2HHQA

O6-methyl-guanine:t pair in the polymerase-10 basepair position
Total Genus 217
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
217
sequence length
580
structure length
580
Chain Sequence
KKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*CP*AP*TP*(6OG)P*CP*GP*AP*GP*TP*CP*AP*GP*G)-3'
publication title The structural basis for the mutagenicity of O6-methyl-guanine lesions.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 217
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2006-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2hhqA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 2hhqA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hhqA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2hhqA01
1ZETA 2NRWA 1WSEA 3TR8A 4NCBA 3U3YA 1NOZA 3V7JA 3CFOA 3Q8QB 1Z00B 2PFNA 3N97B 3RJEA 4NM1A 2GBZA 2WOMA 3OYIA 3UPQA 9ICBA 1T05A 3HL8A 4K4IA 4IRDA 4CIGA 4FJMA 2ZD1A 7ICJA 4QZGA 2Y1IA 3M8RA 5K14A 1S0OA 3OYKA 5J2HA 2HW3A 4I2BA 3WNEA 4Q44A 3MEEA 1IKXA 4ED0A 4B8CA 3BQ0A 4KLLA 2ZTDA 1C1CA 4QWDA 5KT5A 3PW2A 1MSWD 2YKNA 4LD0A 4JUZA 3K2PA 5KFTA 2KZZA 4FZXC 3AO2A 1BIUA 1WN7A 3LP1A 4OPJA 4QOZB 3OJUA 2FLNA 4OKKA 4RQ5A 3GIIA 1RXVA 2NRZA 3JYTA 1PZNA 5L1LA 1ZQAA 2ZUBA 1JLCA 1LWCA 3QETA 5KFYA 3ZDAA 4ED7A 3MXJA 1T4GA 3AUOA 4CHYA 5KFJA 2YNIA 4QZ9A 3VQPA 1RT6A 5KFFA 3OYCA 3JPNA 1TL3A 7ICPA 2YNHA 4E1MA 4IQWA 1J53A 4FXDA 3RBDA 1NKCA 5KFXA 4I2EA 3TWHA 3KTQA 2KQ2A 3MECA 4CJKA 2V9WA 1X9WA 1JLQA 4IG0A 3U3GA 1UA1A 4RPYA 4YG2A 4I27A 4XIUA 1LW2A 5DB9A 2BCVA 4FJ9A 2RN2A 4UBBA 1A5WA 3P5JA 1TKDA 5KRTA 1D8YA 3LDSA 5HHHA 4CK3A 1XI1A 2OZSA 9ICHA 4GXKA 1HYSA 1WAJA 2ETJA 4QZ8A 4XRHA 3K59A 2OZMA 3DI6A 3SPYA 4J2BA 1BI4B 2XCPA 1FKPA 3T5LA 1XWLA 3OSPA 4N76A 4LH4A 4UAYA 3H4DA 1RBUA 7ICUA 4YXMA 4CJRA 3OYMA 3K58A 5T7BA 7ICNA 1S1WA 1SZPA 3U6FA 3K75D 4ELTA 1NOYA 1RTDA 4DF8A 4CGFA 4JV0A 4YP3A 4NLZA 1YTUA 4KTQA 1Q9YA 5DB7A 2F8SA 3VQEA 4B9NA 4FLTA 4HHTA 3K5NA 3PV8A 1RT5A 2PYJA 8ICEA 4DO9A 1SV5A 3IRXA 3MBYA 1NK5A 1WSIA 4Q8FA 1ZQTA 1S1TA 5EWFA 3QZ7A 5KG7A 4F3TA 3D0PA 2IHMA 3MXIA 5HP1A 1IO2A 4ED3A 1T03A 5DKWA 2JEGA 4DSIA 2C2RA 3OYAA 2BCUA 4PPXA 1RDCA 4CHNA 7ICGA 3IHQB 1HNIA 4FLZA 1S5JA 4F4ZA 4DSKA 7ICVA 5J2NA 3JPQA 4I2QA 3G0ZA 2FLPA 3RJGA 4QAGA 4ICLA 4Z4FA 2P6RA 1VSMA 3S3MA 4M3YA 3RMDA 4E7IA 4I2DA 2XC9A 4CJQA 1DOQA 1S0VA 4GC7A 4GXJA 5C42A 1B43A 4PHPA 4R8UB 2BCRA 4M41A 1ZBIA 4J2DA 1RBSA 5J2BA 3LWMA 3O3GA 3JPSA 5BPCA 4Z6FA 2VWJA 4CJEA 4KHSA 1ZQDA 2UVWA 3QZ8A 3SZ2A 5EWEA 4KLMA 4BE1A 4NYNA 4EYHB 1NK7A 3Q8KA 3MGIA 2X6SA 1IM4A 5SZTA 5J2JA 5HBMA 3PO4A 3C6TA 4QWAA 4DL6A 3KHGA 4RNNA 2VA2A 4M3WA 4GXIA 4OJRA 2DFLA 9ICIA 1HUOA 3UIQA 3PR4A 2XY8A 3DLHA 2FBTA 1NKEA 4W5NA 1MC8A 1NJYA 1RBTA 4X5VA 3RMCA 4MF8A 1QE1A 3G6XA 4OLBA 1RTHA 3H8SA 4CGJA 5J2EA 7ICMA 3QEWA 3DMJA 9ICOA 3HVRA 2WONA 3M8PA 5I42A 1ZQVA 1ZQZA 1YTAA 1HJPA 4Q43A 3SJJA 4RPZA 1ZQRA 5KG0A 3MR2A 2BQUA 7ICSA 4CJ3A 5KFNA 5KG4A 4ECXA 3TAFA 2YV0X 4M47A 4FZYA 1JXLA 4PGYA 1QHTA 1VSKA 4M3XA 1UWBA 4CGDA 4BWJA 2JGUA 3GIJA 3KIOA 5D46A 4J9RA 3HJFA 1BCMA 2HNDA 1RT2A 1B9FA 2PFQA 4RT3A 1HYZA 2YHBA 1C0MA 1RNHA 7ICOA 2A1SA 1C7YA 4P4MA 2XY5A 1CZBA 3K5OA 4NY8A 2F1HA 4IDKA 4ECVA 4KAZA 4KLFA 3CM5A 4PY5A 5KFVA 1I39A 1S6QA 1VSFA 4Q8EA 1LWFA 4F5QA 1UT8A 4RQ0A 5KFCA 1Z00A 3DRSA 3ZDBA 1BPBA 5C5JA 3Q8LA 3RJHA 2Q3SA 1ZQLA 3OY9A 3AVFA 4FS1A 3NTUA 5CYQA 4JWMA 3NDKA 1WSFA 3LK9A 3RJKA 4O4GA 1YVUA 3RRGA 1J54A 3WNFA 2P1JA 3EZ5A 1AROP 3L2VA 4DTMA 3AO3A 3KLEA 3T5HA 4YNQA 3AVCA 1F21A 3QIPA 1QSSA 4I2HA 5J0TA 4ZHRA 2AU0A 4CJVA 4EBCA 4TSXA 2HVIA 5J2IA 2P51A 4CHZA 4E1NA 1ZQNA 3AO4A 3AVNA 5KFBA 3TFSA 2RPIA 4F3OA 2VG5A 4I2CA 3PX6A 1JL1A 4DTUA 1ZQPA 3NF8A 4UB1A 1BCOA 5IIOA 3L2WA 2ZQBA 1WSGA 2D0CA 4FK4A 4B9UA 3V1OA 1W0HA 1RDBA 3ZD9A 4E7JA 5J2PA 4MQ3A 4CIFA 3NF6A 1HQUA 3AVAA 2HHWA 2C22A 1LWEA 2HHQA 4FLVA 1UAXA 2P66A 2W8LA 4CEQA 4Y1DA 4CEAA 3HT3A 4DSFA 4M9LA 3ISNC 1RYSA 4FK2A 1BQNA 4MFBA 5D49A 3ZCMA 1BPDA 4KO0A 1O1WA 1KVCA 4DL5A 3OYNA 2HNYA 4ZTJA 4Z6EA 4RQ7A 1BI4A 5J0PA 1HMVA 3HSTB 4RNMA 3MDAA 4DS4A 4DQPA 1V9PA 2BDPA 2J6TA 3KHHA 1ZQUA 5DBCA 1U4BA 5CWRA 9ICQA 2ALZA 4F5RA 5HRSA 5EU7A 3ZSWA 5FRNA 1TKXA 1HRHA 2IS3A 4I28A 1S0NA 5KT3A 1U48A 1KLNA 4BWMA 4CJUA 4QW9A 3OVNA 5KFAA 2IOCA 4CGHA 5L1KA 1KEJA 1RZTA 1U45A 5HROA 2VANA 4NYFA 3SQ0A 4DLGA 1GOCA 8ICWA 1VSJA 3ZDDA 4EBDA 2ZE2A 5HRRA 3QNNA 3VQ7A 5CR0A 1B22A 1JL2A 1LAVA 3VQAA 4DOAA 4DS5A 7ICHA 3TFRA 1CXUA 4KLEA 3GQCA 3BQ1A 4PGXA 4DTSA 2NRXA 2NRTA 4F5PA 3OGUA 4YR2A 3S3NA 1VSIA 4NXZA 4CCHA 3KKSA 1HJRA 3C21A 4GLXA 4R8UA 1S97A 4YMOA 4KHYA 5KFRA 4TURA 8ICUA 1TKZA 3MAQA 3MFIA 9ICUA 4Q0BA 1RYRA 4RQ2A 5CZ2A 1RT1A 4FJLA 4M2YA 1TAQA 8ICMA 5HHIA 3FDSA 4OKJA 1ZBLA 1ZQBA 2AGQA 4W5RA 3KLFA 4XUSA 2P5OA 5CYMA 5D3GA 2Y1JA 1TGOA 3NFAA 4DSJA 4K8ZA 4KV8A 3UQ2A 3M9NB 2YHAA 3I0RA 2PYLA 4F4WA 2RF2A 4JRPA 2G8KA 2F1JA 1CLQA 3C94A 4OLAA 5JS2A 5DB6A 3ZSZA 1SUQA 1HNVA 1BPZA 4KN7A 3A2FA 4FLXA 1N6QA 5KFDA 1KFSA 4N56A 3MABA 1XU4A 2ISOA 2JZBA 2J6UA 1HPZA 4MFCA 3KKRA 3AVJA 4M9HA 4RW6A 3C1YA 4OGCA 4M6WB 3NE6A 4BGDA 4TUPA 4IG3A 5F9LA 5DG8A 8ICNA 1DGSA 4KHNA 1XS9D 