2KK0A

Solution structure of dead ringer-like protein 1 (at-rich interactive domain-containing protein 3a) from homo sapiens, northeast structural genomics consortium (nesg) target hr4394c
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
145
structure length
145
Chain Sequence
b'MGHHHHHHSHMPDHGDWTYEEQFKQLYELDGDPKRKEFLDDLFSFMQKRGTPVNRIPIMAKQVLDLFMLYVLVTEKGGLVEVINKKLWREITKGLNLPTSITSAAFTLRTQYMKYLYPYECEKRGLSNPNELQAAIDSNRREGRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AT-rich interactive domain-containing protein 3A
molecule tags Transcription regulator
source organism Homo sapiens
publication title Solution NMR structure of the ARID domain of human AT-rich interactive domain-containing protein 3A: a human cancer protein interaction network target.
pubmed doi rcsb
total genus 35
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 2009-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01388 ARID ARID/BRIGHT DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.60 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 ARID DNA-binding domain 2kk0A01
2EQYA 1RYUA 2JXJA 2JRZA 2CXYA 2KK0A 2LI6A 5K4LA 5CEHA 2OEHA 2RQ5A 1KKXA 1IG6A 1KN5A 4LJXA 1C20A 1KQQA 2LM1A 2EH9A 2YQEA
chains in the Genus database with same CATH superfamily
4KLDA 4KLFA 4PJ0U 5KFTA 4XA5A 4NLCA 2PMZF 3ETRA 2ZTEA 5AKJA 1RG6A 5KG4A 3NVVA 1ZQPA 1QQ7A 7ICMA 2LHTA 2P66A 3OHAA 4KLIA 3SQIA 4Y2VA 2R8KA 8ICKA 2CXYA 3VCBA 1WCNA 4MEXA 4KX5A 4Y2SA 4MFCA 2Q0ZX 5J2IA 4DL5A 5AKZA 1TV9A 1RXWA 4I2JA 4US8A 3RH4A 5AHXA 9ICRA 4DQIA 2JZBB 4MF2A 2DPJA 2C2EA 4J9RA 3AU2A 3T5LA 4F71A 1OXJA 1TFRA 3BS7A 5DB7A 2XICA 4B9TA 1F0MA 1HJPA 2RLTA 4C4RA 4C4TA 2WB1C 1QQ6A 5DBBA 4QZ9A 3WU2U 1ZQAA 1B22A 3F2DA 4J9MA 4O3SA 4QZHA 3KFUF 4KN4A 3PW2A 4IRKA 4NM2A 2GWSA 4PGXA 4O5KA 1XNSA 3PV8A 4MFAA 3MR3A 3KTQA 3K4GA 3LWMA 1RYSA 1X9WA 5DQHA 4JK1A 5AK4A 4J03A 4LZGA 4ED1A 4XQ8A 1OUQA 2K4HA 3PVXA 2YMQA 5ALOA 5AI9A 2KIVA 1KN5A 2W3RA 5EE9A 9ICOA 5J2HA 1AROP 2BKEA 1L3TA 3KOOA 2C2DA 5KT7A 1BNPA 2OH2A 5K4LA 1JX4A 2AQ4A 2W3SA 4AP9A 2YX8A 5GTHU 3H40A 4Q43A 1LB2B 1S8OA 1XC9A 4EX6A 4TUQA 1ZD4A 8ICCA 3L5KA 1ZOLA 2QARA 4I2IA 1TAQA 4Y2PA 3N28A 3Q8KA 5J2BA 4I2EA 5J0PA 4Z6DA 5IIMA 2AH5A 5ALIA 5CP2A 5J2GA 3AL0B 9ICAA 1MC8A 1Z3EB 4F5RA 3SD7A 8ICEA 4ECWA 4QZFA 1QTMA 2WF7A 1PK1A 2AXTU 1XSLA 1L5UA 3NS1A 3H0RB 3HW8A 4TUPA 2F2AB 2JR5A 5EE0A 1MA7A 3Q8PB 4GXJA 5AK3A 3HRDD 1KQQA 4PPXA 1LKYB 3G6YA 4Z6FA 5T14A 3CW2C 5AM1A 4B9MA 4DSKA 8ICWA 4DSFA 4PH5A 4C80A 4UASA 3QUQA 4UB2A 2WFAA 1SWWA 5JTIA 3KKAC 5KG1A 5KFWA 7ICFA 1ZJNA 4FZLA 1S10A 9ICKA 2D3DA 1KFSA 3ZDAA 2ZG6A 2A1AA 4OO1J 3O0FA 5ALHA 2ISOA 4BUGA 3LVWA 4Y2UA 4RT2A 4C8KA 3H8MA 3C1YA 3BQ0A 2ZIVB 4MFFA 3MGIA 2HVHA 2XY5A 1MQ3A 2L5YA 5ALUA 2K4EA 3BS5B 5DLFA 4F4KA 4C8MA 2F1HA 3M9OB 8ICFA 2CRXA 4DSLA 2M9NA 2W7PA 2OHFA 5KFFA 1IIPA 4F92B 7ICQA 3KKAA 4OJ6A 2WF5A 1ZQGA 2XCPA 1Q8KA 3JPOA 2KZ3A 3ICXA 5J2DA 3QU7A 3D2QA 4RUAA 3DEEA 1N56A 3BQ7A 4DFDA 5DB6A 1XSPA 5BOMA 2KHQA 5ALEA 5IIIA 3WKDA 3ED5A 3IM1A 4B9VA 2PFQA 3TFSA 4ELVA 4B6JA 4R8UB 3EUB2 3FDSA 4BX9C 3GV7B 3C2KA 4JV1A 4NY8A 2MU2A 2O6KA 3ORYA 4NLGA 2G0AA 5KL8B 2ZXIA 1WUDA 4O0IA 4DO9A 2XY7A 1B43A 4MHVA 1SWVA 3QEBZ 2C22A 3UQ0A 4US9A 1NK7A 1DGJA 3JPPA 2ZJ5A 1L6NA 4YR2A 4UAZA 4TQRA 9ICLA 4ICAA 1NJZA 1DOQA 1D8YA 1SXDA 4RQ8A 2PFOA 2NRWA 2LPEA 1JROA 4KLJA 2HOFA 4KLHA 2ZJ8A 2I6XA 2FMSA 4BXOB 4GC6A 2QB0B 1DK3A 4O3OA 5IILA 1CUKA 5AI8A 4KITB 4NLNA 3AU6A 3Q8SB 3AN1A 4F50A 8ICRA 2HHUA 1M6YA 2HBLA 3GZFA 5DGAA 2KICA 4P4PA 5KFJA 2E8MA 2W8KA 4GFJA 3I76A 1ZJMA 4QZGA 1J2MA 9ICBA 5EWEA 3RTVA 2YMPA 5CJ7A 1V85A 4KLLA 1WWUA 4QJFB 2KIWA 1ZD5A 2F3NA 2RQ5A 5KT5A 5B5EU 3IN5A 3QU4A 4YG2A 1BPEA 3OHBA 1TVAA 3PX0A 1XU4A 2MRLA 5H2FU 4F3OA 2M0NA 5KFYA 2YB4A 3ONNA 2JEGA 4IQWA 3PSTA 3TACB 4ED6A 