2KK0A

Solution structure of dead ringer-like protein 1 (at-rich interactive domain-containing protein 3a) from homo sapiens, northeast structural genomics consortium (nesg) target hr4394c
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
145
structure length
145
Chain Sequence
MGHHHHHHSHMPDHGDWTYEEQFKQLYELDGDPKRKEFLDDLFSFMQKRGTPVNRIPIMAKQVLDLFMLYVLVTEKGGLVEVINKKLWREITKGLNLPTSITSAAFTLRTQYMKYLYPYECEKRGLSNPNELQAAIDSNRREGRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR structure of the ARID domain of human AT-rich interactive domain-containing protein 3A: a human cancer protein interaction network target.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription regulator
molecule keywords AT-rich interactive domain-containing protein 3A
total genus 35
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 2009-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01388 ARID ARID/BRIGHT DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.60 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 ARID DNA-binding domain 2kk0A01
2EQYA 1KN5A 2RQ5A 2CXYA 4LJXA 2KK0A 5CEHA 5K4LA 1IG6A 2JRZA 2LI6A 2YQEA 1RYUA 1KQQA 1KKXA 2OEHA 1C20A 2JXJA 2LM1A 2EH9A
chains in the Genus database with same CATH superfamily
1SGGA 8ICUA 4YG2A 3T5JA 4EENA 1ZXIA 5KFXA 3Q8QB 4EBDA 3LWMA 3NVZA 5HNKA 9ICPA 1K1SA 5AM2A 1ZQHA 2JV3A 4Y2QA 2KFZA 2NRXA 1DXSA 2M9NA 4ECXA 4P0QB 2KHVA 8ICBA 8ICTA 4FS2A 1YZ7A 2HBLA 3V6JA 4B9MA 2VJ5A 3F2BA 4RQ7A 4M04A 4QNLA 2BZFA 4KLJA 1ZQUA 2WFAA 4LZGA 1XO1A 1HUZA 3NTUA 1SKRA 1SL0A 2ZJAA 1EXNA 4NLGA 4G9BA 2F44A 5ALNA 2W7OA 4ED3A 4RQ8A 4C8NA 4A8EA 5ALIA 4XA5A 3TADC 3FYHA 2KEYA 3F2DA 2KD1A 2G0AA 5ALTA 1MN8A 2JH7A 2W04A 1SZHA 1B43A 2DF4B 5ALQA 2R8GA 3MBYA 2YY6A 3PW4A 4RPXA 4DSLA 1KSPA 2BHNA 1SKSA 4P4PA 1VDVA 2C2DA 1VJ5A 4GC6A 2UVRA 3ALRA 4NV0A 1ZQVA 4RT3A 4R8UA 2JRZA 2IOHA 4ICAA 5J2GA 3NASA 3OPXA 5DB9A 3RH4A 4FBUA 1ED1A 3LYSA 4MEYA 4CE6A 5G5HA 3RJHA 1N63A 3RJFA 5L1LA 4PL1A 1IV8A 4PPXA 1ZQIA 3EZ5A 1TFRA 3PY8A 2ZUDA 2KNJA 3IP4B 3KHRA 1U47A 1ZQZA 2DPIA 2ZIWA 5F3XB 5KG5A 3AEVA 4QW9A 1L7NA 3RR8A 3NS1A 2E8OA 2K4IA 2NYVA 2ZUCA 5KFPA 2EAMA 4M2YA 2QLTA 4O9MA 3QUTA 3KHHA 3H0MB 4ECTA 3ZDEA 2AQ4A 3MFHA 3GDXA 2E8NA 1XWLA 2PFNA 1T94A 1JXEA 5GTHU 1RZTA 4Q8FA 5ALMA 2HHUA 4EEYA 8ICHA 4KLDA 2JEIA 2BPCA 1X40A 1A77A 3N4MB 5J0UA 2XCAA 3UM9A 8ICIA 3ZD8A 3KZIU 5ALXA 1NK4A 1XU4A 2ASJA 4P2HA 2BDPA 1BPBA 5J0SA 8ICGA 4GXIA 4DL2A 2BCUA 4J03A 3PVXA 1NOMA 2DBYA 3RH5A 5IIIA 5HR7A 1LKYA 3Q8KA 3QEBZ 5KG6A 4YVZA 3RR7A 4E0DA 2YMMA 4M9JA 4UQGA 2FPMA 4I2DA 3PSTA 3NUQA 2FLPA 5KTQA 4DEZA 2E8MA 4MHVA 3PX6A 5AI6A 3O0FA 4YMMA 1ZD5A 2XVTA 4YCXA 1ZJNA 4Q8EA 4DSFA 2CPRA 1DRGA 9ICCA 4XQ8A 8ICEA 3F53A 2JR5A 1X42A 3AUOA 3IV6A 1ZQOA 4EX6A 2WAQC 1LV5A 2DL0A 3PW2A 2XCPA 4O5KA 5KT6A 2C2RA 9ICFA 1L7PA 5TISU 5KT2A 4DFDA 4IC9A 2PKEA 5KL8B 3UPQA 2ALZA 8ICCA 4DFMA 3M8RA 2KZZA 1L3SA 3WKBA 2NV3A 4CDGA 3HRDD 4C8OA 2LYAA 5AIAA 5AI0A 5DLGA 1V85A 3QUCA 2OXOA 1AROP 2IA6A 4Y2TA 4CGZA 2A1AA 2KIVA 1KKXA 4US9A 1BPDA 2KICA 2YMQA 4K4GA 1P7DA 4KLLA 1Q8KA 5J2AA 5EE1A 2E3TA 5EOZA 4EZ9A 4K4IA 2J6UA 9ICVA 1ZQFA 2K8CB 1N60A 1ZQNA 8ICJA 2FDRA 1ZQ1C 2Y0SC 5AI5A 4KLMA 4ZH4A 4GXJA 1ECWA 1ZQJA 2EAOA 1T4GA 2ZJ8A 3M6ZA 4EX7A 3IN5A 1F5SA 1COOA 7ICNA 1NKCA 1WWUA 2WF6A 2KK0A 4QZ8A 3PSPA 4BWMA 7ICEA 1ZQTA 3H4BA 3ED5A 1XSLA 4R63A 4JV1A 3SV3A 1CRXA 5L9XA 4HYKA 4DF4A 3RB4A 3GZFA 2F1HA 4RPZA 4RQ1A 5DKWA 5KFNA 5AIBA 4Z6CA 5DQIA 4Y2RA 9ICTA 5K4LA 4F50A 3SR6A 1PVPA 2ESEA 3C29A 2JMGA 3TACB 5D46A 8ICWA 3AU2A 1ZOLA 4LJXA 5AM1A 5DGBA 2ZJ5A 1VLBA 4IRDA 1PVQA 2NRVA 2JZBA 4R64A 4R66A 1FIQA 5KNIA 1Z1BA 3LK9A 4C80A 5G5GA 5AKXA 1NK0A 1QQ5A 3RAQA 4JWNA 5CEHA 1K1QA 3LVVA 5AM0A 1HUOA 5H2FU 9ICHA 2AGQA 5KFDA 3H8MA 2LYBA 2K8BB 4IRKA 2QARB 1L6NA 2BPFA 