2KK0A

Solution structure of dead ringer-like protein 1 (at-rich interactive domain-containing protein 3a) from homo sapiens, northeast structural genomics consortium (nesg) target hr4394c
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
145
structure length
145
Chain Sequence
MGHHHHHHSHMPDHGDWTYEEQFKQLYELDGDPKRKEFLDDLFSFMQKRGTPVNRIPIMAKQVLDLFMLYVLVTEKGGLVEVINKKLWREITKGLNLPTSITSAAFTLRTQYMKYLYPYECEKRGLSNPNELQAAIDSNRREGRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AT-rich interactive domain-containing protein 3A
publication title Solution NMR structure of the ARID domain of human AT-rich interactive domain-containing protein 3A: a human cancer protein interaction network target.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription regulator
total genus 35
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 2009-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01388 ARID ARID/BRIGHT DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.60 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 ARID DNA-binding domain 2kk0A01
1RYUA 4LJXA 2EQYA 2JRZA 2KK0A 5K4LA 2JXJA 2LI6A 2YQEA 1C20A 2OEHA 2EH9A 5CEHA 1KKXA 1KN5A 2CXYA 2RQ5A 2LM1A 1IG6A 1KQQA
chains in the Genus database with same CATH superfamily
5TISU 1RYRA 5EWFA 4DSEA 2KKPA 1KEJA 4EEKA 4M04A 7ICHA 2E1FA 4F4KA 3RB6A 3I1YA 2WAQC 4F8RA 2Q4TA 3V6HA 4BWJA 3C23A 2C2DA 1NKEA 5KFIA 1UA1A 1Q46A 4KLEA 4R8UB 1X9WA 4PL2A 2ASLA 1PVQA 1D9FA 4Y2JA 4DOBA 2QB0A 5J2AA 2HDOA 5HHIA 3JPOA 4O3SA 4RQ5A 3H8SA 3GFKB 5J2DA 2K8AA 2IHMA 4Q43A 4ZH4A 1F5SA 2KNJA 3GIJA 5KFFA 4DFKA 5AM1A 4Y2TA 4P0QA 3BDPA 1F0MA 5J2KA 3QEAZ 9ICPA 3L3FX 2W7OA 3V7KA 3OJSA 5KT7A 3V7JA 2WF5A 4F3OA 4I2DA 2G5IB 1FFUA 4C4SA 1UHUA 1Z3EB 4YFKA 3WK8A 2NYVA 3FC4A 1KFSA 1NJXA 3BJYA 4RQ1A 3M8RA 4RPXA 7ICMA 1ZQZA 2LHTA 4RUCA 5ALWA 4I2FA 3KTQA 4ICAA 5IINA 4KMUA 1FIQA 1CRXA 4O3OA 4IQVA 3WU2U 4QWAA 4KLLA 1PK1B 4LZGA 5ALJA 5J0YA 3ZDEA 2M9NA 1RYSA 1WCLA 3MBYA 5DG9A 3G6XA 2J6SA 3UPQA 2UVUA 3QZ7A 2DF4B 3QEBZ 3ZDDA 1Z00B 3H4DA 4RPZA 3GV7B 3B0YA 2BCQA 2P6RA 4M9JA 8ICNA 4EZ6A 2WFAA 5KFEA 2WF7A 4KLHA 3GQCA 2IOHA 3QUTA 1GO3F 3C2KA 5AKHA 4YVZA 3PY8A 1VJ5A 9ICGA 5AM4A 2DGZA 1JUDA 4QZ9A 3D2SA 3BS5A 2NV3A 4PH5A 1LKYA 2MUTA 5J0QA 4KLTA 3K4GA 3IN5A 2V9WA 4HAIA 4NWIA 3ZDAA 4KX5A 2M0NA 5EE3A 5F9LA 4B9NA 2G06A 4EBCA 3ZD9A 1X40A 4GC7A 5KFBA 3H8WA 3U26A 3EYZA 2NRZA 3N7PD 3OTQA 5CJ7A 1SKSA 1NK9A 3H0RB 3PO4A 4Z6FA 3PW4A 4YMOA 3H8MA 3QU4A 2G0AA 1JMSA 2W03A 1D9DA 2YMMA 4QZIA 4IRDA 1A76A 3UXPA 4ECQA 2PKEA 2W55A 5L1JA 3CRXA 3SI8A 5J0XA 3WKDA 1U49A 4MHVA 1O08A 1NK0A 2F77X 2K8BB 2BDUA 3QUBA 3RB4A 5AK4A 1MC8A 1N61A 4RNOA 2KFNA 2HHXA 5ALUA 3SMVA 2XCAA 4ELTA 1XC9A 2W3SA 2ZXHA 4QZDA 3ZDBA 2Y1IA 5L1KA 1UT8A 5ALPA 2BKEA 2NRWA 1N5WA 2KZZA 2HCFA 7ICIA 4XUSA 1K1SA 2JV3A 1U48A 5HP4A 1MQ3A 2FDRA 2ZIUA 2DFLA 3IDWA 5AK6A 2NO4A 2HBKA 4M9LA 5AIBA 4C7ZA 3BZKA 2AHOB 1J97A 1KFTA 7ICFA 4OJOA 5KFAA 5AK5A 4C4RA 3GIMA 3SR6A 1B4FA 4P4OA 1RM6C 2FMPA 4DWIA 1YZ7A 3JPQA 3C2MA 5EWGA 2FLPA 4UAWA 5F9NA 4RQ8A 1NKBA 2KFZA 2Q0ZX 1Z1BA 4QWCA 5DG8A 2E1EA 1N48A 9ICTA 1ECWA 2FLNA 1NK5A 3RR8A 4GXJA 5J0SA 3RF9A 2B6GA 5ALGA 4Y2VA 1T8EA 1QSYA 2ZJAA 2AQ4A 8ICCA 2NRTA 3HKZF 3RR7A 1XSPA 2K4HA 4DS4A 2LPEA 4KLIA 4UASA 4F93B 2YMQA 1X9XA 5DLGA 4CF3A 2A3VA 2K89A 3NVYA 1X42A 3T5HA 1A77A 2RHFA 3TAQA 1SZPA 2JRZA 4R8UA 2WHEA 3RFAA 4ED2A 1ZQMA 3QXGA 4PZOA 3H40A 4YD1A 3HRDD 2JH7A 2ASJA 2BGWA 2H3ZA 5J2EA 5DG7A 3ED5A 2QB0B 2D8CA 4OJ6A 4FO6A 2F44A 5KT6A 2MU2A 3OHBA 1UT5A 5G5HA 2DL0A 1OXJA 5DDYA 4P0QB 2FI1A 3H7IA 1NJWA 3HW8A 2AQ0A 3JPRA 4IR1A 2F3NA 4IL6U 3C29A 2JEGA 1HJPA 3GU3A 5KAFU 1S76D 2ZTEA 3NTUA 1NJYA 2AGOA 3HILA 8ICRA 2KVSA 1SL2A 3VCBA 1RXVA 1PK1A 5CEHA 5D46A 4Y2SA 8ICQA 1ZD3A 5KFTA 5ALVA 1N56A 3ONNA 3OSPA 3LVWA 3HPOA 