2KK0A

Solution structure of dead ringer-like protein 1 (at-rich interactive domain-containing protein 3a) from homo sapiens, northeast structural genomics consortium (nesg) target hr4394c
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
145
structure length
145
Chain Sequence
MGHHHHHHSHMPDHGDWTYEEQFKQLYELDGDPKRKEFLDDLFSFMQKRGTPVNRIPIMAKQVLDLFMLYVLVTEKGGLVEVINKKLWREITKGLNLPTSITSAAFTLRTQYMKYLYPYECEKRGLSNPNELQAAIDSNRREGRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords AT-rich interactive domain-containing protein 3A
publication title Solution NMR structure of the ARID domain of human AT-rich interactive domain-containing protein 3A: a human cancer protein interaction network target.
pubmed doi rcsb
source organism Homo sapiens
total genus 35
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 2009-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01388 ARID ARID/BRIGHT DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.60 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 ARID DNA-binding domain 2kk0A01
2EQYA 4LJXA 5K4LA 2JRZA 2RQ5A 1C20A 1KQQA 2EH9A 2OEHA 2LM1A 1RYUA 2YQEA 5CEHA 1KN5A 1KKXA 1IG6A 2KK0A 2LI6A 2CXYA 2JXJA
chains in the Genus database with same CATH superfamily
3HPOA 3ISBA 1O08A 8ICHA 1VLBA 4BGDA 1F5SA 3M8RA 2AHOB 7ICFA 1TV9A 4M6WA 1S0NA 1S0MA 3QYPA 5AK5A 1BPDA 2C2DA 4JWNA 4P0QA 2F8LA 2FJ6A 3M6KA 1KW4A 5J2EA 3I1YA 5J2HA 1TFRA 3H4DA 1U45A 4QZEA 4BXOB 5KFCA 4UB8U 2HHTA 3PW4A 5CP2A 4PJ0U 1XSPA 3BS5A 2KFZA 4Y2UA 3F2BA 3PV8A 2K4IA 4ELVA 7ICRA 1C7YA 2UVWA 4F50A 5ALPA 1S8OA 2FPLA 4JUZA 3V7KA 4DWIA 3HILA 2R8JA 3PR4A 4F4YA 3CW2C 2KIWA 1RZTA 2W55A 5AI4A 2D8CA 3GU3A 2Y1IA 4DL5A 2A1JB 1DGSA 3RJKA 8ICTA 2H3IA 2ISPA 3DV9A 3A0HU 5FP0A 5A0LA 3E58A 1KLNA 4PGXA 5KFWA 4DOBA 1WWVA 5AI8A 1N62A 3LK9A 4F4WA 5DGBA 3IG5A 3RJIA 3AMZA 3Q8SB 1SGGA 2Z7JA 2ZIWB 9ICMA 4F5RA 2ZG6A 5IIKA 2L5YA 4RZRA 2IA6A 3LDAA 2HVHA 4EX6A 2VA2A 2FMSA 1T7PA 5L1MA 3BZCA 4TURA 1JMSA 4UATA 2BPCA 2KZ3A 5J2CA 8ICLA 2YMQA 3AN1A 3AU6A 3DDHA 5ALXA 3KZIU 3TACB 3KHHA 4C8OA 4NWIA 1TK0A 4EYHB 3TARA 5AICA 3RB6A 5B66U 9ICBA 2FPMA 4IQTA 5AI0A 2EZXA 4WJ3B 1DK2A 2WHEA 2DQNB 1MN8A 4B9TA 3PSTA 2IOHA 3WKDA 3H40A 4BUGA 3T5KA 1QSYA 1SWVA 1ZETA 3RJHA 2ZXHA 2A1AA 3WK4A 9ICTA 2EAMA 4RQMA 4LVSA 1NK8A 3F5AA 3IDWA 1TKDA 3GIIA 9ICOA 3SI8A 3HW8A 4B9LA 4MF2A 1FFVA 4IQUA 3PO4A 1X2IA 4DL2A 4PHAA 3GV5B 4IR9A 2KHVA 3H7IA 1BNOA 1UCVA 4ED8A 4F4ZA 5CWRA 3PX4A 3WKCA 5J2DA 2JR5A 2NO4A 1JUDA 1N60A 9ICPA 4PZOA 5AHXA 3Q8QB 3SEIA 1B43A 4G9BA 2JGAA 9ICLA 5ALTA 5ALRA 1Z19A 1Z1BA 2W9CA 2WF7A 2XGPA 2XGQA 2FPKA 4EELA 3NTUA 3PX6A 7ICVA 1RYRA 7ICMA 1V9PA 4DSEA 5BOLA 1SV4A 4DSLA 5ALVA 4IRCA 2AXTU 1TE2A 1ZQNA 4RQ6A 5ALQA 1ZQAA 4TUSA 5KFZA 4ECRA 4O3PA 1ZOLA 2V4QA 1DXSA 4Y2RA 1IM4A 2C2EA 1OUQA 2GOLA 1NNLA 8ICSA 4O3RA 2WF8A 1K5OA 2YB4A 3M9OB 4F93B 4QZBA 7ICGA 3QUCA 2LM1A 1NJWA 5AI6A 5AKXA 5F9NA 2RDJA 1X42A 4RQ5A 4UB5A 3H0MB 3H4BA 5KFGA 2Y1JA 1NZBA 2K4HA 3OHBA 3AL0B 4PZNA 4KLHA 3AEVA 3V6JA 5J0PA 1Q8KA 5KFTA 4XUSA 1ZYQA 4R66A 2K8CB 1Z00A 4YVZA 3OSPA 4QWDA 3H8JA 3OHAA 3BJYA 2XC9A 1ZQIA 2HBJA 2HHQA 1P7DA 2W3SA 2W43A 1D8LA 2EAOA 4IQVA 4XRHA 3BQ1A 4NLCA 5KFEA 4NL9A 2KSOB 2HOQA 3SR6A 5KFKA 4Q8EA 5DKWA 4X5VA 3M9NB 3A0BU 4RNMA 3KZXA 2HOFA 1WG8A 3NUQA 2C22A 1WCLA 5DBCA 2F76X 3JPSA 2GH1A 1BPXA 9ICUA 2WF5A 5CA7A 2KV2A 3Q8MA 3MR5A 1ZQRA 1KEJA 1ZJMA 1Z3EB 1FO4A 2RDIA 5AM5A 3QZ8A 2KZMA 4Z6EA 2KHQA 2OWOA 3WK9A 4ECSA 5KFDA 5C5JA 3PR5B 1IIPA 2EDUA 4O3QA 3THVA 5KG5A 1S9FA 3TADC 2XCPA 1V85A 3RB4A 1ZD4A 4YCXA 3F2CA 3SQIA 1ZQCA 4YD2A 4DL7A 2HSZA 4I29A 3I76A 2YMPA 3MBYA 2E8NA 4I2FA 7ICEA 4IRKA 4UQGA 4F5QA 2M9NA 1ZD5A 3NGDA 2MUTB 5KL1B 2KK0A 2BPGA 8ICMA 8ICIA 7ICPA 5HMLA 2Y0SF 4YQWA 4FS2A 3IV6A 4J9PA 3M7DA 8ICGA 2RQ5A 5DDYA 1SZPA 1XC9A 