2LBOA 4RQ3A 1XC9A 3A0BU 4F5RA 4RUCA 2I6XA 3J81j 2GWSA 4KLIA 7ICIA 4AYBF 2W8KA 2MAXA 9ICIA 4IS7A 3SI8A 2IMWP 5CA7A 2H5XA 1UT8A 3MR3A 5FP0A 2H3IA 8ICKA 4ECSA 2J6TA 2D8CA 5DG7A 1S0NA 1ZQEA 1S9FA 2PXIA 4F92B 3PO5A 1NK7A 4I29A 1S8OA 4PGXA 4B9NA 4GXKA 4YFKA 4NLCA 3ISCA 1D9FA 2OEHA 3C5GA 2P6UA 9ICNA 4KLOA 3SENA 3UQ2A 4TUPA 5BOMA 1C20A 3M7DA 1L7MA 1NJYA 2ISPA 4EZ6A 2ATLA 1RG6A 2LHTA 5KFSA 4KLSA 3OSNA 3NVWA 4DQRA 1S77D 3DV9A 4UB5A 5KFQA 2JGAA 3C21A 4GFJA 1IG6A 4YMNA 5KFHA 2IHNA 1PK1A 3PMNA 4DFJA 2FMQA 4Q44A 4M9LA 2A3VA 3QU7A 2AHOB 3CNHA 2L5YA 1KW4A 2FJ6A 4ED8A 5DB8A 1WCNA 5ALVA 5KAIU 4F71A 5J0WA 5J2KA 1KTQA 5ALWA 4HAIA 4NJ8A 1L3VA 2K4EA 3QEAZ 2WHEA 4YR3A 1D8LA 4QWBA 3M6KA 2KV2A 2ASLA 2VJ4A 1ZD4A 5J8YA 4J9LA 2YQEA 5AK6A 1O03A 1NZPA 4O0IA 1MC8A 3MR5A 3HKZC 3H40A 5AM5A 4U6PA 5AKYA 3WK7A 3IHQB 3EUB2 3Q8SB 5DBBA 5J2JA 2KKPA 5KFBA 3D6JA 3Q8LA 2P35A 2RQ5A 1FEZA 1B0XA 2BCVA 1L3UA 4F3OA 2KJ9A 2K4PA 2AXTU 2JZBB 5CB1A 1SXDA 4O5EA 3IRUA 2WB1C 5GTIU 4M0AA 2ZXIA 2NRTA 2VA2A 2ODGA 2F1JA 2E5SA 2FMSA 1OUQA 4DFKA 1Z00A 2HBKA 4OO1J 1XSNA 4RU9A 2CN1A 3TARA 2JEFA 1HJPA 2C28A 4Z6DA 3ONNA 2DQNB 1UQVA 4UATA 1U9LA 1NZBA 5KFJA 4P4OA 4Y2JA 1HEKA 4EYHB 1X6JA 4F4ZA 2HHWA 3C2MA 2FMPA 3MDCA 2KMDA 2F3NA 5BOLA 2G08A 1D8YA 3ZI4A 1RYUA 2F8KA 4KLUA 1TAMA 1SL2A 1C7YA 3V7KA 3HWTA 2YB1A 1V97A 1MA7A 2W8LA 5B66U 4ED7A 3UXNA 3QU9A 3I1YA 3PW0A 1T7PA 2VKQA 3PR5B 2YMLA 4F5NA 1SL1A 4P0PB 4CF4A 3PV8A 4Z6EA 4BWJA 3SAFA 5KG0A 2LM1A 2F8LA 9ICXA 1NJXA 3WK4A 1ZQXA 2ZUBA 5CWRA 1ZRNA 4QIWC 2J6SA 5DB7A 4DOAA 4OD0A 4KLTA 3C28A 3QU2A 1NJZA 4DSEA 2Y9TA 4Y2YA 3D2NA 4TQSA 3PNCA 2HHSA 2XY6A 2OHFA 3DEEA 4OJLA 1F44A 1WG8A 1QSLA 1PZNA 4YQWA 2PFQA 2ZTCA 8ICVA 1NNLA 3M8SA 2HBJA 5KFFA 5AKEA 5AKLA 3RRHA 4F5PA 4KN4A 5AI9A 2RRDA 1XNSA 4I2EA 4F93B 1TK0A 2HOFA 2RDJA 3TADA 1JN3A 4XRHA 3RBDA 4JMUA 1IXRA 7ICMA 4ELTA 3I76A 3H8SA 2PFOA 2PI5A 1B4FA 1ZQSA 4YP3A 4DL3A 4NLZA 3V6HA 2DFLA 3QYPA 1RQLA 2QB1A 1JX4A 4YD1A 5T14A 7ICKA 1MSWD 1TAUA 4DS4A 4P4MA 3C23A 4FO6A 5KFTA 4C8LA 9ICBA 2G5HB 2WTFA 3F5EA 3QX7A 1A0PA 2RLTA 2W9CB 2BKEA 4O3RA 5HP4A 4KLGA 3T79A 2IOFA 4ECYA 1N48A 3Q8MA 2KN7A 2ES6A 1ZQQA 2KFNA 4F2RA 2W7PA 4EBCA 7ICGA 2P6RA 4Y2VA 2OCEA 4PJ0U 2DPJA 2H3VA 4TUQA 4PGQA 1U48A 3QNMA 3AL0B 1OW5A 2F2AB 4QZFA 4PZOA 2ZG6A 1HIWA 4JB3A 1N61A 1O08A 7ICUA 1OXJA 1Z4OA 2BQRA 2ZIUA 3TFRA 1S0MA 2HOIA 4QJFB 4ECZA 5KG2A 1CI4A 4ECVA 3QE9Y 8ICZA 1SB3C 1SV0C 4UASA 3DDHA 1X9WA 3BS5B 4ED0A 2W55A 1BNPA 3V7JA 5IIMA 4DF8A 4YXJA 2Y9UA 5ALLA 3C2LA 4NM1A 3T5LA 1V38A 2OH2A 5D49A 3BQTA 5EE9A 2F77X 1S97A 4O5CA 5ALPA 4KMOB 1ZQKA 2MSNA 4M47A 1UHUA 4FBTA 4MEXA 4R65A 3N7PD 1JUDA 3F2CA 3RBEA 4NY8A 3WKDA 3FAHA 5KFKA 4I2FA 1X6IA 2LKYA 1WWVA 4GIBA 2K8AA 3ICXA 4F8RA 3PSIA 3BQ0A 3ISDA 1IIPA 4ECUA 4DOCA 1S76D 5AICA 3MDAA 3GIJA 2R8KA 4DL4A 1TE2A 2KHQA 4CNQA 5ALJA 1TVAA 4M6WB 2R18A 2HHQA 4KN7A 1KN5A 4QWAA 2HHXA 1S5LU 2W9BA 3K4GA 4KLFA 3BZKA 1N5XA 3RTVA 4KMUA 4TQRA 2HCFA 3QXGA 5J0RA 3NRWA 4QZDA 3HX0A 2HHTA 4UB6U 1UPHA 3AM9A 2DWQA 4KX5A 1NK9A 4RUAA 1X9MA 3T5HA 5KT4A 5CHGA 1ZD2P 3PO4A 2KZMA 4FZMA 7ICOA 3K1ZA 3WK5A 4IR9A 3TI0A 5J2CA 5EE0A 4BJQA 4Q43A 3MC1A 2FLNA 9ICMA 3WK9A 5J0YA 2MU2A 1Z19A 3JPSA 3H8WA 2FPKA 2HSZA 4ZOHC 2ZTEA 4F4YA 3QUBA 3C1ZA 1H38A 1AQ6A 2P66A 4RQ0A 2KZ3A 4F2SA 1JRPA 3IM1A 3HKZF 2AJQA 1N2XA 4QZEA 1RDFA 4OCZA 3N7RC 2OWOA 2NRWA 3AQEA 3L4PA 3PX0A 3G6YA 2GOLA 5JRTA 5AM3A 4F72A 2K4HA 5DG8A 2Q4TA 4Q45A 1KDHA 2V9WA 4I28A 1COKA 1QCKA 2QARA 3MR6A 2G5IB 1D8BA 3E2EA 4MFFA 3ETRA 4DCCA 8ICMA 4B6JA 2E1EA 4UAYA 3ETLA 8ICAA 3GIMA 5ALKA 4PHEA 2A1JA 4RNMA 3WU2U 5J8YC 5KFWA 2CXYA 1ZQBA 4Z6FA 2BDUA 1KBUA 4UARA 2EZXA 1ZQRA 2YTUA 5KT5A 2H3QA 2XICA 2Y0SF 2YMPA 1JIHA 1UA1A 4I27A 4XUSA 2VANA 2H3ZA 4C4RA 9ICJA 3H8JA 5HR6A 4UB8U 1KFTA 2YB4A 4RZRA 1D9DA 3BQ2A 1T3QA 2EANA 4ACOA 5KFCA 4YR2A 