1WWUA 3TACB 5TZVA 5HR6A 1Z00A 1S0OA 1ZQSA 4RQ6A 1ZD2P 4Q44A 4DL5A 2HBLA 3PSPA 5CWRA 5AI6A 4J9OA 4B9SA 2YB4A 1L8LA 5AIAA 2KEYA 4FZLA 3H0MB 2MAXA 3PSFA 2XCPA 5HR7A 5JRTA 4J03A 4QNLA 4YD2A 2WB1F 3MFHA 4UAVA 5DKWA 2EAOA 3GIKA 1RDFA 3WK7A 4M9HA 5L1IA 1BPZA 1N60A 3ALRA 5D4BA 3BS5B 2DQNB 2C2EA 4RNMA 4U7CA 1V9PA 1H38A 5KG6A 4F2SA 4M9GA 3ISBA 1SB3C 4TUQA 2KOBA 4AP9A 4R65A 3JPSA 2KD1A 4CCHA 2Y0SF 1N62A 1U47A 2KZMA 1ZQVA 5J0WA 4EYHB 5G5GA 4O9MA 1X66A 2D3DA 5AI5A 1FFVA 8ICAA 3JPPA 3KFUF 3M8SA 2OM6A 4X5VA 1ZD5A 2QARA 2HOFA 2PMZC 3V6KA 5AI8A 3SYZA 4ECTA 1C20A 1PUZA 4ECWA 1DK2A 2W8KA 2BHNA 3V72A 4DFDA 4F50A 2IOFA 3L4PA 1QSSA 4KLSA 1LVHA 3HKZC 1KKXA 3Q8LA 5J0RA 2YMLA 4JMUA 4F4YA 2F1JA 3RJKA 4I2AA 1ZQNA 3HX0A 2KZ3A 3O0FA 2VA2A 1ZQUA 5K4LA 3IP4B 9ICQA 3AEVA 1D8BA 3IV6A 4B6JA 5J2CA 2F2AB 4FE3A 8ICKA 5J29A 2ZG6A 3G6YA 1SZHA 4YMNA 4TUPA 4J9RA 4RQ4A 4K4HA 5KFLA 4LZDA 4UATA 4BXOB 3Q8QB 1FEZA 4JV0A 2KG5A 3E2EA 5KFZA 5AK3A 2XY7A 4FS2A 5KFYA 1X9MA 1KFDA 3QX7A 4QWDA 3WKBA 2RRDA 2R8JA 2AXTU 2I9GA 4DFMA 3QE9Y 1ZQBA 1ZQDA 1SV0C 4ED6A 2P66A 3LWMA 1SXEA 4XA5A 5C5JA 2KTQA 5EOZA 3SEIA 2I1QA 3TFRA 4IC9A 5KFMA 4BX9C 3MABA 4CF5A 3MDCA 3KD3A 3Q8PB 1U45A 2PFNA 4F5OA 1QSLA 2XICA 9ICMA 2HOQA 2JXJA 1UCVA 3BQ7A 3RBDA 4ED3A 1XU4A 5KG2A 3JPTA 4EX6A 8ICBA 2EAPA 2UVRA 1T3NA 3J81j 5J0OA 4B9VA 4F4ZA 4UBBA 5L1MA 2CXYA 4QWBA 1ZQPA 1SL1A 4YR0A 2JMGA 4YXJA 3MR3A 5KFDA 4PHAA 1OUQA 5FP0A 3KHLA 9ICUA 2ALZA 2KVCA 1LB2B 4JB3A 1ZQWA 1ED1A 4P4MA 5CB1A 4C4TA 2W04A 3BQ0A 3WKAA 8ICPA 3NRWA 2WB1C 1KDHA 1TAMA 3HT3A 2LM1A 3MC1A 7ICEA 5AICA 3RJHA 2OXOA 2F1HA 4IQUA 2AGPA 1X6JA 3MFIA 3PX4A 2KICA 5KFQA 1N2XA 2V4RA 2KJ8A 1SV0A 2VIXA 2Y0SC 5ALEA 4QIWF 1DGSA 3GV5B 5KG5A 8ICHA 4BJQA 2K4PA 2RDIA 1SL0A 2VA8A 3EPGA 4I2BA 4QJFB 2A19A 3M9OB 1JXEA 3NVZA 1PZNA 1NZBA 2IMWP 3LWLA 1JXLA 5KFUA 4DQIA 2ZIVA 3T5KA 2QKQA 4CDGA 1YZ6A 4F71A 3TI0A 1ZQTA 4C8LA 2ZUBA 4DL7A 4RQNA 1L8OA 3RH6A 4LJXA 4MFAA 5AKJA 1PVRA 4OJLA 4I27A 5CR0A 5KFJA 9ICCA 3L5KA 4ECUA 2OEHA 3F2DA 4C0ZA 5J2GA 5B5EU 4Y2YA 1JI7A 4FZNA 2KJ9A 4RZRA 3F2BA 3TADC 3NRZA 3K1RB 5AKIA 2P6UA 2YN4A 4ECYA 1DXSA 3RRGA 8ICVA 5DQGA 1KTQA 1S97A 4KLDA 4Y2RA 4UB5A 4B9TA 4NM2A 3GZFA 4GXIA 4KLOA 3N7RC 1QQ5A 2F1IA 4IS7A 2R8GA 3HWTA 2CRXA 3C5FA 2VANA 4QW9A 9ICBA 1ZYQA 3M6KA 1PVPA 2BCUA 4M0AA 4RT2A 1XO1A 1NK8A 1ZOLA 5KFPA 4Y2XA 2HVHA 3F53A 2ATLA 2UVWA 2QARB 3OGUA 4I28A 5CRXA 1KLNA 2NRVA 4DSJA 3N28A 2MRLA 8ICZA 4C8NA 2ZTDA 3A0BU 5DB8A 1Q3UA 2J6UA 4KMOB 4ELVA 4YN4A 9ICIA 3Q8SB 5IIIA 4NLCA 2YY6A 4O3NA 8ICXA 4MF2A 3MR5A 3M9MB 4YG2A 3KKAC 4FBUA 3TADA 5DB9A 2OCEA 1TK8A 1QTMA 1QCKA 1QQ7A 1SKRA 1NK4A 3LDAA 4YXMA 2XY5A 3IG8A 4Q8FA 3NUQA 4ECXA 2W8LA 3RJIA 4RUAA 3N7SC 1T94A 4BXOA 3TARA 1X6IA 2B0CA 1KN5A 4YP3A 3LVVA 4C8KA 7ICPA 3S6JA 4USAA 8ICYA 1NNLA 2JHDA 5DBAA 5DB6A 3G6VA 3H4BA 2AU0A 4QZBA 3E0FA 4WJ3B 3CW2C 4YCXA 5KT3A 1DOQA 4RQ0A 4JV2A 2EDUA 2W7PA 1S8OA 1HEKA 5JUMA 1F44A 4CE6A 3MDAA 1UQVA 1L3VA 1B22A 2ZJ5A 4QIWC 2E8MA 2RDJA 3PO5A 3TKAA 4J9MA 9ICXA 1ZQKA 2ESEA 3EPIA 2LI6A 2D6FC 4FS1A 7ICQA 2R8HA 1JX4A 2WF6A 2H3FA 3ISCA 2WTFA 4KN7A 1ZQQA 4XRHA 3KKAA 4TURA 2LBOA 4O3RA 4DO9A 2BZFA 4IR9A 2LMRA 4RNNA 2OWOA 5A0LA 2F76X 2BQ3A 1AROP 2JEFA 2KHVA 2Y9UA 2YX8A 2LKYA 5ALSA 1WUDA 4PHEA 1ZJMA 2JGAA 3SV4A 4DFJA 2MA1A 4DEZA 2QLTA 9ICRA 4ED8A 8ICTA 3IHQB 1TAUA 1Z19A 1SXDA 2EZZA 5KG0A 4G9BA 3KHGA 4MEXA 3IG5A 3TQ1A 4Y2QA 2Z7JA 2HHTA 4GLXA 2HVIA 4C7YA 3FYHA 4CNQA 4Z6DA 5ALFA 5IIJA 1XWLA 3QU9A 1KBUA 7ICGA 2GO7A 1ZQ1C 2G08A 4YR3A 3GDXA 3TAPA 2C28A 1L7NA 1V38A 3NS1A 4Y2PA 3IRUA 4EELA 1MQ2A 4B9LA 4FZMA 4PHDA 5DGAA 3BQ2A 1BPXA 4DQQA 4KLUA 8ICOA 1JIHA 2KMDA 4YMMA 1C7YA 5KG4A 5KTQA 5ALQA 3QU5A 4EENA 2YMPA 4JWMA 2GH1A 5AI4A 3KHRA 1Q8KA 3ZD8A 4I29A 5GTHU 5IIOA 4GIBA 2ZIVB 4DQPA 8ICEA 3T3FA 3UMCA 2VKQA 2UVVA 1HUZA 4P0PB 3B0XA 4DS5A 