2HHQA

O6-methyl-guanine:t pair in the polymerase-10 basepair position
Total Genus 217
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
217
sequence length
580
structure length
580
Chain Sequence
KKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structural basis for the mutagenicity of O6-methyl-guanine lesions.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords 5'-D(*CP*AP*TP*(6OG)P*CP*GP*AP*GP*TP*CP*AP*GP*G)-3'
total genus 217
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2006-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2hhqA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 2hhqA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hhqA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2hhqA01
5F9NA 9ICOA 4ECZA 4R8UA 4CJSA 4DQIA 1RYRA 4FM0A 1RDAA 2EX3A 2IS3A 3TI0A 4KO0A 5DMRA 2W9MA 4PH5A 4CESA 4BGDA 3Q8SB 5L1LA 4I2EA 3VQAA 3NE6A 2W8KA 4LSNA 2Q3SA 1LW2A 3BJYA 1S9FA 8ICJA 5CB1A 5KFIA 1J9AA 2V4RA 5JS2A 4YG2A 4FLYA 3L2UA 3C23A 2JEFA 1KDHA 4DS4A 2DPIA 4PQUA 5KFRA 3HL8A 3BDPA 1NKBA 5J2IA 2ZE2A 4IG0A 3K5LA 5KFWA 3PO5A 4DOAA 1RZTA 3LDSA 4DS5A 4JV0A 4KLQA 5IIMA 2RDJA 2ISOA 3K75D 1TAUA 2ATQA 3DLEA 4YR3A 4F4ZA 4CJUA 4CHOA 4E7JA 2X78A 1I39A 4Q0BA 3TAPA 5KFZA 4KHYA 2HVHA 3VQPA 4DTPA 4RQ0A 4DFKA 1D8YA 3NBPA 3AO3A 5C5JA 2YHAA 5J1EA 3C95A 1UWBA 3ZDAA 1DGSA 1BCOA 4FJIA 2ZD1A 2E4LA 4UB5A 1TKTA 2H5XA 1JLFA 1RBVA 3RH5A 2YNFA 2JZBB 4MF8A 4UAWA 2Z1HA 4KKOA 3OJUA 4TUSA 3CM5A 2X6NA 4F50A 2HVIA 1SUQA 2ZTCA 4RNOA 4Q43A 4QW8A 3RJEA 4JK1A 4CGJA 3SPYA 4UBCA 1XC9A 4WE1A 2RDIA 1TKDA 4NM2A 1X9WA 4KRFA 1LB2B 2G8UA 8ICSA 1D5AA 3T5HA 5KFDA 4ELVA 4E89A 3HVRA 3KLFA 3ZD9A 7ICGA 4F2SA 5D4BA 3N97B 4CGGA 2F96A 1NK4A 1O1WA 4FLUA 1WAFA 1HQUA 4F3TA 1EETA 3G10A 2BANA 1KTQA 2PY5A 3C21A 3ZSXA 4M0AA 1RDCA 4DFPA 4OJRA 3PR4A 4FK2A 5EOZA 3NGZA 4J9RA 1NJWA 1LAVA 3V9WA 1X2IA 3T3FA 1ZQJA 2BPFA 8ICQA 2PI4A 3PMLA 4F4WA 3DLRA 3MFHA 3P5JA 2P5OA 4DSIA 3MECA 3QNOA 4JWMA 4FLVA 3MGIA 4W5OA 3ZSWA 4IDKA 4K4HA 3V1RA 4AHSA 1ZQQA 3H8WA 1QSLA 4R64A 4RNNA 1ASWA 3V6JA 4YVZA 4HUGA 4HHTA 3QLHA 1JLGA 3HPHA 3C2MA 5HHIA 1C0TA 1BPXA 4I2QA 4BE0A 4Q8EA 4FJ9A 4M3YA 3SZ2A 3ZT0A 3A2FA 1XWLA 2VA8A 4RW7A 3H08A 5CY4A 2FLLA 2NRVA 3ZT1A 4YFKA 4ED7A 3VN5A 1Q9XA 3KHRA 2Q0ZX 5KGXA 4KB0A 1TKXA 1IH7A 5DB8A 4RW6A 2R8KA 1YTUA 2XY8A 1ZQSA 4DLEA 3B6PA 4RPYA 4ZHRA 3K57A 3VQQA 7ICSA 1UA0A 4PA1A 2GBZA 1JN3A 1TV6A 2VA2A 4IRDA 4DMNA 1S97A 1NOZA 2QKKA 4TUPA 4QZEA 3OSPA 4I2FA 4EBEA 4NYFA 3ZSOA 1QSYA 1L3VA 5HRSA 1XHZA 4ECTA 5J2DA 5KG3A 2RF2A 2LYHA 1UAXA 3LP2A 4I2GA 3PMNA 4BXOA 4PUOA 1AROP 4P2HA 2BE2A 4NYNA 4CIEA 3ZSRA 1ZQUA 4PGQA 3UXNA 1FXXA 2W9CB 4UB1A 3TARA 2G8KA 3RAXA 3SQ2A 1T3NA 3T5LA 4DU1A 5HLFA 1A5VA 2C2RA 4EEYA 4KTZA 3M8QA 3TQ1A 4RUCA 3RJGA 4KV8A 2KZ3A 4YNQA 4OGCA 1Z3EB 1DOQA 5J2FA 1UA1A 4CEEA 1BL3A 2EHGA 3RRGA 3FDSA 5J2NA 9ICRA 4CJTA 1NKEA 4KLTA 2VWKA 1JL1A 4KLLA 3LPTA 4ELUA 5T7BA 3G6VA 4I2JA 2O4GA 5CWRA 2RPIA 3RJHA 5HMMA 1S5JA 3MR3A 1YTAA 3C94A 9ICLA 1ZBFA 3MXIA 4YQWA 2KW4A 4DL7A 4OVLA 3KLEA 4O5BA 1JLCA 3RJFA 4DFJA 3PW7A 1FK9A 4PGXA 4F5NA 2BCVA 4FJXA 3ITHA 3LALA 3C5FA 4RU9A 3V9XA 4CJQA 7ICIA 4Q5VA 3TAEA 4KTQA 4N56A 5HHHA 3G6YA 8ICUA 3G6XA 3BQ0A 3RMCA 5DDMA 3MR5A 2B6AA 1SKSA 4HUEA 4YN4A 2ZUCA 1RILA 2VG5A 3VQ6A 3DYAA 2HHSA 4J2DA 3O3HA 4CEQA 1EP4A 4MEYA 2XGPA 3ZCMA 2BGWA 1ZQKA 3TAFA 1U45A 2PFQA 1BI4B 2XY7A 4X5VA 9ICHA 4QCLA 4I28A 3CFPA 2OA8A 9ICTA 3CFRA 4ECVA 3MR6A 2Y1JA 4FXDA 4LD0A 5HMLA 2IDOA 1EXNA 1IKWA 7ICHA 4C8LA 2JZBA 4CHYA 3AVLA 1BIUA 3NH0A 3RWUA 4FZXC 2D5RA 4CF1A 4FJJA 3Q8RB 5BOLA 2R8IA 4MFFA 3PW4A 4Z4IA 3PX6A 2P1JA 4DQPA 2OPPA 5HROA 1KSPA 1ZQGA 3H4BA 2JEJA 4F5PA 1TL1A 2ZJ8A 4B8AB 4MF2A 1IO2A 3VQ8A 3ZSVA 4RG8A 8ICEA 5KRTA 4QZDA 3LP0A 1HJRA 1B92A 5KTQA 4PHAA 3AO2A 3JPRA 5CYMA 3HX0A 4YMNA 2J6UA 3JSMA 4TUQA 1TK0A 3O4NA 1V9PA 1IM4A 4ZTFA 3OYGA 5KFCA 4FJ5A 3ZDEA 5FRMA 3LWMA 2PI5A 3RB0A 2BQRA 1T7PA 8ICXA 4M04A 3K5NA 4B3OA 1RT1A 5KG5A 3OVNA 3VA3A 3DMJA 3S3NA 4O44A 2X74A 5KI6A 2PZSA 4JV1A 2LSNA 4CK3A 4BWJA 4I2CA 4MQ3A 1QQCA 2J6SA 3EW9A 3OYDA 7ICOA 3RJJA 9ICBA 4ECQA 3SUQA 4CJVA 4ECRA 3K5MA 5DBCA 1HNVA 5J2KA 1S6QA 3GIMA 3DLBA 4NCAA 1TL3A 4EP4A 5J2AA 4CGDA 2ZJAA 3C5GA 2HHUA 2DTUA 5CR0A 1WAJA 4RW8A 5DQGA 1B9DA 1MQ2A 4KN7A 3M8PA 5FDLA 3KLIA 5KFFA 5HP4A 3HPGA 3SPZA 4QWCA 2BQUA 3H4DA 4YCXA 3KIOA 5HRPA 3ALYA 3VQEA 3V4IA 4YP3A 4Q8FA 1WNSA 5DBAA 1REVA 3M9OB 3L2VA 4CF0A 3AO5A 1NJYA 2ZQBA 1X9MA 5IIJA 1HJPA 2KN7A 4DQQA 4HCCA 4R5PA 1IG9A 3M9MB 3QIOA 1GOBA 4RT2A 4ED0A 1JLQA 5KFLA 1UOCA 4GXJA 1VSLA 4C8NA 5BOMA 4GVMA 4FZZA 4KLFA 4ECUA 4CGFA 1TKZA 5KFHA 4CK2A 3AVKA 3GQCA 4ID1A 4J9KA 4CEZA 3OYAA 2OZMA 4QWAA 2HHWA 4CJKA 3QEPA 3OHAA 4F91B 2NRTA 4O5CA 1WCLA 3RH4A 5DLFA 4B9VA 4QZFA 3HXMA 4C8MA 3LAMA 3CYMA 1DLOA 3KKRA 2B21A 4XIUA 3IAYA 4Z6FA 1NK0A 4EP5A 2NRWA 4TQSA 4KLEA 3PVXA 1JLAA 3PW0A 4YMOA 3AUOA 8ICAA 2YNHA 1RTDA 9ICSA 2F1JA 3RMDA 3UIQA 2IA6A 4B08A 1BISA 3ISCA 4YD1A 5EWFA 9ICJA 3SUOA 2W8LA 1BQMA 4M45A 2YNGA 1VSJA 5CHGA 3LANA 4FJLA 3QNNA 3RAQA 1J54A 7ICLA 4CJWA 4PPXA 4BACA 4IRKA 3VQ9A 1U47A 4M3XA 4QWEA 8ICZA 4KREA 3SV3A 