2HHQA

O6-methyl-guanine:t pair in the polymerase-10 basepair position
Total Genus 217
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
217
sequence length
580
structure length
580
Chain Sequence
KKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structural basis for the mutagenicity of O6-methyl-guanine lesions.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords 5'-D(*CP*AP*TP*(6OG)P*CP*GP*AP*GP*TP*CP*AP*GP*G)-3'
total genus 217
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2006-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2hhqA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 2hhqA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hhqA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2hhqA01
2F1IA 8ICEA 4O5EA 1ZQAA 4IQWA 5HP1A 2R8IA 3PMLA 3OJUA 4JLHA 3V9SA 4DS5A 4RQ2A 4M3WA 5J1EA 4HCBA 4DTPA 5KFOA 8ICTA 1BPDA 3NF6A 2XY7A 4F2RA 8ICIA 4FJ8A 3KD5E 1SUQA 4PA1A 3DLKA 9ICTA 1TL1A 3KKSA 1IKYA 4CIFA 4K8XA 3QZ7A 4FS2A 3AVNA 7ICPA 3TANA 4F5RA 1VSMA 3V9WA 1QTMA 1DLOA 8ICQA 3DI6A 2VWJA 4AHCA 4IQUA 4QZIA 5KGXA 5D4BA 3AVMA 4I2HA 3O3HA 1JL1A 4O4GA 4CK3A 3S3OA 4FLVA 2JZBB 4BXOA 2Y1IA 5DGAA 1DTQA 4M0AA 2QK9A 2DFFA 4DTSA 1QSYA 2AGQA 3SQ4A 4CJRA 8ICFA 4N5SA 1WSJA 3ETLA 4YMOA 1RTDA 4M6WB 5KT6A 5DBAA 3RH4A 4RT3A 1TV6A 2ETJA 3CFRA 3M9OB 3MR5A 4KN4A 1B9DA 2W42A 2RDIA 1K6YA 2C2RA 5CWRA 4NLNA 5HRNA 4F2SA 2PXIA 1VSLA 1VSIA 1RT5A 4DSKA 4J9SA 1BPYA 3MFHA 5CP2A 3ZT1A 4CJVA 1DTTA 3OYNA 4FJGA 4FYDA 3FDSA 3M9MB 4YN4A 3OYMA 4UBCA 1H38A 3ZDEA 5J0TA 3MXIA 4IFYA 4KHWA 1S76D 4PY5A 1SL0A 3V1OA 3VN5A 4GC6A 2P1JA 1FKPA 1U04A 4ICLA 5J2MA 3SV4A 3L3UA 4J9PA 4HUGA 4PH5A 3AVAA 3TAQA 3PR5B 3PR4A 4M2YA 4NLGA 5C5JA 1MU2A 3Q8MA 1AROP 4M41A 3AO2A 1TGOA 3QEPA 3B6OA 4JWMA 7ICFA 4R64A 4PGYA 2OZSA 3DRRA 4Q0BA 1X2IA 5JUMA 4CIGA 1S97A 1GOBA 4FZYA 2P6RA 5KFVA 4FVMA 3KLEA 9ICQA 2E6LA 4QZBA 4I7FA 3GV7B 2AJQA 5KFQA 4JRQA 1QS4A 3PNCA 3ZSRA 4CEQA 2G8WA 3PW0A 1NJWA 1BPBA 1VRUA 5KFXA 4F4XA 3TAEA 2KN7A 5DB9A 4E1NA 2XY8A 3H08A 4I2AA 5KFFA 4R63A 2FMPA 2YNGA 3HYFA 4NCAA 3QERA 2A1JA 1KVBA 4H4MA 4DL6A 4N56A 3DRSA 4I9QA 8ICOA 4YD1A 5J0SA 4YCXA 4Z4HA 2FLNA 3QLHA 4B08A 8ICNA 2P6UA 1GOAA 3AO5A 4HUEA 3HPOA 4GC7A 3ZSVA 2G8HA 3KIOA 1L3VA 1CZ9A 4F93B 4K4GA 3L2QA 4O3SA 3PY8A 2Z1GA 1ZJNA 3ZSXA 7ICIA 3JPPA 2NUBA 3QINA 1UAXA 2IMWP 4CIEA 4GLXA 1IKWA 1ZQBA 3RRGA 3AO3A 3E2EA 3RB6A 5J0OA 4F3OA 4LD0A 1SKSA 3QESA 4UB2A 3F9KA 4JUZA 3K5MA 5DMRA 4RQ5A 1JLAA 2XCAA 1KFSA 4FO6A 4IRCA 4BE0A 4NYFA 4I2CA 1VRTA 5CJ7A 7ICUA 3GIJA 3EWAA 3ZSOA 3V72A 4O5BA 4FM0A 2PFNA 2QKBA 1ZQHA 3ITHA 2KZZA 3ULDA 3L3VA 2FBYA 4DTXA 4AHVA 4MFCA 1BPEA 3OHBA 4F92B 2W9BA 1JLEA 2BDPA 1Q9XA 4NLZA 4MEYA 1C1BA 3OYIA 4E7IA 3Q8LA 3ZDBA 4PWDA 4TUSA 3KKRA 4DTMA 4Z6CA 4AHSA 9ICGA 4Q45A 2GBZA 5CZ1A 4PGQA 3O4NA 4RPYA 4TSXA 2ASLA 1C0MA 5HHHA 2OWOA 5C24A 4IRKA 3V81A 1KFTA 1BIUA 4N47A 3GIKA 4YR2A 2BE2A 1COOA 2X78A 4KLLA 1D8YA 2RN2A 5KFCA 1ZQJA 2KFZA 4MFAA 3DRPA 9ICLA 3HXMA 7ICHA 2NRVA 4Q43A 4ELTA 2P66A 3V7JA 4HYKA 4UAWA 3RJJA 3AVIA 4Q8FA 1XSLA 3DMJA 4DSIA 3NH0A 2FPKA 3RMBA 1RT7A 5D3GA 4CJKA 4KTQA 3OHAA 3O3FA 1D9FA 4PQUA 1VSKA 1NKCA 4LSLA 1LAVA 3AA3A 3QO9A 4PGXA 4HCCA 3DLGA 4B8AB 4DMNA 2JEIA 5DBCA 4QCLA 3Q8KA 4O3OA 1Z00A 3AO4A 4PUOA 4RW7A 2BCQA 4JK1A 4M3UA 3MGHA 3T19A 3VQPA 2BCVA 4E7LA 4M6WA 4I2PA 3KK3A 4UAZA 2EX3A 1NKBA 1ZBFA 2XY6A 4AH9A 2VWKA 4YQWA 3V9XA 3TAFA 9ICKA 5DQHA 5FRMA 1LV5A 3G6XA 1JXEA 2WOMA 4Z6DA 1QSSA 4KLJA 5KFRA 3KLHA 3BGRA 3VQEA 3U6FA 1WN7A 3C1ZA 4F4YA 3RTVA 1N48A 3EYZA 2IA6A 4RPXA 5EWEA 1MQ2A 1UWBA 9ICSA 3P5JA 4G1QA 4CEAA 2FBTA 1X9SA 1O1WA 1J53A 3DLEA 3PMNA 1YTAA 1HUOA 1B22A 5CYMA 4MEXA 1S1VA 1XSNA 3DLHA 2JLEA 1EKEA 3AA2A 4CEBA 9ICUA 1JKHA 4EBEA 3BQTA 4IQVA 4B9MA 4CHPA 2F8TA 1R0AA 3BQ1A 4KMUA 4QZGA 4CFAA 3NDKA 2PI5A 5BOLA 4OKEA 1T8EA 2XHBA 3BQ0A 3KJVA 1ZQFA 4DWIA 4CJ3A 4FJKA 5KFSA 4FJ7A 1WAJA 8ICCA 4CCHA 2PY5A 1ZQLA 5J0QA 3K5NA 2ZUCA 3PV8A 4CJUA 4B9TA 3T5JA 4CFDA 1RPLA 1ZQPA 3V1RA 4DTOA 4K8ZA 2RF2A 1IKXA 1S0OA 3SPYA 3BJYA 1NK0A 1BCMA 3ISDA 2MUTA 5KG0A 4QZ8A 4KLQA 1NJXA 1BI4A 2HHVA 4DQPA 1D8LA 3C6UA 4LSNA 3MABA 2NRZA 4DTJA 1L3TA 1TKXA 4KHYA 1HUZA 3A2FA 4I2QA 4BACA 4W5NA 1RT1A 4RQ8A 3LALA 2O4GA 2ZJAA 3AVKA 4DO9A 1S9EA 3AVGA 4Z0UA 2ZTDA 4KLGA 1CLQA 2YNFA 4FZZA 5E41A 4OJRA 3H8SA 2IC3A 4CECA 4J2EA 3C2LA 3M9NB 2ISPA 3LDAA 1W0HA 1BHLA 2VG5A 5KG2A 2HHQA 3VQQA 3K4GA 1RT3A 2ZQBA 4O44A 3EZ5A 1SKRA 1TK5A 1VSDA 4QWCA 4BE2A 3RMCA 2KW4A 1C0TA 2M9NA 3B0YA 4DFKA 4FK4A 1KFDA 4YG2A 3C2MA 5HHIA 3V4IA 1JLGA 5HBMA 3LWLA 2D0CA 3SPZA 5IILA 2ZJ5A 4GW6A 1HMVA 3JSMA 4OPJA 2FMQA 4YFKA 3PX0A 4YMNA 2BCSA 1JLQA 4RUCA 4F4WA 3HO1A 4M3RA 1I39A 1ZQOA 4EP4A 1QE1A 2RDJA 3AO1A 1LW0A 4KLDA 2MAXA 4DSLA 1ZQYA 1X9MA 1A5VA 1KVCA 4AHRA 8ICPA 3KLFA 3L2RA 8ICLA 2FC0A 1BQNA 2BGGA 2WONA 4HVJA 3NF7A 4QZDA 4DTRA 3PW4A 3ZT4A 4XQ8A 3KD1E 4PHEA 1S1XA 3BQ2A 3MDAA 2AU0A 3EPGA 1FKOA 3H8JA 4CEFA 1ZQVA 3HJFA 1JIHA 4KLTA 2HHTA 3ORYA 5HLFA 5DB6A 3NH2A 4KFBA 1XU4A 4P4MA 3MR2A 1NK5A 1S0NA 3JPRA 4DQIA 2I1QA 1K1SA 4I2BA 5J2KA 2E6MA 2PYJA 1KRPA 3JPNA 1EXNA 2YKMA 4KB1A 4DTNA 4I2IA 3LWMA 