4I2CA 1XS9D 1JXLA 3B0YA 3TAQA 3AN1A 5F9LA 2UVVA 3SZ2A 4F91B 1FFVA 1ZQAA 1IM4A 3RAXA 4O3PA 8ICNA 4AYBC 3HJEA 1RXWA 5ALUA 4JV0A 4PL2A 3IG5A 2W43A 5J0PA 1ZQPA 2V4QA 1ZRMA 5TZVA 2XIDA 3TKAA 4JK1A 3H0RB 2FLLA 2GLEA 1ZQCA 2ZIXA 4B9UA 4M6WA 4QWDA 1NI3A 2ZXHA 5J0QA 4KX3A 5DDMA 2DGZA 4C0ZA 2PI4A 1TK5A 2KKVA 2IBKA 1BPXA 1RPLA 4F4XA 3WKEA 2KP7A 3MFIA 4NL9C 2ZIWB 2HVHA 5KFGA 2HOQA 4DSKA 3CP8A 3SEIA 4ELVA 3N28A 4UAUA 4QIWF 5F9NA 3OJUA 4UBBA 4US8A 5CJ7A 3SV4A 4NWIA 2KSOA 3AMZA 2RP5A 3NVVA 2AH5A 1L8LA 5HHHA 4DL5A 2AGOA 5KFMA 2D3DA 2YX8A 3NVYA 5KG1A 2FPLA 4PHDA 5AK5A 1GO3F 4DLGA 2JXJA 7ICQA 4NLKA 2W03A 2MA1A 4IR1A 1ZJMA 5KFZA 2H3FA 3UQ0A 2IHMA 3BZCA 1U4BA 1QTMA 2FE9A 1JALA 3BJYA 1NJWA 4DQQA 9ICSA 3H7IA 5ALEA 3HW8A 4IL6U 3JPRA 4M9NA 3KD3A 1SV0A 1X2IA 4UAVA 4FS1A 3UXOA 5CR0A 3D2SA 2BCQA 4K4HA 1N56A 3RJEA 2KVSA 5KG7A 4F4WA 1NKBA 3EW9A 5ALSA 1KFDA 4EELA 3IG8A 4F4KA 5DQGA 4ECQA 1DOQA 4EBEA 1SXEA 3RRGA 5KFEA 2VIXA 5CRXA 5JU5A 8ICPA 2W11A 1JROA 2JH1A 3SD7A 3ZDBA 4JV2A 2F1IA 2WB1F 4PGYA 4RNNA 1RM6C 7ICSA 2HHVA 4O3MA 4P0PA 1WCLA 2HBMA 1L3TA 1T8EA 3K75D 7ICVA 2W3RA 4ECWA 3GV8B 1QQ6A 4PZNA 2EZYA 3NRZA 5IIKA 3RJGA 4I2AA 5B5EU 1QQ7A 5E79U 5IIOA 4B9VA 1A6SA 3PX4A 3JPPA 1UCVA 1V9PA 2W3SA 4BX9C 1KQQA 4QZBA 2EZZA 3MABA 2KIWA 5JUMA 3V7LA 2KE7A 3OHAA 2KG5A 4J9NA 2W54A 3HPOA 5J2IA 3K1RB 1SV4A 5DDYA 1XSPA 3GU3A 4IQTA 3UXPA 1Y88A 8ICFA 3WKCA 4ECRA 3ORYA 5IIJA 2R8IA 4F5QA 1KRPA 3KBBA 3AU6A 2XY7A 3JPNA 2OYYA 4Y2SA 1RYSA 5KFYA 4FZNA 3L3FX 2XY5A 1DGSA 2Q0ZX 2XGPA 3KZXA 2G06A 2BCSA 4KITB 2HI0A 1L8OA 3MGHA 4O3QA 3EWAA 2W9CA 3PSFA 4GC7A 3H0LB 4LZDA 5ALZA 2LMRA 5J0XA 4OJ5A 2K89A 1S0OA 4DQPA 4EEKA 4GLXA 3JPQA 4I2IA 3SAHA 2ASDA 1K5OA 3GIKA 3ZDDA 4UBCA 1X9SA 4DOBA 3ISBA 3S6JA 2RDIA 5A0LA 4DQIA 5AI8A 1WUDA 4PHAA 4QWCA 5ALGA 4YD2A 7ICFA 3C5FA 2ZIUB 3M9MB 2KTQA 2GO7A 5ALOA 9ICUA 1Q3VA 2FI1A 1QLNA 2BGWA 5EWEA 9ICAA 1TV9A 4ED1A 4J9KA 2I9GA 2XC9A 1S0VA 1J2NA 2WF9A 1LVHA 4J9PA 2WF7A 1UA0A 3MR2A 3QZ7A 4NLNA 2I1QA 1J97A 2PMZF 2ZIVB 4UAZA 3TQ1A 3LWLA 4UB2A 1ZQLA 1SWVA 4KLHA 4FE3A 1QSYA 2R8JA 4AP9A 5IILA 4C4TA 3RB0A 3R9KA 1TKDA 2G09A 2A19A 4DLEA 3T3FA 2XGQA 2ISOA 5DQHA 4I2JA 2BR0A 3PZPA 5DBAA 1UT5A 2UVUA 2Z7JA 1S10A 3H4DA 3QZ8A 4RQ6A 5CP2A 5L1KA 2EAPA 5DBCA 4BXOA 3HP6A 5J2HA 1Q46A 1Z4NA 2E8PA 1TK8A 2CRXA 2R8HA 4QW8A 4YXMA 9ICOA 2LI6A 3D2QA 1URJA 1MQ2A 2W9BB 1KL9A 2V4RA 4QZIA 4C4SA 5HHIA 3KFUF 2GH1A 5AKJA 1NK6A 1XO0A 3LDAA 4MF2A 3EPIA 1ZQMA 3SYZA 4I2HA 4BUGA 2HVIA 2AGPA 3F5AA 5KT7A 3THVA 3Q8PB 4USAA 5AK3A 2LM4A 4BGDA 2KJ5A 2HW3A 3L5KA 2Y1JA 4DSJA 1CUKA 2N1RA 3V6KA 3M9NB 4KLQA 1SWWA 4UB3A 4DFPA 9ICLA 4Y2XA 1BGXT 5AKHA 4J9MA 1L5UA 4RPYA 4NXZA 3RH6A 3SAGA 3RB3A 3GV5B 1NK5A 4DSIA 4C8MA 4O3NA 3NGDA 4P0QA 2LYHA 4KLEA 4FFDA 2QB0B 1X9XA 4MF8A 5AM4A 5J0OA 5J0TA 5C0YA 4I2BA 4M9HA 3OHBA 4TUSA 4C7YA 9ICKA 1PK3A 3PMLA 4DS5A 4J9OA 2WF8A 2OM6A 2EDUA 3BS5A 5L1IA 5KFOA 3C2KA 3WK6A 9ICEA 1F0MA 3OTQA 1Q3UA 2A1JB 4Y2UA 4BDPA 1NKEA 4B9LA 4ED2A 2KVCA 2M0NA 4ELUA 4UB4A 4DWIA 3VC8A 1LB2B 7ICHA 4G3IA 5D4BA 4PH5A 1N62A 1RYRA 3OJSA 2NO4A 5AKKA 3FC4A 5DB6A 1U45A 5ALYA 7ICPA 3TANA 1LKYB 2RHFA 8ICOA 1ZD3A 2VA8A 2EH9A 3RJKA 3GFKB 8ICLA 1PK1B 5KFIA 4R8UB 3IDWA 4J9QA 3C1YA 5J2EA 4QZGA 3N97B 3HT3A 4IQUA 5HMMA 2C22A 4IRCA 4FZLA 4MFCA 3TAPA 4RT2A 1U49A 9ICGA 2W9AA 2HDOA 3QU4A 3PW7A 1J2MA 3AQFA 8ICXA 5C5JA 3CW2C 1DK2A 3RJJA 3WK8A 1ZQWA 3VCBA 4O3SA 4JUZA 2DKZA 2Y1IA 4YR0A 5ALFA 3CRXA 5BPCA 5EWGA 2F76X 3T5KA 1DGJA 2B6GA 5KFAA 2BPGA 5DG9A 2YN4A 3LVWA 2IOFK 4J9SA 5AKGA 5AHXA 2JEJA 4KTQA 5AI4A 3ZD9A 3BQ7A 4UB1A 4UAWA 1ZETA 5L1JA 9ICWA 2ZIXB 1JMSA 1ZQGA 1PVRA 5AKZA 1BPYA 2B0CA 1WYGA 2NO5A 3JPTA 1MQ3A 2XO7A 4J9RA 4RQ2A 2KSOB 1PUZA 2JEGA 3Q8RB 2BQUA 4NM2A 2LPEA 2MUTA 3B9JA 4PHPA 4C8KA 3RB6A 1KFSA 1SZPA 4TURA 2MUTB 1Z1VA 4ED6A 2KOBA 5HMLA 2QKQA 4UW9A 