4M3TA 4OGEA 3NBPA 3PMNA 4PGQA 4CHQA 3LAKA 4DWIA 1C0TA 3HK2A 1TVRA 3RBEA 4TQSA 4JLHA 1ZBFA 1GOAA 3AVGA 3T1AA 1S6PA 9ICAA 1S77D 1N48A 3AO1A 5KG3A 8ICFA 1KVBA 1KTQA 3TI0A 4LVSA 3PY8A 4F4XA 4RQ3A 4ED8A 1BIZA 1RBVA 4E0DA 2DPIA 2E6LA 5HRNA 2BQ3A 1SKWA 3IM1A 4GC6A 3CM6A 4FYDA 4CF1A 1A77A 3RTVA 4O5CA 4RW4A 3VQBA 4ID5A 1UOCA 4RPXA 3B6PA 3PNCA 4FJ5A 4CFCA 1RXWA 3T5JA 3OYDA 4J2AA 4PQUA 2HHUA 2FBVA 4J9NA 1ZBHA 3IAYA 3SQ4A 5KG2A 2A1RA 1IKWA 1LW0A 2NUBA 4R63A 2XY7A 4QWCA 4G1QA 3O4NA 1TL1A 3AA5X 4M9JA 4YD2A 1COOA 5J2QA 4CEDA 3DLRA 3HX0A 3VA3A 3C2KA 3V72A 4CEEA 4RQ6A 3EPIA 8ICBA 1TVAA 1ZQGA 4DSLA 4O0JA 1JN3A 4QW8A 3LAMA 1ZJMA 1EKEA 3MFHA 3QEBZ 3LP2A 1WAFA 5KFWA 1CUKA 3C6UA 2R8GA 1Y97A 7ICLA 1JKHA 2C28A 3TAGA 4KITB 4YD1A 4O5BA 2HHXA 3MXMA 4C8KA 3ZT1A 1D8LA 4XQ8A 7ICIA 3V81A 5KFQA 1RBRA 2R7YA 2ATQA 2DFFA 1XO1A 3RR8A 4RT2A 5J2CA 5J0RA 1BVSA 1N5YA 4F2RA 3KLGA 3GDXA 3C5FA 4B8AB 4E7LA 3OSNA 3CQ8A 4FK0A 2MUTB 1N56A 3GFKB 4F4YA 4CGGA 3OS1A 4KMUA 4FLUA 1ASVA 3CFRA 9ICMA 5BOLA 3AA3A 4M04A 1BHLA 3PUFA 3VQCA 9ICNA 1ZQIA 2FPLA 1REVA 5J0UA 7ICFA 3NF7A 5F9NA 4JV1A 2Z1GA 4ED1A 5KRSA 4RUCA 4CHPA 4BDZA 3UXPA 1T3NA 8ICRA 3ZSXA 5J2GA 5L1IA 1S9EA 4E19A 1H38A 4M3ZA 3ZSQA 4DFJA 4CK2A 1D9DA 4RG8A 3TAQA 4DQRA 2DFEA 4UB3A 3M9OB 2KZ3A 1Z26A 3OYHA 4XA5A 1VK0A 4QCLA 1S76D 1NK4A 4RW7A 1FXXA 5C25A 1VSEA 2KFNA 4FJ8A 1EX4A 4CJSA 4F8RA 4F50A 3HP6A 4O44A 1L3UA 3L3VA 4EZ6A 4KI6A 4O55A 5J1EA 4KKOA 8ICYA 1ZQOA 2QK9A 7ICKA 3L3UA 2JEJA 1WNSA 4DTRA 4PWDA 3O3FA 3BGRA 3NGZA 4CERA 3CYMA 1S0MA 4JS4A 2G8IA 2Z1JA 4KB0A 1HYVA 1EXNA 1IG9A 5FRMA 1G15A 4QWBA 2IGIA 2V4RA 4C8LA 4IRCA 4B08A 4YCXA 1QSYA 4BXOB 4M42A 3KLIA 4Q45A 2P6UA 1NJXA 3VQ9A 1QLNA 4AHTA 3NH2A 4J9PA 2JZBB 1ZQQA 4F4KA 1NK8A 4O3SA 2WTFA 2D0BA 4FW2A 4RQ4A 7ICTA 4W5OA 2BPFA 1RDAA 4ID1A 1MQ2A 4KREA 9ICSA 3HWTA 3SQ1A 1JMSA 4NCGA 4DMNA 4PA1A 1RPLA 1BGXT 1ZJNA 3DRRA 5CA7A 3MR5A 2LSNA 3TABA 4RW8A 3EY1A 4LH5A 3SUNA 1WLJA 4F2SA 3QERA 3TAPA 1RTIA 4O0IA 5JUMA 3EYZA 4RQ1A 3QEPA 4LY7A 3ISBA 4QZHA 4QZAA 4B9TA 4GMJB 4FJIA 9ICJA 4FO6A 3ZDEA 3Q8RB 3RAQA 3RH4A 3UXNA 5DK5A 5HRPA 2W42A 3V1RA 4M6WA 1UA0A 3KHLA 3RJJA 2XO7A 1MQ3A 1FK9A 4KLDA 1KLMA 4RW9A 1BQMA 3HP9A 5KTQA 5D4BA 4P4PA 3Q8MA 1TAUA 4M45A 4J9KA 4K8XA 3AU2A 1VSDA 2JEFA 5J0XA 2Q0ZX 3T5KA 4FJJA 2NRVA 1TKTA 5DGBA 8ICGA 2DY4A 2R8IA 2PI5A 8ICHA 4AHRA 1NK0A 4YQWA 4BE0A 1RCHA 4K4HA 1L3SA 5L9XA 1JXBA 4NCAA 2W9CA 2R8KA 4FS2A 2W9AA 2IDOA 1K1QA 4F5NA 5DLFA 5KGXA 2HHTA 9ICGA 3PX4A 1VRTA 5KT2A 4DL7A 2ZUCA 5KT6A 3ZT2A 3ASMA 8ICPA 3HXMA 3JPTA 2DTUA 3RH6A 1KFDA 1ZQMA 3OS0A 1Q8IA 5DLGA 5J29A 4CF9A 4KLTA 2QKBA 3AV9A 4KLGA 1S1VA 4IR1A 1IKVA 3AVIA 3V9WA 4JWNA 3UXOA 2C2DA 2FMQA 4B3OA 2FPKA 2VG7A 3C5GA 2P5GA 5KFMA 1S1UA 4C8MA 4CF8A 4G3IA 1FKOA 4FM0A 1CXQA 1WSHA 3ZSRA 4W5QA 2FBYA 4CJ4A 3OYFA 3BQ2A 2V4QA 3BDPA 3V4IA 4DOCA 1TV9A 4PHEA 3WNGA 3GIKA 2HMIA 1BISA 1ITGA 3V9UA 3C2LA 3C95A 4Z6DA 2QXFA 1C0UA 1HQEA 4OPKA 2R8HA 2F8TA 2BPGA 1L5UA 3MEGA 2C2EA 2G8HA 2BR0A 4PHDA 4ED6A 4UAWA 5DBBA 4JRQA 4Z6CA 4N47A 2ITGA 1RT7A 5HNKA 3VQ5A 4ECZA 3ZT4A 3L2QA 1T8EA 2BHNA 2MUTA 1JLBA 1CEZA 3QNOA 1JLAA 4NLGA 4ECQA 3OHAA 5DQGA 2W9MA 3AVKA 9ICTA 8ICLA 3SUOA 3NGDA 4H4MA 5I3UA 3QLHA 1EXQA 5HMLA 5J2FA 4YMNA 3D45A 4I2AA 1ZQYA 1QSLA 4DQQA 1ASUA 1TFRA 1JXEA 3KD1E 2VWKA 5E41A 3P83D 4TQRA 2GV9A 3LANA 5J2MA 3GV7B 3ETLA 4IBNA 3S9HA 2FMPA 5DQHA 4JV2A 3DRPA 4BDYA 3SNNA 2W8KA 3MR6A 2YNGA 4ZTFA 3PX0A 4YVZA 2PFPA 4O9MA 3Q8PB 4M9NA 3H7IA 4QZDA 4KLSA 8ICOA 9ICEA 1S1XA 4NLNA 3VQ4A 1RDDA 4FLYA 1IH7A 4E3SA 4KLOA 3QEAZ 3C2MA 4L8RB 3JPPA 2VG6A 4J9LA 4KTWA 3NHGA 3V9XA 3SYZA 5KFGA 3NCIA 4HVJA 4I2JA 5CZ1A 1ZQFA 4I9QA 3QINA 4HCCA 4CEZA 4B9VA 1Z25A 4H4OA 2FLLA 3JSMA 3PW4A 5DBAA 4Z4CA 4EBEA 2OYQA 1VSLA 4DG1A 4IKFA 3DYAA 3NF9A 2X78A 4O3QA 5KFZA 2AJQA 1B92A 1X9MA 5FDLA 4DFKA 3RJIA 7ICQA 4F5OA 3B6OA 4BXOA 4ELUA 3QO9A 1C6VA 2XRIA 3CG7A 3OHBA 4KRFA 3P1GA 1T7PA 8ICZA 8ICIA 3AVHA 4EP4A 5DQIA 5KFHA 4H8KA 1KFTA 4N5SA 4FZZA 1WCLA 4DEZA 3K4GA 1VSHA 3M8QA 3HO1A 4CJTA 5HMMA 3KD5E 3PW0A 3ZDCA 2ZUDA 4UBCA 3T3FA 2KW4A 1JLEA 2XGPA 3SI8A 3MEDA 1S9GA 4HUFA 2LYHA 2B6AA 2FMSA 1XHXA 2RDIA 4UB4A 1A76A 3HM9A 8ICSA 4M9GA 5KFSA 3TAEA 3VN5A 4DQIA 3ITHA 5J0SA 3Q8SB 1QTMA 3DLBA 2Z1HA 2OWOA 2RDJA 4ECUA 1UT5A 2W9CB 2Z1IA 2AQ0A 3SUQA 4KHUA 4CFDA 4HUGA 4UAZA 4CESA 4Z4EA 4J9SA 2UVUA 3LPUA 1RT4A 4RZRA 1TK5A 4CIEA 4CEBA 4N41A 4Z4IA 3RRHA 1QQCA 4NLKA 3RMAA 3ZSVA 3IG1A 1XSPA 5DG7A 4AILC 2XGQA 4AH9A 3MR3A 4KI4A 4B9MA 2ZJAA 4YR0A 3DOKA 3ZT3A 3NGIA 4MFAA 4ECWA 3LALA 1LV5A 3BQTA 3KK3A 3HW8A 3HVTA 5DB8A 4BE2A 3VQDA 3DOLA 1WSJA 3H08A 2DPJA 4I2PA 2EX3A 5J0WA 4DU3A 5KT4A 5J2AA 3ISCA 3VQ6A 1X9SA 3V9SA 2A1JB 4B9LA 2DFHA 4AHSA 2XY6A 1U04A 3G6VA 1B9DA 2BKEA 1JIHA 4CJLA 2I1QA 2G8FA 1I3AA 8ICQA 1DTTA 2W9BB 3PVXA 4IFVA 3GILA 3V6KA 3O3HA 4KHQA 2BANA 4QZBA 5KFKA 1KSPA 3PW7A 2D0AA 2QKKA 4C8OA 4QZCA 8ICKA 3RWUA 3O4QA 1KRPA 3DLEA 8ICAA 2B21A 4W5TA 2FPMA 4J9OA 2FBXA 3V7LA 1KVAA 2IAJA 5HP4A 3G10A 4PHAA 5DDYA 1NOMA 4QZEA 4R66A 4OVLA 3HPOA 1JLFA 3LDAA 1W9HA 3WNHA 4Z4HA 4AHVA 4O5EA 3ALYA 4YR3A 2BCQA 4DFMA 4RU9A 4FCYA 3SUPA 4E7KA 1TV6A 5KFLA 4FJNA 