1S0MA 2WF8A 4FFDA 4F2RA 1WG8A 5IIMA 5KFRA 4MFCA 2G07A 3AUOA 2KSOB 2LYAA 5HNKA 3CYMA 1TV9A 2XC9A 2WF9A 1SV4A 4QZCA 1BPDA 2ZJ8A 4QZ8A 3PW5A 2XGQA 1ZQRA 2GWSA 5JTIA 2ZIWB 3M6ZA 2XVTA 3OHAA 2W9CA 3C21A 8ICFA 1J2MA 5ALHA 3UMGA 5KT4A 5DB7A 2JH1A 1T3QA 1RXWA 2RLTA 5DBBA 5DDMA 2KP7A 4NL9C 5ALKA 4UB4A 2ISPA 2LYBA 4ECSA 5KG1A 2Y9TA 8ICGA 1XSNA 2K4IA 2KK0A 1T7PA 2BPCA 3QNMA 1ZQEA 3WKEA 2R8KA 1SWVA 2ZUCA 4QZGA 4F5PA 2HHQA 1ZQAA 4DOCA 2EAMA 4OO1J 4UAYA 4Q45A 5AKYA 1MSWD 4RQMA 5AM2A 5EE0A 4DL6A 5DQIA 4I2EA 5ALXA 1XS9D 4PJ0U 3EWAA 4R64A 1TKDA 1JALA 2H5XA 4DFPA 7ICVA 3WK4A 3PSTA 4O5EA 5CHGA 1COKA 2KHQA 5CA7A 2DKZA 2HHSA 1SGGA 5BOLA 5EE9A 3BZCA 1Z4NA 5AKEA 2BDPA 4NLKA 2CN1A 3C2LA 5HMMA 1B0XA 1JROA 1X2IA 4I2HA 2HBMA 3R9KA 1DRGA 4RQ3A 5ALZA 1L3UA 4CGZA 5ALYA 3PSIA 3PMNA 3PV8A 4J9SA 3Q8RB 2LM4A 1ZQFA 5AKGA 3T5LA 5DLFA 1YT3A 3C1YA 4KN4A 4AYBF 4BWMA 4NL9A 1HIWA 4J9NA 2F8KA 3SAFA 4ZOHC 2W9AA 3EW9A 5AM5A 1ZQJA 1ZQLA 4QZEA 4O5KA 4DL4A 1K5OA 1ZQHA 4YQWA 1NOMA 3RAQA 3DDHA 2EZXA 2HBJA 4UB2A 3UQ2A 1DK3A 1QQ6A 4KLMA 2BCVA 1RQNA 5KFHA 1XNSA 3RJJA 4US8A 2FPLA 4NLBA 1DGJA 5L1LA 3FAHA 1MN8A 5JU5A 5KNIA 3LK9A 3UMBA 1RZTA 2W9MA 4RU9A 4Z6CA 3KOOA 2PFQA 3HP6A 1BPBA 3ZI4A 3C28A 4R66A 3ETLA 5ALIA 5KL1B 4UQGA 4UAZA 1ZQIA 2E8PA 1T4GA 4B9UA 2ASDA 4DSFA 4NLNA 1V97A 2JR5A 4LVSA 4GC6A 1L6NA 2EH9A 2E3TA 5HMLA 1NJZA 4HYKA 4DL2A 3D2QA 3Q8MA 5IIKA 4MFFA 3CNHA 4G3IA 2GLEA 2YB1A 2E8NA 1WYGA 2VJ5A 4O3PA 1RYUA 2EQYA 2DBYA 4K4GA 1D8YA 9ICJA 5KG7A 3I76A 5BPCA 1WWVA 2IOFK 3H8JA 2W54A 4P2HA 3SZ2A 5KFXA 2N1RA 3RTVA 4EX7A 2G5HB 3ZDCA 5E79U 2KE7A 3M9NB 2BQRA 5KFCA 3D2NA 1BPYA 7ICTA 3B9JA 5J8YA 2R8IA 4J9QA 1BPEA 1ZQXA 3K75D 1TAQA 2YQEA 5ALTA 5ALOA 3PX0A 5F3XB 4DLGA 3AL0B 4C80A 7ICJA 3QU2A 4ED1A 2VA3A 5KT2A 3RRHA 1L7MA 4KITB 3I28A 5T14A 4P0PA 1ZRMA 3C1ZA 2MSNA 4E0DA 4JK1A 2GOLA 4KLGA 4F5QA 1ZXIA 4YR2A 2KSOA 1D8LA 3K1ZA 5KFGA 5HHHA 2ISOA 1A0PA 2DPIA 3EZ5A 3RH4A 2ZIXB 4DF4A 1SKWA 2VJ4A 1LV5A 3Q8KA 3ORYA 2E5SA 3QYPA 2EZYA 2ZIWA 2G09A 2JEIA 2IHNA 5KFKA 5C0YA 2L5YA 1ZQCA 4NM1A 2BPGA 5L9XA 4K4IA 3AM9A 2FE9A 5KG3A 2A1JA 4EYIB 1BGXT 1BNOA 4XQ8A 2W9CB 4KLQA 1CEZA 4C8OA 4PGQA 2BQUA 5J2FA 2LYHA 4FBTA 2H3QA 4AYBC 1KSPA 1NI3A 3KZIU 5DGBA 4F5RA 4UB1A 5IILA 2BCSA 1XO0A 4KLJA 4OCZA 2PI4A 3NVVA 3AN1A 3QU7A 1UA0A 3RH5A 4QWEA 1U9LA 5ALMA 2J6TA 4OJ5A 4IRKA 2RQ5A 4Z6EA 3MGIA 3ICXA 3SAHA 4DQSA 4I2IA 5ALLA 4NLGA 1WCNA 4ECZA 2ZXIA 4DQRA 3KZXA 1Y88A 2AGQA 1IV8A 2H3VA 2R18A 4GFJA 4UW9A 2W9BB 1L3SA 1JRPA 1S5LU 1RG6A 3DV9A 1A6SA 1TK0A 8ICMA 3WK6A 3M1YA 1RPLA 3KHHA 2K8CB 5AKXA 2W43A 1EXNA 3KBBA 4PL1A 2HHWA 3GIIA 9ICSA 2FMSA 2EANA 4DL3A 4J9KA 1B43A 2KIVA 2NO5A 4PGYA 3AU2A 2PFOA 1QH9A 2FLLA 8ICIA 4DLEA 3N4MB 2JZBA 1NK7A 3UXOA 4M6WB 1IIPA 4NJ8A 3TANA 3H0LB 5J2HA 5J2BA 4F72A 2ES6A 1SWWA 3AMZA 2C2RA 3DEEA 3SV3A 4QZFA 4JWNA 4US9A 3IM1A 2DKXA 2W3RA 3BQ1A 2XY6A 1KQQA 2HOIA 3FM9A 4UARA 4UAUA 1HUOA 1PK3A 3WKCA 3V6JA 4OD0A 3HJEA 4RPYA 3MR2A 4ECRA 5ALDA 5J0TA 4DF8A 9ICOA 5EWEA 1COOA 1BNPA 2HHVA 1M6YA 1L5UA 8ICUA 2PMZF 2PI5A 4Q8EA 2XO7A 7ICNA 5BOMA 1J2NA 4QW8A 7ICOA 3AU6A 3CP8A 2V4QA 5AHXA 5H2FU 1Z1VA 3PR4A 8ICJA 3ISDA 5AM0A 4A8EA 8ICWA 4NV0A 4TUSA 1N63A 1KW4A 3RB3A 3PMLA 1KRPA 4J9LA 4ACOA 8ICLA 4RT3A 3T79A 4DSKA 5B66U 1IXRA 4F92B 2O6KA 4NLZA 4PGXA 2BCRA 1N5XA 3V7LA 4NY8A 1P7DA 7ICKA 5DBCA 4J9PA 9ICFA 2I6XA 5J0UA 3EUB2 4M2YA 1ZETA 3NASA 1ZJNA 3BQTA 1O03A 4C8MA 3SENA 4F5NA 4BGDA 3D6JA 2AJQA 1IG6A 5J2IA 1X9SA 2KV2A 1TK5A 4I2GA 5KAIU 7ICUA 2BPFA 3RB0A 1S77D 3F5AA 9ICVA 3VC8A 4DOAA 1S9FA 4NXZA 3RAXA 4UBCA 3PR5B 3WK9A 3UXNA 5AI9A 3PW0A 3QUCA 3BS7A 3PW2A 4JV1A 2OYYA 2HI0A 4BUGA 7ICRA 2CPRA 3WK5A 2C22A 2K60A 3E58A 5D49A 5AM3A 1QLNA 9ICAA 2XIDA 2K4EA 4CF4A 1ZQGA 7ICLA 4U6PA 9ICHA 2ZUDA 4IQWA 2Y1JA 4PZNA 2OH2A 1V85A 4QZHA 3MGVA 4O0IA 1L7OA 2ZIXA 2HW3A 4I2JA 