2KK0A

Solution structure of dead ringer-like protein 1 (at-rich interactive domain-containing protein 3a) from homo sapiens, northeast structural genomics consortium (nesg) target hr4394c
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
145
structure length
145
Chain Sequence
b'MGHHHHHHSHMPDHGDWTYEEQFKQLYELDGDPKRKEFLDDLFSFMQKRGTPVNRIPIMAKQVLDLFMLYVLVTEKGGLVEVINKKLWREITKGLNLPTSITSAAFTLRTQYMKYLYPYECEKRGLSNPNELQAAIDSNRREGRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AT-rich interactive domain-containing protein 3A
publication title Solution NMR structure of the ARID domain of human AT-rich interactive domain-containing protein 3A: a human cancer protein interaction network target.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription regulator
total genus 35
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 2009-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01388 ARID ARID/BRIGHT DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.60 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 ARID DNA-binding domain 2kk0A01
2EQYA 5K4LA 2EH9A 5CEHA 1IG6A 2JRZA 1KKXA 2OEHA 1RYUA 2RQ5A 2KK0A 2JXJA 2YQEA 1C20A 1KQQA 4LJXA 2LI6A 2LM1A 2CXYA 1KN5A
chains in the Genus database with same CATH superfamily
2ZJAA 5IIOA 1LV5A 1C7YA 1A6SA 5C0YA 2H3QA 2FE9A 4FFDA 4PL1A 5KT6A 5ALLA 2HHQA 4XA5A 2D8CA 1ZQKA 4CNQA 5AHXA 3JPOA 4J9SA 4OJLA 2OH2A 1HJPA 2A1AA 1ZXIA 1QSSA 1S77D 3GV8B 2W9CA 2HOFA 2LPEA 2LBOA 5ALSA 2KV2A 3VCBA 1D9DA 3WU2U 3D2NA 1NK6A 4FZNA 3N97B 2DPJA 4FO6A 2BDPA 5EE1A 2BCUA 4P4PA 1N48A 1T7PA 2LHTA 3PW0A 4FS1A 4PL2A 2Y1JA 3QUBA 1NK7A 4O3MA 5AK4A 2F8KA 1QH9A 5ALZA 2HSZA 7ICIA 5KFJA 1MC8A 2ES6A 1ZOLA 2XY6A 1SZPA 5IIIA 5C5JA 2BPFA 2NRZA 3C5FA 4UBBA 4K4GA 4F5NA 1SWVA 1ZD4A 4Y2XA 1K5OA 3SR6A 4DFMA 5J8YA 3JPNA 1TAQA 3H8JA 3MR3A 2CXYA 4KLUA 1XSPA 3M9MB 3ZDDA 4MFFA 2RP5A 3V7LA 3F2BA 3RAQA 3K4GA 4DSLA 3LK9A 2K8CB 9ICKA 2HBLA 5DLGA 2GOLA 5KG3A 5DBBA 1Q3UA 3GV7B 4ED3A 4FBUA 3NRZA 8ICAA 3KHGA 2GO7A 2D6FC 4YD2A 2W11A 4YMNA 2WB1F 3NGDA 5KFCA 2ODGA 4KLSA 5AM4A 3AN1A 4KLJA 1UT5A 3MABA 4F5RA 4KLTA 3CW2C 5A0LA 2RQ5A 4RPYA 1NKBA 3HWTA 2G0AA 5TISU 3GZFA 4QZAA 2BCQA 2JEIA 9ICEA 2NRWA 3PW7A 4P0PB 1MN8A 1JALA 1DGSA 4QWBA 4U7CA 4HAIA 4ECVA 2W03A 3BQTA 1BNPA 3RJEA 4NLNA 1LKYA 3WK7A 3IP4B 8ICZA 1ZETA 3NVVA 5ALTA 4EYHB 5AICA 5J0RA 3PSTA 4QWDA 7ICSA 2RRDA 5CRXA 1JRPA 5KG7A 3UQ2A 2HBKA 4B9LA 2G07A 3HP6A 2FMPA 4ECWA 3EPGA 3LVWA 2B0CA 2JV3A 2W04A 4UAUA 4KLLA 3LVVA 7ICUA 3DDHA 1A76A 1UCVA 4YCXA 5DDMA 2WB1C 2ZTEA 1S0NA 2BQRA 1L5UA 2WFAA 3PSFA 8ICTA 3LWLA 4KLOA 3ETLA 5DQHA 5AI8A 2W3RA 5J2GA 4EENA 2ZIUB 5J0TA 3GIJA 4GLXA 3TKAA 4C8NA 2EZYA 8ICSA 1KL9A 4ED0A 2BQUA 1NOMA 1ZQWA 3E2EA 5L1KA 2HVHA 4KITB 3AUOA 4PHAA 5KFKA 4ECZA 4DFPA 4GXKA 4Z6CA 4Q44A 2O6KA 2GH1A 3CYMA 1SV0A 2WF9A 4F72A 2Y1IA 5AM3A 2PFNA 3ZDCA 9ICVA 2D3DA 3K1RB 4K4HA 4Y2VA 3KHRA 4GIBA 3AU2A 1ZD2P 4DOBA 5DQGA 1TE2A 4UAVA 9ICFA 1WUDA 3UMBA 4ECTA 1ZYQA 1B22A 4EBDA 8ICYA 3NTUA 1X9MA 4MEXA 3MR6A 8ICFA 8ICNA 1HIWA 4O9MA 4KTQA 4CF5A 2JEFA 3MGIA 5J2AA 4DSEA 5EE3A 4DQSA 3PSPA 1AQ6A 2ZIXB 4RQ2A 5J0YA 4P2HA 2ALZA 2R18A 4G9BA 4DL5A 4MFCA 3RB0A 2H3FA 4O0IA 4J9OA 4BGDA 5DBAA 5KT7A 1RYUA 3AM9A 4B9SA 2B6GA 4DLGA 4MF2A 3QU7A 1Q46A 5HNKA 1SGGA 4PJ0U 3M8RA 1QSYA 3OSNA 3F53A 4QZBA 3TADC 2F8LA 4M9NA 4LZGA 5AI4A 4I2IA 3GV5B 3RJFA 4CCHA 5KFRA 2K89A 2YB1A 1S0OA 3MFHA 4MF8A 3GILA 2E3TA 2BPGA 4O3PA 2F1HA 2G09A 4NXZA 3H8MA 5AKJA 3N7PD 3RH4A 4E0DA 2C22A 4F4WA 1N5XA 1L7NA 4QWAA 1CEZA 4J9QA 3RR7A 2Y0SC 3DV9A 2KTQA 3BQ2A 3JPPA 8ICLA 3PX6A 2E1EA 1SV4A 4QW9A 1YT3A 5CWRA 9ICSA 1SL0A 3I1YA 4ICAA 3UQ0A 1QCKA 4DFKA 1NI3A 5AM1A 1P7DA 3SV4A 4PGQA 4RQNA 4YXJA 1L8LA 2KZMA 4UAWA 3OJUA 4Q43A 3V7KA 4KLDA 2M9NA 4TUQA 5EE9A 2KZ3A 3TARA 3RJKA 2V4RA 