3K4GA 8ICJA 2JEFA 4PL1A 2OCEA 1ECWA 3V7JA 3ZDDA 5EE1A 5ALHA 4BXOA 4F3OA 4PH5A 1N5WA 5F9LA 2W9BB 2FDRA 4QIWF 1RYSA 4P4OA 4DQQA 2F8KA 5ALLA 1L3TA 4M9LA 1IV8A 5ALGA 4FZLA 1L8LA 4GC7A 3T5LA 2HHSA 4Y2SA 3JPOA 1SXEA 2A1JA 1S77D 4RUCA 8ICPA 3B0XA 1SKRA 4Z6CA 3QEBZ 3HP6A 2ZJ8A 3OGUA 2MU2A 4QZHA 4EBEA 4P0PB 2YTUA 1N48A 1NOMA 2XY5A 5IILA 4JMUA 3MABA 2CPRA 9ICNA 1ZQGA 4OJ6A 1WYGA 4FBTA 2ZIWA 2JEGA 2JXJA 1XWLA 1F0MA 4PGYA 3C2LA 1JXEA 1ZQHA 4FBUA 4BDPA 5J0YA 3JPRA 4DLGA 1C20A 5KT3A 1YZ6A 5KFAA 5KFQA 3WKEA 5T14A 4CNQA 1PUZA 4P2HA 4UARA 7ICHA 2DUYA 1QTMA 3OSNA 2RRDA 4QJFB 3PW7A 4J9NA 4Q8FA 2ZJAA 2EZYA 4FS1A 1PVQA 2NRXA 2PMZF 1ZQVA 1KFTA 5KG0A 1ZQJA 2QARB 2FLLA 1L7NA 4B9VA 3QUTA 1ZJNA 1B22A 5EWEA 5AKZA 4DQPA 3IP4B 2HBLA 4RPYA 9ICCA 3RJJA 3UMBA 2JH1A 1JROA 2HBKA 3ICXA 3BZKA 5TISU 2BHNA 4C4SA 2LM4A 1PK3A 4YMOA 2E8MA 5ALWA 1OW5A 1JRPA 3H0RB 1PVRA 2K60A 2FMQA 4DSFA 4ECXA 2AGQA 1QLNA 3TAPA 5C0YA 4AP9A 2YX8A 4RQ2A 5KFNA 2VANA 3ZD8A 2KFNA 1KDHA 4I2HA 3K1ZA 5L1LA 4RQ4A 1WCNA 1T94A 2PFOA 4IL6U 4CGZA 3LWMA 1L3UA 5GTIU 2GWSA 1L8OA 3F2DA 3RR7A 1DK3A 4I2JA 1FFUA 5EE0A 2BCVA 3NRWA 2LPEA 5J0TA 4YN4A 5ALUA 5AM1A 4PHEA 5AM0A 2Y0SC 2E3TA 3CNHA 1N2XA 5EWGA 1T8EA 4XQ8A 5KFPA 1T4GA 3OJUA 1KKXA 4YXMA 7ICKA 4KX3A 2BCUA 3QU2A 5AKGA 5J2FA 1NK7A 3KKAA 1X9WA 3BS7A 3WK7A 3EYZA 1ZQUA 4Y2YA 2ZUBA 5J0SA 1L7OA 4UASA 4RQ1A 2R8GA 2W11A 4US9A 1COOA 4JK1A 4MEYA 4QIWC 8ICFA 3IG8A 3SD7A 2IBKA 3PMLA 1X9SA 3B9JA 1VJ5A 3M6ZA 3ZDAA 4M04A 4J9KA 2H3FA 2R18A 4YD1A 3OJSA 3F53A 4ED2A 2KN7A 1S97A 2OM6A 3RFAA 1T3NA 4TQSA 1X40A 7ICSA 4KLLA 4I2DA 2OYYA 3UPQA 1D9FA 2KSOA 3GIJA 1BPEA 4RPXA 3EW9A 3BQ0A 3KHGA 5J2KA 4NLKA 2JRZA 4NJ8A 1B0XA 4MFCA 1B4FA 3FM9A 3KBBA 4QZ8A 7ICQA 4DS4A 3RJGA 4I2BA 2G06A 2EH9A 3N7PD 1RPLA 4EBDA 3PO5A 4DFPA 2HW3A 3MC1A 3UXNA 8ICBA 4JB3A 5HHHA 3H8MA 5D49A 3ZDEA 1ZQTA 4ED7A 3ORYA 1HIWA 1SV0A 3MGIA 4BJQA 2Q4TA 1SXDA 4IS7A 2DF4B 4F2RA 4DSIA 4K4IA 3M8SA 2K89A 5ALDA 4YFKA 3RBEA 1T3QA 4R8UB 1UQVA 2F1JA 3UMGA 2PMZC 2RHFA 1JI7A 3SAFA 2G0AA 3EPIA 1TAUA 3N4MB 2KEYA 1HEKA 3RB3A 5KFMA 3WK8A 2YMMA 4YMNA 2ZUCA 4KMUA 4BX9C 2F3NA 1SIJA 1A76A 3HRDD 4UB4A 4FZMA 2AGOA 1S10A 3AUOA 2MUTA 5EWFA 4UAWA 5F3XB 2VIXA 3N7SC 1X6JA 7ICNA 1L7MA 9ICSA 2KD1A 3SV3A 1SL2A 2DKZA 5AM4A 3C2MA 1ZQDA 2NV3A 2UVUA 2KOBA 2M0NA 5GTHU 3QU9A 2PFQA 1K1QA 2KG5A 3PVXA 4DFJA 3TFRA 2W9BA 3C21A 1Q3UA 4MFAA 1CUKA 3S6JA 2R8IA 4KLQA 2ZIXB 4DL4A 2W3RA 5KG6A 2G09A 4B9NA 5JTIA 1IXRA 2WF9A 4GFJA 4F5PA 1D8YA 4HYKA 1H38A 5DG8A 5EE3A 8ICAA 4Y2JA 3NRZA 1FEZA 3Q8KA 4O3NA 1S0VA 3KHRA 3GIKA 3SAGA 8ICRA 4M0AA 3B0YA 3RTVA 5ALSA 1U4BA 3N7RC 2NRWA 2E8OA 4P0PA 1MQ3A 2KJ5A 2BKEA 4ZOHC 1JIHA 3KTQA 4CDGA 2J6SA 1TAQA 1S76D 7ICUA 3IHQB 5D46A 1IG6A 1PK1B 3JPNA 3SENA 1F44A 1MC8A 3N28A 1NI3A 2HI0A 1JXLA 2HHXA 2F2AB 2BQ3A 1PZNA 4O5KA 2B6GA 1QQ6A 2R8KA 3C29A 5KFUA 4DSJA 4O3SA 2K4EA 2KVSA 2HHVA 4NLBA 5KG3A 2WFAA 3TFSA 2DKXA 1ZD2P 2K8BB 3IRUA 8ICQA 3WKBA 2DPIA 4TQRA 3MGHA 4DCCA 2CRXA 2W54A 4P4PA 2ISOA 3HWTA 2H5XA 2OH2A 3TQ1A 4KN7A 2QARA 3N97B 3Q8RB 4DSKA 3GQCA 3QE9Y 4ED3A 2JHDA 8ICCA 3C5GA 2W04A 1ED1A 4MF8A 3J81j 4QZDA 4Z6DA 2JH7A 1NK9A 4GIBA 3PNCA 4B6JA 1SWWA 5AIAA 3F5EA 4QWAA 5L1KA 2QKQA 2BPFA 1L7PA 1NK4A 1TK5A 2UVRA 2ZTDA 1XO1A 5EOZA 1XU4A 1DRGA 2A19A 2DL0A 3G6VA 3ONNA 1KSPA 4QW8A 2J6UA 1M6YA 1KL9A 4UAVA 9ICQA 1SZHA 3NVWA 3MGVA 3PY8A 4J9LA 5K4LA 4ECVA 2LHTA 1RQNA 1KFDA 5AK3A 4M2YA 2I6XA 1SKSA 2KZZA 4ED0A 2N1RA 3O0FA 3QU5A 1ZQOA 5IIMA 4LZGA 4ACOA 2EANA 5AKLA 2LBOA 5BPCA 4Y2QA 3ETLA 5HR6A 3FYHA 5HHIA 4UB1A 5CRXA 4ED6A 4NV0A 4Q45A 5AKYA 4FFDA 5J0WA 3GILA 4UB2A 1UHUA 4ECTA 1NK5A 4J9OA 4LZDA 2GLEA 2PXIA 2BDPA 4ECWA 4Z6FA 5KFOA 4CCHA 4I2EA 2LMRA 3L4PA 4Y2TA 1NKEA 2W8KA 9ICRA 4PL2A 3V6KA 2VJ5A 3NS1A 5KG2A 4UAUA 2JV3A 3WK6A 4NL9C 4CF3A 9ICXA 3RH6A 3PX0A 4QZCA 4DFMA 1ZQWA 