8ICYA 4ED3A 4ECSA 4M9NA 2G5HB 1ZETA 5L9XA 5HMLA 3GIJA 2JHDA 1X9SA 2W9CB 1T8EA 4NL9C 3UMCA 3GQCA 4DQRA 3C5FA 4QWAA 1YT3A 4UAYA 5AI0A 3RJHA 3TAPA 4R66A 2HHXA 3HKZF 4DQPA 1FO4A 1ZQKA 3IG8A 4F5QA 3LDAA 1UT5A 4NLZA 2AGOA 3PZPA 5AKIA 2KVCA 2QLTA 3GIMA 2F77X 5CRXA 4DSEA 9ICXA 1QQ5A 4M9HA 4MEYA 2IOFA 1IV8A 1Z1BA 4RQNA 2ZIUA 2V4RA 2AHOB 4EZ9A 5ALTA 4KLMA 4KN7A 3TQ1A 8ICLA 3DV9A 4U7CA 2KEYA 2HI0A 9ICUA 1SZPA 1T7PA 1PVQA 1UHUA 2ZTCA 2QB1A 4TURA 3RJGA 2KHVA 1Z4OA 3H7IA 2XGPA 4P0QB 9ICJA 4NJ8A 4C0ZA 5J0YA 1LV5A 3T5HA 2XVTA 2EZZA 1N2XA 2XC9A 1NK9A 7ICLA 4UB8U 3CNHA 4M0AA 1KBUA 1JMSA 2ZUDA 2A3VA 1Z19A 1WWVA 5EWFA 3Q8MA 4O3RA 5EOZA 2EZYA 5ALDA 5TZVA 3EPGA 1ZQLA 5KG3A 2KE7A 3PNCA 4G9BA 3R9KA 3N7SC 2H3IA 5HR6A 4USAA 3NVWA 4QIWC 2KOBA 9ICNA 2EAPA 3IHQB 1Z1VA 1JI7A 5J0SA 5ALPA 3H8SA 2YMLA 4KLGA 3T79A 1NJWA 4RQ4A 3T3FA 3TI0A 3ZI4A 4Z6CA 1TK0A 3QUBA 4M2YA 5ALYA 5HHHA 2ZUCA 1WG8A 2Y9UA 2LYHA 3M6ZA 1QLNA 4ECYA 5KAFU 4E0DA 4HAIA 3AEVA 3QUCA 5ALSA 1PVRA 4RNNA 3RJEA 2K4IA 4Q44A 1ZRMA 1NK8A 5ALZA 3M8RA 2PI4A 2K89A 4ECRA 1KKXA 2BCSA 2DF4B 4B9NA 3FM9A 1X9XA 1X42A 3WK8A 2KMDA 4DOCA 2GOLA 2KV2A 5J2FA 2FPMA 3V7JA 1K1SA 2F8LA 3SR6A 1ZQDA 2NO5A 2I1QA 2A19A 4IRDA 2HMXA 1S77D 4F2SA 3ISBA 5L1IA 2DL0A 4M9GA 2KFZA 1RDFA 2ZIUB 3CYMA 1NZPA 2A1JA 4YQWA 3RB3A 3U26A 1VJ5A 3HKZC 3MDAA 4OJ5A 2FLNA 1N60A 2OYYA 3RBEA 3BQTA 2CN1A 4ZH4A 1TK8A 1RQNA 3UMBA 4XUSA 3SZ2A 5DQGA 1D9FA 3UPQA 3RH5A 1ZQFA 7ICGA 5DBCA 4QZIA 4RQ1A 1SKSA 3Q8LA 3KD3A 3H8WA 3GU3A 5HNKA 4YN4A 2BZFA 1UA0A 4JWMA 5KG5A 1ECWA 2R18A 4NL9A 4QZDA 4F5OA 4NLKA 4CCHA 5D49A 2K4PA 2OCEA 2NRVA 1QCKA 4DEZA 4C7YA 4RQ2A 4UB3A 1X40A 4IC9A 5KFZA 5KFAA 3TANA 5ALMA 1ZQHA 4CF3A 4QW9A 1PVPA 5CA7A 1S0VA 1KSPA 5ALJA 4RNMA 2G09A 2HCFA 4M6WA 2R8IA 5KFBA 2FLLA 4BJQA 3F2BA 3WK7A 2JEFA 2R8GA 1L7PA 4F91B 4DFPA 4Z6EA 5ALWA 2EAMA 4YXMA 4R63A 1QH9A 5BOLA 2MSNA 2VA8A 2WTFA 2W43A 5KFQA 2WAQC 4QWCA 2NO4A 4IL6U 2JH7A 3UXOA 2R8JA 1ZYQA 1L7NA 4I2DA 4ECVA 5AKLA 4F2RA 1TAMA 4B9UA 3TADC 5KFVA 1A0PA 2PFPA 1NKBA 4LVSA 2JXJA 3OPXA 4UW9A 4I2FA 1ZQMA 4KLUA 2HSZA 5DDMA 3WK9A 4FS1A 3KHRA 1BPZA 2BQUA 4DWIA 4BXOA 1KTQA 4F72A 2IBKA 1S97A 2BQ3A 3SEIA 1IM4A 2V9WA 3NRZA 3N97B 2HOIA 3G6VA 1SV0C 1XO1A 2Q4TA 4RT3A 5ALQA 3SV4A 3KHHA 2DGZA 4QW8A 3JPRA 4J9LA 2MAXA 3MABA 1C20A 1ZQTA 3J81j 4NWIA 3PMLA 2NRZA 5L1LA 3OTQA 3A0BU 4IS7A 2AGQA 2FMPA 1D8BA 1RYUA 4DQQA 4DF4A 2RP5A 1KFTA 9ICWA 1A76A 1GO3F 5IIKA 3SMVA 3NRWA 3AUOA 4QWBA 2LYAA 3WKAA 3WK6A 3BS5A 4CNQA 7ICOA 4PL1A 1NI3A 3C2LA 4JV2A 2ZXHA 5ALXA 1URJA 3SV3A 5KT2A 3T5JA 2GH1A 2LBOA 1KEJA 9ICGA 1K5OA 5KNIA 5GTIU 4YCXA 5EWGA 5ALVA 9ICHA 3V7KA 3MGHA 4M47A 1ZQNA 2ASJA 2EH9A 3JPTA 3SENA 4UAWA 3BDPA 8ICIA 3M6KA 3M7DA 4KLEA 5ALFA 4EZ6A 4C7ZA 3JPNA 3GV5B 1WCLA 1ZQVA 3MR6A 3HJEA 3RB0A 7ICNA 2I9GA 4QIWF 2VKQA 1LKYA 3EW9A 1X2IA 4OJPA 4FZMA 3A0HU 3LK9A 1SKRA 2E1EA 5CB1A 2FI1A 2FJ6A 1Z4NA 5AM3A 3V7LA 1S0NA 3QU9A 4O5CA 2MUTA 8ICTA 2BHNA 2JEIA 5AKYA 2DBYA 1SGGA 4B9LA 2E1FA 4ELTA 4G3IA 1MQ2A 1DRGA 5F3XB 4RZRA 3CRXA 4I2GA 5ALRA 5C0YA 1PK1B 3EYZA 5KG6A 3GIKA 9ICFA 2AU0A 4I29A 3E58A 4YR0A 2HOQA 2WF9A 4UAVA 2F8KA 4P4MA 8ICXA 2BCVA 3NVYA 3HILA 5JU5A 1NKEA 4RQMA 1UT8A 2OWOA 1SXEA 3PMNA 5A0LA 4ECTA 2WF6A 4RQ5A 1NK4A 4RU9A 2EAOA 4FO6A 4EX7A 4YR3A 5L1JA 3PO5A 4OJOA 5DG7A 5KFPA 3F2CA 5J0RA 5J0OA 4DL4A 5AM5A 3M9NB 4R64A 1BPYA 3C1ZA 2OM6A 2UVVA 5KTQA 2IOFK 2YN4A 2KZMA 1RYRA 1ZQXA 2HDOA 3F5EA 3BQ2A 2HBJA 1UPHA 1U9LA 4P0QA 4I27A 3QNMA 4PHAA 3BZKA 2E8NA 1NOMA 2WF8A 4JB3A 5HR7A 4O3NA 1LVHA 5J0TA 5AM4A 4RPZA 3HPOA 2NYVA 4RUCA 4DSJA 2FE9A 2PXIA 1C7YA 1V9PA 4QZEA 5AI6A 4GIBA 4KMOB 9ICCA 2B21A 2LMRA 4GLXA 3ISDA 2W54A 3TADA 4X5VA 3MDCA 9ICVA 3V6HA 4EENA 4BWJA 5D4BA 8ICPA 3K75D 4EBEA 3AQEA 4RQ0A 4HYKA 8ICAA 2V4QA 3I1YA 3B9JA 5KFLA 5BPCA 2G07A 5DDYA 1JIHA 4Y2XA 3ZD8A 4P0PB 1SV0A 