2JGAA 1WCNA 1ZQVA 2K60A 1NK4A 4J9LA 2A1JA 1S0VA 2W8KA 5DGBA 1L3VA 5J0OA 5DB6A 3KOOA 7ICEA 4DSKA 4DOAA 5EWGA 1NJXA 3PNCA 1F5SA 5HP4A 4R63A 1S0MA 1Z00A 3FM9A 5AKEA 3H0MB 4I2DA 1FO4A 9ICPA 2R8IA 4O3QA 3PMNA 4C80A 2ISOA 4KLFA 1WWVA 2ZIWA 3QX7A 3V7JA 2LKYA 2PXIA 4DFDA 2IHNA 2G08A 5KT5A 5KFFA 4M6WA 1SKRA 2BR0A 4QJFB 1IM4A 1D8LA 4TQRA 4Y2TA 1S5LU 1JN3A 1NK5A 2ZJ5A 4MHVA 3Q8PB 2FLPA 3RJIA 3M9OB 5D49A 1U49A 4YFKA 3M6KA 3QE9Y 5J29A 5KG6A 3CNHA 2YTUA 4WJ3B 5KFPA 1WYGA 5ALJA 3SV3A 3NVWA 2FMSA 2R8GA 1S10A 1S76D 1PVQA 4I2GA 5F9LA 5HHHA 4RQ4A 9ICXA 2BQ3A 2F3NA 2AQ4A 1NK0A 1SIJA 5F3XB 3HKZC 1N62A 3BQ7A 4Z6FA 4DEZA 5KFBA 3BDPA 1FIQA 1JUDA 4QWCA 2Q4TA 5AIAA 3V6KA 1Z4OA 4PZNA 1D9FA 4QZGA 4R65A 3MGVA 2Y9UA 1X9WA 3LDAA 1U47A 2KSOB 1H38A 2NRTA 3C29A 3SZ2A 1X9XA 2AU0A 4UW9A 3C2MA 1WWUA 3M8SA 8ICWA 7ICGA 4EYIB 5AM2A 2MSNA 5G5GA 5IINA 1DRGA 3BJYA 8ICHA 3WK8A 3MC1A 4US8A 4GFJA 3D2SA 1Y88A 4NLGA 2UVWA 3HW8A 1SKSA 1OUQA 2DGZA 5ALDA 3J81j 3C21A 4NV0A 1N61A 2WAQC 9ICCA 1IIPA 2EAPA 2I5HA 4PH5A 4UQGA 4YR2A 3B9JA 4B9TA 4ED6A 2PI4A 3TADA 2ZIVB 2DFLA 1ZQAA 1DXSA 4RQ6A 3SAGA 2KKVA 2UVVA 5KT2A 4M9HA 2HVIA 1JIHA 1JXLA 1ZRNA 3H40A 4RNNA 4PGYA 2C2EA 1XO0A 4DQIA 3H0RB 4YR0A 2K4HA 2MUTA 3PO5A 5ALWA 2FDRA 2AH5A 2LM4A 1QTMA 2HHTA 3IDWA 2XVTA 9ICIA 2VANA 5EE0A 5BPCA 3PX0A 3PMLA 1ZQLA 4BXOB 3OHBA 5JU5A 5L1JA 2HHUA 4DS4A 5HHIA 2PKEA 3JPTA 4FBTA 1X66A 2G5IB 3BS5B 2R8KA 2IMWP 1UA0A 3E0FA 3VC8A 5CA7A 4IR1A 5CHGA 2RDIA 3CP8A 1CRXA 5DQIA 1NKEA 5ALNA 1RG6A 2VJ4A 2BCRA 4KX3A 2EZZA 4B9UA 2I9GA 2OHFA 3HX0A 1J2MA 3B0YA 2EH9A 3H0LB 4J9PA 5KG5A 5DDYA 4QW8A 2XICA 4YQWA 2OCEA 4KMOB 5J2KA 2LM1A 4J9RA 4UB4A 2VA8A 3T79A 5KFNA 3KBBA 1Z4NA 1NZPA 2PFOA 4F71A 2BCSA 1XC9A 5TZVA 2EZXA 5AKXA 4GXIA 5CP2A 5AI6A 5BOLA 4FZLA 1RQNA 4TQSA 1OXJA 4C8LA 5KFAA 3UXNA 1ZQNA 5EWFA 2AQ0A 2PMZF 1O03A 3GIIA 2QARA 1IV8A 4UB1A 2ASLA 5HMMA 1L3SA 3MDAA 1K1QA 2MAXA 4O5EA 3KZIU 3WKCA 3PVXA 4KLGA 5BOMA 4CF3A 7ICKA 5AK3A 4C7YA 2KOBA 2W9MA 9ICQA 2CN1A 2HMXA 2W9BA 2GWSA 1AROP 5KT3A 5KFYA 2E5SA 2K4IA 1ZQTA 4DL4A 2ASDA 4DQRA 2AXTU 4RQ8A 3R9KA 1WG8A 1N60A 1ZJNA 5AI9A 8ICUA 4F5OA 2YX8A 5AKLA 8ICEA 4RPZA 5KNIA 4IS7A 1COKA 4RU9A 3LYSA 4GXJA 2XY5A 1BPZA 3PR5B 5CJ7A 4M0AA 8ICGA 3IV6A 5G5HA 4RT3A 4Y2QA 4QZDA 3EYZA 3QEAZ 5AKKA 2OEHA 2NV3A 2FMQA 4DQQA 1TAMA 4FS2A 1UPHA 5L1LA 3KD3A 2P35A 3RR8A 8ICQA 3Q8LA 2FPMA 1RM6C 2MRLA 2AGQA 2PMZC 4OD0A 1XU4A 9ICUA 3AQFA 1X40A 8ICCA 5KFGA 2P66A 3U26A 1SL2A 1N5WA 2RHFA 1FEZA 3A0BU 7ICVA 5KFWA 4O3OA 9ICOA 5F9NA 4UAYA 4YXMA 3ORYA 2R8HA 4RQ1A 2RLTA 1X42A 1QLNA 4PPXA 3UMCA 1ZQMA 3H4DA 5J2IA 1HEKA 1RYRA 4JK1A 1ZQFA 2Z7JA 4BWJA 3ALRA 5ALPA 4DFJA 5KFVA 4IL6U 5KG2A 3F5AA 2W54A 1BNOA 5CEHA 2IA6A 2PFQA 2NO4A 3KKAA 5ALUA 4US9A 4Y2UA 4DQPA 4F93B 5AI5A 4QZ8A 3RRGA 3L3FX 4NY8A 4F91B 1KQQA 4ECUA 2PI5A 5ALHA 4Y2YA 4JV0A 1RPLA 2F2AB 4OJ6A 4O3NA 2JH7A 2YY6A 4MEYA 2OYYA 4EBCA 3PZPA 4CRXA 1X6JA 2MU2A 3QU9A 9ICMA 2W7PA 3SEIA 2BHNA 4QZEA 3OHAA 3HRDD 2K8AA 4QZ9A 2W7OA 5ALQA 4R66A 4I2AA 3G6YA 4Q8EA 5DLFA 1MSWD 2LI6A 3H8SA 8ICXA 5IIKA 2KJ9A 3V6HA 2NO5A 5B5EU 4EELA 2OM6A 5AM0A 2W3SA 2WF7A 3MR5A 4TURA 4ELVA 4P0PA 1IXRA 1ZQZA 1BGXT 4BUGA 1EXNA 1D8YA 3QUTA 1ZQIA 1U45A 2PFPA 1L3UA 2E8OA 1TK8A 3OSPA 5ALXA 4G3IA 1ZD5A 5AKYA 1F0MA 5JRTA 7ICPA 4XQ8A 1BPEA 3Q8QB 2JZBB 3C28A 3I28A 5KFOA 2FLLA 1L8OA 2H5XA 5KFTA 2YMQA 3HILA 2F76X 4KMUA 1QQ7A 2ISPA 4QWEA 2LYBA 5KAIU 3AMZA 1FFUA 4I2EA 2KE7A 4QZIA 4YP3A 1ZQBA 3T5KA 9ICTA 1RYSA 4I2BA 2ZIUA 2FPKA 4F3OA 1ECWA 2WTFA 1J97A 2QB1A 4OJPA 3H7IA 4C8OA 4PZOA 4IRDA 4RUAA 1KDHA 4X5VA 1KLNA 2B21A 2ESEA 1QQ6A 1S8OA 2KJ8A 4KX5A 1ED1A 2HHWA 1X6IA 2OXOA 4QIWF 1TK0A 1NJYA 5L9XA 1TVAA 9ICBA 1DK2A 1A0PA 2F44A 1SXEA 3L5KA 2JEJA 3QUCA 1SL1A 2KMDA 1ZRMA 4IQTA 3NVZA 5DG7A 8ICVA 3IG8A 2LMRA 5KFHA 1ZQEA 2EANA 5ALEA 2KK0A 2W9AA 5AKZA 4F4YA 