4AHCA 4BACA 1CZ9A 2KN7A 1JX4A 3LP0A 3SQ2A 2BPCA 4UB5A 4LSLA 4CJPA 4GW6A 9ICCA 3LP3A 4O3RA 5KFIA 2ZTCA 5SWMA 5EOZA 4UB2A 4KLHA 2RKIA 3KJVA 4FW1A 4KB1A 5KFUA 4FJHA 4DL2A 5CB1A 4J2EA 2ASLA 4MF2A 2O4IA 1WCNA 1ZQKA 4YFUA 2X74A 3V6JA 1XHZA 4E89A 4IFYA 1XSLA 3KK1A 3TAMA 4FVMA 4Y1CA 7ICRA 3VQQA 4R64A 4KLJA 2G8WA 1L3TA 4DF4A 1J9AA 5J2KA 3DM2A 2M9NA 4TUQA 4KFBA 4O3NA 1IXRA 1XC9A 3ULDA 3IS9A 3RMBA 3H4BA 4ECTA 3ISDA 4CE9A 1NJWA 2F96A 4FJXA 5JS1A 3B0YA 5DDMA 5KG1A 5IIKA 2ASJA 4DTPA 2AGOA 1JLGA 5KFPA 3TANA 1NK9A 2ZJ8A 4M3UA 2B4JA 3VA0A 1K6YA 3EPGA 3N4MB 9ICPA 1DLOA 3CFPA 4FBUA 3I8DA 2KZMA 4IRKA 3AVBA 4CJFA 2IMWP 4K4GA 4CJWA 3AVMA 2R8JA 4O3PA 1XSNA 1BPXA 4F93B 3NH1A 2ASDA 1D5AA 2PXIA 3M8SA 3EW9A 4Z0UA 3OJSA 3OS2A 4P2HA 3SI6A 3T19A 1ASWA 4YN4A 1D9FA 4M0AA 4DSEA 4O5KA 4HUEA 3LPTA 3RB4A 4LZDA 5IILA 4IQTA 3QEXA 4GVMA 5J0QA 5DMRA 7ICEA 2H5XA 4NM2A 4KN4A 4Q5VA 4ECRA 3RB0A 3F73A 5KFEA 1SL2A 2HVHA 5KT7A 1RILA 3PW5A 2FC0A 2AQ4A 1TK8A 1VRUA 3OYEA 1S10A 2OA8A 3EWAA 1LB2B 2EHGA 4HCBA 9ICKA 4WE1A 4B9SA 1RTJA 3AO5A 3H8JA 1ZQJA 4Z4GA 4QZFA 4DOBA 3OYJA 8ICCA 2HHSA 4CGIA 2E6MA 4M3RA 1SKRA 4LZGA 1SL0A 4HTUA 2JLEA 4RUAA 4I2IA 3F9KA 1A5XA 4AHUA 3E01A 1NJZA 5KFOA 2G8VA 3OYLA 3L2UA 4DTNA 1A5VA 3ZD8A 2OPQA 4UQGA 4JK1A 1X1PA 3ZSOA 4FBTA 3QEVA 3SV4A 4DL4A 3KHRA 3AU6A 4MEYA 5FROA 2D5RA 2BCSA 3GV8B 4DLEA 2X6NA 3LZIA 3B0XA 1S9FA 2GUIA 1Q9XA 4DL3A 3SV3A 8ICXA 4EYIB 2IBKA 1YT3A 3MDCA 4EP5A 5TZVA 2HHVA 3VQ8A 2IC3A 4KLQA 2MAXA 5BOMA 8ICVA 4EZ9A 4IQVA 2F1IA 4KHWA 2IHNA 1NK6A 2BQRA 1RT3A 3MGHA 2OPRA 1ZQWA 4KLUA 3DLKA 2PFOA 3C23A 3OYBA 3SPZA 1BL3A 4YXJA 5L1JA 5IIIA 2KTQA 2HNZA 2OPSA 3QE9Y 4P4OA 4DTJA 2A1JA 1EETA 1BPEA 1Y88A 2G8UA 1BPYA 4FM2A 5CJ7A 5KGWA 4EEYA 5KG6A 3FYHA 2VA8A 3RB3A 4RQ8A 2YKMA 3H40A 2W9BA 5C24A 9ICVA 2KFZA 3C1ZA 4FLWA 1U9LA 2ZTEA 1QS4A 3GIMA 1ZQHA 2OPPA 4FJ7A 4CJ5A 4I9LA 4MFFA 4LSNA 4DU4A 4ECSA 5IIJA 1KCFA 3UQ0A 3RJFA 1U49A 1ZYQA 2O4GA 5KI6A 3ZSYA 4CF2A 1Z3EB 4IQUA 2E4LA 3LZJA 3BJYA 4I29A 1LAWA 2B5JA 4PH5A 4I7FA 5J0YA 1TK0A 3RAXA 2I5JA 2XCAA 3ZT0A 5J0OA 3JPRA 3K5MA 2AGPA 1ZQCA 4FJGA 5EWGA 4R5PA 1ZQEA 3HPHA 2ISPA 3V6DA 4J9QA 2BE2A 1K1SA 4E7HA 2ZJ5A 4CF0A 3PMLA 1HUZA 3AVLA 4I2FA 2ATLA 2XHBA 3JPOA 2PY5A 4YFKA 5DGAA 3PO5A 5CHGA 3QEIA 3M9MB 1DTQA 9ICWA 3NGYA 1C1AA 4ELVA 4CK1A 8ICTA 5IINA 2PI4A 1J5OA 3QESA 3K5LA 4RNOA 4FJKA 3L8BA 4ECYA 3I0SA 5HLFA 3V1QA 3E2EA 4DFPA 4DTOA 3THVA 4BDPA 4ZH4A 3TQ1A 4CHOA 1R0AA 2VA3A 3HPGA 2PZSA 1ZQXA 2GWSA 3V9ZA 4C8NA 4O3OA 1IKYA 2YNFA 1L3VA 4KLIA 3HYFA 3LWLA 9ICLA 2UVRA 1SKSA 3SCXA 4OKEA 4DU1A 4YMMA 3AA2A 3QIOA 1GOBA 1ZBUA 4JS5A 1ZQSA 4HYKA 3RB6A 3V6HA 4CEFA 3KLHA 4ED2A 4CECA 5CP2A 4DQSA 4TUSA 3V7KA 1U47A 9ICFA 3K57A 3RH5A 4QWEA 4CEOA 2JEIA 3FFIA 3L2RA 3PR5B 4F91B 4CFAA 4MEXA 3ORYA 3OYGA 1MU2A 4J9MA 2J6SA 8ICJA 5KG5A 4F92B 4PUOA 3TARA 3DLGA 4KTZA 5J2DA 1EP4A 5DG9A 2UVVA 4IR9A 4CFBA 1SL1A 3NH0A 3AA4A 3H8WA 4QZIA 4DTXA 5CY4A 3RR7A 2BGWA 3NAEA 4KPYA 1KDHA 3S3OA 4FM1A 9ICRA 2BGGA 2HB5A 5IIMA 2IA6A 1X2IA 3KK2A 4I2GA 3G6YA 1NKBA 2I9GA 4R65A 3GV5B 1C1BA 9ICXA
chains in the Genus database with same CATH superfamily
3GG4A 3U3YA 2A40A 5F3ZA 3HDSA 3OYIA 5TKYA 5AKXA 3GU3A 1F2GA 1B99A 1RU1A 1YSJA 4IRDA 4CIGA 1LKYB 2ZD1A 3M8RA 4PABA 3R5AA 1HNZF 3OYKA 4ZPBA 5M2RA 1RHJB 2O8CA 4CBUA 3WNEA 3H8MA 1VBZA 3O9TA 5LMNJ 4KLLA 1IBLF 4WTYA 1Q95G 1C1CA 4QWDA 3PW2A 4CZFA 4N8NA 3E3XA 2G08A 4JUZA 3K2PA 3LGNA 5C15A 4KH6A 1HBUA 4AT1B 3DGVA 2IVYA 1XR6A 3AO2A 1R3NA 1R0CB 4DFDA 1SZ2A 1FFWB 4QOZB 4X65J 2NRZA 3LVWA 3HFKA 5L1LA 3VEZA 4F0HA 2HDOA 2HBMA 3QETA 5KFYA 3ZDAA 1T4GA 2A3ZA 3AUOA 5KFJA 2YNIA 1RCOB 4C80A 1FA0A 3T6JA 3OXFA 3JPNA 3QFWA 4IQWA 3RAMA 3NVVA 1J53A 4FXDA 3PSIA 1HQUB 3KKAA 3RBDA 1XMOK 4RUHA 4I1TA 3KTQA 3TWHA 2XO6A 1HARA 1PC5A 1F44A 1K0VA 1PVPA 4RPYA 4YG2A 2E5SA 4ATNA 3OXLA 3NS7B 3Q8UA 3P5JA 3GFYA 2UUCF 3O08A 5KRTA 1NPPA 4CZCA 3I1YA 1UZHA 1TR0A 1VQYA 4JI0K 1WAJA 2Y0SF 3J81Y 3SPYA 1HMVB 1WI8A 3RW6A 1QHAA 4N76A 3H2UB 1DJ0A 2RRNA 4RLEA 2DGVA 4CE6A 1VQLN 5LMNK 3IFEA 1SJ4P 4XH4A 3BGOP 4DF8A 2QLFB 3W5YA 2FY8A 5GMEA 4YP3A 4NLZA 2YTCA 1UETA 3J81O 1N52B 3UKUA 4X65K 4FLTA 4DR7J 3PV8A 3BR8A 4DO9A 1CQMA 2X7IA 1NK5A 1FFGB 1RWOB 3I5BA 2QA4G 3ISND 2NXJA 3P96A 2RP5A 1OS5A 1GX5A 3QZ7A 1YIJN 3FEXB 2CVIA 3GCWP 2DUYA 1GLJO 3PIOQ 1RAAB 1T03A 2H5IB 1OPZA 2FVSA 4U7CA 1F2HA 4CHNA 7ICGA 4FLZA 1D0EA 1JXVA 4OI4A 5AJ3F 4DSKA 4XEIA 7ICVA 3K0JA 1RADB 1RGIA 3RJGA 2EI5A 3HHNB 4ERDA 4M3YA 1WF2A 2DCUB 5JMNA 3B82A 1HA1A 4FF1A 2HAFA 5AQGA 2C1EB 4I2DA 1Q4RA 3GJSB 1T9TA 3HKZF 1B43A 5C42A 4IQMA 1TKZB 1WOOA 2YVSA 4DI6A 1RDWX 4WCEL 1HBNA 1EB0A 4MT1A 5BPCA 4KX3A 2VZ9A 3V4MA 4P71A 5AQVA 3SZ2A 5GAHU 4KLMA 4BE1A 4EYHB 3Q8KA 4FWOA 3MGIA 4P6QA 3Q7CA 3AAWB 2GIQA 1B0PA 5FLXU 4ZN3A 5J2JA 2JXJA 3F41A 1KL9A 3CIPA 3Q86A 4KV8B 4QWAA 3KHGA 2AJ4A 4DR7K 1CQNA 4M3WA 1VLBA 1GMUA 5JVGL 3M2UA 4OJRA 4FOIA 2DFLA 9ICIA 4CYUA 3UIQA 2A42A 1RDUA 3NGKA 2FBTA 1NKEA 1IUJA 3W2WB 4USIA 1RBTA 3FKBA 1BWVA 4X5VA 2CPXA 2DXDA 2ZOGA 4MF8A 3ZETA 1QE1A 2DXFA 4DN0A 4UB6U 3W2VA 2HHPA 5KPTA 3OHRA 3KUEA 1FXLA 2G2YA 1JJ2R 3EKUA 3D6JA 4IDHA 3U9DA 2Z0GA 3HVRA 