5G5GA 5L9XA 5DB9A 1L3SA 3QZ7A 1CRXA 9ICKA 5AI5A 9ICIA 1QH9A 1A77A 1J2MA 5DDMA 3RH4A 1TAMA 1Q3VA 2V9WA 4ECZA 4RQ3A 5L1JA 1A6SA 2YB1A 4DS5A 3FDSA 5CHGA 2HHUA 5DB6A 4NM1A 2P66A 3ISDA 1K1SA 2VA8A 2E1FA 1N5XA 3D2QA 1ZQYA 2W9MA 4RT3A 3LVWA 1RG6A 4J9RA 2FMPA 2YQEA 1U49A 3QU7A 4C4RA 3DEEA 5H2FU 1A0PA 4QZFA 4CE6A 2E5SA 4MFFA 2W03A 2AU0A 4AYBF 4EYIB 1SL1A 3IM1A 4JV0A 1OXJA 2KJ9A 4KLUA 2NRTA 9ICFA 4GXIA 4LJXA 3OPXA 3LYSA 5ALMA 1HUOA 3UQ2A 1KQQA 2F1HA 1ZQPA 4R8UA 2DFLA 1NJZA 1RYUA 1WUDA 2MA1A 1ZQLA 5JU5A 5IINA 4EZ6A 1ZRNA 1LB2B 5HNKA 5HR7A 2B0CA 5ALJA 2W7OA 4NLNA 4C80A 5J2IA 3C1ZA 4NXZA 2F1IA 2IOFA 2QB1A 1NKCA 2BGWA 2HMXA 5AK4A 4F5OA 2LYAA 2W9AA 2E1EA 1ZD3A 2K8AA 5J2GA 4NLGA 4YXJA 2BCQA 3RB0A 3V6HA 5DB7A 4M9JA 1J2NA 5KAIU 3AU2A 4KLOA 2ASJA 3JPTA 4DOAA 1NJXA 4NY8A 1HUZA 3RRGA 2DWQA 3V7LA 1LKYB 3NVVA 2ZUDA 5KT6A 1ZXIA 4KLFA 2ZTCA 5CR0A 3SV4A 4DQSA 2A3VA 2ATLA 7ICOA 2HOIA 5J29A 5ALIA 3UXOA 4C8LA 1AROP 1KN5A 1XS9D 4FE3A 1NZPA 1MA7A 3T5HA 2CXYA 1U48A 4OJLA 3RJEA 1DGJA 5KFFA 5ALZA 2ZIXA 3KD3A 5EE9A 4GXJA 3KHLA 4O3MA 2AQ4A 3MR2A 2HVIA 4JV1A 3M9MB 2XVTA 1RQLA 4KLTA 2PKEA 2D6FC 2AGPA 3JPPA 1EXNA 1BPZA 2NYVA 1U9LA 2BQUA 3D2NA 8ICNA 3AM9A 1ZQMA 3BQ2A 2YMLA 4DFKA 3RAQA 2ZTEA 5KNIA 3TAQA 4BWJA 2VA3A 4I28A 5J8YA 2EAPA 4HAIA 4QZGA 1PK1A 4PHPA 3PMNA 5DG7A 4OJPA 3CP8A 5KFBA 1Z4NA 1XSLA 4UBBA 5DQIA 2ZXIA 3HJEA 1HJPA 4OD0A 4U7CA 4YR2A 5AKEA 2E8PA 3E0FA 1ZQBA 5KFHA 3K75D 3H8WA 4KLSA 3IN5A 5AKKA 3UM9A 4RQNA 3T79A 2Q0ZX 4Y2VA 8ICVA 2ODGA 3EUB2 5ALYA 2ZIVB 5ALEA 1MSWD 5KFIA 2JZBB 2HCFA 3BQTA 4Q44A 1ZQKA 3QUQA 3QXGA 3GV8B 3VCBA 2KTQA 4I2AA 4EBCA 3E2EA 4OCZA 2FLPA 3SMVA 3ZDBA 1V38A 1KBUA 4KLGA 4UB6U 5KFSA 2MAXA 4I27A 1NK6A 4Q43A 1N63A 3CRXA 5KG1A 2JEIA 3OTQA 4ICAA 2O6KA 1N56A 3SAHA 2EZZA 4AYBC 1L3VA 2MRLA 4IRDA 4TUPA 1KTQA 5J2JA 5DB8A 3ZI4A 4C7YA 3AQEA 4OO1J 2ASDA 5DLGA 1X6IA 8ICUA 1TVAA 3WK5A 1SKWA 1RXVA 5KFYA 3FC4A 4PHDA 4FO6A 5L1IA 3G6YA 4B9MA 5ALKA 2OHFA 1BGXT 5AIBA 3HT3A 2G5IB 5J8YC 4ZH4A 9ICEA 4DLEA 4RQ0A 4J9SA 2AH5A 3T5JA 3C28A 4DQRA 4USAA 4Y2XA 4RPZA 4QW9A 4NM2A 3KKAC 1QQ7A 2WF6A 4C8MA 5KT2A 2BR0A 1QQ5A 2IOFK 3GV7B 4IR1A 1ZQXA 4DEZA 2NRZA 3L3FX 2R8HA 3UMCA 4KLEA 2XY7A 3RH5A 5AM2A 4O9MA 1O03A 3HKZF 1SB3C 5D4BA 2H3QA 1UT8A 4I2GA 2J6TA 4M9GA 2XCAA 2W8LA 3BDPA 3D2SA 4EEKA 4R63A 2PI5A 2ZIUB 1XSNA 1D9DA 2Y9TA 2OXOA 5KG7A 2VKQA 4C8KA 4KN4A 2JMGA 4C7ZA 4YR0A 3VC8A 2QB0B 4KLDA 1YZ7A 3ZD9A 4M9NA 4R64A 2IHNA 2HBMA 1QSSA 3Q8PB 3PSIA 9ICAA 2I9GA 4ED1A 4YR3A 2G08A 4TUQA 4FZNA 3MFHA 4DF4A 1BNPA 5DGAA 3RBDA 1RXWA 1SV0C 4F2SA 1QCKA 9ICHA 4UAZA 2AQ0A 2XY6A 3GDXA 2ALZA 3NVYA 1BVSA 1NK0A 1Z4OA 5IIIA 1NJYA 5JRTA 3RR8A 1ZQ1C 4M9HA 4DQIA 4IQWA 1RM6C 4YG2A 8ICOA 1QSLA 5ALNA 4F92B 4O0IA 3TANA 2CN1A 4OJ5A 4QZAA 2F44A 3TADA 4EEYA 2D3DA 3JPQA 2C28A 3ALRA 1ZQQA 4KLMA 1V97A 2I5HA 4R65A 5CJ7A 1Z1VA 5AK6A 4GLXA 4DL3A 5ALFA 4J9QA 2EQYA 1ZQSA 2B21A 3GZFA 4B9SA 1YT3A 2KICA 4M6WB 4DF8A 2P35A 1DOQA 2ZJ5A 4P0QB 5J0UA 4UAYA 3ETRA 1KFSA 2KE7A 4F91B 4ECYA 3V72A 3SYZA 8ICZA 1UA1A 3BQ7A 1LKYA 1D8BA 5KT5A 3BS5B 4ELTA 2WAQF 2Y9UA 2KVCA 5KFLA 4XA5A 2PFNA 2DBYA 1ZQEA 3RRHA 3QX7A 5BOMA 2G07A 2KJ8A 5AKIA 5KT4A 3WKAA 3AQFA 3QEAZ 3RJFA 3HX0A 5J2AA 1X9MA 4F71A 3U26A 4ECUA 4RQ8A 3TI0A 4I2IA 2ES6A 5CB1A 4YP3A 3KFUF 4RUAA 1GO3F 1X66A 1L5UA 1JX4A 3PW5A 4KTQA 5KFXA 3QU4A 3MR3A 4U6PA 3RF9A 4UBCA 3ISCA 5B5EU 2IMWP 1BPYA 2AJQA 2FI1A 5DBAA 1CEZA 3PW2A 4E0DA 3PZPA 1SL0A 7ICTA 3KOOA 2BZFA 3WU2U 4EENA 2RLTA 3GFKB 4RNOA 2DPJA 2BQRA 3LVVA 2KNJA 4RQ7A 5HMMA 3HKZC 4UB3A 5J0XA 2BDUA 7ICJA 1U47A 1XNSA 2XICA 1CI4A 3CYMA 1UA0A 4YMMA 2WB1F 3MFIA 1JALA 1BPBA 4F72A 5KT7A 5CEHA 2WTFA 3PW0A 2W7PA 4UW9A 2G5HB 2ZIVA 3C23A 2ESEA 2JZBA 4OJOA 1UPHA 2KKVA 1COKA 5KG4A 4JWMA 5J0RA 4BWMA 5KL8B 4ECQA 4C0ZA 3SZ2A 4G3IA 4K4GA 1KRPA 7ICLA 2H3ZA 4Y2PA 2NRVA 2FE9A 