4JUZA 2WAQF 9ICEA 2P35A 3MR6A 5KFSA 2YTUA 4RQ2A 2DWQA 1FO4A 4UB3A 4EBDA 3RJGA 3SQIA 1ZQOA 1ZQYA 9ICWA 3F2CA 2FPKA 4O5CA 4OJPA 2FMQA 3NVWA 1Q3VA 1NK6A 3PZPA 3OSNA 4M9NA 3PVXA 2FJ6A 1VDVA 4IQTA 1AQ6A 1UPHA 1TE2A 5GTIU 2ZTCA 5EE1A 1OW5A 3UQ0A 3C5GA 4R63A 2A1JB 4B9MA 2XGPA 2IA6A 3MGHA 1LKYB 2MUTB 4M47A 2DUYA 2HMXA 1IM4A 2DPJA 5KT5A 4PPXA 5AKLA 3PNCA 4TQSA 2F8LA 1NKCA 9ICKA 5ALNA 2HHUA 2HSZA 2PXIA 1VLBA 5AKKA 4ED0A 1L7PA 3M7DA 2W9BA 1SIJA 5KFWA 1TFRA 5KFNA 5J2JA 4GXKA 3NGDA 1TVAA 8ICSA 3OPXA 4O3QA 2A1AA 1CUKA 3PX6A 3QZ8A 3JPNA 4KX3A 3RJEA 2BR0A 1JN3A 2AH5A 5KFVA 7ICSA 2JEJA 3ETRA 4UB6U 3GILA 1U4BA 2E8OA 4ECVA 2KKVA 4BDPA 1S10A 1CI4A 3LYSA 1URJA 4DSLA 3OJUA 4MEYA 2QB1A 5DQHA 2KJ5A 3GV8B 4DSIA 3SD7A 4M6WA 2PFPA 2KN7A 4EEYA 1ZRNA 3PW7A 1MA7A 2ODGA 4EZ9A 2JZBB 5ALRA 2RP5A 1KL9A 2XI9A 4UB8U 4QZAA 4I2CA 4ELUA 3UM9A 9ICNA 2NRXA 2H3IA 1BVSA 5AI0A 1Z4OA 4PHPA 4F4XA 2ZIUB 1S0VA 2B21A 4ED7A 4O3MA 3TFSA 1L3TA 4TQRA 2OHFA 3F5EA 4CRXA 4KTQA 2I5HA 4MF8A 3THVA 4IRCA 1NZPA 4P4PA 5KL8B 5CP2A 4DCCA 2IBKA 9ICLA 3A0HU 3T5JA 3RBEA 5J8YC 4RQ7A 4F91B 5KFOA 4EBEA 3RJFA 4Y2UA 4KLFA 2W11A 3SAGA 1XSLA 2KIWA 5AKZA 1K1QA 3FDSA 1ZD4A 3AQEA 1S0NA 3AQFA 5J0PA 3N97B 3QUQA 2FPMA 4F4WA 1RQLA
chains in the Genus database with same CATH topology
1RYUA 4LJXA 2EQYA 2JRZA 2KK0A 5K4LA 2JXJA 2LI6A 2YQEA 1C20A 2OEHA 2EH9A 5CEHA 1KKXA 1KN5A 2CXYA 2RQ5A 2LM1A 1IG6A 1KQQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RYU A;  4LJX A;  2EQY A;  2JRZ A;  2KK0 A;  5K4L A;  2JXJ A;  2LI6 A;  2YQE A;  1C20 A;  2OEH A;  2EH9 A;  5CEH A;  1KKX A;  1KN5 A;  2CXY A;  2RQ5 A;  2LM1 A;  1IG6 A;  1KQQ A; 
#chains in the Genus database with same CATH topology
 5TIS U;  1RYR A;  5EWF A;  4DSE A;  2KKP A;  1KEJ A;  4EEK A;  4M04 A;  7ICH A;  2E1F A;  4F4K A;  3RB6 A;  3I1Y A;  2WAQ C;  4F8R A;  2Q4T A;  3V6H A;  4BWJ A;  3C23 A;  2C2D A;  1NKE A;  5KFI A;  1UA1 A;  1Q46 A;  4KLE A;  4R8U B;  1X9W A;  4PL2 A;  2ASL A;  1PVQ A;  1D9F A;  4Y2J A;  4DOB A;  2QB0 A;  5J2A A;  2HDO A;  5HHI A;  3JPO A;  4O3S A;  4RQ5 A;  3H8S A;  3GFK B;  5J2D A;  2K8A A;  2IHM A;  4Q43 A;  4ZH4 A;  1F5S A;  2KNJ A;  3GIJ A;  5KFF A;  4DFK A;  5AM1 A;  4Y2T A;  4P0Q A;  3BDP A;  1F0M A;  5J2K A;  3QEA Z;  9ICP A;  3L3F X;  2W7O A;  3V7K A;  3OJS A;  5KT7 A;  3V7J A;  2WF5 A;  4F3O A;  4I2D A;  2G5I B;  1FFU A;  4C4S A;  1UHU A;  1Z3E B;  4YFK A;  3WK8 A;  2NYV A;  3FC4 A;  1KFS A;  1NJX A;  3BJY A;  4RQ1 A;  3M8R A;  4RPX A;  7ICM A;  1ZQZ A;  2LHT A;  4RUC A;  5ALW A;  4I2F A;  3KTQ A;  4ICA A;  5IIN A;  4KMU A;  1FIQ A;  1CRX A;  4O3O A;  4IQV A;  3WU2 U;  4QWA A;  4KLL A;  1PK1 B;  4LZG A;  5ALJ A;  5J0Y A;  3ZDE A;  2M9N A;  1RYS A;  1WCL A;  3MBY A;  5DG9 A;  3G6X A;  2J6S A;  3UPQ A;  2UVU A;  3QZ7 A;  2DF4 B;  3QEB Z;  3ZDD A;  1Z00 B;  3H4D A;  4RPZ A;  3GV7 B;  3B0Y A;  2BCQ A;  2P6R A;  4M9J A;  8ICN A;  4EZ6 A;  2WFA A;  5KFE A;  2WF7 A;  4KLH A;  3GQC A;  2IOH A;  3QUT A;  1GO3 F;  3C2K A;  5AKH A;  4YVZ A;  3PY8 A;  1VJ5 A;  9ICG A;  5AM4 A;  2DGZ A;  1JUD A;  4QZ9 A;  3D2S A;  3BS5 A;  2NV3 A;  4PH5 A;  1LKY A;  2MUT A;  5J0Q A;  4KLT A;  3K4G A;  3IN5 A;  2V9W A;  4HAI A;  4NWI A;  3ZDA A;  4KX5 A;  2M0N A;  5EE3 A;  5F9L A;  4B9N A;  2G06 A;  4EBC A;  3ZD9 A;  1X40 A;  4GC7 A;  5KFB A;  3H8W A;  3U26 A;  3EYZ A;  2NRZ A;  3N7P D;  3OTQ A;  5CJ7 A;  1SKS A;  1NK9 A;  3H0R B;  3PO4 A;  4Z6F A;  3PW4 A;  4YMO A;  3H8M A;  3QU4 A;  2G0A A;  1JMS A;  2W03 A;  1D9D A;  2YMM A;  4QZI A;  4IRD A;  1A76 A;  3UXP A;  4ECQ A;  2PKE A;  2W55 A;  5L1J A;  3CRX A;  3SI8 A;  5J0X A;  3WKD A;  1U49 A;  4MHV A;  1O08 A;  1NK0 A;  2F77 X;  2K8B B;  2BDU A;  3QUB A;  3RB4 A;  5AK4 A;  1MC8 A;  1N61 A;  4RNO A;  2KFN A;  2HHX A;  5ALU