3RJGA 4CHZA 2JEJA 4F3TA 4KTZA 2W8KA 2OYQA 2W9CB 4RG8A 3LP3A 1WCLA 4FJ9A 4LH4A 1CXUA 2D0BA 2XGPA 4DSEA 1RT2A 4KHSA 2PYLA 1U4BA 4K4HA 4J2BA 4KHQA 3VQBA 3RJEA 2WTFA 3F73A 9ICWA 4RNMA 5IIKA 3GQCA 2PI4A 5J0XA 3HM9A 2ZE2A 1B92A 4KO0A 4M42A 3HT3A 5J29A 3IHQB 3ZDCA 2HMIA 1LW2A 4KN7A 3TR8A 7ICQA 4B9UA 3TAMA 5KFEA 4YMMA 3OYLA 3RAXA 1XWLA 3HWTA 3SV3A 3K58A 4CF9A 4FW2A 4F5OA 3NF8A 1ZBUA 3SI6A 5J2HA 1JN3A 3MEGA 2P5OA 3HX0A 1RBSA 3SUPA 2HVHA 2KFNA 2VA8A 4W5TA 3DYAA 2XRIA 4CESA 2UVVA 4GXKA 4NM1A 1BGXT 3L2UA 3ZSQA 3HK2A 4DFMA 4E19A 3RWUA 4LY7A 4CF2A 3L8BA 2ZD1A 4AILC 2BHNA 1T4GA 5F9LA 1ZJMA 2VANA 4G3IA 2IAJA 2YNIA 2DPIA 3IM1A 3SQ2A 3KHGA 5KFKA 2B21A 3C21A 8ICHA 4ED2A 4AHUA 3OYHA 2BQRA 2YHAA 4CGJA 3H7IA 4H4OA 4OGCA 1ZQCA 1RDBA 3RR8A 2FPMA 4R65A 1XHXA 4RU9A 4O55A 3JYTA 1T7PA 1NK6A 3LPUA 2ISOA 3RBDA 1RBTA 4Z4EA 7ICVA 2BPGA 1U47A 2C22A 4J9NA 2QXFA 5HRPA 2B6AA 2XCPA 1A5XA 4ZHRA 5T7BA 4CJFA 4CEEA 4JS4A 3V6KA 4J9OA 3TABA 5DDMA 2XO7A 3TAPA 3V7LA 4LZGA 4LVSA 2LYHA 3K5LA 3ALYA 3QEXA 1NK9A 4CJQA 4EZ6A 4FLUA 3PW5A 2ZTCA 2IHMA 4F50A 3NFAA 1RILA 1LAWA 7ICLA 2O4IA 3GDXA 5CY4A 1IH7A 1TVRA 2H5XA 4KHUA 4CEZA 3S9HA 3LP2A 5D49A 4QW9A 4KLUA 3RB3A 5CYQA 2DFLA 3LK9A 3M8PA 4XRHA 4KAZA 5SZTA 4O5KA 3M8SA 1WAFA 1CUKA 2IBKA 2HVIA 3UXPA 3ZDDA 4KLIA 4FLWA 4FJHA 2BKEA 3TI0A 4KLSA 1C1CA 3C94A 1A76A 3C1YA 3P83D 5CZ2A 1N6QA 1A5WA 3OYCA 1Z25A 4KV8A 1MQ3A 5DBBA 1EXQA 2G8KA 4I27A 4HHTA 3RJIA 3RJFA 4F4KA 1TAQA 1S0MA 4CF1A 1RXWA 4Z6EA 1RTHA 3D0PA 3HW8A 8ICKA 1BCOA 4CEOA 3ZT3A 3PX4A 2IDOA 4YP3A 4M9NA 2E4LA 3AVBA 5C25A 3UXOA 1U9LA 4CE9A 1T03A 1RT4A 5DLGA 9ICOA 1SKWA 4BE1A 5JS1A 4O0JA 1XSPA 1TVAA 1ZBHA 1QHTA 2GUIA 3GV8B 2D5RA 5DQGA 5HRSA 3KHRA 4QOZB 3JPSA 4NXZA 1KLNA 4YFUA 3LP0A 4DSFA 1YT3A 5TZVA 1KCFA 2IOCA 4DL2A 1DOQA 3SUOA 3T5HA 4M45A 2W9AA 2OZMA 4I2GA 2XC9A 1LB2B 1QSLA 4CGHA 1REVA 4IBNA 1RYSA 3PO4A 9ICCA 4IG3A 4Q44A 4M9HA 4E7KA 4IRDA 5EWFA 7ICEA 2X74A 5F9NA 1RDDA 5SWMA 3O4QA 3VQ8A 8ICJA 3QZ8A 4RUAA 3LP1A 4OGEA 1Z00B 3THVA 1TK8A 1L3UA 4YR3A 4F5PA 2DTUA 2GWSA 4FCYA 5HMMA 4RZRA 9ICJA 2C2DA 4NY8A 5J2AA 2ALZA 9ICVA 5KT4A 1G15A 1U49A 3RR7A 3C95A 3QEWA 1ZETA 4C8MA 3EPIA 8ICUA 3OYDA 1HNVA 4PHDA 4ECVA 3C5FA 3CQ8A 5DKWA 4DF4A 1EETA 3GIIA 3ZSZA 4ED8A 3OYEA 4CFBA 4E7JA 5IIMA 1WNSA 8ICRA 3C6TA 4FJLA 3DLBA 1XC9A 3B0XA 4KLMA 2IS3A 4NYNA 4DEZA 3VA0A 4DTUA 3QNOA 4ZTFA 5HP4A 3AU6A 1IXRA 1HQEA 2DY4A 4DQQA 2C28A 2BPCA 1LWFA 4NCGA 4BWJA 5J2JA 3VQDA 2FMSA 3K57A 3WNEA 3MFIA 1ZQDA 3SYZA 3PW2A 3MXMA 1KLMA 1I3AA 1XI1A 3QIPA 1ZBLA 1Y97A 8ICZA 9ICXA 3SJJA 4FJNA 3ZD9A 4KI4A 3OY9A 4KKOA 3SNNA 4OLBA 4YXMA 4B9NA 1D5AA 4BDYA 4CJ5A 1UA1A 4FJMA 4FJ5A 4M04A 9ICRA 4H8KA 1S9GA 3EY1A 5KFPA 4DL3A 1JL2A 4JWNA 4Z4GA 3EW9A 1BIZA 4J2DA 4RQ0A 3I0SA 4PPXA 1S1TA 1S1WA 1J9AA 1HPZA 3ZD8A 4TQSA 3PO5A 5CA7A 4TUQA 4EEYA 1NOYA 3KHLA 2VG6A 4BDPA 3M8RA 4P2HA 1FK9A 4QWBA 3V7KA 1XS9D 4FLXA 3NH1A 1ZQNA 5I3UA 1X1PA 1S10A 1UOCA 5DB7A 1WSHA 9ICHA 1JXLA 2ATLA 7ICMA 4M47A 2I5JA 1U45A 4UB3A 4KLEA 4R8UB 4TUPA 3O3GA 3S3MA 4CHOA 3H40A 5I42A 3PX6A 2LSNA 1T05A 1VK0A 4DQSA 1CXQA 4QZEA 3KHHA 3SUNA 1RZTA 3N4MB 3DOKA 7ICSA 1KDHA 3MEDA 4ED3A 2IHNA 3VQ7A 4O5CA 4J9RA 3OS1A 4YNQA 5IIIA 3KK1A 4RQ3A 3UPQA 2BQ3A 1JXBA 4DU1A 4E3SA 4DSJA 2W9CA 4F5NA 3T5KA 5HROA 4JV1A 4J9LA 3ZDAA 4FK2A 1RTIA 4ECSA 3C2KA 2FLLA 4E89A 5KFNA 3GILA 3TAGA 1EP4A 5FRNA 2ASJA 4Y1CA 8ICVA 3NE6A 5KFGA 1ZQRA 3MEEA 5J0UA 2F8SA 2BGWA 2NRWA 3Q8RB 1Q8IA 1X9WA 2R8HA 3LZIA 5KG1A 3OS0A 4RT2A 2ZUBA 2KTQA 2V4RA 1J54A 1VSFA 2DFHA 4DOAA 4OLAA 1RBRA 1BPXA 4JS5A 4KHNA 5J2CA 4ECQA 1NK4A 2J6UA 3G6YA 2Y1JA 3QEBZ 2X6NA 3TWHA 1FXXA 2AGPA 2FBXA 4Z4FA 3AA5X 2UVRA 1TKZA 7ICNA 4KI6A 3RB0A 2P51A 4P4PA 5DG8A 3NGZA 4DF8A 2YV0X 3SI8A 4ZH4A 3CFOA 4BDZA 3PVXA 3QEAZ 1KVAA 3RBEA 3T3FA 4KLOA 4CJEA 3VQ5A 1IM4A 4QZAA 4JRPA 1UT8A 2OA8A 3ISBA 5J2NA 5D46A 4DFPA 4FS1A 4O3RA 3OGUA 1JMSA 2R8JA 3K2PA 1HYVA 1EX4A 5KFZA 4RNOA 4M9LA 1LWEA 4ECZA 5DQIA 1SZPA 3HPGA 2R8GA 2A1SA 4UQGA 4FBUA 3AVCA 1Z26A 3MECA 3QETA 4ECUA 3HP9A 4RW4A 5KFLA 3QIOA 5KT3A 1NJZA 4KREA 8ICBA 2FPLA 1W9HA 4OVLA 5L1IA 3SCXA 4E1MA 7ICTA 3WNHA 4L8RB 1HYZA 3KLIA 2BCUA 4CJ4A 1RXVA 4ZTJA 2VA3A 2RPIA 5C42A 4I2FA 2W9MA 3PUFA 4C8KA 3AA4A 4RQ4A 1NOZA 5KFAA 1IKVA 3LANA 4KLFA 5EU7A 3CM6A 1QQCA 5KFBA 4NLKA 1NJYA 5HRRA 1BVSA 1MSWD 1SL2A 1ZQGA 2FLPA 3MXJA 4N76A 4MFBA 1JLBA 4EYHB 4B3OA 1D9DA 3DM2A 3OJSA 3RH6A 1HJRA 2GV9A 2Z1HA 4TURA 3RJKA 7ICRA 4CFCA 3V9ZA 4DL4A 2ZUDA 4LZDA 5K14A 2ITGA 3RRHA 4ED7A 3V6DA 1DGSA 3LDSA 4ID1A 3GIMA 8ICMA 1A77A 4ECTA 5KFDA 3NCIA 2JEGA 1ZQQA 8ICSA 4UBBA 4FJXA 3AUOA 4X5VA 1S5JA 7ICOA 3NGDA 3V1QA 4K4IA 3T5LA 4QWAA 4CJTA 3TFSA 5L1JA 2KQ2A 3HL8A 5KFWA 8ICXA 4E0DA 1ZQSA 4O3NA 3I0RA 3NAEA 3TFRA 4LH5A 3NBPA 5L9XA 1JX4A 1K1QA 3QEVA 2IGIA 5FROA 2MUTB 4YR0A 1RTJA 3IS9A 4Z6FA 4GVMA 1YTUA 2HHSA 4IG0A 4I28A 3NGIA 4ELUA 1T3NA 3I8DA 5J0WA 5J2FA 2VG7A 3LAMA 2J6SA 5J2QA 1NK8A 3WNFA 3VQ9A 4M9JA 5KTQA 5KT2A 4CF8A 4Z4IA 1S9FA 2ZTEA 2A1JB 3MR6A 1HYSA 5KFHA 3OSNA 2JGUA 3AVHA 3U3YA 4QAGA 2B4JA 4NM2A 1Y88A 5DB8A 3PW7A 2HNDA 2YKNA 4J2AA 8ICAA 3FYHA 5KT7A 2PFQA 3U3GA 1B43A 2UVWA 2XGQA 4M3YA 4R8UA 