3PW5A 2IOHA 5DB7A 4LJXA 4UAZA 1KSPA 1FFVA 3QUQA 8ICBA 2J6UA 3UMGA 1SKWA 3IN5A 2UVUA 1T94A 1JXEA 3GFKB 1U4BA 3KHLA 2ZIXA 4UARA 2YMLA 5J2JA 4ED2A 3CRXA 1YZ7A 5KFXA 4P0QB 4Y2PA 2NYVA 4KN7A 1XS9D 4ECQA 3TFSA 4UB5A 3FC4A 2V9WA 2XI9A 3T3FA 3V6JA 4A8EA 3SI8A 1VJ5A 2C2DA 2XC9A 2F1JA 4YG2A 4QZHA 2P6UA 4F4KA 8ICPA 3IRUA 2AHOB 4EX6A 2JXJA 2XGPA 2MA1A 3RB6A 1DOQA 4U6PA 3WK9A 2VJ5A 2WF5A 4IRKA 2F1IA 2KVCA 4RQ5A 4UATA 4NWIA 1PUZA 4RQ7A 2QKQA 4NJ8A 8ICIA 1KW4A 2KIWA 4DSIA 2LYHA 2JR5A 2HBJA 4DL3A 5DB9A 3SD7A 3RB4A 1V97A 2JZBA 3ZDEA 2OWOA 5AKIA 4Q45A 1MQ2A 1SXDA 4LZDA 4OO1J 9ICWA 2DUYA 5DG8A 1N56A 2W43A 3HT3A 5KL8B 5AKHA 3M9NB 4RQ0A 4Y2RA 1Q3VA 1ZQHA 3QZ8A 5KFIA 2F77X 3ONNA 4QZFA 4CDGA 1KFDA 4QZCA 1PZNA 2J6SA 3BQ0A 3L4PA 4NLZA 3ZI4A 2YN4A 1UT8A 1L7OA 3V72A 4DF4A 2V4QA 5KTQA 5D46A 4IC9A 4JWNA 2ZUDA 3D2QA 3HJEA 1L3TA 3KKAC 2IOFA 4J9MA 3FAHA 5J2FA 4JV2A 1SZHA 1HUZA 2A19A 4ELUA 5ALKA 5HR7A 5KG4A 4IQWA 3T5JA 2HI0A 5J0PA 2L5YA 1LKYB 5J0UA 4NL9A 3HPOA 4Y2SA 1F44A 3GDXA 4JV1A 1VLBA 4Q8FA 3IHQB 2FJ6A 4ZOHC 1ZQGA 1DGJA 1KBUA 1KFSA 4YMMA 4XUSA 4FE3A 1XSLA 1UHUA 1NKCA 4IQVA 5IIJA 1TKDA 3F2CA 4UB8U 3RBDA 2NRVA 3PY8A 3ICXA 1ZQPA 7ICOA 2ZG6A 1RXWA 3BZKA 4EEYA 1X9SA 3QU5A 4CE6A 4RNOA 1NJZA 3NASA 4YVZA 4P0QA 2E1FA 2UVRA 1GO3F 4R64A 3NS1A 1CUKA 3ZDAA 4F2SA 4YD1A 3M1YA 2HCFA 2HHSA 4CF4A 4O5CA 1Z1BA 3ZD9A 2JRZA 4ED8A 2KEYA 8ICOA 1ZQDA 3H8WA 2YMPA 3EZ5A 1JMSA 3SQIA 3H4BA 3ETRA 4KN4A 3UPQA 5ALIA 3TANA 4DLEA 3UXOA 4DL7A 2KKPA 2BKEA 4KLEA 4RNMA 4ECSA 4PHEA 2HHVA 4AP9A 1RDFA 3QZ7A 2XIDA 4DF8A 2DKZA 4DSFA 3K75D 3RB3A 3AL0B 2ZUBA 3FYHA 4QNLA 4BX9C 3TFRA 7ICMA 1T4GA 2Y9TA 3FDSA 4TUPA 2KJ5A 2KSOA 1D8BA 3G6XA 3N4MB 1X2IA 2HDOA 2DWQA 4UB3A 4DO9A 4PHPA 3AQEA 4EZ6A 1JI7A 4I28A 5EOZA 4GC6A 1BPDA 2LYAA 3N7SC 2E8PA 4EEKA 2XY7A 4EZ9A 2EAOA 7ICJA 4UASA 1NK8A 1JX4A 2DKXA 3QEBZ 2P6RA 2FPLA 3PW4A 4NLKA 3RBEA 2JMGA 4F50A 3PSIA 4ELTA 4DSJA 2BCVA 2Q0ZX 2BDUA 2JH1A 5AM5A 4AYBF 3LWMA 3C1YA 3EWAA 4I2FA 9ICHA 8ICJA 2ZIVA 2KVSA 1L6NA 1ZQXA 4BDPA 5J0QA 4I29A 3WKEA 2EQYA 4F92B 3SAFA 2VIXA 3C5GA 4ED1A 5J2HA 2AJQA 3OPXA 2C28A 1TAUA 5ALYA 2DPIA 3SAHA 4M9LA 4C8KA 1LVHA 4Z6EA 4HYKA 5IIMA 3ISBA 1YZ6A 1UA1A 9ICLA 5ALVA 1SB3C 4F5QA 2HW3A 3ISCA 5B66U 1XSNA 4UBCA 4I2JA 4ECXA 2KD1A 5IILA 2WF8A 1ZQQA 2I6XA 3AU6A 1Q8KA 4RQ3A 1Z19A 4XRHA 3OJSA 4BXOA 1PK3A 3EUB2 5ALOA 2KHVA 2K4PA 5GTIU 3BS5A 2YQEA 2G5HB 1TK5A 1KFTA 3N7RC 2H3IA 3QYPA 3Q8KA 4UB6U 3GIKA 7ICRA 3QU2A 3MGHA 3EW9A 5KG0A 2HHXA 1XWLA 2ASJA 4DOCA 4AYBC 5L1MA 5AKGA 3T5LA 1B4FA 2ZTDA 2KZZA 3OGUA 2A1JB 4NLCA 4CGZA 1ZQUA 4F8RA 1KRPA 2WHEA 1BPXA 2KP7A 3RF9A 1HUOA 4DCCA 1U9LA 2BPCA 1Z00B 2GLEA 2ATLA 2CPRA 4R8UB 2WF6A 2DL0A 5H2FU 1NZBA 7ICLA 2ZIWB 4OCZA 4OJ5A 5DGAA 2KN7A 3ZD8A 1RZTA 3Q8MA 3RH5A 5DKWA 5JUMA 1LB2B 5KFLA 2KIVA 2AGOA 5AI0A 4RZRA 4M6WB 2JEGA 1WCLA 5EWEA 1BVSA 3WKBA 2KNJA 5T14A 3RRHA 2H3ZA 3QXGA 2Y0SF 3PX4A 1PVPA 4BWMA 4B9VA 4M9JA 5ALGA 4P4OA 3PR4A 2KG5A 3C2LA 4GC7A 3RFAA 1N63A 3JPSA 5KFMA 5KAFU 1TFRA 3BS7A 5AK5A 4ECYA 5DB8A 3PW2A 3TAQA 1U48A 1PK1B 5AIBA 1KTQA 3AEVA 2KICA 5KFSA 4KLIA 1ZQRA 3G6VA 3ZDBA 4IR9A 2BGWA 3TI0A 2R8JA 3UXPA 2VA3A 4YN4A 2K8BB 4LVSA 5L1IA 2IBKA 2HBMA 1JROA 1BPBA 4NL9C 4P4MA 2IHMA 3O0FA 3PO4A 5ALMA 4NM1A 2IOFK 2DQNB 2JHDA 4JMUA 3Q8RB 4C4SA 7ICFA 4M2YA 4B6JA 4I27A 3DEEA 5CR0A 5KFEA 5AK6A 2XCPA 3EPIA 4B9NA 1S9FA 1KEJA 5HMLA 1ZQSA 4RT2A 4C4RA 1C20A 1TV9A 1ZQCA 1QQ5A 1SWWA 5J2CA 3E58A 2CRXA 1M6YA 4RUCA 3S6JA 7ICNA 5JTIA 5CB1A 4M04A 3ED5A 5E79U 4C8MA 1KKXA 3MFIA 3KHHA 9ICGA 2H3VA 4DL2A 3BZCA 4USAA 3ISDA 1UQVA 2QB0B 1B0XA 3RH6A 4M47A 3OTQA 3NUQA 2FLNA 1Z1VA 2FI1A 4C7ZA 4DS5A 2BZFA 4RPXA 4Y2JA 2QLTA 1ZQOA 4DWIA 4RQMA 2HOQA 3KZXA 9ICNA 4JWMA 4KLQA 7ICHA 1URJA 1NK9A 2RDJA 3RJGA 8ICKA 1OW5A 2KFNA 2YB4A 1B43A 5J0WA 3BQ1A 4YR3A 3IM1A 4KLHA 5J0XA 4J03A 5J8YC 