2IC3A 4QZBA 2JGUA 4TURA 2IOCA 4DL4A 4E0DA 3HO1A 5KFXA 3L2WA 2BHNA 3VQCA 4G1QA 3VQ5A 4J9OA 5I3UA 2OYQA 3MEDA 3WNFA 1UT8A 4KLHA 1K1SA 4FLXA 2DFEA 1RT7A 3V81A 4ED2A 4M6WA 2OPQA 4H4OA 3MDAA 4DLGA 4YXMA 2KZZA 3AA3A 3AVFA 4LSLA 4QOZB 3M8RA 1N56A 4CEFA 4E7IA 1JX4A 4JRPA 4ZTJA 4YFUA 9ICXA 4CEDA 3NGDA 3OJSA 1Q9YA 3QEWA 4CJEA 4G3IA 2KFNA 4M9NA 3ISBA 2WONA 3V6DA 5CZ1A 4KLSA 1NK7A 3NH1A 4UB2A 1NKCA 3HP9A 7ICEA 1XSPA 5KFUA 4BE1A 3LPUA 1VSMA 3HYFA 2PFOA 4K8ZA 4J9PA 1NK9A 2HHXA 4LZDA 3ULDA 4HCBA 1RT4A 4CHZA 1SKWA 4E7LA 4DQRA 1WLJA 2OPSA 4FK0A 5KFQA 5SWMA 4J2BA 1RDDA 7ICUA 1GOCA 4CF8A 5KFTA 3C2KA 2UVVA 1JMSA 3AU6A 3K2PA 4F4KA 1W9HA 2ZUBA 4Z4CA 5CZ2A 4CF2A 3SQ0A 1ITGA 1ZBLA 2IHNA 4F5OA 3EY1A 1WCNA 3GFKB 1HYVA 2BPGA 2E6MA 2ATLA 3Q8LA 4HYKA 2XY5A 1F21A 2A1JA 3G0ZA 3T5KA 2HW3A 3SI8A 4QZ9A 4CFCA 7ICFA 4JS4A 5DG8A 4FJ8A 2W9BB 4M42A 3OS1A 3KHGA 3FYHA 4FVMA 3AU2A 2B4JA 1ZQWA 4Z4GA 4M3UA 1NK6A 1KVCA 3SUPA 2W9CA 3V6KA 4CEBA 3AV9A 3C2LA 1Z25A 5TZVA 2XCPA 4DQSA 3KK2A 4F4XA 3AVCA 3KK1A 3RRHA 4CGIA 4W5RA 4C8KA 4EBDA 4AHRA 3KD5E 4KFBA 1BPZA 9ICAA 3F9KA 4J9NA 2ASJA 4AHTA 3MXMA 1ZQAA 7ICPA 1BIZA 3MXJA 4GXIA 1BQNA 8ICMA 1TAQA 4CFDA 1C6VA 3DLHA 3LZJA 3H8JA 3AVJA 4AH9A 1HNIA 5DB6A 9ICMA 2FPKA 5KFOA 1FKOA 3ZSZA 1NOMA 4CHPA 4DSFA 1NK5A 8ICGA 4CEAA 5J0WA 4M9JA 4FBTA 3ZDBA 4IFVA 4KLIA 2RKIA 3OS0A 3S3OA 3RR8A 2FC0A 4N47A 3NF9A 3K4GA 3RB4A 4FM1A 4OPKA 9ICWA 1ZQIA 5EWGA 4ZH4A 2XGQA 4RPZA 4CJFA 4KI6A 3SCXA 3ZT4A 4DL2A 5KFEA 3PX0A 3AVBA 3O4QA 3PR5B 3KTQA 1R0AA 5KT2A 3EYZA 4OKEA 1ZETA 1U4BA 1TFRA 1S6PA 4YMMA 5DKWA 4E3SA 3LAKA 3E01A 3PX4A 2I5JA 3SI6A 2FMPA 2A1RA 8ICWA 2V4QA 1ZBHA 1A77A 2JEGA 3NF6A 3RMAA 1YT3A 1T4GA 4M3RA 4MFBA 5KG1A 1T05A 4DSKA 1KFSA 1ZQYA 4DO9A 2UVWA 4AHUA 4HTUA 2FBYA 3IRXA 1VSIA 1MQ3A 4F92B 3U3GA 4MFCA 3IS9A 3ASMA 4CJ5A 2HNZA 4M3WA 2BCSA 4R8UB 4GC6A 4B9TA 1LWEA 4O3NA 4DL5A 4Z0UA 5HNKA 5HBMA 3THVA 3DLKA 1J5OA 3LZIA 1QSSA 5L1JA 4N41A 3MFIA 4KB1A 4M3TA 8ICLA 5IIIA 1SL1A 1TV9A 1NK8A 4CFAA 5KFKA 4DL3A 4FJHA 3QEAZ 2GWSA 2F1IA 3QZ7A 3LK9A 2FBVA 4FJKA 2FPMA 4OKKA 3QZ8A 3EZ5A 3MABA 2VANA 2P66A 3L2RA 1H38A 3HP6A 3IHQB 3T19A 3JPSA 2C2EA 4CFBA 1LV5A 2NRXA 4M47A 4NLZA 4ECWA 4P4OA 5EWEA 2QXFA 1D8LA 3OSNA 1RBRA 3QE9Y 3MAQA 1XI1A 2XCAA 3JPPA 3SNNA 4K4IA 1K6YA 4CK1A 5IILA 4AHCA 1CXQA 4OGEA 4GC7A 5DK5A 1CZ9A 1BVSA 4IR9A 5HP1A 7ICKA 1U04A 2UVUA 4XQ8A 2ALZA 2GUIA 1HQEA 2HB5A 2YHBA 3WNEA 3O3GA 3SQ4A 4NCBA 4P4PA 3ISDA 3RR7A 3TABA 5IIOA 3ZD8A 2M9NA 1S1UA 4KLGA 4NLKA 5DG9A 2VG7A 4Z6CA 3ZT2A 1RXWA 1KVBA 1JLEA 3AVHA 1BPBA 3QEVA 1KFDA 2AQ4A 3C6TA 1ZQZA 2R8JA 1S76D 9ICUA 4J9LA 1CUKA 2HMIA 4IBNA 4W5NA 3HM9A 8ICNA 1ZQHA 4M9HA 3EWAA 3LP1A 1ZQEA 2V9WA 8ICVA 4IQVA 3PNCA 9ICEA 4IQTA 4FW1A 4PHEA 2OWOA 1A76A 3ETLA 5DQHA 5D46A 4J2EA 3N4MB 2E6LA 4RQ8A 8ICYA 4J9MA 3K58A 1ZQNA 4KHWA 1SZPA 3RJIA 9ICVA 1IXRA 4NM1A 4B9LA 5C25A 1JXBA 1WN7A 2HNYA 4CIGA 5KFSA 3RBEA 8ICRA 3T1AA 3HJFA 1ZQOA 4E7HA 3H8SA 4ELTA 4O3RA 2VA3A 4W5TA 5E41A 1RT3A 4CEOA 1SL0A 5CA7A 2KZMA 4FLZA 4F5RA 1MC8A 3MEGA 4EYIB 4CJ3A 4R63A 3OHBA 4LH5A 1Y88A 3HSTB 3QERA 1XU4A 1XSLA 4KHSA 4RW4A 1RBUA 1KRPA 2AGQA 2AGOA 4RQ7A 4N76A 2ISPA 3PY8A 1S0VA 3AVAA 4O9MA 3V7LA 4DF4A 5EU7A 2Z1GA 3NHGA 4XRHA 5C42A 1HPZA 3AVMA 3AO4A 2FBTA 2FPLA 1VSHA 4M3ZA 1NOYA 3ZSQA 1Z00B 1HYZA 4DTUA 2P6UA 4I2PA 1WSFA 2R8GA 4O0JA 4H8KA 4F4YA 4I27A 3HK2A 1RBTA 4DFMA 4BXOB 2W9AA 1N5YA 3OS2A 2PXIA 4RPXA 4RQ2A 3C1ZA 5DLGA 2ASDA 5KT5A 3NFAA 3HWTA 4CGHA 2YNIA 5JUMA 1RXVA 4KHNA 9ICIA 4B9NA 4QWDA 5KT7A 3OYMA 3EPGA 1RPLA 4UQGA 3ORYA 3GV5B 3SYZA 4LZGA 1HUZA 4QZAA 2W42A 4ED1A 2NUBA 2XO7A 3TFSA 1LW0A 4PWDA 5J2GA 3GV8B 3QESA 3BQ2A 4I2IA 5FROA 1T03A 1ZJNA 1MU2A 3CFOA 8ICHA 3KHHA 4PHDA 3F73A 5J0QA 4KLUA 4ECYA 4KLJA 3TANA 4IRCA 5BPCA 5J2CA 4FBUA 1C1AA 2DPJA 5FRNA 4O5KA 5KFAA 2XC9A 4LVSA 4FYDA 3EPIA 5DDYA 3ZT3A 1X9SA 1A5XA 4CJLA 4DEZA 1KCFA 4DU4A 8ICKA 1CLQA 5L9XA 4O55A 1S1TA 1VK0A 2BKEA 1WSHA 2F8SA 4O3QA 4FS1A 1XHXA 4QZHA 1S0OA 2UVRA 4JLHA 4I7FA 4JS5A 5I42A 1ZQRA 3Q8MA 2XRIA 7ICJA 4RQ6A 1NJZA 3BQTA 4EZ9A 3JPTA 1NJXA 4BDPA 2HHTA 2FLNA 5KG2A 9ICPA 2HHVA 3CM6A 4LH4A 3RJKA 4O3PA 3V9ZA 3DLGA 2BCUA 3UXOA 4DU3A 3HT3A 3OYCA 2PFNA 2Y1IA 3GIKA 2BQ3A 4NLGA 1QLNA 2P51A 1JKHA 1GOAA 4FJNA 4DL6A 4O3OA 4ID5A 4I2HA 3Q8QB 3OYEA 4I2DA 5KG6A 1ZQMA 4J9SA 3GILA 1A5WA 3AO1A 2BCRA 1JLBA 4FM2A 4KLOA 1LWFA 3K5OA 5J29A 5HRRA 5J2JA 1ZQPA 3L3UA 4DG1A 3QINA 3GDXA 4XUSA 2MAXA 4NY8A 1B43A 3OYKA 2BPCA 9ICCA 4O4GA 2KFZA 1KVAA 1S1XA 4RW9A 7ICQA 5KG7A 3TAQA 5JS1A 2G8FA 2PYLA 2AQ0A 4CJPA 3M9NB 1VRUA 2JLEA 1SL2A 1XSNA 4KHUA 5IIKA 1BPYA 4E1NA 1U49A 4L8RB 3B0YA 2C2DA 4F2RA 5KG0A 4FCYA 3KLHA 3UQ2A 5KFVA 3HPOA 1S1WA 3OYLA 2Z1IA 5D49A 4UB3A 1TVRA 3ZDCA 4CERA 4RQ5A 3OYBA 4GW6A 5J0RA 2BCQA 4DTJA 1WSJA 3QEBZ 2P6RA 5KG4A 5KFNA 1ZQBA 3PW5A 3P83D 4EYHB 3RH6A 3UQ0A 4K4GA 4IFYA 4Y1CA 7ICNA 3D45A 5J0OA 1ZQTA 3I0SA 4QZIA 3OYFA 1FKPA 1BPEA 4I2AA 1ZQLA 4UAYA 2HHQA 3IG1A 9ICFA 3RB3A 5J2MA 1VSEA 4FJ7A 1ZQVA 5KGWA 5DB9A 1QTMA 3SJJA 2MUTB 4QWBA 4R65A 2ZTDA 4XA5A 4I2BA 2Z1JA 1G15A 1EX4A 1RBSA 1L3UA 3JPQA 3DRPA 3NGIA 1S0NA 4KI4A 2DY4A 1BGXT 3OY9A 3ISNC 1RT5A 1S0MA 