3PW7A 2W9BB 1L8OA 2KJ5A 1KRPA 2XGQA 5AIAA 3F53A 5KFCA 2W03A 1ZQCA 4DL7A 3MR2A 1RQLA 2I5HA 3SAFA 4YD1A 4K4GA 9ICQA 3HT3A 1NK0A 4KMUA 4PHDA 2LM1A 2ZIWB 3QU5A 5EE1A 7ICRA 2D6FC 5KG0A 8ICJA 2ZJAA 2KTQA 3FC4A 3RBDA 2ZIXB 3KHLA 5J0XA 1S5LU 2DUYA 4CF4A 3TKAA 3V72A 2Z7JA 2E3TA 4I2CA 2EQYA 5AI4A 4ELUA 8ICVA 4Y2QA 3RJIA 4O3QA 2C2RA 3SYZA 1B0XA 3SAHA 1MSWD 4YXJA 1F5SA 2B0CA 3HX0A 3WKCA 2FDRA 3IG5A 5JUMA 1Q3VA 2RDJA 2ZIWA 5G5HA 2HHSA 3THVA 1L7OA 4J9NA 2NV3A 1YZ7A 1PK3A 4P0PA 5AKEA 5JRTA 2YTUA 3QEAZ 2QB0A 2KN7A 3M1YA 2Y9TA 3BQ1A 2VA3A 2W9BA 7ICUA 2CPRA 2IOHA 3UXNA 2YB1A 4F4XA 1QSLA 1T3NA 2FPLA 3M8SA 3M9MB 3OSNA 7ICIA 4F93B 5AKKA 5ALGA 1WYGA 2WHEA 9ICEA 2ZTDA 2BQRA 3WKBA 5KT3A 3NUQA 4FFDA 1XS9D 4IR9A 1L7MA 5KFNA 4RPXA 3EZ5A 1ED1A 1DXSA 3SI8A 3UM9A 4DF8A 1ZQSA 4CGZA 3V6KA 5KG7A 5DLGA 4GXKA 1TK5A 4R8UA 2ODGA 7ICSA 3QU2A 7ICEA 1Z00A 4RQ3A 1X66A 2KP7A 3S6JA 8ICNA 2XCAA 4ED7A 1PUZA 5AM2A 3BJYA 9ICIA 1IG6A 4FS2A 2PMZC 4Y2TA 2LYBA 1TE2A 1Q3UA 1ZQIA 2IHMA 2VANA 7ICJA 4YMNA 3F5AA 2JV3A 4ACOA 3C29A 1SKWA 4QZBA 4KTQA 1HUOA 5KT6A 4DL2A 4ECQA 2AJQA 1B4FA 2J6UA 4O3MA 4ED0A 2F1IA 2XY6A 5J2CA 3PSIA 3MBYA 4ECUA 3EPIA 1SV4A 2KVSA 2DFLA 5AK6A 4Q45A 1KDHA 8ICHA 3N7RC 2KKPA 2DKXA 2HHVA 2JH1A 1UCVA 4DOAA 2J6TA 1ZD3A 5E79U 4LZDA 2C28A 2FLPA 3RRHA 3IDWA 1ZQBA 2YY6A 2R8HA 3PY8A 1U47A 2PFNA 4FE3A 4UB6U 3WK5A 2KKVA 2W55A 1BVSA 8ICGA 5DB8A 3RJFA 4QZCA 2HHWA 2ZIVA 3C28A 2W7OA 4DFKA 1SL2A 5AKHA 2KJ8A 4KLQA 3RH6A 3KZXA 1NJYA 3H0LB 5KFEA 3L3FX 1ZQWA 2XO7A 2BPFA 1ZQ1C 4EYIB 3H4BA 2LKYA 2MUTB 3FAHA 5DB9A 2AGPA 5AK5A 3AMZA 1JALA 5AICA 1K1QA 5KG2A 5B66U 4IQTA 2JEJA 2HHTA 2KZZA 4ECXA 2VA2A 2KD1A 4A8EA 5J8YC 4OD0A 3TAQA 1S0OA 4J9KA 2BDUA 2ASLA 3QYPA 3PO4A 1FEZA 1XWLA 3Q8RB 3WKEA 5KFGA 1RPLA 2W9AA 1F44A 2NRTA 4PGQA 1BPXA 4AYBC 4EELA 4Q8EA 3KBBA 4RNOA 2FPKA 8ICBA 4DS5A 1X9MA 2W04A 5AKXA 1N5XA 3C2MA 3TFRA 3I28A 4U6PA 5F9NA 1N5WA 1L3UA 1KLNA 2W9CA 4NM1A 5ALLA 3RR7A 9ICSA 4F4YA 3BZCA 1JXLA 8ICMA 1JUDA 5KFDA 3ALRA 4UB4A 5KFHA 1OW5A 3JPQA 3QZ7A 2KFNA 2F44A 4BDPA 7ICKA 1DGSA 4PZNA 8ICQA 4CRXA 2BCRA 4ED2A 5KT4A 4IR1A 4F4WA 4FZNA 2H3ZA 3PSPA 2H3FA 1QSYA 4DOBA 3E2EA 1SL0A 1JN3A 3ZDDA 4BGDA 5L1KA 4TQSA 4QZAA 4YVZA 1HIWA 3RAXA 2ALZA 3RJJA 2BDPA 2F76X 3OSPA 1O03A 4RPYA 3SAGA 2BPGA 5DG9A 5J29A 3HWTA 3NGDA 2VJ4A 2E5SA 3OJUA 2UVUA 2G5IB 3PW5A 2ES6A 1UQVA 4DFJA 2KK0A 4F8RA 1TKDA 1ZQJA 2UVRA 1P7DA 5CEHA 4IQVA 4FBUA 3KZIU 2UVWA 3D2NA 1HUZA 3GIIA 3MGVA 4QNLA 3QXGA 5IIJA 4B9SA 1CEZA 3RRGA 4DQSA 3H0MB 5TISU 2IMWP 1ZRNA 2YQEA 3C5GA 1ZQEA 1CI4A 2LM4A 5J0QA 3IRUA 2K60A 4KX3A 4Y2RA 1N48A 2QKQA 5DQIA 3TARA 5CHGA 2W11A 2E8OA 4C8LA 1COOA 1RZTA 1S76D 3Q8QB 4C8OA 5L1MA 2K8CB 5DBAA 1RM6C 5KFOA 3E0FA 3MR5A 5DKWA 1ZQQA 1FFUA 3D6JA 2LI6A 3RR8A 4KLOA 5CWRA 3LVVA 2KG5A 2DKZA 1XSNA 3GDXA 3PW0A 3NVZA 1L8LA 2Y1JA 3QX7A 4K4HA 1BPBA 4PZOA 3NTUA 4PHPA 4JUZA 5C5JA 5DGBA 1CRXA 4O5EA 4OJLA 1BPDA 2XIDA 4P2HA 5IIOA 3LWLA 5KFUA 2KNJA 4EBCA 4CF5A 9ICTA 3RJKA 4M6WB 1V97A 2J6SA 4GXIA 3ZDBA 2BCQA 1Q46A 2B6GA 7ICVA 1BNOA 2HW3A 3PX4A 1NK6A 4UQGA 1NJXA 4C4SA 3HP6A 2IHNA 1UA1A 1TAUA 2K8BB 1SIJA 4C8NA 3H4DA 2PKEA 4ECZA 8ICOA 2H3VA 3QE9Y 2G06A 4J9SA 4MF8A 1S0MA 1O08A 1D8LA 1ZXIA 1QSSA 4IQUA 1XO0A 1SL1A 3G6XA 4TUSA 5FP0A 1A6SA 1IXRA 5J0UA 3OJSA 3C23A 4FBTA 4YMOA 1VDVA 4DCCA 2N1RA 2ZUBA 4DLEA 2Y0SF 1YZ6A 3T5KA 3WK4A 2HBKA 4UATA 8ICUA 4OCZA 3ZDEA 2KJ9A 5EE3A 1T94A 2YMMA 2HBMA 4PHEA 3MFIA 4J9OA 2IA6A 2F1JA 4LJXA 5J2EA 3RFAA 1U48A 2JGAA 4JMUA 3B0XA 1ZQUA 1N61A 2WAQF 1KW4A 2A1JB 4J9PA 5KFSA 8ICSA 1JXEA 4F5PA 3NASA 4DS4A 1SB3C 3N7PD 2EZXA 4Y2YA 4JV0A 1L3SA 4IRCA 3LYSA 3QUTA 1Y88A 2RDIA 2KSOA 5HHIA 2QARB 2XI9A 5J2KA 4YFKA 2NRXA 5D46A 1DK2A 2D8CA 4NV0A 5KFIA 1X6JA 3IV6A 4CDGA 4Y2JA 5AM0A 3PX6A 3MFHA 2HHQA 3UMGA 4UAUA 1ZQRA 3PSFA 4PL2A 4R65A 4JWNA 2GLEA 4RQ6A 2GO7A 2OXOA 