1IG6A 1L7MA 3NRWA 2VKQA 4JUZA 3GIMA 2M0NA 4NLBA 4R8UA 4O3RA 4ZH4A 1A77A 2ZJ8A 2VA2A 1VDVA 3HKZF 2W8LA 1N2XA 1J2NA 2C2RA 1CI4A 4BJQA 2XO7A 3SMVA 4MFAA 4I2CA 2DF4B 5KT4A 4UB2A 4F4XA 5DG9A 2MUTB 3WK4A 1DK3A 2NRXA 5K4LA 1V85A 8ICMA 2K4EA 3GU3A 4OJOA 1PVRA 2EDUA 1V38A 1T8EA 1ZD3A 1NNLA 9ICRA 5J0SA 1T3NA 4EBEA 2ZTCA 3C23A 4FZMA 3M6ZA 1XNSA 4KLMA 4TUSA 4F2RA 2W9CB 3SENA 2YMMA 5J2BA 7ICQA 1PK1A 1XO1A 3THVA 1ZQYA 4ACOA 4K4IA 4NM2A 9ICAA 1BPYA 1ZJMA 1L7PA 5D4BA 3NVYA 3RAXA 4YMOA 4QIWC 4IQUA 5J2EA 3TQ1A 4C0ZA 2AGPA 1V9PA 4EX7A 4ED7A 4C4TA 3F5EA 2ZXIA 2WAQF 1COOA 4O5KA 3QU4A 3F2DA 4DL6A 2E8MA 3RJHA 3M7DA 3JPRA 3JPQA 4J9KA 5KL1B 8ICRA 3QNMA 3GQCA 5ALFA 2DBYA 1MQ3A 3T5HA 1ZQJA 3C2KA 2XCAA 4I2HA 1T3QA 4IRCA 3KFUF 3MBYA 2E8NA 3MDCA 3Q8SB 1K1SA 1QSLA 1Z3EB 5HR6A 4JB3A 3TAPA 1NJWA 4J9NA 5KG1A 3SYZA 4PGXA 2QARB 3RTVA 4M9GA 2QB0A 3I76A 5FP0A 3C1ZA 5KFDA 2XGQA 9ICJA 4O3SA 5DBCA 2W55A 5J2DA 3WK6A 3K1ZA 1MA7A 4B9MA 2W9BB 2I1QA 2A3VA 4Z6DA 3KTQA 4F4ZA 1RQLA 1SV0C 3TACB 5ALRA 3PV8A 3A0HU 5KFZA 3WKDA 4PHDA 1KN5A 3WK5A 2EAMA 2J6TA 2KFZA 2ZUCA 3WKAA 2N1RA 2G06A 2KHQA 3N28A 3D6JA 3RJJA 2HOIA 5GTHU 1RXVA 1O08A 4F5PA 3MR2A 2ZXHA 7ICTA 5KFQA 1S97A 1ZQ1C 3UM9A 5KFUA 3IG5A 3B0XA 4ECRA
chains in the Genus database with same CATH topology
2EQYA 5K4LA 2EH9A 5CEHA 1IG6A 2JRZA 1KKXA 2OEHA 1RYUA 2RQ5A 2KK0A 2JXJA 2YQEA 1C20A 1KQQA 4LJXA 2LI6A 2LM1A 2CXYA 1KN5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EQY A;  5K4L A;  2EH9 A;  5CEH A;  1IG6 A;  2JRZ A;  1KKX A;  2OEH A;  1RYU A;  2RQ5 A;  2KK0 A;  2JXJ A;  2YQE A;  1C20 A;  1KQQ A;  4LJX A;  2LI6 A;  2LM1 A;  2CXY A;  1KN5 A; 
#chains in the Genus database with same CATH topology
 2ZJA A;  5IIO A;  1LV5 A;  1C7Y A;  1A6S A;  5C0Y A;  2H3Q A;  2FE9 A;  4FFD A;  4PL1 A;  5KT6 A;  5ALL A;  2HHQ A;  4XA5 A;  2D8C A;  1ZQK A;  4CNQ A;  5AHX A;  3JPO A;  4J9S A;  4OJL A;  2OH2 A;  1HJP A;  2A1A A;  1ZXI A;  1QSS A;  1S77 D;  3GV8 B;  2W9C A;  2HOF A;  2LPE A;  2LBO A;  5ALS A;  2KV2 A;  3VCB A;  1D9D A;  3WU2 U;  3D2N A;  1NK6 A;  4FZN A;  3N97 B;  2DPJ A;  4FO6 A;  2BDP A;  5EE1 A;  2BCU A;  4P4P A;  1N48 A;  1T7P A;  2LHT A;  3PW0 A;  4FS1 A;  4PL2 A;  2Y1J A;  3QUB A;  1NK7 A;  4O3M A;  5AK4 A;  2F8K A;  1QH9 A;  5ALZ A;  2HSZ A;  7ICI A;  5KFJ A;  1MC8 A;  2ES6 A;  1ZOL A;  2XY6 A;  1SZP A;  5III A;  5C5J A;  2BPF A;  2NRZ A;  3C5F A;  4UBB A;  4K4G A;  4F5N A;  1SWV A;  1ZD4 A;  4Y2X A;  1K5O A;  3SR6 A;  4DFM A;  5J8Y A;  3JPN A;  1TAQ A;  3H8J A;  3MR3 A;  2CXY A;  4KLU A;  1XSP A;  3M9M B;  3ZDD A;  4MFF A;  2RP5 A;  3V7L A;  3F2B A;  3RAQ A;  3K4G A;  4DSL A;  3LK9 A;  2K8C B;  9ICK A;  2HBL A;  5DLG A;  2GOL A;  5KG3 A;  5DBB A;  1Q3U A;  3GV7 B;  4ED3 A;  4FBU A;  3NRZ A;  8ICA A;  3KHG A;  2GO7 A;  2D6F C;  4YD2 A;  2W11 A;  4YMN A;  2WB1 F;  3NGD A;  5KFC A;  2ODG A;  4KLS A;  5AM4 A;  3AN1 A;  4KLJ A;  1UT5 A;  3MAB A;  4F5R A;  4KLT A;  3CW2 C;  5A0L A;  2RQ5 A;  4RPY A;  1NKB A;  3HWT A;  2G0A A;  5TIS U;  3GZF A;  4QZA A;  2BCQ A;  2JEI A;  9ICE A;  2NRW A;  3PW7 A;  4P0P B;  1MN8 A;  1JAL A;  1DGS A;  4QWB A;  4U7C A;  4HAI A;  4ECV A;  2W03 A;  3BQT A;  1BNP A;  3RJE A;  4NLN A;  1LKY A;  3WK7 A;  3IP4 B;  8ICZ A;  1ZET A;  3NVV A;  5ALT A;  4EYH B;  5AIC A;  5J0R A;  3PST A;  4QWD A;  7ICS A;  2RRD A;  5CRX A;  1JRP A;  5KG7 A;  3UQ2 A;  2HBK A;  4B9L A;  2G07 A;  3HP6 A;  2FMP A;  4ECW A;  3EPG A;  3LVW A;  2B0C A;  2JV3 A;  2W04 A;  4UAU A;  4KLL A;  3LVV A;  7ICU A;  3DDH A;  1A76 A;  1UCV A;  4YCX A;  5DDM A;  2WB1 C;  2ZTE A;  1S0N A;  2BQR A;  1L5U A;  2WFA A;  3PSF A;  8ICT A;  3LWL A;  4KLO A;  3ETL A;  5DQH A;  5AI8 A;  2W3R A;  5J2G A;  4EEN A;  2ZIU B;  5J0T A;  3GIJ A;  4GLX A;  3TKA A;  4C8N A;  2EZY