2ZJ8A 4QZCA 3B6PA 3AVLA 1S6QA 1ZYQA 2R8KA 4IR9A 3QEIA 3DLRA 1Q9YA 2HNYA 3G10A 4CGIA 4FLYA 4KTWA 8ICYA 4R5PA 4F4ZA 1C7YA 1JLCA 4IQTA 5DGBA 5FDLA 3QE9Y 3G6VA 4DOBA 4XUSA 3V6JA 2AQ0A 3OYFA 3IAYA 4FBTA 2AQ4A 3AVJA 4NCBA 3OYAA 4R66A 1WLJA 4CJSA 2G8FA 1UA0A 1ZQUA 3RMAA 1WSGA 2F96A 2NRXA 4ECXA 1GOCA 3IG1A 2OPPA 3V6HA 1WSFA 1ZQWA 4MF2A 1S77D 3M8QA 3RH5A 2OPRA 4EZ9A 4BWMA 3OSPA 1PZNA 4E7HA 2DFEA 3DOLA 3VQAA 7ICGA 4DG1A 1TFRA 4CJWA 4F91B 1U48A 4BGDA 4HUFA 5CR0A 4EP5A 4YD2A 4FW1A 4W5QA 4CGGA 1Z3EB 3WNGA 3VQ6A 4RNNA 4CF0A 3GFKB 1QLNA 2QKKA 7ICJA 4ECYA 4Q5VA 4DLGA 1ZQKA 1VSJA 3LAKA 2F1JA 5J0YA 5KGWA 4OKKA 4CERA 1L3SA 4RW9A 5L1LA 4UB1A 2HB5A 3K75D 5EWGA 1RYRA 2ASDA 9ICAA 5IIJA 5BPCA 4FXDA 3HVTA 9ICMA 4FLZA 4ED6A 2NRTA 3ASMA 4OKJA 1IO2A 4F8RA 3JPTA 2BQUA 3RB4A 3D45A 2FBVA 4DQRA 2P5GA 2HHUA 5DLFA 1XO1A 4IDKA 2Q0ZX 4UB5A 4FZXC 4PHAA 8ICWA 3GV5B 3HP6A 4EBDA 5KG6A 2YNHA 4DOCA 4Z4CA 3KK2A 4B9LA 2JZBA 4BXOB 4DU3A 3KLGA 3RJHA 2B5JA 3SUQA 4M3XA 3Q8SB 4ED0A 4EBCA 3OYBA 1F21A 1YVUA 1TKDA 3H8WA 4RW8A 4Y1DA 4YVZA 2OPQA 4WE1A 1BL3A 1BQMA 1ZQXA 1C0UA 3CG7A 1ZQZA 1KSPA 4DS4A 3MR3A 4I29A 5KRSA 9ICBA 2HW3A 1BISA 4B9VA 1RDAA 3ZT0A 2UVUA 2YHBA 4M9GA 4XIUA 3L2WA 3VA3A 5J0PA 1ZQMA 4GXIA 5CB1A 2PFPA 1ASUA 2W9BB 5JS2A 9ICEA 4KB0A 5KFYA 9ICPA 4IFVA 1L5UA 7ICKA 1S0VA 1NKEA 2DPJA 4B9SA 1HQUA 3OVNA 4O0IA 4ED1A 1RT6A 3QNNA 2HHWA 5J2DA 1HJPA 4PHPA 3JPQA 4GXJA 5KFJA 1TV9A 5CHGA 1ASWA 4FJJA 4FLTA 2RKIA 3OS2A 3UQ2A 3RMDA 1RDCA 1ZQTA 4KPYA 4IKFA 5J0RA 4RQ6A 3TQ1A 5DDYA 3KTQA 5KI6A 1IG9A 4GMJB 3OYKA 5BOMA 4RQ1A 1WSEA 4CGDA 4KLHA 3AU2A 3JPOA 5IINA 4FJIA 3Q8QB 1N56A 3MBYA 3UIQA 2AGOA 4KRFA 4QWEA 1HNIA 1ZQEA 5J2IA 3V9UA 4CHYA 3K59A 3SZ2A 2R7YA 3S3NA 2V4QA 4F5QA 2PFOA 1TKTA 4I9LA 5KG7A 4CJLA 3LZJA 2BANA 2V9WA 3CFPA 3IRXA 4CJPA 3Q8PB 2A1RA 4W5RA 5J2EA 1JLFA 2G8VA 9ICFA 3ZSWA 1CZBA 1RCHA 2D0AA 4AHTA 1XHZA 1MC8A 3BDPA 5KFTA 1ZBIA 4MF8A 4FM1A 1CEZA 2HHXA 3MDCA 4O3PA 2Z1JA 3N97B 4J9MA 5J2PA 4QW8A 1WCNA 3UQ0A 4B8CA 4IR1A 2EHGA 5KFUA 1C1AA 2X6SA 3AV9A 3NF9A 8ICGA 4QZFA 3MGIA 5IIOA 4J9KA 4YXJA 4DL5A 4C8OA 5KT5A 3TARA 1TL3A 4DLEA 4RQ7A 5KG3A 4O9MA 4ELVA 3C23A 4I2JA 3ISCA 1UT5A 1TK0A 1RBUA 5DG7A 3CYMA 5KG5A 4UAYA 4DU4A 1SL1A 4FK0A 5KRTA 3FFIA 3ZCMA 3HPHA 2Q3SA 4C8LA 4ECRA 3NHGA 3NTUA 3ISNC 1SV5A 4C8NA 3G0ZA 9ICNA 1WSIA 5EOZA 4EYIB 2G8IA 4ECWA 1NK7A 1ASVA 2G8UA 1RNHA 3T1AA 4CK2A 1VSHA 1VSEA 1RBVA 4QZHA 4QZ9A 3VQ4A 3OYGA 4ID5A 2Z1IA 2KZ3A 4I2DA 2JEFA 4MFFA 5HMLA 4CHQA 1ZQIA 4TQRA 1C6VA 5KG4A 4HTUA 4DL7A 3CM5A 1S6PA 1BPZA 4CEDA 4M3ZA 2PZSA 4W5OA 3HVRA 4RW6A 4CGFA 4CK1A 2BR0A 5L1KA 1TAUA 1KEJA 5KFMA 1KTQA 4N41A 5J2BA 4OPKA 5HNKA 1NOMA 5DK5A 2HNZA 3P1GA 1B9FA 3K5OA 5J2GA 4FM2A 1ITGA 2XY5A 2W8LA 3ZT2A 4I2EA 3SQ1A 4KITB 4QWDA 3E01A 3SQ0A 3VQCA 1V9PA 4MQ3A 1N5YA 3L2VA 2OPSA 3H4BA 4Q8EA 1BI4B 3RAQA 4J9QA 2ATQA 3AVFA 4UB4A 3ZSYA 2KZMA 2I9GA 4P4OA 2VA2A 2J6TA 4O3QA 3HSTB 2BCRA 3LPTA 1J5OA 4RPZA 3NGYA 4DFJA 3UXNA 2C2EA 2BPFA 5DG9A 3C5GA 5KFIA 1LWCA 4JV0A 2F1HA 1HRHA 4M3TA 4CHNA 3H4DA 1S1UA 3MAQA 3OYJA 4JV2A 4XA5A 9ICIA
chains in the Genus database with same CATH superfamily
8ICEA 1W2BR 2DGVA 1FVQA 1R8AA 5EE1A 2R8IA 3M2VB 3W1YC 3PCOB 3AB2B 4NLXA 5KFOA 8ICTA 5ALPA 2NPIA 4LF7J 4QYRA 3ENHA 2OP5A 3SXLA 3CCSS 4P0QB 4RW8B 1TL1A 3CERA 3KKSA 3MMVA 3LVVA 4FS2A 3VF4A 3DI6A 4OYAA 3D2NA 5CZXA 4QZIA 3CB4A 5D4BA 1JB0C 3GE1A 3RUBL 1FX2A 3DOMA 2AEFA 2W7PA 3VVUA 2J0SD 3CJRA 3GU3A 2Y1IA 3J80U 4NO7A 3KOAA 4M0AA 4IOAL 2AX0A 2C1EB 1F5AA 1FE0A 4CJRA 1WSJA 1OY8A 2WVCA 2K4IA 3ETLA 3UDEA 2YVSA 2A2CA 2M4MA 5D6GA 4CW7B 4JI1J 3CPWR 1N5YB 3PYEA 2QB0B 5J2PB 1RT5B 1H7WA 1TV6A 1U2RA 1RHKB 2F8HA 2FYXA 1NB7A 3MR5A 2QT7A 4KN4A 2RDIA 3DXSX 1K6YA 2C2RA 4GNIA 5LXYA 3CD5A 4Y2KA 1VSLA 3EKSA 3BQ7A 3E0FA 3QFHA 4DSKA 4J9SA 4L3QA 2DNPA 3OHRA 3KG1A 3A8IA 1DTTA 1S99A 4JP8A 2AYEA 4FYDA 2R7XA 1PGZA 4MIWA 1WACA 2FJAB 4DV6K 2F5GA 3AFGA 4BG9A 1I94F 1PK3A 4QU7A 5GTHU 1JLBB 4UBCA 3OYMA 5AKXA 2SXLA 1H38A 5J0TA 4PG7A 4O4GB 2IM1A 4GC6A 5J2MA 3L3UA 4Y0WA 2NXEA 5E2QA 1YHQS 4ANCA 3AVAA 3ILLA 2HSZA 2E29A 2BZFA 3PR5B 4M2YA 1OUQA 5AQQA 1AROP 3DRYA 4IJAA 2XZDB 1JLEB 3ONQA 4YUDA 3MM8A 2XYHB 3W9HA 4JI3J 5LXRA 7ICFA 3QT5A 1SIJA 2OZSA 3SQGB 4Q0BA 3W3DA 3QPIA 3TPQA 4O23A 3TRGA 2O01C 4FZYA 1Q1KA 2P6RA 9ICQA 5F3ZA 1JJHA 4I7FA 2AJQA 5KFQA 2KU7A 4KRWA 4PG6A 4JRQA 1QS4A 1VJQA 3U7JA 4Y2YA 2KJWA 1NGEA 3BPDA 1FFWB 2G8WA 1MN9A 2ABYA 1NJWA 1BPBA 2RT3A 3DN9A 4ILRA 4CLWA 3CMEN 1FWLA 4E1NA 4ZVHA 1EX8A 3QERA 3BS7A 2ZXHA 2E2QA 4N56A 1NZAA 2YBVA 2V4JB 3W62A 4YD1A 5J0SA 3IWNC 3QUBA 2FVQA 2GX9A 3RF9A 3HPOA 4KHPK 2BUPA 3O9SA 1FO1A 4GC7A 1VI7A 1IKXB 4A8MP 2DHXA 4O3SA 2YH0A 2J8AA 4BGAA 2Z1GA 7ICIA 5F0XA 3JPPA 1MWZA 3KLHB 3CQXA 2CIMA 2V8HA 4RR5A 5AIBA 1ZQBA 2MU2A 5G4DA 2R7SA 5AQMA 3RB6A 2GH1A 1FNXH 1SKSA 4OI6A 4AXJA 1RT4B 4MK7A 2D9PA 4UB2A 5AQSA 3F9KA 2ADCA 4JUZA 3WC0A 4KH5A 1V9OA 1TUUA 4ZJQA 3IMXA 2P2CB 5IT9U 4K0KF 3GBTA 1ROFA 3OBYA 4H5RA 2XMMA 1RDRA 4UQTA 2KM8C 3A5NC 1V6HA 5JVGQ 4R79A 1UWAA 4FM0A 1F2HA 3O5BA 4YB6A 1IXKA 2BZ2A 4P2MA 1PIEA 3CJCA 2CQ2A 4MFCA 3UDLA 2B5JB 3KMQA 4NLTA 1Q9XA 1Z6RA 3KK1B 3OYIA 