1YT3A 1L7OA 1Z3EB 8ICSA 4DQSA 4JWMA 3GQCA 3KOOA 5KL1B 5ALRA 4MFAA 2KJ8A 2HMXA 2DKXA 3M1YA 3GIIA 2VA3A 2WF5A 4CRXA 5KT3A 3KKAA 1FFUA 3E0FA 5J29A 2PMZC 3BS7A 3EYZA 4NLBA 5KFLA 3FDSA 4F5OA 4DL7A 2JHDA 3OSPA 5ALHA 3CYMA 2QB0A 5AKIA 1X66A 8ICQA 7ICRA 4EYIB 3N7SC 5J2FA 5ALDA 1Z00B 5KG3A 2D6FC 2MRLA 4QZHA 1NK8A 5J2BA 5JTIA 3V72A 3KHLA 7ICTA 2I5HA 1B22A 1RXVA 1JI7A 4CCHA 1CEZA 3PR4A 4QZAA 4NL9A 1SKWA 3A0HU 4QZCA 3MGIA 5DGAA 1DK3A 1ZQDA 4QZ9A 4YMOA 2XI9A 1BPEA 4CF3A 4BXOB 5DLFA 4X5VA 1BNOA 4Y2PA 2B21A 3BDPA 2ZIVA 1QSSA 4U7CA 3M9OB 3SQIA 2NRZA 4B9SA 4O3OA 3ZDAA 2BCRA 4RQNA 1M6YA 1A76A 3U26A 3UMCA 5KFVA 3QUQA 1FO4A 4IQWA 4RQ4A 5KAFU 3MGVA 1ZQYA 4DL6A 2WAQF 2PFPA 3GV7B 3UMGA 3G6VA 2W9MA 5KFUA 4OJ6A 3JPOA 2EQYA 1KLNA 1BVSA 3I28A 3PW5A 2DUYA 9ICQA 3UMBA 4OJOA 1TAQA 1ZYQA 4B9TA 4I2GA 4IQVA 2K60A 3GILA 2O6KA 4QWEA 5AK4A 4RNOA 3RFAA 4RQMA 1RQNA 3RJIA 2BQ3A 3SMVA 4C7ZA 3OGUA 1N5WA 5KG4A 9ICRA 8ICYA 3E58A 3EPGA 1QH9A 3WKAA 2C2EA 2AU0A 1YZ6A 5L1MA 1T3NA 1SIJA 3KTQA 7ICLA 5J2DA 3HILA 3QU5A 2UVWA 1KEJA 3RF9A 5KFRA 1BPZA 2G07A 3TFSA 3BQ1A 2AQ0A 5IINA 4M9GA 5EE3A 4LVSA 4RQ5A 8ICRA 4DO9A 5EWFA 4CF5A 4WJ3B 4YN4A 3KHGA 3G6XA 2ZTDA 2E1FA 3B0XA 4OJPA 7ICJA 3ZDCA 3KKAC 3FM9A
chains in the Genus database with same CATH topology
2EQYA 1KN5A 2RQ5A 2CXYA 4LJXA 2KK0A 5CEHA 5K4LA 1IG6A 2JRZA 2LI6A 2YQEA 1RYUA 1KQQA 1KKXA 2OEHA 1C20A 2JXJA 2LM1A 2EH9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EQY A;  1KN5 A;  2RQ5 A;  2CXY A;  4LJX A;  2KK0 A;  5CEH A;  5K4L A;  1IG6 A;  2JRZ A;  2LI6 A;  2YQE A;  1RYU A;  1KQQ A;  1KKX A;  2OEH A;  1C20 A;  2JXJ A;  2LM1 A;  2EH9 A; 
#chains in the Genus database with same CATH topology
 1SGG A;  8ICU A;  4YG2 A;  3T5J A;  4EEN A;  1ZXI A;  5KFX A;  3Q8Q B;  4EBD A;  3LWM A;  3NVZ A;  5HNK A;  9ICP A;  1K1S A;  5AM2 A;  1ZQH A;  2JV3 A;  4Y2Q A;  2KFZ A;  2NRX A;  1DXS A;  2M9N A;  4ECX A;  4P0Q B;  2KHV A;  8ICB A;  8ICT A;  4FS2 A;  1YZ7 A;  2HBL A;  3V6J A;  4B9M A;  2VJ5 A;  3F2B A;  4RQ7 A;  4M04 A;  4QNL A;  2BZF A;  4KLJ A;  1ZQU A;  2WFA A;  4LZG A;  1XO1 A;  1HUZ A;  3NTU A;  1SKR A;  1SL0 A;  2ZJA A;  1EXN A;  4NLG A;  4G9B A;  2F44 A;  5ALN A;  2W7O A;  4ED3 A;  4RQ8 A;  4C8N A;  4A8E A;  5ALI A;  4XA5 A;  3TAD C;  3FYH A;  2KEY A;  3F2D A;  2KD1 A;  2G0A A;  5ALT A;  1MN8 A;  2JH7 A;  2W04 A;  1SZH A;  1B43 A;  2DF4 B;  5ALQ A;  2R8G A;  3MBY A;  2YY6 A;  3PW4 A;  4RPX A;  4DSL A;  1KSP A;  2BHN A;  1SKS A;  4P4P A;  1VDV A;  2C2D A;  1VJ5 A;  4GC6 A;  2UVR A;  3ALR A;  4NV0 A;  1ZQV A;  4RT3 A;  4R8U A;  2JRZ A;  2IOH A;  4ICA A;  5J2G A;  3NAS A;  3OPX A;  5DB9 A;  3RH4 A;  4FBU A;  1ED1 A;  3LYS A;  4MEY A;  4CE6 A;  5G5H A;  3RJH A;  1N63 A;  3RJF A;  5L1L A;  4PL1 A;  1IV8 A;  4PPX A;  1ZQI A;  3EZ5 A;  1TFR A;  3PY8 A;  2ZUD A;  2KNJ A;  3IP4 B;  3KHR A;  1U47 A;  1ZQZ A;  2DPI A;  2ZIW A;  5F3X B;  5KG5 A;  3AEV A;  4QW9 A;  1L7N A;  3RR8 A;  3NS1 A;  2E8O A;  2K4I A;  2NYV A;  2ZUC A;  5KFP A;  2EAM A;  4M2Y A;  2QLT A;  4O9M A;  3QUT A;  3KHH A;  3H0M B;  4ECT A;  3ZDE A;  2AQ4 A;  3MFH A;  3GDX A;  2E8N A;  1XWL A;  2PFN A;  1T94 A;  1JXE A;  5GTH U;  1RZT A;  4Q8F A;  5ALM A;  2HHU A;  4EEY A;  8ICH A;  4KLD A;  2JEI A;  2BPC A;  1X40 A;  1A77 A;  3N4M B;  5J0U A;  2XCA A;  3UM9 A;  8ICI A;  3ZD8 A;  3KZI U;  5ALX A;  1NK4 A;  1XU4 A;  2ASJ A;  4P2H A;  2BDP A;  1BPB A;  5J0S A;  8ICG A;  4GXI A;  4DL2 A;  2BCU A;  4J03 A;  3PVX A;  1NOM A;  2DBY A;  3RH5 A;  5III A;  5HR7 A;  1LKY A;  3Q8K A;  3QEB Z;  5KG6 A;  4YVZ A;  3RR7 A;  4E0D A;  2YMM A;  4M9J A;  4UQG A;  2FPM A;  4I2D A;  3PST A;  3NUQ A;  2FLP A;  5KTQ A;  4DEZ A;  2E8M A;  4MHV A;  3PX6 A;  5AI6 A;  3O0F A;  4YMM A;  1ZD5 A;  2XVT A;  4YCX A;  1ZJN A;  4Q8E