A;  3SMV A;  2XCA A;  4ELT A;  1XC9 A;  2W3S A;  2ZXH A;  4QZD A;  3ZDB A;  2Y1I A;  5L1K A;  1UT8 A;  5ALP A;  2BKE A;  2NRW A;  1N5W A;  2KZZ A;  2HCF A;  7ICI A;  4XUS A;  1K1S A;  2JV3 A;  1U48 A;  5HP4 A;  1MQ3 A;  2FDR A;  2ZIU A;  2DFL A;  3IDW A;  5AK6 A;  2NO4 A;  2HBK A;  4M9L A;  5AIB A;  4C7Z A;  3BZK A;  2AHO B;  1J97 A;  1KFT A;  7ICF A;  4OJO A;  5KFA A;  5AK5 A;  4C4R A;  3GIM A;  3SR6 A;  1B4F A;  4P4O A;  1RM6 C;  2FMP A;  4DWI A;  1YZ7 A;  3JPQ A;  3C2M A;  5EWG A;  2FLP A;  4UAW A;  5F9N A;  4RQ8 A;  1NKB A;  2KFZ A;  2Q0Z X;  1Z1B A;  4QWC A;  5DG8 A;  2E1E A;  1N48 A;  9ICT A;  1ECW A;  2FLN A;  1NK5 A;  3RR8 A;  4GXJ A;  5J0S A;  3RF9 A;  2B6G A;  5ALG A;  4Y2V A;  1T8E A;  1QSY A;  2ZJA A;  2AQ4 A;  8ICC A;  2NRT A;  3HKZ F;  3RR7 A;  1XSP A;  2K4H A;  4DS4 A;  2LPE A;  4KLI A;  4UAS A;  4F93 B;  2YMQ A;  1X9X A;  5DLG A;  4CF3 A;  2A3V A;  2K89 A;  3NVY A;  1X42 A;  3T5H A;  1A77 A;  2RHF A;  3TAQ A;  1SZP A;  2JRZ A;  4R8U A;  2WHE A;  3RFA A;  4ED2 A;  1ZQM A;  3QXG A;  4PZO A;  3H40 A;  4YD1 A;  3HRD D;  2JH7 A;  2ASJ A;  2BGW A;  2H3Z A;  5J2E A;  5DG7 A;  3ED5 A;  2QB0 B;  2D8C A;  4OJ6 A;  4FO6 A;  2F44 A;  5KT6 A;  2MU2 A;  3OHB A;  1UT5 A;  5G5H A;  2DL0 A;  1OXJ A;  5DDY A;  4P0Q B;  2FI1 A;  3H7I A;  1NJW A;  3HW8 A;  2AQ0 A;  3JPR A;  4IR1 A;  2F3N A;  4IL6 U;  3C29 A;  2JEG A;  1HJP A;  3GU3 A;  5KAF U;  1S76 D;  2ZTE A;  3NTU A;  1NJY A;  2AGO A;  3HIL A;  8ICR A;  2KVS A;  1SL2 A;  3VCB A;  1RXV A;  1PK1 A;  5CEH A;  5D46 A;  4Y2S A;  8ICQ A;  1ZD3 A;  5KFT A;  5ALV A;  1N56 A;  3ONN A;  3OSP A;  3LVW A;  3HPO A;  1WWU A;  3TAC B;  5TZV A;  5HR6 A;  1Z00 A;  1S0O A;  1ZQS A;  4RQ6 A;  1ZD2 P;  4Q44 A;  4DL5 A;  2HBL A;  3PSP A;  5CWR A;  5AI6 A;  4J9O A;  4B9S A;  2YB4 A;  1L8L A;  5AIA A;  2KEY A;  4FZL A;  3H0M B;  2MAX A;  3PSF A;  2XCP A;  5HR7 A;  5JRT A;  4J03 A;  4QNL A;  4YD2 A;  2WB1 F;  3MFH A;  4UAV A;  5DKW A;  2EAO A;  3GIK A;  1RDF A;  3WK7 A;  4M9H A;  5L1I A;  1BPZ A;  1N60 A;  3ALR A;  5D4B A;  3BS5 B;  2DQN B;  2C2E A;  4RNM A;  4U7C A;  1V9P A;  1H38 A;  5KG6 A;  4F2S A;  4M9G A;  3ISB A;  1SB3 C;  4TUQ A;  2KOB A;  4AP9 A;  4R65 A;  3JPS A;  2KD1 A;  4CCH A;  2Y0S F;  1N62 A;  1U47 A;  2KZM A;  1ZQV A;  5J0W A;  4EYH B;  5G5G A;  4O9M A;  1X66 A;  2D3D A;  5AI5 A;  1FFV A;  8ICA A;  3JPP A;  3KFU F;  3M8S A;  2OM6 A;  4X5V A;  1ZD5 A;  2QAR A;  2HOF A;  2PMZ C;  3V6K A;  5AI8 A;  3SYZ A;  4ECT A;  1C20 A;  1PUZ A;  4ECW A;  1DK2 A;  2W8K A;  2BHN A;  3V72 A;  4DFD A;  4F50 A;  2IOF A;  3L4P A;  1QSS A;  4KLS A;  1LVH A;  3HKZ C;  1KKX A;  3Q8L A;  5J0R A;  2YML A;  4JMU A;  4F4Y A;  2F1J A;  3RJK A;  4I2A A;  1ZQN A;  3HX0 A;  2KZ3 A;  3O0F A;  2VA2 A;  1ZQU A;  5K4L A;  3IP4 B;  9ICQ A;  3AEV A;  1D8B A;  3IV6 A;  4B6J A;  5J2C A;  2F2A B;  4FE3 A;  8ICK A;  5J29 A;  2ZG6 A;  3G6Y A;  1SZH A;  4YMN A;  4TUP A;  4J9R A;  4RQ4 A;  4K4H A;  5KFL A;  4LZD A;  4UAT A;  4BXO B;  3Q8Q B;  1FEZ A;  4JV0 A;  2KG5 A;  3E2E A;  5KFZ A;  5AK3 A;  2XY7 A;  4FS2 A;  5KFY A;  1X9M A;  1KFD A;  3QX7 A;  4QWD A;  3WKB A;  2RRD A;  2R8J A;  2AXT U;  2I9G A;  4DFM A;  3QE9 Y;  1ZQB A;  1ZQD A;  1SV0 C;  4ED6 A;  2P66 A;  3LWM A;  1SXE A;  4XA5 A;  5C5J A;  2KTQ A;  5EOZ A;  3SEI A;  2I1Q A;  3TFR A;  4IC9 A;  5KFM A;  4BX9 C;  3MAB A;  4CF5 A;  3MDC A;  3KD3 A;  3Q8P B;  1U45 A;  2PFN A;  4F5O A;  1QSL A;  2XIC A;  9ICM A;  2HOQ A;  2JXJ A;  1UCV A;  3BQ7 A;  3RBD A;  4ED3 A;  1XU4 A;  5KG2 A;  3JPT A;  4EX6 A;  8ICB A;  2EAP A;  2UVR A;  1T3N A;  3J81 j;  5J0O A;  4B9V A;  4F4Z A;  4UBB A;  5L1M A;  2CXY A;  4QWB A;  1ZQP A;  1SL1 A;  4YR0 A;  2JMG A;  4YXJ A;  3MR3 A;  5KFD A;  4PHA A;  1OUQ A;  5FP0 A;  