGFB 1EWRA 2WB1C 3Q2TC 1B0XA 3RFAA 2KHDA 2LQ9A 4HR2A 1J2NA 2QWMA 2WVCA 1VC6A 3O3FA 3BBBA 1NB2A 2EHGA 1TR0A 3L2UA 4EZ6A 3HSTB 3OY9A 2JXJA 4R5PB 2CZVC 2Q6CA 3ISNC 2UVUA 1RLDA 1VBYA 2BHNA 2OWOA 2Z7JA 4OKJA 1OH8A 3PFEA 3BR9A 4MFBB 4O5KA 5ALLA 2PIIA 3I9V9 1N36F 3MCSA 4WFNL 3QUQA 1VCTA 4GXJA 3N6LA 2G8UA 1NGCA 3BS5A 1HD1A 2EH9A 4OHYA 9ICLA 5AQRA 4JYAJ 1SV0C 3ZZPA 1FNOA 1Y00A 3G8QA 3F5TA 5KFRA 3B4DA 3LYSA 1Q8IA 1JKHA 4BRDA 3ID8A 3BDPA 1ZOTA 4DR7J 1U9LA 2O01C 4CZGA 3VQ9A 4KH0B 4I7FB 4FVMA 3K89A 2CQGA 2LBOA 3E1YA 3WXMB 1PAEX 5IS2A 2P9PB 4DPOA 3TARA 4KIAA 5ADXA 5JVGL 2E7VA 4YFKA 4F25A 1VQYA 3CCTA 3TWHA 7FD1A 1BO5O 5B8HA 3H4DA 3LWMA 1TQLA 3CFRA 3R9PA 4CHPA 3B8AX 2Y0SC 2G8IA 1Q95G 2QA4N 2KVSA 2XMMA 1YQHA 1PJ7A 3M6XA 3O0FA 3AEVA 5J2KA 1U25A 4XAKA 5F8JA 2F4VJ 1O08A 4B3SK <