A;  4DSF A;  2CPR A;  1DRG A;  9ICC A;  4XQ8 A;  8ICE A;  3F53 A;  2JR5 A;  1X42 A;  3AUO A;  3IV6 A;  1ZQO A;  4EX6 A;  2WAQ C;  1LV5 A;  2DL0 A;  3PW2 A;  2XCP A;  4O5K A;  5KT6 A;  2C2R A;  9ICF A;  1L7P A;  5TIS U;  5KT2 A;  4DFD A;  4IC9 A;  2PKE A;  5KL8 B;  3UPQ A;  2ALZ A;  8ICC A;  4DFM A;  3M8R A;  2KZZ A;  1L3S A;  3WKB A;  2NV3 A;  4CDG A;  3HRD D;  4C8O A;  2LYA A;  5AIA A;  5AI0 A;  5DLG A;  1V85 A;  3QUC A;  2OXO A;  1ARO P;  2IA6 A;  4Y2T A;  4CGZ A;  2A1A A;  2KIV A;  1KKX A;  4US9 A;  1BPD A;  2KIC A;  2YMQ A;  4K4G A;  1P7D A;  4KLL A;  1Q8K A;  5J2A A;  5EE1 A;  2E3T A;  5EOZ A;  4EZ9 A;  4K4I A;  2J6U A;  9ICV A;  1ZQF A;  2K8C B;  1N60 A;  1ZQN A;  8ICJ A;  2FDR A;  1ZQ1 C;  2Y0S C;  5AI5 A;  4KLM A;  4ZH4 A;  4GXJ A;  1ECW A;  1ZQJ A;  2EAO A;  1T4G A;  2ZJ8 A;  3M6Z A;  4EX7 A;  3IN5 A;  1F5S A;  1COO A;  7ICN A;  1NKC A;  1WWU A;  2WF6 A;  2KK0 A;  4QZ8 A;  3PSP A;  4BWM A;  7ICE A;  1ZQT A;  3H4B A;  3ED5 A;  1XSL A;  4R63 A;  4JV1 A;  3SV3 A;  1CRX A;  5L9X A;  4HYK A;  4DF4 A;  3RB4 A;  3GZF A;  2F1H A;  4RPZ A;  4RQ1 A;  5DKW A;  5KFN A;  5AIB A;  4Z6C A;  5DQI A;  4Y2R A;  9ICT A;  5K4L A;  4F50 A;  3SR6 A;  1PVP A;  2ESE A;  3C29 A;  2JMG A;  3TAC B;  5D46 A;  8ICW A;  3AU2 A;  1ZOL A;  4LJX A;  5AM1 A;  5DGB A;  2ZJ5 A;  1VLB A;  4IRD A;  1PVQ A;  2NRV A;  2JZB A;  4R64 A;  4R66 A;  1FIQ A;  5KNI A;  1Z1B A;  3LK9 A;  4C80 A;  5G5G A;  5AKX A;  1NK0 A;  1QQ5 A;  3RAQ A;  4JWN A;  5CEH A;  1K1Q A;  3LVV A;  5AM0 A;  1HUO A;  5H2F U;  9ICH A;  2AGQ A;  5KFD A;  3H8M A;  2LYB A;  2K8B B;  4IRK A;  2QAR B;  1L6N A;  2BPF A;  2LBO A;  4RQ3 A;  1XC9 A;  3A0B U;  4F5R A;  4RUC A;  2I6X A;  3J81 j;  2GWS A;  4KLI A;  7ICI A;  4AYB F;  2W8K A;  2MAX A;  9ICI A;  4IS7 A;  3SI8 A;  2IMW P;  5CA7 A;  2H5X A;  1UT8 A;  3MR3 A;  5FP0 A;  2H3I A;  8ICK A;  4ECS A;  2J6T A;  2D8C A;  5DG7 A;  1S0N A;  1ZQE A;  1S9F A;  2PXI A;  4F92 B;  3PO5 A;  1NK7 A;  4I29 A;  1S8O A;  4PGX A;  4B9N A;  4GXK A;  4YFK A;  4NLC A;  3ISC A;  1D9F A;  2OEH A;  3C5G A;  2P6U A;  9ICN A;  4KLO A;  3SEN A;  3UQ2 A;  4TUP A;  5BOM A;  1C20 A;  3M7D A;  1L7M A;  1NJY A;  2ISP A;  4EZ6 A;  2ATL A;  1RG6 A;  2LHT A;  5KFS A;  4KLS A;  3OSN A;  3NVW A;  4DQR A;  1S77 D;  3DV9 A;  4UB5 A;  5KFQ A;  2JGA A;  3C21 A;  4GFJ A;  1IG6 A;  4YMN A;  5KFH A;  2IHN A;  1PK1 A;  3PMN A;  4DFJ A;  2FMQ A;  4Q44 A;  4M9L A;  2A3V A;  3QU7 A;  2AHO B;  3CNH A;  2L5Y A;  1KW4 A;  2FJ6 A;  4ED8 A;  5DB8 A;  1WCN A;  5ALV A;  5KAI U;  4F71 A;  5J0W A;  5J2K A;  1KTQ A;  5ALW A;  4HAI A;  4NJ8 A;  1L3V A;  2K4E A;  3QEA Z;  2WHE A;  4YR3 A;  1D8L A;  4QWB A;  3M6K A;  2KV2 A;  2ASL A;  2VJ4 A;  1ZD4 A;  5J8Y A;  4J9L A;  2YQE A;  5AK6 A;  1O03 A;  1NZP A;  4O0I A;  1MC8 A;  3MR5 A;  3HKZ C;  3H40 A;  5AM5 A;  4U6P A;  5AKY A;  3WK7 A;  3IHQ B;  3EUB 2;  3Q8S B;  5DBB A;  5J2J A;  2KKP A;  5KFB A;  3D6J A;  3Q8L A;  2P35 A;  2RQ5 A;  1FEZ A;  1B0X A;  2BCV A;  1L3U A;  4F3O A;  2KJ9 A;  2K4P A;  2AXT U;  2JZB B;  5CB1 A;  1SXD A;  4O5E A;  3IRU A;  2WB1 C;  5GTI U;  4M0A A;  2ZXI A;  2NRT A;  2VA2 A;  2ODG A;  2F1J A;  2E5S A;  2FMS A;  1OUQ A;  4DFK A;  1Z00 A;  2HBK A;  4OO1 J;  1XSN A;  4RU9 A;  2CN1 A;  3TAR A;  2JEF A;  1HJP A;  2C28 A;  4Z6D A;  3ONN A;  2DQN B;  1UQV A;  4UAT A;  1U9L A;  1NZB A;  5KFJ A;  4P4O A;  4Y2J A;  1HEK A;  4EYH B;  1X6J A;  4F4Z A;  2HHW A;  3C2M A;  2FMP A;  3MDC A;  2KMD A;  2F3N A;  5BOL A;  2G08 A;  1D8Y A;  3ZI4 A;  1RYU A;  2F8K A;  4KLU A;  1TAM A;  1SL2 A;  1C7Y A;  3V7K A;  3HWT A;  2YB1 A;  1V97 A;  1MA7 A;  2W8L A;  5B66 U;  4ED7 A;  3UXN A;  3QU9 A;  3I1Y A;  3PW0 A;  1T7P A;  2VKQ A;  3PR5 B;  2YML A;  4F5N A;  1SL1 A;  4P0P