4PWDA 4TUSA 4AYBD 1QVFR 3M32B 1CRXA 2WOMB 3EICA 2AX1A 2H3IA 1RTZA 3W63A 3UN5A 2ASLA 5C24A 3LM9A 3V81A 1VRTB 4NYOA 4YR2A 2BE2A 4QIWF 4RJVA 5IQ6A 1COOA 3UM9A 3IR6B 2HCFA 2RN2A 3R97A 1ZQJA 4MFAA 1WNEA 4BRHA 9ICLA 1YJ9N 1XNQK 1HI1A 3DV9A 1U2CA 1P8GA 5D77A 1C0TB 3ICXA 3RMBA 2FLOA 4JKFA 2WF7A 3RW6A 3OHAA 1U7LA 1M5VC 2H4YB 2LEBA 4PQUA 1QQMA 1VSKA 3GG4A 4LSLA 5A0LA 5A2QY 1SC1B 4RQNA 4DMNA 2XI2A 3G8SA 3PACA 4QCLA 3AO4A 1JK9B 1PAUB 4JK1A 5KPZA 3MGHA 3T19A 3OL7A 4LFCJ 3H46O 2A5XA 1SJ4P 1CBKA 3VZHA 4UAZA 4OX7A 2M88A 9ICKA 4GKJK 4QJFB 3G6XA 1JXEA 2U1AA 2QE5A 2AP1A 2BKNA 1VRUB 2J9CA 5KFRA 2DH8A 2E8PA 3KLHA 1WN7A 4F4YA 3RTVA 1N48A 3EGNA 2IA6A 2VWBA 5EWEA 1UWBA 4CEAA 1JCGA 2FBTA 3H3OB 1X9SA 4ER8A 1J53A 2Q0RA 3MPWA 5F8NA 2UXBF 3U9ZA 3TJ8A 3BBCA 2OELA 1B22A 1Q46A 3FGVA 3ITHB 3OR2A 5CYMA 3NGKA 3OV7A 3TX8A 4KY3A 2CVEA 2HHHK 3DLHA 2EBEA 2JLEA 4CEBA 1B0TA 4MT1A 2H5IB 5KAFU 4EBEA 4IQVA 3RG6A 4GMKA 3EE3A 4JI7K 4K0KJ 1VGYA 3L7PA 4J90A 1FRMA 3I87A 5H9EJ 3KUEA 2RRAA 4B02A 4ZKAA 2PI5A 1NU0A 1T8EA 2D7SA 1D9AA 2O1PA 5FPNA 4X84A 1MN8A 4DWIA 3SCJE 2KD1A 4AUKA 4FJ7A 4C7ZA 2B8PA 2MQQA 1WC0A 2PY5A 3BEXA 3PV8A 2LYAA 3LTOA 3VC8A 4CFDA 1RPLA 3O9TA 1ZQPA 2DO0A 4K8ZA 1EWRA 1YIJS 3W66A 2P6TA 2CG8A 5E33A 2XWYA 2VJ5A 4C3LA 3BJYA 1HBOB 3CDEA 4JHDA 2YWKA 2BUNA 5GINA 4QZ8A 2HHVA 1D8LA 3C6UA 3QFWA 4LSNA 2NRZA 2JC1A 1RWOB 2W2NP 3A2FA 2E5GA 4NXNK 2IJFA 1QY7A 1RYUA 1RJJA 2ZJAA 3ZYYX 2WFBA 1OVYA 2WBMA 5HLFB 4JI3F 3AVGA 2E1YA 1BLUA 4IOXA 2P9PB 3OUYA 1PG5B 5GAHU 3NVVA 2CZ9A 3AJ1A 2NCKL 3MM7A 2ZOFA 4A8SA 3IUCA 3FAHA 2HZAA 2J9EA 4OJRA 4X4UA 2IC3A 4IG0B 4F0KA 4CECA 4LSLB 4J2EA 2QN6B 3M9NB 3BR9A 1QHAA 1W0HA 3D2FB 1SJ3P 4URGA 3J7AP 3M30A 1M90T 3K4GA 1RT3A 2ZQBA 3T7ZA 2FDNA 1SKRA 1VSDA 1QQOA 2NLXA 1C0TA 4AM7A 2K4PA 3LP2B 4CO4A 4CZEA 3B0YA 4FK4A 1KFDA 2YWWA 2PN6A 2CVIA 1JLGA 5HBMA 1KQSM 2RP5A 5ALMA 4DR6K 3IV6A 2D0PA 2D0CA 3W3SA 2CADA 3R2CJ 5IILA 2PEHA 1RABB 4GW6A 3JSMA 4ILGB 2FMQA 5KOXA 3TUZC 3UVJB 1WELA 1HWUA 3POTA 4OMFG 2BCSA 3JTNA 3MN6A 2W6KA 3HO1A 4F4WA 4LF9J 3E3XA 1LKYB 2RDJA 1QE1A 4ISFA 3D6MB 2UP1A 1N32F 2MAXA 1Z2LA 2UXDF 1N52B 4AHRA 3L2RA 2RUSA 8ICLA 1BQNA 3X3UA 2OFHX 1JNRB 4NLBA 2ZM6F 2W54A 3P3DA 4I1TA 4IL6U 4Y2PA 4J91A 1FKOA 4BR4A 1WKJA 5L39A 1ZQVA 1AQ6A 3CT9A 3HJFA 1JIHA 2HHTA 3ORYA 5DB6A 1T9TA 1XO0A 3UQSA 3NH2A 3E9LA 4RUBA 1UVIA 5GAEU 1FRKA 3N7PD 5A8KB 3IAS9 5E3RA 2I1QA 1K1SA 4I2BA 1HNVB 2ESEA 4OX6A 2BANB 1KRPA 3EXYA 3FJ2A 3JPNA 4C3KA 1EXNA 2RE1A 2YKMA 4DTNA 1RTDB 3RVCA 3RJGA 2OEHA 2EG2A 2JEJA 1PC4A 3P38A 2W9CB 1NO8A 5DETA 2DNHA 3D2EB 3QU2A 2D0BA 4DSEA 4AQYK 1IM6A 1SJ1A 1CJTA 1U4BA 3PRDA 1MA7A 2IRXA 3I56N 3QB0A 3F73A 2XG8A 4HR2A 2E1ZA 3ATUA 3IFEA 2DTJA 4KH6A 4G9ZA 3HM9A 2KLAA 4KO0A 4Z2XA 4DV0K 1J27A 1LW2A 2ZC3A 4B9UA 5KFEA 3BYRA 1UFLA 4AQYJ 3RAXA 4CDGA 1XWLA 2B0GA 3I5BA 3K58A 3B6BA 5LJWA 2QTDA 4DR4J 2ZH3A 1VDHA 3MF5A 3LGMA 5HAOA 1V97A 5GADI 1Q78A 1GEHA 3D2EA 3G86A 4JI1F 2KRBA 3SUPA 3Q7CA 1WF0A 3R8YA 5E3CA 4FOEA 5ALQA 4W5TA 3DYAA 2UVVA 2V7YA 2CQPA 1NGCA 1N60A 5AK6A 2M52A 2XM3A 2I8EA 4E19A 4G1PA 3HSGA 2VIHA 4LY7A 1HQ2A 4MO4A 2FSKA 1T4GA 2BHNA 5F9LA 2CNOB 4NYZA 4G3IA 2IAJA 4CM0A 4S0MA 2VFSA 3SQ2A 5AI6A 3Q23A 5KFKA 4IEEA 2B21A 3CO0P 2PE8A 5AXMA 3CC4S 3AXKA 3KYLA 3LDLA 3UN3A 3D0GE 1ZQCA 5KAIU 5AFUH 2FPMA 2FZCB 4ETXA 3UD3P 1R8CA 3JYTA 2C42A 2A2DA 4YB5A 1S4EA 1IUJA 3RBDA 1URRA 3UD4P 4MO5A 2VQFJ 3UDCA 1RBOB 2G1HA 1N33K 2CPZA 7AT1B 1UVJA 3G8TA 3GL1A 3DHXA 5T7BA 1G7CB 4CJFA 1P1TA 4CEEA 2JVOA 3TABA 1KVJA 5ETOA 2G2OA 4P10A 1LCUA 1LWEB 3DKDA 4LVSA 3JAMO 3EZOA 3K5LA 1NUEA 4K50A 2VBXA 4EZ6A 4FLUA 2XHWA 2ZTCA 1EKSA 2RIJA 1LOUA 3NFAA 3ZEUA 1LAWA 4L6V3 2KK0A 2D69A 1IH7A 2H5XA 1YJNN 2FY8A 2GIRA 4KHUA 2WHOA 3E66A 3IM9A 1U24A 3RB3A 3M6ZA 1SWWA 3UKUB 2A6MA 5SZTA 4O5KA 3M8SA 2VASA 3CJSA 3GR0A 4PAAA 3EXCX 5HN0A 5IT9Y 2CPHA 2KYXA 2QL5B 3O8WA 5AQLA 3NKYA 1KBRA 4KLIA 3CJ9A 1NPRA 2CJYB 1WWVA 1LNQA 3QQCD 1C1CA 2R2UA 1A76A 3C1YA 1Y64A 2BE2B 1MQ3A 3NVZA 1EXQA 2C3OA 1JXVA 2G8KA 4QPXA 1HBMA 5D8HB 1GQEA 3GONA 4DPWA 5ALVA 3UE2A 1K9MT 3RJFA 4EX6A 2IRUA 4FWKA 1N5VA 1N88A 2PSZA 1CJKB 2V0NA 1RXWA 1RTHA 2FJDB 4LSNB 1BCOA 3ZT3A 2ZM6K 2YY6A 5BPNA 5GMKa 3AVBA 3HFZB 4UASA 4WTOB 3PYDA 3IXQA 5DLGA 4JI0J 5GAGI 3SCKE 2W2MP 1TVAA 2CYYA 1ZBHA 1QHTA 1ESVA 2GUIA 3BZCA 3GV8B 4BREA 4P7TA 4O44B 2B43A 5HRSA 3W5YA 2E66A 3LP0A 4BQZA 1IBMK 3A0BU 1LWFB 2IDLA 4H0TB 2IOCA 4I2GA 3MM6A 2ZGZA 1QSLA 2KXHA 4CH0S 1TP7A 2FVSA 1RYSA 4EHTA 1PJ5A 3OFFA 5E5NA 4LQ9A 3WU2U 3H0PA 4E7KA 4LSZB 2XMTA 7ICEA 3J8AA 3CMAN 1IBLK 2X74A 5JMVA 1RK8A 2D6FC 5AKGA 4OIXA 5ALJA 3VQ8A 2QRRA 4IO1A 4RUAA 5HR7A 4OGEA 5M1FA 4JI5F 2RJZA 3NOGA 1L3UA 1HW8A 1REVB 2AJ0A 2QL7B 1TUYA 4MKAA 1UWBB 2GWSA 3NMAA 2C2DA 4NY8A 1W7WA 1XTZA 3PDNA 4JV5F 4AL5A 5ADXH 1KAXA 3C95A 2ITMA 1BUPA 4C8MA 2WFAA 2YX1A 3OYDA 5E7OB 3CQ8A 4EO8A 3SMZA 1S79A 2ZH9A 1XMQJ 4U6PA 4JKEA 4HL9A 1FERA 2VZ9A 1H2TZ 3PKYA 2DR9A 4E7JA 5IIMA 2F7VA 5DRKA 3FC4A 3MHYA 1Y4ZB 2HBLA 3QNOA 4ZTFA 3H2UB 3V6DB 2IDEA 3HCXA 4A8KA 4DG1B 4H4KA 1LWFA 3WX4A 5KQDA 5J2JA 3VQDA 3WNEA 2D8CA 3OFHA 5F8GA 3H0RB 3PW2A 4JI3K 1XI1A 3QIPA 1ZBLA 3AT1B 2KT5A 1HBNB 