4QWEA 5DLFA 4RNNA 2MSNA 2XO7A 5IIJA 5KAFU 2H3VA 1ZQFA 3PSFA 2C2RA 4GC6A 3TKAA 3M1YA 4B9UA 2V4RA 5AM3A 4RT2A 2W9CB 3G6XA 3EZ5A 1Q46A 4C8NA 2BCSA 3MDAA 5IIOA 4QWCA 3PSPA 1PVPA 4EZ9A 2FLNA 2VJ4A 2P6RA 1Y88A 5KFVA 4CRXA 2KIVA 5TZVA 3C2KA 3UQ0A 2JEJA 4MHVA 4KX5A 4EX7A 2LYBA 5ALOA 4QWBA 5J0QA 1LV5A 2P6UA 9ICVA 4DO9A 4P4MA 4J9MA 4JV2A 8ICEA 2NO5A 1ZQZA 2K4PA 3C1YA 4KMOB 9ICJA 2OEHA 1MQ2A 2PFPA 3GIMA 3UXPA 4F8RA 3RAXA 2WAQC 1ZRMA 2LI6A 3NASA 5HP4A 4US8A 1S0OA 4F4XA 4K4HA 5DQGA 5J2BA 5AI9A 8ICWA 3H8SA 7ICIA 1WWUA 4A8EA 4O3OA 3H0LB 3ED5A 1URJA 2GO7A 3ZDCA 4J03A 3T3FA 1TK8A 1LVHA 3QUBA 5DBBA 1Z00B 4RU9A 8ICYA 4KLIA 5AKJA 3FAHA 2ZIUA 1X9XA 2DGZA 1L6NA 4KITB 2LYHA 8ICKA 1UT5A 1NKBA 3MDCA 4QNLA 4F5NA 3I28A 3QNMA 4KLJA 4QZIA 4F4KA 2ASLA 3EWAA 3NVZA 4O5CA 2QB0A 3R9KA 4DFDA 2XIDA 3D6JA 4CF5A 4NLZA 2KMDA 2UVVA 2LKYA 2BCRA 1J97A 2I1QA 4I2CA 3EPGA 4DOCA 1XO0A 2PI4A 9ICWA 4PPXA 2KP7A 9ICGA 4IC9A 1VDVA 4ELUA 3Q8LA 4CF4A 4PGQA 5AKHA 3MR6A 4DL6A 5KTQA 5KFJA 3K1RB 2KKPA 5E79U 5G5HA 2WB1C 5J0OA 4MEXA 2XI9A 2IHMA 1JN3A 4C4TA 1AQ6A 5KFRA 8ICXA 1RDFA 2F77X 2YN4A 4O5EA 2QLTA 5DQHA 3LWLA 2YY6A 2HHWA 2HDOA 3L5KA 2RP5A 4GXKA 1N61A 5DG9A 1S5LU 4QZ9A 4M47A 5JUMA 3C5FA 1FIQA
chains in the Genus database with same CATH topology
2EQYA 4LJXA 5K4LA 2JRZA 2RQ5A 1C20A 1KQQA 2EH9A 2OEHA 2LM1A 1RYUA 2YQEA 5CEHA 1KN5A 1KKXA 1IG6A 2KK0A 2LI6A 2CXYA 2JXJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EQY A;  4LJX A;  5K4L A;  2JRZ A;  2RQ5 A;  1C20 A;  1KQQ A;  2EH9 A;  2OEH A;  2LM1 A;  1RYU A;  2YQE A;  5CEH A;  1KN5 A;  1KKX A;  1IG6 A;  2KK0 A;  2LI6 A;  2CXY A;  2JXJ A; 
#chains in the Genus database with same CATH topology
 3HPO A;  3ISB A;  1O08 A;  8ICH A;  1VLB A;  4BGD A;  1F5S A;  3M8R A;  2AHO B;  7ICF A;  1TV9 A;  4M6W A;  1S0N A;  1S0M A;  3QYP A;  5AK5 A;  1BPD A;  2C2D A;  4JWN A;  4P0Q A;  2F8L A;  2FJ6 A;  3M6K A;  1KW4 A;  5J2E A;  3I1Y A;  5J2H A;  1TFR A;  3H4D A;  1U45 A;  4QZE A;  4BXO B;  5KFC A;  4UB8 U;  2HHT A;  3PW4 A;  5CP2 A;  4PJ0 U;  1XSP A;  3BS5 A;  2KFZ A;  4Y2U A;  3F2B A;  3PV8 A;  2K4I A;  4ELV A;  7ICR A;  1C7Y A;  2UVW A;  4F50 A;  5ALP A;  1S8O A;  2FPL A;  4JUZ A;  3V7K A;  4DWI A;  3HIL A;  2R8J A;  3PR4 A;  4F4Y A;  3CW2 C;  2KIW A;  1RZT A;  2W55 A;  5AI4 A;  2D8C A;  3GU3 A;  2Y1I A;  4DL5 A;  2A1J B;  1DGS A;  3RJK A;  8ICT A;  2H3I A;  2ISP A;  3DV9 A;  3A0H U;  5FP0 A;  5A0L A;  3E58 A;  1KLN A;  4PGX A;  5KFW A;  4DOB A;  1WWV A;  5AI8 A;  1N62 A;  3LK9 A;  4F4W A;  5DGB A;  3IG5 A;  3RJI A;  3AMZ A;  3Q8S B;  1SGG A;  2Z7J A;  2ZIW B;  9ICM A;  4F5R A;  2ZG6 A;  5IIK A;  2L5Y A;  4RZR A;  2IA6 A;  3LDA A;  2HVH A;  4EX6 A;  2VA2 A;  2FMS A;  1T7P A;  5L1M A;  3BZC A;  4TUR A;  1JMS A;  4UAT A;  2BPC A;  2KZ3 A;  5J2C A;  8ICL A;  2YMQ A;  3AN1 A;  3AU6 A;  3DDH A;  5ALX A;  3KZI U;  3TAC B;  3KHH A;  4C8O A;  4NWI A;  1TK0 A;  4EYH B;  3TAR A;  5AIC A;  3RB6 A;  5B66 U;  9ICB A;  2FPM A;  4IQT A;  5AI0 A;  2EZX A;  4WJ3 B;  1DK2 A;  2WHE A;  2DQN B;  1MN8 A;  4B9T A;  3PST A;  2IOH A;  3WKD A;  3H40 A;  4BUG A;  3T5K A;  1QSY A;  1SWV A;  1ZET A;  3RJH A;  2ZXH A;  2A1A A;  3WK4 A;  9ICT A;  2EAM A;  4RQM A;  4LVS A;  1NK8 A;  3F5A A;  3IDW A;  1TKD A;  3GII A;  9ICO A;  3SI8 A;  3HW8 A;  4B9L A;  4MF2 A;  1FFV A;  4IQU A;  3PO4 A;  1X2I A;  4DL2 A;  4PHA A;  3GV5 B;  4IR9 A;  2KHV A;  3H7I A;  1BNO A;  1UCV A;  4ED8 A;  4F4Z A;  5CWR A;  3PX4 A;  3WKC A;  5J2D A;  2JR5 A;  2NO4 A;  1JUD A;  1N60 A;  9ICP A;  4PZO A;  5AHX A;  3Q8Q B;  3SEI A;  1B43 A;  4G9B A;  2JGA A;  9ICL A;  5ALT A;  5ALR A;  1Z19 A;  1Z1B A;  2W9C A;  2WF7 A;  2XGP A;  2XGQ A;  2FPK A;  4EEL A;  3NTU A;  3PX6 A;  7ICV A;  1RYR A;  7ICM A;  1V9P A;  4DSE A;  5BOL A;  