B;  4CF4 A;  3PV8 A;  4Z6E A;  4BWJ A;  3SAF A;  5KG0 A;  2LM1 A;  2F8L A;  9ICX A;  1NJX A;  3WK4 A;  1ZQX A;  2ZUB A;  5CWR A;  1ZRN A;  4QIW C;  2J6S A;  5DB7 A;  4DOA A;  4OD0 A;  4KLT A;  3C28 A;  3QU2 A;  1NJZ A;  4DSE A;  2Y9T A;  4Y2Y A;  3D2N A;  4TQS A;  3PNC A;  2HHS A;  2XY6 A;  2OHF A;  3DEE A;  4OJL A;  1F44 A;  1WG8 A;  1QSL A;  1PZN A;  4YQW A;  2PFQ A;  2ZTC A;  8ICV A;  1NNL A;  3M8S A;  2HBJ A;  5KFF A;  5AKE A;  5AKL A;  3RRH A;  4F5P A;  4KN4 A;  5AI9 A;  2RRD A;  1XNS A;  4I2E A;  4F93 B;  1TK0 A;  2HOF A;  2RDJ A;  3TAD A;  1JN3 A;  4XRH A;  3RBD A;  4JMU A;  1IXR A;  7ICM A;  4ELT A;  3I76 A;  3H8S A;  2PFO A;  2PI5 A;  1B4F A;  1ZQS A;  4YP3 A;  4DL3 A;  4NLZ A;  3V6H A;  2DFL A;  3QYP A;  1RQL A;  2QB1 A;  1JX4 A;  4YD1 A;  5T14 A;  7ICK A;  1MSW D;  1TAU A;  4DS4 A;  4P4M A;  3C23 A;  4FO6 A;  5KFT A;  4C8L A;  9ICB A;  2G5H B;  2WTF A;  3F5E A;  3QX7 A;  1A0P A;  2RLT A;  2W9C B;  2BKE A;  4O3R A;  5HP4 A;  4KLG A;  3T79 A;  2IOF A;  4ECY A;  1N48 A;  3Q8M A;  2KN7 A;  2ES6 A;  1ZQQ A;  2KFN A;  4F2R A;  2W7P A;  4EBC A;  7ICG A;  2P6R A;  4Y2V A;  2OCE A;  4PJ0 U;  2DPJ A;  2H3V A;  4TUQ A;  4PGQ A;  1U48 A;  3QNM A;  3AL0 B;  1OW5 A;  2F2A B;  4QZF A;  4PZO A;  2ZG6 A;  1HIW A;  4JB3 A;  1N61 A;  1O08 A;  7ICU A;  1OXJ A;  1Z4O A;  2BQR A;  2ZIU A;  3TFR A;  1S0M A;  2HOI A;  4QJF B;  4ECZ A;  5KG2 A;  1CI4 A;  4ECV A;  3QE9 Y;  8ICZ A;  1SB3 C;  1SV0 C;  4UAS A;  3DDH A;  1X9W A;  3BS5 B;  4ED0 A;  2W55 A;  1BNP A;  3V7J A;  5IIM A;  4DF8 A;  4YXJ A;  2Y9U A;  5ALL A;  3C2L A;  4NM1 A;  3T5L A;  1V38 A;  2OH2 A;  5D49 A;  3BQT A;  5EE9 A;  2F77 X;  1S97 A;  4O5C A;  5ALP A;  4KMO B;  1ZQK A;  2MSN A;  4M47 A;  1UHU A;  4FBT A;  4MEX A;  4R65 A;  3N7P D;  1JUD A;  3F2C A;  3RBE A;  4NY8 A;  3WKD A;  3FAH A;  5KFK A;  4I2F A;  1X6I A;  2LKY A;  1WWV A;  4GIB A;  2K8A A;  3ICX A;  4F8R A;  3PSI A;  3BQ0 A;  3ISD A;  1IIP A;  4ECU A;  4DOC A;  1S76 D;  5AIC A;  3MDA A;  3GIJ A;  2R8K A;  4DL4 A;  1TE2 A;  2KHQ A;  4CNQ A;  5ALJ A;  1TVA A;  4M6W B;  2R18 A;  2HHQ A;  4KN7 A;  1KN5 A;  4QWA A;  2HHX A;  1S5L U;  2W9B A;  3K4G A;  4KLF A;  3BZK A;  1N5X A;  3RTV A;  4KMU A;  4TQR A;  2HCF A;  3QXG A;  5J0R A;  3NRW A;  4QZD A;  3HX0 A;  2HHT A;  4UB6 U;  1UPH A;  3AM9 A;  2DWQ A;  4KX5 A;  1NK9 A;  4RUA A;  1X9M A;  3T5H A;  5KT4 A;  5CHG A;  1ZD2 P;  3PO4 A;  2KZM A;  4FZM A;  7ICO A;  3K1Z A;  3WK5 A;  4IR9 A;  3TI0 A;  5J2C A;  5EE0 A;  4BJQ A;  4Q43 A;  3MC1 A;  2FLN A;  9ICM A;  3WK9 A;  5J0Y A;  2MU2 A;  1Z19 A;  3JPS A;  3H8W A;  2FPK A;  2HSZ A;  4ZOH C;  2ZTE A;  4F4Y A;  3QUB A;  3C1Z A;  1H38 A;  1AQ6 A;  2P66 A;  4RQ0 A;  2KZ3 A;  4F2S A;  1JRP A;  3IM1 A;  3HKZ F;  2AJQ A;  1N2X A;  4QZE A;  1RDF A;  4OCZ A;  3N7R C;  2OWO A;  2NRW A;  3AQE A;  3L4P A;  3PX0 A;  3G6Y A;  2GOL A;  5JRT A;  5AM3 A;  4F72 A;  2K4H A;  5DG8 A;  2Q4T A;  4Q45 A;  1KDH A;  2V9W A;  4I28 A;  1COK A;  1QCK A;  2QAR A;  3MR6 A;  2G5I B;  1D8B A;  3E2E A;  4MFF A;  3ETR A;  4DCC A;  8ICM A;  4B6J A;  2E1E A;  4UAY A;  3ETL A;  8ICA A;  3GIM A;  5ALK A;  4PHE A;  2A1J A;  4RNM A;  3WU2 U;  5J8Y C;  5KFW A;  2CXY A;  1ZQB A;  4Z6F A;  2BDU A;  1KBU A;  4UAR A;  2EZX A;  1ZQR A;  2YTU A;  5KT5 A;  2H3Q A;  2XIC A;  2Y0S F;  2YMP A;  1JIH A;  1UA1 A;  4I27 A;  4XUS A;  2VAN A;  2H3Z A;  4C4R A;  9ICJ A;  3H8J A;  5HR6 A;  4UB8 U;  1KFT A;  2YB4 A;  4RZR A;  1D9D A;  3BQ2 A;  1T3Q A;  2EAN A;  4ACO A;  5KFC A;  4YR2 A;  4I2C A;  1XS9 D;  1JXL A;  3B0Y A;  3TAQ A;  3AN1 A;  5F9L A;  2UVV A;  3SZ2 A;  4F91 B;  1FFV A;  1ZQA A;  1IM4 A;  3RAX A;  4O3P A;  8ICN A;  4AYB C;  3HJE A;  1RXW A;  5ALU A;  4JV0 A;  4PL2 A;  3IG5 A;  2W43 A;  5J0P A;  