3KHL A;  9ICU A;  2ALZ A;  2KVC A;  1LB2 B;  4JB3 A;  1ZQW A;  1ED1 A;  4P4M A;  5CB1 A;  4C4T A;  2W04 A;  3BQ0 A;  3WKA A;  8ICP A;  3NRW A;  2WB1 C;  1KDH A;  1TAM A;  3HT3 A;  2LM1 A;  3MC1 A;  7ICE A;  5AIC A;  3RJH A;  2OXO A;  2F1H A;  4IQU A;  2AGP A;  1X6J A;  3MFI A;  3PX4 A;  2KIC A;  5KFQ A;  1N2X A;  2V4R A;  2KJ8 A;  1SV0 A;  2VIX A;  2Y0S C;  5ALE A;  4QIW F;  1DGS A;  3GV5 B;  5KG5 A;  8ICH A;  4BJQ A;  2K4P A;  2RDI A;  1SL0 A;  2VA8 A;  3EPG A;  4I2B A;  4QJF B;  2A19 A;  3M9O B;  1JXE A;  3NVZ A;  1PZN A;  1NZB A;  2IMW P;  3LWL A;  1JXL A;  5KFU A;  4DQI A;  2ZIV A;  3T5K A;  2QKQ A;  4CDG A;  1YZ6 A;  4F71 A;  3TI0 A;  1ZQT A;  4C8L A;  2ZUB A;  4DL7 A;  4RQN A;  1L8O A;  3RH6 A;  4LJX A;  4MFA A;  5AKJ A;  1PVR A;  4OJL A;  4I27 A;  5CR0 A;  5KFJ A;  9ICC A;  3L5K A;  4ECU A;  2OEH A;  3F2D A;  4C0Z A;  5J2G A;  5B5E U;  4Y2Y A;  1JI7 A;  4FZN A;  2KJ9 A;  4RZR A;  3F2B A;  3TAD C;  3NRZ A;  3K1R B;  5AKI A;  2P6U A;  2YN4 A;  4ECY A;  1DXS A;  3RRG A;  8ICV A;  5DQG A;  1KTQ A;  1S97 A;  4KLD A;  4Y2R A;  4UB5 A;  4B9T A;  4NM2 A;  3GZF A;  4GXI A;  4KLO A;  3N7R C;  1QQ5 A;  2F1I A;  4IS7 A;  2R8G A;  3HWT A;  2CRX A;  3C5F A;  2VAN A;  4QW9 A;  9ICB A;  1ZYQ A;  3M6K A;  1PVP A;  2BCU A;  4M0A A;  4RT2 A;  1XO1 A;  1NK8 A;  1ZOL A;  5KFP A;  4Y2X A;  2HVH A;  3F53 A;  2ATL A;  2UVW A;  2QAR B;  3OGU A;  4I28 A;  5CRX A;  1KLN A;  2NRV A;  4DSJ A;  3N28 A;  2MRL A;  8ICZ A;  4C8N A;  2ZTD A;  3A0B U;  5DB8 A;  1Q3U A;  2J6U A;  4KMO B;  4ELV A;  4YN4 A;  9ICI A;  3Q8S B;  5III A;  4NLC A;  2YY6 A;  4O3N A;  8ICX A;  4MF2 A;  3MR5 A;  3M9M B;  4YG2 A;  3KKA C;  4FBU A;  3TAD A;  5DB9 A;  2OCE A;  1TK8 A;  1QTM A;  1QCK A;  1QQ7 A;  1SKR A;  1NK4 A;  3LDA A;  4YXM A;  2XY5 A;  3IG8 A;  4Q8F A;  3NUQ A;  4ECX A;  2W8L A;  3RJI A;  4RUA A;  3N7S C;  1T94 A;  4BXO A;  3TAR A;  1X6I A;  2B0C A;  1KN5 A;  4YP3 A;  3LVV A;  4C8K A;  7ICP A;  3S6J A;  4USA A;  8ICY A;  1NNL A;  2JHD A;  5DBA A;  5DB6 A;  3G6V A;  3H4B A;  2AU0 A;  4QZB A;  3E0F A;  4WJ3 B;  3CW2 C;  4YCX A;  5KT3 A;  1DOQ A;  4RQ0 A;  4JV2 A;  2EDU A;  2W7P A;  1S8O A;  1HEK A;  5JUM A;  1F44 A;  4CE6 A;  3MDA A;  1UQV A;  1L3V A;  1B22 A;  2ZJ5 A;  4QIW C;  2E8M A;  2RDJ A;  3PO5 A;  3TKA A;  4J9M A;  9ICX A;  1ZQK A;  2ESE A;  3EPI A;  2LI6 A;  2D6F C;  4FS1 A;  7ICQ A;  2R8H A;  1JX4 A;  2WF6 A;  2H3F A;  3ISC A;  2WTF A;  4KN7 A;  1ZQQ A;  4XRH A;  3KKA A;  4TUR A;  2LBO A;  4O3R A;  4DO9 A;  2BZF A;  4IR9 A;  2LMR A;  4RNN A;  2OWO A;  5A0L A;  2F76 X;  2BQ3 A;  1ARO P;  2JEF A;  2KHV A;  2Y9U A;  2YX8 A;  2LKY A;  5ALS A;  1WUD A;  4PHE A;  1ZJM A;  2JGA A;  3SV4 A;  4DFJ A;  2MA1 A;  4DEZ A;  2QLT A;  9ICR A;  4ED8 A;  8ICT A;  3IHQ B;  1TAU A;  1Z19 A;  1SXD A;  2EZZ A;  5KG0 A;  4G9B A;  3KHG A;  4MEX A;  3IG5 A;  3TQ1 A;  4Y2Q A;  2Z7J A;  2HHT A;  4GLX A;  2HVI A;  4C7Y A;  3FYH A;  4CNQ A;  4Z6D A;  5ALF A;  5IIJ A;  1XWL A;  3QU9 A;  1KBU A;  7ICG A;  2GO7 A;  1ZQ1 C;  2G08 A;  4YR3 A;  3GDX A;  3TAP A;  2C28 A;  1L7N A;  1V38 A;  3NS1 A;  4Y2P A;  3IRU A;  4EEL A;  1MQ2 A;  4B9L A;  4FZM A;  4PHD A;  5DGA A;  3BQ2 A;  1BPX A;  4DQQ A;  4KLU A;  8ICO A;  1JIH A;  2KMD A;  4YMM A;  1C7Y A;  5KG4 A;  5KTQ A;  5ALQ A;  3QU5 A;  4EEN A;  2YMP A;  4JWM A;  2GH1 A;  5AI4 A;  3KHR A;  1Q8K A;  3ZD8 A;  4I29 A;  5GTH U;  5IIO A;  4GIB A;  2ZIV B;  4DQP A;  8ICE A;  3T3F A;  3UMC A;  2VKQ A;  2UVV A;  1HUZ A;  4P0P B;  3B0X A;  4DS5 A;  1S0M A;  2WF8 A;  4FFD A;  4F2R A;  1WG8 A;  5IIM A;  5KFR A;  4MFC A;  2G07 A;  3AUO A;  2KSO B;  2LYA A;  5HNK A;  3CYM A;  1TV9 A;  2XC9 A;  2WF9 A;  1SV4 A;  4QZC A;  1BPD A;  2ZJ8 A;  4QZ8 A;  3PW5 A;  2XGQ A;  1ZQR A;  2GWS