3KKSA 9ICGA 3NGYA 3TAMA 1BHLA 8ICIA 2OPRA 1CXUA 4LY7A 5L1IA 4ED8A 3C1YA 4FJGA 1U9LA 4FZYA 4OLAA 4DF8A 5KT4A 4KN4A 2F8TA 2C22A 1S10A 5F9LA 4DSLA 1C1BA 4DOBA 3V7JA 3JPOA 4Z6DA 4GLXA 5HRNA 3DOLA 1BCMA 1KLMA 1DTQA 4QAGA 5KFPA 3L8BA 1RCHA 4O0IA 3B6OA 3PV8A 1C1CA 4DTNA 4CHNA 2FMQA 3ZSYA 4KITB 9ICNA 3O3FA 3GIIA 1MSWD 3RB6A 2IMWP 3JPNA 2ASLA 3U3YA 4YR0A 4JUZA 2D0AA 4FLWA 3WNHA 5J2BA 3NAEA 1IKXA 1L3TA 1D9DA 4R66A 3AA4A 1QS4A 1YVUA 1B9FA 3VQ7A 3I8DA 1IKVA 3HW8A 1TK8A 2WOMA 1N48A 4DTRA 1BI4A 3HVTA 4I9QA 1TGOA 4W5QA 4DTMA 4Z4EA 4Z6EA 4QZCA 1LWCA 4F8RA 1HRHA 5DQIA 1COOA 5DGBA 5J0SA 4B9MA 3VQ4A 2IAJA 5KFGA 2ETJA 3KK3A 3K59A 1N6QA 1W0HA 3V9SA 1Q8IA 1KEJA 4OKJA 3FFIA 4BDZA 1L3SA 2C28A 4RNMA 1S1VA 2QK9A 3CQ8A 2P5GA 4PGYA 4FK4A 4MEXA 3QIPA 4F3OA 1VSFA 3DM2A 4CJ4A 3KD1E 4KPYA 4YD2A 3P1GA 2G8HA 4N5SA 5DG7A 3VQBA 5K14A 4E1MA 1WSGA 1HUOA 1CEZA 1ASUA 4O5EA 2D0BA 5KT6A 2AJQA 9ICKA 1HYSA 4QZ8A 3NH2A 4OPJA 1TK5A 4YR2A 1S9EA 1RT6A 4H4MA 4J9QA 4GXKA 3E2EA 4M2YA 1TVAA 4DWIA 3PW2A 2AU0A 1XO1A 3V1OA 3PUFA 3NCIA 1ZQFA 3I0RA 4IQWA 4FJMA 4UBBA 5J2PA 2J6TA 4M41A 4BWMA 5J2HA 4Z4FA 3AA5X 3UXPA 1JXEA 3B0XA 1VRTA 2I1QA 2WTFA 5J0UA 1HMVA 1WSIA 5J2QA 3JYTA 3UPQA 2ITGA 3TAGA 1SV5A 1B22A 4TSXA 4RUAA 2BGGA 2F1HA 4HUFA 2B5JA 4ICLA 2YV0X 4KLDA 4UB4A 1D9FA 1WSEA 4J2AA 3MEEA 4B9UA 4Q44A 4DTOA 4AHVA 5D3GA 8ICTA 1C0MA 2FLPA 3BQ1A 2YKMA 1ZQXA 5J2EA 5DGAA 4JV2A 1ZJMA 4ED3A 3TR8A 4M9GA 1L5UA 7ICRA 1C7YA 3PO4A 2IHMA 1JL2A 4EBCA 7ICTA 3OGUA 3KLGA 1ZBIA 1Z00A 3U6FA 1QE1A 4IQUA 4Q45A 3ZDDA 3RTVA 3QEIA 4KAZA 3V7KA 1VSKA 3CG7A 4C8OA 1RTIA 1S9GA 4DOCA 4I29A 4DSJA 2D0CA 2BR0A 1ZBUA 4IG3A 1SKRA 2W9BA 4FO6A 2FMSA 4NCGA 4RQ4A 5KFJA 5CP2A 1T8EA 3Q8KA 3C6UA 3V6HA 4QZGA 2G8IA 1EKEA 4KLMA 3MBYA 1ZYQA 3SQ1A 3BGRA 2NRZA 1EXQA 3NTUA 2OZSA 2IGIA 1LAWA 4RQ3A 4DTSA 3VA0A 2KTQA 4DSEA 2MUTA 4Z4HA 3D0PA 1RTHA 4FW2A 3T5JA 2RN2A 3LWLA 3KJVA 5J0YA 1C0UA 4UAZA 2ZJ5A 3OYNA 2G8VA 1UT5A 3KHLA 1JIHA 1Z26A 4E7KA 4CHQA 5L1KA 2O4IA 1DTTA 4ED6A 3IM1A 4B8CA 4EZ6A 5KFYA 5C24A 3H40A 3NDKA 4PHPA 4P4MA 3DRSA 1CZBA 5J0PA 8ICBA 4M6WB 1RT2A 5DB7A 2DFHA 2DFLA 5J0XA 2ZTEA 3SV4A 2YKNA 4CE9A 3Q8PB 5IINA 3NF8A 5KFBA 4IKFA 9ICQA 3AVNA 4RQ1A 1K1QA 5KT3A 2PFPA 4OLBA 2PYJA 4BE2A 1J53A 2FBXA 1S77D 5CYQA 4E19A 3OYHA 1X1PA 3AVGA 4K8XA 4O3SA 3V1QA 2AGPA 3AVIA 1Y97A 3S3MA 4DTXA 2A1JB 4HVJA 4KMUA 2DFFA 1U48A 4QW9A 5J0TA 1ASVA 4MFAA 3DRRA 3OYIA 4I9LA 4FLTA 3LP3A 1QHTA 3M8SA 4CF9A 3V9UA 5CJ7A 2XHBA 3WNGA 4F5QA 4IR1A 4CCHA 1I3AA 4NXZA 3QO9A 3AA2A 4JWNA 8ICCA 3QEXA 1VSDA 3L3VA 4BDYA 2HNDA 2X6SA 3S9HA 4RT3A 1KLNA 5KFMA 4TQRA 3DOKA 2BDPA 5KRSA 3RBDA 3QETA 4GMJB 4ECSA 8ICPA 3MR2A 2GV9A 3MGHA 4PY5A 4KHQA 3TFRA 2G8WA 8ICFA 3SUNA 4RZRA 1JXLA 2R7YA 4KTWA 4M9LA 2IBKA 3VQDA 4NLNA 1KFTA 2ZUDA 4YXJA 1PZNA 1RNHA 1IKYA 3MDCA 3DI6A 1RYSA 1BPDA 3OYJA 4FS2A 4JRQA 3V72A 4CECA 1ZQDA 3GV7B 5DBBA 2VWJA 2KQ2A 2XY6A 1RDBA 2I9GA 4AILC 3GIJA 4CJRA 5SZTA 3RMBA 2VG6A 3NF7A 4Y1DA 3L2QA 2A1SA 7ICMA 1RTJA 7ICVA 4ECXA 1ZQCA 4F93B 4B9SA 4CIFA 8ICOA 2QKBA 2R8HA 3TWHA 3LDAA 1XS9D 3H7IA 2JEIA
chains in the Genus database with same CATH superfamily
5F9NA 1UKUA 2CUYA 1HNWK 2BRKA 1WHXA 2OD4A 4DQIA 3J80U 2ZJQQ 4WIIA 2CH6A 5F2RA 2ASYA 3ISZA 3MMAA 4GRSA 1MMNA 2PFDA 1A7GE 3BS5B 2OXOA 4I2EA 2ZZNA 2AYGA 4LF8K 3VQAA 4TU9A 2UU9F 3T7ZA 2R42A 4CI6A 3QXGA 2OSQA 2VPXB 3U27A 1JLEB 3A5MC 1J9AA 3VTIA 5ALRA 3BEGB 4DV7K 3L2UA 1XMOJ 3C23A 4QOTA 2W11A 2HBMA 3P5TL 2RRDA 2OGUA 2EBGA 3QWPA 2HGNA 2OLWA 1NKBA 3VVUA 2ZE2A 4B1UB 5ALGA 5AM4A 5KFWA 4M95A 3PO5A 3LDSA 3J81j 4UQTA 3V6DB 4OX9K 1DT9A 3S7RA 4CJUA 3CPEA 4E7JA 3I82A 4DR3K 2FJBB 4JI4J 2WF9A 4RQ0A 1D8YA 4OZ2A 4ZS6A 4LF4J 3CCUN 2YWFA 3F2DA 1TR0A 1RSCA 3HHDA 1B0XA 3DYAB 5D4PA 2AD9A 3FC4A 2HHHK 5IOLA 3DMJB 1S1VB 4CO4A 3G87A 1TKTA 1HWIA 3D3CJ 3KFUF 3DHWC 3RH5A 1KLMB 1WYGA 3TX8A 2JZBB 2YQEA 3VEOA 3ZTOA 2LXIA 4KHPK 4KKOA 2Z1HA 4NLTA 4ID5B 1OY8A 4IWVA 5B66U 4F50A 2HVIA 2Y0BB 3CWJA 2RD5C 4JK1A 1ESVA 3O6WA 4DMZA 4NM2A 1X9WA 3TU5A 2QWQA 1WC0A 4KFBB 1IKYB 2G8UA 2CWXA 4DR7F 5DDRC 3NNHA 3WDOA 3T5HA 2EZXA 3W66A 4ELVA 4DR5F 3CDBA 5DM7Q 5D6GA 2LMRA 3KLFA 4F2SA 4TXSA 1TTHB 3I5CA 5D4BA 3CCUS 2YXLA 3F5AA 3DU5A 5B5EU 3WK8A 3TADC 2E88A 2E5JA 1NK4A 1AXQA 4OYPA 4IKAA 4F3TA 4YS2A 1RDCA 1VHFA 4LF4K 4OJRA 1JK9B 3T3FA 2PI4A 3PMLA 2ABYA 2ES6A 2HWHA 1AFIA 4DSIA 3MECA 1HKGA 3UFCX 2BJ3A 5RUBA 2YNIB 4RNNA 2B4VA 2EKYA 2WRMA 1ASWA 4DHYA 2P9GA 2G1HA 2CNKB 4JB8B 2HWTA 3FUYA 2FXUA 1C0TA 2DGUA 5AFUA 4Q8EA 1M1HA 2H5EA 2VPWB 1XMOK 2QA4N 1J5EF 3SZ2A 1FRJA 4C98A 3ATVA 2E66A 2VA8A 2UXBJ 3VWSA 3EO3A 2BZ2A 2NRVA 4JKHA 2FDNA 4YFKA 5GAHP 2E5SA 1X8DA 1YJUA 4GKKK 1IH7A 2R18A 1FERA 3W61A 3WQTA 3CC4N 1Y64A 3DKDA 4RPYA 5U47A 2KK0A 3D2FA 3WK5A 2ZC4A 1ZZNA 1JN3A 2F4FA 4MMOA 2YMQA 1QZ5A 4IRDA 1S97A 4IFYB 4BG9A 1NH7A 1EX8A 5E5NA 1DARA 3GU0A 4EBEA 4DR3F 3OTQA 3OTEA 3FR0A 2V51B 3HVAA 2MQOA 3ZTRA 2CH5A 3FVYA 3H20A 1RT2B 4K4UA 2HFNA 2LYHA 4TU7A 1PO6A 3CCVS 5GADP 3PMNA 1S72N 2ZG6A 4CIEA 5GAEP 3MECB 1RYUA 3UXNA 3CJ3A 4PQAA 2G8KA 2Q66A 3T5LA 1QAYA 4NMXA 1HD1A 2E2QA 5HAOA 2B7BB 4EEYA 2MY7A 3GPAA 3J81O 1A6LA 3CHWA 4Y2CA 4YNQA 