1SV4 A;  4DSL A;  5ALV A;  4IRC A;  2AXT U;  1TE2 A;  1ZQN A;  4RQ6 A;  5ALQ A;  1ZQA A;  4TUS A;  5KFZ A;  4ECR A;  4O3P A;  1ZOL A;  2V4Q A;  1DXS A;  4Y2R A;  1IM4 A;  2C2E A;  1OUQ A;  2GOL A;  1NNL A;  8ICS A;  4O3R A;  2WF8 A;  1K5O A;  2YB4 A;  3M9O B;  4F93 B;  4QZB A;  7ICG A;  3QUC A;  2LM1 A;  1NJW A;  5AI6 A;  5AKX A;  5F9N A;  2RDJ A;  1X42 A;  4RQ5 A;  4UB5 A;  3H0M B;  3H4B A;  5KFG A;  2Y1J A;  1NZB A;  2K4H A;  3OHB A;  3AL0 B;  4PZN A;  4KLH A;  3AEV A;  3V6J A;  5J0P A;  1Q8K A;  5KFT A;  4XUS A;  1ZYQ A;  4R66 A;  2K8C B;  1Z00 A;  4YVZ A;  3OSP A;  4QWD A;  3H8J A;  3OHA A;  3BJY A;  2XC9 A;  1ZQI A;  2HBJ A;  2HHQ A;  1P7D A;  2W3S A;  2W43 A;  1D8L A;  2EAO A;  4IQV A;  4XRH A;  3BQ1 A;  4NLC A;  5KFE A;  4NL9 A;  2KSO B;  2HOQ A;  3SR6 A;  5KFK A;  4Q8E A;  5DKW A;  4X5V A;  3M9N B;  3A0B U;  4RNM A;  3KZX A;  2HOF A;  1WG8 A;  3NUQ A;  2C22 A;  1WCL A;  5DBC A;  2F76 X;  3JPS A;  2GH1 A;  1BPX A;  9ICU A;  2WF5 A;  5CA7 A;  2KV2 A;  3Q8M A;  3MR5 A;  1ZQR A;  1KEJ A;  1ZJM A;  1Z3E B;  1FO4 A;  2RDI A;  5AM5 A;  3QZ8 A;  2KZM A;  4Z6E A;  2KHQ A;  2OWO A;  3WK9 A;  4ECS A;  5KFD A;  5C5J A;  3PR5 B;  1IIP A;  2EDU A;  4O3Q A;  3THV A;  5KG5 A;  1S9F A;  3TAD C;  2XCP A;  1V85 A;  3RB4 A;  1ZD4 A;  4YCX A;  3F2C A;  3SQI A;  1ZQC A;  4YD2 A;  4DL7 A;  2HSZ A;  4I29 A;  3I76 A;  2YMP A;  3MBY A;  2E8N A;  4I2F A;  7ICE A;  4IRK A;  4UQG A;  4F5Q A;  2M9N A;  1ZD5 A;  3NGD A;  2MUT B;  5KL1 B;  2KK0 A;  2BPG A;  8ICM A;  8ICI A;  7ICP A;  5HML A;  2Y0S F;  4YQW A;  4FS2 A;  3IV6 A;  4J9P A;  3M7D A;  8ICG A;  2RQ5 A;  5DDY A;  1SZP A;  1XC9 A;  3K4G A;  8ICJ A;  2JEF A;  4PL1 A;  2OCE A;  1ECW A;  3V7J A;  3ZDD A;  5EE1 A;  5ALH A;  4BXO A;  4F3O A;  4PH5 A;  1N5W A;  5F9L A;  2W9B B;  2FDR A;  4QIW F;  1RYS A;  4P4O A;  4DQQ A;  2F8K A;  5ALL A;  1L3T A;  4M9L A;  1IV8 A;  5ALG A;  4FZL A;  1L8L A;  4GC7 A;  3T5L A;  2HHS A;  4Y2S A;  3JPO A;  1SXE A;  2A1J A;  1S77 D;  4RUC A;  8ICP A;  3B0X A;  1SKR A;  4Z6C A;  3QEB Z;  3HP6 A;  2ZJ8 A;  3OGU A;  2MU2 A;  4QZH A;  4EBE A;  4P0P B;  2YTU A;  1N48 A;  1NOM A;  2XY5 A;  5IIL A;  4JMU A;  3MAB A;  2CPR A;  9ICN A;  1ZQG A;  4OJ6 A;  1WYG A;  4FBT A;  2ZIW A;  2JEG A;  2JXJ A;  1XWL A;  1F0M A;  4PGY A;  3C2L A;  1JXE A;  1ZQH A;  4FBU A;  4BDP A;  5J0Y A;  3JPR A;  4DLG A;  1C20 A;  5KT3 A;  1YZ6 A;  5KFA A;  5KFQ A;  3WKE A;  5T14 A;  4CNQ A;  1PUZ A;  4P2H A;  4UAR A;  7ICH A;  2DUY A;  1QTM A;  3OSN A;  2RRD A;  4QJF B;  3PW7 A;  4J9N A;  4Q8F A;  2ZJA A;  2EZY A;  4FS1 A;  1PVQ A;  2NRX A;  2PMZ F;  1ZQV A;  1KFT A;  5KG0 A;  1ZQJ A;  2QAR B;  2FLL A;  1L7N A;  4B9V A;  3QUT A;  1ZJN A;  1B22 A;  5EWE A;  5AKZ A;  4DQP A;  3IP4 B;  2HBL A;  4RPY A;  9ICC A;  3RJJ A;  3UMB A;  2JH1 A;  1JRO A;  2HBK A;  3ICX A;  3BZK A;  5TIS U;  2BHN A;  4C4S A;  2LM4 A;  1PK3 A;  4YMO A;  2E8M A;  5ALW A;  1OW5 A;  1JRP A;  3H0R B;  1PVR A;  2K60 A;  2FMQ A;  4DSF A;  4ECX A;  2AGQ A;  1QLN A;  3TAP A;  5C0Y A;  4AP9 A;  2YX8 A;  4RQ2 A;  5KFN A;  2VAN A;  3ZD8 A;  2KFN A;  1KDH A;  4I2H A;  3K1Z A;  5L1L A;  4RQ4 A;  1WCN A;  1T94 A;  2PFO A;  4IL6 U;  4CGZ A;  3LWM A;  1L3U A;  5GTI U;  2GWS A;  1L8O A;  3F2D A;  3RR7 A;  1DK3 A;  4I2J A;  1FFU A;  5EE0 A;  2BCV A;  3NRW A;  2LPE A;  5J0T A;  4YN4 A;  5ALU A;  5AM1 A;  4PHE A;  5AM0 A;  2Y0S C;  2E3T A;  3CNH A;  1N2X A;  5EWG A;  1T8E A;  4XQ8 A;  5KFP A;  1T4G A;  3OJU A;  1KKX A;  4YXM A;  7ICK A;  4KX3 A;  2BCU A;  3QU2 A;  5AKG A;  5J2F A;  1NK7 A;  3KKA A;  1X9W A;  3BS7 A;  3WK7 A;  3EYZ A;  1ZQU A;  4Y2Y A;  2ZUB A;  5J0S A;  1L7O A;  4UAS A;  4RQ1 A;  2R8G A;  2W11 A;  4US9 A;  1COO A;  4JK1 A;  4MEY A;  4QIW C;  8ICF A;  