1L3VA 5KFXA 4EEKA 4DSIA 4CE6A 1SZHA 4AYBF 1NK5A 2H3QA 3K1ZA 3DDHA 4EBDA 2H5XA 5KL1B 2BR0A 5ALKA 1U4BA 8ICZA 4DL3A 2VJ5A 3CP8A 1JRPA 1T3QA 2Y0SC 3UXPA 3B0YA 1MN8A 3C21A 3L4PA 2RRDA 2P35A 3KHGA 5KFRA 7ICPA 4NXZA 4M9JA 3RAQA 1NNLA 3GFKB 4KLTA 5CR0A 1ZD2P 4I2HA 2E8PA 4ED8A 1COKA 2JRZA 2RHFA 2JMGA 1Z00B 2JZBA 4BWMA 5J8YA 2VIXA 4I2BA 3ISCA 3UQ2A 4J9QA 1NKCA 3ZD9A 4DL6A 3RF9A 2K8AA 4M04A 2KSOB 3K1RB 4Q8FA 4YP3A 3RB6A 1EXNA 1KL9A 4M9LA 2EANA 3GILA 2P6RA 2AQ0A 2FMQA 4UBCA 3ETLA 5F9LA 1BGXT 1J97A 2ESEA 4GC7A 3MC1A 3VC8A 7ICTA 3AQFA 2BCUA 4K4IA 2DPIA 1PZNA 3H8JA 4UBBA 1A77A 2G08A 2BPCA 5KFMA 1ZQZA 2DQNB 1J2NA 2BGWA 4DLGA 1U45A 2PI5A 4UB1A 3PR4A 2MA1A 1RXVA 4YD2A 4I28A 1VLBA 1U49A 2W9MA 4NLBA 3D2SA 3FYHA 2ATLA 5AI5A 3V6JA 9ICPA 4UB5A 4RQ7A 3ZDCA 1N62A 1T4GA 5J0WA 4EYHB 2DWQA 5HMMA 2HVIA 4O3PA 4F5NA 4F4ZA 2W8LA 5IINA 7ICHA 3RB4A 3GV8B 4P4OA 4QZ8A 4ZOHC 2ASDA 4YMMA 3IP4B 3EWAA 3QZ8A 4I2AA 1X6IA 3OGUA 3AM9A 5KAIU 5ALNA 3JPSA 3PR5B 2ZIXA 1KFDA 1NZBA 4QWDA 1D9DA 5KFKA 1FIQA 4PGYA 4EEYA 4KLSA 9ICMA 1S9FA 5J2JA 5G5GA 4XRHA 5J2AA 4DFMA 2WB1F 5AKGA 4O9MA 1FFVA 5HP4A 3N4MB 4UARA 2Y1IA 2EDUA 1AQ6A 3PW4A 1ZQYA 1ZQOA 5DG8A 1H38A 5AIBA 2P6UA 1N63A 4QWEA 2OEHA 1HEKA 1V38A 2ISPA 4WJ3B
chains in the Genus database with same CATH topology
2EQYA 1RYUA 2JXJA 2JRZA 2CXYA 2KK0A 2LI6A 5K4LA 5CEHA 2OEHA 2RQ5A 1KKXA 1IG6A 1KN5A 4LJXA 1C20A 1KQQA 2LM1A 2EH9A 2YQEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EQY A;  1RYU A;  2JXJ A;  2JRZ A;  2CXY A;  2KK0 A;  2LI6 A;  5K4L A;  5CEH A;  2OEH A;  2RQ5 A;  1KKX A;  1IG6 A;  1KN5 A;  4LJX A;  1C20 A;  1KQQ A;  2LM1 A;  2EH9 A;  2YQE A; 
#chains in the Genus database with same CATH topology
 4KLD A;  4KLF A;  4PJ0 U;  5KFT A;  4XA5 A;  4NLC A;  2PMZ F;  3ETR A;  2ZTE A;  5AKJ A;  1RG6 A;  5KG4 A;  3NVV A;  1ZQP A;  1QQ7 A;  7ICM A;  2LHT A;  2P66 A;  3OHA A;  4KLI A;  3SQI A;  4Y2V A;  2R8K A;  8ICK A;  2CXY A;  3VCB A;  1WCN A;  4MEX A;  4KX5 A;  4Y2S A;  4MFC A;  2Q0Z X;  5J2I A;  4DL5 A;  5AKZ A;  1TV9 A;  1RXW A;  4I2J A;  4US8 A;  3RH4 A;  5AHX A;  9ICR A;  4DQI A;  2JZB B;  4MF2 A;  2DPJ A;  2C2E A;  4J9R A;  3AU2 A;  3T5L A;  4F71 A;  1OXJ A;  1TFR A;  3BS7 A;  5DB7 A;  2XIC A;  4B9T A;  1F0M A;  1HJP A;  2RLT A;  4C4R A;  4C4T A;  2WB1 C;  1QQ6 A;  5DBB A;  4QZ9 A;  3WU2 U;  1ZQA A;  1B22 A;  3F2D A;  4J9M A;  4O3S A;  4QZH A;  3KFU F;  4KN4 A;  3PW2 A;  4IRK A;  4NM2 A;  2GWS A;  4PGX A;  4O5K A;  1XNS A;  3PV8 A;  4MFA A;  3MR3 A;  3KTQ A;  3K4G A;  3LWM A;  1RYS A;  1X9W A;  5DQH A;  4JK1 A;  5AK4 A;  4J03 A;  4LZG A;  4ED1 A;  4XQ8 A;  1OUQ A;  2K4H A;  3PVX A;  2YMQ A;  5ALO A;  5AI9 A;  2KIV A;  1KN5 A;  2W3R A;  5EE9 A;  9ICO A;  5J2H A;  1ARO P;  2BKE A;  1L3T A;  3KOO A;  2C2D A;  5KT7 A;  1BNP A;  2OH2 A;  5K4L A;  1JX4 A;  2AQ4 A;  2W3S A;  4AP9 A;  2YX8 A;  5GTH U;  3H40 A;  4Q43 A;  1LB2 B;  1S8O A;  1XC9 A;  4EX6 A;  4TUQ A;  1ZD4 A;  8ICC A;  3L5K A;  1ZOL A;  2QAR A;  4I2I A;  1TAQ A;  4Y2P A;  3N28 A;  3Q8K A;  5J2B A;  4I2E A;  5J0P A;  4Z6D A;  5IIM A;  2AH5 A;  5ALI A;  5CP2 A;  5J2G A;  3AL0 B;  9ICA A;  1MC8 A;  1Z3E B;  4F5R A;  3SD7 A;  8ICE A;  4ECW A;  4QZF A;  1QTM A;  2WF7 A;  1PK1 A;  2AXT U;  1XSL A;  1L5U A;  3NS1 A;  3H0R B;  3HW8 A;  4TUP A;  2F2A B;  2JR5 A;  5EE0 A;  1MA7 A;  3Q8P B;  4GXJ A;  5AK3 A;  3HRD D;  1KQQ A;  4PPX A;  1LKY B;  3G6Y A;  4Z6F A;  5T14 A;  3CW2 C;  5AM1 A;  4B9M A;  4DSK A;  8ICW A;  4DSF A;  4PH5 A;  4C80 A;  4UAS A;  3QUQ A;  4UB2 A;  2WFA A;  1SWW A;  5JTI A;  3KKA C;  5KG1 A;  5KFW A;  7ICF A;  1ZJN A;  4FZL A;  1S10 A;  9ICK A;  2D3D A;  1KFS A;  3ZDA A;  2ZG6 A;  2A1A A;  4OO1 J;  3O0F A;  5ALH A;  2ISO A;  4BUG A;  3LVW A;  4Y2U A;  4RT2 A;  4C8K A;  3H8M A;  