1FJGJ 3FJ2A 1UA1A 1C2PA 1C0FA 3IAM9 2RHFA 2KM8C 4CJTA 1NKEA 4KLTA 1OW5A 2AX1A 1UJ5A 4KLLA 3C6TB 2EDUA 3TWZA 4I2JA 4BVPA 2RPIA 1NBWA 2PA3A 1SC1B 4Y28C 4DUZJ 4BRAA 2D9PA 1QUPA 2YTCA 1FDDA 9ICLA 1RZMA 4YQWA 2P9PB 3D2FB 2ZJRQ 3M6XA 4URGA 3E8OA 2VG5B 4OVLA 5HMYA 3RJFA 2HQ3A 3MWTA 4NLBA 2ZEJA 3PW7A 1FK9A 4PGXA 2VH7A 3KG0A 3LALA 4RU9A 3TW0A 3V9XA 3TAEA 2EG2A 1ICEB 3RMCA 3RBZA 3MR5A 2NR0A 2Y0SF 1K73T 2H4WB 2QFIA 1R59O 2BX6A 3DYAA 4DV4F 2HHSA 3AQOA 5M1QA 3O3HA 3MCOA 1EP4A 1KVKA 3FK4A 1TUUA 2XGPA 1PYTA 3ENQA 1CJUB 1XBWA 9ICHA 4QCLA 2RQKA 4A47A 3D5MA 2EK1A 3CFRA 4QPTA 2F8LA 2Y1JA 3NS6A 4FXDA 4YB1P 5HMLA 4UY85 5B0CA 2IDOA 4BRPA 4C8LA 4A4JA 4CHYA 3RWUA 4FZXC 2UUAF 1T44A 4FJJA 4OZNA 5BOLA 5IV4A 5LXYA 5G5HA 3P8BB 4Z4IA 3D28A 2P1JA 2OPPA 2W2OP 3THWB 2QKQA 3GE9A 3H4BA 1DLOB 2WBRA 3ET6B 3SAGA 2QO3A 4LRAA 4MDBA 3C6AA 1IO2A 1L7PA 3POTA 2MU2A 1O5JA 1KR4A 3ZSVA 4NLSA 3EXYA 4NEYA 4OFZA 4RG8A 3CC2N 3CC7N 3J81Y 5KRTA 4QZDA 3CCSN 3LP0A 1RGIA 4PHAA 1G3OA 4RX6A 3MPWA 1QQ6A 2O66A 3HKZF 2XI2A 3Q83A 4CT8A 5ALWA 2OTJN 4MTPA 1VC6A 3MCNA 3CJAA 2JGAA 3MD1A 3NG8A 3DGVA 1V9PA 1TL1B 1KKXA 1VQKN 2VQFJ 5AQMA 1A6SA 3W8PA 3DNCA 1Q7YT 4F7VA 3LWMA 3RB0A 2BQRA 2UXCF 2YTUA 3C14B 3DDNA 3F0NA 4QIWD 4LR8A 4JKFA 3TNVA 1KWMA 2PZSA 3CT9A 4LRBA 2LSNA 2WF8A 4DR2J 3CQYA 4P2FA 4ILHA 2Q0RA 1QQCA 3EW9A 4C4SA 7ICOA 5AZJB 4EFHA 1WB9A 9ICBA 2E1ZA 3K1RB 4CJVA 3HULA 3MN6A 3O9TA 1WKLA 2OAUA 5DBCA 5J2KA 4NCAA 3GFXA 4EWTA 5J2AA 2ZJAA 4FF2A 1WAJA 2UUAK 2MKJA 4KN7A 3M8PA 1TMJA 3RRKA 5C12A 4IG3B 4BCAA 3KLIA 1Q82O 4QWCA 2IHR1 5ALUA 1L6NA 3HFVA 3V4IA 4YP3A 1F2HA 3M9OB 1REVA 1FO1A 2IVPA 3AO5A 1HNWJ 2FYXA 4R5PA 2HOEA 1RA6A 5EX0A 3VF6A 1KC8O 4DHVA 4U7CA 1GOBA 4JI8J 2Z2LA 4GXJA 3AA8A 4KAIA 2ZXHA 1TKZA 1NPKA 3U8XA 4CK2A 3GQCA 1T94A 2ROPA 4CJKA 4F91B 4RO0A 4O5CA 1WCLA 2B4UA 1U1OA 4WFAQ 4B9VA 3US5A 3VF2A 2P6SA 1DLOA 1N61A 2DBBA 4XIUA 1L8LA 2RQ5A 1GLBG 1YJTA 1JLAA 5AKGA 3JTNA 3N5FA 8ICAA 1LWEB 2YNHA 1NG9A 3P4IA 1RTDA 3RMDA 3E0FA 3BDEA 9ICJA 3W7BA 2JR5A 5CHIA 3TA1A 1UP1A 5CHGA 1WF2A 1D3WA 2VQFK 2ZH9A 2LDYA 4CJWA 4PPXA 4UUXA 4IRKA 1MA7A 3VQ9A 2BVZA 3OVBA 2YI1A 4BC7A 2POKA 1P6TA 2DNHA 1NU0A 1X4DA 5AKXA 4TURA 2MA1A 1JQGA 1Q4RA 5CAAA 1IWGA 5KFXA 3QFWA 6FD1A 2RHSB 1Q86O 3MEDA 2P35A 4KLHA 3UDEA 3EVMA 1K1SA 5HL7L 2DFEA 3V81A 2CZVC 1HNIB 3CCES 2XG8A 3FM9A 1YXQA 3ZXWA 4Z7YA 3AVFA 4CEFA 4E7IA 2HF3A 1JX4A 1ZAXA 1D4XA 3NS1A 1R6VA 4YFUA 9ICXA 2DTJA 3AD7C 4QS9A 5HK4A 3FZFA 5IQQA 2DCLA 4ACOA 2ZFHA 1FD8A 2KKPA 4C11A 1UAWA 3THWA 2W7OA 4KLSA 3NH1A 5E3QA 2B9YA 1BU6O 1VSMA 3IMXA 4OJOA 2JWLA 4J9PA 1L7OA 2LEAA 2LCWA 1YHQN 1RT4A 1SKWA 4B3TJ 4NYPA 1SAZA 2CPZA 3D3BJ 1U6FA 1U1MA 2P9LA 4HTLA 4RR5A 4X66F 3A3PB 1YITN 3HTVA 1GOCA 3UKUB 4I67A 4CF8A 2JFDA 3IFEA 1R8CA 1S79A 1RB0A 1W9HA 5FPEA 5AIAA 3SQ0A 2RS8A 2VJ4A 4OJLA 3Q8LA 1DAXA 1F21A 2J9EA 3EWGA 4H4KA 2PEBA 3KFWX 3C3LA 4FJ8A 3MHYA 3KHGA 3FYHA 3PG9A 1FWLA 4HH0A 4M3UA 3G8TA 1KVCA 3I31A 2IM2A 3D2SA 3NWRA 3MM9A 1SPBP 3V6KA 2D8CA 3SFGA 3VOVA 4OHZA 3KLFB 3J81U 1VDVA 4J37A 3AVCA 4WFYA 3KK1A 4CGIA 4JNEA 3ZETB 2LMIA 1WEYA 3ZI4A 2DNGA 3F9KA 4QR0A 1T0TV 4O8KA 2ASJA 5AM5A 3DU6A 3ATUA 3R5JB 4GNIA 5B8HA 2JC1A 2BA9A 4AHTA 2W2NP 1JJ2R 2MQLA 7ICPA 1BIZA 2R2UA 1GEHA 8ICMA 4OHYA 2KN4A 1NGDA 3AVJA 1HNIA 5GAEU 5ALQA 1VQ8S 9ICMA 4Z7CA 2W1BA 1LOTB 1FESA 1Z1VA 4ES1A 4BX9C 2RF2B 3GB0A 1NOMA 4QJVA 8ICGA 3MX2A 4FBTA 3OS0A 1N8RT 3S3OA 4JOUA 3TZXA 5HR7A 2PT0A 3NF9A 4Y2MA 3M5RA 4OPKA 5MAOA 3UCZP 2Y9HA 5EWGA 1VHXA 4TLQA 2IYGA 2XGQA 2V8HA 3WC0A 4CJFA 5HR6A 3SCXA 2FHMA 5KFEA 3E3XA 4ZLNA 4OHXA 1C4CA 1P9YA 2F8MA 3EYZA 2IYIA 1U1RA 4OKEA 2GZOA 1U4BA 2FTRA 1J6ZA 1TFRA 1UPPA 3CCQN 2O01C 2M2BA 4BBYA 1DJ0A 1HHSA 2I5JA 2FMPA 3CC2S 1WHYA 5DDPC 2F76X 2W41A 2WK4A 5C42B 4PR6A 1YT3A 1T4GA 2VOOA 2BEFA 2J9DE 1QAIA 1OH5A 5AR0A 4DO9A 2HOIA 2UVWA 1CC8A 3HVTB 2IJRA 2ROGA 4FF3A 3QBXA 3J7AP 2FBYA 1NPRA 3IDHA 3U3GA 4YOXA 1HNXJ 4MFCA 2KVSA 2HSTA 1J2NA 2FGCA 4NWBA 2IVOA 2QXLA 4R8UB 1IJJA 3QJLA 1LWEA 4LFCF 4Z0UA 3CJ1A 5AK3A 2F5GA 3VEYA 5C15A 3DLKA 3LZIA 3MN5A 3TJ8A 5HMZA 1HW9A 4X64J 4M3TA 3IBPA 5IIIA 3EGZA 1TV9A 2DNLA 3MC1A 5KFKA 4E8UA 3DCAA 4L6V3 1ZTWA 4FJHA 3HI0A 4DUZF 4ZJOA 3ITHB 1CJKB 4JBCA 2FPMA 1MLAA 3FSIA 4UY8T 2DJWA 1ZD5A 2FSJA 4UZCA 3T19A 4QU7A 3JPSA 2YN4A 3BBBA 1Q7YO 2L41A 4M47A 5ALLA 1NWKA 3OBYA 3OSNA 3QYYA 4X62K 4R5PB 2VFSA 4K0KF 1B0PA 2HHHF 1XI1A 4Y2RA 2IDLA 1NLVA 1ZC6A 1K6YA 4C8ZA 1FFUA 2BH1A 3FNNA 4AHCA 1CXQA 4OGEA 4FYVB 1J2VA 2ZDPA 4QIGA 2QI2A 4IR9A 3OV7A 3WK4A 3WXIA 2VQEK 2VC0A 3UI3A 4NL5A 2ALZA 2YHBA 3WNEA 1M5HA 1VJQA 2RNEA 3ISDA 2P2CB 5GMKa 3CF5Q 1XEZA 2M9NA 4KLGA 4NLKA 3H0PA 5DG9A 2F8KA 1MROB 2VG7A 3VENA 4O3MA 4NLWA 2ZH1A 4MAKA 1T9WA 1YITS 1ZOTA 1QM9A 2AQ4A 2PFFB 5K8PA 3RFAA 4Y2IA 1CQMA 1QH9A 1ZQZA 2KU7A 2JNJA 4MKAA 1NO8A 3AOBA 2QA1A 4YOVA 2QL7B 4LF2A 4DV2J 2XM3A 2B7CB 3WXJA 2OI2A 4IG0B 4WP8A 4OYBA 2RQMA 2AJ1A 4M9HA 3P3DA 1GXTA 3VALA 3EWAA 3LP1A 2V9WA 1S5ZA 8ICVA 3VZHA 3VAJA 4DB3A 2R4FA 2HHHJ 4EX7A 3EGWB 3PXGa 1IN0A 5BXIA 1KC8T 2QSWA 2OIHA 3DLGB 4FW1A 4USUA 1A76A 3ETLA 1VIOA 2X1FA 4J2EA 3N4MB 2UUCJ 1K73O 2UXCJ 3A8YA 8ICYA 4H4MB 4J9MA 2X7IA 