A;  8ICS A;  1KL9 A;  4ED0 A;  2BQU A;  1NOM A;  1ZQW A;  3E2E A;  5L1K A;  2HVH A;  4KIT B;  3AUO A;  4PHA A;  5KFK A;  4ECZ A;  4DFP A;  4GXK A;  4Z6C A;  4Q44 A;  2O6K A;  2GH1 A;  3CYM A;  1SV0 A;  2WF9 A;  4F72 A;  2Y1I A;  5AM3 A;  2PFN A;  3ZDC A;  9ICV A;  2D3D A;  3K1R B;  4K4H A;  4Y2V A;  3KHR A;  4GIB A;  3AU2 A;  1ZD2 P;  4DOB A;  5DQG A;  1TE2 A;  4UAV A;  9ICF A;  1WUD A;  3UMB A;  4ECT A;  1ZYQ A;  1B22 A;  4EBD A;  8ICY A;  3NTU A;  1X9M A;  4MEX A;  3MR6 A;  8ICF A;  8ICN A;  1HIW A;  4O9M A;  4KTQ A;  4CF5 A;  2JEF A;  3MGI A;  5J2A A;  4DSE A;  5EE3 A;  4DQS A;  3PSP A;  1AQ6 A;  2ZIX B;  4RQ2 A;  5J0Y A;  4P2H A;  2ALZ A;  2R18 A;  4G9B A;  4DL5 A;  4MFC A;  3RB0 A;  2H3F A;  4O0I A;  4J9O A;  4BGD A;  5DBA A;  5KT7 A;  1RYU A;  3AM9 A;  4B9S A;  2B6G A;  4DLG A;  4MF2 A;  3QU7 A;  1Q46 A;  5HNK A;  1SGG A;  4PJ0 U;  3M8R A;  1QSY A;  3OSN A;  3F53 A;  4QZB A;  3TAD C;  2F8L A;  4M9N A;  4LZG A;  5AI4 A;  4I2I A;  3GV5 B;  3RJF A;  4CCH A;  5KFR A;  2K89 A;  2YB1 A;  1S0O A;  3MFH A;  4MF8 A;  3GIL A;  2E3T A;  2BPG A;  4O3P A;  2F1H A;  2G09 A;  4NXZ A;  3H8M A;  5AKJ A;  3N7P D;  3RH4 A;  4E0D A;  2C22 A;  4F4W A;  1N5X A;  1L7N A;  4QWA A;  1CEZ A;  4J9Q A;  3RR7 A;  2Y0S C;  3DV9 A;  2KTQ A;  3BQ2 A;  3JPP A;  8ICL A;  3PX6 A;  2E1E A;  1SV4 A;  4QW9 A;  1YT3 A;  5CWR A;  9ICS A;  1SL0 A;  3I1Y A;  4ICA A;  3UQ0 A;  1QCK A;  4DFK A;  1NI3 A;  5AM1 A;  1P7D A;  3SV4 A;  4PGQ A;  4RQN A;  4YXJ A;  1L8L A;  2KZM A;  4UAW A;  3OJU A;  4Q43 A;  3V7K A;  4KLD A;  2M9N A;  4TUQ A;  5EE9 A;  2KZ3 A;  3TAR A;  3RJK A;  2V4R A;  2JGA A;  1WCN A;  1ZQV A;  2K60 A;  1NK4 A;  4J9L A;  2A1J A;  1S0V A;  2W8K A;  5DGB A;  1L3V A;  5J0O A;  5DB6 A;  3KOO A;  7ICE A;  4DSK A;  4DOA A;  5EWG A;  1NJX A;  3PNC A;  1F5S A;  5HP4 A;  4R63 A;  1S0M A;  1Z00 A;  3FM9 A;  5AKE A;  3H0M B;  4I2D A;  1FO4 A;  9ICP A;  2R8I A;  4O3Q A;  3PMN A;  4C80 A;  2ISO A;  4KLF A;  1WWV A;  2ZIW A;  3QX7 A;  3V7J A;  2LKY A;  2PXI A;  4DFD A;  2IHN A;  2G08 A;  5KT5 A;  5KFF A;  4M6W A;  1SKR A;  2BR0 A;  4QJF B;  1IM4 A;  1D8L A;  4TQR A;  4Y2T A;  1S5L U;  1JN3 A;  1NK5 A;  2ZJ5 A;  4MHV A;  3Q8P B;  2FLP A;  3RJI A;  3M9O B;  5D49 A;  1U49 A;  4YFK A;  3M6K A;  3QE9 Y;  5J29 A;  5KG6 A;  3CNH A;  2YTU A;  4WJ3 B;  5KFP A;  1WYG A;  5ALJ A;  3SV3 A;  3NVW A;  2FMS A;  2R8G A;  1S10 A;  1S76 D;  1PVQ A;  4I2G A;  5F9L A;  5HHH A;  4RQ4 A;  9ICX A;  2BQ3 A;  2F3N A;  2AQ4 A;  1NK0 A;  1SIJ A;  5F3X B;  3HKZ C;  1N62 A;  3BQ7 A;  4Z6F A;  4DEZ A;  5KFB A;  3BDP A;  1FIQ A;  1JUD A;  4QWC A;  2Q4T A;  5AIA A;  3V6K A;  1Z4O A;  4PZN A;  1D9F A;  4QZG A;  4R65 A;  3MGV A;  2Y9U A;  1X9W A;  3LDA A;  1U47 A;  2KSO B;  1H38 A;  2NRT A;  3C29 A;  3SZ2 A;  1X9X A;  2AU0 A;  4UW9 A;  3C2M A;  1WWU A;  3M8S A;  8ICW A;  7ICG A;  4EYI B;  5AM2 A;  2MSN A;  5G5G A;  5IIN A;  1DRG A;  3BJY A;  8ICH A;  3WK8 A;  3MC1 A;  4US8 A;  4GFJ A;  3D2S A;  1Y88 A;  4NLG A;  2UVW A;  3HW8 A;  1SKS A;  1OUQ A;  2DGZ A;  5ALD A;  3J81 j;  3C21 A;  4NV0 A;  1N61 A;  2WAQ C;  9ICC A;  1IIP A;  2EAP A;  2I5H A;  4PH5 A;  4UQG A;  4YR2 A;  3B9J A;  4B9T A;  4ED6 A;  2PI4 A;  3TAD A;  2ZIV B;  2DFL A;  1ZQA A;  1DXS A;  4RQ6 A;  3SAG A;  2KKV A;  2UVV A;  5KT2 A;  4M9H A;  2HVI A;  1JIH A;  1JXL A;  1ZRN A;  3H40 A;  4RNN A;  4PGY A;  2C2E A;  1XO0 A;  4DQI A;  3H0R B;  4YR0 A;  2K4H A;  2MUT A;  3PO5 A;  5ALW A;  2FDR A;  2AH5 A;  2LM4 A;  1QTM A;  2HHT A;  3IDW A;  2XVT A;  9ICI A;  2VAN A;  5EE0 A;  5BPC A;  3PX0 A;  3PML A;  1ZQL A;  4BXO B;  3OHB A;  5JU5 A;  5L1J A;  2HHU A;  4DS4 A;  5HHI A;  2PKE A;  3JPT A;  4FBT A;  1X66 A;  2G5I B;  3BS5 B;  2R8K A;  2IMW P;  1UA0 A;  3E0F A;  