2WONA 3M8PA 5I42A 1ZQVA 4QJFB 1HJPA 3PYEA 4TYBA 3O3LA 4MJKA 4YS2A 1W7AA 4ITSA 1UPMB 2CJKA 3BKUA 4QS8A 5BJRA 3TVZA 2EDUA 3M5RA 3A3NB 4FL9A 1JXLA 3BS7A 2JZ5A 3SQGB 4AD6A 1QHTA 3FBCA 4ILGB 4M3XA 3ETRA 2VFUA 3U4LA 3HF5A 2JGUA 2DHXA 3CXCR 1WUDA 2WSFC 5K4LA 2J5AA 4J9RA 2P9UA 2KFYA 3WKEA 1RT2A 1RAHB 1B9FA 3C7NB 2KT5A 1HYZA 4C7ZA 2YHBA 3CVKA 2RU3A 3SSSA 7ICOA 4ZJQA 1N34J 2A1SA 2XY5A 1PK1B 3VCBA 4IDKA 4ECVA 5EX5A 4NLQA 3Q8VA 4PY5A 5AR0A 1RAEB 2E1FA 4Q8EA 5B66U 1KTVA 1UT8A 4RQ0A 1BPBA 1RHUB 3EZOA 1ZQLA 3ILIA 4M5MA 2MZRA 3OY9A 2HSTA 4IZ9A 3VZHA 3OTEA 1LKYA 1F9FA 1IKWB 2RD5C 4JWMA 2V50A 4XAKA 3IRUA 3RJKA 1ZM9A 2DIVA 1YVUA 1FESA 2HFZA 2P1JA 4UUWA 2KHOA 1SJFA 3KNGA 1KXPA 1SC3B 4DTMA 4M1KA 1QVFR 4BRKA 1SZHA 1F21A 4I2HA 5J0TA 4X4NA 2HVIA 2FSNA 4ZLLA 2RPIA 1F3FA 3M3ZA 4I2CA 1GX6A 3SENA 3D54A 2M0NA 3LP2B 3VQTA 4QIWF 1EJ7L 3C6UB 4DV3F 4B9UA 5IM0B 3V1OA 1Q5VA 1RDBA 3VF2A 3ZD9A 2YCHA 4MQ3A 1JMTA 4DUZJ 4CIFA 1HQUA 1GFWB 2QIFA 1RTDB 4CEQA 1N34K 3HT3A 2ZH2A 1KQSR 2NO5A 1HNWF 3W1YC 3ISNC 1RYSA 1NZ8A 4FK2A 3KLGB 1NDCA 3ZCMA 5JMVA 3J81U 3SK3A 3B4DA 3CJ8A 2QE5A 2HZCA 2HLTA 1HMVA 3HSTB 3MDAA 1SCJB 4CD1A 2OAUA 2EWSA 2BDPA 1LKZA 2ROEA 5EX0A 1M90O 1U4BA 2OTLN 2DH8A 3ENWA 2ALZA 4LIWA 5HRSA 3CQXA 5EU7A 1ZS6A 4QJVA 2XG8A 1HUXA 2MQOA 5AIBA 4O0NA 2QWLA 2BRLA 3LVVA 2FJWA 3IDHA 1SI9A 1KVIA 3GBTA 3HMJG 5ADZA 4WPAA 4BWMA 4LC9B 5AKZA 1AXQA 4MO5A 2IOCA 1SB3C 2KD1A 4LF4J 2WAQC 2GO9A 5IOLA 2AYEA 4NYFA 1N4LA 8ICWA 4C1NI 1RB0A 1GLDG 3QNNA 2HBZB 5CR0A 2HG4A 1LAVA 4DUZK 4DOAA 2VB6A 1JNRB 2AJ2A 3TFRA 1N36F 3GQCA 3BQ1A 3N0VA 5F8MA 3PYGA 2R3VA 1N8RT 4BR7A 2QI2A 2VC1A 5KAKA 4YR2A 1CBKA 1UKUA 3S3NA 3NOCA 4NXZA 4FE3A 4CO2A 3ENQA 3MUTP 4DR4J 5G4DA 4NXMF 4XK8C 4TURA 1TKZA 2LU1A 3KLIB 4ALZA 4PXDA 3HBTA 1PJ6A 4K8RA 3ZI4A 1IWAA 3GYNA 1UTAA 2FJVA 4M2YA 1M1GA 1KQGB 1NGBA 3GB0A 1TAQA 3L7OA 4NO7A 5B5EU 1Y5NB 5H9EJ 2AGQA 1F0MA 5CHIA 2YX6A 4NCGB 3MN6A 1N5QA 2P5OA 2UUAJ 3EGVA 2ZH9A 1GK8A 1WG5A 4HL9A 1CC8A 1E3MA 3SCLE 4QZVB 4KV8A 2R2SA 3R1LA 2OTJN 5BR8K 2G8KA 2F1JA 3IM8A 4OV1A 5JS2A 3ZSZA 3PDNA 3TSQA 3W2WA 2DBBA 4A48A 2XMAA 1PYTA 4NL9C 2KDOA 4N56A 3MABA 2ISOA 4HHJA 2A19A 1FTRA 2J6UA 3THXB 3KKRA 5AIAA 5AM2A 2EG2A 3PSTA 1E6YB 4YOEA 4M6WB 1RUSA 2JC1A 2ZJQQ 4EU0A 1FK9B 2XSJB 1G1XA 4RW9B 2BW7A 3WU2U 1BQMB 2C3PA 2I6WA 1DGSA 3SSRA 4KHNA 1XS9D 2B4PA 5F0WA 3IWLA 2OFGX 3UMGA 3IG5A 1CC7A 3MTJA 3LUYA 1Z1ZA 2ERRA 3MPDA 3AVGA 4NL9A 3HCXA 1OKJA 3QYPA 1S77D 5C2DA 4JV5F 3SQGA 4P73A 4KHPJ 1KVBA 4LR8A 3TI0A 2V68A 3PY8A 3VEYA 4O8KA 1QQ5A 3DHXA 3I5AA 2DPIA 5E79U 3UCUP 1U09A 2BKOA 3C7NA 2BQ3A 1HI8A 4ZPVR 2ZM6K 2VQFK 2UUAK 5FD1A 2QN6B 2XS5A 4ZOSA 2G1DA 3CF5L 5IWAJ 3L3FX 1PK1A 1A77A 4FWQA 4CF1A 1NLKL 3P8BB 1KAZA 1VRTB 3W8GA 1UOCA 3K9KA 3UDCA 2GIRA 4XTTA 4FJ5A 3IDWA 1SQFA 4Y2PA 4I6AA 1M5PC 4EENA 3IAYA 2XHCA 2XZWA 1IKWA 2E2QA 2XY7A 1WC1A 3FSXA 4WYWA 2E2NA 2OH2A 3TX0A 3DNCA 4M9JA 4Z2XA 2ES6A 1C4AA 4B3OB 2HYIB 5C0YA 3MAAB 2CQBA 3GSIA 1S79A 1U2VA 5CD4A 2UXDJ 3DLRA 4C3KA 1COKA 1G3OA 4RQ6A 4JI7F 1GLCG 1BQNB 1TVAA 2H4YB 1ZQGA 4DSLA 4O0JA 2KU7A 5GTHU 5C12A 3N6MA 3R3TA 2MKHA 3V4IB 3MFHA 1T3QA 4OZLA 1YJ9N 5U47A 3LP2A 1WAFA 4G1PA 1HKGA 5KFWA 2ZWPA 2VPZB 3C6UA 2A10A 1ZA1B 4OZJA 5IM0A 2X3DA 1JKHA 2K4HA 5M2PA 3TAGA 4O5BA 4BRFA 3KOOA 3P39A 1C0UB 3OW2M 1D8LA 7ICIA 2AEJA 5KFQA 2EAMA 4KMOB 1RBRA 4U96A 3J7YP 2R7YA 3HTVA 2CH6A 2D3ZA 3KLGA 4MKYA 2FF6A 3GFKB 4MIWA 3PEHA 4F4YA 2G5IB 4CGGA 1ESVA 2GC8A 4LVOP 2E66A 1U6ZA 1ASVA 2F4VJ 3CFRA 1H7XA 4M04A 2HKEA 4CO1A 1BHLA 5J1PA 1ZQIA 5ETNA 3MZIA 3O8MA 5F9NA 3C19A 2UP1A 4DX8H 4LF5J 2Z1GA 3W66A 2R2TA 1REGX 5KRSA 1EWRA 4RUCA 4NLDA 4BDZA 1KDNA 3UXPA 3ZSXA 5L1IA 2W2OP 2LLZA 2IJNA 1YITS 3NG8A 4DU8A 4DQRA 1FKAF 3OYHA 2OCEA 2UUBF 4E8UA 3ZX0A 1S76D 2YKQA 2NPIA 5ETSA 1H2VZ 3IKMA 1VQMS 4A8KA 1S1XB 1FXXA 1WBDA 2MQPA 3FCWA 3P45B 3KJFB 3F5EA 1KWMA 4Q0BB 2LMIA 3BB5A 4AE5A 5GTIU 1L3UA 3AHPA 4LBHA 1ICEB 2CNLB 4ZDNA 2PA8D 1SV0C 2PMZD 1NGAA 3IMQJ 3L3UA 1U1QA 3K8VA 5GAGP 2PA3A 4ZLJA 5EVZA 2OEHA 2XNRA 1G15A 3X1LB 4QIEA 2RRBA 3UMBA 3NAHA 5B09A 1VC6A 2F4VK 1QSYA 3QO9B 3KLIA 2P6UA 1NJXA 1SV0A 5F0UA 8RUCA 4AHTA 3NH2A 1S59A 4J9PA 2JZBB 4H5RA 1ZQQA 3PZPA 4F4KA 1NK8A 4FW2A 1X3MA 2R2UA 4JAXA 5FPDA 3D0IE 4DV7F 3ZZZA 1NZBA 1MQ2A 3GYXB 5HJXA 2EKYA 3EMTA 4DR6J 3SQ1A 4NCGA 4I4BA 4PA1A 1RPLA 1XEZA 4M5DB 2W7OA 2CJAA 4HI2A 3GL1A 3VPZA 1RP5A 1XK8A 4MK8A 3M7DA 9RUBA 2D0PA 4KQZA 3SUNA 1TZ0A 2Q6CA 4CGZA 3TAPA 2QYCA 2B6AB 3EYZA 4RQ1A 5AXKA 2X1FA 2FZGB 2FE9A 4QZHA 5BXIA 3CJBA 2WF8A 2H4WB 4IO1A 1RAOA 4OJ5A 5BPLA 9ICJA 3ITHB 4FO6A 3ZDEA 3THXA 3RAQA 5B0BA 1E6YA 3UDLA 2EBGA 4M6WA 4FYYB 3THWB 1FK9A 2XSJA 3CULA 4JI5J 4RW9A 2J9CA 1BQMA 4NMLA 4CNQA 3GJTB 1ZM3A 1TAUA 1V6HA 4ID5B 3CPWR 3KHYA 3AU2A 2DHAA 1RA6A 5F3TA 3HX9A 5LY3A 3IG1B 4FJJA 4CVNE 3GZ7A 2F8EX 2A5XA 3HHLB 2VBWA 5DGBA 2VICA 4V19X 2PI5A 4LF7F 4AHRA 1OMSA 1V3SA 3OBIA 2XTJP 1NK0A 3NGSA 4BE0A 5LXRA 3W62A 1XC3A 5K8OA 1VFJA 4I0WA 1IG6A 3DOLB 5L9XA 3E8OA 5BN8A 4DR6K 4NCAA 1YTYA 3HHLD 3WXIA 3UI3A 5DLFA 2HHTA 1VRTA 2LMRA 4HHUA 1ZBSA 3ED5A 5L9NA 3LO3A 5LSLA 2RT3A 4LMZA 3CIMA 5F8JA 5AKJA 2DR8A 2UXBF 1Q8IA 3UD5A 3NCQA 