5HVHA 1OS5A 2P9PA 3SCKE 2Z7JA 1JXBA 1WN7A 1Y11A 3DXMA 1VISA 3GSDA 3HJFA 2QT7A 3W9IA 5AKHA 3IR5B 4C3LA 2VA3A 1OH8A 2CQBA 4FVUA 4WP9A 1SL0A 3U26A 4F5RA 3MEGA 4H5WA 3SQGA 2JXJA 3ID8A 4ERDA 2BZFA 4ZP7A 1NGHA 1VC0A 1XSLA 2ZGYA 3NCQA 1KRPA 4RQ7A 3PY8A 4ANDA 4ZN3A 2D4WA 2A1AA 2V63A 2XZDB 1KL9A 5EU7A 1N5QA 2P9KA 4KGZB 4M3ZA 3O0FA 1HYZA 4PG4A 3CD6N 4O0JA 4KH6A 2MZQA 2KOBA 4IOCL 3H59A 5TKWA 3MURP 5FP0A 4CW7B 3OS2A 3MF5A 4Y2XA 1E6YB 1XERA 5DLGA 2CFXA 3WKEA 3SMVA 3DC2A 5KT5A 3DRSB 3QWUA 2UP1A 4CGHA 2YNIA 1JJCB 3VAHA 1RXVA 2AP6A 4KHNA 1Q8KA 3IC1A 4B9NA 1H98A 4QWDA 5KT7A 1RPLA 3IWNC 4UQGA 1AB8A 4BS2A 1VLOA 3SYZA 4ILRA 4LF6K 3C19A 2NUBA 1RI7A 2XO7A 4PWDA 3LVWA 1GXUA 5FROA 1G6BA 3TAMB 4JI2F 1R0CB 1H2TZ 2E1CA 5J0QA 3UN2A 2U2FA 4KLUA 4KLJA 4AXIA 2KG0A 1LKYA 3O5TB 4OX6A 2DPJA 5AQQA 3LGMA 3EPIA 4NRUA 3RAMA 4CH1A 3CDAA 1KCFA 4AYBD 4OI3A 2HZCA 1CLQA 5L9XA 2C3PA 2H9ZA 2R2SA 2RU3A 1NGCA 4CTAA 1S1TA 1VK0A 2BKEA 2WBNA 1U0HB 3HMJG 2LQBA 1WSHA 1XHXA 4QZHA 4WIQA 3CD0A 3CO9A 4NXMK 4JS5A 1ZQRA 4USWA 2V8DA 4DX6A 3V4MA 1XMOF 1LOUA 2OPSB 2ZIVB 4NXMJ 5GIPA 1NJZA 3PZPA 2LPEA 4LC9B 4H4OB 4HDGA 3CC7S 3UR0A 3ZZPA 2YNFB 2BBEA 1VC5A 2H3ZA 4RW4B 3CM6A 3RJKA 2UU9J 4NRTA 1PBAA 2CPRA 4GKJK 3BH7B 1SBRA 4UB8U 2RUSA 5HL7Q 5DS7A 4NLGA 1SV0C 3J80Y 2CA9A 1JKHA 1DRGA 5FPDA 1IUJA 4O3OA 4B3RK 3CIZA 3M32A 4ZPBA 2HWIA 3W0LA 4RQMA 4TYAA 3GYGA 5J29A 2Y0SC 1R0AB 4OD0A 4NCGB 4WQ4C 4DPYA 2UXBK 2FJ6A 4WQ4A 2OCEA 2OTJS 1RTHB 4MFBB 1S1XA 5K14B 7ICQA 2MJNA 4YHHF 5BREA 5K4LA 2G8FA 2KVQE 3T1YF 2AQ0A 4C4TA 2MZJA 3R27A 4AYBF 2JLEA 1XSNA 2V2QA 4I4BA 3X3UA 3WEEA 3K0SA 3LP1B 2JSXA 4CLFA 3UQ2A 3KLHA 3G96A 4Y00A 2XS5A 5IT9U 2KIWA 3ZDCA 4RQ5A 4PYAA 3OYBA 4GW6A 2UXBF 4WFZA 1RHRB 3GWCA 3UD5A 4AQYK 4Y2PA 3PW5A 2DIUA 4EYHB 2R7OA 4K4GA 1UPMB 3AAQA 4Y1CA 1VDHA 3D45A 5J0OA 3HZGA 4EELA 3N0VA 2OANA 4QZIA 3NS5A 3OW2M 4UAYA 1YDLA 4P2XA 3M2RB 1SUQB 1ZQVA 4M7YA 4KPCA 2PC6A 4I2BA 1OQ6A 2KG5A 1GXLA 3VHQA 3MR7A 4PXBA 1HUXA 3NGIA 1S0NA 2ZBPA 3ISNC 1PIEA 2EAPA 1RDUA 1S0MA 4HI2A 2PE8A 3NGYA 3TAMA 4B3SJ 1HLWA 2ZVSA 3UNYA 3SSQA 1TL7B 4NLRA 1CZAN 5L1IA 4LY7A 4ED8A 2DNKA 2WVEA 5F3TA 2ZWPA 1RGVA 3IP4B 1U9LA 1HBUB 3VPZA 3ZFVA 4XAKA 3QGGA 1Z4NA 2C22A 5ALJA 1AUSL 3ILJA 3J7A1 2CIMA 4HKQA 4IEIA 5HRNA 2KYXA 3IG8A 1T6CA 4P0QA 5ALYA 2PAVA 1RCHA 4O0IA 3QU7A 1FRLA 2GWKA 5L46A 2FMQA 5LMUK 1RAHB 3ZSYA 2WW8A 3OTBA 5EOYA 3FMBA 4ZVOB 3ZC4A 3O3FA 1MSWD 3RB6A 1HHTP 3I0SB 1X9XA 2EW9A 5ALVA 2O8DB 4FLWA 2C2MB 3AARA 3HDSA 4RBTA 2PIIA 3W5YA 1D9DA 4M5LA 1CULA 4CYUA 3VAFA 2MSTA 2V2KA 1PVQA 3VQ7A 2QN6B 1TK8A 3FCHA 2WOMA 5K9FA 1N48A 1WEXA 3U1MA 4DTRA 1RWKB 2E8OA 1GLLO 3G25A 1OVQA 4W5QA 1S99A 2G0AA 1F5CA 4KO0B 1KQKA 2IIHA 2V68A 4I6WA 4JI4F 1SH3A 3AY0A 1HRHA 4USJC 2G2ZA 3WXLA 1Y9OA 2CWKA 3VQ4A 4DR6F 5A6WA 4CRXA 5A8RA 3KK3A 1N6QA 1W0HA 2FJWA 1Q5YA 1GH8A 2GNKA 4OKJA 3FFIA 2Q43A 1FTCA 1X9JA 2C28A 3H46O 2DK2A 2FUG9 1RTJB 3UWTA 2OKQA 3C16A 3D1OA 5FPMA 3ENAA 1S1VA 3CQ8A 3U9DA 1VQMN 1IXKA 3AT1B 1VSFA 3DDKA 3DM2A 3OUYA 4CJ4A 2DIVA 3VQBA 1FFVA 2H4YB 2GVDA 5GVQA 5E3CA 1P1LA 4DV1J 4O5EA 4CLSA 4G1IA 2AJQA 3C15A 2H48B 5ADXA 3VGTA 4X4OA 3NH2A 4OPJA 1TK5A 2OPQB 4YR2A 4XEIA 4KBIA 3KWMA 4GXKA 2AH5A 4DWIA 3CNQP 3PW2A 1U2RA 2P5VA 1PG5B 5ETOA 3T69A 3Q2SC 2LA4A 4IQWA 3EICA 3RUBL 4UBBA 1N63A 5J2PA 1BA0A 4FJMA 4DR2F 3HOSA 4Z4FA 3AA5X 4MO4A 1YJNN 2WTFA 4LF6F 2SXLA 3ILOA 4MKYA 2BGGA 2KT3A 1SS6A 1WSEA 3LH2S 4J2AA 1PYOB 3MEEA 2VQFF 1ZXIA 3GONA 2JMGA 1H2UX 5D3GA 8ICTA 1XC3A 1C0MA 2GX9A 1GMUA 5J2EA 4JV2A 2CGKA 4RL1A 3TR8A 5HMXA 5LSOA 2NNWA 2EFQA 4CF3A 4X62J 1QE1B 5ALNA 3PIPQ 3U6FA 3ZDDA 2W7PA 2F3JA 4IOCQ 5K20B 5CRXA 3QEIA 1D8ZA 1IG6A 3N6MA 4X4SA 3OD2A 1S9GA 2YQ1A 4DSJA 2D0CA 5F0UA 4RW7B 4IG3A 1SKRA 5EE9A 4KX5A 1SZ2A 3ADAC 2RIJA 5E26A 5CQGA 4PXCA 5D15A 2WONB 4C1NK 3C6UA 3W60A 2G8IA 1EKEA 4KLMA 3MBYA 1ZYQA 3SQ1A 2NRZA 2CDRB 4Q2LA 5AXNA 3P45B 4J5OA 4FF4A 3BF3A 3H2UB 1Q79A 1SCJB 1RLDA 3SEIA 2DY9A 2ZOFA 2DR9A 1HPZB 1LAWA 1EO1A 1JROA 4QPXA 2QA2A 4DTSA 3DAWA 2KTQA 1RTIB 4DR6K 1RTHA 2GMLA 2YH0A 4F67A 2ZXIA 4FW2A 1JLFB 2DXFA 1VBZA 2RN2A 3LWLA 2OMOA 1RWOB 4W4MA 4GVBB 4RW8B 5K8MA 3BGUA 3OTOF 2CRXA 3KHLA 2FVSA 1ROFA 5CD4A 4OYIA 1LWFB 1RTZA 3ENWA 4NOHA 5B0FA 3AL0B 1I3OB 5AE3A 3IM1A 3DN9A 3I55N 3AM9A 2JH3A 4KY3A 3P49B 4EZ6A 3RU0A 5KFYA 3H40A 4PHPA 1FVQA 2NS1B 5J0PA 3H8MA 1RT2A 5CYJA 3ENVA 2DFHA 3KD3A 1E6VB 2DFLA 4LF9J 2D3UA 1SWVA 3SV4A 2ZTEA 3NVWA 2HQDA 2YKNA 4UB6U 3GSIA 5IINA 3NF8A 5KFBA 4IKFA 1L3KA 1S4FA 5KT3A 1RWXB 1F6TA 1BQXA 3WX4A 2MKCA 5IC4B 3KUEA 1QHAA 4I6MA 2RLTA 4LIRA 3AVIA 1Y97A 3S3MA 4DTXA 4P0QB 2DVIA 3FZKA 2DBYA 3QT7A 3O1BA 1ASVA 2VONA 5ALPA 2AV5A 4XH4A 5AJ3K 3EDQB 4FLTA 3V9UA 5EXWA 2DNZA 4LBIA 4JI0J 4F5QA 4IR1A 1BNPA 1I3AA 3ZZYA 2JFKA 3PJ9A 1VQNN 1URNA 4XO0A 3OA9A 4K25A 2A19A 4BDYA 2X6SA 3I56S 3S9HA 4LF8F 5BR8J 4FWNA 1XNQK 3A8KA 2BDPA 3RBDA 2E1RA 3OTOK 3QETA 2E8NA 3OXFA 4LRDA 1E3MA 8ICPA 1IKXB 4G1QB 3MD3A 1YSJA 2RJZA 1EAYC 1NHUA 3OFFA 1NMNA 3M8PB 3TFRA 2G8WA 3IBFB 2LYVA 1JXLA 2IBKA 2B5JB 1JXVA 1RNHA 2R2RA 3DI6A 4I6AA 2NPFA 4FS2A 3EUB2 1YJVA 3V72A 2MGZA 4CECA 5LJWA 4J90A 2VWJA 4WBFA 2QFJA 5DZ6A 4KHPJ 