3IG8 A;  3SD7 A;  2IBK A;  3PML A;  1X9S A;  3B9J A;  1VJ5 A;  3M6Z A;  3ZDA A;  4M04 A;  4J9K A;  2H3F A;  2R18 A;  4YD1 A;  3OJS A;  3F53 A;  4ED2 A;  2KN7 A;  1S97 A;  2OM6 A;  3RFA A;  1T3N A;  4TQS A;  1X40 A;  7ICS A;  4KLL A;  4I2D A;  2OYY A;  3UPQ A;  1D9F A;  2KSO A;  3GIJ A;  1BPE A;  4RPX A;  3EW9 A;  3BQ0 A;  3KHG A;  5J2K A;  4NLK A;  2JRZ A;  4NJ8 A;  1B0X A;  4MFC A;  1B4F A;  3FM9 A;  3KBB A;  4QZ8 A;  7ICQ A;  4DS4 A;  3RJG A;  4I2B A;  2G06 A;  2EH9 A;  3N7P D;  1RPL A;  4EBD A;  3PO5 A;  4DFP A;  2HW3 A;  3MC1 A;  3UXN A;  8ICB A;  4JB3 A;  5HHH A;  3H8M A;  5D49 A;  3ZDE A;  1ZQT A;  4ED7 A;  3ORY A;  1HIW A;  1SV0 A;  3MGI A;  4BJQ A;  2Q4T A;  1SXD A;  4IS7 A;  2DF4 B;  4F2R A;  4DSI A;  4K4I A;  3M8S A;  2K89 A;  5ALD A;  4YFK A;  3RBE A;  1T3Q A;  4R8U B;  1UQV A;  2F1J A;  3UMG A;  2PMZ C;  2RHF A;  1JI7 A;  3SAF A;  2G0A A;  3EPI A;  1TAU A;  3N4M B;  2KEY A;  1HEK A;  3RB3 A;  5KFM A;  3WK8 A;  2YMM A;  4YMN A;  2ZUC A;  4KMU A;  4BX9 C;  2F3N A;  1SIJ A;  1A76 A;  3HRD D;  4UB4 A;  4FZM A;  2AGO A;  1S10 A;  3AUO A;  2MUT A;  5EWF A;  4UAW A;  5F3X B;  2VIX A;  3N7S C;  1X6J A;  7ICN A;  1L7M A;  9ICS A;  2KD1 A;  3SV3 A;  1SL2 A;  2DKZ A;  5AM4 A;  3C2M A;  1ZQD A;  2NV3 A;  2UVU A;  2KOB A;  2M0N A;  5GTH U;  3QU9 A;  2PFQ A;  1K1Q A;  2KG5 A;  3PVX A;  4DFJ A;  3TFR A;  2W9B A;  3C21 A;  1Q3U A;  4MFA A;  1CUK A;  3S6J A;  2R8I A;  4KLQ A;  2ZIX B;  4DL4 A;  2W3R A;  5KG6 A;  2G09 A;  4B9N A;  5JTI A;  1IXR A;  2WF9 A;  4GFJ A;  4F5P A;  1D8Y A;  4HYK A;  1H38 A;  5DG8 A;  5EE3 A;  8ICA A;  4Y2J A;  3NRZ A;  1FEZ A;  3Q8K A;  4O3N A;  1S0V A;  3KHR A;  3GIK A;  3SAG A;  8ICR A;  4M0A A;  3B0Y A;  3RTV A;  5ALS A;  1U4B A;  3N7R C;  2NRW A;  2E8O A;  4P0P A;  1MQ3 A;  2KJ5 A;  2BKE A;  4ZOH C;  1JIH A;  3KTQ A;  4CDG A;  2J6S A;  1TAQ A;  1S76 D;  7ICU A;  3IHQ B;  5D46 A;  1IG6 A;  1PK1 B;  3JPN A;  3SEN A;  1F44 A;  1MC8 A;  3N28 A;  1NI3 A;  2HI0 A;  1JXL A;  2HHX A;  2F2A B;  2BQ3 A;  1PZN A;  4O5K A;  2B6G A;  1QQ6 A;  2R8K A;  3C29 A;  5KFU A;  4DSJ A;  4O3S A;  2K4E A;  2KVS A;  2HHV A;  4NLB A;  5KG3 A;  2WFA A;  3TFS A;  2DKX A;  1ZD2 P;  2K8B B;  3IRU A;  8ICQ A;  3WKB A;  2DPI A;  4TQR A;  3MGH A;  4DCC A;  2CRX A;  2W54 A;  4P4P A;  2ISO A;  3HWT A;  2H5X A;  2OH2 A;  3TQ1 A;  4KN7 A;  2QAR A;  3N97 B;  3Q8R B;  4DSK A;  3GQC A;  3QE9 Y;  4ED3 A;  2JHD A;  8ICC A;  3C5G A;  2W04 A;  1ED1 A;  4MF8 A;  3J81 j;  4QZD A;  4Z6D A;  2JH7 A;  1NK9 A;  4GIB A;  3PNC A;  4B6J A;  1SWW A;  5AIA A;  3F5E A;  4QWA A;  5L1K A;  2QKQ A;  2BPF A;  1L7P A;  1NK4 A;  1TK5 A;  2UVR A;  2ZTD A;  1XO1 A;  5EOZ A;  1XU4 A;  1DRG A;  2A19 A;  2DL0 A;  3G6V A;  3ONN A;  1KSP A;  4QW8 A;  2J6U A;  1M6Y A;  1KL9 A;  4UAV A;  9ICQ A;  1SZH A;  3NVW A;  3MGV A;  3PY8 A;  4J9L A;  5K4L A;  4ECV A;  2LHT A;  1RQN A;  1KFD A;  5AK3 A;  4M2Y A;  2I6X A;  1SKS A;  2KZZ A;  4ED0 A;  2N1R A;  3O0F A;  3QU5 A;  1ZQO A;  5IIM A;  4LZG A;  4ACO A;  2EAN A;  5AKL A;  2LBO A;  5BPC A;  4Y2Q A;  3ETL A;  5HR6 A;  3FYH A;  5HHI A;  4UB1 A;  5CRX A;  4ED6 A;  4NV0 A;  4Q45 A;  5AKY A;  4FFD A;  5J0W A;  3GIL A;  4UB2 A;  1UHU A;  4ECT A;  1NK5 A;  4J9O A;  4LZD A;  2GLE A;  2PXI A;  2BDP A;  4ECW A;  4Z6F A;  5KFO A;  4CCH A;  4I2E A;  2LMR A;  3L4P A;  4Y2T A;  1NKE A;  2W8K A;  9ICR A;  4PL2 A;  3V6K A;  2VJ5 A;  3NS1 A;  5KG2 A;  4UAU A;  2JV3 A;  3WK6 A;  4NL9 C;  4CF3 A;  9ICX A;  3RH6 A;  3PX0 A;  4QZC A;  4DFM A;  1ZQW A;  5G5G A;  5L9X A;  5DB9 A;  1L3S A;  3QZ7 A;  1CRX A;  9ICK A;  5AI5 A;  9ICI A;  1QH9 A;  1A77 A;  1J2M A;  5DDM A;  3RH4 A;  1TAM A;  1Q3V A;  2V9W A;  4ECZ A;  4RQ3 A;  5L1J A;  1A6S A;  2YB1 A;  4DS5 A;  3FDS A;  5CHG