1ZQP A;  2V4Q A;  1ZRM A;  5TZV A;  2XID A;  3TKA A;  4JK1 A;  3H0R B;  2FLL A;  2GLE A;  1ZQC A;  2ZIX A;  4B9U A;  4M6W A;  4QWD A;  1NI3 A;  2ZXH A;  5J0Q A;  4KX3 A;  5DDM A;  2DGZ A;  4C0Z A;  2PI4 A;  1TK5 A;  2KKV A;  2IBK A;  1BPX A;  1RPL A;  4F4X A;  3WKE A;  2KP7 A;  3MFI A;  4NL9 C;  2ZIW B;  2HVH A;  5KFG A;  2HOQ A;  4DSK A;  3CP8 A;  3SEI A;  4ELV A;  3N28 A;  4UAU A;  4QIW F;  5F9N A;  3OJU A;  4UBB A;  4US8 A;  5CJ7 A;  3SV4 A;  4NWI A;  2KSO A;  3AMZ A;  2RP5 A;  3NVV A;  2AH5 A;  1L8L A;  5HHH A;  4DL5 A;  2AGO A;  5KFM A;  2D3D A;  2YX8 A;  3NVY A;  5KG1 A;  2FPL A;  4PHD A;  5AK5 A;  1GO3 F;  4DLG A;  2JXJ A;  7ICQ A;  4NLK A;  2W03 A;  2MA1 A;  4IR1 A;  1ZJM A;  5KFZ A;  2H3F A;  3UQ0 A;  2IHM A;  3BZC A;  1U4B A;  1QTM A;  2FE9 A;  1JAL A;  3BJY A;  1NJW A;  4DQQ A;  9ICS A;  3H7I A;  5ALE A;  3HW8 A;  4IL6 U;  3JPR A;  4M9N A;  3KD3 A;  1SV0 A;  1X2I A;  4UAV A;  4FS1 A;  3UXO A;  5CR0 A;  3D2S A;  2BCQ A;  4K4H A;  1N56 A;  3RJE A;  2KVS A;  5KG7 A;  4F4W A;  1NKB A;  3EW9 A;  5ALS A;  1KFD A;  4EEL A;  3IG8 A;  4F4K A;  5DQG A;  4ECQ A;  1DOQ A;  4EBE A;  1SXE A;  3RRG A;  5KFE A;  2VIX A;  5CRX A;  5JU5 A;  8ICP A;  2W11 A;  1JRO A;  2JH1 A;  3SD7 A;  3ZDB A;  4JV2 A;  2F1I A;  2WB1 F;  4PGY A;  4RNN A;  1RM6 C;  7ICS A;  2HHV A;  4O3M A;  4P0P A;  1WCL A;  2HBM A;  1L3T A;  1T8E A;  3K75 D;  7ICV A;  2W3R A;  4ECW A;  3GV8 B;  1QQ6 A;  4PZN A;  2EZY A;  3NRZ A;  5IIK A;  3RJG A;  4I2A A;  5B5E U;  1QQ7 A;  5E79 U;  5IIO A;  4B9V A;  1A6S A;  3PX4 A;  3JPP A;  1UCV A;  1V9P A;  2W3S A;  4BX9 C;  1KQQ A;  4QZB A;  2EZZ A;  3MAB A;  2KIW A;  5JUM A;  3V7L A;  2KE7 A;  3OHA A;  2KG5 A;  4J9N A;  2W54 A;  3HPO A;  5J2I A;  3K1R B;  1SV4 A;  5DDY A;  1XSP A;  3GU3 A;  4IQT A;  3UXP A;  1Y88 A;  8ICF A;  3WKC A;  4ECR A;  3ORY A;  5IIJ A;  2R8I A;  4F5Q A;  1KRP A;  3KBB A;  3AU6 A;  2XY7 A;  3JPN A;  2OYY A;  4Y2S A;  1RYS A;  5KFY A;  4FZN A;  3L3F X;  2XY5 A;  1DGS A;  2Q0Z X;  2XGP A;  3KZX A;  2G06 A;  2BCS A;  4KIT B;  2HI0 A;  1L8O A;  3MGH A;  4O3Q A;  3EWA A;  2W9C A;  3PSF A;  4GC7 A;  3H0L B;  4LZD A;  5ALZ A;  2LMR A;  5J0X A;  4OJ5 A;  2K89 A;  1S0O A;  4DQP A;  4EEK A;  4GLX A;  3JPQ A;  4I2I A;  3SAH A;  2ASD A;  1K5O A;  3GIK A;  3ZDD A;  4UBC A;  1X9S A;  4DOB A;  3ISB A;  3S6J A;  2RDI A;  5A0L A;  4DQI A;  5AI8 A;  1WUD A;  4PHA A;  4QWC A;  5ALG A;  4YD2 A;  7ICF A;  3C5F A;  2ZIU B;  3M9M B;  2KTQ A;  2GO7 A;  5ALO A;  9ICU A;  1Q3V A;  2FI1 A;  1QLN A;  2BGW A;  5EWE A;  9ICA A;  1TV9 A;  4ED1 A;  4J9K A;  2I9G A;  2XC9 A;  1S0V A;  1J2N A;  2WF9 A;  1LVH A;  4J9P A;  2WF7 A;  1UA0 A;  3MR2 A;  3QZ7 A;  4NLN A;  2I1Q A;  1J97 A;  2PMZ F;  2ZIV B;  4UAZ A;  3TQ1 A;  3LWL A;  4UB2 A;  1ZQL A;  1SWV A;  4KLH A;  4FE3 A;  1QSY A;  2R8J A;  4AP9 A;  5IIL A;  4C4T A;  3RB0 A;  3R9K A;  1TKD A;  2G09 A;  2A19 A;  4DLE A;  3T3F A;  2XGQ A;  2ISO A;  5DQH A;  4I2J A;  2BR0 A;  3PZP A;  5DBA A;  1UT5 A;  2UVU A;  2Z7J A;  1S10 A;  3H4D A;  3QZ8 A;  4RQ6 A;  5CP2 A;  5L1K A;  2EAP A;  5DBC A;  4BXO A;  3HP6 A;  5J2H A;  1Q46 A;  1Z4N A;  2E8P A;  1TK8 A;  2CRX A;  2R8H A;  4QW8 A;  4YXM A;  9ICO A;  2LI6 A;  3D2Q A;  1URJ A;  1MQ2 A;  2W9B B;  1KL9 A;  2V4R A;  4QZI A;  4C4S A;  5HHI A;  3KFU F;  2GH1 A;  5AKJ A;  1NK6 A;  1XO0 A;  3LDA A;  4MF2 A;  3EPI A;  1ZQM A;  3SYZ A;  4I2H A;  4BUG A;  2HVI A;  2AGP A;  3F5A A;  5KT7 A;  3THV A;  3Q8P B;  4USA A;  5AK3 A;  2LM4 A;  4BGD A;  2KJ5 A;  2HW3 A;  3L5K A;  2Y1J A;  4DSJ A;  1CUK A;  2N1R A;  3V6K A;  3M9N B;  4KLQ A;  1SWW A;  4UB3 A;  4DFP A;  9ICL A;  4Y2X A;  1BGX T;  5AKH A;  4J9M A;  1L5U A;  4RPY A;  4NXZ A;  3RH6 A;  3SAG A;  3RB3 A;  3GV5 B;  1NK5 A;  4DSI