3C1Y A;  3BQ0 A;  2ZIV B;  4MFF A;  3MGI A;  2HVH A;  2XY5 A;  1MQ3 A;  2L5Y A;  5ALU A;  2K4E A;  3BS5 B;  5DLF A;  4F4K A;  4C8M A;  2F1H A;  3M9O B;  8ICF A;  2CRX A;  4DSL A;  2M9N A;  2W7P A;  2OHF A;  5KFF A;  1IIP A;  4F92 B;  7ICQ A;  3KKA A;  4OJ6 A;  2WF5 A;  1ZQG A;  2XCP A;  1Q8K A;  3JPO A;  2KZ3 A;  3ICX A;  5J2D A;  3QU7 A;  3D2Q A;  4RUA A;  3DEE A;  1N56 A;  3BQ7 A;  4DFD A;  5DB6 A;  1XSP A;  5BOM A;  2KHQ A;  5ALE A;  5III A;  3WKD A;  3ED5 A;  3IM1 A;  4B9V A;  2PFQ A;  3TFS A;  4ELV A;  4B6J A;  4R8U B;  3EUB 2;  3FDS A;  4BX9 C;  3GV7 B;  3C2K A;  4JV1 A;  4NY8 A;  2MU2 A;  2O6K A;  3ORY A;  4NLG A;  2G0A A;  5KL8 B;  2ZXI A;  1WUD A;  4O0I A;  4DO9 A;  2XY7 A;  1B43 A;  4MHV A;  1SWV A;  3QEB Z;  2C22 A;  3UQ0 A;  4US9 A;  1NK7 A;  1DGJ A;  3JPP A;  2ZJ5 A;  1L6N A;  4YR2 A;  4UAZ A;  4TQR A;  9ICL A;  4ICA A;  1NJZ A;  1DOQ A;  1D8Y A;  1SXD A;  4RQ8 A;  2PFO A;  2NRW A;  2LPE A;  1JRO A;  4KLJ A;  2HOF A;  4KLH A;  2ZJ8 A;  2I6X A;  2FMS A;  4BXO B;  4GC6 A;  2QB0 B;  1DK3 A;  4O3O A;  5IIL A;  1CUK A;  5AI8 A;  4KIT B;  4NLN A;  3AU6 A;  3Q8S B;  3AN1 A;  4F50 A;  8ICR A;  2HHU A;  1M6Y A;  2HBL A;  3GZF A;  5DGA A;  2KIC A;  4P4P A;  5KFJ A;  2E8M A;  2W8K A;  4GFJ A;  3I76 A;  1ZJM A;  4QZG A;  1J2M A;  9ICB A;  5EWE A;  3RTV A;  2YMP A;  5CJ7 A;  1V85 A;  4KLL A;  1WWU A;  4QJF B;  2KIW A;  1ZD5 A;  2F3N A;  2RQ5 A;  5KT5 A;  5B5E U;  3IN5 A;  3QU4 A;  4YG2 A;  1BPE A;  3OHB A;  1TVA A;  3PX0 A;  1XU4 A;  2MRL A;  5H2F U;  4F3O A;  2M0N A;  5KFY A;  2YB4 A;  3ONN A;  2JEG A;  4IQW A;  3PST A;  3TAC B;  4ED6 A;  8ICY A;  4ED3 A;  4ECS A;  4M9N A;  2G5H B;  1ZET A;  5L9X A;  5HML A;  3GIJ A;  2JHD A;  1X9S A;  2W9C B;  1T8E A;  4NL9 C;  3UMC A;  3GQC A;  4DQR A;  3C5F A;  4QWA A;  1YT3 A;  4UAY A;  5AI0 A;  3RJH A;  3TAP A;  4R66 A;  2HHX A;  3HKZ F;  4DQP A;  1FO4 A;  1ZQK A;  3IG8 A;  4F5Q A;  3LDA A;  1UT5 A;  4NLZ A;  2AGO A;  3PZP A;  5AKI A;  2KVC A;  2QLT A;  3GIM A;  2F77 X;  5CRX A;  4DSE A;  9ICX A;  1QQ5 A;  4M9H A;  4MEY A;  2IOF A;  1IV8 A;  1Z1B A;  4RQN A;  2ZIU A;  2V4R A;  2AHO B;  4EZ9 A;  5ALT A;  4KLM A;  4KN7 A;  3TQ1 A;  8ICL A;  3DV9 A;  4U7C A;  2KEY A;  2HI0 A;  9ICU A;  1SZP A;  1T7P A;  1PVQ A;  1UHU A;  2ZTC A;  2QB1 A;  4TUR A;  3RJG A;  2KHV A;  1Z4O A;  3H7I A;  2XGP A;  4P0Q B;  9ICJ A;  4NJ8 A;  4C0Z A;  5J0Y A;  1LV5 A;  3T5H A;  2XVT A;  2EZZ A;  1N2X A;  2XC9 A;  1NK9 A;  7ICL A;  4UB8 U;  3CNH A;  4M0A A;  1KBU A;  1JMS A;  2ZUD A;  2A3V A;  1Z19 A;  1WWV A;  5EWF A;  3Q8M A;  4O3R A;  5EOZ A;  2EZY A;  5ALD A;  5TZV A;  3EPG A;  1ZQL A;  5KG3 A;  2KE7 A;  3PNC A;  4G9B A;  3R9K A;  3N7S C;  2H3I A;  5HR6 A;  4USA A;  3NVW A;  4QIW C;  2KOB A;  9ICN A;  2EAP A;  3IHQ B;  1Z1V A;  1JI7 A;  5J0S A;  5ALP A;  3H8S A;  2YML A;  4KLG A;  3T79 A;  1NJW A;  4RQ4 A;  3T3F A;  3TI0 A;  3ZI4 A;  4Z6C A;  1TK0 A;  3QUB A;  4M2Y A;  5ALY A;  5HHH A;  2ZUC A;  1WG8 A;  2Y9U A;  2LYH A;  3M6Z A;  1QLN A;  4ECY A;  5KAF U;  4E0D A;  4HAI A;  3AEV A;  3QUC A;  5ALS A;  1PVR A;  4RNN A;  3RJE A;  2K4I A;  4Q44 A;  1ZRM A;  1NK8 A;  5ALZ A;  3M8R A;  2PI4 A;  2K89 A;  4ECR A;  1KKX A;  2BCS A;  2DF4 B;  4B9N A;  3FM9 A;  1X9X A;  1X42 A;  3WK8 A;  2KMD A;  4DOC A;  2GOL A;  2KV2 A;  5J2F A;  2FPM A;  3V7J A;  1K1S A;  2F8L A;  3SR6 A;  1ZQD A;  2NO5 A;  2I1Q A;  2A19 A;  4IRD A;  2HMX A;  1S77 D;  4F2S A;  3ISB A;  5L1I A;  2DL0 A;  4M9G A;  2KFZ A;  1RDF A;  2ZIU B;  3CYM A;  1NZP A;  2A1J A;  4YQW A;  3RB3 A;  3U26 A;  1VJ5 A;  3HKZ C;  3MDA A;  4OJ5 A;  2FLN A;  1N60 A;  2OYY A;  3RBE A;  3BQT A;  2CN1 A;  4ZH4 A;  1TK8 A;  1RQN A;  3UMB A;  4XUS A;  3SZ2 A;  5DQG A;  1D9F A;  3UPQ A;  3RH5 A;  1ZQF