A;  2HHU A;  5DB6 A;  4NM1 A;  2P66 A;  3ISD A;  1K1S A;  2VA8 A;  2E1F A;  1N5X A;  3D2Q A;  1ZQY A;  2W9M A;  4RT3 A;  3LVW A;  1RG6 A;  4J9R A;  2FMP A;  2YQE A;  1U49 A;  3QU7 A;  4C4R A;  3DEE A;  5H2F U;  1A0P A;  4QZF A;  4CE6 A;  2E5S A;  4MFF A;  2W03 A;  2AU0 A;  4AYB F;  4EYI B;  1SL1 A;  3IM1 A;  4JV0 A;  1OXJ A;  2KJ9 A;  4KLU A;  2NRT A;  9ICF A;  4GXI A;  4LJX A;  3OPX A;  3LYS A;  5ALM A;  1HUO A;  3UQ2 A;  1KQQ A;  2F1H A;  1ZQP A;  4R8U A;  2DFL A;  1NJZ A;  1RYU A;  1WUD A;  2MA1 A;  1ZQL A;  5JU5 A;  5IIN A;  4EZ6 A;  1ZRN A;  1LB2 B;  5HNK A;  5HR7 A;  2B0C A;  5ALJ A;  2W7O A;  4NLN A;  4C80 A;  5J2I A;  3C1Z A;  4NXZ A;  2F1I A;  2IOF A;  2QB1 A;  1NKC A;  2BGW A;  2HMX A;  5AK4 A;  4F5O A;  2LYA A;  2W9A A;  2E1E A;  1ZD3 A;  2K8A A;  5J2G A;  4NLG A;  4YXJ A;  2BCQ A;  3RB0 A;  3V6H A;  5DB7 A;  4M9J A;  1J2N A;  5KAI U;  3AU2 A;  4KLO A;  2ASJ A;  3JPT A;  4DOA A;  1NJX A;  4NY8 A;  1HUZ A;  3RRG A;  2DWQ A;  3V7L A;  1LKY B;  3NVV A;  2ZUD A;  5KT6 A;  1ZXI A;  4KLF A;  2ZTC A;  5CR0 A;  3SV4 A;  4DQS A;  2A3V A;  2ATL A;  7ICO A;  2HOI A;  5J29 A;  5ALI A;  3UXO A;  4C8L A;  1ARO P;  1KN5 A;  1XS9 D;  4FE3 A;  1NZP A;  1MA7 A;  3T5H A;  2CXY A;  1U48 A;  4OJL A;  3RJE A;  1DGJ A;  5KFF A;  5ALZ A;  2ZIX A;  3KD3 A;  5EE9 A;  4GXJ A;  3KHL A;  4O3M A;  2AQ4 A;  3MR2 A;  2HVI A;  4JV1 A;  3M9M B;  2XVT A;  1RQL A;  4KLT A;  2PKE A;  2D6F C;  2AGP A;  3JPP A;  1EXN A;  1BPZ A;  2NYV A;  1U9L A;  2BQU A;  3D2N A;  8ICN A;  3AM9 A;  1ZQM A;  3BQ2 A;  2YML A;  4DFK A;  3RAQ A;  2ZTE A;  5KNI A;  3TAQ A;  4BWJ A;  2VA3 A;  4I28 A;  5J8Y A;  2EAP A;  4HAI A;  4QZG A;  1PK1 A;  4PHP A;  3PMN A;  5DG7 A;  4OJP A;  3CP8 A;  5KFB A;  1Z4N A;  1XSL A;  4UBB A;  5DQI A;  2ZXI A;  3HJE A;  1HJP A;  4OD0 A;  4U7C A;  4YR2 A;  5AKE A;  2E8P A;  3E0F A;  1ZQB A;  5KFH A;  3K75 D;  3H8W A;  4KLS A;  3IN5 A;  5AKK A;  3UM9 A;  4RQN A;  3T79 A;  2Q0Z X;  4Y2V A;  8ICV A;  2ODG A;  3EUB 2;  5ALY A;  2ZIV B;  5ALE A;  1MSW D;  5KFI A;  2JZB B;  2HCF A;  3BQT A;  4Q44 A;  1ZQK A;  3QUQ A;  3QXG A;  3GV8 B;  3VCB A;  2KTQ A;  4I2A A;  4EBC A;  3E2E A;  4OCZ A;  2FLP A;  3SMV A;  3ZDB A;  1V38 A;  1KBU A;  4KLG A;  4UB6 U;  5KFS A;  2MAX A;  4I27 A;  1NK6 A;  4Q43 A;  1N63 A;  3CRX A;  5KG1 A;  2JEI A;  3OTQ A;  4ICA A;  2O6K A;  1N56 A;  3SAH A;  2EZZ A;  4AYB C;  1L3V A;  2MRL A;  4IRD A;  4TUP A;  1KTQ A;  5J2J A;  5DB8 A;  3ZI4 A;  4C7Y A;  3AQE A;  4OO1 J;  2ASD A;  5DLG A;  1X6I A;  8ICU A;  1TVA A;  3WK5 A;  1SKW A;  1RXV A;  5KFY A;  3FC4 A;  4PHD A;  4FO6 A;  5L1I A;  3G6Y A;  4B9M A;  5ALK A;  2OHF A;  1BGX T;  5AIB A;  3HT3 A;  2G5I B;  5J8Y C;  4ZH4 A;  9ICE A;  4DLE A;  4RQ0 A;  4J9S A;  2AH5 A;  3T5J A;  3C28 A;  4DQR A;  4USA A;  4Y2X A;  4RPZ A;  4QW9 A;  4NM2 A;  3KKA C;  1QQ7 A;  2WF6 A;  4C8M A;  5KT2 A;  2BR0 A;  1QQ5 A;  2IOF K;  3GV7 B;  4IR1 A;  1ZQX A;  4DEZ A;  2NRZ A;  3L3F X;  2R8H A;  3UMC A;  4KLE A;  2XY7 A;  3RH5 A;  5AM2 A;  4O9M A;  1O03 A;  3HKZ F;  1SB3 C;  5D4B A;  2H3Q A;  1UT8 A;  4I2G A;  2J6T A;  4M9G A;  2XCA A;  2W8L A;  3BDP A;  3D2S A;  4EEK A;  4R63 A;  2PI5 A;  2ZIU B;  1XSN A;  1D9D A;  2Y9T A;  2OXO A;  5KG7 A;  2VKQ A;  4C8K A;  4KN4 A;  2JMG A;  4C7Z A;  4YR0 A;  3VC8 A;  2QB0 B;  4KLD A;  1YZ7 A;  3ZD9 A;  4M9N A;  4R64 A;  2IHN A;  2HBM A;  1QSS A;  3Q8P B;  3PSI A;  9ICA A;  2I9G A;  4ED1 A;  4YR3 A;  2G08 A;  4TUQ A;  4FZN A;  3MFH A;  4DF4 A;  1BNP A;  5DGA A;  3RBD A;  1RXW A;  1SV0 C;  4F2S A;  1QCK A;  9ICH A;  4UAZ A;  2AQ0 A;  2XY6 A;  3GDX A;  2ALZ A;  3NVY A;  1BVS A;  1NK0 A;  1Z4O A;  5III A;  1NJY A;  5JRT A;  3RR8 A;  1ZQ1 C;  4M9H A;  4DQI A;  4IQW A;  1RM6 C;  4YG2 A;  8ICO