3VC8 A;  5CA7 A;  4IR1 A;  5CHG A;  2RDI A;  3CP8 A;  1CRX A;  5DQI A;  1NKE A;  5ALN A;  1RG6 A;  2VJ4 A;  2BCR A;  4KX3 A;  2EZZ A;  4B9U A;  2I9G A;  2OHF A;  3HX0 A;  1J2M A;  3B0Y A;  2EH9 A;  3H0L B;  4J9P A;  5KG5 A;  5DDY A;  4QW8 A;  2XIC A;  4YQW A;  2OCE A;  4KMO B;  5J2K A;  2LM1 A;  4J9R A;  4UB4 A;  2VA8 A;  3T79 A;  5KFN A;  3KBB A;  1Z4N A;  1NZP A;  2PFO A;  4F71 A;  2BCS A;  1XC9 A;  5TZV A;  2EZX A;  5AKX A;  4GXI A;  5CP2 A;  5AI6 A;  5BOL A;  4FZL A;  1RQN A;  4TQS A;  1OXJ A;  4C8L A;  5KFA A;  3UXN A;  1ZQN A;  5EWF A;  2AQ0 A;  2PMZ F;  1O03 A;  3GII A;  2QAR A;  1IV8 A;  4UB1 A;  2ASL A;  5HMM A;  1L3S A;  3MDA A;  1K1Q A;  2MAX A;  4O5E A;  3KZI U;  3WKC A;  3PVX A;  4KLG A;  5BOM A;  4CF3 A;  7ICK A;  5AK3 A;  4C7Y A;  2KOB A;  2W9M A;  9ICQ A;  2CN1 A;  2HMX A;  2W9B A;  2GWS A;  1ARO P;  5KT3 A;  5KFY A;  2E5S A;  2K4I A;  1ZQT A;  4DL4 A;  2ASD A;  4DQR A;  2AXT U;  4RQ8 A;  3R9K A;  1WG8 A;  1N60 A;  1ZJN A;  5AI9 A;  8ICU A;  4F5O A;  2YX8 A;  5AKL A;  8ICE A;  4RPZ A;  5KNI A;  4IS7 A;  1COK A;  4RU9 A;  3LYS A;  4GXJ A;  2XY5 A;  1BPZ A;  3PR5 B;  5CJ7 A;  4M0A A;  8ICG A;  3IV6 A;  5G5H A;  4RT3 A;  4Y2Q A;  4QZD A;  3EYZ A;  3QEA Z;  5AKK A;  2OEH A;  2NV3 A;  2FMQ A;  4DQQ A;  1TAM A;  4FS2 A;  1UPH A;  5L1L A;  3KD3 A;  2P35 A;  3RR8 A;  8ICQ A;  3Q8L A;  2FPM A;  1RM6 C;  2MRL A;  2AGQ A;  2PMZ C;  4OD0 A;  1XU4 A;  9ICU A;  3AQF A;  1X40 A;  8ICC A;  5KFG A;  2P66 A;  3U26 A;  1SL2 A;  1N5W A;  2RHF A;  1FEZ A;  3A0B U;  7ICV A;  5KFW A;  4O3O A;  9ICO A;  5F9N A;  4UAY A;  4YXM A;  3ORY A;  2R8H A;  4RQ1 A;  2RLT A;  1X42 A;  1QLN A;  4PPX A;  3UMC A;  1ZQM A;  3H4D A;  5J2I A;  1HEK A;  1RYR A;  4JK1 A;  1ZQF A;  2Z7J A;  4BWJ A;  3ALR A;  5ALP A;  4DFJ A;  5KFV A;  4IL6 U;  5KG2 A;  3F5A A;  2W54 A;  1BNO A;  5CEH A;  2IA6 A;  2PFQ A;  2NO4 A;  3KKA A;  5ALU A;  4US9 A;  4Y2U A;  4DQP A;  4F93 B;  5AI5 A;  4QZ8 A;  3RRG A;  3L3F X;  4NY8 A;  4F91 B;  1KQQ A;  4ECU A;  2PI5 A;  5ALH A;  4Y2Y A;  4JV0 A;  1RPL A;  2F2A B;  4OJ6 A;  4O3N A;  2JH7 A;  2YY6 A;  4MEY A;  2OYY A;  4EBC A;  3PZP A;  4CRX A;  1X6J A;  2MU2 A;  3QU9 A;  9ICM A;  2W7P A;  3SEI A;  2BHN A;  4QZE A;  3OHA A;  3HRD D;  2K8A A;  4QZ9 A;  2W7O A;  5ALQ A;  4R66 A;  4I2A A;  3G6Y A;  4Q8E A;  5DLF A;  1MSW D;  2LI6 A;  3H8S A;  8ICX A;  5IIK A;  2KJ9 A;  3V6H A;  2NO5 A;  5B5E U;  4EEL A;  2OM6 A;  5AM0 A;  2W3S A;  2WF7 A;  3MR5 A;  4TUR A;  4ELV A;  4P0P A;  1IXR A;  1ZQZ A;  1BGX T;  4BUG A;  1EXN A;  1D8Y A;  3QUT A;  1ZQI A;  1U45 A;  2PFP A;  1L3U A;  2E8O A;  1TK8 A;  3OSP A;  5ALX A;  4G3I A;  1ZD5 A;  5AKY A;  1F0M A;  5JRT A;  7ICP A;  4XQ8 A;  1BPE A;  3Q8Q B;  2JZB B;  3C28 A;  3I28 A;  5KFO A;  2FLL A;  1L8O A;  2H5X A;  5KFT A;  2YMQ A;  3HIL A;  2F76 X;  4KMU A;  1QQ7 A;  2ISP A;  4QWE A;  2LYB A;  5KAI U;  3AMZ A;  1FFU A;  4I2E A;  2KE7 A;  4QZI A;  4YP3 A;  1ZQB A;  3T5K A;  9ICT A;  1RYS A;  4I2B A;  2ZIU A;  2FPK A;  4F3O A;  1ECW A;  2WTF A;  1J97 A;  2QB1 A;  4OJP A;  3H7I A;  4C8O A;  4PZO A;  4IRD A;  4RUA A;  1KDH A;  4X5V A;  1KLN A;  2B21 A;  2ESE A;  1QQ6 A;  1S8O A;  2KJ8 A;  4KX5 A;  1ED1 A;  2HHW A;  1X6I A;  2OXO A;  4QIW F;  1TK0 A;  1NJY A;  5L9X A;  1TVA A;  9ICB A;  1DK2 A;  1A0P A;  2F44 A;  1SXE A;  3L5K A;  2JEJ A;  3QUC A;  1SL1 A;  2KMD A;  1ZRM A;  4IQT A;  3NVZ A;  5DG7 A;  8ICV A;  3IG8 A;  2LMR A;  5KFH A;  1ZQE A;  2EAN A;  5ALE A;  2KK0 A;  2W9A A;  5AKZ A;  4F4Y A;  3PW5 A;  2IOH A;  5DB7 A;  4LJX A;  4UAZ A;  1KSP A;  1FFV A;  3QUQ A;  8ICB A;  2J6U A;  3UMG A;  1SKW A;  3IN5 A;  2UVU A;  1T94 A;  1JXE A;  3GFK B;  1U4B A;  3KHL A;  2ZIX A;  4UAR A;  2YML A;  5J2J A;  4ED2 A;  3CRX A;  1YZ7 