1VQPS 5AKKA 3D2EA 3VMFB 3PRBA 3BM7A 4AILC 2L3MA 4X4RA 2A6OA 2J7KA 3TX0A 4FPRA 2NUHA 5A8WB 4O5FA 2UXDF 2VG6A 3NF7A 4Y1DA 3HVWA 4EO6A 2OYYA 8ICOA 2QKBA 4YUDA 3P31A 4CF4A 3O3LA 2QGFB 4G65A 4H5NA 1RYRA 4BRIA 4CLYA 1NSPA 1W2BR 4FKYA 3BH6B 4DV3F 4BGDA 3Q8SB 5AM3A 5L1LA 4GVLA 1GMWA 3U4LA 5AQZA 3UKRA 5EVZA 3NE6A 1XMQK 2UUCF 4E1JA 1W7AA 2CPFA 2Q3SA 1UZHA 5E3PA 3BEXA 2EZZA 1LW2A 3BJYA 5KAKA 1K8AO 4OJGA 3J8AA 4YG2A 4X4UA 1NZBA 4UTGA 3KLVA 4G1PA 1H72C 4A48A 4CBWA 3CCJS 3O1LA 3JSBA 1KDHA 4DS4A 1NH8A 3R6MA 5AK4A 2KM8B 3HL8A 3OQ2A 5H9FK 5HI7A 3BDPA 5J2IA 1SIJA 5CZVA 3MCMA 1RZTA 2DYAA 3Q24A 4DV2F 4LFBF 1ECWA 5GAHI 4BC4A 1HYSB 1DQ9A 4YR3A 4F4ZA 3ZX3A 3ZO7A 2NZTA 4DBQA 2HBZB 4CHOA 4P0PB 1W2IA 4Y2YA 4PRFA 1I39A 3TAPA 2Q1LA 2D1KA 2CJBA 3MWPA 2HVHA 3M6VA 1LWCB 3GOIA 4DFKA 4LF5F 3UMBA 3AO3A 2YHAA 5B0BA 2VFRA 3C95A 4NX9A 1UWBA 2YH1A 2OEJA 3ZDAA 1BCOA 4FJIA 4AQYF 1NRKA 3R7NB 2CGLA 4UB5A 1M0SA 5A2QY 4L74A 1VQLS 2IVMA 3PYDA 3M6WA 1RBVA 3MCSA 3W3DA 3ZLJA 4N7TA 1YBUA 2HRYA 4FNHA 2MHNA 4WPAA 4ZPAA 4TUSA 2DNRA 2ZTCA 2ZM6K 2CJQA 3VV2B 3RJEA 1N2XA 1RWWB 4WE1A 2RDIA 2WFBA 3GJTB 3PFEA 4Y2VA 1LB2B 4PAAA 1MWYA 4NL9C 2Z2ZA 2V4JB 4Y2SA 3QO9B 1D5AA 4HT7A 4OQJA 5KFDA 3TUPA 1LQ9A 5KL8B 5CH7B 2L9NA 3HVRA 2DD8S 3KG1A 1QJHA 4Y2QA 3ZD9A 3ETRA 5AXMA 3N97B 4CGGA 3AY9A 1GMWD 3T1HK 3IRUA 4WKRA 2KHOA 2KHDA 2W54A 2MLZA 3O8WA 1WAFA 2H3IA 1HQUA 3MN9A 1E4GT 4M0AA 4DFPA 2D41A 1HKBA 3PR4A 1SC6A 4FK2A 2JZ5A 5EOZA 3NGZA 4LUBA 2HK3A 1NJWA 1LAVA 3CD7A 1ZQJA 4WYBA 2BPFA 3TTFA 1PAEX 1Q46A 3VGMA 2E9TA 1RBLA 4DX7A 3VAMA 4W5OA 4WF9Q 1FEZA 1ZQQA 3H8WA 1QSLA 2W2PP 1QD1A 1XNRK 2HS3A 5KAIU 4A5BA 4YVZA 3CQXA 4HUGA 3B9JA 4CP5A 5JVGQ 3G6EN 3QLHA 5HQLA 4HHTA 4CBUA 3HD2A 1N8RO 5HHIA 4LREA 1BPXA 1IR1A 3D6JA 5LMNJ 2G4BA 2HQCA 4B1XB 3MM8B 3UDVA 2B4PA 2KDOA 4H4KC 1XWLA 1TYQB 3I9V9 1GX6A 5CY4A 4HHUA 3BBFA 1O03A 4ED7A 3VN5A 1Q9XA 5GMDA 4WFBQ 3KHRA 3OW2R 3HSCA 4DR1F 3FRYA 4KT0C 4M94A 1P90A 1TKXA 1C0UB 1V97A 4RW6A 3SMSA 2ZIWA 1ZQSA 4DLEA 2HFVA 2HKEA 4BREA 4DCOB 3K57A 3VEXA 3KLGB 4HDHA 2VA2A 1IBCB 1NDKA 2OH2A 3OSPA 4JV5F 2Z0GA 1WI6A 4QS8A 2Z56B 3ZSOA 1QSYA 3PSPA 3MM6A 2FHKA 1SV4A 4BC5A 1X5OA 1X7VA 1R8PA 4C11B 2EQYA 3R7SB 3CD5A 1FKAF 2R7RA 3W2WA 1AROP 4P2HA 4ZIVA 3ZSRA 1FXXA 2B8PA 1DK2A 1KQQA 4OZ3A 1T3NA 3WU2U 2OP5A 2CRLA 4DU1A 5HLFA 2C2RA 3ONNA 1Q5VA 3SENA 4KTZA 1XR6A 3RJGA 4KV8A 4JYAF 2KZ3A 3E66A 3NVMA 4IO9L 4F02A 4CEEA 2R7UA 1BL3A 2EHGA 3RRGA 3G71S 3FDSA 5J2NA 5F41A 2V8VA 4ELUA 1YI2N 2O4GA 3TSPA 2RE1A 2MKKA 2ZOGA 1FFWB 3OFGA 4I6YA 1S5JA 2D1CA 1V85A 1YTAA 4HAIA 3GJQB 3DXMB 4LFAK 5AQGA 3ZX0A 4C1NI 1ZBFA 2DRDA 2B43A 3EE8A 3KJFB 4O5BA 2QB0A 1NJIO 4J9VA 4OV6A 2R7SA 4F5NA 2BCVA 2DCUB 4XTTA 3IFRA 3IO1A 1SKSA 4W98A 2VG5A 1RILA 1RQ0A 4CEQA 3GCWP 1HL6A 2E3TA 1HJOA 2QMUB 2FF3B 2PFQA 1BC6A 2B6GA 3OT9A 2XMJA 2I6WA 2N3OA 4I28A 3PYFA 4RPFA 3F2KA 3UVJA 3A3NB 3S41A 4ECVA 3H7HB 3Q89A 3MR6A 5KPRA 4TY8A 1KN6A 4LD0A 4JI7J 1IKWA 1QAJA 1E6YA 2IIRA 3AVLA 2Z30B 2WB1C 2N82B 4P72A 1PVPA 4F72A 2ZJRL 3PX6A 2Y1RI 2K8BB 4N8NA 3ZZOA 4JD2B 4ZPVR 1KSPA 1ZQGA 3T6BA 1UWBB 3SQGB 1VQKS 1RWUA 1ZM2A 1HQUB 1TL1A 4GKJF 2F7TA 1AT1B 3CCWA 1HWJA 2WBMA 4IJAA 8ICEA 1UEVA 1N33F 4I2QB 3TZYA 2D9OA 3GL1A 1CJVB 5KTQA 5CYMA 4F0KA 3HX0A 1SJFA 1ZD3A 2L48A 4CO5A 5AI8A 2RAQA 3WXKA 4MO5A 2QC3A 5IFMA 1VQMS 2GVDB 1VCTA 3M2UA 2E8AA 5AQJA 3L5KA 2GQQA 1FE4A 4ZTFA 3OYGA 5KFCA 1NEEA 4AXJA 2APOA 1WBDA 1T7PA 1EKSA 2M9KA 8ICXA 4HACA 4M04A 5IWAK 1RT1A 3GFYA 4IOXA 3DMJA 2CQ4A 5KI6A 3WHIA 4ISGA 4MQ3A 3TKAA 2XHCA 4RJVA 4USKA 3WBZA 4ECQA 4ZN1A 1N33J 4LF7J 3K5MA 4AT1B 1F1BB 4B6JA 4G9ZA 1HNVA 5AZJA 3GIMA 2VG7B 2FZCB 1RBOB 4DR4K 4EP4A 3GTYX 2KHQA 2NQPA 4ZLLA 2BM1A 2HHUA 5A0YA 3DJCA 2MQNA 4GVBA 4RW8A 1OY9A 5DQGA 1B9DA 1MQ2A 2VB6A 4A8OA 4Y34A 3MUVP 5FDLA 1AZSB 1ZRMA 4CIOA 5HP4A 3HPGA 2BQUA 5HRPA 1Q81O 3VQEA 3BB5A 3CJSA 4CF0A 4NA1A 2ZQBA 3MM8A 1X9MA 2CPYA 1U09A 2O3DA 5HO4A 1BO5O 2BJDA 1VQ4N 5AE1A 2NXNA 5HBMB 4JI8F 1AUDA 4RT2A 2YHWA 1VSLA 2HSZA 5H9EJ 2RDDA 3ENBA 4GVMA 4KLFA 5A8KB 2EFOA 1PJ6A 5KNIA 1N54B 4CEZA 4QWAA 3LOUA 2HHWA 3QEPA 3OHAA 4X4NA 2NRTA 2XB2D 5DLFA 2E5IA 1PKUA 4MN4C 3LAMA 1NB7A 5GAEI 3KKRA 2K4PA 1B0VA 2NXUA 3UM9A 2DXDA 1X66A 2HQIA 3PVXA 3PW0A 3IGVA 2G09A 4K43A 1OKJA 2I0XA 1RDWX 9ICSA 3UIQA 2IA6A 5D0EA 4B08A 1YRUA 3ISCA 4A8KA 1BISA 4ZVFA 1FNXH 3SUOA 5HANA 2XZTB 2MXYA 3FGUA 1SIZA 4M45A 3Q7CA 2YNGA 4K2XA 1KHWA 5ALSA 3LANA 5LT5A 2E8PA 3SCLE 3QNNA 3H8YA 1T9XA 3D7SB 2NUUG 2HZAA 1URJA 3ILIA 1D8BA 1EHWA 1U47A 3CMQA 4JYAJ 4M3XA 3BO3A 4QWEA 8ICZA 1MA9B 4KREA 2BABA 1NM1A 2P8IA 1X4EA 2IC3A 2JGUA 1BWEA 3S8SA 4DL4A 4E0DA 1UPHA 4MT1A 4PL7A 2BHNA 2NCKL 5E79U 3QU5A 5I3UA 3FQKA 1YUWA 4IYQA 2OYQA 1S6PB 4UASA 1UT8A 1RKIA 1V4SA 2WAQD 1S1WB 3LYSA 3ZZTA 2OELA 1YTYA 2YY6A 3MK6A 1NZ8A 2MB0B 2LU1A 4H4OA 5ALDA 2ZH3A 4YXMA 3R8YA 4X66J 2KZZA 4FWLA 1VFJA 1W26A 2DGVA 2Q1NA 4QOZB 2P9EA 1N56A 1SV0A 2GIQA 2AA4A 3OJSA 3FFKB 3QEWA 2ZZMA 2WONA 2D7SA 2MZSA 2GEMA 5CZ1A 1H3DA 4UB2A 2LVWA 3AJ2A 1GLCG 2EPIA 4BE1A 3KJVB 4QIVA 1V38A 2MQQA 4K8ZA 1NK9A 8AT1B 2UUAJ 2KHVA 3O8MA 4K4VA 3BYPA 3ZZZA 4HCBA 4E7LA 1WLJA 2OPSA 2F9DA 5KFQA 