A;  1QSL A;  5ALN A;  4F92 B;  4O0I A;  3TAN A;  2CN1 A;  4OJ5 A;  4QZA A;  2F44 A;  3TAD A;  4EEY A;  2D3D A;  3JPQ A;  2C28 A;  3ALR A;  1ZQQ A;  4KLM A;  1V97 A;  2I5H A;  4R65 A;  5CJ7 A;  1Z1V A;  5AK6 A;  4GLX A;  4DL3 A;  5ALF A;  4J9Q A;  2EQY A;  1ZQS A;  2B21 A;  3GZF A;  4B9S A;  1YT3 A;  2KIC A;  4M6W B;  4DF8 A;  2P35 A;  1DOQ A;  2ZJ5 A;  4P0Q B;  5J0U A;  4UAY A;  3ETR A;  1KFS A;  2KE7 A;  4F91 B;  4ECY A;  3V72 A;  3SYZ A;  8ICZ A;  1UA1 A;  3BQ7 A;  1LKY A;  1D8B A;  5KT5 A;  3BS5 B;  4ELT A;  2WAQ F;  2Y9U A;  2KVC A;  5KFL A;  4XA5 A;  2PFN A;  2DBY A;  1ZQE A;  3RRH A;  3QX7 A;  5BOM A;  2G07 A;  2KJ8 A;  5AKI A;  5KT4 A;  3WKA A;  3AQF A;  3QEA Z;  3RJF A;  3HX0 A;  5J2A A;  1X9M A;  4F71 A;  3U26 A;  4ECU A;  4RQ8 A;  3TI0 A;  4I2I A;  2ES6 A;  5CB1 A;  4YP3 A;  3KFU F;  4RUA A;  1GO3 F;  1X66 A;  1L5U A;  1JX4 A;  3PW5 A;  4KTQ A;  5KFX A;  3QU4 A;  3MR3 A;  4U6P A;  3RF9 A;  4UBC A;  3ISC A;  5B5E U;  2IMW P;  1BPY A;  2AJQ A;  2FI1 A;  5DBA A;  1CEZ A;  3PW2 A;  4E0D A;  3PZP A;  1SL0 A;  7ICT A;  3KOO A;  2BZF A;  3WU2 U;  4EEN A;  2RLT A;  3GFK B;  4RNO A;  2DPJ A;  2BQR A;  3LVV A;  2KNJ A;  4RQ7 A;  5HMM A;  3HKZ C;  4UB3 A;  5J0X A;  2BDU A;  7ICJ A;  1U47 A;  1XNS A;  2XIC A;  1CI4 A;  3CYM A;  1UA0 A;  4YMM A;  2WB1 F;  3MFI A;  1JAL A;  1BPB A;  4F72 A;  5KT7 A;  5CEH A;  2WTF A;  3PW0 A;  2W7P A;  4UW9 A;  2G5H B;  2ZIV A;  3C23 A;  2ESE A;  2JZB A;  4OJO A;  1UPH A;  2KKV A;  1COK A;  5KG4 A;  4JWM A;  5J0R A;  4BWM A;  5KL8 B;  4ECQ A;  4C0Z A;  3SZ2 A;  4G3I A;  4K4G A;  1KRP A;  7ICL A;  2H3Z A;  4Y2P A;  2NRV A;  2FE9 A;  4QWE A;  5DLF A;  4RNN A;  2MSN A;  2XO7 A;  5IIJ A;  5KAF U;  2H3V A;  1ZQF A;  3PSF A;  2C2R A;  4GC6 A;  3TKA A;  3M1Y A;  4B9U A;  2V4R A;  5AM3 A;  4RT2 A;  2W9C B;  3G6X A;  3EZ5 A;  1Q46 A;  4C8N A;  2BCS A;  3MDA A;  5IIO A;  4QWC A;  3PSP A;  1PVP A;  4EZ9 A;  2FLN A;  2VJ4 A;  2P6R A;  1Y88 A;  5KFV A;  4CRX A;  2KIV A;  5TZV A;  3C2K A;  3UQ0 A;  2JEJ A;  4MHV A;  4KX5 A;  4EX7 A;  2LYB A;  5ALO A;  4QWB A;  5J0Q A;  1LV5 A;  2P6U A;  9ICV A;  4DO9 A;  4P4M A;  4J9M A;  4JV2 A;  8ICE A;  2NO5 A;  1ZQZ A;  2K4P A;  3C1Y A;  4KMO B;  9ICJ A;  2OEH A;  1MQ2 A;  2PFP A;  3GIM A;  3UXP A;  4F8R A;  3RAX A;  2WAQ C;  1ZRM A;  2LI6 A;  3NAS A;  5HP4 A;  4US8 A;  1S0O A;  4F4X A;  4K4H A;  5DQG A;  5J2B A;  5AI9 A;  8ICW A;  3H8S A;  7ICI A;  1WWU A;  4A8E A;  4O3O A;  3H0L B;  3ED5 A;  1URJ A;  2GO7 A;  3ZDC A;  4J03 A;  3T3F A;  1TK8 A;  1LVH A;  3QUB A;  5DBB A;  1Z00 B;  4RU9 A;  8ICY A;  4KLI A;  5AKJ A;  3FAH A;  2ZIU A;  1X9X A;  2DGZ A;  1L6N A;  4KIT B;  2LYH A;  8ICK A;  1UT5 A;  1NKB A;  3MDC A;  4QNL A;  4F5N A;  3I28 A;  3QNM A;  4KLJ A;  4QZI A;  4F4K A;  2ASL A;  3EWA A;  3NVZ A;  4O5C A;  2QB0 A;  3R9K A;  4DFD A;  2XID A;  3D6J A;  4CF5 A;  4NLZ A;  2KMD A;  2UVV A;  2LKY A;  2BCR A;  1J97 A;  2I1Q A;  4I2C A;  3EPG A;  4DOC A;  1XO0 A;  2PI4 A;  9ICW A;  4PPX A;  2KP7 A;  9ICG A;  4IC9 A;  1VDV A;  4ELU A;  3Q8L A;  4CF4 A;  4PGQ A;  5AKH A;  3MR6 A;  4DL6 A;  5KTQ A;  5KFJ A;  3K1R B;  2KKP A;  5E79 U;  5G5H A;  2WB1 C;  5J0O A;  4MEX A;  2XI9 A;  2IHM A;  1JN3 A;  4C4T A;  1AQ6 A;  5KFR A;  8ICX A;  1RDF A;  2F77 X;  2YN4 A;  4O5E A;  2QLT A;  5DQH A;  3LWL A;  2YY6 A;  2HHW A;  2HDO A;  3L5K A;  2RP5 A;  4GXK A;  1N61 A;  5DG9 A;  1S5L U;  4QZ9 A;  4M47 A;  5JUM A;  3C5F A;  1FIQ A; 
#chains in the Genus database with same CATH homology
 2EQY A;  4LJX A;  5K4L A;  2JRZ A;  2RQ5 A;  1C20 A;  1KQQ A;  2EH9 A;  2OEH A;  2LM1 A;  1RYU A;  2YQE A;  5CEH A;  1KN5 A;  1KKX A;  1IG6 A;  2KK0 A;  2LI6 A;  2CXY A;  2JXJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...