A;  7ICG A;  5DBC A;  4QZI A;  4RQ1 A;  1SKS A;  3Q8L A;  3KD3 A;  3H8W A;  3GU3 A;  5HNK A;  4YN4 A;  2BZF A;  1UA0 A;  4JWM A;  5KG5 A;  1ECW A;  2R18 A;  4NL9 A;  4QZD A;  4F5O A;  4NLK A;  4CCH A;  5D49 A;  2K4P A;  2OCE A;  2NRV A;  1QCK A;  4DEZ A;  4C7Y A;  4RQ2 A;  4UB3 A;  1X40 A;  4IC9 A;  5KFZ A;  5KFA A;  3TAN A;  5ALM A;  1ZQH A;  4CF3 A;  4QW9 A;  1PVP A;  5CA7 A;  1S0V A;  1KSP A;  5ALJ A;  4RNM A;  2G09 A;  2HCF A;  4M6W A;  2R8I A;  5KFB A;  2FLL A;  4BJQ A;  3F2B A;  3WK7 A;  2JEF A;  2R8G A;  1L7P A;  4F91 B;  4DFP A;  4Z6E A;  5ALW A;  2EAM A;  4YXM A;  4R63 A;  1QH9 A;  5BOL A;  2MSN A;  2VA8 A;  2WTF A;  2W43 A;  5KFQ A;  2WAQ C;  4QWC A;  2NO4 A;  4IL6 U;  2JH7 A;  3UXO A;  2R8J A;  1ZYQ A;  1L7N A;  4I2D A;  4ECV A;  5AKL A;  4F2R A;  1TAM A;  4B9U A;  3TAD C;  5KFV A;  1A0P A;  2PFP A;  1NKB A;  4LVS A;  2JXJ A;  3OPX A;  4UW9 A;  4I2F A;  1ZQM A;  4KLU A;  2HSZ A;  5DDM A;  3WK9 A;  4FS1 A;  3KHR A;  1BPZ A;  2BQU A;  4DWI A;  4BXO A;  1KTQ A;  4F72 A;  2IBK A;  1S97 A;  2BQ3 A;  3SEI A;  1IM4 A;  2V9W A;  3NRZ A;  3N97 B;  2HOI A;  3G6V A;  1SV0 C;  1XO1 A;  2Q4T A;  4RT3 A;  5ALQ A;  3SV4 A;  3KHH A;  2DGZ A;  4QW8 A;  3JPR A;  4J9L A;  2MAX A;  3MAB A;  1C20 A;  1ZQT A;  3J81 j;  4NWI A;  3PML A;  2NRZ A;  5L1L A;  3OTQ A;  3A0B U;  4IS7 A;  2AGQ A;  2FMP A;  1D8B A;  1RYU A;  4DQQ A;  4DF4 A;  2RP5 A;  1KFT A;  9ICW A;  1A76 A;  1GO3 F;  5IIK A;  3SMV A;  3NRW A;  3AUO A;  4QWB A;  2LYA A;  3WKA A;  3WK6 A;  3BS5 A;  4CNQ A;  7ICO A;  4PL1 A;  1NI3 A;  3C2L A;  4JV2 A;  2ZXH A;  5ALX A;  1URJ A;  3SV3 A;  5KT2 A;  3T5J A;  2GH1 A;  2LBO A;  1KEJ A;  9ICG A;  1K5O A;  5KNI A;  5GTI U;  4YCX A;  5EWG A;  5ALV A;  9ICH A;  3V7K A;  3MGH A;  4M47 A;  1ZQN A;  2ASJ A;  2EH9 A;  3JPT A;  3SEN A;  4UAW A;  3BDP A;  8ICI A;  3M6K A;  3M7D A;  4KLE A;  5ALF A;  4EZ6 A;  4C7Z A;  3JPN A;  3GV5 B;  1WCL A;  1ZQV A;  3MR6 A;  3HJE A;  3RB0 A;  7ICN A;  2I9G A;  4QIW F;  2VKQ A;  1LKY A;  3EW9 A;  1X2I A;  4OJP A;  4FZM A;  3A0H U;  3LK9 A;  1SKR A;  2E1E A;  5CB1 A;  2FI1 A;  2FJ6 A;  1Z4N A;  5AM3 A;  3V7L A;  1S0N A;  3QU9 A;  4O5C A;  2MUT A;  8ICT A;  2BHN A;  2JEI A;  5AKY A;  2DBY A;  1SGG A;  4B9L A;  2E1F A;  4ELT A;  4G3I A;  1MQ2 A;  1DRG A;  5F3X B;  4RZR A;  3CRX A;  4I2G A;  5ALR A;  5C0Y A;  1PK1 B;  3EYZ A;  5KG6 A;  3GIK A;  9ICF A;  2AU0 A;  4I29 A;  3E58 A;  4YR0 A;  2HOQ A;  2WF9 A;  4UAV A;  2F8K A;  4P4M A;  8ICX A;  2BCV A;  3NVY A;  3HIL A;  5JU5 A;  1NKE A;  4RQM A;  1UT8 A;  2OWO A;  1SXE A;  3PMN A;  5A0L A;  4ECT A;  2WF6 A;  4RQ5 A;  1NK4 A;  4RU9 A;  2EAO A;  4FO6 A;  4EX7 A;  4YR3 A;  5L1J A;  3PO5 A;  4OJO A;  5DG7 A;  5KFP A;  3F2C A;  5J0R A;  5J0O A;  4DL4 A;  5AM5 A;  3M9N B;  4R64 A;  1BPY A;  3C1Z A;  2OM6 A;  2UVV A;  5KTQ A;  2IOF K;  2YN4 A;  2KZM A;  1RYR A;  1ZQX A;  2HDO A;  3F5E A;  3BQ2 A;  2HBJ A;  1UPH A;  1U9L A;  4P0Q A;  4I27 A;  3QNM A;  4PHA A;  3BZK A;  2E8N A;  1NOM A;  2WF8 A;  4JB3 A;  5HR7 A;  4O3N A;  1LVH A;  5J0T A;  5AM4 A;  4RPZ A;  3HPO A;  2NYV A;  4RUC A;  4DSJ A;  2FE9 A;  2PXI A;  1C7Y A;  1V9P A;  4QZE A;  5AI6 A;  4GIB A;  4KMO B;  9ICC A;  2B21 A;  2LMR A;  4GLX A;  3ISD A;  2W54 A;  3TAD A;  4X5V A;  3MDC A;  9ICV A;  3V6H A;  4EEN A;  4BWJ A;  5D4B A;  8ICP A;  3K75 D;  4EBE A;  3AQE A;  4RQ0 A;  4HYK A;  8ICA A;  2V4Q A;  3I1Y A;  3B9J A;  5KFL A;  5BPC A;  2G07 A;  5DDY A;  1JIH A;  4Y2X A;  3ZD8 A;  4P0P B;  1SV0 A;  3PW7 A;  2W9B B;  1L8O A;  2KJ5 A;  1KRP A;  2XGQ A;  5AIA A;  3F53 A;  5KFC A;  2W03 A;  1ZQC A;  4DL7 A;  3MR2 A;  1RQL A;  2I5H A;  3SAF A;  4YD1 A;  4K4G A;  9ICQ A;  3HT3 A;  1NK0 A;  4KMU A;  4PHD A;  2LM1 A;  2ZIW B;  3QU5 A;  5EE1 A;  7ICR