9ICXA 4NLVA 2E7VA 4WFXA 4HTLA 2JJ4D 1UZDA 4EHUA 4OLBA 2RLTA 4YXMA 2BXJA 4B9NA 4CVNE 2ES6A 5AE2A 4CJ5A 4K2JA 4M95A 5T7LB 3PXGa 5BPMA 3SAHA 4M04A 2QLTA 1CJKA 4H8KA 1WG4A 1S9GA 1RSCA 1WKKA 1NMDA 2OPRB 5KFPA 1RU2A 4DL3A 4A59A 1JL2A 5AQGA 1VQ7N 3I0SA 1S1WA 3AARA 2KXFA 1GO3F 4C8YA 5AT1B 5FPEA 2XSFA 3UCZP 1V38A 4EEYA 3MAHA 1V3RA 2W1BA 5B08A 4IO8A 4FLXA 2WBRA 3T9ZA 2RRDA 3R7NB 1S10A 3K1ZA 2AV5A 5DB7A 5AQYA 1F5CA 1JXLA 2ATLA 2XMWA 4KQZA 3U4LA 4M47A 2EG1A 2I5JA 1S6QB 2AYMA 4R8UB 1NGFA 2CWKA 4K7QA 2VBZA 1R43A 4Y2MA 4RWTA 1CG2A 1VS3A 4DZ6A 1RWMB 1NDCA 1M5OC 2LSNA 4DQSA 1CXQA 4QZEA 2K06A 2FY1A 4M5IA 5IV4A 4ES1A 2HOQA 2JSXA 4UF4A 5C15A 2B6AB 1KDHA 1WC4A 1Y3JA 4LFBJ 5M1QA 4HWIA 1VQLN 1N5SA 3WEEB 1MROB 2BW2A 4J9RA 3L95X 1YJWN 2RB7A 2FJVA 3KK1A 4RQ3A 4BC9A 2ZHOA 2BQ3A 5CQGA 4E3SA 4DSJA 2M70A 3D67A 3T5KA 2W7AA 1SV0C 1N34K 4OZ0A 4E89A 5B0CA 1RGVA 2XYPB 1EP4A 3H0LB 2ASJA 1J2MA 2DR6A 5J0UA 2XLKA 3IFRA 5A8KA 2MYFA 4P0PB 3IRWP 1X9WA 4X66K 2EFGA 2ZVIA 2AT1B 4FWRA 2ZUBA 2HBKA 3CNHA 2F9TA 4UW9A 3HRDD 2QKQA 1TUGB 2JLGA 3BO4A 3ILOA 3R1XA 4OLAA 2K7JA 3LDPA 2DL0A 2QMWA 3U26A 1OS5A 5HQMA 2L9NA 4NJ8A 1U6FA 2EAPA 1XC3A 3F5TA 4ECQA 1NK4A 2J6UA 3QEBZ 1J2VA 2AGPA 4X4PA 3M7DA 2FBXA 4Z4FA 1PO6A 1UVMA 4ZJOA 2Q4TA 3RB0A 2P9GA 5KL1B 1R89A 1RACB 3FMBA 4HACA 4QZVB 3QRPA 3TSPA 3PM9A 2Z2YB 1FEZA 1SIZA 3G25A 4DF8A 2YV0X 1XNRF 3CFOA 1UVKA 2H3EB 4M8LA 3UKUA 4BDZA 2Y1RI 4KLOA 4QZAA 1UT8A 1PILA 2W6LA 5A2QO 4OX9K 3H5XA 2N1RA 4JK8A 4WFAL 3AQEA 5D46A 4DFPA 4QR0A 1LK7A 2AHOB 4B3SJ 1AW0A 2V34A 1WUAA 4NA3A 2ZWOA 2O8DB 3JQJA 1UKUA 3LPYA 4JKHA 4ICAA 4NWIA 5IS2A 3QETA 1OYDA 5JJBA 3D0HE 2QA4G 1NJZA 3AD9C 1BY9A 4OVLA 1IBMJ 7ICTA 1UEVA 3KLIA 4ZTJA 1SZHA 2VA3A 2H48B 2KMDA 3J7YI 1X5TA 1A9NB 2FC8A 4I2FA 2E20A 1NNEA 1NOZA 2B4VA 5T7LA 1FD8A 2QLWA 3M6KA 4RU2A 2ASYA 3QJPA 3I55S 2EWSA 4NLKA 5LMUF 3CCWA 3QXGA 2RHSB 4C0BA 4RBVA 3P6YC 3MXJA 4N76A 4ILJA 4K43A 2H3ZA 2DNOA 1KQKA 1PBAA 4AFFA 3Q8YA 2MZRA 4UARA 3WK6A 1R27B 2DNZA 3O44A 3V9ZA 4DL4A 1OJ4A 5K14A 2ITGA 2MY7A 3RRHA 4ED7A 5AFUA 3GWCA 4J8FA 3UE5A 3TNVA 5BR8F 2HBMA 3NCIA 5ALXA 8ICSA 1TFYA 2G0JA 3ZZ0A 1QUPA 1O0PA 4K4IA 2ROGA 3VF2A 5G0RA 5BRDA 8ICXA 4P0PA 3TZZA 5IZHA 1H98A 1LW2B 1I94K 3TFRA 3IRXB 3CD6N 3CJ4A 1K1QA 3SLCA 1N61A 5FROA 2ZE2B 1RTJA 3IS9A 4Z6FA 1RTIB 1FJGJ 4FPBA 3ZI4A 5BREA 3HHLC 3I5CA 2HHSA 4V1Ak 3CSKA 4I28A 3NGIA 1EAYC 5AK3A 4ELUA 1XBWA 2OTLN 3KFUF 2E1EA 2KKZA 2DRAA 3VQ9A 4BR5A 4WFBL 4M9JA 3MMCB 4CF8A 2OM6A 3QUQA 2ZTEA 2Z2LA 3MR6A 3C19A 4OI0A 3AVHA 2B4JA 1FFUA 1Y88A 2YKNA 4J2AA 1ZTTA 1HPZB 1X0PA 3T1YK 1ATRA 2GVZB 4P0QA 4URQU 4R8UA 2ZJ8A 3QWPA 2VQFF 2L08A 4JI6F 3NNCA 1S6QA 4IR9A 2OKQA 2ZZTA 4AP9A 5GIOA 4CGIA 1WF2A 2G07A 3LP0B 4G65A 5GADU 2KKPA 3E9PA 2CXYA 4NZ0A 4F4ZA 4UW2A 3GCXP 2DO4A 4IQTA 2CQ3A 5DGBA 3S7RA 3VENA 3FFIB 2HG4A 3G6VA 4AT1B 3V6JA 3NNHA 1WHVA 4C4SA 1RQLA 2AQ4A 3AVJA 3PSFA 4U8YA 2I7PA 4R66A 1WLJA 4KGKA 1WSGA 3A8KA 2F96A 2NRXA 2HK2A 3IG1A 1T9VA 1B99A 1GOCA 1S7IA 2DUYA 5E79U 2V2KA 2NR0A 1VBYA 2P9IB 1ZQWA 2IVOA 2P9CA 4KE5A 3H25A 1GAOA 2OPRA 1OKJA 2BKOA 3J7Z5 1PZNA 2DFEA 4K5RA 3DOLA 3PYGA 5C7PA 3JSMB 2LDIA 4WYBA 4CO1A 4W5QA 1N5WA 2K1RA 1Z3EB 4CGGA 4C7YA 4ZLNA 3KK7A 3DGPB 5M2RA 1RA7A 7ICJA 4ECYA 3WZ0A 4Q5VA 3EKUA 1VSJA 5EE0A 5J0YA 3VCBA 4CERA 1L3SA 3EO3A 3JAMY 1H2VZ 4MYTA 4ZITA 1IIPA 2HGMA 1M5HA 2PMWA 2KSOB 2ZJPQ 3BGOP 5AK4A 1B0XA 4KH4A 3QBWA 4FXDA 2F9DA 3HVTA 9ICMA 4FLZA 2FUG9 1RZMA 1WOSA 4OKJA 2JNJA 5AQIA 3A1YG 2P9PA 4DR3J 1P7DA 5GAGU 2DGUA 4FWMA 2QL9B 4TY8B 1NG9A 2HMXA 3KD3A 2Q0ZX 1GNKA 3GV5B 3VESA 4JI5K 4BC4A 3W5ZA 4LF5J 3C6UB 3HP6A 1UAWA 4DV7K 2YNHA 3W8PA 4B9LA 2JZBA 4BXOB 3D6TB 4DU3A 3ZTOA 4M3XA 1UCVA 2HHHJ 1YK9A 4EBCA 3QIPB 2ZBIA 1JWWA 1F21A 3GLJA 4Y1DA 2ZEJA 1FFGB 1KTVA 4WE1A 1ZQXA 3QBCA 3J7AN 1VC6A 2FHKA 1KSPA 3MR3A 5E3QA 1YUWA 9ICBA 1FXLA 2HWIA 2UVUA 4PWDB 1X7VA 3L2WA 1WDDA 1DT9A 2F2AB 2R7RA 2Z8QA 3HD2A 1XN9A 4DPUA 4EU0A 5CB1A 2KV2A 2NXCA 3L6QA 1ASUA 2W9BB 2LU1A 1IKWB 2OPQB 3KLEB 4TLQA 7ICKA 4AYBF 1S0VA 4B9SA 1HQUA 3OVNA 4O0IA 1RT6A 3O5TB 1FRHA 2YHXA 3DRRB 4IFVB 5J2QB 3RU0A 1WHYA 3JPQA 3DDIA 4LBPA 2ZGYA 5C2CA 3HMJG 2B4PA 2RKIA 5HVFA 3HSJA 4ZPDA 1LKZA 3BZKA 3UQ2A 3RMDA 2LU2A 3RZAA 2HWHA 4XK8C 3VAGA 4I0WA 1N62A 1YDLA 2AJ4A 4PZNA 1D1UA 4IDKB 2I9SA 3HHKA 3J80Y 5DDYA 1IG9A 4Z7YA 3OYKA 4YEAA 1KS2A 4DX8H 2E3TA 1IWAA 4FDFA 3Q8QB 3MBYA 4F25A 4C4TA 1SH3A 2C3MA 4QWEA 1K8KB 2FF6A 4L73A 3KLGB 1U1KA 2GJFA 1KAZA 1YJVA 3K59A 1RTJB 3QLHB 2PFOA 1IV0A 4KGZB 4GV9A 3LZJA 2BANA 4WJ3B 1Y10A 3RJMB 3R1HA 2JFKA 3IRXA 4ID5B 3A8YA 1YZ6A 3QU7A 4GIBA 4WWSA 4C23A 4W5RA 1J2NA 2G8VA 4OZ1A 4AHTA 2B0CA 1EIYB 4CRXA 2QWQA 5KFTA 3N0VA 4Y6IA 1ZBIA 4IZ9A 4MF8A 1XR5A 4BVOA 1KC8T 2E1RA 4LRBA 5J2PA 1WCNA 3UQ0A 4B8CA 2EHGA 3W64A 2KKVA 4BG8A 5IV3A 3MGIA 4UOGA 2LCWA 2W03A 2NYVA 5K14B 4C8OA 5KG3A 5IWAJ 2CQGA 4ELVA 4OV6A 3WT0A 1N5XA 3ZZPA 2KHDA 1YBTA 2CQCA 1F3FA 3PHEA 4B3TK 2V8DA 3CGIA 2VC0A 3POTB 2L3MA 1SL1A 2YNHB 5KRTA 3ZCMA 2CA9A 3SBGA 3ISNC 2W4DA 3G0ZA 2NUHA 1WSIA 2G8IA 1VQNN 1NK7A 1HNWK 2G8UA 4ZCIA 5J2MB 1RNHA 4CK2A 3A5LC 2V2ZA 1VSEA 1RBVA 4QZ9A 1YJTA 3G4SS 3OYGA 4ID5A 1NDKA 3P5TL 