5B0FA 3H25A 4CRXA 2M88A 2PIIA 4OI3A 1IKVA 4LRBA 3V81B 4UASA 3ICLA 2C2DA 3MGJA 4B3OA 4Y2JA 3MAAA 4EO6A 1R43A 4P2SA 4JI1F 2KK0A 4CF8A 4P7VA 3AJ2A 2G2ZA 2D41A 1VQOS 4JYAF 4ICAA 4LBPA 1ZXIA 2QJ3A 4TKTA 4CJ4A 3OYFA 3CC4S 2WB1F 5AM0A 3V4IA 1BISA 2W2PP 1SC1B 4DV6J 1ITGA 1WKKA 2CRXA 1ZRMA 2QXFA 1C0UA 2KG0A 1L5UA 1L7NA 3EE8A 2BR0A 4LT6A 4UAWA 4JRQA 4Z6CA 1OWXA 4CO0A 4LF5F 5HNKA 3ZT4A 2P6TA 3IBCB 5ETQA 4HTJA 2BHNA 3G96A 1CEZA 3QGHA 4DV2K 1FD8A 1GLEG 2AMCB 4B3SJ 4K4ZA 3AB2B 3AVKA 2A18A 4FZNA 1S4EA 8ICLA 2C3YA 3NGDA 3OL8A 1H7WA 2XB2D 3CE8A 2R7OA 1NGJA 1WEYA 5J2FA 2ZUAA 5EHHA 5BPNA 4Z7CA 5D78A 4I2AA 1N32K 1QSLA 2C2NA 2GW8A 5LOQA 4NWBA 4Z94A 5D77A 3IS9B 2XMWA 3M2VB 3F44A 3L4PA 5DQHA 2XICA 4YB5A 4JV2A 2ILZA 3PX0A 4RX6A 2HQCA 4O9MA 4CTAB 4M9NA 3H7IA 4QZDA 1S1XA 4FLYA 1PAEX 3FEYB 4KLOA 4BRQA 1WHWA 1GT8A 1U6BA 3C6HA 4Y2RA 3NCIA 2DIUA 2F76X 4F25A 3ZNJ1 4L73A 4K42A 1ZQFA 2JWKA 4I9QA 3VGUA 3FGVA 4P74A 3E9PA 4UATA 4FP9A 3JQKA 2AYBA 2IYGA 4ED5A 2FZCB 2ZZNA 3PYDA 3PW4A 4Z4CA 2KRBA 4RBVA 4PJ0U 2JLGA 3QUTA 5IQQA 5F2RA 4ZPDA 2YHWA 2LBOA 4AQYF 2LQ9A 1LFPA 3EGWB 4J9UE 2IIHA 4DFKA 3B6OA 4O3MA 4PWWA 2IPOB 3QO9A 5AQJA 2DGTA 1C0FA 3MD1A 2QTDA 2HWHA 4KRFA 2OEMA 2XS2A 2FHJD 7FD1A 2G06A 1T7PA 8ICZA 2XZTB 3BF3A 5FIIA 3M6XA 3W9HA 3SAGA 2O67A 5KFHA 1KFTA 3R6MA 3A3OB 1N5TA 4N5SA 5HQ8A 1WCLA 3K4GA 1FEHA 3SMVA 3ENAA 5BREA 4BGBA 4M5DA 5IT0A 3T1YK 5HMMA 1FJGF 2FYXA 3B6BA 1RTJB 3KD5E 4LJMA 2ZUDA 1FWPA 2A0FB 2A6MA 3NMRA 4BR9A 3LDPA 1VIOA 1RFQA 2LYHA 3E51A 2V69A 3WT0A 2FJXA 2B6AA 1FO1A 1XHXA 1X42A 1XMQJ 4X62J 4DV5F 1A76A 4CIOA 1MA9B 3HKZC 5KFSA 3HHLC 2XWXA 1ZXOA 4JI6F 3ITHA 4OX9J 2F63A 1GLAG 1PC4A 2EK1A 1QTMA 4USUA 4Y2IA 1NSQA 5HVGA 3THWA 2W9CB 2GGPB 4S0MA 4KHUA 1NCLA 3MN9A 2YH0A 3VALA 4CESA 3UVJB 4OZ3A 4N41A 2KKPA 1QQCA 1RQNA 4EAHD 5ALJA 1FDDA 3G4SS 3IG1A 1XSPA 1XNRF 5DG7A 2F7TA 1B3TA 3D2FB 3RGIA 4KI4A 4B9MA 2ZJAA 5ALGA 3KWIA 2MZQA 2DGQA 3ZT3A 4ZP6A 2VFRA 1DT9A 4ECWA 2FQQB 1LV5A 4CLFA 3H59A 1NU0A 2UUWA 3DOLA 5ALHA 2CPEA 1WSJA 5KPZA 3H08A 1HKAA 5AQZA 5AI0A 4DU3A 5KT4A 5J2AA 3ISCA 5DDOC 1V3RA 4FYVB 1MDUB 1D1UA 5DZ6A 4OI2A 3TA0A 3VENA 1NMEB 3CCEN 1VCTA 2L08A 3J7YU 1RWUA 5JTIA 4CJLA 3HI0A 5IC4B 2I1QA 2Q1NA 4X62K 2HBYB 2DTJA 8ICQA 5E3PA 2W9BB 3GILA 1DURA 4DPUA 4C0ZA 5DM7Q 4QZBA 1KSPA 2CJQA 2QRRA 1Q8KA 1BNPA 1T9YA 3MEGB 1FRHA 4RWWA 8ICKA 3WZ0A 1LOUA 1KRPA 3IM9A 4DUTA 1RT7B 3HJEA 3CCQS 1W97L 3VHQA 3VGSA 5EX3A 3QPIA 1KVAA 4WKRA 5HP4A 3G10A 3VGLA 2D3UA 5DDYA 2VHGA 4MN4C 2UXCJ 4RUBA 4I7FB 4ETZA 2NXCA 4IS7A 1H3DA 4XH5A 2MQ8A 5AQOA 1W9HA 4AHVA 3S8SA 5IQ6A 7AT1B 3ALYA 4NLBA 2DGUA 4YR3A 2VFSA 2YX4A 3CDWA 1X9XA 4DFMA 4NZ0A 2E9ZA 1ED1A 1FRLA 1CZ9A 3K1ZA 4H0PA 2GO8A 4KGZB 3C14A 1OIAA 3SQ2A 2BPCA 4DR3F 3IAM9 4NLWA 4KYZA 3CC2S 2XLKA 5KFIA 2VDHA 4UB2A 3H1VX 2RKIA 4KB1A 1K73O 1H72C 4O23A 2ASLA 4MF2A 2O4IA 3B8AX 3L09A 4MDBA 1NSAA 3Q24A 2KJ8A 2CPDA 1XHZA 1IJEB 1XNQF 2P9LB 4F3MA 1H98A 4DUYJ 2VD3A 3VQQA 2HGNA 4QQBA 2MMYA 3M7VA 1ECWA 3O6QA 2GLEA 3UDVA 2JOQA 4DR2K 2FPHX 4QIWC 2APOA 1FF2A 3IS9A 3C3LA 3M2VA 1J2NA 4LF8J 1CJVB 4CE9A 5JS1A 5IIKA 1TU0B 2GMHA 2ZH3A 4CTAA 5CZXA 2PO4A 1Q82O 5HR7A 1CG2A 3KLHB 1NK9A 2HBLA 3GFHA 3W61A 2DVIA 5TISU 2EFVA 1K6YA 3N4MB 9ICPA 2I0XA 3I82A 4LFCJ 4E1JA 3FFIB 3CFPA 2KZMA 4K4GA 1MU2B 4A8QA 4DX6A 3AVMA 1XSNA 3BP8A 3M8QB 4F93B 1CVJA 3IA0A 5AK6A 2NLWA 3CD5A 4F67A 1N33F 1U2CA 3OJSA 3OS2A 2PBDA 3SI6A 3T19A 1ASWA 4PAAA 1XMOF 1VQNS 3TO8A 2XMMA 3WXKA 4O5KA 1VIXA 3LPTA 1Q8LA 2AJ1A 2R7VA 4LZDA 2C3UA 3D2SA 4F0MA 4C8ZA 4DUYK 2HK2A 4EELA 2H5XA 4KN4A 4CI0B 3QNMA 4ECRA 2ZEJA 2VASA 5KFEA 2HVHA 2RH3A 1UEKA 4JI0F 2WOMB 2AQ4A 3AY0A 3TX8A 1AZSB 3OYEA 4NYZA 1CJUB 2EHGA 1VGYA 2E1RA 4HCBA 1RT4B 1RTJA 3MEEB 1YITN 4KX5A 1ZQJA 4UY8T 4Z4GA 2D9PA 4I6YA 3OYJA 2JV3A 1W26A 4HDHA 3I55N 3J8AA 3BREA 4CGIA 3CCMS 1N2XA 5F8LA 3TUPA 2UUTA 5ALKA 4I2IA 1NSKL 3F9KA 4RQMA 5HANA 2A6OA 3NVKA 4QIGA 2IVPA 4CWBA 1A5VA 3ZD8A 3CTRA 1QCKA 1JLCB 1RWKB 2GGPA 4XDCA 1RT6B 2LEAA 4OHZA 1T6DA 4ISFA 2V8VA 3D68A 1I94J 1TL3B 2YNHB 3GV8B 3M6GA 4CD3A 1DK2A 4DV4K 3WK6A 4KAIA 1JLQB 2VUGA 4NLSA 3D2FA 1XQSC 3WC2A 3CNQP 3QBCA 2MAXA 1JJHA 8ICVA 3CWJA 2P9IB 1MWQA 1NK6A 3R7BB 4KHMA 2LA6A 3DRYA 1ZQWA 2KVCA 5CD4H 1XMBA 3G8SA 3SPZA 1BL3A 5CHCB 3H20A 1TL7B 2NRRA 2CRLA 1Q3VA 3C0BA 4NZ6A 2O8EB 2QFIA 2MEWA 2OSQA 4ES1A 5M1NA 1S1WB 5HMWA 3BM7A 2C42A 4FDFA 2CJYB 3BSCA 1NGGA 5KGWA 2I5HA 5KG6A 4FZMA 2G0CA 5HQMA 3NOGA 2N7CA 5ALPA 5JXSA 1WD6A 3G9CA 3RB3A 2W9BA 5C24A 3WX4A 1YHQN 4IC9A 1PYOB 3OTQA 2MXYA 2JJ4D 2PDAA 3UWTA 4OMFG 1ZOLA 1F6TA 3SXLA 1KC8O 1VQ7S 4X4VA 1P7DA 3IRXB 1QS4A 5M1FA 2DRAA 1X6JA 3KBBA 5IIJA 3QT7A 1I94K 2Z7JA 2B56A 4RL1A 4QS9A 1MN7A 1VBXA 2HK3A 3ZSYA 4A4JA 1AYEA 4I7FA 1HR0J 4NI2B 3RAXA 4QPTA 2ROPA 3L95X 3ZT0A 2P9CA 4HTIA 1ZM4A 3KK7A 5C2GA 3ICXA 2V67A 1ZQEA 3HPHA 4A61A 3ZTSA 3FBEA 3CJCA 2NXNA 4IUFA 1Y0HA 4CF0A 3VAJA 3I28A 1HUZA 1JQGA 1MWKA 4JB3A 2RLTA 3ZZPA 4BGAA 3EVMA 3PO5A 2RQCA 2M9KA 5E3RA 9ICWA 4ELVA 3BS5B 3P4IA 2P9LA 1DGJA 3QESA 4GY2B 1HX1A 1PSDA 2YQ1A 4ECYA 3E2EA 1HNXJ 2FD2A 1N54B 5DM6L 1BY9A 5IXUA 1KOOA 4NLUA 4NXNK 3QRPA 3HPGA 2B6GA 2MLXA 1MWMA 2CPRA 