A;  2D6F C;  5KG0 A;  8ICJ A;  2ZJA A;  2KTQ A;  3FC4 A;  3RBD A;  2ZIX B;  3KHL A;  5J0X A;  1S5L U;  2DUY A;  4CF4 A;  3TKA A;  3V72 A;  2Z7J A;  2E3T A;  4I2C A;  2EQY A;  5AI4 A;  4ELU A;  8ICV A;  4Y2Q A;  3RJI A;  4O3Q A;  2C2R A;  3SYZ A;  1B0X A;  3SAH A;  1MSW D;  4YXJ A;  1F5S A;  2B0C A;  3HX0 A;  3WKC A;  2FDR A;  3IG5 A;  5JUM A;  1Q3V A;  2RDJ A;  2ZIW A;  5G5H A;  2HHS A;  3THV A;  1L7O A;  4J9N A;  2NV3 A;  1YZ7 A;  1PK3 A;  4P0P A;  5AKE A;  5JRT A;  2YTU A;  3QEA Z;  2QB0 A;  2KN7 A;  3M1Y A;  2Y9T A;  3BQ1 A;  2VA3 A;  2W9B A;  7ICU A;  2CPR A;  2IOH A;  3UXN A;  2YB1 A;  4F4X A;  1QSL A;  1T3N A;  2FPL A;  3M8S A;  3M9M B;  3OSN A;  7ICI A;  4F93 B;  5AKK A;  5ALG A;  1WYG A;  2WHE A;  9ICE A;  2ZTD A;  2BQR A;  3WKB A;  5KT3 A;  3NUQ A;  4FFD A;  1XS9 D;  4IR9 A;  1L7M A;  5KFN A;  4RPX A;  3EZ5 A;  1ED1 A;  1DXS A;  3SI8 A;  3UM9 A;  4DF8 A;  1ZQS A;  4CGZ A;  3V6K A;  5KG7 A;  5DLG A;  4GXK A;  1TK5 A;  4R8U A;  2ODG A;  7ICS A;  3QU2 A;  7ICE A;  1Z00 A;  4RQ3 A;  1X66 A;  2KP7 A;  3S6J A;  8ICN A;  2XCA A;  4ED7 A;  1PUZ A;  5AM2 A;  3BJY A;  9ICI A;  1IG6 A;  4FS2 A;  2PMZ C;  4Y2T A;  2LYB A;  1TE2 A;  1Q3U A;  1ZQI A;  2IHM A;  2VAN A;  7ICJ A;  4YMN A;  3F5A A;  2JV3 A;  4ACO A;  3C29 A;  1SKW A;  4QZB A;  4KTQ A;  1HUO A;  5KT6 A;  4DL2 A;  4ECQ A;  2AJQ A;  1B4F A;  2J6U A;  4O3M A;  4ED0 A;  2F1I A;  2XY6 A;  5J2C A;  3PSI A;  3MBY A;  4ECU A;  3EPI A;  1SV4 A;  2KVS A;  2DFL A;  5AK6 A;  4Q45 A;  1KDH A;  8ICH A;  3N7R C;  2KKP A;  2DKX A;  2HHV A;  2JH1 A;  1UCV A;  4DOA A;  2J6T A;  1ZD3 A;  5E79 U;  4LZD A;  2C28 A;  2FLP A;  3RRH A;  3IDW A;  1ZQB A;  2YY6 A;  2R8H A;  3PY8 A;  1U47 A;  2PFN A;  4FE3 A;  4UB6 U;  3WK5 A;  2KKV A;  2W55 A;  1BVS A;  8ICG A;  5DB8 A;  3RJF A;  4QZC A;  2HHW A;  2ZIV A;  3C28 A;  2W7O A;  4DFK A;  1SL2 A;  5AKH A;  2KJ8 A;  4KLQ A;  3RH6 A;  3KZX A;  1NJY A;  3H0L B;  5KFE A;  3L3F X;  1ZQW A;  2XO7 A;  2BPF A;  1ZQ1 C;  4EYI B;  3H4B A;  2LKY A;  2MUT B;  3FAH A;  5DB9 A;  2AGP A;  5AK5 A;  3AMZ A;  1JAL A;  5AIC A;  1K1Q A;  5KG2 A;  5B66 U;  4IQT A;  2JEJ A;  2HHT A;  2KZZ A;  4ECX A;  2VA2 A;  2KD1 A;  4A8E A;  5J8Y C;  4OD0 A;  3TAQ A;  1S0O A;  4J9K A;  2BDU A;  2ASL A;  3QYP A;  3PO4 A;  1FEZ A;  1XWL A;  3Q8R B;  3WKE A;  5KFG A;  1RPL A;  2W9A A;  1F44 A;  2NRT A;  4PGQ A;  1BPX A;  4AYB C;  4EEL A;  4Q8E A;  3KBB A;  4RNO A;  2FPK A;  8ICB A;  4DS5 A;  1X9M A;  2W04 A;  5AKX A;  1N5X A;  3C2M A;  3TFR A;  3I28 A;  4U6P A;  5F9N A;  1N5W A;  1L3U A;  1KLN A;  2W9C A;  4NM1 A;  5ALL A;  3RR7 A;  9ICS A;  4F4Y A;  3BZC A;  1JXL A;  8ICM A;  1JUD A;  5KFD A;  3ALR A;  4UB4 A;  5KFH A;  1OW5 A;  3JPQ A;  3QZ7 A;  2KFN A;  2F44 A;  4BDP A;  7ICK A;  1DGS A;  4PZN A;  8ICQ A;  4CRX A;  2BCR A;  4ED2 A;  5KT4 A;  4IR1 A;  4F4W A;  4FZN A;  2H3Z A;  3PSP A;  2H3F A;  1QSY A;  4DOB A;  3E2E A;  1SL0 A;  1JN3 A;  3ZDD A;  4BGD A;  5L1K A;  4TQS A;  4QZA A;  4YVZ A;  1HIW A;  3RAX A;  2ALZ A;  3RJJ A;  2BDP A;  2F76 X;  3OSP A;  1O03 A;  4RPY A;  3SAG A;  2BPG A;  5DG9 A;  5J29 A;  3HWT A;  3NGD A;  2VJ4 A;  2E5S A;  3OJU A;  2UVU A;  2G5I B;  3PW5 A;  2ES6 A;  1UQV A;  4DFJ A;  2KK0 A;  4F8R A;  1TKD A;  1ZQJ A;  2UVR A;  1P7D A;  5CEH A;  4IQV A;  4FBU A;  3KZI U;  2UVW A;  3D2N A;  1HUZ A;  3GII A;  3MGV A;  4QNL A;  3QXG A;  5IIJ A;  4B9S A;  1CEZ A;  3RRG A;  4DQS A;  3H0M B;  5TIS U;  2IMW P;  1ZRN A;  2YQE A;  3C5G A;  1ZQE A;  1CI4 A;  2LM4 A;  5J0Q A;  3IRU A;  2K60 A;  4KX3 A;  4Y2R A;  1N48 A;  2QKQ A;  5DQI A;  3TAR A;  5CHG A;  2W11 A;  2E8O A;  4C8L A;  1COO A;  1RZT A;  1S76 D;  3Q8Q B;  4C8O A;  5L1M A;  2K8C B;  5DBA A;  1RM6 C;  5KFO A;  3E0F A;  3MR5 A;  5DKW A;  