4J2BA 1NHVA 3TZZA 1DQ8A 1RDDA 1OWXA 5LMNF 5AM0A 3C2KA 1HNZF 3WT0A 1U8WA 2UXDJ 2EAOA 3TJAA 3W5XA 3EGVA 1HHQA 2KB2A 2ZUBA 3LTOA 4CF2A 2V67A 4FKXA 1M5OC 1ITGA 4CZFA 1WCNA 1VQ5N 2W4PA 2BPGA 2B3TB 2WSFC 3L4PA 3DRRB 1F44A 2ATLA 2N7YA 4WK3A 2JLFA 3S6EA 3G0ZA 4MKVA 1S1UB 3T5KA 4FWRA 2XLKA 1KW4A 3MXHP 2P9IA 1NZAA 3SI8A 4HHJA 4AFFA 3LM2A 4JS4A 4OHWA 4USTA 3KYLA 5LXRA 3TRGA 3MEKA 3OS1A 4FVMA 3ZZRA 3I87A 3JAMY 1VQ8N 2LKZA 1FNOA 2B4JA 1ZQWA 4Z4GA 1NK6A 3H1QA 2HURA 2WW4A 3J7YI 4IUFA 5FPNA 2AEFA 3DFEA 2HMXA 5BR8F 3VZIA 5MLCV 2OO4A 2HNDB 2FY1A 5EX5A 2QLFB 2K06A 3TSQA 2ILYA 1MG7A 4AHRA 5IT9O 5EGYA 2N4DA 4HH1A 3T79A 4TN2A 3ZETA 1RAJA 4DPTA 1S3XA 2PMZC 1ZQAA 4FNIA 1QY7A 2YWKA 4GXIA 1BQNA 2HLUA 1TAQA 4RWXA 4CFDA 3DLHA 1C6VA 3LZJA 5AICA 2CNOB 2QWPA 2JRSA 4AH9A 4DXLA 3P4UB 1TL5A 2H51B 3KBBA 4FOIA 3L4BC 2FPKA 1A0PA 2DGWA 1X5SA 2A6AA 2G13A 3KNAA 3TUIC 2WSEC 4DSFA 1NK5A 4CEAA 5LMNK 5J0WA 3ZDBA 2H3FA 2FC0A 3OVSA 3HJEA 3K4GA 2AHOB 3J7AN 1ZQIA 4ZH4A 4RBVA 1B99A 3LP2B 3SAHA 3G71N 1C0TB 4RPZA 2O67A 4KI6A 1IBMK 3AVBA 1O0PA 3PR5B 1R0AA 4PPDA 1PCAA 4DL0C 1LK5A 4OL8A 1ZETA 2UYTA 4UOGA 5L8RC 3N28A 4A5AA 2LEBA 5DKWA 4E3SA 1QQOA 1GO3F 5G0RB 3MM5A 2XI9A 2QLXA 1C20A 5C2GA 3QMLA 5KG1A 3HCXA 1VQNS 4GV6A 4DSKA 3TUJC 1KFSA 4P75A 5AQYA 1ZQYA 4KGMA 1GFWB 1VYAA 4HTUA 1Q82T 3A3OB 3IRXA 4IO9Q 1VSIA 2UUBK 1F0MA 3JQKA 3QX7A 4AL6A 3NXZA 1R8HA 3NGRA 1N62A 4YOEA 4I64A 2K7JA 1PAUB 4EU0A 3ASMA 3O08A 3I1YA 3BGRB 4GO5X 4B9TA 4BC2A 3U02A 4Y3CA 4O3NA 3QGPA 1ZM9A 4PPZA 1J5OA 2GLEA 5L1JA 4KB1A 3W9HA 1VQ6S 2ADCA 4ATNA 2IJNA 4L3NA 3CJ4A 4CWBA 4LFAF 3QEAZ 3DLLQ 2GWSA 3EUNA 2DHXA 1CSJA 1NB2A 1G2EA 1JJ2M 3L9ZA 3WXMB 4RUHA 4LVOP 4U7BA 5E2QA 1H38A 3IHQB 1DKGD 4ISEA 2G1DA 3EZWA 3JQMA 2QWNA 1FKPB 2NRXA 4NLZA 1JB0C 4P4OA 5EWEA 2WCXA 4BVOA 2G0JA 1UJ4A 4AYBC 2KVIA 5ALXA 3K89A 1RBRA 2MDAA 4DZ6A 2E29A 3WIVA 4K4IA 5B09A 3LDPA 4CYUB 2V7ZA 1RHUB 1LK7A 4HT5A 4O44B 1Z1ZA 3MMCA 3VESA 2HEKA 7ICKA 3BY5A 4LF7K 3MAHA 3O3GA 3SQ4A 2QV6A 4ED5A 1UWAA 5C2DA 2C3OA 3TABA 5IIOA 3MDQA 1S1UA 2QARA 5AI4A 1CLFA 3R5GA 1IIPA 4WFNQ 1NNDA 2RB7A 2HYIB 3KOOA 4UW2A 1JLEA 4KQZA 4TU8A 3O4WA 5D4OA 2H3QA 1UVJA 3BF1A 1KFDA 3EM1A 3GP9A 1KVJA 4PG7A 2CGJA 3PIPL 1WBBA 1LNQA 4HR2A 3OVAA 1HEKA 4ZVGA 4J9LA 2HMIA 3CXCM 3PTWA 3BSCA 1ZQHA 5AT1B 1XNQJ 2ZDOA 2M0NA 3W8GA 1Y5IB 4IQVA 4IFVB 3VEZA 3PNCA 1GMVA 3JXOA 1SZHA 3NASA 2CJYB 3W1YC 4FSVA 3GJRB 5DQHA 4YDXA 2OFGX 1D9AA 3M8QB 1T02A 5GAHU 2DHSA 4NLQA 1ZQNA 2F4VF 4NM1A 4H0TB 2Y8WA 4OI1A 5C24B 3EMTA 5C25A 4CIGA 4CZIA 3LP0B 4PL1A 4LFBK 3Q22A 4ZMMA 4E7HA 1VQSA 3M2UB 2IOFA 1TUVA 1RT3A 3UD4P 4LFCK 5LJVA 2H5IB 4FLZA 5H9FJ 2YPZA 1OXJA 2DR5A 2A42A 3OHBA 2VHGA 3E9PA 2CPDA 4DKWA 3HSTB 1Q7LB 1XK8A 5C2CA 4JI2J 1U1QA 1WORA 2G2OA 2ISPA 3G82B 1ZA1B 3P96A 3AVAA 1XR5A 3V7LA 5K8NA 4UT4A 1HPZA 2MSNA 3AO4A 2IVNA 2FPLA 2GC8A 2OD6A 1Z00B 4X4PA 1UL3A 3TVZA 4H8KA 4F4YA 4I27A 3OHRA 1I6JA 4DFMA 1DZ5A 2W9AA 3AN1A 3SCJE 5EE3A 2UXCK 3NWGA 1N5YA 4N77A 1SIWB 2IRUA 5HP1B 1HBOA 2GAHC 5AQFA 2ZVIA 3C1ZA 3LO3A 5LJ5Y 2ASDA 4K0KK 5AQWA 3HWTA 2EC0A 3BYRA 2NPIA 1J5EJ 4JK8A 4DUYK 3EPGA 1N36F 2AJ0A 2KMDA 4EENA 4DZDA 4UOCA 3D2NA 1HUZA 4QZAA 3D6FB 2W42A 2HVDA 1B4SA 3GCXP 4NASA 3WKDA 2JOQA 1FJCA 1MWMA 3BQ2A 1ZJNA 2NO4A 1NDLA 8ICHA 4BQLA 4KH1B 3M6UA 4GV9A 3WQPA 3KHHA 3F73A 1SQFA 2P9LB 5A76A 4IDKB 3TANA 1GAOA 2HAFA 1C1AA 2UUTA 4WKYA 5KFAA 2IM1A 2XC9A 3CE8A 2YB4A 3H6EA 1C1BB 4DV4K 4ALZA 3NL0A 3AXKA 4BRMA 5I42B 2EK6A 1A5XA 4DEZA 1Q16B 3K8WA 4DU4A 1J5OB 8ICKA 1ZOLA 1N36K 2IMOA 3D1HA 4ZVUB 5ALMA 3E58A 3FEZA 3QQCD 1YLXA 2PMHA 2BJ1A 3NGSA 4FXWA 2A41A 4RQ6A 2I5HA 1KQSM 3R3TA 3MOJB 2HGMA 3AB2B 4OV1A 1UQVA 3RVCA 2QB0B 4LH4A 1YRXA 4O3PA 3DLGA 3NMUA 2PFNA 3GIKA 2D6FC 3R1XA 2P51A 3NVYA 2ZIVA 1PJ5A 1IG8A 2AJ2A 4DL6A 2YWGA 3WK6A 1FXLA 4I2DA 1ZQMA 1WC6A 2HNZB 1CJTB 5A6PA 1NZPA 4ZOSA 1UVIA 1UJ6A 4QR2A 2HDOA 4UOHA 4FM2A 4KLOA 4LQ9A 4A8WA 2B0GA 2GUPA 1KKHA 2XICA 4USMA 1QQNA 4JK9A 5AQOA 2ZH8A 3QINA 4XUSA 5D77A 1CULB 2KFZA 3VQSA 4RW9A 1WG4A 3IWLA 3TSUA 2VPYB 3TAQA 3DEEA 5JS1A 5BJRA 2EZYA 3G9CA 2H65B 2X51A 1Q1KA 1TAMA 3LA0A 3O44A 3M9NB 1TV6B 1SL2A 3HBTA 4AM6A 5IIKA 4K0KJ 3QSYB 3NRZA 2F4VJ 4BUGA 3FEYB 2RVJA 3AH6A 2C2DA 3B54A 4CT9A 5KG0A 2E2PA 4FCYA 5FDLB 3OLBA 4MJKA 4B3MK 1KS2A 4QYZJ 4AF1A 2HF4A 2GO8A 4FWOA 1P8ZA 1U2CA 4ILMA 1YWXA 4DTJA 4NXMF 2CQIA 2DKXA 5KG4A 4ZCIA 3IA0A 3C6HA 1NXIA 2Y0SD 4WFBL 1OY6A 8RUCA 4IOBA 1ZBTA 3UQ0A 4DR1K 4IFYA 7ICNA 1E4FT 4DUZK 1Y7PA 3I0SA 4JI2K 3OYFA 1BPEA 4I2AA 3H0LB 1H7XA 1ZQLA 1T9YA 3O1WA 1VS3A 2RQ4A 4M7XA 4HEA9 3RB3A 2KJ5A 1OJ4A 2XNQA 4NLOA 1L8OA 1VSEA 4NLYA 5KGWA 4LFCJ 5EE1A 3SJJA 2MUTB 1ULRA 3R5AA 4XA5A 4DFDA 3WUHA 9RUBA 3KZXA 4K50A 1L3UA 3DRPA 2DNNA 4PG8A 1FK9B 1HNXF 2O8DA 5L38A 3A13A 4KI4A 2DY4A 2K4EA 4I7FB 3OY9A 2AXTU 3H2VE 3KKSA 2XSFA 5AQHA 2BOPA 3KXDA 3CJKB 1CJUA 5L9NA 2O6KA 2OPRA 1CXUA 1U1LA 3NBPB 3VAGA 2Z2MA 4FJGA 4KN4A 1KBUA 1S48A 1S10A 2B6AB 1C1BA 4M8LA 4DOBA 3AEVA 1Z4UA 4Z6DA 4GLXA 1UVMA 3MWBA 3DOLA 3AJ1A 4H0YB 1NUEA 5KFPA 3L8BA 4DDFA 2MQPA 5HJYA 3P6YC 2F9TA 5FD1A 4DV1K 1WWVA 3CPWR 1FO4A 1KAXA 2BTFA 5HSPA 3U3YA 2KKZA 2ZUGA 4JUZA 3D54A 1IKXA 