A;  4C8M A;  4O3N A;  3NGD A;  4P0Q A;  2LYH A;  4KLE A;  4FFD A;  2QB0 B;  1X9X A;  4MF8 A;  5AM4 A;  5J0O A;  5J0T A;  5C0Y A;  4I2B A;  4M9H A;  3OHB A;  4TUS A;  4C7Y A;  9ICK A;  1PK3 A;  3PML A;  4DS5 A;  4J9O A;  2WF8 A;  2OM6 A;  2EDU A;  3BS5 A;  5L1I A;  5KFO A;  3C2K A;  3WK6 A;  9ICE A;  1F0M A;  3OTQ A;  1Q3U A;  2A1J B;  4Y2U A;  4BDP A;  1NKE A;  4B9L A;  4ED2 A;  2KVC A;  2M0N A;  4ELU A;  4UB4 A;  4DWI A;  3VC8 A;  1LB2 B;  7ICH A;  4G3I A;  5D4B A;  4PH5 A;  1N62 A;  1RYR A;  3OJS A;  2NO4 A;  5AKK A;  3FC4 A;  5DB6 A;  1U45 A;  5ALY A;  7ICP A;  3TAN A;  1LKY B;  2RHF A;  8ICO A;  1ZD3 A;  2VA8 A;  2EH9 A;  3RJK A;  3GFK B;  8ICL A;  1PK1 B;  5KFI A;  4R8U B;  3IDW A;  4J9Q A;  3C1Y A;  5J2E A;  4QZG A;  3N97 B;  3HT3 A;  4IQU A;  5HMM A;  2C22 A;  4IRC A;  4FZL A;  4MFC A;  3TAP A;  4RT2 A;  1U49 A;  9ICG A;  2W9A A;  2HDO A;  3QU4 A;  3PW7 A;  1J2M A;  3AQF A;  8ICX A;  5C5J A;  3CW2 C;  1DK2 A;  3RJJ A;  3WK8 A;  1ZQW A;  3VCB A;  4O3S A;  4JUZ A;  2DKZ A;  2Y1I A;  4YR0 A;  5ALF A;  3CRX A;  5BPC A;  5EWG A;  2F76 X;  3T5K A;  1DGJ A;  2B6G A;  5KFA A;  2BPG A;  5DG9 A;  2YN4 A;  3LVW A;  2IOF K;  4J9S A;  5AKG A;  5AHX A;  2JEJ A;  4KTQ A;  5AI4 A;  3ZD9 A;  3BQ7 A;  4UB1 A;  4UAW A;  1ZET A;  5L1J A;  9ICW A;  2ZIX B;  1JMS A;  1ZQG A;  1PVR A;  5AKZ A;  1BPY A;  2B0C A;  1WYG A;  2NO5 A;  3JPT A;  1MQ3 A;  2XO7 A;  4J9R A;  4RQ2 A;  2KSO B;  1PUZ A;  2JEG A;  3Q8R B;  2BQU A;  4NM2 A;  2LPE A;  2MUT A;  3B9J A;  4PHP A;  4C8K A;  3RB6 A;  1KFS A;  1SZP A;  4TUR A;  2MUT B;  1Z1V A;  4ED6 A;  2KOB A;  5HML A;  2QKQ A;  4UW9 A;  1YT3 A;  1L7O A;  1Z3E B;  8ICS A;  4DQS A;  4JWM A;  3GQC A;  3KOO A;  5KL1 B;  5ALR A;  4MFA A;  2KJ8 A;  2HMX A;  2DKX A;  3M1Y A;  3GII A;  2VA3 A;  2WF5 A;  4CRX A;  5KT3 A;  3KKA A;  1FFU A;  3E0F A;  5J29 A;  2PMZ C;  3BS7 A;  3EYZ A;  4NLB A;  5KFL A;  3FDS A;  4F5O A;  4DL7 A;  2JHD A;  3OSP A;  5ALH A;  3CYM A;  2QB0 A;  5AKI A;  1X66 A;  8ICQ A;  7ICR A;  4EYI B;  3N7S C;  5J2F A;  5ALD A;  1Z00 B;  5KG3 A;  2D6F C;  2MRL A;  4QZH A;  1NK8 A;  5J2B A;  5JTI A;  3V72 A;  3KHL A;  7ICT A;  2I5H A;  1B22 A;  1RXV A;  1JI7 A;  4CCH A;  1CEZ A;  3PR4 A;  4QZA A;  4NL9 A;  1SKW A;  3A0H U;  4QZC A;  3MGI A;  5DGA A;  1DK3 A;  1ZQD A;  4QZ9 A;  4YMO A;  2XI9 A;  1BPE A;  4CF3 A;  4BXO B;  5DLF A;  4X5V A;  1BNO A;  4Y2P A;  2B21 A;  3BDP A;  2ZIV A;  1QSS A;  4U7C A;  3M9O B;  3SQI A;  2NRZ A;  4B9S A;  4O3O A;  3ZDA A;  2BCR A;  4RQN A;  1M6Y A;  1A76 A;  3U26 A;  3UMC A;  5KFV A;  3QUQ A;  1FO4 A;  4IQW A;  4RQ4 A;  5KAF U;  3MGV A;  1ZQY A;  4DL6 A;  2WAQ F;  2PFP A;  3GV7 B;  3UMG A;  3G6V A;  2W9M A;  5KFU A;  4OJ6 A;  3JPO A;  2EQY A;  1KLN A;  1BVS A;  3I28 A;  3PW5 A;  2DUY A;  9ICQ A;  3UMB A;  4OJO A;  1TAQ A;  1ZYQ A;  4B9T A;  4I2G A;  4IQV A;  2K60 A;  3GIL A;  2O6K A;  4QWE A;  5AK4 A;  4RNO A;  3RFA A;  4RQM A;  1RQN A;  3RJI A;  2BQ3 A;  3SMV A;  4C7Z A;  3OGU A;  1N5W A;  5KG4 A;  9ICR A;  8ICY A;  3E58 A;  3EPG A;  1QH9 A;  3WKA A;  2C2E A;  2AU0 A;  1YZ6 A;  5L1M A;  1T3N A;  1SIJ A;  3KTQ A;  7ICL A;  5J2D A;  3HIL A;  3QU5 A;  2UVW A;  1KEJ A;  3RF9 A;  5KFR A;  1BPZ A;  2G07 A;  3TFS A;  3BQ1 A;  2AQ0 A;  5IIN A;  4M9G A;  5EE3 A;  4LVS A;  4RQ5 A;  8ICR A;  4DO9 A;  5EWF A;  4CF5 A;  4WJ3 B;  4YN4 A;  3KHG A;  3G6X A;  2ZTD A;  2E1F A;  3B0X A;  4OJP A;  7ICJ A;  3ZDC A;  3KKA C;  3FM9 A; 
#chains in the Genus database with same CATH homology
 2EQY A;  1KN5 A;  2RQ5 A;  2CXY A;  4LJX A;  2KK0 A;  5CEH A;  5K4L A;  1IG6 A;  2JRZ A;  2LI6 A;  2YQE A;  1RYU A;  1KQQ A;  1KKX A;  2OEH A;  1C20 A;  2JXJ A;  2LM1 A;  2EH9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...