5AKIA 4JI0K 5AKJA 5ADXA 1DK2A 1V4SA 2JEFA 1HKCA 3WXJA 4CE6A 2IVYA 3F0NA 3D2FA 4ALZA 1C6VA 2E44A 5KG4A 1K47A 2CQBA 4FL9A 5BRFA 3DCAA 4W5OA 3AQPA 3HVRA 2CDRB 2D3ZA 5L1KA 4R5PB 5KFMA 3ZNJ1 4CO5A 5EN1A 5FJ4A 3WEEA 1XR6A 1BO5O 3IC1A 3P8BB 3QJLA 4JD2A 1WC5A 2VBWA 3P1GA 1B9FA 3O1BA 3DGPA 3FBFA 4HI2A 3PRVA 4FM2A 4ILMA 3R5JB 5J1PA 3Q0AA 5KNIA 4RUHA 2XY5A 1VC0A 2VDIA 4RWXA 2UU9K 3OQ2A 3ZT2A 3SQ1A 4OZ5A 4KITB 5HL7Q 3FRYA 3VQCA 1N5YA 4MQ3A 2E9ZA 4Q8EA 2H54B 4J9QA 5D78A 1K0TA 3JS6A 2AJ2A 2BJ9A 2I9GA 5IWAK 4UOCA 5H9FK 3VAKA 4C6AA 4MAKA 4P4OA 1NAQA 3KJFB 4PWWA 2Q6CA 3MAAB 5F0WA 2BCRA 3LPTA 4RPZA 3H5SA 4MN4C 5DG9A 3OTDA 3FSIA 1O5JA 3H8MA 1LWCA 4DU7A 2F1HA 3C3LA 3H4DA 4PCQA 1SH0A 3EGZA 3PJWA 4XA5A 3CJKB 1GX5A 9ICIA 2Z2MA 3VWSA 3BEGB 2YWHA 2F1IA 4O5EA 1MWKA 3Q83A 2XO6A 1B64A 1XMBA 5HP1A 2VFUA 2KN4A 5ITHA 1HD0A 5GAHP 4DS5A 3D68A 3DDKA 4A4JA 4RQ2A 3O2IA 4M3WA 5J1EA 4HCBA 4DTPA 3NF6A 1N4LA 3OD2A 3MN5A 2Z56B 1OQ6A 2LYBA 4FJ8A 1VFJA 4PA1A 1IKYA 2AJ1A 2A1BA 3MCMA 7ICPA 1VSMA 4C9DA 1DLOA 3J7ZT 2N7CA 2B56A 3VGVA 3CDWA 5KGXA 3F2CA 4XPEA 5IWAF 3GFYA 4O4GA 3O8MA 3TSUA 2RU3A 4CK3A 3S3OA 3SQIA 2KL8A 2NPFA 4LBIA 4M5JA 3P4IA 1N6QB 2ODGA 4QYZJ 2QK9A 2GFFA 5AQJA 2IMOA 2DR7A 8ICFA 4N5SA 3ZZTA 1FJEB 3MCSA 2JGAA 2A3VA 4TY8A 1NLVA 5U47A 2W41A 1RTDA 2CUYA 5KT6A 3T69A 2MQLA 4QYZK 1GLFO 2P9KB 2J7KA 4DV1J 2Y8YA 2ETJA 3CFRA 1F0XA 2CN1A 3FK4A 4OYIA 1WEYA 3TU5A 2BV3A 5CWRA 1IJJA 1Q5YA 4LFCF 2AYBA 4DR4K 3HKZC 1RT7B 1RT5A 3BP8A 1BPYA 2FJXA 5ETKA 3ZT1A 4CJVA 1KQGB 5AQOA 1Q86T 2ZNZA 2KXNB 3QYYA 3P49B 1EB0A 1VQLS 4CZKA 1QZ6A 3M9MB 3VEXA 3S41A 2PAVA 1SVDA 4ZVFA 3I0SB 1HNXJ 4BRPA 3MXIA 1HFEL 2PA3A 4NLYA 1HBUA 3A4TA 2P1JA 1FKPA 3DLJA 4ICLA 5DM6L 3AH6A 4F3QA 4HUGA 2EFNA 4IS7A 1ZA2B 3EJMA 2QARA 3IWXA 3RW7A 4OI1A 3TAQA 2IY5B 2C2ZB 4NLGA 3ETOA 2G5IB 3Q8MA 2QV6A 2ADBA 5EVZA 1DBDA 4DV2J 3B6OA 2IAJB 1HBNA 4A8EA 3DDNA 2OH2A 2GHPA 3DRRA 2B4UA 5JUMA 4CIGA 1GOBA 2MLZA 3NG8A 4M94A 5M2PA 5KFVA 4Y3CA 2MJUA 3KLEA 3BGFA 2EFVA 1VQOS 3HJEA 1RCXB 4DCHA 4PG5A 1NI3A 4ED5A 3K89A 3OXFA 1Q0NA 3THWB 2AZ1A 2GO8A 4RWWA 4OI2A 4M7YA 1MROA 2VFRA 1T11A 3U27A 4F4XA 3M8WA 3TAEA 2KN7A 4C7QA 2ZKUA 2MB0B 1T44A 3SMSA 2CQ4A 5KFFA 2QTWA 4X62F 3FGUA 2DNNA 4H4MA 5GADP 4I9QA 2KHCA 2R18A 1ZC6A 2JV3A 5CABA 3EUB2 4BHQA 4UAVA 4B08A 8ICNA 2P8IA 1HBOA 3FKBA 3ZSVA 4ZPWR 3HZ6A 1TL4A 1CZ9A 4F93B 5CCMA 3IDHA 2VJVA 1HNWJ 3PY8A 5AJ3J 2EANA 5AI9A 3TADC 2ZBPA 4WYWA 2ZH8A 1WJ9A 3SK3A 2NUBA 3SIPB 2WAQF 4OJ5A 3NS5A 2IMWP 3DMJB 4X4NA 1QCKA 3CUNA 4CIEA 4GLXA 3AO3A 5JICA 2H5JB 1U2VA 3BYPA 1P1LA 2F76X 3M3ZA 5ALIA 2BEFA 2KH9A 3K5MA 3OTOF 2IVPA 5DMRA 3RSEB 1KFSA 1UZHA 2ZIUB 4IRCA 4BE0A 5AQZA 3CCVS 1C0GA 4NEYA 2ZBQA 1L3KA 2ZJQL 4MIAA 4F72A 1XNQF 4DHYA 1L7PA 4TKTA 2HQCA 2LMRA 5AZJA 2DH9A 3IBFB 1KD1T 1ZQHA 2QJ3A 3OL6A 3CCLN 4NL5A 2YX8A 3ULDA 3L3VA 2FBYA 5M1KA 4KHRA 4DTXA 5M1NA 1TELA 1BPEA 1ICEB 1X4EA 2UXDJ 4NLZA 5L8RC 3E58A 5B0FA 1LKYA 1QE1B 3CVKA 4AHSA 1VQ9N 4B1XB 1NNLA 3TKAA 2QARB 1NM1A 1Q86O 2O6KA 4N8OA 4B1YB 4LF5F 4RPYA 4TSXA 2UV8A 4P7VA 3BF3A 5HHHA 2OWOA 3W9IA 3G6ES 4LF4J 3HOTA 3SBMA 3GIKA 2ZIUA 2MSTA 1D8YA 5KFCA 1C1CB 3F9MA 3A3OB 3N9UC 3DLGB 2VJ4A 1LFWA 4Q43A 3HKZF 2JWKA 2VODA 3V7JA 4UAWA 3RJJA 4H4KC 3AVIA 2HZVA 4WCEL 4EI2A 1BNOA 2F3JA 2WB1C 2XIDA 3ED5A 1RT7A 4BQLA 1NRKA 4MKVA 3O3FA 1D9FA 1N36K 1LAVA 1HEKA 3QO9A 5J2NB 4BVPA 4PGXA 2F4FA 2FHMA 3UD5A 3DLGA 3D6HB 4B8AB 3QGGA 2JFDA 1IG6A 5DBCA 3Q8KA 1Z00A 4OJHA 2BCQA 3BM7A 4X64F 2HFUA 4DV6J 4E7LA 2P35A 3J7ZO 2XY6A 4IH7A 1YGYA 4JYAK 4ZVEA 3V9XA 3PEHA 4ZVTB 2WOMA 4Z6DA 1X4GA 1HI8A 1QSSA 1RAIB 2FGCA 4YB1P 2E7XA 3FR0A 4WIIA 1Z19A 4RPXA 1NDPA 9ICSA 2LI6A 4NA2A 1ZZFA 1KLMB 4L72B 1YTAA 4WPAA 1HUOA 5HJXA 4MEXA 1KKXA 1Q3VA 1ZD2P 2FI1A 2HFVA 1S1VA 2KFYA 1KQQA 2H1YA 2DR5A 2CQHA 2L48A 3JSBA 3NMRA 2DGQA 1AUSL 3BQTA 1HHTP 4B9MA 2G0CA 3MCPA 4CHPA 5I4MA 4OQJA 1IBCB 2F9JA 2CGJA 4KMUA 2N4DA 3ET6B 3WBZA 3NDKA 1Z4NA 5BOLA 4OKEA 2RD5C 1U2VB 4KGMA 1LVHA 4GFJA 4DUZF 3CJ2A 1RAJA 4A8QA 4FJKA 4FYYB 2ZH2A 8ICCA 3ZFVA 4ZLLA 5LSRA 4PHTX 3W65A 1ZQLA 1S57A 4B9TA 3GCWP 4RX6A 4X62K 2RF2A 2D0OA 3K2YA 2O8CA 2OSQA 2DWQA 3SSRA 2B3TB 1IKXA 3KDOA 1PK1A 3SMPA 1S0OA 3E51A 1BCMA 4AD6A 4ZPTR 2DNRA 4KLQA 4KBOA 2QWMA 4M7XA 4DQPA 2QFIA 3T1HK 3MABA 2CZ4A 5AZIB 2O5DA 1U6ZA 2QMXA 1TKXA 2IIHA 1HUZA 4CGZA 2I38A 2W4PA 3MGJA 4RQ8A 1RBLA 2WK4A 3VAJA 3OFGA 1VQPN 3AVKA 1NDLA 5D4PA 3WXMB 1ZA1B 3THWA 3BSNA 3VQSA 5HMWA 3Q7BA 3SDEB 2W01A 4YY3F 2VV5A 1O03A 4A5AA 2GQCA 5F1XA 1X3MA 2ISPA 3C2PA 4PL1A 3GG0A 4X66F 1L6NA 1TUWA 2PMZF 2ZZMA 4O44A 3EZ5A 5ALDA 4JMUA 3M05A 4QIWD 4QWCA 3RMCA 2KW4A 4WJBA 3OUYB 4FWNA 2M9NA 4I68A 4DFKA 4JBCA 2LLZA 2HQGA 3C2MA 5HHIA 2OEJA 1VBKA 3ENWA 3LWLA 5FP0A 4FE3A 5AKHA 2YWEA 1TKXB 5IXUA 2QB0A 1RM6C 4CT8A 4CZJA 1TR0A 4BBYA 3QFUA 1HBMB 4EAHD 3ELHA 2LXUA 4LF9F 3MK6A 3IM8A 3SCIE 1LW0A 4KLDA 4Y34A 5JXSA 4OFZA 1ZQYA 1X9MA 2LQ8A 2V50A 5KPRA 1KVCA 3CQYA 4B17A 4U9RA 2IM2A 2AYGA 2FC0A 2LMIA 5E26A 3N7SC 4BRFA 2UXBJ 2BGGA 5DDQC 1DQ8A 1DTTB 3CJ7A 2OEMA 1YWXA 2PT0A 4CJ7A 1N36F 1KL9A 4XQ8A 4CI6A 1S1XA 5EX5A 3MDAA 2WF8A 5ETSA 3MEGB 1T0TV 3OPKA 1DGKN 2G08A 1S9EB 