A;  5KFX A;  4P0Q B;  4Y2P A;  2NYV A;  4KN7 A;  1XS9 D;  4ECQ A;  3TFS A;  4UB5 A;  3FC4 A;  2V9W A;  2XI9 A;  3T3F A;  3V6J A;  4A8E A;  3SI8 A;  1VJ5 A;  2C2D A;  2XC9 A;  2F1J A;  4YG2 A;  4QZH A;  2P6U A;  4F4K A;  8ICP A;  3IRU A;  2AHO B;  4EX6 A;  2JXJ A;  2XGP A;  2MA1 A;  3RB6 A;  1DOQ A;  4U6P A;  3WK9 A;  2VJ5 A;  2WF5 A;  4IRK A;  2F1I A;  2KVC A;  4RQ5 A;  4UAT A;  4NWI A;  1PUZ A;  4RQ7 A;  2QKQ A;  4NJ8 A;  8ICI A;  1KW4 A;  2KIW A;  4DSI A;  2LYH A;  2JR5 A;  2HBJ A;  4DL3 A;  5DB9 A;  3SD7 A;  3RB4 A;  1V97 A;  2JZB A;  3ZDE A;  2OWO A;  5AKI A;  4Q45 A;  1MQ2 A;  1SXD A;  4LZD A;  4OO1 J;  9ICW A;  2DUY A;  5DG8 A;  1N56 A;  2W43 A;  3HT3 A;  5KL8 B;  5AKH A;  3M9N B;  4RQ0 A;  4Y2R A;  1Q3V A;  1ZQH A;  3QZ8 A;  5KFI A;  2F77 X;  3ONN A;  4QZF A;  4CDG A;  1KFD A;  4QZC A;  1PZN A;  2J6S A;  3BQ0 A;  3L4P A;  4NLZ A;  3ZI4 A;  2YN4 A;  1UT8 A;  1L7O A;  3V72 A;  4DF4 A;  2V4Q A;  5KTQ A;  5D46 A;  4IC9 A;  4JWN A;  2ZUD A;  3D2Q A;  3HJE A;  1L3T A;  3KKA C;  2IOF A;  4J9M A;  3FAH A;  5J2F A;  4JV2 A;  1SZH A;  1HUZ A;  2A19 A;  4ELU A;  5ALK A;  5HR7 A;  5KG4 A;  4IQW A;  3T5J A;  2HI0 A;  5J0P A;  2L5Y A;  1LKY B;  5J0U A;  4NL9 A;  3HPO A;  4Y2S A;  1F44 A;  3GDX A;  4JV1 A;  1VLB A;  4Q8F A;  3IHQ B;  2FJ6 A;  4ZOH C;  1ZQG A;  1DGJ A;  1KBU A;  1KFS A;  4YMM A;  4XUS A;  4FE3 A;  1XSL A;  1UHU A;  1NKC A;  4IQV A;  5IIJ A;  1TKD A;  3F2C A;  4UB8 U;  3RBD A;  2NRV A;  3PY8 A;  3ICX A;  1ZQP A;  7ICO A;  2ZG6 A;  1RXW A;  3BZK A;  4EEY A;  1X9S A;  3QU5 A;  4CE6 A;  4RNO A;  1NJZ A;  3NAS A;  4YVZ A;  4P0Q A;  2E1F A;  2UVR A;  1GO3 F;  4R64 A;  3NS1 A;  1CUK A;  3ZDA A;  4F2S A;  4YD1 A;  3M1Y A;  2HCF A;  2HHS A;  4CF4 A;  4O5C A;  1Z1B A;  3ZD9 A;  2JRZ A;  4ED8 A;  2KEY A;  8ICO A;  1ZQD A;  3H8W A;  2YMP A;  3EZ5 A;  1JMS A;  3SQI A;  3H4B A;  3ETR A;  4KN4 A;  3UPQ A;  5ALI A;  3TAN A;  4DLE A;  3UXO A;  4DL7 A;  2KKP A;  2BKE A;  4KLE A;  4RNM A;  4ECS A;  4PHE A;  2HHV A;  4AP9 A;  1RDF A;  3QZ7 A;  2XID A;  4DF8 A;  2DKZ A;  4DSF A;  3K75 D;  3RB3 A;  3AL0 B;  2ZUB A;  3FYH A;  4QNL A;  4BX9 C;  3TFR A;  7ICM A;  1T4G A;  2Y9T A;  3FDS A;  4TUP A;  2KJ5 A;  2KSO A;  1D8B A;  3G6X A;  3N4M B;  1X2I A;  2HDO A;  2DWQ A;  4UB3 A;  4DO9 A;  4PHP A;  3AQE A;  4EZ6 A;  1JI7 A;  4I28 A;  5EOZ A;  4GC6 A;  1BPD A;  2LYA A;  3N7S C;  2E8P A;  4EEK A;  2XY7 A;  4EZ9 A;  2EAO A;  7ICJ A;  4UAS A;  1NK8 A;  1JX4 A;  2DKX A;  3QEB Z;  2P6R A;  2FPL A;  3PW4 A;  4NLK A;  3RBE A;  2JMG A;  4F50 A;  3PSI A;  4ELT A;  4DSJ A;  2BCV A;  2Q0Z X;  2BDU A;  2JH1 A;  5AM5 A;  4AYB F;  3LWM A;  3C1Y A;  3EWA A;  4I2F A;  9ICH A;  8ICJ A;  2ZIV A;  2KVS A;  1L6N A;  1ZQX A;  4BDP A;  5J0Q A;  4I29 A;  3WKE A;  2EQY A;  4F92 B;  3SAF A;  2VIX A;  3C5G A;  4ED1 A;  5J2H A;  2AJQ A;  3OPX A;  2C28 A;  1TAU A;  5ALY A;  2DPI A;  3SAH A;  4M9L A;  4C8K A;  1LVH A;  4Z6E A;  4HYK A;  5IIM A;  3ISB A;  1YZ6 A;  1UA1 A;  9ICL A;  5ALV A;  1SB3 C;  4F5Q A;  2HW3 A;  3ISC A;  5B66 U;  1XSN A;  4UBC A;  4I2J A;  4ECX A;  2KD1 A;  5IIL A;  2WF8 A;  1ZQQ A;  2I6X A;  3AU6 A;  1Q8K A;  4RQ3 A;  1Z19 A;  4XRH A;  3OJS A;  4BXO A;  1PK3 A;  3EUB 2;  5ALO A;  2KHV A;  2K4P A;  5GTI U;  3BS5 A;  2YQE A;  2G5H B;  1TK5 A;  1KFT A;  3N7R C;  2H3I A;  3QYP A;  3Q8K A;  4UB6 U;  3GIK A;  7ICR A;  3QU2 A;  3MGH A;  3EW9 A;  5KG0 A;  2HHX A;  1XWL A;  2ASJ A;  4DOC A;  4AYB C;  5L1M A;  5AKG A;  3T5L A;  1B4F A;  2ZTD A;  2KZZ A;  3OGU A;  2A1J B;  4NLC A;  4CGZ A;  1ZQU A;  4F8R A;  1KRP A;  2WHE A;  1BPX A;  2KP7 A;  3RF9 A;  1HUO A;  4DCC A;  1U9L A;  2BPC A;  1Z00 B;  2GLE A;  2ATL A;  2CPR A;  4R8U B;  2WF6 A;  2DL0 A;  5H2F U;  1NZB A;  7ICL A;  2ZIW B;  