1CJVA 5D4PA 2Z2MA 2K8CB 1LQ9A 4O3OA 4YDUC 4Y28C 2Y9HA 1L3VA 4KLIA 9ICLA 2CPIA 3DXKB 3QIOA 2FLOA 4PG7A 5GADP 1KD1O 2E5HA 3MR7A 2ZNZA 4JHDB 3KLHA 3RJMB 4DQSA 1GLLO 3V7KA 3K57A 4QWEA 4ED4A 2DY9A 3CC4N 3FFIA 3L2RA 3QQCD 2X3GA 3PR5B 3ZZTA 2F5GA 4CFAA 4MEXA 3OYGA 1MU2A 4J9MA 2QLJB 4YDUA 8ICJA 1GNKA 3EO3A 3O80A 3JSYA 1NJIT 2ABYA 2WF5A 5J2DA 2JFDA 2W1BA 5DG9A 1S6UA 1UWBB 3H8WA 5CY4A 2FI1A 2UU9K 3S3OA 2AIRB 4X4TA 2A3VA 3TRGA 5IIMA 2IA6A 2AD9A 3MUVP 1ELOA 4I2GA 3G6YA 5ETKA 4ZVHA 4R65A 3F56A 4K4WA 1GTHA 1CJKB 4WKYA 3SDEB 4JI3F 3W64A 5GAHI 2B9YA 4NCBA 3KWMA 3U02A 3Q8QB 2MKSA 3GIRA 3RJEA 2WOMA 2GBZA 1AZSA 3Q83A 2B51A 3HL8A 3MX2A 1SJ3P 3UE5A 1CJUA 3FEZA 3CETA 3HKWA 2XIDA 4IO9L 4KE5A 4M63C 5J2HA 4I2BA 2ZC3A 3MEEA 1SGGA 1IKXA 2AYMA 4ED0A 4B8CA 2CQCA 2IA0A 3IV6A 3JS9A 3OLBA 5KFTA 1SS6A 3SMZA 3NVZA 4DMZA 3TTFA 2HWIA 3ETMA 1WN7A 3T7ZA 2FLNA 2VPXB 4IKAA 3GIIA 1RXVA 1RT3B 4LF9J 3FC9A 4ILHA 1JLCA 3UD3P 1EWQA 5B0CA 4M63A 2VF3A 3BBBA 1VMBA 3VQPA 1RT6A 1U02A 3OYCA 5IFMA 1TL3A 7ICPA 2YNHA 4RNHA 4E1MA 2GZOA 2KVQE 2D8CA 5KFXA 2PT0A 4B1UB 3QAEA 4I2EA 2EFGA 1IWGA 1P9QC 3KOAA 1S3XA 1JLQA 3AOAA 3U3GA 5AHXA 4I27A 4XIUA 5DB9A 4EO8A 1RWMB 4K0KJ 1A5WA 3FZ2A 2P9IA 2LXUA 5AQTA 3LDSA 1RWXB 5DJBA 4WFAQ 2W24A 2WB4A 2OZSA 1XI1A 1SKUB 2ETJA 3AH6A 3K59A 4WWSA 2VPYB 4OYWA 3DI6A 2KP7A 3L5KA 2F8MA 1TL7A 5M2UA 1VQ9S 2BXJA 3GR1A 3H4DA 1RBUA 2ALYB 7ICUA 1D9AA 2O8EA 4QYRA 1BO5O 4BR5A 5T7BA 7ICNA 4XPCA 3CCLS 1S1WA 1UFLA 3U6FA 2FB0A 1NOYA 3FR0A 5CZVA 5HAOA 2FDRA 4JV0A 2D9OA 4JI8F 1XBWA 5G5HA 4KTQA 3VAMA 2YHYA 3MGVA 3UO0A 5AI6A 3U27A 2F8SA 2JRSA 3K5NA 5M1KA 4QBUA 5BR8F 4LF9K 2K4IA 3IRXA 1MWYA 3MBYA 2JFKA 2ZE2B 4DR1J 3MPYA 5KG7A 1HHSA 2IHMA 3MXIA 1IO2A 1M5KC 4F02A 5DKWA 2JEGA 4DSIA 1CZAN 2H51B 3OYAA 3M1VB 4CZMA 2HVDA 1S5JA 2KYXA 4F4ZA 2YWFA 4PPDA 2FLPA 4DV0K 1NMDA 4NI2A 3D3BJ 1VSMA 1A6LA 1NRKA 4KB7A 5JICA 3G4SN 2QLTA 2HS4A 1TTHB 2J7WA 2Q3PA 2BCRA 3VQSA 3OTOJ 1I1GA 4J2DA 1RBSA 3AOCA 2HQGA 1TUWA 1QH9A 1VQKS 4ZLPA 3LWMA 3CJ4A 4FWMA 1F9HA 4G9BA 3JPSA 3A8JA 2IJFA 2WW8A 5ALTA 3N9UC 3QZ8A 4J7CA 1A7GE 4BLGA 5EWEA 3M6WA 5D15A 1XO0A 2KB2A 2XYHB 2O8FB 2ZM6F 2VQFF 2B0GA 3HZ6A 3KLFB 3BS5A 3QSYB 2X6SA 3MM8B 3H46O 4X4SA 5IZHA 5B0EA 3G6ES 5DRKA 3GPAA 2AV5A 3PO4A 3G86A 2WB1C 1VC0A 4RNNA 2DNGA 3F5AA 1NGFA 1HUOA 1T9UA 1DEJA 2MTLA 5JVHL 3PACA 1N5SA 2R7TA 2PKEA 1HHQA 1S7IA 1N6QB 4FSVA 4CQ1A 4OLBA 1TFWA 2EAOA 5EE9A 3DXKA 4RW6B 4CGJA 7ICMA 3NGRA 1MNEA 2D74B 2ZIWB 4M5GA 4JHDA 3KK2B 2K7JA 2DGWA 4IG3B 4HH0A 2IIRA 4FYWB 3CCQN 2IMOA 1R6VA 2M8DB 4DQ8A 2NNWA 1C0GA 3IMXA 2Q0RA 4RPZA 2RMLA 5CR4A 3R2DJ 2V6AA 4OHYA 4AUKA 7ICSA 4CLKA 3HFZB 2BJ1A 2XBPA 1UP1A 1YJVA 5KFNA 4CJ3A 3UFCX 4ECXA 2YV0X 1T05B 4M47A 4PGYA 2KJWA 3BF1A 1UWBA 2PFDA 4AYBF 4UZCA 1HEKA 3GIJA 3P31A 1S5LU 3HJFA 2ZUGA 3VEWA 4HH1A 1Q0NA 3CC2N 3G8QA 3KDOA 3R8YA 5ALMA 1C7YA 3K5OA 2ZVSA 4CF4A 4KAZA 1CJKA 3SDEA 1VLYA 3MM5B 1WDTA 1EIYB 4ZVPB 3QU5A 2LFVA 3ZDBA 3LGHA 3F5TA 3L0QA 5C5JA 4E2FB 1Q16B 3CUNA 3BBCA 2HQ3A 3AVFA 4J90A 3IBWA 4FS1A 1LW0B 5ALQA 4OLPA 4G1QB 2HMXA 1KNZA 3NDKA 1YZ6A 4YY3J 1WSFA 3ENBA 3LK9A 3MCPA 1GAOA 1XTZA 3W5XA 3RRGA 2VKZG 2ZH4A 2ZXIA 1YGYA 5J2QB 4PG5A 3AO3A 2IDEA 3T5HA 4OYIA 2EFQA 4YNQA 1QSSA 4RBTA 5DZ7A 1G2EA 1Q7LB 3MTKA 5J2IA 2P51A 4PXCA 1S49A 3GTYX 5KFBA 1HYSB 3AVNA 4K50A 2OP5A 4A2BA 4F3OA 3PX6A 4DTUA 3KMSA 3NF8A 5IIOA 3ZEUB 1RI7A 4KY3A 1WSGA 4FK4A 4PXBA 2DPNA 1TL4A 4LRDA 2NS1B 4FKXA 3NF6A 5AXLA 3UR0A 2MHNA 2B9EA 3RBXA 4F04B 2R7WA 4Y1DA 4J37A 4DSFA 1YDLA 1VQNN 5HQLA 5D49A 1Q53A 3AT1B 4CP5A 3FZKA 3TZYA 4WJBA 1KVCA 5AICA 4FYXB 4ZCIA 1IBKK 4BG9A 1RACB 4JN4A 2RQ5A 3VAIA 4RQ7A 5J0PA 1L8OA 2ZH8A 2AW0A 2BKPA 1T9VA 4YY3K 2LCWA 5FRNA 1UPPA 1G4CA 5J2NB 3HSDA 4X64F 4CZGA 3VERA 2Z4PA 3QT6A 4I6MB 5KT3A 4FKYA 2QB0B 1KLNA 4A8YA 2IFXA 2BM1A 4QW9A 5KFAA 4RW7B 4LQ9A 4NLYA 4X4PA 2XI9A 3T79A 1QQNA 1U45A 3H98A 3SQ0A 4DLGA 1U1MA 2KM8B 3PCOB 4O44B 4EBDA 3AFGA 2ZE2A 4J91A 3VQ7A 1JL2A 2DEJA 1VQ8N 4DS5A 3CJ5A 5LXYA 4KLEA 3M1VA 1L7OA 3R5BA 3TJ8A 5E3QA 4EHUA 3BGRB 3VAGA 4FXWA 1J97A 4TY8B 3CJAA 2X1AA 5HBMB 1VSIA 3T9ZA 1S4FA 4ISEA 4JI4J 1K9MO 3J80Y 4PHTX 3C21A 2AJFE 4GLXA 5GADU 1S97A 3M8WA 4YMOA 1L6NA 8ICUA 3MAQA 3MFIA 3UN3A 3AN1A 4ZPAA 2MQNA 4FPBA 4WYBA 5CZ2A 1NSPA 3FBFA 2HZAA 2PE8A 1ZH5A 3PXGa 8ICMA 1R8CA 5HHIA 3FDSA 1ZQBA 1NPRA 3J80O 1B0TA 3KLFA 4W5RA 1DQ8A 3MM8A 1VQ4S 3CCSN 2YHAA 3I0RA 4DCPB 5FJ4A 4JRPA 4YB6A 3QATA 4M7XA 4G65A 3C94A 4CZKA 4KH4A 4OLAA 4LF2A 1DRGA 3SBGA 1Q79A 5AM5A 5HI7A 4JKGB 4LF6J 3A2FA 2RQKA 1WKJA 5CH7B 5KFDA 1N6QA 3J7ZT 1JJ2M 3I4PA 1VQ7N 4BR0A 4MFCA 2A2CA 4RW6A 4WXWA 2D1KA 1AW0A 4IG3A 1DARA 2DISA 3VZIA 1C20A 4GVBA 4OGEA 2FF3B 3PMNA 3O9SA 3OFHA 3LAKA 4JI4K 1IJFB 3HK2A 3T1HJ 4LRAA 2HMPA 1JNZB 5THWA 4TQSA 1ZBFA 3T1AA 2BA9A 3KG1A 1KS2A 2LHTA 2GQ2A 2HVZA 5MAOA 2R18A 3CXCM 2ZH5A 4LVSA 2H3EB 1ZAVA 4RQ3A 4U7BA 2DRBA 2FC9A 4F3QA 2P9PB 1AUDA 1RA7A 2UV8A 4Q7AA 1PVQA 1P6TA 1SKWA 3NRZA 1GH8A 3IM1A 4A8FA 1Z05A 4FYDA 3CM6A 2D1CA 2HHHF 4DPOA 2J4RA 2WBRA 1OY6A 3MM5A 5SUHA 2QA4S 2DO4A 4DKWA 3KFUF 4M5KA 1NNLA 1E4GT 4IL6U 2CH5A 1GTEA 4LF6K 2F8HA 4PL8A 1U8WA 2FVQA 1LW0A 2NUBA 