2GO9A 1AA1B 4P4MA 1NK5A 2P9KA 5DO2A 4K25A 2PYJA 2MHEA 2CNNB 1TU0B 2E8AA 5GAHI 3CJ3A 1YIJN 1WDTA 1HYSB 5DM7L 4TLRA 2W8KA 2ASPA 2OYQA 5T14A 2WF6A 4IJNA 2XGPA 4K4HA 3WDOA 3D2QA 3RJEA 4YDDB 3GQCA 5AQXA 2PI4A 2VBYA 2ZE2A 4DCCA 3LGHA 1S6OA 1MLAA 3CCEN 2P6SA 7ICQA 4YMMA 3CDBA 4P2XA 2YHYA 1NLKL 3OPXA 3SV3A 5J1EB 2KHVA 2YKAA 1RDUA 4DV2K 3D2SA 2WW4A 3P96A 3SI6A 2W3SA 5J2HA 2HSEB 3LGNA 2EC0A 1FRXA 1JN3A 4WFBQ 3MEGA 2P5OA 3CMES 2HVHA 4X66J 1YRXA 1S1UB 2WVFA 2XRIA 4CESA 2XULA 4BRCA 4BROA 1SXDA 3L2UA 3ZSQA 2HQDA 3HK2A 4DFMA 4CF2A 1BD6A 2NS1B 3AOCA 4PRFA 2VANA 4UOFA 3QU4A 4X64J 2GQ2A 4KFBB 5KAKA 3IM1A 3KHGA 2DIVA 1RKIA 8ICHA 4ED2A 3DLLL 3S01A 4AHUA 3OYHA 4PXBA 3G2XA 2HFOA 3H5YA 5ETPA 4H4OA 4LT6A 4NL9A 1FVSA 1MMLA 4H0YB 3IP0A 4RU9A 5M1OA 4O55A 2K3KA 1NK6A 2ISOA 4NASA 4Z4EA 5ALWA 7ICVA 2BPGA 1CQMA 3L7UA 2WAQC 2QB1A 4NLPA 3PFOA 7FD1A 1B4SA 4DU8A 4ZHRA 1WUDA 5AXKA 4JS4A 1YF5L 3V6KA 3LDNA 3BH7B 1CULA 2VGMA 2XO7A 1Q95G 3J81O 3V7LA 4LZGA 2DCLA 4RNHA 1NK9A 3BS5B 2GIQA 4GVEA 3PW5A 4F50A 4PQAA 1R31A 2VICA 4HAIA 2O4IA 3KG0A 4USTA 3VGLA 3E8OA 4A8OA 3VEZA 1SQKA 1IR0A 2DITA 1JUDA 3R7SB 4PABA 1OWXA 1VK8A 5CYQA 2H3GX 4NMXA 2ZZNA 1WAFA 2J76E 2WSCC 3LM2A 2QLXA 4DUYK 1Q82O 3R5CA 4EUVA 3ZDDA 1VQON 5LY3A 2YNFB 2BKEA 3C94A 4KLSA 5CZ2A 3JYTB 2C3PA 1X4FA 4ZDNA 3OYCA 4OJPA 4BJQA 4AL7A 1HA1A 4DZDA 3RBZA 3UNGC 3WKCA 4K41A 2AD9A 2KJVA 3CCMS 1L8OA 2HS3A 1TAQA 3EVMA 4CF1A 1GT8A 2LPEA 2OEKA 3D0PA 4U8VA 3VR1A 3CRXA 8ICKA 4LJMA 4CT9A 1V3SA 3UXOA 5I3QA 1T03A 5IM0B 9ICOA 2BABA 4Q2LA 2POKA 2GELA 1SC3B 2DEIA 4C1NK 4ANEA 5DQGA 2FHJA 2Q97A 3CC7N 3VMFB 2PC6A 2XBPA 4YFUA 2G13A 5TZVA 1KCFA 1DOQA 4K4XA 3T5HA 2F8KA 3FEZA 2HWTA 1R6VA 2XC9A 1LB2B 1K8KA 3BGUA 2GV1A 4IBNA 3PO4A 9ICCA 4I6MB 5AI4A 4Q44A 2O3DA 5EWFA 2CQDA 4XEIA 3R27A 4CBWA 3QGHA 2CGKA 4OYMA 4WU2A 1RDDA 4JYAJ 5C10A 1H72C 1MWMA 2HGNA 8ICJA 2R42A 3NGTA 1G2EA 1EZZB 1Z00B 3THVA 4PXCA 6FD1A 3PEJA 1NMEB 3JSYA 1SQFA 2RKIB 4LBHA 4MKBA 4A8XA 3VEOA 5CA5A 3TADA 4G1QB 4FCYA 2COLA 1ZD5A 1CJUA 1Y00A 3QGPA 1GLJO 5J2AA 4HHJA 3RR7A 3QEWA 1ZETA 3EPIA 8ICUA 4ERDA 4PHDA 3C5FA 2DXFA 2UUWA 2DPNA 2J9DA 1EETA 5D0EA 2DJWA 4BC7A 2WSEC 4LR8A 1WTBA 3DLBA 3B0XA 1N33F 3MM9A 5JVHQ 3GB0A 2L41A 4US9A 1SV0A 1HQEA 2DY4A 2BPCA 2HS0A 3Q2SC 5ETLA 2FMSA 1A6LA 1M1KT 1WOQA 2HDOA 3C14B 4NE9C 3FEXB 3NCRA 3O6QA 1T3VA 1OY6A 1X5PA 2IFXA 3T41A 3KNGA 3UW1A 1LW0B 8ICZA 1Y97A 3SJJA 5CE3A 2A41A 1I3OB 2CJQA 4DR2J 5GAGP 3OY9A 2A18A 2KB2A 4JB8B 5JLFA 1D5AA 4BDYA 3UVJA 1QQ6A 4FJMA 4FJ5A 4O8KA 5HANA 2XMKA 2F4VJ 3MM5A 3FM9A 3B78A 3ZETA 3EY1A 1B7FA 4F9OA 1TMJA 3QRRA 4FF2A 3AJDA 1DHMA 4OYBA 1X4AA 4JWNA 1RAAB 2MQPA 4Z4GA 1NEEA 1YQHA 1DZ5A 1EQYA 7FDRA 3TTCA 1SXEA 4PPXA 1T3OA 1YXQA 4DR5K 1HPZA 2GS8A 3ZD8A 3CCUS 3DFEA 1ZM2A 3KMSA 1NOYA 4BDPA 1JJ4A 5H9EK 2MKJA 5I3UA 3VEYA 2VG7B 4Y2JA 4IKAA 4Y28C 1WSHA 3HHEA 7ICMA 1U45A 3M6VA 4KLEA 2ZITA 4IOAQ 4TUPA 2CPXA 3CNQP 3O3GA 1DQ9A 2V7ZA 3H40A 5I42A 3F41A 1B0PA 4EK2A 3KWMA 5IT0A 3WQTA 3OTQA 1ZS6A 3DOLB 3D28A 1RZTA 2FDRA 3DOKA 1N0VC 2Z58B 2O8CB 1L7MA 7ICSA 2HYIB 3WK9A 4YNQA 1DFDA 1OSDA 3CF5Q 3EE8A 2DGZA 4DU1A 3KG4A 2W9CA 4F5NA 4DR2F 2XMVA 3JQMA 4JV1A 4I7FB 4ECSA 2YKOA 3MN7A 2FLLA 2PEBA 3CI5A 5LT5A 3AL0B 2FJEB 3EEQA 3DI6B 5FRNA 4PYDA 1ZQRA 3DM2B 4HEA9 4ES2A 2HOIA 4Z94A 4DPYA 2VONA 3NS7B 3US5A 2R8HA 3W2WB 2NZCA 1AB8A 1ZM3A 3OS0A 4J9UE 2EAOA 4HKQA 5BYRA 2P9EA 3TUJC 3D66A 3LW5C 1PSDA 1VSFA 2DFHA 4DOAA 5AJ3K 4YDUC 3J81j 2LM1A 4A8FA 2KHQA 3H1QA 4JS5A 1RWPB 4O3MA 5AQHA 1NGGA 5J2CA 2BTFA 5EGYA 2VKZG 5K9FA 3H3NO 1VLOA 5BR9A 2X6NA 1FTRA 1FXXA 1QM9A 3B4MA 4WK3A 2UVRA 3Q86A 1HNXK 4KI6A 4FWOA 2Q79A 1YLXA 4P4PA 3TA1A 4JK7A 1W7AA 3NGZA 3ZTSA 3KKAA 4L76A 3FZHA 3V2UC 3SI8A 3U8XA 5AKLA 1WTFA 1QDUB 1IM4A 2UUAJ 3MDFA 4CNZA 4JK9A 3R1LA 5G0RB 3MPYA 2GHWA 1MMDA 1HR0J 1CLFA 3QO9B 5J2NA 1ZH5A 1JNZB 4Y2VA 2XTJP 3EDQB 2R8JA 2L9DA 3K2PA 1GK8A 1SV5B 2EWHA 1ZPWX 3O3LA 2Q2RA 4WK1A 1KXPA 4MYUA 1LWEA 4U95A 1RA6A 2GO7A 5DJBA 1MWYA 4IO9Q 3HPGA 2R8GA 2A1SA 4FBUA 3AVCA 3U1LA 3FCHA 3MECA 2EK6A 3HP9A 5KFLA 1KNZA 1Y3KA 4FO0A 1IBKF 2YPZA 3WX8A 1MMNA 4KREA 3F5EA 4UOHA 3OL8A 3SCXA 4LVNP 3WNHA 2AJFE 4L8RB 2UXBK 2BCUA 4CJ4A 4ZN1A 4WZQA 5C24B 4XPCA 3E9OA 1YITN 5ALGA 5B5EU 2VU5A 4ZK7M 2E5SA 3AA4A 1DLOB 2HS4A 2XZTB 3EGWB 5KFAA 3M8YA 3NL0A 1TL1B 3ID6A 3CM6A 1QQCA 1NJYA 1Q3UA 2HBYB 1K73O 4B3TF 3I9V9 4H0XB 2OYYA 3DLLQ 2JXJA 3C65A 4QS9A 3KLIB 1ZQGA 2FLPA 4MFBA 5C2DA 1JLBA 2G0IA 3C16B 1D9DA 3DM2A 4KPCA 2Z1HA 4TURA 3RJKA 7ICRA 3NWRA 4OHZA 3SBTA 2K8BB 2Q36A 3ZZUA 3QAEA 2PKEA 1S4FA 3FCWA 5BYQA 5A2QU 3V6DA 4X4RA 3LDSA 8ICMA 4DUYF 1A77A 4Y2AA 1N8RO 1ZQQA 2J9DE 1R3NA 2NSBA 4DV7F 4FJXA 4DR1F 1OH8A 1EWQA 4KR0B 2IYGA 1JKHB 1S5JA 4P73A 3V4IB 1NGHA 5ETMA 7ICOA 3V1QA 4DX6A 1PAEX 1J5EK 4JKAA 4CJTA 1EO1A 3TFSA 1JLFB 3HL8A 2MKCA 2MY8A 3NAEA 1BA1A 4LH5A 3UR3C 2ZJQQ 9ATCB 2MXYA 2GHVC 2HLUA 1WC1A 1BOTO 3FZFA 3I55N 4C98A 5BPLA 2Q31A 3MUTP 3OBIA 1YI2S 4JI7F 2DXEA 2JZ5A 4RBTA 1YTUA 4ZLPA 2KO1A 1ZOLA 1HNIB 1T3NA 5J2FA 4NYPA 2H65B 2VG7A 2M9KA 1U2FA 2HBRB 2M7SA 2F7TA 4RW6B 2OTJS 3MEDB 1YVNA 1NK8A 4LF8F 2ROEA 5KTQA 5KT2A 2HLTA 2QZ8A 2RRNA 3FZ2A 