4OCZ A;  4OJ5 A;  5DGA A;  2KN7 A;  3ZD8 A;  1RZT A;  3Q8M A;  3RH5 A;  5DKW A;  5JUM A;  1LB2 B;  5KFL A;  2KIV A;  2AGO A;  5AI0 A;  4RZR A;  4M6W B;  2JEG A;  1WCL A;  5EWE A;  1BVS A;  3WKB A;  2KNJ A;  5T14 A;  3RRH A;  2H3Z A;  3QXG A;  2Y0S F;  3PX4 A;  1PVP A;  4BWM A;  4B9V A;  4M9J A;  5ALG A;  4P4O A;  3PR4 A;  2KG5 A;  3C2L A;  4GC7 A;  3RFA A;  1N63 A;  3JPS A;  5KFM A;  5KAF U;  1TFR A;  3BS7 A;  5AK5 A;  4ECY A;  5DB8 A;  3PW2 A;  3TAQ A;  1U48 A;  1PK1 B;  5AIB A;  1KTQ A;  3AEV A;  2KIC A;  5KFS A;  4KLI A;  1ZQR A;  3G6V A;  3ZDB A;  4IR9 A;  2BGW A;  3TI0 A;  2R8J A;  3UXP A;  2VA3 A;  4YN4 A;  2K8B B;  4LVS A;  5L1I A;  2IBK A;  2HBM A;  1JRO A;  1BPB A;  4NL9 C;  4P4M A;  2IHM A;  3O0F A;  3PO4 A;  5ALM A;  4NM1 A;  2IOF K;  2DQN B;  2JHD A;  4JMU A;  3Q8R B;  4C4S A;  7ICF A;  4M2Y A;  4B6J A;  4I27 A;  3DEE A;  5CR0 A;  5KFE A;  5AK6 A;  2XCP A;  3EPI A;  4B9N A;  1S9F A;  1KEJ A;  5HML A;  1ZQS A;  4RT2 A;  4C4R A;  1C20 A;  1TV9 A;  1ZQC A;  1QQ5 A;  1SWW A;  5J2C A;  3E58 A;  2CRX A;  1M6Y A;  4RUC A;  3S6J A;  7ICN A;  5JTI A;  5CB1 A;  4M04 A;  3ED5 A;  5E79 U;  4C8M A;  1KKX A;  3MFI A;  3KHH A;  9ICG A;  2H3V A;  4DL2 A;  3BZC A;  4USA A;  3ISD A;  1UQV A;  2QB0 B;  1B0X A;  3RH6 A;  4M47 A;  3OTQ A;  3NUQ A;  2FLN A;  1Z1V A;  2FI1 A;  4C7Z A;  4DS5 A;  2BZF A;  4RPX A;  4Y2J A;  2QLT A;  1ZQO A;  4DWI A;  4RQM A;  2HOQ A;  3KZX A;  9ICN A;  4JWM A;  4KLQ A;  7ICH A;  1URJ A;  1NK9 A;  2RDJ A;  3RJG A;  8ICK A;  1OW5 A;  2KFN A;  2YB4 A;  1B43 A;  5J0W A;  3BQ1 A;  4YR3 A;  3IM1 A;  4KLH A;  5J0X A;  4J03 A;  5J8Y C;  1IG6 A;  1L7M A;  3NRW A;  2VKQ A;  4JUZ A;  3GIM A;  2M0N A;  4NLB A;  4R8U A;  4O3R A;  4ZH4 A;  1A77 A;  2ZJ8 A;  2VA2 A;  1VDV A;  3HKZ F;  2W8L A;  1N2X A;  1J2N A;  2C2R A;  1CI4 A;  4BJQ A;  2XO7 A;  3SMV A;  4MFA A;  4I2C A;  2DF4 B;  5KT4 A;  4UB2 A;  4F4X A;  5DG9 A;  2MUT B;  3WK4 A;  1DK3 A;  2NRX A;  5K4L A;  1V85 A;  8ICM A;  2K4E A;  3GU3 A;  4OJO A;  1PVR A;  2EDU A;  1V38 A;  1T8E A;  1ZD3 A;  1NNL A;  9ICR A;  5J0S A;  1T3N A;  4EBE A;  2ZTC A;  3C23 A;  4FZM A;  3M6Z A;  1XNS A;  4KLM A;  4TUS A;  4F2R A;  2W9C B;  3SEN A;  2YMM A;  5J2B A;  7ICQ A;  1PK1 A;  1XO1 A;  3THV A;  1ZQY A;  4ACO A;  4K4I A;  4NM2 A;  9ICA A;  1BPY A;  1ZJM A;  1L7P A;  5D4B A;  3NVY A;  3RAX A;  4YMO A;  4QIW C;  4IQU A;  5J2E A;  3TQ1 A;  4C0Z A;  2AGP A;  1V9P A;  4EX7 A;  4ED7 A;  4C4T A;  3F5E A;  2ZXI A;  2WAQ F;  1COO A;  4O5K A;  3QU4 A;  3F2D A;  4DL6 A;  2E8M A;  3RJH A;  3M7D A;  3JPR A;  3JPQ A;  4J9K A;  5KL1 B;  8ICR A;  3QNM A;  3GQC A;  5ALF A;  2DBY A;  1MQ3 A;  3T5H A;  1ZQJ A;  3C2K A;  2XCA A;  4I2H A;  1T3Q A;  4IRC A;  3KFU F;  3MBY A;  2E8N A;  3MDC A;  3Q8S B;  1K1S A;  1QSL A;  1Z3E B;  5HR6 A;  4JB3 A;  3TAP A;  1NJW A;  4J9N A;  5KG1 A;  3SYZ A;  4PGX A;  2QAR B;  3RTV A;  4M9G A;  2QB0 A;  3I76 A;  5FP0 A;  3C1Z A;  5KFD A;  2XGQ A;  9ICJ A;  4O3S A;  5DBC A;  2W55 A;  5J2D A;  3WK6 A;  3K1Z A;  1MA7 A;  4B9M A;  2W9B B;  2I1Q A;  2A3V A;  4Z6D A;  3KTQ A;  4F4Z A;  1RQL A;  1SV0 C;  3TAC B;  5ALR A;  3PV8 A;  3A0H U;  5KFZ A;  3WKD A;  4PHD A;  1KN5 A;  3WK5 A;  2EAM A;  2J6T A;  2KFZ A;  2ZUC A;  3WKA A;  2N1R A;  2G06 A;  2KHQ A;  3N28 A;  3D6J A;  3RJJ A;  2HOI A;  5GTH U;  1RXV A;  1O08 A;  4F5P A;  3MR2 A;  2ZXH A;  7ICT A;  5KFQ A;  1S97 A;  1ZQ1 C;  3UM9 A;  5KFU A;  3IG5 A;  3B0X A;  4ECR A; 
#chains in the Genus database with same CATH homology
 2EQY A;  5K4L A;  2EH9 A;  5CEH A;  1IG6 A;  2JRZ A;  1KKX A;  2OEH A;  1RYU A;  2RQ5 A;  2KK0 A;  2JXJ A;  2YQE A;  1C20 A;  1KQQ A;  4LJX A;  2LI6 A;  2LM1 A;  2CXY A;  1KN5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...