3KLVA 1ZD2P 5D0HA 3ZFVA 4YMEA 3O9RA 4G1QA 2NZ4A 3O4NA 3MI7X 4OCZA 3SSQA 3OXGA 4FWNA 3AA5X 1FO4A 5G0RB 4YD2A 1N32F 3E58A 3KUGA 3FZHA 5J2QA 2HOEA 3R9PA 3H5XA 3N7PD 3MHYA 2GHVC 2YWHA 4G1IA 2B9XA 8ICBA 4H03B 2V94A 4NEYA 4UUXA 3I4HX 4JD2B 3NGTA 4W92B 4PKDB 4RO0A 4B17A 2VFVA 5AQNA 5KOXA 3QEBZ 3ZEUA 2HMIB 2H3FA 4PG4A 3FZBA 2CYYA 3IGVA 2E8OA 1HD0A 4DCOB 4DPWA 4YHHJ 7ICLA 2C28A 1Q7YT 4KITB 2HHXA 2I7NA 2DNOA 4XQ8A 1ZD4A 1XO1A 2E88A 1Q86O 1FRJA 3KDNA 4RT2A 3PJXA 5J0RA 3R3LA 4UARA 3BGLA 3O2IA 2RS2A 4M5HA 2ZIXB 2MUTB 2SXLA 3FUYA 2BOAA 2ZBQA 4GKJK 3W60A 2GV1A 1X4EA 3AA3A 4OD0A 1HBOB 9ICNA 3C28A 2FPLA 3UMCA 1A6SA 3IWXA 3QLHB 2QEXS 1ATRA 5AQQA 5AE1A 2KM8C 4CH1A 2I8EA 4QR0A 4OZ0A 5J2GA 3RYLA 4M3ZA 3CNHA 3LM9A 4CK2A 1D9DA 4RG8A 5J2MB 3RF9A 1FNOA 3FGUA 3R5CA 3FM9A 3T1YF 3IR5B 1WC3A 4I6MA 5MLCQ 2FJAB 2QB0A 4XA5A 4LFBK 1HWIA 4RW7A 3HRGA 2XULA 4RU2A 1N63A 2ZITA 2VG6B 3B78A 2Q4TA 4O44A 2R7SA 3L3VA 3NS6A 1FDAA 4EZ6A 3QBXA 2MDAA 1O0PA 2F9TA 1N5XA 2AZ1A 4H0XB 4KKOA 1ZQOA 3WQPA 2LM4A 2JEJA 5HO4A 3M6UA 3FC4A 1V3ZA 4M95A 1RXOB 1EARA 5M1PA 3BGRA 3NGZA 2LEPA 1S0MA 4TY8A 2G8IA 3J80U 2CQDA 4DG1B 2OSRA 1KR4A 4QWBA 1R31A 1WTBA 4C8LA 2RNEA 3D6MB 2QC3A 4OYOA 2WHEA 5AQPA 3NNAA 3SQIA 4M42A 3VQ9A 1OQ6A 3BN4A 3PHEA 2ZJPL 1QLNA 4C11B 3QU2A 3PFOA 1NI3A 3N4WA 2N1RA 2XZDB 3L3CA 1VQ9N 4KREA 9ICSA 3HWTA 2E8MA 2E9RX 1FHTA 3ATUA 4DMNA 3TQEA 1BGXT 2V4JB 1ZJNA 4IO9Q 3CCLN 5CA7A 2ASYA 1J2VA 4GKKJ 1GXTA 3HT0A 3QAUA 4UAVA 3F2BA 1MA7A 3E9OA 4F2SA 1UJ4A 1VJWA 2AT1B 1S6PB 5FP0A 1PBUA 4ISGA 1VDHA 4DN9A 5JUMA 1BE4A 4X4OA 4JKGA 4ZK7M 4LY7A 3C29A 4B9TA 4GMJB 4B3TJ 2E5LF 4EGLA 1SQEA 1CJTB 4JI2J 1S5ZA 3FZLA 3V1RA 2E2OA 2X1BA 2ZOMA 4Y0WA 2CA9A 2YQ3A 3WK7A 4I56A 4NASA 3NRBA 3CJ0A 4P4PA 3Q8MA 1X3NA 2VBXA 1EHWA 4DPTA 4J9KA 2OGUA 5J0XA 2Q0ZX 4URSA 5AKKA 2NRVA 3NCPA 1U7LA 2P9KB 2KVSA 3JTOA 2R8IA 1PGZA 1HNZJ 3QUCA 1NWKA 4YQWA 5A8WA 4BBYA 3KK3B 1YXQA 2P9PA 1L3SA 3GSDA 1VQKN 1J5EF 2DKOB 1IBLJ 1MN9A 1OVQA 2MZSA 2CQ0A 3BEGB 2KIVA 3BKFA 2Y8WA 3U8XA 3A1YG 3M8YA 1K1QA 3QYYA 1FJEB 5KGXA 2Q79A 5AKIA 2DTUA 3G6EN 5ALDA 5HVHA 1KFDA 1SV4A 1FWLA 3SJHA 3OS0A 2RHQB 1K8KB 2QO3A 4C4WA 3VV2B 3NCRA 3W3DA 3NMAA 1YWXA 4KGVB 2PEHA 4DR2F 4C0HA 4KH5A 3AVIA 3C2PA 3V9WA 1RK8A 4JWNA 2MB0B 3UXOA 2FMQA 4JKEA 4FO0A 2VG7A 3C5GA 3N7SC 5KFMA 2QX0A 5AT1B 3GLJA 4PZOA 3K9JA 4FM0A 1CXQA 4W5QA 1O5JA 2FBYA 4YB1P 2FXUA 3WKDA 2V4QA 1B7FA 4B3RF 1JLFB 1CRXA 3WNGA 3GIKA 2HMIA 3SQOP 1HNZK 1VQ5S 5HK4A 2AX1A 1X5SA 2VDIA 2Q2RA 3C95A 1N62A 2HBRB 3TSPA 2KE7A 4OV6A 2G8HA 4ED6A 4QIFA 1EKSA 4ANEA 3L2QA 2ZIXA 5E5NA 2MUTA 2DB1A 4Q2LA 1CI4A 2ZH7A 3QU4A 1RKJA 5DQGA 2W9MA 1UVKA 1HBOA 4KC5A 3KK1B 1XR5A 2F8KA 3PRVA 1FX2A 1M1KO 2BJ3A 3LPEA 3QLHA 3LH2S 3Q2TC 2Z2LA 4OYPA 1JCEA 3MCAB 4BC7A 4R79A 3ENOA 1ACMB 3J7YI 1ZQYA 1HW9A 5JVHQ 5TKWA 5CXTA 1JXEA 5AJ3J 4DCJB 3RW7A 4MDAA 5J2MA 4MTPA 3ETLA 3S9HA 1IR0A 2CGLA 3N79A 5IT4A 4WF9L 3CC7S 3SNNA 2W8KA 2YNGA 1K8AT 2UUCK 3MD3A 2PFPA 3TVKA 4U67L 9ICEA 1IH7A 1LEOA 4E3SA 3QEAZ 3JPPA 2VG6A 1KVKA 2UYTA 2E1ZA 2Y1LB 4EFHA 2ZHOA 1DLOB 2GJFA 2DNHA 1QQ7A 2EANA 3IC1A 2WBNA 4HCCA 1Y3KA 4MH8A 4B9VA 4KJIA 3JSBA 3MUMP 4GV9A 4K43A 5AQYA 3EWGA 3S01A 3NVMA 4IOCL 1YLXA 4EBEA 4Y2UA 4DG1A 3NL0A 1A9NB 3N5FA 3QFHA 4DV4F 2F9WA 4Y2MA 1HIYA 1UFWA 2XRIA 1IQTA 4IWVA 3CG7A 3P1GA 2V63A 3ZTPA 1Z1BA 3AVHA 2XI2A 1BA0A 4H8KA 4UW9A 3I5CA 2KHQA 5AZJB 1DFDA 1GMWA 4FZZA 3OBWA 3DDHA 1GO3F 5GAGI 5D0EA 3N28A 1HIWA 2V4JA 4NPOA 3LQVA 4CJTA 1WEXA 3PW0A 1FDBA 1EQYA 2FSJA 3DDNA 3NEKA 3HLUA 2FGCA 4LSZB 1PIEA 2WMMA 2P9SA 3U1NA 3KUHA 3PM9A 3OLAA 5EGYA 4UB4A 4WFBL 2MLZA 4EI2A 4M9GA 1H73A 3E01B 3CJ7A 1IIPA 1OY9A 3JSRA 1CJTA 1BNOA 1Q81O 3THTA 4P9SA 3BEXA 4M5NA 4TU8A 2W3SA 2B8PA 3CPWM 1NAQA 2L9DA 5ETTA 2BUNA 4Z4EA 1S99A 1GQEA 4RZRA 1TK5A 4CIEA 4HACB 4Z4IA 4U95A 2QL7B 2MZTA 2V7ZA 4NLKA 4CI6A 1GEHA 2HEKA 3ZSVA 2V8PA 4AILC 2VGMA 1NDLA 2P9KA 2PMZF 1NGEA 4X66F 4LR7A 3BPSP 3LALA 1U26A 1NBWA 3KK3A 1QQOA 4FF2A 5DB8A 3UB5A 3CB4A 3A5MC 3VQDA 2ACYA 3PIPL 4R0EA 3AAQA 1S6OA 3QNWB 3HZEA 3IXQA 3ULEB 2GH1A 2HNZB 2EX3A 2G0IA 2OFHX 2OPSB 2XMVA 4TU7A 4BC2A 3AAPA 4IJNA 1T0TV 5J8YC 1NM1A 1B9DA 3D1HA 1SIZA 3M32B 1Q78A 1VQ4N 2IJRA 2YWKA 3EVOA 2YKMB 3D1OA 1T9WA 2YBVA 2J9DE 3PVXA 1K8KA 4DV3J 2EK6A 2ZKTA 1PYSB 4KHQA 2K3KA 2V7YA 3O44A 2BYCA 4JKBA 3MDFA 4OJGA 3PW7A 4LFAF 1S12A 2O1PA 3B4MA 1JRPA 2D0AA 2QKKA 2R9LA 4NXNF 2E29A 4PL2A 4C8OA 4KGKA 4AYBC 1J27A 4GO7X 5ETLA 3AODA 1SQKA 3LGMA 2WSEC 1HNWJ 5J8YA 3H1QA 4ZN1A 2QA2A 2DKZA 2FPMA 3MMCB 4J9OA 3CCWA 1WB9A 2JVOA 4PHAA 1SJ1A 1NOMA 2G09A 4R66A 2V52B 2B5JB 3NRWA 1F5CA 3HPOA 1JLFA 3LDAA 1NB7A 3WNHA 3GOIA 4WQ5C 1WOSA 3IP0A 3KKFA 4R5PB 2QARB 1O13A 4RU9A 4FCYA 4E7KA 3S7RA 4CLUA 5KFLA 4AHCA 4TNOA 1UJ5A 4V19S 2W6LA 1TQLA 5CA5A 4ZVQB 1SIWB 2E1AA 5BN9A 9ICCA 2ZTCA 1FTCA 3A0BU 2B4OA 2Q66A 4FJHA 4ILLA 4DL2A 2UU9F 5CB1A 4J2EA 2H3IA 2MKYA 3ONQA 5KOWA 1T3OA 1VDVA 2B4UA 4NE9C 2QV6A 2X74A 3LM2A 3TW0A 3G25A 1XSLA 1J5OB 3KK1A 3R8EA 5ALYA 3HD2A 4DV3K 3I0SB 4R64A 2QA4N 2G8WA 2YHXA 1KW4A 1J9AA 1VRQC 4M7YA 3OFFA 1N36J 5KNIA 3O1WA 3ULDA 1N0VC 2MJNA 4B3MJ 3CGIA 2HSEB 4ECTA 2Z30B 2ZBCA 2HFSA 4FJXA 