2YH1A 3OSNA 2JGUA 4QAGA 5DB8A 1Y0HA 1WC6A 8ICAA 3FYHA 1AFJA 1B43A 3E1YA 2XGQA 3WXLA 2NXUA 2HURA 4Y65A 4QZCA 3CJ8A 4NPOA 1IR2A 2R7WA 2Q1LA 1ZYQA 1FESA 5HQLA 5L46A 1Q9YA 1NSQA 1R0CB 4FLYA 2KSOA 1S9GB 3H6EA 4WE1B 8ICYA 4K0KK 1FT8A 3TUPA 2JOQA 1C7YA 2GMLA 2RQ4A 3NCQA 2RVJA 3M6GA 1X5SA 4DOBA 1I6JA 2AQ0A 3IAYA 4FBTA 1IBKJ 1TQLA 4CH7A 1U25A 3MMBB 3S8SA 3RMAA 2HHHF 2K1RB 2OPPA 2A6AA 2OHDA 1P9YA 3L5KA 2GNKA 4OI4A 1RADB 4DR1J 5DDOC 5F8LA 4EZ9A 3VQAA 2KRRA 1TFRA 3NAIA 1U02A 4YD2A 2CH5A 3MMJA 4AL6A 4F71A 3VQ6A 3R6LB 1N5QA 4R0EA 1E3MA 2W2PP 4BRIA 4CF0A 3GFKB 1RHJB 3VGKA 5K4LA 3WXIA 3I32A 5ALYA 1RT3B 2OMOA 5AHXA 4OKKA 3SR6A 1VLYA 3TWZA 3MZIA 1W97L 1HIYA 2HNYB 5FIIA 2ASDA 9ICAA 1RKJA 5IIJA 1QQNA 4CZMA 4KX3A 3F2DA 2UU9J 4ED6A 5L38A 3BF1A 5MAOA 1IO2A 2BQUA 5LSLA 3RB4A 3RYLA 3D45A 1SAZA 2QI2A 2P5GA 2E5IA 1DEJA 1XO1A 4IDKA 4PWUA 1PBUA 4V19X 4FZXC 4LRFA 4PHAA 2HBQB 3UCUP 2AP6A 3FFKB 1J5EJ 1FJGF 1SI9A 1VOMA 5AI5A 4EBDA 1JMTA 1WG1A 1VC5A 3G6EN 2LXFA 1SC6A 4USMA 3DRPB 1S72N 2ZNYA 4ED0A 3FVYA 1S12A 2JR5A 2OAUA 1YJRA 3CCVN 2CNLB 1YVUA 1F3VA 4NXMJ 3H8WA 4RW8A 5HMZA 2OPQA 3O1WA 4UUWA 1BL3A 3L4QA 4EENA 1ZQZA 4DS4A 5KRSA 2YB4A 1HPMA 4CDIA 1BISA 4LFBF 2KYZA 3KWGA 4JV5K 4USWA 3ZT0A 4M9GA 4XIUA 5J0PA 2VJUA 3D3CJ 1ZQMA 3H5UA 2PFPA 2KJ9A 2XSJA 2FGOA 3U1MA 5GAEI 3S1TA 3D6RA 2HMPA 1BQMB 3HJVA 3IMQJ 5KFYA 9ICPA 1NKEA 1UPPA 3OR2B 1BQXA 2E5LF 3B9JA 1FJ7A 4Q0BB 5J2DA 5EUHA 3M2UB 2QM1A 1VK3A 2RMLA 4GXJA 3MM8B 1T02A 1VQNS 2CJKA 1H1VA 4FJJA 2VPZB 5IOLA 3CHWA 2YMMA 3KZBA 1ZQTA 3MOZA 3G4SN 1SGGA 3QT8A 2R7OA 1NJIT 1EQ0A 5J0RA 3H98A 3QMQA 3TQ1A 2MQMA 1KD1O 4RQ1A 1WSEA 3FE1A 3ETRA 1ECWA 2XMAA 4CGDA 2BJEA 3AU2A 5EY4A 1HR0K 4LFCK 2O8FB 2K3IA 2KOBA 4LF9K 2YQ0A 3N01A 4OJOA 1ED1A 3EX7B 5J2IA 4CHYA 4OJLA 3T6JA 3S3NA 2H3FA 2AEMA 3TTFA 1PVRA 1TKTA 4I9LA 2LEAA 3GFZA 2V9WA 4KBIA 2R3VA 2Z4PA 2QX0A 4NXMF 4KHMA 1YJWS 1YKWA 3NCPA 1K5OA 1RCHA 1HLUA 2G06A 1HNXF 2VOOA 5J1NA 1AZSA 3EGVA 2XEXA 2HHXA 2Z30B 5AI8A 2E1MC 3N6MA 2LA4A 1RTHB 2XI9A 4KHPJ 8ICGA 3RGIA 3V81B 1B0VA 3ZTQA 4QZFA 1RQNA 1XR7A 5LMNJ 2RDDA 3TARA 1TL3A 1WUUA 2CPYA 4DLEA 3EMTA 1UP1A 1NXIA 3W2VA 4C11B 5B8HA 3VF6A 4PG8A 2DISA 1UT5A 1TK0A 1RBUA 5DG7A 3CYMA 5KG5A 2EEYA 3SENA 2FXUA 4FZVA 1GMUA 3CC2N 4UAYA 4OV1A 1NB2A 3FFIA 4V19J 4C8LA 4K4SA 2O8DA 4ECRA 1OIAA 3NTUA 2E9RX 3QJJA 1SV5A 1Z1BA 4KJIA 9ICNA 2YKQA 1VQKS 4UB8U 3UFCX 3B8AX 3ZX3A 3JAMU 2VQEJ 1VSHA 2MEWA 4QZHA 4KIAA 4USAA 2DRBA 2DK2A 3BN7A 4CF5A 1S59A 3Q89A 2E5LK 5GMEA 4U67L 3FZLA 4KO0B 4CHQA 1ZQIA 1RWKB 3HI0A 1T6CA 4XH1A 4HTUA 3ULHA 3CM5A 4FOIA 2C3UA 2PZSA 4CK1A 5CH7B 5B09A 5F3XB 1GLAG 4B1VA 1KTQA 3WHIA 1KVKA 4N41A 2RQ5A 5HNKA 5KPTA 1NOMA 5ALOA 5DK5A 3DXKB 2BRKA 5J2GA 1SJRA 2NQPA 4I2EA 1K0VA 2C2OB 2DRDA 2I1RA 4ANDA 2OCEA 3SQ0A 4MKYA 3I0RB 3L2VA 1URJA 3AVFA 3I4HX 4UB4A 2Y3YA 1X0FA 2VA2A 3F53A 3FEYB 1RXOB 3W61A 3NVKA 3WIUA 4IXCA 1U1MA 3UXNA 2C2EA 1T3QA 3QT7A 2JHDA 1HRHA 3LO3A 4M3TA 1WEZA 4JV2A 3CETA 4NXNJ 2MQOA 1MWQA 3OR1A 3FSXA 1S1WB 4IQWA 4JI6J 1FHTA 1FDBA 4JLHA 3V9SA 2F44A 3AAQA 1BPDA 2XY7A 3OVBA 4BRDA 4F2RA 5FD1A 1WEXA 3D6FB 3KD5E 4U67Q 3HSCA 3DLKA 4KH1B 9ICTA 3K7RA 4CIFA 1YZ7A 3D1HA 4UUXA 5I42B 3OR1B 3AVNA 4DJBA 3TANA 4F5RA 1Q53A 2DYAA 1CZAN 4E8UA 4AHCA 4IQUA 3M1FA 4OI3A 3OTOK 4LR7A 4X4OA 3AVMA 4I2HA 1JLGB 5HBMB 3EZWA 1S8OA 2VQEK 4A62A 2JZBB 4BXOA 4WP9A 1KR4A 1SPBP 2QEXS 4LF7K 4ZPBA 4ID8A 2CJ9A 2MDAA 4DTSA 1QSYA 4TY9A 4EWTA 5FPDA 4YMOA 4JB3A 4HHHA 4M6WB 1CPZA 1HMVB 1VDVA 3N79A 3VHQA 2MGZA 3NEKA 5AQWA 1R7IA 2W42A 2YB1A 3ZZOA 4LFAK 4ZJLA 4DR5J 4PEOA 3HBTA 3EDRB 3I9ZA 5HRNA 4F2SA 2QIFA 1TV6B 3DC2A 5FLXY 4YOUA 2CWXA 3R3TA 1Y5IB 2VD3A 3IDWA 1S6UA 4ZVSB 1FA0A 4FJGA 2LYVA 1FO4A 3I96A 4RKUC 1KEKA 2R7VA 1RDWX 2ACYA 4O0NA 2KJ5A 4LMZA 2H51B 1I94J 2J7UA 3FDSA 4YN4A 1V5VA 3PLAA 2VL1A 4FSVA 1SQGA 1VQ5S 1S76D 4W4MA 5TKYA 1RAFB 3V1OA 4ES3A 1RHUB 3SV4A 4J9PA 3AD8C 3LDQA 1RAHB 2E8NA 2HPUA 4BR7A 3G87A 1U1OA 1R59O 4IG3B 5ALEA 5C5JA 1MU2A 4OJ3A 1B70B 3NMUA 4BR2A 1A0PA 3R9KA 4JEPA 3AO2A 3H0MB 2FHOB 5IQQA 2QMUB 4GY2B 2ZG6A 2YNIB 4JWMA 2O8BA 4R64A 2DGOA 3P45B 4AXIA 1ZM9A 1CC7A 3KUGA 3ISZA 4NLOA 1S97A 2DGSA 3G71N 4PPDA 1XMOF 2J0QD 4FVMA 4PG4A 2HBZB 2KVQE 4CLLA 4NXNF 3WQUA 4QZBA 3GV7B 4C0ZA 4TU7A 3TVYA 4FFDA 3ZSRA 2NO5A 3A5MC 1DAXA 1NWKA 4CEQA 3R5BA 3MM7B 4WQ5C 1VRUA 4K8RA 5DB9A 3ZX2A 2XY8A 3H08A 2XVTA 3C46A 2UUBK 4I2AA 1VQ8S 2FMPA 2YNGA 2A1JA 4QIGA 3M8ZA 3DRSA 4ED4A 1KVIA 1IQTA 4K4ZA 4QR1A 1LEOA 1U0HA 2LVWA 4F4AA 1GXTA 3CCMN 2WUSA 2I5JB 4USUA 2NRRA 2G8HA 3MM6B 4DUTA 5E84A 3L2QA 4DB3A 1TKZB 3IS9B 2UXCK 2RE2A 3N5FA 3H20A 3I1YA 4LFAF 3QINA 3JXUA 2NXNA 3CWJA 2V4JA 1VQ9S 2Q66A 1S6PB 4P9SA 4V19S 1IKWA 1SJFA 4OZJA 4F3OA 4LD0A 2OLWA 4WIQA 4UY8O 4FKYA 4JI4F 3QESA 2YPYA 3CC7S 3HSDA 4FO6A 1XNSA 4FF4A 4NYFA 4XH4A 1U8WA 4ZCMA 6AT1B 4I2CA 1VRTA 3WKBA 3GIJA 2E8MA 3ENVA 3M2UA 4QNLA 3V72A 2AIRB 3ZO7A 4CLSA 4O5BA 2PFNA 1FXDA 2QKBA 3ITHA 3HHDA 3QDKA 1BA0A 3OHBA 4YHHF 2XSJB 1JLEA 5CHCB 4YORA 1C1BA 1OH6A 4FPRA 2BE7D 3Q8LA 2R7QA 2G1DA 3SSSA 2K2PA 3ZDBA 3KKRA 2VKRA 5EX3A 2FQQB 4Z6CA 2XZWA 2UZAA 3BREA 3M7VA 1M5SA 1N36J 4EFHA 2Y0SD 1VQMN 4IRKA