A;  5JTI A;  2ZIW B;  3M6Z A;  2XVT A;  3OHA A;  2W9C A;  3C21 A;  8ICF A;  1J2M A;  5ALH A;  3UMG A;  5KT4 A;  5DB7 A;  2JH1 A;  1T3Q A;  1RXW A;  2RLT A;  5DBB A;  5DDM A;  2KP7 A;  4NL9 C;  5ALK A;  4UB4 A;  2ISP A;  2LYB A;  4ECS A;  5KG1 A;  2Y9T A;  8ICG A;  1XSN A;  2K4I A;  2KK0 A;  1T7P A;  2BPC A;  3QNM A;  1ZQE A;  3WKE A;  2R8K A;  1SWV A;  2ZUC A;  4QZG A;  4F5P A;  2HHQ A;  1ZQA A;  4DOC A;  2EAM A;  4OO1 J;  4UAY A;  4Q45 A;  5AKY A;  1MSW D;  4RQM A;  5AM2 A;  5EE0 A;  4DL6 A;  5DQI A;  4I2E A;  5ALX A;  1XS9 D;  4PJ0 U;  3EWA A;  4R64 A;  1TKD A;  1JAL A;  2H5X A;  4DFP A;  7ICV A;  3WK4 A;  3PST A;  4O5E A;  5CHG A;  1COK A;  2KHQ A;  5CA7 A;  2DKZ A;  2HHS A;  1SGG A;  5BOL A;  5EE9 A;  3BZC A;  1Z4N A;  5AKE A;  2BDP A;  4NLK A;  2CN1 A;  3C2L A;  5HMM A;  1B0X A;  1JRO A;  1X2I A;  4I2H A;  2HBM A;  3R9K A;  1DRG A;  4RQ3 A;  5ALZ A;  1L3U A;  4CGZ A;  5ALY A;  3PSI A;  3PMN A;  3PV8 A;  4J9S A;  3Q8R B;  2LM4 A;  1ZQF A;  5AKG A;  3T5L A;  5DLF A;  1YT3 A;  3C1Y A;  4KN4 A;  4AYB F;  4BWM A;  4NL9 A;  1HIW A;  4J9N A;  2F8K A;  3SAF A;  4ZOH C;  2W9A A;  3EW9 A;  5AM5 A;  1ZQJ A;  1ZQL A;  4QZE A;  4O5K A;  4DL4 A;  1K5O A;  1ZQH A;  4YQW A;  1NOM A;  3RAQ A;  3DDH A;  2EZX A;  2HBJ A;  4UB2 A;  3UQ2 A;  1DK3 A;  1QQ6 A;  4KLM A;  2BCV A;  1RQN A;  5KFH A;  1XNS A;  3RJJ A;  4US8 A;  2FPL A;  4NLB A;  1DGJ A;  5L1L A;  3FAH A;  1MN8 A;  5JU5 A;  5KNI A;  3LK9 A;  3UMB A;  1RZT A;  2W9M A;  4RU9 A;  4Z6C A;  3KOO A;  2PFQ A;  3HP6 A;  1BPB A;  3ZI4 A;  3C28 A;  4R66 A;  3ETL A;  5ALI A;  5KL1 B;  4UQG A;  4UAZ A;  1ZQI A;  2E8P A;  1T4G A;  4B9U A;  2ASD A;  4DSF A;  4NLN A;  1V97 A;  2JR5 A;  4LVS A;  4GC6 A;  1L6N A;  2EH9 A;  2E3T A;  5HML A;  1NJZ A;  4HYK A;  4DL2 A;  3D2Q A;  3Q8M A;  5IIK A;  4MFF A;  3CNH A;  4G3I A;  2GLE A;  2YB1 A;  2E8N A;  1WYG A;  2VJ5 A;  4O3P A;  1RYU A;  2EQY A;  2DBY A;  4K4G A;  1D8Y A;  9ICJ A;  5KG7 A;  3I76 A;  5BPC A;  1WWV A;  2IOF K;  3H8J A;  2W54 A;  4P2H A;  3SZ2 A;  5KFX A;  2N1R A;  3RTV A;  4EX7 A;  2G5H B;  3ZDC A;  5E79 U;  2KE7 A;  3M9N B;  2BQR A;  5KFC A;  3D2N A;  1BPY A;  7ICT A;  3B9J A;  5J8Y A;  2R8I A;  4J9Q A;  1BPE A;  1ZQX A;  3K75 D;  1TAQ A;  2YQE A;  5ALT A;  5ALO A;  3PX0 A;  5F3X B;  4DLG A;  3AL0 B;  4C80 A;  7ICJ A;  3QU2 A;  4ED1 A;  2VA3 A;  5KT2 A;  3RRH A;  1L7M A;  4KIT B;  3I28 A;  5T14 A;  4P0P A;  1ZRM A;  3C1Z A;  2MSN A;  4E0D A;  4JK1 A;  2GOL A;  4KLG A;  4F5Q A;  1ZXI A;  4YR2 A;  2KSO A;  1D8L A;  3K1Z A;  5KFG A;  5HHH A;  2ISO A;  1A0P A;  2DPI A;  3EZ5 A;  3RH4 A;  2ZIX B;  4DF4 A;  1SKW A;  2VJ4 A;  1LV5 A;  3Q8K A;  3ORY A;  2E5S A;  3QYP A;  2EZY A;  2ZIW A;  2G09 A;  2JEI A;  2IHN A;  5KFK A;  5C0Y A;  2L5Y A;  1ZQC A;  4NM1 A;  2BPG A;  5L9X A;  4K4I A;  3AM9 A;  2FE9 A;  5KG3 A;  2A1J A;  4EYI B;  1BGX T;  1BNO A;  4XQ8 A;  2W9C B;  4KLQ A;  1CEZ A;  4C8O A;  4PGQ A;  2BQU A;  5J2F A;  2LYH A;  4FBT A;  2H3Q A;  4AYB C;  1KSP A;  1NI3 A;  3KZI U;  5DGB A;  4F5R A;  4UB1 A;  5IIL A;  2BCS A;  1XO0 A;  4KLJ A;  4OCZ A;  2PI4 A;  3NVV A;  3AN1 A;  3QU7 A;  1UA0 A;  3RH5 A;  4QWE A;  1U9L A;  5ALM A;  2J6T A;  4OJ5 A;  4IRK A;  2RQ5 A;  4Z6E A;  3MGI A;  3ICX A;  3SAH A;  4DQS A;  4I2I A;  5ALL A;  4NLG A;  1WCN A;  4ECZ A;  2ZXI A;  4DQR A;  3KZX A;  1Y88 A;  2AGQ A;  1IV8 A;  2H3V A;  2R18 A;  4GFJ A;  4UW9 A;  2W9B B;  1L3S A;  1JRP A;  1S5L U;  1RG6 A;  3DV9 A;  1A6S A;  1TK0 A;  8ICM A;  3WK6 A;  3M1Y A;  1RPL A;  3KHH A;  2K8C B;  5AKX A;  2W43 A;  1EXN A;  3KBB A;  4PL1 A;  2HHW A;  3GII A;  9ICS A;  2FMS A;  2EAN A;  4DL3 A;  4J9K A;  1B43 A;  2KIV A;  2NO5 A;  4PGY A;  3AU2 A;  2PFO A;  1QH9 A;  2FLL A;  8ICI A;  4DLE A;  3N4M B;  