3MPWA 1V4SA 3QFUA 3MWTA 5DDMA 2Z57B 2CAJA 3L7UA 5HR6A 3UD4P 1MW7A 3G87A 4P2XA 1PAUB 3CJ3A 3AARA 4NXMJ 3D0GE 4M3UA 5CRXA 1UCNA 1UWAA 2B4JA 2HS0A 2YMLA 3VA0A 3RG6A 1DQ9A 3UNYA 3KVGA 3BO2A 2DCLA 1DLOA 2DNZA 3I8DA 2Q6BA 4YOUA 1VHIA 4M5LA 4IRKA 4ANCA 4X4UA 3LDOA 2IMWP 1KHWA 2GX9A 3ADAC 1ZD3A 3TWZA 2ZGZA 1YJNS 3OUYB 1D5AA 2FHOB 4HKQA 3EW9A 3WQUA 5AZIB 3FCHA 4YN4A 1SQGA 4DSEA 3OVBA 4CZHA 5RUBA 4A8SA 2LYAA 4WTOB 3QEXA 2CJBA 3DKDA 1JALA 4M94A 3FMWA 4LIRA 4NM2A 1C1BB 1VJQA 2XLIA 3RB0A 1Z4NA 2G2OA 3F73A 1SL2A 2G9OA 1N36K 2F40A 5AZJA 2CQ2A 3CCUS 3PW5A 1D09B 4MK9A 2QEXN 1S10A 2IM2A 1LB2B 2QSFA 3BQ7A 3DHWC 4GO5X 5E26A 9ICKA 3AO5A 3TP2A 1OYDA 3EX7B 3H8JA 3PLAA 1PO6A 3ETOA 5K8MA 1M6YA 2JLFA 1IVZA 4DOBA 4IO8A 2NRHA 2YKNB 3VEOA 4PG6A 2MLYA 4Z37A 4M3RA 1N88A 4JV5J 2P35A 4RUAA 3DOKB 4CF3A 3LP1B 3E01A 5T7LB 3L2UA 4DTNA 2KJ9A 2G4BA 1HI1A 2ZG6A 4UQGA 3N01A 5AI8A 1X1PA 2HRTA 2HF4A 4FBTA 3QEVA 3KHRA 1V5VA 1LXNA 2VGNA 9ATCB 2YQEA 1LK5A 4HACA 1X31C 4EMDA 4KH0B 3UW1A 5AQWA 1YT3A 4IG0B 3MDCA 4EP5A 4PWUA 1LW2B 4DV0F 3EJMA 1WC5A 1DTTB 2IBOA 2YWEA 4OL8A 2IHNA 2B43A 3S41A 5B0AA 3SEIA 4WP9A 3OYBA 3W63A 1YQHA 1FKPB 4YXJA 2WVBA 3WC0A 2BVZA 3ULEA 2HNZA 1B7YB 2QLBB 3CDEA 4JI7J 3SLCA 2OPSA 2BJ7A 3KD3A 4ILJA 3C15B 1MN8A 4P4OA 5I3PA 4DTJA 1NGCA 1SC6A 1BPEA 4WZMA 1Y88A 5A8RB 3SMPA 4FM2A 2G8UA 2FY1A 1RHRB 4OQJA 3FRYA 2YKMA 5AI4A 9ICVA 2FDNA 4EEKA 2KFZA 3BGUA 4BC5A 2M5YA 1BUPA 1AT1B 1SV5B 4CM0A 1ZQHA 4P2FA 1G7CB 4MFFA 2DR9A 2ZGYA 4ECSA 1KCFA 1MLAA 1ZYQA 5HP1B 2O4GA 3IFRA 2KG1A 1K9MT 3MMCA 5KI6A 4J5OA 2GWJA 4YDDB 4FZLA 3I8BA 2E4LA 3KYLA 1HKCA 4W90B 5EUHA 1DGKN 4JEPA 2B5JA 1YVFA 5J0YA 4I2QB 3L4BC 3NASA 4B02A 4UOFA 2ADCA 2AF6A 4CDGA 3HSZA 2DRDA 3H5YA 4USWA 1MWZA 1X5TA 2CJ9A 2W7AA 4ACOA 2XSFA 4FJGA 1NU4A 4R5PA 4YOTA 2QARA 4MKAA 4QR2A 2OANA 4IH6A 2K1RB 2JH7A 5AQRA 1K1SA 3A0IX 2ZJPQ 3MM9B 2G5HB 2RAQA 4L76A 4BROA 2YWWA 2UUBJ 2XHBA 1P90A 3JPOA 1EO1A 4K4XA 4YFKA 5CHGA 2EQYA 1FWKA 1K44A 2J7KA 2VKQA 1WI6A 4X4RA 3WIVA 4B3MF 1J5OA 2NQPA 4RNOA 3BSOA 3L8BA 3I0SA 3BV8A 1W2BR 4WU2A 3EE9A 3AQPA 1FT8A 4DFPA 3VEXA 3VTIA 2EFOA 1KBUA 2X51A 3THVA 4BDPA 4ZH4A 3TQ1A 3G2XA 1YG0A 4K2XA 2E2PA 2PZSA 1F5BA 2GWSA 1RG6A 1B4FA 1RWPB 4W98A 4U8VA 1U1KA 1SWWA 1RTHB 3P5BP 1SKSA 4OKEA 4YMMA 2VBYA 2E7WA 4JS5A 4AL7A 4N77A 3DMJB 1P8GA 2D3O1 4MK7A 1N8RO 1WWVA 1JWWA 4CEOA 4C48A 2JEIA 4BVOA 4F91B 2KSOB 5M1OA 4LF4K 3SIPB 4CNYA 1VHFA 4DV7J 4V1Ak 3CCVS 2J6SA 1JB0C 3PEJA 1S48A 3GJRB 2Q31A 1VQ5N 3OUYA 2VQEF 4CZJA 1R8PA 2CDRB 2Y0BB 3BKTA 3MEKA 1SL1A 3AA4A 5AZIA 3NS5A 2UUBK 4DTXA 4BVPA 3RR7A 3NAEA 2L5YA 3QICA 2UV8G 2BGGA 1LFWA 2HB5A 2DHGA 4CO4A 3CERA 1CPZA 2JNJA 2GJIA 3NXZA 4WZQA 2OYYA 2PD1A 1C1BA 4AXIA 3FLCO 3V2UC 1ZETA 1S6QB 3TVYA 1WSEA 2R42A 3TR8A 1NOZA 1LWFB 4XH1A 1IBKF 2DKXA 4DR4K 5BYRA 2LECA 1UJ6A 9ICBA 4JKAA 1OY8A 2YX7A 4K4IA 4J03A 3RVCA 3ENHA 3RBZA 4FJMA 4FWPA 7ICJA 4QZGA 2P2CB 5M1QA 3CMQA 1S0OA 2HW3A 1RSCA 2ZBIA 4O4GB 1TYQB 4Q44A 3B54A 2MQMA 2ZZMA 3DRXA 5H9EK 3BQ0A 3UKRB 5KT5A 1MSWD 1UFKA 2YKNA 3CC7N 1J2MA 3ZXWA 2KZZA 2D69A 3KMQA 2G13A 4FZXC 1YF5L 4LF7J 4OIXA 1BIUA 5F8IA 3LP1A 4OPJA 3OJUA 1VR6A 2E7VA 5T7LA 4FWKA 3WEEB 1LK7A 1TMMA 2VG5B 2LU2A 4JK8A 1ZQAA 4WFNQ 5FPEA 5AM4A 1Q86T 2MRLA 4ED7A 3MXJA 4CZLA 4CHYA 4QZ9A 4GNIA 1YI2S 2XLJA 4ZCKA 5KFFA 4FNIA 1OUQA 5J2PB 2QMWA 1TFYA 1YKWA 1PJ5A 1LWEB 3QIDA 4CJKA 1X9WA 4IG0A 3AXMA 1JJCB 1LW2A 4TLQA 3FE1A 2BCVA 1RAGB 4K4UA 2UXBJ 3BSNA 4FJ9A 2RN2A 4MFBB 2IOFK 1TKDA 3M6VA 1UAWA 1KHVA 4CK3A 9ICHA 4GXKA 3CJ1A 1HHTP 4QZ8A 4XRHA 2HNYB 1H2TZ 3TPQA 4BQZA 1FKPA 1XWLA 3OSPA 5AKYA 4KHPK 4FFDA 4LH4A 4UAYA 4JI1J 4JB8B 4YXMA 3C15A 5A2QY 3N5BA 4EWTA 4JYAJ 1SZPA 4WYLA 4ELTA 1RTDA 3KFWX 5EXWA 1SH2A 1TKXB 1Q9YA 5DB7A 4WF9Q 5IWAK 2RQMA 3N6LA 3VQEA 1DRZA 3TACB 3CJKB 1QAIA 4HHTA 4U67Q 4C4SA 2PYJA 2GMLA 1DQAA 1FNXH 3ZZOA 4Y2KA 1SV5A 2JHDA 1CULB 1WSIA 5A2QO 5ADXH 4NRUA 1ZQTA 5HVFA 1WNEA 5EWFA 4F3TA 3D0PA 2W41A 5HP1A 3ZC4A 2JGAA 2F3NA 3OV7A 2C2RA 2FZKB 2RUSA 2KJ5A 4OPAA 2BCUA 3WK9A 1WEZA 3CHWA 3IHQB 4YEAA 2P5VA 4I2QA 2UXDK 4IOCQ 3G0ZA 3OFEA 3AOBA 1QQMA 2UXBK 3LW5C 4Z4FA 2P6RA 1VYAA 2C2MB 2CXEA 2D7SA 2IM3A 4E7IA 1U1NA 2XC9A 4CJQA 1RWWB 1S0VA 2ZVIA 4PHPA 4R8UB 2LQBA 2K1RA 1ZBIA 3R97A 3VESA 1UVLA 1JCFA 1SC4B 1R8AA 2QWQA 1OO0B 4C9DA 3O3GA 3MM9A 4JI1K 4UF4A 3MCMA 2YNFB 3MPUB 2N3OA 1WJ9A 1PJ7A 4P0PB 3ILOA 4CJEA 1T44A 2KNJA 4DR5F 1X8DA 2ZDPA 2UVWA 2A2DA 4NYNA 3EUNA 3QWUA 3C16B 5CYMB 1T95A 2QL5B 2DNKA 4US8A 3JS6A 2VIXA 4WFZA 2B9WA 4GXIA 2RF2B 1QAXA 1LWXA 4GIBA 3P38A 1ILYA 2A1AA 3DLHA 3QUQA 5AM1A 4W5NA 4BJQA 1NJYA 3CDBA 4WFBQ 2LPEA 1UW4A 3GCXP 2MKKA 4LF5K 4CT8A 3G6XA 5ELZA 1RTHA 4NLVA 3IGNA 4AQYJ 3JQMA 1GXUA 3LDNA 5AQUA 3CI5A 2BV3A 3DMJA 1Y00A 9ICOA 1RWVB 1WWUA 2WFBA 4NA2A 4Q43A 1X40A 1WTFA 5AKLA 1OH8A 1ZQRA 1VI7A 1C0TB 3MR2A 1R7IA 4QIVA 1TVRB 3QRQA 2KSOA 2DNLA 2EZXA 4FPAA 4FZYA 1GLBG 4FVUA 3SAFA 3W65A 2MQQA 4C3LA 3PNIA 2YB4A 1FJGJ 2PSZA 2MYFA 3HM8A 5GADI 5I4MA 3KIOA 5D46A 3BN7A 1OVYA 1AUSL 1BCMA 1SAZA 2MZJA 4K5RA 3PIPQ 2BABA 2I7PA 1RDRA 2Z58B 4PXEA 4NY8A 4DV5J 4KLFA 2WBMA 5KFVA 2FGOA 1S6QA 3H2VE 4JI6J 4NWIA 2CNKB 2EPIA 3FRZA