1N5VA 1L3TA 4I69A 2DNMA 4R66A 3ONQA 1H73A 2ZBQA 3TJ9A 1QS4A 1YVUA 1Q95G 1B9FA 3I8DA 3HW8A 4XH5A 1M1KO 3D9BA 4ZVRB 3FLCO 1RLCL 2KXFA 1WOSA 4K8RA 3HVTA 1U2VA 4BR7A 5KPZA 3VR1A 1X40A 1HR0J 2WZ1A 1WG1A 5DQIA 4P74A 4WE1B 4Z94A 5J0SA 4JEPA 2V2VA 4ZIWA 4LMZA 1ILYA 3DLEB 4Z2XA 1AQ6A 2LXUA 3FSYA 1IM6A 3D2WA 2VFVA 3K59A 4BHQA 2M88A 4JYAK 4KBOA 4RNMA 2J7UA 5KOXA 2WVDA 4PGYA 1SC3B 2CJXB 4MEXA 5GADU 4X2BA 4F3OA 2FE9A 3MTJA 2CNNB 3KD1E 1W7WA 4YD2A 4KPYA 1VHIA 2G8HA 4Q7AA 4N5SA 1RAAB 4E1MA 1HUOA 1CEZA 2D0BA 3PEJA 1CS4A 1VK8A 2DKZA 3UN3A 1V3ZA 5LL6d 4QZ8A 3MAAA 4CBXA 4OPAA 2YQ3A 1S9EA 1RT6A 4H4MA 4IH5A 1U2FA 1V4TA 5ADZA 2M4MA 5F1XA 5AKYA 4KV8B 4DV1F 3C2PA 3BSNA 3SK3A 2WC9A 1VLYA 3NCIA 4KH5A 1N33K 3R7BB 4E2FB 1KNZA 4BC3A 2V52B 3N5BA 5T41A 2WB4A 1JXEA 5F8LA 3B0XA 2I1QA 2OPPB 2ITGA 3WKBA 4USHA 1RABB 2VOPA 4ICLA 1HBNA 3WIUA 5ETQA 2WOMB 1D9FA 4EHTA 2ZJQL 1T95A 4Q44A 3ULHA 4WJBA 2RRAA 1VQYA 1X5TA 3DRPB 3BQ1A 1QAXA 4DV6J 4B3TF 2GV1A 5DGAA 1ZJMA 2GTDA 4M9GA 4JI3K 7ICRA 4I56A 1UETA 2NZCA 2FSKA 1DFDA 2RHQB 3OR2A 4U95A 1ZBIA 3HHKA 2IDEA 1QE1A 3CCMN 3BKUA 3LUYA 3AODA 4RU2A 4KAZA 3ULEB 2W4CA 3RW6A 1RTIA 4R0JA 2X3GA 1IWAA 3UMCA 2ESEA 4FYXB 3S1TA 2AP1A 2QWOA 1ZBUA 1OYDA 4CZJA 3UVJB 5CABA 3KUHA 5AE2A 3RYLA 2E44A 3W62A 4RQ4A 2GGPA 5CE3A 2R7XA 3DRXA 5CP2A 3FBEA 1T8EA 4MLEA 1RU2A 5BR9A 3HRDD 3I5AA 2V9KA 2C2ZB 3NTUA 2EEYA 1EXQA 2XYPB 4DPWA 5GTIU 1Z2ZA 1RAFB 2F1FA 4KKOB 3M6GA 4FPBA 2CG4A 3VA0A 4JKBA 1SB6A 2GIFA 2BMBA 4Z4HA 2GW8A 3D0PA 3IV6A 4K4XA 2FJAB 5D0GA 1JUDA 2YKNB 5ETLA 3KJVA 5J0YA 1C0UA 3OBIA 1MNEA 4WK1A 3FFIB 3VF4A 4KE5A 5IC6B 1V3SA 3D6MB 1Z26A 3EZUA 3T1HF 4CHQA 5J1EB 2W7AA 1R8AA 2N4CA 4WP3A 3GMGA 2O8CA 5JVHL 4ED6A 3AXMA 3QT8A 4FYWB 1F9FA 1TUWA 3GG0A 3CDEA 4MLHA 2BJ9A 2A0FB 3DM2B 4BJQA 4MHVA 2DF4B 3DRSA 3A8IA 5TKYA 3R97A 3HJVA 3LL3A 4CD1A 4M6WB 3HSZA 3PRVA 4NB4A 2FD2A 5HQ8A 1VQLN 2ODGA 2FGOA 4CE9A 1NGEA 4LR7A 1Q18A 4KHRA 2XYGB 9ICQA 3AVNA 4RQ1A 2CYYA 2ZIUB 3VGSA 2K8AA 4JI7F 5D0HA 2FBXA 5CYQA 4ZCLA 3KG4A 4ZCKA 4DV5F 2AT1B 2DEJA 3A0HU 1X1PA 3OYHA 3AVGA 2HOQA 3V1QA 2LLZA 3L7UA 2L9WA 5ITHA 3U9ZA 2DFFA 1U1NA 4JKGB 5J0TA 2F44A 4QYZK 4CO0A 3EKSA 1X4AA 3V5RA 4A8FA 3VVTA 1QHTA 1MN8A 3EVOA 3K2YA 4P10A 1I94F 3KDOA 1IBKF 3QO9A 3BKFA 2RP5A 2Z2YB 3UNGC 4H5VA 3QEXA 4FWSA 2HRUA 3VAKA 1HI8A 4M5DA 4JI3F 2HVZA 3D1QA 3VGUA 4DV0K 1H74A 2BUPA 2MPUA 2ZIXB 2KD1A 2K2PA 3DOKA 2D0OA 5KRSA 3K7RA 3IXQA 4ECSA 1MW7A 3M1VA 2GS8A 2VJVA 2GV9A 3MGHA 5A8RB 4PY5A 1G99A 4KHQA 3GR1A 3MCPA 8ICFA 1KP6A 4RZRA 5DRKA 4M9LA 1LW2B 4CLKA 4OYAA 2HQGA 5F8HA 4UAVA 1FW6A 1IKYA 4FXVA 4NI2B 2Q6CA 2E1YA 1YVFA 3M1FA 3EDRB 1ZQDA 3R5DA 3I4HX 3OUYB 2KQ2A 1RDBA 2I9GA 3NCPA 1X0PA 3UDCA 4QIEA 3KMQA 4FOEA 2M70A 5SZTA 3RMBA 5BN9A 3CO0P 4ZVSB 4ECXA 1ZQCA 1NGGA 3GIRA 4X64F 2K89A 4B9SA 4FWQA 4CIFA 3CRXA 3SLCA 3H7IA 2JEIA 4US8A 9ICOA 4ECZA 4CJSA 5A8WA 2ZHOA 2GQ2A 3AB4B 3K17A 2FJEB 3F9MA 5DMRA 2W9MA 2MKSA 4CESA 2CXYA 1R31A 4ANEA 5J2MB 4L75A 3CERA 4NLVA 3UO0A 1WKKA 4P7VA 5F0XA 4LSNA 2K8GA 2WUSA 3CD6S 3LM9A 1HNZJ 4LF7F 3I56N 3DOMA 1RT3B 8ICJA 5JS2A 2V4RA 1RT5B 5CCLA 4F25A 4YEAA 1YHQS 4NZ0A 2FVQA 4FLYA 2EBEA 1EB0A 1VRQC 2DPIA 3CCRS 4PQUA 1WHVA 3PHTA 1ZBSA 4JKCA 1S1XB 3AJDA 2NRRA 3HHEA 3K5LA 3Q23A 4DV5K 3O80A 4DOAA 4NO7A 1TQLA 4DS5A 4CO2A 2CZ4A 4ZKAA 2WFAA 2RDJA 2ISOA 1TAUA 2ATQA 2P9SB 3MPUB 1QDUB 4PXEA 1D0EA 4Q0BA 3N6LA 2OM6A 5KFZA 4OJPA 4KHYA 2QL9B 2WB1F 3VQPA 4DTPA 2Y1LB 2ZH6A 4AM7A 4LSZB 5C5JA 5J1EA 4UY8O 3R5BA 1MWZA 2YX4A 5B0DA 1I1GA 3U1NA 2ZD1A 3UW1A 2CVEA 5AQSA 4ZOHC 4BRKA 4EGLA 2VG6B 2J0XA 2XWYA 4X64K 1BA1A 1NU4A 2YNFA 2AZ1A 4UAWA 3BR8A 3PJXA 1YJ9N 5E84A 2LHTA 3E1YA 3I55S 2X6NA 1SUQA 2KI2A 3CM5A 3FMWA 4CGJA 3SPYA 4UBCA 1XC9A 1TKDA 1FKOB 3V2UC 4ILJA 3HHNB 3K1ZA 4LIWA 2ZNYA 4JI6F 4YB6A 3ETMA 3M7VA 2CQHA 2A3VA 2HFUA 4E89A 2UU9K 1WC4A 4LR9A 2O8EB 2XULA 3MUMP 2MGZB 1V9OA 2PSZA 4JV5K 5KPTA 3MDFA 3JSYA 1EETA 2WVCA 3EGNA 3ZSXA 1VBXA 4I2PB 3IG1B 3JXUA 4JI3J 4AQYJ 1MN7A 1WDTA 5C2FA 2JH1A 3R9PA 4J9RA 1GTHA 8ICQA 4F4WA 2WB1D 1SB3C 3DLRA 1VJ5A 3E01B 3P5JA 1VGYA 1RE1B 1GT8A 4RW9B 1S49A 4FLVA 3MGIA 2LXFA 4A59A 3MTKA 3ZSWA 2O8BB 2PDAA 3DOKB 2KO1A 2QJ3A 4EK2A 3J7YU 2HLTA 3AA9A 4Q2MA 4M5DB 3V6JA 4YORA 4EHUA 1JLGA 2VV5A 2DITA 2DY1A 4BE0A 1HLUA 1KOOA 4CJ7A 1CJTA 4M3YA 5DJBA 2QZ8A 4RW7A 1HPMA 2DPNA 2JWKA 4KGKA 2FLLA 3ZT1A 4K4SA 2QW9A 5ALOA 4ZHRB 4KB0A 5DB8A 2D3ZA 2VPZB 2R8KA 4CNQA 2F40A 2VD3A 3B6PA 1BDGA 1YZ7A 2ACMA 3TTDA 1RHMB 4P73A 2GBZA 3FAHA 3QPIA 1TV6A 2HOFA 1C0GA 3EVWA 4DMNA 4XPEA 4A61A 1NOZA 1FIQA 4RLEA 2W03A 4ZJQA 4TUPA 3NOCA 1F5SA 5IT0A 4I2FA 1ZQ1C 4URSA 3C6UB 4B1WB 2F2AB 4NYFA 2EKNA 4DX8H 5HRSA 3NS7B 4ECTA 5J2DA 5KG3A 2GWJA 5FJ4A 4HTIA 1UAXA 3AQFA 3LP2A 4I2GA 4BXOA 4PUOA 3BN7A 2E9ZA 2E1FA 1ZQUA 4PGQA 1U8SA 4CZMA 2W9CB 3TACB 3MZIA 4BROA 4K59A 4H54A 3RAXA 3QJPA 5AQLA 3SFUA 2VJ5A 1W25A 5AJ3J 1A5VA 2FJXA 4CZEA 3OTCA 3J7YP 3OPXA 3TQ1A 4RUCA 4RNFA 2QMWA 3B8AX 4OGCA 5J2FA 1Z3EB 2A5XA 2R2TA 2WF5A 2RUGA 4OMFG 2L08A 1YJWN 4JI6K 1TKZB 4PWWA 1FA0A 5J2NB 3QU4A 1WC3A 5CWRA 1REGX 3RJHA 1C4AA 3QAEA 3IR6B 5HMMA 2CDQA 2IRYA 1IQTA 4DUYF 3I96A 3OLAA 3BN4A 3CCJN 2Z8QA