1ZQQ A;  1FFU A;  3D6J A;  2LI6 A;  3RR8 A;  4KLO A;  5CWR A;  3LVV A;  2KG5 A;  2DKZ A;  1XSN A;  3GDX A;  3PW0 A;  3NVZ A;  1L8L A;  2Y1J A;  3QX7 A;  4K4H A;  1BPB A;  4PZO A;  3NTU A;  4PHP A;  4JUZ A;  5C5J A;  5DGB A;  1CRX A;  4O5E A;  4OJL A;  1BPD A;  2XID A;  4P2H A;  5IIO A;  3LWL A;  5KFU A;  2KNJ A;  4EBC A;  4CF5 A;  9ICT A;  3RJK A;  4M6W B;  1V97 A;  2J6S A;  4GXI A;  3ZDB A;  2BCQ A;  1Q46 A;  2B6G A;  7ICV A;  1BNO A;  2HW3 A;  3PX4 A;  1NK6 A;  4UQG A;  1NJX A;  4C4S A;  3HP6 A;  2IHN A;  1UA1 A;  1TAU A;  2K8B B;  1SIJ A;  4C8N A;  3H4D A;  2PKE A;  4ECZ A;  8ICO A;  2H3V A;  3QE9 Y;  2G06 A;  4J9S A;  4MF8 A;  1S0M A;  1O08 A;  1D8L A;  1ZXI A;  1QSS A;  4IQU A;  1XO0 A;  1SL1 A;  3G6X A;  4TUS A;  5FP0 A;  1A6S A;  1IXR A;  5J0U A;  3OJS A;  3C23 A;  4FBT A;  4YMO A;  1VDV A;  4DCC A;  2N1R A;  2ZUB A;  4DLE A;  2Y0S F;  1YZ6 A;  3T5K A;  3WK4 A;  2HBK A;  4UAT A;  8ICU A;  4OCZ A;  3ZDE A;  2KJ9 A;  5EE3 A;  1T94 A;  2YMM A;  2HBM A;  4PHE A;  3MFI A;  4J9O A;  2IA6 A;  2F1J A;  4LJX A;  5J2E A;  3RFA A;  1U48 A;  2JGA A;  4JMU A;  3B0X A;  1ZQU A;  1N61 A;  2WAQ F;  1KW4 A;  2A1J B;  4J9P A;  5KFS A;  8ICS A;  1JXE A;  4F5P A;  3NAS A;  4DS4 A;  1SB3 C;  3N7P D;  2EZX A;  4Y2Y A;  4JV0 A;  1L3S A;  4IRC A;  3LYS A;  3QUT A;  1Y88 A;  2RDI A;  2KSO A;  5HHI A;  2QAR B;  2XI9 A;  5J2K A;  4YFK A;  2NRX A;  5D46 A;  1DK2 A;  2D8C A;  4NV0 A;  5KFI A;  1X6J A;  3IV6 A;  4CDG A;  4Y2J A;  5AM0 A;  3PX6 A;  3MFH A;  2HHQ A;  3UMG A;  4UAU A;  1ZQR A;  3PSF A;  4PL2 A;  4R65 A;  4JWN A;  2GLE A;  4RQ6 A;  2GO7 A;  2OXO A;  1L3V A;  5KFX A;  4EEK A;  4DSI A;  4CE6 A;  1SZH A;  4AYB F;  1NK5 A;  2H3Q A;  3K1Z A;  3DDH A;  4EBD A;  2H5X A;  5KL1 B;  2BR0 A;  5ALK A;  1U4B A;  8ICZ A;  4DL3 A;  2VJ5 A;  3CP8 A;  1JRP A;  1T3Q A;  2Y0S C;  3UXP A;  3B0Y A;  1MN8 A;  3C21 A;  3L4P A;  2RRD A;  2P35 A;  3KHG A;  5KFR A;  7ICP A;  4NXZ A;  4M9J A;  3RAQ A;  1NNL A;  3GFK B;  4KLT A;  5CR0 A;  1ZD2 P;  4I2H A;  2E8P A;  4ED8 A;  1COK A;  2JRZ A;  2RHF A;  2JMG A;  1Z00 B;  2JZB A;  4BWM A;  5J8Y A;  2VIX A;  4I2B A;  3ISC A;  3UQ2 A;  4J9Q A;  1NKC A;  3ZD9 A;  4DL6 A;  3RF9 A;  2K8A A;  4M04 A;  2KSO B;  3K1R B;  4Q8F A;  4YP3 A;  3RB6 A;  1EXN A;  1KL9 A;  4M9L A;  2EAN A;  3GIL A;  2P6R A;  2AQ0 A;  2FMQ A;  4UBC A;  3ETL A;  5F9L A;  1BGX T;  1J97 A;  2ESE A;  4GC7 A;  3MC1 A;  3VC8 A;  7ICT A;  3AQF A;  2BCU A;  4K4I A;  2DPI A;  1PZN A;  3H8J A;  4UBB A;  1A77 A;  2G08 A;  2BPC A;  5KFM A;  1ZQZ A;  2DQN B;  1J2N A;  2BGW A;  4DLG A;  1U45 A;  2PI5 A;  4UB1 A;  3PR4 A;  2MA1 A;  1RXV A;  4YD2 A;  4I28 A;  1VLB A;  1U49 A;  2W9M A;  4NLB A;  3D2S A;  3FYH A;  2ATL A;  5AI5 A;  3V6J A;  9ICP A;  4UB5 A;  4RQ7 A;  3ZDC A;  1N62 A;  1T4G A;  5J0W A;  4EYH B;  2DWQ A;  5HMM A;  2HVI A;  4O3P A;  4F5N A;  4F4Z A;  2W8L A;  5IIN A;  7ICH A;  3RB4 A;  3GV8 B;  4P4O A;  4QZ8 A;  4ZOH C;  2ASD A;  4YMM A;  3IP4 B;  3EWA A;  3QZ8 A;  4I2A A;  1X6I A;  3OGU A;  3AM9 A;  5KAI U;  5ALN A;  3JPS A;  3PR5 B;  2ZIX A;  1KFD A;  1NZB A;  4QWD A;  1D9D A;  5KFK A;  1FIQ A;  4PGY A;  4EEY A;  4KLS A;  9ICM A;  1S9F A;  5J2J A;  5G5G A;  4XRH A;  5J2A A;  4DFM A;  2WB1 F;  5AKG A;  4O9M A;  1FFV A;  5HP4 A;  3N4M B;  4UAR A;  2Y1I A;  2EDU A;  1AQ6 A;  3PW4 A;  1ZQY A;  1ZQO A;  5DG8 A;  1H38 A;  5AIB A;  2P6U A;  1N63 A;  4QWE A;  2OEH A;  1HEK A;  1V38 A;  2ISP A;  4WJ3 B; 
#chains in the Genus database with same CATH homology
 2EQY A;  1RYU A;  2JXJ A;  2JRZ A;  2CXY A;  2KK0 A;  2LI6 A;  5K4L A;  5CEH A;  2OEH A;  2RQ5 A;  1KKX A;  1IG6 A;  1KN5 A;  4LJX A;  1C20 A;  1KQQ A;  2LM1 A;  2EH9 A;  2YQE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...