2JZB A;  1NK7 A;  3UXO A;  4M6W B;  1IIP A;  4NJ8 A;  3TAN A;  3H0L B;  5J2H A;  5J2B A;  4F72 A;  2ES6 A;  1SWW A;  3AMZ A;  2C2R A;  3DEE A;  3SV3 A;  4QZF A;  4JWN A;  4US9 A;  3IM1 A;  2DKX A;  2W3R A;  3BQ1 A;  2XY6 A;  1KQQ A;  2HOI A;  3FM9 A;  4UAR A;  4UAU A;  1HUO A;  1PK3 A;  3WKC A;  3V6J A;  4OD0 A;  3HJE A;  4RPY A;  3MR2 A;  4ECR A;  5ALD A;  5J0T A;  4DF8 A;  9ICO A;  5EWE A;  1COO A;  1BNP A;  2HHV A;  1M6Y A;  1L5U A;  8ICU A;  2PMZ F;  2PI5 A;  4Q8E A;  2XO7 A;  7ICN A;  5BOM A;  1J2N A;  4QW8 A;  7ICO A;  3AU6 A;  3CP8 A;  2V4Q A;  5AHX A;  5H2F U;  1Z1V A;  3PR4 A;  8ICJ A;  3ISD A;  5AM0 A;  4A8E A;  8ICW A;  4NV0 A;  4TUS A;  1N63 A;  1KW4 A;  3RB3 A;  3PML A;  1KRP A;  4J9L A;  4ACO A;  8ICL A;  4RT3 A;  3T79 A;  4DSK A;  5B66 U;  1IXR A;  4F92 B;  2O6K A;  4NLZ A;  4PGX A;  2BCR A;  1N5X A;  3V7L A;  4NY8 A;  1P7D A;  7ICK A;  5DBC A;  4J9P A;  9ICF A;  2I6X A;  5J0U A;  3EUB 2;  4M2Y A;  1ZET A;  3NAS A;  1ZJN A;  3BQT A;  1O03 A;  4C8M A;  3SEN A;  4F5N A;  4BGD A;  3D6J A;  2AJQ A;  1IG6 A;  5J2I A;  1X9S A;  2KV2 A;  1TK5 A;  4I2G A;  5KAI U;  7ICU A;  2BPF A;  3RB0 A;  1S77 D;  3F5A A;  9ICV A;  3VC8 A;  4DOA A;  1S9F A;  4NXZ A;  3RAX A;  4UBC A;  3PR5 B;  3WK9 A;  3UXN A;  5AI9 A;  3PW0 A;  3QUC A;  3BS7 A;  3PW2 A;  4JV1 A;  2OYY A;  2HI0 A;  4BUG A;  7ICR A;  2CPR A;  3WK5 A;  2C22 A;  2K60 A;  3E58 A;  5D49 A;  5AM3 A;  1QLN A;  9ICA A;  2XID A;  2K4E A;  4CF4 A;  1ZQG A;  7ICL A;  4U6P A;  9ICH A;  2ZUD A;  4IQW A;  2Y1J A;  4PZN A;  2OH2 A;  1V85 A;  4QZH A;  3MGV A;  4O0I A;  1L7O A;  2ZIX A;  2HW3 A;  4I2J A;  4JUZ A;  2WAQ F;  9ICE A;  2P35 A;  3MR6 A;  5KFS A;  2YTU A;  4RQ2 A;  2DWQ A;  1FO4 A;  4UB3 A;  4EBD A;  3RJG A;  3SQI A;  1ZQO A;  1ZQY A;  9ICW A;  3F2C A;  2FPK A;  4O5C A;  4OJP A;  2FMQ A;  3NVW A;  1Q3V A;  1NK6 A;  3PZP A;  3OSN A;  4M9N A;  3PVX A;  2FJ6 A;  1VDV A;  4IQT A;  1AQ6 A;  1UPH A;  1TE2 A;  5GTI U;  2ZTC A;  5EE1 A;  1OW5 A;  3UQ0 A;  3C5G A;  4R63 A;  2A1J B;  4B9M A;  2XGP A;  2IA6 A;  3MGH A;  1LKY B;  2MUT B;  4M47 A;  2DUY A;  2HMX A;  1IM4 A;  2DPJ A;  5KT5 A;  4PPX A;  5AKL A;  3PNC A;  4TQS A;  2F8L A;  1NKC A;  9ICK A;  5ALN A;  2HHU A;  2HSZ A;  2PXI A;  1VLB A;  5AKK A;  4ED0 A;  1L7P A;  3M7D A;  2W9B A;  1SIJ A;  5KFW A;  1TFR A;  5KFN A;  5J2J A;  4GXK A;  3NGD A;  1TVA A;  8ICS A;  3OPX A;  4O3Q A;  2A1A A;  1CUK A;  3PX6 A;  3QZ8 A;  3JPN A;  4KX3 A;  3RJE A;  2BR0 A;  1JN3 A;  2AH5 A;  5KFV A;  7ICS A;  2JEJ A;  3ETR A;  4UB6 U;  3GIL A;  1U4B A;  2E8O A;  4ECV A;  2KKV A;  4BDP A;  1S10 A;  1CI4 A;  3LYS A;  1URJ A;  4DSL A;  3OJU A;  4MEY A;  2QB1 A;  5DQH A;  2KJ5 A;  3GV8 B;  4DSI A;  3SD7 A;  4M6W A;  2PFP A;  2KN7 A;  4EEY A;  1ZRN A;  3PW7 A;  1MA7 A;  2ODG A;  4EZ9 A;  2JZB B;  5ALR A;  2RP5 A;  1KL9 A;  2XI9 A;  4UB8 U;  4QZA A;  4I2C A;  4ELU A;  3UM9 A;  9ICN A;  2NRX A;  2H3I A;  1BVS A;  5AI0 A;  1Z4O A;  4PHP A;  4F4X A;  2ZIU B;  1S0V A;  2B21 A;  4ED7 A;  4O3M A;  3TFS A;  1L3T A;  4TQR A;  2OHF A;  3F5E A;  4CRX A;  4KTQ A;  2I5H A;  4MF8 A;  3THV A;  4IRC A;  1NZP A;  4P4P A;  5KL8 B;  5CP2 A;  4DCC A;  2IBK A;  9ICL A;  3A0H U;  3T5J A;  3RBE A;  5J8Y C;  4RQ7 A;  4F91 B;  5KFO A;  4EBE A;  3RJF A;  4Y2U A;  4KLF A;  2W11 A;  3SAG A;  1XSL A;  2KIW A;  5AKZ A;  1K1Q A;  3FDS A;  1ZD4 A;  3AQE A;  1S0N A;  3AQF A;  5J0P A;  3N97 B;  3QUQ A;  2FPM A;  4F4W A;  1RQL A; 
#chains in the Genus database with same CATH homology
 1RYU A;  4LJX A;  2EQY A;  2JRZ A;  2KK0 A;  5K4L A;  2JXJ A;  2LI6 A;  2YQE A;  1C20 A;  2OEH A;  2EH9 A;  5CEH A;  1KKX A;  1KN5 A;  2CXY A;  2RQ5 A;  2LM1 A;  1IG6 A;  1KQQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...